3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
3UFXA 4RZHA 3HSRA 4GX1A 2DPGA 4W99A 3RKUA 4QUKA 1YDWA 2YW9A 2O6GE 2J5OA 1B26A 1QYCA 3D5QA 3JQFA 4XYMA 4BO0A 1H6DA 2PLYA 2GF2A 4BKQA 3OIFA 3KZVA 1V3UA 2Q99A 3J81Z 1FOKA 1H9BA 2CDAA 3RBZA 4IDEA 5CDTA 2BHLA 1AGNA 1C0PA 4HNHA 4AJ2A 1HYHA 4RVGA 3GZ4A 3DPLC 2KIMA 3FMRA 4MQVA 1NBOA 3CXRA 3WJ7A 2HCTA 4RQTA 1T6SA 3TO9A 3ROUA 3BMNB 3EZLA 4E32A 4R5HA 2H6CA 4L18B 4HBGA 4FB5A 2BV6A 5LRRA 3HDHA 4W6ZA 1SD7A 5L53A 2LKPA 4N5MA 3DONA 5TS3A 1XA0A 3NRVA 2V6GA 3GZNA 4FGSA 4NJMB 3FWNA 2BD0A 5HOOA 4TSKA 3I5UA 4BGVA 4HZFA 4M8SA 4U6SA 5D5XB 5IZ4A 5FFZA 2K02A 1ZMOA 2Y1FA 5GZ1A 2B4RO 4OIMA 4R01A 2PZMA 4IZHA 3V4GA 3K31A 1I3LA 1ZG1A 4ZH4F 3GPIA 4Z9YA 1YW9A 2F5EA 3ZP5A 1NQAO 1PEDA 3LT1A 4GMGA 4LRSB 2WD7B 4GSLA 4D42A 4RPHA 3DZHA 4WXDA 3GT0A 3J7AO 4J2HA 2OOSA 1F06A 1TA4A 1FBSA 5B4VA 1U5TC 2HYGD 3E8XA 1U4OA 4MPDA 1A4UA 1X14A 2YHIB 4IJKA 1XYGA 4BNMA 3VPFA 4CM4B 3PYXA 3MEQA 5EQDA 1VI2A 3CSDA 2OBPA 3WNVA 2ZYGA 3Q9NA 2O4CA 4YJGB 2KJCA 2FNPA 5CVUA 4BHCA 2H27A 4AJIA 1R1TA 5LHGA 5ER9A 3HG7A 2QX7A 3L4BC 3NGLA 1B9NA 2HS5A 1E3WA 2RGVA 2Y0DA 5JPIA 4Z6KA 1GQQA 2F5FA 2VWQA 3IWFA 5BPIA 1SD6A 1P4WA 4ZYEA 1F4KA 1K0UA 4A0YA 1DAOA 1ZJYA 3PP8A 4YAGA 2ESNA 2K86A 3D5TA 1K6XA 1RNLA 4J7CA 3SX2A 1HTBA 3BTOA 3EETA 4HX7A 4HF2A 1E7YA 4IDDA 1YJ8A 3SXPA 2QQAA 1OMIA 2D2WA 4R1SA 3WOHA 3WWYA 3CLOA 3R4KA 4GYIA 4DXHA 5FEUA 4FFNA 2DBRA 4ND3A 1OR7A 4HNGA 3WTCA 3WGIA 1UXHA 1KVTA 5KWEA 5HDKA 4ZZDA 2STTA 1Q7CA 1YL6A 2ZQZA 2HSDA 3GH3A 3H7AA 3QRWA 4L75A 3RI4A 2GCGA 3NX4A 4KP7A 2Y1GA 3ZMZA 3WSWA 4R16A 3S2GA 1B7GO 1QQIA 3IWZA 2CVQA 5LHHA 2X5KO 1HLPA 4KDPA 1BI3A 3HTUA 5CAEA 5CDGA 4NJMA 3RPUA 2V65A 3I9JA 2ZNYA 1YJQA 5DULA 2FZWA 3JD4A 4QEDA 1HF3A 4XGNA 4PG5A 1TEHA 3VKUA 1FLIA 5LBQA 3QQPA 4G9YA 3D4NA 5AONA 4NHEA 3CUQB 3CTAA 2VZ9A 3R60A 4FX4A 4KIGA 1PL8A 1Y81A 1FMCA 3FI9A 2B0JA 4D41A 3PZRA 3WTWC 2JPBA 3D5LA 1DEHA 2Z5LA 5A2QZ 1XDUA 2RNJA 1MP0A 2HKIA 2NWQA 3IQDB 4WOKA 5AOVA 5KKAA 5I9LA 4J2OA 4I9NA 3C7CB 1C1DB 4ZVVA 3AUUA 3D64A 3WX0A 2WYVA 2EFOA 1E17A 4BNXA 4BNUA 4EMSA 4WWCA 4E4YA 1LB2A 2O7QA 4I8XA 3I4PA 2QZ8A 4CLEA 5B4UA 4JCOA 5AXCA 1UCRA 1W5TA 4WCDA 1WP4A 4XB1A 1N1GA 3JTMA 3RPQA 2G1UA 2ISZA 1QO0D 4G6DA 1RYDA 4XB2A 1I33A 4B09A 2BI7A 2A6HF 1UUFA 5JR3A 3OETA 5H81A 2VBWA 5FD6A 1LDNA 4KWHA 3KE2A 2XAJA 1GZ6A 2HZTA 2EEZA 1WAMA 3M8FA 3LA3A 3F8BA 3K92A 1XD7A 2F2EA 1ZK4A 1YQXA 4BO2A 4EW6A 1XCVA 5IAAA 3JQDA 3T4EA 2DW4A 3C7AA 3RJPA 3F6YA 4AJNA 3KLMX 3R0IA 2K4BA 2PG4A 4EJVA 4YT5A 4KDFA 4Z3DA 4MVJI 3TGNA 3L6DA 3W8EA 3K5PA 2DLLA 1MJ9A 3BROA 2GR9A 3N74A 2VBXA 3ITKA 4CQLB 2NADA 4FFMA 3ONEA 2P6TA 3D1LA 4BNZA 2C2YA 1N5DA 4YAIA 2C7VA 2HTSA 2DBQA 2NU8A 3BAZA 1XGNA 1JE8A 3TFOA 1PJ4A 3LLVA 1PL6A 4EV0A 4E5MA 4RPGA 2DK5A 1UP7A 4XSZF 1ZFNA 4XDYA 3D4OA 5CDSA 4O5VA 4I5GA 2C7GA 4O6VA 1LEAA 2A68F 3EDPA 5DUKA 5ERIA 4R79A 2XAQA 4GO1A 3I6IA 2W2KB 3MJEA 3CUKA 4HKTA 4Q47A 3B02A 3BZ6A 2P8TA 1U8RA 4ZZLA 1IPFA 4AJHA 1PWZA 1XLTA 4Z9FA 4IUYA 4J3FA 1OKRA 5GZ6A 2X58A 5H6QA 4BKUA 1FF9A 3IJRA 3JV7A 3OJLA 2OAZA 2GASA 2PD4A 4RGUA 4JX8A 1Q2XA 3LDHA 3GNSA 1TNSA 3WNQA 3REOA 3H9GA 5DDIP 1ZG3A 2RBEA 4WK6A 3F3SA 5GMOA 4E33A 5AQ1A 4XJSA 3H6KA 1HKQA 3WFIA 5KOIA 3E6BA 2O0YA 3T4XA 3GDOA 1GD1O 3JD0A 5T57A 2Q1UA 2C5AA 4BNHA 3O38A 3KP6A 4YJHA 1YB5A 1QZYA 3VH2A 5JY1A 1V3TA 1H0KA 1P6RA 4OOFA 4I5FA 1G3SA 1PIWA 1P4XA 4UVBA 3RKYA 1TLTA 1WDMA 2Y67A 3LT2A 2B0LA 5IN5A 3T7CA 1JQBA 2MLGA 1X7GA 2B83A 3BMCB 4B3HA 4N9HA 3I71A 1F12A 2WYUA 3HJAA 4M1QA 1L3LA 2QQ9A 1FSHA 4CXFA 1I36A 3U49A 3D4PA 3EUHA 1OOEA 3GQVA 3WB9A 1CQIA 5CJ9A 2K4JA 4DQXA 2DO7A 1QPMA 1UAGA 1LUAA 2ET6A 1O7FA 4YCAA 1UZNA 5B37A 1NYTA 3MTGA 5EEGA 1TTYA 4I0AA 1D8AA 3IHUA 1EDZA 2GUGA 3NDRA 1HXDA 4R4JA 1TQIA 3ZWCA 3AM3A 4U0WA 1DXYA 4JJGA 4XYBA 4E5YA 1T2FA 3WTVC 3JQ8B 1R66A 4E6PA 3KYBA 5IDYA 3ABIA 4QO8A 3ABUA 4CQMD 1U7HA 4BVAA 4IVNA 4CM9A 1NM5A 2I76A 5EN4A 2VZ8A 3GRPA 2IDZA 1F8GA 1TT5B 2HU2A 1BDBA 1H94A 5L3FA 2NUAA 4R41A 3G49A 2BBYA 2J6IA 1ZG5A 1YBMA 5U1PA 1X1EA 5A9TA 4S1VA 5JCXA 2HMUA 5EEHA 2W90A 4LD5A 3EY4A 3PIIA 4HFMA 1Y1PA 4XQCA 2OP1A 4PZEA 3QPTA 5TLSA 1E3JA 1R7JA 2GWRA 4CZZA 1GCUA 1HDZA 4YYZA 1FY7A 1NQOA 2C07A 1F0YA 3U62A 3UHAA 3FX3A 3D0SA 3DAPA 1ZEMA 3GUCA 4CM3A 3HZZA 4A7PA 2XAAA 1O7LA 5FO5A 1H9TA 1P74A 2AQKA 3NEUA 5DCWA 4A03A 2NAZA 3TOZA 2MC3A 1CIVA 4WNIA 2IA0A 4JP2A 1NVTA 1J0XO 2FMUA 3ZW8A 2GN4A 4A26A 3LT0A 2NV6A 2YJZA 2NQTA 4DYDA 2K27A 3OJOA 2W25A 1B0AA 4R69A 4BNFA 5FWNA 3DBRB 2NQ8A 4TVBA 1XU7A 1GPDG 1LJ9A 5JI6A 1Y8RA 1S7CA 3AFMA 4OAQA 3U4CA 1B8PA 1R6DA 1O94A 4AL4A 4R1HA 1HSJA 2HK9A 2OO5A 3N7UA 1TQPA 3OJFA 3Q5FA 3IIEA 5G0VA 2W2LA 3MJCA 4P4GA 1I2BA 5KVRA 1HYEA 4IINA 2VODA 5I7FA 4QECA 4WASA 2FZEA 1I32A 5BPDA 5L7TA 3HB4X 3PLRA 1LDMA 2D8AA 4H16A 5KCZA 4YA6A 3R6SA 5IT9K 4A73A 1S7OA 2QM3A 4I9HA 4EGZA 2POQX 2Z95A 2A5YB 4EUEA 2DPDA 4CQLA 4HBLA 4CL8A 3KP4A 3E03A 1BVRA 2BE5F 4XBFA 4JP3A 3F1LA 4URFA 1Y8QB 3MCZA 4NBWA 3PFWO 1EH8A 4KN7X 2M87A 4UUPA 4OIOF 3NDJA 3I9KA 1KBZA 2PZKA 2XXJA 4ZHSA 2R6JA 4H0EA 2Y1CA 3MWEB 4IIVA 1DJNA 2DKNA 4J1QA 3RSHA 5ILOA 2IZ1A 2X6TA 4JLWA 4AJKA 2EJRA 3V7RA 3UGKA 3HTSB 2VYNA 5TRTA 1JTVA 3OEWA 1ZGAA 5COAA 1MD0A 2BI8A 2O61A 1M76A 1X7DA 3VPSA 1LEBA 1QXSA 3KTDA 2A6EF 3VTZA 4BQPA 3MFKA 2PA3A 1PP7U 2M30A 4ZRMA 3V1UA 1UXIA 5JBIA 3BZUA 3UCXA 4Z0TA 3WQQA 3E82A 4E2ZA 1BIBA 4DQUA 4Q3NA 2HMTA 1EK6A 2ZBKA 4YRBA 2WTEA 3BPVA 1R0SA 3WTSC 2D2IA 3WE3A 2BYVE 3R61A 1NNUA 3C8MA 4P22A 3WTXC 1GEEA 2AA3A 5ICCA 3RFXA 4BV9A 2GZ3A 3K0LA 1N92A 2EG9A 4LB5A 2VT3A 3B1FA 1K3TA 1SAYA 2CYYA 5BQTA 1I10A 1SZJG 4YACA 4XSXF 2P5LC 1PJ2A 2JPCA 3JQ6A 1U2WA 1D8KA 4ZD6A 4EZBA 2ILTA 1DO8A 4WLVA 4NPCA 3PI7A 5C5IA 2HQNA 3HDYA 2KIFA 4C7JA 4UNOA 3GN1A 4IPAA 3AWDA 5I9MA 3FR8A 4YAKA 1PR9A 3ZMSA 4M49A 1JWBB 4NJOA 4RF3A 1KQ8A 3FPLA 1UDCA 4AFNA 2Q0OA 2HWVA 3PYMA 4ROSA 4RGRA 5E1XA 5E18F 1AUPA 4JQFA 1SMYF 4LG0A 5JFRA 1KEUA 1G3TA 2FBHA 4LG0B 1PTJA 3I9MA 1ADGA 4BO3A 4RQUA 1C1DA 2VWHA 1NXQA 2KRFA 3L7WA 2HQRA 5BNFA 3ROKA 3OECA 2G82A 2HFHA 1QG6A 2TMDA 2X4GA 4R68A 3E9MA 1ISGA 3RFTA 2XIGA 4LK0F 5H83A 4Y6PA 2B37A 5F1KA 1P9LA 4E30A 1DIGA 3D3EA 3RBVA 1MV8A 1FBUA 4JXKA 3O3KA 2JTVA 4DYVA 5TNXA 3ZWAA 3T8RA 1ZIDA 3DEYX 3QJ5A 5BSGA 1HZZA 1JVBA 1IY8A 4ZU3A 1FP2A 4UAGA 4U88A 2I3AA 5LHIA 2YYYA 3GVIA 4P8RA 5EERA 3I9LA 3OQBA 1ONVA 3OH8A 4YQYA 3W4JA 1SBYA 3WYCA 4UUOA 3T0YA 1GV0A 2GN6A 4CO8A 2ZKZA 3G3ZA 4MNUA 5F3RA 4OIQF 1SMKA 2BFOA 3PJGA 1Y9AA 1CRWG 4NQZA 3TOXA 3CE6A 2BF7A 3NQOA 2DK8A 1LSOA 2I5PO 4D0RA 1QNTA 4KZPA 4EJTA 2FP4A 4FT8A 5L4SA 2PFGA 4IDGA 4ON0A 2C54A 3I53A 3ETGA 3QWAA 5JAIA 2VOPA 3TPCA 1YG2A 1HDOA 4OO3A 3Q9SA 4LMRA 5HWSA 3ZWVA 4HQEA 4E2WA 4M55A 4DC1A 1LC3A 3WYBA 4PZJA 1D3AA 3EAGA 1VJ1A 3VODA 1PJCA 4M72A 1LRJA 3I83A 3M2PA 1RM5A 1OC4A 3W8FA 3TOAA 2ZCVA 2Q3EA 3E5RA 1FC3A 3K1NA 3KEOA 1HEUA 1UP6A 2HMSA 2O3QA 3F8CA 4WXCA 3KV3O 4ESBA 5JHUA 2HKXA 4L0ZB 2P9CA 4XGIA 3ROMA 1ML3A 4A0ZA 3LSYA 1GYQA 4EJUA 2W2KA 5D6FA 2ZATA 3ZW9A 1ZK2A 1HW5A 3TOBA 4IZIA 4NBVA 5G2OA 1LNWA 2J3JA 1LDYA 4NDNE 4FC6A 3L0DA 5I8ZA 1GYPA 4CV3A 4ZYHA 1E3IA 3AI3A 5T6BA 2AXLA 3HRSA 3O26A 2XGXA 2O3SA 1Q0HA 3A28A 4DLLA 1EUCA 4UVHA 2YHUA 4CR8A 1TXGA 1FNNA 4I98B 5L95A 1DHTA 3BP8A 5DZSA 4CMIB 3M6IA 5C3MA 4EI2A 4DWVA 4IQ0A 1DRVA 1U28A 8ADHA 5HS4A 1UAYA 5HS7A 4B4VA 1X13A 4AVPA 2EHDA 4K1LA 5BNTA 3KO8A 1BG6A 1H0MA 1D4FA 3PYLA 5CP8A 5T5QA 3KSZO 5KK1A 1A04A 3KSUA 4BO9A 5JYDA 2XRNA 3U9GA 1HKUA 3B6ZA 3ORFA 4N9IA 3ETDA 1LA2A 1Z82A 4FIZA 5COQA 5K6AC 5KJ1A 1WSUA 2QQBA 4AJLA 1JHHA 4HYEA 2EKPA 4JJIA 5A9SA 5BS6A 2QZZA 1QYXA 3ZDFA 1OC2A 3GGGA 2FQ3A 3IL2A 3WMWA 2GAUA 2PTGA 2PQ8A 2NYXA 2O4UX 3DOJA 3ST7A 1ZAOA 3GGOA 3L4SO 3JD2A 4XJTA 3LC7O 3UN1A 3CTMA 1ZN2A 4QLCU 3PHLA 5K6AA 3QU6A 2VHVA 1BN5A 5EMHA 4KTTE 2NU7A 3FBTA 3VVBA 3ZZNA 2ESHA 4FHTA 2QLZA 4OXYA 1LSSA 2ZK7A 4XQEA 1UXJA 3KP2A 4OM8A 3S8MA 3MZYA 4IRHA 1WWKA 4NFHA 4D3DA 4I2OA 1MJBA 1C3VA 3ASVA 1SO8A 4QO7A 3HUGA 4BNNA 1H5QA 1O6ZA 1MXHA 2ZYDA 3ZQ7A 1ZARA 3FXQA 4GCVA 4XLPF 1ZBQA 2W8ZA 3GLXA 1O8CA 3WS7A 3ZWPA 3FM5A 2Q2QA 4RS8A 5E1WA 3I54A 4IDAA 2WD7A 4XDZA 5DP2A 4N0BA 5EIOA 5LC1A 3SEFA 2WM3A 3WQSB 3MJSA 3SJUA 4F6CA 5C37A 2C6YA 3WG9A 4B8XA 1Z6RA 3H9JA 4WUVA 2A3SA 1IULA 3A1NA 2FE3A 2NNNA 4ENJA 4O3MA 4UVGA 3E5UA 5JS6A 5TIIA 3E5XA 1GUFA 5HVQC 4HP8A 4BB6A 1IHYA 3PFFA 4L4RA 2VTDA 4JBIA 4HADA 5HDNA 3VPGA 3I5MA 4DRYA 1ARZA 3T5XA 2HK8A 4CM4A 4A10A 2PV7A 2YUTA 4AIKA 4DPMA 1Q0LA 2O23A 2NACA 4PLFA 3M8EA 4R3WA 3RYRA 1E3LA 3PHIA 4PRKA 2BMAA 4M9XA 3E18A 1RUOA 4YJGA 4Q48A 1R12A 2FY8A 4PGGA 3INGA 1MC5A 2F5CA 4BNWA 2E1CA 5CYVA 1H6BA 3QP9A 3RKWA 1VM6A 5DBIA 4OMZA 3VOEA 1GHCA 3DC2A 1DIBA 4XQGA 1Y8RB 4J0FA 4XZ3A 4IRGA 2UWMA 3GVXA 3ZV4A 3G1TA 3Q3CA 3KSDO 2EK5A 2AW5A 2IZZA 3L4BA 1SEVA 4KMUX 2HK7A 4IGEA 2H94A 5DNAA 3AY3A 2UVDA 2QRKA 3GAZA 3ZV5A 4P55A 3GNTA 2QENA 4L9VA 1XN7A 1ID1A 3U4HA 3JD1A 2MD5A 4GVLA 4Q3CA 4OKNA 1QBJA 3EYYA 4Y15A 3X2EA 2E37A 2CDCA 3ONDA 2M8EA 5T67A 2COMA 3DHNA 4HLYA 3RC9A 2IYPA 4L8VA 1U4SA 3U3XA 1VRWA 4KA4A 2QZ9A 3AOEA 4IBOA 2EGHA 4OXNA 2ACJA 2J3HA 5G0SA 1PJLA 2VHZA 2UXXA 1WQ2A 1UZLA 1BJAA 1YDEA 3FBGA 3C18A 5CVJA 2DI3A 3SFZA 1U3WA 2CDBA 4GGGA 2DAPA 2UYYA 3CUQA 3AY6A 4QT0A 3KM0A 3LQQA 4FD3A 3ZU3A 7ADHA 1YKFA 1IZ9A 5BNIA 3E6MA 3SQNA 4J49A 1XGMA 1E2XA 1X7HA 1UFMA 4GKBA 4PVDA 4RLSA 2L3DA 4LSMA 4WCFC 3PXXA 3E5QA 3FF4A 5L3EA 2VHYA 4PLVA 1XDSA 2QWWA 1G0NA 3AK4A 4J91A 4PLTA 1CETA 1E1MA 3TDKA 3JQ9C 4F45A 3K2BA 4BOYA 1R1VA 4ZYDA 1IZ0A 8LDHA 4I9UA 1Z7EA 5JCJA 5JC1A 2PWZA 2X1HA 1LI4A 3RUAA 5CEEA 3B73A 1P3DA 4QXMA 5CPFA 4G7ZF 4LVCA 4TROA 5JDCC 3ZWYA 1FDVA 3DPTA 4L73A 5HBRA 5JYEA 5JNLA 2YZ7A 3KEQA 4XRRA 3WBBA 3EHEA 1TNTA 3VZSA 3RDIA 1P77A 3M7GA 4E3ZA 2PNFA 4PGHA 2O2YA 1GUZA 3LQRA 3GMDA 2G0TA 3QVTA 1RIOH 4OXKA 3V2UA 4IGFA 5FGMA 3P7NA 1XEAA 4E21A 1ZKMA 1IXCA 1OI7A 3PDUA 5EPOA 4IDCA 2FMLA 4HDUA 1LRLA 3BA1A 1KEWA 1B14A 2LNBA 3K96A 2YFHA 4MIEA 2RVCA 2VC1A 5TJJA 2JD0A 4RO0A 5D8KB 2VYVD 2GD1O 2AQ8A 4KICA 2RHCA 3JQBC 2D1VA 1U5AA 1I2CA 3B70A 3WDSA 1Z9CA 1U3VA 3GEZA 1QRRA 4EDFA 1U2GA 5A4DA 3Q2IA 1FBQA 2Q49A 5J8FA 2VUTA 1G1AA 5AVOA 4DGSA 3C1AA 4LFUA 2DQ4A 3JSAA 3RKRA 1A7KA 4E70A 1X3UA 5KIAA 1DOHA 3H5NA 3VKVA 1IB6A 2GQQA 3DTTA 1ZK1A 4M54A 2Q2WA 1PZEA 1PGPA 2ZTLA 1JW9B 3JQBA 2X4HA 2KJBA 2D59A 2JCVA 4AJPA 5L4LA 2BFMA 3QWHA 2EF1A 1SD5A 1QYWA 1GPJA 1T26A 1EH7A 1DC6A 3S2FA 1ZNQO 2L54A 3IC7A 1SEPA 1W7PD 1B59A 4DNCA 1HLDA 1FDUA 2PH5A 3TRIA 4ALIA 3FHLA 2AS5F 3QWFA 3DAGA 5HA5A 5JXWA 1ZO8A 4YFNF 4ENMA 4LLGF 1LQ1A 5IG2A 1Z6ZA 3VC7A 5FYDA 1AWCA 2NVUB 5KVSA 3E3VA 3JQ7A 1ORRA 2PD6A 3HSKA 1RM3A 5D5VB 2IVMA 3GN2A 4YT4A 2HAEA 4L76A 2OXIA 2HYFA 1IF1A 4IJVA 1LQUA 3Q1LA 4FBGA 1K7AA 4L5IA 3D0OA 3CPSA 3TZKA 1ULUA 1YH3A 4DVJA 3QVXA 4HFJA 4J4TA 3VHRA 3ZWWA 1G6KA 1KU9A 1A71A 4BIIA 5ENDA 4ESOA 2O3RA 1BC8C 4D79A 1O5IA 3O4RA 3DBLA 4D0SA 1BIAA 1E92A 2GLXA 3HRMA 3DV8A 3RROA 5DV5A 1Z91A 3EW7A 3H3UA 5GZ3A 3LAPA 1SFXA 1I2ZA 2JL1A 3OHSX 1R16A 5JVTA 2GZ1A 4DL9A 3SZPA 4FQ8A 2HLPA 2IYOA 1GL3A 2H09A 5L7YA 3P19A 1Z6TA 4O1MA 3ICCA 3PWZA 4NBTA 4ZQGA 5K9ZA 2FMYA 5DD4A 1PJSA 2WSBA 4YFKF 2ZB3A 1J49A 1XB4A 3X2FA 2V6BA 4CLHA 1J0RA 1XR3A 1IYZA 1DLJA 3PTZA 3P2YA 4HXYA 1P31A 2V6MA 3ANMA 3PEFA 4QFCA 4WLUA 4LGVA 3TFQA 3O2PE 3BOQA 1EEHA 5U9CA 1G0OA 4FN4A 5EQFA 4NI5A 4ESFA 5IDWA 4PG4A 3S2IA 3NYWA 3L6EA 1WWXA 2OORA 3O8QB 5DOVA 4OOEA 3QWBA 4B7CA 1YW7A 3RWBA 3IKVA 1PZFA 4NK4A 4WLNA 1M67A 1TQMA 1ISHA 1X0VA 3BTUA 1R4NB 3NGXA 1E3SA 1XWFA 4YRAA 4LGWA 4LLLA 1GTMA 1B8UA 4OU0A 3C24A 3SHFA 1HQCA 2VBZA 1J2XA 5BOXA 4PG8A 1Y6JA 2D1HA 1OYYA 2CFCA 3JQ9A 3LC1O 2ZXJA 1X0XA 2CMDA 1DP7P 1IAWA 2B5WA 6PAXA 2CG4A 2DC1A 3NJ4A 4RAZA 1KC3A 1LLUA 2DPHA 3DWFA 2YDXA 2E1NA 1NPTO 1KEVA 1B2LA 3NKLA 1HDGO 1BW9B 4K6FA 2FR0A 2QRLA 4O0LA 5TGDA 5D8LB 4FW8A 2IW5A 4BHBA 4HV5A 1FK8A 5F1OA 1GQYA 3JSPA 4M73A 3TDZC 1ADBA 3FM3A 2JKVA 5HS6A 2X9VA 3RVDA 4LB6B 2D4AA 3TL3A 3FN4A 2ZB4A 1CF7A 3NTOA 4XRFA 3O03A 2DU9A 4RDHA 4TQGA 3W4IA 3K73O 3KRTA 2SCUA 3NV9A 1BDMA 1ZRCA 1I5ZA 1BSVA 5ENVA 1YIOA 4BNTA 3FZVA 3VZPA 1R37A 3NRCA 2WMDA 4PLGA 3F8MA 1D5VA 2B36A 4MVJF 4GKVA 4O59O 5DCMB 4Z9XA 3ZMDA 3GAFA 1TVEA 5ES3A 2NNLD 4DBZA 2PD3A 3GW2A 1R00A 1R23A 4OIPF 4ZQHA 4HV4A 4EVIA 5J8CA 1U5TA 3FNGA 4NZ9A 4TRJA 1U78A 4PLCA 4M6YA 3WMXA 1Z74A 3C1DA 1X15A 4PLWA 1UJMA 1YBAA 3JYOA 1TT7A 4EITA 5L3BA 5DOZA 2QVOA 3T8TA 1YOVB 1BGVA 4WCFA 5G4KB 2BGKA 3HN7A 3LVFO 2DTRA 3M1AA 2W24A 5BR7A 1E1LA 5HS8A 4JBGA 3RYPA 2X22A 2TMGA 2F5DA 4AJ1A 2L02A 1IUKA 4XLNF 3DHEA 2RC4A 3WSVA 2WD8A 2Y68A 3VOSA 1VSUA 4MO2A 3ZU4A 3JQAD 1CJCA 1SB9A 1AN9A 2X0IA 2VHXA 1CWUA 4LK1F 2AG5A 3F4LA 3KOUA 5ITWA 2P4WA 2EP5A 4KT5C 1ADFA 3GDFA 1RJWA 2DTDA 1FYKA 3INRA 1TI7A 4ALMA 1KY4A 1P44A 3H5RA 1LLCA 6LDHA 3W6UA 2QYTA 3KP3A 2FHSA 2IXAA 4IQ8A 2I66A 2ZFWA 3R6DA 5B1YA 5I8WA 4PRLA 2QYOA 3I58A 1C0IA 2ZTMA 4IMPA 3V5NA 3ENKA 5LGUA 1T0FA 1LVAA 3CO6C 1Q7GA 2DLDA 5DUIA 4BMVA 5IDXA 4Q5SF 1E7SA 4JBAA 4Z3KA 1J5PA 3ASUA 2A92A 1UDAA 1PQUA 1YQGA 4BHPA 2CF5A 4J1NA 5CVIA 3PIDA 3V1YA 4CMKA 3I4CA 4BNLA 2JRTA 2LDUA 1F9NA 5I7EA 5JCJD 2ZMEA 1XCBA 2ZMEB 1IN6A 4RORA 4R51A 4Y17A 4E31A 4E5NA 3OQ6A 4A2UA 4PLPA 5B12A 1AXGA 4GGOA 3UCFA 4N54A 1V4RA 2CGPA 2W2LD 1B15A 3P2OA 3GO5A 3E9QA 4IXWA 3H9EO 4CLXA 4AIJA 3OOPA 2R00C 2JT1A 4Y98A 4MP8A 4ND2A 1NVMB 1U5TB 2JJYA 4N5NA 3OF2A 5A03A 4A27A 3B20A 4TZKA 3ITDA 4GX0A 4YJDA 3WFJA 1PU2A 2HJRA 2W98A 4NG5A 4E5PA 4OYRA 4AWXB 2IXBA 2QW8A 3DFGA 1EK5A 2RHRA 3FSRA 4ETSA 1SCUA 1D3YA 5A9RA 3LQFA 1P0CA 4AG3A 5HTOA 3G17A 4L4XA 4RL6A 3TSCA 4Y13A 2NM0A 1PGQA 2FNAA 4II2A 1KA8A 1DC4A 2XAFA 4U7DA 2PJPA 1AHIA 3GGPA 3M2TA 1J9IA 1R1UA 3HRTA 2AEMA 3BIOA 2CSOA 4ND1A 5IZCA 3OFSA 5DCYA 4Z2YA 4U6QA 4D3SA 5L45A 2XV4S 4HUJA 5H82A 5HLGA 1HE5A 4CM7A 4YIFA 5KJCA 4UULA 3V8JA 2NTJA 2X9NA 3NT5A 3BMOB 4FSHA 1U8XX 2LDBA 4MDHA 3BMOA 4HY3A 2RH4A 4CDGA 1BW9A 3KYDA 4UEJA 3PWSA 4U7WA 2PKRA 4RJTA 1KY5A 2E6UX 4M9SA 3EMKA 4XR4A 3DOOA 4WX9A 3AOGA 1FDSA 3ZWXA 1XSXA 2GZ2A 1E5LA 1XQ1A 4GWGA 2VZ0A 2LSOA 1QR6A 5D4RA 3WODF 2GDZA 1EMDA 3JQFC 2P5YA 1ZLKA 2LDXA 3HDQA 3DMYA 3G0OA 3TN7A 1CF7B 3WTBA 4YRDA 3HIFA 2JCYA 4ZQBA 5A06A 5CDYA 3A4VA 4MEYF 2PN6A 1KS9A 3C1OA 3HOSA 1ADCA 2PZJA 1VTNC 4BAYA 3KYCA 1HETA 4LCEA 5CG2A 3NTRA 3OP4A 1HBXG 3F23A 1GY8A 3ELKA 3PRJA 4BNGA 4WEOA 1FX7A 1RI7A 3FXUA 5EESA 2PEXA 3GDGA 2FSSA 2AE2A 2PKQP 1GXPA 4NIMA 1CQJA 2C29D 3P9KA 2OQRA 4NBRA 3DXFA 1D1TA 5JDCA 2PGLA 1V9LA 1LDEA 4WGGA 3WGOA 5FF9A 4MKXA 3AY7A 4OL9A 4UVAA 4R9RA 3J80Z 4EGFA 4ALKA 3NEPX 1IRFA 2E4AA 1J6UA 2AQHA 1PS9A 4K26A 4GX5A 3AUSA 4A5NA 3WTTC 1EH6A 4IXAA 1WRJA 4TRRA 3ULKA 2OFPA 4MVJD 1PJBA 3DP7A 2EA4A 3Q11A 4IIUA 4MOWA 1DRUA 1MX3A 3JW4A 2DPUA 2DUUA 3AI2A 4R9SA 5JDIA 1B3RA 4O5OA 4E5KA 4D44A 2IEDA 3BXXA 1LDBA 2H5LA 1WI9A 1T98A 2CSUA 4YG2F 4W7IA 3M1EA 2V6FA 5C7OO 3QLJA 1HSZA 1LTHR 4IHSA 1I27A 4EYEA 4WNCA 2J5PA 3ETEA 3JQAA 4UEOA 3DQVC 3S2WA 3I52A 3V2GA 2JSCA 3HB5X 4N7RA 5I7VA 5ITVA 4ASNA 4BMNA 1S8NA 2J3IA 4CM9D 3HE3A 2Q8KA 3RTRA 3ZMVA 4MIOA 1PZHA 5HLIA 3HADA 4DA9A 2GPTA 5TJ9A 3UUWA 4D0PA 1ZCJA 4GGPA 1T2CA 3WTZA 4CPDA 5KJ6A 2ZIZA 5TQVA 1HE3A 4DREA 1PGOA 2YQ4A 4TRNA 5DT9A 4R1NA 4D43A 5H6RA 3PQJA 5BSEA 3CDHA 1A9YA 2Y48A 1DLIA 1QGPA 5JMWA 4RAYA 3HDJA 4MVJH 5COBA 1EZ4A 4X54A 3ON5A 5KVCA 2X5OA 3ZWOA 1JKFA 3GFIA 2VYVA 3WU1B 4CICA 2VE9A 3VPXA 1DBVO 1R4MB 1G6NA 1U7TA 5FB2A 4R1TA 4BS9A 4ID9A 4BNIA 1DDNA 3U4IA 3SLKA 1BC7C 2W4QA 2DTEA 4KMSA 4CUJA 2FU4A 1C0LA 1WMBA 4XCVA 4K2EA 3EK2A 1LQTA 3G79A 4PCVA 3NJ8A 1N7GA 2OA4A 2Z33A 4M89A 2OHXA 5L3DA 3F4BA 1O89A 1DIAA 2YHIA 1C0KA 1YL5A 1YWGO 2EP7A 2BH9A 4FOSA 2BGLA 4A5MA 1W6UA 3V7SA 5K5QA 4L0QA 4P4LA 4FFPA 1DFHA 2HEOA 3O6BB 2NTVA 3ZMTA 3JQGB 5CFZA 5AIPA 3QPHA 1FSEA 2RKHA 3ECHA 1CDOA 2R00A 3RBXA 4XKJA 4O6JA 3VZRA 3ZU5A 4EQQA 1SNYA 1GCOA 1ZXLA 3CIFA 3IUPA 4PG7A 4S3MA 1VPDA 3SVTA 3K1MA 1FWZA 4UV8A 2Y1OA 4K6CA 2YQ5A 3MJVA 4IHTA 4A5OA 5FD5A 1USSA 4IRIA 4KFCA 4GAEA 1LXCA 4EBFA 4RLHA 4BL5A 1K6IA 5MDHA 4J1TA 9LDTA 4E0BA 3AAFA 2VRCD 3BTVA 1JA9A 3AW9A 4CMBA 1REPC 3L9XA 4UREA 1NR1A 5L7WA 2MH2A 1QV6A 4CMEC 3PVZA 2VYND 1MG0A 4Q3AA 1WDLA 3RUIA 2I67A 5JW6A 4EGYA 3FXRA 4W7HA 2FPIA 4TRMA 1F8FA 3KP7A 1BXZA 1TW3A 1YS4A 1ZMTA 3DQPA 1WW8A 3BMQA 2XAHA 5DBGA 2EV6A 3V8KA 3DXJF 2UZKA 4L5JA 1DDOA 2PGJA 5TX7A 1LDGA 3TL2A 3I59A 4S04A 5CG1A 4IDFA 1ENZA 3JYNA 4XQ9A 1ZZEA 1HDYA 1VL6A 4S05A 4RVUA 3ZNOA 3L2CA 1NR7A 4L4SA 3EVTA 3NT4A 2QBYB 3T1BA 3GVCA 4WLFA 3BPXA 4NB5A 2P2SA 3NDIA 3C3XA 3FD8A 3RKXA 4JIGA 5F1PA 3E48A 3BDDA 5KVVA 1J7KA 1BHSA 4BXUA 1Z75A 1UB9A 3ZHXA 2WDZA 4C7KA 1T1SA 3OIDA 1SFEA 3L09A 1DFIA 3L9WA 4RCVA 1IUYA 1IE3A 5G4LA 3W4KA 1DC5A 4OHUA 2XF8A 4OSOA 4P9UA 1S6LA 3K2EA 3WBFA 5KJFA 4Y6RA 4MINA 2PFBA 1ENPA 1K6OA 5FFXA 3CUQC 2BKAA 2VQ3A 3LU1A 4KYWA 1QLJA 4IJUA 1J59A 4W4TA 3U4DA 4HX8A 1HRDA 3CINA 3GUDA 4L9NA 3U2RA 3H3ZA 3TDUC 3PHJA 2RN7A 1JKJA 3DFZA 3WYEA 4IS3A 1E7MA 5T64A 1GDHA 2BRUA 2D3TA 4UVIA 1ZHFA 2ZJ2A 3AUTA 5FLXK 1KU3A 4DPLA 1FPQA 3VH4A 2HQ1A 4CODB 3I4FA 3ZGYA 3TQNA 1B16A 1KERA 4KIFA 3EDMA 3TWOA 4F6LA 2PZLA 1L7EA 5ICFA 3H5AA 4RF4A 1Y5MA 4RZIA 4LRTB 4A6DA 4TKLA 4HX4A 4AJEA 3CH6A 2XHKA 2P9EA 4KIBA 3U09A 1I24A 1MA0A 4PCQA 5IF3A 1U6GA 2E7WA 1NASA 3E97A 3FHZA 5A5FA 3OICA 1X1TA 2CF6A 3TO7A 1MJAA 4HW0A 5DCUA 3RUCA 3WLFA 2GO1A 4PLHA 4ZRNA 3BMQB 3RC1A 3COSA 1IHXA 2IPQX 4IJAA 1DB3A 2BELA 3IC5A 4GLOA 1YXMA 5KKCA 5HDGA 5D6EA 1HYGA 3GVHA 3I59B 1ON1A 4DTIA 1PGNA 1P1RA 1T2DA 7MDHA 1JDJA 1KETA 2X7HA 2Y1DA 1K6JA 2WE8A 4PZDA 3VB2A 4J4BA 2X9GA 4ILKA 4O63O 3UCEA 1E6UA 4LK3A 1B6AA 1EVZA 3EYWA 4TWRA 5G0TA 3RUFA 5E20A 5LRSA 3F22A 2XKOA 2NVUA 2J5QA 4AIHA 3UAGA 4B8WA 2AXQA 4JK3A 2Z99A 3IRQA 4NH4A 3CJNA 4DUPA 5L40A 1BXKA 3C7JA 2ZJ1A 3GK3A 5BQFA 4QFDA 3H92A 3HUDA 1GFSA 1HDXA 2V1UA 4NBUA 4YAJA 3ZU2A 5D5WB 1NP3A 3WGTA 4GL4A 1ZW1A 2O8XA 2W84A 4GLLA 4XA8A 2Q1TA 2BFAA 2YY7A 1YBVA 5AXBA 3UH1A 1J5YA 1XKQA 4GX2A 2VTEA 3M9AA 1KGSA 3PPIA 4IXTA 1CGPA 1K5HA 4DQVA 3BHMA 4CL3A 1MG5A 1PGJA 3SC4A 3GFGA 3IAHA 3WGYA 3QE3A 3R3JA 1QORA 5JAQA 3PQEA 4FFRA 2ZCUA 1M6WA 4LISA 4OKIA 4U7BA 5AYVA 1BRMA 5IXSA 1K2WA 3OJ0A 2P9GA 2NU6A 4BHTA 2ZYAA 1KC1A 1VC2A 1E6WA 5A3JA 3JAMK 4G7HF 1I3NA 2HMVA 3DZGA 2OD5A 3BTSA 4G2NA 4G7OF 1U2DA 3E6CC 1JN0A 4PDKA 1Y7TA 2ZB8A 4RB2C 3F1KA 3GG9A 1MDMA 3H8VA 3LT4A 2AHRA 3DFUA 5TT0A 2GGSA 1W7PB 5LEJA 5JAMA 2DFIA 3MZHA 4TZTA 2OQGA 4WCFB 1RZ4A 2GYYA 4CV0A 2HJSA 2C2XA 4RGSA 3Q0EA 4HFRA 3R0AA 4I01A 2OZ6A 3CMMA 4BO8A 1V3VA 5DCFA 3G1UA 3HQ4O 1P92A 3BJOA 1FYMA 3EUWA 3PGXA 2P7VB 5LEKA 2NVBA 1O0SA 5LLQA 3KETA 5L4NA 1LLDA 2D45A 3JD3A 4KOAA 3RIHA 3WU0A 2JCXA 3I9NA 1U3TA 1U3EM 1I3KA 4EJOA 1Z73A 1UHWA 3SJ7A 1WKMA 5ED4A 1GZ3A 1F1ZA 3JQAB 1EVIA 2PH3A 2V1DA 2GSDA 2Z1MA 4EJMA 2PMHA 3HSEA 1SD4A 1U9JA 2VOJA 4U0YA 2H63A 3HYIA 1BM9A 4HF0A 3VZQA 1XMKA 5J6XA 3KB6A 2A9FA 4I5DA 4ZQFA 2VWGA 3QIVA 1T38A 1Z1DA 2FPPA 4J90A 2GN8A 2ZNZA 4CMEA 3RUEA 3LF2A 2C20A 4J7XA 3W1VA 3LA2A 1IL0A 3RFVA 5JSFA 4FJ1A 1G3YA 3ROPA 5J23A 4FDAA 2V7PA 5K1YA 3GZ5A 3H9QA 3FF5A 1LU9A 3JCZA 1GV1A 3NAQA 4AJJA 2X23A 2EFQA 3LAJA 3ZV3A 2O3JA 5CVRA 1YFHA 2IT0A 1BXGB 2X8LA 5D4SA 5IXYA 5L3GA 2IRFG 1ISIA 3K1PA 1N7HA 2BFPA 2FR8A 2Z9OA 1Z7BA 4MKRA 2G76A 3GEDA 3W6ZA 3H4VA 5THQA 2AE1A 2Q1WA 1BI0A 2PGDA 3H65A 1CERA 2ZTUA 3WR5A 1DAPA 1KEPA 1P1HA 4UUVA 3PHHA 3HWRA 4PVCA 2P68A 1MGOA 2A94A 3ZHZA 2EKLA 3W6KB 4K28A 2MA3A 1T25A 2C59A 2C5EA 4MEXF 1KOLA 5EJ2A 5K5RA 2P6SA 3R1IA 1GAEO 4YQZA 1SB8A 1T4DA 1USTA 1O3QA 2OMEA 3K6JA 3MOIA 1R0LA 4BO1A 4CLRA 4IQGA 2EJVA 4CLRB 1U8FO 3DZFA 3OMLA 4GPD1 5HM8A 4WCGA 3RU7A 4CMIA 3GR6A 5L9AA 2HKOA 1DFGA 1XQ6A 3R0JA 2UV8A 5ICMA 1GXQA 2P7CB 4KMFA 2O3TA 4NMHA 4NFYA 2XVCA 1M6HA 1FJHA 2FWMX 2JD1A 3G3EA 3GNQA 4HQMA 2O2SA 2G5CA 2ZCWA 1ISMA 3P9IA 1ZK0A 3F21A 1ZRFA 3H2ZA 5CLSA 2Y0CA 4CV2A 2VE8A 2FSVA 2YDYA 1XHLA 3ZPLA 2DBVO 2HDHA 2VT2A 3V7CA 1LEHA 3ZWMA 4BO5A 2EKQA 1FYLA 4KTVE 1YQAA 1RYEA 4ALNA 2QUFA 5DEQA 2Q45A 4PGFA 1XIVA 4M87A 4G6QA 1A7AA 2B5VA 1P33A 5DD8A 2GERA 1NAIA 1NFFA 2J8ZA 3KLPX 4MVJA 2CQKA 4TMFA 2CO5A 1QKIA 4W82A 3BHJA 1O3TA 1PQPA 2FPGA 4YIIA 1D8JA 2OP0A 2Z1NA 1HDRA 5K5OA 5E17F 2P5VA 1RPNA 1P1FA 2Q4EA 2VNAA 5H20A 4CGZA 2ZB7A 3QVWA 4MP3A 3V2HA 2P5KA 4UV9A 3EVNA 5CPBA 1Q0QA 5GY7A 1ZLJA 3NT2A 2Y0EA 1T2AA 5JO9A 2FOIA 1DJQA 1K79A 3FR7A 5CHEA 4WK8F 1F5TA 3DBRA 2R7DA 5DN9A 3GVPA 1UR5A 4AJOA 4YWJA 3COAC 4ZJUA 2J5RA 3A9WA 3WQRA 4C4OA 2YV3A 3TQHA 1LDDA 4CM8A 3TZCA 3EYIA 4XYEA 2QBYA 2QHXA 1BI1A 1EE9A 1XGSA 1KVQA 5DYMA 3ZV6A 3QVOA 1PWXA 5C7LO 3F6OA 1MXFA 3ULQB 3AU8A 4J4HA 1VJ0A 3UW3A 3RQSA 2Z3YA 1NAHA 1HXHA 2WYWA 2F1KA 4RVDA 2FOKA 3GRKA 3PK0A 3LFKA 1UHMA 1MFPA 4AVYA 5CEJA 1B9MA 3ZWNA 2Y75A 2VUSA 4ND5A 4MIYA 2OBYA 4UUMA 2JHGA 5U4QA 4L74A 1NVGA 5E8IA 5E1ZB 2H6EA 2I9PA 3NTQA 1HW1A 5LGNA 3ICPA 2X0LA 3OA0A 4GVXA 4IPTA 1MUUA 1YQDA 4NQWA 3PHGA 3JQGA 4II3A 2VUUA 4JNKA 4CM6A 1R4NA 4EM0B 1IN7A 1I3MA 1ZEJA 4WF2A 2CNBA 4FOOA 4KQWA 3S55A 1GZ4A 3CEAA 1YRLA 1CEQA 2DTXA 2P4QA 3WJAA 3CZRA 2EV0A 2GN9A 1DPGA 4FX0A 2OUIA 2CFXA 1SAXA 3DBHA 2X0NA 2HRZA 4YAEA 3KUXA 5TSDA 3WGZA 3H3FA 4XGKA 3VDRA 1XU9A 4GMFA 2V1XA 3DKWA 2QRJA 3EZYA 1KVRA 1OBFO 3DHYA 3JQ7B 3ZNNA 3PZBA 4D45A 3GOHA 2EIHA 1LX6A 3FTNA 4Q3DA 4HAMA 4F7ZA 1VL8A 1VE9A 3WIEA 2E49A 2EFWA 5BMZA 3INTA 4XEHA 1XG5A 2DBZA 1WXDA 2EFPA 4D46A 1OZAA 4U0KA 3BMNA 1OPCA 2C82A 5DF1A 2W85A 3SC6A 4YJFB 4AJ4A 1Y0UA 2Y05A 4LN1A 5IZCC 3QOPA 2RIRA 3MOGA 5C7IO 1WMAA 3PJFA 4H15A 4IDBA 1GR0A 2WV0A 5IT3A 4BQRA 1KYWA 2PY6A 3F47A 1E7WA 2OL4A 2RV8A 1E3EA 1IRGA 1DRWA 4NFSA 1LC0A 3VPHA 1YONA 2STWA 4KQXA 1N2SA 1HDCA 3HNPA 3ZN0A 1RM4A 3L07A 3QSGA 1ISJA 1NWHA 2XUBA 3ZN1A 2PK3A 1NTOA 3ANLA 3OEYA 1NQTA 1IN4A 2J3KA 3QWIA 4FC7A 5EL0A 4ZYGA 3AFNA 3EGOA 4PG6A 1PP8F 3IRRA 3GFMA 2NLOA 2RDPA 4ITUA 3FMSA 2H9IA 3FWZA 3IUSA 3JQCA 2MH9A 1QSGA 1T1RA 4DMMA 2CUKA 2DQLA 3KZYA 3WTUC 4ONEA 4RVFA 3F8NA 4UVDA 3BJAA 4CMGA 2YX4A 1HT0A 1W7PA 2HDCA 3I0TA 3E1KA 1L1FA 1LSJA 5JC8A 2L4AA 4BNJA 4J1SA 1I30A 3GF2A 1IXRC 4OMYA 5ILGA 3NUGA 1EUDA 3HOTA 3RC7A 4WLOA 3U5TA 3W6JB 1EBFA 5F5NA 4AICA 4GH5A 3PGJA 4R5MA 2PKQO 4DIOA 3KFWX 2DFDA 5A05A 3OBBA 3DBLB 1TBXA 1KVUA 4QQRA 5LDHA 1ZH8A 4B4OA 2GRAA 4BGEA 1YE3A 4M9ZA 3ENNA 2Q1SA 3K69A 2VWPA 2IP2A 2X0JA 3PWKA 3RUHA 4BMSA 1SFUA 2I65A 1H6AA 1E77A 4J16A 4XYLA 4J9UE 2DT5A 3TO6A 4RF5A 5JY6A 1HL3A 1FXSA 4WOJA 2JHFA 1KYQA 4XX0A 1IXSB 3QHAA 3GFJA 4WECA 3E6AA 4RB3C 4FJ0A 5F1RA 4LSWA 4A12A 2JAHA 4B3JA 1JGSA 4D3FA 4E13A 5HLHA 2FEZA 2LF8A 2ZTVA 3AJRA 3OIGA 4XYGA 3K9TA 2V9VA 3L9FA 3LSTA 4G94A 1B8VA 1I8TA 1NFQA 2C0CA 2QYSA 1PX0A 2IEBA 3AUAA 4PLZA 1W8DA 4CQMA 2EFNA 3DEUA 3D7LA 1OYIA 3ZNQA 1NHGA 2EJWA 2NVWA 1F14A 3H3JA 3TZQA 5KTKA 5AXAA 1PSDA 2G17A 4BO6A 1NPYA 3UF0A 1V6AA 1ZSVA 3DMTC 2Y0MA 3O8QA 2KKOA 4IY1A 3MJ4A 4KUHA 4MVJP 4YT8A 1STZA 2RAFA 1NHWA 1MC4A 4J9VA 3GFBA 4N5LA 4OGWA 3TZHA 2W57A 1XSEA 3AOEC 4GI2A 1EQ2A 4MVJE 2E48A 1E0DA 4LMPA 3RU9A 5IN4A 4HDVA 1UZMA 1HE2A 1SMTA 2HOEA 3U0BA 3CUOA 3QP5A 2VN8A 1YS7A 2VN2A 1ZVMA 1QLHA 1S29A 1NHAA 4DPKA 4RV9A 2VNSA 5FI5A 4YVFA 1L0OC 3PFIA 3AM5A 3IS3A 4I08A 4XR9A 1EUZA 3GVAA 1RKXA 2VONA 4OOIA 4OINF 3WTYC 3MWDB 1NQ5A 1P1JA 5LGTA 4EM1A 2XXBA 3ADOA 1LLQA 4QTZA 1YYVA 2E7XA 1ZK3A 4B79A 3U1DA 3U9LA 2DAOA 2H1SA 1PR3A 2EV5A 3GHHA 5KJEA 3LF1A 1VSVA 4MGRA 1V0JA 3DR3A 2CWEA 1R58A 4UVEA 4Z0PA 4BKRA 1DIHA 1GYRA 1O95A 1ZSYA 1Z05A 1U5CA 3FMQA 4M86A 3QU3A 5ICSA 2EXXA 3UOGA 4CLOB 1Q1HA 2X5JO 1CYDA 1DSSG 3DF8A 2DVMA 3JYLA 4U5QA 4CLOA 5IT9Z 3BHIA 3I3OA 4CLDA 4MKZA 2L4MA 3JTGA 2IE0A 2WWRA 5A1TA 4MJLA 1YLFA 4G81A 2GA1A 4ENKA 1LNQA 1YW8A 3GHYA 5JAZA 4U0JA 2EW2A 2QG4A 3WXBA 5JMPA 2O50A 3VEPA 1PZGA 2BLLA 1Y9EA 4OSPA 3P9CA 3GFLA 3MAJA 1EE2A 4H3VA 4N18A 3TJRA 3QRFF 1QP8A 2JFHA 2B4TO 3EC7A 2VOOA 4D7AA 1AHHA 1UXGA 1C1XB 4R1UA 3WGQA 3C1TA 1C1XA 2CZCA 1PJQA 3GEGA 2PR2A 4BO7A 3MWMA 3ZWBA 1PJ3A 1N1EA 5LDGA 4BNVA 2KIUA 4I7HA 2OGUA 3FNHA 5G4KA 1JHFA 2VRBA 3QA9A 4GYGA 1GADO 5DBFA 2VC0A 1KYZA 3AI1A 4L9JA 5FFFA 4XRGA 3F3XA 3MJTA 4WPGA 3L6OO 2JD2A 3DZKA 4KN4X 4DBVO 3QVSA 1IPEA 3ML6A 4UXNA 3CO7C 5ADHA 4FFLA 2ELHA 4HOBA 2P91A 2YV1A 3KZZA 1M75A 3A14A 2BEOA 1A72A 5I9NA 1B4AA 4W9NC 2NS0A 1T39A 3KLOA 3SXYA 1XELA 2BGMA 2DFVA 4WEQA 2OZPA 1EBUA 3EQLF 4J6FA 5AXDA 3WLEA 1KU2A 4INAA 4XIYA 4ALLA 1PQWA 5IDQA 1QV7A 2YPRA 3JYQA 4P4NA 4CUKA 4DLAA 3PQDA 3E9NA 2J5KA 3DZBA 5MGBA 2VHWA 5CVVA 1C14A 4Y8VA 4CMHA 2M45A 4Q4ZF 3N97A 4R8HA 1OFGA 3F8FA 1GVJA 1OAAA 3GYHX 1N8KA 5BSFA 1R5GA 1E1KA 4FS3A 3CKYA 4Y9DA 1VLLA 3BY6A 4WJZA 4TKMA 1JWAB 2EWMA 2FF4A 5TF4A 3RD5A 1JAYA 1NWCA 2GXGA 4ZN6A 2DUWA 3KP5A 2EV9A 4YJHB 4WXHA 5A5EA 1K78A 2CW0F 3LA7A 1DHRA 3OM9A 4J0EA 1OMOA 3DBHB 5L51A 1TLHB 3QP6A 4LLNA 4DQ2A 2EB7A 4NHJA 3RASA 1QZZA 4IF4A 1YVEI 1NFRA 2WTBA 4BNYA 2NSDA 1FDWA 3GF4A 4MTEA 1BXGA 1Z45A 3IKTA 4TVOA 3WWZA 4B7XA 1DPRA 2D1YA 2TDXA 1HSTA 2PLAA 9LDBA 1J75A 4WKGA 3UICA 3GX4X 3IP3A 1YTYA 1PS8A 4L9RA 4Q9NA 1H9AA 3V8BA 3E5MA 1LJ8A 3A06A 1Q1NA 3UVEA 4EEZA 1V8BA 4PLYA 4CR6A 4BNCA 4CQMB 4JK1X 5B4TA 4R54A 4YJFA 5K0ZA 1ONOA 3UXYA 2FBIA 3HFSA 1F17A 3WGGA 1MKMA 1S7AA 3LZ6A 1A9ZA 1SC6A 3KCCA 2IA2A 2AEJA 4DIBA 2GZWA 1BTOA 3I64A 3ISPA 2ZQYA 3GZNB 1MZBA 1Y8QA 3K9QO 3TZ6A 2OU2A 1E6EA 4CHUA 3F5QA 2Q46A 4DLBA 2GA2A 4I5EA 1B3BA 3ZCXA 3HHPA 3KXDA 3KYCB 5ILVA 4XWYA 3P5SA 3RUDA 4YPOA 3ZMUA 2IZ0A 1XDWA 4JGBA 1R22A 4I02A 1D7OA 2EGGA 3WGHA 5T8KC 1ONPA 5JDIC 2AQIA 1UXKA 3GA0A 3T7EA 1R36A 2Z5UA 2GNAA 3D3WB 4JN6B 2HGCA 4MHGA 4QSMA 5KVQA 5F21A 3GMSA 5JE8A 3WIDA 2I6TA 3VDQA 3CZMA 3J81K 1JKIA 1OYWA 2O48X 4L0YB 1IN8A 2YR2A 2XROA 1SOWA 1Z7UA 1CF2O 3KYDB 3GXOA 5T8KA 5DDGA 4EJ0A 2AEFA 4I09A 4ND4A 4G5HA 4U0VA 2FXAA 1QYDA 4E12A 2PMUA 2UXNA 1WZIA 1YB1A 1ZREA 1I0ZA 1QYVA 2D5CA 4JBHA 4NNJA 1MFZA 5A04A 1U1IA 2IA1A 4UVCA 1HKTA 1O57A 1E3WB 1TB4A 3JYPA 4RPLA 5ILUA 2JAPA 3VTFA 4I1IA 3JQEA 3Q9VA 3DZIA 3F6VA 5G0WA 1YO5C 1RM0A 3DMTA 1XMAA 1BWSA 3SZTA 4CM1A 1W4ZA 5JLAA 3JTHA 1FP1D 2F00A 2BGCA 3OJEA 1P2FA 4HF1A 3LYLA 4OH1A 5A9SB 2IJLA 2CD9A 4YR9A 5F6FA 4A6EA 2EA2A 2WWYA 4NR0A 2FBKA 4CR7A 4MQ9F 5TT1A 4CV1A 4FCCA 2UDPA 1P1KA 4JROA 2EW8A 4Y67A 4A0SA 1MDMB 4P38A 1PJTA 2XOXA 5AIQA 4Z0HO 4OQYA 2GIVA 4CMJA 5A3VA 3MQ0A 2FR1A 1S6YA 1DC3A 2Y66A 3DO5A 2FSWA 3PJDA 1HKSA 4GWKA 4Y6SA 1B1BA 3ECOA 1C0WA 1AOYA 3BYZA 3ONFA 1RWBA 4B4UA 3I9OA 3R3SA 3JSOA 3I1JA 4F3YA 5TC4A 5I7SA 4KDEA 3JQ8A 2RCYA 2DQRA 3OV8A 2IODA 3W8DA 4L9TA 5ICEA 3K30A 2H6BA 2Q2VA 4IS2A 1E5QA 4ZGWA 2ZKLA 1EFKA 1JXSA 1VKNA 4BQAA 2X0RA 2Q2EA 2NNYA 1YB4A 4WLEA 2O3FA 4HWKA 1R4MA 2VRCA 4BKOA 4ESJA 2DM6A 3MCVA 1AE1A 3S1LA 3GEMA 2YX7A 4WE3A 2XAGA 3SBOA 4BB5A 1YL7A 3DTYA 3QW2A 4UUNA 4OJNA 3VH1A 2NTNA 3VVCA 3FWEA 5ILSA 1LBEA 1T4BA 5ER6A 2WE7A 4CMCA 2P4HX 4OQZA 4BGUA 4MVJG 2JFFA 3GUYA 4FPXA 5D5UB 2MLKA 2G7HA 2RQPA 1EDOA 1I01A 3C7DB 4FFOA 4YDRA 2ETHA 3IOYA 2AG8A 4JQCA 5FI3A 2YV2A 4EM2A 1ULYA 1TW2A 4HA8A 2K7LA 4QWQA 4LMYA 1ENOA 4W9NA 1KQ0A 2EWNA 2WJPA 2X86A 3IMFA 3KBOA 5L3CA 3C85A 1ON2A 1UP4A 3HRUA 2VOEA 3V1TC 1A5ZA 1N9GB 1HW2A 1YS6A 3SLGA 4CUZA 5A02A 3LC2O 5CDUA 1U3UA 1T2KA 3O9ZA 3LWFA 1XGKA 4DC0A 2WC2A 4RVSA 3VFZA 1XSDA 1K89A 2Y99A 3DOCA 3FCOA 3PLNA 2VXZA 1H9GA 4GBJA 4ZA2A 2UAGA 2XPCA 1XGOA 5EINA 1ZYRF 1DPUA 3CMCO 1MB4A 3ZN2A 2A35A 2UUPA 2G9WA 4XD2A 2YU3A 4PZCA 1HZJA 1R5HA 5HS9A 2FRHA 1KVSA 3DBVO 4NU5A 5BT9A 2I3GA 2AMFA 2NU9A 3IP1A 4KWIA 2VCYA 1VJTA 4GSKA 3OA2A 4K9DA 4YT2A 1T2EA 4G65A 4MP6A 5HRUA 4YB8A 2DBBA 3PQFA 4E2YA 1BOAA 2MBFA 1UH5A 4CMAA 1SPXA 5A2QK 1EFLA 2FN7A 2O7SA 1BBYA 2OZUA 2Y1EA 3B1KA 3C3WA 1YOVA 3GPDG 4U8GA 2D5AA 3FNFA 3BJ6A 1MGTA 3ANNA 4HFNA 4M6XA 1JLLA 4PFJA 3VAZA 4YTEA 1GUYA 2Y93A 2QQ5A 2FA5A 3AM4A 6ADHA 3ZH2A 2A07F 3F5SA 4P9FA 4PIVA 4UEKA 1O3SA 2E82A 3Q2KA 2OBNA 4QX6A 3JAMZ 4M71A 3LLSA 3P7MA 5THKA 3HHGA 1H6CA 4YBZA 2B35A 2WEKA 1E7QA 1FZPB 5ICGA 4B8ZA 1LDKB 4HLXA 1MLDA 3RI3A 3KHUA 4RPJA 4GXOA 3WE2A 1A4IA 1G3WA 2QIOA 3RJ9A 4J7UA 3DZJA 1AXEA 4RGXA 4I0BA 4LJZF 1JAXA 4BKPA 1ODDA 1W5SA 1NPDA 1P0FA 5G0UA 3RIRA 1I6XA 2D0IA 4JJFA 3UKOA 2HTJA 4HV6A 2A69F 1I1SA 2Q4BA 3OSUA 4EEXA 4P5OA 3B1JA 2NRAC 3GLQA 3PDJA 3PQKA 3ABTA 2EERA 4Q3BA 1LDJA 4DMLA 1DUXC 2VBYA 4R3NA 3GG2A 5E8GA 1M66A 2ADUA 1VL0A 3STHA 1K78B 1Y5RA 3GWZA 2YSRA 2JZYA 5BSHA 3Q9UA 4CM5A 4RB0A 3FPCA 1D1SA 4B7UA 2JFGA 3PJEA 1IOLA 1O9BA 4HX5A 1FT9A 3F46A 4CM8B 1BMDA 3E6DA 3K2ZA 1E7RA 1GQ2A 1KIFA 3HFGA 4FR5A 5JO0A 3QV1A 4NU6A 4XIJA 5IJZA 3TF5A 4IJWA 2CVOA 4BO4A 2CY0A 4H7PA 3ZNPA 3L00A 1T24A 4RGBA 3FTPA 3MTJA 3N4MA 4AD9A 1ZH5A 4RB1A 5FLXZ 1JVSA 3F72A 1P1IA 1IW7F 1R0KA 2XASA 3DB2A 4LVUA 4Q39A 1ZJZA 2LF7A 2G7UA 5F5LA 3I23A 3MEXA 2I99A 1S3JA 1KQ9A 4RVHA 5JFOA 3KLNA 1NX6A 1W73A 2P5UA 4PN3A 5DP1A 1PL7A 3HSFA 3F9IA 1GU7A 4FGWA 1WDKA 4G8XA 5TJHA 4BGIA 4DIFA 3ZHYA 4YXFA 1IN5A 1HSOA 5F64A 4RPKA 4BNKA 1ISFA 1A27A 1W0CA 3QAHA 1E1NA 1ZGJA 4Q3EA 2Q50A 3BWGA 5LCXA 1IZ1A 2A61A 2L01A 2PBIA 1VKOA 1WPQA 3J80K 1PUEE 1EVYA 1ZXBA 3GY0A 1ENYA 2V79A 4RF2A 1TT5A 1V35A 4M74A 5L3ZA 4EJ6A 4KNYA 3L77A 3ERED 4RDIA 1ZUD1 4BYYA 2R2GA 1BI2A 4P96A 1GEGA 1EV7A 3TKYA 4UHTA 1ULSA 4BH9A 3ZI0A 2DU8A 1V3FA 4LW8A 4EUFA 1YGYA 2HO5A 1BVUA 2HR3A 1JU9A 4CJXA 4CYDA 2HMWA 1O3RA 2RH8A 2O03A 4F46A 4FJ2A 5IFLA 1YO6A 1KU7A 4YEDA 3HN2A 1EQUA 3FNEA 3ADPA 4B4WA 2HRBA 3DAFA 3ROQA 3HHHA 3RAJA 2IRWA 4EUHA 1LSUA 1PS0A 2V6CA 4ENNA 2YFQA 4OIRF 1SOVA 3WICA 3IDSA 4E2XA 1WLYA 4NK5A 5KNLA 2CVZA 1L7DA 2R7FA 4A0XA 1G4DA 1FDTA 1N9GA 2A4KA 4KUEA 3QY9A 3GZ6A 2ISYA 2R3SA 4MTDA 2ZO4A 3K8ZA 3AU9A 3LK7A 1I5RA 1P45A 5TRDA 4IMRA 5DCMA 4TV7A 4J43A 3G73A 3MZ0A 4YFXF 3VH3A 3BMCA 3IJPA 1P4AA 4GQAA 1EVJA 4B3IA 1ONNA 1UDBA 2M5WA 3V8LA 3DDNA 3H2SA 3H9UA 1Q7BA 3DL2A 3I6QA 4A2CA 4BUCA 3ZHBA 4IM7A 4ZQEA 1ZSNA 3RCBA 3D3WA 3KVOA 2UUOA 1R15A 1WZEA 3M1LA 2PI0A 1QMGA 1LRKA 3TNLA 1ZRDA 1H2HA 2HUNA 3N58A 3OQ1A 2B69A 3GC6A 4OMUA 1WNTA 2O3UA 1H93A 5CEFA 1WVGA 1J4AA 3Q6IA 4KUGA 2ZJ0A 2FRDA 3RC2A 1PDNC 2GXBA 4EJWA 2M1BA 1DIRA 1HE4A 1I1GA 1M2WA 4LCJA 1H2BA 4MVJM 3RJ5A 4ALJA 3FRJA 1HWYA 3S2EA 4BV8A 4ZICA 2B4QA 1W4MA 1RUNA 2XKPA 1XSVA 4KUMA
chains in the Genus database with same CATH superfamily
4RK7A 3UFXA 1HEYA 4HQ0A 5CVDA 5FWYB 4CKZA 2DPGA 4W99A 4H31A 4QUKA 2YW9A 1YBHA 1B26A 4XYMA 3UPTA 4B3RB 3JQFA 4BO0A 1WV0A 2GF2A 1V9CA 3IV6A 4M8LA 3E7LA 3B1WA 1V3UA 3J81Z 2QRHA 4X1YA 2IXTA 2MFZA 3KVNA 5CDTA 2QQGA 3BFVA 1H89C 1DAKA 3LHIA 1BAPA 1RI2A 3T1TA 3X1XA 3BJZA 2QPLA 3GZ4A 3DPLC 2KIMA 1GIAA 1NBOA 2XNKA 3FFXA 2WUEA 5MN6A 3KQMA 3MCWA 3EZLA 2IU6A 2BN4A 2FN9A 4HMQA 2H6CA 4HWOA 3OKPA 3LI2A 5LRRA 4E32A 1UJ6A 2WF8A 3HDHA 4XKCA 1KI4A 4H0CA 4NC8A 4W6ZA 3BVPA 3FG9A 1JECA 3X1KA 4XICA 4DIFA 5L53A 2LKPA 3VJMA 1HA3A 1ZJ6A 2WQZA 5A7GA 4XFKA 1QS0A 1E9FA 4FGSA 3CC8A 3SMQA 3CCVI 2MJLA 2NSLA 1N6PA 3IE0A 1KOFA 5TMDA 4KLZA 1QBGA 1RXCA 2QVZX 2XJ4A 4HZFA 3GLTA 4M8SA 4TUYB 3ZHQA 2WMYA 2R7KA 5GZ1A 4C2AA 2B4RO 2EFJA 3PR1A 4OIMA 2OAQ1 1BE6A 2XTAA 4KBGA 3V4GA 3WP0A 4DCTA 4C0BA 3TTWA 5CA0A 4F84A 1C80A 1ZNZA 5F2OA 5I3CA 1V3QE 3KQNA 3LT1A 5D2CA 1QOPB 4LRSB 2VDVE 1QWOA 4RPHA 4HWSA 1R5ID 5K4HA 1W19A 3AF1A 3GT0A 5C8ZA 4Z3OA 5D3MA 1Z2EA 5A6VA 1PSZA 5M7EA 1XPRA 5B4VA 1QC5B 4QRHA 1U4OA 2QROA 1X14A 4UCWA 1VYHA 1XYGA 3V7NA 3WWOA 2QTRA 5INTA 3G02A 4N39A 1O6CA 4XZ3A 3WNVA 1XEWX 1M1ZA 3Q9NA 5LYYA 1XJWA 3E4CA 4YJGB 5KOHB 5CVUA 2H27A 1QRDA 2ES4A 1R1TA 2YQZA 3TBIA 3VOBA 3HG7A 4D8YA 1WB9A 4KK3A 4DFDA 3DC7A 1B9NA 1XK6A 4JDUA 2Y0DA 2VNKA 4UU7A 1L7NA 2ZSUA 1GQQA 1OAOA 3G7SA 2JC3A 4OSEA 5REQA 1ZJYA 1P4WA 4ZYEA 3D0RA 1K0UA 4A0YA 2DF8A 4H7JA 2PL1A 3WI7A 5DXJA 2CCKA 3SF8A 3THYB 1OZGA 2BJHA 3BTOA 4E5SA 3H0GJ 2VQGA 5HODA 4KQMA 2HIHA 4IKFA 3NHLA 1UPCA 4S0ZA 1WZ2A 3WOHA 5C8YB 4GYIA 3T3OA 2HLDA 1FQOA 4FFNA 4G5OA 5DTDA 3IV7A 4ZU6X 4CF4A 3WLQA 5DRTA 3BDIA 5KWEA 1FJXA 5HDKA 3O2QB 4L75A 2Q62A 2ZQZA 3MGGA 4OP1A 3F7MA 1K7EB 4NAVA 2D8MA 2Z2IA 4KP7A 3ZWKA 2NYVA 3PSFA 2PVSA 4YDSA 3JQQA 4UPEA 2CVQA 4YR7A 1O97D 3NHKA 4WBNA 1U1CA 4KDPA 1BI3A 5IC5A 1X7WB 1LBSA 4LOAA 1ACIA 4FGLA 1K4YA 3X1WA 8GPBA 5DULA 4HAIA 3DNFA 4QEDA 1C4XA 1TQHA 2LWIA 4XGNA 4DOMA 2AG0A 3RRNA 2BFWA 2V4UA 1SUEA 1TEHA 6GPBA 1ZCAA 5IC4A 2XSDC 1H42A 3DPUA 3QQPA 4G9YA 4JCCA 1UMCA 1IZ7A 3GUVA 4N7MA 4UZEA 3CUQB 3R9XB 3R60A 1HORA 1PL8A 1Y81A 4I8DA 1T35A 5F2KA 4KQEA 2B0JA 3MWFA 4IILA 4MROA 4D41A 1DEHA 1GPBA 2Z5LA 5A2QZ 3UO8B 2RNJA 1MP0A 3IQDB 5KKAA 3UJ3X 1NR5A 3UK1A 4J2OA 3F78A 2X0DA 4I9NA 1E8DA 1TZJA 2JAOA 3R7LA 2HU8A 3GGDA 1GGJA 4MVCA 2BJWA 2IUYA 3B89A 4R6WA 4RK5A 4YLEA 1ZGCA 3BF8A 3LSGA 1BC5A 4M53A 2EFOA 1U8BA 4MAMA 5DM0A 3SBEA 4AMVA 4E4YA 2PUWA 4AY5A 1LB2A 5KREA 1A9XA 1FIPA 4WN9A 3GT7A 3HI4A 3ZHSA 2B2CA 4BLVA 5B4UA 1TZMA 2JJ2A 5AXCA 2OBLA 3QPDA 5HFJA 1PUXA 3WIOA 1JEYB 3OKAA 1WP4A 2RHOA 3QU2A 3R0VA 3QXJA 2BI7A 4ZDWA 1UUFA 1OCCH 2XE6A 3OETA 1P1CA 4KWHA 2WAEA 4ZO4A 2HZTA 2QX9A 1SKMA 2WPNA 2EEZA 4BBZA 3ZE6A 5A4FS 1WAMA 5GP9A 2OFFA 2Q3LA 3F8BA 1C1HA 4RDUA 3K92A 4G07A 3UMRA 2JLSA 1SXJA 2A0WA 4EW6A 2WINI 2LVSA 1U8UA 3WFZA 1MIOA 4QKQA 1YA6A 4FUTA 5T3YA 3WHPA 1R0XA 4AJNA 2K4BA 4P3KA 1FSSA 3HEMA 3W8EA 3TEFA 1MJ9A 3BROA 2K2WA 2ZRNA 3N74A 1QQTA 2YVLA 1YFZA 2LNDA 4IUDS 4C88A 5JSZA 2P6TA 3D1LA 5C34B 4EENA 3K4CA 2C7VA 2AOUA 2NU8A 3BAZA 1XGNA 1JE8A 1W96A 2R5YB 3DYBA 5K8IA 1FFYA 2EQBA 3LLVA 2GXQA 2W1OA 4V2FA 5E7JA 1YA4A 4LOLA 4JKYA 5HFAA 3VNBA 2BW3B 2QMYA 3WE7A 1BWQA 3VZDA 4AQYB 1Y9DA 2EBFX 4I5GA 1PYOA 1V95A 2G77B 3CNHA 5FV4A 4V0OA 3MJEA 1UKCA 2XAQA 1W76A 2LTAA 4C0LA 5JQWA 3IUQA 4Q47A 3B02A 3KQQA 4B7ZA 4ZZLA 1QIIA 3WHBA 1J9ZA 1PWZA 1XLTA 4LHEA 4AJHA 4D3YA 4LJRA 4J3FA 1A9PA 1Q3TA 2YUIA 3OR1C 3IOMA 4V03A 5EPUA 4BEJA 2X58A 3OJCA 5H6QA 1CP2A 1FF9A 2DFTA 2ZRAA 1EYZA 3JV7A 1L5FA 3SS8A 1Y3CE 4XEUA 3EWSA 3WJ1A 4DDTA 3WNQA 4EB6A 1QX4A 3R3UA 1RMQA 2Q1YA 1U4NA 4RPIA 5EZQA 3ZHOA 4XJSA 5KDLA 5KOIA 1HKQA 5KKNB 3ZGOA 3T4XA 3A58B 4RESA 1BCRB 4H08A 3F49S 2Q1UA 2ZS7A 4WK0B 4R1MA 4BNHA 2ZAMA 3KP6A 2OVFA 1YB5A 3OOUA 1MQAA 4P0TA 3AKEA 2ZJFA 3H5TA 3IAS2 1H0KA 3T5CA 4I5FA 1G3SA 3ZRGA 1P4XA 4ITVA 1B73A 1GVHA 1P5FA 2GCIA 2Y67A 1HYQA 3L8EA 3LT2A 3L7YA 4L07A 3TH5A 2EX4A 4OPMA 3U44A 3HUFA 1MO3A 3Q40A 2QJRA 2G40A 3GLLA 2B83A 4GXQA 4TSFA 2R1ZA 3D6JA 4XR6A 3W1EA 3U7EB 4DJFC 2JB9A 1WKVA 4M1QA 1Z5OA 3NTVA 1MH3A 4QBTA 1GZ7A 1K06A 1HG1A 2RHDA 1P5RA 1VIMA 1U9NA 3U49A 3D4PA 1L7AA 2C2OA 1CQIA 1U9IA 4C2TA 4C7OA 1LPNA 3EFEA 4OA5A 2X5NA 1LUAA 2ET6A 2X85A 2C7BA 1UZNA 2Q8QA 1NYTA 3ZCRA 3MTGA 1TTYA 2HYJA 1D8AA 1SVMA 2D0OB 5KAMA 1DXYA 1G20E 1VP9A 5ERXA 1T2FA 3JQ8B 4KGDA 4LZPA 2DJNA 5HF8A 3TCKA 4B83A 1XJ0A 4ZCMA 4E6PA 3L7CA 3KYBA 3B6IA 3AR5A 3ABIA 3HPHA 4QO8A 4C07A 5DM2A 2WAYA 4LITA 4IVNA 4MARA 4X8LA 1TIKA 2EZ8A 1THZA 2FZ4A 2OZLB 5AK6A 3GRPA 1UBCA 1OGYA 2W6MA 1TT5B 1YE8A 3GFFA 2VBIA 5FEMA 3ONQA 5CA0B 1Y8ZA 5JNUA 4KEAA 1IDOA 2J6IA 1EAMA 4JX6A 2MMCA 3DM5A 4MWDA 1WI3A 4HSGA 4X90A 3BTLA 2ZRLA 2CUZA 4NPAA 4S1VA 5ALHA 1HDPA 2PHZA 4X6UA 4CT5A 5CB6A 5JCXA 3EIQA 3PIIA 4HFMA 2P6RA 4LJ5A 4OHVA 2HDWA 2GK3A 1HDZA 4YYZA 4CZZA 5KC9A 2BGTA 1X7ZA 5ADUS 5TPZA 3UHAA 3D0SA 3DAPA 1ZEMA 2H9AA 3O21A 5PNTA 3UGTA 1IO2A 3KXPA 4JITA 2XAAA 2FUG2 3MTDA 1P74A 1H9TA 2X8JA 4IEEA 1SVLA 3X2SA 2IGNA 2MC3A 1UXOA 3K71B 2IA0A 4JP2A 1J0XO 3REQB 1XC5A 2E1MC 4R2XA 4R69A 1B0AA 1XRLA 5J43A 1MH4A 4YRNA 3DBRB 1MU0A 4I50F 1XU7A 1XMQB 4OAQA 3U4CA 1OV4A 4N4AA 1O94A 2LUOA 2MOKA 3DZCA 2HK9A 3LY8A 2I78A 4AVZA 4WDRA 2OO5A 3N7UA 4XLCA 5G0VA 3Q5FA 3PEYA 2W2LA 3LOPA 4HRVA 1GM5A 1PDVA 4MB6A 4XM3A 1HYEA 2WZQA 3QKRA 3C3YA 2JS7A 1K4KA 2IXDA 3QKRB 4OP2A 4WKNA 2FZEA 5BPDA 1QV9A 1VQ7I 4CQNA 1LDMA 3HKBA 4KO3S 1N6RA 2YINC 4YA6A 1LFBA 3WZLA 5FORA 2VXBA 5B2EA 4EK9A 4LF9B 2POQX 1P5HA 5ALIA 4PPQA 2DPDA 5F0HA 2P9HA 2Z1DA 3CONA 4WBNB 5AW5A 1IBKB 2CCGA 3KP4A 4C4XA 3E03A 2WHYA 1LB1B 3QYJA 2BE5F 4URFA 1NUQA 2ZXHA 1Y8QB 4QATA 3HJNA 4UU0A 5JAPA 4UUPA 1EH8A 4KN7X 1LE8B 2CJPA 4J0CA 2GJSA 2B61A 3BSWA 4LEIA 5IEJA 2P9YA 5CFQA 4CCKA 1U5BB 3HRKA 1QRAA 2WA2A 2WTXA 3CUEF 3KYJB 2Y4NA 5ILOA 3KPHA 2X2EA 4JLWA 1MBHA 4AJKA 4F4DA 2H5EA 4CRWB 2O8DB 2LC2A 2FFQA 6YASA 4RPCA 1UKZA 1JTVA 2ZW9A 3BGSA 3U39A 1S02A 1XB2A 1M0SA 1MD0A 1R5NA 1X7DA 1HBJA 2BI8A 3KVYA 5CM9C 3VPSA 3MINA 5AM5A 3OUZA 4HL6A 4CKEB 3T1QA 5CDFA 4BRWA 4UFNA 5LLTA 1UXIA 5E6RB 3VU3A 3PUIA 4RSMA 3AFOA 3PCXA 5JBIA 1Y3FE 2XB8A 1BKDR 1BIBA 2GJKA 4OGKA 3NRBA 4NYJR 4Q3NA 5GQSA 4D5GA 2YOFA 2FFRA 3IP4B 5A4MS 1R6BX 1A9XB 2H4HA 1RZVA 3EMBA 2VPTA 3S17J 4RWEA 3R61A 1SWVA 2WY7Q 4B3BA 3WTXC 3UMYA 4PBTA 1IBRA 2EG9A 4QUBA 4XUGB 1MEOA 4NCXA 2PYZA 1ISPA 2EC5A 3Q6MA 4LXGA 1K3TA 1SAYA 1PCXA 3S2ZA 1I10A 4LF4B 3BXOA 1N4AA 1PYVA 4BNDB 1VP3A 4J2TA 3AQ4A 5D85A 2I87A 2ILTA 4WLVA 3CVUA 5C5IA 1SD2A 1XZGA 4MDEA 1MZPA 3B6MA 3GN1A 4TTRA 3AWDA 5I9MA 5IWAB 2WW8A 1XJ5A 3EC1A 2N75A 4ZXFA 3W8RA 3AVYA 3AEQA 3SZRA 1G5FA 1KQ8A 1UDCA 3B8EA 2F3UA 3SICE 2HWVA 4BLSA 3OI7A 2EFEB 3BCUA 5GVRA 3L4JA 1AUPA 5ALDA 4KOEC 3TSYA 1VB5A 1G3TA 2FBHA 4LG0B 1ADGA 3D2CA 4KQ9A 3OYNA 2BMWA 1C1DA 3H3XA 2VWHA 1NXQA 5CYPA 5AICA 2ORWA 3IBTA 3OZEA 1QG6A 1XXHB 4X1IA 4F2HA 2X4GA 4XK4A 4OB8A 5A4KA 1X8LA 2IOQA 2RREA 3KEYA 1OY1A 2EIXA 4UUAA 5H83A 4AQ7A 3QKSB 3BXEA 3PFGA 1B8IB 2B37A 4H0FA 5ILQA 2IY7A 2JN6A 4E30A 2F90A 1AUQA 3D3EA 1FBUA 1MTZA 1WKCA 2JTVA 3MCTA 4JXKA 2XCTB 2ONKA 2BY2A 1EI9A 3L8CA 3MQFA 2ZBUA 2FEXA 4HCJA 4L6CA 1IY8A 1F2DA 1PDOA 4UAGA 4ZU3A 2YV5A 5LHIA 3SDBA 4ETMA 2XUOA 4QOIA 2FF5A 3OH8A 1QR2A 2OQIA 1SBYA 2WIJA 3RTBA 4D8UA 1TJ3A 5F3RA 2XUZA 3OUTA 4MNUA 3ID6C 1GO2A 4OIQF 1SMKA 3AZQA 2C4WA 3IDFA 1MO4A 3IUOA 3T3DA 4FZ5A 4GUAA 3TOXA 5KHDA 4DAOA 3THOA 3R8XA 2GJAA 3UK2A 2JGDB 2VPZA 1IXZA 4YQFA 5KWVA 4EJTA 1UDWA 1YSCA 2PMBA 2J7PA 2DSTA 4EUSA 5IU6A 3B7PA 3I53A 3QWAA 4PJNA 1YG2A 2CB9A 2HA4A 2IYEA 2Q0XA 4V39A 1A8SA 4HQEA 1B6GA 4XD7D 4DVGA 1OR7C 4DC1A 1RIIA 3C6MA 3VVLA 3W2VA 3EAGA 2DR2A 2M0CA 3VODA 3GDHA 3I83A 1LRJA 3B5IA 3PCTA 3OPYB 3RVKA 3E2IA 4Q00A 1G3QA 5EKXA 1OC4A 2DBYA 2BVLA 4OQEA 3TOAA 2DYSH 2E71A 3A02A 1FC3A 3E5RA 5JATA 2H57A 4ZV4A 1FFSA 1OFIA 1NE2A 4YCBA 4BQQA 1YZTA 1UEXC 2ZROA 4IQJA 1GWNA 4XGIA 4A0ZA 3LSYA 2XMZA 3ZW9A 2J59A 1HW5A 1V6SA 4C78A 1AQLA 3J7AY 1V7CA 1JDNA 4UMVA 1MDBA 3AB3A 3ENVA 1LNWA 1Q0PA 2J3JA 4HAYA 5G2OA 2R8XA 3UATA 1YIJI 3AEUA 3DLPX 5DT2A 4DA4A 4ZYHA 1E3IA 1QF9A 2JJ8A 4CG1A 3E15A 5HM8A 3ERCA 3OSZA 5K3FB 3WDLA 2PQMA 3A28A 3G8YA 3L0PA 5B3JC 5LLSA 3J80A 3STTA 2P0YA 3Q5GA 1COZA 1FNNA 3Q7EA 4IYJA 4I98B 3WKCA 4CR8A 2X0KA 1JHZA 4KIUA 4BVLA 4C3UA 5L95A 4V0MA 3VFDA 4CTJA 4YJKA 1GG9A 3RT1A 4ENPA 2DY1A 2IPMA 5DZSA 3WL8A 1CJMA 2GTHA 4CMIB 2XQIA 3OLYA 5J4KA 5ELXA 1G9XA 4KIJA 3G2NA 1JJAA 1LFUP 1PQYA 1UAYA 3UWOA 5HS7A 1WXGA 2WWGA 2JBHA 1GLGA 3G1WA 3KQWA 3Q3IA 1KARA 3COYA 4IHKA 5BNTA 1DT3A 1BG6A 1H0MA 1RXIA 1D4FA 4O2BF 4S1NA 5CP8A 5T5QA 5E2IA 5DISB 1RRCA 4XXHA 1VJDA 5BQXA 5E8JA 3TCNA 3V7WA 2XRNA 3BILA 1H1TA 3ACBA 2MSYA 3DLLF 3T1YB 3AVOA 3EZ7A 1Z82A 3IOEA 2MWMA 3DTVB 4FIZA 5JAHA 1WSUA 2QQBA 1VQ6I 4HYEA 1CR2A 2EKPA 4I55F 5A9SA 1KQFA 1XL0A 5BS6A 3G2IA 3HWX1 1P0PA 2OBXA 3ZDFA 1O8BA 1TJ4A 1OC2A 3BSSA 3ND5A 1NATA 4RGVA 4MQMA 1Z2PX 2GAUA 1TCVA 2JGDA 5FRDA 3MSCA 4LBVA 4CGYA 1A6QA 2ZS9A 1VLZA 2JEYA 3KKKA 1COWD 3JD2A 4XJTA 1AVTA 1XTSA 2XX3A 5FKOA 2VAPA 3LC7O 1ECFA 1ZN2A 1QUEA 3PHLA 4RYLA 1RHMA 2P0WA 3DFKA 5EMHA 3VVBA 2YUSA 2NU7A 4MA5A 4HPQA 3BL5A 3I72A 1JFRA 3TL4X 5JWHA 3ZZNA 4F60A 4TS4A 3BR5A 2OG1A 1ZL0A 2FMHA 2Z57A 2VP3A 1E2JA 2ZK7A 2XCQA 3IXMA 4FDUA 3KP2A 4MWCA 4IRHA 2FQWA 3VA7A 3L1PA 2AWNA 3OZWA 1MJBA 3AHDA 2E5FA 3C43A 1SO8A 4F4IA 4IQ4A 4BNNA 4BCCA 3ADCA 1O6ZA 2ZYDA 5HXAA 1T6XA 3ZQ7A 5CD1A 3O95A 4B6JA 3C2BA 4OGFA 3LUHA 1OCPA 2DKFA 4MUXA 2Z9DA 3GLXA 1P91A 5IYZA 4PTZA 2YBDA 2XUPA 4RS8A 5E1WA 1SUSA 2O7NA 3NAMA 1OCZH 1M10A 3R40A 4RX1A 3ZGXA 3ZE8A 4GIBA 1WSAA 2VKQA 5IP5A 2WPDD 3WQSB 3VSAA 2C6YA 4MIKA 4UNRA 5TMPA 1JEQA 2FE3A 1J8VA 4O3MA 4EY3A 1FFEA 2BI4A 2BFDB 2LRHA 5I7AA 3M3PA 1AUVA 1WUHS 4OAPA 4B6SA 3VPGA 1JWLA 4DRYA 1ARZA 3T5XA 2HK8A 4CM4A 3D8RA 4NARA 2PV7A 3UJ8A 4AIKA 2HNAA 2R1TB 3QI7A 4PWZA 1IJKA 2O06A 2PJRB 1TADA 3EXEA 3GZJA 4PYJA 4NX2A 3OTQA 1UL1X 3IOCA 4RQAA 5TV2A 4M9XA 4FK8A 5F7OA 4YJGA 4QNNA 4TZ6A 1FTNA 2F5CA 1EA3A 1AKWA 3PWTA 1DBPA 3RKWA 1QZEA 1I4WA 2WIBA 3A2NA 3PDWA 4I4TB 5DBIA 3WWPA 4F9TA 5BRJA 5JANA 1DIBA 4AUEA 2JUCA 1Q0TA 1Y8RB 1XHEA 1Y3BE 2VJOA 3GBSA 3G1MA 1WJCA 1NSTA 2I7DA 3CH4B 3NANA 3SSMA 1ZLYA 1JAIA 1OFUX 3TLMA 1RLJA 4H4KC 2EK5A 2HOAA 2AW5A 3KSRA 3VXKA 1SEVA 1TF2A 2HK7A 3IXQA 3ZQGA 4IGEA 2LBFA 5H7XA 3T9EA 4IRXA 4JDPA 3EDCA 3WQHA 2O8CA 4L9VA 2EINH 3KQSA 3T5AA 2E4YA 1M83A 2O8DA 2LR0A 4GVLA 1US8A 4OKNA 2AN9A 4FDTA 5SY4A 1TF5A 1QBJA 3EYYA 1JUDA 3KKOA 4AN1A 2E37A 2UXCB 2CDCA 2M2IA 4U2BA 1LVKA 4YFVA 4D9IA 3TGPA 3ONDA 1I4TD 2M8EA 2AJCA 5FADA 5HE9A 1ZHHA 2I6SA 2HK6A