3S2WA

The crystal structure of a marr transcriptional regulator from methanosarcina mazei go1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
146
Chain Sequence
GISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDERSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a MarR transcriptional regulator from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 48
structure length 146
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3s2wA00
1P4WA 2CW0F 3W6JB 2H6CA 3BPVA 4ON0A 1XCBA 4A0XA 3MCZA 3M8FA 4M9XA 3TGNA 4WF2A 1OYWA 2V6CA 2FBKA 3WTVC 2PBIA 2EB7A 3JTHA 4B8XA 2K02A 4HA8A 3FXRA 4ASNA 4HV5A 1HKQA 2HR3A 1TNSA 4ZYHA 3T8TA 2KIMA 4U7BA 3PQJA 2F5CA 1O7FA 1REPC 3JAMZ 5K5QA 3C3WA 2VBXA 4CHUA 4MEYF 4Y13A 1XSVA 5EEGA 1HSTA 2NNNA 1FPQA 4GYIA 4UXNA 3JSPA 1I1SA 3I64A 5F64A 3FWEA 1BC7C 1S29A 2VC1A 1ZAOA 2VOOA 2WC2A 1TBXA 2HZTA 4WX9A 4KFCA 2DK5A 2WTEA 1ZLJA 1DPRA 1W4MA 3KZZA 4I09A 5CLSA 1MDMB 2KJBA 3KEQA 2ZBKA 2XKPA 1YYVA 2DAOA 2DW4A 4IXAA 2CFXA 3MFKA 4OIRF 1U8RA 1XSXA 5BS6A 3J80K 2ZFWA 3B73A 3E6DA 3CUQB 4EM1A 3N97A 3BJAA 4G7OF 1G3WA 3GYHX 3WODF 3RKYA 2O0YA 1DUXC 4H0EA 3DP7A 4UNOA 1IN4A 4YG2F 2HGCA 1P6RA 4UVBA 1R00A 1Q1HA 4ENMA 3TO9A 3FX3A 2V79A 1T0FA 2L4AA 5KVRA 4L0YB 3BJ6A 2MC3A 5IT9K 5F6FA 5FFXA 4K2EA 1EH8A 1RI7A 3MEXA 3TOAA 3VOEA 3I0TA 1CF7B 3T0YA 2O8XA 2OA4A 4KICA 2MH9A 2VODA 4GCVA 2XGXA 3BP8A 3PQKA 4Y17A 4Q47A 2A3SA 2CWEA 1R22A 5L3FA 2JPBA 1E17A 4LLLA 2Z33A 3GO5A 3WGHA 4RAZA 1ZLKA 1WI9A 4A5MA 2YR2A 3ZMSA 3WE2A 3DPLC 5L3GA 1O7LA 1IN6A 5JVTA 1XN7A 3ROUA 1STZA 5BOXA 1ODDA 3K1NA 2HWVA 5HS7A 2CO5A 5HDKA 4ESJA 3WTYC 3ML6A 5BPIA 3E6MA 3HOSA 5L3EA 2V1UA 2FBIA 2ZCWA 4LG0A 3GFIA 2P8TA 2PN6A 2FQ3A 4XBFA 2A6EF 4HZFA 1FLIA 4IRIA 2EJRA 3JTGA 1IXSB 3LWFA 1UCRA 1FX7A 3ABUA 1IUYA 2Y75A 4O5VA 4I01A 4YIFA 4EV0A 3RKXA 2EFOA 3WTSC 3V8LA 2R3SA 3F21A 3O6BB 2IRFG 1D3YA 3BJOA 3IKVA 2GQQA 2AXLA 2FEZA 2OQGA 2RKHA 4BAYA 2M87A 3ZP5A 1SFXA 3R60A 2W25A 1E2XA 3SFZA 4CDGA 4QWQA 1XGOA 4ZYDA 2OQRA 4L9NA 2JZYA 3WTTC 1G3TA 5D5UB 2HYGD 5AIQA 1B59A 4UVCA 2QQBA 5CVJA 5ED4A 3W6KB 3BZ6A 3EETA 3JAMK 4RB0A 3FMQA 2G9WA 3MZYA 5E1XA 4RS8A 5ICCA 1IF1A 2EV6A 3E6BA 3ELKA 4A6EA 5LRSA 4R1HA 1P2FA 3C7JA 4L5IA 3H3ZA 2STWA 2ZNYA 3ERED 2RGVA 5ICEA 2OU2A 4KT5C 3HIFA 2DK8A 1EH6A 5DUKA 3HSFA 4BXUA 1SFUA 1BI0A 2FE3A 2EFNA 4G94A 4Q4ZF 5TJJA 4HX8A 1Z05A 3GVAA 2FA5A 5CVVA 4KMFA 4A0ZA 2CG4A 3WGGA 4O6JA 3Q9VA 1V4RA 2QBYA 4U7DA 4HX4A 2QBYB 1BIAA 2ZJ2A 2Q8KA 3KFWX 1OR7A 5LHIA 2DFIA 4HX7A 2JSCA 3DFGA 3IC7A 5F1RA 4PZJA 2EK5A 4ESFA 3I71A 3V7CA 5J6XA 3SQNA 2D1HA 2PMHA 2PI0A 4EJOA 1D8JA 5BMZA 3ZMTA 2HTSA 1IXCA 2VT3A 3BPXA 3LA3A 4G6DA 3CUQC 4N9HA 3F22A 4LLGF 4PDKA 1LQ1A 3E5XA 1MKMA 2ZO4A 3BDDA 1HBXG 1GVJA 2A5YB 2K4JA 1TLHB 4P55A 2FSWA 3K9TA 4FX4A 3IWFA 2ISZA 4ESBA 4QLCU 3C1DA 3J80Z 4BQAA 3VFZA 1HW1A 3DPTA 1FC3A 3F8CA 3QU3A 2F5FA 1HW5A 1BN5A 3E3VA 2J5PA 3P9CA 2ETHA 3WE3A 5DCFA 2CSOA 4ZYEA 3BY6A 3L2CA 4B09A 3IRRA 1YFHA 4HF2A 4I0AA 4OOIA 1RUNA 1KU7A 4AIHA 4RGSA 2XUBA 4HV6A 3MAJA 1QZYA 1IW7F 1YTYA 1KGSA 1G3SA 2W85A 1JHFA 1YO5C 2W57A 2QLZA 3FM3A 2XRNA 1XCVA 3F8MA 3LA2A 4ENKA 3E5UA 2MLGA 3U2RA 3V4GA 1FBQA 3KETA 1ZRCA 2BYVE 4I7HA 3V8JA 3ISPA 2EV5A 3PFIA 4ENJA 1IXRC 1L0OC 3ZMVA 4NHJA 2Z5UA 4KUMA 1ZG1A 4ETSA 1K78A 1LDJA 4XRFA 4RGXA 1TW2A 3QPTA 4UHTA 3HRTA 3DKWA 2STTA 4P5OA 4BYYA 2QYOA 3K2ZA 4GYGA 4GXOA 4ZH4F 3E97A 1DP7P 4N9IA 3I53A 2IA0A 3R6SA 1CF7A 2XVCA 3EUHA 3LA7A 4Q5SF 3ZMUA 4WWCA 1G4DA 2Q2EA 1YLFA 2H27A 5H6QA 4IHTA 2QZ8A 2XAFA 2DBBA 5LBQA 1K7AA 1PDNC 5ILSA 2EFWA 3MQ0A 2X4HA 1YQAA 4P96A 2IA2A 2E7XA 2IT0A 3VODA 5DD8A 2EA2A 1FWZA 2EFPA 4E70A 5L3CA 2YX7A 2IP2A 1IRGA 4MNUA 2K86A 4L18B 1SD6A 3P7NA 2XAHA 4MQVA 4A6DA 2B0LA 3MZHA 5CVUA 1FYLA 2D2WA 5E8GA 3KP7A 3SXYA 3RIRA 2ZXJA 1PP8F 5CVRA 4ZZDA 2ZKZA 1FBSA 3P9KA 1TW3A 2WWYA 1XSDA 3GXOA 2IJLA 4CYDA 4OIQF 1KA8A 3NEUA 1YW7A 2CYYA 4KNYA 2A69F 4I98B 2NRAC 3GWZA 1Z91A 3I59A 3ZPLA 2IVMA 4M71A 4HF0A 3CDHA 1KQ9A 5ERIA 4LFUA 4RGRA 4WXHA 2BEOA 1B6AA 1KQ8A 1ON2A 4XLNF 1B4AA 2X0LA 2BV6A 1JE8A 5ILUA 1CGPA 2ESHA 4U88A 4L9TA 2XV4S 1FY7A 1OKRA 3QU6A 3HRMA 2K27A 2Z3YA 3M7GA 3RPQA 2C6YA 3J81K 4OMZA 4XSXF 5JFRA 3HTUA 5DCMA 1U5TA 2FU4A 2YSRA 2LF7A 3ZQ7A 2DT5A 5FD5A 3F23A 1R1VA 4IRHA 1ZRFA 1I5ZA 1AOYA 2VN2A 4OINF 4DNCA 1IZ1A 1ZGAA 3GFLA 4I0BA 3QP6A 1Z7UA 3SZPA 2V1XA 3DEUA 2DO7A 2R7FA 4LMYA 4YFKF 2L54A 4KA4A 1KU3A 1FSEA 1AWCA 3WU1B 2MD5A 2NYXA 5AONA 5JI6A 2COMA 4A12A 3VB2A 1T38A 5LGTA 1NHAA 3WG9A 2QVOA 1LEBA 2YPRA 3WTZA 3HHGA 1FBUA 3F6OA 2O03A 1ZGJA 1J2XA 2UXXA 4CICA 2ACJA 2Y48A 1C0WA 1O3TA 2V1DA 1FOKA 3QOPA 4AD9A 1YIOA 4JK1X 4EVIA 2FBHA 5LRRA 3NQOA 2KJCA 2BGCA 2RNJA 1Z1DA 1IN8A 5D8LB 2GA2A 3CO6C 4MGRA 4HAMA 4LB6B 1EV7A 1KQ0A 1RNLA 1W7PB 3KZYA 2XIGA 3Q9SA 1P92A 2NS0A 1ULYA 2EV0A 3L09A 5E18F 5D5VB 3R0JA 5CVIA 3U1DA 1XGNA 4P9UA 5LHHA 2Q0OA 2P5VA 4KN7X 3RJPA 2RC4A 3GFMA 4M72A 1MJ9A 4EJWA 4HLXA 1SD4A 2GXGA 5HVQC 4BNCA 1W7PD 1B9MA 1S7OA 5D6FA 2FMLA 4IHSA 3FMRA 3V8KA 1LJ9A 3J7AO 2QM3A 2MA3A 3CTAA 3KP5A 4M73A 3GUDA 1OMIA 5K5RA 3LQQA 3TDUC 3CUOA 5E17F 4PGHA 3QRFF 5A2QK 5D5XB 3RYPA 1J0RA 1WQ2A 1BBYA 3ZN0A 2D1VA 1IRFA 4HW0A 4KYWA 3FM5A 2ELHA 1MDMA 1U3EM 4S05A 1BI1A 2DQRA 5HS9A 1J75A 3V7RA 1MJBA 4EJTA 3M8EA 2VXZA 3JSOA 3E6CC 2VC0A 5LHGA 4KIBA 2VOPA 2ZMEB 3B02A 4AWXB 3LAJA 4A2UA 2XASA 2QQ9A 1F4KA 2EWNA 1WKMA 1H9TA 4OU0A 2H09A 1PUEE 3M1EA 4G9YA 3FF5A 4RB2C 1LVAA 1OYIA 1S3JA 2XKOA 3GW2A 3KP2A 4IVNA 4CGZA 4RB3C 3DV8A 5DYMA 1FZPB 2HKOA 3F72A 3F6VA 3KP6A 3HOTA 4ENNA 1TQPA 2IA1A 1YS6A 3TOBA 1FP2A 1RZ4A 3T1BA 3BROA 4O3MA 3R61A 3O3KA 2W24A 4YIIA 5K1YA 1BI3A 2GIVA 4IF4A 1P4XA 2LNBA 2AS5F 2A6HF 4LB5A 1T6SA 1U78A 2E1CA 2BBYA 1HQCA 5CJ9A 2PLYA 4AIKA 2JPCA 2CGPA 1X3UA 1MJAA 2FOKA 2PG4A 1S6LA 3FHZA 1SMYF 2A61A 3O2PE 3I58A 2DPDA 1XD7A 1FYMA 5H20A 3D0SA 3K1PA 3REOA 2PEXA 5FLXZ 3ZMDA 2V9VA 4WCGA 2ZMEA 3KP4A 2F5DA 5HLIA 4I02A 4GO1A 5CYVA 1ZG5A 2O61A 2VBZA 4UUVA 1UHMA 3D5LA 3HRSA 4EM2A 1ZRDA 3GZ6A 3JW4A 1GXQA 2NAZA 3KEOA 4S04A 4MHGA 2RN7A 3WU0A 3K0LA 3WTWC 3BOQA 4BHCA 4MTDA 4MQ9F 3ECOA 4HOBA 5LEJA 5ILVA 1TQIA 3FMSA 1QQIA 2L02A 2H94A 5DV5A 3IRQA 2PMUA 1R5GA 3OV8A 3K69A 1FSHA 2P6TA 3EDPA 2WV0A 1DDNA 5FFZA 5FGMA 2E7WA 2GZWA 2Z9OA 2XHKA 3IHUA 2HFHA 3ULQB 2M45A 4DQ2A 1JGSA 1J59A 1T2KA 3H3UA 4EGYA 1H9GA 5IT3A 2XAJA 2G7UA 1H0MA 2KIFA 2DTRA 1A04A 2FRHA 1HKTA 4JQFA 2EA4A 2LSOA 1YS7A 2Y0MA 3L00A 4XLPF 2GXBA 4HQEA 3TO7A 4NQWA 2PFBA 3C18A 1HXDA 4HBLA 1YG2A 5EEHA 5FB2A 3HTSB 1FNNA 1XMAA 4ZYGA 2P5LC 1I1GA 1XMKA 2RQPA 2HYFA 4M6YA 2KIUA 3G3ZA 3LFKA 4Z2YA 3ZMZA 2HS5A 3TQNA 2VBYA 2YX4A 3T5XA 1MGTA 4G6QA 3HUGA 3I54A 1JHHA 3KP3A 5J8CA 1WRJA 3WGIA 1VTNC 3MWMA 3F8BA 1RIOH 1SD7A 2J5OA 5FO5A 3E5QA 4HDVA 5IT9Z 4Y15A 1R7JA 1IN5A 1T39A 3GFJA 1MZBA 2A07F 1LNWA 2VBWA 3KE2A 2PJPA 3GZ5A 2JT1A 1FP1D 2QENA 1ZREA 4WXCA 4KIFA 3FZVA 1BOAA 1O3RA 1HSJA 1EH7A 1T98A 5DCMB 5LGNA 2VE8A 2UZKA 5HS8A 3TO6A 3ECHA 2IPQX 1USSA 2GWRA 2DI3A 1O57A 4OIOF 4AVPA 3AAFA 4FHTA 3RPUA 5DDGA 1Z6RA 3IL2A 3R0AA 3T8RA 1V3FA 4LGWA 1B9NA 2XAQA 4YFXF 4L9VA 2ESNA 3L7WA 4P9FA 3V7SA 4M9ZA 3QPHA 2DQLA 2CQKA 5HDNA 1Z9CA 1QZZA 4L5JA 1O3QA 3VEPA 1R36A 2FF4A 1FT9A 1YW8A 4LJZF 1TNTA 1OPCA 2QUFA 4OMYA 2OBPA 4CO8A 2F2EA 2LF8A 4LK1F 2EFQA 5HOOA 1P4AA 1K6OA 1U6GA 2FMYA 4D0PA 3WTXC 5A2QZ 4IJAA 1IN7A 1ZARA 1U5TB 5LLQA 2DU9A 3U9GA 5BQTA 3P9IA 3SHFA 2Z99A 4BHBA 5TRDA 1RUOA 1ZHFA 2M5WA 2P7CB 1ZYRF 3GEZA 1FYKA 5K5OA 1KU2A 4CXFA 3EYIA 3RTRA 5ICFA 4KDPA 2LDUA 1W5SA 3EQLF 1XB4A 2HQRA 2K7LA 5AIPA 4RAYA 4KMUX 1SFEA 2VONA 2HOEA 2P4WA 2NNYA 3HSRA 5BPDA 3F8FA 2M1BA 2FXAA 2R7DA 4U0VA 3DF8A 5L3BA 3I4PA 4CZZA 4EGZA 4ZZLA 2OZUA 5J8FA 5HDGA 2IW5A 2FNPA 4EJVA 4EMSA 4HF1A 4JBAA 2H6BA 1TTYA 1J9IA 4XSZF 2XROA 1R58A 3FXQA 1SD5A 2M30A 4FX0A 1R23A 4M9SA 5JR3A 4PCQA 3FXUA 3NRVA 4L0ZB 1G6NA 1BC8C 2L3DA 1HW2A 2L01A 2GAUA 1XDUA 1KYZA 4M74A 4MEXF 5E20A 5JHUA 4HYEA 2QWWA 3LAPA 1K79A 4LK0F 5KK1A 1ZN2A 1BI2A 4HQMA 3G73A 4WXDA 3Q5FA 3CJNA 1TQMA 1ON1A 2HEOA 3ABTA 5E8IA 5ICGA 3RKWA 3CUQA 1UFMA 3KLNA 1S7AA 4UVAA 1QPMA 3HYIA 5L3DA 1KU9A 1I6XA 2ZNZA 2YU3A 2P7VB 4L9JA 1O3SA 1YW9A 1PP7U 1F1ZA 1Y0UA 4U0YA 4AIJA 1W5TA 1R1TA 3QAHA 4KIGA 3GF2A 3GX4X 1OYYA 4G8XA 1LB2A 3TKYA 1QBJA 1D5VA 1S8NA 2MH2A 1HKSA 4IPAA 1Z6TA 1R1UA 2HTJA 5D6EA 1GHCA 1MD0A 3KLOA 1ZG3A 4N0BA 3K1MA 1ONVA 2HDCA 5E1WA 4PGGA 4R8HA 1QNTA 1GXPA 1I27A 4IRGA 2HQNA 4LD5A 3TDZC 1D8KA 1J5YA 2DPUA 2VT2A 1DPUA 1UHWA 4A0YA 3L9FA 1LDDA 4HLYA 2D45A 5LGUA 4NB5A 3BWGA 3IWZA 2HKXA 3I59B 3I5UA 3CLOA 4RGUA 2PQ8A 1F9NA 2UXNA 3H92A 4Q48A 2O6GE 4M6XA 4OIPF 3J81Z 3IKTA 5D4SA 3HHHA 3ZN1A 1B1BA 4TV7A 1G3YA 1XDSA 5DUIA 1XGMA 3R4KA 2G7HA 2A68F 5FLXK 1L3LA 1BM9A 1LEAA 4LG0B 4FT8A 4RB1A 2ISYA 2E1NA 3F3XA 3DQVC 1QGPA 2KRFA 2GA1A 3GLXA 5D4RA 1R5HA 2P5KA 3CO7C 3QP5A 4KN4X 2KKOA 5LEKA 4LLNA 1SAXA 5HLGA 5HLHA 2ADUA 5E1ZB 4I2OA 1BJAA 2UWMA 3RDIA 4EJUA 2RV8A 6PAXA 5H6RA 1JXSA 1ZH5A 1WWXA 1U5TC 2RVCA 2FNAA 3LSTA 3RI4A 5D8KB 3COAC 4BHPA 2P6SA 2MBFA 4F7ZA 2OAZA 2LKPA 2RDPA 2W84A 1UB9A 1USTA 4A5NA 4MTEA 3S2WA 2MLKA 1W7PA 3KCCA 4EM0B 1LDKB 2F5EA 1BIBA 4WK8F 1SMTA 3F8NA 5FD6A 4U0WA 3HRUA 2L4MA 2M8EA 2TDXA 5DD4A 2JTVA 3SZTA 4G7HF 2O3FA 1K78B 2QQAA 1WSUA 2XAGA 2DLLA 3N4MA 4UV8A 2JRTA 4HDUA 1J7KA 5D5WB 3HSEA 2K4BA 1KYWA 2OZ6A 4UV9A 1F5TA 4GGGA 3WTUC 3EYYA 4YFNF 4G7ZF 1XGSA 2VE9A 2OD5A 3LQRA 2BE5F 3DXJF 5DEQA 3M9AA 4EQQA 1QO0D 1IAWA 3OOPA 3RYRA 1U2WA 4BH9A 4R79A
chains in the Genus database with same CATH superfamily
2CH0A 5GPCA 1P4WA 2VQLA 2V7FA 2CW0F 3W6JB 2H6CA 3BPVA 5EEAA 4ON0A 1XCBA 1R9TJ 4A0XA 4HRIA 3MCZA 3M8FA 4M9XA 3TGNA 4WF2A 1OYWA 4BJ6C 2V6CA 4C2TA 2FBKA 1X58A 3WTVC 3FXMA 2PBIA 2JVHA 3N05A 2EB7A 3JTHA 2MSYA 2GBYA 4XOPA 4B8XA 2K02A 4HA8A 2MC4A 1MMAA 1BR2A 3FXRA 4ASNA 3DPUA 2VIXA 4HV5A 4BACA 5GAHJ 1HKQA 2EIMH 4P1WA 2HR3A 1J09A 3ZCOA 2CW7A 3MKZA 1TNSA 4ZYHA 2JA8J 3Q0UA 2CV0A 3T8TA 4XN0A 2KIMA 4U7BA 3CDIA 2WBMA 3PQJA 2E36A 3S32A 2F5CA 1O7FA 1REPC 4XICA 2UUZA 3JAMZ 5K5QA 3C3WA 3SEZA 1JKQC 2VBXA 4CHUA 2DMTA 4V2GA 4MEYF 1FJLA 4Y13A 2FD5A 1XSVA 2CJJA 5EEGA 2V9KA 5F27A 1HSTA 2NNNA 1FPQA 4BUPA 5KCMA 4GYIA 2LY1A 3S8PA 4C2MJ 1FEXA 1MMNA 4UXNA 3JSPA 3A02A 1I1SA 2VKDA 3I64A 1N25A 3FWEA 1RESA 5F64A 5TISC 1BC7C 3ABKH 1MMSA 1S29A 2VC1A 1TZLA 4V19K 1ZAOA 1GLNA 1QPIA 1TWAJ 2VOOA 4W97A 1VQPI 2WC2A 1TT0A 1TBXA 2HZTA 4WX9A 4KFCA 2DK5A 2WTEA 3BC8A 2ME6A 3W2AA 1ZLJA 1DPRA 1W4MA 2LYCA 3KZZA 4I09A 5F08A 5CLSA 1MDMB 2NVQJ 2KJBA 3KEQA 1Y1WJ 2ZBKA 2WA0A 2L2OA 4HEA2 1E3PA 2XKPA 2CU7A 2JUGA 3OR2C 1YYVA 1D0XA 2DA1A 2DAOA 2DW4A 2K85A 2X6YA 3QYEA 3K10A 4IXAA 2CFXA 5K7HA 3MFKA 2X51A 4OIRF 3VYUB 1KONA 1U8RA 2XGCA 3B6CA 1XSXA 5BS6A 2KZGA 2DA2A 1QZEA 3BG3A 3J80K 2ZFWA 1W0TA 3B73A 3HUGB 3E6DA 3CUQB 3PUBA 1JT0A 4EM1A 3N97A 4GRIA 3BJAA 4G7OF 3K2AA 1JJ6C 3BQYA 1G3WA 2EZHA 3GYHX 2LH9A 3JRDA 3WODF 4I76A 1HCRA 3RKYA 2O0YA 2WB1N 2WY8Q 4E7SA 3OYCA 3MMYB 4H0EA 1UG2A 1DUXC 1ACIA 5FKMA 3DP7A 4UNOA 1IN4A 4YG2F 2HGCA 2K3PA 3NWTA 5F1JA 1SVLA 1P6RA 2P81A 4UVBA 1R00A 1Q1HA 2F4IA 1R5ID 2DFFA 4D1QA 4ENMA 3TO9A 3ZRGA 4JYKA 3PM1A 3FX3A 2V79A 1T0FA 2L4AA 5KVRA 4L0YB 3BJ6A 2MC3A 5IT9K 5K7ZA 5F6FA 1W36C 1FOXA 2F5VA 1Y1VJ 2WAFA 5FFXA 1FTZA 1Y6IA 3BTJA 4K2EA 4BY1J 4KJZA 1EH8A 5JVGF 1RI7A 3MEXA 3TOAA 1IUFA 3VOEA 3I0TA 4KT6A 1CF7B 3T0YA 2O8XA 2OA4A 4KICA 2MH9A 1ORKA 2VODA 4GCVA 2XGXA 2M2EA 1QVTA 3BP8A 3PQKA 4Y17A 3K4NA 4Q47A 2DFHA 1TWCJ 2QKLB 2A3SA 1IV8A 2CWEA 2EBIA 1R22A 3DEEA 4RLFA 5L3FA 2JPBA 4E7HA 1E17A 4LLLA 2KZVA 4QSHA 2XPVA 2Z33A 3GTGJ 3GO5A 1DQUA 2CUJA 3WGHA 2IGOA 2FOWA 4AVZA 4RAZA 1ZLKA 1R4MB 1WI9A 3CMEI 4A5MA 4A3EJ 2YR2A 1YX5A 3ZMSA 2DOFA 3ZQCA 3WE2A 3DPLC 1QA6A 1ETKA 4B47A 4NNJA 3AFHA 5L3GA 3A4CA 2LP0A 5IOZA 4E4HA 1O7LA 1IN6A 2RAEA 2Y0SN 5JVTA 4XKVA 5DTDA 1XN7A 5LFAA 3ROUA 1STZA 5BOXA 1ODDA 3PNTA 3K1NA 2HWVA 4EATA 5EF6A 1FIPA 2VPRA 1X4OA 5HS7A 4AU7A 3C2GA 2CO5A 3CD6I 5HDKA 3GTQJ 1F36A 4ESJA 3EPZA 3WTYC 3ML6A 3MKLA 5BPIA 3E6MA 3HOSA 4E6KG 5L3EA 2V1UA 2VASA 2FBIA 4BQNA 1EA3A 2ZCWA 4LG0A 4IL6C 3W2VA 2LFBA 3GFIA 2P8TA 2PN6A 4FE4A 2FQ3A 4XBFA 2A6EF 3BR2A 1ETOA 5CQGA 3SJMA 4HZFA 3BCAA 5FRMA 2AQFA 1OCRH 1FLIA 2LKSA 4RMNA 4IRIA 2EJRA 2OCEA 3JTGA 2XC7A 1IXSB 3LWFA 1UCRA 3CLQA 4RLQA 5CPRB 1FX7A 2ZFUA 3ABUA 3JCUC 1IUYA 2Y75A 1JUMA 4O5VA 1QVUA 4I01A 4YIFA 4EV0A 3RKXA 2JA6J 2EFOA 3WTSC 4I99C 3V8LA 3IH2A 4IHVA 2R3SA 3F21A 3O6BB 2BHYA 2IRFG 1D3YA 1VQ8I 3BJOA 3S1RJ 3IKVA 2GQQA 5FJ8J 4PSXA 2AXLA 2R92J 2FEZA 2OQGA 2RKHA 4BAYA 3OYJA 2GOMA 2M87A 3ZP5A 1VNDA 4HG2A 1SFXA 1W0UA 3A01B 3R60A 2W25A 2E2HJ 1E2XA 3SFZA 4CDGA 2DA7A 1H88C 3ONQA 3GMEA 3CF2A 4QWQA 1XGOA 3G4SI 4IHXA 4ZYDA 2OQRA 1D0YA 4L9NA 2JZYA 3WTTC 1G3TA 5D5UB 4DZJA 2HYGD 5AIQA 1B59A 1D1CA 4UVCA 2QQBA 4XOTA 5CVJA 2B9SA 1WJFA 5ED4A 3W6KB 3BZ6A 3EETA 2CW8A 1I50J 5M3MJ 2KPMA 3JAMK 3G1OA 1VF9A 3IAS2 1UAAA 4DZPA 2Y2ZA 2KRCA 2M8GX 3FMQA 3QYBA 4RB0A 2L5QA 1H89C 1YITI 3M07A 2G9WA 3FIWA 3MZYA 3VWBA 2X1DA 3HOZJ 2XF5A 3FXLA 5E1XA 4RS8A 1OR7C 3RCOA 5ICCA 1IF1A 2EV6A 3EUHC 2FUG2 3E6BA 3ELKA 1ZR4A 2ID3A 3K70C 3CESA 4A6EA 5LRSA 4R1HA 1P2FA 3B6AA 2QQ8A 3C7JA 4L5IA 3H3ZA 3KYDB 2STWA 3OYLA 3H3VK 3HKZA 2ZNYA 3CCEI 3ERED 1K4SA 3AG3H 2A05A 3BLYA 1HDDC 4BGDA 2RGVA 1ENHA 5ICEA 1QU3A 2OU2A 4XRSA 4KT5C 5E3LA 3HIFA 3BTLA 1BJZA 2DK8A 4IQJA 1EH6A 5DUKA 3HSFA 4CCLA 3UKGA 4LG3A 4E7ZA 4BXUA 1SFUA 2WV1A 1BI0A 2FE3A 4RAGA 2EFNA 4CUGA 4G94A 4E7KA 4Q4ZF 3MZ8A 5E3OA 2LLKA 1Z3XA 5TJJA 4HX8A 1Z05A 3HGGA 1BL0A 4BS9A 4B3AA 1JTXA 3GVAA 2FA5A 4GDFA 3DKYA 5CVVA 4KMFA 4A0ZA 3PIOF 2ZJRF 2ZJPF 2CV2A 1XC5A 2CG4A 3WGGA 4O6JA 2HPIA 1S9HA 3Q9VA 2E35A 2A5WA 1V4RA 2QBYA 4U7DA 1M1EB 1DGWY 4HX4A 2QBYB 1BIAA 5K7FA 5J1UA 2KISA 3NAUA 1Y0NA 2ZJ2A 2Q8KA 4C3JJ 3KFWX 1OR7A 3GLLA 4J19A 3S14J 5LHIA 1D1AA 2V26A 2DFIA 3DTKA 4HX7A 2JSCA 5M3FJ 2OUMA 3DFGA 3IC7A 5F1RA 3OS1A 2VLAA 4PZJA 2IXSA 2EK5A 1ZELA 4ESFA 2EINH 1EJ9A 3I71A 2AHQA 3V7CA 5J6XA 3L2VA 2L9VA 1K61A 1GV5A 2BW3B 3SQNA 2D1HA 2PMHA 1RR8C 1V5EA 2PI0A 1EKEA 4EJOA 4BDZA 3RKQA 1ZGWA 1D8JA 5BMZA 3ZOBA 3ZMTA 2HTSA 3CJTB 2JK3A 2CUZA 1IXCA 3PO2J 2X6OA 4F92B 2VT3A 1OCTC 1A36A 3DBLB 3BPXA 4NQWB 3OL4A 1WJCA 3JRHA 3BG9A 2V4JC 3LA3A 4G6DA 3CUQC 4N9HA 1Q1VA 1G2HA 2EILH 3LSMA 3AG1H 3F22A 1IC8A 3QQAA 4LLGF 1K6YA 4PUSA 3DTIA 1GT0C 4PDKA 2COBA 1LQ1A 2HQAA 1YOVB 3E5XA 3PO3J 3DEWA 3QWLA 3SDBA 1AKHB 1MKMA 2ZO4A 3BDDA 1VQ4I 1X1DA 1HBXG 1OFCX 1GVJA 1WFXA 2A5YB 2K4JA 5GAEJ 2HOTA 1TLHB 4P55A 2FSWA 3K9TA 4FX4A 3IWFA 3TW7A 3CMMA 2ISZA 4ESBA 2Y0SA 3D5SC 2PJRB 1QRYA 2NVYJ 3FK7A 4QLCU 5F04A 3C1DA 3UR3C 1LE8B 4E7IA 3H1CA 3J80Z 2BZTA 4BQAA 4AIDA 3VFZA 4GFBA 1HW1A 3F8CA 1FC3A 3DPTA 3QU3A 1FOWA 2R7WA 2BHZA 2F5FA 4V2FA 4A3KJ 1HW5A 2ZSIB 2DA5A 1BN5A 2QCOA 1TWGJ 3E3VA 5HODA 1NG7A 4B4CA 2J5PA 3P9CA 2ETHA 4XKWA 2K9MA 3WE3A 5DCFA 3OY9A 1TWFJ 1GV2A 2CSOA 3J7ZI 4HNTA 4ZYEA 4IX7A 3KYLA 2M7BA 3BY6A 3L2CA 3W3CA 4A3GJ 3VYTB 4LITA 3G1MA 4B09A 3IRRA 1YFHA 1OCZH 3TP0A 4CH7A 4FTHA 4HF2A 3BG7A 1X2NA 1F43A 4I0AA 2CS3A 4OOIA 5EDNA 1RUNA 2DMQA 2E1MB 1KU7A 2R7XA 4CCMA 4AIHA 3MD2A 4RGSA 1MBHA 2BXZA 2H8WA 2VKVA 2XUBA 3S17J 4HV6A 3MAJA 1QZYA 4BE1A 4IEJA 1UELB 1T33A 3JREA 3OYKA 3TL4X 1IW7F 3BTIA 2IS2A 1FMWA 1U8BA 1HDPA 4X0GA 1YTYA 4D5FA 4XLFA 1PUFB 3CMYA 1ETVA 1E0EA 2IS4A 3LL7A 2JMWA 1KGSA 1G3SA 3KYCB 1I3QJ 2W85A 5HNHA 3SYTA 3OS2A 3JRAA 1JHFA 1S5LC 2VKHA 3ERMA 4RM2A 1YO5C 1WPKA 2W57A 3W6VA 1WZ2A 1WH5A 2R7ZJ 3PIPF 2QLZA 1LUJB 3FM3A 2HQ5A 1AA7A 2XRNA 1XCVA 3F8MA 3LA2A 3FBNB 3E5UA 4D7NA 4ENKA 4ZTJA 2MLGA 3U2RA 1NK2P 2R5ZB 3V4GA 2WADA 1QHHD 1FBQA 4BKXA 3KETA 1ZRCA 2BYVE 1JKOC 1WJDA 2WB1A 4I7HA 4RAFA 3V8JA 3ISPA 2EV5A 3PFIA 3DU5A 2ZJQF 2X6XA 4ENJA 3VSLA 5J4VA 1IXRC 3CC4I 3VDXA 3IH3A 4BQQA 3HOVJ 4BJ5C 1L0OC 3H5RA 3ZMVA 2HU9A 2DDAA 4NHJA 1SANA 2NVXJ 2Z5UA 4KUMA 1WJ5A 1ZG1A 4ETSA 1K78A 2VJ4A 1LDJA 1LE8A 2HDDA 2KHMA 4XRFA 4RGXA 3OSFA 1TW2A 2ZMEC 3QPTA 4UHTA 5E3MA 2PJRA 1TL8A 1IJWC 2HDWA 3AG4H 3HRTA 2QGUA 1JJ8C 2VQCA 3DKWA 2STTA 4P5OA 4BYYA 2QYOA 3BZKA 3K2ZA 4GYGA 4GXOA 2FX0A 4ZH4F 2GM4A 2XSJC 3E97A 3BR6A 2L7FP 1DP7P 4N9IA 3I53A 2OC6A 2IA0A 2W1OA 3H9JA 3R6SA 1CF7A 2XVCA 3EUHA 3LA7A 4Q5SF 4JX5A 3WG7H 2MFZA 3ZMUA 4WWCA 1G4DA 4CYCA 4DBQA 3DTEA 2Q2EA 1YLFA 4PJJA 1BA5A 2GOXB 2H27A 2VPLA 5H6QA 4IHTA 2O8KA 1JTYA 2QZ8A 2XAFA 2DBBA 2ELKA 4A3CJ 5LBQA 1K7AA 1QHGA 4JOMA 1PDNC 5ILSA 3E1SA 4BY7J 1ZTRA 3X2QH 2EFWA 5EZHA 3L2QA 3S3MA 3MQ0A 2XF7A 3OWTA 2X4HA 1YQAA 1HA8A 4P96A 2IA2A 2E7XA 3QODA 2IT0A 3S2DJ 3VODA 5DD8A 1YX3A 3HM5A 1WHUA 3L2RA 2EA2A 2OPTA 4MFEA 2DJIA 1FWZA 2EFPA 2ME0A 2QKMB 1JKRC 3HGYA 2IEKA 4E70A 5L3CA 2YX7A 2IP2A 2KL4A 1IRGA 4MNUA 2DMUA 2K86A 4L18B 2LBFB 2NS8A 1SD6A 3BR5A 3P7NA 2XAHA 4MQVA 5J1RA 2A6TA 2R5YB 3IH4A 2YU9J 4A6DA 1POGA 2B0LA 3OYBA 3MZHA 5CVUA 1FYLA 2D2WA 1MBKA 2XPUA 5E8GA 1UHSA 3KP7A 2K9NA 3SXYA 2DFEA 3RIRA 2ZXJA 1K83J 4XMYA 1PP8F 2ECCA 5B5EC 4E7LA 5CVRA 3CQZJ 4ZZDA 2ZKZA 1FBSA 4A69C 3P9KA 1YJ9I 2QA4I 1TW3A 4UUSB 1V54H 4XRSG 2DCEA 2WWYA 4DW6A 4LIUA 1WI3A 1XSDA 3GXOA 2IJLA 2WY7Q 3OYHA 4ITVA 4CYDA 1X3ZB 2BY3A 2ZXWH 3LNQA 2XSDC 4OIQF 1KA8A 2ZXHA 2QF7A 3NEUA 1YW7A 2HZDA 1RR7A 2CYYA 3HJEA 3ZQHA 1LFBA 2LK2A 1JKPC 5E79C 4KNYA 2A69F 1IDZA 2B63J 3H5NA 4I98B 2NRAC 3DBRB 2DOAA 3GWZA 1MBFA 2IAIA 1Z91A 1MBEA 3I59A 2K5CA 3ZPLA 2IVMA 4U87A 4M71A 3DU6A 4HF0A 3CDHA 3CCQI 1WH7A 1KQ9A 5ERIA 1OCPA 1X1CA 2DYSH 4LFUA 4RGRA 4WXHA 2BEOA 1B6AA 1KQ8A 1ON2A 2KDZA 2N8GA 3F9KA 3ZQLA 1A35A 4XLNF 1B4AA 4A3LJ 1RETA 2X0LA 2BV6A 1JE8A 1Z0XA 5ILUA 1CGPA 2ESHA 4B1RA 1JGGA 3HOYJ 1FMVA 3NARA 4U88A 4L9TA 1U9NA 3PSIA 3I55I 2XV4S 1RPWA 3BG6A 1FY7A 1OKRA 4CZCA 2RREA 3QU6A 3HRMA 2K27A 5B66C 3AKZA 2Z3YA 2BVMA 5EZGA 3S16J 5J47A 3CZ6A 3SZGA 2JQ7A 3E0JB 3M7GA 3RPQA 2C6YA 3LSRA 3J81K 4OMZA 4XSXF 2X9DA 3CMAI 5JFRA 3HTUA 5DCMA 1AU7A 1U5TA 2AO9A 2FU4A 2YSRA 3SDGA 2LF7A 3ZQ7A 2DT5A 5FD5A 3F23A 5B1BH 1R1VA 2VI6A 4IRHA 3FISA 1ZRFA 1I5ZA 1VZ0A 1AOYA 2VN2A 3A1YA 4OINF 4DNCA 1IZ1A 1ZGAA 3GFLA 4I0BA 3QP6A 1VQ5I 1Z7UA 3SZPA 2V1XA 3DEUA 3ASNH 1E3OC 2DO7A 3HZJA 4DYRA 4F3QA 2R7FA 4LMYA 4YFKF 4QIWN 5GTHC 3DLLF 4BE0A 3CCSI 2R5ZA 2I5UA 3FDYA 2BY0A 1V5FA 2L54A 4KA4A 1KU3A 1XMXA 1FSEA 1AWCA 3WU1B 4XRMA 2MD5A 2NYXA 3BT9A 5AONA 5JI6A 2COMA 4A12A 2E1MC 2HNHA 3VB2A 1Y8RB 1T38A 1B8IA 3PNYA 5LGTA 1NHAA 4HPQA 2QVOA 4PJLA 3WG9A 2DA6A 2YPRA 1LEBA 4B48A 3WTZA 3HHGA 1FBUA 4PFPA 3F6OA 2O03A 4M3GA 1ZGJA 1J2XA 2UXXA 3CCYA 4CICA 2ACJA 3Q0WA 3K4MA 2Y48A 1C0WA 4X6AJ 1MBJA 2ID6A 1O3TA 2V1DA 4UB8C 5GP9A 1FOKA 4PJ0C 2DN0A 2V1NA 1YIJI 2D5VA 3QOPA 2MGQA 2DOEA 2R93J 2K9SA 4BJTA 4A3DJ 2Q1ZB 1T95A 4AD9A 1YIOA 1YJNI 2F4MB 4JK1X 4ZC3A 5IP9J 3IAM2 4EVIA 2FBHA 5LRRA 3NQOA 3HXLA 1UG0A 2KJCA 2BGCA 2RNJA 1Z1DA 1IN8A 2R7SA 3QPLA 1TT5B 3K4BA 3RZOJ 5IPAA 5D8LB 1X1AA 2GA2A 4XONA 4MGRA 4HAMA 3CO6C 2O7OA 1VQNI 4LB6B 2NVTJ 2V6EA 1EV7A 4Y7NJ 4FASD 1KQ0A 1RNLA 1W7PB 3KZYA 5JLXA 4ZJZA 1TC3C 2XIGA 3NWSA 2HPMA 1MH3A 3Q9SA 5J1YA 5EG0B 3G71I 2E71A 3BQZA 1P92A 2AXTC 2NS0A 3HG9A 1ULYA 2EV0A 5M5YJ 3JRCA 3L09A 1X4PA 2LY2A 2TRTA 4CCNA 5E18F 2W4SA 4A3BJ 4E7JA 5D5VB 3R0JA 5CVIA 3U1DA 2NOJB 1XGNA 4P9UA 5LHHA 4Y52J 3QYFA 2H1KA 3H0DA 2YUSA 1IV6A 3GTPJ 2Q0OA 2DXIA 2P5VA 2XDVA 1JUSA 4KN7X 3RJPA 1SC7A 2RC4A 2BY1A 3GFMA 4M72A 1MJ9A 4EJWA 1VQLI 1DGRM 1SD4A 4HLXA 3VYRB 2GXGA 2DMPA 2Y31A 5HVQC 4BNCA 2ELJA 3MKYB 1N75A 3LSHA 4HNVA 3BR3A 3ABLH 1SVMA 1B9MA 1W7PD 1S7OA 5D6FA 2FMLA 5C3EJ 4IHSA 2X48A 4JX4A 3AL0C 1AKHA 1Z77A 3FMRA 3V8KA 2VQHA 1LJ9A 2GIZA 1WJAA 1YRNA 3J7AO 2QM3A 2MA3A 3CTAA 4NUBA 4BXFA 3KP5A 4XQFA 3LFUA 2OCCH 4M73A 3GUDA 1OMIA 5K5RA 3LQQA 2E2JJ 4A3MJ 2IGKA 3TDUC 3CUOA 3JRBA 5E17F 4PGHA 5B1AH 5A2QK 3QRFF 5D5XB 3RYPA 1J0RA 1XX5A 1WQ2A 3K4JA 1BBYA 3ZN0A 2D1VA 3KIOA 1IRFA 4NC7A 1VQ7I 2JA5J 4HW0A 1N77A 4KYWA 2XGEA 1S72I 3FM5A 2BW3A 2E2IJ 1EF4A 2W82A 3H35A 2R4GA 1VQKI 2ELHA 5IP7J 1K4TA 2Y30A 3FXOA 1MDMA 1ZK8A 4S05A 1BI1A 2DQRA 5HS9A 1U3EM 3TBIA 1J75A 3V7RA 1MJBA 4EJTA 3M8EA 2BVLA 2VXZA 3BTCA 3JSOA 3E6CC 2DA4A 4HNUA 1T56A 2VC0A 3OYIA 5LHGA 4KIBA 2VOPA 2ZMEB 3HPHA 3B02A 4AWXB 3LAJA 3S1MJ 4A2UA 4I6ZA 3I56I 2XASA 4XLHA 3RQIA 2BXYA 2QQ9A 2MYSA 1F4KA 2EWNA 1WKMA 1H9TA 1BW5A 3K7AJ 2LY9A 5EGOB 4OU0A 2H09A 2PMZA 1PUEE 3G6EI 1BR4A 4EEFG 3M1EA 4G9YA 3O8GA 3S1NJ 3FF5A 3M1CA 3KPHA 2OTJI 4RB2C 3VPRA 4DOZA 3WHBA 1LVAA 3RSNA 1IGNA 1MNDA 1OYIA 1S3JA 2XKOA 3GW2A 3KP2A 4IVNA 4CGZA 3FXJA 4RB3C 3DV8A 5DYMA 1FZPB 2HKOA 3F72A 5GTIC 3F6VA 3KP6A 3HOTA 4ENNA 4BE2A 1TQPA 2IA1A 3CJQB 1YS6A 2CMPA 4A93J 3TOBA 2VXDA 1H8AC 1FP2A 3QOEA 2M4GA 1RZ4A 3T1BA 3BROA 4O3MA 3R61A 5FKNA 3O3KA 1W5CC 2LMDA 2W24A 4YIIA 5K1YA 4F91B 2FQ4A 1BI3A 5DS9A 2GIVA 3ZGKA 4IF4A 1P4XA 2LNBA 2ZXIA 2AS5F 1ITYA 3QPSA 4XLAA 2A6HF 4LB5A 2WAEA 1T6SA 1U78A 2E1CA 2BBYA 3OS0A 1VFCA 1HQCA 5CJ9A 2PLYA 4AIKA 3S3OA 4L5EA 3V42A 2JPCA 2E5ZA 2CGPA 3GTKJ 1X3UA 3FXKA 4XLEA 4C3IJ 1MJAA 2VJIA 3CC7I 2FOKA 2PG4A 1S6LA 4CCKA 3FHZA 1SMYF 2A61A 2JSPA 3O2PE 4FE7A 3I58A 2DPDA 4ZDLA 3OYEA 4XK4A 1XD7A 1SFOJ 1FYMA 4XIDA 1OCCH 1DU0A 2W7NA 1I39A 5H20A 2WAQA 3HOUJ 3D0SA 3A01A 5KHDA 2MW8A 3K1PA 3VSKA 3SFIA 4A3IJ 2K9LA 3REOA 3ZR8X 4JX6A 1RKTA 2PEXA 1IO2A 3PUFA 5FLXZ 4AUXA 4HSRA 3ZMDA 2V9VA 4M3DA 4D5CA 2ZMEA 3KP4A 1G8XA 2F5DA 4WCGA 2X1CA 5HLIA 5IYDJ 4I02A 4GO1A 3CCLI 5CYVA 1I3AA 1ZG5A 3BR1A 2O61A 1WJBA 3PFYA 4AYBN 2NS7A 2VBZA 4UUVA 1UHMA 3D5LA 1R49A 1VI0A 3HRSA 4EM2A 2R7UA 1ZRDA 3GZ6A 4BBRJ 3JW4A 4RM3A 5GAGJ 1GXQA 2NAZA 2R7OA 3E7LA 1WVRA 2M7AA 3KEOA 4MIMA 1X1PA 4S04A 4MHGA 2RN7A 3WU0A 3K0LA 4X1EA 3WTWC 3BOQA 4BHCA 2HXIA 2DA3A 3IV5A 2AQEA 2ECBA 3HKZN 2PMZN 2UV1A 4MTDA 4MQ9F 2RQQA 3L2WA 3K6GA 3ECOA 4HOBA 5LEJA 5ILVA 1TQIA 2XRLA 3FMSA 1QQIA 1R6RA 2L02A 5F0FA 2H94A 5DV5A 1D5YA 3J7AY 4BXXJ 3IRQA 2PMUA 2KLOA 1R5GA 1XS9A 3OV8A 3Q0VA 3K69A 4JP0A 1FSHA 5HLTA 2VUMJ 1TWHJ 2P6TA 1OISA 1OJLA 3EDPA 3ZXSA 3CJRB 1ETYA 2WV0A 1X2MA 1DDNA 5FFZA 3CP8A 4CSWA 1PVEA 5FGMA 1B72A 2E7WA 2GZWA 5TGTA 2I10A 3I3LA 2R7RA 1Z21A 1ETXA 2Z9OA 2XHKA 2LVSA 1V5GA 3ZQGA 3IHUA 5KNLA 5EGOA 3CF5F 2HFHA 2E34A 3ULQB 2EQRA 2M45A 4DQ2A 3DWLE 1JGSA 1J59A 1B72B 1T2KA 1W1WE 3H3UA 3OL3A 3OR1C 2LG4A 1U9OA 2DYRH 4AM3A 4EGYA 1H9GA 5IT3A 2XAJA 3DCFA 4NC6A 2G7UA 4BEHA 2L7MP 3MKWB 3CCJI 2KIFA 2DTRA 3JRGA 1H0MA 1A04A 2FRHA 5JHFA 1HKTA 4JQFA 2EA4A 2LSOA 2DTZA 1YS7A 2Y0MA 2OTLI 3L00A 4XLPF 3FHNA 2GXBA 2E1OA 2FJ1A 4HQEA 1UJ8A 1P7JA 2QSFX 3OOUA 2X1EA 3TO7A 1X1BA 1P7IA 4NQWA 2HOAA 2PFBA 1RKWA 3C18A 1HXDA 4HBLA 1YG2A 1D1BA 5EEHA 5FB2A 3HTSB 1FNNA 1XMAA 4ZYGA 5C44J 2P5LC 3Q3SA 4IOCF 1SFKA 3CCUI 1I1GA 4YIRX 1GUUA 3KX2A 2JN6A 2F6CA 3TEDA 3I4NJ 2LR8A 1NTCA 1XMKA 1A5JA 2RQPA 4D7MA 2HYFA 3HPGA 1WJEA 2KIUA 3G3ZA 2NOGA 3LFKA 4M6YA 4Z2YA 2CV1A 3ZMZA 2LOOA 4B44A 2HS5A 3TQNA 2VBYA 2YX4A 3T5XA 2LTPA 3M8JA 1N78A 1MGTA 4G6QA 3HUGA 3I54A 1YRNB 1JHHA 2HVSA 3RPUD 1S7EA 3KP3A 2G0EA 2IGMA 5J8CA 1BOBA 1WRJA 3WGIA 1VTNC 3MWMA 3F8BA 1RIOH 1SD7A 2J5OA 5FO5A 3H0GJ 3E5QA 1G59A 4HDVA 1JI8A 2ZB9A 5IT9Z 2OJED 4Y15A 1YI2I 1R7JA 3OIQA 1IN5A 2CQ7A 5C4XJ 1T39A 3GFJA 1MZBA 3H36A 5HNFA 2IGNA 2A07F 3GTOJ 1LNWA 2VBWA 3KE2A 2PJPA 5J4YA 3GZ5A 3FKJA 2JT1A 1FP1D 4CCOA 1SAUA 2L7KA 2QENA 3HL2A 1ZREA 5KAIC 4WXCA 4KIFA 3FZVA 4XR6A 4PJNA 3HC7A 2DDBA 4J01A 2M0MA 1BOAA 1O3RA 2O5RA 1HSJA 1EH7A 2HOSA 2K9QA 1T98A 4DIQA 5DCMB 2BY2A 1MIJA 5GADJ 5LGNA 2EZKA 2VE8A 2UZKA 5HS8A 2H1LA 3TO6A 5EG0A 3ECHA 2IPQX 1USSA 2GWRA 2DI3A 1O57A 4XLCA 4AVPA 3AAFA 4OIOF 3PNVA 2I8DA 1HLVA 1LFUP 4FHTA 1YJWI 3RPUA 5DDGA 3CCRI 2ICWG 1Z7LA 9ANTA 1Z6RA 3IL2A 3R0AA 3T8RA 1V3FA 4LGWA 3S1QJ 3LMMA 1B9NA 2XAQA 4C9YA 3O8HA 4YFXF 2EIKH 2L9NA 4L9VA 3S93A 1Z67A 3DLAA 2ESNA 1JUPA 1U0JA 3L7WA 4II2A 3K4LA 3OIPA 3K4CA 4P9FA 3CC2I 1T08B 3V7SA 4M9ZA 2JUCA 4LIVA 3QPHA 2DQLA 2CQKA 1MW7A 3JRFA 5HDNA 2CQQA 2R7QA 3K4KA 4XORA 2Y9YA 1Z9CA 1QZZA 4L5JA 1O3QA 1MNEA 1XTAA 4NDLA 3VEPA 2F48A 1R36A 2FF4A 1VQ6I 2KQRA 1MBGA 1FT9A 1OQYA 1YW8A 4LJZF 1TNTA 1OPCA 3KEYA 2QUFA 2KRHA 2NVUB 1W36D 1MSFC 4XNFA 4OMYA 3M4OJ 3GZNB 2OBPA 2VB6A 1X19A 4KISA 1PUFA 4CO8A 2F2EA 2LF8A 4XL9A 4LK1F 4YRVA 2R7VA 1VQOI 3BCBA 2EFQA 5HOOA 5B3SH 1P4AA 2MABA 1K6OA 1Y8QB 1U6GA 3JRIA 2FMYA 3D5RC 1LVKA 1E3HA 1A31A 4D0PA 2WAQN 2DT6A 3WTXC 2QSGX 1D0ZA 5A2QZ 2KDOA 4IJAA 2LC2A 1CQTA 1IN7A 2JRMA 2OF7A 5FLVA 1ZARA 1U5TB 5LLQA 1A6IA 2DU9A 3U9GA 3ASOH 5BQTA 3P9IA 4BL0B 3SHFA 3UNGC 2Z99A 4II3A 4BHBA 5TRDA 4G12A 3LSPA 1RUOA 2L0KA 4IHWA 1ZHFA 2M5WA 1LKXA 4DYQA 3U1KA 3IP4B 2P7CB 2CUEA 4BEHB 2LKXA 3G2BA 1ZYRF 2R5YA 3GEZA 5FKKA 4Y33A 1FYKA 5K5OA 1KU2A 3LOCA 4CXFA 3EYIA 1YHQI 2LRDA 1LPQA 3BZCA 3RTRA 2JA7J 5ICFA 1RRJA 4IHYA 3J7YJ 4BQOA 4KDPA 2LDUA 3ZQFA 3GTMJ 1W5SA 5LD2C 2R0QC 3EQLF 4Y3OA 5KAFC 4QPQA 4A3FJ 3RZDJ 2PX9A 1XB4A 2F4OB 2HQRA 2K7LA 5AIPA 3AL0B 3IUOA 2JA2A 2DJNA 4RAYA 4S0HB 4KMUX 1ZKGA 2CQXA 1R4NB 5DM6F 3OYDA 1SFEA 2VONA 2HOEA 2P4WA 2NNYA 3HSRA 2JWTA 2CRGA 3SEQA 2M3AA 5M5WJ 5BPDA 5FKOA 3CCVI 2DODA 4F93B 4C2UA 3F8FA 3LSGA 4LOCA 2M1BA 2FXAA 2R7DA 4U0VA 3FKIJ 1RC9A 1MH4A 2P0WA 2HXOA 3DF8A 5F0HA 3OYFA 4ABZA 5L3BA 3I4PA 2HVRA 4CZZA 4EGZA 2HVQA 3DKXA 3H9GA 2YS9A 4YEJA 4ZZLA 4UY8I 2OZUA 1XPXA 5J8FA 3P5JA 1FOYA 5HDGA 1R71A 2IW5A 2FNPA 4EJVA 4EMSA 4FCYA 4HF1A 4ANJA 4JBAA 2H6BA 1TTYA 2Y9ZA 1J9IA 4XSZF 3WU2C 2XROA 1R58A 2MD0A 3FXQA 4N4NB 1SD5A 4UUSA 2M30A 2L9RA 3RQ4A 4FX0A 1R23A 4M9SA 3OMYA 5JR3A 3VYSB 3OYNA 4PCQA 2DMNA 3FXUA 5EJCA 3NRVA 4L0ZB 4FETA 1PJRA 3PL8A 1G6NA 1BC8C 1BW6A 2Y69H 5CQEA 2L3DA 5J40A 1HW2A 4F52A 2L01A 1GDTA 2GAUA 1XDUA 1IRZA 1KYZA 4M74A 1Z3YA 1ETWA 4MEXF 5E20A 2CQNA 2X6WA 5JHUA 1X3WB 2KMUA 4HYEA 4A3JJ 2QWWA 1IDYA 4BU2A 3LAPA 1SEUA 3WHCA 4LK0F 2VJJA 1K79A 1NH3A 1P9QC 5KK1A 2ZSHB 1MNMC 1DP3A 3I9V2 2RNGA 4IOAF 1ZN2A 1BI2A 4HQMA 3G73A 4PJMA 4WXDA 2HYJA 3CJNA 3Q5FA 2XF6A 1TQMA 1JT6A 2E5NA 1O4XA 1ON1A 2XGDA 4PFOA 2HEOA 3ABTA 4D9JA 2JJ7A 4ZDPA 5E8IA 5ICGA 2IBDA 3HBLA 3MN2A 3RKWA 3CUQA 1FIAA 4M3BA 1HF0A 5H2FC 4BBSJ 1UFMA 3KLNA 4QTRA 4C30A 1S7AA 2L7ZA 4UVAA 4CCJA 2VJ5A 2M0CA 1QPMA 3HYIA 3PJRA 4N4OB 4RBOA 5L3DA 3A03A 1KU9A 1LFPA 5IY5H 5IOYA 1I6XA 2KP6A 2ZNZA 2YU3A 4ZYAA 4AC0A 2P7VB 1PYVA 4L9JA 2JVGA 1O3SA 2IS1A 2M9HA 1YW9A 1T8IA 1F1ZA 3C2HA 1PP7U 4F55A 1Y0UA 2E19A 2OV7A 2Q2EB 1NK3P 2B7EA 4U0YA 3L1PA 4AIJA 1W5TA 1R1TA 1ERDA 3QAHA 1A6QA 4C3HJ 3D1NI 3L2UA 3OYGA 4KIGA 3GF2A 3GX4X 1OYYA 2ZC2A 4G8XA 2Z1DA 1LB2A 3TKYA 1QBJA 1WGXA 4UUTA 4B43A 4HSTA 1D5VA 2Z2SB 1NG6A 1S8NA 5C4JJ 3OYAA 2MH2A 1HKSA 2H8RA 1SVOA 2M4KA 2LREA 4XKCA 2GXAA 2MG4A 4IPAA 1UZCA 1Z6TA 1R1UA 2HTJA 5D6EA 4IO9F 2XPWA 1GHCA 2XB5A 2Z16A 1MD0A 3KLOA 1ZG3A 4N0BA 3K1MA 1APLC 1ONVA 2HDCA 5E1WA 4BDYA 4PGGA 4R8HA 2V9PA 2M34A 1QNTA 5FRNA 2XAUA 1GXPA 1I27A 2QSHX 4IRGA 2HQNA 4LD5A 3TDZC 3A0HC 5FKLA 5F0CA 3OIOA 3M3YJ 5GPAA 2O9LA 1D8KA 3GTJJ 4MFDA 4DBRA 1J5YA 4PSWA 1VQ9I 2DPUA 4M6VA 2KIQA 2VT2A 1DPUA 1UHWA 3A0BC 4A0YA 3TW6A 3L9FA 3OSGA 2K40A 1LDDA 5CKTA 3TP3A 1TP4A 4HLYA 1FTTA 2D45A 5LGUA 5M5XJ 2R7TA 4NB5A 3BWGA 1V55H 3IWZA 2HKXA 3I59B 3I5UA 3CLOA 4QPOA 4RGUA 5FLMJ 2PQ8A 1F9NA 2UXNA 5DM7F 3H92A 4MLOA 4DGWB 2W00A 4Q48A 4FISA 2O6GE 3KZIC 4M6XA 4OIPF 2VKEA 3PSFA 3J81Z 1UMQA 3IKTA 5D4SA 2BOLA 3BG5A 3HHHA 3ZN1A 1B1BA 4TV7A 4NBQA 4DJAA 1G3YA 4UB6C 1XDSA 5DUIA 1XGMA 3R4KA 1IG7A 3G1LA 3ABMH 2GLOA 1MMGA 2G7HA 2A68F 5FLXK 3EUAA 1L3LA 1BM9A 1LEAA 4LG0B 4MO7A 4FT8A 4RB1A 2ISYA 2E1NA 3F3XA 1IRXA 4RA2A 3DQVC 2L9SA 5IYBJ 1QGPA 4M3EA 2KRFA 3AG2H 3ZQQA 2GA1A 3GBGA 2W48A 3BR0A 1OLTA 3MVPA 3GLXA 2VQGA 4B3XA 3FK6A 1R5HA 5D4RA 2P5KA 3CO7C 3QP5A 4KN4X 2KKOA 5LEKA 3DBHB 1ETQA 4LLNA 1SAXA 3ZQIA 5HLGA 2VL8A 3H5AA 5HLHA 5E3NA 2ADUA 2LBFA 3HB9A 5E1ZB 4I2OA 2E60A 1WCMJ 1KZHA 1BJAA 2UWMA 3RDIA 3S2HJ 4EJUA 2RV8A 4RDUA 6PAXA 4ZDOA 5H6RA 1JXSA 1ZH5A 2EH3A 2EPFA 1WWXA 1U5TC 3CCMI 2RVCA 2FNAA 3LSTA 4J00A 3RI4A 4G6TB 5D8KB 5EYRA 1MSEC 1AHDP 3COAC 4BHPA 1YE9A 4AYBA 1DU6A 4IZZA 2P6SA 3S3NA 2MBFA 3CDLA 4F7ZA 3A2KA 2OAZA 2LKPA 2RDPA 2W84A 1UB9A 1HC8A 1USTA 4A5NA 4MTEA 4NC8A 3S2WA 2MLKA 3OYMA 1W7PA 3KCCA 5BNGA 2DT7B 4H4KC 1HOMA 2EZIA 4EM0B 3TMOA 2LD5A 1MMDA 1LDKB 2F5EA 5IYCJ 4CYCB 2IS6A 1BIBA 5FROA 3HOXJ 4DYCA 1GVDA 1OCOH 4WK8F 3HEFA 4Y4RA 3W2WA 3FBIB 2HI3A 2XB0X 1SMTA 3F8NA 3HOWJ 2EIJH 3ESWB 4PK4A 4XKBA 5FD6A 4U0WA 3CP2A 4OAZA 3HRUA 3EUKL 2L4MA 2M8EA 2TDXA 5DD4A 2JTVA 3K70D 4M3FA 3LSIA 2CFOA 3H9QA 3SZTA 4IKFA 4G7HF 2O3FA 2X85A 1K78B 2QQAA 1WSUA 2XAGA 2DLLA 2K3FA 2TCTA 3N4MA 4UV8A 3GTLJ 1BR1A 2JRTA 1J7KA 3C2BA 4HDUA 5D5WB 4IQ4A 1B8IB 1Y39A 3HSEA 2CUFA 2K4BA 3LSJA 1KYWA 2OZ6A 4UV9A 1F5TA 3LSKA 2QEXI 2KT0A 4Z6YA 2NXNB 5JLWA 3I4MJ 4GGGA 4FQGA 3WTUC 1ZR2A 1T0FC 1Y56A 3EYYA 1ZQ3P 3S15J 4YFNF 4XN3A 4G7ZF 4W1UA 4KITB 1XGSA 5J3LA 3GCMA 2KFDA 2VE9A 4OWRB 3HDDA 2OD5A 3LQRA 2BE5F 3DXJF 1VQMI 5IP6A 5DEQA 4XM3A 3U21A 3JR9A 4ZTFA 4CA0A 3M9AA 4EQQA 1QO0D 1IAWA 4YELA 1I6HJ 3OOPA 3RYRA 1U2WA 4OAYA 1XG1A 4BH9A 3F0CA 4R79A 2EZLA
chains in the Genus database with same CATH topology
1P4WA 2CW0F 3W6JB 2H6CA 3BPVA 4ON0A 1XCBA 4A0XA 3MCZA 3M8FA 4M9XA 3TGNA 4WF2A 1OYWA 2V6CA 2FBKA 3WTVC 2PBIA 2EB7A 3JTHA 4B8XA 2K02A 4HA8A 3FXRA 4ASNA 4HV5A 1HKQA 2HR3A 1TNSA 4ZYHA 3T8TA 2KIMA 4U7BA 3PQJA 2F5CA 1O7FA 1REPC 3JAMZ 5K5QA 3C3WA 2VBXA 4CHUA 4MEYF 4Y13A 1XSVA 5EEGA 1HSTA 2NNNA 1FPQA 4GYIA 4UXNA 3JSPA 1I1SA 3I64A 5F64A 3FWEA 1BC7C 1S29A 2VC1A 1ZAOA 2VOOA 2WC2A 1TBXA 2HZTA 4WX9A 4KFCA 2DK5A 2WTEA 1ZLJA 1DPRA 1W4MA 3KZZA 4I09A 5CLSA 1MDMB 2KJBA 3KEQA 2ZBKA 2XKPA 1YYVA 2DAOA 2DW4A 4IXAA 2CFXA 3MFKA 4OIRF 1U8RA 1XSXA 5BS6A 3J80K 2ZFWA 3B73A 3E6DA 3CUQB 4EM1A 3N97A 3BJAA 4G7OF 1G3WA 3GYHX 3WODF 3RKYA 2O0YA 1DUXC 4H0EA 3DP7A 4UNOA 1IN4A 4YG2F 2HGCA 1P6RA 4UVBA 1R00A 1Q1HA 4ENMA 3TO9A 3FX3A 2V79A 1T0FA 2L4AA 5KVRA 4L0YB 3BJ6A 2MC3A 5IT9K 5F6FA 5FFXA 4K2EA 1EH8A 1RI7A 3MEXA 3TOAA 3VOEA 3I0TA 1CF7B 3T0YA 2O8XA 2OA4A 4KICA 2MH9A 2VODA 4GCVA 2XGXA 3BP8A 3PQKA 4Y17A 4Q47A 2A3SA 2CWEA 1R22A 5L3FA 2JPBA 1E17A 4LLLA 2Z33A 3GO5A 3WGHA 4RAZA 1ZLKA 1WI9A 4A5MA 2YR2A 3ZMSA 3WE2A 3DPLC 5L3GA 1O7LA 1IN6A 5JVTA 1XN7A 3ROUA 1STZA 5BOXA 1ODDA 3K1NA 2HWVA 5HS7A 2CO5A 5HDKA 4ESJA 3WTYC 3ML6A 5BPIA 3E6MA 3HOSA 5L3EA 2V1UA 2FBIA 2ZCWA 4LG0A 3GFIA 2P8TA 2PN6A 2FQ3A 4XBFA 2A6EF 4HZFA 1FLIA 4IRIA 2EJRA 3JTGA 1IXSB 3LWFA 1UCRA 1FX7A 3ABUA 1IUYA 2Y75A 4O5VA 4I01A 4YIFA 4EV0A 3RKXA 2EFOA 3WTSC 3V8LA 2R3SA 3F21A 3O6BB 2IRFG 1D3YA 3BJOA 3IKVA 2GQQA 2AXLA 2FEZA 2OQGA 2RKHA 4BAYA 2M87A 3ZP5A 1SFXA 3R60A 2W25A 1E2XA 3SFZA 4CDGA 4QWQA 1XGOA 4ZYDA 2OQRA 4L9NA 2JZYA 3WTTC 1G3TA 5D5UB 2HYGD 5AIQA 1B59A 4UVCA 2QQBA 5CVJA 5ED4A 3W6KB 3BZ6A 3EETA 3JAMK 4RB0A 3FMQA 2G9WA 3MZYA 5E1XA 4RS8A 5ICCA 1IF1A 2EV6A 3E6BA 3ELKA 4A6EA 5LRSA 4R1HA 1P2FA 3C7JA 4L5IA 3H3ZA 2STWA 2ZNYA 3ERED 2RGVA 5ICEA 2OU2A 4KT5C 3HIFA 2DK8A 1EH6A 5DUKA 3HSFA 4BXUA 1SFUA 1BI0A 2FE3A 2EFNA 4G94A 4Q4ZF 5TJJA 4HX8A 1Z05A 3GVAA 2FA5A 5CVVA 4KMFA 4A0ZA 2CG4A 3WGGA 4O6JA 3Q9VA 1V4RA 2QBYA 4U7DA 4HX4A 2QBYB 1BIAA 2ZJ2A 2Q8KA 3KFWX 1OR7A 5LHIA 2DFIA 4HX7A 2JSCA 3DFGA 3IC7A 5F1RA 4PZJA 2EK5A 4ESFA 3I71A 3V7CA 5J6XA 3SQNA 2D1HA 2PMHA 2PI0A 4EJOA 1D8JA 5BMZA 3ZMTA 2HTSA 1IXCA 2VT3A 3BPXA 3LA3A 4G6DA 3CUQC 4N9HA 3F22A 4LLGF 4PDKA 1LQ1A 3E5XA 1MKMA 2ZO4A 3BDDA 1HBXG 1GVJA 2A5YB 2K4JA 1TLHB 4P55A 2FSWA 3K9TA 4FX4A 3IWFA 2ISZA 4ESBA 4QLCU 3C1DA 3J80Z 4BQAA 3VFZA 1HW1A 3DPTA 1FC3A 3F8CA 3QU3A 2F5FA 1HW5A 1BN5A 3E3VA 2J5PA 3P9CA 2ETHA 3WE3A 5DCFA 2CSOA 4ZYEA 3BY6A 3L2CA 4B09A 3IRRA 1YFHA 4HF2A 4I0AA 4OOIA 1RUNA 1KU7A 4AIHA 4RGSA 2XUBA 4HV6A 3MAJA 1QZYA 1IW7F 1YTYA 1KGSA 1G3SA 2W85A 1JHFA 1YO5C 2W57A 2QLZA 3FM3A 2XRNA 1XCVA 3F8MA 3LA2A 4ENKA 3E5UA 2MLGA 3U2RA 3V4GA 1FBQA 3KETA 1ZRCA 2BYVE 4I7HA 3V8JA 3ISPA 2EV5A 3PFIA 4ENJA 1IXRC 1L0OC 3ZMVA 4NHJA 2Z5UA 4KUMA 1ZG1A 4ETSA 1K78A 1LDJA 4XRFA 4RGXA 1TW2A 3QPTA 4UHTA 3HRTA 3DKWA 2STTA 4P5OA 4BYYA 2QYOA 3K2ZA 4GYGA 4GXOA 4ZH4F 3E97A 1DP7P 4N9IA 3I53A 2IA0A 3R6SA 1CF7A 2XVCA 3EUHA 3LA7A 4Q5SF 3ZMUA 4WWCA 1G4DA 2Q2EA 1YLFA 2H27A 5H6QA 4IHTA 2QZ8A 2XAFA 2DBBA 5LBQA 1K7AA 1PDNC 5ILSA 2EFWA 3MQ0A 2X4HA 1YQAA 4P96A 2IA2A 2E7XA 2IT0A 3VODA 5DD8A 2EA2A 1FWZA 2EFPA 4E70A 5L3CA 2YX7A 2IP2A 1IRGA 4MNUA 2K86A 4L18B 1SD6A 3P7NA 2XAHA 4MQVA 4A6DA 2B0LA 3MZHA 5CVUA 1FYLA 2D2WA 5E8GA 3KP7A 3SXYA 3RIRA 2ZXJA 1PP8F 5CVRA 4ZZDA 2ZKZA 1FBSA 3P9KA 1TW3A 2WWYA 1XSDA 3GXOA 2IJLA 4CYDA 4OIQF 1KA8A 3NEUA 1YW7A 2CYYA 4KNYA 2A69F 4I98B 2NRAC 3GWZA 1Z91A 3I59A 3ZPLA 2IVMA 4M71A 4HF0A 3CDHA 1KQ9A 5ERIA 4LFUA 4RGRA 4WXHA 2BEOA 1B6AA 1KQ8A 1ON2A 4XLNF 1B4AA 2X0LA 2BV6A 1JE8A 5ILUA 1CGPA 2ESHA 4U88A 4L9TA 2XV4S 1FY7A 1OKRA 3QU6A 3HRMA 2K27A 2Z3YA 3M7GA 3RPQA 2C6YA 3J81K 4OMZA 4XSXF 5JFRA 3HTUA 5DCMA 1U5TA 2FU4A 2YSRA 2LF7A 3ZQ7A 2DT5A 5FD5A 3F23A 1R1VA 4IRHA 1ZRFA 1I5ZA 1AOYA 2VN2A 4OINF 4DNCA 1IZ1A 1ZGAA 3GFLA 4I0BA 3QP6A 1Z7UA 3SZPA 2V1XA 3DEUA 2DO7A 2R7FA 4LMYA 4YFKF 2L54A 4KA4A 1KU3A 1FSEA 1AWCA 3WU1B 2MD5A 2NYXA 5AONA 5JI6A 2COMA 4A12A 3VB2A 1T38A 5LGTA 1NHAA 3WG9A 2QVOA 1LEBA 2YPRA 3WTZA 3HHGA 1FBUA 3F6OA 2O03A 1ZGJA 1J2XA 2UXXA 4CICA 2ACJA 2Y48A 1C0WA 1O3TA 2V1DA 1FOKA 3QOPA 4AD9A 1YIOA 4JK1X 4EVIA 2FBHA 5LRRA 3NQOA 2KJCA 2BGCA 2RNJA 1Z1DA 1IN8A 5D8LB 2GA2A 3CO6C 4MGRA 4HAMA 4LB6B 1EV7A 1KQ0A 1RNLA 1W7PB 3KZYA 2XIGA 3Q9SA 1P92A 2NS0A 1ULYA 2EV0A 3L09A 5E18F 5D5VB 3R0JA 5CVIA 3U1DA 1XGNA 4P9UA 5LHHA 2Q0OA 2P5VA 4KN7X 3RJPA 2RC4A 3GFMA 4M72A 1MJ9A 4EJWA 4HLXA 1SD4A 2GXGA 5HVQC 4BNCA 1W7PD 1B9MA 1S7OA 5D6FA 2FMLA 4IHSA 3FMRA 3V8KA 1LJ9A 3J7AO 2QM3A 2MA3A 3CTAA 3KP5A 4M73A 3GUDA 1OMIA 5K5RA 3LQQA 3TDUC 3CUOA 5E17F 4PGHA 3QRFF 5A2QK 5D5XB 3RYPA 1J0RA 1WQ2A 1BBYA 3ZN0A 2D1VA 1IRFA 4HW0A 4KYWA 3FM5A 2ELHA 1MDMA 1U3EM 4S05A 1BI1A 2DQRA 5HS9A 1J75A 3V7RA 1MJBA 4EJTA 3M8EA 2VXZA 3JSOA 3E6CC 2VC0A 5LHGA 4KIBA 2VOPA 2ZMEB 3B02A 4AWXB 3LAJA 4A2UA 2XASA 2QQ9A 1F4KA 2EWNA 1WKMA 1H9TA 4OU0A 2H09A 1PUEE 3M1EA 4G9YA 3FF5A 4RB2C 1LVAA 1OYIA 1S3JA 2XKOA 3GW2A 3KP2A 4IVNA 4CGZA 4RB3C 3DV8A 5DYMA 1FZPB 2HKOA 3F72A 3F6VA 3KP6A 3HOTA 4ENNA 1TQPA 2IA1A 1YS6A 3TOBA 1FP2A 1RZ4A 3T1BA 3BROA 4O3MA 3R61A 3O3KA 2W24A 4YIIA 5K1YA 1BI3A 2GIVA 4IF4A 1P4XA 2LNBA 2AS5F 2A6HF 4LB5A 1T6SA 1U78A 2E1CA 2BBYA 1HQCA 5CJ9A 2PLYA 4AIKA 2JPCA 2CGPA 1X3UA 1MJAA 2FOKA 2PG4A 1S6LA 3FHZA 1SMYF 2A61A 3O2PE 3I58A 2DPDA 1XD7A 1FYMA 5H20A 3D0SA 3K1PA 3REOA 2PEXA 5FLXZ 3ZMDA 2V9VA 4WCGA 2ZMEA 3KP4A 2F5DA 5HLIA 4I02A 4GO1A 5CYVA 1ZG5A 2O61A 2VBZA 4UUVA 1UHMA 3D5LA 3HRSA 4EM2A 1ZRDA 3GZ6A 3JW4A 1GXQA 2NAZA 3KEOA 4S04A 4MHGA 2RN7A 3WU0A 3K0LA 3WTWC 3BOQA 4BHCA 4MTDA 4MQ9F 3ECOA 4HOBA 5LEJA 5ILVA 1TQIA 3FMSA 1QQIA 2L02A 2H94A 5DV5A 3IRQA 2PMUA 1R5GA 3OV8A 3K69A 1FSHA 2P6TA 3EDPA 2WV0A 1DDNA 5FFZA 5FGMA 2E7WA 2GZWA 2Z9OA 2XHKA 3IHUA 2HFHA 3ULQB 2M45A 4DQ2A 1JGSA 1J59A 1T2KA 3H3UA 4EGYA 1H9GA 5IT3A 2XAJA 2G7UA 1H0MA 2KIFA 2DTRA 1A04A 2FRHA 1HKTA 4JQFA 2EA4A 2LSOA 1YS7A 2Y0MA 3L00A 4XLPF 2GXBA 4HQEA 3TO7A 4NQWA 2PFBA 3C18A 1HXDA 4HBLA 1YG2A 5EEHA 5FB2A 3HTSB 1FNNA 1XMAA 4ZYGA 2P5LC 1I1GA 1XMKA 2RQPA 2HYFA 4M6YA 2KIUA 3G3ZA 3LFKA 4Z2YA 3ZMZA 2HS5A 3TQNA 2VBYA 2YX4A 3T5XA 1MGTA 4G6QA 3HUGA 3I54A 1JHHA 3KP3A 5J8CA 1WRJA 3WGIA 1VTNC 3MWMA 3F8BA 1RIOH 1SD7A 2J5OA 5FO5A 3E5QA 4HDVA 5IT9Z 4Y15A 1R7JA 1IN5A 1T39A 3GFJA 1MZBA 2A07F 1LNWA 2VBWA 3KE2A 2PJPA 3GZ5A 2JT1A 1FP1D 2QENA 1ZREA 4WXCA 4KIFA 3FZVA 1BOAA 1O3RA 1HSJA 1EH7A 1T98A 5DCMB 5LGNA 2VE8A 2UZKA 5HS8A 3TO6A 3ECHA 2IPQX 1USSA 2GWRA 2DI3A 1O57A 4OIOF 4AVPA 3AAFA 4FHTA 3RPUA 5DDGA 1Z6RA 3IL2A 3R0AA 3T8RA 1V3FA 4LGWA 1B9NA 2XAQA 4YFXF 4L9VA 2ESNA 3L7WA 4P9FA 3V7SA 4M9ZA 3QPHA 2DQLA 2CQKA 5HDNA 1Z9CA 1QZZA 4L5JA 1O3QA 3VEPA 1R36A 2FF4A 1FT9A 1YW8A 4LJZF 1TNTA 1OPCA 2QUFA 4OMYA 2OBPA 4CO8A 2F2EA 2LF8A 4LK1F 2EFQA 5HOOA 1P4AA 1K6OA 1U6GA 2FMYA 4D0PA 3WTXC 5A2QZ 4IJAA 1IN7A 1ZARA 1U5TB 5LLQA 2DU9A 3U9GA 5BQTA 3P9IA 3SHFA 2Z99A 4BHBA 5TRDA 1RUOA 1ZHFA 2M5WA 2P7CB 1ZYRF 3GEZA 1FYKA 5K5OA 1KU2A 4CXFA 3EYIA 3RTRA 5ICFA 4KDPA 2LDUA 1W5SA 3EQLF 1XB4A 2HQRA 2K7LA 5AIPA 4RAYA 4KMUX 1SFEA 2VONA 2HOEA 2P4WA 2NNYA 3HSRA 5BPDA 3F8FA 2M1BA 2FXAA 2R7DA 4U0VA 3DF8A 5L3BA 3I4PA 4CZZA 4EGZA 4ZZLA 2OZUA 5J8FA 5HDGA 2IW5A 2FNPA 4EJVA 4EMSA 4HF1A 4JBAA 2H6BA 1TTYA 1J9IA 4XSZF 2XROA 1R58A 3FXQA 1SD5A 2M30A 4FX0A 1R23A 4M9SA 5JR3A 4PCQA 3FXUA 3NRVA 4L0ZB 1G6NA 1BC8C 2L3DA 1HW2A 2L01A 2GAUA 1XDUA 1KYZA 4M74A 4MEXF 5E20A 5JHUA 4HYEA 2QWWA 3LAPA 1K79A 4LK0F 5KK1A 1ZN2A 1BI2A 4HQMA 3G73A 4WXDA 3Q5FA 3CJNA 1TQMA 1ON1A 2HEOA 3ABTA 5E8IA 5ICGA 3RKWA 3CUQA 1UFMA 3KLNA 1S7AA 4UVAA 1QPMA 3HYIA 5L3DA 1KU9A 1I6XA 2ZNZA 2YU3A 2P7VB 4L9JA 1O3SA 1YW9A 1PP7U 1F1ZA 1Y0UA 4U0YA 4AIJA 1W5TA 1R1TA 3QAHA 4KIGA 3GF2A 3GX4X 1OYYA 4G8XA 1LB2A 3TKYA 1QBJA 1D5VA 1S8NA 2MH2A 1HKSA 4IPAA 1Z6TA 1R1UA 2HTJA 5D6EA 1GHCA 1MD0A 3KLOA 1ZG3A 4N0BA 3K1MA 1ONVA 2HDCA 5E1WA 4PGGA 4R8HA 1QNTA 1GXPA 1I27A 4IRGA 2HQNA 4LD5A 3TDZC 1D8KA 1J5YA 2DPUA 2VT2A 1DPUA 1UHWA 4A0YA 3L9FA 1LDDA 4HLYA 2D45A 5LGUA 4NB5A 3BWGA 3IWZA 2HKXA 3I59B 3I5UA 3CLOA 4RGUA 2PQ8A 1F9NA 2UXNA 3H92A 4Q48A 2O6GE 4M6XA 4OIPF 3J81Z 3IKTA 5D4SA 3HHHA 3ZN1A 1B1BA 4TV7A 1G3YA 1XDSA 5DUIA 1XGMA 3R4KA 2G7HA 2A68F 5FLXK 1L3LA 1BM9A 1LEAA 4LG0B 4FT8A 4RB1A 2ISYA 2E1NA 3F3XA 3DQVC 1QGPA 2KRFA 2GA1A 3GLXA 5D4RA 1R5HA 2P5KA 3CO7C 3QP5A 4KN4X 2KKOA 5LEKA 4LLNA 1SAXA 5HLGA 5HLHA 2ADUA 5E1ZB 4I2OA 1BJAA 2UWMA 3RDIA 4EJUA 2RV8A 6PAXA 5H6RA 1JXSA 1ZH5A 1WWXA 1U5TC 2RVCA 2FNAA 3LSTA 3RI4A 5D8KB 3COAC 4BHPA 2P6SA 2MBFA 4F7ZA 2OAZA 2LKPA 2RDPA 2W84A 1UB9A 1USTA 4A5NA 4MTEA 3S2WA 2MLKA 1W7PA 3KCCA 4EM0B 1LDKB 2F5EA 1BIBA 4WK8F 1SMTA 3F8NA 5FD6A 4U0WA 3HRUA 2L4MA 2M8EA 2TDXA 5DD4A 2JTVA 3SZTA 4G7HF 2O3FA 1K78B 2QQAA 1WSUA 2XAGA 2DLLA 3N4MA 4UV8A 2JRTA 4HDUA 1J7KA 5D5WB 3HSEA 2K4BA 1KYWA 2OZ6A 4UV9A 1F5TA 4GGGA 3WTUC 3EYYA 4YFNF 4G7ZF 1XGSA 2VE9A 2OD5A 3LQRA 2BE5F 3DXJF 5DEQA 3M9AA 4EQQA 1QO0D 1IAWA 3OOPA 3RYRA 1U2WA 4BH9A 4R79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4W A;  2CW0 F;  3W6J B;  2H6C A;  3BPV A;  4ON0 A;  1XCB A;  4A0X A;  3MCZ A;  3M8F A;  4M9X A;  3TGN A;  4WF2 A;  1OYW A;  2V6C A;  2FBK A;  3WTV C;  2PBI A;  2EB7 A;  3JTH A;  4B8X A;  2K02 A;  4HA8 A;  3FXR A;  4ASN A;  4HV5 A;  1HKQ A;  2HR3 A;  1TNS A;  4ZYH A;  3T8T A;  2KIM A;  4U7B A;  3PQJ A;  2F5C A;  1O7F A;  1REP C;  3JAM Z;  5K5Q A;  3C3W A;  2VBX A;  4CHU A;  4MEY F;  4Y13 A;  1XSV A;  5EEG A;  1HST A;  2NNN A;  1FPQ A;  4GYI A;  4UXN A;  3JSP A;  1I1S A;  3I64 A;  5F64 A;  3FWE A;  1BC7 C;  1S29 A;  2VC1 A;  1ZAO A;  2VOO A;  2WC2 A;  1TBX A;  2HZT A;  4WX9 A;  4KFC A;  2DK5 A;  2WTE A;  1ZLJ A;  1DPR A;  1W4M A;  3KZZ A;  4I09 A;  5CLS A;  1MDM B;  2KJB A;  3KEQ A;  2ZBK A;  2XKP A;  1YYV A;  2DAO A;  2DW4 A;  4IXA A;  2CFX A;  3MFK A;  4OIR F;  1U8R A;  1XSX A;  5BS6 A;  3J80 K;  2ZFW A;  3B73 A;  3E6D A;  3CUQ B;  4EM1 A;  3N97 A;  3BJA A;  4G7O F;  1G3W A;  3GYH X;  3WOD F;  3RKY A;  2O0Y A;  1DUX C;  4H0E A;  3DP7 A;  4UNO A;  1IN4 A;  4YG2 F;  2HGC A;  1P6R A;  4UVB A;  1R00 A;  1Q1H A;  4ENM A;  3TO9 A;  3FX3 A;  2V79 A;  1T0F A;  2L4A A;  5KVR A;  4L0Y B;  3BJ6 A;  2MC3 A;  5IT9 K;  5F6F A;  5FFX A;  4K2E A;  1EH8 A;  1RI7 A;  3MEX A;  3TOA A;  3VOE A;  3I0T A;  1CF7 B;  3T0Y A;  2O8X A;  2OA4 A;  4KIC A;  2MH9 A;  2VOD A;  4GCV A;  2XGX A;  3BP8 A;  3PQK A;  4Y17 A;  4Q47 A;  2A3S A;  2CWE A;  1R22 A;  5L3F A;  2JPB A;  1E17 A;  4LLL A;  2Z33 A;  3GO5 A;  3WGH A;  4RAZ A;  1ZLK A;  1WI9 A;  4A5M A;  2YR2 A;  3ZMS A;  3WE2 A;  3DPL C;  5L3G A;  1O7L A;  1IN6 A;  5JVT A;  1XN7 A;  3ROU A;  1STZ A;  5BOX A;  1ODD A;  3K1N A;  2HWV A;  5HS7 A;  2CO5 A;  5HDK A;  4ESJ A;  3WTY C;  3ML6 A;  5BPI A;  3E6M A;  3HOS A;  5L3E A;  2V1U A;  2FBI A;  2ZCW A;  4LG0 A;  3GFI A;  2P8T A;  2PN6 A;  2FQ3 A;  4XBF A;  2A6E F;  4HZF A;  1FLI A;  4IRI A;  2EJR A;  3JTG A;  1IXS B;  3LWF A;  1UCR A;  1FX7 A;  3ABU A;  1IUY A;  2Y75 A;  4O5V A;  4I01 A;  4YIF A;  4EV0 A;  3RKX A;  2EFO A;  3WTS C;  3V8L A;  2R3S A;  3F21 A;  3O6B B;  2IRF G;  1D3Y A;  3BJO A;  3IKV A;  2GQQ A;  2AXL A;  2FEZ A;  2OQG A;  2RKH A;  4BAY A;  2M87 A;  3ZP5 A;  1SFX A;  3R60 A;  2W25 A;  1E2X A;  3SFZ A;  4CDG A;  4QWQ A;  1XGO A;  4ZYD A;  2OQR A;  4L9N A;  2JZY A;  3WTT C;  1G3T A;  5D5U B;  2HYG D;  5AIQ A;  1B59 A;  4UVC A;  2QQB A;  5CVJ A;  5ED4 A;  3W6K B;  3BZ6 A;  3EET A;  3JAM K;  4RB0 A;  3FMQ A;  2G9W A;  3MZY A;  5E1X A;  4RS8 A;  5ICC A;  1IF1 A;  2EV6 A;  3E6B A;  3ELK A;  4A6E A;  5LRS A;  4R1H A;  1P2F A;  3C7J A;  4L5I A;  3H3Z A;  2STW A;  2ZNY A;  3ERE D;  2RGV A;  5ICE A;  2OU2 A;  4KT5 C;  3HIF A;  2DK8 A;  1EH6 A;  5DUK A;  3HSF A;  4BXU A;  1SFU A;  1BI0 A;  2FE3 A;  2EFN A;  4G94 A;  4Q4Z F;  5TJJ A;  4HX8 A;  1Z05 A;  3GVA A;  2FA5 A;  5CVV A;  4KMF A;  4A0Z A;  2CG4 A;  3WGG A;  4O6J A;  3Q9V A;  1V4R A;  2QBY A;  4U7D A;  4HX4 A;  2QBY B;  1BIA A;  2ZJ2 A;  2Q8K A;  3KFW X;  1OR7 A;  5LHI A;  2DFI A;  4HX7 A;  2JSC A;  3DFG A;  3IC7 A;  5F1R A;  4PZJ A;  2EK5 A;  4ESF A;  3I71 A;  3V7C A;  5J6X A;  3SQN A;  2D1H A;  2PMH A;  2PI0 A;  4EJO A;  1D8J A;  5BMZ A;  3ZMT A;  2HTS A;  1IXC A;  2VT3 A;  3BPX A;  3LA3 A;  4G6D A;  3CUQ C;  4N9H A;  3F22 A;  4LLG F;  4PDK A;  1LQ1 A;  3E5X A;  1MKM A;  2ZO4 A;  3BDD A;  1HBX G;  1GVJ A;  2A5Y B;  2K4J A;  1TLH B;  4P55 A;  2FSW A;  3K9T A;  4FX4 A;  3IWF A;  2ISZ A;  4ESB A;  4QLC U;  3C1D A;  3J80 Z;  4BQA A;  3VFZ A;  1HW1 A;  3DPT A;  1FC3 A;  3F8C A;  3QU3 A;  2F5F A;  1HW5 A;  1BN5 A;  3E3V A;  2J5P A;  3P9C A;  2ETH A;  3WE3 A;  5DCF A;  2CSO A;  4ZYE A;  3BY6 A;  3L2C A;  4B09 A;  3IRR A;  1YFH A;  4HF2 A;  4I0A A;  4OOI A;  1RUN A;  1KU7 A;  4AIH A;  4RGS A;  2XUB A;  4HV6 A;  3MAJ A;  1QZY A;  1IW7 F;  1YTY A;  1KGS A;  1G3S A;  2W85 A;  1JHF A;  1YO5 C;  2W57 A;  2QLZ A;  3FM3 A;  2XRN A;  1XCV A;  3F8M A;  3LA2 A;  4ENK A;  3E5U A;  2MLG A;  3U2R A;  3V4G A;  1FBQ A;  3KET A;  1ZRC A;  2BYV E;  4I7H A;  3V8J A;  3ISP A;  2EV5 A;  3PFI A;  4ENJ A;  1IXR C;  1L0O C;  3ZMV A;  4NHJ A;  2Z5U A;  4KUM A;  1ZG1 A;  4ETS A;  1K78 A;  1LDJ A;  4XRF A;  4RGX A;  1TW2 A;  3QPT A;  4UHT A;  3HRT A;  3DKW A;  2STT A;  4P5O A;  4BYY A;  2QYO A;  3K2Z A;  4GYG A;  4GXO A;  4ZH4 F;  3E97 A;  1DP7 P;  4N9I A;  3I53 A;  2IA0 A;  3R6S A;  1CF7 A;  2XVC A;  3EUH A;  3LA7 A;  4Q5S F;  3ZMU A;  4WWC A;  1G4D A;  2Q2E A;  1YLF A;  2H27 A;  5H6Q A;  4IHT A;  2QZ8 A;  2XAF A;  2DBB A;  5LBQ A;  1K7A A;  1PDN C;  5ILS A;  2EFW A;  3MQ0 A;  2X4H A;  1YQA A;  4P96 A;  2IA2 A;  2E7X A;  2IT0 A;  3VOD A;  5DD8 A;  2EA2 A;  1FWZ A;  2EFP A;  4E70 A;  5L3C A;  2YX7 A;  2IP2 A;  1IRG A;  4MNU A;  2K86 A;  4L18 B;  1SD6 A;  3P7N A;  2XAH A;  4MQV A;  4A6D A;  2B0L A;  3MZH A;  5CVU A;  1FYL A;  2D2W A;  5E8G A;  3KP7 A;  3SXY A;  3RIR A;  2ZXJ A;  1PP8 F;  5CVR A;  4ZZD A;  2ZKZ A;  1FBS A;  3P9K A;  1TW3 A;  2WWY A;  1XSD A;  3GXO A;  2IJL A;  4CYD A;  4OIQ F;  1KA8 A;  3NEU A;  1YW7 A;  2CYY A;  4KNY A;  2A69 F;  4I98 B;  2NRA C;  3GWZ A;  1Z91 A;  3I59 A;  3ZPL A;  2IVM A;  4M71 A;  4HF0 A;  3CDH A;  1KQ9 A;  5ERI A;  4LFU A;  4RGR A;  4WXH A;  2BEO A;  1B6A A;  1KQ8 A;  1ON2 A;  4XLN F;  1B4A A;  2X0L A;  2BV6 A;  1JE8 A;  5ILU A;  1CGP A;  2ESH A;  4U88 A;  4L9T A;  2XV4 S;  1FY7 A;  1OKR A;  3QU6 A;  3HRM A;  2K27 A;  2Z3Y A;  3M7G A;  3RPQ A;  2C6Y A;  3J81 K;  4OMZ A;  4XSX F;  5JFR A;  3HTU A;  5DCM A;  1U5T A;  2FU4 A;  2YSR A;  2LF7 A;  3ZQ7 A;  2DT5 A;  5FD5 A;  3F23 A;  1R1V A;  4IRH A;  1ZRF A;  1I5Z A;  1AOY A;  2VN2 A;  4OIN F;  4DNC A;  1IZ1 A;  1ZGA A;  3GFL A;  4I0B A;  3QP6 A;  1Z7U A;  3SZP A;  2V1X A;  3DEU A;  2DO7 A;  2R7F A;  4LMY A;  4YFK F;  2L54 A;  4KA4 A;  1KU3 A;  1FSE A;  1AWC A;  3WU1 B;  2MD5 A;  2NYX A;  5AON A;  5JI6 A;  2COM A;  4A12 A;  3VB2 A;  1T38 A;  5LGT A;  1NHA A;  3WG9 A;  2QVO A;  1LEB A;  2YPR A;  3WTZ A;  3HHG A;  1FBU A;  3F6O A;  2O03 A;  1ZGJ A;  1J2X A;  2UXX A;  4CIC A;  2ACJ A;  2Y48 A;  1C0W A;  1O3T A;  2V1D A;  1FOK A;  3QOP A;  4AD9 A;  1YIO A;  4JK1 X;  4EVI A;  2FBH A;  5LRR A;  3NQO A;  2KJC A;  2BGC A;  2RNJ A;  1Z1D A;  1IN8 A;  5D8L B;  2GA2 A;  3CO6 C;  4MGR A;  4HAM A;  4LB6 B;  1EV7 A;  1KQ0 A;  1RNL A;  1W7P B;  3KZY A;  2XIG A;  3Q9S A;  1P92 A;  2NS0 A;  1ULY A;  2EV0 A;  3L09 A;  5E18 F;  5D5V B;  3R0J A;  5CVI A;  3U1D A;  1XGN A;  4P9U A;  5LHH A;  2Q0O A;  2P5V A;  4KN7 X;  3RJP A;  2RC4 A;  3GFM A;  4M72 A;  1MJ9 A;  4EJW A;  4HLX A;  1SD4 A;  2GXG A;  5HVQ C;  4BNC A;  1W7P D;  1B9M A;  1S7O A;  5D6F A;  2FML A;  4IHS A;  3FMR A;  3V8K A;  1LJ9 A;  3J7A O;  2QM3 A;  2MA3 A;  3CTA A;  3KP5 A;  4M73 A;  3GUD A;  1OMI A;  5K5R A;  3LQQ A;  3TDU C;  3CUO A;  5E17 F;  4PGH A;  3QRF F;  5A2Q K;  5D5X B;  3RYP A;  1J0R A;  1WQ2 A;  1BBY A;  3ZN0 A;  2D1V A;  1IRF A;  4HW0 A;  4KYW A;  3FM5 A;  2ELH A;  1MDM A;  1U3E M;  4S05 A;  1BI1 A;  2DQR A;  5HS9 A;  1J75 A;  3V7R A;  1MJB A;  4EJT A;  3M8E A;  2VXZ A;  3JSO A;  3E6C C;  2VC0 A;  5LHG A;  4KIB A;  2VOP A;  2ZME B;  3B02 A;  4AWX B;  3LAJ A;  4A2U A;  2XAS A;  2QQ9 A;  1F4K A;  2EWN A;  1WKM A;  1H9T A;  4OU0 A;  2H09 A;  1PUE E;  3M1E A;  4G9Y A;  3FF5 A;  4RB2 C;  1LVA A;  1OYI A;  1S3J A;  2XKO A;  3GW2 A;  3KP2 A;  4IVN A;  4CGZ A;  4RB3 C;  3DV8 A;  5DYM A;  1FZP B;  2HKO A;  3F72 A;  3F6V A;  3KP6 A;  3HOT A;  4ENN A;  1TQP A;  2IA1 A;  1YS6 A;  3TOB A;  1FP2 A;  1RZ4 A;  3T1B A;  3BRO A;  4O3M A;  3R61 A;  3O3K A;  2W24 A;  4YII A;  5K1Y A;  1BI3 A;  2GIV A;  4IF4 A;  1P4X A;  2LNB A;  2AS5 F;  2A6H F;  4LB5 A;  1T6S A;  1U78 A;  2E1C A;  2BBY A;  1HQC A;  5CJ9 A;  2PLY A;  4AIK A;  2JPC A;  2CGP A;  1X3U A;  1MJA A;  2FOK A;  2PG4 A;  1S6L A;  3FHZ A;  1SMY F;  2A61 A;  3O2P E;  3I58 A;  2DPD A;  1XD7 A;  1FYM A;  5H20 A;  3D0S A;  3K1P A;  3REO A;  2PEX A;  5FLX Z;  3ZMD A;  2V9V A;  4WCG A;  2ZME A;  3KP4 A;  2F5D A;  5HLI A;  4I02 A;  4GO1 A;  5CYV A;  1ZG5 A;  2O61 A;  2VBZ A;  4UUV A;  1UHM A;  3D5L A;  3HRS A;  4EM2 A;  1ZRD A;  3GZ6 A;  3JW4 A;  1GXQ A;  2NAZ A;  3KEO A;  4S04 A;  4MHG A;  2RN7 A;  3WU0 A;  3K0L A;  3WTW C;  3BOQ A;  4BHC A;  4MTD A;  4MQ9 F;  3ECO A;  4HOB A;  5LEJ A;  5ILV A;  1TQI A;  3FMS A;  1QQI A;  2L02 A;  2H94 A;  5DV5 A;  3IRQ A;  2PMU A;  1R5G A;  3OV8 A;  3K69 A;  1FSH A;  2P6T A;  3EDP A;  2WV0 A;  1DDN A;  5FFZ A;  5FGM A;  2E7W A;  2GZW A;  2Z9O A;  2XHK A;  3IHU A;  2HFH A;  3ULQ B;  2M45 A;  4DQ2 A;  1JGS A;  1J59 A;  1T2K A;  3H3U A;  4EGY A;  1H9G A;  5IT3 A;  2XAJ A;  2G7U A;  1H0M A;  2KIF A;  2DTR A;  1A04 A;  2FRH A;  1HKT A;  4JQF A;  2EA4 A;  2LSO A;  1YS7 A;  2Y0M A;  3L00 A;  4XLP F;  2GXB A;  4HQE A;  3TO7 A;  4NQW A;  2PFB A;  3C18 A;  1HXD A;  4HBL A;  1YG2 A;  5EEH A;  5FB2 A;  3HTS B;  1FNN A;  1XMA A;  4ZYG A;  2P5L C;  1I1G A;  1XMK A;  2RQP A;  2HYF A;  4M6Y A;  2KIU A;  3G3Z A;  3LFK A;  4Z2Y A;  3ZMZ A;  2HS5 A;  3TQN A;  2VBY A;  2YX4 A;  3T5X A;  1MGT A;  4G6Q A;  3HUG A;  3I54 A;  1JHH A;  3KP3 A;  5J8C A;  1WRJ A;  3WGI A;  1VTN C;  3MWM A;  3F8B A;  1RIO H;  1SD7 A;  2J5O A;  5FO5 A;  3E5Q A;  4HDV A;  5IT9 Z;  4Y15 A;  1R7J A;  1IN5 A;  1T39 A;  3GFJ A;  1MZB A;  2A07 F;  1LNW A;  2VBW A;  3KE2 A;  2PJP A;  3GZ5 A;  2JT1 A;  1FP1 D;  2QEN A;  1ZRE A;  4WXC A;  4KIF A;  3FZV A;  1BOA A;  1O3R A;  1HSJ A;  1EH7 A;  1T98 A;  5DCM B;  5LGN A;  2VE8 A;  2UZK A;  5HS8 A;  3TO6 A;  3ECH A;  2IPQ X;  1USS A;  2GWR A;  2DI3 A;  1O57 A;  4OIO F;  4AVP A;  3AAF A;  4FHT A;  3RPU A;  5DDG A;  1Z6R A;  3IL2 A;  3R0A A;  3T8R A;  1V3F A;  4LGW A;  1B9N A;  2XAQ A;  4YFX F;  4L9V A;  2ESN A;  3L7W A;  4P9F A;  3V7S A;  4M9Z A;  3QPH A;  2DQL A;  2CQK A;  5HDN A;  1Z9C A;  1QZZ A;  4L5J A;  1O3Q A;  3VEP A;  1R36 A;  2FF4 A;  1FT9 A;  1YW8 A;  4LJZ F;  1TNT A;  1OPC A;  2QUF A;  4OMY A;  2OBP A;  4CO8 A;  2F2E A;  2LF8 A;  4LK1 F;  2EFQ A;  5HOO A;  1P4A A;  1K6O A;  1U6G A;  2FMY A;  4D0P A;  3WTX C;  5A2Q Z;  4IJA A;  1IN7 A;  1ZAR A;  1U5T B;  5LLQ A;  2DU9 A;  3U9G A;  5BQT A;  3P9I A;  3SHF A;  2Z99 A;  4BHB A;  5TRD A;  1RUO A;  1ZHF A;  2M5W A;  2P7C B;  1ZYR F;  3GEZ A;  1FYK A;  5K5O A;  1KU2 A;  4CXF A;  3EYI A;  3RTR A;  5ICF A;  4KDP A;  2LDU A;  1W5S A;  3EQL F;  1XB4 A;  2HQR A;  2K7L A;  5AIP A;  4RAY A;  4KMU X;  1SFE A;  2VON A;  2HOE A;  2P4W A;  2NNY A;  3HSR A;  5BPD A;  3F8F A;  2M1B A;  2FXA A;  2R7D A;  4U0V A;  3DF8 A;  5L3B A;  3I4P A;  4CZZ A;  4EGZ A;  4ZZL A;  2OZU A;  5J8F A;  5HDG A;  2IW5 A;  2FNP A;  4EJV A;  4EMS A;  4HF1 A;  4JBA A;  2H6B A;  1TTY A;  1J9I A;  4XSZ F;  2XRO A;  1R58 A;  3FXQ A;  1SD5 A;  2M30 A;  4FX0 A;  1R23 A;  4M9S A;  5JR3 A;  4PCQ A;  3FXU A;  3NRV A;  4L0Z B;  1G6N A;  1BC8 C;  2L3D A;  1HW2 A;  2L01 A;  2GAU A;  1XDU A;  1KYZ A;  4M74 A;  4MEX F;  5E20 A;  5JHU A;  4HYE A;  2QWW A;  3LAP A;  1K79 A;  4LK0 F;  5KK1 A;  1ZN2 A;  1BI2 A;  4HQM A;  3G73 A;  4WXD A;  3Q5F A;  3CJN A;  1TQM A;  1ON1 A;  2HEO A;  3ABT A;  5E8I A;  5ICG A;  3RKW A;  3CUQ A;  1UFM A;  3KLN A;  1S7A A;  4UVA A;  1QPM A;  3HYI A;  5L3D A;  1KU9 A;  1I6X A;  2ZNZ A;  2YU3 A;  2P7V B;  4L9J A;  1O3S A;  1YW9 A;  1PP7 U;  1F1Z A;  1Y0U A;  4U0Y A;  4AIJ A;  1W5T A;  1R1T A;  3QAH A;  4KIG A;  3GF2 A;  3GX4 X;  1OYY A;  4G8X A;  1LB2 A;  3TKY A;  1QBJ A;  1D5V A;  1S8N A;  2MH2 A;  1HKS A;  4IPA A;  1Z6T A;  1R1U A;  2HTJ A;  5D6E A;  1GHC A;  1MD0 A;  3KLO A;  1ZG3 A;  4N0B A;  3K1M A;  1ONV A;  2HDC A;  5E1W A;  4PGG A;  4R8H A;  1QNT A;  1GXP A;  1I27 A;  4IRG A;  2HQN A;  4LD5 A;  3TDZ C;  1D8K A;  1J5Y A;  2DPU A;  2VT2 A;  1DPU A;  1UHW A;  4A0Y A;  3L9F A;  1LDD A;  4HLY A;  2D45 A;  5LGU A;  4NB5 A;  3BWG A;  3IWZ A;  2HKX A;  3I59 B;  3I5U A;  3CLO A;  4RGU A;  2PQ8 A;  1F9N A;  2UXN A;  3H92 A;  4Q48 A;  2O6G E;  4M6X A;  4OIP F;  3J81 Z;  3IKT A;  5D4S A;  3HHH A;  3ZN1 A;  1B1B A;  4TV7 A;  1G3Y A;  1XDS A;  5DUI A;  1XGM A;  3R4K A;  2G7H A;  2A68 F;  5FLX K;  1L3L A;  1BM9 A;  1LEA A;  4LG0 B;  4FT8 A;  4RB1 A;  2ISY A;  2E1N A;  3F3X A;  3DQV C;  1QGP A;  2KRF A;  2GA1 A;  3GLX A;  5D4R A;  1R5H A;  2P5K A;  3CO7 C;  3QP5 A;  4KN4 X;  2KKO A;  5LEK A;  4LLN A;  1SAX A;  5HLG A;  5HLH A;  2ADU A;  5E1Z B;  4I2O A;  1BJA A;  2UWM A;  3RDI A;  4EJU A;  2RV8 A;  6PAX A;  5H6R A;  1JXS A;  1ZH5 A;  1WWX A;  1U5T C;  2RVC A;  2FNA A;  3LST A;  3RI4 A;  5D8K B;  3COA C;  4BHP A;  2P6S A;  2MBF A;  4F7Z A;  2OAZ A;  2LKP A;  2RDP A;  2W84 A;  1UB9 A;  1UST A;  4A5N A;  4MTE A;  3S2W A;  2MLK A;  1W7P A;  3KCC A;  4EM0 B;  1LDK B;  2F5E A;  1BIB A;  4WK8 F;  1SMT A;  3F8N A;  5FD6 A;  4U0W A;  3HRU A;  2L4M A;  2M8E A;  2TDX A;  5DD4 A;  2JTV A;  3SZT A;  4G7H F;  2O3F A;  1K78 B;  2QQA A;  1WSU A;  2XAG A;  2DLL A;  3N4M A;  4UV8 A;  2JRT A;  4HDU A;  1J7K A;  5D5W B;  3HSE A;  2K4B A;  1KYW A;  2OZ6 A;  4UV9 A;  1F5T A;  4GGG A;  3WTU C;  3EYY A;  4YFN F;  4G7Z F;  1XGS A;  2VE9 A;  2OD5 A;  3LQR A;  2BE5 F;  3DXJ F;  5DEQ A;  3M9A A;  4EQQ A;  1QO0 D;  1IAW A;  3OOP A;  3RYR A;  1U2W A;  4BH9 A;  4R79 A; 
#chains in the Genus database with same CATH topology
 2CH0 A;  5GPC A;  1P4W A;  2VQL A;  2V7F A;  2CW0 F;  3W6J B;  2H6C A;  3BPV A;  5EEA A;  4ON0 A;  1XCB A;  1R9T J;  4A0X A;  4HRI A;  3MCZ A;  3M8F A;  4M9X A;  3TGN A;  4WF2 A;  1OYW A;  4BJ6 C;  2V6C A;  4C2T A;  2FBK A;  1X58 A;  3WTV C;  3FXM A;  2PBI A;  2JVH A;  3N05 A;  2EB7 A;  3JTH A;  2MSY A;  2GBY A;  4XOP A;  4B8X A;  2K02 A;  4HA8 A;  2MC4 A;  1MMA A;  1BR2 A;  3FXR A;  4ASN A;  3DPU A;  2VIX A;  4HV5 A;  4BAC A;  5GAH J;  1HKQ A;  2EIM H;  4P1W A;  2HR3 A;  1J09 A;  3ZCO A;  2CW7 A;  3MKZ A;  1TNS A;  4ZYH A;  2JA8 J;  3Q0U A;  2CV0 A;  3T8T A;  4XN0 A;  2KIM A;  4U7B A;  3CDI A;  2WBM A;  3PQJ A;  2E36 A;  3S32 A;  2F5C A;  1O7F A;  1REP C;  4XIC A;  2UUZ A;  3JAM Z;  5K5Q A;  3C3W A;  3SEZ A;  1JKQ C;  2VBX A;  4CHU A;  2DMT A;  4V2G A;  4MEY F;  1FJL A;  4Y13 A;  2FD5 A;  1XSV A;  2CJJ A;  5EEG A;  2V9K A;  5F27 A;  1HST A;  2NNN A;  1FPQ A;  4BUP A;  5KCM A;  4GYI A;  2LY1 A;  3S8P A;  4C2M J;  1FEX A;  1MMN A;  4UXN A;  3JSP A;  3A02 A;  1I1S A;  2VKD A;  3I64 A;  1N25 A;  3FWE A;  1RES A;  5F64 A;  5TIS C;  1BC7 C;  3ABK H;  1MMS A;  1S29 A;  2VC1 A;  1TZL A;  4V19 K;  1ZAO A;  1GLN A;  1QPI A;  1TWA J;  2VOO A;  4W97 A;  1VQP I;  2WC2 A;  1TT0 A;  1TBX A;  2HZT A;  4WX9 A;  4KFC A;  2DK5 A;  2WTE A;  3BC8 A;  2ME6 A;  3W2A A;  1ZLJ A;  1DPR A;  1W4M A;  2LYC A;  3KZZ A;  4I09 A;  5F08 A;  5CLS A;  1MDM B;  2NVQ J;  2KJB A;  3KEQ A;  1Y1W J;  2ZBK A;  2WA0 A;  2L2O A;  4HEA 2;  1E3P A;  2XKP A;  2CU7 A;  2JUG A;  3OR2 C;  1YYV A;  1D0X A;  2DA1 A;  2DAO A;  2DW4 A;  2K85 A;  2X6Y A;  3QYE A;  3K10 A;  4IXA A;  2CFX A;  5K7H A;  3MFK A;  2X51 A;  4OIR F;  3VYU B;  1KON A;  1U8R A;  2XGC A;  3B6C A;  1XSX A;  5BS6 A;  2KZG A;  2DA2 A;  1QZE A;  3BG3 A;  3J80 K;  2ZFW A;  1W0T A;  3B73 A;  3HUG B;  3E6D A;  3CUQ B;  3PUB A;  1JT0 A;  4EM1 A;  3N97 A;  4GRI A;  3BJA A;  4G7O F;  3K2A A;  1JJ6 C;  3BQY A;  1G3W A;  2EZH A;  3GYH X;  2LH9 A;  3JRD A;  3WOD F;  4I76 A;  1HCR A;  3RKY A;  2O0Y A;  2WB1 N;  2WY8 Q;  4E7S A;  3OYC A;  3MMY B;  4H0E A;  1UG2 A;  1DUX C;  1ACI A;  5FKM A;  3DP7 A;  4UNO A;  1IN4 A;  4YG2 F;  2HGC A;  2K3P A;  3NWT A;  5F1J A;  1SVL A;  1P6R A;  2P81 A;  4UVB A;  1R00 A;  1Q1H A;  2F4I A;  1R5I D;  2DFF A;  4D1Q A;  4ENM A;  3TO9 A;  3ZRG A;  4JYK A;  3PM1 A;  3FX3 A;  2V79 A;  1T0F A;  2L4A A;  5KVR A;  4L0Y B;  3BJ6 A;  2MC3 A;  5IT9 K;  5K7Z A;  5F6F A;  1W36 C;  1FOX A;  2F5V A;  1Y1V J;  2WAF A;  5FFX A;  1FTZ A;  1Y6I A;  3BTJ A;  4K2E A;  4BY1 J;  4KJZ A;  1EH8 A;  5JVG F;  1RI7 A;  3MEX A;  3TOA A;  1IUF A;  3VOE A;  3I0T A;  4KT6 A;  1CF7 B;  3T0Y A;  2O8X A;  2OA4 A;  4KIC A;  2MH9 A;  1ORK A;  2VOD A;  4GCV A;  2XGX A;  2M2E A;  1QVT A;  3BP8 A;  3PQK A;  4Y17 A;  3K4N A;  4Q47 A;  2DFH A;  1TWC J;  2QKL B;  2A3S A;  1IV8 A;  2CWE A;  2EBI A;  1R22 A;  3DEE A;  4RLF A;  5L3F A;  2JPB A;  4E7H A;  1E17 A;  4LLL A;  2KZV A;  4QSH A;  2XPV A;  2Z33 A;  3GTG J;  3GO5 A;  1DQU A;  2CUJ A;  3WGH A;  2IGO A;  2FOW A;  4AVZ A;  4RAZ A;  1ZLK A;  1R4M B;  1WI9 A;  3CME I;  4A5M A;  4A3E J;  2YR2 A;  1YX5 A;  3ZMS A;  2DOF A;  3ZQC A;  3WE2 A;  3DPL C;  1QA6 A;  1ETK A;  4B47 A;  4NNJ A;  3AFH A;  5L3G A;  3A4C A;  2LP0 A;  5IOZ A;  4E4H A;  1O7L A;  1IN6 A;  2RAE A;  2Y0S N;  5JVT A;  4XKV A;  5DTD A;  1XN7 A;  5LFA A;  3ROU A;  1STZ A;  5BOX A;  1ODD A;  3PNT A;  3K1N A;  2HWV A;  4EAT A;  5EF6 A;  1FIP A;  2VPR A;  1X4O A;  5HS7 A;  4AU7 A;  3C2G A;  2CO5 A;  3CD6 I;  5HDK A;  3GTQ J;  1F36 A;  4ESJ A;  3EPZ A;  3WTY C;  3ML6 A;  3MKL A;  5BPI A;  3E6M A;  3HOS A;  4E6K G;  5L3E A;  2V1U A;  2VAS A;  2FBI A;  4BQN A;  1EA3 A;  2ZCW A;  4LG0 A;  4IL6 C;  3W2V A;  2LFB A;  3GFI A;  2P8T A;  2PN6 A;  4FE4 A;  2FQ3 A;  4XBF A;  2A6E F;  3BR2 A;  1ETO A;  5CQG A;  3SJM A;  4HZF A;  3BCA A;  5FRM A;  2AQF A;  1OCR H;  1FLI A;  2LKS A;  4RMN A;  4IRI A;  2EJR A;  2OCE A;  3JTG A;  2XC7 A;  1IXS B;  3LWF A;  1UCR A;  3CLQ A;  4RLQ A;  5CPR B;  1FX7 A;  2ZFU A;  3ABU A;  3JCU C;  1IUY A;  2Y75 A;  1JUM A;  4O5V A;  1QVU A;  4I01 A;  4YIF A;  4EV0 A;  3RKX A;  2JA6 J;  2EFO A;  3WTS C;  4I99 C;  3V8L A;  3IH2 A;  4IHV A;  2R3S A;  3F21 A;  3O6B B;  2BHY A;  2IRF G;  1D3Y A;  1VQ8 I;  3BJO A;  3S1R J;  3IKV A;  2GQQ A;  5FJ8 J;  4PSX A;  2AXL A;  2R92 J;  2FEZ A;  2OQG A;  2RKH A;  4BAY A;  3OYJ A;  2GOM A;  2M87 A;  3ZP5 A;  1VND A;  4HG2 A;  1SFX A;  1W0U A;  3A01 B;  3R60 A;  2W25 A;  2E2H J;  1E2X A;  3SFZ A;  4CDG A;  2DA7 A;  1H88 C;  3ONQ A;  3GME A;  3CF2 A;  4QWQ A;  1XGO A;  3G4S I;  4IHX A;  4ZYD A;  2OQR A;  1D0Y A;  4L9N A;  2JZY A;  3WTT C;  1G3T A;  5D5U B;  4DZJ A;  2HYG D;  5AIQ A;  1B59 A;  1D1C A;  4UVC A;  2QQB A;  4XOT A;  5CVJ A;  2B9S A;  1WJF A;  5ED4 A;  3W6K B;  3BZ6 A;  3EET A;  2CW8 A;  1I50 J;  5M3M J;  2KPM A;  3JAM K;  3G1O A;  1VF9 A;  3IAS 2;  1UAA A;  4DZP A;  2Y2Z A;  2KRC A;  2M8G X;  3FMQ A;  3QYB A;  4RB0 A;  2L5Q A;  1H89 C;  1YIT I;  3M07 A;  2G9W A;  3FIW A;  3MZY A;  3VWB A;  2X1D A;  3HOZ J;  2XF5 A;  3FXL A;  5E1X A;  4RS8 A;  1OR7 C;  3RCO A;  5ICC A;  1IF1 A;  2EV6 A;  3EUH C;  2FUG 2;  3E6B A;  3ELK A;  1ZR4 A;  2ID3 A;  3K70 C;  3CES A;  4A6E A;  5LRS A;  4R1H A;  1P2F A;  3B6A A;  2QQ8 A;  3C7J A;  4L5I A;  3H3Z A;  3KYD B;  2STW A;  3OYL A;  3H3V K;  3HKZ A;  2ZNY A;  3CCE I;  3ERE D;  1K4S A;  3AG3 H;  2A05 A;  3BLY A;  1HDD C;  4BGD A;  2RGV A;  1ENH A;  5ICE A;  1QU3 A;  2OU2 A;  4XRS A;  4KT5 C;  5E3L A;  3HIF A;  3BTL A;  1BJZ A;  2DK8 A;  4IQJ A;  1EH6 A;  5DUK A;  3HSF A;  4CCL A;  3UKG A;  4LG3 A;  4E7Z A;  4BXU A;  1SFU A;  2WV1 A;  1BI0 A;  2FE3 A;  4RAG A;  2EFN A;  4CUG A;  4G94 A;  4E7K A;  4Q4Z F;  3MZ8 A;  5E3O A;  2LLK A;  1Z3X A;  5TJJ A;  4HX8 A;  1Z05 A;  3HGG A;  1BL0 A;  4BS9 A;  4B3A A;  1JTX A;  3GVA A;  2FA5 A;  4GDF A;  3DKY A;  5CVV A;  4KMF A;  4A0Z A;  3PIO F;  2ZJR F;  2ZJP F;  2CV2 A;  1XC5 A;  2CG4 A;  3WGG A;  4O6J A;  2HPI A;  1S9H A;  3Q9V A;  2E35 A;  2A5W A;  1V4R A;  2QBY A;  4U7D A;  1M1E B;  1DGW Y;  4HX4 A;  2QBY B;  1BIA A;  5K7F A;  5J1U A;  2KIS A;  3NAU A;  1Y0N A;  2ZJ2 A;  2Q8K A;  4C3J J;  3KFW X;  1OR7 A;  3GLL A;  4J19 A;  3S14 J;  5LHI A;  1D1A A;  2V26 A;  2DFI A;  3DTK A;  4HX7 A;  2JSC A;  5M3F J;  2OUM A;  3DFG A;  3IC7 A;  5F1R A;  3OS1 A;  2VLA A;  4PZJ A;  2IXS A;  2EK5 A;  1ZEL A;  4ESF A;  2EIN H;  1EJ9 A;  3I71 A;  2AHQ A;  3V7C A;  5J6X A;  3L2V A;  2L9V A;  1K61 A;  1GV5 A;  2BW3 B;  3SQN A;  2D1H A;  2PMH A;  1RR8 C;  1V5E A;  2PI0 A;  1EKE A;  4EJO A;  4BDZ A;  3RKQ A;  1ZGW A;  1D8J A;  5BMZ A;  3ZOB A;  3ZMT A;  2HTS A;  3CJT B;  2JK3 A;  2CUZ A;  1IXC A;  3PO2 J;  2X6O A;  4F92 B;  2VT3 A;  1OCT C;  1A36 A;  3DBL B;  3BPX A;  4NQW B;  3OL4 A;  1WJC A;  3JRH A;  3BG9 A;  2V4J C;  3LA3 A;  4G6D A;  3CUQ C;  4N9H A;  1Q1V A;  1G2H A;  2EIL H;  3LSM A;  3AG1 H;  3F22 A;  1IC8 A;  3QQA A;  4LLG F;  1K6Y A;  4PUS A;  3DTI A;  1GT0 C;  4PDK A;  2COB A;  1LQ1 A;  2HQA A;  1YOV B;  3E5X A;  3PO3 J;  3DEW A;  3QWL A;  3SDB A;  1AKH B;  1MKM A;  2ZO4 A;  3BDD A;  1VQ4 I;  1X1D A;  1HBX G;  1OFC X;  1GVJ A;  1WFX A;  2A5Y B;  2K4J A;  5GAE J;  2HOT A;  1TLH B;  4P55 A;  2FSW A;  3K9T A;  4FX4 A;  3IWF A;  3TW7 A;  3CMM A;  2ISZ A;  4ESB A;  2Y0S A;  3D5S C;  2PJR B;  1QRY A;  2NVY J;  3FK7 A;  4QLC U;  5F04 A;  3C1D A;  3UR3 C;  1LE8 B;  4E7I A;  3H1C A;  3J80 Z;  2BZT A;  4BQA A;  4AID A;  3VFZ A;  4GFB A;  1HW1 A;  3F8C A;  1FC3 A;  3DPT A;  3QU3 A;  1FOW A;  2R7W A;  2BHZ A;  2F5F A;  4V2F A;  4A3K J;  1HW5 A;  2ZSI B;  2DA5 A;  1BN5 A;  2QCO A;  1TWG J;  3E3V A;  5HOD A;  1NG7 A;  4B4C A;  2J5P A;  3P9C A;  2ETH A;  4XKW A;  2K9M A;  3WE3 A;  5DCF A;  3OY9 A;  1TWF J;  1GV2 A;  2CSO A;  3J7Z I;  4HNT A;  4ZYE A;  4IX7 A;  3KYL A;  2M7B A;  3BY6 A;  3L2C A;  3W3C A;  4A3G J;  3VYT B;  4LIT A;  3G1M A;  4B09 A;  3IRR A;  1YFH A;  1OCZ H;  3TP0 A;  4CH7 A;  4FTH A;  4HF2 A;  3BG7 A;  1X2N A;  1F43 A;  4I0A A;  2CS3 A;  4OOI A;  5EDN A;  1RUN A;  2DMQ A;  2E1M B;  1KU7 A;  2R7X A;  4CCM A;  4AIH A;  3MD2 A;  4RGS A;  1MBH A;  2BXZ A;  2H8W A;  2VKV A;  2XUB A;  3S17 J;  4HV6 A;  3MAJ A;  1QZY A;  4BE1 A;  4IEJ A;  1UEL B;  1T33 A;  3JRE A;  3OYK A;  3TL4 X;  1IW7 F;  3BTI A;  2IS2 A;  1FMW A;  1U8B A;  1HDP A;  4X0G A;  1YTY A;  4D5F A;  4XLF A;  1PUF B;  3CMY A;  1ETV A;  1E0E A;  2IS4 A;  3LL7 A;  2JMW A;  1KGS A;  1G3S A;  3KYC B;  1I3Q J;  2W85 A;  5HNH A;  3SYT A;  3OS2 A;  3JRA A;  1JHF A;  1S5L C;  2VKH A;  3ERM A;  4RM2 A;  1YO5 C;  1WPK A;  2W57 A;  3W6V A;  1WZ2 A;  1WH5 A;  2R7Z J;  3PIP F;  2QLZ A;  1LUJ B;  3FM3 A;  2HQ5 A;  1AA7 A;  2XRN A;  1XCV A;  3F8M A;  3LA2 A;  3FBN B;  3E5U A;  4D7N A;  4ENK A;  4ZTJ A;  2MLG A;  3U2R A;  1NK2 P;  2R5Z B;  3V4G A;  2WAD A;  1QHH D;  1FBQ A;  4BKX A;  3KET A;  1ZRC A;  2BYV E;  1JKO C;  1WJD A;  2WB1 A;  4I7H A;  4RAF A;  3V8J A;  3ISP A;  2EV5 A;  3PFI A;  3DU5 A;  2ZJQ F;  2X6X A;  4ENJ A;  3VSL A;  5J4V A;  1IXR C;  3CC4 I;  3VDX A;  3IH3 A;  4BQQ A;  3HOV J;  4BJ5 C;  1L0O C;  3H5R A;  3ZMV A;  2HU9 A;  2DDA A;  4NHJ A;  1SAN A;  2NVX J;  2Z5U A;  4KUM A;  1WJ5 A;  1ZG1 A;  4ETS A;  1K78 A;  2VJ4 A;  1LDJ A;  1LE8 A;  2HDD A;  2KHM A;  4XRF A;  4RGX A;  3OSF A;  1TW2 A;  2ZME C;  3QPT A;  4UHT A;  5E3M A;  2PJR A;  1TL8 A;  1IJW C;  2HDW A;  3AG4 H;  3HRT A;  2QGU A;  1JJ8 C;  2VQC A;  3DKW A;  2STT A;  4P5O A;  4BYY A;  2QYO A;  3BZK A;  3K2Z A;  4GYG A;  4GXO A;  2FX0 A;  4ZH4 F;  2GM4 A;  2XSJ C;  3E97 A;  3BR6 A;  2L7F P;  1DP7 P;  4N9I A;  3I53 A;  2OC6 A;  2IA0 A;  2W1O A;  3H9J A;  3R6S A;  1CF7 A;  2XVC A;  3EUH A;  3LA7 A;  4Q5S F;  4JX5 A;  3WG7 H;  2MFZ A;  3ZMU A;  4WWC A;  1G4D A;  4CYC A;  4DBQ A;  3DTE A;  2Q2E A;  1YLF A;  4PJJ A;  1BA5 A;  2GOX B;  2H27 A;  2VPL A;  5H6Q A;  4IHT A;  2O8K A;  1JTY A;  2QZ8 A;  2XAF A;  2DBB A;  2ELK A;  4A3C J;  5LBQ A;  1K7A A;  1QHG A;  4JOM A;  1PDN C;  5ILS A;  3E1S A;  4BY7 J;  1ZTR A;  3X2Q H;  2EFW A;  5EZH A;  3L2Q A;  3S3M A;  3MQ0 A;  2XF7 A;  3OWT A;  2X4H A;  1YQA A;  1HA8 A;  4P96 A;  2IA2 A;  2E7X A;  3QOD A;  2IT0 A;  3S2D J;  3VOD A;  5DD8 A;  1YX3 A;  3HM5 A;  1WHU A;  3L2R A;  2EA2 A;  2OPT A;  4MFE A;  2DJI A;  1FWZ A;  2EFP A;  2ME0 A;  2QKM B;  1JKR C;  3HGY A;  2IEK A;  4E70 A;  5L3C A;  2YX7 A;  2IP2 A;  2KL4 A;  1IRG A;  4MNU A;  2DMU A;  2K86 A;  4L18 B;  2LBF B;  2NS8 A;  1SD6 A;  3BR5 A;  3P7N A;  2XAH A;  4MQV A;  5J1R A;  2A6T A;  2R5Y B;  3IH4 A;  2YU9 J;  4A6D A;  1POG A;  2B0L A;  3OYB A;  3MZH A;  5CVU A;  1FYL A;  2D2W A;  1MBK A;  2XPU A;  5E8G A;  1UHS A;  3KP7 A;  2K9N A;  3SXY A;  2DFE A;  3RIR A;  2ZXJ A;  1K83 J;  4XMY A;  1PP8 F;  2ECC A;  5B5E C;  4E7L A;  5CVR A;  3CQZ J;  4ZZD A;  2ZKZ A;  1FBS A;  4A69 C;  3P9K A;  1YJ9 I;  2QA4 I;  1TW3 A;  4UUS B;  1V54 H;  4XRS G;  2DCE A;  2WWY A;  4DW6 A;  4LIU A;  1WI3 A;  1XSD A;  3GXO A;  2IJL A;  2WY7 Q;  3OYH A;  4ITV A;  4CYD A;  1X3Z B;  2BY3 A;  2ZXW H;  3LNQ A;  2XSD C;  4OIQ F;  1KA8 A;  2ZXH A;  2QF7 A;  3NEU A;  1YW7 A;  2HZD A;  1RR7 A;  2CYY A;  3HJE A;  3ZQH A;  1LFB A;  2LK2 A;  1JKP C;  5E79 C;  4KNY A;  2A69 F;  1IDZ A;  2B63 J;  3H5N A;  4I98 B;  2NRA C;  3DBR B;  2DOA A;  3GWZ A;  1MBF A;  2IAI A;  1Z91 A;  1MBE A;  3I59 A;  2K5C A;  3ZPL A;  2IVM A;  4U87 A;  4M71 A;  3DU6 A;  4HF0 A;  3CDH A;  3CCQ I;  1WH7 A;  1KQ9 A;  5ERI A;  1OCP A;  1X1C A;  2DYS H;  4LFU A;  4RGR A;  4WXH A;  2BEO A;  1B6A A;  1KQ8 A;  1ON2 A;  2KDZ A;  2N8G A;  3F9K A;  3ZQL A;  1A35 A;  4XLN F;  1B4A A;  4A3L J;  1RET A;  2X0L A;  2BV6 A;  1JE8 A;  1Z0X A;  5ILU A;  1CGP A;  2ESH A;  4B1R A;  1JGG A;  3HOY J;  1FMV A;  3NAR A;  4U88 A;  4L9T A;  1U9N A;  3PSI A;  3I55 I;  2XV4 S;  1RPW A;  3BG6 A;  1FY7 A;  1OKR A;  4CZC A;  2RRE A;  3QU6 A;  3HRM A;  2K27 A;  5B66 C;  3AKZ A;  2Z3Y A;  2BVM A;  5EZG A;  3S16 J;  5J47 A;  3CZ6 A;  3SZG A;  2JQ7 A;  3E0J B;  3M7G A;  3RPQ A;  2C6Y A;  3LSR A;  3J81 K;  4OMZ A;  4XSX F;  2X9D A;  3CMA I;  5JFR A;  3HTU A;  5DCM A;  1AU7 A;  1U5T A;  2AO9 A;  2FU4 A;  2YSR A;  3SDG A;  2LF7 A;  3ZQ7 A;  2DT5 A;  5FD5 A;  3F23 A;  5B1B H;  1R1V A;  2VI6 A;  4IRH A;  3FIS A;  1ZRF A;  1I5Z A;  1VZ0 A;  1AOY A;  2VN2 A;  3A1Y A;  4OIN F;  4DNC A;  1IZ1 A;  1ZGA A;  3GFL A;  4I0B A;  3QP6 A;  1VQ5 I;  1Z7U A;  3SZP A;  2V1X A;  3DEU A;  3ASN H;  1E3O C;  2DO7 A;  3HZJ A;  4DYR A;  4F3Q A;  2R7F A;  4LMY A;  4YFK F;  4QIW N;  5GTH C;  3DLL F;  4BE0 A;  3CCS I;  2R5Z A;  2I5U A;  3FDY A;  2BY0 A;  1V5F A;  2L54 A;  4KA4 A;  1KU3 A;  1XMX A;  1FSE A;  1AWC A;  3WU1 B;  4XRM A;  2MD5 A;  2NYX A;  3BT9 A;  5AON A;  5JI6 A;  2COM A;  4A12 A;  2E1M C;  2HNH A;  3VB2 A;  1Y8R B;  1T38 A;  1B8I A;  3PNY A;  5LGT A;  1NHA A;  4HPQ A;  2QVO A;  4PJL A;  3WG9 A;  2DA6 A;  2YPR A;  1LEB A;  4B48 A;  3WTZ A;  3HHG A;  1FBU A;  4PFP A;  3F6O A;  2O03 A;  4M3G A;  1ZGJ A;  1J2X A;  2UXX A;  3CCY A;  4CIC A;  2ACJ A;  3Q0W A;  3K4M A;  2Y48 A;  1C0W A;  4X6A J;  1MBJ A;  2ID6 A;  1O3T A;  2V1D A;  4UB8 C;  5GP9 A;  1FOK A;  4PJ0 C;  2DN0 A;  2V1N A;  1YIJ I;  2D5V A;  3QOP A;  2MGQ A;  2DOE A;  2R93 J;  2K9S A;  4BJT A;  4A3D J;  2Q1Z B;  1T95 A;  4AD9 A;  1YIO A;  1YJN I;  2F4M B;  4JK1 X;  4ZC3 A;  5IP9 J;  3IAM 2;  4EVI A;  2FBH A;  5LRR A;  3NQO A;  3HXL A;  1UG0 A;  2KJC A;  2BGC A;  2RNJ A;  1Z1D A;  1IN8 A;  2R7S A;  3QPL A;  1TT5 B;  3K4B A;  3RZO J;  5IPA A;  5D8L B;  1X1A A;  2GA2 A;  4XON A;  4MGR A;  4HAM A;  3CO6 C;  2O7O A;  1VQN I;  4LB6 B;  2NVT J;  2V6E A;  1EV7 A;  4Y7N J;  4FAS D;  1KQ0 A;  1RNL A;  1W7P B;  3KZY A;  5JLX A;  4ZJZ A;  1TC3 C;  2XIG A;  3NWS A;  2HPM A;  1MH3 A;  3Q9S A;  5J1Y A;  5EG0 B;  3G71 I;  2E71 A;  3BQZ A;  1P92 A;  2AXT C;  2NS0 A;  3HG9 A;  1ULY A;  2EV0 A;  5M5Y J;  3JRC A;  3L09 A;  1X4P A;  2LY2 A;  2TRT A;  4CCN A;  5E18 F;  2W4S A;  4A3B J;  4E7J A;  5D5V B;  3R0J A;  5CVI A;  3U1D A;  2NOJ B;  1XGN A;  4P9U A;  5LHH A;  4Y52 J;  3QYF A;  2H1K A;  3H0D A;  2YUS A;  1IV6 A;  3GTP J;  2Q0O A;  2DXI A;  2P5V A;  2XDV A;  1JUS A;  4KN7 X;  3RJP A;  1SC7 A;  2RC4 A;  2BY1 A;  3GFM A;  4M72 A;  1MJ9 A;  4EJW A;  1VQL I;  1DGR M;  1SD4 A;  4HLX A;  3VYR B;  2GXG A;  2DMP A;  2Y31 A;  5HVQ C;  4BNC A;  2ELJ A;  3MKY B;  1N75 A;  3LSH A;  4HNV A;  3BR3 A;  3ABL H;  1SVM A;  1B9M A;  1W7P D;  1S7O A;  5D6F A;  2FML A;  5C3E J;  4IHS A;  2X48 A;  4JX4 A;  3AL0 C;  1AKH A;  1Z77 A;  3FMR A;  3V8K A;  2VQH A;  1LJ9 A;  2GIZ A;  1WJA A;  1YRN A;  3J7A O;  2QM3 A;  2MA3 A;  3CTA A;  4NUB A;  4BXF A;  3KP5 A;  4XQF A;  3LFU A;  2OCC H;  4M73 A;  3GUD A;  1OMI A;  5K5R A;  3LQQ A;  2E2J J;  4A3M J;  2IGK A;  3TDU C;  3CUO A;  3JRB A;  5E17 F;  4PGH A;  5B1A H;  5A2Q K;  3QRF F;  5D5X B;  3RYP A;  1J0R A;  1XX5 A;  1WQ2 A;  3K4J A;  1BBY A;  3ZN0 A;  2D1V A;  3KIO A;  1IRF A;  4NC7 A;  1VQ7 I;  2JA5 J;  4HW0 A;  1N77 A;  4KYW A;  2XGE A;  1S72 I;  3FM5 A;  2BW3 A;  2E2I J;  1EF4 A;  2W82 A;  3H35 A;  2R4G A;  1VQK I;  2ELH A;  5IP7 J;  1K4T A;  2Y30 A;  3FXO A;  1MDM A;  1ZK8 A;  4S05 A;  1BI1 A;  2DQR A;  5HS9 A;  1U3E M;  3TBI A;  1J75 A;  3V7R A;  1MJB A;  4EJT A;  3M8E A;  2BVL A;  2VXZ A;  3BTC A;  3JSO A;  3E6C C;  2DA4 A;  4HNU A;  1T56 A;  2VC0 A;  3OYI A;  5LHG A;  4KIB A;  2VOP A;  2ZME B;  3HPH A;  3B02 A;  4AWX B;  3LAJ A;  3S1M J;  4A2U A;  4I6Z A;  3I56 I;  2XAS A;  4XLH A;  3RQI A;  2BXY A;  2QQ9 A;  2MYS A;  1F4K A;  2EWN A;  1WKM A;  1H9T A;  1BW5 A;  3K7A J;  2LY9 A;  5EGO B;  4OU0 A;  2H09 A;  2PMZ A;  1PUE E;  3G6E I;  1BR4 A;  4EEF G;  3M1E A;  4G9Y A;  3O8G A;  3S1N J;  3FF5 A;  3M1C A;  3KPH A;  2OTJ I;  4RB2 C;  3VPR A;  4DOZ A;  3WHB A;  1LVA A;  3RSN A;  1IGN A;  1MND A;  1OYI A;  1S3J A;  2XKO A;  3GW2 A;  3KP2 A;  4IVN A;  4CGZ A;  3FXJ A;  4RB3 C;  3DV8 A;  5DYM A;  1FZP B;  2HKO A;  3F72 A;  5GTI C;  3F6V A;  3KP6 A;  3HOT A;  4ENN A;  4BE2 A;  1TQP A;  2IA1 A;  3CJQ B;  1YS6 A;  2CMP A;  4A93 J;  3TOB A;  2VXD A;  1H8A C;  1FP2 A;  3QOE A;  2M4G A;  1RZ4 A;  3T1B A;  3BRO A;  4O3M A;  3R61 A;  5FKN A;  3O3K A;  1W5C C;  2LMD A;  2W24 A;  4YII A;  5K1Y A;  4F91 B;  2FQ4 A;  1BI3 A;  5DS9 A;  2GIV A;  3ZGK A;  4IF4 A;  1P4X A;  2LNB A;  2ZXI A;  2AS5 F;  1ITY A;  3QPS A;  4XLA A;  2A6H F;  4LB5 A;  2WAE A;  1T6S A;  1U78 A;  2E1C A;  2BBY A;  3OS0 A;  1VFC A;  1HQC A;  5CJ9 A;  2PLY A;  4AIK A;  3S3O A;  4L5E A;  3V42 A;  2JPC A;  2E5Z A;  2CGP A;  3GTK J;  1X3U A;  3FXK A;  4XLE A;  4C3I J;  1MJA A;  2VJI A;  3CC7 I;  2FOK A;  2PG4 A;  1S6L A;  4CCK A;  3FHZ A;  1SMY F;  2A61 A;  2JSP A;  3O2P E;  4FE7 A;  3I58 A;  2DPD A;  4ZDL A;  3OYE A;  4XK4 A;  1XD7 A;  1SFO J;  1FYM A;  4XID A;  1OCC H;  1DU0 A;  2W7N A;  1I39 A;  5H20 A;  2WAQ A;  3HOU J;  3D0S A;  3A01 A;  5KHD A;  2MW8 A;  3K1P A;  3VSK A;  3SFI A;  4A3I J;  2K9L A;  3REO A;  3ZR8 X;  4JX6 A;  1RKT A;  2PEX A;  1IO2 A;  3PUF A;  5FLX Z;  4AUX A;  4HSR A;  3ZMD A;  2V9V A;  4M3D A;  4D5C A;  2ZME A;  3KP4 A;  1G8X A;  2F5D A;  4WCG A;  2X1C A;  5HLI A;  5IYD J;  4I02 A;  4GO1 A;  3CCL I;  5CYV A;  1I3A A;  1ZG5 A;  3BR1 A;  2O61 A;  1WJB A;  3PFY A;  4AYB N;  2NS7 A;  2VBZ A;  4UUV A;  1UHM A;  3D5L A;  1R49 A;  1VI0 A;  3HRS A;  4EM2 A;  2R7U A;  1ZRD A;  3GZ6 A;  4BBR J;  3JW4 A;  4RM3 A;  5GAG J;  1GXQ A;  2NAZ A;  2R7O A;  3E7L A;  1WVR A;  2M7A A;  3KEO A;  4MIM A;  1X1P A;  4S04 A;  4MHG A;  2RN7 A;  3WU0 A;  3K0L A;  4X1E A;  3WTW C;  3BOQ A;  4BHC A;  2HXI A;  2DA3 A;  3IV5 A;  2AQE A;  2ECB A;  3HKZ N;  2PMZ N;  2UV1 A;  4MTD A;  4MQ9 F;  2RQQ A;  3L2W A;  3K6G A;  3ECO A;  4HOB A;  5LEJ A;  5ILV A;  1TQI A;  2XRL A;  3FMS A;  1QQI A;  1R6R A;  2L02 A;  5F0F A;  2H94 A;  5DV5 A;  1D5Y A;  3J7A Y;  4BXX J;  3IRQ A;  2PMU A;  2KLO A;  1R5G A;  1XS9 A;  3OV8 A;  3Q0V A;  3K69 A;  4JP0 A;  1FSH A;  5HLT A;  2VUM J;  1TWH J;  2P6T A;  1OIS A;  1OJL A;  3EDP A;  3ZXS A;  3CJR B;  1ETY A;  2WV0 A;  1X2M A;  1DDN A;  5FFZ A;  3CP8 A;  4CSW A;  1PVE A;  5FGM A;  1B72 A;  2E7W A;  2GZW A;  5TGT A;  2I10 A;  3I3L A;  2R7R A;  1Z21 A;  1ETX A;  2Z9O A;  2XHK A;  2LVS A;  1V5G A;  3ZQG A;  3IHU A;  5KNL A;  5EGO A;  3CF5 F;  2HFH A;  2E34 A;  3ULQ B;  2EQR A;  2M45 A;  4DQ2 A;  3DWL E;  1JGS A;  1J59 A;  1B72 B;  1T2K A;  1W1W E;  3H3U A;  3OL3 A;  3OR1 C;  2LG4 A;  1U9O A;  2DYR H;  4AM3 A;  4EGY A;  1H9G A;  5IT3 A;  2XAJ A;  3DCF A;  4NC6 A;  2G7U A;  4BEH A;  2L7M P;  3MKW B;  3CCJ I;  2KIF A;  2DTR A;  3JRG A;  1H0M A;  1A04 A;  2FRH A;  5JHF A;  1HKT A;  4JQF A;  2EA4 A;  2LSO A;  2DTZ A;  1YS7 A;  2Y0M A;  2OTL I;  3L00 A;  4XLP F;  3FHN A;  2GXB A;  2E1O A;  2FJ1 A;  4HQE A;  1UJ8 A;  1P7J A;  2QSF X;  3OOU A;  2X1E A;  3TO7 A;  1X1B A;  1P7I A;  4NQW A;  2HOA A;  2PFB A;  1RKW A;  3C18 A;  1HXD A;  4HBL A;  1YG2 A;  1D1B A;  5EEH A;  5FB2 A;  3HTS B;  1FNN A;  1XMA A;  4ZYG A;  5C44 J;  2P5L C;  3Q3S A;  4IOC F;  1SFK A;  3CCU I;  1I1G A;  4YIR X;  1GUU A;  3KX2 A;  2JN6 A;  2F6C A;  3TED A;  3I4N J;  2LR8 A;  1NTC A;  1XMK A;  1A5J A;  2RQP A;  4D7M A;  2HYF A;  3HPG A;  1WJE A;  2KIU A;  3G3Z A;  2NOG A;  3LFK A;  4M6Y A;  4Z2Y A;  2CV1 A;  3ZMZ A;  2LOO A;  4B44 A;  2HS5 A;  3TQN A;  2VBY A;  2YX4 A;  3T5X A;  2LTP A;  3M8J A;  1N78 A;  1MGT A;  4G6Q A;  3HUG A;  3I54 A;  1YRN B;  1JHH A;  2HVS A;  3RPU D;  1S7E A;  3KP3 A;  2G0E A;  2IGM A;  5J8C A;  1BOB A;  1WRJ A;  3WGI A;  1VTN C;  3MWM A;  3F8B A;  1RIO H;  1SD7 A;  2J5O A;  5FO5 A;  3H0G J;  3E5Q A;  1G59 A;  4HDV A;  1JI8 A;  2ZB9 A;  5IT9 Z;  2OJE D;  4Y15 A;  1YI2 I;  1R7J A;  3OIQ A;  1IN5 A;  2CQ7 A;  5C4X J;  1T39 A;  3GFJ A;  1MZB A;  3H36 A;  5HNF A;  2IGN A;  2A07 F;  3GTO J;  1LNW A;  2VBW A;  3KE2 A;  2PJP A;  5J4Y A;  3GZ5 A;  3FKJ A;  2JT1 A;  1FP1 D;  4CCO A;  1SAU A;  2L7K A;  2QEN A;  3HL2 A;  1ZRE A;  5KAI C;  4WXC A;  4KIF A;  3FZV A;  4XR6 A;  4PJN A;  3HC7 A;  2DDB A;  4J01 A;  2M0M A;  1BOA A;  1O3R A;  2O5R A;  1HSJ A;  1EH7 A;  2HOS A;  2K9Q A;  1T98 A;  4DIQ A;  5DCM B;  2BY2 A;  1MIJ A;  5GAD J;  5LGN A;  2EZK A;  2VE8 A;  2UZK A;  5HS8 A;  2H1L A;  3TO6 A;  5EG0 A;  3ECH A;  2IPQ X;  1USS A;  2GWR A;  2DI3 A;  1O57 A;  4XLC A;  4AVP A;  3AAF A;  4OIO F;  3PNV A;  2I8D A;  1HLV A;  1LFU P;  4FHT A;  1YJW I;  3RPU A;  5DDG A;  3CCR I;  2ICW G;  1Z7L A;  9ANT A;  1Z6R A;  3IL2 A;  3R0A A;  3T8R A;  1V3F A;  4LGW A;  3S1Q J;  3LMM A;  1B9N A;  2XAQ A;  4C9Y A;  3O8H A;  4YFX F;  2EIK H;  2L9N A;  4L9V A;  3S93 A;  1Z67 A;  3DLA A;  2ESN A;  1JUP A;  1U0J A;  3L7W A;  4II2 A;  3K4L A;  3OIP A;  3K4C A;  4P9F A;  3CC2 I;  1T08 B;  3V7S A;  4M9Z A;  2JUC A;  4LIV A;  3QPH A;  2DQL A;  2CQK A;  1MW7 A;  3JRF A;  5HDN A;  2CQQ A;  2R7Q A;  3K4K A;  4XOR A;  2Y9Y A;  1Z9C A;  1QZZ A;  4L5J A;  1O3Q A;  1MNE A;  1XTA A;  4NDL A;  3VEP A;  2F48 A;  1R36 A;  2FF4 A;  1VQ6 I;  2KQR A;  1MBG A;  1FT9 A;  1OQY A;  1YW8 A;  4LJZ F;  1TNT A;  1OPC A;  3KEY A;  2QUF A;  2KRH A;  2NVU B;  1W36 D;  1MSF C;  4XNF A;  4OMY A;  3M4O J;  3GZN B;  2OBP A;  2VB6 A;  1X19 A;  4KIS A;  1PUF A;  4CO8 A;  2F2E A;  2LF8 A;  4XL9 A;  4LK1 F;  4YRV A;  2R7V A;  1VQO I;  3BCB A;  2EFQ A;  5HOO A;  5B3S H;  1P4A A;  2MAB A;  1K6O A;  1Y8Q B;  1U6G A;  3JRI A;  2FMY A;  3D5R C;  1LVK A;  1E3H A;  1A31 A;  4D0P A;  2WAQ N;  2DT6 A;  3WTX C;  2QSG X;  1D0Z A;  5A2Q Z;  2KDO A;  4IJA A;  2LC2 A;  1CQT A;  1IN7 A;  2JRM A;  2OF7 A;  5FLV A;  1ZAR A;  1U5T B;  5LLQ A;  1A6I A;  2DU9 A;  3U9G A;  3ASO H;  5BQT A;  3P9I A;  4BL0 B;  3SHF A;  3UNG C;  2Z99 A;  4II3 A;  4BHB A;  5TRD A;  4G12 A;  3LSP A;  1RUO A;  2L0K A;  4IHW A;  1ZHF A;  2M5W A;  1LKX A;  4DYQ A;  3U1K A;  3IP4 B;  2P7C B;  2CUE A;  4BEH B;  2LKX A;  3G2B A;  1ZYR F;  2R5Y A;  3GEZ A;  5FKK A;  4Y33 A;  1FYK A;  5K5O A;  1KU2 A;  3LOC A;  4CXF A;  3EYI A;  1YHQ I;  2LRD A;  1LPQ A;  3BZC A;  3RTR A;  2JA7 J;  5ICF A;  1RRJ A;  4IHY A;  3J7Y J;  4BQO A;  4KDP A;  2LDU A;  3ZQF A;  3GTM J;  1W5S A;  5LD2 C;  2R0Q C;  3EQL F;  4Y3O A;  5KAF C;  4QPQ A;  4A3F J;  3RZD J;  2PX9 A;  1XB4 A;  2F4O B;  2HQR A;  2K7L A;  5AIP A;  3AL0 B;  3IUO A;  2JA2 A;  2DJN A;  4RAY A;  4S0H B;  4KMU X;  1ZKG A;  2CQX A;  1R4N B;  5DM6 F;  3OYD A;  1SFE A;  2VON A;  2HOE A;  2P4W A;  2NNY A;  3HSR A;  2JWT A;  2CRG A;  3SEQ A;  2M3A A;  5M5W J;  5BPD A;  5FKO A;  3CCV I;  2DOD A;  4F93 B;  4C2U A;  3F8F A;  3LSG A;  4LOC A;  2M1B A;  2FXA A;  2R7D A;  4U0V A;  3FKI J;  1RC9 A;  1MH4 A;  2P0W A;  2HXO A;  3DF8 A;  5F0H A;  3OYF A;  4ABZ A;  5L3B A;  3I4P A;  2HVR A;  4CZZ A;  4EGZ A;  2HVQ A;  3DKX A;  3H9G A;  2YS9 A;  4YEJ A;  4ZZL A;  4UY8 I;  2OZU A;  1XPX A;  5J8F A;  3P5J A;  1FOY A;  5HDG A;  1R71 A;  2IW5 A;  2FNP A;  4EJV A;  4EMS A;  4FCY A;  4HF1 A;  4ANJ A;  4JBA A;  2H6B A;  1TTY A;  2Y9Z A;  1J9I A;  4XSZ F;  3WU2 C;  2XRO A;  1R58 A;  2MD0 A;  3FXQ A;  4N4N B;  1SD5 A;  4UUS A;  2M30 A;  2L9R A;  3RQ4 A;  4FX0 A;  1R23 A;  4M9S A;  3OMY A;  5JR3 A;  3VYS B;  3OYN A;  4PCQ A;  2DMN A;  3FXU A;  5EJC A;  3NRV A;  4L0Z B;  4FET A;  1PJR A;  3PL8 A;  1G6N A;  1BC8 C;  1BW6 A;  2Y69 H;  5CQE A;  2L3D A;  5J40 A;  1HW2 A;  4F52 A;  2L01 A;  1GDT A;  2GAU A;  1XDU A;  1IRZ A;  1KYZ A;  4M74 A;  1Z3Y A;  1ETW A;  4MEX F;  5E20 A;  2CQN A;  2X6W A;  5JHU A;  1X3W B;  2KMU A;  4HYE A;  4A3J J;  2QWW A;  1IDY A;  4BU2 A;  3LAP A;  1SEU A;  3WHC A;  4LK0 F;  2VJJ A;  1K79 A;  1NH3 A;  1P9Q C;  5KK1 A;  2ZSH B;  1MNM C;  1DP3 A;  3I9V 2;  2RNG A;  4IOA F;  1ZN2 A;  1BI2 A;  4HQM A;  3G73 A;  4PJM A;  4WXD A;  2HYJ A;  3CJN A;  3Q5F A;  2XF6 A;  1TQM A;  1JT6 A;  2E5N A;  1O4X A;  1ON1 A;  2XGD A;  4PFO A;  2HEO A;  3ABT A;  4D9J A;  2JJ7 A;  4ZDP A;  5E8I A;  5ICG A;  2IBD A;  3HBL A;  3MN2 A;  3RKW A;  3CUQ A;  1FIA A;  4M3B A;  1HF0 A;  5H2F C;  4BBS J;  1UFM A;  3KLN A;  4QTR A;  4C30 A;  1S7A A;  2L7Z A;  4UVA A;  4CCJ A;  2VJ5 A;  2M0C A;  1QPM A;  3HYI A;  3PJR A;  4N4O B;  4RBO A;  5L3D A;  3A03 A;  1KU9 A;  1LFP A;  5IY5 H;  5IOY A;  1I6X A;  2KP6 A;  2ZNZ A;  2YU3 A;  4ZYA A;  4AC0 A;  2P7V B;  1PYV A;  4L9J A;  2JVG A;  1O3S A;  2IS1 A;  2M9H A;  1YW9 A;  1T8I A;  1F1Z A;  3C2H A;  1PP7 U;  4F55 A;  1Y0U A;  2E19 A;  2OV7 A;  2Q2E B;  1NK3 P;  2B7E A;  4U0Y A;  3L1P A;  4AIJ A;  1W5T A;  1R1T A;  1ERD A;  3QAH A;  1A6Q A;  4C3H J;  3D1N I;  3L2U A;  3OYG A;  4KIG A;  3GF2 A;  3GX4 X;  1OYY A;  2ZC2 A;  4G8X A;  2Z1D A;  1LB2 A;  3TKY A;  1QBJ A;  1WGX A;  4UUT A;  4B43 A;  4HST A;  1D5V A;  2Z2S B;  1NG6 A;  1S8N A;  5C4J J;  3OYA A;  2MH2 A;  1HKS A;  2H8R A;  1SVO A;  2M4K A;  2LRE A;  4XKC A;  2GXA A;  2MG4 A;  4IPA A;  1UZC A;  1Z6T A;  1R1U A;  2HTJ A;  5D6E A;  4IO9 F;  2XPW A;  1GHC A;  2XB5 A;  2Z16 A;  1MD0 A;  3KLO A;  1ZG3 A;  4N0B A;  3K1M A;  1APL C;  1ONV A;  2HDC A;  5E1W A;  4BDY A;  4PGG A;  4R8H A;  2V9P A;  2M34 A;  1QNT A;  5FRN A;  2XAU A;  1GXP A;  1I27 A;  2QSH X;  4IRG A;  2HQN A;  4LD5 A;  3TDZ C;  3A0H C;  5FKL A;  5F0C A;  3OIO A;  3M3Y J;  5GPA A;  2O9L A;  1D8K A;  3GTJ J;  4MFD A;  4DBR A;  1J5Y A;  4PSW A;  1VQ9 I;  2DPU A;  4M6V A;  2KIQ A;  2VT2 A;  1DPU A;  1UHW A;  3A0B C;  4A0Y A;  3TW6 A;  3L9F A;  3OSG A;  2K40 A;  1LDD A;  5CKT A;  3TP3 A;  1TP4 A;  4HLY A;  1FTT A;  2D45 A;  5LGU A;  5M5X J;  2R7T A;  4NB5 A;  3BWG A;  1V55 H;  3IWZ A;  2HKX A;  3I59 B;  3I5U A;  3CLO A;  4QPO A;  4RGU A;  5FLM J;  2PQ8 A;  1F9N A;  2UXN A;  5DM7 F;  3H92 A;  4MLO A;  4DGW B;  2W00 A;  4Q48 A;  4FIS A;  2O6G E;  3KZI C;  4M6X A;  4OIP F;  2VKE A;  3PSF A;  3J81 Z;  1UMQ A;  3IKT A;  5D4S A;  2BOL A;  3BG5 A;  3HHH A;  3ZN1 A;  1B1B A;  4TV7 A;  4NBQ A;  4DJA A;  1G3Y A;  4UB6 C;  1XDS A;  5DUI A;  1XGM A;  3R4K A;  1IG7 A;  3G1L A;  3ABM H;  2GLO A;  1MMG A;  2G7H A;  2A68 F;  5FLX K;  3EUA A;  1L3L A;  1BM9 A;  1LEA A;  4LG0 B;  4MO7 A;  4FT8 A;  4RB1 A;  2ISY A;  2E1N A;  3F3X A;  1IRX A;  4RA2 A;  3DQV C;  2L9S A;  5IYB J;  1QGP A;  4M3E A;  2KRF A;  3AG2 H;  3ZQQ A;  2GA1 A;  3GBG A;  2W48 A;  3BR0 A;  1OLT A;  3MVP A;  3GLX A;  2VQG A;  4B3X A;  3FK6 A;  1R5H A;  5D4R A;  2P5K A;  3CO7 C;  3QP5 A;  4KN4 X;  2KKO A;  5LEK A;  3DBH B;  1ETQ A;  4LLN A;  1SAX A;  3ZQI A;  5HLG A;  2VL8 A;  3H5A A;  5HLH A;  5E3N A;  2ADU A;  2LBF A;  3HB9 A;  5E1Z B;  4I2O A;  2E60 A;  1WCM J;  1KZH A;  1BJA A;  2UWM A;  3RDI A;  3S2H J;  4EJU A;  2RV8 A;  4RDU A;  6PAX A;  4ZDO A;  5H6R A;  1JXS A;  1ZH5 A;  2EH3 A;  2EPF A;  1WWX A;  1U5T C;  3CCM I;  2RVC A;  2FNA A;  3LST A;  4J00 A;  3RI4 A;  4G6T B;  5D8K B;  5EYR A;  1MSE C;  1AHD P;  3COA C;  4BHP A;  1YE9 A;  4AYB A;  1DU6 A;  4IZZ A;  2P6S A;  3S3N A;  2MBF A;  3CDL A;  4F7Z A;  3A2K A;  2OAZ A;  2LKP A;  2RDP A;  2W84 A;  1UB9 A;  1HC8 A;  1UST A;  4A5N A;  4MTE A;  4NC8 A;  3S2W A;  2MLK A;  3OYM A;  1W7P A;  3KCC A;  5BNG A;  2DT7 B;  4H4K C;  1HOM A;  2EZI A;  4EM0 B;  3TMO A;  2LD5 A;  1MMD A;  1LDK B;  2F5E A;  5IYC J;  4CYC B;  2IS6 A;  1BIB A;  5FRO A;  3HOX J;  4DYC A;  1GVD A;  1OCO H;  4WK8 F;  3HEF A;  4Y4R A;  3W2W A;  3FBI B;  2HI3 A;  2XB0 X;  1SMT A;  3F8N A;  3HOW J;  2EIJ H;  3ESW B;  4PK4 A;  4XKB A;  5FD6 A;  4U0W A;  3CP2 A;  4OAZ A;  3HRU A;  3EUK L;  2L4M A;  2M8E A;  2TDX A;  5DD4 A;  2JTV A;  3K70 D;  4M3F A;  3LSI A;  2CFO A;  3H9Q A;  3SZT A;  4IKF A;  4G7H F;  2O3F A;  2X85 A;  1K78 B;  2QQA A;  1WSU A;  2XAG A;  2DLL A;  2K3F A;  2TCT A;  3N4M A;  4UV8 A;  3GTL J;  1BR1 A;  2JRT A;  1J7K A;  3C2B A;  4HDU A;  5D5W B;  4IQ4 A;  1B8I B;  1Y39 A;  3HSE A;  2CUF A;  2K4B A;  3LSJ A;  1KYW A;  2OZ6 A;  4UV9 A;  1F5T A;  3LSK A;  2QEX I;  2KT0 A;  4Z6Y A;  2NXN B;  5JLW A;  3I4M J;  4GGG A;  4FQG A;  3WTU C;  1ZR2 A;  1T0F C;  1Y56 A;  3EYY A;  1ZQ3 P;  3S15 J;  4YFN F;  4XN3 A;  4G7Z F;  4W1U A;  4KIT B;  1XGS A;  5J3L A;  3GCM A;  2KFD A;  2VE9 A;  4OWR B;  3HDD A;  2OD5 A;  3LQR A;  2BE5 F;  3DXJ F;  1VQM I;  5IP6 A;  5DEQ A;  4XM3 A;  3U21 A;  3JR9 A;  4ZTF A;  4CA0 A;  3M9A A;  4EQQ A;  1QO0 D;  1IAW A;  4YEL A;  1I6H J;  3OOP A;  3RYR A;  1U2W A;  4OAY A;  1XG1 A;  4BH9 A;  3F0C A;  4R79 A;  2EZL A; 
#chains in the Genus database with same CATH homology
 1P4W A;  2CW0 F;  3W6J B;  2H6C A;  3BPV A;  4ON0 A;  1XCB A;  4A0X A;  3MCZ A;  3M8F A;  4M9X A;  3TGN A;  4WF2 A;  1OYW A;  2V6C A;  2FBK A;  3WTV C;  2PBI A;  2EB7 A;  3JTH A;  4B8X A;  2K02 A;  4HA8 A;  3FXR A;  4ASN A;  4HV5 A;  1HKQ A;  2HR3 A;  1TNS A;  4ZYH A;  3T8T A;  2KIM A;  4U7B A;  3PQJ A;  2F5C A;  1O7F A;  1REP C;  3JAM Z;  5K5Q A;  3C3W A;  2VBX A;  4CHU A;  4MEY F;  4Y13 A;  1XSV A;  5EEG A;  1HST A;  2NNN A;  1FPQ A;  4GYI A;  4UXN A;  3JSP A;  1I1S A;  3I64 A;  5F64 A;  3FWE A;  1BC7 C;  1S29 A;  2VC1 A;  1ZAO A;  2VOO A;  2WC2 A;  1TBX A;  2HZT A;  4WX9 A;  4KFC A;  2DK5 A;  2WTE A;  1ZLJ A;  1DPR A;  1W4M A;  3KZZ A;  4I09 A;  5CLS A;  1MDM B;  2KJB A;  3KEQ A;  2ZBK A;  2XKP A;  1YYV A;  2DAO A;  2DW4 A;  4IXA A;  2CFX A;  3MFK A;  4OIR F;  1U8R A;  1XSX A;  5BS6 A;  3J80 K;  2ZFW A;  3B73 A;  3E6D A;  3CUQ B;  4EM1 A;  3N97 A;  3BJA A;  4G7O F;  1G3W A;  3GYH X;  3WOD F;  3RKY A;  2O0Y A;  1DUX C;  4H0E A;  3DP7 A;  4UNO A;  1IN4 A;  4YG2 F;  2HGC A;  1P6R A;  4UVB A;  1R00 A;  1Q1H A;  4ENM A;  3TO9 A;  3FX3 A;  2V79 A;  1T0F A;  2L4A A;  5KVR A;  4L0Y B;  3BJ6 A;  2MC3 A;  5IT9 K;  5F6F A;  5FFX A;  4K2E A;  1EH8 A;  1RI7 A;  3MEX A;  3TOA A;  3VOE A;  3I0T A;  1CF7 B;  3T0Y A;  2O8X A;  2OA4 A;  4KIC A;  2MH9 A;  2VOD A;  4GCV A;  2XGX A;  3BP8 A;  3PQK A;  4Y17 A;  4Q47 A;  2A3S A;  2CWE A;  1R22 A;  5L3F A;  2JPB A;  1E17 A;  4LLL A;  2Z33 A;  3GO5 A;  3WGH A;  4RAZ A;  1ZLK A;  1WI9 A;  4A5M A;  2YR2 A;  3ZMS A;  3WE2 A;  3DPL C;  5L3G A;  1O7L A;  1IN6 A;  5JVT A;  1XN7 A;  3ROU A;  1STZ A;  5BOX A;  1ODD A;  3K1N A;  2HWV A;  5HS7 A;  2CO5 A;  5HDK A;  4ESJ A;  3WTY C;  3ML6 A;  5BPI A;  3E6M A;  3HOS A;  5L3E A;  2V1U A;  2FBI A;  2ZCW A;  4LG0 A;  3GFI A;  2P8T A;  2PN6 A;  2FQ3 A;  4XBF A;  2A6E F;  4HZF A;  1FLI A;  4IRI A;  2EJR A;  3JTG A;  1IXS B;  3LWF A;  1UCR A;  1FX7 A;  3ABU A;  1IUY A;  2Y75 A;  4O5V A;  4I01 A;  4YIF A;  4EV0 A;  3RKX A;  2EFO A;  3WTS C;  3V8L A;  2R3S A;  3F21 A;  3O6B B;  2IRF G;  1D3Y A;  3BJO A;  3IKV A;  2GQQ A;  2AXL A;  2FEZ A;  2OQG A;  2RKH A;  4BAY A;  2M87 A;  3ZP5 A;  1SFX A;  3R60 A;  2W25 A;  1E2X A;  3SFZ A;  4CDG A;  4QWQ A;  1XGO A;  4ZYD A;  2OQR A;  4L9N A;  2JZY A;  3WTT C;  1G3T A;  5D5U B;  2HYG D;  5AIQ A;  1B59 A;  4UVC A;  2QQB A;  5CVJ A;  5ED4 A;  3W6K B;  3BZ6 A;  3EET A;  3JAM K;  4RB0 A;  3FMQ A;  2G9W A;  3MZY A;  5E1X A;  4RS8 A;  5ICC A;  1IF1 A;  2EV6 A;  3E6B A;  3ELK A;  4A6E A;  5LRS A;  4R1H A;  1P2F A;  3C7J A;  4L5I A;  3H3Z A;  2STW A;  2ZNY A;  3ERE D;  2RGV A;  5ICE A;  2OU2 A;  4KT5 C;  3HIF A;  2DK8 A;  1EH6 A;  5DUK A;  3HSF A;  4BXU A;  1SFU A;  1BI0 A;  2FE3 A;  2EFN A;  4G94 A;  4Q4Z F;  5TJJ A;  4HX8 A;  1Z05 A;  3GVA A;  2FA5 A;  5CVV A;  4KMF A;  4A0Z A;  2CG4 A;  3WGG A;  4O6J A;  3Q9V A;  1V4R A;  2QBY A;  4U7D A;  4HX4 A;  2QBY B;  1BIA A;  2ZJ2 A;  2Q8K A;  3KFW X;  1OR7 A;  5LHI A;  2DFI A;  4HX7 A;  2JSC A;  3DFG A;  3IC7 A;  5F1R A;  4PZJ A;  2EK5 A;  4ESF A;  3I71 A;  3V7C A;  5J6X A;  3SQN A;  2D1H A;  2PMH A;  2PI0 A;  4EJO A;  1D8J A;  5BMZ A;  3ZMT A;  2HTS A;  1IXC A;  2VT3 A;  3BPX A;  3LA3 A;  4G6D A;  3CUQ C;  4N9H A;  3F22 A;  4LLG F;  4PDK A;  1LQ1 A;  3E5X A;  1MKM A;  2ZO4 A;  3BDD A;  1HBX G;  1GVJ A;  2A5Y B;  2K4J A;  1TLH B;  4P55 A;  2FSW A;  3K9T A;  4FX4 A;  3IWF A;  2ISZ A;  4ESB A;  4QLC U;  3C1D A;  3J80 Z;  4BQA A;  3VFZ A;  1HW1 A;  3DPT A;  1FC3 A;  3F8C A;  3QU3 A;  2F5F A;  1HW5 A;  1BN5 A;  3E3V A;  2J5P A;  3P9C A;  2ETH A;  3WE3 A;  5DCF A;  2CSO A;  4ZYE A;  3BY6 A;  3L2C A;  4B09 A;  3IRR A;  1YFH A;  4HF2 A;  4I0A A;  4OOI A;  1RUN A;  1KU7 A;  4AIH A;  4RGS A;  2XUB A;  4HV6 A;  3MAJ A;  1QZY A;  1IW7 F;  1YTY A;  1KGS A;  1G3S A;  2W85 A;  1JHF A;  1YO5 C;  2W57 A;  2QLZ A;  3FM3 A;  2XRN A;  1XCV A;  3F8M A;  3LA2 A;  4ENK A;  3E5U A;  2MLG A;  3U2R A;  3V4G A;  1FBQ A;  3KET A;  1ZRC A;  2BYV E;  4I7H A;  3V8J A;  3ISP A;  2EV5 A;  3PFI A;  4ENJ A;  1IXR C;  1L0O C;  3ZMV A;  4NHJ A;  2Z5U A;  4KUM A;  1ZG1 A;  4ETS A;  1K78 A;  1LDJ A;  4XRF A;  4RGX A;  1TW2 A;  3QPT A;  4UHT A;  3HRT A;  3DKW A;  2STT A;  4P5O A;  4BYY A;  2QYO A;  3K2Z A;  4GYG A;  4GXO A;  4ZH4 F;  3E97 A;  1DP7 P;  4N9I A;  3I53 A;  2IA0 A;  3R6S A;  1CF7 A;  2XVC A;  3EUH A;  3LA7 A;  4Q5S F;  3ZMU A;  4WWC A;  1G4D A;  2Q2E A;  1YLF A;  2H27 A;  5H6Q A;  4IHT A;  2QZ8 A;  2XAF A;  2DBB A;  5LBQ A;  1K7A A;  1PDN C;  5ILS A;  2EFW A;  3MQ0 A;  2X4H A;  1YQA A;  4P96 A;  2IA2 A;  2E7X A;  2IT0 A;  3VOD A;  5DD8 A;  2EA2 A;  1FWZ A;  2EFP A;  4E70 A;  5L3C A;  2YX7 A;  2IP2 A;  1IRG A;  4MNU A;  2K86 A;  4L18 B;  1SD6 A;  3P7N A;  2XAH A;  4MQV A;  4A6D A;  2B0L A;  3MZH A;  5CVU A;  1FYL A;  2D2W A;  5E8G A;  3KP7 A;  3SXY A;  3RIR A;  2ZXJ A;  1PP8 F;  5CVR A;  4ZZD A;  2ZKZ A;  1FBS A;  3P9K A;  1TW3 A;  2WWY A;  1XSD A;  3GXO A;  2IJL A;  4CYD A;  4OIQ F;  1KA8 A;  3NEU A;  1YW7 A;  2CYY A;  4KNY A;  2A69 F;  4I98 B;  2NRA C;  3GWZ A;  1Z91 A;  3I59 A;  3ZPL A;  2IVM A;  4M71 A;  4HF0 A;  3CDH A;  1KQ9 A;  5ERI A;  4LFU A;  4RGR A;  4WXH A;  2BEO A;  1B6A A;  1KQ8 A;  1ON2 A;  4XLN F;  1B4A A;  2X0L A;  2BV6 A;  1JE8 A;  5ILU A;  1CGP A;  2ESH A;  4U88 A;  4L9T A;  2XV4 S;  1FY7 A;  1OKR A;  3QU6 A;  3HRM A;  2K27 A;  2Z3Y A;  3M7G A;  3RPQ A;  2C6Y A;  3J81 K;  4OMZ A;  4XSX F;  5JFR A;  3HTU A;  5DCM A;  1U5T A;  2FU4 A;  2YSR A;  2LF7 A;  3ZQ7 A;  2DT5 A;  5FD5 A;  3F23 A;  1R1V A;  4IRH A;  1ZRF A;  1I5Z A;  1AOY A;  2VN2 A;  4OIN F;  4DNC A;  1IZ1 A;  1ZGA A;  3GFL A;  4I0B A;  3QP6 A;  1Z7U A;  3SZP A;  2V1X A;  3DEU A;  2DO7 A;  2R7F A;  4LMY A;  4YFK F;  2L54 A;  4KA4 A;  1KU3 A;  1FSE A;  1AWC A;  3WU1 B;  2MD5 A;  2NYX A;  5AON A;  5JI6 A;  2COM A;  4A12 A;  3VB2 A;  1T38 A;  5LGT A;  1NHA A;  3WG9 A;  2QVO A;  1LEB A;  2YPR A;  3WTZ A;  3HHG A;  1FBU A;  3F6O A;  2O03 A;  1ZGJ A;  1J2X A;  2UXX A;  4CIC A;  2ACJ A;  2Y48 A;  1C0W A;  1O3T A;  2V1D A;  1FOK A;  3QOP A;  4AD9 A;  1YIO A;  4JK1 X;  4EVI A;  2FBH A;  5LRR A;  3NQO A;  2KJC A;  2BGC A;  2RNJ A;  1Z1D A;  1IN8 A;  5D8L B;  2GA2 A;  3CO6 C;  4MGR A;  4HAM A;  4LB6 B;  1EV7 A;  1KQ0 A;  1RNL A;  1W7P B;  3KZY A;  2XIG A;  3Q9S A;  1P92 A;  2NS0 A;  1ULY A;  2EV0 A;  3L09 A;  5E18 F;  5D5V B;  3R0J A;  5CVI A;  3U1D A;  1XGN A;  4P9U A;  5LHH A;  2Q0O A;  2P5V A;  4KN7 X;  3RJP A;  2RC4 A;  3GFM A;  4M72 A;  1MJ9 A;  4EJW A;  4HLX A;  1SD4 A;  2GXG A;  5HVQ C;  4BNC A;  1W7P D;  1B9M A;  1S7O A;  5D6F A;  2FML A;  4IHS A;  3FMR A;  3V8K A;  1LJ9 A;  3J7A O;  2QM3 A;  2MA3 A;  3CTA A;  3KP5 A;  4M73 A;  3GUD A;  1OMI A;  5K5R A;  3LQQ A;  3TDU C;  3CUO A;  5E17 F;  4PGH A;  3QRF F;  5A2Q K;  5D5X B;  3RYP A;  1J0R A;  1WQ2 A;  1BBY A;  3ZN0 A;  2D1V A;  1IRF A;  4HW0 A;  4KYW A;  3FM5 A;  2ELH A;  1MDM A;  1U3E M;  4S05 A;  1BI1 A;  2DQR A;  5HS9 A;  1J75 A;  3V7R A;  1MJB A;  4EJT A;  3M8E A;  2VXZ A;  3JSO A;  3E6C C;  2VC0 A;  5LHG A;  4KIB A;  2VOP A;  2ZME B;  3B02 A;  4AWX B;  3LAJ A;  4A2U A;  2XAS A;  2QQ9 A;  1F4K A;  2EWN A;  1WKM A;  1H9T A;  4OU0 A;  2H09 A;  1PUE E;  3M1E A;  4G9Y A;  3FF5 A;  4RB2 C;  1LVA A;  1OYI A;  1S3J A;  2XKO A;  3GW2 A;  3KP2 A;  4IVN A;  4CGZ A;  4RB3 C;  3DV8 A;  5DYM A;  1FZP B;  2HKO A;  3F72 A;  3F6V A;  3KP6 A;  3HOT A;  4ENN A;  1TQP A;  2IA1 A;  1YS6 A;  3TOB A;  1FP2 A;  1RZ4 A;  3T1B A;  3BRO A;  4O3M A;  3R61 A;  3O3K A;  2W24 A;  4YII A;  5K1Y A;  1BI3 A;  2GIV A;  4IF4 A;  1P4X A;  2LNB A;  2AS5 F;  2A6H F;  4LB5 A;  1T6S A;  1U78 A;  2E1C A;  2BBY A;  1HQC A;  5CJ9 A;  2PLY A;  4AIK A;  2JPC A;  2CGP A;  1X3U A;  1MJA A;  2FOK A;  2PG4 A;  1S6L A;  3FHZ A;  1SMY F;  2A61 A;  3O2P E;  3I58 A;  2DPD A;  1XD7 A;  1FYM A;  5H20 A;  3D0S A;  3K1P A;  3REO A;  2PEX A;  5FLX Z;  3ZMD A;  2V9V A;  4WCG A;  2ZME A;  3KP4 A;  2F5D A;  5HLI A;  4I02 A;  4GO1 A;  5CYV A;  1ZG5 A;  2O61 A;  2VBZ A;  4UUV A;  1UHM A;  3D5L A;  3HRS A;  4EM2 A;  1ZRD A;  3GZ6 A;  3JW4 A;  1GXQ A;  2NAZ A;  3KEO A;  4S04 A;  4MHG A;  2RN7 A;  3WU0 A;  3K0L A;  3WTW C;  3BOQ A;  4BHC A;  4MTD A;  4MQ9 F;  3ECO A;  4HOB A;  5LEJ A;  5ILV A;  1TQI A;  3FMS A;  1QQI A;  2L02 A;  2H94 A;  5DV5 A;  3IRQ A;  2PMU A;  1R5G A;  3OV8 A;  3K69 A;  1FSH A;  2P6T A;  3EDP A;  2WV0 A;  1DDN A;  5FFZ A;  5FGM A;  2E7W A;  2GZW A;  2Z9O A;  2XHK A;  3IHU A;  2HFH A;  3ULQ B;  2M45 A;  4DQ2 A;  1JGS A;  1J59 A;  1T2K A;  3H3U A;  4EGY A;  1H9G A;  5IT3 A;  2XAJ A;  2G7U A;  1H0M A;  2KIF A;  2DTR A;  1A04 A;  2FRH A;  1HKT A;  4JQF A;  2EA4 A;  2LSO A;  1YS7 A;  2Y0M A;  3L00 A;  4XLP F;  2GXB A;  4HQE A;  3TO7 A;  4NQW A;  2PFB A;  3C18 A;  1HXD A;  4HBL A;  1YG2 A;  5EEH A;  5FB2 A;  3HTS B;  1FNN A;  1XMA A;  4ZYG A;  2P5L C;  1I1G A;  1XMK A;  2RQP A;  2HYF A;  4M6Y A;  2KIU A;  3G3Z A;  3LFK A;  4Z2Y A;  3ZMZ A;  2HS5 A;  3TQN A;  2VBY A;  2YX4 A;  3T5X A;  1MGT A;  4G6Q A;  3HUG A;  3I54 A;  1JHH A;  3KP3 A;  5J8C A;  1WRJ A;  3WGI A;  1VTN C;  3MWM A;  3F8B A;  1RIO H;  1SD7 A;  2J5O A;  5FO5 A;  3E5Q A;  4HDV A;  5IT9 Z;  4Y15 A;  1R7J A;  1IN5 A;  1T39 A;  3GFJ A;  1MZB A;  2A07 F;  1LNW A;  2VBW A;  3KE2 A;  2PJP A;  3GZ5 A;  2JT1 A;  1FP1 D;  2QEN A;  1ZRE A;  4WXC A;  4KIF A;  3FZV A;  1BOA A;  1O3R A;  1HSJ A;  1EH7 A;  1T98 A;  5DCM B;  5LGN A;  2VE8 A;  2UZK A;  5HS8 A;  3TO6 A;  3ECH A;  2IPQ X;  1USS A;  2GWR A;  2DI3 A;  1O57 A;  4OIO F;  4AVP A;  3AAF A;  4FHT A;  3RPU A;  5DDG A;  1Z6R A;  3IL2 A;  3R0A A;  3T8R A;  1V3F A;  4LGW A;  1B9N A;  2XAQ A;  4YFX F;  4L9V A;  2ESN A;  3L7W A;  4P9F A;  3V7S A;  4M9Z A;  3QPH A;  2DQL A;  2CQK A;  5HDN A;  1Z9C A;  1QZZ A;  4L5J A;  1O3Q A;  3VEP A;  1R36 A;  2FF4 A;  1FT9 A;  1YW8 A;  4LJZ F;  1TNT A;  1OPC A;  2QUF A;  4OMY A;  2OBP A;  4CO8 A;  2F2E A;  2LF8 A;  4LK1 F;  2EFQ A;  5HOO A;  1P4A A;  1K6O A;  1U6G A;  2FMY A;  4D0P A;  3WTX C;  5A2Q Z;  4IJA A;  1IN7 A;  1ZAR A;  1U5T B;  5LLQ A;  2DU9 A;  3U9G A;  5BQT A;  3P9I A;  3SHF A;  2Z99 A;  4BHB A;  5TRD A;  1RUO A;  1ZHF A;  2M5W A;  2P7C B;  1ZYR F;  3GEZ A;  1FYK A;  5K5O A;  1KU2 A;  4CXF A;  3EYI A;  3RTR A;  5ICF A;  4KDP A;  2LDU A;  1W5S A;  3EQL F;  1XB4 A;  2HQR A;  2K7L A;  5AIP A;  4RAY A;  4KMU X;  1SFE A;  2VON A;  2HOE A;  2P4W A;  2NNY A;  3HSR A;  5BPD A;  3F8F A;  2M1B A;  2FXA A;  2R7D A;  4U0V A;  3DF8 A;  5L3B A;  3I4P A;  4CZZ A;  4EGZ A;  4ZZL A;  2OZU A;  5J8F A;  5HDG A;  2IW5 A;  2FNP A;  4EJV A;  4EMS A;  4HF1 A;  4JBA A;  2H6B A;  1TTY A;  1J9I A;  4XSZ F;  2XRO A;  1R58 A;  3FXQ A;  1SD5 A;  2M30 A;  4FX0 A;  1R23 A;  4M9S A;  5JR3 A;  4PCQ A;  3FXU A;  3NRV A;  4L0Z B;  1G6N A;  1BC8 C;  2L3D A;  1HW2 A;  2L01 A;  2GAU A;  1XDU A;  1KYZ A;  4M74 A;  4MEX F;  5E20 A;  5JHU A;  4HYE A;  2QWW A;  3LAP A;  1K79 A;  4LK0 F;  5KK1 A;  1ZN2 A;  1BI2 A;  4HQM A;  3G73 A;  4WXD A;  3Q5F A;  3CJN A;  1TQM A;  1ON1 A;  2HEO A;  3ABT A;  5E8I A;  5ICG A;  3RKW A;  3CUQ A;  1UFM A;  3KLN A;  1S7A A;  4UVA A;  1QPM A;  3HYI A;  5L3D A;  1KU9 A;  1I6X A;  2ZNZ A;  2YU3 A;  2P7V B;  4L9J A;  1O3S A;  1YW9 A;  1PP7 U;  1F1Z A;  1Y0U A;  4U0Y A;  4AIJ A;  1W5T A;  1R1T A;  3QAH A;  4KIG A;  3GF2 A;  3GX4 X;  1OYY A;  4G8X A;  1LB2 A;  3TKY A;  1QBJ A;  1D5V A;  1S8N A;  2MH2 A;  1HKS A;  4IPA A;  1Z6T A;  1R1U A;  2HTJ A;  5D6E A;  1GHC A;  1MD0 A;  3KLO A;  1ZG3 A;  4N0B A;  3K1M A;  1ONV A;  2HDC A;  5E1W A;  4PGG A;  4R8H A;  1QNT A;  1GXP A;  1I27 A;  4IRG A;  2HQN A;  4LD5 A;  3TDZ C;  1D8K A;  1J5Y A;  2DPU A;  2VT2 A;  1DPU A;  1UHW A;  4A0Y A;  3L9F A;  1LDD A;  4HLY A;  2D45 A;  5LGU A;  4NB5 A;  3BWG A;  3IWZ A;  2HKX A;  3I59 B;  3I5U A;  3CLO A;  4RGU A;  2PQ8 A;  1F9N A;  2UXN A;  3H92 A;  4Q48 A;  2O6G E;  4M6X A;  4OIP F;  3J81 Z;  3IKT A;  5D4S A;  3HHH A;  3ZN1 A;  1B1B A;  4TV7 A;  1G3Y A;  1XDS A;  5DUI A;  1XGM A;  3R4K A;  2G7H A;  2A68 F;  5FLX K;  1L3L A;  1BM9 A;  1LEA A;  4LG0 B;  4FT8 A;  4RB1 A;  2ISY A;  2E1N A;  3F3X A;  3DQV C;  1QGP A;  2KRF A;  2GA1 A;  3GLX A;  5D4R A;  1R5H A;  2P5K A;  3CO7 C;  3QP5 A;  4KN4 X;  2KKO A;  5LEK A;  4LLN A;  1SAX A;  5HLG A;  5HLH A;  2ADU A;  5E1Z B;  4I2O A;  1BJA A;  2UWM A;  3RDI A;  4EJU A;  2RV8 A;  6PAX A;  5H6R A;  1JXS A;  1ZH5 A;  1WWX A;  1U5T C;  2RVC A;  2FNA A;  3LST A;  3RI4 A;  5D8K B;  3COA C;  4BHP A;  2P6S A;  2MBF A;  4F7Z A;  2OAZ A;  2LKP A;  2RDP A;  2W84 A;  1UB9 A;  1UST A;  4A5N A;  4MTE A;  3S2W A;  2MLK A;  1W7P A;  3KCC A;  4EM0 B;  1LDK B;  2F5E A;  1BIB A;  4WK8 F;  1SMT A;  3F8N A;  5FD6 A;  4U0W A;  3HRU A;  2L4M A;  2M8E A;  2TDX A;  5DD4 A;  2JTV A;  3SZT A;  4G7H F;  2O3F A;  1K78 B;  2QQA A;  1WSU A;  2XAG A;  2DLL A;  3N4M A;  4UV8 A;  2JRT A;  4HDU A;  1J7K A;  5D5W B;  3HSE A;  2K4B A;  1KYW A;  2OZ6 A;  4UV9 A;  1F5T A;  4GGG A;  3WTU C;  3EYY A;  4YFN F;  4G7Z F;  1XGS A;  2VE9 A;  2OD5 A;  3LQR A;  2BE5 F;  3DXJ F;  5DEQ A;  3M9A A;  4EQQ A;  1QO0 D;  1IAW A;  3OOP A;  3RYR A;  1U2W A;  4BH9 A;  4R79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...