3S2WA

The crystal structure of a marr transcriptional regulator from methanosarcina mazei go1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
146
Chain Sequence
GISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDERSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title The crystal structure of a MarR transcriptional regulator from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Transcription regulator
total genus 48
structure length 146
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3s2wA00
3F6VA 5F6FA 3TDZC 3GLXA 1YTYA 1ZG3A 4AD9A 4BXUA 3VB2A 4R79A 2QBYA 1KU7A 2HQNA 4UUVA 2VOPA 3DPTA 1D3YA 2VT2A 4M6XA 3L2CA 5FLXZ 1XMKA 2O61A 3BOQA 2AXLA 4UV9A 5LEKA 1JGSA 4WK8F 4HA8A 3LQQA 5TRDA 2P6SA 4PDKA 4AWXB 1O3RA 2JT1A 4HX8A 4Q47A 3RYPA 3JAMK 4U88A 3K9TA 4M73A 3GVAA 4KDPA 2MLGA 3JTHA 5DUKA 3BROA 3K1PA 1Q1HA 1SMYF 2ZNYA 2YSRA 5D8LB 3CDHA 4JK1X 1T6SA 2DFIA 3FM3A 3F21A 3F3XA 4WX9A 1KGSA 4YFNF 5LGUA 1O57A 2P5VA 2L02A 1NHAA 5D4SA 3K0LA 3BJ6A 4MGRA 4L9JA 2FBKA 1XSXA 4N9HA 4MTEA 4WXHA 1KYWA 4HW0A 4L9NA 5D5UB 1IAWA 1O3QA 3V8KA 1R5HA 3BZ6A 1KQ8A 1UHWA 2LF8A 2R7DA 4G94A 3I4PA 5JHUA 5AONA 4P5OA 1LEAA 4Q48A 4KNYA 5LHHA 4XBFA 1JHFA 4RAYA 4XRFA 1Z05A 2RGVA 1QZZA 2IA2A 3QPTA 3IKVA 3WTYC 1JHHA 4AIJA 2EFQA 2H6BA 2EJRA 4IHSA 2K86A 3I64A 2ZNZA 2IA0A 2WC2A 2KJBA 3SZPA 2STWA 3FMRA 3CUOA 2M8EA 1V4RA 4I2OA 2DQLA 3I59B 3E5QA 3RKYA 1XGSA 4FX4A 3WTVC 3IRQA 3WTWC 1MJ9A 1MDMA 2GAUA 4OU0A 1H0MA 3V7SA 1FYLA 3C18A 3S2WA 1ULYA 2RNJA 2KIFA 5LRSA 1FNNA 2BEOA 4G6QA 4EJTA 3PFIA 2HZTA 3IC7A 4RGXA 3K2ZA 1WWXA 1IRFA 3SXYA 2P8TA 1HSTA 3KP5A 1QGPA 4ZYHA 5E1ZB 3SQNA 4DNCA 2A69F 3ERED 3HSEA 3I53A 1FBUA 4HZFA 2OZUA 1PP7U 3MCZA 1O7LA 4ESBA 4NQWA 1QBJA 2OQGA 3JTGA 1S7OA 1D8JA 3Q9SA 3ML6A 4N0BA 2OZ6A 4KIFA 2A61A 3KCCA 4I09A 5A2QK 3WTZA 2L54A 3I71A 2FBIA 4S04A 4IJAA 3QP5A 2F2EA 3E3VA 1IF1A 3ABTA 4CZZA 1Z1DA 3CUQB 2DQRA 5H6QA 2L01A 2CO5A 3M1EA 1KYZA 1YO5C 2DTRA 3RIRA 1OPCA 4LFUA 3FM5A 3G73A 1MZBA 1G6NA 1PP8F 4ZH4F 3DPLC 3I58A 4U0WA 4IXAA 5LGTA 4RGRA 3CJNA 3V8JA 1K79A 5CVUA 1BIBA 3Q5FA 1YYVA 3F8MA 3NEUA 5CYVA 5IT3A 4AVPA 3MZYA 1G3YA 2L4AA 1TLHB 2H94A 2VBYA 3TO6A 4UVBA 2NS0A 1FZPB 2VE8A 4M72A 1XCBA 1REPC 1OYYA 1HKTA 4OMZA 2ZKZA 2P5KA 1SD4A 5FGMA 1I27A 3GZ5A 1P4XA 1W5TA 5FD6A 1UHMA 3W6JB 4I98B 2CWEA 2WV0A 1L3LA 1FOKA 2WTEA 3ABUA 1K6OA 1UFMA 3ZMVA 4R1HA 3ZMTA 2EV0A 5HS9A 2QYOA 3B02A 3WTSC 1LDJA 4ASNA 2JTVA 2Q2EA 1H9GA 3KEOA 4HF1A 1LDDA 3CUQC 4G7ZF 1FSHA 2HKOA 1BN5A 1ZRCA 3LAPA 3ZMSA 1QPMA 4CICA 1LNWA 1MJAA 1ZGJA 3P9KA 2M87A 2O0YA 4UVAA 2IRFG 4BNCA 5CVJA 5D4RA 1DPRA 1YW9A 1ZG1A 3R60A 4HBLA 2VXZA 1H9TA 4KMFA 1BI0A 3ROUA 4BHBA 4L18B 2V1UA 1MD0A 5ICFA 1U5TA 3J81K 1G3WA 2YX7A 1ZRFA 2YPRA 2EA2A 1RUNA 4KUMA 2OBPA 1C0WA 4GYGA 4L0ZB 3KE2A 1UCRA 3T8TA 2QVOA 5KK1A 5HLHA 2MBFA 3L09A 2L3DA 3J80Z 3ZMDA 3TO9A 5HVQC 4WCGA 1VTNC 4I0BA 4M9SA 1EV7A 1J9IA 1OMIA 2P7CB 4HDVA 4MHGA 1B9MA 4GXOA 5E18F 1LB2A 2UXNA 2PLYA 2FQ3A 1BM9A 2LF7A 3ELKA 1HXDA 1IXCA 4AIKA 1T2KA 4EJUA 3IHUA 2Z3YA 4ETSA 1W7PD 6PAXA 2D45A 2WWYA 2MLKA 3KEQA 4HDUA 4CDGA 1WSUA 2YU3A 4KIBA 2FF4A 4IVNA 3Q9VA 2R3SA 2ZMEA 4KN4X 2DO7A 2HR3A 4LLLA 2X0LA 2QZ8A 2MH9A 2Y75A 1KQ9A 3I54A 4KT5C 4HF2A 4LD5A 3EUHA 3L7WA 3IWFA 4UXNA 3U9GA 1BI2A 2HFHA 1EH6A 5F1RA 3ZN0A 5L3BA 4U7BA 1FYKA 2VONA 1P4AA 1B6AA 4FT8A 1W7PA 2PQ8A 2XKOA 1R36A 2MH2A 3KP7A 3N97A 2HWVA 2H6CA 5E1XA 1I1SA 3KP6A 2MD5A 2QQBA 3KLOA 1ZREA 3RDIA 2G7UA 3WODF 4UHTA 3ZMZA 2JPCA 1FBSA 1KA8A 5JFRA 1IXSB 4XLPF 4A0YA 1DUXC 2KIMA 2FXAA 3DXJF 2FMYA 1SAXA 1KU9A 5IT9K 5BOXA 3VOEA 1F1ZA 2VODA 3K69A 4LJZF 4WF2A 1XDUA 2XASA 3MFKA 2HTJA 5DCMB 2RC4A 5D5XB 4ZYGA 1BC7C 5HS8A 1U6GA 4Y17A 1R22A 4HYEA 2XGXA 1TNSA 2PMHA 3I5UA 4R8HA 4EM0B 2BYVE 5CVRA 4I7HA 3FF5A 2EFWA 4L0YB 1GXQA 3LA2A 3GXOA 1UB9A 1DDNA 3QU6A 4HF0A 3FHZA 3EYIA 1A04A 4QLCU 5ICEA 2IT0A 1E17A 2V1XA 1P6RA 1SFEA 2K7LA 2OQRA 3HSRA 2K02A 5JVTA 1XD7A 2HOEA 4RB0A 4S05A 2DPDA 3RKWA 3DF8A 1RUOA 1J75A 1K78A 2TDXA 4JQFA 2E1CA 2XRNA 1D5VA 1LQ1A 2PG4A 3KP2A 2BE5F 3RPUA 1HBXG 5LGNA 1O3SA 1RI7A 1WQ2A 1MGTA 4LMYA 3AAFA 2KJCA 5J6XA 3WGHA 2IPQX 4I0AA 2NRAC 4N9IA 3DV8A 2K27A 2QWWA 2STTA 4U0YA 1YS6A 1Z6RA 1J5YA 2A3SA 2FRHA 4BQAA 3HRSA 3BDDA 3P9IA 3WE2A 2JPBA 2Y48A 4L9TA 5L3DA 3B73A 1BI1A 4RGUA 1FSEA 4EGZA 1KQ0A 1SD5A 1TQPA 3T1BA 4IPAA 3V8LA 4RS8A 2PMUA 4KIGA 5ED4A 4G6DA 2FNAA 1IN5A 3JSOA 4IHTA 2ZFWA 5A2QZ 1FP1D 3R0JA 1PDNC 2VC1A 5BPDA 1DP7P 3QOPA 3E6MA 5LLQA 2Z9OA 5DDGA 4MQVA 1QQIA 2P4WA 4IRHA 2GQQA 5FFZA 3NQOA 2IJLA 5DYMA 1IN7A 3QRFF 2IVMA 2ZBKA 5CVVA 4LG0B 3E5UA 3WGGA 1QO0D 1BI3A 2LSOA 4I02A 3TOBA 1AWCA 1I6XA 1CGPA 3IL2A 4HX7A 3IRRA 3G3ZA 3OOPA 2EK5A 1LVAA 1FBQA 1GHCA 4UVCA 1KU3A 1J0RA 1T38A 1YW8A 4KA4A 3HOTA 3F8NA 4HX4A 2XIGA 1R1VA 5EEHA 1ZHFA 2D2WA 4O3MA 2KIUA 4PGHA 2Q8KA 3R6SA 4WXCA 3WG9A 4UNOA 5BPIA 4OIOF 4OINF 4EM1A 4RB2C 2FU4A 1F9NA 1KU2A 1V3FA 1IZ1A 1D8KA 3F6OA 1T98A 3GW2A 2D1HA 5HDGA 5ILSA 1CF7B 4E70A 4Q5SF 3ECHA 2KRFA 1YQAA 3O6BB 1XGMA 3ECOA 2G7HA 1TQMA 2P6TA 1G3SA 4HV5A 2ESHA 4ESFA 2V79A 3SZTA 5ILVA 5AIPA 1BOAA 4NHJA 1DPUA 2PBIA 4EQQA 1FYMA 2J5OA 4F7ZA 2GA1A 2NNYA 1R23A 5DV5A 2LKPA 1LEBA 1J59A 3E97A 1EH8A 3WU1B 1U5TC 5HLGA 4OMYA 5D6EA 3D0SA 1B59A 3R61A 3FXRA 3TGNA 5L3EA 3C1DA 3GX4X 2MC3A 3TQNA 5CLSA 5LEJA 4EJVA 2DPUA 2XVCA 2ZO4A 2PJPA 3K1MA 2XAGA 2YR2A 4G9YA 3RJPA 2QBYB 2RN7A 4A12A 3LQRA 1TTYA 3ZQ7A 2V6CA 2P5LC 2DT5A 3H3ZA 1YFHA 4O5VA 2FOKA 1ODDA 3EYYA 3KZZA 4H0EA 4EM2A 2EFNA 2ZXJA 1PUEE 2HS5A 1Y0UA 1P2FA 3I59A 5ICCA 3FZVA 2JSCA 3CO7C 1USSA 2ISZA 3O3KA 2XAQA 3R0AA 4GGGA 4LB5A 2HGCA 4MTDA 2GXGA 3KLNA 1Z6TA 1FLIA 1XGNA 3KFWX 2MA3A 1JE8A 1FY7A 1IN6A 2NNNA 1IN4A 3EDPA 1IW7F 4CXFA 2M5WA 1U8RA 2XAFA 2FBHA 2QM3A 3TO7A 4P9FA 2W57A 4BHPA 3GZ6A 1GXPA 3V4GA 4KMUX 1ON1A 1SD6A 3N4MA 4P55A 4CGZA 4M6YA 1E2XA 2X4HA 3MEXA 4M9ZA 4U7DA 3WE3A 1R7JA 2VT3A 5L3GA 3L00A 3GO5A 2YX4A 4P9UA 3MZHA 1OKRA 1ZLJA 5JR3A 1R00A 3H3UA 5HDNA 5ERIA 3W6KB 1WI9A 3CUQA 4PCQA 5F64A 3HOSA 3DEUA 3GF2A 3COAC 1MDMB 1ONVA 3OV8A 4Y15A 3M8FA 2DLLA 2DW4A 2UXXA 4L9VA 3D5LA 2ISYA 1JXSA 4LGWA 2RKHA 4B09A 4HQEA 4BAYA 3HIFA 1YLFA 4QWQA 2EFOA 3TOAA 4BYYA 3WTUC 4UV8A 3F72A 4HAMA 2H09A 3RKXA 1TBXA 3ZMUA 2XHKA 5IT9Z 4RB1A 1HKSA 1STZA 1OYIA 3CTAA 2KKOA 4RB3C 2A07F 4EV0A 3O2PE 4A2UA 2PI0A 3E5XA 2HYGD 5D5VB 4OIQF 2M30A 1RZ4A 1AOYA 4K2EA 5E1WA 1U2WA 2V1DA 3QU3A 2COMA 5DUIA 3GFIA 1HKQA 5H6RA 2XAJA 4I01A 3JAMZ 1FX7A 3NRVA 1K7AA 2O6GE 4L5IA 5HDKA 3REOA 5DEQA 4A0XA 2HYFA 2GWRA 4M74A 2JZYA 1YG2A 3GFMA 2QENA 1ZLKA 1USTA 2A6EF 1P4WA 1HSJA 2ELHA 4HQMA 1FWZA 1BJAA 2J5PA 1FT9A 3SFZA 2CYYA 1FP2A 4ENNA 3R4KA 2FNPA 4LB6B 1F4KA 4PZJA 5D8KB 1G4DA 2HKXA 1O7FA 1BBYA 3E6DA 4ZZDA 1XDSA 1LJ9A 1I1GA 1R1UA 3LA7A 4GO1A 5TJJA 3FMQA 3KZYA 5JI6A 4U0VA 5L3FA 3WU0A 3GWZA 1TW2A 2C6YA 2HDCA 1R1TA 4Q4ZF 3U1DA 1FC3A 3JSPA 5FLXK 1B9NA 2UZKA 1XB4A 2UWMA 2RQPA 2E7XA 4P96A 2ETHA 2R7FA 4XLNF 2LNBA 2XROA 5L3CA 2RDPA 1QNTA 3M9AA 1YS7A 3VFZA 4RAZA 2XAHA 2O03A 2EB7A 1B1BA 1WRJA 1RNLA 5KVRA 2ZCWA 1GVJA 2EFPA 3E6CC 4KN7X 2DAOA 5J8FA 2VBZA 4HV6A 3RPQA 4YIIA 3TDUC 2ADUA 4AIHA 4HLYA 2Z5UA 3HUGA 3J7AO 3HSFA 3U2RA 4G8XA 1TQIA 2FA5A 4BHCA 3T0YA 5ICGA 1ZAOA 2QUFA 2OU2A 5BS6A 4ZYDA 1S6LA 3BWGA 4Y13A 3RI4A 1BC8C 4A6EA 3DQVC 4ENKA 3P7NA 1S7AA 3FWEA 1IN8A 2IP2A 1YIOA 3ZP5A 1MKMA 4WXDA 1SMTA 3ZN1A 2D1VA 2GZWA 1U3EM 3PQKA 1J7KA 4KICA 5DD4A 5LHGA 4G7OF 2BGCA 1U5TB 4B8XA 2RVCA 2F5CA 2QLZA 3F8BA 1I5ZA 5E20A 1Z7UA 4TV7A 2ACJA 1HW1A 2AS5F 2W24A 3KETA 2P7VB 2K4JA 2FSWA 5D5WB 1FPQA 1J2XA 1S8NA 1XCVA 2B0LA 3CLOA 3L9FA 3BPVA 4KFCA 4YFXF 1T0FA 4OIPF 3IWZA 1R58A 3MAJA 3I0TA 2O8XA 3E6BA 3HRUA 2L4MA 2PN6A 2DU9A 5FB2A 2DI3A 3VEPA 4L5JA 2A5YB 2PEXA 2DK5A 2IW5A 4NB5A 4FHTA 2VBWA 5EEGA 1TNTA 5BMZA 4IF4A 1XSDA 1R5GA 1SFXA 2ESNA 3LFKA 1SFUA 5DCMA 1U78A 4WWCA 2V9VA 4EMSA 1OYWA 2BV6A 4O6JA 3C7JA 2OA4A 2GA2A 5DD8A 3BP8A 3ULQB 2ZMEB 5AIQA 5K5OA 2XV4S 5CVIA 2HEOA 1ZARA 1L0OC 4LK1F 3GFJA 2W85A 1XGOA 2ZJ2A 1P92A 3T5XA 4IRIA 3HHGA 1XSVA 3DKWA 3MWMA 1ZGAA 4ON0A 1WKMA 5LRRA 4MQ9F 2FMLA 1W7PB 3BJAA 4IRGA 2DBBA 2M45A 3QAHA 4XSXF 4GYIA 3C3WA 1SD7A 4Z2YA 5J8CA 2CFXA 3DFGA 1T39A 2EV5A 1W5SA 3VODA 5LHIA 5HOOA 2BBYA 3WTTC 1RIOH 1HQCA 2VC0A 2XUBA 5HLIA 4XSZF 3KP4A 2FE3A 2F5EA 2E1NA 1IRGA 2NYXA 3RYRA 3JW4A 2IA1A 3FXUA 1Z9CA 3DP7A 4M71A 2Z33A 3HRMA 3HYIA 3FXQA 2W25A 1B4AA 3M8EA 2CGPA 3K1NA 4CO8A 3V7RA 4ENJA 5HS7A 4OOIA 2PFBA 2Z99A 5E17F 4BH9A 3J81Z 2VOOA 2VE9A 2RV8A 3HHHA 3WGIA 4MEYF 3F22A 3CO6C 2H27A 4A5NA 3HTUA 1IUYA 2HQRA 1OR7A 2Q0OA 1YW7A 4A6DA 3WTXC 5ILUA 4OIRF 2EWNA 4ZYEA 2GXBA 4LLNA 2VN2A 5FD5A 1G3TA 4YG2F 1ZRDA 3BJOA 5H20A 5FO5A 3LSTA 4A5MA 2E7WA 2CQKA 2XKPA 3ISPA 2F5FA 2QQ9A 1W4MA 4ENMA 1EH7A 2GIVA 2OAZA 1ZG5A 3BY6A 3HTSB 3EQLF 1F5TA 4HOBA 2CW0F 5E8GA 2QQAA 2JRTA 1TW3A 1XN7A 1LDKB 3GUDA 3V7CA 4D0PA 3LWFA 3IKTA 1HW2A 1IXRC 4RGSA 3TKYA 3F8CA 4JBAA 1K78B 4MNUA 3GYHX 2A6HF 1ZN2A 4MEXF 1S3JA 5E8IA 2Y0MA 3T8RA 2HTSA 4ESJA 1HW5A 5D6FA 1ZH5A 1S29A 5FFXA 4LG0A 3GEZA 2NAZA 2W84A 4YIFA 4KYWA 5LBQA 1ON2A 3FMSA 1O3TA 3HRTA 2DK8A 3SHFA 5DCFA 4EJWA 4YFKF 2CSOA 3EETA 4EVIA 3FX3A 3QP6A 1Z91A 4FX0A 3PQJA 1XMAA 2VBXA 3BPXA 3P9CA 2A68F 5BQTA 2OD5A 2M1BA 5K5RA 2K4BA 4ZZLA 3LAJA 4DQ2A 2EV6A 3J80K 4CYDA 4M9XA 4CHUA 2G9WA 4PGGA 3GFLA 1CF7A 5K1YA 4LLGF 3M7GA 2FEZA 5CJ9A 3ZPLA 3H92A 1X3UA 2EA4A 3F23A 3KP3A 3MQ0A 4GCVA 4EGYA 1ZYRF 1BIAA 5K5QA 4LK0F 2CG4A 2O3FA 3LA3A 4G7HF 4EJOA 4A0ZA 3QPHA 3RTRA 4HLXA 1QZYA 2F5DA 2LDUA 3F8FA 1MJBA
chains in the Genus database with same CATH superfamily
2KT0A 3F6VA 4BL0B 5F6FA 3TDZC 2ZXHA 1IO2A 3GLXA 1YTYA 4BE2A 1ENHA 2OCEA 2LKSA 4B3AA 5IOZA 1ZG3A 4AD9A 1OCCH 1QVUA 3K4KA 4XL9A 4BXUA 5GTHC 5M5XJ 3VB2A 4R79A 2VQLA 4DZJA 2QBYA 1KU7A 2HQNA 4UUVA 2VOPA 1UG0A 3DPTA 2R5YB 1SVLA 1D3YA 2VT2A 3GLLA 4PK4A 5F0FA 4M6XA 1HLVA 5IYDJ 3L2CA 2HPMA 3BR6A 1H89C 5FLXZ 3CCEI 5J1UA 1TWCJ 1XMKA 1QPIA 4ZTFA 2O61A 5GP9A 2KFDA 4YELA 3BOQA 2AXLA 4UV9A 5LEKA 5FRNA 4B48A 1JGSA 1SAUA 1YX3A 4LG3A 4WK8F 4HA8A 5J4VA 1ETKA 3LQQA 2W7NA 5TRDA 2P6SA 4PDKA 5HODA 4AWXB 1O3RA 2BVLA 3ZR8X 2JT1A 1Y6IA 1Z7LA 4CCKA 4C30A 4HX8A 4NBQA 4Q47A 3RYPA 3DPUA 3JAMK 2IBDA 2XSJC 2E2JJ 4U88A 3K9TA 3ZRGA 4M73A 3GVAA 5FROA 3CF5F 3AG2H 1FOXA 4KDPA 2MLGA 3JTHA 5DUKA 1Y0NA 3BROA 2KIQA 4DGWB 2BY0A 3K1PA 3TMOA 4XN0A 1WJBA 1JT0A 1Q1HA 1SMYF 3I9V2 4IHVA 2ZNYA 1LKXA 2YSRA 5D8LB 1ETWA 3CDHA 3JREA 4PJLA 4JK1X 1ZR2A 1T6SA 2A05A 2KRHA 2DFIA 2H1LA 2KLOA 2MG4A 3FM3A 3F3XA 4XK4A 1BR1A 1KGSA 4WX9A 3F21A 4YFNF 4XQFA 5LGUA 1O57A 1FEXA 4XM3A 2P5VA 1VQ6I 2L02A 1NHAA 4QPOA 2K9LA 1X58A 5D4SA 4BE1A 2E2IJ 4RAGA 4CCMA 3K0LA 3WHBA 3BJ6A 4MGRA 3LNQA 1Y39A 3BR3A 2F4OB 4L9JA 2FBKA 1XSXA 4N9HA 4MTEA 4WXHA 4CCJA 2L7KA 1KYWA 4HW0A 4L9NA 5D5UB 3LSHA 2QSFX 1IAWA 3LL7A 2DA5A 2EZKA 1O3QA 3D5RC 3V8KA 2QSGX 1R5HA 1RR8C 1Y8QB 3BZ6A 3OR1C 1KQ8A 1UHWA 1NK2P 1SVMA 2LF8A 2BZTA 4BXFA 4AIDA 2M2EA 3FXJA 2R7DA 3QYFA 2JK3A 4G94A 2LC2A 3SFIA 3I4PA 5JHUA 3KZIC 2IGNA 5AONA 4P5OA 3EUAA 1LEAA 4Q48A 4PJMA 4KNYA 5LHHA 4XBFA 1JHFA 4RAYA 4XRFA 3E7LA 1Z05A 2RGVA 1QZZA 2IA2A 3QPTA 2R0QC 3IKVA 2CW8A 5M3MJ 3WTYC 4HPQA 4M3BA 2AQEA 3PUBA 1JHHA 4AIJA 2EFQA 2H6BA 3BR0A 3HJEA 2K9SA 2EJRA 4BJTA 2O8KA 1W5CC 4IHSA 3GBGA 2K86A 2DA6A 2ZNZA 3I64A 2VJIA 1H8AC 3H9GA 4H4KC 2IA0A 4NC8A 4UUSB 1YIJI 2WC2A 2KJBA 3BC8A 3SZPA 3MD2A 3QPLA 4E7HA 2STWA 3FMRA 2HOAA 3CUOA 2M8EA 1V4RA 4I2OA 2DQLA 4A3EJ 2DMNA 3I59B 2ECCA 1X1PA 3E5QA 1ERDA 3RKYA 1XGSA 3S2DJ 2X6OA 1MMSA 4FX4A 1IDYA 3WTVC 3IRQA 2NVXJ 3WTWC 2COBA 1MJ9A 2ME0A 3X2QH 1MDMA 2GAUA 4OU0A 1H0MA 1UG2A 2HPIA 3V7SA 1MIJA 1HOMA 4F91B 1VQ9I 1FYLA 3C18A 3S2WA 3ZQIA 2R7VA 2DN0A 2CQXA 1ULYA 1Z0XA 2KIFA 2RNJA 5LRSA 1FNNA 2BEOA 4G6QA 1TWFJ 4EJTA 2K9QA 2E35A 2MGQA 2LREA 1WI3A 3BTLA 3PFIA 2HZTA 4W97A 1MNMC 1IC8A 5F0CA 3IC7A 4RGXA 3K2ZA 1WWXA 1IRFA 5H2FC 3G2BA 2LYCA 4A3MJ 4RLQA 3TW7A 1JJ6C 3BG7A 4CSWA 3SXYA 1MBGA 2Z16A 4AC0A 2WB1N 2NVTJ 2P8TA 1HSTA 1OCTC 3K10A 1QGPA 3KP5A 3HC7A 3W3CA 4ZYHA 2M7BA 5E1ZB 3BTCA 3SQNA 4DNCA 5GADJ 2M9HA 3CC7I 2A69F 2VB6A 3ERED 1E3PA 2LRDA 4AUXA 3N05A 4I6ZA 3HSEA 3I53A 1FBUA 4HZFA 2XC7A 2OZUA 2GLOA 1PP7U 3MCZA 1O7LA 1ZTRA 2K9MA 4J00A 1W0UA 3K4NA 2DJIA 4ESBA 4NQWA 1OCZH 2R5ZA 1QBJA 2OQGA 3GCMA 2EIJH 4PJJA 3JTGA 1S7OA 1D8JA 2XF6A 4ZDPA 3Q9SA 2DA4A 3ML6A 4N0BA 2OZ6A 4KIFA 1R71A 2A61A 3KCCA 2OPTA 4I09A 5A2QK 5FRMA 3WTZA 3GTMJ 3LSIA 3DBHB 4XLCA 1POGA 2L54A 3I71A 2FBIA 1ACIA 1W36D 4S04A 4IJAA 3QP5A 2F2EA 3E3VA 5EYRA 1IF1A 3ABTA 3OYAA 2O5RA 1IV8A 4CZZA 1Z1DA 3CUQB 2DQRA 4ZDOA 2JJ7A 5H6QA 2L01A 2CO5A 3S3MA 3M1EA 1KYZA 5J1RA 1YO5C 2DTRA 1NG7A 2X1DA 3RIRA 1OPCA 4LFUA 4Z6YA 4NNJA 4XN3A 4C9YA 4F93B 2R4GA 4FASD 3GTLJ 1OCRH 1O4XA 3FM5A 3G73A 1MZBA 3KX2A 3IH2A 1G6NA 2MW8A 1MBFA 1BL0A 1FMVA 1PP8F 2DDBA 2DODA 4ZH4F 1ETOA 1OR7C 3DPLC 3I58A 4LITA 3CJTB 4U0WA 4DIQA 1DGRM 4IXAA 5LGTA 3H5AA 5E79C 4RGRA 2IAIA 4PFPA 3I4NJ 3CJNA 3V8JA 1A6IA 3SEQA 1K79A 5FJ8J 4C2TA 1S5LC 1F36A 5CVUA 5KNLA 4E7IA 1BIBA 1ZR4A 3DTIA 3DBLB 3Q5FA 1YYVA 2GBYA 3F8MA 3CLQA 3NEUA 5CYVA 2R7OA 4FISA 5IT3A 9ANTA 1SANA 4AVPA 3MZYA 1G3YA 2L4AA 2CUEA 4A3CJ 2P0WA 1TLHB 1JKPC 2H94A 2QF7A 1ZKGA 2VBYA 4C2UA 2K9NA 1RESA 3TO6A 3CCJI 1OLTA 3OSFA 3A01B 4UVBA 2NS0A 1FZPB 2VE8A 4M72A 1XCBA 1REPC 1X1CA 1HDDC 2WAFA 1OYYA 2D5VA 1HKTA 4OMZA 2ZKZA 2P5KA 1SD4A 4Y7NJ 1MBJA 2R7WA 4M3FA 2HXOA 5FGMA 1YHQI 1I27A 1JUPA 3GZ5A 3G1OA 1P4XA 5J1YA 2LKXA 1W5TA 5FD6A 3HDDA 3KIOA 1UHMA 3EUKL 4BGDA 3OYJA 3W6JB 1BJZA 1GV5A 4I98B 3WG7H 2CWEA 2WV0A 3VSLA 1L3LA 2WTEA 1FOKA 2HQAA 1D0ZA 1ETXA 3ABUA 2MD0A 1K6OA 1UFMA 1Y1VJ 2DTZA 3ZMVA 1Y56A 4R1HA 2VJ5A 3MKYB 3ZMTA 2EV0A 1XS9A 5HS9A 2G0EA 2QYOA 3B02A 4D7NA 2ELJA 4V19K 4IOAF 4EATA 3FK7A 3WTSC 4RMNA 2NXNB 2ID6A 3S93A 1LDJA 3BR2A 4ASNA 4HEA2 3J7AY 2JTVA 2K85A 1LVKA 3A03A 2Q2EA 1H9GA 3KEOA 4B47A 4HF1A 4Y3OA 1LDDA 1X1AA 3CUQC 4G7ZF 1R9TJ 1FSHA 3BZKA 2HKOA 3EPZA 3OL4A 1JGGA 3BTJA 2E2HJ 1BN5A 1ZRCA 3LSMA 3ZMSA 1AA7A 1VNDA 3LAPA 4IHXA 4D7MA 1QPMA 4CICA 1LNWA 3SDGA 3CCVI 1MJAA 1ZGJA 3P9KA 2M87A 1LPQA 4NUBA 2O0YA 4UVAA 2IRFG 4BNCA 5CVJA 5D4RA 1DPRA 1YW9A 3S1QJ 1ZG1A 3R60A 3UNGC 1A5JA 4FTHA 1X1DA 4HBLA 2CV2A 2DMPA 4BDZA 2VXZA 1X19A 1H9TA 4YEJA 4KMFA 1BI0A 2OTLI 1DGWY 2EILH 5K7HA 3SEZA 4W1UA 3ROUA 4BHBA 3K70C 4L18B 3IH4A 4P1WA 1QA6A 5E3LA 2V1UA 2TRTA 2GOMA 3BQYA 2K5CA 1MD0A 4BBRJ 2PMZN 5ICFA 4XONA 1U5TA 3J81K 3GTKJ 3S15J 2BY3A 1G3WA 2YX7A 1ZRFA 4XNFA 2YPRA 2DFFA 5E3OA 2EA2A 4X6AJ 1RUNA 2L2OA 2CRGA 1YRNB 4KUMA 2OBPA 3F0CA 2Y9ZA 1C0WA 4GYGA 2X6WA 2XF7A 1B8IB 4L0ZB 1N77A 2JQ7A 3A2KA 3A1YA 2L0KA 3KE2A 1RRJA 1SFKA 2VQCA 1P7JA 1UCRA 3T8TA 2HZDA 2QVOA 5KK1A 1KZHA 5HLHA 3U1KA 2MBFA 3L09A 3OYEA 3RSNA 2L7FP 3L2QA 4XICA 4I76A 2L3DA 3PUFA 3J80Z 3ZMDA 3TO9A 5HVQC 4WCGA 1IGNA 3K4JA 1VTNC 4DYRA 5KCMA 4I0BA 4M9SA 5FKMA 1DU0A 3HUGB 1EV7A 1A35A 2KQRA 1J9IA 2WADA 1OMIA 4I99C 2P7CB 3PO3J 4HDVA 3NARA 4E4HA 4MHGA 5HNFA 1B9MA 4GXOA 2BW3B 3FXMA 4A93J 5E18F 1LB2A 4A3GJ 2UXNA 4EEFG 2PLYA 2FQ3A 1BM9A 5EZHA 3TP3A 2LF7A 5B66C 3ELKA 5EG0A 1HXDA 1PVEA 5J3LA 1IXCA 4AIKA 4BXXJ 1S9HA 1T2KA 4EJUA 3IHUA 4B1RA 2Z3YA 1ZQ3P 4NDLA 4ETSA 1W7PD 4XMYA 4S0HB 1WJCA 6PAXA 2D45A 2WWYA 4QPQA 3KPHA 2MLKA 3KEQA 4HDUA 4CDGA 3S17J 1WSUA 2YU3A 4KIBA 2PJRA 1JI8A 2UV1A 2FF4A 2R92J 4IVNA 2X6YA 3M07A 4E6KG 3Q9VA 4ZTJA 5EZGA 1VQ7I 1D1CA 2R3SA 2ZMEA 1OJLA 2DO7A 3O8HA 4KN4X 5DS9A 2HR3A 4LLLA 2X0LA 2QZ8A 2FJ1A 2MH9A 2VPLA 2Y75A 3I55I 4FETA 2GIZA 2VI6A 1KQ9A 3I54A 4KT5C 3AG4H 4HF2A 3AL0B 4LD5A 2EH3A 3EUHA 3L7WA 2JA5J 3IWFA 4UXNA 3U9GA 1BI2A 2HFHA 1EH6A 2MABA 5F1RA 3HOYJ 2HYJA 3JRBA 4Y33A 3ZN0A 5L3BA 4U7BA 4MFEA 1FYKA 4UY8I 2VONA 1P4AA 1WH5A 1B6AA 4FT8A 1W7PA 2PQ8A 2XKOA 1RKTA 1R36A 2MH2A 4BEHA 3KP7A 3L2WA 3N97A 2HWVA 4XKCA 4CCOA 1MBHA 2KHMA 3W6VA 3HGGA 2H6CA 2LP0A 3E1SA 5E1XA 4XOPA 4E7LA 1I1SA 3FXLA 3KP6A 3Q0UA 2MD5A 2QQBA 3KLOA 1ZREA 3RDIA 2CV0A 2G7UA 3WODF 4DYCA 1TC3C 3ABKH 4UHTA 3ZMZA 2JPCA 3CQZJ 2JA6J 1FBSA 2IS2A 4D5CA 2HOSA 1IJWC 2DMUA 3OYHA 4A3DJ 1DP3A 1BOBA 5IP7J 1KA8A 5JFRA 1IXSB 3VYSB 3AFHA 1WH7A 1RETA 4A0YA 2KIMA 4XLPF 1DUXC 3NWTA 2FXAA 4UUTA 3DXJF 2L5QA 5EGOB 2FMYA 4V2FA 3HOXJ 1SAXA 1KU9A 5IT9K 5BOXA 3VOEA 1F1ZA 1OCPA 2E36A 2VODA 3ASOH 3K69A 4LJZF 4WF2A 2TCTA 4DYQA 3S3OA 1XDUA 2XASA 2ZJQF 3S16J 2XB5A 4XRSA 3FDYA 3MFKA 2RREA 2HTJA 2LR8A 5IP9J 2L7ZA 2O9LA 5DCMB 2RC4A 4C3HJ 3DLLF 3M1CA 3CCSI 5D5XB 4ZYGA 1BC7C 5HS8A 1RPWA 1H88C 1U6GA 3JRAA 2JSPA 3BR5A 5HNHA 3MKLA 4Y17A 2KMUA 4N4OB 2BY1A 2XB0X 4KISA 1QU3A 4A3IJ 1R22A 4DZPA 1PUFA 4HYEA 2XGXA 1TNSA 2CUFA 2PMHA 3I5UA 4R8HA 4U87A 2LH9A 4EM0B 2M4KA 1GUUA 3TBIA 2R7XA 2BYVE 5CVRA 4XOTA 4I7HA 3IV5A 4IEJA 2VPRA 2LBFB 3FF5A 5GAGJ 2EFWA 4AM3A 4G6TB 4L0YB 2ECBA 2DFEA 2XRLA 3OIOA 1GXQA 3OWTA 3LA2A 3RPUD 3GXOA 1UB9A 2BVMA 3QU6A 4HF0A 3FHZA 1DDNA 3OYIA 3EYIA 2CJJA 2M7AA 1A04A 1IG7A 4QLCU 1B72A 5DTDA 3CMMA 3H5NA 5ICEA 1I3QJ 1UHSA 4M3GA 2IT0A 1E17A 3S1RJ 2V1XA 1I3AA 1MMDA 3IH3A 3KYCB 3I56I 3JRHA 3PO2J 1P6RA 3RZOJ 1SFEA 4HSRA 1D5YA 2K7LA 2OQRA 3HSRA 2K02A 3AL0C 2KZVA 5JVTA 1XD7A 3JRCA 2ZFUA 3HKZA 4B44A 2WY8Q 3OYBA 2HOEA 4XKVA 4RB0A 4V2GA 1NH3A 4S05A 1X4OA 4HRIA 2JA8J 1D0XA 4BQQA 1G59A 2DPDA 3RKWA 4BACA 3DF8A 1JKRC 1RUOA 1J75A 1K78A 2TDXA 4JQFA 2E1CA 3ABLH 4RA2A 2JVGA 2ZJPF 1VI0A 1QRYA 4B4CA 2XRNA 1D5VA 1LQ1A 2PG4A 3KP2A 3BCAA 2BE5F 3RPUA 1HBXG 5LGNA 1O3SA 1RI7A 3LFUA 1WQ2A 1MGTA 4LMYA 2FQ4A 2WV1A 3AAFA 5LFAA 2KJCA 1T0FC 2M0MA 4JP0A 1FIAA 5J6XA 2B9SA 3WGHA 1LE8A 2IPQX 3BZCA 4I0AA 1YE9A 4N9IA 2NRAC 1MBEA 3DV8A 2K27A 2XPUA 2L9SA 2QWWA 1U8BA 4IZZA 4U0YA 1YS6A 2STTA 2NVQJ 1X4PA 1Z6RA 1AU7A 1J5YA 3OIQA 2A3SA 2BY2A 3GTPJ 2FRHA 4KITB 4BQAA 1X2NA 4JX4A 3HRSA 3BDDA 3P9IA 2CFOA 2V26A 3WE2A 2H1KA 5C4XJ 3DKXA 4X1EA 4RAFA 1TZLA 2JPBA 2Y48A 4L9TA 5CPRB 5L3DA 1TWHJ 1LUJB 3B73A 1V5GA 1BI1A 4RGUA 3KYDB 1ZK8A 1FSEA 1K6YA 2EPFA 4EGZA 2KZGA 2DOAA 1KQ0A 1SD5A 2W00A 1XC5A 1TQPA 2P81A 2VKVA 3T1BA 4IPAA 3V8LA 4KT6A 4RS8A 2PMUA 4KIGA 5ED4A 3CC4I 4A3BJ 5IP6A 4G6DA 2WAQA 3K4CA 2K3PA 2FNAA 1ETVA 1IN5A 3JSOA 4L5EA 4IHTA 2NOJB 2EZIA 2ZSIB 1RR7A 3BQZA 1IRZA 3JRFA 3S14J 4DJAA 1V5EA 2ZFWA 5A2QZ 1FP1D 4IQJA 3R0JA 5C44J 1PDNC 2VC1A 1HDPA 5BPDA 4CYCB 1DP7P 3QOPA 1VFCA 2VQGA 3E6MA 2L9VA 5LLQA 2XPWA 5DDGA 2Z9OA 4MQVA 3CCRI 3H35A 2R7UA 2VKHA 1QQIA 2DT6A 1E3OC 2P4WA 3S1MJ 4OAZA 1HA8A 3HB9A 4IRHA 3K4MA 2GQQA 5FFZA 4D9JA 4IQ4A 3BTIA 1AKHA 3NQOA 2IJLA 5M5WJ 5DYMA 2A5WA 1IN7A 2W4SA 3QRFF 2IVMA 2ZBKA 1MNDA 5CVVA 4LG0B 3E5UA 3G4SI 3WGGA 1QO0D 1BI3A 2LSOA 1UZCA 2WAEA 3SDBA 5FLVA 4I02A 3TOBA 1BA5A 5E3MA 4DOZA 1AWCA 4II2A 4J01A 1I6XA 1CGPA 4NC7A 3IL2A 2HVQA 4HX7A 2V9PA 3IRRA 3PL8A 2Y30A 2N8GA 2LG4A 2ZXIA 3G3ZA 3OOPA 3OOUA 3ZGKA 2EK5A 1LVAA 5FLMJ 1FBQA 1GHCA 4UVCA 1KU3A 1J0RA 1T38A 1YW8A 4KA4A 3HOTA 3F8NA 4CUGA 1VQ4I 1T08B 4HX4A 2FD5A 2XIGA 2R5YA 2FOWA 1R1VA 3ZQFA 5EEHA 2HVSA 1ZHFA 2LTPA 4FE7A 2D2WA 2AO9A 4O3MA 3H0DA 2KIUA 4PGHA 2Q8KA 3R6SA 4DBQA 4WXCA 3WG9A 5JHFA 4UNOA 5BPIA 4OIOF 4OINF 3CMEI 3GTQJ 4EM1A 4RB2C 5CKTA 2FU4A 3A0BC 1F9NA 1KU2A 1V3FA 1IZ1A 2DFHA 3OYFA 1D8KA 2L7MP 3F6OA 1BW5A 2UUZA 3ZQQA 1T98A 3GW2A 3LSJA 2D1HA 2L9RA 5HDGA 3DCFA 5ILSA 1CF7B 2DDAA 1LFPA 3VWBA 4CA0A 4E70A 2VXDA 4Q5SF 2CUZA 3ECHA 2KRFA 3QQAA 1YQAA 3O6BB 1XGMA 1ZGWA 3ECOA 2G7HA 4AYBA 1P9QC 3JCUC 1D1AA 1TQMA 2P6TA 1G3SA 4B3XA 4HV5A 3ZQCA 2ESHA 4ESFA 1K4SA 2M0CA 2V79A 3SZTA 5ILVA 5AIPA 3QWLA 3I3LA 3ABMH 3B6AA 1BOAA 4NHJA 4BBSJ 1T33A 1DPUA 4M3DA 1A36A 2PBIA 4EQQA 2DMTA 1N25A 3BG5A 4IHWA 3PNTA 2V6EA 2MYSA 1FYMA 1VQ5I 2J5OA 4F7ZA 2KP6A 2GA1A 3HEFA 2NNYA 1R23A 5DV5A 2LKPA 1LEBA 1J59A 4LOCA 2KDOA 2QCOA 3E97A 1MSEC 1EH8A 3WU1B 1U5TC 5HLGA 4OMYA 1EJ9A 5D6EA 5KHDA 3D0SA 1B59A 3OMYA 3R61A 3K2AA 2WA0A 3FXRA 4MFDA 3TGNA 5L3EA 3C1DA 3GX4X 3OSGA 2MC3A 1SEUA 3TQNA 2OCCH 5CLSA 3TW6A 5LEJA 4BQNA 4EJVA 4DBRA 2HDDA 2X9DA 2DPUA 1RC9A 2XVCA 2ZO4A 2QA4I 3G1LA 2PJPA 3K1MA 4XIDA 2XAGA 2YR2A 4G9YA 3DU6A 3RJPA 2QBYB 3J7YJ 3L2UA 4BE0A 3RKQA 2RN7A 3FXOA 3FISA 4BJ6C 4A12A 3LQRA 1TTYA 3ZQ7A 2R7TA 2V6CA 2P5LC 2DT5A 3H3ZA 4ITVA 1YFHA 4O5VA 2FOKA 1ZELA 1ETYA 2FUG2 3FKIJ 1ODDA 2M8GX 3EYYA 3GZNB 1RKWA 3KZZA 4H0EA 4EM2A 3CCYA 2EFNA 4FE4A 4UUSA 2ZXJA 1PUEE 2HS5A 1WGXA 1W0TA 4XKWA 1Y0UA 1P2FA 4PJ0C 3SJMA 5GTIC 1MSFC 3WHCA 3I59A 5ICCA 3FZVA 2JSCA 3W2AA 2CQNA 3CO7C 5B3SH 1USSA 1R4MB 2JMWA 3W2VA 2ISZA 3O3KA 2XAQA 3R0AA 3BR1A 4GGGA 3CMAI 3LSGA 2V7FA 1JKOC 2XSDC 4PSWA 4RM2A 3OIPA 4PJNA 4LB5A 4BUPA 2HGCA 2R7QA 3CMYA 4E7JA 4MTDA 3DEWA 2GXGA 3LSKA 3CJQB 1Z6TA 3KLNA 1FLIA 3GTJJ 1XGNA 1I50J 2ZMEC 2MA3A 3KFWX 2FX0A 1FY7A 1JE8A 1IN6A 1QVTA 3CCLI 2NNNA 3K6GA 4CZCA 1MMAA 1XPXA 1IN4A 2Y9YA 3EDPA 4C3IJ 4F55A 1GDTA 1IW7F 2PX9A 4CXFA 2M5WA 1U8RA 2XGCA 2QSHX 2XAFA 2FBHA 3HOVJ 2BXZA 4LIVA 3S2HJ 2QM3A 3TO7A 4P9FA 3MKZA 2W57A 2EINH 4BHPA 3GZ6A 1GXPA 3V4GA 4GRIA 3G6EI 5B1BH 4KMUX 4RLFA 1XTAA 3H5RA 5LD2C 1ON1A 2HXIA 2HU9A 1SD6A 1OFCX 3N4MA 4P55A 4CGZA 5FKNA 1UJ8A 1VQMI 2DA2A 2CUJA 4M6YA 4BY7J 1E2XA 2X4HA 2ME6A 1TT5B 2DYSH 2CQ7A 2XGDA 5F04A 3MEXA 4YIRX 3CCMI 2B63J 3ONQA 2R93J 3RQIA 4M9ZA 3L2VA 3Q0WA 1OISA 1FMWA 4U7DA 2F6CA 3WE3A 5KAFC 2V4JC 1R7JA 1J09A 2RAEA 1SC7A 1K83J 2VT3A 5L3GA 3L00A 3GO5A 2YX4A 2IS1A 4P9UA 3FBIB 2HDWA 4RM3A 2VJJA 2ID3A 4CCLA 3MZHA 1OKRA 4JOMA 3K70D 4AU7A 1Z21A 3OR2C 1X2MA 1Z3XA 3KYLA 3H3VK 2DA3A 1ZLJA 3C2BA 3IUOA 4MIMA 5JR3A 4YRVA 2IS4A 3JR9A 2VIXA 1R00A 3H3UA 5HDNA 5ERIA 5B1AH 3W6KB 1BR2A 1WI9A 3CUQA 5E3NA 3L2RA 3BG3A 1WZ2A 3L1PA 4PCQA 1I39A 1R4NB 5F64A 3HOSA 3DEUA 1GVDA 3GF2A 3COAC 5FKLA 1MDMB 1ONVA 4BY1J 3OV8A 4Y15A 4ZJZA 3M8FA 2DLLA 2JRMA 2DW4A 2UXXA 4L9VA 3D5LA 2ISYA 1TP4A 1JXSA 4LGWA 2RKHA 1P7IA 1XX5A 4B09A 4HQEA 1T95A 4BAYA 3HIFA 3ESWB 1YLFA 4QWQA 2EFOA 3TOAA 4BYYA 2VASA 2EZLA 1QHHD 5JLWA 5K7ZA 3WTUC 4UV8A 1EA3A 2DOEA 3HZJA 2WB1A 3OYCA 3F72A 4HAMA 3QOEA 4HG2A 1MW7A 2H09A 4XLHA 4E7ZA 2ZC2A 3RKXA 1TBXA 5K7FA 3ZMUA 5EEAA 2H8WA 1Z77A 2XHKA 5IT9Z 2OC6A 3OL3A 2HOTA 4RB1A 1STZA 1HKSA 1OYIA 3CTAA 1EKEA 2RQQA 2KKOA 2LMDA 2EIMH 4RB3C 2A07F 3PIOF 3HPGA 4EV0A 3O2PE 4A2UA 1PJRA 2PI0A 2IS6A 3E5XA 1U0JA 2HYGD 5F27A 5D5VB 2EQRA 4OIQF 2M30A 1RZ4A 1AOYA 3CZ6A 5CQEA 4K2EA 5E1WA 4BS9A 4XRMA 1U2WA 2V1DA 3QU3A 4NQWB 3DTKA 5HLTA 2COMA 5DUIA 3HXLA 1HKQA 5H6RA 4Y4RA 3GFIA 2R5ZB 2XAJA 2XDVA 4I01A 3JAMZ 4A3KJ 3A01A 1FX7A 1APLC 2XPVA 3NRVA 2GOXB 1K7AA 3NWSA 1XG1A 2NVUB 2O6GE 1TWAJ 2QGUA 4L5IA 5HDKA 1JUSA 4A3FJ 3REOA 4BDYA 2LY9A 5DEQA 4A0XA 3CDIA 4BKXA 5GPCA 2HYFA 1U9NA 3IAM2 1E3HA 2GWRA 4M74A 4E7SA 2JZYA 1YG2A 2M34A 3VYUB 3GFMA 1TL8A 5C4JJ 1NTCA 2QENA 2ZB9A 1ZLKA 1USTA 1JTXA 2A6EF 5IYBJ 1P4WA 1QZEA 3CC2I 5M3FJ 1HSJA 2M4GA 2ELHA 4HQMA 1FWZA 1BJAA 2J5PA 1FT9A 3SFZA 2CYYA 1FP2A 1ORKA 3R4KA 2FNPA 3RCOA 4ENNA 4LB6B 2H8RA 3LSPA 5F08A 2RNGA 1F4KA 1JUMA 4PZJA 5D8KB 1G4DA 2HKXA 3HBLA 1BW6A 1O7FA 1MBKA 1BBYA 3E6DA 2IGMA 3FXKA 4D5FA 4ZZDA 2CQQA 1XDSA 4F92B 1LJ9A 1I1GA 1R1UA 3LA7A 3DTEA 4GO1A 4LIUA 2JVHA 3FMQA 5TJJA 3KZYA 5EDNA 1E0EA 5JI6A 4U0VA 1VZ0A 1YOVB 2R7RA 5L3FA 3WU0A 3GWZA 1TW2A 2C6YA 1YJ9I 1LFUP 2X85A 4GDFA 2HDCA 1R1TA 3QYEA 1NG6A 1D1BA 2NVYJ 3K7AJ 3CP8A 3QYBA 4UB8C 3NAUA 4Q4ZF 3U1DA 5GPAA 1Z3YA 1FC3A 3JSPA 4JX6A 2BOLA 3VYTB 3CJRB 5FLXK 2IXSA 1B9NA 2XGEA 4C3JJ 2UZKA 2E71A 1XB4A 2UWMA 2RQPA 2E7XA 4P96A 3G1MA 2ETHA 1EF4A 2R7FA 4NC6A 2CMPA 3ZQHA 4XLNF 1IUFA 3JRDA 1FTTA 2LNBA 2YUSA 2XROA 1CQTA 2E19A 5L3CA 2RDPA 2ICWG 5DM7F 2OJED 5FKOA 1OQYA 1QNTA 3M9AA 1YS7A 3VFZA 4G12A 4RAZA 2XAHA 2VKDA 2O03A 2EB7A 1YRNA 3PSFA 4IX7A 1FOYA 2V9KA 1B1BA 1WRJA 1B8IA 1RNLA 5KVRA 2ZCWA 5J4YA 2EBIA 1GVJA 1Y1WJ 2EFPA 3V42A 4XRSG 4IHYA 1UAAA 3E6CC 4Y52J 2QKMB 2E1MC 4KN7X 2DAOA 3LOCA 2E60A 2CW7A 5J8FA 2VBZA 4HV6A 3RPQA 2DJNA 4YIIA 3TDUC 2EIKH 2ADUA 4AIHA 4HLYA 4KJZA 3OS0A 2DA7A 2AXTC 2Z5UA 3SYTA 1GLNA 5TISC 3HUGA 1R5ID 2X1EA 3J7AO 1V54H 3HSFA 3U2RA 4HNUA 4G8XA 3AKZA 5EJCA 1SFOJ 2LK2A 2Y0SN 1TQIA 2FA5A 1VF9A 2BW3A 1WVRA 4BHCA 3T0YA 5ICGA 1IDZA 2Q2EB 3B6CA 3QPSA 1ZAOA 2QUFA 3MZ8A 2OU2A 1T56A 1VQPI 1YJWI 5BS6A 2QKLB 4ZYDA 1S6LA 3S3NA 3BWGA 4Y13A 2DXIA 4PUSA 3RI4A 2XF5A 1BC8C 3S1NJ 4A6EA 3DQVC 2LOOA 1ITYA 4ENKA 4RDUA 5GAEJ 4ANJA 2IGOA 3P7NA 1S7AA 2DA1A 3FWEA 4HSTA 1IN8A 2IP2A 2JUGA 4E7KA 1YIOA 3ZP5A 1MKMA 4WXDA 1MNEA 1SMTA 3ZN1A 2D1VA 3D5SC 2GZWA 2F48A 2W1OA 3ZQGA 3HG9A 1U3EM 3PQKA 3C2HA 2PMZA 3DKYA 1FJLA 2JA7J 4J19A 2WBMA 3GMEA 1J7KA 1W36C 4KICA 5DD4A 3S32A 5LHGA 4G7OF 2BGCA 4CH7A 2DOFA 1U5TB 3BT9A 2BHYA 4XORA 2MFZA 2I5UA 4B8XA 3PIPF 2QQ8A 2RVCA 2F5CA 2QLZA 3Q3SA 2VUMJ 3F8BA 1I5ZA 4B43A 4HNVA 5J40A 3MVPA 4XLFA 2ELKA 5E20A 1Z7UA 4TV7A 5J47A 2XAUA 4C2MJ 4QIWN 2ACJA 1HW1A 3K4BA 1SVOA 3OYKA 2W24A 3KETA 2AS5F 1WJ5A 2P7VB 3WU2C 2K4JA 2E1OA 2LY1A 2FSWA 5F0HA 2LVSA 5D5WB 1FPQA 3BG6A 3CD6I 2B7EA 2DCEA 3UR3C 2X51A 3A0HC 3ERMA 2ZJRF 1HC8A 1J2XA 3CCUI 1S8NA 1XCVA 3W2WA 2B0LA 1YX5A 3CLOA 3L9FA 4N4NB 3BPVA 4KFCA 4YFXF 3O8GA 3MMYB 1T0FA 3J7ZI 4OIPF 1A31A 3IWZA 2F5VA 2JN6A 1R58A 3MAJA 3VPRA 1FOWA 3I0TA 2I8DA 2AHQA 2O8XA 5EGOA 2BXYA 3E6BA 3HRUA 1GV2A 2L4MA 3MKWB 2PN6A 2DU9A 1PYVA 4OWRB 4IOCF 5FKKA 5FB2A 2DI3A 3ZXSA 3VEPA 2HI3A 3H0GJ 4L5JA 2A5YB 1W1WE 2PEXA 2DK5A 2IW5A 3FIWA 1TT0A 2VQHA 3M8JA 3HL2A 2DT7B 4NB5A 1MH4A 4FHTA 2VBWA 5EG0B 5EEGA 1TNTA 3HOZJ 4ZYAA 4AVZA 5BMZA 4IF4A 1XSDA 1R5GA 1SFXA 2ESNA 3LFKA 1SFUA 2NOGA 5DCMA 3OS2A 1U78A 4WWCA 1R6RA 3C2GA 2QEXI 2ZSHB 2V9VA 2KISA 4EMSA 1FIPA 3VSKA 1WCMJ 3H9QA 1OYWA 2BV6A 2HQ5A 2PJRB 4O6JA 1VQ8I 5IY5H 3C7JA 2OA4A 2LFBA 3F9KA 2GA2A 3DLAA 4ZC3A 5DD8A 3BP8A 3PSIA 2VL8A 2IEKA 3ULQB 4FQGA 3H1CA 2ZMEB 3DU5A 5AIQA 5K5OA 1ETQA 2XV4S 1WPKA 2Y31A 5CVIA 3VYRB 2HEOA 1ZARA 1YITI 1L0OC 4LK1F 4FCYA 1JKQC 2L9NA 3Q0VA 3GFJA 2Z1DA 3VDXA 2W85A 2LBFA 3CESA 1XGOA 2ZJ2A 4JX5A 2GXAA 1P92A 3OYLA 1WJEA 3TP0A 3P5JA 3T5XA 3TL4X 4IRIA 1V5FA 3HHGA 1XSVA 3DKWA 3MWMA 1VQNI 3G71I 1LFBA 1ZGAA 4ON0A 1WHUA 5EF6A 1WKMA 5LRRA 2I10A 3TEDA 4MQ9F 2FMLA 2DYRH 3KEYA 3RQ4A 1Z67A 4QTRA 1W7PB 2NS7A 3BJAA 4IRGA 2DBBA 4BEHB 1DU6A 2M45A 3QAHA 4XSXF 4GYIA 3C3WA 1SD7A 4Z2YA 5J8CA 2CFXA 3DFGA 1T39A 4XLEA 4XR6A 2EV5A 1W5SA 3VODA 2OF7A 4PFOA 3E0JB 2Z2SB 5IYCJ 5LHIA 1K4TA 2R7SA 5BNGA 5HOOA 3M3YJ 2BBYA 3WTTC 1RIOH 3HPHA 1HQCA 2LY2A 2VC0A 2E5NA 2XUBA 3IAS2 1FTZA 3HKZN 5HLIA 4XSZF 3KP4A 2FE3A 1TWGJ 3D1NI 2F5EA 1R49A 2E1NA 1T8IA 1IRGA 2NYXA 3RYRA 3JW4A 2IA1A 2W48A 3FXUA 3UKGA 1Z9CA 3OYDA 1D0YA 1XMXA 3OYNA 1DQUA 3DP7A 3QODA 4M71A 2Z33A 2JUCA 2O7OA 3JRGA 3HRMA 3HYIA 3FXQA 3CDLA 1U9OA 2W25A 1B4AA 3CF2A 3FBNB 5KAIC 3ZOBA 4D1QA 2F4IA 1JT6A 2KL4A 3M8EA 2CGPA 1OCOH 3OYGA 3K1NA 4A3JJ 4CO8A 3V7RA 4ENJA 4ZDLA 4OOIA 5HS7A 4RBOA 2PFBA 2Z99A 5E17F 4BH9A 2E34A 3OYMA 5CQGA 1HCRA 5M5YJ 1A6QA 3J81Z 4IKFA 2VOOA 1I6HJ 2OTJI 2VE9A 2JA2A 2RV8A 3HHHA 3WGIA 4MEYF 3PM1A 3F22A 3CO6C 2H27A 2K3FA 4A5NA 3HTUA 2YS9A 3U21A 1IUYA 2HQRA 1OR7A 1WJFA 1IRXA 2X6XA 2EZHA 2Q0OA 1MMNA 4DW6A 1GT0C 1PUFB 1YW7A 4A6DA 3HGYA 3WTXC 5ILUA 4QSHA 4OIRF 1Q1VA 1MH3A 2EWNA 4ZYEA 1F43A 2GXBA 3DEEA 4LLNA 2F4MB 2HNHA 4M6VA 2VN2A 5FD5A 1G3TA 4YG2F 2CH0A 1ZRDA 5IPAA 3BJOA 1S7EA 4XKBA 1VQOI 1JJ8C 5H20A 2VLAA 5FO5A 3LSTA 3DBRB 1Y8RB 3OY9A 1K61A 4A5MA 1WFXA 2E7WA 2IGKA 1B72B 2CQKA 2XKPA 5F1JA 3ISPA 2F5FA 2QQ9A 3ASNH 1W4MA 4ENMA 1EH7A 2GIVA 2OAZA 3FHNA 3MN2A 4A69C 1ZG5A 3BY6A 3PNYA 3HOUJ 2HVRA 3HTSB 2MSYA 3EQLF 3RZDJ 1JTYA 1F5TA 1VQKI 4HOBA 4XLAA 2V1NA 1X3WB 2CW0F 5E8GA 2QQAA 2WAQN 2JRTA 3EUHC 1TW3A 1XN7A 1X1BA 1LDKB 1IV6A 3GUDA 3V7CA 2A6TA 4BU2A 4D0PA 3LWFA 4CYCA 3IKTA 2LLKA 3M4OJ 1HW2A 2VKEA 1N75A 2X1CA 3OS1A 1S72I 1IXRC 3CP2A 2M3AA 4RGSA 3TKYA 3F8CA 4JBAA 1K78B 4JYKA 3FKJA 5JVGF 4MLOA 4MNUA 3GYHX 4F3QA 3FK6A 2A6HF 1ZN2A 4MEXF 1WJDA 1S3JA 5E8IA 3DWLE 4A3LJ 2KRCA 2Y0MA 3T8RA 2HTSA 4ESJA 1HW5A 5D6FA 1ZH5A 1S29A 1NK3P 5FFXA 4UB6C 3GEZA 4LG0A 1M1EB 2NAZA 3CCQI 2W84A 4YIFA 4F52A 2MC4A 4KYWA 4II3A 5LBQA 3ZQLA 1LE8B 3S8PA 3A4CA 1BR4A 1ON2A 3FMSA 1O3TA 2VJ4A 3AG1H 2YU9J 3HRTA 4X0GA 4BJ5C 2GM4A 2DK8A 2KDZA 2Y0SA 3SHFA 5DCFA 4EJWA 4YFKF 5GAHJ 1QHGA 2KPMA 3HOWJ 2CSOA 3SZGA 2DMQA 2CV1A 3EETA 4EVIA 5IOYA 1UELB 4MO7A 3FX3A 3QP6A 4IL6C 1Z91A 2CU7A 4FX0A 2OUMA 3PQJA 1XMAA 2VBXA 3BPXA 4OAYA 3HM5A 3P9CA 1VQLI 4GFBA 2A68F 3PNVA 2CS3A 5BQTA 3JRIA 2OD5A 2X48A 2M1BA 5K5RA 1X3ZB 2K4BA 4ZZLA 3LAJA 2K40A 3BLYA 2Y69H 4DQ2A 3LSRA 2EV6A 5C3EJ 3J80K 1G2HA 4CYDA 4HNTA 4BQOA 3PFYA 4M9XA 1UMQA 4CHUA 2G9WA 4CCNA 3LMMA 4PGGA 3GFLA 3BCBA 1CF7A 5JLXA 1YJNI 5K1YA 4LLGF 2LD5A 2E5ZA 1AHDP 4M3EA 3M7GA 2FEZA 2BHZA 2Y2ZA 5B5EC 3I4MJ 5CJ9A 3ZPLA 3H92A 1G8XA 1X3UA 2EA4A 3F23A 3KP3A 2NS8A 3MQ0A 2WY7Q 2AQFA 1KONA 2OV7A 4PSXA 3BG9A 2W82A 3ZCOA 4GCVA 4EGYA 1ZYRF 4AYBN 1BIAA 1V55H 5K5QA 4LK0F 3H9JA 1YI2I 2JWTA 5DM6F 2R7ZJ 3IP4B 3K4LA 1WJAA 2CG4A 2O3FA 4IO9F 5TGTA 1MMGA 3LA3A 4G7HF 1HF0A 1N78A 1AKHB 4EJOA 2E1MB 3GTGJ 4A0ZA 3QPHA 3RTRA 3GTOJ 3A02A 4HLXA 1QZYA 3AG3H 2F5DA 2LDUA 4ABZA 3F8FA 1MJBA 3PJRA 2Q1ZB 2ZXWH 3H36A
chains in the Genus database with same CATH topology
3F6VA 5F6FA 3TDZC 3GLXA 1YTYA 1ZG3A 4AD9A 4BXUA 3VB2A 4R79A 2QBYA 1KU7A 2HQNA 4UUVA 2VOPA 3DPTA 1D3YA 2VT2A 4M6XA 3L2CA 5FLXZ 1XMKA 2O61A 3BOQA 2AXLA 4UV9A 5LEKA 1JGSA 4WK8F 4HA8A 3LQQA 5TRDA 2P6SA 4PDKA 4AWXB 1O3RA 2JT1A 4HX8A 4Q47A 3RYPA 3JAMK 4U88A 3K9TA 4M73A 3GVAA 4KDPA 2MLGA 3JTHA 5DUKA 3BROA 3K1PA 1Q1HA 1SMYF 2ZNYA 2YSRA 5D8LB 3CDHA 4JK1X 1T6SA 2DFIA 3FM3A 3F21A 3F3XA 4WX9A 1KGSA 4YFNF 5LGUA 1O57A 2P5VA 2L02A 1NHAA 5D4SA 3K0LA 3BJ6A 4MGRA 4L9JA 2FBKA 1XSXA 4N9HA 4MTEA 4WXHA 1KYWA 4HW0A 4L9NA 5D5UB 1IAWA 1O3QA 3V8KA 1R5HA 3BZ6A 1KQ8A 1UHWA 2LF8A 2R7DA 4G94A 3I4PA 5JHUA 5AONA 4P5OA 1LEAA 4Q48A 4KNYA 5LHHA 4XBFA 1JHFA 4RAYA 4XRFA 1Z05A 2RGVA 1QZZA 2IA2A 3QPTA 3IKVA 3WTYC 1JHHA 4AIJA 2EFQA 2H6BA 2EJRA 4IHSA 2K86A 3I64A 2ZNZA 2IA0A 2WC2A 2KJBA 3SZPA 2STWA 3FMRA 3CUOA 2M8EA 1V4RA 4I2OA 2DQLA 3I59B 3E5QA 3RKYA 1XGSA 4FX4A 3WTVC 3IRQA 3WTWC 1MJ9A 1MDMA 2GAUA 4OU0A 1H0MA 3V7SA 1FYLA 3C18A 3S2WA 1ULYA 2RNJA 2KIFA 5LRSA 1FNNA 2BEOA 4G6QA 4EJTA 3PFIA 2HZTA 3IC7A 4RGXA 3K2ZA 1WWXA 1IRFA 3SXYA 2P8TA 1HSTA 3KP5A 1QGPA 4ZYHA 5E1ZB 3SQNA 4DNCA 2A69F 3ERED 3HSEA 3I53A 1FBUA 4HZFA 2OZUA 1PP7U 3MCZA 1O7LA 4ESBA 4NQWA 1QBJA 2OQGA 3JTGA 1S7OA 1D8JA 3Q9SA 3ML6A 4N0BA 2OZ6A 4KIFA 2A61A 3KCCA 4I09A 5A2QK 3WTZA 2L54A 3I71A 2FBIA 4S04A 4IJAA 3QP5A 2F2EA 3E3VA 1IF1A 3ABTA 4CZZA 1Z1DA 3CUQB 2DQRA 5H6QA 2L01A 2CO5A 3M1EA 1KYZA 1YO5C 2DTRA 3RIRA 1OPCA 4LFUA 3FM5A 3G73A 1MZBA 1G6NA 1PP8F 4ZH4F 3DPLC 3I58A 4U0WA 4IXAA 5LGTA 4RGRA 3CJNA 3V8JA 1K79A 5CVUA 1BIBA 3Q5FA 1YYVA 3F8MA 3NEUA 5CYVA 5IT3A 4AVPA 3MZYA 1G3YA 2L4AA 1TLHB 2H94A 2VBYA 3TO6A 4UVBA 2NS0A 1FZPB 2VE8A 4M72A 1XCBA 1REPC 1OYYA 1HKTA 4OMZA 2ZKZA 2P5KA 1SD4A 5FGMA 1I27A 3GZ5A 1P4XA 1W5TA 5FD6A 1UHMA 3W6JB 4I98B 2CWEA 2WV0A 1L3LA 1FOKA 2WTEA 3ABUA 1K6OA 1UFMA 3ZMVA 4R1HA 3ZMTA 2EV0A 5HS9A 2QYOA 3B02A 3WTSC 1LDJA 4ASNA 2JTVA 2Q2EA 1H9GA 3KEOA 4HF1A 1LDDA 3CUQC 4G7ZF 1FSHA 2HKOA 1BN5A 1ZRCA 3LAPA 3ZMSA 1QPMA 4CICA 1LNWA 1MJAA 1ZGJA 3P9KA 2M87A 2O0YA 4UVAA 2IRFG 4BNCA 5CVJA 5D4RA 1DPRA 1YW9A 1ZG1A 3R60A 4HBLA 2VXZA 1H9TA 4KMFA 1BI0A 3ROUA 4BHBA 4L18B 2V1UA 1MD0A 5ICFA 1U5TA 3J81K 1G3WA 2YX7A 1ZRFA 2YPRA 2EA2A 1RUNA 4KUMA 2OBPA 1C0WA 4GYGA 4L0ZB 3KE2A 1UCRA 3T8TA 2QVOA 5KK1A 5HLHA 2MBFA 3L09A 2L3DA 3J80Z 3ZMDA 3TO9A 5HVQC 4WCGA 1VTNC 4I0BA 4M9SA 1EV7A 1J9IA 1OMIA 2P7CB 4HDVA 4MHGA 1B9MA 4GXOA 5E18F 1LB2A 2UXNA 2PLYA 2FQ3A 1BM9A 2LF7A 3ELKA 1HXDA 1IXCA 4AIKA 1T2KA 4EJUA 3IHUA 2Z3YA 4ETSA 1W7PD 6PAXA 2D45A 2WWYA 2MLKA 3KEQA 4HDUA 4CDGA 1WSUA 2YU3A 4KIBA 2FF4A 4IVNA 3Q9VA 2R3SA 2ZMEA 4KN4X 2DO7A 2HR3A 4LLLA 2X0LA 2QZ8A 2MH9A 2Y75A 1KQ9A 3I54A 4KT5C 4HF2A 4LD5A 3EUHA 3L7WA 3IWFA 4UXNA 3U9GA 1BI2A 2HFHA 1EH6A 5F1RA 3ZN0A 5L3BA 4U7BA 1FYKA 2VONA 1P4AA 1B6AA 4FT8A 1W7PA 2PQ8A 2XKOA 1R36A 2MH2A 3KP7A 3N97A 2HWVA 2H6CA 5E1XA 1I1SA 3KP6A 2MD5A 2QQBA 3KLOA 1ZREA 3RDIA 2G7UA 3WODF 4UHTA 3ZMZA 2JPCA 1FBSA 1KA8A 5JFRA 1IXSB 4XLPF 4A0YA 1DUXC 2KIMA 2FXAA 3DXJF 2FMYA 1SAXA 1KU9A 5IT9K 5BOXA 3VOEA 1F1ZA 2VODA 3K69A 4LJZF 4WF2A 1XDUA 2XASA 3MFKA 2HTJA 5DCMB 2RC4A 5D5XB 4ZYGA 1BC7C 5HS8A 1U6GA 4Y17A 1R22A 4HYEA 2XGXA 1TNSA 2PMHA 3I5UA 4R8HA 4EM0B 2BYVE 5CVRA 4I7HA 3FF5A 2EFWA 4L0YB 1GXQA 3LA2A 3GXOA 1UB9A 1DDNA 3QU6A 4HF0A 3FHZA 3EYIA 1A04A 4QLCU 5ICEA 2IT0A 1E17A 2V1XA 1P6RA 1SFEA 2K7LA 2OQRA 3HSRA 2K02A 5JVTA 1XD7A 2HOEA 4RB0A 4S05A 2DPDA 3RKWA 3DF8A 1RUOA 1J75A 1K78A 2TDXA 4JQFA 2E1CA 2XRNA 1D5VA 1LQ1A 2PG4A 3KP2A 2BE5F 3RPUA 1HBXG 5LGNA 1O3SA 1RI7A 1WQ2A 1MGTA 4LMYA 3AAFA 2KJCA 5J6XA 3WGHA 2IPQX 4I0AA 2NRAC 4N9IA 3DV8A 2K27A 2QWWA 2STTA 4U0YA 1YS6A 1Z6RA 1J5YA 2A3SA 2FRHA 4BQAA 3HRSA 3BDDA 3P9IA 3WE2A 2JPBA 2Y48A 4L9TA 5L3DA 3B73A 1BI1A 4RGUA 1FSEA 4EGZA 1KQ0A 1SD5A 1TQPA 3T1BA 4IPAA 3V8LA 4RS8A 2PMUA 4KIGA 5ED4A 4G6DA 2FNAA 1IN5A 3JSOA 4IHTA 2ZFWA 5A2QZ 1FP1D 3R0JA 1PDNC 2VC1A 5BPDA 1DP7P 3QOPA 3E6MA 5LLQA 2Z9OA 5DDGA 4MQVA 1QQIA 2P4WA 4IRHA 2GQQA 5FFZA 3NQOA 2IJLA 5DYMA 1IN7A 3QRFF 2IVMA 2ZBKA 5CVVA 4LG0B 3E5UA 3WGGA 1QO0D 1BI3A 2LSOA 4I02A 3TOBA 1AWCA 1I6XA 1CGPA 3IL2A 4HX7A 3IRRA 3G3ZA 3OOPA 2EK5A 1LVAA 1FBQA 1GHCA 4UVCA 1KU3A 1J0RA 1T38A 1YW8A 4KA4A 3HOTA 3F8NA 4HX4A 2XIGA 1R1VA 5EEHA 1ZHFA 2D2WA 4O3MA 2KIUA 4PGHA 2Q8KA 3R6SA 4WXCA 3WG9A 4UNOA 5BPIA 4OIOF 4OINF 4EM1A 4RB2C 2FU4A 1F9NA 1KU2A 1V3FA 1IZ1A 1D8KA 3F6OA 1T98A 3GW2A 2D1HA 5HDGA 5ILSA 1CF7B 4E70A 4Q5SF 3ECHA 2KRFA 1YQAA 3O6BB 1XGMA 3ECOA 2G7HA 1TQMA 2P6TA 1G3SA 4HV5A 2ESHA 4ESFA 2V79A 3SZTA 5ILVA 5AIPA 1BOAA 4NHJA 1DPUA 2PBIA 4EQQA 1FYMA 2J5OA 4F7ZA 2GA1A 2NNYA 1R23A 5DV5A 2LKPA 1LEBA 1J59A 3E97A 1EH8A 3WU1B 1U5TC 5HLGA 4OMYA 5D6EA 3D0SA 1B59A 3R61A 3FXRA 3TGNA 5L3EA 3C1DA 3GX4X 2MC3A 3TQNA 5CLSA 5LEJA 4EJVA 2DPUA 2XVCA 2ZO4A 2PJPA 3K1MA 2XAGA 2YR2A 4G9YA 3RJPA 2QBYB 2RN7A 4A12A 3LQRA 1TTYA 3ZQ7A 2V6CA 2P5LC 2DT5A 3H3ZA 1YFHA 4O5VA 2FOKA 1ODDA 3EYYA 3KZZA 4H0EA 4EM2A 2EFNA 2ZXJA 1PUEE 2HS5A 1Y0UA 1P2FA 3I59A 5ICCA 3FZVA 2JSCA 3CO7C 1USSA 2ISZA 3O3KA 2XAQA 3R0AA 4GGGA 4LB5A 2HGCA 4MTDA 2GXGA 3KLNA 1Z6TA 1FLIA 1XGNA 3KFWX 2MA3A 1JE8A 1FY7A 1IN6A 2NNNA 1IN4A 3EDPA 1IW7F 4CXFA 2M5WA 1U8RA 2XAFA 2FBHA 2QM3A 3TO7A 4P9FA 2W57A 4BHPA 3GZ6A 1GXPA 3V4GA 4KMUX 1ON1A 1SD6A 3N4MA 4P55A 4CGZA 4M6YA 1E2XA 2X4HA 3MEXA 4M9ZA 4U7DA 3WE3A 1R7JA 2VT3A 5L3GA 3L00A 3GO5A 2YX4A 4P9UA 3MZHA 1OKRA 1ZLJA 5JR3A 1R00A 3H3UA 5HDNA 5ERIA 3W6KB 1WI9A 3CUQA 4PCQA 5F64A 3HOSA 3DEUA 3GF2A 3COAC 1MDMB 1ONVA 3OV8A 4Y15A 3M8FA 2DLLA 2DW4A 2UXXA 4L9VA 3D5LA 2ISYA 1JXSA 4LGWA 2RKHA 4B09A 4HQEA 4BAYA 3HIFA 1YLFA 4QWQA 2EFOA 3TOAA 4BYYA 3WTUC 4UV8A 3F72A 4HAMA 2H09A 3RKXA 1TBXA 3ZMUA 2XHKA 5IT9Z 4RB1A 1HKSA 1STZA 1OYIA 3CTAA 2KKOA 4RB3C 2A07F 4EV0A 3O2PE 4A2UA 2PI0A 3E5XA 2HYGD 5D5VB 4OIQF 2M30A 1RZ4A 1AOYA 4K2EA 5E1WA 1U2WA 2V1DA 3QU3A 2COMA 5DUIA 3GFIA 1HKQA 5H6RA 2XAJA 4I01A 3JAMZ 1FX7A 3NRVA 1K7AA 2O6GE 4L5IA 5HDKA 3REOA 5DEQA 4A0XA 2HYFA 2GWRA 4M74A 2JZYA 1YG2A 3GFMA 2QENA 1ZLKA 1USTA 2A6EF 1P4WA 1HSJA 2ELHA 4HQMA 1FWZA 1BJAA 2J5PA 1FT9A 3SFZA 2CYYA 1FP2A 4ENNA 3R4KA 2FNPA 4LB6B 1F4KA 4PZJA 5D8KB 1G4DA 2HKXA 1O7FA 1BBYA 3E6DA 4ZZDA 1XDSA 1LJ9A 1I1GA 1R1UA 3LA7A 4GO1A 5TJJA 3FMQA 3KZYA 5JI6A 4U0VA 5L3FA 3WU0A 3GWZA 1TW2A 2C6YA 2HDCA 1R1TA 4Q4ZF 3U1DA 1FC3A 3JSPA 5FLXK 1B9NA 2UZKA 1XB4A 2UWMA 2RQPA 2E7XA 4P96A 2ETHA 2R7FA 4XLNF 2LNBA 2XROA 5L3CA 2RDPA 1QNTA 3M9AA 1YS7A 3VFZA 4RAZA 2XAHA 2O03A 2EB7A 1B1BA 1WRJA 1RNLA 5KVRA 2ZCWA 1GVJA 2EFPA 3E6CC 4KN7X 2DAOA 5J8FA 2VBZA 4HV6A 3RPQA 4YIIA 3TDUC 2ADUA 4AIHA 4HLYA 2Z5UA 3HUGA 3J7AO 3HSFA 3U2RA 4G8XA 1TQIA 2FA5A 4BHCA 3T0YA 5ICGA 1ZAOA 2QUFA 2OU2A 5BS6A 4ZYDA 1S6LA 3BWGA 4Y13A 3RI4A 1BC8C 4A6EA 3DQVC 4ENKA 3P7NA 1S7AA 3FWEA 1IN8A 2IP2A 1YIOA 3ZP5A 1MKMA 4WXDA 1SMTA 3ZN1A 2D1VA 2GZWA 1U3EM 3PQKA 1J7KA 4KICA 5DD4A 5LHGA 4G7OF 2BGCA 1U5TB 4B8XA 2RVCA 2F5CA 2QLZA 3F8BA 1I5ZA 5E20A 1Z7UA 4TV7A 2ACJA 1HW1A 2AS5F 2W24A 3KETA 2P7VB 2K4JA 2FSWA 5D5WB 1FPQA 1J2XA 1S8NA 1XCVA 2B0LA 3CLOA 3L9FA 3BPVA 4KFCA 4YFXF 1T0FA 4OIPF 3IWZA 1R58A 3MAJA 3I0TA 2O8XA 3E6BA 3HRUA 2L4MA 2PN6A 2DU9A 5FB2A 2DI3A 3VEPA 4L5JA 2A5YB 2PEXA 2DK5A 2IW5A 4NB5A 4FHTA 2VBWA 5EEGA 1TNTA 5BMZA 4IF4A 1XSDA 1R5GA 1SFXA 2ESNA 3LFKA 1SFUA 5DCMA 1U78A 4WWCA 2V9VA 4EMSA 1OYWA 2BV6A 4O6JA 3C7JA 2OA4A 2GA2A 5DD8A 3BP8A 3ULQB 2ZMEB 5AIQA 5K5OA 2XV4S 5CVIA 2HEOA 1ZARA 1L0OC 4LK1F 3GFJA 2W85A 1XGOA 2ZJ2A 1P92A 3T5XA 4IRIA 3HHGA 1XSVA 3DKWA 3MWMA 1ZGAA 4ON0A 1WKMA 5LRRA 4MQ9F 2FMLA 1W7PB 3BJAA 4IRGA 2DBBA 2M45A 3QAHA 4XSXF 4GYIA 3C3WA 1SD7A 4Z2YA 5J8CA 2CFXA 3DFGA 1T39A 2EV5A 1W5SA 3VODA 5LHIA 5HOOA 2BBYA 3WTTC 1RIOH 1HQCA 2VC0A 2XUBA 5HLIA 4XSZF 3KP4A 2FE3A 2F5EA 2E1NA 1IRGA 2NYXA 3RYRA 3JW4A 2IA1A 3FXUA 1Z9CA 3DP7A 4M71A 2Z33A 3HRMA 3HYIA 3FXQA 2W25A 1B4AA 3M8EA 2CGPA 3K1NA 4CO8A 3V7RA 4ENJA 5HS7A 4OOIA 2PFBA 2Z99A 5E17F 4BH9A 3J81Z 2VOOA 2VE9A 2RV8A 3HHHA 3WGIA 4MEYF 3F22A 3CO6C 2H27A 4A5NA 3HTUA 1IUYA 2HQRA 1OR7A 2Q0OA 1YW7A 4A6DA 3WTXC 5ILUA 4OIRF 2EWNA 4ZYEA 2GXBA 4LLNA 2VN2A 5FD5A 1G3TA 4YG2F 1ZRDA 3BJOA 5H20A 5FO5A 3LSTA 4A5MA 2E7WA 2CQKA 2XKPA 3ISPA 2F5FA 2QQ9A 1W4MA 4ENMA 1EH7A 2GIVA 2OAZA 1ZG5A 3BY6A 3HTSB 3EQLF 1F5TA 4HOBA 2CW0F 5E8GA 2QQAA 2JRTA 1TW3A 1XN7A 1LDKB 3GUDA 3V7CA 4D0PA 3LWFA 3IKTA 1HW2A 1IXRC 4RGSA 3TKYA 3F8CA 4JBAA 1K78B 4MNUA 3GYHX 2A6HF 1ZN2A 4MEXF 1S3JA 5E8IA 2Y0MA 3T8RA 2HTSA 4ESJA 1HW5A 5D6FA 1ZH5A 1S29A 5FFXA 4LG0A 3GEZA 2NAZA 2W84A 4YIFA 4KYWA 5LBQA 1ON2A 3FMSA 1O3TA 3HRTA 2DK8A 3SHFA 5DCFA 4EJWA 4YFKF 2CSOA 3EETA 4EVIA 3FX3A 3QP6A 1Z91A 4FX0A 3PQJA 1XMAA 2VBXA 3BPXA 3P9CA 2A68F 5BQTA 2OD5A 2M1BA 5K5RA 2K4BA 4ZZLA 3LAJA 4DQ2A 2EV6A 3J80K 4CYDA 4M9XA 4CHUA 2G9WA 4PGGA 3GFLA 1CF7A 5K1YA 4LLGF 3M7GA 2FEZA 5CJ9A 3ZPLA 3H92A 1X3UA 2EA4A 3F23A 3KP3A 3MQ0A 4GCVA 4EGYA 1ZYRF 1BIAA 5K5QA 4LK0F 2CG4A 2O3FA 3LA3A 4G7HF 4EJOA 4A0ZA 3QPHA 3RTRA 4HLXA 1QZYA 2F5DA 2LDUA 3F8FA 1MJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6V A;  5F6F A;  3TDZ C;  3GLX A;  1YTY A;  1ZG3 A;  4AD9 A;  4BXU A;  3VB2 A;  4R79 A;  2QBY A;  1KU7 A;  2HQN A;  4UUV A;  2VOP A;  3DPT A;  1D3Y A;  2VT2 A;  4M6X A;  3L2C A;  5FLX Z;  1XMK A;  2O61 A;  3BOQ A;  2AXL A;  4UV9 A;  5LEK A;  1JGS A;  4WK8 F;  4HA8 A;  3LQQ A;  5TRD A;  2P6S A;  4PDK A;  4AWX B;  1O3R A;  2JT1 A;  4HX8 A;  4Q47 A;  3RYP A;  3JAM K;  4U88 A;  3K9T A;  4M73 A;  3GVA A;  4KDP A;  2MLG A;  3JTH A;  5DUK A;  3BRO A;  3K1P A;  1Q1H A;  1SMY F;  2ZNY A;  2YSR A;  5D8L B;  3CDH A;  4JK1 X;  1T6S A;  2DFI A;  3FM3 A;  3F21 A;  3F3X A;  4WX9 A;  1KGS A;  4YFN F;  5LGU A;  1O57 A;  2P5V A;  2L02 A;  1NHA A;  5D4S A;  3K0L A;  3BJ6 A;  4MGR A;  4L9J A;  2FBK A;  1XSX A;  4N9H A;  4MTE A;  4WXH A;  1KYW A;  4HW0 A;  4L9N A;  5D5U B;  1IAW A;  1O3Q A;  3V8K A;  1R5H A;  3BZ6 A;  1KQ8 A;  1UHW A;  2LF8 A;  2R7D A;  4G94 A;  3I4P A;  5JHU A;  5AON A;  4P5O A;  1LEA A;  4Q48 A;  4KNY A;  5LHH A;  4XBF A;  1JHF A;  4RAY A;  4XRF A;  1Z05 A;  2RGV A;  1QZZ A;  2IA2 A;  3QPT A;  3IKV A;  3WTY C;  1JHH A;  4AIJ A;  2EFQ A;  2H6B A;  2EJR A;  4IHS A;  2K86 A;  3I64 A;  2ZNZ A;  2IA0 A;  2WC2 A;  2KJB A;  3SZP A;  2STW A;  3FMR A;  3CUO A;  2M8E A;  1V4R A;  4I2O A;  2DQL A;  3I59 B;  3E5Q A;  3RKY A;  1XGS A;  4FX4 A;  3WTV C;  3IRQ A;  3WTW C;  1MJ9 A;  1MDM A;  2GAU A;  4OU0 A;  1H0M A;  3V7S A;  1FYL A;  3C18 A;  3S2W A;  1ULY A;  2RNJ A;  2KIF A;  5LRS A;  1FNN A;  2BEO A;  4G6Q A;  4EJT A;  3PFI A;  2HZT A;  3IC7 A;  4RGX A;  3K2Z A;  1WWX A;  1IRF A;  3SXY A;  2P8T A;  1HST A;  3KP5 A;  1QGP A;  4ZYH A;  5E1Z B;  3SQN A;  4DNC A;  2A69 F;  3ERE D;  3HSE A;  3I53 A;  1FBU A;  4HZF A;  2OZU A;  1PP7 U;  3MCZ A;  1O7L A;  4ESB A;  4NQW A;  1QBJ A;  2OQG A;  3JTG A;  1S7O A;  1D8J A;  3Q9S A;  3ML6 A;  4N0B A;  2OZ6 A;  4KIF A;  2A61 A;  3KCC A;  4I09 A;  5A2Q K;  3WTZ A;  2L54 A;  3I71 A;  2FBI A;  4S04 A;  4IJA A;  3QP5 A;  2F2E A;  3E3V A;  1IF1 A;  3ABT A;  4CZZ A;  1Z1D A;  3CUQ B;  2DQR A;  5H6Q A;  2L01 A;  2CO5 A;  3M1E A;  1KYZ A;  1YO5 C;  2DTR A;  3RIR A;  1OPC A;  4LFU A;  3FM5 A;  3G73 A;  1MZB A;  1G6N A;  1PP8 F;  4ZH4 F;  3DPL C;  3I58 A;  4U0W A;  4IXA A;  5LGT A;  4RGR A;  3CJN A;  3V8J A;  1K79 A;  5CVU A;  1BIB A;  3Q5F A;  1YYV A;  3F8M A;  3NEU A;  5CYV A;  5IT3 A;  4AVP A;  3MZY A;  1G3Y A;  2L4A A;  1TLH B;  2H94 A;  2VBY A;  3TO6 A;  4UVB A;  2NS0 A;  1FZP B;  2VE8 A;  4M72 A;  1XCB A;  1REP C;  1OYY A;  1HKT A;  4OMZ A;  2ZKZ A;  2P5K A;  1SD4 A;  5FGM A;  1I27 A;  3GZ5 A;  1P4X A;  1W5T A;  5FD6 A;  1UHM A;  3W6J B;  4I98 B;  2CWE A;  2WV0 A;  1L3L A;  1FOK A;  2WTE A;  3ABU A;  1K6O A;  1UFM A;  3ZMV A;  4R1H A;  3ZMT A;  2EV0 A;  5HS9 A;  2QYO A;  3B02 A;  3WTS C;  1LDJ A;  4ASN A;  2JTV A;  2Q2E A;  1H9G A;  3KEO A;  4HF1 A;  1LDD A;  3CUQ C;  4G7Z F;  1FSH A;  2HKO A;  1BN5 A;  1ZRC A;  3LAP A;  3ZMS A;  1QPM A;  4CIC A;  1LNW A;  1MJA A;  1ZGJ A;  3P9K A;  2M87 A;  2O0Y A;  4UVA A;  2IRF G;  4BNC A;  5CVJ A;  5D4R A;  1DPR A;  1YW9 A;  1ZG1 A;  3R60 A;  4HBL A;  2VXZ A;  1H9T A;  4KMF A;  1BI0 A;  3ROU A;  4BHB A;  4L18 B;  2V1U A;  1MD0 A;  5ICF A;  1U5T A;  3J81 K;  1G3W A;  2YX7 A;  1ZRF A;  2YPR A;  2EA2 A;  1RUN A;  4KUM A;  2OBP A;  1C0W A;  4GYG A;  4L0Z B;  3KE2 A;  1UCR A;  3T8T A;  2QVO A;  5KK1 A;  5HLH A;  2MBF A;  3L09 A;  2L3D A;  3J80 Z;  3ZMD A;  3TO9 A;  5HVQ C;  4WCG A;  1VTN C;  4I0B A;  4M9S A;  1EV7 A;  1J9I A;  1OMI A;  2P7C B;  4HDV A;  4MHG A;  1B9M A;  4GXO A;  5E18 F;  1LB2 A;  2UXN A;  2PLY A;  2FQ3 A;  1BM9 A;  2LF7 A;  3ELK A;  1HXD A;  1IXC A;  4AIK A;  1T2K A;  4EJU A;  3IHU A;  2Z3Y A;  4ETS A;  1W7P D;  6PAX A;  2D45 A;  2WWY A;  2MLK A;  3KEQ A;  4HDU A;  4CDG A;  1WSU A;  2YU3 A;  4KIB A;  2FF4 A;  4IVN A;  3Q9V A;  2R3S A;  2ZME A;  4KN4 X;  2DO7 A;  2HR3 A;  4LLL A;  2X0L A;  2QZ8 A;  2MH9 A;  2Y75 A;  1KQ9 A;  3I54 A;  4KT5 C;  4HF2 A;  4LD5 A;  3EUH A;  3L7W A;  3IWF A;  4UXN A;  3U9G A;  1BI2 A;  2HFH A;  1EH6 A;  5F1R A;  3ZN0 A;  5L3B A;  4U7B A;  1FYK A;  2VON A;  1P4A A;  1B6A A;  4FT8 A;  1W7P A;  2PQ8 A;  2XKO A;  1R36 A;  2MH2 A;  3KP7 A;  3N97 A;  2HWV A;  2H6C A;  5E1X A;  1I1S A;  3KP6 A;  2MD5 A;  2QQB A;  3KLO A;  1ZRE A;  3RDI A;  2G7U A;  3WOD F;  4UHT A;  3ZMZ A;  2JPC A;  1FBS A;  1KA8 A;  5JFR A;  1IXS B;  4XLP F;  4A0Y A;  1DUX C;  2KIM A;  2FXA A;  3DXJ F;  2FMY A;  1SAX A;  1KU9 A;  5IT9 K;  5BOX A;  3VOE A;  1F1Z A;  2VOD A;  3K69 A;  4LJZ F;  4WF2 A;  1XDU A;  2XAS A;  3MFK A;  2HTJ A;  5DCM B;  2RC4 A;  5D5X B;  4ZYG A;  1BC7 C;  5HS8 A;  1U6G A;  4Y17 A;  1R22 A;  4HYE A;  2XGX A;  1TNS A;  2PMH A;  3I5U A;  4R8H A;  4EM0 B;  2BYV E;  5CVR A;  4I7H A;  3FF5 A;  2EFW A;  4L0Y B;  1GXQ A;  3LA2 A;  3GXO A;  1UB9 A;  1DDN A;  3QU6 A;  4HF0 A;  3FHZ A;  3EYI A;  1A04 A;  4QLC U;  5ICE A;  2IT0 A;  1E17 A;  2V1X A;  1P6R A;  1SFE A;  2K7L A;  2OQR A;  3HSR A;  2K02 A;  5JVT A;  1XD7 A;  2HOE A;  4RB0 A;  4S05 A;  2DPD A;  3RKW A;  3DF8 A;  1RUO A;  1J75 A;  1K78 A;  2TDX A;  4JQF A;  2E1C A;  2XRN A;  1D5V A;  1LQ1 A;  2PG4 A;  3KP2 A;  2BE5 F;  3RPU A;  1HBX G;  5LGN A;  1O3S A;  1RI7 A;  1WQ2 A;  1MGT A;  4LMY A;  3AAF A;  2KJC A;  5J6X A;  3WGH A;  2IPQ X;  4I0A A;  2NRA C;  4N9I A;  3DV8 A;  2K27 A;  2QWW A;  2STT A;  4U0Y A;  1YS6 A;  1Z6R A;  1J5Y A;  2A3S A;  2FRH A;  4BQA A;  3HRS A;  3BDD A;  3P9I A;  3WE2 A;  2JPB A;  2Y48 A;  4L9T A;  5L3D A;  3B73 A;  1BI1 A;  4RGU A;  1FSE A;  4EGZ A;  1KQ0 A;  1SD5 A;  1TQP A;  3T1B A;  4IPA A;  3V8L A;  4RS8 A;  2PMU A;  4KIG A;  5ED4 A;  4G6D A;  2FNA A;  1IN5 A;  3JSO A;  4IHT A;  2ZFW A;  5A2Q Z;  1FP1 D;  3R0J A;  1PDN C;  2VC1 A;  5BPD A;  1DP7 P;  3QOP A;  3E6M A;  5LLQ A;  2Z9O A;  5DDG A;  4MQV A;  1QQI A;  2P4W A;  4IRH A;  2GQQ A;  5FFZ A;  3NQO A;  2IJL A;  5DYM A;  1IN7 A;  3QRF F;  2IVM A;  2ZBK A;  5CVV A;  4LG0 B;  3E5U A;  3WGG A;  1QO0 D;  1BI3 A;  2LSO A;  4I02 A;  3TOB A;  1AWC A;  1I6X A;  1CGP A;  3IL2 A;  4HX7 A;  3IRR A;  3G3Z A;  3OOP A;  2EK5 A;  1LVA A;  1FBQ A;  1GHC A;  4UVC A;  1KU3 A;  1J0R A;  1T38 A;  1YW8 A;  4KA4 A;  3HOT A;  3F8N A;  4HX4 A;  2XIG A;  1R1V A;  5EEH A;  1ZHF A;  2D2W A;  4O3M A;  2KIU A;  4PGH A;  2Q8K A;  3R6S A;  4WXC A;  3WG9 A;  4UNO A;  5BPI A;  4OIO F;  4OIN F;  4EM1 A;  4RB2 C;  2FU4 A;  1F9N A;  1KU2 A;  1V3F A;  1IZ1 A;  1D8K A;  3F6O A;  1T98 A;  3GW2 A;  2D1H A;  5HDG A;  5ILS A;  1CF7 B;  4E70 A;  4Q5S F;  3ECH A;  2KRF A;  1YQA A;  3O6B B;  1XGM A;  3ECO A;  2G7H A;  1TQM A;  2P6T A;  1G3S A;  4HV5 A;  2ESH A;  4ESF A;  2V79 A;  3SZT A;  5ILV A;  5AIP A;  1BOA A;  4NHJ A;  1DPU A;  2PBI A;  4EQQ A;  1FYM A;  2J5O A;  4F7Z A;  2GA1 A;  2NNY A;  1R23 A;  5DV5 A;  2LKP A;  1LEB A;  1J59 A;  3E97 A;  1EH8 A;  3WU1 B;  1U5T C;  5HLG A;  4OMY A;  5D6E A;  3D0S A;  1B59 A;  3R61 A;  3FXR A;  3TGN A;  5L3E A;  3C1D A;  3GX4 X;  2MC3 A;  3TQN A;  5CLS A;  5LEJ A;  4EJV A;  2DPU A;  2XVC A;  2ZO4 A;  2PJP A;  3K1M A;  2XAG A;  2YR2 A;  4G9Y A;  3RJP A;  2QBY B;  2RN7 A;  4A12 A;  3LQR A;  1TTY A;  3ZQ7 A;  2V6C A;  2P5L C;  2DT5 A;  3H3Z A;  1YFH A;  4O5V A;  2FOK A;  1ODD A;  3EYY A;  3KZZ A;  4H0E A;  4EM2 A;  2EFN A;  2ZXJ A;  1PUE E;  2HS5 A;  1Y0U A;  1P2F A;  3I59 A;  5ICC A;  3FZV A;  2JSC A;  3CO7 C;  1USS A;  2ISZ A;  3O3K A;  2XAQ A;  3R0A A;  4GGG A;  4LB5 A;  2HGC A;  4MTD A;  2GXG A;  3KLN A;  1Z6T A;  1FLI A;  1XGN A;  3KFW X;  2MA3 A;  1JE8 A;  1FY7 A;  1IN6 A;  2NNN A;  1IN4 A;  3EDP A;  1IW7 F;  4CXF A;  2M5W A;  1U8R A;  2XAF A;  2FBH A;  2QM3 A;  3TO7 A;  4P9F A;  2W57 A;  4BHP A;  3GZ6 A;  1GXP A;  3V4G A;  4KMU X;  1ON1 A;  1SD6 A;  3N4M A;  4P55 A;  4CGZ A;  4M6Y A;  1E2X A;  2X4H A;  3MEX A;  4M9Z A;  4U7D A;  3WE3 A;  1R7J A;  2VT3 A;  5L3G A;  3L00 A;  3GO5 A;  2YX4 A;  4P9U A;  3MZH A;  1OKR A;  1ZLJ A;  5JR3 A;  1R00 A;  3H3U A;  5HDN A;  5ERI A;  3W6K B;  1WI9 A;  3CUQ A;  4PCQ A;  5F64 A;  3HOS A;  3DEU A;  3GF2 A;  3COA C;  1MDM B;  1ONV A;  3OV8 A;  4Y15 A;  3M8F A;  2DLL A;  2DW4 A;  2UXX A;  4L9V A;  3D5L A;  2ISY A;  1JXS A;  4LGW A;  2RKH A;  4B09 A;  4HQE A;  4BAY A;  3HIF A;  1YLF A;  4QWQ A;  2EFO A;  3TOA A;  4BYY A;  3WTU C;  4UV8 A;  3F72 A;  4HAM A;  2H09 A;  3RKX A;  1TBX A;  3ZMU A;  2XHK A;  5IT9 Z;  4RB1 A;  1HKS A;  1STZ A;  1OYI A;  3CTA A;  2KKO A;  4RB3 C;  2A07 F;  4EV0 A;  3O2P E;  4A2U A;  2PI0 A;  3E5X A;  2HYG D;  5D5V B;  4OIQ F;  2M30 A;  1RZ4 A;  1AOY A;  4K2E A;  5E1W A;  1U2W A;  2V1D A;  3QU3 A;  2COM A;  5DUI A;  3GFI A;  1HKQ A;  5H6R A;  2XAJ A;  4I01 A;  3JAM Z;  1FX7 A;  3NRV A;  1K7A A;  2O6G E;  4L5I A;  5HDK A;  3REO A;  5DEQ A;  4A0X A;  2HYF A;  2GWR A;  4M74 A;  2JZY A;  1YG2 A;  3GFM A;  2QEN A;  1ZLK A;  1UST A;  2A6E F;  1P4W A;  1HSJ A;  2ELH A;  4HQM A;  1FWZ A;  1BJA A;  2J5P A;  1FT9 A;  3SFZ A;  2CYY A;  1FP2 A;  4ENN A;  3R4K A;  2FNP A;  4LB6 B;  1F4K A;  4PZJ A;  5D8K B;  1G4D A;  2HKX A;  1O7F A;  1BBY A;  3E6D A;  4ZZD A;  1XDS A;  1LJ9 A;  1I1G A;  1R1U A;  3LA7 A;  4GO1 A;  5TJJ A;  3FMQ A;  3KZY A;  5JI6 A;  4U0V A;  5L3F A;  3WU0 A;  3GWZ A;  1TW2 A;  2C6Y A;  2HDC A;  1R1T A;  4Q4Z F;  3U1D A;  1FC3 A;  3JSP A;  5FLX K;  1B9N A;  2UZK A;  1XB4 A;  2UWM A;  2RQP A;  2E7X A;  4P96 A;  2ETH A;  2R7F A;  4XLN F;  2LNB A;  2XRO A;  5L3C A;  2RDP A;  1QNT A;  3M9A A;  1YS7 A;  3VFZ A;  4RAZ A;  2XAH A;  2O03 A;  2EB7 A;  1B1B A;  1WRJ A;  1RNL A;  5KVR A;  2ZCW A;  1GVJ A;  2EFP A;  3E6C C;  4KN7 X;  2DAO A;  5J8F A;  2VBZ A;  4HV6 A;  3RPQ A;  4YII A;  3TDU C;  2ADU A;  4AIH A;  4HLY A;  2Z5U A;  3HUG A;  3J7A O;  3HSF A;  3U2R A;  4G8X A;  1TQI A;  2FA5 A;  4BHC A;  3T0Y A;  5ICG A;  1ZAO A;  2QUF A;  2OU2 A;  5BS6 A;  4ZYD A;  1S6L A;  3BWG A;  4Y13 A;  3RI4 A;  1BC8 C;  4A6E A;  3DQV C;  4ENK A;  3P7N A;  1S7A A;  3FWE A;  1IN8 A;  2IP2 A;  1YIO A;  3ZP5 A;  1MKM A;  4WXD A;  1SMT A;  3ZN1 A;  2D1V A;  2GZW A;  1U3E M;  3PQK A;  1J7K A;  4KIC A;  5DD4 A;  5LHG A;  4G7O F;  2BGC A;  1U5T B;  4B8X A;  2RVC A;  2F5C A;  2QLZ A;  3F8B A;  1I5Z A;  5E20 A;  1Z7U A;  4TV7 A;  2ACJ A;  1HW1 A;  2AS5 F;  2W24 A;  3KET A;  2P7V B;  2K4J A;  2FSW A;  5D5W B;  1FPQ A;  1J2X A;  1S8N A;  1XCV A;  2B0L A;  3CLO A;  3L9F A;  3BPV A;  4KFC A;  4YFX F;  1T0F A;  4OIP F;  3IWZ A;  1R58 A;  3MAJ A;  3I0T A;  2O8X A;  3E6B A;  3HRU A;  2L4M A;  2PN6 A;  2DU9 A;  5FB2 A;  2DI3 A;  3VEP A;  4L5J A;  2A5Y B;  2PEX A;  2DK5 A;  2IW5 A;  4NB5 A;  4FHT A;  2VBW A;  5EEG A;  1TNT A;  5BMZ A;  4IF4 A;  1XSD A;  1R5G A;  1SFX A;  2ESN A;  3LFK A;  1SFU A;  5DCM A;  1U78 A;  4WWC A;  2V9V A;  4EMS A;  1OYW A;  2BV6 A;  4O6J A;  3C7J A;  2OA4 A;  2GA2 A;  5DD8 A;  3BP8 A;  3ULQ B;  2ZME B;  5AIQ A;  5K5O A;  2XV4 S;  5CVI A;  2HEO A;  1ZAR A;  1L0O C;  4LK1 F;  3GFJ A;  2W85 A;  1XGO A;  2ZJ2 A;  1P92 A;  3T5X A;  4IRI A;  3HHG A;  1XSV A;  3DKW A;  3MWM A;  1ZGA A;  4ON0 A;  1WKM A;  5LRR A;  4MQ9 F;  2FML A;  1W7P B;  3BJA A;  4IRG A;  2DBB A;  2M45 A;  3QAH A;  4XSX F;  4GYI A;  3C3W A;  1SD7 A;  4Z2Y A;  5J8C A;  2CFX A;  3DFG A;  1T39 A;  2EV5 A;  1W5S A;  3VOD A;  5LHI A;  5HOO A;  2BBY A;  3WTT C;  1RIO H;  1HQC A;  2VC0 A;  2XUB A;  5HLI A;  4XSZ F;  3KP4 A;  2FE3 A;  2F5E A;  2E1N A;  1IRG A;  2NYX A;  3RYR A;  3JW4 A;  2IA1 A;  3FXU A;  1Z9C A;  3DP7 A;  4M71 A;  2Z33 A;  3HRM A;  3HYI A;  3FXQ A;  2W25 A;  1B4A A;  3M8E A;  2CGP A;  3K1N A;  4CO8 A;  3V7R A;  4ENJ A;  5HS7 A;  4OOI A;  2PFB A;  2Z99 A;  5E17 F;  4BH9 A;  3J81 Z;  2VOO A;  2VE9 A;  2RV8 A;  3HHH A;  3WGI A;  4MEY F;  3F22 A;  3CO6 C;  2H27 A;  4A5N A;  3HTU A;  1IUY A;  2HQR A;  1OR7 A;  2Q0O A;  1YW7 A;  4A6D A;  3WTX C;  5ILU A;  4OIR F;  2EWN A;  4ZYE A;  2GXB A;  4LLN A;  2VN2 A;  5FD5 A;  1G3T A;  4YG2 F;  1ZRD A;  3BJO A;  5H20 A;  5FO5 A;  3LST A;  4A5M A;  2E7W A;  2CQK A;  2XKP A;  3ISP A;  2F5F A;  2QQ9 A;  1W4M A;  4ENM A;  1EH7 A;  2GIV A;  2OAZ A;  1ZG5 A;  3BY6 A;  3HTS B;  3EQL F;  1F5T A;  4HOB A;  2CW0 F;  5E8G A;  2QQA A;  2JRT A;  1TW3 A;  1XN7 A;  1LDK B;  3GUD A;  3V7C A;  4D0P A;  3LWF A;  3IKT A;  1HW2 A;  1IXR C;  4RGS A;  3TKY A;  3F8C A;  4JBA A;  1K78 B;  4MNU A;  3GYH X;  2A6H F;  1ZN2 A;  4MEX F;  1S3J A;  5E8I A;  2Y0M A;  3T8R A;  2HTS A;  4ESJ A;  1HW5 A;  5D6F A;  1ZH5 A;  1S29 A;  5FFX A;  4LG0 A;  3GEZ A;  2NAZ A;  2W84 A;  4YIF A;  4KYW A;  5LBQ A;  1ON2 A;  3FMS A;  1O3T A;  3HRT A;  2DK8 A;  3SHF A;  5DCF A;  4EJW A;  4YFK F;  2CSO A;  3EET A;  4EVI A;  3FX3 A;  3QP6 A;  1Z91 A;  4FX0 A;  3PQJ A;  1XMA A;  2VBX A;  3BPX A;  3P9C A;  2A68 F;  5BQT A;  2OD5 A;  2M1B A;  5K5R A;  2K4B A;  4ZZL A;  3LAJ A;  4DQ2 A;  2EV6 A;  3J80 K;  4CYD A;  4M9X A;  4CHU A;  2G9W A;  4PGG A;  3GFL A;  1CF7 A;  5K1Y A;  4LLG F;  3M7G A;  2FEZ A;  5CJ9 A;  3ZPL A;  3H92 A;  1X3U A;  2EA4 A;  3F23 A;  3KP3 A;  3MQ0 A;  4GCV A;  4EGY A;  1ZYR F;  1BIA A;  5K5Q A;  4LK0 F;  2CG4 A;  2O3F A;  3LA3 A;  4G7H F;  4EJO A;  4A0Z A;  3QPH A;  3RTR A;  4HLX A;  1QZY A;  2F5D A;  2LDU A;  3F8F A;  1MJB A; 
#chains in the Genus database with same CATH topology
 2KT0 A;  3F6V A;  4BL0 B;  5F6F A;  3TDZ C;  2ZXH A;  1IO2 A;  3GLX A;  1YTY A;  4BE2 A;  1ENH A;  2OCE A;  2LKS A;  4B3A A;  5IOZ A;  1ZG3 A;  4AD9 A;  1OCC H;  1QVU A;  3K4K A;  4XL9 A;  4BXU A;  5GTH C;  5M5X J;  3VB2 A;  4R79 A;  2VQL A;  4DZJ A;  2QBY A;  1KU7 A;  2HQN A;  4UUV A;  2VOP A;  1UG0 A;  3DPT A;  2R5Y B;  1SVL A;  1D3Y A;  2VT2 A;  3GLL A;  4PK4 A;  5F0F A;  4M6X A;  1HLV A;  5IYD J;  3L2C A;  2HPM A;  3BR6 A;  1H89 C;  5FLX Z;  3CCE I;  5J1U A;  1TWC J;  1XMK A;  1QPI A;  4ZTF A;  2O61 A;  5GP9 A;  2KFD A;  4YEL A;  3BOQ A;  2AXL A;  4UV9 A;  5LEK A;  5FRN A;  4B48 A;  1JGS A;  1SAU A;  1YX3 A;  4LG3 A;  4WK8 F;  4HA8 A;  5J4V A;  1ETK A;  3LQQ A;  2W7N A;  5TRD A;  2P6S A;  4PDK A;  5HOD A;  4AWX B;  1O3R A;  2BVL A;  3ZR8 X;  2JT1 A;  1Y6I A;  1Z7L A;  4CCK A;  4C30 A;  4HX8 A;  4NBQ A;  4Q47 A;  3RYP A;  3DPU A;  3JAM K;  2IBD A;  2XSJ C;  2E2J J;  4U88 A;  3K9T A;  3ZRG A;  4M73 A;  3GVA A;  5FRO A;  3CF5 F;  3AG2 H;  1FOX A;  4KDP A;  2MLG A;  3JTH A;  5DUK A;  1Y0N A;  3BRO A;  2KIQ A;  4DGW B;  2BY0 A;  3K1P A;  3TMO A;  4XN0 A;  1WJB A;  1JT0 A;  1Q1H A;  1SMY F;  3I9V 2;  4IHV A;  2ZNY A;  1LKX A;  2YSR A;  5D8L B;  1ETW A;  3CDH A;  3JRE A;  4PJL A;  4JK1 X;  1ZR2 A;  1T6S A;  2A05 A;  2KRH A;  2DFI A;  2H1L A;  2KLO A;  2MG4 A;  3FM3 A;  3F3X A;  4XK4 A;  1BR1 A;  1KGS A;  4WX9 A;  3F21 A;  4YFN F;  4XQF A;  5LGU A;  1O57 A;  1FEX A;  4XM3 A;  2P5V A;  1VQ6 I;  2L02 A;  1NHA A;  4QPO A;  2K9L A;  1X58 A;  5D4S A;  4BE1 A;  2E2I J;  4RAG A;  4CCM A;  3K0L A;  3WHB A;  3BJ6 A;  4MGR A;  3LNQ A;  1Y39 A;  3BR3 A;  2F4O B;  4L9J A;  2FBK A;  1XSX A;  4N9H A;  4MTE A;  4WXH A;  4CCJ A;  2L7K A;  1KYW A;  4HW0 A;  4L9N A;  5D5U B;  3LSH A;  2QSF X;  1IAW A;  3LL7 A;  2DA5 A;  2EZK A;  1O3Q A;  3D5R C;  3V8K A;  2QSG X;  1R5H A;  1RR8 C;  1Y8Q B;  3BZ6 A;  3OR1 C;  1KQ8 A;  1UHW A;  1NK2 P;  1SVM A;  2LF8 A;  2BZT A;  4BXF A;  4AID A;  2M2E A;  3FXJ A;  2R7D A;  3QYF A;  2JK3 A;  4G94 A;  2LC2 A;  3SFI A;  3I4P A;  5JHU A;  3KZI C;  2IGN A;  5AON A;  4P5O A;  3EUA A;  1LEA A;  4Q48 A;  4PJM A;  4KNY A;  5LHH A;  4XBF A;  1JHF A;  4RAY A;  4XRF A;  3E7L A;  1Z05 A;  2RGV A;  1QZZ A;  2IA2 A;  3QPT A;  2R0Q C;  3IKV A;  2CW8 A;  5M3M J;  3WTY C;  4HPQ A;  4M3B A;  2AQE A;  3PUB A;  1JHH A;  4AIJ A;  2EFQ A;  2H6B A;  3BR0 A;  3HJE A;  2K9S A;  2EJR A;  4BJT A;  2O8K A;  1W5C C;  4IHS A;  3GBG A;  2K86 A;  2DA6 A;  2ZNZ A;  3I64 A;  2VJI A;  1H8A C;  3H9G A;  4H4K C;  2IA0 A;  4NC8 A;  4UUS B;  1YIJ I;  2WC2 A;  2KJB A;  3BC8 A;  3SZP A;  3MD2 A;  3QPL A;  4E7H A;  2STW A;  3FMR A;  2HOA A;  3CUO A;  2M8E A;  1V4R A;  4I2O A;  2DQL A;  4A3E J;  2DMN A;  3I59 B;  2ECC A;  1X1P A;  3E5Q A;  1ERD A;  3RKY A;  1XGS A;  3S2D J;  2X6O A;  1MMS A;  4FX4 A;  1IDY A;  3WTV C;  3IRQ A;  2NVX J;  3WTW C;  2COB A;  1MJ9 A;  2ME0 A;  3X2Q H;  1MDM A;  2GAU A;  4OU0 A;  1H0M A;  1UG2 A;  2HPI A;  3V7S A;  1MIJ A;  1HOM A;  4F91 B;  1VQ9 I;  1FYL A;  3C18 A;  3S2W A;  3ZQI A;  2R7V A;  2DN0 A;  2CQX A;  1ULY A;  1Z0X A;  2KIF A;  2RNJ A;  5LRS A;  1FNN A;  2BEO A;  4G6Q A;  1TWF J;  4EJT A;  2K9Q A;  2E35 A;  2MGQ A;  2LRE A;  1WI3 A;  3BTL A;  3PFI A;  2HZT A;  4W97 A;  1MNM C;  1IC8 A;  5F0C A;  3IC7 A;  4RGX A;  3K2Z A;  1WWX A;  1IRF A;  5H2F C;  3G2B A;  2LYC A;  4A3M J;  4RLQ A;  3TW7 A;  1JJ6 C;  3BG7 A;  4CSW A;  3SXY A;  1MBG A;  2Z16 A;  4AC0 A;  2WB1 N;  2NVT J;  2P8T A;  1HST A;  1OCT C;  3K10 A;  1QGP A;  3KP5 A;  3HC7 A;  3W3C A;  4ZYH A;  2M7B A;  5E1Z B;  3BTC A;  3SQN A;  4DNC A;  5GAD J;  2M9H A;  3CC7 I;  2A69 F;  2VB6 A;  3ERE D;  1E3P A;  2LRD A;  4AUX A;  3N05 A;  4I6Z A;  3HSE A;  3I53 A;  1FBU A;  4HZF A;  2XC7 A;  2OZU A;  2GLO A;  1PP7 U;  3MCZ A;  1O7L A;  1ZTR A;  2K9M A;  4J00 A;  1W0U A;  3K4N A;  2DJI A;  4ESB A;  4NQW A;  1OCZ H;  2R5Z A;  1QBJ A;  2OQG A;  3GCM A;  2EIJ H;  4PJJ A;  3JTG A;  1S7O A;  1D8J A;  2XF6 A;  4ZDP A;  3Q9S A;  2DA4 A;  3ML6 A;  4N0B A;  2OZ6 A;  4KIF A;  1R71 A;  2A61 A;  3KCC A;  2OPT A;  4I09 A;  5A2Q K;  5FRM A;  3WTZ A;  3GTM J;  3LSI A;  3DBH B;  4XLC A;  1POG A;  2L54 A;  3I71 A;  2FBI A;  1ACI A;  1W36 D;  4S04 A;  4IJA A;  3QP5 A;  2F2E A;  3E3V A;  5EYR A;  1IF1 A;  3ABT A;  3OYA A;  2O5R A;  1IV8 A;  4CZZ A;  1Z1D A;  3CUQ B;  2DQR A;  4ZDO A;  2JJ7 A;  5H6Q A;  2L01 A;  2CO5 A;  3S3M A;  3M1E A;  1KYZ A;  5J1R A;  1YO5 C;  2DTR A;  1NG7 A;  2X1D A;  3RIR A;  1OPC A;  4LFU A;  4Z6Y A;  4NNJ A;  4XN3 A;  4C9Y A;  4F93 B;  2R4G A;  4FAS D;  3GTL J;  1OCR H;  1O4X A;  3FM5 A;  3G73 A;  1MZB A;  3KX2 A;  3IH2 A;  1G6N A;  2MW8 A;  1MBF A;  1BL0 A;  1FMV A;  1PP8 F;  2DDB A;  2DOD A;  4ZH4 F;  1ETO A;  1OR7 C;  3DPL C;  3I58 A;  4LIT A;  3CJT B;  4U0W A;  4DIQ A;  1DGR M;  4IXA A;  5LGT A;  3H5A A;  5E79 C;  4RGR A;  2IAI A;  4PFP A;  3I4N J;  3CJN A;  3V8J A;  1A6I A;  3SEQ A;  1K79 A;  5FJ8 J;  4C2T A;  1S5L C;  1F36 A;  5CVU A;  5KNL A;  4E7I A;  1BIB A;  1ZR4 A;  3DTI A;  3DBL B;  3Q5F A;  1YYV A;  2GBY A;  3F8M A;  3CLQ A;  3NEU A;  5CYV A;  2R7O A;  4FIS A;  5IT3 A;  9ANT A;  1SAN A;  4AVP A;  3MZY A;  1G3Y A;  2L4A A;  2CUE A;  4A3C J;  2P0W A;  1TLH B;  1JKP C;  2H94 A;  2QF7 A;  1ZKG A;  2VBY A;  4C2U A;  2K9N A;  1RES A;  3TO6 A;  3CCJ I;  1OLT A;  3OSF A;  3A01 B;  4UVB A;  2NS0 A;  1FZP B;  2VE8 A;  4M72 A;  1XCB A;  1REP C;  1X1C A;  1HDD C;  2WAF A;  1OYY A;  2D5V A;  1HKT A;  4OMZ A;  2ZKZ A;  2P5K A;  1SD4 A;  4Y7N J;  1MBJ A;  2R7W A;  4M3F A;  2HXO A;  5FGM A;  1YHQ I;  1I27 A;  1JUP A;  3GZ5 A;  3G1O A;  1P4X A;  5J1Y A;  2LKX A;  1W5T A;  5FD6 A;  3HDD A;  3KIO A;  1UHM A;  3EUK L;  4BGD A;  3OYJ A;  3W6J B;  1BJZ A;  1GV5 A;  4I98 B;  3WG7 H;  2CWE A;  2WV0 A;  3VSL A;  1L3L A;  2WTE A;  1FOK A;  2HQA A;  1D0Z A;  1ETX A;  3ABU A;  2MD0 A;  1K6O A;  1UFM A;  1Y1V J;  2DTZ A;  3ZMV A;  1Y56 A;  4R1H A;  2VJ5 A;  3MKY B;  3ZMT A;  2EV0 A;  1XS9 A;  5HS9 A;  2G0E A;  2QYO A;  3B02 A;  4D7N A;  2ELJ A;  4V19 K;  4IOA F;  4EAT A;  3FK7 A;  3WTS C;  4RMN A;  2NXN B;  2ID6 A;  3S93 A;  1LDJ A;  3BR2 A;  4ASN A;  4HEA 2;  3J7A Y;  2JTV A;  2K85 A;  1LVK A;  3A03 A;  2Q2E A;  1H9G A;  3KEO A;  4B47 A;  4HF1 A;  4Y3O A;  1LDD A;  1X1A A;  3CUQ C;  4G7Z F;  1R9T J;  1FSH A;  3BZK A;  2HKO A;  3EPZ A;  3OL4 A;  1JGG A;  3BTJ A;  2E2H J;  1BN5 A;  1ZRC A;  3LSM A;  3ZMS A;  1AA7 A;  1VND A;  3LAP A;  4IHX A;  4D7M A;  1QPM A;  4CIC A;  1LNW A;  3SDG A;  3CCV I;  1MJA A;  1ZGJ A;  3P9K A;  2M87 A;  1LPQ A;  4NUB A;  2O0Y A;  4UVA A;  2IRF G;  4BNC A;  5CVJ A;  5D4R A;  1DPR A;  1YW9 A;  3S1Q J;  1ZG1 A;  3R60 A;  3UNG C;  1A5J A;  4FTH A;  1X1D A;  4HBL A;  2CV2 A;  2DMP A;  4BDZ A;  2VXZ A;  1X19 A;  1H9T A;  4YEJ A;  4KMF A;  1BI0 A;  2OTL I;  1DGW Y;  2EIL H;  5K7H A;  3SEZ A;  4W1U A;  3ROU A;  4BHB A;  3K70 C;  4L18 B;  3IH4 A;  4P1W A;  1QA6 A;  5E3L A;  2V1U A;  2TRT A;  2GOM A;  3BQY A;  2K5C A;  1MD0 A;  4BBR J;  2PMZ N;  5ICF A;  4XON A;  1U5T A;  3J81 K;  3GTK J;  3S15 J;  2BY3 A;  1G3W A;  2YX7 A;  1ZRF A;  4XNF A;  2YPR A;  2DFF A;  5E3O A;  2EA2 A;  4X6A J;  1RUN A;  2L2O A;  2CRG A;  1YRN B;  4KUM A;  2OBP A;  3F0C A;  2Y9Z A;  1C0W A;  4GYG A;  2X6W A;  2XF7 A;  1B8I B;  4L0Z B;  1N77 A;  2JQ7 A;  3A2K A;  3A1Y A;  2L0K A;  3KE2 A;  1RRJ A;  1SFK A;  2VQC A;  1P7J A;  1UCR A;  3T8T A;  2HZD A;  2QVO A;  5KK1 A;  1KZH A;  5HLH A;  3U1K A;  2MBF A;  3L09 A;  3OYE A;  3RSN A;  2L7F P;  3L2Q A;  4XIC A;  4I76 A;  2L3D A;  3PUF A;  3J80 Z;  3ZMD A;  3TO9 A;  5HVQ C;  4WCG A;  1IGN A;  3K4J A;  1VTN C;  4DYR A;  5KCM A;  4I0B A;  4M9S A;  5FKM A;  1DU0 A;  3HUG B;  1EV7 A;  1A35 A;  2KQR A;  1J9I A;  2WAD A;  1OMI A;  4I99 C;  2P7C B;  3PO3 J;  4HDV A;  3NAR A;  4E4H A;  4MHG A;  5HNF A;  1B9M A;  4GXO A;  2BW3 B;  3FXM A;  4A93 J;  5E18 F;  1LB2 A;  4A3G J;  2UXN A;  4EEF G;  2PLY A;  2FQ3 A;  1BM9 A;  5EZH A;  3TP3 A;  2LF7 A;  5B66 C;  3ELK A;  5EG0 A;  1HXD A;  1PVE A;  5J3L A;  1IXC A;  4AIK A;  4BXX J;  1S9H A;  1T2K A;  4EJU A;  3IHU A;  4B1R A;  2Z3Y A;  1ZQ3 P;  4NDL A;  4ETS A;  1W7P D;  4XMY A;  4S0H B;  1WJC A;  6PAX A;  2D45 A;  2WWY A;  4QPQ A;  3KPH A;  2MLK A;  3KEQ A;  4HDU A;  4CDG A;  3S17 J;  1WSU A;  2YU3 A;  4KIB A;  2PJR A;  1JI8 A;  2UV1 A;  2FF4 A;  2R92 J;  4IVN A;  2X6Y A;  3M07 A;  4E6K G;  3Q9V A;  4ZTJ A;  5EZG A;  1VQ7 I;  1D1C A;  2R3S A;  2ZME A;  1OJL A;  2DO7 A;  3O8H A;  4KN4 X;  5DS9 A;  2HR3 A;  4LLL A;  2X0L A;  2QZ8 A;  2FJ1 A;  2MH9 A;  2VPL A;  2Y75 A;  3I55 I;  4FET A;  2GIZ A;  2VI6 A;  1KQ9 A;  3I54 A;  4KT5 C;  3AG4 H;  4HF2 A;  3AL0 B;  4LD5 A;  2EH3 A;  3EUH A;  3L7W A;  2JA5 J;  3IWF A;  4UXN A;  3U9G A;  1BI2 A;  2HFH A;  1EH6 A;  2MAB A;  5F1R A;  3HOY J;  2HYJ A;  3JRB A;  4Y33 A;  3ZN0 A;  5L3B A;  4U7B A;  4MFE A;  1FYK A;  4UY8 I;  2VON A;  1P4A A;  1WH5 A;  1B6A A;  4FT8 A;  1W7P A;  2PQ8 A;  2XKO A;  1RKT A;  1R36 A;  2MH2 A;  4BEH A;  3KP7 A;  3L2W A;  3N97 A;  2HWV A;  4XKC A;  4CCO A;  1MBH A;  2KHM A;  3W6V A;  3HGG A;  2H6C A;  2LP0 A;  3E1S A;  5E1X A;  4XOP A;  4E7L A;  1I1S A;  3FXL A;  3KP6 A;  3Q0U A;  2MD5 A;  2QQB A;  3KLO A;  1ZRE A;  3RDI A;  2CV0 A;  2G7U A;  3WOD F;  4DYC A;  1TC3 C;  3ABK H;  4UHT A;  3ZMZ A;  2JPC A;  3CQZ J;  2JA6 J;  1FBS A;  2IS2 A;  4D5C A;  2HOS A;  1IJW C;  2DMU A;  3OYH A;  4A3D J;  1DP3 A;  1BOB A;  5IP7 J;  1KA8 A;  5JFR A;  1IXS B;  3VYS B;  3AFH A;  1WH7 A;  1RET A;  4A0Y A;  2KIM A;  4XLP F;  1DUX C;  3NWT A;  2FXA A;  4UUT A;  3DXJ F;  2L5Q A;  5EGO B;  2FMY A;  4V2F A;  3HOX J;  1SAX A;  1KU9 A;  5IT9 K;  5BOX A;  3VOE A;  1F1Z A;  1OCP A;  2E36 A;  2VOD A;  3ASO H;  3K69 A;  4LJZ F;  4WF2 A;  2TCT A;  4DYQ A;  3S3O A;  1XDU A;  2XAS A;  2ZJQ F;  3S16 J;  2XB5 A;  4XRS A;  3FDY A;  3MFK A;  2RRE A;  2HTJ A;  2LR8 A;  5IP9 J;  2L7Z A;  2O9L A;  5DCM B;  2RC4 A;  4C3H J;  3DLL F;  3M1C A;  3CCS I;  5D5X B;  4ZYG A;  1BC7 C;  5HS8 A;  1RPW A;  1H88 C;  1U6G A;  3JRA A;  2JSP A;  3BR5 A;  5HNH A;  3MKL A;  4Y17 A;  2KMU A;  4N4O B;  2BY1 A;  2XB0 X;  4KIS A;  1QU3 A;  4A3I J;  1R22 A;  4DZP A;  1PUF A;  4HYE A;  2XGX A;  1TNS A;  2CUF A;  2PMH A;  3I5U A;  4R8H A;  4U87 A;  2LH9 A;  4EM0 B;  2M4K A;  1GUU A;  3TBI A;  2R7X A;  2BYV E;  5CVR A;  4XOT A;  4I7H A;  3IV5 A;  4IEJ A;  2VPR A;  2LBF B;  3FF5 A;  5GAG J;  2EFW A;  4AM3 A;  4G6T B;  4L0Y B;  2ECB A;  2DFE A;  2XRL A;  3OIO A;  1GXQ A;  3OWT A;  3LA2 A;  3RPU D;  3GXO A;  1UB9 A;  2BVM A;  3QU6 A;  4HF0 A;  3FHZ A;  1DDN A;  3OYI A;  3EYI A;  2CJJ A;  2M7A A;  1A04 A;  1IG7 A;  4QLC U;  1B72 A;  5DTD A;  3CMM A;  3H5N A;  5ICE A;  1I3Q J;  1UHS A;  4M3G A;  2IT0 A;  1E17 A;  3S1R J;  2V1X A;  1I3A A;  1MMD A;  3IH3 A;  3KYC B;  3I56 I;  3JRH A;  3PO2 J;  1P6R A;  3RZO J;  1SFE A;  4HSR A;  1D5Y A;  2K7L A;  2OQR A;  3HSR A;  2K02 A;  3AL0 C;  2KZV A;  5JVT A;  1XD7 A;  3JRC A;  2ZFU A;  3HKZ A;  4B44 A;  2WY8 Q;  3OYB A;  2HOE A;  4XKV A;  4RB0 A;  4V2G A;  1NH3 A;  4S05 A;  1X4O A;  4HRI A;  2JA8 J;  1D0X A;  4BQQ A;  1G59 A;  2DPD A;  3RKW A;  4BAC A;  3DF8 A;  1JKR C;  1RUO A;  1J75 A;  1K78 A;  2TDX A;  4JQF A;  2E1C A;  3ABL H;  4RA2 A;  2JVG A;  2ZJP F;  1VI0 A;  1QRY A;  4B4C A;  2XRN A;  1D5V A;  1LQ1 A;  2PG4 A;  3KP2 A;  3BCA A;  2BE5 F;  3RPU A;  1HBX G;  5LGN A;  1O3S A;  1RI7 A;  3LFU A;  1WQ2 A;  1MGT A;  4LMY A;  2FQ4 A;  2WV1 A;  3AAF A;  5LFA A;  2KJC A;  1T0F C;  2M0M A;  4JP0 A;  1FIA A;  5J6X A;  2B9S A;  3WGH A;  1LE8 A;  2IPQ X;  3BZC A;  4I0A A;  1YE9 A;  4N9I A;  2NRA C;  1MBE A;  3DV8 A;  2K27 A;  2XPU A;  2L9S A;  2QWW A;  1U8B A;  4IZZ A;  4U0Y A;  1YS6 A;  2STT A;  2NVQ J;  1X4P A;  1Z6R A;  1AU7 A;  1J5Y A;  3OIQ A;  2A3S A;  2BY2 A;  3GTP J;  2FRH A;  4KIT B;  4BQA A;  1X2N A;  4JX4 A;  3HRS A;  3BDD A;  3P9I A;  2CFO A;  2V26 A;  3WE2 A;  2H1K A;  5C4X J;  3DKX A;  4X1E A;  4RAF A;  1TZL A;  2JPB A;  2Y48 A;  4L9T A;  5CPR B;  5L3D A;  1TWH J;  1LUJ B;  3B73 A;  1V5G A;  1BI1 A;  4RGU A;  3KYD B;  1ZK8 A;  1FSE A;  1K6Y A;  2EPF A;  4EGZ A;  2KZG A;  2DOA A;  1KQ0 A;  1SD5 A;  2W00 A;  1XC5 A;  1TQP A;  2P81 A;  2VKV A;  3T1B A;  4IPA A;  3V8L A;  4KT6 A;  4RS8 A;  2PMU A;  4KIG A;  5ED4 A;  3CC4 I;  4A3B J;  5IP6 A;  4G6D A;  2WAQ A;  3K4C A;  2K3P A;  2FNA A;  1ETV A;  1IN5 A;  3JSO A;  4L5E A;  4IHT A;  2NOJ B;  2EZI A;  2ZSI B;  1RR7 A;  3BQZ A;  1IRZ A;  3JRF A;  3S14 J;  4DJA A;  1V5E A;  2ZFW A;  5A2Q Z;  1FP1 D;  4IQJ A;  3R0J A;  5C44 J;  1PDN C;  2VC1 A;  1HDP A;  5BPD A;  4CYC B;  1DP7 P;  3QOP A;  1VFC A;  2VQG A;  3E6M A;  2L9V A;  5LLQ A;  2XPW A;  5DDG A;  2Z9O A;  4MQV A;  3CCR I;  3H35 A;  2R7U A;  2VKH A;  1QQI A;  2DT6 A;  1E3O C;  2P4W A;  3S1M J;  4OAZ A;  1HA8 A;  3HB9 A;  4IRH A;  3K4M A;  2GQQ A;  5FFZ A;  4D9J A;  4IQ4 A;  3BTI A;  1AKH A;  3NQO A;  2IJL A;  5M5W J;  5DYM A;  2A5W A;  1IN7 A;  2W4S A;  3QRF F;  2IVM A;  2ZBK A;  1MND A;  5CVV A;  4LG0 B;  3E5U A;  3G4S I;  3WGG A;  1QO0 D;  1BI3 A;  2LSO A;  1UZC A;  2WAE A;  3SDB A;  5FLV A;  4I02 A;  3TOB A;  1BA5 A;  5E3M A;  4DOZ A;  1AWC A;  4II2 A;  4J01 A;  1I6X A;  1CGP A;  4NC7 A;  3IL2 A;  2HVQ A;  4HX7 A;  2V9P A;  3IRR A;  3PL8 A;  2Y30 A;  2N8G A;  2LG4 A;  2ZXI A;  3G3Z A;  3OOP A;  3OOU A;  3ZGK A;  2EK5 A;  1LVA A;  5FLM J;  1FBQ A;  1GHC A;  4UVC A;  1KU3 A;  1J0R A;  1T38 A;  1YW8 A;  4KA4 A;  3HOT A;  3F8N A;  4CUG A;  1VQ4 I;  1T08 B;  4HX4 A;  2FD5 A;  2XIG A;  2R5Y A;  2FOW A;  1R1V A;  3ZQF A;  5EEH A;  2HVS A;  1ZHF A;  2LTP A;  4FE7 A;  2D2W A;  2AO9 A;  4O3M A;  3H0D A;  2KIU A;  4PGH A;  2Q8K A;  3R6S A;  4DBQ A;  4WXC A;  3WG9 A;  5JHF A;  4UNO A;  5BPI A;  4OIO F;  4OIN F;  3CME I;  3GTQ J;  4EM1 A;  4RB2 C;  5CKT A;  2FU4 A;  3A0B C;  1F9N A;  1KU2 A;  1V3F A;  1IZ1 A;  2DFH A;  3OYF A;  1D8K A;  2L7M P;  3F6O A;  1BW5 A;  2UUZ A;  3ZQQ A;  1T98 A;  3GW2 A;  3LSJ A;  2D1H A;  2L9R A;  5HDG A;  3DCF A;  5ILS A;  1CF7 B;  2DDA A;  1LFP A;  3VWB A;  4CA0 A;  4E70 A;  2VXD A;  4Q5S F;  2CUZ A;  3ECH A;  2KRF A;  3QQA A;  1YQA A;  3O6B B;  1XGM A;  1ZGW A;  3ECO A;  2G7H A;  4AYB A;  1P9Q C;  3JCU C;  1D1A A;  1TQM A;  2P6T A;  1G3S A;  4B3X A;  4HV5 A;  3ZQC A;  2ESH A;  4ESF A;  1K4S A;  2M0C A;  2V79 A;  3SZT A;  5ILV A;  5AIP A;  3QWL A;  3I3L A;  3ABM H;  3B6A A;  1BOA A;  4NHJ A;  4BBS J;  1T33 A;  1DPU A;  4M3D A;  1A36 A;  2PBI A;  4EQQ A;  2DMT A;  1N25 A;  3BG5 A;  4IHW A;  3PNT A;  2V6E A;  2MYS A;  1FYM A;  1VQ5 I;  2J5O A;  4F7Z A;  2KP6 A;  2GA1 A;  3HEF A;  2NNY A;  1R23 A;  5DV5 A;  2LKP A;  1LEB A;  1J59 A;  4LOC A;  2KDO A;  2QCO A;  3E97 A;  1MSE C;  1EH8 A;  3WU1 B;  1U5T C;  5HLG A;  4OMY A;  1EJ9 A;  5D6E A;  5KHD A;  3D0S A;  1B59 A;  3OMY A;  3R61 A;  3K2A A;  2WA0 A;  3FXR A;  4MFD A;  3TGN A;  5L3E A;  3C1D A;  3GX4 X;  3OSG A;  2MC3 A;  1SEU A;  3TQN A;  2OCC H;  5CLS A;  3TW6 A;  5LEJ A;  4BQN A;  4EJV A;  4DBR A;  2HDD A;  2X9D A;  2DPU A;  1RC9 A;  2XVC A;  2ZO4 A;  2QA4 I;  3G1L A;  2PJP A;  3K1M A;  4XID A;  2XAG A;  2YR2 A;  4G9Y A;  3DU6 A;  3RJP A;  2QBY B;  3J7Y J;  3L2U A;  4BE0 A;  3RKQ A;  2RN7 A;  3FXO A;  3FIS A;  4BJ6 C;  4A12 A;  3LQR A;  1TTY A;  3ZQ7 A;  2R7T A;  2V6C A;  2P5L C;  2DT5 A;  3H3Z A;  4ITV A;  1YFH A;  4O5V A;  2FOK A;  1ZEL A;  1ETY A;  2FUG 2;  3FKI J;  1ODD A;  2M8G X;  3EYY A;  3GZN B;  1RKW A;  3KZZ A;  4H0E A;  4EM2 A;  3CCY A;  2EFN A;  4FE4 A;  4UUS A;  2ZXJ A;  1PUE E;  2HS5 A;  1WGX A;  1W0T A;  4XKW A;  1Y0U A;  1P2F A;  4PJ0 C;  3SJM A;  5GTI C;  1MSF C;  3WHC A;  3I59 A;  5ICC A;  3FZV A;  2JSC A;  3W2A A;  2CQN A;  3CO7 C;  5B3S H;  1USS A;  1R4M B;  2JMW A;  3W2V A;  2ISZ A;  3O3K A;  2XAQ A;  3R0A A;  3BR1 A;  4GGG A;  3CMA I;  3LSG A;  2V7F A;  1JKO C;  2XSD C;  4PSW A;  4RM2 A;  3OIP A;  4PJN A;  4LB5 A;  4BUP A;  2HGC A;  2R7Q A;  3CMY A;  4E7J A;  4MTD A;  3DEW A;  2GXG A;  3LSK A;  3CJQ B;  1Z6T A;  3KLN A;  1FLI A;  3GTJ J;  1XGN A;  1I50 J;  2ZME C;  2MA3 A;  3KFW X;  2FX0 A;  1FY7 A;  1JE8 A;  1IN6 A;  1QVT A;  3CCL I;  2NNN A;  3K6G A;  4CZC A;  1MMA A;  1XPX A;  1IN4 A;  2Y9Y A;  3EDP A;  4C3I J;  4F55 A;  1GDT A;  1IW7 F;  2PX9 A;  4CXF A;  2M5W A;  1U8R A;  2XGC A;  2QSH X;  2XAF A;  2FBH A;  3HOV J;  2BXZ A;  4LIV A;  3S2H J;  2QM3 A;  3TO7 A;  4P9F A;  3MKZ A;  2W57 A;  2EIN H;  4BHP A;  3GZ6 A;  1GXP A;  3V4G A;  4GRI A;  3G6E I;  5B1B H;  4KMU X;  4RLF A;  1XTA A;  3H5R A;  5LD2 C;  1ON1 A;  2HXI A;  2HU9 A;  1SD6 A;  1OFC X;  3N4M A;  4P55 A;  4CGZ A;  5FKN A;  1UJ8 A;  1VQM I;  2DA2 A;  2CUJ A;  4M6Y A;  4BY7 J;  1E2X A;  2X4H A;  2ME6 A;  1TT5 B;  2DYS H;  2CQ7 A;  2XGD A;  5F04 A;  3MEX A;  4YIR X;  3CCM I;  2B63 J;  3ONQ A;  2R93 J;  3RQI A;  4M9Z A;  3L2V A;  3Q0W A;  1OIS A;  1FMW A;  4U7D A;  2F6C A;  3WE3 A;  5KAF C;  2V4J C;  1R7J A;  1J09 A;  2RAE A;  1SC7 A;  1K83 J;  2VT3 A;  5L3G A;  3L00 A;  3GO5 A;  2YX4 A;  2IS1 A;  4P9U A;  3FBI B;  2HDW A;  4RM3 A;  2VJJ A;  2ID3 A;  4CCL A;  3MZH A;  1OKR A;  4JOM A;  3K70 D;  4AU7 A;  1Z21 A;  3OR2 C;  1X2M A;  1Z3X A;  3KYL A;  3H3V K;  2DA3 A;  1ZLJ A;  3C2B A;  3IUO A;  4MIM A;  5JR3 A;  4YRV A;  2IS4 A;  3JR9 A;  2VIX A;  1R00 A;  3H3U A;  5HDN A;  5ERI A;  5B1A H;  3W6K B;  1BR2 A;  1WI9 A;  3CUQ A;  5E3N A;  3L2R A;  3BG3 A;  1WZ2 A;  3L1P A;  4PCQ A;  1I39 A;  1R4N B;  5F64 A;  3HOS A;  3DEU A;  1GVD A;  3GF2 A;  3COA C;  5FKL A;  1MDM B;  1ONV A;  4BY1 J;  3OV8 A;  4Y15 A;  4ZJZ A;  3M8F A;  2DLL A;  2JRM A;  2DW4 A;  2UXX A;  4L9V A;  3D5L A;  2ISY A;  1TP4 A;  1JXS A;  4LGW A;  2RKH A;  1P7I A;  1XX5 A;  4B09 A;  4HQE A;  1T95 A;  4BAY A;  3HIF A;  3ESW B;  1YLF A;  4QWQ A;  2EFO A;  3TOA A;  4BYY A;  2VAS A;  2EZL A;  1QHH D;  5JLW A;  5K7Z A;  3WTU C;  4UV8 A;  1EA3 A;  2DOE A;  3HZJ A;  2WB1 A;  3OYC A;  3F72 A;  4HAM A;  3QOE A;  4HG2 A;  1MW7 A;  2H09 A;  4XLH A;  4E7Z A;  2ZC2 A;  3RKX A;  1TBX A;  5K7F A;  3ZMU A;  5EEA A;  2H8W A;  1Z77 A;  2XHK A;  5IT9 Z;  2OC6 A;  3OL3 A;  2HOT A;  4RB1 A;  1STZ A;  1HKS A;  1OYI A;  3CTA A;  1EKE A;  2RQQ A;  2KKO A;  2LMD A;  2EIM H;  4RB3 C;  2A07 F;  3PIO F;  3HPG A;  4EV0 A;  3O2P E;  4A2U A;  1PJR A;  2PI0 A;  2IS6 A;  3E5X A;  1U0J A;  2HYG D;  5F27 A;  5D5V B;  2EQR A;  4OIQ F;  2M30 A;  1RZ4 A;  1AOY A;  3CZ6 A;  5CQE A;  4K2E A;  5E1W A;  4BS9 A;  4XRM A;  1U2W A;  2V1D A;  3QU3 A;  4NQW B;  3DTK A;  5HLT A;  2COM A;  5DUI A;  3HXL A;  1HKQ A;  5H6R A;  4Y4R A;  3GFI A;  2R5Z B;  2XAJ A;  2XDV A;  4I01 A;  3JAM Z;  4A3K J;  3A01 A;  1FX7 A;  1APL C;  2XPV A;  3NRV A;  2GOX B;  1K7A A;  3NWS A;  1XG1 A;  2NVU B;  2O6G E;  1TWA J;  2QGU A;  4L5I A;  5HDK A;  1JUS A;  4A3F J;  3REO A;  4BDY A;  2LY9 A;  5DEQ A;  4A0X A;  3CDI A;  4BKX A;  5GPC A;  2HYF A;  1U9N A;  3IAM 2;  1E3H A;  2GWR A;  4M74 A;  4E7S A;  2JZY A;  1YG2 A;  2M34 A;  3VYU B;  3GFM A;  1TL8 A;  5C4J J;  1NTC A;  2QEN A;  2ZB9 A;  1ZLK A;  1UST A;  1JTX A;  2A6E F;  5IYB J;  1P4W A;  1QZE A;  3CC2 I;  5M3F J;  1HSJ A;  2M4G A;  2ELH A;  4HQM A;  1FWZ A;  1BJA A;  2J5P A;  1FT9 A;  3SFZ A;  2CYY A;  1FP2 A;  1ORK A;  3R4K A;  2FNP A;  3RCO A;  4ENN A;  4LB6 B;  2H8R A;  3LSP A;  5F08 A;  2RNG A;  1F4K A;  1JUM A;  4PZJ A;  5D8K B;  1G4D A;  2HKX A;  3HBL A;  1BW6 A;  1O7F A;  1MBK A;  1BBY A;  3E6D A;  2IGM A;  3FXK A;  4D5F A;  4ZZD A;  2CQQ A;  1XDS A;  4F92 B;  1LJ9 A;  1I1G A;  1R1U A;  3LA7 A;  3DTE A;  4GO1 A;  4LIU A;  2JVH A;  3FMQ A;  5TJJ A;  3KZY A;  5EDN A;  1E0E A;  5JI6 A;  4U0V A;  1VZ0 A;  1YOV B;  2R7R A;  5L3F A;  3WU0 A;  3GWZ A;  1TW2 A;  2C6Y A;  1YJ9 I;  1LFU P;  2X85 A;  4GDF A;  2HDC A;  1R1T A;  3QYE A;  1NG6 A;  1D1B A;  2NVY J;  3K7A J;  3CP8 A;  3QYB A;  4UB8 C;  3NAU A;  4Q4Z F;  3U1D A;  5GPA A;  1Z3Y A;  1FC3 A;  3JSP A;  4JX6 A;  2BOL A;  3VYT B;  3CJR B;  5FLX K;  2IXS A;  1B9N A;  2XGE A;  4C3J J;  2UZK A;  2E71 A;  1XB4 A;  2UWM A;  2RQP A;  2E7X A;  4P96 A;  3G1M A;  2ETH A;  1EF4 A;  2R7F A;  4NC6 A;  2CMP A;  3ZQH A;  4XLN F;  1IUF A;  3JRD A;  1FTT A;  2LNB A;  2YUS A;  2XRO A;  1CQT A;  2E19 A;  5L3C A;  2RDP A;  2ICW G;  5DM7 F;  2OJE D;  5FKO A;  1OQY A;  1QNT A;  3M9A A;  1YS7 A;  3VFZ A;  4G12 A;  4RAZ A;  2XAH A;  2VKD A;  2O03 A;  2EB7 A;  1YRN A;  3PSF A;  4IX7 A;  1FOY A;  2V9K A;  1B1B A;  1WRJ A;  1B8I A;  1RNL A;  5KVR A;  2ZCW A;  5J4Y A;  2EBI A;  1GVJ A;  1Y1W J;  2EFP A;  3V42 A;  4XRS G;  4IHY A;  1UAA A;  3E6C C;  4Y52 J;  2QKM B;  2E1M C;  4KN7 X;  2DAO A;  3LOC A;  2E60 A;  2CW7 A;  5J8F A;  2VBZ A;  4HV6 A;  3RPQ A;  2DJN A;  4YII A;  3TDU C;  2EIK H;  2ADU A;  4AIH A;  4HLY A;  4KJZ A;  3OS0 A;  2DA7 A;  2AXT C;  2Z5U A;  3SYT A;  1GLN A;  5TIS C;  3HUG A;  1R5I D;  2X1E A;  3J7A O;  1V54 H;  3HSF A;  3U2R A;  4HNU A;  4G8X A;  3AKZ A;  5EJC A;  1SFO J;  2LK2 A;  2Y0S N;  1TQI A;  2FA5 A;  1VF9 A;  2BW3 A;  1WVR A;  4BHC A;  3T0Y A;  5ICG A;  1IDZ A;  2Q2E B;  3B6C A;  3QPS A;  1ZAO A;  2QUF A;  3MZ8 A;  2OU2 A;  1T56 A;  1VQP I;  1YJW I;  5BS6 A;  2QKL B;  4ZYD A;  1S6L A;  3S3N A;  3BWG A;  4Y13 A;  2DXI A;  4PUS A;  3RI4 A;  2XF5 A;  1BC8 C;  3S1N J;  4A6E A;  3DQV C;  2LOO A;  1ITY A;  4ENK A;  4RDU A;  5GAE J;  4ANJ A;  2IGO A;  3P7N A;  1S7A A;  2DA1 A;  3FWE A;  4HST A;  1IN8 A;  2IP2 A;  2JUG A;  4E7K A;  1YIO A;  3ZP5 A;  1MKM A;  4WXD A;  1MNE A;  1SMT A;  3ZN1 A;  2D1V A;  3D5S C;  2GZW A;  2F48 A;  2W1O A;  3ZQG A;  3HG9 A;  1U3E M;  3PQK A;  3C2H A;  2PMZ A;  3DKY A;  1FJL A;  2JA7 J;  4J19 A;  2WBM A;  3GME A;  1J7K A;  1W36 C;  4KIC A;  5DD4 A;  3S32 A;  5LHG A;  4G7O F;  2BGC A;  4CH7 A;  2DOF A;  1U5T B;  3BT9 A;  2BHY A;  4XOR A;  2MFZ A;  2I5U A;  4B8X A;  3PIP F;  2QQ8 A;  2RVC A;  2F5C A;  2QLZ A;  3Q3S A;  2VUM J;  3F8B A;  1I5Z A;  4B43 A;  4HNV A;  5J40 A;  3MVP A;  4XLF A;  2ELK A;  5E20 A;  1Z7U A;  4TV7 A;  5J47 A;  2XAU A;  4C2M J;  4QIW N;  2ACJ A;  1HW1 A;  3K4B A;  1SVO A;  3OYK A;  2W24 A;  3KET A;  2AS5 F;  1WJ5 A;  2P7V B;  3WU2 C;  2K4J A;  2E1O A;  2LY1 A;  2FSW A;  5F0H A;  2LVS A;  5D5W B;  1FPQ A;  3BG6 A;  3CD6 I;  2B7E A;  2DCE A;  3UR3 C;  2X51 A;  3A0H C;  3ERM A;  2ZJR F;  1HC8 A;  1J2X A;  3CCU I;  1S8N A;  1XCV A;  3W2W A;  2B0L A;  1YX5 A;  3CLO A;  3L9F A;  4N4N B;  3BPV A;  4KFC A;  4YFX F;  3O8G A;  3MMY B;  1T0F A;  3J7Z I;  4OIP F;  1A31 A;  3IWZ A;  2F5V A;  2JN6 A;  1R58 A;  3MAJ A;  3VPR A;  1FOW A;  3I0T A;  2I8D A;  2AHQ A;  2O8X A;  5EGO A;  2BXY A;  3E6B A;  3HRU A;  1GV2 A;  2L4M A;  3MKW B;  2PN6 A;  2DU9 A;  1PYV A;  4OWR B;  4IOC F;  5FKK A;  5FB2 A;  2DI3 A;  3ZXS A;  3VEP A;  2HI3 A;  3H0G J;  4L5J A;  2A5Y B;  1W1W E;  2PEX A;  2DK5 A;  2IW5 A;  3FIW A;  1TT0 A;  2VQH A;  3M8J A;  3HL2 A;  2DT7 B;  4NB5 A;  1MH4 A;  4FHT A;  2VBW A;  5EG0 B;  5EEG A;  1TNT A;  3HOZ J;  4ZYA A;  4AVZ A;  5BMZ A;  4IF4 A;  1XSD A;  1R5G A;  1SFX A;  2ESN A;  3LFK A;  1SFU A;  2NOG A;  5DCM A;  3OS2 A;  1U78 A;  4WWC A;  1R6R A;  3C2G A;  2QEX I;  2ZSH B;  2V9V A;  2KIS A;  4EMS A;  1FIP A;  3VSK A;  1WCM J;  3H9Q A;  1OYW A;  2BV6 A;  2HQ5 A;  2PJR B;  4O6J A;  1VQ8 I;  5IY5 H;  3C7J A;  2OA4 A;  2LFB A;  3F9K A;  2GA2 A;  3DLA A;  4ZC3 A;  5DD8 A;  3BP8 A;  3PSI A;  2VL8 A;  2IEK A;  3ULQ B;  4FQG A;  3H1C A;  2ZME B;  3DU5 A;  5AIQ A;  5K5O A;  1ETQ A;  2XV4 S;  1WPK A;  2Y31 A;  5CVI A;  3VYR B;  2HEO A;  1ZAR A;  1YIT I;  1L0O C;  4LK1 F;  4FCY A;  1JKQ C;  2L9N A;  3Q0V A;  3GFJ A;  2Z1D A;  3VDX A;  2W85 A;  2LBF A;  3CES A;  1XGO A;  2ZJ2 A;  4JX5 A;  2GXA A;  1P92 A;  3OYL A;  1WJE A;  3TP0 A;  3P5J A;  3T5X A;  3TL4 X;  4IRI A;  1V5F A;  3HHG A;  1XSV A;  3DKW A;  3MWM A;  1VQN I;  3G71 I;  1LFB A;  1ZGA A;  4ON0 A;  1WHU A;  5EF6 A;  1WKM A;  5LRR A;  2I10 A;  3TED A;  4MQ9 F;  2FML A;  2DYR H;  3KEY A;  3RQ4 A;  1Z67 A;  4QTR A;  1W7P B;  2NS7 A;  3BJA A;  4IRG A;  2DBB A;  4BEH B;  1DU6 A;  2M45 A;  3QAH A;  4XSX F;  4GYI A;  3C3W A;  1SD7 A;  4Z2Y A;  5J8C A;  2CFX A;  3DFG A;  1T39 A;  4XLE A;  4XR6 A;  2EV5 A;  1W5S A;  3VOD A;  2OF7 A;  4PFO A;  3E0J B;  2Z2S B;  5IYC J;  5LHI A;  1K4T A;  2R7S A;  5BNG A;  5HOO A;  3M3Y J;  2BBY A;  3WTT C;  1RIO H;  3HPH A;  1HQC A;  2LY2 A;  2VC0 A;  2E5N A;  2XUB A;  3IAS 2;  1FTZ A;  3HKZ N;  5HLI A;  4XSZ F;  3KP4 A;  2FE3 A;  1TWG J;  3D1N I;  2F5E A;  1R49 A;  2E1N A;  1T8I A;  1IRG A;  2NYX A;  3RYR A;  3JW4 A;  2IA1 A;  2W48 A;  3FXU A;  3UKG A;  1Z9C A;  3OYD A;  1D0Y A;  1XMX A;  3OYN A;  1DQU A;  3DP7 A;  3QOD A;  4M71 A;  2Z33 A;  2JUC A;  2O7O A;  3JRG A;  3HRM A;  3HYI A;  3FXQ A;  3CDL A;  1U9O A;  2W25 A;  1B4A A;  3CF2 A;  3FBN B;  5KAI C;  3ZOB A;  4D1Q A;  2F4I A;  1JT6 A;  2KL4 A;  3M8E A;  2CGP A;  1OCO H;  3OYG A;  3K1N A;  4A3J J;  4CO8 A;  3V7R A;  4ENJ A;  4ZDL A;  4OOI A;  5HS7 A;  4RBO A;  2PFB A;  2Z99 A;  5E17 F;  4BH9 A;  2E34 A;  3OYM A;  5CQG A;  1HCR A;  5M5Y J;  1A6Q A;  3J81 Z;  4IKF A;  2VOO A;  1I6H J;  2OTJ I;  2VE9 A;  2JA2 A;  2RV8 A;  3HHH A;  3WGI A;  4MEY F;  3PM1 A;  3F22 A;  3CO6 C;  2H27 A;  2K3F A;  4A5N A;  3HTU A;  2YS9 A;  3U21 A;  1IUY A;  2HQR A;  1OR7 A;  1WJF A;  1IRX A;  2X6X A;  2EZH A;  2Q0O A;  1MMN A;  4DW6 A;  1GT0 C;  1PUF B;  1YW7 A;  4A6D A;  3HGY A;  3WTX C;  5ILU A;  4QSH A;  4OIR F;  1Q1V A;  1MH3 A;  2EWN A;  4ZYE A;  1F43 A;  2GXB A;  3DEE A;  4LLN A;  2F4M B;  2HNH A;  4M6V A;  2VN2 A;  5FD5 A;  1G3T A;  4YG2 F;  2CH0 A;  1ZRD A;  5IPA A;  3BJO A;  1S7E A;  4XKB A;  1VQO I;  1JJ8 C;  5H20 A;  2VLA A;  5FO5 A;  3LST A;  3DBR B;  1Y8R B;  3OY9 A;  1K61 A;  4A5M A;  1WFX A;  2E7W A;  2IGK A;  1B72 B;  2CQK A;  2XKP A;  5F1J A;  3ISP A;  2F5F A;  2QQ9 A;  3ASN H;  1W4M A;  4ENM A;  1EH7 A;  2GIV A;  2OAZ A;  3FHN A;  3MN2 A;  4A69 C;  1ZG5 A;  3BY6 A;  3PNY A;  3HOU J;  2HVR A;  3HTS B;  2MSY A;  3EQL F;  3RZD J;  1JTY A;  1F5T A;  1VQK I;  4HOB A;  4XLA A;  2V1N A;  1X3W B;  2CW0 F;  5E8G A;  2QQA A;  2WAQ N;  2JRT A;  3EUH C;  1TW3 A;  1XN7 A;  1X1B A;  1LDK B;  1IV6 A;  3GUD A;  3V7C A;  2A6T A;  4BU2 A;  4D0P A;  3LWF A;  4CYC A;  3IKT A;  2LLK A;  3M4O J;  1HW2 A;  2VKE A;  1N75 A;  2X1C A;  3OS1 A;  1S72 I;  1IXR C;  3CP2 A;  2M3A A;  4RGS A;  3TKY A;  3F8C A;  4JBA A;  1K78 B;  4JYK A;  3FKJ A;  5JVG F;  4MLO A;  4MNU A;  3GYH X;  4F3Q A;  3FK6 A;  2A6H F;  1ZN2 A;  4MEX F;  1WJD A;  1S3J A;  5E8I A;  3DWL E;  4A3L J;  2KRC A;  2Y0M A;  3T8R A;  2HTS A;  4ESJ A;  1HW5 A;  5D6F A;  1ZH5 A;  1S29 A;  1NK3 P;  5FFX A;  4UB6 C;  3GEZ A;  4LG0 A;  1M1E B;  2NAZ A;  3CCQ I;  2W84 A;  4YIF A;  4F52 A;  2MC4 A;  4KYW A;  4II3 A;  5LBQ A;  3ZQL A;  1LE8 B;  3S8P A;  3A4C A;  1BR4 A;  1ON2 A;  3FMS A;  1O3T A;  2VJ4 A;  3AG1 H;  2YU9 J;  3HRT A;  4X0G A;  4BJ5 C;  2GM4 A;  2DK8 A;  2KDZ A;  2Y0S A;  3SHF A;  5DCF A;  4EJW A;  4YFK F;  5GAH J;  1QHG A;  2KPM A;  3HOW J;  2CSO A;  3SZG A;  2DMQ A;  2CV1 A;  3EET A;  4EVI A;  5IOY A;  1UEL B;  4MO7 A;  3FX3 A;  3QP6 A;  4IL6 C;  1Z91 A;  2CU7 A;  4FX0 A;  2OUM A;  3PQJ A;  1XMA A;  2VBX A;  3BPX A;  4OAY A;  3HM5 A;  3P9C A;  1VQL I;  4GFB A;  2A68 F;  3PNV A;  2CS3 A;  5BQT A;  3JRI A;  2OD5 A;  2X48 A;  2M1B A;  5K5R A;  1X3Z B;  2K4B A;  4ZZL A;  3LAJ A;  2K40 A;  3BLY A;  2Y69 H;  4DQ2 A;  3LSR A;  2EV6 A;  5C3E J;  3J80 K;  1G2H A;  4CYD A;  4HNT A;  4BQO A;  3PFY A;  4M9X A;  1UMQ A;  4CHU A;  2G9W A;  4CCN A;  3LMM A;  4PGG A;  3GFL A;  3BCB A;  1CF7 A;  5JLX A;  1YJN I;  5K1Y A;  4LLG F;  2LD5 A;  2E5Z A;  1AHD P;  4M3E A;  3M7G A;  2FEZ A;  2BHZ A;  2Y2Z A;  5B5E C;  3I4M J;  5CJ9 A;  3ZPL A;  3H92 A;  1G8X A;  1X3U A;  2EA4 A;  3F23 A;  3KP3 A;  2NS8 A;  3MQ0 A;  2WY7 Q;  2AQF A;  1KON A;  2OV7 A;  4PSX A;  3BG9 A;  2W82 A;  3ZCO A;  4GCV A;  4EGY A;  1ZYR F;  4AYB N;  1BIA A;  1V55 H;  5K5Q A;  4LK0 F;  3H9J A;  1YI2 I;  2JWT A;  5DM6 F;  2R7Z J;  3IP4 B;  3K4L A;  1WJA A;  2CG4 A;  2O3F A;  4IO9 F;  5TGT A;  1MMG A;  3LA3 A;  4G7H F;  1HF0 A;  1N78 A;  1AKH B;  4EJO A;  2E1M B;  3GTG J;  4A0Z A;  3QPH A;  3RTR A;  3GTO J;  3A02 A;  4HLX A;  1QZY A;  3AG3 H;  2F5D A;  2LDU A;  4ABZ A;  3F8F A;  1MJB A;  3PJR A;  2Q1Z B;  2ZXW H;  3H36 A; 
#chains in the Genus database with same CATH homology
 3F6V A;  5F6F A;  3TDZ C;  3GLX A;  1YTY A;  1ZG3 A;  4AD9 A;  4BXU A;  3VB2 A;  4R79 A;  2QBY A;  1KU7 A;  2HQN A;  4UUV A;  2VOP A;  3DPT A;  1D3Y A;  2VT2 A;  4M6X A;  3L2C A;  5FLX Z;  1XMK A;  2O61 A;  3BOQ A;  2AXL A;  4UV9 A;  5LEK A;  1JGS A;  4WK8 F;  4HA8 A;  3LQQ A;  5TRD A;  2P6S A;  4PDK A;  4AWX B;  1O3R A;  2JT1 A;  4HX8 A;  4Q47 A;  3RYP A;  3JAM K;  4U88 A;  3K9T A;  4M73 A;  3GVA A;  4KDP A;  2MLG A;  3JTH A;  5DUK A;  3BRO A;  3K1P A;  1Q1H A;  1SMY F;  2ZNY A;  2YSR A;  5D8L B;  3CDH A;  4JK1 X;  1T6S A;  2DFI A;  3FM3 A;  3F21 A;  3F3X A;  4WX9 A;  1KGS A;  4YFN F;  5LGU A;  1O57 A;  2P5V A;  2L02 A;  1NHA A;  5D4S A;  3K0L A;  3BJ6 A;  4MGR A;  4L9J A;  2FBK A;  1XSX A;  4N9H A;  4MTE A;  4WXH A;  1KYW A;  4HW0 A;  4L9N A;  5D5U B;  1IAW A;  1O3Q A;  3V8K A;  1R5H A;  3BZ6 A;  1KQ8 A;  1UHW A;  2LF8 A;  2R7D A;  4G94 A;  3I4P A;  5JHU A;  5AON A;  4P5O A;  1LEA A;  4Q48 A;  4KNY A;  5LHH A;  4XBF A;  1JHF A;  4RAY A;  4XRF A;  1Z05 A;  2RGV A;  1QZZ A;  2IA2 A;  3QPT A;  3IKV A;  3WTY C;  1JHH A;  4AIJ A;  2EFQ A;  2H6B A;  2EJR A;  4IHS A;  2K86 A;  3I64 A;  2ZNZ A;  2IA0 A;  2WC2 A;  2KJB A;  3SZP A;  2STW A;  3FMR A;  3CUO A;  2M8E A;  1V4R A;  4I2O A;  2DQL A;  3I59 B;  3E5Q A;  3RKY A;  1XGS A;  4FX4 A;  3WTV C;  3IRQ A;  3WTW C;  1MJ9 A;  1MDM A;  2GAU A;  4OU0 A;  1H0M A;  3V7S A;  1FYL A;  3C18 A;  3S2W A;  1ULY A;  2RNJ A;  2KIF A;  5LRS A;  1FNN A;  2BEO A;  4G6Q A;  4EJT A;  3PFI A;  2HZT A;  3IC7 A;  4RGX A;  3K2Z A;  1WWX A;  1IRF A;  3SXY A;  2P8T A;  1HST A;  3KP5 A;  1QGP A;  4ZYH A;  5E1Z B;  3SQN A;  4DNC A;  2A69 F;  3ERE D;  3HSE A;  3I53 A;  1FBU A;  4HZF A;  2OZU A;  1PP7 U;  3MCZ A;  1O7L A;  4ESB A;  4NQW A;  1QBJ A;  2OQG A;  3JTG A;  1S7O A;  1D8J A;  3Q9S A;  3ML6 A;  4N0B A;  2OZ6 A;  4KIF A;  2A61 A;  3KCC A;  4I09 A;  5A2Q K;  3WTZ A;  2L54 A;  3I71 A;  2FBI A;  4S04 A;  4IJA A;  3QP5 A;  2F2E A;  3E3V A;  1IF1 A;  3ABT A;  4CZZ A;  1Z1D A;  3CUQ B;  2DQR A;  5H6Q A;  2L01 A;  2CO5 A;  3M1E A;  1KYZ A;  1YO5 C;  2DTR A;  3RIR A;  1OPC A;  4LFU A;  3FM5 A;  3G73 A;  1MZB A;  1G6N A;  1PP8 F;  4ZH4 F;  3DPL C;  3I58 A;  4U0W A;  4IXA A;  5LGT A;  4RGR A;  3CJN A;  3V8J A;  1K79 A;  5CVU A;  1BIB A;  3Q5F A;  1YYV A;  3F8M A;  3NEU A;  5CYV A;  5IT3 A;  4AVP A;  3MZY A;  1G3Y A;  2L4A A;  1TLH B;  2H94 A;  2VBY A;  3TO6 A;  4UVB A;  2NS0 A;  1FZP B;  2VE8 A;  4M72 A;  1XCB A;  1REP C;  1OYY A;  1HKT A;  4OMZ A;  2ZKZ A;  2P5K A;  1SD4 A;  5FGM A;  1I27 A;  3GZ5 A;  1P4X A;  1W5T A;  5FD6 A;  1UHM A;  3W6J B;  4I98 B;  2CWE A;  2WV0 A;  1L3L A;  1FOK A;  2WTE A;  3ABU A;  1K6O A;  1UFM A;  3ZMV A;  4R1H A;  3ZMT A;  2EV0 A;  5HS9 A;  2QYO A;  3B02 A;  3WTS C;  1LDJ A;  4ASN A;  2JTV A;  2Q2E A;  1H9G A;  3KEO A;  4HF1 A;  1LDD A;  3CUQ C;  4G7Z F;  1FSH A;  2HKO A;  1BN5 A;  1ZRC A;  3LAP A;  3ZMS A;  1QPM A;  4CIC A;  1LNW A;  1MJA A;  1ZGJ A;  3P9K A;  2M87 A;  2O0Y A;  4UVA A;  2IRF G;  4BNC A;  5CVJ A;  5D4R A;  1DPR A;  1YW9 A;  1ZG1 A;  3R60 A;  4HBL A;  2VXZ A;  1H9T A;  4KMF A;  1BI0 A;  3ROU A;  4BHB A;  4L18 B;  2V1U A;  1MD0 A;  5ICF A;  1U5T A;  3J81 K;  1G3W A;  2YX7 A;  1ZRF A;  2YPR A;  2EA2 A;  1RUN A;  4KUM A;  2OBP A;  1C0W A;  4GYG A;  4L0Z B;  3KE2 A;  1UCR A;  3T8T A;  2QVO A;  5KK1 A;  5HLH A;  2MBF A;  3L09 A;  2L3D A;  3J80 Z;  3ZMD A;  3TO9 A;  5HVQ C;  4WCG A;  1VTN C;  4I0B A;  4M9S A;  1EV7 A;  1J9I A;  1OMI A;  2P7C B;  4HDV A;  4MHG A;  1B9M A;  4GXO A;  5E18 F;  1LB2 A;  2UXN A;  2PLY A;  2FQ3 A;  1BM9 A;  2LF7 A;  3ELK A;  1HXD A;  1IXC A;  4AIK A;  1T2K A;  4EJU A;  3IHU A;  2Z3Y A;  4ETS A;  1W7P D;  6PAX A;  2D45 A;  2WWY A;  2MLK A;  3KEQ A;  4HDU A;  4CDG A;  1WSU A;  2YU3 A;  4KIB A;  2FF4 A;  4IVN A;  3Q9V A;  2R3S A;  2ZME A;  4KN4 X;  2DO7 A;  2HR3 A;  4LLL A;  2X0L A;  2QZ8 A;  2MH9 A;  2Y75 A;  1KQ9 A;  3I54 A;  4KT5 C;  4HF2 A;  4LD5 A;  3EUH A;  3L7W A;  3IWF A;  4UXN A;  3U9G A;  1BI2 A;  2HFH A;  1EH6 A;  5F1R A;  3ZN0 A;  5L3B A;  4U7B A;  1FYK A;  2VON A;  1P4A A;  1B6A A;  4FT8 A;  1W7P A;  2PQ8 A;  2XKO A;  1R36 A;  2MH2 A;  3KP7 A;  3N97 A;  2HWV A;  2H6C A;  5E1X A;  1I1S A;  3KP6 A;  2MD5 A;  2QQB A;  3KLO A;  1ZRE A;  3RDI A;  2G7U A;  3WOD F;  4UHT A;  3ZMZ A;  2JPC A;  1FBS A;  1KA8 A;  5JFR A;  1IXS B;  4XLP F;  4A0Y A;  1DUX C;  2KIM A;  2FXA A;  3DXJ F;  2FMY A;  1SAX A;  1KU9 A;  5IT9 K;  5BOX A;  3VOE A;  1F1Z A;  2VOD A;  3K69 A;  4LJZ F;  4WF2 A;  1XDU A;  2XAS A;  3MFK A;  2HTJ A;  5DCM B;  2RC4 A;  5D5X B;  4ZYG A;  1BC7 C;  5HS8 A;  1U6G A;  4Y17 A;  1R22 A;  4HYE A;  2XGX A;  1TNS A;  2PMH A;  3I5U A;  4R8H A;  4EM0 B;  2BYV E;  5CVR A;  4I7H A;  3FF5 A;  2EFW A;  4L0Y B;  1GXQ A;  3LA2 A;  3GXO A;  1UB9 A;  1DDN A;  3QU6 A;  4HF0 A;  3FHZ A;  3EYI A;  1A04 A;  4QLC U;  5ICE A;  2IT0 A;  1E17 A;  2V1X A;  1P6R A;  1SFE A;  2K7L A;  2OQR A;  3HSR A;  2K02 A;  5JVT A;  1XD7 A;  2HOE A;  4RB0 A;  4S05 A;  2DPD A;  3RKW A;  3DF8 A;  1RUO A;  1J75 A;  1K78 A;  2TDX A;  4JQF A;  2E1C A;  2XRN A;  1D5V A;  1LQ1 A;  2PG4 A;  3KP2 A;  2BE5 F;  3RPU A;  1HBX G;  5LGN A;  1O3S A;  1RI7 A;  1WQ2 A;  1MGT A;  4LMY A;  3AAF A;  2KJC A;  5J6X A;  3WGH A;  2IPQ X;  4I0A A;  2NRA C;  4N9I A;  3DV8 A;  2K27 A;  2QWW A;  2STT A;  4U0Y A;  1YS6 A;  1Z6R A;  1J5Y A;  2A3S A;  2FRH A;  4BQA A;  3HRS A;  3BDD A;  3P9I A;  3WE2 A;  2JPB A;  2Y48 A;  4L9T A;  5L3D A;  3B73 A;  1BI1 A;  4RGU A;  1FSE A;  4EGZ A;  1KQ0 A;  1SD5 A;  1TQP A;  3T1B A;  4IPA A;  3V8L A;  4RS8 A;  2PMU A;  4KIG A;  5ED4 A;  4G6D A;  2FNA A;  1IN5 A;  3JSO A;  4IHT A;  2ZFW A;  5A2Q Z;  1FP1 D;  3R0J A;  1PDN C;  2VC1 A;  5BPD A;  1DP7 P;  3QOP A;  3E6M A;  5LLQ A;  2Z9O A;  5DDG A;  4MQV A;  1QQI A;  2P4W A;  4IRH A;  2GQQ A;  5FFZ A;  3NQO A;  2IJL A;  5DYM A;  1IN7 A;  3QRF F;  2IVM A;  2ZBK A;  5CVV A;  4LG0 B;  3E5U A;  3WGG A;  1QO0 D;  1BI3 A;  2LSO A;  4I02 A;  3TOB A;  1AWC A;  1I6X A;  1CGP A;  3IL2 A;  4HX7 A;  3IRR A;  3G3Z A;  3OOP A;  2EK5 A;  1LVA A;  1FBQ A;  1GHC A;  4UVC A;  1KU3 A;  1J0R A;  1T38 A;  1YW8 A;  4KA4 A;  3HOT A;  3F8N A;  4HX4 A;  2XIG A;  1R1V A;  5EEH A;  1ZHF A;  2D2W A;  4O3M A;  2KIU A;  4PGH A;  2Q8K A;  3R6S A;  4WXC A;  3WG9 A;  4UNO A;  5BPI A;  4OIO F;  4OIN F;  4EM1 A;  4RB2 C;  2FU4 A;  1F9N A;  1KU2 A;  1V3F A;  1IZ1 A;  1D8K A;  3F6O A;  1T98 A;  3GW2 A;  2D1H A;  5HDG A;  5ILS A;  1CF7 B;  4E70 A;  4Q5S F;  3ECH A;  2KRF A;  1YQA A;  3O6B B;  1XGM A;  3ECO A;  2G7H A;  1TQM A;  2P6T A;  1G3S A;  4HV5 A;  2ESH A;  4ESF A;  2V79 A;  3SZT A;  5ILV A;  5AIP A;  1BOA A;  4NHJ A;  1DPU A;  2PBI A;  4EQQ A;  1FYM A;  2J5O A;  4F7Z A;  2GA1 A;  2NNY A;  1R23 A;  5DV5 A;  2LKP A;  1LEB A;  1J59 A;  3E97 A;  1EH8 A;  3WU1 B;  1U5T C;  5HLG A;  4OMY A;  5D6E A;  3D0S A;  1B59 A;  3R61 A;  3FXR A;  3TGN A;  5L3E A;  3C1D A;  3GX4 X;  2MC3 A;  3TQN A;  5CLS A;  5LEJ A;  4EJV A;  2DPU A;  2XVC A;  2ZO4 A;  2PJP A;  3K1M A;  2XAG A;  2YR2 A;  4G9Y A;  3RJP A;  2QBY B;  2RN7 A;  4A12 A;  3LQR A;  1TTY A;  3ZQ7 A;  2V6C A;  2P5L C;  2DT5 A;  3H3Z A;  1YFH A;  4O5V A;  2FOK A;  1ODD A;  3EYY A;  3KZZ A;  4H0E A;  4EM2 A;  2EFN A;  2ZXJ A;  1PUE E;  2HS5 A;  1Y0U A;  1P2F A;  3I59 A;  5ICC A;  3FZV A;  2JSC A;  3CO7 C;  1USS A;  2ISZ A;  3O3K A;  2XAQ A;  3R0A A;  4GGG A;  4LB5 A;  2HGC A;  4MTD A;  2GXG A;  3KLN A;  1Z6T A;  1FLI A;  1XGN A;  3KFW X;  2MA3 A;  1JE8 A;  1FY7 A;  1IN6 A;  2NNN A;  1IN4 A;  3EDP A;  1IW7 F;  4CXF A;  2M5W A;  1U8R A;  2XAF A;  2FBH A;  2QM3 A;  3TO7 A;  4P9F A;  2W57 A;  4BHP A;  3GZ6 A;  1GXP A;  3V4G A;  4KMU X;  1ON1 A;  1SD6 A;  3N4M A;  4P55 A;  4CGZ A;  4M6Y A;  1E2X A;  2X4H A;  3MEX A;  4M9Z A;  4U7D A;  3WE3 A;  1R7J A;  2VT3 A;  5L3G A;  3L00 A;  3GO5 A;  2YX4 A;  4P9U A;  3MZH A;  1OKR A;  1ZLJ A;  5JR3 A;  1R00 A;  3H3U A;  5HDN A;  5ERI A;  3W6K B;  1WI9 A;  3CUQ A;  4PCQ A;  5F64 A;  3HOS A;  3DEU A;  3GF2 A;  3COA C;  1MDM B;  1ONV A;  3OV8 A;  4Y15 A;  3M8F A;  2DLL A;  2DW4 A;  2UXX A;  4L9V A;  3D5L A;  2ISY A;  1JXS A;  4LGW A;  2RKH A;  4B09 A;  4HQE A;  4BAY A;  3HIF A;  1YLF A;  4QWQ A;  2EFO A;  3TOA A;  4BYY A;  3WTU C;  4UV8 A;  3F72 A;  4HAM A;  2H09 A;  3RKX A;  1TBX A;  3ZMU A;  2XHK A;  5IT9 Z;  4RB1 A;  1HKS A;  1STZ A;  1OYI A;  3CTA A;  2KKO A;  4RB3 C;  2A07 F;  4EV0 A;  3O2P E;  4A2U A;  2PI0 A;  3E5X A;  2HYG D;  5D5V B;  4OIQ F;  2M30 A;  1RZ4 A;  1AOY A;  4K2E A;  5E1W A;  1U2W A;  2V1D A;  3QU3 A;  2COM A;  5DUI A;  3GFI A;  1HKQ A;  5H6R A;  2XAJ A;  4I01 A;  3JAM Z;  1FX7 A;  3NRV A;  1K7A A;  2O6G E;  4L5I A;  5HDK A;  3REO A;  5DEQ A;  4A0X A;  2HYF A;  2GWR A;  4M74 A;  2JZY A;  1YG2 A;  3GFM A;  2QEN A;  1ZLK A;  1UST A;  2A6E F;  1P4W A;  1HSJ A;  2ELH A;  4HQM A;  1FWZ A;  1BJA A;  2J5P A;  1FT9 A;  3SFZ A;  2CYY A;  1FP2 A;  4ENN A;  3R4K A;  2FNP A;  4LB6 B;  1F4K A;  4PZJ A;  5D8K B;  1G4D A;  2HKX A;  1O7F A;  1BBY A;  3E6D A;  4ZZD A;  1XDS A;  1LJ9 A;  1I1G A;  1R1U A;  3LA7 A;  4GO1 A;  5TJJ A;  3FMQ A;  3KZY A;  5JI6 A;  4U0V A;  5L3F A;  3WU0 A;  3GWZ A;  1TW2 A;  2C6Y A;  2HDC A;  1R1T A;  4Q4Z F;  3U1D A;  1FC3 A;  3JSP A;  5FLX K;  1B9N A;  2UZK A;  1XB4 A;  2UWM A;  2RQP A;  2E7X A;  4P96 A;  2ETH A;  2R7F A;  4XLN F;  2LNB A;  2XRO A;  5L3C A;  2RDP A;  1QNT A;  3M9A A;  1YS7 A;  3VFZ A;  4RAZ A;  2XAH A;  2O03 A;  2EB7 A;  1B1B A;  1WRJ A;  1RNL A;  5KVR A;  2ZCW A;  1GVJ A;  2EFP A;  3E6C C;  4KN7 X;  2DAO A;  5J8F A;  2VBZ A;  4HV6 A;  3RPQ A;  4YII A;  3TDU C;  2ADU A;  4AIH A;  4HLY A;  2Z5U A;  3HUG A;  3J7A O;  3HSF A;  3U2R A;  4G8X A;  1TQI A;  2FA5 A;  4BHC A;  3T0Y A;  5ICG A;  1ZAO A;  2QUF A;  2OU2 A;  5BS6 A;  4ZYD A;  1S6L A;  3BWG A;  4Y13 A;  3RI4 A;  1BC8 C;  4A6E A;  3DQV C;  4ENK A;  3P7N A;  1S7A A;  3FWE A;  1IN8 A;  2IP2 A;  1YIO A;  3ZP5 A;  1MKM A;  4WXD A;  1SMT A;  3ZN1 A;  2D1V A;  2GZW A;  1U3E M;  3PQK A;  1J7K A;  4KIC A;  5DD4 A;  5LHG A;  4G7O F;  2BGC A;  1U5T B;  4B8X A;  2RVC A;  2F5C A;  2QLZ A;  3F8B A;  1I5Z A;  5E20 A;  1Z7U A;  4TV7 A;  2ACJ A;  1HW1 A;  2AS5 F;  2W24 A;  3KET A;  2P7V B;  2K4J A;  2FSW A;  5D5W B;  1FPQ A;  1J2X A;  1S8N A;  1XCV A;  2B0L A;  3CLO A;  3L9F A;  3BPV A;  4KFC A;  4YFX F;  1T0F A;  4OIP F;  3IWZ A;  1R58 A;  3MAJ A;  3I0T A;  2O8X A;  3E6B A;  3HRU A;  2L4M A;  2PN6 A;  2DU9 A;  5FB2 A;  2DI3 A;  3VEP A;  4L5J A;  2A5Y B;  2PEX A;  2DK5 A;  2IW5 A;  4NB5 A;  4FHT A;  2VBW A;  5EEG A;  1TNT A;  5BMZ A;  4IF4 A;  1XSD A;  1R5G A;  1SFX A;  2ESN A;  3LFK A;  1SFU A;  5DCM A;  1U78 A;  4WWC A;  2V9V A;  4EMS A;  1OYW A;  2BV6 A;  4O6J A;  3C7J A;  2OA4 A;  2GA2 A;  5DD8 A;  3BP8 A;  3ULQ B;  2ZME B;  5AIQ A;  5K5O A;  2XV4 S;  5CVI A;  2HEO A;  1ZAR A;  1L0O C;  4LK1 F;  3GFJ A;  2W85 A;  1XGO A;  2ZJ2 A;  1P92 A;  3T5X A;  4IRI A;  3HHG A;  1XSV A;  3DKW A;  3MWM A;  1ZGA A;  4ON0 A;  1WKM A;  5LRR A;  4MQ9 F;  2FML A;  1W7P B;  3BJA A;  4IRG A;  2DBB A;  2M45 A;  3QAH A;  4XSX F;  4GYI A;  3C3W A;  1SD7 A;  4Z2Y A;  5J8C A;  2CFX A;  3DFG A;  1T39 A;  2EV5 A;  1W5S A;  3VOD A;  5LHI A;  5HOO A;  2BBY A;  3WTT C;  1RIO H;  1HQC A;  2VC0 A;  2XUB A;  5HLI A;  4XSZ F;  3KP4 A;  2FE3 A;  2F5E A;  2E1N A;  1IRG A;  2NYX A;  3RYR A;  3JW4 A;  2IA1 A;  3FXU A;  1Z9C A;  3DP7 A;  4M71 A;  2Z33 A;  3HRM A;  3HYI A;  3FXQ A;  2W25 A;  1B4A A;  3M8E A;  2CGP A;  3K1N A;  4CO8 A;  3V7R A;  4ENJ A;  5HS7 A;  4OOI A;  2PFB A;  2Z99 A;  5E17 F;  4BH9 A;  3J81 Z;  2VOO A;  2VE9 A;  2RV8 A;  3HHH A;  3WGI A;  4MEY F;  3F22 A;  3CO6 C;  2H27 A;  4A5N A;  3HTU A;  1IUY A;  2HQR A;  1OR7 A;  2Q0O A;  1YW7 A;  4A6D A;  3WTX C;  5ILU A;  4OIR F;  2EWN A;  4ZYE A;  2GXB A;  4LLN A;  2VN2 A;  5FD5 A;  1G3T A;  4YG2 F;  1ZRD A;  3BJO A;  5H20 A;  5FO5 A;  3LST A;  4A5M A;  2E7W A;  2CQK A;  2XKP A;  3ISP A;  2F5F A;  2QQ9 A;  1W4M A;  4ENM A;  1EH7 A;  2GIV A;  2OAZ A;  1ZG5 A;  3BY6 A;  3HTS B;  3EQL F;  1F5T A;  4HOB A;  2CW0 F;  5E8G A;  2QQA A;  2JRT A;  1TW3 A;  1XN7 A;  1LDK B;  3GUD A;  3V7C A;  4D0P A;  3LWF A;  3IKT A;  1HW2 A;  1IXR C;  4RGS A;  3TKY A;  3F8C A;  4JBA A;  1K78 B;  4MNU A;  3GYH X;  2A6H F;  1ZN2 A;  4MEX F;  1S3J A;  5E8I A;  2Y0M A;  3T8R A;  2HTS A;  4ESJ A;  1HW5 A;  5D6F A;  1ZH5 A;  1S29 A;  5FFX A;  4LG0 A;  3GEZ A;  2NAZ A;  2W84 A;  4YIF A;  4KYW A;  5LBQ A;  1ON2 A;  3FMS A;  1O3T A;  3HRT A;  2DK8 A;  3SHF A;  5DCF A;  4EJW A;  4YFK F;  2CSO A;  3EET A;  4EVI A;  3FX3 A;  3QP6 A;  1Z91 A;  4FX0 A;  3PQJ A;  1XMA A;  2VBX A;  3BPX A;  3P9C A;  2A68 F;  5BQT A;  2OD5 A;  2M1B A;  5K5R A;  2K4B A;  4ZZL A;  3LAJ A;  4DQ2 A;  2EV6 A;  3J80 K;  4CYD A;  4M9X A;  4CHU A;  2G9W A;  4PGG A;  3GFL A;  1CF7 A;  5K1Y A;  4LLG F;  3M7G A;  2FEZ A;  5CJ9 A;  3ZPL A;  3H92 A;  1X3U A;  2EA4 A;  3F23 A;  3KP3 A;  3MQ0 A;  4GCV A;  4EGY A;  1ZYR F;  1BIA A;  5K5Q A;  4LK0 F;  2CG4 A;  2O3F A;  3LA3 A;  4G7H F;  4EJO A;  4A0Z A;  3QPH A;  3RTR A;  4HLX A;  1QZY A;  2F5D A;  2LDU A;  3F8F A;  1MJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...