3AG2H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag2H00
1OCRH 3AG3H 2EIMH 2DYSH 3AG1H 1V55H 2ZXWH 1OCCH 2Y69H 5B3SH 3ABMH 3X2QH 3WG7H 3ABKH 1OCOH 2EINH 2DYRH 3ASOH 2EIJH 3AG4H 2EILH 3ASNH 2EIKH 2OCCH 3AG2H 1OCZH 5B1BH 5IY5H 5B1AH 1V54H 3ABLH
chains in the Genus database with same CATH superfamily
1O3QA 4CCKA 4L5JA 4M3DA 2KQRA 3E5QA 4C3JJ 4EEFG 2VQCA 4YELA 4EATA 4R79A 2M87A 1MBEA 4HNUA 1ETWA 3TMOA 3CCVI 2DA3A 3FXRA 4ZZDA 2X1CA 2KP6A 5FKNA 4HDVA 1HW2A 3IL2A 4BDYA 4H4KC 1XB4A 5HS9A 4I2OA 1H9TA 4MQ9F 3E6DA 5K5RA 2X4HA 1HBXG 1YJNI 3IRQA 1FC3A 1B72A 3LOCA 1P92A 4L5EA 2GWRA 3DTIA 1WI3A 2UXXA 2H6BA 2LFBA 1W7PA 2NAZA 1RIOH 1ON2A 2JT1A 5CQGA 2EILH 1WFXA 3ERED 3CMMA 4DBRA 3HPGA 5L3DA 2WV0A 2JVHA 2DA2A 3CMAI 3C1DA 3RKXA 1BW5A 1MSFC 3WTTC 1JJ8C 2XAUA 2Y0MA 5DD4A 4PDKA 1QHHD 3W2WA 1W0UA 2JA2A 4BBSJ 2EZLA 4M3BA 3HRTA 3E6CC 2DU9A 5BS6A 2Y48A 4DBQA 5FLMJ 5F0FA 2OA4A 1MGTA 1TT5B 3A01A 1T95A 1ZR2A 1JUMA 4YEJA 2MA3A 3BTLA 2JA8J 1U9OA 2ZJRF 1BIAA 2EIMH 1KYWA 3OYHA 2IP2A 1K79A 2IRFG 1MMDA 2DYSH 2IVMA 4N0BA 2BV6A 2K7LA 4A3LJ 5HDGA 3LA3A 2QZ8A 2DPDA 3GTQJ 1FYMA 2QQ8A 1O3SA 5GTIC 2NNNA 4BEHA 2ME6A 4F91B 2XAFA 4KIGA 4GO1A 2F2EA 2V9PA 1YJ9I 1PUFA 1SEUA 2QF7A 3ZQ7A 2QVOA 2CUZA 2V9VA 3O8HA 3IHUA 1YHQI 3BG6A 1Z0XA 3I4MJ 2RQPA 3K10A 2O6GE 3ECHA 5HLGA 1NHAA 1K78A 3CJRB 4O6JA 2CQ7A 2DMQA 1FNNA 1J2XA 2V26A 3DFGA 3QYEA 3Q3SA 4LGWA 3I58A 4I09A 2STTA 3TP0A 1RPWA 3HBLA 3QPLA 3KCCA 5E3NA 2L7ZA 2VT2A 2ECBA 4LLGF 4BJTA 1TQPA 2Z99A 4A5NA 1JHHA 2CH0A 2HQ5A 1IV8A 3TO9A 2RN7A 2DCEA 2R7FA 4LMYA 2E5NA 4XK4A 3T8RA 3F8FA 4FETA 4HPQA 3KLNA 2L9RA 4AIHA 4WK8F 3PQKA 3T5XA 4BU2A 3F8BA 3G3ZA 4GRIA 2QUFA 4KIBA 4E4HA 4GYIA 3H9JA 1R7JA 4AIKA 2A69F 2NS7A 1GVJA 3M8FA 2CUEA 4HW0A 2C6YA 3ZGKA 2HS5A 2KZVA 2NRAC 1FIPA 4W1UA 4OIOF 3G2BA 4JX5A 3V7SA 4O3MA 4X6AJ 1IRZA 3GVAA 2QENA 4IJAA 5CJ9A 1ERDA 1ZLKA 2V4JC 3BZ6A 2DA7A 3G1LA 4D1QA 2PJPA 3A0BC 1RRJA 3I71A 2FNAA 1V5GA 3H0GJ 2O03A 4L0ZB 1HSJA 3LSIA 4EM0B 3MZHA 2OJED 3BR2A 2QKLB 3FM5A 4L5IA 4YFXF 4G7OF 1X4PA 1E3OC 4E7HA 1YG2A 4OOIA 1S72I 1O57A 2M8EA 1DUXC 1B6AA 2EIJH 4MEYF 4HZFA 3F0CA 4BAYA 2K27A 4F52A 3D5SC 1R1VA 2RV8A 1V5FA 3OYJA 2F5DA 4B48A 4CCLA 3DQVC 3HOYJ 3Q0WA 3S3MA 1LE8B 5L3EA 2R7WA 1R71A 1V54H 2ZC2A 4B44A 1FEXA 1I3QJ 3H3VK 4XKWA 2ZKZA 3JRIA 1R6RA 3K4CA 2PJRB 3MAJA 3D1NI 1I6HJ 1OCOH 1JTXA 2KZGA 2LY2A 3RPQA 4C2MJ 1SFEA 2Q8KA 5M5YJ 4L9JA 4IQ4A 2WAFA 3L9FA 2DOFA 4RGXA 2G7HA 4XRSA 3J81Z 2FBIA 1RR8C 1U8RA 1IAWA 1A5JA 2CQKA 1XS9A 1WGXA 1LNWA 1Y1VJ 3IKVA 1SMTA 2W85A 3CTAA 3I53A 2BEOA 1GT0C 2Y31A 3IWZA 3OYGA 2XC7A 3DV8A 1KZHA 1HDPA 2LH9A 1XPXA 3ABUA 4ABZA 4EJWA 3E6BA 4B43A 1DP7P 1QZZA 4G9YA 1CGPA 1HW1A 1E17A 2CMPA 3HOTA 5L3CA 2CU7A 3DWLE 4IEJA 2WV1A 1TWGJ 2EFNA 1SFKA 2XAHA 3HOWJ 5F6FA 5KK1A 2V1XA 1X3UA 3JCUC 3ZMZA 5ICFA 3PUFA 2HFHA 2LOOA 2JK3A 2FMLA 4MTDA 1NG7A 2FRHA 1HKQA 3DTKA 3TQNA 2IS6A 3ZCOA 5FB2A 1LVAA 2HWVA 3FMSA 3ZR8X 4UXNA 2AXLA 3GX4X 4LK1F 4BJ5C 1D1AA 2XPWA 5B66C 1YTYA 2F5CA 3LL7A 2EH3A 1TNSA 5GP9A 3MFKA 5EYRA 3E1SA 4UB6C 3LSMA 1HCRA 3HC7A 3SFIA 2JUCA 5C4XJ 5CVIA 4ZDPA 3OR1C 2PEXA 1B1BA 3LQQA 1J7KA 2CG4A 5EEAA 1IN5A 1V3FA 1ZRFA 1WKMA 1S7EA 3GBGA 5KHDA 1TQIA 3OIPA 5LGTA 4UUSB 3HOXJ 2K3PA 3BQZA 4O5VA 4F92B 3E6MA 4LITA 1L0OC 3CCSI 4M6YA 1R4MB 4FASD 5A2QZ 1LDJA 2CQQA 3FXJA 1ZRDA 3M7GA 2G9WA 3KEQA 3LMMA 4WWCA 3MKYB 2BHZA 4BXUA 1DU6A 4LOCA 1LUJB 4S0HB 4NHJA 5F1JA 3CJNA 1Z91A 2GA2A 3OS2A 2HYFA 1FMVA 3TOBA 3VPRA 3OS1A 3LWFA 4IHTA 2O8XA 2XPUA 1X1AA 3G6EI 3M8JA 4NDLA 1E0EA 3UR3C 5K7HA 2PJRA 4A93J 3IAS2 2Q2EB 2EFQA 2EV0A 4KNYA 2UXNA 4LJZF 1D1CA 1FJLA 1WRJA 1X2NA 3J7AO 3GW2A 4HNTA 2ELJA 3OYBA 3GLLA 2EQRA 3V8KA 1PUEE 3MN2A 1SVOA 4LIVA 3U1DA 1QU3A 3K70C 2XROA 4PJJA 1ZGAA 5EF6A 3CMYA 1SAXA 3QYBA 4CSWA 2L3DA 2R7XA 2JTVA 2XF5A 3HEFA 3IP4B 4IHYA 2K86A 1A36A 1O7LA 4Y52J 2HQAA 2DYRH 2HXOA 1FYLA 4D7NA 3KETA 2IGKA 3NRVA 5D4SA 3H3UA 3GTPJ 3Q0UA 3SDGA 4OMYA 4LLNA 3SDBA 4A0YA 1IDYA 3WU2C 2VASA 4CGZA 4UY8I 2FSWA 3HG9A 3H5NA 3RTRA 2L4AA 4S04A 3RZDJ 2LY1A 3HSEA 3GUDA 2CW0F 5DYMA 3M1CA 3PNTA 2B9SA 1LDKB 3ELKA 4BS9A 2IEKA 3CUQC 3OYFA 5M3FJ 1PDNC 4RGSA 3U2RA 4XLHA 1KU9A 3LSTA 3GF2A 5FROA 1QVTA 1RC9A 3S3OA 2VJ5A 4V19K 1O7FA 2XUBA 4XLPF 4XMYA 2E60A 2L7KA 1UCRA 2HEOA 1OMIA 1S7AA 4MHGA 3CF5F 4ZTJA 1PP7U 3CC2I 3NEUA 2E34A 2OCEA 3D5LA 3DCFA 3DEEA 3FXLA 3LAPA 3RKYA 4RGUA 2LSOA 3ML6A 5TJJA 2IT0A 1LKXA 1MH4A 2Y9YA 1M1EB 1I1SA 1U5TB 1JKQC 5KAFC 2PN6A 5D5WB 3GWZA 3E5XA 5CVRA 5KAIC 1P6RA 5JVGF 4AVZA 3G73A 3CZ6A 3MKWB 1LVKA 2L9SA 2K9NA 3L00A 3DPUA 5DM7F 2EFPA 1U9NA 2FF4A 1R1UA 3HRUA 2IGOA 2Z16A 4ZDLA 4C2UA 1Z6TA 1UG0A 4XBFA 2HOEA 5KVRA 5FRNA 1FBSA 4ZDOA 2Q2EA 4RAZA 2ZMEC 1XDSA 4D0PA 1ZYRF 2VE8A 3ABTA 1MDMB 1BA5A 3B02A 2XAJA 1R4NB 2L4MA 1T38A 1TBXA 3RIRA 2IW5A 3IWFA 5TISC 5D8KB 4WX9A 1VQ7I 2QQAA 4AYBN 4CDGA 2RC4A 2LTPA 3VODA 1UFMA 1K4SA 4PFOA 4RGRA 2BY2A 2E1CA 5CPRB 2M1BA 3CJTB 4Y4RA 3I59A 4BJ6C 4YIRX 2L5QA 2CUFA 1D0XA 1PP8F 4A6EA 1JKOC 1ETKA 1JUPA 1FBQA 5FD6A 4A3MJ 3QOEA 1IDZA 2FMYA 4QTRA 3J80Z 4XLCA 4BE2A 4LG0B 1EF4A 1FX7A 5E18F 2DJIA 5FO5A 2GQQA 2A61A 3BJAA 5IOYA 2VKEA 3DBHB 2MC4A 2WY8Q 4KMUX 2MFZA 3R61A 5IOZA 1HF0A 4MTEA 3RJPA 5JLXA 2LY9A 4P1WA 4II2A 5EG0B 5J40A 4BY1J 1R1TA 2PFBA 3OS0A 1BC7C 2V6CA 2LKPA 2XAQA 4ZYDA 1OCCH 1HKTA 1GXQA 4L0YB 3C18A 5D5UB 2I10A 3IUOA 5J6XA 2BBYA 1P7IA 4M74A 3JRFA 2QQ9A 3AG4H 3WGIA 3JRCA 4ZC3A 3OYKA 1FMWA 5E17F 2ID6A 1S5LC 2E71A 5DCMB 1LB2A 2NVXJ 3VSLA 1BR4A 3B73A 4D7MA 1OCRH 4KIFA 3FK7A 3N4MA 2DXIA 1U5TA 1V55H 2P7VB 2FBKA 3JRHA 1R5GA 3BR0A 1LEAA 2MG4A 2KFDA 5EGOB 3FHNA 3EQLF 4CCNA 2RREA 4HRIA 2B0LA 2IA0A 3U21A 4D9JA 3OOPA 1H8AC 1PJRA 3KFWX 2NXNB 2DAOA 1FOYA 3CP2A 4L18B 3CO7C 1MIJA 5M3MJ 3OYMA 1ZELA 4MGRA 1S8NA 2AO9A 2ID3A 1IG7A 5FD5A 2D1HA 2G0EA 5E20A 4M9ZA 3CDLA 4CYCA 2HDWA 2X6XA 3MD2A 4WCGA 1UG2A 2TDXA 2UUZA 2XPVA 5EEHA 3L2VA 2G7UA 1L3LA 1WZ2A 5FLVA 4PFPA 3SQNA 2MW8A 3VYRB 4KN7X 4XKBA 2E36A 2OV7A 3CESA 1VQ9I 5EZHA 1EH8A 3OIOA 1UHWA 2IXSA 4IQJA 4FQGA 1G6NA 4F3QA 1MKMA 1MJBA 3FZVA 2OZ6A 4PSXA 4J19A 2IA2A 3W6KB 1YRNB 4ESJA 1EA3A 3KP4A 4LB6B 1KQ9A 1F4KA 2QSHX 5ILSA 1TTYA 5TGTA 2MYSA 4KITB 2GZWA 2M0CA 5L3GA 1JJ6C 4FISA 1R58A 4ZYGA 3LFUA 3K69A 2HQRA 2M45A 2ELKA 3K1PA 4OINF 1IN4A 3FK6A 1ON1A 1HLVA 3WTXC 3F6OA 4IHWA 2LNBA 2OTJI 1ZLJA 2F5VA 2X6WA 4I0BA 2XKOA 1HW5A 3TGNA 2D1VA 4IOCF 1BOBA 4P5OA 4LG3A 5JHFA 1OYYA 5HLHA 2M2EA 2RNJA 3LA2A 2X1EA 3KYLA 4X0GA 3FXQA 2HR3A 2MLGA 3ERMA 3S1MJ 3PIPF 3OIQA 2AHQA 4M6XA 2AXTC 2YU9J 4IRIA 4JX4A 4CUGA 2CV1A 2NVUB 4CYDA 1WJFA 2UV1A 3CCRI 2E2HJ 4XKCA 5EGOA 2XASA 1KQ0A 1N25A 2GBYA 4HBLA 5HLTA 3KP6A 1RZ4A 2H6CA 1ETVA 2JRTA 5BQTA 1WH5A 3S1RJ 1VQKI 2CO5A 1F9NA 2DTZA 2WTEA 2R3SA 3GLXA 2CJJA 1FBUA 1Z7LA 1WJDA 2NOGA 1IO2A 3ZMSA 3I9V2 2O3FA 5J8FA 3KP7A 2KRFA 4XLAA 2HTJA 2O61A 2CFOA 2VQLA 4RBOA 2NNYA 1P4XA 2PX9A 2JA7J 1XSVA 2ZSIB 3F6VA 1IC8A 4BACA 4C2TA 3PUBA 1P4AA 3JAMK 2HNHA 1MH3A 1OKRA 2XF7A 3LSKA 4PJMA 4B4CA 3L2UA 4B1RA 2VOOA 3MQ0A 1JGGA 3DF8A 3HGYA 4FE7A 2VQHA 4AYBA 3BG7A 2OZUA 2X9DA 4FTHA 4RLQA 1FP1D 2XGDA 5IT9K 1OCZH 2EA4A 1H9GA 4XORA 1I50J 2WA0A 4XONA 4AU7A 2ISZA 2E35A 4A3DJ 2EV6A 2EK5A 2R7ZJ 2A3SA 2L7FP 1YYVA 1V4RA 1YRNA 3MEXA 2LRDA 1S9HA 3BCAA 4MNUA 3H9QA 4HX7A 4HOBA 1R22A 3B6CA 2P81A 2QWWA 3FX3A 2R0QC 3DBRB 3IH4A 3JSOA 3CCEI 4FX4A 2E1MB 2HPMA 5F0HA 4RA2A 5K7FA 2GM4A 2IS1A 5BPIA 3BR1A 4EMSA 4HV5A 2H94A 4NC8A 2DQLA 4RLFA 3S14J 4BQNA 1B4AA 3LAJA 2JRMA 1TZLA 6PAXA 2E7WA 1HDDC 4BQQA 1UMQA 2L9VA 2VUMJ 2ESNA 3R6SA 4WXCA 3KPHA 2XGXA 4II3A 1LPQA 2XRLA 4P55A 2PBIA 2KIUA 4KDPA 2X0LA 4HF0A 3PNYA 4XLEA 4U7DA 1OPCA 2HZTA 4B8XA 3HHGA 2BY0A 4RS8A 3VFZA 1IXRC 4AC0A 1IXSB 1G59A 1YO5C 5IYDJ 1LFPA 1LFUP 3RI4A 2DOAA 3LSGA 4RMNA 3SZTA 1WI9A 5ICGA 1YS6A 1X1BA 2EV5A 3WTUC 3OY9A 3AAFA 3BG9A 3W2AA 1FLIA 2COBA 2ETHA 1YLFA 3E5UA 5GADJ 4GGGA 3VDXA 3OYNA 3JREA 4G94A 1QZYA 1VQLI 3J81K 1ZGWA 2YS9A 5DEQA 1TC3C 3ZMVA 4BNCA 1IF1A 4HA8A 3GTMJ 4CXFA 1N78A 3EUAA 4PJ0C 1Y6IA 4BQAA 4UUVA 5IP7J 1OR7A 3JRGA 1XD7A 4GDFA 3H92A 3HPHA 2HZDA 1O3RA 1VQ4I 1UHMA 4UVCA 3PFYA 3P9KA 4CZZA 4GCVA 3ZMUA 4QWQA 5FKOA 5J1YA 3PM1A 1AWCA 2QQBA 3C2GA 5FLXK 4B09A 3X2QH 3GYHX 1FT9A 5C4JJ 3J7YJ 1BL0A 2A6EF 3CC4I 4KISA 2Z33A 1TQMA 2NYXA 3L09A 1IW7F 2IBDA 2RDPA 4I6ZA 2GIZA 5HDNA 1BBYA 2JPBA 3ZQFA 1SANA 1RETA 4EM2A 5LHIA 2HU9A 4PZJA 3ZRGA 3ZQLA 3A4CA 2JN6A 1BM9A 3ASNH 3F23A 1FTTA 3BZCA 1U0JA 2DO7A 4XIDA 3V7CA 3K6GA 4A3JJ 2F4IA 3BP8A 5LHGA 2P5LC 2XV4S 2K4BA 3I5UA 4UV9A 1S7OA 1YX3A 4A0ZA 1E3HA 2N8GA 3RPUD 4CHUA 2VOPA 4WXDA 5LGUA 3VSKA 2R5ZB 3IH3A 3ZQHA 1IRFA 4EJUA 3FM3A 4I02A 2LBFB 3OYEA 2DMPA 3MZ8A 2HDDA 1POGA 5J47A 3LSPA 1WSUA 3CQZJ 3S16J 2QEXI 1DU0A 2OBPA 1GHCA 1T0FC 4L9NA 3TBIA 3JR9A 5A2QK 3FXUA 3KLOA 4M72A 1H0MA 2YX7A 4AUXA 4OAYA 1YW7A 1A6QA 1DP3A 2XGCA 2KISA 2KPMA 3E3VA 3E97A 3PQJA 3RDIA 4U0YA 2FXAA 3SJMA 2VBWA 3WG7H 1SFOJ 3VWBA 2LMDA 1IN8A 2RVCA 3OYLA 1KA8A 5HS8A 1W5SA 3CD6I 3ROUA 1JKPC 2JA5J 2XF6A 4CZCA 2YR2A 1I6XA 1J5YA 3CP8A 2K9LA 4Y13A 3OL4A 4ZH4F 3OYDA 3WGGA 3DU6A 3VOEA 4HQEA 1S29A 5F0CA 2EJRA 2ECCA 5DD8A 5H2FC 3BC8A 5EZGA 4OIRF 4NBQA 3K9TA 3BTCA 1XSXA 2KIMA 3TW7A 3DLLF 3M3YJ 2XAGA 1MMSA 2ZFUA 2R7VA 4PJLA 3CC7I 3DPLC 4DYCA 1C0WA 2Q0OA 1BIBA 5D6FA 3NWTA 3I4PA 1TW3A 2A68F 4E6KG 3OYIA 3BR5A 4C9YA 2A05A 3S1NJ 2OPTA 2XRNA 1TWAJ 2Q1ZB 1VQ5I 1RKWA 4F55A 4IVNA 3IV5A 4BY7J 5KNLA 1F36A 4W97A 1T98A 1RI7A 2DQRA 1HSTA 2V79A 1TNTA 1YIJI 2JPCA 3BZKA 3H3ZA 2XSJC 3L2WA 3L2RA 5GAGJ 3EYYA 5CLSA 4PCQA 1ZRCA 5HS7A 4XL9A 2NOJB 2W48A 3BTIA 3DLAA 1MBGA 4EM1A 2COMA 4E7SA 2E1OA 4QSHA 2DK8A 3BR3A 3M9AA 2GXBA 1LE8A 1EKEA 2CQXA 3TDUC 1DPRA 3S8PA 1JHFA 1HC8A 5CVVA 3SEQA 2H1LA 4ZJZA 2PI0A 3I56I 2KT0A 4ENKA 3S3NA 2H8WA 1D8JA 1EH7A 2QCOA 1P9QC 2ZNZA 3CCMI 2E7XA 4DGWB 3OYAA 5F64A 2VIXA 3FDYA 2KHMA 3WE3A 2R5ZA 3D0SA 4Q4ZF 1AOYA 1WVRA 3ECOA 1EJ9A 2LBFA 3H5AA 3CCQI 4DNCA 4LIUA 2VKVA 1B9NA 3PIOF 3IRRA 3FF5A 4E7IA 2ZBKA 1SD6A 2YUSA 4GXOA 3F21A 4E7JA 2ISYA 5JLWA 3S1QJ 3ULQB 4TV7A 2HOSA 5IY5H 4RB0A 2V1UA 1Y1WJ 2MH9A 2XKPA 1P4WA 2KIQA 3JRBA 1Q1HA 4LK0F 5FJ8J 4YG2F 3WTVC 1T33A 4RDUA 1XGOA 3GCMA 1K83J 1T0FA 2M7BA 2LG4A 2E2IJ 3TL4X 2DFFA 5E8IA 5HVQC 2XB5A 1UHSA 1F43A 3RYPA 2K40A 3HSFA 2VPLA 3FKJA 2P0WA 3VYSB 1FOKA 5LHHA 2HYJA 3VEPA 4BHCA 5DTDA 4HV6A 2DK5A 5FFZA 4V2GA 4P9FA 3HHHA 1MBJA 2KIFA 4ZYHA 3QP6A 1R5HA 2GOMA 2YPRA 5IP6A 2Y9ZA 2GOXB 2X48A 3OYCA 2BW3B 2FQ4A 4A3IJ 3D5RC 1CQTA 2HPIA 1R36A 3BY6A 3O2PE 3V8JA 5TRDA 2MGQA 3ISPA 2L54A 1U5TC 1GDTA 1BR2A 3BDDA 3QU6A 3J80K 2R5YB 1S6LA 2VKHA 2HI3A 1ETXA 2R7SA 4UUSA 1BR1A 1JUSA 4U88A 3CJQB 1JI8A 4AWXB 1QPIA 4GFBA 4M6VA 5B3SH 1N75A 3WTZA 1LQ1A 2W82A 1XCVA 3VB2A 3GEZA 2A6TA 1FOWA 3KP5A 3BJOA 2WAQN 3ZPLA 4JBAA 1W36D 3R4KA 4DZPA 2I8DA 4EVIA 1XMXA 3H5RA 4PSWA 1SD5A 4DYQA 1AA7A 1YS7A 2CUJA 3HOSA 3ZQGA 1ZTRA 5K5QA 4YIFA 4XQFA 4EQQA 1Y0NA 4H0EA 3M4OJ 2TCTA 4KT6A 4XSZF 1Y8RB 3KP2A 3LSRA 4NNJA 5BOXA 2WAEA 4XN0A 1Y0UA 2DA5A 3WTYC 2VONA 3WU0A 1SFUA 2KL4A 3KIOA 1Y8QB 3ZMDA 1TWHJ 1OFCX 4IF4A 4RAGA 3L7WA 1XSDA 1G3SA 5LLQA 5LFAA 2GAUA 2M5WA 3KX2A 4KUMA 5DV5A 3L2QA 2VBZA 4YIIA 2CSOA 4A6DA 5ERIA 4M9XA 4KFCA 1MJAA 3ESWB 2H09A 4G7HF 3CDHA 2IA1A 3FBNB 1FZPB 2WWYA 4BE1A 4D5CA 4LLLA 2XGEA 3F72A 3RSNA 2VB6A 1YOVB 1W5CC 2ZXHA 4KJZA 4PJNA 4BHBA 2M0MA 2J5OA 3FISA 5E79C 4Y3OA 2NVYJ 4E70A 1D3YA 1GVDA 2GA1A 2CFXA 3AG2H 1Z3XA 1IXCA 1YW8A 4A3FJ 2K9QA 4ESFA 3HUGB 1E3PA 3KEOA 1ULYA 1YW9A 2DFIA 3MKLA 5F04A 2Y2ZA 3COAC 2K02A 3MWMA 1T2KA 1VI0A 3AL0B 3KEYA 4IO9F 2XDVA 3HGGA 2BW3A 3DBLB 2O0YA 2X1DA 2QKMB 1XG1A 1U3EM 3T8TA 4DW6A 1IV6A 1SD7A 3RPUA 2VI6A 2DDAA 2R5YA 5D8LB 2Y75A 5GAHJ 2FQ3A 1H89C 3OSGA 2ZXJA 1K6OA 1G4DA 3AFHA 5B5EC 4NC7A 1HKSA 1TW2A 4PK4A 2VXZA 2JMWA 3HRMA 5CYVA 2DI3A 3BPXA 3QAHA 3TOAA 3I3LA 3IKTA 3QYFA 4IHVA 2DA1A 3A2KA 1ODDA 2GLOA 1BC8C 1A31A 2WB1N 1TP4A 3HRSA 3J7ZI 3IAM2 3DPTA 1BI3A 4FX0A 3ASOH 2HVRA 3LFKA 4OU0A 2LVSA 1SVLA 3QPTA 5F1RA 3WU1B 1OYIA 2B7EA 1UZCA 3OR2C 3KE2A 2O8KA 2A5WA 1IN6A 2ZJ2A 3K1NA 3T0YA 1F1ZA 1ZARA 3KYDB 5IP9J 2DMNA 3REOA 1XX5A 4CA0A 4BE0A 4YFKF 1MDMA 1NK3P 2F48A 2QM3A 5BPDA 1ITYA 1ETYA 1K7AA 2YU3A 1YQAA 2MABA 4R1HA 2AQFA 1KQ8A 4HX4A 2VC1A 3K7AJ 2X6OA 1MD0A 2K5CA 3KZIC 2DLLA 4LFUA 3U9GA 5EEGA 1W7PB 3OMYA 3F3XA 2FE3A 4PGHA 3A03A 1R49A 2STWA 4CICA 1YFHA 1T6SA 2V1NA 3H9GA 3BOQA 1DDNA 5K7ZA 3ABLH 3DP7A 3EUHA 4HDUA 1ZREA 4KYWA 2NVQJ 3S2HJ 3KZYA 1BI1A 3KP3A 3TEDA 5K5OA 4LG0A 5LGNA 3EDPA 2Z5UA 5LEJA 1BW6A 1G3TA 2BVMA 5E3MA 3HSRA 4ZYEA 1JKRC 4ASNA 1TT0A 2LR8A 5GTHC 5LBQA 1I5ZA 1U2WA 1X2MA 4BYYA 4F93B 4EGYA 3CO6C 3RQ4A 3N97A 3S2DJ 1W5TA 1KU2A 2V9KA 3GFMA 2BOLA 5HODA 1P2FA 3HUGA 3NAUA 2W24A 4OIQF 4XLNF 5EG0A 5E1ZB 5EJCA 3A01B 1D1BA 2HGCA 1A04A 3HYIA 2P6TA 4ON0A 5J4VA 2FBHA 3HTUA 2QSGX 1QPMA 2QBYB 3ONQA 2ZFWA 2KKOA 3MKZA 2RGVA 3JRDA 3PO3J 2Y69H 2VKDA 2R7QA 2VC0A 3ABMH 4CO8A 1VTNC 5CVJA 2GIVA 3R60A 3S17J 3ABKH 2LC2A 3RCOA 1NG6A 2VE9A 4RAFA 3VYUB 3HJEA 1RUNA 1DPUA 1SD4A 5DCMA 4BEHB 1Z7UA 2VODA 2LKXA 4ANJA 3DKWA 2EZHA 1QZEA 2BZTA 1PUFB 3A0HC 5E3LA 3C2HA 3ZN1A 4Z6YA 1NK2P 4G8XA 2OTLI 1DQUA 5ED4A 2KDOA 2CRGA 2QYOA 4CCJA 2FJ1A 1LFBA 5JR3A 1ZGJA 3IC7A 4BUPA 4CCMA 2EBIA 5J1RA 1K78B 5J1UA 3BCBA 1ZHFA 3GTJJ 4AIDA 1GUUA 1D8KA 1OR7C 5LEKA 1QHGA 2Z3YA 3Q0VA 3W3CA 4MEXF 4M71A 4OMZA 1LJ9A 2HOAA 4HEA2 2EIKH 2P5KA 4MIMA 2WAQA 4ZYAA 3G71I 3S93A 4QPQA 5FKMA 2VBYA 3BWGA 3K2ZA 2ZJQF 3W6VA 2DN0A 3VYTB 4I99C 2BVLA 3DXJF 1R23A 2DT6A 3CLQA 1WWXA 4HG2A 1UJ8A 1WJAA 2PG4A 2KMUA 1MNDA 2MBFA 1WJ5A 1Z05A 3O3KA 4E7LA 3RKQA 3H0DA 2PLYA 2ZB9A 1O4XA 1RESA 1BI0A 3A1YA 4G7ZF 2CQNA 3B6AA 2BE5F 3JTGA 2HKOA 2E1NA 1X3WB 2RQQA 4M3GA 3CF2A 3FXMA 4A5MA 2ZO4A 2HVQA 4JYKA 2W4SA 2VBXA 2WBMA 1FYKA 2E1MC 3HL2A 4JX6A 2R7UA 2KLOA 3PNVA 4AM3A 2JZYA 2H8RA 1MJ9A 3SFZA 1WQ2A 2V1DA 4WF2A 3CCLI 4IRGA 1U78A 3G4SI 2Z9OA 2A5YB 4J00A 1X1CA 1G2HA 1R9TJ 2EZKA 4DQ2A 4A3EJ 1ZQ3P 3WHCA 1X19A 2FOWA 3BPVA 2F4OB 5H20A 3F8CA 4U0WA 1Z6RA 2QSFX 4NUBA 4XOTA 2QBYA 2HVSA 1W4MA 4HQMA 3K1MA 4P96A 4A69C 2DOEA 2CV2A 4B3AA 1I39A 4OIPF 3FXKA 4BXXJ 2DMTA 1KONA 2JUGA 1V5EA 4QPOA 1YJWI 4Y7NJ 4G6DA 4UHTA 3P7NA 3I0TA 5K1YA 3M07A 4HLYA 4BH9A 3CUOA 3C3WA 2H27A 3PJRA 2RNGA 3U1KA 3BT9A 5IT3A 3V8LA 1O3TA 3QQAA 1OYWA 3PSFA 3HOZJ 1J0RA 2M7AA 3CLOA 2M8GX 1SMYF 3HKZA 3PSIA 1MMGA 2FEZA 2TRTA 2BXZA 3E0JB 2LK2A 2ACJA 1Y39A 1Q1VA 5HNFA 4NQWB 2W1OA 3FIWA 5ICEA 2Y0SA 4I76A 1CF7B 2HOTA 4A3KJ 2HTSA 2W00A 5KCMA 4HYEA 1KU7A 2CGPA 2O9LA 5E1WA 4HNVA 4A3GJ 2VXDA 2R7TA 1H88C 2IAIA 2P6SA 1YE9A 1YIOA 4M3EA 1FOXA 4I0AA 2WB1A 1EV7A 4M9SA 3SZGA 4ENJA 4Y17A 4RM2A 1QVUA 3JAMZ 4PUSA 1QA6A 1WCMJ 2O5RA 4KN4X 3V42A 2M4KA 2IGMA 3KZZA 4LD5A 2VJIA 5IT9Z 1TLHB 1YX5A 4M73A 2F5FA 1B9MA 2BY1A 2L0KA 1AHDP 1R00A 4XNFA 2XIGA 5AIPA 1J09A 2FX0A 1WJCA 5D6EA 3TDZC 5GPCA 2L2OA 2VT3A 3I55I 2DA6A 1JGSA 4A12A 3K4NA 5J8CA 3ZOBA 4U0VA 4C30A 4IHXA 4MFEA 3I54A 5L3BA 2VQGA 1VZ0A 2DDBA 4PGGA 3K70D 1U6GA 4MLOA 1IZ1A 2EPFA 3HB9A 2FU4A 1FIAA 1J59A 2ZXWH 2L7MP 2DTRA 4QIWN 1BJZA 5J3LA 4BQOA 5FKKA 5JHUA 3DKYA 2JSCA 2M9HA 2LF7A 5ICCA 2GXGA 1QQIA 3BJ6A 4R8HA 3WODF 3TO6A 3EETA 2R7RA 2WADA 3K4MA 4UVAA 3S15J 4FCYA 5CQEA 3GTOJ 2XB0X 2EA2A 4BKXA 2I5UA 1QO0D 4ENNA 3UNGC 1ETQA 5B1AH 3GXOA 1ZG1A 1ZN2A 2K85A 3P5JA 2OU2A 2VN2A 3HTSB 2LP0A 2LDUA 5H6QA 2OF7A 4BHPA 2OC6A 4AIJA 1OISA 1XC5A 2CV0A 2MLKA 1FTZA 3WTWC 1RKTA 4UVBA 1USSA 1Z67A 1UELB 2CYYA 5FFXA 1QBJA 3BQYA 3WTSC 1OCTC 3SXYA 1F5TA 3GO5A 5DS9A 4XN3A 2QA4I 1ZG5A 2HDCA 3HDDA 4XSXF 4NQWA 2PMZN 4B47A 4Y33A 3ZP5A 1CF7A 4BXFA 4BDZA 2VPRA 2HKXA 4C3IJ 5E3OA 3FWEA 1E2XA 2X6YA 4GYGA 3JTHA 1XTAA 3G1OA 4V2FA 1SVMA 4ZZLA 2MH2A 4JK1X 1B8IB 1LEBA 4A0XA 2R7DA 1GV2A 1KYZA 3W6JB 4XKVA 1JT6A 2L01A 1X4OA 5D4RA 1IN7A 4IPAA 1VF9A 2DBBA 5FLXZ 4RM3A 1VQ8I 4I7HA 3H1CA 9ANTA 2IS4A 1MNEA 3TKYA 1ZG3A 5D5VB 1BJAA 3P9CA 5AIQA 2J5PA 3WGHA 3V7RA 4ESBA 4G6TB 1N77A 3S2WA 2ZSHB 4EJTA 1NH3A 5JVTA 5CVUA 4J01A 3NARA 3C2BA 1JXSA 4IOAF 2VL8A 2KRCA 4DOZA 5FRMA 2JQ7A 2ZCWA 2KJCA 5DUKA 4N4OB 5HNHA 1FY7A 5H6RA 1WHUA 2EFWA 2D2WA 1ETOA 3FBIB 3L2CA 5M5WJ 2HYGD 4FT8A 1MMNA 3O8GA 3EYIA 1K4TA 4IKFA 2OCCH 4MQVA 3DU5A 1K61A 1MMAA 3M8EA 2GXAA 1X1PA 2F4MB 5HLIA 2QLZA 4HF2A 3RZOJ 3FMQA 3F8MA 5GPAA 3AG1H 3CMEI 2IPQX 2LD5A 3PO2J 1ZAOA 2FNPA 3QOPA 2JSPA 2P8TA 4K2EA 3WG9A 1HQCA 1P7JA 5LRSA 5IYBJ 4EV0A 1NTCA 1OLTA 1TWCJ 2DT5A 2E2JJ 2KRHA 4AD9A 5DUIA 4YRVA 3RQIA 2V6EA 1XMAA 4HSRA 2K3FA 5ILUA 1XN7A 2LYCA 4OWRB 1D0ZA 1W1WE 1MW7A 3OSFA 4KT5C 3A02A 2EWNA 2ESHA 2L02A 1IRGA 1ZH5A 3HIFA 1HA8A 3BG3A 3GFIA 1SAUA 4HLXA 3T1BA 1APLC 4IHSA 2DPUA 4WXHA 3GFLA 4E7ZA 1SC7A 2V7FA 2UWMA 1WJBA 3TO7A 1TL8A 3DEWA 4JQFA 1T56A 1MBKA 2ME0A 5E8GA 2BGCA 3LSJA 3OL3A 3CDIA 2DMUA 5J4YA 5ILVA 1X58A 3I64A 5JFRA 4RB2C 1K6YA 4ZTFA 4FHTA 1I1GA 3I59B 3SHFA 1HOMA 3QPSA 1JT0A 4QLCU 2BYVE 5JI6A 5IYCJ 4XM3A 2R92J 1Z1DA 3Q9SA 4M3FA 4D5FA 1B8IA 3FKIJ 3QU3A 1G3WA 1XGSA 1W7PD 3UKGA 2ZJPF 3S32A 2DFEA 3PFIA 4L9VA 1ENHA 3BR6A 3WE2A 1XGNA 2RKHA 3R0JA 3P9IA 1D5YA 1TWFJ 5BMZA 2OUMA 1MBFA 3GTGJ 4U87A 1D0YA 1S3JA 1IUYA 3GZNB 1J75A 1ZK8A 1USTA 3Q5FA 4AVPA 4KICA 5LD2C 2NVTJ 4IX7A 2FOKA 2LF8A 1DGWY 2R4GA 1VQPI 3TW6A 1QRYA 3AG3H 5GAEJ 2ADUA 3M1EA 2MSYA 4G12A 3H35A 2K9SA 3QPHA 2YX4A 1RNLA 4KA4A 4RAYA 1OQYA 4UNOA 4XRSG 1PVEA 3E7LA 4NC6A 1ZR4A 2BXYA 3O6BB 2OQRA 2JJ7A 5HDKA 3CUQB 1A35A 2LREA 3F9KA 3GTLJ 1SFXA 4Q5SF 1ACIA 2D45A 3QRFF 1GXPA 3R0AA 3ZQCA 4EJOA 3GZ5A 2VJ4A 3QODA 4BGDA 1YI2I 3K4KA 1FP2A 3BTJA 3DEUA 2YSRA 1JTYA 1UAAA 2XHKA 2MD5A 2W84A 4HSTA 2P7CB 3MMYB 2EINH 2P4WA 2F6CA 3EUHC 2M4GA 4LB5A 1STZA 4HX8A 1PYVA 1MBHA 4EJVA 4XRMA 2E19A 2D5VA 2Y30A 1WPKA 1X1DA 2W57A 2OAZA 2X51A 2R93J 3J7AY 2BY3A 4HAMA 3OOUA 2DJNA 3LQRA 4A3BJ 2BHYA 4DZJA 3W2VA 4EGZA 1IGNA 1T8IA 3BROA 4CCOA 1REPC 4MO7A 4Y15A 3HOUJ 5M5XJ 1ONVA 2OD5A 3FXOA 4RB1A 1AKHB 2ELHA 2WY7Q 3MVPA 2EB7A 2KDZA 4CYCB 1FSHA 1X3ZB 2O7OA 1IRXA 4XRFA 3I4NJ 3FMRA 3HZJA 3AL0C 1BOAA 4XOPA 2QGUA 2M3AA 2WC2A 2PMUA 5C3EJ 3G1MA 2HXIA 2ZMEB 2F5EA 4IZZA 4L9TA 2CW7A 5C44J 3MZYA 1G3YA 3F8NA 1Z77A 2MD0A 3GTKJ 2AQEA 1UB9A 4C3HJ 3SEZA 2A6HF 2PMZA 2PMHA 4E7KA 3KYCB 4I01A 4KMFA 3K4JA 1VNDA 2R7OA 4CH7A 1VFCA 4NB5A 4UUTA 4JP0A 4XLFA 1T08B 2P5VA 3EUKL 4JOMA 3GZ6A 3CCUI 3K4LA 4DYRA 3L1PA 2B63J 1HXDA 1XGMA 3QP5A 4IL6C 3HKZN 5BNGA 4BL0B 3HXLA 1I27A 1YITI 2DA4A 1BN5A 3IH2A 3TP3A 3NQOA 2JWTA 1EH6A 4OAZA 4FE4A 3ZQQA 3ZN0A 1MNMC 2DT7B 2K9MA 4UV8A 2A07F 2Y0SN 1J9IA 2RAEA 3JSPA 5DM6F 3LNQA 1RUOA 4X1EA 4DJAA 4A3CJ 4N9IA 1U8BA 4YFNF 4Z2YA 5D5XB 4F7ZA 1FPQA 5IPAA 1MZBA 4UB8C 3CCYA 3K4BA 1Z3YA 3SYTA 5CKTA 5HOOA 2EFOA 3Q9VA 4P9UA 1JE8A 1AU7A 4XICA 1XDUA 2K4JA 2ZXIA 1FSEA 2L9NA 2NS0A 2H1KA 5L3FA 1KU3A 5F08A 3CUQA 4ETSA 1ORKA 3AKZA 2ZNYA 2LKSA 2AS5F 1BI2A 2JA6J 2XVCA 4B3XA 1QGPA 5LRRA 4Q47A 3GFJA 3LSHA 3JW4A 1ZKGA 1GLNA 3QWLA 3DTEA 5DDGA 1B72B 2JVGA 3C7JA 4N9HA 3JRAA 3BG5A 3DKXA 1VQNI 5E1XA 2VLAA 1MSEC 3HM5A 3RYRA 2Z1DA 1XCBA 3GMEA 4Q48A 1W0TA 4IXAA 1DGRM 5FGMA 1Z21A 3LA7A 5B1BH 2DFHA 3H36A 2W7NA 2EZIA 1KGSA 1GV5A 1AKHA 1FWZA 1XMKA 2MC3A 1IUFA 1OCPA 3MCZA 3PL8A 3HOVJ 2CW8A 3WHBA 3OWTA 1Z9CA 2VJJA 4ENMA 1RR7A 2DODA 4S05A 1LDDA 1W36C 2XSDC 4DIQA 2CS3A 2ZMEA 5FKLA 2ICWG 3FHZA 3K2AA 3ZQIA 2E5ZA 2Z2SB 2PQ8A 4G6QA 1OJLA 4XR6A 1G8XA 2IS2A 3EPZA 1VQ6I 2LLKA 3BLYA 3OV8A 2NS8A 1A6IA 4A2UA 4BBRJ 1D5VA 3NWSA 1Y56A 2FA5A 1WH7A 3CCJI 2UZKA 1R5ID 4MFDA 1IJWC 3F22A 2OQGA 4ITVA 5F27A 2KJBA 4RB3C 2DW4A 1QNTA 5AONA 1WJEA 3K0LA 3ZMTA 2HQNA 4I98B 4HF1A 3RKWA 1T39A 2IGNA 1VQMI 2CWEA 2X85A 2FUG2 2M34A 1VQOI 5DCFA 2M30A 4IRHA 1I3AA 3V4GA 1B59A 2FD5A 5EDNA 4U7BA 2IJLA 3N05A 4N4NB 2W25A 3SZPA 3ZXSA
chains in the Genus database with same CATH topology
1OCRH 3AG3H 2EIMH 2DYSH 3AG1H 1V55H 2ZXWH 1OCCH 2Y69H 5B3SH 3ABMH 3X2QH 3WG7H 3ABKH 1OCOH 2EINH 2DYRH 3ASOH 2EIJH 3AG4H 2EILH 3ASNH 2EIKH 2OCCH 3AG2H 1OCZH 5B1BH 5IY5H 5B1AH 1V54H 3ABLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR H;  3AG3 H;  2EIM H;  2DYS H;  3AG1 H;  1V55 H;  2ZXW H;  1OCC H;  2Y69 H;  5B3S H;  3ABM H;  3X2Q H;  3WG7 H;  3ABK H;  1OCO H;  2EIN H;  2DYR H;  3ASO H;  2EIJ H;  3AG4 H;  2EIL H;  3ASN H;  2EIK H;  2OCC H;  3AG2 H;  1OCZ H;  5B1B H;  5IY5 H;  5B1A H;  1V54 H;  3ABL H; 
#chains in the Genus database with same CATH topology
 1O3Q A;  4CCK A;  4L5J A;  4M3D A;  2KQR A;  3E5Q A;  4C3J J;  4EEF G;  2VQC A;  4YEL A;  4EAT A;  4R79 A;  2M87 A;  1MBE A;  4HNU A;  1ETW A;  3TMO A;  3CCV I;  2DA3 A;  3FXR A;  4ZZD A;  2X1C A;  2KP6 A;  5FKN A;  4HDV A;  1HW2 A;  3IL2 A;  4BDY A;  4H4K C;  1XB4 A;  5HS9 A;  4I2O A;  1H9T A;  4MQ9 F;  3E6D A;  5K5R A;  2X4H A;  1HBX G;  1YJN I;  3IRQ A;  1FC3 A;  1B72 A;  3LOC A;  1P92 A;  4L5E A;  2GWR A;  3DTI A;  1WI3 A;  2UXX A;  2H6B A;  2LFB A;  1W7P A;  2NAZ A;  1RIO H;  1ON2 A;  2JT1 A;  5CQG A;  2EIL H;  1WFX A;  3ERE D;  3CMM A;  4DBR A;  3HPG A;  5L3D A;  2WV0 A;  2JVH A;  2DA2 A;  3CMA I;  3C1D A;  3RKX A;  1BW5 A;  1MSF C;  3WTT C;  1JJ8 C;  2XAU A;  2Y0M A;  5DD4 A;  4PDK A;  1QHH D;  3W2W A;  1W0U A;  2JA2 A;  4BBS J;  2EZL A;  4M3B A;  3HRT A;  3E6C C;  2DU9 A;  5BS6 A;  2Y48 A;  4DBQ A;  5FLM J;  5F0F A;  2OA4 A;  1MGT A;  1TT5 B;  3A01 A;  1T95 A;  1ZR2 A;  1JUM A;  4YEJ A;  2MA3 A;  3BTL A;  2JA8 J;  1U9O A;  2ZJR F;  1BIA A;  2EIM H;  1KYW A;  3OYH A;  2IP2 A;  1K79 A;  2IRF G;  1MMD A;  2DYS H;  2IVM A;  4N0B A;  2BV6 A;  2K7L A;  4A3L J;  5HDG A;  3LA3 A;  2QZ8 A;  2DPD A;  3GTQ J;  1FYM A;  2QQ8 A;  1O3S A;  5GTI C;  2NNN A;  4BEH A;  2ME6 A;  4F91 B;  2XAF A;  4KIG A;  4GO1 A;  2F2E A;  2V9P A;  1YJ9 I;  1PUF A;  1SEU A;  2QF7 A;  3ZQ7 A;  2QVO A;  2CUZ A;  2V9V A;  3O8H A;  3IHU A;  1YHQ I;  3BG6 A;  1Z0X A;  3I4M J;  2RQP A;  3K10 A;  2O6G E;  3ECH A;  5HLG A;  1NHA A;  1K78 A;  3CJR B;  4O6J A;  2CQ7 A;  2DMQ A;  1FNN A;  1J2X A;  2V26 A;  3DFG A;  3QYE A;  3Q3S A;  4LGW A;  3I58 A;  4I09 A;  2STT A;  3TP0 A;  1RPW A;  3HBL A;  3QPL A;  3KCC A;  5E3N A;  2L7Z A;  2VT2 A;  2ECB A;  4LLG F;  4BJT A;  1TQP A;  2Z99 A;  4A5N A;  1JHH A;  2CH0 A;  2HQ5 A;  1IV8 A;  3TO9 A;  2RN7 A;  2DCE A;  2R7F A;  4LMY A;  2E5N A;  4XK4 A;  3T8R A;  3F8F A;  4FET A;  4HPQ A;  3KLN A;  2L9R A;  4AIH A;  4WK8 F;  3PQK A;  3T5X A;  4BU2 A;  3F8B A;  3G3Z A;  4GRI A;  2QUF A;  4KIB A;  4E4H A;  4GYI A;  3H9J A;  1R7J A;  4AIK A;  2A69 F;  2NS7 A;  1GVJ A;  3M8F A;  2CUE A;  4HW0 A;  2C6Y A;  3ZGK A;  2HS5 A;  2KZV A;  2NRA C;  1FIP A;  4W1U A;  4OIO F;  3G2B A;  4JX5 A;  3V7S A;  4O3M A;  4X6A J;  1IRZ A;  3GVA A;  2QEN A;  4IJA A;  5CJ9 A;  1ERD A;  1ZLK A;  2V4J C;  3BZ6 A;  2DA7 A;  3G1L A;  4D1Q A;  2PJP A;  3A0B C;  1RRJ A;  3I71 A;  2FNA A;  1V5G A;  3H0G J;  2O03 A;  4L0Z B;  1HSJ A;  3LSI A;  4EM0 B;  3MZH A;  2OJE D;  3BR2 A;  2QKL B;  3FM5 A;  4L5I A;  4YFX F;  4G7O F;  1X4P A;  1E3O C;  4E7H A;  1YG2 A;  4OOI A;  1S72 I;  1O57 A;  2M8E A;  1DUX C;  1B6A A;  2EIJ H;  4MEY F;  4HZF A;  3F0C A;  4BAY A;  2K27 A;  4F52 A;  3D5S C;  1R1V A;  2RV8 A;  1V5F A;  3OYJ A;  2F5D A;  4B48 A;  4CCL A;  3DQV C;  3HOY J;  3Q0W A;  3S3M A;  1LE8 B;  5L3E A;  2R7W A;  1R71 A;  1V54 H;  2ZC2 A;  4B44 A;  1FEX A;  1I3Q J;  3H3V K;  4XKW A;  2ZKZ A;  3JRI A;  1R6R A;  3K4C A;  2PJR B;  3MAJ A;  3D1N I;  1I6H J;  1OCO H;  1JTX A;  2KZG A;  2LY2 A;  3RPQ A;  4C2M J;  1SFE A;  2Q8K A;  5M5Y J;  4L9J A;  4IQ4 A;  2WAF A;  3L9F A;  2DOF A;  4RGX A;  2G7H A;  4XRS A;  3J81 Z;  2FBI A;  1RR8 C;  1U8R A;  1IAW A;  1A5J A;  2CQK A;  1XS9 A;  1WGX A;  1LNW A;  1Y1V J;  3IKV A;  1SMT A;  2W85 A;  3CTA A;  3I53 A;  2BEO A;  1GT0 C;  2Y31 A;  3IWZ A;  3OYG A;  2XC7 A;  3DV8 A;  1KZH A;  1HDP A;  2LH9 A;  1XPX A;  3ABU A;  4ABZ A;  4EJW A;  3E6B A;  4B43 A;  1DP7 P;  1QZZ A;  4G9Y A;  1CGP A;  1HW1 A;  1E17 A;  2CMP A;  3HOT A;  5L3C A;  2CU7 A;  3DWL E;  4IEJ A;  2WV1 A;  1TWG J;  2EFN A;  1SFK A;  2XAH A;  3HOW J;  5F6F A;  5KK1 A;  2V1X A;  1X3U A;  3JCU C;  3ZMZ A;  5ICF A;  3PUF A;  2HFH A;  2LOO A;  2JK3 A;  2FML A;  4MTD A;  1NG7 A;  2FRH A;  1HKQ A;  3DTK A;  3TQN A;  2IS6 A;  3ZCO A;  5FB2 A;  1LVA A;  2HWV A;  3FMS A;  3ZR8 X;  4UXN A;  2AXL A;  3GX4 X;  4LK1 F;  4BJ5 C;  1D1A A;  2XPW A;  5B66 C;  1YTY A;  2F5C A;  3LL7 A;  2EH3 A;  1TNS A;  5GP9 A;  3MFK A;  5EYR A;  3E1S A;  4UB6 C;  3LSM A;  1HCR A;  3HC7 A;  3SFI A;  2JUC A;  5C4X J;  5CVI A;  4ZDP A;  3OR1 C;  2PEX A;  1B1B A;  3LQQ A;  1J7K A;  2CG4 A;  5EEA A;  1IN5 A;  1V3F A;  1ZRF A;  1WKM A;  1S7E A;  3GBG A;  5KHD A;  1TQI A;  3OIP A;  5LGT A;  4UUS B;  3HOX J;  2K3P A;  3BQZ A;  4O5V A;  4F92 B;  3E6M A;  4LIT A;  1L0O C;  3CCS I;  4M6Y A;  1R4M B;  4FAS D;  5A2Q Z;  1LDJ A;  2CQQ A;  3FXJ A;  1ZRD A;  3M7G A;  2G9W A;  3KEQ A;  3LMM A;  4WWC A;  3MKY B;  2BHZ A;  4BXU A;  1DU6 A;  4LOC A;  1LUJ B;  4S0H B;  4NHJ A;  5F1J A;  3CJN A;  1Z91 A;  2GA2 A;  3OS2 A;  2HYF A;  1FMV A;  3TOB A;  3VPR A;  3OS1 A;  3LWF A;  4IHT A;  2O8X A;  2XPU A;  1X1A A;  3G6E I;  3M8J A;  4NDL A;  1E0E A;  3UR3 C;  5K7H A;  2PJR A;  4A93 J;  3IAS 2;  2Q2E B;  2EFQ A;  2EV0 A;  4KNY A;  2UXN A;  4LJZ F;  1D1C A;  1FJL A;  1WRJ A;  1X2N A;  3J7A O;  3GW2 A;  4HNT A;  2ELJ A;  3OYB A;  3GLL A;  2EQR A;  3V8K A;  1PUE E;  3MN2 A;  1SVO A;  4LIV A;  3U1D A;  1QU3 A;  3K70 C;  2XRO A;  4PJJ A;  1ZGA A;  5EF6 A;  3CMY A;  1SAX A;  3QYB A;  4CSW A;  2L3D A;  2R7X A;  2JTV A;  2XF5 A;  3HEF A;  3IP4 B;  4IHY A;  2K86 A;  1A36 A;  1O7L A;  4Y52 J;  2HQA A;  2DYR H;  2HXO A;  1FYL A;  4D7N A;  3KET A;  2IGK A;  3NRV A;  5D4S A;  3H3U A;  3GTP J;  3Q0U A;  3SDG A;  4OMY A;  4LLN A;  3SDB A;  4A0Y A;  1IDY A;  3WU2 C;  2VAS A;  4CGZ A;  4UY8 I;  2FSW A;  3HG9 A;  3H5N A;  3RTR A;  2L4A A;  4S04 A;  3RZD J;  2LY1 A;  3HSE A;  3GUD A;  2CW0 F;  5DYM A;  3M1C A;  3PNT A;  2B9S A;  1LDK B;  3ELK A;  4BS9 A;  2IEK A;  3CUQ C;  3OYF A;  5M3F J;  1PDN C;  4RGS A;  3U2R A;  4XLH A;  1KU9 A;  3LST A;  3GF2 A;  5FRO A;  1QVT A;  1RC9 A;  3S3O A;  2VJ5 A;  4V19 K;  1O7F A;  2XUB A;  4XLP F;  4XMY A;  2E60 A;  2L7K A;  1UCR A;  2HEO A;  1OMI A;  1S7A A;  4MHG A;  3CF5 F;  4ZTJ A;  1PP7 U;  3CC2 I;  3NEU A;  2E34 A;  2OCE A;  3D5L A;  3DCF A;  3DEE A;  3FXL A;  3LAP A;  3RKY A;  4RGU A;  2LSO A;  3ML6 A;  5TJJ A;  2IT0 A;  1LKX A;  1MH4 A;  2Y9Y A;  1M1E B;  1I1S A;  1U5T B;  1JKQ C;  5KAF C;  2PN6 A;  5D5W B;  3GWZ A;  3E5X A;  5CVR A;  5KAI C;  1P6R A;  5JVG F;  4AVZ A;  3G73 A;  3CZ6 A;  3MKW B;  1LVK A;  2L9S A;  2K9N A;  3L00 A;  3DPU A;  5DM7 F;  2EFP A;  1U9N A;  2FF4 A;  1R1U A;  3HRU A;  2IGO A;  2Z16 A;  4ZDL A;  4C2U A;  1Z6T A;  1UG0 A;  4XBF A;  2HOE A;  5KVR A;  5FRN A;  1FBS A;  4ZDO A;  2Q2E A;  4RAZ A;  2ZME C;  1XDS A;  4D0P A;  1ZYR F;  2VE8 A;  3ABT A;  1MDM B;  1BA5 A;  3B02 A;  2XAJ A;  1R4N B;  2L4M A;  1T38 A;  1TBX A;  3RIR A;  2IW5 A;  3IWF A;  5TIS C;  5D8K B;  4WX9 A;  1VQ7 I;  2QQA A;  4AYB N;  4CDG A;  2RC4 A;  2LTP A;  3VOD A;  1UFM A;  1K4S A;  4PFO A;  4RGR A;  2BY2 A;  2E1C A;  5CPR B;  2M1B A;  3CJT B;  4Y4R A;  3I59 A;  4BJ6 C;  4YIR X;  2L5Q A;  2CUF A;  1D0X A;  1PP8 F;  4A6E A;  1JKO C;  1ETK A;  1JUP A;  1FBQ A;  5FD6 A;  4A3M J;  3QOE A;  1IDZ A;  2FMY A;  4QTR A;  3J80 Z;  4XLC A;  4BE2 A;  4LG0 B;  1EF4 A;  1FX7 A;  5E18 F;  2DJI A;  5FO5 A;  2GQQ A;  2A61 A;  3BJA A;  5IOY A;  2VKE A;  3DBH B;  2MC4 A;  2WY8 Q;  4KMU X;  2MFZ A;  3R61 A;  5IOZ A;  1HF0 A;  4MTE A;  3RJP A;  5JLX A;  2LY9 A;  4P1W A;  4II2 A;  5EG0 B;  5J40 A;  4BY1 J;  1R1T A;  2PFB A;  3OS0 A;  1BC7 C;  2V6C A;  2LKP A;  2XAQ A;  4ZYD A;  1OCC H;  1HKT A;  1GXQ A;  4L0Y B;  3C18 A;  5D5U B;  2I10 A;  3IUO A;  5J6X A;  2BBY A;  1P7I A;  4M74 A;  3JRF A;  2QQ9 A;  3AG4 H;  3WGI A;  3JRC A;  4ZC3 A;  3OYK A;  1FMW A;  5E17 F;  2ID6 A;  1S5L C;  2E71 A;  5DCM B;  1LB2 A;  2NVX J;  3VSL A;  1BR4 A;  3B73 A;  4D7M A;  1OCR H;  4KIF A;  3FK7 A;  3N4M A;  2DXI A;  1U5T A;  1V55 H;  2P7V B;  2FBK A;  3JRH A;  1R5G A;  3BR0 A;  1LEA A;  2MG4 A;  2KFD A;  5EGO B;  3FHN A;  3EQL F;  4CCN A;  2RRE A;  4HRI A;  2B0L A;  2IA0 A;  3U21 A;  4D9J A;  3OOP A;  1H8A C;  1PJR A;  3KFW X;  2NXN B;  2DAO A;  1FOY A;  3CP2 A;  4L18 B;  3CO7 C;  1MIJ A;  5M3M J;  3OYM A;  1ZEL A;  4MGR A;  1S8N A;  2AO9 A;  2ID3 A;  1IG7 A;  5FD5 A;  2D1H A;  2G0E A;  5E20 A;  4M9Z A;  3CDL A;  4CYC A;  2HDW A;  2X6X A;  3MD2 A;  4WCG A;  1UG2 A;  2TDX A;  2UUZ A;  2XPV A;  5EEH A;  3L2V A;  2G7U A;  1L3L A;  1WZ2 A;  5FLV A;  4PFP A;  3SQN A;  2MW8 A;  3VYR B;  4KN7 X;  4XKB A;  2E36 A;  2OV7 A;  3CES A;  1VQ9 I;  5EZH A;  1EH8 A;  3OIO A;  1UHW A;  2IXS A;  4IQJ A;  4FQG A;  1G6N A;  4F3Q A;  1MKM A;  1MJB A;  3FZV A;  2OZ6 A;  4PSX A;  4J19 A;  2IA2 A;  3W6K B;  1YRN B;  4ESJ A;  1EA3 A;  3KP4 A;  4LB6 B;  1KQ9 A;  1F4K A;  2QSH X;  5ILS A;  1TTY A;  5TGT A;  2MYS A;  4KIT B;  2GZW A;  2M0C A;  5L3G A;  1JJ6 C;  4FIS A;  1R58 A;  4ZYG A;  3LFU A;  3K69 A;  2HQR A;  2M45 A;  2ELK A;  3K1P A;  4OIN F;  1IN4 A;  3FK6 A;  1ON1 A;  1HLV A;  3WTX C;  3F6O A;  4IHW A;  2LNB A;  2OTJ I;  1ZLJ A;  2F5V A;  2X6W A;  4I0B A;  2XKO A;  1HW5 A;  3TGN A;  2D1V A;  4IOC F;  1BOB A;  4P5O A;  4LG3 A;  5JHF A;  1OYY A;  5HLH A;  2M2E A;  2RNJ A;  3LA2 A;  2X1E A;  3KYL A;  4X0G A;  3FXQ A;  2HR3 A;  2MLG A;  3ERM A;  3S1M J;  3PIP F;  3OIQ A;  2AHQ A;  4M6X A;  2AXT C;  2YU9 J;  4IRI A;  4JX4 A;  4CUG A;  2CV1 A;  2NVU B;  4CYD A;  1WJF A;  2UV1 A;  3CCR I;  2E2H J;  4XKC A;  5EGO A;  2XAS A;  1KQ0 A;  1N25 A;  2GBY A;  4HBL A;  5HLT A;  3KP6 A;  1RZ4 A;  2H6C A;  1ETV A;  2JRT A;  5BQT A;  1WH5 A;  3S1R J;  1VQK I;  2CO5 A;  1F9N A;  2DTZ A;  2WTE A;  2R3S A;  3GLX A;  2CJJ A;  1FBU A;  1Z7L A;  1WJD A;  2NOG A;  1IO2 A;  3ZMS A;  3I9V 2;  2O3F A;  5J8F A;  3KP7 A;  2KRF A;  4XLA A;  2HTJ A;  2O61 A;  2CFO A;  2VQL A;  4RBO A;  2NNY A;  1P4X A;  2PX9 A;  2JA7 J;  1XSV A;  2ZSI B;  3F6V A;  1IC8 A;  4BAC A;  4C2T A;  3PUB A;  1P4A A;  3JAM K;  2HNH A;  1MH3 A;  1OKR A;  2XF7 A;  3LSK A;  4PJM A;  4B4C A;  3L2U A;  4B1R A;  2VOO A;  3MQ0 A;  1JGG A;  3DF8 A;  3HGY A;  4FE7 A;  2VQH A;  4AYB A;  3BG7 A;  2OZU A;  2X9D A;  4FTH A;  4RLQ A;  1FP1 D;  2XGD A;  5IT9 K;  1OCZ H;  2EA4 A;  1H9G A;  4XOR A;  1I50 J;  2WA0 A;  4XON A;  4AU7 A;  2ISZ A;  2E35 A;  4A3D J;  2EV6 A;  2EK5 A;  2R7Z J;  2A3S A;  2L7F P;  1YYV A;  1V4R A;  1YRN A;  3MEX A;  2LRD A;  1S9H A;  3BCA A;  4MNU A;  3H9Q A;  4HX7 A;  4HOB A;  1R22 A;  3B6C A;  2P81 A;  2QWW A;  3FX3 A;  2R0Q C;  3DBR B;  3IH4 A;  3JSO A;  3CCE I;  4FX4 A;  2E1M B;  2HPM A;  5F0H A;  4RA2 A;  5K7F A;  2GM4 A;  2IS1 A;  5BPI A;  3BR1 A;  4EMS A;  4HV5 A;  2H94 A;  4NC8 A;  2DQL A;  4RLF A;  3S14 J;  4BQN A;  1B4A A;  3LAJ A;  2JRM A;  1TZL A;  6PAX A;  2E7W A;  1HDD C;  4BQQ A;  1UMQ A;  2L9V A;  2VUM J;  2ESN A;  3R6S A;  4WXC A;  3KPH A;  2XGX A;  4II3 A;  1LPQ A;  2XRL A;  4P55 A;  2PBI A;  2KIU A;  4KDP A;  2X0L A;  4HF0 A;  3PNY A;  4XLE A;  4U7D A;  1OPC A;  2HZT A;  4B8X A;  3HHG A;  2BY0 A;  4RS8 A;  3VFZ A;  1IXR C;  4AC0 A;  1IXS B;  1G59 A;  1YO5 C;  5IYD J;  1LFP A;  1LFU P;  3RI4 A;  2DOA A;  3LSG A;  4RMN A;  3SZT A;  1WI9 A;  5ICG A;  1YS6 A;  1X1B A;  2EV5 A;  3WTU C;  3OY9 A;  3AAF A;  3BG9 A;  3W2A A;  1FLI A;  2COB A;  2ETH A;  1YLF A;  3E5U A;  5GAD J;  4GGG A;  3VDX A;  3OYN A;  3JRE A;  4G94 A;  1QZY A;  1VQL I;  3J81 K;  1ZGW A;  2YS9 A;  5DEQ A;  1TC3 C;  3ZMV A;  4BNC A;  1IF1 A;  4HA8 A;  3GTM J;  4CXF A;  1N78 A;  3EUA A;  4PJ0 C;  1Y6I A;  4BQA A;  4UUV A;  5IP7 J;  1OR7 A;  3JRG A;  1XD7 A;  4GDF A;  3H92 A;  3HPH A;  2HZD A;  1O3R A;  1VQ4 I;  1UHM A;  4UVC A;  3PFY A;  3P9K A;  4CZZ A;  4GCV A;  3ZMU A;  4QWQ A;  5FKO A;  5J1Y A;  3PM1 A;  1AWC A;  2QQB A;  3C2G A;  5FLX K;  4B09 A;  3X2Q H;  3GYH X;  1FT9 A;  5C4J J;  3J7Y J;  1BL0 A;  2A6E F;  3CC4 I;  4KIS A;  2Z33 A;  1TQM A;  2NYX A;  3L09 A;  1IW7 F;  2IBD A;  2RDP A;  4I6Z A;  2GIZ A;  5HDN A;  1BBY A;  2JPB A;  3ZQF A;  1SAN A;  1RET A;  4EM2 A;  5LHI A;  2HU9 A;  4PZJ A;  3ZRG A;  3ZQL A;  3A4C A;  2JN6 A;  1BM9 A;  3ASN H;  3F23 A;  1FTT A;  3BZC A;  1U0J A;  2DO7 A;  4XID A;  3V7C A;  3K6G A;  4A3J J;  2F4I A;  3BP8 A;  5LHG A;  2P5L C;  2XV4 S;  2K4B A;  3I5U A;  4UV9 A;  1S7O A;  1YX3 A;  4A0Z A;  1E3H A;  2N8G A;  3RPU D;  4CHU A;  2VOP A;  4WXD A;  5LGU A;  3VSK A;  2R5Z B;  3IH3 A;  3ZQH A;  1IRF A;  4EJU A;  3FM3 A;  4I02 A;  2LBF B;  3OYE A;  2DMP A;  3MZ8 A;  2HDD A;  1POG A;  5J47 A;  3LSP A;  1WSU A;  3CQZ J;  3S16 J;  2QEX I;  1DU0 A;  2OBP A;  1GHC A;  1T0F C;  4L9N A;  3TBI A;  3JR9 A;  5A2Q K;  3FXU A;  3KLO A;  4M72 A;  1H0M A;  2YX7 A;  4AUX A;  4OAY A;  1YW7 A;  1A6Q A;  1DP3 A;  2XGC A;  2KIS A;  2KPM A;  3E3V A;  3E97 A;  3PQJ A;  3RDI A;  4U0Y A;  2FXA A;  3SJM A;  2VBW A;  3WG7 H;  1SFO J;  3VWB A;  2LMD A;  1IN8 A;  2RVC A;  3OYL A;  1KA8 A;  5HS8 A;  1W5S A;  3CD6 I;  3ROU A;  1JKP C;  2JA5 J;  2XF6 A;  4CZC A;  2YR2 A;  1I6X A;  1J5Y A;  3CP8 A;  2K9L A;  4Y13 A;  3OL4 A;  4ZH4 F;  3OYD A;  3WGG A;  3DU6 A;  3VOE A;  4HQE A;  1S29 A;  5F0C A;  2EJR A;  2ECC A;  5DD8 A;  5H2F C;  3BC8 A;  5EZG A;  4OIR F;  4NBQ A;  3K9T A;  3BTC A;  1XSX A;  2KIM A;  3TW7 A;  3DLL F;  3M3Y J;  2XAG A;  1MMS A;  2ZFU A;  2R7V A;  4PJL A;  3CC7 I;  3DPL C;  4DYC A;  1C0W A;  2Q0O A;  1BIB A;  5D6F A;  3NWT A;  3I4P A;  1TW3 A;  2A68 F;  4E6K G;  3OYI A;  3BR5 A;  4C9Y A;  2A05 A;  3S1N J;  2OPT A;  2XRN A;  1TWA J;  2Q1Z B;  1VQ5 I;  1RKW A;  4F55 A;  4IVN A;  3IV5 A;  4BY7 J;  5KNL A;  1F36 A;  4W97 A;  1T98 A;  1RI7 A;  2DQR A;  1HST A;  2V79 A;  1TNT A;  1YIJ I;  2JPC A;  3BZK A;  3H3Z A;  2XSJ C;  3L2W A;  3L2R A;  5GAG J;  3EYY A;  5CLS A;  4PCQ A;  1ZRC A;  5HS7 A;  4XL9 A;  2NOJ B;  2W48 A;  3BTI A;  3DLA A;  1MBG A;  4EM1 A;  2COM A;  4E7S A;  2E1O A;  4QSH A;  2DK8 A;  3BR3 A;  3M9A A;  2GXB A;  1LE8 A;  1EKE A;  2CQX A;  3TDU C;  1DPR A;  3S8P A;  1JHF A;  1HC8 A;  5CVV A;  3SEQ A;  2H1L A;  4ZJZ A;  2PI0 A;  3I56 I;  2KT0 A;  4ENK A;  3S3N A;  2H8W A;  1D8J A;  1EH7 A;  2QCO A;  1P9Q C;  2ZNZ A;  3CCM I;  2E7X A;  4DGW B;  3OYA A;  5F64 A;  2VIX A;  3FDY A;  2KHM A;  3WE3 A;  2R5Z A;  3D0S A;  4Q4Z F;  1AOY A;  1WVR A;  3ECO A;  1EJ9 A;  2LBF A;  3H5A A;  3CCQ I;  4DNC A;  4LIU A;  2VKV A;  1B9N A;  3PIO F;  3IRR A;  3FF5 A;  4E7I A;  2ZBK A;  1SD6 A;  2YUS A;  4GXO A;  3F21 A;  4E7J A;  2ISY A;  5JLW A;  3S1Q J;  3ULQ B;  4TV7 A;  2HOS A;  5IY5 H;  4RB0 A;  2V1U A;  1Y1W J;  2MH9 A;  2XKP A;  1P4W A;  2KIQ A;  3JRB A;  1Q1H A;  4LK0 F;  5FJ8 J;  4YG2 F;  3WTV C;  1T33 A;  4RDU A;  1XGO A;  3GCM A;  1K83 J;  1T0F A;  2M7B A;  2LG4 A;  2E2I J;  3TL4 X;  2DFF A;  5E8I A;  5HVQ C;  2XB5 A;  1UHS A;  1F43 A;  3RYP A;  2K40 A;  3HSF A;  2VPL A;  3FKJ A;  2P0W A;  3VYS B;  1FOK A;  5LHH A;  2HYJ A;  3VEP A;  4BHC A;  5DTD A;  4HV6 A;  2DK5 A;  5FFZ A;  4V2G A;  4P9F A;  3HHH A;  1MBJ A;  2KIF A;  4ZYH A;  3QP6 A;  1R5H A;  2GOM A;  2YPR A;  5IP6 A;  2Y9Z A;  2GOX B;  2X48 A;  3OYC A;  2BW3 B;  2FQ4 A;  4A3I J;  3D5R C;  1CQT A;  2HPI A;  1R36 A;  3BY6 A;  3O2P E;  3V8J A;  5TRD A;  2MGQ A;  3ISP A;  2L54 A;  1U5T C;  1GDT A;  1BR2 A;  3BDD A;  3QU6 A;  3J80 K;  2R5Y B;  1S6L A;  2VKH A;  2HI3 A;  1ETX A;  2R7S A;  4UUS A;  1BR1 A;  1JUS A;  4U88 A;  3CJQ B;  1JI8 A;  4AWX B;  1QPI A;  4GFB A;  4M6V A;  5B3S H;  1N75 A;  3WTZ A;  1LQ1 A;  2W82 A;  1XCV A;  3VB2 A;  3GEZ A;  2A6T A;  1FOW A;  3KP5 A;  3BJO A;  2WAQ N;  3ZPL A;  4JBA A;  1W36 D;  3R4K A;  4DZP A;  2I8D A;  4EVI A;  1XMX A;  3H5R A;  4PSW A;  1SD5 A;  4DYQ A;  1AA7 A;  1YS7 A;  2CUJ A;  3HOS A;  3ZQG A;  1ZTR A;  5K5Q A;  4YIF A;  4XQF A;  4EQQ A;  1Y0N A;  4H0E A;  3M4O J;  2TCT A;  4KT6 A;  4XSZ F;  1Y8R B;  3KP2 A;  3LSR A;  4NNJ A;  5BOX A;  2WAE A;  4XN0 A;  1Y0U A;  2DA5 A;  3WTY C;  2VON A;  3WU0 A;  1SFU A;  2KL4 A;  3KIO A;  1Y8Q B;  3ZMD A;  1TWH J;  1OFC X;  4IF4 A;  4RAG A;  3L7W A;  1XSD A;  1G3S A;  5LLQ A;  5LFA A;  2GAU A;  2M5W A;  3KX2 A;  4KUM A;  5DV5 A;  3L2Q A;  2VBZ A;  4YII A;  2CSO A;  4A6D A;  5ERI A;  4M9X A;  4KFC A;  1MJA A;  3ESW B;  2H09 A;  4G7H F;  3CDH A;  2IA1 A;  3FBN B;  1FZP B;  2WWY A;  4BE1 A;  4D5C A;  4LLL A;  2XGE A;  3F72 A;  3RSN A;  2VB6 A;  1YOV B;  1W5C C;  2ZXH A;  4KJZ A;  4PJN A;  4BHB A;  2M0M A;  2J5O A;  3FIS A;  5E79 C;  4Y3O A;  2NVY J;  4E70 A;  1D3Y A;  1GVD A;  2GA1 A;  2CFX A;  3AG2 H;  1Z3X A;  1IXC A;  1YW8 A;  4A3F J;  2K9Q A;  4ESF A;  3HUG B;  1E3P A;  3KEO A;  1ULY A;  1YW9 A;  2DFI A;  3MKL A;  5F04 A;  2Y2Z A;  3COA C;  2K02 A;  3MWM A;  1T2K A;  1VI0 A;  3AL0 B;  3KEY A;  4IO9 F;  2XDV A;  3HGG A;  2BW3 A;  3DBL B;  2O0Y A;  2X1D A;  2QKM B;  1XG1 A;  1U3E M;  3T8T A;  4DW6 A;  1IV6 A;  1SD7 A;  3RPU A;  2VI6 A;  2DDA A;  2R5Y A;  5D8L B;  2Y75 A;  5GAH J;  2FQ3 A;  1H89 C;  3OSG A;  2ZXJ A;  1K6O A;  1G4D A;  3AFH A;  5B5E C;  4NC7 A;  1HKS A;  1TW2 A;  4PK4 A;  2VXZ A;  2JMW A;  3HRM A;  5CYV A;  2DI3 A;  3BPX A;  3QAH A;  3TOA A;  3I3L A;  3IKT A;  3QYF A;  4IHV A;  2DA1 A;  3A2K A;  1ODD A;  2GLO A;  1BC8 C;  1A31 A;  2WB1 N;  1TP4 A;  3HRS A;  3J7Z I;  3IAM 2;  3DPT A;  1BI3 A;  4FX0 A;  3ASO H;  2HVR A;  3LFK A;  4OU0 A;  2LVS A;  1SVL A;  3QPT A;  5F1R A;  3WU1 B;  1OYI A;  2B7E A;  1UZC A;  3OR2 C;  3KE2 A;  2O8K A;  2A5W A;  1IN6 A;  2ZJ2 A;  3K1N A;  3T0Y A;  1F1Z A;  1ZAR A;  3KYD B;  5IP9 J;  2DMN A;  3REO A;  1XX5 A;  4CA0 A;  4BE0 A;  4YFK F;  1MDM A;  1NK3 P;  2F48 A;  2QM3 A;  5BPD A;  1ITY A;  1ETY A;  1K7A A;  2YU3 A;  1YQA A;  2MAB A;  4R1H A;  2AQF A;  1KQ8 A;  4HX4 A;  2VC1 A;  3K7A J;  2X6O A;  1MD0 A;  2K5C A;  3KZI C;  2DLL A;  4LFU A;  3U9G A;  5EEG A;  1W7P B;  3OMY A;  3F3X A;  2FE3 A;  4PGH A;  3A03 A;  1R49 A;  2STW A;  4CIC A;  1YFH A;  1T6S A;  2V1N A;  3H9G A;  3BOQ A;  1DDN A;  5K7Z A;  3ABL H;  3DP7 A;  3EUH A;  4HDU A;  1ZRE A;  4KYW A;  2NVQ J;  3S2H J;  3KZY A;  1BI1 A;  3KP3 A;  3TED A;  5K5O A;  4LG0 A;  5LGN A;  3EDP A;  2Z5U A;  5LEJ A;  1BW6 A;  1G3T A;  2BVM A;  5E3M A;  3HSR A;  4ZYE A;  1JKR C;  4ASN A;  1TT0 A;  2LR8 A;  5GTH C;  5LBQ A;  1I5Z A;  1U2W A;  1X2M A;  4BYY A;  4F93 B;  4EGY A;  3CO6 C;  3RQ4 A;  3N97 A;  3S2D J;  1W5T A;  1KU2 A;  2V9K A;  3GFM A;  2BOL A;  5HOD A;  1P2F A;  3HUG A;  3NAU A;  2W24 A;  4OIQ F;  4XLN F;  5EG0 A;  5E1Z B;  5EJC A;  3A01 B;  1D1B A;  2HGC A;  1A04 A;  3HYI A;  2P6T A;  4ON0 A;  5J4V A;  2FBH A;  3HTU A;  2QSG X;  1QPM A;  2QBY B;  3ONQ A;  2ZFW A;  2KKO A;  3MKZ A;  2RGV A;  3JRD A;  3PO3 J;  2Y69 H;  2VKD A;  2R7Q A;  2VC0 A;  3ABM H;  4CO8 A;  1VTN C;  5CVJ A;  2GIV A;  3R60 A;  3S17 J;  3ABK H;  2LC2 A;  3RCO A;  1NG6 A;  2VE9 A;  4RAF A;  3VYU B;  3HJE A;  1RUN A;  1DPU A;  1SD4 A;  5DCM A;  4BEH B;  1Z7U A;  2VOD A;  2LKX A;  4ANJ A;  3DKW A;  2EZH A;  1QZE A;  2BZT A;  1PUF B;  3A0H C;  5E3L A;  3C2H A;  3ZN1 A;  4Z6Y A;  1NK2 P;  4G8X A;  2OTL I;  1DQU A;  5ED4 A;  2KDO A;  2CRG A;  2QYO A;  4CCJ A;  2FJ1 A;  1LFB A;  5JR3 A;  1ZGJ A;  3IC7 A;  4BUP A;  4CCM A;  2EBI A;  5J1R A;  1K78 B;  5J1U A;  3BCB A;  1ZHF A;  3GTJ J;  4AID A;  1GUU A;  1D8K A;  1OR7 C;  5LEK A;  1QHG A;  2Z3Y A;  3Q0V A;  3W3C A;  4MEX F;  4M71 A;  4OMZ A;  1LJ9 A;  2HOA A;  4HEA 2;  2EIK H;  2P5K A;  4MIM A;  2WAQ A;  4ZYA A;  3G71 I;  3S93 A;  4QPQ A;  5FKM A;  2VBY A;  3BWG A;  3K2Z A;  2ZJQ F;  3W6V A;  2DN0 A;  3VYT B;  4I99 C;  2BVL A;  3DXJ F;  1R23 A;  2DT6 A;  3CLQ A;  1WWX A;  4HG2 A;  1UJ8 A;  1WJA A;  2PG4 A;  2KMU A;  1MND A;  2MBF A;  1WJ5 A;  1Z05 A;  3O3K A;  4E7L A;  3RKQ A;  3H0D A;  2PLY A;  2ZB9 A;  1O4X A;  1RES A;  1BI0 A;  3A1Y A;  4G7Z F;  2CQN A;  3B6A A;  2BE5 F;  3JTG A;  2HKO A;  2E1N A;  1X3W B;  2RQQ A;  4M3G A;  3CF2 A;  3FXM A;  4A5M A;  2ZO4 A;  2HVQ A;  4JYK A;  2W4S A;  2VBX A;  2WBM A;  1FYK A;  2E1M C;  3HL2 A;  4JX6 A;  2R7U A;  2KLO A;  3PNV A;  4AM3 A;  2JZY A;  2H8R A;  1MJ9 A;  3SFZ A;  1WQ2 A;  2V1D A;  4WF2 A;  3CCL I;  4IRG A;  1U78 A;  3G4S I;  2Z9O A;  2A5Y B;  4J00 A;  1X1C A;  1G2H A;  1R9T J;  2EZK A;  4DQ2 A;  4A3E J;  1ZQ3 P;  3WHC A;  1X19 A;  2FOW A;  3BPV A;  2F4O B;  5H20 A;  3F8C A;  4U0W A;  1Z6R A;  2QSF X;  4NUB A;  4XOT A;  2QBY A;  2HVS A;  1W4M A;  4HQM A;  3K1M A;  4P96 A;  4A69 C;  2DOE A;  2CV2 A;  4B3A A;  1I39 A;  4OIP F;  3FXK A;  4BXX J;  2DMT A;  1KON A;  2JUG A;  1V5E A;  4QPO A;  1YJW I;  4Y7N J;  4G6D A;  4UHT A;  3P7N A;  3I0T A;  5K1Y A;  3M07 A;  4HLY A;  4BH9 A;  3CUO A;  3C3W A;  2H27 A;  3PJR A;  2RNG A;  3U1K A;  3BT9 A;  5IT3 A;  3V8L A;  1O3T A;  3QQA A;  1OYW A;  3PSF A;  3HOZ J;  1J0R A;  2M7A A;  3CLO A;  2M8G X;  1SMY F;  3HKZ A;  3PSI A;  1MMG A;  2FEZ A;  2TRT A;  2BXZ A;  3E0J B;  2LK2 A;  2ACJ A;  1Y39 A;  1Q1V A;  5HNF A;  4NQW B;  2W1O A;  3FIW A;  5ICE A;  2Y0S A;  4I76 A;  1CF7 B;  2HOT A;  4A3K J;  2HTS A;  2W00 A;  5KCM A;  4HYE A;  1KU7 A;  2CGP A;  2O9L A;  5E1W A;  4HNV A;  4A3G J;  2VXD A;  2R7T A;  1H88 C;  2IAI A;  2P6S A;  1YE9 A;  1YIO A;  4M3E A;  1FOX A;  4I0A A;  2WB1 A;  1EV7 A;  4M9S A;  3SZG A;  4ENJ A;  4Y17 A;  4RM2 A;  1QVU A;  3JAM Z;  4PUS A;  1QA6 A;  1WCM J;  2O5R A;  4KN4 X;  3V42 A;  2M4K A;  2IGM A;  3KZZ A;  4LD5 A;  2VJI A;  5IT9 Z;  1TLH B;  1YX5 A;  4M73 A;  2F5F A;  1B9M A;  2BY1 A;  2L0K A;  1AHD P;  1R00 A;  4XNF A;  2XIG A;  5AIP A;  1J09 A;  2FX0 A;  1WJC A;  5D6E A;  3TDZ C;  5GPC A;  2L2O A;  2VT3 A;  3I55 I;  2DA6 A;  1JGS A;  4A12 A;  3K4N A;  5J8C A;  3ZOB A;  4U0V A;  4C30 A;  4IHX A;  4MFE A;  3I54 A;  5L3B A;  2VQG A;  1VZ0 A;  2DDB A;  4PGG A;  3K70 D;  1U6G A;  4MLO A;  1IZ1 A;  2EPF A;  3HB9 A;  2FU4 A;  1FIA A;  1J59 A;  2ZXW H;  2L7M P;  2DTR A;  4QIW N;  1BJZ A;  5J3L A;  4BQO A;  5FKK A;  5JHU A;  3DKY A;  2JSC A;  2M9H A;  2LF7 A;  5ICC A;  2GXG A;  1QQI A;  3BJ6 A;  4R8H A;  3WOD F;  3TO6 A;  3EET A;  2R7R A;  2WAD A;  3K4M A;  4UVA A;  3S15 J;  4FCY A;  5CQE A;  3GTO J;  2XB0 X;  2EA2 A;  4BKX A;  2I5U A;  1QO0 D;  4ENN A;  3UNG C;  1ETQ A;  5B1A H;  3GXO A;  1ZG1 A;  1ZN2 A;  2K85 A;  3P5J A;  2OU2 A;  2VN2 A;  3HTS B;  2LP0 A;  2LDU A;  5H6Q A;  2OF7 A;  4BHP A;  2OC6 A;  4AIJ A;  1OIS A;  1XC5 A;  2CV0 A;  2MLK A;  1FTZ A;  3WTW C;  1RKT A;  4UVB A;  1USS A;  1Z67 A;  1UEL B;  2CYY A;  5FFX A;  1QBJ A;  3BQY A;  3WTS C;  1OCT C;  3SXY A;  1F5T A;  3GO5 A;  5DS9 A;  4XN3 A;  2QA4 I;  1ZG5 A;  2HDC A;  3HDD A;  4XSX F;  4NQW A;  2PMZ N;  4B47 A;  4Y33 A;  3ZP5 A;  1CF7 A;  4BXF A;  4BDZ A;  2VPR A;  2HKX A;  4C3I J;  5E3O A;  3FWE A;  1E2X A;  2X6Y A;  4GYG A;  3JTH A;  1XTA A;  3G1O A;  4V2F A;  1SVM A;  4ZZL A;  2MH2 A;  4JK1 X;  1B8I B;  1LEB A;  4A0X A;  2R7D A;  1GV2 A;  1KYZ A;  3W6J B;  4XKV A;  1JT6 A;  2L01 A;  1X4O A;  5D4R A;  1IN7 A;  4IPA A;  1VF9 A;  2DBB A;  5FLX Z;  4RM3 A;  1VQ8 I;  4I7H A;  3H1C A;  9ANT A;  2IS4 A;  1MNE A;  3TKY A;  1ZG3 A;  5D5V B;  1BJA A;  3P9C A;  5AIQ A;  2J5P A;  3WGH A;  3V7R A;  4ESB A;  4G6T B;  1N77 A;  3S2W A;  2ZSH B;  4EJT A;  1NH3 A;  5JVT A;  5CVU A;  4J01 A;  3NAR A;  3C2B A;  1JXS A;  4IOA F;  2VL8 A;  2KRC A;  4DOZ A;  5FRM A;  2JQ7 A;  2ZCW A;  2KJC A;  5DUK A;  4N4O B;  5HNH A;  1FY7 A;  5H6R A;  1WHU A;  2EFW A;  2D2W A;  1ETO A;  3FBI B;  3L2C A;  5M5W J;  2HYG D;  4FT8 A;  1MMN A;  3O8G A;  3EYI A;  1K4T A;  4IKF A;  2OCC H;  4MQV A;  3DU5 A;  1K61 A;  1MMA A;  3M8E A;  2GXA A;  1X1P A;  2F4M B;  5HLI A;  2QLZ A;  4HF2 A;  3RZO J;  3FMQ A;  3F8M A;  5GPA A;  3AG1 H;  3CME I;  2IPQ X;  2LD5 A;  3PO2 J;  1ZAO A;  2FNP A;  3QOP A;  2JSP A;  2P8T A;  4K2E A;  3WG9 A;  1HQC A;  1P7J A;  5LRS A;  5IYB J;  4EV0 A;  1NTC A;  1OLT A;  1TWC J;  2DT5 A;  2E2J J;  2KRH A;  4AD9 A;  5DUI A;  4YRV A;  3RQI A;  2V6E A;  1XMA A;  4HSR A;  2K3F A;  5ILU A;  1XN7 A;  2LYC A;  4OWR B;  1D0Z A;  1W1W E;  1MW7 A;  3OSF A;  4KT5 C;  3A02 A;  2EWN A;  2ESH A;  2L02 A;  1IRG A;  1ZH5 A;  3HIF A;  1HA8 A;  3BG3 A;  3GFI A;  1SAU A;  4HLX A;  3T1B A;  1APL C;  4IHS A;  2DPU A;  4WXH A;  3GFL A;  4E7Z A;  1SC7 A;  2V7F A;  2UWM A;  1WJB A;  3TO7 A;  1TL8 A;  3DEW A;  4JQF A;  1T56 A;  1MBK A;  2ME0 A;  5E8G A;  2BGC A;  3LSJ A;  3OL3 A;  3CDI A;  2DMU A;  5J4Y A;  5ILV A;  1X58 A;  3I64 A;  5JFR A;  4RB2 C;  1K6Y A;  4ZTF A;  4FHT A;  1I1G A;  3I59 B;  3SHF A;  1HOM A;  3QPS A;  1JT0 A;  4QLC U;  2BYV E;  5JI6 A;  5IYC J;  4XM3 A;  2R92 J;  1Z1D A;  3Q9S A;  4M3F A;  4D5F A;  1B8I A;  3FKI J;  3QU3 A;  1G3W A;  1XGS A;  1W7P D;  3UKG A;  2ZJP F;  3S32 A;  2DFE A;  3PFI A;  4L9V A;  1ENH A;  3BR6 A;  3WE2 A;  1XGN A;  2RKH A;  3R0J A;  3P9I A;  1D5Y A;  1TWF J;  5BMZ A;  2OUM A;  1MBF A;  3GTG J;  4U87 A;  1D0Y A;  1S3J A;  1IUY A;  3GZN B;  1J75 A;  1ZK8 A;  1UST A;  3Q5F A;  4AVP A;  4KIC A;  5LD2 C;  2NVT J;  4IX7 A;  2FOK A;  2LF8 A;  1DGW Y;  2R4G A;  1VQP I;  3TW6 A;  1QRY A;  3AG3 H;  5GAE J;  2ADU A;  3M1E A;  2MSY A;  4G12 A;  3H35 A;  2K9S A;  3QPH A;  2YX4 A;  1RNL A;  4KA4 A;  4RAY A;  1OQY A;  4UNO A;  4XRS G;  1PVE A;  3E7L A;  4NC6 A;  1ZR4 A;  2BXY A;  3O6B B;  2OQR A;  2JJ7 A;  5HDK A;  3CUQ B;  1A35 A;  2LRE A;  3F9K A;  3GTL J;  1SFX A;  4Q5S F;  1ACI A;  2D45 A;  3QRF F;  1GXP A;  3R0A A;  3ZQC A;  4EJO A;  3GZ5 A;  2VJ4 A;  3QOD A;  4BGD A;  1YI2 I;  3K4K A;  1FP2 A;  3BTJ A;  3DEU A;  2YSR A;  1JTY A;  1UAA A;  2XHK A;  2MD5 A;  2W84 A;  4HST A;  2P7C B;  3MMY B;  2EIN H;  2P4W A;  2F6C A;  3EUH C;  2M4G A;  4LB5 A;  1STZ A;  4HX8 A;  1PYV A;  1MBH A;  4EJV A;  4XRM A;  2E19 A;  2D5V A;  2Y30 A;  1WPK A;  1X1D A;  2W57 A;  2OAZ A;  2X51 A;  2R93 J;  3J7A Y;  2BY3 A;  4HAM A;  3OOU A;  2DJN A;  3LQR A;  4A3B J;  2BHY A;  4DZJ A;  3W2V A;  4EGZ A;  1IGN A;  1T8I A;  3BRO A;  4CCO A;  1REP C;  4MO7 A;  4Y15 A;  3HOU J;  5M5X J;  1ONV A;  2OD5 A;  3FXO A;  4RB1 A;  1AKH B;  2ELH A;  2WY7 Q;  3MVP A;  2EB7 A;  2KDZ A;  4CYC B;  1FSH A;  1X3Z B;  2O7O A;  1IRX A;  4XRF A;  3I4N J;  3FMR A;  3HZJ A;  3AL0 C;  1BOA A;  4XOP A;  2QGU A;  2M3A A;  2WC2 A;  2PMU A;  5C3E J;  3G1M A;  2HXI A;  2ZME B;  2F5E A;  4IZZ A;  4L9T A;  2CW7 A;  5C44 J;  3MZY A;  1G3Y A;  3F8N A;  1Z77 A;  2MD0 A;  3GTK J;  2AQE A;  1UB9 A;  4C3H J;  3SEZ A;  2A6H F;  2PMZ A;  2PMH A;  4E7K A;  3KYC B;  4I01 A;  4KMF A;  3K4J A;  1VND A;  2R7O A;  4CH7 A;  1VFC A;  4NB5 A;  4UUT A;  4JP0 A;  4XLF A;  1T08 B;  2P5V A;  3EUK L;  4JOM A;  3GZ6 A;  3CCU I;  3K4L A;  4DYR A;  3L1P A;  2B63 J;  1HXD A;  1XGM A;  3QP5 A;  4IL6 C;  3HKZ N;  5BNG A;  4BL0 B;  3HXL A;  1I27 A;  1YIT I;  2DA4 A;  1BN5 A;  3IH2 A;  3TP3 A;  3NQO A;  2JWT A;  1EH6 A;  4OAZ A;  4FE4 A;  3ZQQ A;  3ZN0 A;  1MNM C;  2DT7 B;  2K9M A;  4UV8 A;  2A07 F;  2Y0S N;  1J9I A;  2RAE A;  3JSP A;  5DM6 F;  3LNQ A;  1RUO A;  4X1E A;  4DJA A;  4A3C J;  4N9I A;  1U8B A;  4YFN F;  4Z2Y A;  5D5X B;  4F7Z A;  1FPQ A;  5IPA A;  1MZB A;  4UB8 C;  3CCY A;  3K4B A;  1Z3Y A;  3SYT A;  5CKT A;  5HOO A;  2EFO A;  3Q9V A;  4P9U A;  1JE8 A;  1AU7 A;  4XIC A;  1XDU A;  2K4J A;  2ZXI A;  1FSE A;  2L9N A;  2NS0 A;  2H1K A;  5L3F A;  1KU3 A;  5F08 A;  3CUQ A;  4ETS A;  1ORK A;  3AKZ A;  2ZNY A;  2LKS A;  2AS5 F;  1BI2 A;  2JA6 J;  2XVC A;  4B3X A;  1QGP A;  5LRR A;  4Q47 A;  3GFJ A;  3LSH A;  3JW4 A;  1ZKG A;  1GLN A;  3QWL A;  3DTE A;  5DDG A;  1B72 B;  2JVG A;  3C7J A;  4N9H A;  3JRA A;  3BG5 A;  3DKX A;  1VQN I;  5E1X A;  2VLA A;  1MSE C;  3HM5 A;  3RYR A;  2Z1D A;  1XCB A;  3GME A;  4Q48 A;  1W0T A;  4IXA A;  1DGR M;  5FGM A;  1Z21 A;  3LA7 A;  5B1B H;  2DFH A;  3H36 A;  2W7N A;  2EZI A;  1KGS A;  1GV5 A;  1AKH A;  1FWZ A;  1XMK A;  2MC3 A;  1IUF A;  1OCP A;  3MCZ A;  3PL8 A;  3HOV J;  2CW8 A;  3WHB A;  3OWT A;  1Z9C A;  2VJJ A;  4ENM A;  1RR7 A;  2DOD A;  4S05 A;  1LDD A;  1W36 C;  2XSD C;  4DIQ A;  2CS3 A;  2ZME A;  5FKL A;  2ICW G;  3FHZ A;  3K2A A;  3ZQI A;  2E5Z A;  2Z2S B;  2PQ8 A;  4G6Q A;  1OJL A;  4XR6 A;  1G8X A;  2IS2 A;  3EPZ A;  1VQ6 I;  2LLK A;  3BLY A;  3OV8 A;  2NS8 A;  1A6I A;  4A2U A;  4BBR J;  1D5V A;  3NWS A;  1Y56 A;  2FA5 A;  1WH7 A;  3CCJ I;  2UZK A;  1R5I D;  4MFD A;  1IJW C;  3F22 A;  2OQG A;  4ITV A;  5F27 A;  2KJB A;  4RB3 C;  2DW4 A;  1QNT A;  5AON A;  1WJE A;  3K0L A;  3ZMT A;  2HQN A;  4I98 B;  4HF1 A;  3RKW A;  1T39 A;  2IGN A;  1VQM I;  2CWE A;  2X85 A;  2FUG 2;  2M34 A;  1VQO I;  5DCF A;  2M30 A;  4IRH A;  1I3A A;  3V4G A;  1B59 A;  2FD5 A;  5EDN A;  4U7B A;  2IJL A;  3N05 A;  4N4N B;  2W25 A;  3SZP A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 1OCR H;  3AG3 H;  2EIM H;  2DYS H;  3AG1 H;  1V55 H;  2ZXW H;  1OCC H;  2Y69 H;  5B3S H;  3ABM H;  3X2Q H;  3WG7 H;  3ABK H;  1OCO H;  2EIN H;  2DYR H;  3ASO H;  2EIJ H;  3AG4 H;  2EIL H;  3ASN H;  2EIK H;  2OCC H;  3AG2 H;  1OCZ H;  5B1B H;  5IY5 H;  5B1A H;  1V54 H;  3ABL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...