4U88A

Structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
93
Chain Sequence
EQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator SaeR
publication title Structure of the DNA-Binding Domain of the Response Regulator SaeR from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus usa300-ismms1
total genus 25
structure length 93
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u88A00
3HSEA 3KEOA 2L01A 4U0YA 3ABTA 3ECOA 4M6YA 4MTDA 1CF7A 2FU4A 1FLIA 4YFKF 1GHCA 5LRRA 1FOKA 1KU7A 3CTAA 1YW9A 1G3TA 1OKRA 1W5TA 2HKOA 3QP6A 4O6JA 4WWCA 4I09A 2DPUA 1SD6A 3JSOA 4HOBA 3RYPA 4EJOA 1FZPB 5FO5A 2ESNA 2FMYA 3ML6A 3EQLF 2ZNZA 5ERIA 3D0SA 2QLZA 1G3WA 2YPRA 1TBXA 1U5TA 3RDIA 4WX9A 3TO9A 3CLOA 1ZG5A 3CUQC 3ZMTA 2EK5A 1JGSA 1V4RA 1P4AA 3KZZA 1FY7A 2FBIA 2BGCA 2O3FA 5LHIA 4AIKA 2FE3A 3IKVA 4XLNF 2CQKA 2V6CA 2R7FA 3PQKA 2Y48A 1J59A 1ZREA 2VBWA 1F1ZA 3GZ5A 3RPUA 2B0LA 3SXYA 4MEXF 3QU6A 1RZ4A 4HZFA 3KE2A 4GCVA 4EJWA 5CLSA 3P9CA 1H0MA 1QZYA 2VT2A 3E5UA 1XGMA 4M74A 5H6QA 2H09A 2BE5F 3K1PA 2IT0A 2ZKZA 2NAZA 2L4AA 3V4GA 3VEPA 5LRSA 2C6YA 4LLLA 2DO7A 1FC3A 3GEZA 1SMYF 4LD5A 2K27A 1XN7A 3TDZC 1S3JA 1YS6A 4YIFA 1EH7A 2EV6A 3DF8A 4KNYA 1R36A 4IHSA 3F6OA 4HF2A 4FHTA 1S6LA 3G3ZA 1I1SA 2HS5A 1Z6RA 3BJ6A 2XAGA 4ZYEA 3KFWX 1WRJA 2O61A 1ZARA 3WODF 3FXUA 3B73A 3QPHA 4Q48A 2WTEA 1ULYA 2EV0A 2F2EA 3FMSA 4P9FA 4M6XA 1STZA 2ZO4A 2UXNA 3WGHA 3E6BA 4ESJA 2CFXA 4EV0A 1XB4A 2OU2A 1J75A 1USTA 2QBYA 1H9TA 5BPIA 1K7AA 1F4KA 4IRHA 4ETSA 4HYEA 2J5PA 2EV5A 1MDMA 1T98A 1DP7P 2GQQA 2MA3A 2RV8A 4U7DA 3RKYA 2KIUA 2RN7A 1SAXA 2PLYA 1IN7A 4RGRA 1I6XA 5KVRA 4ZYHA 2FSWA 2OD5A 3FWEA 3F6VA 4UV8A 5CYVA 4PZJA 3L2CA 5K1YA 2K7LA 2STTA 5J8CA 4R8HA 4HQMA 2JTVA 3IWFA 1ZGAA 5TRDA 4S04A 4A5MA 1W7PD 3U9GA 2HWVA 2XIGA 2A69F 5A2QK 4L9NA 5D4RA 1D5VA 5D8LB 2H94A 2VE8A 2VN2A 3BWGA 3BY6A 4GYGA 3RYRA 2G9WA 5HDGA 2EA2A 4G8XA 4RGUA 3LA7A 5FGMA 4CHUA 3LQRA 3JAMK 3U1DA 4S05A 5IT9K 2LF7A 2CGPA 2PMHA 5HOOA 4IRIA 3H92A 5CVVA 1I5ZA 2KKOA 3DP7A 1LDKB 4HLXA 4EJVA 4I98B 5DUKA 4O3MA 2QM3A 2YX7A 2JT1A 4M73A 3OV8A 5DYMA 1BOAA 1W4MA 2MLKA 2ZMEA 5JR3A 3MAJA 4HX7A 3KP4A 2DK5A 1HSJA 3Q5FA 1WI9A 3ZN1A 5AONA 4Z2YA 2H6BA 1KU3A 4EGZA 2ZNYA 4N9IA 4UXNA 4G7OF 5JHUA 3ELKA 3I71A 1IRFA 5HLGA 2MC3A 3O3KA 3IHUA 1H9GA 3C3WA 5L3BA 3I53A 4IXAA 1YS7A 1MJBA 4OIRF 1XSVA 2FF4A 1BIAA 3JTGA 4LG0B 3DEUA 1QPMA 3F72A 2P7CB 1XCVA 3K9TA 3I58A 2HQRA 5JI6A 1XMKA 3IC7A 3KETA 2G7UA 4N0BA 1ON1A 3SZPA 2PG4A 1W7PA 4ENJA 1QNTA 1BI2A 3I4PA 3T0YA 4A6DA 2XAJA 1WQ2A 5HS7A 2HFHA 5F6FA 2XROA 4WF2A 2ZBKA 3C1DA 5K5RA 5ILVA 1YTYA 1D8KA 5L3FA 3GWZA 4EGYA 4BHPA 3R6SA 2QUFA 5DCFA 5E18F 2XAHA 3CDHA 1OYYA 1XSDA 2YX4A 3Q9VA 3F8NA 4KMFA 2NNYA 1XGOA 4WXDA 2Q8KA 4I0BA 4HA8A 4G7ZF 1OPCA 1RIOH 3BDDA 2ZFWA 3CUQA 1PUEE 4N9HA 3I0TA 5L3DA 3HYIA 5J6XA 1T2KA 1P92A 1AOYA 3BPXA 3T1BA 2P8TA 2QQBA 3LA2A 1LEAA 3VFZA 5LHHA 2Z33A 3ULQB 1GVJA 1FPQA 2VBZA 1YQAA 1LEBA 2OAZA 2NNNA 3AAFA 1VTNC 4NHJA 4R79A 1EV7A 1LDDA 3FM5A 4ZZDA 3CUOA 4ESFA 2JSCA 3TKYA 3R0AA 1ZG1A 2IP2A 3PFIA 2BEOA 2F5DA 2J5OA 4L0YB 2O03A 4LLGF 1LB2A 1HBXG 1GXPA 5CVJA 2DW4A 3HRSA 5HDKA 3SQNA 4A0XA 2XAQA 4BHCA 5HVQC 3J80Z 3FMQA 5LEKA 1R7JA 4BQAA 1K78A 2HQNA 4NQWA 2VODA 3TGNA 3QRFF 3KP7A 2M30A 1FP2A 1YIOA 4KIFA 2O6GE 2OZUA 4HDUA 4ENNA 2P6SA 1P4XA 1UHMA 2JRTA 2EJRA 2ETHA 1WKMA 4KIBA 1A04A 1Z7UA 3J81Z 1EH8A 1LVAA 3I5UA 2HTSA 4GXOA 2PN6A 3LSTA 4RGSA 3T8TA 4U0WA 2K86A 2XV4S 3K1NA 3JAMZ 3FMRA 1O7FA 5D8KB 3DV8A 1QGPA 3K1MA 3GXOA 2A3SA 3E97A 1JHFA 4B8XA 5EEGA 1HKQA 3TOAA 1UB9A 1FP1D 3Q9SA 2W25A 1O3TA 3BROA 2EFPA 2A68F 5ICEA 5FFZA 3WG9A 1B4AA 3M7GA 5FFXA 2V79A 3FZVA 3KP5A 1R5GA 2RVCA 1HW1A 1TTYA 1IW7F 3ZMUA 4PDKA 1TNSA 2H6CA 3IWZA 1T0FA 5K5QA 2V1XA 2IA2A 1OR7A 4U88A 4E70A 1IZ1A 3KLNA 2IRFG 4BHBA 1FYKA 3BOQA 4M72A 4BAYA 4LB6B 3KP3A 3ZPLA 5BMZA 2HR3A 1I27A 2Q0OA 5L3EA 4HQEA 2IVMA 3H3UA 4GGGA 3EDPA 4DQ2A 3N4MA 1DPUA 4LFUA 4A6EA 1ZRCA 1O3SA 2PEXA 3EETA 3RIRA 4WXHA 2KIFA 3ZMDA 3I54A 4RB1A 1BJAA 4CYDA 3LQQA 2EWNA 1BC8C 2HYGD 4HF0A 4HV5A 4YIIA 3QU3A 5CJ9A 3E5QA 1ZGJA 2IA0A 3F8MA 1R5HA 2XKPA 4KICA 5E1XA 3V7RA 3HSFA 1JHHA 1IXCA 4XBFA 4ENKA 4OIOF 4OMZA 5E20A 2CYYA 4M9XA 2P5LC 2FXAA 3EYYA 4HLYA 4EM2A 5K5OA 1P4WA 1IN4A 2DU9A 2FEZA 1J9IA 1HKSA 1ZG3A 4YFXF 3M8EA 3VOEA 2HEOA 5ED4A 3OOPA 4A5NA 1CGPA 3IKTA 1ZYRF 2V9VA 2KIMA 1QZZA 3TO6A 4LJZF 2TDXA 2BBYA 1UCRA 1L0OC 5DCMA 2KRFA 2M87A 1FYMA 3K2ZA 4MHGA 4WK8F 2EFOA 5L3CA 3NQOA 3P7NA 3M9AA 5DV5A 3GFIA 3N97A 2FBKA 3TDUC 4KIGA 5TJJA 5BS6A 2AXLA 2XAFA 2RDPA 3GLXA 1TW3A 1FT9A 5FLXK 1BBYA 1NHAA 1KQ9A 3KEQA 4UVAA 2FRHA 1JE8A 4O5VA 3F3XA 2WWYA 4L18B 3ECHA 4CO8A 4ON0A 3K0LA 1T6SA 1XSXA 4L9TA 1FBQA 4R1HA 1L3LA 3RI4A 2P7VB 2A6EF 2XUBA 5D5XB 1ZRDA 3IRQA 5CVIA 3VB2A 5CVRA 3R61A 1Z05A 2DT5A 2QWWA 3WGIA 1FYLA 4RGXA 1D8JA 1RNLA 1Z1DA 1I1GA 1W5SA 3V8LA 4EM1A 2E7WA 1TNTA 1MD0A 4MQVA 4L5IA 3I59B 4G6QA 2WV0A 1FX7A 2OQRA 5E17F 2EB7A 4LB5A 2KJBA 5LLQA 4OIPF 4Y17A 5D5VB 2X4HA 4ESBA 2IJLA 3JW4A 1YG2A 4QWQA 3HSRA 3HHGA 4JQFA 4L5JA 3RKWA 5D4SA 4AD9A 4KDPA 3GW2A 3GFJA 4M9ZA 4P96A 2CG4A 4BNCA 3ROUA 1O7LA 2P5KA 1Z6TA 2STWA 4HBLA 3MZYA 3WU0A 4KA4A 4OIQF 2NS0A 2JPCA 3DXJF 1S7OA 2ZCWA 3K69A 3P9IA 4KN7X 1BIBA 3WE2A 4XRFA 3CO7C 3F8CA 2VT3A 2FBHA 3LFKA 5L3GA 2DQLA 4I7HA 2MH9A 1O3RA 1REPC 4OMYA 2AS5F 3ZP5A 4I2OA 1U8RA 3HTSB 3E6MA 3O6BB 4UVCA 3DFGA 3DQVC 4XSZF 2A07F 3KZYA 3WTWC 2K4JA 5ICCA 5ICGA 3HHHA 3HTUA 3SHFA 4KUMA 3EUHA 3RJPA 1SFXA 2R7DA 3MFKA 1S8NA 2GA1A 1P2FA 2H27A 2LF8A 3ERED 4P5OA 5ILUA 4IF4A 2VONA 3E6CC 1ZH5A 4MGRA 2DBBA 2P5VA 2L3DA 1OYIA 4JBAA 3QOPA 1G4DA 2LNBA 2QVOA 5H6RA 4IVNA 3SZTA 1FSEA 1HSTA 1IN6A 1LNWA 4PCQA 4RS8A 1Y0UA 2CW0F 1U5TB 4GYIA 2DPDA 1ZN2A 4HW0A 3T8RA 3F21A 3ZMZA 1U3EM 1B9NA 2K02A 3MCZA 4CICA 4K2EA 1SFUA 1E2XA 4L9VA 2VC1A 4UV9A 2V1DA 2RQPA 2RKHA 3I59A 2Q2EA 3PQJA 2YU3A 4IJAA 3ZN0A 3FX3A 2IW5A 1G3YA 4I01A 3W6JB 3WTSC 5JVTA 4F7ZA 3BJAA 2JZYA 2Z3YA 4KMUX 4WCGA 2DTRA 4DNCA 2RNJA 1ONVA 1Q1HA 3R0JA 2M8EA 3VODA 2A6HF 1QBJA 3FXQA 1KYWA 5J8FA 5AIPA 1SMTA 2ESHA 2WC2A 2P6TA 1ODDA 2D1HA 1SD7A 4FX4A 2EFWA 2LKPA 5AIQA 3HRMA 3KP2A 1TQPA 3R4KA 2E1NA 3GFMA 1KGSA 4OOIA 2COMA 2XRNA 2XHKA 1R23A 4MTEA 1U2WA 2VXZA 5A2QZ 1U6GA 2KJCA 4G7HF 3TQNA 3TO7A 4PGHA 2DI3A 1EH6A 2UXXA 1YFHA 1ZLKA 4LG0A 1OMIA 2G7HA 2W84A 4B09A 2ISZA 2L54A 4WXCA 5IT9Z 4I0AA 4RAYA 4UHTA 1KQ8A 1LDJA 4GO1A 2HKXA 4KN4X 2X0LA 5E8GA 1BI1A 5EEHA 1DDNA 2FNAA 2RGVA 1DUXC 5DEQA 4Q5SF 1MDMB 3GO5A 5LEJA 1TLHB 4L0ZB 4IHTA 1SFEA 2QQ9A 1XGNA 5DUIA 3WGGA 1BC7C 5HS9A 1XGSA 2VBXA 4UNOA 1R1UA 4EJTA 2MBFA 2BYVE 4Q47A 4A12A 5HLHA 2K4BA 4A0YA 1IF1A 4ZYDA 2ZXJA 2DQRA 4OU0A 2GIVA 2RC4A 5DD8A 3HRUA 1O3QA 2Z99A 4IRGA 3RTRA 1QQIA 1Z9CA 4U0VA 2PMUA 2R3SA 1D3YA 1ZRFA 1GXQA 1ON2A 4RB2C 3DKWA 3F8BA 3WU1B 1ZAOA 1IXSB 3U2RA 3HOTA 2PBIA 2VC0A 3BJOA 4AIHA 4HDVA 1IUYA 3M1EA 5ICFA 1YLFA 2ZJ2A 3BZ6A 3V7SA 2BV6A 4CZZA 2HTJA 1MKMA 1E17A 2LDUA 5FD5A 2Y75A 2FOKA 4L9JA 2PFBA 2UZKA 4G94A 2PI0A 1BI0A 3HOSA 1JXSA 3KCCA 4EJUA 5LGTA 2A61A 2YSRA 4A0ZA 2ADUA 2ELHA 2O0YA 2HYFA 3GUDA 2OQGA 1UFMA 5D6EA 3LAJA 2ZMEB 2F5CA 2MLGA 4CDGA 6PAXA 4G9YA 1PP8F 2W85A 1R1TA 2CO5A 2PQ8A 4LLNA 2OA4A 1MZBA 3I64A 4Y13A 2LSOA 2GXGA 5FB2A 1WSUA 1F5TA 1DPRA 1BN5A 1LQ1A 3FXRA 3L09A 2CSOA 1XD7A 5JFRA 5F64A 5LHGA 3V7CA 3BP8A 1XDUA 4MNUA 1R22A 1XDSA 1KU2A 4RB0A 2L02A 1FWZA 3GFLA 4HF1A 4RB3C 4A2UA 1HXDA 3B02A 4ASNA 1W7PB 4EVIA 1USSA 2Z5UA 3F22A 2GA2A 5E1ZB 1OYWA 1KQ0A 1LJ9A 1TW2A 1J7KA 5KK1A 1R1VA 3NRVA 1YW7A 3MQ0A 4D0PA 4G6DA 5LGUA 4EMSA 4BYYA 2FNPA 2MD5A 2DLLA 5IT3A 1HKTA 3C7JA 3L7WA 3R60A 3CO6C 3V8JA 2L4MA 2HOEA 3SFZA 4YFNF 1RUOA 3MEXA 2JPBA 3F8FA 4P55A 1HW5A 2HGCA 1U5TC 3O2PE 5HS8A 3CUQB 3J80K 2VOOA 2QQAA 4Y15A 1WWXA 4AWXB 1C0WA 3E6DA 3LA3A 1YW8A 5E1WA 5F1RA 4AIJA 2O8XA 1IAWA 4H0EA 1RI7A 1KU9A 1J0RA 4BH9A 4MEYF 1PDNC 3J81K 3MWMA 5H20A 1XMAA 1SD4A 4KFCA 2MH2A 2XGXA 2NYXA 2VOPA 1G6NA 3FM3A 4NB5A 5D5UB 1K6OA 2XVCA 1J2XA 3LAPA 2F5FA 1BM9A 4HAMA 3IL2A 1RUNA 1X3UA 4ZYGA 3MZHA 4ZZLA 3D5LA 2XKOA 4EM0B 1F9NA 5CVUA 4KT5C 2VBYA 3WTVC 1MJ9A 3HIFA 1ZHFA 3WTUC 1K78B 4ZH4F 1T38A 4ENMA 2GAUA 4XLPF 1P6RA 3ZMVA 1R00A 3WE3A 4QLCU 1B1BA 3S2WA 3GX4X 3QP5A 1S7AA 1TQIA 1FSHA 5LBQA 4I02A 2GZWA 4AVPA 3DPTA 3L9FA 2HDCA 3EYIA 2V1UA 5D6FA 3W6KB 2Z9OA 1KA8A 1BI3A 4LK0F 3CJNA 5HLIA 4EQQA 4M9SA 1J5YA 2ACJA 4IPAA 1IN8A 3GF2A 3ABUA 2A5YB 2IA1A 1CF7B 1R58A 4YG2F 2FA5A 4HV6A 1FBUA 3ZQ7A 2UWMA 3FHZA 1MJAA 5LGNA 2GWRA 2QENA 3RPQA 2YR2A 3JSPA 2XASA 5DD4A 4HX8A 3H3ZA 1IN5A 1YO5C 3WTTC 5BQTA 3ISPA 3F23A 3ZMSA 3KLOA 5ILSA 3LWFA 1IXRC 1FNNA 2EFNA 3HRTA 4U7BA 2QYOA 2OZ6A 2VE9A 2EFQA 2D1VA 5BOXA 1U78A 1B6AA 3RKXA 4LMYA 1B9MA 3L00A 1Z91A 2PJPA 5DDGA 4HX4A 1FBSA 2IPQX 4FT8A 2M5WA 3E5XA 5FLXZ 2FQ3A 1IRGA 2Y0MA 4TV7A 3NEUA 4FX0A 3DPLC 2OBPA 3M8FA 4UVBA 2E7XA 3G73A 2E1CA 4P9UA 2EA4A 4KYWA 2DAOA 1PP7U 3QAHA 4BXUA 2DK8A 4UUVA 5D5WB 5BPDA 2M1BA 2D2WA 2NRAC 1B59A 2FMLA 2W57A 1G3SA 2M45A 3T5XA 1ZLJA 1MGTA 4LGWA 4CGZA 1YYVA 4MQ9F 5FD6A 2CWEA 4Q4ZF 3QPTA 1UHWA 3FF5A 4OINF 1XCBA 2QZ8A 1QO0D 3WTZA 3COAC 1KYZA 3V8KA 3KP6A 1V3FA 3IRRA 4RAZA 2F5EA 2HZTA 4LK1F 2W24A 5DCMB 1SD5A 1TQMA 1S29A 3E3VA 3JTHA 3HUGA 5E8IA 2P4WA 4JK1X 3BPVA 3TOBA 3GZ6A 3J7AO 2GXBA 5HDNA 2D45A 2ISYA 2DFIA 1HW2A 3P9KA 3GYHX 2QBYB 3GVAA 1T39A 4CXFA 4PGGA 1HQCA 1O57A 1K79A 4M71A 3REOA 3C18A 3WTXC 3WTYC 1AWCA 4XSXF
chains in the Genus database with same CATH superfamily
3HSEA 4BJ6C 4DGWB 3KEOA 2L01A 4U0YA 3ABTA 3ECOA 4M6YA 4CYCB 4MTDA 4PFOA 4JYKA 4A3JJ 1CF7A 1U0JA 2R7QA 2FU4A 3CP2A 3ZQIA 1MSEC 1FLIA 4YFKF 1GHCA 2XDVA 3W2AA 5LRRA 1FOKA 1OJLA 2O7OA 1KU7A 4ZYAA 3CTAA 1YW9A 3PM1A 1G3TA 5HNFA 1OKRA 3TP3A 1Y0NA 1MMNA 1W5TA 2HKOA 3QP6A 5GTHC 4O6JA 1QHHD 3BG9A 1UG0A 4WWCA 3DBRB 4E7LA 4I09A 3OYMA 2R7SA 3QYEA 2DPUA 5C4JJ 3PO3J 2R7VA 1SD6A 3ONQA 5IP6A 3JSOA 4HOBA 5CKTA 4IEJA 3RYPA 3IP4B 4M3BA 5FO5A 4EJOA 1FZPB 2GXAA 2MGQA 2Y9YA 2ESNA 2FMYA 3ML6A 3OS2A 3EQLF 2ZNZA 4DBQA 5ERIA 3D0SA 5J1YA 2QLZA 1G3WA 2IXSA 1JUSA 1V5FA 3H9JA 2YPRA 1TBXA 1U5TA 3A03A 3OYCA 3L2RA 4FTHA 2E1MC 2L7ZA 3RDIA 4WX9A 3TO9A 3P5JA 2E36A 3CJRB 3A01A 3BT9A 2DFHA 2WY8Q 3CLOA 3CUQC 3FKIJ 3ZMTA 2XC7A 1ZG5A 2EK5A 2VQHA 3LSJA 1JGSA 4BEHB 1V4RA 3SDBA 1P4AA 3KZZA 1FY7A 4HPQA 2FBIA 2HNHA 2BGCA 2O3FA 5LHIA 4AIKA 2MFZA 2FE3A 3UR3C 3IKVA 2FJ1A 2KZVA 4XLNF 4XR6A 2CQKA 2OCEA 2V6CA 2R7FA 1YOVB 3CESA 3PQKA 2Y48A 2XSDC 3DKYA 1J59A 1ZREA 4BE1A 2VBWA 2JA5J 3TL4X 1F1ZA 1I3AA 3GZ5A 1B72A 3RPUA 2B0LA 3SXYA 4MEXF 4CCLA 3QU6A 3I4MJ 4FCYA 1N75A 1HF0A 1RZ4A 1RESA 4HZFA 3KE2A 3H36A 4GCVA 2Y0SA 2YU9J 5GPAA 4B48A 1S72I 1FOWA 3BTLA 4BKXA 4IX7A 3U1KA 2GOMA 4EJWA 5CLSA 3P9CA 1H0MA 1OCCH 1QZYA 2VT2A 3BC8A 3E5UA 2V9KA 3CCRI 3SYTA 1XGMA 4M74A 2HYJA 5H6QA 4A3FJ 3PIPF 2H09A 2BE5F 3K1PA 2IT0A 2LP0A 2ZKZA 2NAZA 2L4AA 3V4GA 4HEA2 3VEPA 5LRSA 1R71A 2C6YA 1V54H 4LLLA 2DO7A 1SVMA 3SEZA 1FC3A 4KISA 3GEZA 2A05A 1SMYF 2X85A 4LD5A 3LSHA 4A3CJ 1BL0A 3M3YJ 4E7KA 2K27A 2KLOA 1XN7A 3HM5A 2MSYA 2LH9A 3HDDA 2WV1A 2CUZA 3TDZC 4XLFA 3BR1A 1APLC 1S3JA 3TBIA 1YS6A 2F4OB 4MFEA 4YIFA 2HOSA 1EH7A 2DTZA 2EV6A 2X1DA 3A0HC 3DF8A 1ZR4A 4CCOA 1LKXA 4KNYA 1R36A 1WCMJ 3NWSA 4IHSA 3F6OA 5FKOA 4QPQA 4HF2A 4FHTA 1D5YA 1JI8A 1S6LA 3G3ZA 1I1SA 2HS5A 1Z6RA 3BJ6A 2XAGA 4ZYEA 3KFWX 3G1OA 1WRJA 5K7ZA 2O61A 1ZARA 3WODF 3FBNB 3FXUA 3B73A 3TMOA 3QPHA 3VSKA 1IV8A 4Q48A 2WTEA 1ULYA 3HEFA 2BY0A 2EV0A 4IHYA 2F2EA 3FMSA 4JP0A 4P9FA 4M6XA 1YJNI 1STZA 1X2NA 2ZO4A 2UUZA 2UXNA 3WGHA 3E6BA 4ESJA 2CFXA 4EV0A 3GTQJ 3OYGA 3BQYA 1XB4A 2L9SA 4Y3OA 1XX5A 3HL2A 2OU2A 1J75A 1USTA 2QBYA 3HOWJ 5IPAA 1H9TA 4X6AJ 3CCSI 5BPIA 1K7AA 1SANA 1F4KA 2R92J 2Y0SN 4IRHA 4P1WA 1VQ4I 4ETSA 4HYEA 4KT6A 3ABMH 2J5PA 2EV5A 1OISA 1MDMA 5GTIC 4NDLA 1ETYA 3TP0A 1T98A 3MVPA 1PUFB 1DP7P 2LY2A 2XAUA 3H3VK 2CQ7A 2GQQA 1TWHJ 2MA3A 1W36D 3A2KA 2LLKA 3L2WA 2RV8A 2KFDA 4U7DA 5H2FC 3RKYA 3PJRA 3GTGJ 2KIUA 3Q0WA 2F5VA 2RN7A 4BY1J 2ME6A 3UKGA 3D5RC 2OTLI 1SAXA 2PLYA 1IN7A 2JK3A 3PSIA 4RGRA 1TC3C 2DA2A 3CMAI 3G1MA 1I6XA 1IDYA 5KVRA 1MBGA 3ZGKA 4ZYHA 2L7FP 4XKCA 2FSWA 2OD5A 2W4SA 2QCOA 3FWEA 3BR3A 3F6VA 4UV8A 1R5ID 5C4XJ 5CYVA 4BDZA 4PZJA 3L2CA 5K1YA 1U9OA 2K7LA 3GTLJ 2STTA 1ZKGA 1MBFA 5J8CA 1JTXA 4R8HA 4HQMA 2JTVA 3IWFA 1MBEA 1ZGAA 3FXJA 5TRDA 4S04A 4LOCA 2DA7A 4A5MA 1W7PD 1BR2A 3U9GA 2HWVA 4BDYA 2XIGA 1ZK8A 3CZ6A 4RBOA 2A69F 4BGDA 2Q2EB 5A2QK 1YHQI 4L9NA 5K7HA 5D4RA 2EIJH 1D5VA 5D8LB 1Y39A 4D1QA 4XICA 2LC2A 3FK7A 3ZQHA 2H94A 2VE8A 1OCTC 2VN2A 3BWGA 3BY6A 2VUMJ 4GYGA 4ABZA 2LY1A 3RYRA 2M9HA 4ZJZA 2FQ4A 2G9WA 5HDGA 2EA2A 1X1AA 4G8XA 3LA7A 4RGUA 5FGMA 4XRSG 4C2MJ 4DZPA 5B5EC 2HVRA 2EZLA 3LQRA 3JAMK 2M0CA 3U1DA 4DIQA 1IUFA 4S05A 4RA2A 2LF7A 5IT9K 4XK4A 2CGPA 2PMHA 5HOOA 4IRIA 3H92A 2LBFA 1T95A 3H1CA 5CVVA 1I5ZA 2YS9A 2KKOA 4F93B 3S3OA 3DP7A 3OR2C 5DM6F 1LDKB 3U21A 2X1CA 3K70D 4HLXA 4EJVA 4I98B 2CUJA 5DUKA 1ZGWA 4O3MA 2ZXHA 2QM3A 2YX7A 2JT1A 4M73A 3X2QH 3OV8A 5DYMA 2V7FA 1BOAA 2Y69H 1W4MA 2MLKA 2ZMEA 5JR3A 3MAJA 3AL0C 2XPWA 4HX7A 3JRGA 2VQCA 1ENHA 2DK5A 3KP4A 1NK3P 1HSJA 3Q5FA 4BE2A 1P7JA 1WI9A 3ZN1A 5AONA 4Z2YA 2H6BA 1KU3A 2ZSHB 3FXKA 4EGZA 1NH3A 2ZNYA 4N9IA 1LUJB 1DGRM 4UXNA 3E7LA 2IS6A 1IG7A 4PJNA 2IGMA 2CV1A 4G7OF 2DN0A 1WHUA 2R7RA 3CCEI 4UB6C 2CW8A 2AO9A 3S8PA 2QSGX 4FE7A 5JHUA 3ELKA 3I71A 1IRFA 5HLGA 4PFPA 2MC3A 3O3KA 1X1DA 4AU7A 3IHUA 1WJDA 1H9GA 4LIVA 3C3WA 5L3BA 1HA8A 3I53A 2F4IA 4PSXA 4IXAA 1YS7A 1MJBA 4XRSA 4OIRF 1IRZA 2K3PA 1XSVA 2FF4A 1BIAA 3JTGA 4LG0B 2DA5A 3DEUA 2E71A 4QTRA 1QPMA 1R49A 3F72A 3IV5A 2P7CB 3ZQLA 1IC8A 1XCVA 1HDDC 3K9TA 3I58A 2HQRA 1NG6A 2H8RA 5JI6A 4BACA 3DTIA 1XMKA 3IC7A 3KETA 2G7UA 1OLTA 1T33A 4N0BA 2JMWA 5CPRB 1ON1A 3SZPA 2PG4A 1MH4A 1W7PA 4ENJA 1QNTA 4C3IJ 1BI2A 2D5VA 3I4PA 4II2A 1TZLA 3T0YA 4A6DA 3HOUJ 3W3CA 5EJCA 2XAJA 1WQ2A 3TEDA 5HS7A 2HFHA 2O8KA 4ZTJA 4XMYA 5F6FA 1ORKA 1TWAJ 2XROA 3QPSA 4WF2A 1D0YA 3SEQA 2LR8A 3S2DJ 1LE8A 3RSNA 4XN3A 2ZBKA 3C1DA 4CCKA 1TT0A 5K5RA 5ILVA 1YTYA 2IGOA 2JSPA 3K6GA 1D8KA 2IAIA 5EG0B 5L3FA 2LREA 2ZJQF 4CCMA 5JVGF 3GWZA 1PUFA 4EGYA 4BHPA 2G0EA 3R6SA 2QUFA 2E2IJ 3CLQA 3HBLA 5DS9A 5DCFA 1UZCA 5E18F 5B3SH 2XAHA 3CDHA 2NXNB 1OYYA 1X4OA 1XSDA 1MMSA 3JRFA 3D1NI 2QSFX 4YEJA 3RKQA 2YX4A 3Q9VA 4BY7J 3F8NA 4KMFA 2NNYA 1XGOA 3GCMA 1A6IA 4WXDA 2Q8KA 4ZC3A 4I0BA 4HA8A 2ZC2A 2BW3A 1E0EA 4G7ZF 1FTZA 2XGCA 1OPCA 1RIOH 1QU3A 3TW7A 3BDDA 3ZQCA 2ZFWA 3CUQA 1PUEE 1VNDA 2JRMA 3OYFA 3OYKA 3OR1C 2KRHA 4N9HA 3I0TA 5L3DA 3HYIA 5J6XA 2M4KA 3DU6A 1T2KA 1P92A 4I99C 1AOYA 2CU7A 2Y31A 3BPXA 3T1BA 2P8TA 2QQBA 2VB6A 2K3FA 3K4LA 3K4NA 3CMEI 3LA2A 1LEAA 3DBLB 3VFZA 5J4VA 1QZEA 5LHHA 2Z33A 2B9SA 3ULQB 3LFUA 2AHQA 2HZDA 1TWFJ 1GVJA 1FPQA 1WH5A 4F91B 2EBIA 3PNYA 2PJRA 1VQ5I 1MW7A 2VBZA 4GRIA 4F3QA 5DM7F 1YQAA 5HODA 2R7UA 5KHDA 1LEBA 4E7ZA 2OAZA 2NNNA 3AAFA 1VTNC 2JWTA 2Y2ZA 4NHJA 4R79A 2KP6A 4AVZA 2WB1A 1EV7A 4MFDA 1LDDA 3FM5A 5E3LA 4ZZDA 3CUOA 4DBRA 1E3HA 4BU2A 2JSCA 4ESFA 3TKYA 5C44J 3R0AA 1IRXA 1ZG1A 2IP2A 2DDBA 2NS8A 3PFIA 1VQLI 4GFBA 1HLVA 5M5WJ 2BEOA 4DW6A 2F5DA 2J5OA 1X1PA 1SFOJ 4L0YB 2XPVA 2L7MP 2O03A 4LLGF 3L1PA 1LB2A 1HBXG 4OWRB 3DLLF 1GXPA 5CVJA 2DW4A 4B47A 4XLEA 3HRSA 3BTCA 2L9NA 2H1LA 5HDKA 3SQNA 3BTJA 4A0XA 1QVTA 2XAQA 4BHCA 5HVQC 1W36C 3J80Z 3DEEA 3FMQA 5LEKA 2K85A 1N77A 1R7JA 4BQAA 1I3QJ 2HQNA 1K78A 4NQWA 2VODA 1GUUA 3BR5A 3TGNA 4ZDPA 3QRFF 1WJFA 1XC5A 3KP7A 2M30A 1FP2A 1YIOA 4KIFA 2O6GE 3KYLA 2OZUA 1SFKA 4HDUA 4ENNA 5F1JA 2P6SA 1P4XA 2HQ5A 1UHMA 2I5UA 2JRTA 2EJRA 2ETHA 1B8IB 3GLLA 2RNGA 1WKMA 1T8IA 2V9PA 3CCVI 3JCUC 1A04A 4KIBA 4JOMA 4S0HB 1Z7UA 3J81Z 2Q1ZB 1EH8A 1MMGA 2JVGA 4DYRA 5J1RA 1LVAA 3I5UA 4RM2A 2HTSA 3N05A 4GXOA 2PN6A 2TCTA 4HSRA 5FRMA 3LSTA 4RGSA 4XM3A 2BOLA 1FOYA 1WJCA 2BXYA 3EUHC 3T8TA 4U0WA 2N8GA 1NK2P 2K86A 2XV4S 3K1NA 1OCPA 3JAMZ 3FMRA 1O7FA 5D8KB 2BXZA 3DV8A 1QGPA 2JVHA 3OS1A 2LKSA 3FISA 1N25A 3GXOA 3K1MA 2A3SA 2K40A 1W1WE 3E97A 1YRNB 2L2OA 1JHFA 4B8XA 2ZXIA 5EEGA 1HKQA 2WB1N 1VQ6I 3TOAA 1UB9A 1FP1D 5FLMJ 1MMDA 3Q9SA 5F04A 2W25A 3S1QJ 5KNLA 4A3LJ 2OCCH 3BROA 2EFPA 2A68F 5ICEA 5FFZA 3WG9A 1O3TA 2HDDA 2DMPA 1LFUP 3C2HA 4OAYA 3S16J 5KAIC 1B4AA 2B7EA 2P81A 5GAGJ 2DFFA 5B1BH 3HGGA 1EKEA 4XLAA 2R5ZB 3M7GA 2XB5A 5FFXA 3GMEA 3NARA 2XGEA 3DCFA 3EPZA 2V79A 3FZVA 3FDYA 3KP5A 3LOCA 3JRCA 1R5GA 2RVCA 2NVXJ 1HW1A 2BVLA 1TTYA 1IW7F 3GTKJ 1W5CC 1VQ9I 3ZMUA 4A69C 2EINH 4UY8I 4PDKA 3K70C 1TNSA 2H6CA 3IWZA 1T0FA 5K5QA 2V1XA 4M6VA 2IA2A 4UUSB 4LIUA 1OR7A 2LTPA 4U88A 4E7IA 4E70A 1IZ1A 2Y30A 3KLNA 2IRFG 1Y1WJ 4BHBA 1FYKA 3BOQA 4M72A 4BAYA 3MKYB 4LB6B 3KP3A 2LFBA 3ZPLA 2ZSIB 1WJAA 2WAFA 3S17J 2MW8A 5BMZA 5FKMA 5BNGA 1VF9A 1K4SA 3GZNB 3PL8A 2HR3A 2DJIA 1I27A 2Q0OA 5L3EA 4HQEA 3GTOJ 2IVMA 3H3UA 4GGGA 3EDPA 4DQ2A 3CD6I 4DYQA 3N4MA 5M5XJ 1DPUA 4LFUA 4A6EA 4F55A 1ZRCA 2JA7J 2E1OA 1O3SA 4IHXA 2CMPA 2EILH 2PEXA 2NVUB 2DA4A 3EETA 2R7WA 4Y52J 3RIRA 3K4JA 1YE9A 4WXHA 2KIFA 3ZMDA 5FKNA 3I54A 4RB1A 1BJAA 2VPRA 3FXOA 3M07A 4RAGA 3S14J 2K9NA 4CYDA 3LQQA 1WJEA 2CQXA 3IH4A 2EWNA 3BQZA 3S93A 2VI6A 1BC8C 1SAUA 1Z7LA 1TP4A 5HNHA 2HYGD 4HF0A 4HV5A 4YIIA 3QU3A 5CJ9A 5TISC 3E5QA 1ZGJA 4XORA 2IA0A 3F8MA 2F48A 4JX5A 4BQNA 1R5HA 2XKPA 4KICA 5E1XA 3OYHA 1SVOA 3HB9A 3HZJA 2DA6A 3V7RA 3HSFA 1JHHA 1IXCA 2K9SA 4RMNA 4XBFA 4ENKA 4OIOF 4OMZA 5E20A 2F4MB 2CYYA 5IP7J 4M9XA 2P5LC 2FXAA 5C3EJ 3EYYA 2VKVA 4HLYA 3ESWB 2DMQA 1MMAA 2WY7Q 4EM2A 3LSRA 5K5OA 5EF6A 1P4WA 4XONA 1IN4A 2DU9A 2FEZA 1J9IA 1HKSA 1MBHA 1ZG3A 2DA1A 4YFXF 2M3AA 3M8EA 3BG5A 1FOXA 3HJEA 4Y7NJ 4FETA 4C30A 3VOEA 2HEOA 5ED4A 3OMYA 3OOPA 4A5NA 1CGPA 3IKTA 4GDFA 1F36A 1ZYRF 2V9VA 2KIMA 3VYUB 1QZZA 2XRLA 3TO6A 4LJZF 1WGXA 2ZB9A 2I10A 2IGKA 2XB0X 1GT0C 2L9RA 3H5NA 2TDXA 4B3AA 2BBYA 2EQRA 3H0GJ 5GADJ 1AKHA 3L2UA 3VWBA 1UCRA 1L0OC 3CC2I 5DCMA 2KRFA 4HSTA 1I6HJ 2M87A 1FYMA 1PJRA 4BJ5C 1ETVA 1K4TA 3K2ZA 5DTDA 4MHGA 3MD2A 3M1CA 1SC7A 4WK8F 1X19A 4CCJA 2K9QA 2BHZA 2EFOA 3F0CA 3HXLA 5L3CA 1RC9A 3NQOA 1ETXA 2R5YA 3P7NA 3H0DA 1OQYA 2OPTA 3M9AA 4LG3A 5DV5A 2IGNA 3GFIA 3N97A 2FBKA 2XF5A 3TDUC 4KIGA 1WZ2A 5TJJA 5BS6A 3SFIA 2AXLA 3LSIA 1M1EB 4W1UA 2XAFA 2RDPA 3GLXA 1TW3A 3BR2A 2DOAA 3B6AA 1FT9A 5FLXK 1BBYA 2CW7A 3D5SC 1NHAA 1KQ9A 3KEQA 4Y4RA 3BZCA 4UVAA 2FUG2 3S1NJ 1QVUA 1IDZA 2FRHA 3PUFA 2QA4I 4O5VA 1JE8A 1A36A 3F3XA 4NC6A 2WWYA 4L18B 3KZIC 4A3IJ 3ECHA 2ZFUA 4CO8A 4ON0A 4NUBA 4XKVA 3QODA 3K0LA 1T6SA 2KQRA 1XSXA 4CYCA 4L9TA 1FBQA 2QKMB 4R1HA 1L3LA 2ZJPF 5E3NA 2CJJA 3RI4A 2P7VB 2A6EF 2XUBA 4XQFA 4BBRJ 2LRDA 5D5XB 1ZRDA 1T0FC 3IRQA 1D0XA 5CVIA 3VB2A 4RAFA 1S5LC 5CVRA 2CV2A 3R61A 2E35A 4AYBA 3RZDJ 1OR7C 1Z05A 5EEAA 1IGNA 4BQOA 2DT5A 2QWWA 2MABA 3K7AJ 5FROA 2WAEA 3WGIA 1R9TJ 3KYDB 3WG7H 2JA6J 3HOXJ 2Y9ZA 5FKKA 1ITYA 2CQNA 3S1MJ 1ZR2A 1JKQC 2ICWG 4IQ4A 1FYLA 4RGXA 2DOEA 1D8JA 5EDNA 5JLXA 2CUEA 1RNLA 1BW6A 1Z1DA 1V55H 1I1GA 3H35A 1W5SA 4UUSA 2QSHX 2VQLA 3V8LA 4EM1A 2E7WA 1AA7A 3HKZA 3H5RA 1TNTA 1MD0A 4MQVA 4H4KC 3FXLA 4L5IA 3I59B 3PO2J 2AXTC 4G6QA 2WV0A 1FX7A 2OQRA 4C2TA 4BEHA 2HQAA 2EB7A 3G6EI 5E17F 1QPIA 4LB5A 2KJBA 5LLQA 4OIPF 3AG1H 4Y17A 3HPHA 5D5VB 2X4HA 4ESBA 2IJLA 3JW4A 1YG2A 4QWQA 3HSRA 2OUMA 2O5RA 2BY3A 2KDOA 3HHGA 2X6XA 3CCYA 4PJMA 4JQFA 4L5JA 3RKWA 3WHBA 3HC7A 4BBSJ 5D4SA 2R7OA 4AD9A 1D0ZA 3DU5A 4KDPA 1OCOH 4D9JA 5IOZA 3GW2A 2DODA 3GFJA 3MKLA 4M9ZA 3K2AA 2ECCA 2W82A 4P96A 4B3XA 1AU7A 2CG4A 4IHWA 3WU2C 4BNCA 1BR4A 3S2HJ 3ROUA 4Y33A 1O7LA 2M34A 3OSFA 3KYCB 2HPIA 4ZDLA 3ZQGA 2P5KA 3HPGA 3A0BC 4MLOA 1VQMI 4XKBA 3GTJJ 1Z6TA 3S32A 2STWA 4HBLA 1H8AC 3MZYA 2NVTJ 3WU0A 3M8JA 1Y56A 4RM3A 4KA4A 4OIQF 2NS0A 3MMYB 1UG2A 2JPCA 3DXJF 4NNJA 2NOGA 1S7OA 2ZCWA 1WVRA 3K69A 3P9IA 2JN6A 3ASOH 4KN7X 4AYBN 1BIBA 5IY5H 2QKLB 1I50J 3WE2A 4XRFA 1FTTA 3CO7C 2ZXWH 3FIWA 3F8CA 4FISA 3AKZA 2VT3A 2XPUA 2FBHA 3CCJI 3LFKA 5L3GA 3S3NA 2M7BA 2DQLA 4I7HA 2MH9A 1O3RA 1REPC 4OMYA 3DEWA 2AS5F 3HKZN 4B1RA 1DP3A 3ZP5A 3HUGB 4I2OA 1U8RA 2OTJI 3HTSB 5J1UA 2MG4A 3E6MA 4IOCF 1FEXA 2BY2A 3O6BB 1UAAA 3I56I 4UVCA 2DYSH 1BW5A 2WADA 4B4CA 3DFGA 1I39A 3DQVC 4XSZF 2A07F 4QPOA 5F0CA 3KZYA 2V1NA 3WTWC 2K4JA 5LD2C 2LOOA 3MZ8A 3BG3A 3H9GA 5ICCA 5ICGA 4MO7A 3HHHA 1VQ7I 2Z1DA 3HTUA 2BY1A 3SHFA 2ME0A 3SZGA 4NC7A 1LVKA 3CF2A 4KUMA 3L2VA 4V2FA 2JA8J 3EUHA 1VQKI 3RJPA 1SFXA 2R7DA 5M3FJ 2DMNA 4FASD 3MFKA 2M0MA 1VQ8I 1RKTA 1S8NA 2GA1A 3JRBA 2DXIA 2LG4A 1RPWA 1P2FA 1JUMA 2H27A 4AC0A 3LSPA 1S9HA 2L0KA 2LF8A 5CQGA 2LMDA 4U87A 3ERED 4P5OA 5ILUA 4IF4A 2MYSA 2VONA 4KITB 1R4NB 2A6TA 1KONA 3E6CC 1W0UA 1ZH5A 4MGRA 1ETOA 1X4PA 4XIDA 3QWLA 4KJZA 2DJNA 4C3JJ 1YI2I 2DBBA 5IP9J 2P5VA 2OF7A 3K4KA 2L3DA 1OYIA 2NVYJ 4JBAA 2R7XA 3QOPA 2KDZA 2LNBA 1G4DA 2XF6A 2QVOA 5H6RA 2LVSA 3OIQA 4IVNA 3SZTA 4J00A 1FSEA 4OAZA 5HLTA 1HSTA 1IN6A 1LNWA 4PCQA 1MNDA 1V5EA 4RS8A 1Y0UA 2CW0F 1U5TB 2BVMA 4GYIA 2DPDA 1ZN2A 1E3OC 4HW0A 3T8RA 2CRGA 3A01B 3LNQA 3F21A 3ZMZA 1U3EM 1Q1VA 1B9NA 4IHVA 2K02A 5FKLA 3MCZA 1V5GA 4EEFG 4CICA 2EH3A 2NVQJ 2X1EA 2QF7A 4K2EA 1SFUA 3WHCA 1E2XA 4L9VA 2VC1A 1GV2A 5KAFC 3OIPA 1YX5A 4UV9A 2VASA 1GV5A 2DFEA 2FX0A 2RQQA 2V1DA 1G59A 1DGWY 2RQPA 2RKHA 3I59A 2E19A 2Q2EA 3S15J 3PQJA 4IQJA 2YU3A 4IJAA 3ZN0A 4BL0B 1A6QA 3FX3A 3IH2A 1UHSA 1XG1A 2UV1A 1U9NA 2IW5A 3DBHB 1X3WB 3OYAA 3ZXSA 1G3YA 3AG3H 4I01A 3W6JB 3WTSC 2DT7B 2TRTA 5JVTA 2FD5A 4IZZA 1JT6A 2KT0A 4CCNA 4F7ZA 3BJAA 2JZYA 2Z3YA 4KMUX 4M3GA 4WCGA 2DTRA 4DNCA 1MH3A 4YIRX 2M2EA 2RNJA 1ONVA 1Q1HA 3K10A 2FOWA 3RZOJ 1HC8A 3R0JA 3HOYJ 2M8EA 3VODA 3PUBA 1EA3A 2A6HF 1QBJA 2EIKH 3PFYA 1OCZH 3FXQA 3V42A 1BA5A 1KYWA 5J8FA 5AIPA 3G4SI 1SMTA 2LD5A 4A3DJ 3BCAA 2XSJC 5B66C 2ESHA 2BHYA 2MC4A 2WC2A 4C9YA 3AL0B 4D7MA 2P6TA 4A3GJ 2DDAA 1K83J 4X0GA 4FE4A 3CMYA 4CUGA 4D5FA 1Z3XA 3J7AY 1ODDA 2D1HA 4YELA 2HVQA 1SD7A 4C2UA 3ERMA 3O8GA 4FX4A 2EFWA 2LKPA 5AIQA 1G2HA 3HRMA 3KP2A 1TQPA 3R4KA 2VQGA 1TL8A 2GBYA 2E1NA 3A4CA 4IKFA 3GFMA 2M7AA 2WBMA 1KGSA 2L5QA 4OOIA 2COMA 2XRNA 1PYVA 3CQZJ 4PJJA 2XHKA 1R23A 4MTEA 1D1AA 1U2WA 2VXZA 2M8GX 4A3KJ 5A2QZ 1U6GA 2X6YA 2KJCA 2JA2A 3OL4A 4G7HF 3TQNA 1ZQ3P 2E5NA 4E7SA 3TO7A 4XLHA 4JX6A 2KL4A 4PGHA 3SJMA 4G6TB 5EZGA 4L5EA 3CCQI 2VJ4A 2DI3A 1EH6A 2UXXA 1YFHA 3OYJA 1ZLKA 3JRIA 4LG0A 1OMIA 3K4CA 2G7HA 2V26A 3NWTA 1VZ0A 3OYIA 2W84A 4B09A 3CMMA 1LFPA 2ISZA 2L54A 4WXCA 5IT9Z 4I0AA 4RAYA 4UHTA 2B63J 1KQ8A 1LDJA 4GO1A 4I6ZA 3BG6A 2HKXA 1WPKA 4KN4X 3MKWB 2X0LA 5E8GA 1BI1A 3OYBA 2HOAA 1JTYA 4N4NB 2K9LA 2VL8A 2V4JC 5EEHA 1DDNA 2FNAA 2RGVA 1DUXC 5DEQA 4Q5SF 3BR0A 1MDMB 3GO5A 4HNTA 1TLHB 4M3FA 5LEJA 4L0ZB 3CF5F 4IHTA 1SFEA 2QQ9A 1HOMA 2VIXA 1OCRH 1XGNA 3QPLA 3W2WA 5DUIA 4E7HA 3WGGA 1BC7C 5HS9A 2QEXI 2E2HJ 1QRYA 1XGSA 2VBXA 4UNOA 1R1UA 4XOPA 4EJTA 2MBFA 1YITI 2BYVE 3CJTB 4Q47A 4A3EJ 4A12A 5HLHA 2NS7A 2ID3A 2K4BA 4A0YA 1IF1A 4ZYDA 2A5WA 3OWTA 2ZXJA 4V19K 3C2BA 3CCLI 1U8BA 2DQRA 4OU0A 2GIVA 2RC4A 4CA0A 4D7NA 1ACIA 5DD8A 1K61A 5GPCA 5EG0A 3HRUA 2WA0A 1O3QA 2Z99A 3BR6A 2VJ5A 2DA3A 4IRGA 2X6WA 3EUKL 1ZTRA 3RTRA 1VQOI 1QQIA 1Z9CA 4U0VA 1PVEA 2PMUA 2R3SA 1D3YA 2E34A 5K7FA 2ZJRF 1ZRFA 1GXQA 1ON2A 4IOAF 2ID6A 3OIOA 4RB2C 3DKWA 4IO9F 1Y6IA 3F8BA 3WU1B 1ZAOA 1JGGA 1IXSB 2V6EA 3I55I 3U2RA 5EZHA 3HOTA 4B44A 2PBIA 4XRMA 2AQEA 3PNVA 3O8HA 2M4GA 2XGDA 4J01A 2VC0A 3BJOA 3I4NJ 1HCRA 3VYRB 2EPFA 3ZQFA 4AIHA 3JREA 4HDVA 1IUYA 3M1EA 3MN2A 5ICFA 1YLFA 3DLAA 1RKWA 4DOZA 3BG7A 2ZJ2A 3BZ6A 3V7SA 2BV6A 4CZZA 2HTJA 1MKMA 1E17A 2LDUA 2CS3A 5FD5A 1XMXA 2Y75A 2DMTA 2FOKA 4L9JA 2PFBA 2UZKA 4G94A 2PI0A 1ETWA 1X2MA 1BI0A 3ZCOA 3HOSA 1JXSA 1BOBA 2LBFB 3KCCA 1E3PA 5LFAA 1K6YA 3AG2H 3AFHA 5CQEA 4EJUA 5LGTA 2A61A 1O4XA 2YSRA 5IOYA 4A0ZA 2ADUA 2ELHA 2O0YA 1EJ9A 3SDGA 2HYFA 3GUDA 2KPMA 2OQGA 5TGTA 1UFMA 2KISA 5D6EA 4XOTA 1RR7A 4DJAA 3LAJA 2ZMEB 3E0JB 1FMWA 2F5CA 2MLGA 2YUSA 1MSFC 3OS0A 4CDGA 6PAXA 2IBDA 3OYEA 4G9YA 1MNMC 1PP8F 5IYBJ 2W85A 1R1TA 4QSHA 2CO5A 1NG7A 2ELKA 5FRNA 2PQ8A 2W1OA 1G8XA 2HOTA 4LLNA 2ELJA 2OA4A 3ASNH 2JUGA 4X1EA 3H9QA 1MZBA 4XLCA 3I64A 4Y13A 3VDXA 2LSOA 3ZOBA 4QIWN 4A93J 2GXGA 3J7ZI 3PNTA 3QQAA 5FB2A 2VKEA 1WSUA 1F5TA 1DPRA 4M3DA 1BN5A 4M3EA 1LQ1A 3UNGC 4JX4A 3FXRA 4RDUA 2QGUA 3L09A 1W0TA 2CSOA 4DYCA 1XD7A 5JFRA 1WJ5A 2HXOA 5F64A 2GOXB 5LHGA 1KZHA 3W2VA 3ZR8X 3V7CA 3BP8A 2JQ7A 1XDUA 5EGOB 4MNUA 2O9LA 1R22A 2LKXA 1XDSA 1KU2A 1MIJA 2L02A 1FWZA 4RB0A 3MKZA 2XF7A 1B8IA 1VFCA 3GFLA 2ECBA 4HF1A 3FBIB 4EATA 4RB3C 2EZIA 4A2UA 1HXDA 1Z3YA 3B02A 4ASNA 3G1LA 1W7PB 2JJ7A 2PMZA 4II3A 4EVIA 1USSA 2Z5UA 2HDWA 2F6CA 3F22A 1IO2A 2GA2A 5E1ZB 1OYWA 1KQ0A 3IAS2 2E60A 4PK4A 4BJTA 1LJ9A 3RQIA 1TW2A 2CFOA 1JKPC 3QYFA 1J7KA 4G12A 1LE8B 1YRNA 5KK1A 1R1VA 3NRVA 1YW7A 4FQGA 3MQ0A 1F43A 4D0PA 2LY9A 2L7KA 3DPUA 4G6DA 4RLQA 5LGUA 4NC8A 4EMSA 4BYYA 1FJLA 2FNPA 2MD5A 3LL7A 2DLLA 5IT3A 1HKTA 3C7JA 2HVSA 2IS4A 2L9VA 1YJWI 3L7WA 3R60A 3CO6C 4V2GA 2I8DA 2R5ZA 3VYSB 3V8JA 2L4MA 5B1AH 2HOEA 3SFZA 3OYLA 2JUCA 2QQ8A 3VYTB 3ZQQA 1LPQA 4LITA 4YFNF 1RUOA 3KIOA 3MEXA 2KZGA 2EZHA 2JPBA 3F8FA 2NOJB 2DCEA 3VPRA 1JJ6C 4P55A 2BW3B 1HW5A 2HGCA 4C3HJ 3CJQB 5IYCJ 2R7TA 3OSGA 2E1MB 1XTAA 1U5TC 3O2PE 2R0QC 5HS8A 2DYRH 3I3LA 3CUQB 3J80K 1WFXA 2VOOA 2QQAA 4Y15A 1WWXA 4AWXB 1TWGJ 2KMUA 3E6DA 3LA3A 1Z21A 1HDPA 4Z6YA 1C0WA 2CV0A 1YW8A 3BLYA 1DU0A 3DKXA 2R4GA 2COBA 2H8WA 2OV7A 2RREA 5E1WA 5F1RA 4AIJA 2O8XA 1NTCA 4ZDOA 3H5AA 1IAWA 4H0EA 2OC6A 1RI7A 1KU9A 5M5YJ 3IH3A 1J0RA 4BH9A 4ZTFA 4MEYF 1PDNC 3CP8A 2PJRB 3RQ4A 2WAQA 3J81K 3MWMA 5H20A 1XMAA 1SD4A 2PMZN 3K4MA 4KFCA 2DMUA 2E2JJ 4PUSA 1Y8RB 2MH2A 2XGXA 2NYXA 1GVDA 4IL6C 2AQFA 5FJ8J 2VOPA 3G71I 1G6NA 5F08A 1D1CA 3F9KA 3FM3A 4NB5A 5D5UB 1K6OA 2XVCA 2OJED 4I76A 1AHDP 1A31A 1VQNI 3OY9A 2LK2A 1QHGA 2X48A 1J2XA 3LAPA 2F5FA 3BCBA 3FK6A 5JLWA 1Z77A 1IJWC 1BM9A 2Z16A 5GAHJ 2PX9A 4HAMA 2DT6A 3IL2A 3PSFA 3S3MA 4AIDA 1X3UA 1RUNA 4ZYGA 3MZHA 4ZZLA 3D5LA 2XKOA 4EM0B 3TW6A 2H1KA 1F9NA 1T08B 5CVUA 5KCMA 4HRIA 5F27A 4KT5C 2VBYA 3KPHA 3WTVC 1MJ9A 3HIFA 1ZHFA 5J4YA 3A1YA 1X1BA 1P9QC 2W00A 1FMVA 5F0HA 3WTUC 1K78B 4ZH4F 4HNUA 1T38A 4F52A 4ENMA 1IV6A 2GAUA 4NQWB 4DZJA 4XLPF 1P6RA 3ZMVA 1R00A 4UUTA 3WE3A 4QLCU 1B1BA 3AG4H 3FKJA 1OFCX 3S2WA 3HOVJ 1Z67A 3QOEA 3GX4X 1A35A 3QP5A 1VI0A 1X58A 2CUFA 1ERDA 2CQQA 1SVLA 5JHFA 1S7AA 1TQIA 4XNFA 1FSHA 5LBQA 2W48A 4I02A 2GZWA 1YIJI 4AVPA 3DPTA 3L9FA 2HDCA 3EYIA 4CHUA 1X1CA 2V1UA 4BQQA 2X9DA 3C2GA 1BR1A 5D6FA 1RRJA 3W6KB 3Q3SA 5GP9A 5J3LA 2Z9OA 1KA8A 3J7YJ 1RETA 1BI3A 1UJ8A 2VKDA 3CJNA 3HGYA 4LK0F 5HLIA 4M9SA 4EQQA 3BTIA 1J5YA 2ACJA 2EIMH 4IPAA 1EF4A 1GDTA 2WAQN 2DOFA 2HXIA 4A3MJ 5EGOA 1IN8A 1JUPA 3GF2A 5EYRA 3ABUA 2A5YB 3K4BA 2IA1A 1CF7B 1N78A 4ITVA 1JKOC 5E3MA 1R58A 4YG2F 1H89C 3HOZJ 1ZELA 5E3OA 2FA5A 4HV6A 2GIZA 3EUAA 1YX3A 1S7EA 1FBUA 3ZQ7A 2VLAA 4PSWA 1XPXA 1J09A 2UWMA 3FHZA 2K9MA 2RAEA 2P0WA 1MJAA 5J47A 3JRDA 4XN0A 1VQPI 3GBGA 3L2QA 1UELB 5LGNA 5IYDJ 2VJJA 2GWRA 2QENA 3RPQA 2YR2A 3DTEA 2KIQA 1MNEA 1Y8QB 3JSPA 3ABKH 2XASA 2HPMA 5DD4A 3GTMJ 3A02A 2IS2A 4W97A 1T56A 4HX8A 4CH7A 4CZCA 4BS9A 5FLVA 3GTPJ 3H3ZA 1IN5A 3ABLH 3BZKA 3OYNA 4B43A 4J19A 3CDIA 1YO5C 3WTTC 1WJBA 5M3MJ 5BQTA 2MD0A 3CC7I 1UMQA 3HG9A 3ISPA 1QA6A 3F23A 1Y1VJ 3ZRGA 3ZMSA 3KLOA 5ILSA 3LWFA 4BXFA 1XS9A 1MBKA 1MBJA 5GAEJ 1IXRC 1FNNA 2EFNA 3HRTA 4U7BA 2QYOA 4PJLA 2OZ6A 2X51A 2VE9A 4BUPA 2EFQA 2D1VA 3E1SA 4E7JA 5BOXA 4CSWA 3JR9A 1U78A 1B6AA 3CC4I 3RKXA 3M4OJ 4LMYA 1B9MA 3KX2A 4MIMA 3FHNA 3L00A 1Z91A 2PJPA 2GM4A 5DDGA 1ETKA 1POGA 2E5ZA 4PJ0C 2VPLA 4HX4A 1FBSA 2IPQX 4FT8A 1R4MB 1P7IA 2M5WA 2BZTA 1H88C 3OYDA 1B72B 4XKWA 3RCOA 3E5XA 1CQTA 5FLXZ 2X6OA 2FQ3A 1IRGA 2HU9A 3CDLA 2Y0MA 4HNVA 2R7ZJ 4TV7A 1RR8C 1JT0A 3NEUA 4FX0A 2R93J 3DPLC 2OBPA 1DU6A 3M8FA 4UVBA 4XL9A 2E7XA 3G73A 2E1CA 3S1RJ 4P9UA 2GLOA 2EA4A 3IAM2 4KYWA 2DAOA 1PP7U 3QAHA 1R6RA 4BXUA 4NBQA 2DK8A 4UUVA 5D5WB 5BPDA 2M1BA 2VKHA 2D2WA 5J40A 2NRAC 3OL3A 1B59A 3W6VA 1Z0XA 1WH7A 4YRVA 3QYBA 2VXDA 2FMLA 2W57A 1G3SA 2M45A 3T5XA 2ZMEC 1ZLJA 3DTKA 1JJ8C 1MGTA 1TT5B 5E79C 4D5CA 4LGWA 4CGZA 4UB8C 1YYVA 4MQ9F 5FD6A 2HI3A 1TWCJ 2CWEA 3KEYA 4Q4ZF 3QPTA 1UHWA 3FF5A 4E4HA 4OINF 3B6CA 1ETQA 2K5CA 3I9V2 3CCUI 4N4OB 4F92B 1JKRC 1XCBA 3VSLA 1D1BA 2QZ8A 3JRHA 1QO0D 3WTZA 2KRCA 3Q0VA 3COAC 4ANJA 1KYZA 1DQUA 1FIPA 2LYCA 3V8KA 3KP6A 1V3FA 3IRRA 4RAZA 2F5EA 3CCMI 4A3BJ 4AUXA 2HZTA 1AKHB 3G2BA 4LK1F 2W24A 5DCMB 3JRAA 1SD5A 3RPUD 1LFBA 1TQMA 2EZKA 1GLNA 1S29A 2IS1A 3E3VA 3JTHA 3HUGA 5E8IA 2IEKA 3LSGA 2P4WA 1WI3A 4JK1X 3BPVA 1BJZA 2VJIA 3Q0UA 3TOBA 4E6KG 9ANTA 3GZ6A 3J7AO 4RLFA 2GXBA 2R5YB 2Z2SB 5HDNA 2D45A 2ISYA 4AM3A 1YJ9I 1FIAA 2DFIA 3NAUA 3DWLE 3LMMA 3PIOF 1SEUA 1HW2A 3P9KA 3LSMA 3GYHX 2CH0A 2QBYB 3GVAA 1T39A 4CXFA 4PGGA 5F0FA 3OOUA 4HG2A 1X3ZB 1HQCA 3IUOA 4BE0A 1A5JA 3LSKA 1O57A 1K79A 2KHMA 4M71A 3REOA 3C18A 2W7NA 3FXMA 3WTXC 3WTYC 1AWCA 4BXXJ 4XSXF
chains in the Genus database with same CATH topology
3HSEA 3KEOA 2L01A 4U0YA 3ABTA 3ECOA 4M6YA 4MTDA 1CF7A 2FU4A 1FLIA 4YFKF 1GHCA 5LRRA 1FOKA 1KU7A 3CTAA 1YW9A 1G3TA 1OKRA 1W5TA 2HKOA 3QP6A 4O6JA 4WWCA 4I09A 2DPUA 1SD6A 3JSOA 4HOBA 3RYPA 4EJOA 1FZPB 5FO5A 2ESNA 2FMYA 3ML6A 3EQLF 2ZNZA 5ERIA 3D0SA 2QLZA 1G3WA 2YPRA 1TBXA 1U5TA 3RDIA 4WX9A 3TO9A 3CLOA 1ZG5A 3CUQC 3ZMTA 2EK5A 1JGSA 1V4RA 1P4AA 3KZZA 1FY7A 2FBIA 2BGCA 2O3FA 5LHIA 4AIKA 2FE3A 3IKVA 4XLNF 2CQKA 2V6CA 2R7FA 3PQKA 2Y48A 1J59A 1ZREA 2VBWA 1F1ZA 3GZ5A 3RPUA 2B0LA 3SXYA 4MEXF 3QU6A 1RZ4A 4HZFA 3KE2A 4GCVA 4EJWA 5CLSA 3P9CA 1H0MA 1QZYA 2VT2A 3E5UA 1XGMA 4M74A 5H6QA 2H09A 2BE5F 3K1PA 2IT0A 2ZKZA 2NAZA 2L4AA 3V4GA 3VEPA 5LRSA 2C6YA 4LLLA 2DO7A 1FC3A 3GEZA 1SMYF 4LD5A 2K27A 1XN7A 3TDZC 1S3JA 1YS6A 4YIFA 1EH7A 2EV6A 3DF8A 4KNYA 1R36A 4IHSA 3F6OA 4HF2A 4FHTA 1S6LA 3G3ZA 1I1SA 2HS5A 1Z6RA 3BJ6A 2XAGA 4ZYEA 3KFWX 1WRJA 2O61A 1ZARA 3WODF 3FXUA 3B73A 3QPHA 4Q48A 2WTEA 1ULYA 2EV0A 2F2EA 3FMSA 4P9FA 4M6XA 1STZA 2ZO4A 2UXNA 3WGHA 3E6BA 4ESJA 2CFXA 4EV0A 1XB4A 2OU2A 1J75A 1USTA 2QBYA 1H9TA 5BPIA 1K7AA 1F4KA 4IRHA 4ETSA 4HYEA 2J5PA 2EV5A 1MDMA 1T98A 1DP7P 2GQQA 2MA3A 2RV8A 4U7DA 3RKYA 2KIUA 2RN7A 1SAXA 2PLYA 1IN7A 4RGRA 1I6XA 5KVRA 4ZYHA 2FSWA 2OD5A 3FWEA 3F6VA 4UV8A 5CYVA 4PZJA 3L2CA 5K1YA 2K7LA 2STTA 5J8CA 4R8HA 4HQMA 2JTVA 3IWFA 1ZGAA 5TRDA 4S04A 4A5MA 1W7PD 3U9GA 2HWVA 2XIGA 2A69F 5A2QK 4L9NA 5D4RA 1D5VA 5D8LB 2H94A 2VE8A 2VN2A 3BWGA 3BY6A 4GYGA 3RYRA 2G9WA 5HDGA 2EA2A 4G8XA 4RGUA 3LA7A 5FGMA 4CHUA 3LQRA 3JAMK 3U1DA 4S05A 5IT9K 2LF7A 2CGPA 2PMHA 5HOOA 4IRIA 3H92A 5CVVA 1I5ZA 2KKOA 3DP7A 1LDKB 4HLXA 4EJVA 4I98B 5DUKA 4O3MA 2QM3A 2YX7A 2JT1A 4M73A 3OV8A 5DYMA 1BOAA 1W4MA 2MLKA 2ZMEA 5JR3A 3MAJA 4HX7A 3KP4A 2DK5A 1HSJA 3Q5FA 1WI9A 3ZN1A 5AONA 4Z2YA 2H6BA 1KU3A 4EGZA 2ZNYA 4N9IA 4UXNA 4G7OF 5JHUA 3ELKA 3I71A 1IRFA 5HLGA 2MC3A 3O3KA 3IHUA 1H9GA 3C3WA 5L3BA 3I53A 4IXAA 1YS7A 1MJBA 4OIRF 1XSVA 2FF4A 1BIAA 3JTGA 4LG0B 3DEUA 1QPMA 3F72A 2P7CB 1XCVA 3K9TA 3I58A 2HQRA 5JI6A 1XMKA 3IC7A 3KETA 2G7UA 4N0BA 1ON1A 3SZPA 2PG4A 1W7PA 4ENJA 1QNTA 1BI2A 3I4PA 3T0YA 4A6DA 2XAJA 1WQ2A 5HS7A 2HFHA 5F6FA 2XROA 4WF2A 2ZBKA 3C1DA 5K5RA 5ILVA 1YTYA 1D8KA 5L3FA 3GWZA 4EGYA 4BHPA 3R6SA 2QUFA 5DCFA 5E18F 2XAHA 3CDHA 1OYYA 1XSDA 2YX4A 3Q9VA 3F8NA 4KMFA 2NNYA 1XGOA 4WXDA 2Q8KA 4I0BA 4HA8A 4G7ZF 1OPCA 1RIOH 3BDDA 2ZFWA 3CUQA 1PUEE 4N9HA 3I0TA 5L3DA 3HYIA 5J6XA 1T2KA 1P92A 1AOYA 3BPXA 3T1BA 2P8TA 2QQBA 3LA2A 1LEAA 3VFZA 5LHHA 2Z33A 3ULQB 1GVJA 1FPQA 2VBZA 1YQAA 1LEBA 2OAZA 2NNNA 3AAFA 1VTNC 4NHJA 4R79A 1EV7A 1LDDA 3FM5A 4ZZDA 3CUOA 4ESFA 2JSCA 3TKYA 3R0AA 1ZG1A 2IP2A 3PFIA 2BEOA 2F5DA 2J5OA 4L0YB 2O03A 4LLGF 1LB2A 1HBXG 1GXPA 5CVJA 2DW4A 3HRSA 5HDKA 3SQNA 4A0XA 2XAQA 4BHCA 5HVQC 3J80Z 3FMQA 5LEKA 1R7JA 4BQAA 1K78A 2HQNA 4NQWA 2VODA 3TGNA 3QRFF 3KP7A 2M30A 1FP2A 1YIOA 4KIFA 2O6GE 2OZUA 4HDUA 4ENNA 2P6SA 1P4XA 1UHMA 2JRTA 2EJRA 2ETHA 1WKMA 4KIBA 1A04A 1Z7UA 3J81Z 1EH8A 1LVAA 3I5UA 2HTSA 4GXOA 2PN6A 3LSTA 4RGSA 3T8TA 4U0WA 2K86A 2XV4S 3K1NA 3JAMZ 3FMRA 1O7FA 5D8KB 3DV8A 1QGPA 3K1MA 3GXOA 2A3SA 3E97A 1JHFA 4B8XA 5EEGA 1HKQA 3TOAA 1UB9A 1FP1D 3Q9SA 2W25A 1O3TA 3BROA 2EFPA 2A68F 5ICEA 5FFZA 3WG9A 1B4AA 3M7GA 5FFXA 2V79A 3FZVA 3KP5A 1R5GA 2RVCA 1HW1A 1TTYA 1IW7F 3ZMUA 4PDKA 1TNSA 2H6CA 3IWZA 1T0FA 5K5QA 2V1XA 2IA2A 1OR7A 4U88A 4E70A 1IZ1A 3KLNA 2IRFG 4BHBA 1FYKA 3BOQA 4M72A 4BAYA 4LB6B 3KP3A 3ZPLA 5BMZA 2HR3A 1I27A 2Q0OA 5L3EA 4HQEA 2IVMA 3H3UA 4GGGA 3EDPA 4DQ2A 3N4MA 1DPUA 4LFUA 4A6EA 1ZRCA 1O3SA 2PEXA 3EETA 3RIRA 4WXHA 2KIFA 3ZMDA 3I54A 4RB1A 1BJAA 4CYDA 3LQQA 2EWNA 1BC8C 2HYGD 4HF0A 4HV5A 4YIIA 3QU3A 5CJ9A 3E5QA 1ZGJA 2IA0A 3F8MA 1R5HA 2XKPA 4KICA 5E1XA 3V7RA 3HSFA 1JHHA 1IXCA 4XBFA 4ENKA 4OIOF 4OMZA 5E20A 2CYYA 4M9XA 2P5LC 2FXAA 3EYYA 4HLYA 4EM2A 5K5OA 1P4WA 1IN4A 2DU9A 2FEZA 1J9IA 1HKSA 1ZG3A 4YFXF 3M8EA 3VOEA 2HEOA 5ED4A 3OOPA 4A5NA 1CGPA 3IKTA 1ZYRF 2V9VA 2KIMA 1QZZA 3TO6A 4LJZF 2TDXA 2BBYA 1UCRA 1L0OC 5DCMA 2KRFA 2M87A 1FYMA 3K2ZA 4MHGA 4WK8F 2EFOA 5L3CA 3NQOA 3P7NA 3M9AA 5DV5A 3GFIA 3N97A 2FBKA 3TDUC 4KIGA 5TJJA 5BS6A 2AXLA 2XAFA 2RDPA 3GLXA 1TW3A 1FT9A 5FLXK 1BBYA 1NHAA 1KQ9A 3KEQA 4UVAA 2FRHA 1JE8A 4O5VA 3F3XA 2WWYA 4L18B 3ECHA 4CO8A 4ON0A 3K0LA 1T6SA 1XSXA 4L9TA 1FBQA 4R1HA 1L3LA 3RI4A 2P7VB 2A6EF 2XUBA 5D5XB 1ZRDA 3IRQA 5CVIA 3VB2A 5CVRA 3R61A 1Z05A 2DT5A 2QWWA 3WGIA 1FYLA 4RGXA 1D8JA 1RNLA 1Z1DA 1I1GA 1W5SA 3V8LA 4EM1A 2E7WA 1TNTA 1MD0A 4MQVA 4L5IA 3I59B 4G6QA 2WV0A 1FX7A 2OQRA 5E17F 2EB7A 4LB5A 2KJBA 5LLQA 4OIPF 4Y17A 5D5VB 2X4HA 4ESBA 2IJLA 3JW4A 1YG2A 4QWQA 3HSRA 3HHGA 4JQFA 4L5JA 3RKWA 5D4SA 4AD9A 4KDPA 3GW2A 3GFJA 4M9ZA 4P96A 2CG4A 4BNCA 3ROUA 1O7LA 2P5KA 1Z6TA 2STWA 4HBLA 3MZYA 3WU0A 4KA4A 4OIQF 2NS0A 2JPCA 3DXJF 1S7OA 2ZCWA 3K69A 3P9IA 4KN7X 1BIBA 3WE2A 4XRFA 3CO7C 3F8CA 2VT3A 2FBHA 3LFKA 5L3GA 2DQLA 4I7HA 2MH9A 1O3RA 1REPC 4OMYA 2AS5F 3ZP5A 4I2OA 1U8RA 3HTSB 3E6MA 3O6BB 4UVCA 3DFGA 3DQVC 4XSZF 2A07F 3KZYA 3WTWC 2K4JA 5ICCA 5ICGA 3HHHA 3HTUA 3SHFA 4KUMA 3EUHA 3RJPA 1SFXA 2R7DA 3MFKA 1S8NA 2GA1A 1P2FA 2H27A 2LF8A 3ERED 4P5OA 5ILUA 4IF4A 2VONA 3E6CC 1ZH5A 4MGRA 2DBBA 2P5VA 2L3DA 1OYIA 4JBAA 3QOPA 1G4DA 2LNBA 2QVOA 5H6RA 4IVNA 3SZTA 1FSEA 1HSTA 1IN6A 1LNWA 4PCQA 4RS8A 1Y0UA 2CW0F 1U5TB 4GYIA 2DPDA 1ZN2A 4HW0A 3T8RA 3F21A 3ZMZA 1U3EM 1B9NA 2K02A 3MCZA 4CICA 4K2EA 1SFUA 1E2XA 4L9VA 2VC1A 4UV9A 2V1DA 2RQPA 2RKHA 3I59A 2Q2EA 3PQJA 2YU3A 4IJAA 3ZN0A 3FX3A 2IW5A 1G3YA 4I01A 3W6JB 3WTSC 5JVTA 4F7ZA 3BJAA 2JZYA 2Z3YA 4KMUX 4WCGA 2DTRA 4DNCA 2RNJA 1ONVA 1Q1HA 3R0JA 2M8EA 3VODA 2A6HF 1QBJA 3FXQA 1KYWA 5J8FA 5AIPA 1SMTA 2ESHA 2WC2A 2P6TA 1ODDA 2D1HA 1SD7A 4FX4A 2EFWA 2LKPA 5AIQA 3HRMA 3KP2A 1TQPA 3R4KA 2E1NA 3GFMA 1KGSA 4OOIA 2COMA 2XRNA 2XHKA 1R23A 4MTEA 1U2WA 2VXZA 5A2QZ 1U6GA 2KJCA 4G7HF 3TQNA 3TO7A 4PGHA 2DI3A 1EH6A 2UXXA 1YFHA 1ZLKA 4LG0A 1OMIA 2G7HA 2W84A 4B09A 2ISZA 2L54A 4WXCA 5IT9Z 4I0AA 4RAYA 4UHTA 1KQ8A 1LDJA 4GO1A 2HKXA 4KN4X 2X0LA 5E8GA 1BI1A 5EEHA 1DDNA 2FNAA 2RGVA 1DUXC 5DEQA 4Q5SF 1MDMB 3GO5A 5LEJA 1TLHB 4L0ZB 4IHTA 1SFEA 2QQ9A 1XGNA 5DUIA 3WGGA 1BC7C 5HS9A 1XGSA 2VBXA 4UNOA 1R1UA 4EJTA 2MBFA 2BYVE 4Q47A 4A12A 5HLHA 2K4BA 4A0YA 1IF1A 4ZYDA 2ZXJA 2DQRA 4OU0A 2GIVA 2RC4A 5DD8A 3HRUA 1O3QA 2Z99A 4IRGA 3RTRA 1QQIA 1Z9CA 4U0VA 2PMUA 2R3SA 1D3YA 1ZRFA 1GXQA 1ON2A 4RB2C 3DKWA 3F8BA 3WU1B 1ZAOA 1IXSB 3U2RA 3HOTA 2PBIA 2VC0A 3BJOA 4AIHA 4HDVA 1IUYA 3M1EA 5ICFA 1YLFA 2ZJ2A 3BZ6A 3V7SA 2BV6A 4CZZA 2HTJA 1MKMA 1E17A 2LDUA 5FD5A 2Y75A 2FOKA 4L9JA 2PFBA 2UZKA 4G94A 2PI0A 1BI0A 3HOSA 1JXSA 3KCCA 4EJUA 5LGTA 2A61A 2YSRA 4A0ZA 2ADUA 2ELHA 2O0YA 2HYFA 3GUDA 2OQGA 1UFMA 5D6EA 3LAJA 2ZMEB 2F5CA 2MLGA 4CDGA 6PAXA 4G9YA 1PP8F 2W85A 1R1TA 2CO5A 2PQ8A 4LLNA 2OA4A 1MZBA 3I64A 4Y13A 2LSOA 2GXGA 5FB2A 1WSUA 1F5TA 1DPRA 1BN5A 1LQ1A 3FXRA 3L09A 2CSOA 1XD7A 5JFRA 5F64A 5LHGA 3V7CA 3BP8A 1XDUA 4MNUA 1R22A 1XDSA 1KU2A 4RB0A 2L02A 1FWZA 3GFLA 4HF1A 4RB3C 4A2UA 1HXDA 3B02A 4ASNA 1W7PB 4EVIA 1USSA 2Z5UA 3F22A 2GA2A 5E1ZB 1OYWA 1KQ0A 1LJ9A 1TW2A 1J7KA 5KK1A 1R1VA 3NRVA 1YW7A 3MQ0A 4D0PA 4G6DA 5LGUA 4EMSA 4BYYA 2FNPA 2MD5A 2DLLA 5IT3A 1HKTA 3C7JA 3L7WA 3R60A 3CO6C 3V8JA 2L4MA 2HOEA 3SFZA 4YFNF 1RUOA 3MEXA 2JPBA 3F8FA 4P55A 1HW5A 2HGCA 1U5TC 3O2PE 5HS8A 3CUQB 3J80K 2VOOA 2QQAA 4Y15A 1WWXA 4AWXB 1C0WA 3E6DA 3LA3A 1YW8A 5E1WA 5F1RA 4AIJA 2O8XA 1IAWA 4H0EA 1RI7A 1KU9A 1J0RA 4BH9A 4MEYF 1PDNC 3J81K 3MWMA 5H20A 1XMAA 1SD4A 4KFCA 2MH2A 2XGXA 2NYXA 2VOPA 1G6NA 3FM3A 4NB5A 5D5UB 1K6OA 2XVCA 1J2XA 3LAPA 2F5FA 1BM9A 4HAMA 3IL2A 1RUNA 1X3UA 4ZYGA 3MZHA 4ZZLA 3D5LA 2XKOA 4EM0B 1F9NA 5CVUA 4KT5C 2VBYA 3WTVC 1MJ9A 3HIFA 1ZHFA 3WTUC 1K78B 4ZH4F 1T38A 4ENMA 2GAUA 4XLPF 1P6RA 3ZMVA 1R00A 3WE3A 4QLCU 1B1BA 3S2WA 3GX4X 3QP5A 1S7AA 1TQIA 1FSHA 5LBQA 4I02A 2GZWA 4AVPA 3DPTA 3L9FA 2HDCA 3EYIA 2V1UA 5D6FA 3W6KB 2Z9OA 1KA8A 1BI3A 4LK0F 3CJNA 5HLIA 4EQQA 4M9SA 1J5YA 2ACJA 4IPAA 1IN8A 3GF2A 3ABUA 2A5YB 2IA1A 1CF7B 1R58A 4YG2F 2FA5A 4HV6A 1FBUA 3ZQ7A 2UWMA 3FHZA 1MJAA 5LGNA 2GWRA 2QENA 3RPQA 2YR2A 3JSPA 2XASA 5DD4A 4HX8A 3H3ZA 1IN5A 1YO5C 3WTTC 5BQTA 3ISPA 3F23A 3ZMSA 3KLOA 5ILSA 3LWFA 1IXRC 1FNNA 2EFNA 3HRTA 4U7BA 2QYOA 2OZ6A 2VE9A 2EFQA 2D1VA 5BOXA 1U78A 1B6AA 3RKXA 4LMYA 1B9MA 3L00A 1Z91A 2PJPA 5DDGA 4HX4A 1FBSA 2IPQX 4FT8A 2M5WA 3E5XA 5FLXZ 2FQ3A 1IRGA 2Y0MA 4TV7A 3NEUA 4FX0A 3DPLC 2OBPA 3M8FA 4UVBA 2E7XA 3G73A 2E1CA 4P9UA 2EA4A 4KYWA 2DAOA 1PP7U 3QAHA 4BXUA 2DK8A 4UUVA 5D5WB 5BPDA 2M1BA 2D2WA 2NRAC 1B59A 2FMLA 2W57A 1G3SA 2M45A 3T5XA 1ZLJA 1MGTA 4LGWA 4CGZA 1YYVA 4MQ9F 5FD6A 2CWEA 4Q4ZF 3QPTA 1UHWA 3FF5A 4OINF 1XCBA 2QZ8A 1QO0D 3WTZA 3COAC 1KYZA 3V8KA 3KP6A 1V3FA 3IRRA 4RAZA 2F5EA 2HZTA 4LK1F 2W24A 5DCMB 1SD5A 1TQMA 1S29A 3E3VA 3JTHA 3HUGA 5E8IA 2P4WA 4JK1X 3BPVA 3TOBA 3GZ6A 3J7AO 2GXBA 5HDNA 2D45A 2ISYA 2DFIA 1HW2A 3P9KA 3GYHX 2QBYB 3GVAA 1T39A 4CXFA 4PGGA 1HQCA 1O57A 1K79A 4M71A 3REOA 3C18A 3WTXC 3WTYC 1AWCA 4XSXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSE A;  3KEO A;  2L01 A;  4U0Y A;  3ABT A;  3ECO A;  4M6Y A;  4MTD A;  1CF7 A;  2FU4 A;  1FLI A;  4YFK F;  1GHC A;  5LRR A;  1FOK A;  1KU7 A;  3CTA A;  1YW9 A;  1G3T A;  1OKR A;  1W5T A;  2HKO A;  3QP6 A;  4O6J A;  4WWC A;  4I09 A;  2DPU A;  1SD6 A;  3JSO A;  4HOB A;  3RYP A;  4EJO A;  1FZP B;  5FO5 A;  2ESN A;  2FMY A;  3ML6 A;  3EQL F;  2ZNZ A;  5ERI A;  3D0S A;  2QLZ A;  1G3W A;  2YPR A;  1TBX A;  1U5T A;  3RDI A;  4WX9 A;  3TO9 A;  3CLO A;  1ZG5 A;  3CUQ C;  3ZMT A;  2EK5 A;  1JGS A;  1V4R A;  1P4A A;  3KZZ A;  1FY7 A;  2FBI A;  2BGC A;  2O3F A;  5LHI A;  4AIK A;  2FE3 A;  3IKV A;  4XLN F;  2CQK A;  2V6C A;  2R7F A;  3PQK A;  2Y48 A;  1J59 A;  1ZRE A;  2VBW A;  1F1Z A;  3GZ5 A;  3RPU A;  2B0L A;  3SXY A;  4MEX F;  3QU6 A;  1RZ4 A;  4HZF A;  3KE2 A;  4GCV A;  4EJW A;  5CLS A;  3P9C A;  1H0M A;  1QZY A;  2VT2 A;  3E5U A;  1XGM A;  4M74 A;  5H6Q A;  2H09 A;  2BE5 F;  3K1P A;  2IT0 A;  2ZKZ A;  2NAZ A;  2L4A A;  3V4G A;  3VEP A;  5LRS A;  2C6Y A;  4LLL A;  2DO7 A;  1FC3 A;  3GEZ A;  1SMY F;  4LD5 A;  2K27 A;  1XN7 A;  3TDZ C;  1S3J A;  1YS6 A;  4YIF A;  1EH7 A;  2EV6 A;  3DF8 A;  4KNY A;  1R36 A;  4IHS A;  3F6O A;  4HF2 A;  4FHT A;  1S6L A;  3G3Z A;  1I1S A;  2HS5 A;  1Z6R A;  3BJ6 A;  2XAG A;  4ZYE A;  3KFW X;  1WRJ A;  2O61 A;  1ZAR A;  3WOD F;  3FXU A;  3B73 A;  3QPH A;  4Q48 A;  2WTE A;  1ULY A;  2EV0 A;  2F2E A;  3FMS A;  4P9F A;  4M6X A;  1STZ A;  2ZO4 A;  2UXN A;  3WGH A;  3E6B A;  4ESJ A;  2CFX A;  4EV0 A;  1XB4 A;  2OU2 A;  1J75 A;  1UST A;  2QBY A;  1H9T A;  5BPI A;  1K7A A;  1F4K A;  4IRH A;  4ETS A;  4HYE A;  2J5P A;  2EV5 A;  1MDM A;  1T98 A;  1DP7 P;  2GQQ A;  2MA3 A;  2RV8 A;  4U7D A;  3RKY A;  2KIU A;  2RN7 A;  1SAX A;  2PLY A;  1IN7 A;  4RGR A;  1I6X A;  5KVR A;  4ZYH A;  2FSW A;  2OD5 A;  3FWE A;  3F6V A;  4UV8 A;  5CYV A;  4PZJ A;  3L2C A;  5K1Y A;  2K7L A;  2STT A;  5J8C A;  4R8H A;  4HQM A;  2JTV A;  3IWF A;  1ZGA A;  5TRD A;  4S04 A;  4A5M A;  1W7P D;  3U9G A;  2HWV A;  2XIG A;  2A69 F;  5A2Q K;  4L9N A;  5D4R A;  1D5V A;  5D8L B;  2H94 A;  2VE8 A;  2VN2 A;  3BWG A;  3BY6 A;  4GYG A;  3RYR A;  2G9W A;  5HDG A;  2EA2 A;  4G8X A;  4RGU A;  3LA7 A;  5FGM A;  4CHU A;  3LQR A;  3JAM K;  3U1D A;  4S05 A;  5IT9 K;  2LF7 A;  2CGP A;  2PMH A;  5HOO A;  4IRI A;  3H92 A;  5CVV A;  1I5Z A;  2KKO A;  3DP7 A;  1LDK B;  4HLX A;  4EJV A;  4I98 B;  5DUK A;  4O3M A;  2QM3 A;  2YX7 A;  2JT1 A;  4M73 A;  3OV8 A;  5DYM A;  1BOA A;  1W4M A;  2MLK A;  2ZME A;  5JR3 A;  3MAJ A;  4HX7 A;  3KP4 A;  2DK5 A;  1HSJ A;  3Q5F A;  1WI9 A;  3ZN1 A;  5AON A;  4Z2Y A;  2H6B A;  1KU3 A;  4EGZ A;  2ZNY A;  4N9I A;  4UXN A;  4G7O F;  5JHU A;  3ELK A;  3I71 A;  1IRF A;  5HLG A;  2MC3 A;  3O3K A;  3IHU A;  1H9G A;  3C3W A;  5L3B A;  3I53 A;  4IXA A;  1YS7 A;  1MJB A;  4OIR F;  1XSV A;  2FF4 A;  1BIA A;  3JTG A;  4LG0 B;  3DEU A;  1QPM A;  3F72 A;  2P7C B;  1XCV A;  3K9T A;  3I58 A;  2HQR A;  5JI6 A;  1XMK A;  3IC7 A;  3KET A;  2G7U A;  4N0B A;  1ON1 A;  3SZP A;  2PG4 A;  1W7P A;  4ENJ A;  1QNT A;  1BI2 A;  3I4P A;  3T0Y A;  4A6D A;  2XAJ A;  1WQ2 A;  5HS7 A;  2HFH A;  5F6F A;  2XRO A;  4WF2 A;  2ZBK A;  3C1D A;  5K5R A;  5ILV A;  1YTY A;  1D8K A;  5L3F A;  3GWZ A;  4EGY A;  4BHP A;  3R6S A;  2QUF A;  5DCF A;  5E18 F;  2XAH A;  3CDH A;  1OYY A;  1XSD A;  2YX4 A;  3Q9V A;  3F8N A;  4KMF A;  2NNY A;  1XGO A;  4WXD A;  2Q8K A;  4I0B A;  4HA8 A;  4G7Z F;  1OPC A;  1RIO H;  3BDD A;  2ZFW A;  3CUQ A;  1PUE E;  4N9H A;  3I0T A;  5L3D A;  3HYI A;  5J6X A;  1T2K A;  1P92 A;  1AOY A;  3BPX A;  3T1B A;  2P8T A;  2QQB A;  3LA2 A;  1LEA A;  3VFZ A;  5LHH A;  2Z33 A;  3ULQ B;  1GVJ A;  1FPQ A;  2VBZ A;  1YQA A;  1LEB A;  2OAZ A;  2NNN A;  3AAF A;  1VTN C;  4NHJ A;  4R79 A;  1EV7 A;  1LDD A;  3FM5 A;  4ZZD A;  3CUO A;  4ESF A;  2JSC A;  3TKY A;  3R0A A;  1ZG1 A;  2IP2 A;  3PFI A;  2BEO A;  2F5D A;  2J5O A;  4L0Y B;  2O03 A;  4LLG F;  1LB2 A;  1HBX G;  1GXP A;  5CVJ A;  2DW4 A;  3HRS A;  5HDK A;  3SQN A;  4A0X A;  2XAQ A;  4BHC A;  5HVQ C;  3J80 Z;  3FMQ A;  5LEK A;  1R7J A;  4BQA A;  1K78 A;  2HQN A;  4NQW A;  2VOD A;  3TGN A;  3QRF F;  3KP7 A;  2M30 A;  1FP2 A;  1YIO A;  4KIF A;  2O6G E;  2OZU A;  4HDU A;  4ENN A;  2P6S A;  1P4X A;  1UHM A;  2JRT A;  2EJR A;  2ETH A;  1WKM A;  4KIB A;  1A04 A;  1Z7U A;  3J81 Z;  1EH8 A;  1LVA A;  3I5U A;  2HTS A;  4GXO A;  2PN6 A;  3LST A;  4RGS A;  3T8T A;  4U0W A;  2K86 A;  2XV4 S;  3K1N A;  3JAM Z;  3FMR A;  1O7F A;  5D8K B;  3DV8 A;  1QGP A;  3K1M A;  3GXO A;  2A3S A;  3E97 A;  1JHF A;  4B8X A;  5EEG A;  1HKQ A;  3TOA A;  1UB9 A;  1FP1 D;  3Q9S A;  2W25 A;  1O3T A;  3BRO A;  2EFP A;  2A68 F;  5ICE A;  5FFZ A;  3WG9 A;  1B4A A;  3M7G A;  5FFX A;  2V79 A;  3FZV A;  3KP5 A;  1R5G A;  2RVC A;  1HW1 A;  1TTY A;  1IW7 F;  3ZMU A;  4PDK A;  1TNS A;  2H6C A;  3IWZ A;  1T0F A;  5K5Q A;  2V1X A;  2IA2 A;  1OR7 A;  4U88 A;  4E70 A;  1IZ1 A;  3KLN A;  2IRF G;  4BHB A;  1FYK A;  3BOQ A;  4M72 A;  4BAY A;  4LB6 B;  3KP3 A;  3ZPL A;  5BMZ A;  2HR3 A;  1I27 A;  2Q0O A;  5L3E A;  4HQE A;  2IVM A;  3H3U A;  4GGG A;  3EDP A;  4DQ2 A;  3N4M A;  1DPU A;  4LFU A;  4A6E A;  1ZRC A;  1O3S A;  2PEX A;  3EET A;  3RIR A;  4WXH A;  2KIF A;  3ZMD A;  3I54 A;  4RB1 A;  1BJA A;  4CYD A;  3LQQ A;  2EWN A;  1BC8 C;  2HYG D;  4HF0 A;  4HV5 A;  4YII A;  3QU3 A;  5CJ9 A;  3E5Q A;  1ZGJ A;  2IA0 A;  3F8M A;  1R5H A;  2XKP A;  4KIC A;  5E1X A;  3V7R A;  3HSF A;  1JHH A;  1IXC A;  4XBF A;  4ENK A;  4OIO F;  4OMZ A;  5E20 A;  2CYY A;  4M9X A;  2P5L C;  2FXA A;  3EYY A;  4HLY A;  4EM2 A;  5K5O A;  1P4W A;  1IN4 A;  2DU9 A;  2FEZ A;  1J9I A;  1HKS A;  1ZG3 A;  4YFX F;  3M8E A;  3VOE A;  2HEO A;  5ED4 A;  3OOP A;  4A5N A;  1CGP A;  3IKT A;  1ZYR F;  2V9V A;  2KIM A;  1QZZ A;  3TO6 A;  4LJZ F;  2TDX A;  2BBY A;  1UCR A;  1L0O C;  5DCM A;  2KRF A;  2M87 A;  1FYM A;  3K2Z A;  4MHG A;  4WK8 F;  2EFO A;  5L3C A;  3NQO A;  3P7N A;  3M9A A;  5DV5 A;  3GFI A;  3N97 A;  2FBK A;  3TDU C;  4KIG A;  5TJJ A;  5BS6 A;  2AXL A;  2XAF A;  2RDP A;  3GLX A;  1TW3 A;  1FT9 A;  5FLX K;  1BBY A;  1NHA A;  1KQ9 A;  3KEQ A;  4UVA A;  2FRH A;  1JE8 A;  4O5V A;  3F3X A;  2WWY A;  4L18 B;  3ECH A;  4CO8 A;  4ON0 A;  3K0L A;  1T6S A;  1XSX A;  4L9T A;  1FBQ A;  4R1H A;  1L3L A;  3RI4 A;  2P7V B;  2A6E F;  2XUB A;  5D5X B;  1ZRD A;  3IRQ A;  5CVI A;  3VB2 A;  5CVR A;  3R61 A;  1Z05 A;  2DT5 A;  2QWW A;  3WGI A;  1FYL A;  4RGX A;  1D8J A;  1RNL A;  1Z1D A;  1I1G A;  1W5S A;  3V8L A;  4EM1 A;  2E7W A;  1TNT A;  1MD0 A;  4MQV A;  4L5I A;  3I59 B;  4G6Q A;  2WV0 A;  1FX7 A;  2OQR A;  5E17 F;  2EB7 A;  4LB5 A;  2KJB A;  5LLQ A;  4OIP F;  4Y17 A;  5D5V B;  2X4H A;  4ESB A;  2IJL A;  3JW4 A;  1YG2 A;  4QWQ A;  3HSR A;  3HHG A;  4JQF A;  4L5J A;  3RKW A;  5D4S A;  4AD9 A;  4KDP A;  3GW2 A;  3GFJ A;  4M9Z A;  4P96 A;  2CG4 A;  4BNC A;  3ROU A;  1O7L A;  2P5K A;  1Z6T A;  2STW A;  4HBL A;  3MZY A;  3WU0 A;  4KA4 A;  4OIQ F;  2NS0 A;  2JPC A;  3DXJ F;  1S7O A;  2ZCW A;  3K69 A;  3P9I A;  4KN7 X;  1BIB A;  3WE2 A;  4XRF A;  3CO7 C;  3F8C A;  2VT3 A;  2FBH A;  3LFK A;  5L3G A;  2DQL A;  4I7H A;  2MH9 A;  1O3R A;  1REP C;  4OMY A;  2AS5 F;  3ZP5 A;  4I2O A;  1U8R A;  3HTS B;  3E6M A;  3O6B B;  4UVC A;  3DFG A;  3DQV C;  4XSZ F;  2A07 F;  3KZY A;  3WTW C;  2K4J A;  5ICC A;  5ICG A;  3HHH A;  3HTU A;  3SHF A;  4KUM A;  3EUH A;  3RJP A;  1SFX A;  2R7D A;  3MFK A;  1S8N A;  2GA1 A;  1P2F A;  2H27 A;  2LF8 A;  3ERE D;  4P5O A;  5ILU A;  4IF4 A;  2VON A;  3E6C C;  1ZH5 A;  4MGR A;  2DBB A;  2P5V A;  2L3D A;  1OYI A;  4JBA A;  3QOP A;  1G4D A;  2LNB A;  2QVO A;  5H6R A;  4IVN A;  3SZT A;  1FSE A;  1HST A;  1IN6 A;  1LNW A;  4PCQ A;  4RS8 A;  1Y0U A;  2CW0 F;  1U5T B;  4GYI A;  2DPD A;  1ZN2 A;  4HW0 A;  3T8R A;  3F21 A;  3ZMZ A;  1U3E M;  1B9N A;  2K02 A;  3MCZ A;  4CIC A;  4K2E A;  1SFU A;  1E2X A;  4L9V A;  2VC1 A;  4UV9 A;  2V1D A;  2RQP A;  2RKH A;  3I59 A;  2Q2E A;  3PQJ A;  2YU3 A;  4IJA A;  3ZN0 A;  3FX3 A;  2IW5 A;  1G3Y A;  4I01 A;  3W6J B;  3WTS C;  5JVT A;  4F7Z A;  3BJA A;  2JZY A;  2Z3Y A;  4KMU X;  4WCG A;  2DTR A;  4DNC A;  2RNJ A;  1ONV A;  1Q1H A;  3R0J A;  2M8E A;  3VOD A;  2A6H F;  1QBJ A;  3FXQ A;  1KYW A;  5J8F A;  5AIP A;  1SMT A;  2ESH A;  2WC2 A;  2P6T A;  1ODD A;  2D1H A;  1SD7 A;  4FX4 A;  2EFW A;  2LKP A;  5AIQ A;  3HRM A;  3KP2 A;  1TQP A;  3R4K A;  2E1N A;  3GFM A;  1KGS A;  4OOI A;  2COM A;  2XRN A;  2XHK A;  1R23 A;  4MTE A;  1U2W A;  2VXZ A;  5A2Q Z;  1U6G A;  2KJC A;  4G7H F;  3TQN A;  3TO7 A;  4PGH A;  2DI3 A;  1EH6 A;  2UXX A;  1YFH A;  1ZLK A;  4LG0 A;  1OMI A;  2G7H A;  2W84 A;  4B09 A;  2ISZ A;  2L54 A;  4WXC A;  5IT9 Z;  4I0A A;  4RAY A;  4UHT A;  1KQ8 A;  1LDJ A;  4GO1 A;  2HKX A;  4KN4 X;  2X0L A;  5E8G A;  1BI1 A;  5EEH A;  1DDN A;  2FNA A;  2RGV A;  1DUX C;  5DEQ A;  4Q5S F;  1MDM B;  3GO5 A;  5LEJ A;  1TLH B;  4L0Z B;  4IHT A;  1SFE A;  2QQ9 A;  1XGN A;  5DUI A;  3WGG A;  1BC7 C;  5HS9 A;  1XGS A;  2VBX A;  4UNO A;  1R1U A;  4EJT A;  2MBF A;  2BYV E;  4Q47 A;  4A12 A;  5HLH A;  2K4B A;  4A0Y A;  1IF1 A;  4ZYD A;  2ZXJ A;  2DQR A;  4OU0 A;  2GIV A;  2RC4 A;  5DD8 A;  3HRU A;  1O3Q A;  2Z99 A;  4IRG A;  3RTR A;  1QQI A;  1Z9C A;  4U0V A;  2PMU A;  2R3S A;  1D3Y A;  1ZRF A;  1GXQ A;  1ON2 A;  4RB2 C;  3DKW A;  3F8B A;  3WU1 B;  1ZAO A;  1IXS B;  3U2R A;  3HOT A;  2PBI A;  2VC0 A;  3BJO A;  4AIH A;  4HDV A;  1IUY A;  3M1E A;  5ICF A;  1YLF A;  2ZJ2 A;  3BZ6 A;  3V7S A;  2BV6 A;  4CZZ A;  2HTJ A;  1MKM A;  1E17 A;  2LDU A;  5FD5 A;  2Y75 A;  2FOK A;  4L9J A;  2PFB A;  2UZK A;  4G94 A;  2PI0 A;  1BI0 A;  3HOS A;  1JXS A;  3KCC A;  4EJU A;  5LGT A;  2A61 A;  2YSR A;  4A0Z A;  2ADU A;  2ELH A;  2O0Y A;  2HYF A;  3GUD A;  2OQG A;  1UFM A;  5D6E A;  3LAJ A;  2ZME B;  2F5C A;  2MLG A;  4CDG A;  6PAX A;  4G9Y A;  1PP8 F;  2W85 A;  1R1T A;  2CO5 A;  2PQ8 A;  4LLN A;  2OA4 A;  1MZB A;  3I64 A;  4Y13 A;  2LSO A;  2GXG A;  5FB2 A;  1WSU A;  1F5T A;  1DPR A;  1BN5 A;  1LQ1 A;  3FXR A;  3L09 A;  2CSO A;  1XD7 A;  5JFR A;  5F64 A;  5LHG A;  3V7C A;  3BP8 A;  1XDU A;  4MNU A;  1R22 A;  1XDS A;  1KU2 A;  4RB0 A;  2L02 A;  1FWZ A;  3GFL A;  4HF1 A;  4RB3 C;  4A2U A;  1HXD A;  3B02 A;  4ASN A;  1W7P B;  4EVI A;  1USS A;  2Z5U A;  3F22 A;  2GA2 A;  5E1Z B;  1OYW A;  1KQ0 A;  1LJ9 A;  1TW2 A;  1J7K A;  5KK1 A;  1R1V A;  3NRV A;  1YW7 A;  3MQ0 A;  4D0P A;  4G6D A;  5LGU A;  4EMS A;  4BYY A;  2FNP A;  2MD5 A;  2DLL A;  5IT3 A;  1HKT A;  3C7J A;  3L7W A;  3R60 A;  3CO6 C;  3V8J A;  2L4M A;  2HOE A;  3SFZ A;  4YFN F;  1RUO A;  3MEX A;  2JPB A;  3F8F A;  4P55 A;  1HW5 A;  2HGC A;  1U5T C;  3O2P E;  5HS8 A;  3CUQ B;  3J80 K;  2VOO A;  2QQA A;  4Y15 A;  1WWX A;  4AWX B;  1C0W A;  3E6D A;  3LA3 A;  1YW8 A;  5E1W A;  5F1R A;  4AIJ A;  2O8X A;  1IAW A;  4H0E A;  1RI7 A;  1KU9 A;  1J0R A;  4BH9 A;  4MEY F;  1PDN C;  3J81 K;  3MWM A;  5H20 A;  1XMA A;  1SD4 A;  4KFC A;  2MH2 A;  2XGX A;  2NYX A;  2VOP A;  1G6N A;  3FM3 A;  4NB5 A;  5D5U B;  1K6O A;  2XVC A;  1J2X A;  3LAP A;  2F5F A;  1BM9 A;  4HAM A;  3IL2 A;  1RUN A;  1X3U A;  4ZYG A;  3MZH A;  4ZZL A;  3D5L A;  2XKO A;  4EM0 B;  1F9N A;  5CVU A;  4KT5 C;  2VBY A;  3WTV C;  1MJ9 A;  3HIF A;  1ZHF A;  3WTU C;  1K78 B;  4ZH4 F;  1T38 A;  4ENM A;  2GAU A;  4XLP F;  1P6R A;  3ZMV A;  1R00 A;  3WE3 A;  4QLC U;  1B1B A;  3S2W A;  3GX4 X;  3QP5 A;  1S7A A;  1TQI A;  1FSH A;  5LBQ A;  4I02 A;  2GZW A;  4AVP A;  3DPT A;  3L9F A;  2HDC A;  3EYI A;  2V1U A;  5D6F A;  3W6K B;  2Z9O A;  1KA8 A;  1BI3 A;  4LK0 F;  3CJN A;  5HLI A;  4EQQ A;  4M9S A;  1J5Y A;  2ACJ A;  4IPA A;  1IN8 A;  3GF2 A;  3ABU A;  2A5Y B;  2IA1 A;  1CF7 B;  1R58 A;  4YG2 F;  2FA5 A;  4HV6 A;  1FBU A;  3ZQ7 A;  2UWM A;  3FHZ A;  1MJA A;  5LGN A;  2GWR A;  2QEN A;  3RPQ A;  2YR2 A;  3JSP A;  2XAS A;  5DD4 A;  4HX8 A;  3H3Z A;  1IN5 A;  1YO5 C;  3WTT C;  5BQT A;  3ISP A;  3F23 A;  3ZMS A;  3KLO A;  5ILS A;  3LWF A;  1IXR C;  1FNN A;  2EFN A;  3HRT A;  4U7B A;  2QYO A;  2OZ6 A;  2VE9 A;  2EFQ A;  2D1V A;  5BOX A;  1U78 A;  1B6A A;  3RKX A;  4LMY A;  1B9M A;  3L00 A;  1Z91 A;  2PJP A;  5DDG A;  4HX4 A;  1FBS A;  2IPQ X;  4FT8 A;  2M5W A;  3E5X A;  5FLX Z;  2FQ3 A;  1IRG A;  2Y0M A;  4TV7 A;  3NEU A;  4FX0 A;  3DPL C;  2OBP A;  3M8F A;  4UVB A;  2E7X A;  3G73 A;  2E1C A;  4P9U A;  2EA4 A;  4KYW A;  2DAO A;  1PP7 U;  3QAH A;  4BXU A;  2DK8 A;  4UUV A;  5D5W B;  5BPD A;  2M1B A;  2D2W A;  2NRA C;  1B59 A;  2FML A;  2W57 A;  1G3S A;  2M45 A;  3T5X A;  1ZLJ A;  1MGT A;  4LGW A;  4CGZ A;  1YYV A;  4MQ9 F;  5FD6 A;  2CWE A;  4Q4Z F;  3QPT A;  1UHW A;  3FF5 A;  4OIN F;  1XCB A;  2QZ8 A;  1QO0 D;  3WTZ A;  3COA C;  1KYZ A;  3V8K A;  3KP6 A;  1V3F A;  3IRR A;  4RAZ A;  2F5E A;  2HZT A;  4LK1 F;  2W24 A;  5DCM B;  1SD5 A;  1TQM A;  1S29 A;  3E3V A;  3JTH A;  3HUG A;  5E8I A;  2P4W A;  4JK1 X;  3BPV A;  3TOB A;  3GZ6 A;  3J7A O;  2GXB A;  5HDN A;  2D45 A;  2ISY A;  2DFI A;  1HW2 A;  3P9K A;  3GYH X;  2QBY B;  3GVA A;  1T39 A;  4CXF A;  4PGG A;  1HQC A;  1O57 A;  1K79 A;  4M71 A;  3REO A;  3C18 A;  3WTX C;  3WTY C;  1AWC A;  4XSX F; 
#chains in the Genus database with same CATH topology
 3HSE A;  4BJ6 C;  4DGW B;  3KEO A;  2L01 A;  4U0Y A;  3ABT A;  3ECO A;  4M6Y A;  4CYC B;  4MTD A;  4PFO A;  4JYK A;  4A3J J;  1CF7 A;  1U0J A;  2R7Q A;  2FU4 A;  3CP2 A;  3ZQI A;  1MSE C;  1FLI A;  4YFK F;  1GHC A;  2XDV A;  3W2A A;  5LRR A;  1FOK A;  1OJL A;  2O7O A;  1KU7 A;  4ZYA A;  3CTA A;  1YW9 A;  3PM1 A;  1G3T A;  5HNF A;  1OKR A;  3TP3 A;  1Y0N A;  1MMN A;  1W5T A;  2HKO A;  3QP6 A;  5GTH C;  4O6J A;  1QHH D;  3BG9 A;  1UG0 A;  4WWC A;  3DBR B;  4E7L A;  4I09 A;  3OYM A;  2R7S A;  3QYE A;  2DPU A;  5C4J J;  3PO3 J;  2R7V A;  1SD6 A;  3ONQ A;  5IP6 A;  3JSO A;  4HOB A;  5CKT A;  4IEJ A;  3RYP A;  3IP4 B;  4M3B A;  5FO5 A;  4EJO A;  1FZP B;  2GXA A;  2MGQ A;  2Y9Y A;  2ESN A;  2FMY A;  3ML6 A;  3OS2 A;  3EQL F;  2ZNZ A;  4DBQ A;  5ERI A;  3D0S A;  5J1Y A;  2QLZ A;  1G3W A;  2IXS A;  1JUS A;  1V5F A;  3H9J A;  2YPR A;  1TBX A;  1U5T A;  3A03 A;  3OYC A;  3L2R A;  4FTH A;  2E1M C;  2L7Z A;  3RDI A;  4WX9 A;  3TO9 A;  3P5J A;  2E36 A;  3CJR B;  3A01 A;  3BT9 A;  2DFH A;  2WY8 Q;  3CLO A;  3CUQ C;  3FKI J;  3ZMT A;  2XC7 A;  1ZG5 A;  2EK5 A;  2VQH A;  3LSJ A;  1JGS A;  4BEH B;  1V4R A;  3SDB A;  1P4A A;  3KZZ A;  1FY7 A;  4HPQ A;  2FBI A;  2HNH A;  2BGC A;  2O3F A;  5LHI A;  4AIK A;  2MFZ A;  2FE3 A;  3UR3 C;  3IKV A;  2FJ1 A;  2KZV A;  4XLN F;  4XR6 A;  2CQK A;  2OCE A;  2V6C A;  2R7F A;  1YOV B;  3CES A;  3PQK A;  2Y48 A;  2XSD C;  3DKY A;  1J59 A;  1ZRE A;  4BE1 A;  2VBW A;  2JA5 J;  3TL4 X;  1F1Z A;  1I3A A;  3GZ5 A;  1B72 A;  3RPU A;  2B0L A;  3SXY A;  4MEX F;  4CCL A;  3QU6 A;  3I4M J;  4FCY A;  1N75 A;  1HF0 A;  1RZ4 A;  1RES A;  4HZF A;  3KE2 A;  3H36 A;  4GCV A;  2Y0S A;  2YU9 J;  5GPA A;  4B48 A;  1S72 I;  1FOW A;  3BTL A;  4BKX A;  4IX7 A;  3U1K A;  2GOM A;  4EJW A;  5CLS A;  3P9C A;  1H0M A;  1OCC H;  1QZY A;  2VT2 A;  3BC8 A;  3E5U A;  2V9K A;  3CCR I;  3SYT A;  1XGM A;  4M74 A;  2HYJ A;  5H6Q A;  4A3F J;  3PIP F;  2H09 A;  2BE5 F;  3K1P A;  2IT0 A;  2LP0 A;  2ZKZ A;  2NAZ A;  2L4A A;  3V4G A;  4HEA 2;  3VEP A;  5LRS A;  1R71 A;  2C6Y A;  1V54 H;  4LLL A;  2DO7 A;  1SVM A;  3SEZ A;  1FC3 A;  4KIS A;  3GEZ A;  2A05 A;  1SMY F;  2X85 A;  4LD5 A;  3LSH A;  4A3C J;  1BL0 A;  3M3Y J;  4E7K A;  2K27 A;  2KLO A;  1XN7 A;  3HM5 A;  2MSY A;  2LH9 A;  3HDD A;  2WV1 A;  2CUZ A;  3TDZ C;  4XLF A;  3BR1 A;  1APL C;  1S3J A;  3TBI A;  1YS6 A;  2F4O B;  4MFE A;  4YIF A;  2HOS A;  1EH7 A;  2DTZ A;  2EV6 A;  2X1D A;  3A0H C;  3DF8 A;  1ZR4 A;  4CCO A;  1LKX A;  4KNY A;  1R36 A;  1WCM J;  3NWS A;  4IHS A;  3F6O A;  5FKO A;  4QPQ A;  4HF2 A;  4FHT A;  1D5Y A;  1JI8 A;  1S6L A;  3G3Z A;  1I1S A;  2HS5 A;  1Z6R A;  3BJ6 A;  2XAG A;  4ZYE A;  3KFW X;  3G1O A;  1WRJ A;  5K7Z A;  2O61 A;  1ZAR A;  3WOD F;  3FBN B;  3FXU A;  3B73 A;  3TMO A;  3QPH A;  3VSK A;  1IV8 A;  4Q48 A;  2WTE A;  1ULY A;  3HEF A;  2BY0 A;  2EV0 A;  4IHY A;  2F2E A;  3FMS A;  4JP0 A;  4P9F A;  4M6X A;  1YJN I;  1STZ A;  1X2N A;  2ZO4 A;  2UUZ A;  2UXN A;  3WGH A;  3E6B A;  4ESJ A;  2CFX A;  4EV0 A;  3GTQ J;  3OYG A;  3BQY A;  1XB4 A;  2L9S A;  4Y3O A;  1XX5 A;  3HL2 A;  2OU2 A;  1J75 A;  1UST A;  2QBY A;  3HOW J;  5IPA A;  1H9T A;  4X6A J;  3CCS I;  5BPI A;  1K7A A;  1SAN A;  1F4K A;  2R92 J;  2Y0S N;  4IRH A;  4P1W A;  1VQ4 I;  4ETS A;  4HYE A;  4KT6 A;  3ABM H;  2J5P A;  2EV5 A;  1OIS A;  1MDM A;  5GTI C;  4NDL A;  1ETY A;  3TP0 A;  1T98 A;  3MVP A;  1PUF B;  1DP7 P;  2LY2 A;  2XAU A;  3H3V K;  2CQ7 A;  2GQQ A;  1TWH J;  2MA3 A;  1W36 D;  3A2K A;  2LLK A;  3L2W A;  2RV8 A;  2KFD A;  4U7D A;  5H2F C;  3RKY A;  3PJR A;  3GTG J;  2KIU A;  3Q0W A;  2F5V A;  2RN7 A;  4BY1 J;  2ME6 A;  3UKG A;  3D5R C;  2OTL I;  1SAX A;  2PLY A;  1IN7 A;  2JK3 A;  3PSI A;  4RGR A;  1TC3 C;  2DA2 A;  3CMA I;  3G1M A;  1I6X A;  1IDY A;  5KVR A;  1MBG A;  3ZGK A;  4ZYH A;  2L7F P;  4XKC A;  2FSW A;  2OD5 A;  2W4S A;  2QCO A;  3FWE A;  3BR3 A;  3F6V A;  4UV8 A;  1R5I D;  5C4X J;  5CYV A;  4BDZ A;  4PZJ A;  3L2C A;  5K1Y A;  1U9O A;  2K7L A;  3GTL J;  2STT A;  1ZKG A;  1MBF A;  5J8C A;  1JTX A;  4R8H A;  4HQM A;  2JTV A;  3IWF A;  1MBE A;  1ZGA A;  3FXJ A;  5TRD A;  4S04 A;  4LOC A;  2DA7 A;  4A5M A;  1W7P D;  1BR2 A;  3U9G A;  2HWV A;  4BDY A;  2XIG A;  1ZK8 A;  3CZ6 A;  4RBO A;  2A69 F;  4BGD A;  2Q2E B;  5A2Q K;  1YHQ I;  4L9N A;  5K7H A;  5D4R A;  2EIJ H;  1D5V A;  5D8L B;  1Y39 A;  4D1Q A;  4XIC A;  2LC2 A;  3FK7 A;  3ZQH A;  2H94 A;  2VE8 A;  1OCT C;  2VN2 A;  3BWG A;  3BY6 A;  2VUM J;  4GYG A;  4ABZ A;  2LY1 A;  3RYR A;  2M9H A;  4ZJZ A;  2FQ4 A;  2G9W A;  5HDG A;  2EA2 A;  1X1A A;  4G8X A;  3LA7 A;  4RGU A;  5FGM A;  4XRS G;  4C2M J;  4DZP A;  5B5E C;  2HVR A;  2EZL A;  3LQR A;  3JAM K;  2M0C A;  3U1D A;  4DIQ A;  1IUF A;  4S05 A;  4RA2 A;  2LF7 A;  5IT9 K;  4XK4 A;  2CGP A;  2PMH A;  5HOO A;  4IRI A;  3H92 A;  2LBF A;  1T95 A;  3H1C A;  5CVV A;  1I5Z A;  2YS9 A;  2KKO A;  4F93 B;  3S3O A;  3DP7 A;  3OR2 C;  5DM6 F;  1LDK B;  3U21 A;  2X1C A;  3K70 D;  4HLX A;  4EJV A;  4I98 B;  2CUJ A;  5DUK A;  1ZGW A;  4O3M A;  2ZXH A;  2QM3 A;  2YX7 A;  2JT1 A;  4M73 A;  3X2Q H;  3OV8 A;  5DYM A;  2V7F A;  1BOA A;  2Y69 H;  1W4M A;  2MLK A;  2ZME A;  5JR3 A;  3MAJ A;  3AL0 C;  2XPW A;  4HX7 A;  3JRG A;  2VQC A;  1ENH A;  2DK5 A;  3KP4 A;  1NK3 P;  1HSJ A;  3Q5F A;  4BE2 A;  1P7J A;  1WI9 A;  3ZN1 A;  5AON A;  4Z2Y A;  2H6B A;  1KU3 A;  2ZSH B;  3FXK A;  4EGZ A;  1NH3 A;  2ZNY A;  4N9I A;  1LUJ B;  1DGR M;  4UXN A;  3E7L A;  2IS6 A;  1IG7 A;  4PJN A;  2IGM A;  2CV1 A;  4G7O F;  2DN0 A;  1WHU A;  2R7R A;  3CCE I;  4UB6 C;  2CW8 A;  2AO9 A;  3S8P A;  2QSG X;  4FE7 A;  5JHU A;  3ELK A;  3I71 A;  1IRF A;  5HLG A;  4PFP A;  2MC3 A;  3O3K A;  1X1D A;  4AU7 A;  3IHU A;  1WJD A;  1H9G A;  4LIV A;  3C3W A;  5L3B A;  1HA8 A;  3I53 A;  2F4I A;  4PSX A;  4IXA A;  1YS7 A;  1MJB A;  4XRS A;  4OIR F;  1IRZ A;  2K3P A;  1XSV A;  2FF4 A;  1BIA A;  3JTG A;  4LG0 B;  2DA5 A;  3DEU A;  2E71 A;  4QTR A;  1QPM A;  1R49 A;  3F72 A;  3IV5 A;  2P7C B;  3ZQL A;  1IC8 A;  1XCV A;  1HDD C;  3K9T A;  3I58 A;  2HQR A;  1NG6 A;  2H8R A;  5JI6 A;  4BAC A;  3DTI A;  1XMK A;  3IC7 A;  3KET A;  2G7U A;  1OLT A;  1T33 A;  4N0B A;  2JMW A;  5CPR B;  1ON1 A;  3SZP A;  2PG4 A;  1MH4 A;  1W7P A;  4ENJ A;  1QNT A;  4C3I J;  1BI2 A;  2D5V A;  3I4P A;  4II2 A;  1TZL A;  3T0Y A;  4A6D A;  3HOU J;  3W3C A;  5EJC A;  2XAJ A;  1WQ2 A;  3TED A;  5HS7 A;  2HFH A;  2O8K A;  4ZTJ A;  4XMY A;  5F6F A;  1ORK A;  1TWA J;  2XRO A;  3QPS A;  4WF2 A;  1D0Y A;  3SEQ A;  2LR8 A;  3S2D J;  1LE8 A;  3RSN A;  4XN3 A;  2ZBK A;  3C1D A;  4CCK A;  1TT0 A;  5K5R A;  5ILV A;  1YTY A;  2IGO A;  2JSP A;  3K6G A;  1D8K A;  2IAI A;  5EG0 B;  5L3F A;  2LRE A;  2ZJQ F;  4CCM A;  5JVG F;  3GWZ A;  1PUF A;  4EGY A;  4BHP A;  2G0E A;  3R6S A;  2QUF A;  2E2I J;  3CLQ A;  3HBL A;  5DS9 A;  5DCF A;  1UZC A;  5E18 F;  5B3S H;  2XAH A;  3CDH A;  2NXN B;  1OYY A;  1X4O A;  1XSD A;  1MMS A;  3JRF A;  3D1N I;  2QSF X;  4YEJ A;  3RKQ A;  2YX4 A;  3Q9V A;  4BY7 J;  3F8N A;  4KMF A;  2NNY A;  1XGO A;  3GCM A;  1A6I A;  4WXD A;  2Q8K A;  4ZC3 A;  4I0B A;  4HA8 A;  2ZC2 A;  2BW3 A;  1E0E A;  4G7Z F;  1FTZ A;  2XGC A;  1OPC A;  1RIO H;  1QU3 A;  3TW7 A;  3BDD A;  3ZQC A;  2ZFW A;  3CUQ A;  1PUE E;  1VND A;  2JRM A;  3OYF A;  3OYK A;  3OR1 C;  2KRH A;  4N9H A;  3I0T A;  5L3D A;  3HYI A;  5J6X A;  2M4K A;  3DU6 A;  1T2K A;  1P92 A;  4I99 C;  1AOY A;  2CU7 A;  2Y31 A;  3BPX A;  3T1B A;  2P8T A;  2QQB A;  2VB6 A;  2K3F A;  3K4L A;  3K4N A;  3CME I;  3LA2 A;  1LEA A;  3DBL B;  3VFZ A;  5J4V A;  1QZE A;  5LHH A;  2Z33 A;  2B9S A;  3ULQ B;  3LFU A;  2AHQ A;  2HZD A;  1TWF J;  1GVJ A;  1FPQ A;  1WH5 A;  4F91 B;  2EBI A;  3PNY A;  2PJR A;  1VQ5 I;  1MW7 A;  2VBZ A;  4GRI A;  4F3Q A;  5DM7 F;  1YQA A;  5HOD A;  2R7U A;  5KHD A;  1LEB A;  4E7Z A;  2OAZ A;  2NNN A;  3AAF A;  1VTN C;  2JWT A;  2Y2Z A;  4NHJ A;  4R79 A;  2KP6 A;  4AVZ A;  2WB1 A;  1EV7 A;  4MFD A;  1LDD A;  3FM5 A;  5E3L A;  4ZZD A;  3CUO A;  4DBR A;  1E3H A;  4BU2 A;  2JSC A;  4ESF A;  3TKY A;  5C44 J;  3R0A A;  1IRX A;  1ZG1 A;  2IP2 A;  2DDB A;  2NS8 A;  3PFI A;  1VQL I;  4GFB A;  1HLV A;  5M5W J;  2BEO A;  4DW6 A;  2F5D A;  2J5O A;  1X1P A;  1SFO J;  4L0Y B;  2XPV A;  2L7M P;  2O03 A;  4LLG F;  3L1P A;  1LB2 A;  1HBX G;  4OWR B;  3DLL F;  1GXP A;  5CVJ A;  2DW4 A;  4B47 A;  4XLE A;  3HRS A;  3BTC A;  2L9N A;  2H1L A;  5HDK A;  3SQN A;  3BTJ A;  4A0X A;  1QVT A;  2XAQ A;  4BHC A;  5HVQ C;  1W36 C;  3J80 Z;  3DEE A;  3FMQ A;  5LEK A;  2K85 A;  1N77 A;  1R7J A;  4BQA A;  1I3Q J;  2HQN A;  1K78 A;  4NQW A;  2VOD A;  1GUU A;  3BR5 A;  3TGN A;  4ZDP A;  3QRF F;  1WJF A;  1XC5 A;  3KP7 A;  2M30 A;  1FP2 A;  1YIO A;  4KIF A;  2O6G E;  3KYL A;  2OZU A;  1SFK A;  4HDU A;  4ENN A;  5F1J A;  2P6S A;  1P4X A;  2HQ5 A;  1UHM A;  2I5U A;  2JRT A;  2EJR A;  2ETH A;  1B8I B;  3GLL A;  2RNG A;  1WKM A;  1T8I A;  2V9P A;  3CCV I;  3JCU C;  1A04 A;  4KIB A;  4JOM A;  4S0H B;  1Z7U A;  3J81 Z;  2Q1Z B;  1EH8 A;  1MMG A;  2JVG A;  4DYR A;  5J1R A;  1LVA A;  3I5U A;  4RM2 A;  2HTS A;  3N05 A;  4GXO A;  2PN6 A;  2TCT A;  4HSR A;  5FRM A;  3LST A;  4RGS A;  4XM3 A;  2BOL A;  1FOY A;  1WJC A;  2BXY A;  3EUH C;  3T8T A;  4U0W A;  2N8G A;  1NK2 P;  2K86 A;  2XV4 S;  3K1N A;  1OCP A;  3JAM Z;  3FMR A;  1O7F A;  5D8K B;  2BXZ A;  3DV8 A;  1QGP A;  2JVH A;  3OS1 A;  2LKS A;  3FIS A;  1N25 A;  3GXO A;  3K1M A;  2A3S A;  2K40 A;  1W1W E;  3E97 A;  1YRN B;  2L2O A;  1JHF A;  4B8X A;  2ZXI A;  5EEG A;  1HKQ A;  2WB1 N;  1VQ6 I;  3TOA A;  1UB9 A;  1FP1 D;  5FLM J;  1MMD A;  3Q9S A;  5F04 A;  2W25 A;  3S1Q J;  5KNL A;  4A3L J;  2OCC H;  3BRO A;  2EFP A;  2A68 F;  5ICE A;  5FFZ A;  3WG9 A;  1O3T A;  2HDD A;  2DMP A;  1LFU P;  3C2H A;  4OAY A;  3S16 J;  5KAI C;  1B4A A;  2B7E A;  2P81 A;  5GAG J;  2DFF A;  5B1B H;  3HGG A;  1EKE A;  4XLA A;  2R5Z B;  3M7G A;  2XB5 A;  5FFX A;  3GME A;  3NAR A;  2XGE A;  3DCF A;  3EPZ A;  2V79 A;  3FZV A;  3FDY A;  3KP5 A;  3LOC A;  3JRC A;  1R5G A;  2RVC A;  2NVX J;  1HW1 A;  2BVL A;  1TTY A;  1IW7 F;  3GTK J;  1W5C C;  1VQ9 I;  3ZMU A;  4A69 C;  2EIN H;  4UY8 I;  4PDK A;  3K70 C;  1TNS A;  2H6C A;  3IWZ A;  1T0F A;  5K5Q A;  2V1X A;  4M6V A;  2IA2 A;  4UUS B;  4LIU A;  1OR7 A;  2LTP A;  4U88 A;  4E7I A;  4E70 A;  1IZ1 A;  2Y30 A;  3KLN A;  2IRF G;  1Y1W J;  4BHB A;  1FYK A;  3BOQ A;  4M72 A;  4BAY A;  3MKY B;  4LB6 B;  3KP3 A;  2LFB A;  3ZPL A;  2ZSI B;  1WJA A;  2WAF A;  3S17 J;  2MW8 A;  5BMZ A;  5FKM A;  5BNG A;  1VF9 A;  1K4S A;  3GZN B;  3PL8 A;  2HR3 A;  2DJI A;  1I27 A;  2Q0O A;  5L3E A;  4HQE A;  3GTO J;  2IVM A;  3H3U A;  4GGG A;  3EDP A;  4DQ2 A;  3CD6 I;  4DYQ A;  3N4M A;  5M5X J;  1DPU A;  4LFU A;  4A6E A;  4F55 A;  1ZRC A;  2JA7 J;  2E1O A;  1O3S A;  4IHX A;  2CMP A;  2EIL H;  2PEX A;  2NVU B;  2DA4 A;  3EET A;  2R7W A;  4Y52 J;  3RIR A;  3K4J A;  1YE9 A;  4WXH A;  2KIF A;  3ZMD A;  5FKN A;  3I54 A;  4RB1 A;  1BJA A;  2VPR A;  3FXO A;  3M07 A;  4RAG A;  3S14 J;  2K9N A;  4CYD A;  3LQQ A;  1WJE A;  2CQX A;  3IH4 A;  2EWN A;  3BQZ A;  3S93 A;  2VI6 A;  1BC8 C;  1SAU A;  1Z7L A;  1TP4 A;  5HNH A;  2HYG D;  4HF0 A;  4HV5 A;  4YII A;  3QU3 A;  5CJ9 A;  5TIS C;  3E5Q A;  1ZGJ A;  4XOR A;  2IA0 A;  3F8M A;  2F48 A;  4JX5 A;  4BQN A;  1R5H A;  2XKP A;  4KIC A;  5E1X A;  3OYH A;  1SVO A;  3HB9 A;  3HZJ A;  2DA6 A;  3V7R A;  3HSF A;  1JHH A;  1IXC A;  2K9S A;  4RMN A;  4XBF A;  4ENK A;  4OIO F;  4OMZ A;  5E20 A;  2F4M B;  2CYY A;  5IP7 J;  4M9X A;  2P5L C;  2FXA A;  5C3E J;  3EYY A;  2VKV A;  4HLY A;  3ESW B;  2DMQ A;  1MMA A;  2WY7 Q;  4EM2 A;  3LSR A;  5K5O A;  5EF6 A;  1P4W A;  4XON A;  1IN4 A;  2DU9 A;  2FEZ A;  1J9I A;  1HKS A;  1MBH A;  1ZG3 A;  2DA1 A;  4YFX F;  2M3A A;  3M8E A;  3BG5 A;  1FOX A;  3HJE A;  4Y7N J;  4FET A;  4C30 A;  3VOE A;  2HEO A;  5ED4 A;  3OMY A;  3OOP A;  4A5N A;  1CGP A;  3IKT A;  4GDF A;  1F36 A;  1ZYR F;  2V9V A;  2KIM A;  3VYU B;  1QZZ A;  2XRL A;  3TO6 A;  4LJZ F;  1WGX A;  2ZB9 A;  2I10 A;  2IGK A;  2XB0 X;  1GT0 C;  2L9R A;  3H5N A;  2TDX A;  4B3A A;  2BBY A;  2EQR A;  3H0G J;  5GAD J;  1AKH A;  3L2U A;  3VWB A;  1UCR A;  1L0O C;  3CC2 I;  5DCM A;  2KRF A;  4HST A;  1I6H J;  2M87 A;  1FYM A;  1PJR A;  4BJ5 C;  1ETV A;  1K4T A;  3K2Z A;  5DTD A;  4MHG A;  3MD2 A;  3M1C A;  1SC7 A;  4WK8 F;  1X19 A;  4CCJ A;  2K9Q A;  2BHZ A;  2EFO A;  3F0C A;  3HXL A;  5L3C A;  1RC9 A;  3NQO A;  1ETX A;  2R5Y A;  3P7N A;  3H0D A;  1OQY A;  2OPT A;  3M9A A;  4LG3 A;  5DV5 A;  2IGN A;  3GFI A;  3N97 A;  2FBK A;  2XF5 A;  3TDU C;  4KIG A;  1WZ2 A;  5TJJ A;  5BS6 A;  3SFI A;  2AXL A;  3LSI A;  1M1E B;  4W1U A;  2XAF A;  2RDP A;  3GLX A;  1TW3 A;  3BR2 A;  2DOA A;  3B6A A;  1FT9 A;  5FLX K;  1BBY A;  2CW7 A;  3D5S C;  1NHA A;  1KQ9 A;  3KEQ A;  4Y4R A;  3BZC A;  4UVA A;  2FUG 2;  3S1N J;  1QVU A;  1IDZ A;  2FRH A;  3PUF A;  2QA4 I;  4O5V A;  1JE8 A;  1A36 A;  3F3X A;  4NC6 A;  2WWY A;  4L18 B;  3KZI C;  4A3I J;  3ECH A;  2ZFU A;  4CO8 A;  4ON0 A;  4NUB A;  4XKV A;  3QOD A;  3K0L A;  1T6S A;  2KQR A;  1XSX A;  4CYC A;  4L9T A;  1FBQ A;  2QKM B;  4R1H A;  1L3L A;  2ZJP F;  5E3N A;  2CJJ A;  3RI4 A;  2P7V B;  2A6E F;  2XUB A;  4XQF A;  4BBR J;  2LRD A;  5D5X B;  1ZRD A;  1T0F C;  3IRQ A;  1D0X A;  5CVI A;  3VB2 A;  4RAF A;  1S5L C;  5CVR A;  2CV2 A;  3R61 A;  2E35 A;  4AYB A;  3RZD J;  1OR7 C;  1Z05 A;  5EEA A;  1IGN A;  4BQO A;  2DT5 A;  2QWW A;  2MAB A;  3K7A J;  5FRO A;  2WAE A;  3WGI A;  1R9T J;  3KYD B;  3WG7 H;  2JA6 J;  3HOX J;  2Y9Z A;  5FKK A;  1ITY A;  2CQN A;  3S1M J;  1ZR2 A;  1JKQ C;  2ICW G;  4IQ4 A;  1FYL A;  4RGX A;  2DOE A;  1D8J A;  5EDN A;  5JLX A;  2CUE A;  1RNL A;  1BW6 A;  1Z1D A;  1V55 H;  1I1G A;  3H35 A;  1W5S A;  4UUS A;  2QSH X;  2VQL A;  3V8L A;  4EM1 A;  2E7W A;  1AA7 A;  3HKZ A;  3H5R A;  1TNT A;  1MD0 A;  4MQV A;  4H4K C;  3FXL A;  4L5I A;  3I59 B;  3PO2 J;  2AXT C;  4G6Q A;  2WV0 A;  1FX7 A;  2OQR A;  4C2T A;  4BEH A;  2HQA A;  2EB7 A;  3G6E I;  5E17 F;  1QPI A;  4LB5 A;  2KJB A;  5LLQ A;  4OIP F;  3AG1 H;  4Y17 A;  3HPH A;  5D5V B;  2X4H A;  4ESB A;  2IJL A;  3JW4 A;  1YG2 A;  4QWQ A;  3HSR A;  2OUM A;  2O5R A;  2BY3 A;  2KDO A;  3HHG A;  2X6X A;  3CCY A;  4PJM A;  4JQF A;  4L5J A;  3RKW A;  3WHB A;  3HC7 A;  4BBS J;  5D4S A;  2R7O A;  4AD9 A;  1D0Z A;  3DU5 A;  4KDP A;  1OCO H;  4D9J A;  5IOZ A;  3GW2 A;  2DOD A;  3GFJ A;  3MKL A;  4M9Z A;  3K2A A;  2ECC A;  2W82 A;  4P96 A;  4B3X A;  1AU7 A;  2CG4 A;  4IHW A;  3WU2 C;  4BNC A;  1BR4 A;  3S2H J;  3ROU A;  4Y33 A;  1O7L A;  2M34 A;  3OSF A;  3KYC B;  2HPI A;  4ZDL A;  3ZQG A;  2P5K A;  3HPG A;  3A0B C;  4MLO A;  1VQM I;  4XKB A;  3GTJ J;  1Z6T A;  3S32 A;  2STW A;  4HBL A;  1H8A C;  3MZY A;  2NVT J;  3WU0 A;  3M8J A;  1Y56 A;  4RM3 A;  4KA4 A;  4OIQ F;  2NS0 A;  3MMY B;  1UG2 A;  2JPC A;  3DXJ F;  4NNJ A;  2NOG A;  1S7O A;  2ZCW A;  1WVR A;  3K69 A;  3P9I A;  2JN6 A;  3ASO H;  4KN7 X;  4AYB N;  1BIB A;  5IY5 H;  2QKL B;  1I50 J;  3WE2 A;  4XRF A;  1FTT A;  3CO7 C;  2ZXW H;  3FIW A;  3F8C A;  4FIS A;  3AKZ A;  2VT3 A;  2XPU A;  2FBH A;  3CCJ I;  3LFK A;  5L3G A;  3S3N A;  2M7B A;  2DQL A;  4I7H A;  2MH9 A;  1O3R A;  1REP C;  4OMY A;  3DEW A;  2AS5 F;  3HKZ N;  4B1R A;  1DP3 A;  3ZP5 A;  3HUG B;  4I2O A;  1U8R A;  2OTJ I;  3HTS B;  5J1U A;  2MG4 A;  3E6M A;  4IOC F;  1FEX A;  2BY2 A;  3O6B B;  1UAA A;  3I56 I;  4UVC A;  2DYS H;  1BW5 A;  2WAD A;  4B4C A;  3DFG A;  1I39 A;  3DQV C;  4XSZ F;  2A07 F;  4QPO A;  5F0C A;  3KZY A;  2V1N A;  3WTW C;  2K4J A;  5LD2 C;  2LOO A;  3MZ8 A;  3BG3 A;  3H9G A;  5ICC A;  5ICG A;  4MO7 A;  3HHH A;  1VQ7 I;  2Z1D A;  3HTU A;  2BY1 A;  3SHF A;  2ME0 A;  3SZG A;  4NC7 A;  1LVK A;  3CF2 A;  4KUM A;  3L2V A;  4V2F A;  2JA8 J;  3EUH A;  1VQK I;  3RJP A;  1SFX A;  2R7D A;  5M3F J;  2DMN A;  4FAS D;  3MFK A;  2M0M A;  1VQ8 I;  1RKT A;  1S8N A;  2GA1 A;  3JRB A;  2DXI A;  2LG4 A;  1RPW A;  1P2F A;  1JUM A;  2H27 A;  4AC0 A;  3LSP A;  1S9H A;  2L0K A;  2LF8 A;  5CQG A;  2LMD A;  4U87 A;  3ERE D;  4P5O A;  5ILU A;  4IF4 A;  2MYS A;  2VON A;  4KIT B;  1R4N B;  2A6T A;  1KON A;  3E6C C;  1W0U A;  1ZH5 A;  4MGR A;  1ETO A;  1X4P A;  4XID A;  3QWL A;  4KJZ A;  2DJN A;  4C3J J;  1YI2 I;  2DBB A;  5IP9 J;  2P5V A;  2OF7 A;  3K4K A;  2L3D A;  1OYI A;  2NVY J;  4JBA A;  2R7X A;  3QOP A;  2KDZ A;  2LNB A;  1G4D A;  2XF6 A;  2QVO A;  5H6R A;  2LVS A;  3OIQ A;  4IVN A;  3SZT A;  4J00 A;  1FSE A;  4OAZ A;  5HLT A;  1HST A;  1IN6 A;  1LNW A;  4PCQ A;  1MND A;  1V5E A;  4RS8 A;  1Y0U A;  2CW0 F;  1U5T B;  2BVM A;  4GYI A;  2DPD A;  1ZN2 A;  1E3O C;  4HW0 A;  3T8R A;  2CRG A;  3A01 B;  3LNQ A;  3F21 A;  3ZMZ A;  1U3E M;  1Q1V A;  1B9N A;  4IHV A;  2K02 A;  5FKL A;  3MCZ A;  1V5G A;  4EEF G;  4CIC A;  2EH3 A;  2NVQ J;  2X1E A;  2QF7 A;  4K2E A;  1SFU A;  3WHC A;  1E2X A;  4L9V A;  2VC1 A;  1GV2 A;  5KAF C;  3OIP A;  1YX5 A;  4UV9 A;  2VAS A;  1GV5 A;  2DFE A;  2FX0 A;  2RQQ A;  2V1D A;  1G59 A;  1DGW Y;  2RQP A;  2RKH A;  3I59 A;  2E19 A;  2Q2E A;  3S15 J;  3PQJ A;  4IQJ A;  2YU3 A;  4IJA A;  3ZN0 A;  4BL0 B;  1A6Q A;  3FX3 A;  3IH2 A;  1UHS A;  1XG1 A;  2UV1 A;  1U9N A;  2IW5 A;  3DBH B;  1X3W B;  3OYA A;  3ZXS A;  1G3Y A;  3AG3 H;  4I01 A;  3W6J B;  3WTS C;  2DT7 B;  2TRT A;  5JVT A;  2FD5 A;  4IZZ A;  1JT6 A;  2KT0 A;  4CCN A;  4F7Z A;  3BJA A;  2JZY A;  2Z3Y A;  4KMU X;  4M3G A;  4WCG A;  2DTR A;  4DNC A;  1MH3 A;  4YIR X;  2M2E A;  2RNJ A;  1ONV A;  1Q1H A;  3K10 A;  2FOW A;  3RZO J;  1HC8 A;  3R0J A;  3HOY J;  2M8E A;  3VOD A;  3PUB A;  1EA3 A;  2A6H F;  1QBJ A;  2EIK H;  3PFY A;  1OCZ H;  3FXQ A;  3V42 A;  1BA5 A;  1KYW A;  5J8F A;  5AIP A;  3G4S I;  1SMT A;  2LD5 A;  4A3D J;  3BCA A;  2XSJ C;  5B66 C;  2ESH A;  2BHY A;  2MC4 A;  2WC2 A;  4C9Y A;  3AL0 B;  4D7M A;  2P6T A;  4A3G J;  2DDA A;  1K83 J;  4X0G A;  4FE4 A;  3CMY A;  4CUG A;  4D5F A;  1Z3X A;  3J7A Y;  1ODD A;  2D1H A;  4YEL A;  2HVQ A;  1SD7 A;  4C2U A;  3ERM A;  3O8G A;  4FX4 A;  2EFW A;  2LKP A;  5AIQ A;  1G2H A;  3HRM A;  3KP2 A;  1TQP A;  3R4K A;  2VQG A;  1TL8 A;  2GBY A;  2E1N A;  3A4C A;  4IKF A;  3GFM A;  2M7A A;  2WBM A;  1KGS A;  2L5Q A;  4OOI A;  2COM A;  2XRN A;  1PYV A;  3CQZ J;  4PJJ A;  2XHK A;  1R23 A;  4MTE A;  1D1A A;  1U2W A;  2VXZ A;  2M8G X;  4A3K J;  5A2Q Z;  1U6G A;  2X6Y A;  2KJC A;  2JA2 A;  3OL4 A;  4G7H F;  3TQN A;  1ZQ3 P;  2E5N A;  4E7S A;  3TO7 A;  4XLH A;  4JX6 A;  2KL4 A;  4PGH A;  3SJM A;  4G6T B;  5EZG A;  4L5E A;  3CCQ I;  2VJ4 A;  2DI3 A;  1EH6 A;  2UXX A;  1YFH A;  3OYJ A;  1ZLK A;  3JRI A;  4LG0 A;  1OMI A;  3K4C A;  2G7H A;  2V26 A;  3NWT A;  1VZ0 A;  3OYI A;  2W84 A;  4B09 A;  3CMM A;  1LFP A;  2ISZ A;  2L54 A;  4WXC A;  5IT9 Z;  4I0A A;  4RAY A;  4UHT A;  2B63 J;  1KQ8 A;  1LDJ A;  4GO1 A;  4I6Z A;  3BG6 A;  2HKX A;  1WPK A;  4KN4 X;  3MKW B;  2X0L A;  5E8G A;  1BI1 A;  3OYB A;  2HOA A;  1JTY A;  4N4N B;  2K9L A;  2VL8 A;  2V4J C;  5EEH A;  1DDN A;  2FNA A;  2RGV A;  1DUX C;  5DEQ A;  4Q5S F;  3BR0 A;  1MDM B;  3GO5 A;  4HNT A;  1TLH B;  4M3F A;  5LEJ A;  4L0Z B;  3CF5 F;  4IHT A;  1SFE A;  2QQ9 A;  1HOM A;  2VIX A;  1OCR H;  1XGN A;  3QPL A;  3W2W A;  5DUI A;  4E7H A;  3WGG A;  1BC7 C;  5HS9 A;  2QEX I;  2E2H J;  1QRY A;  1XGS A;  2VBX A;  4UNO A;  1R1U A;  4XOP A;  4EJT A;  2MBF A;  1YIT I;  2BYV E;  3CJT B;  4Q47 A;  4A3E J;  4A12 A;  5HLH A;  2NS7 A;  2ID3 A;  2K4B A;  4A0Y A;  1IF1 A;  4ZYD A;  2A5W A;  3OWT A;  2ZXJ A;  4V19 K;  3C2B A;  3CCL I;  1U8B A;  2DQR A;  4OU0 A;  2GIV A;  2RC4 A;  4CA0 A;  4D7N A;  1ACI A;  5DD8 A;  1K61 A;  5GPC A;  5EG0 A;  3HRU A;  2WA0 A;  1O3Q A;  2Z99 A;  3BR6 A;  2VJ5 A;  2DA3 A;  4IRG A;  2X6W A;  3EUK L;  1ZTR A;  3RTR A;  1VQO I;  1QQI A;  1Z9C A;  4U0V A;  1PVE A;  2PMU A;  2R3S A;  1D3Y A;  2E34 A;  5K7F A;  2ZJR F;  1ZRF A;  1GXQ A;  1ON2 A;  4IOA F;  2ID6 A;  3OIO A;  4RB2 C;  3DKW A;  4IO9 F;  1Y6I A;  3F8B A;  3WU1 B;  1ZAO A;  1JGG A;  1IXS B;  2V6E A;  3I55 I;  3U2R A;  5EZH A;  3HOT A;  4B44 A;  2PBI A;  4XRM A;  2AQE A;  3PNV A;  3O8H A;  2M4G A;  2XGD A;  4J01 A;  2VC0 A;  3BJO A;  3I4N J;  1HCR A;  3VYR B;  2EPF A;  3ZQF A;  4AIH A;  3JRE A;  4HDV A;  1IUY A;  3M1E A;  3MN2 A;  5ICF A;  1YLF A;  3DLA A;  1RKW A;  4DOZ A;  3BG7 A;  2ZJ2 A;  3BZ6 A;  3V7S A;  2BV6 A;  4CZZ A;  2HTJ A;  1MKM A;  1E17 A;  2LDU A;  2CS3 A;  5FD5 A;  1XMX A;  2Y75 A;  2DMT A;  2FOK A;  4L9J A;  2PFB A;  2UZK A;  4G94 A;  2PI0 A;  1ETW A;  1X2M A;  1BI0 A;  3ZCO A;  3HOS A;  1JXS A;  1BOB A;  2LBF B;  3KCC A;  1E3P A;  5LFA A;  1K6Y A;  3AG2 H;  3AFH A;  5CQE A;  4EJU A;  5LGT A;  2A61 A;  1O4X A;  2YSR A;  5IOY A;  4A0Z A;  2ADU A;  2ELH A;  2O0Y A;  1EJ9 A;  3SDG A;  2HYF A;  3GUD A;  2KPM A;  2OQG A;  5TGT A;  1UFM A;  2KIS A;  5D6E A;  4XOT A;  1RR7 A;  4DJA A;  3LAJ A;  2ZME B;  3E0J B;  1FMW A;  2F5C A;  2MLG A;  2YUS A;  1MSF C;  3OS0 A;  4CDG A;  6PAX A;  2IBD A;  3OYE A;  4G9Y A;  1MNM C;  1PP8 F;  5IYB J;  2W85 A;  1R1T A;  4QSH A;  2CO5 A;  1NG7 A;  2ELK A;  5FRN A;  2PQ8 A;  2W1O A;  1G8X A;  2HOT A;  4LLN A;  2ELJ A;  2OA4 A;  3ASN H;  2JUG A;  4X1E A;  3H9Q A;  1MZB A;  4XLC A;  3I64 A;  4Y13 A;  3VDX A;  2LSO A;  3ZOB A;  4QIW N;  4A93 J;  2GXG A;  3J7Z I;  3PNT A;  3QQA A;  5FB2 A;  2VKE A;  1WSU A;  1F5T A;  1DPR A;  4M3D A;  1BN5 A;  4M3E A;  1LQ1 A;  3UNG C;  4JX4 A;  3FXR A;  4RDU A;  2QGU A;  3L09 A;  1W0T A;  2CSO A;  4DYC A;  1XD7 A;  5JFR A;  1WJ5 A;  2HXO A;  5F64 A;  2GOX B;  5LHG A;  1KZH A;  3W2V A;  3ZR8 X;  3V7C A;  3BP8 A;  2JQ7 A;  1XDU A;  5EGO B;  4MNU A;  2O9L A;  1R22 A;  2LKX A;  1XDS A;  1KU2 A;  1MIJ A;  2L02 A;  1FWZ A;  4RB0 A;  3MKZ A;  2XF7 A;  1B8I A;  1VFC A;  3GFL A;  2ECB A;  4HF1 A;  3FBI B;  4EAT A;  4RB3 C;  2EZI A;  4A2U A;  1HXD A;  1Z3Y A;  3B02 A;  4ASN A;  3G1L A;  1W7P B;  2JJ7 A;  2PMZ A;  4II3 A;  4EVI A;  1USS A;  2Z5U A;  2HDW A;  2F6C A;  3F22 A;  1IO2 A;  2GA2 A;  5E1Z B;  1OYW A;  1KQ0 A;  3IAS 2;  2E60 A;  4PK4 A;  4BJT A;  1LJ9 A;  3RQI A;  1TW2 A;  2CFO A;  1JKP C;  3QYF A;  1J7K A;  4G12 A;  1LE8 B;  1YRN A;  5KK1 A;  1R1V A;  3NRV A;  1YW7 A;  4FQG A;  3MQ0 A;  1F43 A;  4D0P A;  2LY9 A;  2L7K A;  3DPU A;  4G6D A;  4RLQ A;  5LGU A;  4NC8 A;  4EMS A;  4BYY A;  1FJL A;  2FNP A;  2MD5 A;  3LL7 A;  2DLL A;  5IT3 A;  1HKT A;  3C7J A;  2HVS A;  2IS4 A;  2L9V A;  1YJW I;  3L7W A;  3R60 A;  3CO6 C;  4V2G A;  2I8D A;  2R5Z A;  3VYS B;  3V8J A;  2L4M A;  5B1A H;  2HOE A;  3SFZ A;  3OYL A;  2JUC A;  2QQ8 A;  3VYT B;  3ZQQ A;  1LPQ A;  4LIT A;  4YFN F;  1RUO A;  3KIO A;  3MEX A;  2KZG A;  2EZH A;  2JPB A;  3F8F A;  2NOJ B;  2DCE A;  3VPR A;  1JJ6 C;  4P55 A;  2BW3 B;  1HW5 A;  2HGC A;  4C3H J;  3CJQ B;  5IYC J;  2R7T A;  3OSG A;  2E1M B;  1XTA A;  1U5T C;  3O2P E;  2R0Q C;  5HS8 A;  2DYR H;  3I3L A;  3CUQ B;  3J80 K;  1WFX A;  2VOO A;  2QQA A;  4Y15 A;  1WWX A;  4AWX B;  1TWG J;  2KMU A;  3E6D A;  3LA3 A;  1Z21 A;  1HDP A;  4Z6Y A;  1C0W A;  2CV0 A;  1YW8 A;  3BLY A;  1DU0 A;  3DKX A;  2R4G A;  2COB A;  2H8W A;  2OV7 A;  2RRE A;  5E1W A;  5F1R A;  4AIJ A;  2O8X A;  1NTC A;  4ZDO A;  3H5A A;  1IAW A;  4H0E A;  2OC6 A;  1RI7 A;  1KU9 A;  5M5Y J;  3IH3 A;  1J0R A;  4BH9 A;  4ZTF A;  4MEY F;  1PDN C;  3CP8 A;  2PJR B;  3RQ4 A;  2WAQ A;  3J81 K;  3MWM A;  5H20 A;  1XMA A;  1SD4 A;  2PMZ N;  3K4M A;  4KFC A;  2DMU A;  2E2J J;  4PUS A;  1Y8R B;  2MH2 A;  2XGX A;  2NYX A;  1GVD A;  4IL6 C;  2AQF A;  5FJ8 J;  2VOP A;  3G71 I;  1G6N A;  5F08 A;  1D1C A;  3F9K A;  3FM3 A;  4NB5 A;  5D5U B;  1K6O A;  2XVC A;  2OJE D;  4I76 A;  1AHD P;  1A31 A;  1VQN I;  3OY9 A;  2LK2 A;  1QHG A;  2X48 A;  1J2X A;  3LAP A;  2F5F A;  3BCB A;  3FK6 A;  5JLW A;  1Z77 A;  1IJW C;  1BM9 A;  2Z16 A;  5GAH J;  2PX9 A;  4HAM A;  2DT6 A;  3IL2 A;  3PSF A;  3S3M A;  4AID A;  1X3U A;  1RUN A;  4ZYG A;  3MZH A;  4ZZL A;  3D5L A;  2XKO A;  4EM0 B;  3TW6 A;  2H1K A;  1F9N A;  1T08 B;  5CVU A;  5KCM A;  4HRI A;  5F27 A;  4KT5 C;  2VBY A;  3KPH A;  3WTV C;  1MJ9 A;  3HIF A;  1ZHF A;  5J4Y A;  3A1Y A;  1X1B A;  1P9Q C;  2W00 A;  1FMV A;  5F0H A;  3WTU C;  1K78 B;  4ZH4 F;  4HNU A;  1T38 A;  4F52 A;  4ENM A;  1IV6 A;  2GAU A;  4NQW B;  4DZJ A;  4XLP F;  1P6R A;  3ZMV A;  1R00 A;  4UUT A;  3WE3 A;  4QLC U;  1B1B A;  3AG4 H;  3FKJ A;  1OFC X;  3S2W A;  3HOV J;  1Z67 A;  3QOE A;  3GX4 X;  1A35 A;  3QP5 A;  1VI0 A;  1X58 A;  2CUF A;  1ERD A;  2CQQ A;  1SVL A;  5JHF A;  1S7A A;  1TQI A;  4XNF A;  1FSH A;  5LBQ A;  2W48 A;  4I02 A;  2GZW A;  1YIJ I;  4AVP A;  3DPT A;  3L9F A;  2HDC A;  3EYI A;  4CHU A;  1X1C A;  2V1U A;  4BQQ A;  2X9D A;  3C2G A;  1BR1 A;  5D6F A;  1RRJ A;  3W6K B;  3Q3S A;  5GP9 A;  5J3L A;  2Z9O A;  1KA8 A;  3J7Y J;  1RET A;  1BI3 A;  1UJ8 A;  2VKD A;  3CJN A;  3HGY A;  4LK0 F;  5HLI A;  4M9S A;  4EQQ A;  3BTI A;  1J5Y A;  2ACJ A;  2EIM H;  4IPA A;  1EF4 A;  1GDT A;  2WAQ N;  2DOF A;  2HXI A;  4A3M J;  5EGO A;  1IN8 A;  1JUP A;  3GF2 A;  5EYR A;  3ABU A;  2A5Y B;  3K4B A;  2IA1 A;  1CF7 B;  1N78 A;  4ITV A;  1JKO C;  5E3M A;  1R58 A;  4YG2 F;  1H89 C;  3HOZ J;  1ZEL A;  5E3O A;  2FA5 A;  4HV6 A;  2GIZ A;  3EUA A;  1YX3 A;  1S7E A;  1FBU A;  3ZQ7 A;  2VLA A;  4PSW A;  1XPX A;  1J09 A;  2UWM A;  3FHZ A;  2K9M A;  2RAE A;  2P0W A;  1MJA A;  5J47 A;  3JRD A;  4XN0 A;  1VQP I;  3GBG A;  3L2Q A;  1UEL B;  5LGN A;  5IYD J;  2VJJ A;  2GWR A;  2QEN A;  3RPQ A;  2YR2 A;  3DTE A;  2KIQ A;  1MNE A;  1Y8Q B;  3JSP A;  3ABK H;  2XAS A;  2HPM A;  5DD4 A;  3GTM J;  3A02 A;  2IS2 A;  4W97 A;  1T56 A;  4HX8 A;  4CH7 A;  4CZC A;  4BS9 A;  5FLV A;  3GTP J;  3H3Z A;  1IN5 A;  3ABL H;  3BZK A;  3OYN A;  4B43 A;  4J19 A;  3CDI A;  1YO5 C;  3WTT C;  1WJB A;  5M3M J;  5BQT A;  2MD0 A;  3CC7 I;  1UMQ A;  3HG9 A;  3ISP A;  1QA6 A;  3F23 A;  1Y1V J;  3ZRG A;  3ZMS A;  3KLO A;  5ILS A;  3LWF A;  4BXF A;  1XS9 A;  1MBK A;  1MBJ A;  5GAE J;  1IXR C;  1FNN A;  2EFN A;  3HRT A;  4U7B A;  2QYO A;  4PJL A;  2OZ6 A;  2X51 A;  2VE9 A;  4BUP A;  2EFQ A;  2D1V A;  3E1S A;  4E7J A;  5BOX A;  4CSW A;  3JR9 A;  1U78 A;  1B6A A;  3CC4 I;  3RKX A;  3M4O J;  4LMY A;  1B9M A;  3KX2 A;  4MIM A;  3FHN A;  3L00 A;  1Z91 A;  2PJP A;  2GM4 A;  5DDG A;  1ETK A;  1POG A;  2E5Z A;  4PJ0 C;  2VPL A;  4HX4 A;  1FBS A;  2IPQ X;  4FT8 A;  1R4M B;  1P7I A;  2M5W A;  2BZT A;  1H88 C;  3OYD A;  1B72 B;  4XKW A;  3RCO A;  3E5X A;  1CQT A;  5FLX Z;  2X6O A;  2FQ3 A;  1IRG A;  2HU9 A;  3CDL A;  2Y0M A;  4HNV A;  2R7Z J;  4TV7 A;  1RR8 C;  1JT0 A;  3NEU A;  4FX0 A;  2R93 J;  3DPL C;  2OBP A;  1DU6 A;  3M8F A;  4UVB A;  4XL9 A;  2E7X A;  3G73 A;  2E1C A;  3S1R J;  4P9U A;  2GLO A;  2EA4 A;  3IAM 2;  4KYW A;  2DAO A;  1PP7 U;  3QAH A;  1R6R A;  4BXU A;  4NBQ A;  2DK8 A;  4UUV A;  5D5W B;  5BPD A;  2M1B A;  2VKH A;  2D2W A;  5J40 A;  2NRA C;  3OL3 A;  1B59 A;  3W6V A;  1Z0X A;  1WH7 A;  4YRV A;  3QYB A;  2VXD A;  2FML A;  2W57 A;  1G3S A;  2M45 A;  3T5X A;  2ZME C;  1ZLJ A;  3DTK A;  1JJ8 C;  1MGT A;  1TT5 B;  5E79 C;  4D5C A;  4LGW A;  4CGZ A;  4UB8 C;  1YYV A;  4MQ9 F;  5FD6 A;  2HI3 A;  1TWC J;  2CWE A;  3KEY A;  4Q4Z F;  3QPT A;  1UHW A;  3FF5 A;  4E4H A;  4OIN F;  3B6C A;  1ETQ A;  2K5C A;  3I9V 2;  3CCU I;  4N4O B;  4F92 B;  1JKR C;  1XCB A;  3VSL A;  1D1B A;  2QZ8 A;  3JRH A;  1QO0 D;  3WTZ A;  2KRC A;  3Q0V A;  3COA C;  4ANJ A;  1KYZ A;  1DQU A;  1FIP A;  2LYC A;  3V8K A;  3KP6 A;  1V3F A;  3IRR A;  4RAZ A;  2F5E A;  3CCM I;  4A3B J;  4AUX A;  2HZT A;  1AKH B;  3G2B A;  4LK1 F;  2W24 A;  5DCM B;  3JRA A;  1SD5 A;  3RPU D;  1LFB A;  1TQM A;  2EZK A;  1GLN A;  1S29 A;  2IS1 A;  3E3V A;  3JTH A;  3HUG A;  5E8I A;  2IEK A;  3LSG A;  2P4W A;  1WI3 A;  4JK1 X;  3BPV A;  1BJZ A;  2VJI A;  3Q0U A;  3TOB A;  4E6K G;  9ANT A;  3GZ6 A;  3J7A O;  4RLF A;  2GXB A;  2R5Y B;  2Z2S B;  5HDN A;  2D45 A;  2ISY A;  4AM3 A;  1YJ9 I;  1FIA A;  2DFI A;  3NAU A;  3DWL E;  3LMM A;  3PIO F;  1SEU A;  1HW2 A;  3P9K A;  3LSM A;  3GYH X;  2CH0 A;  2QBY B;  3GVA A;  1T39 A;  4CXF A;  4PGG A;  5F0F A;  3OOU A;  4HG2 A;  1X3Z B;  1HQC A;  3IUO A;  4BE0 A;  1A5J A;  3LSK A;  1O57 A;  1K79 A;  2KHM A;  4M71 A;  3REO A;  3C18 A;  2W7N A;  3FXM A;  3WTX C;  3WTY C;  1AWC A;  4BXX J;  4XSX F; 
#chains in the Genus database with same CATH homology
 3HSE A;  3KEO A;  2L01 A;  4U0Y A;  3ABT A;  3ECO A;  4M6Y A;  4MTD A;  1CF7 A;  2FU4 A;  1FLI A;  4YFK F;  1GHC A;  5LRR A;  1FOK A;  1KU7 A;  3CTA A;  1YW9 A;  1G3T A;  1OKR A;  1W5T A;  2HKO A;  3QP6 A;  4O6J A;  4WWC A;  4I09 A;  2DPU A;  1SD6 A;  3JSO A;  4HOB A;  3RYP A;  4EJO A;  1FZP B;  5FO5 A;  2ESN A;  2FMY A;  3ML6 A;  3EQL F;  2ZNZ A;  5ERI A;  3D0S A;  2QLZ A;  1G3W A;  2YPR A;  1TBX A;  1U5T A;  3RDI A;  4WX9 A;  3TO9 A;  3CLO A;  1ZG5 A;  3CUQ C;  3ZMT A;  2EK5 A;  1JGS A;  1V4R A;  1P4A A;  3KZZ A;  1FY7 A;  2FBI A;  2BGC A;  2O3F A;  5LHI A;  4AIK A;  2FE3 A;  3IKV A;  4XLN F;  2CQK A;  2V6C A;  2R7F A;  3PQK A;  2Y48 A;  1J59 A;  1ZRE A;  2VBW A;  1F1Z A;  3GZ5 A;  3RPU A;  2B0L A;  3SXY A;  4MEX F;  3QU6 A;  1RZ4 A;  4HZF A;  3KE2 A;  4GCV A;  4EJW A;  5CLS A;  3P9C A;  1H0M A;  1QZY A;  2VT2 A;  3E5U A;  1XGM A;  4M74 A;  5H6Q A;  2H09 A;  2BE5 F;  3K1P A;  2IT0 A;  2ZKZ A;  2NAZ A;  2L4A A;  3V4G A;  3VEP A;  5LRS A;  2C6Y A;  4LLL A;  2DO7 A;  1FC3 A;  3GEZ A;  1SMY F;  4LD5 A;  2K27 A;  1XN7 A;  3TDZ C;  1S3J A;  1YS6 A;  4YIF A;  1EH7 A;  2EV6 A;  3DF8 A;  4KNY A;  1R36 A;  4IHS A;  3F6O A;  4HF2 A;  4FHT A;  1S6L A;  3G3Z A;  1I1S A;  2HS5 A;  1Z6R A;  3BJ6 A;  2XAG A;  4ZYE A;  3KFW X;  1WRJ A;  2O61 A;  1ZAR A;  3WOD F;  3FXU A;  3B73 A;  3QPH A;  4Q48 A;  2WTE A;  1ULY A;  2EV0 A;  2F2E A;  3FMS A;  4P9F A;  4M6X A;  1STZ A;  2ZO4 A;  2UXN A;  3WGH A;  3E6B A;  4ESJ A;  2CFX A;  4EV0 A;  1XB4 A;  2OU2 A;  1J75 A;  1UST A;  2QBY A;  1H9T A;  5BPI A;  1K7A A;  1F4K A;  4IRH A;  4ETS A;  4HYE A;  2J5P A;  2EV5 A;  1MDM A;  1T98 A;  1DP7 P;  2GQQ A;  2MA3 A;  2RV8 A;  4U7D A;  3RKY A;  2KIU A;  2RN7 A;  1SAX A;  2PLY A;  1IN7 A;  4RGR A;  1I6X A;  5KVR A;  4ZYH A;  2FSW A;  2OD5 A;  3FWE A;  3F6V A;  4UV8 A;  5CYV A;  4PZJ A;  3L2C A;  5K1Y A;  2K7L A;  2STT A;  5J8C A;  4R8H A;  4HQM A;  2JTV A;  3IWF A;  1ZGA A;  5TRD A;  4S04 A;  4A5M A;  1W7P D;  3U9G A;  2HWV A;  2XIG A;  2A69 F;  5A2Q K;  4L9N A;  5D4R A;  1D5V A;  5D8L B;  2H94 A;  2VE8 A;  2VN2 A;  3BWG A;  3BY6 A;  4GYG A;  3RYR A;  2G9W A;  5HDG A;  2EA2 A;  4G8X A;  4RGU A;  3LA7 A;  5FGM A;  4CHU A;  3LQR A;  3JAM K;  3U1D A;  4S05 A;  5IT9 K;  2LF7 A;  2CGP A;  2PMH A;  5HOO A;  4IRI A;  3H92 A;  5CVV A;  1I5Z A;  2KKO A;  3DP7 A;  1LDK B;  4HLX A;  4EJV A;  4I98 B;  5DUK A;  4O3M A;  2QM3 A;  2YX7 A;  2JT1 A;  4M73 A;  3OV8 A;  5DYM A;  1BOA A;  1W4M A;  2MLK A;  2ZME A;  5JR3 A;  3MAJ A;  4HX7 A;  3KP4 A;  2DK5 A;  1HSJ A;  3Q5F A;  1WI9 A;  3ZN1 A;  5AON A;  4Z2Y A;  2H6B A;  1KU3 A;  4EGZ A;  2ZNY A;  4N9I A;  4UXN A;  4G7O F;  5JHU A;  3ELK A;  3I71 A;  1IRF A;  5HLG A;  2MC3 A;  3O3K A;  3IHU A;  1H9G A;  3C3W A;  5L3B A;  3I53 A;  4IXA A;  1YS7 A;  1MJB A;  4OIR F;  1XSV A;  2FF4 A;  1BIA A;  3JTG A;  4LG0 B;  3DEU A;  1QPM A;  3F72 A;  2P7C B;  1XCV A;  3K9T A;  3I58 A;  2HQR A;  5JI6 A;  1XMK A;  3IC7 A;  3KET A;  2G7U A;  4N0B A;  1ON1 A;  3SZP A;  2PG4 A;  1W7P A;  4ENJ A;  1QNT A;  1BI2 A;  3I4P A;  3T0Y A;  4A6D A;  2XAJ A;  1WQ2 A;  5HS7 A;  2HFH A;  5F6F A;  2XRO A;  4WF2 A;  2ZBK A;  3C1D A;  5K5R A;  5ILV A;  1YTY A;  1D8K A;  5L3F A;  3GWZ A;  4EGY A;  4BHP A;  3R6S A;  2QUF A;  5DCF A;  5E18 F;  2XAH A;  3CDH A;  1OYY A;  1XSD A;  2YX4 A;  3Q9V A;  3F8N A;  4KMF A;  2NNY A;  1XGO A;  4WXD A;  2Q8K A;  4I0B A;  4HA8 A;  4G7Z F;  1OPC A;  1RIO H;  3BDD A;  2ZFW A;  3CUQ A;  1PUE E;  4N9H A;  3I0T A;  5L3D A;  3HYI A;  5J6X A;  1T2K A;  1P92 A;  1AOY A;  3BPX A;  3T1B A;  2P8T A;  2QQB A;  3LA2 A;  1LEA A;  3VFZ A;  5LHH A;  2Z33 A;  3ULQ B;  1GVJ A;  1FPQ A;  2VBZ A;  1YQA A;  1LEB A;  2OAZ A;  2NNN A;  3AAF A;  1VTN C;  4NHJ A;  4R79 A;  1EV7 A;  1LDD A;  3FM5 A;  4ZZD A;  3CUO A;  4ESF A;  2JSC A;  3TKY A;  3R0A A;  1ZG1 A;  2IP2 A;  3PFI A;  2BEO A;  2F5D A;  2J5O A;  4L0Y B;  2O03 A;  4LLG F;  1LB2 A;  1HBX G;  1GXP A;  5CVJ A;  2DW4 A;  3HRS A;  5HDK A;  3SQN A;  4A0X A;  2XAQ A;  4BHC A;  5HVQ C;  3J80 Z;  3FMQ A;  5LEK A;  1R7J A;  4BQA A;  1K78 A;  2HQN A;  4NQW A;  2VOD A;  3TGN A;  3QRF F;  3KP7 A;  2M30 A;  1FP2 A;  1YIO A;  4KIF A;  2O6G E;  2OZU A;  4HDU A;  4ENN A;  2P6S A;  1P4X A;  1UHM A;  2JRT A;  2EJR A;  2ETH A;  1WKM A;  4KIB A;  1A04 A;  1Z7U A;  3J81 Z;  1EH8 A;  1LVA A;  3I5U A;  2HTS A;  4GXO A;  2PN6 A;  3LST A;  4RGS A;  3T8T A;  4U0W A;  2K86 A;  2XV4 S;  3K1N A;  3JAM Z;  3FMR A;  1O7F A;  5D8K B;  3DV8 A;  1QGP A;  3K1M A;  3GXO A;  2A3S A;  3E97 A;  1JHF A;  4B8X A;  5EEG A;  1HKQ A;  3TOA A;  1UB9 A;  1FP1 D;  3Q9S A;  2W25 A;  1O3T A;  3BRO A;  2EFP A;  2A68 F;  5ICE A;  5FFZ A;  3WG9 A;  1B4A A;  3M7G A;  5FFX A;  2V79 A;  3FZV A;  3KP5 A;  1R5G A;  2RVC A;  1HW1 A;  1TTY A;  1IW7 F;  3ZMU A;  4PDK A;  1TNS A;  2H6C A;  3IWZ A;  1T0F A;  5K5Q A;  2V1X A;  2IA2 A;  1OR7 A;  4U88 A;  4E70 A;  1IZ1 A;  3KLN A;  2IRF G;  4BHB A;  1FYK A;  3BOQ A;  4M72 A;  4BAY A;  4LB6 B;  3KP3 A;  3ZPL A;  5BMZ A;  2HR3 A;  1I27 A;  2Q0O A;  5L3E A;  4HQE A;  2IVM A;  3H3U A;  4GGG A;  3EDP A;  4DQ2 A;  3N4M A;  1DPU A;  4LFU A;  4A6E A;  1ZRC A;  1O3S A;  2PEX A;  3EET A;  3RIR A;  4WXH A;  2KIF A;  3ZMD A;  3I54 A;  4RB1 A;  1BJA A;  4CYD A;  3LQQ A;  2EWN A;  1BC8 C;  2HYG D;  4HF0 A;  4HV5 A;  4YII A;  3QU3 A;  5CJ9 A;  3E5Q A;  1ZGJ A;  2IA0 A;  3F8M A;  1R5H A;  2XKP A;  4KIC A;  5E1X A;  3V7R A;  3HSF A;  1JHH A;  1IXC A;  4XBF A;  4ENK A;  4OIO F;  4OMZ A;  5E20 A;  2CYY A;  4M9X A;  2P5L C;  2FXA A;  3EYY A;  4HLY A;  4EM2 A;  5K5O A;  1P4W A;  1IN4 A;  2DU9 A;  2FEZ A;  1J9I A;  1HKS A;  1ZG3 A;  4YFX F;  3M8E A;  3VOE A;  2HEO A;  5ED4 A;  3OOP A;  4A5N A;  1CGP A;  3IKT A;  1ZYR F;  2V9V A;  2KIM A;  1QZZ A;  3TO6 A;  4LJZ F;  2TDX A;  2BBY A;  1UCR A;  1L0O C;  5DCM A;  2KRF A;  2M87 A;  1FYM A;  3K2Z A;  4MHG A;  4WK8 F;  2EFO A;  5L3C A;  3NQO A;  3P7N A;  3M9A A;  5DV5 A;  3GFI A;  3N97 A;  2FBK A;  3TDU C;  4KIG A;  5TJJ A;  5BS6 A;  2AXL A;  2XAF A;  2RDP A;  3GLX A;  1TW3 A;  1FT9 A;  5FLX K;  1BBY A;  1NHA A;  1KQ9 A;  3KEQ A;  4UVA A;  2FRH A;  1JE8 A;  4O5V A;  3F3X A;  2WWY A;  4L18 B;  3ECH A;  4CO8 A;  4ON0 A;  3K0L A;  1T6S A;  1XSX A;  4L9T A;  1FBQ A;  4R1H A;  1L3L A;  3RI4 A;  2P7V B;  2A6E F;  2XUB A;  5D5X B;  1ZRD A;  3IRQ A;  5CVI A;  3VB2 A;  5CVR A;  3R61 A;  1Z05 A;  2DT5 A;  2QWW A;  3WGI A;  1FYL A;  4RGX A;  1D8J A;  1RNL A;  1Z1D A;  1I1G A;  1W5S A;  3V8L A;  4EM1 A;  2E7W A;  1TNT A;  1MD0 A;  4MQV A;  4L5I A;  3I59 B;  4G6Q A;  2WV0 A;  1FX7 A;  2OQR A;  5E17 F;  2EB7 A;  4LB5 A;  2KJB A;  5LLQ A;  4OIP F;  4Y17 A;  5D5V B;  2X4H A;  4ESB A;  2IJL A;  3JW4 A;  1YG2 A;  4QWQ A;  3HSR A;  3HHG A;  4JQF A;  4L5J A;  3RKW A;  5D4S A;  4AD9 A;  4KDP A;  3GW2 A;  3GFJ A;  4M9Z A;  4P96 A;  2CG4 A;  4BNC A;  3ROU A;  1O7L A;  2P5K A;  1Z6T A;  2STW A;  4HBL A;  3MZY A;  3WU0 A;  4KA4 A;  4OIQ F;  2NS0 A;  2JPC A;  3DXJ F;  1S7O A;  2ZCW A;  3K69 A;  3P9I A;  4KN7 X;  1BIB A;  3WE2 A;  4XRF A;  3CO7 C;  3F8C A;  2VT3 A;  2FBH A;  3LFK A;  5L3G A;  2DQL A;  4I7H A;  2MH9 A;  1O3R A;  1REP C;  4OMY A;  2AS5 F;  3ZP5 A;  4I2O A;  1U8R A;  3HTS B;  3E6M A;  3O6B B;  4UVC A;  3DFG A;  3DQV C;  4XSZ F;  2A07 F;  3KZY A;  3WTW C;  2K4J A;  5ICC A;  5ICG A;  3HHH A;  3HTU A;  3SHF A;  4KUM A;  3EUH A;  3RJP A;  1SFX A;  2R7D A;  3MFK A;  1S8N A;  2GA1 A;  1P2F A;  2H27 A;  2LF8 A;  3ERE D;  4P5O A;  5ILU A;  4IF4 A;  2VON A;  3E6C C;  1ZH5 A;  4MGR A;  2DBB A;  2P5V A;  2L3D A;  1OYI A;  4JBA A;  3QOP A;  1G4D A;  2LNB A;  2QVO A;  5H6R A;  4IVN A;  3SZT A;  1FSE A;  1HST A;  1IN6 A;  1LNW A;  4PCQ A;  4RS8 A;  1Y0U A;  2CW0 F;  1U5T B;  4GYI A;  2DPD A;  1ZN2 A;  4HW0 A;  3T8R A;  3F21 A;  3ZMZ A;  1U3E M;  1B9N A;  2K02 A;  3MCZ A;  4CIC A;  4K2E A;  1SFU A;  1E2X A;  4L9V A;  2VC1 A;  4UV9 A;  2V1D A;  2RQP A;  2RKH A;  3I59 A;  2Q2E A;  3PQJ A;  2YU3 A;  4IJA A;  3ZN0 A;  3FX3 A;  2IW5 A;  1G3Y A;  4I01 A;  3W6J B;  3WTS C;  5JVT A;  4F7Z A;  3BJA A;  2JZY A;  2Z3Y A;  4KMU X;  4WCG A;  2DTR A;  4DNC A;  2RNJ A;  1ONV A;  1Q1H A;  3R0J A;  2M8E A;  3VOD A;  2A6H F;  1QBJ A;  3FXQ A;  1KYW A;  5J8F A;  5AIP A;  1SMT A;  2ESH A;  2WC2 A;  2P6T A;  1ODD A;  2D1H A;  1SD7 A;  4FX4 A;  2EFW A;  2LKP A;  5AIQ A;  3HRM A;  3KP2 A;  1TQP A;  3R4K A;  2E1N A;  3GFM A;  1KGS A;  4OOI A;  2COM A;  2XRN A;  2XHK A;  1R23 A;  4MTE A;  1U2W A;  2VXZ A;  5A2Q Z;  1U6G A;  2KJC A;  4G7H F;  3TQN A;  3TO7 A;  4PGH A;  2DI3 A;  1EH6 A;  2UXX A;  1YFH A;  1ZLK A;  4LG0 A;  1OMI A;  2G7H A;  2W84 A;  4B09 A;  2ISZ A;  2L54 A;  4WXC A;  5IT9 Z;  4I0A A;  4RAY A;  4UHT A;  1KQ8 A;  1LDJ A;  4GO1 A;  2HKX A;  4KN4 X;  2X0L A;  5E8G A;  1BI1 A;  5EEH A;  1DDN A;  2FNA A;  2RGV A;  1DUX C;  5DEQ A;  4Q5S F;  1MDM B;  3GO5 A;  5LEJ A;  1TLH B;  4L0Z B;  4IHT A;  1SFE A;  2QQ9 A;  1XGN A;  5DUI A;  3WGG A;  1BC7 C;  5HS9 A;  1XGS A;  2VBX A;  4UNO A;  1R1U A;  4EJT A;  2MBF A;  2BYV E;  4Q47 A;  4A12 A;  5HLH A;  2K4B A;  4A0Y A;  1IF1 A;  4ZYD A;  2ZXJ A;  2DQR A;  4OU0 A;  2GIV A;  2RC4 A;  5DD8 A;  3HRU A;  1O3Q A;  2Z99 A;  4IRG A;  3RTR A;  1QQI A;  1Z9C A;  4U0V A;  2PMU A;  2R3S A;  1D3Y A;  1ZRF A;  1GXQ A;  1ON2 A;  4RB2 C;  3DKW A;  3F8B A;  3WU1 B;  1ZAO A;  1IXS B;  3U2R A;  3HOT A;  2PBI A;  2VC0 A;  3BJO A;  4AIH A;  4HDV A;  1IUY A;  3M1E A;  5ICF A;  1YLF A;  2ZJ2 A;  3BZ6 A;  3V7S A;  2BV6 A;  4CZZ A;  2HTJ A;  1MKM A;  1E17 A;  2LDU A;  5FD5 A;  2Y75 A;  2FOK A;  4L9J A;  2PFB A;  2UZK A;  4G94 A;  2PI0 A;  1BI0 A;  3HOS A;  1JXS A;  3KCC A;  4EJU A;  5LGT A;  2A61 A;  2YSR A;  4A0Z A;  2ADU A;  2ELH A;  2O0Y A;  2HYF A;  3GUD A;  2OQG A;  1UFM A;  5D6E A;  3LAJ A;  2ZME B;  2F5C A;  2MLG A;  4CDG A;  6PAX A;  4G9Y A;  1PP8 F;  2W85 A;  1R1T A;  2CO5 A;  2PQ8 A;  4LLN A;  2OA4 A;  1MZB A;  3I64 A;  4Y13 A;  2LSO A;  2GXG A;  5FB2 A;  1WSU A;  1F5T A;  1DPR A;  1BN5 A;  1LQ1 A;  3FXR A;  3L09 A;  2CSO A;  1XD7 A;  5JFR A;  5F64 A;  5LHG A;  3V7C A;  3BP8 A;  1XDU A;  4MNU A;  1R22 A;  1XDS A;  1KU2 A;  4RB0 A;  2L02 A;  1FWZ A;  3GFL A;  4HF1 A;  4RB3 C;  4A2U A;  1HXD A;  3B02 A;  4ASN A;  1W7P B;  4EVI A;  1USS A;  2Z5U A;  3F22 A;  2GA2 A;  5E1Z B;  1OYW A;  1KQ0 A;  1LJ9 A;  1TW2 A;  1J7K A;  5KK1 A;  1R1V A;  3NRV A;  1YW7 A;  3MQ0 A;  4D0P A;  4G6D A;  5LGU A;  4EMS A;  4BYY A;  2FNP A;  2MD5 A;  2DLL A;  5IT3 A;  1HKT A;  3C7J A;  3L7W A;  3R60 A;  3CO6 C;  3V8J A;  2L4M A;  2HOE A;  3SFZ A;  4YFN F;  1RUO A;  3MEX A;  2JPB A;  3F8F A;  4P55 A;  1HW5 A;  2HGC A;  1U5T C;  3O2P E;  5HS8 A;  3CUQ B;  3J80 K;  2VOO A;  2QQA A;  4Y15 A;  1WWX A;  4AWX B;  1C0W A;  3E6D A;  3LA3 A;  1YW8 A;  5E1W A;  5F1R A;  4AIJ A;  2O8X A;  1IAW A;  4H0E A;  1RI7 A;  1KU9 A;  1J0R A;  4BH9 A;  4MEY F;  1PDN C;  3J81 K;  3MWM A;  5H20 A;  1XMA A;  1SD4 A;  4KFC A;  2MH2 A;  2XGX A;  2NYX A;  2VOP A;  1G6N A;  3FM3 A;  4NB5 A;  5D5U B;  1K6O A;  2XVC A;  1J2X A;  3LAP A;  2F5F A;  1BM9 A;  4HAM A;  3IL2 A;  1RUN A;  1X3U A;  4ZYG A;  3MZH A;  4ZZL A;  3D5L A;  2XKO A;  4EM0 B;  1F9N A;  5CVU A;  4KT5 C;  2VBY A;  3WTV C;  1MJ9 A;  3HIF A;  1ZHF A;  3WTU C;  1K78 B;  4ZH4 F;  1T38 A;  4ENM A;  2GAU A;  4XLP F;  1P6R A;  3ZMV A;  1R00 A;  3WE3 A;  4QLC U;  1B1B A;  3S2W A;  3GX4 X;  3QP5 A;  1S7A A;  1TQI A;  1FSH A;  5LBQ A;  4I02 A;  2GZW A;  4AVP A;  3DPT A;  3L9F A;  2HDC A;  3EYI A;  2V1U A;  5D6F A;  3W6K B;  2Z9O A;  1KA8 A;  1BI3 A;  4LK0 F;  3CJN A;  5HLI A;  4EQQ A;  4M9S A;  1J5Y A;  2ACJ A;  4IPA A;  1IN8 A;  3GF2 A;  3ABU A;  2A5Y B;  2IA1 A;  1CF7 B;  1R58 A;  4YG2 F;  2FA5 A;  4HV6 A;  1FBU A;  3ZQ7 A;  2UWM A;  3FHZ A;  1MJA A;  5LGN A;  2GWR A;  2QEN A;  3RPQ A;  2YR2 A;  3JSP A;  2XAS A;  5DD4 A;  4HX8 A;  3H3Z A;  1IN5 A;  1YO5 C;  3WTT C;  5BQT A;  3ISP A;  3F23 A;  3ZMS A;  3KLO A;  5ILS A;  3LWF A;  1IXR C;  1FNN A;  2EFN A;  3HRT A;  4U7B A;  2QYO A;  2OZ6 A;  2VE9 A;  2EFQ A;  2D1V A;  5BOX A;  1U78 A;  1B6A A;  3RKX A;  4LMY A;  1B9M A;  3L00 A;  1Z91 A;  2PJP A;  5DDG A;  4HX4 A;  1FBS A;  2IPQ X;  4FT8 A;  2M5W A;  3E5X A;  5FLX Z;  2FQ3 A;  1IRG A;  2Y0M A;  4TV7 A;  3NEU A;  4FX0 A;  3DPL C;  2OBP A;  3M8F A;  4UVB A;  2E7X A;  3G73 A;  2E1C A;  4P9U A;  2EA4 A;  4KYW A;  2DAO A;  1PP7 U;  3QAH A;  4BXU A;  2DK8 A;  4UUV A;  5D5W B;  5BPD A;  2M1B A;  2D2W A;  2NRA C;  1B59 A;  2FML A;  2W57 A;  1G3S A;  2M45 A;  3T5X A;  1ZLJ A;  1MGT A;  4LGW A;  4CGZ A;  1YYV A;  4MQ9 F;  5FD6 A;  2CWE A;  4Q4Z F;  3QPT A;  1UHW A;  3FF5 A;  4OIN F;  1XCB A;  2QZ8 A;  1QO0 D;  3WTZ A;  3COA C;  1KYZ A;  3V8K A;  3KP6 A;  1V3F A;  3IRR A;  4RAZ A;  2F5E A;  2HZT A;  4LK1 F;  2W24 A;  5DCM B;  1SD5 A;  1TQM A;  1S29 A;  3E3V A;  3JTH A;  3HUG A;  5E8I A;  2P4W A;  4JK1 X;  3BPV A;  3TOB A;  3GZ6 A;  3J7A O;  2GXB A;  5HDN A;  2D45 A;  2ISY A;  2DFI A;  1HW2 A;  3P9K A;  3GYH X;  2QBY B;  3GVA A;  1T39 A;  4CXF A;  4PGG A;  1HQC A;  1O57 A;  1K79 A;  4M71 A;  3REO A;  3C18 A;  3WTX C;  3WTY C;  1AWC A;  4XSX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...