3M8JA

Crystal structure of e.coli focb at 1.4 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FocB protein
publication title Structure of FocB - a member of a family of transcription factors regulating fimbrial adhesin expression in uropathogenic Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03333 PapB Adhesin biosynthesis transcription regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3m8jA00
3M8JA 2W7NA 5CKTA
chains in the Genus database with same CATH superfamily
2X85A 2VLAA 4S05A 3LWFA 1AOYA 3QPHA 4ZTJA 2DFIA 3M4OJ 1WJEA 3BZKA 4ZDPA 3MVPA 2M0MA 1H8AC 4AVZA 1FSHA 2KHMA 3LFKA 2NRAC 2VQCA 1HOMA 2P7VB 1FP2A 4JQFA 2XSJC 4JYKA 2W85A 2CS3A 5JHFA 1KU7A 4IKFA 2XGDA 3QOPA 3J81Z 1T98A 2IA2A 4BQNA 5CVVA 1EH8A 3J7AY 5L3BA 1E2XA 4XLHA 2NVTJ 2HQNA 1P9QC 1TT5B 1D1BA 3BOQA 2A61A 1ORKA 3IAM2 3ZQHA 3K4MA 5LEKA 2NVXJ 3JSOA 2ELJA 4EJTA 2P6SA 3GYHX 1DDNA 2FQ3A 2L01A 1TWFJ 2ZNZA 3BR3A 4WXCA 2JUGA 2BVLA 4UUTA 3G73A 2L02A 3QU3A 1QQIA 4B3AA 3F21A 3BT9A 2DAOA 2M4KA 3DEEA 1XCBA 3G2BA 1VQOI 2FF4A 4HF0A 4BE0A 3HJEA 3E6CC 2DODA 1YW8A 3OYJA 3G1OA 4A3KJ 1R23A 2QQAA 1U8RA 2OCEA 2GA2A 3EYYA 2XAGA 1POGA 2LDUA 3HSFA 3RCOA 2LBFA 2LF8A 4BYYA 2HU9A 4BACA 4X6AJ 3ESWB 4PDKA 3K4JA 3LOCA 2XAJA 2HYFA 2CYYA 2DJNA 2WC2A 2VOPA 1JKPC 3TQNA 1R5GA 4M9SA 2B7EA 1IRFA 2LK2A 4E7IA 5DD8A 2KFDA 2YX4A 4IQJA 1QRYA 3EUHC 4ZYEA 5L3EA 3OIQA 4HPQA 1P7IA 3CJQB 5KCMA 3WTTC 1I6XA 3W3CA 5AONA 1VQNI 1XGMA 2VKEA 4MFDA 4KUMA 2Q1ZB 3OOPA 3T8RA 1PUEE 4EVIA 2CV2A 3V7CA 1K83J 5LRSA 1MD0A 2R7OA 4LIUA 2DMTA 3ML6A 4A3CJ 1MDMB 3CC2I 1SVLA 2X0LA 3ZMVA 1WH7A 1Y8RB 3T1BA 2WB1A 3KP2A 4BXUA 5HS8A 1ZG5A 3S3MA 4M6XA 4N4NB 3VYUB 3F8NA 2EFWA 2RDPA 4CCJA 4IRGA 3HSRA 3HOYJ 1HCRA 5D8LB 4D0PA 3MFKA 2WAQA 2EWNA 3KIOA 4PFPA 2XASA 1N75A 1UG2A 3F72A 1HSJA 3SFIA 3U2RA 5HNHA 2ZJPF 1FBSA 3JAMK 3DFGA 2CQXA 1G3SA 3IKTA 3CMEI 4L18B 2ZMEC 4ZTFA 1KQ0A 3FHNA 2E7XA 2LP0A 2VN2A 2BBYA 3OL4A 3JREA 4XICA 3E5QA 3DKWA 2JVGA 3ZRGA 3QYFA 1ZG1A 4D7MA 5D4SA 1ZN2A 1HXDA 1S5LC 1ZGWA 3WU0A 4ETSA 5GP9A 1WRJA 4C30A 4WCGA 1GXPA 1TWGJ 2F4MB 3I53A 3DEUA 4XLAA 3KE2A 3WG7H 2E5NA 4U88A 2XKOA 3P5JA 1I3AA 3ZQIA 3K4BA 4FTHA 4P1WA 2FBHA 3BR1A 4FQGA 1EA3A 2LRDA 1WFXA 3ZQ7A 1WSUA 1YE9A 4BS9A 1KU3A 2E2JJ 1SAUA 1S7AA 1VI0A 4K2EA 3VEPA 3TL4X 4XLPF 1O3RA 2D1HA 4KNYA 2R7XA 1BW5A 3CDLA 3OS2A 1ZLKA 5IP7J 1ETXA 1F4KA 4MTDA 1MMAA 3KZYA 5EG0B 5FLXZ 1XDSA 4FT8A 4BU2A 4HRIA 4RM2A 2CQQA 3G1MA 1B4AA 1UHMA 2LYCA 2QVOA 4CYCB 1B8IB 3H5RA 1F9NA 2F5EA 2VQHA 4L0YB 1Z67A 1V4RA 2LFBA 1VQ8I 1MJAA 4OIQF 3JRGA 4UB6C 2F5CA 2X51A 2Y0MA 4DYRA 1ZELA 1TW3A 1E3HA 2MBFA 4WF2A 4DBRA 1FMWA 3HBLA 1OR7A 2RREA 5IP6A 2V9PA 4PCQA 1OMIA 1BI2A 1MGTA 5D8KB 1A6QA 4IZZA 3KZZA 4R8HA 4RDUA 3DTEA 3SZPA 3FBNB 2FBIA 2JN6A 3FM3A 5A2QK 2HS5A 2DI3A 2FEZA 3K6GA 4ITVA 1IV6A 2VASA 2CUJA 3F8BA 2K27A 3P9IA 1R4MB 2IA1A 2E35A 4IXAA 2G9WA 1R5HA 1XX5A 5K5QA 1AKHB 3L2UA 1VQ5I 1W7PB 3VYRB 4LLNA 3KLNA 1Y1VJ 5C3EJ 1XMAA 4QPQA 2Y31A 3JRHA 1IZ1A 3RTRA 1RRJA 3QP6A 2VJJA 4D9JA 1YFHA 1I1GA 3GBGA 3GUDA 4CCKA 4CZZA 4UUSA 2DA1A 2KISA 2TCTA 3B02A 3MKLA 4AVPA 4G6TB 4HLYA 3AG2H 3JW4A 4HDUA 3PO2J 4JX4A 3EPZA 5FJ8J 4JX6A 2ZMEB 3IAS2 4OAYA 1FMVA 2HQAA 2R93J 3L2RA 4PFOA 1FTZA 3Q9VA 2FQ4A 1PJRA 2AXLA 2M7AA 4WXDA 2CMPA 1FSEA 3CCYA 4UVBA 1J0RA 2ICWG 2W1OA 3F22A 5IOYA 5HLTA 2GZWA 1WWXA 5BPDA 2H6CA 4HA8A 3H9GA 1Z6TA 1A04A 2HNHA 2EIKH 2Y0SA 3DQVC 4BQOA 1OISA 2XROA 2M9HA 5F04A 2HQ5A 2VIXA 3IRQA 2ISYA 4J19A 4ZYGA 2MGQA 4LK1F 5CVUA 2GQQA 2GOXB 4MNUA 1H0MA 3FISA 2HXOA 1J59A 2M45A 1MZBA 2QA4I 4BE2A 4M6VA 2PMZN 3E3VA 4B44A 2HQRA 4XM3A 4E4HA 4BH9A 4E7ZA 2AO9A 1XSDA 4WK8F 5EYRA 4KMUX 1OQYA 4NUBA 2W4SA 3OOUA 5IP9J 4G7HF 2CQNA 1J7KA 1LDKB 2BHZA 2DDBA 3BPVA 3U21A 4AIDA 2OJED 5IPAA 1VQPI 3L2CA 2R7DA 3K9TA 5AIPA 3RYPA 3G4SI 3VPRA 2DPUA 4B48A 2RNJA 5E1WA 3TW6A 1QZEA 5ICCA 2A6HF 1ETVA 3T0YA 4NQWB 4Z2YA 1E17A 2EQRA 3F8CA 2E2HJ 1FOWA 2FUG2 5J47A 3PSIA 5D6FA 1PVEA 4MIMA 4IO9F 3I59B 2KIQA 1L0OC 5FKLA 1BC7C 2OQRA 5H6QA 1SD4A 1E0EA 3BR6A 3HXLA 1FYLA 3BDDA 2ZXHA 2C6YA 1FNNA 1YHQI 1CGPA 2XRLA 3BR0A 1X2MA 2JZYA 1I6HJ 1O3TA 2HYGD 2ZCWA 3COAC 2F4IA 1YYVA 2CWEA 2RAEA 1CQTA 2AQFA 1U9OA 2NVYJ 1XGSA 3DTKA 1O7LA 1WJBA 5J1UA 2PJPA 3REOA 4PGGA 1R6RA 3M1CA 3AG1H 5H6RA 1JHFA 4KICA 4CUGA 2UXNA 2EK5A 1B72A 2NOGA 3BTCA 2ZFWA 2OQGA 4IF4A 3HPGA 2QQ9A 5CYVA 4ENNA 2IS6A 4IHTA 2IGMA 1UFMA 1SD6A 4GGGA 2LKXA 4B47A 3RYRA 3K4LA 1OPCA 2QYOA 3GCMA 2A05A 3HSEA 2JMWA 4RLFA 1BJAA 3CC4I 3ZN1A 1W1WE 4BNCA 1TL8A 4PGHA 5HODA 4BL0B 2YU9J 2NS7A 5L3GA 4UV9A 1IG7A 1PP8F 1IN6A 4QPOA 1RUOA 2PN6A 1ZTRA 3HIFA 3FXQA 3IL2A 2A6TA 3I58A 2X1CA 2EA4A 3TOAA 4J01A 2FU4A 3HKZA 1R4NB 2KIUA 4YG2F 2IRFG 1RUNA 5JLXA 4EGZA 1QPIA 3RSNA 1MKMA 3WODF 3ZCOA 3ZOBA 2JA5J 2J5PA 1K6YA 1R00A 3BQYA 3R6SA 2AXTC 3OY9A 5JVTA 2O6GE 1YTYA 5DYMA 1X4OA 3WTVC 2Y2ZA 5KK1A 1C0WA 1A36A 3D0SA 5HLGA 3V8LA 3WHBA 3HYIA 5CLSA 3OL3A 4XRSA 2MC3A 5K7ZA 1RR7A 5EG0A 4I09A 1KU9A 1OYWA 1LPQA 1RPWA 1K79A 4B8XA 3J7AO 5TISC 4XRMA 1TC3C 1XN7A 3BZ6A 4KN4X 3WE2A 2V26A 2DLLA 1HLVA 3HHGA 3A01A 4A2UA 1B8IA 4EJVA 1JT0A 2PLYA 4QTRA 3HZJA 4BEHB 1F36A 5DV5A 4EM0B 2P5LC 5JVGF 3IKVA 4UB8C 5CJ9A 1WHUA 3M9AA 4N0BA 2JA7J 2H6BA 2CO5A 3CCRI 2OPTA 4RGRA 2VQLA 2L5QA 2VPRA 3FK6A 1SFUA 1UJ8A 4GO1A 2O8XA 4U87A 1FEXA 2WAQN 1IW7F 1VZ0A 2P81A 4RLQA 2VPLA 4RS8A 1MBHA 2ZSHB 5FRMA 3TP0A 2QQBA 2HWVA 4LOCA 1YJWI 3V7SA 5ED4A 3S3OA 1H88C 1Z91A 3KZIC 1APLC 4F92B 1E3PA 2KRCA 2ZNYA 5CQEA 2GLOA 3IH2A 2RN7A 1UZCA 4AUXA 3SYTA 3HC7A 1D0YA 1YS7A 2VE9A 3BZCA 4KMFA 1W36C 1AKHA 3KLOA 3M8EA 4AIHA 2K7LA 1XSXA 2MD0A 3TO9A 1BBYA 4A12A 5FRNA 1KQ9A 3WTWC 2NVQJ 1QO0D 3QWLA 3B6AA 2EJRA 3ONQA 1SD5A 3G6EI 3H9QA 3WTXC 1JTXA 3QU6A 1H9GA 1LQ1A 4A3JJ 3CZ6A 4IHSA 4A3DJ 3H92A 2MYSA 3VWBA 4IX7A 2KL4A 4MGRA 1XS9A 2ISZA 5GPAA 3Q0UA 3VYTB 1FP1D 3F6OA 1YG2A 1MBKA 1TNSA 3ECOA 5B5EC 1G3WA 2M4GA 1DGRM 1R7JA 3JRAA 3OSFA 5HNFA 2CUEA 1QPMA 1S3JA 3S1RJ 3C7JA 2LNBA 2ZBKA 3ZGKA 1HQCA 2ZB9A 2M2EA 2XKPA 3I71A 5L3DA 2LKSA 3GZ6A 1D1CA 5F64A 2XGCA 1O3QA 1QBJA 3KEOA 3U9GA 4CYDA 2FMLA 1S72I 4HEA2 4IPAA 5JR3A 3FXRA 5BOXA 4XLNF 3OYFA 1X4PA 1LEBA 1Z05A 4JP0A 2XRNA 5DCFA 4MEYF 1VQKI 2CJJA 1MNEA 5F1RA 1LFBA 2K85A 1WI9A 3H0GJ 3PUFA 2ZJQF 1OJLA 5DCMB 3WTUC 1REPC 2H8RA 4M71A 4DJAA 5FFXA 1W5SA 2HOAA 4P5OA 2DT5A 1ZKGA 2RQPA 3Q0WA 2M30A 4X1EA 3U1DA 2Y30A 4NNJA 2CSOA 2IEKA 2X6XA 4F7ZA 3WU1B 1Z0XA 1MMDA 2VXZA 3WGIA 4KIGA 2DMNA 2NS0A 2LD5A 3HRTA 3H3ZA 5CQGA 5ILUA 2Z1DA 3HM5A 2L4AA 2LKPA 1FIPA 3K1NA 1ULYA 2KZGA 3GFLA 4Y15A 1U78A 3N4MA 2VI6A 3I3LA 4M72A 1AWCA 4NHJA 2M8GX 3ABUA 4RB0A 4FHTA 4Y13A 4NQWA 2OAZA 3TP3A 2UV1A 4UUSB 2EFOA 2Z9OA 1OYYA 2ELHA 3JRDA 3NWTA 3I59A 4HLXA 1YI2I 1ETQA 2UWMA 3TKYA 4D7NA 2KJBA 2XIGA 4XKVA 4IL6C 1NHAA 1BOBA 1QZZA 2GWRA 2N8GA 4HNTA 3JRBA 1V5FA 3V4GA 3HPHA 3AAFA 3CCQI 4GXOA 3BLYA 5GADJ 2NVUB 1L3LA 4D1QA 1ITYA 3IH4A 5K5RA 3W2AA 4F52A 4BHCA 5KAFC 2IS2A 2ETHA 4D5FA 3AL0C 4I0AA 2DT7B 2ECBA 4F93B 5H20A 2K9NA 3I4MJ 2K4BA 1IN4A 1TWCJ 3K4CA 3S2DJ 4U0YA 3WU2C 1IN5A 5J6XA 2DBBA 3H35A 2FXAA 1HBXG 4L0ZB 2L9NA 4N9HA 4U0WA 3SEZA 3MKWB 1XC5A 3ZN0A 1SFOJ 2DDAA 2FRHA 3HB9A 3A0BC 1NG7A 1KGSA 2L3DA 4S04A 3SFZA 2CW0F 3P9CA 3W2WA 4KYWA 5DS9A 5CVIA 1SC7A 3CCVI 2IGNA 3HOUJ 3DU5A 1D0XA 2OTJI 4Q48A 4RAFA 1RKWA 3R61A 4M9ZA 1KZHA 3HOVJ 1IUYA 1IDYA 3E97A 3ELKA 1ETOA 5E3OA 1CF7B 1NH3A 2VJ5A 2YU3A 3P9KA 2QQ8A 4XONA 4IHWA 5M3MJ 2FNAA 3MZYA 2X1DA 1I27A 3D5SC 3BG9A 2PMHA 3HOSA 2Y75A 3ZQCA 1ZR4A 1X3ZB 2WTEA 4B09A 3GTJJ 4KT5C 3CO7C 2R92J 3MWMA 1GHCA 2WV0A 1FBQA 1K6OA 3FMQA 3GTMJ 3S32A 1ZHFA 2GAUA 4GRIA 2ESHA 2GXBA 1K7AA 5FLXK 1P6RA 3ZMTA 4C2UA 2DTZA 2HZTA 2R4GA 4U7BA 2L7KA 4DZJA 1BC8C 1G59A 4XN3A 2Y48A 1WVRA 1XGOA 2D1VA 1ZQ3P 3OYIA 2PJRA 2Y9YA 4BEHA 4GYGA 2IT0A 4C2TA 2LSOA 3IRRA 1JKOC 2DW4A 1B72B 1S7OA 5HOOA 3E5XA 4IHYA 2IJLA 3GTQJ 2BEOA 2JPCA 3F0CA 4A3BJ 5D5VB 2P5VA 2ZO4A 3PFIA 1K78A 4KA4A 1BL0A 1U5TA 2P6TA 1R36A 1FJLA 3JRIA 2LTPA 3HG9A 2R7SA 2VXDA 4LJZF 2R7TA 2F6CA 4M3EA 3T5XA 1Z3XA 3OSGA 1MW7A 1SFEA 1LVAA 1IN7A 1GV2A 2DOFA 3H9JA 3F8FA 4YIIA 5F27A 4WWCA 2VB6A 1YW9A 3AL0B 1JUPA 3RPUD 4QIWN 3BQZA 2JVHA 1TW2A 4CCMA 3KETA 4MEXF 1V54H 1XD7A 3FHZA 4CCLA 1RIOH 5E17F 3BG3A 2ACJA 4LB6B 3RQIA 5EZHA 3G1LA 5IYDJ 1P4WA 4OMZA 2XC7A 2OD5A 2DMPA 3A02A 3SXYA 2EINH 4XRFA 4BY1J 2A3SA 2BYVE 2IVMA 4XK4A 4A6EA 3PIOF 1AHDP 1X1DA 1WPKA 2MC4A 4NC6A 3BTLA 2CW8A 2L2OA 4AIJA 3A03A 1QVTA 1W0UA 2A5YB 1H9TA 2HZDA 2A07F 4MTEA 1QHGA 3A01B 4CZCA 2NS8A 1YJ9I 2R7RA 4I6ZA 4DZPA 4LFUA 4E7JA 4G8XA 3RDIA 2JT1A 3SEQA 1OCZH 1G3TA 4RGXA 5C4JJ 3K70C 5BMZA 1HSTA 3PNYA 4ON0A 4NDLA 3OS0A 3CP2A 3BCAA 3BPXA 3GTPJ 4NBQA 3OYLA 3VFZA 2IGKA 4AU7A 2FNPA 3W2VA 2DA4A 2ZC2A 3I4PA 2XF7A 2QM3A 2V7FA 3QPLA 4LIVA 3I55I 1KYZA 5L3FA 2XUBA 5DM7F 1D0ZA 2DYRH 3CJRB 1XPXA 2MG4A 4R79A 5DCMA 3U1KA 2LF7A 4L9NA 4MQVA 3CCMI 3DV8A 5LEJA 3LSPA 5J8FA 2XGXA 5B3SH 1DGWY 4L5JA 2Z5UA 2YPRA 1XMXA 5F0CA 1A6IA 1QVUA 4ZYDA 3FKJA 4GYIA 3FXMA 5CKTA 3BP8A 4XSZF 3LSRA 4ZYHA 5J1RA 1JHHA 4JX5A 3ZQLA 3TEDA 3K2ZA 1XGNA 1YIJI 1OLTA 2EV6A 2CU7A 3RKXA 1F43A 4RGUA 2DQLA 1HKQA 3IUOA 1LFPA 4WXHA 4IRIA 3FZVA 3OIOA 3DU6A 1VQ9I 2V6CA 5EJCA 2HKOA 1O7FA 4WX9A 2EPFA 1A5JA 4YELA 5LD2C 1G4DA 4B4CA 3DKXA 3RKQA 4E7HA 4GFBA 2OU2A 3LSMA 2LMDA 1FYMA 2LY1A 5H2FC 2GXGA 1VTNC 3KCCA 3C2HA 2FOKA 2LOOA 3HRSA 5D5XB 3R0JA 2NNNA 4HX4A 4EV0A 5EDNA 3MD2A 2K3PA 4V19K 3J80K 2O8KA 3FM5A 3I4NJ 1TLHB 2X1EA 3MEXA 4AM3A 3OYAA 3S1NJ 1LE8A 2F5VA 3IC7A 4I7HA 2V1XA 1USTA 4DIQA 1V5GA 1N25A 2HFHA 5HLHA 3DPUA 4XLFA 2KDOA 5BS6A 3OYKA 1BI3A 2JJ7A 1R71A 1UHSA 2BXZA 3CJNA 3DWLE 1DU0A 1TQIA 1W5CC 1BIAA 2ZSIB 3LA7A 1FIAA 2R7UA 2VC0A 4G7OF 2M87A 4FX4A 2R5YB 3I56I 3FXUA 2M1BA 4A69C 4PZJA 1B59A 5LLQA 1LFUP 5HDNA 4C3HJ 1OFCX 1UAAA 1QNTA 2P8TA 4IHVA 2V9KA 4Y17A 2X4HA 3QOEA 2H94A 2VONA 4HNUA 1EV7A 1RI7A 3I64A 1LJ9A 4LG0B 2O3FA 1TWHJ 4LG3A 1FOXA 3N05A 1WZ2A 4IQ4A 2XHKA 1JJ6C 3CCUI 1MMSA 3QRFF 1JKQC 5F08A 2AHQA 3D5LA 2EH3A 1V55H 2K9QA 4M9XA 1F1ZA 2NAZA 3FXJA 5K1YA 2E1NA 3M07A 5ICEA 1T38A 2VUMJ 3ERMA 1CF7A 3BTJA 1GT0C 1M1EB 5B1BH 3P7NA 5A2QZ 2P5KA 3CCEI 3KYLA 4GDFA 2W57A 3H5NA 4H0EA 5DDGA 2B9SA 3HOZJ 2E19A 1UCRA 1TTYA 3QP5A 3NARA 2Z3YA 5EF6A 1F5TA 2K3FA 1U5TC 3GVAA 3ZMDA 4Y33A 3KPHA 1HW1A 1XG1A 3CJTB 3SHFA 2QKLB 3VOEA 1TQPA 4FCYA 2HDDA 2DK5A 2EILH 3GW2A 3GLLA 4J00A 2MA3A 4XIDA 2D2WA 1D8KA 3BG5A 5J4YA 2R3SA 4KIBA 3V42A 4I0BA 4MLOA 3ROUA 2X6WA 3I5UA 1ODDA 2Z16A 2KDZA 2CFXA 4OMYA 2Q0OA 3ERED 2QSHX 4A5NA 3PO3J 4R1HA 3JCUC 2R7FA 4CCNA 2ADUA 5BQTA 3C1DA 1TQMA 3R4KA 4CO8A 4AWXB 3OYBA 3NEUA 3LMMA 2DA7A 2EV5A 3M1EA 3SDGA 1P92A 4RAZA 2V1NA 1FBUA 4LK0F 1RETA 3KP5A 2D5VA 4HAMA 5HS7A 2O61A 4CHUA 4M6YA 2RV8A 3ISPA 1MMGA 3K2AA 2Y9ZA 3J7ZI 4D5CA 4CDGA 5KNLA 3FXLA 2LLKA 3ASNH 2OV7A 3WHCA 2QCOA 2MABA 1MNMC 1OCPA 3ZQQA 3CTAA 3QAHA 5AIQA 3FBIB 1VFCA 1K61A 1TP4A 6PAXA 2D45A 2HGCA 2JSPA 2CRGA 2RQQA 1ONVA 3L2WA 1IF1A 1Z6RA 4UUVA 1RESA 4DW6A 3OYMA 2B0LA 5LBQA 3S2HJ 2G7UA 3HDDA 3HRUA 1X1PA 1ZG3A 4V2GA 3Q3SA 3CD6I 2DA3A 5DEQA 3HL2A 4DOZA 2GIVA 2JTVA 5L3CA 4HQMA 3HRMA 3LSTA 1ZH5A 3BTIA 4KN7X 1YITI 2HDCA 4HW0A 1FOYA 3OIPA 2QEXI 2VT3A 2WA0A 4F91B 1ZRFA 1ZYRF 4BJTA 3HTSB 5GAEJ 1O57A 3OYGA 2WY7Q 4XNFA 1MH4A 1RZ4A 4II3A 3ASOH 2LY9A 3WGGA 2V1UA 4YFXF 1ZREA 5LHIA 3TDZC 1YRNB 1N78A 3GX4X 1LNWA 2BW3B 1U6GA 2HOTA 5IT9K 3PSFA 1Z3YA 3GF2A 4CICA 1FZPB 4A3FJ 1T0FA 2PJRB 1IRZA 3BC8A 5LRRA 2STWA 3A2KA 4ZZLA 1WJAA 3HEFA 2WV1A 3NWSA 3E7LA 2I5UA 2WB1N 3MKZA 5GPCA 1QZYA 2OA4A 3VSLA 3C2BA 4QLCU 4IVNA 4ZZDA 1PUFB 3BG6A 5EGOA 1Q1HA 5JLWA 1V3FA 4V2FA 4AC0A 2O7OA 1DQUA 1I39A 4I99C 3LSJA 5ILVA 2VODA 3NAUA 1K78B 3HHHA 3AG3H 4BHBA 1FYKA 4A3GJ 3SQNA 2OBPA 1U5TB 2A69F 1UB9A 2VJ4A 5HS9A 1VQMI 3EDPA 4NC7A 1J9IA 3HGGA 2EZLA 2F5FA 5LHGA 1OCRH 3I9V2 2OTLI 4CSWA 4EGYA 1GDTA 3FK7A 1I3QJ 2BY3A 3GZ5A 2L9RA 1D5VA 5E3MA 5DD4A 3HTUA 3S93A 5D5UB 1DU6A 3QQAA 2E71A 1U0JA 2EIJH 4KIFA 1SD7A 4YIRX 3LNQA 3DCFA 3IP4B 2DA2A 1NK2P 2W7NA 2BZTA 2ZXIA 1ON2A 1T6SA 5LGTA 5D4RA 4JOMA 3LQRA 3LQQA 1QU3A 1LB2A 3M8JA 1FWZA 2WBMA 1IRGA 2H09A 3GFMA 4QSHA 5JFRA 2CQKA 4Y4RA 1T33A 4N9IA 2DN0A 4BJ6C 2QKMB 5FO5A 5J1YA 4OINF 3ZQGA 4DBQA 5D5WB 1U8BA 3O2PE 3OMYA 5IT3A 2YSRA 2H8WA 4A3LJ 3BJOA 3I54A 4HYEA 1MIJA 4BKXA 4LLGF 4E7LA 2L7FP 3TGNA 2VBWA 2EFPA 3CDHA 3V8KA 1PDNC 4F55A 5GTHC 3N97A 2WWYA 1IJWC 3K69A 1R1TA 5JI6A 2VC1A 2ID6A 3J81K 4KFCA 1DUXC 4XBFA 2DOEA 3ZQFA 5FLVA 4U7DA 4CCOA 1DPRA 2Z2SB 1W7PD 3RQ4A 3ZP5A 2EZHA 4A0XA 2ZFUA 1BIBA 3CUOA 4EJWA 3CUQA 3H36A 1D3YA 4RBOA 2R5YA 4DGWB 4G12A 3RKWA 3PQKA 5FFZA 2PFBA 3PL8A 3F6VA 3HOXJ 1IGNA 3LAJA 4HX7A 1EF4A 3A1YA 2I10A 3E5UA 1Y1WJ 2K5CA 4BQQA 1S6LA 2EFQA 5KHDA 4LG0A 2ID3A 4B1RA 3MMYB 1JJ8C 2O5RA 5KVRA 1Y0NA 1RKTA 2OCCH 5TJJA 4C2MJ 5B66C 3HUGA 2K9MA 3MN2A 3JRFA 1EH6A 3WGHA 3DBRB 1OCCH 5M3FJ 1VQ6I 2KT0A 4BHPA 3LA3A 3OYHA 3BR2A 4H4KC 4I2OA 1FOKA 2PMZA 2HVRA 2PBIA 4A0YA 4RM3A 3PJRA 4CH7A 2WAFA 2XDVA 5JHUA 5J40A 4UVCA 3S16J 2Q2EA 1T8IA 2QBYB 3PQJA 2VL8A 1X1CA 5EEHA 3F8MA 2V6EA 2IA0A 4M3DA 3K10A 2OZUA 2JPBA 3ZMZA 4M74A 3PIPF 2XAQA 2BY1A 4XKWA 5F6FA 3LSHA 1MMNA 4HV5A 2BV6A 2K9SA 3Q0VA 3RZOJ 1P7JA 5DM6F 2IGOA 5CVRA 2F48A 1R22A 2W25A 5EZGA 1ETWA 3L00A 1LE8B 4FX0A 2V4JC 4MFEA 2HPIA 2KJCA 1K4SA 1J09A 1XTAA 5FD5A 3RKYA 4DQ2A 1MSEC 5E1XA 4C9YA 2DU9A 1BI0A 2R7QA 3ABKH 3DKYA 1X1BA 4Y7NJ 3MZHA 1FX7A 2HVQA 3BY6A 2E7WA 2IW5A 1WCMJ 2QENA 2P7CB 1BR4A 4ZYAA 4EQQA 4P9UA 1Y0UA 2CG4A 2Y0SN 2NOJB 2DMUA 2X48A 3OWTA 3KP6A 2VKHA 2YX7A 2ECCA 3UKGA 3WG9A 1B9NA 3CDIA 2FSWA 3FDYA 3TO7A 5IYBJ 4DYCA 2M7BA 1MH3A 5CPRB 2XF6A 5FROA 1G6NA 3JSPA 4FISA 4ESBA 1FT9A 5J8CA 2EV0A 3K70D 2DA6A 1WQ2A 1T56A 3OYDA 1Z7UA 4IRHA 3EUAA 1Z9CA 5LGNA 2XPVA 3WTSC 4UY8I 4M73A 2CGPA 3GTKJ 3A0HC 3NRVA 1JUSA 4P96A 1T0FC 1FLIA 2E36A 3GTOJ 3LAPA 4PJNA 1JGSA 4HF2A 2PI0A 1J75A 1Y39A 1ERDA 2PMUA 2A6EF 4A6DA 1UMQA 3FXKA 3TO6A 2YR2A 2GOMA 3RPQA 4LGWA 3ULQB 4BQAA 3TMOA 3S17J 2FMYA 4G7ZF 1IXRC 4PJ0C 4G6DA 1GXQA 3CC7I 1TWAJ 5LFAA 2DT6A 5ICGA 1YX3A 2BY2A 2TDXA 3LSIA 4Y52J 1ZGAA 5TGTA 1ETKA 3VB2A 1KU2A 1LKXA 5BNGA 2MFZA 1K4TA 4BBRJ 1SFKA 2FJ1A 4ZDOA 3L9FA 1FY7A 2KMUA 4A0ZA 4IEJA 4RB2C 1KQ8A 4QWQA 1AU7A 2KIMA 1ZARA 2V1DA 1B9MA 5DTDA 4BBSJ 2YS9A 1S29A 4ESFA 2G7HA 2HEOA 4PJJA 1YRNA 5FB2A 1WH5A 3S15J 1LDDA 2BW3A 2O03A 4ESJA 3W6VA 2BE5F 5HDKA 1BOAA 2HOEA 4RAGA 4A5MA 4YIFA 2OF7A 5B1AH 2W24A 3F23A 2AS5F 2L54A 2ZXJA 4E70A 4AYBA 2ME0A 3J7YJ 3GZNB 2V79A 1DP7P 1VF9A 1Z21A 3KX2A 1ZK8A 2KRFA 1PUFA 1Z7LA 2K40A 1NG6A 3K4KA 1YLFA 2PG4A 2W00A 3CF2A 3TDUC 4ASNA 2BGCA 2HDWA 3JR9A 3RPUA 1D8JA 1J2XA 4A3EJ 4HQEA 1HDPA 3DEWA 1QA6A 2BVMA 3DPTA 2XF5A 2ZXWH 2DQRA 4Z6YA 4LB5A 2F4OB 3FXOA 2E5ZA 3D5RC 3GTLJ 1D1AA 1JTYA 4BGDA 4ZC3A 3WTYC 3GEZA 3X2QH 4A3MJ 2L0KA 2E60A 2Y69H 4HSRA 5ICFA 2XAFA 3C2GA 4I02A 1TZLA 3IWZA 2XB0X 2LH9A 3BWGA 2IAIA 2K02A 5FKMA 4M3GA 2KRHA 3MZ8A 4XR6A 3TW7A 1IRXA 2VKVA 1VQ7I 1X58A 4PJMA 3HKZN 1G8XA 3CUQC 3QPTA 2ZJRF 1GUUA 2LR8A 2BY0A 5J4VA 3W6JB 4XLEA 5K5OA 5LGUA 1RNLA 3GMEA 1GV5A 1I5ZA 3K7AJ 1W0TA 1SEUA 2QGUA 1Y6IA 1MBEA 4IOCF 3R60A 2V9VA 1SMYF 2YUSA 4O6JA 5DUKA 4UVAA 4MHGA 4M3BA 3R0AA 2CV0A 1KYWA 2XAUA 5GAHJ 1PP7U 3L7WA 1ACIA 1NK3P 1GLNA 2M3AA 3CLOA 1XCVA 2B63J 2UZKA 1ETYA 3HOWJ 1O3SA 1WJCA 2ESNA 3HOTA 4RB1A 2VJIA 4Q47A 5J3LA 3ECHA 2MLKA 1P4AA 1OCOH 3UNGC 1R1VA 2HTJA 3ABLH 3CF5F 4EEFG 4L9JA 1LEAA 4X0GA 1Z1DA 2VKDA 1ZRCA 3WTZA 5EGOB 1ZRDA 3EQLF 4BE1A 5M5XJ 2HI3A 2KZVA 4NC8A 3AKZA 3L2VA 3E6DA 1SVMA 2ZKZA 1UHWA 4KT6A 1N77A 4Q5SF 3C3WA 1S8NA 1MNDA 4C3JJ 2KKOA 4JK1X 3MCZA 1WJFA 2CW7A 4O3MA 2WAEA 5KAIC 3K1MA 3QPSA 3S14J 1PYVA 1Z77A 5HDGA 4JBAA 3V8JA 2DK8A 5FKOA 3F3XA 2TRTA 4EM2A 3GXOA 2CV1A 2DFFA 1JXSA 4HNVA 3RIRA 3JAMZ 3H1CA 1RR8C 3MKYB 2FOWA 1IN8A 4ZH4F 4HDVA 1EH7A 1LUJB 2FBKA 2R7WA 2DXIA 4I98B 2QSGX 2P4WA 4L9TA 2HVSA 2FE3A 5E3NA 5E18F 4BJ5C 1ZR2A 2GM4A 1T39A 1NTCA 2IXSA 2DJIA 2H1LA 1JKRC 3KYCB 3FMSA 4PUSA 2DFEA 5ERIA 2QBYA 2BOLA 1T2KA 1IUFA 2BHYA 2AQEA 2GIZA 2LC2A 3Q9SA 4RA2A 1IV8A 1R5ID 2X6YA 2QSFX 5ILSA 4KITB 3L1PA 3BR5A 4OAZA 4FE7A 1WJ5A 2OZ6A 4L5EA 3S2WA 3CO6C 4FETA 1T08B 3PNTA 5C44J 3AG4H 1MSFC 5E3LA 1IO2A 2DFHA 4MO7A 3GWZA 4BY7J 2HYJA 3BG7A 2R7VA 2CUFA 1YW7A 1B6AA 1BR2A 1QGPA 3C18A 4BDZA 3EYIA 1WI3A 5E1ZB 3CCSI 2W84A 4ABZA 2JWTA 3SZTA 3DLAA 1BM9A 2XV4S 3BJAA 4YFKF 4Y3OA 1YO5C 3WE3A 1HDDC 3DP7A 2JSCA 3Q5FA 4XKBA 3JTHA 4HBLA 4W97A 4S0HB 1ZGJA 4HSTA 1X2NA 4P55A 1XSVA 3CUQB 3CCLI 1HW5A 4XSXF 2PQ8A 1SFXA 3M3YJ 1OYIA 4XORA 1X1AA 3E0JB 5HLIA 1XB4A 2LVSA 2W48A 4KISA 3O3KA 3KEYA 3O8GA 4II2A 3TBIA 1W5TA 3QODA 2EBIA 2JA8J 1FC3A 5CVJA 3HUGB 3L2QA 3FKIJ 1MJ9A 3GFIA 3VSKA 4LMYA 1SAXA 2IBDA 4BXFA 2HTSA 4RAYA 2WY8Q 3T8TA 1S7EA 2JA6J 4N4OB 3RJPA 2RC4A 5K7FA 2Q2EB 2M5WA 3GFJA 2L7ZA 1U3EM 3HGYA 1W36D 1JI8A 2NYXA 2IPQX 3OYEA 4G94A 4ZJZA 3VODA 2R7ZJ 2E2IJ 2RKHA 3IV5A 2FX0A 1VQLI 2EA2A 2EZKA 1GVJA 3I0TA 3K4NA 2STTA 2EB7A 3KP3A 3VYSB 4HOBA 1Q1VA 2DTRA 2A5WA 3FWEA 1I50J 1P4XA 3SDBA 2Z33A 2R0QC 1UELB 1YX5A 3CMAI 2VE8A 3S1QJ 3A4CA 3CLQA 1R1UA 3FIWA 2R5ZB 1R49A 1FTTA 3BCBA 2BXYA 4YEJA 2XB5A 3S8PA 5F0FA 1A31A 2UUZA 4EJOA 5GTIC 1Y8QB 2QLZA 3J80Z 2XSDC 1LVKA 1MJBA 3FF5A 2IS4A 4A93J 4UNOA 2VBYA 4L5IA 4ENJA 2QF7A 2H1KA 1DPUA 1MDMA 3ZR8X 3ZMSA 2COBA 4W1UA 3M7GA 1JE8A 3CP8A 4FE4A 2X9DA 4IJAA 2RNGA 1HF0A 2CFOA 3UR3C 2A68F 4EM1A 4OIOF 5FD6A 2MH2A 2M8EA 2G0EA 5FGMA 3G3ZA 1A35A 2JRMA 2GA1A 2L4MA 4BUPA 3H3UA 3GTGJ 2CH0A 3FMRA 2QWWA 2L9SA 2JK3A 2F2EA 3AFHA 1GVDA 4B43A 3QYEA 3JTGA 1T95A 5GAGJ 5E79C 3F9KA 2XGEA 4IHXA 1STZA 2DOAA 3PUBA 2HXIA 2PX9A 1VQ4I 1G2HA 5FKNA 3BJ6A 2XPWA 2VQGA 3KP7A 2MH9A 1TT0A 3LA2A 4HX8A 2COMA 4E7KA 5M5YJ 1BJZA 2CUZA 2LBFB 1R9TJ 4RGSA 1SMTA 3H0DA 1J5YA 3DXJF 1WJDA 1XDUA 2RVCA 1YIOA 2EFNA 3DBLB 5IYCJ 4IOAF 4UV8A 9ANTA 1OR7C 4PSWA 2LY2A 5K7HA 3LSKA 3RI4A 2VBZA 1U2WA 3OYCA 2FD5A 1TNTA 2E1MC 4XKCA 3ZPLA 1EKEA 4ZDLA 1E3OC 1OCTC 1U9NA 1HKSA 2Q8KA 4HG2A 3ZXSA 2I8DA 3E6MA 1ZLJA 3G71I 4AYBN 4LD5A 3JRCA 2K9LA 4XN0A 3W6KB 4G6QA 2E34A 1SVOA 4ENKA 4MQ9F 5DUIA 1X19A 4EMSA 4F3QA 5EEGA 1HW2A 3DF8A 2MSYA 1BA5A 4EJUA 2K4JA 4HV6A 4AD9A 4BAYA 1USSA 4CYCA 2HPMA 2Z99A 4BXXJ 5FKKA 1KONA 2KQRA 3QYBA 4XOTA 4XRSG 2O9LA 4XMYA 4L9VA 1FPQA 3DLLF 3OR1C 2X6OA 1X3UA 2OUMA 1Y56A 2ELKA 4LITA 4E7SA 4PJLA 4RMNA 2DPDA 4P9FA 4C3IJ 2EIMH 2IP2A 1B1BA 1D5YA 4FASD 5IOZA 1O4XA 3ABMH 2FA5A 1JT6A 4DYQA 4G9YA 4UHTA 3S1MJ 3CQZJ 3ABTA 3EUKL 3EUHA 3MAJA 4HZFA 3GO5A 4M3FA 2NNYA 5EEAA 1LDJA 4KDPA 1TBXA 3DPLC 2LREA 1JUMA 3IH3A 2JRTA 3KYDB 3DBHB 3CCJI 5F0HA 4OIRF 5HVQC 2HR3A 2HOSA 1ON1A 2MD5A 4OOIA 2RGVA 2KP6A 2KIFA 2KLOA 3KP4A 1YS6A 2QUFA 2MW8A 1W7PA 2GXAA 3OR2C 1QHHD 1S9HA 1IXCA 4XL9A 4CA0A 4OU0A 2O0YA 2XPUA 3OS1A 3K1PA 2KPMA 2L7MP 2XAHA 2J5OA 3E1SA 5FLMJ 4O5VA 4UXNA 3VDXA 4ANJA 3NQOA 3GLXA 3PM1A 3KEQA 2MLGA 2VBXA 5D6EA 3MQ0A 5C4XJ 4TV7A 3B73A 5E8IA 3E6BA 1R58A 3O8HA 3IWFA 4CGZA 2DMQA 2W82A 3K0LA 4B3XA 4Q4ZF 2ME6A 1V5EA 2F5DA 1KA8A 1IDZA 1HA8A 2ZMEA 4BDYA 1XMKA 1MBGA 3L09A 2DCEA 2DO7A 3PNVA 5IT9Z 5F1JA 1IXSB 4EATA 4KJZA 4XQFA 2XVCA 3OV8A 1BW6A 2VOOA 3O6BB 5BPIA 4XOPA 1YQAA 1BR1A 3CMMA 1BN5A 1MBFA 1BI1A 3FX3A 1IAWA 2WADA 1OKRA 5IY5H 2K86A 3S3NA 1WKMA 3D1NI 5TRDA 4PSXA 1HC8A 5LHHA 2GBYA 4XLCA 2L9VA 3LFUA 1P2FA 3BROA 1X3WB 4I76A 2M0CA 5E8GA 3H3VK 2E1MB 1YJNI 4NB5A 3PFYA 3M8FA 2QZ8A 2LG4A 2E1CA 3LL7A 3CMYA 1MBJA 5M5WJ 1SANA 4U0VA 3OYNA 2UXXA 4I01A 2P0WA 3KFWX 2DA5A 2PEXA 3ZMUA 4AIKA 2JA2A 1EJ9A 2E1OA 4OIPF 3V7RA 5E20A 1ENHA 2JQ7A 4A3IJ 2CQ7A 2ZJ2A 4E6KG 4ENMA 4DNCA 2NXNB 2OC6A 2VT2A 4GCVA 4LLLA 3RZDJ 1WGXA 3EETA 1AA7A 1JGGA 1DP3A 2DYSH 4CXFA 1VNDA 3TOBA 4OWRB 3H5AA 1YOVB 3IHUA 2JUCA 1G3YA 3CESA 2HKXA 4HF1A 2EZIA 1UG0A 2H27A 4YFNF 1RC9A 1H89C 1ZAOA 3B6CA 1HKTA 3SZGA 1W4MA 3LSGA 1I1SA 2R5ZA 4YRVA 2M34A 4RB3C 3DTIA 3SJMA 1IC8A 2IS1A 4PK4A
chains in the Genus database with same CATH topology
2X85A 2VLAA 4U87A 1VZ0A 4ZTJA 4RLQA 2CV0A 2VPLA 2XAUA 1WJEA 4ZDPA 2ZSHB 1GLNA 5FRMA 2M0MA 4AVZA 2M3AA 2KHMA 3KYLA 3S3OA 2VQCA 3H5NA 1WJCA 3HOTA 4F92B 4JQFA 2XSJC 2KRCA 2CS3A 2VJIA 5JHFA 4IKFA 5CQEA 3UNGC 4BQNA 3J7AY 4Y33A 4XLHA 4X0GA 1P9QC 1D1BA 2VKDA 3HC7A 1D0YA 3SYTA 2QKLB 3IAM2 1W36C 3K4MA 2ELJA 4BE1A 4J00A 2KZVA 4NC8A 3AKZA 3L2VA 2MD0A 5FRNA 3V42A 4MLOA 2JUGA 2BVLA 2X6WA 4KT6A 2Z16A 3ONQA 1N77A 1MNDA 2M4KA 3H9QA 3DEEA 3G2BA 1WJFA 2CW7A 4BE0A 2WAEA 4CCNA 3CZ6A 3OYJA 1PYVA 2MYSA 3OYBA 3VWBA 3LMMA 2CV1A 4IX7A 2KL4A 3VYTB 2V1NA 3MKYB 3RCOA 2LBFA 2HU9A 2M4GA 1DGRM 4BACA 5HNFA 3K4JA 2R7WA 2DXIA 2HVSA 1MMGA 3ZGKA 4BJ5C 5KNLA 4E7IA 2IXSA 4IQJA 2DJIA 3EUHC 4PUSA 2OV7A 1D1CA 3OIQA 4HPQA 3CJQB 5KCMA 2MABA 3W3CA 3ZQQA 2BOLA 3FBIB 2AQEA 2LC2A 4HEA2 2JSPA 2X6YA 2RQQA 4KITB 3L2WA 4OAZA 1WJ5A 3OYMA 2Q1ZB 3OYFA 1X4PA 4FETA 2CV2A 3PNTA 2R7OA 1MNEA 4LIUA 3HL2A 3BG7A 4DOZA 2R7VA 4DJAA 1BR2A 4P5OA 2WB1A 4BDZA 3S3MA 4N4NB 3VYUB 4CCJA 4NNJA 3DLAA 3OIPA 2X6XA 2WA0A 4Y3OA 1MMDA 4F91B 2VXZA 2WAQA 4XKBA 4PFPA 4BJTA 4HSTA 1N75A 5CQGA 3OYGA 2WY7Q 5HNHA 2Z1DA 4XNFA 4II3A 4XORA 1X1AA 3E0JB 3I3LA 1N78A 2BW3B 4ZTFA 3PSFA 3FHNA 1Z3YA 4KISA 3KEYA 2UV1A 2PJRB 4II2A 3TBIA 3BC8A 3OL4A 3A2KA 3QODA 1WJAA 2JVGA 3NWTA 3ZRGA 3NWSA 3MKZA 3HUGB 3QYFA 2UWMA 3L2QA 3VSLA 4XKVA 1BOBA 4HNTA 3VSKA 3BG6A 1V5FA 3HPHA 4C30A 4BXFA 1DQUA 3BLYA 4XLAA 4D1QA 2WY8Q 2E5NA 3W2AA 4N4OB 3K4BA 4F52A 4P1WA 2Q2EB 2IS2A 2VJ4A 1EA3A 2LRDA 1WFXA 4NC7A 3AL0C 1YE9A 4BS9A 2DT7B 4F93B 1SAUA 3I9V2 1W36D 1JI8A 3TL4X 4CSWA 2R7XA 3OYEA 3OS2A 4ZJZA 3K4CA 1MMAA 3S93A 3H35A 1U0JA 4BU2A 3K4NA 3IP4B 4HRIA 2L9NA 4RM2A 3VYSB 3SEZA 3MKWB 2ZXIA 2W7NA 2A5WA 2LYCA 4JOMA 1NG7A 3H5RA 1QU3A 3SDBA 2VQHA 3W2WA 3M8JA 1UELB 1YX5A 2IGNA 2WBMA 3A4CA 3DU5A 1D0XA 4Y4RA 2X51A 3BCBA 4YEJA 1ZELA 4BJ6C 2QKMB 3S8PA 2UUZA 4DBRA 1FMWA 4DBQA 2RREA 3OMYA 2VJ5A 1LVKA 2IS4A 4IZZA 4XONA 3DTEA 3FBNB 2X1DA 4E7LA 3D5SC 3ZR8X 3HOSA 3K6GA 4ITVA 3CP8A 4F55A 2VASA 2CUJA 2RNGA 2CFOA 3UR3C 3L2UA 4CCOA 2Z2SB 3VYRB 4BUPA 3S32A 4QPQA 3RQ4A 4GRIA 2ZFUA 2CH0A 2L9SA 4C2UA 3RTRA 3AFHA 4DGWB 4B43A 2R4GA 3QYEA 4U7BA 1T95A 2L7KA 3F9KA 2VJJA 1G59A 3PL8A 4XN3A 4D9JA 3GBGA 4CCKA 3A1YA 2DOAA 3OYIA 3PUBA 2K5CA 2PJRA 4BQQA 5KHDA 4G6TB 4BEHA 3MMYB 2O5RA 4C2TA 2VQGA 1TT0A 2K9MA 3EPZA 4E7KA 2CUZA 4OAYA 3IAS2 2LBFB 5HOOA 1FMVA 2HQAA 3OYHA 3L2RA 3H0DA 4H4KC 4PFOA 1WJDA 2HVRA 2PMZA 1PJRA 2M7AA 4RM3A 1OR7C 4PSWA 2LY2A 3PJRA 2CMPA 4CH7A 2WAFA 3LSKA 2XDVA 2W1OA 3OYCA 5HLTA 2R7SA 3HG9A 2E1MC 4XKCA 2VL8A 1X1CA 3H9GA 2VXDA 2V6EA 4ZDLA 2R7TA 2F6CA 1Z3XA 2HNHA 2Y0SA 3DQVC 3K10A 4HG2A 4BQOA 3ZXSA 2I8DA 1MW7A 2VIXA 2K9LA 4XN0A 4XKWA 3LSHA 1MMNA 3H9JA 2GOXB 2VB6A 1X19A 3AL0B 4F3QA 2IGOA 3RPUD 2JVHA 4CCMA 4BE2A 2HPMA 2V4JC 4B44A 2HPIA 4CCLA 4XM3A 1J09A 4E4HA 4E7ZA 1KONA 2KQRA 3QYBA 4XOTA 4NUBA 2R7QA 4C9YA 3DKYA 4XMYA 1X1BA 2W4SA 3OOUA 3OR1C 1LDKB 2HVQA 2OUMA 1Y56A 3U21A 4LITA 4E7SA 4PJLA 4RMNA 2XC7A 1BR4A 4ZYAA 4B48A 2NOJB 4FASD 1X1DA 2MC4A 3OWTA 2VKHA 2CW8A 2L2OA 3FDYA 4NQWB 2HZDA 2M7BA 3EUKL 5CPRB 2XF6A 5FROA 1QHGA 4CZCA 3K70D 2FUG2 3PSIA 3OYDA 2R7RA 3DPLC 3EUAA 2LREA 4E7JA 5HVQC 1E0EA 3SEQA 3K70C 3HXLA 1T0FC 2ZXHA 3PNYA 2KP6A 3OS0A 2KLOA 3CP2A 3BCAA 4PJNA 3OYLA 2IGKA 4AU7A 3W2VA 3OR2C 1QHHD 1S9HA 4XL9A 4CA0A 2XF7A 4LIVA 2V7FA 1ERDA 3OS1A 2KPMA 2GOMA 1D0ZA 3E1SA 2F4IA 3TMOA 3CJRB 3VDXA 4R79A 2AQFA 4ANJA 5LFAA 2DT6A 1YX3A 3LSIA 3DTKA 5TGTA 1WJBA 1R6RA 3M1CA 1LKXA 1DGWY 4CUGA 2MFZA 2W82A 1SFKA 4B3XA 4ZDOA 1V5EA 3FKJA 2KMUA 5CKTA 1HA8A 4BDYA 3HPGA 2DCEA 3PNVA 2IS6A 2IGMA 1OLTA 4EATA 4KJZA 4XQFA 4PJJA 4B47A 3IUOA 1LFPA 3K4LA 2BW3A 3DU6A 4XOPA 1BR1A 3CMMA 4RLFA 4YELA 5LD2C 2WADA 4AYBA 3DKXA 4E7HA 3S3NA 3LSMA 4PSXA 1Z21A 2LY1A 4XLCA 4BL0B 3LFUA 3KX2A 4QPOA 4J01A 3C2HA 2A6TA 2LOOA 1Z7LA 2X1CA 1NG6A 3K4KA 3HKZA 2E1MB 3MD2A 2K3PA 2W00A 3CF2A 3PFYA 2HDWA 2LG4A 3LL7A 3RSNA 2X1EA 3OYNA 2BVMA 3DPTA 3OYAA 2XF5A 2F5VA 3ZCOA 2P0WA 2E5ZA 3D5RC 4DIQA 1K6YA 1V5GA 1D1AA 3DPUA 4XLFA 2KDOA 3OYKA 3OY9A 2JA2A 4BGDA 1X4OA 4ZC3A 3DWLE 2ZSIB 2R7UA 2E60A 4HSRA 4E6KG 3C2GA 3OL3A 2OC6A 1TZLA 2LH9A 1AA7A 1DP3A 2KRHA 4XR6A 4OWRB 3H5AA 1UAAA 1IRXA 2V9KA 4PJMA 3CESA 1G8XA 2V26A 3QOEA 1UG0A 4BEHB 4HNUA 4XLEA 4LG3A 3N05A 4IQ4A 3SZGA 3LSGA 4YRVA 1Y6IA 3DTIA 2IS1A 2VQLA 4PK4A 2L5QA 3D5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8J A;  2W7N A;  5CKT A; 
#chains in the Genus database with same CATH topology
 2X85 A;  2VLA A;  4S05 A;  3LWF A;  1AOY A;  3QPH A;  4ZTJ A;  2DFI A;  3M4O J;  1WJE A;  3BZK A;  4ZDP A;  3MVP A;  2M0M A;  1H8A C;  4AVZ A;  1FSH A;  2KHM A;  3LFK A;  2NRA C;  2VQC A;  1HOM A;  2P7V B;  1FP2 A;  4JQF A;  2XSJ C;  4JYK A;  2W85 A;  2CS3 A;  5JHF A;  1KU7 A;  4IKF A;  2XGD A;  3QOP A;  3J81 Z;  1T98 A;  2IA2 A;  4BQN A;  5CVV A;  1EH8 A;  3J7A Y;  5L3B A;  1E2X A;  4XLH A;  2NVT J;  2HQN A;  1P9Q C;  1TT5 B;  1D1B A;  3BOQ A;  2A61 A;  1ORK A;  3IAM 2;  3ZQH A;  3K4M A;  5LEK A;  2NVX J;  3JSO A;  2ELJ A;  4EJT A;  2P6S A;  3GYH X;  1DDN A;  2FQ3 A;  2L01 A;  1TWF J;  2ZNZ A;  3BR3 A;  4WXC A;  2JUG A;  2BVL A;  4UUT A;  3G73 A;  2L02 A;  3QU3 A;  1QQI A;  4B3A A;  3F21 A;  3BT9 A;  2DAO A;  2M4K A;  3DEE A;  1XCB A;  3G2B A;  1VQO I;  2FF4 A;  4HF0 A;  4BE0 A;  3HJE A;  3E6C C;  2DOD A;  1YW8 A;  3OYJ A;  3G1O A;  4A3K J;  1R23 A;  2QQA A;  1U8R A;  2OCE A;  2GA2 A;  3EYY A;  2XAG A;  1POG A;  2LDU A;  3HSF A;  3RCO A;  2LBF A;  2LF8 A;  4BYY A;  2HU9 A;  4BAC A;  4X6A J;  3ESW B;  4PDK A;  3K4J A;  3LOC A;  2XAJ A;  2HYF A;  2CYY A;  2DJN A;  2WC2 A;  2VOP A;  1JKP C;  3TQN A;  1R5G A;  4M9S A;  2B7E A;  1IRF A;  2LK2 A;  4E7I A;  5DD8 A;  2KFD A;  2YX4 A;  4IQJ A;  1QRY A;  3EUH C;  4ZYE A;  5L3E A;  3OIQ A;  4HPQ A;  1P7I A;  3CJQ B;  5KCM A;  3WTT C;  1I6X A;  3W3C A;  5AON A;  1VQN I;  1XGM A;  2VKE A;  4MFD A;  4KUM A;  2Q1Z B;  3OOP A;  3T8R A;  1PUE E;  4EVI A;  2CV2 A;  3V7C A;  1K83 J;  5LRS A;  1MD0 A;  2R7O A;  4LIU A;  2DMT A;  3ML6 A;  4A3C J;  1MDM B;  3CC2 I;  1SVL A;  2X0L A;  3ZMV A;  1WH7 A;  1Y8R B;  3T1B A;  2WB1 A;  3KP2 A;  4BXU A;  5HS8 A;  1ZG5 A;  3S3M A;  4M6X A;  4N4N B;  3VYU B;  3F8N A;  2EFW A;  2RDP A;  4CCJ A;  4IRG A;  3HSR A;  3HOY J;  1HCR A;  5D8L B;  4D0P A;  3MFK A;  2WAQ A;  2EWN A;  3KIO A;  4PFP A;  2XAS A;  1N75 A;  1UG2 A;  3F72 A;  1HSJ A;  3SFI A;  3U2R A;  5HNH A;  2ZJP F;  1FBS A;  3JAM K;  3DFG A;  2CQX A;  1G3S A;  3IKT A;  3CME I;  4L18 B;  2ZME C;  4ZTF A;  1KQ0 A;  3FHN A;  2E7X A;  2LP0 A;  2VN2 A;  2BBY A;  3OL4 A;  3JRE A;  4XIC A;  3E5Q A;  3DKW A;  2JVG A;  3ZRG A;  3QYF A;  1ZG1 A;  4D7M A;  5D4S A;  1ZN2 A;  1HXD A;  1S5L C;  1ZGW A;  3WU0 A;  4ETS A;  5GP9 A;  1WRJ A;  4C30 A;  4WCG A;  1GXP A;  1TWG J;  2F4M B;  3I53 A;  3DEU A;  4XLA A;  3KE2 A;  3WG7 H;  2E5N A;  4U88 A;  2XKO A;  3P5J A;  1I3A A;  3ZQI A;  3K4B A;  4FTH A;  4P1W A;  2FBH A;  3BR1 A;  4FQG A;  1EA3 A;  2LRD A;  1WFX A;  3ZQ7 A;  1WSU A;  1YE9 A;  4BS9 A;  1KU3 A;  2E2J J;  1SAU A;  1S7A A;  1VI0 A;  4K2E A;  3VEP A;  3TL4 X;  4XLP F;  1O3R A;  2D1H A;  4KNY A;  2R7X A;  1BW5 A;  3CDL A;  3OS2 A;  1ZLK A;  5IP7 J;  1ETX A;  1F4K A;  4MTD A;  1MMA A;  3KZY A;  5EG0 B;  5FLX Z;  1XDS A;  4FT8 A;  4BU2 A;  4HRI A;  4RM2 A;  2CQQ A;  3G1M A;  1B4A A;  1UHM A;  2LYC A;  2QVO A;  4CYC B;  1B8I B;  3H5R A;  1F9N A;  2F5E A;  2VQH A;  4L0Y B;  1Z67 A;  1V4R A;  2LFB A;  1VQ8 I;  1MJA A;  4OIQ F;  3JRG A;  4UB6 C;  2F5C A;  2X51 A;  2Y0M A;  4DYR A;  1ZEL A;  1TW3 A;  1E3H A;  2MBF A;  4WF2 A;  4DBR A;  1FMW A;  3HBL A;  1OR7 A;  2RRE A;  5IP6 A;  2V9P A;  4PCQ A;  1OMI A;  1BI2 A;  1MGT A;  5D8K B;  1A6Q A;  4IZZ A;  3KZZ A;  4R8H A;  4RDU A;  3DTE A;  3SZP A;  3FBN B;  2FBI A;  2JN6 A;  3FM3 A;  5A2Q K;  2HS5 A;  2DI3 A;  2FEZ A;  3K6G A;  4ITV A;  1IV6 A;  2VAS A;  2CUJ A;  3F8B A;  2K27 A;  3P9I A;  1R4M B;  2IA1 A;  2E35 A;  4IXA A;  2G9W A;  1R5H A;  1XX5 A;  5K5Q A;  1AKH B;  3L2U A;  1VQ5 I;  1W7P B;  3VYR B;  4LLN A;  3KLN A;  1Y1V J;  5C3E J;  1XMA A;  4QPQ A;  2Y31 A;  3JRH A;  1IZ1 A;  3RTR A;  1RRJ A;  3QP6 A;  2VJJ A;  4D9J A;  1YFH A;  1I1G A;  3GBG A;  3GUD A;  4CCK A;  4CZZ A;  4UUS A;  2DA1 A;  2KIS A;  2TCT A;  3B02 A;  3MKL A;  4AVP A;  4G6T B;  4HLY A;  3AG2 H;  3JW4 A;  4HDU A;  3PO2 J;  4JX4 A;  3EPZ A;  5FJ8 J;  4JX6 A;  2ZME B;  3IAS 2;  4OAY A;  1FMV A;  2HQA A;  2R93 J;  3L2R A;  4PFO A;  1FTZ A;  3Q9V A;  2FQ4 A;  1PJR A;  2AXL A;  2M7A A;  4WXD A;  2CMP A;  1FSE A;  3CCY A;  4UVB A;  1J0R A;  2ICW G;  2W1O A;  3F22 A;  5IOY A;  5HLT A;  2GZW A;  1WWX A;  5BPD A;  2H6C A;  4HA8 A;  3H9G A;  1Z6T A;  1A04 A;  2HNH A;  2EIK H;  2Y0S A;  3DQV C;  4BQO A;  1OIS A;  2XRO A;  2M9H A;  5F04 A;  2HQ5 A;  2VIX A;  3IRQ A;  2ISY A;  4J19 A;  4ZYG A;  2MGQ A;  4LK1 F;  5CVU A;  2GQQ A;  2GOX B;  4MNU A;  1H0M A;  3FIS A;  2HXO A;  1J59 A;  2M45 A;  1MZB A;  2QA4 I;  4BE2 A;  4M6V A;  2PMZ N;  3E3V A;  4B44 A;  2HQR A;  4XM3 A;  4E4H A;  4BH9 A;  4E7Z A;  2AO9 A;  1XSD A;  4WK8 F;  5EYR A;  4KMU X;  1OQY A;  4NUB A;  2W4S A;  3OOU A;  5IP9 J;  4G7H F;  2CQN A;  1J7K A;  1LDK B;  2BHZ A;  2DDB A;  3BPV A;  3U21 A;  4AID A;  2OJE D;  5IPA A;  1VQP I;  3L2C A;  2R7D A;  3K9T A;  5AIP A;  3RYP A;  3G4S I;  3VPR A;  2DPU A;  4B48 A;  2RNJ A;  5E1W A;  3TW6 A;  1QZE A;  5ICC A;  2A6H F;  1ETV A;  3T0Y A;  4NQW B;  4Z2Y A;  1E17 A;  2EQR A;  3F8C A;  2E2H J;  1FOW A;  2FUG 2;  5J47 A;  3PSI A;  5D6F A;  1PVE A;  4MIM A;  4IO9 F;  3I59 B;  2KIQ A;  1L0O C;  5FKL A;  1BC7 C;  2OQR A;  5H6Q A;  1SD4 A;  1E0E A;  3BR6 A;  3HXL A;  1FYL A;  3BDD A;  2ZXH A;  2C6Y A;  1FNN A;  1YHQ I;  1CGP A;  2XRL A;  3BR0 A;  1X2M A;  2JZY A;  1I6H J;  1O3T A;  2HYG D;  2ZCW A;  3COA C;  2F4I A;  1YYV A;  2CWE A;  2RAE A;  1CQT A;  2AQF A;  1U9O A;  2NVY J;  1XGS A;  3DTK A;  1O7L A;  1WJB A;  5J1U A;  2PJP A;  3REO A;  4PGG A;  1R6R A;  3M1C A;  3AG1 H;  5H6R A;  1JHF A;  4KIC A;  4CUG A;  2UXN A;  2EK5 A;  1B72 A;  2NOG A;  3BTC A;  2ZFW A;  2OQG A;  4IF4 A;  3HPG A;  2QQ9 A;  5CYV A;  4ENN A;  2IS6 A;  4IHT A;  2IGM A;  1UFM A;  1SD6 A;  4GGG A;  2LKX A;  4B47 A;  3RYR A;  3K4L A;  1OPC A;  2QYO A;  3GCM A;  2A05 A;  3HSE A;  2JMW A;  4RLF A;  1BJA A;  3CC4 I;  3ZN1 A;  1W1W E;  4BNC A;  1TL8 A;  4PGH A;  5HOD A;  4BL0 B;  2YU9 J;  2NS7 A;  5L3G A;  4UV9 A;  1IG7 A;  1PP8 F;  1IN6 A;  4QPO A;  1RUO A;  2PN6 A;  1ZTR A;  3HIF A;  3FXQ A;  3IL2 A;  2A6T A;  3I58 A;  2X1C A;  2EA4 A;  3TOA A;  4J01 A;  2FU4 A;  3HKZ A;  1R4N B;  2KIU A;  4YG2 F;  2IRF G;  1RUN A;  5JLX A;  4EGZ A;  1QPI A;  3RSN A;  1MKM A;  3WOD F;  3ZCO A;  3ZOB A;  2JA5 J;  2J5P A;  1K6Y A;  1R00 A;  3BQY A;  3R6S A;  2AXT C;  3OY9 A;  5JVT A;  2O6G E;  1YTY A;  5DYM A;  1X4O A;  3WTV C;  2Y2Z A;  5KK1 A;  1C0W A;  1A36 A;  3D0S A;  5HLG A;  3V8L A;  3WHB A;  3HYI A;  5CLS A;  3OL3 A;  4XRS A;  2MC3 A;  5K7Z A;  1RR7 A;  5EG0 A;  4I09 A;  1KU9 A;  1OYW A;  1LPQ A;  1RPW A;  1K79 A;  4B8X A;  3J7A O;  5TIS C;  4XRM A;  1TC3 C;  1XN7 A;  3BZ6 A;  4KN4 X;  3WE2 A;  2V26 A;  2DLL A;  1HLV A;  3HHG A;  3A01 A;  4A2U A;  1B8I A;  4EJV A;  1JT0 A;  2PLY A;  4QTR A;  3HZJ A;  4BEH B;  1F36 A;  5DV5 A;  4EM0 B;  2P5L C;  5JVG F;  3IKV A;  4UB8 C;  5CJ9 A;  1WHU A;  3M9A A;  4N0B A;  2JA7 J;  2H6B A;  2CO5 A;  3CCR I;  2OPT A;  4RGR A;  2VQL A;  2L5Q A;  2VPR A;  3FK6 A;  1SFU A;  1UJ8 A;  4GO1 A;  2O8X A;  4U87 A;  1FEX A;  2WAQ N;  1IW7 F;  1VZ0 A;  2P81 A;  4RLQ A;  2VPL A;  4RS8 A;  1MBH A;  2ZSH B;  5FRM A;  3TP0 A;  2QQB A;  2HWV A;  4LOC A;  1YJW I;  3V7S A;  5ED4 A;  3S3O A;  1H88 C;  1Z91 A;  3KZI C;  1APL C;  4F92 B;  1E3P A;  2KRC A;  2ZNY A;  5CQE A;  2GLO A;  3IH2 A;  2RN7 A;  1UZC A;  4AUX A;  3SYT A;  3HC7 A;  1D0Y A;  1YS7 A;  2VE9 A;  3BZC A;  4KMF A;  1W36 C;  1AKH A;  3KLO A;  3M8E A;  4AIH A;  2K7L A;  1XSX A;  2MD0 A;  3TO9 A;  1BBY A;  4A12 A;  5FRN A;  1KQ9 A;  3WTW C;  2NVQ J;  1QO0 D;  3QWL A;  3B6A A;  2EJR A;  3ONQ A;  1SD5 A;  3G6E I;  3H9Q A;  3WTX C;  1JTX A;  3QU6 A;  1H9G A;  1LQ1 A;  4A3J J;  3CZ6 A;  4IHS A;  4A3D J;  3H92 A;  2MYS A;  3VWB A;  4IX7 A;  2KL4 A;  4MGR A;  1XS9 A;  2ISZ A;  5GPA A;  3Q0U A;  3VYT B;  1FP1 D;  3F6O A;  1YG2 A;  1MBK A;  1TNS A;  3ECO A;  5B5E C;  1G3W A;  2M4G A;  1DGR M;  1R7J A;  3JRA A;  3OSF A;  5HNF A;  2CUE A;  1QPM A;  1S3J A;  3S1R J;  3C7J A;  2LNB A;  2ZBK A;  3ZGK A;  1HQC A;  2ZB9 A;  2M2E A;  2XKP A;  3I71 A;  5L3D A;  2LKS A;  3GZ6 A;  1D1C A;  5F64 A;  2XGC A;  1O3Q A;  1QBJ A;  3KEO A;  3U9G A;  4CYD A;  2FML A;  1S72 I;  4HEA 2;  4IPA A;  5JR3 A;  3FXR A;  5BOX A;  4XLN F;  3OYF A;  1X4P A;  1LEB A;  1Z05 A;  4JP0 A;  2XRN A;  5DCF A;  4MEY F;  1VQK I;  2CJJ A;  1MNE A;  5F1R A;  1LFB A;  2K85 A;  1WI9 A;  3H0G J;  3PUF A;  2ZJQ F;  1OJL A;  5DCM B;  3WTU C;  1REP C;  2H8R A;  4M71 A;  4DJA A;  5FFX A;  1W5S A;  2HOA A;  4P5O A;  2DT5 A;  1ZKG A;  2RQP A;  3Q0W A;  2M30 A;  4X1E A;  3U1D A;  2Y30 A;  4NNJ A;  2CSO A;  2IEK A;  2X6X A;  4F7Z A;  3WU1 B;  1Z0X A;  1MMD A;  2VXZ A;  3WGI A;  4KIG A;  2DMN A;  2NS0 A;  2LD5 A;  3HRT A;  3H3Z A;  5CQG A;  5ILU A;  2Z1D A;  3HM5 A;  2L4A A;  2LKP A;  1FIP A;  3K1N A;  1ULY A;  2KZG A;  3GFL A;  4Y15 A;  1U78 A;  3N4M A;  2VI6 A;  3I3L A;  4M72 A;  1AWC A;  4NHJ A;  2M8G X;  3ABU A;  4RB0 A;  4FHT A;  4Y13 A;  4NQW A;  2OAZ A;  3TP3 A;  2UV1 A;  4UUS B;  2EFO A;  2Z9O A;  1OYY A;  2ELH A;  3JRD A;  3NWT A;  3I59 A;  4HLX A;  1YI2 I;  1ETQ A;  2UWM A;  3TKY A;  4D7N A;  2KJB A;  2XIG A;  4XKV A;  4IL6 C;  1NHA A;  1BOB A;  1QZZ A;  2GWR A;  2N8G A;  4HNT A;  3JRB A;  1V5F A;  3V4G A;  3HPH A;  3AAF A;  3CCQ I;  4GXO A;  3BLY A;  5GAD J;  2NVU B;  1L3L A;  4D1Q A;  1ITY A;  3IH4 A;  5K5R A;  3W2A A;  4F52 A;  4BHC A;  5KAF C;  2IS2 A;  2ETH A;  4D5F A;  3AL0 C;  4I0A A;  2DT7 B;  2ECB A;  4F93 B;  5H20 A;  2K9N A;  3I4M J;  2K4B A;  1IN4 A;  1TWC J;  3K4C A;  3S2D J;  4U0Y A;  3WU2 C;  1IN5 A;  5J6X A;  2DBB A;  3H35 A;  2FXA A;  1HBX G;  4L0Z B;  2L9N A;  4N9H A;  4U0W A;  3SEZ A;  3MKW B;  1XC5 A;  3ZN0 A;  1SFO J;  2DDA A;  2FRH A;  3HB9 A;  3A0B C;  1NG7 A;  1KGS A;  2L3D A;  4S04 A;  3SFZ A;  2CW0 F;  3P9C A;  3W2W A;  4KYW A;  5DS9 A;  5CVI A;  1SC7 A;  3CCV I;  2IGN A;  3HOU J;  3DU5 A;  1D0X A;  2OTJ I;  4Q48 A;  4RAF A;  1RKW A;  3R61 A;  4M9Z A;  1KZH A;  3HOV J;  1IUY A;  1IDY A;  3E97 A;  3ELK A;  1ETO A;  5E3O A;  1CF7 B;  1NH3 A;  2VJ5 A;  2YU3 A;  3P9K A;  2QQ8 A;  4XON A;  4IHW A;  5M3M J;  2FNA A;  3MZY A;  2X1D A;  1I27 A;  3D5S C;  3BG9 A;  2PMH A;  3HOS A;  2Y75 A;  3ZQC A;  1ZR4 A;  1X3Z B;  2WTE A;  4B09 A;  3GTJ J;  4KT5 C;  3CO7 C;  2R92 J;  3MWM A;  1GHC A;  2WV0 A;  1FBQ A;  1K6O A;  3FMQ A;  3GTM J;  3S32 A;  1ZHF A;  2GAU A;  4GRI A;  2ESH A;  2GXB A;  1K7A A;  5FLX K;  1P6R A;  3ZMT A;  4C2U A;  2DTZ A;  2HZT A;  2R4G A;  4U7B A;  2L7K A;  4DZJ A;  1BC8 C;  1G59 A;  4XN3 A;  2Y48 A;  1WVR A;  1XGO A;  2D1V A;  1ZQ3 P;  3OYI A;  2PJR A;  2Y9Y A;  4BEH A;  4GYG A;  2IT0 A;  4C2T A;  2LSO A;  3IRR A;  1JKO C;  2DW4 A;  1B72 B;  1S7O A;  5HOO A;  3E5X A;  4IHY A;  2IJL A;  3GTQ J;  2BEO A;  2JPC A;  3F0C A;  4A3B J;  5D5V B;  2P5V A;  2ZO4 A;  3PFI A;  1K78 A;  4KA4 A;  1BL0 A;  1U5T A;  2P6T A;  1R36 A;  1FJL A;  3JRI A;  2LTP A;  3HG9 A;  2R7S A;  2VXD A;  4LJZ F;  2R7T A;  2F6C A;  4M3E A;  3T5X A;  1Z3X A;  3OSG A;  1MW7 A;  1SFE A;  1LVA A;  1IN7 A;  1GV2 A;  2DOF A;  3H9J A;  3F8F A;  4YII A;  5F27 A;  4WWC A;  2VB6 A;  1YW9 A;  3AL0 B;  1JUP A;  3RPU D;  4QIW N;  3BQZ A;  2JVH A;  1TW2 A;  4CCM A;  3KET A;  4MEX F;  1V54 H;  1XD7 A;  3FHZ A;  4CCL A;  1RIO H;  5E17 F;  3BG3 A;  2ACJ A;  4LB6 B;  3RQI A;  5EZH A;  3G1L A;  5IYD J;  1P4W A;  4OMZ A;  2XC7 A;  2OD5 A;  2DMP A;  3A02 A;  3SXY A;  2EIN H;  4XRF A;  4BY1 J;  2A3S A;  2BYV E;  2IVM A;  4XK4 A;  4A6E A;  3PIO F;  1AHD P;  1X1D A;  1WPK A;  2MC4 A;  4NC6 A;  3BTL A;  2CW8 A;  2L2O A;  4AIJ A;  3A03 A;  1QVT A;  1W0U A;  2A5Y B;  1H9T A;  2HZD A;  2A07 F;  4MTE A;  1QHG A;  3A01 B;  4CZC A;  2NS8 A;  1YJ9 I;  2R7R A;  4I6Z A;  4DZP A;  4LFU A;  4E7J A;  4G8X A;  3RDI A;  2JT1 A;  3SEQ A;  1OCZ H;  1G3T A;  4RGX A;  5C4J J;  3K70 C;  5BMZ A;  1HST A;  3PNY A;  4ON0 A;  4NDL A;  3OS0 A;  3CP2 A;  3BCA A;  3BPX A;  3GTP J;  4NBQ A;  3OYL A;  3VFZ A;  2IGK A;  4AU7 A;  2FNP A;  3W2V A;  2DA4 A;  2ZC2 A;  3I4P A;  2XF7 A;  2QM3 A;  2V7F A;  3QPL A;  4LIV A;  3I55 I;  1KYZ A;  5L3F A;  2XUB A;  5DM7 F;  1D0Z A;  2DYR H;  3CJR B;  1XPX A;  2MG4 A;  4R79 A;  5DCM A;  3U1K A;  2LF7 A;  4L9N A;  4MQV A;  3CCM I;  3DV8 A;  5LEJ A;  3LSP A;  5J8F A;  2XGX A;  5B3S H;  1DGW Y;  4L5J A;  2Z5U A;  2YPR A;  1XMX A;  5F0C A;  1A6I A;  1QVU A;  4ZYD A;  3FKJ A;  4GYI A;  3FXM A;  5CKT A;  3BP8 A;  4XSZ F;  3LSR A;  4ZYH A;  5J1R A;  1JHH A;  4JX5 A;  3ZQL A;  3TED A;  3K2Z A;  1XGN A;  1YIJ I;  1OLT A;  2EV6 A;  2CU7 A;  3RKX A;  1F43 A;  4RGU A;  2DQL A;  1HKQ A;  3IUO A;  1LFP A;  4WXH A;  4IRI A;  3FZV A;  3OIO A;  3DU6 A;  1VQ9 I;  2V6C A;  5EJC A;  2HKO A;  1O7F A;  4WX9 A;  2EPF A;  1A5J A;  4YEL A;  5LD2 C;  1G4D A;  4B4C A;  3DKX A;  3RKQ A;  4E7H A;  4GFB A;  2OU2 A;  3LSM A;  2LMD A;  1FYM A;  2LY1 A;  5H2F C;  2GXG A;  1VTN C;  3KCC A;  3C2H A;  2FOK A;  2LOO A;  3HRS A;  5D5X B;  3R0J A;  2NNN A;  4HX4 A;  4EV0 A;  5EDN A;  3MD2 A;  2K3P A;  4V19 K;  3J80 K;  2O8K A;  3FM5 A;  3I4N J;  1TLH B;  2X1E A;  3MEX A;  4AM3 A;  3OYA A;  3S1N J;  1LE8 A;  2F5V A;  3IC7 A;  4I7H A;  2V1X A;  1UST A;  4DIQ A;  1V5G A;  1N25 A;  2HFH A;  5HLH A;  3DPU A;  4XLF A;  2KDO A;  5BS6 A;  3OYK A;  1BI3 A;  2JJ7 A;  1R71 A;  1UHS A;  2BXZ A;  3CJN A;  3DWL E;  1DU0 A;  1TQI A;  1W5C C;  1BIA A;  2ZSI B;  3LA7 A;  1FIA A;  2R7U A;  2VC0 A;  4G7O F;  2M87 A;  4FX4 A;  2R5Y B;  3I56 I;  3FXU A;  2M1B A;  4A69 C;  4PZJ A;  1B59 A;  5LLQ A;  1LFU P;  5HDN A;  4C3H J;  1OFC X;  1UAA A;  1QNT A;  2P8T A;  4IHV A;  2V9K A;  4Y17 A;  2X4H A;  3QOE A;  2H94 A;  2VON A;  4HNU A;  1EV7 A;  1RI7 A;  3I64 A;  1LJ9 A;  4LG0 B;  2O3F A;  1TWH J;  4LG3 A;  1FOX A;  3N05 A;  1WZ2 A;  4IQ4 A;  2XHK A;  1JJ6 C;  3CCU I;  1MMS A;  3QRF F;  1JKQ C;  5F08 A;  2AHQ A;  3D5L A;  2EH3 A;  1V55 H;  2K9Q A;  4M9X A;  1F1Z A;  2NAZ A;  3FXJ A;  5K1Y A;  2E1N A;  3M07 A;  5ICE A;  1T38 A;  2VUM J;  3ERM A;  1CF7 A;  3BTJ A;  1GT0 C;  1M1E B;  5B1B H;  3P7N A;  5A2Q Z;  2P5K A;  3CCE I;  3KYL A;  4GDF A;  2W57 A;  3H5N A;  4H0E A;  5DDG A;  2B9S A;  3HOZ J;  2E19 A;  1UCR A;  1TTY A;  3QP5 A;  3NAR A;  2Z3Y A;  5EF6 A;  1F5T A;  2K3F A;  1U5T C;  3GVA A;  3ZMD A;  4Y33 A;  3KPH A;  1HW1 A;  1XG1 A;  3CJT B;  3SHF A;  2QKL B;  3VOE A;  1TQP A;  4FCY A;  2HDD A;  2DK5 A;  2EIL H;  3GW2 A;  3GLL A;  4J00 A;  2MA3 A;  4XID A;  2D2W A;  1D8K A;  3BG5 A;  5J4Y A;  2R3S A;  4KIB A;  3V42 A;  4I0B A;  4MLO A;  3ROU A;  2X6W A;  3I5U A;  1ODD A;  2Z16 A;  2KDZ A;  2CFX A;  4OMY A;  2Q0O A;  3ERE D;  2QSH X;  4A5N A;  3PO3 J;  4R1H A;  3JCU C;  2R7F A;  4CCN A;  2ADU A;  5BQT A;  3C1D A;  1TQM A;  3R4K A;  4CO8 A;  4AWX B;  3OYB A;  3NEU A;  3LMM A;  2DA7 A;  2EV5 A;  3M1E A;  3SDG A;  1P92 A;  4RAZ A;  2V1N A;  1FBU A;  4LK0 F;  1RET A;  3KP5 A;  2D5V A;  4HAM A;  5HS7 A;  2O61 A;  4CHU A;  4M6Y A;  2RV8 A;  3ISP A;  1MMG A;  3K2A A;  2Y9Z A;  3J7Z I;  4D5C A;  4CDG A;  5KNL A;  3FXL A;  2LLK A;  3ASN H;  2OV7 A;  3WHC A;  2QCO A;  2MAB A;  1MNM C;  1OCP A;  3ZQQ A;  3CTA A;  3QAH A;  5AIQ A;  3FBI B;  1VFC A;  1K61 A;  1TP4 A;  6PAX A;  2D45 A;  2HGC A;  2JSP A;  2CRG A;  2RQQ A;  1ONV A;  3L2W A;  1IF1 A;  1Z6R A;  4UUV A;  1RES A;  4DW6 A;  3OYM A;  2B0L A;  5LBQ A;  3S2H J;  2G7U A;  3HDD A;  3HRU A;  1X1P A;  1ZG3 A;  4V2G A;  3Q3S A;  3CD6 I;  2DA3 A;  5DEQ A;  3HL2 A;  4DOZ A;  2GIV A;  2JTV A;  5L3C A;  4HQM A;  3HRM A;  3LST A;  1ZH5 A;  3BTI A;  4KN7 X;  1YIT I;  2HDC A;  4HW0 A;  1FOY A;  3OIP A;  2QEX I;  2VT3 A;  2WA0 A;  4F91 B;  1ZRF A;  1ZYR F;  4BJT A;  3HTS B;  5GAE J;  1O57 A;  3OYG A;  2WY7 Q;  4XNF A;  1MH4 A;  1RZ4 A;  4II3 A;  3ASO H;  2LY9 A;  3WGG A;  2V1U A;  4YFX F;  1ZRE A;  5LHI A;  3TDZ C;  1YRN B;  1N78 A;  3GX4 X;  1LNW A;  2BW3 B;  1U6G A;  2HOT A;  5IT9 K;  3PSF A;  1Z3Y A;  3GF2 A;  4CIC A;  1FZP B;  4A3F J;  1T0F A;  2PJR B;  1IRZ A;  3BC8 A;  5LRR A;  2STW A;  3A2K A;  4ZZL A;  1WJA A;  3HEF A;  2WV1 A;  3NWS A;  3E7L A;  2I5U A;  2WB1 N;  3MKZ A;  5GPC A;  1QZY A;  2OA4 A;  3VSL A;  3C2B A;  4QLC U;  4IVN A;  4ZZD A;  1PUF B;  3BG6 A;  5EGO A;  1Q1H A;  5JLW A;  1V3F A;  4V2F A;  4AC0 A;  2O7O A;  1DQU A;  1I39 A;  4I99 C;  3LSJ A;  5ILV A;  2VOD A;  3NAU A;  1K78 B;  3HHH A;  3AG3 H;  4BHB A;  1FYK A;  4A3G J;  3SQN A;  2OBP A;  1U5T B;  2A69 F;  1UB9 A;  2VJ4 A;  5HS9 A;  1VQM I;  3EDP A;  4NC7 A;  1J9I A;  3HGG A;  2EZL A;  2F5F A;  5LHG A;  1OCR H;  3I9V 2;  2OTL I;  4CSW A;  4EGY A;  1GDT A;  3FK7 A;  1I3Q J;  2BY3 A;  3GZ5 A;  2L9R A;  1D5V A;  5E3M A;  5DD4 A;  3HTU A;  3S93 A;  5D5U B;  1DU6 A;  3QQA A;  2E71 A;  1U0J A;  2EIJ H;  4KIF A;  1SD7 A;  4YIR X;  3LNQ A;  3DCF A;  3IP4 B;  2DA2 A;  1NK2 P;  2W7N A;  2BZT A;  2ZXI A;  1ON2 A;  1T6S A;  5LGT A;  5D4R A;  4JOM A;  3LQR A;  3LQQ A;  1QU3 A;  1LB2 A;  3M8J A;  1FWZ A;  2WBM A;  1IRG A;  2H09 A;  3GFM A;  4QSH A;  5JFR A;  2CQK A;  4Y4R A;  1T33 A;  4N9I A;  2DN0 A;  4BJ6 C;  2QKM B;  5FO5 A;  5J1Y A;  4OIN F;  3ZQG A;  4DBQ A;  5D5W B;  1U8B A;  3O2P E;  3OMY A;  5IT3 A;  2YSR A;  2H8W A;  4A3L J;  3BJO A;  3I54 A;  4HYE A;  1MIJ A;  4BKX A;  4LLG F;  4E7L A;  2L7F P;  3TGN A;  2VBW A;  2EFP A;  3CDH A;  3V8K A;  1PDN C;  4F55 A;  5GTH C;  3N97 A;  2WWY A;  1IJW C;  3K69 A;  1R1T A;  5JI6 A;  2VC1 A;  2ID6 A;  3J81 K;  4KFC A;  1DUX C;  4XBF A;  2DOE A;  3ZQF A;  5FLV A;  4U7D A;  4CCO A;  1DPR A;  2Z2S B;  1W7P D;  3RQ4 A;  3ZP5 A;  2EZH A;  4A0X A;  2ZFU A;  1BIB A;  3CUO A;  4EJW A;  3CUQ A;  3H36 A;  1D3Y A;  4RBO A;  2R5Y A;  4DGW B;  4G12 A;  3RKW A;  3PQK A;  5FFZ A;  2PFB A;  3PL8 A;  3F6V A;  3HOX J;  1IGN A;  3LAJ A;  4HX7 A;  1EF4 A;  3A1Y A;  2I10 A;  3E5U A;  1Y1W J;  2K5C A;  4BQQ A;  1S6L A;  2EFQ A;  5KHD A;  4LG0 A;  2ID3 A;  4B1R A;  3MMY B;  1JJ8 C;  2O5R A;  5KVR A;  1Y0N A;  1RKT A;  2OCC H;  5TJJ A;  4C2M J;  5B66 C;  3HUG A;  2K9M A;  3MN2 A;  3JRF A;  1EH6 A;  3WGH A;  3DBR B;  1OCC H;  5M3F J;  1VQ6 I;  2KT0 A;  4BHP A;  3LA3 A;  3OYH A;  3BR2 A;  4H4K C;  4I2O A;  1FOK A;  2PMZ A;  2HVR A;  2PBI A;  4A0Y A;  4RM3 A;  3PJR A;  4CH7 A;  2WAF A;  2XDV A;  5JHU A;  5J40 A;  4UVC A;  3S16 J;  2Q2E A;  1T8I A;  2QBY B;  3PQJ A;  2VL8 A;  1X1C A;  5EEH A;  3F8M A;  2V6E A;  2IA0 A;  4M3D A;  3K10 A;  2OZU A;  2JPB A;  3ZMZ A;  4M74 A;  3PIP F;  2XAQ A;  2BY1 A;  4XKW A;  5F6F A;  3LSH A;  1MMN A;  4HV5 A;  2BV6 A;  2K9S A;  3Q0V A;  3RZO J;  1P7J A;  5DM6 F;  2IGO A;  5CVR A;  2F48 A;  1R22 A;  2W25 A;  5EZG A;  1ETW A;  3L00 A;  1LE8 B;  4FX0 A;  2V4J C;  4MFE A;  2HPI A;  2KJC A;  1K4S A;  1J09 A;  1XTA A;  5FD5 A;  3RKY A;  4DQ2 A;  1MSE C;  5E1X A;  4C9Y A;  2DU9 A;  1BI0 A;  2R7Q A;  3ABK H;  3DKY A;  1X1B A;  4Y7N J;  3MZH A;  1FX7 A;  2HVQ A;  3BY6 A;  2E7W A;  2IW5 A;  1WCM J;  2QEN A;  2P7C B;  1BR4 A;  4ZYA A;  4EQQ A;  4P9U A;  1Y0U A;  2CG4 A;  2Y0S N;  2NOJ B;  2DMU A;  2X48 A;  3OWT A;  3KP6 A;  2VKH A;  2YX7 A;  2ECC A;  3UKG A;  3WG9 A;  1B9N A;  3CDI A;  2FSW A;  3FDY A;  3TO7 A;  5IYB J;  4DYC A;  2M7B A;  1MH3 A;  5CPR B;  2XF6 A;  5FRO A;  1G6N A;  3JSP A;  4FIS A;  4ESB A;  1FT9 A;  5J8C A;  2EV0 A;  3K70 D;  2DA6 A;  1WQ2 A;  1T56 A;  3OYD A;  1Z7U A;  4IRH A;  3EUA A;  1Z9C A;  5LGN A;  2XPV A;  3WTS C;  4UY8 I;  4M73 A;  2CGP A;  3GTK J;  3A0H C;  3NRV A;  1JUS A;  4P96 A;  1T0F C;  1FLI A;  2E36 A;  3GTO J;  3LAP A;  4PJN A;  1JGS A;  4HF2 A;  2PI0 A;  1J75 A;  1Y39 A;  1ERD A;  2PMU A;  2A6E F;  4A6D A;  1UMQ A;  3FXK A;  3TO6 A;  2YR2 A;  2GOM A;  3RPQ A;  4LGW A;  3ULQ B;  4BQA A;  3TMO A;  3S17 J;  2FMY A;  4G7Z F;  1IXR C;  4PJ0 C;  4G6D A;  1GXQ A;  3CC7 I;  1TWA J;  5LFA A;  2DT6 A;  5ICG A;  1YX3 A;  2BY2 A;  2TDX A;  3LSI A;  4Y52 J;  1ZGA A;  5TGT A;  1ETK A;  3VB2 A;  1KU2 A;  1LKX A;  5BNG A;  2MFZ A;  1K4T A;  4BBR J;  1SFK A;  2FJ1 A;  4ZDO A;  3L9F A;  1FY7 A;  2KMU A;  4A0Z A;  4IEJ A;  4RB2 C;  1KQ8 A;  4QWQ A;  1AU7 A;  2KIM A;  1ZAR A;  2V1D A;  1B9M A;  5DTD A;  4BBS J;  2YS9 A;  1S29 A;  4ESF A;  2G7H A;  2HEO A;  4PJJ A;  1YRN A;  5FB2 A;  1WH5 A;  3S15 J;  1LDD A;  2BW3 A;  2O03 A;  4ESJ A;  3W6V A;  2BE5 F;  5HDK A;  1BOA A;  2HOE A;  4RAG A;  4A5M A;  4YIF A;  2OF7 A;  5B1A H;  2W24 A;  3F23 A;  2AS5 F;  2L54 A;  2ZXJ A;  4E70 A;  4AYB A;  2ME0 A;  3J7Y J;  3GZN B;  2V79 A;  1DP7 P;  1VF9 A;  1Z21 A;  3KX2 A;  1ZK8 A;  2KRF A;  1PUF A;  1Z7L A;  2K40 A;  1NG6 A;  3K4K A;  1YLF A;  2PG4 A;  2W00 A;  3CF2 A;  3TDU C;  4ASN A;  2BGC A;  2HDW A;  3JR9 A;  3RPU A;  1D8J A;  1J2X A;  4A3E J;  4HQE A;  1HDP A;  3DEW A;  1QA6 A;  2BVM A;  3DPT A;  2XF5 A;  2ZXW H;  2DQR A;  4Z6Y A;  4LB5 A;  2F4O B;  3FXO A;  2E5Z A;  3D5R C;  3GTL J;  1D1A A;  1JTY A;  4BGD A;  4ZC3 A;  3WTY C;  3GEZ A;  3X2Q H;  4A3M J;  2L0K A;  2E60 A;  2Y69 H;  4HSR A;  5ICF A;  2XAF A;  3C2G A;  4I02 A;  1TZL A;  3IWZ A;  2XB0 X;  2LH9 A;  3BWG A;  2IAI A;  2K02 A;  5FKM A;  4M3G A;  2KRH A;  3MZ8 A;  4XR6 A;  3TW7 A;  1IRX A;  2VKV A;  1VQ7 I;  1X58 A;  4PJM A;  3HKZ N;  1G8X A;  3CUQ C;  3QPT A;  2ZJR F;  1GUU A;  2LR8 A;  2BY0 A;  5J4V A;  3W6J B;  4XLE A;  5K5O A;  5LGU A;  1RNL A;  3GME A;  1GV5 A;  1I5Z A;  3K7A J;  1W0T A;  1SEU A;  2QGU A;  1Y6I A;  1MBE A;  4IOC F;  3R60 A;  2V9V A;  1SMY F;  2YUS A;  4O6J A;  5DUK A;  4UVA A;  4MHG A;  4M3B A;  3R0A A;  2CV0 A;  1KYW A;  2XAU A;  5GAH J;  1PP7 U;  3L7W A;  1ACI A;  1NK3 P;  1GLN A;  2M3A A;  3CLO A;  1XCV A;  2B63 J;  2UZK A;  1ETY A;  3HOW J;  1O3S A;  1WJC A;  2ESN A;  3HOT A;  4RB1 A;  2VJI A;  4Q47 A;  5J3L A;  3ECH A;  2MLK A;  1P4A A;  1OCO H;  3UNG C;  1R1V A;  2HTJ A;  3ABL H;  3CF5 F;  4EEF G;  4L9J A;  1LEA A;  4X0G A;  1Z1D A;  2VKD A;  1ZRC A;  3WTZ A;  5EGO B;  1ZRD A;  3EQL F;  4BE1 A;  5M5X J;  2HI3 A;  2KZV A;  4NC8 A;  3AKZ A;  3L2V A;  3E6D A;  1SVM A;  2ZKZ A;  1UHW A;  4KT6 A;  1N77 A;  4Q5S F;  3C3W A;  1S8N A;  1MND A;  4C3J J;  2KKO A;  4JK1 X;  3MCZ A;  1WJF A;  2CW7 A;  4O3M A;  2WAE A;  5KAI C;  3K1M A;  3QPS A;  3S14 J;  1PYV A;  1Z77 A;  5HDG A;  4JBA A;  3V8J A;  2DK8 A;  5FKO A;  3F3X A;  2TRT A;  4EM2 A;  3GXO A;  2CV1 A;  2DFF A;  1JXS A;  4HNV A;  3RIR A;  3JAM Z;  3H1C A;  1RR8 C;  3MKY B;  2FOW A;  1IN8 A;  4ZH4 F;  4HDV A;  1EH7 A;  1LUJ B;  2FBK A;  2R7W A;  2DXI A;  4I98 B;  2QSG X;  2P4W A;  4L9T A;  2HVS A;  2FE3 A;  5E3N A;  5E18 F;  4BJ5 C;  1ZR2 A;  2GM4 A;  1T39 A;  1NTC A;  2IXS A;  2DJI A;  2H1L A;  1JKR C;  3KYC B;  3FMS A;  4PUS A;  2DFE A;  5ERI A;  2QBY A;  2BOL A;  1T2K A;  1IUF A;  2BHY A;  2AQE A;  2GIZ A;  2LC2 A;  3Q9S A;  4RA2 A;  1IV8 A;  1R5I D;  2X6Y A;  2QSF X;  5ILS A;  4KIT B;  3L1P A;  3BR5 A;  4OAZ A;  4FE7 A;  1WJ5 A;  2OZ6 A;  4L5E A;  3S2W A;  3CO6 C;  4FET A;  1T08 B;  3PNT A;  5C44 J;  3AG4 H;  1MSF C;  5E3L A;  1IO2 A;  2DFH A;  4MO7 A;  3GWZ A;  4BY7 J;  2HYJ A;  3BG7 A;  2R7V A;  2CUF A;  1YW7 A;  1B6A A;  1BR2 A;  1QGP A;  3C18 A;  4BDZ A;  3EYI A;  1WI3 A;  5E1Z B;  3CCS I;  2W84 A;  4ABZ A;  2JWT A;  3SZT A;  3DLA A;  1BM9 A;  2XV4 S;  3BJA A;  4YFK F;  4Y3O A;  1YO5 C;  3WE3 A;  1HDD C;  3DP7 A;  2JSC A;  3Q5F A;  4XKB A;  3JTH A;  4HBL A;  4W97 A;  4S0H B;  1ZGJ A;  4HST A;  1X2N A;  4P55 A;  1XSV A;  3CUQ B;  3CCL I;  1HW5 A;  4XSX F;  2PQ8 A;  1SFX A;  3M3Y J;  1OYI A;  4XOR A;  1X1A A;  3E0J B;  5HLI A;  1XB4 A;  2LVS A;  2W48 A;  4KIS A;  3O3K A;  3KEY A;  3O8G A;  4II2 A;  3TBI A;  1W5T A;  3QOD A;  2EBI A;  2JA8 J;  1FC3 A;  5CVJ A;  3HUG B;  3L2Q A;  3FKI J;  1MJ9 A;  3GFI A;  3VSK A;  4LMY A;  1SAX A;  2IBD A;  4BXF A;  2HTS A;  4RAY A;  2WY8 Q;  3T8T A;  1S7E A;  2JA6 J;  4N4O B;  3RJP A;  2RC4 A;  5K7F A;  2Q2E B;  2M5W A;  3GFJ A;  2L7Z A;  1U3E M;  3HGY A;  1W36 D;  1JI8 A;  2NYX A;  2IPQ X;  3OYE A;  4G94 A;  4ZJZ A;  3VOD A;  2R7Z J;  2E2I J;  2RKH A;  3IV5 A;  2FX0 A;  1VQL I;  2EA2 A;  2EZK A;  1GVJ A;  3I0T A;  3K4N A;  2STT A;  2EB7 A;  3KP3 A;  3VYS B;  4HOB A;  1Q1V A;  2DTR A;  2A5W A;  3FWE A;  1I50 J;  1P4X A;  3SDB A;  2Z33 A;  2R0Q C;  1UEL B;  1YX5 A;  3CMA I;  2VE8 A;  3S1Q J;  3A4C A;  3CLQ A;  1R1U A;  3FIW A;  2R5Z B;  1R49 A;  1FTT A;  3BCB A;  2BXY A;  4YEJ A;  2XB5 A;  3S8P A;  5F0F A;  1A31 A;  2UUZ A;  4EJO A;  5GTI C;  1Y8Q B;  2QLZ A;  3J80 Z;  2XSD C;  1LVK A;  1MJB A;  3FF5 A;  2IS4 A;  4A93 J;  4UNO A;  2VBY A;  4L5I A;  4ENJ A;  2QF7 A;  2H1K A;  1DPU A;  1MDM A;  3ZR8 X;  3ZMS A;  2COB A;  4W1U A;  3M7G A;  1JE8 A;  3CP8 A;  4FE4 A;  2X9D A;  4IJA A;  2RNG A;  1HF0 A;  2CFO A;  3UR3 C;  2A68 F;  4EM1 A;  4OIO F;  5FD6 A;  2MH2 A;  2M8E A;  2G0E A;  5FGM A;  3G3Z A;  1A35 A;  2JRM A;  2GA1 A;  2L4M A;  4BUP A;  3H3U A;  3GTG J;  2CH0 A;  3FMR A;  2QWW A;  2L9S A;  2JK3 A;  2F2E A;  3AFH A;  1GVD A;  4B43 A;  3QYE A;  3JTG A;  1T95 A;  5GAG J;  5E79 C;  3F9K A;  2XGE A;  4IHX A;  1STZ A;  2DOA A;  3PUB A;  2HXI A;  2PX9 A;  1VQ4 I;  1G2H A;  5FKN A;  3BJ6 A;  2XPW A;  2VQG A;  3KP7 A;  2MH9 A;  1TT0 A;  3LA2 A;  4HX8 A;  2COM A;  4E7K A;  5M5Y J;  1BJZ A;  2CUZ A;  2LBF B;  1R9T J;  4RGS A;  1SMT A;  3H0D A;  1J5Y A;  3DXJ F;  1WJD A;  1XDU A;  2RVC A;  1YIO A;  2EFN A;  3DBL B;  5IYC J;  4IOA F;  4UV8 A;  9ANT A;  1OR7 C;  4PSW A;  2LY2 A;  5K7H A;  3LSK A;  3RI4 A;  2VBZ A;  1U2W A;  3OYC A;  2FD5 A;  1TNT A;  2E1M C;  4XKC A;  3ZPL A;  1EKE A;  4ZDL A;  1E3O C;  1OCT C;  1U9N A;  1HKS A;  2Q8K A;  4HG2 A;  3ZXS A;  2I8D A;  3E6M A;  1ZLJ A;  3G71 I;  4AYB N;  4LD5 A;  3JRC A;  2K9L A;  4XN0 A;  3W6K B;  4G6Q A;  2E34 A;  1SVO A;  4ENK A;  4MQ9 F;  5DUI A;  1X19 A;  4EMS A;  4F3Q A;  5EEG A;  1HW2 A;  3DF8 A;  2MSY A;  1BA5 A;  4EJU A;  2K4J A;  4HV6 A;  4AD9 A;  4BAY A;  1USS A;  4CYC A;  2HPM A;  2Z99 A;  4BXX J;  5FKK A;  1KON A;  2KQR A;  3QYB A;  4XOT A;  4XRS G;  2O9L A;  4XMY A;  4L9V A;  1FPQ A;  3DLL F;  3OR1 C;  2X6O A;  1X3U A;  2OUM A;  1Y56 A;  2ELK A;  4LIT A;  4E7S A;  4PJL A;  4RMN A;  2DPD A;  4P9F A;  4C3I J;  2EIM H;  2IP2 A;  1B1B A;  1D5Y A;  4FAS D;  5IOZ A;  1O4X A;  3ABM H;  2FA5 A;  1JT6 A;  4DYQ A;  4G9Y A;  4UHT A;  3S1M J;  3CQZ J;  3ABT A;  3EUK L;  3EUH A;  3MAJ A;  4HZF A;  3GO5 A;  4M3F A;  2NNY A;  5EEA A;  1LDJ A;  4KDP A;  1TBX A;  3DPL C;  2LRE A;  1JUM A;  3IH3 A;  2JRT A;  3KYD B;  3DBH B;  3CCJ I;  5F0H A;  4OIR F;  5HVQ C;  2HR3 A;  2HOS A;  1ON1 A;  2MD5 A;  4OOI A;  2RGV A;  2KP6 A;  2KIF A;  2KLO A;  3KP4 A;  1YS6 A;  2QUF A;  2MW8 A;  1W7P A;  2GXA A;  3OR2 C;  1QHH D;  1S9H A;  1IXC A;  4XL9 A;  4CA0 A;  4OU0 A;  2O0Y A;  2XPU A;  3OS1 A;  3K1P A;  2KPM A;  2L7M P;  2XAH A;  2J5O A;  3E1S A;  5FLM J;  4O5V A;  4UXN A;  3VDX A;  4ANJ A;  3NQO A;  3GLX A;  3PM1 A;  3KEQ A;  2MLG A;  2VBX A;  5D6E A;  3MQ0 A;  5C4X J;  4TV7 A;  3B73 A;  5E8I A;  3E6B A;  1R58 A;  3O8H A;  3IWF A;  4CGZ A;  2DMQ A;  2W82 A;  3K0L A;  4B3X A;  4Q4Z F;  2ME6 A;  1V5E A;  2F5D A;  1KA8 A;  1IDZ A;  1HA8 A;  2ZME A;  4BDY A;  1XMK A;  1MBG A;  3L09 A;  2DCE A;  2DO7 A;  3PNV A;  5IT9 Z;  5F1J A;  1IXS B;  4EAT A;  4KJZ A;  4XQF A;  2XVC A;  3OV8 A;  1BW6 A;  2VOO A;  3O6B B;  5BPI A;  4XOP A;  1YQA A;  1BR1 A;  3CMM A;  1BN5 A;  1MBF A;  1BI1 A;  3FX3 A;  1IAW A;  2WAD A;  1OKR A;  5IY5 H;  2K86 A;  3S3N A;  1WKM A;  3D1N I;  5TRD A;  4PSX A;  1HC8 A;  5LHH A;  2GBY A;  4XLC A;  2L9V A;  3LFU A;  1P2F A;  3BRO A;  1X3W B;  4I76 A;  2M0C A;  5E8G A;  3H3V K;  2E1M B;  1YJN I;  4NB5 A;  3PFY A;  3M8F A;  2QZ8 A;  2LG4 A;  2E1C A;  3LL7 A;  3CMY A;  1MBJ A;  5M5W J;  1SAN A;  4U0V A;  3OYN A;  2UXX A;  4I01 A;  2P0W A;  3KFW X;  2DA5 A;  2PEX A;  3ZMU A;  4AIK A;  2JA2 A;  1EJ9 A;  2E1O A;  4OIP F;  3V7R A;  5E20 A;  1ENH A;  2JQ7 A;  4A3I J;  2CQ7 A;  2ZJ2 A;  4E6K G;  4ENM A;  4DNC A;  2NXN B;  2OC6 A;  2VT2 A;  4GCV A;  4LLL A;  3RZD J;  1WGX A;  3EET A;  1AA7 A;  1JGG A;  1DP3 A;  2DYS H;  4CXF A;  1VND A;  3TOB A;  4OWR B;  3H5A A;  1YOV B;  3IHU A;  2JUC A;  1G3Y A;  3CES A;  2HKX A;  4HF1 A;  2EZI A;  1UG0 A;  2H27 A;  4YFN F;  1RC9 A;  1H89 C;  1ZAO A;  3B6C A;  1HKT A;  3SZG A;  1W4M A;  3LSG A;  1I1S A;  2R5Z A;  4YRV A;  2M34 A;  4RB3 C;  3DTI A;  3SJM A;  1IC8 A;  2IS1 A;  4PK4 A; 
#chains in the Genus database with same CATH homology
 2X85 A;  2VLA A;  4U87 A;  1VZ0 A;  4ZTJ A;  4RLQ A;  2CV0 A;  2VPL A;  2XAU A;  1WJE A;  4ZDP A;  2ZSH B;  1GLN A;  5FRM A;  2M0M A;  4AVZ A;  2M3A A;  2KHM A;  3KYL A;  3S3O A;  2VQC A;  3H5N A;  1WJC A;  3HOT A;  4F92 B;  4JQF A;  2XSJ C;  2KRC A;  2CS3 A;  2VJI A;  5JHF A;  4IKF A;  5CQE A;  3UNG C;  4BQN A;  3J7A Y;  4Y33 A;  4XLH A;  4X0G A;  1P9Q C;  1D1B A;  2VKD A;  3HC7 A;  1D0Y A;  3SYT A;  2QKL B;  3IAM 2;  1W36 C;  3K4M A;  2ELJ A;  4BE1 A;  4J00 A;  2KZV A;  4NC8 A;  3AKZ A;  3L2V A;  2MD0 A;  5FRN A;  3V42 A;  4MLO A;  2JUG A;  2BVL A;  2X6W A;  4KT6 A;  2Z16 A;  3ONQ A;  1N77 A;  1MND A;  2M4K A;  3H9Q A;  3DEE A;  3G2B A;  1WJF A;  2CW7 A;  4BE0 A;  2WAE A;  4CCN A;  3CZ6 A;  3OYJ A;  1PYV A;  2MYS A;  3OYB A;  3VWB A;  3LMM A;  2CV1 A;  4IX7 A;  2KL4 A;  3VYT B;  2V1N A;  3MKY B;  3RCO A;  2LBF A;  2HU9 A;  2M4G A;  1DGR M;  4BAC A;  5HNF A;  3K4J A;  2R7W A;  2DXI A;  2HVS A;  1MMG A;  3ZGK A;  4BJ5 C;  5KNL A;  4E7I A;  2IXS A;  4IQJ A;  2DJI A;  3EUH C;  4PUS A;  2OV7 A;  1D1C A;  3OIQ A;  4HPQ A;  3CJQ B;  5KCM A;  2MAB A;  3W3C A;  3ZQQ A;  2BOL A;  3FBI B;  2AQE A;  2LC2 A;  4HEA 2;  2JSP A;  2X6Y A;  2RQQ A;  4KIT B;  3L2W A;  4OAZ A;  1WJ5 A;  3OYM A;  2Q1Z B;  3OYF A;  1X4P A;  4FET A;  2CV2 A;  3PNT A;  2R7O A;  1MNE A;  4LIU A;  3HL2 A;  3BG7 A;  4DOZ A;  2R7V A;  4DJA A;  1BR2 A;  4P5O A;  2WB1 A;  4BDZ A;  3S3M A;  4N4N B;  3VYU B;  4CCJ A;  4NNJ A;  3DLA A;  3OIP A;  2X6X A;  2WA0 A;  4Y3O A;  1MMD A;  4F91 B;  2VXZ A;  2WAQ A;  4XKB A;  4PFP A;  4BJT A;  4HST A;  1N75 A;  5CQG A;  3OYG A;  2WY7 Q;  5HNH A;  2Z1D A;  4XNF A;  4II3 A;  4XOR A;  1X1A A;  3E0J B;  3I3L A;  1N78 A;  2BW3 B;  4ZTF A;  3PSF A;  3FHN A;  1Z3Y A;  4KIS A;  3KEY A;  2UV1 A;  2PJR B;  4II2 A;  3TBI A;  3BC8 A;  3OL4 A;  3A2K A;  3QOD A;  1WJA A;  2JVG A;  3NWT A;  3ZRG A;  3NWS A;  3MKZ A;  3HUG B;  3QYF A;  2UWM A;  3L2Q A;  3VSL A;  4XKV A;  1BOB A;  4HNT A;  3VSK A;  3BG6 A;  1V5F A;  3HPH A;  4C30 A;  4BXF A;  1DQU A;  3BLY A;  4XLA A;  4D1Q A;  2WY8 Q;  2E5N A;  3W2A A;  4N4O B;  3K4B A;  4F52 A;  4P1W A;  2Q2E B;  2IS2 A;  2VJ4 A;  1EA3 A;  2LRD A;  1WFX A;  4NC7 A;  3AL0 C;  1YE9 A;  4BS9 A;  2DT7 B;  4F93 B;  1SAU A;  3I9V 2;  1W36 D;  1JI8 A;  3TL4 X;  4CSW A;  2R7X A;  3OYE A;  3OS2 A;  4ZJZ A;  3K4C A;  1MMA A;  3S93 A;  3H35 A;  1U0J A;  4BU2 A;  3K4N A;  3IP4 B;  4HRI A;  2L9N A;  4RM2 A;  3VYS B;  3SEZ A;  3MKW B;  2ZXI A;  2W7N A;  2A5W A;  2LYC A;  4JOM A;  1NG7 A;  3H5R A;  1QU3 A;  3SDB A;  2VQH A;  3W2W A;  3M8J A;  1UEL B;  1YX5 A;  2IGN A;  2WBM A;  3A4C A;  3DU5 A;  1D0X A;  4Y4R A;  2X51 A;  3BCB A;  4YEJ A;  1ZEL A;  4BJ6 C;  2QKM B;  3S8P A;  2UUZ A;  4DBR A;  1FMW A;  4DBQ A;  2RRE A;  3OMY A;  2VJ5 A;  1LVK A;  2IS4 A;  4IZZ A;  4XON A;  3DTE A;  3FBN B;  2X1D A;  4E7L A;  3D5S C;  3ZR8 X;  3HOS A;  3K6G A;  4ITV A;  3CP8 A;  4F55 A;  2VAS A;  2CUJ A;  2RNG A;  2CFO A;  3UR3 C;  3L2U A;  4CCO A;  2Z2S B;  3VYR B;  4BUP A;  3S32 A;  4QPQ A;  3RQ4 A;  4GRI A;  2ZFU A;  2CH0 A;  2L9S A;  4C2U A;  3RTR A;  3AFH A;  4DGW B;  4B43 A;  2R4G A;  3QYE A;  4U7B A;  1T95 A;  2L7K A;  3F9K A;  2VJJ A;  1G59 A;  3PL8 A;  4XN3 A;  4D9J A;  3GBG A;  4CCK A;  3A1Y A;  2DOA A;  3OYI A;  3PUB A;  2K5C A;  2PJR A;  4BQQ A;  5KHD A;  4G6T B;  4BEH A;  3MMY B;  2O5R A;  4C2T A;  2VQG A;  1TT0 A;  2K9M A;  3EPZ A;  4E7K A;  2CUZ A;  4OAY A;  3IAS 2;  2LBF B;  5HOO A;  1FMV A;  2HQA A;  3OYH A;  3L2R A;  3H0D A;  4H4K C;  4PFO A;  1WJD A;  2HVR A;  2PMZ A;  1PJR A;  2M7A A;  4RM3 A;  1OR7 C;  4PSW A;  2LY2 A;  3PJR A;  2CMP A;  4CH7 A;  2WAF A;  3LSK A;  2XDV A;  2W1O A;  3OYC A;  5HLT A;  2R7S A;  3HG9 A;  2E1M C;  4XKC A;  2VL8 A;  1X1C A;  3H9G A;  2VXD A;  2V6E A;  4ZDL A;  2R7T A;  2F6C A;  1Z3X A;  2HNH A;  2Y0S A;  3DQV C;  3K10 A;  4HG2 A;  4BQO A;  3ZXS A;  2I8D A;  1MW7 A;  2VIX A;  2K9L A;  4XN0 A;  4XKW A;  3LSH A;  1MMN A;  3H9J A;  2GOX B;  2VB6 A;  1X19 A;  3AL0 B;  4F3Q A;  2IGO A;  3RPU D;  2JVH A;  4CCM A;  4BE2 A;  2HPM A;  2V4J C;  4B44 A;  2HPI A;  4CCL A;  4XM3 A;  1J09 A;  4E4H A;  4E7Z A;  1KON A;  2KQR A;  3QYB A;  4XOT A;  4NUB A;  2R7Q A;  4C9Y A;  3DKY A;  4XMY A;  1X1B A;  2W4S A;  3OOU A;  3OR1 C;  1LDK B;  2HVQ A;  2OUM A;  1Y56 A;  3U21 A;  4LIT A;  4E7S A;  4PJL A;  4RMN A;  2XC7 A;  1BR4 A;  4ZYA A;  4B48 A;  2NOJ B;  4FAS D;  1X1D A;  2MC4 A;  3OWT A;  2VKH A;  2CW8 A;  2L2O A;  3FDY A;  4NQW B;  2HZD A;  2M7B A;  3EUK L;  5CPR B;  2XF6 A;  5FRO A;  1QHG A;  4CZC A;  3K70 D;  2FUG 2;  3PSI A;  3OYD A;  2R7R A;  3DPL C;  3EUA A;  2LRE A;  4E7J A;  5HVQ C;  1E0E A;  3SEQ A;  3K70 C;  3HXL A;  1T0F C;  2ZXH A;  3PNY A;  2KP6 A;  3OS0 A;  2KLO A;  3CP2 A;  3BCA A;  4PJN A;  3OYL A;  2IGK A;  4AU7 A;  3W2V A;  3OR2 C;  1QHH D;  1S9H A;  4XL9 A;  4CA0 A;  2XF7 A;  4LIV A;  2V7F A;  1ERD A;  3OS1 A;  2KPM A;  2GOM A;  1D0Z A;  3E1S A;  2F4I A;  3TMO A;  3CJR B;  3VDX A;  4R79 A;  2AQF A;  4ANJ A;  5LFA A;  2DT6 A;  1YX3 A;  3LSI A;  3DTK A;  5TGT A;  1WJB A;  1R6R A;  3M1C A;  1LKX A;  1DGW Y;  4CUG A;  2MFZ A;  2W82 A;  1SFK A;  4B3X A;  4ZDO A;  1V5E A;  3FKJ A;  2KMU A;  5CKT A;  1HA8 A;  4BDY A;  3HPG A;  2DCE A;  3PNV A;  2IS6 A;  2IGM A;  1OLT A;  4EAT A;  4KJZ A;  4XQF A;  4PJJ A;  4B47 A;  3IUO A;  1LFP A;  3K4L A;  2BW3 A;  3DU6 A;  4XOP A;  1BR1 A;  3CMM A;  4RLF A;  4YEL A;  5LD2 C;  2WAD A;  4AYB A;  3DKX A;  4E7H A;  3S3N A;  3LSM A;  4PSX A;  1Z21 A;  2LY1 A;  4XLC A;  4BL0 B;  3LFU A;  3KX2 A;  4QPO A;  4J01 A;  3C2H A;  2A6T A;  2LOO A;  1Z7L A;  2X1C A;  1NG6 A;  3K4K A;  3HKZ A;  2E1M B;  3MD2 A;  2K3P A;  2W00 A;  3CF2 A;  3PFY A;  2HDW A;  2LG4 A;  3LL7 A;  3RSN A;  2X1E A;  3OYN A;  2BVM A;  3DPT A;  3OYA A;  2XF5 A;  2F5V A;  3ZCO A;  2P0W A;  2E5Z A;  3D5R C;  4DIQ A;  1K6Y A;  1V5G A;  1D1A A;  3DPU A;  4XLF A;  2KDO A;  3OYK A;  3OY9 A;  2JA2 A;  4BGD A;  1X4O A;  4ZC3 A;  3DWL E;  2ZSI B;  2R7U A;  2E60 A;  4HSR A;  4E6K G;  3C2G A;  3OL3 A;  2OC6 A;  1TZL A;  2LH9 A;  1AA7 A;  1DP3 A;  2KRH A;  4XR6 A;  4OWR B;  3H5A A;  1UAA A;  1IRX A;  2V9K A;  4PJM A;  3CES A;  1G8X A;  2V26 A;  3QOE A;  1UG0 A;  4BEH B;  4HNU A;  4XLE A;  4LG3 A;  3N05 A;  4IQ4 A;  3SZG A;  3LSG A;  4YRV A;  1Y6I A;  3DTI A;  2IS1 A;  2VQL A;  4PK4 A;  2L5Q A;  3D5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...