3S2WA

The crystal structure of a marr transcriptional regulator from methanosarcina mazei go1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
146
Chain Sequence
GISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDERSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a MarR transcriptional regulator from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 48
structure length 146
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3s2wA00
2VE8A 4YFKF 1B9NA 1MJBA 5E1ZB 4CXFA 4Y15A 3E97A 1IF1A 5LRRA 2M1BA 4HV6A 1P4AA 3CJNA 1Z7UA 4MEXF 4AIKA 4BHCA 2MA3A 5KK1A 1S6LA 4NQWA 3B73A 1KQ9A 3KE2A 3JW4A 3OV8A 2RKHA 2F5EA 3VODA 4OMZA 3CTAA 5E8GA 1J0RA 4ETSA 5CVIA 3ZMUA 5EEGA 2OQGA 1O3QA 3ZMDA 3I53A 2DTRA 2Z3YA 1FYKA 2QWWA 4UUVA 3L00A 1XMAA 1CF7B 3KZYA 2DK8A 2PG4A 5HS7A 4NHJA 4OINF 3CO7C 4YFNF 3RKWA 3BOQA 3G73A 1MDMB 5H6QA 3DQVC 3V8JA 2BGCA 3KP2A 2NS0A 2UXNA 2O0YA 1QNTA 1XB4A 2Q2EA 1W4MA 2Q8KA 3IWFA 4I09A 3MAJA 2OZ6A 5DEQA 3GX4X 5L3GA 2K02A 5LGTA 1QPMA 3ERED 4ENJA 5DCMB 1IN7A 3FF5A 3M9AA 1YQAA 3FM5A 2F5DA 4CGZA 3K69A 2XUBA 3KEQA 4L9JA 3F23A 5ICEA 3I4PA 3R61A 2COMA 2ZCWA 4XBFA 5E18F 3SZPA 3RKYA 4YG2F 3GW2A 4ESBA 4Q5SF 5CVRA 2M87A 2EFPA 2ESHA 2NRAC 4PZJA 4U7DA 4P9UA 1ONVA 4PGGA 5JFRA 2A6HF 3M8EA 3TDZC 2CW0F 2QM3A 5J6XA 2XAHA 4HW0A 4L18B 3KP3A 2FBKA 5AIQA 1BC8C 1S29A 2D2WA 2KKOA 3DV8A 2A68F 2JPCA 2A69F 5HS8A 2QENA 3O2PE 2IVMA 1KU2A 1HQCA 2E1CA 4A6EA 5E1WA 4KMUX 3DKWA 3DFGA 3MFKA 3HTUA 2V79A 1IUYA 3RIRA 3H3UA 4BQAA 3F8MA 4UNOA 5D5XB 3E6BA 2R7FA 2FF4A 3K1NA 4BYYA 5D5UB 1SMTA 1BJAA 2M45A 3IC7A 3M8FA 3ULQB 2F5FA 4OIRF 3DF8A 3SFZA 1LEBA 4WCGA 1QO0D 3ZMTA 4EQQA 3HSEA 3GUDA 1FYMA 2FBIA 5DD8A 1G3SA 2M5WA 4OMYA 2EFNA 3R0AA 4NB5A 3H92A 4O6JA 3T8TA 1AOYA 4G6QA 1YS6A 3N97A 4RS8A 3Q5FA 4IRIA 3I59B 2GQQA 2ACJA 1PP7U 1UCRA 1U5TB 4FX0A 4MQ9F 2GXBA 3ZQ7A 1IRGA 5FLXZ 3WG9A 3SZTA 3Q9SA 1UB9A 2XAFA 1WRJA 5CJ9A 3KP4A 3JAMZ 2VE9A 1ZRCA 4HLYA 4N9HA 5F1RA 3G3ZA 4TV7A 4ON0A 2X0LA 3TOAA 1LDJA 2HDCA 1K78B 2XGXA 2IPQX 4Q47A 4B09A 2NNNA 4A0XA 1KU7A 2P6TA 3BZ6A 2IA0A 5FO5A 1O7FA 1UHMA 2FBHA 3VB2A 2YX7A 3P9CA 3IWZA 2PLYA 2WV0A 1FSEA 1U5TA 3RPQA 1H9TA 5D6FA 3HOTA 2G7HA 5IT9K 3IKVA 4Q4ZF 1S8NA 2EA2A 3WTWC 4RGXA 1ZREA 3RTRA 4I98B 5D8KB 2HQRA 4ZH4F 1P4WA 5K1YA 1L0OC 2YX4A 3GZ6A 4KYWA 4RB2C 1IXCA 2XIGA 2XAJA 1HW5A 1HSJA 2OAZA 2DFIA 4HBLA 4XSZF 2CYYA 2L4AA 1Y0UA 3E6CC 4RGUA 3BDDA 3GFLA 1U2WA 2OQRA 4MQVA 5D6EA 4LLGF 4IXAA 3CUOA 4I2OA 5CVVA 2EK5A 1ZLJA 1YG2A 2KRFA 4OIOF 4QLCU 3IRRA 2KIMA 4B8XA 1BOAA 1D3YA 3WGIA 2XKPA 4LMYA 2HFHA 3TO7A 1DUXC 3ECHA 3LSTA 5L3CA 5JVTA 4LLLA 2Z99A 1YTYA 2D1VA 4YFXF 2XAQA 5F64A 4HF0A 4K2EA 1I27A 1WI9A 5HLHA 3WTVC 1ZGJA 2TDXA 4PGHA 3F8BA 1I5ZA 1XSVA 4KN7X 2GAUA 2Y48A 4LLNA 5ILVA 4KIGA 1B9MA 4RGSA 2AXLA 1TW2A 4CO8A 2A6EF 4ZYGA 5ERIA 2EJRA 2R3SA 5DUIA 1O57A 4BHBA 1U5TC 1G4DA 3TO9A 4UXNA 3V7CA 1L3LA 3AAFA 1BC7C 2QQ9A 2W24A 3NQOA 4AVPA 4P9FA 4MTEA 2GZWA 4BNCA 3FZVA 5DYMA 2HOEA 3KP7A 4RAYA 3R60A 1Z1DA 1I1SA 1TTYA 2LDUA 5D4SA 3IRQA 2O8XA 4HQMA 4AD9A 3KLNA 4CDGA 1GHCA 1V4RA 4HA8A 1STZA 2JSCA 2V9VA 4G8XA 2O61A 4HX8A 3GVAA 4OIPF 4HDUA 3HUGA 2M30A 1PDNC 2EB7A 1FLIA 4KUMA 2MC3A 4R79A 3O6BB 2HWVA 2XKOA 1HKQA 4IF4A 4EM0B 4JQFA 3WTZA 4I01A 1K7AA 4UV9A 3MCZA 3EDPA 2DO7A 5A2QK 2STWA 5HLIA 1ON2A 3BROA 2PFBA 1KYZA 2A3SA 2CSOA 2PEXA 2OD5A 4CZZA 1LB2A 1ULYA 2D45A 5CVJA 4IRHA 4IJAA 2OBPA 3C7JA 4I0BA 2DQRA 2GA2A 3COAC 1ZAOA 1SD4A 1BI0A 5EEHA 3QU6A 2Q0OA 4A0YA 2P7VB 2HQNA 3EUHA 2UXXA 1BI2A 1KU9A 5ICFA 2DI3A 1BI3A 4KT5C 2WTEA 1FT9A 5ILSA 2DPDA 4LB6B 2VC1A 5E17F 1YO5C 2RQPA 3D0SA 5ILUA 2ETHA 2HKXA 2RNJA 1O3TA 2BEOA 2W84A 3ZN0A 4KMFA 2JRTA 1G3YA 3MZHA 3U2RA 1HW1A 1O3RA 3I58A 1Q1HA 2P5LC 1GVJA 4M9XA 5ICCA 1YYVA 4KDPA 5AIPA 1T38A 2UWMA 2HYFA 5LGNA 2PBIA 5FFZA 1LDDA 3H3ZA 4M9ZA 1TQPA 1WQ2A 4KICA 4IHTA 4EJOA 5LHHA 2F2EA 2VN2A 4L5IA 4ENMA 3J81Z 4FT8A 3FXQA 4EMSA 4WK8F 4GYIA 1R23A 3HRUA 2RC4A 1SFXA 5HDGA 1FZPB 2ZXJA 3QOPA 2DAOA 2FMYA 2PQ8A 4XLPF 4ENKA 3OOPA 1XGOA 4H0EA 3ZMVA 1G3WA 1RUNA 1IN8A 3CUQB 2W85A 2H6CA 3I59A 1XCBA 2YR2A 4MNUA 4EM1A 3RDIA 2VONA 1EH7A 1S7AA 1TQMA 5ICGA 3FM3A 3E5QA 4EM2A 5JI6A 2O3FA 4M72A 3GEZA 2FRHA 2OZUA 2IA2A 2FNAA 4EV0A 3NEUA 2D1HA 1ZGAA 2H6BA 4S05A 1U8RA 1IXSB 1ON1A 1PUEE 3TQNA 2EV0A 3VFZA 2EFWA 2CFXA 1FOKA 1FYLA 2VT2A 4UVBA 5HS9A 3T1BA 4ZYEA 1OYYA 3BWGA 3DXJF 3QPTA 1YW9A 3KP6A 3BJ6A 4A12A 3B02A 3O3KA 4BXUA 1RIOH 3W6JB 1IN4A 2EWNA 1P4XA 1Z91A 1G6NA 3J7AO 3IL2A 1USTA 5BPDA 2RV8A 2R7DA 1FBSA 4U7BA 1D8KA 5DCFA 4EGYA 1T39A 3ELKA 1XDSA 3I0TA 3I71A 2JZYA 3WTXC 2QZ8A 1D8JA 3BY6A 2W25A 5HVQC 1P2FA 1U78A 1R1VA 4MHGA 3WU0A 3IHUA 2H09A 1SFEA 4M6XA 3LFKA 1Z05A 2RDPA 4BHPA 1F4KA 4HX7A 4M9SA 3WTYC 3F72A 1BIAA 5J8CA 1ZLKA 3FMSA 2V1XA 2XAGA 4JK1X 3WTSC 4O3MA 3ZN1A 1LNWA 5DDGA 5JHUA 3ROUA 3LWFA 2Z33A 1XGMA 1YIOA 4P55A 4WXCA 1GXQA 5E8IA 2HKOA 3E3VA 2JTVA 5DCMA 5D5WB 1LEAA 3T0YA 4F7ZA 2PMUA 2DW4A 3K2ZA 4U0VA 1ZARA 3CUQC 4R8HA 4Y17A 2CWEA 1EV7A 2CQKA 2IJLA 4HOBA 5LRSA 5LLQA 5BPIA 3FMRA 4M74A 5BOXA 3HSFA 1ZG1A 5HOOA 2KJCA 3CO6C 2VBWA 5L3BA 1O3SA 4HF1A 3HSRA 3M7GA 2WWYA 1VTNC 1USSA 5K5QA 5AONA 5D8LB 1CF7A 3P9IA 3GFIA 2VC0A 3F8FA 4IHSA 3EYYA 1IN6A 5LHGA 3VOEA 1V3FA 1W7PB 4HAMA 4MEYF 2XASA 3V8KA 3LAPA 2FQ3A 5FD6A 3ECOA 4I7HA 1FX7A 3GLXA 1RZ4A 3F21A 2FU4A 1YW7A 5JR3A 1YW8A 3TGNA 4LFUA 4I02A 1NHAA 3LAJA 1MJ9A 2YU3A 5D5VB 2A07F 4A5MA 4O5VA 1BI1A 2CG4A 2VBYA 4UVCA 2FE3A 3FWEA 3PQKA 2OU2A 1HKTA 2P7CB 3E5UA 4DNCA 1HKSA 2RN7A 4YIIA 1Z6RA 3L09A 2J5OA 2DK5A 4LK1F 3F8NA 2HEOA 3K1MA 1JHHA 1W7PD 1D5VA 2GA1A 2L02A 1J2XA 2K4JA 3REOA 2EFQA 4Q48A 4Z2YA 1H9GA 1E2XA 1F9NA 4GO1A 4MTDA 3DP7A 2NAZA 3M1EA 2UZKA 2MBFA 4LG0B 3LQRA 3QP6A 4EGZA 4LB5A 1XCVA 3L9FA 4EVIA 2IP2A 3VEPA 4L0ZB 1K79A 1OYWA 1QBJA 3U1DA 2RGVA 1FBQA 1LQ1A 5F6FA 3F22A 4AIJA 2L3DA 3RKXA 4LK0F 3HRTA 1ZRDA 3JAMK 2LSOA 2IRFG 5LEKA 1JGSA 4M73A 1R7JA 3JSPA 3TKYA 1FY7A 3HHGA 5FLXK 1AWCA 3MQ0A 1R22A 4IRGA 2H94A 4WXHA 4LG0A 1SAXA 2ADUA 5CYVA 5FB2A 2DPUA 2PI0A 5L3DA 1FC3A 1MZBA 3E6MA 5J8FA 3GO5A 1JE8A 4R1HA 1GXPA 4EJTA 2EV6A 2HYGD 3GFMA 3BJOA 1KQ0A 5FFXA 3TO6A 1SFUA 4ESJA 3ML6A 3W6KB 4GGGA 2FMLA 2ZJ2A 1HXDA 3GYHX 2KIUA 5CLSA 3DPTA 1I6XA 2DBBA 3FMQA 1R58A 2AS5F 1BBYA 4PDKA 2ZO4A 3R0JA 3KCCA 4GYGA 1QZYA 4RGRA 4RB1A 3N4MA 4BH9A 5HDKA 4WX9A 3HRMA 4EJVA 1QQIA 4L0YB 1B4AA 4AIHA 3GXOA 4E70A 4EJUA 3V4GA 4ZZLA 3S2WA 3HTSB 1LJ9A 1K6OA 3TOBA 3SXYA 3V8LA 2Y0MA 3WODF 3Q9VA 3RYRA 2DLLA 2STTA 1B6AA 2NYXA 1KYWA 4G94A 2W57A 2GWRA 1RNLA 4G7ZF 1UHWA 3JSOA 2G9WA 1T6SA 3F8CA 1BM9A 2ZBKA 2Z9OA 4L5JA 2IA1A 4HZFA 2FA5A 2JT1A 1H0MA 1XN7A 2BE5F 4OU0A 2E7XA 3PQJA 1RUOA 1KQ8A 4RB3C 3T8RA 5E20A 2LF8A 1FBUA 2MLGA 1FP2A 4XSXF 5H6RA 4G7OF 3LA3A 2XVCA 2ELHA 5DUKA 3ZMSA 3FX3A 5K5RA 3KEOA 2QYOA 1BIBA 2ZNZA 2P4WA 4LD5A 1J7KA 3NRVA 4L9NA 1EH8A 3HIFA 1KA8A 1OMIA 2ZNYA 4MGRA 3J81K 4KN4X 4I0AA 4WF2A 2YSRA 5HLGA 1QZZA 2H27A 2MD5A 2FNPA 4U0YA 3HYIA 1SD5A 3WU1B 1CGPA 5LBQA 2ZFWA 5BQTA 1R1TA 2A5YB 2Y75A 4S04A 1MGTA 1ZH5A 4A5NA 1F1ZA 1HW2A 2GXGA 3RPUA 1EH6A 4KIBA 1QGPA 1WWXA 3HRSA 2HTJA 2QBYB 1J59A 1FNNA 3QAHA 3GFJA 5LEJA 4ENNA 3F3XA 3CUQA 1TNTA 4WWCA 2X4HA 3KETA 3I54A 4G9YA 1MJAA 2GIVA 2K7LA 2FSWA 1REPC 1E17A 2JPBA 1IW7F 1MKMA 4ZYHA 4GXOA 1ZG5A 3V7SA 4CHUA 2FXAA 2K27A 2LF7A 2NNYA 2A61A 1SD7A 1J75A 3WTTC 4N0BA 2HGCA 5BS6A 2IW5A 1WKMA 4A0ZA 5H20A 4HV5A 3MWMA 3SQNA 4OIQF 3LA2A 5E1XA 1DPRA 2P6SA 4KFCA 4UHTA 1WSUA 4ZYDA 2VOPA 1C0WA 3WTUC 3RYPA 1JXSA 5DD4A 2QQAA 1OKRA 4ESFA 1XSDA 4FHTA 2QBYA 2O03A 4BAYA 2L4MA 2QUFA 1XGNA 4IPAA 1HBXG 2G7UA 4D0PA 1TBXA 4RAZA 1R1UA 3GZ5A 1UFMA 4ZZDA 3ABUA 1HSTA 3LA7A 4P96A 2XHKA 3DEUA 1OPCA 3ABTA 2OA4A 2LNBA 2P5VA 1SD6A 2WC2A 1X3UA 4IVNA 1R5HA 4GCVA 1T98A 3K1PA 3L7WA 2K86A 2EV5A 3GWZA 1P92A 5HDNA 3P9KA 1JHFA 2CO5A 3PFIA 2EFOA 2BBYA 2XRNA 5TJJA 4LJZF 3KLOA 1U3EM 2ISYA 3EQLF 5ED4A 1W7PA 6PAXA 2IT0A 4CYDA 3ISPA 2VOOA 1LVAA 4CICA 2ISZA 1IZ1A 2M8EA 1ZHFA 4P5OA 3ZMZA 5LGUA 3KFWX 1T2KA 2MLKA 4KA4A 1U6GA 3ZPLA 3BP8A 2HZTA 1ZG3A 3KZZA 2HTSA 1W5TA 5CVUA 5DV5A 4JBAA 2HR3A 5K5OA 3F6VA 3C3WA 2V1UA 3QP5A 1F5TA 4FX4A 3QRFF 2L01A 3FXUA 4UV8A 3KP5A 3WE2A 2DQLA 3BPXA 3R6SA 2C6YA 1B59A 1XSXA 3TDUC 1SMYF 4HX4A 1YS7A 3BPVA 4HLXA 2FOKA 4HYEA 1W5SA 3F6OA 4HDVA 4Y13A 4WXDA 1O7LA 4M71A 3J80Z 2VT3A 1XGSA 4G6DA 5IT3A 2B0LA 3HHHA 3R4KA 4A6DA 5L3EA 1IN5A 3E5XA 2V6CA 4UVAA 3HOSA 2VBXA 3IKTA 4N9IA 3MZYA 1DP7P 3JTGA 3D5LA 2KIFA 2J5PA 1ZYRF 1TLHB 5D4RA 1S7OA 3EYIA 3E6DA 5LHIA 5L3FA 2E1NA 1FPQA 2MH2A 3WE3A 4KNYA 1BN5A 1OR7A 1ZN2A 1R36A 2DU9A 4QWQA 3MEXA 1IAWA 1G3TA 3K9TA 1XDUA 3T5XA 1YLFA 3CDHA 3L2CA 3J80K 1LDKB 1TNSA 1P6RA 1KGSA 3BJAA 4KIFA 4AWXB 2L54A 2VBZA 3RJPA 3I64A 5IT9Z 3C1DA 1T0FA 1S3JA 1IRFA 3GF2A 3DPLC 3P7NA 2ZMEB 4OOIA 3V7RA 2FEZA 1R5GA 4RB0A 3QPHA 2XROA 1FWZA 2KJBA 3WGHA 4LGWA 1K78A 3JTHA 1ZRFA 2QQBA 5KVRA 5FGMA 1KU3A 2XV4S 3CLOA 2YPRA 1DPUA 2BYVE 1I1GA 2PMHA 2HS5A 4PCQA 1R00A 4DQ2A 3QU3A 4A2UA 2E7WA 2VXZA 4U0WA 2ZMEA 1PP8F 4U88A 1IXRC 3K0LA 3ZP5A 4G7HF 2LKPA 1Z9CA 3C18A 4M6YA 2PN6A 1FSHA 4XLNF 2EA4A 2QVOA 1TQIA 1TW3A 1B1BA 1J5YA 5FD5A 2DT5A 2QLZA 4EJWA 2PJPA 1ODDA 2P5KA 3EETA 2P8TA 4YIFA 3FHZA 2ESNA 1DDNA 1XD7A 1MD0A 1Z6TA 1XMKA 2ZKZA 3RI4A 4ASNA 5TRDA 4HQEA 4HF2A 1RI7A 3LQQA 2F5CA 2MH9A 2K4BA 5A2QZ 2O6GE 1FP1D 5BMZA 1OYIA 2RVCA 4XRFA 1MDMA 3U9GA 1J9IA 4L9TA 4L9VA 2V1DA 3SHFA 1YFHA 3I5UA 2CGPA 3FXRA 2VODA 3WGGA 1A04A 2Z5UA 2BV6A
chains in the Genus database with same CATH superfamily
5EGOA 4CCOA 2VE8A 2R7XA 4YFKF 2H8WA 1B9NA 1MJBA 5E1ZB 1QHGA 1VF9A 5C4XJ 4CXFA 1T08B 4BGDA 2LKSA 3E97A 2XF6A 4Y15A 1JTYA 1IF1A 1W5CC 4DW6A 5LRRA 2M1BA 4A3IJ 5JHFA 4HV6A 1P4AA 3CJNA 3JR9A 1Z7UA 4MEXF 4AIKA 3QPLA 4BHCA 3JRCA 2MA3A 2BXYA 1MBFA 3A4CA 5KK1A 1S6LA 4NQWA 3B73A 4GRIA 1KQ9A 3KE2A 3JW4A 3OV8A 1SVLA 2RKHA 1OCOH 1QRYA 2F5EA 3VODA 4OMZA 4C2TA 3ZQCA 2E71A 1SVOA 3CTAA 5E8GA 1J0RA 4ETSA 5CVIA 3ZMUA 1LE8B 5EEGA 3IAM2 2OQGA 5K7FA 1O3QA 1FTTA 4FE4A 3I53A 3ZMDA 3M8JA 5GAEJ 2ZJPF 3DCFA 2DTRA 1MBKA 5F04A 2Z3YA 1FYKA 3H9JA 3FBNB 2ECBA 3BG6A 3LOCA 2R5YB 4FE7A 4BE0A 2XB5A 1WJAA 4A3LJ 2QWWA 4XLCA 4UUVA 4II3A 3L00A 2VI6A 2NOJB 1QZEA 1XMAA 1CF7B 3KZYA 2DK8A 5GPAA 2PG4A 5HS7A 1FOWA 4NHJA 4YRVA 4OINF 5LFAA 3CO7C 4YFNF 2OTJI 1MBGA 3D5SC 3RKWA 3BOQA 2EQRA 5C3EJ 3G73A 1MMSA 1MDMB 4E7JA 1RKTA 2YS9A 5H6QA 3SDBA 5KAFC 3DQVC 4CSWA 3V8JA 2BGCA 3KP2A 2NS0A 1JTXA 4DYQA 4KITB 1GLNA 2VKDA 2YU9J 3BR6A 5M5XJ 2UXNA 2DA1A 2NVYJ 3CJRB 2O0YA 1QNTA 1XB4A 2Q2EA 1W4MA 3PFYA 2Q8KA 3IWFA 3OIQA 3MAJA 4I09A 4XORA 2OZ6A 5DEQA 3GX4X 5L3GA 1MNEA 4MFEA 3OSGA 1JKPC 2K02A 5LGTA 1QPMA 3HUGB 3A2KA 3ERED 4ABZA 4NQWB 4ENJA 5DCMB 1JUMA 1IN7A 3CC2I 3FF5A 2O8KA 3M9AA 1YQAA 3FM5A 1UZCA 2F5DA 4XRSG 2VJJA 2IS2A 3CQZJ 3ZQIA 3OR1C 4CGZA 4HSRA 5M5YJ 3IH2A 3HPHA 3K69A 2XUBA 4L5EA 2LMDA 4F52A 3KEQA 4L9JA 2Y69H 3DU6A 3LMMA 3F23A 3FXJA 5ICEA 4E7LA 3I4PA 3E1SA 4DIQA 1VQOI 3R61A 4II2A 1ZTRA 2CW8A 2COMA 2HPIA 2ZCWA 3LSHA 4PJ0C 2DOAA 2E34A 3JRFA 4XBFA 5E18F 5HODA 3SZPA 4A3MJ 3RKYA 4YG2F 3GTJJ 1FTZA 3G4SI 3PO2J 2XRLA 1GVDA 3HZJA 3GW2A 4ESBA 3I4MJ 5CVRA 1BW6A 2EFPA 2M87A 2ESHA 4Q5SF 1IDZA 2DODA 3IH4A 1ETOA 2NRAC 2OPTA 2LREA 4PZJA 4U7DA 3B6AA 3FHNA 4P9UA 2VUMJ 1ONVA 4PGGA 5JFRA 2A6HF 2ID6A 5GAHJ 1S5LC 3EUAA 1GV2A 3PO3J 3M8EA 3OYBA 2FUG2 2VPRA 3TDZC 1S72I 3CD6I 3BR3A 2IS6A 2CW0F 3H0GJ 1BJZA 2QM3A 2Q1ZB 5J6XA 3OYAA 2XAHA 4HW0A 4L18B 2JN6A 3KP3A 2FBKA 5AIQA 3BQZA 1BC8C 3U1KA 4IZZA 1S29A 2QA4I 2D2WA 2DMNA 2KKOA 3DV8A 1A5JA 5FRNA 2VJIA 2A68F 1F36A 2JPCA 3PNTA 3UR3C 2XPVA 2A69F 3CMYA 2VQHA 2CUFA 5TISC 5HS8A 2QENA 3O2PE 4KT6A 2IVMA 2L5QA 1E3PA 1KU2A 5FKMA 2EIKH 5EGOB 2ME0A 3CDIA 4EATA 1HQCA 1R4NB 3CCMI 2E1CA 1PJRA 2OJED 1PVEA 4A6EA 5E1WA 4KMUX 3DKWA 3DFGA 3MFKA 4BDYA 3HTUA 2V79A 1IUYA 2KFDA 3B6CA 3RIRA 3H3UA 4BQAA 3F8MA 4UNOA 5D5XB 4DGWB 3E6BA 1LKXA 3A03A 2R7FA 1UG0A 3DWLE 2KL4A 2FF4A 1DU0A 4J00A 1W0UA 3K1NA 4BYYA 5D5UB 1SMTA 1BJAA 3DPUA 1MIJA 2M45A 3IC7A 3M8FA 3ULQB 2F5FA 4F55A 4OIRF 4BE1A 1IRZA 4BY7J 2W48A 3RPUD 2KZVA 3DF8A 2OC6A 3SFZA 1LEBA 4F91B 4WCGA 1QO0D 3ZMTA 4EQQA 3OYMA 3HSEA 1UELB 2VKEA 2JRMA 3GUDA 3EUKL 2ZMEC 1VQPI 4HNVA 2FBIA 1LFUP 1FYMA 2FOWA 3BCBA 1SC7A 4UUTA 2W1OA 3BLYA 4X1EA 5DD8A 1G3SA 2M5WA 4OMYA 2EFNA 3R0AA 4XIDA 4C3IJ 3OYFA 3G6EI 1NTCA 4NB5A 3H92A 2X6YA 1LPQA 2HOAA 4O6JA 1LFBA 1X4PA 3T8TA 4V19K 1N77A 1HDDC 1AOYA 2PMZA 4G6QA 1W1WE 4E6KG 1YS6A 2XAUA 3N97A 5GTIC 4RS8A 5J4YA 1D0YA 5KHDA 1TT0A 2GLOA 3Q5FA 5EG0A 4IRIA 5EZHA 3I59B 2GQQA 2ACJA 5IP6A 1GUUA 2W7NA 1APLC 3NAUA 3CMEI 1UCRA 1PP7U 3ZR8X 1U5TB 3CJTB 4FX0A 2X6XA 4MQ9F 2GXBA 3ZQ7A 1NK3P 2W00A 1FJLA 5FLXZ 1IRGA 2ICWG 2QGUA 3WG9A 3SZTA 3Q9SA 3ZQQA 1X3ZB 1UB9A 2XAFA 1WRJA 4PFOA 4KJZA 5CJ9A 2VB6A 2IS4A 2MC4A 5J4VA 3KP4A 3JAMZ 2VE9A 4P1WA 2WB1N 2JA5J 1D1BA 1ZRCA 4HLYA 1VQ4I 4N9HA 5F1RA 3G3ZA 4TV7A 4ON0A 2X0LA 3TOAA 1LDJA 4D5CA 2DN0A 2HDCA 4IL6C 4BKXA 1JJ6C 1K78B 2XGXA 3FK6A 3KEYA 2OUMA 4JP0A 2IPQX 4Q47A 2HPMA 4B09A 2NNNA 4A0XA 1KU7A 1VQ9I 3QODA 3K4JA 3F9KA 2P6TA 3H5AA 3BZ6A 2A05A 4IOCF 2IA0A 5FO5A 1O7FA 2L2OA 1UHMA 5F0HA 2K85A 2DOFA 2FBHA 2LC2A 3VB2A 2YX7A 3VSKA 1XTAA 4CA0A 3P9CA 3SEQA 2EBIA 1MNMC 3IWZA 4XKWA 2PLYA 2QSHX 2WV0A 2DXIA 4JX6A 3H0DA 1YJWI 1FSEA 1U5TA 1NK2P 4HSTA 3H5NA 3RPQA 1H9TA 5D6FA 3O8GA 4QPQA 3BG3A 3HOTA 3OSFA 2G7HA 1E0EA 5IT9K 3IKVA 4Q4ZF 1S8NA 2EA2A 3WTWC 3RKQA 4RGXA 3N05A 3NWTA 1ZREA 1YX3A 3RTRA 4I98B 4NUBA 5D8KB 2HQRA 1VQ5I 4UB6C 2L0KA 4ZH4F 2VIXA 1P4WA 3K70D 2M8GX 4A3KJ 5K1YA 2ZC2A 1L0OC 3PUBA 5GTHC 2YX4A 3AG4H 1SFOJ 3GZ6A 2E2JJ 4KYWA 4RB2C 1IXCA 2XIGA 3HB9A 2E5NA 2MFZA 3S3NA 4IKFA 2XAJA 3I9V2 1HW5A 3QOEA 2XGCA 1HSJA 3LFUA 2M3AA 2OAZA 3K4CA 2DFIA 3BC8A 4HBLA 4XSZF 5F1JA 2CYYA 4QIWN 3J7AY 2L4AA 1T95A 2WADA 1DGRM 1Y0UA 1XMXA 3E6CC 4RGUA 3BDDA 4IX7A 3GFLA 3Q3SA 4RA2A 1U2WA 2PMZN 3C2HA 3L2RA 2OQRA 4M3FA 4MQVA 5H2FC 1DGWY 5D6EA 4LLGF 4IXAA 3CUOA 4I2OA 5CVVA 2EK5A 5J1RA 1ZLJA 4CYCB 1YG2A 2DDAA 3HPGA 1JUPA 2CQXA 2KRFA 4OIOF 4CCKA 4QLCU 3IRRA 2KIMA 3G71I 4B8XA 4D7NA 2GOMA 3OWTA 1BOAA 3A01B 1GV5A 1V55H 1D3YA 3WGIA 2XKPA 4LMYA 3CC7I 3D5RC 5FKOA 3QYEA 2HFHA 2HZDA 3TO7A 2LKXA 3GMEA 2KISA 2D5VA 5EYRA 2XDVA 2KDOA 1DUXC 3GTLJ 3ECHA 3ERMA 3MKWB 2EZKA 1Z0XA 3CZ6A 1R49A 3LSTA 5L3CA 4XLHA 5JVTA 4LLLA 3WU2C 2Z99A 1YTYA 2D1VA 4PSXA 4YFXF 2XAQA 5F64A 3GTKJ 4HF0A 1K4SA 4K2EA 1I27A 4RMNA 1WI9A 2NS7A 5JLXA 3OYLA 4BQOA 2KP6A 3JRDA 4DYCA 2R5ZA 1VFCA 5HLHA 3G1MA 4ZC3A 3WHBA 3WTVC 1QPIA 1ZGJA 5EZGA 3CC4I 1UHSA 2ECCA 2TDXA 2X85A 4PGHA 1FEXA 3OYDA 3MKYB 5EDNA 4BU2A 2QSGX 3F8BA 3TL4X 1QHHD 1I5ZA 5F0CA 3K6GA 2R7TA 3BQYA 3QWLA 1XSVA 4KN7X 2GAUA 4NC6A 2Y48A 4LLNA 3RQIA 1YRNA 4B47A 5ILVA 4KIGA 1B9MA 1OQYA 1Z3XA 4LIVA 4RGSA 2HYJA 3GTOJ 2F4MB 2GBYA 4D1QA 3HXLA 3BR1A 2AXLA 1TW2A 1D0ZA 2DYRH 1HDPA 3G1LA 2N8GA 4DJAA 4IEJA 1MSEC 5IYDJ 4CO8A 2A6EF 2H1LA 4PK4A 4ZYGA 5ERIA 1JKRC 2EJRA 3M4OJ 2R3SA 3OIOA 5DUIA 3CCQI 1O57A 4D5FA 2XGEA 2XGDA 4BHBA 3CMAI 1U5TC 1G4DA 3G2BA 4IQ4A 3QYBA 2CS3A 5IP7J 3TO9A 2VXDA 2PJRA 4UXNA 4BUPA 3V7CA 3BCAA 1L3LA 3WHCA 3PM1A 3AAFA 1NG7A 1BC7C 4F92B 2QQ9A 2W24A 3K4BA 3ABKH 3NQOA 4AVPA 5C44J 4P9FA 1FIAA 2DMTA 2W4SA 4MTEA 3OYGA 2GZWA 3MKZA 1HA8A 4BNCA 3S2DJ 3HEFA 3H36A 3FZVA 5DYMA 4AUXA 2Z16A 2X6WA 2HOEA 3KP7A 4RAYA 2LBFA 3M07A 2ZXIA 2DTZA 3UKGA 3R60A 1Z1DA 1I1SA 3BG7A 1TTYA 2LDUA 2ELJA 5D4SA 3BTCA 3IRQA 2O8XA 1Z21A 3CCYA 4HQMA 1WZ2A 4AD9A 2CUEA 3KLNA 4CCJA 1YX5A 4CDGA 1GHCA 1V4RA 2EPFA 2VPLA 4FETA 1SAUA 4HA8A 4B1RA 1STZA 1D1AA 2JSCA 2V9VA 1Y8RB 3A02A 4A3DJ 2LR8A 4G8XA 3M1CA 2O61A 4HNUA 1F43A 3AL0B 4HX8A 3GVAA 4OIPF 4HDUA 1TWAJ 2CV1A 3HUGA 3VPRA 5FRMA 2RNGA 2LVSA 2M30A 1PDNC 4MIMA 2JQ7A 2EB7A 1FLIA 3CCSI 2LG4A 4KUMA 3DEEA 2MC3A 4R79A 3S1RJ 4AC0A 2DJNA 3O6BB 5F27A 4XMYA 1X1PA 2HWVA 2AO9A 2XKOA 4RLFA 1HKQA 4IF4A 1W36D 2LP0A 2X1CA 4EM0B 5TGTA 4JQFA 3WTZA 4I01A 1K7AA 4XL9A 1W36C 5CQGA 2QF7A 3A0HC 4UV9A 5K7HA 1P9QC 3MCZA 3EDPA 2DO7A 1WHUA 5A2QK 2R4GA 2STWA 5HLIA 1ON2A 3BROA 2PFBA 2L9NA 1KYZA 1RPWA 1O4XA 3OR2C 2A3SA 3PSIA 5BNGA 3CP2A 2CSOA 2PEXA 2OD5A 2CMPA 4CZZA 1LB2A 1ULYA 3LSIA 2K9QA 2D45A 3S1MJ 5CVJA 4IRHA 4IJAA 2OBPA 4BE2A 1VQ7I 3C7JA 3H9GA 4I0BA 2DQRA 2GA2A 4DZJA 3COAC 3IP4B 1ZAOA 2DMUA 1SD4A 4E7ZA 1BI0A 3L1PA 3MN2A 3L2WA 2DCEA 5EEHA 3QU6A 5HLTA 1V5FA 2Q0OA 4A0YA 2HOTA 2LFBA 4XONA 2JA2A 2P7VB 3I56I 2FJ1A 2HQNA 2EILH 3EUHA 4IHXA 2UXXA 1OFCX 2K9SA 1BI2A 2VKHA 1OCTC 1KU9A 1I6HJ 3S8PA 5ICFA 3VYTB 4XKCA 4CCNA 2DMQA 2DI3A 5FKNA 3FKJA 4BS9A 3JRHA 1BI3A 4KT5C 2WTEA 3BT9A 2K9LA 4IQJA 1ETQA 3W2WA 1FT9A 1ETYA 5ILSA 3ZQFA 2JJ7A 5M3FJ 1AKHB 2DPDA 4LB6B 1RR8C 2VC1A 5E17F 1YO5C 2RQPA 3D0SA 5ILUA 4EEFG 3CCVI 1IGNA 1X58A 4Y33A 1TL8A 4RAGA 2ETHA 2HKXA 2RNJA 2LY9A 4A3EJ 1O3TA 2L9RA 2BEOA 1HF0A 1JUSA 1BL0A 2W84A 3ZN0A 3VWBA 2CW7A 4KMFA 2JRTA 3VDXA 1G3YA 5J47A 3MZHA 1H8AC 3U2RA 1HW1A 1O3RA 3I58A 3IUOA 4J19A 1BOBA 4A3BJ 1Q1HA 2P5LC 1GVJA 4M9XA 5ICCA 1YYVA 4KDPA 5AIPA 1T38A 2UWMA 4DOZA 4H4KC 3X2QH 2HYFA 2BY1A 2IEKA 1H89C 5LGNA 1ENHA 4BEHB 2CUJA 3HM5A 3SEZA 1X3WB 2PBIA 5FFZA 1LDDA 2JMWA 3H3ZA 1TQPA 1WQ2A 4KICA 4M9ZA 4IHTA 2M2EA 2Y30A 4EJOA 5LHHA 4CUGA 3K7AJ 2F2EA 2VN2A 4L5IA 1WH7A 4C3JJ 4ENMA 3J81Z 2M34A 3FXQA 2CUZA 4FT8A 2DDBA 4EMSA 4WK8F 1A36A 4GYIA 1R23A 3HRUA 2RC4A 2R92J 4UUSA 1SFXA 1J09A 5HDGA 1FZPB 4JOMA 2ZXJA 3QOPA 2DAOA 2LBFB 4BXFA 2BOLA 2FMYA 2PQ8A 4XLPF 4ENKA 4D9JA 3OOPA 3W2VA 2F4OB 1ETVA 1XGOA 3V42A 4H0EA 3BG9A 1H88C 1I39A 3ZMVA 4OWRB 1G3WA 3JRAA 1RUNA 2OTLI 3AG3H 2DA2A 3J7YJ 1ZR4A 1IN8A 2BZTA 2FD5A 3CUQB 2HXIA 2W85A 2H6CA 2UUZA 2GIZA 2OV7A 3I59A 1JKOC 1XCBA 3HL2A 4A3CJ 5J3LA 3RSNA 3PL8A 2YR2A 4X0GA 4MNUA 4EM1A 3RDIA 2VONA 1EH7A 1S7AA 5DTDA 1TQMA 5J40A 4AIDA 5ICGA 3FM3A 4MFDA 2XPUA 2DOEA 3E5QA 4HEA2 4EM2A 5JI6A 4W1UA 2O3FA 3BR0A 4M72A 1X1AA 1IG7A 3GEZA 2FRHA 2OZUA 4BJ6C 2R7WA 1GDTA 2IA2A 2NVTJ 1WJBA 2R7OA 2EIJH 2FNAA 2M0MA 2GXAA 4EV0A 2L9VA 2KMUA 3K4LA 3AL0C 2EZIA 3TEDA 1X1CA 3NEUA 2D1HA 3FKIJ 3QPSA 5F0FA 3FXKA 4N4OB 1ZGAA 3IAS2 1SVMA 1OISA 2H6BA 4S05A 2EINH 3S2HJ 2XF7A 3EUHC 4QPOA 4I6ZA 3GLLA 1VQKI 1KZHA 4ZDPA 1U8RA 1IXSB 1ON1A 2I10A 3E7LA 4XM3A 1PUEE 3TQNA 3TP0A 2EV0A 3VFZA 2EFWA 2CFXA 1FOKA 4UB8C 1FYLA 2VT2A 4UVBA 5HS9A 3ESWB 3LSRA 3T1BA 4ZYEA 2MGQA 3OS2A 1OYYA 5IY5H 3BWGA 3DXJF 3QPTA 2BY3A 1YW9A 3KP6A 1Y56A 3BJ6A 4A12A 4XLFA 2ZXHA 1RKWA 1R71A 3PJRA 3B02A 1SFKA 3HGYA 3O3KA 2AQFA 4BXUA 4HNTA 1RIOH 4M6VA 3W6JB 1IN4A 2EWNA 2QKMB 4CH7A 1P4XA 1Z91A 1G6NA 3J7AO 1ITYA 3IL2A 1USTA 1V5EA 5BPDA 1YJNI 5E3NA 2MABA 2RV8A 2E19A 2R7DA 1FBSA 1R4MB 4U7BA 1D8KA 5DM7F 4FCYA 5DCFA 5CKTA 2EZLA 1VZ0A 2KIQA 5J1YA 4EGYA 1T39A 2E1MB 2AXTC 2FQ4A 3KX2A 3ELKA 3HKZN 1XDSA 3I0TA 3I71A 3CMMA 2JZYA 2QCOA 3WTXC 1XC5A 2MYSA 2QZ8A 4AYBA 1D8JA 3BY6A 3DLAA 2W25A 5HVQC 3CCEI 1P2FA 2WY7Q 1U78A 4FQGA 1R1VA 1TP4A 4MHGA 3WU0A 2DFFA 2VJ5A 3KPHA 3IHUA 2H09A 1SFEA 2K40A 3OS1A 1DQUA 2E5ZA 3GBGA 1HC8A 3W2AA 2LD5A 4M6XA 1HLVA 3LFKA 1Z05A 2RDPA 4BHPA 3ZQGA 1F4KA 2DMPA 3G1OA 4HX7A 4M9SA 3BZCA 3WTYC 1U9OA 3F72A 1BIAA 1Y0NA 5J8CA 2WAQA 2ZB9A 1ZLKA 1BR2A 1HCRA 3FMSA 2V1XA 2XAGA 4B3XA 5B5EC 5EF6A 5GAGJ 4JK1X 3WTSC 5FJ8J 3OY9A 3I55I 3FISA 4O3MA 1M1EB 2M0CA 2JK3A 3ZN1A 1ZK8A 1LNWA 5DDGA 4Y4RA 5JHUA 3HOUJ 3FXLA 3ROUA 1VQMI 2KRHA 2R7SA 1EKEA 1K4TA 2CFOA 1CQTA 1WGXA 5CPRB 2COBA 3LWFA 2Z33A 2BW3A 1T0FC 1E3OC 1XGMA 1MMNA 1WH5A 1YIOA 4P55A 4WXCA 1GXQA 3PSFA 5E8IA 3MZ8A 2HKOA 3E3VA 2JTVA 5DCMA 2WBMA 3K10A 1UG2A 5J1UA 1YHQI 5D5WB 3FDYA 1LEAA 3DBRB 3T0YA 3CP8A 4F7ZA 1EF4A 1Z7LA 2PMUA 4Y3OA 2DW4A 3CCJI 3K2ZA 2B63J 2WB1A 4U0VA 1ZARA 3CUQC 4R8HA 4NDLA 4IHYA 4Y17A 1EV7A 2CWEA 2CQKA 2M7AA 3DTIA 2IJLA 4HOBA 3TP3A 1IC8A 5LRSA 5LLQA 3S93A 4FASD 3FMRA 5BPIA 4C2UA 4PFPA 4M74A 3HOWJ 2DA7A 5BOXA 3HSFA 1ZG1A 5HOOA 2KJCA 3BG5A 3P5JA 2IBDA 3CO6C 2VBWA 5L3BA 1TWGJ 3VSLA 1O3SA 2NVXJ 2XSDC 4HF1A 3HSRA 3M7GA 2WWYA 1T56A 1A6IA 1VTNC 4AU7A 1USSA 5K5QA 4DBRA 5AONA 1RR7A 2W82A 3JRIA 5D8LB 1CF7A 1WJEA 3P9IA 2WA0A 3JCUC 3GFIA 2VC0A 2ZJRF 1Y6IA 2IGMA 5E3OA 1D1CA 3F8FA 4IHSA 3EYYA 1IN6A 5LHGA 3VOEA 1V3FA 1W7PB 4HAMA 4MEYF 4B4CA 2XASA 3D1NI 3V8KA 3LAPA 4ZTJA 2UV1A 3BTJA 4DYRA 2FQ3A 4C3HJ 3PNYA 2K3FA 5IYCJ 1ETKA 2M9HA 3FXMA 5FD6A 3HOXJ 1KONA 1DP3A 3ECOA 4I7HA 1FX7A 3GLXA 2IAIA 1RZ4A 3F21A 2FU4A 2DA6A 2CQNA 3U21A 4IHVA 1YW7A 5JR3A 1WI3A 2QSFX 1YW8A 3TGNA 4LFUA 4I02A 1NHAA 3LAJA 2LRDA 1PUFA 1MJ9A 2YU3A 5D5VB 2A07F 4A5MA 5GPCA 4O5VA 3PNVA 2DFHA 1BI1A 2CG4A 1IRXA 3RZDJ 2VBYA 4NBQA 4UVCA 3TW7A 2FE3A 3FWEA 3MD2A 3PQKA 4XKBA 2OU2A 1VQ6I 3HOVJ 1HKTA 4LITA 2K9NA 2ZSHB 1U9NA 1IUFA 2P7CB 5KNLA 3E5UA 4G6TB 3LNQA 1S9HA 4DNCA 2NXNB 1HKSA 2RN7A 2R5YA 4YIIA 1Z6RA 4BBRJ 1U0JA 3L09A 2J5OA 2DK5A 2CU7A 4LK1F 3W3CA 1X2MA 3S1QJ 1MNDA 3F8NA 3A01A 2ZSIB 2HEOA 3K1MA 1JHHA 2VQLA 1W7PD 2HOSA 1D5VA 2GA1A 2L02A 1J2XA 2E1MC 4ANJA 1OCCH 2K4JA 2VL8A 3REOA 2EFQA 2IS1A 1Z67A 3DBLB 4Q48A 4Z2YA 1H9GA 2R93J 1E2XA 4GDFA 2X6OA 1F9NA 4GO1A 4MTDA 1POGA 3DP7A 2NAZA 4XN3A 3M1EA 4BQQA 2UZKA 2MBFA 4LG0B 3ZCOA 3HGGA 4PJNA 3LQRA 2ZJQF 3QP6A 4EGZA 1RESA 1XCVA 1TT5B 3L9FA 4HPQA 4B48A 4LB5A 4EVIA 3S3MA 2R7VA 2IP2A 4A3GJ 3VEPA 4L0ZB 3DKXA 1K79A 1OYWA 1UJ8A 2QKLB 3JREA 1TC3C 2K3PA 3K4KA 3DTKA 1QBJA 1Z77A 2DA5A 3U1DA 2RGVA 2V4JC 1FBQA 5FROA 2O9LA 1LQ1A 5F6FA 3F22A 4AIJA 2L3DA 3RKXA 2I5UA 2F5VA 5M3MJ 4LK0F 3HRTA 4V2FA 2DYSH 4M3GA 1ZRDA 3DU5A 3JAMK 2LSOA 2IRFG 5LEKA 1JGSA 2HI3A 3S3OA 2PJRB 3S1NJ 3TBIA 4M73A 2BW3B 1K83J 1R7JA 3JSPA 4B3AA 3TKYA 3JRGA 1FY7A 5B1BH 3HHGA 3DKYA 5FLXK 1AWCA 1GT0C 1OCPA 1ETXA 2IGOA 3MQ0A 1R22A 1WPKA 4IRGA 5FLMJ 2H94A 4WXHA 2E2IJ 4LG0A 2BHZA 1SAXA 2ADUA 5IP9J 5CYVA 5FB2A 2DPUA 2LK2A 2PI0A 5L3DA 1FC3A 2LOOA 4XQFA 1MZBA 1ZGWA 3E6MA 5J8FA 3GO5A 3GTQJ 1JE8A 4R1HA 1GXPA 3OYJA 4EJTA 1TWHJ 2EV6A 2HYGD 3GFMA 3BJOA 1KQ0A 2CV2A 1V54H 2XC7A 5FFXA 3TO6A 1XG1A 1G2HA 1R6RA 1SFUA 1BA5A 4ESJA 3ML6A 2MW8A 3ZQHA 3W6KB 4GGGA 3PUFA 2FMLA 4LIUA 3K70C 2ZJ2A 4PJJA 1HXDA 3GYHX 2KIUA 5CLSA 4F93B 2HU9A 4BQNA 2KLOA 2XB0X 3DPTA 3LSGA 4NC7A 2M7BA 4RM3A 1ACIA 1I6XA 3SYTA 2DBBA 3FMQA 2ZFUA 2JVGA 1R58A 4PJMA 2AS5F 1BBYA 2PX9A 1UMQA 4PDKA 2ZO4A 5E79C 3R0JA 3KCCA 4UUSB 4IHWA 4GYGA 4MLOA 4U87A 4CYCA 4D7MA 4BXXJ 1JKQC 1QZYA 4RGRA 4RB1A 3J7ZI 1PYVA 3O8HA 3N4MA 1LUJB 4BH9A 2H8RA 2HNHA 2K9MA 5HDKA 2DA4A 4WX9A 4B44A 3HRMA 2CJJA 4EJVA 1QQIA 1SANA 1UAAA 2CRGA 4L0YB 1B4AA 4AIHA 3SJMA 4YELA 3GXOA 4E70A 4EJUA 3GTGJ 1WVRA 3V4GA 4ZZLA 3MKLA 3S2WA 1YJ9I 1E3HA 3HTSB 3ASNH 2MG4A 1LJ9A 1RETA 1K6OA 3TOBA 2X48A 1OLTA 3SXYA 3IV5A 3ZRGA 3V8LA 1FMWA 2Y0MA 3WODF 1MW7A 1AHDP 3Q9VA 3RYRA 1EJ9A 2DLLA 2DFEA 3OYNA 3S16J 3HJEA 2STTA 4PUSA 1B6AA 2KHMA 2HQAA 2NYXA 1KYWA 2A5WA 3HDDA 4G94A 2W57A 2O7OA 4B43A 2GWRA 2Q2EB 2VASA 2F4IA 3HG9A 2JUGA 2ELKA 1RNLA 4G7ZF 3DEWA 1UHWA 3JSOA 2G9WA 1T6SA 3F8CA 1X1BA 1BM9A 2LH9A 2ZBKA 2Z9OA 4L5JA 2IA1A 2V26A 4HZFA 2FA5A 2JT1A 3VYSB 3MMYB 1H0MA 4JX5A 3Q0UA 1XN7A 1YOVB 2XSJC 4FTHA 2BE5F 2EIMH 3BZKA 2F6CA 4OU0A 2E7XA 3PQJA 4QSHA 4DZPA 2DJIA 3TW6A 1RUOA 1KQ8A 4I76A 4M3DA 5IPAA 4RB3C 5FKKA 1P7IA 5FKLA 3AG1H 3T8RA 5E20A 1ZELA 1IV8A 1OJLA 1FBUA 2LF8A 2MLGA 4YEJA 1ETWA 1FP2A 5GP9A 4XSXF 5H6RA 1Y8QB 4G7OF 3LA3A 3S32A 2XVCA 2ELHA 5DUKA 3ZMSA 1B72B 3F0CA 3FX3A 5K5RA 5LD2C 2HDDA 3KEOA 3JRBA 2QYOA 1BIBA 2QEXI 2ZNZA 2P4WA 3OYIA 2XF5A 5GADJ 1WJDA 4C30A 4LD5A 1NG6A 2NVQJ 3HOZJ 1J7KA 3NRVA 4N4NB 4L9NA 1EH8A 3HIFA 1KA8A 1OMIA 2ZNYA 3BTLA 3C2BA 4MGRA 3J81K 4KN4X 4I0AA 4J01A 4WF2A 2YSRA 3RQ4A 3ONQA 5HLGA 4XRMA 5EEAA 2KQRA 3K2AA 1QZZA 2H27A 2MD5A 2FNPA 4U0YA 2E1OA 1X4OA 3HYIA 1N25A 1SD5A 3WU1B 1CGPA 4HG2A 5LBQA 1D5YA 1YIJI 2HQ5A 2JA8J 2ZFWA 5BQTA 1R1TA 2A5YB 2Y75A 4RDUA 1JGGA 2QQ8A 4S04A 1MGTA 3CCUI 4A5NA 2KZGA 1ZH5A 1IO2A 1F1ZA 2WY8Q 1N78A 1HW2A 2GXGA 2TRTA 3RPUA 1EH6A 3S14J 2IGKA 4KIBA 4BACA 1QGPA 1WWXA 3HRSA 4NNJA 1Y1WJ 2HTJA 2QBYB 1J59A 1T8IA 3C2GA 1I3QJ 2DT6A 3I3LA 4A3FJ 4XKVA 1FNNA 3QAHA 3GFJA 5LEJA 4ENNA 2NS8A 3F3XA 4ZDLA 3DLLF 3CUQA 1TNTA 4WWCA 2X4HA 3KETA 3I54A 4G9YA 4V2GA 4E7HA 3CCRI 1R5ID 4NC8A 2YUSA 1B8IA 1MJAA 1FIPA 2GIVA 2HVRA 2VQCA 2K7LA 2O5RA 1YI2I 2FSWA 1A35A 3VYUB 4X6AJ 1REPC 4A3JJ 1E17A 2JPBA 3OMYA 4HRIA 1QA6A 1QVUA 1IW7F 2LY2A 1MKMA 4JYKA 4BL0B 2K5CA 3OL4A 2V9KA 4ZYHA 3W6VA 4GXOA 4XLAA 3CCLI 4BEHA 1ZG5A 4M3BA 3H9QA 5M5WJ 4AM3A 3V7SA 5DM6F 4CHUA 1WJFA 2FXAA 4PJLA 2HXOA 2P0WA 2WV1A 1OR7C 2A6TA 2K27A 2LF7A 2X1DA 2NNYA 2A61A 2R7QA 1I50J 3OOUA 4CCMA 3OIPA 2OCEA 1SD7A 1J75A 3WTTC 4C2MJ 1K6YA 4BJ5C 3PIPF 3HKZA 1Y1VJ 4N0BA 1X1DA 2HGCA 3A0BC 5BS6A 2IW5A 2L7ZA 2KT0A 4LOCA 1WKMA 3AKZA 3S15J 2KRCA 4A0ZA 4BBSJ 9ANTA 1FOYA 3GZNB 2TCTA 4GFBA 5H20A 4HV5A 3MWMA 3L2UA 3SQNA 1MBJA 2E36A 1HOMA 4C9YA 4CCLA 4OIQF 3LA2A 5E1XA 1DPRA 3RCOA 1WCMJ 3MVPA 5B66C 2P6SA 4KFCA 5B3SH 3CLQA 4UHTA 1YITI 1WSUA 4KISA 4ZYDA 1WJ5A 2VOPA 1C0WA 3WTUC 1D0XA 3RYPA 1JXSA 3S17J 3BR5A 5DD4A 3DTEA 2QQAA 1OKRA 4ESFA 2JVHA 1XSDA 4FHTA 4I99C 2QBYA 2O03A 4BAYA 2L4MA 2QUFA 3KYDB 2R7UA 5HNHA 2JSPA 2ME6A 1U8BA 2ZXWH 3VYRB 1XGNA 4IPAA 2R7RA 1HBXG 4AVZA 2G7UA 1EA3A 2JWTA 4D0PA 1TBXA 4RAZA 1R1UA 3GZ5A 2HVQA 4YIRX 4MO7A 1UFMA 3ABLH 4ZZDA 3ASOH 1OCRH 4AYBN 3ABUA 1IJWC 1MMGA 1HSTA 1BR4A 5JVGF 3RZOJ 3A1YA 3LA7A 4P96A 1MMDA 1RC9A 4XOTA 3HOYJ 2XHKA 3DEUA 3OYHA 1OPCA 3H35A 4XRSA 3ABTA 2OA4A 3NARA 2LNBA 2P5VA 1SD6A 2WC2A 4XLEA 1X3UA 4IVNA 1R5HA 4GCVA 4PSWA 1R9TJ 1T98A 3K1PA 3L7WA 1JT6A 2K86A 1Q1VA 2EV5A 3GWZA 3FIWA 1P92A 3SZGA 3CF5F 4E7IA 5HDNA 1TWCJ 3P9KA 1JHFA 2CO5A 3PFIA 2LTPA 2Y9ZA 2EFOA 1BW5A 2BBYA 2XRNA 5TJJA 4LJZF 2RAEA 3KLOA 1U3EM 2ISYA 4Y7NJ 3EQLF 1PUFB 4F3QA 5ED4A 1W7PA 2CQQA 6PAXA 2IT0A 2V6EA 4CYDA 1VNDA 3ISPA 2VOOA 3GTPJ 1WJCA 1LVAA 4OAZA 4CICA 2VLAA 3ABMH 3K4MA 1S7EA 2ISZA 1ZR2A 1IZ1A 5C4JJ 2M8EA 2RQQA 1ZHFA 4P5OA 4Z6YA 3L2QA 1RRJA 3ZMZA 5LGUA 3KFWX 1T2KA 2MLKA 4LG3A 4KA4A 1ERDA 4E7SA 1U6GA 2X1EA 3ZPLA 1XX5A 3LSKA 3ZGKA 3CDLA 3BP8A 1A6QA 2HZTA 3GCMA 3QQAA 2IGNA 1LFPA 1ZG3A 3KZZA 2HTSA 1W5TA 2JA6J 2V7FA 5CVUA 2VJ4A 5DV5A 4JBAA 2HR3A 5K5OA 3WG7H 3F6VA 3C3WA 3FK7A 3LL7A 2V1UA 3QP5A 5F08A 1F5TA 2XPWA 3HBLA 4FX4A 3QRFF 5E3MA 2L01A 3FXUA 5HNFA 2H1KA 2BXZA 2B9SA 4BJTA 4E7KA 4UV8A 3KP5A 2LYCA 2X9DA 3WE2A 2DQLA 2Z1DA 3BPXA 3OL3A 2BVMA 4CZCA 1B8IB 2L7KA 3FBIB 3R6SA 2C6YA 1B59A 1XSXA 3KIOA 3TDUC 1SMYF 4HX4A 3ZQLA 1YS7A 3SDGA 3BPVA 4HLXA 3BTIA 2FOKA 2M4KA 1K61A 2CH0A 2EZHA 4HYEA 2WAQN 1W5SA 3F6OA 5IYBJ 4HDVA 1VQNI 1X19A 2NOGA 4Y13A 4WXDA 4E4HA 2MD0A 1I3AA 1O7LA 4M71A 1AKHA 3J80Z 2VT3A 4XR6A 3AFHA 2L7MP 5CQEA 1XS9A 2Y0SN 1XGSA 2P81A 2GOXB 4FISA 4G6DA 5DS9A 5JLWA 2V9PA 3ZOBA 5IT3A 2B0LA 1QU3A 3HHHA 4Y52J 3R4KA 1MSFC 2R0QC 4A6DA 5L3EA 1IN5A 3E0JB 3E5XA 2V6CA 4UVAA 5B1AH 3HOSA 4M3EA 2VBXA 2AQEA 2L9SA 4RAFA 2WAEA 3IKTA 4N9IA 1N75A 1YE9A 3EPZA 3MZYA 1DP7P 3JTGA 3D5LA 1FOXA 2KIFA 2J5PA 1ZYRF 1TLHB 3DBHB 3ZXSA 3LSJA 4DBQA 5D4RA 1S7OA 3EYIA 3E6DA 1MBEA 1X2NA 5EG0B 5LHIA 2IXSA 3SFIA 5L3FA 1YRNB 4ZTFA 1TWFJ 4ZJZA 1JI8A 2Z2SB 2E1NA 3OYKA 1XPXA 1FPQA 2MH2A 3FXOA 2DA3A 2RREA 3WE3A 4KNYA 4XN0A 3H3VK 1BN5A 1OR7A 1ZN2A 1QVTA 1R36A 1B72A 1P7JA 5K7ZA 2DU9A 4W97A 5EJCA 4QWQA 3MEXA 1IAWA 1G3TA 4IO9F 3UNGC 1TZLA 3K9TA 1XDUA 4QTRA 3OYEA 2R5ZB 2HDWA 3T5XA 2ID3A 1YLFA 1Y39A 2I8DA 3CDHA 3L2CA 3J80K 2E60A 1LDKB 1TNSA 1P6RA 2GM4A 3PIOF 1ZQ3P 2CV0A 1KGSA 4G12A 3H1CA 3CJQB 4RLQA 3BJAA 4KIFA 4AWXB 4RM2A 2L54A 2VBZA 3RJPA 3I64A 2KDZA 3KYCB 4XNFA 5IT9Z 4ZDOA 3C1DA 1T0FA 1S3JA 1IRFA 3H5RA 3GF2A 2WAFA 3LSMA 3BR2A 2F48A 3DPLC 3P7NA 3LSPA 2ZMEB 4OOIA 3CESA 3V7RA 2FEZA 1R5GA 4RB0A 1G59A 3QPHA 2XROA 2Y9YA 1FWZA 2KJBA 1SEUA 2EH3A 1NH3A 2L7FP 2VQGA 3WGHA 4JX4A 4LGWA 2E35A 4IOAF 1K78A 4A69C 3JTHA 2CQ7A 1ZRFA 2QQBA 2V1NA 4BDZA 5KVRA 5FGMA 2FX0A 1KU3A 2XV4S 3CLOA 2YPRA 1G8XA 2Y0SA 4XICA 3IH3A 4BY1J 1DPUA 2BYVE 1I1GA 1AA7A 2HS5A 2JUCA 2PMHA 4PCQA 1MMAA 1R00A 1JJ8C 2X51A 4DQ2A 1MH3A 3QU3A 4A2UA 2R7ZJ 1WFXA 2LLKA 2MSYA 2OCCH 2E7WA 3L2VA 2HVSA 2VXZA 2AHQA 4U0WA 2ZMEA 2Y2ZA 4ZYAA 1PP8F 1LVKA 4U88A 1IXRC 3K0LA 5E3LA 3ZP5A 4G7HF 4A93J 2LKPA 1Z9CA 3C18A 1FMVA 1MBHA 3OS0A 3HC7A 4M6YA 2PN6A 3CF2A 1FSHA 4XLNF 1T33A 2EA4A 4UY8I 2JA7J 2QVOA 1VQLI 1TQIA 1TW3A 2VKVA 1VI0A 4RBOA 4OAYA 3M3YJ 4ITVA 1B1BA 1J5YA 3K4NA 5FD5A 2DT5A 1VQ8I 3TMOA 2QLZA 2Y31A 4EJWA 2PJPA 1ODDA 2P5KA 1OCZH 3QYFA 3EETA 2P8TA 4XOPA 4YIFA 3FHZA 2E2HJ 3KZIC 2NVUB 1ZKGA 1W0TA 2ESNA 1DDNA 4S0HB 1XD7A 3NWSA 2B7EA 3AG2H 1MD0A 3OYCA 1MH4A 1Z6TA 1XMKA 1LE8A 1IDYA 2ZKZA 5KCMA 2BVLA 3Q0WA 4ASNA 5TRDA 2G0EA 4HQEA 3RI4A 3I4NJ 4HF2A 1JT0A 1RI7A 3LQQA 2F5CA 2MH9A 3KYLA 2K4BA 1ORKA 5A2QZ 2O6GE 5IOZA 2DT7B 2OF7A 1AU7A 3GTMJ 2BY0A 5KAIC 2BY2A 1DU6A 1FP1D 5BMZA 1OYIA 2RVCA 4XRFA 1MDMA 2KPMA 3U9GA 5FLVA 1J9IA 4L9TA 1A31A 1Z3YA 2V1DA 4L9VA 3SHFA 3Q0VA 2BHYA 1YFHA 3I5UA 2CGPA 1BR1A 3FXRA 2LY1A 2VODA 1IV6A 2M4GA 4XK4A 3WGGA 1A04A 2Z5UA 1V5GA 5IOYA 2BV6A
chains in the Genus database with same CATH topology
2VE8A 4YFKF 1B9NA 1MJBA 5E1ZB 4CXFA 4Y15A 3E97A 1IF1A 5LRRA 2M1BA 4HV6A 1P4AA 3CJNA 1Z7UA 4MEXF 4AIKA 4BHCA 2MA3A 5KK1A 1S6LA 4NQWA 3B73A 1KQ9A 3KE2A 3JW4A 3OV8A 2RKHA 2F5EA 3VODA 4OMZA 3CTAA 5E8GA 1J0RA 4ETSA 5CVIA 3ZMUA 5EEGA 2OQGA 1O3QA 3ZMDA 3I53A 2DTRA 2Z3YA 1FYKA 2QWWA 4UUVA 3L00A 1XMAA 1CF7B 3KZYA 2DK8A 2PG4A 5HS7A 4NHJA 4OINF 3CO7C 4YFNF 3RKWA 3BOQA 3G73A 1MDMB 5H6QA 3DQVC 3V8JA 2BGCA 3KP2A 2NS0A 2UXNA 2O0YA 1QNTA 1XB4A 2Q2EA 1W4MA 2Q8KA 3IWFA 4I09A 3MAJA 2OZ6A 5DEQA 3GX4X 5L3GA 2K02A 5LGTA 1QPMA 3ERED 4ENJA 5DCMB 1IN7A 3FF5A 3M9AA 1YQAA 3FM5A 2F5DA 4CGZA 3K69A 2XUBA 3KEQA 4L9JA 3F23A 5ICEA 3I4PA 3R61A 2COMA 2ZCWA 4XBFA 5E18F 3SZPA 3RKYA 4YG2F 3GW2A 4ESBA 4Q5SF 5CVRA 2M87A 2EFPA 2ESHA 2NRAC 4PZJA 4U7DA 4P9UA 1ONVA 4PGGA 5JFRA 2A6HF 3M8EA 3TDZC 2CW0F 2QM3A 5J6XA 2XAHA 4HW0A 4L18B 3KP3A 2FBKA 5AIQA 1BC8C 1S29A 2D2WA 2KKOA 3DV8A 2A68F 2JPCA 2A69F 5HS8A 2QENA 3O2PE 2IVMA 1KU2A 1HQCA 2E1CA 4A6EA 5E1WA 4KMUX 3DKWA 3DFGA 3MFKA 3HTUA 2V79A 1IUYA 3RIRA 3H3UA 4BQAA 3F8MA 4UNOA 5D5XB 3E6BA 2R7FA 2FF4A 3K1NA 4BYYA 5D5UB 1SMTA 1BJAA 2M45A 3IC7A 3M8FA 3ULQB 2F5FA 4OIRF 3DF8A 3SFZA 1LEBA 4WCGA 1QO0D 3ZMTA 4EQQA 3HSEA 3GUDA 1FYMA 2FBIA 5DD8A 1G3SA 2M5WA 4OMYA 2EFNA 3R0AA 4NB5A 3H92A 4O6JA 3T8TA 1AOYA 4G6QA 1YS6A 3N97A 4RS8A 3Q5FA 4IRIA 3I59B 2GQQA 2ACJA 1PP7U 1UCRA 1U5TB 4FX0A 4MQ9F 2GXBA 3ZQ7A 1IRGA 5FLXZ 3WG9A 3SZTA 3Q9SA 1UB9A 2XAFA 1WRJA 5CJ9A 3KP4A 3JAMZ 2VE9A 1ZRCA 4HLYA 4N9HA 5F1RA 3G3ZA 4TV7A 4ON0A 2X0LA 3TOAA 1LDJA 2HDCA 1K78B 2XGXA 2IPQX 4Q47A 4B09A 2NNNA 4A0XA 1KU7A 2P6TA 3BZ6A 2IA0A 5FO5A 1O7FA 1UHMA 2FBHA 3VB2A 2YX7A 3P9CA 3IWZA 2PLYA 2WV0A 1FSEA 1U5TA 3RPQA 1H9TA 5D6FA 3HOTA 2G7HA 5IT9K 3IKVA 4Q4ZF 1S8NA 2EA2A 3WTWC 4RGXA 1ZREA 3RTRA 4I98B 5D8KB 2HQRA 4ZH4F 1P4WA 5K1YA 1L0OC 2YX4A 3GZ6A 4KYWA 4RB2C 1IXCA 2XIGA 2XAJA 1HW5A 1HSJA 2OAZA 2DFIA 4HBLA 4XSZF 2CYYA 2L4AA 1Y0UA 3E6CC 4RGUA 3BDDA 3GFLA 1U2WA 2OQRA 4MQVA 5D6EA 4LLGF 4IXAA 3CUOA 4I2OA 5CVVA 2EK5A 1ZLJA 1YG2A 2KRFA 4OIOF 4QLCU 3IRRA 2KIMA 4B8XA 1BOAA 1D3YA 3WGIA 2XKPA 4LMYA 2HFHA 3TO7A 1DUXC 3ECHA 3LSTA 5L3CA 5JVTA 4LLLA 2Z99A 1YTYA 2D1VA 4YFXF 2XAQA 5F64A 4HF0A 4K2EA 1I27A 1WI9A 5HLHA 3WTVC 1ZGJA 2TDXA 4PGHA 3F8BA 1I5ZA 1XSVA 4KN7X 2GAUA 2Y48A 4LLNA 5ILVA 4KIGA 1B9MA 4RGSA 2AXLA 1TW2A 4CO8A 2A6EF 4ZYGA 5ERIA 2EJRA 2R3SA 5DUIA 1O57A 4BHBA 1U5TC 1G4DA 3TO9A 4UXNA 3V7CA 1L3LA 3AAFA 1BC7C 2QQ9A 2W24A 3NQOA 4AVPA 4P9FA 4MTEA 2GZWA 4BNCA 3FZVA 5DYMA 2HOEA 3KP7A 4RAYA 3R60A 1Z1DA 1I1SA 1TTYA 2LDUA 5D4SA 3IRQA 2O8XA 4HQMA 4AD9A 3KLNA 4CDGA 1GHCA 1V4RA 4HA8A 1STZA 2JSCA 2V9VA 4G8XA 2O61A 4HX8A 3GVAA 4OIPF 4HDUA 3HUGA 2M30A 1PDNC 2EB7A 1FLIA 4KUMA 2MC3A 4R79A 3O6BB 2HWVA 2XKOA 1HKQA 4IF4A 4EM0B 4JQFA 3WTZA 4I01A 1K7AA 4UV9A 3MCZA 3EDPA 2DO7A 5A2QK 2STWA 5HLIA 1ON2A 3BROA 2PFBA 1KYZA 2A3SA 2CSOA 2PEXA 2OD5A 4CZZA 1LB2A 1ULYA 2D45A 5CVJA 4IRHA 4IJAA 2OBPA 3C7JA 4I0BA 2DQRA 2GA2A 3COAC 1ZAOA 1SD4A 1BI0A 5EEHA 3QU6A 2Q0OA 4A0YA 2P7VB 2HQNA 3EUHA 2UXXA 1BI2A 1KU9A 5ICFA 2DI3A 1BI3A 4KT5C 2WTEA 1FT9A 5ILSA 2DPDA 4LB6B 2VC1A 5E17F 1YO5C 2RQPA 3D0SA 5ILUA 2ETHA 2HKXA 2RNJA 1O3TA 2BEOA 2W84A 3ZN0A 4KMFA 2JRTA 1G3YA 3MZHA 3U2RA 1HW1A 1O3RA 3I58A 1Q1HA 2P5LC 1GVJA 4M9XA 5ICCA 1YYVA 4KDPA 5AIPA 1T38A 2UWMA 2HYFA 5LGNA 2PBIA 5FFZA 1LDDA 3H3ZA 4M9ZA 1TQPA 1WQ2A 4KICA 4IHTA 4EJOA 5LHHA 2F2EA 2VN2A 4L5IA 4ENMA 3J81Z 4FT8A 3FXQA 4EMSA 4WK8F 4GYIA 1R23A 3HRUA 2RC4A 1SFXA 5HDGA 1FZPB 2ZXJA 3QOPA 2DAOA 2FMYA 2PQ8A 4XLPF 4ENKA 3OOPA 1XGOA 4H0EA 3ZMVA 1G3WA 1RUNA 1IN8A 3CUQB 2W85A 2H6CA 3I59A 1XCBA 2YR2A 4MNUA 4EM1A 3RDIA 2VONA 1EH7A 1S7AA 1TQMA 5ICGA 3FM3A 3E5QA 4EM2A 5JI6A 2O3FA 4M72A 3GEZA 2FRHA 2OZUA 2IA2A 2FNAA 4EV0A 3NEUA 2D1HA 1ZGAA 2H6BA 4S05A 1U8RA 1IXSB 1ON1A 1PUEE 3TQNA 2EV0A 3VFZA 2EFWA 2CFXA 1FOKA 1FYLA 2VT2A 4UVBA 5HS9A 3T1BA 4ZYEA 1OYYA 3BWGA 3DXJF 3QPTA 1YW9A 3KP6A 3BJ6A 4A12A 3B02A 3O3KA 4BXUA 1RIOH 3W6JB 1IN4A 2EWNA 1P4XA 1Z91A 1G6NA 3J7AO 3IL2A 1USTA 5BPDA 2RV8A 2R7DA 1FBSA 4U7BA 1D8KA 5DCFA 4EGYA 1T39A 3ELKA 1XDSA 3I0TA 3I71A 2JZYA 3WTXC 2QZ8A 1D8JA 3BY6A 2W25A 5HVQC 1P2FA 1U78A 1R1VA 4MHGA 3WU0A 3IHUA 2H09A 1SFEA 4M6XA 3LFKA 1Z05A 2RDPA 4BHPA 1F4KA 4HX7A 4M9SA 3WTYC 3F72A 1BIAA 5J8CA 1ZLKA 3FMSA 2V1XA 2XAGA 4JK1X 3WTSC 4O3MA 3ZN1A 1LNWA 5DDGA 5JHUA 3ROUA 3LWFA 2Z33A 1XGMA 1YIOA 4P55A 4WXCA 1GXQA 5E8IA 2HKOA 3E3VA 2JTVA 5DCMA 5D5WB 1LEAA 3T0YA 4F7ZA 2PMUA 2DW4A 3K2ZA 4U0VA 1ZARA 3CUQC 4R8HA 4Y17A 2CWEA 1EV7A 2CQKA 2IJLA 4HOBA 5LRSA 5LLQA 5BPIA 3FMRA 4M74A 5BOXA 3HSFA 1ZG1A 5HOOA 2KJCA 3CO6C 2VBWA 5L3BA 1O3SA 4HF1A 3HSRA 3M7GA 2WWYA 1VTNC 1USSA 5K5QA 5AONA 5D8LB 1CF7A 3P9IA 3GFIA 2VC0A 3F8FA 4IHSA 3EYYA 1IN6A 5LHGA 3VOEA 1V3FA 1W7PB 4HAMA 4MEYF 2XASA 3V8KA 3LAPA 2FQ3A 5FD6A 3ECOA 4I7HA 1FX7A 3GLXA 1RZ4A 3F21A 2FU4A 1YW7A 5JR3A 1YW8A 3TGNA 4LFUA 4I02A 1NHAA 3LAJA 1MJ9A 2YU3A 5D5VB 2A07F 4A5MA 4O5VA 1BI1A 2CG4A 2VBYA 4UVCA 2FE3A 3FWEA 3PQKA 2OU2A 1HKTA 2P7CB 3E5UA 4DNCA 1HKSA 2RN7A 4YIIA 1Z6RA 3L09A 2J5OA 2DK5A 4LK1F 3F8NA 2HEOA 3K1MA 1JHHA 1W7PD 1D5VA 2GA1A 2L02A 1J2XA 2K4JA 3REOA 2EFQA 4Q48A 4Z2YA 1H9GA 1E2XA 1F9NA 4GO1A 4MTDA 3DP7A 2NAZA 3M1EA 2UZKA 2MBFA 4LG0B 3LQRA 3QP6A 4EGZA 4LB5A 1XCVA 3L9FA 4EVIA 2IP2A 3VEPA 4L0ZB 1K79A 1OYWA 1QBJA 3U1DA 2RGVA 1FBQA 1LQ1A 5F6FA 3F22A 4AIJA 2L3DA 3RKXA 4LK0F 3HRTA 1ZRDA 3JAMK 2LSOA 2IRFG 5LEKA 1JGSA 4M73A 1R7JA 3JSPA 3TKYA 1FY7A 3HHGA 5FLXK 1AWCA 3MQ0A 1R22A 4IRGA 2H94A 4WXHA 4LG0A 1SAXA 2ADUA 5CYVA 5FB2A 2DPUA 2PI0A 5L3DA 1FC3A 1MZBA 3E6MA 5J8FA 3GO5A 1JE8A 4R1HA 1GXPA 4EJTA 2EV6A 2HYGD 3GFMA 3BJOA 1KQ0A 5FFXA 3TO6A 1SFUA 4ESJA 3ML6A 3W6KB 4GGGA 2FMLA 2ZJ2A 1HXDA 3GYHX 2KIUA 5CLSA 3DPTA 1I6XA 2DBBA 3FMQA 1R58A 2AS5F 1BBYA 4PDKA 2ZO4A 3R0JA 3KCCA 4GYGA 1QZYA 4RGRA 4RB1A 3N4MA 4BH9A 5HDKA 4WX9A 3HRMA 4EJVA 1QQIA 4L0YB 1B4AA 4AIHA 3GXOA 4E70A 4EJUA 3V4GA 4ZZLA 3S2WA 3HTSB 1LJ9A 1K6OA 3TOBA 3SXYA 3V8LA 2Y0MA 3WODF 3Q9VA 3RYRA 2DLLA 2STTA 1B6AA 2NYXA 1KYWA 4G94A 2W57A 2GWRA 1RNLA 4G7ZF 1UHWA 3JSOA 2G9WA 1T6SA 3F8CA 1BM9A 2ZBKA 2Z9OA 4L5JA 2IA1A 4HZFA 2FA5A 2JT1A 1H0MA 1XN7A 2BE5F 4OU0A 2E7XA 3PQJA 1RUOA 1KQ8A 4RB3C 3T8RA 5E20A 2LF8A 1FBUA 2MLGA 1FP2A 4XSXF 5H6RA 4G7OF 3LA3A 2XVCA 2ELHA 5DUKA 3ZMSA 3FX3A 5K5RA 3KEOA 2QYOA 1BIBA 2ZNZA 2P4WA 4LD5A 1J7KA 3NRVA 4L9NA 1EH8A 3HIFA 1KA8A 1OMIA 2ZNYA 4MGRA 3J81K 4KN4X 4I0AA 4WF2A 2YSRA 5HLGA 1QZZA 2H27A 2MD5A 2FNPA 4U0YA 3HYIA 1SD5A 3WU1B 1CGPA 5LBQA 2ZFWA 5BQTA 1R1TA 2A5YB 2Y75A 4S04A 1MGTA 1ZH5A 4A5NA 1F1ZA 1HW2A 2GXGA 3RPUA 1EH6A 4KIBA 1QGPA 1WWXA 3HRSA 2HTJA 2QBYB 1J59A 1FNNA 3QAHA 3GFJA 5LEJA 4ENNA 3F3XA 3CUQA 1TNTA 4WWCA 2X4HA 3KETA 3I54A 4G9YA 1MJAA 2GIVA 2K7LA 2FSWA 1REPC 1E17A 2JPBA 1IW7F 1MKMA 4ZYHA 4GXOA 1ZG5A 3V7SA 4CHUA 2FXAA 2K27A 2LF7A 2NNYA 2A61A 1SD7A 1J75A 3WTTC 4N0BA 2HGCA 5BS6A 2IW5A 1WKMA 4A0ZA 5H20A 4HV5A 3MWMA 3SQNA 4OIQF 3LA2A 5E1XA 1DPRA 2P6SA 4KFCA 4UHTA 1WSUA 4ZYDA 2VOPA 1C0WA 3WTUC 3RYPA 1JXSA 5DD4A 2QQAA 1OKRA 4ESFA 1XSDA 4FHTA 2QBYA 2O03A 4BAYA 2L4MA 2QUFA 1XGNA 4IPAA 1HBXG 2G7UA 4D0PA 1TBXA 4RAZA 1R1UA 3GZ5A 1UFMA 4ZZDA 3ABUA 1HSTA 3LA7A 4P96A 2XHKA 3DEUA 1OPCA 3ABTA 2OA4A 2LNBA 2P5VA 1SD6A 2WC2A 1X3UA 4IVNA 1R5HA 4GCVA 1T98A 3K1PA 3L7WA 2K86A 2EV5A 3GWZA 1P92A 5HDNA 3P9KA 1JHFA 2CO5A 3PFIA 2EFOA 2BBYA 2XRNA 5TJJA 4LJZF 3KLOA 1U3EM 2ISYA 3EQLF 5ED4A 1W7PA 6PAXA 2IT0A 4CYDA 3ISPA 2VOOA 1LVAA 4CICA 2ISZA 1IZ1A 2M8EA 1ZHFA 4P5OA 3ZMZA 5LGUA 3KFWX 1T2KA 2MLKA 4KA4A 1U6GA 3ZPLA 3BP8A 2HZTA 1ZG3A 3KZZA 2HTSA 1W5TA 5CVUA 5DV5A 4JBAA 2HR3A 5K5OA 3F6VA 3C3WA 2V1UA 3QP5A 1F5TA 4FX4A 3QRFF 2L01A 3FXUA 4UV8A 3KP5A 3WE2A 2DQLA 3BPXA 3R6SA 2C6YA 1B59A 1XSXA 3TDUC 1SMYF 4HX4A 1YS7A 3BPVA 4HLXA 2FOKA 4HYEA 1W5SA 3F6OA 4HDVA 4Y13A 4WXDA 1O7LA 4M71A 3J80Z 2VT3A 1XGSA 4G6DA 5IT3A 2B0LA 3HHHA 3R4KA 4A6DA 5L3EA 1IN5A 3E5XA 2V6CA 4UVAA 3HOSA 2VBXA 3IKTA 4N9IA 3MZYA 1DP7P 3JTGA 3D5LA 2KIFA 2J5PA 1ZYRF 1TLHB 5D4RA 1S7OA 3EYIA 3E6DA 5LHIA 5L3FA 2E1NA 1FPQA 2MH2A 3WE3A 4KNYA 1BN5A 1OR7A 1ZN2A 1R36A 2DU9A 4QWQA 3MEXA 1IAWA 1G3TA 3K9TA 1XDUA 3T5XA 1YLFA 3CDHA 3L2CA 3J80K 1LDKB 1TNSA 1P6RA 1KGSA 3BJAA 4KIFA 4AWXB 2L54A 2VBZA 3RJPA 3I64A 5IT9Z 3C1DA 1T0FA 1S3JA 1IRFA 3GF2A 3DPLC 3P7NA 2ZMEB 4OOIA 3V7RA 2FEZA 1R5GA 4RB0A 3QPHA 2XROA 1FWZA 2KJBA 3WGHA 4LGWA 1K78A 3JTHA 1ZRFA 2QQBA 5KVRA 5FGMA 1KU3A 2XV4S 3CLOA 2YPRA 1DPUA 2BYVE 1I1GA 2PMHA 2HS5A 4PCQA 1R00A 4DQ2A 3QU3A 4A2UA 2E7WA 2VXZA 4U0WA 2ZMEA 1PP8F 4U88A 1IXRC 3K0LA 3ZP5A 4G7HF 2LKPA 1Z9CA 3C18A 4M6YA 2PN6A 1FSHA 4XLNF 2EA4A 2QVOA 1TQIA 1TW3A 1B1BA 1J5YA 5FD5A 2DT5A 2QLZA 4EJWA 2PJPA 1ODDA 2P5KA 3EETA 2P8TA 4YIFA 3FHZA 2ESNA 1DDNA 1XD7A 1MD0A 1Z6TA 1XMKA 2ZKZA 3RI4A 4ASNA 5TRDA 4HQEA 4HF2A 1RI7A 3LQQA 2F5CA 2MH9A 2K4BA 5A2QZ 2O6GE 1FP1D 5BMZA 1OYIA 2RVCA 4XRFA 1MDMA 3U9GA 1J9IA 4L9TA 4L9VA 2V1DA 3SHFA 1YFHA 3I5UA 2CGPA 3FXRA 2VODA 3WGGA 1A04A 2Z5UA 2BV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VE8 A;  4YFK F;  1B9N A;  1MJB A;  5E1Z B;  4CXF A;  4Y15 A;  3E97 A;  1IF1 A;  5LRR A;  2M1B A;  4HV6 A;  1P4A A;  3CJN A;  1Z7U A;  4MEX F;  4AIK A;  4BHC A;  2MA3 A;  5KK1 A;  1S6L A;  4NQW A;  3B73 A;  1KQ9 A;  3KE2 A;  3JW4 A;  3OV8 A;  2RKH A;  2F5E A;  3VOD A;  4OMZ A;  3CTA A;  5E8G A;  1J0R A;  4ETS A;  5CVI A;  3ZMU A;  5EEG A;  2OQG A;  1O3Q A;  3ZMD A;  3I53 A;  2DTR A;  2Z3Y A;  1FYK A;  2QWW A;  4UUV A;  3L00 A;  1XMA A;  1CF7 B;  3KZY A;  2DK8 A;  2PG4 A;  5HS7 A;  4NHJ A;  4OIN F;  3CO7 C;  4YFN F;  3RKW A;  3BOQ A;  3G73 A;  1MDM B;  5H6Q A;  3DQV C;  3V8J A;  2BGC A;  3KP2 A;  2NS0 A;  2UXN A;  2O0Y A;  1QNT A;  1XB4 A;  2Q2E A;  1W4M A;  2Q8K A;  3IWF A;  4I09 A;  3MAJ A;  2OZ6 A;  5DEQ A;  3GX4 X;  5L3G A;  2K02 A;  5LGT A;  1QPM A;  3ERE D;  4ENJ A;  5DCM B;  1IN7 A;  3FF5 A;  3M9A A;  1YQA A;  3FM5 A;  2F5D A;  4CGZ A;  3K69 A;  2XUB A;  3KEQ A;  4L9J A;  3F23 A;  5ICE A;  3I4P A;  3R61 A;  2COM A;  2ZCW A;  4XBF A;  5E18 F;  3SZP A;  3RKY A;  4YG2 F;  3GW2 A;  4ESB A;  4Q5S F;  5CVR A;  2M87 A;  2EFP A;  2ESH A;  2NRA C;  4PZJ A;  4U7D A;  4P9U A;  1ONV A;  4PGG A;  5JFR A;  2A6H F;  3M8E A;  3TDZ C;  2CW0 F;  2QM3 A;  5J6X A;  2XAH A;  4HW0 A;  4L18 B;  3KP3 A;  2FBK A;  5AIQ A;  1BC8 C;  1S29 A;  2D2W A;  2KKO A;  3DV8 A;  2A68 F;  2JPC A;  2A69 F;  5HS8 A;  2QEN A;  3O2P E;  2IVM A;  1KU2 A;  1HQC A;  2E1C A;  4A6E A;  5E1W A;  4KMU X;  3DKW A;  3DFG A;  3MFK A;  3HTU A;  2V79 A;  1IUY A;  3RIR A;  3H3U A;  4BQA A;  3F8M A;  4UNO A;  5D5X B;  3E6B A;  2R7F A;  2FF4 A;  3K1N A;  4BYY A;  5D5U B;  1SMT A;  1BJA A;  2M45 A;  3IC7 A;  3M8F A;  3ULQ B;  2F5F A;  4OIR F;  3DF8 A;  3SFZ A;  1LEB A;  4WCG A;  1QO0 D;  3ZMT A;  4EQQ A;  3HSE A;  3GUD A;  1FYM A;  2FBI A;  5DD8 A;  1G3S A;  2M5W A;  4OMY A;  2EFN A;  3R0A A;  4NB5 A;  3H92 A;  4O6J A;  3T8T A;  1AOY A;  4G6Q A;  1YS6 A;  3N97 A;  4RS8 A;  3Q5F A;  4IRI A;  3I59 B;  2GQQ A;  2ACJ A;  1PP7 U;  1UCR A;  1U5T B;  4FX0 A;  4MQ9 F;  2GXB A;  3ZQ7 A;  1IRG A;  5FLX Z;  3WG9 A;  3SZT A;  3Q9S A;  1UB9 A;  2XAF A;  1WRJ A;  5CJ9 A;  3KP4 A;  3JAM Z;  2VE9 A;  1ZRC A;  4HLY A;  4N9H A;  5F1R A;  3G3Z A;  4TV7 A;  4ON0 A;  2X0L A;  3TOA A;  1LDJ A;  2HDC A;  1K78 B;  2XGX A;  2IPQ X;  4Q47 A;  4B09 A;  2NNN A;  4A0X A;  1KU7 A;  2P6T A;  3BZ6 A;  2IA0 A;  5FO5 A;  1O7F A;  1UHM A;  2FBH A;  3VB2 A;  2YX7 A;  3P9C A;  3IWZ A;  2PLY A;  2WV0 A;  1FSE A;  1U5T A;  3RPQ A;  1H9T A;  5D6F A;  3HOT A;  2G7H A;  5IT9 K;  3IKV A;  4Q4Z F;  1S8N A;  2EA2 A;  3WTW C;  4RGX A;  1ZRE A;  3RTR A;  4I98 B;  5D8K B;  2HQR A;  4ZH4 F;  1P4W A;  5K1Y A;  1L0O C;  2YX4 A;  3GZ6 A;  4KYW A;  4RB2 C;  1IXC A;  2XIG A;  2XAJ A;  1HW5 A;  1HSJ A;  2OAZ A;  2DFI A;  4HBL A;  4XSZ F;  2CYY A;  2L4A A;  1Y0U A;  3E6C C;  4RGU A;  3BDD A;  3GFL A;  1U2W A;  2OQR A;  4MQV A;  5D6E A;  4LLG F;  4IXA A;  3CUO A;  4I2O A;  5CVV A;  2EK5 A;  1ZLJ A;  1YG2 A;  2KRF A;  4OIO F;  4QLC U;  3IRR A;  2KIM A;  4B8X A;  1BOA A;  1D3Y A;  3WGI A;  2XKP A;  4LMY A;  2HFH A;  3TO7 A;  1DUX C;  3ECH A;  3LST A;  5L3C A;  5JVT A;  4LLL A;  2Z99 A;  1YTY A;  2D1V A;  4YFX F;  2XAQ A;  5F64 A;  4HF0 A;  4K2E A;  1I27 A;  1WI9 A;  5HLH A;  3WTV C;  1ZGJ A;  2TDX A;  4PGH A;  3F8B A;  1I5Z A;  1XSV A;  4KN7 X;  2GAU A;  2Y48 A;  4LLN A;  5ILV A;  4KIG A;  1B9M A;  4RGS A;  2AXL A;  1TW2 A;  4CO8 A;  2A6E F;  4ZYG A;  5ERI A;  2EJR A;  2R3S A;  5DUI A;  1O57 A;  4BHB A;  1U5T C;  1G4D A;  3TO9 A;  4UXN A;  3V7C A;  1L3L A;  3AAF A;  1BC7 C;  2QQ9 A;  2W24 A;  3NQO A;  4AVP A;  4P9F A;  4MTE A;  2GZW A;  4BNC A;  3FZV A;  5DYM A;  2HOE A;  3KP7 A;  4RAY A;  3R60 A;  1Z1D A;  1I1S A;  1TTY A;  2LDU A;  5D4S A;  3IRQ A;  2O8X A;  4HQM A;  4AD9 A;  3KLN A;  4CDG A;  1GHC A;  1V4R A;  4HA8 A;  1STZ A;  2JSC A;  2V9V A;  4G8X A;  2O61 A;  4HX8 A;  3GVA A;  4OIP F;  4HDU A;  3HUG A;  2M30 A;  1PDN C;  2EB7 A;  1FLI A;  4KUM A;  2MC3 A;  4R79 A;  3O6B B;  2HWV A;  2XKO A;  1HKQ A;  4IF4 A;  4EM0 B;  4JQF A;  3WTZ A;  4I01 A;  1K7A A;  4UV9 A;  3MCZ A;  3EDP A;  2DO7 A;  5A2Q K;  2STW A;  5HLI A;  1ON2 A;  3BRO A;  2PFB A;  1KYZ A;  2A3S A;  2CSO A;  2PEX A;  2OD5 A;  4CZZ A;  1LB2 A;  1ULY A;  2D45 A;  5CVJ A;  4IRH A;  4IJA A;  2OBP A;  3C7J A;  4I0B A;  2DQR A;  2GA2 A;  3COA C;  1ZAO A;  1SD4 A;  1BI0 A;  5EEH A;  3QU6 A;  2Q0O A;  4A0Y A;  2P7V B;  2HQN A;  3EUH A;  2UXX A;  1BI2 A;  1KU9 A;  5ICF A;  2DI3 A;  1BI3 A;  4KT5 C;  2WTE A;  1FT9 A;  5ILS A;  2DPD A;  4LB6 B;  2VC1 A;  5E17 F;  1YO5 C;  2RQP A;  3D0S A;  5ILU A;  2ETH A;  2HKX A;  2RNJ A;  1O3T A;  2BEO A;  2W84 A;  3ZN0 A;  4KMF A;  2JRT A;  1G3Y A;  3MZH A;  3U2R A;  1HW1 A;  1O3R A;  3I58 A;  1Q1H A;  2P5L C;  1GVJ A;  4M9X A;  5ICC A;  1YYV A;  4KDP A;  5AIP A;  1T38 A;  2UWM A;  2HYF A;  5LGN A;  2PBI A;  5FFZ A;  1LDD A;  3H3Z A;  4M9Z A;  1TQP A;  1WQ2 A;  4KIC A;  4IHT A;  4EJO A;  5LHH A;  2F2E A;  2VN2 A;  4L5I A;  4ENM A;  3J81 Z;  4FT8 A;  3FXQ A;  4EMS A;  4WK8 F;  4GYI A;  1R23 A;  3HRU A;  2RC4 A;  1SFX A;  5HDG A;  1FZP B;  2ZXJ A;  3QOP A;  2DAO A;  2FMY A;  2PQ8 A;  4XLP F;  4ENK A;  3OOP A;  1XGO A;  4H0E A;  3ZMV A;  1G3W A;  1RUN A;  1IN8 A;  3CUQ B;  2W85 A;  2H6C A;  3I59 A;  1XCB A;  2YR2 A;  4MNU A;  4EM1 A;  3RDI A;  2VON A;  1EH7 A;  1S7A A;  1TQM A;  5ICG A;  3FM3 A;  3E5Q A;  4EM2 A;  5JI6 A;  2O3F A;  4M72 A;  3GEZ A;  2FRH A;  2OZU A;  2IA2 A;  2FNA A;  4EV0 A;  3NEU A;  2D1H A;  1ZGA A;  2H6B A;  4S05 A;  1U8R A;  1IXS B;  1ON1 A;  1PUE E;  3TQN A;  2EV0 A;  3VFZ A;  2EFW A;  2CFX A;  1FOK A;  1FYL A;  2VT2 A;  4UVB A;  5HS9 A;  3T1B A;  4ZYE A;  1OYY A;  3BWG A;  3DXJ F;  3QPT A;  1YW9 A;  3KP6 A;  3BJ6 A;  4A12 A;  3B02 A;  3O3K A;  4BXU A;  1RIO H;  3W6J B;  1IN4 A;  2EWN A;  1P4X A;  1Z91 A;  1G6N A;  3J7A O;  3IL2 A;  1UST A;  5BPD A;  2RV8 A;  2R7D A;  1FBS A;  4U7B A;  1D8K A;  5DCF A;  4EGY A;  1T39 A;  3ELK A;  1XDS A;  3I0T A;  3I71 A;  2JZY A;  3WTX C;  2QZ8 A;  1D8J A;  3BY6 A;  2W25 A;  5HVQ C;  1P2F A;  1U78 A;  1R1V A;  4MHG A;  3WU0 A;  3IHU A;  2H09 A;  1SFE A;  4M6X A;  3LFK A;  1Z05 A;  2RDP A;  4BHP A;  1F4K A;  4HX7 A;  4M9S A;  3WTY C;  3F72 A;  1BIA A;  5J8C A;  1ZLK A;  3FMS A;  2V1X A;  2XAG A;  4JK1 X;  3WTS C;  4O3M A;  3ZN1 A;  1LNW A;  5DDG A;  5JHU A;  3ROU A;  3LWF A;  2Z33 A;  1XGM A;  1YIO A;  4P55 A;  4WXC A;  1GXQ A;  5E8I A;  2HKO A;  3E3V A;  2JTV A;  5DCM A;  5D5W B;  1LEA A;  3T0Y A;  4F7Z A;  2PMU A;  2DW4 A;  3K2Z A;  4U0V A;  1ZAR A;  3CUQ C;  4R8H A;  4Y17 A;  2CWE A;  1EV7 A;  2CQK A;  2IJL A;  4HOB A;  5LRS A;  5LLQ A;  5BPI A;  3FMR A;  4M74 A;  5BOX A;  3HSF A;  1ZG1 A;  5HOO A;  2KJC A;  3CO6 C;  2VBW A;  5L3B A;  1O3S A;  4HF1 A;  3HSR A;  3M7G A;  2WWY A;  1VTN C;  1USS A;  5K5Q A;  5AON A;  5D8L B;  1CF7 A;  3P9I A;  3GFI A;  2VC0 A;  3F8F A;  4IHS A;  3EYY A;  1IN6 A;  5LHG A;  3VOE A;  1V3F A;  1W7P B;  4HAM A;  4MEY F;  2XAS A;  3V8K A;  3LAP A;  2FQ3 A;  5FD6 A;  3ECO A;  4I7H A;  1FX7 A;  3GLX A;  1RZ4 A;  3F21 A;  2FU4 A;  1YW7 A;  5JR3 A;  1YW8 A;  3TGN A;  4LFU A;  4I02 A;  1NHA A;  3LAJ A;  1MJ9 A;  2YU3 A;  5D5V B;  2A07 F;  4A5M A;  4O5V A;  1BI1 A;  2CG4 A;  2VBY A;  4UVC A;  2FE3 A;  3FWE A;  3PQK A;  2OU2 A;  1HKT A;  2P7C B;  3E5U A;  4DNC A;  1HKS A;  2RN7 A;  4YII A;  1Z6R A;  3L09 A;  2J5O A;  2DK5 A;  4LK1 F;  3F8N A;  2HEO A;  3K1M A;  1JHH A;  1W7P D;  1D5V A;  2GA1 A;  2L02 A;  1J2X A;  2K4J A;  3REO A;  2EFQ A;  4Q48 A;  4Z2Y A;  1H9G A;  1E2X A;  1F9N A;  4GO1 A;  4MTD A;  3DP7 A;  2NAZ A;  3M1E A;  2UZK A;  2MBF A;  4LG0 B;  3LQR A;  3QP6 A;  4EGZ A;  4LB5 A;  1XCV A;  3L9F A;  4EVI A;  2IP2 A;  3VEP A;  4L0Z B;  1K79 A;  1OYW A;  1QBJ A;  3U1D A;  2RGV A;  1FBQ A;  1LQ1 A;  5F6F A;  3F22 A;  4AIJ A;  2L3D A;  3RKX A;  4LK0 F;  3HRT A;  1ZRD A;  3JAM K;  2LSO A;  2IRF G;  5LEK A;  1JGS A;  4M73 A;  1R7J A;  3JSP A;  3TKY A;  1FY7 A;  3HHG A;  5FLX K;  1AWC A;  3MQ0 A;  1R22 A;  4IRG A;  2H94 A;  4WXH A;  4LG0 A;  1SAX A;  2ADU A;  5CYV A;  5FB2 A;  2DPU A;  2PI0 A;  5L3D A;  1FC3 A;  1MZB A;  3E6M A;  5J8F A;  3GO5 A;  1JE8 A;  4R1H A;  1GXP A;  4EJT A;  2EV6 A;  2HYG D;  3GFM A;  3BJO A;  1KQ0 A;  5FFX A;  3TO6 A;  1SFU A;  4ESJ A;  3ML6 A;  3W6K B;  4GGG A;  2FML A;  2ZJ2 A;  1HXD A;  3GYH X;  2KIU A;  5CLS A;  3DPT A;  1I6X A;  2DBB A;  3FMQ A;  1R58 A;  2AS5 F;  1BBY A;  4PDK A;  2ZO4 A;  3R0J A;  3KCC A;  4GYG A;  1QZY A;  4RGR A;  4RB1 A;  3N4M A;  4BH9 A;  5HDK A;  4WX9 A;  3HRM A;  4EJV A;  1QQI A;  4L0Y B;  1B4A A;  4AIH A;  3GXO A;  4E70 A;  4EJU A;  3V4G A;  4ZZL A;  3S2W A;  3HTS B;  1LJ9 A;  1K6O A;  3TOB A;  3SXY A;  3V8L A;  2Y0M A;  3WOD F;  3Q9V A;  3RYR A;  2DLL A;  2STT A;  1B6A A;  2NYX A;  1KYW A;  4G94 A;  2W57 A;  2GWR A;  1RNL A;  4G7Z F;  1UHW A;  3JSO A;  2G9W A;  1T6S A;  3F8C A;  1BM9 A;  2ZBK A;  2Z9O A;  4L5J A;  2IA1 A;  4HZF A;  2FA5 A;  2JT1 A;  1H0M A;  1XN7 A;  2BE5 F;  4OU0 A;  2E7X A;  3PQJ A;  1RUO A;  1KQ8 A;  4RB3 C;  3T8R A;  5E20 A;  2LF8 A;  1FBU A;  2MLG A;  1FP2 A;  4XSX F;  5H6R A;  4G7O F;  3LA3 A;  2XVC A;  2ELH A;  5DUK A;  3ZMS A;  3FX3 A;  5K5R A;  3KEO A;  2QYO A;  1BIB A;  2ZNZ A;  2P4W A;  4LD5 A;  1J7K A;  3NRV A;  4L9N A;  1EH8 A;  3HIF A;  1KA8 A;  1OMI A;  2ZNY A;  4MGR A;  3J81 K;  4KN4 X;  4I0A A;  4WF2 A;  2YSR A;  5HLG A;  1QZZ A;  2H27 A;  2MD5 A;  2FNP A;  4U0Y A;  3HYI A;  1SD5 A;  3WU1 B;  1CGP A;  5LBQ A;  2ZFW A;  5BQT A;  1R1T A;  2A5Y B;  2Y75 A;  4S04 A;  1MGT A;  1ZH5 A;  4A5N A;  1F1Z A;  1HW2 A;  2GXG A;  3RPU A;  1EH6 A;  4KIB A;  1QGP A;  1WWX A;  3HRS A;  2HTJ A;  2QBY B;  1J59 A;  1FNN A;  3QAH A;  3GFJ A;  5LEJ A;  4ENN A;  3F3X A;  3CUQ A;  1TNT A;  4WWC A;  2X4H A;  3KET A;  3I54 A;  4G9Y A;  1MJA A;  2GIV A;  2K7L A;  2FSW A;  1REP C;  1E17 A;  2JPB A;  1IW7 F;  1MKM A;  4ZYH A;  4GXO A;  1ZG5 A;  3V7S A;  4CHU A;  2FXA A;  2K27 A;  2LF7 A;  2NNY A;  2A61 A;  1SD7 A;  1J75 A;  3WTT C;  4N0B A;  2HGC A;  5BS6 A;  2IW5 A;  1WKM A;  4A0Z A;  5H20 A;  4HV5 A;  3MWM A;  3SQN A;  4OIQ F;  3LA2 A;  5E1X A;  1DPR A;  2P6S A;  4KFC A;  4UHT A;  1WSU A;  4ZYD A;  2VOP A;  1C0W A;  3WTU C;  3RYP A;  1JXS A;  5DD4 A;  2QQA A;  1OKR A;  4ESF A;  1XSD A;  4FHT A;  2QBY A;  2O03 A;  4BAY A;  2L4M A;  2QUF A;  1XGN A;  4IPA A;  1HBX G;  2G7U A;  4D0P A;  1TBX A;  4RAZ A;  1R1U A;  3GZ5 A;  1UFM A;  4ZZD A;  3ABU A;  1HST A;  3LA7 A;  4P96 A;  2XHK A;  3DEU A;  1OPC A;  3ABT A;  2OA4 A;  2LNB A;  2P5V A;  1SD6 A;  2WC2 A;  1X3U A;  4IVN A;  1R5H A;  4GCV A;  1T98 A;  3K1P A;  3L7W A;  2K86 A;  2EV5 A;  3GWZ A;  1P92 A;  5HDN A;  3P9K A;  1JHF A;  2CO5 A;  3PFI A;  2EFO A;  2BBY A;  2XRN A;  5TJJ A;  4LJZ F;  3KLO A;  1U3E M;  2ISY A;  3EQL F;  5ED4 A;  1W7P A;  6PAX A;  2IT0 A;  4CYD A;  3ISP A;  2VOO A;  1LVA A;  4CIC A;  2ISZ A;  1IZ1 A;  2M8E A;  1ZHF A;  4P5O A;  3ZMZ A;  5LGU A;  3KFW X;  1T2K A;  2MLK A;  4KA4 A;  1U6G A;  3ZPL A;  3BP8 A;  2HZT A;  1ZG3 A;  3KZZ A;  2HTS A;  1W5T A;  5CVU A;  5DV5 A;  4JBA A;  2HR3 A;  5K5O A;  3F6V A;  3C3W A;  2V1U A;  3QP5 A;  1F5T A;  4FX4 A;  3QRF F;  2L01 A;  3FXU A;  4UV8 A;  3KP5 A;  3WE2 A;  2DQL A;  3BPX A;  3R6S A;  2C6Y A;  1B59 A;  1XSX A;  3TDU C;  1SMY F;  4HX4 A;  1YS7 A;  3BPV A;  4HLX A;  2FOK A;  4HYE A;  1W5S A;  3F6O A;  4HDV A;  4Y13 A;  4WXD A;  1O7L A;  4M71 A;  3J80 Z;  2VT3 A;  1XGS A;  4G6D A;  5IT3 A;  2B0L A;  3HHH A;  3R4K A;  4A6D A;  5L3E A;  1IN5 A;  3E5X A;  2V6C A;  4UVA A;  3HOS A;  2VBX A;  3IKT A;  4N9I A;  3MZY A;  1DP7 P;  3JTG A;  3D5L A;  2KIF A;  2J5P A;  1ZYR F;  1TLH B;  5D4R A;  1S7O A;  3EYI A;  3E6D A;  5LHI A;  5L3F A;  2E1N A;  1FPQ A;  2MH2 A;  3WE3 A;  4KNY A;  1BN5 A;  1OR7 A;  1ZN2 A;  1R36 A;  2DU9 A;  4QWQ A;  3MEX A;  1IAW A;  1G3T A;  3K9T A;  1XDU A;  3T5X A;  1YLF A;  3CDH A;  3L2C A;  3J80 K;  1LDK B;  1TNS A;  1P6R A;  1KGS A;  3BJA A;  4KIF A;  4AWX B;  2L54 A;  2VBZ A;  3RJP A;  3I64 A;  5IT9 Z;  3C1D A;  1T0F A;  1S3J A;  1IRF A;  3GF2 A;  3DPL C;  3P7N A;  2ZME B;  4OOI A;  3V7R A;  2FEZ A;  1R5G A;  4RB0 A;  3QPH A;  2XRO A;  1FWZ A;  2KJB A;  3WGH A;  4LGW A;  1K78 A;  3JTH A;  1ZRF A;  2QQB A;  5KVR A;  5FGM A;  1KU3 A;  2XV4 S;  3CLO A;  2YPR A;  1DPU A;  2BYV E;  1I1G A;  2PMH A;  2HS5 A;  4PCQ A;  1R00 A;  4DQ2 A;  3QU3 A;  4A2U A;  2E7W A;  2VXZ A;  4U0W A;  2ZME A;  1PP8 F;  4U88 A;  1IXR C;  3K0L A;  3ZP5 A;  4G7H F;  2LKP A;  1Z9C A;  3C18 A;  4M6Y A;  2PN6 A;  1FSH A;  4XLN F;  2EA4 A;  2QVO A;  1TQI A;  1TW3 A;  1B1B A;  1J5Y A;  5FD5 A;  2DT5 A;  2QLZ A;  4EJW A;  2PJP A;  1ODD A;  2P5K A;  3EET A;  2P8T A;  4YIF A;  3FHZ A;  2ESN A;  1DDN A;  1XD7 A;  1MD0 A;  1Z6T A;  1XMK A;  2ZKZ A;  3RI4 A;  4ASN A;  5TRD A;  4HQE A;  4HF2 A;  1RI7 A;  3LQQ A;  2F5C A;  2MH9 A;  2K4B A;  5A2Q Z;  2O6G E;  1FP1 D;  5BMZ A;  1OYI A;  2RVC A;  4XRF A;  1MDM A;  3U9G A;  1J9I A;  4L9T A;  4L9V A;  2V1D A;  3SHF A;  1YFH A;  3I5U A;  2CGP A;  3FXR A;  2VOD A;  3WGG A;  1A04 A;  2Z5U A;  2BV6 A; 
#chains in the Genus database with same CATH topology
 5EGO A;  4CCO A;  2VE8 A;  2R7X A;  4YFK F;  2H8W A;  1B9N A;  1MJB A;  5E1Z B;  1QHG A;  1VF9 A;  5C4X J;  4CXF A;  1T08 B;  4BGD A;  2LKS A;  3E97 A;  2XF6 A;  4Y15 A;  1JTY A;  1IF1 A;  1W5C C;  4DW6 A;  5LRR A;  2M1B A;  4A3I J;  5JHF A;  4HV6 A;  1P4A A;  3CJN A;  3JR9 A;  1Z7U A;  4MEX F;  4AIK A;  3QPL A;  4BHC A;  3JRC A;  2MA3 A;  2BXY A;  1MBF A;  3A4C A;  5KK1 A;  1S6L A;  4NQW A;  3B73 A;  4GRI A;  1KQ9 A;  3KE2 A;  3JW4 A;  3OV8 A;  1SVL A;  2RKH A;  1OCO H;  1QRY A;  2F5E A;  3VOD A;  4OMZ A;  4C2T A;  3ZQC A;  2E71 A;  1SVO A;  3CTA A;  5E8G A;  1J0R A;  4ETS A;  5CVI A;  3ZMU A;  1LE8 B;  5EEG A;  3IAM 2;  2OQG A;  5K7F A;  1O3Q A;  1FTT A;  4FE4 A;  3I53 A;  3ZMD A;  3M8J A;  5GAE J;  2ZJP F;  3DCF A;  2DTR A;  1MBK A;  5F04 A;  2Z3Y A;  1FYK A;  3H9J A;  3FBN B;  2ECB A;  3BG6 A;  3LOC A;  2R5Y B;  4FE7 A;  4BE0 A;  2XB5 A;  1WJA A;  4A3L J;  2QWW A;  4XLC A;  4UUV A;  4II3 A;  3L00 A;  2VI6 A;  2NOJ B;  1QZE A;  1XMA A;  1CF7 B;  3KZY A;  2DK8 A;  5GPA A;  2PG4 A;  5HS7 A;  1FOW A;  4NHJ A;  4YRV A;  4OIN F;  5LFA A;  3CO7 C;  4YFN F;  2OTJ I;  1MBG A;  3D5S C;  3RKW A;  3BOQ A;  2EQR A;  5C3E J;  3G73 A;  1MMS A;  1MDM B;  4E7J A;  1RKT A;  2YS9 A;  5H6Q A;  3SDB A;  5KAF C;  3DQV C;  4CSW A;  3V8J A;  2BGC A;  3KP2 A;  2NS0 A;  1JTX A;  4DYQ A;  4KIT B;  1GLN A;  2VKD A;  2YU9 J;  3BR6 A;  5M5X J;  2UXN A;  2DA1 A;  2NVY J;  3CJR B;  2O0Y A;  1QNT A;  1XB4 A;  2Q2E A;  1W4M A;  3PFY A;  2Q8K A;  3IWF A;  3OIQ A;  3MAJ A;  4I09 A;  4XOR A;  2OZ6 A;  5DEQ A;  3GX4 X;  5L3G A;  1MNE A;  4MFE A;  3OSG A;  1JKP C;  2K02 A;  5LGT A;  1QPM A;  3HUG B;  3A2K A;  3ERE D;  4ABZ A;  4NQW B;  4ENJ A;  5DCM B;  1JUM A;  1IN7 A;  3CC2 I;  3FF5 A;  2O8K A;  3M9A A;  1YQA A;  3FM5 A;  1UZC A;  2F5D A;  4XRS G;  2VJJ A;  2IS2 A;  3CQZ J;  3ZQI A;  3OR1 C;  4CGZ A;  4HSR A;  5M5Y J;  3IH2 A;  3HPH A;  3K69 A;  2XUB A;  4L5E A;  2LMD A;  4F52 A;  3KEQ A;  4L9J A;  2Y69 H;  3DU6 A;  3LMM A;  3F23 A;  3FXJ A;  5ICE A;  4E7L A;  3I4P A;  3E1S A;  4DIQ A;  1VQO I;  3R61 A;  4II2 A;  1ZTR A;  2CW8 A;  2COM A;  2HPI A;  2ZCW A;  3LSH A;  4PJ0 C;  2DOA A;  2E34 A;  3JRF A;  4XBF A;  5E18 F;  5HOD A;  3SZP A;  4A3M J;  3RKY A;  4YG2 F;  3GTJ J;  1FTZ A;  3G4S I;  3PO2 J;  2XRL A;  1GVD A;  3HZJ A;  3GW2 A;  4ESB A;  3I4M J;  5CVR A;  1BW6 A;  2EFP A;  2M87 A;  2ESH A;  4Q5S F;  1IDZ A;  2DOD A;  3IH4 A;  1ETO A;  2NRA C;  2OPT A;  2LRE A;  4PZJ A;  4U7D A;  3B6A A;  3FHN A;  4P9U A;  2VUM J;  1ONV A;  4PGG A;  5JFR A;  2A6H F;  2ID6 A;  5GAH J;  1S5L C;  3EUA A;  1GV2 A;  3PO3 J;  3M8E A;  3OYB A;  2FUG 2;  2VPR A;  3TDZ C;  1S72 I;  3CD6 I;  3BR3 A;  2IS6 A;  2CW0 F;  3H0G J;  1BJZ A;  2QM3 A;  2Q1Z B;  5J6X A;  3OYA A;  2XAH A;  4HW0 A;  4L18 B;  2JN6 A;  3KP3 A;  2FBK A;  5AIQ A;  3BQZ A;  1BC8 C;  3U1K A;  4IZZ A;  1S29 A;  2QA4 I;  2D2W A;  2DMN A;  2KKO A;  3DV8 A;  1A5J A;  5FRN A;  2VJI A;  2A68 F;  1F36 A;  2JPC A;  3PNT A;  3UR3 C;  2XPV A;  2A69 F;  3CMY A;  2VQH A;  2CUF A;  5TIS C;  5HS8 A;  2QEN A;  3O2P E;  4KT6 A;  2IVM A;  2L5Q A;  1E3P A;  1KU2 A;  5FKM A;  2EIK H;  5EGO B;  2ME0 A;  3CDI A;  4EAT A;  1HQC A;  1R4N B;  3CCM I;  2E1C A;  1PJR A;  2OJE D;  1PVE A;  4A6E A;  5E1W A;  4KMU X;  3DKW A;  3DFG A;  3MFK A;  4BDY A;  3HTU A;  2V79 A;  1IUY A;  2KFD A;  3B6C A;  3RIR A;  3H3U A;  4BQA A;  3F8M A;  4UNO A;  5D5X B;  4DGW B;  3E6B A;  1LKX A;  3A03 A;  2R7F A;  1UG0 A;  3DWL E;  2KL4 A;  2FF4 A;  1DU0 A;  4J00 A;  1W0U A;  3K1N A;  4BYY A;  5D5U B;  1SMT A;  1BJA A;  3DPU A;  1MIJ A;  2M45 A;  3IC7 A;  3M8F A;  3ULQ B;  2F5F A;  4F55 A;  4OIR F;  4BE1 A;  1IRZ A;  4BY7 J;  2W48 A;  3RPU D;  2KZV A;  3DF8 A;  2OC6 A;  3SFZ A;  1LEB A;  4F91 B;  4WCG A;  1QO0 D;  3ZMT A;  4EQQ A;  3OYM A;  3HSE A;  1UEL B;  2VKE A;  2JRM A;  3GUD A;  3EUK L;  2ZME C;  1VQP I;  4HNV A;  2FBI A;  1LFU P;  1FYM A;  2FOW A;  3BCB A;  1SC7 A;  4UUT A;  2W1O A;  3BLY A;  4X1E A;  5DD8 A;  1G3S A;  2M5W A;  4OMY A;  2EFN A;  3R0A A;  4XID A;  4C3I J;  3OYF A;  3G6E I;  1NTC A;  4NB5 A;  3H92 A;  2X6Y A;  1LPQ A;  2HOA A;  4O6J A;  1LFB A;  1X4P A;  3T8T A;  4V19 K;  1N77 A;  1HDD C;  1AOY A;  2PMZ A;  4G6Q A;  1W1W E;  4E6K G;  1YS6 A;  2XAU A;  3N97 A;  5GTI C;  4RS8 A;  5J4Y A;  1D0Y A;  5KHD A;  1TT0 A;  2GLO A;  3Q5F A;  5EG0 A;  4IRI A;  5EZH A;  3I59 B;  2GQQ A;  2ACJ A;  5IP6 A;  1GUU A;  2W7N A;  1APL C;  3NAU A;  3CME I;  1UCR A;  1PP7 U;  3ZR8 X;  1U5T B;  3CJT B;  4FX0 A;  2X6X A;  4MQ9 F;  2GXB A;  3ZQ7 A;  1NK3 P;  2W00 A;  1FJL A;  5FLX Z;  1IRG A;  2ICW G;  2QGU A;  3WG9 A;  3SZT A;  3Q9S A;  3ZQQ A;  1X3Z B;  1UB9 A;  2XAF A;  1WRJ A;  4PFO A;  4KJZ A;  5CJ9 A;  2VB6 A;  2IS4 A;  2MC4 A;  5J4V A;  3KP4 A;  3JAM Z;  2VE9 A;  4P1W A;  2WB1 N;  2JA5 J;  1D1B A;  1ZRC A;  4HLY A;  1VQ4 I;  4N9H A;  5F1R A;  3G3Z A;  4TV7 A;  4ON0 A;  2X0L A;  3TOA A;  1LDJ A;  4D5C A;  2DN0 A;  2HDC A;  4IL6 C;  4BKX A;  1JJ6 C;  1K78 B;  2XGX A;  3FK6 A;  3KEY A;  2OUM A;  4JP0 A;  2IPQ X;  4Q47 A;  2HPM A;  4B09 A;  2NNN A;  4A0X A;  1KU7 A;  1VQ9 I;  3QOD A;  3K4J A;  3F9K A;  2P6T A;  3H5A A;  3BZ6 A;  2A05 A;  4IOC F;  2IA0 A;  5FO5 A;  1O7F A;  2L2O A;  1UHM A;  5F0H A;  2K85 A;  2DOF A;  2FBH A;  2LC2 A;  3VB2 A;  2YX7 A;  3VSK A;  1XTA A;  4CA0 A;  3P9C A;  3SEQ A;  2EBI A;  1MNM C;  3IWZ A;  4XKW A;  2PLY A;  2QSH X;  2WV0 A;  2DXI A;  4JX6 A;  3H0D A;  1YJW I;  1FSE A;  1U5T A;  1NK2 P;  4HST A;  3H5N A;  3RPQ A;  1H9T A;  5D6F A;  3O8G A;  4QPQ A;  3BG3 A;  3HOT A;  3OSF A;  2G7H A;  1E0E A;  5IT9 K;  3IKV A;  4Q4Z F;  1S8N A;  2EA2 A;  3WTW C;  3RKQ A;  4RGX A;  3N05 A;  3NWT A;  1ZRE A;  1YX3 A;  3RTR A;  4I98 B;  4NUB A;  5D8K B;  2HQR A;  1VQ5 I;  4UB6 C;  2L0K A;  4ZH4 F;  2VIX A;  1P4W A;  3K70 D;  2M8G X;  4A3K J;  5K1Y A;  2ZC2 A;  1L0O C;  3PUB A;  5GTH C;  2YX4 A;  3AG4 H;  1SFO J;  3GZ6 A;  2E2J J;  4KYW A;  4RB2 C;  1IXC A;  2XIG A;  3HB9 A;  2E5N A;  2MFZ A;  3S3N A;  4IKF A;  2XAJ A;  3I9V 2;  1HW5 A;  3QOE A;  2XGC A;  1HSJ A;  3LFU A;  2M3A A;  2OAZ A;  3K4C A;  2DFI A;  3BC8 A;  4HBL A;  4XSZ F;  5F1J A;  2CYY A;  4QIW N;  3J7A Y;  2L4A A;  1T95 A;  2WAD A;  1DGR M;  1Y0U A;  1XMX A;  3E6C C;  4RGU A;  3BDD A;  4IX7 A;  3GFL A;  3Q3S A;  4RA2 A;  1U2W A;  2PMZ N;  3C2H A;  3L2R A;  2OQR A;  4M3F A;  4MQV A;  5H2F C;  1DGW Y;  5D6E A;  4LLG F;  4IXA A;  3CUO A;  4I2O A;  5CVV A;  2EK5 A;  5J1R A;  1ZLJ A;  4CYC B;  1YG2 A;  2DDA A;  3HPG A;  1JUP A;  2CQX A;  2KRF A;  4OIO F;  4CCK A;  4QLC U;  3IRR A;  2KIM A;  3G71 I;  4B8X A;  4D7N A;  2GOM A;  3OWT A;  1BOA A;  3A01 B;  1GV5 A;  1V55 H;  1D3Y A;  3WGI A;  2XKP A;  4LMY A;  3CC7 I;  3D5R C;  5FKO A;  3QYE A;  2HFH A;  2HZD A;  3TO7 A;  2LKX A;  3GME A;  2KIS A;  2D5V A;  5EYR A;  2XDV A;  2KDO A;  1DUX C;  3GTL J;  3ECH A;  3ERM A;  3MKW B;  2EZK A;  1Z0X A;  3CZ6 A;  1R49 A;  3LST A;  5L3C A;  4XLH A;  5JVT A;  4LLL A;  3WU2 C;  2Z99 A;  1YTY A;  2D1V A;  4PSX A;  4YFX F;  2XAQ A;  5F64 A;  3GTK J;  4HF0 A;  1K4S A;  4K2E A;  1I27 A;  4RMN A;  1WI9 A;  2NS7 A;  5JLX A;  3OYL A;  4BQO A;  2KP6 A;  3JRD A;  4DYC A;  2R5Z A;  1VFC A;  5HLH A;  3G1M A;  4ZC3 A;  3WHB A;  3WTV C;  1QPI A;  1ZGJ A;  5EZG A;  3CC4 I;  1UHS A;  2ECC A;  2TDX A;  2X85 A;  4PGH A;  1FEX A;  3OYD A;  3MKY B;  5EDN A;  4BU2 A;  2QSG X;  3F8B A;  3TL4 X;  1QHH D;  1I5Z A;  5F0C A;  3K6G A;  2R7T A;  3BQY A;  3QWL A;  1XSV A;  4KN7 X;  2GAU A;  4NC6 A;  2Y48 A;  4LLN A;  3RQI A;  1YRN A;  4B47 A;  5ILV A;  4KIG A;  1B9M A;  1OQY A;  1Z3X A;  4LIV A;  4RGS A;  2HYJ A;  3GTO J;  2F4M B;  2GBY A;  4D1Q A;  3HXL A;  3BR1 A;  2AXL A;  1TW2 A;  1D0Z A;  2DYR H;  1HDP A;  3G1L A;  2N8G A;  4DJA A;  4IEJ A;  1MSE C;  5IYD J;  4CO8 A;  2A6E F;  2H1L A;  4PK4 A;  4ZYG A;  5ERI A;  1JKR C;  2EJR A;  3M4O J;  2R3S A;  3OIO A;  5DUI A;  3CCQ I;  1O57 A;  4D5F A;  2XGE A;  2XGD A;  4BHB A;  3CMA I;  1U5T C;  1G4D A;  3G2B A;  4IQ4 A;  3QYB A;  2CS3 A;  5IP7 J;  3TO9 A;  2VXD A;  2PJR A;  4UXN A;  4BUP A;  3V7C A;  3BCA A;  1L3L A;  3WHC A;  3PM1 A;  3AAF A;  1NG7 A;  1BC7 C;  4F92 B;  2QQ9 A;  2W24 A;  3K4B A;  3ABK H;  3NQO A;  4AVP A;  5C44 J;  4P9F A;  1FIA A;  2DMT A;  2W4S A;  4MTE A;  3OYG A;  2GZW A;  3MKZ A;  1HA8 A;  4BNC A;  3S2D J;  3HEF A;  3H36 A;  3FZV A;  5DYM A;  4AUX A;  2Z16 A;  2X6W A;  2HOE A;  3KP7 A;  4RAY A;  2LBF A;  3M07 A;  2ZXI A;  2DTZ A;  3UKG A;  3R60 A;  1Z1D A;  1I1S A;  3BG7 A;  1TTY A;  2LDU A;  2ELJ A;  5D4S A;  3BTC A;  3IRQ A;  2O8X A;  1Z21 A;  3CCY A;  4HQM A;  1WZ2 A;  4AD9 A;  2CUE A;  3KLN A;  4CCJ A;  1YX5 A;  4CDG A;  1GHC A;  1V4R A;  2EPF A;  2VPL A;  4FET A;  1SAU A;  4HA8 A;  4B1R A;  1STZ A;  1D1A A;  2JSC A;  2V9V A;  1Y8R B;  3A02 A;  4A3D J;  2LR8 A;  4G8X A;  3M1C A;  2O61 A;  4HNU A;  1F43 A;  3AL0 B;  4HX8 A;  3GVA A;  4OIP F;  4HDU A;  1TWA J;  2CV1 A;  3HUG A;  3VPR A;  5FRM A;  2RNG A;  2LVS A;  2M30 A;  1PDN C;  4MIM A;  2JQ7 A;  2EB7 A;  1FLI A;  3CCS I;  2LG4 A;  4KUM A;  3DEE A;  2MC3 A;  4R79 A;  3S1R J;  4AC0 A;  2DJN A;  3O6B B;  5F27 A;  4XMY A;  1X1P A;  2HWV A;  2AO9 A;  2XKO A;  4RLF A;  1HKQ A;  4IF4 A;  1W36 D;  2LP0 A;  2X1C A;  4EM0 B;  5TGT A;  4JQF A;  3WTZ A;  4I01 A;  1K7A A;  4XL9 A;  1W36 C;  5CQG A;  2QF7 A;  3A0H C;  4UV9 A;  5K7H A;  1P9Q C;  3MCZ A;  3EDP A;  2DO7 A;  1WHU A;  5A2Q K;  2R4G A;  2STW A;  5HLI A;  1ON2 A;  3BRO A;  2PFB A;  2L9N A;  1KYZ A;  1RPW A;  1O4X A;  3OR2 C;  2A3S A;  3PSI A;  5BNG A;  3CP2 A;  2CSO A;  2PEX A;  2OD5 A;  2CMP A;  4CZZ A;  1LB2 A;  1ULY A;  3LSI A;  2K9Q A;  2D45 A;  3S1M J;  5CVJ A;  4IRH A;  4IJA A;  2OBP A;  4BE2 A;  1VQ7 I;  3C7J A;  3H9G A;  4I0B A;  2DQR A;  2GA2 A;  4DZJ A;  3COA C;  3IP4 B;  1ZAO A;  2DMU A;  1SD4 A;  4E7Z A;  1BI0 A;  3L1P A;  3MN2 A;  3L2W A;  2DCE A;  5EEH A;  3QU6 A;  5HLT A;  1V5F A;  2Q0O A;  4A0Y A;  2HOT A;  2LFB A;  4XON A;  2JA2 A;  2P7V B;  3I56 I;  2FJ1 A;  2HQN A;  2EIL H;  3EUH A;  4IHX A;  2UXX A;  1OFC X;  2K9S A;  1BI2 A;  2VKH A;  1OCT C;  1KU9 A;  1I6H J;  3S8P A;  5ICF A;  3VYT B;  4XKC A;  4CCN A;  2DMQ A;  2DI3 A;  5FKN A;  3FKJ A;  4BS9 A;  3JRH A;  1BI3 A;  4KT5 C;  2WTE A;  3BT9 A;  2K9L A;  4IQJ A;  1ETQ A;  3W2W A;  1FT9 A;  1ETY A;  5ILS A;  3ZQF A;  2JJ7 A;  5M3F J;  1AKH B;  2DPD A;  4LB6 B;  1RR8 C;  2VC1 A;  5E17 F;  1YO5 C;  2RQP A;  3D0S A;  5ILU A;  4EEF G;  3CCV I;  1IGN A;  1X58 A;  4Y33 A;  1TL8 A;  4RAG A;  2ETH A;  2HKX A;  2RNJ A;  2LY9 A;  4A3E J;  1O3T A;  2L9R A;  2BEO A;  1HF0 A;  1JUS A;  1BL0 A;  2W84 A;  3ZN0 A;  3VWB A;  2CW7 A;  4KMF A;  2JRT A;  3VDX A;  1G3Y A;  5J47 A;  3MZH A;  1H8A C;  3U2R A;  1HW1 A;  1O3R A;  3I58 A;  3IUO A;  4J19 A;  1BOB A;  4A3B J;  1Q1H A;  2P5L C;  1GVJ A;  4M9X A;  5ICC A;  1YYV A;  4KDP A;  5AIP A;  1T38 A;  2UWM A;  4DOZ A;  4H4K C;  3X2Q H;  2HYF A;  2BY1 A;  2IEK A;  1H89 C;  5LGN A;  1ENH A;  4BEH B;  2CUJ A;  3HM5 A;  3SEZ A;  1X3W B;  2PBI A;  5FFZ A;  1LDD A;  2JMW A;  3H3Z A;  1TQP A;  1WQ2 A;  4KIC A;  4M9Z A;  4IHT A;  2M2E A;  2Y30 A;  4EJO A;  5LHH A;  4CUG A;  3K7A J;  2F2E A;  2VN2 A;  4L5I A;  1WH7 A;  4C3J J;  4ENM A;  3J81 Z;  2M34 A;  3FXQ A;  2CUZ A;  4FT8 A;  2DDB A;  4EMS A;  4WK8 F;  1A36 A;  4GYI A;  1R23 A;  3HRU A;  2RC4 A;  2R92 J;  4UUS A;  1SFX A;  1J09 A;  5HDG A;  1FZP B;  4JOM A;  2ZXJ A;  3QOP A;  2DAO A;  2LBF B;  4BXF A;  2BOL A;  2FMY A;  2PQ8 A;  4XLP F;  4ENK A;  4D9J A;  3OOP A;  3W2V A;  2F4O B;  1ETV A;  1XGO A;  3V42 A;  4H0E A;  3BG9 A;  1H88 C;  1I39 A;  3ZMV A;  4OWR B;  1G3W A;  3JRA A;  1RUN A;  2OTL I;  3AG3 H;  2DA2 A;  3J7Y J;  1ZR4 A;  1IN8 A;  2BZT A;  2FD5 A;  3CUQ B;  2HXI A;  2W85 A;  2H6C A;  2UUZ A;  2GIZ A;  2OV7 A;  3I59 A;  1JKO C;  1XCB A;  3HL2 A;  4A3C J;  5J3L A;  3RSN A;  3PL8 A;  2YR2 A;  4X0G A;  4MNU A;  4EM1 A;  3RDI A;  2VON A;  1EH7 A;  1S7A A;  5DTD A;  1TQM A;  5J40 A;  4AID A;  5ICG A;  3FM3 A;  4MFD A;  2XPU A;  2DOE A;  3E5Q A;  4HEA 2;  4EM2 A;  5JI6 A;  4W1U A;  2O3F A;  3BR0 A;  4M72 A;  1X1A A;  1IG7 A;  3GEZ A;  2FRH A;  2OZU A;  4BJ6 C;  2R7W A;  1GDT A;  2IA2 A;  2NVT J;  1WJB A;  2R7O A;  2EIJ H;  2FNA A;  2M0M A;  2GXA A;  4EV0 A;  2L9V A;  2KMU A;  3K4L A;  3AL0 C;  2EZI A;  3TED A;  1X1C A;  3NEU A;  2D1H A;  3FKI J;  3QPS A;  5F0F A;  3FXK A;  4N4O B;  1ZGA A;  3IAS 2;  1SVM A;  1OIS A;  2H6B A;  4S05 A;  2EIN H;  3S2H J;  2XF7 A;  3EUH C;  4QPO A;  4I6Z A;  3GLL A;  1VQK I;  1KZH A;  4ZDP A;  1U8R A;  1IXS B;  1ON1 A;  2I10 A;  3E7L A;  4XM3 A;  1PUE E;  3TQN A;  3TP0 A;  2EV0 A;  3VFZ A;  2EFW A;  2CFX A;  1FOK A;  4UB8 C;  1FYL A;  2VT2 A;  4UVB A;  5HS9 A;  3ESW B;  3LSR A;  3T1B A;  4ZYE A;  2MGQ A;  3OS2 A;  1OYY A;  5IY5 H;  3BWG A;  3DXJ F;  3QPT A;  2BY3 A;  1YW9 A;  3KP6 A;  1Y56 A;  3BJ6 A;  4A12 A;  4XLF A;  2ZXH A;  1RKW A;  1R71 A;  3PJR A;  3B02 A;  1SFK A;  3HGY A;  3O3K A;  2AQF A;  4BXU A;  4HNT A;  1RIO H;  4M6V A;  3W6J B;  1IN4 A;  2EWN A;  2QKM B;  4CH7 A;  1P4X A;  1Z91 A;  1G6N A;  3J7A O;  1ITY A;  3IL2 A;  1UST A;  1V5E A;  5BPD A;  1YJN I;  5E3N A;  2MAB A;  2RV8 A;  2E19 A;  2R7D A;  1FBS A;  1R4M B;  4U7B A;  1D8K A;  5DM7 F;  4FCY A;  5DCF A;  5CKT A;  2EZL A;  1VZ0 A;  2KIQ A;  5J1Y A;  4EGY A;  1T39 A;  2E1M B;  2AXT C;  2FQ4 A;  3KX2 A;  3ELK A;  3HKZ N;  1XDS A;  3I0T A;  3I71 A;  3CMM A;  2JZY A;  2QCO A;  3WTX C;  1XC5 A;  2MYS A;  2QZ8 A;  4AYB A;  1D8J A;  3BY6 A;  3DLA A;  2W25 A;  5HVQ C;  3CCE I;  1P2F A;  2WY7 Q;  1U78 A;  4FQG A;  1R1V A;  1TP4 A;  4MHG A;  3WU0 A;  2DFF A;  2VJ5 A;  3KPH A;  3IHU A;  2H09 A;  1SFE A;  2K40 A;  3OS1 A;  1DQU A;  2E5Z A;  3GBG A;  1HC8 A;  3W2A A;  2LD5 A;  4M6X A;  1HLV A;  3LFK A;  1Z05 A;  2RDP A;  4BHP A;  3ZQG A;  1F4K A;  2DMP A;  3G1O A;  4HX7 A;  4M9S A;  3BZC A;  3WTY C;  1U9O A;  3F72 A;  1BIA A;  1Y0N A;  5J8C A;  2WAQ A;  2ZB9 A;  1ZLK A;  1BR2 A;  1HCR A;  3FMS A;  2V1X A;  2XAG A;  4B3X A;  5B5E C;  5EF6 A;  5GAG J;  4JK1 X;  3WTS C;  5FJ8 J;  3OY9 A;  3I55 I;  3FIS A;  4O3M A;  1M1E B;  2M0C A;  2JK3 A;  3ZN1 A;  1ZK8 A;  1LNW A;  5DDG A;  4Y4R A;  5JHU A;  3HOU J;  3FXL A;  3ROU A;  1VQM I;  2KRH A;  2R7S A;  1EKE A;  1K4T A;  2CFO A;  1CQT A;  1WGX A;  5CPR B;  2COB A;  3LWF A;  2Z33 A;  2BW3 A;  1T0F C;  1E3O C;  1XGM A;  1MMN A;  1WH5 A;  1YIO A;  4P55 A;  4WXC A;  1GXQ A;  3PSF A;  5E8I A;  3MZ8 A;  2HKO A;  3E3V A;  2JTV A;  5DCM A;  2WBM A;  3K10 A;  1UG2 A;  5J1U A;  1YHQ I;  5D5W B;  3FDY A;  1LEA A;  3DBR B;  3T0Y A;  3CP8 A;  4F7Z A;  1EF4 A;  1Z7L A;  2PMU A;  4Y3O A;  2DW4 A;  3CCJ I;  3K2Z A;  2B63 J;  2WB1 A;  4U0V A;  1ZAR A;  3CUQ C;  4R8H A;  4NDL A;  4IHY A;  4Y17 A;  1EV7 A;  2CWE A;  2CQK A;  2M7A A;  3DTI A;  2IJL A;  4HOB A;  3TP3 A;  1IC8 A;  5LRS A;  5LLQ A;  3S93 A;  4FAS D;  3FMR A;  5BPI A;  4C2U A;  4PFP A;  4M74 A;  3HOW J;  2DA7 A;  5BOX A;  3HSF A;  1ZG1 A;  5HOO A;  2KJC A;  3BG5 A;  3P5J A;  2IBD A;  3CO6 C;  2VBW A;  5L3B A;  1TWG J;  3VSL A;  1O3S A;  2NVX J;  2XSD C;  4HF1 A;  3HSR A;  3M7G A;  2WWY A;  1T56 A;  1A6I A;  1VTN C;  4AU7 A;  1USS A;  5K5Q A;  4DBR A;  5AON A;  1RR7 A;  2W82 A;  3JRI A;  5D8L B;  1CF7 A;  1WJE A;  3P9I A;  2WA0 A;  3JCU C;  3GFI A;  2VC0 A;  2ZJR F;  1Y6I A;  2IGM A;  5E3O A;  1D1C A;  3F8F A;  4IHS A;  3EYY A;  1IN6 A;  5LHG A;  3VOE A;  1V3F A;  1W7P B;  4HAM A;  4MEY F;  4B4C A;  2XAS A;  3D1N I;  3V8K A;  3LAP A;  4ZTJ A;  2UV1 A;  3BTJ A;  4DYR A;  2FQ3 A;  4C3H J;  3PNY A;  2K3F A;  5IYC J;  1ETK A;  2M9H A;  3FXM A;  5FD6 A;  3HOX J;  1KON A;  1DP3 A;  3ECO A;  4I7H A;  1FX7 A;  3GLX A;  2IAI A;  1RZ4 A;  3F21 A;  2FU4 A;  2DA6 A;  2CQN A;  3U21 A;  4IHV A;  1YW7 A;  5JR3 A;  1WI3 A;  2QSF X;  1YW8 A;  3TGN A;  4LFU A;  4I02 A;  1NHA A;  3LAJ A;  2LRD A;  1PUF A;  1MJ9 A;  2YU3 A;  5D5V B;  2A07 F;  4A5M A;  5GPC A;  4O5V A;  3PNV A;  2DFH A;  1BI1 A;  2CG4 A;  1IRX A;  3RZD J;  2VBY A;  4NBQ A;  4UVC A;  3TW7 A;  2FE3 A;  3FWE A;  3MD2 A;  3PQK A;  4XKB A;  2OU2 A;  1VQ6 I;  3HOV J;  1HKT A;  4LIT A;  2K9N A;  2ZSH B;  1U9N A;  1IUF A;  2P7C B;  5KNL A;  3E5U A;  4G6T B;  3LNQ A;  1S9H A;  4DNC A;  2NXN B;  1HKS A;  2RN7 A;  2R5Y A;  4YII A;  1Z6R A;  4BBR J;  1U0J A;  3L09 A;  2J5O A;  2DK5 A;  2CU7 A;  4LK1 F;  3W3C A;  1X2M A;  3S1Q J;  1MND A;  3F8N A;  3A01 A;  2ZSI B;  2HEO A;  3K1M A;  1JHH A;  2VQL A;  1W7P D;  2HOS A;  1D5V A;  2GA1 A;  2L02 A;  1J2X A;  2E1M C;  4ANJ A;  1OCC H;  2K4J A;  2VL8 A;  3REO A;  2EFQ A;  2IS1 A;  1Z67 A;  3DBL B;  4Q48 A;  4Z2Y A;  1H9G A;  2R93 J;  1E2X A;  4GDF A;  2X6O A;  1F9N A;  4GO1 A;  4MTD A;  1POG A;  3DP7 A;  2NAZ A;  4XN3 A;  3M1E A;  4BQQ A;  2UZK A;  2MBF A;  4LG0 B;  3ZCO A;  3HGG A;  4PJN A;  3LQR A;  2ZJQ F;  3QP6 A;  4EGZ A;  1RES A;  1XCV A;  1TT5 B;  3L9F A;  4HPQ A;  4B48 A;  4LB5 A;  4EVI A;  3S3M A;  2R7V A;  2IP2 A;  4A3G J;  3VEP A;  4L0Z B;  3DKX A;  1K79 A;  1OYW A;  1UJ8 A;  2QKL B;  3JRE A;  1TC3 C;  2K3P A;  3K4K A;  3DTK A;  1QBJ A;  1Z77 A;  2DA5 A;  3U1D A;  2RGV A;  2V4J C;  1FBQ A;  5FRO A;  2O9L A;  1LQ1 A;  5F6F A;  3F22 A;  4AIJ A;  2L3D A;  3RKX A;  2I5U A;  2F5V A;  5M3M J;  4LK0 F;  3HRT A;  4V2F A;  2DYS H;  4M3G A;  1ZRD A;  3DU5 A;  3JAM K;  2LSO A;  2IRF G;  5LEK A;  1JGS A;  2HI3 A;  3S3O A;  2PJR B;  3S1N J;  3TBI A;  4M73 A;  2BW3 B;  1K83 J;  1R7J A;  3JSP A;  4B3A A;  3TKY A;  3JRG A;  1FY7 A;  5B1B H;  3HHG A;  3DKY A;  5FLX K;  1AWC A;  1GT0 C;  1OCP A;  1ETX A;  2IGO A;  3MQ0 A;  1R22 A;  1WPK A;  4IRG A;  5FLM J;  2H94 A;  4WXH A;  2E2I J;  4LG0 A;  2BHZ A;  1SAX A;  2ADU A;  5IP9 J;  5CYV A;  5FB2 A;  2DPU A;  2LK2 A;  2PI0 A;  5L3D A;  1FC3 A;  2LOO A;  4XQF A;  1MZB A;  1ZGW A;  3E6M A;  5J8F A;  3GO5 A;  3GTQ J;  1JE8 A;  4R1H A;  1GXP A;  3OYJ A;  4EJT A;  1TWH J;  2EV6 A;  2HYG D;  3GFM A;  3BJO A;  1KQ0 A;  2CV2 A;  1V54 H;  2XC7 A;  5FFX A;  3TO6 A;  1XG1 A;  1G2H A;  1R6R A;  1SFU A;  1BA5 A;  4ESJ A;  3ML6 A;  2MW8 A;  3ZQH A;  3W6K B;  4GGG A;  3PUF A;  2FML A;  4LIU A;  3K70 C;  2ZJ2 A;  4PJJ A;  1HXD A;  3GYH X;  2KIU A;  5CLS A;  4F93 B;  2HU9 A;  4BQN A;  2KLO A;  2XB0 X;  3DPT A;  3LSG A;  4NC7 A;  2M7B A;  4RM3 A;  1ACI A;  1I6X A;  3SYT A;  2DBB A;  3FMQ A;  2ZFU A;  2JVG A;  1R58 A;  4PJM A;  2AS5 F;  1BBY A;  2PX9 A;  1UMQ A;  4PDK A;  2ZO4 A;  5E79 C;  3R0J A;  3KCC A;  4UUS B;  4IHW A;  4GYG A;  4MLO A;  4U87 A;  4CYC A;  4D7M A;  4BXX J;  1JKQ C;  1QZY A;  4RGR A;  4RB1 A;  3J7Z I;  1PYV A;  3O8H A;  3N4M A;  1LUJ B;  4BH9 A;  2H8R A;  2HNH A;  2K9M A;  5HDK A;  2DA4 A;  4WX9 A;  4B44 A;  3HRM A;  2CJJ A;  4EJV A;  1QQI A;  1SAN A;  1UAA A;  2CRG A;  4L0Y B;  1B4A A;  4AIH A;  3SJM A;  4YEL A;  3GXO A;  4E70 A;  4EJU A;  3GTG J;  1WVR A;  3V4G A;  4ZZL A;  3MKL A;  3S2W A;  1YJ9 I;  1E3H A;  3HTS B;  3ASN H;  2MG4 A;  1LJ9 A;  1RET A;  1K6O A;  3TOB A;  2X48 A;  1OLT A;  3SXY A;  3IV5 A;  3ZRG A;  3V8L A;  1FMW A;  2Y0M A;  3WOD F;  1MW7 A;  1AHD P;  3Q9V A;  3RYR A;  1EJ9 A;  2DLL A;  2DFE A;  3OYN A;  3S16 J;  3HJE A;  2STT A;  4PUS A;  1B6A A;  2KHM A;  2HQA A;  2NYX A;  1KYW A;  2A5W A;  3HDD A;  4G94 A;  2W57 A;  2O7O A;  4B43 A;  2GWR A;  2Q2E B;  2VAS A;  2F4I A;  3HG9 A;  2JUG A;  2ELK A;  1RNL A;  4G7Z F;  3DEW A;  1UHW A;  3JSO A;  2G9W A;  1T6S A;  3F8C A;  1X1B A;  1BM9 A;  2LH9 A;  2ZBK A;  2Z9O A;  4L5J A;  2IA1 A;  2V26 A;  4HZF A;  2FA5 A;  2JT1 A;  3VYS B;  3MMY B;  1H0M A;  4JX5 A;  3Q0U A;  1XN7 A;  1YOV B;  2XSJ C;  4FTH A;  2BE5 F;  2EIM H;  3BZK A;  2F6C A;  4OU0 A;  2E7X A;  3PQJ A;  4QSH A;  4DZP A;  2DJI A;  3TW6 A;  1RUO A;  1KQ8 A;  4I76 A;  4M3D A;  5IPA A;  4RB3 C;  5FKK A;  1P7I A;  5FKL A;  3AG1 H;  3T8R A;  5E20 A;  1ZEL A;  1IV8 A;  1OJL A;  1FBU A;  2LF8 A;  2MLG A;  4YEJ A;  1ETW A;  1FP2 A;  5GP9 A;  4XSX F;  5H6R A;  1Y8Q B;  4G7O F;  3LA3 A;  3S32 A;  2XVC A;  2ELH A;  5DUK A;  3ZMS A;  1B72 B;  3F0C A;  3FX3 A;  5K5R A;  5LD2 C;  2HDD A;  3KEO A;  3JRB A;  2QYO A;  1BIB A;  2QEX I;  2ZNZ A;  2P4W A;  3OYI A;  2XF5 A;  5GAD J;  1WJD A;  4C30 A;  4LD5 A;  1NG6 A;  2NVQ J;  3HOZ J;  1J7K A;  3NRV A;  4N4N B;  4L9N A;  1EH8 A;  3HIF A;  1KA8 A;  1OMI A;  2ZNY A;  3BTL A;  3C2B A;  4MGR A;  3J81 K;  4KN4 X;  4I0A A;  4J01 A;  4WF2 A;  2YSR A;  3RQ4 A;  3ONQ A;  5HLG A;  4XRM A;  5EEA A;  2KQR A;  3K2A A;  1QZZ A;  2H27 A;  2MD5 A;  2FNP A;  4U0Y A;  2E1O A;  1X4O A;  3HYI A;  1N25 A;  1SD5 A;  3WU1 B;  1CGP A;  4HG2 A;  5LBQ A;  1D5Y A;  1YIJ I;  2HQ5 A;  2JA8 J;  2ZFW A;  5BQT A;  1R1T A;  2A5Y B;  2Y75 A;  4RDU A;  1JGG A;  2QQ8 A;  4S04 A;  1MGT A;  3CCU I;  4A5N A;  2KZG A;  1ZH5 A;  1IO2 A;  1F1Z A;  2WY8 Q;  1N78 A;  1HW2 A;  2GXG A;  2TRT A;  3RPU A;  1EH6 A;  3S14 J;  2IGK A;  4KIB A;  4BAC A;  1QGP A;  1WWX A;  3HRS A;  4NNJ A;  1Y1W J;  2HTJ A;  2QBY B;  1J59 A;  1T8I A;  3C2G A;  1I3Q J;  2DT6 A;  3I3L A;  4A3F J;  4XKV A;  1FNN A;  3QAH A;  3GFJ A;  5LEJ A;  4ENN A;  2NS8 A;  3F3X A;  4ZDL A;  3DLL F;  3CUQ A;  1TNT A;  4WWC A;  2X4H A;  3KET A;  3I54 A;  4G9Y A;  4V2G A;  4E7H A;  3CCR I;  1R5I D;  4NC8 A;  2YUS A;  1B8I A;  1MJA A;  1FIP A;  2GIV A;  2HVR A;  2VQC A;  2K7L A;  2O5R A;  1YI2 I;  2FSW A;  1A35 A;  3VYU B;  4X6A J;  1REP C;  4A3J J;  1E17 A;  2JPB A;  3OMY A;  4HRI A;  1QA6 A;  1QVU A;  1IW7 F;  2LY2 A;  1MKM A;  4JYK A;  4BL0 B;  2K5C A;  3OL4 A;  2V9K A;  4ZYH A;  3W6V A;  4GXO A;  4XLA A;  3CCL I;  4BEH A;  1ZG5 A;  4M3B A;  3H9Q A;  5M5W J;  4AM3 A;  3V7S A;  5DM6 F;  4CHU A;  1WJF A;  2FXA A;  4PJL A;  2HXO A;  2P0W A;  2WV1 A;  1OR7 C;  2A6T A;  2K27 A;  2LF7 A;  2X1D A;  2NNY A;  2A61 A;  2R7Q A;  1I50 J;  3OOU A;  4CCM A;  3OIP A;  2OCE A;  1SD7 A;  1J75 A;  3WTT C;  4C2M J;  1K6Y A;  4BJ5 C;  3PIP F;  3HKZ A;  1Y1V J;  4N0B A;  1X1D A;  2HGC A;  3A0B C;  5BS6 A;  2IW5 A;  2L7Z A;  2KT0 A;  4LOC A;  1WKM A;  3AKZ A;  3S15 J;  2KRC A;  4A0Z A;  4BBS J;  9ANT A;  1FOY A;  3GZN B;  2TCT A;  4GFB A;  5H20 A;  4HV5 A;  3MWM A;  3L2U A;  3SQN A;  1MBJ A;  2E36 A;  1HOM A;  4C9Y A;  4CCL A;  4OIQ F;  3LA2 A;  5E1X A;  1DPR A;  3RCO A;  1WCM J;  3MVP A;  5B66 C;  2P6S A;  4KFC A;  5B3S H;  3CLQ A;  4UHT A;  1YIT I;  1WSU A;  4KIS A;  4ZYD A;  1WJ5 A;  2VOP A;  1C0W A;  3WTU C;  1D0X A;  3RYP A;  1JXS A;  3S17 J;  3BR5 A;  5DD4 A;  3DTE A;  2QQA A;  1OKR A;  4ESF A;  2JVH A;  1XSD A;  4FHT A;  4I99 C;  2QBY A;  2O03 A;  4BAY A;  2L4M A;  2QUF A;  3KYD B;  2R7U A;  5HNH A;  2JSP A;  2ME6 A;  1U8B A;  2ZXW H;  3VYR B;  1XGN A;  4IPA A;  2R7R A;  1HBX G;  4AVZ A;  2G7U A;  1EA3 A;  2JWT A;  4D0P A;  1TBX A;  4RAZ A;  1R1U A;  3GZ5 A;  2HVQ A;  4YIR X;  4MO7 A;  1UFM A;  3ABL H;  4ZZD A;  3ASO H;  1OCR H;  4AYB N;  3ABU A;  1IJW C;  1MMG A;  1HST A;  1BR4 A;  5JVG F;  3RZO J;  3A1Y A;  3LA7 A;  4P96 A;  1MMD A;  1RC9 A;  4XOT A;  3HOY J;  2XHK A;  3DEU A;  3OYH A;  1OPC A;  3H35 A;  4XRS A;  3ABT A;  2OA4 A;  3NAR A;  2LNB A;  2P5V A;  1SD6 A;  2WC2 A;  4XLE A;  1X3U A;  4IVN A;  1R5H A;  4GCV A;  4PSW A;  1R9T J;  1T98 A;  3K1P A;  3L7W A;  1JT6 A;  2K86 A;  1Q1V A;  2EV5 A;  3GWZ A;  3FIW A;  1P92 A;  3SZG A;  3CF5 F;  4E7I A;  5HDN A;  1TWC J;  3P9K A;  1JHF A;  2CO5 A;  3PFI A;  2LTP A;  2Y9Z A;  2EFO A;  1BW5 A;  2BBY A;  2XRN A;  5TJJ A;  4LJZ F;  2RAE A;  3KLO A;  1U3E M;  2ISY A;  4Y7N J;  3EQL F;  1PUF B;  4F3Q A;  5ED4 A;  1W7P A;  2CQQ A;  6PAX A;  2IT0 A;  2V6E A;  4CYD A;  1VND A;  3ISP A;  2VOO A;  3GTP J;  1WJC A;  1LVA A;  4OAZ A;  4CIC A;  2VLA A;  3ABM H;  3K4M A;  1S7E A;  2ISZ A;  1ZR2 A;  1IZ1 A;  5C4J J;  2M8E A;  2RQQ A;  1ZHF A;  4P5O A;  4Z6Y A;  3L2Q A;  1RRJ A;  3ZMZ A;  5LGU A;  3KFW X;  1T2K A;  2MLK A;  4LG3 A;  4KA4 A;  1ERD A;  4E7S A;  1U6G A;  2X1E A;  3ZPL A;  1XX5 A;  3LSK A;  3ZGK A;  3CDL A;  3BP8 A;  1A6Q A;  2HZT A;  3GCM A;  3QQA A;  2IGN A;  1LFP A;  1ZG3 A;  3KZZ A;  2HTS A;  1W5T A;  2JA6 J;  2V7F A;  5CVU A;  2VJ4 A;  5DV5 A;  4JBA A;  2HR3 A;  5K5O A;  3WG7 H;  3F6V A;  3C3W A;  3FK7 A;  3LL7 A;  2V1U A;  3QP5 A;  5F08 A;  1F5T A;  2XPW A;  3HBL A;  4FX4 A;  3QRF F;  5E3M A;  2L01 A;  3FXU A;  5HNF A;  2H1K A;  2BXZ A;  2B9S A;  4BJT A;  4E7K A;  4UV8 A;  3KP5 A;  2LYC A;  2X9D A;  3WE2 A;  2DQL A;  2Z1D A;  3BPX A;  3OL3 A;  2BVM A;  4CZC A;  1B8I B;  2L7K A;  3FBI B;  3R6S A;  2C6Y A;  1B59 A;  1XSX A;  3KIO A;  3TDU C;  1SMY F;  4HX4 A;  3ZQL A;  1YS7 A;  3SDG A;  3BPV A;  4HLX A;  3BTI A;  2FOK A;  2M4K A;  1K61 A;  2CH0 A;  2EZH A;  4HYE A;  2WAQ N;  1W5S A;  3F6O A;  5IYB J;  4HDV A;  1VQN I;  1X19 A;  2NOG A;  4Y13 A;  4WXD A;  4E4H A;  2MD0 A;  1I3A A;  1O7L A;  4M71 A;  1AKH A;  3J80 Z;  2VT3 A;  4XR6 A;  3AFH A;  2L7M P;  5CQE A;  1XS9 A;  2Y0S N;  1XGS A;  2P81 A;  2GOX B;  4FIS A;  4G6D A;  5DS9 A;  5JLW A;  2V9P A;  3ZOB A;  5IT3 A;  2B0L A;  1QU3 A;  3HHH A;  4Y52 J;  3R4K A;  1MSF C;  2R0Q C;  4A6D A;  5L3E A;  1IN5 A;  3E0J B;  3E5X A;  2V6C A;  4UVA A;  5B1A H;  3HOS A;  4M3E A;  2VBX A;  2AQE A;  2L9S A;  4RAF A;  2WAE A;  3IKT A;  4N9I A;  1N75 A;  1YE9 A;  3EPZ A;  3MZY A;  1DP7 P;  3JTG A;  3D5L A;  1FOX A;  2KIF A;  2J5P A;  1ZYR F;  1TLH B;  3DBH B;  3ZXS A;  3LSJ A;  4DBQ A;  5D4R A;  1S7O A;  3EYI A;  3E6D A;  1MBE A;  1X2N A;  5EG0 B;  5LHI A;  2IXS A;  3SFI A;  5L3F A;  1YRN B;  4ZTF A;  1TWF J;  4ZJZ A;  1JI8 A;  2Z2S B;  2E1N A;  3OYK A;  1XPX A;  1FPQ A;  2MH2 A;  3FXO A;  2DA3 A;  2RRE A;  3WE3 A;  4KNY A;  4XN0 A;  3H3V K;  1BN5 A;  1OR7 A;  1ZN2 A;  1QVT A;  1R36 A;  1B72 A;  1P7J A;  5K7Z A;  2DU9 A;  4W97 A;  5EJC A;  4QWQ A;  3MEX A;  1IAW A;  1G3T A;  4IO9 F;  3UNG C;  1TZL A;  3K9T A;  1XDU A;  4QTR A;  3OYE A;  2R5Z B;  2HDW A;  3T5X A;  2ID3 A;  1YLF A;  1Y39 A;  2I8D A;  3CDH A;  3L2C A;  3J80 K;  2E60 A;  1LDK B;  1TNS A;  1P6R A;  2GM4 A;  3PIO F;  1ZQ3 P;  2CV0 A;  1KGS A;  4G12 A;  3H1C A;  3CJQ B;  4RLQ A;  3BJA A;  4KIF A;  4AWX B;  4RM2 A;  2L54 A;  2VBZ A;  3RJP A;  3I64 A;  2KDZ A;  3KYC B;  4XNF A;  5IT9 Z;  4ZDO A;  3C1D A;  1T0F A;  1S3J A;  1IRF A;  3H5R A;  3GF2 A;  2WAF A;  3LSM A;  3BR2 A;  2F48 A;  3DPL C;  3P7N A;  3LSP A;  2ZME B;  4OOI A;  3CES A;  3V7R A;  2FEZ A;  1R5G A;  4RB0 A;  1G59 A;  3QPH A;  2XRO A;  2Y9Y A;  1FWZ A;  2KJB A;  1SEU A;  2EH3 A;  1NH3 A;  2L7F P;  2VQG A;  3WGH A;  4JX4 A;  4LGW A;  2E35 A;  4IOA F;  1K78 A;  4A69 C;  3JTH A;  2CQ7 A;  1ZRF A;  2QQB A;  2V1N A;  4BDZ A;  5KVR A;  5FGM A;  2FX0 A;  1KU3 A;  2XV4 S;  3CLO A;  2YPR A;  1G8X A;  2Y0S A;  4XIC A;  3IH3 A;  4BY1 J;  1DPU A;  2BYV E;  1I1G A;  1AA7 A;  2HS5 A;  2JUC A;  2PMH A;  4PCQ A;  1MMA A;  1R00 A;  1JJ8 C;  2X51 A;  4DQ2 A;  1MH3 A;  3QU3 A;  4A2U A;  2R7Z J;  1WFX A;  2LLK A;  2MSY A;  2OCC H;  2E7W A;  3L2V A;  2HVS A;  2VXZ A;  2AHQ A;  4U0W A;  2ZME A;  2Y2Z A;  4ZYA A;  1PP8 F;  1LVK A;  4U88 A;  1IXR C;  3K0L A;  5E3L A;  3ZP5 A;  4G7H F;  4A93 J;  2LKP A;  1Z9C A;  3C18 A;  1FMV A;  1MBH A;  3OS0 A;  3HC7 A;  4M6Y A;  2PN6 A;  3CF2 A;  1FSH A;  4XLN F;  1T33 A;  2EA4 A;  4UY8 I;  2JA7 J;  2QVO A;  1VQL I;  1TQI A;  1TW3 A;  2VKV A;  1VI0 A;  4RBO A;  4OAY A;  3M3Y J;  4ITV A;  1B1B A;  1J5Y A;  3K4N A;  5FD5 A;  2DT5 A;  1VQ8 I;  3TMO A;  2QLZ A;  2Y31 A;  4EJW A;  2PJP A;  1ODD A;  2P5K A;  1OCZ H;  3QYF A;  3EET A;  2P8T A;  4XOP A;  4YIF A;  3FHZ A;  2E2H J;  3KZI C;  2NVU B;  1ZKG A;  1W0T A;  2ESN A;  1DDN A;  4S0H B;  1XD7 A;  3NWS A;  2B7E A;  3AG2 H;  1MD0 A;  3OYC A;  1MH4 A;  1Z6T A;  1XMK A;  1LE8 A;  1IDY A;  2ZKZ A;  5KCM A;  2BVL A;  3Q0W A;  4ASN A;  5TRD A;  2G0E A;  4HQE A;  3RI4 A;  3I4N J;  4HF2 A;  1JT0 A;  1RI7 A;  3LQQ A;  2F5C A;  2MH9 A;  3KYL A;  2K4B A;  1ORK A;  5A2Q Z;  2O6G E;  5IOZ A;  2DT7 B;  2OF7 A;  1AU7 A;  3GTM J;  2BY0 A;  5KAI C;  2BY2 A;  1DU6 A;  1FP1 D;  5BMZ A;  1OYI A;  2RVC A;  4XRF A;  1MDM A;  2KPM A;  3U9G A;  5FLV A;  1J9I A;  4L9T A;  1A31 A;  1Z3Y A;  2V1D A;  4L9V A;  3SHF A;  3Q0V A;  2BHY A;  1YFH A;  3I5U A;  2CGP A;  1BR1 A;  3FXR A;  2LY1 A;  2VOD A;  1IV6 A;  2M4G A;  4XK4 A;  3WGG A;  1A04 A;  2Z5U A;  1V5G A;  5IOY A;  2BV6 A; 
#chains in the Genus database with same CATH homology
 2VE8 A;  4YFK F;  1B9N A;  1MJB A;  5E1Z B;  4CXF A;  4Y15 A;  3E97 A;  1IF1 A;  5LRR A;  2M1B A;  4HV6 A;  1P4A A;  3CJN A;  1Z7U A;  4MEX F;  4AIK A;  4BHC A;  2MA3 A;  5KK1 A;  1S6L A;  4NQW A;  3B73 A;  1KQ9 A;  3KE2 A;  3JW4 A;  3OV8 A;  2RKH A;  2F5E A;  3VOD A;  4OMZ A;  3CTA A;  5E8G A;  1J0R A;  4ETS A;  5CVI A;  3ZMU A;  5EEG A;  2OQG A;  1O3Q A;  3ZMD A;  3I53 A;  2DTR A;  2Z3Y A;  1FYK A;  2QWW A;  4UUV A;  3L00 A;  1XMA A;  1CF7 B;  3KZY A;  2DK8 A;  2PG4 A;  5HS7 A;  4NHJ A;  4OIN F;  3CO7 C;  4YFN F;  3RKW A;  3BOQ A;  3G73 A;  1MDM B;  5H6Q A;  3DQV C;  3V8J A;  2BGC A;  3KP2 A;  2NS0 A;  2UXN A;  2O0Y A;  1QNT A;  1XB4 A;  2Q2E A;  1W4M A;  2Q8K A;  3IWF A;  4I09 A;  3MAJ A;  2OZ6 A;  5DEQ A;  3GX4 X;  5L3G A;  2K02 A;  5LGT A;  1QPM A;  3ERE D;  4ENJ A;  5DCM B;  1IN7 A;  3FF5 A;  3M9A A;  1YQA A;  3FM5 A;  2F5D A;  4CGZ A;  3K69 A;  2XUB A;  3KEQ A;  4L9J A;  3F23 A;  5ICE A;  3I4P A;  3R61 A;  2COM A;  2ZCW A;  4XBF A;  5E18 F;  3SZP A;  3RKY A;  4YG2 F;  3GW2 A;  4ESB A;  4Q5S F;  5CVR A;  2M87 A;  2EFP A;  2ESH A;  2NRA C;  4PZJ A;  4U7D A;  4P9U A;  1ONV A;  4PGG A;  5JFR A;  2A6H F;  3M8E A;  3TDZ C;  2CW0 F;  2QM3 A;  5J6X A;  2XAH A;  4HW0 A;  4L18 B;  3KP3 A;  2FBK A;  5AIQ A;  1BC8 C;  1S29 A;  2D2W A;  2KKO A;  3DV8 A;  2A68 F;  2JPC A;  2A69 F;  5HS8 A;  2QEN A;  3O2P E;  2IVM A;  1KU2 A;  1HQC A;  2E1C A;  4A6E A;  5E1W A;  4KMU X;  3DKW A;  3DFG A;  3MFK A;  3HTU A;  2V79 A;  1IUY A;  3RIR A;  3H3U A;  4BQA A;  3F8M A;  4UNO A;  5D5X B;  3E6B A;  2R7F A;  2FF4 A;  3K1N A;  4BYY A;  5D5U B;  1SMT A;  1BJA A;  2M45 A;  3IC7 A;  3M8F A;  3ULQ B;  2F5F A;  4OIR F;  3DF8 A;  3SFZ A;  1LEB A;  4WCG A;  1QO0 D;  3ZMT A;  4EQQ A;  3HSE A;  3GUD A;  1FYM A;  2FBI A;  5DD8 A;  1G3S A;  2M5W A;  4OMY A;  2EFN A;  3R0A A;  4NB5 A;  3H92 A;  4O6J A;  3T8T A;  1AOY A;  4G6Q A;  1YS6 A;  3N97 A;  4RS8 A;  3Q5F A;  4IRI A;  3I59 B;  2GQQ A;  2ACJ A;  1PP7 U;  1UCR A;  1U5T B;  4FX0 A;  4MQ9 F;  2GXB A;  3ZQ7 A;  1IRG A;  5FLX Z;  3WG9 A;  3SZT A;  3Q9S A;  1UB9 A;  2XAF A;  1WRJ A;  5CJ9 A;  3KP4 A;  3JAM Z;  2VE9 A;  1ZRC A;  4HLY A;  4N9H A;  5F1R A;  3G3Z A;  4TV7 A;  4ON0 A;  2X0L A;  3TOA A;  1LDJ A;  2HDC A;  1K78 B;  2XGX A;  2IPQ X;  4Q47 A;  4B09 A;  2NNN A;  4A0X A;  1KU7 A;  2P6T A;  3BZ6 A;  2IA0 A;  5FO5 A;  1O7F A;  1UHM A;  2FBH A;  3VB2 A;  2YX7 A;  3P9C A;  3IWZ A;  2PLY A;  2WV0 A;  1FSE A;  1U5T A;  3RPQ A;  1H9T A;  5D6F A;  3HOT A;  2G7H A;  5IT9 K;  3IKV A;  4Q4Z F;  1S8N A;  2EA2 A;  3WTW C;  4RGX A;  1ZRE A;  3RTR A;  4I98 B;  5D8K B;  2HQR A;  4ZH4 F;  1P4W A;  5K1Y A;  1L0O C;  2YX4 A;  3GZ6 A;  4KYW A;  4RB2 C;  1IXC A;  2XIG A;  2XAJ A;  1HW5 A;  1HSJ A;  2OAZ A;  2DFI A;  4HBL A;  4XSZ F;  2CYY A;  2L4A A;  1Y0U A;  3E6C C;  4RGU A;  3BDD A;  3GFL A;  1U2W A;  2OQR A;  4MQV A;  5D6E A;  4LLG F;  4IXA A;  3CUO A;  4I2O A;  5CVV A;  2EK5 A;  1ZLJ A;  1YG2 A;  2KRF A;  4OIO F;  4QLC U;  3IRR A;  2KIM A;  4B8X A;  1BOA A;  1D3Y A;  3WGI A;  2XKP A;  4LMY A;  2HFH A;  3TO7 A;  1DUX C;  3ECH A;  3LST A;  5L3C A;  5JVT A;  4LLL A;  2Z99 A;  1YTY A;  2D1V A;  4YFX F;  2XAQ A;  5F64 A;  4HF0 A;  4K2E A;  1I27 A;  1WI9 A;  5HLH A;  3WTV C;  1ZGJ A;  2TDX A;  4PGH A;  3F8B A;  1I5Z A;  1XSV A;  4KN7 X;  2GAU A;  2Y48 A;  4LLN A;  5ILV A;  4KIG A;  1B9M A;  4RGS A;  2AXL A;  1TW2 A;  4CO8 A;  2A6E F;  4ZYG A;  5ERI A;  2EJR A;  2R3S A;  5DUI A;  1O57 A;  4BHB A;  1U5T C;  1G4D A;  3TO9 A;  4UXN A;  3V7C A;  1L3L A;  3AAF A;  1BC7 C;  2QQ9 A;  2W24 A;  3NQO A;  4AVP A;  4P9F A;  4MTE A;  2GZW A;  4BNC A;  3FZV A;  5DYM A;  2HOE A;  3KP7 A;  4RAY A;  3R60 A;  1Z1D A;  1I1S A;  1TTY A;  2LDU A;  5D4S A;  3IRQ A;  2O8X A;  4HQM A;  4AD9 A;  3KLN A;  4CDG A;  1GHC A;  1V4R A;  4HA8 A;  1STZ A;  2JSC A;  2V9V A;  4G8X A;  2O61 A;  4HX8 A;  3GVA A;  4OIP F;  4HDU A;  3HUG A;  2M30 A;  1PDN C;  2EB7 A;  1FLI A;  4KUM A;  2MC3 A;  4R79 A;  3O6B B;  2HWV A;  2XKO A;  1HKQ A;  4IF4 A;  4EM0 B;  4JQF A;  3WTZ A;  4I01 A;  1K7A A;  4UV9 A;  3MCZ A;  3EDP A;  2DO7 A;  5A2Q K;  2STW A;  5HLI A;  1ON2 A;  3BRO A;  2PFB A;  1KYZ A;  2A3S A;  2CSO A;  2PEX A;  2OD5 A;  4CZZ A;  1LB2 A;  1ULY A;  2D45 A;  5CVJ A;  4IRH A;  4IJA A;  2OBP A;  3C7J A;  4I0B A;  2DQR A;  2GA2 A;  3COA C;  1ZAO A;  1SD4 A;  1BI0 A;  5EEH A;  3QU6 A;  2Q0O A;  4A0Y A;  2P7V B;  2HQN A;  3EUH A;  2UXX A;  1BI2 A;  1KU9 A;  5ICF A;  2DI3 A;  1BI3 A;  4KT5 C;  2WTE A;  1FT9 A;  5ILS A;  2DPD A;  4LB6 B;  2VC1 A;  5E17 F;  1YO5 C;  2RQP A;  3D0S A;  5ILU A;  2ETH A;  2HKX A;  2RNJ A;  1O3T A;  2BEO A;  2W84 A;  3ZN0 A;  4KMF A;  2JRT A;  1G3Y A;  3MZH A;  3U2R A;  1HW1 A;  1O3R A;  3I58 A;  1Q1H A;  2P5L C;  1GVJ A;  4M9X A;  5ICC A;  1YYV A;  4KDP A;  5AIP A;  1T38 A;  2UWM A;  2HYF A;  5LGN A;  2PBI A;  5FFZ A;  1LDD A;  3H3Z A;  4M9Z A;  1TQP A;  1WQ2 A;  4KIC A;  4IHT A;  4EJO A;  5LHH A;  2F2E A;  2VN2 A;  4L5I A;  4ENM A;  3J81 Z;  4FT8 A;  3FXQ A;  4EMS A;  4WK8 F;  4GYI A;  1R23 A;  3HRU A;  2RC4 A;  1SFX A;  5HDG A;  1FZP B;  2ZXJ A;  3QOP A;  2DAO A;  2FMY A;  2PQ8 A;  4XLP F;  4ENK A;  3OOP A;  1XGO A;  4H0E A;  3ZMV A;  1G3W A;  1RUN A;  1IN8 A;  3CUQ B;  2W85 A;  2H6C A;  3I59 A;  1XCB A;  2YR2 A;  4MNU A;  4EM1 A;  3RDI A;  2VON A;  1EH7 A;  1S7A A;  1TQM A;  5ICG A;  3FM3 A;  3E5Q A;  4EM2 A;  5JI6 A;  2O3F A;  4M72 A;  3GEZ A;  2FRH A;  2OZU A;  2IA2 A;  2FNA A;  4EV0 A;  3NEU A;  2D1H A;  1ZGA A;  2H6B A;  4S05 A;  1U8R A;  1IXS B;  1ON1 A;  1PUE E;  3TQN A;  2EV0 A;  3VFZ A;  2EFW A;  2CFX A;  1FOK A;  1FYL A;  2VT2 A;  4UVB A;  5HS9 A;  3T1B A;  4ZYE A;  1OYY A;  3BWG A;  3DXJ F;  3QPT A;  1YW9 A;  3KP6 A;  3BJ6 A;  4A12 A;  3B02 A;  3O3K A;  4BXU A;  1RIO H;  3W6J B;  1IN4 A;  2EWN A;  1P4X A;  1Z91 A;  1G6N A;  3J7A O;  3IL2 A;  1UST A;  5BPD A;  2RV8 A;  2R7D A;  1FBS A;  4U7B A;  1D8K A;  5DCF A;  4EGY A;  1T39 A;  3ELK A;  1XDS A;  3I0T A;  3I71 A;  2JZY A;  3WTX C;  2QZ8 A;  1D8J A;  3BY6 A;  2W25 A;  5HVQ C;  1P2F A;  1U78 A;  1R1V A;  4MHG A;  3WU0 A;  3IHU A;  2H09 A;  1SFE A;  4M6X A;  3LFK A;  1Z05 A;  2RDP A;  4BHP A;  1F4K A;  4HX7 A;  4M9S A;  3WTY C;  3F72 A;  1BIA A;  5J8C A;  1ZLK A;  3FMS A;  2V1X A;  2XAG A;  4JK1 X;  3WTS C;  4O3M A;  3ZN1 A;  1LNW A;  5DDG A;  5JHU A;  3ROU A;  3LWF A;  2Z33 A;  1XGM A;  1YIO A;  4P55 A;  4WXC A;  1GXQ A;  5E8I A;  2HKO A;  3E3V A;  2JTV A;  5DCM A;  5D5W B;  1LEA A;  3T0Y A;  4F7Z A;  2PMU A;  2DW4 A;  3K2Z A;  4U0V A;  1ZAR A;  3CUQ C;  4R8H A;  4Y17 A;  2CWE A;  1EV7 A;  2CQK A;  2IJL A;  4HOB A;  5LRS A;  5LLQ A;  5BPI A;  3FMR A;  4M74 A;  5BOX A;  3HSF A;  1ZG1 A;  5HOO A;  2KJC A;  3CO6 C;  2VBW A;  5L3B A;  1O3S A;  4HF1 A;  3HSR A;  3M7G A;  2WWY A;  1VTN C;  1USS A;  5K5Q A;  5AON A;  5D8L B;  1CF7 A;  3P9I A;  3GFI A;  2VC0 A;  3F8F A;  4IHS A;  3EYY A;  1IN6 A;  5LHG A;  3VOE A;  1V3F A;  1W7P B;  4HAM A;  4MEY F;  2XAS A;  3V8K A;  3LAP A;  2FQ3 A;  5FD6 A;  3ECO A;  4I7H A;  1FX7 A;  3GLX A;  1RZ4 A;  3F21 A;  2FU4 A;  1YW7 A;  5JR3 A;  1YW8 A;  3TGN A;  4LFU A;  4I02 A;  1NHA A;  3LAJ A;  1MJ9 A;  2YU3 A;  5D5V B;  2A07 F;  4A5M A;  4O5V A;  1BI1 A;  2CG4 A;  2VBY A;  4UVC A;  2FE3 A;  3FWE A;  3PQK A;  2OU2 A;  1HKT A;  2P7C B;  3E5U A;  4DNC A;  1HKS A;  2RN7 A;  4YII A;  1Z6R A;  3L09 A;  2J5O A;  2DK5 A;  4LK1 F;  3F8N A;  2HEO A;  3K1M A;  1JHH A;  1W7P D;  1D5V A;  2GA1 A;  2L02 A;  1J2X A;  2K4J A;  3REO A;  2EFQ A;  4Q48 A;  4Z2Y A;  1H9G A;  1E2X A;  1F9N A;  4GO1 A;  4MTD A;  3DP7 A;  2NAZ A;  3M1E A;  2UZK A;  2MBF A;  4LG0 B;  3LQR A;  3QP6 A;  4EGZ A;  4LB5 A;  1XCV A;  3L9F A;  4EVI A;  2IP2 A;  3VEP A;  4L0Z B;  1K79 A;  1OYW A;  1QBJ A;  3U1D A;  2RGV A;  1FBQ A;  1LQ1 A;  5F6F A;  3F22 A;  4AIJ A;  2L3D A;  3RKX A;  4LK0 F;  3HRT A;  1ZRD A;  3JAM K;  2LSO A;  2IRF G;  5LEK A;  1JGS A;  4M73 A;  1R7J A;  3JSP A;  3TKY A;  1FY7 A;  3HHG A;  5FLX K;  1AWC A;  3MQ0 A;  1R22 A;  4IRG A;  2H94 A;  4WXH A;  4LG0 A;  1SAX A;  2ADU A;  5CYV A;  5FB2 A;  2DPU A;  2PI0 A;  5L3D A;  1FC3 A;  1MZB A;  3E6M A;  5J8F A;  3GO5 A;  1JE8 A;  4R1H A;  1GXP A;  4EJT A;  2EV6 A;  2HYG D;  3GFM A;  3BJO A;  1KQ0 A;  5FFX A;  3TO6 A;  1SFU A;  4ESJ A;  3ML6 A;  3W6K B;  4GGG A;  2FML A;  2ZJ2 A;  1HXD A;  3GYH X;  2KIU A;  5CLS A;  3DPT A;  1I6X A;  2DBB A;  3FMQ A;  1R58 A;  2AS5 F;  1BBY A;  4PDK A;  2ZO4 A;  3R0J A;  3KCC A;  4GYG A;  1QZY A;  4RGR A;  4RB1 A;  3N4M A;  4BH9 A;  5HDK A;  4WX9 A;  3HRM A;  4EJV A;  1QQI A;  4L0Y B;  1B4A A;  4AIH A;  3GXO A;  4E70 A;  4EJU A;  3V4G A;  4ZZL A;  3S2W A;  3HTS B;  1LJ9 A;  1K6O A;  3TOB A;  3SXY A;  3V8L A;  2Y0M A;  3WOD F;  3Q9V A;  3RYR A;  2DLL A;  2STT A;  1B6A A;  2NYX A;  1KYW A;  4G94 A;  2W57 A;  2GWR A;  1RNL A;  4G7Z F;  1UHW A;  3JSO A;  2G9W A;  1T6S A;  3F8C A;  1BM9 A;  2ZBK A;  2Z9O A;  4L5J A;  2IA1 A;  4HZF A;  2FA5 A;  2JT1 A;  1H0M A;  1XN7 A;  2BE5 F;  4OU0 A;  2E7X A;  3PQJ A;  1RUO A;  1KQ8 A;  4RB3 C;  3T8R A;  5E20 A;  2LF8 A;  1FBU A;  2MLG A;  1FP2 A;  4XSX F;  5H6R A;  4G7O F;  3LA3 A;  2XVC A;  2ELH A;  5DUK A;  3ZMS A;  3FX3 A;  5K5R A;  3KEO A;  2QYO A;  1BIB A;  2ZNZ A;  2P4W A;  4LD5 A;  1J7K A;  3NRV A;  4L9N A;  1EH8 A;  3HIF A;  1KA8 A;  1OMI A;  2ZNY A;  4MGR A;  3J81 K;  4KN4 X;  4I0A A;  4WF2 A;  2YSR A;  5HLG A;  1QZZ A;  2H27 A;  2MD5 A;  2FNP A;  4U0Y A;  3HYI A;  1SD5 A;  3WU1 B;  1CGP A;  5LBQ A;  2ZFW A;  5BQT A;  1R1T A;  2A5Y B;  2Y75 A;  4S04 A;  1MGT A;  1ZH5 A;  4A5N A;  1F1Z A;  1HW2 A;  2GXG A;  3RPU A;  1EH6 A;  4KIB A;  1QGP A;  1WWX A;  3HRS A;  2HTJ A;  2QBY B;  1J59 A;  1FNN A;  3QAH A;  3GFJ A;  5LEJ A;  4ENN A;  3F3X A;  3CUQ A;  1TNT A;  4WWC A;  2X4H A;  3KET A;  3I54 A;  4G9Y A;  1MJA A;  2GIV A;  2K7L A;  2FSW A;  1REP C;  1E17 A;  2JPB A;  1IW7 F;  1MKM A;  4ZYH A;  4GXO A;  1ZG5 A;  3V7S A;  4CHU A;  2FXA A;  2K27 A;  2LF7 A;  2NNY A;  2A61 A;  1SD7 A;  1J75 A;  3WTT C;  4N0B A;  2HGC A;  5BS6 A;  2IW5 A;  1WKM A;  4A0Z A;  5H20 A;  4HV5 A;  3MWM A;  3SQN A;  4OIQ F;  3LA2 A;  5E1X A;  1DPR A;  2P6S A;  4KFC A;  4UHT A;  1WSU A;  4ZYD A;  2VOP A;  1C0W A;  3WTU C;  3RYP A;  1JXS A;  5DD4 A;  2QQA A;  1OKR A;  4ESF A;  1XSD A;  4FHT A;  2QBY A;  2O03 A;  4BAY A;  2L4M A;  2QUF A;  1XGN A;  4IPA A;  1HBX G;  2G7U A;  4D0P A;  1TBX A;  4RAZ A;  1R1U A;  3GZ5 A;  1UFM A;  4ZZD A;  3ABU A;  1HST A;  3LA7 A;  4P96 A;  2XHK A;  3DEU A;  1OPC A;  3ABT A;  2OA4 A;  2LNB A;  2P5V A;  1SD6 A;  2WC2 A;  1X3U A;  4IVN A;  1R5H A;  4GCV A;  1T98 A;  3K1P A;  3L7W A;  2K86 A;  2EV5 A;  3GWZ A;  1P92 A;  5HDN A;  3P9K A;  1JHF A;  2CO5 A;  3PFI A;  2EFO A;  2BBY A;  2XRN A;  5TJJ A;  4LJZ F;  3KLO A;  1U3E M;  2ISY A;  3EQL F;  5ED4 A;  1W7P A;  6PAX A;  2IT0 A;  4CYD A;  3ISP A;  2VOO A;  1LVA A;  4CIC A;  2ISZ A;  1IZ1 A;  2M8E A;  1ZHF A;  4P5O A;  3ZMZ A;  5LGU A;  3KFW X;  1T2K A;  2MLK A;  4KA4 A;  1U6G A;  3ZPL A;  3BP8 A;  2HZT A;  1ZG3 A;  3KZZ A;  2HTS A;  1W5T A;  5CVU A;  5DV5 A;  4JBA A;  2HR3 A;  5K5O A;  3F6V A;  3C3W A;  2V1U A;  3QP5 A;  1F5T A;  4FX4 A;  3QRF F;  2L01 A;  3FXU A;  4UV8 A;  3KP5 A;  3WE2 A;  2DQL A;  3BPX A;  3R6S A;  2C6Y A;  1B59 A;  1XSX A;  3TDU C;  1SMY F;  4HX4 A;  1YS7 A;  3BPV A;  4HLX A;  2FOK A;  4HYE A;  1W5S A;  3F6O A;  4HDV A;  4Y13 A;  4WXD A;  1O7L A;  4M71 A;  3J80 Z;  2VT3 A;  1XGS A;  4G6D A;  5IT3 A;  2B0L A;  3HHH A;  3R4K A;  4A6D A;  5L3E A;  1IN5 A;  3E5X A;  2V6C A;  4UVA A;  3HOS A;  2VBX A;  3IKT A;  4N9I A;  3MZY A;  1DP7 P;  3JTG A;  3D5L A;  2KIF A;  2J5P A;  1ZYR F;  1TLH B;  5D4R A;  1S7O A;  3EYI A;  3E6D A;  5LHI A;  5L3F A;  2E1N A;  1FPQ A;  2MH2 A;  3WE3 A;  4KNY A;  1BN5 A;  1OR7 A;  1ZN2 A;  1R36 A;  2DU9 A;  4QWQ A;  3MEX A;  1IAW A;  1G3T A;  3K9T A;  1XDU A;  3T5X A;  1YLF A;  3CDH A;  3L2C A;  3J80 K;  1LDK B;  1TNS A;  1P6R A;  1KGS A;  3BJA A;  4KIF A;  4AWX B;  2L54 A;  2VBZ A;  3RJP A;  3I64 A;  5IT9 Z;  3C1D A;  1T0F A;  1S3J A;  1IRF A;  3GF2 A;  3DPL C;  3P7N A;  2ZME B;  4OOI A;  3V7R A;  2FEZ A;  1R5G A;  4RB0 A;  3QPH A;  2XRO A;  1FWZ A;  2KJB A;  3WGH A;  4LGW A;  1K78 A;  3JTH A;  1ZRF A;  2QQB A;  5KVR A;  5FGM A;  1KU3 A;  2XV4 S;  3CLO A;  2YPR A;  1DPU A;  2BYV E;  1I1G A;  2PMH A;  2HS5 A;  4PCQ A;  1R00 A;  4DQ2 A;  3QU3 A;  4A2U A;  2E7W A;  2VXZ A;  4U0W A;  2ZME A;  1PP8 F;  4U88 A;  1IXR C;  3K0L A;  3ZP5 A;  4G7H F;  2LKP A;  1Z9C A;  3C18 A;  4M6Y A;  2PN6 A;  1FSH A;  4XLN F;  2EA4 A;  2QVO A;  1TQI A;  1TW3 A;  1B1B A;  1J5Y A;  5FD5 A;  2DT5 A;  2QLZ A;  4EJW A;  2PJP A;  1ODD A;  2P5K A;  3EET A;  2P8T A;  4YIF A;  3FHZ A;  2ESN A;  1DDN A;  1XD7 A;  1MD0 A;  1Z6T A;  1XMK A;  2ZKZ A;  3RI4 A;  4ASN A;  5TRD A;  4HQE A;  4HF2 A;  1RI7 A;  3LQQ A;  2F5C A;  2MH9 A;  2K4B A;  5A2Q Z;  2O6G E;  1FP1 D;  5BMZ A;  1OYI A;  2RVC A;  4XRF A;  1MDM A;  3U9G A;  1J9I A;  4L9T A;  4L9V A;  2V1D A;  3SHF A;  1YFH A;  3I5U A;  2CGP A;  3FXR A;  2VOD A;  3WGG A;  1A04 A;  2Z5U A;  2BV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...