4U88A

Structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
93
Chain Sequence
EQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DNA-Binding Domain of the Response Regulator SaeR from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus usa300-ismms1
molecule tags Dna binding protein
molecule keywords Transcriptional regulator SaeR
total genus 25
structure length 93
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u88A00
1FX7A 3F8FA 2QLZA 2ELHA 3HSRA 1U3EM 5IT3A 3R61A 2L01A 2XRNA 4F7ZA 3H3UA 1P4WA 3T0YA 3ZMSA 2OU2A 2M30A 5BPIA 1O7LA 5DYMA 4HF1A 3T5XA 3V4GA 1E2XA 3PQJA 2KIMA 2F5DA 3RYRA 5H6RA 5LRRA 2WWYA 4G7OF 4Y13A 3EUHA 3FF5A 2DBBA 3QU6A 2K4BA 2Q0OA 4L0ZB 1KYWA 2JT1A 3RKYA 1S7AA 3HOSA 2P6SA 1ZRCA 2M87A 3RKWA 1YS6A 2BE5F 5L3GA 1U5TB 2UXNA 3I59B 1OMIA 4FHTA 2O3FA 3BP8A 2QZ8A 4Y15A 4U7BA 3IWFA 4N9HA 5CJ9A 1RUNA 3NEUA 1ZRFA 4LK0F 2A69F 1D3YA 2P5LC 2BV6A 1LDKB 3CUQB 1XMAA 4LG0A 2ESHA 5BMZA 4OOIA 2OD5A 4LLNA 1I1SA 4I0BA 4G94A 2P8TA 1KU9A 2GAUA 3ECHA 1XCVA 2O6GE 3QRFF 1R5HA 1R58A 3SHFA 3WTVC 4B09A 1R7JA 3B73A 4YFNF 4KICA 5HS9A 3HIFA 4HF2A 2EA2A 4LB6B 2DQRA 3SFZA 5E1XA 4UNOA 1Z6TA 4EJVA 1UCRA 3BWGA 1U2WA 3IL2A 4UXNA 4ETSA 1HBXG 3R0JA 2VE8A 2XKPA 1I27A 1SMYF 4YIIA 2LSOA 4HX7A 2VOOA 1CF7B 3KZZA 4WXCA 3GEZA 2O61A 4XRFA 2P6TA 3GXOA 3T8TA 3BPXA 1KU7A 1KQ8A 5D6EA 3QOPA 5ILVA 2TDXA 1J5YA 3F6OA 2IA1A 1EH6A 2OZ6A 4U88A 4ZZDA 3V8LA 5L3DA 5JI6A 1TLHB 3L7WA 1K79A 2VN2A 2DW4A 3IRQA 2FBHA 2GA2A 1IXRC 1V4RA 4BQAA 5ERIA 1SD6A 3WTTC 1B4AA 1U5TA 4OIOF 4HV6A 4S05A 5HLGA 1ZH5A 3QAHA 3VOEA 2FF4A 4XBFA 4LG0B 5ED4A 1U78A 1GXQA 2PFBA 2E1CA 2D2WA 1D8JA 3F72A 5E17F 1J75A 4BH9A 5K5OA 4B8XA 2YU3A 4G9YA 2K27A 3GFIA 1T98A 3BJOA 3D5LA 3MAJA 2VONA 4Y17A 4HW0A 3ERED 1AOYA 4MQ9F 1IN4A 3WTWC 3PQKA 3JTGA 2VBXA 3QU3A 3HOTA 2FMLA 4CHUA 4BAYA 5E20A 1Z1DA 2M5WA 2ZNYA 3H3ZA 2BBYA 3ZMVA 4KN4X 2F2EA 3RPUA 1SFXA 5AONA 5IT9K 1VTNC 3E6BA 1JE8A 1LEBA 2MA3A 4A12A 2A68F 4HYEA 3CLOA 2EFNA 4HLXA 2NNNA 2H27A 2QQBA 4MNUA 2PQ8A 3ZN1A 3M8EA 3ZMTA 3BY6A 4RB2C 1U8RA 5FD6A 1T2KA 4HOBA 3TGNA 4MEXF 1IN5A 2HQNA 2RV8A 2P5KA 1USSA 2JZYA 3L9FA 3E6DA 4OMYA 1JHHA 1YO5C 2HQRA 1P4XA 1WSUA 2HDCA 1EH8A 3HTUA 3REOA 4FX4A 4HA8A 1F5TA 1Z91A 1T6SA 5ICCA 1RZ4A 3VB2A 2KJBA 5HDKA 4ESBA 2PBIA 1FP2A 3I4PA 3WU1B 2LNBA 2W85A 1BI3A 3QP6A 5ILUA 2UZKA 3CO6C 3F6VA 4KN7X 3GFMA 1PUEE 4HAMA 3EQLF 3HHHA 4IXAA 2DO7A 2FXAA 2H09A 3F23A 1XMKA 4HZFA 5D5XB 3LQQA 1D5VA 6PAXA 2L4AA 2ZXJA 3K9TA 1R00A 5D5UB 2OQGA 1XDUA 4EJOA 2ETHA 2IJLA 2RN7A 2QYOA 4IJAA 2G7UA 1KYZA 5HDNA 1O3TA 4R1HA 1RI7A 4OIRF 4PGGA 3GLXA 3LA3A 2COMA 2GIVA 5A2QZ 2C6YA 1YW8A 2CWEA 5DCMA 1ZRDA 3B02A 3TDUC 3LSTA 3TO7A 4BYYA 4RGSA 1ZHFA 1U6GA 1XGMA 3FMSA 3TOBA 4EJWA 4XLPF 2IRFG 2PEXA 5H20A 1LDDA 2EB7A 2Z3YA 3HRMA 4IVNA 2CGPA 2WC2A 1XGNA 5D6FA 5BQTA 4KT5C 3ROUA 1KU3A 4UV8A 4FT8A 1HW2A 2L4MA 4HDUA 1BBYA 1BC8C 3ZP5A 1QGPA 4PGHA 1TW2A 2AS5F 4L9JA 2IVMA 4M72A 5FLXK 1W7PB 3P7NA 5KK1A 3M1EA 3KP7A 1DDNA 2RNJA 2QBYA 1P92A 3MWMA 1TW3A 2X4HA 4HV5A 5J8FA 2IW5A 1SFEA 4ZYEA 1G3YA 1LVAA 1I5ZA 4P5OA 1KU2A 3MZYA 4R79A 3C3WA 1YQAA 1FYLA 1RUOA 4HQMA 5CVIA 2XAFA 4LFUA 2OAZA 3RJPA 5F1RA 1S8NA 1F4KA 2FRHA 4UV9A 4EJUA 2ZCWA 1ZYRF 1XB4A 2YX4A 2EWNA 1DUXC 4N0BA 3RKXA 4G8XA 1WI9A 4MTEA 1MKMA 3CTAA 4A0ZA 3QPTA 5H6QA 3RIRA 4ENNA 4MEYF 1MGTA 1MDMB 3SZPA 3F8NA 5DCFA 5CVVA 2L3DA 1TQMA 4UVBA 5LEKA 2YR2A 1IZ1A 2CQKA 3GZ6A 2ZJ2A 2G7HA 2H6CA 4WX9A 3WGIA 2UXXA 4PDKA 2ZFWA 4U0YA 2D1HA 5J8CA 3J81Z 1H9TA 4M6YA 2R3SA 3N4MA 2VE9A 1I6XA 2VBWA 2JPBA 2PN6A 2PI0A 2MLKA 3K0LA 3VODA 4OMZA 3WTYC 3E6CC 2CW0F 4BHCA 5K5RA 1R22A 1H0MA 2XIGA 3GFJA 4RB1A 4NHJA 1BI2A 2XVCA 4IF4A 2A3SA 3Q5FA 5DUKA 3R4KA 4GXOA 1LNWA 4RB0A 5AIPA 2MC3A 2XUBA 1EH7A 3RDIA 4L9TA 3TDZC 4AVPA 4UVAA 3L2CA 4A6DA 1HQCA 1A04A 1ZLKA 3FM5A 1O3SA 1ZGAA 1FWZA 2MBFA 1LDJA 4PCQA 1PP8F 3L09A 1XDSA 2EFWA 5CVJA 1BI0A 3ZMDA 3LA2A 4Z2YA 3EYYA 2DK5A 5CYVA 4GYGA 4KMFA 4H0EA 1YS7A 1UFMA 5HDGA 3KEQA 1LEAA 4OINF 3DEUA 3DF8A 2DU9A 2X0LA 4BXUA 1DPUA 2EJRA 4RAYA 3FWEA 1SD4A 4Q5SF 2GWRA 3I64A 4ESFA 2RKHA 5CVRA 3KP5A 4LD5A 2STTA 2FA5A 5DDGA 3MFKA 2V1UA 1BN5A 1R23A 3DKWA 4EGZA 3DP7A 4AIJA 3IC7A 3HRUA 3JAMK 2FEZA 3E5XA 1BOAA 1XSVA 4L9VA 1KQ0A 2DPDA 2QBYB 2FOKA 3LQRA 2V1XA 1MJBA 2E1NA 1T0FA 4YFXF 2VT3A 1XCBA 1F9NA 3F8BA 2EV6A 1FNNA 2PMUA 3O3KA 2A07F 4IRHA 4HQEA 4GO1A 2VOPA 2B0LA 4IHSA 3AAFA 3MCZA 1ZG1A 4GYIA 3JW4A 2GQQA 1V3FA 3HRSA 3BOQA 1ZARA 2OBPA 2NRAC 2FU4A 5D4RA 3WTSC 5DEQA 2W84A 2YX7A 1HKSA 1Z9CA 4EM2A 4HX8A 4UVCA 3RI4A 3E5QA 1LJ9A 2KRFA 1QZYA 3U2RA 2GXGA 1FOKA 2HTSA 4CXFA 3M7GA 4KMUX 2QENA 4G6QA 4M71A 3RPQA 3GFLA 3IWZA 4WXHA 3SZTA 3NQOA 1CF7A 5HOOA 3BPVA 1STZA 5LHIA 1ON1A 4I09A 4L5IA 5LBQA 1FSEA 4EM1A 3K1PA 1TBXA 2VBYA 4EQQA 1GXPA 3JSPA 2V1DA 3CUQC 4YG2F 3JTHA 3I54A 1IW7F 2O0YA 4A5NA 4FX0A 1FC3A 1PDNC 2DFIA 3M9AA 2HWVA 3F3XA 4A6EA 3ABTA 2XHKA 2IPQX 1XGSA 2HGCA 2D45A 3HTSB 3GO5A 1XN7A 5CVUA 1FPQA 5HLHA 5LHHA 1K7AA 1BC7C 4CZZA 3ECOA 1UB9A 5HS7A 3R60A 4N9IA 3TKYA 2XAHA 3KE2A 1NHAA 2RGVA 5ICFA 3KCCA 2L02A 3E5UA 2HR3A 3F21A 1FT9A 2ESNA 2FSWA 1B9MA 3CJNA 3FZVA 3J81K 2MH9A 3TOAA 1O3RA 4ENMA 4L18B 1FP1D 1IN6A 5AIQA 2XAQA 1IUYA 5TJJA 4MGRA 4RAZA 4O3MA 2KKOA 3TO6A 4AD9A 3S2WA 3J80Z 2EFQA 3E6MA 3WGHA 3ZQ7A 4M73A 4M74A 2XV4S 3FHZA 2PJPA 4HDVA 5KVRA 5JHUA 3DFGA 1G3WA 4U0VA 3IKTA 4P55A 2ISZA 4HF0A 4LMYA 2JPCA 3O2PE 3LWFA 4ZZLA 3VEPA 2Z5UA 4CICA 1WWXA 4BHBA 1BI1A 5L3BA 3GX4X 3EETA 1B1BA 2XGXA 2LDUA 2HYFA 3QP5A 2ZO4A 1Z05A 2ACJA 1UHWA 1Y0UA 5CLSA 5FB2A 1S3JA 2GA1A 4QLCU 2P7CB 4P96A 2J5PA 4HLYA 5D5VB 2UWMA 3VFZA 4IRIA 3E3VA 1ZLJA 1R1VA 5JVTA 1P2FA 1JGSA 3FM3A 4A0XA 1QNTA 2LF7A 3BJ6A 3Q9SA 1K78B 3DPTA 2ADUA 1Q1HA 2CO5A 4LLLA 2NNYA 2DQLA 2F5CA 1YFHA 3WG9A 1QO0D 1YG2A 3CUOA 3QPHA 3EYIA 3IHUA 5D5WB 3KP2A 2JRTA 3LAPA 1Z6RA 1RIOH 3SXYA 3K1NA 3T8RA 3KZYA 3V7CA 2RQPA 4LK1F 1F1ZA 4ZYHA 1GHCA 2DLLA 1DPRA 1YLFA 1U5TC 3ELKA 1WRJA 2XASA 1MD0A 2WTEA 1ZG3A 2BGCA 1TQIA 4KDPA 1HKQA 2KIUA 4OIPF 2Z33A 4KIBA 3LAJA 1ONVA 3W6KB 1R1TA 4I2OA 4AIKA 1KGSA 4OIQF 1TQPA 2D1VA 1FLIA 5L3FA 1J7KA 4M9SA 1ZREA 2QVOA 1D8KA 4AWXB 2Q2EA 1OKRA 3HSFA 5F6FA 1P4AA 2V6CA 1B9NA 2DK8A 1T39A 2ZMEA 2Y48A 1TNSA 2IA2A 1YYVA 3ZMZA 2M1BA 3BZ6A 4PZJA 3F8MA 3DV8A 1CGPA 5JR3A 3TQNA 2VBZA 4MQVA 2O03A 2ZMEB 4RGXA 3GF2A 3J7AO 5E1WA 1MJ9A 1IXSB 1S6LA 3COAC 2FQ3A 3FMQA 5LHGA 1SD7A 4RGUA 2CYYA 5JFRA 2QUFA 2HEOA 2LF8A 1XGOA 1BJAA 3L00A 4I7HA 3KFWX 1IXCA 4YIFA 2G9WA 1LQ1A 2MD5A 4OU0A 4ON0A 4IPAA 2EK5A 1MJAA 4O5VA 4WWCA 5D8LB 2VT2A 3R0AA 3P9KA 1OYWA 2RVCA 4HX4A 1W5SA 2V9VA 5TRDA 4M6XA 3LA7A 3G3ZA 2F5EA 2W57A 1XD7A 2QWWA 2VXZA 1SAXA 1G4DA 2HZTA 3ABUA 3WTUC 2JSCA 1ODDA 3JSOA 3GVAA 4WF2A 3Q9VA 4ESJA 3WTXC 3K69A 3IRRA 5HVQC 5ICGA 4NB5A 4TV7A 2XAGA 3SQNA 3T1BA 5E18F 2OQRA 1SFUA 4EV0A 1OPCA 2ZBKA 4ENKA 1G3SA 1W7PD 3HYIA 2A6HF 2CSOA 4S04A 3I53A 2EFPA 2EFOA 1AWCA 1P6RA 4O6JA 4CO8A 4Q4ZF 1TTYA 3R6SA 4L5JA 2DTRA 2HKXA 3DQVC 2HFHA 2M8EA 3ZMUA 5LLQA 2XKOA 1OR7A 3MEXA 2GZWA 1UHMA 1QZZA 2WV0A 3GW2A 3GYHX 4BNCA 2RC4A 5LRSA 3WTZA 1IRFA 4WK8F 2FNPA 3FXQA 2HOEA 4JK1X 2BYVE 3J80K 4XSXF 3WGGA 3HHGA 2P7VB 2AXLA 4QWQA 5LGTA 2GXBA 1H9GA 1XSDA 3O6BB 4I02A 3RYPA 2E7XA 2CG4A 3OV8A 2A61A 4RS8A 4XLNF 1REPC 4JBAA 1EV7A 2DT5A 5FLXZ 4M9XA 2FNAA 3KEOA 2YSRA 3IKVA 1HW1A 1BM9A 1L3LA 5ICEA 2W25A 2KIFA 5DD8A 3DPLC 2NYXA 3W6JB 5FGMA 1IF1A 5L3EA 4EJTA 2J5OA 3WU0A 1B6AA 1HXDA 2Z9OA 1RNLA 2HYGD 5FO5A 2A6EF 3DXJF 4RB3C 5BPDA 1SD5A 4U0WA 3KP6A 4UHTA 1ZN2A 2DPUA 2M45A 4Q47A 5LGUA 4L9NA 4DNCA 4LB5A 4WCGA 3P9IA 3HUGA 4K2EA 3M8FA 2NAZA 2FBKA 4Q48A 1BIAA 3WODF 3CUQA 5HS8A 2H6BA 3K1MA 2IT0A 3C1DA 3I59A 2R7DA 1TNTA 2QQ9A 2XAJA 4KUMA 1J9IA 5E1ZB 1HW5A 1R36A 3KP3A 5FFXA 3FMRA 4G6DA 1HKTA 2ZNZA 3JAMZ 1QPMA 4KA4A 2EA4A 4LLGF 4U7DA 3KLNA 2K86A 5DV5A 1Z7UA 2ISYA 2KJCA 3CDHA 4GCVA 1WQ2A 2Z99A 1WKMA 4I01A 1IRGA 1YTYA 4A0YA 5FD5A 1J0RA 3I71A 2P4WA 5BS6A 3ML6A 2QM3A 3ZN0A 3D0SA 2BEOA 2A5YB 1O3QA 1FYMA 1MDMA 1W5TA 4P9FA 5DD4A 2F5FA 1IN7A 1HSTA 2VC1A 1OYYA 4D0PA 1G6NA 4G7HF 4ASNA 4P9UA 3EDPA 3HSEA 2HTJA 2K02A 4CGZA 2OA4A 2R7FA 2FMYA 2E7WA 4ZH4F 1FBUA 1FZPB 2EV0A 5EEHA 5HLIA 4KNYA 4ZYGA 4LJZF 2YPRA 4EVIA 1B59A 4ZYDA 1I1GA 2Q8KA 1O57A 1GVJA 1T38A 3U1DA 1BIBA 4XSZF 2PLYA 1OYIA 1W7PA 3OOPA 1JHFA 3C18A 1K6OA 4WXDA 3TO9A 4R8HA 2CFXA 4I0AA 2IP2A 4I98B 5F64A 1S29A 1R5GA 3NRVA 5LGNA 2HKOA 5E8GA 1O7FA 1USTA 1ZAOA 2IA0A 3RTRA 4EM0B 4L0YB 3BROA 1YIOA 3WE2A 2W24A 3HRTA 1FSHA 4A2UA 4MHGA 1IAWA 1KA8A 4A5MA 4BHPA 2QQAA 2VODA 3KP4A 2V79A 2XROA 2RDPA 4EGYA 1X3UA 3GWZA 3CO7C 3I5UA 5K1YA 1PP7U 2Y75A 4M9ZA 1ZG5A 4UUVA 4AIHA 2PMHA 4MTDA 4IHTA 2FE3A 1ON2A 1K78A 1ULYA 3MZHA 3C7JA 4EMSA 5DUIA 4DQ2A 3FX3A 1E17A 1L0OC 3F22A 3FXRA 2MLGA 2H94A 3PFIA 1FY7A 2JTVA 2K4JA 5D4SA 3P9CA 2ZKZA 1DP7P 1SMTA 4KFCA 2O8XA 1J2XA 5LEJA 3ZPLA 3ISPA 2P5VA 1FYKA 2DI3A 5D8KB 4YFKF 5E8IA 4NQWA 3WE3A 2LKPA 1IN8A 3H92A 1R1UA 4IRGA 3GZ5A 1YW7A 4JQFA 3FXUA 1MZBA 1J59A 3N97A 2K7LA 4GGGA 1ZGJA 3U9GA 3I0TA 1YW9A 1HSJA 3BDDA 4ENJA 5A2QK 4G7ZF 2L54A 5DCMB 3ULQB 1W4MA 5K5QA 4LGWA 5J6XA 4CDGA 3G73A 1LB2A 3KETA 4HBLA 3MQ0A 5EEGA 3BJAA 3K2ZA 1FBSA 2OZUA 4KYWA 2Y0MA 4KIFA 3KLOA 4RGRA 4E70A 4CYDA 5IT9Z 5BOXA 3I58A 5L3CA 3V7SA 1S7OA 1XSXA 1KQ9A 3F8CA 5FFZA 3LFKA 2MH2A 5ILSA 2VC0A 1C0WA 1JXSA 3V8JA 2FBIA 1QQIA 1QBJA 2PG4A 3V7RA 2HS5A 2NS0A 1FBQA 2EV5A 4KIGA 3V8KA 2DAOA 2STWA 3E97A 1G3TA 3GUDA
chains in the Genus database with same CATH superfamily
1FX7A 3F8FA 2QLZA 2ELHA 3ZQHA 3HSRA 1U3EM 3SDGA 5F0CA 4RA2A 5HNFA 4M3BA 1MSEC 5IT3A 3H9QA 4M6VA 3R61A 2L01A 2XRNA 2OTLI 4F7ZA 2HU9A 5EGOA 3H3UA 4BE0A 2JA6J 1P4WA 2XF7A 3WHBA 4XN3A 2X85A 1YJ9I 3T0YA 3ZMSA 3W6VA 2OU2A 3SDBA 2M30A 5BPIA 1DGWY 1O7LA 1OR7C 2LR8A 2V26A 5DYMA 4HF1A 2XDVA 3G4SI 3T5XA 3V4GA 1E2XA 1O4XA 3KYCB 3PQJA 1FOYA 1QZEA 3A0HC 2KIMA 2W4SA 4HNTA 4LG3A 2F5DA 3RYRA 5H6RA 3CC2I 3OR2C 5LRRA 2WWYA 2E19A 4G7OF 2Z1DA 4Y13A 3EUHA 3FF5A 2DBBA 3QU6A 2K4BA 2Q0OA 1Z3YA 4L0ZB 4DYQA 2PJRA 1KYWA 2JT1A 4G12A 1S7AA 3RKYA 2P6SA 3CDLA 3HOSA 2M87A 3SJMA 1ZRCA 1F43A 2XGEA 3RKWA 2E1MC 1OCPA 1YS6A 2BE5F 3K4LA 4MIMA 1U5TB 2UXNA 3I59B 1OMIA 5L3GA 4FHTA 1D1CA 2L7KA 2O3FA 1FMWA 3A0BC 4IHWA 3BP8A 2QZ8A 3S32A 3Q0UA 1LPQA 5GTHC 4Y15A 4U7BA 5EZHA 3HPGA 4XRSA 3RPUD 4QSHA 5FKNA 3H0DA 1AU7A 1HA8A 3IWFA 4N9HA 5CJ9A 1RUNA 3NEUA 4LK0F 1ZRFA 2A69F 1D3YA 2P5LC 3JREA 5EJCA 2BV6A 5C4JJ 1LDKB 3CUQB 1XMAA 4LG0A 3QWLA 3RKQA 2ESHA 4I76A 3K70C 4CCJA 5BMZA 4BY1J 2ECBA 4OOIA 2OD5A 4LLNA 1I1SA 4I0BA 2ECCA 1RC9A 4G94A 2P8TA 1KU9A 3ESWB 2GAUA 4DW6A 2PMZN 3RSNA 1ZR2A 3ECHA 3EPZA 1XCVA 3CQZJ 2L5QA 2O6GE 3QRFF 1R5HA 1R58A 4C9YA 4ZDLA 3SHFA 3WTVC 2JUGA 3FBNB 4B09A 3CMYA 4B47A 1R7JA 3OYJA 2CU7A 5K7ZA 1WGXA 3B73A 4KICA 3ZOBA 3QYBA 1MBGA 4YFNF 3BLYA 5HS9A 3QYEA 5IYCJ 3HC7A 4XLEA 3HIFA 4HF2A 4A3JJ 2EA2A 4LB6B 2DQRA 3BTIA 3K10A 3SFZA 4IO9F 2GXAA 5E1XA 4UNOA 3LSPA 2R7VA 1Z6TA 4XKBA 4EJVA 1UCRA 3BWGA 2LK2A 1BW6A 1U2WA 3IL2A 4UXNA 4Y3OA 3ABMH 4ETSA 1HF0A 1K4TA 1HBXG 1U8BA 2ZXIA 1KZHA 4D7MA 4A3EJ 3R0JA 2VE8A 3CMMA 2L2OA 1V5FA 2CUEA 1WJ5A 3PM1A 4EATA 2KDZA 4IHYA 2XKPA 4E4HA 1I27A 3M07A 1SMYF 4YIIA 3G1OA 1TWHJ 2LSOA 4HX7A 4I99C 2VOOA 1CF7B 2BXZA 3KZZA 4WXCA 1HDPA 3GEZA 3OL4A 2O61A 1E0EA 2BHYA 4XRFA 1B8IA 2P6TA 3GXOA 1PJRA 3OYKA 3PO3J 3T8TA 3BPXA 1KU7A 1X3ZB 2XF5A 5IPAA 1KQ8A 3PNYA 5D6EA 3QOPA 1BA5A 5ILVA 4DZPA 1JUMA 2TDXA 2F5VA 3JRFA 1J5YA 3F6OA 2IA1A 1EH6A 5FKOA 2OZ6A 4PFOA 4U88A 3OS0A 4ABZA 5GAEJ 2O8KA 2VQGA 3PUBA 4MFEA 4ZZDA 1D0YA 3V8LA 5L3DA 3FXMA 5F0FA 5JI6A 3E7LA 1TLHB 3UNGC 3L7WA 1K79A 2VN2A 2EH3A 1FTZA 4E7KA 2DW4A 3IRQA 1QHHD 1R49A 4BJTA 2FBHA 1ZGWA 3GTKJ 4XONA 2GA2A 3I4NJ 1IXRC 2CV2A 1V4RA 4BQAA 5ERIA 2LH9A 1MBEA 3AG1H 4JOMA 1SD6A 3WTTC 3M1CA 3CCUI 3MKYB 2HQ5A 2DOEA 1B4AA 1U5TA 4OIOF 3A01A 4HV6A 4BL0B 5J4YA 4S05A 1IV6A 5HLGA 1ZH5A 2ZC2A 3QAHA 3VOEA 2FF4A 4XBFA 4RM2A 4LG0B 5ED4A 1W0TA 1GXQA 1U78A 2PFBA 2E1CA 2Y31A 3MMYB 2D2WA 4IEJA 1D8JA 3F72A 5E17F 1J75A 4BH9A 4A3KJ 5K5OA 4B8XA 2YU3A 1ACIA 1IC8A 1VQNI 1Y56A 1ZK8A 4G9YA 2FOWA 1VQMI 1ETYA 2K27A 4RBOA 3GFIA 1POGA 1T98A 4Y33A 4PJMA 3BJOA 4V2GA 3D5LA 3MAJA 2VONA 4Y17A 4HW0A 3ERED 1AOYA 1Y8QB 4MQ9F 2VIXA 1IN4A 2E1OA 1Q1VA 3WTWC 2IGKA 3PQKA 2XB0X 4A3BJ 3JTGA 2VBXA 3QU3A 4DJAA 4D1QA 3HOTA 2FMLA 4BEHB 4FTHA 3K4MA 4CCLA 2K9NA 4CHUA 2LRDA 3MKLA 2UV1A 4BAYA 5E20A 1Z1DA 2BW3A 3BTJA 3CCQI 2M5WA 3UKGA 1R4NB 3H3ZA 1F36A 2BBYA 1Y1VJ 2ZNYA 3HEFA 3ZMVA 4KN4X 1JUPA 2F2EA 4XLAA 3E1SA 3RPUA 3A03A 3GTLJ 1SFXA 1Z77A 2VUMJ 4BY7J 3DKXA 3ZCOA 3S1MJ 2JSPA 5AONA 2KLOA 5IT9K 1VTNC 1S72I 3E6BA 2QKLB 1JE8A 3N05A 1LEBA 2MA3A 4A12A 2A68F 4HYEA 3CLOA 2EFNA 2VB6A 3KPHA 1W0UA 4HLXA 4IZZA 3K4NA 2NNNA 1IGNA 2H27A 2QQBA 2A05A 4MNUA 2PQ8A 5IOYA 3ZN1A 2VQCA 3M8EA 3ZMTA 3DTIA 4BU2A 1VQ7I 3BY6A 4RB2C 1U8RA 1I39A 5CKTA 2V6EA 4C2TA 5F1JA 1GDTA 5FD6A 2X1EA 1IUFA 4ZYAA 1T2KA 1MH3A 4HOBA 3TGNA 4LITA 4IQJA 2QQ8A 4MEXF 1YE9A 4ZDPA 3CC7I 1IN5A 2HQNA 2RV8A 1FOWA 1LE8B 2P5KA 1USSA 2JZYA 3OYIA 3FKIJ 2LFBA 3L9FA 2RAEA 3E6DA 1BJZA 1NG6A 3GTMJ 4OMYA 1JHHA 2ZMEC 1YO5C 2NVQJ 3V42A 2HQRA 4B3AA 2DA1A 2LG4A 3ONQA 1P4XA 1DP3A 2R7OA 2MD0A 1WSUA 4E7HA 2HDCA 4IOAF 1D0XA 1EH8A 4HSTA 2E60A 3HTUA 3REOA 4FX4A 1A6QA 5M3MJ 3ZGKA 4FQGA 2DN0A 2R7SA 4HA8A 1F5TA 1Z91A 3ASOH 4XQFA 1T6SA 5ICCA 1EF4A 3PIPF 3RZOJ 3MD2A 2O9LA 1RZ4A 3OYDA 3E0JB 3VB2A 1Z7LA 2KJBA 5HDKA 5KHDA 4ESBA 2PBIA 2XGCA 1FP2A 1LFPA 4HEA2 3I4PA 2L9VA 3WU1B 2LNBA 4C2UA 2W85A 1BI3A 2X1DA 3QP6A 4D5CA 5ILUA 2UZKA 3CO6C 4FETA 4PFPA 3F6VA 4V2FA 1OQYA 4NNJA 4UY8I 1Y0NA 4KN7X 3OY9A 3VPRA 3GFMA 4H4KC 4UUSA 1BL0A 5E3NA 1EA3A 3D5RC 1PUEE 4HAMA 3EQLF 3HHHA 4IXAA 3OS1A 3GTQJ 1IO2A 2BY0A 2GM4A 2DO7A 2FXAA 2HOTA 2FX0A 2H09A 4UUSB 3F23A 2VXDA 1XMKA 4HZFA 5D5XB 3LQQA 1D5VA 6PAXA 2KPMA 1RKTA 1BR2A 2OCEA 1SAUA 1U9OA 1NTCA 2L4AA 2ZXJA 3K9TA 4NC8A 1LE8A 1R00A 3MN2A 5D5UB 2OQGA 1NK2P 1YRNB 1XDUA 3ZQFA 4EJOA 3S15J 2QCOA 2ETHA 2IJLA 3VYSB 1QPIA 3JRBA 2RN7A 2QYOA 4RLQA 4PK4A 4IJAA 2G7UA 1KYZA 5HDNA 1O3TA 4R1HA 1HLVA 1Z21A 1Y1WJ 1RI7A 3FXKA 4OIRF 4PGGA 2MABA 3GLXA 3LA3A 2COMA 2CQXA 4XLHA 4PSWA 2GIVA 5A2QZ 3BR1A 3D1NI 2C6YA 1YW8A 4N4OB 2CWEA 5DCMA 2H8WA 5GAHJ 1TWGJ 1ZRDA 3VYRB 3B02A 5EEAA 3TDUC 1JKOC 3BCAA 3CC4I 3CJQB 3LSTA 3TO7A 4BYYA 2BVMA 4RGSA 1ZHFA 5FRMA 1U6GA 1XGMA 3FMSA 3TOBA 4EJWA 4XLPF 2IRFG 2I10A 2PEXA 1IRZA 5H20A 2CUFA 1RESA 1LDDA 2EB7A 1VNDA 2Z3YA 3HRMA 2ICWG 4IVNA 2CGPA 2WC2A 2EZLA 1XGNA 5D6FA 1OISA 1DQUA 5BQTA 2I8DA 3S8PA 1UHSA 4KT5C 1I6HJ 4M3GA 3ROUA 1KU3A 4UV8A 4X1EA 1H8AC 4FT8A 5LD2C 1JGGA 1G59A 1EKEA 1HW2A 4W1UA 2L4MA 2XB5A 2V9PA 3I3LA 3BQZA 4HDUA 1BBYA 2R5YB 4YRVA 1BC8C 1T56A 3ZP5A 4BE2A 2QSHX 2R93J 4NQWB 1QGPA 4PGHA 4XNFA 2OTJI 2NOGA 4XRMA 1TW2A 2Q2EB 4IHXA 2AS5F 3G2BA 1X2MA 5K7FA 4L9JA 2IVMA 3GLLA 3CF5F 4DOZA 4B43A 4XL9A 5M5XJ 1SEUA 4M72A 3DU5A 1W7PB 2Y0SN 3H35A 3P7NA 3OYEA 5FLXK 2AQEA 4A3IJ 5KK1A 2NXNB 3DBRB 3M1EA 3NAUA 4FE7A 3HM5A 2WBMA 3KP7A 1JJ8C 1DDNA 1WJEA 2RNJA 1K83J 5M3FJ 2QBYA 1P92A 4P1WA 3MWMA 1TW3A 3ERMA 2X4HA 4HV5A 5J8FA 2IW5A 1SFEA 4ZYEA 1G3YA 1LVAA 1I5ZA 3BR3A 4P5OA 1KU2A 3MZYA 4R79A 3F9KA 1ETXA 3C3WA 1YQAA 3C2HA 1FYLA 1RUOA 2FUG2 3M3YJ 2F4IA 1GLNA 4HQMA 5IP9J 3G6EI 3AG4H 2UUZA 2XAFA 2OAZA 4LFUA 5CVIA 3RJPA 4Y52J 3FXLA 3FK6A 3H5NA 3DKYA 5F1RA 1JI8A 3OYLA 4FE4A 5J1YA 1S8NA 1F4KA 3G1LA 2IS6A 3OYHA 3LSMA 4A69C 2FRHA 4UV9A 4EJUA 1LKXA 2DXIA 2ZCWA 1I50J 1ORKA 4Y4RA 1ZYRF 2W1OA 1XB4A 1WH7A 2YX4A 5FKLA 2EWNA 1DUXC 4N0BA 3RKXA 3ZRGA 2P81A 4G8XA 1WI9A 4MTEA 1JKRC 2L0KA 3CD6I 1MKMA 2DFEA 1MNEA 2A6TA 3CTAA 3LSJA 3RZDJ 4QPOA 1S7EA 4A0ZA 2DMUA 2WY7Q 2FQ4A 1ETQA 2Y9YA 3QPTA 5H6QA 3RIRA 2GIZA 4ENNA 4MEYF 3GTJJ 2VL8A 1MGTA 5B3SH 1MDMB 4QIWN 1VF9A 1UELB 3SZPA 3F8NA 3GCMA 5DCFA 5CVVA 1W36C 4MO7A 1T33A 2L3DA 1TQMA 4UVBA 2CQ7A 5LEKA 5J47A 2HPMA 2KP6A 2YR2A 1IZ1A 4PJJA 2CQKA 2M4GA 3CP8A 5IY5H 1E3PA 3GZ6A 5DS9A 2EIMH 2ZJ2A 2G7HA 2FD5A 2H6CA 4WX9A 3FIWA 2HYJA 2Q1ZB 2UXXA 3BTLA 3WGIA 3K2AA 3OR1C 4BUPA 1B72A 4PDKA 4IHVA 3MVPA 2ZFWA 3K70D 2TRTA 1G8XA 3B6AA 1TL8A 3OMYA 4U0YA 2D1HA 2DOFA 5J8CA 2XPUA 3J81Z 1H9TA 4M6YA 3Q0WA 4BQQA 1NH3A 3X2QH 1GT0C 1ERDA 2QGUA 1W5CC 2R3SA 3N4MA 2VE9A 1I6XA 2BOLA 3OSFA 2VBWA 2JPBA 2PN6A 1B8IB 2PI0A 4BXFA 2MLKA 3K0LA 2KZGA 1VQLI 3VODA 4FASD 1MW7A 4C2MJ 3CCJI 4OMZA 3WTYC 1VFCA 2VKDA 3E6CC 4ZC3A 2CW0F 4BHCA 3H9JA 5K5RA 1RR8C 2K85A 2DTZA 1R22A 3WU2C 1X19A 1H0MA 2XIGA 3A02A 3GFJA 4RB1A 3OYNA 4NHJA 1BI2A 2M7AA 2QKMB 3TL4X 2XVCA 4IF4A 2LKSA 2MYSA 4ZTFA 2A3SA 3JRCA 3Q5FA 5DUKA 1AKHA 3R4KA 5E3LA 2IEKA 1S9HA 1LNWA 4GXOA 5J4VA 4RB0A 1FIAA 5AIPA 3IH2A 2MC3A 3GTOJ 2XUBA 1EH7A 3RDIA 3OSGA 3NARA 2BY1A 4JYKA 4L9TA 5HLTA 3TDZC 1JKQC 4L5EA 3SFIA 4AVPA 3JCUC 3IP4B 2DMPA 1W1WE 4UVAA 1IRXA 2HVQA 3L2CA 1OCOH 2ZFUA 1YRNA 2R92J 2DT6A 4A6DA 1V54H 2F4OB 1HQCA 4XKWA 1A04A 1MBKA 1ZLKA 3FM5A 1ETWA 5LFAA 1ZGAA 1D0ZA 1O3SA 1SFOJ 3SZGA 4XLCA 1FWZA 3LL7A 5FRNA 2MBFA 1LDJA 4UUTA 4PCQA 3ZQQA 1PP8F 3JRGA 2YS9A 3L09A 3QYFA 2N8GA 1XDSA 3GBGA 3A2KA 3S2HJ 4BEHA 2DFHA 2EFWA 4RAGA 5CVJA 2LYCA 5E79C 1BI0A 5IP7J 2DMNA 1OCCH 3ZMDA 2OJED 3LA2A 1RETA 3H3VK 4Z2YA 3H0GJ 3JRIA 4F3QA 3EYYA 2DK5A 3VDXA 5CYVA 1LVKA 5FJ8J 4GYGA 2E2HJ 2R5ZB 1OCTC 4KMFA 4H0EA 1YS7A 4RAFA 1UFMA 4I6ZA 2KL4A 5HDGA 1K61A 3KEQA 1Y8RB 3VSLA 1LEAA 1MH4A 2R7TA 2X48A 4OINF 3OIOA 3DEUA 3DF8A 4IKFA 2DU9A 2X0LA 3OYGA 2LC2A 4AYBA 2BHZA 4BXUA 1DPUA 2EJRA 1VQOI 4RAYA 3FWEA 1MMSA 2R7RA 1SD4A 4Q5SF 2GWRA 4MLOA 3I64A 4ESFA 5J1RA 1B72B 3OS2A 2RKHA 3CJRB 5CVRA 3KP5A 4LD5A 2STTA 5GTIC 2FA5A 1RRJA 5E3MA 4C3IJ 2R7UA 5DDGA 3ABLH 3HOWJ 3MFKA 1A5JA 2V1UA 3K7AJ 1BN5A 1TT0A 1R23A 2KT0A 3DKWA 5M5WJ 2IXSA 2X6WA 4EGZA 1A31A 4B4CA 2IAIA 3Q0VA 3DP7A 4AIJA 3IC7A 3HRUA 4B48A 3JAMK 3ASNH 1SANA 3JRDA 2FEZA 3E5XA 2ZJQF 4CCKA 1BOAA 2IGNA 2BXYA 2ELJA 2ZSHB 1XSVA 1JT6A 1Z3XA 4L9VA 1KQ0A 2DPDA 2QBYB 1GV2A 4X6AJ 3FISA 2FOKA 3LQRA 4BDZA 2V1XA 1MJBA 2E1NA 1T0FA 4YFXF 2VT3A 2CV0A 1XCBA 4RDUA 1QVTA 1F9NA 3F8BA 2BVLA 2EV6A 4HRIA 2ZXWH 1FNNA 1UJ8A 2X6XA 2PMUA 3O3KA 3B6CA 1UG2A 2A07F 4IRHA 4HQEA 4GO1A 2VOPA 2NVYJ 3CCMI 2B0LA 2M0MA 4DYRA 4IHSA 3AAFA 3MCZA 1ZG1A 2NS7A 4GYIA 3JW4A 4A3FJ 2GQQA 1V3FA 5GPCA 3HRSA 3BOQA 4CCNA 2DMTA 1RKWA 5M5YJ 1ZARA 2HVRA 2OBPA 2NRAC 4F93B 4IQ4A 1UG0A 1OFCX 2FU4A 5D4RA 2D5VA 2DA3A 2KISA 2E2JJ 3WTSC 3LSIA 5EGOB 5FROA 4JX5A 5DEQA 1XS9A 2W84A 2NVXJ 2EIJH 2YX7A 5EG0B 1HKSA 3LSRA 1VI0A 1Z9CA 2B63J 4EM2A 4HX8A 4UVCA 1BOBA 3RI4A 3E5QA 5J3LA 1LJ9A 2KZVA 1JTYA 2KRFA 1QZYA 3SEQA 3U2RA 2GXGA 1MNDA 3DWLE 1FOKA 1DGRM 4DIQA 2HTSA 4CXFA 3H5AA 4BQNA 3M7GA 4M3EA 4KMUX 2QENA 2HVSA 2QEXI 4G6QA 4M71A 2DA5A 1ZQ3P 3LMMA 1X3WB 2KFDA 2OCCH 3RPQA 3GFLA 5FKMA 4F91B 3VYUB 3IWZA 4GRIA 4WXHA 5EYRA 3SZTA 3NQOA 1SC7A 1CF7A 5HOOA 3BPVA 1STZA 1PYVA 5LHIA 2EINH 3H1CA 3KZIC 2R4GA 4NC7A 1NG7A 2QSFX 1ON1A 1VQ5I 4PJLA 4A3CJ 2Z2SB 1JUSA 1OCRH 4I09A 2LTPA 4L5IA 3AFHA 1YX5A 3QPLA 5LBQA 3LOCA 1FSEA 4EM1A 3K1PA 4G6TB 1TBXA 2VBYA 4EQQA 1GXPA 3JSPA 2V1DA 2JQ7A 3CUQC 4YG2F 2DYRH 3JTHA 2M0CA 3I54A 1IW7F 2O0YA 4A5NA 1HOMA 2OC6A 4FX0A 4XKVA 1FC3A 4RMNA 4EEFG 1PDNC 2DFIA 2OUMA 1X4OA 4XRSG 3M9AA 2HWVA 3AG2H 2XRLA 3C2BA 4KT6A 1KONA 3F3XA 4A6EA 3G1MA 3ABTA 1CQTA 4CYCB 2L9NA 2XHKA 2RNGA 2IPQX 5K7HA 3HDDA 1XGSA 2HGCA 5F08A 5C44J 2D45A 3HTSB 1MIJA 3GO5A 1XN7A 5CVUA 1FPQA 2DMQA 5HLHA 5LHHA 1K7AA 1BC7C 5KNLA 1PUFA 4CZZA 3ECOA 1UB9A 3HOZJ 3SYTA 4Y7NJ 5HS7A 3FKJA 1E3OC 1LFBA 1TP4A 3R60A 4N9IA 3TKYA 4ITVA 2M34A 2L7MP 3FXOA 2XAHA 3KE2A 1NHAA 2RGVA 5ICFA 2DODA 3KCCA 2R0QC 4DBRA 3S14J 2H1LA 2L02A 3KYLA 3S93A 1SVOA 3E5UA 1X1BA 5B66C 1PUFB 2JN6A 2HR3A 3I9V2 3F21A 1X1CA 1FT9A 5C4XJ 2ESNA 3BG7A 5KAIC 2EZKA 2FSWA 4CH7A 1B9MA 3CJNA 3CCLI 4XK4A 2WB1N 3FZVA 3H36A 1U9NA 2MH9A 4BBRJ 3J81K 3TOAA 1O3RA 4ENMA 4OAZA 4L18B 2AQFA 1FP1D 1IN6A 2LY9A 5AIQA 2XAQA 1IUYA 4XORA 5TJJA 4MGRA 4RAZA 2E34A 1D5YA 4O3MA 2KKOA 4XR6A 1TZLA 3TO6A 4AD9A 5J1UA 3S2WA 3J80Z 2EFQA 3E6MA 1X4PA 3WGHA 1MBFA 3CESA 3ZQIA 5GPAA 3ZQ7A 4M73A 4CZCA 4M74A 1YIJI 2XV4S 3FHZA 2AXTC 2VJJA 2M8GX 3OYAA 2PJPA 4HDVA 5KVRA 5JHUA 3DFGA 1G3WA 2G0EA 1ZELA 3J7AY 2QF7A 4U0VA 4P55A 3IKTA 4HG2A 2ISZA 2MW8A 2B7EA 1SVLA 4HF0A 4LMYA 2JPCA 3O2PE 3LWFA 4ZZLA 3SEZA 3VEPA 2Z5UA 1R4MB 4CICA 3FK7A 3NWTA 1X1PA 1WWXA 4BHBA 3CMEI 1AA7A 1BI1A 2E1MB 5L3BA 3HG9A 3GX4X 3EETA 1VQPI 1B1BA 2XGXA 2LDUA 4KITB 1QA6A 1QRYA 2X9DA 2HYFA 3EUHC 4A3DJ 4CCOA 4QTRA 3K4KA 2ZO4A 3QP5A 4V19K 3S16J 2L9SA 1H88C 2VASA 1Z05A 2ACJA 1UHWA 1Y0UA 5CLSA 2QSGX 2VJ5A 5FB2A 1TWAJ 2BY2A 1S3JA 4RM3A 2GA1A 1YX3A 4JP0A 4QLCU 2X6YA 2P7CB 4P96A 2J5PA 2DA2A 4HLYA 5D5VB 3ZQCA 3VFZA 2UWMA 3F0CA 4IRIA 2ME6A 3E3VA 2HI3A 3BG6A 4XLFA 2WAFA 3PNVA 1ZLJA 2WAQN 2F6CA 3DEWA 1R71A 1R1VA 5JVTA 2KQRA 1IV8A 1P2FA 1JGSA 2HXIA 3FM3A 4A0XA 2XF6A 2CUJA 1WJBA 2DA4A 4XN0A 1QNTA 2LF7A 3BJ6A 3Q9SA 1K78B 3DPTA 2ADUA 5J40A 3PIOF 4XMYA 4J19A 1MBJA 1GVDA 1Q1HA 2JVGA 2CO5A 4W97A 4LLLA 3QQAA 3AKZA 2DJIA 2NNYA 1DU6A 2DQLA 2F5CA 4BACA 2IS4A 1Z67A 1YFHA 2HPIA 1R9TJ 3WG9A 1QO0D 4XICA 1YG2A 4XIDA 2B9SA 3L1PA 4ZTJA 1RPWA 2DYSH 3IH4A 3CUOA 3QPHA 3EYIA 3A1YA 1XG1A 3IHUA 1UMQA 5D5WB 3KP2A 1P7JA 2XPWA 1QVUA 2TCTA 4NUBA 2JRTA 3LSHA 3LAPA 1ENHA 1Z6RA 2VI6A 1RIOH 3SXYA 5DTDA 3H5RA 3K1NA 2XPVA 3T8RA 2MGQA 3KZYA 3V7CA 2RQPA 4LK1F 2M4KA 4HSRA 1F1ZA 3BR2A 4BXXJ 2E35A 3IAS2 4ZYHA 2R5ZA 1IG7A 1GHCA 2DLLA 4UB8C 1DPRA 3PNTA 1YLFA 1U5TC 2ZJPF 1YI2I 3ELKA 1WRJA 2XASA 1MD0A 2WTEA 2E5NA 2LBFB 1ZG3A 1V5EA 4GDFA 1VQ6I 3HL2A 2BGCA 1WH5A 1TQIA 3I55I 1HKQA 4KDPA 2KIUA 1APLC 4OIPF 4BQOA 2KHMA 5FKKA 4MFDA 4BS9A 2Z33A 2Y0SA 3KIOA 4KIBA 3LAJA 1ONVA 2NOJB 1TC3C 2LBFA 3W6KB 1K4SA 1R1TA 3TEDA 3BTCA 4Z6YA 4I2OA 4AIKA 1KGSA 3HB9A 4OIQF 1TQPA 2VPLA 2D1VA 1FLIA 3DTEA 1QHGA 4U87A 4F92B 2WADA 2K9MA 5L3FA 1J7KA 2HDWA 3MZ8A 4M9SA 5HODA 4ANJA 2QVOA 1D8KA 1ZREA 3VWBA 4AWXB 2Q2EA 1OKRA 3HSFA 5F6FA 5F0HA 1P4AA 3S17J 2LOOA 2V6CA 1B9NA 3PSIA 2DK8A 1SVMA 1T39A 2ZMEA 3J7ZI 2Y48A 2MG4A 1TNSA 2IA2A 1YYVA 4D7NA 2DFFA 1ETVA 5IYDJ 2CRGA 3DU6A 3ZMZA 2R7XA 2P0WA 2M1BA 3W2WA 3BZKA 1P7IA 4JX6A 2V1NA 3BZ6A 4PZJA 3F8MA 3DV8A 3CCSI 1WFXA 1CGPA 5JR3A 3TQNA 2VBZA 4MQVA 3HOXJ 2O03A 2O5RA 2ZMEB 4C3HJ 4RGXA 3GF2A 3J7AO 5E1WA 1MJ9A 1IXSB 1S6LA 3COAC 4J00A 1I3AA 2FQ3A 4LIUA 3FMQA 5CQGA 1K6YA 2YUSA 2BZTA 5LHGA 2X6OA 1T95A 4RLFA 2F4MB 4IX7A 1SD7A 4RGUA 3C2GA 3TW7A 2CYYA 5TISC 9ANTA 5JFRA 1FMVA 2QUFA 2HEOA 2LF8A 4PUSA 1XGOA 2K5CA 2NVUB 1BJAA 4CUGA 3I4MJ 3A01B 1UAAA 4BGDA 3L00A 4I7HA 2K3PA 5JHFA 3KFWX 3PO2J 1IXCA 4YIFA 3IV5A 2XSDC 2G9WA 1LQ1A 2MD5A 4OU0A 1MMNA 4ON0A 2LMDA 4IPAA 2EK5A 3BG5A 2JRMA 5B5EC 5CPRB 1MJAA 3DBLB 4O5VA 4WWCA 5D8LB 2VT2A 3R0AA 2HOAA 4F55A 1D1AA 3P9KA 2MFZA 1OYWA 2RVCA 4HX4A 1QU3A 2W7NA 2RQQA 3HPHA 1W5SA 4D5FA 3BQYA 2V9VA 3J7YJ 4E6KG 2K9QA 1LUJB 5F04A 5TRDA 4M6XA 3LA7A 3G3ZA 2EZHA 5FLVA 2F5EA 1V5GA 4E7IA 3S1QJ 1BW5A 2W57A 2WV1A 1XD7A 2QWWA 2VXZA 4C3JJ 1SAXA 1G4DA 2HZTA 1WI3A 2WA0A 3ABUA 3WTUC 1GV5A 2JSCA 1T8IA 1FIPA 3TW6A 1ODDA 4BJ6C 5B1BH 3JSOA 3GVAA 1AHDP 4WF2A 3Q9VA 3L2WA 3HXLA 4ESJA 3WTXC 2JA8J 3K69A 2V9KA 3IRRA 2WB1A 5HVQC 5ICGA 4NB5A 4TV7A 2BW3B 2XAGA 3SQNA 3T1BA 4B3XA 5E18F 2OQRA 1SFUA 4A3GJ 4J01A 4EV0A 1OPCA 2WAEA 3W3CA 2ZBKA 4ENKA 1G3SA 1FTTA 1N75A 5BNGA 1W7PD 3HYIA 4C30A 1SFKA 2A6HF 2CSOA 4S04A 3I53A 3MKWB 3OL3A 2AO9A 3JR9A 2EFPA 3HOYJ 2EFOA 2JVHA 1AWCA 2K9SA 2Y2ZA 4FCYA 1P6RA 1A35A 4ZJZA 4O6JA 4CO8A 4Q4ZF 1TTYA 3R6SA 4L5JA 2CQNA 2DTRA 5DM6F 2HKXA 3DQVC 2HFHA 2M8EA 3ZMUA 3KEYA 5LLQA 2XKOA 1OR7A 3MEXA 1UHMA 2GZWA 1QZZA 2WV0A 4BKXA 1UZCA 3GW2A 3QOEA 3GYHX 3ABKH 4BNCA 2RC4A 3BG3A 4E7ZA 5LRSA 3WTZA 1IRFA 3TP3A 3G71I 4NC6A 4OWRB 2FNPA 4WK8F 3DBHB 3FXQA 2ZSIB 2HOEA 1TWFJ 2JWTA 4JK1X 2BYVE 4DBQA 3J80K 2VLAA 4XSXF 4QPQA 1XTAA 3K4JA 3WGGA 3HHGA 2P7VB 3PFYA 2DOAA 2AXLA 4QWQA 2Z16A 1WJAA 5LGTA 2GXBA 3LFUA 1H9GA 2QA4I 1XSDA 3MKZA 1XX5A 5KAFC 1LFUP 5EF6A 3O6BB 1VZ0A 4I02A 3RYPA 2E7XA 2CG4A 3OV8A 4AUXA 3K4BA 3QPSA 2A61A 4A3LJ 4RS8A 3GZNB 4XLNF 2NS8A 1REPC 1NK3P 4JBAA 1DU0A 1EV7A 2ZB9A 2DT5A 3IAM2 3PJRA 4XM3A 2EBIA 3TP0A 2KMUA 5FLXZ 5KCMA 4M9XA 2FNAA 3ZXSA 3KEOA 2OF7A 2YSRA 2R7WA 1IJWC 3IH3A 3IKVA 1HW1A 4N4NB 1BM9A 1L3LA 4HPQA 5ICEA 2W25A 1YOVB 2KIFA 3HJEA 3LSGA 1MMDA 5DD8A 4AM3A 3L2RA 4GFBA 2X1CA 2PX9A 3DPLC 3OIQA 2NYXA 3W6JB 4F52A 2XGDA 3PSFA 5C3EJ 5FGMA 1IF1A 5JVGF 5L3EA 2JA5J 5CQEA 4EJTA 3OYMA 2EZIA 1M1EB 2J5OA 4YEJA 2PJRB 3WU0A 4DYCA 1B6AA 2RREA 1HXDA 2Z9OA 2DCEA 1RNLA 2DT7B 2HYGD 5FO5A 1WPKA 2A6EF 3DXJF 4RB3C 5BPDA 1SD5A 3OYFA 3RQIA 4U0WA 3KP6A 4UHTA 2A5WA 1ZN2A 2DPUA 2JA7J 5GP9A 2DDBA 4YELA 2M45A 3HBLA 4Q47A 5LGUA 1VQKI 4L9NA 4DNCA 4LB5A 4WCGA 3P9IA 3HUGA 4K2EA 3K6GA 1D1BA 1OCZH 3M8FA 2NAZA 3HZJA 2FBKA 4Q48A 3EUKL 5B1AH 2KRHA 1W36D 4NBQA 1BIAA 1ZTRA 4IL6C 3WODF 5IOZA 3CUQA 2CW8A 3CJTB 5HS8A 3AL0B 2PMZA 2H6BA 3QODA 3WHCA 3K1MA 1EJ9A 2IT0A 5TGTA 4AIDA 2LKXA 3C1DA 3BR6A 3I59A 2R7DA 1TNTA 2QQ9A 3KX2A 2KIQA 2XAJA 4KUMA 1XMXA 4PJNA 3FDYA 2AHQA 1Y39A 1J9IA 3PUFA 2W82A 5E1ZB 1HW5A 2HOSA 1R36A 3KP3A 2VJIA 3FXJA 2F48A 3FMRA 5FFXA 4G6DA 3HGGA 1HKTA 2ME0A 2ZNZA 2GOXB 4B44A 3JAMZ 2LVSA 2OPTA 1QPMA 4KA4A 1V55H 2EA4A 1ETOA 1E3HA 3DCFA 4LLGF 1YJNI 1A6IA 4U7DA 3KLNA 4LOCA 2K86A 5DV5A 1Z7UA 1X58A 1N78A 2GBYA 2ISYA 2EPFA 2KJCA 3CDHA 3CCVI 4GCVA 3CMAI 1WQ2A 2R5YA 1FJLA 4II3A 4CCMA 2Z99A 3AL0C 1WKMA 4PSXA 3M4OJ 1Z0XA 4I01A 2HXOA 4JX4A 1IRGA 4E7SA 1YTYA 1GUUA 5FD5A 4A0YA 2JJ7A 1J0RA 1IDYA 4AYBN 3EUAA 3ZR8X 3I71A 2P4WA 5BS6A 3ML6A 2QM3A 2HNHA 3ZN0A 2DA6A 3HKZA 3D0SA 2BEOA 2A5YB 4YIRX 1O3QA 3ZQLA 1FYMA 3W2AA 2M9HA 4IOCF 1MDMA 1W5TA 2CFOA 4P9FA 2CW7A 4KISA 5DD4A 2F5FA 3BC8A 2M2EA 1IN7A 1HSTA 2VC1A 4A3MJ 2MSYA 2WAQA 2XAUA 1YITI 1OYYA 4KJZA 4D0PA 1YHQI 3GTPJ 1G6NA 4G7HF 4ASNA 4P9UA 3EDPA 4NDLA 1MMAA 1IDZA 2CQQA 3HSEA 1MSFC 2HTJA 5FLMJ 1ZR4A 2K02A 3JRAA 1T0FC 4UB6C 1JT0A 2EIKH 2MC4A 2V7FA 4A93J 2JA2A 2VKEA 1AKHB 4CGZA 2OA4A 1FOXA 2R7FA 2FMYA 3BCBA 2E7WA 3O8HA 4ZH4F 1FBUA 3A4CA 3DEEA 1FZPB 2EV0A 3KYDB 3FHNA 5EEHA 5HLIA 2W00A 3AG3H 2DJNA 1X1DA 4KNYA 2CS3A 4ZYGA 4LJZF 3LNQA 2YPRA 3S1NJ 4EVIA 1B59A 3S1RJ 3W2VA 3DLLF 2IBDA 1I1GA 2Q8KA 4ZYDA 1O57A 3GMEA 5F27A 3O8GA 1GVJA 3OOUA 3P5JA 2W48A 2OV7A 1T38A 3U1DA 1BIBA 4XSZF 2CUZA 4D9JA 2PLYA 1OYIA 2VKHA 1W7PA 3OOPA 3U21A 4BE1A 1JHFA 3UR3C 1WJDA 3C18A 1T08B 5EG0A 4CSWA 1K6OA 2HQAA 4XOPA 5GAGJ 4WXDA 1N25A 3TO9A 4R8HA 2CFXA 4I0AA 1MBHA 2IP2A 2LP0A 2HZDA 5JLWA 4HNUA 3ZQGA 1N77A 4I98B 5F64A 3D5SC 1OJLA 1S29A 1R5ID 3CP2A 3NWSA 1R5GA 3NRVA 1A36A 4AU7A 2CJJA 5LGNA 2HKOA 5E8GA 4M3FA 1O7FA 1USTA 2LY2A 3OWTA 1ZAOA 3JRHA 2IA0A 4OAYA 3RTRA 4EM0B 3CCYA 3BROA 4L0YB 1S5LC 1WVRA 2E36A 1YIOA 3M8JA 3WE2A 3HRTA 2W24A 5HNHA 4X0GA 1FSHA 4A2UA 1JJ6C 1HDDC 4MHGA 3TBIA 5EDNA 1IAWA 1KA8A 4A5MA 4BHPA 1X2NA 2QQAA 2VODA 3KP4A 1G2HA 2V79A 5IP6A 4HNVA 2XROA 3HGYA 2RDPA 2VJ4A 4EGYA 4E7JA 4S0HB 1JKPC 3CDIA 3VSKA 1P9QC 2Y30A 1I3QJ 1X3UA 1RR7A 2H1KA 3GWZA 3CO7C 2JK3A 3I5UA 2I5UA 1BR1A 2KDOA 2X51A 2L7FP 5K1YA 1PP7U 2Y75A 5DM7F 2CH0A 4M9ZA 3RQ4A 1ZG5A 4UUVA 4AIHA 4DGWB 3TMOA 1PVEA 2PMHA 4MTDA 2E5ZA 4IHTA 2FE3A 2ELKA 1H89C 1ON2A 4XOTA 1K78A 5JLXA 1ULYA 1WCMJ 3BR5A 3MZHA 3C7JA 3CCEI 3S3MA 4EMSA 3U1KA 2FJ1A 5DUIA 3S3OA 1Y6IA 3BR0A 2V4JC 1WJCA 2VQHA 4E7LA 3Q3SA 4DQ2A 3FX3A 1E17A 1L0OC 4BDYA 1WZ2A 3FXRA 3F22A 2MLGA 2DDAA 2H94A 5E3OA 3PFIA 3L2VA 4ZDOA 1FY7A 3OYCA 2JTVA 2JUCA 3OIPA 2ID6A 3DLAA 2K4JA 2VPRA 2XSJC 5D4SA 2K3FA 2M7BA 2ZXHA 2ZKZA 3P9CA 1DP7P 1SMTA 4KFCA 3FBIB 1TT5B 4AC0A 3CF2A 2Y69H 3RCOA 2HDDA 2IS1A 2O8XA 1J2XA 5LEJA 1FEXA 3ZPLA 3ISPA 5IYBJ 2P5VA 5H2FC 1FYKA 1HC8A 2DA7A 1WJFA 2GOMA 3BZCA 2DI3A 5D8KB 1HCRA 4YFKF 1ETKA 5E8IA 2EILH 4NQWA 3WE3A 4BJ5C 2LY1A 2IGOA 2LKPA 1IN8A 3CLQA 3K4CA 2CV1A 3H92A 1R1UA 2BY3A 2ID3A 2EQRA 4IRGA 3GZ5A 4BBSJ 3GTGJ 1YW7A 4JQFA 3FXUA 3HUGB 2CMPA 1MZBA 1J59A 2R7ZJ 3BG9A 3N97A 2K7LA 3I56I 1OLTA 4M3DA 4GGGA 1ZGJA 3U9GA 3I0TA 5GADJ 2M3AA 1ZKGA 1YW9A 1WHUA 1HSJA 2K9LA 4AVZA 1X1AA 3BDDA 4II2A 5A2QK 4ENJA 4G7ZF 4CA0A 2LREA 1TWCJ 2VKVA 3LSKA 1MNMC 2L54A 5DCMB 1R6RA 3WG7H 3ULQB 2XC7A 2IS2A 1W4MA 3CZ6A 5K5QA 4CYCA 3CCRI 4LGWA 5J6XA 4CDGA 3G73A 1LB2A 3KETA 1U0JA 2LLKA 3MQ0A 4HBLA 4PJ0C 5EEGA 3BJAA 3OYBA 3DTKA 3K2ZA 1FBSA 2OZUA 2YU9J 1JTXA 4KYWA 1XC5A 2Y0MA 4XKCA 2JMWA 3HOUJ 3H9GA 3L2UA 2L9RA 4KIFA 3KLOA 4RGRA 4E70A 4CYDA 2COBA 1VQ8I 5IT9Z 5BOXA 1VQ4I 3HOVJ 2LD5A 3I58A 2H8RA 5L3CA 3IUOA 3V7SA 1XPXA 1S7OA 1YJWI 1XSXA 2ZJRF 1KQ9A 3F8CA 5FFZA 2L7ZA 3S3NA 3LFKA 5EZGA 2E71A 3HKZN 3PL8A 2MH2A 5ILSA 2VC0A 1C0WA 4DZJA 3VYTB 4B1RA 2KRCA 2O7OA 3L2QA 1JXSA 1ITYA 3DPUA 3BT9A 2GLOA 2Y9ZA 3V8JA 2FBIA 2VQLA 1QQIA 1QBJA 1J09A 3S2DJ 1MMGA 2PG4A 2IGMA 2K40A 3V7RA 2HS5A 2NS0A 1FBQA 2EV5A 4KIGA 4FISA 4LIVA 2WY8Q 1BR4A 3V8KA 2DAOA 2R7QA 2NVTJ 2E2IJ 1VQ9I 2STWA 3E97A 1G3TA 3GUDA
chains in the Genus database with same CATH topology
1FX7A 3F8FA 2QLZA 2ELHA 3HSRA 1U3EM 5IT3A 3R61A 2L01A 2XRNA 4F7ZA 3H3UA 1P4WA 3T0YA 3ZMSA 2OU2A 2M30A 5BPIA 1O7LA 5DYMA 4HF1A 3T5XA 3V4GA 1E2XA 3PQJA 2KIMA 2F5DA 3RYRA 5H6RA 5LRRA 2WWYA 4G7OF 4Y13A 3EUHA 3FF5A 2DBBA 3QU6A 2K4BA 2Q0OA 4L0ZB 1KYWA 2JT1A 3RKYA 1S7AA 3HOSA 2P6SA 1ZRCA 2M87A 3RKWA 1YS6A 2BE5F 5L3GA 1U5TB 2UXNA 3I59B 1OMIA 4FHTA 2O3FA 3BP8A 2QZ8A 4Y15A 4U7BA 3IWFA 4N9HA 5CJ9A 1RUNA 3NEUA 1ZRFA 4LK0F 2A69F 1D3YA 2P5LC 2BV6A 1LDKB 3CUQB 1XMAA 4LG0A 2ESHA 5BMZA 4OOIA 2OD5A 4LLNA 1I1SA 4I0BA 4G94A 2P8TA 1KU9A 2GAUA 3ECHA 1XCVA 2O6GE 3QRFF 1R5HA 1R58A 3SHFA 3WTVC 4B09A 1R7JA 3B73A 4YFNF 4KICA 5HS9A 3HIFA 4HF2A 2EA2A 4LB6B 2DQRA 3SFZA 5E1XA 4UNOA 1Z6TA 4EJVA 1UCRA 3BWGA 1U2WA 3IL2A 4UXNA 4ETSA 1HBXG 3R0JA 2VE8A 2XKPA 1I27A 1SMYF 4YIIA 2LSOA 4HX7A 2VOOA 1CF7B 3KZZA 4WXCA 3GEZA 2O61A 4XRFA 2P6TA 3GXOA 3T8TA 3BPXA 1KU7A 1KQ8A 5D6EA 3QOPA 5ILVA 2TDXA 1J5YA 3F6OA 2IA1A 1EH6A 2OZ6A 4U88A 4ZZDA 3V8LA 5L3DA 5JI6A 1TLHB 3L7WA 1K79A 2VN2A 2DW4A 3IRQA 2FBHA 2GA2A 1IXRC 1V4RA 4BQAA 5ERIA 1SD6A 3WTTC 1B4AA 1U5TA 4OIOF 4HV6A 4S05A 5HLGA 1ZH5A 3QAHA 3VOEA 2FF4A 4XBFA 4LG0B 5ED4A 1U78A 1GXQA 2PFBA 2E1CA 2D2WA 1D8JA 3F72A 5E17F 1J75A 4BH9A 5K5OA 4B8XA 2YU3A 4G9YA 2K27A 3GFIA 1T98A 3BJOA 3D5LA 3MAJA 2VONA 4Y17A 4HW0A 3ERED 1AOYA 4MQ9F 1IN4A 3WTWC 3PQKA 3JTGA 2VBXA 3QU3A 3HOTA 2FMLA 4CHUA 4BAYA 5E20A 1Z1DA 2M5WA 2ZNYA 3H3ZA 2BBYA 3ZMVA 4KN4X 2F2EA 3RPUA 1SFXA 5AONA 5IT9K 1VTNC 3E6BA 1JE8A 1LEBA 2MA3A 4A12A 2A68F 4HYEA 3CLOA 2EFNA 4HLXA 2NNNA 2H27A 2QQBA 4MNUA 2PQ8A 3ZN1A 3M8EA 3ZMTA 3BY6A 4RB2C 1U8RA 5FD6A 1T2KA 4HOBA 3TGNA 4MEXF 1IN5A 2HQNA 2RV8A 2P5KA 1USSA 2JZYA 3L9FA 3E6DA 4OMYA 1JHHA 1YO5C 2HQRA 1P4XA 1WSUA 2HDCA 1EH8A 3HTUA 3REOA 4FX4A 4HA8A 1F5TA 1Z91A 1T6SA 5ICCA 1RZ4A 3VB2A 2KJBA 5HDKA 4ESBA 2PBIA 1FP2A 3I4PA 3WU1B 2LNBA 2W85A 1BI3A 3QP6A 5ILUA 2UZKA 3CO6C 3F6VA 4KN7X 3GFMA 1PUEE 4HAMA 3EQLF 3HHHA 4IXAA 2DO7A 2FXAA 2H09A 3F23A 1XMKA 4HZFA 5D5XB 3LQQA 1D5VA 6PAXA 2L4AA 2ZXJA 3K9TA 1R00A 5D5UB 2OQGA 1XDUA 4EJOA 2ETHA 2IJLA 2RN7A 2QYOA 4IJAA 2G7UA 1KYZA 5HDNA 1O3TA 4R1HA 1RI7A 4OIRF 4PGGA 3GLXA 3LA3A 2COMA 2GIVA 5A2QZ 2C6YA 1YW8A 2CWEA 5DCMA 1ZRDA 3B02A 3TDUC 3LSTA 3TO7A 4BYYA 4RGSA 1ZHFA 1U6GA 1XGMA 3FMSA 3TOBA 4EJWA 4XLPF 2IRFG 2PEXA 5H20A 1LDDA 2EB7A 2Z3YA 3HRMA 4IVNA 2CGPA 2WC2A 1XGNA 5D6FA 5BQTA 4KT5C 3ROUA 1KU3A 4UV8A 4FT8A 1HW2A 2L4MA 4HDUA 1BBYA 1BC8C 3ZP5A 1QGPA 4PGHA 1TW2A 2AS5F 4L9JA 2IVMA 4M72A 5FLXK 1W7PB 3P7NA 5KK1A 3M1EA 3KP7A 1DDNA 2RNJA 2QBYA 1P92A 3MWMA 1TW3A 2X4HA 4HV5A 5J8FA 2IW5A 1SFEA 4ZYEA 1G3YA 1LVAA 1I5ZA 4P5OA 1KU2A 3MZYA 4R79A 3C3WA 1YQAA 1FYLA 1RUOA 4HQMA 5CVIA 2XAFA 4LFUA 2OAZA 3RJPA 5F1RA 1S8NA 1F4KA 2FRHA 4UV9A 4EJUA 2ZCWA 1ZYRF 1XB4A 2YX4A 2EWNA 1DUXC 4N0BA 3RKXA 4G8XA 1WI9A 4MTEA 1MKMA 3CTAA 4A0ZA 3QPTA 5H6QA 3RIRA 4ENNA 4MEYF 1MGTA 1MDMB 3SZPA 3F8NA 5DCFA 5CVVA 2L3DA 1TQMA 4UVBA 5LEKA 2YR2A 1IZ1A 2CQKA 3GZ6A 2ZJ2A 2G7HA 2H6CA 4WX9A 3WGIA 2UXXA 4PDKA 2ZFWA 4U0YA 2D1HA 5J8CA 3J81Z 1H9TA 4M6YA 2R3SA 3N4MA 2VE9A 1I6XA 2VBWA 2JPBA 2PN6A 2PI0A 2MLKA 3K0LA 3VODA 4OMZA 3WTYC 3E6CC 2CW0F 4BHCA 5K5RA 1R22A 1H0MA 2XIGA 3GFJA 4RB1A 4NHJA 1BI2A 2XVCA 4IF4A 2A3SA 3Q5FA 5DUKA 3R4KA 4GXOA 1LNWA 4RB0A 5AIPA 2MC3A 2XUBA 1EH7A 3RDIA 4L9TA 3TDZC 4AVPA 4UVAA 3L2CA 4A6DA 1HQCA 1A04A 1ZLKA 3FM5A 1O3SA 1ZGAA 1FWZA 2MBFA 1LDJA 4PCQA 1PP8F 3L09A 1XDSA 2EFWA 5CVJA 1BI0A 3ZMDA 3LA2A 4Z2YA 3EYYA 2DK5A 5CYVA 4GYGA 4KMFA 4H0EA 1YS7A 1UFMA 5HDGA 3KEQA 1LEAA 4OINF 3DEUA 3DF8A 2DU9A 2X0LA 4BXUA 1DPUA 2EJRA 4RAYA 3FWEA 1SD4A 4Q5SF 2GWRA 3I64A 4ESFA 2RKHA 5CVRA 3KP5A 4LD5A 2STTA 2FA5A 5DDGA 3MFKA 2V1UA 1BN5A 1R23A 3DKWA 4EGZA 3DP7A 4AIJA 3IC7A 3HRUA 3JAMK 2FEZA 3E5XA 1BOAA 1XSVA 4L9VA 1KQ0A 2DPDA 2QBYB 2FOKA 3LQRA 2V1XA 1MJBA 2E1NA 1T0FA 4YFXF 2VT3A 1XCBA 1F9NA 3F8BA 2EV6A 1FNNA 2PMUA 3O3KA 2A07F 4IRHA 4HQEA 4GO1A 2VOPA 2B0LA 4IHSA 3AAFA 3MCZA 1ZG1A 4GYIA 3JW4A 2GQQA 1V3FA 3HRSA 3BOQA 1ZARA 2OBPA 2NRAC 2FU4A 5D4RA 3WTSC 5DEQA 2W84A 2YX7A 1HKSA 1Z9CA 4EM2A 4HX8A 4UVCA 3RI4A 3E5QA 1LJ9A 2KRFA 1QZYA 3U2RA 2GXGA 1FOKA 2HTSA 4CXFA 3M7GA 4KMUX 2QENA 4G6QA 4M71A 3RPQA 3GFLA 3IWZA 4WXHA 3SZTA 3NQOA 1CF7A 5HOOA 3BPVA 1STZA 5LHIA 1ON1A 4I09A 4L5IA 5LBQA 1FSEA 4EM1A 3K1PA 1TBXA 2VBYA 4EQQA 1GXPA 3JSPA 2V1DA 3CUQC 4YG2F 3JTHA 3I54A 1IW7F 2O0YA 4A5NA 4FX0A 1FC3A 1PDNC 2DFIA 3M9AA 2HWVA 3F3XA 4A6EA 3ABTA 2XHKA 2IPQX 1XGSA 2HGCA 2D45A 3HTSB 3GO5A 1XN7A 5CVUA 1FPQA 5HLHA 5LHHA 1K7AA 1BC7C 4CZZA 3ECOA 1UB9A 5HS7A 3R60A 4N9IA 3TKYA 2XAHA 3KE2A 1NHAA 2RGVA 5ICFA 3KCCA 2L02A 3E5UA 2HR3A 3F21A 1FT9A 2ESNA 2FSWA 1B9MA 3CJNA 3FZVA 3J81K 2MH9A 3TOAA 1O3RA 4ENMA 4L18B 1FP1D 1IN6A 5AIQA 2XAQA 1IUYA 5TJJA 4MGRA 4RAZA 4O3MA 2KKOA 3TO6A 4AD9A 3S2WA 3J80Z 2EFQA 3E6MA 3WGHA 3ZQ7A 4M73A 4M74A 2XV4S 3FHZA 2PJPA 4HDVA 5KVRA 5JHUA 3DFGA 1G3WA 4U0VA 3IKTA 4P55A 2ISZA 4HF0A 4LMYA 2JPCA 3O2PE 3LWFA 4ZZLA 3VEPA 2Z5UA 4CICA 1WWXA 4BHBA 1BI1A 5L3BA 3GX4X 3EETA 1B1BA 2XGXA 2LDUA 2HYFA 3QP5A 2ZO4A 1Z05A 2ACJA 1UHWA 1Y0UA 5CLSA 5FB2A 1S3JA 2GA1A 4QLCU 2P7CB 4P96A 2J5PA 4HLYA 5D5VB 2UWMA 3VFZA 4IRIA 3E3VA 1ZLJA 1R1VA 5JVTA 1P2FA 1JGSA 3FM3A 4A0XA 1QNTA 2LF7A 3BJ6A 3Q9SA 1K78B 3DPTA 2ADUA 1Q1HA 2CO5A 4LLLA 2NNYA 2DQLA 2F5CA 1YFHA 3WG9A 1QO0D 1YG2A 3CUOA 3QPHA 3EYIA 3IHUA 5D5WB 3KP2A 2JRTA 3LAPA 1Z6RA 1RIOH 3SXYA 3K1NA 3T8RA 3KZYA 3V7CA 2RQPA 4LK1F 1F1ZA 4ZYHA 1GHCA 2DLLA 1DPRA 1YLFA 1U5TC 3ELKA 1WRJA 2XASA 1MD0A 2WTEA 1ZG3A 2BGCA 1TQIA 4KDPA 1HKQA 2KIUA 4OIPF 2Z33A 4KIBA 3LAJA 1ONVA 3W6KB 1R1TA 4I2OA 4AIKA 1KGSA 4OIQF 1TQPA 2D1VA 1FLIA 5L3FA 1J7KA 4M9SA 1ZREA 2QVOA 1D8KA 4AWXB 2Q2EA 1OKRA 3HSFA 5F6FA 1P4AA 2V6CA 1B9NA 2DK8A 1T39A 2ZMEA 2Y48A 1TNSA 2IA2A 1YYVA 3ZMZA 2M1BA 3BZ6A 4PZJA 3F8MA 3DV8A 1CGPA 5JR3A 3TQNA 2VBZA 4MQVA 2O03A 2ZMEB 4RGXA 3GF2A 3J7AO 5E1WA 1MJ9A 1IXSB 1S6LA 3COAC 2FQ3A 3FMQA 5LHGA 1SD7A 4RGUA 2CYYA 5JFRA 2QUFA 2HEOA 2LF8A 1XGOA 1BJAA 3L00A 4I7HA 3KFWX 1IXCA 4YIFA 2G9WA 1LQ1A 2MD5A 4OU0A 4ON0A 4IPAA 2EK5A 1MJAA 4O5VA 4WWCA 5D8LB 2VT2A 3R0AA 3P9KA 1OYWA 2RVCA 4HX4A 1W5SA 2V9VA 5TRDA 4M6XA 3LA7A 3G3ZA 2F5EA 2W57A 1XD7A 2QWWA 2VXZA 1SAXA 1G4DA 2HZTA 3ABUA 3WTUC 2JSCA 1ODDA 3JSOA 3GVAA 4WF2A 3Q9VA 4ESJA 3WTXC 3K69A 3IRRA 5HVQC 5ICGA 4NB5A 4TV7A 2XAGA 3SQNA 3T1BA 5E18F 2OQRA 1SFUA 4EV0A 1OPCA 2ZBKA 4ENKA 1G3SA 1W7PD 3HYIA 2A6HF 2CSOA 4S04A 3I53A 2EFPA 2EFOA 1AWCA 1P6RA 4O6JA 4CO8A 4Q4ZF 1TTYA 3R6SA 4L5JA 2DTRA 2HKXA 3DQVC 2HFHA 2M8EA 3ZMUA 5LLQA 2XKOA 1OR7A 3MEXA 2GZWA 1UHMA 1QZZA 2WV0A 3GW2A 3GYHX 4BNCA 2RC4A 5LRSA 3WTZA 1IRFA 4WK8F 2FNPA 3FXQA 2HOEA 4JK1X 2BYVE 3J80K 4XSXF 3WGGA 3HHGA 2P7VB 2AXLA 4QWQA 5LGTA 2GXBA 1H9GA 1XSDA 3O6BB 4I02A 3RYPA 2E7XA 2CG4A 3OV8A 2A61A 4RS8A 4XLNF 1REPC 4JBAA 1EV7A 2DT5A 5FLXZ 4M9XA 2FNAA 3KEOA 2YSRA 3IKVA 1HW1A 1BM9A 1L3LA 5ICEA 2W25A 2KIFA 5DD8A 3DPLC 2NYXA 3W6JB 5FGMA 1IF1A 5L3EA 4EJTA 2J5OA 3WU0A 1B6AA 1HXDA 2Z9OA 1RNLA 2HYGD 5FO5A 2A6EF 3DXJF 4RB3C 5BPDA 1SD5A 4U0WA 3KP6A 4UHTA 1ZN2A 2DPUA 2M45A 4Q47A 5LGUA 4L9NA 4DNCA 4LB5A 4WCGA 3P9IA 3HUGA 4K2EA 3M8FA 2NAZA 2FBKA 4Q48A 1BIAA 3WODF 3CUQA 5HS8A 2H6BA 3K1MA 2IT0A 3C1DA 3I59A 2R7DA 1TNTA 2QQ9A 2XAJA 4KUMA 1J9IA 5E1ZB 1HW5A 1R36A 3KP3A 5FFXA 3FMRA 4G6DA 1HKTA 2ZNZA 3JAMZ 1QPMA 4KA4A 2EA4A 4LLGF 4U7DA 3KLNA 2K86A 5DV5A 1Z7UA 2ISYA 2KJCA 3CDHA 4GCVA 1WQ2A 2Z99A 1WKMA 4I01A 1IRGA 1YTYA 4A0YA 5FD5A 1J0RA 3I71A 2P4WA 5BS6A 3ML6A 2QM3A 3ZN0A 3D0SA 2BEOA 2A5YB 1O3QA 1FYMA 1MDMA 1W5TA 4P9FA 5DD4A 2F5FA 1IN7A 1HSTA 2VC1A 1OYYA 4D0PA 1G6NA 4G7HF 4ASNA 4P9UA 3EDPA 3HSEA 2HTJA 2K02A 4CGZA 2OA4A 2R7FA 2FMYA 2E7WA 4ZH4F 1FBUA 1FZPB 2EV0A 5EEHA 5HLIA 4KNYA 4ZYGA 4LJZF 2YPRA 4EVIA 1B59A 4ZYDA 1I1GA 2Q8KA 1O57A 1GVJA 1T38A 3U1DA 1BIBA 4XSZF 2PLYA 1OYIA 1W7PA 3OOPA 1JHFA 3C18A 1K6OA 4WXDA 3TO9A 4R8HA 2CFXA 4I0AA 2IP2A 4I98B 5F64A 1S29A 1R5GA 3NRVA 5LGNA 2HKOA 5E8GA 1O7FA 1USTA 1ZAOA 2IA0A 3RTRA 4EM0B 4L0YB 3BROA 1YIOA 3WE2A 2W24A 3HRTA 1FSHA 4A2UA 4MHGA 1IAWA 1KA8A 4A5MA 4BHPA 2QQAA 2VODA 3KP4A 2V79A 2XROA 2RDPA 4EGYA 1X3UA 3GWZA 3CO7C 3I5UA 5K1YA 1PP7U 2Y75A 4M9ZA 1ZG5A 4UUVA 4AIHA 2PMHA 4MTDA 4IHTA 2FE3A 1ON2A 1K78A 1ULYA 3MZHA 3C7JA 4EMSA 5DUIA 4DQ2A 3FX3A 1E17A 1L0OC 3F22A 3FXRA 2MLGA 2H94A 3PFIA 1FY7A 2JTVA 2K4JA 5D4SA 3P9CA 2ZKZA 1DP7P 1SMTA 4KFCA 2O8XA 1J2XA 5LEJA 3ZPLA 3ISPA 2P5VA 1FYKA 2DI3A 5D8KB 4YFKF 5E8IA 4NQWA 3WE3A 2LKPA 1IN8A 3H92A 1R1UA 4IRGA 3GZ5A 1YW7A 4JQFA 3FXUA 1MZBA 1J59A 3N97A 2K7LA 4GGGA 1ZGJA 3U9GA 3I0TA 1YW9A 1HSJA 3BDDA 4ENJA 5A2QK 4G7ZF 2L54A 5DCMB 3ULQB 1W4MA 5K5QA 4LGWA 5J6XA 4CDGA 3G73A 1LB2A 3KETA 4HBLA 3MQ0A 5EEGA 3BJAA 3K2ZA 1FBSA 2OZUA 4KYWA 2Y0MA 4KIFA 3KLOA 4RGRA 4E70A 4CYDA 5IT9Z 5BOXA 3I58A 5L3CA 3V7SA 1S7OA 1XSXA 1KQ9A 3F8CA 5FFZA 3LFKA 2MH2A 5ILSA 2VC0A 1C0WA 1JXSA 3V8JA 2FBIA 1QQIA 1QBJA 2PG4A 3V7RA 2HS5A 2NS0A 1FBQA 2EV5A 4KIGA 3V8KA 2DAOA 2STWA 3E97A 1G3TA 3GUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX7 A;  3F8F A;  2QLZ A;  2ELH A;  3HSR A;  1U3E M;  5IT3 A;  3R61 A;  2L01 A;  2XRN A;  4F7Z A;  3H3U A;  1P4W A;  3T0Y A;  3ZMS A;  2OU2 A;  2M30 A;  5BPI A;  1O7L A;  5DYM A;  4HF1 A;  3T5X A;  3V4G A;  1E2X A;  3PQJ A;  2KIM A;  2F5D A;  3RYR A;  5H6R A;  5LRR A;  2WWY A;  4G7O F;  4Y13 A;  3EUH A;  3FF5 A;  2DBB A;  3QU6 A;  2K4B A;  2Q0O A;  4L0Z B;  1KYW A;  2JT1 A;  3RKY A;  1S7A A;  3HOS A;  2P6S A;  1ZRC A;  2M87 A;  3RKW A;  1YS6 A;  2BE5 F;  5L3G A;  1U5T B;  2UXN A;  3I59 B;  1OMI A;  4FHT A;  2O3F A;  3BP8 A;  2QZ8 A;  4Y15 A;  4U7B A;  3IWF A;  4N9H A;  5CJ9 A;  1RUN A;  3NEU A;  1ZRF A;  4LK0 F;  2A69 F;  1D3Y A;  2P5L C;  2BV6 A;  1LDK B;  3CUQ B;  1XMA A;  4LG0 A;  2ESH A;  5BMZ A;  4OOI A;  2OD5 A;  4LLN A;  1I1S A;  4I0B A;  4G94 A;  2P8T A;  1KU9 A;  2GAU A;  3ECH A;  1XCV A;  2O6G E;  3QRF F;  1R5H A;  1R58 A;  3SHF A;  3WTV C;  4B09 A;  1R7J A;  3B73 A;  4YFN F;  4KIC A;  5HS9 A;  3HIF A;  4HF2 A;  2EA2 A;  4LB6 B;  2DQR A;  3SFZ A;  5E1X A;  4UNO A;  1Z6T A;  4EJV A;  1UCR A;  3BWG A;  1U2W A;  3IL2 A;  4UXN A;  4ETS A;  1HBX G;  3R0J A;  2VE8 A;  2XKP A;  1I27 A;  1SMY F;  4YII A;  2LSO A;  4HX7 A;  2VOO A;  1CF7 B;  3KZZ A;  4WXC A;  3GEZ A;  2O61 A;  4XRF A;  2P6T A;  3GXO A;  3T8T A;  3BPX A;  1KU7 A;  1KQ8 A;  5D6E A;  3QOP A;  5ILV A;  2TDX A;  1J5Y A;  3F6O A;  2IA1 A;  1EH6 A;  2OZ6 A;  4U88 A;  4ZZD A;  3V8L A;  5L3D A;  5JI6 A;  1TLH B;  3L7W A;  1K79 A;  2VN2 A;  2DW4 A;  3IRQ A;  2FBH A;  2GA2 A;  1IXR C;  1V4R A;  4BQA A;  5ERI A;  1SD6 A;  3WTT C;  1B4A A;  1U5T A;  4OIO F;  4HV6 A;  4S05 A;  5HLG A;  1ZH5 A;  3QAH A;  3VOE A;  2FF4 A;  4XBF A;  4LG0 B;  5ED4 A;  1U78 A;  1GXQ A;  2PFB A;  2E1C A;  2D2W A;  1D8J A;  3F72 A;  5E17 F;  1J75 A;  4BH9 A;  5K5O A;  4B8X A;  2YU3 A;  4G9Y A;  2K27 A;  3GFI A;  1T98 A;  3BJO A;  3D5L A;  3MAJ A;  2VON A;  4Y17 A;  4HW0 A;  3ERE D;  1AOY A;  4MQ9 F;  1IN4 A;  3WTW C;  3PQK A;  3JTG A;  2VBX A;  3QU3 A;  3HOT A;  2FML A;  4CHU A;  4BAY A;  5E20 A;  1Z1D A;  2M5W A;  2ZNY A;  3H3Z A;  2BBY A;  3ZMV A;  4KN4 X;  2F2E A;  3RPU A;  1SFX A;  5AON A;  5IT9 K;  1VTN C;  3E6B A;  1JE8 A;  1LEB A;  2MA3 A;  4A12 A;  2A68 F;  4HYE A;  3CLO A;  2EFN A;  4HLX A;  2NNN A;  2H27 A;  2QQB A;  4MNU A;  2PQ8 A;  3ZN1 A;  3M8E A;  3ZMT A;  3BY6 A;  4RB2 C;  1U8R A;  5FD6 A;  1T2K A;  4HOB A;  3TGN A;  4MEX F;  1IN5 A;  2HQN A;  2RV8 A;  2P5K A;  1USS A;  2JZY A;  3L9F A;  3E6D A;  4OMY A;  1JHH A;  1YO5 C;  2HQR A;  1P4X A;  1WSU A;  2HDC A;  1EH8 A;  3HTU A;  3REO A;  4FX4 A;  4HA8 A;  1F5T A;  1Z91 A;  1T6S A;  5ICC A;  1RZ4 A;  3VB2 A;  2KJB A;  5HDK A;  4ESB A;  2PBI A;  1FP2 A;  3I4P A;  3WU1 B;  2LNB A;  2W85 A;  1BI3 A;  3QP6 A;  5ILU A;  2UZK A;  3CO6 C;  3F6V A;  4KN7 X;  3GFM A;  1PUE E;  4HAM A;  3EQL F;  3HHH A;  4IXA A;  2DO7 A;  2FXA A;  2H09 A;  3F23 A;  1XMK A;  4HZF A;  5D5X B;  3LQQ A;  1D5V A;  6PAX A;  2L4A A;  2ZXJ A;  3K9T A;  1R00 A;  5D5U B;  2OQG A;  1XDU A;  4EJO A;  2ETH A;  2IJL A;  2RN7 A;  2QYO A;  4IJA A;  2G7U A;  1KYZ A;  5HDN A;  1O3T A;  4R1H A;  1RI7 A;  4OIR F;  4PGG A;  3GLX A;  3LA3 A;  2COM A;  2GIV A;  5A2Q Z;  2C6Y A;  1YW8 A;  2CWE A;  5DCM A;  1ZRD A;  3B02 A;  3TDU C;  3LST A;  3TO7 A;  4BYY A;  4RGS A;  1ZHF A;  1U6G A;  1XGM A;  3FMS A;  3TOB A;  4EJW A;  4XLP F;  2IRF G;  2PEX A;  5H20 A;  1LDD A;  2EB7 A;  2Z3Y A;  3HRM A;  4IVN A;  2CGP A;  2WC2 A;  1XGN A;  5D6F A;  5BQT A;  4KT5 C;  3ROU A;  1KU3 A;  4UV8 A;  4FT8 A;  1HW2 A;  2L4M A;  4HDU A;  1BBY A;  1BC8 C;  3ZP5 A;  1QGP A;  4PGH A;  1TW2 A;  2AS5 F;  4L9J A;  2IVM A;  4M72 A;  5FLX K;  1W7P B;  3P7N A;  5KK1 A;  3M1E A;  3KP7 A;  1DDN A;  2RNJ A;  2QBY A;  1P92 A;  3MWM A;  1TW3 A;  2X4H A;  4HV5 A;  5J8F A;  2IW5 A;  1SFE A;  4ZYE A;  1G3Y A;  1LVA A;  1I5Z A;  4P5O A;  1KU2 A;  3MZY A;  4R79 A;  3C3W A;  1YQA A;  1FYL A;  1RUO A;  4HQM A;  5CVI A;  2XAF A;  4LFU A;  2OAZ A;  3RJP A;  5F1R A;  1S8N A;  1F4K A;  2FRH A;  4UV9 A;  4EJU A;  2ZCW A;  1ZYR F;  1XB4 A;  2YX4 A;  2EWN A;  1DUX C;  4N0B A;  3RKX A;  4G8X A;  1WI9 A;  4MTE A;  1MKM A;  3CTA A;  4A0Z A;  3QPT A;  5H6Q A;  3RIR A;  4ENN A;  4MEY F;  1MGT A;  1MDM B;  3SZP A;  3F8N A;  5DCF A;  5CVV A;  2L3D A;  1TQM A;  4UVB A;  5LEK A;  2YR2 A;  1IZ1 A;  2CQK A;  3GZ6 A;  2ZJ2 A;  2G7H A;  2H6C A;  4WX9 A;  3WGI A;  2UXX A;  4PDK A;  2ZFW A;  4U0Y A;  2D1H A;  5J8C A;  3J81 Z;  1H9T A;  4M6Y A;  2R3S A;  3N4M A;  2VE9 A;  1I6X A;  2VBW A;  2JPB A;  2PN6 A;  2PI0 A;  2MLK A;  3K0L A;  3VOD A;  4OMZ A;  3WTY C;  3E6C C;  2CW0 F;  4BHC A;  5K5R A;  1R22 A;  1H0M A;  2XIG A;  3GFJ A;  4RB1 A;  4NHJ A;  1BI2 A;  2XVC A;  4IF4 A;  2A3S A;  3Q5F A;  5DUK A;  3R4K A;  4GXO A;  1LNW A;  4RB0 A;  5AIP A;  2MC3 A;  2XUB A;  1EH7 A;  3RDI A;  4L9T A;  3TDZ C;  4AVP A;  4UVA A;  3L2C A;  4A6D A;  1HQC A;  1A04 A;  1ZLK A;  3FM5 A;  1O3S A;  1ZGA A;  1FWZ A;  2MBF A;  1LDJ A;  4PCQ A;  1PP8 F;  3L09 A;  1XDS A;  2EFW A;  5CVJ A;  1BI0 A;  3ZMD A;  3LA2 A;  4Z2Y A;  3EYY A;  2DK5 A;  5CYV A;  4GYG A;  4KMF A;  4H0E A;  1YS7 A;  1UFM A;  5HDG A;  3KEQ A;  1LEA A;  4OIN F;  3DEU A;  3DF8 A;  2DU9 A;  2X0L A;  4BXU A;  1DPU A;  2EJR A;  4RAY A;  3FWE A;  1SD4 A;  4Q5S F;  2GWR A;  3I64 A;  4ESF A;  2RKH A;  5CVR A;  3KP5 A;  4LD5 A;  2STT A;  2FA5 A;  5DDG A;  3MFK A;  2V1U A;  1BN5 A;  1R23 A;  3DKW A;  4EGZ A;  3DP7 A;  4AIJ A;  3IC7 A;  3HRU A;  3JAM K;  2FEZ A;  3E5X A;  1BOA A;  1XSV A;  4L9V A;  1KQ0 A;  2DPD A;  2QBY B;  2FOK A;  3LQR A;  2V1X A;  1MJB A;  2E1N A;  1T0F A;  4YFX F;  2VT3 A;  1XCB A;  1F9N A;  3F8B A;  2EV6 A;  1FNN A;  2PMU A;  3O3K A;  2A07 F;  4IRH A;  4HQE A;  4GO1 A;  2VOP A;  2B0L A;  4IHS A;  3AAF A;  3MCZ A;  1ZG1 A;  4GYI A;  3JW4 A;  2GQQ A;  1V3F A;  3HRS A;  3BOQ A;  1ZAR A;  2OBP A;  2NRA C;  2FU4 A;  5D4R A;  3WTS C;  5DEQ A;  2W84 A;  2YX7 A;  1HKS A;  1Z9C A;  4EM2 A;  4HX8 A;  4UVC A;  3RI4 A;  3E5Q A;  1LJ9 A;  2KRF A;  1QZY A;  3U2R A;  2GXG A;  1FOK A;  2HTS A;  4CXF A;  3M7G A;  4KMU X;  2QEN A;  4G6Q A;  4M71 A;  3RPQ A;  3GFL A;  3IWZ A;  4WXH A;  3SZT A;  3NQO A;  1CF7 A;  5HOO A;  3BPV A;  1STZ A;  5LHI A;  1ON1 A;  4I09 A;  4L5I A;  5LBQ A;  1FSE A;  4EM1 A;  3K1P A;  1TBX A;  2VBY A;  4EQQ A;  1GXP A;  3JSP A;  2V1D A;  3CUQ C;  4YG2 F;  3JTH A;  3I54 A;  1IW7 F;  2O0Y A;  4A5N A;  4FX0 A;  1FC3 A;  1PDN C;  2DFI A;  3M9A A;  2HWV A;  3F3X A;  4A6E A;  3ABT A;  2XHK A;  2IPQ X;  1XGS A;  2HGC A;  2D45 A;  3HTS B;  3GO5 A;  1XN7 A;  5CVU A;  1FPQ A;  5HLH A;  5LHH A;  1K7A A;  1BC7 C;  4CZZ A;  3ECO A;  1UB9 A;  5HS7 A;  3R60 A;  4N9I A;  3TKY A;  2XAH A;  3KE2 A;  1NHA A;  2RGV A;  5ICF A;  3KCC A;  2L02 A;  3E5U A;  2HR3 A;  3F21 A;  1FT9 A;  2ESN A;  2FSW A;  1B9M A;  3CJN A;  3FZV A;  3J81 K;  2MH9 A;  3TOA A;  1O3R A;  4ENM A;  4L18 B;  1FP1 D;  1IN6 A;  5AIQ A;  2XAQ A;  1IUY A;  5TJJ A;  4MGR A;  4RAZ A;  4O3M A;  2KKO A;  3TO6 A;  4AD9 A;  3S2W A;  3J80 Z;  2EFQ A;  3E6M A;  3WGH A;  3ZQ7 A;  4M73 A;  4M74 A;  2XV4 S;  3FHZ A;  2PJP A;  4HDV A;  5KVR A;  5JHU A;  3DFG A;  1G3W A;  4U0V A;  3IKT A;  4P55 A;  2ISZ A;  4HF0 A;  4LMY A;  2JPC A;  3O2P E;  3LWF A;  4ZZL A;  3VEP A;  2Z5U A;  4CIC A;  1WWX A;  4BHB A;  1BI1 A;  5L3B A;  3GX4 X;  3EET A;  1B1B A;  2XGX A;  2LDU A;  2HYF A;  3QP5 A;  2ZO4 A;  1Z05 A;  2ACJ A;  1UHW A;  1Y0U A;  5CLS A;  5FB2 A;  1S3J A;  2GA1 A;  4QLC U;  2P7C B;  4P96 A;  2J5P A;  4HLY A;  5D5V B;  2UWM A;  3VFZ A;  4IRI A;  3E3V A;  1ZLJ A;  1R1V A;  5JVT A;  1P2F A;  1JGS A;  3FM3 A;  4A0X A;  1QNT A;  2LF7 A;  3BJ6 A;  3Q9S A;  1K78 B;  3DPT A;  2ADU A;  1Q1H A;  2CO5 A;  4LLL A;  2NNY A;  2DQL A;  2F5C A;  1YFH A;  3WG9 A;  1QO0 D;  1YG2 A;  3CUO A;  3QPH A;  3EYI A;  3IHU A;  5D5W B;  3KP2 A;  2JRT A;  3LAP A;  1Z6R A;  1RIO H;  3SXY A;  3K1N A;  3T8R A;  3KZY A;  3V7C A;  2RQP A;  4LK1 F;  1F1Z A;  4ZYH A;  1GHC A;  2DLL A;  1DPR A;  1YLF A;  1U5T C;  3ELK A;  1WRJ A;  2XAS A;  1MD0 A;  2WTE A;  1ZG3 A;  2BGC A;  1TQI A;  4KDP A;  1HKQ A;  2KIU A;  4OIP F;  2Z33 A;  4KIB A;  3LAJ A;  1ONV A;  3W6K B;  1R1T A;  4I2O A;  4AIK A;  1KGS A;  4OIQ F;  1TQP A;  2D1V A;  1FLI A;  5L3F A;  1J7K A;  4M9S A;  1ZRE A;  2QVO A;  1D8K A;  4AWX B;  2Q2E A;  1OKR A;  3HSF A;  5F6F A;  1P4A A;  2V6C A;  1B9N A;  2DK8 A;  1T39 A;  2ZME A;  2Y48 A;  1TNS A;  2IA2 A;  1YYV A;  3ZMZ A;  2M1B A;  3BZ6 A;  4PZJ A;  3F8M A;  3DV8 A;  1CGP A;  5JR3 A;  3TQN A;  2VBZ A;  4MQV A;  2O03 A;  2ZME B;  4RGX A;  3GF2 A;  3J7A O;  5E1W A;  1MJ9 A;  1IXS B;  1S6L A;  3COA C;  2FQ3 A;  3FMQ A;  5LHG A;  1SD7 A;  4RGU A;  2CYY A;  5JFR A;  2QUF A;  2HEO A;  2LF8 A;  1XGO A;  1BJA A;  3L00 A;  4I7H A;  3KFW X;  1IXC A;  4YIF A;  2G9W A;  1LQ1 A;  2MD5 A;  4OU0 A;  4ON0 A;  4IPA A;  2EK5 A;  1MJA A;  4O5V A;  4WWC A;  5D8L B;  2VT2 A;  3R0A A;  3P9K A;  1OYW A;  2RVC A;  4HX4 A;  1W5S A;  2V9V A;  5TRD A;  4M6X A;  3LA7 A;  3G3Z A;  2F5E A;  2W57 A;  1XD7 A;  2QWW A;  2VXZ A;  1SAX A;  1G4D A;  2HZT A;  3ABU A;  3WTU C;  2JSC A;  1ODD A;  3JSO A;  3GVA A;  4WF2 A;  3Q9V A;  4ESJ A;  3WTX C;  3K69 A;  3IRR A;  5HVQ C;  5ICG A;  4NB5 A;  4TV7 A;  2XAG A;  3SQN A;  3T1B A;  5E18 F;  2OQR A;  1SFU A;  4EV0 A;  1OPC A;  2ZBK A;  4ENK A;  1G3S A;  1W7P D;  3HYI A;  2A6H F;  2CSO A;  4S04 A;  3I53 A;  2EFP A;  2EFO A;  1AWC A;  1P6R A;  4O6J A;  4CO8 A;  4Q4Z F;  1TTY A;  3R6S A;  4L5J A;  2DTR A;  2HKX A;  3DQV C;  2HFH A;  2M8E A;  3ZMU A;  5LLQ A;  2XKO A;  1OR7 A;  3MEX A;  2GZW A;  1UHM A;  1QZZ A;  2WV0 A;  3GW2 A;  3GYH X;  4BNC A;  2RC4 A;  5LRS A;  3WTZ A;  1IRF A;  4WK8 F;  2FNP A;  3FXQ A;  2HOE A;  4JK1 X;  2BYV E;  3J80 K;  4XSX F;  3WGG A;  3HHG A;  2P7V B;  2AXL A;  4QWQ A;  5LGT A;  2GXB A;  1H9G A;  1XSD A;  3O6B B;  4I02 A;  3RYP A;  2E7X A;  2CG4 A;  3OV8 A;  2A61 A;  4RS8 A;  4XLN F;  1REP C;  4JBA A;  1EV7 A;  2DT5 A;  5FLX Z;  4M9X A;  2FNA A;  3KEO A;  2YSR A;  3IKV A;  1HW1 A;  1BM9 A;  1L3L A;  5ICE A;  2W25 A;  2KIF A;  5DD8 A;  3DPL C;  2NYX A;  3W6J B;  5FGM A;  1IF1 A;  5L3E A;  4EJT A;  2J5O A;  3WU0 A;  1B6A A;  1HXD A;  2Z9O A;  1RNL A;  2HYG D;  5FO5 A;  2A6E F;  3DXJ F;  4RB3 C;  5BPD A;  1SD5 A;  4U0W A;  3KP6 A;  4UHT A;  1ZN2 A;  2DPU A;  2M45 A;  4Q47 A;  5LGU A;  4L9N A;  4DNC A;  4LB5 A;  4WCG A;  3P9I A;  3HUG A;  4K2E A;  3M8F A;  2NAZ A;  2FBK A;  4Q48 A;  1BIA A;  3WOD F;  3CUQ A;  5HS8 A;  2H6B A;  3K1M A;  2IT0 A;  3C1D A;  3I59 A;  2R7D A;  1TNT A;  2QQ9 A;  2XAJ A;  4KUM A;  1J9I A;  5E1Z B;  1HW5 A;  1R36 A;  3KP3 A;  5FFX A;  3FMR A;  4G6D A;  1HKT A;  2ZNZ A;  3JAM Z;  1QPM A;  4KA4 A;  2EA4 A;  4LLG F;  4U7D A;  3KLN A;  2K86 A;  5DV5 A;  1Z7U A;  2ISY A;  2KJC A;  3CDH A;  4GCV A;  1WQ2 A;  2Z99 A;  1WKM A;  4I01 A;  1IRG A;  1YTY A;  4A0Y A;  5FD5 A;  1J0R A;  3I71 A;  2P4W A;  5BS6 A;  3ML6 A;  2QM3 A;  3ZN0 A;  3D0S A;  2BEO A;  2A5Y B;  1O3Q A;  1FYM A;  1MDM A;  1W5T A;  4P9F A;  5DD4 A;  2F5F A;  1IN7 A;  1HST A;  2VC1 A;  1OYY A;  4D0P A;  1G6N A;  4G7H F;  4ASN A;  4P9U A;  3EDP A;  3HSE A;  2HTJ A;  2K02 A;  4CGZ A;  2OA4 A;  2R7F A;  2FMY A;  2E7W A;  4ZH4 F;  1FBU A;  1FZP B;  2EV0 A;  5EEH A;  5HLI A;  4KNY A;  4ZYG A;  4LJZ F;  2YPR A;  4EVI A;  1B59 A;  4ZYD A;  1I1G A;  2Q8K A;  1O57 A;  1GVJ A;  1T38 A;  3U1D A;  1BIB A;  4XSZ F;  2PLY A;  1OYI A;  1W7P A;  3OOP A;  1JHF A;  3C18 A;  1K6O A;  4WXD A;  3TO9 A;  4R8H A;  2CFX A;  4I0A A;  2IP2 A;  4I98 B;  5F64 A;  1S29 A;  1R5G A;  3NRV A;  5LGN A;  2HKO A;  5E8G A;  1O7F A;  1UST A;  1ZAO A;  2IA0 A;  3RTR A;  4EM0 B;  4L0Y B;  3BRO A;  1YIO A;  3WE2 A;  2W24 A;  3HRT A;  1FSH A;  4A2U A;  4MHG A;  1IAW A;  1KA8 A;  4A5M A;  4BHP A;  2QQA A;  2VOD A;  3KP4 A;  2V79 A;  2XRO A;  2RDP A;  4EGY A;  1X3U A;  3GWZ A;  3CO7 C;  3I5U A;  5K1Y A;  1PP7 U;  2Y75 A;  4M9Z A;  1ZG5 A;  4UUV A;  4AIH A;  2PMH A;  4MTD A;  4IHT A;  2FE3 A;  1ON2 A;  1K78 A;  1ULY A;  3MZH A;  3C7J A;  4EMS A;  5DUI A;  4DQ2 A;  3FX3 A;  1E17 A;  1L0O C;  3F22 A;  3FXR A;  2MLG A;  2H94 A;  3PFI A;  1FY7 A;  2JTV A;  2K4J A;  5D4S A;  3P9C A;  2ZKZ A;  1DP7 P;  1SMT A;  4KFC A;  2O8X A;  1J2X A;  5LEJ A;  3ZPL A;  3ISP A;  2P5V A;  1FYK A;  2DI3 A;  5D8K B;  4YFK F;  5E8I A;  4NQW A;  3WE3 A;  2LKP A;  1IN8 A;  3H92 A;  1R1U A;  4IRG A;  3GZ5 A;  1YW7 A;  4JQF A;  3FXU A;  1MZB A;  1J59 A;  3N97 A;  2K7L A;  4GGG A;  1ZGJ A;  3U9G A;  3I0T A;  1YW9 A;  1HSJ A;  3BDD A;  4ENJ A;  5A2Q K;  4G7Z F;  2L54 A;  5DCM B;  3ULQ B;  1W4M A;  5K5Q A;  4LGW A;  5J6X A;  4CDG A;  3G73 A;  1LB2 A;  3KET A;  4HBL A;  3MQ0 A;  5EEG A;  3BJA A;  3K2Z A;  1FBS A;  2OZU A;  4KYW A;  2Y0M A;  4KIF A;  3KLO A;  4RGR A;  4E70 A;  4CYD A;  5IT9 Z;  5BOX A;  3I58 A;  5L3C A;  3V7S A;  1S7O A;  1XSX A;  1KQ9 A;  3F8C A;  5FFZ A;  3LFK A;  2MH2 A;  5ILS A;  2VC0 A;  1C0W A;  1JXS A;  3V8J A;  2FBI A;  1QQI A;  1QBJ A;  2PG4 A;  3V7R A;  2HS5 A;  2NS0 A;  1FBQ A;  2EV5 A;  4KIG A;  3V8K A;  2DAO A;  2STW A;  3E97 A;  1G3T A;  3GUD A; 
#chains in the Genus database with same CATH topology
 1FX7 A;  3F8F A;  2QLZ A;  2ELH A;  3ZQH A;  3HSR A;  1U3E M;  3SDG A;  5F0C A;  4RA2 A;  5HNF A;  4M3B A;  1MSE C;  5IT3 A;  3H9Q A;  4M6V A;  3R61 A;  2L01 A;  2XRN A;  2OTL I;  4F7Z A;  2HU9 A;  5EGO A;  3H3U A;  4BE0 A;  2JA6 J;  1P4W A;  2XF7 A;  3WHB A;  4XN3 A;  2X85 A;  1YJ9 I;  3T0Y A;  3ZMS A;  3W6V A;  2OU2 A;  3SDB A;  2M30 A;  5BPI A;  1DGW Y;  1O7L A;  1OR7 C;  2LR8 A;  2V26 A;  5DYM A;  4HF1 A;  2XDV A;  3G4S I;  3T5X A;  3V4G A;  1E2X A;  1O4X A;  3KYC B;  3PQJ A;  1FOY A;  1QZE A;  3A0H C;  2KIM A;  2W4S A;  4HNT A;  4LG3 A;  2F5D A;  3RYR A;  5H6R A;  3CC2 I;  3OR2 C;  5LRR A;  2WWY A;  2E19 A;  4G7O F;  2Z1D A;  4Y13 A;  3EUH A;  3FF5 A;  2DBB A;  3QU6 A;  2K4B A;  2Q0O A;  1Z3Y A;  4L0Z B;  4DYQ A;  2PJR A;  1KYW A;  2JT1 A;  4G12 A;  1S7A A;  3RKY A;  2P6S A;  3CDL A;  3HOS A;  2M87 A;  3SJM A;  1ZRC A;  1F43 A;  2XGE A;  3RKW A;  2E1M C;  1OCP A;  1YS6 A;  2BE5 F;  3K4L A;  4MIM A;  1U5T B;  2UXN A;  3I59 B;  1OMI A;  5L3G A;  4FHT A;  1D1C A;  2L7K A;  2O3F A;  1FMW A;  3A0B C;  4IHW A;  3BP8 A;  2QZ8 A;  3S32 A;  3Q0U A;  1LPQ A;  5GTH C;  4Y15 A;  4U7B A;  5EZH A;  3HPG A;  4XRS A;  3RPU D;  4QSH A;  5FKN A;  3H0D A;  1AU7 A;  1HA8 A;  3IWF A;  4N9H A;  5CJ9 A;  1RUN A;  3NEU A;  4LK0 F;  1ZRF A;  2A69 F;  1D3Y A;  2P5L C;  3JRE A;  5EJC A;  2BV6 A;  5C4J J;  1LDK B;  3CUQ B;  1XMA A;  4LG0 A;  3QWL A;  3RKQ A;  2ESH A;  4I76 A;  3K70 C;  4CCJ A;  5BMZ A;  4BY1 J;  2ECB A;  4OOI A;  2OD5 A;  4LLN A;  1I1S A;  4I0B A;  2ECC A;  1RC9 A;  4G94 A;  2P8T A;  1KU9 A;  3ESW B;  2GAU A;  4DW6 A;  2PMZ N;  3RSN A;  1ZR2 A;  3ECH A;  3EPZ A;  1XCV A;  3CQZ J;  2L5Q A;  2O6G E;  3QRF F;  1R5H A;  1R58 A;  4C9Y A;  4ZDL A;  3SHF A;  3WTV C;  2JUG A;  3FBN B;  4B09 A;  3CMY A;  4B47 A;  1R7J A;  3OYJ A;  2CU7 A;  5K7Z A;  1WGX A;  3B73 A;  4KIC A;  3ZOB A;  3QYB A;  1MBG A;  4YFN F;  3BLY A;  5HS9 A;  3QYE A;  5IYC J;  3HC7 A;  4XLE A;  3HIF A;  4HF2 A;  4A3J J;  2EA2 A;  4LB6 B;  2DQR A;  3BTI A;  3K10 A;  3SFZ A;  4IO9 F;  2GXA A;  5E1X A;  4UNO A;  3LSP A;  2R7V A;  1Z6T A;  4XKB A;  4EJV A;  1UCR A;  3BWG A;  2LK2 A;  1BW6 A;  1U2W A;  3IL2 A;  4UXN A;  4Y3O A;  3ABM H;  4ETS A;  1HF0 A;  1K4T A;  1HBX G;  1U8B A;  2ZXI A;  1KZH A;  4D7M A;  4A3E J;  3R0J A;  2VE8 A;  3CMM A;  2L2O A;  1V5F A;  2CUE A;  1WJ5 A;  3PM1 A;  4EAT A;  2KDZ A;  4IHY A;  2XKP A;  4E4H A;  1I27 A;  3M07 A;  1SMY F;  4YII A;  3G1O A;  1TWH J;  2LSO A;  4HX7 A;  4I99 C;  2VOO A;  1CF7 B;  2BXZ A;  3KZZ A;  4WXC A;  1HDP A;  3GEZ A;  3OL4 A;  2O61 A;  1E0E A;  2BHY A;  4XRF A;  1B8I A;  2P6T A;  3GXO A;  1PJR A;  3OYK A;  3PO3 J;  3T8T A;  3BPX A;  1KU7 A;  1X3Z B;  2XF5 A;  5IPA A;  1KQ8 A;  3PNY A;  5D6E A;  3QOP A;  1BA5 A;  5ILV A;  4DZP A;  1JUM A;  2TDX A;  2F5V A;  3JRF A;  1J5Y A;  3F6O A;  2IA1 A;  1EH6 A;  5FKO A;  2OZ6 A;  4PFO A;  4U88 A;  3OS0 A;  4ABZ A;  5GAE J;  2O8K A;  2VQG A;  3PUB A;  4MFE A;  4ZZD A;  1D0Y A;  3V8L A;  5L3D A;  3FXM A;  5F0F A;  5JI6 A;  3E7L A;  1TLH B;  3UNG C;  3L7W A;  1K79 A;  2VN2 A;  2EH3 A;  1FTZ A;  4E7K A;  2DW4 A;  3IRQ A;  1QHH D;  1R49 A;  4BJT A;  2FBH A;  1ZGW A;  3GTK J;  4XON A;  2GA2 A;  3I4N J;  1IXR C;  2CV2 A;  1V4R A;  4BQA A;  5ERI A;  2LH9 A;  1MBE A;  3AG1 H;  4JOM A;  1SD6 A;  3WTT C;  3M1C A;  3CCU I;  3MKY B;  2HQ5 A;  2DOE A;  1B4A A;  1U5T A;  4OIO F;  3A01 A;  4HV6 A;  4BL0 B;  5J4Y A;  4S05 A;  1IV6 A;  5HLG A;  1ZH5 A;  2ZC2 A;  3QAH A;  3VOE A;  2FF4 A;  4XBF A;  4RM2 A;  4LG0 B;  5ED4 A;  1W0T A;  1GXQ A;  1U78 A;  2PFB A;  2E1C A;  2Y31 A;  3MMY B;  2D2W A;  4IEJ A;  1D8J A;  3F72 A;  5E17 F;  1J75 A;  4BH9 A;  4A3K J;  5K5O A;  4B8X A;  2YU3 A;  1ACI A;  1IC8 A;  1VQN I;  1Y56 A;  1ZK8 A;  4G9Y A;  2FOW A;  1VQM I;  1ETY A;  2K27 A;  4RBO A;  3GFI A;  1POG A;  1T98 A;  4Y33 A;  4PJM A;  3BJO A;  4V2G A;  3D5L A;  3MAJ A;  2VON A;  4Y17 A;  4HW0 A;  3ERE D;  1AOY A;  1Y8Q B;  4MQ9 F;  2VIX A;  1IN4 A;  2E1O A;  1Q1V A;  3WTW C;  2IGK A;  3PQK A;  2XB0 X;  4A3B J;  3JTG A;  2VBX A;  3QU3 A;  4DJA A;  4D1Q A;  3HOT A;  2FML A;  4BEH B;  4FTH A;  3K4M A;  4CCL A;  2K9N A;  4CHU A;  2LRD A;  3MKL A;  2UV1 A;  4BAY A;  5E20 A;  1Z1D A;  2BW3 A;  3BTJ A;  3CCQ I;  2M5W A;  3UKG A;  1R4N B;  3H3Z A;  1F36 A;  2BBY A;  1Y1V J;  2ZNY A;  3HEF A;  3ZMV A;  4KN4 X;  1JUP A;  2F2E A;  4XLA A;  3E1S A;  3RPU A;  3A03 A;  3GTL J;  1SFX A;  1Z77 A;  2VUM J;  4BY7 J;  3DKX A;  3ZCO A;  3S1M J;  2JSP A;  5AON A;  2KLO A;  5IT9 K;  1VTN C;  1S72 I;  3E6B A;  2QKL B;  1JE8 A;  3N05 A;  1LEB A;  2MA3 A;  4A12 A;  2A68 F;  4HYE A;  3CLO A;  2EFN A;  2VB6 A;  3KPH A;  1W0U A;  4HLX A;  4IZZ A;  3K4N A;  2NNN A;  1IGN A;  2H27 A;  2QQB A;  2A05 A;  4MNU A;  2PQ8 A;  5IOY A;  3ZN1 A;  2VQC A;  3M8E A;  3ZMT A;  3DTI A;  4BU2 A;  1VQ7 I;  3BY6 A;  4RB2 C;  1U8R A;  1I39 A;  5CKT A;  2V6E A;  4C2T A;  5F1J A;  1GDT A;  5FD6 A;  2X1E A;  1IUF A;  4ZYA A;  1T2K A;  1MH3 A;  4HOB A;  3TGN A;  4LIT A;  4IQJ A;  2QQ8 A;  4MEX F;  1YE9 A;  4ZDP A;  3CC7 I;  1IN5 A;  2HQN A;  2RV8 A;  1FOW A;  1LE8 B;  2P5K A;  1USS A;  2JZY A;  3OYI A;  3FKI J;  2LFB A;  3L9F A;  2RAE A;  3E6D A;  1BJZ A;  1NG6 A;  3GTM J;  4OMY A;  1JHH A;  2ZME C;  1YO5 C;  2NVQ J;  3V42 A;  2HQR A;  4B3A A;  2DA1 A;  2LG4 A;  3ONQ A;  1P4X A;  1DP3 A;  2R7O A;  2MD0 A;  1WSU A;  4E7H A;  2HDC A;  4IOA F;  1D0X A;  1EH8 A;  4HST A;  2E60 A;  3HTU A;  3REO A;  4FX4 A;  1A6Q A;  5M3M J;  3ZGK A;  4FQG A;  2DN0 A;  2R7S A;  4HA8 A;  1F5T A;  1Z91 A;  3ASO H;  4XQF A;  1T6S A;  5ICC A;  1EF4 A;  3PIP F;  3RZO J;  3MD2 A;  2O9L A;  1RZ4 A;  3OYD A;  3E0J B;  3VB2 A;  1Z7L A;  2KJB A;  5HDK A;  5KHD A;  4ESB A;  2PBI A;  2XGC A;  1FP2 A;  1LFP A;  4HEA 2;  3I4P A;  2L9V A;  3WU1 B;  2LNB A;  4C2U A;  2W85 A;  1BI3 A;  2X1D A;  3QP6 A;  4D5C A;  5ILU A;  2UZK A;  3CO6 C;  4FET A;  4PFP A;  3F6V A;  4V2F A;  1OQY A;  4NNJ A;  4UY8 I;  1Y0N A;  4KN7 X;  3OY9 A;  3VPR A;  3GFM A;  4H4K C;  4UUS A;  1BL0 A;  5E3N A;  1EA3 A;  3D5R C;  1PUE E;  4HAM A;  3EQL F;  3HHH A;  4IXA A;  3OS1 A;  3GTQ J;  1IO2 A;  2BY0 A;  2GM4 A;  2DO7 A;  2FXA A;  2HOT A;  2FX0 A;  2H09 A;  4UUS B;  3F23 A;  2VXD A;  1XMK A;  4HZF A;  5D5X B;  3LQQ A;  1D5V A;  6PAX A;  2KPM A;  1RKT A;  1BR2 A;  2OCE A;  1SAU A;  1U9O A;  1NTC A;  2L4A A;  2ZXJ A;  3K9T A;  4NC8 A;  1LE8 A;  1R00 A;  3MN2 A;  5D5U B;  2OQG A;  1NK2 P;  1YRN B;  1XDU A;  3ZQF A;  4EJO A;  3S15 J;  2QCO A;  2ETH A;  2IJL A;  3VYS B;  1QPI A;  3JRB A;  2RN7 A;  2QYO A;  4RLQ A;  4PK4 A;  4IJA A;  2G7U A;  1KYZ A;  5HDN A;  1O3T A;  4R1H A;  1HLV A;  1Z21 A;  1Y1W J;  1RI7 A;  3FXK A;  4OIR F;  4PGG A;  2MAB A;  3GLX A;  3LA3 A;  2COM A;  2CQX A;  4XLH A;  4PSW A;  2GIV A;  5A2Q Z;  3BR1 A;  3D1N I;  2C6Y A;  1YW8 A;  4N4O B;  2CWE A;  5DCM A;  2H8W A;  5GAH J;  1TWG J;  1ZRD A;  3VYR B;  3B02 A;  5EEA A;  3TDU C;  1JKO C;  3BCA A;  3CC4 I;  3CJQ B;  3LST A;  3TO7 A;  4BYY A;  2BVM A;  4RGS A;  1ZHF A;  5FRM A;  1U6G A;  1XGM A;  3FMS A;  3TOB A;  4EJW A;  4XLP F;  2IRF G;  2I10 A;  2PEX A;  1IRZ A;  5H20 A;  2CUF A;  1RES A;  1LDD A;  2EB7 A;  1VND A;  2Z3Y A;  3HRM A;  2ICW G;  4IVN A;  2CGP A;  2WC2 A;  2EZL A;  1XGN A;  5D6F A;  1OIS A;  1DQU A;  5BQT A;  2I8D A;  3S8P A;  1UHS A;  4KT5 C;  1I6H J;  4M3G A;  3ROU A;  1KU3 A;  4UV8 A;  4X1E A;  1H8A C;  4FT8 A;  5LD2 C;  1JGG A;  1G59 A;  1EKE A;  1HW2 A;  4W1U A;  2L4M A;  2XB5 A;  2V9P A;  3I3L A;  3BQZ A;  4HDU A;  1BBY A;  2R5Y B;  4YRV A;  1BC8 C;  1T56 A;  3ZP5 A;  4BE2 A;  2QSH X;  2R93 J;  4NQW B;  1QGP A;  4PGH A;  4XNF A;  2OTJ I;  2NOG A;  4XRM A;  1TW2 A;  2Q2E B;  4IHX A;  2AS5 F;  3G2B A;  1X2M A;  5K7F A;  4L9J A;  2IVM A;  3GLL A;  3CF5 F;  4DOZ A;  4B43 A;  4XL9 A;  5M5X J;  1SEU A;  4M72 A;  3DU5 A;  1W7P B;  2Y0S N;  3H35 A;  3P7N A;  3OYE A;  5FLX K;  2AQE A;  4A3I J;  5KK1 A;  2NXN B;  3DBR B;  3M1E A;  3NAU A;  4FE7 A;  3HM5 A;  2WBM A;  3KP7 A;  1JJ8 C;  1DDN A;  1WJE A;  2RNJ A;  1K83 J;  5M3F J;  2QBY A;  1P92 A;  4P1W A;  3MWM A;  1TW3 A;  3ERM A;  2X4H A;  4HV5 A;  5J8F A;  2IW5 A;  1SFE A;  4ZYE A;  1G3Y A;  1LVA A;  1I5Z A;  3BR3 A;  4P5O A;  1KU2 A;  3MZY A;  4R79 A;  3F9K A;  1ETX A;  3C3W A;  1YQA A;  3C2H A;  1FYL A;  1RUO A;  2FUG 2;  3M3Y J;  2F4I A;  1GLN A;  4HQM A;  5IP9 J;  3G6E I;  3AG4 H;  2UUZ A;  2XAF A;  2OAZ A;  4LFU A;  5CVI A;  3RJP A;  4Y52 J;  3FXL A;  3FK6 A;  3H5N A;  3DKY A;  5F1R A;  1JI8 A;  3OYL A;  4FE4 A;  5J1Y A;  1S8N A;  1F4K A;  3G1L A;  2IS6 A;  3OYH A;  3LSM A;  4A69 C;  2FRH A;  4UV9 A;  4EJU A;  1LKX A;  2DXI A;  2ZCW A;  1I50 J;  1ORK A;  4Y4R A;  1ZYR F;  2W1O A;  1XB4 A;  1WH7 A;  2YX4 A;  5FKL A;  2EWN A;  1DUX C;  4N0B A;  3RKX A;  3ZRG A;  2P81 A;  4G8X A;  1WI9 A;  4MTE A;  1JKR C;  2L0K A;  3CD6 I;  1MKM A;  2DFE A;  1MNE A;  2A6T A;  3CTA A;  3LSJ A;  3RZD J;  4QPO A;  1S7E A;  4A0Z A;  2DMU A;  2WY7 Q;  2FQ4 A;  1ETQ A;  2Y9Y A;  3QPT A;  5H6Q A;  3RIR A;  2GIZ A;  4ENN A;  4MEY F;  3GTJ J;  2VL8 A;  1MGT A;  5B3S H;  1MDM B;  4QIW N;  1VF9 A;  1UEL B;  3SZP A;  3F8N A;  3GCM A;  5DCF A;  5CVV A;  1W36 C;  4MO7 A;  1T33 A;  2L3D A;  1TQM A;  4UVB A;  2CQ7 A;  5LEK A;  5J47 A;  2HPM A;  2KP6 A;  2YR2 A;  1IZ1 A;  4PJJ A;  2CQK A;  2M4G A;  3CP8 A;  5IY5 H;  1E3P A;  3GZ6 A;  5DS9 A;  2EIM H;  2ZJ2 A;  2G7H A;  2FD5 A;  2H6C A;  4WX9 A;  3FIW A;  2HYJ A;  2Q1Z B;  2UXX A;  3BTL A;  3WGI A;  3K2A A;  3OR1 C;  4BUP A;  1B72 A;  4PDK A;  4IHV A;  3MVP A;  2ZFW A;  3K70 D;  2TRT A;  1G8X A;  3B6A A;  1TL8 A;  3OMY A;  4U0Y A;  2D1H A;  2DOF A;  5J8C A;  2XPU A;  3J81 Z;  1H9T A;  4M6Y A;  3Q0W A;  4BQQ A;  1NH3 A;  3X2Q H;  1GT0 C;  1ERD A;  2QGU A;  1W5C C;  2R3S A;  3N4M A;  2VE9 A;  1I6X A;  2BOL A;  3OSF A;  2VBW A;  2JPB A;  2PN6 A;  1B8I B;  2PI0 A;  4BXF A;  2MLK A;  3K0L A;  2KZG A;  1VQL I;  3VOD A;  4FAS D;  1MW7 A;  4C2M J;  3CCJ I;  4OMZ A;  3WTY C;  1VFC A;  2VKD A;  3E6C C;  4ZC3 A;  2CW0 F;  4BHC A;  3H9J A;  5K5R A;  1RR8 C;  2K85 A;  2DTZ A;  1R22 A;  3WU2 C;  1X19 A;  1H0M A;  2XIG A;  3A02 A;  3GFJ A;  4RB1 A;  3OYN A;  4NHJ A;  1BI2 A;  2M7A A;  2QKM B;  3TL4 X;  2XVC A;  4IF4 A;  2LKS A;  2MYS A;  4ZTF A;  2A3S A;  3JRC A;  3Q5F A;  5DUK A;  1AKH A;  3R4K A;  5E3L A;  2IEK A;  1S9H A;  1LNW A;  4GXO A;  5J4V A;  4RB0 A;  1FIA A;  5AIP A;  3IH2 A;  2MC3 A;  3GTO J;  2XUB A;  1EH7 A;  3RDI A;  3OSG A;  3NAR A;  2BY1 A;  4JYK A;  4L9T A;  5HLT A;  3TDZ C;  1JKQ C;  4L5E A;  3SFI A;  4AVP A;  3JCU C;  3IP4 B;  2DMP A;  1W1W E;  4UVA A;  1IRX A;  2HVQ A;  3L2C A;  1OCO H;  2ZFU A;  1YRN A;  2R92 J;  2DT6 A;  4A6D A;  1V54 H;  2F4O B;  1HQC A;  4XKW A;  1A04 A;  1MBK A;  1ZLK A;  3FM5 A;  1ETW A;  5LFA A;  1ZGA A;  1D0Z A;  1O3S A;  1SFO J;  3SZG A;  4XLC A;  1FWZ A;  3LL7 A;  5FRN A;  2MBF A;  1LDJ A;  4UUT A;  4PCQ A;  3ZQQ A;  1PP8 F;  3JRG A;  2YS9 A;  3L09 A;  3QYF A;  2N8G A;  1XDS A;  3GBG A;  3A2K A;  3S2H J;  4BEH A;  2DFH A;  2EFW A;  4RAG A;  5CVJ A;  2LYC A;  5E79 C;  1BI0 A;  5IP7 J;  2DMN A;  1OCC H;  3ZMD A;  2OJE D;  3LA2 A;  1RET A;  3H3V K;  4Z2Y A;  3H0G J;  3JRI A;  4F3Q A;  3EYY A;  2DK5 A;  3VDX A;  5CYV A;  1LVK A;  5FJ8 J;  4GYG A;  2E2H J;  2R5Z B;  1OCT C;  4KMF A;  4H0E A;  1YS7 A;  4RAF A;  1UFM A;  4I6Z A;  2KL4 A;  5HDG A;  1K61 A;  3KEQ A;  1Y8R B;  3VSL A;  1LEA A;  1MH4 A;  2R7T A;  2X48 A;  4OIN F;  3OIO A;  3DEU A;  3DF8 A;  4IKF A;  2DU9 A;  2X0L A;  3OYG A;  2LC2 A;  4AYB A;  2BHZ A;  4BXU A;  1DPU A;  2EJR A;  1VQO I;  4RAY A;  3FWE A;  1MMS A;  2R7R A;  1SD4 A;  4Q5S F;  2GWR A;  4MLO A;  3I64 A;  4ESF A;  5J1R A;  1B72 B;  3OS2 A;  2RKH A;  3CJR B;  5CVR A;  3KP5 A;  4LD5 A;  2STT A;  5GTI C;  2FA5 A;  1RRJ A;  5E3M A;  4C3I J;  2R7U A;  5DDG A;  3ABL H;  3HOW J;  3MFK A;  1A5J A;  2V1U A;  3K7A J;  1BN5 A;  1TT0 A;  1R23 A;  2KT0 A;  3DKW A;  5M5W J;  2IXS A;  2X6W A;  4EGZ A;  1A31 A;  4B4C A;  2IAI A;  3Q0V A;  3DP7 A;  4AIJ A;  3IC7 A;  3HRU A;  4B48 A;  3JAM K;  3ASN H;  1SAN A;  3JRD A;  2FEZ A;  3E5X A;  2ZJQ F;  4CCK A;  1BOA A;  2IGN A;  2BXY A;  2ELJ A;  2ZSH B;  1XSV A;  1JT6 A;  1Z3X A;  4L9V A;  1KQ0 A;  2DPD A;  2QBY B;  1GV2 A;  4X6A J;  3FIS A;  2FOK A;  3LQR A;  4BDZ A;  2V1X A;  1MJB A;  2E1N A;  1T0F A;  4YFX F;  2VT3 A;  2CV0 A;  1XCB A;  4RDU A;  1QVT A;  1F9N A;  3F8B A;  2BVL A;  2EV6 A;  4HRI A;  2ZXW H;  1FNN A;  1UJ8 A;  2X6X A;  2PMU A;  3O3K A;  3B6C A;  1UG2 A;  2A07 F;  4IRH A;  4HQE A;  4GO1 A;  2VOP A;  2NVY J;  3CCM I;  2B0L A;  2M0M A;  4DYR A;  4IHS A;  3AAF A;  3MCZ A;  1ZG1 A;  2NS7 A;  4GYI A;  3JW4 A;  4A3F J;  2GQQ A;  1V3F A;  5GPC A;  3HRS A;  3BOQ A;  4CCN A;  2DMT A;  1RKW A;  5M5Y J;  1ZAR A;  2HVR A;  2OBP A;  2NRA C;  4F93 B;  4IQ4 A;  1UG0 A;  1OFC X;  2FU4 A;  5D4R A;  2D5V A;  2DA3 A;  2KIS A;  2E2J J;  3WTS C;  3LSI A;  5EGO B;  5FRO A;  4JX5 A;  5DEQ A;  1XS9 A;  2W84 A;  2NVX J;  2EIJ H;  2YX7 A;  5EG0 B;  1HKS A;  3LSR A;  1VI0 A;  1Z9C A;  2B63 J;  4EM2 A;  4HX8 A;  4UVC A;  1BOB A;  3RI4 A;  3E5Q A;  5J3L A;  1LJ9 A;  2KZV A;  1JTY A;  2KRF A;  1QZY A;  3SEQ A;  3U2R A;  2GXG A;  1MND A;  3DWL E;  1FOK A;  1DGR M;  4DIQ A;  2HTS A;  4CXF A;  3H5A A;  4BQN A;  3M7G A;  4M3E A;  4KMU X;  2QEN A;  2HVS A;  2QEX I;  4G6Q A;  4M71 A;  2DA5 A;  1ZQ3 P;  3LMM A;  1X3W B;  2KFD A;  2OCC H;  3RPQ A;  3GFL A;  5FKM A;  4F91 B;  3VYU B;  3IWZ A;  4GRI A;  4WXH A;  5EYR A;  3SZT A;  3NQO A;  1SC7 A;  1CF7 A;  5HOO A;  3BPV A;  1STZ A;  1PYV A;  5LHI A;  2EIN H;  3H1C A;  3KZI C;  2R4G A;  4NC7 A;  1NG7 A;  2QSF X;  1ON1 A;  1VQ5 I;  4PJL A;  4A3C J;  2Z2S B;  1JUS A;  1OCR H;  4I09 A;  2LTP A;  4L5I A;  3AFH A;  1YX5 A;  3QPL A;  5LBQ A;  3LOC A;  1FSE A;  4EM1 A;  3K1P A;  4G6T B;  1TBX A;  2VBY A;  4EQQ A;  1GXP A;  3JSP A;  2V1D A;  2JQ7 A;  3CUQ C;  4YG2 F;  2DYR H;  3JTH A;  2M0C A;  3I54 A;  1IW7 F;  2O0Y A;  4A5N A;  1HOM A;  2OC6 A;  4FX0 A;  4XKV A;  1FC3 A;  4RMN A;  4EEF G;  1PDN C;  2DFI A;  2OUM A;  1X4O A;  4XRS G;  3M9A A;  2HWV A;  3AG2 H;  2XRL A;  3C2B A;  4KT6 A;  1KON A;  3F3X A;  4A6E A;  3G1M A;  3ABT A;  1CQT A;  4CYC B;  2L9N A;  2XHK A;  2RNG A;  2IPQ X;  5K7H A;  3HDD A;  1XGS A;  2HGC A;  5F08 A;  5C44 J;  2D45 A;  3HTS B;  1MIJ A;  3GO5 A;  1XN7 A;  5CVU A;  1FPQ A;  2DMQ A;  5HLH A;  5LHH A;  1K7A A;  1BC7 C;  5KNL A;  1PUF A;  4CZZ A;  3ECO A;  1UB9 A;  3HOZ J;  3SYT A;  4Y7N J;  5HS7 A;  3FKJ A;  1E3O C;  1LFB A;  1TP4 A;  3R60 A;  4N9I A;  3TKY A;  4ITV A;  2M34 A;  2L7M P;  3FXO A;  2XAH A;  3KE2 A;  1NHA A;  2RGV A;  5ICF A;  2DOD A;  3KCC A;  2R0Q C;  4DBR A;  3S14 J;  2H1L A;  2L02 A;  3KYL A;  3S93 A;  1SVO A;  3E5U A;  1X1B A;  5B66 C;  1PUF B;  2JN6 A;  2HR3 A;  3I9V 2;  3F21 A;  1X1C A;  1FT9 A;  5C4X J;  2ESN A;  3BG7 A;  5KAI C;  2EZK A;  2FSW A;  4CH7 A;  1B9M A;  3CJN A;  3CCL I;  4XK4 A;  2WB1 N;  3FZV A;  3H36 A;  1U9N A;  2MH9 A;  4BBR J;  3J81 K;  3TOA A;  1O3R A;  4ENM A;  4OAZ A;  4L18 B;  2AQF A;  1FP1 D;  1IN6 A;  2LY9 A;  5AIQ A;  2XAQ A;  1IUY A;  4XOR A;  5TJJ A;  4MGR A;  4RAZ A;  2E34 A;  1D5Y A;  4O3M A;  2KKO A;  4XR6 A;  1TZL A;  3TO6 A;  4AD9 A;  5J1U A;  3S2W A;  3J80 Z;  2EFQ A;  3E6M A;  1X4P A;  3WGH A;  1MBF A;  3CES A;  3ZQI A;  5GPA A;  3ZQ7 A;  4M73 A;  4CZC A;  4M74 A;  1YIJ I;  2XV4 S;  3FHZ A;  2AXT C;  2VJJ A;  2M8G X;  3OYA A;  2PJP A;  4HDV A;  5KVR A;  5JHU A;  3DFG A;  1G3W A;  2G0E A;  1ZEL A;  3J7A Y;  2QF7 A;  4U0V A;  4P55 A;  3IKT A;  4HG2 A;  2ISZ A;  2MW8 A;  2B7E A;  1SVL A;  4HF0 A;  4LMY A;  2JPC A;  3O2P E;  3LWF A;  4ZZL A;  3SEZ A;  3VEP A;  2Z5U A;  1R4M B;  4CIC A;  3FK7 A;  3NWT A;  1X1P A;  1WWX A;  4BHB A;  3CME I;  1AA7 A;  1BI1 A;  2E1M B;  5L3B A;  3HG9 A;  3GX4 X;  3EET A;  1VQP I;  1B1B A;  2XGX A;  2LDU A;  4KIT B;  1QA6 A;  1QRY A;  2X9D A;  2HYF A;  3EUH C;  4A3D J;  4CCO A;  4QTR A;  3K4K A;  2ZO4 A;  3QP5 A;  4V19 K;  3S16 J;  2L9S A;  1H88 C;  2VAS A;  1Z05 A;  2ACJ A;  1UHW A;  1Y0U A;  5CLS A;  2QSG X;  2VJ5 A;  5FB2 A;  1TWA J;  2BY2 A;  1S3J A;  4RM3 A;  2GA1 A;  1YX3 A;  4JP0 A;  4QLC U;  2X6Y A;  2P7C B;  4P96 A;  2J5P A;  2DA2 A;  4HLY A;  5D5V B;  3ZQC A;  3VFZ A;  2UWM A;  3F0C A;  4IRI A;  2ME6 A;  3E3V A;  2HI3 A;  3BG6 A;  4XLF A;  2WAF A;  3PNV A;  1ZLJ A;  2WAQ N;  2F6C A;  3DEW A;  1R71 A;  1R1V A;  5JVT A;  2KQR A;  1IV8 A;  1P2F A;  1JGS A;  2HXI A;  3FM3 A;  4A0X A;  2XF6 A;  2CUJ A;  1WJB A;  2DA4 A;  4XN0 A;  1QNT A;  2LF7 A;  3BJ6 A;  3Q9S A;  1K78 B;  3DPT A;  2ADU A;  5J40 A;  3PIO F;  4XMY A;  4J19 A;  1MBJ A;  1GVD A;  1Q1H A;  2JVG A;  2CO5 A;  4W97 A;  4LLL A;  3QQA A;  3AKZ A;  2DJI A;  2NNY A;  1DU6 A;  2DQL A;  2F5C A;  4BAC A;  2IS4 A;  1Z67 A;  1YFH A;  2HPI A;  1R9T J;  3WG9 A;  1QO0 D;  4XIC A;  1YG2 A;  4XID A;  2B9S A;  3L1P A;  4ZTJ A;  1RPW A;  2DYS H;  3IH4 A;  3CUO A;  3QPH A;  3EYI A;  3A1Y A;  1XG1 A;  3IHU A;  1UMQ A;  5D5W B;  3KP2 A;  1P7J A;  2XPW A;  1QVU A;  2TCT A;  4NUB A;  2JRT A;  3LSH A;  3LAP A;  1ENH A;  1Z6R A;  2VI6 A;  1RIO H;  3SXY A;  5DTD A;  3H5R A;  3K1N A;  2XPV A;  3T8R A;  2MGQ A;  3KZY A;  3V7C A;  2RQP A;  4LK1 F;  2M4K A;  4HSR A;  1F1Z A;  3BR2 A;  4BXX J;  2E35 A;  3IAS 2;  4ZYH A;  2R5Z A;  1IG7 A;  1GHC A;  2DLL A;  4UB8 C;  1DPR A;  3PNT A;  1YLF A;  1U5T C;  2ZJP F;  1YI2 I;  3ELK A;  1WRJ A;  2XAS A;  1MD0 A;  2WTE A;  2E5N A;  2LBF B;  1ZG3 A;  1V5E A;  4GDF A;  1VQ6 I;  3HL2 A;  2BGC A;  1WH5 A;  1TQI A;  3I55 I;  1HKQ A;  4KDP A;  2KIU A;  1APL C;  4OIP F;  4BQO A;  2KHM A;  5FKK A;  4MFD A;  4BS9 A;  2Z33 A;  2Y0S A;  3KIO A;  4KIB A;  3LAJ A;  1ONV A;  2NOJ B;  1TC3 C;  2LBF A;  3W6K B;  1K4S A;  1R1T A;  3TED A;  3BTC A;  4Z6Y A;  4I2O A;  4AIK A;  1KGS A;  3HB9 A;  4OIQ F;  1TQP A;  2VPL A;  2D1V A;  1FLI A;  3DTE A;  1QHG A;  4U87 A;  4F92 B;  2WAD A;  2K9M A;  5L3F A;  1J7K A;  2HDW A;  3MZ8 A;  4M9S A;  5HOD A;  4ANJ A;  2QVO A;  1D8K A;  1ZRE A;  3VWB A;  4AWX B;  2Q2E A;  1OKR A;  3HSF A;  5F6F A;  5F0H A;  1P4A A;  3S17 J;  2LOO A;  2V6C A;  1B9N A;  3PSI A;  2DK8 A;  1SVM A;  1T39 A;  2ZME A;  3J7Z I;  2Y48 A;  2MG4 A;  1TNS A;  2IA2 A;  1YYV A;  4D7N A;  2DFF A;  1ETV A;  5IYD J;  2CRG A;  3DU6 A;  3ZMZ A;  2R7X A;  2P0W A;  2M1B A;  3W2W A;  3BZK A;  1P7I A;  4JX6 A;  2V1N A;  3BZ6 A;  4PZJ A;  3F8M A;  3DV8 A;  3CCS I;  1WFX A;  1CGP A;  5JR3 A;  3TQN A;  2VBZ A;  4MQV A;  3HOX J;  2O03 A;  2O5R A;  2ZME B;  4C3H J;  4RGX A;  3GF2 A;  3J7A O;  5E1W A;  1MJ9 A;  1IXS B;  1S6L A;  3COA C;  4J00 A;  1I3A A;  2FQ3 A;  4LIU A;  3FMQ A;  5CQG A;  1K6Y A;  2YUS A;  2BZT A;  5LHG A;  2X6O A;  1T95 A;  4RLF A;  2F4M B;  4IX7 A;  1SD7 A;  4RGU A;  3C2G A;  3TW7 A;  2CYY A;  5TIS C;  9ANT A;  5JFR A;  1FMV A;  2QUF A;  2HEO A;  2LF8 A;  4PUS A;  1XGO A;  2K5C A;  2NVU B;  1BJA A;  4CUG A;  3I4M J;  3A01 B;  1UAA A;  4BGD A;  3L00 A;  4I7H A;  2K3P A;  5JHF A;  3KFW X;  3PO2 J;  1IXC A;  4YIF A;  3IV5 A;  2XSD C;  2G9W A;  1LQ1 A;  2MD5 A;  4OU0 A;  1MMN A;  4ON0 A;  2LMD A;  4IPA A;  2EK5 A;  3BG5 A;  2JRM A;  5B5E C;  5CPR B;  1MJA A;  3DBL B;  4O5V A;  4WWC A;  5D8L B;  2VT2 A;  3R0A A;  2HOA A;  4F55 A;  1D1A A;  3P9K A;  2MFZ A;  1OYW A;  2RVC A;  4HX4 A;  1QU3 A;  2W7N A;  2RQQ A;  3HPH A;  1W5S A;  4D5F A;  3BQY A;  2V9V A;  3J7Y J;  4E6K G;  2K9Q A;  1LUJ B;  5F04 A;  5TRD A;  4M6X A;  3LA7 A;  3G3Z A;  2EZH A;  5FLV A;  2F5E A;  1V5G A;  4E7I A;  3S1Q J;  1BW5 A;  2W57 A;  2WV1 A;  1XD7 A;  2QWW A;  2VXZ A;  4C3J J;  1SAX A;  1G4D A;  2HZT A;  1WI3 A;  2WA0 A;  3ABU A;  3WTU C;  1GV5 A;  2JSC A;  1T8I A;  1FIP A;  3TW6 A;  1ODD A;  4BJ6 C;  5B1B H;  3JSO A;  3GVA A;  1AHD P;  4WF2 A;  3Q9V A;  3L2W A;  3HXL A;  4ESJ A;  3WTX C;  2JA8 J;  3K69 A;  2V9K A;  3IRR A;  2WB1 A;  5HVQ C;  5ICG A;  4NB5 A;  4TV7 A;  2BW3 B;  2XAG A;  3SQN A;  3T1B A;  4B3X A;  5E18 F;  2OQR A;  1SFU A;  4A3G J;  4J01 A;  4EV0 A;  1OPC A;  2WAE A;  3W3C A;  2ZBK A;  4ENK A;  1G3S A;  1FTT A;  1N75 A;  5BNG A;  1W7P D;  3HYI A;  4C30 A;  1SFK A;  2A6H F;  2CSO A;  4S04 A;  3I53 A;  3MKW B;  3OL3 A;  2AO9 A;  3JR9 A;  2EFP A;  3HOY J;  2EFO A;  2JVH A;  1AWC A;  2K9S A;  2Y2Z A;  4FCY A;  1P6R A;  1A35 A;  4ZJZ A;  4O6J A;  4CO8 A;  4Q4Z F;  1TTY A;  3R6S A;  4L5J A;  2CQN A;  2DTR A;  5DM6 F;  2HKX A;  3DQV C;  2HFH A;  2M8E A;  3ZMU A;  3KEY A;  5LLQ A;  2XKO A;  1OR7 A;  3MEX A;  1UHM A;  2GZW A;  1QZZ A;  2WV0 A;  4BKX A;  1UZC A;  3GW2 A;  3QOE A;  3GYH X;  3ABK H;  4BNC A;  2RC4 A;  3BG3 A;  4E7Z A;  5LRS A;  3WTZ A;  1IRF A;  3TP3 A;  3G71 I;  4NC6 A;  4OWR B;  2FNP A;  4WK8 F;  3DBH B;  3FXQ A;  2ZSI B;  2HOE A;  1TWF J;  2JWT A;  4JK1 X;  2BYV E;  4DBQ A;  3J80 K;  2VLA A;  4XSX F;  4QPQ A;  1XTA A;  3K4J A;  3WGG A;  3HHG A;  2P7V B;  3PFY A;  2DOA A;  2AXL A;  4QWQ A;  2Z16 A;  1WJA A;  5LGT A;  2GXB A;  3LFU A;  1H9G A;  2QA4 I;  1XSD A;  3MKZ A;  1XX5 A;  5KAF C;  1LFU P;  5EF6 A;  3O6B B;  1VZ0 A;  4I02 A;  3RYP A;  2E7X A;  2CG4 A;  3OV8 A;  4AUX A;  3K4B A;  3QPS A;  2A61 A;  4A3L J;  4RS8 A;  3GZN B;  4XLN F;  2NS8 A;  1REP C;  1NK3 P;  4JBA A;  1DU0 A;  1EV7 A;  2ZB9 A;  2DT5 A;  3IAM 2;  3PJR A;  4XM3 A;  2EBI A;  3TP0 A;  2KMU A;  5FLX Z;  5KCM A;  4M9X A;  2FNA A;  3ZXS A;  3KEO A;  2OF7 A;  2YSR A;  2R7W A;  1IJW C;  3IH3 A;  3IKV A;  1HW1 A;  4N4N B;  1BM9 A;  1L3L A;  4HPQ A;  5ICE A;  2W25 A;  1YOV B;  2KIF A;  3HJE A;  3LSG A;  1MMD A;  5DD8 A;  4AM3 A;  3L2R A;  4GFB A;  2X1C A;  2PX9 A;  3DPL C;  3OIQ A;  2NYX A;  3W6J B;  4F52 A;  2XGD A;  3PSF A;  5C3E J;  5FGM A;  1IF1 A;  5JVG F;  5L3E A;  2JA5 J;  5CQE A;  4EJT A;  3OYM A;  2EZI A;  1M1E B;  2J5O A;  4YEJ A;  2PJR B;  3WU0 A;  4DYC A;  1B6A A;  2RRE A;  1HXD A;  2Z9O A;  2DCE A;  1RNL A;  2DT7 B;  2HYG D;  5FO5 A;  1WPK A;  2A6E F;  3DXJ F;  4RB3 C;  5BPD A;  1SD5 A;  3OYF A;  3RQI A;  4U0W A;  3KP6 A;  4UHT A;  2A5W A;  1ZN2 A;  2DPU A;  2JA7 J;  5GP9 A;  2DDB A;  4YEL A;  2M45 A;  3HBL A;  4Q47 A;  5LGU A;  1VQK I;  4L9N A;  4DNC A;  4LB5 A;  4WCG A;  3P9I A;  3HUG A;  4K2E A;  3K6G A;  1D1B A;  1OCZ H;  3M8F A;  2NAZ A;  3HZJ A;  2FBK A;  4Q48 A;  3EUK L;  5B1A H;  2KRH A;  1W36 D;  4NBQ A;  1BIA A;  1ZTR A;  4IL6 C;  3WOD F;  5IOZ A;  3CUQ A;  2CW8 A;  3CJT B;  5HS8 A;  3AL0 B;  2PMZ A;  2H6B A;  3QOD A;  3WHC A;  3K1M A;  1EJ9 A;  2IT0 A;  5TGT A;  4AID A;  2LKX A;  3C1D A;  3BR6 A;  3I59 A;  2R7D A;  1TNT A;  2QQ9 A;  3KX2 A;  2KIQ A;  2XAJ A;  4KUM A;  1XMX A;  4PJN A;  3FDY A;  2AHQ A;  1Y39 A;  1J9I A;  3PUF A;  2W82 A;  5E1Z B;  1HW5 A;  2HOS A;  1R36 A;  3KP3 A;  2VJI A;  3FXJ A;  2F48 A;  3FMR A;  5FFX A;  4G6D A;  3HGG A;  1HKT A;  2ME0 A;  2ZNZ A;  2GOX B;  4B44 A;  3JAM Z;  2LVS A;  2OPT A;  1QPM A;  4KA4 A;  1V55 H;  2EA4 A;  1ETO A;  1E3H A;  3DCF A;  4LLG F;  1YJN I;  1A6I A;  4U7D A;  3KLN A;  4LOC A;  2K86 A;  5DV5 A;  1Z7U A;  1X58 A;  1N78 A;  2GBY A;  2ISY A;  2EPF A;  2KJC A;  3CDH A;  3CCV I;  4GCV A;  3CMA I;  1WQ2 A;  2R5Y A;  1FJL A;  4II3 A;  4CCM A;  2Z99 A;  3AL0 C;  1WKM A;  4PSX A;  3M4O J;  1Z0X A;  4I01 A;  2HXO A;  4JX4 A;  1IRG A;  4E7S A;  1YTY A;  1GUU A;  5FD5 A;  4A0Y A;  2JJ7 A;  1J0R A;  1IDY A;  4AYB N;  3EUA A;  3ZR8 X;  3I71 A;  2P4W A;  5BS6 A;  3ML6 A;  2QM3 A;  2HNH A;  3ZN0 A;  2DA6 A;  3HKZ A;  3D0S A;  2BEO A;  2A5Y B;  4YIR X;  1O3Q A;  3ZQL A;  1FYM A;  3W2A A;  2M9H A;  4IOC F;  1MDM A;  1W5T A;  2CFO A;  4P9F A;  2CW7 A;  4KIS A;  5DD4 A;  2F5F A;  3BC8 A;  2M2E A;  1IN7 A;  1HST A;  2VC1 A;  4A3M J;  2MSY A;  2WAQ A;  2XAU A;  1YIT I;  1OYY A;  4KJZ A;  4D0P A;  1YHQ I;  3GTP J;  1G6N A;  4G7H F;  4ASN A;  4P9U A;  3EDP A;  4NDL A;  1MMA A;  1IDZ A;  2CQQ A;  3HSE A;  1MSF C;  2HTJ A;  5FLM J;  1ZR4 A;  2K02 A;  3JRA A;  1T0F C;  4UB6 C;  1JT0 A;  2EIK H;  2MC4 A;  2V7F A;  4A93 J;  2JA2 A;  2VKE A;  1AKH B;  4CGZ A;  2OA4 A;  1FOX A;  2R7F A;  2FMY A;  3BCB A;  2E7W A;  3O8H A;  4ZH4 F;  1FBU A;  3A4C A;  3DEE A;  1FZP B;  2EV0 A;  3KYD B;  3FHN A;  5EEH A;  5HLI A;  2W00 A;  3AG3 H;  2DJN A;  1X1D A;  4KNY A;  2CS3 A;  4ZYG A;  4LJZ F;  3LNQ A;  2YPR A;  3S1N J;  4EVI A;  1B59 A;  3S1R J;  3W2V A;  3DLL F;  2IBD A;  1I1G A;  2Q8K A;  4ZYD A;  1O57 A;  3GME A;  5F27 A;  3O8G A;  1GVJ A;  3OOU A;  3P5J A;  2W48 A;  2OV7 A;  1T38 A;  3U1D A;  1BIB A;  4XSZ F;  2CUZ A;  4D9J A;  2PLY A;  1OYI A;  2VKH A;  1W7P A;  3OOP A;  3U21 A;  4BE1 A;  1JHF A;  3UR3 C;  1WJD A;  3C18 A;  1T08 B;  5EG0 A;  4CSW A;  1K6O A;  2HQA A;  4XOP A;  5GAG J;  4WXD A;  1N25 A;  3TO9 A;  4R8H A;  2CFX A;  4I0A A;  1MBH A;  2IP2 A;  2LP0 A;  2HZD A;  5JLW A;  4HNU A;  3ZQG A;  1N77 A;  4I98 B;  5F64 A;  3D5S C;  1OJL A;  1S29 A;  1R5I D;  3CP2 A;  3NWS A;  1R5G A;  3NRV A;  1A36 A;  4AU7 A;  2CJJ A;  5LGN A;  2HKO A;  5E8G A;  4M3F A;  1O7F A;  1UST A;  2LY2 A;  3OWT A;  1ZAO A;  3JRH A;  2IA0 A;  4OAY A;  3RTR A;  4EM0 B;  3CCY A;  3BRO A;  4L0Y B;  1S5L C;  1WVR A;  2E36 A;  1YIO A;  3M8J A;  3WE2 A;  3HRT A;  2W24 A;  5HNH A;  4X0G A;  1FSH A;  4A2U A;  1JJ6 C;  1HDD C;  4MHG A;  3TBI A;  5EDN A;  1IAW A;  1KA8 A;  4A5M A;  4BHP A;  1X2N A;  2QQA A;  2VOD A;  3KP4 A;  1G2H A;  2V79 A;  5IP6 A;  4HNV A;  2XRO A;  3HGY A;  2RDP A;  2VJ4 A;  4EGY A;  4E7J A;  4S0H B;  1JKP C;  3CDI A;  3VSK A;  1P9Q C;  2Y30 A;  1I3Q J;  1X3U A;  1RR7 A;  2H1K A;  3GWZ A;  3CO7 C;  2JK3 A;  3I5U A;  2I5U A;  1BR1 A;  2KDO A;  2X51 A;  2L7F P;  5K1Y A;  1PP7 U;  2Y75 A;  5DM7 F;  2CH0 A;  4M9Z A;  3RQ4 A;  1ZG5 A;  4UUV A;  4AIH A;  4DGW B;  3TMO A;  1PVE A;  2PMH A;  4MTD A;  2E5Z A;  4IHT A;  2FE3 A;  2ELK A;  1H89 C;  1ON2 A;  4XOT A;  1K78 A;  5JLX A;  1ULY A;  1WCM J;  3BR5 A;  3MZH A;  3C7J A;  3CCE I;  3S3M A;  4EMS A;  3U1K A;  2FJ1 A;  5DUI A;  3S3O A;  1Y6I A;  3BR0 A;  2V4J C;  1WJC A;  2VQH A;  4E7L A;  3Q3S A;  4DQ2 A;  3FX3 A;  1E17 A;  1L0O C;  4BDY A;  1WZ2 A;  3FXR A;  3F22 A;  2MLG A;  2DDA A;  2H94 A;  5E3O A;  3PFI A;  3L2V A;  4ZDO A;  1FY7 A;  3OYC A;  2JTV A;  2JUC A;  3OIP A;  2ID6 A;  3DLA A;  2K4J A;  2VPR A;  2XSJ C;  5D4S A;  2K3F A;  2M7B A;  2ZXH A;  2ZKZ A;  3P9C A;  1DP7 P;  1SMT A;  4KFC A;  3FBI B;  1TT5 B;  4AC0 A;  3CF2 A;  2Y69 H;  3RCO A;  2HDD A;  2IS1 A;  2O8X A;  1J2X A;  5LEJ A;  1FEX A;  3ZPL A;  3ISP A;  5IYB J;  2P5V A;  5H2F C;  1FYK A;  1HC8 A;  2DA7 A;  1WJF A;  2GOM A;  3BZC A;  2DI3 A;  5D8K B;  1HCR A;  4YFK F;  1ETK A;  5E8I A;  2EIL H;  4NQW A;  3WE3 A;  4BJ5 C;  2LY1 A;  2IGO A;  2LKP A;  1IN8 A;  3CLQ A;  3K4C A;  2CV1 A;  3H92 A;  1R1U A;  2BY3 A;  2ID3 A;  2EQR A;  4IRG A;  3GZ5 A;  4BBS J;  3GTG J;  1YW7 A;  4JQF A;  3FXU A;  3HUG B;  2CMP A;  1MZB A;  1J59 A;  2R7Z J;  3BG9 A;  3N97 A;  2K7L A;  3I56 I;  1OLT A;  4M3D A;  4GGG A;  1ZGJ A;  3U9G A;  3I0T A;  5GAD J;  2M3A A;  1ZKG A;  1YW9 A;  1WHU A;  1HSJ A;  2K9L A;  4AVZ A;  1X1A A;  3BDD A;  4II2 A;  5A2Q K;  4ENJ A;  4G7Z F;  4CA0 A;  2LRE A;  1TWC J;  2VKV A;  3LSK A;  1MNM C;  2L54 A;  5DCM B;  1R6R A;  3WG7 H;  3ULQ B;  2XC7 A;  2IS2 A;  1W4M A;  3CZ6 A;  5K5Q A;  4CYC A;  3CCR I;  4LGW A;  5J6X A;  4CDG A;  3G73 A;  1LB2 A;  3KET A;  1U0J A;  2LLK A;  3MQ0 A;  4HBL A;  4PJ0 C;  5EEG A;  3BJA A;  3OYB A;  3DTK A;  3K2Z A;  1FBS A;  2OZU A;  2YU9 J;  1JTX A;  4KYW A;  1XC5 A;  2Y0M A;  4XKC A;  2JMW A;  3HOU J;  3H9G A;  3L2U A;  2L9R A;  4KIF A;  3KLO A;  4RGR A;  4E70 A;  4CYD A;  2COB A;  1VQ8 I;  5IT9 Z;  5BOX A;  1VQ4 I;  3HOV J;  2LD5 A;  3I58 A;  2H8R A;  5L3C A;  3IUO A;  3V7S A;  1XPX A;  1S7O A;  1YJW I;  1XSX A;  2ZJR F;  1KQ9 A;  3F8C A;  5FFZ A;  2L7Z A;  3S3N A;  3LFK A;  5EZG A;  2E71 A;  3HKZ N;  3PL8 A;  2MH2 A;  5ILS A;  2VC0 A;  1C0W A;  4DZJ A;  3VYT B;  4B1R A;  2KRC A;  2O7O A;  3L2Q A;  1JXS A;  1ITY A;  3DPU A;  3BT9 A;  2GLO A;  2Y9Z A;  3V8J A;  2FBI A;  2VQL A;  1QQI A;  1QBJ A;  1J09 A;  3S2D J;  1MMG A;  2PG4 A;  2IGM A;  2K40 A;  3V7R A;  2HS5 A;  2NS0 A;  1FBQ A;  2EV5 A;  4KIG A;  4FIS A;  4LIV A;  2WY8 Q;  1BR4 A;  3V8K A;  2DAO A;  2R7Q A;  2NVT J;  2E2I J;  1VQ9 I;  2STW A;  3E97 A;  1G3T A;  3GUD A; 
#chains in the Genus database with same CATH homology
 1FX7 A;  3F8F A;  2QLZ A;  2ELH A;  3HSR A;  1U3E M;  5IT3 A;  3R61 A;  2L01 A;  2XRN A;  4F7Z A;  3H3U A;  1P4W A;  3T0Y A;  3ZMS A;  2OU2 A;  2M30 A;  5BPI A;  1O7L A;  5DYM A;  4HF1 A;  3T5X A;  3V4G A;  1E2X A;  3PQJ A;  2KIM A;  2F5D A;  3RYR A;  5H6R A;  5LRR A;  2WWY A;  4G7O F;  4Y13 A;  3EUH A;  3FF5 A;  2DBB A;  3QU6 A;  2K4B A;  2Q0O A;  4L0Z B;  1KYW A;  2JT1 A;  3RKY A;  1S7A A;  3HOS A;  2P6S A;  1ZRC A;  2M87 A;  3RKW A;  1YS6 A;  2BE5 F;  5L3G A;  1U5T B;  2UXN A;  3I59 B;  1OMI A;  4FHT A;  2O3F A;  3BP8 A;  2QZ8 A;  4Y15 A;  4U7B A;  3IWF A;  4N9H A;  5CJ9 A;  1RUN A;  3NEU A;  1ZRF A;  4LK0 F;  2A69 F;  1D3Y A;  2P5L C;  2BV6 A;  1LDK B;  3CUQ B;  1XMA A;  4LG0 A;  2ESH A;  5BMZ A;  4OOI A;  2OD5 A;  4LLN A;  1I1S A;  4I0B A;  4G94 A;  2P8T A;  1KU9 A;  2GAU A;  3ECH A;  1XCV A;  2O6G E;  3QRF F;  1R5H A;  1R58 A;  3SHF A;  3WTV C;  4B09 A;  1R7J A;  3B73 A;  4YFN F;  4KIC A;  5HS9 A;  3HIF A;  4HF2 A;  2EA2 A;  4LB6 B;  2DQR A;  3SFZ A;  5E1X A;  4UNO A;  1Z6T A;  4EJV A;  1UCR A;  3BWG A;  1U2W A;  3IL2 A;  4UXN A;  4ETS A;  1HBX G;  3R0J A;  2VE8 A;  2XKP A;  1I27 A;  1SMY F;  4YII A;  2LSO A;  4HX7 A;  2VOO A;  1CF7 B;  3KZZ A;  4WXC A;  3GEZ A;  2O61 A;  4XRF A;  2P6T A;  3GXO A;  3T8T A;  3BPX A;  1KU7 A;  1KQ8 A;  5D6E A;  3QOP A;  5ILV A;  2TDX A;  1J5Y A;  3F6O A;  2IA1 A;  1EH6 A;  2OZ6 A;  4U88 A;  4ZZD A;  3V8L A;  5L3D A;  5JI6 A;  1TLH B;  3L7W A;  1K79 A;  2VN2 A;  2DW4 A;  3IRQ A;  2FBH A;  2GA2 A;  1IXR C;  1V4R A;  4BQA A;  5ERI A;  1SD6 A;  3WTT C;  1B4A A;  1U5T A;  4OIO F;  4HV6 A;  4S05 A;  5HLG A;  1ZH5 A;  3QAH A;  3VOE A;  2FF4 A;  4XBF A;  4LG0 B;  5ED4 A;  1U78 A;  1GXQ A;  2PFB A;  2E1C A;  2D2W A;  1D8J A;  3F72 A;  5E17 F;  1J75 A;  4BH9 A;  5K5O A;  4B8X A;  2YU3 A;  4G9Y A;  2K27 A;  3GFI A;  1T98 A;  3BJO A;  3D5L A;  3MAJ A;  2VON A;  4Y17 A;  4HW0 A;  3ERE D;  1AOY A;  4MQ9 F;  1IN4 A;  3WTW C;  3PQK A;  3JTG A;  2VBX A;  3QU3 A;  3HOT A;  2FML A;  4CHU A;  4BAY A;  5E20 A;  1Z1D A;  2M5W A;  2ZNY A;  3H3Z A;  2BBY A;  3ZMV A;  4KN4 X;  2F2E A;  3RPU A;  1SFX A;  5AON A;  5IT9 K;  1VTN C;  3E6B A;  1JE8 A;  1LEB A;  2MA3 A;  4A12 A;  2A68 F;  4HYE A;  3CLO A;  2EFN A;  4HLX A;  2NNN A;  2H27 A;  2QQB A;  4MNU A;  2PQ8 A;  3ZN1 A;  3M8E A;  3ZMT A;  3BY6 A;  4RB2 C;  1U8R A;  5FD6 A;  1T2K A;  4HOB A;  3TGN A;  4MEX F;  1IN5 A;  2HQN A;  2RV8 A;  2P5K A;  1USS A;  2JZY A;  3L9F A;  3E6D A;  4OMY A;  1JHH A;  1YO5 C;  2HQR A;  1P4X A;  1WSU A;  2HDC A;  1EH8 A;  3HTU A;  3REO A;  4FX4 A;  4HA8 A;  1F5T A;  1Z91 A;  1T6S A;  5ICC A;  1RZ4 A;  3VB2 A;  2KJB A;  5HDK A;  4ESB A;  2PBI A;  1FP2 A;  3I4P A;  3WU1 B;  2LNB A;  2W85 A;  1BI3 A;  3QP6 A;  5ILU A;  2UZK A;  3CO6 C;  3F6V A;  4KN7 X;  3GFM A;  1PUE E;  4HAM A;  3EQL F;  3HHH A;  4IXA A;  2DO7 A;  2FXA A;  2H09 A;  3F23 A;  1XMK A;  4HZF A;  5D5X B;  3LQQ A;  1D5V A;  6PAX A;  2L4A A;  2ZXJ A;  3K9T A;  1R00 A;  5D5U B;  2OQG A;  1XDU A;  4EJO A;  2ETH A;  2IJL A;  2RN7 A;  2QYO A;  4IJA A;  2G7U A;  1KYZ A;  5HDN A;  1O3T A;  4R1H A;  1RI7 A;  4OIR F;  4PGG A;  3GLX A;  3LA3 A;  2COM A;  2GIV A;  5A2Q Z;  2C6Y A;  1YW8 A;  2CWE A;  5DCM A;  1ZRD A;  3B02 A;  3TDU C;  3LST A;  3TO7 A;  4BYY A;  4RGS A;  1ZHF A;  1U6G A;  1XGM A;  3FMS A;  3TOB A;  4EJW A;  4XLP F;  2IRF G;  2PEX A;  5H20 A;  1LDD A;  2EB7 A;  2Z3Y A;  3HRM A;  4IVN A;  2CGP A;  2WC2 A;  1XGN A;  5D6F A;  5BQT A;  4KT5 C;  3ROU A;  1KU3 A;  4UV8 A;  4FT8 A;  1HW2 A;  2L4M A;  4HDU A;  1BBY A;  1BC8 C;  3ZP5 A;  1QGP A;  4PGH A;  1TW2 A;  2AS5 F;  4L9J A;  2IVM A;  4M72 A;  5FLX K;  1W7P B;  3P7N A;  5KK1 A;  3M1E A;  3KP7 A;  1DDN A;  2RNJ A;  2QBY A;  1P92 A;  3MWM A;  1TW3 A;  2X4H A;  4HV5 A;  5J8F A;  2IW5 A;  1SFE A;  4ZYE A;  1G3Y A;  1LVA A;  1I5Z A;  4P5O A;  1KU2 A;  3MZY A;  4R79 A;  3C3W A;  1YQA A;  1FYL A;  1RUO A;  4HQM A;  5CVI A;  2XAF A;  4LFU A;  2OAZ A;  3RJP A;  5F1R A;  1S8N A;  1F4K A;  2FRH A;  4UV9 A;  4EJU A;  2ZCW A;  1ZYR F;  1XB4 A;  2YX4 A;  2EWN A;  1DUX C;  4N0B A;  3RKX A;  4G8X A;  1WI9 A;  4MTE A;  1MKM A;  3CTA A;  4A0Z A;  3QPT A;  5H6Q A;  3RIR A;  4ENN A;  4MEY F;  1MGT A;  1MDM B;  3SZP A;  3F8N A;  5DCF A;  5CVV A;  2L3D A;  1TQM A;  4UVB A;  5LEK A;  2YR2 A;  1IZ1 A;  2CQK A;  3GZ6 A;  2ZJ2 A;  2G7H A;  2H6C A;  4WX9 A;  3WGI A;  2UXX A;  4PDK A;  2ZFW A;  4U0Y A;  2D1H A;  5J8C A;  3J81 Z;  1H9T A;  4M6Y A;  2R3S A;  3N4M A;  2VE9 A;  1I6X A;  2VBW A;  2JPB A;  2PN6 A;  2PI0 A;  2MLK A;  3K0L A;  3VOD A;  4OMZ A;  3WTY C;  3E6C C;  2CW0 F;  4BHC A;  5K5R A;  1R22 A;  1H0M A;  2XIG A;  3GFJ A;  4RB1 A;  4NHJ A;  1BI2 A;  2XVC A;  4IF4 A;  2A3S A;  3Q5F A;  5DUK A;  3R4K A;  4GXO A;  1LNW A;  4RB0 A;  5AIP A;  2MC3 A;  2XUB A;  1EH7 A;  3RDI A;  4L9T A;  3TDZ C;  4AVP A;  4UVA A;  3L2C A;  4A6D A;  1HQC A;  1A04 A;  1ZLK A;  3FM5 A;  1O3S A;  1ZGA A;  1FWZ A;  2MBF A;  1LDJ A;  4PCQ A;  1PP8 F;  3L09 A;  1XDS A;  2EFW A;  5CVJ A;  1BI0 A;  3ZMD A;  3LA2 A;  4Z2Y A;  3EYY A;  2DK5 A;  5CYV A;  4GYG A;  4KMF A;  4H0E A;  1YS7 A;  1UFM A;  5HDG A;  3KEQ A;  1LEA A;  4OIN F;  3DEU A;  3DF8 A;  2DU9 A;  2X0L A;  4BXU A;  1DPU A;  2EJR A;  4RAY A;  3FWE A;  1SD4 A;  4Q5S F;  2GWR A;  3I64 A;  4ESF A;  2RKH A;  5CVR A;  3KP5 A;  4LD5 A;  2STT A;  2FA5 A;  5DDG A;  3MFK A;  2V1U A;  1BN5 A;  1R23 A;  3DKW A;  4EGZ A;  3DP7 A;  4AIJ A;  3IC7 A;  3HRU A;  3JAM K;  2FEZ A;  3E5X A;  1BOA A;  1XSV A;  4L9V A;  1KQ0 A;  2DPD A;  2QBY B;  2FOK A;  3LQR A;  2V1X A;  1MJB A;  2E1N A;  1T0F A;  4YFX F;  2VT3 A;  1XCB A;  1F9N A;  3F8B A;  2EV6 A;  1FNN A;  2PMU A;  3O3K A;  2A07 F;  4IRH A;  4HQE A;  4GO1 A;  2VOP A;  2B0L A;  4IHS A;  3AAF A;  3MCZ A;  1ZG1 A;  4GYI A;  3JW4 A;  2GQQ A;  1V3F A;  3HRS A;  3BOQ A;  1ZAR A;  2OBP A;  2NRA C;  2FU4 A;  5D4R A;  3WTS C;  5DEQ A;  2W84 A;  2YX7 A;  1HKS A;  1Z9C A;  4EM2 A;  4HX8 A;  4UVC A;  3RI4 A;  3E5Q A;  1LJ9 A;  2KRF A;  1QZY A;  3U2R A;  2GXG A;  1FOK A;  2HTS A;  4CXF A;  3M7G A;  4KMU X;  2QEN A;  4G6Q A;  4M71 A;  3RPQ A;  3GFL A;  3IWZ A;  4WXH A;  3SZT A;  3NQO A;  1CF7 A;  5HOO A;  3BPV A;  1STZ A;  5LHI A;  1ON1 A;  4I09 A;  4L5I A;  5LBQ A;  1FSE A;  4EM1 A;  3K1P A;  1TBX A;  2VBY A;  4EQQ A;  1GXP A;  3JSP A;  2V1D A;  3CUQ C;  4YG2 F;  3JTH A;  3I54 A;  1IW7 F;  2O0Y A;  4A5N A;  4FX0 A;  1FC3 A;  1PDN C;  2DFI A;  3M9A A;  2HWV A;  3F3X A;  4A6E A;  3ABT A;  2XHK A;  2IPQ X;  1XGS A;  2HGC A;  2D45 A;  3HTS B;  3GO5 A;  1XN7 A;  5CVU A;  1FPQ A;  5HLH A;  5LHH A;  1K7A A;  1BC7 C;  4CZZ A;  3ECO A;  1UB9 A;  5HS7 A;  3R60 A;  4N9I A;  3TKY A;  2XAH A;  3KE2 A;  1NHA A;  2RGV A;  5ICF A;  3KCC A;  2L02 A;  3E5U A;  2HR3 A;  3F21 A;  1FT9 A;  2ESN A;  2FSW A;  1B9M A;  3CJN A;  3FZV A;  3J81 K;  2MH9 A;  3TOA A;  1O3R A;  4ENM A;  4L18 B;  1FP1 D;  1IN6 A;  5AIQ A;  2XAQ A;  1IUY A;  5TJJ A;  4MGR A;  4RAZ A;  4O3M A;  2KKO A;  3TO6 A;  4AD9 A;  3S2W A;  3J80 Z;  2EFQ A;  3E6M A;  3WGH A;  3ZQ7 A;  4M73 A;  4M74 A;  2XV4 S;  3FHZ A;  2PJP A;  4HDV A;  5KVR A;  5JHU A;  3DFG A;  1G3W A;  4U0V A;  3IKT A;  4P55 A;  2ISZ A;  4HF0 A;  4LMY A;  2JPC A;  3O2P E;  3LWF A;  4ZZL A;  3VEP A;  2Z5U A;  4CIC A;  1WWX A;  4BHB A;  1BI1 A;  5L3B A;  3GX4 X;  3EET A;  1B1B A;  2XGX A;  2LDU A;  2HYF A;  3QP5 A;  2ZO4 A;  1Z05 A;  2ACJ A;  1UHW A;  1Y0U A;  5CLS A;  5FB2 A;  1S3J A;  2GA1 A;  4QLC U;  2P7C B;  4P96 A;  2J5P A;  4HLY A;  5D5V B;  2UWM A;  3VFZ A;  4IRI A;  3E3V A;  1ZLJ A;  1R1V A;  5JVT A;  1P2F A;  1JGS A;  3FM3 A;  4A0X A;  1QNT A;  2LF7 A;  3BJ6 A;  3Q9S A;  1K78 B;  3DPT A;  2ADU A;  1Q1H A;  2CO5 A;  4LLL A;  2NNY A;  2DQL A;  2F5C A;  1YFH A;  3WG9 A;  1QO0 D;  1YG2 A;  3CUO A;  3QPH A;  3EYI A;  3IHU A;  5D5W B;  3KP2 A;  2JRT A;  3LAP A;  1Z6R A;  1RIO H;  3SXY A;  3K1N A;  3T8R A;  3KZY A;  3V7C A;  2RQP A;  4LK1 F;  1F1Z A;  4ZYH A;  1GHC A;  2DLL A;  1DPR A;  1YLF A;  1U5T C;  3ELK A;  1WRJ A;  2XAS A;  1MD0 A;  2WTE A;  1ZG3 A;  2BGC A;  1TQI A;  4KDP A;  1HKQ A;  2KIU A;  4OIP F;  2Z33 A;  4KIB A;  3LAJ A;  1ONV A;  3W6K B;  1R1T A;  4I2O A;  4AIK A;  1KGS A;  4OIQ F;  1TQP A;  2D1V A;  1FLI A;  5L3F A;  1J7K A;  4M9S A;  1ZRE A;  2QVO A;  1D8K A;  4AWX B;  2Q2E A;  1OKR A;  3HSF A;  5F6F A;  1P4A A;  2V6C A;  1B9N A;  2DK8 A;  1T39 A;  2ZME A;  2Y48 A;  1TNS A;  2IA2 A;  1YYV A;  3ZMZ A;  2M1B A;  3BZ6 A;  4PZJ A;  3F8M A;  3DV8 A;  1CGP A;  5JR3 A;  3TQN A;  2VBZ A;  4MQV A;  2O03 A;  2ZME B;  4RGX A;  3GF2 A;  3J7A O;  5E1W A;  1MJ9 A;  1IXS B;  1S6L A;  3COA C;  2FQ3 A;  3FMQ A;  5LHG A;  1SD7 A;  4RGU A;  2CYY A;  5JFR A;  2QUF A;  2HEO A;  2LF8 A;  1XGO A;  1BJA A;  3L00 A;  4I7H A;  3KFW X;  1IXC A;  4YIF A;  2G9W A;  1LQ1 A;  2MD5 A;  4OU0 A;  4ON0 A;  4IPA A;  2EK5 A;  1MJA A;  4O5V A;  4WWC A;  5D8L B;  2VT2 A;  3R0A A;  3P9K A;  1OYW A;  2RVC A;  4HX4 A;  1W5S A;  2V9V A;  5TRD A;  4M6X A;  3LA7 A;  3G3Z A;  2F5E A;  2W57 A;  1XD7 A;  2QWW A;  2VXZ A;  1SAX A;  1G4D A;  2HZT A;  3ABU A;  3WTU C;  2JSC A;  1ODD A;  3JSO A;  3GVA A;  4WF2 A;  3Q9V A;  4ESJ A;  3WTX C;  3K69 A;  3IRR A;  5HVQ C;  5ICG A;  4NB5 A;  4TV7 A;  2XAG A;  3SQN A;  3T1B A;  5E18 F;  2OQR A;  1SFU A;  4EV0 A;  1OPC A;  2ZBK A;  4ENK A;  1G3S A;  1W7P D;  3HYI A;  2A6H F;  2CSO A;  4S04 A;  3I53 A;  2EFP A;  2EFO A;  1AWC A;  1P6R A;  4O6J A;  4CO8 A;  4Q4Z F;  1TTY A;  3R6S A;  4L5J A;  2DTR A;  2HKX A;  3DQV C;  2HFH A;  2M8E A;  3ZMU A;  5LLQ A;  2XKO A;  1OR7 A;  3MEX A;  2GZW A;  1UHM A;  1QZZ A;  2WV0 A;  3GW2 A;  3GYH X;  4BNC A;  2RC4 A;  5LRS A;  3WTZ A;  1IRF A;  4WK8 F;  2FNP A;  3FXQ A;  2HOE A;  4JK1 X;  2BYV E;  3J80 K;  4XSX F;  3WGG A;  3HHG A;  2P7V B;  2AXL A;  4QWQ A;  5LGT A;  2GXB A;  1H9G A;  1XSD A;  3O6B B;  4I02 A;  3RYP A;  2E7X A;  2CG4 A;  3OV8 A;  2A61 A;  4RS8 A;  4XLN F;  1REP C;  4JBA A;  1EV7 A;  2DT5 A;  5FLX Z;  4M9X A;  2FNA A;  3KEO A;  2YSR A;  3IKV A;  1HW1 A;  1BM9 A;  1L3L A;  5ICE A;  2W25 A;  2KIF A;  5DD8 A;  3DPL C;  2NYX A;  3W6J B;  5FGM A;  1IF1 A;  5L3E A;  4EJT A;  2J5O A;  3WU0 A;  1B6A A;  1HXD A;  2Z9O A;  1RNL A;  2HYG D;  5FO5 A;  2A6E F;  3DXJ F;  4RB3 C;  5BPD A;  1SD5 A;  4U0W A;  3KP6 A;  4UHT A;  1ZN2 A;  2DPU A;  2M45 A;  4Q47 A;  5LGU A;  4L9N A;  4DNC A;  4LB5 A;  4WCG A;  3P9I A;  3HUG A;  4K2E A;  3M8F A;  2NAZ A;  2FBK A;  4Q48 A;  1BIA A;  3WOD F;  3CUQ A;  5HS8 A;  2H6B A;  3K1M A;  2IT0 A;  3C1D A;  3I59 A;  2R7D A;  1TNT A;  2QQ9 A;  2XAJ A;  4KUM A;  1J9I A;  5E1Z B;  1HW5 A;  1R36 A;  3KP3 A;  5FFX A;  3FMR A;  4G6D A;  1HKT A;  2ZNZ A;  3JAM Z;  1QPM A;  4KA4 A;  2EA4 A;  4LLG F;  4U7D A;  3KLN A;  2K86 A;  5DV5 A;  1Z7U A;  2ISY A;  2KJC A;  3CDH A;  4GCV A;  1WQ2 A;  2Z99 A;  1WKM A;  4I01 A;  1IRG A;  1YTY A;  4A0Y A;  5FD5 A;  1J0R A;  3I71 A;  2P4W A;  5BS6 A;  3ML6 A;  2QM3 A;  3ZN0 A;  3D0S A;  2BEO A;  2A5Y B;  1O3Q A;  1FYM A;  1MDM A;  1W5T A;  4P9F A;  5DD4 A;  2F5F A;  1IN7 A;  1HST A;  2VC1 A;  1OYY A;  4D0P A;  1G6N A;  4G7H F;  4ASN A;  4P9U A;  3EDP A;  3HSE A;  2HTJ A;  2K02 A;  4CGZ A;  2OA4 A;  2R7F A;  2FMY A;  2E7W A;  4ZH4 F;  1FBU A;  1FZP B;  2EV0 A;  5EEH A;  5HLI A;  4KNY A;  4ZYG A;  4LJZ F;  2YPR A;  4EVI A;  1B59 A;  4ZYD A;  1I1G A;  2Q8K A;  1O57 A;  1GVJ A;  1T38 A;  3U1D A;  1BIB A;  4XSZ F;  2PLY A;  1OYI A;  1W7P A;  3OOP A;  1JHF A;  3C18 A;  1K6O A;  4WXD A;  3TO9 A;  4R8H A;  2CFX A;  4I0A A;  2IP2 A;  4I98 B;  5F64 A;  1S29 A;  1R5G A;  3NRV A;  5LGN A;  2HKO A;  5E8G A;  1O7F A;  1UST A;  1ZAO A;  2IA0 A;  3RTR A;  4EM0 B;  4L0Y B;  3BRO A;  1YIO A;  3WE2 A;  2W24 A;  3HRT A;  1FSH A;  4A2U A;  4MHG A;  1IAW A;  1KA8 A;  4A5M A;  4BHP A;  2QQA A;  2VOD A;  3KP4 A;  2V79 A;  2XRO A;  2RDP A;  4EGY A;  1X3U A;  3GWZ A;  3CO7 C;  3I5U A;  5K1Y A;  1PP7 U;  2Y75 A;  4M9Z A;  1ZG5 A;  4UUV A;  4AIH A;  2PMH A;  4MTD A;  4IHT A;  2FE3 A;  1ON2 A;  1K78 A;  1ULY A;  3MZH A;  3C7J A;  4EMS A;  5DUI A;  4DQ2 A;  3FX3 A;  1E17 A;  1L0O C;  3F22 A;  3FXR A;  2MLG A;  2H94 A;  3PFI A;  1FY7 A;  2JTV A;  2K4J A;  5D4S A;  3P9C A;  2ZKZ A;  1DP7 P;  1SMT A;  4KFC A;  2O8X A;  1J2X A;  5LEJ A;  3ZPL A;  3ISP A;  2P5V A;  1FYK A;  2DI3 A;  5D8K B;  4YFK F;  5E8I A;  4NQW A;  3WE3 A;  2LKP A;  1IN8 A;  3H92 A;  1R1U A;  4IRG A;  3GZ5 A;  1YW7 A;  4JQF A;  3FXU A;  1MZB A;  1J59 A;  3N97 A;  2K7L A;  4GGG A;  1ZGJ A;  3U9G A;  3I0T A;  1YW9 A;  1HSJ A;  3BDD A;  4ENJ A;  5A2Q K;  4G7Z F;  2L54 A;  5DCM B;  3ULQ B;  1W4M A;  5K5Q A;  4LGW A;  5J6X A;  4CDG A;  3G73 A;  1LB2 A;  3KET A;  4HBL A;  3MQ0 A;  5EEG A;  3BJA A;  3K2Z A;  1FBS A;  2OZU A;  4KYW A;  2Y0M A;  4KIF A;  3KLO A;  4RGR A;  4E70 A;  4CYD A;  5IT9 Z;  5BOX A;  3I58 A;  5L3C A;  3V7S A;  1S7O A;  1XSX A;  1KQ9 A;  3F8C A;  5FFZ A;  3LFK A;  2MH2 A;  5ILS A;  2VC0 A;  1C0W A;  1JXS A;  3V8J A;  2FBI A;  1QQI A;  1QBJ A;  2PG4 A;  3V7R A;  2HS5 A;  2NS0 A;  1FBQ A;  2EV5 A;  4KIG A;  3V8K A;  2DAO A;  2STW A;  3E97 A;  1G3T A;  3GUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...