3WGHA

Crystal structure of rsp in complex with beta-nadh
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
206
Chain Sequence
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLNNFYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTSFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVSYRLNEEELFKKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox-sensing transcriptional repressor rex
publication title Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes
doi rcsb
source organism Thermoanaerobacter ethanolicus
molecule tags Transcription
total genus 68
structure length 206
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wghA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wghA02
5JXWA 3EVTA 4J43A 1NASA 2UUOA 3AOEC 4CMJA 3ZW8A 4OQYA 4CM8B 1ZXBA 4IJWA 3RJPA 4EM2A 3K73O 5L7TA 3I58A 2Y1DA 3L4SO 3PJEA 1UP7A 3CEAA 2EJVA 4IXWA 2A35A 2O3JA 1K78A 4M86A 4OMUA 4RVUA 3GH3A 1FT9A 4TVBA 4HYEA 4CODB 3DPLC 4J4TA 3CUQB 5C37A 4R68A 1P1RA 2ZTUA 4A0SA 5GZ1A 2DO7A 3E3VA 1I1SA 1GL3A 2W85A 1Z82A 1XU9A 2JCVA 4DIOA 2P8TA 3ITKA 1J5YA 1C14A 4B7CA 2GRAA 1T2AA 5IDWA 2VBYA 4IPAA 3ML6A 1R0LA 1ISIA 3ZN2A 4I09A 1VL6A 2IEBA 1TW2A 3K5PA 1WKMA 4XGIA 1QMGA 4JBAA 4ESJA 1QYCA 1YE3A 2I67A 4FT8A 1EVIA 1WZIA 2BGCA 3LLVA 2PTGA 4KQXA 5HVQC 4TMFA 3ULQB 1Z9CA 1BRMA 3CMCO 2BGLA 1BJAA 1XU7A 4D45A 1FMCA 3GGOA 2I65A 1Y8RB 1X0XA 4UVIA 2W4QA 4L9NA 2P6TA 1BBYA 4JK1X 1HDCA 3IS3A 3ONEA 3RUIA 1IOLA 4PCVA 3R0JA 3WGIA 1J5PA 1KU7A 4CLEA 2HFHA 3L4BC 1NFQA 2M87A 4MQVA 1LLDA 4LK0F 1RM5A 1WDKA 4MO2A 4B4UA 3TQHA 2JTVA 1NXQA 2VOJA 3NDRA 4RZIA 3DZGA 2HTSA 3OBBA 4OM8A 4CUKA 4YQYA 1USTA 2QUFA 2OUIA 2ZXJA 4RPHA 1FZPB 2V6CA 3GF2A 3ABIA 4E70A 4BYYA 5FFZA 4L0ZB 5JW6A 4BGVA 2C5EA 2LNBA 5H20A 1IE3A 3IWFA 4CV1A 1KGSA 1LQ1A 2E1CA 2IJLA 2BELA 3I6QA 4OH1A 5C7LO 2YDYA 4GKVA 4K6FA 3HOTA 3DQPA 3VPGA 1WRJA 4O6JA 2F5EA 1FYMA 1I1GA 4KIBA 3VH4A 2IA2A 2FOIA 3DHEA 3FNGA 3KZVA 4WCFB 4R1TA 1LSUA 1HRDA 2D0IA 1I3KA 5F1OA 2G1UA 3PHIA 4ALNA 1E77A 3I59A 3FHZA 3GFBA 1E3WA 1LBEA 4WLVA 3CPSA 4XX0A 1J49A 3BOQA 4W99A 2HDCA 4Y6SA 1O9BA 4B3IA 3ZWBA 3ADOA 4FDAA 3TL3A 1PR9A 3SHFA 2WE7A 2BGMA 3GC6A 3RU9A 1NAIA 2TDXA 5F64A 4FGWA 3WYCA 3VTFA 3HZZA 3DXJF 4ZN6A 2J5KA 1G3TA 1SNYA 2X5KO 3MJ4A 2WWRA 4GSKA 5I9NA 3JQ9C 4XGNA 5DBFA 4CLRA 5AIQA 5JC1A 1YFHA 2HKXA 1GUZA 1EQ2A 4IJKA 4UULA 5ENDA 3U4CA 2Q2VA 3LQRA 1BXZA 5HRUA 2ZTVA 1C1DB 3U62A 1ZSYA 1GV1A 4YJFA 1PJQA 1NR7A 5CEEA 4HF1A 2HR3A 3MOIA 1HWYA 5TX7A 5ILOA 3JAMK 4OQZA 4C7JA 4M9ZA 3C7JA 4IIUA 1KBZA 2B0JA 4BNFA 5CVVA 3DZJA 2AA3A 2J5PA 2EJRA 3PQDA 4D42A 1T1RA 3HN7A 3H3FA 1E1NA 1S6YA 2IZ1A 2VBZA 1MC5A 1Z91A 2BYVE 3EUWA 1RWBA 4HY3A 3SX2A 2VXZA 1Y1PA 4DBZA 4KICA 4BV9A 1FP2A 5C7IO 3K1NA 4OAQA 2EB7A 3I6IA 2PH5A 4JJFA 3GNQA 4MIOA 2R7FA 4N18A 1ZH5A 5A9SB 4JCOA 1UXKA 1K78B 4NNJA 3BTUA 2NM0A 1PJTA 1IZ0A 1LI4A 2ZB8A 3GAFA 4GVXA 2JPBA 1H94A 3DC2A 4KWIA 1KOLA 1SB8A 1LTHR 1GYPA 5CVUA 2DBQA 4HDVA 1P77A 2FPPA 3OETA 3PZBA 4JP2A 4IVNA 4HFNA 1RZ4A 1M6WA 1U3VA 4DLAA 2Y0DA 4J16A 1I32A 1UHMA 2A4KA 4RQTA 3C7CB 5EL0A 2IXBA 1EV7A 3BDDA 1H9AA 4IS3A 5T67A 4D0RA 9LDBA 3UF0A 1IF1A 4KN7X 4ALMA 5AYVA 4MVJM 2BEOA 3TN7A 1D3YA 4O5VA 2VWHA 4XWYA 4JBGA 1GEGA 3Q9SA 4HV6A 3O9ZA 3ZHXA 5L95A 3INTA 4IDDA 1T98A 3V8LA 2WWYA 2VONA 2I76A 5ICGA 1GQ2A 3MCZA 3DHNA 2P4QA 3PXXA 3FMQA 2O3RA 4PZEA 4Y9DA 3RD5A 3TZKA 3OJOA 4IY1A 1P92A 4OIPF 2AQHA 4BNIA 4BNTA 3OIFA 3QU3A 3W8EA 3ZWXA 3O38A 5EPOA 4PLFA 5LCXA 3TOXA 3RIRA 3WTSC 2DLDA 3DBLA 4XBFA 2OFPA 3DMTA 3E1KA 3Q0EA 1GHCA 1JTVA 3UN1A 3UKOA 4CL8A 4GXOA 5KJ6A 1UR5A 5DOZA 3GY0A 3TOAA 4TKMA 5EJ2A 2QYOA 3RYRA 1QZYA 4IDBA 1U5TA 4O5OA 3VPSA 2UXXA 5D8LB 3SXYA 1R4MB 4R41A 4A6DA 2OAZA 4U5QA 5DCFA 4TWRA 4EQQA 1YS4A 1ADBA 2HRBA 5CEFA 1G0NA 2Z9OA 2Z95A 4WOKA 2FBHA 1ISHA 1QLHA 4L76A 1PJ2A 5I9LA 1ADFA 2CD9A 1ON2A 1DC6A 1KC1A 1ISMA 2DTDA 3BWGA 2X4HA 1PWXA 3FI9A 2F00A 2OXIA 4WNCA 4YJHA 3E8XA 3RPUA 2RVCA 1HQCA 1JW9B 1AXGA 2CSOA 1GZ3A 2AXQA 2FMUA 2H9IA 4MDHA 4RZHA 4DQUA 4HZFA 4HWKA 4DREA 4L74A 2DBRA 4DQVA 4KWHA 3UUWA 1ZMTA 2CNBA 3F1KA 3PWSA 3V8BA 1J0RA 4DC1A 4YT4A 3ZMTA 3PRJA 1YH3A 3I59B 2W2LA 3VH1A 3PHHA 1IZ9A 5K1YA 3OQ1A 3MQ0A 1U1IA 3LC2O 5BSEA 3KVOA 1SB9A 1MD0A 3JQDA 4FCCA 1C0KA 3FD8A 3KSZO 3BZ6A 4M54A 3OHSX 5TRDA 1U2WA 4A73A 1YIOA 3GVCA 5KIAA 1EDZA 2HZTA 4IJUA 5I9MA 3ONDA 4UUOA 1HKTA 3WE3A 4G6DA 4CLRB 4Q48A 4Y98A 1P4AA 5TSDA 3X2FA 4BNMA 3DBVO 2IYPA 4BNJA 1IXRC 2BGKA 2X7HA 2CYYA 4C7KA 1STZA 3Q6IA 1QBJA 4YJFB 1B6AA 1DIHA 3I9KA 3HFGA 1T38A 2IP2A 3W4JA 4M89A 2P4WA 4KMUX 4BNGA 4ENJA 5J8CA 5FLXZ 3G1UA 4IMRA 4Z0TA 2O2YA 1NQAO 2X5OA 4L75A 2DPDA 2WE8A 3IC5A 2GQQA 1BG6A 2DU8A 4BO7A 4L4XA 4RGSA 3QLJA 3D5QA 3SC6A 1B8UA 4WXHA 1GQYA 3K0LA 1EFKA 1H93A 4H0EA 1C0WA 2X9GA 4ZD6A 1GV0A 1LC3A 4DBVO 3FXUA 4M6XA 2YW9A 3H5AA 4YQZA 3ETDA 1O7FA 3ZN0A 2Q1SA 5K5QA 1HBXG 2XF8A 4CMCA 2PY6A 2HKOA 4CZZA 2OBYA 4PG4A 1G6NA 1F14A 5EEGA 2JCXA 3KV3O 3ZWMA 4I9UA 3ZHBA 2UAGA 1FNNA 4S1VA 4YAJA 3TFQA 3C1AA 2O2SA 4I5DA 5HWSA 2PV7A 3GUDA 3G79A 5ILSA 3PHJA 4JXKA 4YR9A 5BR7A 2K4BA 5BT9A 3EDMA 3H9QA 2I99A 1EUZA 1UZLA 4GX5A 2LKPA 2I6TA 1X0VA 2Y75A 4IMPA 5THKA 1NR1A 3DEUA 4HXYA 3PFFA 5HLIA 1ZCJA 4AJIA 2JD0A 3CTMA 4K2EA 4XQGA 4YT2A 1NTOA 4R54A 4W9NA 3DAFA 2I9PA 4L0QA 2QBYB 5BSFA 3N7UA 3ANLA 1E3EA 5BNFA 1H6CA 3L9WA 4EYEA 3SLGA 1K7AA 1KQ8A 3VHRA 4OSOA 2EWNA 4KUMA 2QRKA 3ZV3A 5ICSA 3JTHA 1HE5A 4XQEA 4YBZA 1CERA 4HOBA 1LXCA 2HDHA 4N5LA 3GRPA 1XSXA 4XCVA 3F3XA 1H6BA 5BOXA 4CUJA 3GZ5A 3CMMA 4B8WA 1PL8A 2F5CA 2WMDA 4NFYA 3V4GA 3SJ7A 3HIFA 4CM3A 1SFUA 1OC4A 3ELKA 1U8RA 4IRIA 1GCUA 3P9CA 4GWGA 4WLUA 3TGNA 4NH4A 5EN4A 2VOOA 5A2QK 2V6MA 1WI9A 1WLYA 1GCOA 2BRUA 1K2WA 3AOEA 4ND1A 4CQLA 1LRLA 5DT9A 1W7PB 3Q2IA 3I52A 3K31A 4W6ZA 3B1FA 3ZWYA 1ZIDA 1QYVA 1J9IA 2WYUA 4NIMA 3AUTA 2FNAA 1YB4A 2CQKA 5HS7A 2QYSA 2WYVA 1TB4A 1KYZA 2PJPA 1U5TB 3ZMVA 2B4RO 3D5LA 2GASA 3V8KA 4D0PA 2IEDA 2J3JA 2QW8A 3P7MA 4G81A 4L4SA 1FBSA 4XYEA 3S2FA 4EUHA 2YX4A 5G2OA 3JQGA 1FBQA 4J6FA 2GXBA 1A04A 3WGOA 5T57A 3CO6C 1NHWA 2JL1A 3L0DA 2GR9A 2BBYA 4I08A 2RQPA 3HSKA 1I2BA 3K1MA 3HDHA 3WTBA 4TV7A 3RBZA 3V1TC 1F9NA 2DBVO 5BQTA 2RAFA 2D1HA 2DFDA 1A72A 2X0LA 1HF3A 4M73A 2M30A 2EGHA 3DOOA 3IAHA 4GQAA 1EK6A 4QSMA 1MJ9A 3K1PA 2C54A 1O3QA 1FK8A 2X9VA 2ZATA 2QLZA 3JW4A 3BMOA 5G0VA 1FX7A 3V8JA 4J2OA 4RF2A 5I7FA 2MBFA 1V9LA 2XIGA 3GX4X 4MP3A 4E5KA 3NX4A 5HS8A 3U5TA 1FDWA 1EFLA 3PYMA 2IDZA 5TLSA 4GMFA 1X7HA 1SC6A 4BO2A 2W2LD 3PLNA 4YAIA 1HW5A 1MG0A 2SCUA 1QGPA 3N97A 4RDIA 1OKRA 3WE2A 8ADHA 3IRRA 4J1QA 4CM7A 3TJRA 1BOAA 1PS8A 2C2YA 2PK3A 4DRYA 3TO9A 1LNQA 4TROA 3C7DB 2LSOA 1E7RA 3M2TA 4BGUA 2YFHA 5HTOA 1PJCA 1HYGA 2K86A 3HRSA 3Q9NA 2FBKA 1O94A 3ZU5A 4PLHA 2DK8A 2JZYA 3B73A 5J23A 1B3RA 2OO5A 1FF9A 3GA0A 5HDNA 1DIBA 2VOPA 1YQXA 4FJ0A 2MD5A 1ML3A 1TLHB 1IB6A 2A94A 5CPFA 3BA1A 4BS9A 4DVJA 2FU4A 4N9IA 3RU7A 4CMBA 3BPXA 1TT7A 4L18B 1K3TA 4G94A 2C6YA 1R15A 2OP1A 2X23A 3L6DA 1CQIA 1TT5A 3EHEA 1DHTA 1RI7A 4AJNA 4RPKA 1VL0A 3F47A 1PIWA 1HE4A 1Z6RA 4TRRA 3L6OO 4Y6PA 2IZZA 1G3SA 1DHRA 2RH4A 3I9LA 2CF6A 3QVTA 2Q0OA 4E2ZA 4OYRA 4IHTA 1ID1A 1LDKB 1I30A 2HJRA 3KYCA 2PLYA 1UDCA 4FSHA 5DNAA 2O4UX 1ENOA 1U6GA 4WCGA 2PKQP 2QQ5A 2LF8A 3KSDO 3W1VA 4CM4B 1EUDA 2KIMA 5MGBA 1I24A 3O8QA 1Q1HA 2NUAA 3WU1B 3BMCB 1Q0QA 3JQ9A 3LA7A 1IYZA 1XGOA 1ZEMA 1B4AA 2FN7A 4UVEA 5G4LA 5JDCC 4M71A 1PGOA 4WASA 3FCOA 2DFIA 3WTWC 1PJBA 3BTSA 3OP4A 4R9SA 4BMNA 1F1ZA 3PWKA 3VOSA 3BZUA 5BSHA 4OOIA 4EJOA 3D7LA 2GNAA 4HFRA 4NZ9A 4RQUA 5AONA 4H3VA 3GVPA 5U1PA 4RVDA 1FDUA 4BKQA 4WJZA 1PZHA 1ZREA 4CV2A 1R7JA 2DKNA 5FEUA 2EP5A 3EK2A 3HE3A 3T8RA 3GFJA 1XN7A 4OXYA 2CDAA 4ZYGA 3X2EA 4O0LA 4DXHA 2MH2A 1I3NA 3PQKA 4WCDA 3VH3A 4CLXA 4FFLA 3KEOA 1TXGA 3WSWA 4YIFA 4PGHA 1BVUA 3ITDA 5IXYA 3CLOA 1Q2XA 2H1SA 3NGLA 4ZYEA 5KJFA 1YXMA 5D4SA 5DZSA 3DZKA 3M9AA 1E7YA 1U5CA 2ELHA 4XSZF 4HFJA 1P45A 3FX3A 4JN6B 1GYRA 2WJPA 4LMPA 3WQQA 2VYND 5FGMA 3IMFA 5A04A 5KWEA 1QR6A 4EGFA 2C0CA 2JAPA 5CVRA 3I9NA 1A4IA 5GMOA 1HKQA 3OECA 2MLKA 4GX0A 4I9HA 3KLMX 4I0AA 5IT9K 3F5QA 4MVJF 3WIDA 1JKJA 1XSDA 2EG9A 3A06A 1BGVA 4HLYA 2W24A 5ES3A 3JQGB 4JBIA 4XD2A 1EH7A 2XRNA 3EUHA 4ZYHA 1DC3A 1L7DA 2G82A 3G0OA 4I1IA 5B4VA 5KCZA 4MVJP 3BYZA 4D43A 1PZGA 3GVXA 2OQGA 2V79A 4PLPA 1GXQA 1ZJYA 1V0JA 4ZA2A 5E20A 4MEYF 4U88A 2P5LC 2GLXA 4MJLA 3HWRA 3ZN1A 2XAAA 1NQTA 1G3WA 3PTZA 4BNHA 1CQJA 2W2KB 4UREA 1E7WA 4FFPA 3JQBA 1U2GA 1UP6A 4MQ9F 2OBNA 4HADA 3V2GA 4OINF 3BMOB 3N58A 4PRKA 4PG8A 1HT0A 1S7OA 1U7TA 4U7DA 1CIVA 4MVJI 2BFOA 1LQTA 2ZYDA 4I0BA 1RPNA 2M1BA 2A07F 1HXDA 4G7HF 1HLPA 1WXDA 1KETA 4Z0HO 3AWDA 2FF4A 3UVEA 4TSKA 4BO0A 4UHTA 1TW3A 3IRQA 3IDSA 3M6IA 3Q9VA 2PGJA 1N1EA 3DZBA 2VRBA 5ENVA 5FFXA 3AI2A 4E6PA 2OBPA 4R51A 3OF2A 2OGUA 4WKGA 4P8RA 3FWZA 5TS3A 2ETHA 3S2WA 3RKWA 3NTQA 5DEQA 2BH9A 2OMEA 3E82A 4N54A 4BMSA 3EMKA 4QQRA 2AW5A 4OIMA 2YU3A 1B26A 3B6ZA 2GGSA 5JMPA 3VPHA 3VB2A 3NT2A 1DDOA 1IUYA 1O57A 4XRFA 4BAYA 2HCTA 2HWVA 4OHUA 3NJ4A 3NYWA 4W7IA 4NPCA 2EGGA 5DN9A 5EESA 4G7OF 4CV0A 5FI5A 3R0AA 1T25A 3ROQA 5L4SA 1Z74A 4L73A 4TVOA 2GZ2A 3ZI0A 1EBFA 2AEMA 1K6XA 1SEPA 1A71A 3E6AA 1IUKA 2WSBA 2MC3A 2KKOA 5AXDA 5I7EA 3DKWA 2E49A 3WX0A 1U4OA 2QZZA 4B09A 3IIEA 5HM8A 2RHRA 4MVJD 4BQPA 1E3IA 3WLEA 4KOAA 2QVOA 4WEOA 3F23A 5D5XB 4EGYA 2GN9A 2W25A 1REPC 4IRGA 2OD5A 1RUNA 3L77A 3RTRA 1QLJA 1SAYA 2G9WA 3LZ6A 3KYCB 4FFRA 3V7SA 4LLNA 5IF3A 2C20A 2BMAA 4MNUA 3I3OA 5COQA 1HE3A 1H9GA 1ZK3A 3O8QB 1C0LA 1P1IA 2E1NA 2FBIA 3ZMDA 3IKTA 4A10A 2OQRA 1Z6ZA 2Q3EA 3U4HA 5G4KB 1JVBA 5L3CA 3F22A 1E7SA 4KA4A 2ZKLA 1Y5RA 1XB4A 4Y8VA 2ADUA 1E6WA 4G9YA 4OMYA 2VYVD 3CXRA 4UUVA 1DAPA 1B14A 3MJEA 4J0EA 1PQUA 4DLBA 2BFMA 1K6JA 3LT4A 4DIFA 2WEKA 2DK5A 4L5JA 3L7WA 1O6ZA 1ZG5A 1PUEE 1Z75A 3BMNA 4P4NA 3ZCXA 4KDEA 4ZHSA 2D45A 2XV4S 5FD5A 3HHHA 4EEXA 5ICFA 1OBFO 4YFXF 1H6DA 2VUUA 2UYYA 1DP7P 2G17A 3GDFA 1MC4A 3ECHA 3Q2KA 2FP4A 4RGBA 3G73A 3C3WA 4CUZA 2YQ4A 1LNWA 4MTDA 4YRAA 3FN4A 1QKIA 3JQFC 3RJ5A 1IZ1A 3D1LA 4P38A 2D5CA 4GLLA 4PLCA 2FSSA 3V1YA 1I3MA 1KQ9A 4XSXF 1PJLA 5CDGA 3MAJA 1GYQA 5A5EA 1IRGA 1LU9A 4WGGA 5EEHA 5L7YA 3P2OA 4NBVA 5C7OO 1L1FA 3WGZA 4KTTE 1BXGA 3NT5A 5ED4A 4J90A 1A7AA 3HDJA 4HFMA 2V1UA 1JGSA 2J3IA 1DDNA 4QECA 5H83A 4A0YA 5L40A 3ULKA 3GDGA 2RBEA 3QRFF 3PEFA 5ITVA 1S7AA 1J59A 3LT0A 3BIOA 4PLGA 4INAA 3KP6A 1F06A 7ADHA 4GGGA 4I02A 4OOFA 4EDFA 2R00C 4OKIA 3UICA 1TTYA 1FY7A 4A12A 5JMWA 5CPBA 3MWDB 4MVJE 1R16A 2W90A 3QVSA 5KVCA 1HZZA 3FXRA 3NEUA 2JFHA 3C85A 4JLWA 4PFJA 2Z1MA 1J2XA 1ULSA 4UEJA 3TNLA 4U8GA 4Z6KA 2C29D 1LA2A 2EKLA 3U49A 3FM3A 3REOA 5B4TA 3C24A 3KP5A 3E5RA 4JJGA 2GPTA 4TKLA 4HDUA 2Q2WA 5L3ZA 4AJ2A 3GHHA 4GYGA 4PCQA 2UVDA 3FBTA 3ZWPA 1OAAA 3GEGA 3MZHA 2NVWA 4UUMA 3WICA 4EEZA 1JHHA 4BHCA 1W0CA 5F1RA 2OZUA 3LVFO 4CR7A 2P4HX 5JYDA 5AOVA 2L02A 4AFNA 5KNLA 2NNNA 1O8CA 2BLLA 3D5TA 1PS0A 2O3SA 1YOVA 1ARZA 3O3KA 5DUIA 3I53A 2J3KA 1EBUA 3EC7A 3R0IA 1T0FA 4XR4A 4CMAA 3LA3A 2EKQA 3ENNA 2DTXA 2O50A 4I2OA 1LQUA 2PGLA 5I8WA 1KEWA 1UXHA 3KZZA 3GVHA 4KUHA 1P1HA 2X1HA 3T7CA 3KYDA 2PQ8A 5LRSA 4YFKF 3T8TA 2JKVA 3AY6A 4FS3A 1UJMA 3QAHA 4KIGA 1QYXA 5LGTA 1GU7A 1H9BA 2C5AA 2DPGA 2FMYA 3LQQA 2A61A 4Y15A 2ZNZA 4HX5A 4EW6A 4I7HA 3J7AO 4B4OA 2AQ8A 3BHIA 3DBHA 1KC3A 4BNZA 4N9HA 2X0NA 2X8LA 1O5IA 5DOVA 3P9KA 4JIGA 4OMZA 1OI7A 1F4KA 1I33A 2E7WA 1P0CA 2VRCD 2YFQA 3PIIA 2PN6A 2H09A 1AOYA 2PA3A 5I8ZA 3UOGA 4P96A 3C7AA 4HQEA 3D64A 3OICA 3NGXA 5ER6A 3GWZA 4C4OA 4DIBA 3JD4A 5JNLA 5L3BA 1X7DA 7MDHA 3QPTA 1HSOA 3FPLA 3WGQA 4RPGA 3HSRA 1TI7A 3B02A 2HQRA 5CG1A 4DMLA 2XXBA 1Y9EA 5KVQA 2TMGA 5DDIP 4I5GA 4HV4A 3UCXA 4WK8F 1YJ8A 2E6UX 2YYYA 4OU0A 1E5QA 4AJJA 1BVRA 4R79A 2G7HA 1YRLA 3QWFA 3LF2A 5DCYA 4RL6A 1ENZA 3ZZNA 2PFGA 3BHJA 4MVJH 4BKPA 1N2SA 2XAGA 3F1LA 4PVCA 1MX3A 4LB5A 2CVZA 3CJNA 2VUTA 4Y13A 2OP0A 5JCJA 2OZPA 1WZEA 1ZEJA 4XLNF 2ZMEB 4BB6A 3IQDB 5TC4A 2OHXA 4RLSA 1IXSB 3MWEB 4R4JA 3U9LA 1EVJA 3BMNB 3WTUC 2RH8A 1M75A 2XPCA 2L54A 4ND3A 3RDIA 4PVDA 4U6SA 1X15A 4BXUA 3C8MA 5FF9A 4LCEA 3HRUA 1ZGJA 1CRWG 2Z5UA 4QT0A 1YBMA 3FZVA 3OOPA 1ZFNA 1ONVA 3CH6A 5E8GA 4E30A 1E3LA 1JA9A 4ENMA 2D59A 1UXJA 4RF4A 3LK7A 2FXAA 1Q1NA 4EGZA 3DEYX 1ENYA 5HS6A 4LLGF 3JD3A 2UV8A 2PD4A 3JTMA 5BQFA 4CLHA 3GO5A 4RVFA 2VHVA 1XWFA 1BC7C 2VE9A 3W4IA 5E1WA 4Q5SF 3HOSA 3OA2A 1MJAA 1ULYA 3VZQA 1MV8A 5JY6A 1EE9A 4DWVA 4EJWA 3JQAA 1FWZA 2QQAA 4XYMA 2XUBA 3IKVA 4RGXA 3CZMA 2CVOA 3OEYA 5G0UA 4BNYA 4DL9A 2DAOA 1BXGB 1TQIA 1NVMB 2CY0A 2NADA 1H0MA 2WTBA 3BPVA 4U0KA 1FP1D 1LRKA 5CYVA 3ON5A 2E82A 5LHHA 4YAGA 4CLDA 5JAIA 1ZK1A 4UVBA 1IY8A 3KFWX 2A92A 1MJBA 3ASVA 3RUAA 5JDCA 4G5HA 5CDTA 1IPFA 1NBOA 2XXJA 1BIBA 2VC1A 4GSLA 2C7VA 3RAJA 4BGEA 4LK3A 1R00A 3FM5A 2Y0CA 3C1TA 3DZHA 4LRTB 1O7LA 1PJ3A 1XYGA 3PJDA 4MP8A 1J0XO 4RVHA 4YACA 3QA9A 2B4QA 3U09A 4II3A 2Q1WA 2KJCA 1L7EA 3FNFA 2EFNA 3RPQA 1KU3A 1YW9A 1NP3A 2VNSA 3GQVA 1LJ8A 2FPGA 3PWZA 5TT1A 3ZNQA 2YSRA 4AIKA 5A1TA 2H6EA 1U28A 4WPGA 4BUCA 1X14A 1PSDA 2NQTA 1EVYA 2POQX 3H2ZA 5L3FA 1XELA 3S2GA 4E5NA 3VZRA 3W4KA 1BI0A 2STTA 1M66A 3GXOA 3ORFA 4MIYA 1BDMA 1VSVA 4YAEA 3Q3CA 2OA4A 4JQFA 4BO3A 1YDWA 1NYTA 3JCZA 2NYXA 1K79A 2CFCA 1EH6A 5L3EA 3FNHA 4NFSA 2XKOA 5BS6A 1G0OA 1GVJA 1FOKA 4OIQF 1UUFA 3VTZA 4ZQBA 4EI2A 1P3DA 5DP1A 1YJQA 1B0AA 1BSVA 1Y6JA 2BD0A 2HK9A 4FFNA 2UWMA 1UXGA 4PZDA 4XIJA 4XYGA 2D3TA 5A3JA 2WC2A 3WTZA 4DQ2A 4ETSA 3WNQA 2GZ3A 3JQBC 5TIIA 3RUDA 1ZG3A 3SZPA 3KYDB 4I5FA 3A4VA 1HLDA 3DOJA 1TQMA 5COBA 3NTOA 2ZB7A 3INGA 1BC8C 4N0BA 2EXXA 2Q8KA 1PZEA 4CMGA 3CZRA 2UZKA 3H5NA 1B15A 3TOBA 4FW8A 1K0UA 1U2DA 1YS7A 1SCUA 2NTNA 3I4CA 4HX7A 1KVSA 5CDUA 3DBHB 1HDGO 2ZTLA 2EERA 4BHPA 1CDOA 1CWUA 1KU9A 4HBLA 1V3UA 1DJQA 2PD6A 1D1SA 1E7QA 4E2WA 4IBOA 3ABUA 1Q7GA 3I9MA 4L5IA 2RN7A 1Q0HA 1S29A 3JD2A 4XEHA 1P33A 5DF1A 1GXPA 1EMDA 3CIFA 1FPQA 3JV7A 5G0SA 1AGNA 3TDZC 4K1LA 4KMSA 3ERED 4YXFA 2J5QA 1XSEA 3WWYA 2FNPA 3ZWNA 3VZSA 3GRKA 2A3SA 3W6JB 1U5AA 1ZUD1 2WV0A 4JROA 3WGYA 4CMIA 3H8VA 3VVCA 4IRHA 3WFJA 2JRTA 2GUGA 3D4OA 4R1NA 3J80Z 4AD9A 1ZJZA 2NTJA 4BOYA 3FBGA 4HW0A 3TFOA 3NQOA 3DXFA 3DR3A 1R5GA 4LG0A 1QNTA 1ZAOA 3BTVA 5L45A 3OJLA 1E7MA 1FLIA 2B0LA 2ZCWA 3BJOA 3GVAA 3GNTA 4CICA 4QFCA 3VH2A 3CE6A 1SD5A 5IAAA 2CG4A 1UCRA 5CLSA 1HDOA 1PWZA 2W8ZA 2P2SA 1RM4A 2P5UA 3U0BA 1E3WB 3WR5A 4R5HA 4U0WA 5JCJD 1YW7A 2PMHA 2DPUA 1AN9A 2GF2A 4CR8A 4D44A 5IG2A 1QYDA 4HV5A 1W8DA 3KOUA 3OV8A 4BKOA 3JAMZ 3GEMA 5IXSA 5JAMA 1K6IA 3LU1A 4KUEA 1OYYA 1ZLJA 2O23A 4LGWA 3EYWA 2ZYGA 2QHXA 5U4QA 5ILGA 1Z45A 4CM5A 4Q47A 1LLQA 3I5MA 4QFDA 1EEHA 4W82A 2CSUA 2W98A 5EINA 3CO7C 2B37A 3VAZA 1O3RA 4PGGA 3QWAA 4D3DA 4IHSA 1XQ6A 3WG9A 2DW4A 3H5RA 1WMAA 4JK3A 4AJOA 4ESBA 1I5RA 1ADCA 2VWPA 3U3XA 2GERA 4A27A 3JQAD 4FX0A 4IQ8A 4LRSB 1V6AA 4DUPA 3LSYA 2O8XA 1V3TA 2Q46A 1VJ1A 2XASA 4G8XA 4QUKA 2IA1A 1HSTA 1IHXA 1MA0A 1U8FO 4HLXA 3GPDG 4BNXA 3TZCA 4LMYA 3ROUA 3HRTA 4ZJUA 5D5WB 1HEUA 2AE2A 4L4RA 2VN2A 5CVIA 1IPEA 4BO9A 4NU6A 4A03A 1NHGA 5H82A 5DD8A 5AVOA 1UB9A 5KVRA 4P9UA 4XQ9A 4R3WA 3COSA 1T2FA 1WVGA 2D4AA 4UV8A 5FO5A 3F9IA 3I23A 4WCFC 4A2CA 4HAMA 4L9TA 3SZTA 1T2CA 2Q4EA 2FR8A 3I1JA 3QV1A 3ZHZA 3I5UA 1ISJA 3PLRA 4HBGA 4HNGA 4M55A 4BMVA 4FJ2A 3JQFA 3FWEA 4HQMA 1LB2A 1U7HA 2RGVA 4CDGA 3DZFA 3RFVA 4YVFA 5ILVA 4CQMA 4YG2F 1RM3A 3GG9A 1MB4A 2ZBKA 1MG5A 2O3FA 4PZJA 1U3UA 1PJ4A 2PWZA 2ISZA 4NFHA 1T4DA 2RDPA 1DRWA 5DBIA 2CUKA 1P6RA 1N92A 4OXNA 5IFLA 1YVEI 3ROPA 1SMYF 3MJCA 5T6BA 1E5LA 3E5UA 1Q7BA 1U78A 3V1UA 4DLLA 3IUPA 3QIVA 3WGHA 1VI2A 4Q3CA 3DONA 3GZNA 5TRTA 4XR9A 1Z7EA 3H9GA 3EZYA 3QRWA 4RPJA 3R6SA 4OOEA 1ZHFA 2ZB3A 4WUVA 5CDYA 2K7LA 1WDMA 3GFLA 1DOHA 1OYWA 2KIUA 2YR2A 4JJIA 3ZPLA 4P22A 2ZYAA 2R00A 3TDKA 2V6GA 2VYNA 4PZCA 1KYQA 1NPYA 4F6CA 3LFKA 1HDYA 2GWRA 1E1MA 1XMAA 3JQ7B 1RNLA 5F1KA 1MLDA 3LLSA 5MDHA 2JPCA 3DBLB 3H3UA 3E9NA 1MP0A 4J7XA 4BNUA 1Y7TA 1XEAA 1L0OC 2ZJ1A 5J8FA 3QP6A 4CM6A 5JCXA 3QOPA 3WTCA 4CMKA 1OR7A 5IZCA 3VODA 3M1AA 3UW3A 4XKJA 4E21A 3AUAA 4AJLA 2I5PO 2NVUA 4R01A 2P5VA 1BWSA 3F8MA 2OORA 2CW0F 2BF7A 4FBGA 1VPDA 1HZJA 1BIAA 5CAEA 1DUXC 1HDXA 2GZWA 4UVGA 2RKHA 5HLGA 2LDBA 3ZH2A 4CLOA 2FOKA 5EERA 4LG0B 3BJAA 1U3TA 1SFEA 4YJHB 1E0DA 3FR7A 1ZLKA 1DB3A 2EKPA 3E9QA 5IN4A 3E6MA 2KIFA 4HP8A 3ZWVA 4PG7A 2V9VA 2ZO4A 1HSJA 1YTYA 2Y66A 3SEFA 4J9UE 2HSDA 4BB5A 4PN3A 2NV6A 3VFZA 1E92A 1ON1A 2HK7A 3JQCA 3OJEA 2AE1A 4NBUA 4KQWA 3GLQA 5GY7A 4ZQFA 3S1LA 5JC8A 3E9MA 3I4PA 1ONOA 1O89A 5CHEA 3SQNA 1T4BA 1BDBA 1SMTA 2F5DA 3LAJA 4L0YB 1QQIA 5L4NA 2MA3A 1SEVA 1KS9A 3E5MA 4BKRA 4WLFA 4DYDA 3KBOA 4BIIA 3OFSA 2YHIA 2EA2A 1WAMA 3ANMA 4HKTA 4DPLA 4BO1A 1GDHA 1T39A 3MTJA 4Z9FA 5I7SA 1H5QA 3EETA 3L6EA 4PLZA 1L3LA 3BXXA 5KJCA 3ZMSA 1S7CA 1Y5MA 2HO5A 3L07A 3F46A 3RSHA 2EEZA 2NLOA 1QV7A 3RC7A 4G2NA 1G6KA 4M9XA 2WTEA 2I3AA 2L4MA 1P1JA 4EUEA 4BNVA 1ZG1A 4XB2A 2NQ8A 4CL3A 2NS0A 2VBXA 1KEPA 4MVJA 5H81A 4HUJA 4FPXA 4Q3BA 4G65A 3B1JA 4YB8A 4D7AA 4WNIA 5JVTA 1YL5A 5F3RA 1HL3A 1N1GA 5TNXA 4KIFA 2VHYA 1ODDA 2IRWA 3FTNA 1BTOA 1NNUA 3A28A 3PJGA 2B69A 4RB0A 1VSUA 1H6AA 2QENA 1E6EA 3RASA 4GMGA 5K9ZA 2J3HA 1I3LA 4JP3A 4MP6A 3KLOA 4ONEA 4GI2A 3QW2A 4O3MA 4O6VA 2OU2A 5FB2A 2VYVA 2NNLD 4QLCU 1JKIA 3RKYA 1JAYA 3PGJA 2VZ8A 4EITA 2WYWA 3DWFA 4U6QA 3EAGA 5FI3A 1UP4A 1XA0A 2V1XA 1OYIA 4MTEA 1ISFA 4M87A 1TNSA 5A05A 3WIEA 4NMHA 4CQMD 4E2YA 4BL5A 2A6HF 3LT2A 2XVCA 1XGMA 1UH5A 3O2PE 5JDIC 4BO4A 1F5TA 1CGPA 2Z99A 1WDLA 4PDKA 2X4GA 1BM9A 4R5MA 4RGUA 2IT0A 5ICCA 1LLCA 2A9FA 3JQ8A 5LDGA 1X1EA 1S6LA 4CM9D 4YJDA 2XAJA 2HMTA 4EM0B 1SD7A 1LDYA 4DNCA 4QXMA 4ALKA 1D5VA 1LDBA 4Y67A 1YKFA 1GTMA 3ETGA 3K96A 1J6UA 4MINA 2Y1CA 3CUKA 1TBXA 4IGFA 4B7UA 4HX8A 1LX6A 1LDEA 2DFVA 3RC1A 3KZYA 3NRCA 5D5VB 4PLVA 3IP1A 2LDUA 2X0JA 4S3MA 3V2UA 3KP3A 4EVIA 1R1VA 2GAUA 5A5FA 2IYOA 4CQLB 4HNHA 3MJSA 1WSUA 1NFFA 1X1TA 4IZIA 1JE8A 3F72A 1TVEA 4MKXA 4RB1A 2VZ9A 4A2UA 5E17F 1T24A 4GYIA 2E48A 4CMEC 5DDGA 3DQVC 3WWZA 3G3EA 3RQSA 3AI1A 4L8VA 1PP8F 1V3FA 1B9NA 1N7GA 3H9EO 4MPDA 2Q2EA 4Q4ZF 2NVUB 1NVTA 2YX7A 4LB6B 1DRVA 3HUGA 1IN7A 2D5AA 2BFAA 4D3FA 4E5MA 3NAQA 1YG2A 5JYEA 5LHIA 1LDGA 1D4FA 3KEQA 3EW7A 3ZU2A 1F8FA 3ADPA 2HK8A 3QWBA 5E1XA 2Y99A 2ZKZA 3J81K 5DYMA 4LFUA 1B59A 2DQLA 4A0XA 2AHRA 2CF5A 1U4SA 4MKZA 4OO3A 4Q3AA 3W6KB 2NVBA 4J3FA 4J1TA 4BO8A 3HDYA 3B70A 4K6CA 1T2DA 4UUPA 1GPJA 3JD0A 2P6SA 4J7CA 4LISA 1IRFA 1B1BA 2Y1FA 3JSPA 2EA4A 2G0TA 1FSEA 4Z9XA 3TKYA 1P1FA 2IVMA 1MDMA 3LWFA 4H15A 2Y0MA 3U4IA 4EUFA 2ZJ2A 1D7OA 2AEFA 1PGPA 1VKNA 2X5JO 1SD6A 3MZYA 4IPTA 1JQBA 1ZNQO 4ZICA 4ESFA 5JFRA 1YBAA 4WEQA 4GAEA 2GZ1A 3OM9A 1JHFA 1HETA 1HKSA 3AK4A 4FGSA 1FBUA 1PZFA 1DIGA 1FC3A 4IXAA 2KJBA 3SBOA 2HMUA 3PFWO 4TRMA 2G76A 5E18F 1JLLA 3JYPA 2DQ4A 2EP7A 4D3SA 4YA6A 5K5RA 1PQWA 5EQDA 3AOGA 4NBWA 2P68A 3WFIA 1KY5A 2EV9A 1XCBA 2XROA 1Z05A 1EDOA 2VHZA 3GK3A 4YT5A 1I5ZA 4IJAA 2ZJ0A 4OXKA 1RKXA 2VT3A 1IAWA 1XKQA 3VVBA 1DPRA 2JJYA 2Z33A 1M6HA 1K6OA 3HQ4O 3T4XA 2HKIA 3ZV5A 1IULA 3QU6A 2FQ3A 2EFPA 1EE2A 3G1TA 1KQ0A 4EJMA 5HA5A 1EH8A 3LAPA 1DC5A 3FMRA 2BFPA 2HJSA 1KEVA 1CF2O 4WLEA 4XQCA 2VRCA 4B8XA 2M5WA 1WPQA 4BNKA 1ZVMA 3LC7O 1TT5B 1LSSA 3VOEA 2K4JA 3PQEA 3QQPA 1HW1A 2A6EF 3TPCA 2ZQYA 4AJHA 1TQPA 2QRJA 3DDNA 3WB9A 3RVDA 4NHJA 1I6XA 3R60A 3DP7A 1CYDA 1NWHA 1ONPA 4BQRA 1SAXA 3PK0A 2VZ0A 4XYLA 4WK6A 3KLPX 4YRBA 2AMFA 3ZWCA 1H2HA 3QPHA 3PFIA 3U2RA 2NU6A 2O7SA 3PYXA 3VDQA 2O3QA 2AQKA 5B12A 4CHUA 4KFCA 3TRIA 4GGPA 3K9QO 4YT8A 2X22A 2HS5A 1CETA 1KEUA 1I10A 2JFFA 3FF5A 1G3YA 3N74A 4NBRA 2FPIA 3SXPA 4A26A 4CXFA 1GZ6A 2J8ZA 4HF2A 3AAFA 3LYLA 1NQ5A 1UDBA 5B37A 4UNOA 1JKFA 1HE2A 3IUSA 3IHUA 5CEJA 2JAHA 5J6XA 4B4VA 2ACJA 3RKXA 2L3DA 1H9TA 3WU0A 2CDCA 1DO8A 1H2BA 2ZCUA 1PGNA 3LQFA 2ZK7A 3R6DA 1B16A 4RORA 4NI5A 1QP8A 3KHUA 3VKUA 2IXAA 2HTJA 3JSOA 1XDSA 1UXIA 2C07A 2I66A 3EY4A 4WECA 3VKVA 4AL4A 3JQ8B 4I01A 1ZSNA 5LGUA 1N5DA 3IP3A 3MOGA 4FIZA 2OL4A 1USSA 1KY4A 1D8AA 2O3UA 5COAA 4FFMA 4DC0A 5A4DA 4A5NA 2VTEA 4F7ZA 5K6AA 2DC1A 1LLUA 4M1QA 3UAGA 5IT9Z 4J0FA 4KMFA 2W57A 4UVDA 1KVTA 1QV6A 1BI3A 4FOSA 1O3TA 4QWQA 3NTRA 4WCFA 4X54A 1JN0A 3OMLA 3W6ZA 3HB4X 4BO6A 5AQ1A 4YWJA 2OOSA 5DCUA 3GN2A 4YIIA 3PQFA 5G0WA 1M67A 2EW8A 4TZTA 3HYIA 5KJEA 1SOWA 5JY1A 3GUCA 1ZW1A 4JNKA 4NB5A 2STWA 2PZLA 3C18A 3RUFA 3TZ6A 4K9DA 1C1XA 3GEDA 5ADHA 2Q1TA 1EUCA 5CG2A 3QWHA 4DMMA 2V7PA 3D4NA 2EV0A 5IJZA 5DBGA 4M74A 3NT4A 1ZN2A 1R4NA 3RC9A 5FYDA 4NJOA 5C3MA 3PPIA 4MEXF 1JU9A 2G7UA 2L4AA 1LDNA 4ND5A 2ILTA 3MTGA 1YDEA 4J7UA 1E6UA 1EZ4A 1MFZA 2VTDA 3ZNNA 4XYBA 3RROA 1OPCA 2NAZA 5KKAA 4RF3A 1OMIA 3L09A 3WJAA 3ICCA 1YWGO 3GHYA 2O03A 4CV3A 5A9TA 1UDAA 1HW2A 1B2LA 3DTTA 3KO8A 5KVVA 2Q1UA 4LVCA 2EK5A 4DA9A 1IN4A 1R1TA 1MDMB 3PDJA 1M76A 1PJSA 5D4RA 3E5XA 2GA1A 4EJUA 2C7GA 3MCVA 3BP8A 4Y17A 3ISPA 4WF2A 2EW2A 4LSWA 4XJSA 4GVLA 4GO1A 4CM1A 2XKPA 3MJTA 3PJFA 2B35A 2B5WA 5IZCC 3JQ6A 2QX7A 5D6EA 4IINA 4AJEA 4KN4X 3WLFA 1DIRA 4I5EA 1HXHA 2H94A 1BI1A 4IF4A 4FHTA 3HRMA 3QP9A 2NWQA 2IRFG 4W4TA 2VQ3A 2DT5A 4E33A 4GWKA 1VLLA 4Z3DA 5BSGA 4BGIA 4YJGA 5A9SA 1MZBA 1S8NA 2CWEA 5HS9A 3F3SA 4Z3KA 3HTUA 3DHYA 1E2XA 1YW8A 5LEKA 9LDTA 3M8EA 4HF0A 2QQ9A 1KVQA 4U0JA 4IXTA 1Q0LA 1BN5A 5THQA 4OJNA 5FWNA 1OFGA 5KJ1A 1DFHA 3F5SA 2HEOA 2VN8A 5TGDA 4IDGA 1SBYA 3F8BA 5CFZA 3A14A 5CVJA 2YZ7A 4ZZDA 4R1SA 3TO6A 1XLTA 2O48X 2ZIZA 3Q9UA 4ZRNA 2XAQA 4RV9A 3I64A 2EIHA 3JTGA 4L9RA 3GGGA 2B36A 4RF5A 5ER9A 3SC4A 4J4BA 5JBIA 1LDDA 3KETA 1W4MA 2PEXA 1YO6A 2YY7A 4XA8A 1ZSVA 4NJMA 3ZU4A 2GN6A 4FD3A 5A03A 3HSFA 2H6CA 4P9FA 3I71A 2P9GA 3V5NA 3ZGYA 5BNTA 1QYWA 2H5LA 1WP4A 4TRJA 2HQNA 3EZLA 4OGWA 3F8CA 3F8NA 5HLHA 3L9FA 3RYPA 2PGDA 2GXGA 1F0YA 1ULUA 1VJ0A 2BI8A 4FFOA 4IQGA 5T5QA 3DFUA 1O0SA 5LDHA 2V65A 2HRZA 3K2BA 4M72A 2BV6A 2BI7A 4U7BA 1V4RA 4Q39A 2QYTA 2PR2A 3LC1O 2FMLA 1UHWA 1JWBB 1JVSA 4IS2A 3FMSA 4A5MA 4QO8A 4BV8A 5K0ZA 3HFSA 4YCAA 2FA5A 3CUOA 1XGSA 2JHGA 3DZIA 3F6OA 3IJRA 3G49A 2X0RA 3CINA 5AXBA 4B79A 4ESOA 1R4MA 3RCBA 3RI4A 1QG6A 1DIAA 3SFZA 4R16A 2JFGA 4W7HA 3RUCA 5CP8A 3KP7A 3NJ8A 3AU9A 4Q3DA 5L3GA 3PVZA 2E7XA 4KYWA 2WD7A 4E31A 5ERIA 3MFKA 4PLYA 2VHWA 1DLJA 1D8KA 5JR3A 3WGGA 2Q4BA 4IQ0A 3D0SA 1K5HA 1T2KA 1TLTA 1CJCA 4RAYA 3EDPA 3W8FA 6ADHA 3PQJA 5JFOA 1XSVA 3D3WA 3WXBA 2NTVA 3S2IA 5L7WA 3S2EA 1NPDA 5E1ZB 3GFGA 3OIGA 2RC4A 5TQVA 3QP5A 3J80K 1ZGAA 2V1DA 4HX4A 1DC4A 2D1YA 4P5OA 3RJ9A 4IDEA 4F45A 2P7VB 2LF7A 2P9CA 1QXSA 3OJ0A 5CDSA 2HGCA 3GFMA 3GOHA 5IDXA 2VWQA 1C1XB 1F17A 1S3JA 1ZKMA 4YTEA 4BNCA 3CSDA 2EV6A 3M1EA 3BJ6A 1DFIA 1DBVO 3FF4A 1P2FA 1VL8A 2AQIA 3IOYA 3O26A 4XB1A 4FC6A 4ITUA 4ND2A 4J4HA 1R4NB 2C59A 4KNYA 4AVPA 3PGXA 3WJ7A 5BPDA 3WYBA 3ZV4A 2YV3A 3FTPA 2B5VA 3CTAA 3LT1A 4NDNE 3DMYA 4KTVE 1YBVA 2PFBA 3E6BA 3L2CA 4LD5A 2AG5A 2RCYA 3JD1A 4J91A 1HKUA 1LDJA 2GDZA 2HMVA 5JDIA 4B8ZA 2QZ8A 1KU2A 1RM0A 1ZXLA 5KKCA 3I9OA 1LSJA 2HOEA 3NDJA 3T4EA 4OKNA 4CJXA 4ALJA 1ZK2A 3UGKA 1CF7A 4E2XA 1GEEA 4ON0A 4Q9NA 5L51A 2YQ5A 5D8KB 1WQ2A 2CMDA 3ZWAA 2ESNA 1B8PA 2GA2A 1P4WA 3N4MA 3QSGA 3ZQ7A 1VRWA 3DBRA 4Z0PA 5IDQA 4ROSA 3TWOA 2JD1A 3EQLF 2CO5A 2VOEA 3AI3A 2X0IA 3WTVC 2NU8A 2PZMA 3ENKA 1PL7A 2D2IA 1PGJA 3MJVA 3PIDA 1KIFA 1Q7CA 4ZU3A 5GZ6A 2DLLA 1NQOA 2IE0A 3HADA 4AJPA 4CMHA 3LSTA 3DTYA 3H9UA 4EM1A 5FLXK 3VPFA 3B20A 3GNSA 3WQRA 4CMEA 3OIDA 2V6FA 2PNFA 5LEJA 1YOVB 2C82A 4RS8A 1ZH8A 5DULA 3KLNA 4KUGA 1RYDA 4BH9A 4YJGB 4UEKA 1VE9A 1D1TA 4PIVA 3E6DA 1NPTO 3Q5FA 2Q99A 1E1LA 3I83A 5CJ9A 4BNLA 4YAKA 1EK5A 5DCMA 4RPLA 4GCVA 5IDYA 5BPIA 1VTNC 1SFXA 1V3VA 1R37A 3W6UA 3FXQA 2IODA 3JYNA 4A7PA 3V7CA 1JXSA 2HYGD 2TMDA 3INRA 1RIOH 2QBYA 3KB6A 4MOWA 4WWCA 3NRVA 3JQEA 3QWIA 1Z1DA 1JDJA 3ROMA 4RJTA 1C0PA 3A9WA 1XGKA 3C3XA 5DCWA 3ONFA 3QE3A 5F21A 3KE2A 3F4BA 2AG8A 4QX6A 3VC7A 3M8FA 4E12A 3KXDA 3GFIA 1ADGA 1ENPA 2G5CA 4RB2C 2LDXA 3HG7A 4IM7A 4AG3A 1D8JA 4NJMB 2CZCA 4EJTA 1DEHA 3QJ5A 1LDMA 1X3UA 1P0FA 5LC1A 1PGQA 4F46A 4LJZF 3E6CC 4G6QA 1Y0UA 1R66A 2BKAA 3FNEA 3FRJA 4LVUA 2QM3A 1Z6TA 2A68F 1PDNC 1MGOA 2FSVA 5K5OA 4R3NA 3GVIA 3CUQC 4ENKA 1ZZEA 3M1LA 1DSSG 3GR6A 3H9JA 3DB2A 1W7PA 5KK1A 3PDUA 1W5TA 5FD6A 1RUOA 4LLLA 3D0OA 3ZV6A 1ZARA 1UZNA 2FY8A 4EZBA 4PRLA 5IZ4A 3HDQA 4WXCA 2XOXA 3G3ZA 2FR0A 4YFNF 1I0ZA 1YB5A 2HU2A 5TJ9A 2NU9A 5GZ3A 1XD7A 3DAPA 4N5MA 1WWKA 2O61A 3AY7A 4XIYA 3TL2A 2MH9A 4UEOA 5HBRA 4L9JA 2VUSA 2WD7B 2RV8A 5BMZA 3F21A 2X58A 3RIHA 4E0BA 4KDFA 4BQAA 3AFMA 3PI7A 1AXEA 4H7PA 3NDIA 4NBTA 1AUPA 5B1YA 3WNVA 2GN4A 2EV5A 1AE1A 1OC2A 3MZ0A 2VBWA 4D41A 4XLPF 4M8SA 3D3WB 3MEXA 4NHEA 3JQAB 3EYIA 3SLKA 3HHGA 1MGTA 2O7QA 4FN4A 1YL7A 1XG5A 1NM5A 5EMHA 3NEPX 3ZWOA 2Y1GA 4ALLA 3RKRA 4CPDA 2EFOA 1GR0A 4ZQEA 3H3JA 3H7AA 5KTKA 1WWXA 1XDUA 4E4YA 2COMA 3NKLA 5JHUA 4ZZLA 4FC7A 1QSGA 1ZO8A 2VODA 2JCYA 3F4LA 4H16A 5K6AC 5TT0A 4PGFA 1MXHA 2DTRA 3DOCA 1BXKA 3GZ6A 1YB1A 4M49A 4ZQGA 4MGRA 4LK1F 3DPTA 3GYHX 1C3VA 4UV9A 1PL6A 2ESHA 2QQBA 1RJWA 1B7GO 2Y93A 3DAGA 1CF7B 3FR8A 3JQ7A 3R4KA 4NR0A 1JWAB 3V7RA 3IL2A 5TJJA 1E1KA 2Q50A 1FDVA 3R3JA 5JE8A 3S8MA 4ALIA 2H27A 3RC2A 3FWNA 4M6YA 2FEZA 1DAOA 1AHIA 2XAHA 3DBRB 3BHMA 1PP7U 1ZK0A 2AEJA 3OJFA 4XJTA 3ZHYA 4BVAA 5JS6A 1R6DA 3GUYA 2O6GE 2RHCA 3TOZA 2QIOA 4AICA 1DXYA 2EHDA 1IN5A 3P7NA 2F1KA 1ISGA 1LEBA 1I2ZA 4NG5A 5JO9A 4GPD1 3P9IA 4AJKA 4TZKA 4CM9A 1HYEA 4E3ZA 3LF1A 5KVSA 2QZ9A 5T8KC 2UDPA 3GG2A 3I4FA 2Z5LA 2P91A 1NAHA 2YUTA 1XMKA 2PZKA 2R2GA 3BMQA 1A4UA 2FRDA 4CM4A 5DCMB 2PKQO 3WMWA 4Q3EA 4KP7A 3BMCA 2A69F 3GAZA 3AW9A 2OZ6A 4FR5A 1Y9AA 1BMDA 5DD4A 1V35A 4RDHA 5IT3A 1GY8A 4NQZA 4E13A 3F6YA 1ZRDA 4LSMA 4QEDA 2L01A 3P19A 3IC7A 4NU5A 2JT1A 1H0KA 4S05A 3WTTC 4FQ8A 5JAQA 5TJHA 1YL6A 3TDUC 4OSPA 5ICMA 5JSFA 2Z3YA 5JAZA 2Y05A 4YDRA 4UXNA 1PTJA 3JYOA 2YHUA 1E17A 4YRDA 4AWXB 1UAYA 4RGRA 2GD1O 2DI3A 3KSUA 1DRUA 4CMIB 3OH8A 4AJ4A 3KRTA 4Y6RA 2Y0EA 3TF5A 2NSDA 4GX2A 3AUUA 1HDRA 3AJRA 3HJAA 2VT2A 3TQNA 3G17A 2DAPA 4A5OA 4MKRA 3KUXA 2FWMX 4I98B 1MXFA 2HQ1A 1NX6A 1YGYA 3COAC 1M2WA 5FFFA 1FYKA 3ZNOA 1NVGA 1LEHA 1GQQA 1T6SA 3K92A 2GN8A 5A3VA 4A0ZA 3Q1LA 1ORRA 1A9ZA 1SZJG 4DYVA 1W7PD 5AIPA 1N7HA 1VM6A 1Z73A 1SD4A 1P9LA 2AXLA 3KM0A 2J5OA 4JBHA 4ND4A 3H65A 2K27A 3GGPA 4QO7A 4R9RA 2JD2A 4JX8A 2DU9A 5F5LA 4ZVVA 3KP2A 3OQ6A 4U7WA 1DJNA 2CDBA 2O4CA 3E03A 5ILUA 3PHLA 3RUHA 1MFPA 3U4DA 4R1UA 2X9NA 4UVHA 2FE3A 3KYBA 4N7RA 1HSZA 3IJPA 3R61A 3T0YA 1FDSA 1SMKA 1YONA 1KVUA 2FR1A 2YV2A 3D3EA 4KT5C 3K69A 1C0IA 1LSOA 3QVWA 4PLTA 5HDKA 4UVAA 1B8VA 1T26A 4RVGA 3HUDA 4AJ1A 2W2KA 1MUUA 2DVMA 4P55A 1OZAA 1QZZA 1PU2A 2C2XA 2GSDA 4NK4A 2JHFA 2FHSA 1ZYRF 3L00A 3GT0A 4NK5A 4M9SA 3WODF 1A9YA 4I9NA 4XDYA 3K9TA 3W8DA 1A27A 1P4XA 4IJVA 4BO5A 4AVYA 3U9GA 2Y68A 3GF4A 4I8XA 2YDXA 1TA4A 3GMSA 2XGXA 1ONNA 2KRFA 5D5UB 3AUSA 3DFGA 4EJVA 2PG4A 4GLOA 1Z7UA 1MKMA 3GPIA 3L4BA 4LW8A 1A7KA 1YYVA 2DUWA 5EIOA 2ZCVA 1IL0A 1W6UA 1GFSA 3BROA 2F5FA 3K30A 1ZRCA 4AIHA 3ZW9A 2QRLA 4ZRMA 1IXCA 2AS5F 1U9JA 1EQUA 2VWGA 1T2EA 3T5XA 1DLIA 1HYHA 2HAEA 4FJ1A 4Z9YA 4DPMA 5I7VA 1XQ1A 5E8IA 4ZQHA 4YPOA 3FPCA 2CGPA 2P5YA 1BW9A 4DTIA 2UUPA 2ZTMA 3E48A 5F1PA 3IWZA 1HTBA 1FSHA 4LN1A 3LA2A 2ZB4A 3DFZA 3KTDA 1SOVA 3HNPA 2ISYA 3EVNA 1WMBA 3P5SA 2Q2QA 4CO8A 4ZGWA 5EQFA 2D1VA 1GUYA 3ABTA 3H92A 2WM3A 3QY9A 4CQMB 2PH3A 1D3AA 3T1BA 5KOIA 4J1SA 5L4LA 1EVZA 4ASNA 4ENNA 4YYZA 2O3TA 4OIOF 4CGZA 5DUKA 4K26A 4RO0A 3ZDFA 1I36A 3FSRA 1I2CA 2HMSA 3O4RA 3WQSB 1I27A 5F6FA 1DPGA 3O6BB 4D0SA 5A2QZ 1QO0D 3D4PA 3BY6A 5DP2A 4XGKA 4CR6A 1XCVA 4J49A 1PR3A 2HMWA 3GZNB 2XAFA 1VC2A 5LBQA 2E37A 3CDHA 3TSCA 5C5IA 3ZU3A 4BNWA 6PAXA 1XDWA 3BMQB 1BI2A 3C1OA 3AM5A 3K6JA 3ECOA 2Q45A 4GBJA 2D8AA 3SJUA 1RYEA 1NFRA 2B83A 5AXAA 3L9XA 2GO1A 5ICEA 1J4AA 5G4KA 4GL4A 1FXSA 3DO5A 3K2EA 4EMSA 1DFGA 2PI0A 2IA0A 4MVJG 5TF4A 3ZWWA 4FB5A 1E3JA 2VHXA 2O0YA 3ZMZA 4GX1A 4BNNA 3F8FA 2VC0A 1HDZA 5H6RA 2J5RA 2CFXA 2BHLA 3VDRA 5A02A 2DUUA 2HLPA 1IHYA 4CYDA 3EGOA 4ID9A 2IW5A 3RFXA 4QTZA 3AM3A 2Z1NA 5JLAA 1AWCA 1UFMA 1XGNA 2DBZA 1P44A 2RNJA 2FZWA 1IN6A 4L9VA 1KERA 5HS4A 5T64A 5A9RA 4NQWA 5LRRA 1XHLA 1Y8QA 2DPHA 3UH1A 3R3SA 4R8HA 4K28A 4PG5A 1ZBQA 2RIRA 3PP8A 2I3GA 4XRRA 4CLOB 3SVTA 3HHPA 1FDTA 3BAZA 1IW7F 3T7EA 4IDFA 1R1UA 4EV0A 4BHTA 1VJTA 3ETEA 4R69A 3E18A 2PKRA 4IGEA 1P74A 2EFWA 1B9MA 1R5HA 3WBBA 3FHLA 3GN1A 3ZNPA 5U9CA 3HTSB 3WMXA 2P7CB 4EJ0A 4WX9A 1K89A 1UAGA 1W73A 1YS6A 2GIVA 2WD8A 3JYQA 3AFNA 4WE3A 1XR3A 2WDZA 3E5QA 2YJZA 3MEQA 3WOHA 2M8EA 1E3SA 3RFTA 4XRGA 2EJWA 1R22A 1N9GA 2M45A 3VEPA 5LHGA 2PLAA 4IDCA 3UXYA 2EFQA 4EBFA 4D46A 4B3HA 3PHGA 1U3EM 1R36A 3RBVA 6LDHA 3I54A 3PYLA 3H2SA 4IUYA 3QVXA 4UVCA 1TNTA 1UZMA 3VZPA 2R6JA 2YHIB 1NHAA 1XIVA 2P9EA 4JQCA 4LGVA 4WLNA 4WOJA 3ANNA 4CM8A 4F3YA 1Y81A 5ITWA 1R23A 3K2ZA 1P1KA 3B1KA 3GDOA 3DMTC 3NUGA 4TRNA 3C1DA 4PLWA 4B7XA 1JAXA 4JGBA 3ASUA 3U1DA 3RI3A 4E32A 2NU7A 4WXDA 1U5TC 2VNAA 1LVAA 2GCGA 3CUQA 1LEAA 2YPRA 2ZFWA 1V8BA 1KA8A 1GUFA 2FZEA 1YLFA 5HOOA 1WNTA 4ILKA 2FSWA 3I0TA 2R7DA 4OIRF 4GGOA 3VPXA 1KVRA 5DV5A 2CVQA 3ROKA 3H4VA 4J1NA 3DV8A 3NV9A 1YQAA 1FYLA 3O03A 1IN8A 4E5YA 5L3DA 1OMOA 3WBFA 4ZYDA 1GPDG 4FOOA 4IIVA 3BTOA 3M2PA 5D6FA 3TZQA 2F2EA 4S04A 2PMUA 4HA8A 4BHBA 1AHHA 5HDGA 2PZJA 3LDHA 1YQDA 2Y48A 1G4DA 4J2HA 3OQBA 4OL9A 2PBIA 4ZH4F 2ZNYA 2W84A 1BW9B 2QWWA 1GADO 4A6EA 2NNYA 1KYWA 3WTXC 3WSVA 3WTYC 2Y1OA 3GMDA 1PS9A 3HB5X 2K02A 1Y8RA 3ICPA 4LCJA 5B4UA 1F12A 3GEZA 4U0VA 1SO8A 1TEHA 2V6BA 3E97A 2ET6A 3V2HA 2GYYA 2NRAC 1ZK4A 3PZRA 4MHGA 3ZP5A 1N8KA 2HUNA 3RUEA 4DGSA 5L53A 2DQRA 1X7GA 3QHAA 3Q11A 3S55A 4XDZA 2VCYA 2E4AA 2P5KA 3KCCA 4D79A 1GAEO 5JPIA 3HSEA 3STHA 1I8TA 1PX0A 1R0KA 1Z7BA 3KP4A 1P31A 2Q49A 4PG6A 4TQGA 4J9VA 4RB3C 2FRHA 1QORA 5F5NA 2D2WA 4KDPA 1GZ4A 5H6QA 3A1NA 3ST7A 3TZHA 4YEDA 3JSAA 3WDSA 2HYFA 3M7GA 4IDAA 8LDHA 4P4LA 1O95A 1J75A 4B3JA 1PEDA 4URFA 3TO7A 1QRRA 3UFXA 3WYEA 1X13A 3UCEA 2JSCA 4MIEA 4BKUA 3AY3A 2VE8A 1SPXA 4WLOA 4GKBA 1QPMA 4O63O 2X6TA 1T1SA 2BE5F 2MLGA 4UUNA 4N5NA 4O1MA 4DPKA 5BNIA 2ZMEA 1LJ9A 2R3SA 3R1IA 1WW8A 4O59O 1R58A 2IZ0A 2DTEA 3AM4A 4IZHA 4AIJA 1F8GA 3J81Z 2B4TO 2Y1EA 1YO5C 2NACA 1FJHA 3JYLA 5IN5A 4E5PA 4F6LA 3MWMA 1BHSA 3GLXA 1CEQA 1R0SA 3I9JA 4UAGA 3UHAA 1LRJA 3P2YA 1U8XX 3RBXA 1O3SA 1NWCA 4RVSA 2PD3A 4DQXA 3F6VA 1DPUA 3H6KA 4LMRA 2J6IA 3EYYA 1Y8QB 2EWMA 3CKYA 2QG4A 3OA0A 3GW2A 3AU8A 5JO0A 5JI6A 2Y67A 1YQGA 4G7ZF 1ZMOA 1W5SA 3H3ZA 1I01A 4Q3NA 5L9AA 2YV1A 5T8KA 4Z2YA 1LUAA 4W9NC 3DF8A 4II2A 2IPQX 1LC0A 2A5YB 1W4ZA 1C1DA 4R1HA 4RAZA 3GZ4A 4FX4A 3ZMUA 3OEWA 4EJ6A 1A5ZA 3WS7A 3QVOA 1U3WA 2H6BA 5A06A 3RKUA 1J7KA 5LGNA 4RCVA 3WGTA 4RLHA 2H63A 2DBBA 1B3BA 1VKOA 2EF1A 4GH5A 4B4WA 5LLQA 1ZRFA 2X86A 1N9GB 4KZPA 1R12A 4XZ3A 5G0TA 2UXNA 2XHKA 3HN2A 5AXCA 4U0YA 1OOEA 3DL2A 3K8ZA 1GD1O 3UCFA 4P4GA 1G1AA 2ZQZA 1PQPA 2DM6A 3RWBA 3OSUA
chains in the Genus database with same CATH superfamily
5JXWA 2ZJ3A 1F6WA 3RJPA 3W5DA 3GRAA 5BNZA 2R92J 4N49A 1BAPA 5MN6A 4DIOA 2GBLA 3HJHA 1JHVA 5TEVA 5EGOA 1JHYA 1CDEA 4YAOA 1YK0A 4HZUB 4M3BA 1FMCA 2HLHA 4L9NA 2P6TA 3S2ZA 2QVGA 4ZK2A 3SOPA 4BQQA 2ZT8A 1DP4A 3LGXA 5GOTA 4TSFD 5E7MA 5TMBA 1USTA 2QUFA 3DTVD 4YRMA 1BW6A 2V6CA 5JW6A 4ZT6A 1I6KA 1N8SA 2FMTA 5BQ3A 1HRDA 1RBYA 5F2KA 3OCXA 3PHIA 1E77A 3GFBA 1X77A 1R0XA 1G8HA 2V7UA 4O4IF 2B6HA 2WE7A 5B58T 3H16A 3BR0A 4ARZB 5DBFA 2WM2A 2WJIA 1EQ2A 4R2XA 4EDHA 4C7JA 2O20A 1GZSA 4F3QA 5D5PA 4BNFA 2UZ0A 1JIQA 3VSEA 2D0DA 4I4IA 1RWBA 2ZYWX 2VP5A 1FIPA 1HC8A 4J0CA 4JJ7A 2Q4TA 5DX8A 1GLGA 4NNJA 1JLMA 4C1BA 4ZDLA 3FKSD 3KIOA 5CVUA 5ALMA 3TOCA 3OIUA 2VLIA 3A3KA 1D3YA 4QODA 4XN3A 3ZHXA 1T0UA 3R7AA 1N5JA 1A6IA 4Y3OA 2B3TA 4KYTA 4Q7LA 3BJZA 3G8YA 4EH1A 3UN1A 4GXOA 1UR5A 1LWOA 5BYBA 5HQ3A 1ZI9A 3CUVA 2YL2A 2MSEB 3QELA 4OU4A 4WNCA 3WWDA 1R1DA 1GZ3A 3H0GJ 2B20A 4DQUA 3HM2A 2X41A 5KNBH 1GP2A 3QLUA 4KEAA 3VH1A 5CH5A 4RY0A 3S1AA 5AMXA 1X7ZA 3H9BA 4Z4CA 5HIJA 1M54A 3S32A 3HPRA 4IJUA 4CT5A 1C3EA 1HFEL 3VNVA 1HKTA 4DQDA 1KZYC 2X7HA 4YJFB 2OLEA 3N2LA 1AXRA 5EHXA 1E1CA 2RHGB 5DXFA 3RS4A 1M7BA 1NNEA 1AQUA 4M6XA 4UBIA 3K3PA 3ZHBA 3PT5A 2V7TA 1OXKB 5B3AA 1NUAA 3VU3A 2GJAA 1KPIA 3DEUA 5HLIA 1IMOA 5TY0A 1KJ9A 3SY8A 3G0HA 3B6CA 4LHXA 1NK3P 1K88A 3VHRA 4OSOA 5ICSA 3BWMA 1R5NA 2O8CB 3PIOF 1TKAA 2VR1A 1RPAA 1WBDA 1WI9A 2BRUA 5IJ0B 3P97A 2D2VA 4JJKA 2ZWOA 4HG2A 1VXRA 3EH2A 2GFHA 3PENA 4J0GA 1T0FC 1PWYE 3MQFA 4NC9A 4UAVA 2OCKA 3AKZA 4RZXA 1MBHA 4V0QA 4TV7A 3G5AA 2DBVO 2EGHA 1JTEA 4DIDA 4IX9A 1H85A 2CJJA 3PYMA 4PYOA 1MJ5A 1MG0A 3EWSA 4GBED 1OKRA 2PK3A 5K3OA 3C7DB 1UT6A 4I1VA 4Y1RA 1XPOA 4KGVA 2BPOA 4PLHA 3I4LA 2L9RA 3IUBA 3OEHA 1VHTA 3VHXB 2OP1A 5D7NA 4QQ8A 5K1ZA 2IZZA 1XWIA 2CK3D 3KYCA 4XFKA 5JECA 4MGKR 1XPUA 5HR5A 1GRRA 3JQ9A 1IYZA 3CC7I 5JDCC 1ZCAA 1GNSA 2D5IA 2DFIA 1Z0AA 2H0AA 2PXCA 4MAMA 5B3JC 2XUZA 4A8JA 4F2PA 5IKPA 3T8RA 3GFJA 2BR4A 2G04A 1DAGA 1H0SA 4MUEA 2MH2A 1RQPA 5LJLA 1BFKA 4PGHA 3TL4X 5E6SA 1Q2XA 1W1WA 4OY3A 1TJNA 4DUGA 2AL7A 1EHIA 4LMPA 5CVRA 3CLQA 2E4XA 4I46A 4GX0A 4XOIA 2ID9A 5K4HA 3EUHA 3G0OA 3MRXA 3KB8A 2IZ6A 1XZDA 1PZGA 2WM9B 4FMBB 3HWRA 3ZN1A 1P0QA 5B7GA 4P93A 4AN1A 1CIVA 1LQTA 4I0BA 5K0FA 1RPNA 5AICA 3VR3D 1YDGA 1J0CA 1H5UA 2WKSA 2FFJA 4WKGA 4P8RA 5DEQA 3EMKA 4BX2A 1B26A 1YB6A 2ODWA 1FVOA 5AXAA 5GAJA 2R8PA 3RSFA 3LK6A 4AJ9A 5EMMA 3RIMA 1WSDA 3PS9A 1A8IA 4A2WA 3WLEA 4EGYA 4JU9A 1RUNA 3TUZC 2G9WA 4DMUB 1ZK3A 1FTZA 1WMFA 3H1BA 1JIJA 4MRPA 4Q4AB 2F9LA 2UXCB 4X1OA 1T3LA 2F8LA 3IVXA 1XB4A 5ETJA 1Q95A 4QBIA 2BFMA 2QAGB 3AZOA 1QGZA 2XV4S 4DQKA 1X4PA 1FMTA 3ZUPA 4P38A 1KZ1A 5HFAA 2PRYA 4YP1A 3P2OA 5J40A 1WUKS 4J90A 1G8GA 5L40A 3ULKA 3GDGA 4TKVB 1ANKA 2F64A 1RDFA 3OIPA 1DGWY 1KE2A 4YEJA 3WWCA 2C29D 1LA2A 5G1PA 5C18A 4ENPA 2Q2WA 4COOA 5BN1A 3ZWDA 2LKDA 3WICA 1GDTA 2BMJA 3ER6A 1CK4A 1DKNA 4TOIA 2VSNA 3SJCA 3ZQCA 5DJ5A 1PLLA 4RENA 3KD3A 2OWEA 1GU7A 2BJVA 3B6JA 1A31A 2Z2JA 3JAKB 3UO8B 2AOTA 2X8LA 1O5IA 1ETHA 3P5JA 5BORA 3I3SR 3KFXA 2GN1A 7MDHA 4KFRA 3PPVA 1WZCA 5ECYA 4DMLA 2XXBA 1Z26A 1EDBA 3F1LA 3DT9A 1V8OA 3ZS9A 1ZEJA 3CCUI 3MWEB 3GB9A 3RDIA 2Z2SB 4Y52J 3PQ5A 3RTCA 1GTRA 3C3KA 4KSCA 1ULYA 3HYSA 3KQLA 1GAWA 1NVMB 2WTBA 4XM3A 3C97A 4F1KA 4UVBA 4MCIA 1Q5PA 3T7JA 3DZHA 1FYWA 2GHIA 1PVEA 1OCTC 2NO9A 1QONA 1X38A 3RPQA 5BWLA 1LW7A 5AKHA 1F0PA 2LTAA 3DF9A 1R9NA 2ZIUB 1K79A 1NLUA 1MKYA 4FEAA 1G0OA 2VJAA 5TMPA 4U39A 3UGJA 2IYXA 3KBBA 4WESB 4XIJA 2HK9A 2ZT6A 1OKKD 3JQBC 1PT7A 3QG1A 5J1SB 4C5BA 4W8HA 2R6CA 3PHCA 2ZB7A 3NUQA 2GYVA 1K0UA 4C06A 1NONA 1ZWKA 3LUGA 2BM9A 2VHJA 4KLRA 4ZTFA 1Q7GA 5EYRA 5DF1A 1EMDA 4UE2A 2WP8J 1U5AA 3S14J 2GUGA 2I33A 2NTJA 4KFUA 2L19A 3RVPA 4AP6A 1N9ZA 1RIIA 3BJOA 1XPXA 5EC8A 3CE6A 4X20A 1HDOA 4CIVA 2BTEA 3ICEA 4U0WA 1YW7A 1QYDA 2YRFA 1EESA 4BKOA 2M4KA 1NJ8A 5AUNB 2XDWA 2ZUFA 2XRMA 3BMXA 1UMBB 4QFDA 2I2DA 2W98A 4N39A 4RTJA 4ESBA 3L82B 4MUJA 4Q34A 2XE8A 4QUKA 1MA0A 1HSTA 4G5GA 2AUTA 2AE2A 1FOWA 3NAUA 3I9V1 2P27A 2FFBA 5KVRA 1PYOA 2W83A 3FI0A 3S8YA 4RE5A 2X2FA 3COSA 2R751 5EE9A 4L9TA 5CNMA 3RVSA 1I6WA 4HBGA 1QP4A 3JQFA 2ZRJA 1KF0A 3T9CA 3IULA 3MB5A 1VSQA 2R6GA 1T4DA 3BD7A 4TL9A 2QL9A 3T9EA 3REQB 1QF9A 2SBTA 5E6UB 3ZJTA 2JA5J 1EK0A 1UFKA 5FOUA 2NXNB 2DCEA 4BLOA 5CITA 3PSFA 1WJCA 3WB0A 1D1PA 1LZKA 3IMEA 4AZTA 1CEYA 5LP6B 3W9YA 5K01A 1E58A 4C30A 4X62B 1U7DA 1DUXC 4P34A 3RR2A 4KGDA 3IBGA 3VA7A 1SFEA 1X9HA 3DUFB 4FGLA 4JT4A 4XOTA 1EX1A 3NRJA 4D5GA 5HJEA 2F1HA 4QBGB 2ZO4A 4AZWA 1ZDMA 4HWOA 4KQWA 3GLQA 5C4XJ 2JKYA 3MUFA 2R1VA 3LAJA 3FWPA 2YHIA 3ANMA 3DL0A 1JA0A 3RSHA 5J1TB 1G6KA 2I3AA 4FGJA 1ZG1A 3NKVA 4MVJA 1B00A 3ADCA 1XE3A 4FPXA 4MJ3A 1N3YA 1SIBE 4JQSA 1ZMRA 2ZDQA 2Q3FA 3FMPB 3HYRA 4CSWA 4LE0A 3KLOA 4FE4A 1RR7A 5IT9A 3ZVKA 1QP7A 2UYHA 4JYKA 4UY8I 1X1EA 1G5RA 4GM0A 3GEIA 1LDYA 4HDAA 2ME0A 1D5VA 2JIRA 2YY5A 3NOQA 4JLDA 3K96A 5LZ5A 1FNBA 5J2UB 3KP3A 4JL5A 1Y1VJ 3F72A 2QG6A 5AM0A 2H4WA 3HJBA 1TT0A 4EW1A 2HJWA 2Q2EA 3BJMA 2NVUB 4GKJB 5JYEA 3K0AA 1L7BA 4LFUA 3A1WA 4LC0A 3QMWA 1Z4LA 4RV5A 4OUKX 4CF7A 3TLCA 1PGPA 3CZ6A 5DLEA 2HI0A 2HX1A 5AW6A 4BBRJ 2FQQA 2JF0A 5EZYB 2XWJI 4V0LA 4H77A 4IDOA 3WP0A 3A1YA 2F3UA 1KEVA 1CF2O 1KYXA 4LBVA 1TT5B 2ZQYA 1QKKA 1O6CA 3DDNA 1I6XA 1ONPA 2P62A 4HHEA 2BEVA 4KFCA 1JHPA 4GPEA 3K9QO 1X2BA 8MHTA 4HC4A 1N5RA 1G3YA 2RJNA 3GYBA 1HF0A 4WK4B 4E6KG 1TWHJ 4ARBA 3V32A 1YHNA 3DKPA 1H2BA 1QGDA 1VLZA 2VPZA 3BBLA 3PEUA 2BHNA 3MOGA 4TQ9A 4BQFA 3O8HA 4GOJA 3VXKA 2WU0A 1Y8ZA 1CUXA 2I6FA 2H4FA 2EW8A 1RWKA 1PFVA 2YUSA 1R4NA 2YHSA 2Z98A 5AVWA 1WPKA 2ILTA 1E6UA 5KTPA 3KJZA 1ZD2P 5JNSA 4FETA 2OE2A 2MINA 1IN4A 3PDJA 5B1SA 2F4NA 4RLQA 3VI3B 4UATA 4GO1A 3LO8A 3WB2A 4G4GA 3O82A 3Q98A 4LHVA 3UAZA 3LPNA 1WXXA 1IJBA 4BGIA 1GTJ1 1WIWA 4YJGA 2FLVA 2C3UA 3F3SA 2PBLA 3FIWA 3F5SA 3FOBA 3KJEA 3WSTA 2Q5FA 3F8BA 4ZZDA 4FISA 4NY1A 3DGFC 1M1YA 3UIEA 2H3HA 5CA1B 3SMQA 1BQ3A 1M0EA 3AR5A 5EIFA 1T35A 2FVXA 2PGDA 2ZIVB 3FETA 3K2BA 3N07A 1ZR4A 5KYXA 1OYOA 1HDPA 3K09C 3FMSA 4A5MA 5BMVB 4I4LA 5SYAA 3G49A 5HG0A 3CWQA 3RUCA 4MRAA 3TE7A 3KP7A 4RESA 1GAJA 2KHZA 5JFOA 3GZTB 3WHBA 1Y7LA 3RDPA 2J9FA 2E85A 3KTFA 4JU8A 1VHJA 5CDSA 4O25A 3M1EA 4FFMA 1M74A 3MLEA 3TW7A 2JGDA 1ZJ5A 4CM1A 3L2CA 5JDIA 3ZYZA 3ER9A 3WLPA 1LSJA 4D4MA 1ZK2A 4MO9A 2XR1A 5IM5A 2A0YA 4C03A 4I1UA 4FHFA 3U3ZA 4D92A 2QN9A 2QJOA 3UMVA 1X9IA 2FOLA 3TLZA 3SZMA 4BEHA 1CY2A 2OZLB 2C82A 2CNOA 2F3SA 4BH9A 3PGA1 3FDZA 1QIHA 1U2RA 2NPFA 1RZRD 4ZV7A 4EGSA 1OWPA 3I34X 3SQDA 4ATNA 2WIKA 5FTNA 4GMDA 3QEMB 4W6QA 3UEOA 1FLNA 2DDBA 1YCFA 1ZZEA 5A5GA 4G2TA 1E4OA 4EYOA 4Z1MD 1RUOA 2BFEA 3IH4A 3EVEA 3HDQA 2FN3A 4TMVA 2CUJA 3AY7A 1IPHA 4H7PA 1TM1E 3PI7A 4NBTA 3NDIA 3Q7QA 3FTQA 1ZCFA 1FFAA 4M7OA 4LYAA 2GIZA 3H8SA 2WJHA 4RHXA 2D7CA 1NM5A 1XZCA 2VKQA 1K68A 1FP7A 1NYQA 3HS3A 3O3NB 3THSA 1RKQA 4DY4A 1YX5A 3W3AH 2VDKB 4MGRA 5JRDS 4UV9A 3BEOA 3QOEA 4MQLA 3S8MA 5IC5A 2W00A 4O2RA 2B98A 4M6YA 5CK4A 5BURA 1L1QA 4Y7CA 1FYEA 2Y3IA 2OCEA 2XT9A 4DV1B 1PKEA 4TZKA 3BGWA 1W29A 3QXGA 4DLNA 4NQRA 2PDAA 5KWJA 3S93A 2HPAA 1SEUA 3F6YA 3NAZA 2BCEA 4MK4A 3H1AA 1CUYA 5FXMA 5CUQA 4OHFA 4GRAA 4L4YA 4FHZA 2BR3A 3CNNA 2X14A 3KRTA 1YZTA 2YZNA 3OTQA 1QZ3A 4KQGA 3TQSA 4UHCA 3LPMA 4XWTA 1MMGA 1UBRS 1GQQA 3UR3C 1WDTA 3UK0A 3HYTA 1W7PD 1OA0A 3P0IA 4LZWA 3A3PA 4JX8A 1JV2B 4U1RA 1QTRA 3ANSA 3KYBA 2P9BA 5J1YA 1FDSA 1C0IA 2LCFA 4J8PA 1QGUB 3ZXSA 4XWWA 4G23A 2P6RA 1W0JA 5DSTA 1UT8A 1P7JA 5FR2A 4RE6A 3LDUA 1K8YB 5HXAA 4FJ1A 3IPCA 1VYTA 4DTIA 4X6YA 5ALIA 1AK1A 5ADUS 2W4MA 2VJNA 2I4OA 2ZB4A 1IJEA 3EVNA 5JG7A 3LPCA 1Z5NA 2R7QA 1GUYA 4EY7A 4BV3A 3MLAA 2V5VA 5LMCA 1I36A 3GEBA 2OPBA 3QBJA 3PX3A 2DHQA 4EWLA 3E35A 1ORVA 2E37A 3KR1A 3RYFB 1C7EA 3MB8A 3C1OA 2F4IA 2APJA 4TT3D 4FB5A 3ZWWA 4PJNA 4GX1A 4MMYB 2W70A 3Q8WA 4H17A 3KC2A 1XKTA 1C4XA 1S89A 4L9VA 5FFMA 1E6KA 1XHLA 4K28A 4PG5A 1HOMA 4E5VA 2B2XA 1XD2B 3HOWJ 1VJTA 3DXYA 1P74A 1AD2A 4YASA 3W90A 4PM4A 4EJ0A 3A4IA 4JSYA 3OCZA 3NYIA 1NE2A 3OWHA 4MQ5A 4Y0VA 2WUFA 2CLIB 4S35A 3ANNA 3MWGA 4HNVA 5ITWA 1B8IB 1LV8A 2NU7A 4LZNA 1MTZA 4RMHA 4IRMA 4GGOA 5DV5A 3DV8A 1XDBA 1GT6A 5L3DA 1Z6XA 4MI6A 1JIXA 3QLEA 3MUNA 2GXAA 2VTVA 4F8YA 1AHHA 5HDGA 4C0LA 2FMKA 2RHWA 2GLOA 5GTIC 2I3ZA 2J9GA 2HYIC 2VKVA 3NWOA 3WTXC 1JP7A 2OVFA 3BQMB 4LCJA 1IBRA 1G9SA 3AZQA 1QMPA 3M6AA 4B2LA 3Q11A 1TCUA 4XDZA 2QW0X 4D79A 5JPIA 4PS1A 1GARA 2A3RA 5EOVA 1P31A 4PG6A 1AZTA 3A1DA 3OIVA 2QDKA 3OKPA 2R7RA 1GZ4A 5H6QA 4ZVPA 4P4LA 2P69A 1VQPI 4A3JJ 4OB7A 4CE6A 2WTAA 3AF0A 4N5NA 5I3CA 1LJ9A 2WJZB 1R0SA 1GWNA 3L92A 2ECBA 3IH3A 1U8XX 4DQXA 2EWMA 2WHYA 1TLFA 4F5DA 3GW2A 3PPXA 2Y67A 1J8VA 1I01A 4W9NC 2XHZA 2Y76A 1OILA 3GZ4A 4EJ6A 4EUKA 1ZRFA 1X80B 1UC5B 2CVHA 2RD2A 1XD9A 1Y5LA 4J43A 2A0KA 2RHHA 4J01A 1R10A 4NZZA 1I2AA 2XVXA 2ZTUA 1BHO1 5TEWA 3V97A 3EQ9A 1WLSA 4ZXPA 4MPTA 4ZVKA 1XQXA 4AM3A 1V54H 3T3PB 2NU6B 1Q1VA 4JBAA 1YE3A 6YASA 1KKMA 2BGLA 2P9ZA 3EEQA 3T7TA 3FOFC 3DCFA 3NHRA 4PAWA 3ONEA 3R0JA 2I6SA 3H3XA 3X1MA 4YONB 1RM5A 4LK0F 1JRLA 1LNSA 3T5AA 2HCJB 4C6SA 1SXJE 3EW9A 2X9QA 3H5WA 1G3QA 2C2OA 4K6FA 1UOQA 5JJBA 4H2DA 2P40A 4I9GA 4TXNA 1ENHA 4R1LA 3AO0B 3DLIA 2GEKA 4ZVNA 3ZVLA 1K98A 1ODIA 4BMOB 3UG6A 2BGMA 3MK31 3RRNA 3SKXA 3Q41A 3C6XA 2QRQA 1EKXA 2MDTA 5JS2A 1DCKA 5MN4A 3CUYA 3PQDA 2R6DA 4KSBA 2EP8A 1YR3A 4JYMA 4MXDA 1AVTA 1RPWA 2JFQA 1T91A 3RS2A 1TAGA 1SXJC 3D7NA 1IZ0A 3C4VA 4IRXA 1PSZA 2V8BA 4JY7A 4J16A 2A4KA 3I61A 4FUQA 2CFIA 1HT3A 4RY2A 3UF0A 5AKJA 1N2CA 1F48A 5TGZA 5ICGA 2JI6A 4X66B 3GT7A 4BNTA 2ZS9A 3EUEA 1JTVA 3UT0A 4TKMA 4P5PA 2Z9OA 4WOKA 2G06A 2HWYA 2JLYA 3BWGA 2RAEA 1D1CA 3R2JA 4HZFA 4B4CA 1V8FA 4L74A 5HBGA 3V8BA 1GSIA 4CKCA 2R6AA 1P5FA 3PD0A 4WA8A 3ZHQA 2Q3BA 3JQDA 1A35A 3SSNA 3X2FA 3DBVO 4BUJA 1GFIA 1QBJA 3W4JA 4W5OA 4KMUX 1R64A 4ZZ0A 1PV1A 3IC5A 4WAUA 2BFBA 2FSGA 3SC6A 2GPNA 2KP6A 5EJIA 2OBYA 3PM1A 4PNZA 3CKLA 4L5YA 1Z33A 1FNNA 4U63A 3IP9A 4YR9A 4RTNA 1K4SA 3H9QA 1UZLA 4HPQA 3JRIA 5K3CA 5JNVA 1XNJA 1FUYB 1H2WA 4YT2A 1OX5A 2I9PA 3U7QA 1VFCA 3V8VA 4XCXA 2XUGA 3EXG1 4JA0A 2IEGA 5AJWA 1OJLA 3INYA 1E0JA 4XCVA 2ANCA 1DXQA 4OHYA 3SJ7A 5GGXA 2HRCA 4ND1A 1LRLA 4TM8A 1J9IA 2RC5A 2EARA 2WIBA 5JEEA 3QTLA 3D5LA 3K4LA 4KXUA 2FWAA 2P9YA 4CKBB 2GXBA 1SXQA 3LUCA 4I55F 2DFKB 4I08A 4WOCA 4F0JA 2WT4A 1X3LA 3QPCA 2EOAA 3JW4A 4NECA 1OAKA 3ONNA 4BMCA 5A6SA 3GX4X 3EBPA 4TMKA 4LBWA 3AKCA 4X97A 2SCUA 1QGPA 4RDIA 4B2PA 1W0TA 3TRHA 4A9AA 4TROA 1N8TA 4O4JB 5BN5B 2ZP1A 2QY9A 3IHKA 3ZU5A 2DK8A 4OQLA 1OFUA 1GRCA 3AR3A 2H8RA 4MI1A 5A2GA 2YXLA 1TT7A 1K3TA 2W43A 2FPUA 3L6OO 3EXAA 4I0WB 1AGPA 1N2OA