3S2WA

The crystal structure of a marr transcriptional regulator from methanosarcina mazei go1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
146
Chain Sequence
b'GISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDERSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title The crystal structure of a MarR transcriptional regulator from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Transcription regulator
total genus 48
structure length 146
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3s2wA00
1B9NA 3GW2A 3WG9A 1J9IA 4LJZF 2D2WA 1W7PA 2AXLA 3W6KB 2JPCA 4EM2A 2VE8A 4HX4A 2PEXA 1B59A 2P7CB 1FYLA 3J7AO 3CO6C 1T6SA 2PG4A 5D8KB 4HX8A 2O03A 1SFXA 3I59B 1KQ0A 2DO7A 4LLLA 1O3TA 5HLHA 2XVCA 3KE2A 3V7RA 1NHAA 1BN5A 2G7UA 4BHPA 4ETSA 2ZFWA 5TJJA 2L3DA 4A6EA 2Z5UA 1PP8F 2FBHA 4I7HA 4UXNA 3HRSA 4AWXB 3I5UA 2MA3A 3EETA 3ISPA 2IVMA 3F8MA 3GFMA 1SD4A 3KZZA 3U9GA 1ON1A 4CICA 4YFNF 2XASA 4YFXF 1Z91A 2JSCA 1I5ZA 3CUQB 1XCVA 4I09A 1BJAA 4M9SA 1Q1HA 2BE5F 5CJ9A 1QO0D 4HF1A 4L9JA 3RTRA 4P96A 4XSXF 3F6OA 3HRUA 1YTYA 2ZBKA 1ZG5A 4Q5SF 5IT9Z 1S7OA 1LDDA 3PQJA 3VOEA 5HLGA 2WC2A 3RKYA 1G3TA 3O3KA 4L18B 4O6JA 2L02A 4XLNF 1R00A 1JHHA 5F1RA 3LFKA 2EV5A 1H9TA 2C6YA 2ZCWA 5ILVA 2XHKA 2RVCA 3EDPA 3I53A 5L3EA 3ULQB 2NS0A 3KCCA 3HOTA 2CW0F 1R1VA 3FHZA 4OIQF 3GWZA 4I98B 3HSRA 1V3FA 1GVJA 3TOAA 1WI9A 3ZN1A 3BZ6A 4M71A 3E6CC 4GXOA 4IVNA 1U78A 1XSDA 3TKYA 2FXAA 2WWYA 1JGSA 3BJOA 3H3ZA 2DQRA 3QPHA 5J8FA 2DI3A 1RI7A 3C18A 2QWWA 5L3FA 2MLKA 4KNYA 3P7NA 3TGNA 1FBUA 2QM3A 4IRGA 2M5WA 4L9NA 2V1UA 1IXRC 5JFRA 1XGOA 2GA2A 3RIRA 3WGIA 5FFXA 5ICCA 2PJPA 2QYOA 1FYKA 2IA2A 2XV4S 3T1BA 1IF1A 4L0ZB 2FSWA 2YX7A 1ZAOA 3ZN0A 4AD9A 1Z6RA 2QZ8A 5FD6A 2IP2A 4G7ZF 5ICFA 1YS6A 4M74A 5HDKA 1JHFA 1K78A 2OZ6A 5LEKA 4HQEA 1LVAA 4EJVA 3CO7C 2L54A 2GA1A 1XDSA 2ISYA 4OU0A 2P5KA 1TNSA 3WE3A 5J8CA 3K0LA 4CO8A 4ENNA 2P7VB 1YQAA 2E1NA 1C0WA 2H27A 2CWEA 2V79A 4D0PA 4IXAA 2EFWA 2P5VA 2FEZA 3O2PE 5F6FA 4A0ZA 4ESFA 3V8LA 2FU4A 2EV0A 4M9ZA 1ZRCA 3TO6A 3KZYA 5E8GA 3F23A 3TDZC 2CSOA 1S29A 3P9CA 2ESHA 4G6QA 1X3UA 1XGSA 1H9GA 2H6BA 1XSXA 2RKHA 4GCVA 3Q5FA 1RUNA 1BIBA 1XGNA 2OQGA 3CUOA 2A69F 1B4AA 5BPIA 3GVAA 3ZPLA 3QAHA 3MZHA 5JR3A 2HQNA 4UV8A 2E1CA 1OYWA 1TQPA 1BI1A 1P4AA 2DAOA 4CZZA 4BXUA 1F4KA 2PMUA 2M87A 3GXOA 4P5OA 1WQ2A 1LDKB 3E97A 3CLOA 1ZREA 3GZ6A 2QENA 4YG2F 1BI3A 2UZKA 5E1ZB 1OYYA 2PN6A 5ILSA 4RS8A 1QQIA 3R4KA 1W7PD 4G7OF 3OOPA 4XRFA 3J81K 1CF7B 2ELHA 3WTTC 3T8RA 5CYVA 3TO9A 4LK0F 2Y0MA 5ILUA 3Q9VA 1WSUA 1AOYA 2A6EF 2KIUA 1D3YA 3F6VA 2A68F 5CVIA 3WTSC 5CVVA 3BJ6A 5LBQA 3IKVA 4MTDA 2MBFA 1TBXA 4M72A 1G3SA 3IC7A 2IJLA 2QBYA 4U7DA 2NRAC 5E17F 4ZYGA 1J0RA 3D0SA 3FXRA 4AIJA 3HRMA 2ZNYA 3VFZA 3BDDA 2ESNA 2DW4A 2CFXA 3VODA 2NNNA 2EA4A 1HKQA 3T0YA 3CDHA 4WK8F 2VBXA 4DNCA 2KKOA 4BQAA 3KP3A 4WXHA 3R0JA 2ACJA 4HYEA 1UHMA 3B02A 5FO5A 3WU1B 5FLXK 4ENMA 2W57A 2FQ3A 1DUXC 3QOPA 3BJAA 4OMYA 1P4XA 1DPRA 4KIFA 3NQOA 4U0WA 4HBLA 3R0AA 3GX4X 1IUYA 3ZMUA 3KLOA 1QGPA 3R6SA 1P6RA 1ZARA 4A0YA 3DFGA 1ZGJA 4I2OA 3K2ZA 3SZPA 4KA4A 1G3WA 1BOAA 1FNNA 3FMRA 3E6MA 1YYVA 3T8TA 3MFKA 5LGTA 2BGCA 2CO5A 3LWFA 3SZTA 5BPDA 4ZYEA 5LGNA 3O6BB 1Z7UA 3M9AA 4P55A 2Y75A 3LA7A 4XSZF 2VBWA 3C3WA 2PBIA 2R7FA 4ZH4F 4KT5C 4BHBA 3HTSB 3LSTA 3K1PA 3REOA 1W7PB 3GFJA 2DBBA 3F21A 4MTEA 1QZZA 1TLHB 5CVUA 1ZRFA 2KRFA 2Q8KA 2VC1A 4PCQA 3IRRA 6PAXA 4KYWA 4LFUA 1WKMA 4EVIA 4EGYA 3HOSA 1IN8A 3BPXA 1R1UA 2FNAA 4DQ2A 4A2UA 3W6JB 3M8FA 2NAZA 5LEJA 2J5PA 1R22A 4S05A 2HEOA 2EB7A 3BP8A 2JPBA 2YSRA 2OA4A 4N9HA 2Q2EA 1PP7U 5EEHA 1YO5C 2XRNA 1I6XA 5DCFA 2JTVA 3FF5A 4GYIA 4KIBA 1HW2A 3BWGA 1T98A 2FMLA 5E1XA 4B09A 4AVPA 4N0BA 1Z6TA 2A61A 3D5LA 3ERED 3WTYC 1BM9A 5DDGA 5FGMA 5LRRA 1T38A 2LSOA 2RV8A 3RYRA 3J80Z 4I02A 3KP5A 3ZMZA 4Q48A 2FF4A 1YIOA 1D5VA 1STZA 4A6DA 1YLFA 5D5VB 2HOEA 4P9FA 2LDUA 2H6CA 2DTRA 2EFPA 2OBPA 4IPAA 2K27A 4XLPF 2K7LA 4EGZA 5JVTA 5L3DA 4HV6A 4KN4X 1YW9A 2P5LC 1G4DA 5K5QA 3G3ZA 1LEBA 2CQKA 3KETA 3L00A 1RIOH 4UVBA 1RNLA 3E5QA 2L01A 3MAJA 3J80K 1I1SA 4ASNA 1OYIA 1S3JA 1XSVA 2IA1A 1XN7A 4MEXF 1G6NA 3JAMK 1O7FA 1KU9A 3ZMVA 1VTNC 2LF8A 3ZMDA 4XBFA 1R1TA 4B8XA 4OOIA 2QQAA 2PMHA 2RNJA 3RKWA 1KU2A 4G8XA 1HXDA 1T2KA 1L0OC 1FZPB 4PZJA 4FT8A 4U0VA 2F5EA 2RGVA 1HBXG 3FM5A 3QP5A 3G73A 2RQPA 4EQQA 3L2CA 3KP4A 1FYMA 1KYWA 3WTWC 1B6AA 3IKTA 3TQNA 1OMIA 5ED4A 1KGSA 2DPDA 2COMA 4OIOF 2LNBA 4NB5A 3ABUA 1H0MA 1K78B 1ZHFA 4UNOA 1D8KA 2VN2A 4A12A 2DFIA 4RGSA 5E1WA 4JK1X 3I58A 1ODDA 5DV5A 3V7CA 1P92A 1FWZA 3NRVA 1S7AA 2OAZA 1YFHA 1ZG1A 1FSEA 4LMYA 2CYYA 3HIFA 4RGXA 3JSPA 4Z2YA 2A6HF 4TV7A 2F5FA 4CHUA 5IT3A 3QU3A 1FSHA 4LLNA 2D1VA 2RDPA 2IPQX 2Q0OA 3NEUA 3I4PA 3T5XA 3WTUC 1T39A 3MCZA 1ZYRF 1FT9A 2A3SA 1E2XA 2XAFA 2XIGA 2KIMA 4CYDA 4HAMA 2IT0A 3C7JA 2FE3A 1ZRDA 2V1XA 2YR2A 1LJ9A 2LF7A 2EFNA 1W5TA 3DV8A 2D1HA 2HKOA 5CVJA 3LQRA 3E3VA 1R58A 4MHGA 2FOKA 4EV0A 3DXJF 3RYPA 3V7SA 1WWXA 2WV0A 2UXXA 1V4RA 5HS7A 3H3UA 4HF0A 1MDMA 3J81Z 2K86A 3SXYA 4UUVA 1TNTA 2DQLA 2O6GE 2JT1A 4S04A 3TOBA 3N4MA 1IRFA 3GLXA 2D45A 2M30A 5ICEA 4WX9A 3QP6A 2GQQA 3WU0A 1MJBA 4KFCA 1F5TA 4KMFA 3Q9SA 4MNUA 1XDUA 3JW4A 4I0AA 1ZH5A 3M1EA 5HDNA 3MEXA 4MEYF 1XGMA 2OU2A 2MH2A 1FBSA 5E20A 1KYZA 4ZZLA 2VE9A 2VBZA 4HDUA 1SMTA 4HOBA 2ISZA 1SAXA 3VEPA 2HTSA 5K1YA 4KN7X 2QBYB 1PDNC 3P9IA 1TW3A 5D5UB 1A04A 2VONA 2O8XA 2OZUA 5BOXA 3V4GA 2STTA 4FHTA 4CXFA 3GFIA 4ZZDA 2ZMEA 2M8EA 3LAPA 3LAJA 4RB0A 5AIQA 4IRIA 2KJCA 5FLXZ 1IZ1A 1HSTA 4RB3C 3MWMA 3AAFA 1R5HA 3EUHA 5ICGA 4NQWA 1YW7A 4FX0A 5LLQA 4M73A 1LB2A 4G9YA 4HF2A 2PI0A 3DF8A 3PFIA 3QRFF 3B73A 3IHUA 2MC3A 4UHTA 4O3MA 4KICA 4LG0A 2E7XA 2UWMA 2DK8A 1XD7A 3WTZA 4IHTA 5K5RA 2ETHA 1FP2A 1ZG3A 1DP7P 3LQQA 2STWA 5E8IA 3GUDA 1L3LA 1REPC 1IXSB 2O61A 1P2FA 1Z1DA 1IN5A 3COAC 5FB2A 2VC0A 1FPQA 4IRHA 2W85A 3MZYA 2HR3A 2DU9A 4ESJA 2HWVA 3IRQA 1ULYA 1ZLJA 3FXUA 1GXPA 1K7AA 1U2WA 4ENKA 2HYGD 1KQ8A 3GF2A 1GHCA 1HKSA 1E17A 5HS9A 2YU3A 4EM1A 3HUGA 2GAUA 5BMZA 3GO5A 1ZLKA 2ZNZA 4HLXA 2M45A 2A5YB 5DCMA 2Z33A 3RI4A 5DUKA 5D4SA 4ESBA 4I01A 1FLIA 3DKWA 2MH9A 3GEZA 2M1BA 5JHUA 4A0XA 4GGGA 1TQIA 4LB6B 4JBAA 1HW5A 2DT5A 3EQLF 2HYFA 3F22A 1PUEE 1EH6A 1FBQA 3WGGA 5HOOA 4RAYA 4FX4A 2GZWA 1UB9A 4G7HF 5H20A 4WCGA 4Q47A 2GWRA 1BBYA 3WE2A 1UHWA 2TDXA 4YIIA 1CGPA 2UXNA 1TTYA 4IJAA 3OV8A 4KDPA 4EM0B 5D4RA 3E6DA 3WODF 5CLSA 2O0YA 2DK5A 1D8JA 1S8NA 2EFQA 2G7HA 4U88A 1XMAA 1I27A 3ROUA 3ZP5A 2LKPA 3I71A 5L3CA 5AIPA 3U1DA 1ZGAA 1U5TA 3ZMSA 3S2WA 1HKTA 1XCBA 3M8EA 4F7ZA 2XROA 2HTJA 1B1BA 4A5NA 3WTXC 2Z99A 5L3BA 3DQVC 2EWNA 4Y13A 2GXGA 2PQ8A 5LRSA 2F5DA 4RAZA 1KU3A 2HS5A 5H6QA 1R23A 3HSEA 1LNWA 2H94A 1BI0A 1OPCA 1BC7C 3IL2A 2XKOA 2IW5A 5A2QK 1LQ1A 2GIVA 2L4MA 2HZTA 3L09A 1S6LA 5HDGA 1R36A 3RKXA 1W4MA 2P8TA 3JAMZ 3L7WA 4K2EA 5BS6A 5E18F 5D6EA 1YS7A 3ABTA 2EK5A 1F9NA 3PQKA 4CDGA 1YG2A 2L4AA 3I59A 1I1GA 4PGHA 3BPVA 4EJOA 4EJTA 4HZFA 5TRDA 2ZXJA 5ERIA 1MZBA 1W5SA 1IXCA 5DD8A 2P4WA 1Z05A 2W24A 5EEGA 4WF2A 5LHHA 1J75A 1IN6A 4RB1A 3U2RA 1O3RA 1QPMA 4HV5A 3FMSA 3R60A 2XUBA 4Q4ZF 4BAYA 1RZ4A 4AIHA 3FX3A 1R7JA 3SQNA 3RDIA 3JTHA 3BROA 3I0TA 3HHGA 1EV7A 3GFLA 3JSOA 2EJRA 3CUQA 1J7KA 4Y15A 5HVQC 2B0LA 2V9VA 2XAJA 3BOQA 4ZYDA 2OQRA 4GO1A 3F8FA 1B9MA 4BNCA 2ZKZA 1QBJA 3E5UA 1G3YA 2RN7A 4LB5A 1IN4A 3FXQA 1UFMA 3HHHA 4KUMA 1O3SA 1OR7A 5IT9K 2MLGA 4EJWA 1O57A 3WGHA 4PDKA 2P6SA 2EA2A 4MQVA 3KP2A 3HYIA 1JXSA 2HFHA 3HRTA 1IRGA 3ZQ7A 4IHSA 1MD0A 3C1DA 4M9XA 4GYGA 4O5VA 5KVRA 1USTA 5AONA 3QU6A 4G94A 5JI6A 3F8BA 2HGCA 1FY7A 3FZVA 4MQ9F 1KA8A 4WXDA 1SFEA 1U8RA 3I54A 3P9KA 1IAWA 3RJPA 4LK1F 2ADUA 3DEUA 2BBYA 4CGZA 2IRFG 2QVOA 5F64A 4L9VA 2FRHA 1QNTA 5DUIA 4QLCU 1MKMA 1TW2A 5HLIA 2HDCA 4LGWA 1KU7A 2PLYA 1GXQA 1U6GA 3ML6A 3K69A 5L3GA 3GYHX 1MDMB 2ZJ2A 2A07F 3ZMTA 1AWCA 3GZ5A 2NYXA 4R8HA 1HW1A 3IWZA 2E7WA 2DLLA 5H6RA 1ON2A 3N97A 3M7GA 4RGRA 2OD5A 2KIFA 3MQ0A 5LHGA 5KK1A 2F5CA 2AS5F 1DPUA 2X0LA 4M6XA 4L9TA 3BY6A 4AIKA 3F72A 1T0FA 3ECOA 1DDNA 4U7BA 1WRJA 4N9IA 2VXZA 3I64A 4HA8A 3TDUC 2H09A 1SMYF 4L5IA 3V8KA 3QPTA 1BC8C 5K5OA 3SFZA 2O3FA 3H92A 1SD6A 2YPRA 5D5WB 2CG4A 3CJNA 2ZMEB 4HW0A 3F3XA 3HTUA 4RB2C 2J5OA 2YX4A 1SD7A 2MD5A 2R3SA 1FX7A 4LD5A 1LDJA 4EJUA 4I0BA 3DP7A 4YFKF 1UCRA 5D8LB 4LLGF 2FNPA 4WXCA 4U0YA 1TQMA 1U3EM 4UV9A 3EYIA 4IF4A 3WTVC 1K79A 2HQRA 3RPUA 1O3QA 3DPTA 2QQBA 4E70A 1MGTA 3CTAA 2W84A 1U5TC 4R1HA 1BI2A 5HS8A 1SFUA 1JE8A 3SHFA 4JQFA 2HKXA 4HDVA 1KQ9A 2V1DA 4PGGA 4LG0B 1LEAA 4M6YA 4OMZA 1R5GA 3DPLC 1P4WA 3TO7A 3FWEA 1K6OA 4P9UA 2G9WA 4L0YB 5CVRA 2FMYA 1IW7F 4KIGA 1ZN2A 3K9TA 2K02A 2DPUA 4NHJA 1Y0UA 1RUOA 2BV6A 3L9FA 2R7DA 1MJAA 3FM3A 3ELKA 3KP6A 5DYMA 1J59A 1CF7A 2VBYA 4HX7A 2VOOA 1SD5A 3VB2A 2K4BA 1QZYA 4OIRF 2VOPA 2JZYA 1HQCA 1O7LA 1XMKA 2RC4A 4BH9A 2QLZA 4RGUA 2K4JA 2KJBA 2XAQA 5FD5A 2XKPA 4G6DA 3F8NA 2VT3A 2PFBA 4ON0A 2FA5A 5LGUA 5DCMB 4QWQA 2WTEA 2XAHA 3IWFA 2X4HA 2P6TA 3KEOA 4L5JA 1EH7A 4KMUX 3JTGA 2GXBA 3EYYA 3FMQA 1XB4A 2QQ9A 1MJ9A 4BYYA 3V8JA 5D6FA 2NNYA 3ECHA 2V6CA 2Z3YA 1BIAA 2XGXA 2FBIA 3LA3A 4ENJA 1YW8A 2CGPA 3CUQC 5LHIA 4BHCA 4OINF 1IN7A 3F8CA 4UVAA 2BYVE 4A5MA 5BQTA 1FP1D 1USSA 4H0EA 1FC3A 2IA0A 2XAGA 5DEQA 1EH8A 3KFWX 4OIPF 2JRTA 5D5XB 2ZO4A 3K1NA 4EMSA 4UVCA 2F2EA 1F1ZA 1U5TB 4HLYA 4Y17A 1OKRA 4MGRA 2Z9OA 3KEQA 3E6BA 2EFOA 1J5YA 2EV6A 4HQMA 5FFZA 3KP7A 1FOKA 1HSJA 1J2XA 2VODA 2BEOA 4WWCA 4R79A 2QUFA 2W25A 4YIFA 2FBKA 2Y48A 3R61A 1ONVA 5A2QZ 3E5XA 2VT2A 5DD4A 3RPQA 1Z9CA 3K1MA 3KLNA 3HSFA 4ZYHA 3LA2A 5J6XA
chains in the Genus database with same CATH superfamily
1B9NA 3GW2A 3J7AY 3CP2A 3WG9A 3HG9A 1J9IA 4LJZF 2AQEA 2D2WA 1FTZA 1JUMA 1JGGA 3HL2A 5GTIC 3J7ZI 1W7PA 2AXLA 4LITA 3W6KB 2JPCA 4DYRA 4EM2A 5TGTA 2VE8A 4HX4A 2PEXA 1B59A 2DA6A 2P7CB 1FYLA 3J7AO 3CO6C 1T6SA 1ZK8A 2PG4A 5D8KB 4HX8A 2O03A 2KPMA 1OQYA 1SFXA 3I59B 1KQ0A 2DO7A 3K4NA 4LLLA 3L1PA 5HLHA 1O3TA 2HPMA 1YJNI 1HF0A 1Y0NA 2XVCA 2E19A 3KE2A 3V7RA 1NHAA 1HDDC 1RKTA 1BN5A 1VNDA 2G7UA 2GM4A 2XPUA 3IUOA 4JX5A 5F0FA 4BHPA 2XF5A 3LSMA 4ETSA 4GDFA 2ZFWA 4JYKA 5TJJA 5IP7J 3W6VA 2L3DA 4A6EA 2KHMA 1X3WB 3AG1H 2Z5UA 3IH4A 1PP8F 2FBHA 4RLFA 4I7HA 2QGUA 3BCAA 1T95A 3HRSA 4UXNA 4AWXB 3D1NI 3H3VK 3I5UA 2Y0SA 2MA3A 3EETA 3G2BA 1HDPA 4BJTA 3ISPA 2IVMA 3F8MA 3TP0A 3GFMA 1SD4A 4XK4A 3KZZA 3U9GA 4A93J 4RLQA 1JTYA 1ON1A 3BQZA 3CCRI 4CICA 4YFNF 2XPVA 3K2AA 2DFFA 2OF7A 4M3FA 2I10A 1P7JA 2XASA 2L7KA 3K4MA 4YFXF 1Z91A 2JSCA 1I5ZA 3CUQB 1XCVA 4I09A 2R92J 1BJAA 1D1CA 4M9SA 5J40A 2KIQA 1Q1HA 2BE5F 3KX2A 3ZXSA 1VQ8I 2WB1A 4NUBA 1T0FC 5CQGA 5CJ9A 5E79C 1QO0D 2MABA 4HF1A 4L9JA 3M8JA 3RTRA 1O4XA 4P96A 1BL0A 5IYDJ 2RAEA 4XSXF 3F6OA 3HRUA 1YTYA 2ZBKA 1ZG5A 4Q5SF 1BR1A 2IGNA 2IGKA 5IT9Z 1S7OA 2XDVA 2HYJA 4FISA 1LDDA 3BR0A 3OYHA 3PQJA 3VOEA 5HLGA 1ZR4A 2WC2A 2IEKA 3OYLA 3RKQA 3RKYA 1G3TA 3O3KA 4L18B 4O6JA 2VKEA 1JI8A 5DM6F 2L02A 3H1CA 1Y1WJ 4B48A 1R4MB 2MG4A 2ME0A 5GAEJ 1BR2A 3HM5A 1R00A 2V4JC 3DCFA 4XLNF 1JHHA 2GXAA 5F1RA 2JMWA 2R4GA 3LFKA 2EV5A 1H9TA 2C6YA 2ZCWA 5ILVA 2XHKA 2RVCA 3EDPA 5E3NA 3I53A 3RPUD 5L3EA 3ULQB 2NS0A 1W36D 2EZLA 2DA7A 1LFUP 1F43A 3FKJA 2BXYA 1VQNI 3KCCA 3HOTA 2CW0F 1R1VA 2HOAA 3BG9A 3FHZA 4OIQF 3GWZA 4I98B 5EEAA 3HSRA 1S72I 1JJ8C 1V3FA 4P1WA 1W36C 1GVJA 3TOAA 1WI9A 3ZN1A 3BZ6A 4M71A 1OLTA 1XX5A 3E6CC 4GXOA 4IVNA 1U78A 2L5QA 3GCMA 1XSDA 2NOGA 1ORKA 3TKYA 2FXAA 3MKYB 1EF4A 2WWYA 1JGSA 4CA0A 3OYAA 3CCYA 3Q0VA 2X1EA 3BJOA 3H3ZA 2DQRA 3QPHA 5J8FA 5GAHJ 2DI3A 1RI7A 2V1NA 3C18A 1SAUA 3GTGJ 1G59A 1IUFA 2QWWA 3OSGA 1PUFB 3S2DJ 5L3FA 2DMTA 1FEXA 2MLKA 4KNYA 3P7NA 4E7ZA 3TGNA 2KP6A 4A3BJ 1FBUA 3PFYA 2QM3A 4IRGA 3HJEA 3EPZA 2XF6A 4XICA 2H1LA 2M5WA 4L9NA 1MSFC 5FKNA 3G6EI 2IS6A 2V1UA 2VQLA 1IXRC 5JFRA 3W3CA 2DMUA 1XGOA 2FD5A 2B9SA 2XRLA 2GA2A 1ZQ3P 1WHUA 3RIRA 3G1OA 3WGIA 4N4NB 3RCOA 5FFXA 2MGQA 3BCBA 3MVPA 5ICCA 1JKRC 2ZC2A 1E3HA 2PJPA 2QYOA 1FYKA 3UNGC 1VQ4I 4DYCA 2IA2A 5JHFA 2XV4S 3T1BA 2DA1A 2JK3A 1IF1A 2L9NA 4L0ZB 2FSWA 2YX7A 1ZAOA 4ZDPA 3ZN0A 4AD9A 1Z6RA 1Y39A 2QZ8A 1SC7A 5FD6A 1TC3C 1V5FA 2IP2A 4G7ZF 5ICFA 1BA5A 1YS6A 4M74A 4QSHA 5HDKA 4IZZA 1JHFA 1K78A 5KAIC 2OZ6A 5LEKA 4HQEA 1X4PA 3BTCA 4X1EA 1LVAA 4EJVA 2CMPA 3CO7C 2L54A 1DU6A 2JUGA 4DYQA 2GA1A 1Z0XA 1FIAA 1XDSA 2ISYA 4OU0A 4HEA2 2P5KA 1R6RA 1V5EA 3ASNH 1TNSA 3WE3A 2ZJPF 5J8CA 2OCCH 3K0LA 4CO8A 3ZQIA 2P7VB 4ENNA 3OYFA 2K85A 3H0DA 3JRBA 1YQAA 2E1NA 4BUPA 3NAUA 1HCRA 2BXZA 1C0WA 3L2UA 4E6KG 2LC2A 4D1QA 4XR6A 3TBIA 2H27A 2CWEA 2M3AA 4HNVA 2V79A 4D0PA 1NK2P 1R5ID 3OYMA 1D1AA 4IXAA 2EFWA 2P5VA 2N8GA 2FEZA 3O2PE 4XLFA 5F6FA 3BR5A 3RQ4A 4A0ZA 1E0EA 4ESFA 1WPKA 2LLKA 2FU4A 3V8LA 1OCOH 2EV0A 4M9ZA 4FE7A 1ZRCA 3C2BA 2V6EA 2LY1A 3TO6A 3OYDA 1LKXA 3KZYA 1X19A 5E8GA 3F23A 3TDZC 2QKLB 2CSOA 1S29A 3P5JA 3P9CA 1NK3P 2ESHA 1WJEA 1G8XA 2X9DA 1X3UA 2Z16A 4G6QA 1XGSA 3JCUC 1TP4A 1H9GA 4XRSG 2H6BA 1U9NA 2L9RA 1XSXA 2RKHA 3ZCOA 4BDZA 3TMOA 4GCVA 3CCQI 3FK7A 3BR3A 3Q5FA 1S7EA 3H9GA 5GTHC 1RUNA 3VWBA 1BIBA 1XGNA 2OQGA 4U87A 3CUOA 2A69F 1B4AA 5BPIA 4F93B 4LOCA 5H2FC 3GVAA 2VI6A 1Y8QB 2KZGA 2E2HJ 3ZPLA 3QAHA 3MZHA 4XKWA 1E3OC 4C3HJ 5JR3A 2RREA 3RSNA 1PVEA 1BW5A 2HQNA 3A1YA 4UV8A 2E1CA 2CV2A 1OYWA 3Q3SA 1TQPA 1BI1A 1P4AA 2DAOA 4CZZA 4BXUA 4XLCA 4BQQA 1F4KA 2PMUA 2M87A 3LSGA 3GXOA 3H9QA 4P5OA 1WQ2A 1LDKB 1IV8A 3E97A 1H88C 3QPSA 4NC8A 2R7OA 3CLOA 4BQNA 1ZREA 2R5YA 2E1OA 3GZ6A 4ZTFA 2QENA 2DTZA 3CMEI 3I4NJ 3OYKA 1FMVA 1BI3A 1WFXA 4YG2F 1A35A 3DBHB 2UZKA 3A01A 5LD2C 5E1ZB 4EEFG 2K9LA 1ENHA 2PN6A 1OYYA 1QQIA 4RS8A 3R4KA 5ILSA 1W7PD 4CCJA 5DS9A 4G7OF 3OOPA 4XRFA 3J81K 3CDLA 1CF7B 4XONA 2ELHA 5JLWA 2CV1A 2OPTA 5GP9A 5J1YA 3WTTC 3LSKA 1MW7A 2KMUA 3TW6A 1VFCA 4IOAF 3T8RA 5CYVA 5C4XJ 3TO9A 2BY1A 4LK0F 4C2MJ 2Y0MA 3ABMH 3S8PA 4BBSJ 5ILUA 1LE8A 2JN6A 3Q9VA 1WSUA 1AOYA 2NOJB 1K61A 2A6EF 2LOOA 2KIUA 1D3YA 2V9PA 3ONQA 3KYCB 3F6VA 3W2WA 2A68F 4JP0A 5CVIA 1HLVA 1VQ7I 5K7FA 3JRHA 4F3QA 3WTSC 1JT6A 2W48A 4LIUA 4HNTA 2XGDA 2XB5A 4W97A 5CVVA 3BJ6A 5LBQA 3DU6A 3IKVA 4MTDA 4BXXJ 2F5VA 2MBFA 1TBXA 9ANTA 3DLLF 2L9VA 3L2WA 3KIOA 3DKXA 4M72A 4IQJA 4CCNA 1G3SA 3IC7A 2IJLA 2VQCA 2QBYA 3S1NJ 1TT5B 1UHSA 5FRNA 3AL0C 4YRVA 2MW8A 4U7DA 5FJ8J 2NRAC 5E17F 3ZQGA 3GBGA 4ZYGA 3KYDB 3CMAI 1J0RA 3D0SA 3FXRA 4AIJA 3HOZJ 1HC8A 3HRMA 3VYRB 2ZNYA 3VFZA 5J1RA 3BDDA 2P81A 2ESNA 2DW4A 5CKTA 2CFXA 2MSYA 1ETVA 3VODA 2NNNA 4HSRA 2EA4A 4PJNA 2W4SA 1HKQA 3T0YA 2VXDA 3CDHA 4WK8F 3J7YJ 4BACA 2VBXA 1D0ZA 1JTXA 4DZPA 2R7UA 4B47A 4DNCA 3OS1A 2KKOA 4BQAA 3HKZN 3KP3A 4WXHA 3WG7H 4BJ6C 2OJED 3R0JA 2ACJA 1RKWA 1WGXA 2X6WA 4HYEA 1UHMA 5M3MJ 1X2NA 3B02A 5FO5A 3K10A 5C4JJ 3WU1B 5FLXK 2LTPA 4ENMA 5M5WJ 2W57A 1FOXA 2FQ3A 1DUXC 3IV5A 3QOPA 5CQEA 3BJAA 3OWTA 3HOXJ 1P4XA 4OMYA 4JOMA 1B8IA 3I55I 3QODA 1DPRA 3LL7A 4KIFA 3NQOA 2W1OA 4BQOA 3HPGA 4II3A 1VZ0A 4U0WA 3JRFA 2F4IA 4HBLA 3R0AA 1BJZA 4KJZA 3GX4X 1IUYA 1QRYA 2Y2ZA 2HI3A 1YX5A 3ZMUA 3KLOA 1QGPA 3R6SA 1P6RA 2DOAA 1ZARA 3IAM2 5J47A 4A0YA 2KDZA 2PJRA 2JVGA 1WJ5A 4MO7A 2EZHA 3O8HA 3S3OA 3GTMJ 4E7LA 3DFGA 2VPRA 2PMZA 2L7MP 2Y69H 1ZGJA 4D5CA 5B3SH 3K2ZA 3SZPA 4I2OA 2CFOA 3D5SC 4KA4A 1G3WA 1JKPC 2CQXA 1BOAA 3AG4H 3K4CA 1FNNA 1OCRH 3FMRA 3E6MA 1YYVA 3T8TA 3MFKA 5LGTA 2BGCA 2CO5A 3LWFA 4BY7J 3SZTA 5BPDA 3W2VA 4ZYEA 3OYJA 5LGNA 2KL4A 3O6BB 1Z7UA 1MBEA 3B6AA 1UG2A 3M9AA 4P55A 2EQRA 2Y75A 3LA7A 3PNYA 3LSJA 3FXKA 1GV2A 4DBQA 4XSZF 2VBWA 3C3WA 2PBIA 2R7FA 4ZH4F 4KT5C 4BHBA 4A3IJ 3HTSB 5TISC 3BQYA 1POGA 4QPOA 2KRCA 4I76A 3LSTA 3K1PA 3FHNA 3HGGA 3REOA 4XORA 1W7PB 3CCVI 2K9QA 3GFJA 2DBBA 1T08B 1WCMJ 3VSKA 3F21A 4MTEA 1QZZA 1TLHB 1WH5A 5CVUA 3CC7I 1ZRFA 2E71A 2KRFA 4IQ4A 2Q8KA 2E60A 4LIVA 2ZJRF 1BOBA 2VC1A 4Z6YA 1VQ5I 2FOWA 4PCQA 3IRRA 6PAXA 1WJDA 5J1UA 4KYWA 4LFUA 3BTLA 1WKMA 1WJBA 4EVIA 4EGYA 3BLYA 3X2QH 3PIOF 3QQAA 4UB8C 3HOSA 5IYBJ 2R7VA 4PFPA 2F6CA 1IN8A 3BPXA 1R1UA 2TCTA 2FNAA 4BE2A 5EJCA 1ACIA 1AKHA 4DQ2A 4NC6A 2BY3A 2GOXB 4A2UA 2VIXA 3ASOH 3W6JB 3AL0B 3M8FA 3FKIJ 3CQZJ 4A3FJ 2NAZA 5LEJA 2J5PA 1R22A 4S05A 2HEOA 2EB7A 3BP8A 2JPBA 3FBNB 2YSRA 2E5NA 3LSIA 2OA4A 4N9HA 3BR1A 2Q2EA 1VQ6I 1PP7U 5EEHA 5EGOA 1YO5C 2XRNA 3GTKJ 2ELKA 2DDBA 1I6XA 4PSWA 5DCFA 2JTVA 5IP9J 3FF5A 3HDDA 2RQQA 3ZQHA 1QVUA 4GYIA 4KIBA 4D7MA 1HW2A 3CCUI 1HA8A 3BWGA 1T98A 2FMLA 5E1XA 4B09A 3C2GA 4F92B 4AVPA 4N0BA 1Z6TA 2A61A 1QHGA 2QQ8A 2G0EA 1A31A 1S9HA 2HZDA 2EILH 3HZJA 2DXIA 3D5LA 3ERED 3WTYC 1BM9A 5DDGA 3I4MJ 5FGMA 3WHBA 2KLOA 5LRRA 2ELJA 3DKYA 3OY9A 3OR2C 4AVZA 1T38A 1Q1VA 4H4KC 2LSOA 4B4CA 2RV8A 3RYRA 3J80Z 3GZNB 4NBQA 5HODA 2LG4A 4I02A 3BG3A 1UJ8A 3KP5A 3ZMZA 4Q48A 4C3IJ 1MMSA 3LFUA 2FF4A 1YIOA 1D5VA 2ZXIA 3JRAA 4XN0A 1STZA 3K4JA 3V42A 5BNGA 3B6CA 2BOLA 1YLFA 4A6DA 5D5VB 2HOEA 4AYBN 4P9FA 2LDUA 3G1LA 2H6CA 2DTRA 2LY9A 3S32A 3GTOJ 4XRMA 2L0KA 3PSFA 5IP6A 3OYGA 4XIDA 2JA8J 1DQUA 2EFPA 1YJWI 4J19A 2OBPA 3DPUA 1GUUA 4IPAA 2QSGX 1ZKGA 2K27A 4XLPF 2K7LA 4EGZA 5DM7F 5JVTA 1KONA 4AM3A 5L3DA 2KFDA 2XSJC 4HV6A 2O9LA 4KN4X 1YW9A 2P5LC 2KT0A 1G4DA 2XB0X 5K5QA 3G3ZA 1LEBA 2CQKA 1N78A 3Q0UA 3KETA 1W0UA 4PUSA 3L00A 4E7SA 1RIOH 4UVBA 1DP3A 1RNLA 2DOFA 3E5QA 3VYSB 2CRGA 4RA2A 2CH0A 2L01A 2WB1N 4I6ZA 3MAJA 1R71A 2BHZA 2KRHA 1OFCX 3C2HA 2ID3A 1OCPA 3J80K 3OSFA 4HPQA 1I1SA 5GADJ 4ASNA 1ZTRA 4FTHA 1OYIA 1S3JA 1XSVA 3QOEA 4HRIA 2IA1A 1XN7A 3PNTA 4MEXF 3E7LA 1G6NA 4PJ0C 2B7EA 3H5AA 3JAMK 1IGNA 1O7FA 1KU9A 3ZMVA 1VTNC 2LF8A 3ZMDA 4XBFA 1R1TA 4B8XA 4OOIA 2QQAA 2PMHA 1FJLA 2RNJA 3FK6A 2JUCA 1KU2A 3RKWA 4G8XA 3LSPA 4V19K 1HXDA 4C2TA 1TWGJ 1T2KA 1L0OC 1FZPB 4PZJA 3H5NA 4CUGA 4FT8A 5FKLA 4U0VA 2UV1A 2F5EA 2R93J 2VQGA 3L2RA 2RGVA 1HBXG 4E7HA 3SYTA 1RESA 3FM5A 3QP5A 2RQPA 3G73A 1ZR2A 4EQQA 2DFEA 3L2CA 4XOTA 3KP4A 1FYMA 1KYWA 3WTWC 1B6AA 4XLAA 3IKTA 1W1WE 3TQNA 2WAFA 3TP3A 3ZQFA 3S17J 2DJIA 1OMIA 5ED4A 1KGSA 2DPDA 2COMA 4OIOF 2LNBA 4CSWA 4NB5A 3SDGA 2EINH 3ABUA 1H0MA 1K78B 2EIKH 4PJLA 1ZHFA 4UNOA 4MLOA 2LY2A 4X0GA 4CYCA 1YRNA 1D8KA 2RNGA 2VN2A 4A12A 2DFIA 4RGSA 5E1WA 3CF5F 4JK1X 1SEUA 2WA0A 3I58A 3K6GA 1ODDA 4C2UA 2VKHA 1IDZA 2M4KA 2EZKA 2FQ4A 3MKWB 5DV5A 3V7CA 1P92A 1FWZA 1S5LC 5JVGF 1I50J 2LFBA 2LREA 2CU7A 3NRVA 3PM1A 4ZDOA 1RC9A 3MKLA 1Y1VJ 2CW8A 1YHQI 3LSHA 4N4OB 4PFOA 1S7AA 4FASD 4HSTA 2OAZA 1DGRM 4A3MJ 1YFHA 1ZG1A 1FSEA 2IBDA 2MD0A 2VKDA 4IHWA 2AHQA 1QVTA 5HNHA 4LMYA 2FUG2 2CYYA 2DYRH 3HIFA 4XN3A 2NVXJ 4RGXA 3JSPA 1AA7A 2O5RA 1YOVB 4Z2YA 2A6HF 4XRSA 2YS9A 4BY1J 1M1EB 3IP4B 3S1QJ 4TV7A 1ETYA 4G6TB 2F5FA 2R7TA 1BW6A 2X6OA 4CHUA 3JREA 2Z2SB 5IT3A 2BHYA 4NNJA 2X51A 2V9KA 3QU3A 3ZQQA 1FSHA 4LLNA 1V55H 2D1VA 2RDPA 4XKCA 2IPQX 2Q0OA 1MIJA 4BJ5C 5CPRB 1ETQA 2I5UA 4MFEA 1IJWC 3NEUA 3I4PA 3N05A 4RM3A 3T5XA 5K7HA 4XL9A 5HNFA 1YITI 2Q1ZB 4A3DJ 1FIPA 2VQHA 3WTUC 2IGOA 5C3EJ 3UKGA 5DTDA 3FXLA 3BC8A 1T39A 3MCZA 1ZYRF 2O8KA 1FT9A 1FMWA 3H36A 2A3SA 1E2XA 2QKMB 1WJFA 2XAFA 2XIGA 2KIMA 4CYDA 4HAMA 5B5EC 4RAGA 2IT0A 3C7JA 2FE3A 1ZRDA 2V1XA 3AG3H 1QZEA 1WJAA 2YR2A 1LJ9A 3HB9A 2LF7A 2EFNA 1MNEA 1W5TA 1X1BA 2CUZA 3DV8A 2DA3A 3EUKL 2D1HA 1MBKA 2HKOA 4Y4RA 5CVJA 1GLNA 3LQRA 4DGWB 5JLXA 2ZXHA 3E3VA 1R58A 4MHGA 1P7IA 3A0HC 2FOKA 1EA3A 3DXJF 4EV0A 1XS9A 3RYPA 2ZB9A 3V7SA 1WWXA 2IS1A 2QSFX 2WV0A 2UXXA 1Z3YA 1V4RA 5HS7A 3H3UA 4BEHB 2VLAA 4HF0A 3FXJA 1MDMA 3J81Z 2K86A 2M7AA 3SXYA 4UUVA 1TNTA 2DQLA 2O6GE 2JT1A 3BZCA 4S04A 2WY8Q 2EIMH 3TOBA 1YX3A 3A01B 3N4MA 1IRFA 3GLXA 3CJTB 2D45A 1IO2A 2M30A 5ICEA 5FRMA 1X58A 4WX9A 4UUTA 5EG0A 3QP6A 3NWTA 2GQQA 3G1MA 3WU0A 3M1CA 3JR9A 1MJBA 1RRJA 4KFCA 1F5TA 4KMFA 3Q9SA 4MNUA 1EJ9A 1XDUA 3JW4A 4RM2A 2B63J 4D7NA 4I0AA 4XLEA 1ZH5A 3M1EA 4C3JJ 5HDNA 3MEXA 4MEYF 1XGMA 1RR8C 1PYVA 1JKOC 2OU2A 1AHDP 3FXOA 1SVLA 2MH2A 1FTTA 1LUJB 1FBSA 2P0WA 5E20A 4AIDA 4DZJA 3JRGA 1KYZA 1A36A 1B72A 3LMMA 3S3NA 1LPQA 3OMYA 4ZZLA 2VE9A 5EZGA 2VBZA 1Y6IA 4HDUA 1SMTA 2E2JJ 4HOBA 4B43A 1V5GA 2QSHX 2ISZA 1SAXA 3QPLA 4ZYAA 2IGMA 3VEPA 2HTSA 5GAGJ 5B66C 4JX4A 5K1YA 3BTJA 4KN7X 2QBYB 1I6HJ 1PDNC 3VPRA 2K5CA 3P9IA 1TW3A 4B44A 5D5UB 1A04A 2DODA 4NC7A 2O8XA 1WVRA 3DU5A 2VONA 2OZUA 4IL6C 5FKKA 4UB6C 5BOXA 3BG5A 3V4GA 2STTA 4FHTA 5F08A 4CXFA 3GFIA 4ZZDA 1UELB 2ZMEA 2M8EA 4B1RA 3I3LA 3LAPA 3LAJA 4RB0A 3FISA 1UMQA 5AIQA 1IG7A 1OISA 3BZKA 2HXOA 2ICWG 4IRIA 2KJCA 5FLXZ 1IZ1A 2ZXWH 1HSTA 2AXTC 4RB3C 5EZHA 3DTEA 3MWMA 3AAFA 3IAS2 1R5HA 3EUHA 5ICGA 3S14J 4NQWA 1YW7A 3CCSI 4FX0A 5LLQA 4M73A 1XC5A 1D5YA 1LB2A 2MFZA 4G9YA 3MD2A 4HF2A 2PI0A 4BDYA 3DF8A 3PFIA 3G4SI 3MZ8A 3QRFF 3B73A 3S2HJ 4D9JA 1B8IB 1OJLA 4S0HB 3IHUA 2MC3A 3S1MJ 2W82A 4NDLA 2R7WA 4UHTA 3G71I 4KICA 4O3MA 4LG0A 1D0YA 3CMYA 1R4NB 2KQRA 4E7JA 3CMMA 2E7XA 2UWMA 2QCOA 3CJQB 2BW3A 2DK8A 1XD7A 3WTZA 2MC4A 1Z3XA 3EUAA 3OYIA 2PJRB 5K5RA 4IHTA 2ETHA 1FP2A 1IDYA 4PSXA 1ZG3A 1IRZA 1N75A 4IHVA 1TWAJ 2WAEA 1DP7P 3LQQA 2STWA 5E8IA 3HC7A 2VL8A 2QEXI 4JX6A 2LR8A 4HG2A 2F4OB 3GUDA 1L3LA 1REPC 3U1KA 1IXSB 1P9QC 2X1DA 1MH3A 3D5RC 2O61A 3WU2C 1VQLI 1P2FA 1Z1DA 1IN5A 3COAC 1A6IA 1XG1A 5FB2A 2VC0A 1FPQA 3GMEA 5E3OA 4IRHA 1ETWA 5F0CA 3DWLE 5J4VA 2W85A 3MZYA 2HR3A 2DU9A 2K3FA 5F27A 4ESJA 1UZCA 3ZQCA 1GVDA 1K4SA 2HWVA 3IRQA 1ULYA 1ZLJA 2DN0A 3FXUA 1GXPA 1K7AA 3CC4I 5IOYA 1U2WA 3K4LA 1SFKA 2R7RA 4ENKA 3SZGA 3A02A 1WI3A 2HYGD 1KQ8A 2X85A 3GF2A 1GHCA 2CJJA 2I8DA 1HKSA 1E17A 1ETOA 5HS9A 1IC8A 2YU3A 3KEYA 1MMDA 4EM1A 2BVLA 3HUGA 2GAUA 5BMZA 3GO5A 1ZLKA 3S16J 2LK2A 2ZNZA 4HLXA 2AQFA 2O7OA 2M45A 2A5YB 5DCMA 5IYCJ 5K7ZA 2Z33A 2BVMA 1X1AA 2BY0A 5DUKA 1FOWA 3RI4A 1XPXA 5D4SA 4ESBA 1K4TA 4I01A 1FLIA 3DKWA 4L5EA 3DLAA 1WH7A 2MH9A 3M4OJ 3GEZA 3VYUB 2M1BA 3BG7A 4CCOA 3MKZA 1TWHJ 5JHUA 4A0XA 2WAQN 4GGGA 1AKHB 1TQIA 4LB6B 4AUXA 4JBAA 4YEJA 3WHCA 1RR7A 1HW5A 4OWRB 1N77A 2DT5A 3EQLF 2DCEA 2R5ZA 2LYCA 3I9V2 2HYFA 3F22A 2F48A 4UUSA 1PUEE 1EH6A 1FBQA 3WGGA 5HOOA 3HOUJ 4RAYA 4FX4A 2GZWA 1UB9A 2FJ1A 2L7FP 4G7HF 2H1KA 2Q2EB 5H20A 4WCGA 4Q47A 2HVRA 2GWRA 1BBYA 3WE2A 1ETXA 3F9KA 5EGOB 2JA2A 1UHWA 3IH2A 2TDXA 3CESA 4YIIA 1U9OA 1NG7A 1CGPA 2UXNA 1TTYA 4IJAA 3GTLJ 3S1RJ 5FLVA 2NVYJ 3OV8A 2OTLI 4KDPA 4EM0B 5D4RA 3E6DA 2R7ZJ 1I39A 2LBFA 3WODF 1MNMC 2DYSH 4BBRJ 5EF6A 3CCMI 5CLSA 5FROA 2O0YA 2DK5A 1D8JA 4BE1A 1S8NA 3K4BA 2EFQA 2G7HA 4A69C 1X2MA 4U88A 1XMAA 4DBRA 1I27A 3UR3C 4E7KA 2X1CA 1IV6A 3ROUA 4A3KJ 3FIWA 3ZP5A 2LKPA 3I71A 5L3CA 5AIPA 3U1DA 3PSIA 1ZGAA 1U5TA 3ZMSA 4IEJA 3S2WA 5KCMA 1VI0A 3H0GJ 3QYEA 1HKTA 1XCBA 3M8EA 4F7ZA 2XROA 4M6VA 2HTJA 1B1BA 2Y30A 4A5NA 1RETA 2E36A 3WTXC 1ERDA 2DT6A 1I3QJ 2Z99A 4F91B 5L3BA 3DQVC 2EWNA 4Y13A 2GXGA 2PQ8A 3E0JB 1CQTA 3RQIA 5LRSA 4J01A 5HLTA 2F5DA 2LRDA 4RAZA 2ECBA 4M3BA 4A3JJ 2JA6J 1KU3A 2HS5A 2KZVA 3HEFA 5H6QA 4XKVA 5IY5H 3W2AA 1R23A 3HSEA 1A5JA 1LNWA 3OYEA 2E2IJ 1LFPA 2GBYA 3PO3J 2H94A 1BI0A 1OPCA 4DW6A 3CCJI 4M3DA 1BC7C 3PNVA 3IL2A 2XC7A 2XKOA 1V54H 2IW5A 2Y9ZA 5A2QK 1LQ1A 2GIVA 3JRCA 2L4MA 2HZTA 2H8RA 1QA6A 3PJRA 4AYBA 3L09A 1S6LA 4PK4A 1R36A 5HDGA 3RKXA 1W4MA 2CQ7A 2P8TA 1QU3A 3JAMZ 4CCKA 3L7WA 4K2EA 4ZJZA 5BS6A 2ZSIB 5E18F 4RMNA 5D6EA 1YS7A 3CD6I 3ABTA 2EK5A 2E35A 2ME6A 4CH7A 1F9NA 3PQKA 4D5FA 4CDGA 1OCZH 2Y0SN 2M2EA 2VJ5A 2L4AA 1YG2A 2DDAA 2L2OA 5IOZA 3I59A 1IRXA 3AKZA 4XKBA 1D1BA 4B3XA 1I1GA 4PGHA 2JA5J 3BPVA 4EJOA 4EJTA 2CV0A 4DOZA 3VYTB 4OAYA 3OL4A 2LKSA 4HZFA 1Z77A 4ABZA 2WADA 2OTJI 5TRDA 4IHXA 1JT0A 4J00A 2ZXJA 5ERIA 1MZBA 2Y9YA 1W5SA 4MIMA 1IXCA 5DD8A 2P4WA 3SDBA 1Z05A 3SEZA 2W24A 3DEWA 2LKXA 5EEGA 4WF2A 5LHHA 4ZTJA 1J75A 1IN6A 3SEQA 1MMGA 4RB1A 3U2RA 2R0QC 1O3RA 1QPMA 2UUZA 2DMNA 4Y52J 2VASA 3QYBA 4HV5A 4X6AJ 2PX9A 3FMSA 3CDIA 3R60A 1BR4A 1QHHD 4ANJA 3TL4X 4BU2A 2XUBA 4Q4ZF 4BAYA 1RZ4A 4AIHA 3FX3A 1R7JA 4W1UA 3SQNA 3PUBA 3RDIA 3JTHA 3OIQA 3BROA 4MFDA 3OIPA 3I0TA 3HHGA 3NARA 1EV7A 3GFLA 3JSOA 2EJRA 3CUQA 1DGWY 3S3MA 1J7KA 4Y15A 3CCLI 4CYCB 5HVQC 2B0LA 1YRNB 2V9VA 2XAJA 1NH3A 3BOQA 4ZYDA 2OQRA 4XOPA 4GO1A 1UAAA 4FETA 5J3LA 3F8FA 3K70D 2VB6A 3BTIA 1B9MA 3VDXA 1T33A 2V7FA 1W5CC 2EIJH 2KDOA 4BNCA 1SVMA 2XF7A 2ZKZA 1QBJA 3E5UA 3HPHA 2E1MC 1G3YA 3BR2A 2JVHA 2NVQJ 3E1SA 3HOYJ 2RN7A 3O8GA 5B1AH 3K70C 4LB5A 1IN4A 3FXQA 4RBOA 1J09A 1JJ6C 1YI2I 1UFMA 3HHHA 3CLQA 4A3GJ 4KUMA 1O3SA 4KT6A 3LNQA 1OR7A 4AC0A 5IT9K 2HQAA 2ID6A 2MLGA 2ZMEC 4EJWA 5EYRA 1FOYA 1O57A 3WGHA 1X4OA 4PDKA 2M8GX 2P6SA 1SANA 4YIRX 1DU0A 2HU9A 3OS0A 2EA2A 4MQVA 2A5WA 3KP2A 4Y3OA 3HYIA 1JXSA 4M3GA 4C30A 2HFHA 3HRTA 1IRGA 3ZQ7A 3TEDA 4XLHA 3ZQLA 1MD0A 4IHSA 3C1DA 3MN2A 4M9XA 3EUHC 4GYGA 2H8WA 1VQ9I 2GOMA 1MBJA 3PL8A 4O5VA 5KVRA 1G2HA 2HOTA 1USTA 5AONA 2XAUA 5E3LA 3QU6A 2JQ7A 4G94A 2K3PA 5JI6A 3F8BA 1NTCA 2HGCA 4ZDLA 1FY7A 1VQPI 2HPIA 1TWFJ 3FZVA 3K4KA 4MQ9F 3CCEI 1KA8A 4WXDA 2K40A 1SFEA 1QPIA 1VF9A 2F4MB 1U8RA 3I54A 5B1BH 3P9KA 2XSDC 3RZDJ 2DMQA 1IAWA 3F0CA 3RJPA 4RDUA 1JKQC 4LK1F 2ADUA 1TWCJ 3DEUA 2BBYA 4CGZA 2IRFG 4EATA 2QVOA 2K9SA 5F64A 2DT7B 1PUFA 4QTRA 4L9VA 2FRHA 1QNTA 1HOMA 1Y8RB 2EH3A 5DUIA 4ITVA 3U21A 4QLCU 2WY7Q 1MKMA 1TW2A 2IXSA 2LMDA 3KPHA 5HLIA 2HDCA 1RPWA 1VQOI 4LGWA 1KU7A 2MYSA 2PLYA 3CF2A 2OC6A 1GXQA 1U6GA 2M4GA 3HXLA 3ML6A 4RAFA 3K69A 4CCLA 4M3EA 3ERMA 5L3GA 2X48A 3GYHX 3A4CA 1MDMB 2ZJ2A 4FQGA 1Z21A 2A07F 3A0BC 2L7ZA 5KHDA 4XMYA 3HOWJ 3H35A 2HQ5A 5M3FJ 3ZMTA 1WZ2A 1AWCA 3GZ5A 2KISA 4Y33A 2NYXA 4YELA 4R8HA 2QF7A 1HW1A 3IWZA 2XPWA 3OYBA 4DIQA 5EG0B 2E7WA 2LH9A 2COBA 1EKEA 1OCTC 2DLLA 2Y31A 1ON2A 5H6RA 1T8IA 3N97A 3M7GA 4RGRA 2OD5A 4BXFA 3DTKA 2KIFA 3MQ0A 5LHGA 2GLOA 3OIOA 1Z67A 2NVUB 4HNUA 1MNDA 3LSRA 5KK1A 5F0HA 3SJMA 5LFAA 2R7SA 2F5CA 4C9YA 2AS5F 2VUMJ 2BY2A 1DPUA 2BZTA 2X0LA 4XM3A 3IH3A 3GTQJ 4IO9F 2VJJA 3BG6A 4M6XA 4L9TA 2R5YB 3BY6A 4AIKA 3ZR8X 3F72A 1T0FA 3ECOA 1B72B 2XGCA 1DDNA 4U7BA 1YIJI 4A3CJ 1WRJA 4N9IA 5C44J 2VXZA 1XTAA 3I64A 2NS7A 3S93A 1MBHA 3BR6A 4HA8A 3TDUC 3ESWB 2IS4A 2JA7J 4IX7A 2H09A 1LVKA 1SMYF 1KZHA 2E1MB 4B3AA 3GTPJ 4L5IA 2GIZA 1H89C 3V8KA 3OOUA 3QPTA 3Q0WA 1BC8C 5K5OA 4A3LJ 3SFZA 2O3FA 1ITYA 2CUFA 2CQQA 2HVQA 3H92A 3ABKH 1Z7LA 1SD6A 1GDTA 2QA4I 2YPRA 5D5WB 1LE8B 2D5VA 2CG4A 3CJNA 2DA2A 1GV5A 2ZMEB 4HW0A 3F3XA 2CQNA 3HTUA 4RB2C 2J5OA 3TW7A 1I3AA 1H8AC 2YX4A 1SD7A 2MD5A 4KISA 1JUPA 2R3SA 1FX7A 4LD5A 3JRIA 5GPAA 1LDJA 4CZCA 5GPCA 3QWLA 2IS2A 1A6QA 4FE4A 3GTJJ 4EJUA 1R9TJ 4I0BA 2DA4A 3DP7A 3PUFA 4YFKF 4NQWB 1UCRA 5D8LB 4LLGF 2FNPA 2K9MA 2OV7A 4WXCA 1TQMA 4BEHA 4U0YA 4FCYA 3JRDA 1U8BA 1U3EM 4UV9A 3CP8A 3EYIA 3OYCA 4IF4A 4OAZA 2LVSA 3WTVC 1K79A 2M7BA 2HQRA 3RPUA 1O3QA 2HNHA 3DPTA 2QQBA 4E70A 1MGTA 3CTAA 4XQFA 2CUJA 2W84A 2CW7A 4F55A 1R49A 1U5TC 4R1HA 2M0MA 1BI2A 5HS8A 2XGEA 2NXNB 2M0CA 4BGDA 1SFUA 5KAFC 2A05A 1JE8A 3SHFA 4JQFA 2HKXA 2YUSA 4HDVA 4ZC3A 1KQ9A 2V1DA 4PGGA 4LG0B 1LEAA 4M6YA 4OMZA 4PJJA 1R5GA 4QPQA 1TL8A 2BW3B 2HOSA 3DPLC 3HBLA 1P4WA 4E4HA 3TO7A 3FWEA 1K6OA 1MMNA 1AU7A 1K83J 4P9UA 2G9WA 4L0YB 3DEEA 5CVRA 2FMYA 3FBIB 2HXIA 3ZGKA 1IW7F 3A2KA 4KIGA 1UG0A 1ZELA 3CZ6A 1ZN2A 1NG6A 3K9TA 1ETKA 2K02A 2JSPA 2DPUA 4NHJA 1WJCA 4I99C 1MSEC 1LFBA 1Y0UA 4AU7A 3NWSA 1OCCH 2BV6A 3AFHA 3L9FA 2R7DA 4GRIA 1RUOA 1MJAA 3FM3A 3ELKA 3KP6A 5M5YJ 5DYMA 4IHYA 1X3ZB 3ZOBA 2ZSHB 2LP0A 3LOCA 1J59A 1N25A 5E3MA 1CF7A 2VBYA 4HX7A 1SFOJ 2VOOA 1SD5A 2R7XA 3VB2A 4II2A 3DTIA 2K4BA 3HOVJ 1QZYA 2NS8A 2OUMA 2YU9J 1E3PA 5F04A 3RZOJ 1D0XA 4OIRF 2VOPA 1MBFA 1YE9A 3HKZA 3DBLB 4QIWN 3PIPF 2JZYA 1PJRA 2RC4A 1HQCA 1O7LA 1XMKA 4BH9A 1APLC 2EBIA 3SFIA 2TRTA 2QLZA 4RGUA 1X1DA 5IPAA 4Y7NJ 3K7AJ 2DMPA 2K4JA 2KJBA 2XAQA 5FD5A 2XKPA 1TZLA 3OS2A 2A6TA 4G6DA 5FKMA 5EDNA 3ABLH 4IKFA 3F8NA 3HUGB 2EZIA 2VT3A 2PFBA 2E34A 1X1CA 3FXMA 4GFBA 4ON0A 2K9NA 2FA5A 5LGUA 2V26A 4IOCF 5DCMB 4QWQA 2WTEA 2XAHA 2OCEA 3IWFA 3CC2I 2X4HA 3FDYA 4CCMA 3L2QA 2P6TA 4BL0B 1MMAA 4KITB 3KEOA 4LG3A 2Z1DA 4L5JA 1EH7A 4KMUX 3JTGA 2GXBA 1W0TA 3EYYA 3FMQA 4BKXA 2ZJQF 1XB4A 2AO9A 2FX0A 3S15J 2QQ9A 1JUSA 1MJ9A 3M07A 4BYYA 1YJ9I 2WBMA 3V8JA 5D6FA 2NNYA 2VJ4A 3H9JA 3I56I 3ECHA 2V6CA 2DFHA 2Z3YA 2R5ZB 1Y56A 1BIAA 4UUSB 3OL3A 2XGXA 3KZIC 1K6YA 2FBIA 3LA3A 2CS3A 1MH4A 2M34A 2JRMA 4ENJA 1YW8A 3HGYA 4G12A 1U0JA 2W7NA 1F36A 4A3EJ 2VJIA 3CUQC 2CGPA 5LHIA 4BHCA 1SVOA 4OINF 5F1JA 3KYLA 1IN7A 2EPFA 1XMXA 2ECCA 3F8CA 4UVAA 2BYVE 3AG2H 2PMZN 4UY8I 4V2FA 4F52A 3M3YJ 4DJAA 2L9SA 2E5ZA 2LBFB 4A5MA 5BQTA 2LD5A 1FP1D 1USSA 4H0EA 3OR1C 1FC3A 1X1PA 2IA0A 3DBRB 2WAQA 3ZRGA 1T56A 2XAGA 3MMYB 5DEQA 3A03A 1EH8A 1VQMI 3KFWX 4XNFA 4OIPF 2JRTA 5D5XB 2ZO4A 5KNLA 3K1NA 4EMSA 2NVTJ 3QYFA 4UVCA 2R7QA 2F2EA 3BT9A 2ZFUA 1F1ZA 1U5TB 4HLYA 4BE0A 1MBGA 4Y17A 2W00A 1OKRA 4MGRA 1OR7C 2Z9OA 1GT0C 3KEQA 5M5XJ 3PO2J 2DJNA 2HVSA 3CJRB 3E6BA 4E7IA 2EFOA 1J5YA 2DA5A 3VSLA 1ZGWA 2EV6A 4HQMA 5FFZA 3KP7A 2WV1A 2HDDA 1FOKA 1HSJA 2X6YA 4BS9A 1J2XA 2VKVA 3L2VA 2VODA 2BEOA 2M9HA 4WWCA 4R79A 5FLMJ 2QUFA 2W25A 2VPLA 5J4YA 3H5RA 2JJ7A 4YIFA 2FBKA 2Y48A 3R61A 1ONVA 4V2GA 5A2QZ 3GLLA 2HDWA 2X6XA 3E5XA 2VT2A 5DD4A 5FKOA 1TT0A 2CUEA 3RPQA 1Z9CA 3K1MA 2DOEA 3KLNA 1VQKI 2IAIA 2JWTA 3HSFA 4PJMA 4ZYHA 3LA2A 5J6XA 3OYNA
chains in the Genus database with same CATH topology
1B9NA 3GW2A 3WG9A 1J9IA 4LJZF 2D2WA 1W7PA 2AXLA 3W6KB 2JPCA 4EM2A 2VE8A 4HX4A 2PEXA 1B59A 2P7CB 1FYLA 3J7AO 3CO6C 1T6SA 2PG4A 5D8KB 4HX8A 2O03A 1SFXA 3I59B 1KQ0A 2DO7A 4LLLA 1O3TA 5HLHA 2XVCA 3KE2A 3V7RA 1NHAA 1BN5A 2G7UA 4BHPA 4ETSA 2ZFWA 5TJJA 2L3DA 4A6EA 2Z5UA 1PP8F 2FBHA 4I7HA 4UXNA 3HRSA 4AWXB 3I5UA 2MA3A 3EETA 3ISPA 2IVMA 3F8MA 3GFMA 1SD4A 3KZZA 3U9GA 1ON1A 4CICA 4YFNF 2XASA 4YFXF 1Z91A 2JSCA 1I5ZA 3CUQB 1XCVA 4I09A 1BJAA 4M9SA 1Q1HA 2BE5F 5CJ9A 1QO0D 4HF1A 4L9JA 3RTRA 4P96A 4XSXF 3F6OA 3HRUA 1YTYA 2ZBKA 1ZG5A 4Q5SF 5IT9Z 1S7OA 1LDDA 3PQJA 3VOEA 5HLGA 2WC2A 3RKYA 1G3TA 3O3KA 4L18B 4O6JA 2L02A 4XLNF 1R00A 1JHHA 5F1RA 3LFKA 2EV5A 1H9TA 2C6YA 2ZCWA 5ILVA 2XHKA 2RVCA 3EDPA 3I53A 5L3EA 3ULQB 2NS0A 3KCCA 3HOTA 2CW0F 1R1VA 3FHZA 4OIQF 3GWZA 4I98B 3HSRA 1V3FA 1GVJA 3TOAA 1WI9A 3ZN1A 3BZ6A 4M71A 3E6CC 4GXOA 4IVNA 1U78A 1XSDA 3TKYA 2FXAA 2WWYA 1JGSA 3BJOA 3H3ZA 2DQRA 3QPHA 5J8FA 2DI3A 1RI7A 3C18A 2QWWA 5L3FA 2MLKA 4KNYA 3P7NA 3TGNA 1FBUA 2QM3A 4IRGA 2M5WA 4L9NA 2V1UA 1IXRC 5JFRA 1XGOA 2GA2A 3RIRA 3WGIA 5FFXA 5ICCA 2PJPA 2QYOA 1FYKA 2IA2A 2XV4S 3T1BA 1IF1A 4L0ZB 2FSWA 2YX7A 1ZAOA 3ZN0A 4AD9A 1Z6RA 2QZ8A 5FD6A 2IP2A 4G7ZF 5ICFA 1YS6A 4M74A 5HDKA 1JHFA 1K78A 2OZ6A 5LEKA 4HQEA 1LVAA 4EJVA 3CO7C 2L54A 2GA1A 1XDSA 2ISYA 4OU0A 2P5KA 1TNSA 3WE3A 5J8CA 3K0LA 4CO8A 4ENNA 2P7VB 1YQAA 2E1NA 1C0WA 2H27A 2CWEA 2V79A 4D0PA 4IXAA 2EFWA 2P5VA 2FEZA 3O2PE 5F6FA 4A0ZA 4ESFA 3V8LA 2FU4A 2EV0A 4M9ZA 1ZRCA 3TO6A 3KZYA 5E8GA 3F23A 3TDZC 2CSOA 1S29A 3P9CA 2ESHA 4G6QA 1X3UA 1XGSA 1H9GA 2H6BA 1XSXA 2RKHA 4GCVA 3Q5FA 1RUNA 1BIBA 1XGNA 2OQGA 3CUOA 2A69F 1B4AA 5BPIA 3GVAA 3ZPLA 3QAHA 3MZHA 5JR3A 2HQNA 4UV8A 2E1CA 1OYWA 1TQPA 1BI1A 1P4AA 2DAOA 4CZZA 4BXUA 1F4KA 2PMUA 2M87A 3GXOA 4P5OA 1WQ2A 1LDKB 3E97A 3CLOA 1ZREA 3GZ6A 2QENA 4YG2F 1BI3A 2UZKA 5E1ZB 1OYYA 2PN6A 5ILSA 4RS8A 1QQIA 3R4KA 1W7PD 4G7OF 3OOPA 4XRFA 3J81K 1CF7B 2ELHA 3WTTC 3T8RA 5CYVA 3TO9A 4LK0F 2Y0MA 5ILUA 3Q9VA 1WSUA 1AOYA 2A6EF 2KIUA 1D3YA 3F6VA 2A68F 5CVIA 3WTSC 5CVVA 3BJ6A 5LBQA 3IKVA 4MTDA 2MBFA 1TBXA 4M72A 1G3SA 3IC7A 2IJLA 2QBYA 4U7DA 2NRAC 5E17F 4ZYGA 1J0RA 3D0SA 3FXRA 4AIJA 3HRMA 2ZNYA 3VFZA 3BDDA 2ESNA 2DW4A 2CFXA 3VODA 2NNNA 2EA4A 1HKQA 3T0YA 3CDHA 4WK8F 2VBXA 4DNCA 2KKOA 4BQAA 3KP3A 4WXHA 3R0JA 2ACJA 4HYEA 1UHMA 3B02A 5FO5A 3WU1B 5FLXK 4ENMA 2W57A 2FQ3A 1DUXC 3QOPA 3BJAA 4OMYA 1P4XA 1DPRA 4KIFA 3NQOA 4U0WA 4HBLA 3R0AA 3GX4X 1IUYA 3ZMUA 3KLOA 1QGPA 3R6SA 1P6RA 1ZARA 4A0YA 3DFGA 1ZGJA 4I2OA 3K2ZA 3SZPA 4KA4A 1G3WA 1BOAA 1FNNA 3FMRA 3E6MA 1YYVA 3T8TA 3MFKA 5LGTA 2BGCA 2CO5A 3LWFA 3SZTA 5BPDA 4ZYEA 5LGNA 3O6BB 1Z7UA 3M9AA 4P55A 2Y75A 3LA7A 4XSZF 2VBWA 3C3WA 2PBIA 2R7FA 4ZH4F 4KT5C 4BHBA 3HTSB 3LSTA 3K1PA 3REOA 1W7PB 3GFJA 2DBBA 3F21A 4MTEA 1QZZA 1TLHB 5CVUA 1ZRFA 2KRFA 2Q8KA 2VC1A 4PCQA 3IRRA 6PAXA 4KYWA 4LFUA 1WKMA 4EVIA 4EGYA 3HOSA 1IN8A 3BPXA 1R1UA 2FNAA 4DQ2A 4A2UA 3W6JB 3M8FA 2NAZA 5LEJA 2J5PA 1R22A 4S05A 2HEOA 2EB7A 3BP8A 2JPBA 2YSRA 2OA4A 4N9HA 2Q2EA 1PP7U 5EEHA 1YO5C 2XRNA 1I6XA 5DCFA 2JTVA 3FF5A 4GYIA 4KIBA 1HW2A 3BWGA 1T98A 2FMLA 5E1XA 4B09A 4AVPA 4N0BA 1Z6TA 2A61A 3D5LA 3ERED 3WTYC 1BM9A 5DDGA 5FGMA 5LRRA 1T38A 2LSOA 2RV8A 3RYRA 3J80Z 4I02A 3KP5A 3ZMZA 4Q48A 2FF4A 1YIOA 1D5VA 1STZA 4A6DA 1YLFA 5D5VB 2HOEA 4P9FA 2LDUA 2H6CA 2DTRA 2EFPA 2OBPA 4IPAA 2K27A 4XLPF 2K7LA 4EGZA 5JVTA 5L3DA 4HV6A 4KN4X 1YW9A 2P5LC 1G4DA 5K5QA 3G3ZA 1LEBA 2CQKA 3KETA 3L00A 1RIOH 4UVBA 1RNLA 3E5QA 2L01A 3MAJA 3J80K 1I1SA 4ASNA 1OYIA 1S3JA 1XSVA 2IA1A 1XN7A 4MEXF 1G6NA 3JAMK 1O7FA 1KU9A 3ZMVA 1VTNC 2LF8A 3ZMDA 4XBFA 1R1TA 4B8XA 4OOIA 2QQAA 2PMHA 2RNJA 3RKWA 1KU2A 4G8XA 1HXDA 1T2KA 1L0OC 1FZPB 4PZJA 4FT8A 4U0VA 2F5EA 2RGVA 1HBXG 3FM5A 3QP5A 3G73A 2RQPA 4EQQA 3L2CA 3KP4A 1FYMA 1KYWA 3WTWC 1B6AA 3IKTA 3TQNA 1OMIA 5ED4A 1KGSA 2DPDA 2COMA 4OIOF 2LNBA 4NB5A 3ABUA 1H0MA 1K78B 1ZHFA 4UNOA 1D8KA 2VN2A 4A12A 2DFIA 4RGSA 5E1WA 4JK1X 3I58A 1ODDA 5DV5A 3V7CA 1P92A 1FWZA 3NRVA 1S7AA 2OAZA 1YFHA 1ZG1A 1FSEA 4LMYA 2CYYA 3HIFA 4RGXA 3JSPA 4Z2YA 2A6HF 4TV7A 2F5FA 4CHUA 5IT3A 3QU3A 1FSHA 4LLNA 2D1VA 2RDPA 2IPQX 2Q0OA 3NEUA 3I4PA 3T5XA 3WTUC 1T39A 3MCZA 1ZYRF 1FT9A 2A3SA 1E2XA 2XAFA 2XIGA 2KIMA 4CYDA 4HAMA 2IT0A 3C7JA 2FE3A 1ZRDA 2V1XA 2YR2A 1LJ9A 2LF7A 2EFNA 1W5TA 3DV8A 2D1HA 2HKOA 5CVJA 3LQRA 3E3VA 1R58A 4MHGA 2FOKA 4EV0A 3DXJF 3RYPA 3V7SA 1WWXA 2WV0A 2UXXA 1V4RA 5HS7A 3H3UA 4HF0A 1MDMA 3J81Z 2K86A 3SXYA 4UUVA 1TNTA 2DQLA 2O6GE 2JT1A 4S04A 3TOBA 3N4MA 1IRFA 3GLXA 2D45A 2M30A 5ICEA 4WX9A 3QP6A 2GQQA 3WU0A 1MJBA 4KFCA 1F5TA 4KMFA 3Q9SA 4MNUA 1XDUA 3JW4A 4I0AA 1ZH5A 3M1EA 5HDNA 3MEXA 4MEYF 1XGMA 2OU2A 2MH2A 1FBSA 5E20A 1KYZA 4ZZLA 2VE9A 2VBZA 4HDUA 1SMTA 4HOBA 2ISZA 1SAXA 3VEPA 2HTSA 5K1YA 4KN7X 2QBYB 1PDNC 3P9IA 1TW3A 5D5UB 1A04A 2VONA 2O8XA 2OZUA 5BOXA 3V4GA 2STTA 4FHTA 4CXFA 3GFIA 4ZZDA 2ZMEA 2M8EA 3LAPA 3LAJA 4RB0A 5AIQA 4IRIA 2KJCA 5FLXZ 1IZ1A 1HSTA 4RB3C 3MWMA 3AAFA 1R5HA 3EUHA 5ICGA 4NQWA 1YW7A 4FX0A 5LLQA 4M73A 1LB2A 4G9YA 4HF2A 2PI0A 3DF8A 3PFIA 3QRFF 3B73A 3IHUA 2MC3A 4UHTA 4O3MA 4KICA 4LG0A 2E7XA 2UWMA 2DK8A 1XD7A 3WTZA 4IHTA 5K5RA 2ETHA 1FP2A 1ZG3A 1DP7P 3LQQA 2STWA 5E8IA 3GUDA 1L3LA 1REPC 1IXSB 2O61A 1P2FA 1Z1DA 1IN5A 3COAC 5FB2A 2VC0A 1FPQA 4IRHA 2W85A 3MZYA 2HR3A 2DU9A 4ESJA 2HWVA 3IRQA 1ULYA 1ZLJA 3FXUA 1GXPA 1K7AA 1U2WA 4ENKA 2HYGD 1KQ8A 3GF2A 1GHCA 1HKSA 1E17A 5HS9A 2YU3A 4EM1A 3HUGA 2GAUA 5BMZA 3GO5A 1ZLKA 2ZNZA 4HLXA 2M45A 2A5YB 5DCMA 2Z33A 3RI4A 5DUKA 5D4SA 4ESBA 4I01A 1FLIA 3DKWA 2MH9A 3GEZA 2M1BA 5JHUA 4A0XA 4GGGA 1TQIA 4LB6B 4JBAA 1HW5A 2DT5A 3EQLF 2HYFA 3F22A 1PUEE 1EH6A 1FBQA 3WGGA 5HOOA 4RAYA 4FX4A 2GZWA 1UB9A 4G7HF 5H20A 4WCGA 4Q47A 2GWRA 1BBYA 3WE2A 1UHWA 2TDXA 4YIIA 1CGPA 2UXNA 1TTYA 4IJAA 3OV8A 4KDPA 4EM0B 5D4RA 3E6DA 3WODF 5CLSA 2O0YA 2DK5A 1D8JA 1S8NA 2EFQA 2G7HA 4U88A 1XMAA 1I27A 3ROUA 3ZP5A 2LKPA 3I71A 5L3CA 5AIPA 3U1DA 1ZGAA 1U5TA 3ZMSA 3S2WA 1HKTA 1XCBA 3M8EA 4F7ZA 2XROA 2HTJA 1B1BA 4A5NA 3WTXC 2Z99A 5L3BA 3DQVC 2EWNA 4Y13A 2GXGA 2PQ8A 5LRSA 2F5DA 4RAZA 1KU3A 2HS5A 5H6QA 1R23A 3HSEA 1LNWA 2H94A 1BI0A 1OPCA 1BC7C 3IL2A 2XKOA 2IW5A 5A2QK 1LQ1A 2GIVA 2L4MA 2HZTA 3L09A 1S6LA 5HDGA 1R36A 3RKXA 1W4MA 2P8TA 3JAMZ 3L7WA 4K2EA 5BS6A 5E18F 5D6EA 1YS7A 3ABTA 2EK5A 1F9NA 3PQKA 4CDGA 1YG2A 2L4AA 3I59A 1I1GA 4PGHA 3BPVA 4EJOA 4EJTA 4HZFA 5TRDA 2ZXJA 5ERIA 1MZBA 1W5SA 1IXCA 5DD8A 2P4WA 1Z05A 2W24A 5EEGA 4WF2A 5LHHA 1J75A 1IN6A 4RB1A 3U2RA 1O3RA 1QPMA 4HV5A 3FMSA 3R60A 2XUBA 4Q4ZF 4BAYA 1RZ4A 4AIHA 3FX3A 1R7JA 3SQNA 3RDIA 3JTHA 3BROA 3I0TA 3HHGA 1EV7A 3GFLA 3JSOA 2EJRA 3CUQA 1J7KA 4Y15A 5HVQC 2B0LA 2V9VA 2XAJA 3BOQA 4ZYDA 2OQRA 4GO1A 3F8FA 1B9MA 4BNCA 2ZKZA 1QBJA 3E5UA 1G3YA 2RN7A 4LB5A 1IN4A 3FXQA 1UFMA 3HHHA 4KUMA 1O3SA 1OR7A 5IT9K 2MLGA 4EJWA 1O57A 3WGHA 4PDKA 2P6SA 2EA2A 4MQVA 3KP2A 3HYIA 1JXSA 2HFHA 3HRTA 1IRGA 3ZQ7A 4IHSA 1MD0A 3C1DA 4M9XA 4GYGA 4O5VA 5KVRA 1USTA 5AONA 3QU6A 4G94A 5JI6A 3F8BA 2HGCA 1FY7A 3FZVA 4MQ9F 1KA8A 4WXDA 1SFEA 1U8RA 3I54A 3P9KA 1IAWA 3RJPA 4LK1F 2ADUA 3DEUA 2BBYA 4CGZA 2IRFG 2QVOA 5F64A 4L9VA 2FRHA 1QNTA 5DUIA 4QLCU 1MKMA 1TW2A 5HLIA 2HDCA 4LGWA 1KU7A 2PLYA 1GXQA 1U6GA 3ML6A 3K69A 5L3GA 3GYHX 1MDMB 2ZJ2A 2A07F 3ZMTA 1AWCA 3GZ5A 2NYXA 4R8HA 1HW1A 3IWZA 2E7WA 2DLLA 5H6RA 1ON2A 3N97A 3M7GA 4RGRA 2OD5A 2KIFA 3MQ0A 5LHGA 5KK1A 2F5CA 2AS5F 1DPUA 2X0LA 4M6XA 4L9TA 3BY6A 4AIKA 3F72A 1T0FA 3ECOA 1DDNA 4U7BA 1WRJA 4N9IA 2VXZA 3I64A 4HA8A 3TDUC 2H09A 1SMYF 4L5IA 3V8KA 3QPTA 1BC8C 5K5OA 3SFZA 2O3FA 3H92A 1SD6A 2YPRA 5D5WB 2CG4A 3CJNA 2ZMEB 4HW0A 3F3XA 3HTUA 4RB2C 2J5OA 2YX4A 1SD7A 2MD5A 2R3SA 1FX7A 4LD5A 1LDJA 4EJUA 4I0BA 3DP7A 4YFKF 1UCRA 5D8LB 4LLGF 2FNPA 4WXCA 4U0YA 1TQMA 1U3EM 4UV9A 3EYIA 4IF4A 3WTVC 1K79A 2HQRA 3RPUA 1O3QA 3DPTA 2QQBA 4E70A 1MGTA 3CTAA 2W84A 1U5TC 4R1HA 1BI2A 5HS8A 1SFUA 1JE8A 3SHFA 4JQFA 2HKXA 4HDVA 1KQ9A 2V1DA 4PGGA 4LG0B 1LEAA 4M6YA 4OMZA 1R5GA 3DPLC 1P4WA 3TO7A 3FWEA 1K6OA 4P9UA 2G9WA 4L0YB 5CVRA 2FMYA 1IW7F 4KIGA 1ZN2A 3K9TA 2K02A 2DPUA 4NHJA 1Y0UA 1RUOA 2BV6A 3L9FA 2R7DA 1MJAA 3FM3A 3ELKA 3KP6A 5DYMA 1J59A 1CF7A 2VBYA 4HX7A 2VOOA 1SD5A 3VB2A 2K4BA 1QZYA 4OIRF 2VOPA 2JZYA 1HQCA 1O7LA 1XMKA 2RC4A 4BH9A 2QLZA 4RGUA 2K4JA 2KJBA 2XAQA 5FD5A 2XKPA 4G6DA 3F8NA 2VT3A 2PFBA 4ON0A 2FA5A 5LGUA 5DCMB 4QWQA 2WTEA 2XAHA 3IWFA 2X4HA 2P6TA 3KEOA 4L5JA 1EH7A 4KMUX 3JTGA 2GXBA 3EYYA 3FMQA 1XB4A 2QQ9A 1MJ9A 4BYYA 3V8JA 5D6FA 2NNYA 3ECHA 2V6CA 2Z3YA 1BIAA 2XGXA 2FBIA 3LA3A 4ENJA 1YW8A 2CGPA 3CUQC 5LHIA 4BHCA 4OINF 1IN7A 3F8CA 4UVAA 2BYVE 4A5MA 5BQTA 1FP1D 1USSA 4H0EA 1FC3A 2IA0A 2XAGA 5DEQA 1EH8A 3KFWX 4OIPF 2JRTA 5D5XB 2ZO4A 3K1NA 4EMSA 4UVCA 2F2EA 1F1ZA 1U5TB 4HLYA 4Y17A 1OKRA 4MGRA 2Z9OA 3KEQA 3E6BA 2EFOA 1J5YA 2EV6A 4HQMA 5FFZA 3KP7A 1FOKA 1HSJA 1J2XA 2VODA 2BEOA 4WWCA 4R79A 2QUFA 2W25A 4YIFA 2FBKA 2Y48A 3R61A 1ONVA 5A2QZ 3E5XA 2VT2A 5DD4A 3RPQA 1Z9CA 3K1MA 3KLNA 3HSFA 4ZYHA 3LA2A 5J6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9N A;  3GW2 A;  3WG9 A;  1J9I A;  4LJZ F;  2D2W A;  1W7P A;  2AXL A;  3W6K B;  2JPC A;  4EM2 A;  2VE8 A;  4HX4 A;  2PEX A;  1B59 A;  2P7C B;  1FYL A;  3J7A O;  3CO6 C;  1T6S A;  2PG4 A;  5D8K B;  4HX8 A;  2O03 A;  1SFX A;  3I59 B;  1KQ0 A;  2DO7 A;  4LLL A;  1O3T A;  5HLH A;  2XVC A;  3KE2 A;  3V7R A;  1NHA A;  1BN5 A;  2G7U A;  4BHP A;  4ETS A;  2ZFW A;  5TJJ A;  2L3D A;  4A6E A;  2Z5U A;  1PP8 F;  2FBH A;  4I7H A;  4UXN A;  3HRS A;  4AWX B;  3I5U A;  2MA3 A;  3EET A;  3ISP A;  2IVM A;  3F8M A;  3GFM A;  1SD4 A;  3KZZ A;  3U9G A;  1ON1 A;  4CIC A;  4YFN F;  2XAS A;  4YFX F;  1Z91 A;  2JSC A;  1I5Z A;  3CUQ B;  1XCV A;  4I09 A;  1BJA A;  4M9S A;  1Q1H A;  2BE5 F;  5CJ9 A;  1QO0 D;  4HF1 A;  4L9J A;  3RTR A;  4P96 A;  4XSX F;  3F6O A;  3HRU A;  1YTY A;  2ZBK A;  1ZG5 A;  4Q5S F;  5IT9 Z;  1S7O A;  1LDD A;  3PQJ A;  3VOE A;  5HLG A;  2WC2 A;  3RKY A;  1G3T A;  3O3K A;  4L18 B;  4O6J A;  2L02 A;  4XLN F;  1R00 A;  1JHH A;  5F1R A;  3LFK A;  2EV5 A;  1H9T A;  2C6Y A;  2ZCW A;  5ILV A;  2XHK A;  2RVC A;  3EDP A;  3I53 A;  5L3E A;  3ULQ B;  2NS0 A;  3KCC A;  3HOT A;  2CW0 F;  1R1V A;  3FHZ A;  4OIQ F;  3GWZ A;  4I98 B;  3HSR A;  1V3F A;  1GVJ A;  3TOA A;  1WI9 A;  3ZN1 A;  3BZ6 A;  4M71 A;  3E6C C;  4GXO A;  4IVN A;  1U78 A;  1XSD A;  3TKY A;  2FXA A;  2WWY A;  1JGS A;  3BJO A;  3H3Z A;  2DQR A;  3QPH A;  5J8F A;  2DI3 A;  1RI7 A;  3C18 A;  2QWW A;  5L3F A;  2MLK A;  4KNY A;  3P7N A;  3TGN A;  1FBU A;  2QM3 A;  4IRG A;  2M5W A;  4L9N A;  2V1U A;  1IXR C;  5JFR A;  1XGO A;  2GA2 A;  3RIR A;  3WGI A;  5FFX A;  5ICC A;  2PJP A;  2QYO A;  1FYK A;  2IA2 A;  2XV4 S;  3T1B A;  1IF1 A;  4L0Z B;  2FSW A;  2YX7 A;  1ZAO A;  3ZN0 A;  4AD9 A;  1Z6R A;  2QZ8 A;  5FD6 A;  2IP2 A;  4G7Z F;  5ICF A;  1YS6 A;  4M74 A;  5HDK A;  1JHF A;  1K78 A;  2OZ6 A;  5LEK A;  4HQE A;  1LVA A;  4EJV A;  3CO7 C;  2L54 A;  2GA1 A;  1XDS A;  2ISY A;  4OU0 A;  2P5K A;  1TNS A;  3WE3 A;  5J8C A;  3K0L A;  4CO8 A;  4ENN A;  2P7V B;  1YQA A;  2E1N A;  1C0W A;  2H27 A;  2CWE A;  2V79 A;  4D0P A;  4IXA A;  2EFW A;  2P5V A;  2FEZ A;  3O2P E;  5F6F A;  4A0Z A;  4ESF A;  3V8L A;  2FU4 A;  2EV0 A;  4M9Z A;  1ZRC A;  3TO6 A;  3KZY A;  5E8G A;  3F23 A;  3TDZ C;  2CSO A;  1S29 A;  3P9C A;  2ESH A;  4G6Q A;  1X3U A;  1XGS A;  1H9G A;  2H6B A;  1XSX A;  2RKH A;  4GCV A;  3Q5F A;  1RUN A;  1BIB A;  1XGN A;  2OQG A;  3CUO A;  2A69 F;  1B4A A;  5BPI A;  3GVA A;  3ZPL A;  3QAH A;  3MZH A;  5JR3 A;  2HQN A;  4UV8 A;  2E1C A;  1OYW A;  1TQP A;  1BI1 A;  1P4A A;  2DAO A;  4CZZ A;  4BXU A;  1F4K A;  2PMU A;  2M87 A;  3GXO A;  4P5O A;  1WQ2 A;  1LDK B;  3E97 A;  3CLO A;  1ZRE A;  3GZ6 A;  2QEN A;  4YG2 F;  1BI3 A;  2UZK A;  5E1Z B;  1OYY A;  2PN6 A;  5ILS A;  4RS8 A;  1QQI A;  3R4K A;  1W7P D;  4G7O F;  3OOP A;  4XRF A;  3J81 K;  1CF7 B;  2ELH A;  3WTT C;  3T8R A;  5CYV A;  3TO9 A;  4LK0 F;  2Y0M A;  5ILU A;  3Q9V A;  1WSU A;  1AOY A;  2A6E F;  2KIU A;  1D3Y A;  3F6V A;  2A68 F;  5CVI A;  3WTS C;  5CVV A;  3BJ6 A;  5LBQ A;  3IKV A;  4MTD A;  2MBF A;  1TBX A;  4M72 A;  1G3S A;  3IC7 A;  2IJL A;  2QBY A;  4U7D A;  2NRA C;  5E17 F;  4ZYG A;  1J0R A;  3D0S A;  3FXR A;  4AIJ A;  3HRM A;  2ZNY A;  3VFZ A;  3BDD A;  2ESN A;  2DW4 A;  2CFX A;  3VOD A;  2NNN A;  2EA4 A;  1HKQ A;  3T0Y A;  3CDH A;  4WK8 F;  2VBX A;  4DNC A;  2KKO A;  4BQA A;  3KP3 A;  4WXH A;  3R0J A;  2ACJ A;  4HYE A;  1UHM A;  3B02 A;  5FO5 A;  3WU1 B;  5FLX K;  4ENM A;  2W57 A;  2FQ3 A;  1DUX C;  3QOP A;  3BJA A;  4OMY A;  1P4X A;  1DPR A;  4KIF A;  3NQO A;  4U0W A;  4HBL A;  3R0A A;  3GX4 X;  1IUY A;  3ZMU A;  3KLO A;  1QGP A;  3R6S A;  1P6R A;  1ZAR A;  4A0Y A;  3DFG A;  1ZGJ A;  4I2O A;  3K2Z A;  3SZP A;  4KA4 A;  1G3W A;  1BOA A;  1FNN A;  3FMR A;  3E6M A;  1YYV A;  3T8T A;  3MFK A;  5LGT A;  2BGC A;  2CO5 A;  3LWF A;  3SZT A;  5BPD A;  4ZYE A;  5LGN A;  3O6B B;  1Z7U A;  3M9A A;  4P55 A;  2Y75 A;  3LA7 A;  4XSZ F;  2VBW A;  3C3W A;  2PBI A;  2R7F A;  4ZH4 F;  4KT5 C;  4BHB A;  3HTS B;  3LST A;  3K1P A;  3REO A;  1W7P B;  3GFJ A;  2DBB A;  3F21 A;  4MTE A;  1QZZ A;  1TLH B;  5CVU A;  1ZRF A;  2KRF A;  2Q8K A;  2VC1 A;  4PCQ A;  3IRR A;  6PAX A;  4KYW A;  4LFU A;  1WKM A;  4EVI A;  4EGY A;  3HOS A;  1IN8 A;  3BPX A;  1R1U A;  2FNA A;  4DQ2 A;  4A2U A;  3W6J B;  3M8F A;  2NAZ A;  5LEJ A;  2J5P A;  1R22 A;  4S05 A;  2HEO A;  2EB7 A;  3BP8 A;  2JPB A;  2YSR A;  2OA4 A;  4N9H A;  2Q2E A;  1PP7 U;  5EEH A;  1YO5 C;  2XRN A;  1I6X A;  5DCF A;  2JTV A;  3FF5 A;  4GYI A;  4KIB A;  1HW2 A;  3BWG A;  1T98 A;  2FML A;  5E1X A;  4B09 A;  4AVP A;  4N0B A;  1Z6T A;  2A61 A;  3D5L A;  3ERE D;  3WTY C;  1BM9 A;  5DDG A;  5FGM A;  5LRR A;  1T38 A;  2LSO A;  2RV8 A;  3RYR A;  3J80 Z;  4I02 A;  3KP5 A;  3ZMZ A;  4Q48 A;  2FF4 A;  1YIO A;  1D5V A;  1STZ A;  4A6D A;  1YLF A;  5D5V B;  2HOE A;  4P9F A;  2LDU A;  2H6C A;  2DTR A;  2EFP A;  2OBP A;  4IPA A;  2K27 A;  4XLP F;  2K7L A;  4EGZ A;  5JVT A;  5L3D A;  4HV6 A;  4KN4 X;  1YW9 A;  2P5L C;  1G4D A;  5K5Q A;  3G3Z A;  1LEB A;  2CQK A;  3KET A;  3L00 A;  1RIO H;  4UVB A;  1RNL A;  3E5Q A;  2L01 A;  3MAJ A;  3J80 K;  1I1S A;  4ASN A;  1OYI A;  1S3J A;  1XSV A;  2IA1 A;  1XN7 A;  4MEX F;  1G6N A;  3JAM K;  1O7F A;  1KU9 A;  3ZMV A;  1VTN C;  2LF8 A;  3ZMD A;  4XBF A;  1R1T A;  4B8X A;  4OOI A;  2QQA A;  2PMH A;  2RNJ A;  3RKW A;  1KU2 A;  4G8X A;  1HXD A;  1T2K A;  1L0O C;  1FZP B;  4PZJ A;  4FT8 A;  4U0V A;  2F5E A;  2RGV A;  1HBX G;  3FM5 A;  3QP5 A;  3G73 A;  2RQP A;  4EQQ A;  3L2C A;  3KP4 A;  1FYM A;  1KYW A;  3WTW C;  1B6A A;  3IKT A;  3TQN A;  1OMI A;  5ED4 A;  1KGS A;  2DPD A;  2COM A;  4OIO F;  2LNB A;  4NB5 A;  3ABU A;  1H0M A;  1K78 B;  1ZHF A;  4UNO A;  1D8K A;  2VN2 A;  4A12 A;  2DFI A;  4RGS A;  5E1W A;  4JK1 X;  3I58 A;  1ODD A;  5DV5 A;  3V7C A;  1P92 A;  1FWZ A;  3NRV A;  1S7A A;  2OAZ A;  1YFH A;  1ZG1 A;  1FSE A;  4LMY A;  2CYY A;  3HIF A;  4RGX A;  3JSP A;  4Z2Y A;  2A6H F;  4TV7 A;  2F5F A;  4CHU A;  5IT3 A;  3QU3 A;  1FSH A;  4LLN A;  2D1V A;  2RDP A;  2IPQ X;  2Q0O A;  3NEU A;  3I4P A;  3T5X A;  3WTU C;  1T39 A;  3MCZ A;  1ZYR F;  1FT9 A;  2A3S A;  1E2X A;  2XAF A;  2XIG A;  2KIM A;  4CYD A;  4HAM A;  2IT0 A;  3C7J A;  2FE3 A;  1ZRD A;  2V1X A;  2YR2 A;  1LJ9 A;  2LF7 A;  2EFN A;  1W5T A;  3DV8 A;  2D1H A;  2HKO A;  5CVJ A;  3LQR A;  3E3V A;  1R58 A;  4MHG A;  2FOK A;  4EV0 A;  3DXJ F;  3RYP A;  3V7S A;  1WWX A;  2WV0 A;  2UXX A;  1V4R A;  5HS7 A;  3H3U A;  4HF0 A;  1MDM A;  3J81 Z;  2K86 A;  3SXY A;  4UUV A;  1TNT A;  2DQL A;  2O6G E;  2JT1 A;  4S04 A;  3TOB A;  3N4M A;  1IRF A;  3GLX A;  2D45 A;  2M30 A;  5ICE A;  4WX9 A;  3QP6 A;  2GQQ A;  3WU0 A;  1MJB A;  4KFC A;  1F5T A;  4KMF A;  3Q9S A;  4MNU A;  1XDU A;  3JW4 A;  4I0A A;  1ZH5 A;  3M1E A;  5HDN A;  3MEX A;  4MEY F;  1XGM A;  2OU2 A;  2MH2 A;  1FBS A;  5E20 A;  1KYZ A;  4ZZL A;  2VE9 A;  2VBZ A;  4HDU A;  1SMT A;  4HOB A;  2ISZ A;  1SAX A;  3VEP A;  2HTS A;  5K1Y A;  4KN7 X;  2QBY B;  1PDN C;  3P9I A;  1TW3 A;  5D5U B;  1A04 A;  2VON A;  2O8X A;  2OZU A;  5BOX A;  3V4G A;  2STT A;  4FHT A;  4CXF A;  3GFI A;  4ZZD A;  2ZME A;  2M8E A;  3LAP A;  3LAJ A;  4RB0 A;  5AIQ A;  4IRI A;  2KJC A;  5FLX Z;  1IZ1 A;  1HST A;  4RB3 C;  3MWM A;  3AAF A;  1R5H A;  3EUH A;  5ICG A;  4NQW A;  1YW7 A;  4FX0 A;  5LLQ A;  4M73 A;  1LB2 A;  4G9Y A;  4HF2 A;  2PI0 A;  3DF8 A;  3PFI A;  3QRF F;  3B73 A;  3IHU A;  2MC3 A;  4UHT A;  4O3M A;  4KIC A;  4LG0 A;  2E7X A;  2UWM A;  2DK8 A;  1XD7 A;  3WTZ A;  4IHT A;  5K5R A;  2ETH A;  1FP2 A;  1ZG3 A;  1DP7 P;  3LQQ A;  2STW A;  5E8I A;  3GUD A;  1L3L A;  1REP C;  1IXS B;  2O61 A;  1P2F A;  1Z1D A;  1IN5 A;  3COA C;  5FB2 A;  2VC0 A;  1FPQ A;  4IRH A;  2W85 A;  3MZY A;  2HR3 A;  2DU9 A;  4ESJ A;  2HWV A;  3IRQ A;  1ULY A;  1ZLJ A;  3FXU A;  1GXP A;  1K7A A;  1U2W A;  4ENK A;  2HYG D;  1KQ8 A;  3GF2 A;  1GHC A;  1HKS A;  1E17 A;  5HS9 A;  2YU3 A;  4EM1 A;  3HUG A;  2GAU A;  5BMZ A;  3GO5 A;  1ZLK A;  2ZNZ A;  4HLX A;  2M45 A;  2A5Y B;  5DCM A;  2Z33 A;  3RI4 A;  5DUK A;  5D4S A;  4ESB A;  4I01 A;  1FLI A;  3DKW A;  2MH9 A;  3GEZ A;  2M1B A;  5JHU A;  4A0X A;  4GGG A;  1TQI A;  4LB6 B;  4JBA A;  1HW5 A;  2DT5 A;  3EQL F;  2HYF A;  3F22 A;  1PUE E;  1EH6 A;  1FBQ A;  3WGG A;  5HOO A;  4RAY A;  4FX4 A;  2GZW A;  1UB9 A;  4G7H F;  5H20 A;  4WCG A;  4Q47 A;  2GWR A;  1BBY A;  3WE2 A;  1UHW A;  2TDX A;  4YII A;  1CGP A;  2UXN A;  1TTY A;  4IJA A;  3OV8 A;  4KDP A;  4EM0 B;  5D4R A;  3E6D A;  3WOD F;  5CLS A;  2O0Y A;  2DK5 A;  1D8J A;  1S8N A;  2EFQ A;  2G7H A;  4U88 A;  1XMA A;  1I27 A;  3ROU A;  3ZP5 A;  2LKP A;  3I71 A;  5L3C A;  5AIP A;  3U1D A;  1ZGA A;  1U5T A;  3ZMS A;  3S2W A;  1HKT A;  1XCB A;  3M8E A;  4F7Z A;  2XRO A;  2HTJ A;  1B1B A;  4A5N A;  3WTX C;  2Z99 A;  5L3B A;  3DQV C;  2EWN A;  4Y13 A;  2GXG A;  2PQ8 A;  5LRS A;  2F5D A;  4RAZ A;  1KU3 A;  2HS5 A;  5H6Q A;  1R23 A;  3HSE A;  1LNW A;  2H94 A;  1BI0 A;  1OPC A;  1BC7 C;  3IL2 A;  2XKO A;  2IW5 A;  5A2Q K;  1LQ1 A;  2GIV A;  2L4M A;  2HZT A;  3L09 A;  1S6L A;  5HDG A;  1R36 A;  3RKX A;  1W4M A;  2P8T A;  3JAM Z;  3L7W A;  4K2E A;  5BS6 A;  5E18 F;  5D6E A;  1YS7 A;  3ABT A;  2EK5 A;  1F9N A;  3PQK A;  4CDG A;  1YG2 A;  2L4A A;  3I59 A;  1I1G A;  4PGH A;  3BPV A;  4EJO A;  4EJT A;  4HZF A;  5TRD A;  2ZXJ A;  5ERI A;  1MZB A;  1W5S A;  1IXC A;  5DD8 A;  2P4W A;  1Z05 A;  2W24 A;  5EEG A;  4WF2 A;  5LHH A;  1J75 A;  1IN6 A;  4RB1 A;  3U2R A;  1O3R A;  1QPM A;  4HV5 A;  3FMS A;  3R60 A;  2XUB A;  4Q4Z F;  4BAY A;  1RZ4 A;  4AIH A;  3FX3 A;  1R7J A;  3SQN A;  3RDI A;  3JTH A;  3BRO A;  3I0T A;  3HHG A;  1EV7 A;  3GFL A;  3JSO A;  2EJR A;  3CUQ A;  1J7K A;  4Y15 A;  5HVQ C;  2B0L A;  2V9V A;  2XAJ A;  3BOQ A;  4ZYD A;  2OQR A;  4GO1 A;  3F8F A;  1B9M A;  4BNC A;  2ZKZ A;  1QBJ A;  3E5U A;  1G3Y A;  2RN7 A;  4LB5 A;  1IN4 A;  3FXQ A;  1UFM A;  3HHH A;  4KUM A;  1O3S A;  1OR7 A;  5IT9 K;  2MLG A;  4EJW A;  1O57 A;  3WGH A;  4PDK A;  2P6S A;  2EA2 A;  4MQV A;  3KP2 A;  3HYI A;  1JXS A;  2HFH A;  3HRT A;  1IRG A;  3ZQ7 A;  4IHS A;  1MD0 A;  3C1D A;  4M9X A;  4GYG A;  4O5V A;  5KVR A;  1UST A;  5AON A;  3QU6 A;  4G94 A;  5JI6 A;  3F8B A;  2HGC A;  1FY7 A;  3FZV A;  4MQ9 F;  1KA8 A;  4WXD A;  1SFE A;  1U8R A;  3I54 A;  3P9K A;  1IAW A;  3RJP A;  4LK1 F;  2ADU A;  3DEU A;  2BBY A;  4CGZ A;  2IRF G;  2QVO A;  5F64 A;  4L9V A;  2FRH A;  1QNT A;  5DUI A;  4QLC U;  1MKM A;  1TW2 A;  5HLI A;  2HDC A;  4LGW A;  1KU7 A;  2PLY A;  1GXQ A;  1U6G A;  3ML6 A;  3K69 A;  5L3G A;  3GYH X;  1MDM B;  2ZJ2 A;  2A07 F;  3ZMT A;  1AWC A;  3GZ5 A;  2NYX A;  4R8H A;  1HW1 A;  3IWZ A;  2E7W A;  2DLL A;  5H6R A;  1ON2 A;  3N97 A;  3M7G A;  4RGR A;  2OD5 A;  2KIF A;  3MQ0 A;  5LHG A;  5KK1 A;  2F5C A;  2AS5 F;  1DPU A;  2X0L A;  4M6X A;  4L9T A;  3BY6 A;  4AIK A;  3F72 A;  1T0F A;  3ECO A;  1DDN A;  4U7B A;  1WRJ A;  4N9I A;  2VXZ A;  3I64 A;  4HA8 A;  3TDU C;  2H09 A;  1SMY F;  4L5I A;  3V8K A;  3QPT A;  1BC8 C;  5K5O A;  3SFZ A;  2O3F A;  3H92 A;  1SD6 A;  2YPR A;  5D5W B;  2CG4 A;  3CJN A;  2ZME B;  4HW0 A;  3F3X A;  3HTU A;  4RB2 C;  2J5O A;  2YX4 A;  1SD7 A;  2MD5 A;  2R3S A;  1FX7 A;  4LD5 A;  1LDJ A;  4EJU A;  4I0B A;  3DP7 A;  4YFK F;  1UCR A;  5D8L B;  4LLG F;  2FNP A;  4WXC A;  4U0Y A;  1TQM A;  1U3E M;  4UV9 A;  3EYI A;  4IF4 A;  3WTV C;  1K79 A;  2HQR A;  3RPU A;  1O3Q A;  3DPT A;  2QQB A;  4E70 A;  1MGT A;  3CTA A;  2W84 A;  1U5T C;  4R1H A;  1BI2 A;  5HS8 A;  1SFU A;  1JE8 A;  3SHF A;  4JQF A;  2HKX A;  4HDV A;  1KQ9 A;  2V1D A;  4PGG A;  4LG0 B;  1LEA A;  4M6Y A;  4OMZ A;  1R5G A;  3DPL C;  1P4W A;  3TO7 A;  3FWE A;  1K6O A;  4P9U A;  2G9W A;  4L0Y B;  5CVR A;  2FMY A;  1IW7 F;  4KIG A;  1ZN2 A;  3K9T A;  2K02 A;  2DPU A;  4NHJ A;  1Y0U A;  1RUO A;  2BV6 A;  3L9F A;  2R7D A;  1MJA A;  3FM3 A;  3ELK A;  3KP6 A;  5DYM A;  1J59 A;  1CF7 A;  2VBY A;  4HX7 A;  2VOO A;  1SD5 A;  3VB2 A;  2K4B A;  1QZY A;  4OIR F;  2VOP A;  2JZY A;  1HQC A;  1O7L A;  1XMK A;  2RC4 A;  4BH9 A;  2QLZ A;  4RGU A;  2K4J A;  2KJB A;  2XAQ A;  5FD5 A;  2XKP A;  4G6D A;  3F8N A;  2VT3 A;  2PFB A;  4ON0 A;  2FA5 A;  5LGU A;  5DCM B;  4QWQ A;  2WTE A;  2XAH A;  3IWF A;  2X4H A;  2P6T A;  3KEO A;  4L5J A;  1EH7 A;  4KMU X;  3JTG A;  2GXB A;  3EYY A;  3FMQ A;  1XB4 A;  2QQ9 A;  1MJ9 A;  4BYY A;  3V8J A;  5D6F A;  2NNY A;  3ECH A;  2V6C A;  2Z3Y A;  1BIA A;  2XGX A;  2FBI A;  3LA3 A;  4ENJ A;  1YW8 A;  2CGP A;  3CUQ C;  5LHI A;  4BHC A;  4OIN F;  1IN7 A;  3F8C A;  4UVA A;  2BYV E;  4A5M A;  5BQT A;  1FP1 D;  1USS A;  4H0E A;  1FC3 A;  2IA0 A;  2XAG A;  5DEQ A;  1EH8 A;  3KFW X;  4OIP F;  2JRT A;  5D5X B;  2ZO4 A;  3K1N A;  4EMS A;  4UVC A;  2F2E A;  1F1Z A;  1U5T B;  4HLY A;  4Y17 A;  1OKR A;  4MGR A;  2Z9O A;  3KEQ A;  3E6B A;  2EFO A;  1J5Y A;  2EV6 A;  4HQM A;  5FFZ A;  3KP7 A;  1FOK A;  1HSJ A;  1J2X A;  2VOD A;  2BEO A;  4WWC A;  4R79 A;  2QUF A;  2W25 A;  4YIF A;  2FBK A;  2Y48 A;  3R61 A;  1ONV A;  5A2Q Z;  3E5X A;  2VT2 A;  5DD4 A;  3RPQ A;  1Z9C A;  3K1M A;  3KLN A;  3HSF A;  4ZYH A;  3LA2 A;  5J6X A; 
#chains in the Genus database with same CATH topology
 1B9N A;  3GW2 A;  3J7A Y;  3CP2 A;  3WG9 A;  3HG9 A;  1J9I A;  4LJZ F;  2AQE A;  2D2W A;  1FTZ A;  1JUM A;  1JGG A;  3HL2 A;  5GTI C;  3J7Z I;  1W7P A;  2AXL A;  4LIT A;  3W6K B;  2JPC A;  4DYR A;  4EM2 A;  5TGT A;  2VE8 A;  4HX4 A;  2PEX A;  1B59 A;  2DA6 A;  2P7C B;  1FYL A;  3J7A O;  3CO6 C;  1T6S A;  1ZK8 A;  2PG4 A;  5D8K B;  4HX8 A;  2O03 A;  2KPM A;  1OQY A;  1SFX A;  3I59 B;  1KQ0 A;  2DO7 A;  3K4N A;  4LLL A;  3L1P A;  5HLH A;  1O3T A;  2HPM A;  1YJN I;  1HF0 A;  1Y0N A;  2XVC A;  2E19 A;  3KE2 A;  3V7R A;  1NHA A;  1HDD C;  1RKT A;  1BN5 A;  1VND A;  2G7U A;  2GM4 A;  2XPU A;  3IUO A;  4JX5 A;  5F0F A;  4BHP A;  2XF5 A;  3LSM A;  4ETS A;  4GDF A;  2ZFW A;  4JYK A;  5TJJ A;  5IP7 J;  3W6V A;  2L3D A;  4A6E A;  2KHM A;  1X3W B;  3AG1 H;  2Z5U A;  3IH4 A;  1PP8 F;  2FBH A;  4RLF A;  4I7H A;  2QGU A;  3BCA A;  1T95 A;  3HRS A;  4UXN A;  4AWX B;  3D1N I;  3H3V K;  3I5U A;  2Y0S A;  2MA3 A;  3EET A;  3G2B A;  1HDP A;  4BJT A;  3ISP A;  2IVM A;  3F8M A;  3TP0 A;  3GFM A;  1SD4 A;  4XK4 A;  3KZZ A;  3U9G A;  4A93 J;  4RLQ A;  1JTY A;  1ON1 A;  3BQZ A;  3CCR I;  4CIC A;  4YFN F;  2XPV A;  3K2A A;  2DFF A;  2OF7 A;  4M3F A;  2I10 A;  1P7J A;  2XAS A;  2L7K A;  3K4M A;  4YFX F;  1Z91 A;  2JSC A;  1I5Z A;  3CUQ B;  1XCV A;  4I09 A;  2R92 J;  1BJA A;  1D1C A;  4M9S A;  5J40 A;  2KIQ A;  1Q1H A;  2BE5 F;  3KX2 A;  3ZXS A;  1VQ8 I;  2WB1 A;  4NUB A;  1T0F C;  5CQG A;  5CJ9 A;  5E79 C;  1QO0 D;  2MAB A;  4HF1 A;  4L9J A;  3M8J A;  3RTR A;  1O4X A;  4P96 A;  1BL0 A;  5IYD J;  2RAE A;  4XSX F;  3F6O A;  3HRU A;  1YTY A;  2ZBK A;  1ZG5 A;  4Q5S F;  1BR1 A;  2IGN A;  2IGK A;  5IT9 Z;  1S7O A;  2XDV A;  2HYJ A;  4FIS A;  1LDD A;  3BR0 A;  3OYH A;  3PQJ A;  3VOE A;  5HLG A;  1ZR4 A;  2WC2 A;  2IEK A;  3OYL A;  3RKQ A;  3RKY A;  1G3T A;  3O3K A;  4L18 B;  4O6J A;  2VKE A;  1JI8 A;  5DM6 F;  2L02 A;  3H1C A;  1Y1W J;  4B48 A;  1R4M B;  2MG4 A;  2ME0 A;  5GAE J;  1BR2 A;  3HM5 A;  1R00 A;  2V4J C;  3DCF A;  4XLN F;  1JHH A;  2GXA A;  5F1R A;  2JMW A;  2R4G A;  3LFK A;  2EV5 A;  1H9T A;  2C6Y A;  2ZCW A;  5ILV A;  2XHK A;  2RVC A;  3EDP A;  5E3N A;  3I53 A;  3RPU D;  5L3E A;  3ULQ B;  2NS0 A;  1W36 D;  2EZL A;  2DA7 A;  1LFU P;  1F43 A;  3FKJ A;  2BXY A;  1VQN I;  3KCC A;  3HOT A;  2CW0 F;  1R1V A;  2HOA A;  3BG9 A;  3FHZ A;  4OIQ F;  3GWZ A;  4I98 B;  5EEA A;  3HSR A;  1S72 I;  1JJ8 C;  1V3F A;  4P1W A;  1W36 C;  1GVJ A;  3TOA A;  1WI9 A;  3ZN1 A;  3BZ6 A;  4M71 A;  1OLT A;  1XX5 A;  3E6C C;  4GXO A;  4IVN A;  1U78 A;  2L5Q A;  3GCM A;  1XSD A;  2NOG A;  1ORK A;  3TKY A;  2FXA A;  3MKY B;  1EF4 A;  2WWY A;  1JGS A;  4CA0 A;  3OYA A;  3CCY A;  3Q0V A;  2X1E A;  3BJO A;  3H3Z A;  2DQR A;  3QPH A;  5J8F A;  5GAH J;  2DI3 A;  1RI7 A;  2V1N A;  3C18 A;  1SAU A;  3GTG J;  1G59 A;  1IUF A;  2QWW A;  3OSG A;  1PUF B;  3S2D J;  5L3F A;  2DMT A;  1FEX A;  2MLK A;  4KNY A;  3P7N A;  4E7Z A;  3TGN A;  2KP6 A;  4A3B J;  1FBU A;  3PFY A;  2QM3 A;  4IRG A;  3HJE A;  3EPZ A;  2XF6 A;  4XIC A;  2H1L A;  2M5W A;  4L9N A;  1MSF C;  5FKN A;  3G6E I;  2IS6 A;  2V1U A;  2VQL A;  1IXR C;  5JFR A;  3W3C A;  2DMU A;  1XGO A;  2FD5 A;  2B9S A;  2XRL A;  2GA2 A;  1ZQ3 P;  1WHU A;  3RIR A;  3G1O A;  3WGI A;  4N4N B;  3RCO A;  5FFX A;  2MGQ A;  3BCB A;  3MVP A;  5ICC A;  1JKR C;  2ZC2 A;  1E3H A;  2PJP A;  2QYO A;  1FYK A;  3UNG C;  1VQ4 I;  4DYC A;  2IA2 A;  5JHF A;  2XV4 S;  3T1B A;  2DA1 A;  2JK3 A;  1IF1 A;  2L9N A;  4L0Z B;  2FSW A;  2YX7 A;  1ZAO A;  4ZDP A;  3ZN0 A;  4AD9 A;  1Z6R A;  1Y39 A;  2QZ8 A;  1SC7 A;  5FD6 A;  1TC3 C;  1V5F A;  2IP2 A;  4G7Z F;  5ICF A;  1BA5 A;  1YS6 A;  4M74 A;  4QSH A;  5HDK A;  4IZZ A;  1JHF A;  1K78 A;  5KAI C;  2OZ6 A;  5LEK A;  4HQE A;  1X4P A;  3BTC A;  4X1E A;  1LVA A;  4EJV A;  2CMP A;  3CO7 C;  2L54 A;  1DU6 A;  2JUG A;  4DYQ A;  2GA1 A;  1Z0X A;  1FIA A;  1XDS A;  2ISY A;  4OU0 A;  4HEA 2;  2P5K A;  1R6R A;  1V5E A;  3ASN H;  1TNS A;  3WE3 A;  2ZJP F;  5J8C A;  2OCC H;  3K0L A;  4CO8 A;  3ZQI A;  2P7V B;  4ENN A;  3OYF A;  2K85 A;  3H0D A;  3JRB A;  1YQA A;  2E1N A;  4BUP A;  3NAU A;  1HCR A;  2BXZ A;  1C0W A;  3L2U A;  4E6K G;  2LC2 A;  4D1Q A;  4XR6 A;  3TBI A;  2H27 A;  2CWE A;  2M3A A;  4HNV A;  2V79 A;  4D0P A;  1NK2 P;  1R5I D;  3OYM A;  1D1A A;  4IXA A;  2EFW A;  2P5V A;  2N8G A;  2FEZ A;  3O2P E;  4XLF A;  5F6F A;  3BR5 A;  3RQ4 A;  4A0Z A;  1E0E A;  4ESF A;  1WPK A;  2LLK A;  2FU4 A;  3V8L A;  1OCO H;  2EV0 A;  4M9Z A;  4FE7 A;  1ZRC A;  3C2B A;  2V6E A;  2LY1 A;  3TO6 A;  3OYD A;  1LKX A;  3KZY A;  1X19 A;  5E8G A;  3F23 A;  3TDZ C;  2QKL B;  2CSO A;  1S29 A;  3P5J A;  3P9C A;  1NK3 P;  2ESH A;  1WJE A;  1G8X A;  2X9D A;  1X3U A;  2Z16 A;  4G6Q A;  1XGS A;  3JCU C;  1TP4 A;  1H9G A;  4XRS G;  2H6B A;  1U9N A;  2L9R A;  1XSX A;  2RKH A;  3ZCO A;  4BDZ A;  3TMO A;  4GCV A;  3CCQ I;  3FK7 A;  3BR3 A;  3Q5F A;  1S7E A;  3H9G A;  5GTH C;  1RUN A;  3VWB A;  1BIB A;  1XGN A;  2OQG A;  4U87 A;  3CUO A;  2A69 F;  1B4A A;  5BPI A;  4F93 B;  4LOC A;  5H2F C;  3GVA A;  2VI6 A;  1Y8Q B;  2KZG A;  2E2H J;  3ZPL A;  3QAH A;  3MZH A;  4XKW A;  1E3O C;  4C3H J;  5JR3 A;  2RRE A;  3RSN A;  1PVE A;  1BW5 A;  2HQN A;  3A1Y A;  4UV8 A;  2E1C A;  2CV2 A;  1OYW A;  3Q3S A;  1TQP A;  1BI1 A;  1P4A A;  2DAO A;  4CZZ A;  4BXU A;  4XLC A;  4BQQ A;  1F4K A;  2PMU A;  2M87 A;  3LSG A;  3GXO A;  3H9Q A;  4P5O A;  1WQ2 A;  1LDK B;  1IV8 A;  3E97 A;  1H88 C;  3QPS A;  4NC8 A;  2R7O A;  3CLO A;  4BQN A;  1ZRE A;  2R5Y A;  2E1O A;  3GZ6 A;  4ZTF A;  2QEN A;  2DTZ A;  3CME I;  3I4N J;  3OYK A;  1FMV A;  1BI3 A;  1WFX A;  4YG2 F;  1A35 A;  3DBH B;  2UZK A;  3A01 A;  5LD2 C;  5E1Z B;  4EEF G;  2K9L A;  1ENH A;  2PN6 A;  1OYY A;  1QQI A;  4RS8 A;  3R4K A;  5ILS A;  1W7P D;  4CCJ A;  5DS9 A;  4G7O F;  3OOP A;  4XRF A;  3J81 K;  3CDL A;  1CF7 B;  4XON A;  2ELH A;  5JLW A;  2CV1 A;  2OPT A;  5GP9 A;  5J1Y A;  3WTT C;  3LSK A;  1MW7 A;  2KMU A;  3TW6 A;  1VFC A;  4IOA F;  3T8R A;  5CYV A;  5C4X J;  3TO9 A;  2BY1 A;  4LK0 F;  4C2M J;  2Y0M A;  3ABM H;  3S8P A;  4BBS J;  5ILU A;  1LE8 A;  2JN6 A;  3Q9V A;  1WSU A;  1AOY A;  2NOJ B;  1K61 A;  2A6E F;  2LOO A;  2KIU A;  1D3Y A;  2V9P A;  3ONQ A;  3KYC B;  3F6V A;  3W2W A;  2A68 F;  4JP0 A;  5CVI A;  1HLV A;  1VQ7 I;  5K7F A;  3JRH A;  4F3Q A;  3WTS C;  1JT6 A;  2W48 A;  4LIU A;  4HNT A;  2XGD A;  2XB5 A;  4W97 A;  5CVV A;  3BJ6 A;  5LBQ A;  3DU6 A;  3IKV A;  4MTD A;  4BXX J;  2F5V A;  2MBF A;  1TBX A;  9ANT A;  3DLL F;  2L9V A;  3L2W A;  3KIO A;  3DKX A;  4M72 A;  4IQJ A;  4CCN A;  1G3S A;  3IC7 A;  2IJL A;  2VQC A;  2QBY A;  3S1N J;  1TT5 B;  1UHS A;  5FRN A;  3AL0 C;  4YRV A;  2MW8 A;  4U7D A;  5FJ8 J;  2NRA C;  5E17 F;  3ZQG A;  3GBG A;  4ZYG A;  3KYD B;  3CMA I;  1J0R A;  3D0S A;  3FXR A;  4AIJ A;  3HOZ J;  1HC8 A;  3HRM A;  3VYR B;  2ZNY A;  3VFZ A;  5J1R A;  3BDD A;  2P81 A;  2ESN A;  2DW4 A;  5CKT A;  2CFX A;  2MSY A;  1ETV A;  3VOD A;  2NNN A;  4HSR A;  2EA4 A;  4PJN A;  2W4S A;  1HKQ A;  3T0Y A;  2VXD A;  3CDH A;  4WK8 F;  3J7Y J;  4BAC A;  2VBX A;  1D0Z A;  1JTX A;  4DZP A;  2R7U A;  4B47 A;  4DNC A;  3OS1 A;  2KKO A;  4BQA A;  3HKZ N;  3KP3 A;  4WXH A;  3WG7 H;  4BJ6 C;  2OJE D;  3R0J A;  2ACJ A;  1RKW A;  1WGX A;  2X6W A;  4HYE A;  1UHM A;  5M3M J;  1X2N A;  3B02 A;  5FO5 A;  3K10 A;  5C4J J;  3WU1 B;  5FLX K;  2LTP A;  4ENM A;  5M5W J;  2W57 A;  1FOX A;  2FQ3 A;  1DUX C;  3IV5 A;  3QOP A;  5CQE A;  3BJA A;  3OWT A;  3HOX J;  1P4X A;  4OMY A;  4JOM A;  1B8I A;  3I55 I;  3QOD A;  1DPR A;  3LL7 A;  4KIF A;  3NQO A;  2W1O A;  4BQO A;  3HPG A;  4II3 A;  1VZ0 A;  4U0W A;  3JRF A;  2F4I A;  4HBL A;  3R0A A;  1BJZ A;  4KJZ A;  3GX4 X;  1IUY A;  1QRY A;  2Y2Z A;  2HI3 A;  1YX5 A;  3ZMU A;  3KLO A;  1QGP A;  3R6S A;  1P6R A;  2DOA A;  1ZAR A;  3IAM 2;  5J47 A;  4A0Y A;  2KDZ A;  2PJR A;  2JVG A;  1WJ5 A;  4MO7 A;  2EZH A;  3O8H A;  3S3O A;  3GTM J;  4E7L A;  3DFG A;  2VPR A;  2PMZ A;  2L7M P;  2Y69 H;  1ZGJ A;  4D5C A;  5B3S H;  3K2Z A;  3SZP A;  4I2O A;  2CFO A;  3D5S C;  4KA4 A;  1G3W A;  1JKP C;  2CQX A;  1BOA A;  3AG4 H;  3K4C A;  1FNN A;  1OCR H;  3FMR A;  3E6M A;  1YYV A;  3T8T A;  3MFK A;  5LGT A;  2BGC A;  2CO5 A;  3LWF A;  4BY7 J;  3SZT A;  5BPD A;  3W2V A;  4ZYE A;  3OYJ A;  5LGN A;  2KL4 A;  3O6B B;  1Z7U A;  1MBE A;  3B6A A;  1UG2 A;  3M9A A;  4P55 A;  2EQR A;  2Y75 A;  3LA7 A;  3PNY A;  3LSJ A;  3FXK A;  1GV2 A;  4DBQ A;  4XSZ F;  2VBW A;  3C3W A;  2PBI A;  2R7F A;  4ZH4 F;  4KT5 C;  4BHB A;  4A3I J;  3HTS B;  5TIS C;  3BQY A;  1POG A;  4QPO A;  2KRC A;  4I76 A;  3LST A;  3K1P A;  3FHN A;  3HGG A;  3REO A;  4XOR A;  1W7P B;  3CCV I;  2K9Q A;  3GFJ A;  2DBB A;  1T08 B;  1WCM J;  3VSK A;  3F21 A;  4MTE A;  1QZZ A;  1TLH B;  1WH5 A;  5CVU A;  3CC7 I;  1ZRF A;  2E71 A;  2KRF A;  4IQ4 A;  2Q8K A;  2E60 A;  4LIV A;  2ZJR F;  1BOB A;  2VC1 A;  4Z6Y A;  1VQ5 I;  2FOW A;  4PCQ A;  3IRR A;  6PAX A;  1WJD A;  5J1U A;  4KYW A;  4LFU A;  3BTL A;  1WKM A;  1WJB A;  4EVI A;  4EGY A;  3BLY A;  3X2Q H;  3PIO F;  3QQA A;  4UB8 C;  3HOS A;  5IYB J;  2R7V A;  4PFP A;  2F6C A;  1IN8 A;  3BPX A;  1R1U A;  2TCT A;  2FNA A;  4BE2 A;  5EJC A;  1ACI A;  1AKH A;  4DQ2 A;  4NC6 A;  2BY3 A;  2GOX B;  4A2U A;  2VIX A;  3ASO H;  3W6J B;  3AL0 B;  3M8F A;  3FKI J;  3CQZ J;  4A3F J;  2NAZ A;  5LEJ A;  2J5P A;  1R22 A;  4S05 A;  2HEO A;  2EB7 A;  3BP8 A;  2JPB A;  3FBN B;  2YSR A;  2E5N A;  3LSI A;  2OA4 A;  4N9H A;  3BR1 A;  2Q2E A;  1VQ6 I;  1PP7 U;  5EEH A;  5EGO A;  1YO5 C;  2XRN A;  3GTK J;  2ELK A;  2DDB A;  1I6X A;  4PSW A;  5DCF A;  2JTV A;  5IP9 J;  3FF5 A;  3HDD A;  2RQQ A;  3ZQH A;  1QVU A;  4GYI A;  4KIB A;  4D7M A;  1HW2 A;  3CCU I;  1HA8 A;  3BWG A;  1T98 A;  2FML A;  5E1X A;  4B09 A;  3C2G A;  4F92 B;  4AVP A;  4N0B A;  1Z6T A;  2A61 A;  1QHG A;  2QQ8 A;  2G0E A;  1A31 A;  1S9H A;  2HZD A;  2EIL H;  3HZJ A;  2DXI A;  3D5L A;  3ERE D;  3WTY C;  1BM9 A;  5DDG A;  3I4M J;  5FGM A;  3WHB A;  2KLO A;  5LRR A;  2ELJ A;  3DKY A;  3OY9 A;  3OR2 C;  4AVZ A;  1T38 A;  1Q1V A;  4H4K C;  2LSO A;  4B4C A;  2RV8 A;  3RYR A;  3J80 Z;  3GZN B;  4NBQ A;  5HOD A;  2LG4 A;  4I02 A;  3BG3 A;  1UJ8 A;  3KP5 A;  3ZMZ A;  4Q48 A;  4C3I J;  1MMS A;  3LFU A;  2FF4 A;  1YIO A;  1D5V A;  2ZXI A;  3JRA A;  4XN0 A;  1STZ A;  3K4J A;  3V42 A;  5BNG A;  3B6C A;  2BOL A;  1YLF A;  4A6D A;  5D5V B;  2HOE A;  4AYB N;  4P9F A;  2LDU A;  3G1L A;  2H6C A;  2DTR A;  2LY9 A;  3S32 A;  3GTO J;  4XRM A;  2L0K A;  3PSF A;  5IP6 A;  3OYG A;  4XID A;  2JA8 J;  1DQU A;  2EFP A;  1YJW I;  4J19 A;  2OBP A;  3DPU A;  1GUU A;  4IPA A;  2QSG X;  1ZKG A;  2K27 A;  4XLP F;  2K7L A;  4EGZ A;  5DM7 F;  5JVT A;  1KON A;  4AM3 A;  5L3D A;  2KFD A;  2XSJ C;  4HV6 A;  2O9L A;  4KN4 X;  1YW9 A;  2P5L C;  2KT0 A;  1G4D A;  2XB0 X;  5K5Q A;  3G3Z A;  1LEB A;  2CQK A;  1N78 A;  3Q0U A;  3KET A;  1W0U A;  4PUS A;  3L00 A;  4E7S A;  1RIO H;  4UVB A;  1DP3 A;  1RNL A;  2DOF A;  3E5Q A;  3VYS B;  2CRG A;  4RA2 A;  2CH0 A;  2L01 A;  2WB1 N;  4I6Z A;  3MAJ A;  1R71 A;  2BHZ A;  2KRH A;  1OFC X;  3C2H A;  2ID3 A;  1OCP A;  3J80 K;  3OSF A;  4HPQ A;  1I1S A;  5GAD J;  4ASN A;  1ZTR A;  4FTH A;  1OYI A;  1S3J A;  1XSV A;  3QOE A;  4HRI A;  2IA1 A;  1XN7 A;  3PNT A;  4MEX F;  3E7L A;  1G6N A;  4PJ0 C;  2B7E A;  3H5A A;  3JAM K;  1IGN A;  1O7F A;  1KU9 A;  3ZMV A;  1VTN C;  2LF8 A;  3ZMD A;  4XBF A;  1R1T A;  4B8X A;  4OOI A;  2QQA A;  2PMH A;  1FJL A;  2RNJ A;  3FK6 A;  2JUC A;  1KU2 A;  3RKW A;  4G8X A;  3LSP A;  4V19 K;  1HXD A;  4C2T A;  1TWG J;  1T2K A;  1L0O C;  1FZP B;  4PZJ A;  3H5N A;  4CUG A;  4FT8 A;  5FKL A;  4U0V A;  2UV1 A;  2F5E A;  2R93 J;  2VQG A;  3L2R A;  2RGV A;  1HBX G;  4E7H A;  3SYT A;  1RES A;  3FM5 A;  3QP5 A;  2RQP A;  3G73 A;  1ZR2 A;  4EQQ A;  2DFE A;  3L2C A;  4XOT A;  3KP4 A;  1FYM A;  1KYW A;  3WTW C;  1B6A A;  4XLA A;  3IKT A;  1W1W E;  3TQN A;  2WAF A;  3TP3 A;  3ZQF A;  3S17 J;  2DJI A;  1OMI A;  5ED4 A;  1KGS A;  2DPD A;  2COM A;  4OIO F;  2LNB A;  4CSW A;  4NB5 A;  3SDG A;  2EIN H;  3ABU A;  1H0M A;  1K78 B;  2EIK H;  4PJL A;  1ZHF A;  4UNO A;  4MLO A;  2LY2 A;  4X0G A;  4CYC A;  1YRN A;  1D8K A;  2RNG A;  2VN2 A;  4A12 A;  2DFI A;  4RGS A;  5E1W A;  3CF5 F;  4JK1 X;  1SEU A;  2WA0 A;  3I58 A;  3K6G A;  1ODD A;  4C2U A;  2VKH A;  1IDZ A;  2M4K A;  2EZK A;  2FQ4 A;  3MKW B;  5DV5 A;  3V7C A;  1P92 A;  1FWZ A;  1S5L C;  5JVG F;  1I50 J;  2LFB A;  2LRE A;  2CU7 A;  3NRV A;  3PM1 A;  4ZDO A;  1RC9 A;  3MKL A;  1Y1V J;  2CW8 A;  1YHQ I;  3LSH A;  4N4O B;  4PFO A;  1S7A A;  4FAS D;  4HST A;  2OAZ A;  1DGR M;  4A3M J;  1YFH A;  1ZG1 A;  1FSE A;  2IBD A;  2MD0 A;  2VKD A;  4IHW A;  2AHQ A;  1QVT A;  5HNH A;  4LMY A;  2FUG 2;  2CYY A;  2DYR H;  3HIF A;  4XN3 A;  2NVX J;  4RGX A;  3JSP A;  1AA7 A;  2O5R A;  1YOV B;  4Z2Y A;  2A6H F;  4XRS A;  2YS9 A;  4BY1 J;  1M1E B;  3IP4 B;  3S1Q J;  4TV7 A;  1ETY A;  4G6T B;  2F5F A;  2R7T A;  1BW6 A;  2X6O A;  4CHU A;  3JRE A;  2Z2S B;  5IT3 A;  2BHY A;  4NNJ A;  2X51 A;  2V9K A;  3QU3 A;  3ZQQ A;  1FSH A;  4LLN A;  1V55 H;  2D1V A;  2RDP A;  4XKC A;  2IPQ X;  2Q0O A;  1MIJ A;  4BJ5 C;  5CPR B;  1ETQ A;  2I5U A;  4MFE A;  1IJW C;  3NEU A;  3I4P A;  3N05 A;  4RM3 A;  3T5X A;  5K7H A;  4XL9 A;  5HNF A;  1YIT I;  2Q1Z B;  4A3D J;  1FIP A;  2VQH A;  3WTU C;  2IGO A;  5C3E J;  3UKG A;  5DTD A;  3FXL A;  3BC8 A;  1T39 A;  3MCZ A;  1ZYR F;  2O8K A;  1FT9 A;  1FMW A;  3H36 A;  2A3S A;  1E2X A;  2QKM B;  1WJF A;  2XAF A;  2XIG A;  2KIM A;  4CYD A;  4HAM A;  5B5E C;  4RAG A;  2IT0 A;  3C7J A;  2FE3 A;  1ZRD A;  2V1X A;  3AG3 H;  1QZE A;  1WJA A;  2YR2 A;  1LJ9 A;  3HB9 A;  2LF7 A;  2EFN A;  1MNE A;  1W5T A;  1X1B A;  2CUZ A;  3DV8 A;  2DA3 A;  3EUK L;  2D1H A;  1MBK A;  2HKO A;  4Y4R A;  5CVJ A;  1GLN A;  3LQR A;  4DGW B;  5JLX A;  2ZXH A;  3E3V A;  1R58 A;  4MHG A;  1P7I A;  3A0H C;  2FOK A;  1EA3 A;  3DXJ F;  4EV0 A;  1XS9 A;  3RYP A;  2ZB9 A;  3V7S A;  1WWX A;  2IS1 A;  2QSF X;  2WV0 A;  2UXX A;  1Z3Y A;  1V4R A;  5HS7 A;  3H3U A;  4BEH B;  2VLA A;  4HF0 A;  3FXJ A;  1MDM A;  3J81 Z;  2K86 A;  2M7A A;  3SXY A;  4UUV A;  1TNT A;  2DQL A;  2O6G E;  2JT1 A;  3BZC A;  4S04 A;  2WY8 Q;  2EIM H;  3TOB A;  1YX3 A;  3A01 B;  3N4M A;  1IRF A;  3GLX A;  3CJT B;  2D45 A;  1IO2 A;  2M30 A;  5ICE A;  5FRM A;  1X58 A;  4WX9 A;  4UUT A;  5EG0 A;  3QP6 A;  3NWT A;  2GQQ A;  3G1M A;  3WU0 A;  3M1C A;  3JR9 A;  1MJB A;  1RRJ A;  4KFC A;  1F5T A;  4KMF A;  3Q9S A;  4MNU A;  1EJ9 A;  1XDU A;  3JW4 A;  4RM2 A;  2B63 J;  4D7N A;  4I0A A;  4XLE A;  1ZH5 A;  3M1E A;  4C3J J;  5HDN A;  3MEX A;  4MEY F;  1XGM A;  1RR8 C;  1PYV A;  1JKO C;  2OU2 A;  1AHD P;  3FXO A;  1SVL A;  2MH2 A;  1FTT A;  1LUJ B;  1FBS A;  2P0W A;  5E20 A;  4AID A;  4DZJ A;  3JRG A;  1KYZ A;  1A36 A;  1B72 A;  3LMM A;  3S3N A;  1LPQ A;  3OMY A;  4ZZL A;  2VE9 A;  5EZG A;  2VBZ A;  1Y6I A;  4HDU A;  1SMT A;  2E2J J;  4HOB A;  4B43 A;  1V5G A;  2QSH X;  2ISZ A;  1SAX A;  3QPL A;  4ZYA A;  2IGM A;  3VEP A;  2HTS A;  5GAG J;  5B66 C;  4JX4 A;  5K1Y A;  3BTJ A;  4KN7 X;  2QBY B;  1I6H J;  1PDN C;  3VPR A;  2K5C A;  3P9I A;  1TW3 A;  4B44 A;  5D5U B;  1A04 A;  2DOD A;  4NC7 A;  2O8X A;  1WVR A;  3DU5 A;  2VON A;  2OZU A;  4IL6 C;  5FKK A;  4UB6 C;  5BOX A;  3BG5 A;  3V4G A;  2STT A;  4FHT A;  5F08 A;  4CXF A;  3GFI A;  4ZZD A;  1UEL B;  2ZME A;  2M8E A;  4B1R A;  3I3L A;  3LAP A;  3LAJ A;  4RB0 A;  3FIS A;  1UMQ A;  5AIQ A;  1IG7 A;  1OIS A;  3BZK A;  2HXO A;  2ICW G;  4IRI A;  2KJC A;  5FLX Z;  1IZ1 A;  2ZXW H;  1HST A;  2AXT C;  4RB3 C;  5EZH A;  3DTE A;  3MWM A;  3AAF A;  3IAS 2;  1R5H A;  3EUH A;  5ICG A;  3S14 J;  4NQW A;  1YW7 A;  3CCS I;  4FX0 A;  5LLQ A;  4M73 A;  1XC5 A;  1D5Y A;  1LB2 A;  2MFZ A;  4G9Y A;  3MD2 A;  4HF2 A;  2PI0 A;  4BDY A;  3DF8 A;  3PFI A;  3G4S I;  3MZ8 A;  3QRF F;  3B73 A;  3S2H J;  4D9J A;  1B8I B;  1OJL A;  4S0H B;  3IHU A;  2MC3 A;  3S1M J;  2W82 A;  4NDL A;  2R7W A;  4UHT A;  3G71 I;  4KIC A;  4O3M A;  4LG0 A;  1D0Y A;  3CMY A;  1R4N B;  2KQR A;  4E7J A;  3CMM A;  2E7X A;  2UWM A;  2QCO A;  3CJQ B;  2BW3 A;  2DK8 A;  1XD7 A;  3WTZ A;  2MC4 A;  1Z3X A;  3EUA A;  3OYI A;  2PJR B;  5K5R A;  4IHT A;  2ETH A;  1FP2 A;  1IDY A;  4PSX A;  1ZG3 A;  1IRZ A;  1N75 A;  4IHV A;  1TWA J;  2WAE A;  1DP7 P;  3LQQ A;  2STW A;  5E8I A;  3HC7 A;  2VL8 A;  2QEX I;  4JX6 A;  2LR8 A;  4HG2 A;  2F4O B;  3GUD A;  1L3L A;  1REP C;  3U1K A;  1IXS B;  1P9Q C;  2X1D A;  1MH3 A;  3D5R C;  2O61 A;  3WU2 C;  1VQL I;  1P2F A;  1Z1D A;  1IN5 A;  3COA C;  1A6I A;  1XG1 A;  5FB2 A;  2VC0 A;  1FPQ A;  3GME A;  5E3O A;  4IRH A;  1ETW A;  5F0C A;  3DWL E;  5J4V A;  2W85 A;  3MZY A;  2HR3 A;  2DU9 A;  2K3F A;  5F27 A;  4ESJ A;  1UZC A;  3ZQC A;  1GVD A;  1K4S A;  2HWV A;  3IRQ A;  1ULY A;  1ZLJ A;  2DN0 A;  3FXU A;  1GXP A;  1K7A A;  3CC4 I;  5IOY A;  1U2W A;  3K4L A;  1SFK A;  2R7R A;  4ENK A;  3SZG A;  3A02 A;  1WI3 A;  2HYG D;  1KQ8 A;  2X85 A;  3GF2 A;  1GHC A;  2CJJ A;  2I8D A;  1HKS A;  1E17 A;  1ETO A;  5HS9 A;  1IC8 A;  2YU3 A;  3KEY A;  1MMD A;  4EM1 A;  2BVL A;  3HUG A;  2GAU A;  5BMZ A;  3GO5 A;  1ZLK A;  3S16 J;  2LK2 A;  2ZNZ A;  4HLX A;  2AQF A;  2O7O A;  2M45 A;  2A5Y B;  5DCM A;  5IYC J;  5K7Z A;  2Z33 A;  2BVM A;  1X1A A;  2BY0 A;  5DUK A;  1FOW A;  3RI4 A;  1XPX A;  5D4S A;  4ESB A;  1K4T A;  4I01 A;  1FLI A;  3DKW A;  4L5E A;  3DLA A;  1WH7 A;  2MH9 A;  3M4O J;  3GEZ A;  3VYU B;  2M1B A;  3BG7 A;  4CCO A;  3MKZ A;  1TWH J;  5JHU A;  4A0X A;  2WAQ N;  4GGG A;  1AKH B;  1TQI A;  4LB6 B;  4AUX A;  4JBA A;  4YEJ A;  3WHC A;  1RR7 A;  1HW5 A;  4OWR B;  1N77 A;  2DT5 A;  3EQL F;  2DCE A;  2R5Z A;  2LYC A;  3I9V 2;  2HYF A;  3F22 A;  2F48 A;  4UUS A;  1PUE E;  1EH6 A;  1FBQ A;  3WGG A;  5HOO A;  3HOU J;  4RAY A;  4FX4 A;  2GZW A;  1UB9 A;  2FJ1 A;  2L7F P;  4G7H F;  2H1K A;  2Q2E B;  5H20 A;  4WCG A;  4Q47 A;  2HVR A;  2GWR A;  1BBY A;  3WE2 A;  1ETX A;  3F9K A;  5EGO B;  2JA2 A;  1UHW A;  3IH2 A;  2TDX A;  3CES A;  4YII A;  1U9O A;  1NG7 A;  1CGP A;  2UXN A;  1TTY A;  4IJA A;  3GTL J;  3S1R J;  5FLV A;  2NVY J;  3OV8 A;  2OTL I;  4KDP A;  4EM0 B;  5D4R A;  3E6D A;  2R7Z J;  1I39 A;  2LBF A;  3WOD F;  1MNM C;  2DYS H;  4BBR J;  5EF6 A;  3CCM I;  5CLS A;  5FRO A;  2O0Y A;  2DK5 A;  1D8J A;  4BE1 A;  1S8N A;  3K4B A;  2EFQ A;  2G7H A;  4A69 C;  1X2M A;  4U88 A;  1XMA A;  4DBR A;  1I27 A;  3UR3 C;  4E7K A;  2X1C A;  1IV6 A;  3ROU A;  4A3K J;  3FIW A;  3ZP5 A;  2LKP A;  3I71 A;  5L3C A;  5AIP A;  3U1D A;  3PSI A;  1ZGA A;  1U5T A;  3ZMS A;  4IEJ A;  3S2W A;  5KCM A;  1VI0 A;  3H0G J;  3QYE A;  1HKT A;  1XCB A;  3M8E A;  4F7Z A;  2XRO A;  4M6V A;  2HTJ A;  1B1B A;  2Y30 A;  4A5N A;  1RET A;  2E36 A;  3WTX C;  1ERD A;  2DT6 A;  1I3Q J;  2Z99 A;  4F91 B;  5L3B A;  3DQV C;  2EWN A;  4Y13 A;  2GXG A;  2PQ8 A;  3E0J B;  1CQT A;  3RQI A;  5LRS A;  4J01 A;  5HLT A;  2F5D A;  2LRD A;  4RAZ A;  2ECB A;  4M3B A;  4A3J J;  2JA6 J;  1KU3 A;  2HS5 A;  2KZV A;  3HEF A;  5H6Q A;  4XKV A;  5IY5 H;  3W2A A;  1R23 A;  3HSE A;  1A5J A;  1LNW A;  3OYE A;  2E2I J;  1LFP A;  2GBY A;  3PO3 J;  2H94 A;  1BI0 A;  1OPC A;  4DW6 A;  3CCJ I;  4M3D A;  1BC7 C;  3PNV A;  3IL2 A;  2XC7 A;  2XKO A;  1V54 H;  2IW5 A;  2Y9Z A;  5A2Q K;  1LQ1 A;  2GIV A;  3JRC A;  2L4M A;  2HZT A;  2H8R A;  1QA6 A;  3PJR A;  4AYB A;  3L09 A;  1S6L A;  4PK4 A;  1R36 A;  5HDG A;  3RKX A;  1W4M A;  2CQ7 A;  2P8T A;  1QU3 A;  3JAM Z;  4CCK A;  3L7W A;  4K2E A;  4ZJZ A;  5BS6 A;  2ZSI B;  5E18 F;  4RMN A;  5D6E A;  1YS7 A;  3CD6 I;  3ABT A;  2EK5 A;  2E35 A;  2ME6 A;  4CH7 A;  1F9N A;  3PQK A;  4D5F A;  4CDG A;  1OCZ H;  2Y0S N;  2M2E A;  2VJ5 A;  2L4A A;  1YG2 A;  2DDA A;  2L2O A;  5IOZ A;  3I59 A;  1IRX A;  3AKZ A;  4XKB A;  1D1B A;  4B3X A;  1I1G A;  4PGH A;  2JA5 J;  3BPV A;  4EJO A;  4EJT A;  2CV0 A;  4DOZ A;  3VYT B;  4OAY A;  3OL4 A;  2LKS A;  4HZF A;  1Z77 A;  4ABZ A;  2WAD A;  2OTJ I;  5TRD A;  4IHX A;  1JT0 A;  4J00 A;  2ZXJ A;  5ERI A;  1MZB A;  2Y9Y A;  1W5S A;  4MIM A;  1IXC A;  5DD8 A;  2P4W A;  3SDB A;  1Z05 A;  3SEZ A;  2W24 A;  3DEW A;  2LKX A;  5EEG A;  4WF2 A;  5LHH A;  4ZTJ A;  1J75 A;  1IN6 A;  3SEQ A;  1MMG A;  4RB1 A;  3U2R A;  2R0Q C;  1O3R A;  1QPM A;  2UUZ A;  2DMN A;  4Y52 J;  2VAS A;  3QYB A;  4HV5 A;  4X6A J;  2PX9 A;  3FMS A;  3CDI A;  3R60 A;  1BR4 A;  1QHH D;  4ANJ A;  3TL4 X;  4BU2 A;  2XUB A;  4Q4Z F;  4BAY A;  1RZ4 A;  4AIH A;  3FX3 A;  1R7J A;  4W1U A;  3SQN A;  3PUB A;  3RDI A;  3JTH A;  3OIQ A;  3BRO A;  4MFD A;  3OIP A;  3I0T A;  3HHG A;  3NAR A;  1EV7 A;  3GFL A;  3JSO A;  2EJR A;  3CUQ A;  1DGW Y;  3S3M A;  1J7K A;  4Y15 A;  3CCL I;  4CYC B;  5HVQ C;  2B0L A;  1YRN B;  2V9V A;  2XAJ A;  1NH3 A;  3BOQ A;  4ZYD A;  2OQR A;  4XOP A;  4GO1 A;  1UAA A;  4FET A;  5J3L A;  3F8F A;  3K70 D;  2VB6 A;  3BTI A;  1B9M A;  3VDX A;  1T33 A;  2V7F A;  1W5C C;  2EIJ H;  2KDO A;  4BNC A;  1SVM A;  2XF7 A;  2ZKZ A;  1QBJ A;  3E5U A;  3HPH A;  2E1M C;  1G3Y A;  3BR2 A;  2JVH A;  2NVQ J;  3E1S A;  3HOY J;  2RN7 A;  3O8G A;  5B1A H;  3K70 C;  4LB5 A;  1IN4 A;  3FXQ A;  4RBO A;  1J09 A;  1JJ6 C;  1YI2 I;  1UFM A;  3HHH A;  3CLQ A;  4A3G J;  4KUM A;  1O3S A;  4KT6 A;  3LNQ A;  1OR7 A;  4AC0 A;  5IT9 K;  2HQA A;  2ID6 A;  2MLG A;  2ZME C;  4EJW A;  5EYR A;  1FOY A;  1O57 A;  3WGH A;  1X4O A;  4PDK A;  2M8G X;  2P6S A;  1SAN A;  4YIR X;  1DU0 A;  2HU9 A;  3OS0 A;  2EA2 A;  4MQV A;  2A5W A;  3KP2 A;  4Y3O A;  3HYI A;  1JXS A;  4M3G A;  4C30 A;  2HFH A;  3HRT A;  1IRG A;  3ZQ7 A;  3TED A;  4XLH A;  3ZQL A;  1MD0 A;  4IHS A;  3C1D A;  3MN2 A;  4M9X A;  3EUH C;  4GYG A;  2H8W A;  1VQ9 I;  2GOM A;  1MBJ A;  3PL8 A;  4O5V A;  5KVR A;  1G2H A;  2HOT A;  1UST A;  5AON A;  2XAU A;  5E3L A;  3QU6 A;  2JQ7 A;  4G94 A;  2K3P A;  5JI6 A;  3F8B A;  1NTC A;  2HGC A;  4ZDL A;  1FY7 A;  1VQP I;  2HPI A;  1TWF J;  3FZV A;  3K4K A;  4MQ9 F;  3CCE I;  1KA8 A;  4WXD A;  2K40 A;  1SFE A;  1QPI A;  1VF9 A;  2F4M B;  1U8R A;  3I54 A;  5B1B H;  3P9K A;  2XSD C;  3RZD J;  2DMQ A;  1IAW A;  3F0C A;  3RJP A;  4RDU A;  1JKQ C;  4LK1 F;  2ADU A;  1TWC J;  3DEU A;  2BBY A;  4CGZ A;  2IRF G;  4EAT A;  2QVO A;  2K9S A;  5F64 A;  2DT7 B;  1PUF A;  4QTR A;  4L9V A;  2FRH A;  1QNT A;  1HOM A;  1Y8R B;  2EH3 A;  5DUI A;  4ITV A;  3U21 A;  4QLC U;  2WY7 Q;  1MKM A;  1TW2 A;  2IXS A;  2LMD A;  3KPH A;  5HLI A;  2HDC A;  1RPW A;  1VQO I;  4LGW A;  1KU7 A;  2MYS A;  2PLY A;  3CF2 A;  2OC6 A;  1GXQ A;  1U6G A;  2M4G A;  3HXL A;  3ML6 A;  4RAF A;  3K69 A;  4CCL A;  4M3E A;  3ERM A;  5L3G A;  2X48 A;  3GYH X;  3A4C A;  1MDM B;  2ZJ2 A;  4FQG A;  1Z21 A;  2A07 F;  3A0B C;  2L7Z A;  5KHD A;  4XMY A;  3HOW J;  3H35 A;  2HQ5 A;  5M3F J;  3ZMT A;  1WZ2 A;  1AWC A;  3GZ5 A;  2KIS A;  4Y33 A;  2NYX A;  4YEL A;  4R8H A;  2QF7 A;  1HW1 A;  3IWZ A;  2XPW A;  3OYB A;  4DIQ A;  5EG0 B;  2E7W A;  2LH9 A;  2COB A;  1EKE A;  1OCT C;  2DLL A;  2Y31 A;  1ON2 A;  5H6R A;  1T8I A;  3N97 A;  3M7G A;  4RGR A;  2OD5 A;  4BXF A;  3DTK A;  2KIF A;  3MQ0 A;  5LHG A;  2GLO A;  3OIO A;  1Z67 A;  2NVU B;  4HNU A;  1MND A;  3LSR A;  5KK1 A;  5F0H A;  3SJM A;  5LFA A;  2R7S A;  2F5C A;  4C9Y A;  2AS5 F;  2VUM J;  2BY2 A;  1DPU A;  2BZT A;  2X0L A;  4XM3 A;  3IH3 A;  3GTQ J;  4IO9 F;  2VJJ A;  3BG6 A;  4M6X A;  4L9T A;  2R5Y B;  3BY6 A;  4AIK A;  3ZR8 X;  3F72 A;  1T0F A;  3ECO A;  1B72 B;  2XGC A;  1DDN A;  4U7B A;  1YIJ I;  4A3C J;  1WRJ A;  4N9I A;  5C44 J;  2VXZ A;  1XTA A;  3I64 A;  2NS7 A;  3S93 A;  1MBH A;  3BR6 A;  4HA8 A;  3TDU C;  3ESW B;  2IS4 A;  2JA7 J;  4IX7 A;  2H09 A;  1LVK A;  1SMY F;  1KZH A;  2E1M B;  4B3A A;  3GTP J;  4L5I A;  2GIZ A;  1H89 C;  3V8K A;  3OOU A;  3QPT A;  3Q0W A;  1BC8 C;  5K5O A;  4A3L J;  3SFZ A;  2O3F A;  1ITY A;  2CUF A;  2CQQ A;  2HVQ A;  3H92 A;  3ABK H;  1Z7L A;  1SD6 A;  1GDT A;  2QA4 I;  2YPR A;  5D5W B;  1LE8 B;  2D5V A;  2CG4 A;  3CJN A;  2DA2 A;  1GV5 A;  2ZME B;  4HW0 A;  3F3X A;  2CQN A;  3HTU A;  4RB2 C;  2J5O A;  3TW7 A;  1I3A A;  1H8A C;  2YX4 A;  1SD7 A;  2MD5 A;  4KIS A;  1JUP A;  2R3S A;  1FX7 A;  4LD5 A;  3JRI A;  5GPA A;  1LDJ A;  4CZC A;  5GPC A;  3QWL A;  2IS2 A;  1A6Q A;  4FE4 A;  3GTJ J;  4EJU A;  1R9T J;  4I0B A;  2DA4 A;  3DP7 A;  3PUF A;  4YFK F;  4NQW B;  1UCR A;  5D8L B;  4LLG F;  2FNP A;  2K9M A;  2OV7 A;  4WXC A;  1TQM A;  4BEH A;  4U0Y A;  4FCY A;  3JRD A;  1U8B A;  1U3E M;  4UV9 A;  3CP8 A;  3EYI A;  3OYC A;  4IF4 A;  4OAZ A;  2LVS A;  3WTV C;  1K79 A;  2M7B A;  2HQR A;  3RPU A;  1O3Q A;  2HNH A;  3DPT A;  2QQB A;  4E70 A;  1MGT A;  3CTA A;  4XQF A;  2CUJ A;  2W84 A;  2CW7 A;  4F55 A;  1R49 A;  1U5T C;  4R1H A;  2M0M A;  1BI2 A;  5HS8 A;  2XGE A;  2NXN B;  2M0C A;  4BGD A;  1SFU A;  5KAF C;  2A05 A;  1JE8 A;  3SHF A;  4JQF A;  2HKX A;  2YUS A;  4HDV A;  4ZC3 A;  1KQ9 A;  2V1D A;  4PGG A;  4LG0 B;  1LEA A;  4M6Y A;  4OMZ A;  4PJJ A;  1R5G A;  4QPQ A;  1TL8 A;  2BW3 B;  2HOS A;  3DPL C;  3HBL A;  1P4W A;  4E4H A;  3TO7 A;  3FWE A;  1K6O A;  1MMN A;  1AU7 A;  1K83 J;  4P9U A;  2G9W A;  4L0Y B;  3DEE A;  5CVR A;  2FMY A;  3FBI B;  2HXI A;  3ZGK A;  1IW7 F;  3A2K A;  4KIG A;  1UG0 A;  1ZEL A;  3CZ6 A;  1ZN2 A;  1NG6 A;  3K9T A;  1ETK A;  2K02 A;  2JSP A;  2DPU A;  4NHJ A;  1WJC A;  4I99 C;  1MSE C;  1LFB A;  1Y0U A;  4AU7 A;  3NWS A;  1OCC H;  2BV6 A;  3AFH A;  3L9F A;  2R7D A;  4GRI A;  1RUO A;  1MJA A;  3FM3 A;  3ELK A;  3KP6 A;  5M5Y J;  5DYM A;  4IHY A;  1X3Z B;  3ZOB A;  2ZSH B;  2LP0 A;  3LOC A;  1J59 A;  1N25 A;  5E3M A;  1CF7 A;  2VBY A;  4HX7 A;  1SFO J;  2VOO A;  1SD5 A;  2R7X A;  3VB2 A;  4II2 A;  3DTI A;  2K4B A;  3HOV J;  1QZY A;  2NS8 A;  2OUM A;  2YU9 J;  1E3P A;  5F04 A;  3RZO J;  1D0X A;  4OIR F;  2VOP A;  1MBF A;  1YE9 A;  3HKZ A;  3DBL B;  4QIW N;  3PIP F;  2JZY A;  1PJR A;  2RC4 A;  1HQC A;  1O7L A;  1XMK A;  4BH9 A;  1APL C;  2EBI A;  3SFI A;  2TRT A;  2QLZ A;  4RGU A;  1X1D A;  5IPA A;  4Y7N J;  3K7A J;  2DMP A;  2K4J A;  2KJB A;  2XAQ A;  5FD5 A;  2XKP A;  1TZL A;  3OS2 A;  2A6T A;  4G6D A;  5FKM A;  5EDN A;  3ABL H;  4IKF A;  3F8N A;  3HUG B;  2EZI A;  2VT3 A;  2PFB A;  2E34 A;  1X1C A;  3FXM A;  4GFB A;  4ON0 A;  2K9N A;  2FA5 A;  5LGU A;  2V26 A;  4IOC F;  5DCM B;  4QWQ A;  2WTE A;  2XAH A;  2OCE A;  3IWF A;  3CC2 I;  2X4H A;  3FDY A;  4CCM A;  3L2Q A;  2P6T A;  4BL0 B;  1MMA A;  4KIT B;  3KEO A;  4LG3 A;  2Z1D A;  4L5J A;  1EH7 A;  4KMU X;  3JTG A;  2GXB A;  1W0T A;  3EYY A;  3FMQ A;  4BKX A;  2ZJQ F;  1XB4 A;  2AO9 A;  2FX0 A;  3S15 J;  2QQ9 A;  1JUS A;  1MJ9 A;  3M07 A;  4BYY A;  1YJ9 I;  2WBM A;  3V8J A;  5D6F A;  2NNY A;  2VJ4 A;  3H9J A;  3I56 I;  3ECH A;  2V6C A;  2DFH A;  2Z3Y A;  2R5Z B;  1Y56 A;  1BIA A;  4UUS B;  3OL3 A;  2XGX A;  3KZI C;  1K6Y A;  2FBI A;  3LA3 A;  2CS3 A;  1MH4 A;  2M34 A;  2JRM A;  4ENJ A;  1YW8 A;  3HGY A;  4G12 A;  1U0J A;  2W7N A;  1F36 A;  4A3E J;  2VJI A;  3CUQ C;  2CGP A;  5LHI A;  4BHC A;  1SVO A;  4OIN F;  5F1J A;  3KYL A;  1IN7 A;  2EPF A;  1XMX A;  2ECC A;  3F8C A;  4UVA A;  2BYV E;  3AG2 H;  2PMZ N;  4UY8 I;  4V2F A;  4F52 A;  3M3Y J;  4DJA A;  2L9S A;  2E5Z A;  2LBF B;  4A5M A;  5BQT A;  2LD5 A;  1FP1 D;  1USS A;  4H0E A;  3OR1 C;  1FC3 A;  1X1P A;  2IA0 A;  3DBR B;  2WAQ A;  3ZRG A;  1T56 A;  2XAG A;  3MMY B;  5DEQ A;  3A03 A;  1EH8 A;  1VQM I;  3KFW X;  4XNF A;  4OIP F;  2JRT A;  5D5X B;  2ZO4 A;  5KNL A;  3K1N A;  4EMS A;  2NVT J;  3QYF A;  4UVC A;  2R7Q A;  2F2E A;  3BT9 A;  2ZFU A;  1F1Z A;  1U5T B;  4HLY A;  4BE0 A;  1MBG A;  4Y17 A;  2W00 A;  1OKR A;  4MGR A;  1OR7 C;  2Z9O A;  1GT0 C;  3KEQ A;  5M5X J;  3PO2 J;  2DJN A;  2HVS A;  3CJR B;  3E6B A;  4E7I A;  2EFO A;  1J5Y A;  2DA5 A;  3VSL A;  1ZGW A;  2EV6 A;  4HQM A;  5FFZ A;  3KP7 A;  2WV1 A;  2HDD A;  1FOK A;  1HSJ A;  2X6Y A;  4BS9 A;  1J2X A;  2VKV A;  3L2V A;  2VOD A;  2BEO A;  2M9H A;  4WWC A;  4R79 A;  5FLM J;  2QUF A;  2W25 A;  2VPL A;  5J4Y A;  3H5R A;  2JJ7 A;  4YIF A;  2FBK A;  2Y48 A;  3R61 A;  1ONV A;  4V2G A;  5A2Q Z;  3GLL A;  2HDW A;  2X6X A;  3E5X A;  2VT2 A;  5DD4 A;  5FKO A;  1TT0 A;  2CUE A;  3RPQ A;  1Z9C A;  3K1M A;  2DOE A;  3KLN A;  1VQK I;  2IAI A;  2JWT A;  3HSF A;  4PJM A;  4ZYH A;  3LA2 A;  5J6X A;  3OYN A; 
#chains in the Genus database with same CATH homology
 1B9N A;  3GW2 A;  3WG9 A;  1J9I A;  4LJZ F;  2D2W A;  1W7P A;  2AXL A;  3W6K B;  2JPC A;  4EM2 A;  2VE8 A;  4HX4 A;  2PEX A;  1B59 A;  2P7C B;  1FYL A;  3J7A O;  3CO6 C;  1T6S A;  2PG4 A;  5D8K B;  4HX8 A;  2O03 A;  1SFX A;  3I59 B;  1KQ0 A;  2DO7 A;  4LLL A;  1O3T A;  5HLH A;  2XVC A;  3KE2 A;  3V7R A;  1NHA A;  1BN5 A;  2G7U A;  4BHP A;  4ETS A;  2ZFW A;  5TJJ A;  2L3D A;  4A6E A;  2Z5U A;  1PP8 F;  2FBH A;  4I7H A;  4UXN A;  3HRS A;  4AWX B;  3I5U A;  2MA3 A;  3EET A;  3ISP A;  2IVM A;  3F8M A;  3GFM A;  1SD4 A;  3KZZ A;  3U9G A;  1ON1 A;  4CIC A;  4YFN F;  2XAS A;  4YFX F;  1Z91 A;  2JSC A;  1I5Z A;  3CUQ B;  1XCV A;  4I09 A;  1BJA A;  4M9S A;  1Q1H A;  2BE5 F;  5CJ9 A;  1QO0 D;  4HF1 A;  4L9J A;  3RTR A;  4P96 A;  4XSX F;  3F6O A;  3HRU A;  1YTY A;  2ZBK A;  1ZG5 A;  4Q5S F;  5IT9 Z;  1S7O A;  1LDD A;  3PQJ A;  3VOE A;  5HLG A;  2WC2 A;  3RKY A;  1G3T A;  3O3K A;  4L18 B;  4O6J A;  2L02 A;  4XLN F;  1R00 A;  1JHH A;  5F1R A;  3LFK A;  2EV5 A;  1H9T A;  2C6Y A;  2ZCW A;  5ILV A;  2XHK A;  2RVC A;  3EDP A;  3I53 A;  5L3E A;  3ULQ B;  2NS0 A;  3KCC A;  3HOT A;  2CW0 F;  1R1V A;  3FHZ A;  4OIQ F;  3GWZ A;  4I98 B;  3HSR A;  1V3F A;  1GVJ A;  3TOA A;  1WI9 A;  3ZN1 A;  3BZ6 A;  4M71 A;  3E6C C;  4GXO A;  4IVN A;  1U78 A;  1XSD A;  3TKY A;  2FXA A;  2WWY A;  1JGS A;  3BJO A;  3H3Z A;  2DQR A;  3QPH A;  5J8F A;  2DI3 A;  1RI7 A;  3C18 A;  2QWW A;  5L3F A;  2MLK A;  4KNY A;  3P7N A;  3TGN A;  1FBU A;  2QM3 A;  4IRG A;  2M5W A;  4L9N A;  2V1U A;  1IXR C;  5JFR A;  1XGO A;  2GA2 A;  3RIR A;  3WGI A;  5FFX A;  5ICC A;  2PJP A;  2QYO A;  1FYK A;  2IA2 A;  2XV4 S;  3T1B A;  1IF1 A;  4L0Z B;  2FSW A;  2YX7 A;  1ZAO A;  3ZN0 A;  4AD9 A;  1Z6R A;  2QZ8 A;  5FD6 A;  2IP2 A;  4G7Z F;  5ICF A;  1YS6 A;  4M74 A;  5HDK A;  1JHF A;  1K78 A;  2OZ6 A;  5LEK A;  4HQE A;  1LVA A;  4EJV A;  3CO7 C;  2L54 A;  2GA1 A;  1XDS A;  2ISY A;  4OU0 A;  2P5K A;  1TNS A;  3WE3 A;  5J8C A;  3K0L A;  4CO8 A;  4ENN A;  2P7V B;  1YQA A;  2E1N A;  1C0W A;  2H27 A;  2CWE A;  2V79 A;  4D0P A;  4IXA A;  2EFW A;  2P5V A;  2FEZ A;  3O2P E;  5F6F A;  4A0Z A;  4ESF A;  3V8L A;  2FU4 A;  2EV0 A;  4M9Z A;  1ZRC A;  3TO6 A;  3KZY A;  5E8G A;  3F23 A;  3TDZ C;  2CSO A;  1S29 A;  3P9C A;  2ESH A;  4G6Q A;  1X3U A;  1XGS A;  1H9G A;  2H6B A;  1XSX A;  2RKH A;  4GCV A;  3Q5F A;  1RUN A;  1BIB A;  1XGN A;  2OQG A;  3CUO A;  2A69 F;  1B4A A;  5BPI A;  3GVA A;  3ZPL A;  3QAH A;  3MZH A;  5JR3 A;  2HQN A;  4UV8 A;  2E1C A;  1OYW A;  1TQP A;  1BI1 A;  1P4A A;  2DAO A;  4CZZ A;  4BXU A;  1F4K A;  2PMU A;  2M87 A;  3GXO A;  4P5O A;  1WQ2 A;  1LDK B;  3E97 A;  3CLO A;  1ZRE A;  3GZ6 A;  2QEN A;  4YG2 F;  1BI3 A;  2UZK A;  5E1Z B;  1OYY A;  2PN6 A;  5ILS A;  4RS8 A;  1QQI A;  3R4K A;  1W7P D;  4G7O F;  3OOP A;  4XRF A;  3J81 K;  1CF7 B;  2ELH A;  3WTT C;  3T8R A;  5CYV A;  3TO9 A;  4LK0 F;  2Y0M A;  5ILU A;  3Q9V A;  1WSU A;  1AOY A;  2A6E F;  2KIU A;  1D3Y A;  3F6V A;  2A68 F;  5CVI A;  3WTS C;  5CVV A;  3BJ6 A;  5LBQ A;  3IKV A;  4MTD A;  2MBF A;  1TBX A;  4M72 A;  1G3S A;  3IC7 A;  2IJL A;  2QBY A;  4U7D A;  2NRA C;  5E17 F;  4ZYG A;  1J0R A;  3D0S A;  3FXR A;  4AIJ A;  3HRM A;  2ZNY A;  3VFZ A;  3BDD A;  2ESN A;  2DW4 A;  2CFX A;  3VOD A;  2NNN A;  2EA4 A;  1HKQ A;  3T0Y A;  3CDH A;  4WK8 F;  2VBX A;  4DNC A;  2KKO A;  4BQA A;  3KP3 A;  4WXH A;  3R0J A;  2ACJ A;  4HYE A;  1UHM A;  3B02 A;  5FO5 A;  3WU1 B;  5FLX K;  4ENM A;  2W57 A;  2FQ3 A;  1DUX C;  3QOP A;  3BJA A;  4OMY A;  1P4X A;  1DPR A;  4KIF A;  3NQO A;  4U0W A;  4HBL A;  3R0A A;  3GX4 X;  1IUY A;  3ZMU A;  3KLO A;  1QGP A;  3R6S A;  1P6R A;  1ZAR A;  4A0Y A;  3DFG A;  1ZGJ A;  4I2O A;  3K2Z A;  3SZP A;  4KA4 A;  1G3W A;  1BOA A;  1FNN A;  3FMR A;  3E6M A;  1YYV A;  3T8T A;  3MFK A;  5LGT A;  2BGC A;  2CO5 A;  3LWF A;  3SZT A;  5BPD A;  4ZYE A;  5LGN A;  3O6B B;  1Z7U A;  3M9A A;  4P55 A;  2Y75 A;  3LA7 A;  4XSZ F;  2VBW A;  3C3W A;  2PBI A;  2R7F A;  4ZH4 F;  4KT5 C;  4BHB A;  3HTS B;  3LST A;  3K1P A;  3REO A;  1W7P B;  3GFJ A;  2DBB A;  3F21 A;  4MTE A;  1QZZ A;  1TLH B;  5CVU A;  1ZRF A;  2KRF A;  2Q8K A;  2VC1 A;  4PCQ A;  3IRR A;  6PAX A;  4KYW A;  4LFU A;  1WKM A;  4EVI A;  4EGY A;  3HOS A;  1IN8 A;  3BPX A;  1R1U A;  2FNA A;  4DQ2 A;  4A2U A;  3W6J B;  3M8F A;  2NAZ A;  5LEJ A;  2J5P A;  1R22 A;  4S05 A;  2HEO A;  2EB7 A;  3BP8 A;  2JPB A;  2YSR A;  2OA4 A;  4N9H A;  2Q2E A;  1PP7 U;  5EEH A;  1YO5 C;  2XRN A;  1I6X A;  5DCF A;  2JTV A;  3FF5 A;  4GYI A;  4KIB A;  1HW2 A;  3BWG A;  1T98 A;  2FML A;  5E1X A;  4B09 A;  4AVP A;  4N0B A;  1Z6T A;  2A61 A;  3D5L A;  3ERE D;  3WTY C;  1BM9 A;  5DDG A;  5FGM A;  5LRR A;  1T38 A;  2LSO A;  2RV8 A;  3RYR A;  3J80 Z;  4I02 A;  3KP5 A;  3ZMZ A;  4Q48 A;  2FF4 A;  1YIO A;  1D5V A;  1STZ A;  4A6D A;  1YLF A;  5D5V B;  2HOE A;  4P9F A;  2LDU A;  2H6C A;  2DTR A;  2EFP A;  2OBP A;  4IPA A;  2K27 A;  4XLP F;  2K7L A;  4EGZ A;  5JVT A;  5L3D A;  4HV6 A;  4KN4 X;  1YW9 A;  2P5L C;  1G4D A;  5K5Q A;  3G3Z A;  1LEB A;  2CQK A;  3KET A;  3L00 A;  1RIO H;  4UVB A;  1RNL A;  3E5Q A;  2L01 A;  3MAJ A;  3J80 K;  1I1S A;  4ASN A;  1OYI A;  1S3J A;  1XSV A;  2IA1 A;  1XN7 A;  4MEX F;  1G6N A;  3JAM K;  1O7F A;  1KU9 A;  3ZMV A;  1VTN C;  2LF8 A;  3ZMD A;  4XBF A;  1R1T A;  4B8X A;  4OOI A;  2QQA A;  2PMH A;  2RNJ A;  3RKW A;  1KU2 A;  4G8X A;  1HXD A;  1T2K A;  1L0O C;  1FZP B;  4PZJ A;  4FT8 A;  4U0V A;  2F5E A;  2RGV A;  1HBX G;  3FM5 A;  3QP5 A;  3G73 A;  2RQP A;  4EQQ A;  3L2C A;  3KP4 A;  1FYM A;  1KYW A;  3WTW C;  1B6A A;  3IKT A;  3TQN A;  1OMI A;  5ED4 A;  1KGS A;  2DPD A;  2COM A;  4OIO F;  2LNB A;  4NB5 A;  3ABU A;  1H0M A;  1K78 B;  1ZHF A;  4UNO A;  1D8K A;  2VN2 A;  4A12 A;  2DFI A;  4RGS A;  5E1W A;  4JK1 X;  3I58 A;  1ODD A;  5DV5 A;  3V7C A;  1P92 A;  1FWZ A;  3NRV A;  1S7A A;  2OAZ A;  1YFH A;  1ZG1 A;  1FSE A;  4LMY A;  2CYY A;  3HIF A;  4RGX A;  3JSP A;  4Z2Y A;  2A6H F;  4TV7 A;  2F5F A;  4CHU A;  5IT3 A;  3QU3 A;  1FSH A;  4LLN A;  2D1V A;  2RDP A;  2IPQ X;  2Q0O A;  3NEU A;  3I4P A;  3T5X A;  3WTU C;  1T39 A;  3MCZ A;  1ZYR F;  1FT9 A;  2A3S A;  1E2X A;  2XAF A;  2XIG A;  2KIM A;  4CYD A;  4HAM A;  2IT0 A;  3C7J A;  2FE3 A;  1ZRD A;  2V1X A;  2YR2 A;  1LJ9 A;  2LF7 A;  2EFN A;  1W5T A;  3DV8 A;  2D1H A;  2HKO A;  5CVJ A;  3LQR A;  3E3V A;  1R58 A;  4MHG A;  2FOK A;  4EV0 A;  3DXJ F;  3RYP A;  3V7S A;  1WWX A;  2WV0 A;  2UXX A;  1V4R A;  5HS7 A;  3H3U A;  4HF0 A;  1MDM A;  3J81 Z;  2K86 A;  3SXY A;  4UUV A;  1TNT A;  2DQL A;  2O6G E;  2JT1 A;  4S04 A;  3TOB A;  3N4M A;  1IRF A;  3GLX A;  2D45 A;  2M30 A;  5ICE A;  4WX9 A;  3QP6 A;  2GQQ A;  3WU0 A;  1MJB A;  4KFC A;  1F5T A;  4KMF A;  3Q9S A;  4MNU A;  1XDU A;  3JW4 A;  4I0A A;  1ZH5 A;  3M1E A;  5HDN A;  3MEX A;  4MEY F;  1XGM A;  2OU2 A;  2MH2 A;  1FBS A;  5E20 A;  1KYZ A;  4ZZL A;  2VE9 A;  2VBZ A;  4HDU A;  1SMT A;  4HOB A;  2ISZ A;  1SAX A;  3VEP A;  2HTS A;  5K1Y A;  4KN7 X;  2QBY B;  1PDN C;  3P9I A;  1TW3 A;  5D5U B;  1A04 A;  2VON A;  2O8X A;  2OZU A;  5BOX A;  3V4G A;  2STT A;  4FHT A;  4CXF A;  3GFI A;  4ZZD A;  2ZME A;  2M8E A;  3LAP A;  3LAJ A;  4RB0 A;  5AIQ A;  4IRI A;  2KJC A;  5FLX Z;  1IZ1 A;  1HST A;  4RB3 C;  3MWM A;  3AAF A;  1R5H A;  3EUH A;  5ICG A;  4NQW A;  1YW7 A;  4FX0 A;  5LLQ A;  4M73 A;  1LB2 A;  4G9Y A;  4HF2 A;  2PI0 A;  3DF8 A;  3PFI A;  3QRF F;  3B73 A;  3IHU A;  2MC3 A;  4UHT A;  4O3M A;  4KIC A;  4LG0 A;  2E7X A;  2UWM A;  2DK8 A;  1XD7 A;  3WTZ A;  4IHT A;  5K5R A;  2ETH A;  1FP2 A;  1ZG3 A;  1DP7 P;  3LQQ A;  2STW A;  5E8I A;  3GUD A;  1L3L A;  1REP C;  1IXS B;  2O61 A;  1P2F A;  1Z1D A;  1IN5 A;  3COA C;  5FB2 A;  2VC0 A;  1FPQ A;  4IRH A;  2W85 A;  3MZY A;  2HR3 A;  2DU9 A;  4ESJ A;  2HWV A;  3IRQ A;  1ULY A;  1ZLJ A;  3FXU A;  1GXP A;  1K7A A;  1U2W A;  4ENK A;  2HYG D;  1KQ8 A;  3GF2 A;  1GHC A;  1HKS A;  1E17 A;  5HS9 A;  2YU3 A;  4EM1 A;  3HUG A;  2GAU A;  5BMZ A;  3GO5 A;  1ZLK A;  2ZNZ A;  4HLX A;  2M45 A;  2A5Y B;  5DCM A;  2Z33 A;  3RI4 A;  5DUK A;  5D4S A;  4ESB A;  4I01 A;  1FLI A;  3DKW A;  2MH9 A;  3GEZ A;  2M1B A;  5JHU A;  4A0X A;  4GGG A;  1TQI A;  4LB6 B;  4JBA A;  1HW5 A;  2DT5 A;  3EQL F;  2HYF A;  3F22 A;  1PUE E;  1EH6 A;  1FBQ A;  3WGG A;  5HOO A;  4RAY A;  4FX4 A;  2GZW A;  1UB9 A;  4G7H F;  5H20 A;  4WCG A;  4Q47 A;  2GWR A;  1BBY A;  3WE2 A;  1UHW A;  2TDX A;  4YII A;  1CGP A;  2UXN A;  1TTY A;  4IJA A;  3OV8 A;  4KDP A;  4EM0 B;  5D4R A;  3E6D A;  3WOD F;  5CLS A;  2O0Y A;  2DK5 A;  1D8J A;  1S8N A;  2EFQ A;  2G7H A;  4U88 A;  1XMA A;  1I27 A;  3ROU A;  3ZP5 A;  2LKP A;  3I71 A;  5L3C A;  5AIP A;  3U1D A;  1ZGA A;  1U5T A;  3ZMS A;  3S2W A;  1HKT A;  1XCB A;  3M8E A;  4F7Z A;  2XRO A;  2HTJ A;  1B1B A;  4A5N A;  3WTX C;  2Z99 A;  5L3B A;  3DQV C;  2EWN A;  4Y13 A;  2GXG A;  2PQ8 A;  5LRS A;  2F5D A;  4RAZ A;  1KU3 A;  2HS5 A;  5H6Q A;  1R23 A;  3HSE A;  1LNW A;  2H94 A;  1BI0 A;  1OPC A;  1BC7 C;  3IL2 A;  2XKO A;  2IW5 A;  5A2Q K;  1LQ1 A;  2GIV A;  2L4M A;  2HZT A;  3L09 A;  1S6L A;  5HDG A;  1R36 A;  3RKX A;  1W4M A;  2P8T A;  3JAM Z;  3L7W A;  4K2E A;  5BS6 A;  5E18 F;  5D6E A;  1YS7 A;  3ABT A;  2EK5 A;  1F9N A;  3PQK A;  4CDG A;  1YG2 A;  2L4A A;  3I59 A;  1I1G A;  4PGH A;  3BPV A;  4EJO A;  4EJT A;  4HZF A;  5TRD A;  2ZXJ A;  5ERI A;  1MZB A;  1W5S A;  1IXC A;  5DD8 A;  2P4W A;  1Z05 A;  2W24 A;  5EEG A;  4WF2 A;  5LHH A;  1J75 A;  1IN6 A;  4RB1 A;  3U2R A;  1O3R A;  1QPM A;  4HV5 A;  3FMS A;  3R60 A;  2XUB A;  4Q4Z F;  4BAY A;  1RZ4 A;  4AIH A;  3FX3 A;  1R7J A;  3SQN A;  3RDI A;  3JTH A;  3BRO A;  3I0T A;  3HHG A;  1EV7 A;  3GFL A;  3JSO A;  2EJR A;  3CUQ A;  1J7K A;  4Y15 A;  5HVQ C;  2B0L A;  2V9V A;  2XAJ A;  3BOQ A;  4ZYD A;  2OQR A;  4GO1 A;  3F8F A;  1B9M A;  4BNC A;  2ZKZ A;  1QBJ A;  3E5U A;  1G3Y A;  2RN7 A;  4LB5 A;  1IN4 A;  3FXQ A;  1UFM A;  3HHH A;  4KUM A;  1O3S A;  1OR7 A;  5IT9 K;  2MLG A;  4EJW A;  1O57 A;  3WGH A;  4PDK A;  2P6S A;  2EA2 A;  4MQV A;  3KP2 A;  3HYI A;  1JXS A;  2HFH A;  3HRT A;  1IRG A;  3ZQ7 A;  4IHS A;  1MD0 A;  3C1D A;  4M9X A;  4GYG A;  4O5V A;  5KVR A;  1UST A;  5AON A;  3QU6 A;  4G94 A;  5JI6 A;  3F8B A;  2HGC A;  1FY7 A;  3FZV A;  4MQ9 F;  1KA8 A;  4WXD A;  1SFE A;  1U8R A;  3I54 A;  3P9K A;  1IAW A;  3RJP A;  4LK1 F;  2ADU A;  3DEU A;  2BBY A;  4CGZ A;  2IRF G;  2QVO A;  5F64 A;  4L9V A;  2FRH A;  1QNT A;  5DUI A;  4QLC U;  1MKM A;  1TW2 A;  5HLI A;  2HDC A;  4LGW A;  1KU7 A;  2PLY A;  1GXQ A;  1U6G A;  3ML6 A;  3K69 A;  5L3G A;  3GYH X;  1MDM B;  2ZJ2 A;  2A07 F;  3ZMT A;  1AWC A;  3GZ5 A;  2NYX A;  4R8H A;  1HW1 A;  3IWZ A;  2E7W A;  2DLL A;  5H6R A;  1ON2 A;  3N97 A;  3M7G A;  4RGR A;  2OD5 A;  2KIF A;  3MQ0 A;  5LHG A;  5KK1 A;  2F5C A;  2AS5 F;  1DPU A;  2X0L A;  4M6X A;  4L9T A;  3BY6 A;  4AIK A;  3F72 A;  1T0F A;  3ECO A;  1DDN A;  4U7B A;  1WRJ A;  4N9I A;  2VXZ A;  3I64 A;  4HA8 A;  3TDU C;  2H09 A;  1SMY F;  4L5I A;  3V8K A;  3QPT A;  1BC8 C;  5K5O A;  3SFZ A;  2O3F A;  3H92 A;  1SD6 A;  2YPR A;  5D5W B;  2CG4 A;  3CJN A;  2ZME B;  4HW0 A;  3F3X A;  3HTU A;  4RB2 C;  2J5O A;  2YX4 A;  1SD7 A;  2MD5 A;  2R3S A;  1FX7 A;  4LD5 A;  1LDJ A;  4EJU A;  4I0B A;  3DP7 A;  4YFK F;  1UCR A;  5D8L B;  4LLG F;  2FNP A;  4WXC A;  4U0Y A;  1TQM A;  1U3E M;  4UV9 A;  3EYI A;  4IF4 A;  3WTV C;  1K79 A;  2HQR A;  3RPU A;  1O3Q A;  3DPT A;  2QQB A;  4E70 A;  1MGT A;  3CTA A;  2W84 A;  1U5T C;  4R1H A;  1BI2 A;  5HS8 A;  1SFU A;  1JE8 A;  3SHF A;  4JQF A;  2HKX A;  4HDV A;  1KQ9 A;  2V1D A;  4PGG A;  4LG0 B;  1LEA A;  4M6Y A;  4OMZ A;  1R5G A;  3DPL C;  1P4W A;  3TO7 A;  3FWE A;  1K6O A;  4P9U A;  2G9W A;  4L0Y B;  5CVR A;  2FMY A;  1IW7 F;  4KIG A;  1ZN2 A;  3K9T A;  2K02 A;  2DPU A;  4NHJ A;  1Y0U A;  1RUO A;  2BV6 A;  3L9F A;  2R7D A;  1MJA A;  3FM3 A;  3ELK A;  3KP6 A;  5DYM A;  1J59 A;  1CF7 A;  2VBY A;  4HX7 A;  2VOO A;  1SD5 A;  3VB2 A;  2K4B A;  1QZY A;  4OIR F;  2VOP A;  2JZY A;  1HQC A;  1O7L A;  1XMK A;  2RC4 A;  4BH9 A;  2QLZ A;  4RGU A;  2K4J A;  2KJB A;  2XAQ A;  5FD5 A;  2XKP A;  4G6D A;  3F8N A;  2VT3 A;  2PFB A;  4ON0 A;  2FA5 A;  5LGU A;  5DCM B;  4QWQ A;  2WTE A;  2XAH A;  3IWF A;  2X4H A;  2P6T A;  3KEO A;  4L5J A;  1EH7 A;  4KMU X;  3JTG A;  2GXB A;  3EYY A;  3FMQ A;  1XB4 A;  2QQ9 A;  1MJ9 A;  4BYY A;  3V8J A;  5D6F A;  2NNY A;  3ECH A;  2V6C A;  2Z3Y A;  1BIA A;  2XGX A;  2FBI A;  3LA3 A;  4ENJ A;  1YW8 A;  2CGP A;  3CUQ C;  5LHI A;  4BHC A;  4OIN F;  1IN7 A;  3F8C A;  4UVA A;  2BYV E;  4A5M A;  5BQT A;  1FP1 D;  1USS A;  4H0E A;  1FC3 A;  2IA0 A;  2XAG A;  5DEQ A;  1EH8 A;  3KFW X;  4OIP F;  2JRT A;  5D5X B;  2ZO4 A;  3K1N A;  4EMS A;  4UVC A;  2F2E A;  1F1Z A;  1U5T B;  4HLY A;  4Y17 A;  1OKR A;  4MGR A;  2Z9O A;  3KEQ A;  3E6B A;  2EFO A;  1J5Y A;  2EV6 A;  4HQM A;  5FFZ A;  3KP7 A;  1FOK A;  1HSJ A;  1J2X A;  2VOD A;  2BEO A;  4WWC A;  4R79 A;  2QUF A;  2W25 A;  4YIF A;  2FBK A;  2Y48 A;  3R61 A;  1ONV A;  5A2Q Z;  3E5X A;  2VT2 A;  5DD4 A;  3RPQ A;  1Z9C A;  3K1M A;  3KLN A;  3HSF A;  4ZYH A;  3LA2 A;  5J6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...