4U88A

Structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
93
Chain Sequence
b'EQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator SaeR
publication title Structure of the DNA-Binding Domain of the Response Regulator SaeR from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus usa300-ismms1
molecule tags Dna binding protein
total genus 25
structure length 93
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u88A00
3V7RA 4HBLA 3QU6A 2HQNA 3ZMDA 3BOQA 5ICEA 1MDMA 3P7NA 1ONVA 3GUDA 3LFKA 2KJCA 3RKXA 3GZ5A 2HEOA 2A61A 4OINF 1SMYF 1EH8A 1F1ZA 4UNOA 3VEPA 3J80Z 3GLXA 4FX0A 3RI4A 3BPXA 1ZG5A 2VXZA 4KMUX 1LEAA 5E1WA 5H6RA 4GYGA 4WX9A 4G7ZF 2VBZA 1TQMA 2VE9A 1IZ1A 2RDPA 1HKQA 1GXQA 4RB3C 2IT0A 3K2ZA 5HS9A 4FT8A 3MZYA 5LRRA 1MJBA 4Y13A 2ISYA 2OZ6A 4O6JA 1IAWA 4LK1F 5D4SA 5CVRA 1RUOA 3I4PA 1Z9CA 1IN7A 2D1VA 3LQRA 2RVCA 3KETA 3HRSA 4PGHA 4BHBA 1BI1A 2K86A 4HLXA 2FBHA 2IA1A 4Y15A 4A12A 3QOPA 1HW1A 2QM3A 1IXCA 2MLKA 3F8BA 4G9YA 2OU2A 1E2XA 1BJAA 2OD5A 2WC2A 4HX8A 5BS6A 2IPQX 4EJWA 3LAPA 3DQVC 3E5UA 5ICGA 2PJPA 2DI3A 4KYWA 3ZN1A 4Q5SF 5K5OA 1KGSA 1YS7A 3F8FA 1V3FA 4MQVA 3ERED 2CGPA 4YFKF 2EA4A 3CJNA 2PMHA 3L9FA 1B59A 1FBUA 1R23A 3F6OA 2GWRA 4U7BA 2EA2A 2XIGA 3SFZA 5HDGA 2XASA 1XCVA 3ROUA 4S05A 4AIKA 1YS6A 4U0WA 1XDUA 3IRQA 4LB6B 1LDKB 3CUQA 4EJUA 4UV9A 4RAZA 4KUMA 3VFZA 1J75A 4WXHA 1IW7F 4L9NA 3FZVA 1L0OC 1I5ZA 1FBSA 4A5NA 4IJAA 3KEQA 1HXDA 1QZYA 3HOTA 2A68F 1Z1DA 1S3JA 3FXQA 3ELKA 3TO6A 2QZ8A 4GYIA 2M5WA 1QPMA 2QBYA 2NRAC 4EQQA 3R4KA 2V1DA 1S7OA 5D5WB 3R6SA 2HS5A 3C18A 1RNLA 3E97A 3T0YA 5J6XA 5ILUA 1G3TA 1ZN2A 4XBFA 2O0YA 1ZG3A 3PFIA 2NS0A 4I2OA 4HX4A 3WGIA 3CUQB 2H6BA 4JQFA 4EM1A 1OYYA 2L02A 3ZMVA 4BYYA 2BBYA 4OIRF 3I58A 3C3WA 1ZGJA 4L18B 3J81K 1T6SA 4IPAA 3WTUC 1G3SA 2BYVE 2YPRA 3JTHA 3NEUA 3GFLA 1BN5A 1BIBA 2M30A 1ZG1A 3WTYC 1H0MA 3W6JB 3I53A 4RGXA 2QBYB 2EJRA 2QYOA 5CVJA 4BHPA 2X4HA 5F1RA 5DCFA 2V6CA 2VN2A 4U7DA 2PN6A 2IA0A 5BMZA 3F72A 3EDPA 2AS5F 1O3SA 2F5DA 4HF2A 1YG2A 4CGZA 4HX7A 2GA1A 5FFXA 2FXAA 1KU9A 2HGCA 5FLXK 2NNNA 5DDGA 2VOOA 2V79A 3V8JA 1XGOA 3CLOA 1FP1D 1J59A 1Z05A 3TOAA 6PAXA 5ICFA 3FHZA 5DD4A 1LDJA 2E1NA 3GF2A 4QWQA 3GZ6A 2UWMA 1RZ4A 1O3TA 2W57A 1YYVA 3JSOA 1OYWA 2IRFG 1R1VA 5JFRA 2O3FA 2Q8KA 2XKOA 1B4AA 1R7JA 2LKPA 4HF1A 4G7OF 1U5TA 5D4RA 4XSZF 1SFUA 3U2RA 5BOXA 5FLXZ 5DCMA 3EQLF 1R5GA 4I02A 2KJBA 3DP7A 5CYVA 4A5MA 3FX3A 5LGUA 2IW5A 4IRGA 1P4WA 1XSVA 1X3UA 4AIHA 1R22A 4HV6A 1ZARA 2ZCWA 3ULQB 3F22A 3FMSA 3HTSB 3W6KB 2GXBA 1O7FA 1ZGAA 3B02A 3MZHA 2CWEA 1IN8A 5FFZA 3RYRA 1QGPA 1KYWA 5D6EA 2PI0A 3U1DA 3JTGA 1S7AA 4MGRA 4ENJA 5LLQA 1TNTA 1R58A 2RNJA 1LQ1A 4KN7X 2FEZA 3AAFA 3M7GA 2NYXA 1FYLA 1K7AA 3P9IA 2GQQA 2DPUA 2Z9OA 5ICCA 4LFUA 5L3EA 5CVUA 3TKYA 1J7KA 1U5TB 2A07F 2RGVA 1QQIA 3H3ZA 1FX7A 4O5VA 3IHUA 4XSXF 5AONA 2A5YB 5DCMB 4Z2YA 1KA8A 3DPLC 4RAYA 1W5SA 2P8TA 2VBXA 2COMA 1JGSA 1R36A 4ZYEA 3ZPLA 5E17F 1U2WA 5BPIA 4NHJA 4LJZF 3TQNA 3Q9VA 1A04A 3BWGA 1REPC 4HQMA 1AOYA 1WWXA 4M74A 3V8KA 1F4KA 4RGSA 4JK1X 3E3VA 1SD5A 5LEKA 1BI0A 3HHGA 3P9CA 1VTNC 1DPRA 3HHHA 3K1PA 2DK5A 4FX4A 4G6QA 2DK8A 3QP6A 4L5IA 1BM9A 1SD6A 4M72A 4UVAA 2DU9A 2H09A 3KE2A 4ON0A 2OQRA 4I01A 5L3FA 1EV7A 4N9HA 1G6NA 5D8KB 2STTA 2ESHA 2Q2EA 1IXRC 3Q9SA 4TV7A 4IVNA 5AIQA 1XMKA 2G7UA 2WWYA 4LG0B 2E7XA 3SZPA 3SXYA 2PBIA 1SD7A 3HTUA 3WE2A 4KN4X 4A6DA 2NNYA 2ZBKA 1TW3A 2LNBA 4IF4A 1G3WA 1I6XA 4U88A 5KK1A 2PEXA 2RQPA 5L3CA 4OIPF 4Q4ZF 1IUYA 3BP8A 1FPQA 2XVCA 1KU2A 1HKSA 4N0BA 2XROA 2GZWA 2UXXA 2CG4A 3ISPA 1FNNA 4P96A 4RGUA 2JZYA 2RC4A 2DBBA 5FB2A 3E5XA 3FM5A 2JT1A 1UHWA 2MA3A 1YW8A 1Y0UA 1P92A 4P9FA 2QVOA 1OYIA 3RKWA 2D2WA 2HOEA 2HR3A 4UUVA 4KT5C 3M8EA 1OMIA 2QWWA 3GYHX 4PDKA 2IJLA 2DT5A 2ZNYA 3N97A 1F9NA 2OA4A 4U0YA 2O6GE 3T8TA 1SFEA 3U9GA 4FHTA 5L3BA 3GX4X 4YIFA 1ZRDA 2J5PA 4NQWA 4WF2A 2L01A 2QUFA 3ML6A 1XGNA 2H6CA 3REOA 3L09A 2M87A 4YG2F 1KQ8A 4LB5A 3WU0A 5JI6A 1R00A 2VT3A 2FBIA 3RDIA 1BC7C 4HV5A 2DO7A 1TTYA 3FF5A 3L2CA 5HVQC 1JHFA 4EMSA 1PP8F 3RPQA 3ABUA 4LLLA 1QZZA 1XGSA 4LLNA 4ETSA 5D5VB 2W24A 3CTAA 4Q48A 4XLPF 4RGRA 4JBAA 3QPTA 4WCGA 2DQRA 2CYYA 4M9SA 1FSHA 3FM3A 1CF7A 2HDCA 1DPUA 4DQ2A 4L9JA 2WV0A 2MH2A 4P55A 3KP6A 2ZO4A 3O2PE 4KIGA 2LSOA 1ZRCA 3PQKA 3GWZA 1XDSA 2KIMA 3WODF 2HFHA 3EETA 1YO5C 3I64A 1YQAA 4LK0F 2EWNA 4E70A 2HKXA 4H0EA 4AVPA 5DD8A 3IWFA 1D3YA 1TNSA 3TO7A 1Z7UA 3J7AO 1U6GA 2OAZA 3HOSA 2A69F 1FWZA 3I5UA 4I98B 5DUKA 5FGMA 4CXFA 5E18F 4WK8F 1CF7B 3KZZA 2Z3YA 1C0WA 2VODA 3HUGA 1T98A 1ZLKA 3L7WA 5JVTA 2PQ8A 3CUOA 1J0RA 2CQKA 2XV4S 1HBXG 1UCRA 1ZH5A 4PGGA 2DQLA 1HKTA 2M8EA 3IKVA 1T2KA 3M8FA 2A6EF 2ZMEA 1O57A 2ZFWA 2FBKA 5E8IA 5D6FA 3FXRA 1RIOH 2L4MA 4EM2A 5DEQA 1D8KA 5E1XA 5K5QA 1FY7A 3CDHA 2MH9A 4BH9A 2KIFA 2XAJA 3ZN0A 1JHHA 2HTSA 3K0LA 4HYEA 1SD4A 4O3MA 4F7ZA 3ZQ7A 4ZYHA 1FP2A 3KP3A 2FF4A 2MLGA 1TBXA 3EYIA 3TDZC 3WU1B 2E7WA 4WWCA 2Z99A 1WQ2A 3TO9A 3I71A 2RV8A 1BBYA 5LGTA 2M45A 1LB2A 4MHGA 3P9KA 3LSTA 3G3ZA 4AWXB 2L54A 2QQAA 4HDUA 1G3YA 1DUXC 2ZMEB 1EH7A 3IKTA 1K79A 2P5LC 1R1UA 3ABTA 5DV5A 2EV0A 4I09A 3FMQA 3WTSC 4M6XA 5CJ9A 4ZYGA 2MD5A 3LQQA 3GFIA 4MEYF 2HZTA 2KIUA 2O03A 2JRTA 3KP5A 4BHCA 2VC1A 1I1SA 2EB7A 2Y0MA 1T38A 5IT3A 4A0ZA 4OIQF 4KA4A 3V7CA 4ESJA 1HSTA 1HW5A 2VT2A 2DTRA 3FMRA 2G7HA 2UZKA 3GFMA 2HKOA 3MEXA 4GCVA 3V8LA 2X0LA 2XRNA 1ZLJA 4EM0B 2YSRA 2PLYA 5LHGA 1QO0D 3M9AA 1I27A 2K27A 4BAYA 4HQEA 4L9VA 2VBYA 1IXSB 4KMFA 1ON1A 1FSEA 1ULYA 2P6TA 2FMLA 2A3SA 4CO8A 1E17A 2XAQA 3JSPA 3E6DA 4M6YA 3DF8A 4ZZDA 1XN7A 3QAHA 5ILVA 2D45A 4KIFA 2L4AA 3I59B 5TRDA 1FT9A 5EEGA 2YX4A 5AIPA 4CDGA 5FO5A 3Q5FA 1BC8C 3DFGA 4M71A 5DYMA 4HOBA 2GAUA 4B8XA 2FOKA 4M73A 1FC3A 4Y17A 2ZNZA 1B1BA 5CLSA 5HS8A 3LWFA 4OMZA 2JTVA 2K02A 3E6BA 2HWVA 5CVVA 1O3RA 2FA5A 4LG0A 2FRHA 2YX7A 4EGYA 5HLHA 1P4AA 1TLHB 1P6RA 4LLGF 1PP7U 3HRUA 3KP2A 4HW0A 2VONA 3V4GA 2LDUA 2JPBA 1ZYRF 3MCZA 1XGMA 4UVBA 5LHIA 3BJAA 4G94A 3S2WA 2J5OA 3QRFF 1S29A 5IT9Z 4KICA 1U3EM 3OOPA 4HAMA 1YW9A 2V9VA 1IF1A 3LA3A 1T39A 1UHMA 1XSXA 3D0SA 3GEZA 4A0YA 4CZZA 1LDDA 1J2XA 3KP4A 3KLNA 3WG9A 1ON2A 1YTYA 5D5XB 1B9NA 4HF0A 5BQTA 2GA2A 2M1BA 3HRTA 4MNUA 2HYGD 4LD5A 4IRIA 4YIIA 1ODDA 1WKMA 4KIBA 2QQBA 1R5HA 1H9GA 3KZYA 2H27A 2PMUA 1PUEE 2P7VB 4WXCA 4ESBA 5HLGA 2FMYA 1IN5A 3KLOA 1S8NA 1UB9A 2ZXJA 1O7LA 1O3QA 3O3KA 3KEOA 1Z6TA 2Y48A 3ZMUA 1OPCA 3F8NA 3F21A 1BI3A 2EV5A 1GHCA 3F8CA 3VOEA 4RS8A 5J8CA 1LJ9A 5LEJA 1J5YA 5JHUA 2GXGA 2P5KA 1YW7A 2VC0A 3R61A 2JSCA 5HLIA 4I0BA 1MKMA 3F8MA 3IRRA 2W84A 2KRFA 2CO5A 5L3DA 2JPCA 3BY6A 2IA2A 2BV6A 1RI7A 2ESNA 3PQJA 5LBQA 3K1NA 1WSUA 1WI9A 3E6MA 4IHSA 1IRGA 3F6VA 3DKWA 4ZYDA 2P7CB 4G8XA 1XMAA 4M9XA 3LA7A 1TW2A 1W7PD 2RKHA 3RIRA 2F2EA 4PCQA 3NQOA 2HTJA 1W5TA 4AIJA 4EJVA 2G9WA 4UV8A 4PZJA 3M1EA 2ELHA 3G73A 5BPDA 1IN4A 5H6QA 4XRFA 4EJOA 2FNPA 3FWEA 2CFXA 1UFMA 3BZ6A 3WGGA 4MEXF 5HDKA 1D5VA 4ASNA 1FOKA 1FLIA 1FBQA 3WE3A 1NHAA 1MDMB 3WTWC 4YFXF 1FYMA 3TDUC 1YIOA 1DP7P 3HSRA 2EK5A 5HOOA 5E1ZB 2MBFA 2ISZA 5KVRA 2YR2A 3F23A 3HRMA 1YLFA 4A0XA 1FYKA 2RN7A 4EV0A 2Z33A 1TQPA 5CVIA 2KKOA 3HSEA 3MQ0A 3CO7C 3GXOA 4BXUA 2LF7A 3RYPA 2H94A 2WTEA 5HS7A 2R3SA 1J9IA 2HYFA 2PG4A 2EFWA 3CO6C 1K6OA 3TOBA 3VODA 3V7SA 4ZZLA 2CSOA 4UHTA 3FXUA 2XAFA 3SHFA 1B6AA 4ENNA 2EFNA 4NB5A 3CUQC 2STWA 4XLNF 1USSA 1JXSA 4G6DA 4RB2C 4MQ9F 4WXDA 5LGNA 2VBWA 3ZMSA 4ENKA 1XCBA 3WTZA 4B09A 4IXAA 4UVCA 1K78A 3MFKA 2QLZA 5FD6A 4KDPA 3R0JA 3BPVA 2TDXA 3N4MA 4I7HA 1MGTA 2Z5UA 3KFWX 3EUHA 1ZHFA 3WTVC 2QENA 1Z91A 5HDNA 2P5VA 4RB0A 5F6FA 2VE8A 1W7PA 1HQCA 4P9UA 1KU7A 4GGGA 5DUIA 2BEOA 1OR7A 2R7DA 3T8RA 3COAC 3JW4A 2XHKA 5ED4A 1IRFA 3KCCA 5JR3A 1LNWA 3I0TA 4KNYA 1KQ0A 4R79A 2XKPA 1LEBA 3DXJF 4Q47A 1SMTA 4L0YB 2V1XA 2Y75A 3IWZA 5D5UB 2AXLA 1K78B 2OQGA 1Q1HA 2OZUA 3C7JA 3JAMK 2V1UA 2EFOA 3F3XA 1LVAA 1ZRFA 4M9ZA 5H20A 2K4BA 4L9TA 3LAJA 4BNCA 3IL2A 3RJPA 1WRJA 3R0AA 3TGNA 4IHTA 2GIVA 2ZJ2A 1CGPA 4G7HF 1MJAA 1S6LA 3GW2A 3K1MA 2CW0F 1STZA 4L0ZB 2A6HF 3D5LA 3T1BA 4CICA 1L3LA 2DFIA 1W7PB 4DNCA 4OU0A 2XGXA 5E20A 5A2QK 4OMYA 3LA2A 3QU3A 4P5OA 1PDNC 5TJJA 4GO1A 2ETHA 3JAMZ 4RB1A 3WGHA 3I59A 1SAXA 5L3GA 1ZREA 1TQIA 4A6EA 1I1GA 5K1YA 4LMYA 2HQRA 3H3UA 1GVJA 3J81Z 3SZTA 1BOAA 3RPUA 4UXNA 4ZH4F 5ERIA 5EEHA 2ACJA 5ILSA 2BE5F 3BROA 3ECOA 2EV6A 3RKYA 1U5TC 3ZP5A 4KFCA 3HSFA 2EFPA 2K4JA 5A2QZ 4K2EA 4MTEA 3C1DA 4GXOA 2XUBA 5E8GA 5D8LB 1JE8A 2DAOA 1W4MA 1MD0A 2YU3A 1AWCA 3KP7A 1EH6A 2FNAA 3DV8A 3T5XA 1MZBA 2FQ3A 2K7LA 2P6SA 3BDDA 3H92A 5FD5A 2LF8A 2E1CA 1KQ9A 3OV8A 1B9MA 1OKRA 1XSDA 4I0AA 5IT9K 2QQ9A 1Z6RA 1IN6A 4LGWA 2FE3A 2MC3A 4S04A 2DPDA 1RUNA 3MWMA 2UXNA 3DEUA 1QNTA 2D1HA 3K69A 4L5JA 2NAZA 5LHHA 1XD7A 4IRHA 1SFXA 1V4RA 2L3DA 4CHUA 1P2FA 4N9IA 4CYDA 3EYYA 3NRVA 1GXPA 4MTDA 4QLCU 2Q0OA 2BGCA 2VOPA 4ESFA 2OBPA 2ZKZA 1F5TA 3HIFA 3GVAA 3ZMZA 3VB2A 3BJ6A 2O61A 2R7FA 3QPHA 4HDVA 1G4DA 3GFJA 4HZFA 4U0VA 2W25A 3WTXC 5LRSA 2FSWA 2B0LA 4AD9A 2C6YA 3K9TA 4R8HA 1U8RA 2IP2A 1P4XA 1FZPB 2F5FA 1BIAA 4EGZA 2DLLA 1R1TA 3ECHA 3RTRA 3O6BB 4EJTA 2W85A 1T0FA 2IVMA 5F64A 3BJOA 2O8XA 1YFHA 1XB4A 1HSJA 3IC7A 2FU4A 3L00A 1USTA 1U78A 1KU3A 3R60A 3I54A 4A2UA 3GO5A 3E6CC 1KYZA 2XAHA 1H9TA 1HW2A 2F5CA 1BI2A 4HA8A 4D0PA 2F5EA 5J8FA 4YFNF 4OOIA 3WTTC 4EVIA 2EFQA 4ENMA 4OIOF 2P4WA 3SQNA 4R1HA 1ZAOA 3J80K 3MAJA 4BQAA 1MJ9A 1D8JA 3QP5A 3B73A 5K5RA 2XAGA 3E5QA 2ADUA 1QBJA 3HYIA 2PFBA 3ZMTA 2DW4A 1DDNA 3DPTA 4HLYA
chains in the Genus database with same CATH superfamily
3V7RA 4HBLA 3QU6A 2HQNA 1FEXA 3ZMDA 5EEAA 3MMYB 3BG5A 3BOQA 3CP2A 4BDZA 3HPHA 2FX0A 5ICEA 3K6GA 3KPHA 2WY7Q 1MDMA 3P7NA 4BJTA 3SJMA 1ONVA 2Q2EB 3DTKA 3LOCA 3GUDA 3LFKA 2KJCA 5JLWA 3RKXA 3GZ5A 3DLAA 2HEOA 2A61A 4OINF 1APLC 1SMYF 1EH8A 2NS8A 1F1ZA 4UNOA 3VEPA 1W1WE 3J80Z 3S8PA 4E7KA 2EZLA 3SEZA 3ZCOA 3OL3A 3KYCB 3GLXA 1HLVA 4FX0A 1XC5A 3RI4A 1UHSA 2LR8A 2XB5A 3BPXA 3OYEA 2QA4I 2R7SA 1ZG5A 2VXZA 2YUSA 4KMUX 1LEAA 2RNGA 2R7QA 4ANJA 5E1WA 5H6RA 4GYGA 5CQGA 4WX9A 1BOBA 1MBHA 2Z16A 2P81A 4G7ZF 2AO9A 4XIDA 4J19A 2IS2A 2VBZA 1GLNA 2BW3B 3PUBA 1TQMA 2VE9A 2GM4A 5C3EJ 1IZ1A 1YRNA 1ORKA 3BCBA 2RDPA 1HKQA 2OF7A 1GXQA 4RB3C 2K9QA 2IT0A 1OLTA 2X6YA 2QF7A 3GTMJ 1EKEA 3K2ZA 2XAUA 3O8HA 4FT8A 5HS9A 3MZYA 5LRRA 1A6QA 2R5ZB 4B48A 1MJBA 2LK2A 4Y13A 2ISYA 2OZ6A 1IDYA 5TISC 2JA6J 5EGOA 4LG3A 4O6JA 5B3SH 1JI8A 1IAWA 4LK1F 5D4SA 5CVRA 3H35A 1RUOA 3I4PA 1Z9CA 1IN7A 2D1VA 3LQRA 1ETXA 2RVCA 1G59A 3KETA 1RR8C 3HRSA 3K4MA 4PGHA 4BHBA 4QTRA 3W6VA 1BI1A 2K86A 4HLXA 2B63J 2FBHA 4A3FJ 1LPQA 4B47A 2IA1A 4Y15A 4A12A 2X85A 4BUPA 3QOPA 1HW1A 2QM3A 1GVDA 1IXCA 2MLKA 1DQUA 2IBDA 3OSGA 3F8BA 4G9YA 2DYRH 3LMMA 2OU2A 4PUSA 1E2XA 4CCLA 1BJAA 3FBNB 1SANA 3BTCA 2OD5A 2E35A 4Y52J 3GTOJ 4Y3OA 2UUZA 2WC2A 2XB0X 4HX8A 5BS6A 2IPQX 4EJWA 5K7ZA 1H89C 4BEHA 5E3OA 3LAPA 2LY2A 3DQVC 3E5UA 5ICGA 4PJMA 2PJPA 3PFYA 1AA7A 1N25A 2DI3A 4DIQA 1IGNA 4KYWA 1MMSA 1QHHD 2WV1A 4M3DA 3ZN1A 4E7SA 2IAIA 1NG7A 4Q5SF 2PMZA 5K5OA 3SEQA 1R49A 3A0HC 1KGSA 5M5WJ 1V5EA 1YS7A 1HCRA 2ME0A 4DW6A 3F8FA 1V3FA 2KL4A 4MQVA 3ERED 2CGPA 5EGOB 4YFKF 2EA4A 3D5SC 1TWFJ 2HU9A 2PX9A 4YRVA 1S72I 3A02A 2MYSA 5K7HA 1Z3XA 3CJNA 4FISA 1JUPA 2PMHA 3IAS2 3L9FA 3BC8A 3HOYJ 1B59A 3BTIA 2CV0A 1GUUA 1FBUA 1R23A 2WADA 2XDVA 3F6OA 4E4HA 1VQLI 2L2OA 1E0EA 2GWRA 2K9LA 4U7BA 2EA2A 2M4GA 2XIGA 4CYCA 3SFZA 5HDGA 1AHDP 2XASA 1XCVA 3ROUA 5EDNA 3CDLA 4S05A 1OJLA 4AIKA 1YS6A 1WJ5A 1XDUA 4U0WA 2XSDC 3IRQA 4LB6B 1LDKB 2JUCA 1WGXA 3CUQA 4EJUA 3H0DA 4UV9A 1K4SA 4RAZA 5B66C 4KUMA 3VFZA 1W5CC 1J75A 4WXHA 1IW7F 4BKXA 1AU7A 4L9NA 4W1UA 3FZVA 1L0OC 2UV1A 1ACIA 4ZJZA 1WHUA 3AG3H 3ZQFA 1HF0A 4BEHB 2VI6A 1I5ZA 2F48A 1FBSA 3J7ZI 4A5NA 4IJAA 2NVUB 2E1MC 3KEQA 3FK6A 1HXDA 1QZYA 3HOTA 2A68F 1Z1DA 2HVRA 2KZVA 2JQ7A 1S3JA 3FXQA 2CUZA 3DU5A 5GP9A 1V55H 5EJCA 3ELKA 1FJLA 2P0WA 3TO6A 1VI0A 2QZ8A 1JKQC 4XQFA 4GYIA 4P1WA 2M5WA 5CQEA 3LSIA 1QPMA 2QBYA 2NRAC 4EQQA 2ZMEC 3R4KA 3RQIA 3EUKL 2M9HA 3HOZJ 2V1DA 1S7OA 3OS1A 5D5WB 4NC6A 3R6SA 2HS5A 2DOFA 2VUMJ 3C18A 1RNLA 2X9DA 1OR7C 3E97A 4RMNA 4F92B 5GPCA 1BJZA 1LE8A 3A01A 3BLYA 3T0YA 4IX7A 1YJ9I 5J6XA 5ILUA 1WJFA 2OTLI 1G3TA 1ZN2A 4XBFA 3MKLA 2O0YA 2WAQN 1ZG3A 1Y0NA 2LD5A 3PFIA 2NS0A 4I2OA 4HX4A 2OC6A 3C2BA 3QPLA 3BR3A 1SVOA 3WGIA 4BGDA 4XRSA 3CUQB 2H6BA 4JQFA 4EM1A 1NTCA 2VKDA 3JR9A 1IDZA 3OYHA 3ZGKA 1RKTA 3HM5A 1OYYA 1ZK8A 3TEDA 1HC8A 2L02A 3ZMVA 4BYYA 3S1RJ 2BBYA 3PIOF 4OIRF 3I58A 3C3WA 1ZGJA 4L18B 3J81K 2XF7A 3S93A 3AG4H 3M1CA 1X58A 1T6SA 2Q1ZB 4IPAA 2CQNA 2KPMA 3WTUC 1G3SA 2BYVE 2N8GA 3PSIA 2YPRA 3JTHA 2EPFA 3NEUA 2K3PA 2M7AA 3GFLA 1BN5A 1LFBA 2MD0A 4D7NA 5F0FA 3MN2A 1BIBA 2M30A 3HC7A 1ZG1A 3WTYC 5HLTA 1H0MA 2DA3A 3W6JB 3I53A 4RGXA 1I50J 2QBYB 1ETYA 3RSNA 2KP6A 1WJDA 2EJRA 2QYOA 5CVJA 2VPLA 4BHPA 2NVXJ 2X4HA 5F1RA 5DCFA 2V6CA 2VN2A 2HPIA 4U7DA 2PN6A 5E3LA 2IA0A 5B1BH 2H1KA 5C4JJ 5BMZA 3F72A 3EDPA 2AS5F 3FDYA 1I6HJ 1O3SA 2F5DA 4HF2A 1YG2A 1LE8B 4KISA 4CGZA 2KMUA 3FIWA 4HX7A 2GA1A 5FFXA 2FXAA 1KU9A 5IP9J 2RREA 4BJ5C 3TMOA 2HGCA 5FLXK 2NNNA 5DDGA 2VOOA 5FKMA 2V79A 1XS9A 1U0JA 3V8JA 1XGOA 3CLOA 3TP3A 1FP1D 1KONA 1J59A 1Z05A 3TOAA 2R5YB 2M34A 2DFEA 6PAXA 3BG7A 2EZHA 5ICFA 3FHZA 4FCYA 4XLAA 1MMNA 2BY2A 1I39A 5DD4A 1UG0A 1LDJA 2V4JC 2E1NA 4XRMA 3GF2A 4QWQA 3GZ6A 2UWMA 4XLHA 1DP3A 1RZ4A 1O3TA 4CSWA 1MBJA 2W57A 1YYVA 4QPOA 1E3OC 3JSOA 4UUTA 1OYWA 5CKTA 3CCRI 2KDZA 4DYCA 2DYSH 3DCFA 1WH5A 4XLEA 4CH7A 3DLLF 2IRFG 2JVHA 3FXLA 1R1VA 5JFRA 3S1QJ 2O3FA 5DS9A 2DA7A 2ZSIB 3LSKA 2EIMH 1Y39A 2Q8KA 1X2NA 4B1RA 2LLKA 2XKOA 1B4AA 1R7JA 2LKPA 5J1YA 4HF1A 4G7OF 1U5TA 5D4RA 2IXSA 4XSZF 2X1CA 1SFUA 3U2RA 1ZKGA 2K9MA 3PNYA 5BOXA 3LSPA 5FLXZ 5DCMA 1X4OA 2DA5A 3A0BC 3EQLF 4EEFG 5KHDA 1R5GA 1WCMJ 4I02A 3KX2A 2KJBA 2IEKA 1R71A 3DP7A 1OCTC 1MMDA 5CYVA 2M8GX 4A5MA 4YEJA 4XKCA 1SFKA 3BR0A 1ETOA 3FX3A 4GFBA 4J00A 3JRGA 5LGUA 1U8BA 2IGMA 2IW5A 4IRGA 1P4WA 1XSVA 2LY9A 1X3UA 4AIHA 1R22A 1HA8A 4HV6A 2I8DA 1ZARA 2ZCWA 3ULQB 3F22A 3FMSA 4PJNA 3HTSB 3W6KB 2GXBA 2E5NA 1O7FA 1ZGAA 3B02A 5LD2C 3IH3A 3MZHA 2ZB9A 2CWEA 1IN8A 5FFZA 3RYRA 5GAGJ 1QGPA 1KYWA 2K85A 5D6EA 3E0JB 3LSHA 4D5FA 2PI0A 1J09A 3U1DA 3JTGA 1S7AA 4MGRA 4ENJA 3S16J 4XKWA 5LLQA 3BQYA 4UY8I 1TNTA 1R58A 2RNJA 1LQ1A 5GPAA 4KN7X 2FEZA 1IV8A 5IOYA 3AAFA 4A3KJ 3M7GA 1YE9A 3UKGA 1H8AC 2NYXA 1FYLA 1K7AA 1UMQA 3P9IA 2GQQA 3PO3J 1RR7A 2LTPA 3GLLA 4RAFA 5FLMJ 2DPUA 2Z9OA 5ICCA 4LFUA 5L3EA 5CVUA 3TKYA 1J7KA 1U5TB 2CW8A 2A07F 4XOTA 2NS7A 3FISA 2RGVA 3M8JA 3Q3SA 1QQIA 3H3ZA 1FX7A 3IH4A 4O5VA 2CH0A 3IHUA 3L2WA 4XSXF 1RC9A 2BZTA 3VYRB 5AONA 1QHGA 2A5YB 5DCMB 4Z2YA 2ECBA 1KA8A 2PMZN 3BQZA 4BQOA 3DPLC 4RAYA 1W5SA 2P8TA 3OSFA 2VBXA 3J7AY 2COMA 1JGSA 1R36A 4ZYEA 3AL0B 5FKKA 3ZPLA 2DT7B 1IV6A 5E17F 2I5UA 1U2WA 1ETQA 5BPIA 1A6IA 1P7JA 4NHJA 3PIPF 4LJZF 3TQNA 3Q9VA 1MH3A 1A04A 2VIXA 4XNFA 3JREA 3BWGA 1REPC 4HQMA 1AOYA 1WWXA 4M74A 3V8KA 1F4KA 4RGSA 4JK1X 3E3VA 1SD5A 3HOUJ 2HOAA 5LEKA 3AKZA 1BI0A 3HHGA 3P9CA 1VTNC 1DPRA 3S2HJ 3HHHA 3K1PA 2M7BA 2MFZA 2DK5A 4FX4A 2X51A 2VKVA 5EZHA 3FXOA 3D1NI 4G6QA 2DK8A 3ZXSA 2KLOA 3QP6A 1JGGA 3CCYA 4L5IA 2CFOA 1BM9A 1SD6A 4M72A 4UVAA 4A93J 2ZXHA 1T0FC 2DU9A 1Y8RB 3CP8A 2H09A 3KE2A 4ON0A 5F27A 2OQRA 4JOMA 4IQJA 2OCEA 3QODA 2RQQA 4I01A 5L3FA 4XONA 1EV7A 4N9HA 3K7AJ 5J3LA 1TWAJ 1G6NA 2MGQA 5D8KB 2DTZA 1R4NB 1OCOH 4NNJA 1TZLA 2STTA 2ESHA 2WB1A 1VQOI 4I6ZA 2Q2EA 1R6RA 1IXRC 1WPKA 3Q9SA 1YJNI 4TV7A 4IVNA 5AIQA 1XMKA 2G7UA 2ECCA 3LSMA 3S17J 2WWYA 2X48A 4LG0B 2E7XA 3SZPA 3SXYA 1QA6A 2PBIA 5KAIC 1SD7A 3HTUA 3VDXA 3WE2A 2CQQA 1XTAA 4KN4X 4A6DA 2NNYA 3Q0UA 2ZBKA 1TW3A 2LNBA 2WBMA 1G3WA 1I6XA 4IF4A 4U88A 5KK1A 4BJ6C 2PEXA 2RQPA 5L3CA 1TWGJ 4OIPF 3OYNA 4Q4ZF 1IUYA 2BVMA 3OYFA 1N77A 3HOXJ 2XGEA 2LFBA 3BP8A 4BE0A 1FPQA 4UB8C 2XVCA 1VQ5I 1KU2A 2VQLA 1HKSA 1HDDC 4N0BA 4J01A 2XROA 5FROA 2GZWA 1VNDA 2UXXA 1ZGWA 1FMVA 2CG4A 3CDIA 2R5ZA 1X3ZB 3ISPA 4XLFA 3PJRA 1FNNA 3W2VA 1X1PA 4P96A 4RGUA 2JZYA 2RC4A 5KCMA 2V7FA 3HB9A 4BE1A 1HOMA 3VSLA 2F4IA 3HGGA 1VF9A 2DBBA 2ZXIA 2L9RA 5FB2A 3E5XA 3MKZA 1GV5A 5HODA 3FM5A 2JT1A 4IOCF 1UHWA 2MA3A 2OV7A 3H9GA 3ABKH 1YW8A 1Y0UA 1P92A 5LFAA 2EZKA 4P9FA 2QVOA 3LL7A 3QYBA 1OYIA 1X2MA 3RKWA 2D2WA 2HOEA 2HR3A 4AVZA 4UUVA 4KT5C 4PJ0C 3M8EA 1OMIA 3VYSB 4X0GA 2CV1A 2L7FP 4FE4A 2QWWA 4CCKA 1K61A 3GYHX 2PJRB 2FUG2 4PDKA 4BL0B 2IJLA 3H1CA 2V9PA 3SDGA 1YI2I 2DT5A 1XG1A 4DZJA 4E7JA 4IHYA 2ZNYA 2YU9J 3N97A 3CMMA 3S1MJ 1F9NA 5IYBJ 2OA4A 4U0YA 2O6GE 2R7ZJ 1BW6A 1WJCA 1OQYA 1B72B 3T8TA 1ERDA 2LBFB 4DYRA 1SFEA 3K10A 3U9GA 1YITI 3V42A 4FHTA 3TBIA 5L3BA 3GX4X 3PSFA 4ZDPA 4YIFA 1ZRDA 2J5PA 2DJNA 4NQWA 4WF2A 4JX4A 2L01A 1MH4A 2CRGA 4A3GJ 2X6WA 2JUGA 2JVGA 2VJJA 2QUFA 3ML6A 2R0QC 4QPQA 1XGNA 2H6CA 3S2DJ 3REOA 4NUBA 3L09A 5E3MA 1VQKI 2LYCA 1RETA 3PNTA 3FXMA 3AG1H 4YG2F 4LB5A 1KQ8A 3WU0A 4D7MA 5JI6A 2F4OB 4A3MJ 1WH7A 1R00A 2VT3A 1ETWA 5K7FA 4CCMA 2FBIA 3FKIJ 3RDIA 1BC7C 2QSHX 4HV5A 2BXZA 1P9QC 2DO7A 1TTYA 4E7ZA 2VXDA 5IP6A 2DMTA 1MBFA 3FF5A 3L2CA 5HVQC 1R9TJ 3HEFA 2EIJH 5IPAA 1K6YA 1NK3P 1JHFA 4EMSA 1PP8F 3RPQA 3ABUA 4LLLA 1QZZA 1XGSA 4LLNA 3F0CA 4ETSA 2R7VA 5D5VB 2DA6A 1OCCH 2W24A 2HDWA 3CTAA 3FKJA 4Q48A 4OWRB 4X1EA 4XLPF 4RGRA 3JRCA 5M3MJ 2ID6A 3D5RC 2QEXI 4JBAA 3WHBA 3QPTA 4WCGA 2DQRA 4E6KG 2CYYA 4M9SA 1FSHA 3FM3A 3S32A 2L7MP 1CF7A 2HDCA 1DPUA 1SAUA 4X6AJ 4DQ2A 2D5VA 4L9JA 4Z6YA 4BBSJ 4KJZA 2WV0A 3LSJA 2FJ1A 2GIZA 4MLOA 2MH2A 2LMDA 2QKMB 1JKOC 1SVLA 4NQWB 2VKHA 4P55A 4CCOA 3FBIB 5IYDJ 3KP6A 2ZO4A 3O2PE 3TL4X 4KIGA 2LSOA 3L1PA 1ZRCA 3PQKA 3SDBA 3GWZA 1XDSA 3VWBA 2KIMA 3WODF 4B3AA 2F4MB 2HFHA 4RDUA 3EETA 1YO5C 3BCAA 3I64A 3IP4B 3DBHB 1UELB 1YQAA 4XR6A 2E2JJ 4LK0F 3OYIA 5EF6A 2NXNB 2EWNA 2R7WA 2EILH 1IJWC 3HGYA 4E70A 4Y7NJ 2JA8J 1Q1VA 1FTZA 2HKXA 4H0EA 4RA2A 5DD8A 4AVPA 3GTLJ 3IWFA 1D3YA 1GDTA 1TNSA 3E7LA 3TO7A 4LIUA 1Z7UA 1W36C 2JMWA 1LKXA 1QVUA 3J7YJ 3J7AO 2QQ8A 4A3BJ 1U6GA 2OAZA 3G1LA 4AC0A 3HOSA 2A69F 1FWZA 3I5UA 3DEWA 2RAEA 2CS3A 4I98B 2DN0A 5DUKA 4CA0A 3NARA 5FGMA 3HOVJ 1XMXA 4CXFA 5E18F 4WK8F 3KIOA 1N75A 3WHCA 3H0GJ 3CCEI 1CF7B 2R7RA 2XC7A 3KZZA 1KZHA 2Z3YA 2E34A 5IYCJ 1C0WA 3L2UA 1SFOJ 2VODA 5F04A 3A1YA 2R4GA 2QCOA 3HUGA 3CC4I 1T98A 2AQFA 1ZLKA 3L7WA 5JVTA 2PQ8A 3CUOA 1J0RA 1JJ6C 1PUFB 3GZNB 2CQKA 3GTQJ 2XV4S 3DPUA 3EUHC 4DOZA 2K9NA 2DFHA 1HBXG 3MKYB 3QYEA 1UCRA 1ZH5A 4PGGA 4FETA 5H2FC 4HSRA 3HBLA 2DQLA 1QRYA 4QSHA 2V6EA 1HKTA 4HNVA 2M8EA 2ZJQF 3IKVA 5BNGA 3NWSA 2QSGX 2ZJRF 3AG2H 1QVTA 2VQCA 4RLQA 1FMWA 1QZEA 1JTXA 3RKQA 3K70C 1T2KA 3M8FA 2A6EF 2ZMEA 1O57A 2OCCH 2ZFWA 2VPRA 3IV5A 3F9KA 4RM2A 2FBKA 5E8IA 2V26A 5D6FA 3ZQQA 1O4XA 3FXRA 1ZR2A 1RIOH 2L4MA 4EM2A 3AFHA 3I3LA 5DEQA 1EF4A 1D8KA 2R5YA 2O9LA 1A36A 5E1XA 3CMEI 1FIAA 2VJ4A 5K5QA 1FY7A 1JTYA 1OFCX 3CDHA 1WVRA 2JA2A 2MH9A 2KDOA 4BH9A 3OYBA 1GT0C 2WB1N 2KIFA 1ZELA 2XAJA 1TWCJ 2GBYA 3QQAA 3ZN0A 1JHHA 4I76A 2HTSA 1UAAA 3K0LA 4HYEA 1SD4A 2GXAA 4O3MA 2R7UA 4F7ZA 3ZQ7A 2LKXA 4RM3A 4ZYHA 3HUGB 3HKZA 2KIQA 1FP2A 2NOGA 2FF4A 2MLGA 1TBXA 3KP3A 3CJRB 3P5JA 3EYIA 3TDZC 3WU1B 3I9V2 2E7WA 4XM3A 4A3JJ 4WWCA 1JT0A 2E1MB 2EQRA 3ASOH 3IAM2 2Z99A 1R4MB 1WQ2A 3TO9A 5GADJ 2RV8A 3I71A 1BBYA 5LGTA 2M45A 1LB2A 2K40A 4MHGA 2BXYA 4MFDA 1JJ8C 3P9KA 2DXIA 3LSTA 5J4YA 3G3ZA 4AWXB 2TRTA 2L54A 2QQAA 3KEYA 4HDUA 3UNGC 1G3YA 1DUXC 1H88C 2ZMEB 1EH7A 2DMNA 3IKTA 1POGA 5M3FJ 3DBRB 1K79A 2XSJC 4F93B 5J4VA 2P5LC 1R1UA 3ABTA 5DV5A 2EV0A 1MMAA 3FMQA 4I09A 2VKEA 3WTSC 2DJIA 4M6XA 4ITVA 4OAYA 3NWTA 5CJ9A 4ZYGA 3I4NJ 2MD5A 4A3EJ 3LQQA 3G6EI 3GFIA 4MEYF 2HZTA 2HZDA 3H3VK 2KIUA 4BY7J 2EIKH 2W82A 2O03A 3NAUA 2JRTA 3KP5A 4BHCA 2VC1A 1I1SA 2EB7A 2Y0MA 3BTLA 3CCVI 1T38A 5IT3A 4A0ZA 1X1DA 4OIQF 4KA4A 3CMYA 2TCTA 3V7CA 4ESJA 4ZYAA 1HSTA 1HW5A 2VT2A 2DTRA 3FMRA 1JKRC 4MIMA 2G7HA 2Z1DA 1V5FA 2UZKA 3GFMA 2HKOA 3MEXA 4ABZA 4HSTA 4GCVA 4B43A 3V8LA 5EYRA 2X0LA 2XRNA 1ZLJA 3S3NA 2W1OA 2F5VA 4EM0B 2YSRA 2PLYA 5LHGA 2CQXA 5IY5H 1VQMI 3OR1C 5KNLA 4YIRX 3DWLE 1BA5A 5FRMA 1QO0D 3M9AA 3OYAA 4F91B 1I27A 2K27A 3ZQHA 4BAYA 1TL8A 4HQEA 2KT0A 3U1KA 4BACA 1M1EB 4L9VA 4CUGA 2VBYA 1JKPC 4OAZA 3AL0C 4XMYA 1IXSB 2XRLA 4KMFA 4Y4RA 1ON1A 2DDBA 1FSEA 4BQNA 1ULYA 1IG7A 4C3IJ 1E3PA 5FKLA 2KRCA 3K4KA 4RAGA 4M3BA 2P6TA 2FMLA 2A3SA 4CO8A 1F36A 1E17A 1B8IB 2XAQA 2ID3A 3JSPA 2MC4A 1Z3YA 4II3A 3E6DA 3DEEA 2XGCA 4M6YA 3DF8A 4XKVA 1XN7A 4ZZDA 1WFXA 3QAHA 2LY1A 5ILVA 2D45A 2HOTA 4KIFA 2L4AA 3I59B 5TRDA 4C30A 1TT0A 1EA3A 1FT9A 2XPVA 3PNVA 2YX4A 5AIPA 5EEGA 3VYUB 4CDGA 5FO5A 3Q5FA 1BC8C 3DFGA 3OIOA 2DMQA 5JHFA 4M71A 1TT5B 5DYMA 4A3LJ 4HOBA 2GAUA 4B4CA 3JRAA 4PFOA 4B8XA 4UUSA 1ENHA 3G1MA 2WAEA 5GTHC 2FOKA 4M73A 1FC3A 4Y17A 1RRJA 2ZNZA 1B1BA 4IL6C 1ETKA 2Y69H 5CLSA 5HS8A 3LWFA 4OMZA 4XKBA 2JTVA 4HNTA 2K02A 3E6BA 1DGRM 2HWVA 3QYFA 5CVVA 1VQ6I 1D0XA 1O3RA 2FA5A 4LITA 4LG0A 2O5RA 3OYKA 1IUFA 2BHZA 2FRHA 2YX7A 3SZGA 3OYLA 3DKYA 3K4CA 4EGYA 5HLHA 1LUJB 1S5LC 1P4AA 1TLHB 1Y56A 1P6RA 1WJAA 4LLGF 1X1BA 3JRBA 1PP7U 3HRUA 3KP2A 3G4SI 5HNFA 4HW0A 2VONA 1IRXA 2X1DA 4ZTJA 3V4GA 2E19A 2LDUA 2JPBA 2M2EA 1ZYRF 3MCZA 1XGMA 4II2A 1VQ8I 4DBQA 3E1SA 4UVBA 2JK3A 5LHIA 3BJAA 3C2HA 4G94A 3S2WA 2J5OA 3QRFF 1S29A 2B9SA 5IT9Z 3BZCA 3BTJA 2JWTA 4AM3A 4KICA 2XPUA 1U3EM 1BR2A 3OOPA 2DA1A 4HAMA 1YW9A 2V9VA 1IF1A 3LA3A 2VJ5A 2OPTA 1UHMA 1T39A 1XSXA 5C44J 1SC7A 3D0SA 3GEZA 4A0YA 3ASNH 5J1UA 4CZZA 2DCEA 2XF6A 2E36A 2MW8A 3GTJJ 4UUSB 2K5CA 2LOOA 3OWTA 5J40A 4C9YA 1LDDA 1Z67A 4BBRJ 1J2XA 2EH3A 3KP4A 3U21A 4FE7A 1VFCA 2ZFUA 3KLNA 3WG9A 1ON2A 4NC8A 3PM1A 9ANTA 1YTYA 2G0EA 3CJQB 4H4KC 5D5XB 1B9NA 4HF0A 3OOUA 5BQTA 1BR4A 2GA2A 2M1BA 3I56I 1IC8A 2PJRA 3O8GA 1U9NA 3HRTA 4MNUA 3DTIA 2ELKA 2E1OA 1OCRH 1NK2P 1R5ID 2HYGD 4LD5A 4IRIA 4YIIA 5F08A 1ODDA 1WKMA 1D0YA 1YX5A 4A3IJ 4KIBA 2CU7A 2X1EA 3H9QA 2QQBA 3ABMH 1R5HA 1H9GA 3KZYA 1QPIA 2PMUA 3CCQI 2H27A 1PUEE 1B72A 3IUOA 1G8XA 2IGNA 2LBFA 3L2RA 2P7VB 2BHYA 4WXCA 4D1QA 4L5EA 2V1NA 4ESBA 5HLGA 1P7IA 4M3EA 4MO7A 2KRHA 2FMYA 2HQ5A 3G71I 1IN5A 2I10A 3KLOA 1S8NA 3L2VA 2JA5J 1UB9A 2ZXJA 1O7LA 4MFEA 1O3QA 3O3KA 3KEOA 1Z6TA 4IZZA 2X6OA 2Y48A 4PJLA 3DBLB 2R93J 4XN3A 4ZC3A 1OPCA 3F8NA 3EUAA 1BI3A 3Q0VA 5EZGA 3ZMUA 2HXIA 2EV5A 3F21A 1GHCA 2L9VA 3CCMI 2DA4A 3F8CA 3VOEA 1W36D 4RS8A 3G2BA 2DMUA 3ESWB 2H8RA 5J8CA 5F1JA 1LJ9A 5LEJA 1Z7LA 1J5YA 3K2AA 5FJ8J 1E3HA 4ZDOA 1ZR4A 2CW7A 3M07A 5JHUA 4ZDLA 2GXGA 2P5KA 1YW7A 2VC0A 3QWLA 3S15J 3R61A 2JSCA 5HLIA 2JA7J 4I0BA 3HKZN 1MKMA 3F8MA 3IRRA 2W84A 4BY1J 1K83J 2KRFA 2WY8Q 4Y33A 2CO5A 4AYBA 5B5EC 5L3DA 4B3XA 4GRIA 2JPCA 3W2AA 1X3WB 3H9JA 3BY6A 4HG2A 4IKFA 2IA2A 2BV6A 4JYKA 1RI7A 2ESNA 3PQJA 5LBQA 4F55A 3K1NA 1WSUA 2CQ7A 1WI9A 2JRMA 3S14J 2HI3A 3ZR8X 2IGOA 3E6MA 2ELJA 5IP7J 4IHSA 1IRGA 3F6VA 3DKWA 4XLCA 1ETVA 3OYGA 1T56A 1YOVB 4A69C 4ZYDA 1VQ7I 2P7CB 2Y31A 3S1NJ 4G8XA 3W3CA 2FQ4A 1XMAA 4NC7A 4M9XA 3ZQGA 3LA7A 2Y9YA 4KT6A 1D5YA 1T08B 1TW2A 3BT9A 3CC7I 1W7PD 2RKHA 3RIRA 3KZIC 2Y2ZA 2F2EA 4PCQA 3NQOA 2OJED 3VYTB 1Z21A 2HTJA 2QGUA 1W5TA 5JVGF 4AIJA 1TC3C 3BG9A 3ZRGA 3W2WA 2G9WA 4EJVA 4UV8A 3ZQIA 3OY9A 3K70D 1VQ4I 4IHVA 4PZJA 1V5GA 3M1EA 2W4SA 3RQ4A 3JRDA 2ZSHB 2ELHA 1YX3A 3G73A 4C3HJ 5BPDA 1IN4A 3RCOA 5H6QA 2LVSA 4XRFA 4C2TA 1DGWY 2KFDA 4EJOA 3ERMA 2FNPA 3FWEA 2CFXA 1UFMA 3BZ6A 3WGGA 1RESA 4MEXF 5HDKA 4N4OB 2BVLA 1D5VA 4ASNA 1F43A 1FOKA 1FLIA 1FBQA 4AUXA 3WE3A 1NHAA 1D1AA 1MDMB 1X1AA 3WTWC 2CUEA 1DU6A 1I3QJ 4YFXF 5DM6F 1FYMA 1LFPA 3TDUC 1YIOA 5FKOA 1FIPA 1DP7P 4S0HB 1T8IA 2LRDA 2R7TA 4DZPA 2E2IJ 4F3QA 3HSRA 2EK5A 5HOOA 4XOPA 5E1ZB 1D0ZA 4XRSG 2MBFA 2ISZA 5KVRA 2A5WA 2YR2A 2VQGA 3F23A 3HRMA 1MMGA 1YLFA 4A0XA 3GTGJ 1PUFA 2NOJB 4HNUA 1FYKA 2RN7A 4EV0A 4ZTFA 2KHMA 2IS6A 2Z33A 1TQPA 3TW6A 3CCLI 1XX5A 5CVIA 4HRIA 2DT6A 2KKOA 4PSWA 3HSEA 2LP0A 3MQ0A 3OS2A 4BDYA 1BW5A 3CO7C 1MNDA 3GXOA 3UR3C 4BXUA 1MW7A 3LSRA 5CPRB 2LF7A 1IO2A 3JRHA 3RYPA 1YRNB 3CZ6A 2H94A 2WTEA 3LSGA 2R3SA 5HS7A 4F52A 1J9IA 3K4NA 2HYFA 3FK7A 1ZTRA 4CCNA 1MIJA 2ICWG 2PG4A 1MNMC 2EFWA 1W0UA 3CO6C 2HYJA 3CC2I 1K6OA 4RLFA 1A35A 3TOBA 3CJTB 5B1AH 2OUMA 3VODA 3V7SA 3EPZA 3RPUD 4ZZLA 4EATA 2XF5A 2CSOA 1W0TA 3OYDA 4UHTA 2VLAA 3FXUA 2XAFA 3CCSI 3SHFA 1A5JA 4BQQA 2Y30A 3JRFA 1B6AA 1TWHJ 1MSFC 4ENNA 1WJEA 2EFNA 2XGDA 3MVPA 4NB5A 3CUQC 3OIQA 4I99C 2STWA 4XLNF 5GAEJ 3I4MJ 1RPWA 4A3DJ 1USSA 1JXSA 4G6DA 4RB2C 4MQ9F 1A31A 1QU3A 4JX6A 4WXDA 3BR2A 3CCUI 2HPMA 5E79C 5LGNA 2MG4A 2VBWA 3ZMSA 5E3NA 1VQ9I 4ENKA 1XPXA 1XCBA 3WTZA 4B09A 4GDFA 4IXAA 4UVCA 2L9NA 1K78A 3MFKA 2QLZA 3OIPA 1NH3A 3CD6I 5FD6A 4KDPA 3R0JA 4G6TB 1Y1WJ 3OS0A 3BPVA 1T33A 4XL9A 2TDXA 3N4MA 3RZOJ 4I7HA 2YS9A 2VJIA 2ZXWH 2ME6A 4C2UA 1MGTA 2M3AA 3ABLH 2Z5UA 2R92J 3KFWX 2BY1A 3EUHA 3IH2A 1ZHFA 3WTVC 2QENA 1Z91A 5HDNA 2LREA 2DMPA 2P5VA 2Y0SA 4RB0A 5F6FA 2GOMA 3DKXA 2VE8A 1W7PA 1UJ8A 1HQCA 4P9UA 1KU7A 4AU7A 2O7OA 1SEUA 5GAHJ 4GGGA 5DUIA 1S9HA 4FQGA 2BEOA 2OTJI 1OR7A 2R7DA 3T8RA 3COAC 3JW4A 3BR5A 5F0CA 2XHKA 5ED4A 1IRFA 3KCCA 5JR3A 1LNWA 3I0TA 4KNYA 4HEA2 3SFIA 1MSEC 4CYCB 1KQ0A 4R79A 2XKPA 4IO9F 2DDAA 3B6AA 2W00A 1LEBA 3DXJF 4Q47A 4NBQA 1SMTA 2EINH 4L0YB 4B44A 5F0HA 2V1XA 2Y75A 3IWZA 5D5UB 1IRZA 1RKWA 2AXLA 2K9SA 2OQGA 1Q1HA 1K78B 2OZUA 3M4OJ 3C7JA 3JAMK 2HDDA 2V1UA 2EFOA 3F3XA 1LVAA 1GV2A 1ZRFA 2A05A 2IGKA 4M9ZA 1VQNI 5H20A 2FOWA 2F6CA 2K4BA 4L9TA 3LAJA 4BNCA 3IL2A 2W7NA 3RJPA 1MBKA 1G2HA 1WRJA 3RZDJ 1UZCA 1NG6A 3R0AA 3TGNA 3CQZJ 3MKWB 1OISA 4BU2A 4IHTA 3A4CA 1Z77A 1MNEA 2GIVA 2ZJ2A 3SYTA 4D5CA 1CGPA 3CCJI 2HQAA 3QPSA 2CV2A 4G7HF 1MJAA 1S6LA 3GW2A 3BR6A 2L9SA 3K4BA 3N05A 3K1MA 2CW0F 1STZA 4L0ZB 2A6HF 3D5LA 1EJ9A 3T1BA 5TGTA 2MSYA 5J1RA 2DFFA 4CICA 3TW7A 1L3LA 2DFIA 4DJAA 1V54H 2M0CA 2HOSA 1W7PB 4DNCA 4OU0A 2XGXA 2E60A 2LH9A 4C2MJ 5E20A 3HDDA 4XK4A 3I55I 3K4JA 2M0MA 5A2QK 1JUMA 4UB6C 1B8IA 4OMYA 1PJRA 2E5ZA 5IOZA 1D1CA 3PL8A 4LOCA 5M5YJ 3LA2A 3FXJA 2COBA 3QU3A 3A01B 4P5OA 1PDNC 5TJJA 4G12A 2ETHA 4GO1A 3JAMZ 4XORA 3G1OA 4RB1A 3WGHA 3I59A 1SAXA 2AHQA 3HZJA 2HVSA 3H5AA 1WZ2A 5L3GA 2E71A 1T95A 1ZREA 1TQIA 2FD5A 4A6EA 1I1GA 5M5XJ 5K1YA 1DU0A 4LMYA 2HQRA 3H3UA 3H5RA 2KZGA 4AYBN 1YIJI 2KISA 1GVJA 1YJWI 3J81Z 3SZTA 1BOAA 2AXTC 2BY0A 3RPUA 3S3MA 4UXNA 4ZH4F 5EG0A 4BXXJ 5ERIA 4FTHA 5EEHA 2ACJA 1X4PA 2JJ7A 5ILSA 2WAFA 3HG9A 2BE5F 3BROA 3A03A 3ECOA 2EV6A 3RKYA 4KITB 1U5TC 2JSPA 3K4LA 3ZP5A 4XN0A 4KFCA 2K3FA 3HSFA 4N4NB 2EFPA 4FASD 4BS9A 3OYJA 2K4JA 4PSXA 2Y9ZA 5A2QZ 2BOLA 1ITYA 2CUFA 4K2EA 2EBIA 4C3JJ 1FOWA 1MBEA 3OR2C 4MTEA 3C1DA 2DOEA 4GXOA 3ONQA 3WG7H 2XUBA 5E8GA 1AKHA 4NDLA 1PYVA 5D8LB 1Y6IA 2HVQA 1JE8A 2DAOA 4YELA 3H5NA 2LG4A 1W4MA 1MD0A 2YU3A 2CUJA 2L7KA 2MABA 1WI3A 1AWCA 5J47A 3PUFA 2CMPA 3KP7A 3MZ8A 2HXOA 4JP0A 2NVQJ 1EH6A 3CLQA 2FNAA 3GCMA 3DV8A 4IOAF 3T5XA 3S3OA 1I3AA 2VL8A 3X2QH 1MZBA 1CQTA 2FQ3A 1HDPA 2K7LA 2P6SA 3BDDA 3H92A 5FD5A 2LF8A 2E1CA 1KQ9A 2NVYJ 1FOYA 3OV8A 1B9MA 3OYCA 3HL2A 4M3GA 1K4TA 2LKSA 2M4KA 2NVTJ 1OKRA 3CMAI 2XPWA 1N78A 1XSDA 1X1CA 5EG0B 4DGWB 4M6VA 4I0AA 1OCZH 3KYDB 2O8KA 2V9KA 2L0KA 4IHWA 2CJJA 5IT9K 2QQ9A 1Z6RA 1S7EA 4XICA 1MBGA 1IN6A 4LGWA 2FE3A 4U87A 3BZKA 3ZQLA 2MC3A 4E7IA 3GBGA 4S04A 1UG2A 1RUNA 1OCPA 2DPDA 1LVKA 3MWMA 2LC2A 4D9JA 1BL0A 3B6CA 2UXNA 3FHNA 3DEUA 1QNTA 2D1HA 4BXFA 3GMEA 5DM7F 2Z2SB 3K69A 3BG6A 2IS4A 3TP0A 2WA0A 3BG3A 4L5JA 2DOAA 2KQRA 2NAZA 4PK4A 5LHHA 1XD7A 4IRHA 1SFXA 2L7ZA 1V4RA 3LNQA 2L3DA 1SVMA 4CHUA 3HPGA 1P2FA 4N9IA 3CESA 4CYDA 1FOXA 1Z0XA 3EYYA 4CZCA 3NRVA 1GXPA 2X6XA 1X19A 4QLCU 5HNHA 2Q0OA 4MTDA 1AKHB 2BGCA 3A2KA 3DTEA 2VASA 1JUSA 2VQHA 3OL4A 2VOPA 4ESFA 2OBPA 2ZKZA 1F5TA 1Y8QB 3VSKA 3L2QA 3HIFA 3GVAA 3ZMZA 3VB2A 3M3YJ 1ZQ3P 3BJ6A 3FXKA 2O61A 2R7FA 3QPHA 4HDVA 2ZC2A 1G4DA 3GFJA 4HZFA 4U0VA 2W25A 3OMYA 2R7OA 1TP4A 3WTXC 1LFUP 2A6TA 5LRSA 3OYMA 2FSWA 2QSFX 1JT6A 2IS1A 2B0LA 4AD9A 2C6YA 5FRNA 3K9TA 2DODA 4R8HA 5FKNA 1U8RA 3HOWJ 2IP2A 1P4XA 1D1BA 1FZPB 2GLOA 2F5FA 3BR1A 4DYQA 4DBRA 1BIAA 4EGZA 2DLLA 2HNHA 2R7XA 4IHXA 1R1TA 5KAFC 3ECHA 4JX5A 3RTRA 2ZJPF 3O6BB 4A3CJ 3KYLA 4QIWN 2VB6A 4EJTA 2W85A 3ZQCA 3MD2A 3CF2A 1T0FA 4LIVA 2IVMA 5F64A 4IEJA 3BJOA 2O8XA 1YFHA 1XB4A 4V19K 1HSJA 3ZOBA 2WAQA 3IC7A 3PO2J 3LFUA 2FU4A 3L00A 1USTA 1U78A 1KU3A 3R60A 3I54A 3JRIA 5C4XJ 2BY3A 4A2UA 2B7EA 4PFPA 3GO5A 1Y1VJ 1FTTA 4HLYA 2GOXB 3E6CC 1KYZA 2EZIA 3Q0WA 4M3FA 5JLXA 4E7HA 2XAHA 1H9TA 2W48A 1HW2A 4RBOA 2F5CA 1VQPI 4PJJA 3WU2C 1BI2A 4HA8A 3HJEA 4E7LA 1YHQI 1U9OA 3GTPJ 1WJBA 4D0PA 2F5EA 5J8FA 4YFNF 4OOIA 3WTTC 1PVEA 3GTKJ 2Y0SN 3QOEA 5GTIC 5DTDA 4HPQA 4EVIA 1VZ0A 2EFQA 4BE2A 4ENMA 3C2GA 4OIOF 2P4WA 3VPRA 3SQNA 2H1LA 4AIDA 4R1HA 4W97A 2BW3A 2H8WA 1ZAOA 3J80K 3MAJA 4CCJA 4BQAA 3CF5F 1MJ9A 1D8JA 3QP5A 2DA2A 2JN6A 3B73A 5FLVA 5K5RA 2XAGA 3E5QA 2ADUA 2L5QA 4V2FA 3HXLA 4IQ4A 3DU6A 1QBJA 3HYIA 1BR1A 3JCUC 2AQEA 2QKLB 2PFBA 3ZMTA 2DW4A 4V2GA 1DDNA 2E2HJ 3DPTA 2M87A 3H36A
chains in the Genus database with same CATH topology
3V7RA 4HBLA 3QU6A 2HQNA 3ZMDA 3BOQA 5ICEA 1MDMA 3P7NA 1ONVA 3GUDA 3LFKA 2KJCA 3RKXA 3GZ5A 2HEOA 2A61A 4OINF 1SMYF 1EH8A 1F1ZA 4UNOA 3VEPA 3J80Z 3GLXA 4FX0A 3RI4A 3BPXA 1ZG5A 2VXZA 4KMUX 1LEAA 5E1WA 5H6RA 4GYGA 4WX9A 4G7ZF 2VBZA 1TQMA 2VE9A 1IZ1A 2RDPA 1HKQA 1GXQA 4RB3C 2IT0A 3K2ZA 5HS9A 4FT8A 3MZYA 5LRRA 1MJBA 4Y13A 2ISYA 2OZ6A 4O6JA 1IAWA 4LK1F 5D4SA 5CVRA 1RUOA 3I4PA 1Z9CA 1IN7A 2D1VA 3LQRA 2RVCA 3KETA 3HRSA 4PGHA 4BHBA 1BI1A 2K86A 4HLXA 2FBHA 2IA1A 4Y15A 4A12A 3QOPA 1HW1A 2QM3A 1IXCA 2MLKA 3F8BA 4G9YA 2OU2A 1E2XA 1BJAA 2OD5A 2WC2A 4HX8A 5BS6A 2IPQX 4EJWA 3LAPA 3DQVC 3E5UA 5ICGA 2PJPA 2DI3A 4KYWA 3ZN1A 4Q5SF 5K5OA 1KGSA 1YS7A 3F8FA 1V3FA 4MQVA 3ERED 2CGPA 4YFKF 2EA4A 3CJNA 2PMHA 3L9FA 1B59A 1FBUA 1R23A 3F6OA 2GWRA 4U7BA 2EA2A 2XIGA 3SFZA 5HDGA 2XASA 1XCVA 3ROUA 4S05A 4AIKA 1YS6A 4U0WA 1XDUA 3IRQA 4LB6B 1LDKB 3CUQA 4EJUA 4UV9A 4RAZA 4KUMA 3VFZA 1J75A 4WXHA 1IW7F 4L9NA 3FZVA 1L0OC 1I5ZA 1FBSA 4A5NA 4IJAA 3KEQA 1HXDA 1QZYA 3HOTA 2A68F 1Z1DA 1S3JA 3FXQA 3ELKA 3TO6A 2QZ8A 4GYIA 2M5WA 1QPMA 2QBYA 2NRAC 4EQQA 3R4KA 2V1DA 1S7OA 5D5WB 3R6SA 2HS5A 3C18A 1RNLA 3E97A 3T0YA 5J6XA 5ILUA 1G3TA 1ZN2A 4XBFA 2O0YA 1ZG3A 3PFIA 2NS0A 4I2OA 4HX4A 3WGIA 3CUQB 2H6BA 4JQFA 4EM1A 1OYYA 2L02A 3ZMVA 4BYYA 2BBYA 4OIRF 3I58A 3C3WA 1ZGJA 4L18B 3J81K 1T6SA 4IPAA 3WTUC 1G3SA 2BYVE 2YPRA 3JTHA 3NEUA 3GFLA 1BN5A 1BIBA 2M30A 1ZG1A 3WTYC 1H0MA 3W6JB 3I53A 4RGXA 2QBYB 2EJRA 2QYOA 5CVJA 4BHPA 2X4HA 5F1RA 5DCFA 2V6CA 2VN2A 4U7DA 2PN6A 2IA0A 5BMZA 3F72A 3EDPA 2AS5F 1O3SA 2F5DA 4HF2A 1YG2A 4CGZA 4HX7A 2GA1A 5FFXA 2FXAA 1KU9A 2HGCA 5FLXK 2NNNA 5DDGA 2VOOA 2V79A 3V8JA 1XGOA 3CLOA 1FP1D 1J59A 1Z05A 3TOAA 6PAXA 5ICFA 3FHZA 5DD4A 1LDJA 2E1NA 3GF2A 4QWQA 3GZ6A 2UWMA 1RZ4A 1O3TA 2W57A 1YYVA 3JSOA 1OYWA 2IRFG 1R1VA 5JFRA 2O3FA 2Q8KA 2XKOA 1B4AA 1R7JA 2LKPA 4HF1A 4G7OF 1U5TA 5D4RA 4XSZF 1SFUA 3U2RA 5BOXA 5FLXZ 5DCMA 3EQLF 1R5GA 4I02A 2KJBA 3DP7A 5CYVA 4A5MA 3FX3A 5LGUA 2IW5A 4IRGA 1P4WA 1XSVA 1X3UA 4AIHA 1R22A 4HV6A 1ZARA 2ZCWA 3ULQB 3F22A 3FMSA 3HTSB 3W6KB 2GXBA 1O7FA 1ZGAA 3B02A 3MZHA 2CWEA 1IN8A 5FFZA 3RYRA 1QGPA 1KYWA 5D6EA 2PI0A 3U1DA 3JTGA 1S7AA 4MGRA 4ENJA 5LLQA 1TNTA 1R58A 2RNJA 1LQ1A 4KN7X 2FEZA 3AAFA 3M7GA 2NYXA 1FYLA 1K7AA 3P9IA 2GQQA 2DPUA 2Z9OA 5ICCA 4LFUA 5L3EA 5CVUA 3TKYA 1J7KA 1U5TB 2A07F 2RGVA 1QQIA 3H3ZA 1FX7A 4O5VA 3IHUA 4XSXF 5AONA 2A5YB 5DCMB 4Z2YA 1KA8A 3DPLC 4RAYA 1W5SA 2P8TA 2VBXA 2COMA 1JGSA 1R36A 4ZYEA 3ZPLA 5E17F 1U2WA 5BPIA 4NHJA 4LJZF 3TQNA 3Q9VA 1A04A 3BWGA 1REPC 4HQMA 1AOYA 1WWXA 4M74A 3V8KA 1F4KA 4RGSA 4JK1X 3E3VA 1SD5A 5LEKA 1BI0A 3HHGA 3P9CA 1VTNC 1DPRA 3HHHA 3K1PA 2DK5A 4FX4A 4G6QA 2DK8A 3QP6A 4L5IA 1BM9A 1SD6A 4M72A 4UVAA 2DU9A 2H09A 3KE2A 4ON0A 2OQRA 4I01A 5L3FA 1EV7A 4N9HA 1G6NA 5D8KB 2STTA 2ESHA 2Q2EA 1IXRC 3Q9SA 4TV7A 4IVNA 5AIQA 1XMKA 2G7UA 2WWYA 4LG0B 2E7XA 3SZPA 3SXYA 2PBIA 1SD7A 3HTUA 3WE2A 4KN4X 4A6DA 2NNYA 2ZBKA 1TW3A 2LNBA 4IF4A 1G3WA 1I6XA 4U88A 5KK1A 2PEXA 2RQPA 5L3CA 4OIPF 4Q4ZF 1IUYA 3BP8A 1FPQA 2XVCA 1KU2A 1HKSA 4N0BA 2XROA 2GZWA 2UXXA 2CG4A 3ISPA 1FNNA 4P96A 4RGUA 2JZYA 2RC4A 2DBBA 5FB2A 3E5XA 3FM5A 2JT1A 1UHWA 2MA3A 1YW8A 1Y0UA 1P92A 4P9FA 2QVOA 1OYIA 3RKWA 2D2WA 2HOEA 2HR3A 4UUVA 4KT5C 3M8EA 1OMIA 2QWWA 3GYHX 4PDKA 2IJLA 2DT5A 2ZNYA 3N97A 1F9NA 2OA4A 4U0YA 2O6GE 3T8TA 1SFEA 3U9GA 4FHTA 5L3BA 3GX4X 4YIFA 1ZRDA 2J5PA 4NQWA 4WF2A 2L01A 2QUFA 3ML6A 1XGNA 2H6CA 3REOA 3L09A 2M87A 4YG2F 1KQ8A 4LB5A 3WU0A 5JI6A 1R00A 2VT3A 2FBIA 3RDIA 1BC7C 4HV5A 2DO7A 1TTYA 3FF5A 3L2CA 5HVQC 1JHFA 4EMSA 1PP8F 3RPQA 3ABUA 4LLLA 1QZZA 1XGSA 4LLNA 4ETSA 5D5VB 2W24A 3CTAA 4Q48A 4XLPF 4RGRA 4JBAA 3QPTA 4WCGA 2DQRA 2CYYA 4M9SA 1FSHA 3FM3A 1CF7A 2HDCA 1DPUA 4DQ2A 4L9JA 2WV0A 2MH2A 4P55A 3KP6A 2ZO4A 3O2PE 4KIGA 2LSOA 1ZRCA 3PQKA 3GWZA 1XDSA 2KIMA 3WODF 2HFHA 3EETA 1YO5C 3I64A 1YQAA 4LK0F 2EWNA 4E70A 2HKXA 4H0EA 4AVPA 5DD8A 3IWFA 1D3YA 1TNSA 3TO7A 1Z7UA 3J7AO 1U6GA 2OAZA 3HOSA 2A69F 1FWZA 3I5UA 4I98B 5DUKA 5FGMA 4CXFA 5E18F 4WK8F 1CF7B 3KZZA 2Z3YA 1C0WA 2VODA 3HUGA 1T98A 1ZLKA 3L7WA 5JVTA 2PQ8A 3CUOA 1J0RA 2CQKA 2XV4S 1HBXG 1UCRA 1ZH5A 4PGGA 2DQLA 1HKTA 2M8EA 3IKVA 1T2KA 3M8FA 2A6EF 2ZMEA 1O57A 2ZFWA 2FBKA 5E8IA 5D6FA 3FXRA 1RIOH 2L4MA 4EM2A 5DEQA 1D8KA 5E1XA 5K5QA 1FY7A 3CDHA 2MH9A 4BH9A 2KIFA 2XAJA 3ZN0A 1JHHA 2HTSA 3K0LA 4HYEA 1SD4A 4O3MA 4F7ZA 3ZQ7A 4ZYHA 1FP2A 3KP3A 2FF4A 2MLGA 1TBXA 3EYIA 3TDZC 3WU1B 2E7WA 4WWCA 2Z99A 1WQ2A 3TO9A 3I71A 2RV8A 1BBYA 5LGTA 2M45A 1LB2A 4MHGA 3P9KA 3LSTA 3G3ZA 4AWXB 2L54A 2QQAA 4HDUA 1G3YA 1DUXC 2ZMEB 1EH7A 3IKTA 1K79A 2P5LC 1R1UA 3ABTA 5DV5A 2EV0A 4I09A 3FMQA 3WTSC 4M6XA 5CJ9A 4ZYGA 2MD5A 3LQQA 3GFIA 4MEYF 2HZTA 2KIUA 2O03A 2JRTA 3KP5A 4BHCA 2VC1A 1I1SA 2EB7A 2Y0MA 1T38A 5IT3A 4A0ZA 4OIQF 4KA4A 3V7CA 4ESJA 1HSTA 1HW5A 2VT2A 2DTRA 3FMRA 2G7HA 2UZKA 3GFMA 2HKOA 3MEXA 4GCVA 3V8LA 2X0LA 2XRNA 1ZLJA 4EM0B 2YSRA 2PLYA 5LHGA 1QO0D 3M9AA 1I27A 2K27A 4BAYA 4HQEA 4L9VA 2VBYA 1IXSB 4KMFA 1ON1A 1FSEA 1ULYA 2P6TA 2FMLA 2A3SA 4CO8A 1E17A 2XAQA 3JSPA 3E6DA 4M6YA 3DF8A 4ZZDA 1XN7A 3QAHA 5ILVA 2D45A 4KIFA 2L4AA 3I59B 5TRDA 1FT9A 5EEGA 2YX4A 5AIPA 4CDGA 5FO5A 3Q5FA 1BC8C 3DFGA 4M71A 5DYMA 4HOBA 2GAUA 4B8XA 2FOKA 4M73A 1FC3A 4Y17A 2ZNZA 1B1BA 5CLSA 5HS8A 3LWFA 4OMZA 2JTVA 2K02A 3E6BA 2HWVA 5CVVA 1O3RA 2FA5A 4LG0A 2FRHA 2YX7A 4EGYA 5HLHA 1P4AA 1TLHB 1P6RA 4LLGF 1PP7U 3HRUA 3KP2A 4HW0A 2VONA 3V4GA 2LDUA 2JPBA 1ZYRF 3MCZA 1XGMA 4UVBA 5LHIA 3BJAA 4G94A 3S2WA 2J5OA 3QRFF 1S29A 5IT9Z 4KICA 1U3EM 3OOPA 4HAMA 1YW9A 2V9VA 1IF1A 3LA3A 1T39A 1UHMA 1XSXA 3D0SA 3GEZA 4A0YA 4CZZA 1LDDA 1J2XA 3KP4A 3KLNA 3WG9A 1ON2A 1YTYA 5D5XB 1B9NA 4HF0A 5BQTA 2GA2A 2M1BA 3HRTA 4MNUA 2HYGD 4LD5A 4IRIA 4YIIA 1ODDA 1WKMA 4KIBA 2QQBA 1R5HA 1H9GA 3KZYA 2H27A 2PMUA 1PUEE 2P7VB 4WXCA 4ESBA 5HLGA 2FMYA 1IN5A 3KLOA 1S8NA 1UB9A 2ZXJA 1O7LA 1O3QA 3O3KA 3KEOA 1Z6TA 2Y48A 3ZMUA 1OPCA 3F8NA 3F21A 1BI3A 2EV5A 1GHCA 3F8CA 3VOEA 4RS8A 5J8CA 1LJ9A 5LEJA 1J5YA 5JHUA 2GXGA 2P5KA 1YW7A 2VC0A 3R61A 2JSCA 5HLIA 4I0BA 1MKMA 3F8MA 3IRRA 2W84A 2KRFA 2CO5A 5L3DA 2JPCA 3BY6A 2IA2A 2BV6A 1RI7A 2ESNA 3PQJA 5LBQA 3K1NA 1WSUA 1WI9A 3E6MA 4IHSA 1IRGA 3F6VA 3DKWA 4ZYDA 2P7CB 4G8XA 1XMAA 4M9XA 3LA7A 1TW2A 1W7PD 2RKHA 3RIRA 2F2EA 4PCQA 3NQOA 2HTJA 1W5TA 4AIJA 4EJVA 2G9WA 4UV8A 4PZJA 3M1EA 2ELHA 3G73A 5BPDA 1IN4A 5H6QA 4XRFA 4EJOA 2FNPA 3FWEA 2CFXA 1UFMA 3BZ6A 3WGGA 4MEXF 5HDKA 1D5VA 4ASNA 1FOKA 1FLIA 1FBQA 3WE3A 1NHAA 1MDMB 3WTWC 4YFXF 1FYMA 3TDUC 1YIOA 1DP7P 3HSRA 2EK5A 5HOOA 5E1ZB 2MBFA 2ISZA 5KVRA 2YR2A 3F23A 3HRMA 1YLFA 4A0XA 1FYKA 2RN7A 4EV0A 2Z33A 1TQPA 5CVIA 2KKOA 3HSEA 3MQ0A 3CO7C 3GXOA 4BXUA 2LF7A 3RYPA 2H94A 2WTEA 5HS7A 2R3SA 1J9IA 2HYFA 2PG4A 2EFWA 3CO6C 1K6OA 3TOBA 3VODA 3V7SA 4ZZLA 2CSOA 4UHTA 3FXUA 2XAFA 3SHFA 1B6AA 4ENNA 2EFNA 4NB5A 3CUQC 2STWA 4XLNF 1USSA 1JXSA 4G6DA 4RB2C 4MQ9F 4WXDA 5LGNA 2VBWA 3ZMSA 4ENKA 1XCBA 3WTZA 4B09A 4IXAA 4UVCA 1K78A 3MFKA 2QLZA 5FD6A 4KDPA 3R0JA 3BPVA 2TDXA 3N4MA 4I7HA 1MGTA 2Z5UA 3KFWX 3EUHA 1ZHFA 3WTVC 2QENA 1Z91A 5HDNA 2P5VA 4RB0A 5F6FA 2VE8A 1W7PA 1HQCA 4P9UA 1KU7A 4GGGA 5DUIA 2BEOA 1OR7A 2R7DA 3T8RA 3COAC 3JW4A 2XHKA 5ED4A 1IRFA 3KCCA 5JR3A 1LNWA 3I0TA 4KNYA 1KQ0A 4R79A 2XKPA 1LEBA 3DXJF 4Q47A 1SMTA 4L0YB 2V1XA 2Y75A 3IWZA 5D5UB 2AXLA 1K78B 2OQGA 1Q1HA 2OZUA 3C7JA 3JAMK 2V1UA 2EFOA 3F3XA 1LVAA 1ZRFA 4M9ZA 5H20A 2K4BA 4L9TA 3LAJA 4BNCA 3IL2A 3RJPA 1WRJA 3R0AA 3TGNA 4IHTA 2GIVA 2ZJ2A 1CGPA 4G7HF 1MJAA 1S6LA 3GW2A 3K1MA 2CW0F 1STZA 4L0ZB 2A6HF 3D5LA 3T1BA 4CICA 1L3LA 2DFIA 1W7PB 4DNCA 4OU0A 2XGXA 5E20A 5A2QK 4OMYA 3LA2A 3QU3A 4P5OA 1PDNC 5TJJA 4GO1A 2ETHA 3JAMZ 4RB1A 3WGHA 3I59A 1SAXA 5L3GA 1ZREA 1TQIA 4A6EA 1I1GA 5K1YA 4LMYA 2HQRA 3H3UA 1GVJA 3J81Z 3SZTA 1BOAA 3RPUA 4UXNA 4ZH4F 5ERIA 5EEHA 2ACJA 5ILSA 2BE5F 3BROA 3ECOA 2EV6A 3RKYA 1U5TC 3ZP5A 4KFCA 3HSFA 2EFPA 2K4JA 5A2QZ 4K2EA 4MTEA 3C1DA 4GXOA 2XUBA 5E8GA 5D8LB 1JE8A 2DAOA 1W4MA 1MD0A 2YU3A 1AWCA 3KP7A 1EH6A 2FNAA 3DV8A 3T5XA 1MZBA 2FQ3A 2K7LA 2P6SA 3BDDA 3H92A 5FD5A 2LF8A 2E1CA 1KQ9A 3OV8A 1B9MA 1OKRA 1XSDA 4I0AA 5IT9K 2QQ9A 1Z6RA 1IN6A 4LGWA 2FE3A 2MC3A 4S04A 2DPDA 1RUNA 3MWMA 2UXNA 3DEUA 1QNTA 2D1HA 3K69A 4L5JA 2NAZA 5LHHA 1XD7A 4IRHA 1SFXA 1V4RA 2L3DA 4CHUA 1P2FA 4N9IA 4CYDA 3EYYA 3NRVA 1GXPA 4MTDA 4QLCU 2Q0OA 2BGCA 2VOPA 4ESFA 2OBPA 2ZKZA 1F5TA 3HIFA 3GVAA 3ZMZA 3VB2A 3BJ6A 2O61A 2R7FA 3QPHA 4HDVA 1G4DA 3GFJA 4HZFA 4U0VA 2W25A 3WTXC 5LRSA 2FSWA 2B0LA 4AD9A 2C6YA 3K9TA 4R8HA 1U8RA 2IP2A 1P4XA 1FZPB 2F5FA 1BIAA 4EGZA 2DLLA 1R1TA 3ECHA 3RTRA 3O6BB 4EJTA 2W85A 1T0FA 2IVMA 5F64A 3BJOA 2O8XA 1YFHA 1XB4A 1HSJA 3IC7A 2FU4A 3L00A 1USTA 1U78A 1KU3A 3R60A 3I54A 4A2UA 3GO5A 3E6CC 1KYZA 2XAHA 1H9TA 1HW2A 2F5CA 1BI2A 4HA8A 4D0PA 2F5EA 5J8FA 4YFNF 4OOIA 3WTTC 4EVIA 2EFQA 4ENMA 4OIOF 2P4WA 3SQNA 4R1HA 1ZAOA 3J80K 3MAJA 4BQAA 1MJ9A 1D8JA 3QP5A 3B73A 5K5RA 2XAGA 3E5QA 2ADUA 1QBJA 3HYIA 2PFBA 3ZMTA 2DW4A 1DDNA 3DPTA 4HLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7R A;  4HBL A;  3QU6 A;  2HQN A;  3ZMD A;  3BOQ A;  5ICE A;  1MDM A;  3P7N A;  1ONV A;  3GUD A;  3LFK A;  2KJC A;  3RKX A;  3GZ5 A;  2HEO A;  2A61 A;  4OIN F;  1SMY F;  1EH8 A;  1F1Z A;  4UNO A;  3VEP A;  3J80 Z;  3GLX A;  4FX0 A;  3RI4 A;  3BPX A;  1ZG5 A;  2VXZ A;  4KMU X;  1LEA A;  5E1W A;  5H6R A;  4GYG A;  4WX9 A;  4G7Z F;  2VBZ A;  1TQM A;  2VE9 A;  1IZ1 A;  2RDP A;  1HKQ A;  1GXQ A;  4RB3 C;  2IT0 A;  3K2Z A;  5HS9 A;  4FT8 A;  3MZY A;  5LRR A;  1MJB A;  4Y13 A;  2ISY A;  2OZ6 A;  4O6J A;  1IAW A;  4LK1 F;  5D4S A;  5CVR A;  1RUO A;  3I4P A;  1Z9C A;  1IN7 A;  2D1V A;  3LQR A;  2RVC A;  3KET A;  3HRS A;  4PGH A;  4BHB A;  1BI1 A;  2K86 A;  4HLX A;  2FBH A;  2IA1 A;  4Y15 A;  4A12 A;  3QOP A;  1HW1 A;  2QM3 A;  1IXC A;  2MLK A;  3F8B A;  4G9Y A;  2OU2 A;  1E2X A;  1BJA A;  2OD5 A;  2WC2 A;  4HX8 A;  5BS6 A;  2IPQ X;  4EJW A;  3LAP A;  3DQV C;  3E5U A;  5ICG A;  2PJP A;  2DI3 A;  4KYW A;  3ZN1 A;  4Q5S F;  5K5O A;  1KGS A;  1YS7 A;  3F8F A;  1V3F A;  4MQV A;  3ERE D;  2CGP A;  4YFK F;  2EA4 A;  3CJN A;  2PMH A;  3L9F A;  1B59 A;  1FBU A;  1R23 A;  3F6O A;  2GWR A;  4U7B A;  2EA2 A;  2XIG A;  3SFZ A;  5HDG A;  2XAS A;  1XCV A;  3ROU A;  4S05 A;  4AIK A;  1YS6 A;  4U0W A;  1XDU A;  3IRQ A;  4LB6 B;  1LDK B;  3CUQ A;  4EJU A;  4UV9 A;  4RAZ A;  4KUM A;  3VFZ A;  1J75 A;  4WXH A;  1IW7 F;  4L9N A;  3FZV A;  1L0O C;  1I5Z A;  1FBS A;  4A5N A;  4IJA A;  3KEQ A;  1HXD A;  1QZY A;  3HOT A;  2A68 F;  1Z1D A;  1S3J A;  3FXQ A;  3ELK A;  3TO6 A;  2QZ8 A;  4GYI A;  2M5W A;  1QPM A;  2QBY A;  2NRA C;  4EQQ A;  3R4K A;  2V1D A;  1S7O A;  5D5W B;  3R6S A;  2HS5 A;  3C18 A;  1RNL A;  3E97 A;  3T0Y A;  5J6X A;  5ILU A;  1G3T A;  1ZN2 A;  4XBF A;  2O0Y A;  1ZG3 A;  3PFI A;  2NS0 A;  4I2O A;  4HX4 A;  3WGI A;  3CUQ B;  2H6B A;  4JQF A;  4EM1 A;  1OYY A;  2L02 A;  3ZMV A;  4BYY A;  2BBY A;  4OIR F;  3I58 A;  3C3W A;  1ZGJ A;  4L18 B;  3J81 K;  1T6S A;  4IPA A;  3WTU C;  1G3S A;  2BYV E;  2YPR A;  3JTH A;  3NEU A;  3GFL A;  1BN5 A;  1BIB A;  2M30 A;  1ZG1 A;  3WTY C;  1H0M A;  3W6J B;  3I53 A;  4RGX A;  2QBY B;  2EJR A;  2QYO A;  5CVJ A;  4BHP A;  2X4H A;  5F1R A;  5DCF A;  2V6C A;  2VN2 A;  4U7D A;  2PN6 A;  2IA0 A;  5BMZ A;  3F72 A;  3EDP A;  2AS5 F;  1O3S A;  2F5D A;  4HF2 A;  1YG2 A;  4CGZ A;  4HX7 A;  2GA1 A;  5FFX A;  2FXA A;  1KU9 A;  2HGC A;  5FLX K;  2NNN A;  5DDG A;  2VOO A;  2V79 A;  3V8J A;  1XGO A;  3CLO A;  1FP1 D;  1J59 A;  1Z05 A;  3TOA A;  6PAX A;  5ICF A;  3FHZ A;  5DD4 A;  1LDJ A;  2E1N A;  3GF2 A;  4QWQ A;  3GZ6 A;  2UWM A;  1RZ4 A;  1O3T A;  2W57 A;  1YYV A;  3JSO A;  1OYW A;  2IRF G;  1R1V A;  5JFR A;  2O3F A;  2Q8K A;  2XKO A;  1B4A A;  1R7J A;  2LKP A;  4HF1 A;  4G7O F;  1U5T A;  5D4R A;  4XSZ F;  1SFU A;  3U2R A;  5BOX A;  5FLX Z;  5DCM A;  3EQL F;  1R5G A;  4I02 A;  2KJB A;  3DP7 A;  5CYV A;  4A5M A;  3FX3 A;  5LGU A;  2IW5 A;  4IRG A;  1P4W A;  1XSV A;  1X3U A;  4AIH A;  1R22 A;  4HV6 A;  1ZAR A;  2ZCW A;  3ULQ B;  3F22 A;  3FMS A;  3HTS B;  3W6K B;  2GXB A;  1O7F A;  1ZGA A;  3B02 A;  3MZH A;  2CWE A;  1IN8 A;  5FFZ A;  3RYR A;  1QGP A;  1KYW A;  5D6E A;  2PI0 A;  3U1D A;  3JTG A;  1S7A A;  4MGR A;  4ENJ A;  5LLQ A;  1TNT A;  1R58 A;  2RNJ A;  1LQ1 A;  4KN7 X;  2FEZ A;  3AAF A;  3M7G A;  2NYX A;  1FYL A;  1K7A A;  3P9I A;  2GQQ A;  2DPU A;  2Z9O A;  5ICC A;  4LFU A;  5L3E A;  5CVU A;  3TKY A;  1J7K A;  1U5T B;  2A07 F;  2RGV A;  1QQI A;  3H3Z A;  1FX7 A;  4O5V A;  3IHU A;  4XSX F;  5AON A;  2A5Y B;  5DCM B;  4Z2Y A;  1KA8 A;  3DPL C;  4RAY A;  1W5S A;  2P8T A;  2VBX A;  2COM A;  1JGS A;  1R36 A;  4ZYE A;  3ZPL A;  5E17 F;  1U2W A;  5BPI A;  4NHJ A;  4LJZ F;  3TQN A;  3Q9V A;  1A04 A;  3BWG A;  1REP C;  4HQM A;  1AOY A;  1WWX A;  4M74 A;  3V8K A;  1F4K A;  4RGS A;  4JK1 X;  3E3V A;  1SD5 A;  5LEK A;  1BI0 A;  3HHG A;  3P9C A;  1VTN C;  1DPR A;  3HHH A;  3K1P A;  2DK5 A;  4FX4 A;  4G6Q A;  2DK8 A;  3QP6 A;  4L5I A;  1BM9 A;  1SD6 A;  4M72 A;  4UVA A;  2DU9 A;  2H09 A;  3KE2 A;  4ON0 A;  2OQR A;  4I01 A;  5L3F A;  1EV7 A;  4N9H A;  1G6N A;  5D8K B;  2STT A;  2ESH A;  2Q2E A;  1IXR C;  3Q9S A;  4TV7 A;  4IVN A;  5AIQ A;  1XMK A;  2G7U A;  2WWY A;  4LG0 B;  2E7X A;  3SZP A;  3SXY A;  2PBI A;  1SD7 A;  3HTU A;  3WE2 A;  4KN4 X;  4A6D A;  2NNY A;  2ZBK A;  1TW3 A;  2LNB A;  4IF4 A;  1G3W A;  1I6X A;  4U88 A;  5KK1 A;  2PEX A;  2RQP A;  5L3C A;  4OIP F;  4Q4Z F;  1IUY A;  3BP8 A;  1FPQ A;  2XVC A;  1KU2 A;  1HKS A;  4N0B A;  2XRO A;  2GZW A;  2UXX A;  2CG4 A;  3ISP A;  1FNN A;  4P96 A;  4RGU A;  2JZY A;  2RC4 A;  2DBB A;  5FB2 A;  3E5X A;  3FM5 A;  2JT1 A;  1UHW A;  2MA3 A;  1YW8 A;  1Y0U A;  1P92 A;  4P9F A;  2QVO A;  1OYI A;  3RKW A;  2D2W A;  2HOE A;  2HR3 A;  4UUV A;  4KT5 C;  3M8E A;  1OMI A;  2QWW A;  3GYH X;  4PDK A;  2IJL A;  2DT5 A;  2ZNY A;  3N97 A;  1F9N A;  2OA4 A;  4U0Y A;  2O6G E;  3T8T A;  1SFE A;  3U9G A;  4FHT A;  5L3B A;  3GX4 X;  4YIF A;  1ZRD A;  2J5P A;  4NQW A;  4WF2 A;  2L01 A;  2QUF A;  3ML6 A;  1XGN A;  2H6C A;  3REO A;  3L09 A;  2M87 A;  4YG2 F;  1KQ8 A;  4LB5 A;  3WU0 A;  5JI6 A;  1R00 A;  2VT3 A;  2FBI A;  3RDI A;  1BC7 C;  4HV5 A;  2DO7 A;  1TTY A;  3FF5 A;  3L2C A;  5HVQ C;  1JHF A;  4EMS A;  1PP8 F;  3RPQ A;  3ABU A;  4LLL A;  1QZZ A;  1XGS A;  4LLN A;  4ETS A;  5D5V B;  2W24 A;  3CTA A;  4Q48 A;  4XLP F;  4RGR A;  4JBA A;  3QPT A;  4WCG A;  2DQR A;  2CYY A;  4M9S A;  1FSH A;  3FM3 A;  1CF7 A;  2HDC A;  1DPU A;  4DQ2 A;  4L9J A;  2WV0 A;  2MH2 A;  4P55 A;  3KP6 A;  2ZO4 A;  3O2P E;  4KIG A;  2LSO A;  1ZRC A;  3PQK A;  3GWZ A;  1XDS A;  2KIM A;  3WOD F;  2HFH A;  3EET A;  1YO5 C;  3I64 A;  1YQA A;  4LK0 F;  2EWN A;  4E70 A;  2HKX A;  4H0E A;  4AVP A;  5DD8 A;  3IWF A;  1D3Y A;  1TNS A;  3TO7 A;  1Z7U A;  3J7A O;  1U6G A;  2OAZ A;  3HOS A;  2A69 F;  1FWZ A;  3I5U A;  4I98 B;  5DUK A;  5FGM A;  4CXF A;  5E18 F;  4WK8 F;  1CF7 B;  3KZZ A;  2Z3Y A;  1C0W A;  2VOD A;  3HUG A;  1T98 A;  1ZLK A;  3L7W A;  5JVT A;  2PQ8 A;  3CUO A;  1J0R A;  2CQK A;  2XV4 S;  1HBX G;  1UCR A;  1ZH5 A;  4PGG A;  2DQL A;  1HKT A;  2M8E A;  3IKV A;  1T2K A;  3M8F A;  2A6E F;  2ZME A;  1O57 A;  2ZFW A;  2FBK A;  5E8I A;  5D6F A;  3FXR A;  1RIO H;  2L4M A;  4EM2 A;  5DEQ A;  1D8K A;  5E1X A;  5K5Q A;  1FY7 A;  3CDH A;  2MH9 A;  4BH9 A;  2KIF A;  2XAJ A;  3ZN0 A;  1JHH A;  2HTS A;  3K0L A;  4HYE A;  1SD4 A;  4O3M A;  4F7Z A;  3ZQ7 A;  4ZYH A;  1FP2 A;  3KP3 A;  2FF4 A;  2MLG A;  1TBX A;  3EYI A;  3TDZ C;  3WU1 B;  2E7W A;  4WWC A;  2Z99 A;  1WQ2 A;  3TO9 A;  3I71 A;  2RV8 A;  1BBY A;  5LGT A;  2M45 A;  1LB2 A;  4MHG A;  3P9K A;  3LST A;  3G3Z A;  4AWX B;  2L54 A;  2QQA A;  4HDU A;  1G3Y A;  1DUX C;  2ZME B;  1EH7 A;  3IKT A;  1K79 A;  2P5L C;  1R1U A;  3ABT A;  5DV5 A;  2EV0 A;  4I09 A;  3FMQ A;  3WTS C;  4M6X A;  5CJ9 A;  4ZYG A;  2MD5 A;  3LQQ A;  3GFI A;  4MEY F;  2HZT A;  2KIU A;  2O03 A;  2JRT A;  3KP5 A;  4BHC A;  2VC1 A;  1I1S A;  2EB7 A;  2Y0M A;  1T38 A;  5IT3 A;  4A0Z A;  4OIQ F;  4KA4 A;  3V7C A;  4ESJ A;  1HST A;  1HW5 A;  2VT2 A;  2DTR A;  3FMR A;  2G7H A;  2UZK A;  3GFM A;  2HKO A;  3MEX A;  4GCV A;  3V8L A;  2X0L A;  2XRN A;  1ZLJ A;  4EM0 B;  2YSR A;  2PLY A;  5LHG A;  1QO0 D;  3M9A A;  1I27 A;  2K27 A;  4BAY A;  4HQE A;  4L9V A;  2VBY A;  1IXS B;  4KMF A;  1ON1 A;  1FSE A;  1ULY A;  2P6T A;  2FML A;  2A3S A;  4CO8 A;  1E17 A;  2XAQ A;  3JSP A;  3E6D A;  4M6Y A;  3DF8 A;  4ZZD A;  1XN7 A;  3QAH A;  5ILV A;  2D45 A;  4KIF A;  2L4A A;  3I59 B;  5TRD A;  1FT9 A;  5EEG A;  2YX4 A;  5AIP A;  4CDG A;  5FO5 A;  3Q5F A;  1BC8 C;  3DFG A;  4M71 A;  5DYM A;  4HOB A;  2GAU A;  4B8X A;  2FOK A;  4M73 A;  1FC3 A;  4Y17 A;  2ZNZ A;  1B1B A;  5CLS A;  5HS8 A;  3LWF A;  4OMZ A;  2JTV A;  2K02 A;  3E6B A;  2HWV A;  5CVV A;  1O3R A;  2FA5 A;  4LG0 A;  2FRH A;  2YX7 A;  4EGY A;  5HLH A;  1P4A A;  1TLH B;  1P6R A;  4LLG F;  1PP7 U;  3HRU A;  3KP2 A;  4HW0 A;  2VON A;  3V4G A;  2LDU A;  2JPB A;  1ZYR F;  3MCZ A;  1XGM A;  4UVB A;  5LHI A;  3BJA A;  4G94 A;  3S2W A;  2J5O A;  3QRF F;  1S29 A;  5IT9 Z;  4KIC A;  1U3E M;  3OOP A;  4HAM A;  1YW9 A;  2V9V A;  1IF1 A;  3LA3 A;  1T39 A;  1UHM A;  1XSX A;  3D0S A;  3GEZ A;  4A0Y A;  4CZZ A;  1LDD A;  1J2X A;  3KP4 A;  3KLN A;  3WG9 A;  1ON2 A;  1YTY A;  5D5X B;  1B9N A;  4HF0 A;  5BQT A;  2GA2 A;  2M1B A;  3HRT A;  4MNU A;  2HYG D;  4LD5 A;  4IRI A;  4YII A;  1ODD A;  1WKM A;  4KIB A;  2QQB A;  1R5H A;  1H9G A;  3KZY A;  2H27 A;  2PMU A;  1PUE E;  2P7V B;  4WXC A;  4ESB A;  5HLG A;  2FMY A;  1IN5 A;  3KLO A;  1S8N A;  1UB9 A;  2ZXJ A;  1O7L A;  1O3Q A;  3O3K A;  3KEO A;  1Z6T A;  2Y48 A;  3ZMU A;  1OPC A;  3F8N A;  3F21 A;  1BI3 A;  2EV5 A;  1GHC A;  3F8C A;  3VOE A;  4RS8 A;  5J8C A;  1LJ9 A;  5LEJ A;  1J5Y A;  5JHU A;  2GXG A;  2P5K A;  1YW7 A;  2VC0 A;  3R61 A;  2JSC A;  5HLI A;  4I0B A;  1MKM A;  3F8M A;  3IRR A;  2W84 A;  2KRF A;  2CO5 A;  5L3D A;  2JPC A;  3BY6 A;  2IA2 A;  2BV6 A;  1RI7 A;  2ESN A;  3PQJ A;  5LBQ A;  3K1N A;  1WSU A;  1WI9 A;  3E6M A;  4IHS A;  1IRG A;  3F6V A;  3DKW A;  4ZYD A;  2P7C B;  4G8X A;  1XMA A;  4M9X A;  3LA7 A;  1TW2 A;  1W7P D;  2RKH A;  3RIR A;  2F2E A;  4PCQ A;  3NQO A;  2HTJ A;  1W5T A;  4AIJ A;  4EJV A;  2G9W A;  4UV8 A;  4PZJ A;  3M1E A;  2ELH A;  3G73 A;  5BPD A;  1IN4 A;  5H6Q A;  4XRF A;  4EJO A;  2FNP A;  3FWE A;  2CFX A;  1UFM A;  3BZ6 A;  3WGG A;  4MEX F;  5HDK A;  1D5V A;  4ASN A;  1FOK A;  1FLI A;  1FBQ A;  3WE3 A;  1NHA A;  1MDM B;  3WTW C;  4YFX F;  1FYM A;  3TDU C;  1YIO A;  1DP7 P;  3HSR A;  2EK5 A;  5HOO A;  5E1Z B;  2MBF A;  2ISZ A;  5KVR A;  2YR2 A;  3F23 A;  3HRM A;  1YLF A;  4A0X A;  1FYK A;  2RN7 A;  4EV0 A;  2Z33 A;  1TQP A;  5CVI A;  2KKO A;  3HSE A;  3MQ0 A;  3CO7 C;  3GXO A;  4BXU A;  2LF7 A;  3RYP A;  2H94 A;  2WTE A;  5HS7 A;  2R3S A;  1J9I A;  2HYF A;  2PG4 A;  2EFW A;  3CO6 C;  1K6O A;  3TOB A;  3VOD A;  3V7S A;  4ZZL A;  2CSO A;  4UHT A;  3FXU A;  2XAF A;  3SHF A;  1B6A A;  4ENN A;  2EFN A;  4NB5 A;  3CUQ C;  2STW A;  4XLN F;  1USS A;  1JXS A;  4G6D A;  4RB2 C;  4MQ9 F;  4WXD A;  5LGN A;  2VBW A;  3ZMS A;  4ENK A;  1XCB A;  3WTZ A;  4B09 A;  4IXA A;  4UVC A;  1K78 A;  3MFK A;  2QLZ A;  5FD6 A;  4KDP A;  3R0J A;  3BPV A;  2TDX A;  3N4M A;  4I7H A;  1MGT A;  2Z5U A;  3KFW X;  3EUH A;  1ZHF A;  3WTV C;  2QEN A;  1Z91 A;  5HDN A;  2P5V A;  4RB0 A;  5F6F A;  2VE8 A;  1W7P A;  1HQC A;  4P9U A;  1KU7 A;  4GGG A;  5DUI A;  2BEO A;  1OR7 A;  2R7D A;  3T8R A;  3COA C;  3JW4 A;  2XHK A;  5ED4 A;  1IRF A;  3KCC A;  5JR3 A;  1LNW A;  3I0T A;  4KNY A;  1KQ0 A;  4R79 A;  2XKP A;  1LEB A;  3DXJ F;  4Q47 A;  1SMT A;  4L0Y B;  2V1X A;  2Y75 A;  3IWZ A;  5D5U B;  2AXL A;  1K78 B;  2OQG A;  1Q1H A;  2OZU A;  3C7J A;  3JAM K;  2V1U A;  2EFO A;  3F3X A;  1LVA A;  1ZRF A;  4M9Z A;  5H20 A;  2K4B A;  4L9T A;  3LAJ A;  4BNC A;  3IL2 A;  3RJP A;  1WRJ A;  3R0A A;  3TGN A;  4IHT A;  2GIV A;  2ZJ2 A;  1CGP A;  4G7H F;  1MJA A;  1S6L A;  3GW2 A;  3K1M A;  2CW0 F;  1STZ A;  4L0Z B;  2A6H F;  3D5L A;  3T1B A;  4CIC A;  1L3L A;  2DFI A;  1W7P B;  4DNC A;  4OU0 A;  2XGX A;  5E20 A;  5A2Q K;  4OMY A;  3LA2 A;  3QU3 A;  4P5O A;  1PDN C;  5TJJ A;  4GO1 A;  2ETH A;  3JAM Z;  4RB1 A;  3WGH A;  3I59 A;  1SAX A;  5L3G A;  1ZRE A;  1TQI A;  4A6E A;  1I1G A;  5K1Y A;  4LMY A;  2HQR A;  3H3U A;  1GVJ A;  3J81 Z;  3SZT A;  1BOA A;  3RPU A;  4UXN A;  4ZH4 F;  5ERI A;  5EEH A;  2ACJ A;  5ILS A;  2BE5 F;  3BRO A;  3ECO A;  2EV6 A;  3RKY A;  1U5T C;  3ZP5 A;  4KFC A;  3HSF A;  2EFP A;  2K4J A;  5A2Q Z;  4K2E A;  4MTE A;  3C1D A;  4GXO A;  2XUB A;  5E8G A;  5D8L B;  1JE8 A;  2DAO A;  1W4M A;  1MD0 A;  2YU3 A;  1AWC A;  3KP7 A;  1EH6 A;  2FNA A;  3DV8 A;  3T5X A;  1MZB A;  2FQ3 A;  2K7L A;  2P6S A;  3BDD A;  3H92 A;  5FD5 A;  2LF8 A;  2E1C A;  1KQ9 A;  3OV8 A;  1B9M A;  1OKR A;  1XSD A;  4I0A A;  5IT9 K;  2QQ9 A;  1Z6R A;  1IN6 A;  4LGW A;  2FE3 A;  2MC3 A;  4S04 A;  2DPD A;  1RUN A;  3MWM A;  2UXN A;  3DEU A;  1QNT A;  2D1H A;  3K69 A;  4L5J A;  2NAZ A;  5LHH A;  1XD7 A;  4IRH A;  1SFX A;  1V4R A;  2L3D A;  4CHU A;  1P2F A;  4N9I A;  4CYD A;  3EYY A;  3NRV A;  1GXP A;  4MTD A;  4QLC U;  2Q0O A;  2BGC A;  2VOP A;  4ESF A;  2OBP A;  2ZKZ A;  1F5T A;  3HIF A;  3GVA A;  3ZMZ A;  3VB2 A;  3BJ6 A;  2O61 A;  2R7F A;  3QPH A;  4HDV A;  1G4D A;  3GFJ A;  4HZF A;  4U0V A;  2W25 A;  3WTX C;  5LRS A;  2FSW A;  2B0L A;  4AD9 A;  2C6Y A;  3K9T A;  4R8H A;  1U8R A;  2IP2 A;  1P4X A;  1FZP B;  2F5F A;  1BIA A;  4EGZ A;  2DLL A;  1R1T A;  3ECH A;  3RTR A;  3O6B B;  4EJT A;  2W85 A;  1T0F A;  2IVM A;  5F64 A;  3BJO A;  2O8X A;  1YFH A;  1XB4 A;  1HSJ A;  3IC7 A;  2FU4 A;  3L00 A;  1UST A;  1U78 A;  1KU3 A;  3R60 A;  3I54 A;  4A2U A;  3GO5 A;  3E6C C;  1KYZ A;  2XAH A;  1H9T A;  1HW2 A;  2F5C A;  1BI2 A;  4HA8 A;  4D0P A;  2F5E A;  5J8F A;  4YFN F;  4OOI A;  3WTT C;  4EVI A;  2EFQ A;  4ENM A;  4OIO F;  2P4W A;  3SQN A;  4R1H A;  1ZAO A;  3J80 K;  3MAJ A;  4BQA A;  1MJ9 A;  1D8J A;  3QP5 A;  3B73 A;  5K5R A;  2XAG A;  3E5Q A;  2ADU A;  1QBJ A;  3HYI A;  2PFB A;  3ZMT A;  2DW4 A;  1DDN A;  3DPT A;  4HLY A; 
#chains in the Genus database with same CATH topology
 3V7R A;  4HBL A;  3QU6 A;  2HQN A;  1FEX A;  3ZMD A;  5EEA A;  3MMY B;  3BG5 A;  3BOQ A;  3CP2 A;  4BDZ A;  3HPH A;  2FX0 A;  5ICE A;  3K6G A;  3KPH A;  2WY7 Q;  1MDM A;  3P7N A;  4BJT A;  3SJM A;  1ONV A;  2Q2E B;  3DTK A;  3LOC A;  3GUD A;  3LFK A;  2KJC A;  5JLW A;  3RKX A;  3GZ5 A;  3DLA A;  2HEO A;  2A61 A;  4OIN F;  1APL C;  1SMY F;  1EH8 A;  2NS8 A;  1F1Z A;  4UNO A;  3VEP A;  1W1W E;  3J80 Z;  3S8P A;  4E7K A;  2EZL A;  3SEZ A;  3ZCO A;  3OL3 A;  3KYC B;  3GLX A;  1HLV A;  4FX0 A;  1XC5 A;  3RI4 A;  1UHS A;  2LR8 A;  2XB5 A;  3BPX A;  3OYE A;  2QA4 I;  2R7S A;  1ZG5 A;  2VXZ A;  2YUS A;  4KMU X;  1LEA A;  2RNG A;  2R7Q A;  4ANJ A;  5E1W A;  5H6R A;  4GYG A;  5CQG A;  4WX9 A;  1BOB A;  1MBH A;  2Z16 A;  2P81 A;  4G7Z F;  2AO9 A;  4XID A;  4J19 A;  2IS2 A;  2VBZ A;  1GLN A;  2BW3 B;  3PUB A;  1TQM A;  2VE9 A;  2GM4 A;  5C3E J;  1IZ1 A;  1YRN A;  1ORK A;  3BCB A;  2RDP A;  1HKQ A;  2OF7 A;  1GXQ A;  4RB3 C;  2K9Q A;  2IT0 A;  1OLT A;  2X6Y A;  2QF7 A;  3GTM J;  1EKE A;  3K2Z A;  2XAU A;  3O8H A;  4FT8 A;  5HS9 A;  3MZY A;  5LRR A;  1A6Q A;  2R5Z B;  4B48 A;  1MJB A;  2LK2 A;  4Y13 A;  2ISY A;  2OZ6 A;  1IDY A;  5TIS C;  2JA6 J;  5EGO A;  4LG3 A;  4O6J A;  5B3S H;  1JI8 A;  1IAW A;  4LK1 F;  5D4S A;  5CVR A;  3H35 A;  1RUO A;  3I4P A;  1Z9C A;  1IN7 A;  2D1V A;  3LQR A;  1ETX A;  2RVC A;  1G59 A;  3KET A;  1RR8 C;  3HRS A;  3K4M A;  4PGH A;  4BHB A;  4QTR A;  3W6V A;  1BI1 A;  2K86 A;  4HLX A;  2B63 J;  2FBH A;  4A3F J;  1LPQ A;  4B47 A;  2IA1 A;  4Y15 A;  4A12 A;  2X85 A;  4BUP A;  3QOP A;  1HW1 A;  2QM3 A;  1GVD A;  1IXC A;  2MLK A;  1DQU A;  2IBD A;  3OSG A;  3F8B A;  4G9Y A;  2DYR H;  3LMM A;  2OU2 A;  4PUS A;  1E2X A;  4CCL A;  1BJA A;  3FBN B;  1SAN A;  3BTC A;  2OD5 A;  2E35 A;  4Y52 J;  3GTO J;  4Y3O A;  2UUZ A;  2WC2 A;  2XB0 X;  4HX8 A;  5BS6 A;  2IPQ X;  4EJW A;  5K7Z A;  1H89 C;  4BEH A;  5E3O A;  3LAP A;  2LY2 A;  3DQV C;  3E5U A;  5ICG A;  4PJM A;  2PJP A;  3PFY A;  1AA7 A;  1N25 A;  2DI3 A;  4DIQ A;  1IGN A;  4KYW A;  1MMS A;  1QHH D;  2WV1 A;  4M3D A;  3ZN1 A;  4E7S A;  2IAI A;  1NG7 A;  4Q5S F;  2PMZ A;  5K5O A;  3SEQ A;  1R49 A;  3A0H C;  1KGS A;  5M5W J;  1V5E A;  1YS7 A;  1HCR A;  2ME0 A;  4DW6 A;  3F8F A;  1V3F A;  2KL4 A;  4MQV A;  3ERE D;  2CGP A;  5EGO B;  4YFK F;  2EA4 A;  3D5S C;  1TWF J;  2HU9 A;  2PX9 A;  4YRV A;  1S72 I;  3A02 A;  2MYS A;  5K7H A;  1Z3X A;  3CJN A;  4FIS A;  1JUP A;  2PMH A;  3IAS 2;  3L9F A;  3BC8 A;  3HOY J;  1B59 A;  3BTI A;  2CV0 A;  1GUU A;  1FBU A;  1R23 A;  2WAD A;  2XDV A;  3F6O A;  4E4H A;  1VQL I;  2L2O A;  1E0E A;  2GWR A;  2K9L A;  4U7B A;  2EA2 A;  2M4G A;  2XIG A;  4CYC A;  3SFZ A;  5HDG A;  1AHD P;  2XAS A;  1XCV A;  3ROU A;  5EDN A;  3CDL A;  4S05 A;  1OJL A;  4AIK A;  1YS6 A;  1WJ5 A;  1XDU A;  4U0W A;  2XSD C;  3IRQ A;  4LB6 B;  1LDK B;  2JUC A;  1WGX A;  3CUQ A;  4EJU A;  3H0D A;  4UV9 A;  1K4S A;  4RAZ A;  5B66 C;  4KUM A;  3VFZ A;  1W5C C;  1J75 A;  4WXH A;  1IW7 F;  4BKX A;  1AU7 A;  4L9N A;  4W1U A;  3FZV A;  1L0O C;  2UV1 A;  1ACI A;  4ZJZ A;  1WHU A;  3AG3 H;  3ZQF A;  1HF0 A;  4BEH B;  2VI6 A;  1I5Z A;  2F48 A;  1FBS A;  3J7Z I;  4A5N A;  4IJA A;  2NVU B;  2E1M C;  3KEQ A;  3FK6 A;  1HXD A;  1QZY A;  3HOT A;  2A68 F;  1Z1D A;  2HVR A;  2KZV A;  2JQ7 A;  1S3J A;  3FXQ A;  2CUZ A;  3DU5 A;  5GP9 A;  1V55 H;  5EJC A;  3ELK A;  1FJL A;  2P0W A;  3TO6 A;  1VI0 A;  2QZ8 A;  1JKQ C;  4XQF A;  4GYI A;  4P1W A;  2M5W A;  5CQE A;  3LSI A;  1QPM A;  2QBY A;  2NRA C;  4EQQ A;  2ZME C;  3R4K A;  3RQI A;  3EUK L;  2M9H A;  3HOZ J;  2V1D A;  1S7O A;  3OS1 A;  5D5W B;  4NC6 A;  3R6S A;  2HS5 A;  2DOF A;  2VUM J;  3C18 A;  1RNL A;  2X9D A;  1OR7 C;  3E97 A;  4RMN A;  4F92 B;  5GPC A;  1BJZ A;  1LE8 A;  3A01 A;  3BLY A;  3T0Y A;  4IX7 A;  1YJ9 I;  5J6X A;  5ILU A;  1WJF A;  2OTL I;  1G3T A;  1ZN2 A;  4XBF A;  3MKL A;  2O0Y A;  2WAQ N;  1ZG3 A;  1Y0N A;  2LD5 A;  3PFI A;  2NS0 A;  4I2O A;  4HX4 A;  2OC6 A;  3C2B A;  3QPL A;  3BR3 A;  1SVO A;  3WGI A;  4BGD A;  4XRS A;  3CUQ B;  2H6B A;  4JQF A;  4EM1 A;  1NTC A;  2VKD A;  3JR9 A;  1IDZ A;  3OYH A;  3ZGK A;  1RKT A;  3HM5 A;  1OYY A;  1ZK8 A;  3TED A;  1HC8 A;  2L02 A;  3ZMV A;  4BYY A;  3S1R J;  2BBY A;  3PIO F;  4OIR F;  3I58 A;  3C3W A;  1ZGJ A;  4L18 B;  3J81 K;  2XF7 A;  3S93 A;  3AG4 H;  3M1C A;  1X58 A;  1T6S A;  2Q1Z B;  4IPA A;  2CQN A;  2KPM A;  3WTU C;  1G3S A;  2BYV E;  2N8G A;  3PSI A;  2YPR A;  3JTH A;  2EPF A;  3NEU A;  2K3P A;  2M7A A;  3GFL A;  1BN5 A;  1LFB A;  2MD0 A;  4D7N A;  5F0F A;  3MN2 A;  1BIB A;  2M30 A;  3HC7 A;  1ZG1 A;  3WTY C;  5HLT A;  1H0M A;  2DA3 A;  3W6J B;  3I53 A;  4RGX A;  1I50 J;  2QBY B;  1ETY A;  3RSN A;  2KP6 A;  1WJD A;  2EJR A;  2QYO A;  5CVJ A;  2VPL A;  4BHP A;  2NVX J;  2X4H A;  5F1R A;  5DCF A;  2V6C A;  2VN2 A;  2HPI A;  4U7D A;  2PN6 A;  5E3L A;  2IA0 A;  5B1B H;  2H1K A;  5C4J J;  5BMZ A;  3F72 A;  3EDP A;  2AS5 F;  3FDY A;  1I6H J;  1O3S A;  2F5D A;  4HF2 A;  1YG2 A;  1LE8 B;  4KIS A;  4CGZ A;  2KMU A;  3FIW A;  4HX7 A;  2GA1 A;  5FFX A;  2FXA A;  1KU9 A;  5IP9 J;  2RRE A;  4BJ5 C;  3TMO A;  2HGC A;  5FLX K;  2NNN A;  5DDG A;  2VOO A;  5FKM A;  2V79 A;  1XS9 A;  1U0J A;  3V8J A;  1XGO A;  3CLO A;  3TP3 A;  1FP1 D;  1KON A;  1J59 A;  1Z05 A;  3TOA A;  2R5Y B;  2M34 A;  2DFE A;  6PAX A;  3BG7 A;  2EZH A;  5ICF A;  3FHZ A;  4FCY A;  4XLA A;  1MMN A;  2BY2 A;  1I39 A;  5DD4 A;  1UG0 A;  1LDJ A;  2V4J C;  2E1N A;  4XRM A;  3GF2 A;  4QWQ A;  3GZ6 A;  2UWM A;  4XLH A;  1DP3 A;  1RZ4 A;  1O3T A;  4CSW A;  1MBJ A;  2W57 A;  1YYV A;  4QPO A;  1E3O C;  3JSO A;  4UUT A;  1OYW A;  5CKT A;  3CCR I;  2KDZ A;  4DYC A;  2DYS H;  3DCF A;  1WH5 A;  4XLE A;  4CH7 A;  3DLL F;  2IRF G;  2JVH A;  3FXL A;  1R1V A;  5JFR A;  3S1Q J;  2O3F A;  5DS9 A;  2DA7 A;  2ZSI B;  3LSK A;  2EIM H;  1Y39 A;  2Q8K A;  1X2N A;  4B1R A;  2LLK A;  2XKO A;  1B4A A;  1R7J A;  2LKP A;  5J1Y A;  4HF1 A;  4G7O F;  1U5T A;  5D4R A;  2IXS A;  4XSZ F;  2X1C A;  1SFU A;  3U2R A;  1ZKG A;  2K9M A;  3PNY A;  5BOX A;  3LSP A;  5FLX Z;  5DCM A;  1X4O A;  2DA5 A;  3A0B C;  3EQL F;  4EEF G;  5KHD A;  1R5G A;  1WCM J;  4I02 A;  3KX2 A;  2KJB A;  2IEK A;  1R71 A;  3DP7 A;  1OCT C;  1MMD A;  5CYV A;  2M8G X;  4A5M A;  4YEJ A;  4XKC A;  1SFK A;  3BR0 A;  1ETO A;  3FX3 A;  4GFB A;  4J00 A;  3JRG A;  5LGU A;  1U8B A;  2IGM A;  2IW5 A;  4IRG A;  1P4W A;  1XSV A;  2LY9 A;  1X3U A;  4AIH A;  1R22 A;  1HA8 A;  4HV6 A;  2I8D A;  1ZAR A;  2ZCW A;  3ULQ B;  3F22 A;  3FMS A;  4PJN A;  3HTS B;  3W6K B;  2GXB A;  2E5N A;  1O7F A;  1ZGA A;  3B02 A;  5LD2 C;  3IH3 A;  3MZH A;  2ZB9 A;  2CWE A;  1IN8 A;  5FFZ A;  3RYR A;  5GAG J;  1QGP A;  1KYW A;  2K85 A;  5D6E A;  3E0J B;  3LSH A;  4D5F A;  2PI0 A;  1J09 A;  3U1D A;  3JTG A;  1S7A A;  4MGR A;  4ENJ A;  3S16 J;  4XKW A;  5LLQ A;  3BQY A;  4UY8 I;  1TNT A;  1R58 A;  2RNJ A;  1LQ1 A;  5GPA A;  4KN7 X;  2FEZ A;  1IV8 A;  5IOY A;  3AAF A;  4A3K J;  3M7G A;  1YE9 A;  3UKG A;  1H8A C;  2NYX A;  1FYL A;  1K7A A;  1UMQ A;  3P9I A;  2GQQ A;  3PO3 J;  1RR7 A;  2LTP A;  3GLL A;  4RAF A;  5FLM J;  2DPU A;  2Z9O A;  5ICC A;  4LFU A;  5L3E A;  5CVU A;  3TKY A;  1J7K A;  1U5T B;  2CW8 A;  2A07 F;  4XOT A;  2NS7 A;  3FIS A;  2RGV A;  3M8J A;  3Q3S A;  1QQI A;  3H3Z A;  1FX7 A;  3IH4 A;  4O5V A;  2CH0 A;  3IHU A;  3L2W A;  4XSX F;  1RC9 A;  2BZT A;  3VYR B;  5AON A;  1QHG A;  2A5Y B;  5DCM B;  4Z2Y A;  2ECB A;  1KA8 A;  2PMZ N;  3BQZ A;  4BQO A;  3DPL C;  4RAY A;  1W5S A;  2P8T A;  3OSF A;  2VBX A;  3J7A Y;  2COM A;  1JGS A;  1R36 A;  4ZYE A;  3AL0 B;  5FKK A;  3ZPL A;  2DT7 B;  1IV6 A;  5E17 F;  2I5U A;  1U2W A;  1ETQ A;  5BPI A;  1A6I A;  1P7J A;  4NHJ A;  3PIP F;  4LJZ F;  3TQN A;  3Q9V A;  1MH3 A;  1A04 A;  2VIX A;  4XNF A;  3JRE A;  3BWG A;  1REP C;  4HQM A;  1AOY A;  1WWX A;  4M74 A;  3V8K A;  1F4K A;  4RGS A;  4JK1 X;  3E3V A;  1SD5 A;  3HOU J;  2HOA A;  5LEK A;  3AKZ A;  1BI0 A;  3HHG A;  3P9C A;  1VTN C;  1DPR A;  3S2H J;  3HHH A;  3K1P A;  2M7B A;  2MFZ A;  2DK5 A;  4FX4 A;  2X51 A;  2VKV A;  5EZH A;  3FXO A;  3D1N I;  4G6Q A;  2DK8 A;  3ZXS A;  2KLO A;  3QP6 A;  1JGG A;  3CCY A;  4L5I A;  2CFO A;  1BM9 A;  1SD6 A;  4M72 A;  4UVA A;  4A93 J;  2ZXH A;  1T0F C;  2DU9 A;  1Y8R B;  3CP8 A;  2H09 A;  3KE2 A;  4ON0 A;  5F27 A;  2OQR A;  4JOM A;  4IQJ A;  2OCE A;  3QOD A;  2RQQ A;  4I01 A;  5L3F A;  4XON A;  1EV7 A;  4N9H A;  3K7A J;  5J3L A;  1TWA J;  1G6N A;  2MGQ A;  5D8K B;  2DTZ A;  1R4N B;  1OCO H;  4NNJ A;  1TZL A;  2STT A;  2ESH A;  2WB1 A;  1VQO I;  4I6Z A;  2Q2E A;  1R6R A;  1IXR C;  1WPK A;  3Q9S A;  1YJN I;  4TV7 A;  4IVN A;  5AIQ A;  1XMK A;  2G7U A;  2ECC A;  3LSM A;  3S17 J;  2WWY A;  2X48 A;  4LG0 B;  2E7X A;  3SZP A;  3SXY A;  1QA6 A;  2PBI A;  5KAI C;  1SD7 A;  3HTU A;  3VDX A;  3WE2 A;  2CQQ A;  1XTA A;  4KN4 X;  4A6D A;  2NNY A;  3Q0U A;  2ZBK A;  1TW3 A;  2LNB A;  2WBM A;  1G3W A;  1I6X A;  4IF4 A;  4U88 A;  5KK1 A;  4BJ6 C;  2PEX A;  2RQP A;  5L3C A;  1TWG J;  4OIP F;  3OYN A;  4Q4Z F;  1IUY A;  2BVM A;  3OYF A;  1N77 A;  3HOX J;  2XGE A;  2LFB A;  3BP8 A;  4BE0 A;  1FPQ A;  4UB8 C;  2XVC A;  1VQ5 I;  1KU2 A;  2VQL A;  1HKS A;  1HDD C;  4N0B A;  4J01 A;  2XRO A;  5FRO A;  2GZW A;  1VND A;  2UXX A;  1ZGW A;  1FMV A;  2CG4 A;  3CDI A;  2R5Z A;  1X3Z B;  3ISP A;  4XLF A;  3PJR A;  1FNN A;  3W2V A;  1X1P A;  4P96 A;  4RGU A;  2JZY A;  2RC4 A;  5KCM A;  2V7F A;  3HB9 A;  4BE1 A;  1HOM A;  3VSL A;  2F4I A;  3HGG A;  1VF9 A;  2DBB A;  2ZXI A;  2L9R A;  5FB2 A;  3E5X A;  3MKZ A;  1GV5 A;  5HOD A;  3FM5 A;  2JT1 A;  4IOC F;  1UHW A;  2MA3 A;  2OV7 A;  3H9G A;  3ABK H;  1YW8 A;  1Y0U A;  1P92 A;  5LFA A;  2EZK A;  4P9F A;  2QVO A;  3LL7 A;  3QYB A;  1OYI A;  1X2M A;  3RKW A;  2D2W A;  2HOE A;  2HR3 A;  4AVZ A;  4UUV A;  4KT5 C;  4PJ0 C;  3M8E A;  1OMI A;  3VYS B;  4X0G A;  2CV1 A;  2L7F P;  4FE4 A;  2QWW A;  4CCK A;  1K61 A;  3GYH X;  2PJR B;  2FUG 2;  4PDK A;  4BL0 B;  2IJL A;  3H1C A;  2V9P A;  3SDG A;  1YI2 I;  2DT5 A;  1XG1 A;  4DZJ A;  4E7J A;  4IHY A;  2ZNY A;  2YU9 J;  3N97 A;  3CMM A;  3S1M J;  1F9N A;  5IYB J;  2OA4 A;  4U0Y A;  2O6G E;  2R7Z J;  1BW6 A;  1WJC A;  1OQY A;  1B72 B;  3T8T A;  1ERD A;  2LBF B;  4DYR A;  1SFE A;  3K10 A;  3U9G A;  1YIT I;  3V42 A;  4FHT A;  3TBI A;  5L3B A;  3GX4 X;  3PSF A;  4ZDP A;  4YIF A;  1ZRD A;  2J5P A;  2DJN A;  4NQW A;  4WF2 A;  4JX4 A;  2L01 A;  1MH4 A;  2CRG A;  4A3G J;  2X6W A;  2JUG A;  2JVG A;  2VJJ A;  2QUF A;  3ML6 A;  2R0Q C;  4QPQ A;  1XGN A;  2H6C A;  3S2D J;  3REO A;  4NUB A;  3L09 A;  5E3M A;  1VQK I;  2LYC A;  1RET A;  3PNT A;  3FXM A;  3AG1 H;  4YG2 F;  4LB5 A;  1KQ8 A;  3WU0 A;  4D7M A;  5JI6 A;  2F4O B;  4A3M J;  1WH7 A;  1R00 A;  2VT3 A;  1ETW A;  5K7F A;  4CCM A;  2FBI A;  3FKI J;  3RDI A;  1BC7 C;  2QSH X;  4HV5 A;  2BXZ A;  1P9Q C;  2DO7 A;  1TTY A;  4E7Z A;  2VXD A;  5IP6 A;  2DMT A;  1MBF A;  3FF5 A;  3L2C A;  5HVQ C;  1R9T J;  3HEF A;  2EIJ H;  5IPA A;  1K6Y A;  1NK3 P;  1JHF A;  4EMS A;  1PP8 F;  3RPQ A;  3ABU A;  4LLL A;  1QZZ A;  1XGS A;  4LLN A;  3F0C A;  4ETS A;  2R7V A;  5D5V B;  2DA6 A;  1OCC H;  2W24 A;  2HDW A;  3CTA A;  3FKJ A;  4Q48 A;  4OWR B;  4X1E A;  4XLP F;  4RGR A;  3JRC A;  5M3M J;  2ID6 A;  3D5R C;  2QEX I;  4JBA A;  3WHB A;  3QPT A;  4WCG A;  2DQR A;  4E6K G;  2CYY A;  4M9S A;  1FSH A;  3FM3 A;  3S32 A;  2L7M P;  1CF7 A;  2HDC A;  1DPU A;  1SAU A;  4X6A J;  4DQ2 A;  2D5V A;  4L9J A;  4Z6Y A;  4BBS J;  4KJZ A;  2WV0 A;  3LSJ A;  2FJ1 A;  2GIZ A;  4MLO A;  2MH2 A;  2LMD A;  2QKM B;  1JKO C;  1SVL A;  4NQW B;  2VKH A;  4P55 A;  4CCO A;  3FBI B;  5IYD J;  3KP6 A;  2ZO4 A;  3O2P E;  3TL4 X;  4KIG A;  2LSO A;  3L1P A;  1ZRC A;  3PQK A;  3SDB A;  3GWZ A;  1XDS A;  3VWB A;  2KIM A;  3WOD F;  4B3A A;  2F4M B;  2HFH A;  4RDU A;  3EET A;  1YO5 C;  3BCA A;  3I64 A;  3IP4 B;  3DBH B;  1UEL B;  1YQA A;  4XR6 A;  2E2J J;  4LK0 F;  3OYI A;  5EF6 A;  2NXN B;  2EWN A;  2R7W A;  2EIL H;  1IJW C;  3HGY A;  4E70 A;  4Y7N J;  2JA8 J;  1Q1V A;  1FTZ A;  2HKX A;  4H0E A;  4RA2 A;  5DD8 A;  4AVP A;  3GTL J;  3IWF A;  1D3Y A;  1GDT A;  1TNS A;  3E7L A;  3TO7 A;  4LIU A;  1Z7U A;  1W36 C;  2JMW A;  1LKX A;  1QVU A;  3J7Y J;  3J7A O;  2QQ8 A;  4A3B J;  1U6G A;  2OAZ A;  3G1L A;  4AC0 A;  3HOS A;  2A69 F;  1FWZ A;  3I5U A;  3DEW A;  2RAE A;  2CS3 A;  4I98 B;  2DN0 A;  5DUK A;  4CA0 A;  3NAR A;  5FGM A;  3HOV J;  1XMX A;  4CXF A;  5E18 F;  4WK8 F;  3KIO A;  1N75 A;  3WHC A;  3H0G J;  3CCE I;  1CF7 B;  2R7R A;  2XC7 A;  3KZZ A;  1KZH A;  2Z3Y A;  2E34 A;  5IYC J;  1C0W A;  3L2U A;  1SFO J;  2VOD A;  5F04 A;  3A1Y A;  2R4G A;  2QCO A;  3HUG A;  3CC4 I;  1T98 A;  2AQF A;  1ZLK A;  3L7W A;  5JVT A;  2PQ8 A;  3CUO A;  1J0R A;  1JJ6 C;  1PUF B;  3GZN B;  2CQK A;  3GTQ J;  2XV4 S;  3DPU A;  3EUH C;  4DOZ A;  2K9N A;  2DFH A;  1HBX G;  3MKY B;  3QYE A;  1UCR A;  1ZH5 A;  4PGG A;  4FET A;  5H2F C;  4HSR A;  3HBL A;  2DQL A;  1QRY A;  4QSH A;  2V6E A;  1HKT A;  4HNV A;  2M8E A;  2ZJQ F;  3IKV A;  5BNG A;  3NWS A;  2QSG X;  2ZJR F;  3AG2 H;  1QVT A;  2VQC A;  4RLQ A;  1FMW A;  1QZE A;  1JTX A;  3RKQ A;  3K70 C;  1T2K A;  3M8F A;  2A6E F;  2ZME A;  1O57 A;  2OCC H;  2ZFW A;  2VPR A;  3IV5 A;  3F9K A;  4RM2 A;  2FBK A;  5E8I A;  2V26 A;  5D6F A;  3ZQQ A;  1O4X A;  3FXR A;  1ZR2 A;  1RIO H;  2L4M A;  4EM2 A;  3AFH A;  3I3L A;  5DEQ A;  1EF4 A;  1D8K A;  2R5Y A;  2O9L A;  1A36 A;  5E1X A;  3CME I;  1FIA A;  2VJ4 A;  5K5Q A;  1FY7 A;  1JTY A;  1OFC X;  3CDH A;  1WVR A;  2JA2 A;  2MH9 A;  2KDO A;  4BH9 A;  3OYB A;  1GT0 C;  2WB1 N;  2KIF A;  1ZEL A;  2XAJ A;  1TWC J;  2GBY A;  3QQA A;  3ZN0 A;  1JHH A;  4I76 A;  2HTS A;  1UAA A;  3K0L A;  4HYE A;  1SD4 A;  2GXA A;  4O3M A;  2R7U A;  4F7Z A;  3ZQ7 A;  2LKX A;  4RM3 A;  4ZYH A;  3HUG B;  3HKZ A;  2KIQ A;  1FP2 A;  2NOG A;  2FF4 A;  2MLG A;  1TBX A;  3KP3 A;  3CJR B;  3P5J A;  3EYI A;  3TDZ C;  3WU1 B;  3I9V 2;  2E7W A;  4XM3 A;  4A3J J;  4WWC A;  1JT0 A;  2E1M B;  2EQR A;  3ASO H;  3IAM 2;  2Z99 A;  1R4M B;  1WQ2 A;  3TO9 A;  5GAD J;  2RV8 A;  3I71 A;  1BBY A;  5LGT A;  2M45 A;  1LB2 A;  2K40 A;  4MHG A;  2BXY A;  4MFD A;  1JJ8 C;  3P9K A;  2DXI A;  3LST A;  5J4Y A;  3G3Z A;  4AWX B;  2TRT A;  2L54 A;  2QQA A;  3KEY A;  4HDU A;  3UNG C;  1G3Y A;  1DUX C;  1H88 C;  2ZME B;  1EH7 A;  2DMN A;  3IKT A;  1POG A;  5M3F J;  3DBR B;  1K79 A;  2XSJ C;  4F93 B;  5J4V A;  2P5L C;  1R1U A;  3ABT A;  5DV5 A;  2EV0 A;  1MMA A;  3FMQ A;  4I09 A;  2VKE A;  3WTS C;  2DJI A;  4M6X A;  4ITV A;  4OAY A;  3NWT A;  5CJ9 A;  4ZYG A;  3I4N J;  2MD5 A;  4A3E J;  3LQQ A;  3G6E I;  3GFI A;  4MEY F;  2HZT A;  2HZD A;  3H3V K;  2KIU A;  4BY7 J;  2EIK H;  2W82 A;  2O03 A;  3NAU A;  2JRT A;  3KP5 A;  4BHC A;  2VC1 A;  1I1S A;  2EB7 A;  2Y0M A;  3BTL A;  3CCV I;  1T38 A;  5IT3 A;  4A0Z A;  1X1D A;  4OIQ F;  4KA4 A;  3CMY A;  2TCT A;  3V7C A;  4ESJ A;  4ZYA A;  1HST A;  1HW5 A;  2VT2 A;  2DTR A;  3FMR A;  1JKR C;  4MIM A;  2G7H A;  2Z1D A;  1V5F A;  2UZK A;  3GFM A;  2HKO A;  3MEX A;  4ABZ A;  4HST A;  4GCV A;  4B43 A;  3V8L A;  5EYR A;  2X0L A;  2XRN A;  1ZLJ A;  3S3N A;  2W1O A;  2F5V A;  4EM0 B;  2YSR A;  2PLY A;  5LHG A;  2CQX A;  5IY5 H;  1VQM I;  3OR1 C;  5KNL A;  4YIR X;  3DWL E;  1BA5 A;  5FRM A;  1QO0 D;  3M9A A;  3OYA A;  4F91 B;  1I27 A;  2K27 A;  3ZQH A;  4BAY A;  1TL8 A;  4HQE A;  2KT0 A;  3U1K A;  4BAC A;  1M1E B;  4L9V A;  4CUG A;  2VBY A;  1JKP C;  4OAZ A;  3AL0 C;  4XMY A;  1IXS B;  2XRL A;  4KMF A;  4Y4R A;  1ON1 A;  2DDB A;  1FSE A;  4BQN A;  1ULY A;  1IG7 A;  4C3I J;  1E3P A;  5FKL A;  2KRC A;  3K4K A;  4RAG A;  4M3B A;  2P6T A;  2FML A;  2A3S A;  4CO8 A;  1F36 A;  1E17 A;  1B8I B;  2XAQ A;  2ID3 A;  3JSP A;  2MC4 A;  1Z3Y A;  4II3 A;  3E6D A;  3DEE A;  2XGC A;  4M6Y A;  3DF8 A;  4XKV A;  1XN7 A;  4ZZD A;  1WFX A;  3QAH A;  2LY1 A;  5ILV A;  2D45 A;  2HOT A;  4KIF A;  2L4A A;  3I59 B;  5TRD A;  4C30 A;  1TT0 A;  1EA3 A;  1FT9 A;  2XPV A;  3PNV A;  2YX4 A;  5AIP A;  5EEG A;  3VYU B;  4CDG A;  5FO5 A;  3Q5F A;  1BC8 C;  3DFG A;  3OIO A;  2DMQ A;  5JHF A;  4M71 A;  1TT5 B;  5DYM A;  4A3L J;  4HOB A;  2GAU A;  4B4C A;  3JRA A;  4PFO A;  4B8X A;  4UUS A;  1ENH A;  3G1M A;  2WAE A;  5GTH C;  2FOK A;  4M73 A;  1FC3 A;  4Y17 A;  1RRJ A;  2ZNZ A;  1B1B A;  4IL6 C;  1ETK A;  2Y69 H;  5CLS A;  5HS8 A;  3LWF A;  4OMZ A;  4XKB A;  2JTV A;  4HNT A;  2K02 A;  3E6B A;  1DGR M;  2HWV A;  3QYF A;  5CVV A;  1VQ6 I;  1D0X A;  1O3R A;  2FA5 A;  4LIT A;  4LG0 A;  2O5R A;  3OYK A;  1IUF A;  2BHZ A;  2FRH A;  2YX7 A;  3SZG A;  3OYL A;  3DKY A;  3K4C A;  4EGY A;  5HLH A;  1LUJ B;  1S5L C;  1P4A A;  1TLH B;  1Y56 A;  1P6R A;  1WJA A;  4LLG F;  1X1B A;  3JRB A;  1PP7 U;  3HRU A;  3KP2 A;  3G4S I;  5HNF A;  4HW0 A;  2VON A;  1IRX A;  2X1D A;  4ZTJ A;  3V4G A;  2E19 A;  2LDU A;  2JPB A;  2M2E A;  1ZYR F;  3MCZ A;  1XGM A;  4II2 A;  1VQ8 I;  4DBQ A;  3E1S A;  4UVB A;  2JK3 A;  5LHI A;  3BJA A;  3C2H A;  4G94 A;  3S2W A;  2J5O A;  3QRF F;  1S29 A;  2B9S A;  5IT9 Z;  3BZC A;  3BTJ A;  2JWT A;  4AM3 A;  4KIC A;  2XPU A;  1U3E M;  1BR2 A;  3OOP A;  2DA1 A;  4HAM A;  1YW9 A;  2V9V A;  1IF1 A;  3LA3 A;  2VJ5 A;  2OPT A;  1UHM A;  1T39 A;  1XSX A;  5C44 J;  1SC7 A;  3D0S A;  3GEZ A;  4A0Y A;  3ASN H;  5J1U A;  4CZZ A;  2DCE A;  2XF6 A;  2E36 A;  2MW8 A;  3GTJ J;  4UUS B;  2K5C A;  2LOO A;  3OWT A;  5J40 A;  4C9Y A;  1LDD A;  1Z67 A;  4BBR J;  1J2X A;  2EH3 A;  3KP4 A;  3U21 A;  4FE7 A;  1VFC A;  2ZFU A;  3KLN A;  3WG9 A;  1ON2 A;  4NC8 A;  3PM1 A;  9ANT A;  1YTY A;  2G0E A;  3CJQ B;  4H4K C;  5D5X B;  1B9N A;  4HF0 A;  3OOU A;  5BQT A;  1BR4 A;  2GA2 A;  2M1B A;  3I56 I;  1IC8 A;  2PJR A;  3O8G A;  1U9N A;  3HRT A;  4MNU A;  3DTI A;  2ELK A;  2E1O A;  1OCR H;  1NK2 P;  1R5I D;  2HYG D;  4LD5 A;  4IRI A;  4YII A;  5F08 A;  1ODD A;  1WKM A;  1D0Y A;  1YX5 A;  4A3I J;  4KIB A;  2CU7 A;  2X1E A;  3H9Q A;  2QQB A;  3ABM H;  1R5H A;  1H9G A;  3KZY A;  1QPI A;  2PMU A;  3CCQ I;  2H27 A;  1PUE E;  1B72 A;  3IUO A;  1G8X A;  2IGN A;  2LBF A;  3L2R A;  2P7V B;  2BHY A;  4WXC A;  4D1Q A;  4L5E A;  2V1N A;  4ESB A;  5HLG A;  1P7I A;  4M3E A;  4MO7 A;  2KRH A;  2FMY A;  2HQ5 A;  3G71 I;  1IN5 A;  2I10 A;  3KLO A;  1S8N A;  3L2V A;  2JA5 J;  1UB9 A;  2ZXJ A;  1O7L A;  4MFE A;  1O3Q A;  3O3K A;  3KEO A;  1Z6T A;  4IZZ A;  2X6O A;  2Y48 A;  4PJL A;  3DBL B;  2R93 J;  4XN3 A;  4ZC3 A;  1OPC A;  3F8N A;  3EUA A;  1BI3 A;  3Q0V A;  5EZG A;  3ZMU A;  2HXI A;  2EV5 A;  3F21 A;  1GHC A;  2L9V A;  3CCM I;  2DA4 A;  3F8C A;  3VOE A;  1W36 D;  4RS8 A;  3G2B A;  2DMU A;  3ESW B;  2H8R A;  5J8C A;  5F1J A;  1LJ9 A;  5LEJ A;  1Z7L A;  1J5Y A;  3K2A A;  5FJ8 J;  1E3H A;  4ZDO A;  1ZR4 A;  2CW7 A;  3M07 A;  5JHU A;  4ZDL A;  2GXG A;  2P5K A;  1YW7 A;  2VC0 A;  3QWL A;  3S15 J;  3R61 A;  2JSC A;  5HLI A;  2JA7 J;  4I0B A;  3HKZ N;  1MKM A;  3F8M A;  3IRR A;  2W84 A;  4BY1 J;  1K83 J;  2KRF A;  2WY8 Q;  4Y33 A;  2CO5 A;  4AYB A;  5B5E C;  5L3D A;  4B3X A;  4GRI A;  2JPC A;  3W2A A;  1X3W B;  3H9J A;  3BY6 A;  4HG2 A;  4IKF A;  2IA2 A;  2BV6 A;  4JYK A;  1RI7 A;  2ESN A;  3PQJ A;  5LBQ A;  4F55 A;  3K1N A;  1WSU A;  2CQ7 A;  1WI9 A;  2JRM A;  3S14 J;  2HI3 A;  3ZR8 X;  2IGO A;  3E6M A;  2ELJ A;  5IP7 J;  4IHS A;  1IRG A;  3F6V A;  3DKW A;  4XLC A;  1ETV A;  3OYG A;  1T56 A;  1YOV B;  4A69 C;  4ZYD A;  1VQ7 I;  2P7C B;  2Y31 A;  3S1N J;  4G8X A;  3W3C A;  2FQ4 A;  1XMA A;  4NC7 A;  4M9X A;  3ZQG A;  3LA7 A;  2Y9Y A;  4KT6 A;  1D5Y A;  1T08 B;  1TW2 A;  3BT9 A;  3CC7 I;  1W7P D;  2RKH A;  3RIR A;  3KZI C;  2Y2Z A;  2F2E A;  4PCQ A;  3NQO A;  2OJE D;  3VYT B;  1Z21 A;  2HTJ A;  2QGU A;  1W5T A;  5JVG F;  4AIJ A;  1TC3 C;  3BG9 A;  3ZRG A;  3W2W A;  2G9W A;  4EJV A;  4UV8 A;  3ZQI A;  3OY9 A;  3K70 D;  1VQ4 I;  4IHV A;  4PZJ A;  1V5G A;  3M1E A;  2W4S A;  3RQ4 A;  3JRD A;  2ZSH B;  2ELH A;  1YX3 A;  3G73 A;  4C3H J;  5BPD A;  1IN4 A;  3RCO A;  5H6Q A;  2LVS A;  4XRF A;  4C2T A;  1DGW Y;  2KFD A;  4EJO A;  3ERM A;  2FNP A;  3FWE A;  2CFX A;  1UFM A;  3BZ6 A;  3WGG A;  1RES A;  4MEX F;  5HDK A;  4N4O B;  2BVL A;  1D5V A;  4ASN A;  1F43 A;  1FOK A;  1FLI A;  1FBQ A;  4AUX A;  3WE3 A;  1NHA A;  1D1A A;  1MDM B;  1X1A A;  3WTW C;  2CUE A;  1DU6 A;  1I3Q J;  4YFX F;  5DM6 F;  1FYM A;  1LFP A;  3TDU C;  1YIO A;  5FKO A;  1FIP A;  1DP7 P;  4S0H B;  1T8I A;  2LRD A;  2R7T A;  4DZP A;  2E2I J;  4F3Q A;  3HSR A;  2EK5 A;  5HOO A;  4XOP A;  5E1Z B;  1D0Z A;  4XRS G;  2MBF A;  2ISZ A;  5KVR A;  2A5W A;  2YR2 A;  2VQG A;  3F23 A;  3HRM A;  1MMG A;  1YLF A;  4A0X A;  3GTG J;  1PUF A;  2NOJ B;  4HNU A;  1FYK A;  2RN7 A;  4EV0 A;  4ZTF A;  2KHM A;  2IS6 A;  2Z33 A;  1TQP A;  3TW6 A;  3CCL I;  1XX5 A;  5CVI A;  4HRI A;  2DT6 A;  2KKO A;  4PSW A;  3HSE A;  2LP0 A;  3MQ0 A;  3OS2 A;  4BDY A;  1BW5 A;  3CO7 C;  1MND A;  3GXO A;  3UR3 C;  4BXU A;  1MW7 A;  3LSR A;  5CPR B;  2LF7 A;  1IO2 A;  3JRH A;  3RYP A;  1YRN B;  3CZ6 A;  2H94 A;  2WTE A;  3LSG A;  2R3S A;  5HS7 A;  4F52 A;  1J9I A;  3K4N A;  2HYF A;  3FK7 A;  1ZTR A;  4CCN A;  1MIJ A;  2ICW G;  2PG4 A;  1MNM C;  2EFW A;  1W0U A;  3CO6 C;  2HYJ A;  3CC2 I;  1K6O A;  4RLF A;  1A35 A;  3TOB A;  3CJT B;  5B1A H;  2OUM A;  3VOD A;  3V7S A;  3EPZ A;  3RPU D;  4ZZL A;  4EAT A;  2XF5 A;  2CSO A;  1W0T A;  3OYD A;  4UHT A;  2VLA A;  3FXU A;  2XAF A;  3CCS I;  3SHF A;  1A5J A;  4BQQ A;  2Y30 A;  3JRF A;  1B6A A;  1TWH J;  1MSF C;  4ENN A;  1WJE A;  2EFN A;  2XGD A;  3MVP A;  4NB5 A;  3CUQ C;  3OIQ A;  4I99 C;  2STW A;  4XLN F;  5GAE J;  3I4M J;  1RPW A;  4A3D J;  1USS A;  1JXS A;  4G6D A;  4RB2 C;  4MQ9 F;  1A31 A;  1QU3 A;  4JX6 A;  4WXD A;  3BR2 A;  3CCU I;  2HPM A;  5E79 C;  5LGN A;  2MG4 A;  2VBW A;  3ZMS A;  5E3N A;  1VQ9 I;  4ENK A;  1XPX A;  1XCB A;  3WTZ A;  4B09 A;  4GDF A;  4IXA A;  4UVC A;  2L9N A;  1K78 A;  3MFK A;  2QLZ A;  3OIP A;  1NH3 A;  3CD6 I;  5FD6 A;  4KDP A;  3R0J A;  4G6T B;  1Y1W J;  3OS0 A;  3BPV A;  1T33 A;  4XL9 A;  2TDX A;  3N4M A;  3RZO J;  4I7H A;  2YS9 A;  2VJI A;  2ZXW H;  2ME6 A;  4C2U A;  1MGT A;  2M3A A;  3ABL H;  2Z5U A;  2R92 J;  3KFW X;  2BY1 A;  3EUH A;  3IH2 A;  1ZHF A;  3WTV C;  2QEN A;  1Z91 A;  5HDN A;  2LRE A;  2DMP A;  2P5V A;  2Y0S A;  4RB0 A;  5F6F A;  2GOM A;  3DKX A;  2VE8 A;  1W7P A;  1UJ8 A;  1HQC A;  4P9U A;  1KU7 A;  4AU7 A;  2O7O A;  1SEU A;  5GAH J;  4GGG A;  5DUI A;  1S9H A;  4FQG A;  2BEO A;  2OTJ I;  1OR7 A;  2R7D A;  3T8R A;  3COA C;  3JW4 A;  3BR5 A;  5F0C A;  2XHK A;  5ED4 A;  1IRF A;  3KCC A;  5JR3 A;  1LNW A;  3I0T A;  4KNY A;  4HEA 2;  3SFI A;  1MSE C;  4CYC B;  1KQ0 A;  4R79 A;  2XKP A;  4IO9 F;  2DDA A;  3B6A A;  2W00 A;  1LEB A;  3DXJ F;  4Q47 A;  4NBQ A;  1SMT A;  2EIN H;  4L0Y B;  4B44 A;  5F0H A;  2V1X A;  2Y75 A;  3IWZ A;  5D5U B;  1IRZ A;  1RKW A;  2AXL A;  2K9S A;  2OQG A;  1Q1H A;  1K78 B;  2OZU A;  3M4O J;  3C7J A;  3JAM K;  2HDD A;  2V1U A;  2EFO A;  3F3X A;  1LVA A;  1GV2 A;  1ZRF A;  2A05 A;  2IGK A;  4M9Z A;  1VQN I;  5H20 A;  2FOW A;  2F6C A;  2K4B A;  4L9T A;  3LAJ A;  4BNC A;  3IL2 A;  2W7N A;  3RJP A;  1MBK A;  1G2H A;  1WRJ A;  3RZD J;  1UZC A;  1NG6 A;  3R0A A;  3TGN A;  3CQZ J;  3MKW B;  1OIS A;  4BU2 A;  4IHT A;  3A4C A;  1Z77 A;  1MNE A;  2GIV A;  2ZJ2 A;  3SYT A;  4D5C A;  1CGP A;  3CCJ I;  2HQA A;  3QPS A;  2CV2 A;  4G7H F;  1MJA A;  1S6L A;  3GW2 A;  3BR6 A;  2L9S A;  3K4B A;  3N05 A;  3K1M A;  2CW0 F;  1STZ A;  4L0Z B;  2A6H F;  3D5L A;  1EJ9 A;  3T1B A;  5TGT A;  2MSY A;  5J1R A;  2DFF A;  4CIC A;  3TW7 A;  1L3L A;  2DFI A;  4DJA A;  1V54 H;  2M0C A;  2HOS A;  1W7P B;  4DNC A;  4OU0 A;  2XGX A;  2E60 A;  2LH9 A;  4C2M J;  5E20 A;  3HDD A;  4XK4 A;  3I55 I;  3K4J A;  2M0M A;  5A2Q K;  1JUM A;  4UB6 C;  1B8I A;  4OMY A;  1PJR A;  2E5Z A;  5IOZ A;  1D1C A;  3PL8 A;  4LOC A;  5M5Y J;  3LA2 A;  3FXJ A;  2COB A;  3QU3 A;  3A01 B;  4P5O A;  1PDN C;  5TJJ A;  4G12 A;  2ETH A;  4GO1 A;  3JAM Z;  4XOR A;  3G1O A;  4RB1 A;  3WGH A;  3I59 A;  1SAX A;  2AHQ A;  3HZJ A;  2HVS A;  3H5A A;  1WZ2 A;  5L3G A;  2E71 A;  1T95 A;  1ZRE A;  1TQI A;  2FD5 A;  4A6E A;  1I1G A;  5M5X J;  5K1Y A;  1DU0 A;  4LMY A;  2HQR A;  3H3U A;  3H5R A;  2KZG A;  4AYB N;  1YIJ I;  2KIS A;  1GVJ A;  1YJW I;  3J81 Z;  3SZT A;  1BOA A;  2AXT C;  2BY0 A;  3RPU A;  3S3M A;  4UXN A;  4ZH4 F;  5EG0 A;  4BXX J;  5ERI A;  4FTH A;  5EEH A;  2ACJ A;  1X4P A;  2JJ7 A;  5ILS A;  2WAF A;  3HG9 A;  2BE5 F;  3BRO A;  3A03 A;  3ECO A;  2EV6 A;  3RKY A;  4KIT B;  1U5T C;  2JSP A;  3K4L A;  3ZP5 A;  4XN0 A;  4KFC A;  2K3F A;  3HSF A;  4N4N B;  2EFP A;  4FAS D;  4BS9 A;  3OYJ A;  2K4J A;  4PSX A;  2Y9Z A;  5A2Q Z;  2BOL A;  1ITY A;  2CUF A;  4K2E A;  2EBI A;  4C3J J;  1FOW A;  1MBE A;  3OR2 C;  4MTE A;  3C1D A;  2DOE A;  4GXO A;  3ONQ A;  3WG7 H;  2XUB A;  5E8G A;  1AKH A;  4NDL A;  1PYV A;  5D8L B;  1Y6I A;  2HVQ A;  1JE8 A;  2DAO A;  4YEL A;  3H5N A;  2LG4 A;  1W4M A;  1MD0 A;  2YU3 A;  2CUJ A;  2L7K A;  2MAB A;  1WI3 A;  1AWC A;  5J47 A;  3PUF A;  2CMP A;  3KP7 A;  3MZ8 A;  2HXO A;  4JP0 A;  2NVQ J;  1EH6 A;  3CLQ A;  2FNA A;  3GCM A;  3DV8 A;  4IOA F;  3T5X A;  3S3O A;  1I3A A;  2VL8 A;  3X2Q H;  1MZB A;  1CQT A;  2FQ3 A;  1HDP A;  2K7L A;  2P6S A;  3BDD A;  3H92 A;  5FD5 A;  2LF8 A;  2E1C A;  1KQ9 A;  2NVY J;  1FOY A;  3OV8 A;  1B9M A;  3OYC A;  3HL2 A;  4M3G A;  1K4T A;  2LKS A;  2M4K A;  2NVT J;  1OKR A;  3CMA I;  2XPW A;  1N78 A;  1XSD A;  1X1C A;  5EG0 B;  4DGW B;  4M6V A;  4I0A A;  1OCZ H;  3KYD B;  2O8K A;  2V9K A;  2L0K A;  4IHW A;  2CJJ A;  5IT9 K;  2QQ9 A;  1Z6R A;  1S7E A;  4XIC A;  1MBG A;  1IN6 A;  4LGW A;  2FE3 A;  4U87 A;  3BZK A;  3ZQL A;  2MC3 A;  4E7I A;  3GBG A;  4S04 A;  1UG2 A;  1RUN A;  1OCP A;  2DPD A;  1LVK A;  3MWM A;  2LC2 A;  4D9J A;  1BL0 A;  3B6C A;  2UXN A;  3FHN A;  3DEU A;  1QNT A;  2D1H A;  4BXF A;  3GME A;  5DM7 F;  2Z2S B;  3K69 A;  3BG6 A;  2IS4 A;  3TP0 A;  2WA0 A;  3BG3 A;  4L5J A;  2DOA A;  2KQR A;  2NAZ A;  4PK4 A;  5LHH A;  1XD7 A;  4IRH A;  1SFX A;  2L7Z A;  1V4R A;  3LNQ A;  2L3D A;  1SVM A;  4CHU A;  3HPG A;  1P2F A;  4N9I A;  3CES A;  4CYD A;  1FOX A;  1Z0X A;  3EYY A;  4CZC A;  3NRV A;  1GXP A;  2X6X A;  1X19 A;  4QLC U;  5HNH A;  2Q0O A;  4MTD A;  1AKH B;  2BGC A;  3A2K A;  3DTE A;  2VAS A;  1JUS A;  2VQH A;  3OL4 A;  2VOP A;  4ESF A;  2OBP A;  2ZKZ A;  1F5T A;  1Y8Q B;  3VSK A;  3L2Q A;  3HIF A;  3GVA A;  3ZMZ A;  3VB2 A;  3M3Y J;  1ZQ3 P;  3BJ6 A;  3FXK A;  2O61 A;  2R7F A;  3QPH A;  4HDV A;  2ZC2 A;  1G4D A;  3GFJ A;  4HZF A;  4U0V A;  2W25 A;  3OMY A;  2R7O A;  1TP4 A;  3WTX C;  1LFU P;  2A6T A;  5LRS A;  3OYM A;  2FSW A;  2QSF X;  1JT6 A;  2IS1 A;  2B0L A;  4AD9 A;  2C6Y A;  5FRN A;  3K9T A;  2DOD A;  4R8H A;  5FKN A;  1U8R A;  3HOW J;  2IP2 A;  1P4X A;  1D1B A;  1FZP B;  2GLO A;  2F5F A;  3BR1 A;  4DYQ A;  4DBR A;  1BIA A;  4EGZ A;  2DLL A;  2HNH A;  2R7X A;  4IHX A;  1R1T A;  5KAF C;  3ECH A;  4JX5 A;  3RTR A;  2ZJP F;  3O6B B;  4A3C J;  3KYL A;  4QIW N;  2VB6 A;  4EJT A;  2W85 A;  3ZQC A;  3MD2 A;  3CF2 A;  1T0F A;  4LIV A;  2IVM A;  5F64 A;  4IEJ A;  3BJO A;  2O8X A;  1YFH A;  1XB4 A;  4V19 K;  1HSJ A;  3ZOB A;  2WAQ A;  3IC7 A;  3PO2 J;  3LFU A;  2FU4 A;  3L00 A;  1UST A;  1U78 A;  1KU3 A;  3R60 A;  3I54 A;  3JRI A;  5C4X J;  2BY3 A;  4A2U A;  2B7E A;  4PFP A;  3GO5 A;  1Y1V J;  1FTT A;  4HLY A;  2GOX B;  3E6C C;  1KYZ A;  2EZI A;  3Q0W A;  4M3F A;  5JLX A;  4E7H A;  2XAH A;  1H9T A;  2W48 A;  1HW2 A;  4RBO A;  2F5C A;  1VQP I;  4PJJ A;  3WU2 C;  1BI2 A;  4HA8 A;  3HJE A;  4E7L A;  1YHQ I;  1U9O A;  3GTP J;  1WJB A;  4D0P A;  2F5E A;  5J8F A;  4YFN F;  4OOI A;  3WTT C;  1PVE A;  3GTK J;  2Y0S N;  3QOE A;  5GTI C;  5DTD A;  4HPQ A;  4EVI A;  1VZ0 A;  2EFQ A;  4BE2 A;  4ENM A;  3C2G A;  4OIO F;  2P4W A;  3VPR A;  3SQN A;  2H1L A;  4AID A;  4R1H A;  4W97 A;  2BW3 A;  2H8W A;  1ZAO A;  3J80 K;  3MAJ A;  4CCJ A;  4BQA A;  3CF5 F;  1MJ9 A;  1D8J A;  3QP5 A;  2DA2 A;  2JN6 A;  3B73 A;  5FLV A;  5K5R A;  2XAG A;  3E5Q A;  2ADU A;  2L5Q A;  4V2F A;  3HXL A;  4IQ4 A;  3DU6 A;  1QBJ A;  3HYI A;  1BR1 A;  3JCU C;  2AQE A;  2QKL B;  2PFB A;  3ZMT A;  2DW4 A;  4V2G A;  1DDN A;  2E2H J;  3DPT A;  2M87 A;  3H36 A; 
#chains in the Genus database with same CATH homology
 3V7R A;  4HBL A;  3QU6 A;  2HQN A;  3ZMD A;  3BOQ A;  5ICE A;  1MDM A;  3P7N A;  1ONV A;  3GUD A;  3LFK A;  2KJC A;  3RKX A;  3GZ5 A;  2HEO A;  2A61 A;  4OIN F;  1SMY F;  1EH8 A;  1F1Z A;  4UNO A;  3VEP A;  3J80 Z;  3GLX A;  4FX0 A;  3RI4 A;  3BPX A;  1ZG5 A;  2VXZ A;  4KMU X;  1LEA A;  5E1W A;  5H6R A;  4GYG A;  4WX9 A;  4G7Z F;  2VBZ A;  1TQM A;  2VE9 A;  1IZ1 A;  2RDP A;  1HKQ A;  1GXQ A;  4RB3 C;  2IT0 A;  3K2Z A;  5HS9 A;  4FT8 A;  3MZY A;  5LRR A;  1MJB A;  4Y13 A;  2ISY A;  2OZ6 A;  4O6J A;  1IAW A;  4LK1 F;  5D4S A;  5CVR A;  1RUO A;  3I4P A;  1Z9C A;  1IN7 A;  2D1V A;  3LQR A;  2RVC A;  3KET A;  3HRS A;  4PGH A;  4BHB A;  1BI1 A;  2K86 A;  4HLX A;  2FBH A;  2IA1 A;  4Y15 A;  4A12 A;  3QOP A;  1HW1 A;  2QM3 A;  1IXC A;  2MLK A;  3F8B A;  4G9Y A;  2OU2 A;  1E2X A;  1BJA A;  2OD5 A;  2WC2 A;  4HX8 A;  5BS6 A;  2IPQ X;  4EJW A;  3LAP A;  3DQV C;  3E5U A;  5ICG A;  2PJP A;  2DI3 A;  4KYW A;  3ZN1 A;  4Q5S F;  5K5O A;  1KGS A;  1YS7 A;  3F8F A;  1V3F A;  4MQV A;  3ERE D;  2CGP A;  4YFK F;  2EA4 A;  3CJN A;  2PMH A;  3L9F A;  1B59 A;  1FBU A;  1R23 A;  3F6O A;  2GWR A;  4U7B A;  2EA2 A;  2XIG A;  3SFZ A;  5HDG A;  2XAS A;  1XCV A;  3ROU A;  4S05 A;  4AIK A;  1YS6 A;  4U0W A;  1XDU A;  3IRQ A;  4LB6 B;  1LDK B;  3CUQ A;  4EJU A;  4UV9 A;  4RAZ A;  4KUM A;  3VFZ A;  1J75 A;  4WXH A;  1IW7 F;  4L9N A;  3FZV A;  1L0O C;  1I5Z A;  1FBS A;  4A5N A;  4IJA A;  3KEQ A;  1HXD A;  1QZY A;  3HOT A;  2A68 F;  1Z1D A;  1S3J A;  3FXQ A;  3ELK A;  3TO6 A;  2QZ8 A;  4GYI A;  2M5W A;  1QPM A;  2QBY A;  2NRA C;  4EQQ A;  3R4K A;  2V1D A;  1S7O A;  5D5W B;  3R6S A;  2HS5 A;  3C18 A;  1RNL A;  3E97 A;  3T0Y A;  5J6X A;  5ILU A;  1G3T A;  1ZN2 A;  4XBF A;  2O0Y A;  1ZG3 A;  3PFI A;  2NS0 A;  4I2O A;  4HX4 A;  3WGI A;  3CUQ B;  2H6B A;  4JQF A;  4EM1 A;  1OYY A;  2L02 A;  3ZMV A;  4BYY A;  2BBY A;  4OIR F;  3I58 A;  3C3W A;  1ZGJ A;  4L18 B;  3J81 K;  1T6S A;  4IPA A;  3WTU C;  1G3S A;  2BYV E;  2YPR A;  3JTH A;  3NEU A;  3GFL A;  1BN5 A;  1BIB A;  2M30 A;  1ZG1 A;  3WTY C;  1H0M A;  3W6J B;  3I53 A;  4RGX A;  2QBY B;  2EJR A;  2QYO A;  5CVJ A;  4BHP A;  2X4H A;  5F1R A;  5DCF A;  2V6C A;  2VN2 A;  4U7D A;  2PN6 A;  2IA0 A;  5BMZ A;  3F72 A;  3EDP A;  2AS5 F;  1O3S A;  2F5D A;  4HF2 A;  1YG2 A;  4CGZ A;  4HX7 A;  2GA1 A;  5FFX A;  2FXA A;  1KU9 A;  2HGC A;  5FLX K;  2NNN A;  5DDG A;  2VOO A;  2V79 A;  3V8J A;  1XGO A;  3CLO A;  1FP1 D;  1J59 A;  1Z05 A;  3TOA A;  6PAX A;  5ICF A;  3FHZ A;  5DD4 A;  1LDJ A;  2E1N A;  3GF2 A;  4QWQ A;  3GZ6 A;  2UWM A;  1RZ4 A;  1O3T A;  2W57 A;  1YYV A;  3JSO A;  1OYW A;  2IRF G;  1R1V A;  5JFR A;  2O3F A;  2Q8K A;  2XKO A;  1B4A A;  1R7J A;  2LKP A;  4HF1 A;  4G7O F;  1U5T A;  5D4R A;  4XSZ F;  1SFU A;  3U2R A;  5BOX A;  5FLX Z;  5DCM A;  3EQL F;  1R5G A;  4I02 A;  2KJB A;  3DP7 A;  5CYV A;  4A5M A;  3FX3 A;  5LGU A;  2IW5 A;  4IRG A;  1P4W A;  1XSV A;  1X3U A;  4AIH A;  1R22 A;  4HV6 A;  1ZAR A;  2ZCW A;  3ULQ B;  3F22 A;  3FMS A;  3HTS B;  3W6K B;  2GXB A;  1O7F A;  1ZGA A;  3B02 A;  3MZH A;  2CWE A;  1IN8 A;  5FFZ A;  3RYR A;  1QGP A;  1KYW A;  5D6E A;  2PI0 A;  3U1D A;  3JTG A;  1S7A A;  4MGR A;  4ENJ A;  5LLQ A;  1TNT A;  1R58 A;  2RNJ A;  1LQ1 A;  4KN7 X;  2FEZ A;  3AAF A;  3M7G A;  2NYX A;  1FYL A;  1K7A A;  3P9I A;  2GQQ A;  2DPU A;  2Z9O A;  5ICC A;  4LFU A;  5L3E A;  5CVU A;  3TKY A;  1J7K A;  1U5T B;  2A07 F;  2RGV A;  1QQI A;  3H3Z A;  1FX7 A;  4O5V A;  3IHU A;  4XSX F;  5AON A;  2A5Y B;  5DCM B;  4Z2Y A;  1KA8 A;  3DPL C;  4RAY A;  1W5S A;  2P8T A;  2VBX A;  2COM A;  1JGS A;  1R36 A;  4ZYE A;  3ZPL A;  5E17 F;  1U2W A;  5BPI A;  4NHJ A;  4LJZ F;  3TQN A;  3Q9V A;  1A04 A;  3BWG A;  1REP C;  4HQM A;  1AOY A;  1WWX A;  4M74 A;  3V8K A;  1F4K A;  4RGS A;  4JK1 X;  3E3V A;  1SD5 A;  5LEK A;  1BI0 A;  3HHG A;  3P9C A;  1VTN C;  1DPR A;  3HHH A;  3K1P A;  2DK5 A;  4FX4 A;  4G6Q A;  2DK8 A;  3QP6 A;  4L5I A;  1BM9 A;  1SD6 A;  4M72 A;  4UVA A;  2DU9 A;  2H09 A;  3KE2 A;  4ON0 A;  2OQR A;  4I01 A;  5L3F A;  1EV7 A;  4N9H A;  1G6N A;  5D8K B;  2STT A;  2ESH A;  2Q2E A;  1IXR C;  3Q9S A;  4TV7 A;  4IVN A;  5AIQ A;  1XMK A;  2G7U A;  2WWY A;  4LG0 B;  2E7X A;  3SZP A;  3SXY A;  2PBI A;  1SD7 A;  3HTU A;  3WE2 A;  4KN4 X;  4A6D A;  2NNY A;  2ZBK A;  1TW3 A;  2LNB A;  4IF4 A;  1G3W A;  1I6X A;  4U88 A;  5KK1 A;  2PEX A;  2RQP A;  5L3C A;  4OIP F;  4Q4Z F;  1IUY A;  3BP8 A;  1FPQ A;  2XVC A;  1KU2 A;  1HKS A;  4N0B A;  2XRO A;  2GZW A;  2UXX A;  2CG4 A;  3ISP A;  1FNN A;  4P96 A;  4RGU A;  2JZY A;  2RC4 A;  2DBB A;  5FB2 A;  3E5X A;  3FM5 A;  2JT1 A;  1UHW A;  2MA3 A;  1YW8 A;  1Y0U A;  1P92 A;  4P9F A;  2QVO A;  1OYI A;  3RKW A;  2D2W A;  2HOE A;  2HR3 A;  4UUV A;  4KT5 C;  3M8E A;  1OMI A;  2QWW A;  3GYH X;  4PDK A;  2IJL A;  2DT5 A;  2ZNY A;  3N97 A;  1F9N A;  2OA4 A;  4U0Y A;  2O6G E;  3T8T A;  1SFE A;  3U9G A;  4FHT A;  5L3B A;  3GX4 X;  4YIF A;  1ZRD A;  2J5P A;  4NQW A;  4WF2 A;  2L01 A;  2QUF A;  3ML6 A;  1XGN A;  2H6C A;  3REO A;  3L09 A;  2M87 A;  4YG2 F;  1KQ8 A;  4LB5 A;  3WU0 A;  5JI6 A;  1R00 A;  2VT3 A;  2FBI A;  3RDI A;  1BC7 C;  4HV5 A;  2DO7 A;  1TTY A;  3FF5 A;  3L2C A;  5HVQ C;  1JHF A;  4EMS A;  1PP8 F;  3RPQ A;  3ABU A;  4LLL A;  1QZZ A;  1XGS A;  4LLN A;  4ETS A;  5D5V B;  2W24 A;  3CTA A;  4Q48 A;  4XLP F;  4RGR A;  4JBA A;  3QPT A;  4WCG A;  2DQR A;  2CYY A;  4M9S A;  1FSH A;  3FM3 A;  1CF7 A;  2HDC A;  1DPU A;  4DQ2 A;  4L9J A;  2WV0 A;  2MH2 A;  4P55 A;  3KP6 A;  2ZO4 A;  3O2P E;  4KIG A;  2LSO A;  1ZRC A;  3PQK A;  3GWZ A;  1XDS A;  2KIM A;  3WOD F;  2HFH A;  3EET A;  1YO5 C;  3I64 A;  1YQA A;  4LK0 F;  2EWN A;  4E70 A;  2HKX A;  4H0E A;  4AVP A;  5DD8 A;  3IWF A;  1D3Y A;  1TNS A;  3TO7 A;  1Z7U A;  3J7A O;  1U6G A;  2OAZ A;  3HOS A;  2A69 F;  1FWZ A;  3I5U A;  4I98 B;  5DUK A;  5FGM A;  4CXF A;  5E18 F;  4WK8 F;  1CF7 B;  3KZZ A;  2Z3Y A;  1C0W A;  2VOD A;  3HUG A;  1T98 A;  1ZLK A;  3L7W A;  5JVT A;  2PQ8 A;  3CUO A;  1J0R A;  2CQK A;  2XV4 S;  1HBX G;  1UCR A;  1ZH5 A;  4PGG A;  2DQL A;  1HKT A;  2M8E A;  3IKV A;  1T2K A;  3M8F A;  2A6E F;  2ZME A;  1O57 A;  2ZFW A;  2FBK A;  5E8I A;  5D6F A;  3FXR A;  1RIO H;  2L4M A;  4EM2 A;  5DEQ A;  1D8K A;  5E1X A;  5K5Q A;  1FY7 A;  3CDH A;  2MH9 A;  4BH9 A;  2KIF A;  2XAJ A;  3ZN0 A;  1JHH A;  2HTS A;  3K0L A;  4HYE A;  1SD4 A;  4O3M A;  4F7Z A;  3ZQ7 A;  4ZYH A;  1FP2 A;  3KP3 A;  2FF4 A;  2MLG A;  1TBX A;  3EYI A;  3TDZ C;  3WU1 B;  2E7W A;  4WWC A;  2Z99 A;  1WQ2 A;  3TO9 A;  3I71 A;  2RV8 A;  1BBY A;  5LGT A;  2M45 A;  1LB2 A;  4MHG A;  3P9K A;  3LST A;  3G3Z A;  4AWX B;  2L54 A;  2QQA A;  4HDU A;  1G3Y A;  1DUX C;  2ZME B;  1EH7 A;  3IKT A;  1K79 A;  2P5L C;  1R1U A;  3ABT A;  5DV5 A;  2EV0 A;  4I09 A;  3FMQ A;  3WTS C;  4M6X A;  5CJ9 A;  4ZYG A;  2MD5 A;  3LQQ A;  3GFI A;  4MEY F;  2HZT A;  2KIU A;  2O03 A;  2JRT A;  3KP5 A;  4BHC A;  2VC1 A;  1I1S A;  2EB7 A;  2Y0M A;  1T38 A;  5IT3 A;  4A0Z A;  4OIQ F;  4KA4 A;  3V7C A;  4ESJ A;  1HST A;  1HW5 A;  2VT2 A;  2DTR A;  3FMR A;  2G7H A;  2UZK A;  3GFM A;  2HKO A;  3MEX A;  4GCV A;  3V8L A;  2X0L A;  2XRN A;  1ZLJ A;  4EM0 B;  2YSR A;  2PLY A;  5LHG A;  1QO0 D;  3M9A A;  1I27 A;  2K27 A;  4BAY A;  4HQE A;  4L9V A;  2VBY A;  1IXS B;  4KMF A;  1ON1 A;  1FSE A;  1ULY A;  2P6T A;  2FML A;  2A3S A;  4CO8 A;  1E17 A;  2XAQ A;  3JSP A;  3E6D A;  4M6Y A;  3DF8 A;  4ZZD A;  1XN7 A;  3QAH A;  5ILV A;  2D45 A;  4KIF A;  2L4A A;  3I59 B;  5TRD A;  1FT9 A;  5EEG A;  2YX4 A;  5AIP A;  4CDG A;  5FO5 A;  3Q5F A;  1BC8 C;  3DFG A;  4M71 A;  5DYM A;  4HOB A;  2GAU A;  4B8X A;  2FOK A;  4M73 A;  1FC3 A;  4Y17 A;  2ZNZ A;  1B1B A;  5CLS A;  5HS8 A;  3LWF A;  4OMZ A;  2JTV A;  2K02 A;  3E6B A;  2HWV A;  5CVV A;  1O3R A;  2FA5 A;  4LG0 A;  2FRH A;  2YX7 A;  4EGY A;  5HLH A;  1P4A A;  1TLH B;  1P6R A;  4LLG F;  1PP7 U;  3HRU A;  3KP2 A;  4HW0 A;  2VON A;  3V4G A;  2LDU A;  2JPB A;  1ZYR F;  3MCZ A;  1XGM A;  4UVB A;  5LHI A;  3BJA A;  4G94 A;  3S2W A;  2J5O A;  3QRF F;  1S29 A;  5IT9 Z;  4KIC A;  1U3E M;  3OOP A;  4HAM A;  1YW9 A;  2V9V A;  1IF1 A;  3LA3 A;  1T39 A;  1UHM A;  1XSX A;  3D0S A;  3GEZ A;  4A0Y A;  4CZZ A;  1LDD A;  1J2X A;  3KP4 A;  3KLN A;  3WG9 A;  1ON2 A;  1YTY A;  5D5X B;  1B9N A;  4HF0 A;  5BQT A;  2GA2 A;  2M1B A;  3HRT A;  4MNU A;  2HYG D;  4LD5 A;  4IRI A;  4YII A;  1ODD A;  1WKM A;  4KIB A;  2QQB A;  1R5H A;  1H9G A;  3KZY A;  2H27 A;  2PMU A;  1PUE E;  2P7V B;  4WXC A;  4ESB A;  5HLG A;  2FMY A;  1IN5 A;  3KLO A;  1S8N A;  1UB9 A;  2ZXJ A;  1O7L A;  1O3Q A;  3O3K A;  3KEO A;  1Z6T A;  2Y48 A;  3ZMU A;  1OPC A;  3F8N A;  3F21 A;  1BI3 A;  2EV5 A;  1GHC A;  3F8C A;  3VOE A;  4RS8 A;  5J8C A;  1LJ9 A;  5LEJ A;  1J5Y A;  5JHU A;  2GXG A;  2P5K A;  1YW7 A;  2VC0 A;  3R61 A;  2JSC A;  5HLI A;  4I0B A;  1MKM A;  3F8M A;  3IRR A;  2W84 A;  2KRF A;  2CO5 A;  5L3D A;  2JPC A;  3BY6 A;  2IA2 A;  2BV6 A;  1RI7 A;  2ESN A;  3PQJ A;  5LBQ A;  3K1N A;  1WSU A;  1WI9 A;  3E6M A;  4IHS A;  1IRG A;  3F6V A;  3DKW A;  4ZYD A;  2P7C B;  4G8X A;  1XMA A;  4M9X A;  3LA7 A;  1TW2 A;  1W7P D;  2RKH A;  3RIR A;  2F2E A;  4PCQ A;  3NQO A;  2HTJ A;  1W5T A;  4AIJ A;  4EJV A;  2G9W A;  4UV8 A;  4PZJ A;  3M1E A;  2ELH A;  3G73 A;  5BPD A;  1IN4 A;  5H6Q A;  4XRF A;  4EJO A;  2FNP A;  3FWE A;  2CFX A;  1UFM A;  3BZ6 A;  3WGG A;  4MEX F;  5HDK A;  1D5V A;  4ASN A;  1FOK A;  1FLI A;  1FBQ A;  3WE3 A;  1NHA A;  1MDM B;  3WTW C;  4YFX F;  1FYM A;  3TDU C;  1YIO A;  1DP7 P;  3HSR A;  2EK5 A;  5HOO A;  5E1Z B;  2MBF A;  2ISZ A;  5KVR A;  2YR2 A;  3F23 A;  3HRM A;  1YLF A;  4A0X A;  1FYK A;  2RN7 A;  4EV0 A;  2Z33 A;  1TQP A;  5CVI A;  2KKO A;  3HSE A;  3MQ0 A;  3CO7 C;  3GXO A;  4BXU A;  2LF7 A;  3RYP A;  2H94 A;  2WTE A;  5HS7 A;  2R3S A;  1J9I A;  2HYF A;  2PG4 A;  2EFW A;  3CO6 C;  1K6O A;  3TOB A;  3VOD A;  3V7S A;  4ZZL A;  2CSO A;  4UHT A;  3FXU A;  2XAF A;  3SHF A;  1B6A A;  4ENN A;  2EFN A;  4NB5 A;  3CUQ C;  2STW A;  4XLN F;  1USS A;  1JXS A;  4G6D A;  4RB2 C;  4MQ9 F;  4WXD A;  5LGN A;  2VBW A;  3ZMS A;  4ENK A;  1XCB A;  3WTZ A;  4B09 A;  4IXA A;  4UVC A;  1K78 A;  3MFK A;  2QLZ A;  5FD6 A;  4KDP A;  3R0J A;  3BPV A;  2TDX A;  3N4M A;  4I7H A;  1MGT A;  2Z5U A;  3KFW X;  3EUH A;  1ZHF A;  3WTV C;  2QEN A;  1Z91 A;  5HDN A;  2P5V A;  4RB0 A;  5F6F A;  2VE8 A;  1W7P A;  1HQC A;  4P9U A;  1KU7 A;  4GGG A;  5DUI A;  2BEO A;  1OR7 A;  2R7D A;  3T8R A;  3COA C;  3JW4 A;  2XHK A;  5ED4 A;  1IRF A;  3KCC A;  5JR3 A;  1LNW A;  3I0T A;  4KNY A;  1KQ0 A;  4R79 A;  2XKP A;  1LEB A;  3DXJ F;  4Q47 A;  1SMT A;  4L0Y B;  2V1X A;  2Y75 A;  3IWZ A;  5D5U B;  2AXL A;  1K78 B;  2OQG A;  1Q1H A;  2OZU A;  3C7J A;  3JAM K;  2V1U A;  2EFO A;  3F3X A;  1LVA A;  1ZRF A;  4M9Z A;  5H20 A;  2K4B A;  4L9T A;  3LAJ A;  4BNC A;  3IL2 A;  3RJP A;  1WRJ A;  3R0A A;  3TGN A;  4IHT A;  2GIV A;  2ZJ2 A;  1CGP A;  4G7H F;  1MJA A;  1S6L A;  3GW2 A;  3K1M A;  2CW0 F;  1STZ A;  4L0Z B;  2A6H F;  3D5L A;  3T1B A;  4CIC A;  1L3L A;  2DFI A;  1W7P B;  4DNC A;  4OU0 A;  2XGX A;  5E20 A;  5A2Q K;  4OMY A;  3LA2 A;  3QU3 A;  4P5O A;  1PDN C;  5TJJ A;  4GO1 A;  2ETH A;  3JAM Z;  4RB1 A;  3WGH A;  3I59 A;  1SAX A;  5L3G A;  1ZRE A;  1TQI A;  4A6E A;  1I1G A;  5K1Y A;  4LMY A;  2HQR A;  3H3U A;  1GVJ A;  3J81 Z;  3SZT A;  1BOA A;  3RPU A;  4UXN A;  4ZH4 F;  5ERI A;  5EEH A;  2ACJ A;  5ILS A;  2BE5 F;  3BRO A;  3ECO A;  2EV6 A;  3RKY A;  1U5T C;  3ZP5 A;  4KFC A;  3HSF A;  2EFP A;  2K4J A;  5A2Q Z;  4K2E A;  4MTE A;  3C1D A;  4GXO A;  2XUB A;  5E8G A;  5D8L B;  1JE8 A;  2DAO A;  1W4M A;  1MD0 A;  2YU3 A;  1AWC A;  3KP7 A;  1EH6 A;  2FNA A;  3DV8 A;  3T5X A;  1MZB A;  2FQ3 A;  2K7L A;  2P6S A;  3BDD A;  3H92 A;  5FD5 A;  2LF8 A;  2E1C A;  1KQ9 A;  3OV8 A;  1B9M A;  1OKR A;  1XSD A;  4I0A A;  5IT9 K;  2QQ9 A;  1Z6R A;  1IN6 A;  4LGW A;  2FE3 A;  2MC3 A;  4S04 A;  2DPD A;  1RUN A;  3MWM A;  2UXN A;  3DEU A;  1QNT A;  2D1H A;  3K69 A;  4L5J A;  2NAZ A;  5LHH A;  1XD7 A;  4IRH A;  1SFX A;  1V4R A;  2L3D A;  4CHU A;  1P2F A;  4N9I A;  4CYD A;  3EYY A;  3NRV A;  1GXP A;  4MTD A;  4QLC U;  2Q0O A;  2BGC A;  2VOP A;  4ESF A;  2OBP A;  2ZKZ A;  1F5T A;  3HIF A;  3GVA A;  3ZMZ A;  3VB2 A;  3BJ6 A;  2O61 A;  2R7F A;  3QPH A;  4HDV A;  1G4D A;  3GFJ A;  4HZF A;  4U0V A;  2W25 A;  3WTX C;  5LRS A;  2FSW A;  2B0L A;  4AD9 A;  2C6Y A;  3K9T A;  4R8H A;  1U8R A;  2IP2 A;  1P4X A;  1FZP B;  2F5F A;  1BIA A;  4EGZ A;  2DLL A;  1R1T A;  3ECH A;  3RTR A;  3O6B B;  4EJT A;  2W85 A;  1T0F A;  2IVM A;  5F64 A;  3BJO A;  2O8X A;  1YFH A;  1XB4 A;  1HSJ A;  3IC7 A;  2FU4 A;  3L00 A;  1UST A;  1U78 A;  1KU3 A;  3R60 A;  3I54 A;  4A2U A;  3GO5 A;  3E6C C;  1KYZ A;  2XAH A;  1H9T A;  1HW2 A;  2F5C A;  1BI2 A;  4HA8 A;  4D0P A;  2F5E A;  5J8F A;  4YFN F;  4OOI A;  3WTT C;  4EVI A;  2EFQ A;  4ENM A;  4OIO F;  2P4W A;  3SQN A;  4R1H A;  1ZAO A;  3J80 K;  3MAJ A;  4BQA A;  1MJ9 A;  1D8J A;  3QP5 A;  3B73 A;  5K5R A;  2XAG A;  3E5Q A;  2ADU A;  1QBJ A;  3HYI A;  2PFB A;  3ZMT A;  2DW4 A;  1DDN A;  3DPT A;  4HLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...