3AG2H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag2H00
2EINH 5B1AH 3ABKH 2OCCH 3AG2H 5IY5H 2DYSH 3AG4H 3X2QH 3ASNH 3AG3H 1OCOH 1V55H 1OCZH 2Y69H 3ABLH 1OCCH 2EIJH 3ASOH 3WG7H 2EIMH 1V54H 2DYRH 2EILH 2EIKH 5B1BH 3AG1H 3ABMH 5B3SH 2ZXWH 1OCRH
chains in the Genus database with same CATH superfamily
4ANJA 1SANA 3GXOA 4CZCA 4QPQA 3WU2C 1OJLA 1YOVB 2QQBA 3QPSA 3RQIA 1A04A 2OZ6A 5F6FA 5FRNA 4E7KA 2P7CB 4PK4A 3IV5A 3TQNA 1EKEA 1J5YA 1HKQA 1GUUA 4B48A 2R4GA 1V4RA 2F5FA 2KL4A 2V7FA 4XLHA 4P55A 2HTSA 3J80Z 2LTPA 1GT0C 4UNOA 2BW3A 1FZPB 3KFWX 2DFFA 2ZJ2A 4MQ9F 2L54A 4BE0A 1BC8C 4HOBA 1W36D 3E7LA 1FIPA 4Y3OA 2M45A 3NAUA 3G1MA 4UVBA 3TO9A 3A02A 3G1LA 4Y33A 2CMPA 2K40A 3HGGA 5LGNA 2FOWA 4H4KC 3HOSA 5LHHA 4WXCA 1H0MA 2KIQA 1MW7A 1TNSA 4RB0A 3DBRB 1R5GA 2QQ8A 1KYWA 1FOKA 3V7RA 3FK6A 2OC6A 1JKOC 4YIFA 3WG7H 5AIQA 2OU2A 1KU7A 3HOZJ 2H09A 4RB2C 2ME0A 3K0LA 3Q0VA 3DBHB 1OCRH 1UHSA 3H92A 5LGUA 1MSFC 2VC0A 2LP0A 2CFOA 2DCEA 1A6IA 1XCBA 3F8BA 2CWEA 4G7OF 1SFKA 2X85A 2IPQX 1PJRA 4WXHA 2CUZA 2DQLA 3WHCA 2TDXA 3S1RJ 1MBHA 1ZN2A 2V26A 4S0HB 3E5XA 5LRSA 3MZ8A 4XIDA 3CMEI 2D1VA 1U8BA 3HEFA 5GAHJ 4YEJA 3S93A 1ZR4A 4H0EA 2K4JA 4I6ZA 2EQRA 4PJJA 2R3SA 1YX3A 5HLTA 1YITI 1YJNI 4L18B 5E1ZB 4B43A 2BY1A 5J8FA 2R7SA 2P8TA 2TCTA 2L02A 1DPRA 2OA4A 1O3TA 2DMTA 2O0YA 4XORA 3CJRB 3TDUC 3DF8A 5FD6A 3QAHA 3BR0A 3CMMA 3HZJA 1RUOA 1TLHB 4KMFA 2O8KA 3S1QJ 2WAFA 1XCVA 2WA0A 2KHMA 3CCRI 1L3LA 1SMYF 3DWLE 3M9AA 4IZZA 3ABKH 3RQ4A 5ICEA 4LLGF 5K7HA 4BHPA 3I59B 3O2PE 3WTVC 1FSHA 3T1BA 2OBPA 4FISA 4EM2A 2LYCA 2LH9A 1A31A 3B73A 5F64A 1FBUA 1NHAA 2F5CA 3MAJA 4FT8A 4XKWA 1XMAA 3WGHA 1IDZA 2ZFWA 1H9TA 4GYIA 4EEFG 2DDBA 2HZTA 4J19A 2EIJH 2XGCA 5E20A 3J81Z 2HXIA 3HHGA 2FOKA 2KZVA 2VUMJ 3JRFA 4II2A 4FX0A 1UMQA 4BXUA 4V2GA 1OR7C 5HS7A 3VSKA 2MW8A 3J7AY 2KRFA 3LA7A 4BYYA 1IAWA 4HPQA 5HNFA 1BR4A 3BLYA 2VKEA 1LFUP 4YELA 2R7VA 4DOZA 4BNCA 3C1DA 2KMUA 3W6KB 2LKPA 3C2BA 1RUNA 3S17J 5KAIC 4AIKA 2WY7Q 5IOZA 4HLXA 2WWYA 1D0XA 2K9LA 1K61A 2H6BA 1UFMA 3FM3A 3HUGA 2XB0X 2BZTA 3WTZA 1IC8A 2VT2A 4XL9A 4OAZA 4L0ZB 2V1DA 4HX7A 5J6XA 1UCRA 2BGCA 4IHTA 3OOPA 4Y15A 3T5XA 4KIBA 2LBFA 2R93J 1RETA 4BQOA 5H6QA 1Y1VJ 2QYOA 3FXLA 4E7SA 1MBKA 1YHQI 3DLAA 1K78B 2QCOA 3JRIA 1OMIA 4RLFA 1VTNC 3H0DA 1YO5C 5IPAA 3HHHA 4BKXA 2TRTA 2HQRA 1XDUA 5E17F 2Z9OA 2VJ5A 2K85A 3MWMA 5BPDA 3DU6A 3MCZA 2DA2A 2CW0F 2L3DA 1KQ0A 2M30A 3ML6A 3GZ5A 3VOEA 4XN3A 4IHSA 1LKXA 3K4KA 4GFBA 2I10A 4MTEA 1HBXG 5H20A 2R7ZJ 5J40A 2HU9A 5IOYA 2Z33A 2FMYA 3SZGA 2JRTA 2IXSA 2W1OA 1AWCA 1QA6A 3QP5A 2VBYA 4AU7A 4BQQA 3PQKA 2R7DA 1B4AA 2R0QC 5BPIA 3GEZA 4G12A 2Y48A 3EYIA 2ZXIA 4HSTA 4LJZF 2BXYA 4D5CA 4O3MA 2JA2A 1UHMA 3DKWA 2VI6A 3CMAI 3GMEA 2E5ZA 2BOLA 2VASA 4U87A 4LB5A 1G8XA 1LDKB 2PQ8A 2YUSA 2A5YB 4XLNF 1X2MA 5IYBJ 4ZZLA 2V9PA 2DPUA 1LFPA 4HYEA 3LSRA 1R1VA 5L3DA 4XICA 1FYKA 2LSOA 3EDPA 1NK2P 2H8RA 4V2FA 4BAYA 2NYXA 4IHVA 1KONA 1FTTA 3BCBA 4DYQA 5K5QA 3LQRA 2EV5A 1B72B 1IRZA 1MGTA 2M3AA 1EJ9A 2PFBA 2M1BA 3LL7A 3U2RA 4LK1F 2VBZA 3HYIA 2KT0A 2MLGA 2OCCH 5M5WJ 4ZYGA 3ABTA 3BY6A 3M4OJ 2OCEA 4XLFA 1YRNB 3EYYA 1D1BA 5L3CA 2F4OB 3RSNA 4KMUX 3BPXA 4F7ZA 4BJ6C 5BQTA 5K7ZA 2XDVA 3JTGA 2D2WA 1Z67A 3P9KA 4YFNF 2ZJRF 1HDPA 2WB1A 4M3GA 3OR2C 2DXIA 2LF7A 2QLZA 3VYSB 2LC2A 4D5FA 2CGPA 1D3YA 1ETVA 2IBDA 1U8RA 4UB6C 5J4VA 2XF6A 2XAHA 2H1LA 3BTJA 3QYFA 4ZJZA 4M73A 4MTDA 5TJJA 3CDIA 3BDDA 2CQKA 3S2DJ 2V1XA 2L01A 3MKLA 1B8IB 1U9NA 2RC4A 5EGOB 1PUEE 4B44A 3LSMA 1D8JA 3F21A 2VJ4A 1H9GA 2COBA 1LQ1A 3K69A 3MVPA 1J0RA 2G7HA 2YU3A 2IGNA 4M3DA 3SHFA 1MDMB 1JKPC 3HTSB 1F43A 2MD5A 1J7KA 1HC8A 1ZRCA 1ETOA 2UUZA 1BC7C 2EILH 2RQQA 1QQIA 4F92B 1O3SA 2FNAA 3DPTA 2CYYA 1RKWA 4A3CJ 4C2MJ 1N78A 2NS7A 1T33A 2E60A 4XOPA 2CUFA 2IRFG 5IP9J 1H88C 1I5ZA 4XRSA 3DP7A 1ZR2A 1FC3A 5FB2A 2DN0A 4IX7A 2MG4A 1O7LA 2DMUA 2H6CA 3NRVA 5CKTA 5FGMA 4WCGA 2WAQN 2K86A 2ME6A 4NNJA 5LBQA 1HQCA 5ERIA 3JSOA 1G3WA 3SEZA 2XF5A 1G59A 5D4RA 1JE8A 1BI0A 3W3CA 3DTIA 2B0LA 3CDLA 4HLYA 4P9FA 1YW8A 2BY2A 4XOTA 4UUTA 5FKMA 3RDIA 4CCLA 1MMSA 5DM7F 4HDUA 3KCCA 2LR8A 1Y6IA 1QVTA 5JVTA 1YE9A 2EWNA 5F1RA 2E7XA 1BA5A 4AYBN 3I54A 5D8LB 3F8FA 2R92J 9ANTA 1P4WA 3TOAA 1RC9A 1YTYA 4NC6A 4LG0A 4B3XA 2VQLA 2V6CA 4F52A 2MFZA 2KDZA 2HYGD 5HLHA 1W0UA 4YRVA 1WI9A 2VN2A 2L7KA 2P6SA 2BE5F 1F36A 2EIKH 3LA2A 1G4DA 2DQRA 3K6GA 4PJMA 1V5FA 5D5WB 1I6XA 2NNNA 4HDVA 4XNFA 4N9IA 4KDPA 3B6CA 5LRRA 5EGOA 1D1CA 1W5CC 3R6SA 5F0CA 4C3IJ 2VQGA 1TW2A 4HV6A 5M3MJ 2B9SA 3K1PA 3ASOH 1XDSA 5FO5A 1KYZA 5CYVA 3OYEA 4CH7A 2GQQA 3HXLA 1Z21A 1WWXA 3W6JB 5A2QZ 2EH3A 3ECOA 3BG3A 2R5YA 3CZ6A 3J80K 2ZO4A 4HBLA 3ZQFA 3AG3H 2V9KA 2X6WA 3I4MJ 2LRDA 4KT6A 1WJEA 2OJED 5LGTA 2L0KA 3H3ZA 3JRBA 3BPVA 3GF2A 4AC0A 2YPRA 4GGGA 2X6XA 1BOBA 1FIAA 3DXJF 3HIFA 2OD5A 1EV7A 4Z6YA 3JRHA 4NHJA 2LD5A 2L7MP 3KPHA 2GA1A 4IVNA 1UB9A 1JTYA 2NOJB 2EFPA 5F04A 4XRSG 2D5VA 4A3LJ 3PSIA 4A3BJ 2STWA 3M3YJ 3VWBA 5EEGA 4RGUA 4BXXJ 1MSEC 3HOWJ 4BU2A 3F6VA 1Z3YA 2V1NA 1OCZH 3KETA 4MLOA 1YYVA 3HSRA 2ADUA 3MZHA 1DUXC 1DQUA 4L5JA 4JBAA 2GLOA 4DQ2A 5C44J 4G8XA 2CSOA 2ZJPF 2CV2A 3PO2J 1FYLA 4HNUA 1X19A 1X2NA 4M9XA 4C3JJ 2CS3A 2KDOA 2MBFA 2N8GA 2OV7A 3S3OA 1BOAA 2XAJA 3OIQA 5DTDA 4NC8A 5D5UB 5FRMA 3BJAA 3S3NA 5KK1A 4ZYDA 3E97A 5CLSA 2UXNA 3AL0C 2OQRA 4IEJA 4F91B 4E7IA 2BYVE 3JR9A 4GDFA 4P1WA 3WU0A 1Z77A 3K4LA 4ESBA 5IP6A 1JHHA 2DJIA 2VL8A 3ZQQA 2F4MB 2BW3B 1OCTC 3KEQA 2PJPA 2EV0A 3GUDA 4ETSA 3CCSI 1JUSA 3BZKA 3ZQGA 4FHTA 4NC7A 3BG9A 4A12A 2M34A 1ZLJA 3FKJA 2KFDA 2KQRA 3PNYA 1E17A 3KEOA 5HS8A 2A3SA 4C2TA 2HNHA 2XAFA 2CRGA 3N05A 2ZC2A 1J75A 3TP0A 4I02A 2XASA 1QHHD 2JMWA 1DGWY 2EFNA 2P81A 2EFQA 3K4BA 4BGDA 3Q9SA 3LWFA 5DDGA 3BROA 4BEHA 5JVGF 3BR5A 3C18A 1BW6A 2JUGA 4BBSJ 1S3JA 5CJ9A 4BE2A 1BR2A 5HVQC 2KJCA 1DGRM 3GFJA 2XKOA 4RAFA 2XKPA 5E3LA 4IOAF 3JAMK 2HQ5A 2CV1A 2O3FA 3KIOA 4GCVA 5K5OA 2QKLB 3GWZA 2YX4A 4XKBA 1E0EA 3VFZA 1IV8A 4BBRJ 5HNHA 4Y13A 1PVEA 1T95A 3HKZA 3I64A 2WV0A 4PCQA 4CSWA 2QA4I 2BHYA 4HA8A 2CH0A 2IVMA 2M7AA 3AAFA 5HDKA 1D8KA 5FJ8J 1XX5A 3CCMI 1YFHA 1VNDA 4XR6A 1F9NA 1QZEA 2W25A 3FISA 5TRDA 2R5YB 2M2EA 5E3OA 1BI2A 3H3VK 3OMYA 5H6RA 2W85A 4A93J 2GAUA 3W2WA 2R7OA 3CP2A 1XTAA 2MC4A 2AQEA 3GTMJ 4LB6B 1WJCA 2MH2A 4P96A 1LDJA 4RBOA 3HPGA 1FOYA 3IP4B 2WB1N 3IRQA 4Q48A 3EUAA 2FA5A 3I56I 3IH4A 2VPRA 2PMZN 1VQ9I 4N0BA 4DW6A 3N97A 4QPOA 3I9V2 3TDZC 2PI0A 5H2FC 2CG4A 2R5ZA 4ENNA 4OAYA 3L7WA 1NH3A 2JT1A 2KIMA 4NB5A 4HW0A 3WTYC 5FLVA 1XC5A 2ESNA 2E5NA 3J7YJ 4WK8F 2ELKA 4GO1A 5D8KB 5FKNA 2H1KA 5KNLA 3AG2H 2CU7A 4G6TB 5JFRA 3M8EA 4KITB 4QSHA 4GRIA 1FTZA 2NS0A 4MFDA 4RGRA 1R00A 2O03A 2LVSA 3HOYJ 3ELKA 3I53A 1ZGJA 2DA6A 2DTRA 4ZYAA 1WI3A 2YSRA 3CC7I 3OYNA 3M7GA 1R1UA 3ECHA 2XSJC 4EGYA 1MH3A 4GYGA 4RAGA 3ZR8X 5LFAA 4U0VA 1O3QA 2BXZA 1IN5A 2WBMA 3CUQB 2ICWG 2QENA 4FETA 1IUYA 1G6NA 4AIHA 3MEXA 2X51A 4Q4ZF 4YG2F 3PM1A 4ZC3A 1Z7UA 3K10A 3K4MA 1BL0A 4IQJA 2LDUA 4ZDPA 5L3FA 2H27A 1BIAA 1X1PA 2DA5A 1M1EB 2VQCA 4HQEA 4WXDA 2Y9YA 2LY9A 3K2AA 3OS2A 2H94A 4L9VA 1MZBA 4D9JA 5EYRA 1ETWA 4FASD 3LSGA 2XV4S 4D0PA 1Z05A 2KIFA 5J8CA 4M9SA 1H89C 5EZHA 1T2KA 3WGGA 3J7AO 3K2ZA 4RM2A 1IN6A 1R4MB 4L5EA 3RPQA 3JRAA 2FF4A 2IA2A 4KIGA 5FKLA 2BV6A 2XGEA 3N4MA 1OCOH 4AM3A 1JXSA 2VKHA 3FIWA 3KZZA 3TGNA 3GTGJ 5DYMA 1MNEA 3M1EA 4A69C 2HWVA 1STZA 2GA2A 1U6GA 3L2RA 3ZMSA 1I3AA 2R7QA 4W97A 3UKGA 1V5GA 1SVMA 3I3LA 2Q8KA 1TQMA 2OAZA 4M3EA 4V19K 2R7UA 1W5TA 3FHNA 4Q47A 2FU4A 3JCUC 2HKOA 4PZJA 4UV9A 2I5UA 2DJNA 1T39A 2EFWA 2PJRB 1V5EA 3IAM2 1LVAA 1SFXA 1T0FA 3WU1B 5K5RA 1MMAA 3SFIA 3JSPA 1GV5A 1U0JA 1ZLKA 2KZGA 3HSEA 3JRGA 2LKXA 3A01B 2DA4A 1N25A 3WTWC 2DLLA 4CA0A 2Z1DA 4BJTA 3K70C 1FP1D 1ZARA 2K9MA 2ZCWA 1QZZA 2HEOA 3CCYA 1JT6A 2M0CA 4A0ZA 3S15J 2O61A 2EZHA 3A1YA 3ERED 2E2HJ 2MH9A 1HF0A 4B09A 2ZBKA 2E2IJ 1QU3A 4KICA 1S29A 5BNGA 3AFHA 4ZYHA 3G4SI 3GVAA 4C9YA 5L3BA 1HLVA 1MMGA 2ZMEB 1HOMA 3OYJA 2DFHA 3SZTA 3A0BC 1SFOJ 3LSIA 1W5SA 2DDAA 3OS1A 2KRCA 4B3AA 2VBWA 3WODF 3PNVA 4TV7A 2CQNA 5LLQA 3HL2A 1JGGA 1MIJA 4R8HA 3E5QA 4YFXF 4LIUA 2O5RA 2O8XA 1ZG1A 3T8TA 3QOPA 3S16J 1LDDA 4LD5A 4LG3A 2Y0MA 1WVRA 5L3GA 3BTIA 3S3MA 3T0YA 3OIOA 3GYHX 3FMQA 4G7HF 2GXBA 4Y4RA 4S04A 4UY8I 1J09A 1TT0A 5B3SH 4M74A 1QVUA 2NVQJ 3OR1C 2VLAA 2M5WA 2K9SA 4ESJA 1YS7A 2VXZA 4CGZA 3FBNB 3IKVA 2AXTC 2K9QA 1V3FA 2FJ1A 1S72I 5DUKA 3F0CA 3HTUA 2ELJA 5JHUA 5J1RA 2BHZA 1UG2A 4RGXA 3ABLH 4E7JA 3QOEA 1EH7A 2LK2A 4G6DA 2E2JJ 5IT9K 1XMXA 2XPVA 1JUMA 1YW7A 3K1NA 5ED4A 1D0ZA 4I0BA 4OWRB 1A6QA 4DZPA 2KKOA 2PMUA 1HW1A 3VSLA 3ONQA 1G2HA 1MJBA 4KISA 4WF2A 3BG6A 4D1QA 3R0AA 4XRMA 1P7JA 4B4CA 1Z7LA 3OYFA 4HF2A 4O6JA 4I2OA 2PJRA 1SEUA 4DBRA 2CQ7A 3ZN0A 1VZ0A 4EJOA 3W6VA 2PN6A 3O6BB 3CLOA 3MZYA 2ZMEA 2V1UA 5B66C 4HZFA 3WG9A 1OFCX 4ZTJA 2OF7A 3KZIC 1PYVA 1X3UA 3D0SA 2F4IA 1APLC 2ESHA 4NBQA 2ZB9A 1UAAA 2WAEA 2IS2A 3FXRA 4AUXA 4JX5A 4BDZA 2E35A 5ILVA 3IL2A 1AA7A 4O5VA 5AONA 1FPQA 3S2HJ 3H5AA 3RZDJ 2NOGA 1X1CA 4CHUA 1PP8F 2V6EA 4C30A 1TQIA 1FNNA 3H36A 3CF5F 4CCOA 3QQAA 3PJRA 1VQ4I 2Q1ZB 3CLQA 2JPCA 4XLCA 2HGCA 4ENKA 3A0HC 2VC1A 2LG4A 3ISPA 1SFEA 1DPUA 1HCRA 4S05A 4LITA 3NARA 5LHGA 5DCFA 4X0GA 5EJCA 2D1HA 3KYCB 2OUMA 3KX2A 3OYCA 5E3NA 5E18F 3LQQA 4IHYA 3GFMA 3TOBA 3GX4X 4CUGA 2JVGA 3L2CA 4XRFA 3TEDA 3JREA 1I3QJ 2A69F 4KIFA 1A36A 4CCJA 2O6GE 1X1DA 4IXAA 1XB4A 4BS9A 1FT9A 3FDYA 3FM5A 1D5YA 4N4OB 4IHXA 3K4NA 2CW8A 2FRHA 2X4HA 4AYBA 3BC8A 5GPCA 2QEXI 1QPMA 1O57A 3K9TA 1LNWA 2EV6A 4ZDOA 3HB9A 3KLOA 5LEKA 2LFBA 1ZAOA 3KLNA 4N9HA 5J4YA 3O3KA 5GP9A 3EUKL 1HKTA 2HVQA 1MDMA 5JLWA 2XAUA 2VE8A 2E71A 2Y69H 1WHUA 3QRFF 1Y8QB 4FX4A 1P9QC 2Q2EA 4BHBA 2K3PA 3G73A 1IUFA 1SD5A 1ODDA 1MBFA 2HOTA 1PP7U 2GBYA 3S32A 3QODA 1K6OA 5HLIA 4DYCA 5TISC 2ZMEC 2PMHA 1IRGA 1QPIA 2IGMA 2EZLA 5C4JJ 1R9TJ 2XPUA 3TL4X 2PX9A 4QTRA 1Y8RB 3HOXJ 4ABZA 5E79C 4EQQA 3HG9A 1XS9A 3GCMA 3TKYA 1T0FC 3OYKA 4LMYA 4CICA 5EF6A 1S9HA 4IPAA 3A2KA 1GV2A 2MABA 4FE7A 1WPKA 4I01A 2E7WA 3C2GA 4BQAA 3I55I 1GHCA 1XD7A 1LUJB 2PLYA 4I7HA 1X58A 3WTXC 1MBGA 2R7FA 5IYCJ 4HF0A 4I0AA 4MGRA 3FBIB 2NRAC 2XAGA 4ITVA 3F9KA 3SXYA 1WGXA 1TT5B 4U0WA 4DNCA 2F5EA 1SAXA 2ZXJA 2FBKA 5CVJA 4G9YA 1ETYA 2HR3A 5D4SA 1UHWA 2Z16A 3L2VA 3ZMDA 2NAZA 2WADA 3D5LA 2YX7A 3KEYA 1SVLA 3BZ6A 1S6LA 2JPBA 1VQ5I 3DTEA 3LAJA 3F23A 2ID3A 3R4KA 4LLNA 1Y56A 3QP6A 1BJZA 1W0TA 1HDDC 2FUG2 2W7NA 3LFKA 2HZDA 2DOEA 3RYPA 4Z2YA 3G3ZA 3MKZA 1YI2I 2IA1A 3KP4A 3FXOA 4A3JJ 2ACJA 1W1WE 2LF8A 2X9DA 2RNGA 3LA3A 3COAC 4C2UA 5KCMA 2K4BA 3V7CA 4DIQA 1R71A 4KA4A 4YFKF 2QM3A 3LFUA 2R7WA 3A4CA 3L09A 1G3SA 5B5EC 1T6SA 2QBYB 2A5WA 4A6EA 1ZH5A 4Y52J 3H35A 4XMYA 2VOPA 2K27A 4QLCU 2XGXA 1NK3P 1ZGAA 2MC3A 3P5JA 3RKQA 2AXLA 3FXMA 5DEQA 1JJ6C 1IN4A 1E3PA 1P4AA 1YJ9I 2X1DA 3WTUC 3GO5A 2HDWA 4UUSA 4AIDA 2M0MA 2K5CA 1UJ8A 3VODA 2VKVA 3ZMUA 5IP7J 2AHQA 1R22A 1ETKA 4FQGA 4PSWA 3WE3A 1KU9A 3Q9VA 4RDUA 1TL8A 4ENMA 4A5MA 2B7EA 4OU0A 3JTHA 3AG1H 1VQKI 3PO3J 3ZCOA 1W7PB 3OYHA 2NVTJ 2FQ4A 4IOCF 5ICGA 1ZKGA 3KP7A 5M5YJ 4HX8A 4KN7X 3G71I 2LY2A 4HAMA 2W57A 2Q2EB 1X1AA 1K6YA 1HA8A 2M4GA 4XSXF 3RTRA 4R79A 3GTJJ 3CCVI 3RKWA 1K78A 4EJUA 3OIPA 1K4SA 3LSTA 2VPLA 4MHGA 2MA3A 5KHDA 1U78A 2W00A 2VXDA 1SFUA 1LJ9A 4R1HA 1TWAJ 1U9OA 2ZJQF 2E1CA 2QBYA 1XN7A 2HDDA 2JA8J 1ZHFA 2GZWA 3HDDA 2P5KA 1YS6A 3HUGB 3KP6A 1R23A 4A3EJ 2M8GX 1AHDP 4ON0A 1C0WA 3DQVC 2E1MC 1IN8A 2RREA 2YS9A 2FQ3A 1LPQA 4IKFA 1XSXA 5AIPA 2E34A 2DW4A 4LLLA 3HOUJ 4I98B 3WHBA 2NVYJ 1RR7A 3CCQI 3ZQCA 4D7MA 1OQYA 1WH5A 3BQZA 2FX0A 4E4HA 4Y7NJ 2LOOA 3OY9A 1DP3A 5DUIA 1RI7A 4UV8A 3CC2I 2IEKA 2LMDA 3DEWA 3KZYA 1YIJI 2HYFA 1YQAA 2Z5UA 3ZXSA 5GTHC 3ABUA 5JI6A 2KIUA 3S1NJ 1Z9CA 1ZREA 3FWEA 2FEZA 5K1YA 3MKWB 1LE8B 3CCLI 2GIZA 3MD2A 3P9CA 1KA8A 3PFIA 1QZYA 3OL4A 2XSDC 2A6HF 3DPLC 4XQFA 4E7LA 2J5OA 1OCCH 3BOQA 1E3HA 3J7ZI 1SC7A 4W1UA 1WKMA 1ULYA 1FJLA 4I99C 1R5ID 3RCOA 2OTJI 2GXGA 2ISYA 5E8GA 5JLXA 2Y9ZA 1XSDA 3BR3A 2DPDA 2EJRA 1QO0D 2GIVA 1W7PA 2QUFA 1A35A 1FBQA 2QWWA 2DT6A 3IWZA 2OQGA 1AKHB 1T8IA 4EGZA 4LOCA 3RKXA 4FTHA 2D45A 1VQ6I 1KU2A 2ZKZA 3FMSA 1YIOA 5CVUA 1VQ7I 4PGHA 1Q1HA 1QGPA 1BM9A 3HC7A 4RA2A 2YR2A 2EFOA 2A05A 3V8KA 3VEPA 1ZQ3P 1R49A 3GBGA 3V8LA 2EIMH 4QIWN 3LMMA 3H9GA 1XSVA 1VQLI 3ZOBA 2GOXB 1A5JA 3DPUA 1D1AA 1JHFA 4MEYF 1J2XA 1OKRA 5IY5H 2L9SA 1X1BA 1OYWA 1REPC 2HS5A 2UV1A 2VKDA 2QQ9A 3HKZN 2RAEA 1L0OC 1ZRFA 1FBSA 1FWZA 3GTOJ 2QKMB 3EUHA 4II3A 1OYYA 2FD5A 4ZZDA 2JUCA 4A3FJ 4CYCA 1MMNA 2NVUB 2BY3A 4A5NA 1RESA 2BEOA 3QU3A 4RAYA 1J9IA 2DYSH 3VYUB 2MD0A 1B59A 4M3FA 2WY8Q 5F1JA 5LD2C 2VT3A 4A3KJ 1V55H 3PIPF 3ROUA 3I5UA 1SD4A 1GXQA 3GFIA 3OYMA 4CYDA 4E6KG 3SEQA 1WZ2A 1R6RA 1B8IA 4A6DA 4I76A 3E0JB 2EK5A 4E70A 1NG7A 4IF4A 5D6FA 2CJJA 5GAEJ 5FLXZ 4WWCA 1MNMC 2VJIA 5FFZA 3ULQB 3JAMZ 1MNDA 2M9HA 1GLNA 3F8MA 4UB8C 4PDKA 3BJ6A 3WE2A 1CGPA 4UXNA 3IRRA 2DA3A 1IZ1A 1QRYA 3ASNH 3PIOF 3V42A 3BG5A 3ZMZA 5A2QK 2XPWA 3MKYB 4U7BA 2JQ7A 3R60A 3MQ0A 3PNTA 5LHIA 1LB2A 2GWRA 1WRJA 3HPHA 4UUSB 3H3UA 1TP4A 2DMPA 4XLEA 2J5PA 1V54H 2P0WA 2X1CA 2QF7A 3R0JA 4B47A 2DYRH 2KPMA 4D7NA 4LGWA 3JRDA 5IYDJ 1FMVA 4M3BA 3BG7A 5EEAA 4KJZA 4RAZA 1TW3A 3LSPA 2AS5F 2VBXA 1Z3XA 4CCKA 3SDGA 3FK7A 3FXKA 2E1NA 3ZQLA 3OYBA 1B72A 3PUBA 4WX9A 2CQQA 1ZRDA 1I27A 5CVRA 1D0YA 1XGNA 3CUQA 2GOMA 2JWTA 4ZDLA 2QSHX 1P2FA 2A6TA 3FXUA 2MSYA 3B6AA 3VB2A 1BIBA 2BBYA 4NQWA 3AL0B 4IRGA 1K4TA 3CMYA 2B63J 3F6OA 4XK4A 1S8NA 4BEHB 3OV8A 4IQ4A 4EATA 3DEUA 3K4JA 1VI0A 1TWHJ 4AVZA 3H5RA 3TO7A 4U88A 1KGSA 4KFCA 4A3GJ 4KT5C 3OYGA 4RB3C 3H1CA 4CCMA 4LK0F 2Y0SN 5J47A 2E36A 2UZKA 1MJAA 3ZP5A 2HQAA 3S1MJ 4EJVA 2HPIA 5CQGA 5M3FJ 5EDNA 1EH8A 5CPRB 4XKCA 2L7FP 4IO9F 4J00A 2GM4A 1TNTA 2F5DA 3P7NA 3JW4A 2FNPA 2JN6A 3FX3A 3BTCA 4KUMA 3H9QA 5FKOA 4Q5SF 2LREA 2Y31A 1X3ZB 3HM5A 2X6YA 4K2EA 5ILUA 1FEXA 3CF2A 4HEA2 4YIIA 4X6AJ 2PBIA 3KYLA 4HSRA 2HVSA 2VJJA 5C4XJ 3IH2A 2HTJA 3RPUA 1E2XA 1XPXA 1DP7P 4L0YB 4OIOF 3CESA 5JHFA 2LKSA 4PJ0C 1WSUA 1JGSA 1UG0A 1ETXA 2QSGX 4HQMA 1IXRC 5HLGA 1O4XA 4XM3A 2DMQA 3BZCA 3F22A 5D5XB 1JJ8C 5F0FA 3D1NI 5DV5A 4OINF 3PUFA 4EJTA 2VQHA 5E1XA 5BS6A 3HOTA 1GVJA 1ZG3A 2KLOA 1T08B 1Z91A 2Z2SB 3C3WA 3L9FA 5D6EA 4A2UA 1F4KA 2CV0A 3E3VA 4UVAA 2R7RA 1RRJA 1H8AC 2HI3A 1CF7A 2L7ZA 3AG4H 1U2WA 1WJBA 2WC2A 1ZELA 3OL3A 1OISA 1FMWA 3W2VA 3HRTA 4CZZA 1Z0XA 4CCNA 4BDYA 2BY0A 5JR3A 5J3LA 1ERDA 2DTZA 1ACIA 2RKHA 2I8DA 2A6EF 3C7JA 4EM1A 1UZCA 1KU3A 3SFZA 3BR1A 1E3OC 2ZNYA 3CO7C 4HNVA 2L9VA 1XMKA 2LNBA 3G1OA 5HOOA 3I4NJ 5IT9Z 2KISA 3ZQIA 2A68F 5B1AH 2CFXA 3PL8A 4P9UA 3HOVJ 1IXSB 2O9LA 2IGOA 5F0HA 3LNQA 1I1SA 2M87A 2L9NA 1RZ4A 3Q0UA 1HXDA 3DKXA 2DO7A 4IL6C 2HVRA 2UWMA 2E1OA 2DT7B 1IO2A 3I59A 4NUBA 3VYTB 1DDNA 4KN4X 2QZ8A 3FXQA 4IJAA 3MFKA 3CP8A 2X1EA 3TBIA 2KP6A 3F8CA 2L9RA 1FSEA 2YU9J 1ETQA 2DFIA 1NTCA 1SMTA 1WQ2A 3NWTA 2VE9A 4MEXF 2IS1A 3F72A 5DD8A 3OYDA 1IV6A 2IS6A 2RVCA 1HW2A 4HNTA 2EINH 3LAPA 1I6HJ 3U1KA 5DD4A 2A61A 2XGDA 3S8PA 2HOSA 4CDGA 2IT0A 3HRSA 3V7SA 1F5TA 5GADJ 2RDPA 2NVXJ 1ZYRF 4E7HA 2JA6J 4EMSA 3IKTA 3L1PA 1U5TC 1R58A 1I50J 3KP2A 3ZN1A 1TTYA 4RGSA 2R7XA 1QHGA 4G6QA 2CUJA 3QPLA 4X1EA 2WTEA 1Y0NA 3M07A 2K02A 1S7EA 3CJNA 2V4JC 1T38A 2G9WA 3DKYA 3BT9A 4L5IA 4CYCB 2XRLA 3V4GA 4I09A 1BI1A 2Y2ZA 2V79A 2XB5A 4EM0B 1MBEA 3G2BA 2ZSIB 1FX7A 1J59A 4BXFA 1Z6TA 2P6TA 3IHUA 3KP5A 1I39A 2HYJA 4JX4A 2XROA 3ZMVA 2EA2A 3DEEA 1IF1A 3CCJI 3ZQ7A 1TWGJ 1Y39A 2F2EA 2JJ7A 1XGMA 1RR8C 3A03A 1FYMA 4RB1A 2XAQA 3HBLA 3O8HA 4BY1J 1Q1VA 2RQPA 3OOUA 1IRFA 2ISZA 1T56A 1HKSA 1BJAA 4A0XA 3EPZA 4JP0A 1LVKA 3TMOA 3U9GA 3L00A 4BACA 3CUQC 5J1UA 1JUPA 1GXPA 5DS9A 2HPMA 4YIRX 1PUFA 2XIGA 2IJLA 1AKHA 1G3YA 3E6DA 3M8JA 1LFBA 1RPWA 4L9TA 3RJPA 3CJTB 3PFYA 3P9IA 2CUEA 2Q0OA 3CDHA 2EPFA 4DBQA 2M7BA 4UUVA 1VFCA 2KRHA 2CW7A 1BI3A 1EA3A 4XKVA 3L2UA 2L5QA 4BJ5C 3FKIJ 3RI4A 2K3FA 3I0TA 3GFLA 2OTLI 3U1DA 4J01A 2DODA 2LY1A 2W48A 3CO6C 2EBIA 2X48A 3FF5A 1YW9A 3GLXA 2Z99A 2ZNZA 2HXOA 3SJMA 1B6AA 4BH9A 3GZ6A 2ZFUA 2JA7J 3Q0WA 4AWXB 2ECBA 2HOAA 4OIQF 1ZG5A 3SDBA 4G7ZF 5E1WA 1CF7B 3BP8A 1VQMI 2QVOA 1OR7A 4BY7J 4PUSA 1ON1A 2FE3A 5CQEA 1K7AA 1WFXA 3ABMH 1RNLA 2DK5A 1K79A 4BUPA 4LIVA 4P5OA 3HRMA 3KYDB 4QWQA 3SYTA 4PGGA 3RPUD 4B1RA 1QNTA 3HRUA 2DA7A 1IJWC 3L2WA 2PEXA 4G94A 1FLIA 4KYWA 3GLLA 2R7TA 2P4WA 5GAGJ 1W4MA 2BVLA 3GW2A 3K4CA 1JKQC 4MFEA 1XGSA 1SD6A 2AQFA 4CXFA 2P5LC 4DJAA 3IC7A 1VQPI 3QWLA 2LLKA 2OPTA 3LSKA 4ZTFA 2W82A 2STTA 2G0EA 2RV8A 3Q5FA 1IG7A 2L4MA 3BCAA 2O7OA 1RIOH 2EB7A 4PFOA 4E7ZA 5M5XJ 2HKXA 3S2WA 5KAFC 5J1YA 3RZOJ 4NDLA 4JYKA 2FBIA 3K1MA 3VPRA 1PUFB 2DMNA 2K9NA 1G3TA 1O3RA 3GTQJ 5GPAA 5HDGA 4BHCA 1NG6A 1JI8A 3PQJA 1OYIA 4F3QA 1GDTA 2A07F 5HDNA 4BE1A 1EH6A 1ENHA 1XGOA 3IWFA 1ZTRA 3EETA 1B1BA 2ZXWH 3EQLF 1ORKA 1YRNA 2CQXA 5EEHA 1ON2A 1ONVA 1R1TA 4BL0B 4RS8A 5FFXA 4NQWB 1RKTA 1HSJA 4OOIA 3I4PA 1W36C 1X4OA 2W84A 2FXAA 1KZHA 2JVHA 5ICFA 3WTSC 2XC7A 1KQ9A 3QPTA 3GZNB 3BQYA 2H8WA 2XHKA 4XONA 3ZGKA 1ZGWA 4FE4A 1IN7A 4ESFA 3H9JA 3CCUI 4AD9A 1BW5A 5ICCA 4DYRA 1WJAA 4KNYA 4ASNA 1U5TA 2X6OA 2BVMA 1K83J 4LG0B 3X2QH 3K70D 2Y75A 4MO7A 4XSZF 1WCMJ 3HSFA 2EZIA 4M9ZA 1SAUA 3F8NA 3K7AJ 3OSFA 3NWSA 2C6YA 1JT0A 4L9JA 3RIRA 3ZMTA 4A0YA 5L3EA 1UELB 1VQOI 2IW5A 3REOA 3TW6A 5E3MA 1T98A 3V8JA 1FP2A 3UR3C 2IA0A 1QBJA 1FOWA 4JOMA 1YJWI 1Z6RA 2QQAA 2P7VB 1MJ9A 5FLMJ 3D5RC 3BJOA 1X3WB 2DOAA 3QYEA 1USTA 4PJNA 4GXOA 2DU9A 3RKYA 3RYRA 1JKRC 4JK1X 2HDCA 3E6CC 3NEUA 3QU6A 2PMZA 4AIJA 2MYSA 4F93B 3VDXA 1DU6A 2ID6A 3FHZA 4IRHA 4AVPA 5C3EJ 3O8GA 3CJQB 5FROA 5K7FA 3ZQHA 3CD6I 4M71A 1S7AA 3OYIA 4MNUA 2ZSHB 2ETHA 1TZLA 5B1BH 3UNGC 3H0GJ 1O7FA 2F5VA 1Y0UA 2GXAA 3JRCA 1JTXA 4FCYA 3W2AA 3F3XA 1P4XA 3LSJA 2IS4A 4PJLA 4LFUA 1BR1A 2RGVA 4HX4A 4A3IJ 2DK8A 3J81K 2JA5J 2WV1A 2DT5A 4M72A 5BMZA 2L2OA 1MH4A 4BQNA 3GTPJ 1OCPA 2Z3YA 2VONA 1SVOA 3QPHA 4M6YA 3Q3SA 4ZYEA 3DU5A 1B9NA 1YG2A 3OYAA 1U3EM 2QSFX 4DGWB 2F6CA 5IT3A 1S7OA 3DTKA 2HOEA 2DFEA 5BOXA 3SZPA 2XF7A 1IDYA 2COMA 1TC3C 4F55A 2UXXA 2VODA 2MLKA 2XUBA 5DCMB 1W7PD 2VIXA 2MGQA 3BR6A 4XLPF 4ZH4F 5GTIC 2DOFA 1P7IA 3NQOA 3QYBA 3KE2A 4UHTA 5EG0B 3E5UA 5HS9A 2JK3A 3FXJA 5EZGA 4UVCA 2W4SA 3T8RA 2PG4A 3CC4I 5CVVA 3CTAA 2JZYA 1R36A 1DU0A 2XVCA 3DCFA 1IGNA 1EF4A 1AU7A 3TO6A 4HG2A 2OZUA 3A01A 4MIMA 4HRIA 6PAXA 1BN5A 1XG1A 2RNJA 4IRIA 1R4NB 2M4KA 1LE8A 1TWCJ 3KP3A 2F48A 1MKMA 1TQPA 4XBFA 4DZJA 5HODA 1AOYA 3VYRB 4HF1A 2ELHA 2G7UA 3H5NA 4MQVA 1Z1DA 2X0LA 3BTLA 4PSXA 4EJWA 2KJBA 3M8FA 4EV0A 4OMZA 2ZXHA 4U0YA 3ERMA 1SD7A 5LEJA 3OSGA 3PSFA 3HGYA 1S5LC 1WH7A 1B9MA 1HSTA 3I71A 4N4NB 5FLXK 1F1ZA 2NXNB 3FZVA 2AO9A 2CO5A 2XRNA 2IP2A 2NNYA 3ZPLA 1GVDA 1X4PA 3SQNA 3C2HA 4U7DA 4PFPA 3WTTC 2IAIA 3DLLF 2E1MB 1U5TB 3CQZJ 3MN2A 4IHWA 3GTLJ 2JSPA 3GTKJ 3M1CA 1HW5A 5FD5A 3E6MA 3TW7A 2R5ZB 5CVIA 2DBBA 4A3MJ 2DA1A 3U21A 1IXCA 4Y17A 1MMDA 1WJFA 1WJDA 2JTVA 4L9NA 1YX5A 4RLQA 2ECCA 2DAOA 3ESWB 3OS0A 1Y1WJ 5F27A 4OIPF 1POGA 1VQ8I 3DBLB 1FY7A 1KQ8A 1TBXA 2FSWA 2E19A 5FKKA 1IRXA 2JSCA 3IUOA 1YLFA 1USSA 3HJEA 4B8XA 1D5VA 2M8EA 3IAS2 3AKZA 2W24A 2WAQA 3E1SA 3TP3A 2FMLA 1IW7F 3LSHA 2Y30A 3FMRA 2EZKA 3S14J 3R61A 4JQFA 1FOXA 4RMNA 3E6BA 2HFHA 3BR2A 4HV5A 3I58A 1CQTA 2VOOA 1OPCA 1ITYA 2HQNA 4XLAA 1TWFJ 1ZK8A 3MMYB 1PDNC 1I1GA 4XN0A 2EA4A 1N75A 4JX6A 3CUOA 4OIRF 5E8IA 5ILSA 4M6VA 4M6XA 4RM3A 2Y0SA 3D5SC 1P92A 4C3HJ 1P6RA 1LEBA 2DI3A 3OWTA 4A3DJ 2LBFB 2K7LA 5F08A 3CCEI 3EUHC 2QGUA 5DCMA 3LOCA 5DM6F 1N77A 1LEAA 2RN7A 2P5VA 5TGTA 4CO8A 1MBJA 5D5VB 3G6EI 3ZRGA 3DFGA 5EG0A 1WJ5A 2JRMA 2L4AA 3BWGA 3WGIA 2FBHA 3B02A 5KVRA 1BBYA 2IGKA 2VB6A 3L2QA 4EVIA 3IH3A 1OLTA 2NS8A 1R7JA 2V9VA 4ENJA 1VQNI 1R5HA 3OYLA 4OMYA 3DV8A 1MD0A 1VF9A
chains in the Genus database with same CATH topology
2EINH 5B1AH 3ABKH 2OCCH 3AG2H 5IY5H 2DYSH 3AG4H 3X2QH 3ASNH 3AG3H 1OCOH 1V55H 1OCZH 2Y69H 3ABLH 1OCCH 2EIJH 3ASOH 3WG7H 2EIMH 1V54H 2DYRH 2EILH 2EIKH 5B1BH 3AG1H 3ABMH 5B3SH 2ZXWH 1OCRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  5B1A H;  3ABK H;  2OCC H;  3AG2 H;  5IY5 H;  2DYS H;  3AG4 H;  3X2Q H;  3ASN H;  3AG3 H;  1OCO H;  1V55 H;  1OCZ H;  2Y69 H;  3ABL H;  1OCC H;  2EIJ H;  3ASO H;  3WG7 H;  2EIM H;  1V54 H;  2DYR H;  2EIL H;  2EIK H;  5B1B H;  3AG1 H;  3ABM H;  5B3S H;  2ZXW H;  1OCR H; 
#chains in the Genus database with same CATH topology
 4ANJ A;  1SAN A;  3GXO A;  4CZC A;  4QPQ A;  3WU2 C;  1OJL A;  1YOV B;  2QQB A;  3QPS A;  3RQI A;  1A04 A;  2OZ6 A;  5F6F A;  5FRN A;  4E7K A;  2P7C B;  4PK4 A;  3IV5 A;  3TQN A;  1EKE A;  1J5Y A;  1HKQ A;  1GUU A;  4B48 A;  2R4G A;  1V4R A;  2F5F A;  2KL4 A;  2V7F A;  4XLH A;  4P55 A;  2HTS A;  3J80 Z;  2LTP A;  1GT0 C;  4UNO A;  2BW3 A;  1FZP B;  3KFW X;  2DFF A;  2ZJ2 A;  4MQ9 F;  2L54 A;  4BE0 A;  1BC8 C;  4HOB A;  1W36 D;  3E7L A;  1FIP A;  4Y3O A;  2M45 A;  3NAU A;  3G1M A;  4UVB A;  3TO9 A;  3A02 A;  3G1L A;  4Y33 A;  2CMP A;  2K40 A;  3HGG A;  5LGN A;  2FOW A;  4H4K C;  3HOS A;  5LHH A;  4WXC A;  1H0M A;  2KIQ A;  1MW7 A;  1TNS A;  4RB0 A;  3DBR B;  1R5G A;  2QQ8 A;  1KYW A;  1FOK A;  3V7R A;  3FK6 A;  2OC6 A;  1JKO C;  4YIF A;  3WG7 H;  5AIQ A;  2OU2 A;  1KU7 A;  3HOZ J;  2H09 A;  4RB2 C;  2ME0 A;  3K0L A;  3Q0V A;  3DBH B;  1OCR H;  1UHS A;  3H92 A;  5LGU A;  1MSF C;  2VC0 A;  2LP0 A;  2CFO A;  2DCE A;  1A6I A;  1XCB A;  3F8B A;  2CWE A;  4G7O F;  1SFK A;  2X85 A;  2IPQ X;  1PJR A;  4WXH A;  2CUZ A;  2DQL A;  3WHC A;  2TDX A;  3S1R J;  1MBH A;  1ZN2 A;  2V26 A;  4S0H B;  3E5X A;  5LRS A;  3MZ8 A;  4XID A;  3CME I;  2D1V A;  1U8B A;  3HEF A;  5GAH J;  4YEJ A;  3S93 A;  1ZR4 A;  4H0E A;  2K4J A;  4I6Z A;  2EQR A;  4PJJ A;  2R3S A;  1YX3 A;  5HLT A;  1YIT I;  1YJN I;  4L18 B;  5E1Z B;  4B43 A;  2BY1 A;  5J8F A;  2R7S A;  2P8T A;  2TCT A;  2L02 A;  1DPR A;  2OA4 A;  1O3T A;  2DMT A;  2O0Y A;  4XOR A;  3CJR B;  3TDU C;  3DF8 A;  5FD6 A;  3QAH A;  3BR0 A;  3CMM A;  3HZJ A;  1RUO A;  1TLH B;  4KMF A;  2O8K A;  3S1Q J;  2WAF A;  1XCV A;  2WA0 A;  2KHM A;  3CCR I;  1L3L A;  1SMY F;  3DWL E;  3M9A A;  4IZZ A;  3ABK H;  3RQ4 A;  5ICE A;  4LLG F;  5K7H A;  4BHP A;  3I59 B;  3O2P E;  3WTV C;  1FSH A;  3T1B A;  2OBP A;  4FIS A;  4EM2 A;  2LYC A;  2LH9 A;  1A31 A;  3B73 A;  5F64 A;  1FBU A;  1NHA A;  2F5C A;  3MAJ A;  4FT8 A;  4XKW A;  1XMA A;  3WGH A;  1IDZ A;  2ZFW A;  1H9T A;  4GYI A;  4EEF G;  2DDB A;  2HZT A;  4J19 A;  2EIJ H;  2XGC A;  5E20 A;  3J81 Z;  2HXI A;  3HHG A;  2FOK A;  2KZV A;  2VUM J;  3JRF A;  4II2 A;  4FX0 A;  1UMQ A;  4BXU A;  4V2G A;  1OR7 C;  5HS7 A;  3VSK A;  2MW8 A;  3J7A Y;  2KRF A;  3LA7 A;  4BYY A;  1IAW A;  4HPQ A;  5HNF A;  1BR4 A;  3BLY A;  2VKE A;  1LFU P;  4YEL A;  2R7V A;  4DOZ A;  4BNC A;  3C1D A;  2KMU A;  3W6K B;  2LKP A;  3C2B A;  1RUN A;  3S17 J;  5KAI C;  4AIK A;  2WY7 Q;  5IOZ A;  4HLX A;  2WWY A;  1D0X A;  2K9L A;  1K61 A;  2H6B A;  1UFM A;  3FM3 A;  3HUG A;  2XB0 X;  2BZT A;  3WTZ A;  1IC8 A;  2VT2 A;  4XL9 A;  4OAZ A;  4L0Z B;  2V1D A;  4HX7 A;  5J6X A;  1UCR A;  2BGC A;  4IHT A;  3OOP A;  4Y15 A;  3T5X A;  4KIB A;  2LBF A;  2R93 J;  1RET A;  4BQO A;  5H6Q A;  1Y1V J;  2QYO A;  3FXL A;  4E7S A;  1MBK A;  1YHQ I;  3DLA A;  1K78 B;  2QCO A;  3JRI A;  1OMI A;  4RLF A;  1VTN C;  3H0D A;  1YO5 C;  5IPA A;  3HHH A;  4BKX A;  2TRT A;  2HQR A;  1XDU A;  5E17 F;  2Z9O A;  2VJ5 A;  2K85 A;  3MWM A;  5BPD A;  3DU6 A;  3MCZ A;  2DA2 A;  2CW0 F;  2L3D A;  1KQ0 A;  2M30 A;  3ML6 A;  3GZ5 A;  3VOE A;  4XN3 A;  4IHS A;  1LKX A;  3K4K A;  4GFB A;  2I10 A;  4MTE A;  1HBX G;  5H20 A;  2R7Z J;  5J40 A;  2HU9 A;  5IOY A;  2Z33 A;  2FMY A;  3SZG A;  2JRT A;  2IXS A;  2W1O A;  1AWC A;  1QA6 A;  3QP5 A;  2VBY A;  4AU7 A;  4BQQ A;  3PQK A;  2R7D A;  1B4A A;  2R0Q C;  5BPI A;  3GEZ A;  4G12 A;  2Y48 A;  3EYI A;  2ZXI A;  4HST A;  4LJZ F;  2BXY A;  4D5C A;  4O3M A;  2JA2 A;  1UHM A;  3DKW A;  2VI6 A;  3CMA I;  3GME A;  2E5Z A;  2BOL A;  2VAS A;  4U87 A;  4LB5 A;  1G8X A;  1LDK B;  2PQ8 A;  2YUS A;  2A5Y B;  4XLN F;  1X2M A;  5IYB J;  4ZZL A;  2V9P A;  2DPU A;  1LFP A;  4HYE A;  3LSR A;  1R1V A;  5L3D A;  4XIC A;  1FYK A;  2LSO A;  3EDP A;  1NK2 P;  2H8R A;  4V2F A;  4BAY A;  2NYX A;  4IHV A;  1KON A;  1FTT A;  3BCB A;  4DYQ A;  5K5Q A;  3LQR A;  2EV5 A;  1B72 B;  1IRZ A;  1MGT A;  2M3A A;  1EJ9 A;  2PFB A;  2M1B A;  3LL7 A;  3U2R A;  4LK1 F;  2VBZ A;  3HYI A;  2KT0 A;  2MLG A;  2OCC H;  5M5W J;  4ZYG A;  3ABT A;  3BY6 A;  3M4O J;  2OCE A;  4XLF A;  1YRN B;  3EYY A;  1D1B A;  5L3C A;  2F4O B;  3RSN A;  4KMU X;  3BPX A;  4F7Z A;  4BJ6 C;  5BQT A;  5K7Z A;  2XDV A;  3JTG A;  2D2W A;  1Z67 A;  3P9K A;  4YFN F;  2ZJR F;  1HDP A;  2WB1 A;  4M3G A;  3OR2 C;  2DXI A;  2LF7 A;  2QLZ A;  3VYS B;  2LC2 A;  4D5F A;  2CGP A;  1D3Y A;  1ETV A;  2IBD A;  1U8R A;  4UB6 C;  5J4V A;  2XF6 A;  2XAH A;  2H1L A;  3BTJ A;  3QYF A;  4ZJZ A;  4M73 A;  4MTD A;  5TJJ A;  3CDI A;  3BDD A;  2CQK A;  3S2D J;  2V1X A;  2L01 A;  3MKL A;  1B8I B;  1U9N A;  2RC4 A;  5EGO B;  1PUE E;  4B44 A;  3LSM A;  1D8J A;  3F21 A;  2VJ4 A;  1H9G A;  2COB A;  1LQ1 A;  3K69 A;  3MVP A;  1J0R A;  2G7H A;  2YU3 A;  2IGN A;  4M3D A;  3SHF A;  1MDM B;  1JKP C;  3HTS B;  1F43 A;  2MD5 A;  1J7K A;  1HC8 A;  1ZRC A;  1ETO A;  2UUZ A;  1BC7 C;  2EIL H;  2RQQ A;  1QQI A;  4F92 B;  1O3S A;  2FNA A;  3DPT A;  2CYY A;  1RKW A;  4A3C J;  4C2M J;  1N78 A;  2NS7 A;  1T33 A;  2E60 A;  4XOP A;  2CUF A;  2IRF G;  5IP9 J;  1H88 C;  1I5Z A;  4XRS A;  3DP7 A;  1ZR2 A;  1FC3 A;  5FB2 A;  2DN0 A;  4IX7 A;  2MG4 A;  1O7L A;  2DMU A;  2H6C A;  3NRV A;  5CKT A;  5FGM A;  4WCG A;  2WAQ N;  2K86 A;  2ME6 A;  4NNJ A;  5LBQ A;  1HQC A;  5ERI A;  3JSO A;  1G3W A;  3SEZ A;  2XF5 A;  1G59 A;  5D4R A;  1JE8 A;  1BI0 A;  3W3C A;  3DTI A;  2B0L A;  3CDL A;  4HLY A;  4P9F A;  1YW8 A;  2BY2 A;  4XOT A;  4UUT A;  5FKM A;  3RDI A;  4CCL A;  1MMS A;  5DM7 F;  4HDU A;  3KCC A;  2LR8 A;  1Y6I A;  1QVT A;  5JVT A;  1YE9 A;  2EWN A;  5F1R A;  2E7X A;  1BA5 A;  4AYB N;  3I54 A;  5D8L B;  3F8F A;  2R92 J;  9ANT A;  1P4W A;  3TOA A;  1RC9 A;  1YTY A;  4NC6 A;  4LG0 A;  4B3X A;  2VQL A;  2V6C A;  4F52 A;  2MFZ A;  2KDZ A;  2HYG D;  5HLH A;  1W0U A;  4YRV A;  1WI9 A;  2VN2 A;  2L7K A;  2P6S A;  2BE5 F;  1F36 A;  2EIK H;  3LA2 A;  1G4D A;  2DQR A;  3K6G A;  4PJM A;  1V5F A;  5D5W B;  1I6X A;  2NNN A;  4HDV A;  4XNF A;  4N9I A;  4KDP A;  3B6C A;  5LRR A;  5EGO A;  1D1C A;  1W5C C;  3R6S A;  5F0C A;  4C3I J;  2VQG A;  1TW2 A;  4HV6 A;  5M3M J;  2B9S A;  3K1P A;  3ASO H;  1XDS A;  5FO5 A;  1KYZ A;  5CYV A;  3OYE A;  4CH7 A;  2GQQ A;  3HXL A;  1Z21 A;  1WWX A;  3W6J B;  5A2Q Z;  2EH3 A;  3ECO A;  3BG3 A;  2R5Y A;  3CZ6 A;  3J80 K;  2ZO4 A;  4HBL A;  3ZQF A;  3AG3 H;  2V9K A;  2X6W A;  3I4M J;  2LRD A;  4KT6 A;  1WJE A;  2OJE D;  5LGT A;  2L0K A;  3H3Z A;  3JRB A;  3BPV A;  3GF2 A;  4AC0 A;  2YPR A;  4GGG A;  2X6X A;  1BOB A;  1FIA A;  3DXJ F;  3HIF A;  2OD5 A;  1EV7 A;  4Z6Y A;  3JRH A;  4NHJ A;  2LD5 A;  2L7M P;  3KPH A;  2GA1 A;  4IVN A;  1UB9 A;  1JTY A;  2NOJ B;  2EFP A;  5F04 A;  4XRS G;  2D5V A;  4A3L J;  3PSI A;  4A3B J;  2STW A;  3M3Y J;  3VWB A;  5EEG A;  4RGU A;  4BXX J;  1MSE C;  3HOW J;  4BU2 A;  3F6V A;  1Z3Y A;  2V1N A;  1OCZ H;  3KET A;  4MLO A;  1YYV A;  3HSR A;  2ADU A;  3MZH A;  1DUX C;  1DQU A;  4L5J A;  4JBA A;  2GLO A;  4DQ2 A;  5C44 J;  4G8X A;  2CSO A;  2ZJP F;  2CV2 A;  3PO2 J;  1FYL A;  4HNU A;  1X19 A;  1X2N A;  4M9X A;  4C3J J;  2CS3 A;  2KDO A;  2MBF A;  2N8G A;  2OV7 A;  3S3O A;  1BOA A;  2XAJ A;  3OIQ A;  5DTD A;  4NC8 A;  5D5U B;  5FRM A;  3BJA A;  3S3N A;  5KK1 A;  4ZYD A;  3E97 A;  5CLS A;  2UXN A;  3AL0 C;  2OQR A;  4IEJ A;  4F91 B;  4E7I A;  2BYV E;  3JR9 A;  4GDF A;  4P1W A;  3WU0 A;  1Z77 A;  3K4L A;  4ESB A;  5IP6 A;  1JHH A;  2DJI A;  2VL8 A;  3ZQQ A;  2F4M B;  2BW3 B;  1OCT C;  3KEQ A;  2PJP A;  2EV0 A;  3GUD A;  4ETS A;  3CCS I;  1JUS A;  3BZK A;  3ZQG A;  4FHT A;  4NC7 A;  3BG9 A;  4A12 A;  2M34 A;  1ZLJ A;  3FKJ A;  2KFD A;  2KQR A;  3PNY A;  1E17 A;  3KEO A;  5HS8 A;  2A3S A;  4C2T A;  2HNH A;  2XAF A;  2CRG A;  3N05 A;  2ZC2 A;  1J75 A;  3TP0 A;  4I02 A;  2XAS A;  1QHH D;  2JMW A;  1DGW Y;  2EFN A;  2P81 A;  2EFQ A;  3K4B A;  4BGD A;  3Q9S A;  3LWF A;  5DDG A;  3BRO A;  4BEH A;  5JVG F;  3BR5 A;  3C18 A;  1BW6 A;  2JUG A;  4BBS J;  1S3J A;  5CJ9 A;  4BE2 A;  1BR2 A;  5HVQ C;  2KJC A;  1DGR M;  3GFJ A;  2XKO A;  4RAF A;  2XKP A;  5E3L A;  4IOA F;  3JAM K;  2HQ5 A;  2CV1 A;  2O3F A;  3KIO A;  4GCV A;  5K5O A;  2QKL B;  3GWZ A;  2YX4 A;  4XKB A;  1E0E A;  3VFZ A;  1IV8 A;  4BBR J;  5HNH A;  4Y13 A;  1PVE A;  1T95 A;  3HKZ A;  3I64 A;  2WV0 A;  4PCQ A;  4CSW A;  2QA4 I;  2BHY A;  4HA8 A;  2CH0 A;  2IVM A;  2M7A A;  3AAF A;  5HDK A;  1D8K A;  5FJ8 J;  1XX5 A;  3CCM I;  1YFH A;  1VND A;  4XR6 A;  1F9N A;  1QZE A;  2W25 A;  3FIS A;  5TRD A;  2R5Y B;  2M2E A;  5E3O A;  1BI2 A;  3H3V K;  3OMY A;  5H6R A;  2W85 A;  4A93 J;  2GAU A;  3W2W A;  2R7O A;  3CP2 A;  1XTA A;  2MC4 A;  2AQE A;  3GTM J;  4LB6 B;  1WJC A;  2MH2 A;  4P96 A;  1LDJ A;  4RBO A;  3HPG A;  1FOY A;  3IP4 B;  2WB1 N;  3IRQ A;  4Q48 A;  3EUA A;  2FA5 A;  3I56 I;  3IH4 A;  2VPR A;  2PMZ N;  1VQ9 I;  4N0B A;  4DW6 A;  3N97 A;  4QPO A;  3I9V 2;  3TDZ C;  2PI0 A;  5H2F C;  2CG4 A;  2R5Z A;  4ENN A;  4OAY A;  3L7W A;  1NH3 A;  2JT1 A;  2KIM A;  4NB5 A;  4HW0 A;  3WTY C;  5FLV A;  1XC5 A;  2ESN A;  2E5N A;  3J7Y J;  4WK8 F;  2ELK A;  4GO1 A;  5D8K B;  5FKN A;  2H1K A;  5KNL A;  3AG2 H;  2CU7 A;  4G6T B;  5JFR A;  3M8E A;  4KIT B;  4QSH A;  4GRI A;  1FTZ A;  2NS0 A;  4MFD A;  4RGR A;  1R00 A;  2O03 A;  2LVS A;  3HOY J;  3ELK A;  3I53 A;  1ZGJ A;  2DA6 A;  2DTR A;  4ZYA A;  1WI3 A;  2YSR A;  3CC7 I;  3OYN A;  3M7G A;  1R1U A;  3ECH A;  2XSJ C;  4EGY A;  1MH3 A;  4GYG A;  4RAG A;  3ZR8 X;  5LFA A;  4U0V A;  1O3Q A;  2BXZ A;  1IN5 A;  2WBM A;  3CUQ B;  2ICW G;  2QEN A;  4FET A;  1IUY A;  1G6N A;  4AIH A;  3MEX A;  2X51 A;  4Q4Z F;  4YG2 F;  3PM1 A;  4ZC3 A;  1Z7U A;  3K10 A;  3K4M A;  1BL0 A;  4IQJ A;  2LDU A;  4ZDP A;  5L3F A;  2H27 A;  1BIA A;  1X1P A;  2DA5 A;  1M1E B;  2VQC A;  4HQE A;  4WXD A;  2Y9Y A;  2LY9 A;  3K2A A;  3OS2 A;  2H94 A;  4L9V A;  1MZB A;  4D9J A;  5EYR A;  1ETW A;  4FAS D;  3LSG A;  2XV4 S;  4D0P A;  1Z05 A;  2KIF A;  5J8C A;  4M9S A;  1H89 C;  5EZH A;  1T2K A;  3WGG A;  3J7A O;  3K2Z A;  4RM2 A;  1IN6 A;  1R4M B;  4L5E A;  3RPQ A;  3JRA A;  2FF4 A;  2IA2 A;  4KIG A;  5FKL A;  2BV6 A;  2XGE A;  3N4M A;  1OCO H;  4AM3 A;  1JXS A;  2VKH A;  3FIW A;  3KZZ A;  3TGN A;  3GTG J;  5DYM A;  1MNE A;  3M1E A;  4A69 C;  2HWV A;  1STZ A;  2GA2 A;  1U6G A;  3L2R A;  3ZMS A;  1I3A A;  2R7Q A;  4W97 A;  3UKG A;  1V5G A;  1SVM A;  3I3L A;  2Q8K A;  1TQM A;  2OAZ A;  4M3E A;  4V19 K;  2R7U A;  1W5T A;  3FHN A;  4Q47 A;  2FU4 A;  3JCU C;  2HKO A;  4PZJ A;  4UV9 A;  2I5U A;  2DJN A;  1T39 A;  2EFW A;  2PJR B;  1V5E A;  3IAM 2;  1LVA A;  1SFX A;  1T0F A;  3WU1 B;  5K5R A;  1MMA A;  3SFI A;  3JSP A;  1GV5 A;  1U0J A;  1ZLK A;  2KZG A;  3HSE A;  3JRG A;  2LKX A;  3A01 B;  2DA4 A;  1N25 A;  3WTW C;  2DLL A;  4CA0 A;  2Z1D A;  4BJT A;  3K70 C;  1FP1 D;  1ZAR A;  2K9M A;  2ZCW A;  1QZZ A;  2HEO A;  3CCY A;  1JT6 A;  2M0C A;  4A0Z A;  3S15 J;  2O61 A;  2EZH A;  3A1Y A;  3ERE D;  2E2H J;  2MH9 A;  1HF0 A;  4B09 A;  2ZBK A;  2E2I J;  1QU3 A;  4KIC A;  1S29 A;  5BNG A;  3AFH A;  4ZYH A;  3G4S I;  3GVA A;  4C9Y A;  5L3B A;  1HLV A;  1MMG A;  2ZME B;  1HOM A;  3OYJ A;  2DFH A;  3SZT A;  3A0B C;  1SFO J;  3LSI A;  1W5S A;  2DDA A;  3OS1 A;  2KRC A;  4B3A A;  2VBW A;  3WOD F;  3PNV A;  4TV7 A;  2CQN A;  5LLQ A;  3HL2 A;  1JGG A;  1MIJ A;  4R8H A;  3E5Q A;  4YFX F;  4LIU A;  2O5R A;  2O8X A;  1ZG1 A;  3T8T A;  3QOP A;  3S16 J;  1LDD A;  4LD5 A;  4LG3 A;  2Y0M A;  1WVR A;  5L3G A;  3BTI A;  3S3M A;  3T0Y A;  3OIO A;  3GYH X;  3FMQ A;  4G7H F;  2GXB A;  4Y4R A;  4S04 A;  4UY8 I;  1J09 A;  1TT0 A;  5B3S H;  4M74 A;  1QVU A;  2NVQ J;  3OR1 C;  2VLA A;  2M5W A;  2K9S A;  4ESJ A;  1YS7 A;  2VXZ A;  4CGZ A;  3FBN B;  3IKV A;  2AXT C;  2K9Q A;  1V3F A;  2FJ1 A;  1S72 I;  5DUK A;  3F0C A;  3HTU A;  2ELJ A;  5JHU A;  5J1R A;  2BHZ A;  1UG2 A;  4RGX A;  3ABL H;  4E7J A;  3QOE A;  1EH7 A;  2LK2 A;  4G6D A;  2E2J J;  5IT9 K;  1XMX A;  2XPV A;  1JUM A;  1YW7 A;  3K1N A;  5ED4 A;  1D0Z A;  4I0B A;  4OWR B;  1A6Q A;  4DZP A;  2KKO A;  2PMU A;  1HW1 A;  3VSL A;  3ONQ A;  1G2H A;  1MJB A;  4KIS A;  4WF2 A;  3BG6 A;  4D1Q A;  3R0A A;  4XRM A;  1P7J A;  4B4C A;  1Z7L A;  3OYF A;  4HF2 A;  4O6J A;  4I2O A;  2PJR A;  1SEU A;  4DBR A;  2CQ7 A;  3ZN0 A;  1VZ0 A;  4EJO A;  3W6V A;  2PN6 A;  3O6B B;  3CLO A;  3MZY A;  2ZME A;  2V1U A;  5B66 C;  4HZF A;  3WG9 A;  1OFC X;  4ZTJ A;  2OF7 A;  3KZI C;  1PYV A;  1X3U A;  3D0S A;  2F4I A;  1APL C;  2ESH A;  4NBQ A;  2ZB9 A;  1UAA A;  2WAE A;  2IS2 A;  3FXR A;  4AUX A;  4JX5 A;  4BDZ A;  2E35 A;  5ILV A;  3IL2 A;  1AA7 A;  4O5V A;  5AON A;  1FPQ A;  3S2H J;  3H5A A;  3RZD J;  2NOG A;  1X1C A;  4CHU A;  1PP8 F;  2V6E A;  4C30 A;  1TQI A;  1FNN A;  3H36 A;  3CF5 F;  4CCO A;  3QQA A;  3PJR A;  1VQ4 I;  2Q1Z B;  3CLQ A;  2JPC A;  4XLC A;  2HGC A;  4ENK A;  3A0H C;  2VC1 A;  2LG4 A;  3ISP A;  1SFE A;  1DPU A;  1HCR A;  4S05 A;  4LIT A;  3NAR A;  5LHG A;  5DCF A;  4X0G A;  5EJC A;  2D1H A;  3KYC B;  2OUM A;  3KX2 A;  3OYC A;  5E3N A;  5E18 F;  3LQQ A;  4IHY A;  3GFM A;  3TOB A;  3GX4 X;  4CUG A;  2JVG A;  3L2C A;  4XRF A;  3TED A;  3JRE A;  1I3Q J;  2A69 F;  4KIF A;  1A36 A;  4CCJ A;  2O6G E;  1X1D A;  4IXA A;  1XB4 A;  4BS9 A;  1FT9 A;  3FDY A;  3FM5 A;  1D5Y A;  4N4O B;  4IHX A;  3K4N A;  2CW8 A;  2FRH A;  2X4H A;  4AYB A;  3BC8 A;  5GPC A;  2QEX I;  1QPM A;  1O57 A;  3K9T A;  1LNW A;  2EV6 A;  4ZDO A;  3HB9 A;  3KLO A;  5LEK A;  2LFB A;  1ZAO A;  3KLN A;  4N9H A;  5J4Y A;  3O3K A;  5GP9 A;  3EUK L;  1HKT A;  2HVQ A;  1MDM A;  5JLW A;  2XAU A;  2VE8 A;  2E71 A;  2Y69 H;  1WHU A;  3QRF F;  1Y8Q B;  4FX4 A;  1P9Q C;  2Q2E A;  4BHB A;  2K3P A;  3G73 A;  1IUF A;  1SD5 A;  1ODD A;  1MBF A;  2HOT A;  1PP7 U;  2GBY A;  3S32 A;  3QOD A;  1K6O A;  5HLI A;  4DYC A;  5TIS C;  2ZME C;  2PMH A;  1IRG A;  1QPI A;  2IGM A;  2EZL A;  5C4J J;  1R9T J;  2XPU A;  3TL4 X;  2PX9 A;  4QTR A;  1Y8R B;  3HOX J;  4ABZ A;  5E79 C;  4EQQ A;  3HG9 A;  1XS9 A;  3GCM A;  3TKY A;  1T0F C;  3OYK A;  4LMY A;  4CIC A;  5EF6 A;  1S9H A;  4IPA A;  3A2K A;  1GV2 A;  2MAB A;  4FE7 A;  1WPK A;  4I01 A;  2E7W A;  3C2G A;  4BQA A;  3I55 I;  1GHC A;  1XD7 A;  1LUJ B;  2PLY A;  4I7H A;  1X58 A;  3WTX C;  1MBG A;  2R7F A;  5IYC J;  4HF0 A;  4I0A A;  4MGR A;  3FBI B;  2NRA C;  2XAG A;  4ITV A;  3F9K A;  3SXY A;  1WGX A;  1TT5 B;  4U0W A;  4DNC A;  2F5E A;  1SAX A;  2ZXJ A;  2FBK A;  5CVJ A;  4G9Y A;  1ETY A;  2HR3 A;  5D4S A;  1UHW A;  2Z16 A;  3L2V A;  3ZMD A;  2NAZ A;  2WAD A;  3D5L A;  2YX7 A;  3KEY A;  1SVL A;  3BZ6 A;  1S6L A;  2JPB A;  1VQ5 I;  3DTE A;  3LAJ A;  3F23 A;  2ID3 A;  3R4K A;  4LLN A;  1Y56 A;  3QP6 A;  1BJZ A;  1W0T A;  1HDD C;  2FUG 2;  2W7N A;  3LFK A;  2HZD A;  2DOE A;  3RYP A;  4Z2Y A;  3G3Z A;  3MKZ A;  1YI2 I;  2IA1 A;  3KP4 A;  3FXO A;  4A3J J;  2ACJ A;  1W1W E;  2LF8 A;  2X9D A;  2RNG A;  3LA3 A;  3COA C;  4C2U A;  5KCM A;  2K4B A;  3V7C A;  4DIQ A;  1R71 A;  4KA4 A;  4YFK F;  2QM3 A;  3LFU A;  2R7W A;  3A4C A;  3L09 A;  1G3S A;  5B5E C;  1T6S A;  2QBY B;  2A5W A;  4A6E A;  1ZH5 A;  4Y52 J;  3H35 A;  4XMY A;  2VOP A;  2K27 A;  4QLC U;  2XGX A;  1NK3 P;  1ZGA A;  2MC3 A;  3P5J A;  3RKQ A;  2AXL A;  3FXM A;  5DEQ A;  1JJ6 C;  1IN4 A;  1E3P A;  1P4A A;  1YJ9 I;  2X1D A;  3WTU C;  3GO5 A;  2HDW A;  4UUS A;  4AID A;  2M0M A;  2K5C A;  1UJ8 A;  3VOD A;  2VKV A;  3ZMU A;  5IP7 J;  2AHQ A;  1R22 A;  1ETK A;  4FQG A;  4PSW A;  3WE3 A;  1KU9 A;  3Q9V A;  4RDU A;  1TL8 A;  4ENM A;  4A5M A;  2B7E A;  4OU0 A;  3JTH A;  3AG1 H;  1VQK I;  3PO3 J;  3ZCO A;  1W7P B;  3OYH A;  2NVT J;  2FQ4 A;  4IOC F;  5ICG A;  1ZKG A;  3KP7 A;  5M5Y J;  4HX8 A;  4KN7 X;  3G71 I;  2LY2 A;  4HAM A;  2W57 A;  2Q2E B;  1X1A A;  1K6Y A;  1HA8 A;  2M4G A;  4XSX F;  3RTR A;  4R79 A;  3GTJ J;  3CCV I;  3RKW A;  1K78 A;  4EJU A;  3OIP A;  1K4S A;  3LST A;  2VPL A;  4MHG A;  2MA3 A;  5KHD A;  1U78 A;  2W00 A;  2VXD A;  1SFU A;  1LJ9 A;  4R1H A;  1TWA J;  1U9O A;  2ZJQ F;  2E1C A;  2QBY A;  1XN7 A;  2HDD A;  2JA8 J;  1ZHF A;  2GZW A;  3HDD A;  2P5K A;  1YS6 A;  3HUG B;  3KP6 A;  1R23 A;  4A3E J;  2M8G X;  1AHD P;  4ON0 A;  1C0W A;  3DQV C;  2E1M C;  1IN8 A;  2RRE A;  2YS9 A;  2FQ3 A;  1LPQ A;  4IKF A;  1XSX A;  5AIP A;  2E34 A;  2DW4 A;  4LLL A;  3HOU J;  4I98 B;  3WHB A;  2NVY J;  1RR7 A;  3CCQ I;  3ZQC A;  4D7M A;  1OQY A;  1WH5 A;  3BQZ A;  2FX0 A;  4E4H A;  4Y7N J;  2LOO A;  3OY9 A;  1DP3 A;  5DUI A;  1RI7 A;  4UV8 A;  3CC2 I;  2IEK A;  2LMD A;  3DEW A;  3KZY A;  1YIJ I;  2HYF A;  1YQA A;  2Z5U A;  3ZXS A;  5GTH C;  3ABU A;  5JI6 A;  2KIU A;  3S1N J;  1Z9C A;  1ZRE A;  3FWE A;  2FEZ A;  5K1Y A;  3MKW B;  1LE8 B;  3CCL I;  2GIZ A;  3MD2 A;  3P9C A;  1KA8 A;  3PFI A;  1QZY A;  3OL4 A;  2XSD C;  2A6H F;  3DPL C;  4XQF A;  4E7L A;  2J5O A;  1OCC H;  3BOQ A;  1E3H A;  3J7Z I;  1SC7 A;  4W1U A;  1WKM A;  1ULY A;  1FJL A;  4I99 C;  1R5I D;  3RCO A;  2OTJ I;  2GXG A;  2ISY A;  5E8G A;  5JLX A;  2Y9Z A;  1XSD A;  3BR3 A;  2DPD A;  2EJR A;  1QO0 D;  2GIV A;  1W7P A;  2QUF A;  1A35 A;  1FBQ A;  2QWW A;  2DT6 A;  3IWZ A;  2OQG A;  1AKH B;  1T8I A;  4EGZ A;  4LOC A;  3RKX A;  4FTH A;  2D45 A;  1VQ6 I;  1KU2 A;  2ZKZ A;  3FMS A;  1YIO A;  5CVU A;  1VQ7 I;  4PGH A;  1Q1H A;  1QGP A;  1BM9 A;  3HC7 A;  4RA2 A;  2YR2 A;  2EFO A;  2A05 A;  3V8K A;  3VEP A;  1ZQ3 P;  1R49 A;  3GBG A;  3V8L A;  2EIM H;  4QIW N;  3LMM A;  3H9G A;  1XSV A;  1VQL I;  3ZOB A;  2GOX B;  1A5J A;  3DPU A;  1D1A A;  1JHF A;  4MEY F;  1J2X A;  1OKR A;  5IY5 H;  2L9S A;  1X1B A;  1OYW A;  1REP C;  2HS5 A;  2UV1 A;  2VKD A;  2QQ9 A;  3HKZ N;  2RAE A;  1L0O C;  1ZRF A;  1FBS A;  1FWZ A;  3GTO J;  2QKM B;  3EUH A;  4II3 A;  1OYY A;  2FD5 A;  4ZZD A;  2JUC A;  4A3F J;  4CYC A;  1MMN A;  2NVU B;  2BY3 A;  4A5N A;  1RES A;  2BEO A;  3QU3 A;  4RAY A;  1J9I A;  2DYS H;  3VYU B;  2MD0 A;  1B59 A;  4M3F A;  2WY8 Q;  5F1J A;  5LD2 C;  2VT3 A;  4A3K J;  1V55 H;  3PIP F;  3ROU A;  3I5U A;  1SD4 A;  1GXQ A;  3GFI A;  3OYM A;  4CYD A;  4E6K G;  3SEQ A;  1WZ2 A;  1R6R A;  1B8I A;  4A6D A;  4I76 A;  3E0J B;  2EK5 A;  4E70 A;  1NG7 A;  4IF4 A;  5D6F A;  2CJJ A;  5GAE J;  5FLX Z;  4WWC A;  1MNM C;  2VJI A;  5FFZ A;  3ULQ B;  3JAM Z;  1MND A;  2M9H A;  1GLN A;  3F8M A;  4UB8 C;  4PDK A;  3BJ6 A;  3WE2 A;  1CGP A;  4UXN A;  3IRR A;  2DA3 A;  1IZ1 A;  1QRY A;  3ASN H;  3PIO F;  3V42 A;  3BG5 A;  3ZMZ A;  5A2Q K;  2XPW A;  3MKY B;  4U7B A;  2JQ7 A;  3R60 A;  3MQ0 A;  3PNT A;  5LHI A;  1LB2 A;  2GWR A;  1WRJ A;  3HPH A;  4UUS B;  3H3U A;  1TP4 A;  2DMP A;  4XLE A;  2J5P A;  1V54 H;  2P0W A;  2X1C A;  2QF7 A;  3R0J A;  4B47 A;  2DYR H;  2KPM A;  4D7N A;  4LGW A;  3JRD A;  5IYD J;  1FMV A;  4M3B A;  3BG7 A;  5EEA A;  4KJZ A;  4RAZ A;  1TW3 A;  3LSP A;  2AS5 F;  2VBX A;  1Z3X A;  4CCK A;  3SDG A;  3FK7 A;  3FXK A;  2E1N A;  3ZQL A;  3OYB A;  1B72 A;  3PUB A;  4WX9 A;  2CQQ A;  1ZRD A;  1I27 A;  5CVR A;  1D0Y A;  1XGN A;  3CUQ A;  2GOM A;  2JWT A;  4ZDL A;  2QSH X;  1P2F A;  2A6T A;  3FXU A;  2MSY A;  3B6A A;  3VB2 A;  1BIB A;  2BBY A;  4NQW A;  3AL0 B;  4IRG A;  1K4T A;  3CMY A;  2B63 J;  3F6O A;  4XK4 A;  1S8N A;  4BEH B;  3OV8 A;  4IQ4 A;  4EAT A;  3DEU A;  3K4J A;  1VI0 A;  1TWH J;  4AVZ A;  3H5R A;  3TO7 A;  4U88 A;  1KGS A;  4KFC A;  4A3G J;  4KT5 C;  3OYG A;  4RB3 C;  3H1C A;  4CCM A;  4LK0 F;  2Y0S N;  5J47 A;  2E36 A;  2UZK A;  1MJA A;  3ZP5 A;  2HQA A;  3S1M J;  4EJV A;  2HPI A;  5CQG A;  5M3F J;  5EDN A;  1EH8 A;  5CPR B;  4XKC A;  2L7F P;  4IO9 F;  4J00 A;  2GM4 A;  1TNT A;  2F5D A;  3P7N A;  3JW4 A;  2FNP A;  2JN6 A;  3FX3 A;  3BTC A;  4KUM A;  3H9Q A;  5FKO A;  4Q5S F;  2LRE A;  2Y31 A;  1X3Z B;  3HM5 A;  2X6Y A;  4K2E A;  5ILU A;  1FEX A;  3CF2 A;  4HEA 2;  4YII A;  4X6A J;  2PBI A;  3KYL A;  4HSR A;  2HVS A;  2VJJ A;  5C4X J;  3IH2 A;  2HTJ A;  3RPU A;  1E2X A;  1XPX A;  1DP7 P;  4L0Y B;  4OIO F;  3CES A;  5JHF A;  2LKS A;  4PJ0 C;  1WSU A;  1JGS A;  1UG0 A;  1ETX A;  2QSG X;  4HQM A;  1IXR C;  5HLG A;  1O4X A;  4XM3 A;  2DMQ A;  3BZC A;  3F22 A;  5D5X B;  1JJ8 C;  5F0F A;  3D1N I;  5DV5 A;  4OIN F;  3PUF A;  4EJT A;  2VQH A;  5E1X A;  5BS6 A;  3HOT A;  1GVJ A;  1ZG3 A;  2KLO A;  1T08 B;  1Z91 A;  2Z2S B;  3C3W A;  3L9F A;  5D6E A;  4A2U A;  1F4K A;  2CV0 A;  3E3V A;  4UVA A;  2R7R A;  1RRJ A;  1H8A C;  2HI3 A;  1CF7 A;  2L7Z A;  3AG4 H;  1U2W A;  1WJB A;  2WC2 A;  1ZEL A;  3OL3 A;  1OIS A;  1FMW A;  3W2V A;  3HRT A;  4CZZ A;  1Z0X A;  4CCN A;  4BDY A;  2BY0 A;  5JR3 A;  5J3L A;  1ERD A;  2DTZ A;  1ACI A;  2RKH A;  2I8D A;  2A6E F;  3C7J A;  4EM1 A;  1UZC A;  1KU3 A;  3SFZ A;  3BR1 A;  1E3O C;  2ZNY A;  3CO7 C;  4HNV A;  2L9V A;  1XMK A;  2LNB A;  3G1O A;  5HOO A;  3I4N J;  5IT9 Z;  2KIS A;  3ZQI A;  2A68 F;  5B1A H;  2CFX A;  3PL8 A;  4P9U A;  3HOV J;  1IXS B;  2O9L A;  2IGO A;  5F0H A;  3LNQ A;  1I1S A;  2M87 A;  2L9N A;  1RZ4 A;  3Q0U A;  1HXD A;  3DKX A;  2DO7 A;  4IL6 C;  2HVR A;  2UWM A;  2E1O A;  2DT7 B;  1IO2 A;  3I59 A;  4NUB A;  3VYT B;  1DDN A;  4KN4 X;  2QZ8 A;  3FXQ A;  4IJA A;  3MFK A;  3CP8 A;  2X1E A;  3TBI A;  2KP6 A;  3F8C A;  2L9R A;  1FSE A;  2YU9 J;  1ETQ A;  2DFI A;  1NTC A;  1SMT A;  1WQ2 A;  3NWT A;  2VE9 A;  4MEX F;  2IS1 A;  3F72 A;  5DD8 A;  3OYD A;  1IV6 A;  2IS6 A;  2RVC A;  1HW2 A;  4HNT A;  2EIN H;  3LAP A;  1I6H J;  3U1K A;  5DD4 A;  2A61 A;  2XGD A;  3S8P A;  2HOS A;  4CDG A;  2IT0 A;  3HRS A;  3V7S A;  1F5T A;  5GAD J;  2RDP A;  2NVX J;  1ZYR F;  4E7H A;  2JA6 J;  4EMS A;  3IKT A;  3L1P A;  1U5T C;  1R58 A;  1I50 J;  3KP2 A;  3ZN1 A;  1TTY A;  4RGS A;  2R7X A;  1QHG A;  4G6Q A;  2CUJ A;  3QPL A;  4X1E A;  2WTE A;  1Y0N A;  3M07 A;  2K02 A;  1S7E A;  3CJN A;  2V4J C;  1T38 A;  2G9W A;  3DKY A;  3BT9 A;  4L5I A;  4CYC B;  2XRL A;  3V4G A;  4I09 A;  1BI1 A;  2Y2Z A;  2V79 A;  2XB5 A;  4EM0 B;  1MBE A;  3G2B A;  2ZSI B;  1FX7 A;  1J59 A;  4BXF A;  1Z6T A;  2P6T A;  3IHU A;  3KP5 A;  1I39 A;  2HYJ A;  4JX4 A;  2XRO A;  3ZMV A;  2EA2 A;  3DEE A;  1IF1 A;  3CCJ I;  3ZQ7 A;  1TWG J;  1Y39 A;  2F2E A;  2JJ7 A;  1XGM A;  1RR8 C;  3A03 A;  1FYM A;  4RB1 A;  2XAQ A;  3HBL A;  3O8H A;  4BY1 J;  1Q1V A;  2RQP A;  3OOU A;  1IRF A;  2ISZ A;  1T56 A;  1HKS A;  1BJA A;  4A0X A;  3EPZ A;  4JP0 A;  1LVK A;  3TMO A;  3U9G A;  3L00 A;  4BAC A;  3CUQ C;  5J1U A;  1JUP A;  1GXP A;  5DS9 A;  2HPM A;  4YIR X;  1PUF A;  2XIG A;  2IJL A;  1AKH A;  1G3Y A;  3E6D A;  3M8J A;  1LFB A;  1RPW A;  4L9T A;  3RJP A;  3CJT B;  3PFY A;  3P9I A;  2CUE A;  2Q0O A;  3CDH A;  2EPF A;  4DBQ A;  2M7B A;  4UUV A;  1VFC A;  2KRH A;  2CW7 A;  1BI3 A;  1EA3 A;  4XKV A;  3L2U A;  2L5Q A;  4BJ5 C;  3FKI J;  3RI4 A;  2K3F A;  3I0T A;  3GFL A;  2OTL I;  3U1D A;  4J01 A;  2DOD A;  2LY1 A;  2W48 A;  3CO6 C;  2EBI A;  2X48 A;  3FF5 A;  1YW9 A;  3GLX A;  2Z99 A;  2ZNZ A;  2HXO A;  3SJM A;  1B6A A;  4BH9 A;  3GZ6 A;  2ZFU A;  2JA7 J;  3Q0W A;  4AWX B;  2ECB A;  2HOA A;  4OIQ F;  1ZG5 A;  3SDB A;  4G7Z F;  5E1W A;  1CF7 B;  3BP8 A;  1VQM I;  2QVO A;  1OR7 A;  4BY7 J;  4PUS A;  1ON1 A;  2FE3 A;  5CQE A;  1K7A A;  1WFX A;  3ABM H;  1RNL A;  2DK5 A;  1K79 A;  4BUP A;  4LIV A;  4P5O A;  3HRM A;  3KYD B;  4QWQ A;  3SYT A;  4PGG A;  3RPU D;  4B1R A;  1QNT A;  3HRU A;  2DA7 A;  1IJW C;  3L2W A;  2PEX A;  4G94 A;  1FLI A;  4KYW A;  3GLL A;  2R7T A;  2P4W A;  5GAG J;  1W4M A;  2BVL A;  3GW2 A;  3K4C A;  1JKQ C;  4MFE A;  1XGS A;  1SD6 A;  2AQF A;  4CXF A;  2P5L C;  4DJA A;  3IC7 A;  1VQP I;  3QWL A;  2LLK A;  2OPT A;  3LSK A;  4ZTF A;  2W82 A;  2STT A;  2G0E A;  2RV8 A;  3Q5F A;  1IG7 A;  2L4M A;  3BCA A;  2O7O A;  1RIO H;  2EB7 A;  4PFO A;  4E7Z A;  5M5X J;  2HKX A;  3S2W A;  5KAF C;  5J1Y A;  3RZO J;  4NDL A;  4JYK A;  2FBI A;  3K1M A;  3VPR A;  1PUF B;  2DMN A;  2K9N A;  1G3T A;  1O3R A;  3GTQ J;  5GPA A;  5HDG A;  4BHC A;  1NG6 A;  1JI8 A;  3PQJ A;  1OYI A;  4F3Q A;  1GDT A;  2A07 F;  5HDN A;  4BE1 A;  1EH6 A;  1ENH A;  1XGO A;  3IWF A;  1ZTR A;  3EET A;  1B1B A;  2ZXW H;  3EQL F;  1ORK A;  1YRN A;  2CQX A;  5EEH A;  1ON2 A;  1ONV A;  1R1T A;  4BL0 B;  4RS8 A;  5FFX A;  4NQW B;  1RKT A;  1HSJ A;  4OOI A;  3I4P A;  1W36 C;  1X4O A;  2W84 A;  2FXA A;  1KZH A;  2JVH A;  5ICF A;  3WTS C;  2XC7 A;  1KQ9 A;  3QPT A;  3GZN B;  3BQY A;  2H8W A;  2XHK A;  4XON A;  3ZGK A;  1ZGW A;  4FE4 A;  1IN7 A;  4ESF A;  3H9J A;  3CCU I;  4AD9 A;  1BW5 A;  5ICC A;  4DYR A;  1WJA A;  4KNY A;  4ASN A;  1U5T A;  2X6O A;  2BVM A;  1K83 J;  4LG0 B;  3X2Q H;  3K70 D;  2Y75 A;  4MO7 A;  4XSZ F;  1WCM J;  3HSF A;  2EZI A;  4M9Z A;  1SAU A;  3F8N A;  3K7A J;  3OSF A;  3NWS A;  2C6Y A;  1JT0 A;  4L9J A;  3RIR A;  3ZMT A;  4A0Y A;  5L3E A;  1UEL B;  1VQO I;  2IW5 A;  3REO A;  3TW6 A;  5E3M A;  1T98 A;  3V8J A;  1FP2 A;  3UR3 C;  2IA0 A;  1QBJ A;  1FOW A;  4JOM A;  1YJW I;  1Z6R A;  2QQA A;  2P7V B;  1MJ9 A;  5FLM J;  3D5R C;  3BJO A;  1X3W B;  2DOA A;  3QYE A;  1UST A;  4PJN A;  4GXO A;  2DU9 A;  3RKY A;  3RYR A;  1JKR C;  4JK1 X;  2HDC A;  3E6C C;  3NEU A;  3QU6 A;  2PMZ A;  4AIJ A;  2MYS A;  4F93 B;  3VDX A;  1DU6 A;  2ID6 A;  3FHZ A;  4IRH A;  4AVP A;  5C3E J;  3O8G A;  3CJQ B;  5FRO A;  5K7F A;  3ZQH A;  3CD6 I;  4M71 A;  1S7A A;  3OYI A;  4MNU A;  2ZSH B;  2ETH A;  1TZL A;  5B1B H;  3UNG C;  3H0G J;  1O7F A;  2F5V A;  1Y0U A;  2GXA A;  3JRC A;  1JTX A;  4FCY A;  3W2A A;  3F3X A;  1P4X A;  3LSJ A;  2IS4 A;  4PJL A;  4LFU A;  1BR1 A;  2RGV A;  4HX4 A;  4A3I J;  2DK8 A;  3J81 K;  2JA5 J;  2WV1 A;  2DT5 A;  4M72 A;  5BMZ A;  2L2O A;  1MH4 A;  4BQN A;  3GTP J;  1OCP A;  2Z3Y A;  2VON A;  1SVO A;  3QPH A;  4M6Y A;  3Q3S A;  4ZYE A;  3DU5 A;  1B9N A;  1YG2 A;  3OYA A;  1U3E M;  2QSF X;  4DGW B;  2F6C A;  5IT3 A;  1S7O A;  3DTK A;  2HOE A;  2DFE A;  5BOX A;  3SZP A;  2XF7 A;  1IDY A;  2COM A;  1TC3 C;  4F55 A;  2UXX A;  2VOD A;  2MLK A;  2XUB A;  5DCM B;  1W7P D;  2VIX A;  2MGQ A;  3BR6 A;  4XLP F;  4ZH4 F;  5GTI C;  2DOF A;  1P7I A;  3NQO A;  3QYB A;  3KE2 A;  4UHT A;  5EG0 B;  3E5U A;  5HS9 A;  2JK3 A;  3FXJ A;  5EZG A;  4UVC A;  2W4S A;  3T8R A;  2PG4 A;  3CC4 I;  5CVV A;  3CTA A;  2JZY A;  1R36 A;  1DU0 A;  2XVC A;  3DCF A;  1IGN A;  1EF4 A;  1AU7 A;  3TO6 A;  4HG2 A;  2OZU A;  3A01 A;  4MIM A;  4HRI A;  6PAX A;  1BN5 A;  1XG1 A;  2RNJ A;  4IRI A;  1R4N B;  2M4K A;  1LE8 A;  1TWC J;  3KP3 A;  2F48 A;  1MKM A;  1TQP A;  4XBF A;  4DZJ A;  5HOD A;  1AOY A;  3VYR B;  4HF1 A;  2ELH A;  2G7U A;  3H5N A;  4MQV A;  1Z1D A;  2X0L A;  3BTL A;  4PSX A;  4EJW A;  2KJB A;  3M8F A;  4EV0 A;  4OMZ A;  2ZXH A;  4U0Y A;  3ERM A;  1SD7 A;  5LEJ A;  3OSG A;  3PSF A;  3HGY A;  1S5L C;  1WH7 A;  1B9M A;  1HST A;  3I71 A;  4N4N B;  5FLX K;  1F1Z A;  2NXN B;  3FZV A;  2AO9 A;  2CO5 A;  2XRN A;  2IP2 A;  2NNY A;  3ZPL A;  1GVD A;  1X4P A;  3SQN A;  3C2H A;  4U7D A;  4PFP A;  3WTT C;  2IAI A;  3DLL F;  2E1M B;  1U5T B;  3CQZ J;  3MN2 A;  4IHW A;  3GTL J;  2JSP A;  3GTK J;  3M1C A;  1HW5 A;  5FD5 A;  3E6M A;  3TW7 A;  2R5Z B;  5CVI A;  2DBB A;  4A3M J;  2DA1 A;  3U21 A;  1IXC A;  4Y17 A;  1MMD A;  1WJF A;  1WJD A;  2JTV A;  4L9N A;  1YX5 A;  4RLQ A;  2ECC A;  2DAO A;  3ESW B;  3OS0 A;  1Y1W J;  5F27 A;  4OIP F;  1POG A;  1VQ8 I;  3DBL B;  1FY7 A;  1KQ8 A;  1TBX A;  2FSW A;  2E19 A;  5FKK A;  1IRX A;  2JSC A;  3IUO A;  1YLF A;  1USS A;  3HJE A;  4B8X A;  1D5V A;  2M8E A;  3IAS 2;  3AKZ A;  2W24 A;  2WAQ A;  3E1S A;  3TP3 A;  2FML A;  1IW7 F;  3LSH A;  2Y30 A;  3FMR A;  2EZK A;  3S14 J;  3R61 A;  4JQF A;  1FOX A;  4RMN A;  3E6B A;  2HFH A;  3BR2 A;  4HV5 A;  3I58 A;  1CQT A;  2VOO A;  1OPC A;  1ITY A;  2HQN A;  4XLA A;  1TWF J;  1ZK8 A;  3MMY B;  1PDN C;  1I1G A;  4XN0 A;  2EA4 A;  1N75 A;  4JX6 A;  3CUO A;  4OIR F;  5E8I A;  5ILS A;  4M6V A;  4M6X A;  4RM3 A;  2Y0S A;  3D5S C;  1P92 A;  4C3H J;  1P6R A;  1LEB A;  2DI3 A;  3OWT A;  4A3D J;  2LBF B;  2K7L A;  5F08 A;  3CCE I;  3EUH C;  2QGU A;  5DCM A;  3LOC A;  5DM6 F;  1N77 A;  1LEA A;  2RN7 A;  2P5V A;  5TGT A;  4CO8 A;  1MBJ A;  5D5V B;  3G6E I;  3ZRG A;  3DFG A;  5EG0 A;  1WJ5 A;  2JRM A;  2L4A A;  3BWG A;  3WGI A;  2FBH A;  3B02 A;  5KVR A;  1BBY A;  2IGK A;  2VB6 A;  3L2Q A;  4EVI A;  3IH3 A;  1OLT A;  2NS8 A;  1R7J A;  2V9V A;  4ENJ A;  1VQN I;  1R5H A;  3OYL A;  4OMY A;  3DV8 A;  1MD0 A;  1VF9 A; 
#chains in the Genus database with same CATH homology
 2EIN H;  5B1A H;  3ABK H;  2OCC H;  3AG2 H;  5IY5 H;  2DYS H;  3AG4 H;  3X2Q H;  3ASN H;  3AG3 H;  1OCO H;  1V55 H;  1OCZ H;  2Y69 H;  3ABL H;  1OCC H;  2EIJ H;  3ASO H;  3WG7 H;  2EIM H;  1V54 H;  2DYR H;  2EIL H;  2EIK H;  5B1B H;  3AG1 H;  3ABM H;  5B3S H;  2ZXW H;  1OCR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...