3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
4LJZF 4CICA 4LISA 3IJPA 4Q9NA 1HE4A 4R51A 1FWZA 1YFHA 1T39A 2EKPA 4WLNA 1HXDA 2PMUA 4LLGF 2AXQA 1PL8A 5DUKA 1SAXA 2OO5A 5ED4A 1H2HA 3OH8A 4I5EA 1IXSB 2GASA 3FPCA 5IF3A 3DTYA 4WCFB 4E12A 2YJZA 3EK2A 1V6AA 2YHIB 3JTMA 3O8QB 4ETSA 3C7DB 1MD0A 4PFJA 1AUPA 1Y8RB 4PLYA 5D5XB 3VH1A 2RC4A 1R23A 4HF0A 1HEUA 4PLFA 2CY0A 3U9GA 3WICA 2PGDA 4FT8A 2WYWA 5H82A 3W6ZA 4L0ZB 3H9GA 1Q1HA 4MEXF 4CM9D 3BAZA 3DC2A 2GPTA 4BNTA 5ITWA 2I6TA 1R4NB 4XIJA 2X58A 4J4BA 3OJ0A 4NQZA 2PH5A 1BIBA 3DZFA 3J81K 8ADHA 1G0OA 4TZKA 5BPDA 4B3JA 2XHKA 2C5EA 2GLXA 3WB9A 1SD7A 1YBAA 4MPDA 2JRTA 4YAGA 2GO1A 2V6MA 4CL3A 5G0TA 1FOKA 4NQWA 1YXMA 4Y6PA 3T8TA 4ALNA 3X2EA 1YYVA 3FXUA 4UXNA 1GHCA 2QZ9A 4YJHA 1PDNC 2W24A 2HWVA 4ALMA 3J81Z 4P55A 1SCUA 3PVZA 4GL4A 5L4SA 2F5FA 3MJ4A 3QIVA 4J49A 3WGZA 4ZRNA 4PLZA 1X3UA 1YBMA 4ON0A 1IW7F 3BHJA 4MKRA 3OEWA 2UZKA 2FXAA 2YDXA 1R12A 4IS3A 1YLFA 4J4HA 1W7PB 4QSMA 2NU8A 4GX2A 1VJ1A 3LDHA 4ZD6A 4MGRA 4HKTA 1G6NA 1GUFA 3PDUA 1K89A 2XROA 3GDOA 2A69F 4AJOA 3E97A 4PLGA 2H63A 1KU9A 1ULSA 3I4FA 1FBUA 4XZ3A 2HEOA 4YT4A 2P5UA 1FBQA 1MDMB 3TZ6A 4YJFA 2RIRA 1DUXC 5G2OA 2R7FA 2DK5A 3FMQA 2XUBA 4BQAA 1B14A 4WE3A 3RVDA 3PJGA 4B8XA 2UDPA 1UHWA 3RUHA 3HUGA 1PQPA 1UAGA 3G1UA 1N8KA 2DTDA 3W6KB 3A4VA 4BNVA 2OBPA 2OFPA 1WZIA 1X15A 4B3IA 4P96A 2PY6A 4CUJA 3RIRA 1WWKA 2QIOA 4XQ9A 1O57A 1KVUA 5GZ6A 5CDUA 4CMGA 2O3JA 4F7ZA 3GGOA 2HMSA 2VODA 3ONDA 4U88A 1B15A 3WOHA 4RB0A 3ZU5A 5F5LA 1I1SA 1VE9A 2R00C 4XGIA 4AJJA 1E7QA 1ZMOA 5CEFA 3TO6A 4HQEA 3KYBA 3RUFA 3HSKA 3H3UA 3CXRA 3KTDA 3U0BA 4BKQA 2MBFA 3I9MA 4D79A 4FGWA 5JFRA 5L53A 1XYGA 2VTEA 4A0ZA 1V3FA 1A71A 3AOEA 5LC1A 4XB2A 3K2EA 1O7LA 3FI9A 4NFSA 3QVWA 3L9WA 3ZMSA 1CWUA 4ZGWA 1R36A 4JXKA 3E6BA 1KGSA 1A9YA 1XDUA 2FN7A 2CF5A 3KLMX 5JDIA 3GH3A 3L77A 3OHSX 4OHUA 3WIEA 4BNNA 4AJPA 3JAMK 2EG9A 2Y1DA 2XAGA 4E5KA 1VM6A 2V6GA 2HMVA 1WI9A 3E5QA 1RM4A 2D59A 3INTA 4MO2A 1E3JA 2EKLA 3GF2A 5CVRA 2BFOA 3DQPA 2V1DA 3DZBA 3PQFA 4J9UE 4EJUA 3T4EA 2STWA 2YFQA 2FBIA 1KVRA 4HBGA 4BO8A 4UVBA 1PJ2A 3WU0A 3KEQA 3V4GA 3B70A 2WM3A 5T8KA 3B1JA 1QQIA 2FEZA 1FX7A 2ZKZA 1X1EA 3P2YA 1BWSA 2AXLA 1R4NA 4XYEA 5KVQA 4AIJA 3V7CA 5L4NA 2UUPA 5DUIA 1H6AA 3P7MA 3HN7A 1W5SA 3R61A 1NTOA 1PX0A 3A1NA 2VNAA 5I8ZA 3OF2A 3RUEA 2W2LA 2QZ8A 1SEPA 1MA0A 1H0MA 2X5OA 4EJTA 3TQNA 3PLNA 5EQFA 2DLLA 3GVAA 3VKUA 3KP5A 1YS6A 1ZJZA 4C4OA 4OH1A 5ADHA 4OIQF 2BRUA 3PFFA 2PEXA 3KSUA 4BO6A 3DFZA 3M1EA 5JDIC 4WLEA 2VWHA 2WTBA 2XKPA 1EVYA 1HW2A 1QBJA 2GXBA 5A2QK 4UUMA 4R1HA 3TOBA 3ZWYA 4AJIA 3O9ZA 2VXZA 4Q3BA 3DFGA 2DAPA 1VKOA 4GO1A 2FE3A 3I4CA 4U0KA 1MV8A 1W6UA 1XCVA 3TKYA 3PQKA 2NU7A 3NJ4A 2FQ3A 4RB2C 3KHUA 4WCGA 1UJMA 4UHTA 3ZWAA 1H6CA 1JE8A 3E5MA 1Y8QB 4BO7A 4IJAA 4G81A 3FMRA 1YH3A 3PHIA 3U3XA 1U7TA 2EA4A 1D8JA 1N92A 1O94A 4QO7A 2P6TA 3EUWA 4GWKA 2P5LC 3GZNA 4C7KA 2V6BA 1Y81A 3JQAB 4NHEA 3KZYA 1FNNA 3KEOA 1DHTA 4IDCA 1XN7A 4Q4ZF 4BKOA 1MUUA 3HJAA 3DTTA 2DU8A 2PI0A 3DAPA 3MTJA 4IQGA 4UAGA 5U1PA 3W4IA 3UFXA 4KUGA 4BV9A 2COMA 4AL4A 1HDRA 2ZQYA 4AIHA 1BW9B 3DBHA 4WCFA 3F8NA 1DJQA 5DCYA 4DQXA 3INGA 4YXFA 4AVPA 5HOOA 3RBZA 4XKJA 1Y8RA 1FBSA 1PJQA 3E6AA 4LLLA 1QXSA 3M8FA 2NQ8A 5FFXA 4N9IA 2VQ3A 5ILUA 4R69A 4AG3A 1TA4A 3JD3A 5F1RA 1NQOA 2O3QA 4HQMA 4J3FA 1W73A 4LD5A 1RI7A 2OUIA 4EJ0A 1VRWA 3DMYA 5KKAA 1IZ1A 1GV0A 2JFFA 1K6IA 2O2SA 2R3SA 3E9MA 3GDFA 3I71A 2Q4BA 4L5JA 1PUEE 1NPTO 3GOHA 3I9KA 3T5XA 1HLDA 3HQ4O 4K28A 3V1UA 3VAZA 2GR9A 1QYWA 1UZLA 4Y13A 2OOSA 3F8MA 4CDGA 1SAYA 5EEHA 1ZUD1 2RBEA 3F4LA 3GAFA 3SX2A 3TFQA 4ESOA 2ZCVA 1E3LA 4LB6B 1BTOA 2WD7A 5DDIP 1GY8A 4HV6A 1LNWA 2EIHA 4RVFA 1BDMA 3WTTC 1Y9AA 2M30A 4Q3CA 4AJHA 3JD4A 2O3UA 3ECHA 1VPDA 1WNTA 2GERA 3AM3A 2W90A 4UVHA 1FC3A 3K9QO 4PG5A 2K4BA 5JE8A 3V1TC 2WDZA 2FR8A 2OZ6A 5E8GA 4WK6A 1QGPA 3AI3A 4I1IA 2RAFA 5DP2A 4ASNA 5C7LO 1MJ9A 3ZQ7A 1EEHA 1G6KA 2RHRA 4W4TA 1W7PA 1MFZA 1A04A 2NRAC 2YW9A 3F6OA 4MIOA 3WE2A 4Z0PA 1B0AA 2LF8A 5AXDA 3G49A 4DMLA 4BNIA 1HSOA 4CODB 1P31A 1NVGA 3BZUA 3TOXA 1SD4A 1XGSA 2DM6A 2GYYA 3E5UA 4PZCA 2AEMA 3T7EA 2RKHA 4LG0B 2DFVA 4NJMA 3JQGB 5GMOA 3ETEA 2ISZA 3VDRA 1HW5A 3HOSA 2VCYA 3JQEA 3QP5A 4OMUA 4RVGA 1X0XA 4R1NA 4IJWA 2L01A 2DFDA 3NQOA 1EUCA 3WTZA 2FBKA 4L5IA 2H5LA 3ULQB 4IGFA 4IPAA 2UAGA 2FMYA 4L74A 4NG5A 3CH6A 4U6QA 4FJ2A 4R5MA 3ZNNA 3KBOA 4WASA 1V0JA 5COBA 4IXWA 4AJEA 3GUYA 2Y1GA 1LDYA 2ZKLA 4KIGA 1F5TA 4HA8A 1YQGA 2BKAA 4RAZA 4WOKA 4YAEA 2XRNA 3O38A 3PYXA 2C07A 4IJUA 2GN6A 1HYGA 1REPC 2FU4A 1TBXA 4NH4A 1XU9A 3L4BA 4J90A 2D3TA 2D1HA 3MQ0A 1H5QA 3QVOA 4TQGA 2P7VB 5HLHA 1XWFA 3TZKA 1YW7A 1E1KA 3EC7A 9LDBA 3LQQA 4EJWA 2R00A 4EUHA 5DN9A 4AJ1A 2BGKA 3NRCA 3H9UA 2OU2A 1DAPA 3KV3O 3ORFA 3AW9A 4YIFA 3GF4A 4H15A 4CLRA 4IUYA 3GVPA 1MX3A 3H9JA 3U1DA 3PJDA 4BQPA 5F1KA 2O03A 4M9SA 1ZH5A 2G5CA 3IL2A 1EQUA 4ENKA 3KO8A 1L7EA 3JQ9A 3GZ6A 1ADBA 1QYCA 1CDOA 3EMKA 2Q1SA 5AOVA 2ISYA 4J0FA 1LQTA 5HLIA 1Q7GA 3M6IA 1KQ8A 4YWJA 2EFPA 3GK3A 2DU9A 1YS7A 3SHFA 3IDSA 1P1RA 4FB5A 4E2YA 4BNGA 1HE3A 1J6UA 2J3HA 4I08A 4KDPA 2FSSA 4CQMB 2JD2A 2X0IA 5ENDA 4M73A 2VHVA 2GZ3A 5HS7A 1FJHA 4ZYHA 1V35A 2HQNA 3HSRA 2Q1TA 3GNSA 4JK3A 1E17A 2Y0EA 1R1VA 1HQCA 2AQ8A 3BMQA 2B36A 1PR3A 4L73A 4E5MA 1A7KA 5KJFA 5B4TA 4MQVA 1X13A 3FNEA 3NGXA 2DBVO 1ENZA 3RYPA 1CERA 3PYMA 3F3XA 2QQAA 4GH5A 1O6ZA 1S7CA 1XD7A 2XV4S 4ENNA 3OQ6A 5EERA 5LEJA 2Q46A 1LLUA 3ZCXA 5JC8A 1F14A 1HDYA 4KWHA 4KMSA 5JAQA 1LNQA 3OIDA 2Y1EA 4JBHA 1FPQA 2PGLA 1DJNA 1E7YA 4EJ6A 3KP3A 5K0ZA 1U4OA 4M71A 3H65A 1QV6A 3ZU3A 2X7HA 1S7AA 1J5YA 1GYPA 2D45A 3NDIA 4YA6A 2DTEA 4O59O 2D1YA 3GVHA 3LK7A 2J5OA 3V8JA 1LEHA 1NQAO 2VE8A 4K2EA 5E1XA 1LDGA 3WFJA 1ZHFA 3EYIA 1IN5A 5CLSA 2VWPA 4IBOA 3CMCO 5H83A 2A35A 3H4VA 5CFZA 4IY1A 4ZA2A 3CZMA 1KC3A 2GN8A 1USSA 1AN9A 3DMTA 3LC1O 3GZNB 5A5FA 1CF7B 4YIIA 1B1BA 3L2CA 1TT7A 4WX9A 1ZK0A 4J1QA 1ON1A 1NBOA 3ZWMA 5CHEA 3K9TA 2LSOA 4QT0A 3VZRA 4UUPA 2VHZA 3TZHA 1MC5A 2FPPA 3HUDA 3JQ6A 3UH1A 4A0SA 3H2SA 5ER9A 2IRFG 1ONVA 5KJ1A 5E1ZB 3O6BB 5H6QA 5K5OA 3CUKA 3PXXA 3ZNPA 1RYDA 4RF2A 2HTSA 2MD5A 1KEVA 3Q2KA 1HL3A 1LRKA 1TB4A 2MA3A 2ZTVA 1LX6A 3GPDG 4ZQHA 2VRBA 2PQ8A 2L54A 3R0AA 4P9UA 1D3YA 3DZKA 1U8RA 3MJCA 4IF4A 1HDXA 4BVAA 3RI3A 2I3AA 4R1TA 4A7PA 3S1LA 4BS9A 1IRGA 1Q0QA 3FNFA 1HSTA 4LK1F 3AM4A 3QWBA 3TZQA 4JQCA 3UHAA 3EYWA 4MKZA 2NADA 1T2CA 2P4QA 2HGCA 4XGNA 1FP1D 4CM5A 4CGZA 4WGGA 4WXDA 1ZG3A 1ZZEA 1OAAA 3ADPA 3DAFA 3PEFA 4ZJUA 1Q7BA 4J16A 1TI7A 3DBVO 1R1TA 2DFIA 2XVCA 4UULA 4WCDA 5I9MA 1JDJA 5JSFA 2XXJA 2CDBA 3BMOB 3D1LA 3F9IA 3FRJA 4DWVA 1HYEA 1LJ8A 4II3A 4ALLA 2EKQA 3QE3A 5EJ2A 3ZNOA 5L3CA 1VL6A 5CDSA 4HV4A 2ZJ2A 5COAA 2AEFA 1KC1A 4NBUA 2YYYA 2A6EF 1E3EA 2NVUB 1J49A 2ETHA 5JNLA 3D5TA 1KBZA 2MLGA 2JJYA 2X5JO 3D4OA 5F21A 6ADHA 2EV5A 4RGXA 3SQNA 2L3DA 1NWCA 3DQVC 4IXAA 3RC7A 1FYLA 3GFIA 3B73A 2V6FA 3RUIA 1D1TA 3ZPLA 3I23A 3RC1A 2I9PA 1B8PA 3JQGA 4XA8A 4A0YA 1PWZA 1FLIA 2O4UX 3PI7A 5A9SA 5I9NA 3JYQA 3SVTA 2IJLA 4XRFA 1R22A 4UVCA 1W5TA 3GLQA 4HNHA 4R01A 3IRRA 1YG2A 4L9NA 3TSCA 3TOAA 1P4XA 4BB6A 4CM9A 4D41A 5L3GA 2HZTA 2DPGA 5DCWA 3UUWA 1EVZA 1OMIA 2GZWA 1LDNA 4K9DA 5BNFA 2HJSA 4QECA 1X14A 4WNCA 3U49A 3NT5A 2PH3A 4I9HA 4CQMD 4MQ9F 5HDKA 4LN1A 1XLTA 3KOUA 5CVUA 1ZARA 1KEPA 2UV8A 3QRWA 1KYQA 3B6ZA 3QLJA 1GYQA 3I1JA 3JQFA 4W6ZA 1P45A 4O6VA 4E2WA 3CMMA 1ULYA 5AYVA 5BPIA 5FEUA 5I7VA 1DRWA 1GVJA 1C1DA 5JFOA 2X6TA 3WWZA 5BOXA 4XEHA 1A4UA 3HDHA 2ZQZA 3IAHA 2QX7A 2Q2EA 2CO5A 2E48A 2STTA 4CMJA 5CG2A 2CFXA 4FD3A 1L1FA 1BJAA 3D3EA 3I9OA 3E5XA 1ID1A 2P5KA 4OIMA 5TQVA 2XAJA 1PJ4A 2P6SA 5ITVA 1KU2A 4I2OA 2C20A 3LU1A 1Q7CA 3L4BC 1ODDA 4I5FA 2HYFA 3I9NA 4WJZA 2QYSA 5G0SA 5TGDA 3VVBA 1IOLA 1H93A 2W98A 1R6DA 4JROA 1LLCA 4NK4A 3FXRA 1YB1A 3SJ7A 2BEOA 4S3MA 1CEQA 2ZYAA 4HOBA 3GEMA 3O26A 3WJAA 4MP8A 2PZLA 4GSLA 3VPXA 1TT5B 1Y7TA 5EESA 1ZN2A 1PWXA 4FSHA 1HW1A 3BPXA 5THKA 1P4AA 2TMGA 2VC0A 4E2ZA 4CR7A 2IZZA 4RPHA 1DC5A 3ITDA 1KYZA 4A0XA 2ZIZA 1U8XX 2H6EA 3ON5A 4Z3DA 2OZUA 3HTUA 2I65A 1QYXA 4XQCA 1LDJA 3K73O 4N7RA 3UKOA 4BXUA 2CUKA 2NU9A 5FFFA 2LKPA 1W4ZA 3C8MA 1HKTA 1M67A 3O03A 1F8FA 3F8BA 3ZN2A 5KTKA 4RV9A 1NHAA 1R0SA 1Z9CA 2A5YB 2X5KO 3T4XA 5JR3A 3BMQB 4D0RA 4O63O 1E1MA 1QORA 5G4KA 3LFKA 2MH9A 3H9QA 5BMZA 1AXEA 3ASUA 4UVDA 1QYVA 3UCEA 4AJ4A 4L9RA 2VT3A 4BQRA 4YR9A 2WWYA 1S7OA 5KIAA 4XQEA 2EP5A 2NU6A 1B7GO 2QYOA 1GPDG 1CYDA 3PHJA 1P4WA 3WYBA 3U62A 1Q0HA 4Q5SF 4UVAA 1BMDA 3CUOA 2A4KA 2Y05A 3K5PA 4S05A 3BHIA 5JPIA 3GAZA 2HYGD 1U2DA 5BR7A 2AA3A 3FHLA 5C7OO 4W99A 5FD6A 1PTJA 1SOVA 3KETA 4XSZF 5AXBA 3OFSA 1S6YA 5KJCA 1U8FO 2ZB8A 4I5DA 4O6JA 4GCVA 2DTRA 4BNHA 1FSHA 4G6QA 4XYGA 5HBRA 4BNLA 4AVYA 3HB5X 2PKRA 1K6XA 3K96A 3OEYA 4MP6A 4RPKA 1ZAOA 5ICMA 1P1HA 4WK8F 4O0LA 5J8CA 1O9BA 1RPNA 1DFIA 2KJBA 5HM8A 5A9SB 4N9HA 2V9VA 1RIOH 1DIHA 3ZMUA 4HBLA 2JZYA 1DRVA 3MZHA 4IDBA 1WKMA 4GMFA 1GCUA 3K1NA 1HTBA 4WEQA 4CMHA 1Z7UA 5A04A 3HYIA 2O8XA 3LT4A 4OM8A 2Q2QA 1IPEA 5U9CA 1OZAA 1EDOA 2J5KA 4NPCA 2K02A 1GCOA 1I2CA 1O95A 1XGNA 3GX4X 1MGTA 3KP4A 2Q4EA 4BV8A 5JXWA 5K9ZA 3JQ9C 1LRLA 4ZICA 4RVUA 3K1MA 3Q11A 1K79A 1KERA 2JCVA 4X54A 4Q3DA 4G7ZF 1C1DB 1E7MA 1DOHA 3ZU2A 4CLXA 4MVJI 1M76A 3HADA 4R79A 2FRHA 4QLCU 1JU9A 3OMLA 4L8VA 4RPGA 4F46A 3EQLF 4XJSA 4E21A 4OXYA 1BDBA 2IZ0A 3PWKA 4IRHA 5K6AC 3P19A 3EZYA 3N4MA 1A72A 3BTVA 5D5VB 3SXYA 3ICPA 3IUPA 4DLLA 2B4RO 2EV9A 4UVEA 4YQZA 1NXQA 3WMWA 3B1KA 2PA3A 3GVXA 1B6AA 1VLLA 3JD1A 3A28A 3Q0EA 3GMDA 4JX8A 3AFNA 2CVOA 3ZMVA 1KU3A 2VUTA 1OKRA 5EL0A 5TF4A 5AQ1A 1FYMA 5KVSA 1HE5A 1Y1PA 3K69A 1ISHA 3OP4A 2G7UA 3M7GA 3U4IA 4FDAA 1EE9A 4XDYA 3ZWOA 2CWEA 4E70A 4EJOA 2K27A 1XG5A 2G82A 1K5HA 2OGUA 3ROKA 4RQUA 1GUZA 3JV7A 3Q6IA 1FDUA 3AUSA 3R1IA 2UXXA 5EEGA 4FN4A 4OXKA 3NAQA 4BO5A 3Q9VA 5CJ9A 4GXOA 1KVSA 4L9VA 1PJ3A 3D4PA 3GFBA 3L6DA 1U5TC 4R9RA 1T1SA 2VOJA 4QO8A 2OXIA 3EUHA 3IHUA 1JXSA 1S6LA 5CYVA 3C7CB 5IT9K 1HDCA 1HT0A 4Q3EA 2NNYA 1UB9A 4EM1A 5JDCC 3M9AA 4E13A 1T1RA 2ESNA 2O48X 4IDFA 1BN5A 3NTQA 2JSCA 2WE8A 4ZYGA 1LBEA 5FO5A 3Q3CA 3GT0A 2NVWA 1JVBA 2J6IA 2IVMA 4HF1A 2QW8A 4J7XA 2C82A 1LXCA 2EGHA 1EE2A 4XQGA 4MIEA 3GC6A 3IKVA 2YR2A 3WQSB 4A12A 3L6OO 1VC2A 1SFUA 2XASA 1N2SA 1ZK2A 4Y15A 1HSZA 2Z1NA 3JQBC 1CGPA 3PZRA 4IRGA 2M45A 2YFHA 3J80K 4D0SA 1O3QA 4HX5A 4R68A 2X4GA 1S29A 3N74A 3RKUA 1WQ2A 2VBZA 1TQMA 2J3IA 1X7HA 2P2SA 3IC5A 4PLTA 4W82A 3Q9SA 1Q0LA 3I9JA 4FFPA 4FFMA 1KVTA 4FOOA 4LFUA 2YV2A 4CMEC 3H5AA 5L7WA 3R0IA 1YIOA 2CF6A 3COSA 3F6VA 3ONEA 4DLBA 4TRRA 2ZO4A 1U4SA 1VI2A 1DO8A 1E1NA 2P4HX 2UYYA 1E77A 3WNQA 4CLRB 2HR3A 4L0QA 2RHCA 4OIOF 1R15A 4CMBA 3GLXA 3HSFA 4INAA 4ZH4F 1TEHA 3A06A 1BC7C 1VKNA 3RD5A 5CAEA 2JKVA 2D5AA 3TJRA 3WYEA 3Q2IA 4MVJG 3DXJF 3C3XA 5JS6A 4ALJA 2HK7A 3I64A 3K8ZA 3C24A 1JLLA 2YHIA 3O8QA 2PFGA 4PZDA 3I5MA 3DB2A 5TLSA 3VH4A 2H09A 1LC0A 3VPSA 3I52A 3I59A 2P9GA 3LSYA 1JA9A 4FJ0A 4EGYA 3HDJA 4D43A 4QFCA 4KT5C 4D46A 4II2A 1J9IA 1B9MA 3KSZO 5T67A 4ND4A 3GMSA 1QKIA 3F3SA 1G3SA 1P44A 1Z7EA 3N58A 3DPTA 4WKGA 5ICSA 3WU1B 3P2OA 4NBVA 1NWHA 4PZJA 5G4KB 4RDIA 2EXXA 2NAZA 1AE1A 4FBGA 4GLLA 2XAAA 4BNKA 3LZ6A 4H3VA 1B16A 4M6XA 4LK0F 3PLRA 1HLPA 4CO8A 4IXTA 3PIIA 4Y6RA 3ZWCA 3DZJA 4RF3A 4RL6A 4DYVA 3KLPX 2PK3A 1C0WA 3GZ4A 5IDQA 1P3DA 2W2LD 1R5GA 5CVVA 4JJGA 1P1JA 3MCZA 4YFXF 3FF4A 4OKNA 4XRRA 2IA2A 4AFNA 2V6CA 1Z6TA 2VYVA 5IDWA 3IKTA 2CG4A 1R66A 3LLVA 5JY6A 1YDEA 4ESJA 2E37A 1LDEA 4P22A 4BHPA 2EJWA 2NTJA 4XR9A 4DBZA 2A61A 2YPRA 3F21A 4DIOA 4CZZA 4LCJA 5FF9A 1MFPA 2VYNA 3JQFC 1KA8A 3VOEA 1I3LA 3KM0A 1YOVA 5HDGA 4O5VA 3CUQC 3WODF 2KRFA 1I01A 4I9NA 1R7JA 1JTVA 2GN4A 5T5QA 1OPCA 4WXHA 2JL1A 1UXIA 2H1SA 3JSAA 3GYHX 4TV7A 4GGPA 4ZQEA 1CF7A 3V5NA 4XIYA 4PLVA 4YG2F 3MZYA 1I0ZA 2O3SA 1QZYA 3E6MA 4I5GA 3AWDA 4WCFC 2O7QA 1ZSYA 4G7OF 2VZ9A 4Y9DA 3V7SA 2W2KA 2ZTUA 4EJVA 5EPOA 5CVIA 3QA9A 4O3MA 1NR7A 4KTTE 3H7AA 4IDGA 3WTBA 3WE3A 2QQ5A 4NBWA 4N18A 3OIGA 4P8RA 2W85A 2IZ1A 1IXCA 2DLDA 1EFLA 2GN9A 3DWFA 3S55A 5MGBA 2FY8A 3MEXA 4D3SA 2RQPA 1EVJA 2D2IA 2VNSA 4ESBA 3LC2O 3V7RA 2W8ZA 3Q5FA 1ZW1A 2W25A 2KKOA 3EVTA 1Y5MA 2PGJA 5I8WA 3FTNA 3I0TA 2PWZA 4LGWA 4BKPA 5TJJA 4TVBA 3D5LA 5KK1A 5KVVA 1Z7BA 5ILVA 5LGUA 4EITA 4KZPA 1E5QA 5B4UA 1PJTA 5IT9Z 3TNLA 1BXGA 1WRJA 3F72A 1XMAA 2O3FA 4W9NA 2Q45A 3DBRA 1T2EA 3UVEA 4BNUA 1ENOA 2EW8A 4ND2A 5ILGA 1I8TA 3G3EA 4I8XA 3QWIA 4YACA 2OA4A 2B0LA 2X22A 3PHGA 4D42A 1XSVA 2EJVA 2O3TA 4Z9XA 4M87A 3WR5A 1XSEA 4A10A 5A03A 2CZCA 1QO0D 1L0OC 1DC3A 3UN1A 4EZBA 5DP1A 4CYDA 2ZCUA 4ZU3A 3NRVA 4M49A 2R2GA 1OMOA 1U6GA 2HS5A 1XIVA 4AIKA 4HW0A 1FMCA 3C85A 1ZLJA 1WDMA 4MNUA 2V1UA 1YVEI 4R3NA 3LQRA 3RCBA 5ILSA 2AS5F 1SBYA 3RI4A 1IZ0A 2ZNZA 1OC2A 3QAHA 4IJKA 4YDRA 1CIVA 5BSHA 2PZJA 1DIGA 1JHHA 4Q39A 4UEJA 1E5LA 2XAQA 4DYDA 1T6SA 1ISMA 1RJWA 1T4DA 3DOOA 2VOOA 4CM1A 5G0UA 4CM8A 3H92A 4GX5A 4RZHA 1U2GA 4J9VA 2W4QA 5KWEA 3SC4A 4XLNF 2C7VA 4E5PA 1Z91A 5JHUA 3TZCA 4A6DA 4JJFA 4PG7A 4NNJA 3M1AA 4U5QA 2FWMX 2VHWA 2D5CA 1OBFO 2VZ8A 1ZSVA 3BHMA 1T38A 5A3VA 3K1PA 1V3UA 3P9KA 1O3RA 2EWNA 2ACJA 1N5DA 3RQSA 3RUCA 2HMUA 2L02A 2YU3A 1FZPB 1GD1O 4HYEA 3C3WA 1WP4A 5LGTA 4IDEA 3UCXA 1DAOA 2LDXA 3PRJA 1YOVB 2OBYA 5BSEA 4R3WA 1VL8A 4CR6A 1P77A 1HZZA 4I7HA 1X0VA 2G1UA 1QLHA 3AY3A 3LF2A 6LDHA 4RGSA 3KRTA 2FRDA 4IMPA 5D6EA 4M89A 3AY6A 5THQA 2AW5A 3ABUA 5ICEA 5J6XA 4ZZLA 3D3WA 4YRBA 4OJNA 1YB4A 1ZKMA 3G0OA 4CPDA 2HAEA 3H5RA 1I27A 4KYWA 4HX8A 5H81A 5D4RA 4O5OA 3V2HA 1EFKA 3BPVA 5E1WA 5K5RA 1TT5A 3TRIA 5JCJD 1HKSA 1UP6A 3CTAA 3LWFA 1EH8A 2FMLA 1KY4A 3E6DA 4MP3A 3L0DA 4NU5A 1KS9A 4Y98A 1YKFA 3ASVA 4M6YA 4DQ2A 3GGPA 3G1TA 5DCUA 2M1BA 3GFLA 2ZJ0A 1OYWA 2NNLD 1E1LA 2M8EA 1SB9A 4ND3A 5GY7A 1B26A 1TQIA 1J75A 2JPCA 1GTMA 2RNJA 1IPFA 3Q1LA 5BSGA 2JD1A 4ROSA 3QOPA 3TOZA 1N7HA 4U0YA 4HWKA 3LQFA 3M1LA 2AG8A 1JGSA 2QLZA 2DBQA 4WXCA 3P9CA 1M6HA 3AOEC 1E0DA 1ZG1A 5EIOA 5JDCA 4I09A 1N1EA 2EK5A 3L7WA 5FLXZ 3GW2A 3JTGA 1BI1A 1BG6A 1D1SA 1J4AA 1NAIA 3NGLA 3FNGA 3N7UA 3OJLA 3PZBA 4TSKA 3KSDO 4XYMA 3W6UA 4DA9A 1U9JA 3E3VA 3BTOA 4YRAA 3ZHBA 5LDGA 2FSVA 3AU8A 3EETA 2XGXA 1XQ6A 1LA2A 2YUTA 3S2FA 2Y1OA 5C7IO 4BL5A 4CLDA 2JCYA 1WXDA 1V8BA 1E3IA 3W8EA 4B4WA 2DI3A 2TDXA 2X8LA 1QRRA 2NSDA 3INRA 3MAJA 1ZRCA 4MVJP 4A27A 2FNPA 2J3JA 3WX0A 2EFNA 2PG4A 5HA5A 3FWEA 1ONOA 5DBFA 2CVZA 4AJKA 5DBGA 4DTIA 3ZV4A 4CMEA 3G17A 4E6PA 4C7JA 5L7TA 3TDKA 5HVQC 3V1YA 3VZSA 3MOIA 1YO5C 4U7WA 3A14A 4YRDA 1Z1DA 5BNIA 3WTUC 2HJRA 2D4AA 4HUJA 1XGMA 4BNCA 1ADFA 3KB6A 1IHYA 4PGGA 1HZJA 2E4AA 3CTMA 2ZK7A 1G0NA 2W57A 4BAYA 5DCMA 3SLKA 3C7JA 3AFMA 4B7XA 5I7FA 2HKXA 3H2ZA 2H6CA 1RM3A 1K6OA 4NK5A 2YZ7A 7ADHA 2ZXJA 3RKYA 5H6RA 1I3MA 1LLDA 2CDCA 2GDZA 1E3WA 5U4QA 4EDFA 2AMFA 5ICGA 3BWGA 3DHNA 4J43A 3IIEA 4FQ8A 4MVJF 3HWRA 3GUDA 2GXGA 1U5AA 4DMMA 2VTDA 2A6HF 1B3BA 1SEVA 3F8FA 3KLOA 1ISIA 1CETA 1PZHA 2C2XA 2XKOA 3NDRA 3WSVA 5KJ6A 5I7SA 2G76A 1B2LA 4BNJA 5JCXA 1LEAA 3J7AO 2JHGA 2F1KA 2EB7A 3QRFF 4YAKA 5BNTA 4IRIA 3WS7A 2OZPA 1W0CA 5KVRA 2Q1UA 4CV2A 4DVJA 5F1PA 1YTYA 5LCXA 4B79A 2O0YA 1WDKA 2ZB7A 4OL9A 4CM7A 4PG4A 1G3TA 1EBFA 3EDMA 3Q9UA 1Z74A 1BI3A 2X4HA 3FBTA 3PDJA 2E49A 4GKBA 2VWQA 4TMFA 1WDLA 4J91A 3MJVA 3RC2A 2PR2A 1EMDA 1PS8A 3SJUA 1ZIDA 2E82A 2VUSA 1E92A 5JLAA 3ISPA 2VOEA 4YEDA 1GDHA 4CV0A 1BIAA 2X0RA 3RJ9A 1J5PA 3SZTA 5DYMA 4WWCA 2EHDA 1N9GA 2G17A 3IQDB 5CPBA 1NPDA 4FPXA 3LT0A 2V79A 3WFIA 3SXPA 5JY1A 1QLJA 1J0XO 1JQBA 1ZGAA 1FP2A 3RFXA 4CLOA 4OMYA 1LTHR 2PZMA 4BGUA 1KIFA 5A5EA 2DVMA 2EERA 3LSTA 1R4MA 3MOGA 2ELHA 5DD4A 3WGHA 1KQ0A 2Z5UA 4FX4A 2IT0A 2CNBA 3KXDA 2NQTA 2JAPA 1RYEA 1FYKA 2I5PO 5CPFA 4J0EA 2IA1A 3I54A 2O61A 1T24A 1VL0A 2Y67A 3E48A 3MWDB 3O2PE 1XMKA 4TWRA 2BGLA 2VBWA 2AQKA 4JK1X 2C54A 2EF1A 1X7GA 5LHIA 4B7CA 3S2WA 3TDUC 3M2PA 1KQ9A 1R58A 3DHYA 1PJCA 1ZK4A 3T0YA 5TJHA 2HFHA 1VTNC 3HZZA 2F00A 5JAIA 1B4AA 1PZGA 4DREA 4EUFA 3KP2A 5L95A 1PGPA 4WLVA 4QUKA 1LC3A 4NFHA 4NR0A 3H3ZA 4L18B 1UZMA 4WUVA 4CM4A 5G0VA 4G65A 5IXYA 2GNAA 3E5RA 2NV6A 3RROA 1MJBA 5L3FA 3WQRA 1SD6A 4MTDA 4A5OA 4HFMA 3HTSB 4HZFA 3BJ6A 3HRSA 4UV8A 4EQQA 1GEGA 4HAMA 1NVTA 3OJOA 5CDYA 1LDBA 3W8DA 1PQWA 1T25A 3D5QA 1ONNA 4IHTA 3AI2A 4OQZA 4CHUA 4UUOA 3LF1A 1XR3A 2H6BA 5MDHA 2WMDA 3CE6A 1QNTA 3QSGA 3HIFA 2OHXA 4OSPA 3LC7O 3W6JB 1GFSA 4HF2A 3QP9A 2OP0A 4FFNA 2CSOA 3WXBA 1FXSA 3M8EA 1Y6JA 1GAEO 3EGOA 4BMSA 3N97A 5TS3A 3NX4A 4A2CA 3BJAA 2DBRA 2WTEA 3TO7A 3I5UA 3DV8A 4RLSA 4IM7A 3DONA 3P7NA 3L09A 2G0TA 3C1OA 2GCGA 3BA1A 3FBGA 3GFJA 4DQUA 2PTGA 3DAGA 4FW8A 1A5ZA 3R6SA 1GEEA 2YQ5A 1E3WB 4MVJD 3CDHA 1P6RA 2EGGA 4PLWA 4YAJA 4E31A 3I59B 4WLOA 1EK6A 2YX7A 1HWYA 2NLOA 3ZN0A 1YW8A 3P5SA 4I02A 1R0KA 3WTYC 2WYVA 3OA0A 1VJTA 4OSOA 4PG6A 4Q3AA 3VPHA 4E2XA 4RDHA 2NNNA 1NAHA 4GWGA 3PYLA 3L9XA 1C0IA 4UREA 4UNOA 1IZ9A 4D45A 3TFOA 4ZVVA 4HX7A 1L3LA 4RGUA 1LDDA 2WV0A 4KN7X 1DDNA 4KP7A 2AQIA 2GQQA 1H94A 3GDGA 5A4DA 3ZV5A 4EW6A 3ZDFA 1TLHB 2R7DA 3CEAA 3NTOA 1LJ9A 3NYWA 4CM8B 1QZZA 3RU7A 1J0RA 3D7LA 3OJFA 3VPGA 3OETA 4G2NA 4BNZA 2WEKA 3C18A 4KOAA 5ERIA 4JNKA 1UXKA 1ENPA 3VPFA 1OI7A 5AONA 4ZN6A 5BSFA 1V3TA 2D8AA 1XGOA 3DPLC 1ZEJA 2B69A 3WGYA 1N9GB 1HSJA 3RC9A 3CUQB 1YS4A 5D8LB 3ERED 1O7FA 3QWAA 4AICA 2G7HA 1YJ8A 4YFNF 1V3VA 4LRSB 4QFDA 3UAGA 1I10A 1Z75A 1H9TA 4MVJH 4FHTA 4OMZA 5F64A 3JQCA 4OXNA 3U2RA 2WD8A 2ET6A 3C1AA 1N7GA 3P9IA 3F22A 1PQUA 5IG2A 5FLXK 2GRAA 2O23A 2Y68A 4J2OA 2PFBA 1ZSNA 4GSKA 4DUPA 1GR0A 4HP8A 1BXZA 5A9TA 4EGZA 2PKQP 3GG2A 2GSDA 4D0PA 2AEJA 4E32A 3MJTA 4YVFA 5JW6A 2CMDA 5ICFA 3I6IA 4IIVA 1Z6ZA 4D3FA 4G5HA 5CVJA 2HMWA 2Q3EA 3ZV3A 2J5RA 1AGNA 2Z5LA 5DCMB 2P9CA 4HFJA 4OKIA 5J23A 5EN4A 4Y17A 3F8CA 3F6YA 2FOKA 4N0BA 2PV7A 4JP2A 5A06A 3ROQA 3F5SA 2HUNA 4BO0A 3LAPA 3F5QA 4CLEA 1Z82A 4RORA 4KDEA 1H9BA 1K6JA 2PLAA 4BO9A 2QHXA 1P1KA 4H0EA 3QV1A 1ISFA 2A9FA 4JIGA 5JVTA 2LDUA 4M54A 4RCVA 3U9LA 4G6DA 5LRRA 1PJSA 5A02A 5L51A 3DEYX 1JAXA 2P68A 4J1NA 4PZEA 4FFOA 2O6GE 3LVFO 3STHA 1JHFA 4D7AA 2P7CB 3FWZA 4L9JA 1BC8C 1R1UA 5CDGA 1DFHA 1T2DA 1BXGB 2QM3A 4L4RA 5CP8A 1S3JA 4RB1A 1ZG5A 4RZIA 2RCYA 4XGKA 3DBRB 4Q47A 2DC1A 1IE3A 3PP8A 1ADGA 5DZSA 3REOA 4IINA 2NTNA 4TROA 3PQEA 4HNGA 2C0CA 2GZ1A 1Z45A 1EUZA 1E6EA 3GHHA 1GZ6A 2GD1O 5L45A 1Y0UA 2A3SA 3OIFA 4YCAA 5HS6A 3ANMA 4BO4A 4J2HA 3GVIA 1F9NA 4GMGA 1IB6A 3JW4A 3S2IA 4UVGA 4CUZA 3F47A 4CMKA 4XYLA 5DCFA 3V8LA 1ORRA 2NWQA 1JWAB 3HDYA 2I66A 3TO9A 3ZMTA 2A07F 1IHXA 3IS3A 2PKQO 3F4BA 3ZWBA 4BKUA 3IRQA 1XSXA 4TZTA 5HWSA 3VH3A 1C0PA 1DIAA 1PL7A 3WNVA 4TRJA 2WC2A 1KY5A 3RFVA 2C6YA 3ABIA 2IEDA 3OBBA 5L9AA 1NHWA 5T6BA 3I4PA 2HCTA 4KDFA 2HQRA 2JD0A 2BF7A 3RASA 4GYGA 2PNFA 3KYCB 3S8MA 4F6LA 4I9UA 2X9GA 1NFFA 2B4TO 3QHAA 3GQVA 2FZWA 3ZW8A 4U7DA 1KEWA 1H6DA 3JD0A 3E03A 4EJMA 2QYTA 5COQA 2BI8A 1R5HA 5D5WB 4IPTA 1DIRA 4ND1A 5TC4A 3TF5A 3DZHA 3W8FA 5K5QA 2GA2A 2POQX 3VZQA 5K1YA 3V2GA 4KTVE 2L4AA 3BZ6A 1I36A 3GNQA 3BIOA 1K78B 2DQ4A 3WGTA 4P4NA 1ON2A 1HKUA 4S1VA 3VKVA 4DIBA 5C37A 3W4JA 1SFEA 2PJPA 1T2FA 4JQFA 3MTGA 2VBYA 3NT2A 4JN6B 3CIFA 4LSWA 1UXHA 2C2YA 1PP7U 1P92A 3R3JA 1OYYA 2TMDA 4B4OA 3IMFA 4QX6A 3S2EA 4QWQA 3M2TA 1GPJA 1Q2XA 3ELKA 4P9FA 1TNSA 1YWGO 1K2WA 4Y67A 3VTZA 3VZPA 1NQTA 2FPIA 2CVQA 4YT8A 1STZA 3D3WB 4M55A 5DBIA 4DIFA 4IHSA 5E18F 1DFGA 3G79A 2EFQA 2GF2A 3W1VA 3DMTC 3RPUA 2FNAA 5DD8A 4ZZDA 1AOYA 4ZYEA 3OJEA 1R0LA 4BNYA 4XSXF 2BLLA 3EY4A 4GX1A 3ZW9A 1GADO 2BFPA 3X2FA 1ULUA 1E3SA 3AOGA 3BYZA 4NFYA 4R9SA 4JJIA 4DRYA 2UUOA 5A2QZ 4HDVA 3NDJA 1GQQA 3IWFA 2Z99A 2RGVA 1DP7P 3HFSA 1U3VA 4H7PA 4L4SA 4JP3A 4U0VA 5FFZA 4LW8A 3AU9A 3ZWXA 1A27A 1V4RA 1P74A 1O89A 5E17F 4YJDA 4WLFA 2EW2A 5IN4A 3BY6A 5KJEA 4GQAA 5KNLA 2VT2A 1CF2O 3JCZA 4UEOA 2JCXA 4R8HA 4I0AA 4DNCA 4EV0A 1QP8A 2JHFA 3QVTA 3FMSA 3JYOA 3AK4A 1GZ4A 4PCVA 1SB8A 1ZO8A 1DEHA 1YB5A 3WG9A 2ESHA 2JAHA 2FHSA 1EH7A 2ADUA 1E6WA 3F23A 5HS8A 2WJPA 1LEBA 3PGJA 4J1SA 4D3DA 5A1TA 2QQ9A 1P1IA 3VODA 4R4JA 1LQUA 3JQ7A 4K26A 5D6FA 4GVLA 3GEZA 2O3RA 3L4SO 1E7WA 4BO1A 1FK8A 3K2BA 4PLCA 3WLFA 1PJLA 3I3OA 1YL7A 1ZYRF 2IW5A 2VBXA 3CUQA 2L4MA 1WLYA 2Y66A 3FSRA 1I3KA 4FFRA 4BHTA 1BBYA 1I5RA 2B5WA 2XF8A 4GKVA 4CJXA 4NMHA 2QRLA 1ZCJA 4GGGA 3HFGA 2Q49A 1BHSA 4D44A 5C5IA 1I30A 1I33A 4DC0A 3WGGA 1UXJA 2YSRA 1PEDA 2OAZA 1IN4A 2FZEA 1SO8A 3FTPA 5B1YA 3H3JA 2DW4A 3KYCA 3RBXA 3TWOA 2BGCA 1TW2A 4BUCA 4EVIA 1GYRA 4KQWA 3GWZA 2D1VA 2ZTMA 3WJ7A 3CLOA 3EZLA 2XOXA 2VWGA 3E82A 2H27A 3H9EO 1MLDA 3RAJA 4XDZA 4KUEA 1M6WA 1M2WA 3VEPA 3RUDA 3LLSA 1ZBQA 4YB8A 4M72A 1H2BA 4XD2A 1IL0A 4CV1A 3MEQA 4BIIA 2K86A 5LGNA 3JYPA 3WWYA 1Y5RA 5FYDA 4BOYA 3UICA 5F1OA 1EH6A 5L3EA 1G1AA 2X23A 4E30A 2DUUA 5LLQA 2VYVD 4EM0B 2Q50A 1LVAA 5ENVA 5CEJA 1MB4A 3WMXA 4XX0A 1DLIA 2GAUA 4L75A 3ZP5A 2QRKA 3HHGA 5FWNA 4U0WA 3CJNA 1PZEA 4IJVA 2Q1WA 3CKYA 3SC6A 4M1QA 2ZYDA 4RGRA 4BGIA 3LA7A 4ND5A 1E6UA 1UFMA 5HS9A 1V9LA 1Y9EA 4NZ9A 3VDQA 3JQAD 2HQ1A 4DPKA 3JYLA 4J1TA 2V65A 2WSBA 1DPUA 1UZNA 1U78A 1D5VA 4IZHA 2E1CA 2FA5A 2K4JA 2ZATA 3MCVA 4FC7A 3TPCA 2P91A 5C3MA 3WGQA 4XLPF 1GXQA 2DPDA 1EBUA 2WWRA 1G3YA 1DRUA 2ILTA 3S2GA 3RTRA 1PZFA 5B37A 3DBLB 4PRLA 1ZRFA 1YGYA 4K1LA 4OO3A 4B7UA 3GZ5A 5HS4A 2VUUA 3MWEB 2FP4A 1GV1A 1G3WA 3FM3A 2I67A 4XYBA 2RVCA 5BQTA 1GQ2A 4CM6A 2VONA 2E6UX 1ZJYA 4PLHA 2XIGA 1R4MB 4GLOA 1OC4A 4Y6SA 3FPLA 4PGHA 1BVRA 2Z9OA 2OD5A 4H16A 1QV7A 1XKQA 1RM0A 1U5CA 1IF1A 4FGSA 4W7HA 4N5LA 2Y1CA 4DLAA 4UV9A 5H20A 4YPOA 4WLUA 3EVNA 2Z3YA 2HDCA 3KUXA 5JAZA 1RZ4A 3JYNA 3OSUA 1MZBA 1D8AA 2HRBA 1C3VA 4KWIA 4RVSA 3RKWA 3ZGYA 1C1XB 5IAAA 1T2KA 1ARZA 3U09A 3SZPA 3DKWA 3PJEA 2BE5F 1MG0A 5DF1A 1ADCA 1RUNA 1PL6A 3NEUA 4I0BA 5HDNA 1EK5A 4HXYA 3L6EA 4NJOA 4NHJA 4JBGA 2QWWA 4LMRA 1IAWA 3ZWVA 4OYRA 1ENYA 4LMPA 1AXGA 4FJ1A 4MVJE 4RVHA 3ZHXA 1LLQA 5JMPA 1MGOA 2MLKA 3UW3A 1AHIA 2MC3A 2BFMA 2DPHA 2NM0A 3HHPA 4G7HF 1HF3A 4EMSA 4QTZA 4RLHA 2P8TA 3PQDA 1GZ3A 1B9NA 2B0JA 4B8WA 3K6JA 2HRZA 3TDZC 3HDQA 5HRUA 1TLTA 3GFMA 4B8ZA 3D4NA 3R3SA 3MJEA 2AQHA 2BBYA 3AUAA 2W2KB 2ZTLA 4ZQFA 3OOPA 1ZEMA 2IE0A 5T8KC 3QU3A 4G94A 4NB5A 2RH8A 1F1ZA 2EV0A 1ZK1A 2JT1A 1ZFNA 3KLNA 4GAEA 3JSOA 1PU2A 1HYHA 2A68F 4MJLA 3RSHA 1GQYA 1P0FA 3PFWO 3JQBA 1VSVA 4WECA 4Y8VA 4XB1A 5A3JA 5DDGA 3TN7A 2QBYA 4LVCA 4FFLA 1JN0A 3GRKA 1PGNA 2HOEA 1PGQA 2FF4A 1UH5A 3JD2A 4IDDA 4NI5A 3K0LA 1KEUA 3GEGA 5I9LA 2EWMA 5IDXA 1JAYA 1QMGA 5FI5A 1UDCA 2OQGA 3ZHZA 1XELA 3O4RA 1J2XA 3BOQA 3QP6A 3SFZA 1D7OA 1DB3A 1PJBA 3JQDA 3QU6A 4G9YA 3D0OA 2BMAA 3C1TA 1BI2A 4RGBA 3L07A 1XDSA 3ZHYA 3FXQA 1BW9A 1K0UA 3DBHB 3RJPA 4OU0A 2ZBKA 1NM5A 1DPGA 3FWNA 5TNXA 4N5MA 1A4IA 2PD3A 3AY7A 3WQQA 2D2WA 1BI0A 4L9TA 1VSUA 2HO5A 4FC6A 3VVCA 4B3HA 4EI2A 1YDWA 2HKOA 1IUKA 4J4TA 5JO9A 4M9ZA 3D0SA 1PP8F 4PIVA 3QPTA 2UVDA 5F6FA 3T8RA 2D0IA 3PWSA 4HY3A 3VTFA 3WDSA 3DF8A 2YQ4A 2B83A 2DT5A 1PS9A 4XCVA 3KP6A 4BMNA 2PMHA 4E33A 3ENKA 1FDVA 2XPCA 3DR3A 4HLXA 4RPLA 3OM9A 4DL9A 5IFLA 4TKLA 5BS6A 3WTSC 3R6DA 1ZVMA 5FD5A 1UP4A 2WD7B 3DXFA 4JCOA 4YQYA 1F4KA 4F45A 2BI7A 4HX4A 4M9XA 1W8DA 2HTJA 4FR5A 3VH2A 3ANLA 1PGOA 1JKFA 1OFGA 3FD8A 4E3ZA 2M5WA 4BHCA 2LDBA 3CINA 1C0KA 1C1XA 3FM5A 1T26A 5KKCA 1J59A 5ICCA 3HOTA 1XDWA 4YT2A 5IT3A 4XR4A 5DEQA 4K6FA 4MDHA 2YV3A 2EP7A 1SMYF 4J7UA 4Q3NA 1ML3A 5TT0A 3W4KA 1OYIA 3F1KA 3ABTA 2JTVA 1IN7A 3KFWX 4KICA 1LSOA 2Q2WA 3DOJA 9LDTA 2NS0A 4EBFA 1A7AA 4AWXB 2I99A 3FN4A 5L3BA 1L7DA 4YBZA 3RJ5A 5TRDA 3IC7A 3BXXA 4FS3A 4A26A 4OOFA 5L3ZA 1SMKA 1O5IA 3ZN1A 3RKRA 3H5NA 1P1FA 2HU2A 3PGXA 3U4CA 5IXSA 1X7DA 4NJMB 4DQVA 3KE2A 1RM5A 5IN5A 1U3EM 5AIPA 4BNWA 4L76A 4KQXA 3ITKA 4CXFA 2P5VA 4CQLA 1F17A 3WIDA 4IDAA 1DSSG 3ZZNA 4WNIA 5TIIA 4XBFA 2VHYA 5AIQA 1CQJA 1EZ4A 3H3FA 2Y93A 5L3DA 1GUYA 1SC6A 2X0LA 4CMCA 4BH9A 1U5TA 2XAHA 1O3SA 3NKLA 1ZREA 7MDHA 1YE3A 2DBBA 3DFUA 3DBLA 1ZRDA 4E5NA 2UXNA 4BHBA 4PVCA 1XB4A 3UGKA 4XJTA 1JKIA 3L00A 2CYYA 2GA1A 2QQBA 4XWYA 1KOLA 2Y0CA 1O0SA 2QBYB 5CDTA 4XRGA 2O2YA 3OA2A 3PIDA 1GXPA 1XEAA 4JGBA 1WPQA 3E6CC 5GZ3A 1BOAA 3EAGA 5ER6A 3WBBA 3HRTA 2BV6A 4AJNA 3GGGA 4E5YA 3QWFA 2VRCD 1PGJA 4CMIB 5E20A 4Z6KA 3ETGA 4NU6A 4UUVA 2AE2A 3E8XA 1UCRA 1P33A 2IXAA 3E1KA 2P4WA 3CZRA 1NQ5A 3HRUA 1ZLKA 2MH2A 3CO6C 2Y99A 4IQ8A 1B8VA 4KIFA 1DIBA 5ILOA 4GBJA 4O1MA 1TW3A 4E4YA 4L0YB 1PIWA 3HN2A 2BD0A 3WTXC 1UDAA 3OQ1A 3QW2A 4YTEA 1U28A 4LGVA 4Z0TA 2EFWA 4GI2A 4I01A 5F5NA 1MJAA 1MG5A 2HLPA 4PGFA 3DEUA 4FCCA 1C14A 4CQMA 1B8UA 1U3WA 3BMCA 4R41A 1QPMA 3DDNA 4PN3A 2YDYA 1X1TA 2AE1A 3BJOA 1TQPA 1NR1A 4JLWA 3KZVA 3EDPA 3BTUA 2BYVE 3B02A 1F06A 2CSUA 5LEKA 2QUFA 1I24A 4A5MA 2E1NA 2VRCA 3SBOA 2C29D 3GRPA 4P4GA 4DXHA 3ENNA 3WTVC 1XQ1A 3E9QA 4RVDA 5G4LA 4ID9A 3ICCA 2FR0A 4LLNA 1YBVA 1VJ0A 1WMAA 3C1DA 1Z6RA 3LA2A 1WVGA 2PZKA 2EA2A 2E7WA 1SD5A 3MWMA 3C7AA 4YJHB 1LU9A 1M66A 2DQRA 2QG4A 1IYZA 1NP3A 4M8SA 1YQDA 1UHMA 3CSDA 4UVIA 1Z05A 3PQJA 1LUAA 3ZV6A 2OMEA 4U6SA 4Z0HO 3EHEA 2NVBA 1DDOA 2F2EA 1F12A 1LDMA 1LSJA 5JI6A 3FF5A 3L9FA 2F5CA 1P2FA 4GX0A 3AI1A 1ZH8A 4RS8A 3E18A 4YJGB 1XGKA 2E7XA 3GFGA 2WE7A 4QQRA 4E0BA 4EUEA 1HKQA 4U0JA 3RUAA 5E8IA 2VHXA 3PTZA 8LDHA 1NYTA 4FX0A 3ROMA 2B35A 2K7LA 2DBZA 4KUHA 3QVSA 2CD9A 2ZYGA 3UCFA 5KVCA 1YL5A 1LRJA 3HHHA 1T0FA 1BRMA 1H9AA 2WYUA 1K7AA 1MDMA 3CPSA 3I53A 3RU9A 4TVOA 2QVOA 4RJTA 2J3KA 3BTSA 3GEDA 4IIUA 2O4CA 4M74A 1B3RA 4DGSA 4MOWA 4AJLA 2HKIA 5DULA 4I98B 5A9RA 2OL4A 1B59A 1XSDA 1AHHA 3ANNA 4F3YA 2IRWA 3JQ7B 4ENJA 4JBAA 2DK8A 1SFXA 1FDWA 1EQ2A 1N1GA 1JW9B 1U5TB 2GUGA 2KIMA 3WGIA 1RNLA 3HE3A 2CW0F 4RF5A 3RBVA 5JMWA 2BELA 3B20A 3PFIA 2X9NA 3RKXA 4NIMA 1SMTA 3OECA 4URFA 1XA0A 2B5VA 3K31A 3ST7A 3COAC 3Q9NA 3U4HA 4BO2A 5I7EA 4CLOB 3K30A 2Q8KA 1R00A 2BHLA 3OQBA 4R1UA 2P5YA 4IVNA 3NV9A 3LT1A 3SLGA 4LSMA 2J5PA 4KUMA 1MKMA 2Y1FA 4P5OA 4UUNA 2PN6A 3RDIA 1UXGA 1WMBA 3FHZA 4CMAA 3WYCA 3NJ8A 1U7HA 5FGMA 4DPLA 3VC7A 4EGFA 3I6QA 3ZI0A 1DPRA 1H6BA 2OP1A 5TSDA 3HB4X 2VYND 3FNHA 2R6JA 3ECOA 2HSDA 4HDUA 4OAQA 2CQKA 3VFZA 5DNAA 1FY7A 3FR7A 3FX3A 1PSDA 1USTA 4RO0A 3BMOA 4R5HA 3HNPA 2YX4A 2KJCA 2RV8A 1ZNQO 1TNTA 6PAXA 3D64A 4YT5A 2IA0A 4AJ2A 4BGEA 5KCZA 1EDZA 4BYYA 3MJSA 5JYDA 2FPGA 1XU7A 1R16A 3BROA 5FI3A 2FR1A 1CJCA 3AJRA 1IY8A 2IP2A 1KETA 2VOPA 1KVQA 2PLYA 4BNXA 4CM4B 5CEEA 2X0JA 2NVUA 3HSEA 4CL8A 4MINA 4A73A 3BMCB 1F0YA 1U1IA 4M86A 1Q1NA 1EV7A 4U8GA 1YW9A 2CFCA 3GA0A 2ZCWA 4OIPF 3BDDA 4MEYF 3TGNA 5LHHA 2JFGA 3RWBA 4Z3KA 2IYOA 2BGMA 2EV6A 4Z9YA 1JWBB 4ILKA 4DC1A 1I2ZA 1UDBA 4GGOA 1HDZA 3TQHA 3RIHA 2Z33A 1TVEA 2V7PA 1FDTA 4BNFA 3ZMDA 5EQDA 4HLYA 2HK8A 1U3TA 4MVJA 2DPUA 5AXAA 4B4VA 3PPIA 2X9VA 4EEZA 2H94A 1BM9A 2HDHA 2B4QA 3UF0A 2RDPA 3JQ8A 3OICA 1I6XA 1I3NA 3UXYA 3VHRA 1NASA 1ONPA 3ADOA 2FOIA 3JTHA 1K3TA 2NUAA 2VZ0A 2VN2A 3FCOA 4Z2YA 1QYDA 3QY9A 2M87A 3ZWNA 2C7GA 1NVMB 3O3KA 2OORA 2H9IA 4P38A 4TKMA 3K92A 4IS2A 4A2UA 4MVJM 5K6AA 1BSVA 3DOCA 1WAMA 4MIYA 5AVOA 3RFTA 4CUKA 1Y8QA 3V2UA 4CV3A 1ISGA 1YQXA 3LT2A 5J8FA 3I83A 1SPXA 1NX6A 3PWZA 4ITUA 5DT9A 1WZEA 4R16A 2DUWA 1NFRA 2UWMA 3DO5A 4EM2A 1LQ1A 3V8KA 2KIUA 1MXHA 2X1HA 5A05A 3JQAA 3T1BA 3ULKA 5HTOA 2YV1A 1EUDA 4A03A 2OBNA 4LB5A 1UR5A 2DAOA 2IPQX 3R60A 2YHUA 1NFQA 3B1FA 3GNTA 4NDNE 3ZWPA 4MHGA 1E7RA 1FF9A 2X0NA 3PK0A 4HADA 4DBVO 3DZIA 3EW7A 1IXRC 1QR6A 2KIFA 3A9WA 4L4XA 2ZJ1A 3WLEA 2Q0OA 1U3UA 3KCCA 1G4DA 2I76A 2DKNA 5ES3A 3ZH2A 3BMNB 1I2BA 1RKXA 5D8KB 4KA4A 2EEZA 4CR8A 2VN8A 2GZ2A 2JFHA 4WOJA 5TT1A 4J7CA 2G9WA 2X86A 3ETDA 2XAFA 1PR9A 4K6CA 4OOEA 4PDKA 3DL2A 4QXMA 5TX7A 2Y75A 2W84A 1RWBA 1UAYA 3DHEA 3GVCA 4N5NA 1JVSA 4EEXA 1H0KA 2NTVA 4W7IA 1S8NA 1JKJA 4PLPA 3MFKA 4MKXA 4UEKA 3GUCA 4RB3C 4KNYA 4ENMA 2SCUA 3LAJA 4GYIA 2NACA 4IGEA 5JAMA 3NUGA 1NNUA 3U5TA 1FSEA 4RAYA 5D4SA 2GWRA 3QVXA 5JC1A 2DTXA 2A94A 3FR8A 4HFRA 4LRTB 4BMVA 4A5NA 1D8KA 3I58A 3KVOA 1YONA 1LB2A 5LRSA 2LF7A 1UP7A 2V1XA 1W4MA 4IMRA 3ML6A 3GPIA 4WPGA 1TXGA 1UUFA 3IUSA 5EMHA 4FIZA 4NBTA 2F5EA 5EINA 3WTWC 4LK3A 1IN6A 3ROUA 5FB2A 3LA3A 1ZXLA 2FMUA 3KP7A 1D4FA 3KYDB 4OQYA 4P4LA 5LDHA 2ZMEB 2ZB3A 3TL2A 1LDKB 1MC4A 3MZ0A 2F5DA 4OGWA 4JBIA 4BGVA 4YJGA 4YAIA 1J7KA 4B09A 2FSWA 2C59A 4ZHSA 2Z95A 2IYPA 3QJ5A 2O7SA 1C0LA 2FBHA 3ZNQA 3AUTA 3ZU4A 1YRLA 2PBIA 5IZ4A 2ZNYA 2YY7A 4OINF 4IZIA 3GN1A 3PHHA 5DOVA 5JYEA 1RUOA 1T98A 3KZZA 1KU7A 5G0WA 3VOSA 4LG0A 1YL6A 2Q99A 3ZMZA 1LI4A 2VE9A 2EJRA 2CDAA 2BFAA 3WSWA 4YJFB 5L40A 3H8VA 1HBXG 2J5QA 4ZQGA 2P9EA 3JQ8B 4B4UA 1YJQA 1NHGA 5BT9A 1E7SA 1GL3A 1O3TA 3T7CA 1HDOA 2EFOA 4RQTA 4KIBA 3WGOA 4G8XA 5JBIA 4AD9A 1YO6A 4RPJA 1XHLA 5JCJA 4CLHA 1FT9A 1QG6A 1KYWA 1LSSA 5B12A 4PCQA 1F8GA 2B37A 4GPD1 1ZGJA 5HLGA 3NTRA 4RF4A 4IQ0A 5KOIA 1DBVO 4BNMA 2JPBA 2I3GA 3AUUA 1OR7A 3GY0A 1P0CA 3H6KA 1NPYA 1E2XA 5L4LA 4LCEA 2Y0MA 2PD4A 4TRMA 3PHLA 4YFKF 2GIVA 5T64A 4R1SA 1HETA 3AAFA 4OIRF 3UOGA 5JO0A 1W7PD 3DZGA 1CRWG 2IXBA 3DP7A 4ZQBA 4NBRA 3GHYA 3VB2A 1OOEA 2IODA 1HRDA 5CG1A 1BXKA 3R4KA 2RN7A 3GXOA 3GO5A 3CO7C 4KMFA 1I32A 2NYXA 3JSPA 1T4BA 1ZK3A 2QRJA 2ZB4A 3IOYA 1EVIA 4ZRMA 4TRNA 4J6FA 2Q2VA 4ZYDA 1BGVA 5IJZA 5BQFA 1SNYA 2O50A 3K2ZA 1QSGA 1P9LA 3FZVA 1ISJA 2J8ZA 4LVUA 1MXFA 3BMNA 4N54A 3J80Z 2Y0DA 1XCBA 4FOSA 4ONEA 2HK9A 1I1GA 5L7YA 4YYZA 4OOIA 3G73A 1SZJG 4KMUX 4PG8A 1K78A 3GG9A 4GVXA 4HV5A 5B4VA 4ALKA 2BH9A 1DC4A 1BVUA 2LNBA 4BB5A 2DQLA 1HDGO 2AG5A 4CM3A 5TRTA 3NT4A 3I9LA 1Z73A 1I5ZA 1GU7A 4A6EA 4EYEA 1U2WA 1T2AA 2Z1MA 2HMTA 3HG7A 2OQRA 3U4DA 3JAMZ 3AM5A 3GR6A 1IN8A 3PJFA 2AHRA 3OV8A 4DPMA 3V8BA 2VC1A 1DLJA 1WWXA 5DOZA 5IZCA 1HXHA 2IEBA 1IUYA 5D5UB 1A9ZA 3IWZA 1CQIA 3GN2A 3IP3A 3QQPA 1DXYA 3G3ZA 3LYLA 4ALIA 4WEOA 1D3AA 3HRMA 4U7BA 1IULA 4R54A 3WBFA 2QZZA 2C5AA 3IP1A 3ONFA 3ZWWA 3RYRA 4CQLB 3RPQA 1DC6A 4PRKA 3TL3A 5TJ9A 5GZ1A 1DHRA 3EYYA 3F46A 1ZXBA 4PVDA 1WW8A 3KYDA 1M75A 5DV5A 1HE2A 5T57A 4F6CA 2ZMEA 1H9GA 2CGPA 4WF2A 1O8CA 3ROPA 1PS0A 4ESFA 3QPHA 5F3RA 3QWHA 4Z9FA 1IRFA 4LMYA 3IJRA 5LHGA 2PD6A 2QENA 2XXBA 4HFNA 5IDYA 2IDZA 1AWCA 1WSUA 4KN4X 4Q48A 3BP8A 3R0JA 1TTYA 2GGSA 4MTEA 4W9NC 1ZMTA 1R37A 1YQAA 2Y48A 1FDSA 5LBQA 4S04A 4KFCA 2ZFWA 3WTCA 2A92A 3NEPX 3SEFA 4QEDA 1SOWA 1LSUA 2DO7A 1MP0A 4BKRA 4BO3A 2RH4A 3F1LA 4CMIA 3E9NA 5AXCA 5IZCC
chains in the Genus database with same CATH superfamily
1C1HA 1RI2A 4LJZF 4GEKA 3AERB 3JVDA 5AFSA 1FWZA 1YFHA 2EKPA 4YMSA 2FYTA 1KPHA 4QIHA 1HXDA 3MQFA 4WACA 5H59A 1PL8A 1SAXA 2OO5A 3T35A 3N53A 5G1PA 4A8HA 3HO8A 4OX9B 4QUGA 4E12A 1GFWA 2YJZA 3JTMA 2YHIB 4PFJA 3C7DB 1MD0A 3VH1A 1Y8RB 1E2PA 4P4SB 4NMXB 4WUTA 1R23A 1HEUA 1R50A 4ZYLA 2CY0A 2FN8A 5GPCA 1UAAA 1FTQA 1D1AA 3W6ZA 2C4WA 1XTQA 1E0AA 1VQLI 3LKVA 3SS7X 3DC2A 4CM9D 5LP6A 1XTIA 1AZSC 3CLUC 5ALSA 3ZE0B 5DIZA 4XIJA 3KG2A 3LYAA 3EVCA 1PR6A 3KUDA 1P39A 4KI0A 4NQZA 4NZMA 1HA8A 1T6NA 3T3HA 3J81K 3AL0C 5CFPA 4FEYA 8ADHA 1LUJB 1WSDA 2DQYA 3G13A 2C5EA 4HH3C 2YJTD 3JCUC 3CGWA 4DXHA 1YBAA 2QP4A 2W0SA 2EZIA 3VKGA 3OYKA 1V5WA 1U8YA 3OYNA 4MWDA 4R8VA 4X95A 1AA9A 5G0TA 2A14A 1DUVG 4GZ5A 1AKWA 3T8TA 2QX8A 4KSYA 3FAKA 3X2EA 4ALNA 4UXNA 1D07A 1E4EB 4DUGD 1XKXA 1GVNB 1MSEC 4YWHA 1Z3XA 4ALMA 3DLHA 5M04A 1PYGA 4CCYA 3KQLA 5CB6A 1UQUA 3GJ3A 1E64A 3PVZA 4F0JA 3OEHA 2HWXA 2OCAA 2WADA 2V5AA 3OFVA 4JUIA 3VYVA 3CNQS 4J49A 3WGZA 2RC5A 4P58A 4G0ZA 2QI9C 1F5SA 1T6YA 1M9NA 2VP4A 4INZA 3BWEA 2ZRCA 4DARA 2JGMA 1CJUC 2NU7B 4MKRA 2FPWA 5J2TA 4IS3A 4J4HA 3M33A 3FNBA 5IUNC 4F56A 3LDHA 3COVA 3IUEA 1NE2A 5AK3A 1K89A 4KQIA 2XROA 1ZM7A 2CBZA 4DDWA 1MW7A 1E9EA 2P90A 3V6MA 3WHKA 1QOQB 3EEQA 2EFDB 4XZ3A 4DV0B 5M5BA 1AV7A 1V7CA 1Q15A 1AGRA 3EXFB 2C42A 4ZGGA 1RAGA 4CW7A 1DUXC 4BQAA 4RK4A 4WE3A 3RVDA 1K06A 5I7HA 1IGNA 2FWRA 3BFXA 1C9EA 3PJGA 4OH7A 2WWWA 1L5LA 4CYCB 4LBWA 4JLOA 3BH7A 3GV0A 1RWPA 2KBFA 3LUHA 3U6KA 1N8KA 1IRZA 1C30A 2F6RA 2DF8A 2ONCA 3A4VA 2OFPA 1WZIA 2EAUA 4I1RA 4M37A 5BYBA 2PY6A 2RKBA 3R23A 4C43A 4IHJA 3RIRA 1HK7A 5NULA 1U0HC 4CMGA 3GGOA 5ALIA 2FGJA 3NBXX 3S8PA 1Z26A 3EPZA 4OHBA 3RODA 5LOVA 3GYBA 4RB0A 3ZU5A 5F5LA 4XGIA 3EG9B 1ZMOA 3TNFA 3L7DA 1VCNA 3MN1A 4GKKB 1R5BA 3KTDA 5HOQA 3T6KA 2DETA 2VS1A 2Q9UA 5JFRA 3DNPA 1B23P 4LOLA 2VHCA 3B3AA 1L5WA 4GBED 1ZH4A 3T7DA 4LIPD 3GLLA 3A9SA 3QVWA 5BYKA 3THOA 1XMJA 3NIDB 1R36A 2MTBA 1KGSA 1A9YA 4U63A 1UANA 2CF5A 1S9DA 3KLMX 4YDHB 5JDIA 5FOWA 3OHSX 1OYVA 3WIEA 1G98A 4Z4HA 5FA6A 2XAGA 1GZUA 2C2OA 1VM6A 1NOIA 2HMVA 2O7VA 4ZODA 3ANSA 4MO2A 3COYA 4XOUA 1SPBS 3BJIC 3JRIA 3WDKA 3IX7A 5DHTA 4BLVA 3DZBA 1P9QC 5K3BA 4EJUA 1VLJA 4R6XA 1FMWA 1KVRA 3OC0A 1SXJE 4UVBA 3EFEA 5IULC 3B70A 4Q4LA 1BFDA 2JGAA 1JUPA 1SXGA 4EPVA 1QQIA 2CYCA 1FX7A 1X1EA 1ZD8A 2ZSFA 3P2YA 3OTOB 5EJGA 1TRHA 5LNK1 4AIJA 5L4NA 2R60A 5DUIA 1T34A 1H6AA 4MB6A 3ISTA 1ZPDA 1NTOA 1JBQA 5EIWA 5I8ZA 4ENPA 5JWOA 2VCHA 1ECGA 1I0LA 5BUSA 1MA0A 1H0MA 2C31A 2L18A 2YY5A 5EQFA 3CNHA 4Q02A 4CKCA 3WBJA 2DLLA 4MO9A 4ZOEA 2FD5A 1G60A 1VKHA 3ACDA 3MS2A 4H3SA 3VKUA 1YS6A 1QKKA 4J07A 4CFZA 2BSAA 2Z5VA 3U4QB 4TUYB 1HT3A 1FFBA 2VHQA 2YWDA 3LX6A 1L4FA 1RC8A 3DFZA 5TGTA 2CDRA 3FCXA 3L82B 2PSEA 4NJEA 5KYGA 1TEZA 2CL5A 3HJTA 2ZREA 1JGTA 1ZMRA 2ZWOA 3UG6A 1MZPA 3ZZNA 3I4CA 4GO1A 1QC5B 2OF7A 2XH8A 3TB4A 4BYMA 4LJ9A 3UAOA 3TKYA 3JRXA 5GAJA 3WRXC 4EA8A 4OHKA 4YJKA 2YXEA 4ZKEA 2P9TA 1H6CA 3FNQA 1DTEA 1FRVA 3E5MA 3M5WA 1M73E 2C7BA 3G5LA 4K2AA 4IJAA 1BS1A 1FFCA 1GGJA 1NW3A 1W44A 3DUWA 3PHIA 2AKEA 1KMNA 1YJ5A 4QO7A 3RADC 3AGQA 3TEFA 2G9QA 4A8JB 4C7KA 5F9FA 5KSOA 3JQAB 1UFOA 5IJ0B 2CW7A 1CU1A 3I9V6 4YP6A 3EB9A 1NP6A 1KY3A 1VIAA 1WCIA 3DT6A 1TOAA 4B4OA 4C22A 3AESA 3DAPA 1ZR4A 1AU7A 4IQGA 4UAGA 3CZQA 2DY0A 4BV9A 3PITA 4XNFA 2FMFA 1GGEA 4AL4A 5JI2E 1BW9B 1GDTA 5JQWA 1U28C 2A9JA 3NHAA 1KI1A 1H5UA 1YB7A 4AVPA 5HOOA 3DAOA 3IP8A 1II0A 4XKJA 1ESEA 5FQNA 3RBZA 3UTCA 3FCEA 1QXSA 4WINA 1SUAA 4CCWA 2VQ3A 3I45A 2V9ZA 3TECE 5C5EA 2FEWB 1KZ9A 4AG3A 2DTZA 4CBVA 4UNRA 4F1WA 2CW5A 1VFPA 2W6QA 3EAQA 2IV2X 1W73A 3P5BA 4GD3Q 1UBLS 3Q3EA 1CY7A 2XECA 1IZ1A 2JWTA 3OYBA 2XMRA 2I3DA 4AUNA 4AULA 1UBFA 2O5EA 1K6IA 4MDYA 5EZQA 3RFFA 3CV3A 1U9NA 1LFDB 3EIEA 4DA4A 4MR9B 2FLKA 3EF3A 3DT8A 4R84A 1QB7A 5JJIA 2VJOA 2QA5A 1UZLA 4MRPA 4Y13A 1DU0A 3F4LA 4CDGA 3GAFA 3SX2A 3UW1A 5A4MS 3BQ9A 5JNSA 4AYBA 3E8MA 5LIRA 4TVSA 2WD7A 3C4JA 1X94A 5EIEA 2IVZA 2JGJA 1YV9A 4EI7A 1LNWA 1W0UA 4RVFA 1BDMA 3WTTC 1Y9AA 4MJ3A 3QNWA 5EHGA 2XI4A 1WNTA 1E1RA 2P0WA 4PJMA 3ASOH 5GP9A 2B3TA 2GJ4A 4GUDA 4HDCA 4X8OA 1TM1E 1DKPA 5EWJB 5BN5B 5LLSA 4BC0A 4QUHA 3N70A 3EX7C 1MJ9A 3H0EA 1EEHA 1G6KA 3OLQA 4IJQA 3GEBA 3HKCA 2H9AA 2QV7A 2RHRA 4W4TA 4Q9LA 1MFZA 3ZQHA 2CXQA 2YW9A 1Q91A 4MIOA 3H13A 4B3FX 4DMLA 3KZXA 2L7MP 2P65A 4CODB 3AUJB 5AK0A 2Z4TA 3KZCA 4M1EA 4XX1A 1ZI9A 3BZUA 3T8YA 2BTQB 2DM6A 3K1TA 4X0EA 4OHRA 2GQ0A 1TIKA 3E5UA 3LXRA 3CKMA 3TCNA 3TQTA 3I73A 3BE5A 1IAVA 3S2YA 1W2HA 2DFVA 1JTXA 1M2GA 3OFKA 2HH9A 1LE8B 4HL6A 5E6RA 3S5JA 1H3NA 5I9SA 3HOSA 2B1JA 2VSOA 3C6XA 3QP5A 3SVZA 3K5IA 4QGBA 3LOCA 5J5CA 3UY4A 3V7YA 2L01A 1PQ4A 1I39A 3W8NA 1R5ID 3QYEA 3ULQB 1YU6A 4IPAA 2JRLA 4L74A 4FU0A 4GMXA 1LQ2A 3CH6A 1HI9A 4R5MA 5AM3A 2B4KA 1NN3A 1NL3A 3Q7IA 4IXWA 3R7LA 1C4XA 4GYWA 2YYAA 4JT9A 1VIVA 2OCDA 2Y1GA 2F1IA 4QT4A 1TLLA 3G7SA 2XRNA 3DKIA 1JEOA 2QRQA 2G70A 5JLWA 4WBSA 1H2WA 5BOSB 3G9UA 2Q28A 5I45A 4IX9A 1HYGA 5D3MA 4LC9A 1CR1A 2Q9AA 4QXQA 1XU9A 3L4BA 1K4KA 2D3TA 2D1HA 1KI6A 1H5QA 2ZR7A 3F96A 3Q3IA 2QR3A 1YBHA 3NBMA 4TQGA 5HLHA 1CP2A 4ZAFA 5IBPA 3K6SB 4GRIA 2X9LA 3LOUA 1VLMA 4PHHA 3LQQA 4RH1A 3X44A 4LXXA 4TL7A 5K8LA 4COKA 2XIJA 3H9UA 2QI9F 3U6BA 1YI2I 1Z13A 2ZE6A 5A71A 3B12A 1XAGA 3IQGX 1MX3A 3JASB 3PJDA 3ZCVA 2CK3A 4Y9TA 1R10A 3TW7A 2O03A 3MW8A 4ZXPA 5J1SB 2P2NA 5E3MA 1L7EA 1WBJB 3JQ9A 4AP9A 4HJXA 1UOPA 1CDOA 5HTKA 4F1KA 2Q1SA 2RJNA 2PRIA 3I37X 3VR4A 1XVLA 3U61B 5HLIA 5B1EA 1X2BA 1I4OA 2AK2A 2GCPA 1KQ8A 3C3BA 3REQA 3H0CA 3IDSA 2EBWA 3LVRE 1I7NA 2I6XA 1ENHA 4RIFA 1JJFA 4RGVA 4PAOA 4GOLD 1XXLA 2W1OA 2WJJA 3NM4A 2RGNA 1U0GA 1OCOH 2J3HA 3A4LA 2FSSA 4CQMB 2VJLA 3PNVA 4U3JB 1GN8A 1V71A 3ZVNA 2C4NA 3RARA 2UU9B 1KEEB 3OQOA 2Q6TA 3K70C 3DV9A 4RXUA 4URUR 4DIDA 4XASA 1YIDA 1R1VA 2IXDA 4ZVSA 1TZJA 5BO5A 3QITA 4QBHA 4EKGA 5BORA 4L78A 1A7KA 1FIAA 2ZT8A 3E7DA 4MQVA 4P81A 5SICE 4BCBA 3BRCA 2MYSA 5KJFA 2CRGA 1W96A 2DBVO 3SIPA 1L4NA 4EVSA 3RYPA 2HZDA 1GZ7A 2JGDB 3UWMA 1LLUA 2IL1A 5HIIA 3ZCXA 1H66A 5JC8A 2MD0A 4C7OB 3RZOJ 2UV1A 1MMDA 4PQGA 4EG5A 3BMXA 2CUZA 2Y1EA 3DDOA 1SG0A 1Y7HA 1FPQA 3DOUA 1DJNA 1V11B 1WB5A 2BBOA 1EJ6A 3ILHA 4XRMA 3LCCA 1ZD2P 3QYBA 2DHDA 2HWUA 4ZVKA 4M71A 3H65A 3EGXA 4DCNA 2CH0A 3M70A 3ZU3A 1JT2A 1ORTA 1T3TA 5LU9A 5JECA 5DKFA 3A4CA 1FYEA 1NRJB 2VNKA 2DTEA 1D4OA 4YA6A 3LK7A 2UZ3A 1H4VB 3G2NA 3WFJA 1LEHA 1LDGA 2VE8A 5E1XA 4HAIA 5ECGC 1ZHFA 1A2QA 1IN5A 2YASA 3QHPA 4G5RA 4S0ZA 3UV3A 4BVHA 2VQFB 1Z2OX 2VPWA 4E1VA 3BOSA 1U0EA 4ZA2A 1AQ6A 4AVZA 1WTCA 1XNJA 1YHYA 3M3PA 3DMTA 1JQ3A 3G0CA 4EWLA 5JTUA 5EE3A 4YIIA 4MYTA 3L2CA 2PH7A 2D2VA 3AT1A 1ZK0A 4JUBA 3A01B 2LY9A 1IBSA 3ZKWB 2JI8A 3IBYA 5CHEA 3K9TA 2FX2A 4M53A 4F92B 2QLTA 4HBZA 3FXJA 4UUPA 1YQEA 3JQ6A 1M2HA 4E7PA 3F7MA 5ER9A 4E7KA 2P67A 2QMYA 4MGHA 5E1ZB 2WF6A 2NPFA 2C9ZA 4DJJA 2F55A 3CG0A 1IEQA 1RYDA 4NABA 4DW8A 3Q15C 2C58A 3FY4A 1I3CA 2YJNA 1AK1A 1U8ZA 5F7XA 3LSRA 2VUHB 5AW2A 1RWVA 2L54A 3KEGA 2L69A 1OXXK 1UKZA 3FYDA 5BN4A 1MAWA 3MJCA 3T7SA 1HDXA 1QH0A 1Y1VJ 4X1KA 4BBZA 1PZXA 5ITSA 1JEQB 2ZWAA 3IEUA 4YRSA 3UMBA 4KGXA 1Q0QA 3D8SA 1G3UA 5BMOA 3PO2J 3UHAA 3RS5A 1JDBB 4MKZA 2IY8A 1GRRA 2E4UA 2FQWA 2W2PA 5KKNB 2P4QA 1ZGCA 1SBQA 2HGCA 2BY0A 2XOKD 4KCGA 4PC7A 1SFOJ 4PGMA 2AF4C 1U6JA 3PNLA 4CM5A 4ETNA 4LCBA 2GJKA 3ORHA 1VQOI 3DAFA 4NQWB 2OCBA 4TN5A 3DBVO 4IO0A 2DFIA 2HLNA 5I9MA 4WCDA 5JSFA 1JDJA 1FP6A 2GBYA 1MB3A 3Q0TA 4EB6B 2HA0A 1HYEA 3EH1A 4C89A 4UXHA 4R40A 5EJ2A 4IX1A 2XJ4A 3LT0A 4FGLA 2A6TA 2OBLA 1G3MA 2EIXA 4QRDA 2WWVD 4NCAA 4BBRJ 4JXJA 1GCGA 5T4EA 2J09A 5B3JA 1G4AE 3MTEA 5H8WA 3K7EA 3FWKA 1J49A 2ETHA 1Z0IA 1QUFA 2AYYA 3ORYA 1RYFA 3O4GA 3BCUA 3SC3A 4P3OA 5JS2A 1VRVA 1IUOA 3EULA 4NWIA 4ZU1X 5F21A 4D4IA 5M29A 4LOCA 2E35A 3DMDA 5KOJB 3L7BA 3SQNA 5KAFC 2DUNA 1TDJA 3DQVC 4IXAA 1SG9A 2RK6A 1FYLA 3RC7A 3UMYA 3RUIA 2MR5A 4E1BA 1VG8A 3DMHA 5EVJA 4FYPA 1PWZA 3PI7A 1WU7A 1HDPA 5A9SA 3SVTA 2DHCA 1U1CA 5EMNA 4N8SA 1R22A 2VK8A 1W5TA 3RVBA 3ZE6A 1BVHA 5L6MB 3SM9A 1XKLA 3K0EA 3X1DA 4EHAA 4E5DA 5DCWA 1YOBA 3OZ7A 5HZGA 3KDPA 3UUWA 4IUBS 1OMIA 1LDNA 4QLBA 3EZ9A 4HH4A 3HB7A 3JAMA 1F0NA 2X19A 3NT5A 3QX3A 5IZ4A 2W2XA 5HDKA 2ZE5A 4S1WA 4D6XA 1ZI6A 621PA 1J9ZA 1KYQA 2GAAA 1Y7PA 3B6ZA 3LUJA 4Q4HA 4E2WA 1FVXA 3CMMA 3JZMA 2OVFA 4JU9A 5AYVA 5FEUA 2D7CA 2FW1A 3RVKA 3HUUA 4UCXA 2BY4A 2HCBA 1E3OC 5BY2A 3QODA 4DGWB 4CCNA 2IVFA 3HI6A 3QENA 2Q2EA 4IYRA 4Y2TA 4CMJA 5JD3A 2KDOA 1LVHA 3B3JA 2CLOB 3KFXA 2BCJQ 5DRTA 4XICA 5H16A 1L1FA 5FPQA 1ID1A 2YTZA 4OIMA 4NF2A 4UFOA 2FVXA 5GV8A 4AY4A 2WUVA 1P81A 3LU1A 3L4BC 4DDKA 1ODDA 5TY0A 2HYFA 3VVBA 3RYCB 5G0SA 4ENQA 3B1XA 2CXNA 5JXJA 1OLUA 1IOLA 1V41E 3M5CA 2W98A 4JROA 4KVZA 3C5HA 4NK4A 2X3FA 4WJLA 2G04A 2XMQA 2LBFA 1N6PA 3WJAA 1RC0A 3KIOA 3P20A 4GSLA 3VR1A 1EIWA 1SQ0A 3L0PA 3UWSA 4PSCA 1IBCA 1PWXA 1HW1A 2JAQA 2JBAB 2Q1ZB 1PJAA 1VZ2A 2Z56A 2ZI7A 4R1QA 2X1MA 4TT8A 4GLFA 3E9EA 2TMGA 4N7JA 5AVQA 2IOYA 3KU4A 3RR2A 4D9HA 4F5WA 3MJRA 1DC5A 3C15C 4Q4JB 5L3SA 4A0XA 3M89A 3ON5A 4Z3DA 4MJ7A 5KDLA 2I65A 1QYXA 3K73O 3CCJI 3EPJA 2CUKA 2LKPA 4S0HB 1W4ZA 4XRSA 1UCFA 2PX0A 3A0HC 5BVHB 4H1TA 3TUZC 1F8FA 2RE8A 3F67A 1FFDA 2XPWA 1THZA 1K08A 2MOKA 3CNBA 3HRKA 3QF4A 2PMFA 4RV9A 3ZN2A 3HNRA 3NORA 2HGZA 4FI3F 4OFZA 3LFKA 5JNRA 3REGA 4EECA 4YMHA 1AXEA 3BXHA 2KL4A 3HRHA 4KXFB 4L9RA 3FDJA 1XP8A 2EFHB 4YR9A 2X9DA 3W1EA 3ZQIA 1D2GA 1UBKS 3QJYA 2NU6A 1XD9A 1CUYA 2AG6A 2QYOA 1CYDA 3QEBZ 2LD4A 3U62A 4Q4AA 5E8JA 4BCDA 1BMDA 2OOKA 3HCOA 2CJXA 2FPKA 3BHIA 1X9GA 5BR7A 1LBHA 2XQJA 3CTPA 5AKIA 1Z77A 2DCEA 1KHTA 5E6SA 5FD6A 4ENTA 5AXBA 3OFSA 4A23A 4BMZA 5KJCA 1U8FO 1USIA 2AOTB 4W8OA 3D2AA 2HR1A 2HHAA 5B5EC 5JI3E 4CT5A 1TAHA 3FPBA 4ZO8A 1FP4B 4G6QA 3PVCA 5HBRA 4B6JA 1LY1A 4GI3A 2W5UA 3K20A 4RPKA 3I12A 4GDMA 1RPNA 3CEHA 1JIIA 4OMDA 4TWIA 4WZBA 5FTJA 4CEJB 3JREA 1DIHA 1QGZA 2P9BA 2XGOA 3MC1A 3OE7A 1P3JA 3HNOA 5F2OA 3WP0A 5KS2A 2N0SA 5GONA 3D2LA 4GMFA 3V7UA 3K1NA 1HTBA 1Z6YA 2ZRIA 4WEQA 5FR2A 1AKHB 3MMZA 4M60A 2LP4Y 3KE9A 2Q2QA 5U9CA 4M8LA 1DAKA 1K2VN 4ID3A 2W2TA 1EDOA 3QEOA 4OBXA 2VDLB 4KSCA 5DGHA 3OT1B 3TR0A 3PC4A 4HSGA 3VSLA 1QVVA 1M2VA 1T9DA 3GX4X 2GCOB 2R1ZA 4BV8A 2Q4EA 3ES9A 2CL0X 3GTMJ 2BE7A 3ZEIA 3PCTA 4CLXA 4G7ZF 1C1DB 1HFJA 1RZ3A 5FBLB 1N6OA 1M76A 2A33A 2C78A 2OFOA 1MNMC 4MA4A 3ZVLA 2R6FA 4EL0A 3LOQA 1JU9A 2GHIA 3KHTA 3TVYA 2Y2UA 4EVRA 5IT0A 4E21A 1K27A 1U3GA 2GPWA 5HFNA 1XEFA 4DBVO 5I7UA 1M3SA 5AWFC 4MGKR 3HPRA 3OX2A 3P19A 5TMDA 3AHCA 1UBHS 4DLLA 1GIAA 4M76B 3IUPA 2B4RO 1PCXA 2H1HA 1NXQA 2JA6J 4UDOA 2PA3A 4B0PA 1VLLA 4O08A 1AVTA 1PYOA 1N34B 2ZDGA