3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
b'KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
molecule tags Transcription
source organism Thermoanaerobacter ethanolicus
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
5EINA 3A06A 2NS0A 3JYPA 2A69F 2EJVA 3IQDB 1LDYA 3TSCA 1H9TA 3IIEA 1UR5A 2RC4A 5DBIA 3BTSA 4LGVA 1JVSA 1T4BA 1ULYA 2HJRA 3ZNNA 4A6DA 3HRTA 3Q5FA 5IN5A 1IF1A 2NU9A 4RPLA 4CR6A 1E7MA 1W0CA 2CMDA 3PI7A 4OIQF 4MPDA 4GLOA 2Y1GA 1GL3A 5L4NA 1R4NB 2GCGA 4IXWA 3RUFA 1LDNA 5CPFA 3KEOA 2E82A 3CEAA 3ONEA 4IPTA 4Q3CA 5IT9K 1EBFA 1HW1A 2CGPA 4EBFA 1R36A 4RAYA 2EKLA 2DBQA 3OJOA 3SXYA 2EJWA 4BO5A 2OU2A 5T6BA 3C3WA 4R01A 3H3JA 2YYYA 5ADHA 2ACJA 4Y13A 1B15A 3U5TA 3AAFA 2JCXA 4YJDA 3C7CB 3HOTA 1Y1PA 4HDUA 1E7SA 2BMAA 2IRWA 4GL4A 4HFNA 1L1FA 1E3LA 4DL9A 1GY8A 3ENNA 2FBIA 3AOGA 2XAHA 4Y15A 1TVEA 1KYZA 3F1LA 1E3EA 1JAXA 3HWRA 4J9VA 4BKRA 1SD6A 1ENOA 3OJLA 1K6JA 1ZARA 3R61A 2QENA 4IRGA 3V1YA 3FWNA 5T64A 4MVJF 3Q0EA 1YB4A 1DP7P 2J5KA 1T2KA 5FI3A 3C7AA 1P0CA 2BH9A 1FP2A 1YG2A 5KVQA 4BO4A 3DC2A 1C1DA 2QX7A 1O94A 4DMMA 4MNUA 1DC4A 1QLHA 1X13A 2NVUB 3EDPA 4BNJA 5B12A 1JXSA 3I5MA 5JY1A 1JGSA 3F6VA 1XSVA 4JROA 5LDHA 3BIOA 4WEQA 5CEJA 2E1NA 1CQIA 4CR7A 3NT2A 3BROA 1A7KA 2Q1TA 4G8XA 2IXBA 3GYHX 3WTVC 3W8FA 1LSUA 2V6FA 1Z6ZA 2GA1A 5FFXA 2XAFA 5K6AC 3N74A 2VRBA 5MGBA 2G82A 1K3TA 2PD4A 3TL2A 4M71A 1HXHA 3JQFC 3VVBA 3C7JA 1Q0LA 2QM3A 1OMOA 4BIIA 5IG2A 1D3YA 1NP3A 4FJ2A 4Y9DA 4RVHA 1U3UA 2JT1A 1B8PA 1TI7A 1KEPA 2Q49A 2Y67A 4NH4A 4UEOA 2HDHA 4XIYA 4OIRF 3VHRA 5K9ZA 2Z9OA 2X9VA 1BM9A 4BH9A 3UVEA 5JO0A 5THKA 4FW8A 1DAOA 1OBFO 2DPHA 2VWHA 1B9NA 1YW9A 5F1KA 1IZ9A 4OO3A 4YBZA 4BUCA 1NNUA 4MVJM 2JPBA 1X0XA 1GV1A 1SFXA 2FMLA 2P4QA 2XGXA 3RBZA 3QWHA 3ECOA 1J7KA 5GZ6A 5BSGA 2A07F 4W99A 3GLXA 3MTJA 2QRKA 1I24A 3H8VA 4JLWA 2L01A 2VWPA 5L7YA 2D1VA 1PGJA 1TW2A 3BHJA 1XG5A 1PZGA 1XMAA 4UULA 3SZPA 4R79A 5DD8A 1V8BA 2AE1A 2KIFA 5GZ1A 4D7AA 4AJIA 4DC1A 1EQ2A 2JD1A 3D3WA 1LLCA 4YT8A 3F3XA 3IKTA 4J3FA 1R6DA 3DZHA 5CEFA 2VHZA 2DQ4A 2BE5F 4NU5A 4BNLA 2VONA 4LN1A 5BSFA 1WDKA 2GZ1A 3WGYA 4URFA 3I4FA 1FBQA 5LBQA 3QWFA 1R15A 4ND5A 1GD1O 1IOLA 1U1IA 4JNKA 1UXHA 4YAJA 1SOVA 3U4DA 1KEVA 4RGBA 1ZRFA 5LHGA 3ECHA 2B5WA 1UXGA 3OETA 4F3YA 3L4SO 3QV1A 2AG8A 2EFQA 3GO5A 1OMIA 3ZNQA 1YW7A 3H2ZA 1VI2A 5JFOA 4E2XA 3CO6C 2J8ZA 2ZB3A 4PLCA 3F6OA 4XDZA 2EB7A 4Q48A 2UUPA 4FFOA 2I99A 3T0YA 2FBHA 2CVQA 3VKVA 2CUKA 4G2NA 3MQ0A 4WCGA 5A3JA 1MGTA 3L6DA 3S2FA 2UVDA 5FLXK 1ID1A 2HKXA 1I33A 1RM0A 2ZK7A 4XA8A 5TT1A 4M55A 1Y81A 4XR4A 4ZRNA 3DBVO 4YJFB 1VSVA 3V5NA 3S1LA 1SOWA 1Q0QA 3DV8A 4HQMA 4J4TA 4EVIA 2J3HA 4ND1A 4AIKA 1EDOA 2AXLA 2EV6A 2VC1A 1B16A 2UAGA 4CUKA 3A9WA 3EYYA 4LLGF 1YO5C 5IDWA 2VRCA 4HF1A 4YIFA 5CJ9A 2XUBA 4QECA 4CUJA 1QYDA 1B1BA 3WGGA 1V0JA 3EQLF 4HBLA 4HF0A 2VWQA 3PYLA 4JJGA 3GGOA 4JIGA 2AS5F 5JDCA 1X7DA 3I9JA 1K6XA 3O9ZA 3PQEA 4U6QA 2YV1A 2VQ3A 2FPPA 4OYRA 5JE8A 3VDRA 3ZU4A 5A9RA 2AMFA 2VYNA 2GYYA 3EK2A 4FSHA 4H15A 4XKJA 1LJ9A 4XYMA 2BHLA 2RNJA 1G6NA 4I7HA 3G73A 1KA8A 1XGMA 2JCVA 3ICPA 1BMDA 2DTRA 3P9CA 1PS0A 1D1TA 2AQKA 4PG4A 3I5UA 3H9EO 3QU3A 2DI3A 5E18F 1F4KA 3K2BA 3CDHA 3JTHA 1YDEA 4OM8A 4M6YA 5HDKA 1NAIA 3IP3A 1GEGA 3AJRA 1QNTA 3EZYA 5H6RA 4MQVA 2O8XA 1ZGAA 1U8RA 2V6GA 3RKYA 2A35A 2FU4A 1ZCJA 4JQCA 2ZTVA 1I1SA 2Q45A 1GEEA 1YYVA 2WWYA 4L74A 3GR6A 1AHIA 1VRWA 2XAGA 3WJAA 5DD4A 1UZMA 1IUKA 4NHJA 3F47A 2B4TO 3RC9A 3MJ4A 2LF7A 3FF4A 3VOSA 5KK1A 1PL6A 4AVYA 1GZ3A 4N0BA 2W2KA 2ZB7A 4IM7A 1QGPA 1AXEA 4IDGA 2AEMA 3U2RA 1NBOA 3WU1B 1JKFA 5FLXZ 4UHTA 2HK7A 2H94A 3ZWNA 2JFGA 1EUDA 2C82A 2JD2A 3ZMSA 4G7OF 3DMYA 5IXYA 4ILKA 4NQZA 4P4LA 4CM7A 1YDWA 4BNKA 5IDQA 3R60A 1J0XO 2HRBA 1X14A 3GUCA 2R6JA 4EJMA 4PZJA 2V65A 2JKVA 1GVJA 1EEHA 1FK8A 3HE3A 4ENJA 2QBYA 3WBBA 4ND2A 1HDCA 2DPUA 2PQ8A 2PTGA 3ZWYA 2STTA 4CMAA 1K5HA 5LGUA 3FD8A 1SNYA 2DFDA 4YB8A 5HVQC 2H27A 1LSJA 5T67A 5BPDA 2JL1A 3U3XA 1R1VA 1GCUA 3HG7A 4LB5A 1VE9A 3GAZA 3LT2A 1V3FA 3WSWA 3X2EA 1ONVA 5EEGA 4BO1A 1DHTA 2HZTA 2AEJA 2O3TA 1XB4A 1KGSA 3MJSA 4UVHA 1H6AA 3DP7A 3K1NA 3FWZA 1VJTA 2PZJA 2LDXA 4XQCA 3ZQ7A 1DPGA 1GAEO 1OAAA 2VBZA 3F23A 2UDPA 2X4GA 3HDHA 5ICEA 1BHSA 3SC4A 3ZN2A 2VYND 2X86A 4CV3A 4NFYA 2WE8A 5E1XA 3S2EA 5HWSA 3NUGA 3ZMTA 3ORFA 4HV4A 5A5FA 1FPQA 2GAUA 5K5QA 1I2BA 1UDAA 3KRTA 4KP7A 4AJNA 5FEUA 4LG0A 1QYCA 2P4WA 4PZCA 2K86A 3Q1LA 3ZCXA 2E1CA 1I6XA 3H9GA 3JQ9C 2XV4S 3BMCB 1YTYA 3DZGA 4GQAA 2EJRA 4UXNA 3PTZA 1WI9A 3BTVA 3W8DA 1EUCA 3RUAA 3RC2A 2O3FA 1RKXA 2DLDA 2HEOA 2PLAA 4A2CA 4ZZDA 1I3NA 4KNYA 1H9BA 3ABUA 1RJWA 4WXHA 3SQNA 1CF2O 3DO5A 4CM4B 2HSDA 3I64A 4EDFA 1LQTA 3D7LA 3GHYA 3PPIA 2C6YA 4DUPA 5DCWA 2O61A 1B6AA 1EUZA 4U6SA 2V6CA 3U9LA 1HRDA 2VE8A 1S3JA 1BI1A 4EM1A 1ENYA 3ADPA 3WGOA 2B83A 2CFXA 2ZMEB 3M1AA 4J1QA 1EFLA 5EESA 5JR3A 2B69A 3UF0A 2D0IA 4I09A 4ZZLA 1HE5A 3GFGA 4O5VA 3I1JA 3JQFA 9LDBA 3IHUA 3J80K 5JDIC 5E17F 3ROKA 4FN4A 4RAZA 2UUOA 3LSYA 4EMSA 4FFRA 3L77A 4XYBA 1IN4A 5L3ZA 4C7KA 1UP4A 2M87A 3A1NA 3FN4A 3SBOA 1H93A 4I5DA 2YFHA 3D64A 3DEYX 1E1KA 4BMVA 2OHXA 1YQAA 2NM0A 3PHLA 2GUGA 4WLEA 5ICMA 3PWZA 5DBFA 3WTSC 1VL0A 1ZEMA 3FI9A 4L0QA 4PG5A 2CDBA 2XKPA 3GZ6A 4J7UA 1OYYA 4HV6A 2F5EA 1O6ZA 4J49A 3WNVA 2QVOA 3PFFA 1YGYA 3SFZA 1P0FA 1LC3A 2X5JO 3GG2A 4KT5C 5BSHA 1IXSB 3QHAA 8LDHA 3INTA 2GZ2A 3AU8A 4MP8A 1GZ4A 4ZVVA 3U09A 5CVJA 4PLPA 2G9WA 4KIBA 1KVQA 2Q2WA 2YPRA 3GY0A 4Z3KA 5BQFA 4BNXA 2RHCA 5HS7A 1WVGA 1AGNA 3U49A 4PLYA 2DAPA 2P5VA 3DXJF 1O3RA 1RWBA 2MLKA 2GN4A 4L0YB 2IYPA 2JD0A 3AU9A 4N5NA 3SLGA 3FMRA 1K78B 2FR1A 2JFHA 4WE3A 3KP3A 4P4GA 3CUQC 1ZFNA 2KIMA 3PK0A 1GPDG 4IDBA 1SD4A 3DAGA 3QPTA 4RF4A 3HSKA 4KQXA 3W4IA 1T2AA 5J8CA 3AW9A 2KJBA 1N1GA 1YOVA 2B4QA 1YS6A 1U3WA 4LK0F 1A71A 2W98A 4IJWA 1PS9A 1U2GA 3QWBA 4JXKA 4XD2A 4J1SA 1K6OA 3V1TC 2P6SA 3ICCA 4BO0A 3Q2KA 4EUFA 3AK4A 5D5WB 2OFPA 3K9TA 2D4AA 4EJTA 3I9LA 2AQIA 3K1MA 4MIYA 5DUKA 4R1UA 3VPGA 1FXSA 3FNFA 3OICA 5AVOA 2ZNYA 4G94A 5FFFA 3WTCA 4RPGA 2VZ0A 4LCJA 3HRSA 1LEBA 2OBNA 4FR5A 4RDHA 3BMOA 1WWXA 4NFSA 4CMCA 3WQSB 4CMJA 4KMUX 2OBPA 5FF9A 4Z6KA 1YE3A 1TW3A 1MB4A 3G49A 3M1LA 2R7DA 4EV0A 2EKPA 3R3SA 3PRJA 2YQ5A 1EZ4A 2FNPA 2B35A 5KVCA 1E0DA 2QZ9A 3DZJA 1HKSA 2W4QA 1SMYF 4NK5A 5E1WA 1KQ8A 3PHIA 1T6SA 3P2OA 1DJNA 5DT9A 4TQGA 1ZK3A 3K1PA 3DXFA 3EDMA 4QEDA 3HRUA 1L0OC 2FRHA 5JSFA 2I67A 1DUXC 6PAXA 3PJDA 4HX5A 1RIOH 2G0TA 4PLZA 3NT4A 2XXJA 3RROA 2V79A 3HB4X 1ZW1A 4Q39A 4ZQGA 2X4HA 3WGZA 4GAEA 1UXJA 4OKIA 5CAEA 1P1IA 4D45A 1CGPA 1H9AA 2O3JA 2ZO4A 1YBMA 4ITUA 3VVCA 1TLTA 3IMFA 4CQMD 5I9LA 4LK3A 2IVMA 4RGXA 3JAMK 1T2EA 1WDLA 1W6UA 2F5CA 2GF2A 5BS6A 2ZTUA 5JY6A 1BI2A 4IRHA 2TMDA 5LGNA 3GFLA 1P1JA 1PGOA 3E97A 3P19A 3R0IA 4GMFA 1W5SA 2UXXA 1MX3A 3OM9A 5GY7A 3SEFA 5DV5A 4WK6A 4ESFA 3VH3A 2IA0A 2X8LA 3K8ZA 3SZTA 2IP2A 2F5DA 3LC2O 4YIIA 4JQFA 2AE2A 4FOSA 3ZNOA 3IRRA 2TMGA 1A9YA 2A5YB 3CUOA 1BVUA 3WTWC 1GQYA 4WCFA 2XKOA 1RUOA 4HUJA 5ED4A 4IIVA 1BIBA 3MEQA 2O4CA 1P1FA 3TRIA 4YAGA 3OIFA 1PJCA 2EGHA 1UHMA 4LMYA 4OH1A 1PTJA 3J80Z 2VC0A 3PWSA 5J23A 1I0ZA 2EFNA 2DVMA 4WPGA 4CLXA 5C37A 4P9UA 2QZZA 3DBLB 1I5ZA 4NFHA 2ELHA 1RYDA 3BAZA 4G7ZF 4Y67A 5TIIA 1GYRA 4XQ9A 3RDIA 2H9IA 4I9HA 4ZN6A 1RYEA 3L4BC 3B1FA 3SJ7A 3Q6IA 3TOXA 3WOHA 3TOBA 1KYQA 1YBAA 3ANMA 2ISZA 4HFMA 1AOYA 3INGA 3WYBA 1CDOA 2CFCA 4KDPA 4J43A 3MZYA 2X0IA 2QZ8A 5CLSA 3FCOA 4NBWA 2F5FA 3UGKA 3ZU3A 4E31A 3JQCA 3GW2A 4ZH4F 3NJ8A 3HRMA 3BWGA 1EH6A 5CVRA 1E3WB 1IAWA 3JQAD 3EVNA 3T4EA 4D79A 1JN0A 3ROPA 1U3VA 4EJVA 1R16A 1E92A 2WJPA 2HKIA 4CPDA 3QVWA 1FF9A 3Q9UA 2J5PA 5G4KA 2QRJA 4U0YA 1UJMA 3RASA 4FT8A 1O9BA 3F8BA 3FSRA 2IJLA 5LHHA 3MTGA 1QKIA 1W7PD 1P1KA 2BEOA 3QP6A 2V7PA 5DP1A 3H5NA 5JI6A 5CG2A 3GN2A 3UXYA 1P33A 3KV3O 4IPAA 4WF2A 5KJCA 1U2WA 4K2EA 4CHUA 1RI7A 1O3SA 5D6EA 1D1SA 4M49A 3HSFA 1B3RA 1PJBA 2CSUA 3MJEA 1KVUA 1C0PA 4FJ0A 3WIDA 2X9NA 4O1MA 4HADA 5CP8A 1YXMA 4NU6A 3P9KA 3DBRA 1NVGA 4IGEA 4RGUA 4Y8VA 2BD0A 2WDZA 4E33A 4EQQA 2OZ6A 4RB1A 1NTOA 1FDSA 1J75A 1KVRA 2BGCA 2P7VB 3E6DA 1NQ5A 3H3FA 3SHFA 1PP7U 4XJSA 2RH4A 4R9SA 1LXCA 3CE6A 1PJSA 3FF5A 5TNXA 3S8MA 5I7FA 3GC6A 4HWKA 5ICCA 1G0OA 5HS4A 2CY0A 1U6GA 2ET6A 2WC2A 4U0JA 1DIAA 5LRRA 4PFJA 3U0BA 3EAGA 1D8JA 4OXYA 4CMIB 3K30A 2P91A 5TRDA 3KB6A 3X2FA 3E1KA 4JBAA 3CTMA 4LVUA 2A68F 2Y05A 4I2OA 2W90A 4BKUA 2EFOA 1Z73A 4LVCA 4R41A 3GK3A 4E5YA 1XD7A 2ZJ2A 4XDYA 2OOSA 1C1XB 2HMUA 3K2EA 4Y17A 3K6JA 1HKTA 3SVTA 2IEBA 1W5TA 4E5PA 4GI2A 2BFOA 1H6BA 1C14A 2BRUA 4IGFA 5A02A 2H6EA 4YYZA 3WODF 1K89A 3MWDB 4B09A 3DWFA 3SXPA 1YQXA 4YT4A 2C0CA 2DBBA 4HKTA 1KETA 2JCYA 4R9RA 3RPUA 1KEUA 1SD7A 1ZAOA 1L3LA 2VTEA 1FLIA 3TWOA 4HDVA 1VPDA 3AWDA 4FBGA 4OKNA 4HP8A 5C3MA 1TQPA 3HHGA 1B14A 1U4SA 2IODA 2IZ0A 1MGOA 1Z7BA 4HNGA 3RKRA 5A5EA 3PHHA 4MEXF 1UZLA 2O7SA 3E48A 3KLNA 2ZYAA 2JHGA 3V7SA 4Q4ZF 1U8XX 2EKQA 2I3AA 1I30A 3IS3A 4HFRA 4DLLA 1JA9A 1BC7C 2XRNA 3DL2A 5I9NA 3D0OA 4CMIA 5BOXA 3ZWCA 3RTRA 1I1GA 4E5MA 4QWQA 1LX6A 2XIGA 1F8FA 1M66A 3ZMZA 4CMGA 1IXRC 2PMUA 3ZGYA 4DTIA 2K27A 4B8WA 5K6AA 3GVAA 4F7ZA 2K7LA 1J0RA 4ZQFA 4BO2A 1NPTO 4WUVA 4CM9A 1P2FA 4WCFC 1KC3A 4EM0B 2J3JA 2HDCA 2GASA 5ITWA 3AY7A 5JFRA 4RF2A 3JSOA 4TRNA 5LGTA 3QVOA 1NVTA 4GO1A 4OU0A 1X15A 3NV9A 4PZEA 3ZW8A 4R1HA 1E3SA 1YS4A 2Y1OA 3NGXA 4TWRA 5KNLA 1TT5B 1O8CA 1R4MB 2DBZA 3I23A 4DPMA 4XYEA 3GPDG 3J7AO 2R00C 3MJVA 4OAQA 4KZPA 8ADHA 4E3ZA 3DEUA 5E1ZB 3BMQB 4MP3A 1U5TA 3OEWA 2Q1WA 3I9NA 3QPHA 1JW9B 1O7LA 4I01A 1P74A 5EN4A 2DU9A 3TKYA 4AD9A 3Q2IA 5L3FA 1I3MA 4IRIA 1IB6A 5D8KB 1Y8QA 1Y9EA 1ZK2A 4F6CA 2HGCA 4BNMA 2P5UA 1LQUA 3BHMA 4FFNA 1KERA 1IY8A 2O48X 5ILOA 4Z9XA 5ER9A 4CYDA 2Z1NA 3HDQA 2GQQA 3WTYC 4Q3NA 4QSMA 4XX0A 4NBUA 1TNSA 1V3UA 3I6QA 3T7EA 2EA4A 3FM3A 1PGNA 1E3WA 1R0LA 2PZMA 3KUXA 4IJVA 1S29A 1M75A 3NKLA 4IQ0A 3TF5A 1E1NA 3CLOA 3IRQA 1BDBA 4L76A 5U9CA 2FN7A 4CGZA 3IOYA 4IDFA 5TGDA 3C24A 3TZKA 4NZ9A 4CLRB 4DMLA 4N54A 1ADCA 5L3BA 5T8KA 4D0PA 5A06A 1ZMOA 4OIMA 3C7DB 1BTOA 5HDGA 1X7HA 3OQ1A 4R1SA 1SO8A 4R16A 2XAAA 3WR5A 4EJOA 2QRLA 2ZYGA 4CM9D 2DTXA 3GEGA 1MKMA 2QQAA 3K73O 3C1TA 3EY4A 5IXSA 2QWWA 4WWCA 4XB2A 1ZRCA 1I01A 3UCEA 4PLHA 2FXAA 1XYGA 2I9PA 4DQVA 4Z2YA 2O2SA 4YAEA 3W6JB 2OMEA 1I10A 4YFXF 2O23A 2YQ4A 4PGHA 4BNCA 3CZMA 4ZRMA 2G7UA 4AJHA 1VKOA 2M30A 1S8NA 4WGGA 2AQ8A 4EITA 3M2TA 3DBHA 4MIEA 3ROMA 4DWVA 4WCFB 3VH2A 3I59B 1CRWG 1DBVO 5EERA 3PWKA 4E2YA 5JLAA 5CEEA 2Q4BA 2X5OA 1C0LA 1ZVMA 5H81A 4B3HA 2NNYA 2MC3A 2CF6A 1E5LA 4OQZA 1GXPA 1FDTA 3TJRA 3PIIA 3VTFA 3B70A 2RBEA 1I2CA 3GFBA 2Y1DA 4O63O 4L9VA 4GXOA 4D41A 2V6BA 1NVMB 3H5AA 4ALLA 1TTYA 2BF7A 1ADGA 1SPXA 2QQ5A 3MJCA 2M5WA 4FCCA 3ONFA 4Z9FA 2FSVA 4ESBA 3D4NA 3I52A 3W8EA 3N97A 3L0DA 3P2YA 3T8RA 3TZHA 2AEFA 1JKIA 4R4JA 4WLOA 3O26A 1B26A 2HFHA 3HZZA 4NBTA 1R0SA 4RGRA 4Q9NA 3QRWA 4INAA 1SAXA 1QBJA 4G65A 4B7CA 2PKRA 1E17A 4OIOF 1YIOA 2QQ9A 3H3ZA 4MEYF 2QHXA 2A61A 4H16A 4G9YA 1J6UA 1ZJZA 4E2WA 2P5KA 3WB9A 4ZYDA 4YRAA 4OMUA 1X1TA 1PS8A 2Q50A 3EYWA 4G5HA 1I32A 1ML3A 4OXKA 3ZWXA 1G0NA 3OQBA 1ENZA 4BGIA 4W9NC 4LK1F 3LFKA 5CYVA 1JAYA 4YTEA 1AUPA 1DIRA 5L9AA 3KVOA 4EGZA 2VT3A 1XSDA 1DPRA 5FO5A 1EBUA 1WMBA 4QFDA 4QTZA 5ITVA 5ENVA 4M87A 1PWXA 1PZHA 4I0AA 3PFWO 2Y48A 4HOBA 2CF5A 3BPXA 4FX0A 3DF8A 3JAMZ 2HRZA 2VUTA 1HSOA 3BMOB 3H7AA 1KY4A 1O89A 1XLTA 1XDSA 1ZXLA 4FD3A 3UCFA 3ZWVA 4RJTA 5KCZA 1H6CA 3KP2A 4EUEA 1KU7A 5L3GA 1ZJYA 1ON1A 1F12A 4J91A 1LC0A 3KP6A 4E4YA 2NQ8A 1YB1A 2FRDA 3BOQA 3OP4A 1Z6TA 3RFTA 2R7FA 4DBZA 2GD1O 1QO0D 4B8XA 3JSAA 3FMSA 1JKJA 3AY6A 2A92A 5JYDA 2O4UX 1CQJA 2Z1MA 4ROSA 3H92A 3V2HA 5E8GA 2E49A 3WX0A 3GVCA 3H2SA 4IBOA 3OHSX 4RVUA 4P55A 1PP8F 1B7GO 5JCXA 1YOVB 1ONPA 2EWMA 3GFIA 3TNLA 4CUZA 5LRSA 4FFLA 5KJFA 4R1TA 4OQYA 2M45A 1O95A 2RDPA 3D4PA 3IP1A 3BTUA 1H2BA 4N5MA 3RFXA 4OGWA 1U5TC 1FJHA 2WMDA 5F5NA 1UAGA 2L54A 2H63A 2Y1FA 3AI3A 4A10A 3LK7A 1VL8A 4A5OA 4HF2A 1SMKA 2X1HA 4OXNA 4DQ2A 3O8QB 4RF5A 2O3QA 4RVGA 5B4UA 2PMHA 1JTVA 1HQCA 2FSSA 3E6AA 3ETEA 1W4MA 4ZD6A 5L45A 1ZLJA 3HTSB 3ISPA 4DNCA 2C20A 3GDFA 4YA6A 1NXQA 2CSOA 3I9MA 3RYPA 3HTUA 3EHEA 1CEQA 3NJ4A 3PLNA 5HS8A 3M8EA 3RIHA 4J1NA 3LQRA 1HETA 1E2XA 4LCEA 3KZZA 4RV9A 1VTNC 4OMYA 5GMOA 2XHKA 1RM5A 1BOAA 1IXCA 4HYEA 5JDIA 3SJUA 5T5QA 4AJLA 2HYFA 2W85A 2UYYA 2UV8A 3TO9A 3L7WA 5KVSA 2AHRA 1IHYA 2EHDA 3GMSA 1SB9A 4IS2A 1UUFA 1BWSA 1O0SA 1LJ8A 3T5XA 1NAHA 2NTJA 3GDGA 5HA5A 5K0ZA 2R2GA 3BTOA 4GSLA 3BDDA 1PIWA 3B6ZA 1K7AA 3E6MA 1L7EA 3I59A 2W57A 3ZP5A 1N7GA 3GH3A 4J16A 3GFMA 1I3LA 4CLDA 1FP1D 4IF4A 5L95A 3BMNA 2V1XA 3N7UA 1NR7A 3DPTA 2V1DA 3ZU5A 3EYIA 4MVJE 1T25A 4F6LA 5A03A 1PJ4A 4YJHA 5EPOA 5F3RA 2IA2A 2VBWA 2ZMEA 4NJOA 5K5OA 2B0LA 5ILSA 3JQGA 1AN9A 3E9MA 4J2OA 1BC8C 1FOKA 4R68A 3ROQA 2XXBA 4B4UA 3ZWMA 2NADA 2P5LC 3GVHA 1DC6A 3WNQA 3GEMA 2ZNZA 3U1DA 1H0KA 4R5HA 4BMNA 5KJ1A 1I2ZA 3FM5A 1HLPA 4L75A 3VZRA 3H9UA 3ZH2A 4CM8B 5KKCA 3HYIA 4BNFA 4EZBA 1W7PB 2PR2A 4GCVA 4WOKA 4U5QA 1OYIA 2MBFA 2KIUA 3M8FA 1P4XA 4K6FA 3AOEA 5EQDA 4GWKA 3F22A 3IWFA 3QY9A 2DTDA 1E1LA 2X23A 1CF7B 4CLRA 3T7CA 4MHGA 4AJEA 3K2ZA 2G17A 4XQGA 4DYDA 3ZWPA 5KJ6A 4R5MA 3L2CA 1WZEA 3ERED 1IN6A 3F5QA 2G7HA 2FE3A 4M9SA 1XR3A 1WLYA 3FNEA 5A05A 4ND3A 4DLAA 3HN7A 3O3KA 3OOPA 4LG0B 1QSGA 4XIJA 1LRJA 2FZEA 5TSDA 4AG3A 4BQRA 4CV2A 2KJCA 4KUHA 3LAPA 3KLMX 2OXIA 5FB2A 1Q7CA 3V4GA 2I76A 2JAHA 4XLPF 2I6TA 3GZ4A 4K1LA 4M8SA 1Z91A 4U7WA 4PLWA 4CMKA 3EUWA 2HCTA 1MUUA 2R00A 4ON0A 5AIQA 3QA9A 5DNAA 4UV8A 4S3MA 1Y9AA 4FX4A 5ICFA 4N5LA 5FI5A 4PRKA 4NBRA 5LDGA 3O6BB 2AA3A 1UDBA 1ON2A 2PNFA 5KJEA 1NYTA 4KN7X 3E82A 1SC6A 3EC7A 3IKVA 2A4KA 1TBXA 5JAMA 4WX9A 4BO3A 5F64A 3QIVA 4QX6A 3K96A 3H65A 2VT2A 3OIGA 3Q9NA 1LNWA 2LDUA 1R4MA 3GHHA 2JTVA 2WV0A 1DLJA 4XYGA 3U4HA 4EUHA 5ILVA 2GGSA 4IDDA 2RAFA 3JYOA 4P22A 4IJKA 4G7HF 1T2CA 1T98A 3GEDA 1QG6A 3INRA 2NTNA 3NX4A 4A12A 2QBYB 2FPGA 3NDIA 4E70A 2J5OA 4UV9A 4U7BA 5HLHA 2UZKA 1ISMA 3ZZNA 1TQMA 1ZXBA 3D5QA 2EV0A 4CLHA 1HZZA 5L40A 3PQJA 5ES3A 3JQBA 2DC1A 2D59A 3DZBA 1KVTA 1KEWA 1GQ2A 1EV7A 3F3SA 4PVDA 2EK5A 1SFEA 4ZYHA 3RCBA 1RNLA 1HTBA 3UFXA 3FNHA 3DZIA 2YW9A 4HXYA 4CXFA 4E5NA 4O5OA 1PGQA 3CMMA 3G1TA 2B5VA 1V35A 1K2WA 3GMDA 4KIFA 3ULKA 1EE9A 4RCVA 4MDHA 5AXDA 3KSUA 1W8DA 2J5QA 2HTJA 2WEKA 1P4AA 4H7PA 1J9IA 3LAJA 1HLDA 1PSDA 2I5PO 4YWJA 4IJUA 3PJGA 1VSUA 4YT5A 3FR7A 5AXCA 1MJBA 5HS6A 2KRFA 2ZKLA 2ZQZA 3GVIA 4JBGA 1T38A 1QYWA 2IA1A 2L3DA 4D3DA 1YH3A 4ZICA 3ELKA 4L0ZB 1QXSA 1U2DA 3SLKA 4RB3C 2YDXA 6ADHA 1M2WA 2H5LA 2BV6A 2NU6A 1R23A 1DLIA 4WLNA 5IJZA 1GZ6A 4CO8A 1Y8RA 2AXQA 1C1XA 5DZSA 1PJLA 3UN1A 2C07A 1PR3A 1HE4A 4RDIA 3ZHYA 4L9RA 3M6IA 2LDBA 4R54A 2FSWA 3F8CA 3WWYA 1ZH8A 4FQ8A 3VFZA 4I0BA 5A1TA 2Q99A 5L4LA 1JLLA 4WASA 2HMSA 1Q1HA 4UVAA 2AG5A 2EP7A 5IN4A 5B4TA 3F9IA 1J59A 1XELA 3CZRA 1HYGA 4CR8A 3KETA 3JCZA 1QQIA 2WD8A 3ZMDA 1ZLKA 1I36A 2PH3A 3KTDA 1AHHA 1Y8QB 2FMYA 2Q4EA 3CMCO 4BGVA 5KTKA 3J81Z 3RC1A 3HDJA 3WFJA 1BXGB 1YW8A 4U0WA 2P4HX 1ISIA 4BXUA 1Z75A 1U5TB 4RLSA 1BGVA 1NM5A 3TQHA 6LDHA 4KICA 2QIOA 2CD9A 2PK3A 2NV6A 3DHYA 3VKUA 1QZYA 3GDOA 2HAEA 3WSVA 5DBGA 3ZV5A 4L5JA 2HR3A 3MJTA 3QSGA 4K6CA 1Q1NA 2BFMA 5COAA 3WS7A 3KP5A 2ESNA 3QRFF 2O6GE 3E8XA 3HFSA 1VKNA 1UP7A 2WD7A 3N58A 3TQNA 4JK3A 4AJJA 5BNFA 3F4LA 4L73A 4MINA 1NFQA 3IAHA 3ZMUA 5D4RA 1PEDA 3AOEC 1HKUA 4JP3A 1XGOA 5LEKA 3DTTA 4EJUA 4PGFA 5J6XA 5G4KB 4E21A 3D5LA 3CUKA 2DFVA 3NRCA 5IZ4A 4CDGA 3NDRA 3IJRA 5E8IA 1NQOA 1YVEI 2Y66A 4TV7A 3JQDA 4AJKA 3W1VA 1O7FA 3KYBA 2JRTA 3KYCB 1G3WA 1F5TA 1XU9A 5JMPA 1BI0A 5CFZA 3REOA 3PYXA 2DFIA 4OMZA 1A7AA 1WMAA 2QUFA 1T1RA 3EW7A 3GLQA 3I83A 5U4QA 3WMWA 1JU9A 2W2LA 3DHNA 2FQ3A 1VJ0A 2ZBKA 1UH5A 5BSEA 4I5FA 3WXBA 1R1UA 5C5IA 1KY5A 5TJ9A 2CQKA 2C5EA 1V6AA 5TJHA 1EMDA 3R6DA 4NNJA 1FMCA 1GADO 2K4BA 1A4IA 3LA3A 5EJ2A 4KN4X 3VODA 1ISGA 3KLOA 1PQPA 1PU2A 5A9SB 3CIFA 3DB2A 2B36A 1FX7A 3NYWA 4Z9YA 1BXKA 4BB5A 1OOEA 5I8WA 2NUAA 2PBIA 4WOJA 1J2XA 4RS8A 1X0VA 3F6YA 4OSOA 5I8ZA 1ARZA 3WGQA 4E2ZA 1MFPA 4JBIA 2PFGA 3IUSA 4H0EA 2DBRA 2RKHA 3HQ4O 1LBEA 1FT9A 4XGKA 3DKWA 2IYOA 3GT0A 4PZDA 4M1QA 3ZMVA 1UAYA 1Z74A 3JW4A 3FHZA 3FHLA 4TKLA 1HDXA 2CDCA 5H82A 3JQBC 3RI3A 3QE3A 3R6SA 4B3IA 4K28A 2DK8A 1EK5A 3PXXA 2J6IA 5C7OO 2YR2A 2POQX 2XOXA 5BT9A 4M72A 1D8AA 2GA2A 3OSUA 4GH5A 3VC7A 1DRVA 4W7HA 4BKOA 3FPLA 4M73A 1B9MA 5TJJA 1RPNA 1YQDA 3P5SA 3RWBA 2WD7B 4CV0A 3WTTC 2DTEA 2YV3A 4MVJG 2YX4A 4X54A 3FPCA 5LC1A 4Y98A 3ASVA 4PCVA 1GU7A 1HW5A 2CWEA 1F14A 2YJZA 4I5GA 1Z1DA 4A6EA 2HK9A 1PQUA 4S1VA 3OFSA 2O3SA 3VZSA 1LUAA 4PLVA 5ILGA 4NQWA 4MKZA 4CL3A 4BO6A 4KIGA 5IAAA 4R51A 3ULQB 3DHEA 5HRUA 1F06A 4HZFA 1UB9A 2IZ1A 3MWEB 4HX7A 4M9XA 1JE8A 3LT1A 3VH1A 3LC1O 2EW8A 1P92A 1B0AA 1Y0UA 1XSEA 1ZYRF 5EEHA 1ZIDA 4QUKA 4DRYA 1C1DB 4P38A 3PJFA 5JHUA 4BVAA 2VRCD 1W4ZA 1Z45A 3VDQA 4NDNE 4IXAA 1HSJA 2H6CA 4GGOA 2PN6A 4XLNF 1IE3A 3FMQA 1ZH5A 2JFFA 1MG5A 2ZJ1A 3QVSA 4L8VA 1ZRDA 2RCYA 2D2WA 2BLLA 4ALIA 1D3AA 3PFIA 2Z5LA 1E77A 3QP5A 1MC5A 1QV7A 4YEDA 1E3IA 1E6EA 1C3VA 1DEHA 1Y8RB 1D8KA 1YL6A 4TSKA 3KO8A 1NFRA 3VPHA 4P5OA 4A0YA 4I08A 1DC3A 3EGOA 4NB5A 5ENDA 3LT4A 1QR6A 3DMTA 4PCQA 3AI1A 3RJ5A 4RPJA 1DIBA 1E7QA 3CH6A 4A7PA 4FC6A 2VN2A 3D5TA 5EIOA 4YFNF 3AI2A 5D8LB 3L9XA 2X58A 4CL8A 1HDRA 3IC5A 4TVBA 4A0SA 4E13A 1SD5A 1IN8A 5DCFA 4YQYA 5A2QZ 4UNOA 1Z7EA 2GN6A 3COAC 2P8TA 2RV8A 2WM3A 1ORRA 3AFMA 4FFMA 4IINA 3NRVA 1HF3A 5IDXA 1T2DA 3BA1A 1MA0A 3Q3CA 1MZBA 2PKQP 2Q2EA 2OUIA 2MA3A 2OD5A 1EE2A 2Y0MA 3PGJA 4XQEA 4YR9A 1GDHA 4CLOA 1IL0A 5AXAA 1B2LA 2M1BA 1FBUA 1LDMA 3HSEA 1MXFA 5BMZA 3ANNA 3KLPX 4ALNA 4UVGA 2K4JA 4LISA 2NTVA 4LJZF 3KYDB 2Y0CA 2GN8A 2HYGD 3G1UA 4N18A 4MVJI 4AVPA 1DDOA 3VB2A 4PG7A 3K69A 2D2IA 4RGSA 2PV7A 2W2LD 3JQ7B 4BHCA 1LDGA 1JWBB 3MOGA 5B4VA 4BYYA 1LLUA 1KU3A 2HKOA 4YG2F 3RAJA 4BO8A 1GUFA 4Q3EA 3W4JA 2NACA 3L9FA 4FPXA 4Z0HO 1N2SA 4BO9A 2VNAA 5ERIA 4FJ1A 5A2QK 3JQAB 3RUEA 4A03A 3Q9SA 3ZHZA 3NEUA 3ITKA 3LF1A 4HX4A 1SB8A 4KWHA 1Z7UA 1BDMA 1DRWA 2OGUA 4E5KA 4PLGA 5HLGA 4Q3BA 2C59A 4ZA2A 5F1PA 1YL5A 3WTXC 4LB6B 1KIFA 1B4AA 5IT9Z 3MOIA 2FEZA 3H9JA 2PY6A 1E7WA 4PG8A 2HMTA 4OOFA 9LDTA 1U5CA 4BNYA 3SX2A 3PQDA 2FP4A 4D0SA 1ZO8A 4RO0A 3H9QA 2VZ8A 2A6HF 2QYOA 4ETSA 4A0XA 1CJCA 1T2FA 2BFAA 3PQFA 3GF2A 3JD4A 3D3EA 1V9LA 3ST7A 2WWRA 3FNGA 4RLHA 1USTA 3F8NA 1YB5A 4FGSA 1TQIA 4IHSA 1XDWA 2BKAA 3FBGA 1HL3A 3MCVA 3NTRA 2YUTA 2DLLA 1STZA 1XEAA 4ZGWA 1QYVA 5A9TA 4W82A 1U9JA 3G3EA 3KFWX 1I3KA 3OH8A 3ZWAA 1UXKA 4PLFA 4ALMA 5KWEA 2Z95A 3ZDFA 5U1PA 1BVRA 4QQRA 2NVWA 3O2PE 4KDFA 1R0KA 1LSSA 1U8FO 3K92A 3E6BA 1O3QA 4BGEA 1OPCA 4RL6A 4M74A 5LEJA 4RQTA 4UVDA 5IT3A 1A27A 3ON5A 3RUDA 2CNBA 4LW8A 3ML6A 2YSRA 4Q5SF 5K5RA 4CM8A 1N9GA 1M6WA 2C5AA 4KUGA 1IW7F 4Q3DA 4II2A 4J7CA 5IF3A 1ISJA 1DSSG 1JDJA 4OOEA 3TOZA 3MWMA 3RC7A 2L4MA 4WKGA 4BKQA 3FXQA 4UUVA 3QVTA 1KU9A 5L3CA 2Y99A 4O0LA 2PD6A 2ZTMA 2OZUA 3BY6A 4J0EA 4B4WA 3BMNB 4RPHA 5I7EA 5DYMA 4BNNA 4XRGA 3HN2A 1UDCA 1NPYA 5COBA 2MH2A 4GLLA 4HLXA 2V1UA 4WLVA 2C54A 3LYLA 3KZYA 2AQHA 2PLYA 1IRGA 1ZN2A 5D5UB 1PJQA 1TXGA 4Y6RA 4JJIA 2FWMX 4A27A 3GWZA 4DPKA 1WNTA 4O59O 4GMGA 4RORA 3GUYA 3P7NA 1ZUD1 1ISFA 4IQGA 3RYRA 3E5UA 1P4WA 1DFIA 4S04A 1QMGA 3KSZO 3NTQA 1SCUA 3O4RA 4CM5A 3K31A 4XR9A 2OQGA 3WIEA 1DB3A 4K26A 2Q1UA 2TDXA 3E3VA 3RUIA 4BNHA 3T4XA 3GF4A 3PDJA 4KOAA 4XEHA 5G4LA 2X22A 2A6EF 4Z0TA 2O0YA 3RQSA 4ALKA 3DAPA 1O3TA 4EGFA 5DCYA 1ZHFA 2FA5A 1CERA 3QJ5A 1WQ2A 3LT0A 3TFQA 3LZ6A 3FBTA 1JHHA 1A04A 3EETA 1D5VA 1T24A 5H83A 3UAGA 1R1TA 1TT7A 1U28A 4JX8A 3A4VA 1N7HA 4IUYA 1IPFA 5TQVA 2PGJA 1M67A 3CSDA 4XB1A 3C1DA 1PWZA 2COMA 4MVJA 1XA0A 4GSKA 4LFUA 4GGPA 3VTZA 1DIGA 3ETGA 2Q1SA 5L4SA 5AONA 1UXIA 2X6TA 3DFZA 3B73A 1SFUA 1DPUA 4GYIA 1OC2A 4L18B 1T0FA 3WLFA 2JSCA 3FXUA 2P7CB 4NI5A 1HYEA 3DDNA 4ZHSA 5GZ3A 3P9IA 4CMEA 4IMRA 2Z99A 1KOLA 4D44A 3E9QA 2LSOA 3DOOA 2J3KA 3ROUA 1WP4A 2FY8A 1T1SA 1CF7A 1S6YA 4AJ4A 2DO7A 4IZIA 3AUSA 4XZ3A 5CVIA 2IRFG 4CQMB 1YFHA 3VOEA 1ULSA 1LEAA 3E6CC 2EERA 1PJ2A 4C4OA 2CYYA 2C7VA 3ZU2A 2FHSA 5DOVA 4CODB 2ZYDA 4GPD1 1PZEA 1XDUA 4Q3AA 3B20A 2CW0F 2Y1CA 1WW8A 3TZ6A 3LF2A 2GIVA 2O03A 3WGTA 1HWYA 3NTOA 2E48A 3E5RA 1GPJA 3JQGB 3ZWWA 2ZB4A 1WZIA 3TOAA 2P6TA 3M1EA 1D7OA 1GYPA 2X7HA 3NEPX 3H3UA 4PG6A 4GX5A 2FOIA 1FDUA 2PWZA 2ZB8A 2EWNA 1WDMA 2OO5A 3CKYA 3UCXA 5ICSA 1U5AA 3WE3A 5THQA 1O5IA 3OJEA 1NHAA 3R0AA 1IZ1A 1S7CA 4YACA 2PZLA 3GRPA 1PL7A 4GVXA 3LSTA 4ID9A 1A9ZA 1P3DA 1VL6A 3STHA 4DXHA 4HAMA 1FSHA 1V3VA 5C7IO 5A04A 3C18A 1Z6RA 3O03A 2HS5A 1ZEJA 3HUDA 4TVOA 5FWNA 2BFPA 5KKAA 3MZ0A 2ETHA 4C7JA 1DC5A 1TA4A 1ZG5A 1ZK0A 2VHYA 3C85A 4XBFA 2PG4A 4EJ0A 4EGYA 2F00A 4PN3A 1LSOA 3C1AA 2FMUA 4FB5A 5BNIA 1U4OA 3KYDA 1ENPA 1ZKMA 4G81A 4ZQBA 2YDYA 3GZ5A 3O8QA 1T39A 5F5LA 4GX1A 2HLPA 2EG9A 4NJMB 4TMFA 1GR0A 4BO7A 4HY3A 4M6XA 2D5CA 3IC7A 4K9DA 5A4DA 2X0RA 5DDGA 5L7WA 1R66A 1I8TA 4DIFA 4RPKA 2IEDA 4D42A 2VHXA 4TRRA 4CZZA 2F2EA 1HDYA 1JVBA 1PJ3A 4FS3A 1TLHB 3U62A 1N9GB 4WNCA 1HBXG 1AWCA 1J4AA 1J49A 1XQ6A 3QOPA 1ZBQA 1WPQA 3D3WB 3BP8A 2XROA 4CQLA 5CDSA 4IDEA 1M76A 1RM4A 5D5VB 4A73A 3HJAA 4XRRA 2WTBA 5JO9A 4EW6A 3ZN0A 2NWQA 1YJQA 2VYVA 5JCJA 2W25A 1PZFA 3HIFA 1PGPA 1YWGO 3BJ6A 3DR3A 4II3A 4RF3A 4CJXA 3WU0A 4S05A 2DM6A 2JJYA 2OP0A 4WECA 1NX6A 4MKRA 5TRTA 2BI8A 2WTEA 4MOWA 2GXGA 4GYGA 1LI4A 3D4OA 3C1OA 3DQPA 3I9OA 5JXWA 3B02A 2YV2A 4MTEA 4RZIA 2KKOA 3BJAA 4M9ZA 1YJ8A 1WWKA 1HSTA 3RJPA 1BSVA 4NIMA 4LD5A 3FX3A 5LHIA 4OIPF 2Y0DA 1BXZA 2WYUA 4D43A 5JAZA 4HLYA 1WSUA 5T8KC 2HWVA 3JQ8B 2NRAC 4TZKA 4CV1A 3TFOA 1T4DA 1MDMB 4UVCA 4LLNA 5TT0A 1LQ1A 4EJWA 5DEQA 1G1AA 3KSDO 3PDUA 4KQWA 1MV8A 3PHJA 1R7JA 1SAYA 1TEHA 1IN5A 4EEXA 5CHEA 3FR8A 4YJFA 5I9MA 3N4MA 4IDAA 3MZHA 1ADFA 1LTHR 1TT5A 2O2YA 1F9NA 3ETDA 3DAFA 3M2PA 4UEKA 5JDCC 2OP1A 3RUHA 5JPIA 1HT0A 3KEQA 3ASUA 3NGLA 2Y0EA 1LDJA 4OJNA 4XWYA 4CMHA 1HYHA 4GGGA 1BI3A 1E7YA 4Q47A 1NHGA 4BL5A 4BHTA 4XRFA 3V7RA 5COQA 3IDSA 2I66A 4F45A 2PZKA 3U9GA 2B37A 2JAPA 4QXMA 1DAPA 1FWZA 3LVFO 1VM6A 5HDNA 1B59A 2JHFA 2RIRA 4XJTA 1D4FA 1EH7A 2HQNA 1NFFA 2EFWA 1HXDA 2VNSA 3ZWBA 4BNGA 4TROA 4AFNA 3E9NA 2PI0A 3FRJA 3JQ6A 1MD0A 1NPDA 1H94A 1XU7A 4U8GA 2C29D 3RBVA 2Y75A 3W6UA 1NWCA 3GNQA 4JCOA 4NR0A 5G0TA 4CLOB 4IJAA 3DOCA 4L9NA 4L5IA 2ZCWA 1CYDA 1Y7TA 1M6HA 4ND4A 2C2XA 4R3NA 5L7TA 4L9TA 3GXOA 2PA3A 4Y6SA 1R22A 5DUIA 2CDAA 1X3UA 5F1RA 3I6IA 1PUEE 1GV0A 2EV9A 2RQPA 2VZ9A 4BNTA 4BAYA 1JQBA 5HBRA 2ZCVA 3DZKA 3GNSA 4LGWA 2HU2A 5B1YA 4CLEA 1GYQA 4FGWA 2DUUA 4O3MA 1SZJG 2D45A 3GRKA 4J6FA 3CXRA 3G79A 1FBSA 2F1KA 1ISHA 4UVIA 4AJ2A 4CICA 3F8FA 2GXBA 3GOHA 3GNTA 4IQ8A 2C7GA 3W6ZA 4DLBA 4ZQHA 3WTZA 2CVZA 5TC4A 3RI4A 3UICA 3NAQA 4FOOA 5TF4A 4DREA 2W8ZA 3WLEA 5FYDA 5CPBA 3L09A 4AIJA 3PJEA 5IFLA 4XSZF 1N8KA 4HQEA 3W6KB 1G3YA 3PP8A 3WMXA 1NQAO 3KYCA 1PR9A 2FR0A 1ULUA 4TZTA 4ENKA 5JW6A 2LNBA 3GAFA 4CM1A 2HK8A 2VXZA 4BMSA 1YQGA 3BJOA 3LQQA 2HMWA 4EJ6A 2BGLA 1BBYA 3BHIA 3GX4X 3G0OA 2YHIB 4YDRA 3DZFA 2EXXA 3OJ0A 3KE2A 5FFZA 3HUGA 3JV7A 5D6FA 3R4KA 2GNAA 3RKXA 4RVDA 1HEUA 5BPIA 2IDZA 4IZHA 2K02A 4DBVO 3Q9VA 1N5DA 1U3EM 3KOUA 7MDHA 2GSDA 1G3TA 4QO7A 1LVAA 3WQQA 2DQRA 1PJTA 2GDZA 1HE2A 2HUNA 2P5YA 1MFZA 3EMKA 2GLXA 3GGPA 3JD1A 4NBVA 4YPOA 4J9UE 2X0NA 3ZN1A 4OINF 1XHLA 5KVVA 3PGXA 3DBRB 3HOSA 3ZI0A 3ZPLA 2ZKZA 4YFKF 3JTGA 2VODA 1XGNA 3JTMA 4MO2A 3WDSA 3KXDA 3V1UA 3I58A 1DDNA 4RZHA 2V9VA 4TRMA 3WTUC 4YVFA 4MIOA 5CVVA 1JWAB 4AIHA 3T1BA 1E1MA 4ASNA 2VTDA 2E7XA 1DXYA 1IYZA 1GUZA 1BXGA 1Z82A 3E03A 5DF1A 4IVNA 4CMEC 1GTMA 4DIBA 2RH8A 1HDOA 4MVJP 4OL9A 3TDUC 3UHAA 1VJ1A 2HO5A 4D46A 4MGRA 3AFNA 3LLVA 2O3UA 2PD3A 4DPLA 1H5QA 1IULA 3RKUA 3A14A 1XCBA 2BGKA 4J2HA 4J4HA 3V8KA 2VOOA 4RVFA 4ZU3A 4D0RA 4D3SA 1P77A 5I7SA 3KHUA 3QQPA 2DPDA 1XKQA 2ZFWA 2WSBA 1FYLA 1E3JA 1O57A 3TO7A 1H6DA 1U7TA 3OQ6A 1LU9A 1XQ1A 3ZV3A 1WKMA 4U88A 3AUUA 4L4XA 4O6VA 4B79A 3DQVC 2D5AA 3PZRA 4LRSB 5A9SA 5TLSA 4LMRA 3ZHBA 3PIDA 3ZHXA 1QLJA 3HDYA 4GVLA 5EQFA 2XAQA 5L51A 5JMWA 3J81K 2X9GA 3AUAA 2NQTA 4M86A 3F72A 3DBLA 3TGNA 3JYNA 4NG5A 3WWZA 2DBVO 1R4NA 2ZTLA 5G0WA 2LKPA 4HW0A 1ZK1A 1U78A 2MLGA 1EQUA 3FXRA 3M9AA 2YFQA 3WJ7A 1QV6A 2IE0A 3RVDA 3WYCA 2GWRA 3F21A 1KYWA 3EUHA 4OHUA 3I4PA 2J5RA 4YAKA 5IZCC 1R00A 1P9LA 4BB6A 5D5XB 1DFGA 4RVSA 3CO7C 3R0JA 1MC4A 5K1YA 5JAIA 4BNWA 4KYWA 3GGGA 4TRJA 4BNUA 1ZGJA 1XGSA 4BKPA 2ZXJA 1BN5A 1XCVA 4HNHA 4YT2A 3RJ9A 1E6WA 3L07A 3RUCA 3HFGA 3VZQA 3VZPA 3NDJA 4U0KA 4LSWA 2BYVE 1DO8A 2VOJA 3AY3A 3GPIA 4E0BA 5CDYA 1R5HA 1ZG1A 1H0MA 3L00A 1H2HA 4ENNA 2STWA 3W4KA 4U0VA 4QT0A 1LA2A 1QZZA 2IXAA 4GKBA 2VHWA 4Y6PA 1ZG3A 4BNVA 5F6FA 4MKXA 1GXQA 2OBYA 4IXTA 2GN9A 1R12A 3QWIA 1P45A 4QFCA 3TO6A 4R69A 1K79A 3LQFA 2GZWA 3VPXA 2IPQX 2IT0A 3E18A 1TNTA 1KC1A 1EDZA 2NU8A 4PLTA 4YQZA 3D0SA 3IL2A 3V8LA 5KIAA 2DQLA 4XCVA 3ONDA 3QP9A 2WYVA 3H6KA 3HB5X 3KCCA 3T8TA 1GUYA 3QVXA 1NR1A 3H5RA 3QWAA 1C0WA 2GERA 3I53A 1MDMA 4P8RA 1OKRA 2VCYA 3JQ8A 1K6IA 1USSA 1SEVA 3LC7O 2D3TA 4U7DA 4AICA 1N92A 3IJPA 1LLQA 2ISYA 3F1KA 1LDEA 4PRLA 4BV9A 1S7OA 2HMVA 3QW2A 5I7VA 3DMTC 4I8XA 1QPMA 1SMTA 2PGDA 3VEPA 2YHIA 1LDDA 4KMSA 4L4SA 5CDTA 4NMHA 2DT5A 2JZYA 4P9FA 3DTYA 1F1ZA 1KU2A 1C0IA 3WGHA 3S2WA 1KBZA 3LA7A 3DONA 3WE2A 2BI7A 2MD5A 1KVSA 3KM0A 1RZ4A 2EF1A 3OIDA 1VC2A 1G3SA 3BZ6A 5HOOA 3WTBA 3BZUA 2EP5A 4CM6A 2RN7A 1G4DA 3E5MA 3ANLA 1CWUA 4UUNA 4AJPA 1ONOA 4AL4A 4L9JA 2H6BA 1NWHA 4MJLA 4FHTA 1XWFA 4A5MA 4ONEA 1JHFA 1W7PA 2A3SA 2DW4A 4PDKA 2EW2A 1FYMA 2OA4A 2LF8A 5G0UA 4G6DA 3TDKA 2W84A 1UP6A 4J4BA 4CM3A 3EVTA 3JQ9A 3H4VA 4XGNA 4YRBA 4KUMA 2RVCA 5C7LO 1YLFA 3I0TA 1RUNA 3PYMA 5DOZA 4BQAA 1B8VA 3GVPA 1Q0HA 3ZV4A 2WE7A 2QLZA 3ZNPA 4R8HA 1YKFA 3R3JA 4NK4A 2P9CA 4MTDA 1OI7A 5CDUA 1K78A 1P1HA 1UCRA 2Z33A 4UUOA 1A5ZA 2O3RA 4KMFA 3L6OO 1R58A 1U7HA 4BOYA 1OZAA 1J5YA 3RD5A 3LA2A 1B8UA 3U4IA 3IWZA 1I27A 4IDCA 3TL3A 3P7MA 2FR8A 2YY7A 3VPSA 3F46A 4WLFA 1IN7A 4TKMA 4W4TA 4ZYEA 3DFGA 4D3FA 2BGMA 4YXFA 2EEZA 3LU1A 1ZREA 2P9GA 4LSMA 1CIVA 1Z05A 1FC3A 1EVZA 1GCOA 3F5SA 3AM4A 3I3OA 4YCAA 1HE3A 3LWFA 2YX7A 2IW5A 4QO8A 1EVIA 1UHWA 4G6QA 5G2OA 4I5EA 2G76A 2H1SA 3ABIA 4YRDA 4RQUA 1P44A 5DN9A 5AYVA 5L3DA 4JGBA 2SCUA 5DCMA 2ZATA 4XSXF 2ILTA 3RPQA 1MXHA 1SEPA 3RU7A 5JC8A 2ZCUA 1PL8A 3AM5A 1C0KA 2Q2QA 3DOJA 2P9EA 1FY7A 2CZCA 2OL4A 2VOPA 3VPFA 4DA9A 1SBYA 3I9KA 3PHGA 4XYLA 2HQRA 3FZVA 3CJNA 3K9QO 5D4SA 4BV8A 4BS9A 1XGKA 4KA4A 1IPEA 3L4BA 3KBOA 4MP6A 2NYXA 3SC6A 3RU9A 4ZQEA 2I3GA 4WEOA 1EK6A 4BNZA 5FGMA 2P68A 5MDHA 5HTOA 2DK5A 4O6JA 1KQ9A 1E7RA 1FDWA 5E20A 3KP7A 3ITDA 1PQWA 1LLDA 3GZNA 1ZNQO 1ZK4A 3O38A 1BW9A 3CTAA 4EM2A 3WGIA 1ZSYA 4MVJH 3ZW9A 1Z9CA 3ENKA 5IZCA 1FZPB 2FBKA 1BIAA 1BJAA 5ILUA 1LDBA 1X1EA 3GFJA 2WYWA 3KP4A 4CQMA 3CUQA 4ENMA 5A3VA 2GZ3A 5L53A 4I98B 2L4AA 4GKVA 4OSPA 4YJGA 5KOIA 2QG4A 2VBYA 3C3XA 5TS3A 3TN7A 1P1RA 4WK8F 1ZMTA 3CUQB 1Q7BA 3OJFA 4E32A 1EVYA 3G3ZA 2P2SA 4CQLB 4E12A 3M7GA 3QAHA 1BG6A 3GVXA 5LCXA 2Q2VA 4F46A 2NVBA 2XF8A 4GX0A 2JPCA 3V2UA 2RGVA 4QLCU 1MG0A 2D1YA 2DUWA 4DYVA 4DVJA 2ADUA 4J90A 4DQUA 3A28A 3GUDA 5FD5A 4W6ZA 3AM3A 4YJHB 4N9HA 3OV8A 1MJ9A 2FF4A 3E5XA 4KTTE 2PEXA 1V4RA 3K0LA 4HA8A 1DRUA 1A72A 2GR9A 3Q11A 3UH1A 4E30A 3OBBA 5CDGA 2PKQO 3MAJA 4PIVA 1Y5MA 4UAGA 1T26A 4A0ZA 5DULA 4GBJA 3LDHA 4I9NA 1Y6JA 3EZLA 4NJMA 3UUWA 1YS7A 1DHRA 3OECA 5EMHA 4N7RA 4I9UA 4UVBA 4KDEA 1MP0A 3JD3A 1REPC 4HX8A 2H09A 5DCMB 4BHBA 1HDZA 2X0JA 3TZQA 1IUYA 1VLLA 2GPTA 3WQRA 4ALJA 3DFUA 4B4VA 4RB2C 3MCZA 2RHRA 5AOVA 2ESHA 1GHCA 5BR7A 5CG1A 4HBGA 5ER6A 3V8BA 3GA0A 3TZCA 2BELA 3V2GA 2O7QA 3RFVA 4ESJA 5T57A 2YZ7A 4ZYGA 2PGLA 2ZJ0A 4LRTB 2O50A 3CPSA 2Q8KA 2VUSA 4P96A 4KUEA 3ADOA 4J1TA 1F8GA 1HW2A 2D1HA 5B37A 2XASA 3B1KA 3G17A 3OA0A 2FOKA 4DQXA 3HHHA 4JK1X 1BRMA 2D8AA 3UKOA 2EGGA 2QQBA 2UWMA 5ICGA 3C8MA 5JC1A 1LRKA 1ADBA 2XVCA 5BQTA 4N9IA 5IDYA 4LLLA 2Q46A 2Z5UA 5AXBA 1LRLA 4UREA 1OFGA 2YHUA 2VHVA 1FNNA 1FSEA 2EFPA 3HADA 4UVEA 1Q7GA 2HTSA 1IZ0A 1IHXA 5L3EA 3V8JA 1FYKA 3TDZC 3RKWA 2OORA 1H9GA 4UUPA 3OMLA 4CM4A 4BGUA 1AE1A 2Y93A 3FWEA 4BQPA 3I4CA 3I54A 1EVJA 4IIUA 4IS3A 4IY1A 5G0SA 2VE9A 2NNLD 2CVOA 4EI2A 1LB2A 4YJGB 1YRLA 2VBXA 2Q3EA 4B7UA 4MQ9F 3OA2A 4JJFA 4KWIA 3BMCA 4Z0PA 4BNIA 2UXNA 1OC4A 3S2GA 2NSDA 3ZWOA 1QYXA 4DGSA 3E5QA 3JYQA 1HSZA 4M54A 5DDIP 2XPCA 3PLRA 1ZZEA 2E4AA 4R3WA 2M8EA 4GWGA 3S55A 1BW9B 1DJQA 2X5KO 2I65A 3ABTA 4NHEA 4WLUA 3GZNB 1XN7A 1HZJA 5AIPA 4YAIA 3FTNA 2G5CA 1WXDA 1YL7A 2G1UA 4ESOA 3S2IA 3JD2A 2PFBA 2FNAA 1EH8A 1S7AA 4PGGA 2HQ1A 1NQTA 5EL0A 5TX7A 4HFJA 5J8FA 4B8ZA 2YU3A 5G0VA 5HM8A 2E37A 4ZJUA 3BPVA 2W24A 1Y5RA 5H6QA 4IMPA 3UOGA 1CETA 3OF2A 1HKQA 3I71A 1W73A 3OEYA 1MLDA 3MFKA 4IHTA 2FPIA 2VYVD 3BXXA 3JYLA 3HHPA 3JQEA 1N1EA 3PVZA 4CMBA 5JVTA 2A94A 2MH9A 3MEXA 2DPGA 3QU6A 2QYSA 3CINA 2L02A 1WRJA 1B3BA 1YBVA 1HDGO 3F4BA 4I02A 2J3IA 3L6EA 1ZSNA 3VAZA 2B0JA 2VUUA 4WJZA 3WFIA 4I1IA 3GEZA 2B4RO 1R37A 4UEJA 2ZQYA 4WCDA 4J0FA 5F1OA 3NQOA 1IRFA 3IUPA 1A4UA 3F8MA 2HOEA 1QP8A 3UW3A 3RBXA 1DIHA 4JN6B 1PDNC 5JS6A 3WG9A 3B1JA 1KQ0A 4W7IA 4AJOA 1NHWA 1J5PA 5LLQA 3GG9A 3TPCA 1EFKA 1FDVA 2A9FA 2GO1A 4A2UA 1X7GA 2E7WA 1RM3A 5KVRA 3DPLC 3PEFA 3DBHB 2E6UX 2W2KB 4GX2A 2OQRA 1S6LA 4Z3DA 4DC0A 2EV5A 4DIOA 3D1LA 2OZPA 1QORA 3AUTA 2CG4A 5JNLA 3L9WA 2NLOA 1LNQA 4HV5A 5JAQA 1L7DA 2Y68A 2DU8A 2EIHA 4AJ1A 2QW8A 5DP2A 1F17A 3HNPA 5HS9A 4P4NA 4EEZA 2Y1EA 7ADHA 1UFMA 1V3TA 1XIVA 4M89A 2FZWA 5H20A 3NT5A 4L4RA 1OR7A 3JD0A 4XGIA 2AW5A 2R3SA 5BNTA 1GQQA 1OYWA 2X0LA 4FFPA 4J7XA 3V7CA 4PVCA 1MJAA 2VWGA 2VOEA 1PX0A 1LDKB 1I5RA 1ZSVA 4WXCA 3ZV6A 1P6RA 4A5NA 5JBIA 2ZIZA 5F21A 3WYEA 1E5QA 1K0UA 3PQKA 1Q2XA 1ODDA 4KFCA 4FIZA 1XMKA 4JBHA 2Z3YA 2NNNA 4FDAA 2PJPA 1TB4A 1UZNA 1YONA 4EYEA 4WNIA 3VH4A 4BHPA 4NPCA 2HJSA 4RB0A 3K5PA 3WICA 4A26A 4JP2A 3JSPA 2BBYA 2OAZA 1DFHA 4B3JA 1F0YA 1LEHA 3COSA 4WXDA 3GN1A 2GRAA 2XAJA 5AQ1A 3U4CA 3RSHA 4OOIA 4UUMA 4B7XA 1DOHA 3HSRA 3KZVA 5JYEA 1XSXA 2EA2A 1E6UA 4FC7A 1U3TA 2QYTA 2VN8A 3RIRA 3BMQA 4LMPA 4E6PA 1P31A 3JQAA 3FTPA 1R5GA 2NAZA 2Q0OA 4R1NA 1ONNA 2CO5A 4H3VA 5CVUA 2NU7A 3WBFA 5FD6A 2IZZA 4W9NA 1QRRA 3PZBA 1G6KA 2C2YA 5JCJD 3JQ7A 3GQVA 4AWXB 1NASA 1KS9A 1GFSA 2V6MA 5DCUA 1WAMA 3BYZA 1AXGA 1YO6A 2DKNA 3LLSA 3QLJA 5HLIA 4KTVE 2DAOA 2NVUA 4MVJD 4B4OA 3R1IA 2PH5A
chains in the Genus database with same CATH superfamily
5EINA 1W93A 2CGEA 2JRCA 2NS0A 2DMQA 1BFDA 2A69F 4GT1A 4D8UA 4K2HA 1FU7A 1NKVA 3L82B 1RWXA 1USKA 3IIEA 3EGWA 3O8NA 2XCTB 2IY7A 5EP2A 4UTRA 1UJCA 9ANTA 1XKLA 3BTSA 1JR3A 3DDSA 2XWJI 2HJRA 3ZNNA 1Z5PA 4KRFA 3HRTA 1JEAA 5FO0A 2RAVA 3SX4A 1IF1A 4CR6A 2CMDA 4XLEA 1FMTA 4QARA 4OIQF 1B41A 1RADA 2C4KA 1AO0A 4GLOA 3DMHA 3RCOA 2V5VA 4QXPA 2EJBA 5KU7A 1VJGA 1X9GA 4KW7A 2WUFA 3F98A 1PHRA 5DTEA 4PR3A 2ZI3A 3RUFA 2VXOA 1D1PA 1V6SA 1XZNA 2CGPA 3HA3A 3EQ6A 2W6OA 1A88A 1MW9X 5J2TA 2DBQA 1GARA 3OJOA 3AMVA 3NH6A 1WCIB 4RKFA 4BV2A 3C3WA 2J6BA 2YYYA 1XTVA 2ACJA 3S1QJ 3Q7EA 5CM8B 3VOTA 1N57A 2JCXA 2R6R1 4KYVA 5EIHA 3W5VA 3KYIB 4ZHQF 2OM6A 2EZIA 3KX2A 3E3AA 3C7CB 5AJWA 3HOTA 3IT1A 4GL4A 5DTDA 1E7SA 2JA2A 2H08A 1L1FA 1E4EA 1NKSA 3OYLA 2NO1A 4U7FA 2FBIA 4OLAA 2I9KA 2WVJA 3AOGA 1L5HA 2PUGA 4NMMA 3ZY4A 4AU1A 2JFBA 2PSJA 2BI4A 2ZIFA 4PXYA 1TGYA 1VZ2A 1ENOA 1HT3A 3IB3A 1ULBA 2DCUA 3KJZA 3ORQA 3P8ZA 1ZARA 1UBFA 2G83A 3U56A 2IIBA 3DLBA 1JR3E 4UJ3A 3V1YA 3ZIAD 3ZDYB 4D57A 1ZC4A 4MVJF 2VXCA 2YY5A 3Q0EA 1ERDA 2J5KA 4Q5IA 1E2GA 3C7AA 4UDXX 3V6LA 4XLTA 3AKYA 4C43A 3ZQHA 2H4YA 4ZI3A 2OD2A 2QMYA 3EDPA 3WV5A 1G59A 1JXSA 2B6NA 5JY1A 4KQHA 2NO5A 4BWVA 1JGSA 4MWGA 3F6VA 2IYYA 1X58A 5BXYA 4CL2A 4YO8A 1CQIA 2A0KA 2Q6OA 3IIMA 3LY8A 3KIOA 4B3GA 2OXCA 1XTJA 3CHYA 2WT8A 5BWBA 3DYVA 5AVZA 5MN6A 2BCGY 1LSUA 2BKEA 4E6KG 1L4GA 1QA6A 2X1CA 2VIIA 2Y2UA 3M5PA 3TR0A 1T34A 1XJ0A 2OY0A 3EXAA 2XAFA 3U26A 2BONA 4M3NA 5K6AC 2WB1N 2CDRA 1PFYA 3JRXA 4IIJF 4QSHA 4JQSA 2PL1A 4Q9IA 3PIRA 5D7NA 1K3TA 4CCMA 1RYMA 4JU8A 5C52B 1HXHA 2EX1A 1SKBA 1KP9A 1Q0LA 3VVBA 3H2HA 2H7YA 2QM3A 3WIBA 5C1OA 4P0TA 4CYCA 3HMKA 4RVHA 2WIKA 5FWYA 2DT6A 1NY6A 2HRQA 4AUMA 1QNLA 1PYVA 4MV8A 3WLQA 2PXCA 4Y18A 2IU3A 4US0R 1IV8A 5EKXA 1O97C 4QQ8A 5AM1A 5JO0A 1OBFO 4L5BA 3I6YA 3OCUA 2VWHA 1PUFA 5F0HA 1B9NA 1NZJA 4QJ3A 1O7JA 2ZUCA 3DDCA 1SVLA 3EXG2 1P9RA 2ZSEA 3NUZA 4MVJM 4L08A 4XNFA 2P4QA 2QVYX 5KYXA 3RBZA 4KI0A 2OYRA 1JKRC 3BE5A 1U1DA 2HUPA 2BFCA 2FLVA 5GZ6A 3ZWKA 4X62B 4ARIA 2B6HA 3MTJA 3QEMB 5AKGA 4OQFA 4XWOA 1ZKDA 4Z4HA 1PW5A 5MGNA 3H8VA 1C9YA 1SXJC 2L01A 1DTWA 1VHQA 1YCGA 2VWPA 3MBKA 1PGJA 4W5WA 2H1FA 5L7YA 1N2GA 4JX6A 1EX7A 4FZ3A 3SZPA 2XYHA 3ESYA 4CNQA 1G9XA 3SVZA 5GZ1A 1A31A 4Y9TA 3ELYA 4AJIA 1EQ2A 2IPXA 2JD1A 1LLCA 3WQBA 4D43A 3GAMA 5K8IA 3ABLH 4P5PA 1X7XB 2Q8NA 4KEAA 4URWR 3G5AA 1T4MA 3FIUA 4B3AA 4PX2A 2E5FA 2BE5F 4NU5A 3OZTA 3L01A 4B85A 2V7UA 1Y48E 3K0FA 4OQMA 5D2CA 1OWPA 3UMYA 2ZUEA 2PGAA 3K7AJ 3HB1A 2VAMA 5C5EA 1NY5A 1U0SY 1F2TB 4B74A 4ND5A 2R5ZB 1R15A 2R8EA 3QWFA 4TV9A 3HG9A 2FETA 2ZUWA 1HY3A 2VRWA 2V0CA 3BWYA 4L9WA 4YAJA 5JFTA 1AHPA 5LP1A 3EZFA 4YEJA 2DRIA 3NWTA 2O8CA 2B5WA 1T1EA 1UXGA 4PXSA 3NYRA 1JDUA 1W35A 2PBZA 2OHHA 1UJ6A 3GLHA 4MGYR 4QUEA 2BF4A 2BZSA 5BV0A 1Z6YA 2BTEA 1CFZA 1R5BA 4AO8A 2G04A 2RJNA 1YW7A 1WP9A 5EHXA 2BXZA 3MXTA 5HKOA 3D8TA 1B8IB 1VI2A 3A1TA 3CO6C 5DEIA 3ZY2A 1BJKA 2PS9A 4MR7B 4Q48A 2HF7A 3ICQB 2I2CA 3JVEA 2P79A 1XEFA 3CR8A 3ZOBA 1E79D 4G2NA 4WCGA 4FIDA 1G2OA 2GF0A 4YNBA 4JH0A 3WB1A 1MGTA 4BN5A 5A7FA 1Q15A 3LY7A 1K5GA 3IH4A 2HOAA 2NV0A 1LFBA 3MCUA 2VJLA 1NUPA 1U0LA 5TT1A 2QE6A 1HGXA 1VSVA 1JR3D 1XRQA 3S1LA 3TQQA 4GF5A 4FB4A 5JZVA 4EVIA 1JF8A 4AIKA 1EDOA 2XJ9A 3HBMA 4PTZA 2EV6A 2UAGA 3H0GJ 2W6PA 2YWCA 3L0ZA 4LRXA 3EYYA 4CUKA 5IDWA 2VRCA 4HF1A 2WILA 1AQLA 2OXEA 1CY4A 4TYQA 4CUJA 5CX1A 1V0JA 3EQLF 2H9YA 3WL5A 4MS1A 3RAFC 2MT9A 4UBIA 2G77B 1EVKA 3O4JA 1K6XA 4JLDA 1E18A 4RACA 2YASA 4OYRA 5LA6B 3W2IA 1YSCA 1L5NA 1KZYC 1UKZA 1JHDA 5IMSA 3D6FA 2GYYA 1UOQA 2NXNA 4H15A 4XYMA 4XD7A 2BHLA 3IQIX 3R7FA 1VMAA 4B3RB 3IAAA 4B82A 4PANA 4BAGA 1FXUA 3K4JA 4BCDA 4QYSA 3P9CA 4PONA 5KI6A 2W7NA 2AQKA 1Z8FA 3AI7A 1F4KA 2DI3A 5BV7A 3CDHA 1L7OA 4LJ6A 4OM8A 1KSHA 4LV5B 3MINA 1NAIA 2YXLA 3K8OE 3BD8A 5AVVA 5KPDA 2X6OA 5H6RA 3CU5A 1K2VN 5U4QA 1E2FA 4YRRA 1VQ9I 1ZGAA 3QU5A 4UQPA 4TZ6A 3NW9A 1ZCJA 1WU7A 4XFKA 1I1SA 2HI0A 5C8DA 1G18A 4RCYA 1AF4A 3STUA 3DHWC 2AJBA 2I4RA 2ZJ3A 5DD4A 1M2OA 3F47A 3PKIA 5E38A 1OBOA 2B4TO 2LF7A 3FF4A 4EI8A 3QOEA 1RYHA 3F6EX 1G291 3OYIA 2FPMA 2JVIA 2WA0A 1QHIA 3Q87B 2FRDC 2I1QA 4K88A 3WGVA 3VR3A 4IM7A 4AN4A 2D2FA 4DTCA 4EFLA 4TLMB 2AEMA 2Q5OA 3U9TA 2XRMA 5I47A 3ZWNA 5CVDA 1EUDA 2C82A 3Q3JB 4GRAA 3PNLA 4AX4A 4NQZA 2QRZA 3VR3D 2FPXA 1DCFA 4HDQB 3GFFA 4QUGA 3HJGA 3FDIA 4TUYB 4CKZA 4EG5A 5LVAA 2Q8PA 1QCCA 4I1VA 4RELA 4B6OA 3C87A 1A8PA 1NF2A 2ZU6A 5CLLA 4H6XA 2Z3WA 4JHLA 4CTMA 4O4HB 4R31A 1XHEA 3UMCA 1HDCA 3HYLA 4DZJA 1T35A 3A4LA 3GTMJ 4IZZA 1BWPA 1W88B 4PYIA 1WULS 2JH8A 3L1UA 4RK6A 5EYPB 5JAOA 5KDDA 5LKRA 2X3YA 2Z2KA 1CQZA 4AIIA 2Y92A 1IG3A 2ZIWB 2ZM5A 5TEVA 2MSWA 4RC9A 3LT2A 5HZMA 4I4NA 2DWUA 2KDOA 4BO1A 4Q9JA 1EUDB 4QDJA 4UVHA 1OSNA 4RETA 3FNQA 2RHBA 1YHZA 1VJTA 2RCNA 1QV9A 3KOYA 4XQCA 1DPGA 4YFYA 2X4GA 1NLZA 3HDHA 3OLYA 1XLTC 5ICEA 4U9UA 2ADOA 1K8XB 1GVHA 2BZ0A 4QRHA 1UBUS 2EZ4A 4CV3A 5DNWA 3CCVI 2BZGA 3TLGB 2WE8A 3ZDQA 1M2OB 3NUGA 1IBMB 4GR5A 1F2UB 1ZN9A 3O8CA 4ZQCB 3NLLA 5K5QA 2XMCA 2R4UA 4KP7A 4ZI2A 3QMPA 3WNDA 4W5OA 1JEDA 3NOVA 4GMHA 4TQAA 3N75A 4ZZ3A 3Q1LA 1APLC 1ZR4A 2DXIA 3J7YJ 3CUVA 5AVUA 3R7NA 1EFHA 1L0BA 5LQRA 5A7GA 1WI9A 2Y27A 4KDRA 5JS8A 6ADHA 4W63A 4B34A 3SGLA 2PLAA 2MCFA 2QTFA 1R5OA 1UIMA 2ZYSA 4KNYA 1MBGA 1HPLA 2P3OA 3U7FB 1BJRE 3DGEC 5ED0A 5EWLB 5FRMA 5IJZA 4ER0A 2C6YA 3QZUA 4FX5A 4LNUA 2CEAA 4UPEA 5LU8A 4DV3B 4ZI7B 4F3RA 2CSXA 4Q4AA 3GAAA 2V6CA 1Q7EA 3K0BA 4XDGA 3HU2A 3UPUA 1BI1A 4EM1A 1EAYA 2NO7A 2OTLI 2CFXA 2B83A 1EFLA 1S3IA 4BQQA 2B69A 3W1EA 5AICA 4D8YA 1YMVA 5JQGA 3VRHA 1LS1A 3X1WA 4O5VA 2I4MA 4E6EA 2IDKA 1Q1QA 4OUDA 3U17A 4ER6A 4URVR 1W1WA 4QJ4A 4RAZA 2E4WA 3KEGA 3AQ4A 3L77A 1UP4A 2M87A 2BW0A 3FN4A 3NBZC 3C8DA 1N0VC 3DEYX 2OHXA 1YQAA 2NM0A 2QK4A 2RGXA 2XGGA 3C5CA 3FNIA 3PHLA 4JLUA 1KO4A 1T5OA 2V54A 3FI9A 4N6NA 4UM9D 3IKMB 1MX1A 3CW2A 1M6VA 2ZSKA 5T41A 5KYWA 4N41A 1JXOA 1RAGA 1Z4MA 5JD5A 2XMSA 3K0CC 1B8OA 6NULA 5JXHA 3PFFA 1VFNA 3MRSA 2QM8A 1GU0A 1OJ7A 2X5JO 4O4HA 5LN1A 3MTIA 3BTJA 2EKDA 4QPDA 5BSHA 3RYCA 1G1MA 4H0NA 3N70A 3QBJA 4R8MA 3JTEA 5HSGA 1TJPB 4YMUA 2F3TA 4TUYA 4KRGA 4KIBA 1KVQA 2EQBA 4BJTA 2GBLC 2R8RA 3VYVA 3WSTA 4F5YA 3BB1A 3RUPA 3D6TB 4BNXA 4EKYA 5HS7A 3IAUA 3NTUA 4XVHA 2GN4A 1TRKA 1T3SA 1BNCA 1U0GA 5IJ0A 1K8YB 3FMRA 2E71A 1C4WA 3TXYA 2V58A 4TV9B 1SD4A 5E6RA 1RZRA 1J8MF 4UM7A 4RF4A 1ECJA 3RYFA 5K4HA 3SHQA 5F3WB 4M7WA 3AW9A 2KJBA 3TP0A 1RTKA 2B4QA 2DE0X 4HQKA 1U3WA 1GAJA 2VK8A 2PQ0A 4Q7EA 5B64A 5AVTA 1U2GA 1NF8A 3N3AC 3E84A 3VGPA 1K6OA 4EELA 2P6SA 1QNFA 2AUMA 2C57A 3ICCA 3Q2KA 4XOUA 4C3VA 3BG6A 3QXCA 4EH1A 4RTSA 5JHGB 3H0KA 3LPDA 2VDMB 3M4XA 4M1OA 5D5WB 4LE0A 3A1VA 3CH5A 3I9LA 5DM2A 4MIYA 5J2TF 5DUKA 1UWLA 1JFFB 3NKVA 4MTLA 3Q3HA 221PA 3A6KA 3WTCA 1JKQC 4RPGA 3TZBA 1I39A 3DDUA 4G5OA 2R79A 4RDHA 1MNDA 1WWXA 3AIKA 3UJHA 3WQSB 3DTVA 2OWEA 1JJ7A 3QV2A 4G0ZA 2DX7A 1TW3A 4UTZA 5FFNA 4KXMA 1AMOA 4JLPA 4R7GA 1MZVA 1VPTA 2EKPA 3T5AA 2OC6A 2G28A 3E22A 4G4SP 3C74A 2YQ5A 5KC8A 3LCVB 3LP6A 3CD6I 1EZ4A 4TV9F 1FFAA 2OD7A 1TU3A 1HKSA 1FNCA 3FTDA 4BTLA 4NK5A 1X1AA 1CUAA 1NDHA 2GJKA 4FN5A 4ZKDA 2GCEA 4TQGA 3S70A 3K1PA 3EDMA 3UKDA 3HRUA 1NMYA 3KD2A 1LPPA 4BX8A 3CIOA 1CSEE 2CWDA 2ZRBA 5H02A 2QVCA 4BKMA 5DLPA 2G0TA 1US8A 5C8VA 2XXJA 1AX9A 1CXZA 4ZQGA 3RG2A 1NGSA 1UEIA 5HZKA 1SUSA 4NQWB 1UXJA 2JDID 5KBYA 2PMDA 5DX1A 1X8KA 3O47A 4FCYA 4DEXA 4DV4B 1YBMA 2C5LA 3EJWA 4ITUA 1TLTA 4CEHA 1PNRA 3KZNA 1BW5A 1DNPA 1MH9A 2KRHA 2IVMA 4J19A 2GJ8A 4YREA 2CV2A 4Z6YA 1NLYA 4GRIA 2F5CA 5BS6A 1QIMA 3QKRB 2WWVD 1ES9A 1FXWF 1GILA 3TD2A 1L4KA 4YCMA 1P1JA 4ICIA 4U00A 5GY7A 3AF6A 2GD2A 3O1LA 1JTXA 4CCKA 4ESFA 2FTKE 3HKCA 1Z88A 5BR8B 4PNPA 4WNYA 1UCFA 2VP6A 1NXWA 2IP2A 5TARA 3ZNOA 4V1CB 4JQFA 1E3MA 2JBWA 3HUUA 2WR8A 3CVJA 3M8KA 1H23A 3CUOA 1BVUA 1XZIA 5DTRA 4YH1A 5AHWA 1GQYA 4DLWA 2XKOA 2MSYA 1GWNA 5ED4A 3OZIA 3ROXA 5HUHA 4IIVA 1BIBA 1EX6A 1LNSA 2O4CA 2CFRA 4YAGA 1QMPA 1QTNA 4X3PA 3EY9A 2R5ZA 5CBPB 4ZTBA 3VR6D 3EG9A 1PTJA 2AO9A 2OGSA 4IOAF 4A3LJ 3O90A 1W25A 3BSYA 3PWSA 3ZK7A 2UYCA 5B6JA 4MKGA 4D74A 1OWMA 2IUFA 1NTCA 3BGSA 1S2IA 4MAFA 4CIXA 1A8QA 1ZI6A 4KN8A 3ZYCA 4HEA1 1GYRA 5HE9A 4BBPA 4A36A 3MTDA 3GLSA 1WCIA 1LVUA 1RR7A 2MINB 4G5XA 3TOXA 5CT6A 5AKKA 3E81A 3GRAA 3WOHA 2PUEA 2NPFA 4E11A 1YBAA 1PI3A 1ISPA 3LHSA 3F2IA 4YS6A 2MOKA 4B73A 2REQA 1ZIYA 3E7XA 3AHDA 2O7RA 5F2KA 4I2VA 3SE0A 5J3JA 2DDAA 2QZ8A 5CLSA 3UGKA 1KBQA 3GW2A 1IY0A 1CUYA 3NWJA 3HRMA 2EH3A 2C2HA 4LEIA 4ZDOA 1W2GA 3VMFA 1AURA 1P6XA 1E3WB 1AZSC 4B4KA 1IY2A 4Z8XA 4D79A 1JN0A 4FSDA 5CHYA 4QEZA 3WKEA 4RY9A 1KRXA 3A0HC 3ZZMA 3KSRA 5K7SA 3HP1A 4LFAB 4CA0A 3A9RA 3OX4A 1NBME 4CPDA 3IE0A 1FF9A 2DN0A 2A57A 3GBGA 2O05A 5G4KA 2HA0A 2QRJA 3DZCA 5JU6A 3UV6A 3L0OA 2Y77A 3FSRA 4EA7A 4O4LF 2IEYA 4ZK6A 5AKYA 3BTLA 3MPOA 1W7PD 5DW0A 4MGIR 1KS2A 2F5VA 3VSKA 4MQFB 4J0GA 1N6LA 3FZQA 3TI9A 3B6JA 2ZBQA 5JNVA 5KJCA 1I9GA 2EFYA 3L8CA 3D8SA 4G5QA 5LZ4A 3QVUA 1P8AA 4G1FA 3IERA 4MPRA 3LW7A 4AROA 2YWDA 5YASA 5BYKA 1KVUA 4COOA 2H3HA 2W2PA 4TT3D 4H18A 3DXYA 5CP8A 1YXMA 2WABA 4PRZA 1DRKA 2OZLA 3DBRA 3N86A 2R7ZJ 2CLSA 4IGEA 4XQ0A 2O7NA 3KKPA 1NTOA 2EP7A 5TQ0A 1KVRA 2V7GA 3FW1A 2F1JA 3C6KA 3E6DA 1QH1A 3QVMA 1UJ4A 3EGVA 3K94A 1PP7U 1R1DA 4XJSA 2VEDA 3ZHRA 3BDVA 4WH0A 1MIOA 1PJSA 4P81A 5JLWA 3KVNA 4HWKA 1II0A 4LVNA 2Y9PB 3FPEA 2VRNA 1W581 4KPGA 1REQA 2C58A 3USES 2WC2A 3A1FA 4UMVA 1G3QA 2IPAB 5LRRA 4AN0A 3DVAB 3U0BA 1P0MA 2IDJA 3G1MA 4G0QA 2FEOA 1WL8A 1D07A 4HEQA 4MUMA 3K30A 5SY4A 5J58A 1C4XA 5BWMA 5TRDA 1JT9A 3CS3A 2H2WA 3H1EA 1XEWY 4YDQA 5J1RA 4JBAA 3TZLA 2I2AA 3T7JA 2QE7D 1EUYA 5AKEA 3A0BC 1Z2CA 2W90A 1L5HB 3B36A 4R41A 1MA3A 2XOEA 2ZUDA 4KB5A 2JLXA 2ZJ2A 1C3XA 3PNTA 4MLOA 1C1XB 2CQ7A 2HMUA 4MYTA 2WKSA 1F3OA 3LPCA 4K9SA 3Q9LA 2WFMA 3QPUA 2IEBA 3FRHA 5AW0A 3MRTA 4P0PB 1NF3A 2BMDA 1TUGA 1K89A 1OV6A 2IGBA 5IEBA 4QICA 1VHLA 3DWFA 4YT4A 1Z7LA 4RZIA 2JCYA 3TWOA 4YRZA 1ZAOA 3NIGB 4KJZA 1T5DX 2CK3D 3PA8A 3UMJA 3TRDA 5FKKA 1BN7A 3DH0A 3JWEA 3L0BA 1A77A 4MW6A 2DYRH 3A0UA 4OKNA 1U4SA 4WXRA 3WLNA 1MGOA 3TPFA 3ORRA 3R5JA 4U2KA 5AOCA 5A0TA 2OECA 1BS9A 3BXOA 2QMOA 4K9QA 5CGQB 5B5EC 3JVVA 5TVKA 1HBJA 2C1EA 2ZYAA 3OPXA 2JASA 2JHGA 3V7SA 1U8XX 3Q0UA 4IL6C 3IS3A 4MUFA 1BC7C 4KNWA 3SDSA 5I9NA 3ZGNA 2GA9A 4E5MA 1D0ZA 3EQZA 3RSOA 5JADA 1Q6YA 1F8FA 1Y1QA 1V8PA 1EP2B 2X42A 4URYR 4DCPA 2RGNC 2J6HA 5K6AA 4I76A 5IASA 4YHHB 3TD9A 3K4HA 4G63A 1NH3A 2IGTA 1QWSA 1J0RA 2OKCA 1P2FA 1JHXA 3QG5A 2QSJA 3ZKWA 2HDCA 2GASA 1S2OA 3OESA 5HJ2A 3A10A 3AY7A 4IIYA 3JSOA 1E1DA 2PKXA 5LGTA 3W6VA 1XPJA 3FFBA 3IBGA <