3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
1OYYA 2FU4A 2H63A 1E7QA 5KJ6A 1P1HA 5J6XA 3TNLA 3FTPA 3DKWA 3I53A 5FB2A 1G3SA 3RYRA 1Y7TA 1WMBA 3JQAB 2FBHA 4ILKA 3K1PA 3GEZA 4L9NA 1U5TA 1PJ4A 1ZSYA 2BGMA 3KYDA 1UXGA 5ILGA 5G0VA 3GVCA 5AONA 4KUGA 1NR7A 3ZU2A 4C4OA 4P9FA 4ENNA 2VRBA 2RNJA 4XRFA 4PG5A 1C3VA 4XRRA 5TRDA 1J7KA 1USSA 3NRVA 1B15A 4J7UA 4DLBA 4IS3A 1E3WA 3O4RA 4I0AA 2M87A 3BJAA 1WVGA 5TS3A 4QEDA 1ZG3A 3ENKA 4RDHA 4O6JA 1J75A 3QW2A 3H9GA 4OSOA 5TF4A 2GCGA 5L3CA 2DW4A 2I66A 3P7NA 1C1DA 1SAYA 4DGSA 3MJCA 4NDNE 2FE3A 3K9TA 3IC5A 2IPQX 3NJ8A 3ABTA 3G79A 5HBRA 4HFMA 2FPPA 4BNLA 3E6CC 4IF4A 1UXKA 2JTVA 5JAIA 3GY0A 3RQSA 4XDZA 4BNXA 4DC0A 4MPDA 5U4QA 5JMWA 4R3WA 2VC1A 2G1UA 3LT2A 4E2WA 3BMOB 1Q7BA 4OXYA 1M2WA 4KTTE 4WLNA 2NUAA 2NVBA 1S6LA 3A4VA 1T4DA 3JSOA 3DQPA 1LU9A 4AJJA 4OOIA 2WM3A 4E5YA 1ZIDA 1SAXA 3L9WA 3TSCA 4E2XA 2GPTA 1MV8A 4I0BA 1XD7A 1FPQA 3NTRA 4PZJA 2X23A 5HLGA 1DRVA 2YV1A 4F6LA 2QZ9A 5L3BA 4BGVA 1PR3A 4G81A 1NQOA 5CEFA 3L07A 1R1VA 4B3JA 3HN2A 4LK3A 1PSDA 1SBYA 5G0UA 2FNAA 4E5PA 1NPTO 3QAHA 1U3TA 4FGWA 3F1KA 5KVVA 2YR2A 2JFHA 3MZ0A 1N7GA 4H15A 1KEPA 3S2EA 4ETSA 3RKUA 3RU9A 2WTEA 3LC2O 1I01A 1GCUA 1Z7UA 1JE8A 5ILVA 3OJLA 1IN7A 3R3SA 1T2CA 3RBZA 1LLDA 3VDQA 4R69A 2PH5A 2Z5LA 2XAJA 4FJ2A 5J8FA 4XGNA 5ILSA 2C6YA 2D8AA 5JPIA 3C1OA 2X22A 3T4XA 4Z3KA 5A03A 2GXBA 3G1UA 3NGLA 3HB5X 3TZKA 1E7YA 1OYWA 5JCJD 1JW9B 4WPGA 2KRFA 1Y8RA 1IZ1A 1LVAA 4QO8A 4DL9A 2EKQA 2I5PO 3I83A 4M89A 4EGZA 1OKRA 1DIGA 1WMAA 3MZYA 4IPAA 1Y6JA 1YWGO 4ND3A 4D45A 4I1IA 2YHUA 4L8VA 1YQAA 4NFHA 1F9NA 1XU9A 3LA7A 3HUDA 4RF5A 4NPCA 2OQGA 4BNWA 4HFJA 5ILUA 1FBUA 3J81K 4R1TA 1D8JA 3E5MA 1TNTA 3GGPA 2M8EA 3MCZA 1RKXA 4ZQFA 2L3DA 3SFZA 3ENNA 3GVIA 4KDEA 1MDMA 1Y81A 4DTIA 1QQIA 3GVPA 5FI5A 5LEKA 1TNSA 5F3RA 4BO1A 2GO1A 4BO5A 4G9YA 4CM4B 3KCCA 3F6VA 1U5AA 3I5MA 4AJEA 3I59B 1PJQA 4OKIA 5THQA 3FF4A 4M54A 4BNZA 4IRGA 2PZKA 5F1KA 1FP2A 5LGNA 2AEMA 1IB6A 4A10A 5GZ1A 4KOAA 3ZHXA 1O94A 2UZKA 2NLOA 1CDOA 5ICFA 1WRJA 4P55A 1JN0A 1N5DA 1PL8A 3PTZA 2Y0EA 2COMA 1XA0A 1ULYA 4MP3A 4AFNA 5DCYA 1UHMA 4G5HA 2ZQZA 4B7XA 1K89A 5K0ZA 1R16A 3RI3A 2Z33A 1J0XO 2P2SA 4Y98A 4IDGA 4JXKA 4U7BA 5DBGA 3KZVA 2IP2A 1JXSA 4QWQA 1EUDA 5L7TA 5GY7A 2ELHA 5JR3A 4I2OA 3PQFA 3CZMA 2AQHA 4NMHA 4DIBA 1IRGA 5IXSA 4TQGA 1SD6A 1U5TB 2EK5A 3HFSA 1U8FO 3KYDB 4BUCA 1RZ4A 1P31A 1KIFA 4HA8A 5IZ4A 4BO3A 3P2OA 3FN4A 1BC7C 3HDHA 4CMEA 3JQEA 3KB6A 1E3WB 4BS9A 3COAC 4JBAA 4EMSA 4EJTA 5DBIA 4CV2A 3KO8A 4U6SA 2ZJ1A 4ESBA 4LB6B 1HRDA 1UCRA 2GQQA 1T2AA 3AY7A 3VPSA 1MUUA 4N9IA 1C1DB 1Z6RA 1LXCA 2C2YA 2F2EA 1K6JA 2GLXA 2VHXA 3LVFO 3SJ7A 4W9NA 3DWFA 3KZZA 1G3WA 4I8XA 1O3RA 4CR8A 5HS8A 2EV6A 3ZMZA 1HE5A 4RPHA 4EM1A 1O3TA 2Q45A 3OP4A 3VH2A 3VKUA 2L54A 2HCTA 4ALLA 1P74A 1WNTA 3UGKA 3U09A 3KYBA 1KVRA 1HXHA 3CO6C 3KUXA 3V4GA 3REOA 3OICA 1S7OA 3PQKA 3QU3A 2DBZA 2QRJA 3EVTA 5BNFA 2JAHA 2VWHA 5ER6A 2NU8A 3BMNA 4CV1A 4YT8A 5JSFA 4CQLA 4RF3A 4DYVA 2YFHA 4TWRA 2VN2A 1T4BA 3L09A 3AOGA 5FFZA 4E32A 4ALKA 4KUHA 1UUFA 1KOLA 4CPDA 4B8WA 1K6XA 1E2XA 2EFPA 2YHIA 3JD3A 4OKNA 4CL8A 3PYMA 5I7VA 4P38A 1OAAA 3AU8A 4DIOA 1TBXA 1IN8A 1J6UA 5D5UB 1FMCA 3Q9SA 3RJPA 1DC4A 1X0XA 1D1TA 2FR0A 5JO0A 4NQZA 4F46A 3E3VA 1DOHA 1FYLA 4WCFC 4GX5A 4UUNA 5EJ2A 4GGPA 2J5PA 1IY8A 4GAEA 1JU9A 1PJLA 2X0JA 3HDYA 5DBFA 4E5KA 1E5LA 1B14A 3Q9UA 1PP7U 5FFXA 3DO5A 3CLOA 1J5PA 4MOWA 4NR0A 3GLQA 3RFXA 5JC8A 1HW1A 1DJQA 2MH2A 5BT9A 2X0RA 4IJAA 1Y9EA 4KDPA 4O3MA 2BRUA 4RB3C 2H9IA 3F6YA 3I23A 3SZPA 1QLHA 4WCDA 1HW2A 1EE9A 1UP4A 3KLNA 3BA1A 3LC1O 1BDBA 2Y67A 2I99A 3SC4A 2ZYGA 1PZHA 1NFQA 2JJYA 4LFUA 3T7EA 2H6BA 2O4CA 2ACJA 2HTSA 4K2EA 2Y93A 3J81Z 1R15A 1YO5C 1MC4A 3JAMZ 2CW0F 1ZFNA 2VOJA 3FTNA 1LJ8A 1UDCA 3TOBA 1Y8RB 2O3JA 4TVOA 2L02A 5EINA 3KLOA 3TWOA 5B37A 3TKYA 3SXYA 1T25A 4MIEA 4CODB 4ZICA 4WOKA 5KNLA 3NT5A 3ITKA 2E48A 1EUCA 3NV9A 5L3EA 2W24A 3HTUA 4M9ZA 3H5NA 4Q3EA 3F8FA 3K1MA 4UUVA 3ONDA 2O2SA 3GDOA 2VBYA 3IP3A 3U9LA 3DBLA 4AJ2A 4RVGA 2EF1A 4XYEA 3COSA 4RF4A 4KDFA 5ICSA 4D7AA 3GAZA 1ON1A 5JE8A 5AIQA 1UJMA 3U62A 1MDMB 3K69A 2Y0DA 3GAFA 2JPBA 4WXCA 3F8CA 4MINA 5TRTA 2F5CA 1WAMA 4GYIA 2CVOA 1PQWA 2PZLA 1PJCA 3KHUA 1MX3A 5G4KA 3SQNA 1E1MA 1QYVA 4K1LA 1NXQA 5JAMA 4OQYA 4LVCA 5COBA 2VWGA 1X15A 5KCZA 1XGKA 3ZV4A 4Q4ZF 3ZV5A 4BMNA 3VTFA 2FSVA 3HB4X 2D0IA 3C3XA 5FEUA 4XIYA 4MTEA 3LK7A 2HKXA 3DFZA 4I5DA 4Z0PA 3TZQA 3ZWOA 2B37A 1RUNA 1EE2A 3JYQA 3OM9A 4PZDA 3K1NA 1LSJA 4B3HA 2NM0A 5JFOA 2B5WA 1U3EM 2WD7B 1ZMOA 2F1KA 1ISGA 4TRRA 5JS6A 1SFXA 1N9GA 1Z6ZA 3ABIA 3WQQA 2G17A 2CGPA 2PG4A 3ICPA 4E12A 1O6ZA 5CVRA 4AJ4A 1YJQA 3PPIA 4KZPA 5A3JA 3WJ7A 4A03A 3ONEA 1S6YA 2D1VA 4J1SA 2DUWA 4MJLA 5EMHA 5U1PA 1QYXA 4ZYEA 1U78A 3A1NA 5LGTA 3PGJA 4YRDA 4X54A 3K2ZA 3KOUA 4CR6A 4EUFA 2OBPA 3PHGA 3FM3A 4BKRA 4YG2F 3M7GA 4LD5A 4UV9A 1GV0A 1FOKA 2BKAA 3JYOA 3PDJA 4IBOA 4Z0TA 3J7AO 3RPQA 1HWYA 1V0JA 1V3VA 5ERIA 2Q2VA 3FNFA 3VH1A 1HT0A 1FWZA 3I71A 3RYPA 4ZYHA 3LA2A 4H0EA 1T1RA 3EDMA 4II2A 4PRKA 4RVDA 4R79A 4U7DA 1MJAA 1LLUA 1Q7CA 5LLQA 2Q4EA 4ESFA 4IS2A 3E6MA 2Y1EA 1S29A 5I9LA 4PDKA 3OETA 4IDDA 3CIFA 1FYMA 2HMTA 2DAOA 3L6OO 1J2XA 3MZHA 1P44A 4XYBA 2WYUA 1QO0D 1JA9A 3LF2A 1R58A 1HYEA 2DPGA 2RIRA 5L4NA 1Z7BA 4NNJA 3RAJA 5EIOA 5DD8A 3ROUA 3V8JA 2D45A 3J80K 2HJSA 2Y0CA 3LF1A 3I6QA 4Q5SF 1GY8A 5B4UA 4OIRF 4N18A 2VT2A 4GCVA 4U0JA 1Z73A 4F3YA 1E3JA 3MFKA 1S3JA 3R0JA 5HLHA 3H6KA 3RD5A 4CM7A 4D79A 4E13A 2ZATA 3C85A 3UAGA 3TFQA 4RQUA 1PS9A 3BMNB 4PG4A 3DMTA 4CQLB 1E3EA 5JC1A 3MTJA 3W1VA 1B8PA 2ZB8A 3K8ZA 4CMKA 2BV6A 2UYYA 4KMSA 4CLHA 1OMIA 1HEUA 1MG0A 4H7PA 2QW8A 2HQNA 2PTGA 1D3YA 1GZ4A 1VLLA 2B69A 2YHIB 3U3XA 4EZBA 2QQ9A 3VDRA 2K86A 4BNVA 2C0CA 2V1DA 4D42A 1RM5A 4QLCU 4EM0B 4ZYGA 5DOZA 3TPCA 2Z95A 2MC3A 4CHUA 1ZN2A 4J90A 3E1KA 4CM5A 3DONA 2NRAC 3AI3A 4OM8A 3RUCA 2V6CA 3I3OA 4ZA2A 4MVJD 2ZKZA 2OGUA 4FJ0A 4DQXA 4L5IA 4XSXF 1M6WA 5F1OA 4P96A 4BMVA 3LT4A 5EESA 1G0OA 2SCUA 3P2YA 4URFA 4G7OF 4TRMA 2E82A 1T1SA 1M75A 4ALJA 1XSDA 5JYDA 2C82A 5TC4A 3BHJA 1UR5A 4O6VA 2UUOA 4AJIA 2JRTA 1ISFA 4HLYA 1JGSA 4J4TA 3I64A 1NAHA 1VJ0A 1DPGA 3VFZA 4RGRA 2W2LD 3JD0A 4CUKA 4OH1A 4L74A 1IXCA 3IDSA 2VUUA 2E7XA 1A4UA 2DBVO 4U8GA 5L40A 3GEGA 4Z9YA 3AJRA 3I9OA 1ZXLA 4OHUA 3V8KA 1ADFA 1PGOA 3HDJA 2D1HA 2VBWA 3WTZA 2YYYA 3HQ4O 1PDNC 1R5HA 4FCCA 1ZRDA 1CQIA 3GWZA 1ISHA 1QP8A 2WDZA 3B1FA 4YIIA 3MJTA 4WLFA 1Y5MA 3DBLB 5L45A 3ZW9A 2F00A 5F6FA 1V35A 1P4WA 4K9DA 4WK8F 1GZ3A 1NWHA 3RKWA 4I5GA 3GR6A 3WGHA 1AXEA 1PQUA 1V3FA 1O5IA 4IZHA 4RCVA 1HKUA 5HM8A 3JQ8A 3HRSA 4JJGA 4BGIA 3W6KB 4ESOA 3JSAA 3O8QA 1YLFA 2VYNA 2AW5A 2IRWA 3BYZA 4FT8A 3KV3O 3WIEA 4EJMA 2JD1A 4U7WA 2EKPA 2MLKA 1XSEA 5G4KB 2BFAA 3ZH2A 3BMCA 1BG6A 2OU2A 3I4PA 1DDOA 1EVJA 4BO4A 1I30A 2IXBA 2OOSA 4HDVA 2IT0A 4FD3A 4I08A 1ONNA 5JW6A 2FRHA 2J5OA 1P77A 5JDCC 4CLOA 1XWFA 2GDZA 2WD8A 3CMMA 4J1QA 5IZCA 2P5KA 1W7PA 2P4WA 1N9GB 3QWIA 3DOJA 4ID9A 4KN7X 1LDYA 5JBIA 4WE3A 5AQ1A 2YDYA 3OMLA 4LRTB 3HYIA 2RN7A 3H3ZA 4TRJA 4XKJA 3ROMA 3WTSC 5JXWA 3KEOA 1BIAA 4BHCA 2YQ5A 4BMSA 1ZHFA 4AJHA 1DFGA 1JAXA 2W85A 2EJVA 1P4AA 5CVJA 5ED4A 4XLNF 5D4RA 5A2QZ 3TO9A 4OJNA 4UAGA 2ZJ2A 4RB0A 1PZFA 2GUGA 2B5VA 1TB4A 3NTOA 4DMLA 3U5TA 1YBVA 3R0IA 5TIIA 2X5OA 3ANLA 3RFTA 3JTHA 5FI3A 3IJRA 4MVJM 3VVBA 4R9SA 1KY4A 3ZMVA 3S2WA 2B0JA 2WYVA 2H94A 1V6AA 2DQRA 2B35A 4G65A 4MDHA 5AXCA 2BELA 2P91A 2XAFA 3RKXA 3V1TC 3ST7A 2MD5A 4WNIA 3OOPA 4IJWA 1QNTA 4U0VA 1KC1A 5JHUA 4Q3NA 4ALIA 1DB3A 1DBVO 1HE3A 2IA2A 3C1AA 2VUTA 3GFGA 1LDKB 1FP1D 1I3KA 4I98B 4IRIA 2XAGA 4L5JA 1JHHA 3HUGA 4JQFA 4LB5A 1BMDA 1MB4A 3GDGA 3H9QA 1HYGA 4TMFA 3IOYA 3T1BA 2WJPA 2UWMA 3OHSX 2ZTUA 1TW2A 3JD2A 4ON0A 1UXJA 2RVCA 3MJEA 5D8LB 1TXGA 5IT9K 4BNHA 2VE9A 1WWXA 1KQ0A 1J9IA 2IW5A 5HS9A 1KBZA 1Z1DA 2PV7A 4BNFA 1OR7A 1S7CA 3PIIA 1P1KA 4OINF 4NU5A 1ARZA 2V6GA 1I3LA 3QVXA 5DDIP 2VHZA 4P9UA 1NQTA 3H65A 4EEZA 4JCOA 3QA9A 2CF6A 3Q0EA 3QJ5A 2CUKA 3ERED 2LDXA 2HQRA 4LGVA 2H6CA 4A0SA 2HK8A 1BM9A 3ELKA 1RIOH 5LC1A 1NTOA 4JQCA 2JPCA 2VN8A 3BTUA 4EJWA 3H9JA 4GMFA 1LC0A 2VOEA 2HMVA 5A3VA 2DLDA 3L0DA 3VZSA 1SMTA 2O6GE 1NAIA 3VC7A 1U3WA 3KTDA 2JHGA 3HIFA 4YRAA 4UNOA 4M1QA 2KIUA 2IE0A 2D1YA 1HSTA 2LF7A 2IYOA 3BHIA 3D0OA 3GLXA 4PLVA 5E1WA 2P5UA 3I1JA 3PHHA 3JQGA 4AICA 3FR7A 1I1GA 2OBNA 1ENYA 5F21A 5IF3A 5EPOA 1BRMA 3HSKA 4KYWA 4OMYA 4HF1A 3WTVC 2GIVA 4ENJA 1LRKA 1I36A 1M67A 4RORA 4J7CA 1O9BA 1TA4A 1OZAA 2HMUA 2AG5A 4MP8A 3UFXA 3R6SA 1XEAA 2NSDA 4ND2A 2O7QA 2PH3A 1NHWA 3VPXA 2RH8A 3FWZA 3V2GA 3EY4A 3ZW8A 3WQRA 5G0WA 4DBZA 4CUJA 2EW8A 2G0TA 2ZTVA 4NU6A 3W8FA 1I2BA 5BPDA 3RIHA 3JQ8B 1CERA 4UVCA 1H0KA 4MVJF 4ROSA 2RV8A 2A35A 3DTYA 3O8QB 4XGIA 4PGGA 5TQVA 1AWCA 2JT1A 4ZU3A 3K2BA 2CO5A 3GHHA 4FOOA 4GSLA 3M1AA 4F7ZA 1HDYA 3EK2A 2C5AA 3LLVA 5I7EA 1UHWA 3BMCB 4GX1A 4NJMA 2ZJ0A 1FDUA 3EYYA 1KYWA 3W4JA 5A05A 1HSOA 4AWXB 1OMOA 1P1RA 3AY3A 3L6DA 1A71A 2WV0A 2Q8KA 1ODDA 3VPGA 2ZMEA 3JW4A 1FZPB 2VQ3A 3S55A 4IGEA 4CLOB 2EJRA 4LJZF 1IF1A 1JWAB 4MO2A 5AYVA 1HL3A 4O5OA 4UVIA 3ULKA 3EMKA 4XQEA 1W7PB 3WGIA 2CFXA 5J23A 1S8NA 4D0SA 4OOFA 1LDEA 4R5HA 3H5RA 3NX4A 3Q2IA 6PAXA 3P9CA 1FDTA 3GFIA 1R4MA 3FMQA 2VRCD 1K6OA 2P9EA 3K9QO 3QWFA 2E4AA 5L9AA 1BJAA 1T26A 3ICCA 4KQXA 3QE3A 4BNGA 5JNLA 1JVSA 3AFMA 4QECA 4WLUA 3SXPA 1DIAA 3MQ0A 1B7GO 4A6DA 1OI7A 3GRPA 2RCYA 1I8TA 4Y8VA 2NTNA 4QTZA 1I27A 2PKQO 4TKMA 4BB6A 1P1FA 2QYTA 4AIJA 2CVQA 2RH4A 3FBTA 4LN1A 4PLTA 3L4BC 2P5YA 2Z3YA 2W57A 1YGYA 3K31A 1XCVA 3ASUA 1VRWA 5C7LO 3STHA 1LDDA 4CLXA 3CE6A 4BNJA 1SO8A 2GZ2A 4HADA 4M6YA 2P6TA 2EA2A 5BSGA 4AIHA 2AEFA 3A28A 4YWJA 3IAHA 5IT9Z 4CJXA 4YQYA 3L9FA 2PI0A 1YQXA 2PWZA 3LLSA 3UUWA 2J3HA 5G2OA 5E18F 1BXGA 1I10A 5JCJA 3UVEA 3OJ0A 2GZWA 1K7AA 3JQ9C 3U4DA 4XLPF 4WXDA 1EQUA 3AM3A 2IJLA 3FNGA 4RAYA 5EEGA 2IRFG 1TT5A 3F47A 3M1LA 4NG5A 2ZCUA 4MKXA 4Z3DA 3ZU5A 2YQ4A 3UN1A 2H1SA 2I3AA 4G8XA 3WG9A 2RBEA 4W82A 5CVVA 4WUVA 3ZNOA 1HDGO 4IDEA 2AEJA 3D0SA 1B0AA 1XMKA 2AQIA 3E48A 3VPFA 4I01A 3KLMX 3D5TA 3MWEB 3Q9NA 5BSFA 2DK8A 4NBWA 3R1IA 1B26A 2DFDA 2EERA 3NGXA 5DCMA 2XPCA 1A5ZA 2A9FA 1UXIA 3ZWBA 4Z9FA 4DIFA 1DXYA 1K79A 3D5LA 1PWXA 1FK8A 2P4HX 3FR8A 3KVOA 4BO2A 4PCVA 3D7LA 4FFLA 2OHXA 1MGOA 4XR9A 1PP8F 1DHTA 5KOIA 5BPIA 1X1EA 2HSDA 4RVHA 4UVEA 1AUPA 3ZNNA 2NVUA 2CVZA 3DBVO 4IHSA 2Y1FA 3H9EO 2W2KA 1AN9A 3JCZA 2E37A 1F0YA 2B4RO 3ZHYA 2W25A 1EMDA 2FR8A 2C29D 4AJ1A 2EIHA 1G6KA 4KIBA 1YL7A 1FLIA 3FXRA 3PJFA 1USTA 4EQQA 1FDWA 3GN2A 1ZAOA 2WC2A 4LSWA 5BMZA 3AFNA 1LSOA 1SNYA 4U0YA 3WTBA 1O95A 5COQA 3T5XA 3IUSA 4FIZA 1I5RA 4YYZA 1IN6A 3F21A 4XWYA 3LU1A 1WP4A 3KP6A 1H9GA 2EKLA 2NU6A 4RPLA 1CGPA 4KICA 1KETA 4DWVA 3TZHA 2YSRA 3JQGB 3LZ6A 1ZGJA 4TZTA 4WASA 5EQDA 2KIFA 5DCWA 1O89A 4D43A 3TGNA 1XSXA 3WTYC 1CF7A 1T38A 1ORRA 1TW3A 1O57A 2YX7A 2EEZA 2DBQA 1OC2A 2NTVA 2PGLA 2VTDA 2F5EA 4IVNA 2VOOA 4R3NA 2DLLA 1RUOA 1EVZA 1TT7A 1VL8A 3RVDA 5AXAA 3GXOA 1HKTA 1YQDA 4BO7A 3PQEA 5ENVA 1MG5A 3NDIA 3FM5A 1GEGA 4J7XA 3O9ZA 4PLCA 4GGOA 4I9NA 5DUIA 1YS4A 2XASA 4RGSA 3U1DA 2A07F 2DTEA 4K28A 3ZWWA 4PLHA 4BYYA 1PJ3A 1QXSA 3KRTA 1PR9A 4OMZA 5HTOA 4Q39A 2QLZA 2FSWA 3GQVA 4LVUA 3TFOA 3FMRA 1MZBA 3CUOA 2B4TO 2WWRA 5IN5A 1YOVA 1ZEJA 3V2UA 7MDHA 2ISYA 2ETHA 1BTOA 1I1SA 4Y67A 2YW9A 5JDIA 4PCQA 1AE1A 6LDHA 2QQAA 2AE1A 1J59A 4XR4A 3N58A 5KVCA 4BH9A 4YAEA 2XUBA 1PGNA 4NQWA 3Q3CA 1QYDA 3GFMA 3JQ7A 3P5SA 3ZHZA 1NHGA 1XB4A 2ZBKA 1KVUA 1P9LA 2RAFA 4NJMB 5D5VB 4DPLA 1WW8A 2XOXA 1SEPA 4JBGA 4BQAA 2VWPA 3H9UA 5L7WA 1UAGA 1FBSA 5D5XB 3GZ4A 4EGFA 2TMDA 3OA2A 4PLYA 3MTGA 1HKSA 2FOIA 4R68A 2Y0MA 4HX8A 1ZUD1 3I9KA 4LISA 2HS5A 1C0LA 5AXBA 1NFFA 1HF3A 4TSKA 2O23A 1R4MB 4TKLA 4B4OA 4CMCA 2BGKA 4IMRA 3HTSB 1LC3A 2VNAA 1M76A 2W98A 3W8EA 1ISIA 1QG6A 2ZB4A 3W4IA 3R4KA 5CPBA 4L4XA 3GVXA 3PFFA 4QFCA 4XYGA 1YKFA 1G3TA 1LQUA 3LYLA 4PG8A 1V4RA 1B8VA 4IDAA 3ZZNA 4MP6A 2O50A 1ZLJA 2NAZA 2YJZA 3GDFA 5T8KC 2HMSA 2Q49A 3QOPA 2DUUA 1UDBA 3L77A 5FWNA 2HWVA 1ULSA 5G4LA 4JBIA 1A72A 3DEUA 1UZNA 5FF9A 3O38A 4IZIA 3GPIA 3INGA 1L1FA 1H5QA 2XF8A 3ZPLA 2FY8A 1FT9A 4IGFA 4LW8A 3O3KA 4RF2A 1DPRA 1F12A 2Y48A 4GKBA 3FPLA 1V8BA 1I3NA 2LKPA 2VE8A 4GO1A 5MDHA 3WE3A 4NH4A 5K6AC 2G9WA 5T64A 4E6PA 1BXGB 1DFHA 2AXLA 4WOJA 4FFPA 4GL4A 1DJNA 1X13A 4MIYA 3HRTA 5T67A 2RDPA 1TT5B 3SC6A 1D7OA 1B3RA 3ZV6A 2VBZA 4E21A 1GTMA 1LDNA 1U1IA 2J5RA 4KIGA 3H3FA 2J3JA 1B9NA 2ZCWA 1K6IA 1XDWA 3PWZA 4IJUA 4KN4X 4LCJA 1H6CA 4YIFA 1XSVA 2WMDA 4N7RA 5HVQC 4LMRA 4ALNA 1Z75A 4IUYA 4C7JA 5DCMB 5KVRA 3RROA 3GRKA 2FZEA 4A5OA 2HRZA 4JK3A 4LK0F 4Q48A 1P1JA 5E20A 1N92A 1T2FA 5CPFA 1GAEO 5TNXA 3TDKA 3C3WA 1BHSA 1HYHA 4KA4A 1VJTA 5F1RA 2TDXA 2W90A 3C7DB 4UULA 2OXIA 5CDGA 1E1NA 1HXDA 2HQ1A 1ML3A 3MCVA 4R1SA 1D8KA 4UEOA 1TEHA 5T57A 2MLGA 2NVUB 3FHZA 3TDZC 1BSVA 1GD1O 1P1IA 1WDLA 2HRBA 2W2KB 3OBBA 1ONVA 1YB1A 2HK7A 4ZYDA 1E0DA 4ND1A 2PK3A 1QYWA 4OIMA 4WLVA 2FZWA 1R22A 2FSSA 2YUTA 4IRHA 3K5PA 3JYPA 4EDFA 4YAKA 2QZ8A 1KY5A 1BIBA 2GWRA 2O3RA 4OYRA 2PJPA 5BSEA 1ADCA 4F45A 1P92A 4L4SA 5GZ3A 1PEDA 2B83A 4BKPA 4AJKA 2PKQP 5KWEA 5FD5A 3RC9A 3LFKA 3ON5A 3OJOA 1F06A 4IQGA 3DZFA 3S2GA 4YAGA 1H9TA 2V6MA 3OIFA 1YE3A 3N4MA 4DNCA 1AGNA 1GYPA 3MEXA 1SMYF 5IAAA 1CF7B 4O59O 2NQ8A 3BDDA 2O3TA 2QZZA 4IJVA 1HLPA 4EJOA 4HZFA 5L7YA 2QWWA 3EW7A 2QRKA 2VOPA 2HYFA 1VM6A 1O8CA 3CDHA 5GMOA 3ZWNA 3WDSA 3QWHA 4CZZA 5DCFA 4A6EA 2NACA 3DBHA 3TZCA 3TZ6A 1T24A 4XA8A 1IW7F 1XYGA 1LLQA 3IJPA 2XRNA 4JX8A 4XQCA 1YQGA 4E31A 4AL4A 2K4JA 1LEAA 3JQBA 4NBVA 3C18A 1N2SA 2JD0A 3WLFA 5D5WB 1PX0A 5E1XA 3MEQA 4PLZA 2IZ1A 4XJTA 5C5IA 4I02A 1U5TC 1WZIA 2CG4A 2W8ZA 4R16A 4UXNA 2OL4A 1YOVB 3GFLA 1CQJA 3Q6IA 4BO0A 1QSGA 2NV6A 3GVHA 4HQEA 4JJIA 4YJFA 4EGYA 4EJ6A 2J3KA 2JCYA 3GGGA 4PLWA 3JQ7B 3RUFA 5IN4A 3LQQA 2CFCA 3FXQA 5BQTA 3IWZA 5I8ZA 3H7AA 2PFBA 4ALMA 3AUSA 5F1PA 4PZEA 3QVTA 3PDUA 1NWCA 1RPNA 2XAAA 3GA0A 3RUIA 3F8BA 4BHBA 1P33A 5K5QA 1M66A 3K96A 1X0VA 4FHTA 3VTZA 3FNEA 1OBFO 3F23A 2Z9OA 1YTYA 2FBIA 1BDMA 1W4ZA 1FF9A 1SOVA 1T39A 4MIOA 4B4VA 3IRRA 1RM4A 3I6IA 3FX3A 2IEDA 4IY1A 3AOEA 3GNQA 3G3EA 4A12A 1E5QA 1LDBA 1FBQA 2DAPA 4YR9A 4OGWA 1XN7A 4Q9NA 3DAPA 5I7FA 1VJ1A 3WIDA 2ISZA 5D6EA 2P68A 2FMYA 3BWGA 1B16A 2EW2A 2Y99A 1ENZA 4YDRA 3WGZA 4XSZF 4MQVA 3DV8A 5G0TA 1J0RA 1EVYA 1UAYA 3JQFA 3O26A 5CAEA 4ZH4F 4WLEA 3G73A 2HTJA 4RVSA 4MVJA 4Y15A 2GSDA 4WECA 3WTWC 4B79A 3CINA 3GF4A 1R7JA 1PJTA 1DRWA 3ZMUA 4GH5A 4IQ8A 3Q11A 5A02A 4QXMA 3U49A 3SX2A 3FXUA 4HW0A 3DEYX 4RPKA 3ROPA 4E4YA 4XB1A 1XDSA 1R66A 2EA4A 3HSEA 3WU0A 1HE4A 2J6IA 2CMDA 3L9XA 3D4PA 2J5KA 3V8BA 3ULQB 4RO0A 1MJBA 2BHLA 1DIHA 1KVSA 4R1UA 3LSTA 4YCAA 1VTNC 3GUYA 4Q3AA 2CDAA 3F72A 3HSFA 1JKJA 4MVJH 1P0FA 3WBBA 2JFFA 5D8KB 2GF2A 3F5SA 3N97A 3E82A 1HDOA 1E7SA 3ZP5A 3IUPA 1DC3A 3FCOA 3ETEA 3TRIA 2P4QA 4M55A 1IL0A 3G17A 1GUFA 4B8ZA 1H2BA 3GEMA 1T2DA 3KM0A 2IDZA 2PQ8A 4LLLA 1X14A 3GT0A 1GUZA 2VHWA 4K6FA 3ZDFA 1KVTA 5FGMA 5HDKA 2V7PA 2PMUA 4M6XA 1R1UA 4L9TA 4JP3A 4BNMA 1ZRCA 5A06A 3DFGA 1ADGA 3R6DA 3V1UA 4ZJUA 2HZTA 5JDIC 1RYEA 4M49A 2DTDA 3PWKA 1EBFA 3L4SO 4NZ9A 3SHFA 3OEYA 3S8MA 3AU9A 3ZWYA 2PFGA 4CQMA 3PFIA 1LSSA 3CKYA 5DDGA 3WNVA 4I7HA 2FPGA 1DAOA 2CYYA 2CSUA 2UV8A 3H3JA 1LJ9A 1JKIA 1NFRA 3IMFA 3TDUC 1NVTA 1Z6TA 4QQRA 3TJRA 3F4BA 3I54A 2EV9A 1IYZA 1RJWA 4HNHA 5B12A 2K4BA 4DQ2A 2DKNA 3DOCA 4RLSA 3NEUA 3WFIA 2VYVD 1I2CA 3B70A 4FSHA 2OA4A 4R41A 1G6NA 3HRMA 4LCEA 2V9VA 1XQ6A 1HKQA 3JV7A 1QLJA 1GYQA 4RDIA 1I6XA 1XIVA 5EQFA 3ITDA 1K0UA 5KK1A 3IKTA 1PGPA 4BQPA 3VZRA 2V1UA 5JAZA 3BP8A 1UB9A 1GCOA 1MKMA 5LDGA 4MVJP 1CJCA 2NQTA 2HGCA 4XB2A 3GN1A 1IAWA 1RI7A 2IVMA 4MGRA 1BI3A 1E6UA 2X8LA 1KU2A 2DU9A 3IC7A 1NX6A 2YZ7A 3D64A 3F46A 5DULA 4N0BA 4XJSA 1SFEA 2E6UX 1ENPA 2DFVA 5A4DA 5ICEA 4MVJG 2YV3A 2L01A 4ZQBA 2DPHA 2GN4A 2C59A 2O2YA 2P7VB 3TN7A 2XHKA 1ZBQA 1E1KA 3BPVA 5K9ZA 3JTGA 5THKA 4D0PA 4WJZA 3RBXA 1U2GA 3BTOA 4ZRMA 3WODF 3BXXA 4J16A 5F5LA 1LQ1A 4WLOA 1NBOA 3TO6A 1JLLA 2Q50A 1P2FA 2OMEA 3B6ZA 1EH7A 3BJOA 4HBGA 5KJCA 1R0KA 3P9IA 3JYLA 4W4TA 2RC4A 4L0QA 1X7DA 3WSVA 5I9NA 5IDYA 3WNQA 1KEUA 3DR3A 2K02A 1Z7EA 4CMEC 1SZJG 1LDGA 5E8IA 3PGXA 4JGBA 4YJFB 1XMAA 4R1HA 2YV2A 4NBTA 4XYLA 1E17A 5TX7A 3PHJA 2XIGA 1MP0A 1SPXA 4YACA 3PXXA 4II3A 2IODA 2DBBA 3QP5A 4PGFA 2QQBA 1Q2XA 4N5NA 4E5MA 1CEQA 1LI4A 1Q0HA 3OA0A 3QIVA 2QENA 3FD8A 2QVOA 5E1ZB 1GV1A 2QX7A 1A4IA 3ZWCA 2J8ZA 3WMWA 4W9NC 5CG2A 1I33A 3PYLA 4FN4A 4QX6A 1W5SA 4B4WA 1X7HA 4YB8A 1MGTA 4RGBA 3EZLA 3RIRA 4CM1A 1Z82A 3FBGA 3H5AA 3IS3A 5CDYA 3M2PA 5LBQA 5CVIA 2HEOA 2RHRA 3Q1LA 4BL5A 4CMIA 3VHRA 2OP1A 6ADHA 2O0YA 2PKRA 2RGVA 2POQX 3RUDA 3KP4A 1EH6A 2Q0OA 1WDMA 4Y6RA 5CP8A 5LHGA 5CG1A 1RWBA 4YJDA 4HAMA 4K6CA 2FOKA 2JCXA 2WE8A 3L6EA 3MOIA 1C0IA 1SB9A 2VBXA 2EFQA 3L2CA 3N74A 3SVTA 5K1YA 1H9AA 3U9GA 4I5FA 3GYHX 1A9YA 2XKPA 2C7GA 2Q2WA 3W8DA 4EYEA 3VZQA 4CMJA 5I7SA 1H9BA 2LDUA 4ZRNA 4A2CA 5JMPA 5L3GA 4M71A 1EZ4A 2JFGA 3HDQA 2D2IA 2XXBA 1P4XA 3F3SA 4GLOA 4IM7A 2EWNA 2G5CA 1P45A 1PZGA 1XU7A 3VH4A 4AVPA 3DBRA 4KTVE 4OIOF 3ZWVA 3DC2A 3UXYA 2GRAA 1NQAO 4NFYA 3BJ6A 4J2HA 1IRFA 4LRSB 3F1LA 3ISPA 2J3IA 1PJ2A 1L0OC 2NU7A 5HLIA 3J80Z 3D1LA 3PI7A 5AXDA 4YFKF 1U9JA 1U6GA 1PUEE 5CFZA 3NKLA 3ORFA 4G7HF 4KIFA 4RJTA 1PJBA 4R8HA 4HUJA 1LRJA 1GQQA 2IA0A 2X9GA 1I5ZA 2Q2EA 3SLGA 2KKOA 4P5OA 3SLKA 2P9CA 1TQPA 2PZMA 5BQFA 3E18A 3INTA 4FW8A 3E6DA 4CQMB 1HTBA 1IE3A 1EH8A 2BLLA 3GNSA 4LSMA 1B9MA 4RZIA 4YT2A 5ILOA 2G82A 4A73A 1TLTA 1QGPA 2DO7A 4ZD6A 4FJ1A 1U7TA 4EW6A 1LA2A 2H5LA 2QBYA 4RVUA 3QQPA 3DPTA 2BGCA 4QFDA 1ZH5A 5HA5A 2X0IA 1STZA 1YYVA 3ZMDA 2BF7A 2L4AA 5JFRA 3AUAA 3D3WA 1WKMA 2I67A 3AI1A 3UCEA 5KJFA 4UV8A 5H6RA 4AD9A 1BW9A 1DHRA 1VL6A 1Y8QA 2BFOA 3AOEC 3ANMA 4KNYA 3CEAA 2VZ0A 3WQSB 4R9RA 3RC1A 4ZGWA 3RDIA 2X9NA 1NVGA 1LDMA 2YU3A 4M86A 5H82A 4XQ9A 2KJCA 3W6UA 2O8XA 1BC8C 4XYMA 2VRCA 1N1EA 2M5WA 4KT5C 1ZREA 1CIVA 2I65A 4N9HA 2BFMA 3KP3A 2ILTA 4LMYA 3RJ5A 2WYWA 3A9WA 3OQBA 2CDCA 4G2NA 4EBFA 3K2EA 4QT0A 4IHTA 2M45A 1SD4A 2M1BA 4ZZLA 2UVDA 3ZN1A 1ISJA 4MVJI 5TJ9A 3LA3A 3KSZO 5CDTA 2B4QA 3FF5A 2A6HF 3V7SA 1HQCA 5K5OA 5TT0A 3WGQA 4L9VA 2B36A 1ZO8A 3PFWO 1CF2O 4IJKA 1K3TA 2FMUA 2PR2A 3E9QA 3IIEA 2E49A 1T2KA 1E77A 3RC2A 2DQ4A 4EV0A 2X5JO 3RASA 4OIPF 2QIOA 3U2RA 2HAEA 4IIUA 3CTMA 1R4NA 1KU3A 2P7CB 3RUHA 1VPDA 2BMAA 3GOHA 3LWFA 4RB2C 4D46A 2YDXA 3AUTA 4ITUA 2DQLA 1ZJYA 4UVGA 1SD5A 1GFSA 2VTEA 5BR7A 5HOOA 5FFFA 3PEFA 4P4GA 2X7HA 1D5VA 4CM3A 5JY1A 1YW9A 3EUHA 3EHEA 1IN4A 3ZI0A 1F5TA 2XAHA 3WMXA 4CV0A 4D3FA 2D2WA 3QWBA 4MVJE 3R0AA 1Q1HA 4IMPA 5A9RA 5DEQA 2BGLA 2GD1O 1K5HA 1ONOA 2Y1OA 3PP8A 5ER9A 4PVDA 1R36A 2GN9A 1PZEA 4BHTA 2PBIA 3ZWAA 1HZJA 2GA1A 4GBJA 1ON2A 4O5VA 3TOZA 3K92A 1LB2A 3OFSA 4RPJA 4CM9D 4Q3BA 5BSHA 3GZNA 4JJFA 5TSDA 4UREA 4DPKA 1FJHA 4CMIB 4D44A 1SC6A 3W6JB 1WDKA 1VKOA 2EWMA 3LAPA 3DMTC 1G3YA 2K27A 1HDXA 5KJ1A 3QRFF 3RJ9A 2V6FA 3IWFA 1ZGAA 3W4KA 2V6BA 4A5MA 4G94A 1YG2A 1ONPA 1MFZA 3OH8A 5ES3A 4EUEA 4NK4A 4EUHA 3AY6A 3UW3A 5EN4A 3CUKA 3HSRA 2PD4A 2OD5A 4J49A 3AK4A 5KVSA 1NPDA 1BWSA 3E5QA 3B1KA 3JQAD 3KEQA 2C2XA 4L9JA 1YO6A 2JAPA 3LDHA 1ZYRF 4I9UA 4DVJA 1TLHB 8ADHA 4BNKA 3RWBA 1SB8A 3NDJA 2NNLD 3JQCA 5JAQA 4M9SA 3DQVC 1LNQA 1N7HA 4ENKA 3H92A 4XDYA 3GZ5A 2FA5A 2MA3A 3BZUA 2ZK7A 3LT1A 4PLPA 4YEDA 2ZB3A 1KS9A 1J49A 3DBRB 3HFGA 1EQ2A 4JP2A 2O4UX 3AUUA 4OMUA 2Z1MA 3VAZA 4OO3A 2Z99A 1Z45A 1ZSNA 4CUZA 3I0TA 1GDHA 5A5FA 1NR1A 3G0OA 1FYKA 1H93A 2ZYAA 5H83A 1LUAA 1I2ZA 4HKTA 2FBKA 4CM4A 3HG7A 4M72A 3KP5A 4RAZA 1B2LA 5LHHA 2DT5A 4FFRA 4CL3A 1E3IA 2G76A 1T0FA 3SZTA 2NWQA 4GLLA 1AHIA 5LRSA 1AOYA 4NHJA 1GADO 3LT0A 4HF2A 2CZCA 3OQ1A 1JHFA 4XZ3A 1KU9A 3WTTC 4HV4A 1A7KA 2A5YB 1UDAA 4FQ8A 3BPXA 1E92A 4DRYA 4CMAA 1ZG1A 1XKQA 5TT1A 1HDRA 3AM4A 4CM6A 4PG6A 4KMUX 4WCFA 4DC1A 3PYXA 2EV0A 4W99A 2X4GA 5FO5A 3DZIA 3QVOA 2QBYB 4UEJA 4J1TA 4GQAA 3O2PE 4BGUA 5HWSA 4NB5A 1X1TA 2XXJA 4UEKA 3KXDA 1IXSB 2C54A 2VCYA 2A94A 3D3WB 4PRLA 1XELA 4RGXA 4KQWA 2EHDA 1BW9B 1Y8QB 4J4HA 3INRA 3EVNA 4XBFA 5DP1A 4CM8A 3ZNQA 5JCXA 2DU8A 4CYDA 2R00A 2GZ3A 4EJUA 1NYTA 4HFNA 2Y1GA 1XGNA 1R5GA 3VVCA 2DVMA 1W73A 2Q1SA 1UZLA 2BE5F 2DK5A 3R61A 2P5LC 5BOXA 2EP7A 2GASA 2NTJA 3CUQA 3LAJA 3RSHA 3A06A 3NAQA 4AJNA 1YL6A 2Q1TA 4LG0A 3KLPX 4A0ZA 5IZCC 1FDSA 1YJ8A 5JYEA 2B0LA 2EFOA 4D41A 1Z74A 3KP7A 2NNNA 1WI9A 1NVMB 3NTQA 3WX0A 3CPSA 4ASNA 4WEOA 2ZYDA 4E3ZA 5DYMA 4TV7A 4OOEA 4AVYA 3VOEA 5IG2A 3CSDA 5CVUA 5CJ9A 3HZZA 3ANNA 3JD1A 4GX2A 1O7LA 4PLGA 2ZXJA 4WWCA 2Q2QA 4DQUA 1MD0A 2HO5A 1U5CA 4D3SA 3VKVA 4L76A 2FXAA 2JL1A 1QKIA 4CLDA 3TQNA 1R4NB 5JI6A 3B20A 3VOSA 1S7AA 3GFBA 4OU0A 3T8TA 3DHYA 2HK9A 2V79A 2W84A 2X4HA 2R2GA 3DZKA 3HNPA 2X86A 4HWKA 2FHSA 5CYVA 5FLXK 1GZ6A 3CTAA 2O03A 4HDUA 5ICGA 1KC3A 2VWQA 3T0YA 1ZG5A 2FWMX 3PQJA 1DIBA 1GPJA 2Q99A 2BFPA 4I5EA 3I5UA 3OSUA 3F8MA 2I9PA 4IINA 2L4MA 3QU6A 3GHYA 3U4IA 3V8LA 4A5NA 5LGUA 5L4LA 4A0XA 3WU1B 1DLJA 2EP5A 4A2UA 4UVHA 4ZN6A 4GSKA 2X0NA 1DLIA 4U5QA 1H6DA 4BV9A 1WWKA 5KTKA 4ONEA 4YA6A 4WKGA 3GFJA 3V5NA 4YT4A 3F9IA 4YBZA 2VZ9A 4HY3A 5LHIA 1IHXA 3ZU3A 4GXOA 5JY6A 3BROA 3GZNB 3QP9A 9LDTA 1B59A 3IRQA 3N7UA 1M6HA 4OXKA 3JD4A 3L7WA 3WWZA 5JO9A 4LLNA 1O3SA 1B6AA 4R54A 4HYEA 4CR7A 3AI2A 1GVJA 3ZCXA 3GO5A 1F1ZA 3NQOA 3WE2A 1YDWA 2ZMEB 2UDPA 4YAIA 1OPCA 3Q2KA 3WYCA 1BXZA 4E2YA 4ZZDA 4FBGA 4Z0HO 3IKVA 2IZ0A 3ADOA 3PRJA 3MWDB 4L4RA 4OXNA 3UKOA 4N5LA 1XHLA 5L53A 3D3EA 1H94A 2IA1A 4WGGA 2D3TA 4FOSA 4GVXA 3GZ6A 5E8GA 3MAJA 4M8SA 4W6ZA 1OOEA 4L73A 5F64A 5CDUA 2UUPA 3H3UA 2BH9A 3WR5A 3U0BA 8LDHA 3ZQ7A 3HWRA 2NADA 2P6SA 2KJBA 1UH5A 5C3MA 4AJPA 1W8DA 4B8XA 1BGVA 4MNUA 2Q4BA 5B4TA 5KKCA 4YFXF 4CGZA 1U4SA 3BAZA 3NT2A 3WYBA 5A9TA 1F8FA 5TLSA 3JAMK 2X6TA 1E1LA 3EYWA 1J5YA 3ROQA 3FRJA 2RHCA 4FS3A 4BB5A 4J9VA 3RTRA 1R37A 4UUPA 3PVZA 1ZK0A 2JKVA 4B3IA 1BI0A 3OIDA 1ZARA 1XG5A 3E9NA 2A92A 1YDEA 4E70A 3GF2A 2BEOA 3QRWA 4YPOA 1ULUA 4XIJA 3DP7A 3EZYA 1HSJA 4P4NA 2X1HA 1UP6A 4J43A 4INAA 1C0PA 3GGOA 3ZMSA 4BIIA 1ZXBA 3HOTA 2CF5A 3WXBA 5IXYA 5HS7A 1NQ5A 4A0YA 2WD7A 3S2FA 2GGSA 1Z05A 4UHTA 4Q47A 3PIDA 4WCFB 1LQTA 1WXDA 2O3SA 3H2ZA 4WXHA 2P5VA 1DIRA 3Q5FA 3KE2A 2VNSA 3PWSA 4ND4A 4U0KA 1BN5A 4DXHA 5JVTA 3DF8A 4TVBA 5G0SA 4J91A 1GPDG 4YJHA 1KYQA 4J4BA 4M87A 1GUYA 5C7IO 2Y66A 3ETDA 4E2ZA 3K0LA 3C7CB 1SD7A 2IXAA 4EI2A 1MLDA 5AIPA 2PNFA 1XGMA 2CNBA 2I6TA 1WSUA 4CM8B 3PJDA 5KKAA 3TOAA 2MBFA 1LDJA 2FNPA 3KZYA 4BNUA 3BOQA 2PA3A 3NRCA 3M6IA 3QY9A 4IIVA 4MKZA 4RLHA 2FR1A 3CUQB 4CO8A 2J5QA 5IJZA 3SEFA 1GL3A 1VKNA 1FSHA 4ZQHA 2LNBA 4LG0B 1QRRA 1Q0QA 4DMMA 1QBJA 2PLYA 1DAPA 1DEHA 3FWNA 1BOAA 2ZTMA 3GG2A 1YB4A 3GG9A 3F3XA 4W7HA 4R1NA 3I9LA 3S1LA 5A9SA 4BNNA 4FFOA 2Y1CA 3QV1A 4RVFA 3DXFA 1LTHR 2C5EA 3ZMTA 3EGOA 1TQMA 2DTXA 2Q1WA 4P8RA 4BNCA 3O03A 4J9UE 1PGQA 1PWZA 5FLXZ 3DPLC 1SOWA 5TJHA 2IEBA 5I9MA 4HQMA 4PVCA 2V65A 3GK3A 1IUYA 4JNKA 4D3DA 4WK6A 1YXMA 3I4FA 1W5TA 1V3UA 2NNYA 1I3MA 1RM3A 2C20A 3K73O 4R51A 2QHXA 3ZV3A 2YX4A 1JAYA 1YBMA 1DO8A 1QR6A 5KJEA 4Y13A 2XROA 3E5RA 1SMKA 2M30A 3DHNA 1O3QA 1GR0A 3E97A 3QPHA 4FGSA 4R5MA 1B8UA 3GMDA 3V2HA 1H6BA 1U3UA 2G7UA 1SFUA 2PGDA 3OECA 1JKFA 1QV6A 3ECOA 1DUXC 3RFVA 4BVAA 1U8RA 4RQTA 4DLAA 2P8TA 3AWDA 5COAA 2AG8A 4B09A 5DT9A 4FB5A 1DFIA 1HLDA 4CMBA 4BKUA 5DCUA 5JDCA 3NEPX 1D1SA 1ZZEA 4S3MA 1GXQA 4L75A 4RS8A 1K2WA 4P4LA 3ZU4A 1GU7A 5B4VA 3B1JA 3KP2A 4MHGA 3B73A 4A7PA 1YONA 1IUKA 1QV7A 4BKQA 3RBVA 3TL3A 2Q1UA 3E03A 4YQZA 3WTUC 1QYCA 1KU7A 2LDBA 3FSRA 4Y6SA 1NP3A 4Y6PA 2A61A 1U8XX 2WSBA 2VT3A 3V7RA 4L0ZB 1MA0A 5IFLA 1L7EA 4QUKA 2NYXA 3ABUA 5T5QA 2FP4A 5TJJA 1G4DA 1U28A 4DA9A 5L4SA 5U9CA 3EAGA 4HNGA 1Y5RA 1AHHA 3P7MA 2FRDA 3E5UA 4N54A 4GI2A 2R00C 2F5DA 3UOGA 4DQVA 1ZW1A 1X7GA 4PIVA 3C1TA 4NBRA 1LRLA 1E7RA 1LLCA 2VYVA 2ZNZA 3IL2A 5FYDA 5CEEA 3FMSA 2PN6A 5D6FA 3RUAA 1QZZA 3CUQC 3GC6A 2QYOA 2BI7A 2FQ3A 2PD6A 2YFQA 3C7AA 4G7ZF 1PS8A 3AW9A 2C07A 1L7DA 3WGYA 2VUSA 2OORA 1D3AA 2PY6A 3JTMA 4GPD1 2GR9A 3KBOA 3QLJA 3C8MA 1P0CA 3DB2A 3PJGA 3OJFA 4BGEA 5KIAA 4M74A 1LEBA 3M2TA 2EGHA 2BD0A 2PGJA 3ONFA 3WSWA 2AA3A 1QMGA 1XDUA 2F5FA 2PEXA 3BHMA 1BVRA 2HUNA 3EYIA 5L3DA 1AXGA 4QO7A 1JQBA 2VHYA 2KIMA 3WGOA 3LQFA 2JZYA 3W6ZA 2QYSA 2OZ6A 2FMLA 2JHFA 2O7SA 1NASA 1KVQA 2VONA 1E3LA 1ZK4A 4I9HA 5DF1A 3EQLF 3RKRA 2DPDA 3PHIA 3DZHA 1NNUA 4DPMA 5HRUA 3NJ4A 1G1AA 1LX6A 2GYYA 4Y9DA 3TL2A 1T2EA 2GAUA 3KFWX 5A1TA 4FFMA 3HADA 2VZ8A 3H4VA 1R1TA 1IN5A 2DI3A 2FEZA 1HSZA 2OUIA 2W2LA 3D4OA 3K30A 3KETA 3RCBA 4BO9A 1EV7A 3F5QA 3GPDG 1VL0A 3GMSA 1X3UA 1U4OA 4MEYF 2PZJA 4YXFA 4DREA 3CJNA 1T98A 4HLXA 1FX7A 4S05A 1DC5A 3RC7A 3MOGA 1YB5A 3ZGYA 4GYGA 4UVAA 1HZZA 5LEJA 3GNTA 4BXUA 4Q3DA 4B4UA 4KWIA 3QP6A 2O3QA 4BKOA 3NT4A 4BV8A 3B02A 1K78A 3L00A 1PTJA 3CH6A 3FNHA 3G49A 4YJHB 4YAJA 2Z5UA 1CETA 1KGSA 4FPXA 4YJGA 4Z2YA 2EG9A 3UICA 2XVCA 5DOVA 2BI8A 3SJUA 2JSCA 4XRGA 1QPMA 4LK1F 2UAGA 5FD6A 3PZBA 2DFIA 4U0WA 2P9GA 4JLWA 5JLAA 1E6WA 1ZCJA 3OQ6A 5H6QA 4H16A 1EK6A 1PQPA 3I4CA 2A69F 2FN7A 5EERA 2V1XA 4HX5A 4A27A 1E3SA 5HDGA 2EXXA 1IHYA 1ENOA 2OP0A 4FC6A 4UUMA 5H81A 4HFRA 3BZ6A 4E33A 2WE7A 4PN3A 3IQDB 1JWBB 2D4AA 2LF8A 1KEVA 3ASVA 4YVFA 4HX4A 3MJ4A 5A5EA 5A9SB 3LC7O 3FHLA 2AE2A 3WJAA 5ITWA 1Y0UA 5IT3A 4CXFA 3OIGA 4LMPA 2EJWA 2D59A 4IDBA 2OZUA 2CQKA 5A2QK 2HKIA 3E8XA 4XX0A 2E7WA 3R60A 3CXRA 1ZLKA 4OIQF 2X9VA 4HP8A 3CZRA 3DZBA 3F6OA 3MJVA 3QSGA 2DTRA 4RZHA 4S1VA 2Y05A 3X2FA 4AG3A 1RNLA 4M9XA 2RQPA 3D4NA 2OBYA 2ET6A 4FDAA 4GWGA 4Z6KA 4IPTA 4RGUA 2WEKA 5HS4A 4O1MA 3DOOA 1DRUA 4PZCA 4ZQGA 1KYZA 3UF0A 3DXJF 1PL6A 1UFMA 4R01A 3V7CA 1YIOA 3SBOA 4XGKA 3HHHA 1EBUA 4RL6A 5HS6A 3ZWMA 4UVBA 4EJVA 4M73A 1CYDA 3DBHB 3VB2A 1YFHA 1YW8A 2JD2A 5A04A 4EVIA 2O3UA 1PJSA 2ZNYA 5BS6A 5LRRA 2WTBA 1ZH8A 3U4HA 5AVOA 4CDGA 3U4CA 4E0BA 9LDBA 1P6RA 3HOSA 1C0WA 5IDQA 1XCBA 3O6BB 1ZVMA 2X5KO 1NHAA 5DP2A 1R6DA 2YY7A 3TOXA 4S04A 4FFNA 3ZWPA 4JIGA 3WICA 1IPFA 5K5RA 4GGGA 1GYRA 2ESHA 3CMCO 3D5QA 1HDZA 5AOVA 4BAYA 4J0EA 1IPEA 2H27A 1U3VA 5CDSA 1EVIA 3HHGA 2OFPA 1GEEA 3G3ZA 1A9ZA 4KWHA 2A4KA 4BQRA 4GKVA 2D5AA 1HETA 1P3DA 3ML6A 4A26A 3S2IA 1Y1PA 3DZJA 3L4BA 3QVSA 1KERA 2X58A 4PLFA 3QHAA 4TROA 1XGSA 4GMGA 3ZNPA 4KUMA 4ZHSA 1B1BA 3VODA 1MJ9A 3Q9VA 3WB9A 1NM5A 5ENDA 1XQ1A 3BMQA 1D4FA 1WPQA 1EFLA 3PLRA 5DN9A 4WF2A 1DSSG 5BNTA 4J3FA 1GQYA 3KSUA 4H3VA 1JVBA 3PLNA 1Z91A 1KA8A 2QG4A 3PK0A 4TZKA 3QPTA 3HE3A 4PG7A 2E1CA 3WTCA 1R0LA 1O0SA 1FC3A 3JQ9A 2UXNA 1EFKA 4IQ0A 1BI2A 2R6JA 1F8GA 3DMYA 4CLEA 1D8AA 2XGXA 1SCUA 2GN8A 1EEHA 2AXQA 3BTSA 3DFUA 3H2SA 2VC0A 2ZCVA 1H2HA 2EFWA 5L51A 4KMFA 3DTTA 5C37A 1GQ2A 1UXHA 3JQDA 2EV5A 1BBYA 1MXFA 1IXRC 4CQMD 3ADPA 3G1TA 3WBFA 1ZK1A 4DBVO 3H8VA 3CO7C 4WCGA 4NJOA 4ZVVA 1C0KA 4GVLA 3GEDA 4JBHA 5CLSA 1U7HA 4RB1A 2GA2A 4EEXA 1YVEI 1IOLA 5MGBA 2NS0A 3C7JA 3LSYA 1YH3A 3GW2A 3GX4X 4L0YB 3LQRA 5H20A 1WLYA 2ZO4A 1YW7A 3EETA 4OAQA 1C1XA 4KUEA 4XEHA 3DAFA 1REPC 1LNWA 3JQBC 3OF2A 2R3SA 1EK5A 3ZN2A 5ITVA 4L9RA 1PS0A 2BYVE 3DL2A 4U88A 1N8KA 3X2EA 2PLAA 3KSDO 4R4JA 2ZKLA 2Q46A 2CWEA 3VEPA 3MJSA 4P22A 5CHEA 1K78B 5IDWA 3VPHA 1XR3A 5CEJA 4YJGB 3E5XA 3IP1A 3IHUA 3UHAA 1U2WA 2C7VA 2BBYA 3KYCA 5T6BA 5GZ6A 4O0LA 3M8EA 2OZPA 2VXZA 1I0ZA 3BTVA 4HXYA 2HJRA 2WWYA 1Y9AA 5J8CA 4GWKA 2R7DA 3EC7A 2AQKA 2ZQYA 4W7IA 2MH9A 4CM9A 4CMHA 4PFJA 1E7MA 4FX4A 3QVWA 1ZK3A 3DHEA 3OV8A 4MTDA 4NHEA 3T7CA 2Y75A 5ADHA 4J0FA 3OEWA 4RV9A 4MQ9F 1TVEA 2GERA 4N5MA 1DPUA 1ZMTA 2GNAA 4OQZA 1LSUA 2AHRA 4CLRA 4L18B 2AQ8A 4IDFA 4J1NA 2RKHA 1TQIA 1F4KA 1BVUA 4RPGA 1UZMA 1FSEA 1QORA 3PJEA 2Y68A 4BOYA 4DYDA 4U6QA 1HDCA 1ZEMA 2PMHA 3GVAA 3OJEA 1V9LA 4ZQEA 2OAZA 2O61A 1BXKA 2NVWA 3T4EA 3VZPA 3WWYA 4E30A 3DAGA 4G6QA 2LSOA 1IULA 4XQGA 5EL0A 3WS7A 2QUFA 4CMGA 5IDXA 3JQAA 5L3FA 3ZHBA 4ESJA 2HKOA 1XGOA 5I8WA 3JQFC 5D4SA 4FX0A 2H6EA 3FI9A 4TRNA 3ZWXA 1PL7A 1A04A 2I3GA 2VHVA 5TGDA 5B1YA 3M9AA 3DDNA 1WZEA 1Z9CA 1L3LA 1ZK2A 3I58A 4IXWA 4HV5A 4NK5A 2ZFWA 1VSUA 2XV4S 1CWUA 1YBAA 2GZ1A 2I76A 3NDRA 3HRUA 2PD3A 1R0SA 3FWEA 4IDCA 5ICCA 1J4AA 2FF4A 4DUPA 1JDJA 1JTVA 3UCXA 4EITA 3A14A 5L95A 2ESNA 4I09A 3DZGA 1E7WA 2HU2A 3NUGA 3NYWA 2STTA 3AM5A 3GUCA 4YRBA 4HOBA 1TI7A 3WYEA 3HJAA 2VYND 2ADUA 1ISMA 3QWAA 1FY7A 5HDNA 1I24A 2VODA 1VC2A 4OL9A 4YT5A 3I9NA 3UH1A 5DUKA 1DP7P 2HR3A 1O7FA 4JROA 4NBUA 3P9KA 1EDOA 1A7AA 3WFJA 3M1EA 4CICA 5DNAA 2DC1A 2ZTLA 4JN6B 3BMOA 4B7CA 3WTXC 1ZRFA 1H0MA 1DDNA 1RYDA 4XCVA 3UCFA 1YS7A 1C14A 4WNCA 1GXPA 7ADHA 2CSOA 2GN6A 3E9MA 1TTYA 1OFGA 4E5NA 1W7PD 2A3SA 2EFNA 2AS5F 4MKRA 5LCXA 2ZB7A 3RUEA 1Q1NA 2HLPA 3F4LA 4KP7A 2HMWA 5T8KA 3JYNA 1FDVA 2OO5A 3PZRA 4WX9A 1W0CA 1YRLA 1B3BA 4WEQA 1I32A 2NU9A 5F5NA 1GHCA 2OQRA 3BMQB 4FC7A 4PGHA 1ZJZA 2HYGD 1G0NA 4LLGF 4AJOA 4BNIA 5LDHA 3TO7A 5ICMA 2DBRA 5L3ZA 1FXSA 4D0RA 3GUDA 4EM2A 1KQ8A 2FPIA 1T6SA 4ENMA 2IZZA 5K6AA 1OYIA 2HFHA 3WOHA 1MC5A 1PIWA 4GX0A 2CY0A 2O3FA 3E6AA 1N1GA 4ND5A 2DM6A 3RI4A 4YTEA 2QRLA 3ECHA 1R12A 2AMFA 3HN7A 4MEXF 1ZNQO 4Z9XA 3ROKA 4BO8A 3M8FA 1HW5A 1HE2A 4HBLA 4KFCA 3HHPA 4K26A 2DPUA 1DC6A 3WGGA 3C24A 3R3JA 1YS6A 4Q3CA 1B4AA 2K7LA 2YPRA 4G6DA 2CDBA 2H09A 4NFSA 1LBEA 4IXAA 1FNNA 2O48X 2XAQA 1UP7A 1A27A 4HV6A 3WLEA 1H6AA 3F22A 4J2OA 4XD2A 1LEHA 2R7FA 4IXTA 4HX7A 1W6UA 2D5CA 3V1YA 3TF5A 5KVQA 4DLLA 1R23A 3RU7A 2Y1DA 3ZN0A 2GXGA 5E17F 3EUWA 4BNYA 3RKYA 2CD9A 2A6EF 1ZKMA 5DV5A 3PQDA 2X0LA 1Q0LA 3I9JA 1IZ9A 1QZYA 1C1XB 1Q7GA 2Z1NA 4BHPA 2QM3A 1SEVA 1VSVA 4J6FA 4AJLA 2W4QA 4UUOA 1EUZA 4JK1X 3TQHA 1E6EA 1PGJA 4FR5A 3FZVA 4BO6A 1IZ0A 1YL5A 2E1NA 1XLTA 5DZSA 3T8RA 1ID1A 5DD4A 1HBXG 3FPCA 2QQ5A 3PHLA 4NI5A 4OSPA 1R00A 2EGGA 4CV3A 4HF0A 2Q3EA 2G7HA 5EEHA 1VI2A 4AIKA 3I9MA 3I59A 2HDHA 1MXHA 1V3TA 1W4MA 3KYCB 1NPYA 3BY6A 1U2DA 5C7OO 3F8NA 3RPUA 1WQ2A 4Y17A 4BNTA 2UXXA 3BIOA 3MWMA 1VE9A 1OC4A 1F14A 3GH3A 2STWA 3E6BA 1KQ9A 3AAFA 3K6JA 3JQ6A 2EB7A 2HOEA 2IYPA 4O63O 1CRWG 4YFNF 1F17A 3I52A 4UVDA 3VH3A 4B7UA 4EJ0A 2JCVA 2ZIZA 2HDCA 3WGTA 1PU2A 1BI1A 1MFPA 4F6CA 3C1DA 1ADBA 4CLRB 2TMGA 2XKOA 1EDZA 1ZSVA 4NIMA 5BNIA 3EDPA 4C7KA 2A68F 4LGWA 1KEWA 3P19A 3JSPA 1RM0A 4QSMA 3ETGA
chains in the Genus database with same CATH superfamily
1IRXA 3COYA 3EXEA 1Y7TA 2VNIA 3T1OA 4AMYA 3KYDA 1UXGA 2QE7D 3EUKL 1JEDA 1TJNA 2PWBA 3P9NA 3X0DA 2MW8A 5FTNA 2I6GA 4OQDA 5EUBA 2PMEA 3CLHA 4HAXA 1DP3A 3OTIA 1ZH0A 4O6JA 1J75A 2I6XA 2ASEA 4N47A 1U3CA 4BNXA 5HF8A 3DHWC 5D5PA 4QYSA 2J9XB 4OK3A 1YA6A 3VR3A 3TQFA 2QTZA 1SAXA 3HI6A 4I8IA 4Z2AA 2GPTA 2X5NA 2UU9B 2I7CA 2RGUA 1XRNA 3F96A 4KE6A 1NBWB 2YJ4A 2NO1A 3NO4A 3FHOA 5BO5A 5F08A 2FNAA 2Q0QA 5G0UA 3D6JA 3RIYA 4B3AA 1KEPA 5FLXA 1SBIA 4R69A 1BDIA 3ICQB 5FBWB 2ZM6B 3H7IA 3T4XA 3M70A 3TEDA 3GEBA 4BFZA 2O1WA 4QO8A 1QGUA 3VSBA 4U63A 3MRXA 1UJ4A 5K8CA 1FUYB 2AMYA 3P5JA 3GGPA 3SFZA 1K5GA 1Y81A 2IUTA 5GWXA 2A1TS 3FJ1A 1OREA 3ABOB 1IDN1 4D3ZA 3KQUA 2XE6A 5LGNA 2NLOA 1WCYA 1G8SA 5F35A 1EU1A 3THRA 4YYEA 2A05A 2QD5A 2WUEA 4U7BA 3PA8A 1SD6A 3QFCA 3FJOA 5AVJA 3WLOA 1VF9A 3IODA 4I8DA 1NXPA 3UJBA 2CW8A 4CV2A 2GQQA 2HOQA 1MUUA 4IFIA 2GLXA 1O3RA 4AY5A 3A58B 2I1LA 1NDHA 1TU3A 1OLSB 3PQKA 3QU3A 1JHVA 4CQLA 4TS1A 2N47A 1KO1A 1KDTA 3LKVA 1QONA 2XVMA 4D9IA 5J4YA 3MB8A 4JLJA 3PYMA 1DMSA 5JASA 1U2PA 3CCVI 2O8EA 1FYLA 1V8DA 3QKUA 4TL6A 3GU3A 1B14A 1KKLA 2H2AA 3TJZA 3A1DA 1YZNA 2GN2A 2OD2A 2X0RA 5CD1A 3I23A 1ZVVA 1UP4A 1RWPA 3O3NB 2JJYA 3E23A 3E35A 3T7EA 1SOUA 4F85A 1ZFNA 2L02A 3UWPA 4CODB 4WOKA 4D6PA 3GLFB 3FVRA 1JQEA 1NXXA 4H4EA 2O2SA 4UNSA 3DBLA 3OTOB 3NZEA 4KDFA 2G7MC 2I2BA 1UJMA 2ZRJA 5TRTA 2VJIA 2E87A 2B1JA 3MFYA 3H2YA 2IU3A 1WAMA 2H51A 3ESRA 4PYIA 2YICA 4XDHA 1RIFA 4Q4ZF 2AXNA 2X8JB 4JMPA 3CKLA 3FI0A 1JHQA 3ONVA 1Z6ZA 4NS4A 5JSYA 1BZYA 1B8IA 4ESHA 1U0SY 2DUWA 1QUFA 5LGTA 4YG2F 5IYBJ 3BRQA 1EYZA 3ERMA 1EA7A 3FHCB 1RD4A 1O6BA 5KNCA 1Q7CA 4KVFA 3B6KA 5TQ2A 5ADWA 4N7BA 5HJ5A 3C2HA 3MZHA 1QO0D 3NHUA 5EUCA 3TE6A 3H19A 3L2UA 2FZ4A 2WWVD 4MMZB 2ZATA 5JPDA 3OYAA 4MW4A 1EINA 5I5GA 3RSZA 1QNFA 3K8ZA 2F9FA 2UYYA 3E8SA 3RLIA 3D6TB 3S2UA 3RS2A 3LUDA 2ZSUA 2RGCA 1V26A 2FFRA 1XZJA 1X4PA 2NZWA 2AYXA 3EF0A 3WMEA 5IP9J 2P27A 1T33A 1R18A 2W2LD 4QBTA 4BN0A 5C9ZA 1Z67A 2QLMA 5DM1A 4U8GA 1A5SB 1RAFA 2WVAA 1TM1E 1ZCBA 5CW2A 1VE1A 4MCAA 4AJ9A 3EULA 4LDJA 2X1LA 3EW9A 1QLWA 3MJTA 2IPMA 4ZI3A 3ZXXA 5CVTA 1AXEA 1PQUA 3JQ8A 2CMKA 3HRSA 3CJQA 2BY2A 2OCKA 1J0BA 4F2GA 1P7ZA 3UG6A 3NBMA 2MU1A 5JW6A 4F9EA 3H05A 1W7PA 2WMNB 3QEMA 3CT6A 5AQ1A 4E22A 1VP3A 4BYMA 4AKTA 2UXBB 4FBMA 2ZT7A 1JEQB 3DB1A 1I1HA 3S2WA 5T7BA 1I3KA 1BMDA 4HDNA 1E5TA 2PV7A 3MWEA 2BFCB 2V6GA 3WKEA 2OT3B 3H65A 3QA9A 4CUGA 2ZRMA 1PBNA 3SYLA 3DE4X 3PC8C 5JMOA 1UFVA 5GJCA 3SQOA 2VN8A 4G1FA 4WCVA 4AW9A 2BM8A 2QQFA 2KIUA 3BG7A 2XJ9A 3GLXA 4V24A 4AICA 1T36A 3BDIA 3QVMA 1LE8A 4KLZA 5FHQA 4X84A 3F9KA 4HDMA 3NWBA 5I47A 2QI9F 5IUNC 3B6EA 3PO2J 2OTJI 4UBMA 3C74A 1CKEA 2DMQA 3HCCA 3MCTA 5KTRA 2ZI5A 4BBJA 3KS9A 1G8XA 3LCRA 3PPVA 1SUAA 1CUUA 3M1AA 2OK7A 1OMOA 3LA6A 4K1XA 2Y6VA 4RIGA 3FIJA 2QTLA 4XQEA 2FKAA 3SSMA 4EF5A 1DU0A 1FNDA 1GGVA 2I1QA 5JI2E 3OU7A 2IGMA 2JFPA 5JNLA 2GCPA 4RMIA 2RCYA 1KP2A 1I27A 4KPUB 3FBTA 1ZK8A 3C3DA 4X94A 5BN1A 5C7LO 1UF9A 3BWEA 5CU7A 4HADA 4L8YA 1K8XB 2DDAA 2BGNA 3L9FA 2XGOA 5H2FC 1CDDA 4D82A 4BAGA 5EEGA 5K0JA 2GLUA 4TMZA 5E3NA 2ZRBA 4DARA 2AQIA 1B0UA 3JU3A 4OXQA 1ZNYA 3BF8A 4KODA 4BO2A 1Z3IX 2D3WA 5BUCA 3GYBA 2ONYA 2HT6A 1E62A 2YBDA 2W2KA 3DJYA 2R44A 1YL7A 4NBNA 3JWPA 3BXGA 3MPOA 5DWVA 3E9ZA 3MF4A 2E1OA 1F5NA 1EVZA 3A1VA 4V3BA 4D5CA 4QQFA 3Q5GA 2I2FA 2WWRA 4FMCF 2JIQA 4JLVA 4RETA 3CPJB 5CNKA 2IYAA 2CN1A 4JYMA 3OKFA 4GPAA 1HKSA 3B6JA 3T3MB 5C8YF 3MYYA 4QFCA 4RMNA 1L8QA 1LQUA 3LBNA 2EINH 3ZQJA 5B3AA 4OHWA 2JFVA 2HWVA 4TOIA 5FF9A 2IYYA 1NBEA 5I4CA 3NUZA 2ZS8A 1NN0A 3FPLA 3REGA 3Q8WA 4L3WA 4TSRA 3CPEA 2AXLA 5BWMA 1H89C 2NSJA 2WUVA 4JASB 3L4JA 3IUEA 2FVXA 1I4LD 1UJNA 2JNWA 4N0QA 3RROA 3U2QA 4LY9A 4B75A 1HYHA 3DFIA 4GC5A 2V4UA 3BZWA 2G71A 4OIMA 4Z8YA 4LXYA 2X8BA 1ISSA 3QJGA 5GZ3A 4M8NE 2IHTA 1OIWA 3DNMA 3OIFA 2V6MA 4X7PA 4K8RB 1A96A 2X0EA 3K8OE 5FX2A 1N5IA 3NM6B 2F3TA 3DBHA 4UJ3A 5KAIC 3MB5A 5BMVA 1LLQA 4C0SA 1YE5A 2P67A 3UNGC 4F1JA 1TQ6A 1UPUA 1O94D 1PFVA 1RR7A 2VP0A 3WIBA 2BFDA 3QVTA 1WVRA 5K5QA 2XT0A 1UKEA 5EMJA 4DS3A 2XGSA 4KR3A 3FX3A 2FR8C 2YJTD 2BEVB 5I7FA 5F3WB 1RZRA 4BVFA 2ISZA 3BWGA 4NCIA 1EVYA 5ALGA 4HSRA 1BIFA 2I2CA 4GI1A 3KR0A 2GCIA 4PSAA 3ODPA 4HW0A 3DEYX 1EWRA 1RWOA 4XB1A 5CFPA 2P9JA 1DKQA 4R1UA 2B4AA 1SUPA 2J7PA 4ZVSA 1E2UA 4H6PA 2FOWA 3F5SA 1DC3A 3ETEA 4LLLA 3HKDB 5JFTA 2V7PA 3ELUA 4MTCA 4L9TA 3EPLA 3N0RA 4MV5A 3V1UA 4RM3A 1XB2A 1AKHB 5JDIC 2IS2A 2NP7A 4AYBA 1L5WA 3AR3A 2YC2C 1LSSA 3E9DA 3A4NA 4LHSA 1DAOA 4I46A 3LM8A 3P9YA 1IYZA 1QKJA 2FMTA 3O1JC 2DKNA 4RLSA 1OCOH 3D43A 4X1IB 5BVHB 1LNSA 2ORIA 2RE8A 3DLBA 2OESA 1VLHA 3DZCA 4D8WA 4A16A 4AKEA 3A9TA 2YXDA 1QB7A 2JLCA 1ZBQA 1T4MA 1H42A 4KPFC 1U2GA 4XWOA 1IB0A 4J16A 3BFPA 4RD4A 2OMEA 1EH7A 1R0KA 5CIYA 4O1IA 1KEUA 3LP8A 5JNVA 3HV0A 3ET4A 1JH9A 1L2TA 2WZBA 4K6OA 4LJ8A 2ZRQA 1TWHJ 4N5NA 3TGPA 1GPUA 5CG2A 3PSIA 4YB8A 4HQKA 5DSXA 3ROEA 5CDYA 3M2PA 3RVMA 3JWHA 1ETVA 3IQXA 3L8GA 3N2LA 4X20B 2GCOB 4LYHA 1VPWA 2C8JA 1IBCA 5TPWB 4K6KA 2J9FB 1M6YA 4W8HA 1LVUA 3W8DA 1WZCA 1MTOA 4M71A 2DR3A 5ALNA 4MYSA 3B3GA 3G6EI 1XU7A 4XVUA 3BR0A 4DLTA 2FJUA 1CJUC 3B1ZA 1Z4NA 5CFZA 4F2DA 3QELA 3LBYA 5JEDA 3T35A 3AR7A 3SLGA 3INTA 2OLJA 4BLPA 3IQGX 4YT2A 1QHGA 1U0GA 3SHOA 4A73A 2Q0SA 2W0SA 1LBHA 3X1KA 3R40A 3GLRA 3CLTC 3VGPA 1A4XA 4F4HA 3GJSA 2XX3A 4LMYA 2P0AA 2C88A 1YX3A 3Q98A 5CA0A 3CLQA 2PE5A 1PUXA 4LJ7A 3P4XA 3QU9A 4QGAA 1ZM4A 1UBOS 2V8BA 4IIUA 4MSUA 1NUUA 4RB2C 2ICAA 4PJ0C 2VTBB 3ROGA 3HOZJ 3AZPA 1XEXA 1Y4AE 4D3FA 2PZEA 5TY0A 1ZUNA 2QTCA 1KU6A 4NZZA 2R5ZA 3I4NJ 1T5BA 4LEIA 1LBQA 4P3PA 2IHNA 1FQJA 3PUXA 3PQCA 3LAPA 5FTLA 1T8PA 4OYYA 2R93J 1GKYA 1BWSA 1Z7WA 3FPSA 2BKLA 2QG6A 3LDHA 4LYYA 1X74A 1PBTA 5J4KA 2P3QA 1LNQA 4KI7A 4XDYA 1Z77A 4PLPA 4JYBA 2FQ4A 3IDFA 5IKOA 2BJVA 4Z7NB 4CUZA 2R7WA 1FYKA 2VJBA 3U3OA 3KQYA 4I50B 1JQ5A 4M3EA 3LT0A 2D1TA 4HV4A 2GVNA 1ZG1A 1ACIA 5DEOA 2X4GA 1ZVJA 4A82A 4F04A 3TG8A 1XELA 3KVRA 4DUGD 1BW9B 1XRLA 3LUFA 2RHBA 5DISB 3KQNA 4DY4A 2GBYA 2Q1SA 4YMVA 2OENG 5B66C 1C29B 5ALEA 5JYEA 4D41A 1L7VC 1ETKA 3DZ8A 4B48A 2XLCA 1TVKA 1SQSA 4QVIA 1T9ZA 2YRXA 2HK9A 2R2GA 2O03A 4C7XA 4MXDA 3OSUA 4GMHA 5LGUA 1RESA 2Q3FA 1O1YA 2IYVA 5HVNA 4C4XA 2HI0A 2QR5A 4MI3A 3EUFA 1G42A 1YFJA 3D4BA 1VJDA 4J01A 1W25A 3PRJA 1EG2A 2BR3A 4HWTA 4FOSA 3GZ6A 1UMDA 5CBPB 2JIZA 2ZBDA 4D6XA 3ZQ7A 2DFTA 3KB1A 3OIDA 1ZARA 1QOPB 2ECBA 4FFDA 4G0ZA 1UP6A 4J43A 2ZSEA 5IXYA 3FBNB 1PR2A 1B6TA 4HRYA 4YJHA 4M87A 4DMGA 3VDXA 2Y66A 4DZJA 1LDJA 2ZXFA 2PA3A 3M6IA 4BWYA 5P8WA 3PC6A 1FSHA 4IQJA 1JUSA 4FFOA 3QV1A 4JWKA 4H08A 4J9UE 4F56A 1QIDA 3QYJA 4HQMA 2PLNA 4JP8A 5LP6A 3EBLA 2KLBA 3WLPA 4LFCB 1TA9A 3W8NA 5IK2A 5HHTA 4E1VA 3WWDA 1Z83A 2Q07A 4BKUA 2VHEA 3QF7A 4KO8A 1GU7A 5GAJA 1MVNA 2A1TR 4HH1A 4G97A 3LH5A 5CMLA 2P4UA 1U7XA 3DLHA 4Y6GB 3KQSA 5ALPA 2W83A 1ZINA 1SG9A 1Y5RA 2FRDA 2XDAA 1NUPA 2YS6A 1LRLA 3MUEA 2ZULA 1PS8A 3RHFA 1T5SA 1QU2A 4QOGA 1P0CA 1EFTA 1L9XA 2JHFA 2CJWB 4DCNA 2UYQA 1NLZA 2GPAA 3BILA 3GPLA 3RCBA 3IDAA 1EV7A 1YC2A 3PB3A 1ZGBA 4A1FA 3GNTA 1YR8A 1TZLA 3HHEA 5CIWA 3N9IA 3THYB 3G49A 1IC8A 3SZ3A 2UAGA 2EIXA 4JLSA 5EERA 4HX5A 4LQ4A 1X3WB 5AWFC 3OZBA 5H59A 2B5OA 2OCPA 1VGQA 4HP8A 3DOFA 2V7QD 3DZBA 3MJVA 3X2FA 3PFYA 1G20A 4M9XA 1ZN8A 1Z25A 4ZVNA 3MLEA 4O1MA 3GFRA 3IPAA 3EIXA 1JXOA 1O4VA 3DEAA 2FWNA 4PS1A 1MRZA 3P2MA 1BQ3A 3CCFA 2ZNYA 5LRRA 1YHYA 3KIOA 1ZAYA 1NHAA 3K70C 2Q7XA 3CMCO 3FFTA 1F8XA 2HD4A 4Q34A 2A1UA 4UARA 4E5UA 4W97A 1TDJA 3WZLA 3KR2A 1FJLA 5IT4A 1EXWA 1CVLA 3UQYS 1J8DA 5KOJA 3DFUA 1N7IA 1GTG1 2R7MA 5JNSA 2FWAA 1AQNA 4WESB 4Y2RA 1XFDA 2BEUA 1ZK1A 4TMKA 2GS9A 1Q6ZA 3O9VA 2DQZA 4D97A 3K1ZA 4D5FA 3GW2A 4OAQA 1AS0A 5TGZA 3LC0A 2X77A 2ZKLA 5CHEA 3SR0A 3OQPA 4GLJA 5ADVA 1OAOC 2C7VA 4DMUB 2BBYA 4O0LA 3T0IA 3AHDA 4EKYA 2VXZA 1UBTS 1LPPA 2I8AA 4FX4A 1ANKA 1JT0A 1NVKA 3OTGA 4NHEA 3PQ4A 3B53X 4ID3A 2A84A 1PW5A 3C6YA 3JZDA 4LYEA 5M34A 3ZWQA 3RAFC 2KZVA 3DTKA 4LVNA 3VJMA 2LRHA 2OORC 5B7PA 2QUFA 2B2NA 4FX0A 2VHVA 5B1YA 1JDBB 5D86A 5KC9A 2ZFWA 4CG0A 2I76A 5EIXA 1EFPB 5IOZA 4RS3A 4ZVKA 4EITA 1Y3BE 2HU2A 2VQFB 1RHUA 2G08A 2XB2A 3GBGA 3EXFB 3HDGA 1J9EA 4Z9BA 3JATA 3HYRA 2EFNA 4WX2B 2VRNA 4RZQA 1ZU4A 4EB3A 1ZJZA 2GHTA 3TO7A 3VYUB 4JR2A 1T6SA 1TIPA 3LPCA 4CF7A 3ECHA 2AMFA 2YCBA 2AYYA 4WN9B 4HNUA 1YS6A 1XVVA 2FE4A 2RGGA 2OV8A 4J2OA 2FDRA 2HVRA 3KHSA 1OROA 3ZV6A 1Q0LA 4RPGA 3SQXA 3D2BA 4J16C 2DGDA 3WHCA 3W2EA 1VPLA 1BE6A 3PHLA 3U1TA 1MW9X 4U7HA 1EA3A 4N0MA 1E64A 3CRVA 2B7EA 4YFNF 2E1PA 4EJ0A 4ZDKA 5KYYA 5KQGA 4GDMA 3CF6R 2AMLA 4NIMA 4EYKA 4Y2VA 4LGWA 3FPFA 4PO8A 3GUUA 3RREA 3JQAB 4ILKA 4F55A 3D0KA 5G0VA 1VQNI 3ZU2A 4ENNA 5DWDA 4DLBA 4NYJQ 4WMLA 2M87A 5EY5B 1ZG3A 2CRGA 1YZHA 2AI1A 1A1SA 3ROFA 2FG5A 1V9SA 3MJCA 3K9TA 1KQNA 4JY7A 3RQSA 5IMBA 4HQNA 3BHNA 4E2WA 4TTTS 3U7IA 3S8PA 4OOIA 2V7EA 2ZRIA 3ML1A 4PZJA 3ZKAA 1MW8X 2VDWA 3BCAA 2VPIA 1PR3A 1XT6A 2QAGA 3C5WP 5CEFA 2JLAA 2EEPA 2BBSA 1TWAJ 5K6RA 1Z3YA 3OZIA 1E8NA 1U5BB 5J3LA 3TUIC 1A9PA 1XCGB 2GHQA 2XADA 5J8FA 2G09A 2QTWB 2C6YA 2R7OA 2IUYA 2Y1LA 1OYWA 2GLOA 2JJ7A 5HQ3B 1W76A 1U9OA 1DIGA 4DQVA 2JBAA 4C20A 4I1IA 4QUIA 3EXAA 4BZZA 2OQGA 3RK4A 1IOVA 2M1XA 1TECE 1DI0A 3IHTA 2ZRKA 3U4GA 5BW6B 3IEKA 4LVOA 4BO5A 4CKYA 4ZCIA 3CMYA 3R6TA 1RXUA 2WHRA 3PI6A 3FZQA 1IDOA 2FEMA 1FPMA 2YS7A 4DRXA 5DLPA 1PEKE 4PYOA 4N03A 4UB6C 1OCEA 2I4RA 3KPJA 2V7BA 5IASA 5BQ5A 1D4OA 2VHXA 3KZZA 1G3WA 2EKBA 3UIEA 4C0KA 1WJGA 2Q45A 4JQOA 4YRRA 3IVMA 5C53B 4I3HA 3QI2A 3U37A 1KOLA 2VJCA 1Q17A 3BSYA 2EFPA 5EI5A 3G02A 5J1SB 5I7VA 2H08A 4R8RA 5K99A 2DMRA 2JVJA 1KO4A 1JU9A 5B55A 1E5LA 3ZLUA 8GPBA 1R64A 3N2IA 4I1UA 2H9IA 5JAMA 4EG0A 5IAKA 2CV0A 2PLWA 1W4BA 4K81B 2H6BA 4LBVA 1Q0PA 3B7PA 3JAMZ 5B58T 4TVOA 4KO1S 2XMPA 5K7FA 2O14A 2P7HA 1Q3KA 1K27A 1MMDA 3F8FA 1ODCA 3KEMA 4V0RA 4OQQA 3UM9A 2AFVA 1H8ED 4YIRX 3PPYA 4K1LA 4R81A 2IS6A 4MTEA 3OM9A 1PR1A 1AA6A 2R8EA 2CGPA 4AJ4A 1QTIA 3ONEA 1IUFA 4J1SA 1QYXA 2Q5EA 2HYJA 3ZQGA 5ERIA 1HL7A 3RYPA 4R2LA 2OF7A 1TKRA 3Q3GE 3LY9A 3QXHA 1N9KA 1L7AA 2Y1EA 5FI0B 4IDDA 3A3NA 1XA4A 3ORHA 2D6FA 4CN8A 3R3WA 3OS0A 3P9SA 2QM8A 2LFBA 2VHTA 3NHJA 1MJNA 4BV3A 3RD5A 4RQUA 3DMTA 1E3EA 2BZTA 1B8PA 1FA9A 5CB4B 3OFNA 4R6XA 3ZYCA 3UK7A 3U3XA 3HH8A 3UHJA 4EM0B 4H3SA 1JHAA 1UKBA 4JFRA 5GONF 1QRTA 2ZKZA 2ZIFA 4G7OF 4OMCA 1XSDA 3FUXA 4CXMA 1I7PA 1DWUA 4CE6A 2UUOA 3OJCA 2VPXA 3VFZA 3K4LA 1D2CA 5C4JJ 3AJRA 4JLUA 3ILHA 3W2AA 2H18A 3IO3A 1V35A 2DFPA 3CT4A 3HO8A 1HKUA 2WJGA 3W6KB 5LP6C 2IH2A 2IRWA 4FT8A 4C88A 4HNSA 4IIJB 3ANTA 4M9CA 4AWXA 2JLZA 2J5OA 3SCZA 2UYOA 5CD9A 4D9JA 1DTWB 2WD8A