4U88A

Structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
93
Chain Sequence
EQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEKVWANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator SaeR
publication title Structure of the DNA-Binding Domain of the Response Regulator SaeR from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus usa300-ismms1
molecule tags Dna binding protein
total genus 25
structure length 93
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4u88A00
2JT1A 2QBYB 2OZUA 2HKOA 5LEKA 3BY6A 2OZ6A 2LSOA 3CUQB 1YLFA 1XMKA 2PQ8A 2XV4S 5DD4A 3J81K 4ESBA 3OOPA 3V7CA 3RKXA 4WXHA 1JE8A 3ISPA 3GF2A 2FNAA 3D5LA 4HV6A 1O3QA 3E6CC 1R1VA 4NHJA 4U0WA 1FYMA 4CDGA 2PN6A 2DFIA 1LEAA 2HS5A 2IA0A 2ISZA 1W7PD 2ZXJA 4B8XA 4LMYA 3ABUA 1TQPA 4MHGA 2RDPA 2QZ8A 1ZARA 2A6HF 2Q2EA 3IRQA 3I64A 5HVQC 3I58A 1SD6A 4G8XA 1XB4A 4CYDA 2HZTA 4KNYA 5A2QK 4RB1A 5DYMA 1KU9A 2O3FA 3GZ6A 3TDZC 1FLIA 3KEQA 4UVCA 1IAWA 2GIVA 1YW8A 5HOOA 3F8FA 2X4HA 1FY7A 1G3TA 1J59A 2L54A 2KIMA 1R23A 2R7FA 3DXJF 4BHBA 1RUOA 1CF7A 2IA1A 2XHKA 2XKOA 1TW3A 3E5QA 3M8EA 3REOA 3DP7A 5D6FA 2L3DA 1DP7P 2STTA 3HSFA 4BNCA 1NHAA 3KP6A 5HDNA 4Y13A 2VONA 1MJAA 4ZYEA 1F4KA 3GX4X 4OMZA 3LA7A 2FF4A 3V4GA 2DQLA 5IT3A 3COAC 2XGXA 1PDNC 3HRTA 5DCMB 4HOBA 4HW0A 3ROUA 4LG0B 1USTA 1OYWA 5JVTA 4RB2C 1TLHB 5L3DA 5JFRA 2ACJA 1GVJA 3TOAA 1H9GA 1XGSA 1ZAOA 4WWCA 1YG2A 2BYVE 2W84A 2Z33A 4WCGA 2O61A 3ZMTA 1OYYA 2DBBA 5LEJA 5D4SA 3NRVA 2QBYA 4WXCA 4HLXA 1R00A 3WGHA 2J5PA 4XSZF 3CUQA 1J5YA 3BWGA 3MCZA 1FWZA 1IN6A 4KDPA 1HW2A 3E97A 3TO7A 2P4WA 5HLGA 3TO9A 4WX9A 1I27A 3QU6A 4HF0A 4RGUA 4G6QA 3LQRA 4A12A 3LAJA 3FXRA 2DPUA 1J7KA 4PZJA 4U88A 3F8BA 3GYHX 1CGPA 2KKOA 4CGZA 4HZFA 5H6RA 2Y0MA 1L0OC 3HHGA 3HRSA 3CJNA 5DCFA 2BV6A 4I7HA 2V79A 1J9IA 3QOPA 1MD0A 1U5TB 2EK5A 1STZA 1MKMA 2FBIA 1PUEE 3BZ6A 3ULQB 2YPRA 1SFXA 5DEQA 5H20A 2ZMEB 4EGZA 4AIKA 5CVRA 1O3SA 1KU3A 3LQQA 5ICGA 3KEOA 1XN7A 5LGUA 4L9NA 1PP7U 1R36A 2EB7A 5E18F 2CFXA 4WF2A 1WI9A 5LHHA 1KYZA 1IN5A 5FB2A 3M8FA 3C18A 4A0ZA 5E20A 1IXRC 3KP2A 1OR7A 4WXDA 2A61A 3BJOA 1SMTA 1IRGA 2IPQX 2DI3A 2HYFA 5L3GA 4ZH4F 5FO5A 2JSCA 3QPHA 1ZG5A 2UXNA 4KN4X 1R5GA 2VE8A 4M9SA 4JBAA 1XCVA 4MEXF 2PMUA 4BHCA 1K79A 5DCMA 2GZWA 4LG0A 3VODA 3EYIA 2L4AA 2VN2A 1MJ9A 5BPIA 1ZRCA 4LK1F 3BJ6A 4UHTA 1QGPA 1X3UA 3O3KA 4CZZA 1Z05A 3I0TA 5J8CA 3WU1B 2NNNA 1FBQA 1Z7UA 1R5HA 1XGNA 4FHTA 3I4PA 2GA1A 2O03A 1S3JA 2GXGA 5BMZA 4RGRA 3Q5FA 2WC2A 2WWYA 3ZPLA 1J0RA 1V3FA 4GXOA 3HYIA 2EA4A 5E1XA 2O8XA 5ICCA 3ZMDA 3EQLF 4G9YA 3VB2A 1RNLA 2DPDA 2MLKA 3TOBA 3WTXC 2HQNA 5FD5A 3T0YA 1S6LA 3F8CA 1FYLA 4LFUA 4HLYA 4N0BA 5CVUA 5AONA 5K5OA 2A3SA 3DF8A 2Z99A 3IKTA 3R0JA 4BYYA 3DPTA 2QUFA 5L3CA 4O6JA 4AD9A 3GO5A 1U5TA 3FXUA 2MH9A 5HLIA 2P5VA 1DPRA 2RC4A 2RN7A 2JPCA 1U6GA 2ZMEA 4HAMA 3CLOA 3VOEA 1VTNC 4ZYDA 2XAFA 1YS6A 1XCBA 1HW1A 4HQEA 3JW4A 3HHHA 4IRGA 4WK8F 3HSEA 5J6XA 2FE3A 4QLCU 2CW0F 3WU0A 1RI7A 4IJAA 1F1ZA 2CYYA 2ZNYA 4OIRF 3V8JA 2C6YA 4L18B 2E1CA 3HUGA 4L5IA 2EFWA 4DQ2A 3PQJA 3C3WA 2RVCA 1DDNA 2IA2A 2K4JA 3N4MA 4EJOA 4MNUA 4ENMA 3PFIA 2XIGA 2FOKA 1XSVA 4O5VA 2D1VA 1BJAA 4G7ZF 3NEUA 2IRFG 5ED4A 3MAJA 4HQMA 5CVJA 4AIJA 2BE5F 3LWFA 2TDXA 1EH7A 3E3VA 3KP7A 3FM5A 2FMYA 5BQTA 3FMSA 3SZTA 3KZYA 3TDUC 3PQKA 4DNCA 3O2PE 2FBKA 1IUYA 5F64A 3ZMZA 3HSRA 1G3SA 2M5WA 5D8LB 1QO0D 2FSWA 3JSPA 2FU4A 2IVMA 1IN4A 3R61A 2H27A 1MDMB 1I1SA 1K78B 3ECHA 2EFOA 1K6OA 4PCQA 1TQMA 3ZN1A 2FA5A 3TGNA 3MWMA 3L2CA 3ECOA 3I53A 1GXPA 3GEZA 3F22A 2HDCA 2ZCWA 3DEUA 1WKMA 3T8TA 2MH2A 3EUHA 2F5FA 1TW2A 4ENNA 2H09A 1G6NA 3MZYA 3FXQA 4OINF 2V6CA 2H6CA 2LNBA 3LFKA 5HS9A 4HYEA 1ZYRF 1LDKB 1YYVA 1FP2A 1YS7A 2OQGA 3WTYC 3J80K 3L7WA 1IZ1A 5BS6A 2M45A 2K27A 2L4MA 4ENJA 4LK0F 1BI0A 3F23A 3K1PA 1QNTA 3DPLC 5ILUA 5AIPA 2ZKZA 1IXCA 1LQ1A 3FX3A 1UCRA 1SMYF 2P6SA 3KLOA 4GCVA 1YQAA 3GVAA 2AS5F 1QQIA 1ODDA 4ON0A 4XLNF 4Z2YA 3I5UA 2XAGA 4QWQA 5CLSA 1R1UA 1BC8C 3TQNA 3F6OA 2MD5A 4A6DA 4F7ZA 3DFGA 2XAJA 4G6DA 1FC3A 2ESHA 2R7DA 3W6KB 3JTGA 2V9VA 4M6XA 1WWXA 5JR3A 5HS8A 2JRTA 4MTEA 2QWWA 4ESJA 5L3BA 3IKVA 4S04A 2UWMA 1ZLKA 2O6GE 1TNTA 2W25A 1DUXC 3RKWA 4AIHA 5ILSA 1TQIA 1GHCA 2ISYA 2QYOA 4FX4A 3E6DA 2XRNA 4RGXA 4E70A 3ZQ7A 3DQVC 2OAZA 2H6BA 1FX7A 1MJBA 2DU9A 3WGIA 1YIOA 2A6EF 4RB3C 1W5TA 2W57A 2IT0A 3DKWA 1BC7C 4NQWA 2EV6A 4JK1X 3WE3A 2W85A 1F9NA 3FF5A 1FOKA 2STWA 2G7UA 4D0PA 3KFWX 3ABTA 1MDMA 3GW2A 1K78A 1FP1D 4L9TA 1FPQA 1TBXA 3M1EA 4RAZA 1Z1DA 1LEBA 2DK8A 1IW7F 2IW5A 3BDDA 2VC0A 3MFKA 4I98B 3WTZA 3QRFF 1T39A 4R79A 3GFJA 3J7AO 5FGMA 5E1WA 2XROA 4ASNA 2HGCA 3EDPA 5FD6A 1ZLJA 4IHSA 3JSOA 4M74A 2YR2A 4ZZDA 4ESFA 4A5MA 3ELKA 4ZYHA 1R58A 3CO6C 1YTYA 4A6EA 3I59B 5HS7A 2DTRA 5E8GA 3IHUA 2PJPA 3BPVA 2CGPA 4Q48A 1FBSA 1I6XA 2XAQA 2QVOA 1I5ZA 1ZG3A 3ZMVA 4YFKF 1SD4A 4R8HA 2GQQA 3WTVC 1YW9A 2GWRA 4IPAA 3QAHA 1O3RA 2P7VB 2UXXA 2WV0A 2PEXA 4N9IA 1DPUA 1UB9A 1SFUA 1AWCA 3RPQA 2QM3A 3RIRA 2COMA 2ETHA 2F5CA 1SAXA 2V1DA 2M30A 3HTSB 3B02A 3QP6A 3SHFA 2VBYA 3E6MA 1H9TA 1YFHA 3FWEA 2JPBA 2JZYA 1W5SA 2OA4A 3BP8A 4Q4ZF 2Z5UA 4I09A 1Y0UA 5BPDA 1ON2A 3EYYA 2EV5A 1E17A 3WTUC 1ZGJA 3T5XA 4EM2A 2ELHA 1KU7A 5JHUA 5FLXZ 4HDUA 1HSJA 2WTEA 5KVRA 3IRRA 3L9FA 1FYKA 4M72A 5D5UB 2ZNZA 4OMYA 2FMLA 1MGTA 1XDSA 2VOOA 5CYVA 2DW4A 1O57A 1D8JA 1OPCA 1AOYA 1B9NA 3BPXA 5ICFA 2AXLA 2QQ9A 4O3MA 1HKQA 3DV8A 5CVVA 4M71A 4P9FA 4MGRA 3EETA 1ON1A 1ZGAA 2IJLA 3J81Z 3ERED 2VT2A 3M7GA 3WODF 4U7BA 2OD5A 3Q9VA 2D2WA 4IVNA 3SQNA 3I54A 3P7NA 3OV8A 1OMIA 3M9AA 2RV8A 3IC7A 1R1TA 4HX4A 3RYRA 1MZBA 3MEXA 1S7AA 1ZN2A 2Q0OA 5DV5A 4FX0A 3F72A 3WGGA 2FNPA 4I2OA 3I59A 2VODA 2VOPA 3HRMA 1BI2A 2W24A 2NYXA 2FRHA 3SZPA 2PLYA 5D5VB 4KIGA 3JAMZ 5A2QZ 3K69A 3CTAA 3F8MA 1P92A 4MTDA 3BOQA 4Q47A 4P55A 3D0SA 2NRAC 4LLNA 3BROA 2FXAA 3U1DA 4IRHA 3FMQA 5FFXA 1A04A 3H3UA 3KETA 4CXFA 5F6FA 2QQAA 1IXSB 4EM0B 4H0EA 4HX7A 4P5OA 3K1MA 4GO1A 2PBIA 1Z91A 2M87A 2RKHA 2K86A 4ZYGA 3I71A 1BIBA 2A68F 1USSA 3CDHA 2UZKA 2V1UA 1Z9CA 3MZHA 4EM1A 4GYIA 2XVCA 2VXZA 4ZZLA 1ZHFA 1XGMA 2V1XA 4M9XA 5D5WB 4U0YA 1SD7A 4EJTA 5IT9Z 3GFMA 4A2UA 3WTTC 1U8RA 2L01A 1QPMA 2VE9A 6PAXA 1P4AA 2XKPA 5F1RA 5D5XB 5ERIA 4EJWA 3F3XA 5LGNA 2KJBA 1YO5C 1QZYA 2E1NA 3GFLA 1U78A 5FLXK 4OOIA 4OIOF 3WE2A 2HOEA 1REPC 2MBFA 4A0YA 1Z6RA 2FBHA 3IWFA 1ZRDA 2EA2A 3WTSC 4I01A 4EGYA 1S8NA 5DD8A 1U3EM 5ILVA 3ML6A 3G73A 1UHWA 2YSRA 1JGSA 4KMFA 4YFXF 4P96A 4Q5SF 3JTHA 3GFIA 2IP2A 2O0YA 1XD7A 5K5QA 2MA3A 4R1HA 2NNYA 2F5DA 3KCCA 2E7XA 2HTSA 3HTUA 4XSXF 3WG9A 4YIFA 3RTRA 2NS0A 3HOSA 2OQRA 2HTJA 4N9HA 2KJCA 1E2XA 1BN5A 1OKRA 2VBXA 1S29A 4YIIA 3RI4A 1K7AA 3AAFA 1O7LA 3CO7C 3RJPA 1EH8A 4XBFA 2LF7A 3JAMK 4G7HF 3KP4A 2DQRA 2PFBA 1HSTA 3ZMUA 3KP3A 2XUBA 2CSOA 1W4MA 1J2XA 4A5NA 2DK5A 1JHHA 4P9UA 2DLLA 4LB5A 4KFCA 3R6SA 5EEGA 4M9ZA 2CWEA 2BEOA 4L0ZB 2R3SA 3TKYA 2GXBA 4EJVA 3H92A 3K0LA 4TV7A 3N97A 1XSXA 1G3WA 3CUQC 3P9KA 1V4RA 4U0VA 3W6JB 3RDIA 1Z6TA 5K5RA 4UNOA 1P4WA 1RUNA 1KGSA 1YW7A 5LLQA 1BI3A 5L3FA 5LBQA 1SD5A 2KIFA 3VEPA 2MLGA 1IRFA 3HRUA 1XMAA 2OU2A 4IF4A 4HF2A 1O7FA 4UVAA 4YFNF 3B73A 5IT9K 1FSEA 1T98A 5LHGA 1TNSA 4KUMA 3CUOA 5DDGA 2NAZA 2BBYA 4MQVA 1B1BA 4HBLA 3P9CA 3SXYA 2P6TA 4HF1A 4LB6B 3ZMSA 5E17F 2HEOA 3LA3A 3KP5A 1TTYA 4EQQA 1L3LA 1RIOH 1D3YA 4KMUX 3VFZA 5E1ZB 1QZZA 2QENA 5JI6A 5CJ9A 1HKSA 1IN8A 4XRFA 2Q8KA 3K2ZA 5AIQA 4BAYA 1LDDA 1S7OA 3MQ0A 2LKPA 4IHTA 1T0FA 2X0LA 5E8IA 4XLPF 2K7LA 3C1DA 2YX4A 2GAUA 4EV0A 2D1HA 3E6BA 2A69F 3R60A 4LJZF 2ADUA 4MEYF 4G7OF 1I1GA 3GXOA 4KYWA 3O6BB 3BJAA 2F2EA 2ZJ2A 1LNWA 1P2FA 2D45A 5LHIA 5H6QA 1D8KA 2LDUA 2QLZA 2Z9OA 4HDVA 1FSHA 2GA2A 4UUVA 4OIPF 1BBYA 4I0BA 3TO6A 1R7JA 4EVIA 1HW5A 4CHUA 3P9IA 1KQ9A 1KA8A 4ENKA 2VBWA 1IF1A 4I02A 2K4BA 2RGVA 3T8RA 4KA4A 3NQOA 1J75A 5KK1A 2BGCA 1BI1A 2VT3A 2KRFA 3LSTA 2B0LA 3K9TA 5CVIA 4HX8A 2M8EA 3GWZA 4GGGA 1WSUA 2ZFWA 2EFNA 5LRSA 1UFMA 1HKTA 2EFQA 1HXDA 1ZH5A 2P7CB 2P5KA 2ZBKA 1B59A 2HFHA 3T1BA 3RYPA 3KZZA 4LLGF 4AWXB 4GYGA 1Q1HA 4A0XA 1GXQA 1SFEA 3C7JA 5K1YA 2PMHA 2EV0A 1EV7A 3KLNA 3V8KA 4EMSA 5HLHA 1R22A 3ZP5A 1ZREA 4G94A 5D4RA 5TRDA 2L02A 1OYIA 2FEZA 1W7PB 1HQCA 4L0YB 4HA8A 2XAHA 1T6SA 1LVAA 5J8FA 3G3ZA 2QQBA 4IXAA 2A07F 1JHFA 3HIFA 2P8TA 3F8NA 5FFZA 1U5TC 4M6YA 4PGGA 3IWZA 4BXUA 2YX7A 3RPUA 4B09A 4NB5A 5BOXA 1D5VA 3FHZA 2OBPA 3L09A 2HWVA 3IL2A 1O3TA 4KN7X 1BM9A 5ICEA 4I0AA 1G4DA 3F6VA 2FQ3A 4HV5A 3F21A 4MQ9F 1P4XA 4RB0A 5HDGA 4Y17A 4AVPA 3ZN0A 4BQAA 4OU0A 2Y48A 3QPTA 2EWNA 4BHPA 4LD5A 3WTWC 1XGOA 3V8LA 2DT5A 2HYGD 5HDKA 5LGTA 4K2EA 1KYWA 1WQ2A 2MC3A 4ETSA 3V7SA 4BH9A 2A5YB 1BOAA 4RGSA 3K1NA 4KIBA 3U9GA 1EH6A 3LA2A 2G7HA 2Z3YA 1T2KA 3U2RA 3FMRA 1P6RA 4M73A 1XSDA 5D8KB 2J5OA 4OIQF 2VC1A 2CQKA 4IRIA 3J80Z 4KICA 1H0MA 2PG4A 1QBJA 2VBZA 1BIAA 2F5EA 3FZVA 4L5JA 1ONVA 2HKXA 4LLLA 2P5LC 2RQPA 1ZRFA 3FM3A 1RZ4A 1ZG1A 1JXSA 2CO5A 3GLXA 3V7RA 2YU3A 2XASA 1ULYA 1KU2A 4RS8A 4UVBA 1C0WA 2HR3A 4CICA 4RAYA 1UHMA 1XDUA 5D6EA 3HOTA 2K02A 1PP8F 1T38A 5LRRA 2PI0A 2EJRA 1B6AA 3LAPA 5DUIA 1CF7B 2KIUA 1KQ0A 4L9JA 3R0AA 1FNNA 4L9VA 3RKYA 3QP5A 1LB2A 2H94A 2HQRA 1WRJA 2DAOA 1LJ9A 4U7DA 3QU3A 3E5XA 3Q9SA 4JQFA 4KT5C 1LDJA 2E7WA 1F5TA 3R4KA 1B9MA 4YG2F 2ESNA 4UV8A 2Y75A 3S2WA 3E5UA 2G9WA 5TJJA 4CO8A 1W7PA 3GZ5A 4PGHA 2EFPA 2M1BA 3L00A 3GUDA 5EEHA 1G3YA 2DO7A 3SFZA 4PDKA 2CG4A 1FT9A 4Y15A 2JTVA 1IN7A 1FZPB 1KQ8A 3KE2A 4UXNA 1B4AA 5DUKA 4KIFA 4FT8A 4UV9A 1U2WA 4S05A 3H3ZA 2RNJA 4EJUA 1HBXG 4LGWA 2LF8A 2ZO4A 1FBUA 5L3EA
chains in the Genus database with same CATH superfamily
2JT1A 1TWGJ 2XF7A 3OS0A 4M3BA 2QBYB 4NQWB 1OLTA 1TWFJ 1IRZA 2EZLA 4RAGA 2OZUA 4PK4A 2HKOA 4IL6C 5LEKA 3BY6A 2OZ6A 2LSOA 3CUQB 3GBGA 4Y3OA 1YLFA 5FROA 1XMKA 2AHQA 4EATA 1MBGA 2PQ8A 2XV4S 2CUFA 5DD4A 1JI8A 2E71A 2Y0SN 2X9DA 1X2NA 3J81K 3JRCA 1ETYA 4ESBA 3OOPA 4B3AA 3B6AA 3V7CA 3RKXA 2L2OA 4WXHA 1JE8A 3Q0VA 3ISPA 1Q1VA 3GF2A 3KEYA 2HYJA 4L5EA 2FNAA 3HOXJ 5M3MJ 1MW7A 3D5LA 4HV6A 1X1AA 3K2AA 5KCMA 1O3QA 4BY7J 3E6CC 3CC7I 1R1VA 4NHJA 3ABKH 4U0WA 4CCMA 1FYMA 3W2WA 4CDGA 3LSRA 2PN6A 2DFIA 4BQOA 3CMYA 3BG3A 5LFAA 1LEAA 1V5EA 3CCRI 2R7OA 2HS5A 4PSWA 2IA0A 3K70C 2KDZA 2ISZA 1W7PD 2ZXJA 4B8XA 1VQNI 4LMYA 2IGOA 3ABUA 1K4TA 1TQPA 2CQNA 2IS4A 4MHGA 2RDPA 2QZ8A 3A02A 1ZARA 2A6HF 2Q2EA 2KRHA 3IRQA 3I64A 5HVQC 3K4JA 3F9KA 4XRMA 2LREA 3I58A 1SD6A 4G8XA 1XB4A 2DMTA 2K40A 4AC0A 4CYDA 2HZTA 4KNYA 2N8GA 5A2QK 4RB1A 5DYMA 3HL2A 1KU9A 5J4YA 2O3FA 4ITVA 3GZ6A 2OF7A 3TDZC 2DOFA 3AG2H 1FLIA 3KEQA 4UVCA 1IAWA 2GIVA 1YW8A 1I6HJ 5HOOA 1YIJI 3F8FA 2X4HA 3HC7A 3CCYA 1FY7A 1G3TA 3FKJA 4CCJA 2L54A 1J59A 2XC7A 2KIMA 1R23A 3ASNH 2R7FA 3DXJF 4BHBA 1RUOA 1CF7A 1B8IB 4AM3A 2LY1A 9ANTA 2IA1A 2XHKA 3DBHB 2XKOA 1TW3A 3E5QA 2X6YA 3M8EA 1WJAA 3REOA 3DP7A 1IDZA 1EA3A 1MMAA 5D6FA 2L3DA 2XGCA 4ZYAA 4D1QA 1DP7P 4AIDA 2STTA 4FISA 1POGA 3HSFA 3FXMA 4BNCA 1NHAA 3KP6A 5FRMA 1RESA 5HDNA 3HM5A 4NC7A 2QSHX 2HVQA 5EF6A 4Y13A 2VONA 4XLHA 1MJAA 2EH3A 4ZYEA 1AA7A 2M2EA 3OYNA 3OYAA 1F4KA 3GX4X 4OMZA 1UELB 3LA7A 2FF4A 2XPVA 3V4GA 3NARA 4UUSA 2NVXJ 2NVQJ 2BHZA 2EZKA 2DQLA 2X85A 1IG7A 1I39A 5IT3A 3COAC 2XGXA 2HOTA 2L9VA 2QGUA 1PDNC 4M3DA 3HRTA 4B43A 5DCMB 4HOBA 4HW0A 3C2GA 3ROUA 4LG0B 2TCTA 1OCPA 4Y4RA 3ZQLA 1USTA 3ZCOA 1OYWA 2PMZA 3E7LA 2KISA 5JVTA 3GMEA 4AYBA 2OCCH 4RB2C 3TMOA 1TLHB 3FDYA 3LOCA 1JKRC 5L3DA 5JFRA 2A6TA 2ACJA 1TT0A 1GVJA 3TOAA 1H9GA 1XGSA 1ZAOA 4FETA 4WWCA 1YG2A 2VKEA 1Y1VJ 3QODA 2BYVE 2W84A 5F08A 5E79C 3DTKA 3S15J 2Z33A 3BZCA 4WCGA 3E1SA 3G1OA 4B3XA 1NK3P 2O61A 3ZMTA 3J7AY 3JRGA 4NC6A 1OYYA 2DBBA 5LEJA 4KT6A 2L5QA 5D4SA 3HJEA 3NRVA 4E7IA 2QBYA 4WXCA 4HLXA 1D1AA 1R00A 2ZSHB 3AG4H 5EG0A 3WGHA 3I4NJ 2J5PA 4XSZF 1WFXA 3CUQA 3MZ8A 1J5YA 2CQQA 2JA7J 4YELA 3BWGA 3MCZA 1FWZA 1IN6A 4KDPA 1TWCJ 2K9QA 1HW2A 1VF9A 4W1UA 3E97A 3TO7A 2P4WA 5HLGA 2BOLA 3TO9A 1Z21A 4WX9A 1I27A 2NVUB 2VQCA 3SJMA 1MBEA 3QU6A 1T56A 4HF0A 2CUZA 4RGUA 4DOZA 1R4MB 4G6QA 4UB6C 3LQRA 3ASOH 1G59A 4A12A 3L2UA 3FXRA 3LAJA 2E36A 3D5SC 3FK6A 1ZKGA 2DPUA 1J7KA 1YOVB 1JUSA 4PZJA 1MBJA 4U88A 1OCOH 2Z1DA 3F8BA 3CDLA 2BVMA 3GYHX 1CGPA 3QPLA 2KKOA 1J09A 4CGZA 1ETOA 3PSFA 4HZFA 5IYBJ 1NH3A 5H6RA 3CESA 2DT6A 2Y0MA 2ZJPF 1L0OC 3HHGA 1IGNA 2K3FA 3HRSA 1UZCA 3CJNA 3KIOA 1GV2A 5DCFA 2BV6A 4I7HA 2LKSA 4Y7NJ 2VXDA 4G6TB 2V79A 1J9IA 3QOPA 1MD0A 3TP0A 1U5TB 2EK5A 1STZA 1YE9A 1V55H 1MKMA 2FBIA 5GTHC 1PUEE 3BZ6A 1F43A 3ULQB 2YPRA 5B1BH 3ZGKA 1SFXA 5DEQA 2JA2A 5H20A 2ZMEB 3K6GA 4EGZA 4AIKA 5CVRA 1O3SA 4BACA 1QZEA 1KU3A 1R49A 2H1KA 3LQQA 1JTYA 4ZDLA 3SDBA 5ICGA 2LC2A 3KEOA 3CF5F 1XN7A 1BW5A 1TL8A 5LGUA 3IH4A 4L9NA 1PP7U 1R36A 3TP3A 4XNFA 3PIOF 1JT6A 2EB7A 5E18F 2CFXA 4WF2A 2L7ZA 1WI9A 5LHHA 1R5ID 4XIDA 1KYZA 1A31A 1IN5A 2NOJB 5FB2A 3M8FA 3C18A 4A0ZA 1B8IA 5E20A 1IXRC 1TP4A 2Z2SB 1WJ5A 2LRDA 3HUGB 4JX5A 2NXNB 2R7QA 3KP2A 1WVRA 2M8GX 1OR7A 4WXDA 2A61A 3OYLA 2V9KA 3BJOA 3BQYA 2XGDA 2NOGA 1SMTA 3DLLF 1IRGA 2IPQX 2DI3A 2HYFA 5L3GA 4ZH4F 5FO5A 3BR5A 4JYKA 4RA2A 4DZJA 1Z0XA 2JSCA 3QPHA 3CC4I 2QSGX 3OWTA 1VNDA 4V2GA 2CV1A 1ZG5A 2UXNA 4KN4X 2VQGA 1R5GA 2VE8A 5K7ZA 5J1UA 3OYJA 3W3CA 1WGXA 4M9SA 3WHBA 4JBAA 3A01B 1XCVA 4MEXF 2DOAA 2PMUA 1V5GA 4BHCA 2ECCA 1K79A 2CW8A 5DCMA 2GZWA 2IAIA 4LG0A 3F0CA 3VODA 3DU6A 4DW6A 3NAUA 3EYIA 2L4AA 2VN2A 1MJ9A 1QHHD 1MH3A 5BPIA 1LFPA 1MNDA 3CQZJ 3JRBA 4C9YA 1ZRCA 4LK1F 3BJ6A 4M6VA 4UHTA 1QGPA 1O4XA 2K9LA 1X3UA 3O3KA 4CZZA 1Z05A 3TBIA 1DGRM 3DPUA 3I0TA 3G1LA 5J8CA 3DLAA 3WU1B 2NNNA 1W0UA 1FBQA 2R7RA 3HDDA 1Z7UA 1R5HA 1XGNA 4FHTA 2ZMEC 3H9GA 4ZDOA 3I4PA 2GA1A 5M5XJ 3OS1A 2O03A 3ZRGA 1WJDA 1S3JA 2L9NA 2GXGA 3OYEA 2WB1N 5HNFA 5BMZA 2P81A 4RGRA 2LMDA 4D5CA 3Q5FA 2E5NA 2WC2A 4HNUA 4XRSA 2WWYA 3ZPLA 1J0RA 1K61A 1V3FA 4GXOA 1OCZH 3HYIA 2EA4A 5E1XA 2KL4A 2O8XA 3G1MA 5ICCA 2WAQA 3ZMDA 4F55A 3EQLF 4G9YA 2HVRA 3VB2A 4BJ5C 1RNLA 1KZHA 2DPDA 2ICWG 1UMQA 5FKMA 5FJ8J 1Y6IA 2MLKA 3TOBA 3WTXC 3MVPA 2HQNA 5FD5A 3T0YA 4XLCA 3W6VA 3H9QA 3AL0B 1X1BA 1S6LA 3BTCA 3VSLA 5DM6F 3SDGA 1YHQI 3F8CA 1FYLA 3FXLA 4LFUA 5LD2C 4HLYA 3OL3A 4N0BA 5CVUA 3GTPJ 5AONA 2JK3A 5K5OA 2A3SA 3DF8A 3OYIA 2Z99A 2OTJI 3IKTA 3R0JA 2B9SA 4BYYA 3DPTA 5GAHJ 2QUFA 3VYSB 5L3CA 1RR7A 3ZQGA 2W7NA 2FUG2 2X1CA 4HEA2 1MMSA 1JKQC 2L7MP 4O6JA 3PM1A 4AD9A 2FQ4A 1BA5A 2DDAA 3BTIA 3GO5A 2R7WA 1VQPI 1U5TA 3FXUA 1W36D 4IHWA 2MH9A 5HLIA 2P5VA 2K9NA 1DPRA 3BZKA 3A0HC 2RC4A 2RN7A 1R6RA 2JPCA 1U6GA 2VIXA 3CCJI 2ZMEA 3CLQA 4HAMA 3CLOA 2IXSA 3VOEA 2ZJQF 1VTNC 4PFOA 4ZYDA 2XAFA 5CQEA 4IQ4A 1IC8A 1YS6A 1XCBA 1HW1A 3RPUD 3JW4A 4HQEA 3HHHA 4IRGA 4WK8F 3HSEA 5J6XA 2CJJA 2FE3A 3M8JA 4D9JA 4QLCU 5FKLA 2OUMA 1U8BA 2CW0F 3AFHA 3I3LA 2YUSA 1W0TA 5GAEJ 4PUSA 3FBIB 3WU0A 1RI7A 4IJAA 4A3FJ 1F1ZA 3MKWB 3H0DA 5E3LA 2X6OA 2CYYA 2ZNYA 4OIRF 3S3MA 2XSJC 2DFEA 3V8JA 4RM3A 2C6YA 4L18B 1D0XA 2JUCA 3LSIA 2E1CA 2DCEA 3HUGA 2DT7B 4L5IA 4RAFA 4ABZA 2Y9YA 3AKZA 4E7LA 3WHCA 2EFWA 3BR3A 3DTIA 3K4MA 4HNTA 1APLC 2R92J 4FTHA 3IV5A 5GP9A 4DQ2A 2NVYJ 3DCFA 2RREA 3I9V2 3PQJA 3C3WA 2RVCA 3IH3A 3OIQA 3Q0UA 1DDNA 1HCRA 3MD2A 3N05A 2IA2A 4M3FA 3KYCB 1OQYA 2KLOA 4YEJA 2K4JA 2W82A 4BY1J 3AL0C 1NG7A 3N4MA 4EJOA 2NVTJ 2ME6A 3A01A 2O9LA 4MNUA 2ID3A 4J00A 3PFIA 4ENMA 4KISA 2XIGA 3C2HA 2A5WA 2KP6A 2FOKA 2JVGA 1X3WB 2XF6A 1XSVA 1XPXA 2ZSIB 4A69C 4O5VA 1XS9A 2D1VA 1BJAA 4G7ZF 5JVGF 3NEUA 2IRFG 4LG3A 3DEEA 2R7UA 5ED4A 2Y9ZA 1Z3XA 3MAJA 2KZVA 2DYSH 4HQMA 5CVJA 4AIJA 2BE5F 2DA7A 3LWFA 2TDXA 3SEZA 1EH7A 3E3VA 1FTZA 3KP7A 2RNGA 2CRGA 2FMYA 3FM5A 3H0GJ 1ZK8A 5BQTA 3FMSA 4G12A 3SZTA 3KZYA 3TDUC 3PQKA 4DNCA 3O2PE 2QSFX 4XONA 5B1AH 4MLOA 2FBKA 2HXIA 3JREA 2G0EA 1IUYA 5F64A 3ZMZA 3HOUJ 2W48A 3HSRA 1MIJA 2OTLI 1G3SA 4E7KA 2M0MA 3BCAA 1ERDA 2M5WA 1Y1WJ 5D8LB 3DKYA 4OAYA 4UB8C 3OIPA 1ZGWA 1VQMI 1QO0D 4NDLA 2FSWA 2PMZN 2HDDA 3JSPA 4AYBN 1G2HA 2FU4A 4J01A 2IVMA 2Z16A 2X48A 1IN4A 3R61A 2I10A 2ZXWH 4NUBA 4FASD 4BUPA 2LY2A 4W97A 2H27A 1MDMB 1I1SA 4C3IJ 1A36A 1K78B 3ECHA 4QTRA 2EFOA 1K6OA 2XB5A 3VDXA 4PCQA 1TQMA 1BL0A 3ZN1A 2VJIA 2FA5A 3TGNA 3MWMA 4DBRA 3L1PA 3L2CA 2P0WA 3ECOA 3I53A 3OYBA 1GXPA 3GEZA 2LKXA 3FK7A 3F22A 4I6ZA 3A0BC 2HDCA 3S1NJ 2ZCWA 2IS2A 3DBLB 3OYDA 3DEUA 1WKMA 3OSGA 3T8TA 5C4JJ 2MH2A 3EUHA 4CUGA 2F5FA 1TW2A 4ENNA 5C4XJ 2H09A 3CD6I 1G6NA 3MZYA 2BY1A 3FXQA 4BEHB 1BR1A 4OINF 3NWTA 2DA4A 2V6CA 5J3LA 2H6CA 2LNBA 2HOSA 3LFKA 2ZXHA 3M3YJ 5HS9A 4HYEA 3CCQI 3FXKA 1ZYRF 3LNQA 1LDKB 1YYVA 4A3EJ 3RZDJ 3S2HJ 1FP2A 1YS7A 1JUMA 2OQGA 1TT5B 3WTYC 3OSFA 3I4MJ 3J80K 2AQFA 3H35A 3QYFA 3L7WA 3LSHA 1IZ1A 5BS6A 1VQKI 2M45A 3HOYJ 2L0KA 2K27A 2L4MA 4ENJA 4LK0F 3VYRB 4B44A 1H88C 5KAIC 1BI0A 2GLOA 4C3HJ 2M0CA 3F23A 4II3A 3I56I 3K1PA 1QNTA 3FXJA 1YITI 1RPWA 1LPQA 3G71I 3RZOJ 2JVHA 3DPLC 5ILUA 5AIPA 2E19A 2JRMA 2ZKZA 5KNLA 1IXCA 1LQ1A 3FX3A 4P1WA 1UCRA 1SMYF 2P6SA 3KLOA 3DU5A 1X1CA 5IOZA 2DOEA 3MKLA 2EIKH 2E5ZA 2DTZA 3NWSA 3X2QH 1YJ9I 2M34A 2DFFA 4GCVA 1YQAA 3GVAA 4Y33A 2AS5F 4ZDPA 1MMGA 1ODDA 1QQIA 1DU6A 4ON0A 4XLNF 4Z2YA 3I5UA 2XAGA 4QWQA 3G6EI 2KPMA 3LSKA 1R1UA 5CLSA 1BC8C 3TQNA 1KONA 3F6OA 2NS8A 2MD5A 2E1MC 2XPWA 4BKXA 3HOZJ 4A6DA 4F7ZA 3DFGA 2XAJA 4G6DA 2BXYA 1FC3A 2ESHA 3HZJA 4F91B 1CQTA 1E3HA 1SVLA 2R7DA 3W6KB 1LKXA 3JTGA 3WG7H 2V9VA 3OYMA 4M6XA 2ZB9A 1WWXA 1VQ5I 3PSIA 5JR3A 1T0FC 5HS8A 3B6CA 4BJ6C 1Z7LA 4Y52J 1X58A 2KFDA 2XDVA 2R7ZJ 2NS7A 4QPOA 1GVDA 2JRTA 4MTEA 2QWWA 4ESJA 2LK2A 2OC6A 3CZ6A 5L3BA 3BQZA 3IKVA 3LSGA 4S04A 4BJTA 2UWMA 1S7EA 1ZLKA 2O6GE 1TNTA 2W25A 5M3FJ 2WY7Q 1DUXC 3L2WA 2X6WA 3RKWA 4AIHA 5ILSA 3D1NI 1DP3A 4FCYA 4IZZA 2DJNA 1TQIA 3GCMA 4RMNA 2VPLA 2EIJH 2V7FA 1ZR2A 3OYGA 5C3EJ 1GHCA 1LUJB 2ISYA 2MW8A 2QYOA 5GPCA 4FX4A 1D5YA 3E6DA 2XRNA 1A6QA 2MC4A 4RGXA 4E70A 3ZQ7A 1W1WE 1JJ8C 3DQVC 2IS6A 2OAZA 1T33A 2H6BA 3CDIA 1FX7A 3HB9A 2EPFA 2RAEA 1MJBA 2DU9A 3WGIA 1YIOA 2A6EF 4RB3C 4MIMA 1U0JA 2KQRA 3BG7A 1W5TA 1X4PA 2W57A 2IT0A 3DKWA 1JUPA 4NQWA 1BC7C 5F0CA 3ZXSA 2EV6A 3K4KA 3FIWA 4XLEA 4JK1X 1ACIA 3WE3A 2W85A 3S17J 1F9NA 3FF5A 1FOKA 2STWA 2ELKA 2G7UA 1X1PA 4D0PA 3KFWX 2WAFA 2E2IJ 1HF0A 3ABTA 1MDMA 3LFUA 4XL9A 3CF2A 3GW2A 1Z77A 3RKQA 1K78A 3PJRA 3TEDA 1SEUA 1TWHJ 2KDOA 3IH2A 1FP1D 4BBSJ 4L9TA 1FPQA 1TBXA 3M1EA 2DYRH 4RAZA 1Z1DA 1LEBA 2DK8A 1IW7F 2IW5A 3BDDA 2VC0A 3MFKA 2E1OA 3CCSI 4I98B 3WTZA 3QRFF 1HC8A 1T39A 4R79A 3GFJA 3HOWJ 1JGGA 3J7AO 5FGMA 5E1WA 2XROA 4DJAA 1VFCA 4E6KG 3OYCA 4ASNA 2HGCA 3EDPA 4M3EA 5F04A 2F4MB 3E0JB 1ZLJA 2XPUA 5FD6A 4IHSA 4MFEA 4BQQA 3L2QA 2UV1A 2MGQA 4UY8I 1HLVA 3JSOA 4M74A 2WAQN 3H3VK 2YR2A 4ZZDA 2VB6A 4ESFA 4A5MA 1K83J 3G4SI 3ELKA 4ZYHA 1R58A 2CV0A 3VSKA 4BU2A 3CO6C 1RR8C 1P9QC 1YTYA 1K4SA 2DA2A 4NNJA 4A6EA 3I59B 5HS7A 3FBNB 1UG0A 4A3JJ 3O8GA 4BS9A 2VUMJ 4OAZA 3QQAA 1SVMA 2DTRA 2Q1ZB 5E8GA 2ID6A 1Y8QB 3IHUA 3BPVA 2V9PA 4RDUA 3JRIA 4A3IJ 2PJPA 1BW6A 2CGPA 4I76A 4N4OB 4Q48A 2EILH 2F4IA 3KYDB 1YX5A 1FBSA 4HRIA 2ECBA 2L9RA 4QSHA 1MSFC 1W36C 2GIZA 1I6XA 2HQAA 2XAQA 2QVOA 2FD5A 1I5ZA 1ZG3A 1X3ZB 3M07A 3ZMVA 4YFKF 2IS1A 1SD4A 4R8HA 1ETXA 2GQQA 3WTVC 1YW9A 4IKFA 2GWRA 4IPAA 3QAHA 1W5CC 2FOWA 4DYCA 2BY0A 1O3RA 3CP8A 3HKZA 5M5YJ 2P7VB 2UXXA 2WV0A 1D1BA 2PEXA 2JJ7A 4N9IA 3H5RA 1WI3A 2BHYA 2M4GA 4PJMA 4BL0B 2E35A 1DPUA 1SFOJ 1UB9A 1SFUA 1AWCA 2HU9A 3RPQA 2QM3A 3RIRA 5J47A 2W00A 2COMA 2ETHA 2F5CA 1RKWA 1SAXA 2V1DA 2OJED 1GV5A 2M30A 5FKOA 4CA0A 3HTSB 2H8WA 5EYRA 1VQLI 4C2TA 2XGEA 3B02A 3S2DJ 3QP6A 3GTLJ 3SHFA 3RQ4A 2VBYA 3E6MA 1RETA 1H9TA 2V26A 4DBQA 2K9SA 1YFHA 2I5UA 3FWEA 1TC3C 2JPBA 2JZYA 1W5SA 3BR6A 5JLXA 3CMAI 2OA4A 3BP8A 3TW7A 4DYRA 4B48A 2M4KA 2DA6A 4Q4ZF 2Z5UA 1JTXA 1FOWA 3PL8A 4LIUA 3ZQIA 4I09A 3ABLH 3GTQJ 2H8RA 5EZHA 1QHGA 4IOAF 2F5VA 3PO3J 1Y0UA 5BPDA 2F48A 5B66C 2D5VA 3PNYA 1ON2A 2RQQA 2VLAA 1HDPA 3EYYA 2UUZA 2EV5A 5K7FA 4AUXA 1E17A 3WTUC 1ZGJA 1E3PA 3T5XA 4CCNA 4EM2A 4II2A 2ELHA 1KU7A 3FISA 2IBDA 5IP7J 5JHUA 5FLXZ 5DM7F 4HDUA 5JLWA 1R4NB 1MBKA 1HSJA 2LR8A 2WTEA 5KVRA 1R71A 3IRRA 3L9FA 1FYKA 4M72A 5D5UB 2DODA 2ZNZA 4LITA 4OMYA 1JT0A 4A3LJ 2DA5A 4N4NB 4PJLA 2FMLA 2BZTA 3ZQCA 1MGTA 2XRLA 4IX7A 1XDSA 2VOOA 5CPRB 5CYVA 1K6YA 2DW4A 1O57A 3Q0WA 5B5EC 1XG1A 1D8JA 1OPCA 2I8DA 3OOUA 1PVEA 3V42A 1AOYA 3FKIJ 4IHVA 1B9NA 3BPXA 5ICFA 2DMQA 2AXLA 2QQ9A 4GFBA 2IGKA 3A03A 1U9OA 3PUFA 4O3MA 2V6EA 3IAS2 1HKQA 2O5RA 3DWLE 3DV8A 5CVVA 1JKPC 4M71A 2Y2ZA 4P9FA 4MGRA 2WADA 3EETA 1ON1A 3PIPF 3U1KA 1ZGAA 2IJLA 3K4LA 4XORA 3J81Z 3ERED 5F27A 2VT2A 4CSWA 3M7GA 3WODF 2M7BA 3P5JA 4U7BA 2EIMH 2OD5A 1BJZA 3Q9VA 2D2WA 4IVNA 3SQNA 2TRTA 5DTDA 3I54A 4XLFA 3I55I 3P7NA 3LSJA 1AU7A 2LH9A 3OV8A 1OMIA 3M9AA 1MNMC 4BGDA 2CUJA 2XB0X 2K3PA 2RV8A 4XN3A 2COBA 3IC7A 1R1TA 4HX4A 3RYRA 3K4BA 1MZBA 3MEXA 4HG2A 2CMPA 1BOBA 4HNVA 1S7AA 1JKOC 1ZN2A 3BR2A 3A4CA 1WJEA 2Q0OA 5DV5A 2HPMA 4FX0A 1HDDC 1SFKA 5E3MA 3F72A 1WH7A 4E4HA 3WGGA 2FNPA 4A3BJ 3BTJA 4GRIA 1A5JA 4RBOA 4I2OA 3I59A 2VODA 1LFUP 4ANJA 2R5YB 2PJRB 2VOPA 3HRMA 1SVOA 2BY2A 1BI2A 2W24A 3BG6A 1E0EA 1ZTRA 2CFOA 2NYXA 2F4OB 5EJCA 2FRHA 3SZPA 4X1EA 2PLYA 2Y69H 5D5VB 4KIGA 3KYLA 1Y56A 3JAMZ 3OIOA 4M3GA 5A2QZ 3K69A 3CTAA 3F8MA 1P92A 2CW7A 4MTDA 3BOQA 4Q47A 4A93J 3MKZA 4P55A 3MMYB 3D0SA 1RC9A 5EGOB 2NRAC 1I3AA 4LLNA 1TWAJ 3BROA 3A1YA 2FXAA 4ZTJA 3U1DA 5K7HA 4IRHA 3FMQA 4XOTA 1DQUA 4UUTA 5FFXA 1A04A 4BBRJ 3K10A 3H3UA 3KETA 1IV6A 4CXFA 3J7YJ 5F6FA 1UG2A 2QQAA 1E3OC 5J1RA 1IXSB 2MABA 4EM0B 4H0EA 4HX7A 1NTCA 1IDYA 4P5OA 3K1MA 1ZQ3P 4GO1A 2HNHA 2JN6A 2PBIA 1EKEA 1Z91A 2M87A 2RKHA 2K86A 4ZYGA 1T08B 4AVZA 3I71A 1Y0NA 1WH5A 2XSDC 2IEKA 1ETWA 1VQOI 1BIBA 3ZQQA 4I99C 2A68F 1USSA 2JMWA 2GBYA 3CJTB 4CCKA 3CDHA 3S8PA 2UZKA 3HPGA 1FIAA 5TGTA 4XKWA 2V1UA 3BR0A 1AKHB 2AO9A 1Z9CA 1GDTA 3MZHA 4GDFA 2M9HA 4IEJA 4EM1A 4GYIA 2XVCA 2VXZA 3S1RJ 5IP6A 4HPQA 3VPRA 1MH4A 4XKBA 4ZZLA 1RRJA 1ZHFA 1XGMA 2V1XA 4M9XA 1GLNA 5D5WB 4U0YA 1SD7A 5KAFC 4XOPA 4EJTA 5F1JA 5IT9Z 3DEWA 3GFMA 2OCEA 4A2UA 5B3SH 3WTTC 4BXFA 1U8RA 2GOXB 2L01A 1QPMA 2VE9A 6PAXA 1P4AA 2VKDA 1WPKA 5E3NA 2DMUA 2XKPA 5F1RA 4FQGA 2X51A 5J1YA 2IGMA 1IO2A 3BG5A 4HSTA 3MN2A 5D5XB 2KIQA 3HGGA 5ERIA 4EJWA 3BG9A 3F3XA 5LGNA 3ONQA 5M5WJ 3QYEA 4KJZA 4DIQA 2ME0A 2KJBA 5CKTA 2EINH 1YO5C 1QZYA 2E1NA 2M7AA 3GFLA 4BQNA 3ZQHA 4JP0A 1UAAA 3SEQA 1U78A 5FLXK 4YRVA 4OOIA 3CCEI 1LVKA 4PJ0C 5HLTA 3PNVA 4XN0A 2QEXI 4OIOF 3EUAA 1S72I 3WE2A 1ETKA 2HOEA 1REPC 1IV8A 2MBFA 4A0YA 4XM3A 2LBFB 2VJ4A 1S9HA 1Z6RA 2FBHA 1QVTA 3IWFA 1ZRDA 2EA2A 3WTSC 4I01A 1P7IA 4EGYA 1MBFA 2E1MB 2KHMA 2PX9A 4F93B 1S8NA 5DD8A 1U3EM 3GTKJ 3OMYA 5ILVA 3ML6A 3G73A 1UHWA 1N77A 1VQ8I 5EG0B 2YSRA 3S16J 1JGSA 4PJJA 3DBRB 4KMFA 4YFXF 4P96A 5DS9A 4RLFA 4U87A 2R93J 2DXIA 4Q5SF 3W2AA 3JTHA 2AQEA 4CCLA 3K4CA 3GFIA 2VQLA 2BW3B 2IP2A 3S1QJ 2L9SA 2O0YA 3SFIA 1MMDA 2MYSA 1XD7A 5K5QA 1IJWC 2MA3A 3S3OA 1I50J 3TW6A 4R1HA 2NNYA 2F5DA 3KCCA 2E7XA 2HTSA 1N25A 3W2VA 3J7ZI 3HTUA 4XSXF 3WG9A 4YIFA 3RTRA 4C2MJ 5IP9J 1ETVA 2LTPA 2NS0A 3SZGA 2OQRA 3HOSA 2R5YA 2EZHA 2PJRA 2X1EA 2M3AA 3UNGC 2HTJA 3EPZA 3RQIA 2LYCA 4NC8A 2Y30A 2L7FP 2R7SA 4N9HA 2KJCA 2JA6J 1E2XA 1BN5A 1OKRA 2VBXA 1S29A 4YIIA 3LL7A 3RI4A 1K7AA 3AAFA 1QA6A 1YJWI 3O8HA 1O7LA 3CO7C 3S93A 2KRCA 4X0GA 1XMXA 3RJPA 1EH8A 1TZLA 1U9NA 4XK4A 4XBFA 2LF7A 2EBIA 1JJ6C 4ZJZA 3JAMK 2WBMA 5EGOA 4G7HF 3KP4A 2DQRA 2PFBA 2HDWA 3OY9A 1X1DA 4F3QA 1S5LC 3AG1H 1HSTA 3ZMUA 1WJFA 2A05A 3KP3A 2XUBA 2CSOA 1ZELA 1W4MA 2F6CA 1EJ9A 1J2XA 4A5NA 2R7TA 2DK5A 1D0ZA 1FMVA 5EEAA 3QWLA 1IUFA 3UKGA 4D7MA 1JHHA 4QPQA 4P9UA 2DLLA 4OWRB 4KFCA 3R6SA 4LB5A 5EEGA 3HEFA 4M9ZA 2CWEA 2BEOA 4L0ZB 2R3SA 2JWTA 3TKYA 2X6XA 2GXBA 4EJVA 3H92A 3K0LA 4TV7A 3N97A 1XSXA 2MSYA 3OYFA 3RCOA 4V19K 3SYTA 1G3WA 5JHFA 3BCBA 3JCUC 4IOCF 2VI6A 5F0FA 1EF4A 3CUQC 3ESWB 3P9KA 1V4RA 1XTAA 4U0VA 2JA8J 3W6JB 4XQFA 3RDIA 1Z6TA 1AKHA 5K5RA 1WZ2A 5BNGA 3KPHA 1P4WA 1RUNA 4UNOA 3DTEA 1YX3A 1KGSA 1YW7A 3VWBA 5LLQA 1BI3A 2JUGA 3S32A 3QPSA 2DN0A 5L3FA 3HKZN 3BTLA 3OYHA 2QKMB 2JSPA 5LBQA 1T95A 4CYCB 3PFYA 1HA8A 1SD5A 2KIFA 3VEPA 4BXXJ 2MLGA 1IRFA 3HRUA 1XMAA 2OU2A 3K7AJ 4IHXA 4IF4A 2VPRA 4HF2A 2QA4I 1O7FA 4UVAA 3M4OJ 4YFNF 3B73A 5IT9K 4PFPA 1FSEA 3HOVJ 3ZOBA 1ETQA 2BXZA 1T98A 5LHGA 1T8IA 4CH7A 4XLAA 1TNSA 3AG3H 1PYVA 4KUMA 3CUOA 4LOCA 5DDGA 4E7ZA 3GTGJ 2NAZA 2Y0SA 2BBYA 3HPHA 4MQVA 3S1MJ 1WCMJ 3DKXA 4EEFG 1B1BA 4HBLA 3P9CA 3SXYA 2P6TA 2YU9J 3FXOA 4HF1A 1Y39A 4LB6B 2LBFA 3ZMSA 1HOMA 5E17F 1V5FA 2HEOA 3LA3A 3KP5A 4E7SA 1TTYA 4EQQA 1L3LA 1RIOH 1D3YA 4KMUX 2HXOA 1MSEC 3VFZA 1N78A 4NBQA 5E1ZB 1QZZA 2QENA 3QOEA 3GLLA 4B4CA 4IHYA 3H9JA 5FLMJ 5JI6A 1ORKA 3HXLA 4QIWN 1Z3YA 5CJ9A 1HKSA 1IN8A 4XRFA 4RM2A 4IQJA 2Q8KA 1MBHA 3K2ZA 5AIQA 4BAYA 3ZQFA 3CC2I 1LDDA 1S7OA 5HNHA 3MQ0A 2FJ1A 2LKPA 4ZTFA 4IHTA 1T0FA 2X0LA 5E8IA 2R7VA 4XLPF 2JQ7A 2K7LA 3C1DA 1MMNA 1UHSA 1QPIA 4D5FA 2YX4A 2GAUA 4EV0A 2KMUA 2CUEA 2D1HA 3E6BA 3IUOA 1VQ7I 2A69F 3CP2A 2BW3A 3R60A 4LJZF 2ADUA 4MEYF 3K70D 2LOOA 1PUFB 1ZR4A 4G7OF 1I1GA 4BEHA 3GXOA 1VQ6I 1OR7C 2ELJA 4KYWA 2E2JJ 3O6BB 3BJAA 2F2EA 1FJLA 2ZJ2A 1LNWA 2WAEA 1P2FA 2D45A 1OCRH 5LHIA 5EDNA 5H6QA 4XMYA 2VL8A 5C44J 2KT0A 4YIRX 1D8KA 1A6IA 2LDUA 2V4JC 2QLZA 4JX6A 5FRNA 2Z9OA 4HDVA 1FSHA 3MKYB 2GA2A 5IPAA 1LFBA 4UUVA 2R5ZB 4OIPF 4X6AJ 1BBYA 2HVSA 4B1RA 4I0BA 3TO6A 2QKLB 1R7JA 4EVIA 1YRNB 1HW5A 1H8AC 4CHUA 3P9IA 1KQ9A 3S3NA 2BVLA 1KA8A 2O7OA 4ENKA 2VBWA 3JR9A 1IF1A 3OL4A 2MFZA 4I02A 2K4BA 2RGVA 4DZPA 3T8RA 4S0HB 4KA4A 1VQ9I 3NQOA 1J75A 5CQGA 3L2RA 5KK1A 4MFDA 2BGCA 1BI1A 2VT3A 2KRFA 3LSTA 1YJNI 2VKVA 2E34A 2B0LA 3K9TA 5TISC 5CVIA 4HX8A 2M8EA 4B47A 3CCMI 1GUUA 2CQXA 3GWZA 4GGGA 1WSUA 4F52A 2ZFWA 2EFNA 3GTOJ 4FE4A 5LRSA 1P7JA 1UFMA 1HKTA 4A3DJ 1DU0A 2EFQA 3CCLI 1HXDA 4HSRA 1ZH5A 2P7CB 2EZIA 2P5KA 2GXAA 3A2KA 3HGYA 1OCTC 5GTIC 1B72B 2ZBKA 5J40A 1B59A 2HFHA 3T1BA 1PJRA 4IO9F 3RYPA 3KZZA 2BY3A 4LLGF 4AWXB 4GYGA 1Q1HA 4CZCA 5HODA 2W4SA 4A0XA 5GADJ 3KX2A 1GXQA 1SC7A 2O8KA 1SFEA 3C7JA 2K9MA 1OISA 1ITYA 5K1YA 2PMHA 4CYCA 2EV0A 1Y8RB 3OS2A 3H1CA 1EV7A 4J19A 3C2BA 2VJ5A 1OJLA 2HPIA 3KLNA 1FOXA 3V8KA 3OR2C 4EMSA 3JRDA 3OYKA 2CQ7A 1FEXA 1D1CA 5HLHA 1WJCA 1F36A 1R22A 1Z67A 2E60A 4G94A 5D4RA 3ZP5A 2L02A 3ZR8X 5TRDA 1ZREA 1OYIA 1OCCH 2FEZA 3L2VA 4XICA 1W7PB 1HQCA 3CCVI 5FLVA 4L0YB 4HA8A 4A3GJ 2CS3A 2XAHA 1T6SA 4XKCA 1SANA 4DYQA 1QU3A 2DA1A 1LVAA 1RKTA 3PNTA 2LD5A 5J8FA 3G3ZA 1QRYA 2QQBA 4IXAA 4E7HA 2MD0A 1YI2I 2A07F 2HQ5A 1JHFA 1OFCX 2W1OA 3HIFA 3WU2C 2P8TA 3F8NA 3CMMA 1U5TC 4M6YA 5FFZA 4PGGA 3IWZA 4BXUA 2YX7A 3RPUA 4B09A 2IGNA 4C30A 2CH0A 4NB5A 1XX5A 5BOXA 1D5VA 3FHZA 3D5RC 1IRXA 3PUBA 2XAUA 2OBPA 4RLQA 3L09A 2HWVA 3IL2A 1O3TA 4KN7X 1BM9A 5ICEA 2QQ8A 4I0AA 2DFHA 2DA3A 2ZC2A 1G4DA 3F6VA 2LG4A 2FQ3A 2YS9A 1QVUA 4HV5A 5J4VA 3F21A 2FX0A 4MQ9F 1LE8B 4XRSG 1UJ8A 1P4XA 1WHUA 1WJBA 1BR2A 2HOAA 4RB0A 5HDGA 2HI3A 1VI0A 4Y17A 3VYUB 4AVPA 4AU7A 4KITB 3ZN0A 5H2FC 4BE2A 4E7JA 4BQAA 4OU0A 2Y48A 3QPTA 3ERMA 2EWNA 3H36A 4BHPA 2K5CA 2R0QC 4LD5A 2WA0A 3WTWC 1XGOA 1A35A 3V8LA 4Z6YA 4H4KC 1PUFA 1N75A 4JOMA 2DT5A 4XKVA 3U21A 1X4OA 1H89C 1LE8A 2HYGD 5HDKA 5LGTA 4K2EA 2LLKA 3GZNB 1KYWA 1WQ2A 1GT0C 2MC3A 4FE7A 4ETSA 3V7SA 4BH9A 2VASA 2R4GA 3HG9A 2A5YB 1BOAA 4RGSA 3LSPA 1DGWY 3K1NA 4KIBA 4D7NA 3U9GA 2MG4A 2GM4A 1EH6A 3OR1C 3LA2A 2G7HA 1FIPA 3BT9A 3CJQB 2ZFUA 3GTJJ 2Z3YA 1T2KA 3HBLA 2DMPA 2R5ZA 3G2BA 3U2RA 5F0HA 3FMRA 5GAGJ 4A3MJ 2LY9A 1P6RA 4M73A 4PJNA 1XSDA 5D8KB 2J5OA 4OIQF 1YRNA 2VC1A 2ZJRF 2CQKA 4IRIA 3J80Z 4KICA 1H0MA 2PG4A 4XR6A 2CV2A 2QCOA 2VBZA 1QBJA 2L7KA 1BIAA 2F5EA 2Q2EB 3FZVA 4L5JA 1ONVA 2WV1A 4BE0A 2HKXA 4LLLA 1AHDP 2P5LC 3FHNA 2RQPA 1ZRFA 2LVSA 3QYBA 4C3JJ 3EUKL 3FM3A 3UR3C 1ENHA 1RZ4A 3H5NA 1ZG1A 3CMEI 1JXSA 5EZGA 2GOMA 2CO5A 3GLXA 3V7RA 2YU3A 2XASA 1BR4A 1ULYA 2DJIA 4CCOA 1KU2A 4DGWB 4RS8A 4UVBA 1C0WA 2HR3A 3IP4B 1VQ4I 4RAYA 2B7EA 1SAUA 1UHMA 2VKHA 4CICA 1XDUA 5D6EA 3JRFA 3HOTA 3H5AA 2K02A 1PP8F 1T38A 3LSMA 3GTMJ 5LRRA 2VQHA 1FMWA 2PI0A 2EJRA 1B6AA 3LAPA 3BC8A 5DUIA 3JRHA 1CF7B 1B72A 4A3KJ 2HZDA 2KIUA 1KQ0A 2R7XA 2EQRA 2ZXIA 2AXTC 4L9JA 3R0AA 1FNNA 4L9VA 4A3CJ 3RKYA 3QP5A 3CCUI 2H94A 1LB2A 4C2UA 3LMMA 3M1CA 2LP0A 5FKNA 2HQRA 1WRJA 2DAOA 2LFBA 1LJ9A 5FKKA 5GPAA 1FOYA 2DDBA 1I3QJ 2JA5J 3QU3A 4U7DA 1X19A 3E5XA 5IYDJ 4BDZA 3Q9SA 4JQFA 4KT5C 4MO7A 4F92B 1LDJA 1X2MA 1XC5A 2E7WA 1F5TA 3R4KA 1B9MA 1MNEA 1NK2P 3K4NA 4LIVA 4YG2F 4UUSB 1V54H 2ESNA 4UV8A 2VJJA 5E3OA 2Y75A 3S2WA 3E5UA 3BR1A 4ZC3A 1M1EB 2G9WA 2WB1A 1G8XA 5TJJA 4CO8A 3KZIC 5IOYA 2DMNA 1VZ0A 2OV7A 3BLYA 1W7PA 3GZ5A 4PGHA 5IYCJ 1FTTA 2EFPA 2KZGA 2M1BA 3L00A 4JX4A 3GUDA 5EEHA 2XF5A 2WY8Q 1G3YA 2DO7A 1NG6A 3SFZA 4PDKA 2CG4A 1FT9A 3CJRB 3EUHC 4Y15A 2JTVA 1IN7A 3IAM2 5IY5H 1FZPB 3TL4X 1KQ8A 3KE2A 4UXNA 2CU7A 2OPTA 1B4AA 5DUKA 4KIFA 4FT8A 3VYTB 3S14J 3RSNA 2V1NA 4UV9A 1U2WA 5KHDA 3PO2J 4S05A 4BE1A 3JRAA 2H1LA 3H3ZA 4BDYA 2RNJA 2K85A 2QF7A 1R9TJ 2Y31A 4EJUA 1HBXG 2B63J 3ABMH 4PSXA 4LGWA 2LF8A 2ZO4A 3Q3SA 4V2FA 1FBUA 1D0YA 5L3EA 2E2HJ 2X1DA
chains in the Genus database with same CATH topology
2JT1A 2QBYB 2OZUA 2HKOA 5LEKA 3BY6A 2OZ6A 2LSOA 3CUQB 1YLFA 1XMKA 2PQ8A 2XV4S 5DD4A 3J81K 4ESBA 3OOPA 3V7CA 3RKXA 4WXHA 1JE8A 3ISPA 3GF2A 2FNAA 3D5LA 4HV6A 1O3QA 3E6CC 1R1VA 4NHJA 4U0WA 1FYMA 4CDGA 2PN6A 2DFIA 1LEAA 2HS5A 2IA0A 2ISZA 1W7PD 2ZXJA 4B8XA 4LMYA 3ABUA 1TQPA 4MHGA 2RDPA 2QZ8A 1ZARA 2A6HF 2Q2EA 3IRQA 3I64A 5HVQC 3I58A 1SD6A 4G8XA 1XB4A 4CYDA 2HZTA 4KNYA 5A2QK 4RB1A 5DYMA 1KU9A 2O3FA 3GZ6A 3TDZC 1FLIA 3KEQA 4UVCA 1IAWA 2GIVA 1YW8A 5HOOA 3F8FA 2X4HA 1FY7A 1G3TA 1J59A 2L54A 2KIMA 1R23A 2R7FA 3DXJF 4BHBA 1RUOA 1CF7A 2IA1A 2XHKA 2XKOA 1TW3A 3E5QA 3M8EA 3REOA 3DP7A 5D6FA 2L3DA 1DP7P 2STTA 3HSFA 4BNCA 1NHAA 3KP6A 5HDNA 4Y13A 2VONA 1MJAA 4ZYEA 1F4KA 3GX4X 4OMZA 3LA7A 2FF4A 3V4GA 2DQLA 5IT3A 3COAC 2XGXA 1PDNC 3HRTA 5DCMB 4HOBA 4HW0A 3ROUA 4LG0B 1USTA 1OYWA 5JVTA 4RB2C 1TLHB 5L3DA 5JFRA 2ACJA 1GVJA 3TOAA 1H9GA 1XGSA 1ZAOA 4WWCA 1YG2A 2BYVE 2W84A 2Z33A 4WCGA 2O61A 3ZMTA 1OYYA 2DBBA 5LEJA 5D4SA 3NRVA 2QBYA 4WXCA 4HLXA 1R00A 3WGHA 2J5PA 4XSZF 3CUQA 1J5YA 3BWGA 3MCZA 1FWZA 1IN6A 4KDPA 1HW2A 3E97A 3TO7A 2P4WA 5HLGA 3TO9A 4WX9A 1I27A 3QU6A 4HF0A 4RGUA 4G6QA 3LQRA 4A12A 3LAJA 3FXRA 2DPUA 1J7KA 4PZJA 4U88A 3F8BA 3GYHX 1CGPA 2KKOA 4CGZA 4HZFA 5H6RA 2Y0MA 1L0OC 3HHGA 3HRSA 3CJNA 5DCFA 2BV6A 4I7HA 2V79A 1J9IA 3QOPA 1MD0A 1U5TB 2EK5A 1STZA 1MKMA 2FBIA 1PUEE 3BZ6A 3ULQB 2YPRA 1SFXA 5DEQA 5H20A 2ZMEB 4EGZA 4AIKA 5CVRA 1O3SA 1KU3A 3LQQA 5ICGA 3KEOA 1XN7A 5LGUA 4L9NA 1PP7U 1R36A 2EB7A 5E18F 2CFXA 4WF2A 1WI9A 5LHHA 1KYZA 1IN5A 5FB2A 3M8FA 3C18A 4A0ZA 5E20A 1IXRC 3KP2A 1OR7A 4WXDA 2A61A 3BJOA 1SMTA 1IRGA 2IPQX 2DI3A 2HYFA 5L3GA 4ZH4F 5FO5A 2JSCA 3QPHA 1ZG5A 2UXNA 4KN4X 1R5GA 2VE8A 4M9SA 4JBAA 1XCVA 4MEXF 2PMUA 4BHCA 1K79A 5DCMA 2GZWA 4LG0A 3VODA 3EYIA 2L4AA 2VN2A 1MJ9A 5BPIA 1ZRCA 4LK1F 3BJ6A 4UHTA 1QGPA 1X3UA 3O3KA 4CZZA 1Z05A 3I0TA 5J8CA 3WU1B 2NNNA 1FBQA 1Z7UA 1R5HA 1XGNA 4FHTA 3I4PA 2GA1A 2O03A 1S3JA 2GXGA 5BMZA 4RGRA 3Q5FA 2WC2A 2WWYA 3ZPLA 1J0RA 1V3FA 4GXOA 3HYIA 2EA4A 5E1XA 2O8XA 5ICCA 3ZMDA 3EQLF 4G9YA 3VB2A 1RNLA 2DPDA 2MLKA 3TOBA 3WTXC 2HQNA 5FD5A 3T0YA 1S6LA 3F8CA 1FYLA 4LFUA 4HLYA 4N0BA 5CVUA 5AONA 5K5OA 2A3SA 3DF8A 2Z99A 3IKTA 3R0JA 4BYYA 3DPTA 2QUFA 5L3CA 4O6JA 4AD9A 3GO5A 1U5TA 3FXUA 2MH9A 5HLIA 2P5VA 1DPRA 2RC4A 2RN7A 2JPCA 1U6GA 2ZMEA 4HAMA 3CLOA 3VOEA 1VTNC 4ZYDA 2XAFA 1YS6A 1XCBA 1HW1A 4HQEA 3JW4A 3HHHA 4IRGA 4WK8F 3HSEA 5J6XA 2FE3A 4QLCU 2CW0F 3WU0A 1RI7A 4IJAA 1F1ZA 2CYYA 2ZNYA 4OIRF 3V8JA 2C6YA 4L18B 2E1CA 3HUGA 4L5IA 2EFWA 4DQ2A 3PQJA 3C3WA 2RVCA 1DDNA 2IA2A 2K4JA 3N4MA 4EJOA 4MNUA 4ENMA 3PFIA 2XIGA 2FOKA 1XSVA 4O5VA 2D1VA 1BJAA 4G7ZF 3NEUA 2IRFG 5ED4A 3MAJA 4HQMA 5CVJA 4AIJA 2BE5F 3LWFA 2TDXA 1EH7A 3E3VA 3KP7A 3FM5A 2FMYA 5BQTA 3FMSA 3SZTA 3KZYA 3TDUC 3PQKA 4DNCA 3O2PE 2FBKA 1IUYA 5F64A 3ZMZA 3HSRA 1G3SA 2M5WA 5D8LB 1QO0D 2FSWA 3JSPA 2FU4A 2IVMA 1IN4A 3R61A 2H27A 1MDMB 1I1SA 1K78B 3ECHA 2EFOA 1K6OA 4PCQA 1TQMA 3ZN1A 2FA5A 3TGNA 3MWMA 3L2CA 3ECOA 3I53A 1GXPA 3GEZA 3F22A 2HDCA 2ZCWA 3DEUA 1WKMA 3T8TA 2MH2A 3EUHA 2F5FA 1TW2A 4ENNA 2H09A 1G6NA 3MZYA 3FXQA 4OINF 2V6CA 2H6CA 2LNBA 3LFKA 5HS9A 4HYEA 1ZYRF 1LDKB 1YYVA 1FP2A 1YS7A 2OQGA 3WTYC 3J80K 3L7WA 1IZ1A 5BS6A 2M45A 2K27A 2L4MA 4ENJA 4LK0F 1BI0A 3F23A 3K1PA 1QNTA 3DPLC 5ILUA 5AIPA 2ZKZA 1IXCA 1LQ1A 3FX3A 1UCRA 1SMYF 2P6SA 3KLOA 4GCVA 1YQAA 3GVAA 2AS5F 1QQIA 1ODDA 4ON0A 4XLNF 4Z2YA 3I5UA 2XAGA 4QWQA 5CLSA 1R1UA 1BC8C 3TQNA 3F6OA 2MD5A 4A6DA 4F7ZA 3DFGA 2XAJA 4G6DA 1FC3A 2ESHA 2R7DA 3W6KB 3JTGA 2V9VA 4M6XA 1WWXA 5JR3A 5HS8A 2JRTA 4MTEA 2QWWA 4ESJA 5L3BA 3IKVA 4S04A 2UWMA 1ZLKA 2O6GE 1TNTA 2W25A 1DUXC 3RKWA 4AIHA 5ILSA 1TQIA 1GHCA 2ISYA 2QYOA 4FX4A 3E6DA 2XRNA 4RGXA 4E70A 3ZQ7A 3DQVC 2OAZA 2H6BA 1FX7A 1MJBA 2DU9A 3WGIA 1YIOA 2A6EF 4RB3C 1W5TA 2W57A 2IT0A 3DKWA 1BC7C 4NQWA 2EV6A 4JK1X 3WE3A 2W85A 1F9NA 3FF5A 1FOKA 2STWA 2G7UA 4D0PA 3KFWX 3ABTA 1MDMA 3GW2A 1K78A 1FP1D 4L9TA 1FPQA 1TBXA 3M1EA 4RAZA 1Z1DA 1LEBA 2DK8A 1IW7F 2IW5A 3BDDA 2VC0A 3MFKA 4I98B 3WTZA 3QRFF 1T39A 4R79A 3GFJA 3J7AO 5FGMA 5E1WA 2XROA 4ASNA 2HGCA 3EDPA 5FD6A 1ZLJA 4IHSA 3JSOA 4M74A 2YR2A 4ZZDA 4ESFA 4A5MA 3ELKA 4ZYHA 1R58A 3CO6C 1YTYA 4A6EA 3I59B 5HS7A 2DTRA 5E8GA 3IHUA 2PJPA 3BPVA 2CGPA 4Q48A 1FBSA 1I6XA 2XAQA 2QVOA 1I5ZA 1ZG3A 3ZMVA 4YFKF 1SD4A 4R8HA 2GQQA 3WTVC 1YW9A 2GWRA 4IPAA 3QAHA 1O3RA 2P7VB 2UXXA 2WV0A 2PEXA 4N9IA 1DPUA 1UB9A 1SFUA 1AWCA 3RPQA 2QM3A 3RIRA 2COMA 2ETHA 2F5CA 1SAXA 2V1DA 2M30A 3HTSB 3B02A 3QP6A 3SHFA 2VBYA 3E6MA 1H9TA 1YFHA 3FWEA 2JPBA 2JZYA 1W5SA 2OA4A 3BP8A 4Q4ZF 2Z5UA 4I09A 1Y0UA 5BPDA 1ON2A 3EYYA 2EV5A 1E17A 3WTUC 1ZGJA 3T5XA 4EM2A 2ELHA 1KU7A 5JHUA 5FLXZ 4HDUA 1HSJA 2WTEA 5KVRA 3IRRA 3L9FA 1FYKA 4M72A 5D5UB 2ZNZA 4OMYA 2FMLA 1MGTA 1XDSA 2VOOA 5CYVA 2DW4A 1O57A 1D8JA 1OPCA 1AOYA 1B9NA 3BPXA 5ICFA 2AXLA 2QQ9A 4O3MA 1HKQA 3DV8A 5CVVA 4M71A 4P9FA 4MGRA 3EETA 1ON1A 1ZGAA 2IJLA 3J81Z 3ERED 2VT2A 3M7GA 3WODF 4U7BA 2OD5A 3Q9VA 2D2WA 4IVNA 3SQNA 3I54A 3P7NA 3OV8A 1OMIA 3M9AA 2RV8A 3IC7A 1R1TA 4HX4A 3RYRA 1MZBA 3MEXA 1S7AA 1ZN2A 2Q0OA 5DV5A 4FX0A 3F72A 3WGGA 2FNPA 4I2OA 3I59A 2VODA 2VOPA 3HRMA 1BI2A 2W24A 2NYXA 2FRHA 3SZPA 2PLYA 5D5VB 4KIGA 3JAMZ 5A2QZ 3K69A 3CTAA 3F8MA 1P92A 4MTDA 3BOQA 4Q47A 4P55A 3D0SA 2NRAC 4LLNA 3BROA 2FXAA 3U1DA 4IRHA 3FMQA 5FFXA 1A04A 3H3UA 3KETA 4CXFA 5F6FA 2QQAA 1IXSB 4EM0B 4H0EA 4HX7A 4P5OA 3K1MA 4GO1A 2PBIA 1Z91A 2M87A 2RKHA 2K86A 4ZYGA 3I71A 1BIBA 2A68F 1USSA 3CDHA 2UZKA 2V1UA 1Z9CA 3MZHA 4EM1A 4GYIA 2XVCA 2VXZA 4ZZLA 1ZHFA 1XGMA 2V1XA 4M9XA 5D5WB 4U0YA 1SD7A 4EJTA 5IT9Z 3GFMA 4A2UA 3WTTC 1U8RA 2L01A 1QPMA 2VE9A 6PAXA 1P4AA 2XKPA 5F1RA 5D5XB 5ERIA 4EJWA 3F3XA 5LGNA 2KJBA 1YO5C 1QZYA 2E1NA 3GFLA 1U78A 5FLXK 4OOIA 4OIOF 3WE2A 2HOEA 1REPC 2MBFA 4A0YA 1Z6RA 2FBHA 3IWFA 1ZRDA 2EA2A 3WTSC 4I01A 4EGYA 1S8NA 5DD8A 1U3EM 5ILVA 3ML6A 3G73A 1UHWA 2YSRA 1JGSA 4KMFA 4YFXF 4P96A 4Q5SF 3JTHA 3GFIA 2IP2A 2O0YA 1XD7A 5K5QA 2MA3A 4R1HA 2NNYA 2F5DA 3KCCA 2E7XA 2HTSA 3HTUA 4XSXF 3WG9A 4YIFA 3RTRA 2NS0A 3HOSA 2OQRA 2HTJA 4N9HA 2KJCA 1E2XA 1BN5A 1OKRA 2VBXA 1S29A 4YIIA 3RI4A 1K7AA 3AAFA 1O7LA 3CO7C 3RJPA 1EH8A 4XBFA 2LF7A 3JAMK 4G7HF 3KP4A 2DQRA 2PFBA 1HSTA 3ZMUA 3KP3A 2XUBA 2CSOA 1W4MA 1J2XA 4A5NA 2DK5A 1JHHA 4P9UA 2DLLA 4LB5A 4KFCA 3R6SA 5EEGA 4M9ZA 2CWEA 2BEOA 4L0ZB 2R3SA 3TKYA 2GXBA 4EJVA 3H92A 3K0LA 4TV7A 3N97A 1XSXA 1G3WA 3CUQC 3P9KA 1V4RA 4U0VA 3W6JB 3RDIA 1Z6TA 5K5RA 4UNOA 1P4WA 1RUNA 1KGSA 1YW7A 5LLQA 1BI3A 5L3FA 5LBQA 1SD5A 2KIFA 3VEPA 2MLGA 1IRFA 3HRUA 1XMAA 2OU2A 4IF4A 4HF2A 1O7FA 4UVAA 4YFNF 3B73A 5IT9K 1FSEA 1T98A 5LHGA 1TNSA 4KUMA 3CUOA 5DDGA 2NAZA 2BBYA 4MQVA 1B1BA 4HBLA 3P9CA 3SXYA 2P6TA 4HF1A 4LB6B 3ZMSA 5E17F 2HEOA 3LA3A 3KP5A 1TTYA 4EQQA 1L3LA 1RIOH 1D3YA 4KMUX 3VFZA 5E1ZB 1QZZA 2QENA 5JI6A 5CJ9A 1HKSA 1IN8A 4XRFA 2Q8KA 3K2ZA 5AIQA 4BAYA 1LDDA 1S7OA 3MQ0A 2LKPA 4IHTA 1T0FA 2X0LA 5E8IA 4XLPF 2K7LA 3C1DA 2YX4A 2GAUA 4EV0A 2D1HA 3E6BA 2A69F 3R60A 4LJZF 2ADUA 4MEYF 4G7OF 1I1GA 3GXOA 4KYWA 3O6BB 3BJAA 2F2EA 2ZJ2A 1LNWA 1P2FA 2D45A 5LHIA 5H6QA 1D8KA 2LDUA 2QLZA 2Z9OA 4HDVA 1FSHA 2GA2A 4UUVA 4OIPF 1BBYA 4I0BA 3TO6A 1R7JA 4EVIA 1HW5A 4CHUA 3P9IA 1KQ9A 1KA8A 4ENKA 2VBWA 1IF1A 4I02A 2K4BA 2RGVA 3T8RA 4KA4A 3NQOA 1J75A 5KK1A 2BGCA 1BI1A 2VT3A 2KRFA 3LSTA 2B0LA 3K9TA 5CVIA 4HX8A 2M8EA 3GWZA 4GGGA 1WSUA 2ZFWA 2EFNA 5LRSA 1UFMA 1HKTA 2EFQA 1HXDA 1ZH5A 2P7CB 2P5KA 2ZBKA 1B59A 2HFHA 3T1BA 3RYPA 3KZZA 4LLGF 4AWXB 4GYGA 1Q1HA 4A0XA 1GXQA 1SFEA 3C7JA 5K1YA 2PMHA 2EV0A 1EV7A 3KLNA 3V8KA 4EMSA 5HLHA 1R22A 3ZP5A 1ZREA 4G94A 5D4RA 5TRDA 2L02A 1OYIA 2FEZA 1W7PB 1HQCA 4L0YB 4HA8A 2XAHA 1T6SA 1LVAA 5J8FA 3G3ZA 2QQBA 4IXAA 2A07F 1JHFA 3HIFA 2P8TA 3F8NA 5FFZA 1U5TC 4M6YA 4PGGA 3IWZA 4BXUA 2YX7A 3RPUA 4B09A 4NB5A 5BOXA 1D5VA 3FHZA 2OBPA 3L09A 2HWVA 3IL2A 1O3TA 4KN7X 1BM9A 5ICEA 4I0AA 1G4DA 3F6VA 2FQ3A 4HV5A 3F21A 4MQ9F 1P4XA 4RB0A 5HDGA 4Y17A 4AVPA 3ZN0A 4BQAA 4OU0A 2Y48A 3QPTA 2EWNA 4BHPA 4LD5A 3WTWC 1XGOA 3V8LA 2DT5A 2HYGD 5HDKA 5LGTA 4K2EA 1KYWA 1WQ2A 2MC3A 4ETSA 3V7SA 4BH9A 2A5YB 1BOAA 4RGSA 3K1NA 4KIBA 3U9GA 1EH6A 3LA2A 2G7HA 2Z3YA 1T2KA 3U2RA 3FMRA 1P6RA 4M73A 1XSDA 5D8KB 2J5OA 4OIQF 2VC1A 2CQKA 4IRIA 3J80Z 4KICA 1H0MA 2PG4A 1QBJA 2VBZA 1BIAA 2F5EA 3FZVA 4L5JA 1ONVA 2HKXA 4LLLA 2P5LC 2RQPA 1ZRFA 3FM3A 1RZ4A 1ZG1A 1JXSA 2CO5A 3GLXA 3V7RA 2YU3A 2XASA 1ULYA 1KU2A 4RS8A 4UVBA 1C0WA 2HR3A 4CICA 4RAYA 1UHMA 1XDUA 5D6EA 3HOTA 2K02A 1PP8F 1T38A 5LRRA 2PI0A 2EJRA 1B6AA 3LAPA 5DUIA 1CF7B 2KIUA 1KQ0A 4L9JA 3R0AA 1FNNA 4L9VA 3RKYA 3QP5A 1LB2A 2H94A 2HQRA 1WRJA 2DAOA 1LJ9A 4U7DA 3QU3A 3E5XA 3Q9SA 4JQFA 4KT5C 1LDJA 2E7WA 1F5TA 3R4KA 1B9MA 4YG2F 2ESNA 4UV8A 2Y75A 3S2WA 3E5UA 2G9WA 5TJJA 4CO8A 1W7PA 3GZ5A 4PGHA 2EFPA 2M1BA 3L00A 3GUDA 5EEHA 1G3YA 2DO7A 3SFZA 4PDKA 2CG4A 1FT9A 4Y15A 2JTVA 1IN7A 1FZPB 1KQ8A 3KE2A 4UXNA 1B4AA 5DUKA 4KIFA 4FT8A 4UV9A 1U2WA 4S05A 3H3ZA 2RNJA 4EJUA 1HBXG 4LGWA 2LF8A 2ZO4A 1FBUA 5L3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT1 A;  2QBY B;  2OZU A;  2HKO A;  5LEK A;  3BY6 A;  2OZ6 A;  2LSO A;  3CUQ B;  1YLF A;  1XMK A;  2PQ8 A;  2XV4 S;  5DD4 A;  3J81 K;  4ESB A;  3OOP A;  3V7C A;  3RKX A;  4WXH A;  1JE8 A;  3ISP A;  3GF2 A;  2FNA A;  3D5L A;  4HV6 A;  1O3Q A;  3E6C C;  1R1V A;  4NHJ A;  4U0W A;  1FYM A;  4CDG A;  2PN6 A;  2DFI A;  1LEA A;  2HS5 A;  2IA0 A;  2ISZ A;  1W7P D;  2ZXJ A;  4B8X A;  4LMY A;  3ABU A;  1TQP A;  4MHG A;  2RDP A;  2QZ8 A;  1ZAR A;  2A6H F;  2Q2E A;  3IRQ A;  3I64 A;  5HVQ C;  3I58 A;  1SD6 A;  4G8X A;  1XB4 A;  4CYD A;  2HZT A;  4KNY A;  5A2Q K;  4RB1 A;  5DYM A;  1KU9 A;  2O3F A;  3GZ6 A;  3TDZ C;  1FLI A;  3KEQ A;  4UVC A;  1IAW A;  2GIV A;  1YW8 A;  5HOO A;  3F8F A;  2X4H A;  1FY7 A;  1G3T A;  1J59 A;  2L54 A;  2KIM A;  1R23 A;  2R7F A;  3DXJ F;  4BHB A;  1RUO A;  1CF7 A;  2IA1 A;  2XHK A;  2XKO A;  1TW3 A;  3E5Q A;  3M8E A;  3REO A;  3DP7 A;  5D6F A;  2L3D A;  1DP7 P;  2STT A;  3HSF A;  4BNC A;  1NHA A;  3KP6 A;  5HDN A;  4Y13 A;  2VON A;  1MJA A;  4ZYE A;  1F4K A;  3GX4 X;  4OMZ A;  3LA7 A;  2FF4 A;  3V4G A;  2DQL A;  5IT3 A;  3COA C;  2XGX A;  1PDN C;  3HRT A;  5DCM B;  4HOB A;  4HW0 A;  3ROU A;  4LG0 B;  1UST A;  1OYW A;  5JVT A;  4RB2 C;  1TLH B;  5L3D A;  5JFR A;  2ACJ A;  1GVJ A;  3TOA A;  1H9G A;  1XGS A;  1ZAO A;  4WWC A;  1YG2 A;  2BYV E;  2W84 A;  2Z33 A;  4WCG A;  2O61 A;  3ZMT A;  1OYY A;  2DBB A;  5LEJ A;  5D4S A;  3NRV A;  2QBY A;  4WXC A;  4HLX A;  1R00 A;  3WGH A;  2J5P A;  4XSZ F;  3CUQ A;  1J5Y A;  3BWG A;  3MCZ A;  1FWZ A;  1IN6 A;  4KDP A;  1HW2 A;  3E97 A;  3TO7 A;  2P4W A;  5HLG A;  3TO9 A;  4WX9 A;  1I27 A;  3QU6 A;  4HF0 A;  4RGU A;  4G6Q A;  3LQR A;  4A12 A;  3LAJ A;  3FXR A;  2DPU A;  1J7K A;  4PZJ A;  4U88 A;  3F8B A;  3GYH X;  1CGP A;  2KKO A;  4CGZ A;  4HZF A;  5H6R A;  2Y0M A;  1L0O C;  3HHG A;  3HRS A;  3CJN A;  5DCF A;  2BV6 A;  4I7H A;  2V79 A;  1J9I A;  3QOP A;  1MD0 A;  1U5T B;  2EK5 A;  1STZ A;  1MKM A;  2FBI A;  1PUE E;  3BZ6 A;  3ULQ B;  2YPR A;  1SFX A;  5DEQ A;  5H20 A;  2ZME B;  4EGZ A;  4AIK A;  5CVR A;  1O3S A;  1KU3 A;  3LQQ A;  5ICG A;  3KEO A;  1XN7 A;  5LGU A;  4L9N A;  1PP7 U;  1R36 A;  2EB7 A;  5E18 F;  2CFX A;  4WF2 A;  1WI9 A;  5LHH A;  1KYZ A;  1IN5 A;  5FB2 A;  3M8F A;  3C18 A;  4A0Z A;  5E20 A;  1IXR C;  3KP2 A;  1OR7 A;  4WXD A;  2A61 A;  3BJO A;  1SMT A;  1IRG A;  2IPQ X;  2DI3 A;  2HYF A;  5L3G A;  4ZH4 F;  5FO5 A;  2JSC A;  3QPH A;  1ZG5 A;  2UXN A;  4KN4 X;  1R5G A;  2VE8 A;  4M9S A;  4JBA A;  1XCV A;  4MEX F;  2PMU A;  4BHC A;  1K79 A;  5DCM A;  2GZW A;  4LG0 A;  3VOD A;  3EYI A;  2L4A A;  2VN2 A;  1MJ9 A;  5BPI A;  1ZRC A;  4LK1 F;  3BJ6 A;  4UHT A;  1QGP A;  1X3U A;  3O3K A;  4CZZ A;  1Z05 A;  3I0T A;  5J8C A;  3WU1 B;  2NNN A;  1FBQ A;  1Z7U A;  1R5H A;  1XGN A;  4FHT A;  3I4P A;  2GA1 A;  2O03 A;  1S3J A;  2GXG A;  5BMZ A;  4RGR A;  3Q5F A;  2WC2 A;  2WWY A;  3ZPL A;  1J0R A;  1V3F A;  4GXO A;  3HYI A;  2EA4 A;  5E1X A;  2O8X A;  5ICC A;  3ZMD A;  3EQL F;  4G9Y A;  3VB2 A;  1RNL A;  2DPD A;  2MLK A;  3TOB A;  3WTX C;  2HQN A;  5FD5 A;  3T0Y A;  1S6L A;  3F8C A;  1FYL A;  4LFU A;  4HLY A;  4N0B A;  5CVU A;  5AON A;  5K5O A;  2A3S A;  3DF8 A;  2Z99 A;  3IKT A;  3R0J A;  4BYY A;  3DPT A;  2QUF A;  5L3C A;  4O6J A;  4AD9 A;  3GO5 A;  1U5T A;  3FXU A;  2MH9 A;  5HLI A;  2P5V A;  1DPR A;  2RC4 A;  2RN7 A;  2JPC A;  1U6G A;  2ZME A;  4HAM A;  3CLO A;  3VOE A;  1VTN C;  4ZYD A;  2XAF A;  1YS6 A;  1XCB A;  1HW1 A;  4HQE A;  3JW4 A;  3HHH A;  4IRG A;  4WK8 F;  3HSE A;  5J6X A;  2FE3 A;  4QLC U;  2CW0 F;  3WU0 A;  1RI7 A;  4IJA A;  1F1Z A;  2CYY A;  2ZNY A;  4OIR F;  3V8J A;  2C6Y A;  4L18 B;  2E1C A;  3HUG A;  4L5I A;  2EFW A;  4DQ2 A;  3PQJ A;  3C3W A;  2RVC A;  1DDN A;  2IA2 A;  2K4J A;  3N4M A;  4EJO A;  4MNU A;  4ENM A;  3PFI A;  2XIG A;  2FOK A;  1XSV A;  4O5V A;  2D1V A;  1BJA A;  4G7Z F;  3NEU A;  2IRF G;  5ED4 A;  3MAJ A;  4HQM A;  5CVJ A;  4AIJ A;  2BE5 F;  3LWF A;  2TDX A;  1EH7 A;  3E3V A;  3KP7 A;  3FM5 A;  2FMY A;  5BQT A;  3FMS A;  3SZT A;  3KZY A;  3TDU C;  3PQK A;  4DNC A;  3O2P E;  2FBK A;  1IUY A;  5F64 A;  3ZMZ A;  3HSR A;  1G3S A;  2M5W A;  5D8L B;  1QO0 D;  2FSW A;  3JSP A;  2FU4 A;  2IVM A;  1IN4 A;  3R61 A;  2H27 A;  1MDM B;  1I1S A;  1K78 B;  3ECH A;  2EFO A;  1K6O A;  4PCQ A;  1TQM A;  3ZN1 A;  2FA5 A;  3TGN A;  3MWM A;  3L2C A;  3ECO A;  3I53 A;  1GXP A;  3GEZ A;  3F22 A;  2HDC A;  2ZCW A;  3DEU A;  1WKM A;  3T8T A;  2MH2 A;  3EUH A;  2F5F A;  1TW2 A;  4ENN A;  2H09 A;  1G6N A;  3MZY A;  3FXQ A;  4OIN F;  2V6C A;  2H6C A;  2LNB A;  3LFK A;  5HS9 A;  4HYE A;  1ZYR F;  1LDK B;  1YYV A;  1FP2 A;  1YS7 A;  2OQG A;  3WTY C;  3J80 K;  3L7W A;  1IZ1 A;  5BS6 A;  2M45 A;  2K27 A;  2L4M A;  4ENJ A;  4LK0 F;  1BI0 A;  3F23 A;  3K1P A;  1QNT A;  3DPL C;  5ILU A;  5AIP A;  2ZKZ A;  1IXC A;  1LQ1 A;  3FX3 A;  1UCR A;  1SMY F;  2P6S A;  3KLO A;  4GCV A;  1YQA A;  3GVA A;  2AS5 F;  1QQI A;  1ODD A;  4ON0 A;  4XLN F;  4Z2Y A;  3I5U A;  2XAG A;  4QWQ A;  5CLS A;  1R1U A;  1BC8 C;  3TQN A;  3F6O A;  2MD5 A;  4A6D A;  4F7Z A;  3DFG A;  2XAJ A;  4G6D A;  1FC3 A;  2ESH A;  2R7D A;  3W6K B;  3JTG A;  2V9V A;  4M6X A;  1WWX A;  5JR3 A;  5HS8 A;  2JRT A;  4MTE A;  2QWW A;  4ESJ A;  5L3B A;  3IKV A;  4S04 A;  2UWM A;  1ZLK A;  2O6G E;  1TNT A;  2W25 A;  1DUX C;  3RKW A;  4AIH A;  5ILS A;  1TQI A;  1GHC A;  2ISY A;  2QYO A;  4FX4 A;  3E6D A;  2XRN A;  4RGX A;  4E70 A;  3ZQ7 A;  3DQV C;  2OAZ A;  2H6B A;  1FX7 A;  1MJB A;  2DU9 A;  3WGI A;  1YIO A;  2A6E F;  4RB3 C;  1W5T A;  2W57 A;  2IT0 A;  3DKW A;  1BC7 C;  4NQW A;  2EV6 A;  4JK1 X;  3WE3 A;  2W85 A;  1F9N A;  3FF5 A;  1FOK A;  2STW A;  2G7U A;  4D0P A;  3KFW X;  3ABT A;  1MDM A;  3GW2 A;  1K78 A;  1FP1 D;  4L9T A;  1FPQ A;  1TBX A;  3M1E A;  4RAZ A;  1Z1D A;  1LEB A;  2DK8 A;  1IW7 F;  2IW5 A;  3BDD A;  2VC0 A;  3MFK A;  4I98 B;  3WTZ A;  3QRF F;  1T39 A;  4R79 A;  3GFJ A;  3J7A O;  5FGM A;  5E1W A;  2XRO A;  4ASN A;  2HGC A;  3EDP A;  5FD6 A;  1ZLJ A;  4IHS A;  3JSO A;  4M74 A;  2YR2 A;  4ZZD A;  4ESF A;  4A5M A;  3ELK A;  4ZYH A;  1R58 A;  3CO6 C;  1YTY A;  4A6E A;  3I59 B;  5HS7 A;  2DTR A;  5E8G A;  3IHU A;  2PJP A;  3BPV A;  2CGP A;  4Q48 A;  1FBS A;  1I6X A;  2XAQ A;  2QVO A;  1I5Z A;  1ZG3 A;  3ZMV A;  4YFK F;  1SD4 A;  4R8H A;  2GQQ A;  3WTV C;  1YW9 A;  2GWR A;  4IPA A;  3QAH A;  1O3R A;  2P7V B;  2UXX A;  2WV0 A;  2PEX A;  4N9I A;  1DPU A;  1UB9 A;  1SFU A;  1AWC A;  3RPQ A;  2QM3 A;  3RIR A;  2COM A;  2ETH A;  2F5C A;  1SAX A;  2V1D A;  2M30 A;  3HTS B;  3B02 A;  3QP6 A;  3SHF A;  2VBY A;  3E6M A;  1H9T A;  1YFH A;  3FWE A;  2JPB A;  2JZY A;  1W5S A;  2OA4 A;  3BP8 A;  4Q4Z F;  2Z5U A;  4I09 A;  1Y0U A;  5BPD A;  1ON2 A;  3EYY A;  2EV5 A;  1E17 A;  3WTU C;  1ZGJ A;  3T5X A;  4EM2 A;  2ELH A;  1KU7 A;  5JHU A;  5FLX Z;  4HDU A;  1HSJ A;  2WTE A;  5KVR A;  3IRR A;  3L9F A;  1FYK A;  4M72 A;  5D5U B;  2ZNZ A;  4OMY A;  2FML A;  1MGT A;  1XDS A;  2VOO A;  5CYV A;  2DW4 A;  1O57 A;  1D8J A;  1OPC A;  1AOY A;  1B9N A;  3BPX A;  5ICF A;  2AXL A;  2QQ9 A;  4O3M A;  1HKQ A;  3DV8 A;  5CVV A;  4M71 A;  4P9F A;  4MGR A;  3EET A;  1ON1 A;  1ZGA A;  2IJL A;  3J81 Z;  3ERE D;  2VT2 A;  3M7G A;  3WOD F;  4U7B A;  2OD5 A;  3Q9V A;  2D2W A;  4IVN A;  3SQN A;  3I54 A;  3P7N A;  3OV8 A;  1OMI A;  3M9A A;  2RV8 A;  3IC7 A;  1R1T A;  4HX4 A;  3RYR A;  1MZB A;  3MEX A;  1S7A A;  1ZN2 A;  2Q0O A;  5DV5 A;  4FX0 A;  3F72 A;  3WGG A;  2FNP A;  4I2O A;  3I59 A;  2VOD A;  2VOP A;  3HRM A;  1BI2 A;  2W24 A;  2NYX A;  2FRH A;  3SZP A;  2PLY A;  5D5V B;  4KIG A;  3JAM Z;  5A2Q Z;  3K69 A;  3CTA A;  3F8M A;  1P92 A;  4MTD A;  3BOQ A;  4Q47 A;  4P55 A;  3D0S A;  2NRA C;  4LLN A;  3BRO A;  2FXA A;  3U1D A;  4IRH A;  3FMQ A;  5FFX A;  1A04 A;  3H3U A;  3KET A;  4CXF A;  5F6F A;  2QQA A;  1IXS B;  4EM0 B;  4H0E A;  4HX7 A;  4P5O A;  3K1M A;  4GO1 A;  2PBI A;  1Z91 A;  2M87 A;  2RKH A;  2K86 A;  4ZYG A;  3I71 A;  1BIB A;  2A68 F;  1USS A;  3CDH A;  2UZK A;  2V1U A;  1Z9C A;  3MZH A;  4EM1 A;  4GYI A;  2XVC A;  2VXZ A;  4ZZL A;  1ZHF A;  1XGM A;  2V1X A;  4M9X A;  5D5W B;  4U0Y A;  1SD7 A;  4EJT A;  5IT9 Z;  3GFM A;  4A2U A;  3WTT C;  1U8R A;  2L01 A;  1QPM A;  2VE9 A;  6PAX A;  1P4A A;  2XKP A;  5F1R A;  5D5X B;  5ERI A;  4EJW A;  3F3X A;  5LGN A;  2KJB A;  1YO5 C;  1QZY A;  2E1N A;  3GFL A;  1U78 A;  5FLX K;  4OOI A;  4OIO F;  3WE2 A;  2HOE A;  1REP C;  2MBF A;  4A0Y A;  1Z6R A;  2FBH A;  3IWF A;  1ZRD A;  2EA2 A;  3WTS C;  4I01 A;  4EGY A;  1S8N A;  5DD8 A;  1U3E M;  5ILV A;  3ML6 A;  3G73 A;  1UHW A;  2YSR A;  1JGS A;  4KMF A;  4YFX F;  4P96 A;  4Q5S F;  3JTH A;  3GFI A;  2IP2 A;  2O0Y A;  1XD7 A;  5K5Q A;  2MA3 A;  4R1H A;  2NNY A;  2F5D A;  3KCC A;  2E7X A;  2HTS A;  3HTU A;  4XSX F;  3WG9 A;  4YIF A;  3RTR A;  2NS0 A;  3HOS A;  2OQR A;  2HTJ A;  4N9H A;  2KJC A;  1E2X A;  1BN5 A;  1OKR A;  2VBX A;  1S29 A;  4YII A;  3RI4 A;  1K7A A;  3AAF A;  1O7L A;  3CO7 C;  3RJP A;  1EH8 A;  4XBF A;  2LF7 A;  3JAM K;  4G7H F;  3KP4 A;  2DQR A;  2PFB A;  1HST A;  3ZMU A;  3KP3 A;  2XUB A;  2CSO A;  1W4M A;  1J2X A;  4A5N A;  2DK5 A;  1JHH A;  4P9U A;  2DLL A;  4LB5 A;  4KFC A;  3R6S A;  5EEG A;  4M9Z A;  2CWE A;  2BEO A;  4L0Z B;  2R3S A;  3TKY A;  2GXB A;  4EJV A;  3H92 A;  3K0L A;  4TV7 A;  3N97 A;  1XSX A;  1G3W A;  3CUQ C;  3P9K A;  1V4R A;  4U0V A;  3W6J B;  3RDI A;  1Z6T A;  5K5R A;  4UNO A;  1P4W A;  1RUN A;  1KGS A;  1YW7 A;  5LLQ A;  1BI3 A;  5L3F A;  5LBQ A;  1SD5 A;  2KIF A;  3VEP A;  2MLG A;  1IRF A;  3HRU A;  1XMA A;  2OU2 A;  4IF4 A;  4HF2 A;  1O7F A;  4UVA A;  4YFN F;  3B73 A;  5IT9 K;  1FSE A;  1T98 A;  5LHG A;  1TNS A;  4KUM A;  3CUO A;  5DDG A;  2NAZ A;  2BBY A;  4MQV A;  1B1B A;  4HBL A;  3P9C A;  3SXY A;  2P6T A;  4HF1 A;  4LB6 B;  3ZMS A;  5E17 F;  2HEO A;  3LA3 A;  3KP5 A;  1TTY A;  4EQQ A;  1L3L A;  1RIO H;  1D3Y A;  4KMU X;  3VFZ A;  5E1Z B;  1QZZ A;  2QEN A;  5JI6 A;  5CJ9 A;  1HKS A;  1IN8 A;  4XRF A;  2Q8K A;  3K2Z A;  5AIQ A;  4BAY A;  1LDD A;  1S7O A;  3MQ0 A;  2LKP A;  4IHT A;  1T0F A;  2X0L A;  5E8I A;  4XLP F;  2K7L A;  3C1D A;  2YX4 A;  2GAU A;  4EV0 A;  2D1H A;  3E6B A;  2A69 F;  3R60 A;  4LJZ F;  2ADU A;  4MEY F;  4G7O F;  1I1G A;  3GXO A;  4KYW A;  3O6B B;  3BJA A;  2F2E A;  2ZJ2 A;  1LNW A;  1P2F A;  2D45 A;  5LHI A;  5H6Q A;  1D8K A;  2LDU A;  2QLZ A;  2Z9O A;  4HDV A;  1FSH A;  2GA2 A;  4UUV A;  4OIP F;  1BBY A;  4I0B A;  3TO6 A;  1R7J A;  4EVI A;  1HW5 A;  4CHU A;  3P9I A;  1KQ9 A;  1KA8 A;  4ENK A;  2VBW A;  1IF1 A;  4I02 A;  2K4B A;  2RGV A;  3T8R A;  4KA4 A;  3NQO A;  1J75 A;  5KK1 A;  2BGC A;  1BI1 A;  2VT3 A;  2KRF A;  3LST A;  2B0L A;  3K9T A;  5CVI A;  4HX8 A;  2M8E A;  3GWZ A;  4GGG A;  1WSU A;  2ZFW A;  2EFN A;  5LRS A;  1UFM A;  1HKT A;  2EFQ A;  1HXD A;  1ZH5 A;  2P7C B;  2P5K A;  2ZBK A;  1B59 A;  2HFH A;  3T1B A;  3RYP A;  3KZZ A;  4LLG F;  4AWX B;  4GYG A;  1Q1H A;  4A0X A;  1GXQ A;  1SFE A;  3C7J A;  5K1Y A;  2PMH A;  2EV0 A;  1EV7 A;  3KLN A;  3V8K A;  4EMS A;  5HLH A;  1R22 A;  3ZP5 A;  1ZRE A;  4G94 A;  5D4R A;  5TRD A;  2L02 A;  1OYI A;  2FEZ A;  1W7P B;  1HQC A;  4L0Y B;  4HA8 A;  2XAH A;  1T6S A;  1LVA A;  5J8F A;  3G3Z A;  2QQB A;  4IXA A;  2A07 F;  1JHF A;  3HIF A;  2P8T A;  3F8N A;  5FFZ A;  1U5T C;  4M6Y A;  4PGG A;  3IWZ A;  4BXU A;  2YX7 A;  3RPU A;  4B09 A;  4NB5 A;  5BOX A;  1D5V A;  3FHZ A;  2OBP A;  3L09 A;  2HWV A;  3IL2 A;  1O3T A;  4KN7 X;  1BM9 A;  5ICE A;  4I0A A;  1G4D A;  3F6V A;  2FQ3 A;  4HV5 A;  3F21 A;  4MQ9 F;  1P4X A;  4RB0 A;  5HDG A;  4Y17 A;  4AVP A;  3ZN0 A;  4BQA A;  4OU0 A;  2Y48 A;  3QPT A;  2EWN A;  4BHP A;  4LD5 A;  3WTW C;  1XGO A;  3V8L A;  2DT5 A;  2HYG D;  5HDK A;  5LGT A;  4K2E A;  1KYW A;  1WQ2 A;  2MC3 A;  4ETS A;  3V7S A;  4BH9 A;  2A5Y B;  1BOA A;  4RGS A;  3K1N A;  4KIB A;  3U9G A;  1EH6 A;  3LA2 A;  2G7H A;  2Z3Y A;  1T2K A;  3U2R A;  3FMR A;  1P6R A;  4M73 A;  1XSD A;  5D8K B;  2J5O A;  4OIQ F;  2VC1 A;  2CQK A;  4IRI A;  3J80 Z;  4KIC A;  1H0M A;  2PG4 A;  1QBJ A;  2VBZ A;  1BIA A;  2F5E A;  3FZV A;  4L5J A;  1ONV A;  2HKX A;  4LLL A;  2P5L C;  2RQP A;  1ZRF A;  3FM3 A;  1RZ4 A;  1ZG1 A;  1JXS A;  2CO5 A;  3GLX A;  3V7R A;  2YU3 A;  2XAS A;  1ULY A;  1KU2 A;  4RS8 A;  4UVB A;  1C0W A;  2HR3 A;  4CIC A;  4RAY A;  1UHM A;  1XDU A;  5D6E A;  3HOT A;  2K02 A;  1PP8 F;  1T38 A;  5LRR A;  2PI0 A;  2EJR A;  1B6A A;  3LAP A;  5DUI A;  1CF7 B;  2KIU A;  1KQ0 A;  4L9J A;  3R0A A;  1FNN A;  4L9V A;  3RKY A;  3QP5 A;  1LB2 A;  2H94 A;  2HQR A;  1WRJ A;  2DAO A;  1LJ9 A;  4U7D A;  3QU3 A;  3E5X A;  3Q9S A;  4JQF A;  4KT5 C;  1LDJ A;  2E7W A;  1F5T A;  3R4K A;  1B9M A;  4YG2 F;  2ESN A;  4UV8 A;  2Y75 A;  3S2W A;  3E5U A;  2G9W A;  5TJJ A;  4CO8 A;  1W7P A;  3GZ5 A;  4PGH A;  2EFP A;  2M1B A;  3L00 A;  3GUD A;  5EEH A;  1G3Y A;  2DO7 A;  3SFZ A;  4PDK A;  2CG4 A;  1FT9 A;  4Y15 A;  2JTV A;  1IN7 A;  1FZP B;  1KQ8 A;  3KE2 A;  4UXN A;  1B4A A;  5DUK A;  4KIF A;  4FT8 A;  4UV9 A;  1U2W A;  4S05 A;  3H3Z A;  2RNJ A;  4EJU A;  1HBX G;  4LGW A;  2LF8 A;  2ZO4 A;  1FBU A;  5L3E A; 
#chains in the Genus database with same CATH topology
 2JT1 A;  1TWG J;  2XF7 A;  3OS0 A;  4M3B A;  2QBY B;  4NQW B;  1OLT A;  1TWF J;  1IRZ A;  2EZL A;  4RAG A;  2OZU A;  4PK4 A;  2HKO A;  4IL6 C;  5LEK A;  3BY6 A;  2OZ6 A;  2LSO A;  3CUQ B;  3GBG A;  4Y3O A;  1YLF A;  5FRO A;  1XMK A;  2AHQ A;  4EAT A;  1MBG A;  2PQ8 A;  2XV4 S;  2CUF A;  5DD4 A;  1JI8 A;  2E71 A;  2Y0S N;  2X9D A;  1X2N A;  3J81 K;  3JRC A;  1ETY A;  4ESB A;  3OOP A;  4B3A A;  3B6A A;  3V7C A;  3RKX A;  2L2O A;  4WXH A;  1JE8 A;  3Q0V A;  3ISP A;  1Q1V A;  3GF2 A;  3KEY A;  2HYJ A;  4L5E A;  2FNA A;  3HOX J;  5M3M J;  1MW7 A;  3D5L A;  4HV6 A;  1X1A A;  3K2A A;  5KCM A;  1O3Q A;  4BY7 J;  3E6C C;  3CC7 I;  1R1V A;  4NHJ A;  3ABK H;  4U0W A;  4CCM A;  1FYM A;  3W2W A;  4CDG A;  3LSR A;  2PN6 A;  2DFI A;  4BQO A;  3CMY A;  3BG3 A;  5LFA A;  1LEA A;  1V5E A;  3CCR I;  2R7O A;  2HS5 A;  4PSW A;  2IA0 A;  3K70 C;  2KDZ A;  2ISZ A;  1W7P D;  2ZXJ A;  4B8X A;  1VQN I;  4LMY A;  2IGO A;  3ABU A;  1K4T A;  1TQP A;  2CQN A;  2IS4 A;  4MHG A;  2RDP A;  2QZ8 A;  3A02 A;  1ZAR A;  2A6H F;  2Q2E A;  2KRH A;  3IRQ A;  3I64 A;  5HVQ C;  3K4J A;  3F9K A;  4XRM A;  2LRE A;  3I58 A;  1SD6 A;  4G8X A;  1XB4 A;  2DMT A;  2K40 A;  4AC0 A;  4CYD A;  2HZT A;  4KNY A;  2N8G A;  5A2Q K;  4RB1 A;  5DYM A;  3HL2 A;  1KU9 A;  5J4Y A;  2O3F A;  4ITV A;  3GZ6 A;  2OF7 A;  3TDZ C;  2DOF A;  3AG2 H;  1FLI A;  3KEQ A;  4UVC A;  1IAW A;  2GIV A;  1YW8 A;  1I6H J;  5HOO A;  1YIJ I;  3F8F A;  2X4H A;  3HC7 A;  3CCY A;  1FY7 A;  1G3T A;  3FKJ A;  4CCJ A;  2L54 A;  1J59 A;  2XC7 A;  2KIM A;  1R23 A;  3ASN H;  2R7F A;  3DXJ F;  4BHB A;  1RUO A;  1CF7 A;  1B8I B;  4AM3 A;  2LY1 A;  9ANT A;  2IA1 A;  2XHK A;  3DBH B;  2XKO A;  1TW3 A;  3E5Q A;  2X6Y A;  3M8E A;  1WJA A;  3REO A;  3DP7 A;  1IDZ A;  1EA3 A;  1MMA A;  5D6F A;  2L3D A;  2XGC A;  4ZYA A;  4D1Q A;  1DP7 P;  4AID A;  2STT A;  4FIS A;  1POG A;  3HSF A;  3FXM A;  4BNC A;  1NHA A;  3KP6 A;  5FRM A;  1RES A;  5HDN A;  3HM5 A;  4NC7 A;  2QSH X;  2HVQ A;  5EF6 A;  4Y13 A;  2VON A;  4XLH A;  1MJA A;  2EH3 A;  4ZYE A;  1AA7 A;  2M2E A;  3OYN A;  3OYA A;  1F4K A;  3GX4 X;  4OMZ A;  1UEL B;  3LA7 A;  2FF4 A;  2XPV A;  3V4G A;  3NAR A;  4UUS A;  2NVX J;  2NVQ J;  2BHZ A;  2EZK A;  2DQL A;  2X85 A;  1IG7 A;  1I39 A;  5IT3 A;  3COA C;  2XGX A;  2HOT A;  2L9V A;  2QGU A;  1PDN C;  4M3D A;  3HRT A;  4B43 A;  5DCM B;  4HOB A;  4HW0 A;  3C2G A;  3ROU A;  4LG0 B;  2TCT A;  1OCP A;  4Y4R A;  3ZQL A;  1UST A;  3ZCO A;  1OYW A;  2PMZ A;  3E7L A;  2KIS A;  5JVT A;  3GME A;  4AYB A;  2OCC H;  4RB2 C;  3TMO A;  1TLH B;  3FDY A;  3LOC A;  1JKR C;  5L3D A;  5JFR A;  2A6T A;  2ACJ A;  1TT0 A;  1GVJ A;  3TOA A;  1H9G A;  1XGS A;  1ZAO A;  4FET A;  4WWC A;  1YG2 A;  2VKE A;  1Y1V J;  3QOD A;  2BYV E;  2W84 A;  5F08 A;  5E79 C;  3DTK A;  3S15 J;  2Z33 A;  3BZC A;  4WCG A;  3E1S A;  3G1O A;  4B3X A;  1NK3 P;  2O61 A;  3ZMT A;  3J7A Y;  3JRG A;  4NC6 A;  1OYY A;  2DBB A;  5LEJ A;  4KT6 A;  2L5Q A;  5D4S A;  3HJE A;  3NRV A;  4E7I A;  2QBY A;  4WXC A;  4HLX A;  1D1A A;  1R00 A;  2ZSH B;  3AG4 H;  5EG0 A;  3WGH A;  3I4N J;  2J5P A;  4XSZ F;  1WFX A;  3CUQ A;  3MZ8 A;  1J5Y A;  2CQQ A;  2JA7 J;  4YEL A;  3BWG A;  3MCZ A;  1FWZ A;  1IN6 A;  4KDP A;  1TWC J;  2K9Q A;  1HW2 A;  1VF9 A;  4W1U A;  3E97 A;  3TO7 A;  2P4W A;  5HLG A;  2BOL A;  3TO9 A;  1Z21 A;  4WX9 A;  1I27 A;  2NVU B;  2VQC A;  3SJM A;  1MBE A;  3QU6 A;  1T56 A;  4HF0 A;  2CUZ A;  4RGU A;  4DOZ A;  1R4M B;  4G6Q A;  4UB6 C;  3LQR A;  3ASO H;  1G59 A;  4A12 A;  3L2U A;  3FXR A;  3LAJ A;  2E36 A;  3D5S C;  3FK6 A;  1ZKG A;  2DPU A;  1J7K A;  1YOV B;  1JUS A;  4PZJ A;  1MBJ A;  4U88 A;  1OCO H;  2Z1D A;  3F8B A;  3CDL A;  2BVM A;  3GYH X;  1CGP A;  3QPL A;  2KKO A;  1J09 A;  4CGZ A;  1ETO A;  3PSF A;  4HZF A;  5IYB J;  1NH3 A;  5H6R A;  3CES A;  2DT6 A;  2Y0M A;  2ZJP F;  1L0O C;  3HHG A;  1IGN A;  2K3F A;  3HRS A;  1UZC A;  3CJN A;  3KIO A;  1GV2 A;  5DCF A;  2BV6 A;  4I7H A;  2LKS A;  4Y7N J;  2VXD A;  4G6T B;  2V79 A;  1J9I A;  3QOP A;  1MD0 A;  3TP0 A;  1U5T B;  2EK5 A;  1STZ A;  1YE9 A;  1V55 H;  1MKM A;  2FBI A;  5GTH C;  1PUE E;  3BZ6 A;  1F43 A;  3ULQ B;  2YPR A;  5B1B H;  3ZGK A;  1SFX A;  5DEQ A;  2JA2 A;  5H20 A;  2ZME B;  3K6G A;  4EGZ A;  4AIK A;  5CVR A;  1O3S A;  4BAC A;  1QZE A;  1KU3 A;  1R49 A;  2H1K A;  3LQQ A;  1JTY A;  4ZDL A;  3SDB A;  5ICG A;  2LC2 A;  3KEO A;  3CF5 F;  1XN7 A;  1BW5 A;  1TL8 A;  5LGU A;  3IH4 A;  4L9N A;  1PP7 U;  1R36 A;  3TP3 A;  4XNF A;  3PIO F;  1JT6 A;  2EB7 A;  5E18 F;  2CFX A;  4WF2 A;  2L7Z A;  1WI9 A;  5LHH A;  1R5I D;  4XID A;  1KYZ A;  1A31 A;  1IN5 A;  2NOJ B;  5FB2 A;  3M8F A;  3C18 A;  4A0Z A;  1B8I A;  5E20 A;  1IXR C;  1TP4 A;  2Z2S B;  1WJ5 A;  2LRD A;  3HUG B;  4JX5 A;  2NXN B;  2R7Q A;  3KP2 A;  1WVR A;  2M8G X;  1OR7 A;  4WXD A;  2A61 A;  3OYL A;  2V9K A;  3BJO A;  3BQY A;  2XGD A;  2NOG A;  1SMT A;  3DLL F;  1IRG A;  2IPQ X;  2DI3 A;  2HYF A;  5L3G A;  4ZH4 F;  5FO5 A;  3BR5 A;  4JYK A;  4RA2 A;  4DZJ A;  1Z0X A;  2JSC A;  3QPH A;  3CC4 I;  2QSG X;  3OWT A;  1VND A;  4V2G A;  2CV1 A;  1ZG5 A;  2UXN A;  4KN4 X;  2VQG A;  1R5G A;  2VE8 A;  5K7Z A;  5J1U A;  3OYJ A;  3W3C A;  1WGX A;  4M9S A;  3WHB A;  4JBA A;  3A01 B;  1XCV A;  4MEX F;  2DOA A;  2PMU A;  1V5G A;  4BHC A;  2ECC A;  1K79 A;  2CW8 A;  5DCM A;  2GZW A;  2IAI A;  4LG0 A;  3F0C A;  3VOD A;  3DU6 A;  4DW6 A;  3NAU A;  3EYI A;  2L4A A;  2VN2 A;  1MJ9 A;  1QHH D;  1MH3 A;  5BPI A;  1LFP A;  1MND A;  3CQZ J;  3JRB A;  4C9Y A;  1ZRC A;  4LK1 F;  3BJ6 A;  4M6V A;  4UHT A;  1QGP A;  1O4X A;  2K9L A;  1X3U A;  3O3K A;  4CZZ A;  1Z05 A;  3TBI A;  1DGR M;  3DPU A;  3I0T A;  3G1L A;  5J8C A;  3DLA A;  3WU1 B;  2NNN A;  1W0U A;  1FBQ A;  2R7R A;  3HDD A;  1Z7U A;  1R5H A;  1XGN A;  4FHT A;  2ZME C;  3H9G A;  4ZDO A;  3I4P A;  2GA1 A;  5M5X J;  3OS1 A;  2O03 A;  3ZRG A;  1WJD A;  1S3J A;  2L9N A;  2GXG A;  3OYE A;  2WB1 N;  5HNF A;  5BMZ A;  2P81 A;  4RGR A;  2LMD A;  4D5C A;  3Q5F A;  2E5N A;  2WC2 A;  4HNU A;  4XRS A;  2WWY A;  3ZPL A;  1J0R A;  1K61 A;  1V3F A;  4GXO A;  1OCZ H;  3HYI A;  2EA4 A;  5E1X A;  2KL4 A;  2O8X A;  3G1M A;  5ICC A;  2WAQ A;  3ZMD A;  4F55 A;  3EQL F;  4G9Y A;  2HVR A;  3VB2 A;  4BJ5 C;  1RNL A;  1KZH A;  2DPD A;  2ICW G;  1UMQ A;  5FKM A;  5FJ8 J;  1Y6I A;  2MLK A;  3TOB A;  3WTX C;  3MVP A;  2HQN A;  5FD5 A;  3T0Y A;  4XLC A;  3W6V A;  3H9Q A;  3AL0 B;  1X1B A;  1S6L A;  3BTC A;  3VSL A;  5DM6 F;  3SDG A;  1YHQ I;  3F8C A;  1FYL A;  3FXL A;  4LFU A;  5LD2 C;  4HLY A;  3OL3 A;  4N0B A;  5CVU A;  3GTP J;  5AON A;  2JK3 A;  5K5O A;  2A3S A;  3DF8 A;  3OYI A;  2Z99 A;  2OTJ I;  3IKT A;  3R0J A;  2B9S A;  4BYY A;  3DPT A;  5GAH J;  2QUF A;  3VYS B;  5L3C A;  1RR7 A;  3ZQG A;  2W7N A;  2FUG 2;  2X1C A;  4HEA 2;  1MMS A;  1JKQ C;  2L7M P;  4O6J A;  3PM1 A;  4AD9 A;  2FQ4 A;  1BA5 A;  2DDA A;  3BTI A;  3GO5 A;  2R7W A;  1VQP I;  1U5T A;  3FXU A;  1W36 D;  4IHW A;  2MH9 A;  5HLI A;  2P5V A;  2K9N A;  1DPR A;  3BZK A;  3A0H C;  2RC4 A;  2RN7 A;  1R6R A;  2JPC A;  1U6G A;  2VIX A;  3CCJ I;  2ZME A;  3CLQ A;  4HAM A;  3CLO A;  2IXS A;  3VOE A;  2ZJQ F;  1VTN C;  4PFO A;  4ZYD A;  2XAF A;  5CQE A;  4IQ4 A;  1IC8 A;  1YS6 A;  1XCB A;  1HW1 A;  3RPU D;  3JW4 A;  4HQE A;  3HHH A;  4IRG A;  4WK8 F;  3HSE A;  5J6X A;  2CJJ A;  2FE3 A;  3M8J A;  4D9J A;  4QLC U;  5FKL A;  2OUM A;  1U8B A;  2CW0 F;  3AFH A;  3I3L A;  2YUS A;  1W0T A;  5GAE J;  4PUS A;  3FBI B;  3WU0 A;  1RI7 A;  4IJA A;  4A3F J;  1F1Z A;  3MKW B;  3H0D A;  5E3L A;  2X6O A;  2CYY A;  2ZNY A;  4OIR F;  3S3M A;  2XSJ C;  2DFE A;  3V8J A;  4RM3 A;  2C6Y A;  4L18 B;  1D0X A;  2JUC A;  3LSI A;  2E1C A;  2DCE A;  3HUG A;  2DT7 B;  4L5I A;  4RAF A;  4ABZ A;  2Y9Y A;  3AKZ A;  4E7L A;  3WHC A;  2EFW A;  3BR3 A;  3DTI A;  3K4M A;  4HNT A;  1APL C;  2R92 J;  4FTH A;  3IV5 A;  5GP9 A;  4DQ2 A;  2NVY J;  3DCF A;  2RRE A;  3I9V 2;  3PQJ A;  3C3W A;  2RVC A;  3IH3 A;  3OIQ A;  3Q0U A;  1DDN A;  1HCR A;  3MD2 A;  3N05 A;  2IA2 A;  4M3F A;  3KYC B;  1OQY A;  2KLO A;  4YEJ A;  2K4J A;  2W82 A;  4BY1 J;  3AL0 C;  1NG7 A;  3N4M A;  4EJO A;  2NVT J;  2ME6 A;  3A01 A;  2O9L A;  4MNU A;  2ID3 A;  4J00 A;  3PFI A;  4ENM A;  4KIS A;  2XIG A;  3C2H A;  2A5W A;  2KP6 A;  2FOK A;  2JVG A;  1X3W B;  2XF6 A;  1XSV A;  1XPX A;  2ZSI B;  4A69 C;  4O5V A;  1XS9 A;  2D1V A;  1BJA A;  4G7Z F;  5JVG F;  3NEU A;  2IRF G;  4LG3 A;  3DEE A;  2R7U A;  5ED4 A;  2Y9Z A;  1Z3X A;  3MAJ A;  2KZV A;  2DYS H;  4HQM A;  5CVJ A;  4AIJ A;  2BE5 F;  2DA7 A;  3LWF A;  2TDX A;  3SEZ A;  1EH7 A;  3E3V A;  1FTZ A;  3KP7 A;  2RNG A;  2CRG A;  2FMY A;  3FM5 A;  3H0G J;  1ZK8 A;  5BQT A;  3FMS A;  4G12 A;  3SZT A;  3KZY A;  3TDU C;  3PQK A;  4DNC A;  3O2P E;  2QSF X;  4XON A;  5B1A H;  4MLO A;  2FBK A;  2HXI A;  3JRE A;  2G0E A;  1IUY A;  5F64 A;  3ZMZ A;  3HOU J;  2W48 A;  3HSR A;  1MIJ A;  2OTL I;  1G3S A;  4E7K A;  2M0M A;  3BCA A;  1ERD A;  2M5W A;  1Y1W J;  5D8L B;  3DKY A;  4OAY A;  4UB8 C;  3OIP A;  1ZGW A;  1VQM I;  1QO0 D;  4NDL A;  2FSW A;  2PMZ N;  2HDD A;  3JSP A;  4AYB N;  1G2H A;  2FU4 A;  4J01 A;  2IVM A;  2Z16 A;  2X48 A;  1IN4 A;  3R61 A;  2I10 A;  2ZXW H;  4NUB A;  4FAS D;  4BUP A;  2LY2 A;  4W97 A;  2H27 A;  1MDM B;  1I1S A;  4C3I J;  1A36 A;  1K78 B;  3ECH A;  4QTR A;  2EFO A;  1K6O A;  2XB5 A;  3VDX A;  4PCQ A;  1TQM A;  1BL0 A;  3ZN1 A;  2VJI A;  2FA5 A;  3TGN A;  3MWM A;  4DBR A;  3L1P A;  3L2C A;  2P0W A;  3ECO A;  3I53 A;  3OYB A;  1GXP A;  3GEZ A;  2LKX A;  3FK7 A;  3F22 A;  4I6Z A;  3A0B C;  2HDC A;  3S1N J;  2ZCW A;  2IS2 A;  3DBL B;  3OYD A;  3DEU A;  1WKM A;  3OSG A;  3T8T A;  5C4J J;  2MH2 A;  3EUH A;  4CUG A;  2F5F A;  1TW2 A;  4ENN A;  5C4X J;  2H09 A;  3CD6 I;  1G6N A;  3MZY A;  2BY1 A;  3FXQ A;  4BEH B;  1BR1 A;  4OIN F;  3NWT A;  2DA4 A;  2V6C A;  5J3L A;  2H6C A;  2LNB A;  2HOS A;  3LFK A;  2ZXH A;  3M3Y J;  5HS9 A;  4HYE A;  3CCQ I;  3FXK A;  1ZYR F;  3LNQ A;  1LDK B;  1YYV A;  4A3E J;  3RZD J;  3S2H J;  1FP2 A;  1YS7 A;  1JUM A;  2OQG A;  1TT5 B;  3WTY C;  3OSF A;  3I4M J;  3J80 K;  2AQF A;  3H35 A;  3QYF A;  3L7W A;  3LSH A;  1IZ1 A;  5BS6 A;  1VQK I;  2M45 A;  3HOY J;  2L0K A;  2K27 A;  2L4M A;  4ENJ A;  4LK0 F;  3VYR B;  4B44 A;  1H88 C;  5KAI C;  1BI0 A;  2GLO A;  4C3H J;  2M0C A;  3F23 A;  4II3 A;  3I56 I;  3K1P A;  1QNT A;  3FXJ A;  1YIT I;  1RPW A;  1LPQ A;  3G71 I;  3RZO J;  2JVH A;  3DPL C;  5ILU A;  5AIP A;  2E19 A;  2JRM A;  2ZKZ A;  5KNL A;  1IXC A;  1LQ1 A;  3FX3 A;  4P1W A;  1UCR A;  1SMY F;  2P6S A;  3KLO A;  3DU5 A;  1X1C A;  5IOZ A;  2DOE A;  3MKL A;  2EIK H;  2E5Z A;  2DTZ A;  3NWS A;  3X2Q H;  1YJ9 I;  2M34 A;  2DFF A;  4GCV A;  1YQA A;  3GVA A;  4Y33 A;  2AS5 F;  4ZDP A;  1MMG A;  1ODD A;  1QQI A;  1DU6 A;  4ON0 A;  4XLN F;  4Z2Y A;  3I5U A;  2XAG A;  4QWQ A;  3G6E I;  2KPM A;  3LSK A;  1R1U A;  5CLS A;  1BC8 C;  3TQN A;  1KON A;  3F6O A;  2NS8 A;  2MD5 A;  2E1M C;  2XPW A;  4BKX A;  3HOZ J;  4A6D A;  4F7Z A;  3DFG A;  2XAJ A;  4G6D A;  2BXY A;  1FC3 A;  2ESH A;  3HZJ A;  4F91 B;  1CQT A;  1E3H A;  1SVL A;  2R7D A;  3W6K B;  1LKX A;  3JTG A;  3WG7 H;  2V9V A;  3OYM A;  4M6X A;  2ZB9 A;  1WWX A;  1VQ5 I;  3PSI A;  5JR3 A;  1T0F C;  5HS8 A;  3B6C A;  4BJ6 C;  1Z7L A;  4Y52 J;  1X58 A;  2KFD A;  2XDV A;  2R7Z J;  2NS7 A;  4QPO A;  1GVD A;  2JRT A;  4MTE A;  2QWW A;  4ESJ A;  2LK2 A;  2OC6 A;  3CZ6 A;  5L3B A;  3BQZ A;  3IKV A;  3LSG A;  4S04 A;  4BJT A;  2UWM A;  1S7E A;  1ZLK A;  2O6G E;  1TNT A;  2W25 A;  5M3F J;  2WY7 Q;  1DUX C;  3L2W A;  2X6W A;  3RKW A;  4AIH A;  5ILS A;  3D1N I;  1DP3 A;  4FCY A;  4IZZ A;  2DJN A;  1TQI A;  3GCM A;  4RMN A;  2VPL A;  2EIJ H;  2V7F A;  1ZR2 A;  3OYG A;  5C3E J;  1GHC A;  1LUJ B;  2ISY A;  2MW8 A;  2QYO A;  5GPC A;  4FX4 A;  1D5Y A;  3E6D A;  2XRN A;  1A6Q A;  2MC4 A;  4RGX A;  4E70 A;  3ZQ7 A;  1W1W E;  1JJ8 C;  3DQV C;  2IS6 A;  2OAZ A;  1T33 A;  2H6B A;  3CDI A;  1FX7 A;  3HB9 A;  2EPF A;  2RAE A;  1MJB A;  2DU9 A;  3WGI A;  1YIO A;  2A6E F;  4RB3 C;  4MIM A;  1U0J A;  2KQR A;  3BG7 A;  1W5T A;  1X4P A;  2W57 A;  2IT0 A;  3DKW A;  1JUP A;  4NQW A;  1BC7 C;  5F0C A;  3ZXS A;  2EV6 A;  3K4K A;  3FIW A;  4XLE A;  4JK1 X;  1ACI A;  3WE3 A;  2W85 A;  3S17 J;  1F9N A;  3FF5 A;  1FOK A;  2STW A;  2ELK A;  2G7U A;  1X1P A;  4D0P A;  3KFW X;  2WAF A;  2E2I J;  1HF0 A;  3ABT A;  1MDM A;  3LFU A;  4XL9 A;  3CF2 A;  3GW2 A;  1Z77 A;  3RKQ A;  1K78 A;  3PJR A;  3TED A;  1SEU A;  1TWH J;  2KDO A;  3IH2 A;  1FP1 D;  4BBS J;  4L9T A;  1FPQ A;  1TBX A;  3M1E A;  2DYR H;  4RAZ A;  1Z1D A;  1LEB A;  2DK8 A;  1IW7 F;  2IW5 A;  3BDD A;  2VC0 A;  3MFK A;  2E1O A;  3CCS I;  4I98 B;  3WTZ A;  3QRF F;  1HC8 A;  1T39 A;  4R79 A;  3GFJ A;  3HOW J;  1JGG A;  3J7A O;  5FGM A;  5E1W A;  2XRO A;  4DJA A;  1VFC A;  4E6K G;  3OYC A;  4ASN A;  2HGC A;  3EDP A;  4M3E A;  5F04 A;  2F4M B;  3E0J B;  1ZLJ A;  2XPU A;  5FD6 A;  4IHS A;  4MFE A;  4BQQ A;  3L2Q A;  2UV1 A;  2MGQ A;  4UY8 I;  1HLV A;  3JSO A;  4M74 A;  2WAQ N;  3H3V K;  2YR2 A;  4ZZD A;  2VB6 A;  4ESF A;  4A5M A;  1K83 J;  3G4S I;  3ELK A;  4ZYH A;  1R58 A;  2CV0 A;  3VSK A;  4BU2 A;  3CO6 C;  1RR8 C;  1P9Q C;  1YTY A;  1K4S A;  2DA2 A;  4NNJ A;  4A6E A;  3I59 B;  5HS7 A;  3FBN B;  1UG0 A;  4A3J J;  3O8G A;  4BS9 A;  2VUM J;  4OAZ A;  3QQA A;  1SVM A;  2DTR A;  2Q1Z B;  5E8G A;  2ID6 A;  1Y8Q B;  3IHU A;  3BPV A;  2V9P A;  4RDU A;  3JRI A;  4A3I J;  2PJP A;  1BW6 A;  2CGP A;  4I76 A;  4N4O B;  4Q48 A;  2EIL H;  2F4I A;  3KYD B;  1YX5 A;  1FBS A;  4HRI A;  2ECB A;  2L9R A;  4QSH A;  1MSF C;  1W36 C;  2GIZ A;  1I6X A;  2HQA A;  2XAQ A;  2QVO A;  2FD5 A;  1I5Z A;  1ZG3 A;  1X3Z B;  3M07 A;  3ZMV A;  4YFK F;  2IS1 A;  1SD4 A;  4R8H A;  1ETX A;  2GQQ A;  3WTV C;  1YW9 A;  4IKF A;  2GWR A;  4IPA A;  3QAH A;  1W5C C;  2FOW A;  4DYC A;  2BY0 A;  1O3R A;  3CP8 A;  3HKZ A;  5M5Y J;  2P7V B;  2UXX A;  2WV0 A;  1D1B A;  2PEX A;  2JJ7 A;  4N9I A;  3H5R A;  1WI3 A;  2BHY A;  2M4G A;  4PJM A;  4BL0 B;  2E35 A;  1DPU A;  1SFO J;  1UB9 A;  1SFU A;  1AWC A;  2HU9 A;  3RPQ A;  2QM3 A;  3RIR A;  5J47 A;  2W00 A;  2COM A;  2ETH A;  2F5C A;  1RKW A;  1SAX A;  2V1D A;  2OJE D;  1GV5 A;  2M30 A;  5FKO A;  4CA0 A;  3HTS B;  2H8W A;  5EYR A;  1VQL I;  4C2T A;  2XGE A;  3B02 A;  3S2D J;  3QP6 A;  3GTL J;  3SHF A;  3RQ4 A;  2VBY A;  3E6M A;  1RET A;  1H9T A;  2V26 A;  4DBQ A;  2K9S A;  1YFH A;  2I5U A;  3FWE A;  1TC3 C;  2JPB A;  2JZY A;  1W5S A;  3BR6 A;  5JLX A;  3CMA I;  2OA4 A;  3BP8 A;  3TW7 A;  4DYR A;  4B48 A;  2M4K A;  2DA6 A;  4Q4Z F;  2Z5U A;  1JTX A;  1FOW A;  3PL8 A;  4LIU A;  3ZQI A;  4I09 A;  3ABL H;  3GTQ J;  2H8R A;  5EZH A;  1QHG A;  4IOA F;  2F5V A;  3PO3 J;  1Y0U A;  5BPD A;  2F48 A;  5B66 C;  2D5V A;  3PNY A;  1ON2 A;  2RQQ A;  2VLA A;  1HDP A;  3EYY A;  2UUZ A;  2EV5 A;  5K7F A;  4AUX A;  1E17 A;  3WTU C;  1ZGJ A;  1E3P A;  3T5X A;  4CCN A;  4EM2 A;  4II2 A;  2ELH A;  1KU7 A;  3FIS A;  2IBD A;  5IP7 J;  5JHU A;  5FLX Z;  5DM7 F;  4HDU A;  5JLW A;  1R4N B;  1MBK A;  1HSJ A;  2LR8 A;  2WTE A;  5KVR A;  1R71 A;  3IRR A;  3L9F A;  1FYK A;  4M72 A;  5D5U B;  2DOD A;  2ZNZ A;  4LIT A;  4OMY A;  1JT0 A;  4A3L J;  2DA5 A;  4N4N B;  4PJL A;  2FML A;  2BZT A;  3ZQC A;  1MGT A;  2XRL A;  4IX7 A;  1XDS A;  2VOO A;  5CPR B;  5CYV A;  1K6Y A;  2DW4 A;  1O57 A;  3Q0W A;  5B5E C;  1XG1 A;  1D8J A;  1OPC A;  2I8D A;  3OOU A;  1PVE A;  3V42 A;  1AOY A;  3FKI J;  4IHV A;  1B9N A;  3BPX A;  5ICF A;  2DMQ A;  2AXL A;  2QQ9 A;  4GFB A;  2IGK A;  3A03 A;  1U9O A;  3PUF A;  4O3M A;  2V6E A;  3IAS 2;  1HKQ A;  2O5R A;  3DWL E;  3DV8 A;  5CVV A;  1JKP C;  4M71 A;  2Y2Z A;  4P9F A;  4MGR A;  2WAD A;  3EET A;  1ON1 A;  3PIP F;  3U1K A;  1ZGA A;  2IJL A;  3K4L A;  4XOR A;  3J81 Z;  3ERE D;  5F27 A;  2VT2 A;  4CSW A;  3M7G A;  3WOD F;  2M7B A;  3P5J A;  4U7B A;  2EIM H;  2OD5 A;  1BJZ A;  3Q9V A;  2D2W A;  4IVN A;  3SQN A;  2TRT A;  5DTD A;  3I54 A;  4XLF A;  3I55 I;  3P7N A;  3LSJ A;  1AU7 A;  2LH9 A;  3OV8 A;  1OMI A;  3M9A A;  1MNM C;  4BGD A;  2CUJ A;  2XB0 X;  2K3P A;  2RV8 A;  4XN3 A;  2COB A;  3IC7 A;  1R1T A;  4HX4 A;  3RYR A;  3K4B A;  1MZB A;  3MEX A;  4HG2 A;  2CMP A;  1BOB A;  4HNV A;  1S7A A;  1JKO C;  1ZN2 A;  3BR2 A;  3A4C A;  1WJE A;  2Q0O A;  5DV5 A;  2HPM A;  4FX0 A;  1HDD C;  1SFK A;  5E3M A;  3F72 A;  1WH7 A;  4E4H A;  3WGG A;  2FNP A;  4A3B J;  3BTJ A;  4GRI A;  1A5J A;  4RBO A;  4I2O A;  3I59 A;  2VOD A;  1LFU P;  4ANJ A;  2R5Y B;  2PJR B;  2VOP A;  3HRM A;  1SVO A;  2BY2 A;  1BI2 A;  2W24 A;  3BG6 A;  1E0E A;  1ZTR A;  2CFO A;  2NYX A;  2F4O B;  5EJC A;  2FRH A;  3SZP A;  4X1E A;  2PLY A;  2Y69 H;  5D5V B;  4KIG A;  3KYL A;  1Y56 A;  3JAM Z;  3OIO A;  4M3G A;  5A2Q Z;  3K69 A;  3CTA A;  3F8M A;  1P92 A;  2CW7 A;  4MTD A;  3BOQ A;  4Q47 A;  4A93 J;  3MKZ A;  4P55 A;  3MMY B;  3D0S A;  1RC9 A;  5EGO B;  2NRA C;  1I3A A;  4LLN A;  1TWA J;  3BRO A;  3A1Y A;  2FXA A;  4ZTJ A;  3U1D A;  5K7H A;  4IRH A;  3FMQ A;  4XOT A;  1DQU A;  4UUT A;  5FFX A;  1A04 A;  4BBR J;  3K10 A;  3H3U A;  3KET A;  1IV6 A;  4CXF A;  3J7Y J;  5F6F A;  1UG2 A;  2QQA A;  1E3O C;  5J1R A;  1IXS B;  2MAB A;  4EM0 B;  4H0E A;  4HX7 A;  1NTC A;  1IDY A;  4P5O A;  3K1M A;  1ZQ3 P;  4GO1 A;  2HNH A;  2JN6 A;  2PBI A;  1EKE A;  1Z91 A;  2M87 A;  2RKH A;  2K86 A;  4ZYG A;  1T08 B;  4AVZ A;  3I71 A;  1Y0N A;  1WH5 A;  2XSD C;  2IEK A;  1ETW A;  1VQO I;  1BIB A;  3ZQQ A;  4I99 C;  2A68 F;  1USS A;  2JMW A;  2GBY A;  3CJT B;  4CCK A;  3CDH A;  3S8P A;  2UZK A;  3HPG A;  1FIA A;  5TGT A;  4XKW A;  2V1U A;  3BR0 A;  1AKH B;  2AO9 A;  1Z9C A;  1GDT A;  3MZH A;  4GDF A;  2M9H A;  4IEJ A;  4EM1 A;  4GYI A;  2XVC A;  2VXZ A;  3S1R J;  5IP6 A;  4HPQ A;  3VPR A;  1MH4 A;  4XKB A;  4ZZL A;  1RRJ A;  1ZHF A;  1XGM A;  2V1X A;  4M9X A;  1GLN A;  5D5W B;  4U0Y A;  1SD7 A;  5KAF C;  4XOP A;  4EJT A;  5F1J A;  5IT9 Z;  3DEW A;  3GFM A;  2OCE A;  4A2U A;  5B3S H;  3WTT C;  4BXF A;  1U8R A;  2GOX B;  2L01 A;  1QPM A;  2VE9 A;  6PAX A;  1P4A A;  2VKD A;  1WPK A;  5E3N A;  2DMU A;  2XKP A;  5F1R A;  4FQG A;  2X51 A;  5J1Y A;  2IGM A;  1IO2 A;  3BG5 A;  4HST A;  3MN2 A;  5D5X B;  2KIQ A;  3HGG A;  5ERI A;  4EJW A;  3BG9 A;  3F3X A;  5LGN A;  3ONQ A;  5M5W J;  3QYE A;  4KJZ A;  4DIQ A;  2ME0 A;  2KJB A;  5CKT A;  2EIN H;  1YO5 C;  1QZY A;  2E1N A;  2M7A A;  3GFL A;  4BQN A;  3ZQH A;  4JP0 A;  1UAA A;  3SEQ A;  1U78 A;  5FLX K;  4YRV A;  4OOI A;  3CCE I;  1LVK A;  4PJ0 C;  5HLT A;  3PNV A;  4XN0 A;  2QEX I;  4OIO F;  3EUA A;  1S72 I;  3WE2 A;  1ETK A;  2HOE A;  1REP C;  1IV8 A;  2MBF A;  4A0Y A;  4XM3 A;  2LBF B;  2VJ4 A;  1S9H A;  1Z6R A;  2FBH A;  1QVT A;  3IWF A;  1ZRD A;  2EA2 A;  3WTS C;  4I01 A;  1P7I A;  4EGY A;  1MBF A;  2E1M B;  2KHM A;  2PX9 A;  4F93 B;  1S8N A;  5DD8 A;  1U3E M;  3GTK J;  3OMY A;  5ILV A;  3ML6 A;  3G73 A;  1UHW A;  1N77 A;  1VQ8 I;  5EG0 B;  2YSR A;  3S16 J;  1JGS A;  4PJJ A;  3DBR B;  4KMF A;  4YFX F;  4P96 A;  5DS9 A;  4RLF A;  4U87 A;  2R93 J;  2DXI A;  4Q5S F;  3W2A A;  3JTH A;  2AQE A;  4CCL A;  3K4C A;  3GFI A;  2VQL A;  2BW3 B;  2IP2 A;  3S1Q J;  2L9S A;  2O0Y A;  3SFI A;  1MMD A;  2MYS A;  1XD7 A;  5K5Q A;  1IJW C;  2MA3 A;  3S3O A;  1I50 J;  3TW6 A;  4R1H A;  2NNY A;  2F5D A;  3KCC A;  2E7X A;  2HTS A;  1N25 A;  3W2V A;  3J7Z I;  3HTU A;  4XSX F;  3WG9 A;  4YIF A;  3RTR A;  4C2M J;  5IP9 J;  1ETV A;  2LTP A;  2NS0 A;  3SZG A;  2OQR A;  3HOS A;  2R5Y A;  2EZH A;  2PJR A;  2X1E A;  2M3A A;  3UNG C;  2HTJ A;  3EPZ A;  3RQI A;  2LYC A;  4NC8 A;  2Y30 A;  2L7F P;  2R7S A;  4N9H A;  2KJC A;  2JA6 J;  1E2X A;  1BN5 A;  1OKR A;  2VBX A;  1S29 A;  4YII A;  3LL7 A;  3RI4 A;  1K7A A;  3AAF A;  1QA6 A;  1YJW I;  3O8H A;  1O7L A;  3CO7 C;  3S93 A;  2KRC A;  4X0G A;  1XMX A;  3RJP A;  1EH8 A;  1TZL A;  1U9N A;  4XK4 A;  4XBF A;  2LF7 A;  2EBI A;  1JJ6 C;  4ZJZ A;  3JAM K;  2WBM A;  5EGO A;  4G7H F;  3KP4 A;  2DQR A;  2PFB A;  2HDW A;  3OY9 A;  1X1D A;  4F3Q A;  1S5L C;  3AG1 H;  1HST A;  3ZMU A;  1WJF A;  2A05 A;  3KP3 A;  2XUB A;  2CSO A;  1ZEL A;  1W4M A;  2F6C A;  1EJ9 A;  1J2X A;  4A5N A;  2R7T A;  2DK5 A;  1D0Z A;  1FMV A;  5EEA A;  3QWL A;  1IUF A;  3UKG A;  4D7M A;  1JHH A;  4QPQ A;  4P9U A;  2DLL A;  4OWR B;  4KFC A;  3R6S A;  4LB5 A;  5EEG A;  3HEF A;  4M9Z A;  2CWE A;  2BEO A;  4L0Z B;  2R3S A;  2JWT A;  3TKY A;  2X6X A;  2GXB A;  4EJV A;  3H92 A;  3K0L A;  4TV7 A;  3N97 A;  1XSX A;  2MSY A;  3OYF A;  3RCO A;  4V19 K;  3SYT A;  1G3W A;  5JHF A;  3BCB A;  3JCU C;  4IOC F;  2VI6 A;  5F0F A;  1EF4 A;  3CUQ C;  3ESW B;  3P9K A;  1V4R A;  1XTA A;  4U0V A;  2JA8 J;  3W6J B;  4XQF A;  3RDI A;  1Z6T A;  1AKH A;  5K5R A;  1WZ2 A;  5BNG A;  3KPH A;  1P4W A;  1RUN A;  4UNO A;  3DTE A;  1YX3 A;  1KGS A;  1YW7 A;  3VWB A;  5LLQ A;  1BI3 A;  2JUG A;  3S32 A;  3QPS A;  2DN0 A;  5L3F A;  3HKZ N;  3BTL A;  3OYH A;  2QKM B;  2JSP A;  5LBQ A;  1T95 A;  4CYC B;  3PFY A;  1HA8 A;  1SD5 A;  2KIF A;  3VEP A;  4BXX J;  2MLG A;  1IRF A;  3HRU A;  1XMA A;  2OU2 A;  3K7A J;  4IHX A;  4IF4 A;  2VPR A;  4HF2 A;  2QA4 I;  1O7F A;  4UVA A;  3M4O J;  4YFN F;  3B73 A;  5IT9 K;  4PFP A;  1FSE A;  3HOV J;  3ZOB A;  1ETQ A;  2BXZ A;  1T98 A;  5LHG A;  1T8I A;  4CH7 A;  4XLA A;  1TNS A;  3AG3 H;  1PYV A;  4KUM A;  3CUO A;  4LOC A;  5DDG A;  4E7Z A;  3GTG J;  2NAZ A;  2Y0S A;  2BBY A;  3HPH A;  4MQV A;  3S1M J;  1WCM J;  3DKX A;  4EEF G;  1B1B A;  4HBL A;  3P9C A;  3SXY A;  2P6T A;  2YU9 J;  3FXO A;  4HF1 A;  1Y39 A;  4LB6 B;  2LBF A;  3ZMS A;  1HOM A;  5E17 F;  1V5F A;  2HEO A;  3LA3 A;  3KP5 A;  4E7S A;  1TTY A;  4EQQ A;  1L3L A;  1RIO H;  1D3Y A;  4KMU X;  2HXO A;  1MSE C;  3VFZ A;  1N78 A;  4NBQ A;  5E1Z B;  1QZZ A;  2QEN A;  3QOE A;  3GLL A;  4B4C A;  4IHY A;  3H9J A;  5FLM J;  5JI6 A;  1ORK A;  3HXL A;  4QIW N;  1Z3Y A;  5CJ9 A;  1HKS A;  1IN8 A;  4XRF A;  4RM2 A;  4IQJ A;  2Q8K A;  1MBH A;  3K2Z A;  5AIQ A;  4BAY A;  3ZQF A;  3CC2 I;  1LDD A;  1S7O A;  5HNH A;  3MQ0 A;  2FJ1 A;  2LKP A;  4ZTF A;  4IHT A;  1T0F A;  2X0L A;  5E8I A;  2R7V A;  4XLP F;  2JQ7 A;  2K7L A;  3C1D A;  1MMN A;  1UHS A;  1QPI A;  4D5F A;  2YX4 A;  2GAU A;  4EV0 A;  2KMU A;  2CUE A;  2D1H A;  3E6B A;  3IUO A;  1VQ7 I;  2A69 F;  3CP2 A;  2BW3 A;  3R60 A;  4LJZ F;  2ADU A;  4MEY F;  3K70 D;  2LOO A;  1PUF B;  1ZR4 A;  4G7O F;  1I1G A;  4BEH A;  3GXO A;  1VQ6 I;  1OR7 C;  2ELJ A;  4KYW A;  2E2J J;  3O6B B;  3BJA A;  2F2E A;  1FJL A;  2ZJ2 A;  1LNW A;  2WAE A;  1P2F A;  2D45 A;  1OCR H;  5LHI A;  5EDN A;  5H6Q A;  4XMY A;  2VL8 A;  5C44 J;  2KT0 A;  4YIR X;  1D8K A;  1A6I A;  2LDU A;  2V4J C;  2QLZ A;  4JX6 A;  5FRN A;  2Z9O A;  4HDV A;  1FSH A;  3MKY B;  2GA2 A;  5IPA A;  1LFB A;  4UUV A;  2R5Z B;  4OIP F;  4X6A J;  1BBY A;  2HVS A;  4B1R A;  4I0B A;  3TO6 A;  2QKL B;  1R7J A;  4EVI A;  1YRN B;  1HW5 A;  1H8A C;  4CHU A;  3P9I A;  1KQ9 A;  3S3N A;  2BVL A;  1KA8 A;  2O7O A;  4ENK A;  2VBW A;  3JR9 A;  1IF1 A;  3OL4 A;  2MFZ A;  4I02 A;  2K4B A;  2RGV A;  4DZP A;  3T8R A;  4S0H B;  4KA4 A;  1VQ9 I;  3NQO A;  1J75 A;  5CQG A;  3L2R A;  5KK1 A;  4MFD A;  2BGC A;  1BI1 A;  2VT3 A;  2KRF A;  3LST A;  1YJN I;  2VKV A;  2E34 A;  2B0L A;  3K9T A;  5TIS C;  5CVI A;  4HX8 A;  2M8E A;  4B47 A;  3CCM I;  1GUU A;  2CQX A;  3GWZ A;  4GGG A;  1WSU A;  4F52 A;  2ZFW A;  2EFN A;  3GTO J;  4FE4 A;  5LRS A;  1P7J A;  1UFM A;  1HKT A;  4A3D J;  1DU0 A;  2EFQ A;  3CCL I;  1HXD A;  4HSR A;  1ZH5 A;  2P7C B;  2EZI A;  2P5K A;  2GXA A;  3A2K A;  3HGY A;  1OCT C;  5GTI C;  1B72 B;  2ZBK A;  5J40 A;  1B59 A;  2HFH A;  3T1B A;  1PJR A;  4IO9 F;  3RYP A;  3KZZ A;  2BY3 A;  4LLG F;  4AWX B;  4GYG A;  1Q1H A;  4CZC A;  5HOD A;  2W4S A;  4A0X A;  5GAD J;  3KX2 A;  1GXQ A;  1SC7 A;  2O8K A;  1SFE A;  3C7J A;  2K9M A;  1OIS A;  1ITY A;  5K1Y A;  2PMH A;  4CYC A;  2EV0 A;  1Y8R B;  3OS2 A;  3H1C A;  1EV7 A;  4J19 A;  3C2B A;  2VJ5 A;  1OJL A;  2HPI A;  3KLN A;  1FOX A;  3V8K A;  3OR2 C;  4EMS A;  3JRD A;  3OYK A;  2CQ7 A;  1FEX A;  1D1C A;  5HLH A;  1WJC A;  1F36 A;  1R22 A;  1Z67 A;  2E60 A;  4G94 A;  5D4R A;  3ZP5 A;  2L02 A;  3ZR8 X;  5TRD A;  1ZRE A;  1OYI A;  1OCC H;  2FEZ A;  3L2V A;  4XIC A;  1W7P B;  1HQC A;  3CCV I;  5FLV A;  4L0Y B;  4HA8 A;  4A3G J;  2CS3 A;  2XAH A;  1T6S A;  4XKC A;  1SAN A;  4DYQ A;  1QU3 A;  2DA1 A;  1LVA A;  1RKT A;  3PNT A;  2LD5 A;  5J8F A;  3G3Z A;  1QRY A;  2QQB A;  4IXA A;  4E7H A;  2MD0 A;  1YI2 I;  2A07 F;  2HQ5 A;  1JHF A;  1OFC X;  2W1O A;  3HIF A;  3WU2 C;  2P8T A;  3F8N A;  3CMM A;  1U5T C;  4M6Y A;  5FFZ A;  4PGG A;  3IWZ A;  4BXU A;  2YX7 A;  3RPU A;  4B09 A;  2IGN A;  4C30 A;  2CH0 A;  4NB5 A;  1XX5 A;  5BOX A;  1D5V A;  3FHZ A;  3D5R C;  1IRX A;  3PUB A;  2XAU A;  2OBP A;  4RLQ A;  3L09 A;  2HWV A;  3IL2 A;  1O3T A;  4KN7 X;  1BM9 A;  5ICE A;  2QQ8 A;  4I0A A;  2DFH A;  2DA3 A;  2ZC2 A;  1G4D A;  3F6V A;  2LG4 A;  2FQ3 A;  2YS9 A;  1QVU A;  4HV5 A;  5J4V A;  3F21 A;  2FX0 A;  4MQ9 F;  1LE8 B;  4XRS G;  1UJ8 A;  1P4X A;  1WHU A;  1WJB A;  1BR2 A;  2HOA A;  4RB0 A;  5HDG A;  2HI3 A;  1VI0 A;  4Y17 A;  3VYU B;  4AVP A;  4AU7 A;  4KIT B;  3ZN0 A;  5H2F C;  4BE2 A;  4E7J A;  4BQA A;  4OU0 A;  2Y48 A;  3QPT A;  3ERM A;  2EWN A;  3H36 A;  4BHP A;  2K5C A;  2R0Q C;  4LD5 A;  2WA0 A;  3WTW C;  1XGO A;  1A35 A;  3V8L A;  4Z6Y A;  4H4K C;  1PUF A;  1N75 A;  4JOM A;  2DT5 A;  4XKV A;  3U21 A;  1X4O A;  1H89 C;  1LE8 A;  2HYG D;  5HDK A;  5LGT A;  4K2E A;  2LLK A;  3GZN B;  1KYW A;  1WQ2 A;  1GT0 C;  2MC3 A;  4FE7 A;  4ETS A;  3V7S A;  4BH9 A;  2VAS A;  2R4G A;  3HG9 A;  2A5Y B;  1BOA A;  4RGS A;  3LSP A;  1DGW Y;  3K1N A;  4KIB A;  4D7N A;  3U9G A;  2MG4 A;  2GM4 A;  1EH6 A;  3OR1 C;  3LA2 A;  2G7H A;  1FIP A;  3BT9 A;  3CJQ B;  2ZFU A;  3GTJ J;  2Z3Y A;  1T2K A;  3HBL A;  2DMP A;  2R5Z A;  3G2B A;  3U2R A;  5F0H A;  3FMR A;  5GAG J;  4A3M J;  2LY9 A;  1P6R A;  4M73 A;  4PJN A;  1XSD A;  5D8K B;  2J5O A;  4OIQ F;  1YRN A;  2VC1 A;  2ZJR F;  2CQK A;  4IRI A;  3J80 Z;  4KIC A;  1H0M A;  2PG4 A;  4XR6 A;  2CV2 A;  2QCO A;  2VBZ A;  1QBJ A;  2L7K A;  1BIA A;  2F5E A;  2Q2E B;  3FZV A;  4L5J A;  1ONV A;  2WV1 A;  4BE0 A;  2HKX A;  4LLL A;  1AHD P;  2P5L C;  3FHN A;  2RQP A;  1ZRF A;  2LVS A;  3QYB A;  4C3J J;  3EUK L;  3FM3 A;  3UR3 C;  1ENH A;  1RZ4 A;  3H5N A;  1ZG1 A;  3CME I;  1JXS A;  5EZG A;  2GOM A;  2CO5 A;  3GLX A;  3V7R A;  2YU3 A;  2XAS A;  1BR4 A;  1ULY A;  2DJI A;  4CCO A;  1KU2 A;  4DGW B;  4RS8 A;  4UVB A;  1C0W A;  2HR3 A;  3IP4 B;  1VQ4 I;  4RAY A;  2B7E A;  1SAU A;  1UHM A;  2VKH A;  4CIC A;  1XDU A;  5D6E A;  3JRF A;  3HOT A;  3H5A A;  2K02 A;  1PP8 F;  1T38 A;  3LSM A;  3GTM J;  5LRR A;  2VQH A;  1FMW A;  2PI0 A;  2EJR A;  1B6A A;  3LAP A;  3BC8 A;  5DUI A;  3JRH A;  1CF7 B;  1B72 A;  4A3K J;  2HZD A;  2KIU A;  1KQ0 A;  2R7X A;  2EQR A;  2ZXI A;  2AXT C;  4L9J A;  3R0A A;  1FNN A;  4L9V A;  4A3C J;  3RKY A;  3QP5 A;  3CCU I;  2H94 A;  1LB2 A;  4C2U A;  3LMM A;  3M1C A;  2LP0 A;  5FKN A;  2HQR A;  1WRJ A;  2DAO A;  2LFB A;  1LJ9 A;  5FKK A;  5GPA A;  1FOY A;  2DDB A;  1I3Q J;  2JA5 J;  3QU3 A;  4U7D A;  1X19 A;  3E5X A;  5IYD J;  4BDZ A;  3Q9S A;  4JQF A;  4KT5 C;  4MO7 A;  4F92 B;  1LDJ A;  1X2M A;  1XC5 A;  2E7W A;  1F5T A;  3R4K A;  1B9M A;  1MNE A;  1NK2 P;  3K4N A;  4LIV A;  4YG2 F;  4UUS B;  1V54 H;  2ESN A;  4UV8 A;  2VJJ A;  5E3O A;  2Y75 A;  3S2W A;  3E5U A;  3BR1 A;  4ZC3 A;  1M1E B;  2G9W A;  2WB1 A;  1G8X A;  5TJJ A;  4CO8 A;  3KZI C;  5IOY A;  2DMN A;  1VZ0 A;  2OV7 A;  3BLY A;  1W7P A;  3GZ5 A;  4PGH A;  5IYC J;  1FTT A;  2EFP A;  2KZG A;  2M1B A;  3L00 A;  4JX4 A;  3GUD A;  5EEH A;  2XF5 A;  2WY8 Q;  1G3Y A;  2DO7 A;  1NG6 A;  3SFZ A;  4PDK A;  2CG4 A;  1FT9 A;  3CJR B;  3EUH C;  4Y15 A;  2JTV A;  1IN7 A;  3IAM 2;  5IY5 H;  1FZP B;  3TL4 X;  1KQ8 A;  3KE2 A;  4UXN A;  2CU7 A;  2OPT A;  1B4A A;  5DUK A;  4KIF A;  4FT8 A;  3VYT B;  3S14 J;  3RSN A;  2V1N A;  4UV9 A;  1U2W A;  5KHD A;  3PO2 J;  4S05 A;  4BE1 A;  3JRA A;  2H1L A;  3H3Z A;  4BDY A;  2RNJ A;  2K85 A;  2QF7 A;  1R9T J;  2Y31 A;  4EJU A;  1HBX G;  2B63 J;  3ABM H;  4PSX A;  4LGW A;  2LF8 A;  2ZO4 A;  3Q3S A;  4V2F A;  1FBU A;  1D0Y A;  5L3E A;  2E2H J;  2X1D A; 
#chains in the Genus database with same CATH homology
 2JT1 A;  2QBY B;  2OZU A;  2HKO A;  5LEK A;  3BY6 A;  2OZ6 A;  2LSO A;  3CUQ B;  1YLF A;  1XMK A;  2PQ8 A;  2XV4 S;  5DD4 A;  3J81 K;  4ESB A;  3OOP A;  3V7C A;  3RKX A;  4WXH A;  1JE8 A;  3ISP A;  3GF2 A;  2FNA A;  3D5L A;  4HV6 A;  1O3Q A;  3E6C C;  1R1V A;  4NHJ A;  4U0W A;  1FYM A;  4CDG A;  2PN6 A;  2DFI A;  1LEA A;  2HS5 A;  2IA0 A;  2ISZ A;  1W7P D;  2ZXJ A;  4B8X A;  4LMY A;  3ABU A;  1TQP A;  4MHG A;  2RDP A;  2QZ8 A;  1ZAR A;  2A6H F;  2Q2E A;  3IRQ A;  3I64 A;  5HVQ C;  3I58 A;  1SD6 A;  4G8X A;  1XB4 A;  4CYD A;  2HZT A;  4KNY A;  5A2Q K;  4RB1 A;  5DYM A;  1KU9 A;  2O3F A;  3GZ6 A;  3TDZ C;  1FLI A;  3KEQ A;  4UVC A;  1IAW A;  2GIV A;  1YW8 A;  5HOO A;  3F8F A;  2X4H A;  1FY7 A;  1G3T A;  1J59 A;  2L54 A;  2KIM A;  1R23 A;  2R7F A;  3DXJ F;  4BHB A;  1RUO A;  1CF7 A;  2IA1 A;  2XHK A;  2XKO A;  1TW3 A;  3E5Q A;  3M8E A;  3REO A;  3DP7 A;  5D6F A;  2L3D A;  1DP7 P;  2STT A;  3HSF A;  4BNC A;  1NHA A;  3KP6 A;  5HDN A;  4Y13 A;  2VON A;  1MJA A;  4ZYE A;  1F4K A;  3GX4 X;  4OMZ A;  3LA7 A;  2FF4 A;  3V4G A;  2DQL A;  5IT3 A;  3COA C;  2XGX A;  1PDN C;  3HRT A;  5DCM B;  4HOB A;  4HW0 A;  3ROU A;  4LG0 B;  1UST A;  1OYW A;  5JVT A;  4RB2 C;  1TLH B;  5L3D A;  5JFR A;  2ACJ A;  1GVJ A;  3TOA A;  1H9G A;  1XGS A;  1ZAO A;  4WWC A;  1YG2 A;  2BYV E;  2W84 A;  2Z33 A;  4WCG A;  2O61 A;  3ZMT A;  1OYY A;  2DBB A;  5LEJ A;  5D4S A;  3NRV A;  2QBY A;  4WXC A;  4HLX A;  1R00 A;  3WGH A;  2J5P A;  4XSZ F;  3CUQ A;  1J5Y A;  3BWG A;  3MCZ A;  1FWZ A;  1IN6 A;  4KDP A;  1HW2 A;  3E97 A;  3TO7 A;  2P4W A;  5HLG A;  3TO9 A;  4WX9 A;  1I27 A;  3QU6 A;  4HF0 A;  4RGU A;  4G6Q A;  3LQR A;  4A12 A;  3LAJ A;  3FXR A;  2DPU A;  1J7K A;  4PZJ A;  4U88 A;  3F8B A;  3GYH X;  1CGP A;  2KKO A;  4CGZ A;  4HZF A;  5H6R A;  2Y0M A;  1L0O C;  3HHG A;  3HRS A;  3CJN A;  5DCF A;  2BV6 A;  4I7H A;  2V79 A;  1J9I A;  3QOP A;  1MD0 A;  1U5T B;  2EK5 A;  1STZ A;  1MKM A;  2FBI A;  1PUE E;  3BZ6 A;  3ULQ B;  2YPR A;  1SFX A;  5DEQ A;  5H20 A;  2ZME B;  4EGZ A;  4AIK A;  5CVR A;  1O3S A;  1KU3 A;  3LQQ A;  5ICG A;  3KEO A;  1XN7 A;  5LGU A;  4L9N A;  1PP7 U;  1R36 A;  2EB7 A;  5E18 F;  2CFX A;  4WF2 A;  1WI9 A;  5LHH A;  1KYZ A;  1IN5 A;  5FB2 A;  3M8F A;  3C18 A;  4A0Z A;  5E20 A;  1IXR C;  3KP2 A;  1OR7 A;  4WXD A;  2A61 A;  3BJO A;  1SMT A;  1IRG A;  2IPQ X;  2DI3 A;  2HYF A;  5L3G A;  4ZH4 F;  5FO5 A;  2JSC A;  3QPH A;  1ZG5 A;  2UXN A;  4KN4 X;  1R5G A;  2VE8 A;  4M9S A;  4JBA A;  1XCV A;  4MEX F;  2PMU A;  4BHC A;  1K79 A;  5DCM A;  2GZW A;  4LG0 A;  3VOD A;  3EYI A;  2L4A A;  2VN2 A;  1MJ9 A;  5BPI A;  1ZRC A;  4LK1 F;  3BJ6 A;  4UHT A;  1QGP A;  1X3U A;  3O3K A;  4CZZ A;  1Z05 A;  3I0T A;  5J8C A;  3WU1 B;  2NNN A;  1FBQ A;  1Z7U A;  1R5H A;  1XGN A;  4FHT A;  3I4P A;  2GA1 A;  2O03 A;  1S3J A;  2GXG A;  5BMZ A;  4RGR A;  3Q5F A;  2WC2 A;  2WWY A;  3ZPL A;  1J0R A;  1V3F A;  4GXO A;  3HYI A;  2EA4 A;  5E1X A;  2O8X A;  5ICC A;  3ZMD A;  3EQL F;  4G9Y A;  3VB2 A;  1RNL A;  2DPD A;  2MLK A;  3TOB A;  3WTX C;  2HQN A;  5FD5 A;  3T0Y A;  1S6L A;  3F8C A;  1FYL A;  4LFU A;  4HLY A;  4N0B A;  5CVU A;  5AON A;  5K5O A;  2A3S A;  3DF8 A;  2Z99 A;  3IKT A;  3R0J A;  4BYY A;  3DPT A;  2QUF A;  5L3C A;  4O6J A;  4AD9 A;  3GO5 A;  1U5T A;  3FXU A;  2MH9 A;  5HLI A;  2P5V A;  1DPR A;  2RC4 A;  2RN7 A;  2JPC A;  1U6G A;  2ZME A;  4HAM A;  3CLO A;  3VOE A;  1VTN C;  4ZYD A;  2XAF A;  1YS6 A;  1XCB A;  1HW1 A;  4HQE A;  3JW4 A;  3HHH A;  4IRG A;  4WK8 F;  3HSE A;  5J6X A;  2FE3 A;  4QLC U;  2CW0 F;  3WU0 A;  1RI7 A;  4IJA A;  1F1Z A;  2CYY A;  2ZNY A;  4OIR F;  3V8J A;  2C6Y A;  4L18 B;  2E1C A;  3HUG A;  4L5I A;  2EFW A;  4DQ2 A;  3PQJ A;  3C3W A;  2RVC A;  1DDN A;  2IA2 A;  2K4J A;  3N4M A;  4EJO A;  4MNU A;  4ENM A;  3PFI A;  2XIG A;  2FOK A;  1XSV A;  4O5V A;  2D1V A;  1BJA A;  4G7Z F;  3NEU A;  2IRF G;  5ED4 A;  3MAJ A;  4HQM A;  5CVJ A;  4AIJ A;  2BE5 F;  3LWF A;  2TDX A;  1EH7 A;  3E3V A;  3KP7 A;  3FM5 A;  2FMY A;  5BQT A;  3FMS A;  3SZT A;  3KZY A;  3TDU C;  3PQK A;  4DNC A;  3O2P E;  2FBK A;  1IUY A;  5F64 A;  3ZMZ A;  3HSR A;  1G3S A;  2M5W A;  5D8L B;  1QO0 D;  2FSW A;  3JSP A;  2FU4 A;  2IVM A;  1IN4 A;  3R61 A;  2H27 A;  1MDM B;  1I1S A;  1K78 B;  3ECH A;  2EFO A;  1K6O A;  4PCQ A;  1TQM A;  3ZN1 A;  2FA5 A;  3TGN A;  3MWM A;  3L2C A;  3ECO A;  3I53 A;  1GXP A;  3GEZ A;  3F22 A;  2HDC A;  2ZCW A;  3DEU A;  1WKM A;  3T8T A;  2MH2 A;  3EUH A;  2F5F A;  1TW2 A;  4ENN A;  2H09 A;  1G6N A;  3MZY A;  3FXQ A;  4OIN F;  2V6C A;  2H6C A;  2LNB A;  3LFK A;  5HS9 A;  4HYE A;  1ZYR F;  1LDK B;  1YYV A;  1FP2 A;  1YS7 A;  2OQG A;  3WTY C;  3J80 K;  3L7W A;  1IZ1 A;  5BS6 A;  2M45 A;  2K27 A;  2L4M A;  4ENJ A;  4LK0 F;  1BI0 A;  3F23 A;  3K1P A;  1QNT A;  3DPL C;  5ILU A;  5AIP A;  2ZKZ A;  1IXC A;  1LQ1 A;  3FX3 A;  1UCR A;  1SMY F;  2P6S A;  3KLO A;  4GCV A;  1YQA A;  3GVA A;  2AS5 F;  1QQI A;  1ODD A;  4ON0 A;  4XLN F;  4Z2Y A;  3I5U A;  2XAG A;  4QWQ A;  5CLS A;  1R1U A;  1BC8 C;  3TQN A;  3F6O A;  2MD5 A;  4A6D A;  4F7Z A;  3DFG A;  2XAJ A;  4G6D A;  1FC3 A;  2ESH A;  2R7D A;  3W6K B;  3JTG A;  2V9V A;  4M6X A;  1WWX A;  5JR3 A;  5HS8 A;  2JRT A;  4MTE A;  2QWW A;  4ESJ A;  5L3B A;  3IKV A;  4S04 A;  2UWM A;  1ZLK A;  2O6G E;  1TNT A;  2W25 A;  1DUX C;  3RKW A;  4AIH A;  5ILS A;  1TQI A;  1GHC A;  2ISY A;  2QYO A;  4FX4 A;  3E6D A;  2XRN A;  4RGX A;  4E70 A;  3ZQ7 A;  3DQV C;  2OAZ A;  2H6B A;  1FX7 A;  1MJB A;  2DU9 A;  3WGI A;  1YIO A;  2A6E F;  4RB3 C;  1W5T A;  2W57 A;  2IT0 A;  3DKW A;  1BC7 C;  4NQW A;  2EV6 A;  4JK1 X;  3WE3 A;  2W85 A;  1F9N A;  3FF5 A;  1FOK A;  2STW A;  2G7U A;  4D0P A;  3KFW X;  3ABT A;  1MDM A;  3GW2 A;  1K78 A;  1FP1 D;  4L9T A;  1FPQ A;  1TBX A;  3M1E A;  4RAZ A;  1Z1D A;  1LEB A;  2DK8 A;  1IW7 F;  2IW5 A;  3BDD A;  2VC0 A;  3MFK A;  4I98 B;  3WTZ A;  3QRF F;  1T39 A;  4R79 A;  3GFJ A;  3J7A O;  5FGM A;  5E1W A;  2XRO A;  4ASN A;  2HGC A;  3EDP A;  5FD6 A;  1ZLJ A;  4IHS A;  3JSO A;  4M74 A;  2YR2 A;  4ZZD A;  4ESF A;  4A5M A;  3ELK A;  4ZYH A;  1R58 A;  3CO6 C;  1YTY A;  4A6E A;  3I59 B;  5HS7 A;  2DTR A;  5E8G A;  3IHU A;  2PJP A;  3BPV A;  2CGP A;  4Q48 A;  1FBS A;  1I6X A;  2XAQ A;  2QVO A;  1I5Z A;  1ZG3 A;  3ZMV A;  4YFK F;  1SD4 A;  4R8H A;  2GQQ A;  3WTV C;  1YW9 A;  2GWR A;  4IPA A;  3QAH A;  1O3R A;  2P7V B;  2UXX A;  2WV0 A;  2PEX A;  4N9I A;  1DPU A;  1UB9 A;  1SFU A;  1AWC A;  3RPQ A;  2QM3 A;  3RIR A;  2COM A;  2ETH A;  2F5C A;  1SAX A;  2V1D A;  2M30 A;  3HTS B;  3B02 A;  3QP6 A;  3SHF A;  2VBY A;  3E6M A;  1H9T A;  1YFH A;  3FWE A;  2JPB A;  2JZY A;  1W5S A;  2OA4 A;  3BP8 A;  4Q4Z F;  2Z5U A;  4I09 A;  1Y0U A;  5BPD A;  1ON2 A;  3EYY A;  2EV5 A;  1E17 A;  3WTU C;  1ZGJ A;  3T5X A;  4EM2 A;  2ELH A;  1KU7 A;  5JHU A;  5FLX Z;  4HDU A;  1HSJ A;  2WTE A;  5KVR A;  3IRR A;  3L9F A;  1FYK A;  4M72 A;  5D5U B;  2ZNZ A;  4OMY A;  2FML A;  1MGT A;  1XDS A;  2VOO A;  5CYV A;  2DW4 A;  1O57 A;  1D8J A;  1OPC A;  1AOY A;  1B9N A;  3BPX A;  5ICF A;  2AXL A;  2QQ9 A;  4O3M A;  1HKQ A;  3DV8 A;  5CVV A;  4M71 A;  4P9F A;  4MGR A;  3EET A;  1ON1 A;  1ZGA A;  2IJL A;  3J81 Z;  3ERE D;  2VT2 A;  3M7G A;  3WOD F;  4U7B A;  2OD5 A;  3Q9V A;  2D2W A;  4IVN A;  3SQN A;  3I54 A;  3P7N A;  3OV8 A;  1OMI A;  3M9A A;  2RV8 A;  3IC7 A;  1R1T A;  4HX4 A;  3RYR A;  1MZB A;  3MEX A;  1S7A A;  1ZN2 A;  2Q0O A;  5DV5 A;  4FX0 A;  3F72 A;  3WGG A;  2FNP A;  4I2O A;  3I59 A;  2VOD A;  2VOP A;  3HRM A;  1BI2 A;  2W24 A;  2NYX A;  2FRH A;  3SZP A;  2PLY A;  5D5V B;  4KIG A;  3JAM Z;  5A2Q Z;  3K69 A;  3CTA A;  3F8M A;  1P92 A;  4MTD A;  3BOQ A;  4Q47 A;  4P55 A;  3D0S A;  2NRA C;  4LLN A;  3BRO A;  2FXA A;  3U1D A;  4IRH A;  3FMQ A;  5FFX A;  1A04 A;  3H3U A;  3KET A;  4CXF A;  5F6F A;  2QQA A;  1IXS B;  4EM0 B;  4H0E A;  4HX7 A;  4P5O A;  3K1M A;  4GO1 A;  2PBI A;  1Z91 A;  2M87 A;  2RKH A;  2K86 A;  4ZYG A;  3I71 A;  1BIB A;  2A68 F;  1USS A;  3CDH A;  2UZK A;  2V1U A;  1Z9C A;  3MZH A;  4EM1 A;  4GYI A;  2XVC A;  2VXZ A;  4ZZL A;  1ZHF A;  1XGM A;  2V1X A;  4M9X A;  5D5W B;  4U0Y A;  1SD7 A;  4EJT A;  5IT9 Z;  3GFM A;  4A2U A;  3WTT C;  1U8R A;  2L01 A;  1QPM A;  2VE9 A;  6PAX A;  1P4A A;  2XKP A;  5F1R A;  5D5X B;  5ERI A;  4EJW A;  3F3X A;  5LGN A;  2KJB A;  1YO5 C;  1QZY A;  2E1N A;  3GFL A;  1U78 A;  5FLX K;  4OOI A;  4OIO F;  3WE2 A;  2HOE A;  1REP C;  2MBF A;  4A0Y A;  1Z6R A;  2FBH A;  3IWF A;  1ZRD A;  2EA2 A;  3WTS C;  4I01 A;  4EGY A;  1S8N A;  5DD8 A;  1U3E M;  5ILV A;  3ML6 A;  3G73 A;  1UHW A;  2YSR A;  1JGS A;  4KMF A;  4YFX F;  4P96 A;  4Q5S F;  3JTH A;  3GFI A;  2IP2 A;  2O0Y A;  1XD7 A;  5K5Q A;  2MA3 A;  4R1H A;  2NNY A;  2F5D A;  3KCC A;  2E7X A;  2HTS A;  3HTU A;  4XSX F;  3WG9 A;  4YIF A;  3RTR A;  2NS0 A;  3HOS A;  2OQR A;  2HTJ A;  4N9H A;  2KJC A;  1E2X A;  1BN5 A;  1OKR A;  2VBX A;  1S29 A;  4YII A;  3RI4 A;  1K7A A;  3AAF A;  1O7L A;  3CO7 C;  3RJP A;  1EH8 A;  4XBF A;  2LF7 A;  3JAM K;  4G7H F;  3KP4 A;  2DQR A;  2PFB A;  1HST A;  3ZMU A;  3KP3 A;  2XUB A;  2CSO A;  1W4M A;  1J2X A;  4A5N A;  2DK5 A;  1JHH A;  4P9U A;  2DLL A;  4LB5 A;  4KFC A;  3R6S A;  5EEG A;  4M9Z A;  2CWE A;  2BEO A;  4L0Z B;  2R3S A;  3TKY A;  2GXB A;  4EJV A;  3H92 A;  3K0L A;  4TV7 A;  3N97 A;  1XSX A;  1G3W A;  3CUQ C;  3P9K A;  1V4R A;  4U0V A;  3W6J B;  3RDI A;  1Z6T A;  5K5R A;  4UNO A;  1P4W A;  1RUN A;  1KGS A;  1YW7 A;  5LLQ A;  1BI3 A;  5L3F A;  5LBQ A;  1SD5 A;  2KIF A;  3VEP A;  2MLG A;  1IRF A;  3HRU A;  1XMA A;  2OU2 A;  4IF4 A;  4HF2 A;  1O7F A;  4UVA A;  4YFN F;  3B73 A;  5IT9 K;  1FSE A;  1T98 A;  5LHG A;  1TNS A;  4KUM A;  3CUO A;  5DDG A;  2NAZ A;  2BBY A;  4MQV A;  1B1B A;  4HBL A;  3P9C A;  3SXY A;  2P6T A;  4HF1 A;  4LB6 B;  3ZMS A;  5E17 F;  2HEO A;  3LA3 A;  3KP5 A;  1TTY A;  4EQQ A;  1L3L A;  1RIO H;  1D3Y A;  4KMU X;  3VFZ A;  5E1Z B;  1QZZ A;  2QEN A;  5JI6 A;  5CJ9 A;  1HKS A;  1IN8 A;  4XRF A;  2Q8K A;  3K2Z A;  5AIQ A;  4BAY A;  1LDD A;  1S7O A;  3MQ0 A;  2LKP A;  4IHT A;  1T0F A;  2X0L A;  5E8I A;  4XLP F;  2K7L A;  3C1D A;  2YX4 A;  2GAU A;  4EV0 A;  2D1H A;  3E6B A;  2A69 F;  3R60 A;  4LJZ F;  2ADU A;  4MEY F;  4G7O F;  1I1G A;  3GXO A;  4KYW A;  3O6B B;  3BJA A;  2F2E A;  2ZJ2 A;  1LNW A;  1P2F A;  2D45 A;  5LHI A;  5H6Q A;  1D8K A;  2LDU A;  2QLZ A;  2Z9O A;  4HDV A;  1FSH A;  2GA2 A;  4UUV A;  4OIP F;  1BBY A;  4I0B A;  3TO6 A;  1R7J A;  4EVI A;  1HW5 A;  4CHU A;  3P9I A;  1KQ9 A;  1KA8 A;  4ENK A;  2VBW A;  1IF1 A;  4I02 A;  2K4B A;  2RGV A;  3T8R A;  4KA4 A;  3NQO A;  1J75 A;  5KK1 A;  2BGC A;  1BI1 A;  2VT3 A;  2KRF A;  3LST A;  2B0L A;  3K9T A;  5CVI A;  4HX8 A;  2M8E A;  3GWZ A;  4GGG A;  1WSU A;  2ZFW A;  2EFN A;  5LRS A;  1UFM A;  1HKT A;  2EFQ A;  1HXD A;  1ZH5 A;  2P7C B;  2P5K A;  2ZBK A;  1B59 A;  2HFH A;  3T1B A;  3RYP A;  3KZZ A;  4LLG F;  4AWX B;  4GYG A;  1Q1H A;  4A0X A;  1GXQ A;  1SFE A;  3C7J A;  5K1Y A;  2PMH A;  2EV0 A;  1EV7 A;  3KLN A;  3V8K A;  4EMS A;  5HLH A;  1R22 A;  3ZP5 A;  1ZRE A;  4G94 A;  5D4R A;  5TRD A;  2L02 A;  1OYI A;  2FEZ A;  1W7P B;  1HQC A;  4L0Y B;  4HA8 A;  2XAH A;  1T6S A;  1LVA A;  5J8F A;  3G3Z A;  2QQB A;  4IXA A;  2A07 F;  1JHF A;  3HIF A;  2P8T A;  3F8N A;  5FFZ A;  1U5T C;  4M6Y A;  4PGG A;  3IWZ A;  4BXU A;  2YX7 A;  3RPU A;  4B09 A;  4NB5 A;  5BOX A;  1D5V A;  3FHZ A;  2OBP A;  3L09 A;  2HWV A;  3IL2 A;  1O3T A;  4KN7 X;  1BM9 A;  5ICE A;  4I0A A;  1G4D A;  3F6V A;  2FQ3 A;  4HV5 A;  3F21 A;  4MQ9 F;  1P4X A;  4RB0 A;  5HDG A;  4Y17 A;  4AVP A;  3ZN0 A;  4BQA A;  4OU0 A;  2Y48 A;  3QPT A;  2EWN A;  4BHP A;  4LD5 A;  3WTW C;  1XGO A;  3V8L A;  2DT5 A;  2HYG D;  5HDK A;  5LGT A;  4K2E A;  1KYW A;  1WQ2 A;  2MC3 A;  4ETS A;  3V7S A;  4BH9 A;  2A5Y B;  1BOA A;  4RGS A;  3K1N A;  4KIB A;  3U9G A;  1EH6 A;  3LA2 A;  2G7H A;  2Z3Y A;  1T2K A;  3U2R A;  3FMR A;  1P6R A;  4M73 A;  1XSD A;  5D8K B;  2J5O A;  4OIQ F;  2VC1 A;  2CQK A;  4IRI A;  3J80 Z;  4KIC A;  1H0M A;  2PG4 A;  1QBJ A;  2VBZ A;  1BIA A;  2F5E A;  3FZV A;  4L5J A;  1ONV A;  2HKX A;  4LLL A;  2P5L C;  2RQP A;  1ZRF A;  3FM3 A;  1RZ4 A;  1ZG1 A;  1JXS A;  2CO5 A;  3GLX A;  3V7R A;  2YU3 A;  2XAS A;  1ULY A;  1KU2 A;  4RS8 A;  4UVB A;  1C0W A;  2HR3 A;  4CIC A;  4RAY A;  1UHM A;  1XDU A;  5D6E A;  3HOT A;  2K02 A;  1PP8 F;  1T38 A;  5LRR A;  2PI0 A;  2EJR A;  1B6A A;  3LAP A;  5DUI A;  1CF7 B;  2KIU A;  1KQ0 A;  4L9J A;  3R0A A;  1FNN A;  4L9V A;  3RKY A;  3QP5 A;  1LB2 A;  2H94 A;  2HQR A;  1WRJ A;  2DAO A;  1LJ9 A;  4U7D A;  3QU3 A;  3E5X A;  3Q9S A;  4JQF A;  4KT5 C;  1LDJ A;  2E7W A;  1F5T A;  3R4K A;  1B9M A;  4YG2 F;  2ESN A;  4UV8 A;  2Y75 A;  3S2W A;  3E5U A;  2G9W A;  5TJJ A;  4CO8 A;  1W7P A;  3GZ5 A;  4PGH A;  2EFP A;  2M1B A;  3L00 A;  3GUD A;  5EEH A;  1G3Y A;  2DO7 A;  3SFZ A;  4PDK A;  2CG4 A;  1FT9 A;  4Y15 A;  2JTV A;  1IN7 A;  1FZP B;  1KQ8 A;  3KE2 A;  4UXN A;  1B4A A;  5DUK A;  4KIF A;  4FT8 A;  4UV9 A;  1U2W A;  4S05 A;  3H3Z A;  2RNJ A;  4EJU A;  1HBX G;  4LGW A;  2LF8 A;  2ZO4 A;  1FBU A;  5L3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...