3S2WA

The crystal structure of a marr transcriptional regulator from methanosarcina mazei go1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
146
Chain Sequence
GISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDERSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
publication title The crystal structure of a MarR transcriptional regulator from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
total genus 48
structure length 146
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3s2wA00
1ZGJA 2ZKZA 2FMLA 2Q8KA 3I58A 2G9WA 4U7DA 4UV9A 5FFZA 1XD7A 4L0ZB 1ZLKA 2K4JA 3WG9A 2E7XA 4Y17A 2IRFG 3JTGA 1D8JA 1U2WA 4KUMA 2HGCA 1IXCA 2DK8A 4YIIA 4G9YA 4P96A 1IUYA 3ABUA 2ADUA 1AOYA 5LBQA 2GZWA 2OU2A 2XRNA 2LKPA 4WK8F 3QPTA 5DD4A 2WV0A 4IHTA 3I4PA 4AIJA 1R58A 3CUOA 1RNLA 5DUKA 3O2PE 3HSFA 1FOKA 5E8GA 4A2UA 5AIQA 1RIOH 4L9JA 2ZMEB 5J6XA 4OIPF 5TRDA 1U5TB 3DKWA 4ETSA 5E1ZB 1BI2A 4LJZF 2DLLA 1QQIA 3RYRA 4RGUA 2AS5F 3V7SA 3WTVC 2DW4A 1YIOA 3F8MA 3R60A 2HR3A 3F23A 2ZNZA 1BIAA 1ZG1A 1K6OA 2STTA 2V1UA 4HAMA 4XLNF 2UXXA 1XGNA 4K2EA 5BQTA 5J8CA 2P6TA 5L3DA 1EV7A 1R5GA 3B73A 2YSRA 1FYMA 4I02A 2W24A 2KJCA 4H0EA 2FF4A 4G7HF 3LA7A 1XDSA 4UVAA 4HQEA 5FLXK 4HV6A 4HF0A 1USTA 1LDJA 4G6QA 2W85A 3WTYC 1LJ9A 3F8FA 1DPRA 4EGZA 1B59A 1F9NA 3TDUC 1FP1D 1LEAA 2D1HA 3RTRA 1IRGA 2NRAC 5LEJA 2P5VA 1FT9A 2R3SA 1F5TA 3OV8A 2YPRA 3ECOA 3VOEA 4G7OF 4PGGA 2XROA 1BC8C 2AXLA 4IRGA 1T98A 2F2EA 3WTWC 1ZRFA 2ZXJA 2W57A 1BI3A 4BAYA 1D8KA 3C7JA 4UHTA 4HYEA 1SMTA 2QUFA 5CVVA 2Z99A 1Q1HA 1IZ1A 4A0YA 5HDNA 1TTYA 1ZGAA 3PFIA 4HLXA 1TLHB 2OQGA 1FBQA 1F1ZA 1FP2A 2QYOA 3NEUA 4M9ZA 3HRUA 1YQAA 1TBXA 3ISPA 2MA3A 4HQMA 4XBFA 2VBWA 1FSHA 3J80K 3TOBA 2O0YA 2X0LA 3QP6A 1HBXG 5KK1A 3HRTA 2EFNA 2VBZA 3IWFA 4N9HA 2HS5A 2V1XA 4ESJA 2UWMA 1W7PA 3CDHA 5FLXZ 5FD5A 4XSZF 4ZZDA 3GO5A 3KEOA 4P9UA 1SAXA 1QNTA 2M5WA 4KIGA 2VE8A 4RB2C 4M71A 5HDKA 4WXHA 5DYMA 2IVMA 3W6KB 1G4DA 1HW1A 4G6DA 3QOPA 1XDUA 2OA4A 2RN7A 3KP6A 2L4MA 4R8HA 1IRFA 2HEOA 3K0LA 5JI6A 1BBYA 3TOAA 2PLYA 1LQ1A 3E5QA 1BIBA 4ON0A 1H9TA 1DPUA 2YR2A 1I6XA 3FMSA 2IA2A 1FYKA 3RI4A 2XAQA 4IXAA 5BS6A 2FBHA 3NRVA 2PG4A 2B0LA 1SFUA 4HX4A 5D5WB 3BP8A 2VT3A 1ZHFA 4GGGA 3ROUA 4S05A 1YTYA 2GIVA 1HKQA 1OYWA 3GZ5A 1ZN2A 2KRFA 4UNOA 5L3BA 3GF2A 4RAYA 5LHIA 3WODF 3KP4A 3QRFF 4R79A 3E6CC 2WTEA 3ML6A 1Z05A 2XUBA 1YW9A 1B4AA 2CFXA 5DD8A 2VOPA 2V1DA 4EM2A 2E1CA 3K1PA 5KVRA 3RPUA 1BN5A 2F5DA 3SZPA 2OZ6A 3C1DA 4L9NA 2H94A 1I27A 1W7PB 4BNCA 1R1UA 3RDIA 3FX3A 2YX7A 3AAFA 3LFKA 4KICA 4LG0A 1J0RA 3QU3A 2HTSA 3EYYA 3REOA 3ELKA 4WF2A 1G3SA 5FD6A 4M74A 3FXUA 4JBAA 2NNNA 2VC1A 3U9GA 2G7HA 4NB5A 2DPDA 4I2OA 2EA4A 3KP7A 1DP7P 3LAJA 1FWZA 3ULQB 2NYXA 3EDPA 1FY7A 1U78A 2VBYA 2O61A 4BHCA 3CUQB 1DDNA 1FBUA 2FQ3A 3Q9SA 3H3ZA 4Z2YA 3E6BA 2F5EA 1GVJA 4CXFA 3GW2A 3GFIA 2ACJA 4JQFA 1T0FA 1WWXA 1KYZA 2HFHA 4S04A 3O6BB 3TO7A 4KYWA 5ICCA 5AIPA 1ZRDA 2EWNA 1J7KA 1R22A 4I0AA 5LGTA 1G3WA 1J2XA 2HYGD 1W5SA 3GLXA 2EV0A 3ZMZA 4HF2A 4LK0F 3M7GA 5TJJA 5D5XB 4KA4A 3MEXA 4Y15A 1EH6A 3WTXC 2GQQA 1IN4A 2FBIA 2ZJ2A 4QLCU 4ENMA 1R00A 3EQLF 4CYDA 3K9TA 1T2KA 4M6YA 3L09A 2CGPA 4ESBA 4BQAA 3SHFA 4EJOA 2ESHA 1UCRA 4F7ZA 3K69A 1R1TA 1MJAA 5ILSA 3HTSB 1VTNC 4EGYA 4AVPA 4AIKA 1BI1A 3CO6C 2EFWA 2E1NA 4ESFA 5HLHA 1KQ0A 5LHGA 2BYVE 2FSWA 2H27A 4LG0B 1YLFA 4IHSA 1Y0UA 5HDGA 3J7AO 4IVNA 3U2RA 1ODDA 4I01A 2HKXA 3MFKA 1PDNC 1F4KA 1U6GA 1XMKA 5AONA 2K86A 3M1EA 1MD0A 3KZZA 4OU0A 3KP3A 2HOEA 4P5OA 2DK5A 2ZFWA 3QAHA 1O3RA 4I09A 4LB6B 3F22A 2QVOA 2RKHA 4DQ2A 1LDKB 4OIQF 5CVUA 3LSTA 2ZO4A 4YFXF 3ZP5A 4LB5A 3IC7A 1WKMA 1IW7F 3V8KA 2A69F 1E17A 3BJOA 2JPCA 3I59A 2VT2A 5IT3A 5CYVA 1KU7A 3WE2A 1ZG5A 1EH7A 1OYIA 5EEHA 1TW3A 3HOTA 4KFCA 2RGVA 4FT8A 2PBIA 1QZZA 1B1BA 2BV6A 2MH2A 1RUOA 2JZYA 2XIGA 1YW7A 1HKTA 2XAHA 3CTAA 3LQQA 1XSDA 4A12A 1FBSA 1SFXA 4ZYDA 4EM1A 3BWGA 2WC2A 3E5UA 1I1SA 3TQNA 2Z33A 1MJ9A 5BPIA 4OIRF 3ECHA 4BH9A 2A6EF 4LLLA 4WX9A 1G3TA 4LFUA 5ICEA 2O6GE 4MQVA 3CO7C 2YX4A 4ENNA 4MQ9F 5JVTA 1ZAOA 3H92A 2VE9A 1YG2A 1WQ2A 3KETA 4UVCA 1YW8A 2EB7A 3R6SA 5DUIA 3EYIA 1J59A 2OAZA 1BJAA 2FA5A 3FHZA 3IL2A 4LD5A 3V7RA 2ELHA 1ZLJA 2XAFA 2ZBKA 3ZMDA 3T8TA 4YFKF 2NNYA 4GYGA 4G94A 1V3FA 2QM3A 2EJRA 4RGSA 2HKOA 3HHGA 4RGRA 1XSXA 3LWFA 1MGTA 2H6BA 2YU3A 3M8EA 1SFEA 2EV5A 4MEYF 3KFWX 1W5TA 1G6NA 1FZPB 3KE2A 2XKPA 4UV8A 4IRIA 3I64A 4M9XA 2F5CA 3MWMA 1R23A 5D6FA 5JFRA 3F8BA 3BDDA 1IN5A 3TDZC 3C18A 2XGXA 4KN4X 3E5XA 1Z7UA 4HX7A 4G8XA 5CVJA 2IW5A 1OMIA 5DCMA 4BHPA 2BE5F 3FF5A 4Q48A 3I0TA 1ZH5A 5CJ9A 2IP2A 2GXGA 5FB2A 1UHWA 2M87A 2R7DA 3ZMSA 3LA3A 3S2WA 5E8IA 1TNTA 1O7FA 5L3GA 4EJTA 2LNBA 2XAGA 4OOIA 4Q5SF 3HSEA 1ON2A 4U7BA 2W84A 2DPUA 3TGNA 1E2XA 5ICFA 3V8JA 4CZZA 4KNYA 1ZG3A 2A3SA 5E17F 4BXUA 3DV8A 3QP5A 1XSVA 2MH9A 4KDPA 5IT9Z 4B09A 1RZ4A 3KCCA 4ASNA 1O3QA 1LB2A 3ERED 1XMAA 2D2WA 1R36A 5D5VB 3ZMTA 1U5TC 1ULYA 2ISZA 2DT5A 3K1NA 5JR3A 4MTDA 1YO5C 3TO6A 3W6JB 2OQRA 1XN7A 2UXNA 1IF1A 4OMYA 3FWEA 4HOBA 3ABTA 3IKVA 4FX4A 2ISYA 3I53A 2K7LA 1I5ZA 3L9FA 1BI0A 4RB1A 2QQBA 2FMYA 1FLIA 3V8LA 4L9VA 1G3YA 3GYHX 3J81K 2PMUA 5BMZA 2DFIA 3FM5A 1WRJA 3KLOA 2EFOA 4A5NA 4IPAA 5DCMB 1BM9A 4EJUA 3IRQA 4UUVA 3DP7A 4E70A 2M8EA 4RS8A 4CGZA 1Z1DA 4R1HA 1SMYF 2PN6A 1KU3A 3IHUA 1QBJA 4EJWA 1J5YA 2PQ8A 5D8KB 1R1VA 2EV6A 4LMYA 3T0YA 4GO1A 4HW0A 1B9NA 2KJBA 3SFZA 2L3DA 3P9KA 1LDDA 2GAUA 2PMHA 3WGIA 2GWRA 5K1YA 3NQOA 3N4MA 2F5FA 2XHKA 1TQIA 3RJPA 4YIFA 4HDVA 5BOXA 3HTUA 1U8RA 4XRFA 1QPMA 2QENA 2OZUA 3D5LA 4M9SA 1H0MA 1P4XA 2QQ9A 3ZQ7A 1B6AA 4WCGA 2RDPA 4M73A 2Y75A 1MDMA 2Q0OA 5EEGA 3DPTA 4HBLA 1NHAA 3MQ0A 1O3TA 2GXBA 1L3LA 2PEXA 4IRHA 1HXDA 2JRTA 3FMRA 1B9MA 1FNNA 2EFQA 5HLGA 1EH8A 3J81Z 4RB0A 2A68F 1FSEA 5LRRA 4M72A 4PZJA 4NHJA 1USSA 3FZVA 3RPQA 3V7CA 3LA2A 1I1GA 5F6FA 1ZREA 2XASA 4MGRA 2FU4A 2A61A 4NQWA 3M9AA 3FM3A 5H6QA 3HSRA 2IA1A 4JK1X 2DTRA 2ZNYA 5LGNA 2C6YA 4A0XA 4A0ZA 4I0BA 2FXAA 2OBPA 5HVQC 2Q2EA 1ZARA 4A6EA 5L3FA 2BBYA 1KQ8A 3GVAA 4EJVA 3SXYA 2JPBA 2IT0A 1IN6A 1TW2A 4HX8A 5JHUA 2O8XA 5E18F 3F8NA 2L4AA 1X3UA 3LAPA 5D4SA 1IAWA 2FNPA 1FPQA 3Q9VA 3R0JA 3R61A 5D6EA 2KIMA 2XKOA 3I5UA 2MLGA 4UVBA 1JHFA 4WWCA 5K5QA 5D4RA 3B02A 2PFBA 2JT1A 2OD5A 2Z9OA 3E6DA 5L3EA 3Q5FA 4A5MA 4HA8A 1MDMB 3T5XA 4CO8A 3GWZA 2P5LC 1Z6TA 3RKWA 3VEPA 4Q47A 5L3CA 1SD4A 3MZYA 3HRMA 2HYFA 3VODA 4L18B 3E97A 4YG2F 3IWZA 4U88A 2COMA 1V4RA 4PCQA 3BOQA 2DQRA 3F72A 1GXPA 3BZ6A 3JSOA 2Y48A 3BY6A 2H09A 1O3SA 5LGUA 2GA2A 4O6JA 3E6MA 1DUXC 3I71A 2EA2A 3H3UA 4EV0A 3T1BA 4MNUA 4GCVA 3FMQA 1UB9A 4EMSA 3BPVA 1K7AA 1S8NA 2P5KA 1JXSA 4Y13A 2CW0F 3F6VA 4GYIA 2QBYA 1KQ9A 2FNAA 2L54A 3WGGA 2A07F 1XCBA 2HDCA 3WU0A 5E1WA 1AWCA 1S3JA 3MAJA 2D1VA 1SD6A 4FX0A 2VBXA 1SD5A 5CLSA 2J5OA 1C0WA 3CUQC 3HOSA 3D0SA 3BPXA 3R4KA 4KIFA 2BEOA 2DU9A 1P6RA 3GX4X 2DQLA 4I7HA 2K02A 5FGMA 1O57A 3JTHA 1T39A 3JW4A 3RKYA 1SD7A 2CWEA 2FOKA 4P9FA 2VOOA 2R7FA 5ILVA 3KLNA 5ICGA 4ZYHA 3ZPLA 2PJPA 2QQAA 2HZTA 2G7UA 1ZYRF 1HQCA 4CDGA 2ETHA 3BROA 1PP8F 3RYPA 3MCZA 1D5VA 1KU2A 4IJAA 1CF7A 1ZRCA 3JAMZ 1QO0D 3WU1B 1OYYA 1BC7C 4LK1F 2MLKA 4WXCA 3WTZA 1Z9CA 3U1DA 2KKOA 1TQPA 1JHHA 3QU6A 1R7JA 3M8FA 4RB3C 5IT9K 4KIBA 5E20A 4ZYEA 2CQKA 2PI0A 3COAC 1YFHA 3PQJA 2P7CB 1CGPA 1XCVA 1MJBA 3DQVC 1KGSA 2W25A 4OINF 2VONA 3HYIA 2RQPA 1P4AA 3ZMVA 3I59B 4HZFA 4U0VA 1FC3A 4FHTA 4L0YB 2QBYB 2CYYA 3EUHA 1JE8A 1J75A 4KN7X 5DV5A 4P55A 3LQRA 1KA8A 4MTEA 2UZKA 1U3EM 4I98B 1O7LA 1IXRC 3G73A 3IKTA 4XSXF 2LF8A 1UFMA 2HTJA 1KYWA 4DNCA 3QPHA 2FRHA 1REPC 4Q4ZF 2KIFA 4L9TA 4LGWA 1QZYA 4ZYGA 3OOPA 5FFXA 1MKMA 5LRSA 1P2FA 5H20A 2MD5A 3KP2A 2P7VB 1OR7A 1T6SA 5DEQA 3ZN1A 4G7ZF 3DXJF 3WTUC 1XGOA 3GXOA 4HF1A 2MC3A 2TDXA 1K79A 2EFPA 1P92A 3L2CA 2O3FA 4B8XA 2NAZA 3V4GA 1XB4A 4L5JA 4ZZLA 2DO7A 2V9VA 3GEZA 1S6LA 2P6SA 2RVCA 3EETA 2BGCA 3GFLA 3RIRA 5HS8A 3PQKA 1CF7B 1TQMA 5E1XA 1Z6RA 5HOOA 3IRRA 1HSJA 2V79A 4CICA 2Y0MA 1LVAA 2K4BA 5HS7A 3BJ6A 3T8RA 2VN2A 4UXNA 4OMZA 3HIFA 4CHUA 1IN8A 2EK5A 2ESNA 3KP5A 3VB2A 3G3ZA 3WGHA 3P9IA 4O3MA 2CSOA 3I54A 2O03A 4N0BA 4HLYA 3JSPA 5DCFA 5A2QK 3SZTA 3DF8A 3GZ6A 2XV4S 2GA1A 1K78A 4MEXF 5LLQA 2M1BA 3HHHA 3L7WA 1S7OA 4YFNF 3RKXA 4KMFA 2IPQX 1JGSA 4BHBA 1RI7A 5H6RA 4M6XA 4PGHA 2QLZA 5D5UB 1YS6A 3FXQA 4RAZA 2STWA 1J9IA 2JSCA 4GXOA 4HV5A 4EQQA 1STZA 3CUQA 3KEQA 1PUEE 3GFMA 3DEUA 2HQRA 2IA0A 1L0OC 4AWXB 4ENJA 5BPDA 2LDUA 1WI9A 5F64A 5F1RA 2RV8A 3HUGA 3R0AA 2L02A 3GFJA 1D3YA 3E3VA 4U0YA 1OKRA 1IN7A 1R5HA 2M30A 3DFGA 2M45A 4AD9A 2XAJA 2XVCA 4IF4A 2P4WA 1TNSA 5CVRA 1H9GA 2CG4A 3J80Z 2QWWA 2VODA 2E7WA 3F6OA 2J5PA 1T38A 1PP7U 4ZH4F 5A2QZ 4LLGF 4O5VA 1RUNA 3F3XA 5D8LB 2NS0A 4QWQA 2HQNA 2A6HF 3CJNA 2RC4A 1LNWA 1K78B 2FE3A 1OPCA 1HKSA 2JTVA 4N9IA 3N97A 5DDGA 3KZYA 1P4WA 3WTTC 2X4HA 1Z91A 1A04A 4L5IA 5J8FA 4HDUA 3K1MA 1GHCA 5LEKA 1QGPA 2K27A 1XGSA 4LLNA 4U0WA 1KU9A 3SQNA 3TKYA 5HLIA 4BYYA 4XLPF 3F8CA 5ED4A 2VC0A 6PAXA 4KT5C 2DI3A 4TV7A 1HSTA 3O3KA 2P8TA 4PDKA 2DAOA 1UHMA 2WWYA 1ON1A 1HW5A 3C3WA 3WTSC 4WXDA 4ENKA 1ONVA 3P9CA 3GUDA 3FXRA 1FX7A 3P7NA 3TO9A 2QZ8A 2A5YB 2FEZA 4A6DA 3F21A 1HW2A 1YYVA 1XGMA 3K2ZA 2VXZA 3VFZA 3BJAA 4D0PA 5ERIA 1GXQA 2ZCWA 3HRSA 4EM0B 1W7PD 1FYLA 3ZMUA 5FO5A 4AIHA 2DBBA 2LSOA 2Z3YA 1W4MA 2H6CA 2LF7A 4KMUX 2IJLA 1YS7A 4RGXA 2ZMEA 3ZN0A 1U5TA 5ILUA 2KIUA 2Z5UA 3DPLC 2L01A 2FBKA 3JAMK 3CLOA 2HWVA 2V6CA 5HS9A 1MZBA 1S29A 5K5RA 3MZHA 1LEBA 4OIOF 2MBFA 5K5OA 3L00A 1BOAA 5LHHA 2CO5A 4MHGA 2D45A 4EVIA 2RNJA 1S7AA 1IXSB 3WE3A 1WSUA 5CVIA
chains in the Genus database with same CATH superfamily
4BDYA 1ZGJA 3CCYA 4RA2A 2JUGA 2ZKZA 2FMLA 1VQ6I 2Q8KA 3CDIA 4A3CJ 3I58A 4XKWA 2G9WA 2X9DA 1XC5A 3OWTA 4DIQA 4XRMA 4UUSB 1U9OA 2QF7A 4UV9A 4U7DA 3F0CA 2MFZA 5FFZA 4DW6A 1XD7A 4L0ZB 1ZLKA 3HPHA 2X6WA 5KAIC 1UG0A 4QPQA 2K4JA 2IGMA 3WG9A 3S3MA 1K61A 3DWLE 3OYAA 2E7XA 3BCAA 4ITVA 4Y17A 4A3KJ 2IRFG 5GAGJ 3WG7H 3K4LA 4A3BJ 2KQRA 3JTGA 1U2WA 1NH3A 2JJ7A 2H8RA 1UAAA 2WY7Q 4KUMA 1D8JA 2HGCA 4A3DJ 2Z16A 2XPVA 1IXCA 2DK8A 5K7HA 3AFHA 4YIIA 4G9YA 4P96A 1IUYA 1A6QA 2KLOA 1B8IB 3ABUA 2ADUA 1AOYA 3PJRA 3HGYA 5LBQA 1T33A 2V7FA 2GZWA 2OU2A 4HPQA 5FKLA 2XRNA 2LKPA 3RPUD 3M1CA 2E2IJ 4WK8F 1FTTA 3QPTA 5F0FA 3D5SC 5DD4A 1W5CC 2WV0A 2WV1A 3SFIA 3I4PA 3OIPA 4IHTA 4AIJA 1R58A 2ZC2A 3CUOA 1RNLA 5DUKA 5EGOA 1JJ6C 5M5WJ 4ANJA 3O2PE 3HSFA 2DJNA 5FJ8J 3FDYA 4RMNA 1FOKA 2R4GA 4LITA 2FD5A 4AYBA 2NVYJ 4ZDLA 3CMAI 4NC8A 3HOWJ 5E8GA 4A2UA 2R0QC 5AIQA 1PUFA 3JRAA 1RIOH 4L9JA 2M3AA 2ZMEB 3JRBA 5J6XA 4OIPF 5TRDA 1U5TB 3DKWA 4ETSA 4CA0A 5E1ZB 4Z6YA 1YJNI 1BI2A 1B72A 1MBGA 3S1MJ 1NK2P 4LJZF 1VF9A 2DLLA 5B66C 1QQIA 3RYRA 4RGUA 2E1OA 2AS5F 1MBFA 2R7QA 3V7SA 3HJEA 3WTVC 2DW4A 1YIOA 3F8MA 3FK6A 3R60A 2DA3A 2BOLA 2HR3A 4XONA 3F23A 2QA4I 1QU3A 4A3JJ 4YRVA 3BR6A 4I99C 5FKNA 1TWCJ 2ZNZA 1IDYA 1BIAA 2BHZA 1MIJA 1ZG1A 1K6OA 1OCTC 2WA0A 2STTA 2V1UA 4HAMA 4XLNF 4PJJA 2UXXA 1XGNA 3DBRB 2ID3A 2Y0SA 4K2EA 5M5YJ 5BQTA 5J8CA 3LSRA 2DA4A 2P6TA 3GTKJ 5L3DA 2QQ8A 1EV7A 1R5GA 3PO3J 3B73A 2EIJH 4M3BA 2Z1DA 2YSRA 4PJMA 2ZJPF 1FYMA 4I02A 3TEDA 2W24A 4BY7J 2KJCA 3NWSA 4H0EA 2FF4A 2R7WA 1UMQA 4G7HF 3OSFA 3LA7A 1XDSA 4UVAA 3C2BA 1JKQC 4BQOA 1P7IA 4DYQA 2GBYA 4HQEA 2H8WA 2A05A 5FLXK 4HV6A 4HF0A 1USTA 4B3AA 2E5NA 1LDJA 5GAEJ 2DFFA 3OL4A 4G6QA 2K9LA 4XKCA 3HKZN 4LIUA 2W85A 3FISA 3WTYC 3PFYA 1LJ9A 2L7ZA 3F8FA 3M3YJ 1DPRA 4EGZA 3VSKA 4J01A 1B59A 1N77A 1F9NA 5FLMJ 3TDUC 1FP1D 1LEAA 2D1HA 3RTRA 4M3FA 4M3GA 3VDXA 1IRGA 4MLOA 2MC4A 2NRAC 5LEJA 3KIOA 2P5VA 2XB5A 4AVZA 1T0FC 1FT9A 2R3SA 1F5TA 3FKIJ 3OV8A 2YPRA 3ECOA 4KITB 3VYSB 3VOEA 1DP3A 3DCFA 4G7OF 4PGGA 2L9NA 2CV2A 2XROA 1BC8C 3OS2A 2AXLA 4IRGA 3S17J 1T98A 3AL0C 2F2EA 3WTWC 1ZRFA 1GUUA 3K4BA 1Z21A 2BXYA 4C3JJ 5H2FC 2ELKA 3KPHA 2ZXJA 3OYHA 2K9NA 2W57A 1BI3A 4BAYA 2IS4A 1T95A 1D8KA 3C7JA 4BE1A 1IUFA 4UHTA 4HYEA 1SMTA 2QUFA 2V4JC 5CVVA 4ABZA 2Z99A 1FJLA 1RC9A 4PJ0C 1Q1HA 3OYIA 3CLQA 1IZ1A 1PUFB 1OCPA 4A0YA 5HDNA 1TTYA 1ZGAA 2YU9J 3PFIA 4HLXA 1TLHB 3JRHA 2OQGA 1FBQA 1F1ZA 2VKVA 1FP2A 1S5LC 3TBIA 1B72B 3W6VA 4GDFA 2QYOA 4FASD 3NEUA 4M9ZA 3ZCOA 3HRUA 2CQQA 1I3QJ 1YQAA 3CP2A 1A36A 1PVEA 2CW8A 1TBXA 4RLFA 3ISPA 1SANA 1LFUP 2M4KA 1ZR4A 2KZVA 2MA3A 4HQMA 4BE2A 3OYMA 4XBFA 2VBWA 5JVGF 1E3OC 3LSJA 4PUSA 1FSHA 3J80K 5E3MA 3TOBA 2O0YA 2QGUA 2X0LA 3QP6A 1HBXG 5KK1A 3HRTA 2HVRA 2Y69H 2ZXIA 3J7YJ 2EFNA 3FHNA 2VBZA 4ZTFA 3IWFA 4N9HA 2HS5A 2V1XA 3HDDA 4BJ5C 1ZELA 2L7FP 2IEKA 3ZQQA 4ESJA 2UWMA 1LUJB 4MO7A 5M5XJ 1IRXA 1W7PA 3CDHA 5FLXZ 3BG5A 5FD5A 1R5ID 4XSZF 1UHSA 4ZZDA 1ITYA 2AQFA 3A4CA 3GO5A 2MYSA 3KEOA 2K9MA 3FXOA 4UB6C 1QNTA 4P9UA 1SAXA 2E35A 2M5WA 1S7EA 2DFHA 4KIGA 2VE8A 4RB2C 3QYBA 4M71A 4N4NB 1A5JA 5HDKA 4WXHA 2X51A 1UG2A 1Y1WJ 2W82A 5DYMA 2IVMA 3W6KB 3HXLA 3TW6A 1G4DA 5M3MJ 1HW1A 4G6DA 3UR3C 4XKBA 1ETOA 3QOPA 1XDUA 2OA4A 3OR2C 2ZJQF 1Y39A 2RN7A 4F52A 3H5NA 2IS1A 4C9YA 5J4YA 2EZIA 1JUMA 3KP6A 2L4MA 4A3LJ 1XMXA 4R8HA 4IO9F 1IRFA 3B6CA 2HEOA 3K0LA 1EJ9A 2RAEA 4BQQA 2DOFA 3HOZJ 5JI6A 1BBYA 3TOAA 3WU2C 2PLYA 1LQ1A 3E5QA 3SEZA 2X85A 1BIBA 4ON0A 1H9TA 1DPUA 3IH2A 2YR2A 3CMYA 1KZHA 1I6XA 3FMSA 3HBLA 2IA2A 2Z2SB 4BU2A 1FYKA 2JVHA 3E0JB 3RI4A 3K2AA 1FOYA 2XAQA 4IXAA 5BS6A 2FBHA 3JRIA 4AUXA 3NRVA 2PG4A 2B0LA 1LE8A 3IAM2 2GOMA 2BHYA 1SFUA 1F43A 1JKOC 1R6RA 4HX4A 3BP8A 5D5WB 2VT3A 1JGGA 2LOOA 2L9RA 1ZHFA 2Y2ZA 3KZIC 4GGGA 3ROUA 4S05A 1YTYA 2GIVA 4JX5A 4LG3A 1HKQA 1OYWA 3GZ5A 3SZGA 5C44J 1ZN2A 2E60A 2HXIA 2KRFA 1A35A 2ZB9A 4UNOA 2R7SA 5L3BA 3GF2A 4RAYA 5LHIA 3JCUC 4HNVA 3BR5A 3WODF 3KP4A 1MBJA 3NWTA 3QPSA 3QRFF 4R79A 5HODA 4V2GA 3E6CC 2WTEA 4IOCF 3ML6A 1Z05A 2XUBA 1MMAA 3AKZA 1YW9A 3H5RA 2KL4A 3K7AJ 3VYUB 4D7MA 1B4AA 2CFXA 5DD8A 3OYNA 4KISA 2VOPA 1R4NB 3LSGA 2V1DA 1DU0A 4EM2A 2E1CA 3PNVA 3LNQA 1MSEC 3K1PA 5KVRA 2ECBA 1FMVA 2VQHA 2XGDA 3RPUA 2NS8A 3BTIA 1BN5A 2F5DA 3SZPA 2OZ6A 3C1DA 2R7RA 4B48A 2O9LA 4M6VA 3E1SA 4L9NA 5FROA 3JRGA 2H94A 2WAQN 2P81A 3L2VA 1I27A 1W7PB 5FRMA 1WJCA 4BNCA 4IHVA 1R1UA 3RDIA 4BXXJ 3HOUJ 3FX3A 5IY5H 2JSPA 2QCOA 2YX7A 1OLTA 2EZKA 3AAFA 5JLWA 1Y6IA 3LFKA 4KICA 4LG0A 1J0RA 3QU3A 2HTSA 2M34A 4FQGA 1SAUA 3EYYA 3H3VK 2KT0A 3ELKA 3REOA 5E3OA 4WF2A 2R7UA 3ESWB 1G3SA 3S2DJ 5FD6A 4M74A 3FXUA 4JBAA 2KMUA 2NNNA 2Y31A 2R7XA 2VC1A 1I6HJ 2M9HA 3U9GA 2G7HA 1W36C 3BG7A 1VQ7I 4NB5A 2DPDA 4CYCB 1WH5A 4ZJZA 4I2OA 3DU5A 1ORKA 1NG7A 3SDGA 2EA4A 3D1NI 4GFBA 3KP7A 1DP7P 3LAJA 1W0UA 1PJRA 1FWZA 1V55H 3ULQB 1F36A 2NYXA 2QSFX 3OYFA 1WJ5A 3EDPA 2X6YA 1FY7A 1U78A 2NVQJ 2VBYA 2O61A 4BHCA 3CUQB 1DDNA 1FBUA 3I4NJ 2FQ3A 3Q9SA 3H3ZA 4Z2YA 3HL2A 2OCCH 3BG3A 4HEA2 1TWHJ 3LSHA 3E6BA 3K70D 1JT6A 1YITI 2F5EA 1GVJA 4CXFA 2HOSA 1GT0C 5F04A 1YE9A 1VFCA 3W3CA 4RBOA 3GW2A 3GFIA 1K4TA 4JYKA 2ACJA 1S9HA 4JQFA 3HUGB 1T0FA 1WWXA 1KYZA 2HFHA 2L2OA 4S04A 3O6BB 3TO7A 4KYWA 2X1DA 4BBSJ 2L9VA 1LE8B 5ICCA 1FIPA 5AIPA 5BNGA 2EWNA 1ZRDA 4ZTJA 2DN0A 1J7KA 1R22A 1CQTA 1XS9A 1U9NA 3HM5A 3MMYB 4I0AA 5LGTA 1G3WA 3H9GA 4V19K 2KISA 1J2XA 2HYGD 2CW7A 1W5SA 3GLXA 3AG3H 2EV0A 1LVKA 3ZMZA 4HF2A 2LFBA 4IQJA 4LK0F 5EDNA 3M7GA 2ID6A 5TJJA 3VPRA 5D5XB 1I3AA 3L2UA 4KA4A 3MEXA 3H35A 2DA5A 4JOMA 1EH6A 4Y15A 3WTXC 2GQQA 1IN4A 2FBIA 2ZJ2A 1GLNA 1V5FA 2Y30A 4QLCU 1ETQA 4ENMA 1R00A 2NS7A 3EQLF 1ZGWA 4CYDA 3K9TA 4E7JA 1T2KA 4M6YA 3DBLB 3L09A 3PNTA 2CGPA 1IDZA 1GVDA 2R7ZJ 4ESBA 2XC7A 3AG4H 3MKWB 2B9SA 4BQAA 1T56A 3SHFA 4NNJA 3BZCA 4EJOA 1LFBA 2ESHA 4II3A 2EBIA 4CCOA 1ACIA 1HLVA 1UCRA 4F7ZA 1RKTA 2QKLB 3K69A 3I55I 2OTJI 1T08B 4Y33A 1R1TA 1MJAA 3LSMA 1TC3C 5ILSA 5LFAA 3HTSB 3K10A 4EGYA 1VTNC 2GOXB 3CDLA 4OWRB 4AVPA 4AIKA 1BI1A 3CO6C 5J3LA 3OL3A 2EFWA 4F3QA 5EF6A 2E1NA 1WJFA 2NOJB 4BEHB 4FISA 1Y8RB 1YRNA 4ESFA 1LFPA 5HLHA 1KQ0A 1MSFC 3RQIA 5LHGA 3KYDB 2HNHA 3OYGA 2BYVE 2FSWA 5IP9J 2H27A 2DXIA 4LG0B 4UB8C 1BR2A 2R5ZA 1YLFA 3ZQCA 3MKYB 5IP7J 4IHSA 1Y0UA 5HDGA 1BW5A 3FXLA 3J7AO 3QODA 1VQ8I 3GTLJ 4IVNA 1BW6A 3U2RA 2JQ7A 4NDLA 1ODDA 1MBKA 2HKXA 4I01A 3MFKA 2VASA 1PDNC 1F4KA 1U6GA 1XMKA 4PJNA 2K86A 3PSFA 3M1EA 5AONA 1MD0A 3KZZA 2EIMH 2LY2A 4OU0A 3SDBA 3KP3A 2HOEA 1X2MA 2DK5A 4P5OA 2ZFWA 3QAHA 1R71A 1MNDA 1X1BA 5EG0A 3LOCA 2JA2A 3H5AA 4QSHA 3U1KA 2CU7A 1O3RA 4I09A 3FIWA 4V2FA 4LB6B 2LY9A 3F22A 3CCSI 2QVOA 4CCNA 2RKHA 4FE7A 2BVMA 4DQ2A 1LDKB 1AKHA 4OIQF 5CVUA 3LSTA 5J1UA 3HC7A 2ZO4A 4YFXF 1ZR2A 3ZP5A 2IGKA 3RKQA 4LB5A 3IC7A 1WKMA 1IW7F 1VQKI 3V8KA 3FBIB 2A69F 2AXTC 1E17A 2WAEA 5FKKA 3BJOA 1VNDA 2JPCA 3I9V2 3I59A 1JI8A 2VT2A 2V9KA 2K9QA 5IT3A 2DA1A 5CYVA 1KU7A 1IV8A 3WE2A 4HNTA 1ZG5A 1EH7A 1OYIA 5EEHA 2EZLA 1XTAA 1TW3A 4XRSA 3HOTA 4KFCA 2RGVA 4FT8A 5FRNA 2PBIA 1QZZA 1B1BA 4YEJA 1Z67A 2BV6A 2MH2A 1RUOA 1ZKGA 4E7SA 3L2RA 1XX5A 2JZYA 5F0CA 2DYRH 2GIZA 3CMEI 2XIGA 1YW7A 1HKTA 2CMPA 3BLYA 2XAHA 3CTAA 3LQQA 1XSDA 3I3LA 2OF7A 4I6ZA 3W2AA 4A12A 2HXOA 1FBSA 1SFXA 4ZYDA 4EM1A 2R5YB 3CESA 3BWGA 2QSHX 2WC2A 5IYDJ 3OSGA 2KIQA 3E5UA 1I1SA 3TQNA 2DA7A 2Z33A 2HI3A 1AU7A 4IOAF 4QTRA 1MBEA 1MJ9A 1MW7A 2HU9A 2LBFB 5BPIA 4OIRF 3ECHA 4BH9A 2R92J 2KPMA 2A6EF 5EJCA 4LLLA 2ZXHA 4WX9A 3CF2A 3L2QA 5IP6A 1G3TA 4LFUA 1ENHA 2M0MA 5J1YA 1VQMI 3BZKA 3G1OA 5ICEA 4XLEA 2O6GE 5DTDA 1DQUA 4MQVA 3A01B 4BJTA 2R7OA 4HSTA 1MNEA 3CO7C 1SVLA 2YX4A 3CCEI 4ENNA 4MQ9F 5JVTA 1OCRH 1ZAOA 3H92A 2OPTA 2VE9A 1Z3XA 4PK4A 2LK2A 1YG2A 2MD0A 1WQ2A 4CCKA 3KETA 4UVCA 1VQ9I 2WB1A 1YW8A 2EB7A 3LSIA 3OYDA 2B7EA 3R6SA 4PFOA 4F92B 5DUIA 3EYIA 1J59A 2CUFA 2OAZA 5IOZA 1BJAA 3GZNB 3DKYA 2FA5A 4XM3A 3FHZA 3K4CA 3RZDJ 3IL2A 4LD5A 4QIWN 3K4NA 3V7RA 2ELHA 1ZLJA 2CFOA 1LKXA 3OS0A 4NC6A 3BC8A 2XAFA 2ZBKA 3ZMDA 3T8TA 4YFKF 3CCMI 2NNYA 5EG0B 5IYCJ 2LVSA 4GYGA 3SJMA 4G94A 4A3FJ 4RM3A 3HOVJ 1V3FA 2QM3A 3PIPF 3TW7A 2UV1A 2DOEA 2EJRA 2DMNA 2VJJA 4RGSA 2HKOA 3HHGA 4YELA 4RGRA 2KHMA 4BQNA 1XSXA 3LWFA 1MGTA 2H6BA 3CCQI 2YU3A 3M8EA 1SFEA 3B6AA 1SC7A 2OJED 2EV5A 4BE0A 2VJ5A 3ASOH 4MEYF 3KFWX 1WZ2A 1W5TA 3OYJA 1G6NA 1VQOI 1FZPB 1IV6A 5E79C 3KE2A 1G2HA 4XMYA 1R49A 1ZTRA 4FE4A 4RAFA 2XKPA 4UV8A 3ZQLA 4IRIA 3I64A 4M9XA 1X4OA 1JUSA 2F5CA 3MWMA 3Q3SA 1R23A 1GDTA 5D6FA 2JA6J 5JFRA 1X58A 3F8BA 3BDDA 1IN5A 3TDZC 5KAFC 1Q1VA 1RKWA 3C18A 3FXKA 2XGXA 4KN4X 3E5XA 2HYJA 1Z7UA 4HX7A 2VJ4A 4G8XA 5CVJA 3I4MJ 2F4IA 4X6AJ 2IW5A 2BY3A 1OMIA 1X1AA 4E7ZA 5DCMA 4BHPA 2BE5F 2JK3A 3FF5A 4Q48A 1R9TJ 5J47A 1D0ZA 4PSWA 1WFXA 3I0TA 1QHGA 1BR4A 1ZH5A 4XKVA 2E19A 5EGOB 5CJ9A 2ME0A 2HQ5A 2IP2A 2GXGA 5FB2A 3S2HJ 1UHWA 2M87A 2R7DA 4XOTA 1RESA 3S14J 3SEQA 3ZMSA 3LA3A 4XLAA 3S2WA 3D5RC 4F55A 5E8IA 1TNTA 1O7FA 5L3GA 4EJTA 4DZPA 2LNBA 2XAGA 3IAS2 4OOIA 1D5YA 4Q5SF 3KX2A 1R4MB 4B1RA 3HSEA 1QPIA 1ON2A 4KT6A 1ETKA 1GV5A 3FXMA 4U7BA 2W84A 2HDDA 4J19A 2DPUA 3TGNA 3DU6A 1E2XA 5ICFA 1JJ8C 2CRGA 3V8JA 1DGRM 4CZZA 4KNYA 4XORA 1ZG3A 2A3SA 4E4HA 5E17F 3BR0A 4BXUA 2DDBA 3DV8A 3EPZA 3A02A 3DKXA 2DJIA 2ZSHB 1K6YA 3QP5A 3H1CA 3KYCB 1XSVA 2MH9A 2XF7A 3ZQGA 4DYCA 1XPXA 4KDPA 4JX6A 3OIOA 3PM1A 5IT9Z 2DA6A 3KYLA 4B09A 1RZ4A 3KCCA 4ASNA 2VPRA 1O3QA 1LB2A 2OUMA 4W1UA 4A93J 3BTJA 3BG9A 3ERED 5F1JA 1Y1VJ 1SVOA 4IHWA 1XMAA 2D2WA 2JA7J 1R36A 5D5VB 2RREA 2NOGA 1VQ5I 2ZMEC 3ZMTA 1U5TC 1BOBA 1ULYA 2ISZA 3ZRGA 5J1RA 2DT5A 3IP4B 3K1NA 5JR3A 4MTDA 4KJZA 1QVUA 3TP3A 2CQ7A 1YO5C 5B5EC 3HB9A 2N8GA 2BZTA 2XSJC 3S3OA 3TO6A 3W6JB 2OQRA 1XN7A 2UXNA 1IF1A 4BKXA 4OMYA 3FWEA 5JHFA 4HOBA 1HA8A 2FJ1A 3ABTA 3IKVA 4FX4A 5J4VA 2L0KA 2ISYA 3I53A 2K7LA 1I5ZA 3L9FA 2I10A 3CJRB 3VYRB 1BI0A 3GTJJ 4RB1A 1H8AC 1FMWA 2QQBA 2FMYA 3HOYJ 1FLIA 3V8LA 4G12A 1MMGA 1G3YA 2BW3A 4L9VA 3GYHX 2WADA 4AYBN 3J81K 1VQ4I 3ZQHA 2LRDA 2KFDA 2PMUA 5BMZA 2DFIA 3FM5A 4UUTA 1WRJA 2KP6A 2JN6A 3KLOA 2EFOA 3NARA 4A5NA 1BJZA 4IPAA 4HSRA 3S15J 2A6TA 5DCMB 4A69C 1BM9A 4H4KC 1KONA 4EJUA 2H1KA 3IRQA 3G1LA 4UUVA 3DP7A 4E70A 2M8EA 1GV2A 4RS8A 4XOPA 4CGZA 2IBDA 2AQEA 5B1AH 1Z1DA 2WAFA 3BT9A 5GTIC 4R1HA 4DOZA 1SMYF 4PJLA 1MH3A 2PN6A 1KU3A 3IHUA 3JR9A 1QBJA 4D9JA 5TISC 4IHXA 4EJWA 5C4XJ 1J5YA 2PQ8A 5D8KB 3MVPA 1R1VA 1OISA 2Y0SN 1YHQI 2X1CA 4B44A 3HG9A 2GLOA 4EATA 2VXDA 2EV6A 4LMYA 5E3LA 2JUCA 3T0YA 2F4OB 4GO1A 3CCUI 2DA2A 1I39A 2LLKA 1HC8A 3FBNB 2VPLA 4DZJA 3C2GA 5F08A 2CQXA 4RM2A 4HW0A 1TL8A 1B9NA 2KJBA 3SFZA 2L3DA 1W36D 2OCEA 3P9KA 4C3HJ 1LDDA 2Q1ZB 2EINH 2GAUA 4XR6A 2PMHA 3WGIA 2GWRA 2LP0A 4XLHA 3IH3A 5K1YA 2W1OA 4AM3A 2K3FA 3NQOA 3N4MA 1Y8QB 3S8PA 1IRZA 2E36A 1Z0XA 2F5FA 2NVTJ 2XHKA 1TQIA 4Y4RA 3RJPA 4YIFA 4HDVA 3GTGJ 5BOXA 2O5RA 3HTUA 1U8RA 3HZJA 4XRFA 1QPMA 2CS3A 2DFEA 2QENA 1EF4A 1Z3YA 2OZUA 1OCOH 3D5LA 1X4PA 4M9SA 1RPWA 1H0MA 3K4KA 1JTYA 1P4XA 3I56I 2OTLI 2QQ9A 3ZQ7A 3K6GA 1B6AA 2XB0X 4WCGA 2RDPA 4M73A 2Y75A 1MDMA 2B63J 3W2VA 2Q0OA 1MBHA 1OFCX 5F27A 5EEGA 3CJTB 1WI3A 2NVXJ 3DPTA 3QPLA 2QSGX 4HBLA 1NHAA 3MQ0A 1O3TA 3CCRI 2GXBA 1L3LA 3X2QH 3S93A 2PX9A 2XGEA 3EUKL 2PEXA 4IRHA 1HXDA 3RCOA 3BTCA 2JRTA 3FMRA 1B9MA 2VJIA 1O4XA 1FNNA 2M2EA 1N25A 2EFQA 5HLGA 1EH8A 1DGWY 3J81Z 4RB0A 2A68F 3FXJA 3M07A 1FSEA 5LRRA 2EPFA 4M72A 4MFDA 4PZJA 4NHJA 2FUG2 1USSA 2FQ4A 1E3PA 3OYKA 4AC0A 2LD5A 3FZVA 3RPQA 3V7CA 3LA2A 2JWTA 1I1GA 5JLXA 3HEFA 5F6FA 3O8HA 4Y52J 2I5UA 1ZREA 2XASA 4MGRA 3EUHC 2PMZA 4IZZA 1MNMC 2FU4A 2VL8A 3S3NA 2A61A 4NQWA 5CQGA 3M9AA 1WHUA 3FM3A 1AA7A 2IS6A 5H6QA 3HSRA 1X19A 2BY2A 2IA1A 4JK1X 2DTRA 2VI6A 2ZNYA 1TWFJ 3TL4X 5LGNA 3OYLA 2C6YA 4A0XA 4A0ZA 4UUSA 2W00A 4I0BA 2JMWA 2FXAA 3ZOBA 3A0HC 2OBPA 5HVQC 1H89C 2GXAA 2Q2EA 3QOEA 1ZARA 4A6EA 4BL0B 3AG1H 3OYEA 2CH0A 3BCBA 5L3FA 2BBYA 5GP9A 1D1CA 1KQ8A 5B3SH 2R7TA 4D5CA 3GVAA 2DT7B 1DU6A 2DMPA 4EJVA 3SXYA 2GM4A 2JPBA 1TWAJ 2IT0A 2LTPA 2X48A 1IN6A 1TW2A 2IGOA 2ZXWH 4HX8A 5JHUA 1VQPI 2O8XA 2DDAA 2BVLA 2XF6A 3F8NA 5E18F 1OR7C 2L4AA 1X3UA 4RAGA 3LAPA 5D4SA 1IAWA 2FNPA 2EQRA 1FPQA 3Q9VA 3R0JA 4NUBA 3PUFA 3OIQA 4B47A 3BR2A 3R61A 5D6EA 3G2BA 5IOYA 2KIMA 2XKOA 3I5UA 3G4SI 2MLGA 4UVBA 1JHFA 4WWCA 2MABA 2YS9A 5K5QA 5D4RA 2VQCA 4I76A 3B02A 4CZCA 2PFBA 2JT1A 4JP0A 3LFUA 2OD5A 2R7VA 2Z9OA 3E6DA 5L3EA 3Q5FA 1WPKA 4DGWB 2HDWA 4UY8I 2G0EA 4A5MA 2D5VA 2E2HJ 4HA8A 1MDMB 3O8GA 5IYBJ 1T8IA 3ZGKA 3T5XA 4XLCA 4CO8A 3GWZA 3DEEA 2P5LC 4BY1J 2DODA 1Z6TA 3RKWA 1RR8C 3MZ8A 3GTOJ 3VEPA 4E7IA 4Q47A 5L3CA 1SD4A 3MZYA 3HRMA 2F5VA 2HYFA 3VODA 4L18B 3E97A 3UNGC 1D1AA 4YG2F 3IWZA 4YIRX 4U88A 3FKJA 2VQLA 1YX3A 1E0EA 2COMA 1K83J 1V4RA 1U0JA 4PCQA 3BOQA 2DQRA 3F72A 1GXPA 1Z77A 3BZ6A 5IPAA 3JSOA 3OYCA 1N78A 5B1BH 2Y48A 4BJ6C 1JKPC 4D5FA 4XL9A 3BY6A 2LY1A 2H09A 1O3SA 1HDDC 5LGUA 2GA2A 3PIOF 4O6JA 3E6MA 3GMEA 3FK7A 2X1EA 1DUXC 4F93B 3I71A 2EA2A 3QYFA 3H3UA 4EV0A 3DPUA 3GLLA 3T1BA 4MNUA 4NQWB 1OJLA 4GCVA 4X0GA 3FMQA 1UB9A 4EMSA 5E3NA 4MIMA 3BPVA 1K7AA 1S8NA 2P5KA 1JXSA 4Y13A 3L2WA 2CW0F 1D0YA 3F6VA 4GYIA 2QBYA 3VWBA 2F6CA 1OCCH 2Q2EB 2LKSA 3HGGA 3AL0B 1KQ9A 2FNAA 4QPOA 4RLQA 2V1NA 2L54A 4BS9A 4IL6C 3G1MA 3WGGA 3Q0UA 5C3EJ 2VKHA 2L9SA 2A07F 1XCBA 1S72I 2HDCA 3WU0A 1RETA 5E1WA 1YIJI 1X3ZB 1AWCA 3ASNH 1S3JA 5FLVA 1V5EA 3MAJA 2D1VA 1SD6A 2X6XA 3PSIA 4FX0A 2VBXA 1SD5A 5CLSA 2J5OA 1C0WA 3VYTB 2F48A 3CUQC 3HOSA 2XSDC 3D0SA 2DMTA 3BPXA 3R4KA 4KIFA 2BEOA 2DU9A 1P6RA 1FOWA 3GX4X 1AHDP 5CQEA 2KZGA 2DQLA 2K85A 4I7HA 3MN2A 1TZLA 2KDOA 5C4JJ 2K02A 3ZQFA 5FGMA 4IQ4A 2HVQA 1VQLI 1O57A 3JTHA 3HOXJ 3JW4A 3RKYA 1T39A 3GBGA 1SD7A 2CWEA 1HDPA 2V6EA 4FETA 2FOKA 4P9FA 2KRCA 2VOOA 2R7FA 2XPUA 3KLNA 1FIAA 4X1EA 4ZYHA 5ICGA 5ILVA 3G71I 2HPMA 2W48A 3ZPLA 3RQ4A 2PJPA 2QQAA 2HZTA 1YRNB 2G7UA 1ZYRF 3PO2J 2CUEA 1HQCA 4CDGA 2ETHA 3BROA 5GADJ 1V54H 2DMQA 4E7KA 1PP8F 3WHCA 2V9PA 3QYEA 3RYPA 5KCMA 2LG4A 2R5ZB 3MCZA 1D5VA 5DM6F 1NTCA 1KU2A 1Y56A 4IJAA 2CUJA 3OOUA 2PMZN 1CF7A 3OR1C 1LPQA 1ZRCA 3JAMZ 3W2WA 2JA8J 4E7HA 1QO0D 1RRJA 2ELJA 3BR1A 3WU1B 1OYYA 2F4MB 4NC7A 4LK1F 2MLKA 1BC7C 4WXCA 1ZK8A 3WTZA 1Z9CA 3U1DA 2KKOA 1TQPA 1JHHA 4HNUA 3CMMA 3QU6A 1R7JA 3M8FA 4L5EA 4RB3C 5IT9K 3RSNA 1JTXA 3CC7I 4KIBA 1SEUA 5E20A 4ZYEA 2CQKA 1JKRC 2KDZA 3COAC 2PI0A 2HQAA 1AKHB 1YFHA 3PQJA 2K40A 2P7CB 1CGPA 1XCVA 2XAUA 4D7NA 1MJBA 3DQVC 1KGSA 1OQYA 2W25A 4OINF 1WJDA 5J40A 1VQNI 2VONA 2M8GX 3HYIA 2RQPA 3OY9A 4DJAA 3G6EI 1P4AA 2E1MC 2HOAA 1FTZA 2HPIA 3ZMVA 4RDUA 3I59B 4HZFA 4U0VA 1FC3A 2BY0A 3LMMA 4FHTA 1Z7LA 4L0YB 3S1NJ 2QBYB 2DMUA 1FOXA 2CYYA 3EUHA 2CV1A 1JE8A 1J75A 4KN7X 5DV5A 3BTLA 4P55A 1SFOJ 3LQRA 3JRCA 1KA8A 2MGQA 4MTEA 5KNLA 4M3EA 4U87A 2UZKA 1U3EM 4I98B 1O7LA 5GPCA 1P7JA 2MG4A 3JRDA 3H9QA 2COBA 1IXRC 3G73A 3IKTA 2AHQA 2E5ZA 4XSXF 2VUMJ 2LF8A 1UFMA 2HTJA 1KYWA 1SFKA 2LREA 4DNCA 3K4JA 3QPHA 1EKEA 2FRHA 3BG6A 1MH4A 4W97A 4A3IJ 5EZHA 5FKMA 1REPC 4Q4ZF 4A3MJ 2KIFA 4L9TA 3WHBA 1H88C 4LGWA 4II2A 4ZC3A 1QZYA 2WAQA 4ZYGA 1HOMA 3OOPA 4D1QA 5FFXA 1MKMA 5LRSA 2XRLA 1P2FA 5H20A 2CV0A 2MD5A 3KP2A 3JRFA 2P7VB 1OR7A 3H36A 1T6SA 3LSKA 5DEQA 4B43A 1YJ9I 3ZN1A 4G7ZF 3DXJF 1QRYA 3WTUC 1XGOA 3GXOA 2ZJRF 4HF1A 3UKGA 2DYSH 1ETVA 4DYRA 1UJ8A 2MC3A 3ABLH 2IAIA 4E7LA 3J7AY 2TDXA 1K79A 2EFPA 1ETWA 1P92A 1SVMA 3GCMA 3L2CA 4C3IJ 2O3FA 2KRHA 4B8XA 1OCZH 2NAZA 2TCTA 2UUZA 3DLAA 3CQZJ 4XQFA 3V4GA 1XB4A 4L5JA 4ZZLA 4XRSG 2DO7A 3EUAA 2V9VA 3CF5F 3GEZA 1K4SA 1M1EB 1S6LA 2P6SA 3CJQB 1IC8A 1HF0A 2RVCA 3EETA 2BGCA 3GFLA 3RIRA 5HS8A 3PQKA 1CF7B 1TQMA 1X1PA 2ZFUA 1D1BA 5E1XA 5GTHC 4FCYA 5HNHA 1Z6RA 3C2HA 3LL7A 4XIDA 2DCEA 2L7KA 5HOOA 3CCJI 2E2JJ 3H9JA 2LH9A 3IRRA 3DEWA 1BA5A 1RR7A 4DBQA 1POGA 3ONQA 1HSJA 5FKOA 3LSPA 3S16J 2V79A 4CICA 4CCMA 5CKTA 3S1QJ 1TT0A 2Y0MA 3A03A 5K7ZA 1LVAA 2K4BA 5HS7A 4EEFG 4XN0A 4BBRJ 2O8KA 2CJJA 3CC2I 3BJ6A 3KEYA 3T8RA 2VN2A 4UXNA 4OMZA 2JRMA 3HIFA 2HZDA 5EZGA 4CHUA 1IN8A 2EK5A 2ESNA 1YJWI 3BQYA 3M8JA 1UELB 3KP5A 3VB2A 3G3ZA 3SYTA 3PL8A 5LD2C 4BXFA 2M0CA 3WGHA 3N05A 3P9IA 2EH3A 2FOWA 1WJAA 4O3MA 2CSOA 3I54A 1X1CA 2WBMA 2O03A 4N0BA 1MMDA 4IX7A 4HLYA 2K5CA 4FTHA 1U8BA 2Y9ZA 2EZHA 3JSPA 4F91B 5DCFA 5A2QK 3MKZA 3SZTA 3DF8A 3GZ6A 2XV4S 1QVTA 2GA1A 1K78A 2W7NA 4C2TA 3BQZA 3ABKH 4MEXF 2L5QA 5LLQA 2M1BA 3HHHA 2JA5J 1E3HA 1G8XA 2NXNB 3L7WA 1S7OA 4YFNF 2DTZA 3Q0VA 4S0HB 3RKXA 4KMFA 2IPQX 5K7FA 4CCLA 2VKDA 1Y0NA 1JGSA 4BHBA 2WY8Q 1RI7A 5H6RA 4M6XA 4PGHA 2QLZA 4CYCA 2I8DA 2AO9A 5D5UB 3GTMJ 3IH4A 5TGTA 1ETYA 1P9QC 1EA3A 1YS6A 2WB1N 1BL0A 3FXQA 4RAZA 2STWA 4XNFA 2BY1A 1MMNA 1J9IA 3P5JA 2JSCA 4CSWA 3OYBA 1YX5A 3ZQIA 4GXOA 4CUGA 4NBQA 3DTIA 4HV5A 1FEXA 3TP0A 4EQQA 1STZA 2V26A 1APLC 3CUQA 5HNFA 3KEQA 4Y3OA 1IGNA 1PUEE 3ZXSA 3GFMA 3DEUA 2K9SA 1V5GA 2HQRA 1L0OC 2IA0A 4AWXB 4ENJA 3GTQJ 5BPDA 2LDUA 1WI9A 5F64A 2TRTA 2OC6A 5F1RA 2ICWG 2EIKH 2RV8A 3HUGA 1WJEA 3R0AA 5GPAA 2L02A 4BUPA 3DTKA 5CPRB 3GFJA 2LR8A 1JUPA 1D3YA 1A31A 2H1LA 3E3VA 2ZSIB 3V42A 3U21A 2IXSA 2CQNA 3CC4I 2YUSA 1G59A 4U0YA 1OKRA 1IN7A 2XGCA 1R5HA 2M30A 2MSYA 2E71A 1PYVA 3DFGA 2M45A 4AD9A 2DT6A 3H0GJ 3IV5A 2XAJA 2XVCA 4IF4A 2Y9YA 4A3EJ 1QA6A 1VZ0A 2PJRA 3H0DA 1NK3P 4ZDOA 2XF5A 4ZYAA 2JVGA 2P4WA 9ANTA 1TNSA 5CVRA 5EYRA 1H9GA 2CG4A 3J80Z 2VKEA 1ZQ3P 5KHDA 2QWWA 2VODA 3DBHB 2E7WA 3F6OA 2J5PA 1WVRA 4BGDA 3S32A 1T38A 1PP7U 4ZH4F 1UZCA 2P0WA 4B3XA 5A2QZ 1WGXA 3A2KA 2CUZA 4LLGF 1YI2I 1XG1A 5F0HA 4O5VA 1RUNA 3F3XA 5D8LB 2O7OA 2OV7A 3L1PA 4OAYA 4BEHA 3CD6I 3M4OJ 5EEAA 2NS0A 4J00A 4BACA 4QWQA 2HQNA 4G6TB 4DBRA 2A6HF 2QKMB 3A0BC 4LOCA 3CJNA 1JT0A 2RC4A 1LNWA 1K78B 2RQQA 4IHYA 2FE3A 1X1DA 1OPCA 1HKSA 2JTVA 2BW3B 4N9IA 2M7BA 1BR1A 1WJBA 3N97A 4HG2A 5DDGA 3KZYA 2R93J 1P4WA 3WTTC 4GRIA 2X4HA 1Z91A 1A04A 1WCMJ 4L5IA 5J8FA 4HDUA 3K1MA 3DLLF 1GHCA 5LEKA 1QGPA 2K27A 1ERDA 1XGSA 3ZR8X 4LLNA 2XPWA 4U0WA 4ZDPA 2QEXI 1KU9A 2RNGA 4XLFA 4IEJA 3SQNA 3TKYA 5HLIA 4BYYA 1A6IA 3VSLA 4XLPF 3PNYA 3F8CA 4M3DA 5ED4A 2VC0A 6PAXA 4HRIA 4C2UA 4KT5C 3OS1A 2DI3A 2X6OA 4TV7A 1HSTA 1W1WE 3O3KA 2LKXA 4XICA 2M4GA 2P8TA 4PDKA 3CCLI 2DAOA 2LC2A 1TP4A 1UHMA 2WWYA 4P1WA 3MD2A 3K4MA 1ON1A 2VLAA 3QWLA 1HW5A 1HCRA 1D0XA 1WH7A 1X3WB 3C3WA 3WTSC 2IS2A 3RZOJ 4WXDA 1ETXA 3CZ6A 5DS9A 1I50J 4ENKA 1ONVA 3CCVI 1IG7A 3P9CA 3GUDA 2M7AA 3FXRA 1FX7A 2VQGA 3P7NA 3AG2H 4BDZA 3TO9A 4CCJA 1B8IA 3J7ZI 5GAHJ 2QZ8A 1VI0A 5HLTA 2A5WA 1QHHD 2FX0A 1IO2A 2A5YB 3S1RJ 2HOTA 2FEZA 4A6DA 3F21A 3HPGA 2R5YA 1HW2A 1YYVA 2EILH 4CH7A 2PJRB 2DOAA 4XN3A 1TWGJ 1XGMA 3K2ZA 2VXZA 2K3PA 3VFZA 4OAZA 3BJAA 2BXZA 4D0PA 5ERIA 2LBFA 3QQAA 4MFEA 1TT5B 3K70C 3HKZA 1GXQA 2ZCWA 4N4OB 3HRSA 3CP8A 4C30A 4EM0B 1W7PD 1FYLA 3ZMUA 2XDVA 4C2MJ 5FO5A 4AIHA 2DBBA 1MMSA 3DTEA 1X2NA 2LSOA 4IKFA 1IJWC 2Z3YA 1W4MA 4AIDA 3TMOA 2E34A 3A1YA 4PSXA 2H6CA 2LF7A 3NAUA 3OMYA 2IJLA 4KMUX 3A01A 1YS7A 2MW8A 2W4SA 4AU7A 2ME6A 4E6KG 4Y7NJ 4RGXA 4PFPA 2ZMEA 3IUOA 3ZN0A 1W0TA 2LYCA 4B4CA 5M3FJ 3ERMA 1U5TA 5ILUA 2KIUA 2IGNA 2VB6A 2Z5UA 3DPLC 3ABMH 1YOVB 1QZEA 2L01A 2FBKA 3JAMK 3CLOA 2HWVA 2LMDA 2V6CA 2E1MB 5HS9A 4XK4A 1MZBA 5DM7F 2L7MP 1S29A 1J09A 3MKLA 5K5RA 3MZHA 3BR3A 4OIOF 2MBFA 3F9KA 4A3GJ 1LEBA 3Q0WA 5K5OA 4LIVA 3L00A 1NG6A 1BOAA 3PUBA 5LHHA 2HVSA 2CO5A 2VIXA 3JREA 4MHGA 2D45A 4EVIA 2RNJA 1S7AA 1IXSB 4JX4A 2ECCA 2NVUB 3WE3A 3E7LA 3GTPJ 1WSUA 1N75A 5CVIA
chains in the Genus database with same CATH topology
1ZGJA 2ZKZA 2FMLA 2Q8KA 3I58A 2G9WA 4U7DA 4UV9A 5FFZA 1XD7A 4L0ZB 1ZLKA 2K4JA 3WG9A 2E7XA 4Y17A 2IRFG 3JTGA 1D8JA 1U2WA 4KUMA 2HGCA 1IXCA 2DK8A 4YIIA 4G9YA 4P96A 1IUYA 3ABUA 2ADUA 1AOYA 5LBQA 2GZWA 2OU2A 2XRNA 2LKPA 4WK8F 3QPTA 5DD4A 2WV0A 4IHTA 3I4PA 4AIJA 1R58A 3CUOA 1RNLA 5DUKA 3O2PE 3HSFA 1FOKA 5E8GA 4A2UA 5AIQA 1RIOH 4L9JA 2ZMEB 5J6XA 4OIPF 5TRDA 1U5TB 3DKWA 4ETSA 5E1ZB 1BI2A 4LJZF 2DLLA 1QQIA 3RYRA 4RGUA 2AS5F 3V7SA 3WTVC 2DW4A 1YIOA 3F8MA 3R60A 2HR3A 3F23A 2ZNZA 1BIAA 1ZG1A 1K6OA 2STTA 2V1UA 4HAMA 4XLNF 2UXXA 1XGNA 4K2EA 5BQTA 5J8CA 2P6TA 5L3DA 1EV7A 1R5GA 3B73A 2YSRA 1FYMA 4I02A 2W24A 2KJCA 4H0EA 2FF4A 4G7HF 3LA7A 1XDSA 4UVAA 4HQEA 5FLXK 4HV6A 4HF0A 1USTA 1LDJA 4G6QA 2W85A 3WTYC 1LJ9A 3F8FA 1DPRA 4EGZA 1B59A 1F9NA 3TDUC 1FP1D 1LEAA 2D1HA 3RTRA 1IRGA 2NRAC 5LEJA 2P5VA 1FT9A 2R3SA 1F5TA 3OV8A 2YPRA 3ECOA 3VOEA 4G7OF 4PGGA 2XROA 1BC8C 2AXLA 4IRGA 1T98A 2F2EA 3WTWC 1ZRFA 2ZXJA 2W57A 1BI3A 4BAYA 1D8KA 3C7JA 4UHTA 4HYEA 1SMTA 2QUFA 5CVVA 2Z99A 1Q1HA 1IZ1A 4A0YA 5HDNA 1TTYA 1ZGAA 3PFIA 4HLXA 1TLHB 2OQGA 1FBQA 1F1ZA 1FP2A 2QYOA 3NEUA 4M9ZA 3HRUA 1YQAA 1TBXA 3ISPA 2MA3A 4HQMA 4XBFA 2VBWA 1FSHA 3J80K 3TOBA 2O0YA 2X0LA 3QP6A 1HBXG 5KK1A 3HRTA 2EFNA 2VBZA 3IWFA 4N9HA 2HS5A 2V1XA 4ESJA 2UWMA 1W7PA 3CDHA 5FLXZ 5FD5A 4XSZF 4ZZDA 3GO5A 3KEOA 4P9UA 1SAXA 1QNTA 2M5WA 4KIGA 2VE8A 4RB2C 4M71A 5HDKA 4WXHA 5DYMA 2IVMA 3W6KB 1G4DA 1HW1A 4G6DA 3QOPA 1XDUA 2OA4A 2RN7A 3KP6A 2L4MA 4R8HA 1IRFA 2HEOA 3K0LA 5JI6A 1BBYA 3TOAA 2PLYA 1LQ1A 3E5QA 1BIBA 4ON0A 1H9TA 1DPUA 2YR2A 1I6XA 3FMSA 2IA2A 1FYKA 3RI4A 2XAQA 4IXAA 5BS6A 2FBHA 3NRVA 2PG4A 2B0LA 1SFUA 4HX4A 5D5WB 3BP8A 2VT3A 1ZHFA 4GGGA 3ROUA 4S05A 1YTYA 2GIVA 1HKQA 1OYWA 3GZ5A 1ZN2A 2KRFA 4UNOA 5L3BA 3GF2A 4RAYA 5LHIA 3WODF 3KP4A 3QRFF 4R79A 3E6CC 2WTEA 3ML6A 1Z05A 2XUBA 1YW9A 1B4AA 2CFXA 5DD8A 2VOPA 2V1DA 4EM2A 2E1CA 3K1PA 5KVRA 3RPUA 1BN5A 2F5DA 3SZPA 2OZ6A 3C1DA 4L9NA 2H94A 1I27A 1W7PB 4BNCA 1R1UA 3RDIA 3FX3A 2YX7A 3AAFA 3LFKA 4KICA 4LG0A 1J0RA 3QU3A 2HTSA 3EYYA 3REOA 3ELKA 4WF2A 1G3SA 5FD6A 4M74A 3FXUA 4JBAA 2NNNA 2VC1A 3U9GA 2G7HA 4NB5A 2DPDA 4I2OA 2EA4A 3KP7A 1DP7P 3LAJA 1FWZA 3ULQB 2NYXA 3EDPA 1FY7A 1U78A 2VBYA 2O61A 4BHCA 3CUQB 1DDNA 1FBUA 2FQ3A 3Q9SA 3H3ZA 4Z2YA 3E6BA 2F5EA 1GVJA 4CXFA 3GW2A 3GFIA 2ACJA 4JQFA 1T0FA 1WWXA 1KYZA 2HFHA 4S04A 3O6BB 3TO7A 4KYWA 5ICCA 5AIPA 1ZRDA 2EWNA 1J7KA 1R22A 4I0AA 5LGTA 1G3WA 1J2XA 2HYGD 1W5SA 3GLXA 2EV0A 3ZMZA 4HF2A 4LK0F 3M7GA 5TJJA 5D5XB 4KA4A 3MEXA 4Y15A 1EH6A 3WTXC 2GQQA 1IN4A 2FBIA 2ZJ2A 4QLCU 4ENMA 1R00A 3EQLF 4CYDA 3K9TA 1T2KA 4M6YA 3L09A 2CGPA 4ESBA 4BQAA 3SHFA 4EJOA 2ESHA 1UCRA 4F7ZA 3K69A 1R1TA 1MJAA 5ILSA 3HTSB 1VTNC 4EGYA 4AVPA 4AIKA 1BI1A 3CO6C 2EFWA 2E1NA 4ESFA 5HLHA 1KQ0A 5LHGA 2BYVE 2FSWA 2H27A 4LG0B 1YLFA 4IHSA 1Y0UA 5HDGA 3J7AO 4IVNA 3U2RA 1ODDA 4I01A 2HKXA 3MFKA 1PDNC 1F4KA 1U6GA 1XMKA 5AONA 2K86A 3M1EA 1MD0A 3KZZA 4OU0A 3KP3A 2HOEA 4P5OA 2DK5A 2ZFWA 3QAHA 1O3RA 4I09A 4LB6B 3F22A 2QVOA 2RKHA 4DQ2A 1LDKB 4OIQF 5CVUA 3LSTA 2ZO4A 4YFXF 3ZP5A 4LB5A 3IC7A 1WKMA 1IW7F 3V8KA 2A69F 1E17A 3BJOA 2JPCA 3I59A 2VT2A 5IT3A 5CYVA 1KU7A 3WE2A 1ZG5A 1EH7A 1OYIA 5EEHA 1TW3A 3HOTA 4KFCA 2RGVA 4FT8A 2PBIA 1QZZA 1B1BA 2BV6A 2MH2A 1RUOA 2JZYA 2XIGA 1YW7A 1HKTA 2XAHA 3CTAA 3LQQA 1XSDA 4A12A 1FBSA 1SFXA 4ZYDA 4EM1A 3BWGA 2WC2A 3E5UA 1I1SA 3TQNA 2Z33A 1MJ9A 5BPIA 4OIRF 3ECHA 4BH9A 2A6EF 4LLLA 4WX9A 1G3TA 4LFUA 5ICEA 2O6GE 4MQVA 3CO7C 2YX4A 4ENNA 4MQ9F 5JVTA 1ZAOA 3H92A 2VE9A 1YG2A 1WQ2A 3KETA 4UVCA 1YW8A 2EB7A 3R6SA 5DUIA 3EYIA 1J59A 2OAZA 1BJAA 2FA5A 3FHZA 3IL2A 4LD5A 3V7RA 2ELHA 1ZLJA 2XAFA 2ZBKA 3ZMDA 3T8TA 4YFKF 2NNYA 4GYGA 4G94A 1V3FA 2QM3A 2EJRA 4RGSA 2HKOA 3HHGA 4RGRA 1XSXA 3LWFA 1MGTA 2H6BA 2YU3A 3M8EA 1SFEA 2EV5A 4MEYF 3KFWX 1W5TA 1G6NA 1FZPB 3KE2A 2XKPA 4UV8A 4IRIA 3I64A 4M9XA 2F5CA 3MWMA 1R23A 5D6FA 5JFRA 3F8BA 3BDDA 1IN5A 3TDZC 3C18A 2XGXA 4KN4X 3E5XA 1Z7UA 4HX7A 4G8XA 5CVJA 2IW5A 1OMIA 5DCMA 4BHPA 2BE5F 3FF5A 4Q48A 3I0TA 1ZH5A 5CJ9A 2IP2A 2GXGA 5FB2A 1UHWA 2M87A 2R7DA 3ZMSA 3LA3A 3S2WA 5E8IA 1TNTA 1O7FA 5L3GA 4EJTA 2LNBA 2XAGA 4OOIA 4Q5SF 3HSEA 1ON2A 4U7BA 2W84A 2DPUA 3TGNA 1E2XA 5ICFA 3V8JA 4CZZA 4KNYA 1ZG3A 2A3SA 5E17F 4BXUA 3DV8A 3QP5A 1XSVA 2MH9A 4KDPA 5IT9Z 4B09A 1RZ4A 3KCCA 4ASNA 1O3QA 1LB2A 3ERED 1XMAA 2D2WA 1R36A 5D5VB 3ZMTA 1U5TC 1ULYA 2ISZA 2DT5A 3K1NA 5JR3A 4MTDA 1YO5C 3TO6A 3W6JB 2OQRA 1XN7A 2UXNA 1IF1A 4OMYA 3FWEA 4HOBA 3ABTA 3IKVA 4FX4A 2ISYA 3I53A 2K7LA 1I5ZA 3L9FA 1BI0A 4RB1A 2QQBA 2FMYA 1FLIA 3V8LA 4L9VA 1G3YA 3GYHX 3J81K 2PMUA 5BMZA 2DFIA 3FM5A 1WRJA 3KLOA 2EFOA 4A5NA 4IPAA 5DCMB 1BM9A 4EJUA 3IRQA 4UUVA 3DP7A 4E70A 2M8EA 4RS8A 4CGZA 1Z1DA 4R1HA 1SMYF 2PN6A 1KU3A 3IHUA 1QBJA 4EJWA 1J5YA 2PQ8A 5D8KB 1R1VA 2EV6A 4LMYA 3T0YA 4GO1A 4HW0A 1B9NA 2KJBA 3SFZA 2L3DA 3P9KA 1LDDA 2GAUA 2PMHA 3WGIA 2GWRA 5K1YA 3NQOA 3N4MA 2F5FA 2XHKA 1TQIA 3RJPA 4YIFA 4HDVA 5BOXA 3HTUA 1U8RA 4XRFA 1QPMA 2QENA 2OZUA 3D5LA 4M9SA 1H0MA 1P4XA 2QQ9A 3ZQ7A 1B6AA 4WCGA 2RDPA 4M73A 2Y75A 1MDMA 2Q0OA 5EEGA 3DPTA 4HBLA 1NHAA 3MQ0A 1O3TA 2GXBA 1L3LA 2PEXA 4IRHA 1HXDA 2JRTA 3FMRA 1B9MA 1FNNA 2EFQA 5HLGA 1EH8A 3J81Z 4RB0A 2A68F 1FSEA 5LRRA 4M72A 4PZJA 4NHJA 1USSA 3FZVA 3RPQA 3V7CA 3LA2A 1I1GA 5F6FA 1ZREA 2XASA 4MGRA 2FU4A 2A61A 4NQWA 3M9AA 3FM3A 5H6QA 3HSRA 2IA1A 4JK1X 2DTRA 2ZNYA 5LGNA 2C6YA 4A0XA 4A0ZA 4I0BA 2FXAA 2OBPA 5HVQC 2Q2EA 1ZARA 4A6EA 5L3FA 2BBYA 1KQ8A 3GVAA 4EJVA 3SXYA 2JPBA 2IT0A 1IN6A 1TW2A 4HX8A 5JHUA 2O8XA 5E18F 3F8NA 2L4AA 1X3UA 3LAPA 5D4SA 1IAWA 2FNPA 1FPQA 3Q9VA 3R0JA 3R61A 5D6EA 2KIMA 2XKOA 3I5UA 2MLGA 4UVBA 1JHFA 4WWCA 5K5QA 5D4RA 3B02A 2PFBA 2JT1A 2OD5A 2Z9OA 3E6DA 5L3EA 3Q5FA 4A5MA 4HA8A 1MDMB 3T5XA 4CO8A 3GWZA 2P5LC 1Z6TA 3RKWA 3VEPA 4Q47A 5L3CA 1SD4A 3MZYA 3HRMA 2HYFA 3VODA 4L18B 3E97A 4YG2F 3IWZA 4U88A 2COMA 1V4RA 4PCQA 3BOQA 2DQRA 3F72A 1GXPA 3BZ6A 3JSOA 2Y48A 3BY6A 2H09A 1O3SA 5LGUA 2GA2A 4O6JA 3E6MA 1DUXC 3I71A 2EA2A 3H3UA 4EV0A 3T1BA 4MNUA 4GCVA 3FMQA 1UB9A 4EMSA 3BPVA 1K7AA 1S8NA 2P5KA 1JXSA 4Y13A 2CW0F 3F6VA 4GYIA 2QBYA 1KQ9A 2FNAA 2L54A 3WGGA 2A07F 1XCBA 2HDCA 3WU0A 5E1WA 1AWCA 1S3JA 3MAJA 2D1VA 1SD6A 4FX0A 2VBXA 1SD5A 5CLSA 2J5OA 1C0WA 3CUQC 3HOSA 3D0SA 3BPXA 3R4KA 4KIFA 2BEOA 2DU9A 1P6RA 3GX4X 2DQLA 4I7HA 2K02A 5FGMA 1O57A 3JTHA 1T39A 3JW4A 3RKYA 1SD7A 2CWEA 2FOKA 4P9FA 2VOOA 2R7FA 5ILVA 3KLNA 5ICGA 4ZYHA 3ZPLA 2PJPA 2QQAA 2HZTA 2G7UA 1ZYRF 1HQCA 4CDGA 2ETHA 3BROA 1PP8F 3RYPA 3MCZA 1D5VA 1KU2A 4IJAA 1CF7A 1ZRCA 3JAMZ 1QO0D 3WU1B 1OYYA 1BC7C 4LK1F 2MLKA 4WXCA 3WTZA 1Z9CA 3U1DA 2KKOA 1TQPA 1JHHA 3QU6A 1R7JA 3M8FA 4RB3C 5IT9K 4KIBA 5E20A 4ZYEA 2CQKA 2PI0A 3COAC 1YFHA 3PQJA 2P7CB 1CGPA 1XCVA 1MJBA 3DQVC 1KGSA 2W25A 4OINF 2VONA 3HYIA 2RQPA 1P4AA 3ZMVA 3I59B 4HZFA 4U0VA 1FC3A 4FHTA 4L0YB 2QBYB 2CYYA 3EUHA 1JE8A 1J75A 4KN7X 5DV5A 4P55A 3LQRA 1KA8A 4MTEA 2UZKA 1U3EM 4I98B 1O7LA 1IXRC 3G73A 3IKTA 4XSXF 2LF8A 1UFMA 2HTJA 1KYWA 4DNCA 3QPHA 2FRHA 1REPC 4Q4ZF 2KIFA 4L9TA 4LGWA 1QZYA 4ZYGA 3OOPA 5FFXA 1MKMA 5LRSA 1P2FA 5H20A 2MD5A 3KP2A 2P7VB 1OR7A 1T6SA 5DEQA 3ZN1A 4G7ZF 3DXJF 3WTUC 1XGOA 3GXOA 4HF1A 2MC3A 2TDXA 1K79A 2EFPA 1P92A 3L2CA 2O3FA 4B8XA 2NAZA 3V4GA 1XB4A 4L5JA 4ZZLA 2DO7A 2V9VA 3GEZA 1S6LA 2P6SA 2RVCA 3EETA 2BGCA 3GFLA 3RIRA 5HS8A 3PQKA 1CF7B 1TQMA 5E1XA 1Z6RA 5HOOA 3IRRA 1HSJA 2V79A 4CICA 2Y0MA 1LVAA 2K4BA 5HS7A 3BJ6A 3T8RA 2VN2A 4UXNA 4OMZA 3HIFA 4CHUA 1IN8A 2EK5A 2ESNA 3KP5A 3VB2A 3G3ZA 3WGHA 3P9IA 4O3MA 2CSOA 3I54A 2O03A 4N0BA 4HLYA 3JSPA 5DCFA 5A2QK 3SZTA 3DF8A 3GZ6A 2XV4S 2GA1A 1K78A 4MEXF 5LLQA 2M1BA 3HHHA 3L7WA 1S7OA 4YFNF 3RKXA 4KMFA 2IPQX 1JGSA 4BHBA 1RI7A 5H6RA 4M6XA 4PGHA 2QLZA 5D5UB 1YS6A 3FXQA 4RAZA 2STWA 1J9IA 2JSCA 4GXOA 4HV5A 4EQQA 1STZA 3CUQA 3KEQA 1PUEE 3GFMA 3DEUA 2HQRA 2IA0A 1L0OC 4AWXB 4ENJA 5BPDA 2LDUA 1WI9A 5F64A 5F1RA 2RV8A 3HUGA 3R0AA 2L02A 3GFJA 1D3YA 3E3VA 4U0YA 1OKRA 1IN7A 1R5HA 2M30A 3DFGA 2M45A 4AD9A 2XAJA 2XVCA 4IF4A 2P4WA 1TNSA 5CVRA 1H9GA 2CG4A 3J80Z 2QWWA 2VODA 2E7WA 3F6OA 2J5PA 1T38A 1PP7U 4ZH4F 5A2QZ 4LLGF 4O5VA 1RUNA 3F3XA 5D8LB 2NS0A 4QWQA 2HQNA 2A6HF 3CJNA 2RC4A 1LNWA 1K78B 2FE3A 1OPCA 1HKSA 2JTVA 4N9IA 3N97A 5DDGA 3KZYA 1P4WA 3WTTC 2X4HA 1Z91A 1A04A 4L5IA 5J8FA 4HDUA 3K1MA 1GHCA 5LEKA 1QGPA 2K27A 1XGSA 4LLNA 4U0WA 1KU9A 3SQNA 3TKYA 5HLIA 4BYYA 4XLPF 3F8CA 5ED4A 2VC0A 6PAXA 4KT5C 2DI3A 4TV7A 1HSTA 3O3KA 2P8TA 4PDKA 2DAOA 1UHMA 2WWYA 1ON1A 1HW5A 3C3WA 3WTSC 4WXDA 4ENKA 1ONVA 3P9CA 3GUDA 3FXRA 1FX7A 3P7NA 3TO9A 2QZ8A 2A5YB 2FEZA 4A6DA 3F21A 1HW2A 1YYVA 1XGMA 3K2ZA 2VXZA 3VFZA 3BJAA 4D0PA 5ERIA 1GXQA 2ZCWA 3HRSA 4EM0B 1W7PD 1FYLA 3ZMUA 5FO5A 4AIHA 2DBBA 2LSOA 2Z3YA 1W4MA 2H6CA 2LF7A 4KMUX 2IJLA 1YS7A 4RGXA 2ZMEA 3ZN0A 1U5TA 5ILUA 2KIUA 2Z5UA 3DPLC 2L01A 2FBKA 3JAMK 3CLOA 2HWVA 2V6CA 5HS9A 1MZBA 1S29A 5K5RA 3MZHA 1LEBA 4OIOF 2MBFA 5K5OA 3L00A 1BOAA 5LHHA 2CO5A 4MHGA 2D45A 4EVIA 2RNJA 1S7AA 1IXSB 3WE3A 1WSUA 5CVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGJ A;  2ZKZ A;  2FML A;  2Q8K A;  3I58 A;  2G9W A;  4U7D A;  4UV9 A;  5FFZ A;  1XD7 A;  4L0Z B;  1ZLK A;  2K4J A;  3WG9 A;  2E7X A;  4Y17 A;  2IRF G;  3JTG A;  1D8J A;  1U2W A;  4KUM A;  2HGC A;  1IXC A;  2DK8 A;  4YII A;  4G9Y A;  4P96 A;  1IUY A;  3ABU A;  2ADU A;  1AOY A;  5LBQ A;  2GZW A;  2OU2 A;  2XRN A;  2LKP A;  4WK8 F;  3QPT A;  5DD4 A;  2WV0 A;  4IHT A;  3I4P A;  4AIJ A;  1R58 A;  3CUO A;  1RNL A;  5DUK A;  3O2P E;  3HSF A;  1FOK A;  5E8G A;  4A2U A;  5AIQ A;  1RIO H;  4L9J A;  2ZME B;  5J6X A;  4OIP F;  5TRD A;  1U5T B;  3DKW A;  4ETS A;  5E1Z B;  1BI2 A;  4LJZ F;  2DLL A;  1QQI A;  3RYR A;  4RGU A;  2AS5 F;  3V7S A;  3WTV C;  2DW4 A;  1YIO A;  3F8M A;  3R60 A;  2HR3 A;  3F23 A;  2ZNZ A;  1BIA A;  1ZG1 A;  1K6O A;  2STT A;  2V1U A;  4HAM A;  4XLN F;  2UXX A;  1XGN A;  4K2E A;  5BQT A;  5J8C A;  2P6T A;  5L3D A;  1EV7 A;  1R5G A;  3B73 A;  2YSR A;  1FYM A;  4I02 A;  2W24 A;  2KJC A;  4H0E A;  2FF4 A;  4G7H F;  3LA7 A;  1XDS A;  4UVA A;  4HQE A;  5FLX K;  4HV6 A;  4HF0 A;  1UST A;  1LDJ A;  4G6Q A;  2W85 A;  3WTY C;  1LJ9 A;  3F8F A;  1DPR A;  4EGZ A;  1B59 A;  1F9N A;  3TDU C;  1FP1 D;  1LEA A;  2D1H A;  3RTR A;  1IRG A;  2NRA C;  5LEJ A;  2P5V A;  1FT9 A;  2R3S A;  1F5T A;  3OV8 A;  2YPR A;  3ECO A;  3VOE A;  4G7O F;  4PGG A;  2XRO A;  1BC8 C;  2AXL A;  4IRG A;  1T98 A;  2F2E A;  3WTW C;  1ZRF A;  2ZXJ A;  2W57 A;  1BI3 A;  4BAY A;  1D8K A;  3C7J A;  4UHT A;  4HYE A;  1SMT A;  2QUF A;  5CVV A;  2Z99 A;  1Q1H A;  1IZ1 A;  4A0Y A;  5HDN A;  1TTY A;  1ZGA A;  3PFI A;  4HLX A;  1TLH B;  2OQG A;  1FBQ A;  1F1Z A;  1FP2 A;  2QYO A;  3NEU A;  4M9Z A;  3HRU A;  1YQA A;  1TBX A;  3ISP A;  2MA3 A;  4HQM A;  4XBF A;  2VBW A;  1FSH A;  3J80 K;  3TOB A;  2O0Y A;  2X0L A;  3QP6 A;  1HBX G;  5KK1 A;  3HRT A;  2EFN A;  2VBZ A;  3IWF A;  4N9H A;  2HS5 A;  2V1X A;  4ESJ A;  2UWM A;  1W7P A;  3CDH A;  5FLX Z;  5FD5 A;  4XSZ F;  4ZZD A;  3GO5 A;  3KEO A;  4P9U A;  1SAX A;  1QNT A;  2M5W A;  4KIG A;  2VE8 A;  4RB2 C;  4M71 A;  5HDK A;  4WXH A;  5DYM A;  2IVM A;  3W6K B;  1G4D A;  1HW1 A;  4G6D A;  3QOP A;  1XDU A;  2OA4 A;  2RN7 A;  3KP6 A;  2L4M A;  4R8H A;  1IRF A;  2HEO A;  3K0L A;  5JI6 A;  1BBY A;  3TOA A;  2PLY A;  1LQ1 A;  3E5Q A;  1BIB A;  4ON0 A;  1H9T A;  1DPU A;  2YR2 A;  1I6X A;  3FMS A;  2IA2 A;  1FYK A;  3RI4 A;  2XAQ A;  4IXA A;  5BS6 A;  2FBH A;  3NRV A;  2PG4 A;  2B0L A;  1SFU A;  4HX4 A;  5D5W B;  3BP8 A;  2VT3 A;  1ZHF A;  4GGG A;  3ROU A;  4S05 A;  1YTY A;  2GIV A;  1HKQ A;  1OYW A;  3GZ5 A;  1ZN2 A;  2KRF A;  4UNO A;  5L3B A;  3GF2 A;  4RAY A;  5LHI A;  3WOD F;  3KP4 A;  3QRF F;  4R79 A;  3E6C C;  2WTE A;  3ML6 A;  1Z05 A;  2XUB A;  1YW9 A;  1B4A A;  2CFX A;  5DD8 A;  2VOP A;  2V1D A;  4EM2 A;  2E1C A;  3K1P A;  5KVR A;  3RPU A;  1BN5 A;  2F5D A;  3SZP A;  2OZ6 A;  3C1D A;  4L9N A;  2H94 A;  1I27 A;  1W7P B;  4BNC A;  1R1U A;  3RDI A;  3FX3 A;  2YX7 A;  3AAF A;  3LFK A;  4KIC A;  4LG0 A;  1J0R A;  3QU3 A;  2HTS A;  3EYY A;  3REO A;  3ELK A;  4WF2 A;  1G3S A;  5FD6 A;  4M74 A;  3FXU A;  4JBA A;  2NNN A;  2VC1 A;  3U9G A;  2G7H A;  4NB5 A;  2DPD A;  4I2O A;  2EA4 A;  3KP7 A;  1DP7 P;  3LAJ A;  1FWZ A;  3ULQ B;  2NYX A;  3EDP A;  1FY7 A;  1U78 A;  2VBY A;  2O61 A;  4BHC A;  3CUQ B;  1DDN A;  1FBU A;  2FQ3 A;  3Q9S A;  3H3Z A;  4Z2Y A;  3E6B A;  2F5E A;  1GVJ A;  4CXF A;  3GW2 A;  3GFI A;  2ACJ A;  4JQF A;  1T0F A;  1WWX A;  1KYZ A;  2HFH A;  4S04 A;  3O6B B;  3TO7 A;  4KYW A;  5ICC A;  5AIP A;  1ZRD A;  2EWN A;  1J7K A;  1R22 A;  4I0A A;  5LGT A;  1G3W A;  1J2X A;  2HYG D;  1W5S A;  3GLX A;  2EV0 A;  3ZMZ A;  4HF2 A;  4LK0 F;  3M7G A;  5TJJ A;  5D5X B;  4KA4 A;  3MEX A;  4Y15 A;  1EH6 A;  3WTX C;  2GQQ A;  1IN4 A;  2FBI A;  2ZJ2 A;  4QLC U;  4ENM A;  1R00 A;  3EQL F;  4CYD A;  3K9T A;  1T2K A;  4M6Y A;  3L09 A;  2CGP A;  4ESB A;  4BQA A;  3SHF A;  4EJO A;  2ESH A;  1UCR A;  4F7Z A;  3K69 A;  1R1T A;  1MJA A;  5ILS A;  3HTS B;  1VTN C;  4EGY A;  4AVP A;  4AIK A;  1BI1 A;  3CO6 C;  2EFW A;  2E1N A;  4ESF A;  5HLH A;  1KQ0 A;  5LHG A;  2BYV E;  2FSW A;  2H27 A;  4LG0 B;  1YLF A;  4IHS A;  1Y0U A;  5HDG A;  3J7A O;  4IVN A;  3U2R A;  1ODD A;  4I01 A;  2HKX A;  3MFK A;  1PDN C;  1F4K A;  1U6G A;  1XMK A;  5AON A;  2K86 A;  3M1E A;  1MD0 A;  3KZZ A;  4OU0 A;  3KP3 A;  2HOE A;  4P5O A;  2DK5 A;  2ZFW A;  3QAH A;  1O3R A;  4I09 A;  4LB6 B;  3F22 A;  2QVO A;  2RKH A;  4DQ2 A;  1LDK B;  4OIQ F;  5CVU A;  3LST A;  2ZO4 A;  4YFX F;  3ZP5 A;  4LB5 A;  3IC7 A;  1WKM A;  1IW7 F;  3V8K A;  2A69 F;  1E17 A;  3BJO A;  2JPC A;  3I59 A;  2VT2 A;  5IT3 A;  5CYV A;  1KU7 A;  3WE2 A;  1ZG5 A;  1EH7 A;  1OYI A;  5EEH A;  1TW3 A;  3HOT A;  4KFC A;  2RGV A;  4FT8 A;  2PBI A;  1QZZ A;  1B1B A;  2BV6 A;  2MH2 A;  1RUO A;  2JZY A;  2XIG A;  1YW7 A;  1HKT A;  2XAH A;  3CTA A;  3LQQ A;  1XSD A;  4A12 A;  1FBS A;  1SFX A;  4ZYD A;  4EM1 A;  3BWG A;  2WC2 A;  3E5U A;  1I1S A;  3TQN A;  2Z33 A;  1MJ9 A;  5BPI A;  4OIR F;  3ECH A;  4BH9 A;  2A6E F;  4LLL A;  4WX9 A;  1G3T A;  4LFU A;  5ICE A;  2O6G E;  4MQV A;  3CO7 C;  2YX4 A;  4ENN A;  4MQ9 F;  5JVT A;  1ZAO A;  3H92 A;  2VE9 A;  1YG2 A;  1WQ2 A;  3KET A;  4UVC A;  1YW8 A;  2EB7 A;  3R6S A;  5DUI A;  3EYI A;  1J59 A;  2OAZ A;  1BJA A;  2FA5 A;  3FHZ A;  3IL2 A;  4LD5 A;  3V7R A;  2ELH A;  1ZLJ A;  2XAF A;  2ZBK A;  3ZMD A;  3T8T A;  4YFK F;  2NNY A;  4GYG A;  4G94 A;  1V3F A;  2QM3 A;  2EJR A;  4RGS A;  2HKO A;  3HHG A;  4RGR A;  1XSX A;  3LWF A;  1MGT A;  2H6B A;  2YU3 A;  3M8E A;  1SFE A;  2EV5 A;  4MEY F;  3KFW X;  1W5T A;  1G6N A;  1FZP B;  3KE2 A;  2XKP A;  4UV8 A;  4IRI A;  3I64 A;  4M9X A;  2F5C A;  3MWM A;  1R23 A;  5D6F A;  5JFR A;  3F8B A;  3BDD A;  1IN5 A;  3TDZ C;  3C18 A;  2XGX A;  4KN4 X;  3E5X A;  1Z7U A;  4HX7 A;  4G8X A;  5CVJ A;  2IW5 A;  1OMI A;  5DCM A;  4BHP A;  2BE5 F;  3FF5 A;  4Q48 A;  3I0T A;  1ZH5 A;  5CJ9 A;  2IP2 A;  2GXG A;  5FB2 A;  1UHW A;  2M87 A;  2R7D A;  3ZMS A;  3LA3 A;  3S2W A;  5E8I A;  1TNT A;  1O7F A;  5L3G A;  4EJT A;  2LNB A;  2XAG A;  4OOI A;  4Q5S F;  3HSE A;  1ON2 A;  4U7B A;  2W84 A;  2DPU A;  3TGN A;  1E2X A;  5ICF A;  3V8J A;  4CZZ A;  4KNY A;  1ZG3 A;  2A3S A;  5E17 F;  4BXU A;  3DV8 A;  3QP5 A;  1XSV A;  2MH9 A;  4KDP A;  5IT9 Z;  4B09 A;  1RZ4 A;  3KCC A;  4ASN A;  1O3Q A;  1LB2 A;  3ERE D;  1XMA A;  2D2W A;  1R36 A;  5D5V B;  3ZMT A;  1U5T C;  1ULY A;  2ISZ A;  2DT5 A;  3K1N A;  5JR3 A;  4MTD A;  1YO5 C;  3TO6 A;  3W6J B;  2OQR A;  1XN7 A;  2UXN A;  1IF1 A;  4OMY A;  3FWE A;  4HOB A;  3ABT A;  3IKV A;  4FX4 A;  2ISY A;  3I53 A;  2K7L A;  1I5Z A;  3L9F A;  1BI0 A;  4RB1 A;  2QQB A;  2FMY A;  1FLI A;  3V8L A;  4L9V A;  1G3Y A;  3GYH X;  3J81 K;  2PMU A;  5BMZ A;  2DFI A;  3FM5 A;  1WRJ A;  3KLO A;  2EFO A;  4A5N A;  4IPA A;  5DCM B;  1BM9 A;  4EJU A;  3IRQ A;  4UUV A;  3DP7 A;  4E70 A;  2M8E A;  4RS8 A;  4CGZ A;  1Z1D A;  4R1H A;  1SMY F;  2PN6 A;  1KU3 A;  3IHU A;  1QBJ A;  4EJW A;  1J5Y A;  2PQ8 A;  5D8K B;  1R1V A;  2EV6 A;  4LMY A;  3T0Y A;  4GO1 A;  4HW0 A;  1B9N A;  2KJB A;  3SFZ A;  2L3D A;  3P9K A;  1LDD A;  2GAU A;  2PMH A;  3WGI A;  2GWR A;  5K1Y A;  3NQO A;  3N4M A;  2F5F A;  2XHK A;  1TQI A;  3RJP A;  4YIF A;  4HDV A;  5BOX A;  3HTU A;  1U8R A;  4XRF A;  1QPM A;  2QEN A;  2OZU A;  3D5L A;  4M9S A;  1H0M A;  1P4X A;  2QQ9 A;  3ZQ7 A;  1B6A A;  4WCG A;  2RDP A;  4M73 A;  2Y75 A;  1MDM A;  2Q0O A;  5EEG A;  3DPT A;  4HBL A;  1NHA A;  3MQ0 A;  1O3T A;  2GXB A;  1L3L A;  2PEX A;  4IRH A;  1HXD A;  2JRT A;  3FMR A;  1B9M A;  1FNN A;  2EFQ A;  5HLG A;  1EH8 A;  3J81 Z;  4RB0 A;  2A68 F;  1FSE A;  5LRR A;  4M72 A;  4PZJ A;  4NHJ A;  1USS A;  3FZV A;  3RPQ A;  3V7C A;  3LA2 A;  1I1G A;  5F6F A;  1ZRE A;  2XAS A;  4MGR A;  2FU4 A;  2A61 A;  4NQW A;  3M9A A;  3FM3 A;  5H6Q A;  3HSR A;  2IA1 A;  4JK1 X;  2DTR A;  2ZNY A;  5LGN A;  2C6Y A;  4A0X A;  4A0Z A;  4I0B A;  2FXA A;  2OBP A;  5HVQ C;  2Q2E A;  1ZAR A;  4A6E A;  5L3F A;  2BBY A;  1KQ8 A;  3GVA A;  4EJV A;  3SXY A;  2JPB A;  2IT0 A;  1IN6 A;  1TW2 A;  4HX8 A;  5JHU A;  2O8X A;  5E18 F;  3F8N A;  2L4A A;  1X3U A;  3LAP A;  5D4S A;  1IAW A;  2FNP A;  1FPQ A;  3Q9V A;  3R0J A;  3R61 A;  5D6E A;  2KIM A;  2XKO A;  3I5U A;  2MLG A;  4UVB A;  1JHF A;  4WWC A;  5K5Q A;  5D4R A;  3B02 A;  2PFB A;  2JT1 A;  2OD5 A;  2Z9O A;  3E6D A;  5L3E A;  3Q5F A;  4A5M A;  4HA8 A;  1MDM B;  3T5X A;  4CO8 A;  3GWZ A;  2P5L C;  1Z6T A;  3RKW A;  3VEP A;  4Q47 A;  5L3C A;  1SD4 A;  3MZY A;  3HRM A;  2HYF A;  3VOD A;  4L18 B;  3E97 A;  4YG2 F;  3IWZ A;  4U88 A;  2COM A;  1V4R A;  4PCQ A;  3BOQ A;  2DQR A;  3F72 A;  1GXP A;  3BZ6 A;  3JSO A;  2Y48 A;  3BY6 A;  2H09 A;  1O3S A;  5LGU A;  2GA2 A;  4O6J A;  3E6M A;  1DUX C;  3I71 A;  2EA2 A;  3H3U A;  4EV0 A;  3T1B A;  4MNU A;  4GCV A;  3FMQ A;  1UB9 A;  4EMS A;  3BPV A;  1K7A A;  1S8N A;  2P5K A;  1JXS A;  4Y13 A;  2CW0 F;  3F6V A;  4GYI A;  2QBY A;  1KQ9 A;  2FNA A;  2L54 A;  3WGG A;  2A07 F;  1XCB A;  2HDC A;  3WU0 A;  5E1W A;  1AWC A;  1S3J A;  3MAJ A;  2D1V A;  1SD6 A;  4FX0 A;  2VBX A;  1SD5 A;  5CLS A;  2J5O A;  1C0W A;  3CUQ C;  3HOS A;  3D0S A;  3BPX A;  3R4K A;  4KIF A;  2BEO A;  2DU9 A;  1P6R A;  3GX4 X;  2DQL A;  4I7H A;  2K02 A;  5FGM A;  1O57 A;  3JTH A;  1T39 A;  3JW4 A;  3RKY A;  1SD7 A;  2CWE A;  2FOK A;  4P9F A;  2VOO A;  2R7F A;  5ILV A;  3KLN A;  5ICG A;  4ZYH A;  3ZPL A;  2PJP A;  2QQA A;  2HZT A;  2G7U A;  1ZYR F;  1HQC A;  4CDG A;  2ETH A;  3BRO A;  1PP8 F;  3RYP A;  3MCZ A;  1D5V A;  1KU2 A;  4IJA A;  1CF7 A;  1ZRC A;  3JAM Z;  1QO0 D;  3WU1 B;  1OYY A;  1BC7 C;  4LK1 F;  2MLK A;  4WXC A;  3WTZ A;  1Z9C A;  3U1D A;  2KKO A;  1TQP A;  1JHH A;  3QU6 A;  1R7J A;  3M8F A;  4RB3 C;  5IT9 K;  4KIB A;  5E20 A;  4ZYE A;  2CQK A;  2PI0 A;  3COA C;  1YFH A;  3PQJ A;  2P7C B;  1CGP A;  1XCV A;  1MJB A;  3DQV C;  1KGS A;  2W25 A;  4OIN F;  2VON A;  3HYI A;  2RQP A;  1P4A A;  3ZMV A;  3I59 B;  4HZF A;  4U0V A;  1FC3 A;  4FHT A;  4L0Y B;  2QBY B;  2CYY A;  3EUH A;  1JE8 A;  1J75 A;  4KN7 X;  5DV5 A;  4P55 A;  3LQR A;  1KA8 A;  4MTE A;  2UZK A;  1U3E M;  4I98 B;  1O7L A;  1IXR C;  3G73 A;  3IKT A;  4XSX F;  2LF8 A;  1UFM A;  2HTJ A;  1KYW A;  4DNC A;  3QPH A;  2FRH A;  1REP C;  4Q4Z F;  2KIF A;  4L9T A;  4LGW A;  1QZY A;  4ZYG A;  3OOP A;  5FFX A;  1MKM A;  5LRS A;  1P2F A;  5H20 A;  2MD5 A;  3KP2 A;  2P7V B;  1OR7 A;  1T6S A;  5DEQ A;  3ZN1 A;  4G7Z F;  3DXJ F;  3WTU C;  1XGO A;  3GXO A;  4HF1 A;  2MC3 A;  2TDX A;  1K79 A;  2EFP A;  1P92 A;  3L2C A;  2O3F A;  4B8X A;  2NAZ A;  3V4G A;  1XB4 A;  4L5J A;  4ZZL A;  2DO7 A;  2V9V A;  3GEZ A;  1S6L A;  2P6S A;  2RVC A;  3EET A;  2BGC A;  3GFL A;  3RIR A;  5HS8 A;  3PQK A;  1CF7 B;  1TQM A;  5E1X A;  1Z6R A;  5HOO A;  3IRR A;  1HSJ A;  2V79 A;  4CIC A;  2Y0M A;  1LVA A;  2K4B A;  5HS7 A;  3BJ6 A;  3T8R A;  2VN2 A;  4UXN A;  4OMZ A;  3HIF A;  4CHU A;  1IN8 A;  2EK5 A;  2ESN A;  3KP5 A;  3VB2 A;  3G3Z A;  3WGH A;  3P9I A;  4O3M A;  2CSO A;  3I54 A;  2O03 A;  4N0B A;  4HLY A;  3JSP A;  5DCF A;  5A2Q K;  3SZT A;  3DF8 A;  3GZ6 A;  2XV4 S;  2GA1 A;  1K78 A;  4MEX F;  5LLQ A;  2M1B A;  3HHH A;  3L7W A;  1S7O A;  4YFN F;  3RKX A;  4KMF A;  2IPQ X;  1JGS A;  4BHB A;  1RI7 A;  5H6R A;  4M6X A;  4PGH A;  2QLZ A;  5D5U B;  1YS6 A;  3FXQ A;  4RAZ A;  2STW A;  1J9I A;  2JSC A;  4GXO A;  4HV5 A;  4EQQ A;  1STZ A;  3CUQ A;  3KEQ A;  1PUE E;  3GFM A;  3DEU A;  2HQR A;  2IA0 A;  1L0O C;  4AWX B;  4ENJ A;  5BPD A;  2LDU A;  1WI9 A;  5F64 A;  5F1R A;  2RV8 A;  3HUG A;  3R0A A;  2L02 A;  3GFJ A;  1D3Y A;  3E3V A;  4U0Y A;  1OKR A;  1IN7 A;  1R5H A;  2M30 A;  3DFG A;  2M45 A;  4AD9 A;  2XAJ A;  2XVC A;  4IF4 A;  2P4W A;  1TNS A;  5CVR A;  1H9G A;  2CG4 A;  3J80 Z;  2QWW A;  2VOD A;  2E7W A;  3F6O A;  2J5P A;  1T38 A;  1PP7 U;  4ZH4 F;  5A2Q Z;  4LLG F;  4O5V A;  1RUN A;  3F3X A;  5D8L B;  2NS0 A;  4QWQ A;  2HQN A;  2A6H F;  3CJN A;  2RC4 A;  1LNW A;  1K78 B;  2FE3 A;  1OPC A;  1HKS A;  2JTV A;  4N9I A;  3N97 A;  5DDG A;  3KZY A;  1P4W A;  3WTT C;  2X4H A;  1Z91 A;  1A04 A;  4L5I A;  5J8F A;  4HDU A;  3K1M A;  1GHC A;  5LEK A;  1QGP A;  2K27 A;  1XGS A;  4LLN A;  4U0W A;  1KU9 A;  3SQN A;  3TKY A;  5HLI A;  4BYY A;  4XLP F;  3F8C A;  5ED4 A;  2VC0 A;  6PAX A;  4KT5 C;  2DI3 A;  4TV7 A;  1HST A;  3O3K A;  2P8T A;  4PDK A;  2DAO A;  1UHM A;  2WWY A;  1ON1 A;  1HW5 A;  3C3W A;  3WTS C;  4WXD A;  4ENK A;  1ONV A;  3P9C A;  3GUD A;  3FXR A;  1FX7 A;  3P7N A;  3TO9 A;  2QZ8 A;  2A5Y B;  2FEZ A;  4A6D A;  3F21 A;  1HW2 A;  1YYV A;  1XGM A;  3K2Z A;  2VXZ A;  3VFZ A;  3BJA A;  4D0P A;  5ERI A;  1GXQ A;  2ZCW A;  3HRS A;  4EM0 B;  1W7P D;  1FYL A;  3ZMU A;  5FO5 A;  4AIH A;  2DBB A;  2LSO A;  2Z3Y A;  1W4M A;  2H6C A;  2LF7 A;  4KMU X;  2IJL A;  1YS7 A;  4RGX A;  2ZME A;  3ZN0 A;  1U5T A;  5ILU A;  2KIU A;  2Z5U A;  3DPL C;  2L01 A;  2FBK A;  3JAM K;  3CLO A;  2HWV A;  2V6C A;  5HS9 A;  1MZB A;  1S29 A;  5K5R A;  3MZH A;  1LEB A;  4OIO F;  2MBF A;  5K5O A;  3L00 A;  1BOA A;  5LHH A;  2CO5 A;  4MHG A;  2D45 A;  4EVI A;  2RNJ A;  1S7A A;  1IXS B;  3WE3 A;  1WSU A;  5CVI A; 
#chains in the Genus database with same CATH topology
 4BDY A;  1ZGJ A;  3CCY A;  4RA2 A;  2JUG A;  2ZKZ A;  2FML A;  1VQ6 I;  2Q8K A;  3CDI A;  4A3C J;  3I58 A;  4XKW A;  2G9W A;  2X9D A;  1XC5 A;  3OWT A;  4DIQ A;  4XRM A;  4UUS B;  1U9O A;  2QF7 A;  4UV9 A;  4U7D A;  3F0C A;  2MFZ A;  5FFZ A;  4DW6 A;  1XD7 A;  4L0Z B;  1ZLK A;  3HPH A;  2X6W A;  5KAI C;  1UG0 A;  4QPQ A;  2K4J A;  2IGM A;  3WG9 A;  3S3M A;  1K61 A;  3DWL E;  3OYA A;  2E7X A;  3BCA A;  4ITV A;  4Y17 A;  4A3K J;  2IRF G;  5GAG J;  3WG7 H;  3K4L A;  4A3B J;  2KQR A;  3JTG A;  1U2W A;  1NH3 A;  2JJ7 A;  2H8R A;  1UAA A;  2WY7 Q;  4KUM A;  1D8J A;  2HGC A;  4A3D J;  2Z16 A;  2XPV A;  1IXC A;  2DK8 A;  5K7H A;  3AFH A;  4YII A;  4G9Y A;  4P96 A;  1IUY A;  1A6Q A;  2KLO A;  1B8I B;  3ABU A;  2ADU A;  1AOY A;  3PJR A;  3HGY A;  5LBQ A;  1T33 A;  2V7F A;  2GZW A;  2OU2 A;  4HPQ A;  5FKL A;  2XRN A;  2LKP A;  3RPU D;  3M1C A;  2E2I J;  4WK8 F;  1FTT A;  3QPT A;  5F0F A;  3D5S C;  5DD4 A;  1W5C C;  2WV0 A;  2WV1 A;  3SFI A;  3I4P A;  3OIP A;  4IHT A;  4AIJ A;  1R58 A;  2ZC2 A;  3CUO A;  1RNL A;  5DUK A;  5EGO A;  1JJ6 C;  5M5W J;  4ANJ A;  3O2P E;  3HSF A;  2DJN A;  5FJ8 J;  3FDY A;  4RMN A;  1FOK A;  2R4G A;  4LIT A;  2FD5 A;  4AYB A;  2NVY J;  4ZDL A;  3CMA I;  4NC8 A;  3HOW J;  5E8G A;  4A2U A;  2R0Q C;  5AIQ A;  1PUF A;  3JRA A;  1RIO H;  4L9J A;  2M3A A;  2ZME B;  3JRB A;  5J6X A;  4OIP F;  5TRD A;  1U5T B;  3DKW A;  4ETS A;  4CA0 A;  5E1Z B;  4Z6Y A;  1YJN I;  1BI2 A;  1B72 A;  1MBG A;  3S1M J;  1NK2 P;  4LJZ F;  1VF9 A;  2DLL A;  5B66 C;  1QQI A;  3RYR A;  4RGU A;  2E1O A;  2AS5 F;  1MBF A;  2R7Q A;  3V7S A;  3HJE A;  3WTV C;  2DW4 A;  1YIO A;  3F8M A;  3FK6 A;  3R60 A;  2DA3 A;  2BOL A;  2HR3 A;  4XON A;  3F23 A;  2QA4 I;  1QU3 A;  4A3J J;  4YRV A;  3BR6 A;  4I99 C;  5FKN A;  1TWC J;  2ZNZ A;  1IDY A;  1BIA A;  2BHZ A;  1MIJ A;  1ZG1 A;  1K6O A;  1OCT C;  2WA0 A;  2STT A;  2V1U A;  4HAM A;  4XLN F;  4PJJ A;  2UXX A;  1XGN A;  3DBR B;  2ID3 A;  2Y0S A;  4K2E A;  5M5Y J;  5BQT A;  5J8C A;  3LSR A;  2DA4 A;  2P6T A;  3GTK J;  5L3D A;  2QQ8 A;  1EV7 A;  1R5G A;  3PO3 J;  3B73 A;  2EIJ H;  4M3B A;  2Z1D A;  2YSR A;  4PJM A;  2ZJP F;  1FYM A;  4I02 A;  3TED A;  2W24 A;  4BY7 J;  2KJC A;  3NWS A;  4H0E A;  2FF4 A;  2R7W A;  1UMQ A;  4G7H F;  3OSF A;  3LA7 A;  1XDS A;  4UVA A;  3C2B A;  1JKQ C;  4BQO A;  1P7I A;  4DYQ A;  2GBY A;  4HQE A;  2H8W A;  2A05 A;  5FLX K;  4HV6 A;  4HF0 A;  1UST A;  4B3A A;  2E5N A;  1LDJ A;  5GAE J;  2DFF A;  3OL4 A;  4G6Q A;  2K9L A;  4XKC A;  3HKZ N;  4LIU A;  2W85 A;  3FIS A;  3WTY C;  3PFY A;  1LJ9 A;  2L7Z A;  3F8F A;  3M3Y J;  1DPR A;  4EGZ A;  3VSK A;  4J01 A;  1B59 A;  1N77 A;  1F9N A;  5FLM J;  3TDU C;  1FP1 D;  1LEA A;  2D1H A;  3RTR A;  4M3F A;  4M3G A;  3VDX A;  1IRG A;  4MLO A;  2MC4 A;  2NRA C;  5LEJ A;  3KIO A;  2P5V A;  2XB5 A;  4AVZ A;  1T0F C;  1FT9 A;  2R3S A;  1F5T A;  3FKI J;  3OV8 A;  2YPR A;  3ECO A;  4KIT B;  3VYS B;  3VOE A;  1DP3 A;  3DCF A;  4G7O F;  4PGG A;  2L9N A;  2CV2 A;  2XRO A;  1BC8 C;  3OS2 A;  2AXL A;  4IRG A;  3S17 J;  1T98 A;  3AL0 C;  2F2E A;  3WTW C;  1ZRF A;  1GUU A;  3K4B A;  1Z21 A;  2BXY A;  4C3J J;  5H2F C;  2ELK A;  3KPH A;  2ZXJ A;  3OYH A;  2K9N A;  2W57 A;  1BI3 A;  4BAY A;  2IS4 A;  1T95 A;  1D8K A;  3C7J A;  4BE1 A;  1IUF A;  4UHT A;  4HYE A;  1SMT A;  2QUF A;  2V4J C;  5CVV A;  4ABZ A;  2Z99 A;  1FJL A;  1RC9 A;  4PJ0 C;  1Q1H A;  3OYI A;  3CLQ A;  1IZ1 A;  1PUF B;  1OCP A;  4A0Y A;  5HDN A;  1TTY A;  1ZGA A;  2YU9 J;  3PFI A;  4HLX A;  1TLH B;  3JRH A;  2OQG A;  1FBQ A;  1F1Z A;  2VKV A;  1FP2 A;  1S5L C;  3TBI A;  1B72 B;  3W6V A;  4GDF A;  2QYO A;  4FAS D;  3NEU A;  4M9Z A;  3ZCO A;  3HRU A;  2CQQ A;  1I3Q J;  1YQA A;  3CP2 A;  1A36 A;  1PVE A;  2CW8 A;  1TBX A;  4RLF A;  3ISP A;  1SAN A;  1LFU P;  2M4K A;  1ZR4 A;  2KZV A;  2MA3 A;  4HQM A;  4BE2 A;  3OYM A;  4XBF A;  2VBW A;  5JVG F;  1E3O C;  3LSJ A;  4PUS A;  1FSH A;  3J80 K;  5E3M A;  3TOB A;  2O0Y A;  2QGU A;  2X0L A;  3QP6 A;  1HBX G;  5KK1 A;  3HRT A;  2HVR A;  2Y69 H;  2ZXI A;  3J7Y J;  2EFN A;  3FHN A;  2VBZ A;  4ZTF A;  3IWF A;  4N9H A;  2HS5 A;  2V1X A;  3HDD A;  4BJ5 C;  1ZEL A;  2L7F P;  2IEK A;  3ZQQ A;  4ESJ A;  2UWM A;  1LUJ B;  4MO7 A;  5M5X J;  1IRX A;  1W7P A;  3CDH A;  5FLX Z;  3BG5 A;  5FD5 A;  1R5I D;  4XSZ F;  1UHS A;  4ZZD A;  1ITY A;  2AQF A;  3A4C A;  3GO5 A;  2MYS A;  3KEO A;  2K9M A;  3FXO A;  4UB6 C;  1QNT A;  4P9U A;  1SAX A;  2E35 A;  2M5W A;  1S7E A;  2DFH A;  4KIG A;  2VE8 A;  4RB2 C;  3QYB A;  4M71 A;  4N4N B;  1A5J A;  5HDK A;  4WXH A;  2X51 A;  1UG2 A;  1Y1W J;  2W82 A;  5DYM A;  2IVM A;  3W6K B;  3HXL A;  3TW6 A;  1G4D A;  5M3M J;  1HW1 A;  4G6D A;  3UR3 C;  4XKB A;  1ETO A;  3QOP A;  1XDU A;  2OA4 A;  3OR2 C;  2ZJQ F;  1Y39 A;  2RN7 A;  4F52 A;  3H5N A;  2IS1 A;  4C9Y A;  5J4Y A;  2EZI A;  1JUM A;  3KP6 A;  2L4M A;  4A3L J;  1XMX A;  4R8H A;  4IO9 F;  1IRF A;  3B6C A;  2HEO A;  3K0L A;  1EJ9 A;  2RAE A;  4BQQ A;  2DOF A;  3HOZ J;  5JI6 A;  1BBY A;  3TOA A;  3WU2 C;  2PLY A;  1LQ1 A;  3E5Q A;  3SEZ A;  2X85 A;  1BIB A;  4ON0 A;  1H9T A;  1DPU A;  3IH2 A;  2YR2 A;  3CMY A;  1KZH A;  1I6X A;  3FMS A;  3HBL A;  2IA2 A;  2Z2S B;  4BU2 A;  1FYK A;  2JVH A;  3E0J B;  3RI4 A;  3K2A A;  1FOY A;  2XAQ A;  4IXA A;  5BS6 A;  2FBH A;  3JRI A;  4AUX A;  3NRV A;  2PG4 A;  2B0L A;  1LE8 A;  3IAM 2;  2GOM A;  2BHY A;  1SFU A;  1F43 A;  1JKO C;  1R6R A;  4HX4 A;  3BP8 A;  5D5W B;  2VT3 A;  1JGG A;  2LOO A;  2L9R A;  1ZHF A;  2Y2Z A;  3KZI C;  4GGG A;  3ROU A;  4S05 A;  1YTY A;  2GIV A;  4JX5 A;  4LG3 A;  1HKQ A;  1OYW A;  3GZ5 A;  3SZG A;  5C44 J;  1ZN2 A;  2E60 A;  2HXI A;  2KRF A;  1A35 A;  2ZB9 A;  4UNO A;  2R7S A;  5L3B A;  3GF2 A;  4RAY A;  5LHI A;  3JCU C;  4HNV A;  3BR5 A;  3WOD F;  3KP4 A;  1MBJ A;  3NWT A;  3QPS A;  3QRF F;  4R79 A;  5HOD A;  4V2G A;  3E6C C;  2WTE A;  4IOC F;  3ML6 A;  1Z05 A;  2XUB A;  1MMA A;  3AKZ A;  1YW9 A;  3H5R A;  2KL4 A;  3K7A J;  3VYU B;  4D7M A;  1B4A A;  2CFX A;  5DD8 A;  3OYN A;  4KIS A;  2VOP A;  1R4N B;  3LSG A;  2V1D A;  1DU0 A;  4EM2 A;  2E1C A;  3PNV A;  3LNQ A;  1MSE C;  3K1P A;  5KVR A;  2ECB A;  1FMV A;  2VQH A;  2XGD A;  3RPU A;  2NS8 A;  3BTI A;  1BN5 A;  2F5D A;  3SZP A;  2OZ6 A;  3C1D A;  2R7R A;  4B48 A;  2O9L A;  4M6V A;  3E1S A;  4L9N A;  5FRO A;  3JRG A;  2H94 A;  2WAQ N;  2P81 A;  3L2V A;  1I27 A;  1W7P B;  5FRM A;  1WJC A;  4BNC A;  4IHV A;  1R1U A;  3RDI A;  4BXX J;  3HOU J;  3FX3 A;  5IY5 H;  2JSP A;  2QCO A;  2YX7 A;  1OLT A;  2EZK A;  3AAF A;  5JLW A;  1Y6I A;  3LFK A;  4KIC A;  4LG0 A;  1J0R A;  3QU3 A;  2HTS A;  2M34 A;  4FQG A;  1SAU A;  3EYY A;  3H3V K;  2KT0 A;  3ELK A;  3REO A;  5E3O A;  4WF2 A;  2R7U A;  3ESW B;  1G3S A;  3S2D J;  5FD6 A;  4M74 A;  3FXU A;  4JBA A;  2KMU A;  2NNN A;  2Y31 A;  2R7X A;  2VC1 A;  1I6H J;  2M9H A;  3U9G A;  2G7H A;  1W36 C;  3BG7 A;  1VQ7 I;  4NB5 A;  2DPD A;  4CYC B;  1WH5 A;  4ZJZ A;  4I2O A;  3DU5 A;  1ORK A;  1NG7 A;  3SDG A;  2EA4 A;  3D1N I;  4GFB A;  3KP7 A;  1DP7 P;  3LAJ A;  1W0U A;  1PJR A;  1FWZ A;  1V55 H;  3ULQ B;  1F36 A;  2NYX A;  2QSF X;  3OYF A;  1WJ5 A;  3EDP A;  2X6Y A;  1FY7 A;  1U78 A;  2NVQ J;  2VBY A;  2O61 A;  4BHC A;  3CUQ B;  1DDN A;  1FBU A;  3I4N J;  2FQ3 A;  3Q9S A;  3H3Z A;  4Z2Y A;  3HL2 A;  2OCC H;  3BG3 A;  4HEA 2;  1TWH J;  3LSH A;  3E6B A;  3K70 D;  1JT6 A;  1YIT I;  2F5E A;  1GVJ A;  4CXF A;  2HOS A;  1GT0 C;  5F04 A;  1YE9 A;  1VFC A;  3W3C A;  4RBO A;  3GW2 A;  3GFI A;  1K4T A;  4JYK A;  2ACJ A;  1S9H A;  4JQF A;  3HUG B;  1T0F A;  1WWX A;  1KYZ A;  2HFH A;  2L2O A;  4S04 A;  3O6B B;  3TO7 A;  4KYW A;  2X1D A;  4BBS J;  2L9V A;  1LE8 B;  5ICC A;  1FIP A;  5AIP A;  5BNG A;  2EWN A;  1ZRD A;  4ZTJ A;  2DN0 A;  1J7K A;  1R22 A;  1CQT A;  1XS9 A;  1U9N A;  3HM5 A;  3MMY B;  4I0A A;  5LGT A;  1G3W A;  3H9G A;  4V19 K;  2KIS A;  1J2X A;  2HYG D;  2CW7 A;  1W5S A;  3GLX A;  3AG3 H;  2EV0 A;  1LVK A;  3ZMZ A;  4HF2 A;  2LFB A;  4IQJ A;  4LK0 F;  5EDN A;  3M7G A;  2ID6 A;  5TJJ A;  3VPR A;  5D5X B;  1I3A A;  3L2U A;  4KA4 A;  3MEX A;  3H35 A;  2DA5 A;  4JOM A;  1EH6 A;  4Y15 A;  3WTX C;  2GQQ A;  1IN4 A;  2FBI A;  2ZJ2 A;  1GLN A;  1V5F A;  2Y30 A;  4QLC U;  1ETQ A;  4ENM A;  1R00 A;  2NS7 A;  3EQL F;  1ZGW A;  4CYD A;  3K9T A;  4E7J A;  1T2K A;  4M6Y A;  3DBL B;  3L09 A;  3PNT A;  2CGP A;  1IDZ A;  1GVD A;  2R7Z J;  4ESB A;  2XC7 A;  3AG4 H;  3MKW B;  2B9S A;  4BQA A;  1T56 A;  3SHF A;  4NNJ A;  3BZC A;  4EJO A;  1LFB A;  2ESH A;  4II3 A;  2EBI A;  4CCO A;  1ACI A;  1HLV A;  1UCR A;  4F7Z A;  1RKT A;  2QKL B;  3K69 A;  3I55 I;  2OTJ I;  1T08 B;  4Y33 A;  1R1T A;  1MJA A;  3LSM A;  1TC3 C;  5ILS A;  5LFA A;  3HTS B;  3K10 A;  4EGY A;  1VTN C;  2GOX B;  3CDL A;  4OWR B;  4AVP A;  4AIK A;  1BI1 A;  3CO6 C;  5J3L A;  3OL3 A;  2EFW A;  4F3Q A;  5EF6 A;  2E1N A;  1WJF A;  2NOJ B;  4BEH B;  4FIS A;  1Y8R B;  1YRN A;  4ESF A;  1LFP A;  5HLH A;  1KQ0 A;  1MSF C;  3RQI A;  5LHG A;  3KYD B;  2HNH A;  3OYG A;  2BYV E;  2FSW A;  5IP9 J;  2H27 A;  2DXI A;  4LG0 B;  4UB8 C;  1BR2 A;  2R5Z A;  1YLF A;  3ZQC A;  3MKY B;  5IP7 J;  4IHS A;  1Y0U A;  5HDG A;  1BW5 A;  3FXL A;  3J7A O;  3QOD A;  1VQ8 I;  3GTL J;  4IVN A;  1BW6 A;  3U2R A;  2JQ7 A;  4NDL A;  1ODD A;  1MBK A;  2HKX A;  4I01 A;  3MFK A;  2VAS A;  1PDN C;  1F4K A;  1U6G A;  1XMK A;  4PJN A;  2K86 A;  3PSF A;  3M1E A;  5AON A;  1MD0 A;  3KZZ A;  2EIM H;  2LY2 A;  4OU0 A;  3SDB A;  3KP3 A;  2HOE A;  1X2M A;  2DK5 A;  4P5O A;  2ZFW A;  3QAH A;  1R71 A;  1MND A;  1X1B A;  5EG0 A;  3LOC A;  2JA2 A;  3H5A A;  4QSH A;  3U1K A;  2CU7 A;  1O3R A;  4I09 A;  3FIW A;  4V2F A;  4LB6 B;  2LY9 A;  3F22 A;  3CCS I;  2QVO A;  4CCN A;  2RKH A;  4FE7 A;  2BVM A;  4DQ2 A;  1LDK B;  1AKH A;  4OIQ F;  5CVU A;  3LST A;  5J1U A;  3HC7 A;  2ZO4 A;  4YFX F;  1ZR2 A;  3ZP5 A;  2IGK A;  3RKQ A;  4LB5 A;  3IC7 A;  1WKM A;  1IW7 F;  1VQK I;  3V8K A;  3FBI B;  2A69 F;  2AXT C;  1E17 A;  2WAE A;  5FKK A;  3BJO A;  1VND A;  2JPC A;  3I9V 2;  3I59 A;  1JI8 A;  2VT2 A;  2V9K A;  2K9Q A;  5IT3 A;  2DA1 A;  5CYV A;  1KU7 A;  1IV8 A;  3WE2 A;  4HNT A;  1ZG5 A;  1EH7 A;  1OYI A;  5EEH A;  2EZL A;  1XTA A;  1TW3 A;  4XRS A;  3HOT A;  4KFC A;  2RGV A;  4FT8 A;  5FRN A;  2PBI A;  1QZZ A;  1B1B A;  4YEJ A;  1Z67 A;  2BV6 A;  2MH2 A;  1RUO A;  1ZKG A;  4E7S A;  3L2R A;  1XX5 A;  2JZY A;  5F0C A;  2DYR H;  2GIZ A;  3CME I;  2XIG A;  1YW7 A;  1HKT A;  2CMP A;  3BLY A;  2XAH A;  3CTA A;  3LQQ A;  1XSD A;  3I3L A;  2OF7 A;  4I6Z A;  3W2A A;  4A12 A;  2HXO A;  1FBS A;  1SFX A;  4ZYD A;  4EM1 A;  2R5Y B;  3CES A;  3BWG A;  2QSH X;  2WC2 A;  5IYD J;  3OSG A;  2KIQ A;  3E5U A;  1I1S A;  3TQN A;  2DA7 A;  2Z33 A;  2HI3 A;  1AU7 A;  4IOA F;  4QTR A;  1MBE A;  1MJ9 A;  1MW7 A;  2HU9 A;  2LBF B;  5BPI A;  4OIR F;  3ECH A;  4BH9 A;  2R92 J;  2KPM A;  2A6E F;  5EJC A;  4LLL A;  2ZXH A;  4WX9 A;  3CF2 A;  3L2Q A;  5IP6 A;  1G3T A;  4LFU A;  1ENH A;  2M0M A;  5J1Y A;  1VQM I;  3BZK A;  3G1O A;  5ICE A;  4XLE A;  2O6G E;  5DTD A;  1DQU A;  4MQV A;  3A01 B;  4BJT A;  2R7O A;  4HST A;  1MNE A;  3CO7 C;  1SVL A;  2YX4 A;  3CCE I;  4ENN A;  4MQ9 F;  5JVT A;  1OCR H;  1ZAO A;  3H92 A;  2OPT A;  2VE9 A;  1Z3X A;  4PK4 A;  2LK2 A;  1YG2 A;  2MD0 A;  1WQ2 A;  4CCK A;  3KET A;  4UVC A;  1VQ9 I;  2WB1 A;  1YW8 A;  2EB7 A;  3LSI A;  3OYD A;  2B7E A;  3R6S A;  4PFO A;  4F92 B;  5DUI A;  3EYI A;  1J59 A;  2CUF A;  2OAZ A;  5IOZ A;  1BJA A;  3GZN B;  3DKY A;  2FA5 A;  4XM3 A;  3FHZ A;  3K4C A;  3RZD J;  3IL2 A;  4LD5 A;  4QIW N;  3K4N A;  3V7R A;  2ELH A;  1ZLJ A;  2CFO A;  1LKX A;  3OS0 A;  4NC6 A;  3BC8 A;  2XAF A;  2ZBK A;  3ZMD A;  3T8T A;  4YFK F;  3CCM I;  2NNY A;  5EG0 B;  5IYC J;  2LVS A;  4GYG A;  3SJM A;  4G94 A;  4A3F J;  4RM3 A;  3HOV J;  1V3F A;  2QM3 A;  3PIP F;  3TW7 A;  2UV1 A;  2DOE A;  2EJR A;  2DMN A;  2VJJ A;  4RGS A;  2HKO A;  3HHG A;  4YEL A;  4RGR A;  2KHM A;  4BQN A;  1XSX A;  3LWF A;  1MGT A;  2H6B A;  3CCQ I;  2YU3 A;  3M8E A;  1SFE A;  3B6A A;  1SC7 A;  2OJE D;  2EV5 A;  4BE0 A;  2VJ5 A;  3ASO H;  4MEY F;  3KFW X;  1WZ2 A;  1W5T A;  3OYJ A;  1G6N A;  1VQO I;  1FZP B;  1IV6 A;  5E79 C;  3KE2 A;  1G2H A;  4XMY A;  1R49 A;  1ZTR A;  4FE4 A;  4RAF A;  2XKP A;  4UV8 A;  3ZQL A;  4IRI A;  3I64 A;  4M9X A;  1X4O A;  1JUS A;  2F5C A;  3MWM A;  3Q3S A;  1R23 A;  1GDT A;  5D6F A;  2JA6 J;  5JFR A;  1X58 A;  3F8B A;  3BDD A;  1IN5 A;  3TDZ C;  5KAF C;  1Q1V A;  1RKW A;  3C18 A;  3FXK A;  2XGX A;  4KN4 X;  3E5X A;  2HYJ A;  1Z7U A;  4HX7 A;  2VJ4 A;  4G8X A;  5CVJ A;  3I4M J;  2F4I A;  4X6A J;  2IW5 A;  2BY3 A;  1OMI A;  1X1A A;  4E7Z A;  5DCM A;  4BHP A;  2BE5 F;  2JK3 A;  3FF5 A;  4Q48 A;  1R9T J;  5J47 A;  1D0Z A;  4PSW A;  1WFX A;  3I0T A;  1QHG A;  1BR4 A;  1ZH5 A;  4XKV A;  2E19 A;  5EGO B;  5CJ9 A;  2ME0 A;  2HQ5 A;  2IP2 A;  2GXG A;  5FB2 A;  3S2H J;  1UHW A;  2M87 A;  2R7D A;  4XOT A;  1RES A;  3S14 J;  3SEQ A;  3ZMS A;  3LA3 A;  4XLA A;  3S2W A;  3D5R C;  4F55 A;  5E8I A;  1TNT A;  1O7F A;  5L3G A;  4EJT A;  4DZP A;  2LNB A;  2XAG A;  3IAS 2;  4OOI A;  1D5Y A;  4Q5S F;  3KX2 A;  1R4M B;  4B1R A;  3HSE A;  1QPI A;  1ON2 A;  4KT6 A;  1ETK A;  1GV5 A;  3FXM A;  4U7B A;  2W84 A;  2HDD A;  4J19 A;  2DPU A;  3TGN A;  3DU6 A;  1E2X A;  5ICF A;  1JJ8 C;  2CRG A;  3V8J A;  1DGR M;  4CZZ A;  4KNY A;  4XOR A;  1ZG3 A;  2A3S A;  4E4H A;  5E17 F;  3BR0 A;  4BXU A;  2DDB A;  3DV8 A;  3EPZ A;  3A02 A;  3DKX A;  2DJI A;  2ZSH B;  1K6Y A;  3QP5 A;  3H1C A;  3KYC B;  1XSV A;  2MH9 A;  2XF7 A;  3ZQG A;  4DYC A;  1XPX A;  4KDP A;  4JX6 A;  3OIO A;  3PM1 A;  5IT9 Z;  2DA6 A;  3KYL A;  4B09 A;  1RZ4 A;  3KCC A;  4ASN A;  2VPR A;  1O3Q A;  1LB2 A;  2OUM A;  4W1U A;  4A93 J;  3BTJ A;  3BG9 A;  3ERE D;  5F1J A;  1Y1V J;  1SVO A;  4IHW A;  1XMA A;  2D2W A;  2JA7 J;  1R36 A;  5D5V B;  2RRE A;  2NOG A;  1VQ5 I;  2ZME C;  3ZMT A;  1U5T C;  1BOB A;  1ULY A;  2ISZ A;  3ZRG A;  5J1R A;  2DT5 A;  3IP4 B;  3K1N A;  5JR3 A;  4MTD A;  4KJZ A;  1QVU A;  3TP3 A;  2CQ7 A;  1YO5 C;  5B5E C;  3HB9 A;  2N8G A;  2BZT A;  2XSJ C;  3S3O A;  3TO6 A;  3W6J B;  2OQR A;  1XN7 A;  2UXN A;  1IF1 A;  4BKX A;  4OMY A;  3FWE A;  5JHF A;  4HOB A;  1HA8 A;  2FJ1 A;  3ABT A;  3IKV A;  4FX4 A;  5J4V A;  2L0K A;  2ISY A;  3I53 A;  2K7L A;  1I5Z A;  3L9F A;  2I10 A;  3CJR B;  3VYR B;  1BI0 A;  3GTJ J;  4RB1 A;  1H8A C;  1FMW A;  2QQB A;  2FMY A;  3HOY J;  1FLI A;  3V8L A;  4G12 A;  1MMG A;  1G3Y A;  2BW3 A;  4L9V A;  3GYH X;  2WAD A;  4AYB N;  3J81 K;  1VQ4 I;  3ZQH A;  2LRD A;  2KFD A;  2PMU A;  5BMZ A;  2DFI A;  3FM5 A;  4UUT A;  1WRJ A;  2KP6 A;  2JN6 A;  3KLO A;  2EFO A;  3NAR A;  4A5N A;  1BJZ A;  4IPA A;  4HSR A;  3S15 J;  2A6T A;  5DCM B;  4A69 C;  1BM9 A;  4H4K C;  1KON A;  4EJU A;  2H1K A;  3IRQ A;  3G1L A;  4UUV A;  3DP7 A;  4E70 A;  2M8E A;  1GV2 A;  4RS8 A;  4XOP A;  4CGZ A;  2IBD A;  2AQE A;  5B1A H;  1Z1D A;  2WAF A;  3BT9 A;  5GTI C;  4R1H A;  4DOZ A;  1SMY F;  4PJL A;  1MH3 A;  2PN6 A;  1KU3 A;  3IHU A;  3JR9 A;  1QBJ A;  4D9J A;  5TIS C;  4IHX A;  4EJW A;  5C4X J;  1J5Y A;  2PQ8 A;  5D8K B;  3MVP A;  1R1V A;  1OIS A;  2Y0S N;  1YHQ I;  2X1C A;  4B44 A;  3HG9 A;  2GLO A;  4EAT A;  2VXD A;  2EV6 A;  4LMY A;  5E3L A;  2JUC A;  3T0Y A;  2F4O B;  4GO1 A;  3CCU I;  2DA2 A;  1I39 A;  2LLK A;  1HC8 A;  3FBN B;  2VPL A;  4DZJ A;  3C2G A;  5F08 A;  2CQX A;  4RM2 A;  4HW0 A;  1TL8 A;  1B9N A;  2KJB A;  3SFZ A;  2L3D A;  1W36 D;  2OCE A;  3P9K A;  4C3H J;  1LDD A;  2Q1Z B;  2EIN H;  2GAU A;  4XR6 A;  2PMH A;  3WGI A;  2GWR A;  2LP0 A;  4XLH A;  3IH3 A;  5K1Y A;  2W1O A;  4AM3 A;  2K3F A;  3NQO A;  3N4M A;  1Y8Q B;  3S8P A;  1IRZ A;  2E36 A;  1Z0X A;  2F5F A;  2NVT J;  2XHK A;  1TQI A;  4Y4R A;  3RJP A;  4YIF A;  4HDV A;  3GTG J;  5BOX A;  2O5R A;  3HTU A;  1U8R A;  3HZJ A;  4XRF A;  1QPM A;  2CS3 A;  2DFE A;  2QEN A;  1EF4 A;  1Z3Y A;  2OZU A;  1OCO H;  3D5L A;  1X4P A;  4M9S A;  1RPW A;  1H0M A;  3K4K A;  1JTY A;  1P4X A;  3I56 I;  2OTL I;  2QQ9 A;  3ZQ7 A;  3K6G A;  1B6A A;  2XB0 X;  4WCG A;  2RDP A;  4M73 A;  2Y75 A;  1MDM A;  2B63 J;  3W2V A;  2Q0O A;  1MBH A;  1OFC X;  5F27 A;  5EEG A;  3CJT B;  1WI3 A;  2NVX J;  3DPT A;  3QPL A;  2QSG X;  4HBL A;  1NHA A;  3MQ0 A;  1O3T A;  3CCR I;  2GXB A;  1L3L A;  3X2Q H;  3S93 A;  2PX9 A;  2XGE A;  3EUK L;  2PEX A;  4IRH A;  1HXD A;  3RCO A;  3BTC A;  2JRT A;  3FMR A;  1B9M A;  2VJI A;  1O4X A;  1FNN A;  2M2E A;  1N25 A;  2EFQ A;  5HLG A;  1EH8 A;  1DGW Y;  3J81 Z;  4RB0 A;  2A68 F;  3FXJ A;  3M07 A;  1FSE A;  5LRR A;  2EPF A;  4M72 A;  4MFD A;  4PZJ A;  4NHJ A;  2FUG 2;  1USS A;  2FQ4 A;  1E3P A;  3OYK A;  4AC0 A;  2LD5 A;  3FZV A;  3RPQ A;  3V7C A;  3LA2 A;  2JWT A;  1I1G A;  5JLX A;  3HEF A;  5F6F A;  3O8H A;  4Y52 J;  2I5U A;  1ZRE A;  2XAS A;  4MGR A;  3EUH C;  2PMZ A;  4IZZ A;  1MNM C;  2FU4 A;  2VL8 A;  3S3N A;  2A61 A;  4NQW A;  5CQG A;  3M9A A;  1WHU A;  3FM3 A;  1AA7 A;  2IS6 A;  5H6Q A;  3HSR A;  1X19 A;  2BY2 A;  2IA1 A;  4JK1 X;  2DTR A;  2VI6 A;  2ZNY A;  1TWF J;  3TL4 X;  5LGN A;  3OYL A;  2C6Y A;  4A0X A;  4A0Z A;  4UUS A;  2W00 A;  4I0B A;  2JMW A;  2FXA A;  3ZOB A;  3A0H C;  2OBP A;  5HVQ C;  1H89 C;  2GXA A;  2Q2E A;  3QOE A;  1ZAR A;  4A6E A;  4BL0 B;  3AG1 H;  3OYE A;  2CH0 A;  3BCB A;  5L3F A;  2BBY A;  5GP9 A;  1D1C A;  1KQ8 A;  5B3S H;  2R7T A;  4D5C A;  3GVA A;  2DT7 B;  1DU6 A;  2DMP A;  4EJV A;  3SXY A;  2GM4 A;  2JPB A;  1TWA J;  2IT0 A;  2LTP A;  2X48 A;  1IN6 A;  1TW2 A;  2IGO A;  2ZXW H;  4HX8 A;  5JHU A;  1VQP I;  2O8X A;  2DDA A;  2BVL A;  2XF6 A;  3F8N A;  5E18 F;  1OR7 C;  2L4A A;  1X3U A;  4RAG A;  3LAP A;  5D4S A;  1IAW A;  2FNP A;  2EQR A;  1FPQ A;  3Q9V A;  3R0J A;  4NUB A;  3PUF A;  3OIQ A;  4B47 A;  3BR2 A;  3R61 A;  5D6E A;  3G2B A;  5IOY A;  2KIM A;  2XKO A;  3I5U A;  3G4S I;  2MLG A;  4UVB A;  1JHF A;  4WWC A;  2MAB A;  2YS9 A;  5K5Q A;  5D4R A;  2VQC A;  4I76 A;  3B02 A;  4CZC A;  2PFB A;  2JT1 A;  4JP0 A;  3LFU A;  2OD5 A;  2R7V A;  2Z9O A;  3E6D A;  5L3E A;  3Q5F A;  1WPK A;  4DGW B;  2HDW A;  4UY8 I;  2G0E A;  4A5M A;  2D5V A;  2E2H J;  4HA8 A;  1MDM B;  3O8G A;  5IYB J;  1T8I A;  3ZGK A;  3T5X A;  4XLC A;  4CO8 A;  3GWZ A;  3DEE A;  2P5L C;  4BY1 J;  2DOD A;  1Z6T A;  3RKW A;  1RR8 C;  3MZ8 A;  3GTO J;  3VEP A;  4E7I A;  4Q47 A;  5L3C A;  1SD4 A;  3MZY A;  3HRM A;  2F5V A;  2HYF A;  3VOD A;  4L18 B;  3E97 A;  3UNG C;  1D1A A;  4YG2 F;  3IWZ A;  4YIR X;  4U88 A;  3FKJ A;  2VQL A;  1YX3 A;  1E0E A;  2COM A;  1K83 J;  1V4R A;  1U0J A;  4PCQ A;  3BOQ A;  2DQR A;  3F72 A;  1GXP A;  1Z77 A;  3BZ6 A;  5IPA A;  3JSO A;  3OYC A;  1N78 A;  5B1B H;  2Y48 A;  4BJ6 C;  1JKP C;  4D5F A;  4XL9 A;  3BY6 A;  2LY1 A;  2H09 A;  1O3S A;  1HDD C;  5LGU A;  2GA2 A;  3PIO F;  4O6J A;  3E6M A;  3GME A;  3FK7 A;  2X1E A;  1DUX C;  4F93 B;  3I71 A;  2EA2 A;  3QYF A;  3H3U A;  4EV0 A;  3DPU A;  3GLL A;  3T1B A;  4MNU A;  4NQW B;  1OJL A;  4GCV A;  4X0G A;  3FMQ A;  1UB9 A;  4EMS A;  5E3N A;  4MIM A;  3BPV A;  1K7A A;  1S8N A;  2P5K A;  1JXS A;  4Y13 A;  3L2W A;  2CW0 F;  1D0Y A;  3F6V A;  4GYI A;  2QBY A;  3VWB A;  2F6C A;  1OCC H;  2Q2E B;  2LKS A;  3HGG A;  3AL0 B;  1KQ9 A;  2FNA A;  4QPO A;  4RLQ A;  2V1N A;  2L54 A;  4BS9 A;  4IL6 C;  3G1M A;  3WGG A;  3Q0U A;  5C3E J;  2VKH A;  2L9S A;  2A07 F;  1XCB A;  1S72 I;  2HDC A;  3WU0 A;  1RET A;  5E1W A;  1YIJ I;  1X3Z B;  1AWC A;  3ASN H;  1S3J A;  5FLV A;  1V5E A;  3MAJ A;  2D1V A;  1SD6 A;  2X6X A;  3PSI A;  4FX0 A;  2VBX A;  1SD5 A;  5CLS A;  2J5O A;  1C0W A;  3VYT B;  2F48 A;  3CUQ C;  3HOS A;  2XSD C;  3D0S A;  2DMT A;  3BPX A;  3R4K A;  4KIF A;  2BEO A;  2DU9 A;  1P6R A;  1FOW A;  3GX4 X;  1AHD P;  5CQE A;  2KZG A;  2DQL A;  2K85 A;  4I7H A;  3MN2 A;  1TZL A;  2KDO A;  5C4J J;  2K02 A;  3ZQF A;  5FGM A;  4IQ4 A;  2HVQ A;  1VQL I;  1O57 A;  3JTH A;  3HOX J;  3JW4 A;  3RKY A;  1T39 A;  3GBG A;  1SD7 A;  2CWE A;  1HDP A;  2V6E A;  4FET A;  2FOK A;  4P9F A;  2KRC A;  2VOO A;  2R7F A;  2XPU A;  3KLN A;  1FIA A;  4X1E A;  4ZYH A;  5ICG A;  5ILV A;  3G71 I;  2HPM A;  2W48 A;  3ZPL A;  3RQ4 A;  2PJP A;  2QQA A;  2HZT A;  1YRN B;  2G7U A;  1ZYR F;  3PO2 J;  2CUE A;  1HQC A;  4CDG A;  2ETH A;  3BRO A;  5GAD J;  1V54 H;  2DMQ A;  4E7K A;  1PP8 F;  3WHC A;  2V9P A;  3QYE A;  3RYP A;  5KCM A;  2LG4 A;  2R5Z B;  3MCZ A;  1D5V A;  5DM6 F;  1NTC A;  1KU2 A;  1Y56 A;  4IJA A;  2CUJ A;  3OOU A;  2PMZ N;  1CF7 A;  3OR1 C;  1LPQ A;  1ZRC A;  3JAM Z;  3W2W A;  2JA8 J;  4E7H A;  1QO0 D;  1RRJ A;  2ELJ A;  3BR1 A;  3WU1 B;  1OYY A;  2F4M B;  4NC7 A;  4LK1 F;  2MLK A;  1BC7 C;  4WXC A;  1ZK8 A;  3WTZ A;  1Z9C A;  3U1D A;  2KKO A;  1TQP A;  1JHH A;  4HNU A;  3CMM A;  3QU6 A;  1R7J A;  3M8F A;  4L5E A;  4RB3 C;  5IT9 K;  3RSN A;  1JTX A;  3CC7 I;  4KIB A;  1SEU A;  5E20 A;  4ZYE A;  2CQK A;  1JKR C;  2KDZ A;  3COA C;  2PI0 A;  2HQA A;  1AKH B;  1YFH A;  3PQJ A;  2K40 A;  2P7C B;  1CGP A;  1XCV A;  2XAU A;  4D7N A;  1MJB A;  3DQV C;  1KGS A;  1OQY A;  2W25 A;  4OIN F;  1WJD A;  5J40 A;  1VQN I;  2VON A;  2M8G X;  3HYI A;  2RQP A;  3OY9 A;  4DJA A;  3G6E I;  1P4A A;  2E1M C;  2HOA A;  1FTZ A;  2HPI A;  3ZMV A;  4RDU A;  3I59 B;  4HZF A;  4U0V A;  1FC3 A;  2BY0 A;  3LMM A;  4FHT A;  1Z7L A;  4L0Y B;  3S1N J;  2QBY B;  2DMU A;  1FOX A;  2CYY A;  3EUH A;  2CV1 A;  1JE8 A;  1J75 A;  4KN7 X;  5DV5 A;  3BTL A;  4P55 A;  1SFO J;  3LQR A;  3JRC A;  1KA8 A;  2MGQ A;  4MTE A;  5KNL A;  4M3E A;  4U87 A;  2UZK A;  1U3E M;  4I98 B;  1O7L A;  5GPC A;  1P7J A;  2MG4 A;  3JRD A;  3H9Q A;  2COB A;  1IXR C;  3G73 A;  3IKT A;  2AHQ A;  2E5Z A;  4XSX F;  2VUM J;  2LF8 A;  1UFM A;  2HTJ A;  1KYW A;  1SFK A;  2LRE A;  4DNC A;  3K4J A;  3QPH A;  1EKE A;  2FRH A;  3BG6 A;  1MH4 A;  4W97 A;  4A3I J;  5EZH A;  5FKM A;  1REP C;  4Q4Z F;  4A3M J;  2KIF A;  4L9T A;  3WHB A;  1H88 C;  4LGW A;  4II2 A;  4ZC3 A;  1QZY A;  2WAQ A;  4ZYG A;  1HOM A;  3OOP A;  4D1Q A;  5FFX A;  1MKM A;  5LRS A;  2XRL A;  1P2F A;  5H20 A;  2CV0 A;  2MD5 A;  3KP2 A;  3JRF A;  2P7V B;  1OR7 A;  3H36 A;  1T6S A;  3LSK A;  5DEQ A;  4B43 A;  1YJ9 I;  3ZN1 A;  4G7Z F;  3DXJ F;  1QRY A;  3WTU C;  1XGO A;  3GXO A;  2ZJR F;  4HF1 A;  3UKG A;  2DYS H;  1ETV A;  4DYR A;  1UJ8 A;  2MC3 A;  3ABL H;  2IAI A;  4E7L A;  3J7A Y;  2TDX A;  1K79 A;  2EFP A;  1ETW A;  1P92 A;  1SVM A;  3GCM A;  3L2C A;  4C3I J;  2O3F A;  2KRH A;  4B8X A;  1OCZ H;  2NAZ A;  2TCT A;  2UUZ A;  3DLA A;  3CQZ J;  4XQF A;  3V4G A;  1XB4 A;  4L5J A;  4ZZL A;  4XRS G;  2DO7 A;  3EUA A;  2V9V A;  3CF5 F;  3GEZ A;  1K4S A;  1M1E B;  1S6L A;  2P6S A;  3CJQ B;  1IC8 A;  1HF0 A;  2RVC A;  3EET A;  2BGC A;  3GFL A;  3RIR A;  5HS8 A;  3PQK A;  1CF7 B;  1TQM A;  1X1P A;  2ZFU A;  1D1B A;  5E1X A;  5GTH C;  4FCY A;  5HNH A;  1Z6R A;  3C2H A;  3LL7 A;  4XID A;  2DCE A;  2L7K A;  5HOO A;  3CCJ I;  2E2J J;  3H9J A;  2LH9 A;  3IRR A;  3DEW A;  1BA5 A;  1RR7 A;  4DBQ A;  1POG A;  3ONQ A;  1HSJ A;  5FKO A;  3LSP A;  3S16 J;  2V79 A;  4CIC A;  4CCM A;  5CKT A;  3S1Q J;  1TT0 A;  2Y0M A;  3A03 A;  5K7Z A;  1LVA A;  2K4B A;  5HS7 A;  4EEF G;  4XN0 A;  4BBR J;  2O8K A;  2CJJ A;  3CC2 I;  3BJ6 A;  3KEY A;  3T8R A;  2VN2 A;  4UXN A;  4OMZ A;  2JRM A;  3HIF A;  2HZD A;  5EZG A;  4CHU A;  1IN8 A;  2EK5 A;  2ESN A;  1YJW I;  3BQY A;  3M8J A;  1UEL B;  3KP5 A;  3VB2 A;  3G3Z A;  3SYT A;  3PL8 A;  5LD2 C;  4BXF A;  2M0C A;  3WGH A;  3N05 A;  3P9I A;  2EH3 A;  2FOW A;  1WJA A;  4O3M A;  2CSO A;  3I54 A;  1X1C A;  2WBM A;  2O03 A;  4N0B A;  1MMD A;  4IX7 A;  4HLY A;  2K5C A;  4FTH A;  1U8B A;  2Y9Z A;  2EZH A;  3JSP A;  4F91 B;  5DCF A;  5A2Q K;  3MKZ A;  3SZT A;  3DF8 A;  3GZ6 A;  2XV4 S;  1QVT A;  2GA1 A;  1K78 A;  2W7N A;  4C2T A;  3BQZ A;  3ABK H;  4MEX F;  2L5Q A;  5LLQ A;  2M1B A;  3HHH A;  2JA5 J;  1E3H A;  1G8X A;  2NXN B;  3L7W A;  1S7O A;  4YFN F;  2DTZ A;  3Q0V A;  4S0H B;  3RKX A;  4KMF A;  2IPQ X;  5K7F A;  4CCL A;  2VKD A;  1Y0N A;  1JGS A;  4BHB A;  2WY8 Q;  1RI7 A;  5H6R A;  4M6X A;  4PGH A;  2QLZ A;  4CYC A;  2I8D A;  2AO9 A;  5D5U B;  3GTM J;  3IH4 A;  5TGT A;  1ETY A;  1P9Q C;  1EA3 A;  1YS6 A;  2WB1 N;  1BL0 A;  3FXQ A;  4RAZ A;  2STW A;  4XNF A;  2BY1 A;  1MMN A;  1J9I A;  3P5J A;  2JSC A;  4CSW A;  3OYB A;  1YX5 A;  3ZQI A;  4GXO A;  4CUG A;  4NBQ A;  3DTI A;  4HV5 A;  1FEX A;  3TP0 A;  4EQQ A;  1STZ A;  2V26 A;  1APL C;  3CUQ A;  5HNF A;  3KEQ A;  4Y3O A;  1IGN A;  1PUE E;  3ZXS A;  3GFM A;  3DEU A;  2K9S A;  1V5G A;  2HQR A;  1L0O C;  2IA0 A;  4AWX B;  4ENJ A;  3GTQ J;  5BPD A;  2LDU A;  1WI9 A;  5F64 A;  2TRT A;  2OC6 A;  5F1R A;  2ICW G;  2EIK H;  2RV8 A;  3HUG A;  1WJE A;  3R0A A;  5GPA A;  2L02 A;  4BUP A;  3DTK A;  5CPR B;  3GFJ A;  2LR8 A;  1JUP A;  1D3Y A;  1A31 A;  2H1L A;  3E3V A;  2ZSI B;  3V42 A;  3U21 A;  2IXS A;  2CQN A;  3CC4 I;  2YUS A;  1G59 A;  4U0Y A;  1OKR A;  1IN7 A;  2XGC A;  1R5H A;  2M30 A;  2MSY A;  2E71 A;  1PYV A;  3DFG A;  2M45 A;  4AD9 A;  2DT6 A;  3H0G J;  3IV5 A;  2XAJ A;  2XVC A;  4IF4 A;  2Y9Y A;  4A3E J;  1QA6 A;  1VZ0 A;  2PJR A;  3H0D A;  1NK3 P;  4ZDO A;  2XF5 A;  4ZYA A;  2JVG A;  2P4W A;  9ANT A;  1TNS A;  5CVR A;  5EYR A;  1H9G A;  2CG4 A;  3J80 Z;  2VKE A;  1ZQ3 P;  5KHD A;  2QWW A;  2VOD A;  3DBH B;  2E7W A;  3F6O A;  2J5P A;  1WVR A;  4BGD A;  3S32 A;  1T38 A;  1PP7 U;  4ZH4 F;  1UZC A;  2P0W A;  4B3X A;  5A2Q Z;  1WGX A;  3A2K A;  2CUZ A;  4LLG F;  1YI2 I;  1XG1 A;  5F0H A;  4O5V A;  1RUN A;  3F3X A;  5D8L B;  2O7O A;  2OV7 A;  3L1P A;  4OAY A;  4BEH A;  3CD6 I;  3M4O J;  5EEA A;  2NS0 A;  4J00 A;  4BAC A;  4QWQ A;  2HQN A;  4G6T B;  4DBR A;  2A6H F;  2QKM B;  3A0B C;  4LOC A;  3CJN A;  1JT0 A;  2RC4 A;  1LNW A;  1K78 B;  2RQQ A;  4IHY A;  2FE3 A;  1X1D A;  1OPC A;  1HKS A;  2JTV A;  2BW3 B;  4N9I A;  2M7B A;  1BR1 A;  1WJB A;  3N97 A;  4HG2 A;  5DDG A;  3KZY A;  2R93 J;  1P4W A;  3WTT C;  4GRI A;  2X4H A;  1Z91 A;  1A04 A;  1WCM J;  4L5I A;  5J8F A;  4HDU A;  3K1M A;  3DLL F;  1GHC A;  5LEK A;  1QGP A;  2K27 A;  1ERD A;  1XGS A;  3ZR8 X;  4LLN A;  2XPW A;  4U0W A;  4ZDP A;  2QEX I;  1KU9 A;  2RNG A;  4XLF A;  4IEJ A;  3SQN A;  3TKY A;  5HLI A;  4BYY A;  1A6I A;  3VSL A;  4XLP F;  3PNY A;  3F8C A;  4M3D A;  5ED4 A;  2VC0 A;  6PAX A;  4HRI A;  4C2U A;  4KT5 C;  3OS1 A;  2DI3 A;  2X6O A;  4TV7 A;  1HST A;  1W1W E;  3O3K A;  2LKX A;  4XIC A;  2M4G A;  2P8T A;  4PDK A;  3CCL I;  2DAO A;  2LC2 A;  1TP4 A;  1UHM A;  2WWY A;  4P1W A;  3MD2 A;  3K4M A;  1ON1 A;  2VLA A;  3QWL A;  1HW5 A;  1HCR A;  1D0X A;  1WH7 A;  1X3W B;  3C3W A;  3WTS C;  2IS2 A;  3RZO J;  4WXD A;  1ETX A;  3CZ6 A;  5DS9 A;  1I50 J;  4ENK A;  1ONV A;  3CCV I;  1IG7 A;  3P9C A;  3GUD A;  2M7A A;  3FXR A;  1FX7 A;  2VQG A;  3P7N A;  3AG2 H;  4BDZ A;  3TO9 A;  4CCJ A;  1B8I A;  3J7Z I;  5GAH J;  2QZ8 A;  1VI0 A;  5HLT A;  2A5W A;  1QHH D;  2FX0 A;  1IO2 A;  2A5Y B;  3S1R J;  2HOT A;  2FEZ A;  4A6D A;  3F21 A;  3HPG A;  2R5Y A;  1HW2 A;  1YYV A;  2EIL H;  4CH7 A;  2PJR B;  2DOA A;  4XN3 A;  1TWG J;  1XGM A;  3K2Z A;  2VXZ A;  2K3P A;  3VFZ A;  4OAZ A;  3BJA A;  2BXZ A;  4D0P A;  5ERI A;  2LBF A;  3QQA A;  4MFE A;  1TT5 B;  3K70 C;  3HKZ A;  1GXQ A;  2ZCW A;  4N4O B;  3HRS A;  3CP8 A;  4C30 A;  4EM0 B;  1W7P D;  1FYL A;  3ZMU A;  2XDV A;  4C2M J;  5FO5 A;  4AIH A;  2DBB A;  1MMS A;  3DTE A;  1X2N A;  2LSO A;  4IKF A;  1IJW C;  2Z3Y A;  1W4M A;  4AID A;  3TMO A;  2E34 A;  3A1Y A;  4PSX A;  2H6C A;  2LF7 A;  3NAU A;  3OMY A;  2IJL A;  4KMU X;  3A01 A;  1YS7 A;  2MW8 A;  2W4S A;  4AU7 A;  2ME6 A;  4E6K G;  4Y7N J;  4RGX A;  4PFP A;  2ZME A;  3IUO A;  3ZN0 A;  1W0T A;  2LYC A;  4B4C A;  5M3F J;  3ERM A;  1U5T A;  5ILU A;  2KIU A;  2IGN A;  2VB6 A;  2Z5U A;  3DPL C;  3ABM H;  1YOV B;  1QZE A;  2L01 A;  2FBK A;  3JAM K;  3CLO A;  2HWV A;  2LMD A;  2V6C A;  2E1M B;  5HS9 A;  4XK4 A;  1MZB A;  5DM7 F;  2L7M P;  1S29 A;  1J09 A;  3MKL A;  5K5R A;  3MZH A;  3BR3 A;  4OIO F;  2MBF A;  3F9K A;  4A3G J;  1LEB A;  3Q0W A;  5K5O A;  4LIV A;  3L00 A;  1NG6 A;  1BOA A;  3PUB A;  5LHH A;  2HVS A;  2CO5 A;  2VIX A;  3JRE A;  4MHG A;  2D45 A;  4EVI A;  2RNJ A;  1S7A A;  1IXS B;  4JX4 A;  2ECC A;  2NVU B;  3WE3 A;  3E7L A;  3GTP J;  1WSU A;  1N75 A;  5CVI A; 
#chains in the Genus database with same CATH homology
 1ZGJ A;  2ZKZ A;  2FML A;  2Q8K A;  3I58 A;  2G9W A;  4U7D A;  4UV9 A;  5FFZ A;  1XD7 A;  4L0Z B;  1ZLK A;  2K4J A;  3WG9 A;  2E7X A;  4Y17 A;  2IRF G;  3JTG A;  1D8J A;  1U2W A;  4KUM A;  2HGC A;  1IXC A;  2DK8 A;  4YII A;  4G9Y A;  4P96 A;  1IUY A;  3ABU A;  2ADU A;  1AOY A;  5LBQ A;  2GZW A;  2OU2 A;  2XRN A;  2LKP A;  4WK8 F;  3QPT A;  5DD4 A;  2WV0 A;  4IHT A;  3I4P A;  4AIJ A;  1R58 A;  3CUO A;  1RNL A;  5DUK A;  3O2P E;  3HSF A;  1FOK A;  5E8G A;  4A2U A;  5AIQ A;  1RIO H;  4L9J A;  2ZME B;  5J6X A;  4OIP F;  5TRD A;  1U5T B;  3DKW A;  4ETS A;  5E1Z B;  1BI2 A;  4LJZ F;  2DLL A;  1QQI A;  3RYR A;  4RGU A;  2AS5 F;  3V7S A;  3WTV C;  2DW4 A;  1YIO A;  3F8M A;  3R60 A;  2HR3 A;  3F23 A;  2ZNZ A;  1BIA A;  1ZG1 A;  1K6O A;  2STT A;  2V1U A;  4HAM A;  4XLN F;  2UXX A;  1XGN A;  4K2E A;  5BQT A;  5J8C A;  2P6T A;  5L3D A;  1EV7 A;  1R5G A;  3B73 A;  2YSR A;  1FYM A;  4I02 A;  2W24 A;  2KJC A;  4H0E A;  2FF4 A;  4G7H F;  3LA7 A;  1XDS A;  4UVA A;  4HQE A;  5FLX K;  4HV6 A;  4HF0 A;  1UST A;  1LDJ A;  4G6Q A;  2W85 A;  3WTY C;  1LJ9 A;  3F8F A;  1DPR A;  4EGZ A;  1B59 A;  1F9N A;  3TDU C;  1FP1 D;  1LEA A;  2D1H A;  3RTR A;  1IRG A;  2NRA C;  5LEJ A;  2P5V A;  1FT9 A;  2R3S A;  1F5T A;  3OV8 A;  2YPR A;  3ECO A;  3VOE A;  4G7O F;  4PGG A;  2XRO A;  1BC8 C;  2AXL A;  4IRG A;  1T98 A;  2F2E A;  3WTW C;  1ZRF A;  2ZXJ A;  2W57 A;  1BI3 A;  4BAY A;  1D8K A;  3C7J A;  4UHT A;  4HYE A;  1SMT A;  2QUF A;  5CVV A;  2Z99 A;  1Q1H A;  1IZ1 A;  4A0Y A;  5HDN A;  1TTY A;  1ZGA A;  3PFI A;  4HLX A;  1TLH B;  2OQG A;  1FBQ A;  1F1Z A;  1FP2 A;  2QYO A;  3NEU A;  4M9Z A;  3HRU A;  1YQA A;  1TBX A;  3ISP A;  2MA3 A;  4HQM A;  4XBF A;  2VBW A;  1FSH A;  3J80 K;  3TOB A;  2O0Y A;  2X0L A;  3QP6 A;  1HBX G;  5KK1 A;  3HRT A;  2EFN A;  2VBZ A;  3IWF A;  4N9H A;  2HS5 A;  2V1X A;  4ESJ A;  2UWM A;  1W7P A;  3CDH A;  5FLX Z;  5FD5 A;  4XSZ F;  4ZZD A;  3GO5 A;  3KEO A;  4P9U A;  1SAX A;  1QNT A;  2M5W A;  4KIG A;  2VE8 A;  4RB2 C;  4M71 A;  5HDK A;  4WXH A;  5DYM A;  2IVM A;  3W6K B;  1G4D A;  1HW1 A;  4G6D A;  3QOP A;  1XDU A;  2OA4 A;  2RN7 A;  3KP6 A;  2L4M A;  4R8H A;  1IRF A;  2HEO A;  3K0L A;  5JI6 A;  1BBY A;  3TOA A;  2PLY A;  1LQ1 A;  3E5Q A;  1BIB A;  4ON0 A;  1H9T A;  1DPU A;  2YR2 A;  1I6X A;  3FMS A;  2IA2 A;  1FYK A;  3RI4 A;  2XAQ A;  4IXA A;  5BS6 A;  2FBH A;  3NRV A;  2PG4 A;  2B0L A;  1SFU A;  4HX4 A;  5D5W B;  3BP8 A;  2VT3 A;  1ZHF A;  4GGG A;  3ROU A;  4S05 A;  1YTY A;  2GIV A;  1HKQ A;  1OYW A;  3GZ5 A;  1ZN2 A;  2KRF A;  4UNO A;  5L3B A;  3GF2 A;  4RAY A;  5LHI A;  3WOD F;  3KP4 A;  3QRF F;  4R79 A;  3E6C C;  2WTE A;  3ML6 A;  1Z05 A;  2XUB A;  1YW9 A;  1B4A A;  2CFX A;  5DD8 A;  2VOP A;  2V1D A;  4EM2 A;  2E1C A;  3K1P A;  5KVR A;  3RPU A;  1BN5 A;  2F5D A;  3SZP A;  2OZ6 A;  3C1D A;  4L9N A;  2H94 A;  1I27 A;  1W7P B;  4BNC A;  1R1U A;  3RDI A;  3FX3 A;  2YX7 A;  3AAF A;  3LFK A;  4KIC A;  4LG0 A;  1J0R A;  3QU3 A;  2HTS A;  3EYY A;  3REO A;  3ELK A;  4WF2 A;  1G3S A;  5FD6 A;  4M74 A;  3FXU A;  4JBA A;  2NNN A;  2VC1 A;  3U9G A;  2G7H A;  4NB5 A;  2DPD A;  4I2O A;  2EA4 A;  3KP7 A;  1DP7 P;  3LAJ A;  1FWZ A;  3ULQ B;  2NYX A;  3EDP A;  1FY7 A;  1U78 A;  2VBY A;  2O61 A;  4BHC A;  3CUQ B;  1DDN A;  1FBU A;  2FQ3 A;  3Q9S A;  3H3Z A;  4Z2Y A;  3E6B A;  2F5E A;  1GVJ A;  4CXF A;  3GW2 A;  3GFI A;  2ACJ A;  4JQF A;  1T0F A;  1WWX A;  1KYZ A;  2HFH A;  4S04 A;  3O6B B;  3TO7 A;  4KYW A;  5ICC A;  5AIP A;  1ZRD A;  2EWN A;  1J7K A;  1R22 A;  4I0A A;  5LGT A;  1G3W A;  1J2X A;  2HYG D;  1W5S A;  3GLX A;  2EV0 A;  3ZMZ A;  4HF2 A;  4LK0 F;  3M7G A;  5TJJ A;  5D5X B;  4KA4 A;  3MEX A;  4Y15 A;  1EH6 A;  3WTX C;  2GQQ A;  1IN4 A;  2FBI A;  2ZJ2 A;  4QLC U;  4ENM A;  1R00 A;  3EQL F;  4CYD A;  3K9T A;  1T2K A;  4M6Y A;  3L09 A;  2CGP A;  4ESB A;  4BQA A;  3SHF A;  4EJO A;  2ESH A;  1UCR A;  4F7Z A;  3K69 A;  1R1T A;  1MJA A;  5ILS A;  3HTS B;  1VTN C;  4EGY A;  4AVP A;  4AIK A;  1BI1 A;  3CO6 C;  2EFW A;  2E1N A;  4ESF A;  5HLH A;  1KQ0 A;  5LHG A;  2BYV E;  2FSW A;  2H27 A;  4LG0 B;  1YLF A;  4IHS A;  1Y0U A;  5HDG A;  3J7A O;  4IVN A;  3U2R A;  1ODD A;  4I01 A;  2HKX A;  3MFK A;  1PDN C;  1F4K A;  1U6G A;  1XMK A;  5AON A;  2K86 A;  3M1E A;  1MD0 A;  3KZZ A;  4OU0 A;  3KP3 A;  2HOE A;  4P5O A;  2DK5 A;  2ZFW A;  3QAH A;  1O3R A;  4I09 A;  4LB6 B;  3F22 A;  2QVO A;  2RKH A;  4DQ2 A;  1LDK B;  4OIQ F;  5CVU A;  3LST A;  2ZO4 A;  4YFX F;  3ZP5 A;  4LB5 A;  3IC7 A;  1WKM A;  1IW7 F;  3V8K A;  2A69 F;  1E17 A;  3BJO A;  2JPC A;  3I59 A;  2VT2 A;  5IT3 A;  5CYV A;  1KU7 A;  3WE2 A;  1ZG5 A;  1EH7 A;  1OYI A;  5EEH A;  1TW3 A;  3HOT A;  4KFC A;  2RGV A;  4FT8 A;  2PBI A;  1QZZ A;  1B1B A;  2BV6 A;  2MH2 A;  1RUO A;  2JZY A;  2XIG A;  1YW7 A;  1HKT A;  2XAH A;  3CTA A;  3LQQ A;  1XSD A;  4A12 A;  1FBS A;  1SFX A;  4ZYD A;  4EM1 A;  3BWG A;  2WC2 A;  3E5U A;  1I1S A;  3TQN A;  2Z33 A;  1MJ9 A;  5BPI A;  4OIR F;  3ECH A;  4BH9 A;  2A6E F;  4LLL A;  4WX9 A;  1G3T A;  4LFU A;  5ICE A;  2O6G E;  4MQV A;  3CO7 C;  2YX4 A;  4ENN A;  4MQ9 F;  5JVT A;  1ZAO A;  3H92 A;  2VE9 A;  1YG2 A;  1WQ2 A;  3KET A;  4UVC A;  1YW8 A;  2EB7 A;  3R6S A;  5DUI A;  3EYI A;  1J59 A;  2OAZ A;  1BJA A;  2FA5 A;  3FHZ A;  3IL2 A;  4LD5 A;  3V7R A;  2ELH A;  1ZLJ A;  2XAF A;  2ZBK A;  3ZMD A;  3T8T A;  4YFK F;  2NNY A;  4GYG A;  4G94 A;  1V3F A;  2QM3 A;  2EJR A;  4RGS A;  2HKO A;  3HHG A;  4RGR A;  1XSX A;  3LWF A;  1MGT A;  2H6B A;  2YU3 A;  3M8E A;  1SFE A;  2EV5 A;  4MEY F;  3KFW X;  1W5T A;  1G6N A;  1FZP B;  3KE2 A;  2XKP A;  4UV8 A;  4IRI A;  3I64 A;  4M9X A;  2F5C A;  3MWM A;  1R23 A;  5D6F A;  5JFR A;  3F8B A;  3BDD A;  1IN5 A;  3TDZ C;  3C18 A;  2XGX A;  4KN4 X;  3E5X A;  1Z7U A;  4HX7 A;  4G8X A;  5CVJ A;  2IW5 A;  1OMI A;  5DCM A;  4BHP A;  2BE5 F;  3FF5 A;  4Q48 A;  3I0T A;  1ZH5 A;  5CJ9 A;  2IP2 A;  2GXG A;  5FB2 A;  1UHW A;  2M87 A;  2R7D A;  3ZMS A;  3LA3 A;  3S2W A;  5E8I A;  1TNT A;  1O7F A;  5L3G A;  4EJT A;  2LNB A;  2XAG A;  4OOI A;  4Q5S F;  3HSE A;  1ON2 A;  4U7B A;  2W84 A;  2DPU A;  3TGN A;  1E2X A;  5ICF A;  3V8J A;  4CZZ A;  4KNY A;  1ZG3 A;  2A3S A;  5E17 F;  4BXU A;  3DV8 A;  3QP5 A;  1XSV A;  2MH9 A;  4KDP A;  5IT9 Z;  4B09 A;  1RZ4 A;  3KCC A;  4ASN A;  1O3Q A;  1LB2 A;  3ERE D;  1XMA A;  2D2W A;  1R36 A;  5D5V B;  3ZMT A;  1U5T C;  1ULY A;  2ISZ A;  2DT5 A;  3K1N A;  5JR3 A;  4MTD A;  1YO5 C;  3TO6 A;  3W6J B;  2OQR A;  1XN7 A;  2UXN A;  1IF1 A;  4OMY A;  3FWE A;  4HOB A;  3ABT A;  3IKV A;  4FX4 A;  2ISY A;  3I53 A;  2K7L A;  1I5Z A;  3L9F A;  1BI0 A;  4RB1 A;  2QQB A;  2FMY A;  1FLI A;  3V8L A;  4L9V A;  1G3Y A;  3GYH X;  3J81 K;  2PMU A;  5BMZ A;  2DFI A;  3FM5 A;  1WRJ A;  3KLO A;  2EFO A;  4A5N A;  4IPA A;  5DCM B;  1BM9 A;  4EJU A;  3IRQ A;  4UUV A;  3DP7 A;  4E70 A;  2M8E A;  4RS8 A;  4CGZ A;  1Z1D A;  4R1H A;  1SMY F;  2PN6 A;  1KU3 A;  3IHU A;  1QBJ A;  4EJW A;  1J5Y A;  2PQ8 A;  5D8K B;  1R1V A;  2EV6 A;  4LMY A;  3T0Y A;  4GO1 A;  4HW0 A;  1B9N A;  2KJB A;  3SFZ A;  2L3D A;  3P9K A;  1LDD A;  2GAU A;  2PMH A;  3WGI A;  2GWR A;  5K1Y A;  3NQO A;  3N4M A;  2F5F A;  2XHK A;  1TQI A;  3RJP A;  4YIF A;  4HDV A;  5BOX A;  3HTU A;  1U8R A;  4XRF A;  1QPM A;  2QEN A;  2OZU A;  3D5L A;  4M9S A;  1H0M A;  1P4X A;  2QQ9 A;  3ZQ7 A;  1B6A A;  4WCG A;  2RDP A;  4M73 A;  2Y75 A;  1MDM A;  2Q0O A;  5EEG A;  3DPT A;  4HBL A;  1NHA A;  3MQ0 A;  1O3T A;  2GXB A;  1L3L A;  2PEX A;  4IRH A;  1HXD A;  2JRT A;  3FMR A;  1B9M A;  1FNN A;  2EFQ A;  5HLG A;  1EH8 A;  3J81 Z;  4RB0 A;  2A68 F;  1FSE A;  5LRR A;  4M72 A;  4PZJ A;  4NHJ A;  1USS A;  3FZV A;  3RPQ A;  3V7C A;  3LA2 A;  1I1G A;  5F6F A;  1ZRE A;  2XAS A;  4MGR A;  2FU4 A;  2A61 A;  4NQW A;  3M9A A;  3FM3 A;  5H6Q A;  3HSR A;  2IA1 A;  4JK1 X;  2DTR A;  2ZNY A;  5LGN A;  2C6Y A;  4A0X A;  4A0Z A;  4I0B A;  2FXA A;  2OBP A;  5HVQ C;  2Q2E A;  1ZAR A;  4A6E A;  5L3F A;  2BBY A;  1KQ8 A;  3GVA A;  4EJV A;  3SXY A;  2JPB A;  2IT0 A;  1IN6 A;  1TW2 A;  4HX8 A;  5JHU A;  2O8X A;  5E18 F;  3F8N A;  2L4A A;  1X3U A;  3LAP A;  5D4S A;  1IAW A;  2FNP A;  1FPQ A;  3Q9V A;  3R0J A;  3R61 A;  5D6E A;  2KIM A;  2XKO A;  3I5U A;  2MLG A;  4UVB A;  1JHF A;  4WWC A;  5K5Q A;  5D4R A;  3B02 A;  2PFB A;  2JT1 A;  2OD5 A;  2Z9O A;  3E6D A;  5L3E A;  3Q5F A;  4A5M A;  4HA8 A;  1MDM B;  3T5X A;  4CO8 A;  3GWZ A;  2P5L C;  1Z6T A;  3RKW A;  3VEP A;  4Q47 A;  5L3C A;  1SD4 A;  3MZY A;  3HRM A;  2HYF A;  3VOD A;  4L18 B;  3E97 A;  4YG2 F;  3IWZ A;  4U88 A;  2COM A;  1V4R A;  4PCQ A;  3BOQ A;  2DQR A;  3F72 A;  1GXP A;  3BZ6 A;  3JSO A;  2Y48 A;  3BY6 A;  2H09 A;  1O3S A;  5LGU A;  2GA2 A;  4O6J A;  3E6M A;  1DUX C;  3I71 A;  2EA2 A;  3H3U A;  4EV0 A;  3T1B A;  4MNU A;  4GCV A;  3FMQ A;  1UB9 A;  4EMS A;  3BPV A;  1K7A A;  1S8N A;  2P5K A;  1JXS A;  4Y13 A;  2CW0 F;  3F6V A;  4GYI A;  2QBY A;  1KQ9 A;  2FNA A;  2L54 A;  3WGG A;  2A07 F;  1XCB A;  2HDC A;  3WU0 A;  5E1W A;  1AWC A;  1S3J A;  3MAJ A;  2D1V A;  1SD6 A;  4FX0 A;  2VBX A;  1SD5 A;  5CLS A;  2J5O A;  1C0W A;  3CUQ C;  3HOS A;  3D0S A;  3BPX A;  3R4K A;  4KIF A;  2BEO A;  2DU9 A;  1P6R A;  3GX4 X;  2DQL A;  4I7H A;  2K02 A;  5FGM A;  1O57 A;  3JTH A;  1T39 A;  3JW4 A;  3RKY A;  1SD7 A;  2CWE A;  2FOK A;  4P9F A;  2VOO A;  2R7F A;  5ILV A;  3KLN A;  5ICG A;  4ZYH A;  3ZPL A;  2PJP A;  2QQA A;  2HZT A;  2G7U A;  1ZYR F;  1HQC A;  4CDG A;  2ETH A;  3BRO A;  1PP8 F;  3RYP A;  3MCZ A;  1D5V A;  1KU2 A;  4IJA A;  1CF7 A;  1ZRC A;  3JAM Z;  1QO0 D;  3WU1 B;  1OYY A;  1BC7 C;  4LK1 F;  2MLK A;  4WXC A;  3WTZ A;  1Z9C A;  3U1D A;  2KKO A;  1TQP A;  1JHH A;  3QU6 A;  1R7J A;  3M8F A;  4RB3 C;  5IT9 K;  4KIB A;  5E20 A;  4ZYE A;  2CQK A;  2PI0 A;  3COA C;  1YFH A;  3PQJ A;  2P7C B;  1CGP A;  1XCV A;  1MJB A;  3DQV C;  1KGS A;  2W25 A;  4OIN F;  2VON A;  3HYI A;  2RQP A;  1P4A A;  3ZMV A;  3I59 B;  4HZF A;  4U0V A;  1FC3 A;  4FHT A;  4L0Y B;  2QBY B;  2CYY A;  3EUH A;  1JE8 A;  1J75 A;  4KN7 X;  5DV5 A;  4P55 A;  3LQR A;  1KA8 A;  4MTE A;  2UZK A;  1U3E M;  4I98 B;  1O7L A;  1IXR C;  3G73 A;  3IKT A;  4XSX F;  2LF8 A;  1UFM A;  2HTJ A;  1KYW A;  4DNC A;  3QPH A;  2FRH A;  1REP C;  4Q4Z F;  2KIF A;  4L9T A;  4LGW A;  1QZY A;  4ZYG A;  3OOP A;  5FFX A;  1MKM A;  5LRS A;  1P2F A;  5H20 A;  2MD5 A;  3KP2 A;  2P7V B;  1OR7 A;  1T6S A;  5DEQ A;  3ZN1 A;  4G7Z F;  3DXJ F;  3WTU C;  1XGO A;  3GXO A;  4HF1 A;  2MC3 A;  2TDX A;  1K79 A;  2EFP A;  1P92 A;  3L2C A;  2O3F A;  4B8X A;  2NAZ A;  3V4G A;  1XB4 A;  4L5J A;  4ZZL A;  2DO7 A;  2V9V A;  3GEZ A;  1S6L A;  2P6S A;  2RVC A;  3EET A;  2BGC A;  3GFL A;  3RIR A;  5HS8 A;  3PQK A;  1CF7 B;  1TQM A;  5E1X A;  1Z6R A;  5HOO A;  3IRR A;  1HSJ A;  2V79 A;  4CIC A;  2Y0M A;  1LVA A;  2K4B A;  5HS7 A;  3BJ6 A;  3T8R A;  2VN2 A;  4UXN A;  4OMZ A;  3HIF A;  4CHU A;  1IN8 A;  2EK5 A;  2ESN A;  3KP5 A;  3VB2 A;  3G3Z A;  3WGH A;  3P9I A;  4O3M A;  2CSO A;  3I54 A;  2O03 A;  4N0B A;  4HLY A;  3JSP A;  5DCF A;  5A2Q K;  3SZT A;  3DF8 A;  3GZ6 A;  2XV4 S;  2GA1 A;  1K78 A;  4MEX F;  5LLQ A;  2M1B A;  3HHH A;  3L7W A;  1S7O A;  4YFN F;  3RKX A;  4KMF A;  2IPQ X;  1JGS A;  4BHB A;  1RI7 A;  5H6R A;  4M6X A;  4PGH A;  2QLZ A;  5D5U B;  1YS6 A;  3FXQ A;  4RAZ A;  2STW A;  1J9I A;  2JSC A;  4GXO A;  4HV5 A;  4EQQ A;  1STZ A;  3CUQ A;  3KEQ A;  1PUE E;  3GFM A;  3DEU A;  2HQR A;  2IA0 A;  1L0O C;  4AWX B;  4ENJ A;  5BPD A;  2LDU A;  1WI9 A;  5F64 A;  5F1R A;  2RV8 A;  3HUG A;  3R0A A;  2L02 A;  3GFJ A;  1D3Y A;  3E3V A;  4U0Y A;  1OKR A;  1IN7 A;  1R5H A;  2M30 A;  3DFG A;  2M45 A;  4AD9 A;  2XAJ A;  2XVC A;  4IF4 A;  2P4W A;  1TNS A;  5CVR A;  1H9G A;  2CG4 A;  3J80 Z;  2QWW A;  2VOD A;  2E7W A;  3F6O A;  2J5P A;  1T38 A;  1PP7 U;  4ZH4 F;  5A2Q Z;  4LLG F;  4O5V A;  1RUN A;  3F3X A;  5D8L B;  2NS0 A;  4QWQ A;  2HQN A;  2A6H F;  3CJN A;  2RC4 A;  1LNW A;  1K78 B;  2FE3 A;  1OPC A;  1HKS A;  2JTV A;  4N9I A;  3N97 A;  5DDG A;  3KZY A;  1P4W A;  3WTT C;  2X4H A;  1Z91 A;  1A04 A;  4L5I A;  5J8F A;  4HDU A;  3K1M A;  1GHC A;  5LEK A;  1QGP A;  2K27 A;  1XGS A;  4LLN A;  4U0W A;  1KU9 A;  3SQN A;  3TKY A;  5HLI A;  4BYY A;  4XLP F;  3F8C A;  5ED4 A;  2VC0 A;  6PAX A;  4KT5 C;  2DI3 A;  4TV7 A;  1HST A;  3O3K A;  2P8T A;  4PDK A;  2DAO A;  1UHM A;  2WWY A;  1ON1 A;  1HW5 A;  3C3W A;  3WTS C;  4WXD A;  4ENK A;  1ONV A;  3P9C A;  3GUD A;  3FXR A;  1FX7 A;  3P7N A;  3TO9 A;  2QZ8 A;  2A5Y B;  2FEZ A;  4A6D A;  3F21 A;  1HW2 A;  1YYV A;  1XGM A;  3K2Z A;  2VXZ A;  3VFZ A;  3BJA A;  4D0P A;  5ERI A;  1GXQ A;  2ZCW A;  3HRS A;  4EM0 B;  1W7P D;  1FYL A;  3ZMU A;  5FO5 A;  4AIH A;  2DBB A;  2LSO A;  2Z3Y A;  1W4M A;  2H6C A;  2LF7 A;  4KMU X;  2IJL A;  1YS7 A;  4RGX A;  2ZME A;  3ZN0 A;  1U5T A;  5ILU A;  2KIU A;  2Z5U A;  3DPL C;  2L01 A;  2FBK A;  3JAM K;  3CLO A;  2HWV A;  2V6C A;  5HS9 A;  1MZB A;  1S29 A;  5K5R A;  3MZH A;  1LEB A;  4OIO F;  2MBF A;  5K5O A;  3L00 A;  1BOA A;  5LHH A;  2CO5 A;  4MHG A;  2D45 A;  4EVI A;  2RNJ A;  1S7A A;  1IXS B;  3WE3 A;  1WSU A;  5CVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...