3AG2H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag2H00
1V55H 5B1AH 1OCZH 3ASNH 3ABKH 2DYSH 3AG1H 3AG3H 2Y69H 1OCRH 3ASOH 2EILH 2ZXWH 3ABLH 3X2QH 3ABMH 5B1BH 1OCOH 3AG4H 2EIMH 2EINH 3WG7H 1OCCH 2EIJH 2OCCH 5IY5H 2EIKH 3AG2H 2DYRH 5B3SH 1V54H
chains in the Genus database with same CATH superfamily
1T0FC 3U9GA 2MW8A 3L2QA 5H6QA 1OCPA 2Z3YA 2MC3A 2PN6A 3H5RA 1WSUA 4CCNA 1Z6RA 2ZXIA 5D6FA 2P81A 1ZLKA 3WGHA 2NOGA 4L0YB 4KIFA 5IYDJ 4KFCA 2L9NA 2OTLI 2VOPA 3G6EI 3BCBA 3GLLA 2CW7A 1XPXA 2IBDA 3BR3A 4QLCU 2Y48A 1DP3A 4UUVA 2BY1A 1AKHA 1CF7A 2O8KA 2WAQA 1K78A 3DWLE 3NQOA 2HVSA 2E1OA 2V7FA 4FE4A 1G4DA 1X4PA 2XGCA 1GT0C 3NRVA 4AWXB 4Q5SF 1RI7A 1WWXA 4B48A 3DBHB 3RQIA 2CUZA 2OQRA 4IHVA 1JUSA 4AVPA 3ELKA 3SQNA 4ESJA 2VBZA 3HHHA 3SEZA 1IC8A 1ULYA 1VQ9I 2K3PA 2CQ7A 3GTLJ 4FT8A 1STZA 4CCJA 5M5WJ 1X1BA 4G6QA 3IV5A 2M4GA 2COMA 1NTCA 4XOPA 4D7NA 3F22A 3F8NA 1TWCJ 3ECOA 3PM1A 2FQ4A 3LSGA 5D5XB 4XRFA 1YW8A 3JR9A 4G8XA 2JRTA 4AM3A 3QOEA 2G0EA 1GXQA 4IKFA 2DT5A 2ME0A 2XRLA 2O9LA 1RIOH 1XGSA 2Q2EA 2WB1N 3QPTA 4BY1J 1ZKGA 2JK3A 2X6YA 3FHNA 2BE5F 1BIAA 2VBXA 2VKDA 3BLYA 4R8HA 4RGRA 3AAFA 2G9WA 2X1DA 1W5CC 3KLOA 2BBYA 4ANJA 5FD5A 3RKQA 2XSDC 2LYCA 1ON1A 4XLHA 3ABMH 4A3JJ 1X3WB 4PJJA 1MNDA 2DOFA 4U87A 3FKJA 3FK7A 3R60A 4RM2A 1ZARA 2V6CA 5D5VB 1FYKA 5LEKA 3SDBA 1B59A 3ZR8X 5FLMJ 4P96A 3R6SA 4KITB 3FXMA 1TQIA 2DXIA 5KNLA 4PSWA 5DEQA 2Z2SB 1SFKA 2XC7A 3BTLA 3HZJA 3W2WA 3CUOA 5K5RA 4FX0A 2WB1A 2W48A 4OIQF 5DD8A 2MH2A 4Y33A 5ILVA 2N8GA 1USTA 1T8IA 1FBUA 4A3CJ 1BI1A 4XQFA 3MZ8A 3KX2A 3CO7C 3I4NJ 4ESFA 3E3VA 3QOPA 2JMWA 2LF7A 1S72I 3BG5A 3DLLF 4EQQA 3W3CA 5JLWA 4UUSB 2MLGA 2BW3A 2PJRB 3K1NA 3VSKA 4F91B 4LD5A 4HF2A 2E2HJ 1I5ZA 2A69F 2Q1ZB 4Y13A 2LK2A 5HLIA 4J00A 4H0EA 3HPGA 3IH3A 5EEGA 3ZMVA 4U0YA 1U2WA 3LA2A 4XMYA 1XCBA 5IT9K 1QZEA 3ABTA 1TWHJ 3P9IA 1SFOJ 2VPLA 4L9TA 3V7CA 2HQ5A 2HDCA 3DP7A 3KP7A 1OISA 5M5XJ 1WJAA 3IC7A 1IO2A 4P1WA 3ZCOA 1D0YA 5M5YJ 2K86A 1V54H 5CVUA 1MD0A 3KEYA 2F5EA 4A3MJ 1QHHD 3PQKA 2WC2A 3VSLA 4HX8A 3GZNB 4NQWB 2IA0A 5L3FA 3I3LA 3V7SA 1DGWY 1G2HA 1SD4A 2BV6A 3MVPA 1B72B 3D5SC 4XICA 1SVLA 2EFNA 4EMSA 3HOWJ 4Q47A 5ILSA 2RC4A 3I9V2 3QQAA 2P4WA 4CH7A 5KK1A 4HF1A 3K4MA 2F6CA 2R7WA 3QRFF 1QHGA 5JI6A 2XGDA 2R7OA 3DXJF 1JHHA 2JRMA 1SD6A 3HRTA 2A61A 4F93B 3SZTA 5KAFC 1WJEA 4HQEA 5E3LA 3CESA 1HQCA 3QP5A 4MTDA 1RNLA 2VC0A 1IN5A 4RLQA 2PQ8A 1X1CA 4RDUA 4JK1X 4CCMA 1ZELA 4OIOF 2XB5A 4WXHA 2L5QA 1P6RA 4B4CA 2L01A 1LDKB 4OU0A 4MTEA 2GBYA 3H5AA 1XMAA 1U5TA 1MW7A 4YIIA 2CSOA 3CUQC 4M73A 3HOTA 2HGCA 2OV7A 2DA1A 3J7AO 4A69C 4II3A 3BCAA 3MKYB 2IGKA 1DGRM 4HOBA 1W7PB 2E19A 3M1CA 3WGGA 3S15J 3ASOH 3E6MA 1FBSA 2XGEA 5M3MJ 4HX4A 1FLIA 2TRTA 4OIRF 5CVIA 3WHBA 4U7BA 3L2CA 3BR5A 5KHDA 2KPMA 2NAZA 4M3BA 5D5WB 3IUOA 3DKYA 1Q1VA 3JRCA 4XLNF 2YX7A 2KKOA 3BG7A 3OS0A 1USSA 1JHFA 5FFZA 2VBWA 4CICA 5KCMA 2FQ3A 4Q48A 1VQ8I 3MKWB 4BY7J 1XMKA 4JP0A 4XOTA 1QRYA 1YOVB 3ISPA 2M30A 2WY7Q 5BS6A 3S1NJ 3M8EA 4O6JA 2FSWA 4BJTA 2HFHA 5LRSA 1I6HJ 3FXRA 2E36A 4C2TA 2XB0X 5FFXA 4N0BA 5J8CA 3L09A 3KP4A 1YRNA 2ZSIB 1FPQA 5E20A 3ZMUA 3S17J 1IDZA 1EH7A 3BG6A 1TLHB 2HQRA 1C0WA 3C7JA 2LF8A 1FYLA 4ZYDA 1EH6A 1F5TA 1HSJA 4OINF 4JOMA 3UNGC 3GTJJ 2ELHA 2A05A 3RDIA 3DPUA 2HTJA 1EH8A 5C44J 3NEUA 3DPLC 4CXFA 3HJEA 1MNEA 2R0QC 1SAUA 1JKOC 1HW1A 1NK3P 2E7WA 3WG9A 1TQPA 4I0BA 3HTSB 2YPRA 2FRHA 3E5QA 3JAMK 3JREA 3BR0A 3BG9A 4FTHA 2FX0A 4OAYA 2R7QA 1OPCA 3EUHA 3FM5A 1UMQA 3S2WA 3H3UA 1G3YA 1XSVA 3D5RC 3BROA 4EJVA 1B9NA 3ZMDA 1V5FA 4XN3A 3RJPA 1ZHFA 1YIJI 4U0WA 2F4OB 3HTUA 5F0HA 2CV1A 2FBKA 3PIPF 2XF5A 5KVRA 1A04A 2X1EA 1IRGA 3GMEA 2RNJA 2DK5A 3KP6A 3K7AJ 2Z99A 5C4JJ 2HOTA 1NG6A 1SFEA 4A0ZA 2IW5A 3TP0A 2K9MA 4EJOA 2HPMA 2AQEA 3PJRA 5IOZA 1ZH5A 3WU0A 3GFIA 1P2FA 1LFUP 4CYDA 3VYSB 4N9IA 5FKKA 5LGNA 1SAXA 4IRIA 3KLNA 2JA2A 3R61A 1UZCA 4UUTA 3FBIB 4CCOA 4A3KJ 1G3SA 2VQHA 1HXDA 3HOSA 2WA0A 4DOZA 3I59A 3ZQFA 4MO7A 2BHYA 1Z67A 1CQTA 5LHHA 3I4MJ 1UB9A 4HV5A 5LHGA 4E7ZA 2ZCWA 4XSZF 1HCRA 2OJED 2QYOA 4BACA 3K4LA 4PCQA 4EJWA 3I71A 4A3EJ 3KCCA 1OCCH 1T0FA 1X58A 3HEFA 1IRXA 3T1BA 3P5JA 4BKXA 2QBYA 2XF6A 3N05A 2QF7A 1RUOA 1IDYA 2X1CA 4BE1A 2JA8J 3CLOA 1OR7A 3GTPJ 2DTZA 2DFFA 3DBLB 4L18B 4MGRA 2CMPA 2EV6A 1JTYA 5EF6A 5FD6A 3I53A 4D5CA 5HLGA 5K7ZA 1LQ1A 2X9DA 1ITYA 2K9LA 2DFHA 2KFDA 2Y69H 4XR6A 1LE8B 4AUXA 4D0PA 5J1YA 2OU2A 2PLYA 3C2BA 2IS1A 1RESA 1GUUA 1R7JA 5HLTA 2HTSA 5IT9Z 4M6YA 1Y39A 4UVBA 5B66C 3BJAA 1EJ9A 3QPHA 3J7AY 1HA8A 1FY7A 1NG7A 3V8LA 1QVUA 2ZKZA 2OQGA 2LFBA 3OL4A 1I1GA 3JTGA 4ZDPA 4NC8A 1ZQ3P 4L9NA 3S3NA 3MCZA 1HDPA 2LKPA 4BBRJ 1W0TA 4OIPF 2R5ZB 2XAGA 3BR2A 1MJBA 4V2GA 3BY6A 4G7OF 1WH5A 4V2FA 1MGTA 9ANTA 1PJRA 1LB2A 1WZ2A 5CVVA 1IG7A 4NNJA 2H94A 1PYVA 3TO6A 3KZZA 1WJCA 3MQ0A 4A3LJ 4EGYA 4IRHA 1D5VA 2RGVA 2LBFB 4QSHA 1L0OC 2Y30A 3AG3H 2W4SA 3ZMZA 2LNBA 4BGDA 2PG4A 2PMZN 1A36A 3K4NA 4U0VA 2JPBA 2VJ4A 3ESWB 4M9SA 2JVGA 1Y56A 3BOQA 2FBHA 4A3DJ 3GTMJ 3IKVA 3SFZA 5ED4A 3JSPA 2X85A 2JVHA 1D1BA 1O7FA 1RPWA 4MQ9F 2Y9ZA 3KEQA 3LWFA 3CF5F 1IAWA 1ZK8A 4PGGA 1ZRDA 3JRFA 3A01B 4LIVA 3V8JA 2WV0A 4XL9A 2ME6A 3DQVC 2FU4A 2UXXA 1YW9A 3CJTB 1XSXA 2XASA 1LVKA 1R5HA 1XCVA 5TISC 1ZG5A 3JW4A 2W25A 1ZLJA 4YEJA 3GYHX 2CJJA 2ZB9A 3IL2A 4OMZA 1R5GA 4JX4A 3A4CA 2EWNA 2GA1A 5CJ9A 1XGOA 3KYLA 1AWCA 1OFCX 3HB9A 1WH7A 2CW8A 2ID6A 1T38A 2NVTJ 2CG4A 3ZXSA 4XKVA 2GXGA 2CWEA 1XG1A 1T39A 3OV8A 5HS7A 3HC7A 2LP0A 2DFIA 2QM3A 2A5YB 1AA7A 2MC4A 5DUKA 2NS7A 4CCLA 4DJAA 1W36D 4I2OA 2YR2A 5EJCA 1H8AC 1T6SA 3ZQQA 2KZVA 4B1RA 2DA7A 3FXOA 2QA4I 2FD5A 3CMMA 3M07A 1FTTA 1R6RA 3U1KA 2L54A 1JKRC 2HKOA 2F5FA 2CQXA 2K4JA 1D3YA 1IUFA 1M1EB 2G7HA 1VQLI 4YFNF 2EV0A 1GV2A 3CQZJ 1S6LA 2E1CA 4AIJA 2XPUA 3FMSA 2DW4A 2H8WA 1GV5A 3BDDA 1ETQA 4IJAA 2K85A 3BQZA 5FRNA 5L3BA 5E79C 1E2XA 1HKSA 2C6YA 4KN4X 4AIKA 5TJJA 5ILUA 3AKZA 2Z33A 3GTOJ 5DCMA 2A6HF 4LLLA 2QZ8A 4HDUA 5CLSA 5LFAA 3JRAA 3JAMZ 3G3ZA 3H0GJ 4A6EA 3DCFA 3EPZA 3DKWA 3D1NI 1SFXA 1N77A 5DCFA 2EFPA 1VQNI 1LDJA 1MSEC 3I58A 4I98B 3CCEI 5HODA 2FMYA 5GP9A 3LFUA 4UV9A 2FNAA 3QU3A 5IP6A 4FISA 4BH9A 1U6GA 4BS9A 4WWCA 4IHSA 2DOEA 2V79A 1E17A 3QPSA 5CVRA 1VNDA 5ICEA 2AHQA 2OZ6A 1ZN2A 3CO6C 1FYMA 1UJ8A 1J75A 2M1BA 2RAEA 1FX7A 1ZGWA 1PUFA 3OYFA 2B9SA 4GCVA 4WK8F 1GLNA 2BGCA 2R3SA 1YX5A 2GAUA 2CS3A 2P7VB 4RB1A 2V9VA 3KP3A 1Z91A 1SD5A 5IOYA 2ZNYA 2QSGX 2VE9A 3A0HC 5F08A 1I50J 1TT5B 4HZFA 1BR2A 4OOIA 2K27A 5LHIA 4EATA 1JJ6C 3OYKA 3CUQA 1MSFC 2WAQN 5DS9A 2KHMA 2XUBA 4L0ZB 2M45A 2OC6A 5EEHA 2ADUA 4RBOA 3QYBA 1P9QC 5GTHC 3RZDJ 1I3AA 5LEJA 3ABUA 3LSJA 4XBFA 3HSRA 2ID3A 1TWFJ 1YYVA 4E6KG 3WTUC 2Y9YA 2GM4A 1J9IA 2Z1DA 4XSXF 2XKPA 3QPLA 1J0RA 3RPQA 3C3WA 1XMXA 3LAJA 3ZP5A 1E3PA 1J5YA 1YLFA 2W84A 5FKOA 3Q0UA 3HUGA 3KZYA 2M5WA 3KYCB 3HL2A 1WGXA 4F7ZA 4R79A 3ZQGA 3DBRB 3IKTA 3H0DA 1U0JA 2Z16A 2CH0A 2M0MA 1J7KA 5L3GA 3K69A 1H0MA 3KP5A 5F0CA 3ONQA 3PNTA 5FROA 2CU7A 3HRUA 3D5LA 1KQ0A 1W7PD 1W0UA 4XRMA 2ISZA 2DA5A 1BJAA 1HDDC 2WAFA 4YFKF 5IP7J 3GXOA 2JA5J 5FO5A 1A5JA 4I01A 3FKIJ 4HSTA 2AXTC 2VXZA 4UV8A 3S2HJ 2E34A 3EETA 3WG7H 3CCSI 2MLKA 2VC1A 2JQ7A 3MFKA 4EM0B 2PBIA 3FF5A 2JN6A 4BHBA 2E71A 2V4JC 3FXKA 1OYWA 2PJRA 1ZTRA 3BP8A 3T8TA 1TWGJ 3ABKH 1A31A 1DU6A 2XPVA 2A3SA 4XK4A 2W57A 4NB5A 4KN7X 3FMRA 4IRGA 1IV6A 2PMUA 2X51A 4G6DA 1VFCA 4QWQA 2HI3A 3OYGA 2AO9A 4CYCB 2L9VA 1H88C 1D0XA 3I4PA 3LA3A 1X3UA 1UG2A 2EIKH 3AG2H 4HG2A 1R36A 2HNHA 2LKXA 2ETHA 2KRFA 1R71A 4PUSA 5LD2C 2HPIA 3JRBA 2VXDA 2M8EA 4DZJA 3K70D 1MBFA 2IS6A 3PNVA 2LC2A 2GWRA 2K9NA 4IQ4A 4KT6A 4LB5A 4E7JA 4FQGA 3GW2A 1MKMA 1RC9A 1DPRA 3TL4X 1NH3A 4B3XA 3ZMTA 3OY9A 1ZGJA 1X1DA 1R49A 2XROA 2DCEA 2HQNA 2CYYA 4BJ5C 3E0JB 3KZIC 5H6RA 2Y2ZA 2M8GX 1IGNA 4BEHB 3QODA 1KZHA 1YFHA 5EDNA 1MMAA 3NWTA 5E1WA 2MH9A 3MKLA 3TBIA 1VQ5I 1KQ8A 2DO7A 1TW3A 3KIOA 1U78A 4M3DA 1F9NA 1CF7B 1R1VA 3F8CA 5K5QA 4G12A 5BNGA 1K78B 3E6DA 4AIHA 4XORA 5EG0A 2KIQA 5J4YA 1IN7A 5D5UB 1ETYA 2L7MP 1YJNI 2ZJQF 4ZTJA 1QO0D 1A6QA 1TT0A 4DBQA 2ICWG 4AYBA 2GLOA 2XKOA 2XAFA 5F1RA 5B5EC 2ECCA 5DTDA 2CUFA 3HOUJ 3C1DA 4BQNA 2LOOA 1Z1DA 4S0HB 2EZIA 3M4OJ 4BL0B 1BW6A 4KJZA 3CMYA 2VKEA 2OCCH 3HOXJ 2F4MB 1SMTA 3K9TA 4GXOA 5LBQA 2WBMA 5B3SH 1JE8A 2VASA 2QSHX 2O5RA 3FZVA 5ICCA 2AQFA 1MZBA 1FZPB 2Y75A 3TP3A 4M6VA 2E2JJ 3VYTB 5DD4A 3CJNA 4Y3OA 3DTIA 3U2RA 1QA6A 2H6CA 5E3NA 2QQAA 2V9KA 2IRFG 3GBGA 4LB6B 3S14J 5LRRA 3GLXA 2EK5A 2Q2EB 2CQNA 2V1XA 1HKQA 1LEAA 1IRZA 2H09A 2R7RA 1XGMA 3GTGJ 4BDYA 1ON2A 1OJLA 2PX9A 1O7LA 4F92B 5DUIA 4PFOA 4QPQA 3IAM2 2Y0SA 2OA4A 4JX5A 1MBGA 3L2RA 1D1AA 3F6VA 1FIAA 3OYMA 1YHQI 2DTRA 3OYBA 4YIFA 2KZGA 3AL0B 1K4TA 4IHTA 2R4GA 2M2EA 2HKXA 2KT0A 4BQOA 1MJ9A 1SD7A 3RKXA 1LFBA 2LSOA 4XRSG 4BE0A 2ZSHB 3ZQCA 1JXSA 3W6KB 4NC7A 2BOLA 4DBRA 2YU9J 3V7RA 2P6SA 5K1YA 3CP8A 1OLTA 3FXQA 3ZN1A 1XN7A 2ZO4A 3MZHA 2NVQJ 2EILH 3ZQIA 3UKGA 1GVJA 2MD5A 1U8BA 1W36C 2ZC2A 3M1EA 2DJIA 2O7OA 2KQRA 3SXYA 3FBNB 3H1CA 1YW7A 3RPUD 3V4GA 2V1DA 2CGPA 1Y1VJ 3GX4X 2BXYA 4IL6C 2DA2A 3IRQA 1QZYA 3MMYB 4FE7A 3HGYA 1HLVA 1K4SA 3MN2A 3Q3SA 4QPOA 4BU2A 3T0YA 3H36A 1TL8A 2E35A 1TC3C 2KJCA 3SDGA 4EJUA 2KL4A 2COBA 2X6OA 1Z6TA 4L9JA 3V8KA 4P55A 2F5CA 3LSRA 2PI0A 4IOAF 4A3IJ 3VOEA 4U88A 1FMVA 1ZG3A 3BTJA 4BHPA 2KDOA 2I10A 4PZJA 4M6XA 2FF4A 1E3HA 4LG3A 5H2FC 3CLQA 4L5IA 5E1XA 4HLYA 2NNNA 2GQQA 1BBYA 2HS5A 2K9SA 2FBIA 1OKRA 2VOOA 3G4SI 5AIQA 5IYCJ 4G7HF 4L5EA 5EEAA 2ZXWH 2X6XA 1ZG1A 4HAMA 3H3VK 2E5ZA 1BC7C 4K2EA 1DDNA 5DYMA 2M87A 3TO7A 3O2PE 4LOCA 4D5FA 2FEZA 1MJAA 5FKNA 3RKWA 4UNOA 2EJRA 2E2IJ 2STTA 1ZGAA 2A6EF 3G71I 5B1AH 4RB0A 3BC8A 3KPHA 1JI8A 3PL8A 3WU2C 3KFWX 2L7ZA 2GA2A 4O5VA 1EKEA 2R5ZA 1TTYA 2QQ9A 2VKHA 4DYRA 4RB2C 4HNTA 3CTAA 3GFMA 3KEOA 4QIWN 2A07F 2OUMA 1AHDP 1UAAA 3ZGKA 1UCRA 5KAIC 2K5CA 5A2QK 3VODA 1U5TB 5D8KB 4A3BJ 2EIMH 4B8XA 3TOAA 5FRMA 1SVOA 3S16J 3OR2C 2O6GE 3G73A 3K4KA 1B8IB 4XLAA 4X6AJ 5D8LB 3JRGA 1Z9CA 1Z7UA 1SMYF 1BM9A 3ASNH 1FOXA 1E3OC 2HOAA 3QAHA 4XNFA 2LBFA 3DU5A 3IP4B 4AVZA 4GO1A 1HF0A 2QQBA 5H20A 4Q4ZF 4RGXA 3OYJA 3A2KA 5EGOA 1VZ0A 4M71A 2R5YB 3HOYJ 2IJLA 1V4RA 3S32A 4ABZA 5BPIA 3K4BA 1H9GA 3B02A 5FKMA 5D4RA 4IEJA 3OOPA 1MIJA 3L2WA 1QVTA 3L7WA 3AL0C 2NVUB 5HOOA 3SJMA 2VQLA 3V42A 4HSRA 2EBIA 1FSEA 3HIFA 3W6JB 4DQ2A 2OZUA 4BQAA 4CZCA 3JRHA 3HRSA 1JTXA 1UG0A 2I5UA 3A01A 1V55H 5E3OA 2DMUA 5FJ8J 3B6AA 3JCUC 3DEWA 4NC6A 2PMHA 1PVEA 1Y0UA 2EV5A 2CQKA 3QP6A 2OTJI 2RNGA 4UXNA 1FTZA 3N97A 4KIBA 3AFHA 4GRIA 1RR7A 2DI3A 2VQCA 3B6CA 3I5UA 5HNFA 1IJWC 3DLAA 5B1BH 2STWA 2XF7A 3I55I 3F9KA 3S93A 1YRNB 3BTCA 3PUFA 4KMFA 4A5MA 1APLC 2RV8A 3F0CA 2HWVA 1D1CA 5EZGA 3A03A 4YG2F 2VJ5A 3GCMA 1JT0A 2W7NA 3CC4I 2R7XA 4NHJA 5HDKA 1YO5C 4MFEA 4OAZA 3WTZA 3SFIA 3L2VA 1VQKI 2DPDA 2BEOA 3S2DJ 4RLFA 1EV7A 3PQJA 2P6TA 1MMGA 3I54A 1PDNC 2E1NA 2ZJ2A 3QYFA 1BR1A 1LNWA 4LGWA 4ETSA 3MKZA 3ZN0A 3HG9A 1OCOH 4CZZA 4MIMA 3RCOA 3LSTA 3DTEA 2UV1A 2ELJA 5LLQA 1FSHA 1OCZH 3DV8A 1GVDA 1WFXA 1SC7A 1SVMA 3ZQ7A 1BOAA 4YRVA 3HDDA 4O3MA 5GADJ 1BI3A 2FOKA 3PO3J 1O4XA 1OCRH 2R7FA 1W5TA 5L3DA 2K02A 1HW2A 4L9VA 4XM3A 3K70C 4HYEA 1O3TA 3K4JA 1GXPA 3L00A 2BYVE 1ETVA 4DGWB 2NXNB 1D8KA 3J7YJ 2LVSA 4KYWA 2Y0MA 4Z2YA 1UFMA 3LL7A 1ZRFA 2ACJA 3FM3A 3O8HA 3DPTA 2K3FA 1V3FA 3ERMA 3I59B 4LK0F 3OYEA 3Q0WA 4MNUA 2HXIA 2M7AA 2R7ZJ 2FE3A 2ZXHA 3TDUC 1QBJA 2XPWA 3WTSC 2XAHA 2QQ8A 2CQQA 2RQPA 2YS9A 1F36A 1FNNA 1BOBA 3F72A 1VTNC 3W2VA 2LLKA 1ZRCA 1TW2A 2A6TA 1S8NA 2DJNA 1W1WE 2RREA 1N25A 4LG0B 1VQ7I 2H1LA 2BVLA 4MHGA 4ON0A 2VN2A 1O57A 4GYGA 3L2UA 2ZBKA 2HQAA 2MSYA 2NS8A 5TRDA 1U9NA 1T95A 2TCTA 1S7OA 2DA4A 5IT3A 3H35A 2B63J 2KRHA 3HKZA 1KA8A 4KA4A 2FJ1A 2ZJPF 2KLOA 2NVYJ 2ZNZA 5GAHJ 5ICFA 4XRSA 3ZMSA 2IA2A 4ZYEA 1KQ9A 1WJBA 1G3WA 5K7HA 5E1ZB 3KE2A 4ZTFA 3Q0VA 2ELKA 2P5KA 1X1PA 2GXAA 3ABLH 2GXBA 4JBAA 4HDVA 4RMNA 2DT6A 3A0BC 4ENNA 2FOWA 1XDUA 2DMTA 4UVAA 4IHWA 4M9XA 3S8PA 5J40A 1DUXC 2DMQA 1TWAJ 2DQRA 4YELA 2DK8A 3RQ4A 5F6FA 1REPC 3CCUI 4E7IA 1R4MB 4M72A 5CQGA 2EZHA 1KU3A 1I39A 2QUFA 3J81K 2ZMEB 1L3LA 4I7HA 5FLXK 3R0AA 1SEUA 4PJMA 4A5NA 4ZC3A 3FXLA 3G1LA 3GEZA 3H92A 4PJ0C 3F6OA 3EYYA 4Y7NJ 4KNYA 2IGNA 1W5SA 3PFYA 3PUBA 3BG3A 2VJIA 2H6BA 1K79A 3I64A 5GPCA 3EDPA 3VB2A 3TW6A 2NRAC 4KICA 1LUJB 2BZTA 1YG2A 2EA4A 4N9HA 4BAYA 5A2QZ 3OSFA 1WJDA 2V9PA 2ESHA 4A2UA 1LJ9A 1P4WA 2RVCA 4DZPA 3OOUA 4DYCA 1N78A 4C9YA 3F21A 2Y31A 3RZOJ 4DNCA 4ZDLA 3CJRB 4FETA 2HU9A 1LVAA 3LMMA 3E6BA 2M3AA 1EA3A 1OYYA 3ZQHA 2EA2A 3NAUA 1KYZA 3FISA 4PFPA 4CSWA 2E7XA 5FKLA 3KETA 1ETWA 3OWTA 1R22A 3WE3A 3VYUB 1P7JA 2DOAA 2P5LC 3SHFA 1KONA 4MFDA 1G6NA 4CO8A 1BN5A 4XKCA 2J5OA 2QEXI 2OBPA 4MQVA 4DYQA 4KMUX 2XDVA 4P9FA 3M3YJ 4RAYA 3OYIA 3FIWA 4MEYF 3LSHA 1B1BA 2DA3A 5F04A 1TNTA 3OYHA 1E0EA 1UELB 4RAGA 1T2KA 3VEPA 1IRFA 2E5NA 1IN8A 2MABA 1SANA 4RA2A 4TV7A 3OYDA 1IN6A 4LJZF 1IXRC 2R7DA 5IPAA 2LG4A 3TMOA 1N75A 4M9ZA 2XAQA 2L7KA 5AONA 3SZPA 3IWFA 3PNYA 3K2AA 3RKYA 4XN0A 3LAPA 4IPAA 1S9HA 5J3LA 4CCKA 4E7HA 2K40A 2DYRH 5HS9A 5K5OA 4U7DA 2OF7A 3G2BA 4N4OB 2BHZA 1BA5A 1J2XA 2I8DA 2DDAA 2FXAA 2WWYA 1F4KA 2KDZA 4HX7A 3RI4A 1OR7C 4BEHA 4G9YA 4LIUA 1F1ZA 2H27A 3BR1A 1YE9A 3JSOA 1B4AA 1Z05A 3X2QH 2KMUA 5FGMA 3FDYA 2Q8KA 2QENA 3ROUA 4WF2A 2UWMA 1T98A 4ENJA 5DCMB 5E8IA 4BE2A 2EFQA 1BL0A 1R1TA 1WI9A 2R92J 2EZLA 1R23A 2RDPA 1QQIA 2NNYA 3E7LA 5JR3A 5HS8A 4UUSA 3GUDA 4BNCA 3OMYA 5CYVA 3FHZA 1TQMA 1ONVA 2O61A 2AXLA 2XHKA 1UHMA 3C2HA 4XLCA 3RTRA 4HRIA 1HW5A 1WQ2A 1XX5A 3FWEA 3SEQA 3Q9SA 3CCQI 4I0AA 1R5ID 1MMDA 1RKWA 4S05A 1BW5A 5E17F 3LFKA 1QGPA 1B6AA 2DMNA 1F43A 5BPDA 1HOMA 2KIUA 3P9CA 2ISYA 3BZ6A 1Q1HA 3IH2A 4GYIA 2VB6A 1VQ4I 2R7UA 1WKMA 4I76A 5DM6F 2DPUA 5EZHA 4D9JA 2O8XA 1PUFB 2FA5A 3MWMA 3E6CC 4BYYA 2P0WA 2IXSA 4S04A 2VKVA 2V1NA 1XSDA 2ZMEC 2F5DA 3OYNA 2DLLA 2HVQA 4M74A 4NQWA 1SFUA 3L1PA 2TDXA 3BQYA 5JVGF 1G59A 1B72A 3PSIA 3BT9A 3HSEA 3CUQB 1T33A 4FASD 1FEXA 1R4NB 1MDMB 3E5UA 3SYTA 2GOMA 1ZYRF 1RR8C 1EF4A 2ZXJA 1B9MA 2F48A 3OYLA 3HM5A 2HYJA 4ZZLA 2Z9OA 2DAOA 2E60A 2JZYA 3GZ5A 4C30A 2A5WA 3FK6A 1S5LC 2BVMA 1YS6A 3RYPA 3K2ZA 4E7SA 5DV5A 1ZR2A 1I3QJ 4AYBN 2BY2A 4MLOA 3E97A 3HHGA 1ACIA 2CUEA 2M4KA 1K6YA 1LDDA 1QPMA 3GFJA 1MH4A 1JKQC 2P5VA 2M9HA 3KP2A 5BOXA 1Z0XA 1FOWA 2E1MB 4V19K 4EEFG 3RYRA 4BXFA 3M9AA 2OPTA 1ENHA 3VPRA 2KRCA 2MBFA 1YITI 3HUGB 2XVCA 3W6VA 2QKLB 4HQMA 4CA0A 1AKHB 1IXSB 1IN4A 1JKPC 1R58A 4HW0A 5TGTA 3HPHA 5L3EA 4EGZA 2WAEA 2JTVA 3L9FA 1LKXA 1YS7A 4NUBA 4XLEA 4IF4A 1TNSA 4LMYA 4QTRA 1YJWI 1W7PA 2NYXA 4RGUA 4J01A 2D2WA 4CUGA 2EFOA 2Z5UA 3LSPA 2HXOA 1QNTA 5HDNA 2LRDA 3SZGA 4BQQA 2BXZA 1J09A 5K7FA 5D6EA 2VUMJ 3T8RA 2O03A 4UY8I 2F2EA 2V26A 3CCLI 5EYRA 2Y0SN 2IEKA 2O3FA 3OYAA 2JSCA 1PP7U 2PFBA 2KISA 3CCYA 4LLGF 4RGSA 2P7CB 2DDBA 3MZYA 3J81Z 1LFPA 2OAZA 1OCTC 5FLXZ 4FX4A 4LLNA 5CKTA 1JGSA 4KDPA 1V5EA 4CHUA 2JUGA 2L4AA 1FMWA 2BY0A 2CV0A 3F8BA 1DU0A 2HZTA 2HDDA 1U9OA 1U3EM 4A0XA 5HNHA 2K7LA 2V1UA 2EPFA 1ETKA 2ESNA 2X0LA 4B47A 2HOSA 2B7EA 4LK1F 1VF9A 2ZFWA 2CFXA 1YIOA 5GPAA 3HSFA 5JVTA 2JJ7A 3WTTC 3GTKJ 2MGQA 3FXUA 5GAEJ 2JUCA 2LREA 1S29A 2YSRA 3UR3C 4PSXA 2EQRA 4WXCA 2VIXA 2XGXA 3M8JA 5JHFA 4EVIA 2K9QA 3OYCA 3LOCA 3R4KA 3TDZC 2W24A 2YU3A 2LH9A 1WJ5A 4IXAA 3ULQB 2VPRA 3CDLA 4UHTA 1W4MA 4C3JJ 2XIGA 4IHXA 4KUMA 1Y8RB 3JRIA 1MBJA 1P4XA 3S1MJ 4HPQA 3ERED 4DIQA 1ZR4A 4E70A 3TKYA 2ZJRF 3CCRI 1JGGA 2KP6A 2L9RA 4Y4RA 3CCMI 4ITVA 4A0YA 2FMLA 4M3GA 4BXXJ 5BMZA 2HOEA 5E8GA 4HF0A 2X6WA 4PK4A 3TOBA 1MBHA 3LSKA 3J80K 3J7ZI 1VQ6I 1XB4A 1YX3A 2W82A 5M3FJ 2H1KA 1AOYA 1P4AA 3TO9A 4NBQA 1ORKA 1K6OA 2VBYA 2KIMA 1Z77A 2M34A 3A02A 1B8IA 2GIZA 5CVJA 2BW3B 4EM2A 5EG0B 3IAS2 3TQNA 1BR4A 3CMEI 2G7UA 4I02A 3PIOF 4IO9F 1HC8A 1LPQA 4Y15A 5IYBJ 1ZREA 4M3EA 4I99C 2CO5A 5ERIA 3BZKA 2X4HA 3PSFA 5HLHA 2R5YA 4GGGA 3HBLA 3CZ6A 2HVRA 1T56A 2B0LA 2VONA 1HBXG 4XKBA 2E1MC 3IHUA 3HXLA 2L2OA 3GZ6A 3B73A 4Y52J 3NARA 4PGHA 1R9TJ 2EIJH 5IY5H 3F23A 1CGPA 4OMYA 4RAZA 1FP2A 1LEBA 3OS1A 1K7AA 1X4OA 1X1AA 1FIPA 2Q0OA 4L5JA 3NWSA 4BJ6C 2L4MA 2MG4A 1X2NA 3E5XA 3EUKL 4E7KA 2XSJC 4BHCA 4ZYHA 3CCVI 1O3SA 1AU7A 4F52A 5ICGA 3WTWC 2EFWA 4MEXF 4B09A 1D8JA 2YX4A 1Z3YA 1HSTA 2D5VA 3DKXA 1LE8A 4HEA2 2W1OA 3HYIA 2GZWA 2O0YA 4X0GA 4BBSJ 1S3JA 2MFZA 3BPVA 4M3FA 4RS8A 3K1MA 2DFEA 4XLFA 3OL3A 4P5OA 2RKHA 4N4NB 3CDIA 3LQQA 1MNMC 4X1EA 4AIDA 2DQLA 1RKTA 2IS4A 1RETA 1RZ4A 1Y8QB 3C2GA 4OWRB 2JA7J 1BJZA 2R7VA 3EUAA 3M7GA 3WU1B 1K83J 2D1HA 4AD9A 1O3QA 1IXCA 2W00A 2KJBA 3ZOBA 4E4HA 4XKWA 1BIBA 3S3MA 2J5PA 3OIQA 4JX6A 4A3FJ 3TEDA 1PUEE 5CQEA 3REOA 3DU6A 2JPCA 4IOCF 2MD0A 1H89C 3HGGA 1H9TA 5C4XJ 4E7LA 4PJNA 1IF1A 2NS0A 5GTIC 1KU2A 4A93J 2IPQX 4A12A 2LY2A 1JJ8C 2NOJB 5GAGJ 1ZAOA 2V6EA 1ODDA 3CMAI 3OSGA 2CRGA 2PEXA 4A6DA 3JTHA 2WV1A 5JLXA 4P9UA 3CDHA 1P92A 3RPUA 2RN7A 2LR8A 1ETXA 4YFXF 2QLZA 1DP7P 2K4BA 1X3ZB 4KT5C 4WCGA 4ENKA 2MA3A 1V5GA 2X48A 1Z7LA 4I6ZA 4B44A 1QU3A 4G94A 3GVAA 4ZYAA 4RB3C 3BWGA 1DPUA 3CC7I 1VQOI 1Z21A 3DTKA 1WCMJ 2DU9A 2IS2A 1FT9A 4KIGA 1O3RA 2EH3A 5D4SA 1FBQA 3F8FA 3T5XA 2FUG2 3ECHA 1GHCA 2HYFA 2R7TA 3U21A 1U8RA 1TBXA 1TP4A 3TW7A 4HLXA 2AS5F 3CJQB 2LDUA 2QSFX 1Z3XA 3S1RJ 4JQFA 1R1UA 2LMDA 2VT3A 4IX7A 1WHUA 2IP2A 2HZDA 2VJJA 3G1OA 1S7EA 3MAJA 4XLPF 1YQAA 2QKMB 2L9SA 3K4CA 1WJFA 2LY1A 3AG1H 1S7AA 1UHWA 1A35A 1WVRA 4LG0A 4Z6YA 4D1QA 2UZKA 3HOZJ 3IH4A 4LFUA 2JA6J 5CPRB 3HOVJ 3MEXA 3S1QJ 1QPIA 2VT2A 2R93J 1OYIA 4AU7A 4G7ZF 1MMSA 2DA6A 3H9GA 1TZLA 2EINH 2CV2A 4BXUA 2XV4S 2VI6A 1I1SA 5C3EJ 2DODA 5BQTA 3EYIA 4WX9A 4HV6A 4UVCA 3FX3A 2WTEA 1MH3A 3ZQLA 4RM3A 1I6XA 3OIPA 4BUPA 4IZZA 5J47A 5F0FA 5HVQC 2WY8Q 1GDTA 2DBBA 1I27A 3H9QA 1X19A 1JUMA 1QZZA 3OS2A 3K1PA 4XONA 1KU9A 4WXDA 2FNPA 2IVMA 5L3CA 3N4MA 2IGMA 2KIFA 4D7MA 3O8GA 1XC5A 1MMNA 2OCEA 2DN0A 2BY3A 4H4KC 1MBKA 1UHSA 3HRMA 1FJLA 2VE8A 2A68F 3GFLA 4C3HJ 2ZMEA 4CGZA 3W2AA 2VL8A 2VODA 3EQLF 1IV8A 4UB6C 1JUPA 4ZH4F 2MYSA 3LSIA 3FMQA 2JSPA 5EGOB 1Y0NA 4I09A 3RIRA 3P7NA 1A6IA 1IW7F 4B43A 1Y6IA 2XRNA 1G3TA 3HKZN 3M8FA 1VQMI 3A1YA 3VWBA 3DEEA 1BI0A 4Y17A 1KYWA 3J80Z 3ML6A 1Y1WJ 3PFIA 5IP9J 2LD5A 2IA1A 4YIRX 4PJLA 1PP8F 1U5TC 3TGNA 2QBYB 1RUNA 3FXJA 4PDKA 4AC0A 1FOYA 2HDWA 2UXNA 3CD6I 1G8XA 4BDZA 3BJOA 3H3ZA 4HBLA 1YJ9I 2ECBA 2JWTA 5FB2A 2D45A 2IT0A 6PAXA 3P9KA 4C2MJ 2L0KA 4DW6A 3I0TA 3H9JA 4F55A 2IAIA 2PMZA 3U1DA 2R7SA 2L7FP 3I56I 3F3XA 2H8RA 4IHYA 4HNUA 4EM1A 3GWZA 3BTIA 3VYRB 3GTQJ 3BZCA 3LSMA 3QU6A 1D5YA 1OQYA 2XAUA 2HYGD 3O3KA 5J6XA 4XIDA 1BC8C 3O6BB 4F3QA 2QVOA 3F8MA 4EV0A 2HR3A 1POGA 3OIOA 4A3GJ 1NHAA 2CW0F 2LKSA 4UB8C 4KISA 1XS9A 2EB7A 3MD2A 3WODF 3BJ6A 2DMPA 4GFBA 1KGSA 3D0SA 5DM7F 1J59A 4FHTA 3Q9VA 3WTYC 3BR6A 4RAFA 4CDGA 1WRJA 5DDGA 1ETOA 3WHCA 4FCYA 5LGUA 2L02A 4EJTA 4ZZDA 4LITA 5JHUA 5LGTA 3K0LA 5F64A 5JFRA 1FC3A 4GDFA 1BI2A 3WTVC 1K61A 1ERDA 1FWZA 3R0JA 2W85A 3DEUA 3QYEA 3C18A 1P7IA 1DQUA 3RSNA 2M7BA 2QWWA 1WI3A 3JRDA 3Q5FA 2L3DA 3CC2I 1XGNA 3ZPLA 3OR1C 1FOKA 4ASNA 3GF2A 5E18F 4R1HA 3IWZA 1WPKA 5J1UA 4ENMA 2PJPA 3K6GA 1HKTA 2VQGA 5J4VA 3LQRA 4W1UA 4J19A 4ZDOA 3E1SA 4ZJZA 2NVXJ 2LY9A 2D1VA 2EZKA 2UUZA 2CUJA 1NK2P 5AIPA 1JT6A 4NDLA 1R00A 3DFGA 2DYSH 2HEOA 3EUHC 1XD7A 1XTAA 2IGOA 3QWLA 2DT7B 3H5NA 5J8FA 2QGUA 2M0CA 4C3IJ 5J1RA 3WE2A 4W97A 1VI0A 2JT1A 5F1JA 3VFZA 4G6TB 3WGIA 1IUYA 4IVNA 4II2A 4CYCA 1KU7A 3CCJI 3GO5A 4HA8A 3G1MA 5FLVA 2RQQA 3WTXC 3VDXA 2GOXB 2LTPA 2P8TA 2QCOA 5F27A 1VQPI 3S3OA 2XAJA 1MBEA 3K10A 1IZ1A 2CFOA 2OD5A 3BPXA 4B3AA 4IQJA 5HDGA 3COAC 1YTYA 2F4IA 2GIVA 2VLAA 3CP2A 4HNVA 5E3MA 1RRJA 4JYKA 2YUSA 1D0ZA 1X2MA 1MDMA 1T08B 3IRRA 1FP1D 3AG4H 3CF2A 1YI2I 3ZRGA 3LNQA 3DF8A 4ESBA 2F5VA 3PO2J 4C2UA 2WADA 2ZFUA 3LA7A 4ZYGA 1XDSA 3KYDB 1OMIA
chains in the Genus database with same CATH topology
1V55H 5B1AH 1OCZH 3ASNH 3ABKH 2DYSH 3AG1H 3AG3H 2Y69H 1OCRH 3ASOH 2EILH 2ZXWH 3ABLH 3X2QH 3ABMH 5B1BH 1OCOH 3AG4H 2EIMH 2EINH 3WG7H 1OCCH 2EIJH 2OCCH 5IY5H 2EIKH 3AG2H 2DYRH 5B3SH 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 H;  5B1A H;  1OCZ H;  3ASN H;  3ABK H;  2DYS H;  3AG1 H;  3AG3 H;  2Y69 H;  1OCR H;  3ASO H;  2EIL H;  2ZXW H;  3ABL H;  3X2Q H;  3ABM H;  5B1B H;  1OCO H;  3AG4 H;  2EIM H;  2EIN H;  3WG7 H;  1OCC H;  2EIJ H;  2OCC H;  5IY5 H;  2EIK H;  3AG2 H;  2DYR H;  5B3S H;  1V54 H; 
#chains in the Genus database with same CATH topology
 1T0F C;  3U9G A;  2MW8 A;  3L2Q A;  5H6Q A;  1OCP A;  2Z3Y A;  2MC3 A;  2PN6 A;  3H5R A;  1WSU A;  4CCN A;  1Z6R A;  2ZXI A;  5D6F A;  2P81 A;  1ZLK A;  3WGH A;  2NOG A;  4L0Y B;  4KIF A;  5IYD J;  4KFC A;  2L9N A;  2OTL I;  2VOP A;  3G6E I;  3BCB A;  3GLL A;  2CW7 A;  1XPX A;  2IBD A;  3BR3 A;  4QLC U;  2Y48 A;  1DP3 A;  4UUV A;  2BY1 A;  1AKH A;  1CF7 A;  2O8K A;  2WAQ A;  1K78 A;  3DWL E;  3NQO A;  2HVS A;  2E1O A;  2V7F A;  4FE4 A;  1G4D A;  1X4P A;  2XGC A;  1GT0 C;  3NRV A;  4AWX B;  4Q5S F;  1RI7 A;  1WWX A;  4B48 A;  3DBH B;  3RQI A;  2CUZ A;  2OQR A;  4IHV A;  1JUS A;  4AVP A;  3ELK A;  3SQN A;  4ESJ A;  2VBZ A;  3HHH A;  3SEZ A;  1IC8 A;  1ULY A;  1VQ9 I;  2K3P A;  2CQ7 A;  3GTL J;  4FT8 A;  1STZ A;  4CCJ A;  5M5W J;  1X1B A;  4G6Q A;  3IV5 A;  2M4G A;  2COM A;  1NTC A;  4XOP A;  4D7N A;  3F22 A;  3F8N A;  1TWC J;  3ECO A;  3PM1 A;  2FQ4 A;  3LSG A;  5D5X B;  4XRF A;  1YW8 A;  3JR9 A;  4G8X A;  2JRT A;  4AM3 A;  3QOE A;  2G0E A;  1GXQ A;  4IKF A;  2DT5 A;  2ME0 A;  2XRL A;  2O9L A;  1RIO H;  1XGS A;  2Q2E A;  2WB1 N;  3QPT A;  4BY1 J;  1ZKG A;  2JK3 A;  2X6Y A;  3FHN A;  2BE5 F;  1BIA A;  2VBX A;  2VKD A;  3BLY A;  4R8H A;  4RGR A;  3AAF A;  2G9W A;  2X1D A;  1W5C C;  3KLO A;  2BBY A;  4ANJ A;  5FD5 A;  3RKQ A;  2XSD C;  2LYC A;  1ON1 A;  4XLH A;  3ABM H;  4A3J J;  1X3W B;  4PJJ A;  1MND A;  2DOF A;  4U87 A;  3FKJ A;  3FK7 A;  3R60 A;  4RM2 A;  1ZAR A;  2V6C A;  5D5V B;  1FYK A;  5LEK A;  3SDB A;  1B59 A;  3ZR8 X;  5FLM J;  4P96 A;  3R6S A;  4KIT B;  3FXM A;  1TQI A;  2DXI A;  5KNL A;  4PSW A;  5DEQ A;  2Z2S B;  1SFK A;  2XC7 A;  3BTL A;  3HZJ A;  3W2W A;  3CUO A;  5K5R A;  4FX0 A;  2WB1 A;  2W48 A;  4OIQ F;  5DD8 A;  2MH2 A;  4Y33 A;  5ILV A;  2N8G A;  1UST A;  1T8I A;  1FBU A;  4A3C J;  1BI1 A;  4XQF A;  3MZ8 A;  3KX2 A;  3CO7 C;  3I4N J;  4ESF A;  3E3V A;  3QOP A;  2JMW A;  2LF7 A;  1S72 I;  3BG5 A;  3DLL F;  4EQQ A;  3W3C A;  5JLW A;  4UUS B;  2MLG A;  2BW3 A;  2PJR B;  3K1N A;  3VSK A;  4F91 B;  4LD5 A;  4HF2 A;  2E2H J;  1I5Z A;  2A69 F;  2Q1Z B;  4Y13 A;  2LK2 A;  5HLI A;  4J00 A;  4H0E A;  3HPG A;  3IH3 A;  5EEG A;  3ZMV A;  4U0Y A;  1U2W A;  3LA2 A;  4XMY A;  1XCB A;  5IT9 K;  1QZE A;  3ABT A;  1TWH J;  3P9I A;  1SFO J;  2VPL A;  4L9T A;  3V7C A;  2HQ5 A;  2HDC A;  3DP7 A;  3KP7 A;  1OIS A;  5M5X J;  1WJA A;  3IC7 A;  1IO2 A;  4P1W A;  3ZCO A;  1D0Y A;  5M5Y J;  2K86 A;  1V54 H;  5CVU A;  1MD0 A;  3KEY A;  2F5E A;  4A3M J;  1QHH D;  3PQK A;  2WC2 A;  3VSL A;  4HX8 A;  3GZN B;  4NQW B;  2IA0 A;  5L3F A;  3I3L A;  3V7S A;  1DGW Y;  1G2H A;  1SD4 A;  2BV6 A;  3MVP A;  1B72 B;  3D5S C;  4XIC A;  1SVL A;  2EFN A;  4EMS A;  3HOW J;  4Q47 A;  5ILS A;  2RC4 A;  3I9V 2;  3QQA A;  2P4W A;  4CH7 A;  5KK1 A;  4HF1 A;  3K4M A;  2F6C A;  2R7W A;  3QRF F;  1QHG A;  5JI6 A;  2XGD A;  2R7O A;  3DXJ F;  1JHH A;  2JRM A;  1SD6 A;  3HRT A;  2A61 A;  4F93 B;  3SZT A;  5KAF C;  1WJE A;  4HQE A;  5E3L A;  3CES A;  1HQC A;  3QP5 A;  4MTD A;  1RNL A;  2VC0 A;  1IN5 A;  4RLQ A;  2PQ8 A;  1X1C A;  4RDU A;  4JK1 X;  4CCM A;  1ZEL A;  4OIO F;  2XB5 A;  4WXH A;  2L5Q A;  1P6R A;  4B4C A;  2L01 A;  1LDK B;  4OU0 A;  4MTE A;  2GBY A;  3H5A A;  1XMA A;  1U5T A;  1MW7 A;  4YII A;  2CSO A;  3CUQ C;  4M73 A;  3HOT A;  2HGC A;  2OV7 A;  2DA1 A;  3J7A O;  4A69 C;  4II3 A;  3BCA A;  3MKY B;  2IGK A;  1DGR M;  4HOB A;  1W7P B;  2E19 A;  3M1C A;  3WGG A;  3S15 J;  3ASO H;  3E6M A;  1FBS A;  2XGE A;  5M3M J;  4HX4 A;  1FLI A;  2TRT A;  4OIR F;  5CVI A;  3WHB A;  4U7B A;  3L2C A;  3BR5 A;  5KHD A;  2KPM A;  2NAZ A;  4M3B A;  5D5W B;  3IUO A;  3DKY A;  1Q1V A;  3JRC A;  4XLN F;  2YX7 A;  2KKO A;  3BG7 A;  3OS0 A;  1USS A;  1JHF A;  5FFZ A;  2VBW A;  4CIC A;  5KCM A;  2FQ3 A;  4Q48 A;  1VQ8 I;  3MKW B;  4BY7 J;  1XMK A;  4JP0 A;  4XOT A;  1QRY A;  1YOV B;  3ISP A;  2M30 A;  2WY7 Q;  5BS6 A;  3S1N J;  3M8E A;  4O6J A;  2FSW A;  4BJT A;  2HFH A;  5LRS A;  1I6H J;  3FXR A;  2E36 A;  4C2T A;  2XB0 X;  5FFX A;  4N0B A;  5J8C A;  3L09 A;  3KP4 A;  1YRN A;  2ZSI B;  1FPQ A;  5E20 A;  3ZMU A;  3S17 J;  1IDZ A;  1EH7 A;  3BG6 A;  1TLH B;  2HQR A;  1C0W A;  3C7J A;  2LF8 A;  1FYL A;  4ZYD A;  1EH6 A;  1F5T A;  1HSJ A;  4OIN F;  4JOM A;  3UNG C;  3GTJ J;  2ELH A;  2A05 A;  3RDI A;  3DPU A;  2HTJ A;  1EH8 A;  5C44 J;  3NEU A;  3DPL C;  4CXF A;  3HJE A;  1MNE A;  2R0Q C;  1SAU A;  1JKO C;  1HW1 A;  1NK3 P;  2E7W A;  3WG9 A;  1TQP A;  4I0B A;  3HTS B;  2YPR A;  2FRH A;  3E5Q A;  3JAM K;  3JRE A;  3BR0 A;  3BG9 A;  4FTH A;  2FX0 A;  4OAY A;  2R7Q A;  1OPC A;  3EUH A;  3FM5 A;  1UMQ A;  3S2W A;  3H3U A;  1G3Y A;  1XSV A;  3D5R C;  3BRO A;  4EJV A;  1B9N A;  3ZMD A;  1V5F A;  4XN3 A;  3RJP A;  1ZHF A;  1YIJ I;  4U0W A;  2F4O B;  3HTU A;  5F0H A;  2CV1 A;  2FBK A;  3PIP F;  2XF5 A;  5KVR A;  1A04 A;  2X1E A;  1IRG A;  3GME A;  2RNJ A;  2DK5 A;  3KP6 A;  3K7A J;  2Z99 A;  5C4J J;  2HOT A;  1NG6 A;  1SFE A;  4A0Z A;  2IW5 A;  3TP0 A;  2K9M A;  4EJO A;  2HPM A;  2AQE A;  3PJR A;  5IOZ A;  1ZH5 A;  3WU0 A;  3GFI A;  1P2F A;  1LFU P;  4CYD A;  3VYS B;  4N9I A;  5FKK A;  5LGN A;  1SAX A;  4IRI A;  3KLN A;  2JA2 A;  3R61 A;  1UZC A;  4UUT A;  3FBI B;  4CCO A;  4A3K J;  1G3S A;  2VQH A;  1HXD A;  3HOS A;  2WA0 A;  4DOZ A;  3I59 A;  3ZQF A;  4MO7 A;  2BHY A;  1Z67 A;  1CQT A;  5LHH A;  3I4M J;  1UB9 A;  4HV5 A;  5LHG A;  4E7Z A;  2ZCW A;  4XSZ F;  1HCR A;  2OJE D;  2QYO A;  4BAC A;  3K4L A;  4PCQ A;  4EJW A;  3I71 A;  4A3E J;  3KCC A;  1OCC H;  1T0F A;  1X58 A;  3HEF A;  1IRX A;  3T1B A;  3P5J A;  4BKX A;  2QBY A;  2XF6 A;  3N05 A;  2QF7 A;  1RUO A;  1IDY A;  2X1C A;  4BE1 A;  2JA8 J;  3CLO A;  1OR7 A;  3GTP J;  2DTZ A;  2DFF A;  3DBL B;  4L18 B;  4MGR A;  2CMP A;  2EV6 A;  1JTY A;  5EF6 A;  5FD6 A;  3I53 A;  4D5C A;  5HLG A;  5K7Z A;  1LQ1 A;  2X9D A;  1ITY A;  2K9L A;  2DFH A;  2KFD A;  2Y69 H;  4XR6 A;  1LE8 B;  4AUX A;  4D0P A;  5J1Y A;  2OU2 A;  2PLY A;  3C2B A;  2IS1 A;  1RES A;  1GUU A;  1R7J A;  5HLT A;  2HTS A;  5IT9 Z;  4M6Y A;  1Y39 A;  4UVB A;  5B66 C;  3BJA A;  1EJ9 A;  3QPH A;  3J7A Y;  1HA8 A;  1FY7 A;  1NG7 A;  3V8L A;  1QVU A;  2ZKZ A;  2OQG A;  2LFB A;  3OL4 A;  1I1G A;  3JTG A;  4ZDP A;  4NC8 A;  1ZQ3 P;  4L9N A;  3S3N A;  3MCZ A;  1HDP A;  2LKP A;  4BBR J;  1W0T A;  4OIP F;  2R5Z B;  2XAG A;  3BR2 A;  1MJB A;  4V2G A;  3BY6 A;  4G7O F;  1WH5 A;  4V2F A;  1MGT A;  9ANT A;  1PJR A;  1LB2 A;  1WZ2 A;  5CVV A;  1IG7 A;  4NNJ A;  2H94 A;  1PYV A;  3TO6 A;  3KZZ A;  1WJC A;  3MQ0 A;  4A3L J;  4EGY A;  4IRH A;  1D5V A;  2RGV A;  2LBF B;  4QSH A;  1L0O C;  2Y30 A;  3AG3 H;  2W4S A;  3ZMZ A;  2LNB A;  4BGD A;  2PG4 A;  2PMZ N;  1A36 A;  3K4N A;  4U0V A;  2JPB A;  2VJ4 A;  3ESW B;  4M9S A;  2JVG A;  1Y56 A;  3BOQ A;  2FBH A;  4A3D J;  3GTM J;  3IKV A;  3SFZ A;  5ED4 A;  3JSP A;  2X85 A;  2JVH A;  1D1B A;  1O7F A;  1RPW A;  4MQ9 F;  2Y9Z A;  3KEQ A;  3LWF A;  3CF5 F;  1IAW A;  1ZK8 A;  4PGG A;  1ZRD A;  3JRF A;  3A01 B;  4LIV A;  3V8J A;  2WV0 A;  4XL9 A;  2ME6 A;  3DQV C;  2FU4 A;  2UXX A;  1YW9 A;  3CJT B;  1XSX A;  2XAS A;  1LVK A;  1R5H A;  1XCV A;  5TIS C;  1ZG5 A;  3JW4 A;  2W25 A;  1ZLJ A;  4YEJ A;  3GYH X;  2CJJ A;  2ZB9 A;  3IL2 A;  4OMZ A;  1R5G A;  4JX4 A;  3A4C A;  2EWN A;  2GA1 A;  5CJ9 A;  1XGO A;  3KYL A;  1AWC A;  1OFC X;  3HB9 A;  1WH7 A;  2CW8 A;  2ID6 A;  1T38 A;  2NVT J;  2CG4 A;  3ZXS A;  4XKV A;  2GXG A;  2CWE A;  1XG1 A;  1T39 A;  3OV8 A;  5HS7 A;  3HC7 A;  2LP0 A;  2DFI A;  2QM3 A;  2A5Y B;  1AA7 A;  2MC4 A;  5DUK A;  2NS7 A;  4CCL A;  4DJA A;  1W36 D;  4I2O A;  2YR2 A;  5EJC A;  1H8A C;  1T6S A;  3ZQQ A;  2KZV A;  4B1R A;  2DA7 A;  3FXO A;  2QA4 I;  2FD5 A;  3CMM A;  3M07 A;  1FTT A;  1R6R A;  3U1K A;  2L54 A;  1JKR C;  2HKO A;  2F5F A;  2CQX A;  2K4J A;  1D3Y A;  1IUF A;  1M1E B;  2G7H A;  1VQL I;  4YFN F;  2EV0 A;  1GV2 A;  3CQZ J;  1S6L A;  2E1C A;  4AIJ A;  2XPU A;  3FMS A;  2DW4 A;  2H8W A;  1GV5 A;  3BDD A;  1ETQ A;  4IJA A;  2K85 A;  3BQZ A;  5FRN A;  5L3B A;  5E79 C;  1E2X A;  1HKS A;  2C6Y A;  4KN4 X;  4AIK A;  5TJJ A;  5ILU A;  3AKZ A;  2Z33 A;  3GTO J;  5DCM A;  2A6H F;  4LLL A;  2QZ8 A;  4HDU A;  5CLS A;  5LFA A;  3JRA A;  3JAM Z;  3G3Z A;  3H0G J;  4A6E A;  3DCF A;  3EPZ A;  3DKW A;  3D1N I;  1SFX A;  1N77 A;  5DCF A;  2EFP A;  1VQN I;  1LDJ A;  1MSE C;  3I58 A;  4I98 B;  3CCE I;  5HOD A;  2FMY A;  5GP9 A;  3LFU A;  4UV9 A;  2FNA A;  3QU3 A;  5IP6 A;  4FIS A;  4BH9 A;  1U6G A;  4BS9 A;  4WWC A;  4IHS A;  2DOE A;  2V79 A;  1E17 A;  3QPS A;  5CVR A;  1VND A;  5ICE A;  2AHQ A;  2OZ6 A;  1ZN2 A;  3CO6 C;  1FYM A;  1UJ8 A;  1J75 A;  2M1B A;  2RAE A;  1FX7 A;  1ZGW A;  1PUF A;  3OYF A;  2B9S A;  4GCV A;  4WK8 F;  1GLN A;  2BGC A;  2R3S A;  1YX5 A;  2GAU A;  2CS3 A;  2P7V B;  4RB1 A;  2V9V A;  3KP3 A;  1Z91 A;  1SD5 A;  5IOY A;  2ZNY A;  2QSG X;  2VE9 A;  3A0H C;  5F08 A;  1I50 J;  1TT5 B;  4HZF A;  1BR2 A;  4OOI A;  2K27 A;  5LHI A;  4EAT A;  1JJ6 C;  3OYK A;  3CUQ A;  1MSF C;  2WAQ N;  5DS9 A;  2KHM A;  2XUB A;  4L0Z B;  2M45 A;  2OC6 A;  5EEH A;  2ADU A;  4RBO A;  3QYB A;  1P9Q C;  5GTH C;  3RZD J;  1I3A A;  5LEJ A;  3ABU A;  3LSJ A;  4XBF A;  3HSR A;  2ID3 A;  1TWF J;  1YYV A;  4E6K G;  3WTU C;  2Y9Y A;  2GM4 A;  1J9I A;  2Z1D A;  4XSX F;  2XKP A;  3QPL A;  1J0R A;  3RPQ A;  3C3W A;  1XMX A;  3LAJ A;  3ZP5 A;  1E3P A;  1J5Y A;  1YLF A;  2W84 A;  5FKO A;  3Q0U A;  3HUG A;  3KZY A;  2M5W A;  3KYC B;  3HL2 A;  1WGX A;  4F7Z A;  4R79 A;  3ZQG A;  3DBR B;  3IKT A;  3H0D A;  1U0J A;  2Z16 A;  2CH0 A;  2M0M A;  1J7K A;  5L3G A;  3K69 A;  1H0M A;  3KP5 A;  5F0C A;  3ONQ A;  3PNT A;  5FRO A;  2CU7 A;  3HRU A;  3D5L A;  1KQ0 A;  1W7P D;  1W0U A;  4XRM A;  2ISZ A;  2DA5 A;  1BJA A;  1HDD C;  2WAF A;  4YFK F;  5IP7 J;  3GXO A;  2JA5 J;  5FO5 A;  1A5J A;  4I01 A;  3FKI J;  4HST A;  2AXT C;  2VXZ A;  4UV8 A;  3S2H J;  2E34 A;  3EET A;  3WG7 H;  3CCS I;  2MLK A;  2VC1 A;  2JQ7 A;  3MFK A;  4EM0 B;  2PBI A;  3FF5 A;  2JN6 A;  4BHB A;  2E71 A;  2V4J C;  3FXK A;  1OYW A;  2PJR A;  1ZTR A;  3BP8 A;  3T8T A;  1TWG J;  3ABK H;  1A31 A;  1DU6 A;  2XPV A;  2A3S A;  4XK4 A;  2W57 A;  4NB5 A;  4KN7 X;  3FMR A;  4IRG A;  1IV6 A;  2PMU A;  2X51 A;  4G6D A;  1VFC A;  4QWQ A;  2HI3 A;  3OYG A;  2AO9 A;  4CYC B;  2L9V A;  1H88 C;  1D0X A;  3I4P A;  3LA3 A;  1X3U A;  1UG2 A;  2EIK H;  3AG2 H;  4HG2 A;  1R36 A;  2HNH A;  2LKX A;  2ETH A;  2KRF A;  1R71 A;  4PUS A;  5LD2 C;  2HPI A;  3JRB A;  2VXD A;  2M8E A;  4DZJ A;  3K70 D;  1MBF A;  2IS6 A;  3PNV A;  2LC2 A;  2GWR A;  2K9N A;  4IQ4 A;  4KT6 A;  4LB5 A;  4E7J A;  4FQG A;  3GW2 A;  1MKM A;  1RC9 A;  1DPR A;  3TL4 X;  1NH3 A;  4B3X A;  3ZMT A;  3OY9 A;  1ZGJ A;  1X1D A;  1R49 A;  2XRO A;  2DCE A;  2HQN A;  2CYY A;  4BJ5 C;  3E0J B;  3KZI C;  5H6R A;  2Y2Z A;  2M8G X;  1IGN A;  4BEH B;  3QOD A;  1KZH A;  1YFH A;  5EDN A;  1MMA A;  3NWT A;  5E1W A;  2MH9 A;  3MKL A;  3TBI A;  1VQ5 I;  1KQ8 A;  2DO7 A;  1TW3 A;  3KIO A;  1U78 A;  4M3D A;  1F9N A;  1CF7 B;  1R1V A;  3F8C A;  5K5Q A;  4G12 A;  5BNG A;  1K78 B;  3E6D A;  4AIH A;  4XOR A;  5EG0 A;  2KIQ A;  5J4Y A;  1IN7 A;  5D5U B;  1ETY A;  2L7M P;  1YJN I;  2ZJQ F;  4ZTJ A;  1QO0 D;  1A6Q A;  1TT0 A;  4DBQ A;  2ICW G;  4AYB A;  2GLO A;  2XKO A;  2XAF A;  5F1R A;  5B5E C;  2ECC A;  5DTD A;  2CUF A;  3HOU J;  3C1D A;  4BQN A;  2LOO A;  1Z1D A;  4S0H B;  2EZI A;  3M4O J;  4BL0 B;  1BW6 A;  4KJZ A;  3CMY A;  2VKE A;  2OCC H;  3HOX J;  2F4M B;  1SMT A;  3K9T A;  4GXO A;  5LBQ A;  2WBM A;  5B3S H;  1JE8 A;  2VAS A;  2QSH X;  2O5R A;  3FZV A;  5ICC A;  2AQF A;  1MZB A;  1FZP B;  2Y75 A;  3TP3 A;  4M6V A;  2E2J J;  3VYT B;  5DD4 A;  3CJN A;  4Y3O A;  3DTI A;  3U2R A;  1QA6 A;  2H6C A;  5E3N A;  2QQA A;  2V9K A;  2IRF G;  3GBG A;  4LB6 B;  3S14 J;  5LRR A;  3GLX A;  2EK5 A;  2Q2E B;  2CQN A;  2V1X A;  1HKQ A;  1LEA A;  1IRZ A;  2H09 A;  2R7R A;  1XGM A;  3GTG J;  4BDY A;  1ON2 A;  1OJL A;  2PX9 A;  1O7L A;  4F92 B;  5DUI A;  4PFO A;  4QPQ A;  3IAM 2;  2Y0S A;  2OA4 A;  4JX5 A;  1MBG A;  3L2R A;  1D1A A;  3F6V A;  1FIA A;  3OYM A;  1YHQ I;  2DTR A;  3OYB A;  4YIF A;  2KZG A;  3AL0 B;  1K4T A;  4IHT A;  2R4G A;  2M2E A;  2HKX A;  2KT0 A;  4BQO A;  1MJ9 A;  1SD7 A;  3RKX A;  1LFB A;  2LSO A;  4XRS G;  4BE0 A;  2ZSH B;  3ZQC A;  1JXS A;  3W6K B;  4NC7 A;  2BOL A;  4DBR A;  2YU9 J;  3V7R A;  2P6S A;  5K1Y A;  3CP8 A;  1OLT A;  3FXQ A;  3ZN1 A;  1XN7 A;  2ZO4 A;  3MZH A;  2NVQ J;  2EIL H;  3ZQI A;  3UKG A;  1GVJ A;  2MD5 A;  1U8B A;  1W36 C;  2ZC2 A;  3M1E A;  2DJI A;  2O7O A;  2KQR A;  3SXY A;  3FBN B;  3H1C A;  1YW7 A;  3RPU D;  3V4G A;  2V1D A;  2CGP A;  1Y1V J;  3GX4 X;  2BXY A;  4IL6 C;  2DA2 A;  3IRQ A;  1QZY A;  3MMY B;  4FE7 A;  3HGY A;  1HLV A;  1K4S A;  3MN2 A;  3Q3S A;  4QPO A;  4BU2 A;  3T0Y A;  3H36 A;  1TL8 A;  2E35 A;  1TC3 C;  2KJC A;  3SDG A;  4EJU A;  2KL4 A;  2COB A;  2X6O A;  1Z6T A;  4L9J A;  3V8K A;  4P55 A;  2F5C A;  3LSR A;  2PI0 A;  4IOA F;  4A3I J;  3VOE A;  4U88 A;  1FMV A;  1ZG3 A;  3BTJ A;  4BHP A;  2KDO A;  2I10 A;  4PZJ A;  4M6X A;  2FF4 A;  1E3H A;  4LG3 A;  5H2F C;  3CLQ A;  4L5I A;  5E1X A;  4HLY A;  2NNN A;  2GQQ A;  1BBY A;  2HS5 A;  2K9S A;  2FBI A;  1OKR A;  2VOO A;  3G4S I;  5AIQ A;  5IYC J;  4G7H F;  4L5E A;  5EEA A;  2ZXW H;  2X6X A;  1ZG1 A;  4HAM A;  3H3V K;  2E5Z A;  1BC7 C;  4K2E A;  1DDN A;  5DYM A;  2M87 A;  3TO7 A;  3O2P E;  4LOC A;  4D5F A;  2FEZ A;  1MJA A;  5FKN A;  3RKW A;  4UNO A;  2EJR A;  2E2I J;  2STT A;  1ZGA A;  2A6E F;  3G71 I;  5B1A H;  4RB0 A;  3BC8 A;  3KPH A;  1JI8 A;  3PL8 A;  3WU2 C;  3KFW X;  2L7Z A;  2GA2 A;  4O5V A;  1EKE A;  2R5Z A;  1TTY A;  2QQ9 A;  2VKH A;  4DYR A;  4RB2 C;  4HNT A;  3CTA A;  3GFM A;  3KEO A;  4QIW N;  2A07 F;  2OUM A;  1AHD P;  1UAA A;  3ZGK A;  1UCR A;  5KAI C;  2K5C A;  5A2Q K;  3VOD A;  1U5T B;  5D8K B;  4A3B J;  2EIM H;  4B8X A;  3TOA A;  5FRM A;  1SVO A;  3S16 J;  3OR2 C;  2O6G E;  3G73 A;  3K4K A;  1B8I B;  4XLA A;  4X6A J;  5D8L B;  3JRG A;  1Z9C A;  1Z7U A;  1SMY F;  1BM9 A;  3ASN H;  1FOX A;  1E3O C;  2HOA A;  3QAH A;  4XNF A;  2LBF A;  3DU5 A;  3IP4 B;  4AVZ A;  4GO1 A;  1HF0 A;  2QQB A;  5H20 A;  4Q4Z F;  4RGX A;  3OYJ A;  3A2K A;  5EGO A;  1VZ0 A;  4M71 A;  2R5Y B;  3HOY J;  2IJL A;  1V4R A;  3S32 A;  4ABZ A;  5BPI A;  3K4B A;  1H9G A;  3B02 A;  5FKM A;  5D4R A;  4IEJ A;  3OOP A;  1MIJ A;  3L2W A;  1QVT A;  3L7W A;  3AL0 C;  2NVU B;  5HOO A;  3SJM A;  2VQL A;  3V42 A;  4HSR A;  2EBI A;  1FSE A;  3HIF A;  3W6J B;  4DQ2 A;  2OZU A;  4BQA A;  4CZC A;  3JRH A;  3HRS A;  1JTX A;  1UG0 A;  2I5U A;  3A01 A;  1V55 H;  5E3O A;  2DMU A;  5FJ8 J;  3B6A A;  3JCU C;  3DEW A;  4NC6 A;  2PMH A;  1PVE A;  1Y0U A;  2EV5 A;  2CQK A;  3QP6 A;  2OTJ I;  2RNG A;  4UXN A;  1FTZ A;  3N97 A;  4KIB A;  3AFH A;  4GRI A;  1RR7 A;  2DI3 A;  2VQC A;  3B6C A;  3I5U A;  5HNF A;  1IJW C;  3DLA A;  5B1B H;  2STW A;  2XF7 A;  3I55 I;  3F9K A;  3S93 A;  1YRN B;  3BTC A;  3PUF A;  4KMF A;  4A5M A;  1APL C;  2RV8 A;  3F0C A;  2HWV A;  1D1C A;  5EZG A;  3A03 A;  4YG2 F;  2VJ5 A;  3GCM A;  1JT0 A;  2W7N A;  3CC4 I;  2R7X A;  4NHJ A;  5HDK A;  1YO5 C;  4MFE A;  4OAZ A;  3WTZ A;  3SFI A;  3L2V A;  1VQK I;  2DPD A;  2BEO A;  3S2D J;  4RLF A;  1EV7 A;  3PQJ A;  2P6T A;  1MMG A;  3I54 A;  1PDN C;  2E1N A;  2ZJ2 A;  3QYF A;  1BR1 A;  1LNW A;  4LGW A;  4ETS A;  3MKZ A;  3ZN0 A;  3HG9 A;  1OCO H;  4CZZ A;  4MIM A;  3RCO A;  3LST A;  3DTE A;  2UV1 A;  2ELJ A;  5LLQ A;  1FSH A;  1OCZ H;  3DV8 A;  1GVD A;  1WFX A;  1SC7 A;  1SVM A;  3ZQ7 A;  1BOA A;  4YRV A;  3HDD A;  4O3M A;  5GAD J;  1BI3 A;  2FOK A;  3PO3 J;  1O4X A;  1OCR H;  2R7F A;  1W5T A;  5L3D A;  2K02 A;  1HW2 A;  4L9V A;  4XM3 A;  3K70 C;  4HYE A;  1O3T A;  3K4J A;  1GXP A;  3L00 A;  2BYV E;  1ETV A;  4DGW B;  2NXN B;  1D8K A;  3J7Y J;  2LVS A;  4KYW A;  2Y0M A;  4Z2Y A;  1UFM A;  3LL7 A;  1ZRF A;  2ACJ A;  3FM3 A;  3O8H A;  3DPT A;  2K3F A;  1V3F A;  3ERM A;  3I59 B;  4LK0 F;  3OYE A;  3Q0W A;  4MNU A;  2HXI A;  2M7A A;  2R7Z J;  2FE3 A;  2ZXH A;  3TDU C;  1QBJ A;  2XPW A;  3WTS C;  2XAH A;  2QQ8 A;  2CQQ A;  2RQP A;  2YS9 A;  1F36 A;  1FNN A;  1BOB A;  3F72 A;  1VTN C;  3W2V A;  2LLK A;  1ZRC A;  1TW2 A;  2A6T A;  1S8N A;  2DJN A;  1W1W E;  2RRE A;  1N25 A;  4LG0 B;  1VQ7 I;  2H1L A;  2BVL A;  4MHG A;  4ON0 A;  2VN2 A;  1O57 A;  4GYG A;  3L2U A;  2ZBK A;  2HQA A;  2MSY A;  2NS8 A;  5TRD A;  1U9N A;  1T95 A;  2TCT A;  1S7O A;  2DA4 A;  5IT3 A;  3H35 A;  2B63 J;  2KRH A;  3HKZ A;  1KA8 A;  4KA4 A;  2FJ1 A;  2ZJP F;  2KLO A;  2NVY J;  2ZNZ A;  5GAH J;  5ICF A;  4XRS A;  3ZMS A;  2IA2 A;  4ZYE A;  1KQ9 A;  1WJB A;  1G3W A;  5K7H A;  5E1Z B;  3KE2 A;  4ZTF A;  3Q0V A;  2ELK A;  2P5K A;  1X1P A;  2GXA A;  3ABL H;  2GXB A;  4JBA A;  4HDV A;  4RMN A;  2DT6 A;  3A0B C;  4ENN A;  2FOW A;  1XDU A;  2DMT A;  4UVA A;  4IHW A;  4M9X A;  3S8P A;  5J40 A;  1DUX C;  2DMQ A;  1TWA J;  2DQR A;  4YEL A;  2DK8 A;  3RQ4 A;  5F6F A;  1REP C;  3CCU I;  4E7I A;  1R4M B;  4M72 A;  5CQG A;  2EZH A;  1KU3 A;  1I39 A;  2QUF A;  3J81 K;  2ZME B;  1L3L A;  4I7H A;  5FLX K;  3R0A A;  1SEU A;  4PJM A;  4A5N A;  4ZC3 A;  3FXL A;  3G1L A;  3GEZ A;  3H92 A;  4PJ0 C;  3F6O A;  3EYY A;  4Y7N J;  4KNY A;  2IGN A;  1W5S A;  3PFY A;  3PUB A;  3BG3 A;  2VJI A;  2H6B A;  1K79 A;  3I64 A;  5GPC A;  3EDP A;  3VB2 A;  3TW6 A;  2NRA C;  4KIC A;  1LUJ B;  2BZT A;  1YG2 A;  2EA4 A;  4N9H A;  4BAY A;  5A2Q Z;  3OSF A;  1WJD A;  2V9P A;  2ESH A;  4A2U A;  1LJ9 A;  1P4W A;  2RVC A;  4DZP A;  3OOU A;  4DYC A;  1N78 A;  4C9Y A;  3F21 A;  2Y31 A;  3RZO J;  4DNC A;  4ZDL A;  3CJR B;  4FET A;  2HU9 A;  1LVA A;  3LMM A;  3E6B A;  2M3A A;  1EA3 A;  1OYY A;  3ZQH A;  2EA2 A;  3NAU A;  1KYZ A;  3FIS A;  4PFP A;  4CSW A;  2E7X A;  5FKL A;  3KET A;  1ETW A;  3OWT A;  1R22 A;  3WE3 A;  3VYU B;  1P7J A;  2DOA A;  2P5L C;  3SHF A;  1KON A;  4MFD A;  1G6N A;  4CO8 A;  1BN5 A;  4XKC A;  2J5O A;  2QEX I;  2OBP A;  4MQV A;  4DYQ A;  4KMU X;  2XDV A;  4P9F A;  3M3Y J;  4RAY A;  3OYI A;  3FIW A;  4MEY F;  3LSH A;  1B1B A;  2DA3 A;  5F04 A;  1TNT A;  3OYH A;  1E0E A;  1UEL B;  4RAG A;  1T2K A;  3VEP A;  1IRF A;  2E5N A;  1IN8 A;  2MAB A;  1SAN A;  4RA2 A;  4TV7 A;  3OYD A;  1IN6 A;  4LJZ F;  1IXR C;  2R7D A;  5IPA A;  2LG4 A;  3TMO A;  1N75 A;  4M9Z A;  2XAQ A;  2L7K A;  5AON A;  3SZP A;  3IWF A;  3PNY A;  3K2A A;  3RKY A;  4XN0 A;  3LAP A;  4IPA A;  1S9H A;  5J3L A;  4CCK A;  4E7H A;  2K40 A;  2DYR H;  5HS9 A;  5K5O A;  4U7D A;  2OF7 A;  3G2B A;  4N4O B;  2BHZ A;  1BA5 A;  1J2X A;  2I8D A;  2DDA A;  2FXA A;  2WWY A;  1F4K A;  2KDZ A;  4HX7 A;  3RI4 A;  1OR7 C;  4BEH A;  4G9Y A;  4LIU A;  1F1Z A;  2H27 A;  3BR1 A;  1YE9 A;  3JSO A;  1B4A A;  1Z05 A;  3X2Q H;  2KMU A;  5FGM A;  3FDY A;  2Q8K A;  2QEN A;  3ROU A;  4WF2 A;  2UWM A;  1T98 A;  4ENJ A;  5DCM B;  5E8I A;  4BE2 A;  2EFQ A;  1BL0 A;  1R1T A;  1WI9 A;  2R92 J;  2EZL A;  1R23 A;  2RDP A;  1QQI A;  2NNY A;  3E7L A;  5JR3 A;  5HS8 A;  4UUS A;  3GUD A;  4BNC A;  3OMY A;  5CYV A;  3FHZ A;  1TQM A;  1ONV A;  2O61 A;  2AXL A;  2XHK A;  1UHM A;  3C2H A;  4XLC A;  3RTR A;  4HRI A;  1HW5 A;  1WQ2 A;  1XX5 A;  3FWE A;  3SEQ A;  3Q9S A;  3CCQ I;  4I0A A;  1R5I D;  1MMD A;  1RKW A;  4S05 A;  1BW5 A;  5E17 F;  3LFK A;  1QGP A;  1B6A A;  2DMN A;  1F43 A;  5BPD A;  1HOM A;  2KIU A;  3P9C A;  2ISY A;  3BZ6 A;  1Q1H A;  3IH2 A;  4GYI A;  2VB6 A;  1VQ4 I;  2R7U A;  1WKM A;  4I76 A;  5DM6 F;  2DPU A;  5EZH A;  4D9J A;  2O8X A;  1PUF B;  2FA5 A;  3MWM A;  3E6C C;  4BYY A;  2P0W A;  2IXS A;  4S04 A;  2VKV A;  2V1N A;  1XSD A;  2ZME C;  2F5D A;  3OYN A;  2DLL A;  2HVQ A;  4M74 A;  4NQW A;  1SFU A;  3L1P A;  2TDX A;  3BQY A;  5JVG F;  1G59 A;  1B72 A;  3PSI A;  3BT9 A;  3HSE A;  3CUQ B;  1T33 A;  4FAS D;  1FEX A;  1R4N B;  1MDM B;  3E5U A;  3SYT A;  2GOM A;  1ZYR F;  1RR8 C;  1EF4 A;  2ZXJ A;  1B9M A;  2F48 A;  3OYL A;  3HM5 A;  2HYJ A;  4ZZL A;  2Z9O A;  2DAO A;  2E60 A;  2JZY A;  3GZ5 A;  4C30 A;  2A5W A;  3FK6 A;  1S5L C;  2BVM A;  1YS6 A;  3RYP A;  3K2Z A;  4E7S A;  5DV5 A;  1ZR2 A;  1I3Q J;  4AYB N;  2BY2 A;  4MLO A;  3E97 A;  3HHG A;  1ACI A;  2CUE A;  2M4K A;  1K6Y A;  1LDD A;  1QPM A;  3GFJ A;  1MH4 A;  1JKQ C;  2P5V A;  2M9H A;  3KP2 A;  5BOX A;  1Z0X A;  1FOW A;  2E1M B;  4V19 K;  4EEF G;  3RYR A;  4BXF A;  3M9A A;  2OPT A;  1ENH A;  3VPR A;  2KRC A;  2MBF A;  1YIT I;  3HUG B;  2XVC A;  3W6V A;  2QKL B;  4HQM A;  4CA0 A;  1AKH B;  1IXS B;  1IN4 A;  1JKP C;  1R58 A;  4HW0 A;  5TGT A;  3HPH A;  5L3E A;  4EGZ A;  2WAE A;  2JTV A;  3L9F A;  1LKX A;  1YS7 A;  4NUB A;  4XLE A;  4IF4 A;  1TNS A;  4LMY A;  4QTR A;  1YJW I;  1W7P A;  2NYX A;  4RGU A;  4J01 A;  2D2W A;  4CUG A;  2EFO A;  2Z5U A;  3LSP A;  2HXO A;  1QNT A;  5HDN A;  2LRD A;  3SZG A;  4BQQ A;  2BXZ A;  1J09 A;  5K7F A;  5D6E A;  2VUM J;  3T8R A;  2O03 A;  4UY8 I;  2F2E A;  2V26 A;  3CCL I;  5EYR A;  2Y0S N;  2IEK A;  2O3F A;  3OYA A;  2JSC A;  1PP7 U;  2PFB A;  2KIS A;  3CCY A;  4LLG F;  4RGS A;  2P7C B;  2DDB A;  3MZY A;  3J81 Z;  1LFP A;  2OAZ A;  1OCT C;  5FLX Z;  4FX4 A;  4LLN A;  5CKT A;  1JGS A;  4KDP A;  1V5E A;  4CHU A;  2JUG A;  2L4A A;  1FMW A;  2BY0 A;  2CV0 A;  3F8B A;  1DU0 A;  2HZT A;  2HDD A;  1U9O A;  1U3E M;  4A0X A;  5HNH A;  2K7L A;  2V1U A;  2EPF A;  1ETK A;  2ESN A;  2X0L A;  4B47 A;  2HOS A;  2B7E A;  4LK1 F;  1VF9 A;  2ZFW A;  2CFX A;  1YIO A;  5GPA A;  3HSF A;  5JVT A;  2JJ7 A;  3WTT C;  3GTK J;  2MGQ A;  3FXU A;  5GAE J;  2JUC A;  2LRE A;  1S29 A;  2YSR A;  3UR3 C;  4PSX A;  2EQR A;  4WXC A;  2VIX A;  2XGX A;  3M8J A;  5JHF A;  4EVI A;  2K9Q A;  3OYC A;  3LOC A;  3R4K A;  3TDZ C;  2W24 A;  2YU3 A;  2LH9 A;  1WJ5 A;  4IXA A;  3ULQ B;  2VPR A;  3CDL A;  4UHT A;  1W4M A;  4C3J J;  2XIG A;  4IHX A;  4KUM A;  1Y8R B;  3JRI A;  1MBJ A;  1P4X A;  3S1M J;  4HPQ A;  3ERE D;  4DIQ A;  1ZR4 A;  4E70 A;  3TKY A;  2ZJR F;  3CCR I;  1JGG A;  2KP6 A;  2L9R A;  4Y4R A;  3CCM I;  4ITV A;  4A0Y A;  2FML A;  4M3G A;  4BXX J;  5BMZ A;  2HOE A;  5E8G A;  4HF0 A;  2X6W A;  4PK4 A;  3TOB A;  1MBH A;  3LSK A;  3J80 K;  3J7Z I;  1VQ6 I;  1XB4 A;  1YX3 A;  2W82 A;  5M3F J;  2H1K A;  1AOY A;  1P4A A;  3TO9 A;  4NBQ A;  1ORK A;  1K6O A;  2VBY A;  2KIM A;  1Z77 A;  2M34 A;  3A02 A;  1B8I A;  2GIZ A;  5CVJ A;  2BW3 B;  4EM2 A;  5EG0 B;  3IAS 2;  3TQN A;  1BR4 A;  3CME I;  2G7U A;  4I02 A;  3PIO F;  4IO9 F;  1HC8 A;  1LPQ A;  4Y15 A;  5IYB J;  1ZRE A;  4M3E A;  4I99 C;  2CO5 A;  5ERI A;  3BZK A;  2X4H A;  3PSF A;  5HLH A;  2R5Y A;  4GGG A;  3HBL A;  3CZ6 A;  2HVR A;  1T56 A;  2B0L A;  2VON A;  1HBX G;  4XKB A;  2E1M C;  3IHU A;  3HXL A;  2L2O A;  3GZ6 A;  3B73 A;  4Y52 J;  3NAR A;  4PGH A;  1R9T J;  2EIJ H;  5IY5 H;  3F23 A;  1CGP A;  4OMY A;  4RAZ A;  1FP2 A;  1LEB A;  3OS1 A;  1K7A A;  1X4O A;  1X1A A;  1FIP A;  2Q0O A;  4L5J A;  3NWS A;  4BJ6 C;  2L4M A;  2MG4 A;  1X2N A;  3E5X A;  3EUK L;  4E7K A;  2XSJ C;  4BHC A;  4ZYH A;  3CCV I;  1O3S A;  1AU7 A;  4F52 A;  5ICG A;  3WTW C;  2EFW A;  4MEX F;  4B09 A;  1D8J A;  2YX4 A;  1Z3Y A;  1HST A;  2D5V A;  3DKX A;  1LE8 A;  4HEA 2;  2W1O A;  3HYI A;  2GZW A;  2O0Y A;  4X0G A;  4BBS J;  1S3J A;  2MFZ A;  3BPV A;  4M3F A;  4RS8 A;  3K1M A;  2DFE A;  4XLF A;  3OL3 A;  4P5O A;  2RKH A;  4N4N B;  3CDI A;  3LQQ A;  1MNM C;  4X1E A;  4AID A;  2DQL A;  1RKT A;  2IS4 A;  1RET A;  1RZ4 A;  1Y8Q B;  3C2G A;  4OWR B;  2JA7 J;  1BJZ A;  2R7V A;  3EUA A;  3M7G A;  3WU1 B;  1K83 J;  2D1H A;  4AD9 A;  1O3Q A;  1IXC A;  2W00 A;  2KJB A;  3ZOB A;  4E4H A;  4XKW A;  1BIB A;  3S3M A;  2J5P A;  3OIQ A;  4JX6 A;  4A3F J;  3TED A;  1PUE E;  5CQE A;  3REO A;  3DU6 A;  2JPC A;  4IOC F;  2MD0 A;  1H89 C;  3HGG A;  1H9T A;  5C4X J;  4E7L A;  4PJN A;  1IF1 A;  2NS0 A;  5GTI C;  1KU2 A;  4A93 J;  2IPQ X;  4A12 A;  2LY2 A;  1JJ8 C;  2NOJ B;  5GAG J;  1ZAO A;  2V6E A;  1ODD A;  3CMA I;  3OSG A;  2CRG A;  2PEX A;  4A6D A;  3JTH A;  2WV1 A;  5JLX A;  4P9U A;  3CDH A;  1P92 A;  3RPU A;  2RN7 A;  2LR8 A;  1ETX A;  4YFX F;  2QLZ A;  1DP7 P;  2K4B A;  1X3Z B;  4KT5 C;  4WCG A;  4ENK A;  2MA3 A;  1V5G A;  2X48 A;  1Z7L A;  4I6Z A;  4B44 A;  1QU3 A;  4G94 A;  3GVA A;  4ZYA A;  4RB3 C;  3BWG A;  1DPU A;  3CC7 I;  1VQO I;  1Z21 A;  3DTK A;  1WCM J;  2DU9 A;  2IS2 A;  1FT9 A;  4KIG A;  1O3R A;  2EH3 A;  5D4S A;  1FBQ A;  3F8F A;  3T5X A;  2FUG 2;  3ECH A;  1GHC A;  2HYF A;  2R7T A;  3U21 A;  1U8R A;  1TBX A;  1TP4 A;  3TW7 A;  4HLX A;  2AS5 F;  3CJQ B;  2LDU A;  2QSF X;  1Z3X A;  3S1R J;  4JQF A;  1R1U A;  2LMD A;  2VT3 A;  4IX7 A;  1WHU A;  2IP2 A;  2HZD A;  2VJJ A;  3G1O A;  1S7E A;  3MAJ A;  4XLP F;  1YQA A;  2QKM B;  2L9S A;  3K4C A;  1WJF A;  2LY1 A;  3AG1 H;  1S7A A;  1UHW A;  1A35 A;  1WVR A;  4LG0 A;  4Z6Y A;  4D1Q A;  2UZK A;  3HOZ J;  3IH4 A;  4LFU A;  2JA6 J;  5CPR B;  3HOV J;  3MEX A;  3S1Q J;  1QPI A;  2VT2 A;  2R93 J;  1OYI A;  4AU7 A;  4G7Z F;  1MMS A;  2DA6 A;  3H9G A;  1TZL A;  2EIN H;  2CV2 A;  4BXU A;  2XV4 S;  2VI6 A;  1I1S A;  5C3E J;  2DOD A;  5BQT A;  3EYI A;  4WX9 A;  4HV6 A;  4UVC A;  3FX3 A;  2WTE A;  1MH3 A;  3ZQL A;  4RM3 A;  1I6X A;  3OIP A;  4BUP A;  4IZZ A;  5J47 A;  5F0F A;  5HVQ C;  2WY8 Q;  1GDT A;  2DBB A;  1I27 A;  3H9Q A;  1X19 A;  1JUM A;  1QZZ A;  3OS2 A;  3K1P A;  4XON A;  1KU9 A;  4WXD A;  2FNP A;  2IVM A;  5L3C A;  3N4M A;  2IGM A;  2KIF A;  4D7M A;  3O8G A;  1XC5 A;  1MMN A;  2OCE A;  2DN0 A;  2BY3 A;  4H4K C;  1MBK A;  1UHS A;  3HRM A;  1FJL A;  2VE8 A;  2A68 F;  3GFL A;  4C3H J;  2ZME A;  4CGZ A;  3W2A A;  2VL8 A;  2VOD A;  3EQL F;  1IV8 A;  4UB6 C;  1JUP A;  4ZH4 F;  2MYS A;  3LSI A;  3FMQ A;  2JSP A;  5EGO B;  1Y0N A;  4I09 A;  3RIR A;  3P7N A;  1A6I A;  1IW7 F;  4B43 A;  1Y6I A;  2XRN A;  1G3T A;  3HKZ N;  3M8F A;  1VQM I;  3A1Y A;  3VWB A;  3DEE A;  1BI0 A;  4Y17 A;  1KYW A;  3J80 Z;  3ML6 A;  1Y1W J;  3PFI A;  5IP9 J;  2LD5 A;  2IA1 A;  4YIR X;  4PJL A;  1PP8 F;  1U5T C;  3TGN A;  2QBY B;  1RUN A;  3FXJ A;  4PDK A;  4AC0 A;  1FOY A;  2HDW A;  2UXN A;  3CD6 I;  1G8X A;  4BDZ A;  3BJO A;  3H3Z A;  4HBL A;  1YJ9 I;  2ECB A;  2JWT A;  5FB2 A;  2D45 A;  2IT0 A;  6PAX A;  3P9K A;  4C2M J;  2L0K A;  4DW6 A;  3I0T A;  3H9J A;  4F55 A;  2IAI A;  2PMZ A;  3U1D A;  2R7S A;  2L7F P;  3I56 I;  3F3X A;  2H8R A;  4IHY A;  4HNU A;  4EM1 A;  3GWZ A;  3BTI A;  3VYR B;  3GTQ J;  3BZC A;  3LSM A;  3QU6 A;  1D5Y A;  1OQY A;  2XAU A;  2HYG D;  3O3K A;  5J6X A;  4XID A;  1BC8 C;  3O6B B;  4F3Q A;  2QVO A;  3F8M A;  4EV0 A;  2HR3 A;  1POG A;  3OIO A;  4A3G J;  1NHA A;  2CW0 F;  2LKS A;  4UB8 C;  4KIS A;  1XS9 A;  2EB7 A;  3MD2 A;  3WOD F;  3BJ6 A;  2DMP A;  4GFB A;  1KGS A;  3D0S A;  5DM7 F;  1J59 A;  4FHT A;  3Q9V A;  3WTY C;  3BR6 A;  4RAF A;  4CDG A;  1WRJ A;  5DDG A;  1ETO A;  3WHC A;  4FCY A;  5LGU A;  2L02 A;  4EJT A;  4ZZD A;  4LIT A;  5JHU A;  5LGT A;  3K0L A;  5F64 A;  5JFR A;  1FC3 A;  4GDF A;  1BI2 A;  3WTV C;  1K61 A;  1ERD A;  1FWZ A;  3R0J A;  2W85 A;  3DEU A;  3QYE A;  3C18 A;  1P7I A;  1DQU A;  3RSN A;  2M7B A;  2QWW A;  1WI3 A;  3JRD A;  3Q5F A;  2L3D A;  3CC2 I;  1XGN A;  3ZPL A;  3OR1 C;  1FOK A;  4ASN A;  3GF2 A;  5E18 F;  4R1H A;  3IWZ A;  1WPK A;  5J1U A;  4ENM A;  2PJP A;  3K6G A;  1HKT A;  2VQG A;  5J4V A;  3LQR A;  4W1U A;  4J19 A;  4ZDO A;  3E1S A;  4ZJZ A;  2NVX J;  2LY9 A;  2D1V A;  2EZK A;  2UUZ A;  2CUJ A;  1NK2 P;  5AIP A;  1JT6 A;  4NDL A;  1R00 A;  3DFG A;  2DYS H;  2HEO A;  3EUH C;  1XD7 A;  1XTA A;  2IGO A;  3QWL A;  2DT7 B;  3H5N A;  5J8F A;  2QGU A;  2M0C A;  4C3I J;  5J1R A;  3WE2 A;  4W97 A;  1VI0 A;  2JT1 A;  5F1J A;  3VFZ A;  4G6T B;  3WGI A;  1IUY A;  4IVN A;  4II2 A;  4CYC A;  1KU7 A;  3CCJ I;  3GO5 A;  4HA8 A;  3G1M A;  5FLV A;  2RQQ A;  3WTX C;  3VDX A;  2GOX B;  2LTP A;  2P8T A;  2QCO A;  5F27 A;  1VQP I;  3S3O A;  2XAJ A;  1MBE A;  3K10 A;  1IZ1 A;  2CFO A;  2OD5 A;  3BPX A;  4B3A A;  4IQJ A;  5HDG A;  3COA C;  1YTY A;  2F4I A;  2GIV A;  2VLA A;  3CP2 A;  4HNV A;  5E3M A;  1RRJ A;  4JYK A;  2YUS A;  1D0Z A;  1X2M A;  1MDM A;  1T08 B;  3IRR A;  1FP1 D;  3AG4 H;  3CF2 A;  1YI2 I;  3ZRG A;  3LNQ A;  3DF8 A;  4ESB A;  2F5V A;  3PO2 J;  4C2U A;  2WAD A;  2ZFU A;  3LA7 A;  4ZYG A;  1XDS A;  3KYD B;  1OMI A; 
#chains in the Genus database with same CATH homology
 1V55 H;  5B1A H;  1OCZ H;  3ASN H;  3ABK H;  2DYS H;  3AG1 H;  3AG3 H;  2Y69 H;  1OCR H;  3ASO H;  2EIL H;  2ZXW H;  3ABL H;  3X2Q H;  3ABM H;  5B1B H;  1OCO H;  3AG4 H;  2EIM H;  2EIN H;  3WG7 H;  1OCC H;  2EIJ H;  2OCC H;  5IY5 H;  2EIK H;  3AG2 H;  2DYR H;  5B3S H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...