3AG2H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag2H00
3AG2H 1OCOH 1V54H 3ABKH 3ABLH 5IY5H 3AG4H 2EIMH 2DYSH 2OCCH 3ABMH 3ASOH 5B1BH 2EIKH 1OCRH 1OCCH 5B1AH 2DYRH 1V55H 3X2QH 2EIJH 1OCZH 2EILH 2Y69H 3ASNH 3AG1H 2ZXWH 2EINH 3WG7H 5B3SH 3AG3H
chains in the Genus database with same CATH superfamily
4BQOA 1O3TA 3ZQQA 3N05A 1QZYA 3ABKH 1KU3A 3CMEI 1T33A 4B3XA 2WADA 2X0LA 3T8TA 1TP4A 2R7RA 2E5ZA 5FFXA 3QPTA 4WXCA 1P2FA 2E60A 2MD5A 4HX4A 5B1AH 2M3AA 3PFYA 4FTHA 4RM2A 2EJRA 2Y48A 3L00A 2A69F 2PJPA 5K7HA 2MD0A 1BIAA 2G7UA 2M4GA 2ZFWA 4H4KC 2EINH 1T6SA 2GOMA 2FF4A 4IHVA 3WGIA 4PGHA 4UHTA 1U78A 2NNNA 2HR3A 4BNCA 1N25A 4HBLA 1FLIA 4B43A 2WV1A 2PJRB 3QYFA 1ZRCA 4K2EA 3FKIJ 1Z6RA 5FKLA 2W1OA 1LUJB 4A3BJ 1YE9A 1R1TA 5ICCA 3CMAI 2MGQA 2K7LA 2LG4A 2M4KA 1HA8A 3BQZA 4FISA 1XMKA 4N9HA 3GTPJ 4LK1F 4KICA 2NS8A 4CZCA 1X19A 3QP5A 3FXQA 4F91B 1KYZA 4HEA2 1T2KA 2QQAA 2P5KA 4EM1A 3IH4A 1QGPA 2CSOA 2X51A 4S05A 3WU1B 1Q1HA 4GXOA 3KEOA 2JPCA 3VODA 1VQLI 4HQMA 2HDWA 3QPSA 3A03A 3MKWB 2L4AA 1QVUA 3HBLA 2CUZA 2QM3A 1EH6A 1MBJA 1ORKA 5A2QK 3CESA 5DD8A 1BI3A 1V5EA 1WGXA 5L3FA 1T8IA 2E7XA 1XMXA 2FNAA 3BG7A 1WHUA 3I4NJ 2VXZA 2PMHA 3HDDA 5JVGF 4U7DA 2K9NA 3ZQHA 3H9JA 2DA5A 2ZSHB 4RAGA 5JR3A 1U9NA 1BIBA 4EATA 3ZMUA 4E7ZA 4J00A 3OYKA 3DP7A 1AWCA 3CF2A 1MNMC 2HVQA 2CQXA 3TO6A 1BC8C 4Y13A 2RN7A 2HQ5A 3FXJA 1H0MA 5C3EJ 2VQHA 2B7EA 3MVPA 2DPDA 2BXYA 3L2WA 4R8HA 5IT3A 3Q0UA 2VE9A 3CCUI 2LY1A 3BR1A 1JKOC 3BTJA 3FXRA 1KGSA 2E71A 3WGGA 2GIVA 3CJQB 2H6CA 3F23A 2R5YA 4B4CA 4XORA 1AA7A 5M5XJ 3K6GA 1IXCA 2BBYA 2K9QA 4UB6C 2RREA 4HDUA 4QSHA 3FHNA 4PCQA 3KLNA 2GXGA 4M9XA 4BUPA 2Z5UA 4EM2A 3GVAA 2JA7J 5GP9A 1Y0NA 1BL0A 3QAHA 1ZGAA 5LHIA 2M9HA 3R60A 4HZFA 1LFUP 1YO5C 1MBKA 3PO3J 1ETWA 1ETOA 1UHSA 4CCKA 1MSFC 2A07F 1I6HJ 2M45A 3FMSA 4MO7A 3CC4I 2GAUA 5L3BA 2V9PA 3I54A 3J80K 3KP3A 3GTQJ 3HSFA 3UKGA 3I58A 5J8FA 1IW7F 3LSPA 1X1BA 1YJWI 3OYLA 3ZR8X 2HPMA 1SFUA 2XGXA 3CCQI 2VJJA 3BZCA 1KQ8A 3G2BA 1NTCA 2HZTA 3DPTA 3OIPA 2Z3YA 1DQUA 1WJDA 2ZXHA 3DU6A 4NDLA 4OOIA 3RKWA 2QEXI 4L0ZB 5EYRA 5LEJA 2HOAA 5KNLA 5E3OA 3MZHA 4Z2YA 3F9KA 4GCVA 1GVDA 4ITVA 4RGUA 3OR2C 4A6EA 2YR2A 1MDMA 2ISZA 2QUFA 2DT6A 2GXBA 3ZQGA 4NUBA 4YRVA 4RAYA 1VQNI 5EDNA 2PEXA 1JKQC 1RZ4A 2EZLA 1ZELA 3HRMA 3TOBA 5E8IA 4HF1A 1XG1A 3J7YJ 3CCVI 4XRSG 2YX7A 3MKYB 3W2WA 1JE8A 1S29A 3HIFA 5ICFA 2IXSA 1VQMI 5TISC 1FIPA 2W25A 3DF8A 1MH3A 4PDKA 2UXNA 3Q3SA 4L9VA 1WJBA 4HPQA 3OY9A 1TQMA 2NNYA 2FJ1A 5ILSA 5J4VA 2V7FA 3IRQA 2O9LA 4BH9A 2DMTA 4HOBA 3ZPLA 4BU2A 2R7DA 1K61A 1QQIA 5DM7F 5D6EA 3A2KA 4IF4A 5L3DA 1LB2A 3JRHA 1XB4A 5E1WA 5L3GA 1TTYA 4ABZA 2LNBA 1B9NA 2WC2A 3SDBA 4BE2A 3DEWA 1RPWA 3SEQA 3WE3A 5M5YJ 2E35A 3LAPA 1X1CA 3ABTA 1J2XA 4G9YA 4YFXF 1D0YA 5HDNA 2HOSA 4I2OA 3TDZC 1U3EM 1ETQA 4A93J 1RESA 2FMYA 2O0YA 3ELKA 3CC2I 1FTZA 4C3IJ 1P7IA 1XGOA 2P6SA 4H0EA 1XN7A 3QWLA 3WG7H 3TW6A 3LAJA 5L3EA 1UJ8A 2Z16A 1VQOI 1T0FA 4BAYA 4KIFA 2WWYA 2VKVA 4M72A 4I98B 4HQEA 1W36D 4WCGA 1F1ZA 1W0UA 1VQ7I 2W85A 4BEHA 3PQJA 2ME6A 4DNCA 3K4KA 3WU2C 1WFXA 1EJ9A 4KT5C 3TP0A 1P92A 1YJNI 2DA1A 2MSYA 1IN7A 4OIOF 2LBFB 1ZAOA 1K7AA 1QRYA 1BOAA 3A1YA 3OYMA 1PVEA 2R5ZB 3V7CA 3ZRGA 2KRFA 2BY0A 1OLTA 1JTXA 2G9WA 3VWBA 3IC7A 4WWCA 2MFZA 3K4BA 3CCMI 2AHQA 3CDIA 1MBHA 4GRIA 2QSGX 1MBFA 5ICGA 3VYRB 4KYWA 3BJOA 3D5RC 4LD5A 3FF5A 5JLXA 1LDDA 1ZRFA 2XASA 2LKXA 4I6ZA 2Z99A 2F5FA 4JQFA 1QA6A 2E2HJ 3CJTB 3IUOA 2FOKA 3AG3H 4CGZA 4OINF 3FWEA 1Y8QB 3I4PA 3LMMA 3JRGA 4KN4X 3SFIA 1Z3XA 3FXLA 2ZB9A 5DYMA 4UVCA 1ETKA 4YFKF 5J1UA 3NWSA 2XPUA 2VQCA 2Z9OA 1KZHA 4BE0A 1IGNA 2X1CA 1B8IB 3BR0A 2TDXA 2F4MB 2XDVA 4ANJA 3RYPA 1ZQ3P 2VE8A 3SHFA 4BS9A 3FISA 1OCZH 3OS2A 3G1LA 1ULYA 1W7PA 2XKOA 5FKMA 2DA7A 2ICWG 4UY8I 1BN5A 4IOAF 1UHWA 2COMA 3BCAA 4WXDA 1U5TB 1B72B 2OUMA 4MHGA 3A01B 2KQRA 1FNNA 4XRSA 1WZ2A 4M3EA 3CCEI 1FOXA 1N75A 1WQ2A 2DFHA 1IJWC 4DBQA 3I0TA 1WRJA 3TMOA 1KU2A 1CGPA 2VBZA 4MTDA 4I76A 4KT6A 4KJZA 4XMYA 4UXNA 3G73A 3KYLA 4MQ9F 5D5UB 3W2AA 3W6JB 3SEZA 5KHDA 4RGXA 2KHMA 2CFXA 2FNPA 3P9IA 2NS7A 4UUVA 2RQQA 2FSWA 1T56A 4AYBN 2DLLA 2EA4A 3L2QA 2D1HA 3GLLA 4KMFA 2QQBA 4JX4A 3DCFA 3IL2A 1JJ6C 3PIOF 2X6OA 4HNTA 1YTYA 4RAFA 1AKHB 1O57A 1ZG5A 3ESWB 3E7LA 1P7JA 2DMNA 1JUSA 2K9MA 2L9SA 2LY9A 2Y0MA 1ACIA 1SVLA 4HV6A 3CJRB 4EGYA 1BJZA 1ZG1A 2XGDA 4CDGA 2BW3B 5EG0B 3KP6A 4OAYA 4LLNA 2V26A 3T8RA 4F7ZA 1KU9A 3IWFA 5BS6A 3GCMA 2FQ3A 3TGNA 3T5XA 2VJ5A 3S3NA 1GT0C 2KRCA 2EFNA 2HQAA 3S2DJ 3GX4X 2IS6A 2VIXA 3DKWA 1YS7A 2B9SA 4XL9A 1DGWY 3RIRA 4EJWA 3FMQA 1MNEA 5B66C 4Y4RA 1IF1A 3WTTC 4G8XA 4NC7A 2KIMA 1LEBA 2Y0SA 4A0YA 4EMSA 3IH2A 1FWZA 2F4IA 4ENKA 3RQIA 3LWFA 3S3OA 1XCBA 1POGA 5IYBJ 1V5GA 4O5VA 4BQAA 2M30A 2CRGA 2DA3A 4IO9F 1LFBA 3BLYA 1MMGA 5FJ8J 1S8NA 3ML6A 4Y7NJ 1TWCJ 4IQJA 1B1BA 4LJZF 4OMZA 1J9IA 4XLHA 1V3FA 1ZGWA 3BOQA 1OYIA 3ZCOA 4EJUA 4QTRA 3GTGJ 3K1NA 4NC6A 4LG0B 1YOVB 3U1KA 2FA5A 2DU9A 4XR6A 5ED4A 2AQEA 1XGSA 2ELHA 4BDZA 3LNQA 1TLHB 5AIQA 1CF7A 2V1UA 1XDUA 4KA4A 1J09A 2HZDA 3MCZA 1Y6IA 4A6DA 1WI3A 1TWAJ 2RGVA 3KYDB 3TO9A 2IJLA 5EEHA 3HHHA 3S32A 3HGYA 3O6BB 3RPUA 2HKXA 4B44A 3LA7A 2VN2A 3D5SC 3FXUA 2Y69H 3E6CC 1ZHFA 2ELJA 2KRHA 1SD4A 1U0JA 2HI3A 3ZQFA 4PFOA 1S5LC 3HG9A 2EZIA 1ZREA 3I59A 1SFKA 2KMUA 3OOUA 3OYFA 1U6GA 3DLAA 2MA3A 4XKWA 2CS3A 2ESHA 2VQGA 2HEOA 3HGGA 1YHQI 1SANA 1HQCA 3JSOA 1PUFA 2EV6A 1FPQA 1FOYA 3BC8A 2JSCA 4NQWB 2VOOA 5F1RA 3ISPA 1SD7A 1BJAA 3Q5FA 2GXAA 2L3DA 4CYCB 1IO2A 2HQNA 2TRTA 2CUFA 2E7WA 1Y0UA 2JUGA 2VPRA 4DOZA 5LFAA 4PJMA 2ZJ2A 2K02A 1FIAA 1XGNA 4M74A 1YITI 3ABUA 2DFIA 4Z6YA 2DODA 1K78B 2XIGA 2M7BA 4N0BA 2VT2A 5E3MA 1RR8C 2BXZA 3RTRA 2HXIA 2L02A 1ZKGA 2DT5A 2A6EF 1H9GA 3HC7A 2JRTA 4LG3A 3MFKA 4G7OF 1R5HA 4KISA 4ZYGA 3GTLJ 3LQRA 2OU2A 1OKRA 3HHGA 5CVJA 1VQKI 2Y0SN 4ZYDA 1JI8A 3R0JA 4KITB 4KDPA 1S72I 1GXPA 2STWA 2PN6A 4UNOA 1USTA 2XGCA 9ANTA 1BW5A 1SMTA 4L9JA 3DPUA 3QYEA 4F3QA 3KLOA 2BHYA 1KA8A 1VFCA 5FFZA 4X0GA 4ESFA 3L2CA 3HL2A 4TV7A 1YIOA 1XC5A 2KIFA 1YYVA 2W82A 4D0PA 1KONA 4M9SA 1KQ9A 2E19A 4HNVA 5HLGA 2ZJQF 2O8KA 5LRSA 3I64A 3MKLA 3GZ5A 4CXFA 5HNHA 4P5OA 4GGGA 4IX7A 1OYYA 1S6LA 2DA6A 2MABA 4ENJA 1I39A 2P5VA 5CVUA 2XB0X 3PFIA 4D1QA 2RQPA 4BHPA 5TJJA 3OIOA 5FO5A 2WB1A 1X4PA 2JQ7A 5H2FC 5D5WB 5AONA 1Z3YA 3DWLE 4AVZA 4V2FA 2PMUA 3JRCA 3QPHA 1Y1VJ 4JX5A 3LSKA 1XSDA 3OSFA 4BBSJ 4ZTJA 2XAHA 3K9TA 5GPAA 2Y2ZA 3EETA 3K2AA 2V79A 3S93A 4C2TA 1U5TC 1UZCA 2WBMA 3BDDA 4UUSA 2E1MB 3OWTA 4RLQA 1OMIA 4ZZLA 3I53A 3EUHA 1J7KA 1TQIA 2DO7A 1F36A 1Z67A 2Q0OA 2LMDA 3N4MA 1BOBA 4EJTA 2STTA 1RNLA 4Y52J 5E1ZB 3ROUA 5FLXZ 4MGRA 2KDZA 4WXHA 2QGUA 2CFOA 4ZYAA 2MH9A 3H3ZA 3P7NA 4ZDPA 5C4JJ 3WGHA 5DS9A 1EA3A 2QWWA 4M71A 2JZYA 4AUXA 2E1NA 4XQFA 1LVKA 4JK1X 2IP2A 1HW2A 2HPIA 4ENNA 3IWZA 2VLAA 3GFIA 5CPRB 3FK6A 5FKKA 1OCPA 2J5OA 3BJAA 3LA2A 5IP7J 1J59A 1NG6A 3EUKL 2KDOA 3BR3A 5GTHC 5IY5H 4AVPA 4ENMA 2JK3A 1GXQA 2XRNA 1DU0A 1WJ5A 3H5NA 3BT9A 3FBNB 3HPHA 3HZJA 2F5CA 1X1AA 2BY3A 3E5UA 3V42A 1TT0A 5KAFC 2CH0A 4YG2F 3E0JB 2OJED 2A6HF 2HDCA 2CUJA 1MJBA 5JHUA 3H0DA 2XB5A 3RI4A 5HDKA 3HXLA 4HSRA 2NS0A 4XOPA 1VQ9I 3R4KA 1XPXA 2L9NA 4U88A 5DUKA 4XRFA 2QSFX 5KK1A 2LF8A 1IAWA 5HOOA 1ZYRF 5HDGA 3KE2A 3JRBA 2PJRA 3ZMDA 3VB2A 4IJAA 5IOZA 2EBIA 2RDPA 3S15J 2M0MA 3KP7A 1UB9A 2FOWA 2Y9ZA 3IRRA 2BOLA 1WJEA 2K9LA 3KEYA 4CCOA 1YX5A 3HRUA 5J1YA 4N9IA 2VASA 2EK5A 1GV5A 3SZPA 4HA8A 4W97A 2OTJI 3H1CA 4U0WA 3LOCA 1QHHD 2BGCA 2VB6A 4CYDA 1Z91A 4HDVA 4A3GJ 3GW2A 2VT3A 1V5FA 2VXDA 4E7JA 3MN2A 4D5FA 3F6VA 4QPQA 3CO7C 4MTEA 4HX8A 1G8XA 2L7ZA 4MQVA 5DCFA 1UFMA 3J7AO 3S1MJ 1BR2A 3WG9A 4CCMA 3S8PA 2OBPA 1IZ1A 3HJEA 5FB2A 3R61A 3LSIA 4BYYA 3ZQCA 2GWRA 1VQ6I 1JTYA 4DGWB 3PJRA 3J81K 1VI0A 1B4AA 4LFUA 3HUGA 3OYJA 2EV0A 4YELA 4J01A 4RLFA 3EPZA 1MDMB 4CZZA 4QIWN 2KZVA 3PUFA 1QPMA 2LP0A 3I55I 4ZH4F 3S1QJ 3RSNA 2ETHA 3DTKA 1PP8F 4XLFA 4O6JA 5TRDA 1ZN2A 2DFEA 2QQ9A 5CJ9A 2L7FP 2YSRA 4DZJA 3G71I 5F6FA 5HVQC 3SZGA 5J47A 3FMRA 2XAJA 4ESJA 3KCCA 4OIQF 2M7AA 5LHGA 3ZQLA 2ZO4A 2IGKA 4UUTA 5K1YA 3H5RA 5M5WJ 3E6DA 2W57A 4XM3A 5ICEA 1ZRDA 1FX7A 1R22A 3MD2A 4Y15A 3JAMK 3ZGKA 2VL8A 4L5EA 1IV8A 3TEDA 2F2EA 2P81A 1YX3A 4MNUA 4MLOA 2ZMEA 2JVGA 2QSHX 2K5CA 2PMZA 2ZJRF 3AL0B 1H8AC 1JUMA 1YJ9I 3F8CA 4XLPF 4G7ZF 2CW7A 2ZCWA 1OR7C 2JSPA 4BXFA 3DEUA 4ETSA 2FEZA 3U9GA 1RETA 2VBWA 1U9OA 1WI9A 4PJJA 3U2RA 3B02A 3CP8A 4RDUA 2ID3A 1W5CC 1A36A 1SAUA 3CLOA 2BE5F 3FX3A 4M6YA 4V19K 2IEKA 1APLC 2HDDA 4U87A 3L2VA 3BPXA 4ZDOA 3KP2A 4E70A 3GZNB 3GMEA 1IN4A 2GIZA 3GLXA 1Y56A 3DEEA 3DKYA 1FC3A 3HRTA 3GF2A 3OYEA 2LD5A 2XF7A 1TWHJ 3D0SA 4G94A 5JLWA 1FT9A 2E1OA 2W4SA 3CCJI 1UELB 5J3LA 1ETXA 1VZ0A 3G6EI 3CCYA 1P4XA 4XICA 2R92J 1R36A 3W6KB 5E79C 2ZXJA 2RVCA 1R58A 6PAXA 5JFRA 4LGWA 5K7FA 1RIOH 1WKMA 2PFBA 2VPLA 3CJNA 3GZ6A 5BMZA 2J5PA 4XKCA 2QF7A 3BROA 4P96A 2DXIA 3HSRA 4ESBA 5EF6A 1I3QJ 4Q48A 2OF7A 4BGDA 2DA4A 3VEPA 3BG9A 2CU7A 1XS9A 3OIQA 3BTLA 1TW3A 4IHSA 5GTIC 2F48A 1X3ZB 1R5GA 4KN7X 3JRIA 2D5VA 3S1NJ 4BY1J 2UXXA 3LSMA 4PZJA 1DP7P 3E6BA 1OCCH 1KQ0A 2ID6A 2M8EA 1NK3P 2F5DA 2DA2A 3BWGA 3HOSA 1I6XA 4FHTA 4HV5A 2OQRA 3SJMA 2EIJH 1QO0D 1YW9A 2FD5A 1T39A 4PJ0C 3F72A 2MG4A 4M3FA 3BZKA 2VQLA 2LVSA 4Y3OA 4G6QA 1HW1A 3WHBA 3KZYA 2G7HA 2E1MC 4ZYEA 2L54A 3ZMZA 4L18B 1V4RA 5HNFA 3JRAA 1CQTA 1ON2A 3HOUJ 3E5QA 2VONA 1ODDA 3CF5F 1K6OA 5BOXA 2HFHA 2LY2A 3ZN0A 2HTSA 4AD9A 2E34A 3S17J 3C2GA 3K1MA 1IUYA 4C2MJ 1SEUA 5DUIA 2CJJA 2XAGA 1YFHA 3M8FA 2QVOA 2LH9A 4NBQA 5TGTA 1KU7A 2WY8Q 2L2OA 5E20A 1P9QC 1W7PB 3NQOA 1HKSA 2P7VB 1D8JA 3BTCA 1VQ4I 4DYRA 5IT9K 2BVLA 1TW2A 3BG6A 3H9QA 1FYMA 1OYWA 3SYTA 3MKZA 1JGGA 4YIIA 2V9VA 1QZEA 4IVNA 3OV8A 1Z77A 1XCVA 5A2QZ 5BPDA 3COAC 4I0AA 3CTAA 4RGSA 2OCEA 1IDZA 2Z33A 4U7BA 3JSPA 3PNVA 3CMMA 2EIKH 2QBYA 1SD6A 2O3FA 3WTZA 1TWFJ 3VSLA 2ZNZA 2DW4A 4RB2C 4A12A 1A31A 4A3KJ 1W5TA 2KJBA 1IUFA 1UMQA 1FZPB 1Z7UA 1FP2A 4IL6C 5GADJ 2OD5A 2IA2A 2M34A 2NOGA 3TQNA 5ILVA 2R5ZA 1IV6A 3CUQA 4PSWA 4A3FJ 1R7JA 2EPFA 4WF2A 5J40A 3QRFF 1MMDA 2ZFUA 4FE7A 3S3MA 5CVIA 4FQGA 1NG7A 2PLYA 4XN3A 2FU4A 2K4BA 1EV7A 1H9TA 3OYAA 5KAIC 1E3OC 1X1DA 3ECHA 3M07A 1DGRM 2K4JA 3BR5A 2NOJB 4M73A 5CQGA 4U0YA 2I8DA 3R6SA 3OR1C 1FTTA 4DW6A 5DCMB 5LRRA 2LK2A 2WAQA 4A3LJ 2IA1A 2P4WA 3EUAA 4A69C 3OYIA 2XUBA 4E7IA 3FHZA 5FKNA 3L9FA 3Q9VA 1G2HA 1D3YA 2VC0A 3L7WA 1IG7A 1TBXA 2RKHA 3QPLA 3IKTA 4II3A 2O6GE 1AU7A 3KPHA 2QCOA 3AFHA 2RAEA 5KCMA 5K5OA 3MAJA 1HC8A 3DBLB 3J80Z 2PQ8A 3K4CA 2MYSA 1UG0A 4RM3A 4JP0A 2A6TA 2R7WA 3BP8A 1MJ9A 2K86A 3A4CA 4GO1A 3UNGC 1HDDC 1R23A 4IQ4A 5D4SA 1RR7A 1S7OA 4BKXA 2HXOA 1U5TA 4I0BA 1B72A 3ZMSA 4BE1A 3HKZA 3CD6I 3ZXSA 4ASNA 4BXXJ 1Z9CA 4V2GA 1FBQA 2CG4A 1ERDA 1MBEA 1D0XA 4LIUA 4PJLA 3WTYC 2ESNA 3BQYA 3QP6A 4M3BA 5LGTA 4LIVA 2JA2A 1SVOA 2XPVA 4D9JA 1FYLA 3ASNH 4FCYA 1K6YA 3FKJA 2W84A 4AIJA 5L3CA 2NVUB 2AS5F 4U0VA 3QQAA 4S04A 2QKLB 1P4WA 2CO5A 3DXJF 2XROA 2H8RA 2H6BA 2R4GA 4C2UA 3DBRB 3H35A 1R9TJ 4N4NB 1C0WA 2E36A 4BXUA 4BBRJ 2NVTJ 3BY6A 2OC6A 3K70C 1Z21A 2DYRH 3TW7A 1ZK8A 1HF0A 3V8LA 1WCMJ 3H9GA 1FMVA 4GFBA 1HKTA 2VKDA 1E17A 2JA5J 2GA2A 4BACA 3A0BC 1JHHA 2VI6A 3AG1H 1LJ9A 4I99C 3F21A 3H3UA 3ZMTA 3NAUA 1LE8B 1REPC 2IPQX 4RB1A 1IN8A 2KFDA 4KIGA 3W6VA 1OCTC 3IAS2 2H09A 3AL0C 2PG4A 3GTJJ 2EIMH 2OCCH 4EEFG 2B63J 4A3DJ 1MJAA 2GBYA 5FGMA 4RB3C 1PUFB 1G4DA 1HCRA 1MIJA 1I5ZA 4IRGA 3K4MA 2HGCA 2JJ7A 2N8GA 1ZR4A 4L9TA 1K4SA 2YPRA 2JTVA 2XF5A 1Z1DA 4Y33A 4HG2A 1TT5B 2QQ8A 2EA2A 4B09A 2M8GX 1GHCA 1D1AA 5F27A 4YFNF 3CO6C 5F04A 4FASD 2DI3A 2E2JJ 2YX4A 4D7NA 1R49A 3O8HA 5JI6A 1J5YA 1G3YA 3RKYA 3B6AA 1T0FC 2Q2EA 2Z1DA 4QLCU 2LTPA 4RMNA 2O7OA 1HSJA 2CMPA 5HS9A 3IP4B 5BPIA 3PM1A 2A3SA 3O8GA 2JA6J 3DTIA 4L9NA 3K0LA 4F52A 1R00A 2XPWA 3C2HA 2DMUA 3BG5A 2KZGA 3SFZA 3GTOJ 4OIRF 3S1RJ 3HTUA 5LHHA 3LSTA 1Q1VA 4XNFA 2JN6A 1I3AA 1L3LA 2JA8J 3JW4A 1XD7A 1R1VA 3I3LA 3P9CA 3KIOA 3WTWC 1IC8A 4IRIA 1GDTA 3VYTB 5J4YA 3F8MA 2AXLA 3I71A 3CQZJ 1SMYF 4ZDLA 3EQLF 2EFQA 2FRHA 3AG4H 2KL4A 1YRNB 3M9AA 4BJTA 2Y30A 1IXRC 1BC7C 3Q0WA 2CW8A 1TZLA 1MD0A 1GVJA 3X2QH 1PYVA 3NARA 3G1OA 1UCRA 4JOMA 4IOCF 3WE2A 3GBGA 3V4GA 5FRNA 1X3UA 1QVTA 4LLGF 3F22A 3C2BA 1UHMA 2KT0A 3GFLA 4WX9A 4GDFA 1D0ZA 2YU9J 3I4MJ 3J7AY 2ZNYA 4HF0A 2FBKA 1YG2A 1MH4A 1SC7A 2L01A 2L7MP 3TL4X 2Z2SB 4BDYA 3F6OA 4XLAA 4AC0A 4EQQA 4ZJZA 1ENHA 2JT1A 2VC1A 2A61A 1B59A 5CYVA 4DIQA 2UWMA 3M1EA 5CKTA 4IHXA 4HW0A 2FBHA 2HVSA 4CYCA 3RZOJ 2HYGD 3J7ZI 2IAIA 1PJRA 4B47A 3CLQA 2R7QA 4IXAA 3TO7A 4UUSB 3M7GA 4KNYA 4XLCA 3KP4A 4X1EA 2L4MA 2NRAC 4FX0A 1IN5A 4P55A 5IP6A 1K78A 4CH7A 1LKXA 3D5LA 3BR6A 1RC9A 2A05A 2FXAA 3U1DA 5HODA 3ERMA 2XSJC 3WTVC 1UAAA 1HLVA 3WHCA 4F92B 3GXOA 4E7HA 2HS5A 4UV8A 2M2EA 4P1WA 3GEZA 1E3PA 2CV2A 5KVRA 4R1HA 1LFPA 2OZUA 4Y17A 5H6RA 3S16J 1HKQA 3LSGA 2HOEA 3W3CA 3GTMJ 2LF7A 3UR3C 1FBSA 5GAHJ 2OA4A 3CCRI 5EGOA 4XN0A 2V1XA 4E7KA 3R0AA 3OL4A 4IHYA 2D45A 1D1BA 1JKPC 1TL8A 4G7HF 1XSVA 4EGZA 4UV9A 1FP1D 1W5SA 5DV5A 4MEXF 2UUZA 2DOEA 2FBIA 2IBDA 2LREA 1WJAA 3OYBA 2P7CB 5E17F 1RKTA 3REOA 2P5LC 5LD2C 1D5VA 4XSZF 3DU5A 3ECOA 5J8CA 4XRMA 2DCEA 3JR9A 1G6NA 3IKVA 1USSA 1I1SA 2XAQA 2DMPA 2QZ8A 2DTZA 2X48A 4CSWA 3T1BA 2CWEA 3B6CA 2ZBKA 2R7VA 2OQGA 3BG3A 5CVRA 4IHTA 5CLSA 4OWRB 1FJLA 3OS1A 3QOEA 3IAM2 4XKBA 4FX4A 2XHKA 4UB8C 4BQQA 1PDNC 5FRMA 1BI0A 3FM3A 1J75A 3GFMA 1MKMA 2NVXJ 2HWVA 2ZKZA 1AHDP 2L9VA 4HSTA 3SDGA 3EYIA 1O3SA 4CO8A 4EVIA 2AQFA 3FXMA 1FBUA 4A3CJ 3PO2J 3DPLC 3GO5A 4XK4A 2P8TA 2FE3A 2DMQA 3E1SA 4L5IA 1MGTA 3QU6A 1ZLKA 2DK8A 5BQTA 4OMYA 1ZH5A 4M3GA 3H5AA 1RUNA 1MBGA 1SFOJ 2PBIA 2AXTC 2R5YB 1DUXC 3B73A 2DQLA 1KYWA 3JRFA 2DYSH 4YEJA 1IRXA 1FY7A 3OYDA 2LR8A 3RKXA 2Y9YA 4YIFA 1TQPA 2BY1A 4KUMA 4HRIA 2W48A 3LFUA 4ZC3A 3FM5A 5GAEJ 3CZ6A 2JVHA 3QOPA 3H0GJ 2XGEA 2XKPA 3HUGB 2VBXA 4B3AA 4D5CA 4XOTA 2KP6A 3VDXA 4E4HA 3A02A 1Y1WJ 2A5YB 1XTAA 3M8EA 2WB1N 1VQ5I 1EF4A 3HRSA 3GYHX 3K70D 3SQNA 4D7MA 5IYDJ 4AWXB 4X6AJ 1YI2I 3CDLA 4XONA 2DJNA 2E5NA 2F5VA 3I5UA 2EQRA 2EILH 1FEXA 5DEQA 3C3WA 2IRFG 1A35A 5DDGA 1BI2A 1WWXA 5M3FJ 3GFJA 3LFKA 5E8GA 1EKEA 2IS1A 2IGMA 3NRVA 1F9NA 1VF9A 3KETA 1LVAA 4Q5SF 4OIPF 1JXSA 3G1MA 3H92A 4DZPA 5LGUA 2KLOA 4BJ6C 1F5TA 5HS8A 3LSHA 4JX6A 3RCOA 2CQNA 2DAOA 3S14J 4LB6B 2HNHA 4IEJA 3VFZA 3RZDJ 1R5ID 1QU3A 1K83J 2HKOA 1Z7LA 1ONVA 5DD4A 2VJ4A 2X4HA 4DQ2A 2R7FA 2ZMEB 5DTDA 3RQ4A 3L2UA 1BBYA 5IPAA 4P9FA 1IXSB 1IRZA 3HYIA 2ZJPF 1E0EA 2OPTA 2WTEA 1RI7A 1YLFA 2L7KA 3L2RA 3CCSI 2V9KA 5E1XA 2GM4A 3VOEA 3MQ0A 3KFWX 4PUSA 1OFCX 2F4OB 2MC4A 2FQ4A 4M3DA 4WK8F 1VQPI 3U21A 3PUBA 1K4TA 3BZ6A 1XX5A 3WTUC 3K2ZA 1IRGA 4Q4ZF 4A5NA 4IZZA 5H20A 1N77A 3RDIA 2QKMB 5D4RA 5CQEA 4DJAA 1GV2A 4IHWA 4EJOA 4RS8A 1B9MA 3KX2A 1W0TA 4CICA 1BI1A 5BNGA 1XSXA 1FOKA 2D2WA 4NC8A 4A0XA 1SFEA 2FUG2 5D6FA 1HSTA 2GA1A 2CGPA 1HXDA 2DQRA 4DYCA 5FD5A 2F5EA 4AM3A 1VTNC 4ON0A 4BJ5C 2ME0A 1Y39A 2HU9A 5FROA 2CQ7A 2C6YA 4XIDA 2I5UA 4CHUA 5E3LA 2HYJA 3AKZA 3HOVJ 5J1RA 1AOYA 4FETA 4QPOA 2X6WA 1RKWA 2JWTA 1OCOH 2COBA 2WV0A 3W2VA 1WH7A 2ZXIA 1G59A 2G0EA 3HOWJ 3LSJA 4BEHB 4S0HB 1YW8A 2NYXA 2JPBA 1S7AA 4II2A 1MMSA 3A0HC 1F43A 1ZR2A 3ONQA 1A6IA 1PUEE 1WJCA 1MMAA 3TP3A 2DDAA 3C18A 5IOYA 2HOTA 3K4NA 2M5WA 4QWQA 4LMYA 4JBAA 1B6AA 2YU3A 4I7HA 1WSUA 4PGGA 4E7LA 1S9HA 4RGRA 2ZXWH 3WTXC 3GWZA 1LPQA 3EUHC 4ZYHA 3OYHA 3ZN1A 2E1CA 1JUPA 5FD6A 2RC4A 4G12A 2HYFA 1W7PD 3K69A 4HLXA 2OV7A 2EV5A 3AG2H 2OTLI 4A3MJ 3TBIA 4A5MA 2CW0F 3TOAA 5D8KB 3RYRA 4EM0B 1R1UA 2EZHA 2H1LA 1X2NA 3N97A 3IH3A 3NEUA 5GAGJ 1TNSA 2DK5A 5E18F 1H89C 1D5YA 4L5JA 1OCRH 1YS6A 2BEOA 2O5RA 4G6DA 2E2IJ 2CQKA 3FBIB 4B8XA 3HOXJ 1WPKA 1GLNA 4AYBA 1JKRC 3K10A 2VBYA 2F6CA 2GZWA 3CUOA 4NB5A 1MSEC 3MWMA 1OISA 2LDUA 3HOYJ 2XAFA 2HTJA 3ZP5A 3LA3A 4XLNF 3VYSB 3EDPA 4IKFA 1QHGA 2A5WA 2R3SA 1WJFA 1U2WA 3L1PA 2JUCA 2MC3A 2LKSA 1OJLA 2ELKA 2QBYB 3SXYA 4RA2A 5F1JA 3IHUA 1ON1A 2XAUA 1YIJI 2EFPA 4N4OB 2EH3A 2ECCA 1Y8RB 3HOTA 4BQNA 3LSRA 2XRLA 1A6QA 2EFOA 2X1DA 3H3VK 1ITYA 2O03A 3BJ6A 3F8FA 3M3YJ 4YIRX 2R7OA 3E5XA 3MEXA 3HM5A 2EWNA 2LYCA 2KIUA 3HTSB 3CUQB 2DT7B 3FIWA 2H27A 4BY7J 1TNTA 4F93B 2IA0A 2K3PA 3QYBA 4I09A 2OZ6A 3F3XA 1P4AA 1LDJA 4XBFA 3BTIA 1W4MA 1R6RA 2KPMA 2GLOA 2IS4A 4MEYF 1L0OC 2LC2A 1LQ1A 2BHZA 2PMZN 2CV0A 2IGOA 1EH7A 2PX9A 4G6TB 1O3QA 1G3TA 4O3MA 3FDYA 2K40A 2RNJA 5D8LB 4LK0F 5IYCJ 1U8RA 4LB5A 2LBFA 5C4XJ 1JGSA 1E3HA 1FSEA 3JCUC 2NXNB 2V1DA 3O2PE 2H1KA 2W00A 3K4LA 1T98A 5M3MJ 3K7AJ 4KMUX 3KEQA 1RUOA 4PJNA 2WA0A 5GPCA 3E3VA 4NNJA 1BR1A 4PSXA 5HLIA 4CA0A 1A5JA 2P0WA 2X85A 1MNDA 2HQRA 3RKQA 1J0RA 5JVTA 4C30A 5H6QA 5FLVA 3WU0A 2NAZA 1ZTRA 3OOPA 5F64A 2TCTA 3ZOBA 2KKOA 5DM6F 2DFFA 1R71A 2BYVE 4Q47A 4L0YB 3OL3A 2LOOA 3LL7A 4E6KG 3WODF 2QA4I 4EJVA 1JJ8C 2Y75A 1HBXG 5EZGA 1JHFA 2Q1ZB 4B1RA 3OYCA 1I27A 3WTSC 1Z6TA 1O4XA 4BHBA 3V8KA 4UVBA 2X6YA 3FXKA 3ABMH 4I01A 4HAMA 3CMYA 2LRDA 1A04A 3ZQ7A 2IS2A 3QODA 3OYGA 4HX7A 2XV4S 4ZZDA 1B8IA 3Q0VA 1VQ8I 4IPAA 3J81Z 3HSEA 2DDBA 1DP3A 3PIPF 3RPUD 1X3WB 1QBJA 1W1WE 4J19A 5IP9J 2BY2A 1QPIA 3ZQIA 1GUUA 1ZGJA 2R7ZJ 1S3JA 4BHCA 1UG2A 4HYEA 3ABLH 4XKVA 4M9ZA 4HLYA 5EZHA 3S2WA 5D5XB 4ZTFA 1HDPA 2M87A 1XDSA 3K4JA 3PNYA 4C3HJ 1LNWA 3A01A 2NVYJ 3MZYA 2V6CA 2AO9A 3M4OJ 2HVRA 5FLXK 5HLHA 3CC7I 4KIBA 1Z05A 3E6MA 2WAFA 5FKOA 2FX0A 2QLZA 3E97A 4F55A 5JHFA 1FOWA 3TDUC 2Y31A 2MLGA 1X1PA 4FE4A 5ILUA 3I9V2 5EEAA 2EFWA 2GOXB 1Z0XA 3BR2A 2BZTA 5B3SH 3DFGA 4XLEA 5FLMJ 3JAMZ 2ZMEC 1E2XA 1CF7B 3CDHA 1M1EB 1V54H 2V4JC 5DCMA 3VYUB 3ULQB 4CCNA 1MMNA 1IRFA 2KIQA 2DOFA 5F0HA 2R7TA 2X9DA 3VPRA 5E3NA 1I50J 2H94A 4CCLA 2L5QA 1AKHA 2B0LA 1ETVA 2MW8A 3EYYA 1N78A 1ETYA 3HOZJ 2XC7A 1TC3C 2A68F 1RRJA 3PQKA 2VUMJ 1G3SA 2NVQJ 3GUDA 2BW3A 4GYIA 5K5RA 5EG0A 3TKYA 2Q2EB 2DPUA 5C44J 2JRMA 3I59B 1YQAA 2LFBA 3H36A 2DOAA 5F08A 3FZVA 1U8BA 1DPRA 3O3KA 3KZIC 2XF6A 4AIDA 1F4KA 1HOMA 5AIPA 1D1CA 4RB0A 4A3EJ 3OS0A 2O61A 2K85A 2VKEA 1NK2P 3K1PA 3OSGA 2JMWA 4OAZA 5J6XA 1ZARA 4A3IJ 1OPCA 2OAZA 1FYKA 2PI0A 2ZC2A 2M1BA 3DBHB 2ISYA 2K9SA 3ERED 2VJIA 3QU3A 1R4MB 2YUSA 1ZLJA 4PFPA 2ACJA 2XSDC 1LEAA 4E7SA 2EB7A 1ZG3A 2V6EA 3LQQA 3KYCB 2WY7Q 4DBRA 4JYKA 5B1BH 1T38A 1DDNA 3VSKA 1JT0A 3C7JA 2VODA 2D1VA 3OYNA 4A3JJ 2X6XA 4MFDA 2WAQN 4P9UA 1SAXA 1JT6A 3PSIA 3KZZA 3OMYA 1G3WA 5K7ZA 3S2HJ 1BA5A 1DU6A 1SVMA 2Q8KA 3BPVA 3DKXA 2RV8A 4I02A 1XMAA 1LE8A 2ADUA 4UVAA 4LG0A 1BM9A 5K5QA 2ZSIB 3M1CA 4EV0A 2R7XA 1OQYA 3C1DA 2I10A 1O3RA 3JTGA 2CV1A 1R4NB 3D1NI 5B5EC 2R7UA 2VOPA 5CVVA 1T08B 2LSOA 3MMYB 4A2UA 4R79A 4AIHA 2UZKA 1SD5A 4IRHA 2IVMA 1T95A 2W7NA 3F8BA 1NH3A 1K79A 2KISA 1DPUA 2WAEA 4CCJA 2IW5A 3HKZN 5EJCA 3V7RA 4CUGA 4HNUA 3DV8A 2R93J 2FMLA 1X4OA 4OU0A 3F8NA 4MIMA 1LDKB 3I56I 3JREA 1IDYA 1H88C 4B48A 3L09A 1S7EA 2IT0A 2BV6A 1P6RA 4LITA 3PNTA 2YS9A 2P6TA 5IT9Z 2KJCA 2L9RA 3RPQA 3HB9A 4C9YA 5F0CA 3V8JA 4XSXF 1V55H 1QNTA 2QYOA 5LEKA 3CP2A 4FT8A 3PL8A 2GQQA 2CQQA 2DBBA 2UV1A 1O7LA 3SZTA 2K3FA 5ERIA 2W24A 2XVCA 4GYGA 4HF2A 2VKHA 3Q9SA 4NQWA 1STZA 2IGNA 2R0QC 4C3JJ 5HS7A 1WVRA 2M0CA 4LLLA 1NHAA 4RBOA 1EH8A 3JTHA 1MW7A 2EZKA 3CUQC 3JRDA 1XGMA 2LLKA 1PP7U 3T0YA 2BVMA 3ASOH 3NWTA 3ZMVA 2ECBA 3P9KA 1YRNA 1D8KA 3G3ZA 2H8WA 5EGOB 1X58A 3FXOA 3M8JA 4RAZA 1FSHA 1SFXA 5LBQA 1QZZA 2LKPA 4W1UA 2X1EA 1HW5A 1X2MA 2MBFA 2DTRA 3MZ8A 5LGNA 3P5JA 2QENA 4LOCA 4M6VA 3GTKJ 2DN0A 3FK7A 1OR7A 3DQVC 1WH5A 4M6XA 4A0ZA 4AIKA 5F0FA 4BL0B 4KFCA 4NHJA 3G4SI 3DTEA 1W36C 1MZBA 1IN6A 1YW7A 2O8XA 3BCBA 3DLLF 1O7FA 5EEGA 4DYQA 5HLTA 1BR4A 5LLQA 3KP5A 4MFEA 2R7SA 1FMWA 3PSFA 3V7SA 1TWGJ 2CUEA 2CYYA 1I1GA 3CCLI 2V1NA 3AAFA 2L0KA 4AU7A 2MH2A 2K27A 3IV5A 4PK4A 3RJPA 1VNDA 5D5VB 3HEFA 2RNGA 2DJIA 1BW6A 3HPGA 2MLKA 3F0CA
chains in the Genus database with same CATH topology
3AG2H 1OCOH 1V54H 3ABKH 3ABLH 5IY5H 3AG4H 2EIMH 2DYSH 2OCCH 3ABMH 3ASOH 5B1BH 2EIKH 1OCRH 1OCCH 5B1AH 2DYRH 1V55H 3X2QH 2EIJH 1OCZH 2EILH 2Y69H 3ASNH 3AG1H 2ZXWH 2EINH 3WG7H 5B3SH 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 H;  1OCO H;  1V54 H;  3ABK H;  3ABL H;  5IY5 H;  3AG4 H;  2EIM H;  2DYS H;  2OCC H;  3ABM H;  3ASO H;  5B1B H;  2EIK H;  1OCR H;  1OCC H;  5B1A H;  2DYR H;  1V55 H;  3X2Q H;  2EIJ H;  1OCZ H;  2EIL H;  2Y69 H;  3ASN H;  3AG1 H;  2ZXW H;  2EIN H;  3WG7 H;  5B3S H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 4BQO A;  1O3T A;  3ZQQ A;  3N05 A;  1QZY A;  3ABK H;  1KU3 A;  3CME I;  1T33 A;  4B3X A;  2WAD A;  2X0L A;  3T8T A;  1TP4 A;  2R7R A;  2E5Z A;  5FFX A;  3QPT A;  4WXC A;  1P2F A;  2E60 A;  2MD5 A;  4HX4 A;  5B1A H;  2M3A A;  3PFY A;  4FTH A;  4RM2 A;  2EJR A;  2Y48 A;  3L00 A;  2A69 F;  2PJP A;  5K7H A;  2MD0 A;  1BIA A;  2G7U A;  2M4G A;  2ZFW A;  4H4K C;  2EIN H;  1T6S A;  2GOM A;  2FF4 A;  4IHV A;  3WGI A;  4PGH A;  4UHT A;  1U78 A;  2NNN A;  2HR3 A;  4BNC A;  1N25 A;  4HBL A;  1FLI A;  4B43 A;  2WV1 A;  2PJR B;  3QYF A;  1ZRC A;  4K2E A;  3FKI J;  1Z6R A;  5FKL A;  2W1O A;  1LUJ B;  4A3B J;  1YE9 A;  1R1T A;  5ICC A;  3CMA I;  2MGQ A;  2K7L A;  2LG4 A;  2M4K A;  1HA8 A;  3BQZ A;  4FIS A;  1XMK A;  4N9H A;  3GTP J;  4LK1 F;  4KIC A;  2NS8 A;  4CZC A;  1X19 A;  3QP5 A;  3FXQ A;  4F91 B;  1KYZ A;  4HEA 2;  1T2K A;  2QQA A;  2P5K A;  4EM1 A;  3IH4 A;  1QGP A;  2CSO A;  2X51 A;  4S05 A;  3WU1 B;  1Q1H A;  4GXO A;  3KEO A;  2JPC A;  3VOD A;  1VQL I;  4HQM A;  2HDW A;  3QPS A;  3A03 A;  3MKW B;  2L4A A;  1QVU A;  3HBL A;  2CUZ A;  2QM3 A;  1EH6 A;  1MBJ A;  1ORK A;  5A2Q K;  3CES A;  5DD8 A;  1BI3 A;  1V5E A;  1WGX A;  5L3F A;  1T8I A;  2E7X A;  1XMX A;  2FNA A;  3BG7 A;  1WHU A;  3I4N J;  2VXZ A;  2PMH A;  3HDD A;  5JVG F;  4U7D A;  2K9N A;  3ZQH A;  3H9J A;  2DA5 A;  2ZSH B;  4RAG A;  5JR3 A;  1U9N A;  1BIB A;  4EAT A;  3ZMU A;  4E7Z A;  4J00 A;  3OYK A;  3DP7 A;  1AWC A;  3CF2 A;  1MNM C;  2HVQ A;  2CQX A;  3TO6 A;  1BC8 C;  4Y13 A;  2RN7 A;  2HQ5 A;  3FXJ A;  1H0M A;  5C3E J;  2VQH A;  2B7E A;  3MVP A;  2DPD A;  2BXY A;  3L2W A;  4R8H A;  5IT3 A;  3Q0U A;  2VE9 A;  3CCU I;  2LY1 A;  3BR1 A;  1JKO C;  3BTJ A;  3FXR A;  1KGS A;  2E71 A;  3WGG A;  2GIV A;  3CJQ B;  2H6C A;  3F23 A;  2R5Y A;  4B4C A;  4XOR A;  1AA7 A;  5M5X J;  3K6G A;  1IXC A;  2BBY A;  2K9Q A;  4UB6 C;  2RRE A;  4HDU A;  4QSH A;  3FHN A;  4PCQ A;  3KLN A;  2GXG A;  4M9X A;  4BUP A;  2Z5U A;  4EM2 A;  3GVA A;  2JA7 J;  5GP9 A;  1Y0N A;  1BL0 A;  3QAH A;  1ZGA A;  5LHI A;  2M9H A;  3R60 A;  4HZF A;  1LFU P;  1YO5 C;  1MBK A;  3PO3 J;  1ETW A;  1ETO A;  1UHS A;  4CCK A;  1MSF C;  2A07 F;  1I6H J;  2M45 A;  3FMS A;  4MO7 A;  3CC4 I;  2GAU A;  5L3B A;  2V9P A;  3I54 A;  3J80 K;  3KP3 A;  3GTQ J;  3HSF A;  3UKG A;  3I58 A;  5J8F A;  1IW7 F;  3LSP A;  1X1B A;  1YJW I;  3OYL A;  3ZR8 X;  2HPM A;  1SFU A;  2XGX A;  3CCQ I;  2VJJ A;  3BZC A;  1KQ8 A;  3G2B A;  1NTC A;  2HZT A;  3DPT A;  3OIP A;  2Z3Y A;  1DQU A;  1WJD A;  2ZXH A;  3DU6 A;  4NDL A;  4OOI A;  3RKW A;  2QEX I;  4L0Z B;  5EYR A;  5LEJ A;  2HOA A;  5KNL A;  5E3O A;  3MZH A;  4Z2Y A;  3F9K A;  4GCV A;  1GVD A;  4ITV A;  4RGU A;  3OR2 C;  4A6E A;  2YR2 A;  1MDM A;  2ISZ A;  2QUF A;  2DT6 A;  2GXB A;  3ZQG A;  4NUB A;  4YRV A;  4RAY A;  1VQN I;  5EDN A;  2PEX A;  1JKQ C;  1RZ4 A;  2EZL A;  1ZEL A;  3HRM A;  3TOB A;  5E8I A;  4HF1 A;  1XG1 A;  3J7Y J;  3CCV I;  4XRS G;  2YX7 A;  3MKY B;  3W2W A;  1JE8 A;  1S29 A;  3HIF A;  5ICF A;  2IXS A;  1VQM I;  5TIS C;  1FIP A;  2W25 A;  3DF8 A;  1MH3 A;  4PDK A;  2UXN A;  3Q3S A;  4L9V A;  1WJB A;  4HPQ A;  3OY9 A;  1TQM A;  2NNY A;  2FJ1 A;  5ILS A;  5J4V A;  2V7F A;  3IRQ A;  2O9L A;  4BH9 A;  2DMT A;  4HOB A;  3ZPL A;  4BU2 A;  2R7D A;  1K61 A;  1QQI A;  5DM7 F;  5D6E A;  3A2K A;  4IF4 A;  5L3D A;  1LB2 A;  3JRH A;  1XB4 A;  5E1W A;  5L3G A;  1TTY A;  4ABZ A;  2LNB A;  1B9N A;  2WC2 A;  3SDB A;  4BE2 A;  3DEW A;  1RPW A;  3SEQ A;  3WE3 A;  5M5Y J;  2E35 A;  3LAP A;  1X1C A;  3ABT A;  1J2X A;  4G9Y A;  4YFX F;  1D0Y A;  5HDN A;  2HOS A;  4I2O A;  3TDZ C;  1U3E M;  1ETQ A;  4A93 J;  1RES A;  2FMY A;  2O0Y A;  3ELK A;  3CC2 I;  1FTZ A;  4C3I J;  1P7I A;  1XGO A;  2P6S A;  4H0E A;  1XN7 A;  3QWL A;  3WG7 H;  3TW6 A;  3LAJ A;  5L3E A;  1UJ8 A;  2Z16 A;  1VQO I;  1T0F A;  4BAY A;  4KIF A;  2WWY A;  2VKV A;  4M72 A;  4I98 B;  4HQE A;  1W36 D;  4WCG A;  1F1Z A;  1W0U A;  1VQ7 I;  2W85 A;  4BEH A;  3PQJ A;  2ME6 A;  4DNC A;  3K4K A;  3WU2 C;  1WFX A;  1EJ9 A;  4KT5 C;  3TP0 A;  1P92 A;  1YJN I;  2DA1 A;  2MSY A;  1IN7 A;  4OIO F;  2LBF B;  1ZAO A;  1K7A A;  1QRY A;  1BOA A;  3A1Y A;  3OYM A;  1PVE A;  2R5Z B;  3V7C A;  3ZRG A;  2KRF A;  2BY0 A;  1OLT A;  1JTX A;  2G9W A;  3VWB A;  3IC7 A;  4WWC A;  2MFZ A;  3K4B A;  3CCM I;  2AHQ A;  3CDI A;  1MBH A;  4GRI A;  2QSG X;  1MBF A;  5ICG A;  3VYR B;  4KYW A;  3BJO A;  3D5R C;  4LD5 A;  3FF5 A;  5JLX A;  1LDD A;  1ZRF A;  2XAS A;  2LKX A;  4I6Z A;  2Z99 A;  2F5F A;  4JQF A;  1QA6 A;  2E2H J;  3CJT B;  3IUO A;  2FOK A;  3AG3 H;  4CGZ A;  4OIN F;  3FWE A;  1Y8Q B;  3I4P A;  3LMM A;  3JRG A;  4KN4 X;  3SFI A;  1Z3X A;  3FXL A;  2ZB9 A;  5DYM A;  4UVC A;  1ETK A;  4YFK F;  5J1U A;  3NWS A;  2XPU A;  2VQC A;  2Z9O A;  1KZH A;  4BE0 A;  1IGN A;  2X1C A;  1B8I B;  3BR0 A;  2TDX A;  2F4M B;  2XDV A;  4ANJ A;  3RYP A;  1ZQ3 P;  2VE8 A;  3SHF A;  4BS9 A;  3FIS A;  1OCZ H;  3OS2 A;  3G1L A;  1ULY A;  1W7P A;  2XKO A;  5FKM A;  2DA7 A;  2ICW G;  4UY8 I;  1BN5 A;  4IOA F;  1UHW A;  2COM A;  3BCA A;  4WXD A;  1U5T B;  1B72 B;  2OUM A;  4MHG A;  3A01 B;  2KQR A;  1FNN A;  4XRS A;  1WZ2 A;  4M3E A;  3CCE I;  1FOX A;  1N75 A;  1WQ2 A;  2DFH A;  1IJW C;  4DBQ A;  3I0T A;  1WRJ A;  3TMO A;  1KU2 A;  1CGP A;  2VBZ A;  4MTD A;  4I76 A;  4KT6 A;  4KJZ A;  4XMY A;  4UXN A;  3G73 A;  3KYL A;  4MQ9 F;  5D5U B;  3W2A A;  3W6J B;  3SEZ A;  5KHD A;  4RGX A;  2KHM A;  2CFX A;  2FNP A;  3P9I A;  2NS7 A;  4UUV A;  2RQQ A;  2FSW A;  1T56 A;  4AYB N;  2DLL A;  2EA4 A;  3L2Q A;  2D1H A;  3GLL A;  4KMF A;  2QQB A;  4JX4 A;  3DCF A;  3IL2 A;  1JJ6 C;  3PIO F;  2X6O A;  4HNT A;  1YTY A;  4RAF A;  1AKH B;  1O57 A;  1ZG5 A;  3ESW B;  3E7L A;  1P7J A;  2DMN A;  1JUS A;  2K9M A;  2L9S A;  2LY9 A;  2Y0M A;  1ACI A;  1SVL A;  4HV6 A;  3CJR B;  4EGY A;  1BJZ A;  1ZG1 A;  2XGD A;  4CDG A;  2BW3 B;  5EG0 B;  3KP6 A;  4OAY A;  4LLN A;  2V26 A;  3T8R A;  4F7Z A;  1KU9 A;  3IWF A;  5BS6 A;  3GCM A;  2FQ3 A;  3TGN A;  3T5X A;  2VJ5 A;  3S3N A;  1GT0 C;  2KRC A;  2EFN A;  2HQA A;  3S2D J;  3GX4 X;  2IS6 A;  2VIX A;  3DKW A;  1YS7 A;  2B9S A;  4XL9 A;  1DGW Y;  3RIR A;  4EJW A;  3FMQ A;  1MNE A;  5B66 C;  4Y4R A;  1IF1 A;  3WTT C;  4G8X A;  4NC7 A;  2KIM A;  1LEB A;  2Y0S A;  4A0Y A;  4EMS A;  3IH2 A;  1FWZ A;  2F4I A;  4ENK A;  3RQI A;  3LWF A;  3S3O A;  1XCB A;  1POG A;  5IYB J;  1V5G A;  4O5V A;  4BQA A;  2M30 A;  2CRG A;  2DA3 A;  4IO9 F;  1LFB A;  3BLY A;  1MMG A;  5FJ8 J;  1S8N A;  3ML6 A;  4Y7N J;  1TWC J;  4IQJ A;  1B1B A;  4LJZ F;  4OMZ A;  1J9I A;  4XLH A;  1V3F A;  1ZGW A;  3BOQ A;  1OYI A;  3ZCO A;  4EJU A;  4QTR A;  3GTG J;  3K1N A;  4NC6 A;  4LG0 B;  1YOV B;  3U1K A;  2FA5 A;  2DU9 A;  4XR6 A;  5ED4 A;  2AQE A;  1XGS A;  2ELH A;  4BDZ A;  3LNQ A;  1TLH B;  5AIQ A;  1CF7 A;  2V1U A;  1XDU A;  4KA4 A;  1J09 A;  2HZD A;  3MCZ A;  1Y6I A;  4A6D A;  1WI3 A;  1TWA J;  2RGV A;  3KYD B;  3TO9 A;  2IJL A;  5EEH A;  3HHH A;  3S32 A;  3HGY A;  3O6B B;  3RPU A;  2HKX A;  4B44 A;  3LA7 A;  2VN2 A;  3D5S C;  3FXU A;  2Y69 H;  3E6C C;  1ZHF A;  2ELJ A;  2KRH A;  1SD4 A;  1U0J A;  2HI3 A;  3ZQF A;  4PFO A;  1S5L C;  3HG9 A;  2EZI A;  1ZRE A;  3I59 A;  1SFK A;  2KMU A;  3OOU A;  3OYF A;  1U6G A;  3DLA A;  2MA3 A;  4XKW A;  2CS3 A;  2ESH A;  2VQG A;  2HEO A;  3HGG A;  1YHQ I;  1SAN A;  1HQC A;  3JSO A;  1PUF A;  2EV6 A;  1FPQ A;  1FOY A;  3BC8 A;  2JSC A;  4NQW B;  2VOO A;  5F1R A;  3ISP A;  1SD7 A;  1BJA A;  3Q5F A;  2GXA A;  2L3D A;  4CYC B;  1IO2 A;  2HQN A;  2TRT A;  2CUF A;  2E7W A;  1Y0U A;  2JUG A;  2VPR A;  4DOZ A;  5LFA A;  4PJM A;  2ZJ2 A;  2K02 A;  1FIA A;  1XGN A;  4M74 A;  1YIT I;  3ABU A;  2DFI A;  4Z6Y A;  2DOD A;  1K78 B;  2XIG A;  2M7B A;  4N0B A;  2VT2 A;  5E3M A;  1RR8 C;  2BXZ A;  3RTR A;  2HXI A;  2L02 A;  1ZKG A;  2DT5 A;  2A6E F;  1H9G A;  3HC7 A;  2JRT A;  4LG3 A;  3MFK A;  4G7O F;  1R5H A;  4KIS A;  4ZYG A;  3GTL J;  3LQR A;  2OU2 A;  1OKR A;  3HHG A;  5CVJ A;  1VQK I;  2Y0S N;  4ZYD A;  1JI8 A;  3R0J A;  4KIT B;  4KDP A;  1S72 I;  1GXP A;  2STW A;  2PN6 A;  4UNO A;  1UST A;  2XGC A;  9ANT A;  1BW5 A;  1SMT A;  4L9J A;  3DPU A;  3QYE A;  4F3Q A;  3KLO A;  2BHY A;  1KA8 A;  1VFC A;  5FFZ A;  4X0G A;  4ESF A;  3L2C A;  3HL2 A;  4TV7 A;  1YIO A;  1XC5 A;  2KIF A;  1YYV A;  2W82 A;  4D0P A;  1KON A;  4M9S A;  1KQ9 A;  2E19 A;  4HNV A;  5HLG A;  2ZJQ F;  2O8K A;  5LRS A;  3I64 A;  3MKL A;  3GZ5 A;  4CXF A;  5HNH A;  4P5O A;  4GGG A;  4IX7 A;  1OYY A;  1S6L A;  2DA6 A;  2MAB A;  4ENJ A;  1I39 A;  2P5V A;  5CVU A;  2XB0 X;  3PFI A;  4D1Q A;  2RQP A;  4BHP A;  5TJJ A;  3OIO A;  5FO5 A;  2WB1 A;  1X4P A;  2JQ7 A;  5H2F C;  5D5W B;  5AON A;  1Z3Y A;  3DWL E;  4AVZ A;  4V2F A;  2PMU A;  3JRC A;  3QPH A;  1Y1V J;  4JX5 A;  3LSK A;  1XSD A;  3OSF A;  4BBS J;  4ZTJ A;  2XAH A;  3K9T A;  5GPA A;  2Y2Z A;  3EET A;  3K2A A;  2V79 A;  3S93 A;  4C2T A;  1U5T C;  1UZC A;  2WBM A;  3BDD A;  4UUS A;  2E1M B;  3OWT A;  4RLQ A;  1OMI A;  4ZZL A;  3I53 A;  3EUH A;  1J7K A;  1TQI A;  2DO7 A;  1F36 A;  1Z67 A;  2Q0O A;  2LMD A;  3N4M A;  1BOB A;  4EJT A;  2STT A;  1RNL A;  4Y52 J;  5E1Z B;  3ROU A;  5FLX Z;  4MGR A;  2KDZ A;  4WXH A;  2QGU A;  2CFO A;  4ZYA A;  2MH9 A;  3H3Z A;  3P7N A;  4ZDP A;  5C4J J;  3WGH A;  5DS9 A;  1EA3 A;  2QWW A;  4M71 A;  2JZY A;  4AUX A;  2E1N A;  4XQF A;  1LVK A;  4JK1 X;  2IP2 A;  1HW2 A;  2HPI A;  4ENN A;  3IWZ A;  2VLA A;  3GFI A;  5CPR B;  3FK6 A;  5FKK A;  1OCP A;  2J5O A;  3BJA A;  3LA2 A;  5IP7 J;  1J59 A;  1NG6 A;  3EUK L;  2KDO A;  3BR3 A;  5GTH C;  5IY5 H;  4AVP A;  4ENM A;  2JK3 A;  1GXQ A;  2XRN A;  1DU0 A;  1WJ5 A;  3H5N A;  3BT9 A;  3FBN B;  3HPH A;  3HZJ A;  2F5C A;  1X1A A;  2BY3 A;  3E5U A;  3V42 A;  1TT0 A;  5KAF C;  2CH0 A;  4YG2 F;  3E0J B;  2OJE D;  2A6H F;  2HDC A;  2CUJ A;  1MJB A;  5JHU A;  3H0D A;  2XB5 A;  3RI4 A;  5HDK A;  3HXL A;  4HSR A;  2NS0 A;  4XOP A;  1VQ9 I;  3R4K A;  1XPX A;  2L9N A;  4U88 A;  5DUK A;  4XRF A;  2QSF X;  5KK1 A;  2LF8 A;  1IAW A;  5HOO A;  1ZYR F;  5HDG A;  3KE2 A;  3JRB A;  2PJR A;  3ZMD A;  3VB2 A;  4IJA A;  5IOZ A;  2EBI A;  2RDP A;  3S15 J;  2M0M A;  3KP7 A;  1UB9 A;  2FOW A;  2Y9Z A;  3IRR A;  2BOL A;  1WJE A;  2K9L A;  3KEY A;  4CCO A;  1YX5 A;  3HRU A;  5J1Y A;  4N9I A;  2VAS A;  2EK5 A;  1GV5 A;  3SZP A;  4HA8 A;  4W97 A;  2OTJ I;  3H1C A;  4U0W A;  3LOC A;  1QHH D;  2BGC A;  2VB6 A;  4CYD A;  1Z91 A;  4HDV A;  4A3G J;  3GW2 A;  2VT3 A;  1V5F A;  2VXD A;  4E7J A;  3MN2 A;  4D5F A;  3F6V A;  4QPQ A;  3CO7 C;  4MTE A;  4HX8 A;  1G8X A;  2L7Z A;  4MQV A;  5DCF A;  1UFM A;  3J7A O;  3S1M J;  1BR2 A;  3WG9 A;  4CCM A;  3S8P A;  2OBP A;  1IZ1 A;  3HJE A;  5FB2 A;  3R61 A;  3LSI A;  4BYY A;  3ZQC A;  2GWR A;  1VQ6 I;  1JTY A;  4DGW B;  3PJR A;  3J81 K;  1VI0 A;  1B4A A;  4LFU A;  3HUG A;  3OYJ A;  2EV0 A;  4YEL A;  4J01 A;  4RLF A;  3EPZ A;  1MDM B;  4CZZ A;  4QIW N;  2KZV A;  3PUF A;  1QPM A;  2LP0 A;  3I55 I;  4ZH4 F;  3S1Q J;  3RSN A;  2ETH A;  3DTK A;  1PP8 F;  4XLF A;  4O6J A;  5TRD A;  1ZN2 A;  2DFE A;  2QQ9 A;  5CJ9 A;  2L7F P;  2YSR A;  4DZJ A;  3G71 I;  5F6F A;  5HVQ C;  3SZG A;  5J47 A;  3FMR A;  2XAJ A;  4ESJ A;  3KCC A;  4OIQ F;  2M7A A;  5LHG A;  3ZQL A;  2ZO4 A;  2IGK A;  4UUT A;  5K1Y A;  3H5R A;  5M5W J;  3E6D A;  2W57 A;  4XM3 A;  5ICE A;  1ZRD A;  1FX7 A;  1R22 A;  3MD2 A;  4Y15 A;  3JAM K;  3ZGK A;  2VL8 A;  4L5E A;  1IV8 A;  3TED A;  2F2E A;  2P81 A;  1YX3 A;  4MNU A;  4MLO A;  2ZME A;  2JVG A;  2QSH X;  2K5C A;  2PMZ A;  2ZJR F;  3AL0 B;  1H8A C;  1JUM A;  1YJ9 I;  3F8C A;  4XLP F;  4G7Z F;  2CW7 A;  2ZCW A;  1OR7 C;  2JSP A;  4BXF A;  3DEU A;  4ETS A;  2FEZ A;  3U9G A;  1RET A;  2VBW A;  1U9O A;  1WI9 A;  4PJJ A;  3U2R A;  3B02 A;  3CP8 A;  4RDU A;  2ID3 A;  1W5C C;  1A36 A;  1SAU A;  3CLO A;  2BE5 F;  3FX3 A;  4M6Y A;  4V19 K;  2IEK A;  1APL C;  2HDD A;  4U87 A;  3L2V A;  3BPX A;  4ZDO A;  3KP2 A;  4E70 A;  3GZN B;  3GME A;  1IN4 A;  2GIZ A;  3GLX A;  1Y56 A;  3DEE A;  3DKY A;  1FC3 A;  3HRT A;  3GF2 A;  3OYE A;  2LD5 A;  2XF7 A;  1TWH J;  3D0S A;  4G94 A;  5JLW A;  1FT9 A;  2E1O A;  2W4S A;  3CCJ I;  1UEL B;  5J3L A;  1ETX A;  1VZ0 A;  3G6E I;  3CCY A;  1P4X A;  4XIC A;  2R92 J;  1R36 A;  3W6K B;  5E79 C;  2ZXJ A;  2RVC A;  1R58 A;  6PAX A;  5JFR A;  4LGW A;  5K7F A;  1RIO H;  1WKM A;  2PFB A;  2VPL A;  3CJN A;  3GZ6 A;  5BMZ A;  2J5P A;  4XKC A;  2QF7 A;  3BRO A;  4P96 A;  2DXI A;  3HSR A;  4ESB A;  5EF6 A;  1I3Q J;  4Q48 A;  2OF7 A;  4BGD A;  2DA4 A;  3VEP A;  3BG9 A;  2CU7 A;  1XS9 A;  3OIQ A;  3BTL A;  1TW3 A;  4IHS A;  5GTI C;  2F48 A;  1X3Z B;  1R5G A;  4KN7 X;  3JRI A;  2D5V A;  3S1N J;  4BY1 J;  2UXX A;  3LSM A;  4PZJ A;  1DP7 P;  3E6B A;  1OCC H;  1KQ0 A;  2ID6 A;  2M8E A;  1NK3 P;  2F5D A;  2DA2 A;  3BWG A;  3HOS A;  1I6X A;  4FHT A;  4HV5 A;  2OQR A;  3SJM A;  2EIJ H;  1QO0 D;  1YW9 A;  2FD5 A;  1T39 A;  4PJ0 C;  3F72 A;  2MG4 A;  4M3F A;  3BZK A;  2VQL A;  2LVS A;  4Y3O A;  4G6Q A;  1HW1 A;  3WHB A;  3KZY A;  2G7H A;  2E1M C;  4ZYE A;  2L54 A;  3ZMZ A;  4L18 B;  1V4R A;  5HNF A;  3JRA A;  1CQT A;  1ON2 A;  3HOU J;  3E5Q A;  2VON A;  1ODD A;  3CF5 F;  1K6O A;  5BOX A;  2HFH A;  2LY2 A;  3ZN0 A;  2HTS A;  4AD9 A;  2E34 A;  3S17 J;  3C2G A;  3K1M A;  1IUY A;  4C2M J;  1SEU A;  5DUI A;  2CJJ A;  2XAG A;  1YFH A;  3M8F A;  2QVO A;  2LH9 A;  4NBQ A;  5TGT A;  1KU7 A;  2WY8 Q;  2L2O A;  5E20 A;  1P9Q C;  1W7P B;  3NQO A;  1HKS A;  2P7V B;  1D8J A;  3BTC A;  1VQ4 I;  4DYR A;  5IT9 K;  2BVL A;  1TW2 A;  3BG6 A;  3H9Q A;  1FYM A;  1OYW A;  3SYT A;  3MKZ A;  1JGG A;  4YII A;  2V9V A;  1QZE A;  4IVN A;  3OV8 A;  1Z77 A;  1XCV A;  5A2Q Z;  5BPD A;  3COA C;  4I0A A;  3CTA A;  4RGS A;  2OCE A;  1IDZ A;  2Z33 A;  4U7B A;  3JSP A;  3PNV A;  3CMM A;  2EIK H;  2QBY A;  1SD6 A;  2O3F A;  3WTZ A;  1TWF J;  3VSL A;  2ZNZ A;  2DW4 A;  4RB2 C;  4A12 A;  1A31 A;  4A3K J;  1W5T A;  2KJB A;  1IUF A;  1UMQ A;  1FZP B;  1Z7U A;  1FP2 A;  4IL6 C;  5GAD J;  2OD5 A;  2IA2 A;  2M34 A;  2NOG A;  3TQN A;  5ILV A;  2R5Z A;  1IV6 A;  3CUQ A;  4PSW A;  4A3F J;  1R7J A;  2EPF A;  4WF2 A;  5J40 A;  3QRF F;  1MMD A;  2ZFU A;  4FE7 A;  3S3M A;  5CVI A;  4FQG A;  1NG7 A;  2PLY A;  4XN3 A;  2FU4 A;  2K4B A;  1EV7 A;  1H9T A;  3OYA A;  5KAI C;  1E3O C;  1X1D A;  3ECH A;  3M07 A;  1DGR M;  2K4J A;  3BR5 A;  2NOJ B;  4M73 A;  5CQG A;  4U0Y A;  2I8D A;  3R6S A;  3OR1 C;  1FTT A;  4DW6 A;  5DCM B;  5LRR A;  2LK2 A;  2WAQ A;  4A3L J;  2IA1 A;  2P4W A;  3EUA A;  4A69 C;  3OYI A;  2XUB A;  4E7I A;  3FHZ A;  5FKN A;  3L9F A;  3Q9V A;  1G2H A;  1D3Y A;  2VC0 A;  3L7W A;  1IG7 A;  1TBX A;  2RKH A;  3QPL A;  3IKT A;  4II3 A;  2O6G E;  1AU7 A;  3KPH A;  2QCO A;  3AFH A;  2RAE A;  5KCM A;  5K5O A;  3MAJ A;  1HC8 A;  3DBL B;  3J80 Z;  2PQ8 A;  3K4C A;  2MYS A;  1UG0 A;  4RM3 A;  4JP0 A;  2A6T A;  2R7W A;  3BP8 A;  1MJ9 A;  2K86 A;  3A4C A;  4GO1 A;  3UNG C;  1HDD C;  1R23 A;  4IQ4 A;  5D4S A;  1RR7 A;  1S7O A;  4BKX A;  2HXO A;  1U5T A;  4I0B A;  1B72 A;  3ZMS A;  4BE1 A;  3HKZ A;  3CD6 I;  3ZXS A;  4ASN A;  4BXX J;  1Z9C A;  4V2G A;  1FBQ A;  2CG4 A;  1ERD A;  1MBE A;  1D0X A;  4LIU A;  4PJL A;  3WTY C;  2ESN A;  3BQY A;  3QP6 A;  4M3B A;  5LGT A;  4LIV A;  2JA2 A;  1SVO A;  2XPV A;  4D9J A;  1FYL A;  3ASN H;  4FCY A;  1K6Y A;  3FKJ A;  2W84 A;  4AIJ A;  5L3C A;  2NVU B;  2AS5 F;  4U0V A;  3QQA A;  4S04 A;  2QKL B;  1P4W A;  2CO5 A;  3DXJ F;  2XRO A;  2H8R A;  2H6B A;  2R4G A;  4C2U A;  3DBR B;  3H35 A;  1R9T J;  4N4N B;  1C0W A;  2E36 A;  4BXU A;  4BBR J;  2NVT J;  3BY6 A;  2OC6 A;  3K70 C;  1Z21 A;  2DYR H;  3TW7 A;  1ZK8 A;  1HF0 A;  3V8L A;  1WCM J;  3H9G A;  1FMV A;  4GFB A;  1HKT A;  2VKD A;  1E17 A;  2JA5 J;  2GA2 A;  4BAC A;  3A0B C;  1JHH A;  2VI6 A;  3AG1 H;  1LJ9 A;  4I99 C;  3F21 A;  3H3U A;  3ZMT A;  3NAU A;  1LE8 B;  1REP C;  2IPQ X;  4RB1 A;  1IN8 A;  2KFD A;  4KIG A;  3W6V A;  1OCT C;  3IAS 2;  2H09 A;  3AL0 C;  2PG4 A;  3GTJ J;  2EIM H;  2OCC H;  4EEF G;  2B63 J;  4A3D J;  1MJA A;  2GBY A;  5FGM A;  4RB3 C;  1PUF B;  1G4D A;  1HCR A;  1MIJ A;  1I5Z A;  4IRG A;  3K4M A;  2HGC A;  2JJ7 A;  2N8G A;  1ZR4 A;  4L9T A;  1K4S A;  2YPR A;  2JTV A;  2XF5 A;  1Z1D A;  4Y33 A;  4HG2 A;  1TT5 B;  2QQ8 A;  2EA2 A;  4B09 A;  2M8G X;  1GHC A;  1D1A A;  5F27 A;  4YFN F;  3CO6 C;  5F04 A;  4FAS D;  2DI3 A;  2E2J J;  2YX4 A;  4D7N A;  1R49 A;  3O8H A;  5JI6 A;  1J5Y A;  1G3Y A;  3RKY A;  3B6A A;  1T0F C;  2Q2E A;  2Z1D A;  4QLC U;  2LTP A;  4RMN A;  2O7O A;  1HSJ A;  2CMP A;  5HS9 A;  3IP4 B;  5BPI A;  3PM1 A;  2A3S A;  3O8G A;  2JA6 J;  3DTI A;  4L9N A;  3K0L A;  4F52 A;  1R00 A;  2XPW A;  3C2H A;  2DMU A;  3BG5 A;  2KZG A;  3SFZ A;  3GTO J;  4OIR F;  3S1R J;  3HTU A;  5LHH A;  3LST A;  1Q1V A;  4XNF A;  2JN6 A;  1I3A A;  1L3L A;  2JA8 J;  3JW4 A;  1XD7 A;  1R1V A;  3I3L A;  3P9C A;  3KIO A;  3WTW C;  1IC8 A;  4IRI A;  1GDT A;  3VYT B;  5J4Y A;  3F8M A;  2AXL A;  3I71 A;  3CQZ J;  1SMY F;  4ZDL A;  3EQL F;  2EFQ A;  2FRH A;  3AG4 H;  2KL4 A;  1YRN B;  3M9A A;  4BJT A;  2Y30 A;  1IXR C;  1BC7 C;  3Q0W A;  2CW8 A;  1TZL A;  1MD0 A;  1GVJ A;  3X2Q H;  1PYV A;  3NAR A;  3G1O A;  1UCR A;  4JOM A;  4IOC F;  3WE2 A;  3GBG A;  3V4G A;  5FRN A;  1X3U A;  1QVT A;  4LLG F;  3F22 A;  3C2B A;  1UHM A;  2KT0 A;  3GFL A;  4WX9 A;  4GDF A;  1D0Z A;  2YU9 J;  3I4M J;  3J7A Y;  2ZNY A;  4HF0 A;  2FBK A;  1YG2 A;  1MH4 A;  1SC7 A;  2L01 A;  2L7M P;  3TL4 X;  2Z2S B;  4BDY A;  3F6O A;  4XLA A;  4AC0 A;  4EQQ A;  4ZJZ A;  1ENH A;  2JT1 A;  2VC1 A;  2A61 A;  1B59 A;  5CYV A;  4DIQ A;  2UWM A;  3M1E A;  5CKT A;  4IHX A;  4HW0 A;  2FBH A;  2HVS A;  4CYC A;  3RZO J;  2HYG D;  3J7Z I;  2IAI A;  1PJR A;  4B47 A;  3CLQ A;  2R7Q A;  4IXA A;  3TO7 A;  4UUS B;  3M7G A;  4KNY A;  4XLC A;  3KP4 A;  4X1E A;  2L4M A;  2NRA C;  4FX0 A;  1IN5 A;  4P55 A;  5IP6 A;  1K78 A;  4CH7 A;  1LKX A;  3D5L A;  3BR6 A;  1RC9 A;  2A05 A;  2FXA A;  3U1D A;  5HOD A;  3ERM A;  2XSJ C;  3WTV C;  1UAA A;  1HLV A;  3WHC A;  4F92 B;  3GXO A;  4E7H A;  2HS5 A;  4UV8 A;  2M2E A;  4P1W A;  3GEZ A;  1E3P A;  2CV2 A;  5KVR A;  4R1H A;  1LFP A;  2OZU A;  4Y17 A;  5H6R A;  3S16 J;  1HKQ A;  3LSG A;  2HOE A;  3W3C A;  3GTM J;  2LF7 A;  3UR3 C;  1FBS A;  5GAH J;  2OA4 A;  3CCR I;  5EGO A;  4XN0 A;  2V1X A;  4E7K A;  3R0A A;  3OL4 A;  4IHY A;  2D45 A;  1D1B A;  1JKP C;  1TL8 A;  4G7H F;  1XSV A;  4EGZ A;  4UV9 A;  1FP1 D;  1W5S A;  5DV5 A;  4MEX F;  2UUZ A;  2DOE A;  2FBI A;  2IBD A;  2LRE A;  1WJA A;  3OYB A;  2P7C B;  5E17 F;  1RKT A;  3REO A;  2P5L C;  5LD2 C;  1D5V A;  4XSZ F;  3DU5 A;  3ECO A;  5J8C A;  4XRM A;  2DCE A;  3JR9 A;  1G6N A;  3IKV A;  1USS A;  1I1S A;  2XAQ A;  2DMP A;  2QZ8 A;  2DTZ A;  2X48 A;  4CSW A;  3T1B A;  2CWE A;  3B6C A;  2ZBK A;  2R7V A;  2OQG A;  3BG3 A;  5CVR A;  4IHT A;  5CLS A;  4OWR B;  1FJL A;  3OS1 A;  3QOE A;  3IAM 2;  4XKB A;  4FX4 A;  2XHK A;  4UB8 C;  4BQQ A;  1PDN C;  5FRM A;  1BI0 A;  3FM3 A;  1J75 A;  3GFM A;  1MKM A;  2NVX J;  2HWV A;  2ZKZ A;  1AHD P;  2L9V A;  4HST A;  3SDG A;  3EYI A;  1O3S A;  4CO8 A;  4EVI A;  2AQF A;  3FXM A;  1FBU A;  4A3C J;  3PO2 J;  3DPL C;  3GO5 A;  4XK4 A;  2P8T A;  2FE3 A;  2DMQ A;  3E1S A;  4L5I A;  1MGT A;  3QU6 A;  1ZLK A;  2DK8 A;  5BQT A;  4OMY A;  1ZH5 A;  4M3G A;  3H5A A;  1RUN A;  1MBG A;  1SFO J;  2PBI A;  2AXT C;  2R5Y B;  1DUX C;  3B73 A;  2DQL A;  1KYW A;  3JRF A;  2DYS H;  4YEJ A;  1IRX A;  1FY7 A;  3OYD A;  2LR8 A;  3RKX A;  2Y9Y A;  4YIF A;  1TQP A;  2BY1 A;  4KUM A;  4HRI A;  2W48 A;  3LFU A;  4ZC3 A;  3FM5 A;  5GAE J;  3CZ6 A;  2JVH A;  3QOP A;  3H0G J;  2XGE A;  2XKP A;  3HUG B;  2VBX A;  4B3A A;  4D5C A;  4XOT A;  2KP6 A;  3VDX A;  4E4H A;  3A02 A;  1Y1W J;  2A5Y B;  1XTA A;  3M8E A;  2WB1 N;  1VQ5 I;  1EF4 A;  3HRS A;  3GYH X;  3K70 D;  3SQN A;  4D7M A;  5IYD J;  4AWX B;  4X6A J;  1YI2 I;  3CDL A;  4XON A;  2DJN A;  2E5N A;  2F5V A;  3I5U A;  2EQR A;  2EIL H;  1FEX A;  5DEQ A;  3C3W A;  2IRF G;  1A35 A;  5DDG A;  1BI2 A;  1WWX A;  5M3F J;  3GFJ A;  3LFK A;  5E8G A;  1EKE A;  2IS1 A;  2IGM A;  3NRV A;  1F9N A;  1VF9 A;  3KET A;  1LVA A;  4Q5S F;  4OIP F;  1JXS A;  3G1M A;  3H92 A;  4DZP A;  5LGU A;  2KLO A;  4BJ6 C;  1F5T A;  5HS8 A;  3LSH A;  4JX6 A;  3RCO A;  2CQN A;  2DAO A;  3S14 J;  4LB6 B;  2HNH A;  4IEJ A;  3VFZ A;  3RZD J;  1R5I D;  1QU3 A;  1K83 J;  2HKO A;  1Z7L A;  1ONV A;  5DD4 A;  2VJ4 A;  2X4H A;  4DQ2 A;  2R7F A;  2ZME B;  5DTD A;  3RQ4 A;  3L2U A;  1BBY A;  5IPA A;  4P9F A;  1IXS B;  1IRZ A;  3HYI A;  2ZJP F;  1E0E A;  2OPT A;  2WTE A;  1RI7 A;  1YLF A;  2L7K A;  3L2R A;  3CCS I;  2V9K A;  5E1X A;  2GM4 A;  3VOE A;  3MQ0 A;  3KFW X;  4PUS A;  1OFC X;  2F4O B;  2MC4 A;  2FQ4 A;  4M3D A;  4WK8 F;  1VQP I;  3U21 A;  3PUB A;  1K4T A;  3BZ6 A;  1XX5 A;  3WTU C;  3K2Z A;  1IRG A;  4Q4Z F;  4A5N A;  4IZZ A;  5H20 A;  1N77 A;  3RDI A;  2QKM B;  5D4R A;  5CQE A;  4DJA A;  1GV2 A;  4IHW A;  4EJO A;  4RS8 A;  1B9M A;  3KX2 A;  1W0T A;  4CIC A;  1BI1 A;  5BNG A;  1XSX A;  1FOK A;  2D2W A;  4NC8 A;  4A0X A;  1SFE A;  2FUG 2;  5D6F A;  1HST A;  2GA1 A;  2CGP A;  1HXD A;  2DQR A;  4DYC A;  5FD5 A;  2F5E A;  4AM3 A;  1VTN C;  4ON0 A;  4BJ5 C;  2ME0 A;  1Y39 A;  2HU9 A;  5FRO A;  2CQ7 A;  2C6Y A;  4XID A;  2I5U A;  4CHU A;  5E3L A;  2HYJ A;  3AKZ A;  3HOV J;  5J1R A;  1AOY A;  4FET A;  4QPO A;  2X6W A;  1RKW A;  2JWT A;  1OCO H;  2COB A;  2WV0 A;  3W2V A;  1WH7 A;  2ZXI A;  1G59 A;  2G0E A;  3HOW J;  3LSJ A;  4BEH B;  4S0H B;  1YW8 A;  2NYX A;  2JPB A;  1S7A A;  4II2 A;  1MMS A;  3A0H C;  1F43 A;  1ZR2 A;  3ONQ A;  1A6I A;  1PUE E;  1WJC A;  1MMA A;  3TP3 A;  2DDA A;  3C18 A;  5IOY A;  2HOT A;  3K4N A;  2M5W A;  4QWQ A;  4LMY A;  4JBA A;  1B6A A;  2YU3 A;  4I7H A;  1WSU A;  4PGG A;  4E7L A;  1S9H A;  4RGR A;  2ZXW H;  3WTX C;  3GWZ A;  1LPQ A;  3EUH C;  4ZYH A;  3OYH A;  3ZN1 A;  2E1C A;  1JUP A;  5FD6 A;  2RC4 A;  4G12 A;  2HYF A;  1W7P D;  3K69 A;  4HLX A;  2OV7 A;  2EV5 A;  3AG2 H;  2OTL I;  4A3M J;  3TBI A;  4A5M A;  2CW0 F;  3TOA A;  5D8K B;  3RYR A;  4EM0 B;  1R1U A;  2EZH A;  2H1L A;  1X2N A;  3N97 A;  3IH3 A;  3NEU A;  5GAG J;  1TNS A;  2DK5 A;  5E18 F;  1H89 C;  1D5Y A;  4L5J A;  1OCR H;  1YS6 A;  2BEO A;  2O5R A;  4G6D A;  2E2I J;  2CQK A;  3FBI B;  4B8X A;  3HOX J;  1WPK A;  1GLN A;  4AYB A;  1JKR C;  3K10 A;  2VBY A;  2F6C A;  2GZW A;  3CUO A;  4NB5 A;  1MSE C;  3MWM A;  1OIS A;  2LDU A;  3HOY J;  2XAF A;  2HTJ A;  3ZP5 A;  3LA3 A;  4XLN F;  3VYS B;  3EDP A;  4IKF A;  1QHG A;  2A5W A;  2R3S A;  1WJF A;  1U2W A;  3L1P A;  2JUC A;  2MC3 A;  2LKS A;  1OJL A;  2ELK A;  2QBY B;  3SXY A;  4RA2 A;  5F1J A;  3IHU A;  1ON1 A;  2XAU A;  1YIJ I;  2EFP A;  4N4O B;  2EH3 A;  2ECC A;  1Y8R B;  3HOT A;  4BQN A;  3LSR A;  2XRL A;  1A6Q A;  2EFO A;  2X1D A;  3H3V K;  1ITY A;  2O03 A;  3BJ6 A;  3F8F A;  3M3Y J;  4YIR X;  2R7O A;  3E5X A;  3MEX A;  3HM5 A;  2EWN A;  2LYC A;  2KIU A;  3HTS B;  3CUQ B;  2DT7 B;  3FIW A;  2H27 A;  4BY7 J;  1TNT A;  4F93 B;  2IA0 A;  2K3P A;  3QYB A;  4I09 A;  2OZ6 A;  3F3X A;  1P4A A;  1LDJ A;  4XBF A;  3BTI A;  1W4M A;  1R6R A;  2KPM A;  2GLO A;  2IS4 A;  4MEY F;  1L0O C;  2LC2 A;  1LQ1 A;  2BHZ A;  2PMZ N;  2CV0 A;  2IGO A;  1EH7 A;  2PX9 A;  4G6T B;  1O3Q A;  1G3T A;  4O3M A;  3FDY A;  2K40 A;  2RNJ A;  5D8L B;  4LK0 F;  5IYC J;  1U8R A;  4LB5 A;  2LBF A;  5C4X J;  1JGS A;  1E3H A;  1FSE A;  3JCU C;  2NXN B;  2V1D A;  3O2P E;  2H1K A;  2W00 A;  3K4L A;  1T98 A;  5M3M J;  3K7A J;  4KMU X;  3KEQ A;  1RUO A;  4PJN A;  2WA0 A;  5GPC A;  3E3V A;  4NNJ A;  1BR1 A;  4PSX A;  5HLI A;  4CA0 A;  1A5J A;  2P0W A;  2X85 A;  1MND A;  2HQR A;  3RKQ A;  1J0R A;  5JVT A;  4C30 A;  5H6Q A;  5FLV A;  3WU0 A;  2NAZ A;  1ZTR A;  3OOP A;  5F64 A;  2TCT A;  3ZOB A;  2KKO A;  5DM6 F;  2DFF A;  1R71 A;  2BYV E;  4Q47 A;  4L0Y B;  3OL3 A;  2LOO A;  3LL7 A;  4E6K G;  3WOD F;  2QA4 I;  4EJV A;  1JJ8 C;  2Y75 A;  1HBX G;  5EZG A;  1JHF A;  2Q1Z B;  4B1R A;  3OYC A;  1I27 A;  3WTS C;  1Z6T A;  1O4X A;  4BHB A;  3V8K A;  4UVB A;  2X6Y A;  3FXK A;  3ABM H;  4I01 A;  4HAM A;  3CMY A;  2LRD A;  1A04 A;  3ZQ7 A;  2IS2 A;  3QOD A;  3OYG A;  4HX7 A;  2XV4 S;  4ZZD A;  1B8I A;  3Q0V A;  1VQ8 I;  4IPA A;  3J81 Z;  3HSE A;  2DDB A;  1DP3 A;  3PIP F;  3RPU D;  1X3W B;  1QBJ A;  1W1W E;  4J19 A;  5IP9 J;  2BY2 A;  1QPI A;  3ZQI A;  1GUU A;  1ZGJ A;  2R7Z J;  1S3J A;  4BHC A;  1UG2 A;  4HYE A;  3ABL H;  4XKV A;  4M9Z A;  4HLY A;  5EZH A;  3S2W A;  5D5X B;  4ZTF A;  1HDP A;  2M87 A;  1XDS A;  3K4J A;  3PNY A;  4C3H J;  1LNW A;  3A01 A;  2NVY J;  3MZY A;  2V6C A;  2AO9 A;  3M4O J;  2HVR A;  5FLX K;  5HLH A;  3CC7 I;  4KIB A;  1Z05 A;  3E6M A;  2WAF A;  5FKO A;  2FX0 A;  2QLZ A;  3E97 A;  4F55 A;  5JHF A;  1FOW A;  3TDU C;  2Y31 A;  2MLG A;  1X1P A;  4FE4 A;  5ILU A;  3I9V 2;  5EEA A;  2EFW A;  2GOX B;  1Z0X A;  3BR2 A;  2BZT A;  5B3S H;  3DFG A;  4XLE A;  5FLM J;  3JAM Z;  2ZME C;  1E2X A;  1CF7 B;  3CDH A;  1M1E B;  1V54 H;  2V4J C;  5DCM A;  3VYU B;  3ULQ B;  4CCN A;  1MMN A;  1IRF A;  2KIQ A;  2DOF A;  5F0H A;  2R7T A;  2X9D A;  3VPR A;  5E3N A;  1I50 J;  2H94 A;  4CCL A;  2L5Q A;  1AKH A;  2B0L A;  1ETV A;  2MW8 A;  3EYY A;  1N78 A;  1ETY A;  3HOZ J;  2XC7 A;  1TC3 C;  2A68 F;  1RRJ A;  3PQK A;  2VUM J;  1G3S A;  2NVQ J;  3GUD A;  2BW3 A;  4GYI A;  5K5R A;  5EG0 A;  3TKY A;  2Q2E B;  2DPU A;  5C44 J;  2JRM A;  3I59 B;  1YQA A;  2LFB A;  3H36 A;  2DOA A;  5F08 A;  3FZV A;  1U8B A;  1DPR A;  3O3K A;  3KZI C;  2XF6 A;  4AID A;  1F4K A;  1HOM A;  5AIP A;  1D1C A;  4RB0 A;  4A3E J;  3OS0 A;  2O61 A;  2K85 A;  2VKE A;  1NK2 P;  3K1P A;  3OSG A;  2JMW A;  4OAZ A;  5J6X A;  1ZAR A;  4A3I J;  1OPC A;  2OAZ A;  1FYK A;  2PI0 A;  2ZC2 A;  2M1B A;  3DBH B;  2ISY A;  2K9S A;  3ERE D;  2VJI A;  3QU3 A;  1R4M B;  2YUS A;  1ZLJ A;  4PFP A;  2ACJ A;  2XSD C;  1LEA A;  4E7S A;  2EB7 A;  1ZG3 A;  2V6E A;  3LQQ A;  3KYC B;  2WY7 Q;  4DBR A;  4JYK A;  5B1B H;  1T38 A;  1DDN A;  3VSK A;  1JT0 A;  3C7J A;  2VOD A;  2D1V A;  3OYN A;  4A3J J;  2X6X A;  4MFD A;  2WAQ N;  4P9U A;  1SAX A;  1JT6 A;  3PSI A;  3KZZ A;  3OMY A;  1G3W A;  5K7Z A;  3S2H J;  1BA5 A;  1DU6 A;  1SVM A;  2Q8K A;  3BPV A;  3DKX A;  2RV8 A;  4I02 A;  1XMA A;  1LE8 A;  2ADU A;  4UVA A;  4LG0 A;  1BM9 A;  5K5Q A;  2ZSI B;  3M1C A;  4EV0 A;  2R7X A;  1OQY A;  3C1D A;  2I10 A;  1O3R A;  3JTG A;  2CV1 A;  1R4N B;  3D1N I;  5B5E C;  2R7U A;  2VOP A;  5CVV A;  1T08 B;  2LSO A;  3MMY B;  4A2U A;  4R79 A;  4AIH A;  2UZK A;  1SD5 A;  4IRH A;  2IVM A;  1T95 A;  2W7N A;  3F8B A;  1NH3 A;  1K79 A;  2KIS A;  1DPU A;  2WAE A;  4CCJ A;  2IW5 A;  3HKZ N;  5EJC A;  3V7R A;  4CUG A;  4HNU A;  3DV8 A;  2R93 J;  2FML A;  1X4O A;  4OU0 A;  3F8N A;  4MIM A;  1LDK B;  3I56 I;  3JRE A;  1IDY A;  1H88 C;  4B48 A;  3L09 A;  1S7E A;  2IT0 A;  2BV6 A;  1P6R A;  4LIT A;  3PNT A;  2YS9 A;  2P6T A;  5IT9 Z;  2KJC A;  2L9R A;  3RPQ A;  3HB9 A;  4C9Y A;  5F0C A;  3V8J A;  4XSX F;  1V55 H;  1QNT A;  2QYO A;  5LEK A;  3CP2 A;  4FT8 A;  3PL8 A;  2GQQ A;  2CQQ A;  2DBB A;  2UV1 A;  1O7L A;  3SZT A;  2K3F A;  5ERI A;  2W24 A;  2XVC A;  4GYG A;  4HF2 A;  2VKH A;  3Q9S A;  4NQW A;  1STZ A;  2IGN A;  2R0Q C;  4C3J J;  5HS7 A;  1WVR A;  2M0C A;  4LLL A;  1NHA A;  4RBO A;  1EH8 A;  3JTH A;  1MW7 A;  2EZK A;  3CUQ C;  3JRD A;  1XGM A;  2LLK A;  1PP7 U;  3T0Y A;  2BVM A;  3ASO H;  3NWT A;  3ZMV A;  2ECB A;  3P9K A;  1YRN A;  1D8K A;  3G3Z A;  2H8W A;  5EGO B;  1X58 A;  3FXO A;  3M8J A;  4RAZ A;  1FSH A;  1SFX A;  5LBQ A;  1QZZ A;  2LKP A;  4W1U A;  2X1E A;  1HW5 A;  1X2M A;  2MBF A;  2DTR A;  3MZ8 A;  5LGN A;  3P5J A;  2QEN A;  4LOC A;  4M6V A;  3GTK J;  2DN0 A;  3FK7 A;  1OR7 A;  3DQV C;  1WH5 A;  4M6X A;  4A0Z A;  4AIK A;  5F0F A;  4BL0 B;  4KFC A;  4NHJ A;  3G4S I;  3DTE A;  1W36 C;  1MZB A;  1IN6 A;  1YW7 A;  2O8X A;  3BCB A;  3DLL F;  1O7F A;  5EEG A;  4DYQ A;  5HLT A;  1BR4 A;  5LLQ A;  3KP5 A;  4MFE A;  2R7S A;  1FMW A;  3PSF A;  3V7S A;  1TWG J;  2CUE A;  2CYY A;  1I1G A;  3CCL I;  2V1N A;  3AAF A;  2L0K A;  4AU7 A;  2MH2 A;  2K27 A;  3IV5 A;  4PK4 A;  3RJP A;  1VND A;  5D5V B;  3HEF A;  2RNG A;  2DJI A;  1BW6 A;  3HPG A;  2MLK A;  3F0C A; 
#chains in the Genus database with same CATH homology
 3AG2 H;  1OCO H;  1V54 H;  3ABK H;  3ABL H;  5IY5 H;  3AG4 H;  2EIM H;  2DYS H;  2OCC H;  3ABM H;  3ASO H;  5B1B H;  2EIK H;  1OCR H;  1OCC H;  5B1A H;  2DYR H;  1V55 H;  3X2Q H;  2EIJ H;  1OCZ H;  2EIL H;  2Y69 H;  3ASN H;  3AG1 H;  2ZXW H;  2EIN H;  3WG7 H;  5B3S H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...