3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
b'KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
2HUNA 3HFGA 3NDJA 3UW3A 2FP4A 2JCVA 1G3TA 2P6SA 1XCBA 1B6AA 3KZZA 2L4AA 3FHZA 1ZFNA 3WR5A 4CR8A 1IHXA 3D4NA 4OMUA 4O6JA 4LMRA 4PG8A 4GL4A 3ZMDA 1DBVO 2P4QA 2XAHA 3H5AA 3VZSA 2GAUA 1W5SA 4ZH4F 2P5YA 1A72A 2G82A 3CPSA 3RFVA 4I2OA 3GFLA 2AMFA 2Y1GA 4J1QA 3JQ9C 4LG0A 5J23A 3ZV6A 1ZK4A 2NU9A 3ZDFA 3ST7A 4YAIA 2IW5A 3JW4A 1QRRA 4AL4A 4CR6A 4I98B 1O6ZA 4DLLA 2GXBA 3B20A 1NYTA 2QZZA 5E1WA 3TO9A 4KDPA 2YX4A 2A4KA 3F9IA 2KIUA 4PLVA 3K2BA 1R0KA 1WWKA 5LGUA 5F1OA 4YJGB 5JAQA 2EB7A 1V4RA 3ZWYA 7ADHA 1LSOA 4K2EA 2CY0A 4D0PA 2X6TA 4J0FA 1NPDA 1Y8QB 5A06A 5CLSA 3PQFA 4GX2A 2PZJA 4R1NA 4M6XA 3Q2IA 4L0QA 3EZLA 4FPXA 4MO2A 3WODF 1U28A 4BNUA 3ZCXA 3H2ZA 3BP8A 2IJLA 2DBRA 4P9UA 1STZA 4I02A 1D8AA 2H6EA 1GUZA 1UAGA 5IT9K 3IJPA 1QMGA 2JCXA 1G4DA 3DBHA 5C7IO 5I8WA 4WLUA 1NNUA 4BNTA 3ECOA 3D1LA 3GN2A 2CYYA 3DEYX 1GL3A 3C3XA 3CZMA 3F8MA 5B4VA 2CVQA 4XKJA 1LA2A 3ASUA 1K7AA 1YQDA 5G4KB 1OYIA 5L3FA 4TROA 4J9UE 1VTNC 4A0ZA 2Z5LA 4HY3A 5D4SA 5B1YA 4MVJE 2DTXA 3SEFA 1YB1A 2R7FA 3HQ4O 3G3EA 2FPIA 4YJHA 1HYGA 2X0IA 1NWHA 3OJLA 2NLOA 2IP2A 5JY6A 1E3WA 2EF1A 4RVUA 4XDYA 5I7EA 4BNZA 2VODA 2J3HA 4HWKA 1LLDA 2BE5F 4MIOA 5JNLA 1CDOA 5E20A 3V1YA 2ZYGA 4HFNA 4CM9A 3SFZA 3F1LA 1GCUA 1G6NA 5H83A 5IAAA 3R0IA 4BHTA 2CG4A 2YQ5A 4O3MA 1FNNA 4CM7A 4MINA 2FNPA 3TOZA 4EGFA 1OMOA 3V1TC 2IDZA 5BNTA 3LU1A 1WXDA 2P5VA 3ENNA 2J6IA 3B1JA 2X0RA 2ZJ2A 4RF2A 1I01A 3DL2A 4CXFA 3F1KA 4CLHA 2PZKA 1TA4A 5U9CA 2E1NA 1MG5A 1HSJA 3AJRA 2RC4A 1QSGA 2IPQX 2R00C 3F4BA 4OQYA 3W4KA 2TMGA 4TSKA 3I4PA 2YX7A 2VTDA 4CQMD 1R00A 3K2EA 1LTHR 3HG7A 3L2CA 4N18A 4XRRA 4DBZA 3JTHA 3EGOA 4YRAA 5B4TA 2ZCUA 1FLIA 3RFTA 1GEEA 3IDSA 3R61A 3HADA 2OFPA 3VH1A 2UZKA 2POQX 4HQMA 2WE7A 5CDYA 4QX6A 3LT2A 2I5PO 4GX5A 1PGQA 3AOEC 4W9NC 2F5FA 5BS6A 1BDBA 2EFQA 1SPXA 3T7CA 4WX9A 2J5KA 1J75A 5AXAA 3SXYA 1F12A 2Q2VA 4CMJA 3RKRA 3OP4A 4OIRF 4MVJH 1DPGA 1TEHA 1R15A 2V1UA 4N7RA 5KJ6A 3KBOA 2QG4A 1T24A 3CO6C 2VZ8A 3T4EA 1LUAA 2PFGA 1WDLA 4BO1A 2E82A 1XDUA 5DDIP 2QWWA 4PLHA 4I5FA 2DFVA 4TZTA 4W4TA 4G81A 5F64A 1PJBA 2GCGA 4UXNA 3L4BA 3L6EA 4I5EA 4L76A 5BNFA 2BFAA 5E1ZB 4YPOA 1NPYA 3A4VA 4BO0A 3VTFA 4XWYA 2A35A 1YS7A 4YJGA 5B4UA 1R66A 4AG3A 3VZPA 4YWJA 2GZWA 2QRJA 4N5MA 1M67A 1Y8QA 1I6XA 3V2HA 1TI7A 2MLKA 3MZHA 3MJ4A 5A9RA 1HQCA 1TLTA 2PLAA 1ISGA 1HDYA 3I9OA 1VJTA 3AUSA 3CO7C 5LEJA 4KWHA 2MLGA 2FY8A 4C4OA 1UAYA 2ZCWA 4K9DA 3BJAA 2KIMA 3LC2O 2H94A 4GBJA 3ETGA 2CMDA 4E30A 5IT9Z 3ELKA 3I4CA 4XQGA 1NAHA 2Q2QA 4AD9A 3KYCA 4XB2A 5KVCA 1ZVMA 5HWSA 2JHFA 1O89A 4GKVA 4HFMA 3K31A 2OOSA 1T1SA 3DOCA 3KETA 3HSEA 2E7XA 1GVJA 3WTXC 4IDFA 5C37A 4CQMB 1G3SA 1LC0A 1P0CA 3Q9UA 3DOJA 3R3SA 5DCUA 4S04A 1AXEA 3FNFA 3IP3A 3PDUA 3AU8A 2CFCA 1X15A 2ZYDA 5AXCA 5LDHA 4LB5A 1SFXA 3MFKA 4MEXF 3JQEA 1CETA 1DAPA 1SZJG 4MVJG 4R1UA 4M74A 2P5KA 1E7YA 4ENNA 1YS6A 5E18F 1ENZA 1TW3A 1ENYA 3N58A 1OR7A 4OMZA 1AOYA 1T2EA 3IC5A 5IN5A 3I53A 2AW5A 2HDHA 2P4HX 2XAQA 3GA0A 4NDNE 2CFXA 2PBIA 4PRLA 4R51A 4WEQA 5JDCA 2CZCA 2D59A 4ND2A 1BHSA 4RO0A 1D7OA 5JAIA 1HXDA 4J4BA 4PZDA 4CMHA 2HSDA 1EDZA 4KZPA 5EERA 5EQFA 3KZYA 4I01A 1E3IA 2Y48A 2NADA 2V6MA 3K9QO 3ZMSA 1B4AA 1SOVA 3OJOA 1O7FA 2W4QA 3IUPA 4B3JA 4NU6A 1XR3A 1PS0A 4MVJF 3WYEA 2YV2A 5JO9A 3EETA 3K1NA 5DULA 1VI2A 2WTBA 2BH9A 2GNAA 1YQAA 1E0DA 2QQBA 2PMUA 4RVGA 2FN7A 4IIVA 1ZIDA 1XG5A 4NBTA 3QWAA 3TNLA 2DUUA 1PX0A 3UH1A 3D4PA 2QVOA 3DC2A 2FR0A 1A7AA 2O3JA 2IXAA 3EW7A 3FHLA 3S2EA 4IRIA 1K0UA 2FRDA 1S7OA 4OQZA 4HV6A 5IT3A 2E6UX 4YT4A 2CF5A 2D2IA 4BO6A 5K9ZA 4E12A 2FR1A 4OXYA 5ER6A 3RVDA 1RM4A 1B3RA 1U4SA 4BO3A 1X3UA 2GN4A 2Q2WA 4LCJA 5DBIA 3DDNA 3SXPA 4DVJA 1XDSA 3ZU3A 4KICA 4PRKA 4LW8A 5JO0A 2HKIA 3C8MA 3QRFF 2FWMX 4Z6KA 4ALNA 4IQGA 1L3LA 4AVYA 1M76A 1U5TB 2F1KA 2PWZA 1DFHA 4I9UA 2YQ4A 3RSHA 3SJ7A 3VAZA 3NKLA 1BM9A 2OXIA 4I0BA 1X7DA 2HJSA 1GPDG 2FR8A 5AQ1A 5L7TA 4CR7A 4HP8A 1ONNA 5I8ZA 2DO7A 2YW9A 1C0IA 1R16A 3GDFA 4H16A 4JNKA 4PLTA 3I58A 3KSUA 4XRFA 4JXKA 4IJKA 5ICMA 1ZRFA 3WGYA 3KOUA 4WPGA 2C5EA 1N5DA 2E1CA 5IDYA 2CF6A 3WQSB 3G49A 4XJSA 4EJVA 5DV5A 2NVUB 2WJPA 4U0KA 5ICFA 4OKIA 3EDMA 2VYND 1UJMA 4PGFA 4DPLA 3ULKA 5A3VA 1RZ4A 4XJTA 1Y0UA 2W2LD 5L3BA 3L4SO 4CMAA 2KJBA 1NP3A 1DIBA 1WPQA 2NTNA 3GPIA 4HX5A 1CERA 2OBNA 4R01A 2A92A 5DF1A 2V7PA 3I59B 3SC4A 3RWBA 5FWNA 5LHGA 2ZTUA 2MBFA 4DNCA 1E6UA 3V8LA 4DQXA 3UXYA 2YZ7A 3MOIA 4EJTA 1BC8C 1QKIA 4GH5A 4OXKA 4DUPA 4BHBA 1R4NB 4A0SA 2Y1FA 2RVCA 2FQ3A 2A6HF 2MA3A 1DAOA 3KTDA 4PZEA 2BGLA 1Q2XA 4U0JA 1KETA 4WJZA 1BDMA 3M1AA 4JK1X 4BGEA 2A68F 3HSRA 4DC0A 4HX7A 2FOIA 3OHSX 1UDAA 2OBYA 3GVPA 4TQGA 3L77A 4UVEA 3CLOA 1LDYA 2VHWA 4BNIA 3KEQA 2AQ8A 2OP1A 4GWKA 1WKMA 4C7KA 2Z3YA 3GUDA 1J9IA 1JU9A 4UULA 5L3GA 3LC7O 1GDHA 1QV6A 1LDMA 2X4HA 3D4OA 3VKVA 1T38A 3LDHA 4RGBA 5G4LA 4FR5A 2H6CA 1T2FA 4R5HA 4X54A 3CKYA 4ZRMA 1W73A 3PFWO 4RB0A 4G7OF 1V9LA 1MFZA 1DLJA 1JXSA 3E6BA 1BXZA 1Y5MA 2P5UA 3AM5A 4ND4A 5BT9A 4P96A 4A5MA 3ZN0A 1XD7A 1ZGJA 2RDPA 1FY7A 2Q2EA 1REPC 1F14A 1PSDA 2GN6A 3VHRA 2IVMA 2UXNA 4E5KA 3OEYA 1KVRA 3INRA 1E77A 5TF4A 2OAZA 5F21A 4BO8A 4E31A 3GFMA 4LMPA 3BJ6A 2WYVA 3MZYA 1XGNA 2DFIA 2O50A 1GQ2A 3BHJA 3GVCA 3PWSA 5J8FA 2QYTA 3JAMZ 1NVGA 4FJ1A 4D43A 1RM3A 1SD6A 2W85A 1JA9A 3I9MA 2P8TA 2E48A 4RLSA 1P0FA 3NTOA 1NBOA 5CVRA 4DIOA 2AEMA 1R7JA 3EVNA 3DTTA 5DCYA 4IJWA 2EGHA 4XGKA 2GZ2A 1H5QA 4L75A 3STHA 3ANNA 4JJIA 1YB4A 3JD4A 5TRTA 3ZWCA 3ZNQA 2JFHA 3WGHA 2ET6A 1S8NA 4GVLA 1IOLA 2VZ9A 1E2XA 4JLWA 3QWBA 1KEUA 1B3BA 4DQUA 1VRWA 3W6KB 5FB2A 2X58A 3ZWAA 4HDUA 5D6FA 3T4XA 2ZO4A 4N5LA 3DB2A 1JN0A 2HMWA 1KEPA 2OBPA 2GO1A 2V6BA 4A73A 4IDCA 3VZQA 4LGVA 1LXCA 3H3ZA 5BMZA 1DB3A 2V1DA 3W6ZA 1YQXA 1X0VA 4ZYEA 1U5TA 1B9NA 1RWBA 4JBHA 1PP8F 1J49A 5HS4A 3EQLF 5HLHA 2NTJA 3H5NA 4IZHA 4LK3A 2J3KA 1Y1PA 4CMKA 1ONOA 2B4RO 1FP1D 3ZHBA 1HKTA 1BRMA 3ZGYA 2X0NA 4NHEA 1YO5C 1PR9A 4IY1A 1MD0A 2LKPA 3JQ8A 4CM6A 1LVAA 4ZZDA 2BELA 1W5TA 1HDOA 2ZTVA 3IUSA 4YJDA 2D1VA 3FNGA 5CAEA 1LDKB 3BAZA 2HYGD 3ERED 4M54A 4E2ZA 1MX3A 4NFHA 1F9NA 2Y1OA 4WOJA 1PL6A 3NRCA 4KTTE 5JDIA 2NVUA 2X0JA 1FBQA 4TWRA 4HZFA 2GR9A 1LRJA 1P44A 1N7GA 2J5QA 1GYQA 4BL5A 2VC1A 3WSWA 4I9NA 3WTWC 5BNIA 2HAEA 5DBGA 5F3RA 1IUYA 4OXNA 3JQFC 3TOAA 4RPHA 2PLYA 4XQEA 5JMPA 1S29A 4N0BA 1BSVA 4PLCA 2D1HA 4R5MA 2EV0A 4K6CA 3I59A 1KU9A 5BOXA 1T39A 1HYHA 1WMAA 2DW4A 2R00A 4BQPA 4EGYA 1I2BA 5U4QA 5HLIA 1BBYA 4U88A 4ESJA 1R4NA 1V3VA 4BQAA 5DN9A 5ENDA 4FGSA 5BPIA 5KOIA 2WM3A 2Y66A 2PD6A 4A2UA 2NU8A 3NGLA 5DBFA 4OIMA 4MIYA 5TNXA 3U4CA 3BJOA 1OBFO 4LJZF 2FE3A 1SAYA 1H6AA 2OP0A 4MDHA 1QPMA 4IDAA 4HX8A 1B8PA 2Q1UA 4K28A 5L9AA 1LDBA 3L9XA 1DHRA 3D0SA 4TKMA 1ZXLA 2DU9A 4WUVA 5HDNA 5EEGA 3RI4A 1GV0A 1LDGA 2RH8A 4UVDA 2PJPA 4YB8A 4XRGA 1KEWA 3WB9A 2FXAA 2FNAA 1H9AA 3RPUA 1PS8A 2SCUA 2ZKLA 1FF9A 3ICPA 4ZVVA 4D7AA 2DTEA 4F6LA 1R5HA 2X7HA 1ENOA 1UXHA 1KU2A 2FBIA 4GYGA 2YPRA 4CM8B 4CV3A 3OIDA 1Y6JA 2GN9A 3TPCA 4Z9XA 4XX0A 1G3YA 1NQOA 4BVAA 1XMKA 4OINF 1UR5A 3ZU4A 3ICCA 5KIAA 5JHUA 4MTDA 3DZJA 4HV4A 3WE2A 3W6UA 1Z6TA 2HZTA 2P9CA 5L3CA 3OQBA 2XAAA 4XD2A 3RASA 3UGKA 4BNXA 3FI9A 2M8EA 3HDQA 3RJ5A 4DIBA 1ULYA 1LNWA 3OA2A 1QYCA 2D2WA 5LEKA 1O9BA 3S1LA 1U3UA 3UF0A 2DPHA 4EM1A 1HKQA 1GAEO 1YBVA 2O8XA 2W2LA 3MJSA 3ZI0A 3EYIA 4I5DA 3E48A 3KFWX 1GYPA 3D5LA 1ZMTA 2FU4A 2FOKA 1A4IA 2XIGA 4HF1A 4Z0TA 3SHFA 2GRAA 4EJUA 4IHSA 1RYDA 3HDJA 1PUEE 3UUWA 4U7BA 4I1IA 1R23A 2PNFA 1EVIA 1VC2A 4JJGA 4WLFA 1U7HA 1EUCA 3GT0A 1MGTA 4I8XA 3WGIA 3OFSA 1QZZA 2FMUA 2ILTA 5HOOA 4OO3A 3TSCA 3MWEB 2CSOA 3DXJF 4RB3C 2GA2A 2GDZA 3ITKA 3PJGA 4DIFA 2QM3A 4KUEA 4IJAA 1UZLA 3E5MA 3FBGA 4DRYA 2K86A 1NFRA 4J2OA 4CMBA 4II2A 3HRTA 5BR7A 4R54A 4P8RA 1HSZA 1PQPA 2K27A 3DFGA 1WWXA 1E3EA 1GYRA 1QV7A 3U62A 2Y67A 3B6ZA 2OQGA 1UHMA 4AWXB 3O3KA 4JGBA 5AYVA 3GDOA 1P3DA 4KUHA 3WQQA 1FDTA 2D45A 1USTA 1ZN2A 2LDXA 2HQ1A 4FFRA 4NBRA 4RCVA 3ADOA 4ZYGA 3H3JA 1H93A 4MVJI 4R1TA 3V2GA 2YY7A 5TLSA 4CYDA 2B4TO 4AIKA 1J0RA 3BROA 5DOVA 4BNYA 1C0KA 1RI7A 2ZQYA 3G1TA 8ADHA 4IPAA 5LRSA 4BKOA 4DPMA 5DD4A 1T0FA 4ESBA 4RF5A 1P6RA 1LLQA 4RF4A 4UVIA 4MNUA 5HS6A 4L5JA 3GGPA 3OIFA 2WTEA 2ZBKA 1V3TA 3JQAD 4FOOA 1HSOA 1JKIA 1B15A 3S2WA 1FXSA 1R5GA 1LC3A 1VJ1A 5ICCA 1G3WA 1G0OA 3CH6A 4PG6A 1SD4A 1KGSA 1PZGA 1F4KA 5HDKA 1A5ZA 4R4JA 4EQQA 4RPGA 3ZQ7A 1QORA 1YTYA 1J4AA 2X5JO 5EIOA 3T1BA 4D46A 4Z0PA 1V0JA 1PJQA 1MG0A 1C1XB 2NVWA 3B73A 3KB6A 3OH8A 3PHGA 1NR1A 2D5AA 4FOSA 2OL4A 1MJBA 3E9QA 3BPVA 4II3A 4UVGA 2EV5A 4HBGA 2NYXA 5MDHA 4RGXA 2XF8A 2ESHA 3WNVA 1X7GA 4HNHA 4OGWA 2A69F 4DREA 3IHUA 3FF5A 3O4RA 5L3EA 3LT0A 3RDIA 1W7PD 2IE0A 2VHXA 3AM4A 3HE3A 3ONDA 4Y6SA 3Q0EA 5T6BA 3OBBA 2P4WA 1BC7C 1T2AA 3F22A 2WD7B 4DMMA 1WW8A 3KEOA 3AU9A 2FMLA 2CDBA 4EITA 5JW6A 3TZCA 4EUHA 4IVNA 4M6YA 1XLTA 5TJHA 1B14A 4PZCA 3HWRA 2ELHA 1I3LA 2E49A 2H63A 3NAQA 4J1TA 2YV1A 3WTYC 1XQ1A 2X23A 4EVIA 3DMYA 2NQTA 3IP1A 4OIQF 4R69A 4G9YA 3WTZA 2NQ8A 3PWZA 3K96A 3VZRA 4CM8A 1P33A 1HF3A 3H92A 4FFOA 4XYLA 4GGOA 4CL3A 1IN5A 3KE2A 2J3JA 2GIVA 3AFNA 3CTMA 4LN1A 1DHTA 1ZJZA 5ILVA 2P9EA 4MIEA 4P4LA 1IPFA 3GHHA 3SX2A 4FSHA 3HRSA 1WP4A 2H1SA 3PJEA 1I27A 2RNJA 2YHIB 5A1TA 5LRRA 1P1RA 2K4BA 4XEHA 4L9RA 4C7JA 1QGPA 4CM3A 2XHKA 1OI7A 3PEFA 3K69A 4LK0F 1I2CA 1Z91A 5LHIA 3HB4X 4I08A 4EJOA 3E18A 1TQMA 1LI4A 2NNNA 3JQAB 3P9KA 5THQA 2RKHA 1YS4A 4PG4A 1KU7A 4R8HA 3WQRA 1BIBA 2Q50A 2DAPA 2OORA 2VUUA 4BXUA 4BB5A 3GVXA 1JLLA 3KO8A 4OOFA 2YJZA 3OEWA 4A5NA 3PHJA 1I33A 3FNHA 4WCGA 1DDOA 2Z1MA 5FO5A 3JQGB 4Z3KA 1DIAA 1XGSA 3FZVA 4G6DA 1DUXC 5FD6A 4FFLA 5F1KA 4LGWA 1Y9EA 1NXQA 4ZRNA 5A03A 2E7WA 4UV9A 1KVTA 3KRTA 2FA5A 4BO7A 3GEDA 2YUTA 1K89A 2XOXA 4RQUA 1R37A 4YQZA 4GLOA 5AIQA 4FFPA 3TRIA 4LLGF 2Z99A 3ON5A 2DBQA 4FBGA 2UWMA 4U6SA 3C85A 1YIOA 4A12A 4DYDA 3PQEA 3RC9A 2Q1TA 1S6LA 3S2GA 2AEJA 4BMVA 3BIOA 1EMDA 4DPKA 1P92A 2B35A 3FWNA 3MWDB 4YDRA 5TJ9A 5BSEA 2BMAA 1I30A 3OJ0A 1TT5B 3E6MA 1IL0A 2HK7A 1ZHFA 3JTGA 1Z05A 3OV8A 4B4WA 3GH3A 4J9VA 4BKUA 5A04A 1UZNA 2K4JA 1LEHA 1LLUA 2H5LA 4HFRA 3FR8A 5JLAA 5THKA 1YYVA 5KTKA 3WGOA 4D45A 3ZWMA 2BRUA 2X22A 2ESNA 5AONA 4JN6B 4D3DA 3EUHA 1Z9CA 4XYEA 3EUWA 3RC7A 1KIFA 1N1EA 4E0BA 1GFSA 3GG2A 3WX0A 2AA3A 4O5OA 5K6AA 2YHUA 4CQLB 2HDCA 1XYGA 1BJAA 1A9ZA 1C1XA 1W6UA 2HLPA 2VN2A 2P91A 1EFLA 3JQDA 4HDVA 4K1LA 3JQ6A 4G8XA 2PY6A 4NQZA 2QUFA 2DQ4A 3SBOA 4YAKA 1QO0D 3LA3A 1EVYA 4FDAA 5JCXA 3DP7A 1DRVA 2H09A 5TIIA 3P2OA 1Y8RA 3W8FA 3W8DA 1XN7A 1E6WA 2I65A 4CLXA 3JSPA 3NT5A 1ZH8A 1ADGA 3LLVA 2IZ1A 4AFNA 1ZARA 2PD4A 3P7NA 3PP8A 2WD7A 4IF4A 5LGTA 2LF8A 5DEQA 1BMDA 5DOZA 5ILUA 1ISHA 4I0AA 1DJQA 3GMDA 2Q99A 5EESA 1G0NA 3QQPA 5JFOA 2ZKZA 4YBZA 1YLFA 3BMQB 1ENPA 2IT0A 2PGDA 3O8QB 1R6DA 4TRRA 1WQ2A 2WWRA 2CO5A 1UZMA 4CMEA 1WRJA 4CGZA 3HTSB 4M55A 4MP6A 4M71A 4LB6B 1XHLA 2A9FA 3QVTA 1I1SA 5LLQA 3NDRA 3FM5A 1QNTA 2R7DA 4YG2F 4Z3DA 3K1MA 3VFZA 1ZKMA 1U3VA 4KIBA 1YG2A 2XXBA 2YHIA 4NK4A 1MZBA 5A3JA 5C7OO 5K1YA 5A02A 3GLQA 4A6DA 3F8FA 4U7WA 4XQ9A 3C7JA 1XU9A 3WMWA 3HHHA 1LSSA 1UXJA 4O5VA 3EAGA 1ID1A 1T25A 5KVQA 1L1FA 5DCWA 4WASA 3JQAA 4RB1A 4BAYA 1I2ZA 3FXRA 3JQBC 3KP5A 2BFMA 2UVDA 3BTVA 3H2SA 1ZSYA 4G65A 4IBOA 4NMHA 5G0TA 3EYWA 3GWZA 4A6EA 2YSRA 4UREA 5A9TA 2GLXA 3JQGA 3CUQB 3RI3A 2AG8A 4CUJA 3HN7A 4HV5A 1V6AA 3MOGA 2GPTA 3BXXA 1L0OC 4M73A 4MPDA 4PZJA 1Q0LA 1Z7EA 2WYWA 4DXHA 3I1JA 5HDGA 2FEZA 3VEPA 1H2HA 2RAFA 3FTPA 4FN4A 3FPCA 2VYVD 2ZMEB 1RYEA 4ZQGA 2GD1O 1UUFA 1KOLA 2JKVA 4KDEA 4HXYA 4IIUA 4D41A 1D3AA 4RPJA 4I7HA 5G0SA 2ETHA 2PKQP 4TVBA 4BNCA 2KIFA 4FC6A 3NQOA 3O2PE 4E70A 1UXKA 4I9HA 5ITVA 2MD5A 4ZICA 3H9GA 4ZQFA 1UP6A 3QLJA 2JTVA 3ZWWA 1TT5A 4BH9A 1DC5A 1H6CA 5IDQA 3GNQA 5K5OA 5L4NA 3REOA 4KN7X 2O3RA 3PDJA 1DXYA 1LEAA 2W90A 2C29D 5CP8A 1HXHA 4WLEA 3WIEA 4GXOA 4J7CA 3H5RA 5E8GA 1MA0A 1P1FA 4WECA 1S3JA 1KEVA 3BMNB 2CW0F 4OMYA 4GMFA 1GZ6A 4O6VA 4XIYA 5KJCA 3J81K 1D4FA 1GU7A 4J2HA 1VLLA 5FI5A 1RJWA 3FWEA 1ARZA 5BQTA 2OQRA 5ILOA 1TNSA 2E37A 3PVZA 3X2FA 3H3FA 3H9QA 5CDSA 2V6GA 4Q39A 1HDRA 3I5MA 1J59A 2O03A 1N2SA 3E8XA 1BWSA 2BI8A 1IPEA 2Q46A 3GFGA 2V9VA 2EJRA 4L4SA 1HDGO 2AE2A 2RHRA 3BZUA 2RBEA 2V65A 4GCVA 3C7CB 3PHIA 3LFKA 1ISFA 1Z6ZA 2BV6A 1BI1A 4IMPA 2DVMA 5CEEA 3RIHA 4QQRA 4GVXA 1GADO 2X9NA 4P4NA 4U6QA 1LU9A 1U3EM 4KT5C 1NFQA 3LQFA 2CVOA 4WE3A 4EUEA 1BGVA 1XGOA 1P45A 1E5LA 1GR0A 4GQAA 2O2YA 5FFFA 1YE3A 1ZSNA 4JP2A 1GTMA 3DR3A 4KOAA 3ZWOA 5JAZA 1I5RA 4QWQA 1B2LA 4J7UA 2DUWA 4MGRA 5HS9A 3IIEA 3AUUA 1Z74A 1H94A 3O8QA 5L3ZA 3JSOA 3SQNA 1B16A 5CFZA 3NDIA 1K79A 1MJ9A 3ULQB 3NT4A 1V3FA 1DC3A 4KA4A 3G1UA 1YDEA 4LISA 1IXCA 3B70A 2X5OA 3GZNB 4UEOA 4U0YA 1H0MA 3D0OA 1CWUA 5EQDA 4HA8A 3DOOA 1U2GA 4RGUA 4YIIA 4FFNA 3JYNA 4L4RA 2HRBA 4OYRA 1Y9AA 4CJXA 3IWZA 4KDFA 3P9IA 2HRZA 2VOPA 2H27A 5IG2A 4CLRB 1I1GA 5L4LA 1T4DA 2GSDA 3LA7A 1EE2A 4DC1A 4BKRA 1ZW1A 2O3UA 4MQ9F 2Y99A 3FXQA 4NG5A 1T6SA 5DUKA 2WWYA 3LYLA 3CUQA 2PZLA 2UDPA 2AXLA 1E1KA 2C2YA 3PLNA 1X13A 5TT1A 2F5DA 5G4KA 3U0BA 3NT2A 3RKXA 4E2XA 3DMTA 3WGGA 3I23A 4UEKA 4A5OA 4PFJA 3Q3CA 4YXFA 3HSFA 3U2RA 2K7LA 3GVAA 2WE8A 3KLOA 4OSOA 1E6EA 1BG6A 4CV1A 4D0SA 2ZMEA 3JYLA 5DYMA 4HYEA 4KYWA 3HN2A 3WU0A 1B8UA 4L5IA 1OYWA 3G73A 1LEBA 2W8ZA 3QPTA 2EP7A 1X1TA 1GQYA 3ITDA 1IUKA 4IM7A 2V79A 3FBTA 1ULSA 4LMYA 3M8FA 3GOHA 4UUOA 1GV1A 1T98A 3TFQA 5KVSA 2VWQA 4EZBA 5CVJA 2HYFA 4ESFA 3WWZA 4BNWA 2QLZA 3ONEA 5L51A 2EV9A 4BGUA 1MC4A 4AJLA 3RUAA 2YU3A 1Z7BA 3E5UA 3UICA 4RGSA 1QR6A 5KWEA 2HJRA 4CV2A 3PIDA 3QWHA 3DZKA 3QAHA 3V7CA 3DHNA 4KIFA 5CPBA 4XLNF 2ZATA 4YJFB 5D5VB 3CMMA 3H4VA 3L6DA 2BLLA 1R1VA 1U3TA 2QZ9A 3BMNA 4GX0A 4L74A 2JPCA 3M9AA 1ZMOA 4A03A 2DU8A 1U1IA 3KLNA 4LFUA 2MC3A 3FWZA 2VONA 3KSDO 2W2KB 4EGZA 1ZREA 1F17A 1JVSA 3W4JA 3TZKA 1HT0A 2IEBA 2DC1A 4M1QA 3ZV5A 3ZMTA 3PRJA 2DBBA 5TRDA 3E5QA 3JSAA 1B7GO 2J5RA 3FMRA 1P74A 2AQKA 3WTSC 1XSXA 2EWNA 3L0DA 3KM0A 4RDHA 5COQA 2GYYA 1B59A 2A6EF 5JI6A 1E5QA 3QY9A 3BTUA 3M1EA 4RV9A 5L95A 4BB6A 4Z2YA 1PGJA 2Q4BA 2QQ9A 1AXGA 1EE9A 1EEHA 3O6BB 3K6JA 4Z0HO 5ILGA 1XMAA 3WICA 2VC0A 4E33A 3VC7A 1O7LA 2PEXA 4FD3A 3CUOA 4CQLA 1NM5A 3U09A 3LAPA 1ZEJA 1P1HA 4RB2C 2EERA 3WGTA 1QG6A 3WGQA 1HE3A 4CM4B 3OF2A 4EEXA 1V8BA 5CDTA 1EH8A 1FC3A 1NX6A 1U3WA 3QJ5A 1FPQA 1CQIA 4INAA 3AY6A 4TMFA 5DT9A 4A7PA 1LQTA 4CHUA 3GRKA 5KVRA 5IDWA 3V7SA 1DC6A 3ETDA 3ENKA 5H6RA 5HBRA 4DL9A 3KP4A 5IJZA 1ZJYA 4OIPF 4MTEA 1YB5A 3I9LA 3U4IA 4CL8A 1TW2A 3GZNA 3C1DA 3QVXA 5AIPA 2STTA 4BKQA 4PIVA 3U1DA 2VUSA 4EJ0A 4ON0A 2Y93A 3INGA 3SZPA 2IODA 2NACA 1Q7GA 4WCFC 3DPTA 1AWCA 4W7HA 5CVVA 1SB8A 3U4DA 3U4HA 2WEKA 4OHUA 2W25A 3O9ZA 5GMOA 3RFXA 1IRFA 1O3SA 4RPLA 1YBAA 4CLRA 3ZHXA 5KJ1A 3CMCO 3FN4A 4G94A 2QHXA 4FJ2A 4IZIA 1I5ZA 3Q11A 1P9LA 4NBVA 1AHHA 3IKVA 4D3SA 4CQMA 2QX7A 4M9ZA 4WK8F 3IQDB 5ILSA 1BI2A 2IZ0A 2RN7A 5LBQA 1FP2A 1OKRA 3ORFA 2Q1WA 4MKRA 1YFHA 1FMCA 4BV9A 5IXYA 5G0WA 3ZU5A 1PJ4A 4XIJA 3ZH2A 2FPGA 2HQRA 1QLHA 4H3VA 2A61A 4OSPA 5F1PA 4UVBA 1I24A 3D5QA 2EJVA 1LJ9A 3G3ZA 3K0LA 1K78B 3JQ9A 1GZ3A 3HHPA 4WWCA 4UUVA 2QIOA 5EEHA 1H0KA 4GKBA 4NFYA 1XELA 4W6ZA 3IS3A 5E17F 4RQTA 1ON1A 5HRUA 3E5RA 4YFXF 3HOTA 4EEZA 4IINA 3LQRA 1Z82A 1HZJA 2FMYA 1M2WA 4J1NA 4BNKA 2COMA 2J5OA 4IRGA 2Y05A 3DZGA 3KZVA 1ADFA 3PYLA 4LSMA 2O7QA 4Q3NA 1U5CA 1IZ0A 1CQJA 3TFOA 1YJ8A 3TO7A 3ZZNA 5IZCC 4AVPA 4N9IA 4AJJA 1TTYA 2O7SA 1UB9A 4HBLA 3TQHA 1OMIA 1J5YA 1N8KA 1C1DB 1VJ0A 1RNLA 1X0XA 3HDHA 4A10A 4YJFA 4NPCA 1ZLJA 2O6GE 3N97A 4KNYA 3TQNA 1ZSVA 3JD0A 1NPTO 1TVEA 3RD5A 3ZWVA 4WCDA 3F46A 1I36A 3I6IA 3JQBA 4IXTA 5EL0A 3QVOA 3U5TA 3OQ1A 4B7XA 6PAXA 3H9JA 1SFEA 1V35A 3UCFA 2O3QA 1B0AA 1BXGB 3UCXA 2XRNA 1YBMA 1MGOA 2ZJ1A 4F45A 2YFHA 3IAHA 1GXPA 4AJ2A 4RVSA 2CNBA 3RUHA 1BXKA 2I9PA 3K30A 3GFIA 2DK5A 3V8JA 4YRDA 1T4BA 3RUCA 3FMQA 5CDUA 5MGBA 2V1XA 5JPIA 3LF2A 4N9HA 4AJIA 1SOWA 4JIGA 4ETSA 1XKQA 1ORRA 4DTIA 2B37A 5DNAA 1YQGA 5FFXA 4HADA 2EIHA 3CJNA 3PXXA 3QSGA 3TZ6A 2QZ8A 2YR2A 5A05A 1T2CA 3PLRA 4ND5A 3TL3A 4A2CA 1K6OA 3NYWA 2DLDA 1H2BA 3PHLA 4F3YA 3KSZO 3VDQA 5E1XA 1ZBQA 2Y68A 1JAYA 1O3QA 2EFNA 3OQ6A 1D8KA 5FI3A 4MOWA 3Q9SA 2ISZA 4RVDA 4WXHA 3P7MA 1RPNA 4S1VA 2NVBA 2B4QA 3BZ6A 3CIFA 3I71A 4M9SA 4H15A 1BW9B 1CRWG 1ONPA 2VBWA 2FSWA 3I9JA 4U8GA 2HMVA 4WLVA 4WLOA 5FF9A 4A27A 3GO5A 5CPFA 4Y13A 1S6YA 5IZ4A 2HKOA 2LSOA 2VRBA 3MZ0A 3UHAA 1ZK2A 3R60A 4RVFA 4LK1F 3PZBA 1W8DA 3LSYA 2HGCA 1HWYA 2JSCA 4XBFA 2C7GA 3PQDA 4HFJA 4NBWA 1KVSA 3DZFA 2UYYA 3LQQA 1MJAA 5T64A 2PMHA 2EW8A 4IMRA 3ZU2A 3HRUA 4XYBA 3N74A 1YOVB 3F3XA 3R4KA 4FB5A 3DV8A 3AOEA 4W9NA 2G0TA 1HW5A 3LLSA 3F4LA 4NQWA 2IEDA 5FLXK 1VE9A 1GHCA 5ED4A 2Q4EA 2F2EA 3ABIA 4OH1A 5EJ2A 1U78A 1PQWA 4MVJD 5D8LB 1K78A 5JAMA 2GZ3A 2KRFA 4UUPA 5LDGA 1TBXA 3QW2A 1UXIA 3CTAA 3LT1A 2QQAA 2CWEA 2G1UA 4BYYA 2R6JA 4KTVE 4LVCA 4CUZA 1Z45A 4D3FA 1R36A 4B4OA 5L45A 1FT9A 1SMTA 2M87A 3WBBA 2VT2A 3OIGA 1HKSA 4H7PA 1FWZA 2BGCA 2HTJA 3C7AA 4QFCA 5AXDA 2BFOA 1JTVA 3I54A 2VYNA 3A06A 5EMHA 5A2QK 5KJFA 3GUYA 4J4TA 2ZB3A 5L7WA 3VPXA 3ZWBA 3D3WB 1M75A 2IA0A 3V8BA 4GAEA 2R2GA 1TQIA 3A14A 3ZMVA 2XASA 5G0VA 2LF7A 4OL9A 3GVIA 1MXFA 3PJDA 4DA9A 1LSJA 3RIRA 2VHYA 3AUAA 2HEOA 1BXGA 2BGKA 3OETA 5KJEA 4AJNA 1EVJA 4MVJP 8LDHA 4TRNA 4P38A 1X1EA 2AQHA 4GYIA 2DAOA 4KIGA 2Q8KA 1IF1A 3HB5X 3HJAA 2I67A 2DM6A 4QXMA 4D42A 2FHSA 4MKZA 2EGGA 5ADHA 2NU7A 2Z33A 2YYYA 3Q9VA 3WDSA 2EA2A 3IMFA 3IRRA 1A7KA 3TGNA 2B0LA 5HS7A 1ON2A 2FZWA 1Z7UA 5H82A 5JE8A 4M72A 5FGMA 5JYEA 2GZ1A 4O63O 2D1YA 1LDDA 4UVHA 3S2FA 4P5OA 4Q3BA 1DRUA 2QRKA 4FHTA 3KXDA 3RUDA 3I83A 1EFKA 1TQPA 1LQUA 2EW2A 3RUFA 3SLKA 5FFZA 3GFBA 4RDIA 3BWGA 3QV1A 3QU6A 5H6QA 4JBIA 2P7CB 1E17A 4YT8A 1F1ZA 2PI0A 2Q49A 3NEPX 2VHZA 4ENJA 2NSDA 2IRWA 3FR7A 3PQJA 4L8VA 1EUDA 3EZYA 2NS0A 4Y6PA 1ML3A 2D5CA 3ZV3A 4N54A 2BGMA 5DCFA 4U5QA 2AEFA 2OMEA 2OZUA 4ZD6A 2JAPA 1P4XA 3PFIA 1BW9A 3OA0A 2XROA 5AVOA 3OECA 5GY7A 2NUAA 1ZLKA 3U9GA 1HSTA 5FYDA 2QBYB 4WNIA 2ZYAA 1P2FA 2G9WA 1RM0A 2V6FA 4CV0A 3OSUA 4NZ9A 4CO8A 2JJYA 3R1IA 4S05A 4YFKF 2Z9OA 3AY3A 3WFIA 4CDGA 2M30A 4IS3A 2W98A 1DJNA 1E7RA 4HF0A 3PHHA 3TDKA 1WZIA 1JAXA 2HMUA 2BHLA 4R16A 1J2XA 1JW9B 3WLEA 4FT8A 4J3FA 5KCZA 1YOVA 5BPDA 4J0EA 3EVTA 1Q1HA 1GY8A 2RGVA 2C54A 2B83A 2D0IA 4WOKA 1YONA 2WYUA 3F6YA 2DI3A 4K26A 2FPPA 3TF5A 3F6VA 3BOQA 1EK6A 5FLXZ 1ZZEA 3HSKA 4B3HA 3K2ZA 3PTZA 4UVCA 4RVHA 2QYOA 1FYMA 2HKXA 5T67A 3CSDA 3FPLA 4BO9A 1XCVA 3DQPA 4E13A 2HOEA 1DFGA 2HK8A 3RKUA 3LF1A 3INTA 4BNFA 1F0YA 3AI2A 1FSEA 2VRCD 2RCYA 5C5IA 5I7FA 3GGOA 4M8SA 4ND3A 1KQ9A 1R58A 4Y15A 3K1PA 1E1LA 1QQIA 5LCXA 3JQCA 4A26A 4Q3EA 2LDBA 1RKXA 2PQ8A 1T2KA 4Q3CA 4E21A 3DONA 4UV8A 2B5WA 1HDXA 2G17A 1FYKA 3TOBA 2GUGA 4ND1A 4ALJA 1U5AA 1Z1DA 4BNHA 3RQSA 5JDCC 3HUGA 4Q4ZF 3PK0A 4KMFA 3WYBA 4Z9FA 2P2SA 4L18B 1WVGA 4HF2A 2PK3A 2CSUA 2OUIA 4HUJA 4XSZF 2GASA 1P1KA 1X7HA 4XYMA 5H20A 2BFPA 2X5KO 4B7UA 2O3FA 3GEZA 1IRGA 3NTQA 4BNNA 4ZHSA 3VPGA 1EVZA 1QXSA 3R0AA 2OA4A 1MV8A 1NAIA 1U8FO 1ZO8A 2I3GA 3ZWPA 4B4UA 3QWIA 1TT7A 2ZTLA 3VPFA 1QP8A 4OOEA 1ADCA 3ZPLA 1H6BA 3KLMX 1EBFA 3MJVA 4HOBA 2IRFG 4JCOA 4ALIA 1U6GA 5HS8A 4NHJA 3F21A 1W7PB 1K3TA 2D8AA 3PFFA 4WGGA 3OM9A 3V2UA 4L0YB 1GCOA 1N1GA 3MJCA 3WU1B 3I64A 5DZSA 4XSXF 3ZWXA 3W1VA 4BNVA 5ICEA 2VOOA 3ABUA 1PZEA 1C0PA 4AIHA 1WLYA 3FD8A 3LT4A 1KY4A 4TV7A 1CGPA 3AAFA 3DXFA 4WNCA 4BMNA 4EUFA 1K6IA 4L4XA 4MVJM 3V5NA 4IDBA 3I9NA 1ZEMA 2NU6A 1TXGA 2NWQA 4CMIB 3ZHYA 4E2YA 4OIOF 3TKYA 5CVIA 4GSKA 4NH4A 2PG4A 1I3MA 1L7DA 3DZBA 4MVJA 1L7EA 1R0LA 5JXWA 1XSVA 2M1BA 3GQVA 3ZW8A 2PA3A 4IHTA 2PTGA 1UDCA 2EKPA 5U1PA 3ZP5A 2XKOA 3PZRA 3IC7A 1B8VA 2I76A 5IZCA 3PGXA 4PLFA 4R9RA 3KLPX 1E3WB 1YO6A 3D64A 4IGEA 3GZ6A 3UFXA 4W82A 1AGNA 3G0OA 3GXOA 2PKQO 1UH5A 3VVCA 4M49A 2WSBA 5J8CA 1ZCJA 2VWGA 3H7AA 3F8NA 4BO4A 3G79A 3L09A 3SLGA 3Q5FA 1U4OA 2F5EA 3KUXA 1PQUA 1R4MB 3DZHA 4NJOA 5JCJD 2PH3A 4IXWA 2C2XA 2QBYA 2X8LA 1ZRCA 3D5TA 4YACA 4U0VA 4NR0A 4R68A 3NX4A 1ZK3A 3FRJA 5CVUA 4LRSB 3ZN2A 3C1OA 3UN1A 5D8KB 5D5UB 1W4ZA 4EJMA 2BEOA 4Z9YA 1IE3A 5HVQC 3PIIA 5T8KC 4BKPA 2IYPA 3UKOA 1AE1A 1ULUA 2OGUA 3CE6A 4E5NA 5H81A 3M2PA 2WC2A 3OICA 4MKXA 1KVQA 1XWFA 4JJFA 2ZCVA 4OU0A 1UXGA 3RJ9A 4A0YA 1A04A 5JC1A 1QZYA 3J80K 4M89A 3IOYA 4DQ2A 2VNAA 3Q6IA 1XGMA 3R0JA 3WFJA 1YWGO 4RLHA 5TGDA 1E1MA 2PH5A 3GEMA 1WI9A 4M9XA 1FZPB 3GAZA 3MEQA 5AOVA 1R1UA 5A9SB 4B4VA 1CJCA 2EFWA 2ZB8A 4FX0A 3WTVC 1ZG3A 4EDFA 3F8BA 5DDGA 1F8FA 2XAJA 4UUNA 3JYQA 3LWFA 3BHIA 3VPSA 4DLBA 1LRLA 4J90A 5TC4A 4BV8A 2DBVO 2H6BA 4HW0A 3RROA 3LZ6A 3S55A 2JRTA 1HEUA 4L9JA 2I99A 3CZRA 3TZQA 3OOPA 2LDUA 1CF7B 5GZ3A 3IWFA 1WNTA 2VXZA 3JQFA 1MC5A 1DO8A 4G2NA 5HLGA 5A4DA 4RS8A 2F00A 2JAHA 3LSTA 3WLFA 3QA9A 1ZYRF 4YCAA 1KA8A 1J0XO 1LLCA 1QYDA 3AY7A 4R3NA 4IQ0A 4IRHA 3ROUA 3TDZC 3E6AA 3O26A 3VH3A 4E6PA 1NVMB 5A5EA 3BMCB 2W84A 2PN6A 1VL8A 1U8RA 7MDHA 4DYVA 3GRPA 2FRHA 4PLYA 3ROMA 1ZG1A 3HHGA 4DLAA 2D3TA 1P1JA 1E7MA 3A9WA 3TN7A 1KC1A 2W24A 2VE9A 1UDBA 1CEQA 1E7SA 2ADUA 4XQCA 4HLYA 3RPQA 3P2YA 2VT3A 2Y1EA 4J43A 4BNMA 2VWPA 2V6CA 3FMSA 1KVUA 5DCMB 2Y1CA 1OAAA 3BY6A 1O95A 1W7PA 3P5SA 3KYCB 4AJPA 5IN4A 2GF2A 3AWDA 4R3WA 1U2DA 3VOSA 3WTUC 1EH7A 2L02A 4P9FA 2O61A 2Q3EA 4IS2A 1YW7A 4Q48A 1SCUA 3P9CA 1O5IA 3FM3A 1GZ4A 2C82A 1E7QA 4KP7A 3VPHA 2FBKA 1PWZA 1BN5A 3VOEA 3MQ0A 1PJTA 1H6DA 4CMIA 1TLHB 2PKRA 3CUKA 3WTBA 3QOPA 1NQTA 3WS7A 1GUYA 4NB5A 2UAGA 4B3IA 2DTRA 4IQ8A 1U5TC 4P22A 1WAMA 3E6DA 5L53A 3ML6A 2VRCA 2Z5UA 1FDWA 1ODDA 3KHUA 3K9TA 2NM0A 5TS3A 2X1HA 4QUKA 1FX7A 1U9JA 2TMDA 3I3OA 1K5HA 1A71A 3H9EO 3R6SA 2P68A 1PJSA 2VOEA 2Y0DA 3DBVO 3WWYA 3NJ4A 5K0ZA 2X86A 4UNOA 1DIGA 2XGXA 3DFZA 3ANMA 3WSVA 4GSLA 1NVTA 1PTJA 1ZK1A 4CUKA 5JDIC 3V1UA 1R4MA 3LA2A 2HS5A 2JT1A 5I9LA 4MP3A 1HW1A 4IXAA 3AW9A 1D3YA 4O0LA 1U8XX 3AI3A 5CYVA 3OJFA 2X0LA 1BTOA 1C3VA 2VHVA 3RC1A 2NAZA 1JQBA 5L3DA 1JWBB 1CIVA 5CEJA 5E8IA 2A5YB 5LHHA 2BYVE 2ZXJA 3T5XA 2L01A 2VBXA 1PDNC 1I10A 3AK4A 1LRKA 2A94A 1DDNA 1PGOA 1A27A 1IZ9A 3GZ4A 4B8XA 2X4GA 4RGRA 3LC1O 3DPLC 4P55A 3L6OO 4ZGWA 2E4AA 2JD2A 3J80Z 2VBYA 1KYWA 4RAZA 3BMQA 3GR6A 1BIAA 1B1BA 2Y0MA 4IJVA 2YV3A 1PIWA 3F47A 4XR9A 4YYZA 2Q1SA 2Y0CA 4R9SA 3IKTA 1XSEA 2CVZA 2DBZA 2CDCA 4L9TA 2O23A 3VDRA 5A9SA 1NQAO 4QECA 4D0RA 4YVFA 2O3TA 4ZYDA 2AE1A 3S8MA 3IJRA 4BQRA 2PFBA 2G5CA 1KC3A 4RPKA 2O2SA 4YIFA 3FXUA 1F8GA 2VN8A 1SMYF 4M86A 3RYRA 3F3SA 2L4MA 4HKTA 5TT0A 5C7LO 5D4RA 3H8VA 9LDBA 5GZ1A 2NTVA 3BMOB 3COSA 1CF7A 3MTJA 3R3JA 3UCEA 4PG7A 2Y1DA 1H9TA 4FC7A 2GQQA 4BHCA 4GO1A 2BI7A 2PGJA 1MKMA 1Q7CA 3AFMA 4JK3A 1ONVA 4PDKA 2I6TA 5JYDA 1OYYA 3GY0A 4ALLA 5KNLA 4R1SA 4RORA 3TWOA 4E32A 1IB6A 1KY5A 4HQEA 3BMCA 1C0WA 4YT5A 3S2IA 3GN1A 3FF4A 4AICA 4XYGA 3RBVA 4BNJA 3M8EA 3E6CC 1O3TA 5JCJA 2HTSA 2Q45A 2P9GA 2ZNZA 3TO6A 1JDJA 1VM6A 4J49A 4XDZA 5BSFA 5I9NA 3CEAA 4Y98A 3W8EA 1PEDA 1JVBA 3O03A 1W4MA 4BOYA 2HU2A 2CDAA 4PLGA 2X9GA 1GPJA 5IDXA 3EK2A 3E9MA 3E9NA 5DCMA 3MTGA 4Y6RA 5EINA 3LVFO 5HA5A 1K6XA 1HE2A 1LDEA 4WF2A 2WV0A 2PD3A 5KKCA 5I9MA 3CINA 3E97A 1OC2A 3DF8A 3V7RA 5D5WB 3GAFA 2DFDA 1ADBA 4E4YA 5TX7A 1BI3A 1VSVA 3H9UA 2L54A 1JKFA 2JFFA 3QP9A 4L9VA 5F5NA 2EK5A 4L73A 4E2WA 3ROPA 1GQQA 3HDYA 3I6QA 4RJTA 2XAGA 9LDTA 4DQVA 1DSSG 1Z6RA 3KVOA 3RUEA 3QRWA 3FX3A 1I8TA 3JV7A 4BUCA 2UUOA 1HE4A 1P1IA 4JQCA 4QEDA 1FDSA 2FSVA 1FK8A 3QWFA 3C3WA 2P7VB 3ANLA 3I52A 1HETA 3HZZA 4YTEA 1PL7A 4ENKA 3DHYA 3VODA 4WLNA 3J81Z 4ZN6A 3E03A 5IFLA 4PLPA 2JD0A 2DKNA 1Q0QA 3GNSA 1J5PA 1VSUA 1G6KA 5ICSA 5G0UA 1CYDA 2QYSA 4QTZA 2EJWA 3ISPA 1QYXA 2VOJA 3U3XA 1T2DA 3JAMK 2RV8A 2BD0A 3JTMA 4HNGA 3MJTA 1O94A 4EBFA 3MJEA 2CD9A 4GPD1 1SAXA 4B7CA 1XEAA 5T5QA 1E3JA 1D8JA 2P6TA 4FIZA 1GUFA 2YDYA 3I5UA 3EC7A 3RC2A 6LDHA 2VCYA 3GVHA 2HCTA 1WZEA 3NGXA 2NRAC 4G7ZF 3C1AA 3ASVA 4JROA 1TB4A 2VYVA 1LJ8A 3A28A 3WBFA 2IXBA 4XGIA 3WIDA 2HK9A 3BDDA 4UEJA 2PGLA 2OZ6A 3IL2A 1IAWA 4S3MA 1DLIA 1FBSA 4FS3A 1WDMA 2DTDA 4XR4A 3QP6A 3PJFA 4QO8A 2RH4A 1HBXG 3ECHA 4BNLA 2O4UX 4N5NA 4RL6A 1EK5A 3HUDA 3WE3A 2GXGA 1ISJA 4AJEA 2G76A 2IZZA 4W99A 1WSUA 3NRVA 1D1SA 5F5LA 4F6CA 1IULA 3EHEA 2ACJA 3EMKA 1XDWA 1DIRA 1SEPA 4ID9A 4AJ4A 1PWXA 1F06A 2EWMA 5D5XB 4EM0B 3JQ8B 1NTOA 1AUPA 3W4IA 1SO8A 3GPDG 2HWVA 2DPDA 4ZJUA 3E82A 3B1KA 1E1NA 3BMOA 3HIFA 1SNYA 2DQRA 3ZV4A 2EKLA 1ZXBA 4RF3A 1IXSB 1IYZA 3GLXA 1NFFA 3GC6A 3L9WA 4J16A 1MDMB 4PCVA 1GD1O 2IA2A 5I7VA 1JHHA 2FZEA 3N4MA 5JSFA 2ISYA 2XUBA 1P31A 3QHAA 4U0WA 5FD5A 3ZMZA 4F7ZA 4O59O 1LX6A 3H65A 3GF2A 4B79A 5JVTA 4KUGA 4CODB 1XB4A 1YGYA 3R6DA 5T8KA 3KV3O 5L40A 1ISIA 4ILKA 1BI0A 4FGWA 3CDHA 1VKNA 3ZWNA 2R3SA 4WXDA 4H0EA 3LK7A 4W7IA 1P4AA 2EFPA 3E3VA 4HX4A 4IUYA 3GW2A 3ABTA 3B02A 1LQ1A 2AS5F 4Q9NA 5CG2A 3PPIA 4KMUX 1DIHA 1LSUA 3HNPA 4OAQA 5ITWA 2JPBA 3RBXA 2M45A 1DOHA 2H9IA 2TDXA 2EEZA 3M7GA 1PU2A 2C7VA 5JFRA 1KERA 1Y81A 2J3IA 1IN8A 3KP7A 2C6YA 1HYEA 3AI1A 3GYHX 1WDKA 4L9NA 1D1TA 3D7LA 4YAGA 4AJHA 4K6FA 2EG9A 2XV4S 3SC6A 5A5FA 3E5XA 1HLDA 4CMCA 1TNTA 1KQ8A 3K92A 4J4HA 2EHDA 1LB2A 3M2TA 4XLPF 3DHEA 5D6EA 1SFUA 4MQVA 3ROQA 3FTNA 1C14A 1KYZA 2JFGA 1G1AA 4ZU3A 4MHGA 2I3AA 2JHGA 3HTUA 4RAYA 1ZH5A 1FBUA 1HLPA 2C5AA 3DBLB 1B9MA 2AHRA 4ESOA 4WKGA 5CHEA 4AJ1A 3J7AO 1KYQA 1PJCA 1Q1NA 2NNLD 1SD5A 1O57A 2O48X 4OOIA 3AOGA 4YFNF 1IZ1A 2W2KA 4ZQEA 4BGVA 1U2WA 4KMSA 4YAEA 5DUIA 3I4FA 4Q3DA 5ENVA 2O0YA 3KYDB 3F5QA 1NHWA 2JCYA 4GGPA 3WYCA 2A07F 1JWAB 2NV6A 2ZB4A 3T8RA 1N9GB 1SMKA 1MFPA 4TVOA 4QFDA 5JMWA 4UVAA 4G7HF 3WNQA 1SD7A 2GA1A 2LNBA 3KCCA 1FDUA 5COBA 4PCQA 1IN7A 2X9VA 4EI2A 2YFQA 2F5CA 3RYPA 3UOGA 5CJ9A 3CXRA 5K6AC 1S7AA 4PGGA 3RJPA 3DO5A 3DWFA 3GF4A 1LNQA 4I5GA 1XA0A 2Y0EA 3WXBA 4NNJA 1XGKA 4RZIA 2HMSA 1UFMA 2BBYA 4CM4A 5B37A 2C07A 2AXQA 1UP7A 1IXRC 1DC4A 4IDGA 4UAGA 5AXBA 3GMSA 2HMTA 1OPCA 2DK8A 3PYXA 3RAJA 4MJLA 1NASA 4O1MA 3FSRA 3L9FA 3K73O 1O0SA 4WEOA 1EH6A 4FFMA 4ZZLA 3PYMA 2J5PA 3DEUA 3GZ5A 2WD8A 3VKUA 5JY1A 5DP1A 4CLDA 2WMDA 1YW8A 2IYOA 3RU9A 4XZ3A 3ZMUA 1Y7TA 1PR3A 2EXXA 4FW8A 1EV7A 1LBEA 1USSA 3BYZA 4AJOA 2OU2A 4J6FA 1U7TA 1NR7A 5J6XA 3K8ZA 3PI7A 2IA1A 4CMEC 1RM5A 4NJMB 3WOHA 5BSGA 3VTZA 3Q9NA 5HTOA 3NTRA 2W57A 2JZYA 4I09A 3PGJA 1M6WA 4AJKA 3DBRB 4KN4X 4OJNA 2QW8A 3BA1A 5ES3A 4XGNA 1PJLA 1PJ2A 1KBZA 4TRJA 1MDMA 4R79A 1YKFA 2P5LC 3WG9A 2DLLA 5LGNA 4LRTB 4PLZA 4TRMA 1IN4A 3PWKA 4XA8A 2D4AA 3ETEA 4LSWA 4Y67A 4YT2A 1DPUA 4LD5A 4EJWA 1W0CA 3AUTA 3TL2A 3V4GA 1K6JA 3T0YA 2VZ0A 2ZB7A 3AM3A 1UCRA 1UHWA 1VL6A 5B12A 4URFA 1JE8A 1JKJA 4IJUA 4J91A 2I66A 1PL8A 1YW9A 3RU7A 3O38A 3LAJA 4FX4A 1MB4A 2FSSA 3RKWA 1PP7U 2VTEA 3K5PA 4FJ0A 4M87A 4NBUA 3WTCA 1V3UA 4JX8A 1EBUA 2EV6A 3JD2A 1DFIA 5K5QA 4AIJA 3ZNOA 4HLXA 1PJ3A 3F5SA 2C20A 1HZZA 1IY8A 1DRWA 1O3RA 3QIVA 4XCVA 3DQVC 4GGGA 4BHPA 4MP8A 2DPGA 5BSHA 1SEVA 4PLWA 1IHYA 4XB1A 3GX4X 4KUMA 1JGSA 1KQ0A 2YDXA 3C7DB 3T7EA 1YXMA 1RUNA 2RIRA 1S7CA 2ZK7A 4KQXA 3IRQA 4J1SA 3F8CA 1FYLA 3RKYA 4ONEA 4YAJA 3UVEA 3GGGA 1C1DA 1MUUA 1EQUA 3DTYA 1NHGA 1XIVA 2RHCA 2B69A 3GNTA 4WCFB 2PR2A 3ONFA 5COAA 3GG9A 3DBLA 3SZTA 2ZNYA 5C3MA 1OZAA 2Q0OA 4LVUA 3T8TA 3WTTC 1R0SA 3U49A 1BVRA 2CUKA 1EZ4A 4CLEA 1I3KA 2AG5A 1IN6A 3KP2A 1M6HA 3JD3A 2JL1A 3F23A 2OZPA 2CQKA 4MEYF 4LLLA 1A4UA 3KYDA 2GERA 2O4CA 4CLOB 3B1FA 5JR3A 1N9GA 2VBZA 1OFGA 4DMLA 5KVVA 4DGSA 3EDPA 1HW2A 4IGFA 4CPDA 3M6IA 3QU3A 4DBVO 4CMGA 1P4WA 3L00A 1EUZA 2ZJ0A 1AHIA 3C24A 4KWIA 4PN3A 2XKPA 5JS6A 1Q7BA 3N7UA 3I9KA 4NFSA 3A1NA 2GWRA 3KP6A 4B09A 2GGSA 3TDUC 3JYOA 2ZTMA 2RQPA 4Q47A 4NK5A 4OM8A 2ZIZA 1QLJA 2VNSA 5KKAA 1PGPA 1FSHA 3GDGA 3MCVA 1PGNA 5DD8A 4WXCA 3QVWA 3DAFA 4ZYHA 4JBAA 2HR3A 4Y17A 1T1RA 3ZNPA 4BNGA 1ISMA 1BOAA 1PZFA 3PQKA 4HAMA 4JQFA 3MEXA 3QVSA 1I32A 1VPDA 4GI2A 4ALMA 1HRDA 4CM5A 4GWGA 5CEFA 1VKOA 2XPCA 4G6QA 1Z75A 2Z1NA 5IF3A 3P19A 3WJ7A 2OD5A 5GZ6A 3MAJA 1XQ6A 1D5VA 1B26A 4PVDA 3WGZA 4YRBA 1XSDA 1M66A 2PZMA 4Y9DA 3BTOA 1E7WA 1MLDA 1MP0A 1YVEI 1QYVA 4ASNA 3JQ7B 3RBZA 5JC8A 3DAGA 4JBGA 3DZIA 3TOXA 2QENA 4EM2A 2G7HA 3COAC 5EN4A 2KJCA 4Q5SF 1E3LA 3L4BC 4NJMA 4BGIA 5TSDA 2DPUA 4PGHA 3DBRA 1LDJA 2STWA 1YDWA 4FCCA 3NJ8A 1OC4A 1GXQA 2J8ZA 3FCOA 1CF2O 2C59A 5ICGA 2ZQZA 3L07A 3Q2KA 4GMGA 3DFUA 4NU5A 1QYWA 1FOKA 2M5WA 3G17A 3ROKA 4ZA2A 1E3SA 5K5RA 4D79A 2ZFWA 3X2EA 4GX1A 5BQFA 3MWMA 4UHTA 2VWHA 4A0XA 1HKUA 3UAGA 3VB2A 3BTSA 1Z73A 3ZW9A 3ZHZA 5I7SA 4FQ8A 1C0LA 3DKWA 3HOSA 1N92A 5L7YA 3QPHA 2G7UA 1EDOA 3CUQC 3V8KA 1HL3A 2OO5A 3JD1A 1T26A 4EJ6A 1Y8RB 1YH3A 3BPXA 4ALKA 1YL6A 3DMTC 3NUGA 4OKNA 5HM8A 1NQ5A 4ZQBA 1ZG5A 2FBHA 1PZHA 3H3UA 4F46A 1DEHA 2XVCA 4Y8VA 4ZQHA 4ROSA 1ZGAA 1ZAOA 3F6OA 4R1HA 5F1RA 2QQ5A 3NV9A 4P4GA 2UUPA 1J6UA 2VQ3A 1YJQA 2HFHA 4ENMA 4LG0B 4CICA 3BHMA 2B36A 4QO7A 1ZUD1 4QT0A 4E5PA 4QSMA 4CM9D 1R22A 1VL0A 4EYEA 4WK6A 3WJAA 3KYBA 4CZZA 5A2QZ 3GFJA 1OOEA 4Q3AA 2B0JA 1DPRA 4WCFA 1AN9A 1KS9A 3H6KA 4D44A 3D3WA 4LCEA 3QP5A 1P77A 3OMLA 3TZHA 4BO2A 5ERIA 1R1TA 1QBJA 2EA4A 3HRMA 1SBYA 2EP5A 3WMXA 3C1TA 1EQ2A 2K02A 2CGPA 1Q0HA 4B8ZA 2NNYA 1MXHA 5TJJA 3JCZA 4TZKA 4BMSA 1GEGA 4RZHA 3VH4A 5F6FA 4CLOA 1DP7P 5DP2A 2QRLA 3OJEA 4YEDA 5TQVA 3SJUA 3DAPA 4JP3A 4EW6A 2GN8A 3DBHB 2HQNA 5T57A 3GHYA 1RIOH 2EKQA 4UUMA 4E3ZA 2UXXA 3SVTA 3E1KA 2HO5A 3GK3A 3VH2A 5L4SA 5CDGA 2C0CA 3KP3A 4KQWA 1A9YA 1I0ZA 4L0ZB 1ZRDA 4U7DA 4NIMA 4E5MA 1O8CA 3D3EA 3L7WA 3ZN1A 1F5TA 1LDNA 3EYYA 1E92A 1X14A 2BKAA 4CM1A 3MCZA 1UP4A 5G2OA 1JHFA 4IPTA 3RCBA 2DT5A 4KFCA 2Z95A 3VVBA 2L3DA 3RUIA 3NEUA 2VUTA 5KK1A 4BIIA 3U9LA 4DWVA 4YJHB 4PG5A 2XXJA 1YRLA 5FEUA 1IW7F 2PV7A 2Y75A 4EV0A 3GEGA 5EPOA 1HE5A 1J7KA 2JD1A 3GUCA 3JQ7A 4YA6A 4YR9A 4TKLA 4BO5A 2B5VA 2OHXA 4IDDA 5LC1A 3TJRA 3F72A 1I3NA 1BVUA 1NWCA 1RUOA 2WDZA 2UV8A 1K2WA 2A3SA 4GLLA 4BS9A 1ZK0A 3EY4A 1FJHA 3M1LA 4G5HA 4IDEA 3HYIA 3ADPA 2MH2A 1FDVA 2XAFA 1HDCA 1YL7A 2AQIA 1YL5A 1WMBA 3W6JB 2O3SA 5CG1A 2VE8A 1R12A 5JBIA 4E5YA 2KKOA 1XU7A 4R41A 1NHAA 3C18A 1HDZA 1ZNQO 3Q1LA 6ADHA 3FNEA 4EMSA 3RTRA 5IXSA 2BF7A 1N7HA 3I0TA 5ER9A 2EFOA 4B8WA 1PS9A 1SC6A 4LLNA 1H9BA 3ZNNA 4J7XA 3QE3A 4NI5A 4ITUA 1Y5RA 1H9GA 4QLCU 1SB9A 2DQLA 3HFSA 1HTBA 4YQYA 2FF4A 3JYPA 2MH9A 4PVCA 1KU3A
chains in the Genus database with same CATH superfamily
1ORWA 4F56A 3SFTA 1B6AA 1IHXA 4O2BB 4PG8A 1T43A 5KQMA 1RE0A 1U1DA 4RA2A 2YVUA 3I34X 3FSGD 4PW0A 4QPOA 2X6TA 5CLSA 2OD9A 3C7TA 4DVGA 3P2IA 5EKDA 4MHTA 2EOAA 4A4DA 2CVQA 4R8SA 1TT0A 1YQDA 4QDKA 5GP9A 4A8JA 1ZIPA 3A03A 2XSDC 1Z2PX 5LA6A 1JR3A 3HJGA 2E1OA 4JOBA 4LV5B 1XEWX 2XI4A 3USES 4BHTA 3SR4A 4Z1MD 3P8ZA 1EFHA 1TZ2A 5JNVA 1UFKA 4E5SA 5U9CA 5ES4B 2YX7A 1R00A 3L2CA 2CYAA 2VKHA 3P0FA 3VVLA 3IDSA 2V7TA 2WE7A 1OBHA 5KTYA 4DLWA 3A02A 4GX5A 3LWBA 2QXUA 4A91A 5A4IS 3L2WA 3N8NA 5AXAA 5GIPE 1P9NA 2OVFA 3BICA 4DYHA 3KBOA 3I6ZA 1Z0AA 3KVRA 3OCXA 5JZBA 5F64A 4O8CA 3C39A 4YPOA 4QQNA 3OOHA 2A35A 4YJGA 3SDBA 3NP9A 3TXXA 4N5MA 4AKHA 3GLFE 3ZQCA 2EBWA 4HWPA 2P4EA 3PFYA 3V33A 1EP2B 1TK2A 5BQ3A 1WRBA 1WCWA 5TPZD 2Q9AA 2HBZA 1FS6A 1CJKC 2A78A 4EVSA 1G3SA 3IP3A 2FSFA 4CCKA 3OM1A 2QK4A 1KAOA 4Q3KA 3HCDA 4R1UA 1YZHA 1X7WB 1OR7A 5K3BA 1BHSA 1ZLYA 4GMKA 1E3IA 4MOWA 2XNDA 3CV3A 1A6IA 4P2BA 3TNLA 2DUUA 3AINA 3OY2A 1TZJA 3DCYA 1AK1A 1ZD3A 4MV7A 1U1CA 1Q1BA 3IULA 4D8UA 2QP9X 4Q1EA 1DFHA 2IZ6A 1T1JA 4M1OA 5L7TA 5D00A 3NIDB 4MW1A 3NHWA 1E8MA 4JXKA 1N5IA 5CAEB 5ICMA 1ZRFA 3AR8A 1S8FA 1RP7A 4ISBA 3BJZA 1AGYA 1SIUA 5HF5A 3G6EI 1AZLA 3G8BA 4RKRA 2R8PA 1BC8C 1D1PA 5MGNA 4P82A 2BY3A 4ZK2A 3ZE0B 2BGLA 3M1AA 1RE1A 2FOIA 1CUVA 2JIZA 4C7KA 2JGMA 4NQWB 5BN4A 1MAWA 1W73A 1MFZA 1QHEA 3AM5A 2ATXA 2R96A 3DMHA 3RC9A 4KX5A 1VHJA 4COOA 2J0UA 2ZBEA 2QVYX 4EG7A 3EXIB 4WXRA 5LP6B 5C4MA 2PSSA 3MG9A 3ZNQA 2QLMA 1S8NA 3FZQA 1E2XA 1N3LA 2NOAA 3W2AA 2BJVA 1A36A 2CXSA 3JASB 2VI5A 1CV2A 1ETUA 1Y1PA 4FDMA 4IY1A 3I72A 4ZZDA 1LDKB 1PK7A 4PHFA 2WV7A 5FYQA 2W48A 3Q3VA 2DHDA 2KLOA 4ESJA 3W5CA 5FUQA 4FGSA 2Y66A 1E2JA 2OP0A 1SAYA 1PWHA 3HH8A 4TLBA 3L9XA 2PS0A 4LJ5A 4YB8A 3GA5A 1W49A 3GRRA 2ECKA 2OHJA 1P5ZB 1E2LA 5M5WJ 2ZIVB 4KDRA 3P0HA 2JFVA 1OFCX 4HDRB 4TWZA 1G42A 3CUVA 3CRQA 3ZY6A 4H6VA 3QI7A 3GLGA 3MJSA 3J7TA 2PKXA 2IYZA 2IYAA 2PNFA 1TCVA 2WF9A 4HH4A 2X2EA 2GDZA 3QY0A 3FBGA 1T3LA 4R54A 5FEMA 3R5KA 1E3EA 2JBAB 4RHEA 3CDLA 5IM4F 3H3JA 4CYDA 2ZQYA 1Z21A 4WD3A 2X8JB 4TT8A 3B82A 5A62A 3BK1A 3V4PB 3IAUA 3TW0A 3I09A 3DEZA 1SD4A 5HDKA 4JLBA 4RPGA 1J4AA 2ODPA 3K6SB 4YBZA 2BN4A 4KBYA 2Z09A 5L3EA 5T6BA 5DNDA 5CA0B 1A4XA 2CDBA 4IVNA 5TJHA 3GTGJ 5AP9A 3G8AA 4DRZA 1P1RA 1QVTA 1TM7E 2CBGA 4O2AF 3HPRA 1LI4A 4OREX 3JAWB 4PG4A 3DD5A 3K71B 1J33A 4BXUA 3TIVA 3Q8WA 1N5OX 1RYNA 3PHJA 1F7VA 3FNHA 2ZJBA 2YWJA 3RVJA 3OEED 4LQLA 2HF2A 4KXUA 5AW1A 1CULC 4YQZA 2X3YA 1Q84A 3LQ4A 2H1OA 2OPTA 2UWMA 3BJEA 3U1KA 3O0DA 1E6KA 1S6LA 1P92A 1RYHA 2EQBA 2LD4A 2AI1A 5ABPA 4B4WA 1LLUA 2L5QA 1YYVA 3VMFA 3OG9A 4EARA 3EZ7A 2X22A 5AONA 5DV9A 4O5OA 3KDSE 5KSPA 1EFLA 2JI8A 3QUAA 1E1QA 2VJ5A 2ZSBA 1DEKA 1DJQA 5DTEA 1F6BA 3KJGA 2CO5A 2HJGA 2I6FA 4FHCA 3VFZA 3IIKA 5HK8A 5BYAA 5A02A 3F8FA 4MYCA 3NWBA 1TM1E 1KK3A 1NYRA 2M1XA 2KX7A 4MWEA 3AEKA 2FKNA 2ID4A 4I50B 3VC3A 3N76A 2ZRBA 1KZ7B 5FWDA 2OK7A 2PX2A 3VPBA 1VLJA 3NHAA 3CCLI 4U2FA 4D41A 3PA6A 3IT0A 4P84A 3PENA 1OR8A 4ZMRA 3O2PE 1YC5A 1AKUA 1I6WA 4YY3B 1TT5A 1NVEA 2O8DA 3PDJA 5CYFA 3STXA 4NS4A 5DYGA 2DR0A 2VA8A 1ARZA 5ALFA 5BQTA 1JG7A 1FTZA 2V6GA 2AJCA 1SQGA 4AZSA 3DFFA 2WJYA 4YLEA 4L4SA 3PHIA 2ORIA 1Z6ZA 1T8SA 4DGQA 2CU7A 4PSXA 2ZRAA 1E4VA 1L0BA 3IVRA 1U3EM 4W1SA 2M1ZA 4MS3A 1P45A 1GTMA 1KJWA 1OLUA 3SPXA 1H94A 1NF9A 2W1OA 2MMCA 2ME6A 5CLLA 1EWRA 3JCUC 1C3OB 1NUQA 3AFOA 4LISA 5JCOA 3CH5A 3OFKA 3JYNA 2MSDB 1U0FA 2HXOA 3WKBA 3HCFA 2GSDA 3UOAB 5AJYA 1TRHA 1TTPB 3FZGA 2VK2A 2JLSA 4Q9DA 4UEKA 1LWOA 4ZYUA 4ZAFA 2H1CA 4PZUA 2ZSKA 4L5IA 1MBEA 4W5HA 5IAJA 2Y71A 4EZBA 2HJRA 3BGDA 4R1QA 3FPHA 3L7OA 4YJ3F 3AY0A 4YJFB 3CMMA 1ETVA 4L74A 4UDXX 3X43A 1U2QA 4RDCA 1JVSA 4M1QA 2ZXIA 3L7CA 2AQKA 3U4QA 1ZKDA 5EGOA 3W7AA 3M82A 3VC7A 4FD3A 3A01B 1SZDA 3LAPA 4RB2C 5D6OA 1XC5A 5DT9A 4B40A 1DQSA 4K81B 2CUNA 1DC6A 3PC7A 2BTQB 4E15A 3U4IA 3TE6A 1Z67A 2R1ZA 1O8BA 2IODA 1YX3A 1V8DA 4QHTA 3PDIB 5FHQA 1AHHA 1BI2A 2V0NA 2XCSB 4XCXA 4LC9A 4KPUA 1ZM7A 1QLHA 2IHTA 1LJ9A 3K0LA 3SXUB 5DTMA 4IINA 4KQGA 1Z82A 3TAXA 2OBXA 1MAAA 2J4CA 1A5SB 4MFDA 1UEJA 1IWBB 3CNNA 2I2XB 1JYFA 1Z29A 1SXJA 3U5TA 4E22A 1SFEA 2YIVX 1ZL0A 1SZCA 4S1TA 5EXDA 4UTXA 4G1CA 2NU7B 2O20A 4DIQA 2FW0A 1WW3A 5IYBJ 2ZI9A 2R7KA 3NHMA 3MBIA 2HF9A 4LJ4A 4QGHA 1KZYC 2GWHA 1JBEA 2FPUA 2VBWA 4M0FA 4A27A 1ZMBA 2ZBPA 3MS7A 4TMWA 1W8DA 3IP8A 4HFJA 4IJQA 1PJ8A 4NBWA 4JBYA 4NV0A 3MERA 1HT1E 4LTMA 5FPYA 5DYIA 3JQRA 4BLWA 3W06A 1FOYA 4G0VA 1R5JA 1K78A 4LYYA 4L2IB 5JJIA 3ZQ4A 1A2BA 5TY0A 4QATA 1SMTA 3UAOA 1RRFA 4ZCSA 3HCWA 1OXBB 5AVKA 3HUGB 4U39A 3K0EA 5J1UA 2QL9A 4LOKA 4DA9A 3Q5GA 4K6KA 5D8DA 2QM8A 2ZYWX 2FHSA 2ZSAA 2YYYA 5BW8A 5BQPA 4Q3BA 2OTLI 1ZU4A 3RAPR 3QV1A 4ZODA 1XKTA 1FVFA 4HZUA 4C29A 2VHZA 4BAZA 4EGSA 2BGMA 1FJXA 4KQ2A 3RT7A 3IBSA 2ORYA 3LDGA 4R1MA 3ZYZA 3F2VA 1SFRA 2KHZA 1XRSB 4LJ6A 3EGCA 3P97A 3G0GA 3AX6A 2BHLA 2PSFA 2C54A 1YONA 3RHFA 4RVHA 4E7JA 2HK8A 1W0JD 4AIRA 3AI2A 4O4JF 4IOJA 2V96A 2P6RA 1FFGA 1OTYA 4C0AC 3ITNA 3SICE 2QPOA 3AR5A 4BY1J 3H2HA 2ECPA 3ROXA 5BPHA 2OECA 3AMVA 2M0MA 3U7QA 1RI3A 5H20A 2BFPA 3I01A 3GQBA 1BW6A 4JI0B 2Q2OA 2Q5QA 2I3GA 3RWMB 1U8FO 3ASYA 2H2GA 4QQFA 5LXTA 4Y7NJ 3F21A 4WGGA 5FPKA 3ELYA 5F0HA 4IIHA 3ZWXA 1JDBC 3W1VA 2Y31A 5CRIA 1Z4IA 3ZCTA 3DTVA 3M3DA 2NXNB 2XNSA 1QGOA 1J2JA 4P7BA 4L78A 2JUCA 2PTGA 2H2IA 2FEAA 1Z0KA 4ZJPA 2JFPA 1VSQA 1AGNA 4TKVA 4OM7A 3KQSA 3ICQB 3F8NA 3DLIA 2VBIA 2H7XA 4XSHA 4EJMA 2IYPA 4MKXA 3QLEA 1RC8A 2A88A 2PZEA 1KYYA 4X8OA 3V4SA 1P72A 3MMYB 1E1MA 6REQB 3ZV7A 2KDZA 4O4LB 5DDGA 2P0EA 3IAS6 3OLYA 3TLCA 1Y3AA 1G2HA 3CZRA 4KOEC 3LL7A 3K6GA 1X7YA 2Z2IA 2QKYA 5LDDC 4COKA 4IRHA 3ROUA 1PK9A 1E62A 2V98A 1C5KA 3OPXA 1OIXA 3DEKA 3Q5DA 1UC8A 2FF5A 4UCQA 1PZNA 2Y1EA 4J43A 4BNMA 1N6NA 1O95A 4KPFC 2GF2A 1PNTA 3B85A 1QDLB 1KMNA 3QEKA 1ODDA 4FNGA 4GXRA 3A9UA 2WMOB 3VA7A 2YUSA 4X41A 2FOLA 1G3QA 3R3YA 4UUSB 5JDIC 4EKEA 3CWCA 1NRJB 2PSDA 2X0LA 4JX4A 1F38A 1EJ0A 3CT4A 3F5DA 4QBHA 4P55A 2NO5A 2E4AA 2W2QA 4HDOB 1AMUA 4QYTA 1PIWA 2B2XA 3CS3A 3QPAA 4D0RA 2I2WA 2QM7A 2JCBA 1DMRA 4BQRA 1KC3A 4YIFA 3FXUA 1F8GA 2HPIA 5FPTA 4C05A 4EG6A 4QLOA 1IUNA 3E84A 1YFZA 1H9TA 1E6MA 5EI5A 4I3GA 1FIUA 2H08A 4MFEA 1C0WA 4K6OA 3BT9A 2O8EB 1OX6A 3E6CC 5I9NA 2V7QA 4AXXA 3UK1A 4RAOA 1C4WA 3LVFO 4TT3A 1SUIA 1HE2A 5CQGA 2REXB 2VHUA 3E97A 5DSXA 3PFBA 3QEMA 2XAGA 1JGGA 3OT1B 3ZCQA 3JR3A 5AKLA 1SVKA 3ESBA 3LPNA 4PZ9A 3DHYA 4ZN6A 3I45A 3E03A 1RYMA 2JD0A 4ZYXA 5CM2Z 3OZAA 3DKXA 1T2DA 4D1QA 5EE3A 1GGVA 3L41A 2XHZA 1P9QC 3F90A 2DT8A 4JROA 2HK9A 3RNLA 2A5WA 5CR9A 2FB9A 1G63A 3B48A 2XGOA 2FX2A 2JANA 3ZXSA 2VJMB 1NVFA 1SCIA 5ALHA 3EMKA 1R3UA 1ZHOA 4BRZA 3W4IA 1WPKA 1CZHA 1EGHA 3WFZA 1P31A 4F7ZA 1MH9A 1RBZA 4B79A 1XB4A 1UBNA 3EIQA 1H66A 4JYCA 4YRPA 3WYFA 3DV2A 4RY0A 3KV1A 2RREA 4KMUX 2Z2JA 3NBQA 3X1YA 2BE9A 3U40A 5BOSB 1KJ9A 2C7VA 2J3IA 2IH5A 3QPWA 1VLVA 4KLRA 4HN2A 5T3YA 5D6EA 5TV2A 1AY0A 1OHHD 4B6QA 1B9MA 2JEYA 3AOGA 1SD5A 1PFWA 3KZ1E 2ZB4A 3T8RA 3MAGA 5LWHA 3CUYA 3EUHC 5TS2A 3VNVA 3ZGVA 1KNXA 4MUHA 4XQ0A 3C8UA 1FRFS 1ZN8A 5IAOA 1S7AA 1YQQA 4PPFA 5K2MA 3QXSA 3WB1A 1I6LA 4UAGA 5AXBA 3BS4A 1NASA 1TADA 5C8XA 1I4LD 1WXIA 1EH6A 2G72A 2C78A 3PYMA 3TBFA 1P81A 1P2GA 1YW8A 3HBMA 2QL5A 2WFAA 5J6XA 1OU0A 4CF6A 1UFOA 5ECGC 5AJHA 4POOA 2BM1A 3MWFA 4UHJA 5LGNA 4C0JA 4ZVUA 5EG0B 5HZGA 5HPYB 4Y67A 3VKGA 3PX3A 1W0CA 4P2GA 1X3WB 4TTSA 1UHWA 1JKJA 4J91A 1YW9A 1U3FA 2JWTA 3BG3A 3TW4A 3T1YB 1VYHA 1T8WA 2R60A 3D4IA 4BHPA 4BDTA 2PXXA 1JGSA 4BP3A 4CN8A 2G4LA 2XNHA 4RZXA 3GGGA 3VZDA 3D2AA 1KORA 4QBTA 3K2AA 3JD3A 3AP2A 1SVSA 3CW9A 1EUZA 1SOUA 1KKMA 4G6ZA 5HQTA 3JYOA 2FI1A 2HRCA 1CZOA 1PGPA 4NPHA 2OM2A 1XKXA 3HB1A 1MT0A 1VPDA 2WVJA 1VKOA 5KVAA 2XDAA 4UHBA 5FR2A 2EFJA 3IPRA 2Q5FA 1UM8A 4PVDA 5HVNA 4XMYA 2W6CX 1XTQA 2OCAA 3KQYA 3COAC 3UYKA 4NJMA 2CV0A 1A5BB 3C5CA 3T5PA 3ZJTA 4K6HA 2C59A 5ICGA 1TQ8A 4ZDOA 1UBLS 5K5RA 2Q1YA 3X2EA 2VJIA 1Z73A 5KNDH 1JFRA 3KAQA 2WFMA 1EDOA 3T3NA 1WVMA 1T26A 4ALKA 3NUGA 3NJRA 1SVNA 2GXQA 4G84A 4QYWA 4D57A 4C5AA 5HFJA 3TRJA 4CM9D 4RZSA 4YV0A 1DPRA 1LNSA 1VPTA 1PEKE 4LCEA 3BA6A 1HDDC 1S96A 5K01A 4GXTA 4B8ZA 2NNYA 4QUHA 3UJBA 4RXTA 2DKOA 2ZJ8A 4LFAB 4F93B 5HDBB 1W5BA 4L0ZB 4P1ZA 4LVOA 1F5TA 3OD1A 5BR1A 1OAOC 4GZMA 3IJ5A 1Q57A 4R8VA 5AH0A 4LOLA 3DKVA 1NBWB 4DWVA 3Q88A 1HYBA 3GEGA 1V5GA 4YR9A 4BO5A 2Z57A 2C4VA 1K2WA 1NRIA 2AQIA 1YL7A 4CUGA 5E8RA 1U6KA 4QPQA 5E7JA 4NCHA 1EWKA 1UK7A 3TBKA 3LHSA 1QBGA 5J40A 1NZDA 5ER9A 1E94E 2P3QA 2V9KA 3RJMA 1XMJA 4WXYB 5HM6A 2DQLA 2DFTA 3B6KA 3L84A 1XEWY 4D4MA 3LBNA 1ZFNA 2L18A 3CX7A 3FOEC 3ZMDA 2XAHA 1YFJA 1E1DA 1PG5A 3RTGA 3BXGA 5KQSA 4Z1OA 3ST7A 1YRYE 3TNFA 3B20A 3TO9A 5C1PA 2FUKA 3F9IA 3MT7A 3B2EA 2PJRA 1TVMA 4J0FA 1T6XA 2J3LA 3DEFA 4MO2A 1U0RA 4EENA 5TR9A 2IU6A 2JFXA 2XOKD 4N1AA 2BVMA 3IHWA 1NW9B 4Q9AA 3F8MA 5B4VA 4ON9A 1JEQA 1MSFC 3HCNA 4O4IB 2QVBA 2GLUA 1T35A 2NLOA 4P83A 2QJFA 3TBHA 5GV8A 3Q8MA 1LLDA 1CDOA 1U7OA 4HFNA 4AKTA 2L19A 5FJ8J 1KBOA 1LGYA 4F8JA 2SECE 1GCAA 4KQEA 2X0RA 3L49A 4WKCA 3ILXA 4NFLA 3IHTA 3QFTA 4HSRA 4JKIA 4FISA 2POQX 4IIEA 1PGQA 1AF4A 3QFFA 4PO1A 2V6JA 5BUZA 3CR3C 2VK8A 2PUGA 3FE2A 1M1UA 2E1RA 3ROGA 5ALVA 5BW4A 2IUUA 1VZ0A 4JAVC 5B5EC 4YWJA 1SG9A 3X1KA 1GL7A 5A7GA 5IPAA 2WJ6A 3O4HA 4D9IA 2YJGA 3I4CA 4XQGA 2XNJA 1ZVMA 2QNRA 1NI5A 2OOSA 4HDQB 3KETA 3KEFA 4LJ7A 3DOJA 3L8EA 1O9GA 4NC9A 3MFKA 1CETA 2OESA 1USUA 4M74A 1E7YA 3IE2A 4CCNA 2REQB 3RIGA 5C5EA 4Z6YA 1V11B 3OFNA 5TQ0A 2J9YB 1LVUA 1IJWC 5IYZF 3FH0A 3KEGA 2O0LA 1O97D 3RSLA 3IUPA 1D09A 1UKZA 5KNBA 1X38A 4ZT2A 3E3AA 2FPMA 2LY9A 3N3BC 2CGEA 3D4PA 4BY9E 2Y30A 3S68A 1S7OA 3ND5A 2GCOB 2JIOA 4OXYA 1AU7A 3EIWA 2VRWA 2Q9UA 1NQUA 3WV5A 3K9HA 4CEHA 1JLHA 3ETLA 5BV1A 3A6EA 4EQ6B 1YGPA 3IEXA 5AQ1A 2FR8A 4JLKA 4B3GA 3VNAA 2COEA 1C0IA 4H16A 1RRJA 1UINA 1YUNA 5DV5A 5ICFA 4OKIA 3EDMA 2VYND 1UJMA 1ZGHA 4XJTA 2VFAA 4GRAA 3IP5A 4FLFA 4I66A 2HNAA 2OORC 1MJGM 3RWBA 4XM3A 2MYTA 3MOIA 2Y1FA 4YIRX 1QIIA 3HSRA 4TQGA 2VSXA 4XEUA 4P7FA 5KYNA 2TSYB 3II6X 4ID3A 3HYTA 5CX1B 2GD0A 3FOWA 3EBPA 1QC5A 1S3SA 1P7VA 2H4ZA 3KWFA 5F23A 1P80A 1T6YA 3SEQA 1V5WA 3H1BA 1WJCA 3L0YA 2EF0A 3DTTA 2GZ2A 3GLTA 3PM1A 1A8SA 2JFHA 4KYIB 5DT2A 5A2QA 1DEOA 2HBRA 1SXQA 1KO5A 5LMCA 2RAUA 3DB2A 4JBHA 5EMNA 3H5NA 3ZHBA 3O8OA 2YASA 1PR9A 3CZ5A 3CJQB 3E61A 3W9YA 3FNGA 4TM8A 3ERED 3MWYW 2ALJA 5IJ9A 3DTKA 1N32B 1ZDMA 4GM0A 3Q72A 3WSWA 2DB3A 3VDNB 5DBGA 2V26A 3QOEA 3TOAA 1MEEA 1RFLA 4W5OA 1JH9A 4RHCA 5BOXA 1NYQA 2B7CA 5KOIA 3V1MA 4YGXB 3FPBA 4OBBA 4ZALA 4A3KJ 4BC1A 3K16A 1AKRA 1ZXLA 2DU9A 3RYTC 3SYLA 2IYLD 4XRGA 1KEWA 2BM9A <