3M8JA

Crystal structure of e.coli focb at 1.4 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords FocB protein
publication title Structure of FocB - a member of a family of transcription factors regulating fimbrial adhesin expression in uropathogenic Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03333 PapB Adhesin biosynthesis transcription regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3m8jA00
2W7NA 5CKTA 3M8JA
chains in the Genus database with same CATH superfamily
1STZA 2MYSA 2CV0A 3EUKL 3ERMA 3CMAI 2LD5A 4JOMA 3REOA 4BE0A 2WC2A 1ZKGA 1T95A 3OIOA 5FGMA 4ZTFA 2O7OA 1YX5A 4RAZA 2DT6A 2EFPA 3F8NA 2Y75A 4U0WA 4HNVA 3EPZA 2I5UA 4UV8A 2JRMA 2O3FA 1OPCA 2HFHA 2WV0A 3B6CA 3J80K 3JR9A 4GGGA 1F36A 1TTYA 4H4KC 2GZWA 2IRFG 1HW5A 4CGZA 3DTKA 4D9JA 3E1SA 3QU3A 2XPUA 3BG5A 3DTEA 5TRDA 1WVRA 3W6JB 4CH7A 3M8FA 1XPXA 1IN5A 1XC5A 5IYCJ 4E7KA 1HSTA 1V5EA 4F7ZA 3I9V2 2K9NA 2DFEA 3E5UA 5EEHA 3T8RA 3ZMSA 2WAFA 3GVAA 4EM2A 1R4NB 3EUHA 4CCNA 2QKMB 2LMDA 1UHMA 1Z3YA 1JJ6C 1IRGA 3HRMA 5KHDA 3IAS2 4FE4A 4CICA 3K6GA 4RLFA 3VYTB 4NHJA 2IGNA 2PX9A 1K78A 2EFNA 1JUMA 2OU2A 4D5FA 4WX9A 1LFPA 1D1BA 1P4WA 1TC3C 2E7XA 5BPDA 2V1DA 3RPUA 4HLXA 3VODA 2XVCA 4IHYA 2L9RA 2J5PA 2VKHA 1G3YA 1SAUA 2DMTA 4PJMA 2ZO4A 4EMSA 2DDBA 3KLOA 4DGWB 1MJ9A 4HEA2 1JT6A 1WH7A 2LYCA 1K6OA 3FZVA 5HS8A 3LMMA 3PNVA 3FHNA 1SFKA 2E1CA 5LHIA 1ETQA 1QA6A 3SHFA 2ETHA 1ZGJA 4MLOA 4GO1A 3CCEI 4Z2YA 2VKVA 5D4SA 3GLXA 2V26A 3ABTA 2ZJ2A 3HHHA 5HS7A 3CF2A 1GLNA 1WJFA 2TDXA 1TLHB 3IH3A 1K78B 4A93J 3ZOBA 1KU3A 1IXRC 2XF7A 4RM2A 1G59A 4DYCA 3L9FA 3KZYA 1DQUA 1ZH5A 2YPRA 1YW8A 3I4PA 4Y15A 3M4OJ 5LFAA 1OCTC 4JX5A 3WE2A 4X6AJ 1XDUA 5DV5A 4FASD 3G1OA 3BR2A 5TISC 2GWRA 3MWMA 1U8RA 1V54H 3NEUA 4E4HA 1G3TA 1Y0UA 4KT5C 2W82A 1R6RA 2VLAA 3JRHA 1PVEA 2VC0A 1BJAA 2OF7A 3BP8A 5J4VA 1T0FC 4I99C 3RSNA 5B5EC 1A36A 2W4SA 4GDFA 2NOJB 4U7BA 2HVRA 1KU7A 5ERIA 3WE3A 3CJQB 3CQZJ 4Q4ZF 5IPAA 1X4OA 1Z7UA 5F0FA 2VC1A 3QODA 3QU6A 4I01A 2LH9A 2K9LA 4PK4A 1Y8QB 4WCGA 4IHTA 3WTTC 2LF8A 2PJPA 1SEUA 2HTJA 1CQTA 2K4BA 2C6YA 2H27A 4O6JA 2E5NA 1TQPA 3F8BA 1MBKA 3QYBA 2XF6A 2M0CA 4AUXA 3QPSA 2JZYA 2Q0OA 3O6BB 1QU3A 4IZZA 3LSIA 2E1NA 3CCYA 4NQWA 1UCRA 4YFNF 3ESWB 2DA5A 2FA5A 2MLKA 4BYYA 3IKVA 2HXOA 1UMQA 2X48A 2VJIA 2K9MA 5LRSA 2IAIA 4HV5A 2K86A 4XBFA 2VJ5A 3QP5A 4FE7A 5H20A 1MMDA 3I5UA 1YJWI 5EG0A 1A6IA 1R58A 2KP6A 2DI3A 4CDGA 2ZCWA 3F8CA 2XC7A 2G0EA 4BY1J 3K9TA 1BI0A 4UUSA 1H9GA 2KJCA 3I3LA 2PMZN 4CUGA 2ZNZA 5FRNA 2L7FP 2DT5A 2P5LC 3FXJA 4RMNA 1SFOJ 3BJ6A 3VYSB 2KISA 4N9IA 5ICCA 1DU0A 1U5TC 4NQWB 4RB0A 3I56I 2RGVA 1WKMA 3BOQA 2WWYA 5L3BA 1YHQI 2ZKZA 2HYJA 4GCVA 4DJAA 1UHWA 3NRVA 5DEQA 3VFZA 2VQHA 2VBZA 5DUIA 3BG9A 4NUBA 2UUZA 2P5KA 5CYVA 2D1VA 1BOBA 2R4GA 3H9GA 5EG0B 3LSRA 3OV8A 2BXZA 1BL0A 3RKXA 1BW5A 1R49A 5E18F 3C2BA 1IRFA 1WGXA 4UUSB 1BR1A 1GDTA 3BG7A 3F8FA 1E17A 4KYWA 2DJIA 4ENKA 2BY1A 4A5MA 3ZGKA 1T56A 1HDPA 2IGOA 1KGSA 2DAOA 3T8TA 3K70D 2JA7J 3IP4B 1KQ9A 1QPMA 3A02A 2DBBA 5E3MA 2ZXIA 2KRCA 1NK3P 2HEOA 2AQFA 3LSJA 1T2KA 3G71I 4HNTA 2ZSHB 2XGDA 4M74A 4LG0A 1D0ZA 4L9TA 2HQ5A 3PJRA 2B0LA 2MC4A 2M2EA 2QVOA 4RDUA 5M5XJ 2D5VA 3G1LA 4ZDLA 2I10A 2VPLA 1LJ9A 2CQKA 1ZARA 1HXDA 1FOXA 2KQRA 2OZ6A 3GTKJ 2V1XA 5BMZA 2W24A 1S9HA 4XOPA 4M3DA 2R7TA 1YS7A 3PQJA 2O8XA 3RDIA 4EV0A 2K7LA 1MMGA 5ILSA 4LK1F 2KJBA 2JN6A 5K7ZA 2JPBA 2EINH 4Y17A 2HVSA 3V4GA 1VQ9I 5DUKA 3CUOA 2R7FA 3WGGA 1FOYA 4A0XA 2RV8A 5LHGA 3VWBA 4LG0B 2K02A 2EB7A 1FIPA 1R1UA 1F43A 4JK1X 4GXOA 3PIOF 3GXOA 2DA3A 4CZZA 1WCMJ 3BG3A 2GAUA 3MKWB 1Y8RB 2V9PA 1U9OA 1TWHJ 2VBWA 3BG6A 3V7SA 1FTTA 3OS0A 4BJ5C 4I98B 4XMYA 3VYRB 3F21A 3RZOJ 3S32A 3VDXA 1MBGA 3GW2A 1D5VA 1BIBA 3T1BA 2L9NA 1R00A 1S72I 2ZJQF 3RYRA 2LSOA 4PGHA 3UR3C 3IH2A 2WBMA 3P5JA 4ABZA 5C4JJ 3S1RJ 2R5YB 2CV1A 1K7AA 3I0TA 2HWVA 2RQQA 3DXJF 5CJ9A 1BOAA 1HDDC 1NH3A 4D0PA 3J7AY 1IJWC 1LDDA 5D5VB 3CDIA 1R1VA 1H8AC 3BWGA 3GCMA 1O3RA 4ZDPA 2LY1A 1BC7C 4RA2A 1QVTA 2FF4A 3OR1C 2MA3A 4J00A 2CYYA 2A6TA 2NNNA 3RPUD 2VB6A 5DD8A 3H9JA 2L7MP 5EZHA 2L4AA 3F0CA 2DA2A 1DP3A 3OYNA 4DBQA 3CDHA 4KISA 3GZ5A 3S93A 1W5CC 1K6YA 3M8EA 1MMSA 4B48A 1U9NA 4RAFA 4ESJA 3BROA 1VQ6I 2E1MB 2VUMJ 2LREA 1LEBA 3SZTA 2ISYA 1B8IB 5E8IA 1J75A 1D0XA 2K4JA 5JHUA 5FJ8J 1DU6A 1SD5A 1YFHA 4ENNA 9ANTA 4F52A 2H6BA 3MKYB 3WG9A 4YFKF 1K4TA 1B72A 4I76A 1Z67A 1VI0A 2JK3A 5ICEA 1JT0A 2EV6A 2N8GA 3K4KA 2ISZA 2M4KA 4XONA 3OS1A 4HSRA 3HRTA 3D0SA 4P55A 4HDVA 3BPXA 1J2XA 1P6RA 3IH4A 4XICA 2OTLI 5CLSA 3S14J 3AL0C 2R7VA 2L9VA 4ZZLA 3P9CA 4KIBA 1TNSA 5DTDA 1OKRA 4AD9A 1K83J 1TNTA 4BDZA 3NAUA 2DPUA 2IS6A 4DYQA 1IUFA 3K4MA 2HOEA 3MD2A 1RUNA 1MW7A 2EQRA 2PBIA 1O57A 3K1MA 3R0JA 4BS9A 2BY0A 1K79A 4KIFA 1ZR2A 3E6MA 4RS8A 2M7BA 4OAZA 4BH9A 1RNLA 3F6VA 3C7JA 3KPHA 2FNPA 3PM1A 4IVNA 2JSCA 3H5AA 4F92B 2E2HJ 1X2NA 1B72B 1VQ4I 3CCUI 1KU9A 3E0JB 3S2WA 3GTPJ 1ZRDA 4N9HA 3GZ6A 2O03A 2KKOA 4A3LJ 5A2QK 3FXQA 1N25A 3ZMDA 2M87A 2RDPA 2ECCA 1TT0A 1B6AA 5E1WA 2HKOA 4RGRA 3MKZA 2LKSA 3HSFA 4HZFA 4PCQA 4E7JA 3C3WA 4QPOA 4GFBA 4D7NA 3BZ6A 4I0AA 1JGSA 5LD2C 1YJNI 3JRDA 2MBFA 1Z91A 5ICFA 3W6KB 1GV5A 2W57A 2CWEA 3HOSA 1ACIA 2JUCA 3MZHA 3ABKH 2HKXA 2ZMEA 3ZMUA 4BL0B 2LP0A 5DD4A 4IHSA 2P4WA 3KP5A 2E7WA 1KA8A 2IA0A 2VQGA 4UB6C 1SMYF 3OYGA 3TEDA 1IDZA 5DDGA 3DKYA 2M45A 4EGYA 1HCRA 2VJJA 4GRIA 2HS5A 1APLC 4MTEA 2OQGA 1GHCA 1ETKA 1MNEA 4G9YA 2ELKA 2DQRA 2F5DA 1G3SA 4KN7X 2XROA 3CO7C 3G3ZA 1YLFA 1YW7A 2EPFA 3CP2A 4WXCA 3MAJA 3ERED 1V5GA 5K5QA 1G2HA 4P9FA 1R22A 4LLGF 1XSDA 3E5QA 3P7NA 4E7HA 2KDOA 3BR6A 2PLYA 2WTEA 2MD5A 3HG9A 2ZMEB 4AM3A 2VI6A 2VQCA 3J7ZI 1BR4A 2VXZA 2EIMH 1MMNA 1Z1DA 2UXXA 3GTGJ 2O0YA 2VE8A 3HRUA 4KMUX 1VQPI 4Q47A 4LB5A 1B59A 4B43A 1JKQC 5B66C 3IC7A 2Y9YA 3HTUA 2L01A 3L00A 4RGSA 2FNAA 3O8GA 4DNCA 5AIPA 1J59A 3OYMA 1FSEA 3OYHA 2VN2A 3EYIA 2UXNA 2IS4A 1YI2I 1TP4A 2NS7A 3KIOA 2GM4A 1S6LA 3BT9A 3K4JA 1Y56A 1MBJA 3V42A 4BHPA 2Z33A 2J5OA 2FJ1A 2CJJA 5F0CA 4C3HJ 3G1MA 3GTQJ 1MIJA 1MGTA 3IL2A 3ZP5A 4HPQA 2HQNA 2KIUA 1ORKA 5ILUA 4C3JJ 3FBNB 1V3FA 4EVIA 3SFZA 4CSWA 3CCLI 1R36A 3A03A 1QHGA 2XKOA 2DMNA 2Z2SB 1Z3XA 4XLHA 1GXPA 3MKLA 3OMYA 5IYBJ 2W85A 1Z7LA 2AO9A 5HLTA 1MKMA 5E3OA 3MVPA 1Z77A 3WG7H 3V8KA 2VOOA 3F23A 3ABUA 1BN5A 5B1AH 1VQ5I 3VSKA 2M34A 4YIFA 2P6SA 1E3PA 4RB2C 3K10A 1U78A 2V6EA 3S2HJ 2ID3A 5IYDJ 3JW4A 3BR5A 3ABLH 4ZJZA 1HW2A 3GX4X 2CS3A 1YRNA 1PYVA 2QQBA 1SANA 5CVVA 5HDKA 1F9NA 2HVQA 1XDSA 1B9MA 3G6EI 1ZQ3P 4L18B 1S8NA 4CO8A 3BLYA 5ED4A 1O3QA 1ODDA 3HPHA 4M73A 5BOXA 2H8WA 3CO6C 2M4GA 2LOOA 2W7NA 2A07F 1Y39A 2E19A 2L02A 4HOBA 4AWXB 3PUBA 2E1OA 1FWZA 1XGNA 3OR2C 2HDCA 1BA5A 1EV7A 5GAEJ 1T6SA 5E17F 5J8FA 1EF4A 2HPIA 5LHHA 3RJPA 2BXYA 3Q0VA 2CRGA 4K2EA 5KAFC 2FBKA 1XGSA 5HOOA 3ZN1A 4PZJA 3ZMZA 1FYLA 4U88A 2KZVA 1W36C 1FBSA 2Q1ZB 2OQRA 1TWGJ 1RRJA 1JTXA 1YRNB 5FD5A 4D5CA 1XX5A 1IW7F 1ZGAA 3IV5A 2DTRA 4XKVA 1P9QC 3WU0A 4E6KG 5JHFA 2DK5A 2ZJRF 1IGNA 3KFWX 1OISA 3M07A 4UHTA 4E70A 2B63J 2XRLA 4KNYA 5DM7F 3ZQ7A 2IT0A 5JVGF 5IT3A 3DF8A 2DMPA 3V7RA 2OAZA 2HPMA 4UY8I 1I6HJ 1N77A 2YUSA 1U2WA 1JUPA 2VJ4A 1XMXA 1X1BA 4ESFA 2JVGA 2EZKA 4I6ZA 4F3QA 3A0HC 2XGEA 3AG4H 1IDYA 3MCZA 1R1TA 1WJAA 2E35A 3MQ0A 1B9NA 2LNBA 1J5YA 2VODA 2DT7B 5EZGA 4I7HA 2Y0SN 1E3HA 4PJLA 2P5VA 3OYAA 3GYHX 3CCVI 5FO5A 2M7AA 4KUMA 4A3JJ 3FK6A 5IP7J 4KA4A 4A3GJ 4KITB 4HG2A 2WY8Q 4G6QA 5K5RA 5M3FJ 3C2GA 4IF4A 2KRHA 3JAMZ 1FBQA 1OFCX 2CUEA 1GV2A 1BW6A 2R92J 2X51A 2BE5F 5LLQA 2NVYJ 4MIMA 3JRAA 3CDLA 2QQ8A 4DZJA 1UZCA 2XAGA 1ENHA 2XAJA 5BQTA 5JVTA 3GZNB 5C44J 5DCFA 2DFIA 2WAEA 5J6XA 4MFDA 5JR3A 4C30A 4UUTA 1J9IA 1BIAA 3PNYA 4G94A 4P5OA 1FLIA 1YYVA 3ZQLA 1XMAA 3ABMH 2KIQA 2OD5A 2VPRA 4G8XA 4RAGA 4YG2F 5C4XJ 2HOSA 3DEUA 3I53A 1SFEA 2VBYA 5L3DA 5TGTA 2K5CA 3TW7A 3SQNA 3ROUA 2JVHA 4PGGA 4KT6A 2XRNA 2YSRA 3WTXC 2R7WA 2OCCH 2QSHX 4EATA 1FY7A 4A3KJ 4LITA 3CUQC 1A6QA 4FETA 3KX2A 1L0OC 1UFMA 2FMLA 3E97A 3J80Z 2M5WA 4L9JA 1GXQA 3DU6A 4RLQA 1ZTRA 4TV7A 3ECOA 4QLCU 3RI4A 1WSUA 3E5XA 3VB2A 2BEOA 2NYXA 2RNJA 2PMUA 2F5VA 2M3AA 4ZTJA 6PAXA 3HC7A 3FK7A 2MGQA 4M9ZA 3TL4X 4DOZA 3HL2A 3CC4I 3VOEA 4A3IJ 1IG7A 1I39A 2YS9A 3TOAA 4E7LA 4MGRA 5HVQC 1H9TA 1UELB 3OIPA 1O7LA 1SAXA 4BE1A 2NVQJ 3IRRA 1YOVB 2YU3A 3EUAA 4XLFA 3TW6A 4B4CA 2LFBA 2Z1DA 3DLAA 1I27A 2CFOA 3JRBA 1BM9A 2MSYA 2XAFA 3CC7I 1P92A 3DBHB 3F8MA 2VOPA 4FISA 1Q1HA 2COMA 3S1QJ 1W7PA 1VQNI 2AS5F 3U21A 1FYKA 3O3KA 2ESHA 2VT2A 1G4DA 5EJCA 3N05A 4JYKA 1SVMA 2CQ7A 5KNLA 4IPAA 2QM3A 3JTGA 4HSTA 4HLYA 1PUFA 3HUGA 2PMZA 1FMWA 2HQRA 1V4RA 2XUBA 2L7ZA 1O3SA 1HC8A 2ACJA 5DCMA 3QQAA 3CESA 2MFZA 1JI8A 2GOXB 3ASOH 3H3UA 4A12A 4G7OF 1KU2A 2ZJPF 3KP2A 2A61A 1TQMA 3LWFA 1HKTA 1GVJA 3NWSA 5D5UB 2VONA 3H5NA 1TT5B 4W97A 3L2RA 3WU1B 2ADUA 1Z6TA 2NS8A 2RKHA 2DMUA 5H6QA 1SD7A 2R7ZJ 1R4MB 1W7PB 2V6CA 4UB8C 3OYFA 5F64A 2XPVA 4KFCA 3FIWA 2Z99A 1A31A 3A01A 1Z0XA 3H9QA 3IWFA 1PUFB 2OC6A 2ME0A 4N0BA 3EDPA 3OYDA 1SVOA 1JKRC 1Y0NA 3BR1A 4AYBA 4M9SA 3JREA 2GA1A 3VYUB 1LVKA 5LGTA 3BTJA 2W25A 2XIGA 5DCMB 1MNMC 3K2ZA 4HA8A 2MABA 1U8BA 2DK8A 1LPQA 2XPWA 3K1PA 2NS0A 3TDZC 1DGRM 3ZQIA 4NC6A 5H6RA 1ZG5A 3T5XA 5HDNA 2CW7A 4X0GA 1EJ9A 3A2KA 3JRFA 2EV5A 5B1BH 1R5GA 5TJJA 1MSFC 4ENJA 3TP0A 3S1MJ 2WY7Q 2JA8J 3BZKA 3FXUA 5GP9A 3DCFA 4XSZF 4YELA 2LRDA 1IF1A 2DXIA 1G8XA 5JFRA 4HX8A 1MH4A 2JSPA 4NBQA 3TO7A 3HIFA 3HM5A 3C18A 5HLIA 1VQKI 1ZK8A 4IX7A 1W5SA 2ELJA 1I5ZA 2V1NA 3KP4A 4FQGA 4LG3A 5GPAA 4BNCA 2QEXI 1HF0A 2M8EA 4RB1A 2R93J 1LKXA 2EZLA 2FBHA 4IHVA 2JMWA 2KIMA 2GBYA 2JT1A 3VPRA 3CMEI 2OUMA 1U3EM 2D1HA 4Y13A 2CH0A 2X1EA 4PJJA 5J3LA 2JA2A 3MZYA 2IA2A 2KRFA 3OIQA 3Q9SA 5F0HA 1WPKA 1HW1A 4WXDA 3GFIA 5CVUA 3C2HA 1FSHA 2F5CA 3HHGA 3X2QH 2WB1A 4HF0A 5GAGJ 4QIWN 4ZYEA 2VXDA 4YIRX 4MFEA 4HF2A 1AHDP 2ZFWA 2CO5A 3FM3A 4OWRB 3NWTA 5IOYA 1LQ1A 2VL8A 3K1NA 3D5RC 2XHKA 3H5RA 2LY2A 5FKOA 2OA4A 2UV1A 3J81K 1JJ8C 3SZPA 3NQOA 1RPWA 2R7SA 2ZXWH 1XSXA 1YG2A 4F55A 2FEZA 4Q5SF 2YR2A 4XIDA 5GADJ 1I3AA 2HOTA 4LD5A 1JUSA 1ZLJA 4CA0A 2V7FA 3AG2H 2FBIA 4A3EJ 3IWZA 3WGHA 4G12A 4DW6A 3AFHA 4V2FA 4BY7J 2IXSA 1J0RA 2XGXA 4L5JA 2V9KA 1FOKA 3HTSB 1KYWA 1OCZH 1VQ7I 4IRGA 3H35A 3DKWA 4XRMA 2LKPA 4QWQA 4EJUA 1V55H 3ECHA 3CD6I 2I8DA 4XRFA 3H3ZA 4EM1A 1RETA 1XN7A 2R7QA 3GF2A 3JCUC 1SD4A 3V8LA 1IV6A 1JHHA 1WQ2A 2F6CA 2HZDA 2QSFX 4MQ9F 2KPMA 4XN0A 4B3XA 4ZYGA 1W0TA 3S17J 4A3CJ 2IJLA 1QZEA 4M71A 3GTMJ 1T0FA 1HBXG 3GTJJ 4L0ZB 2QA4I 1ZHFA 2LK2A 2Y31A 4ETSA 3W2WA 4WWCA 2CGPA 1SMTA 2IS1A 1QRYA 2K9QA 1EA3A 2BW3A 1MDMA 2OBPA 3TBIA 1MSEC 4C9YA 1D1AA 1R23A 2RVCA 3PL8A 5E3NA 1X1PA 1IO2A 3HSEA 4BE2A 4XRSG 4BJTA 2Z5UA 3I4NJ 3CJRB 5L3FA 2A5YB 1R5ID 1G6NA 2W1OA 4E7SA 2GA2A 2E2IJ 3W3CA 3U1DA 4IOAF 4IXAA 1MJBA 2CW8A 4GYGA 1IN8A 2GXAA 4M9XA 4OMZA 1LDKB 2HZTA 1Y1VJ 3BR3A 3LQQA 1JKPC 1IXCA 4C2TA 1ETXA 2FRHA 5ICGA 3A1YA 2FUG2 3WTWC 2Z16A 4P9UA 2IVMA 2LLKA 3MN2A 4QSHA 4OAYA 2X1DA 4DIQA 4BUPA 5FB2A 4OIOF 2FQ4A 3R61A 2EK5A 5FLXK 2JPCA 3MZ8A 2AXTC 1YIOA 2M0MA 3JRIA 2O5RA 2BW3B 3E7LA 3OYJA 1ZN2A 2G7HA 5LEKA 3K4BA 3I59A 2GQQA 1X4PA 2RQPA 3IAM2 1T8IA 5AONA 5J8CA 4CYCA 4IHXA 2F5FA 5FROA 1O3TA 2AHQA 1FNNA 3KEOA 1SFXA 3I64A 4XORA 3IUOA 4S0HB 2EJRA 3S15J 4G6DA 3TDUC 5E79C 1FC3A 3OYCA 2RC4A 3BJOA 4HV6A 1ETYA 3PSIA 3J7AO 3JTHA 2CU7A 4QPQA 2XKPA 1BC8C 2JTVA 5CVJA 3FX3A 3AG3H 1U5TA 2A05A 2E5ZA 3BQYA 1ITYA 5K5OA 4ASNA 3J7YJ 2DOFA 3H92A 4M3EA 4R8HA 3LSGA 4Y33A 3F22A 2H1KA 3HOYJ 2R7XA 2KMUA 1RR7A 2WADA 1XB4A 2BOLA 4B09A 1SC7A 2D2WA 2DOEA 2DFFA 3I71A 3L2VA 4P96A 4IHWA 2X4HA 1RI7A 2IP2A 5F08A 1FP1D 3KZIC 3E3VA 1FIAA 3SEZA 1EKEA 2HXIA 2JWTA 1HLVA 2QLZA 5IT9K 2NAZA 3WTZA 2L5QA 2GOMA 3GO5A 1YW9A 5FFZA 4CYCB 4MNUA 2DA4A 1QHHD 1QVUA 2DODA 2R7UA 1ON1A 1XTAA 2DFHA 3K4LA 4BU2A 3KE2A 2COBA 2BVLA 3LSTA 2MW8A 3F3XA 3O8HA 4IO9F 5HODA 3FBIB 5EYRA 3DBRB 3HOUJ 1U5TB 1LVAA 1W7PD 5IP6A 4BXFA 1ULYA 3DKXA 4PSXA 4U0VA 3EUHC 3M9AA 1X3UA 5EF6A 1S7OA 1RUOA 3H3VK 1TZLA 2F4IA 4IKFA 1QNTA 2CUZA 2E34A 3LFUA 1BI2A 4B1RA 2L3DA 1MBHA 3E6DA 2E2JJ 1J09A 5DM6F 1RZ4A 4JX4A 3CMMA 1TWAJ 1HSJA 3HKZA 3KZZA 3TQNA 2DTZA 3I58A 2JA6J 5M5WJ 3M3YJ 1W5TA 2M9HA 3AG1H 4XK4A 3RYPA 4M6YA 4YEJA 4UVBA 4ENMA 3D5LA 4EJTA 4H0EA 4HYEA 4A5NA 3DEEA 4BQQA 3IRQA 1R7JA 2QSGX 2XAHA 1DDNA 4M3BA 4ZZDA 4N4NB 1HQCA 1X3ZB 4A2UA 4J01A 2NRAC 3ULQB 2QENA 3RQIA 1DUXC 3CLQA 4KDPA 2VE9A 3TO9A 1KONA 3M7GA 4PJ0C 2RN7A 3DPTA 4XKWA 4DZPA 2X1CA 3S8PA 4A6EA 3H0DA 4II2A 1FOWA 2PEXA 3HOZJ 2BYVE 2FE3A 5D5WB 1PDNC 3B73A 2R5ZA 2P6TA 3PNTA 4FTHA 2O8KA 1NHAA 4RM3A 4BQOA 2UZKA 3GFLA 1KQ0A 2IA1A 2DA6A 1VQLI 4MEXF 3PO3J 3FXLA 5BS6A 2MH9A 2OJED 4P1WA 3DTIA 3WGIA 4M72A 1ZRFA 3HOWJ 5DYMA 5LGNA 1YIJI 3CCSI 4OOIA 3OWTA 1N78A 1IV8A 4JP0A 1M1EB 3SFIA 2F4MB 3UNGC 2X9DA 1KZHA 4S04A 2JQ7A 3RZDJ 4G7HF 2FXAA 2X0LA 1AWCA 3WHBA 1TW2A 1TW3A 3WHCA 1WJ5A 5A2QZ 3HOVJ 2QCOA 1JTYA 1X1CA 1T33A 1ZGWA 3W6VA 1OCCH 1JGGA 1D0YA 5H2FC 4KJZA 3RCOA 2BHYA 3OYEA 3OL3A 2R5ZB 2A6HF 2FOWA 2HNHA 2RAEA 3ONQA 4LJZF 4MO7A 3WTUC 4NNJA 3C1DA 1PUEE 2L4MA 3CCRI 3AAFA 5D8LB 4XSXF 2PI0A 2XGCA 3A4CA 1CGPA 1Z6RA 1YX3A 2KZGA 1WJCA 3M8JA 4IRHA 3MMYB 2ZXJA 1S5LC 2ME6A 5F1RA 3COAC 1EH8A 2EFQA 4R1HA 1UHSA 2WAQN 1HA8A 1QPIA 1O7FA 1ETVA 4BACA 2LR8A 3BCAA 4A3FJ 4IEJA 2WV1A 4XN3A 3G2BA 5CQEA 3CJNA 2LY9A 3GTOJ 1W0UA 1LEAA 3OY9A 4A3BJ 1RKTA 4RBOA 1PP8F 3FXKA 3WU2C 4UVAA 2NVXJ 2YU9J 2Y69H 4BXUA 1T98A 1UB9A 3PUFA 3L7WA 1NG7A 3K7AJ 5HNFA 3BTIA 1FBUA 3I54A 3QPHA 3EQLF 5D4RA 3L09A 3S3OA 3R4KA 4OIQF 1ON2A 1NK2P 2EFWA 2IS2A 3KP6A 5FRMA 1S29A 3K2AA 1HKSA 3OYKA 1E0EA 1IRXA 1ZRCA 4BQAA 5KAIC 1WZ2A 1YE9A 3FXRA 3KEYA 5GPCA 4XLNF 1XGOA 4UV9A 3HBLA 4AIKA 2ESNA 4CYDA 2DYRH 3U2RA 3OSFA 2EZHA 3GFJA 4HX4A 2O61A 4ZYDA 4CCKA 3W2AA 3SXYA 1S7AA 5J4YA 2E71A 2Z3YA 2Y0SA 2DW4A 3SDGA 4FCYA 1A35A 2W00A 2NVUB 3CF5F 3SYTA 3S2DJ 4HNUA 3LAJA 5F6FA 4CCOA 3BR0A 4G6TB 4D1QA 3FMRA 2LBFA 4L5EA 2K9SA 1ZYRF 2BBYA 1SFUA 2KFDA 2QWWA 5D6FA 3WTYC 4HF1A 4OIPF 4LK0F 1P7IA 1OLTA 3HXLA 3OYLA 5IOZA 3Q3SA 4A69C 2ZB9A 2LVSA 2ZNYA 2HQAA 2QQAA 1OQYA 2BHZA 4UXNA 3K4CA 2VASA 4BGDA 1ZR4A 3QP6A 1O4XA 1RIOH 3AL0B 2CFXA 3FMSA 3L2UA 1MH3A 2XSJC 1OYIA 3GFMA 2Y48A 1TQIA 2B7EA 2PQ8A 2R7DA 3B6AA 1TWFJ 3PFYA 5J1YA 1JE8A 3ZQGA 5CKTA 2OTJI 1ETOA 2FU4A 4XR6A 1UJ8A 4OINF 1VQMI 1F4KA 2EZIA 3ZMVA 4A3DJ 1BI1A 1QO0D 3M1CA 2ICWG 3LA2A 2LBFB 1D8JA 1Z21A 3PSFA 1U6GA 2LDUA 1TL8A 1B4AA 3UKGA 1IC8A 2B9SA 4PDKA 2P7VB 3S3NA 4UUVA 3WTSC 1VNDA 1I6XA 2VQLA 4L9VA 1OR7C 2L9SA 4EQQA 3RKWA 2Y30A 4BKXA 5CVIA 2OZUA 1ZREA 4WXHA 3S3MA 1D3YA 4EM0B 2DYSH 4GYIA 2R7RA 1QZYA 4BXXJ 3V8JA 1V5FA 5FLMJ 3Q0WA 3ASNH 2BY3A 4FX4A 5FLVA 2BVMA 3DV8A 4ZDOA 1IUYA 4AIDA 3GWZA 1IN6A 2EIJH 2KIFA 5BNGA 2A68F 2IEKA 1B1BA 1XSVA 4IL6C 4UVCA 3ZMTA 4A0YA 2CQQA 4HDUA 1MNDA 1YS6A 3ZQFA 4BBSJ 1X3WB 2Y9ZA 3H36A 1AOYA 4HX7A 4HQMA 4EJWA 2KL4A 1I1GA 1R71A 3TOBA 4EJOA 2PN6A 2LTPA 2HU9A 2GXBA 3L2WA 3K0LA 2L2OA 3LSMA 5BPIA 1Z9CA 3IHUA 3WTVC 4EGZA 4UNOA 1IN4A 4FHTA 2KLOA 2KT0A 4PJNA 4MHGA 3KP7A 5K7FA 3DFGA 4MTDA 2PJRA 3EETA 1F5TA 2P81A 3LQRA 1AKHA 4XOTA 4RAYA 3QOEA 2DCEA 4I0BA 2E1MC 1BBYA 4Y4RA 1WH5A 1H0MA 1KQ8A 3Q9VA 2AQEA 3TP3A 4L9NA 2K40A 1T38A 2XSDC 2NVTJ 2GLOA 2ZFUA 2XAUA 4U87A 1YITI 3DLLF 3Q5FA 4NC7A 2HI3A 4LIVA 3GLLA 3LAPA 4V2GA 2XAQA 1P7JA 1IN7A 4AIHA 2YX7A 1IZ1A 3N97A 1FX7A 2BGCA 2LF7A 1ERDA 3HGGA 3AKZA 2FOKA 4ITVA 1KYZA 1PP7U 3ZRGA 1OYYA 4C2MJ 4A3MJ 2EILH 4R79A 3OOPA 3HPGA 2PJRB 1YQAA 1YTYA 3PO2J 1AKHB 4RB3C 2DPDA 5EGOA 3KYLA 4EJVA 3O2PE 4B8XA 2P8TA 1H88C 2QKLB 2CUJA 3S1NJ 1FT9A 1AU7A 1AA7A 3HUGB 4BHCA 3CMYA 3LSKA 2VBXA 1WI3A 2PFBA 1Q1VA 1S7EA 3M1EA 2V9VA 1QGPA 4B47A 1VF9A 2QZ8A 4IQ4A 2V1UA 1TBXA 4OIRF 3LSHA 5HLHA 3HGYA 3OSGA 5IP9J 2FD5A 2Q8KA 4Q48A 2HYFA 1WJDA 3OOUA 1I1SA 5EEAA 2V79A 3CTAA 5ILVA 2A3SA 4LFUA 3RQ4A 1YJ9I 5HS9A 2G9WA 2IGKA 1R5HA 4LLLA 2QUFA 1LFUP 2IW5A 1NG6A 1MD0A 3FF5A 4NC8A 2R7OA 3CLOA 5E3LA 3ZXSA 2JJ7A 3FHZA 1WI9A 5EGOB 2Z9OA 2ECBA 4PSWA 3A0BC 1RR8C 2KDZA 3OYBA 3HJEA 3VSLA 3DEWA 3A01B 3CCJI 4JBAA 3GBGA 2G7UA 4JQFA 2R0QC 4X1EA 3JSPA 1CF7A 3ZN0A 1L3LA 2XB5A 2K3PA 1WWXA 3HZJA 2Y2ZA 4BDYA 1OJLA 4XLPF 4AYBN 3DP7A 4XL9A 2Q2EA 3HRSA 1TWCJ 1K4SA 4LB6B 4BAYA 4CCMA 2A5WA 3DPLC 4L5IA 3QAHA 5HDGA 3CP8A 4AC0A 3P9IA 5CPRB 5J40A 5J47A 3B02A 3LSPA 3ZQCA 1A5JA 4W1UA 3TGNA 5KVRA 3PFIA 5B3SH 2ZMEC 1DGWY 1REPC 3QOPA 4PFPA 2XB0X 1GUUA 5LGUA 3SZGA 1I3QJ 3OS2A 3LNQA 4XNFA 4F91B 4WK8F 1GT0C 5CVRA 4OU0A 2EA2A 4O3MA 3FWEA 3R6SA 3F6OA 5GTIC 1Y1WJ 1K61A 2P0WA 1T08B 3R60A 5FKNA 1CF7B 4RGXA 1Y6IA 1HOMA 4LOCA 1X58A 2GIZA 3RKYA 3I55I 2BV6A 1MJAA 2K27A 5JLXA 2M1BA 2HTSA 5FD6A 3QYFA 3BTCA 3DPUA 4AVPA 2Q2EB 1OR7A 1OCPA 2JUGA 4BQNA 1D1CA 3QRFF 2HOAA 1E3OC 1BI3A 3ISPA 2JA5J 2CMPA 3PQKA 3RIRA 1MMAA 2VT3A 4CXFA 4S05A 5M3MJ 3KYDB 4FX0A 2ZC2A 4XM3A 2DU9A 2NNYA 1XMKA 1JXSA 2PG4A 5FKKA 5C3EJ 1QQIA 4BBRJ 3S16J 5D6EA 4M6XA 4CZCA 3CUQA 5GAHJ 1FMVA 2RNGA 2CUFA 5L3EA 2WB1N 2R5YA 4ANJA 3HYIA 4J19A 2BZTA 3E6CC 1H89C 2KHMA 3KP3A 3CJTB 4ZYAA 1IRZA 3KLNA 1XCVA 4MQVA 3FISA 5CQGA 2FX0A 3LA3A 3L2QA 1T39A 1LE8A 3ZQQA 4KICA 1OMIA 1X1DA 1DPRA 3HB9A 3U9GA 2AXLA 4II3A 4M6VA 2QYOA 1MBFA 3DBLB 3BY6A 4KIGA 3FXMA 5FFXA 1ZELA 4JX6A 3K4NA 3K70C 4G7ZF 3BDDA 3CUQB 4DBRA 1XCBA 3L1PA 4D7MA 1P4XA 3FKJA 2XDVA 3DQVC 4Y7NJ 1B8IA 2ID6A 5K7HA 2L54A 1P4AA 2D45A 5IY5H 2L7KA 3BPVA 2X6OA 3LL7A 3G73A 3ZPLA 2X85A 1PJRA 5LBQA 3W2VA 1LFBA 1OCRH 2M30A 3FMQA 2CV2A 3J81Z 1LE8B 3BC8A 4U7DA 4LMYA 4N4OB 1VQ8I 3HDDA 1MZBA 4CHUA 5L3GA 2FMYA 2DDAA 5D8KB 4WF2A 1MDMB 5L3CA 4M3GA 2EA4A 2FQ3A 2M8GX 4A0ZA 2GXGA 2IBDA 4Y52J 2DJNA 3QPTA 4BJ6C 2H09A 4ZH4F 3P9KA 2ZBKA 1YO5C 1QZZA 3BJAA 1XGMA 2F48A 2LC2A 3F9KA 5K1YA 1LB2A 4XLEA 3HOTA 2MD0A 1IXSB 2JRTA 2ELHA 4CCLA 4YFXF 1ZAOA 4ESBA 2QGUA 2NXNB 2QBYA 4YIIA 1N75A 1F1ZA 1USSA 2DA7A 1S3JA 2H6CA 2CQNA 3TKYA 1FJLA 1RESA 5D5XB 2DOAA 3JSOA 5E20A 3FM5A 1P2FA 3KYCB 2VKDA 2A69F 3H0GJ 3K69A 3I59B 3CC2I 4QTRA 4HBLA 2CW0F 1NTCA 2H94A 2YX4A 4XKCA 2E60A 1LUJB 4ZC3A 2DQLA 1UAAA 4Y3OA 2W84A 4CCJA 3IKTA 2CSOA 2EWNA 2HDWA 3CCMI 2ZSIB 3EYYA 3KEQA 3G4SI 2DLLA 1E2XA 2QQ9A 2NOGA 3FXOA 4C2UA 1ZLKA 4OMYA 2L0KA 1XS9A 1DPUA 2V4JC 2QF7A 4HRIA 2QBYB 1X2MA 4HAMA 4E7IA 3DWLE 1SVLA 3BQZA 1W1WE 4LGWA 3DU5A 4PUSA 1MBEA 4MEYF 4EEFG 3WODF 4LLNA 3HSRA 3SDBA 2E36A 5EDNA 4O5VA 3BCBA 4BHBA 2FSWA 2EFOA 4DQ2A 1LNWA 2H8RA 1FEXA 1ZG3A 5JI6A 3ZR8X 4XKBA 3T0YA 3GMEA 5FLXZ 4E7ZA 4HW0A 3FDYA 5LEJA 2GIVA 1OYWA 2HGCA 2IPQX 2TRTA 3V7CA 4IJAA 4BEHA 1XD7A 1UG2A 3JRCA 4V19K 4KN4X 2O9LA 2MH2A 3OYIA 1RKWA 1ETWA 2EBIA 3L2CA 5GTHC 4U0YA 3TO6A 4F93B 4DYRA 1WJEA 2TCTA 1FTZA 5DS9A 1FYMA 3TMOA 1LDJA 5J1RA 5E8GA 3PIPF 4IRIA 3CZ6A 3HEFA 3KCCA 3ML6A 2UWMA 2DMQA 4LIUA 3QYEA 1D8KA 1EH7A 5J1UA 4XRSA 1X19A 3Q0UA 4NB5A 1QBJA 5F27A 2O6GE 1FZPB 1DP7P 1GVDA 4RGUA 2WA0A 3I4MJ 3HKZN 1U0JA 3QWLA 1D5YA 2X6YA 3D5SC 3OL4A 5E1XA 1W36D 1EH6A 2OV7A 3JRGA 1X1AA 1XG1A 2Y0MA 4BEHB 5IT9Z 1VZ0A 4M3FA 5KCMA 3RKQA 4FT8A 1WHUA 2XV4S 2F4OB 1SD6A 5LRRA 3D1NI 5KK1A 4XLAA 2DN0A 4C3IJ 5F04A 4IQJA 4IOCF 3NARA 4ON0A 5EEGA 2HYGD 4HQEA 2EV0A 3U1KA 1JKOC 2XF5A 2WAQA 3LOCA 2F5EA 1C0WA 1J7KA 2ZXHA 1I50J 3GEZA 1USTA 2STWA 2MC3A 1A04A 2A6EF 2LG4A 3BTLA 2X6XA 3GTLJ 2MLGA 1ZG1A 2RREA 3GUDA 1BJZA 4AVZA 4XQFA 2HDDA 2BY2A 2R3SA 5HLGA 2K85A 1RC9A 3FKIJ 1FPQA 4XLCA 3R0AA 3E6BA 2F2EA 3LFKA 2HR3A 1Z05A 1FP2A 2STTA 5F1JA 5FKLA 1VFCA 1WJBA 2X6WA 1POGA 2LKXA 2XASA 5JLWA 2PMHA 4NDLA 3LA7A 3RPQA 3QPLA 4PFOA 5HNHA 4I02A 3ELKA 4YRVA 3KETA 4B44A 2OCEA 3F72A 1WFXA 3CCQI 4A6DA 2DO7A 2IGMA 5FKMA 2DA1A 2CQXA 3JAMK 1JHFA 2VIXA 3SEQA 4I2OA 1R9TJ 3ZQHA 1BR2A 2CG4A 1W4MA 3RTRA 3MFKA 2EH3A 3H1CA 3HOXJ 4I09A 1OCOH 2VKEA 1G3WA 3SJMA 2H1LA 1ONVA 4KMFA 1VQOI 2K3FA 3VEPA 3ZCOA 1UG0A 3BZCA 5AIQA 4L0YB 2P7CB 1WRJA 2OPTA 3MEXA 4AU7A 5E1ZB 1IAWA 4AIJA 2W48A 4Z6YA 5M5YJ 1HKQA 4B3AA 2MG4A 1VTNC 3N4MA 4ZYHA 2EIKH
chains in the Genus database with same CATH topology
2MYSA 5LD2C 4NC7A 2CV0A 3EUKL 4LIVA 4JOMA 3H35A 3HOSA 4BE0A 1T95A 4ZTFA 2I8DA 1ERDA 1YX5A 4BL0B 2DT6A 3AKZA 4ITVA 2R7QA 3ZRGA 3EPZA 3OYGA 2VQGA 4R79A 2F6CA 2HZDA 3HPGA 2PJRB 3DKYA 2KPMA 4XN0A 4B3XA 2VJJA 4GRIA 4H4KC 1MNEA 3KYLA 3DTKA 4D9JA 3E1SA 3W2WA 3DTEA 2IS1A 2QKLB 2CUJA 4CH7A 3CP2A 1EA3A 2BW3A 4E7KA 1AA7A 1V5EA 3HUGB 3TBIA 3LSKA 4C9YA 1D1AA 3I9V2 3PL8A 1V5GA 2WAFA 4B47A 4IQ4A 2QKMB 4CCNA 4BE2A 3LSHA 1Z3YA 4BJTA 5KHDA 4E7HA 2KDOA 3CJRB 3IAS2 3K6GA 2W1OA 1WJDA 4RLFA 3OOUA 3VYTB 4E7SA 3HG9A 3W3CA 2VQCA 1BR4A 2IGNA 2CW8A 2VXZA 1MMNA 3RQ4A 1LFPA 2IGKA 1D1BA 1LDKB 1NG6A 4C2TA 3A1YA 4NC8A 2FUG2 2R7OA 4B43A 2VKHA 2Z16A 3ZXSA 1SAUA 4OAYA 2X1DA 4DIQA 4BUPA 4PSWA 4PJMA 3OYMA 3OYBA 3OYHA 4DGWB 3VSLA 2M0MA 4HEA2 2O5RA 2IS4A 2BW3B 3OYJA 3GBGA 2LYCA 3K4JA 1Y56A 3K4BA 3V42A 1X4PA 3LMMA 4JQFA 3IAM2 3PNVA 3FHNA 1SFKA 5FROA 2K3PA 4HPQA 4XORA 3IUOA 4MLOA 2V26A 3OYCA 3FBNB 4BDYA 3CF2A 4XL9A 4CSWA 1GLNA 3PSIA 1WJFA 4QPQA 1QHGA 4CCMA 2A5WA 3DPLC 2Z2SB 1Z3XA 2XF7A 4RM2A 4XLHA 3CP8A 1G59A 3OMYA 2E5ZA 1DQUA 1Z7LA 5CPRB 5HLTA 4Y33A 3LSGA 2R7XA 2KMUA 5LFAA 2WADA 2BOLA 3L2VA 4FASD 3VSKA 1DGWY 3K10A 2V6EA 4PFPA 3OS2A 3SEZA 3SZGA 4ZJZA 4XNFA 4E4HA 4F91B 2CS3A 1PYVA 2HVQA 2W82A 2L5QA 2GOMA 1R6RA 2VLAA 2P0WA 3BLYA 1Y6IA 3HPHA 1T0FC 1QHHD 2R7UA 3RSNA 2M4GA 3K4LA 4BU2A 3QYFA 2W4SA 2LOOA 2NOJB 3DPUA 4U7BA 2HVRA 2W7NA 2Q2EB 2JUGA 4BQNA 1D1CA 2BVLA 2CMPA 3CJQB 3PUBA 1X4OA 3FBIB 3OR2C 1MMAA 3QODA 2LH9A 2K9LA 4PK4A 4BXFA 3DKXA 4PSXA 3EUHC 4XM3A 2HPIA 1TZLA 2F4IA 4IKFA 2CUZA 3LFUA 4CZCA 1J09A 2E5NA 1FMVA 2RNGA 5HOOA 4ANJA 3CMMA 3HKZA 2KHMA 2KZVA 2Q1ZB 2XF6A 3QYBA 1W36C 4ZYAA 1QU3A 4IZZA 3LSIA 5CQGA 4XKVA 1P9QC 4YEJA 4E6KG 3D5LA 5JHFA 2VJIA 2K9MA 3L2QA 3DEEA 4BQQA 3ZQQA 4N4NB 2VJ5A 1MMDA 1X1DA 4J01A 2HPMA 1N77A 2KP6A 4II3A 2VJ4A 1X1BA 1KONA 2XC7A 2JVGA 3DPTA 4XKWA 4F3QA 1ZELA 3K4NA 3K70C 2X1CA 3S8PA 1WJAA 3H0DA 3I3LA 4II2A 4CUGA 4DBRA 2DT7B 5FRNA 3PNTA 4PJLA 3OYAA 3FKJA 4RMNA 2XDVA 3DQVC 4RM3A 2M7AA 4BQOA 3VYSB 4KITB 4HG2A 2L7KA 4NQWB 2WY8Q 4P1WA 3DTIA 3LL7A 3C2GA 2X85A 2KRHA 4DJAA 1PJRA 3W2VA 2VQHA 3OWTA 2X51A 2CV2A 1N78A 3BC8A 2UUZA 4NUBA 4N4OB 3UNGC 1BOBA 2R4GA 3H9GA 1WJ5A 1X1CA 2WAEA 1BR1A 4BJ6C 1D0YA 4C30A 3BG7A 4KJZA 2DJIA 3PNYA 3RCOA 4P5OA 3OYEA 2LC2A 3F9KA 3OL3A 3ZGKA 2HNHA 2IGOA 4XLEA 3HOTA 2MD0A 3ONQA 3K70D 3IP4B 4NNJA 5TGTA 2K5CA 4CCLA 2ZXIA 2JVHA 2KRCA 4KT6A 2AQFA 2R7WA 4EATA 1N75A 3A4CA 4HNTA 2ZSHB 4LITA 1YX3A 1WJCA 3M8JA 1D0ZA 4FETA 3MMYB 3KX2A 3PJRA 2DOAA 2MC4A 4RLQA 3DU6A 2VKDA 4ZTJA 2F5VA 2M3AA 1HA8A 4ZDLA 3HC7A 2VPLA 4BACA 3TL4X 4DOZA 3BCAA 3HL2A 4XKCA 4XN3A 3G2BA 2E60A 2KQRA 5CQEA 4ZC3A 1UAAA 4Y3OA 4CCJA 2HDWA 2ZSIB 4XOPA 1S9HA 2R7TA 4E7LA 3OY9A 5HVQC 1MMGA 1UELB 3OIPA 4BE1A 4C2UA 3EUAA 4XLFA 2HVSA 1NG7A 5HNFA 2V4JC 2Z1DA 3DLAA 4HRIA 2CFOA 4E7IA 3S3OA 3DWLE 3VWBA 2IS2A 5FRMA 3DU5A 4PUSA 3OYKA 1E0EA 1IRXA 3U21A 3SDBA 1YE9A 3KEYA 3N05A 3BCBA 5KNLA 4HSTA 3MKWB 3ZR8X 4XKBA 4CCKA 3W2AA 2PMZA 1FMWA 4E7ZA 3BG6A 3FDYA 3OS0A 2Y0SA 4BJ5C 4XMYA 2W00A 3VYRB 3SYTA 4HNUA 4BEHA 3S32A 3VDXA 4U87A 4CCOA 3CESA 4G6TB 2MFZA 1JI8A 2GOXB 3OYIA 4D1QA 3NWSA 2LBFA 2L9NA 3H5NA 3L2RA 4F93B 1WJEA 3TMOA 1OLTA 3HXLA 3UR3C 3OYLA 3CZ6A 2WBMA 2HQAA 2UWMA 3OYFA 2CV1A 4LIUA 3K4CA 2VASA 3QYEA 4BGDA 2RQQA 1X19A 3H9QA 3AL0B 2WA0A 3J7AY 2OC6A 3L2UA 1U0JA 2XSJC 2X6YA 3D5SC 3OYDA 3OL4A 4AYBA 3PFYA 4ZDPA 1W36D 2LY1A 2OV7A 1LVKA 1X1AA 3VYUB 5CKTA 3OR1C 4XR6A 4J00A 4BEHB 2A6TA 2MABA 1VZ0A 3RPUD 2VB6A 3H9JA 5KCMA 1DGRM 3M1CA 1DP3A 3OYNA 4DBQA 2LBFB 4KISA 1Z21A 3PSFA 4XLAA 3S93A 4X0GA 2CW7A 1K6YA 3A2KA 4IQJA 4B48A 3S3NA 2WY7Q 2DXIA 2E1MB 2VQLA 2LRDA 4YELA 2LREA 1OR7C 1G8XA 2XF5A 2WAQA 2L9SA 1D0XA 2JSPA 2ZXHA 3S3MA 2R7RA 4F52A 2LG4A 2X6XA 3MKYB 1V5FA 4IX7A 2RREA 4AVZA 2ELJA 2BVMA 2V1NA 4XQFA 4ZDOA 4LG3A 3K4KA 4XLCA 2M4KA 1LKXA 4XONA 3OS1A 4HSRA 1WJBA 2OUMA 1MNDA 2X6WA 3AL0C 2CH0A 2X1EA 4PJJA 2R7VA 2JA2A 3OIQA 2KL4A 4PFOA 4BDZA 5HNHA 2IS6A 3C2HA 3K4MA 2WB1A 4YRVA 3MD2A 2VXDA 4B44A 2HU9A 1MW7A 1WFXA 3L2WA 4BS9A 4OWRB 3NWTA 2L2OA 3LSMA 2IGMA 2VL8A 3D5RC 2VIXA 3SEQA 3H5RA 2LY2A 1BR2A 2KLOA 2M7BA 2UV1A 4OAZA 4PJNA 3RTRA 2PJRA 2R7SA 3H5AA 4F92B 4F55A 3E0JB 4XOTA 3QOEA 2DCEA 3ZCOA 1UG0A 2E1MC 4CA0A 2V7FA 4Y4RA 4AU7A 1TT0A 2AQEA 3AFHA 2IXSA 3MKZA 4E7JA 2ZFUA 2XAUA 4QPOA 2V9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7N A;  5CKT A;  3M8J A; 
#chains in the Genus database with same CATH topology
 1STZ A;  2MYS A;  2CV0 A;  3EUK L;  3ERM A;  3CMA I;  2LD5 A;  4JOM A;  3REO A;  4BE0 A;  2WC2 A;  1ZKG A;  1T95 A;  3OIO A;  5FGM A;  4ZTF A;  2O7O A;  1YX5 A;  4RAZ A;  2DT6 A;  2EFP A;  3F8N A;  2Y75 A;  4U0W A;  4HNV A;  3EPZ A;  2I5U A;  4UV8 A;  2JRM A;  2O3F A;  1OPC A;  2HFH A;  2WV0 A;  3B6C A;  3J80 K;  3JR9 A;  4GGG A;  1F36 A;  1TTY A;  4H4K C;  2GZW A;  2IRF G;  1HW5 A;  4CGZ A;  3DTK A;  4D9J A;  3E1S A;  3QU3 A;  2XPU A;  3BG5 A;  3DTE A;  5TRD A;  1WVR A;  3W6J B;  4CH7 A;  3M8F A;  1XPX A;  1IN5 A;  1XC5 A;  5IYC J;  4E7K A;  1HST A;  1V5E A;  4F7Z A;  3I9V 2;  2K9N A;  2DFE A;  3E5U A;  5EEH A;  3T8R A;  3ZMS A;  2WAF A;  3GVA A;  4EM2 A;  1R4N B;  3EUH A;  4CCN A;  2QKM B;  2LMD A;  1UHM A;  1Z3Y A;  1JJ6 C;  1IRG A;  3HRM A;  5KHD A;  3IAS 2;  4FE4 A;  4CIC A;  3K6G A;  4RLF A;  3VYT B;  4NHJ A;  2IGN A;  2PX9 A;  1K78 A;  2EFN A;  1JUM A;  2OU2 A;  4D5F A;  4WX9 A;  1LFP A;  1D1B A;  1P4W A;  1TC3 C;  2E7X A;  5BPD A;  2V1D A;  3RPU A;  4HLX A;  3VOD A;  2XVC A;  4IHY A;  2L9R A;  2J5P A;  2VKH A;  1G3Y A;  1SAU A;  2DMT A;  4PJM A;  2ZO4 A;  4EMS A;  2DDB A;  3KLO A;  4DGW B;  1MJ9 A;  4HEA 2;  1JT6 A;  1WH7 A;  2LYC A;  1K6O A;  3FZV A;  5HS8 A;  3LMM A;  3PNV A;  3FHN A;  1SFK A;  2E1C A;  5LHI A;  1ETQ A;  1QA6 A;  3SHF A;  2ETH A;  1ZGJ A;  4MLO A;  4GO1 A;  3CCE I;  4Z2Y A;  2VKV A;  5D4S A;  3GLX A;  2V26 A;  3ABT A;  2ZJ2 A;  3HHH A;  5HS7 A;  3CF2 A;  1GLN A;  1WJF A;  2TDX A;  1TLH B;  3IH3 A;  1K78 B;  4A93 J;  3ZOB A;  1KU3 A;  1IXR C;  2XF7 A;  4RM2 A;  1G59 A;  4DYC A;  3L9F A;  3KZY A;  1DQU A;  1ZH5 A;  2YPR A;  1YW8 A;  3I4P A;  4Y15 A;  3M4O J;  5LFA A;  1OCT C;  4JX5 A;  3WE2 A;  4X6A J;  1XDU A;  5DV5 A;  4FAS D;  3G1O A;  3BR2 A;  5TIS C;  2GWR A;  3MWM A;  1U8R A;  1V54 H;  3NEU A;  4E4H A;  1G3T A;  1Y0U A;  4KT5 C;  2W82 A;  1R6R A;  2VLA A;  3JRH A;  1PVE A;  2VC0 A;  1BJA A;  2OF7 A;  3BP8 A;  5J4V A;  1T0F C;  4I99 C;  3RSN A;  5B5E C;  1A36 A;  2W4S A;  4GDF A;  2NOJ B;  4U7B A;  2HVR A;  1KU7 A;  5ERI A;  3WE3 A;  3CJQ B;  3CQZ J;  4Q4Z F;  5IPA A;  1X4O A;  1Z7U A;  5F0F A;  2VC1 A;  3QOD A;  3QU6 A;  4I01 A;  2LH9 A;  2K9L A;  4PK4 A;  1Y8Q B;  4WCG A;  4IHT A;  3WTT C;  2LF8 A;  2PJP A;  1SEU A;  2HTJ A;  1CQT A;  2K4B A;  2C6Y A;  2H27 A;  4O6J A;  2E5N A;  1TQP A;  3F8B A;  1MBK A;  3QYB A;  2XF6 A;  2M0C A;  4AUX A;  3QPS A;  2JZY A;  2Q0O A;  3O6B B;  1QU3 A;  4IZZ A;  3LSI A;  2E1N A;  3CCY A;  4NQW A;  1UCR A;  4YFN F;  3ESW B;  2DA5 A;  2FA5 A;  2MLK A;  4BYY A;  3IKV A;  2HXO A;  1UMQ A;  2X48 A;  2VJI A;  2K9M A;  5LRS A;  2IAI A;  4HV5 A;  2K86 A;  4XBF A;  2VJ5 A;  3QP5 A;  4FE7 A;  5H20 A;  1MMD A;  3I5U A;  1YJW I;  5EG0 A;  1A6I A;  1R58 A;  2KP6 A;  2DI3 A;  4CDG A;  2ZCW A;  3F8C A;  2XC7 A;  2G0E A;  4BY1 J;  3K9T A;  1BI0 A;  4UUS A;  1H9G A;  2KJC A;  3I3L A;  2PMZ N;  4CUG A;  2ZNZ A;  5FRN A;  2L7F P;  2DT5 A;  2P5L C;  3FXJ A;  4RMN A;  1SFO J;  3BJ6 A;  3VYS B;  2KIS A;  4N9I A;  5ICC A;  1DU0 A;  1U5T C;  4NQW B;  4RB0 A;  3I56 I;  2RGV A;  1WKM A;  3BOQ A;  2WWY A;  5L3B A;  1YHQ I;  2ZKZ A;  2HYJ A;  4GCV A;  4DJA A;  1UHW A;  3NRV A;  5DEQ A;  3VFZ A;  2VQH A;  2VBZ A;  5DUI A;  3BG9 A;  4NUB A;  2UUZ A;  2P5K A;  5CYV A;  2D1V A;  1BOB A;  2R4G A;  3H9G A;  5EG0 B;  3LSR A;  3OV8 A;  2BXZ A;  1BL0 A;  3RKX A;  1BW5 A;  1R49 A;  5E18 F;  3C2B A;  1IRF A;  1WGX A;  4UUS B;  1BR1 A;  1GDT A;  3BG7 A;  3F8F A;  1E17 A;  4KYW A;  2DJI A;  4ENK A;  2BY1 A;  4A5M A;  3ZGK A;  1T56 A;  1HDP A;  2IGO A;  1KGS A;  2DAO A;  3T8T A;  3K70 D;  2JA7 J;  3IP4 B;  1KQ9 A;  1QPM A;  3A02 A;  2DBB A;  5E3M A;  2ZXI A;  2KRC A;  1NK3 P;  2HEO A;  2AQF A;  3LSJ A;  1T2K A;  3G71 I;  4HNT A;  2ZSH B;  2XGD A;  4M74 A;  4LG0 A;  1D0Z A;  4L9T A;  2HQ5 A;  3PJR A;  2B0L A;  2MC4 A;  2M2E A;  2QVO A;  4RDU A;  5M5X J;  2D5V A;  3G1L A;  4ZDL A;  2I10 A;  2VPL A;  1LJ9 A;  2CQK A;  1ZAR A;  1HXD A;  1FOX A;  2KQR A;  2OZ6 A;  3GTK J;  2V1X A;  5BMZ A;  2W24 A;  1S9H A;  4XOP A;  4M3D A;  2R7T A;  1YS7 A;  3PQJ A;  2O8X A;  3RDI A;  4EV0 A;  2K7L A;  1MMG A;  5ILS A;  4LK1 F;  2KJB A;  2JN6 A;  5K7Z A;  2JPB A;  2EIN H;  4Y17 A;  2HVS A;  3V4G A;  1VQ9 I;  5DUK A;  3CUO A;  2R7F A;  3WGG A;  1FOY A;  4A0X A;  2RV8 A;  5LHG A;  3VWB A;  4LG0 B;  2K02 A;  2EB7 A;  1FIP A;  1R1U A;  1F43 A;  4JK1 X;  4GXO A;  3PIO F;  3GXO A;  2DA3 A;  4CZZ A;  1WCM J;  3BG3 A;  2GAU A;  3MKW B;  1Y8R B;  2V9P A;  1U9O A;  1TWH J;  2VBW A;  3BG6 A;  3V7S A;  1FTT A;  3OS0 A;  4BJ5 C;  4I98 B;  4XMY A;  3VYR B;  3F21 A;  3RZO J;  3S32 A;  3VDX A;  1MBG A;  3GW2 A;  1D5V A;  1BIB A;  3T1B A;  2L9N A;  1R00 A;  1S72 I;  2ZJQ F;  3RYR A;  2LSO A;  4PGH A;  3UR3 C;  3IH2 A;  2WBM A;  3P5J A;  4ABZ A;  5C4J J;  3S1R J;  2R5Y B;  2CV1 A;  1K7A A;  3I0T A;  2HWV A;  2RQQ A;  3DXJ F;  5CJ9 A;  1BOA A;  1HDD C;  1NH3 A;  4D0P A;  3J7A Y;  1IJW C;  1LDD A;  5D5V B;  3CDI A;  1R1V A;  1H8A C;  3BWG A;  3GCM A;  1O3R A;  4ZDP A;  2LY1 A;  1BC7 C;  4RA2 A;  1QVT A;  2FF4 A;  3OR1 C;  2MA3 A;  4J00 A;  2CYY A;  2A6T A;  2NNN A;  3RPU D;  2VB6 A;  5DD8 A;  3H9J A;  2L7M P;  5EZH A;  2L4A A;  3F0C A;  2DA2 A;  1DP3 A;  3OYN A;  4DBQ A;  3CDH A;  4KIS A;  3GZ5 A;  3S93 A;  1W5C C;  1K6Y A;  3M8E A;  1MMS A;  4B48 A;  1U9N A;  4RAF A;  4ESJ A;  3BRO A;  1VQ6 I;  2E1M B;  2VUM J;  2LRE A;  1LEB A;  3SZT A;  2ISY A;  1B8I B;  5E8I A;  1J75 A;  1D0X A;  2K4J A;  5JHU A;  5FJ8 J;  1DU6 A;  1SD5 A;  1YFH A;  4ENN A;  9ANT A;  4F52 A;  2H6B A;  3MKY B;  3WG9 A;  4YFK F;  1K4T A;  1B72 A;  4I76 A;  1Z67 A;  1VI0 A;  2JK3 A;  5ICE A;  1JT0 A;  2EV6 A;  2N8G A;  3K4K A;  2ISZ A;  2M4K A;  4XON A;  3OS1 A;  4HSR A;  3HRT A;  3D0S A;  4P55 A;  4HDV A;  3BPX A;  1J2X A;  1P6R A;  3IH4 A;  4XIC A;  2OTL I;  5CLS A;  3S14 J;  3AL0 C;  2R7V A;  2L9V A;  4ZZL A;  3P9C A;  4KIB A;  1TNS A;  5DTD A;  1OKR A;  4AD9 A;  1K83 J;  1TNT A;  4BDZ A;  3NAU A;  2DPU A;  2IS6 A;  4DYQ A;  1IUF A;  3K4M A;  2HOE A;  3MD2 A;  1RUN A;  1MW7 A;  2EQR A;  2PBI A;  1O57 A;  3K1M A;  3R0J A;  4BS9 A;  2BY0 A;  1K79 A;  4KIF A;  1ZR2 A;  3E6M A;  4RS8 A;  2M7B A;  4OAZ A;  4BH9 A;  1RNL A;  3F6V A;  3C7J A;  3KPH A;  2FNP A;  3PM1 A;  4IVN A;  2JSC A;  3H5A A;  4F92 B;  2E2H J;  1X2N A;  1B72 B;  1VQ4 I;  3CCU I;  1KU9 A;  3E0J B;  3S2W A;  3GTP J;  1ZRD A;  4N9H A;  3GZ6 A;  2O03 A;  2KKO A;  4A3L J;  5A2Q K;  3FXQ A;  1N25 A;  3ZMD A;  2M87 A;  2RDP A;  2ECC A;  1TT0 A;  1B6A A;  5E1W A;  2HKO A;  4RGR A;  3MKZ A;  2LKS A;  3HSF A;  4HZF A;  4PCQ A;  4E7J A;  3C3W A;  4QPO A;  4GFB A;  4D7N A;  3BZ6 A;  4I0A A;  1JGS A;  5LD2 C;  1YJN I;  3JRD A;  2MBF A;  1Z91 A;  5ICF A;  3W6K B;  1GV5 A;  2W57 A;  2CWE A;  3HOS A;  1ACI A;  2JUC A;  3MZH A;  3ABK H;  2HKX A;  2ZME A;  3ZMU A;  4BL0 B;  2LP0 A;  5DD4 A;  4IHS A;  2P4W A;  3KP5 A;  2E7W A;  1KA8 A;  2IA0 A;  2VQG A;  4UB6 C;  1SMY F;  3OYG A;  3TED A;  1IDZ A;  5DDG A;  3DKY A;  2M45 A;  4EGY A;  1HCR A;  2VJJ A;  4GRI A;  2HS5 A;  1APL C;  4MTE A;  2OQG A;  1GHC A;  1ETK A;  1MNE A;  4G9Y A;  2ELK A;  2DQR A;  2F5D A;  1G3S A;  4KN7 X;  2XRO A;  3CO7 C;  3G3Z A;  1YLF A;  1YW7 A;  2EPF A;  3CP2 A;  4WXC A;  3MAJ A;  3ERE D;  1V5G A;  5K5Q A;  1G2H A;  4P9F A;  1R22 A;  4LLG F;  1XSD A;  3E5Q A;  3P7N A;  4E7H A;  2KDO A;  3BR6 A;  2PLY A;  2WTE A;  2MD5 A;  3HG9 A;  2ZME B;  4AM3 A;  2VI6 A;  2VQC A;  3J7Z I;  1BR4 A;  2VXZ A;  2EIM H;  1MMN A;  1Z1D A;  2UXX A;  3GTG J;  2O0Y A;  2VE8 A;  3HRU A;  4KMU X;  1VQP I;  4Q47 A;  4LB5 A;  1B59 A;  4B43 A;  1JKQ C;  5B66 C;  3IC7 A;  2Y9Y A;  3HTU A;  2L01 A;  3L00 A;  4RGS A;  2FNA A;  3O8G A;  4DNC A;  5AIP A;  1J59 A;  3OYM A;  1FSE A;  3OYH A;  2VN2 A;  3EYI A;  2UXN A;  2IS4 A;  1YI2 I;  1TP4 A;  2NS7 A;  3KIO A;  2GM4 A;  1S6L A;  3BT9 A;  3K4J A;  1Y56 A;  1MBJ A;  3V42 A;  4BHP A;  2Z33 A;  2J5O A;  2FJ1 A;  2CJJ A;  5F0C A;  4C3H J;  3G1M A;  3GTQ J;  1MIJ A;  1MGT A;  3IL2 A;  3ZP5 A;  4HPQ A;  2HQN A;  2KIU A;  1ORK A;  5ILU A;  4C3J J;  3FBN B;  1V3F A;  4EVI A;  3SFZ A;  4CSW A;  3CCL I;  1R36 A;  3A03 A;  1QHG A;  2XKO A;  2DMN A;  2Z2S B;  1Z3X A;  4XLH A;  1GXP A;  3MKL A;  3OMY A;  5IYB J;  2W85 A;  1Z7L A;  2AO9 A;  5HLT A;  1MKM A;  5E3O A;  3MVP A;  1Z77 A;  3WG7 H;  3V8K A;  2VOO A;  3F23 A;  3ABU A;  1BN5 A;  5B1A H;  1VQ5 I;  3VSK A;  2M34 A;  4YIF A;  2P6S A;  1E3P A;  4RB2 C;  3K10 A;  1U78 A;  2V6E A;  3S2H J;  2ID3 A;  5IYD J;  3JW4 A;  3BR5 A;  3ABL H;  4ZJZ A;  1HW2 A;  3GX4 X;  2CS3 A;  1YRN A;  1PYV A;  2QQB A;  1SAN A;  5CVV A;  5HDK A;  1F9N A;  2HVQ A;  1XDS A;  1B9M A;  3G6E I;  1ZQ3 P;  4L18 B;  1S8N A;  4CO8 A;  3BLY A;  5ED4 A;  1O3Q A;  1ODD A;  3HPH A;  4M73 A;  5BOX A;  2H8W A;  3CO6 C;  2M4G A;  2LOO A;  2W7N A;  2A07 F;  1Y39 A;  2E19 A;  2L02 A;  4HOB A;  4AWX B;  3PUB A;  2E1O A;  1FWZ A;  1XGN A;  3OR2 C;  2HDC A;  1BA5 A;  1EV7 A;  5GAE J;  1T6S A;  5E17 F;  5J8F A;  1EF4 A;  2HPI A;  5LHH A;  3RJP A;  2BXY A;  3Q0V A;  2CRG A;  4K2E A;  5KAF C;  2FBK A;  1XGS A;  5HOO A;  3ZN1 A;  4PZJ A;  3ZMZ A;  1FYL A;  4U88 A;  2KZV A;  1W36 C;  1FBS A;  2Q1Z B;  2OQR A;  1TWG J;  1RRJ A;  1JTX A;  1YRN B;  5FD5 A;  4D5C A;  1XX5 A;  1IW7 F;  1ZGA A;  3IV5 A;  2DTR A;  4XKV A;  1P9Q C;  3WU0 A;  4E6K G;  5JHF A;  2DK5 A;  2ZJR F;  1IGN A;  3KFW X;  1OIS A;  3M07 A;  4UHT A;  4E70 A;  2B63 J;  2XRL A;  4KNY A;  5DM7 F;  3ZQ7 A;  2IT0 A;  5JVG F;  5IT3 A;  3DF8 A;  2DMP A;  3V7R A;  2OAZ A;  2HPM A;  4UY8 I;  1I6H J;  1N77 A;  2YUS A;  1U2W A;  1JUP A;  2VJ4 A;  1XMX A;  1X1B A;  4ESF A;  2JVG A;  2EZK A;  4I6Z A;  4F3Q A;  3A0H C;  2XGE A;  3AG4 H;  1IDY A;  3MCZ A;  1R1T A;  1WJA A;  2E35 A;  3MQ0 A;  1B9N A;  2LNB A;  1J5Y A;  2VOD A;  2DT7 B;  5EZG A;  4I7H A;  2Y0S N;  1E3H A;  4PJL A;  2P5V A;  3OYA A;  3GYH X;  3CCV I;  5FO5 A;  2M7A A;  4KUM A;  4A3J J;  3FK6 A;  5IP7 J;  4KA4 A;  4A3G J;  4KIT B;  4HG2 A;  2WY8 Q;  4G6Q A;  5K5R A;  5M3F J;  3C2G A;  4IF4 A;  2KRH A;  3JAM Z;  1FBQ A;  1OFC X;  2CUE A;  1GV2 A;  1BW6 A;  2R92 J;  2X51 A;  2BE5 F;  5LLQ A;  2NVY J;  4MIM A;  3JRA A;  3CDL A;  2QQ8 A;  4DZJ A;  1UZC A;  2XAG A;  1ENH A;  2XAJ A;  5BQT A;  5JVT A;  3GZN B;  5C44 J;  5DCF A;  2DFI A;  2WAE A;  5J6X A;  4MFD A;  5JR3 A;  4C30 A;  4UUT A;  1J9I A;  1BIA A;  3PNY A;  4G94 A;  4P5O A;  1FLI A;  1YYV A;  3ZQL A;  1XMA A;  3ABM H;  2KIQ A;  2OD5 A;  2VPR A;  4G8X A;  4RAG A;  4YG2 F;  5C4X J;  2HOS A;  3DEU A;  3I53 A;  1SFE A;  2VBY A;  5L3D A;  5TGT A;  2K5C A;  3TW7 A;  3SQN A;  3ROU A;  2JVH A;  4PGG A;  4KT6 A;  2XRN A;  2YSR A;  3WTX C;  2R7W A;  2OCC H;  2QSH X;  4EAT A;  1FY7 A;  4A3K J;  4LIT A;  3CUQ C;  1A6Q A;  4FET A;  3KX2 A;  1L0O C;  1UFM A;  2FML A;  3E97 A;  3J80 Z;  2M5W A;  4L9J A;  1GXQ A;  3DU6 A;  4RLQ A;  1ZTR A;  4TV7 A;  3ECO A;  4QLC U;  3RI4 A;  1WSU A;  3E5X A;  3VB2 A;  2BEO A;  2NYX A;  2RNJ A;  2PMU A;  2F5V A;  2M3A A;  4ZTJ A;  6PAX A;  3HC7 A;  3FK7 A;  2MGQ A;  4M9Z A;  3TL4 X;  4DOZ A;  3HL2 A;  3CC4 I;  3VOE A;  4A3I J;  1IG7 A;  1I39 A;  2YS9 A;  3TOA A;  4E7L A;  4MGR A;  5HVQ C;  1H9T A;  1UEL B;  3OIP A;  1O7L A;  1SAX A;  4BE1 A;  2NVQ J;  3IRR A;  1YOV B;  2YU3 A;  3EUA A;  4XLF A;  3TW6 A;  4B4C A;  2LFB A;  2Z1D A;  3DLA A;  1I27 A;  2CFO A;  3JRB A;  1BM9 A;  2MSY A;  2XAF A;  3CC7 I;  1P92 A;  3DBH B;  3F8M A;  2VOP A;  4FIS A;  1Q1H A;  2COM A;  3S1Q J;  1W7P A;  1VQN I;  2AS5 F;  3U21 A;  1FYK A;  3O3K A;  2ESH A;  2VT2 A;  1G4D A;  5EJC A;  3N05 A;  4JYK A;  1SVM A;  2CQ7 A;  5KNL A;  4IPA A;  2QM3 A;  3JTG A;  4HST A;  4HLY A;  1PUF A;  3HUG A;  2PMZ A;  1FMW A;  2HQR A;  1V4R A;  2XUB A;  2L7Z A;  1O3S A;  1HC8 A;  2ACJ A;  5DCM A;  3QQA A;  3CES A;  2MFZ A;  1JI8 A;  2GOX B;  3ASO H;  3H3U A;  4A12 A;  4G7O F;  1KU2 A;  2ZJP F;  3KP2 A;  2A61 A;  1TQM A;  3LWF A;  1HKT A;  1GVJ A;  3NWS A;  5D5U B;  2VON A;  3H5N A;  1TT5 B;  4W97 A;  3L2R A;  3WU1 B;  2ADU A;  1Z6T A;  2NS8 A;  2RKH A;  2DMU A;  5H6Q A;  1SD7 A;  2R7Z J;  1R4M B;  1W7P B;  2V6C A;  4UB8 C;  3OYF A;  5F64 A;  2XPV A;  4KFC A;  3FIW A;  2Z99 A;  1A31 A;  3A01 A;  1Z0X A;  3H9Q A;  3IWF A;  1PUF B;  2OC6 A;  2ME0 A;  4N0B A;  3EDP A;  3OYD A;  1SVO A;  1JKR C;  1Y0N A;  3BR1 A;  4AYB A;  4M9S A;  3JRE A;  2GA1 A;  3VYU B;  1LVK A;  5LGT A;  3BTJ A;  2W25 A;  2XIG A;  5DCM B;  1MNM C;  3K2Z A;  4HA8 A;  2MAB A;  1U8B A;  2DK8 A;  1LPQ A;  2XPW A;  3K1P A;  2NS0 A;  3TDZ C;  1DGR M;  3ZQI A;  4NC6 A;  5H6R A;  1ZG5 A;  3T5X A;  5HDN A;  2CW7 A;  4X0G A;  1EJ9 A;  3A2K A;  3JRF A;  2EV5 A;  5B1B H;  1R5G A;  5TJJ A;  1MSF C;  4ENJ A;  3TP0 A;  3S1M J;  2WY7 Q;  2JA8 J;  3BZK A;  3FXU A;  5GP9 A;  3DCF A;  4XSZ F;  4YEL A;  2LRD A;  1IF1 A;  2DXI A;  1G8X A;  5JFR A;  4HX8 A;  1MH4 A;  2JSP A;  4NBQ A;  3TO7 A;  3HIF A;  3HM5 A;  3C18 A;  5HLI A;  1VQK I;  1ZK8 A;  4IX7 A;  1W5S A;  2ELJ A;  1I5Z A;  2V1N A;  3KP4 A;  4FQG A;  4LG3 A;  5GPA A;  4BNC A;  2QEX I;  1HF0 A;  2M8E A;  4RB1 A;  2R93 J;  1LKX A;  2EZL A;  2FBH A;  4IHV A;  2JMW A;  2KIM A;  2GBY A;  2JT1 A;  3VPR A;  3CME I;  2OUM A;  1U3E M;  2D1H A;  4Y13 A;  2CH0 A;  2X1E A;  4PJJ A;  5J3L A;  2JA2 A;  3MZY A;  2IA2 A;  2KRF A;  3OIQ A;  3Q9S A;  5F0H A;  1WPK A;  1HW1 A;  4WXD A;  3GFI A;  5CVU A;  3C2H A;  1FSH A;  2F5C A;  3HHG A;  3X2Q H;  2WB1 A;  4HF0 A;  5GAG J;  4QIW N;  4ZYE A;  2VXD A;  4YIR X;  4MFE A;  4HF2 A;  1AHD P;  2ZFW A;  2CO5 A;  3FM3 A;  4OWR B;  3NWT A;  5IOY A;  1LQ1 A;  2VL8 A;  3K1N A;  3D5R C;  2XHK A;  3H5R A;  2LY2 A;  5FKO A;  2OA4 A;  2UV1 A;  3J81 K;  1JJ8 C;  3SZP A;  3NQO A;  1RPW A;  2R7S A;  2ZXW H;  1XSX A;  1YG2 A;  4F55 A;  2FEZ A;  4Q5S F;  2YR2 A;  4XID A;  5GAD J;  1I3A A;  2HOT A;  4LD5 A;  1JUS A;  1ZLJ A;  4CA0 A;  2V7F A;  3AG2 H;  2FBI A;  4A3E J;  3IWZ A;  3WGH A;  4G12 A;  4DW6 A;  3AFH A;  4V2F A;  4BY7 J;  2IXS A;  1J0R A;  2XGX A;  4L5J A;  2V9K A;  1FOK A;  3HTS B;  1KYW A;  1OCZ H;  1VQ7 I;  4IRG A;  3H35 A;  3DKW A;  4XRM A;  2LKP A;  4QWQ A;  4EJU A;  1V55 H;  3ECH A;  3CD6 I;  2I8D A;  4XRF A;  3H3Z A;  4EM1 A;  1RET A;  1XN7 A;  2R7Q A;  3GF2 A;  3JCU C;  1SD4 A;  3V8L A;  1IV6 A;  1JHH A;  1WQ2 A;  2F6C A;  2HZD A;  2QSF X;  4MQ9 F;  2KPM A;  4XN0 A;  4B3X A;  4ZYG A;  1W0T A;  3S17 J;  4A3C J;  2IJL A;  1QZE A;  4M71 A;  3GTM J;  1T0F A;  1HBX G;  3GTJ J;  4L0Z B;  2QA4 I;  1ZHF A;  2LK2 A;  2Y31 A;  4ETS A;  3W2W A;  4WWC A;  2CGP A;  1SMT A;  2IS1 A;  1QRY A;  2K9Q A;  1EA3 A;  2BW3 A;  1MDM A;  2OBP A;  3TBI A;  1MSE C;  4C9Y A;  1D1A A;  1R23 A;  2RVC A;  3PL8 A;  5E3N A;  1X1P A;  1IO2 A;  3HSE A;  4BE2 A;  4XRS G;  4BJT A;  2Z5U A;  3I4N J;  3CJR B;  5L3F A;  2A5Y B;  1R5I D;  1G6N A;  2W1O A;  4E7S A;  2GA2 A;  2E2I J;  3W3C A;  3U1D A;  4IOA F;  4IXA A;  1MJB A;  2CW8 A;  4GYG A;  1IN8 A;  2GXA A;  4M9X A;  4OMZ A;  1LDK B;  2HZT A;  1Y1V J;  3BR3 A;  3LQQ A;  1JKP C;  1IXC A;  4C2T A;  1ETX A;  2FRH A;  5ICG A;  3A1Y A;  2FUG 2;  3WTW C;  2Z16 A;  4P9U A;  2IVM A;  2LLK A;  3MN2 A;  4QSH A;  4OAY A;  2X1D A;  4DIQ A;  4BUP A;  5FB2 A;  4OIO F;  2FQ4 A;  3R61 A;  2EK5 A;  5FLX K;  2JPC A;  3MZ8 A;  2AXT C;  1YIO A;  2M0M A;  3JRI A;  2O5R A;  2BW3 B;  3E7L A;  3OYJ A;  1ZN2 A;  2G7H A;  5LEK A;  3K4B A;  3I59 A;  2GQQ A;  1X4P A;  2RQP A;  3IAM 2;  1T8I A;  5AON A;  5J8C A;  4CYC A;  4IHX A;  2F5F A;  5FRO A;  1O3T A;  2AHQ A;  1FNN A;  3KEO A;  1SFX A;  3I64 A;  4XOR A;  3IUO A;  4S0H B;  2EJR A;  3S15 J;  4G6D A;  3TDU C;  5E79 C;  1FC3 A;  3OYC A;  2RC4 A;  3BJO A;  4HV6 A;  1ETY A;  3PSI A;  3J7A O;  3JTH A;  2CU7 A;  4QPQ A;  2XKP A;  1BC8 C;  2JTV A;  5CVJ A;  3FX3 A;  3AG3 H;  1U5T A;  2A05 A;  2E5Z A;  3BQY A;  1ITY A;  5K5O A;  4ASN A;  3J7Y J;  2DOF A;  3H92 A;  4M3E A;  4R8H A;  3LSG A;  4Y33 A;  3F22 A;  2H1K A;  3HOY J;  2R7X A;  2KMU A;  1RR7 A;  2WAD A;  1XB4 A;  2BOL A;  4B09 A;  1SC7 A;  2D2W A;  2DOE A;  2DFF A;  3I71 A;  3L2V A;  4P96 A;  4IHW A;  2X4H A;  1RI7 A;  2IP2 A;  5F08 A;  1FP1 D;  3KZI C;  3E3V A;  1FIA A;  3SEZ A;  1EKE A;  2HXI A;  2JWT A;  1HLV A;  2QLZ A;  5IT9 K;  2NAZ A;  3WTZ A;  2L5Q A;  2GOM A;  3GO5 A;  1YW9 A;  5FFZ A;  4CYC B;  4MNU A;  2DA4 A;  1QHH D;  1QVU A;  2DOD A;  2R7U A;  1ON1 A;  1XTA A;  2DFH A;  3K4L A;  4BU2 A;  3KE2 A;  2COB A;  2BVL A;  3LST A;  2MW8 A;  3F3X A;  3O8H A;  4IO9 F;  5HOD A;  3FBI B;  5EYR A;  3DBR B;  3HOU J;  1U5T B;  1LVA A;  1W7P D;  5IP6 A;  4BXF A;  1ULY A;  3DKX A;  4PSX A;  4U0V A;  3EUH C;  3M9A A;  1X3U A;  5EF6 A;  1S7O A;  1RUO A;  3H3V K;  1TZL A;  2F4I A;  4IKF A;  1QNT A;  2CUZ A;  2E34 A;  3LFU A;  1BI2 A;  4B1R A;  2L3D A;  1MBH A;  3E6D A;  2E2J J;  1J09 A;  5DM6 F;  1RZ4 A;  4JX4 A;  3CMM A;  1TWA J;  1HSJ A;  3HKZ A;  3KZZ A;  3TQN A;  2DTZ A;  3I58 A;  2JA6 J;  5M5W J;  3M3Y J;  1W5T A;  2M9H A;  3AG1 H;  4XK4 A;  3RYP A;  4M6Y A;  4YEJ A;  4UVB A;  4ENM A;  3D5L A;  4EJT A;  4H0E A;  4HYE A;  4A5N A;  3DEE A;  4BQQ A;  3IRQ A;  1R7J A;  2QSG X;  2XAH A;  1DDN A;  4M3B A;  4ZZD A;  4N4N B;  1HQC A;  1X3Z B;  4A2U A;  4J01 A;  2NRA C;  3ULQ B;  2QEN A;  3RQI A;  1DUX C;  3CLQ A;  4KDP A;  2VE9 A;  3TO9 A;  1KON A;  3M7G A;  4PJ0 C;  2RN7 A;  3DPT A;  4XKW A;  4DZP A;  2X1C A;  3S8P A;  4A6E A;  3H0D A;  4II2 A;  1FOW A;  2PEX A;  3HOZ J;  2BYV E;  2FE3 A;  5D5W B;  1PDN C;  3B73 A;  2R5Z A;  2P6T A;  3PNT A;  4FTH A;  2O8K A;  1NHA A;  4RM3 A;  4BQO A;  2UZK A;  3GFL A;  1KQ0 A;  2IA1 A;  2DA6 A;  1VQL I;  4MEX F;  3PO3 J;  3FXL A;  5BS6 A;  2MH9 A;  2OJE D;  4P1W A;  3DTI A;  3WGI A;  4M72 A;  1ZRF A;  3HOW J;  5DYM A;  5LGN A;  1YIJ I;  3CCS I;  4OOI A;  3OWT A;  1N78 A;  1IV8 A;  4JP0 A;  1M1E B;  3SFI A;  2F4M B;  3UNG C;  2X9D A;  1KZH A;  4S04 A;  2JQ7 A;  3RZD J;  4G7H F;  2FXA A;  2X0L A;  1AWC A;  3WHB A;  1TW2 A;  1TW3 A;  3WHC A;  1WJ5 A;  5A2Q Z;  3HOV J;  2QCO A;  1JTY A;  1X1C A;  1T33 A;  1ZGW A;  3W6V A;  1OCC H;  1JGG A;  1D0Y A;  5H2F C;  4KJZ A;  3RCO A;  2BHY A;  3OYE A;  3OL3 A;  2R5Z B;  2A6H F;  2FOW A;  2HNH A;  2RAE A;  3ONQ A;  4LJZ F;  4MO7 A;  3WTU C;  4NNJ A;  3C1D A;  1PUE E;  2L4M A;  3CCR I;  3AAF A;  5D8L B;  4XSX F;  2PI0 A;  2XGC A;  3A4C A;  1CGP A;  1Z6R A;  1YX3 A;  2KZG A;  1WJC A;  3M8J A;  4IRH A;  3MMY B;  2ZXJ A;  1S5L C;  2ME6 A;  5F1R A;  3COA C;  1EH8 A;  2EFQ A;  4R1H A;  1UHS A;  2WAQ N;  1HA8 A;  1QPI A;  1O7F A;  1ETV A;  4BAC A;  2LR8 A;  3BCA A;  4A3F J;  4IEJ A;  2WV1 A;  4XN3 A;  3G2B A;  5CQE A;  3CJN A;  2LY9 A;  3GTO J;  1W0U A;  1LEA A;  3OY9 A;  4A3B J;  1RKT A;  4RBO A;  1PP8 F;  3FXK A;  3WU2 C;  4UVA A;  2NVX J;  2YU9 J;  2Y69 H;  4BXU A;  1T98 A;  1UB9 A;  3PUF A;  3L7W A;  1NG7 A;  3K7A J;  5HNF A;  3BTI A;  1FBU A;  3I54 A;  3QPH A;  3EQL F;  5D4R A;  3L09 A;  3S3O A;  3R4K A;  4OIQ F;  1ON2 A;  1NK2 P;  2EFW A;  2IS2 A;  3KP6 A;  5FRM A;  1S29 A;  3K2A A;  1HKS A;  3OYK A;  1E0E A;  1IRX A;  1ZRC A;  4BQA A;  5KAI C;  1WZ2 A;  1YE9 A;  3FXR A;  3KEY A;  5GPC A;  4XLN F;  1XGO A;  4UV9 A;  3HBL A;  4AIK A;  2ESN A;  4CYD A;  2DYR H;  3U2R A;  3OSF A;  2EZH A;  3GFJ A;  4HX4 A;  2O61 A;  4ZYD A;  4CCK A;  3W2A A;  3SXY A;  1S7A A;  5J4Y A;  2E71 A;  2Z3Y A;  2Y0S A;  2DW4 A;  3SDG A;  4FCY A;  1A35 A;  2W00 A;  2NVU B;  3CF5 F;  3SYT A;  3S2D J;  4HNU A;  3LAJ A;  5F6F A;  4CCO A;  3BR0 A;  4G6T B;  4D1Q A;  3FMR A;  2LBF A;  4L5E A;  2K9S A;  1ZYR F;  2BBY A;  1SFU A;  2KFD A;  2QWW A;  5D6F A;  3WTY C;  4HF1 A;  4OIP F;  4LK0 F;  1P7I A;  1OLT A;  3HXL A;  3OYL A;  5IOZ A;  3Q3S A;  4A69 C;  2ZB9 A;  2LVS A;  2ZNY A;  2HQA A;  2QQA A;  1OQY A;  2BHZ A;  4UXN A;  3K4C A;  2VAS A;  4BGD A;  1ZR4 A;  3QP6 A;  1O4X A;  1RIO H;  3AL0 B;  2CFX A;  3FMS A;  3L2U A;  1MH3 A;  2XSJ C;  1OYI A;  3GFM A;  2Y48 A;  1TQI A;  2B7E A;  2PQ8 A;  2R7D A;  3B6A A;  1TWF J;  3PFY A;  5J1Y A;  1JE8 A;  3ZQG A;  5CKT A;  2OTJ I;  1ETO A;  2FU4 A;  4XR6 A;  1UJ8 A;  4OIN F;  1VQM I;  1F4K A;  2EZI A;  3ZMV A;  4A3D J;  1BI1 A;  1QO0 D;  3M1C A;  2ICW G;  3LA2 A;  2LBF B;  1D8J A;  1Z21 A;  3PSF A;  1U6G A;  2LDU A;  1TL8 A;  1B4A A;  3UKG A;  1IC8 A;  2B9S A;  4PDK A;  2P7V B;  3S3N A;  4UUV A;  3WTS C;  1VND A;  1I6X A;  2VQL A;  4L9V A;  1OR7 C;  2L9S A;  4EQQ A;  3RKW A;  2Y30 A;  4BKX A;  5CVI A;  2OZU A;  1ZRE A;  4WXH A;  3S3M A;  1D3Y A;  4EM0 B;  2DYS H;  4GYI A;  2R7R A;  1QZY A;  4BXX J;  3V8J A;  1V5F A;  5FLM J;  3Q0W A;  3ASN H;  2BY3 A;  4FX4 A;  5FLV A;  2BVM A;  3DV8 A;  4ZDO A;  1IUY A;  4AID A;  3GWZ A;  1IN6 A;  2EIJ H;  2KIF A;  5BNG A;  2A68 F;  2IEK A;  1B1B A;  1XSV A;  4IL6 C;  4UVC A;  3ZMT A;  4A0Y A;  2CQQ A;  4HDU A;  1MND A;  1YS6 A;  3ZQF A;  4BBS J;  1X3W B;  2Y9Z A;  3H36 A;  1AOY A;  4HX7 A;  4HQM A;  4EJW A;  2KL4 A;  1I1G A;  1R71 A;  3TOB A;  4EJO A;  2PN6 A;  2LTP A;  2HU9 A;  2GXB A;  3L2W A;  3K0L A;  2L2O A;  3LSM A;  5BPI A;  1Z9C A;  3IHU A;  3WTV C;  4EGZ A;  4UNO A;  1IN4 A;  4FHT A;  2KLO A;  2KT0 A;  4PJN A;  4MHG A;  3KP7 A;  5K7F A;  3DFG A;  4MTD A;  2PJR A;  3EET A;  1F5T A;  2P81 A;  3LQR A;  1AKH A;  4XOT A;  4RAY A;  3QOE A;  2DCE A;  4I0B A;  2E1M C;  1BBY A;  4Y4R A;  1WH5 A;  1H0M A;  1KQ8 A;  3Q9V A;  2AQE A;  3TP3 A;  4L9N A;  2K40 A;  1T38 A;  2XSD C;  2NVT J;  2GLO A;  2ZFU A;  2XAU A;  4U87 A;  1YIT I;  3DLL F;  3Q5F A;  4NC7 A;  2HI3 A;  4LIV A;  3GLL A;  3LAP A;  4V2G A;  2XAQ A;  1P7J A;  1IN7 A;  4AIH A;  2YX7 A;  1IZ1 A;  3N97 A;  1FX7 A;  2BGC A;  2LF7 A;  1ERD A;  3HGG A;  3AKZ A;  2FOK A;  4ITV A;  1KYZ A;  1PP7 U;  3ZRG A;  1OYY A;  4C2M J;  4A3M J;  2EIL H;  4R79 A;  3OOP A;  3HPG A;  2PJR B;  1YQA A;  1YTY A;  3PO2 J;  1AKH B;  4RB3 C;  2DPD A;  5EGO A;  3KYL A;  4EJV A;  3O2P E;  4B8X A;  2P8T A;  1H88 C;  2QKL B;  2CUJ A;  3S1N J;  1FT9 A;  1AU7 A;  1AA7 A;  3HUG B;  4BHC A;  3CMY A;  3LSK A;  2VBX A;  1WI3 A;  2PFB A;  1Q1V A;  1S7E A;  3M1E A;  2V9V A;  1QGP A;  4B47 A;  1VF9 A;  2QZ8 A;  4IQ4 A;  2V1U A;  1TBX A;  4OIR F;  3LSH A;  5HLH A;  3HGY A;  3OSG A;  5IP9 J;  2FD5 A;  2Q8K A;  4Q48 A;  2HYF A;  1WJD A;  3OOU A;  1I1S A;  5EEA A;  2V79 A;  3CTA A;  5ILV A;  2A3S A;  4LFU A;  3RQ4 A;  1YJ9 I;  5HS9 A;  2G9W A;  2IGK A;  1R5H A;  4LLL A;  2QUF A;  1LFU P;  2IW5 A;  1NG6 A;  1MD0 A;  3FF5 A;  4NC8 A;  2R7O A;  3CLO A;  5E3L A;  3ZXS A;  2JJ7 A;  3FHZ A;  1WI9 A;  5EGO B;  2Z9O A;  2ECB A;  4PSW A;  3A0B C;  1RR8 C;  2KDZ A;  3OYB A;  3HJE A;  3VSL A;  3DEW A;  3A01 B;  3CCJ I;  4JBA A;  3GBG A;  2G7U A;  4JQF A;  2R0Q C;  4X1E A;  3JSP A;  1CF7 A;  3ZN0 A;  1L3L A;  2XB5 A;  2K3P A;  1WWX A;  3HZJ A;  2Y2Z A;  4BDY A;  1OJL A;  4XLP F;  4AYB N;  3DP7 A;  4XL9 A;  2Q2E A;  3HRS A;  1TWC J;  1K4S A;  4LB6 B;  4BAY A;  4CCM A;  2A5W A;  3DPL C;  4L5I A;  3QAH A;  5HDG A;  3CP8 A;  4AC0 A;  3P9I A;  5CPR B;  5J40 A;  5J47 A;  3B02 A;  3LSP A;  3ZQC A;  1A5J A;  4W1U A;  3TGN A;  5KVR A;  3PFI A;  5B3S H;  2ZME C;  1DGW Y;  1REP C;  3QOP A;  4PFP A;  2XB0 X;  1GUU A;  5LGU A;  3SZG A;  1I3Q J;  3OS2 A;  3LNQ A;  4XNF A;  4F91 B;  4WK8 F;  1GT0 C;  5CVR A;  4OU0 A;  2EA2 A;  4O3M A;  3FWE A;  3R6S A;  3F6O A;  5GTI C;  1Y1W J;  1K61 A;  2P0W A;  1T08 B;  3R60 A;  5FKN A;  1CF7 B;  4RGX A;  1Y6I A;  1HOM A;  4LOC A;  1X58 A;  2GIZ A;  3RKY A;  3I55 I;  2BV6 A;  1MJA A;  2K27 A;  5JLX A;  2M1B A;  2HTS A;  5FD6 A;  3QYF A;  3BTC A;  3DPU A;  4AVP A;  2Q2E B;  1OR7 A;  1OCP A;  2JUG A;  4BQN A;  1D1C A;  3QRF F;  2HOA A;  1E3O C;  1BI3 A;  3ISP A;  2JA5 J;  2CMP A;  3PQK A;  3RIR A;  1MMA A;  2VT3 A;  4CXF A;  4S05 A;  5M3M J;  3KYD B;  4FX0 A;  2ZC2 A;  4XM3 A;  2DU9 A;  2NNY A;  1XMK A;  1JXS A;  2PG4 A;  5FKK A;  5C3E J;  1QQI A;  4BBR J;  3S16 J;  5D6E A;  4M6X A;  4CZC A;  3CUQ A;  5GAH J;  1FMV A;  2RNG A;  2CUF A;  5L3E A;  2WB1 N;  2R5Y A;  4ANJ A;  3HYI A;  4J19 A;  2BZT A;  3E6C C;  1H89 C;  2KHM A;  3KP3 A;  3CJT B;  4ZYA A;  1IRZ A;  3KLN A;  1XCV A;  4MQV A;  3FIS A;  5CQG A;  2FX0 A;  3LA3 A;  3L2Q A;  1T39 A;  1LE8 A;  3ZQQ A;  4KIC A;  1OMI A;  1X1D A;  1DPR A;  3HB9 A;  3U9G A;  2AXL A;  4II3 A;  4M6V A;  2QYO A;  1MBF A;  3DBL B;  3BY6 A;  4KIG A;  3FXM A;  5FFX A;  1ZEL A;  4JX6 A;  3K4N A;  3K70 C;  4G7Z F;  3BDD A;  3CUQ B;  4DBR A;  1XCB A;  3L1P A;  4D7M A;  1P4X A;  3FKJ A;  2XDV A;  3DQV C;  4Y7N J;  1B8I A;  2ID6 A;  5K7H A;  2L54 A;  1P4A A;  2D45 A;  5IY5 H;  2L7K A;  3BPV A;  2X6O A;  3LL7 A;  3G73 A;  3ZPL A;  2X85 A;  1PJR A;  5LBQ A;  3W2V A;  1LFB A;  1OCR H;  2M30 A;  3FMQ A;  2CV2 A;  3J81 Z;  1LE8 B;  3BC8 A;  4U7D A;  4LMY A;  4N4O B;  1VQ8 I;  3HDD A;  1MZB A;  4CHU A;  5L3G A;  2FMY A;  2DDA A;  5D8K B;  4WF2 A;  1MDM B;  5L3C A;  4M3G A;  2EA4 A;  2FQ3 A;  2M8G X;  4A0Z A;  2GXG A;  2IBD A;  4Y52 J;  2DJN A;  3QPT A;  4BJ6 C;  2H09 A;  4ZH4 F;  3P9K A;  2ZBK A;  1YO5 C;  1QZZ A;  3BJA A;  1XGM A;  2F48 A;  2LC2 A;  3F9K A;  5K1Y A;  1LB2 A;  4XLE A;  3HOT A;  2MD0 A;  1IXS B;  2JRT A;  2ELH A;  4CCL A;  4YFX F;  1ZAO A;  4ESB A;  2QGU A;  2NXN B;  2QBY A;  4YII A;  1N75 A;  1F1Z A;  1USS A;  2DA7 A;  1S3J A;  2H6C A;  2CQN A;  3TKY A;  1FJL A;  1RES A;  5D5X B;  2DOA A;  3JSO A;  5E20 A;  3FM5 A;  1P2F A;  3KYC B;  2VKD A;  2A69 F;  3H0G J;  3K69 A;  3I59 B;  3CC2 I;  4QTR A;  4HBL A;  2CW0 F;  1NTC A;  2H94 A;  2YX4 A;  4XKC A;  2E60 A;  1LUJ B;  4ZC3 A;  2DQL A;  1UAA A;  4Y3O A;  2W84 A;  4CCJ A;  3IKT A;  2CSO A;  2EWN A;  2HDW A;  3CCM I;  2ZSI B;  3EYY A;  3KEQ A;  3G4S I;  2DLL A;  1E2X A;  2QQ9 A;  2NOG A;  3FXO A;  4C2U A;  1ZLK A;  4OMY A;  2L0K A;  1XS9 A;  1DPU A;  2V4J C;  2QF7 A;  4HRI A;  2QBY B;  1X2M A;  4HAM A;  4E7I A;  3DWL E;  1SVL A;  3BQZ A;  1W1W E;  4LGW A;  3DU5 A;  4PUS A;  1MBE A;  4MEY F;  4EEF G;  3WOD F;  4LLN A;  3HSR A;  3SDB A;  2E36 A;  5EDN A;  4O5V A;  3BCB A;  4BHB A;  2FSW A;  2EFO A;  4DQ2 A;  1LNW A;  2H8R A;  1FEX A;  1ZG3 A;  5JI6 A;  3ZR8 X;  4XKB A;  3T0Y A;  3GME A;  5FLX Z;  4E7Z A;  4HW0 A;  3FDY A;  5LEJ A;  2GIV A;  1OYW A;  2HGC A;  2IPQ X;  2TRT A;  3V7C A;  4IJA A;  4BEH A;  1XD7 A;  1UG2 A;  3JRC A;  4V19 K;  4KN4 X;  2O9L A;  2MH2 A;  3OYI A;  1RKW A;  1ETW A;  2EBI A;  3L2C A;  5GTH C;  4U0Y A;  3TO6 A;  4F93 B;  4DYR A;  1WJE A;  2TCT A;  1FTZ A;  5DS9 A;  1FYM A;  3TMO A;  1LDJ A;  5J1R A;  5E8G A;  3PIP F;  4IRI A;  3CZ6 A;  3HEF A;  3KCC A;  3ML6 A;  2UWM A;  2DMQ A;  4LIU A;  3QYE A;  1D8K A;  1EH7 A;  5J1U A;  4XRS A;  1X19 A;  3Q0U A;  4NB5 A;  1QBJ A;  5F27 A;  2O6G E;  1FZP B;  1DP7 P;  1GVD A;  4RGU A;  2WA0 A;  3I4M J;  3HKZ N;  1U0J A;  3QWL A;  1D5Y A;  2X6Y A;  3D5S C;  3OL4 A;  5E1X A;  1W36 D;  1EH6 A;  2OV7 A;  3JRG A;  1X1A A;  1XG1 A;  2Y0M A;  4BEH B;  5IT9 Z;  1VZ0 A;  4M3F A;  5KCM A;  3RKQ A;  4FT8 A;  1WHU A;  2XV4 S;  2F4O B;  1SD6 A;  5LRR A;  3D1N I;  5KK1 A;  4XLA A;  2DN0 A;  4C3I J;  5F04 A;  4IQJ A;  4IOC F;  3NAR A;  4ON0 A;  5EEG A;  2HYG D;  4HQE A;  2EV0 A;  3U1K A;  1JKO C;  2XF5 A;  2WAQ A;  3LOC A;  2F5E A;  1C0W A;  1J7K A;  2ZXH A;  1I50 J;  3GEZ A;  1UST A;  2STW A;  2MC3 A;  1A04 A;  2A6E F;  2LG4 A;  3BTL A;  2X6X A;  3GTL J;  2MLG A;  1ZG1 A;  2RRE A;  3GUD A;  1BJZ A;  4AVZ A;  4XQF A;  2HDD A;  2BY2 A;  2R3S A;  5HLG A;  2K85 A;  1RC9 A;  3FKI J;  1FPQ A;  4XLC A;  3R0A A;  3E6B A;  2F2E A;  3LFK A;  2HR3 A;  1Z05 A;  1FP2 A;  2STT A;  5F1J A;  5FKL A;  1VFC A;  1WJB A;  2X6W A;  1POG A;  2LKX A;  2XAS A;  5JLW A;  2PMH A;  4NDL A;  3LA7 A;  3RPQ A;  3QPL A;  4PFO A;  5HNH A;  4I02 A;  3ELK A;  4YRV A;  3KET A;  4B44 A;  2OCE A;  3F72 A;  1WFX A;  3CCQ I;  4A6D A;  2DO7 A;  2IGM A;  5FKM A;  2DA1 A;  2CQX A;  3JAM K;  1JHF A;  2VIX A;  3SEQ A;  4I2O A;  1R9T J;  3ZQH A;  1BR2 A;  2CG4 A;  1W4M A;  3RTR A;  3MFK A;  2EH3 A;  3H1C A;  3HOX J;  4I09 A;  1OCO H;  2VKE A;  1G3W A;  3SJM A;  2H1L A;  1ONV A;  4KMF A;  1VQO I;  2K3F A;  3VEP A;  3ZCO A;  1UG0 A;  3BZC A;  5AIQ A;  4L0Y B;  2P7C B;  1WRJ A;  2OPT A;  3MEX A;  4AU7 A;  5E1Z B;  1IAW A;  4AIJ A;  2W48 A;  4Z6Y A;  5M5Y J;  1HKQ A;  4B3A A;  2MG4 A;  1VTN C;  3N4M A;  4ZYH A;  2EIK H; 
#chains in the Genus database with same CATH homology
 2MYS A;  5LD2 C;  4NC7 A;  2CV0 A;  3EUK L;  4LIV A;  4JOM A;  3H35 A;  3HOS A;  4BE0 A;  1T95 A;  4ZTF A;  2I8D A;  1ERD A;  1YX5 A;  4BL0 B;  2DT6 A;  3AKZ A;  4ITV A;  2R7Q A;  3ZRG A;  3EPZ A;  3OYG A;  2VQG A;  4R79 A;  2F6C A;  2HZD A;  3HPG A;  2PJR B;  3DKY A;  2KPM A;  4XN0 A;  4B3X A;  2VJJ A;  4GRI A;  4H4K C;  1MNE A;  3KYL A;  3DTK A;  4D9J A;  3E1S A;  3W2W A;  3DTE A;  2IS1 A;  2QKL B;  2CUJ A;  4CH7 A;  3CP2 A;  1EA3 A;  2BW3 A;  4E7K A;  1AA7 A;  1V5E A;  3HUG B;  3TBI A;  3LSK A;  4C9Y A;  1D1A A;  3I9V 2;  3PL8 A;  1V5G A;  2WAF A;  4B47 A;  4IQ4 A;  2QKM B;  4CCN A;  4BE2 A;  3LSH A;  1Z3Y A;  4BJT A;  5KHD A;  4E7H A;  2KDO A;  3CJR B;  3IAS 2;  3K6G A;  2W1O A;  1WJD A;  4RLF A;  3OOU A;  3VYT B;  4E7S A;  3HG9 A;  3W3C A;  2VQC A;  1BR4 A;  2IGN A;  2CW8 A;  2VXZ A;  1MMN A;  3RQ4 A;  1LFP A;  2IGK A;  1D1B A;  1LDK B;  1NG6 A;  4C2T A;  3A1Y A;  4NC8 A;  2FUG 2;  2R7O A;  4B43 A;  2VKH A;  2Z16 A;  3ZXS A;  1SAU A;  4OAY A;  2X1D A;  4DIQ A;  4BUP A;  4PSW A;  4PJM A;  3OYM A;  3OYB A;  3OYH A;  4DGW B;  3VSL A;  2M0M A;  4HEA 2;  2O5R A;  2IS4 A;  2BW3 B;  3OYJ A;  3GBG A;  2LYC A;  3K4J A;  1Y56 A;  3K4B A;  3V42 A;  1X4P A;  3LMM A;  4JQF A;  3IAM 2;  3PNV A;  3FHN A;  1SFK A;  5FRO A;  2K3P A;  4HPQ A;  4XOR A;  3IUO A;  4MLO A;  2V26 A;  3OYC A;  3FBN B;  4BDY A;  3CF2 A;  4XL9 A;  4CSW A;  1GLN A;  3PSI A;  1WJF A;  4QPQ A;  1QHG A;  4CCM A;  2A5W A;  3DPL C;  2Z2S B;  1Z3X A;  2XF7 A;  4RM2 A;  4XLH A;  3CP8 A;  1G59 A;  3OMY A;  2E5Z A;  1DQU A;  1Z7L A;  5CPR B;  5HLT A;  4Y33 A;  3LSG A;  2R7X A;  2KMU A;  5LFA A;  2WAD A;  2BOL A;  3L2V A;  4FAS D;  3VSK A;  1DGW Y;  3K10 A;  2V6E A;  4PFP A;  3OS2 A;  3SEZ A;  3SZG A;  4ZJZ A;  4XNF A;  4E4H A;  4F91 B;  2CS3 A;  1PYV A;  2HVQ A;  2W82 A;  2L5Q A;  2GOM A;  1R6R A;  2VLA A;  2P0W A;  3BLY A;  1Y6I A;  3HPH A;  1T0F C;  1QHH D;  2R7U A;  3RSN A;  2M4G A;  3K4L A;  4BU2 A;  3QYF A;  2W4S A;  2LOO A;  2NOJ B;  3DPU A;  4U7B A;  2HVR A;  2W7N A;  2Q2E B;  2JUG A;  4BQN A;  1D1C A;  2BVL A;  2CMP A;  3CJQ B;  3PUB A;  1X4O A;  3FBI B;  3OR2 C;  1MMA A;  3QOD A;  2LH9 A;  2K9L A;  4PK4 A;  4BXF A;  3DKX A;  4PSX A;  3EUH C;  4XM3 A;  2HPI A;  1TZL A;  2F4I A;  4IKF A;  2CUZ A;  3LFU A;  4CZC A;  1J09 A;  2E5N A;  1FMV A;  2RNG A;  5HOO A;  4ANJ A;  3CMM A;  3HKZ A;  2KHM A;  2KZV A;  2Q1Z B;  2XF6 A;  3QYB A;  1W36 C;  4ZYA A;  1QU3 A;  4IZZ A;  3LSI A;  5CQG A;  4XKV A;  1P9Q C;  4YEJ A;  4E6K G;  3D5L A;  5JHF A;  2VJI A;  2K9M A;  3L2Q A;  3DEE A;  4BQQ A;  3ZQQ A;  4N4N B;  2VJ5 A;  1MMD A;  1X1D A;  4J01 A;  2HPM A;  1N77 A;  2KP6 A;  4II3 A;  2VJ4 A;  1X1B A;  1KON A;  2XC7 A;  2JVG A;  3DPT A;  4XKW A;  4F3Q A;  1ZEL A;  3K4N A;  3K70 C;  2X1C A;  3S8P A;  1WJA A;  3H0D A;  3I3L A;  4II2 A;  4CUG A;  4DBR A;  2DT7 B;  5FRN A;  3PNT A;  4PJL A;  3OYA A;  3FKJ A;  4RMN A;  2XDV A;  3DQV C;  4RM3 A;  2M7A A;  4BQO A;  3VYS B;  4KIT B;  4HG2 A;  2L7K A;  4NQW B;  2WY8 Q;  4P1W A;  3DTI A;  3LL7 A;  3C2G A;  2X85 A;  2KRH A;  4DJA A;  1PJR A;  3W2V A;  2VQH A;  3OWT A;  2X51 A;  2CV2 A;  1N78 A;  3BC8 A;  2UUZ A;  4NUB A;  4N4O B;  3UNG C;  1BOB A;  2R4G A;  3H9G A;  1WJ5 A;  1X1C A;  2WAE A;  1BR1 A;  4BJ6 C;  1D0Y A;  4C30 A;  3BG7 A;  4KJZ A;  2DJI A;  3PNY A;  3RCO A;  4P5O A;  3OYE A;  2LC2 A;  3F9K A;  3OL3 A;  3ZGK A;  2HNH A;  2IGO A;  4XLE A;  3HOT A;  2MD0 A;  3ONQ A;  3K70 D;  3IP4 B;  4NNJ A;  5TGT A;  2K5C A;  4CCL A;  2ZXI A;  2JVH A;  2KRC A;  4KT6 A;  2AQF A;  2R7W A;  4EAT A;  1N75 A;  3A4C A;  4HNT A;  2ZSH B;  4LIT A;  1YX3 A;  1WJC A;  3M8J A;  1D0Z A;  4FET A;  3MMY B;  3KX2 A;  3PJR A;  2DOA A;  2MC4 A;  4RLQ A;  3DU6 A;  2VKD A;  4ZTJ A;  2F5V A;  2M3A A;  1HA8 A;  4ZDL A;  3HC7 A;  2VPL A;  4BAC A;  3TL4 X;  4DOZ A;  3BCA A;  3HL2 A;  4XKC A;  4XN3 A;  3G2B A;  2E60 A;  2KQR A;  5CQE A;  4ZC3 A;  1UAA A;  4Y3O A;  4CCJ A;  2HDW A;  2ZSI B;  4XOP A;  1S9H A;  2R7T A;  4E7L A;  3OY9 A;  5HVQ C;  1MMG A;  1UEL B;  3OIP A;  4BE1 A;  4C2U A;  3EUA A;  4XLF A;  2HVS A;  1NG7 A;  5HNF A;  2V4J C;  2Z1D A;  3DLA A;  4HRI A;  2CFO A;  4E7I A;  3S3O A;  3DWL E;  3VWB A;  2IS2 A;  5FRM A;  3DU5 A;  4PUS A;  3OYK A;  1E0E A;  1IRX A;  3U21 A;  3SDB A;  1YE9 A;  3KEY A;  3N05 A;  3BCB A;  5KNL A;  4HST A;  3MKW B;  3ZR8 X;  4XKB A;  4CCK A;  3W2A A;  2PMZ A;  1FMW A;  4E7Z A;  3BG6 A;  3FDY A;  3OS0 A;  2Y0S A;  4BJ5 C;  4XMY A;  2W00 A;  3VYR B;  3SYT A;  4HNU A;  4BEH A;  3S32 A;  3VDX A;  4U87 A;  4CCO A;  3CES A;  4G6T B;  2MFZ A;  1JI8 A;  2GOX B;  3OYI A;  4D1Q A;  3NWS A;  2LBF A;  2L9N A;  3H5N A;  3L2R A;  4F93 B;  1WJE A;  3TMO A;  1OLT A;  3HXL A;  3UR3 C;  3OYL A;  3CZ6 A;  2WBM A;  2HQA A;  2UWM A;  3OYF A;  2CV1 A;  4LIU A;  3K4C A;  2VAS A;  3QYE A;  4BGD A;  2RQQ A;  1X19 A;  3H9Q A;  3AL0 B;  2WA0 A;  3J7A Y;  2OC6 A;  3L2U A;  1U0J A;  2XSJ C;  2X6Y A;  3D5S C;  3OYD A;  3OL4 A;  4AYB A;  3PFY A;  4ZDP A;  1W36 D;  2LY1 A;  2OV7 A;  1LVK A;  1X1A A;  3VYU B;  5CKT A;  3OR1 C;  4XR6 A;  4J00 A;  4BEH B;  2A6T A;  2MAB A;  1VZ0 A;  3RPU D;  2VB6 A;  3H9J A;  5KCM A;  1DGR M;  3M1C A;  1DP3 A;  3OYN A;  4DBQ A;  2LBF B;  4KIS A;  1Z21 A;  3PSF A;  4XLA A;  3S93 A;  4X0G A;  2CW7 A;  1K6Y A;  3A2K A;  4IQJ A;  4B48 A;  3S3N A;  2WY7 Q;  2DXI A;  2E1M B;  2VQL A;  2LRD A;  4YEL A;  2LRE A;  1OR7 C;  1G8X A;  2XF5 A;  2WAQ A;  2L9S A;  1D0X A;  2JSP A;  2ZXH A;  3S3M A;  2R7R A;  4F52 A;  2LG4 A;  2X6X A;  3MKY B;  1V5F A;  4IX7 A;  2RRE A;  4AVZ A;  2ELJ A;  2BVM A;  2V1N A;  4XQF A;  4ZDO A;  4LG3 A;  3K4K A;  4XLC A;  2M4K A;  1LKX A;  4XON A;  3OS1 A;  4HSR A;  1WJB A;  2OUM A;  1MND A;  2X6W A;  3AL0 C;  2CH0 A;  2X1E A;  4PJJ A;  2R7V A;  2JA2 A;  3OIQ A;  2KL4 A;  4PFO A;  4BDZ A;  5HNH A;  2IS6 A;  3C2H A;  3K4M A;  2WB1 A;  4YRV A;  3MD2 A;  2VXD A;  4B44 A;  2HU9 A;  1MW7 A;  1WFX A;  3L2W A;  4BS9 A;  4OWR B;  3NWT A;  2L2O A;  3LSM A;  2IGM A;  2VL8 A;  3D5R C;  2VIX A;  3SEQ A;  3H5R A;  2LY2 A;  1BR2 A;  2KLO A;  2M7B A;  2UV1 A;  4OAZ A;  4PJN A;  3RTR A;  2PJR A;  2R7S A;  3H5A A;  4F92 B;  4F55 A;  3E0J B;  4XOT A;  3QOE A;  2DCE A;  3ZCO A;  1UG0 A;  2E1M C;  4CA0 A;  2V7F A;  4Y4R A;  4AU7 A;  1TT0 A;  2AQE A;  3AFH A;  2IXS A;  3MKZ A;  4E7J A;  2ZFU A;  2XAU A;  4QPO A;  2V9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...