3AG2H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag2H00
2EINH 3ABLH 3AG4H 3AG2H 5B3SH 2EIJH 3ASOH 1OCOH 3ABMH 3ASNH 3X2QH 1OCRH 1OCCH 2DYSH 2ZXWH 3ABKH 5B1BH 1V54H 3AG3H 2OCCH 1V55H 5IY5H 3WG7H 3AG1H 2EIMH 5B1AH 2EILH 2Y69H 2EIKH 2DYRH 1OCZH
chains in the Genus database with same CATH superfamily
5IOYA 4F55A 2LK2A 4ZH4F 2DJNA 1F9NA 4IHVA 4HLYA 4KN7X 4C3HJ 3DU6A 4Q48A 1YRNB 1VQLI 5FGMA 2VQCA 4NHJA 4LLLA 5LHGA 3EUHC 2IGOA 3H36A 3A02A 1FWZA 3PSIA 2BE5F 2WB1N 3WGGA 3EYIA 4QWQA 1P4WA 1JJ6C 4G94A 4XM3A 5D5WB 2R7DA 2V79A 4JOMA 5CKTA 1A04A 2L4AA 1LJ9A 4BDYA 2KQRA 4IHSA 3KYCB 3MKWB 1OCZH 3I5UA 3IH2A 5LRRA 5LRSA 5HLGA 5E18F 4BY7J 4PGHA 5D5XB 4DZJA 3TO7A 2PI0A 3FXOA 2XC7A 2PMZA 2DYSH 1F36A 1MBJA 1U3EM 2TRTA 1IN4A 1WRJA 2RV8A 3DKWA 1Z7LA 3QAHA 4HSRA 2XGXA 2R5YB 1F1ZA 1NHAA 3QU6A 5IYBJ 1XSVA 1I6HJ 1D1AA 5DCMA 2Q8KA 4BXXJ 1MH4A 1BM9A 1JKRC 4Q4ZF 1IV6A 3HRMA 2EINH 3C3WA 3DPLC 3P9CA 2ZXJA 2ZBKA 5C44J 1LDKB 1T0FA 2HOAA 1S3JA 3L9FA 2L4MA 1V5EA 1SVMA 1SVOA 2DFIA 2A05A 3OYKA 4MHGA 2DOFA 2KJBA 3H5NA 3W2AA 1ZYRF 4OWRB 1SFUA 3AAFA 5J4YA 4OIQF 4M9SA 3FBIB 4LITA 5A2QK 1U5TA 3RPUA 4YELA 4XN0A 2XRLA 4FASD 2JUGA 2KISA 3HC7A 4HV6A 3PNTA 3MVPA 3CC4I 2H1LA 1HKSA 5J6XA 2Z9OA 2EWNA 4RGUA 2Y31A 4O6JA 2R7QA 2AQFA 3LSMA 3PQJA 4LIUA 4B09A 3S3OA 1XCVA 2FBHA 3X2QH 3WHCA 3BG7A 4O5VA 3OYNA 1CQTA 1D5YA 2OZ6A 5B1BH 1W5SA 5F1JA 3BQYA 2CUFA 3EPZA 5DEQA 3W2WA 2CRGA 3OYEA 1R5ID 1WI9A 1I39A 3T8RA 3GMEA 4CH7A 3WG7H 5L3EA 1APLC 1R9TJ 1B9MA 2L2OA 2O8KA 3M1EA 1HQCA 4UV8A 3IC7A 1FZPB 2F4MB 3RKXA 3S2WA 3BR1A 5LGNA 4LB6B 3K4NA 5EF6A 6PAXA 1JXSA 3NWSA 4LG0A 2VOPA 2UXNA 2OQRA 3WE3A 3ABMH 4OINF 2M9HA 3SHFA 2OF7A 1TBXA 4FX0A 2TCTA 4A5NA 4BNCA 1DUXC 3TGNA 2R93J 2FXAA 3NWTA 1R00A 3LFKA 4LFUA 1VQNI 4EV0A 5J40A 3V42A 4EGZA 3G1OA 2R7FA 5GAGJ 2QSGX 2PJRA 4CSWA 3IWFA 2VL8A 3OMYA 2KFDA 1K4TA 5DUIA 3BCAA 2WA0A 3WTZA 1DU0A 1S29A 1P2FA 1TTYA 1BR2A 2YUSA 4BDZA 1Z7UA 1E17A 1QVUA 2HZTA 4MEYF 3V7SA 5FLXZ 4B44A 2KKOA 2MH9A 1JI8A 3QWLA 3LSPA 5K7FA 1MMGA 1Z77A 1E2XA 1U9OA 3E0JB 3CMEI 2L9RA 4XLFA 4UNOA 1EV7A 1LB2A 5IT9K 1X1AA 1JT0A 3F0CA 3FHNA 2RDPA 4AC0A 4UVBA 4E6KG 3VOEA 1JGSA 3CJRB 1RR8C 1D1CA 3S93A 4ASNA 4KN4X 2OUMA 3ZPLA 5ICGA 3L2UA 2UV1A 2L3DA 9ANTA 1ERDA 4P9FA 5ICCA 3NEUA 2V9KA 3ABLH 1BI2A 3IH4A 3VYSB 1FTTA 3CP2A 1MIJA 3LA7A 2GIVA 2P8TA 3P9KA 2NS7A 3CO6C 2KMUA 1P6RA 4XK4A 3HUGB 4U87A 1U2WA 2R7TA 5FD6A 2YS9A 2VPLA 2JVGA 3BPXA 1LE8A 1S72I 3FISA 5L3DA 3MQ0A 1W0UA 2P5VA 3ZQLA 2ZCWA 4M6XA 3WG9A 3CO7C 2BY1A 1J9IA 2K9NA 3BR6A 4I6ZA 1U9NA 3J80K 2OPTA 2ZB9A 3PO3J 1QGPA 3G1LA 1V5GA 2CFOA 1OKRA 1OJLA 2ELJA 1LVAA 4RM2A 5M5YJ 2XSJC 3JCUC 2YPRA 1HOMA 3BJ6A 1IRFA 1FP1D 2WY8Q 1LKXA 4LGWA 5BS6A 1DP3A 3AG3H 4MGRA 5DCMB 4XIDA 5AONA 3V4GA 1LEBA 4R8HA 3HRSA 1LFBA 4KNYA 4KISA 1O7LA 2A6HF 1HKTA 2K9SA 2UUZA 4OU0A 4TV7A 2PMUA 2Y69H 4UVCA 1ZREA 2GXAA 1S5LC 1FP2A 3A0HC 2LF8A 4N9IA 1ODDA 4CHUA 3O2PE 4ENMA 2L9SA 1B6AA 2M87A 2YR2A 4HRIA 1I5ZA 3MD2A 5M5XJ 1IJWC 1RUOA 2GAUA 3L2WA 2M1BA 2BHZA 1A5JA 2EBIA 1ACIA 2DOAA 3GF2A 1YI2I 3DTEA 3NRVA 3A4CA 3HIFA 1I6XA 4F3QA 3J80Z 1OR7A 1XMKA 5GADJ 1GUUA 1SC7A 4A3MJ 1ETYA 2JA6J 1ON2A 4XLCA 1LE8B 4M72A 4A93J 1O57A 3CCMI 2CSOA 3L7WA 3FHZA 3EYYA 4PJ0C 3OS0A 4JX6A 5K5OA 3R0JA 3I59B 2Q2EA 1KYWA 2IS6A 4L9NA 3OS2A 5HNHA 4D7NA 4C30A 3GFMA 3ZQGA 4EGYA 1TWCJ 4MIMA 2QA4I 3Q9SA 2K9LA 1F43A 1XD7A 3N05A 3HOSA 1RESA 4RM3A 3CCVI 3TP0A 2MLKA 4RAZA 1XDSA 5IOZA 4HDVA 1ZARA 2VKVA 3GEZA 1JJ8C 2V1DA 4MFEA 3BTIA 2K4JA 5GPAA 3WTWC 1ETQA 1R22A 3F9KA 4BHCA 2NOGA 4W1UA 2TDXA 2XRNA 5GAHJ 4OMYA 5JVTA 1T08B 1YIJI 1H89C 3KYLA 3ZN0A 1XMAA 4NDLA 5FLVA 3K2ZA 3I71A 1SD4A 2RQPA 3FK6A 5BPDA 3Q3SA 1L0OC 3L2CA 4IJAA 1I1GA 3CC2I 2ZJRF 4NUBA 2LD5A 3HBLA 4RGSA 2GA1A 2GQQA 3I64A 3WGIA 2M0MA 1A6QA 1SFEA 1QRYA 2HPIA 1KU7A 1X1DA 2VQHA 4LK0F 3DV8A 3BCBA 1DPRA 4XMYA 4E7KA 3FXRA 5L3GA 3O8HA 4Y33A 3E6CC 1TLHB 2R4GA 3G1MA 1GVDA 4EJOA 3WTSC 3LAPA 1K61A 4U0WA 4HX8A 2FBIA 1PVEA 1F4KA 3F21A 2OU2A 4IO9F 1W7PB 2HWVA 4HPQA 4WXDA 4S0HB 3JRFA 4RGRA 1B4AA 3N97A 5M3FJ 4KIGA 5KAIC 2UZKA 1N75A 3TP3A 2X6XA 1SFKA 2KIMA 2X6YA 3SJMA 2EIJH 2F4IA 4G8XA 3BY6A 5EZGA 2H27A 2V4JC 2VQGA 4HQEA 1VQMI 2X51A 5AIPA 4OOIA 4PFOA 3I54A 1WWXA 4IHTA 1G3SA 3H0DA 3M8JA 5GP9A 2QWWA 2K40A 4PZJA 1MSEC 4HF2A 2OV7A 1B59A 4GYGA 4BQAA 2ISZA 3MEXA 3LWFA 1OCTC 3EUHA 2DFEA 3LNQA 4GYIA 3BDDA 2DA6A 3ZQ7A 2RN7A 2VC0A 4JBAA 2IGNA 4A3LJ 2XGEA 3BWGA 3VB2A 4ZYHA 2XF5A 4V2GA 3RYPA 3OYLA 1Y56A 2DAOA 5BOXA 1FJLA 3OYJA 3JRBA 2LREA 2JVHA 4YRVA 2DI3A 1IZ1A 1TWGJ 2EA4A 5D4RA 2V9PA 2XAJA 4D1QA 2A5YB 4GXOA 3RI4A 5A2QZ 3MWMA 3CMAI 2VKEA 2NAZA 2Y48A 2PX9A 3LMMA 4JX5A 2MA3A 3H9GA 2HU9A 3CLQA 2E34A 4WXHA 4BE0A 2ZMEA 5HDKA 2H8RA 2LRDA 3R4KA 2KRHA 3AL0B 2Y2ZA 4CUGA 3ABKH 4X1EA 1DU6A 2O8XA 2A07F 3TL4X 3PFYA 2OCCH 3OYDA 1V55H 2EV0A 2Y30A 2LTPA 2OAZA 1U78A 2GXBA 4DJAA 3S32A 5IPAA 3AKZA 3SDGA 2ECBA 2Z2SB 2I8DA 2E7XA 2K9QA 3BG9A 4U7DA 2R5ZB 3CCJI 3FWEA 4V2FA 4Y3OA 3QPLA 1P4XA 3D5LA 1OCOH 1IF1A 2CV2A 3WTXC 1JHFA 1FBSA 1WGXA 1N77A 5EEHA 2PLYA 4KA4A 5LFAA 5E3NA 2EZIA 4H4KC 3S1QJ 4ZYDA 3K4LA 3PUBA 2BVLA 2GWRA 2LKXA 5BPIA 3OY9A 3FZVA 3HB9A 2DMTA 4KYWA 4XLPF 4ZC3A 1RRJA 2OC6A 3CESA 3L2QA 2FOWA 3K4JA 2P81A 3CD6I 1FOWA 4MO7A 1QA6A 4DYCA 2M4KA 3KEYA 4ZTFA 4U0YA 4DQ2A 4Y15A 2NVXJ 1X3WB 2AXTC 3F8BA 3Q9VA 1IV8A 4N4NB 4OIRF 2R5ZA 3JRHA 4A12A 4MNUA 4L9VA 4ANJA 1OMIA 1NG6A 2MSYA 3H9QA 2V1UA 3LSRA 4LIVA 5LEKA 3ML6A 4Q47A 4MTDA 3WTVC 5BNGA 2A5WA 4CA0A 4RB3C 5CYVA 2XAFA 2R7VA 1BR1A 1V5FA 3LSGA 1ZRDA 2IT0A 1X3UA 4HNTA 2EJRA 2L54A 1YFHA 1ZR2A 2GXGA 4G6QA 5K1YA 5HS8A 3RZDJ 2BY0A 2Z3YA 3E5UA 1R5GA 4PJNA 4UXNA 3A03A 4PJLA 2R7RA 2ME6A 5FFZA 2E5ZA 1PDNC 1UHMA 2R7WA 2MG4A 4B48A 5HDGA 1QBJA 2DXIA 2JQ7A 1D8KA 1MMDA 2E1CA 2DOEA 2O0YA 3CZ6A 5HODA 3H5RA 1S7OA 1BI1A 2RKHA 4JK1X 4EJUA 3DQVC 1A36A 3C1DA 3U9GA 3GLLA 3OSGA 5FROA 1TC3C 1TWHJ 4EJVA 4A69C 1EKEA 5FKNA 4HZFA 3OS1A 2H6BA 2DQRA 2JT1A 3LFUA 4EEFG 3HTUA 2FQ4A 2O6GE 5J8FA 2HVSA 1ULYA 2CQ7A 2IEKA 2WAQA 4EVIA 2CMPA 4XKVA 2LDUA 3AG1H 1J75A 2WBMA 2QCOA 1JUPA 1YW9A 3KFWX 1B8IA 3ZMVA 4RB2C 3K0LA 4XORA 2PMHA 1HW5A 3LSTA 1XMXA 3NQOA 4RA2A 1WZ2A 1UHWA 2NRAC 1E0EA 1FOXA 4PSWA 3DBRB 3K1PA 2CH0A 5JHFA 2ICWG 3DWLE 3Q0UA 4M6YA 2FRHA 2DDBA 4KDPA 4ENNA 4AUXA 2ID3A 3V8KA 1GV5A 2OTLI 5CVRA 2CQQA 2VODA 2DJIA 5ED4A 3ERED 3OIQA 2W24A 5IP7J 1WVRA 5HLTA 2LR8A 2NS0A 4LD5A 1R1UA 4YEJA 2QQBA 3V7RA 2XPWA 2WAFA 2VIXA 2WC2A 4JQFA 1D3YA 5CQGA 3ZQCA 5B66C 3CCRI 4YFNF 2PN6A 4ITVA 1VQ8I 2B7EA 2CS3A 2NVYJ 3JRGA 1S8NA 1ZN2A 1ZLJA 4YG2F 1MJBA 4G12A 4HLXA 2XHKA 1R23A 3BR0A 3JR9A 1K79A 4M9ZA 1YS6A 5J1UA 3I4PA 3LAJA 4II3A 2R7UA 1MGTA 3GX4X 4E7HA 2GZWA 1MDMA 4BHBA 5L3FA 4U7BA 2QSFX 3PIOF 3E6MA 3HGYA 2JUCA 3KP3A 1IC8A 4S04A 3S1NJ 4Y17A 3RCOA 2AXLA 1WJDA 3PFIA 2VJ4A 3REOA 1DQUA 4EM2A 3CJQB 2Y0SA 2GM4A 4FQGA 2VOOA 5D5UB 2G7HA 3HSEA 3JRIA 5IT9Z 3I9V2 2X48A 4PCQA 4PJJA 3M8FA 1JTXA 3MKLA 4Q5SF 3BPVA 2HDCA 2HXIA 4YIIA 1T98A 1UHSA 5E3OA 1FTZA 1BW5A 2JK3A 3FDYA 3H92A 2Q1ZB 1IN6A 1WCMJ 3HG9A 3JREA 4KMFA 1O7FA 2A69F 1X3ZB 2EZHA 2QYOA 1S7EA 4WX9A 4A3DJ 4F52A 2XGDA 5J3LA 1XDUA 2R0QC 4HF1A 2QF7A 1BA5A 4HYEA 2DPDA 2Z33A 5KNLA 4CCKA 1EH7A 2CWEA 2HQ5A 1FNNA 2ZXWH 1X4PA 3D1NI 3RSNA 3CP8A 3T5XA 2JN6A 3K7AJ 1GDTA 3FXLA 3DXJF 2LKPA 2XASA 5D6FA 3OYBA 3QQAA 3MAJA 3KP2A 3GZ5A 4WF2A 4IXAA 5CVJA 2I10A 2OCEA 3IH3A 2F5CA 3SZPA 4XOPA 3HOUJ 3J81Z 4AVPA 4M3EA 1J09A 5EEAA 1MNMC 5CJ9A 1UELB 2PBIA 1S7AA 1FY7A 5E3LA 1D0ZA 1QU3A 2FSWA 1OLTA 4KIBA 2QKLB 3B6CA 3W2VA 1EA3A 4C3JJ 1MNEA 2K85A 3NAUA 3HSRA 2VUMJ 2EIMH 3I4MJ 2YU9J 1J59A 2HR3A 3DKYA 2Y0MA 2O7OA 1BL0A 1Z1DA 2CV0A 3OYAA 1O3TA 3L09A 3I53A 1IGNA 5FKKA 3MKYB 1R5HA 1HDDC 1U8RA 3KIOA 1VI0A 3R61A 4GO1A 3ZMTA 2BXZA 2R7OA 3CDHA 3OOPA 5FRNA 1SANA 1AHDP 2BY3A 1IXRC 3ZQHA 4KITB 1L3LA 2A68F 5DD8A 2L7MP 1KQ0A 1Y1WJ 4BUPA 1Z91A 1MMAA 4L18B 2LG4A 1VQPI 1GVJA 4AIJA 2F2EA 3DEUA 1K6YA 3FXKA 3V8JA 3D5SC 4AYBN 2ZFUA 2RQQA 1ZG3A 3PUFA 4RLFA 3W6JB 4M3FA 2MABA 1ZG1A 2E2IJ 2EB7A 3HUGA 3S17J 1UAAA 2DT5A 2DU9A 3BTCA 3PM1A 5J4VA 1LFPA 5E79C 5E8IA 3RKQA 1WPKA 3JRCA 3I59A 1SD7A 1OISA 3IKTA 1N78A 1MJAA 2L7FP 2XAUA 4CZZA 3CLOA 2I5UA 1HLVA 2YX7A 5KVRA 5J47A 4FISA 3U1DA 2VQLA 3K6GA 2EZLA 4BEHB 4G6DA 3VYTB 4V19K 3QODA 1YJNI 3A01A 3E7LA 2M2EA 2RNJA 4XN3A 4KT5C 5D5VB 1LUJB 2DK5A 3MMYB 2QVOA 1H8AC 2O61A 4I99C 2E19A 2L9NA 3F72A 1DPUA 3OYFA 3FXMA 1DGRM 3H1CA 3RTRA 5H20A 3JAMK 1RIOH 3IHUA 1YX5A 4A6EA 4NC8A 2KHMA 3HZJA 1YG2A 2HOEA 1SAUA 5F08A 4I0AA 2RREA 4Y4RA 3OYGA 2X9DA 1DGWY 4BQOA 1NH3A 1TT0A 3TEDA 2A3SA 3BR5A 4ZYGA 3OIPA 4EJWA 1AU7A 3G6EI 1Y1VJ 2HQRA 1T56A 2V1NA 4RB0A 5IY5H 3ZMZA 1PP8F 4OIPF 1X1PA 2QUFA 3BQZA 4XKBA 2W82A 1K78A 3K70D 1SFOJ 1VQ4I 1BJZA 2AS5F 3EETA 3OSFA 1VQ7I 2FD5A 1XCBA 1N25A 2MFZA 5C4JJ 4ENKA 2ESHA 2E5NA 4ZDPA 4GDFA 4KUMA 1ZR4A 4BBRJ 3S15J 3S2HJ 4DW6A 4ZYEA 2Z16A 2CUJA 4OAYA 2BBYA 3QYEA 4AIDA 4UUSA 4ZZLA 4WK8F 1R1VA 3S1RJ 3QOEA 1WH5A 1HXDA 3T8TA 5JVGF 5E20A 5FB2A 1ETOA 1DDNA 4L9JA 2K27A 2BOLA 2ZSIB 1A31A 4A3GJ 3CF2A 4ZTJA 3IAS2 3ROUA 2OZUA 1IG7A 3I3LA 3OL4A 1KZHA 3ZMUA 4CCJA 1D0YA 3Q0WA 1RNLA 3N4MA 2WAEA 1GV2A 5E8GA 1XSDA 1OCRH 2DMNA 2F5EA 2DBBA 5DUKA 4AU7A 2R7ZJ 4FE4A 4N9HA 3ONQA 4HNVA 2HQAA 1QZYA 2XB0X 2Y0SN 2DA1A 5BMZA 2VE8A 4BJ5C 1RKTA 3G71I 1P92A 2BZTA 3A0BC 4UUVA 3TBIA 2K5CA 4PK4A 2KZGA 1FSEA 4A3IJ 2CU7A 2HNHA 4KFCA 1OCPA 3ERMA 2AO9A 2NNYA 1MW7A 4BL0B 1UG0A 1Q1HA 4K2EA 2EQRA 1H88C 4NQWA 5F64A 2E60A 3FMSA 1MJ9A 1OYIA 4F91B 1C0WA 1I3QJ 1HCRA 3F8CA 2FEZA 2LSOA 2XAQA 3C7JA 1I3AA 2MH2A 2EIKH 3QP6A 3K69A 4EMSA 2PFBA 3GUDA 1UCRA 2IAIA 1R7JA 1SEUA 4BHPA 3R60A 5M5WJ 2W84A 3BR3A 3SZTA 3KZZA 2F5VA 2MGQA 3K2AA 1SMYF 2X1CA 1SVLA 2ZSHB 4RB1A 1JUSA 1YLFA 1UB9A 2W85A 2LLKA 3RPUD 2H8WA 4EJTA 1QHGA 4J19A 1X58A 3PO2J 4XSZF 2LY1A 3KX2A 4U88A 3BZCA 2VJIA 3KP7A 4YIRX 2HI3A 3FKIJ 4M6VA 3BT9A 2CV1A 2QQ9A 2VT3A 4I0BA 5F04A 3DBLB 3IAM2 3DCFA 3S3MA 3ZR8X 5LLQA 4WCGA 4BAYA 4P55A 5TISC 5BQTA 3HHHA 2NOJB 1ZELA 2DPUA 2VBYA 5EG0A 1ZK8A 3I58A 4DNCA 2X1EA 2X0LA 3V8LA 1XS9A 2D1VA 2VT2A 2LF7A 3HPHA 3FMQA 2CW8A 2MD0A 4A6DA 1Z3XA 2WAQN 4M71A 3L1PA 1TQPA 2D5VA 2VB6A 4UB8C 3LA3A 3DPUA 2W25A 4DBRA 4PSXA 1T6SA 3ZGKA 4IRGA 4NC7A 2MYSA 1HSJA 4MLOA 1FLIA 3QPTA 1MKMA 4AM3A 4HDUA 3K4KA 3I0TA 1W1WE 3WTTC 2R3SA 4RAGA 2VI6A 2LVSA 1X1CA 3PIPF 3LSKA 3FBNB 2O9LA 4UV9A 3OOUA 1FOKA 2H6CA 5HS7A 5DDGA 4P9UA 1W4MA 4DYQA 2HVQA 1MBGA 4G6TB 2M7BA 3D0SA 5CPRB 3QOPA 1FMVA 3JTGA 2KZVA 2VPRA 3L2VA 4ZDLA 3DPTA 2FNPA 5FKMA 2IRFG 1EH8A 3E97A 3KP4A 2DK8A 3HOTA 2ZKZA 2IS2A 1T95A 1Q1VA 4HA8A 4BXUA 2QBYA 5E1ZB 1S6LA 2VN2A 4XNFA 5EGOB 4BGDA 3EUKL 3FKJA 3JTHA 3F3XA 1YW8A 1IN7A 1FIPA 1PUFA 4E7IA 4HF0A 5DS9A 3OYCA 1MNDA 2L01A 3MZHA 2G9WA 2KL4A 2KLOA 3PJRA 4AYBA 2LBFA 4JP0A 4AIHA 2HQNA 2IP2A 1TW3A 5F0FA 1ZRFA 1G6NA 1OQYA 2UWMA 5CVVA 2F4OB 3S2DJ 2GOMA 2ZNZA 2MLGA 3AG4H 2HPMA 4ZDOA 3GLXA 1ETKA 3ZRGA 1GXPA 2V1XA 3A01B 1T38A 3G3ZA 1G2HA 3O6BB 2D45A 1U0JA 5E3MA 3PL8A 1W7PA 3EDPA 2M8EA 2J5OA 2XKPA 4XRSA 1E3HA 3DLLF 3K4CA 2P7VB 1IXSB 1YJ9I 3ZP5A 1E3OC 1W36D 2UXXA 2E1OA 5LGTA 4BH9A 1KYZA 1ZKGA 3FXUA 1YYVA 5FLMJ 5EGOA 3WE2A 3VEPA 4S05A 1ZHFA 2K02A 3M8EA 2XF7A 1NTCA 3ZQFA 4LLNA 3GTPJ 1IDZA 2DTRA 1IXCA 4CCOA 2KIUA 1B72A 3GZNB 2HYFA 2XB5A 1WHUA 1K7AA 3U21A 1V54H 2YU3A 2XF6A 1H9GA 3WGHA 5JHUA 1Z67A 4HNUA 2QLZA 3ZCOA 5DM7F 2EZKA 2XUBA 1T39A 1MSFC 2NXNB 5D8LB 4Y13A 3SDBA 4W97A 3K9TA 3HSFA 4YFKF 3H0GJ 1QPIA 4R79A 2KT0A 4FHTA 1J5YA 1ZGAA 4D7MA 3BG5A 2V6CA 4Z6YA 3OR2C 5E1WA 5DCFA 2LOOA 3TW7A 2V26A 5C4XJ 4EM0B 2DDAA 3H3ZA 1BN5A 2M30A 3RQIA 1O3SA 3GWZA 4CYDA 1T33A 2K9MA 1WJAA 2JSCA 4CICA 1HA8A 5KCMA 3GTLJ 4FT8A 4IVNA 2PQ8A 3ELKA 5LEJA 4G7OF 3P5JA 2Q2EB 3JAMZ 2CW7A 1D5VA 3ZQIA 5HVQC 3GYHX 4E7LA 2E2JJ 2DMPA 4HSTA 3HPGA 2DA4A 3J7AO 4B8XA 2DT6A 3WTUC 4ZZDA 1AOYA 5IYCJ 2LKSA 5ILUA 1VQ6I 4M9XA 2EA2A 4HBLA 1WKMA 1NG7A 2QQ8A 3VYRB 1LQ1A 1Y0NA 4HOBA 3OYIA 2X6WA 4OAZA 1MBHA 1XSXA 2HTSA 1FIAA 2IGMA 2QGUA 1CF7A 1OCCH 3RKYA 4A2UA 4M3DA 3J7YJ 4CCMA 1LEAA 2KJCA 4BU2A 1KA8A 5DV5A 3GTKJ 3GFJA 2ZJ2A 2R5YA 2K4BA 4C3IJ 2X1DA 5GPCA 2QBYB 4KMUX 4XBFA 2A6EF 1R4NB 4NQWB 1FBQA 4CO8A 5K7ZA 2F5FA 4KJZA 1YO5C 3UNGC 4I2OA 2VC1A 3H35A 2CFXA 1QZEA 2JRMA 1XGNA 3WU0A 2P7CB 4BBSJ 4MEXF 1BC7C 2K3PA 3LQRA 1YIOA 1IUYA 4CGZA 4RAYA 1Z9CA 1E3PA 4RMNA 4B4CA 4I02A 3C2GA 4RGXA 1H9TA 2ZC2A 3HOVJ 1XGMA 2ISYA 4LMYA 3H3UA 4M3BA 3FM5A 3U2RA 2VKHA 2CG4A 3UR3C 2VBXA 4IRHA 3S16J 1ZRCA 1RI7A 2HKXA 2DMQA 2L0KA 4Z2YA 3HOWJ 2LH9A 2CW0F 2XPVA 1KU3A 3E5XA 1TL8A 4ETSA 4XLAA 5K7HA 5FKOA 1JKOC 3GTJJ 1MBFA 2P5KA 1GLNA 1BOAA 1YITI 3K4MA 2ELKA 2NVTJ 1QPMA 1Y6IA 5LD2C 2VJJA 4IPAA 3RDIA 1HF0A 4DOZA 5DM6F 3U1KA 1R4MB 2K3FA 2P5LC 1IW7F 3QP5A 5FD5A 5F0HA 1YHQI 1YQAA 4KICA 1R49A 3TMOA 4B3AA 1W7PD 2RVCA 3HKZN 3OV8A 3CMYA 1ZH5A 4C9YA 2OJED 1LNWA 3LSIA 2XGCA 3Q0VA 4PGGA 3GW2A 3HOYJ 3F8NA 1KU2A 2EFOA 2HGCA 1FX7A 4D0PA 2QENA 1J0RA 4FETA 1HW1A 1XN7A 3CCEI 4G7ZF 1LPQA 1TW2A 2M5WA 4QPQA 1W0TA 4D9JA 1JKPC 4P1WA 3VYUB 3TQNA 2LC2A 2BXYA 1WSUA 3LSJA 5H2FC 3TO6A 4A3JJ 3GTOJ 2BVMA 2Y9ZA 1W5TA 3HDDA 4RBOA 4A0YA 3KP6A 1IDYA 5TGTA 1EJ9A 1BIBA 5L3CA 1SMTA 4ZJZA 5TJJA 4BE1A 5HLHA 3BG3A 3DU5A 4DGWB 2L7ZA 1UJ8A 4A3EJ 3F23A 3E1SA 1POGA 2OTJI 4HEA2 1XPXA 3ISPA 1HDPA 2F48A 4BYYA 4CCNA 3OYHA 2NS8A 4AIKA 2X6OA 3QPHA 2HZDA 2KPMA 3TDUC 5EDNA 1BC8C 2P4WA 4L5EA 2YX4A 4BQQA 4IHWA 2EFQA 3D5RC 3QU3A 3BJAA 3M9AA 1G3YA 3QYFA 3FK7A 3H5AA 3KYDB 3ZN1A 1ZQ3P 2FMLA 5IYDJ 2KP6A 2JA7J 3ECHA 5EZHA 1IRXA 2B9SA 3DFGA 3ZMDA 3CCLI 4E70A 2STTA 4L5IA 2F6CA 4IEJA 2VASA 1O4XA 3CCSI 2HVRA 4CCLA 3KETA 2LMDA 2EPFA 1XGOA 1ORKA 2STWA 2PMZN 1T2KA 3R0AA 3ZMSA 2M45A 3NARA 4MFDA 5KHDA 4XRSG 2E1MC 1TWAJ 2ZFWA 1SD6A 3S8PA 2QSHX 2ETHA 2O5RA 3BTJA 3SYTA 2L5QA 3SFIA 1FT9A 2E71A 1RR7A 2BW3A 2LP0A 1WFXA 5HS9A 3T1BA 2DQLA 3E5QA 2HOSA 3RKWA 1KU9A 1MH3A 2D1HA 2WY7Q 4I7HA 2ADUA 1QQIA 1WJCA 2VJ5A 5ICFA 4C2MJ 3PQKA 4Y52J 2XKOA 1RKWA 2VE9A 3ZXSA 5J1YA 4X6AJ 5B1AH 2GIZA 1FOYA 1ON1A 3RQ4A 3KLNA 1LDJA 3DEWA 1VQ5I 2M3AA 3VPRA 1J2XA 4XICA 3DP7A 4DYRA 3EUAA 5CVIA 1XC5A 5H6RA 2ME0A 2EFPA 5AIQA 1BI0A 2CQNA 1XB4A 2XSDC 4HQMA 5LHHA 4XRFA 2E1MB 2H94A 4I76A 2JSPA 4E7ZA 1R71A 2NVUB 1I1SA 2FUG2 2IS1A 1G59A 2ESNA 4XRMA 1GT0C 4FTHA 2J5PA 2GBYA 4ESBA 3F8FA 3BG6A 1G3WA 2QEXI 2W48A 4XKWA 1ZG5A 3F6OA 4EQQA 2H1KA 4BY1J 2XAGA 3G4SI 1X19A 2WV1A 3W6VA 1MZBA 1TNSA 1P7IA 3HKZA 2NNNA 3I55I 1TNTA 2FOKA 1Z6RA 4P5OA 2DN0A 3DTIA 3F6VA 2DFHA 2ZMEC 2CUZA 5CQEA 1XGSA 1QHHD 2IGKA 3S14J 5GTIC 3PNYA 1T0FC 3O3KA 2W57A 2XDVA 4BS9A 2P0WA 1MMNA 1D1BA 4ESFA 3TOBA 3CUQC 4A5MA 5JI6A 4B47A 3V7CA 1BR4A 5M3MJ 3RIRA 1RUNA 3VODA 1U6GA 4XLNF 3M7GA 2ZJPF 4RAFA 1PYVA 1ETVA 4ABZA 3CCQI 2IA2A 3ULQB 2V9VA 4A0ZA 1WQ2A 1MD0A 4GRIA 3GZ6A 2IPQX 2IW5A 2COBA 2JMWA 3HOXJ 5IP9J 1IN8A 3TKYA 2W1OA 5JLXA 1IRGA 2EV6A 4XLHA 2EILH 4UUTA 2ELHA 3CJNA 1YE9A 3GFIA 1AKHA 5EEGA 3W6KB 1XX5A 5J8CA 3MKZA 4J00A 3LA2A 5J1RA 3LSHA 3JRDA 2WWYA 1B72B 2IJLA 4C2TA 3IUOA 2Z1DA 4IHXA 4EATA 3DKXA 4E7JA 2KIQA 3JRAA 3SEZA 1Z6TA 4XONA 4II2A 2VBZA 3BJOA 2QQAA 1JKQC 3BTLA 3MN2A 4ON0A 1QVTA 2HXOA 4QPOA 1KONA 5F1RA 5LHIA 3WU1B 1OR7C 2KDOA 2XVCA 1Y8RB 4M74A 4MQVA 2CUEA 4QLCU 3JSOA 2YSRA 3GTGJ 1F5TA 4HAMA 1LVKA 1MBKA 2HOTA 3B02A 5B5EC 3E6DA 3J81K 2DFFA 3KP5A 4ZYAA 3WTYC 3OIOA 1YOVB 3HEFA 5F27A 1K6OA 4YFXF 2WV0A 4IQJA 2DO7A 1QO0D 1JGGA 1AKHB 3SQNA 3VSKA 2HEOA 2X4HA 3HJEA 4X0GA 1Z21A 2R92J 1V3FA 2JA8J 3UKGA 5ILVA 2XV4S 3Q5FA 3CQZJ 1YTYA 1WH7A 4L0ZB 2LBFB 3FM3A 2RNGA 2B63J 2E35A 3IP4B 1AWCA 1JE8A 5D6EA 2HS5A 3KLOA 3QYBA 4IRIA 1UMQA 2IXSA 3KZIC 3GVAA 1UFMA 4NC6A 3K10A 4AWXB 2VXZA 2NVQJ 4PUSA 3TDZC 2M0CA 5D4SA 2XAHA 4BQNA 3J7AY 1ZGJA 5H6QA 4XLEA 3FXJA 1STZA 4A3CJ 2PJPA 1T8IA 2LYCA 2GLOA 2DMUA 2KIFA 1K78B 2A61A 3FIWA 4QTRA 5HNFA 4CYCB 4A3FJ 3BC8A 1OYYA 1YS7A 2CQKA 4L0YB 4Y7NJ 1D8JA 2L7KA 4HX4A 3M07A 3P7NA 3JSPA 4LB5A 1XG1A 4IHYA 2P6TA 4RS8A 2IA1A 1B1BA 1G8XA 1CF7B 2L9VA 4M73A 4UHTA 3DF8A 4D5CA 2P6SA 2FBKA 1JTYA 4NBQA 5GTHC 5JLWA 1BOBA 2IA0A 3A2KA 3K4BA 1TWFJ 4DZPA 1HSTA 3SEQA 2GA2A 4OMZA 1K4SA 3M3YJ 4I09A 3M1CA 1ZLKA 2JA2A 2FE3A 5KAFC 1W5CC 1TQMA 2KRFA 4BACA 1O3RA 3GBGA 1QNTA 1REPC 2ZNYA 5E1XA 2HYGD 3GXOA 1SAXA 1FYLA 3HHGA 3CCYA 2EFNA 3DEEA 1I50J 4F93B 2MD5A 2KRCA 1YRNA 1PJRA 5HOOA 3ESWB 3KE2A 2E2HJ 5JFRA 4D5FA 1R6RA 4JX4A 1I27A 4CYCA 3E3VA 2BEOA 2G7UA 3ABTA 4LK1F 4AVZA 3WHBA 4M3GA 3K1NA 3CF5F 4BJ6C 4KT6A 2M4GA 1Z3YA 2HTJA 4F92B 2Y9YA 1BIAA 3GO5A 4XL9A 3CTAA 5FKLA 1PUEE 3KPHA 1BBYA 1H0MA 2JWTA 4G9YA 1RZ4A 3O8GA 2DLLA 3C2HA 1M1EB 2HYJA 1P7JA 2K86A 4IOAF 4WWCA 3BR2A 2FU4A 4ENJA 1USTA 2DTZA 3FMRA 2A6TA 5F0CA 2IVMA 3HRUA 3I4NJ 2FX0A 4LOCA 2CYYA 2HKOA 1R36A 1Y39A 4UB6C 1TQIA 4IL6C 2DA2A 2JZYA 1U5TB 4MQ9F 2HDWA 2DT7B 2LY9A 2PEXA 2M8GX 3COAC 1WJFA 2BW3B 5LGUA 1U5TC 1O3QA 1A35A 1GHCA 3IKVA 3ASOH 2RAEA 5K5QA 4PDKA 1YX3A 2M34A 3ASNH 2ACJA 2JTVA 4H0EA 3SFZA 1YW7A 5E17F 1D0XA 2D2WA 3QRFF 2XROA 1FYMA 1FMWA 4XKCA 2HDDA 5FFXA 3IV5A 1IAWA 3CUQB 1FPQA 4FCYA 4QSHA 1Y8QB 1Y0UA 3PNVA 4HG2A 3BLYA 3M4OJ 4B43A 1NK3P 2V7FA 2N8GA 3DBHB 1QZZA 1NK2P 3B73A 5DTDA 1KQ9A 4IQ4A 3AG2H 3DLAA 3S3NA 3JW4A 4WXCA 4XQFA 3OYMA 1FSHA 3OL3A 1ZGWA 1HC8A 2LNBA 5CLSA 1K83J 4A3KJ 3BP8A 3CCUI 1IRZA 3C18A 2LY2A 2M7AA 2BHYA 2B0LA 2EH3A 4G7HF 4I98B 2CJJA 1R1TA 3G73A 3VFZA 2BGCA 4DBQA 2CGPA 1W36C 3BZKA 2MW8A 4CDGA 3B6AA 2OA4A 2MC4A 1VFCA 1BI3A 4UVAA 3MZ8A 3ABUA 4B1RA 4B3XA 3TW6A 3CC7I 3HM5A 2WTEA 2BYVE 2COMA 1VQ9I 4UY8I 4BEHA 1MBEA 2IBDA 3L2RA 4F7ZA 5L3BA 2GOXB 4O3MA 3CMMA 1IO2A 2E36A 3K70C 1UZCA 3HGGA 1AA7A 3MCZA 1A6IA 5DYMA 3T0YA 4IX7A 1MDMB 3IRRA 2FJ1A 3CDLA 5D8KB 3S1MJ 3H3VK 1VQKI 3EQLF 2XIGA 4KIFA 5IP6A 4HX7A 5JR3A 1KQ8A 3HL2A 3AL0C 1B9NA 2JA5J 4BKXA 3LQQA 3RZOJ 4I01A 4LLGF 1ZAOA 2Q0OA 1P9QC 4FX4A 2HFHA 3W3CA 1IN5A 4BXFA 4BE2A 1RPWA 3SZGA 2MBFA 2BY2A 2R7SA 5FLXK 2DYRH 2Z99A 3OR1C 4XSXF 3IWZA 4LG3A 3GTMJ 2JPCA 2LFBA 3HYIA 5TRDA 5B3SH 3BZ6A 2JJ7A 2EK5A 2ZXHA 2QM3A 4QIWN 1MMSA 3KZYA 1YJWI 4RDUA 1Z0XA 1IUFA 2JRTA 3RPQA 1S9HA 5EG0B 2JPBA 2FNAA 3RJPA 3OWTA 4CZCA 2L02A 2DA5A 3A1YA 1LFUP 1GXQA 1X2NA 5KK1A 1HBXG 2VXDA 5FO5A 4N4OB 3ZQQA 2W00A 2Y75A 4R1HA 1Z05A 1JHHA 2CO5A 2VONA 3G2BA 1USSA 3C2BA 2OQGA 2K7LA 1JUMA 2OBPA 4N0BA 3VSLA 3I56I 4FE7A 2H09A 4U0VA 2V6EA 4EM1A 1LDDA 5FJ8J 3H9JA 1TP4A 2ZO4A 3PSFA 2ECCA 3TO9A 3KEOA 1X1BA 2IS4A 2DODA 3CUQA 4JYKA 4RLQA 4YIFA 2E7WA 3QPSA 2BV6A 4A0XA 1X4OA 4L5JA 2DA7A 3CDIA 1WJEA 2DA3A 1G3TA 1KGSA 2E1NA 5HLIA 4MTEA 1PP7U 1XTAA 1G4DA 3LOCA 5HDNA 1FBUA 2QZ8A 3LL7A 2DCEA 3SXYA 4A3BJ 3GFLA 2VLAA 1ITYA 3IRQA 2RC4A 1VTNC 1EH6A 5ILSA 2ID6A 2NYXA 1HW2A 5ERIA 3AFHA 1OFCX 1B8IB 4UUSB 5C3EJ 4IKFA 1ETXA 3BROA 1BW6A 1FEXA 5F6FA 5K5RA 2Z5UA 3DTKA 4CXFA 2O03A 3ZOBA 1CGPA 1P4AA 1JT6A 2WADA 4IOCF 4NNJA 1RC9A 3WU2C 3IL2A 2EFWA 3GTQJ 5ICEA 2WB1A 5LBQA 2EV5A 4E4HA 1V4RA 1BJAA 2FQ3A 2O3FA 1VNDA 3FX3A 1ETWA 3HRTA 1WJBA 4DIQA 5FRMA 2ZXIA 2FF4A 4GFBA 4HV5A 3P9IA 3BOQA 1OPCA 2VKDA 3J7ZI 1VZ0A 4PFPA 1ONVA 3WODF 3MFKA 2X85A 1SD5A 5CVUA 1SFXA 4J01A 2AQEA 4PJMA 5GAEJ 3HOZJ 1EF4A 3GCMA 3MZYA 4L9TA 5IT3A 4IF4A 3KEQA 3KCCA 4NB5A 4AD9A 2CQXA 4XOTA 2FMYA 1WJ5A 1RETA 4BJTA 3K1MA 4GCVA 2MC3A 5DD4A 1X2MA 3F22A 4XR6A 2KDZA 3L00A 3HTSB 2OD5A 1FC3A 3CUOA 2RGVA 2DW4A 2C6YA 4P96A 1U8BA 4OIOF 1WI3A 4E7SA 3FF5A 4LJZF 2PJRB 1HKQA 3ECOA 2G0EA 2W7NA 1TT5B 1OYWA 2ZMEB 4IZZA 3R6SA 1R58A 1ZTRA 3RYRA 5EJCA 1UG2A 2XPUA 3HXLA 1FYKA 2PG4A 1ENHA 4LG0B 4ESJA 4C2UA 3E6BA 3CJTB 2QKMB 1TZLA 3TOAA 2VBWA 2W4SA 1VQOI 3VWBA 3FXQA 2AHQA 3VDXA 1VF9A 4GGGA 1PUFB 2R7XA 2FA5A 5EYRA 1DP7P 2ZJQF 1J7KA 4HW0A 2F5DA 3F8MA
chains in the Genus database with same CATH topology
2EINH 3ABLH 3AG4H 3AG2H 5B3SH 2EIJH 3ASOH 1OCOH 3ABMH 3ASNH 3X2QH 1OCRH 1OCCH 2DYSH 2ZXWH 3ABKH 5B1BH 1V54H 3AG3H 2OCCH 1V55H 5IY5H 3WG7H 3AG1H 2EIMH 5B1AH 2EILH 2Y69H 2EIKH 2DYRH 1OCZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  3ABL H;  3AG4 H;  3AG2 H;  5B3S H;  2EIJ H;  3ASO H;  1OCO H;  3ABM H;  3ASN H;  3X2Q H;  1OCR H;  1OCC H;  2DYS H;  2ZXW H;  3ABK H;  5B1B H;  1V54 H;  3AG3 H;  2OCC H;  1V55 H;  5IY5 H;  3WG7 H;  3AG1 H;  2EIM H;  5B1A H;  2EIL H;  2Y69 H;  2EIK H;  2DYR H;  1OCZ H; 
#chains in the Genus database with same CATH topology
 5IOY A;  4F55 A;  2LK2 A;  4ZH4 F;  2DJN A;  1F9N A;  4IHV A;  4HLY A;  4KN7 X;  4C3H J;  3DU6 A;  4Q48 A;  1YRN B;  1VQL I;  5FGM A;  2VQC A;  4NHJ A;  4LLL A;  5LHG A;  3EUH C;  2IGO A;  3H36 A;  3A02 A;  1FWZ A;  3PSI A;  2BE5 F;  2WB1 N;  3WGG A;  3EYI A;  4QWQ A;  1P4W A;  1JJ6 C;  4G94 A;  4XM3 A;  5D5W B;  2R7D A;  2V79 A;  4JOM A;  5CKT A;  1A04 A;  2L4A A;  1LJ9 A;  4BDY A;  2KQR A;  4IHS A;  3KYC B;  3MKW B;  1OCZ H;  3I5U A;  3IH2 A;  5LRR A;  5LRS A;  5HLG A;  5E18 F;  4BY7 J;  4PGH A;  5D5X B;  4DZJ A;  3TO7 A;  2PI0 A;  3FXO A;  2XC7 A;  2PMZ A;  2DYS H;  1F36 A;  1MBJ A;  1U3E M;  2TRT A;  1IN4 A;  1WRJ A;  2RV8 A;  3DKW A;  1Z7L A;  3QAH A;  4HSR A;  2XGX A;  2R5Y B;  1F1Z A;  1NHA A;  3QU6 A;  5IYB J;  1XSV A;  1I6H J;  1D1A A;  5DCM A;  2Q8K A;  4BXX J;  1MH4 A;  1BM9 A;  1JKR C;  4Q4Z F;  1IV6 A;  3HRM A;  2EIN H;  3C3W A;  3DPL C;  3P9C A;  2ZXJ A;  2ZBK A;  5C44 J;  1LDK B;  1T0F A;  2HOA A;  1S3J A;  3L9F A;  2L4M A;  1V5E A;  1SVM A;  1SVO A;  2DFI A;  2A05 A;  3OYK A;  4MHG A;  2DOF A;  2KJB A;  3H5N A;  3W2A A;  1ZYR F;  4OWR B;  1SFU A;  3AAF A;  5J4Y A;  4OIQ F;  4M9S A;  3FBI B;  4LIT A;  5A2Q K;  1U5T A;  3RPU A;  4YEL A;  4XN0 A;  2XRL A;  4FAS D;  2JUG A;  2KIS A;  3HC7 A;  4HV6 A;  3PNT A;  3MVP A;  3CC4 I;  2H1L A;  1HKS A;  5J6X A;  2Z9O A;  2EWN A;  4RGU A;  2Y31 A;  4O6J A;  2R7Q A;  2AQF A;  3LSM A;  3PQJ A;  4LIU A;  4B09 A;  3S3O A;  1XCV A;  2FBH A;  3X2Q H;  3WHC A;  3BG7 A;  4O5V A;  3OYN A;  1CQT A;  1D5Y A;  2OZ6 A;  5B1B H;  1W5S A;  5F1J A;  3BQY A;  2CUF A;  3EPZ A;  5DEQ A;  3W2W A;  2CRG A;  3OYE A;  1R5I D;  1WI9 A;  1I39 A;  3T8R A;  3GME A;  4CH7 A;  3WG7 H;  5L3E A;  1APL C;  1R9T J;  1B9M A;  2L2O A;  2O8K A;  3M1E A;  1HQC A;  4UV8 A;  3IC7 A;  1FZP B;  2F4M B;  3RKX A;  3S2W A;  3BR1 A;  5LGN A;  4LB6 B;  3K4N A;  5EF6 A;  6PAX A;  1JXS A;  3NWS A;  4LG0 A;  2VOP A;  2UXN A;  2OQR A;  3WE3 A;  3ABM H;  4OIN F;  2M9H A;  3SHF A;  2OF7 A;  1TBX A;  4FX0 A;  2TCT A;  4A5N A;  4BNC A;  1DUX C;  3TGN A;  2R93 J;  2FXA A;  3NWT A;  1R00 A;  3LFK A;  4LFU A;  1VQN I;  4EV0 A;  5J40 A;  3V42 A;  4EGZ A;  3G1O A;  2R7F A;  5GAG J;  2QSG X;  2PJR A;  4CSW A;  3IWF A;  2VL8 A;  3OMY A;  2KFD A;  1K4T A;  5DUI A;  3BCA A;  2WA0 A;  3WTZ A;  1DU0 A;  1S29 A;  1P2F A;  1TTY A;  1BR2 A;  2YUS A;  4BDZ A;  1Z7U A;  1E17 A;  1QVU A;  2HZT A;  4MEY F;  3V7S A;  5FLX Z;  4B44 A;  2KKO A;  2MH9 A;  1JI8 A;  3QWL A;  3LSP A;  5K7F A;  1MMG A;  1Z77 A;  1E2X A;  1U9O A;  3E0J B;  3CME I;  2L9R A;  4XLF A;  4UNO A;  1EV7 A;  1LB2 A;  5IT9 K;  1X1A A;  1JT0 A;  3F0C A;  3FHN A;  2RDP A;  4AC0 A;  4UVB A;  4E6K G;  3VOE A;  1JGS A;  3CJR B;  1RR8 C;  1D1C A;  3S93 A;  4ASN A;  4KN4 X;  2OUM A;  3ZPL A;  5ICG A;  3L2U A;  2UV1 A;  2L3D A;  9ANT A;  1ERD A;  4P9F A;  5ICC A;  3NEU A;  2V9K A;  3ABL H;  1BI2 A;  3IH4 A;  3VYS B;  1FTT A;  3CP2 A;  1MIJ A;  3LA7 A;  2GIV A;  2P8T A;  3P9K A;  2NS7 A;  3CO6 C;  2KMU A;  1P6R A;  4XK4 A;  3HUG B;  4U87 A;  1U2W A;  2R7T A;  5FD6 A;  2YS9 A;  2VPL A;  2JVG A;  3BPX A;  1LE8 A;  1S72 I;  3FIS A;  5L3D A;  3MQ0 A;  1W0U A;  2P5V A;  3ZQL A;  2ZCW A;  4M6X A;  3WG9 A;  3CO7 C;  2BY1 A;  1J9I A;  2K9N A;  3BR6 A;  4I6Z A;  1U9N A;  3J80 K;  2OPT A;  2ZB9 A;  3PO3 J;  1QGP A;  3G1L A;  1V5G A;  2CFO A;  1OKR A;  1OJL A;  2ELJ A;  1LVA A;  4RM2 A;  5M5Y J;  2XSJ C;  3JCU C;  2YPR A;  1HOM A;  3BJ6 A;  1IRF A;  1FP1 D;  2WY8 Q;  1LKX A;  4LGW A;  5BS6 A;  1DP3 A;  3AG3 H;  4MGR A;  5DCM B;  4XID A;  5AON A;  3V4G A;  1LEB A;  4R8H A;  3HRS A;  1LFB A;  4KNY A;  4KIS A;  1O7L A;  2A6H F;  1HKT A;  2K9S A;  2UUZ A;  4OU0 A;  4TV7 A;  2PMU A;  2Y69 H;  4UVC A;  1ZRE A;  2GXA A;  1S5L C;  1FP2 A;  3A0H C;  2LF8 A;  4N9I A;  1ODD A;  4CHU A;  3O2P E;  4ENM A;  2L9S A;  1B6A A;  2M87 A;  2YR2 A;  4HRI A;  1I5Z A;  3MD2 A;  5M5X J;  1IJW C;  1RUO A;  2GAU A;  3L2W A;  2M1B A;  2BHZ A;  1A5J A;  2EBI A;  1ACI A;  2DOA A;  3GF2 A;  1YI2 I;  3DTE A;  3NRV A;  3A4C A;  3HIF A;  1I6X A;  4F3Q A;  3J80 Z;  1OR7 A;  1XMK A;  5GAD J;  1GUU A;  1SC7 A;  4A3M J;  1ETY A;  2JA6 J;  1ON2 A;  4XLC A;  1LE8 B;  4M72 A;  4A93 J;  1O57 A;  3CCM I;  2CSO A;  3L7W A;  3FHZ A;  3EYY A;  4PJ0 C;  3OS0 A;  4JX6 A;  5K5O A;  3R0J A;  3I59 B;  2Q2E A;  1KYW A;  2IS6 A;  4L9N A;  3OS2 A;  5HNH A;  4D7N A;  4C30 A;  3GFM A;  3ZQG A;  4EGY A;  1TWC J;  4MIM A;  2QA4 I;  3Q9S A;  2K9L A;  1F43 A;  1XD7 A;  3N05 A;  3HOS A;  1RES A;  4RM3 A;  3CCV I;  3TP0 A;  2MLK A;  4RAZ A;  1XDS A;  5IOZ A;  4HDV A;  1ZAR A;  2VKV A;  3GEZ A;  1JJ8 C;  2V1D A;  4MFE A;  3BTI A;  2K4J A;  5GPA A;  3WTW C;  1ETQ A;  1R22 A;  3F9K A;  4BHC A;  2NOG A;  4W1U A;  2TDX A;  2XRN A;  5GAH J;  4OMY A;  5JVT A;  1T08 B;  1YIJ I;  1H89 C;  3KYL A;  3ZN0 A;  1XMA A;  4NDL A;  5FLV A;  3K2Z A;  3I71 A;  1SD4 A;  2RQP A;  3FK6 A;  5BPD A;  3Q3S A;  1L0O C;  3L2C A;  4IJA A;  1I1G A;  3CC2 I;  2ZJR F;  4NUB A;  2LD5 A;  3HBL A;  4RGS A;  2GA1 A;  2GQQ A;  3I64 A;  3WGI A;  2M0M A;  1A6Q A;  1SFE A;  1QRY A;  2HPI A;  1KU7 A;  1X1D A;  2VQH A;  4LK0 F;  3DV8 A;  3BCB A;  1DPR A;  4XMY A;  4E7K A;  3FXR A;  5L3G A;  3O8H A;  4Y33 A;  3E6C C;  1TLH B;  2R4G A;  3G1M A;  1GVD A;  4EJO A;  3WTS C;  3LAP A;  1K61 A;  4U0W A;  4HX8 A;  2FBI A;  1PVE A;  1F4K A;  3F21 A;  2OU2 A;  4IO9 F;  1W7P B;  2HWV A;  4HPQ A;  4WXD A;  4S0H B;  3JRF A;  4RGR A;  1B4A A;  3N97 A;  5M3F J;  4KIG A;  5KAI C;  2UZK A;  1N75 A;  3TP3 A;  2X6X A;  1SFK A;  2KIM A;  2X6Y A;  3SJM A;  2EIJ H;  2F4I A;  4G8X A;  3BY6 A;  5EZG A;  2H27 A;  2V4J C;  2VQG A;  4HQE A;  1VQM I;  2X51 A;  5AIP A;  4OOI A;  4PFO A;  3I54 A;  1WWX A;  4IHT A;  1G3S A;  3H0D A;  3M8J A;  5GP9 A;  2QWW A;  2K40 A;  4PZJ A;  1MSE C;  4HF2 A;  2OV7 A;  1B59 A;  4GYG A;  4BQA A;  2ISZ A;  3MEX A;  3LWF A;  1OCT C;  3EUH A;  2DFE A;  3LNQ A;  4GYI A;  3BDD A;  2DA6 A;  3ZQ7 A;  2RN7 A;  2VC0 A;  4JBA A;  2IGN A;  4A3L J;  2XGE A;  3BWG A;  3VB2 A;  4ZYH A;  2XF5 A;  4V2G A;  3RYP A;  3OYL A;  1Y56 A;  2DAO A;  5BOX A;  1FJL A;  3OYJ A;  3JRB A;  2LRE A;  2JVH A;  4YRV A;  2DI3 A;  1IZ1 A;  1TWG J;  2EA4 A;  5D4R A;  2V9P A;  2XAJ A;  4D1Q A;  2A5Y B;  4GXO A;  3RI4 A;  5A2Q Z;  3MWM A;  3CMA I;  2VKE A;  2NAZ A;  2Y48 A;  2PX9 A;  3LMM A;  4JX5 A;  2MA3 A;  3H9G A;  2HU9 A;  3CLQ A;  2E34 A;  4WXH A;  4BE0 A;  2ZME A;  5HDK A;  2H8R A;  2LRD A;  3R4K A;  2KRH A;  3AL0 B;  2Y2Z A;  4CUG A;  3ABK H;  4X1E A;  1DU6 A;  2O8X A;  2A07 F;  3TL4 X;  3PFY A;  2OCC H;  3OYD A;  1V55 H;  2EV0 A;  2Y30 A;  2LTP A;  2OAZ A;  1U78 A;  2GXB A;  4DJA A;  3S32 A;  5IPA A;  3AKZ A;  3SDG A;  2ECB A;  2Z2S B;  2I8D A;  2E7X A;  2K9Q A;  3BG9 A;  4U7D A;  2R5Z B;  3CCJ I;  3FWE A;  4V2F A;  4Y3O A;  3QPL A;  1P4X A;  3D5L A;  1OCO H;  1IF1 A;  2CV2 A;  3WTX C;  1JHF A;  1FBS A;  1WGX A;  1N77 A;  5EEH A;  2PLY A;  4KA4 A;  5LFA A;  5E3N A;  2EZI A;  4H4K C;  3S1Q J;  4ZYD A;  3K4L A;  3PUB A;  2BVL A;  2GWR A;  2LKX A;  5BPI A;  3OY9 A;  3FZV A;  3HB9 A;  2DMT A;  4KYW A;  4XLP F;  4ZC3 A;  1RRJ A;  2OC6 A;  3CES A;  3L2Q A;  2FOW A;  3K4J A;  2P81 A;  3CD6 I;  1FOW A;  4MO7 A;  1QA6 A;  4DYC A;  2M4K A;  3KEY A;  4ZTF A;  4U0Y A;  4DQ2 A;  4Y15 A;  2NVX J;  1X3W B;  2AXT C;  3F8B A;  3Q9V A;  1IV8 A;  4N4N B;  4OIR F;  2R5Z A;  3JRH A;  4A12 A;  4MNU A;  4L9V A;  4ANJ A;  1OMI A;  1NG6 A;  2MSY A;  3H9Q A;  2V1U A;  3LSR A;  4LIV A;  5LEK A;  3ML6 A;  4Q47 A;  4MTD A;  3WTV C;  5BNG A;  2A5W A;  4CA0 A;  4RB3 C;  5CYV A;  2XAF A;  2R7V A;  1BR1 A;  1V5F A;  3LSG A;  1ZRD A;  2IT0 A;  1X3U A;  4HNT A;  2EJR A;  2L54 A;  1YFH A;  1ZR2 A;  2GXG A;  4G6Q A;  5K1Y A;  5HS8 A;  3RZD J;  2BY0 A;  2Z3Y A;  3E5U A;  1R5G A;  4PJN A;  4UXN A;  3A03 A;  4PJL A;  2R7R A;  2ME6 A;  5FFZ A;  2E5Z A;  1PDN C;  1UHM A;  2R7W A;  2MG4 A;  4B48 A;  5HDG A;  1QBJ A;  2DXI A;  2JQ7 A;  1D8K A;  1MMD A;  2E1C A;  2DOE A;  2O0Y A;  3CZ6 A;  5HOD A;  3H5R A;  1S7O A;  1BI1 A;  2RKH A;  4JK1 X;  4EJU A;  3DQV C;  1A36 A;  3C1D A;  3U9G A;  3GLL A;  3OSG A;  5FRO A;  1TC3 C;  1TWH J;  4EJV A;  4A69 C;  1EKE A;  5FKN A;  4HZF A;  3OS1 A;  2H6B A;  2DQR A;  2JT1 A;  3LFU A;  4EEF G;  3HTU A;  2FQ4 A;  2O6G E;  5J8F A;  2HVS A;  1ULY A;  2CQ7 A;  2IEK A;  2WAQ A;  4EVI A;  2CMP A;  4XKV A;  2LDU A;  3AG1 H;  1J75 A;  2WBM A;  2QCO A;  1JUP A;  1YW9 A;  3KFW X;  1B8I A;  3ZMV A;  4RB2 C;  3K0L A;  4XOR A;  2PMH A;  1HW5 A;  3LST A;  1XMX A;  3NQO A;  4RA2 A;  1WZ2 A;  1UHW A;  2NRA C;  1E0E A;  1FOX A;  4PSW A;  3DBR B;  3K1P A;  2CH0 A;  5JHF A;  2ICW G;  3DWL E;  3Q0U A;  4M6Y A;  2FRH A;  2DDB A;  4KDP A;  4ENN A;  4AUX A;  2ID3 A;  3V8K A;  1GV5 A;  2OTL I;  5CVR A;  2CQQ A;  2VOD A;  2DJI A;  5ED4 A;  3ERE D;  3OIQ A;  2W24 A;  5IP7 J;  1WVR A;  5HLT A;  2LR8 A;  2NS0 A;  4LD5 A;  1R1U A;  4YEJ A;  2QQB A;  3V7R A;  2XPW A;  2WAF A;  2VIX A;  2WC2 A;  4JQF A;  1D3Y A;  5CQG A;  3ZQC A;  5B66 C;  3CCR I;  4YFN F;  2PN6 A;  4ITV A;  1VQ8 I;  2B7E A;  2CS3 A;  2NVY J;  3JRG A;  1S8N A;  1ZN2 A;  1ZLJ A;  4YG2 F;  1MJB A;  4G12 A;  4HLX A;  2XHK A;  1R23 A;  3BR0 A;  3JR9 A;  1K79 A;  4M9Z A;  1YS6 A;  5J1U A;  3I4P A;  3LAJ A;  4II3 A;  2R7U A;  1MGT A;  3GX4 X;  4E7H A;  2GZW A;  1MDM A;  4BHB A;  5L3F A;  4U7B A;  2QSF X;  3PIO F;  3E6M A;  3HGY A;  2JUC A;  3KP3 A;  1IC8 A;  4S04 A;  3S1N J;  4Y17 A;  3RCO A;  2AXL A;  1WJD A;  3PFI A;  2VJ4 A;  3REO A;  1DQU A;  4EM2 A;  3CJQ B;  2Y0S A;  2GM4 A;  4FQG A;  2VOO A;  5D5U B;  2G7H A;  3HSE A;  3JRI A;  5IT9 Z;  3I9V 2;  2X48 A;  4PCQ A;  4PJJ A;  3M8F A;  1JTX A;  3MKL A;  4Q5S F;  3BPV A;  2HDC A;  2HXI A;  4YII A;  1T98 A;  1UHS A;  5E3O A;  1FTZ A;  1BW5 A;  2JK3 A;  3FDY A;  3H92 A;  2Q1Z B;  1IN6 A;  1WCM J;  3HG9 A;  3JRE A;  4KMF A;  1O7F A;  2A69 F;  1X3Z B;  2EZH A;  2QYO A;  1S7E A;  4WX9 A;  4A3D J;  4F52 A;  2XGD A;  5J3L A;  1XDU A;  2R0Q C;  4HF1 A;  2QF7 A;  1BA5 A;  4HYE A;  2DPD A;  2Z33 A;  5KNL A;  4CCK A;  1EH7 A;  2CWE A;  2HQ5 A;  1FNN A;  2ZXW H;  1X4P A;  3D1N I;  3RSN A;  3CP8 A;  3T5X A;  2JN6 A;  3K7A J;  1GDT A;  3FXL A;  3DXJ F;  2LKP A;  2XAS A;  5D6F A;  3OYB A;  3QQA A;  3MAJ A;  3KP2 A;  3GZ5 A;  4WF2 A;  4IXA A;  5CVJ A;  2I10 A;  2OCE A;  3IH3 A;  2F5C A;  3SZP A;  4XOP A;  3HOU J;  3J81 Z;  4AVP A;  4M3E A;  1J09 A;  5EEA A;  1MNM C;  5CJ9 A;  1UEL B;  2PBI A;  1S7A A;  1FY7 A;  5E3L A;  1D0Z A;  1QU3 A;  2FSW A;  1OLT A;  4KIB A;  2QKL B;  3B6C A;  3W2V A;  1EA3 A;  4C3J J;  1MNE A;  2K85 A;  3NAU A;  3HSR A;  2VUM J;  2EIM H;  3I4M J;  2YU9 J;  1J59 A;  2HR3 A;  3DKY A;  2Y0M A;  2O7O A;  1BL0 A;  1Z1D A;  2CV0 A;  3OYA A;  1O3T A;  3L09 A;  3I53 A;  1IGN A;  5FKK A;  3MKY B;  1R5H A;  1HDD C;  1U8R A;  3KIO A;  1VI0 A;  3R61 A;  4GO1 A;  3ZMT A;  2BXZ A;  2R7O A;  3CDH A;  3OOP A;  5FRN A;  1SAN A;  1AHD P;  2BY3 A;  1IXR C;  3ZQH A;  4KIT B;  1L3L A;  2A68 F;  5DD8 A;  2L7M P;  1KQ0 A;  1Y1W J;  4BUP A;  1Z91 A;  1MMA A;  4L18 B;  2LG4 A;  1VQP I;  1GVJ A;  4AIJ A;  2F2E A;  3DEU A;  1K6Y A;  3FXK A;  3V8J A;  3D5S C;  4AYB N;  2ZFU A;  2RQQ A;  1ZG3 A;  3PUF A;  4RLF A;  3W6J B;  4M3F A;  2MAB A;  1ZG1 A;  2E2I J;  2EB7 A;  3HUG A;  3S17 J;  1UAA A;  2DT5 A;  2DU9 A;  3BTC A;  3PM1 A;  5J4V A;  1LFP A;  5E79 C;  5E8I A;  3RKQ A;  1WPK A;  3JRC A;  3I59 A;  1SD7 A;  1OIS A;  3IKT A;  1N78 A;  1MJA A;  2L7F P;  2XAU A;  4CZZ A;  3CLO A;  2I5U A;  1HLV A;  2YX7 A;  5KVR A;  5J47 A;  4FIS A;  3U1D A;  2VQL A;  3K6G A;  2EZL A;  4BEH B;  4G6D A;  3VYT B;  4V19 K;  3QOD A;  1YJN I;  3A01 A;  3E7L A;  2M2E A;  2RNJ A;  4XN3 A;  4KT5 C;  5D5V B;  1LUJ B;  2DK5 A;  3MMY B;  2QVO A;  1H8A C;  2O61 A;  4I99 C;  2E19 A;  2L9N A;  3F72 A;  1DPU A;  3OYF A;  3FXM A;  1DGR M;  3H1C A;  3RTR A;  5H20 A;  3JAM K;  1RIO H;  3IHU A;  1YX5 A;  4A6E A;  4NC8 A;  2KHM A;  3HZJ A;  1YG2 A;  2HOE A;  1SAU A;  5F08 A;  4I0A A;  2RRE A;  4Y4R A;  3OYG A;  2X9D A;  1DGW Y;  4BQO A;  1NH3 A;  1TT0 A;  3TED A;  2A3S A;  3BR5 A;  4ZYG A;  3OIP A;  4EJW A;  1AU7 A;  3G6E I;  1Y1V J;  2HQR A;  1T56 A;  2V1N A;  4RB0 A;  5IY5 H;  3ZMZ A;  1PP8 F;  4OIP F;  1X1P A;  2QUF A;  3BQZ A;  4XKB A;  2W82 A;  1K78 A;  3K70 D;  1SFO J;  1VQ4 I;  1BJZ A;  2AS5 F;  3EET A;  3OSF A;  1VQ7 I;  2FD5 A;  1XCB A;  1N25 A;  2MFZ A;  5C4J J;  4ENK A;  2ESH A;  2E5N A;  4ZDP A;  4GDF A;  4KUM A;  1ZR4 A;  4BBR J;  3S15 J;  3S2H J;  4DW6 A;  4ZYE A;  2Z16 A;  2CUJ A;  4OAY A;  2BBY A;  3QYE A;  4AID A;  4UUS A;  4ZZL A;  4WK8 F;  1R1V A;  3S1R J;  3QOE A;  1WH5 A;  1HXD A;  3T8T A;  5JVG F;  5E20 A;  5FB2 A;  1ETO A;  1DDN A;  4L9J A;  2K27 A;  2BOL A;  2ZSI B;  1A31 A;  4A3G J;  3CF2 A;  4ZTJ A;  3IAS 2;  3ROU A;  2OZU A;  1IG7 A;  3I3L A;  3OL4 A;  1KZH A;  3ZMU A;  4CCJ A;  1D0Y A;  3Q0W A;  1RNL A;  3N4M A;  2WAE A;  1GV2 A;  5E8G A;  1XSD A;  1OCR H;  2DMN A;  2F5E A;  2DBB A;  5DUK A;  4AU7 A;  2R7Z J;  4FE4 A;  4N9H A;  3ONQ A;  4HNV A;  2HQA A;  1QZY A;  2XB0 X;  2Y0S N;  2DA1 A;  5BMZ A;  2VE8 A;  4BJ5 C;  1RKT A;  3G71 I;  1P92 A;  2BZT A;  3A0B C;  4UUV A;  3TBI A;  2K5C A;  4PK4 A;  2KZG A;  1FSE A;  4A3I J;  2CU7 A;  2HNH A;  4KFC A;  1OCP A;  3ERM A;  2AO9 A;  2NNY A;  1MW7 A;  4BL0 B;  1UG0 A;  1Q1H A;  4K2E A;  2EQR A;  1H88 C;  4NQW A;  5F64 A;  2E60 A;  3FMS A;  1MJ9 A;  1OYI A;  4F91 B;  1C0W A;  1I3Q J;  1HCR A;  3F8C A;  2FEZ A;  2LSO A;  2XAQ A;  3C7J A;  1I3A A;  2MH2 A;  2EIK H;  3QP6 A;  3K69 A;  4EMS A;  2PFB A;  3GUD A;  1UCR A;  2IAI A;  1R7J A;  1SEU A;  4BHP A;  3R60 A;  5M5W J;  2W84 A;  3BR3 A;  3SZT A;  3KZZ A;  2F5V A;  2MGQ A;  3K2A A;  1SMY F;  2X1C A;  1SVL A;  2ZSH B;  4RB1 A;  1JUS A;  1YLF A;  1UB9 A;  2W85 A;  2LLK A;  3RPU D;  2H8W A;  4EJT A;  1QHG A;  4J19 A;  1X58 A;  3PO2 J;  4XSZ F;  2LY1 A;  3KX2 A;  4U88 A;  3BZC A;  2VJI A;  3KP7 A;  4YIR X;  2HI3 A;  3FKI J;  4M6V A;  3BT9 A;  2CV1 A;  2QQ9 A;  2VT3 A;  4I0B A;  5F04 A;  3DBL B;  3IAM 2;  3DCF A;  3S3M A;  3ZR8 X;  5LLQ A;  4WCG A;  4BAY A;  4P55 A;  5TIS C;  5BQT A;  3HHH A;  2NOJ B;  1ZEL A;  2DPU A;  2VBY A;  5EG0 A;  1ZK8 A;  3I58 A;  4DNC A;  2X1E A;  2X0L A;  3V8L A;  1XS9 A;  2D1V A;  2VT2 A;  2LF7 A;  3HPH A;  3FMQ A;  2CW8 A;  2MD0 A;  4A6D A;  1Z3X A;  2WAQ N;  4M71 A;  3L1P A;  1TQP A;  2D5V A;  2VB6 A;  4UB8 C;  3LA3 A;  3DPU A;  2W25 A;  4DBR A;  4PSX A;  1T6S A;  3ZGK A;  4IRG A;  4NC7 A;  2MYS A;  1HSJ A;  4MLO A;  1FLI A;  3QPT A;  1MKM A;  4AM3 A;  4HDU A;  3K4K A;  3I0T A;  1W1W E;  3WTT C;  2R3S A;  4RAG A;  2VI6 A;  2LVS A;  1X1C A;  3PIP F;  3LSK A;  3FBN B;  2O9L A;  4UV9 A;  3OOU A;  1FOK A;  2H6C A;  5HS7 A;  5DDG A;  4P9U A;  1W4M A;  4DYQ A;  2HVQ A;  1MBG A;  4G6T B;  2M7B A;  3D0S A;  5CPR B;  3QOP A;  1FMV A;  3JTG A;  2KZV A;  2VPR A;  3L2V A;  4ZDL A;  3DPT A;  2FNP A;  5FKM A;  2IRF G;  1EH8 A;  3E97 A;  3KP4 A;  2DK8 A;  3HOT A;  2ZKZ A;  2IS2 A;  1T95 A;  1Q1V A;  4HA8 A;  4BXU A;  2QBY A;  5E1Z B;  1S6L A;  2VN2 A;  4XNF A;  5EGO B;  4BGD A;  3EUK L;  3FKJ A;  3JTH A;  3F3X A;  1YW8 A;  1IN7 A;  1FIP A;  1PUF A;  4E7I A;  4HF0 A;  5DS9 A;  3OYC A;  1MND A;  2L01 A;  3MZH A;  2G9W A;  2KL4 A;  2KLO A;  3PJR A;  4AYB A;  2LBF A;  4JP0 A;  4AIH A;  2HQN A;  2IP2 A;  1TW3 A;  5F0F A;  1ZRF A;  1G6N A;  1OQY A;  2UWM A;  5CVV A;  2F4O B;  3S2D J;  2GOM A;  2ZNZ A;  2MLG A;  3AG4 H;  2HPM A;  4ZDO A;  3GLX A;  1ETK A;  3ZRG A;  1GXP A;  2V1X A;  3A01 B;  1T38 A;  3G3Z A;  1G2H A;  3O6B B;  2D45 A;  1U0J A;  5E3M A;  3PL8 A;  1W7P A;  3EDP A;  2M8E A;  2J5O A;  2XKP A;  4XRS A;  1E3H A;  3DLL F;  3K4C A;  2P7V B;  1IXS B;  1YJ9 I;  3ZP5 A;  1E3O C;  1W36 D;  2UXX A;  2E1O A;  5LGT A;  4BH9 A;  1KYZ A;  1ZKG A;  3FXU A;  1YYV A;  5FLM J;  5EGO A;  3WE2 A;  3VEP A;  4S05 A;  1ZHF A;  2K02 A;  3M8E A;  2XF7 A;  1NTC A;  3ZQF A;  4LLN A;  3GTP J;  1IDZ A;  2DTR A;  1IXC A;  4CCO A;  2KIU A;  1B72 A;  3GZN B;  2HYF A;  2XB5 A;  1WHU A;  1K7A A;  3U21 A;  1V54 H;  2YU3 A;  2XF6 A;  1H9G A;  3WGH A;  5JHU A;  1Z67 A;  4HNU A;  2QLZ A;  3ZCO A;  5DM7 F;  2EZK A;  2XUB A;  1T39 A;  1MSF C;  2NXN B;  5D8L B;  4Y13 A;  3SDB A;  4W97 A;  3K9T A;  3HSF A;  4YFK F;  3H0G J;  1QPI A;  4R79 A;  2KT0 A;  4FHT A;  1J5Y A;  1ZGA A;  4D7M A;  3BG5 A;  2V6C A;  4Z6Y A;  3OR2 C;  5E1W A;  5DCF A;  2LOO A;  3TW7 A;  2V26 A;  5C4X J;  4EM0 B;  2DDA A;  3H3Z A;  1BN5 A;  2M30 A;  3RQI A;  1O3S A;  3GWZ A;  4CYD A;  1T33 A;  2K9M A;  1WJA A;  2JSC A;  4CIC A;  1HA8 A;  5KCM A;  3GTL J;  4FT8 A;  4IVN A;  2PQ8 A;  3ELK A;  5LEJ A;  4G7O F;  3P5J A;  2Q2E B;  3JAM Z;  2CW7 A;  1D5V A;  3ZQI A;  5HVQ C;  3GYH X;  4E7L A;  2E2J J;  2DMP A;  4HST A;  3HPG A;  2DA4 A;  3J7A O;  4B8X A;  2DT6 A;  3WTU C;  4ZZD A;  1AOY A;  5IYC J;  2LKS A;  5ILU A;  1VQ6 I;  4M9X A;  2EA2 A;  4HBL A;  1WKM A;  1NG7 A;  2QQ8 A;  3VYR B;  1LQ1 A;  1Y0N A;  4HOB A;  3OYI A;  2X6W A;  4OAZ A;  1MBH A;  1XSX A;  2HTS A;  1FIA A;  2IGM A;  2QGU A;  1CF7 A;  1OCC H;  3RKY A;  4A2U A;  4M3D A;  3J7Y J;  4CCM A;  1LEA A;  2KJC A;  4BU2 A;  1KA8 A;  5DV5 A;  3GTK J;  3GFJ A;  2ZJ2 A;  2R5Y A;  2K4B A;  4C3I J;  2X1D A;  5GPC A;  2QBY B;  4KMU X;  4XBF A;  2A6E F;  1R4N B;  4NQW B;  1FBQ A;  4CO8 A;  5K7Z A;  2F5F A;  4KJZ A;  1YO5 C;  3UNG C;  4I2O A;  2VC1 A;  3H35 A;  2CFX A;  1QZE A;  2JRM A;  1XGN A;  3WU0 A;  2P7C B;  4BBS J;  4MEX F;  1BC7 C;  2K3P A;  3LQR A;  1YIO A;  1IUY A;  4CGZ A;  4RAY A;  1Z9C A;  1E3P A;  4RMN A;  4B4C A;  4I02 A;  3C2G A;  4RGX A;  1H9T A;  2ZC2 A;  3HOV J;  1XGM A;  2ISY A;  4LMY A;  3H3U A;  4M3B A;  3FM5 A;  3U2R A;  2VKH A;  2CG4 A;  3UR3 C;  2VBX A;  4IRH A;  3S16 J;  1ZRC A;  1RI7 A;  2HKX A;  2DMQ A;  2L0K A;  4Z2Y A;  3HOW J;  2LH9 A;  2CW0 F;  2XPV A;  1KU3 A;  3E5X A;  1TL8 A;  4ETS A;  4XLA A;  5K7H A;  5FKO A;  1JKO C;  3GTJ J;  1MBF A;  2P5K A;  1GLN A;  1BOA A;  1YIT I;  3K4M A;  2ELK A;  2NVT J;  1QPM A;  1Y6I A;  5LD2 C;  2VJJ A;  4IPA A;  3RDI A;  1HF0 A;  4DOZ A;  5DM6 F;  3U1K A;  1R4M B;  2K3F A;  2P5L C;  1IW7 F;  3QP5 A;  5FD5 A;  5F0H A;  1YHQ I;  1YQA A;  4KIC A;  1R49 A;  3TMO A;  4B3A A;  1W7P D;  2RVC A;  3HKZ N;  3OV8 A;  3CMY A;  1ZH5 A;  4C9Y A;  2OJE D;  1LNW A;  3LSI A;  2XGC A;  3Q0V A;  4PGG A;  3GW2 A;  3HOY J;  3F8N A;  1KU2 A;  2EFO A;  2HGC A;  1FX7 A;  4D0P A;  2QEN A;  1J0R A;  4FET A;  1HW1 A;  1XN7 A;  3CCE I;  4G7Z F;  1LPQ A;  1TW2 A;  2M5W A;  4QPQ A;  1W0T A;  4D9J A;  1JKP C;  4P1W A;  3VYU B;  3TQN A;  2LC2 A;  2BXY A;  1WSU A;  3LSJ A;  5H2F C;  3TO6 A;  4A3J J;  3GTO J;  2BVM A;  2Y9Z A;  1W5T A;  3HDD A;  4RBO A;  4A0Y A;  3KP6 A;  1IDY A;  5TGT A;  1EJ9 A;  1BIB A;  5L3C A;  1SMT A;  4ZJZ A;  5TJJ A;  4BE1 A;  5HLH A;  3BG3 A;  3DU5 A;  4DGW B;  2L7Z A;  1UJ8 A;  4A3E J;  3F23 A;  3E1S A;  1POG A;  2OTJ I;  4HEA 2;  1XPX A;  3ISP A;  1HDP A;  2F48 A;  4BYY A;  4CCN A;  3OYH A;  2NS8 A;  4AIK A;  2X6O A;  3QPH A;  2HZD A;  2KPM A;  3TDU C;  5EDN A;  1BC8 C;  2P4W A;  4L5E A;  2YX4 A;  4BQQ A;  4IHW A;  2EFQ A;  3D5R C;  3QU3 A;  3BJA A;  3M9A A;  1G3Y A;  3QYF A;  3FK7 A;  3H5A A;  3KYD B;  3ZN1 A;  1ZQ3 P;  2FML A;  5IYD J;  2KP6 A;  2JA7 J;  3ECH A;  5EZH A;  1IRX A;  2B9S A;  3DFG A;  3ZMD A;  3CCL I;  4E70 A;  2STT A;  4L5I A;  2F6C A;  4IEJ A;  2VAS A;  1O4X A;  3CCS I;  2HVR A;  4CCL A;  3KET A;  2LMD A;  2EPF A;  1XGO A;  1ORK A;  2STW A;  2PMZ N;  1T2K A;  3R0A A;  3ZMS A;  2M45 A;  3NAR A;  4MFD A;  5KHD A;  4XRS G;  2E1M C;  1TWA J;  2ZFW A;  1SD6 A;  3S8P A;  2QSH X;  2ETH A;  2O5R A;  3BTJ A;  3SYT A;  2L5Q A;  3SFI A;  1FT9 A;  2E71 A;  1RR7 A;  2BW3 A;  2LP0 A;  1WFX A;  5HS9 A;  3T1B A;  2DQL A;  3E5Q A;  2HOS A;  3RKW A;  1KU9 A;  1MH3 A;  2D1H A;  2WY7 Q;  4I7H A;  2ADU A;  1QQI A;  1WJC A;  2VJ5 A;  5ICF A;  4C2M J;  3PQK A;  4Y52 J;  2XKO A;  1RKW A;  2VE9 A;  3ZXS A;  5J1Y A;  4X6A J;  5B1A H;  2GIZ A;  1FOY A;  1ON1 A;  3RQ4 A;  3KLN A;  1LDJ A;  3DEW A;  1VQ5 I;  2M3A A;  3VPR A;  1J2X A;  4XIC A;  3DP7 A;  4DYR A;  3EUA A;  5CVI A;  1XC5 A;  5H6R A;  2ME0 A;  2EFP A;  5AIQ A;  1BI0 A;  2CQN A;  1XB4 A;  2XSD C;  4HQM A;  5LHH A;  4XRF A;  2E1M B;  2H94 A;  4I76 A;  2JSP A;  4E7Z A;  1R71 A;  2NVU B;  1I1S A;  2FUG 2;  2IS1 A;  1G59 A;  2ESN A;  4XRM A;  1GT0 C;  4FTH A;  2J5P A;  2GBY A;  4ESB A;  3F8F A;  3BG6 A;  1G3W A;  2QEX I;  2W48 A;  4XKW A;  1ZG5 A;  3F6O A;  4EQQ A;  2H1K A;  4BY1 J;  2XAG A;  3G4S I;  1X19 A;  2WV1 A;  3W6V A;  1MZB A;  1TNS A;  1P7I A;  3HKZ A;  2NNN A;  3I55 I;  1TNT A;  2FOK A;  1Z6R A;  4P5O A;  2DN0 A;  3DTI A;  3F6V A;  2DFH A;  2ZME C;  2CUZ A;  5CQE A;  1XGS A;  1QHH D;  2IGK A;  3S14 J;  5GTI C;  3PNY A;  1T0F C;  3O3K A;  2W57 A;  2XDV A;  4BS9 A;  2P0W A;  1MMN A;  1D1B A;  4ESF A;  3TOB A;  3CUQ C;  4A5M A;  5JI6 A;  4B47 A;  3V7C A;  1BR4 A;  5M3M J;  3RIR A;  1RUN A;  3VOD A;  1U6G A;  4XLN F;  3M7G A;  2ZJP F;  4RAF A;  1PYV A;  1ETV A;  4ABZ A;  3CCQ I;  2IA2 A;  3ULQ B;  2V9V A;  4A0Z A;  1WQ2 A;  1MD0 A;  4GRI A;  3GZ6 A;  2IPQ X;  2IW5 A;  2COB A;  2JMW A;  3HOX J;  5IP9 J;  1IN8 A;  3TKY A;  2W1O A;  5JLX A;  1IRG A;  2EV6 A;  4XLH A;  2EIL H;  4UUT A;  2ELH A;  3CJN A;  1YE9 A;  3GFI A;  1AKH A;  5EEG A;  3W6K B;  1XX5 A;  5J8C A;  3MKZ A;  4J00 A;  3LA2 A;  5J1R A;  3LSH A;  3JRD A;  2WWY A;  1B72 B;  2IJL A;  4C2T A;  3IUO A;  2Z1D A;  4IHX A;  4EAT A;  3DKX A;  4E7J A;  2KIQ A;  3JRA A;  3SEZ A;  1Z6T A;  4XON A;  4II2 A;  2VBZ A;  3BJO A;  2QQA A;  1JKQ C;  3BTL A;  3MN2 A;  4ON0 A;  1QVT A;  2HXO A;  4QPO A;  1KON A;  5F1R A;  5LHI A;  3WU1 B;  1OR7 C;  2KDO A;  2XVC A;  1Y8R B;  4M74 A;  4MQV A;  2CUE A;  4QLC U;  3JSO A;  2YSR A;  3GTG J;  1F5T A;  4HAM A;  1LVK A;  1MBK A;  2HOT A;  3B02 A;  5B5E C;  3E6D A;  3J81 K;  2DFF A;  3KP5 A;  4ZYA A;  3WTY C;  3OIO A;  1YOV B;  3HEF A;  5F27 A;  1K6O A;  4YFX F;  2WV0 A;  4IQJ A;  2DO7 A;  1QO0 D;  1JGG A;  1AKH B;  3SQN A;  3VSK A;  2HEO A;  2X4H A;  3HJE A;  4X0G A;  1Z21 A;  2R92 J;  1V3F A;  2JA8 J;  3UKG A;  5ILV A;  2XV4 S;  3Q5F A;  3CQZ J;  1YTY A;  1WH7 A;  4L0Z B;  2LBF B;  3FM3 A;  2RNG A;  2B63 J;  2E35 A;  3IP4 B;  1AWC A;  1JE8 A;  5D6E A;  2HS5 A;  3KLO A;  3QYB A;  4IRI A;  1UMQ A;  2IXS A;  3KZI C;  3GVA A;  1UFM A;  4NC6 A;  3K10 A;  4AWX B;  2VXZ A;  2NVQ J;  4PUS A;  3TDZ C;  2M0C A;  5D4S A;  2XAH A;  4BQN A;  3J7A Y;  1ZGJ A;  5H6Q A;  4XLE A;  3FXJ A;  1STZ A;  4A3C J;  2PJP A;  1T8I A;  2LYC A;  2GLO A;  2DMU A;  2KIF A;  1K78 B;  2A61 A;  3FIW A;  4QTR A;  5HNF A;  4CYC B;  4A3F J;  3BC8 A;  1OYY A;  1YS7 A;  2CQK A;  4L0Y B;  4Y7N J;  1D8J A;  2L7K A;  4HX4 A;  3M07 A;  3P7N A;  3JSP A;  4LB5 A;  1XG1 A;  4IHY A;  2P6T A;  4RS8 A;  2IA1 A;  1B1B A;  1G8X A;  1CF7 B;  2L9V A;  4M73 A;  4UHT A;  3DF8 A;  4D5C A;  2P6S A;  2FBK A;  1JTY A;  4NBQ A;  5GTH C;  5JLW A;  1BOB A;  2IA0 A;  3A2K A;  3K4B A;  1TWF J;  4DZP A;  1HST A;  3SEQ A;  2GA2 A;  4OMZ A;  1K4S A;  3M3Y J;  4I09 A;  3M1C A;  1ZLK A;  2JA2 A;  2FE3 A;  5KAF C;  1W5C C;  1TQM A;  2KRF A;  4BAC A;  1O3R A;  3GBG A;  1QNT A;  1REP C;  2ZNY A;  5E1X A;  2HYG D;  3GXO A;  1SAX A;  1FYL A;  3HHG A;  3CCY A;  2EFN A;  3DEE A;  1I50 J;  4F93 B;  2MD5 A;  2KRC A;  1YRN A;  1PJR A;  5HOO A;  3ESW B;  3KE2 A;  2E2H J;  5JFR A;  4D5F A;  1R6R A;  4JX4 A;  1I27 A;  4CYC A;  3E3V A;  2BEO A;  2G7U A;  3ABT A;  4LK1 F;  4AVZ A;  3WHB A;  4M3G A;  3K1N A;  3CF5 F;  4BJ6 C;  4KT6 A;  2M4G A;  1Z3Y A;  2HTJ A;  4F92 B;  2Y9Y A;  1BIA A;  3GO5 A;  4XL9 A;  3CTA A;  5FKL A;  1PUE E;  3KPH A;  1BBY A;  1H0M A;  2JWT A;  4G9Y A;  1RZ4 A;  3O8G A;  2DLL A;  3C2H A;  1M1E B;  2HYJ A;  1P7J A;  2K86 A;  4IOA F;  4WWC A;  3BR2 A;  2FU4 A;  4ENJ A;  1UST A;  2DTZ A;  3FMR A;  2A6T A;  5F0C A;  2IVM A;  3HRU A;  3I4N J;  2FX0 A;  4LOC A;  2CYY A;  2HKO A;  1R36 A;  1Y39 A;  4UB6 C;  1TQI A;  4IL6 C;  2DA2 A;  2JZY A;  1U5T B;  4MQ9 F;  2HDW A;  2DT7 B;  2LY9 A;  2PEX A;  2M8G X;  3COA C;  1WJF A;  2BW3 B;  5LGU A;  1U5T C;  1O3Q A;  1A35 A;  1GHC A;  3IKV A;  3ASO H;  2RAE A;  5K5Q A;  4PDK A;  1YX3 A;  2M34 A;  3ASN H;  2ACJ A;  2JTV A;  4H0E A;  3SFZ A;  1YW7 A;  5E17 F;  1D0X A;  2D2W A;  3QRF F;  2XRO A;  1FYM A;  1FMW A;  4XKC A;  2HDD A;  5FFX A;  3IV5 A;  1IAW A;  3CUQ B;  1FPQ A;  4FCY A;  4QSH A;  1Y8Q B;  1Y0U A;  3PNV A;  4HG2 A;  3BLY A;  3M4O J;  4B43 A;  1NK3 P;  2V7F A;  2N8G A;  3DBH B;  1QZZ A;  1NK2 P;  3B73 A;  5DTD A;  1KQ9 A;  4IQ4 A;  3AG2 H;  3DLA A;  3S3N A;  3JW4 A;  4WXC A;  4XQF A;  3OYM A;  1FSH A;  3OL3 A;  1ZGW A;  1HC8 A;  2LNB A;  5CLS A;  1K83 J;  4A3K J;  3BP8 A;  3CCU I;  1IRZ A;  3C18 A;  2LY2 A;  2M7A A;  2BHY A;  2B0L A;  2EH3 A;  4G7H F;  4I98 B;  2CJJ A;  1R1T A;  3G73 A;  3VFZ A;  2BGC A;  4DBQ A;  2CGP A;  1W36 C;  3BZK A;  2MW8 A;  4CDG A;  3B6A A;  2OA4 A;  2MC4 A;  1VFC A;  1BI3 A;  4UVA A;  3MZ8 A;  3ABU A;  4B1R A;  4B3X A;  3TW6 A;  3CC7 I;  3HM5 A;  2WTE A;  2BYV E;  2COM A;  1VQ9 I;  4UY8 I;  4BEH A;  1MBE A;  2IBD A;  3L2R A;  4F7Z A;  5L3B A;  2GOX B;  4O3M A;  3CMM A;  1IO2 A;  2E36 A;  3K70 C;  1UZC A;  3HGG A;  1AA7 A;  3MCZ A;  1A6I A;  5DYM A;  3T0Y A;  4IX7 A;  1MDM B;  3IRR A;  2FJ1 A;  3CDL A;  5D8K B;  3S1M J;  3H3V K;  1VQK I;  3EQL F;  2XIG A;  4KIF A;  5IP6 A;  4HX7 A;  5JR3 A;  1KQ8 A;  3HL2 A;  3AL0 C;  1B9N A;  2JA5 J;  4BKX A;  3LQQ A;  3RZO J;  4I01 A;  4LLG F;  1ZAO A;  2Q0O A;  1P9Q C;  4FX4 A;  2HFH A;  3W3C A;  1IN5 A;  4BXF A;  4BE2 A;  1RPW A;  3SZG A;  2MBF A;  2BY2 A;  2R7S A;  5FLX K;  2DYR H;  2Z99 A;  3OR1 C;  4XSX F;  3IWZ A;  4LG3 A;  3GTM J;  2JPC A;  2LFB A;  3HYI A;  5TRD A;  5B3S H;  3BZ6 A;  2JJ7 A;  2EK5 A;  2ZXH A;  2QM3 A;  4QIW N;  1MMS A;  3KZY A;  1YJW I;  4RDU A;  1Z0X A;  1IUF A;  2JRT A;  3RPQ A;  1S9H A;  5EG0 B;  2JPB A;  2FNA A;  3RJP A;  3OWT A;  4CZC A;  2L02 A;  2DA5 A;  3A1Y A;  1LFU P;  1GXQ A;  1X2N A;  5KK1 A;  1HBX G;  2VXD A;  5FO5 A;  4N4O B;  3ZQQ A;  2W00 A;  2Y75 A;  4R1H A;  1Z05 A;  1JHH A;  2CO5 A;  2VON A;  3G2B A;  1USS A;  3C2B A;  2OQG A;  2K7L A;  1JUM A;  2OBP A;  4N0B A;  3VSL A;  3I56 I;  4FE7 A;  2H09 A;  4U0V A;  2V6E A;  4EM1 A;  1LDD A;  5FJ8 J;  3H9J A;  1TP4 A;  2ZO4 A;  3PSF A;  2ECC A;  3TO9 A;  3KEO A;  1X1B A;  2IS4 A;  2DOD A;  3CUQ A;  4JYK A;  4RLQ A;  4YIF A;  2E7W A;  3QPS A;  2BV6 A;  4A0X A;  1X4O A;  4L5J A;  2DA7 A;  3CDI A;  1WJE A;  2DA3 A;  1G3T A;  1KGS A;  2E1N A;  5HLI A;  4MTE A;  1PP7 U;  1XTA A;  1G4D A;  3LOC A;  5HDN A;  1FBU A;  2QZ8 A;  3LL7 A;  2DCE A;  3SXY A;  4A3B J;  3GFL A;  2VLA A;  1ITY A;  3IRQ A;  2RC4 A;  1VTN C;  1EH6 A;  5ILS A;  2ID6 A;  2NYX A;  1HW2 A;  5ERI A;  3AFH A;  1OFC X;  1B8I B;  4UUS B;  5C3E J;  4IKF A;  1ETX A;  3BRO A;  1BW6 A;  1FEX A;  5F6F A;  5K5R A;  2Z5U A;  3DTK A;  4CXF A;  2O03 A;  3ZOB A;  1CGP A;  1P4A A;  1JT6 A;  2WAD A;  4IOC F;  4NNJ A;  1RC9 A;  3WU2 C;  3IL2 A;  2EFW A;  3GTQ J;  5ICE A;  2WB1 A;  5LBQ A;  2EV5 A;  4E4H A;  1V4R A;  1BJA A;  2FQ3 A;  2O3F A;  1VND A;  3FX3 A;  1ETW A;  3HRT A;  1WJB A;  4DIQ A;  5FRM A;  2ZXI A;  2FF4 A;  4GFB A;  4HV5 A;  3P9I A;  3BOQ A;  1OPC A;  2VKD A;  3J7Z I;  1VZ0 A;  4PFP A;  1ONV A;  3WOD F;  3MFK A;  2X85 A;  1SD5 A;  5CVU A;  1SFX A;  4J01 A;  2AQE A;  4PJM A;  5GAE J;  3HOZ J;  1EF4 A;  3GCM A;  3MZY A;  4L9T A;  5IT3 A;  4IF4 A;  3KEQ A;  3KCC A;  4NB5 A;  4AD9 A;  2CQX A;  4XOT A;  2FMY A;  1WJ5 A;  1RET A;  4BJT A;  3K1M A;  4GCV A;  2MC3 A;  5DD4 A;  1X2M A;  3F22 A;  4XR6 A;  2KDZ A;  3L00 A;  3HTS B;  2OD5 A;  1FC3 A;  3CUO A;  2RGV A;  2DW4 A;  2C6Y A;  4P96 A;  1U8B A;  4OIO F;  1WI3 A;  4E7S A;  3FF5 A;  4LJZ F;  2PJR B;  1HKQ A;  3ECO A;  2G0E A;  2W7N A;  1TT5 B;  1OYW A;  2ZME B;  4IZZ A;  3R6S A;  1R58 A;  1ZTR A;  3RYR A;  5EJC A;  1UG2 A;  2XPU A;  3HXL A;  1FYK A;  2PG4 A;  1ENH A;  4LG0 B;  4ESJ A;  4C2U A;  3E6B A;  3CJT B;  2QKM B;  1TZL A;  3TOA A;  2VBW A;  2W4S A;  1VQO I;  3VWB A;  3FXQ A;  2AHQ A;  3VDX A;  1VF9 A;  4GGG A;  1PUF B;  2R7X A;  2FA5 A;  5EYR A;  1DP7 P;  2ZJQ F;  1J7K A;  4HW0 A;  2F5D A;  3F8M A; 
#chains in the Genus database with same CATH homology
 2EIN H;  3ABL H;  3AG4 H;  3AG2 H;  5B3S H;  2EIJ H;  3ASO H;  1OCO H;  3ABM H;  3ASN H;  3X2Q H;  1OCR H;  1OCC H;  2DYS H;  2ZXW H;  3ABK H;  5B1B H;  1V54 H;  3AG3 H;  2OCC H;  1V55 H;  5IY5 H;  3WG7 H;  3AG1 H;  2EIM H;  5B1A H;  2EIL H;  2Y69 H;  2EIK H;  2DYR H;  1OCZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...