3FM5A

X-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
131
Chain Sequence
b'MAESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title X-ray crystal structure of transcriptional regulator (MarR family) from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
total genus 41
structure length 131
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fm5A00
3V4GA 1G3TA 3WGHA 3HRMA 2FOKA 4CYDA 1F1ZA 2HZTA 1HW1A 2UXNA 5L3DA 4EJUA 5DD4A 3KZZA 4IRGA 1I1GA 4PGHA 2K27A 5E1ZB 4L5IA 5DYMA 5FLXZ 5FLXK 2O3FA 2EJRA 3Q9SA 2MA3A 2AXLA 3K9TA 2EA4A 2LF8A 4ENKA 4ZYHA 4ENMA 1R5GA 3DQVC 2R7DA 3ZP5A 3RKYA 1HSTA 1RIOH 3J81K 3I59A 1R22A 4CZZA 1LVAA 4L9VA 2IP2A 1I6XA 3GFMA 3GWZA 3ABTA 1B4AA 1J9IA 2EWNA 4RB1A 3BJOA 2P7VB 2FEZA 3H3ZA 3MAJA 4GO1A 3RI4A 5A2QZ 1IN5A 2AS5F 4WK8F 4BNCA 1HKSA 3N4MA 1XD7A 1YW9A 3RJPA 2V79A 5BOXA 1XSDA 2P5VA 2J5OA 2XHKA 5DCMB 1MJBA 1X3UA 3LAPA 2PI0A 1V3FA 2A61A 4Q47A 1LB2A 2YSRA 4HV6A 5FO5A 4LLNA 3P9KA 3KCCA 2XAQA 3QRFF 2FBKA 5ILVA 3RDIA 1ZRFA 3CO6C 1REPC 5JR3A 2ZNZA 2PLYA 2PJPA 3HRTA 3KP6A 4ZYDA 1CF7B 1SMYF 1OR7A 2C6YA 2EV5A 2A07F 1R1VA 3K1NA 3WTYC 1KA8A 2V6CA 2DK8A 2D1HA 3LQRA 4YIFA 1P4XA 2NAZA 5DDGA 3K69A 1MKMA 2XKOA 1P4WA 2BEOA 4U0YA 3ZMSA 4LB6B 1HSJA 1S7OA 4M6XA 5IT3A 5DCMA 4P9FA 3PQKA 4EM2A 4HW0A 3CDHA 3I0TA 1UHWA 3WTUC 1Z91A 3FXQA 5LRSA 2MLKA 3PFIA 3Q9VA 3HOSA 1CF7A 1JGSA 2XIGA 1BI0A 3DPLC 2EFOA 4KIFA 1GVJA 1FSHA 3F8NA 3E6CC 3I4PA 4IF4A 3WU1B 3LAJA 1BC8C 2XAFA 1F4KA 3ERED 4KNYA 5F1RA 1W7PD 1FPQA 2HKOA 3GFJA 2Q2EA 4HLXA 3FWEA 3V8KA 4TV7A 4UVBA 1UFMA 4Q5SF 1QQIA 4WX9A 2PEXA 3DP7A 4UVAA 5E18F 1U2WA 1U3EM 1H0MA 3OV8A 5LEJA 2BGCA 3TOBA 1MDMB 2M1BA 4CGZA 2YX4A 5K1YA 1J75A 3KLOA 4MEYF 2ETHA 3F21A 5E1XA 3F72A 4RAYA 1K78B 1IW7F 3ZMUA 3EYYA 2HQRA 3DPTA 1B9MA 5TRDA 1Z1DA 2HS5A 4LFUA 5DUKA 3TGNA 3MZYA 2QWWA 1W7PB 3H92A 3NQOA 4BYYA 1KU7A 2BV6A 4FHTA 1TW2A 2P5LC 2Y48A 1H9GA 4A5MA 4EJOA 4HOBA 2JZYA 3QPTA 1AWCA 4ENNA 5CVIA 3JSPA 4AIJA 1O3QA 2MLGA 2BBYA 2H94A 2ZFWA 5LGNA 4H0EA 1B9NA 5DEQA 1F9NA 2QYOA 5BPDA 2XVCA 2QQAA 1T6SA 4WWCA 1K78A 2M5WA 1ZRDA 1XDSA 4LGWA 2L4AA 2HEOA 2NNNA 1D8JA 5J6XA 3KZYA 4OIQF 3SZTA 2O0YA 3M8EA 2QENA 3R6SA 1YS7A 4M74A 1T2KA 3C3WA 4JBAA 1W7PA 3V8LA 1FBUA 1FY7A 1VTNC 2HFHA 3IKTA 3EDPA 3JW4A 2EFQA 2OD5A 3F23A 5CVVA 1B6AA 1DPUA 1KQ9A 1IXRC 5F64A 1MJAA 1R00A 4YFXF 3Q5FA 3TDZC 3C18A 2X0LA 1IXSB 3DKWA 5E8IA 3JTHA 2D1VA 1Q1HA 3HSFA 1FYKA 3N97A 2STTA 1ULYA 1O57A 3IL2A 1BM9A 2K7LA 4G94A 5ICGA 4RB2C 1TTYA 2R3SA 4UV9A 4GCVA 5ILUA 4JQFA 4CO8A 1Z9CA 3QP5A 2WTEA 2UWMA 4HBLA 5E20A 1G3SA 1BC7C 3WTVC 3KEOA 1U6GA 3NRVA 1XMAA 4Q48A 4RB3C 1ZG3A 2QM3A 3CUOA 1YO5C 4YIIA 1YTYA 2VODA 2CO5A 4S05A 4RB0A 4LJZF 5DD8A 4U7BA 4ZZDA 3BWGA 1TQPA 1PUEE 4LG0B 4WCGA 2PFBA 3QPHA 3CLOA 2OZUA 1D3YA 2P8TA 2QZ8A 1XCBA 4N9IA 5LBQA 2NRAC 1O7FA 1YFHA 2ZCWA 3J7AO 1QNTA 5J8CA 4RGUA 2XGXA 5IT9K 5IT9Z 2K4JA 4JK1X 3FMRA 4RGRA 1KGSA 5HOOA 2CYYA 4BHPA 1D8KA 1BN5A 2RV8A 1A04A 2FMYA 2QBYB 3ELKA 2YPRA 3BOQA 5HS7A 1IAWA 2HYGD 2YU3A 3KE2A 1WWXA 4LMYA 1ZRCA 2VOPA 5D8LB 4I01A 2O6GE 5D5VB 3M8FA 4GYGA 1SAXA 4A0ZA 1RUOA 3ZMZA 2P7CB 4O3MA 2XROA 2JPCA 2W85A 2VBWA 2LNBA 5EEGA 1YLFA 4EJWA 3F3XA 3HTSB 2M8EA 4EVIA 3CUQB 4LG0A 3R0AA 3T1BA 3FXUA 1PP7U 3RPUA 2E7XA 2X4HA 1OYYA 3B02A 3FXRA 1QGPA 2ZKZA 3TO6A 5LGTA 3QAHA 2VT2A 1OYIA 5L3EA 4MTEA 2EB7A 1KYZA 3VEPA 2WV0A 2VC1A 2QBYA 1XDUA 3RKWA 2EV0A 4ZYEA 1FYLA 4ZYGA 5BMZA 4BHCA 4UHTA 3E97A 2GZWA 4I2OA 2Y0MA 1OPCA 5LHIA 2DO7A 5ICCA 3J81Z 1WI9A 2FNAA 2XASA 4FT8A 3O2PE 1OYWA 2JRTA 3NEUA 3CUQA 1FBSA 3EYIA 1IUYA 4HAMA 2KRFA 4KN4X 1KU2A 2A6EF 2B0LA 2UZKA 5L3BA 3O6BB 3R4KA 5FGMA 3TKYA 3MQ0A 1JHFA 1WQ2A 4XSXF 5D8KB 1FLIA 1XGOA 1QO0D 2FBIA 3ECOA 3FZVA 4A5NA 2DBBA 2VONA 1YS6A 4WXHA 1EV7A 2OAZA 2IT0A 1JE8A 1U8RA 1TBXA 1XMKA 2K4BA 4ENJA 1YYVA 1W5TA 2VT3A 3MFKA 3RYRA 2BE5F 2ZNYA 1TNTA 5LHHA 2VN2A 3BPVA 5HLIA 1QPMA 2IPQX 3QP6A 1PP8F 4XSZF 4AIHA 2ZMEA 4L0YB 4GYIA 2XRNA 3HIFA 3SFZA 4G8XA 1T0FA 4IVNA 3BZ6A 4HDVA 2VC0A 1I5ZA 3P9IA 2LDUA 4FX0A 3MZHA 4I0AA 1P6RA 2ZO4A 2IJLA 3U9GA 1YG2A 2MD5A 1S6LA 2L02A 3T5XA 1NHAA 4YFNF 4AIKA 3FM3A 5KK1A 2IA0A 3REOA 3FMSA 3ROUA 4M72A 3L2CA 1HBXG 4PGGA 4OINF 2F5EA 1ZHFA 2KIUA 5H6RA 4E70A 3KP2A 4I02A 4HX7A 5D5WB 4IRIA 3GZ5A 4ETSA 2F5CA 3K1MA 3EQLF 1TNSA 1XSVA 4I98B 4M9XA 3WGGA 4WXDA 3HHGA 4KIGA 3K0LA 4MGRA 1IXCA 4EM1A 3GF2A 1R5HA 4IPAA 3GFLA 1E2XA 2K86A 1U5TA 5HS9A 3GVAA 4KT5C 1BI2A 1J5YA 3R61A 4P96A 5CVRA 4EGYA 4HV5A 1O3RA 3AAFA 4UV8A 5JVTA 2P6TA 2W24A 2O8XA 5ICFA 2D2WA 3GW2A 4Z2YA 5HLGA 3HTUA 4LLGF 2IVMA 2FA5A 4PCQA 3FX3A 3V7SA 3IWZA 3V7CA 1SFEA 3QU6A 2JSCA 6PAXA 2DPUA 3SQNA 1XN7A 5L3CA 3GZ6A 3P7NA 3LA2A 1U78A 3RYPA 3TOAA 1KYWA 3KP7A 2CW0F 2EFWA 2YR2A 4HLYA 3BDDA 4ZH4F 4KMFA 3U2RA 3GEZA 1BIBA 2GAUA 1ZLJA 1ZYRF 3GXOA 1YW8A 3M9AA 4UUVA 3KP5A 3R60A 5DV5A 5ED4A 3LA3A 1ON1A 3WTSC 4XRFA 3E5UA 3K2ZA 1B59A 2FF4A 3DV8A 1IF1A 3WGIA 1RNLA 1SMTA 1Z05A 4KN7X 4M6YA 3BJ6A 1KU9A 3ZN1A 3GX4X 4ESBA 2FQ3A 2RGVA 2HGCA 1MJ9A 1LNWA 3WTTC 1ZG5A 3DXJF 4MTDA 1CGPA 1GHCA 3ECHA 3KEQA 1ZH5A 2HKXA 3H3UA 1YIOA 2TDXA 3I54A 5L3GA 2QLZA 4MEXF 2W84A 1GXPA 2ISYA 2M30A 1OMIA 2PMUA 2VE9A 3GLXA 3T8TA 2CFXA 4IHSA 1ZAOA 1LDJA 3M1EA 4RGSA 2H09A 3BPXA 3DFGA 2Z99A 4P9UA 3HRSA 1YQAA 4Y13A 3I64A 1RUNA 3CTAA 1S7AA 1K79A 4DNCA 1K7AA 4G7HF 5FB2A 3D5LA 2EA2A 2W25A 4DQ2A 1MZBA 5ILSA 3CO7C 1USTA 1E17A 4PDKA 1ODDA 2XV4S 4G7ZF 3F8MA 3MCZA 2DQRA 1LEBA 2PN6A 1IN4A 2DTRA 1USSA 1FOKA 5BQTA 2MH2A 1WSUA 4HX4A 2VBYA 1UCRA 1FP2A 3QU3A 3W6JB 1R23A 2GQQA 3DF8A 4ASNA 3B73A 1J7KA 2GIVA 5DCFA 1GXQA 2DPDA 4P5OA 3TO9A 4Y17A 2VOOA 3WE3A 2A68F 3P9CA 2XKPA 2XAGA 3KP4A 4MQ9F 4U7DA 2D45A 1R1TA 3ULQB 3BROA 4M9SA 1BI1A 2EK5A 2Z9OA 4XLNF 4G6DA 3HUGA 1KU3A 1ZARA 3IC7A 5CVUA 5FD5A 3C1DA 1BOAA 3F8FA 5D5XB 5JHUA 3G3ZA 2STWA 1SFXA 1SD6A 3IRQA 2HR3A 3I53A 1SD5A 4LK1F 1IRGA 5BPIA 5JI6A 1MD0A 1IRFA 3J80K 4GXOA 4IXAA 1C0WA 3ABUA 2O03A 2EFPA 4KIBA 3K1PA 1R58A 2VBXA 2IA2A 3QOPA 4MQVA 4K2EA 3KETA 4A12A 2Q0OA 2NYXA 1HW5A 5LGUA 1P4AA 5E17F 1LDDA 4S04A 5D6EA 4R79A 1B1BA 3HRUA 1J0RA 1T38A 3WTXC 2HOEA 5HLHA 2CG4A 1LDKB 2KIMA 2Z3YA 5HS8A 4A6DA 3E6MA 4LK0F 4MHGA 2EFNA 3TO7A 1Z6RA 2OQGA 4D0PA 1FC3A 3W6KB 3F22A 4L0ZB 1QZYA 2XAJA 1G3WA 2F2EA 2FU4A 5K5QA 3L09A 4BHBA 4NB5A 1SFUA 2M45A 1IN8A 3GFIA 2G7UA 4L9TA 3VB2A 4EMSA 2E1CA 3PQJA 2F5FA 3JAMK 3JAMZ 1I1SA 3V7RA 2KIFA 4IJAA 2HTJA 2PBIA 4CDGA 2FXAA 4UNOA 4RAZA 1DDNA 4KMUX 4ON0A 2UXXA 3ZMTA 1RZ4A 3E3VA 4HF0A 2ZXJA 3FHZA 4EJTA 1Z7UA 2JPBA 3VODA 2ZMEB 1ZGJA 4R8HA 1HW2A 3L00A 2QQBA 5TJJA 1G6NA 5CYVA 4NQWA 2DQLA 4LB5A 2L4MA 4B09A 4HF1A 4I09A 3SZPA 2LF7A 2J5PA 1RI7A 1ZGAA 1EH8A 2GXBA 2L3DA 2MC3A 2IRFG 2COMA 1F5TA 1S3JA 3LA7A 3BJAA 2OA4A 4O5VA 1G3YA 1TLHB 2ACJA 2ISZA 1K6OA 2DFIA 4EM0B 1QBJA 5A2QK 4MNUA 1SD7A 2KJBA 4R1HA 4WXCA 3WE2A 3OOPA 3I58A 1XGMA 5K5RA 2V1UA 4ESJA 5E1WA 3T0YA 3KP3A 4L9JA 4ZZLA 4F7ZA 2Y75A 5HDGA 2OQRA 5LLQA 5E8GA 2DT5A 3RKXA 2BYVE 3CUQC 3U1DA 1J2XA 2RNJA 4YFKF 1HQCA 4U0WA 3KFWX 1U5TB 1H9TA 3ZPLA 1SD4A 2FSWA 2PG4A 2HTSA 3LWFA 2QQ9A 4OMZA 1LEAA 4I7HA 1OKRA 4HDUA 2EV6A 1D5VA 5FFXA 1LJ9A 2V9VA 3RTRA 4G6QA 5L3FA 3WTZA 4KYWA 2GWRA 2A69F 5JFRA 4U0VA 4HX8A 4P55A 4HYEA 3ZMDA 2NS0A 3D0SA 2MH9A 4IHTA 2OZ6A 5F6FA 5AIPA 5D6FA 5K5OA 1FP1D 2FNPA 2FRHA 2O61A 1EH7A 2ZJ2A 2CGPA 4OOIA 5LRRA 2L54A 3WU0A 3FM5A 4U88A 1FNNA 3V8JA 3ZMVA 5AONA 5KVRA 1ON2A 3L9FA 3GO5A 4KFCA 3WODF 4I0BA 3E5QA 4KA4A 2HDCA 2ADUA 4G9YA 3ZQ7A 3FMQA 2R7FA 1DUXC 1XCVA 3S2WA 5AIQA 2RC4A 2P4WA 5LHGA 2FBHA 2A3SA 3DEUA 3F8BA 1R7JA 3LQQA 2KJCA 2V1XA 2FMLA 2DK5A 3HSEA 2DAOA 2VXZA 2E7WA 1BJAA 4UXNA 2Q8KA 5LEKA 1W4MA 1BIAA 1FSEA 2WWYA 1KQ8A 2IA1A 1ONVA 3O3KA 4OIPF 3RPQA 2LSOA 2KKOA 5CLSA 4B8XA 1IN7A 2H6CA 4N9HA 4OIRF 4O6JA 1FBQA 1P92A 3E6BA 3F6VA 5CJ9A 4CXFA 3IHUA 4PZJA 3E5XA 2GXGA 3JSOA 1U5TC 4L18B 2Z5UA 2P5KA 3IKVA 1JHHA 4Y15A 5J8FA 2NNYA 3COAC 3MEXA 5D4SA 2DI3A 2RN7A 4M73A 1O3SA 1ZN2A 3LSTA 2CSOA 3CJNA 2P6SA 2RVCA 3GYHX 1HKTA 1FX7A 4LD5A 2K02A 3BY6A 4M9ZA 3EETA 1STZA 1P2FA 1FT9A 4QLCU 3BP8A 4EQQA 5H20A 2L01A 4L5JA 1QZZA 5HVQC 1R36A 2JT1A 1UHMA 3TQNA 2RQPA 3HHHA 5FFZA 3HOTA 1MDMA 1J59A 2A6HF 3GUDA 4HQMA 5HDKA 5ICEA 2QUFA 1ZG1A 1JXSA 2DLLA 2OU2A 3HSRA 4QWQA 1W5SA 2HQNA 5EEHA 1Z6TA 5DUIA 3G73A 4RS8A 2VBZA 5D5UB 4HQEA 4XLPF 1UB9A 1ZLKA 4EJVA 4Q4ZF 1PDNC 4A0YA 2G9WA 4AWXB 3LFKA 1BI3A 2M87A 1L3LA 1S8NA 4KICA 4A2UA 2CQKA 4BXUA 3R0JA 4M71A 3EUHA 4KDPA 1AOYA 1KQ0A 4IRHA 2A5YB 4CHUA 4G7OF 1V4RA 2DU9A 3TDUC 2G7HA 2XUBA 5D4RA 1Y0UA 4NHJA 3KLNA 1L0OC 2W57A 4AVPA 2H27A 2IW5A 4BAYA 1DP7P 2GA1A 1G4DA 3VFZA 4XBFA 1WRJA 2CWEA 1XB4A 3I5UA 5ERIA 5FD6A 1FWZA 3ML6A 2XAHA 4EV0A 4KUMA 2Z33A 2PMHA 3JTGA 2ELHA 3ZN0A 1TQMA 5BS6A 2LKPA 3E6DA 2PQ8A 4N0BA 1YW7A 2GA2A 3RIRA 2WC2A 1HKQA 1LQ1A 1IN6A 2HYFA 4GGGA 1XGNA 3I71A 4HZFA 4ESFA 1XSXA 1T98A 3IWFA 1MGTA 1ZREA 1O3TA 2JTVA 4RGXA 2H6BA 3T8RA 5H6QA 3F8CA 4EGZA 3ISPA 4CICA 4HF2A 3C7JA 3MWMA 1O7LA 3L7WA 3VOEA 2HWVA 3SXYA 1TQIA 2ESHA 3HYIA 3J80Z 5HDNA 2DW4A 4UVCA 1R1UA 1S29A 4AD9A 1T39A 3FF5A 4FX4A 2YX7A 2FE3A 2OBPA 4YG2F 1IZ1A 2ESNA 3SHFA 2F5DA 4OMYA 1HXDA 3M7GA 4A0XA 1FYMA 2RKHA 3WG9A 4WF2A 1DPRA 1XGSA 1BBYA 4BQAA 4A6EA 2E1NA 5CVJA 4OU0A 2ZBKA 1FZPB 2VE8A 3I59B 2RDPA 4OIOF 4BH9A 3IRRA 3WTWC 2QVOA 4LLLA 2V1DA 1WKMA 3F6OA 4HA8A 1TW3A 2MBFA 4L9NA 1I27A 1EH6A
chains in the Genus database with same CATH superfamily
3RZDJ 2OJED 1PVEA 2LH9A 2P0WA 2VXDA 3V4GA 1G3TA 3WGHA 2B63J 3HRMA 2YU9J 2FOKA 4CYDA 4ZC3A 3CCEI 2EQRA 1F1ZA 2HZTA 1HW1A 1ETVA 3FK6A 2UXNA 5L3DA 1MW7A 4EJUA 5DD4A 3KZZA 4IRGA 2WV1A 1I1GA 2KRHA 4PGHA 2K27A 3VWBA 5E1ZB 4L5IA 5DYMA 5FLXZ 5FLXK 1WJAA 1YE9A 2HDWA 3OR1C 1RKTA 2O3FA 1QHGA 1XS9A 2GLOA 2EJRA 3Q9SA 2MA3A 5IP9J 5TISC 2AXLA 4EEFG 3K9TA 2EA4A 2LF8A 4IQ4A 3ZQIA 3GLLA 4ZYHA 4ENKA 3GCMA 4ENMA 1R5GA 3BR6A 2DA6A 2ME6A 4DYRA 3DQVC 2R7TA 4XLHA 2WAEA 5HOOA 2NS8A 2R7DA 4BXXJ 3ZP5A 3RKYA 1HSTA 1RIOH 3J81K 2LD5A 2XDVA 2WBMA 3TMOA 2M2EA 3I59A 3IAS2 3OOUA 3K2AA 1UG0A 1R22A 2KMUA 4CZZA 1LVAA 4L9VA 2IP2A 1I6XA 1MBJA 2G0EA 3GFMA 1T8IA 3AG1H 4DOZA 4G12A 4NBQA 3GWZA 3VYUB 3ABTA 1B4AA 4IHVA 1J9IA 2EWNA 1SFOJ 4RB1A 3BJOA 2P7VB 3TP3A 2FEZA 2KISA 2ZXHA 5E3OA 2ZXWH 3H3ZA 2R7OA 3MAJA 2M7AA 5J3LA 4X0GA 1JKQC 4GO1A 3GTPJ 3RI4A 1UMQA 5A2QZ 1IN5A 2AS5F 2AXTC 2OTJI 1X2MA 4WK8F 1YI2I 1U0JA 4BNCA 1HKSA 3N4MA 1UHSA 1XD7A 2WY8Q 5FROA 5IPAA 1YW9A 3RJPA 2V79A 4KT6A 1JT6A 4F3QA 5BOXA 1XSDA 2RAEA 2P5VA 2J5OA 2XHKA 5DCMB 1MJBA 1X3UA 3OYBA 2PX9A 3LAPA 2PI0A 1F43A 2HXOA 1V3FA 5M3MJ 2A61A 4Q47A 3G6EI 1LB2A 2YSRA 2A6TA 4HV6A 5FO5A 4LLNA 3P9KA 1JTXA 3KCCA 1Y1VJ 2XAQA 3QRFF 1W36C 1HA8A 3UR3C 4BS9A 2FBKA 1MBEA 1ZTRA 3PNYA 5ILVA 1D0ZA 3RDIA 1LPQA 1ZRFA 3CO6C 1REPC 5JR3A 2ZNZA 4CZCA 3B6CA 3HM5A 2PLYA 3HOXJ 1JUSA 4J01A 2PJPA 1DGRM 3HRTA 5GAHJ 3KP6A 4ZYDA 1CF7B 1SMYF 3OYHA 4H4KC 1B8IB 1OR7A 2C6YA 2EV5A 2A07F 1R1VA 1Z67A 3K1NA 2CV1A 4A3KJ 3WTYC 1KA8A 4N4OB 1LUJB 2QF7A 1Z21A 2X6YA 1X4PA 3TBIA 2Z16A 2IGNA 3AFHA 2V6CA 2DK8A 1TWHJ 4DJAA 2BVMA 2D1HA 3LQRA 4YIFA 1P4XA 2NAZA 2R7XA 2BOLA 5DDGA 3K69A 3FISA 4PFPA 2E1MC 1MKMA 3HJEA 2OTLI 2XKOA 2MW8A 1P4WA 2BEOA 4D5CA 4U0YA 4J00A 2RQQA 2V9KA 1F36A 3ZMSA 4A3JJ 4LB6B 2E2HJ 1T08B 1HSJA 1S7OA 2M0CA 2ECBA 4BEHA 1TWCJ 3BLYA 4A3CJ 4IOAF 4M6XA 3K4MA 2H8WA 4DBRA 5IT3A 5DCMA 4P9FA 3PQKA 4EM2A 4HW0A 3CDHA 3CC2I 3I0TA 1X1AA 1UHWA 1HDPA 3BG7A 5C4XJ 3J7YJ 3WTUC 2E35A 1Z91A 3FXQA 2FX0A 5LRSA 1S5LC 4AC0A 2MLKA 3PFIA 1ITYA 1ZK8A 2HI3A 3LSIA 3GBGA 3Q9VA 3O8HA 2RNGA 1RC9A 2XPUA 5F1JA 3AL0B 3HOSA 1XTAA 4XN3A 2O7OA 3FKJA 1CF7A 4PJJA 4BY1J 1JGSA 2XIGA 1BI0A 3DPLC 2XGDA 3DBRB 3HPHA 1HF0A 2EFOA 2DJNA 1ETXA 3H5NA 4KIFA 1JJ6C 1HDDC 4BY7J 4AUXA 2IS4A 2AHQA 1GVJA 2W82A 1FSHA 3GTMJ 3F8NA 3E6CC 3I4PA 4IF4A 3WU1B 3LAJA 2X85A 3KYCB 2XAFA 4RM2A 1F4KA 1B72B 1BC8C 3ERED 3IH3A 2AQFA 1WJ5A 1MBFA 4KNYA 5F1RA 2XF5A 1VQ4I 1W7PD 1FPQA 3G1MA 2HKOA 5J4YA 4AU7A 3GFJA 5FLVA 4PSXA 2ZB9A 1MNMC 2EIJH 2Q2EA 4HLXA 1JUMA 3FWEA 2Y9ZA 2LOOA 3M8JA 3V8KA 1DQUA 4TV7A 3ZQHA 4UVBA 1UFMA 4A3DJ 1EKEA 2LVSA 4Q5SF 1QQIA 4WX9A 2PEXA 3CDLA 3DP7A 4UVAA 5E18F 1JKPC 3G71I 1U2WA 4PJNA 2KRCA 1U3EM 1H0MA 1GUUA 3OV8A 5LEJA 1LVKA 3OYGA 4B47A 2BGCA 3TOBA 1MDMB 1FMWA 2M1BA 1JI8A 4ZYAA 4CGZA 1TWAJ 2LKSA 3GTLJ 2YX4A 3ASNH 3FXOA 1D1CA 5K1YA 1J75A 3KLOA 2KZVA 1S7EA 1E0EA 1APLC 4MEYF 2ETHA 2L7MP 5FJ8J 3F21A 2COBA 5E1XA 3F72A 3M3YJ 3K7AJ 1X4OA 5J1UA 2FUG2 4RAYA 1K78B 1WCMJ 1A35A 1IW7F 4QPOA 3ZMUA 2W7NA 3EYYA 4JOMA 2HQRA 3DPTA 1B9MA 1RPWA 5TRDA 3S16J 1Z1DA 3C2GA 2HS5A 5K7ZA 3QWLA 3WHBA 4LFUA 3L2VA 5DUKA 3TGNA 4IEJA 3CJQB 4A3LJ 2CUJA 1B72A 3MZYA 2QWWA 1D0XA 2KT0A 1RESA 3BG3A 1W7PB 5FKNA 2DFFA 3H92A 3NQOA 4BYYA 2M9HA 1KU7A 2BV6A 5B5EC 4FHTA 2NVUB 1TW2A 1EF4A 2P5LC 4C9YA 2Y48A 1H9GA 4A5MA 4EJOA 4HOBA 5DM7F 2JZYA 4IQJA 5C44J 3LOCA 4GRIA 5EZHA 3QPTA 1TWFJ 1AWCA 2MSYA 3FK7A 1MMSA 1R4NB 3PL8A 2KIQA 2R4GA 4NDLA 4ENNA 5CVIA 3JSPA 5IP6A 4ZJZA 4AIJA 1O3QA 2MLGA 3KX2A 2BBYA 1BL0A 1JGGA 1LKXA 2H94A 3PO2J 2ZFWA 3S17J 5LGNA 4H0EA 3K6GA 2ME0A 4C3JJ 3HDDA 2M3AA 3H3VK 1B9NA 3KZIC 5DEQA 2LY1A 1F9NA 2QYOA 5BPDA 5EGOB 2XVCA 2PJRB 2QQAA 3ABKH 1T6SA 4XKCA 1POGA 4WWCA 2K9NA 3RKQA 1K78A 2M5WA 1ZRDA 3AL0C 5F0FA 1UJ8A 1XDSA 2L4AA 3DKYA 2NNNA 4LGWA 1A36A 2HEOA 1D8JA 5J6XA 3KZYA 4OIQF 3SZTA 2O0YA 1LFBA 4M3GA 3CCVI 3M8EA 2QENA 5CKTA 3R6SA 2OCCH 4IL6C 1YS7A 4M74A 2IBDA 5J40A 1VQNI 2QCOA 1T2KA 3C3WA 4JBAA 3AG4H 4FE7A 3VYTB 1W7PA 3BC8A 3V8LA 2GOMA 2XPVA 3VPRA 1FBUA 2DOEA 1IRXA 2HPMA 1FY7A 3CMEI 1VTNC 2HFHA 3LSPA 1R5ID 2HNHA 3IKTA 2K40A 3OSGA 3EDPA 4E7LA 4BE1A 2CFOA 3X2QH 2R7RA 5HLTA 3D5RC 3JW4A 3QODA 2EFQA 2NXNB 2OD5A 3F23A 5CVVA 1B6AA 1DPUA 4PUSA 1KQ9A 5GTIC 2XSDC 1IXRC 3CCLI 1OCPA 1MJAA 5F64A 2BXYA 1R00A 4FE4A 4YFXF 3Q5FA 3TDZC 3C18A 1FTTA 3FXLA 1X3WB 5HODA 2X0LA 2IAIA 1IXSB 3RPUD 3DKWA 5E8IA 5EGOA 3JTHA 2D1VA 1Q1HA 3K4NA 3ZQFA 3HSFA 2XSJC 3H5RA 1FYKA 3CCRI 3ABLH 3N97A 2STTA 1ULYA 3U21A 3OYNA 1VQ5I 1O57A 1WI3A 4UUSA 3IL2A 3TEDA 1BM9A 2K7LA 1BR2A 4G94A 2ELKA 2A05A 5ICGA 4RB2C 1TTYA 2R3SA 1QU3A 4UV9A 2MC4A 4CCMA 2EILH 3CJTB 3IP4B 4GCVA 5ILUA 2LYCA 3TW7A 2VJ4A 4MFEA 1TL8A 2WADA 3HZJA 2HXIA 4JQFA 1N77A 3SEQA 4CO8A 1Z9CA 1ACIA 3QP5A 1YHQI 2WTEA 2UWMA 2CW7A 4HBLA 5E20A 3ZRGA 3I55I 1G3SA 1BC7C 4XLAA 3WTVC 3A2KA 1K4SA 3EUHC 3KEOA 1WZ2A 4AM3A 3DPUA 1U6GA 3NRVA 2GM4A 5IYBJ 4M3EA 1XMAA 4Q48A 4UB6C 4RB3C 4N4NB 1ZG3A 2ZJPF 4IX7A 2QM3A 3CUOA 1H88C 3GTQJ 3B6AA 1FEXA 1TT5B 1YO5C 4YIIA 1FIAA 1YTYA 3DCFA 5GP9A 5FKLA 2VODA 2CS3A 2CO5A 4S05A 4RB0A 4LJZF 5DD8A 1A5JA 4U7BA 2HU9A 4ZZDA 3BWGA 3OYIA 1TQPA 1PUEE 4LG0B 3Q0UA 1WPKA 2JSPA 4WCGA 2PFBA 3QPHA 3CLOA 4DGWB 2OZUA 5C3EJ 4D7NA 2ZJQF 1MSFC 1D3YA 2P8TA 2QZ8A 1SVLA 3JRBA 1XCBA 2IGOA 4HSTA 4C30A 4N9IA 4CCKA 3L2WA 1K61A 1K6YA 1UZCA 3MKLA 5LBQA 2NOJB 5EG0A 2NRAC 2X9DA 2LY2A 1O7FA 2QA4I 1YFHA 4CH7A 2ZCWA 3VSLA 4I6ZA 1VQ9I 3J7AO 1MBKA 4F93B 2F4OB 4OAZA 2CRGA 1QNTA 3JRDA 5J8CA 2HOAA 4RGUA 1JTYA 3DEEA 4B44A 2XGXA 5IT9K 5IT9Z 1BOBA 3CCMI 2K4JA 2DJIA 1VQKI 1MH4A 4JK1X 3FMRA 4M6VA 4RGRA 2NVXJ 1KGSA 3BT9A 2CYYA 3Q0WA 1D8KA 1BN5A 2RV8A 4V2GA 1A04A 2FMYA 4BHPA 2QBYB 3ELKA 2YPRA 2OF7A 3OL3A 3BOQA 5HS7A 1IAWA 3AG2H 1SFKA 2JRMA 4XRSA 2HYGD 1SVOA 2YU3A 3KE2A 1WWXA 4IOCF 4LMYA 1ZRCA 2VOPA 5D8LB 1ETKA 4I01A 2O6GE 5D5VB 4GDFA 1G8XA 3M8FA 2KPMA 4GYGA 3BR0A 3F0CA 1SAXA 4A0ZA 2IS1A 2VQHA 1RUOA 4A69C 3ZMZA 2P7CB 4O3MA 2XROA 2JPCA 3QYFA 3K70C 2W85A 2VBWA 2LNBA 4RDUA 5EEGA 2CQXA 1YLFA 4EJWA 3F3XA 4BBSJ 3HTSB 2M8EA 4EVIA 3CUQB 4LG0A 3R0AA 2K9SA 4IKFA 3T1BA 2A5WA 4Y4RA 3G4SI 3FXUA 1PP7U 3RPUA 1EA3A 2E7XA 2X4HA 1OYYA 3B02A 3FXRA 3PNVA 1QGPA 2ZKZA 3MVPA 3TO6A 5LGTA 3HOYJ 3QAHA 3H35A 2VT2A 1OYIA 3DBLB 1U9OA 5L3EA 4MTEA 2VJ5A 1T33A 3A4CA 3QOEA 5GPCA 2M7BA 2EB7A 3HL2A 2X6XA 1KYZA 2M0MA 1ERDA 3SJMA 3TL4X 1Y56A 3VEPA 1ZQ3P 2WV0A 2VC1A 4RA2A 2QBYA 4LOCA 1XDUA 3RKWA 2EV0A 3W2AA 4NNJA 2JJ7A 2JN6A 2X51A 4ZYEA 3S14J 1FYLA 2M4GA 2E60A 4A3BJ 3FIWA 2F6CA 3PUBA 2Z2SB 2XF6A 5EJCA 3PIOF 4ZYGA 2V26A 5BMZA 4XLCA 4BHCA 4UHTA 3E97A 1W0TA 2QQ8A 2YS9A 1N78A 2GZWA 3H5AA 4F91B 4I2OA 2Y0MA 1OPCA 2VPRA 5LHIA 2DO7A 5ICCA 3J81Z 1WI9A 1OJLA 2FNAA 2LKXA 4XIDA 2XASA 4FT8A 3RQIA 2R7VA 5BNGA 2IS6A 3O2PE 2Y0SA 1OYWA 3CP2A 2JRTA 2EZLA 3NEUA 3CUQA 1FBSA 3EYIA 2WA0A 1IUYA 4HAMA 2KRFA 4KN4X 2ID6A 3H9QA 5F27A 3A0HC 1KU2A 2A6EF 1Y8QB 2B0LA 2UZKA 2BXZA 2BY3A 5L3BA 3O6BB 3R4KA 5FGMA 3TKYA 1JKOC 3MQ0A 3QPSA 4RAGA 1JHFA 3S93A 1WQ2A 3I3LA 4XSXF 2O9LA 1FOXA 1JUPA 3SYTA 2P81A 5D8KB 1FLIA 1XGOA 1M1EB 1QO0D 2X1DA 3LL7A 2FBIA 3W2WA 1IGNA 3ECOA 3FZVA 3IUOA 1XG1A 4A5NA 2DBBA 2VONA 4V2FA 1PUFA 4U87A 2JUCA 1YS6A 3LSHA 4WXHA 1EV7A 2OAZA 4RM3A 2IT0A 2OPTA 5C4JJ 1TP4A 1JE8A 1U8RA 1DU0A 3K4KA 3FHNA 5GADJ 1MIJA 4BEHB 3PSFA 4IHYA 2CMPA 1TBXA 1OQYA 1XMKA 1O4XA 2K4BA 3H9JA 1YYVA 1W5TA 2VT3A 3MFKA 4ENJA 4BU2A 1WFXA 4RMNA 3RYRA 1QZEA 2BE5F 2ZNYA 5JLXA 1TNTA 5LHHA 2VN2A 3BPVA 3AG3H 3O8GA 5HLIA 1QPMA 4ZDPA 2IPQX 3QP6A 4D1QA 1MBHA 4UUTA 1PP8F 4XSZF 4AIHA 1GLNA 2ZMEA 2UUZA 4L0YB 2LLKA 4GYIA 2DMQA 1A6IA 2XRNA 3HIFA 3SFZA 4G8XA 1T0FA 2E36A 4IVNA 1YJ9I 1Y1WJ 3BZ6A 4HDVA 2Y31A 2VC0A 1I5ZA 3P9IA 2AO9A 2LDUA 3S32A 4F55A 9ANTA 1VQ7I 3CJRB 4FX0A 3MZHA 4I0AA 1P6RA 1Y39A 2QKMB 2ZO4A 2IJLA 3U9GA 4BGDA 4RBOA 1YG2A 3DTIA 2MD5A 1S6LA 2L02A 3M1CA 2Q1ZB 5KCMA 3T5XA 3DKXA 1W0UA 1NHAA 2EZKA 4YFNF 5K7HA 3G2BA 4X1EA 2Q2EB 4AIKA 3FM3A 2X1EA 5KK1A 4BQNA 2IA0A 2ZFUA 4G6TB 2DMPA 1PJRA 3REOA 1IRZA 5TGTA 3FMSA 2LK2A 3ROUA 4M72A 3JRAA 3QPLA 3L2CA 1HBXG 1AHDP 2KP6A 1DGWY 4PGGA 5EDNA 2OV7A 3K4BA 4OINF 1R9TJ 2F5EA 1ZHFA 2HQAA 2MGQA 1WJEA 1I3AA 5IYCJ 3HBLA 2QEXI 1OCOH 4E7ZA 2KIUA 2XF7A 5H6RA 2R92J 4E70A 3KP2A 2CJJA 4I02A 5B66C 4HX7A 2E71A 3EUAA 2DMNA 5D5WB 1ZR2A 2R93J 3HG9A 4IRIA 2OC6A 3GZ5A 4ETSA 2F5CA 3K1MA 4W1UA 3EQLF 3S15J 1TNSA 1H8AC 1XSVA 4M3FA 2IEKA 2VQLA 4I98B 4M9XA 3WGGA 4WXDA 3HHGA 4KIGA 4LG3A 1V5EA 4Y33A 2KFDA 3K0LA 2XAUA 1X2NA 2NVTJ 4CYCB 2WB1N 4MGRA 1IXCA 1OR7C 4EM1A 1H89C 3GF2A 1MSEC 4NC7A 1R5HA 3FKIJ 5B1AH 5GPAA 4IPAA 2EINH 3GFLA 1E2XA 5B1BH 2K86A 3JREA 1VZ0A 3I4NJ 2VIXA 1U5TA 5HS9A 3GVAA 4KT5C 2DYRH 2XB0X 1BI2A 1X19A 2O8KA 1J5YA 3BTIA 3R61A 5EYRA 4XKBA 4A3GJ 3OS0A 1T56A 4P96A 5CVRA 1PYVA 3HC7A 4HV5A 4ITVA 4W97A 5DS9A 4EGYA 1O3RA 3AAFA 4UV8A 5JVTA 2NVYJ 3SEZA 2P6TA 4JYKA 4CUGA 2W24A 2O8XA 2HZDA 2N8GA 4RAFA 5ICFA 3OYAA 1VQ8I 3BZCA 2D2WA 2OUMA 3A1YA 3GW2A 4HEA2 1LFUP 1DU6A 1FIPA 3PM1A 4Z2YA 5HLGA 3HTUA 4LLGF 2IVMA 2FA5A 4PCQA 4Y3OA 3FX3A 3V7SA 3IWZA 3V7CA 2BHZA 3Q3SA 2NS7A 1SFEA 3QU6A 2JSCA 2WB1A 2DT7B 4A93J 6PAXA 5KAFC 2DPUA 3SQNA 1XN7A 1K4TA 5L3CA 3GZ6A 1VQLI 3P7NA 1MBGA 2R7QA 3LA2A 1U78A 4BQQA 2F4IA 3RYPA 1XMXA 3NWTA 1NTCA 3TOAA 2V6EA 1KYWA 3KP7A 3SFIA 2CW0F 4NC8A 1MNDA 2EFWA 2YR2A 4CYCA 4HLYA 2K9LA 3A01B 3BDDA 4ZH4F 4KMFA 1P7IA 4MO7A 3U2RA 3GEZA 4BE2A 2K9QA 1BIBA 2GAUA 2H8RA 2FJ1A 1Y0NA 1ZLJA 5E3NA 3S1MJ 1ZYRF 4V19K 3GXOA 1YW8A 3M9AA 1E3HA 4UUVA 3KP5A 3R60A 1IJWC 5DV5A 5ED4A 3LA3A 4MLOA 4GFBA 2HVSA 2V4JC 1ON1A 3WTSC 4XRFA 3E5UA 3MZ8A 3K2ZA 1B59A 2R7UA 2FF4A 3DV8A 4BACA 1IF1A 1RETA 1V5FA 1ZELA 1RNLA 1SMTA 1Z05A 4KN7X 4M6YA 4ANJA 3WGIA 2CQ7A 3H9GA 3BJ6A 3KYDB 1KU9A 3ZN1A 1ETQA 3GX4X 3H1CA 1I6HJ 4YEJA 4ESBA 2ZJRF 2IGMA 2FQ3A 2JA6J 1I3QJ 2RGVA 3OYJA 4XM3A 2HGCA 1MJ9A 3A02A 1Z3YA 1LNWA 1RR8C 1D0YA 3WTTC 1ZG5A 3DXJF 4HRIA 4MTDA 3HEFA 1CGPA 2KL4A 1GHCA 3ECHA 2DN0A 2GXAA 3BG5A 3KEQA 1ZH5A 1Z0XA 3GTGJ 1RRJA 2HKXA 3H3UA 5J4VA 5IP7J 2L7KA 4UUSB 1YIOA 2TDXA 3I54A 4C2MJ 1YJWI 5L3GA 4XR6A 4ZTJA 5GAEJ 1KZHA 3OL4A 1BW6A 2V7FA 2E34A 1QVUA 2QLZA 3E0JB 4MEXF 1YRNB 2HOTA 3DBHB 3L2UA 3A01A 2W84A 3UKGA 3VYSB 4Y7NJ 1GXPA 2LC2A 4XL9A 2ISYA 2M30A 3CMAI 1YX5A 1OMIA 2Y30A 1XX5A 2PMUA 3E7LA 2VE9A 3GLXA 1WGXA 3BR3A 3I4MJ 3T8TA 2CFXA 4IHSA 1ZAOA 1LDJA 3M1EA 4RGSA 2H09A 4E6KG 3BPXA 1V5GA 2BW3A 2F4MB 1N75A 3DFGA 2Z99A 4P9UA 4II3A 3HRSA 1YQAA 4Y13A 4LIUA 3I64A 3CCSI 1RUNA 3CTAA 1S7AA 2MABA 2DODA 1K79A 5E3MA 3PIPF 4DNCA 1A31A 3G1LA 1LFPA 1K7AA 1P7JA 5FB2A 4G7HF 2BY1A 3D5LA 2EA2A 3HUGB 2W25A 3MKWB 1VQPI 4DQ2A 1MZBA 5ILSA 3CO7C 1IV8A 1USTA 3SDBA 2IGKA 4BDYA 1E17A 1EJ9A 3ZOBA 3W6VA 2VI6A 2MG4A 4PDKA 1ODDA 1WH7A 1MNEA 2XV4S 4G7ZF 5IOYA 3F8MA 3MCZA 2NVQJ 1I39A 2DQRA 1LEBA 1Y8RB 2PN6A 5EG0B 1IN4A 5JLWA 2VB6A 1J09A 1USSA 2DTRA 1FOKA 2ZXIA 5BQTA 2MH2A 1WSUA 2JK3A 4HX4A 2VBYA 1VI0A 3FDYA 1UCRA 1OCTC 3ZCOA 1FP2A 3CF2A 3QU3A 3W6JB 2R5ZB 2XPWA 3CZ6A 5F08A 1R23A 5B3SH 1YRNA 2GQQA 5IYDJ 3DF8A 1WH5A 2UV1A 4ASNA 4D5FA 3B73A 4M3BA 2VUMJ 1J7KA 2GIVA 4FISA 1GXQA 5DCFA 4JX5A 2DPDA 4P5OA 3TO9A 4Y17A 1I50J 2EPFA 2VOOA 3WE3A 2A68F 4XONA 3NWSA 3P9CA 2O5RA 2XKPA 2XAGA 3KP4A 1DP3A 4MQ9F 4U7DA 2D45A 1R1TA 3ULQB 3S3OA 3M4OJ 3BROA 3CESA 4M9SA 3ESWB 2QSFX 1BI1A 3W3CA 2EK5A 5J1YA 3HXLA 2Z9OA 4XLNF 4G6DA 3FXJA 3HUGA 1AU7A 2QSHX 1MMGA 2BVLA 4PJ0C 4A3MJ 1KU3A 1ZARA 1ZGWA 1SEUA 3RSNA 3IC7A 2CW8A 2K85A 1SVMA 2W48A 5CVUA 5FD5A 1W36D 3OYEA 4HPQA 3ONQA 4FTHA 3C1DA 1BOAA 3GMEA 1X3ZB 3QQAA 3F8FA 4L5EA 5D5XB 4BQOA 5JHUA 3G3ZA 1IV6A 2STWA 2X6WA 1SFXA 3DLAA 1XPXA 1SD6A 1NK3P 3IRQA 2I10A 1NG7A 4MIMA 1SANA 2HR3A 3I53A 3OYCA 3W2VA 2KDZA 1SD5A 5H2FC 3OYKA 4LK1F 3BR1A 4BBRJ 4XRMA 1IRGA 5BPIA 5JI6A 2R7SA 3C2HA 1MD0A 1IRFA 3IAM2 2R5ZA 3HOWJ 3QYBA 1VQOI 4CSWA 3DU5A 3J80K 1E3PA 4GXOA 5F0HA 4IXAA 1C0WA 1FMVA 3ABUA 1R6RA 4QPQA 1A6QA 2L9RA 2O03A 4BJTA 4A3EJ 2EBIA 2EFPA 4KIBA 3K1PA 1V55H 5IOZA 1R58A 3HGYA 4B1RA 2CV0A 2VBXA 1VFCA 2IA2A 4XQFA 3QOPA 2XRLA 1ZKGA 4MQVA 2HVRA 2CQQA 4B43A 1U8BA 5JHFA 4K2EA 2X48A 3KETA 2M34A 1BJZA 4XMYA 4A12A 2Q0OA 2HOSA 2GBYA 2W00A 2NYXA 1HW5A 5LGUA 3DTKA 3KYLA 1P4AA 2LBFA 5E17F 1LDDA 1TC3C 4S04A 5D6EA 1YOVB 2X1CA 3S8PA 4R79A 1B1BA 2M4KA 3HRUA 1J0RA 3PO3J 4X6AJ 2VL8A 2E2IJ 1T38A 3V42A 4BL0B 3WTXC 2JVGA 4AIDA 2HOEA 1MH3A 3ABMH 5HLHA 2CG4A 5IY5H 1OCZH 1LDKB 2KIMA 2YUSA 3S2HJ 2Z3YA 5HS8A 4A6DA 3E6MA 4LK0F 4NQWB 4MHGA 2EFNA 3TO7A 1ORKA 5F04A 3JRIA 1Z6RA 4XRSG 2OQGA 4D0PA 1FC3A 3FXKA 3W6KB 3F22A 4P1WA 2DA1A 2LG4A 2Y0SN 4L0ZB 3MN2A 3LSRA 1IDYA 3H36A 1QZYA 2XAJA 1ETOA 1G3WA 2F2EA 4I76A 3WU2C 2FU4A 3ZQQA 5K5QA 1ENHA 3PSIA 3L09A 3M07A 4BHBA 4PK4A 2CUEA 2DCEA 4C3IJ 1PUFB 3CD6I 3ZGKA 4NB5A 2FQ4A 1SFUA 2M45A 4B4CA 1IN8A 1GVDA 2G7UA 3GFIA 1X1DA 4D9JA 4L9TA 3VDXA 3BCAA 3VB2A 5FKKA 3HKZA 4EMSA 1WHUA 2E1MB 2E1CA 5KHDA 3PQJA 2I8DA 2F5FA 4C3HJ 2VKDA 3JAMZ 3JAMK 1I1SA 3BG6A 2DA5A 3LMMA 3V7RA 2KIFA 4IJAA 2HTJA 5J1RA 2PBIA 4YELA 1OLTA 1D1AA 4CDGA 3L1PA 2FXAA 4UNOA 4RAZA 4KISA 2JUGA 4ZDLA 1FOYA 1DDNA 2L9NA 4KMUX 2UXXA 2BY2A 4ON0A 2R7ZJ 3OYLA 3ZMTA 5GTHC 2DMTA 3IV5A 1RZ4A 3E3VA 3K10A 2ZXJA 4HF0A 3FHZA 1Z7UA 2JPBA 4EJTA 3VODA 2ZMEB 3MKZA 2EIMH 1ZGJA 2IXSA 4R8HA 4BE0A 3ZR8X 4E7HA 1HW2A 5E3LA 2B7EA 4FETA 3L00A 2QQBA 5TJJA 1G6NA 5CYVA 4RLQA 4NQWA 1TZLA 3K4JA 2DQLA 3HB9A 3IH2A 2L4MA 3JRHA 4LB5A 3CQZJ 3OY9A 3AKZA 1HLVA 4JP0A 4B09A 2CUFA 4BKXA 4HF1A 4I09A 3I9V2 3SZPA 4HNVA 2LF7A 1BA5A 2J5PA 2KZGA 1RI7A 1ZGAA 2DYSH 4XKVA 1EH8A 2GXBA 4XLFA 1QRYA 3S1QJ 2L3DA 4QIWN 3H0GJ 2MC3A 3OWTA 5DTDA 4FASD 3HOUJ 5E79C 2IRFG 5JVGF 1X58A 2COMA 1F5TA 2GIZA 5FKMA 1S3JA 3LSJA 4CCLA 2DFHA 3LA7A 3BJAA 2CUZA 1JKRC 2OA4A 3CMYA 3OIOA 4O5VA 1G3YA 2LY9A 1TLHB 2KLOA 2VQGA 4BUPA 3KIOA 2ACJA 1K6OA 3N05A 2ISZA 1UG2A 1VF9A 2TRTA 2DFIA 4EM0B 1QBJA 5A2QK 4F52A 4MNUA 1SD7A 2KJBA 3ERMA 4R1HA 4WXCA 5KNLA 3OYDA 3WE2A 1LE8B 1NK2P 3OOPA 1TWGJ 1QHHD 3I58A 2LRDA 1QVTA 1XGMA 5EZGA 5K5RA 4E7KA 2V1UA 2K3PA 4ESJA 1P9QC 5E1WA 4HSRA 3T0YA 5M5XJ 3KP3A 4UY8I 1QPIA 4L9JA 4ZZLA 4F7ZA 5LD2C 1YIJI 3CP8A 2Y75A 5HDGA 1VQ6I 2OQRA 5LLQA 5HNHA 5E8GA 2K3FA 2DT5A 3RKXA 4CCOA 2BYVE 1AA7A 2V9PA 4OWRB 3CUQC 3OYFA 3U1DA 3CMMA 1J2XA 3DEWA 2RNJA 4PJLA 4YFKF 2JWTA 1HQCA 4U0WA 3KFWX 1U5TB 2JA5J 1H9TA 3ZPLA 4Y52J 1SD4A 2FSWA 2PG4A 4NUBA 3CC4I 2HTSA 4XNFA 3LWFA 2QQ9A 4OMZA 4IZZA 3HGGA 1LEAA 1ETWA 2MD0A 4I7HA 3SDGA 1OKRA 2ZSHB 4HDUA 2EV6A 4XKWA 1D5VA 5FFXA 1LJ9A 2DXIA 4C2UA 2V9VA 3RTRA 3DWLE 4G6QA 1IC8A 3OIQA 1UAAA 5L3FA 3H0DA 4XK4A 3WTZA 4KYWA 2GWRA 3QYEA 2A69F 5JFRA 4U0VA 3A0BC 3CCUI 2VKEA 4HX8A 3RQ4A 1G59A 3BCBA 4Z6YA 4P55A 4HYEA 3ZMDA 2QSGX 1ETYA 2K5CA 2E1OA 1UELB 2NS0A 3U1KA 3D0SA 2MH9A 4IHTA 4HNTA 5CQGA 2OZ6A 5F6FA 4S0HB 2Y9YA 2VQCA 5AIPA 5D6FA 1LE8A 2ELJA 2E19A 4LIVA 5K5OA 1FP1D 2FNPA 2FRHA 2EZIA 4A3IJ 1X1BA 2O61A 1EH7A 2ZJ2A 1XC5A 2CGPA 1Z3XA 4OOIA 2EZHA 5LRRA 2L54A 3WU0A 3FM5A 4U88A 1YX3A 1FNNA 1R4MB 2E2JJ 4ZDOA 5CPRB 1VNDA 1HC8A 2L9SA 4DBQA 1VQMI 2ZMEC 2VLAA 3CC7I 2WY7Q 3V8JA 5FRMA 2XGCA 3ZMVA 5AONA 5KVRA 1ON2A 1T0FC 3L9FA 1T95A 2Z1DA 2DA4A 3GO5A 4KFCA 4JX6A 3UNGC 3PJRA 3WODF 4I0BA 3E5QA 2GOXB 2RREA 2LR8A 3K4LA 4KA4A 2HDCA 2ADUA 4G9YA 3ZQ7A 1B8IA 4JX4A 3FMQA 2R7FA 2VJJA 1DUXC 1XCVA 4HG2A 3S2WA 3S1RJ 3L2QA 1Z77A 5AIQA 3LSKA 2JMWA 2XGEA 3FXMA 4YRVA 2RC4A 2P4WA 2FBHA 5LHGA 2A3SA 3DEUA 1IDZA 3F8BA 1R7JA 3LQQA 2KJCA 3TP0A 2V1XA 2R7WA 3L2RA 3BTCA 2FMLA 4KITB 1MMDA 3HOVJ 2DK5A 2H1LA 1FOWA 3HSEA 2DAOA 2H1KA 2VXZA 3DU6A 3KPHA 2E7WA 4E7SA 1BJAA 4UXNA 2XC7A 3ASOH 1QA6A 1FJLA 1BR1A 3EPZA 2Q8KA 5LEKA 1E3OC 4IHWA 4BDZA 1W4MA 2R5YB 5F0CA 1BIAA 2ID3A 1FSEA 1RKWA 2WWYA 3PNTA 2WAQN 1IG7A 1KQ8A 2IA1A 1ONVA 2L2OA 2BHYA 3O3KA 4OIPF 3OYMA 3ZQGA 3RPQA 1TT0A 1X1PA 2WAFA 3JRGA 3HOZJ 2LSOA 3GTJJ 2QKLB 2KKOA 5CLSA 4B8XA 1IN7A 1WJBA 3J7ZI 2H6CA 4N9HA 4OIRF 4O6JA 3IH4A 1FBQA 4E7JA 1P92A 3PFYA 3E6BA 3F6VA 4NC6A 5CJ9A 4CXFA 3IHUA 3NAUA 4PZJA 5FKOA 3E5XA 4D7MA 2GXGA 1BW5A 1OISA 3JSOA 2CH0A 1U5TC 1AKHB 1WJCA 4L18B 2Z5UA 2FD5A 2P5KA 2L0KA 3IKVA 1JHHA 4Y15A 5J8FA 2NNYA 3COAC 1HCRA 3C2BA 5CQEA 4XOTA 3MEXA 5D4SA 2DI3A 2BW3B 3LSGA 2RN7A 3WG7H 4HNUA 2JA8J 2DFEA 3FBNB 4M73A 3WHCA 1O3SA 3E1SA 4II2A 2JVHA 3A03A 1ZN2A 3LSTA 2CSOA 3CJNA 2FOWA 2WAQA 3BG9A 4B3XA 2P6SA 2RVCA 4DIQA 3GYHX 1HKTA 2EH3A 1FX7A 4LD5A 2ZC2A 2AQEA 2K02A 2CU7A 3BY6A 4M9ZA 3PUFA 3EETA 1STZA 1P2FA 4QSHA 1OCCH 3MKYB 1GT0C 1FT9A 2R5YA 1K83J 4XORA 2JA7J 2BZTA 1GDTA 1WVRA 4QLCU 3BP8A 4EQQA 5H20A 2L01A 2L9VA 1QZZA 4L5JA 5HVQC 3K70D 3S2DJ 3VYRB 1R36A 2JT1A 3BZKA 1UHMA 2CQNA 3TQNA 2RQPA 3HHHA 5FFZA 3HOTA 1MDMA 3DTEA 5M5YJ 5M5WJ 2A6HF 1J59A 3MMYB 3GUDA 4HQMA 5HDKA 5ICEA 4C2TA 4DYQA 2QUFA 1ZG1A 5LFAA 2DLLA 1JXSA 5K7FA 2OU2A 4I99C 3HSRA 4QWQA 1W5SA 2HQNA 5EEHA 3CLQA 3ZXSA 1Z6TA 2PMZN 2Y69H 5DUIA 3G73A 4RS8A 1Y6IA 3OR2C 1S9HA 2VBZA 5D5UB 3BQYA 2F5VA 2HDDA 4HQEA 2VKVA 4XLPF 1UB9A 1N25A 4FCYA 2JQ7A 2VPLA 1AKHA 1ZLKA 4EJVA 3DLLF 4Q4ZF 2X6OA 1PDNC 2V1NA 3BR2A 2HYJA 2LREA 4A0YA 2G9WA 1RR7A 5KAIC 4AWXB 3LFKA 1BI3A 2M87A 1FTZA 1L3LA 2K9MA 1OFCX 1S8NA 3OS1A 3LFUA 3F9KA 4KICA 4A2UA 5HNFA 3D1NI 2CQKA 4AYBN 2ZSIB 3OMYA 4BXUA 3RZOJ 3R0JA 4M71A 2L7ZA 3EUHA 2DDBA 4KDPA 1AOYA 1KQ0A 4IRHA 2A5YB 3GTOJ 4CHUA 3RCOA 4G7OF 1V4RA 2DU9A 3TDUC 2G7HA 3TW6A 2DA3A 2DA7A 2QGUA 5EF6A 2XUBA 3S3MA 5D4RA 1Y0UA 4QTRA 4NHJA 3BQZA 1L0OC 3KLNA 2W57A 1Z7LA 2DA2A 4AVPA 1GV5A 2W1OA 2H27A 3S1NJ 2IW5A 4E7IA 4DYCA 2PMZA 4BAYA 1W1WE 1DP7P 2B9SA 5J47A 2GA1A 1HOMA 1G4DA 2BY0A 3VFZA 4XBFA 2L7FP 1WRJA 2CWEA 1U9NA 2M8GX 1NG6A 4XOPA 4CCJA 4UB8C 1XB4A 2IS2A 3I5UA 1MMNA 2DOAA 3J7AY 5ERIA 3ZQLA 3FBIB 2HVQA 5FD6A 1FWZA 3ML6A 3BR5A 2XAHA 4EV0A 2PJRA 4KUMA 3GTKJ 2DTZA 3JTGA 1SAUA 2PMHA 2Z33A 3K4CA 4A3FJ 2ELHA 3KEYA 2LMDA 4AYBA 3ZN0A 1JJ8C 4PJMA 1YITI 1TQMA 1Q1VA 2VJIA 5BS6A 2LKPA 3E6DA 2D5VA 4BJ6C 2PQ8A 4N0BA 4XICA 1YW7A 2ICWG 1WJDA 2Y2ZA 3Q0VA 4BJ5C 2GA2A 3RIRA 2WC2A 1HKQA 2CV2A 3OS2A 1LQ1A 1IN6A 2HYFA 4GGGA 4J19A 2LBFB 5M3FJ 1XGNA 3I71A 2NOGA 4HZFA 2KHMA 2TCTA 4DW6A 4PSWA 4ESFA 1XSXA 4BXFA 1T98A 2VASA 4LITA 3JCUC 3IWFA 1ZR4A 1D1BA 1MGTA 1ZREA 3G1OA 1SC7A 1O3TA 2JTVA 2LFBA 4RGXA 2H6BA 2DMUA 1MMAA 3T8RA 4KJZA 4F92B 3LNQA 3CDIA 2DT6A 3GZNB 5H6QA 4IO9F 2LP0A 3D5SC 3F8CA 3CCYA 2DOFA 4RLFA 3OSFA 2DDAA 3JRCA 4EGZA 5FRNA 3ISPA 4CICA 4HF2A 4OAYA 3C7JA 3MWMA 2W4SA 2R0QC 4XLEA 1O7LA 3L7WA 3VOEA 2HWVA 3SXYA 4DZJA 1TQIA 2ESHA 3JR9A 3CCJI 4M3DA 1V54H 3HYIA 4YIRX 3J80Z 3OIPA 5HDNA 5EEAA 1D5YA 2DW4A 2MYSA 1YJNI 1S72I 3NARA 3JRFA 4UVCA 1R1UA 2HPIA 2F48A 3S3NA 1G2HA 3SZGA 1S29A 4AD9A 4CA0A 4PFOA 1JT0A 4CCNA 1T39A 1NH3A 3FF5A 2JA2A 3MD2A 4FX4A 4B48A 2YX7A 1GV2A 2FE3A 3LSMA 2OBPA 4YG2F 1IZ1A 2ESNA 3SHFA 2F5DA 1KONA 2E5NA 4OMYA 1HXDA 2MFZA 3ZQCA 3HKZN 4DZPA 3M7GA 4A0XA 2OCEA 1FYMA 2RKHA 3P5JA 3WG9A 3HPGA 4EATA 1IO2A 3CF5F 4IHXA 4WF2A 4MFDA 1DPRA 1BR4A 5FLMJ 1XGSA 4ZTFA 1OCRH 3CCQI 2LTPA 1BBYA 3I56I 2EIKH 4BQAA 4AVZA 1R71A 1R49A 1CQTA 4A6EA 2ECCA 2XB5A 4ABZA 2E1NA 5CVJA 4XN0A 5GAGJ 4OU0A 1W5CC 2ZBKA 4E4HA 2L5QA 3EUKL 2VKHA 1FZPB 2VE8A 3I59B 2RDPA 3BTLA 3VSKA 4OIOF 2KQRA 3BTJA 2HQ5A 4BH9A 3IRRA 2KDOA 3WTWC 2QVOA 4LLLA 1WJFA 2V1DA 1WKMA 3F6OA 1IUFA 1X1CA 4FQGA 4HA8A 5DM6F 1TW3A 2E5ZA 2MBFA 4L9NA 1I27A 1EH6A 4B3AA 2I5UA
chains in the Genus database with same CATH topology
3V4GA 1G3TA 3WGHA 3HRMA 2FOKA 4CYDA 1F1ZA 2HZTA 1HW1A 2UXNA 5L3DA 4EJUA 5DD4A 3KZZA 4IRGA 1I1GA 4PGHA 2K27A 5E1ZB 4L5IA 5DYMA 5FLXZ 5FLXK 2O3FA 2EJRA 3Q9SA 2MA3A 2AXLA 3K9TA 2EA4A 2LF8A 4ENKA 4ZYHA 4ENMA 1R5GA 3DQVC 2R7DA 3ZP5A 3RKYA 1HSTA 1RIOH 3J81K 3I59A 1R22A 4CZZA 1LVAA 4L9VA 2IP2A 1I6XA 3GFMA 3GWZA 3ABTA 1B4AA 1J9IA 2EWNA 4RB1A 3BJOA 2P7VB 2FEZA 3H3ZA 3MAJA 4GO1A 3RI4A 5A2QZ 1IN5A 2AS5F 4WK8F 4BNCA 1HKSA 3N4MA 1XD7A 1YW9A 3RJPA 2V79A 5BOXA 1XSDA 2P5VA 2J5OA 2XHKA 5DCMB 1MJBA 1X3UA 3LAPA 2PI0A 1V3FA 2A61A 4Q47A 1LB2A 2YSRA 4HV6A 5FO5A 4LLNA 3P9KA 3KCCA 2XAQA 3QRFF 2FBKA 5ILVA 3RDIA 1ZRFA 3CO6C 1REPC 5JR3A 2ZNZA 2PLYA 2PJPA 3HRTA 3KP6A 4ZYDA 1CF7B 1SMYF 1OR7A 2C6YA 2EV5A 2A07F 1R1VA 3K1NA 3WTYC 1KA8A 2V6CA 2DK8A 2D1HA 3LQRA 4YIFA 1P4XA 2NAZA 5DDGA 3K69A 1MKMA 2XKOA 1P4WA 2BEOA 4U0YA 3ZMSA 4LB6B 1HSJA 1S7OA 4M6XA 5IT3A 5DCMA 4P9FA 3PQKA 4EM2A 4HW0A 3CDHA 3I0TA 1UHWA 3WTUC 1Z91A 3FXQA 5LRSA 2MLKA 3PFIA 3Q9VA 3HOSA 1CF7A 1JGSA 2XIGA 1BI0A 3DPLC 2EFOA 4KIFA 1GVJA 1FSHA 3F8NA 3E6CC 3I4PA 4IF4A 3WU1B 3LAJA 1BC8C 2XAFA 1F4KA 3ERED 4KNYA 5F1RA 1W7PD 1FPQA 2HKOA 3GFJA 2Q2EA 4HLXA 3FWEA 3V8KA 4TV7A 4UVBA 1UFMA 4Q5SF 1QQIA 4WX9A 2PEXA 3DP7A 4UVAA 5E18F 1U2WA 1U3EM 1H0MA 3OV8A 5LEJA 2BGCA 3TOBA 1MDMB 2M1BA 4CGZA 2YX4A 5K1YA 1J75A 3KLOA 4MEYF 2ETHA 3F21A 5E1XA 3F72A 4RAYA 1K78B 1IW7F 3ZMUA 3EYYA 2HQRA 3DPTA 1B9MA 5TRDA 1Z1DA 2HS5A 4LFUA 5DUKA 3TGNA 3MZYA 2QWWA 1W7PB 3H92A 3NQOA 4BYYA 1KU7A 2BV6A 4FHTA 1TW2A 2P5LC 2Y48A 1H9GA 4A5MA 4EJOA 4HOBA 2JZYA 3QPTA 1AWCA 4ENNA 5CVIA 3JSPA 4AIJA 1O3QA 2MLGA 2BBYA 2H94A 2ZFWA 5LGNA 4H0EA 1B9NA 5DEQA 1F9NA 2QYOA 5BPDA 2XVCA 2QQAA 1T6SA 4WWCA 1K78A 2M5WA 1ZRDA 1XDSA 4LGWA 2L4AA 2HEOA 2NNNA 1D8JA 5J6XA 3KZYA 4OIQF 3SZTA 2O0YA 3M8EA 2QENA 3R6SA 1YS7A 4M74A 1T2KA 3C3WA 4JBAA 1W7PA 3V8LA 1FBUA 1FY7A 1VTNC 2HFHA 3IKTA 3EDPA 3JW4A 2EFQA 2OD5A 3F23A 5CVVA 1B6AA 1DPUA 1KQ9A 1IXRC 5F64A 1MJAA 1R00A 4YFXF 3Q5FA 3TDZC 3C18A 2X0LA 1IXSB 3DKWA 5E8IA 3JTHA 2D1VA 1Q1HA 3HSFA 1FYKA 3N97A 2STTA 1ULYA 1O57A 3IL2A 1BM9A 2K7LA 4G94A 5ICGA 4RB2C 1TTYA 2R3SA 4UV9A 4GCVA 5ILUA 4JQFA 4CO8A 1Z9CA 3QP5A 2WTEA 2UWMA 4HBLA 5E20A 1G3SA 1BC7C 3WTVC 3KEOA 1U6GA 3NRVA 1XMAA 4Q48A 4RB3C 1ZG3A 2QM3A 3CUOA 1YO5C 4YIIA 1YTYA 2VODA 2CO5A 4S05A 4RB0A 4LJZF 5DD8A 4U7BA 4ZZDA 3BWGA 1TQPA 1PUEE 4LG0B 4WCGA 2PFBA 3QPHA 3CLOA 2OZUA 1D3YA 2P8TA 2QZ8A 1XCBA 4N9IA 5LBQA 2NRAC 1O7FA 1YFHA 2ZCWA 3J7AO 1QNTA 5J8CA 4RGUA 2XGXA 5IT9K 5IT9Z 2K4JA 4JK1X 3FMRA 4RGRA 1KGSA 5HOOA 2CYYA 4BHPA 1D8KA 1BN5A 2RV8A 1A04A 2FMYA 2QBYB 3ELKA 2YPRA 3BOQA 5HS7A 1IAWA 2HYGD 2YU3A 3KE2A 1WWXA 4LMYA 1ZRCA 2VOPA 5D8LB 4I01A 2O6GE 5D5VB 3M8FA 4GYGA 1SAXA 4A0ZA 1RUOA 3ZMZA 2P7CB 4O3MA 2XROA 2JPCA 2W85A 2VBWA 2LNBA 5EEGA 1YLFA 4EJWA 3F3XA 3HTSB 2M8EA 4EVIA 3CUQB 4LG0A 3R0AA 3T1BA 3FXUA 1PP7U 3RPUA 2E7XA 2X4HA 1OYYA 3B02A 3FXRA 1QGPA 2ZKZA 3TO6A 5LGTA 3QAHA 2VT2A 1OYIA 5L3EA 4MTEA 2EB7A 1KYZA 3VEPA 2WV0A 2VC1A 2QBYA 1XDUA 3RKWA 2EV0A 4ZYEA 1FYLA 4ZYGA 5BMZA 4BHCA 4UHTA 3E97A 2GZWA 4I2OA 2Y0MA 1OPCA 5LHIA 2DO7A 5ICCA 3J81Z 1WI9A 2FNAA 2XASA 4FT8A 3O2PE 1OYWA 2JRTA 3NEUA 3CUQA 1FBSA 3EYIA 1IUYA 4HAMA 2KRFA 4KN4X 1KU2A 2A6EF 2B0LA 2UZKA 5L3BA 3O6BB 3R4KA 5FGMA 3TKYA 3MQ0A 1JHFA 1WQ2A 4XSXF 5D8KB 1FLIA 1XGOA 1QO0D 2FBIA 3ECOA 3FZVA 4A5NA 2DBBA 2VONA 1YS6A 4WXHA 1EV7A 2OAZA 2IT0A 1JE8A 1U8RA 1TBXA 1XMKA 2K4BA 4ENJA 1YYVA 1W5TA 2VT3A 3MFKA 3RYRA 2BE5F 2ZNYA 1TNTA 5LHHA 2VN2A 3BPVA 5HLIA 1QPMA 2IPQX 3QP6A 1PP8F 4XSZF 4AIHA 2ZMEA 4L0YB 4GYIA 2XRNA 3HIFA 3SFZA 4G8XA 1T0FA 4IVNA 3BZ6A 4HDVA 2VC0A 1I5ZA 3P9IA 2LDUA 4FX0A 3MZHA 4I0AA 1P6RA 2ZO4A 2IJLA 3U9GA 1YG2A 2MD5A 1S6LA 2L02A 3T5XA 1NHAA 4YFNF 4AIKA 3FM3A 5KK1A 2IA0A 3REOA 3FMSA 3ROUA 4M72A 3L2CA 1HBXG 4PGGA 4OINF 2F5EA 1ZHFA 2KIUA 5H6RA 4E70A 3KP2A 4I02A 4HX7A 5D5WB 4IRIA 3GZ5A 4ETSA 2F5CA 3K1MA 3EQLF 1TNSA 1XSVA 4I98B 4M9XA 3WGGA 4WXDA 3HHGA 4KIGA 3K0LA 4MGRA 1IXCA 4EM1A 3GF2A 1R5HA 4IPAA 3GFLA 1E2XA 2K86A 1U5TA 5HS9A 3GVAA 4KT5C 1BI2A 1J5YA 3R61A 4P96A 5CVRA 4EGYA 4HV5A 1O3RA 3AAFA 4UV8A 5JVTA 2P6TA 2W24A 2O8XA 5ICFA 2D2WA 3GW2A 4Z2YA 5HLGA 3HTUA 4LLGF 2IVMA 2FA5A 4PCQA 3FX3A 3V7SA 3IWZA 3V7CA 1SFEA 3QU6A 2JSCA 6PAXA 2DPUA 3SQNA 1XN7A 5L3CA 3GZ6A 3P7NA 3LA2A 1U78A 3RYPA 3TOAA 1KYWA 3KP7A 2CW0F 2EFWA 2YR2A 4HLYA 3BDDA 4ZH4F 4KMFA 3U2RA 3GEZA 1BIBA 2GAUA 1ZLJA 1ZYRF 3GXOA 1YW8A 3M9AA 4UUVA 3KP5A 3R60A 5DV5A 5ED4A 3LA3A 1ON1A 3WTSC 4XRFA 3E5UA 3K2ZA 1B59A 2FF4A 3DV8A 1IF1A 3WGIA 1RNLA 1SMTA 1Z05A 4KN7X 4M6YA 3BJ6A 1KU9A 3ZN1A 3GX4X 4ESBA 2FQ3A 2RGVA 2HGCA 1MJ9A 1LNWA 3WTTC 1ZG5A 3DXJF 4MTDA 1CGPA 1GHCA 3ECHA 3KEQA 1ZH5A 2HKXA 3H3UA 1YIOA 2TDXA 3I54A 5L3GA 2QLZA 4MEXF 2W84A 1GXPA 2ISYA 2M30A 1OMIA 2PMUA 2VE9A 3GLXA 3T8TA 2CFXA 4IHSA 1ZAOA 1LDJA 3M1EA 4RGSA 2H09A 3BPXA 3DFGA 2Z99A 4P9UA 3HRSA 1YQAA 4Y13A 3I64A 1RUNA 3CTAA 1S7AA 1K79A 4DNCA 1K7AA 4G7HF 5FB2A 3D5LA 2EA2A 2W25A 4DQ2A 1MZBA 5ILSA 3CO7C 1USTA 1E17A 4PDKA 1ODDA 2XV4S 4G7ZF 3F8MA 3MCZA 2DQRA 1LEBA 2PN6A 1IN4A 2DTRA 1USSA 1FOKA 5BQTA 2MH2A 1WSUA 4HX4A 2VBYA 1UCRA 1FP2A 3QU3A 3W6JB 1R23A 2GQQA 3DF8A 4ASNA 3B73A 1J7KA 2GIVA 5DCFA 1GXQA 2DPDA 4P5OA 3TO9A 4Y17A 2VOOA 3WE3A 2A68F 3P9CA 2XKPA 2XAGA 3KP4A 4MQ9F 4U7DA 2D45A 1R1TA 3ULQB 3BROA 4M9SA 1BI1A 2EK5A 2Z9OA 4XLNF 4G6DA 3HUGA 1KU3A 1ZARA 3IC7A 5CVUA 5FD5A 3C1DA 1BOAA 3F8FA 5D5XB 5JHUA 3G3ZA 2STWA 1SFXA 1SD6A 3IRQA 2HR3A 3I53A 1SD5A 4LK1F 1IRGA 5BPIA 5JI6A 1MD0A 1IRFA 3J80K 4GXOA 4IXAA 1C0WA 3ABUA 2O03A 2EFPA 4KIBA 3K1PA 1R58A 2VBXA 2IA2A 3QOPA 4MQVA 4K2EA 3KETA 4A12A 2Q0OA 2NYXA 1HW5A 5LGUA 1P4AA 5E17F 1LDDA 4S04A 5D6EA 4R79A 1B1BA 3HRUA 1J0RA 1T38A 3WTXC 2HOEA 5HLHA 2CG4A 1LDKB 2KIMA 2Z3YA 5HS8A 4A6DA 3E6MA 4LK0F 4MHGA 2EFNA 3TO7A 1Z6RA 2OQGA 4D0PA 1FC3A 3W6KB 3F22A 4L0ZB 1QZYA 2XAJA 1G3WA 2F2EA 2FU4A 5K5QA 3L09A 4BHBA 4NB5A 1SFUA 2M45A 1IN8A 3GFIA 2G7UA 4L9TA 3VB2A 4EMSA 2E1CA 3PQJA 2F5FA 3JAMK 3JAMZ 1I1SA 3V7RA 2KIFA 4IJAA 2HTJA 2PBIA 4CDGA 2FXAA 4UNOA 4RAZA 1DDNA 4KMUX 4ON0A 2UXXA 3ZMTA 1RZ4A 3E3VA 4HF0A 2ZXJA 3FHZA 4EJTA 1Z7UA 2JPBA 3VODA 2ZMEB 1ZGJA 4R8HA 1HW2A 3L00A 2QQBA 5TJJA 1G6NA 5CYVA 4NQWA 2DQLA 4LB5A 2L4MA 4B09A 4HF1A 4I09A 3SZPA 2LF7A 2J5PA 1RI7A 1ZGAA 1EH8A 2GXBA 2L3DA 2MC3A 2IRFG 2COMA 1F5TA 1S3JA 3LA7A 3BJAA 2OA4A 4O5VA 1G3YA 1TLHB 2ACJA 2ISZA 1K6OA 2DFIA 4EM0B 1QBJA 5A2QK 4MNUA 1SD7A 2KJBA 4R1HA 4WXCA 3WE2A 3OOPA 3I58A 1XGMA 5K5RA 2V1UA 4ESJA 5E1WA 3T0YA 3KP3A 4L9JA 4ZZLA 4F7ZA 2Y75A 5HDGA 2OQRA 5LLQA 5E8GA 2DT5A 3RKXA 2BYVE 3CUQC 3U1DA 1J2XA 2RNJA 4YFKF 1HQCA 4U0WA 3KFWX 1U5TB 1H9TA 3ZPLA 1SD4A 2FSWA 2PG4A 2HTSA 3LWFA 2QQ9A 4OMZA 1LEAA 4I7HA 1OKRA 4HDUA 2EV6A 1D5VA 5FFXA 1LJ9A 2V9VA 3RTRA 4G6QA 5L3FA 3WTZA 4KYWA 2GWRA 2A69F 5JFRA 4U0VA 4HX8A 4P55A 4HYEA 3ZMDA 2NS0A 3D0SA 2MH9A 4IHTA 2OZ6A 5F6FA 5AIPA 5D6FA 5K5OA 1FP1D 2FNPA 2FRHA 2O61A 1EH7A 2ZJ2A 2CGPA 4OOIA 5LRRA 2L54A 3WU0A 3FM5A 4U88A 1FNNA 3V8JA 3ZMVA 5AONA 5KVRA 1ON2A 3L9FA 3GO5A 4KFCA 3WODF 4I0BA 3E5QA 4KA4A 2HDCA 2ADUA 4G9YA 3ZQ7A 3FMQA 2R7FA 1DUXC 1XCVA 3S2WA 5AIQA 2RC4A 2P4WA 5LHGA 2FBHA 2A3SA 3DEUA 3F8BA 1R7JA 3LQQA 2KJCA 2V1XA 2FMLA 2DK5A 3HSEA 2DAOA 2VXZA 2E7WA 1BJAA 4UXNA 2Q8KA 5LEKA 1W4MA 1BIAA 1FSEA 2WWYA 1KQ8A 2IA1A 1ONVA 3O3KA 4OIPF 3RPQA 2LSOA 2KKOA 5CLSA 4B8XA 1IN7A 2H6CA 4N9HA 4OIRF 4O6JA 1FBQA 1P92A 3E6BA 3F6VA 5CJ9A 4CXFA 3IHUA 4PZJA 3E5XA 2GXGA 3JSOA 1U5TC 4L18B 2Z5UA 2P5KA 3IKVA 1JHHA 4Y15A 5J8FA 2NNYA 3COAC 3MEXA 5D4SA 2DI3A 2RN7A 4M73A 1O3SA 1ZN2A 3LSTA 2CSOA 3CJNA 2P6SA 2RVCA 3GYHX 1HKTA 1FX7A 4LD5A 2K02A 3BY6A 4M9ZA 3EETA 1STZA 1P2FA 1FT9A 4QLCU 3BP8A 4EQQA 5H20A 2L01A 4L5JA 1QZZA 5HVQC 1R36A 2JT1A 1UHMA 3TQNA 2RQPA 3HHHA 5FFZA 3HOTA 1MDMA 1J59A 2A6HF 3GUDA 4HQMA 5HDKA 5ICEA 2QUFA 1ZG1A 1JXSA 2DLLA 2OU2A 3HSRA 4QWQA 1W5SA 2HQNA 5EEHA 1Z6TA 5DUIA 3G73A 4RS8A 2VBZA 5D5UB 4HQEA 4XLPF 1UB9A 1ZLKA 4EJVA 4Q4ZF 1PDNC 4A0YA 2G9WA 4AWXB 3LFKA 1BI3A 2M87A 1L3LA 1S8NA 4KICA 4A2UA 2CQKA 4BXUA 3R0JA 4M71A 3EUHA 4KDPA 1AOYA 1KQ0A 4IRHA 2A5YB 4CHUA 4G7OF 1V4RA 2DU9A 3TDUC 2G7HA 2XUBA 5D4RA 1Y0UA 4NHJA 3KLNA 1L0OC 2W57A 4AVPA 2H27A 2IW5A 4BAYA 1DP7P 2GA1A 1G4DA 3VFZA 4XBFA 1WRJA 2CWEA 1XB4A 3I5UA 5ERIA 5FD6A 1FWZA 3ML6A 2XAHA 4EV0A 4KUMA 2Z33A 2PMHA 3JTGA 2ELHA 3ZN0A 1TQMA 5BS6A 2LKPA 3E6DA 2PQ8A 4N0BA 1YW7A 2GA2A 3RIRA 2WC2A 1HKQA 1LQ1A 1IN6A 2HYFA 4GGGA 1XGNA 3I71A 4HZFA 4ESFA 1XSXA 1T98A 3IWFA 1MGTA 1ZREA 1O3TA 2JTVA 4RGXA 2H6BA 3T8RA 5H6QA 3F8CA 4EGZA 3ISPA 4CICA 4HF2A 3C7JA 3MWMA 1O7LA 3L7WA 3VOEA 2HWVA 3SXYA 1TQIA 2ESHA 3HYIA 3J80Z 5HDNA 2DW4A 4UVCA 1R1UA 1S29A 4AD9A 1T39A 3FF5A 4FX4A 2YX7A 2FE3A 2OBPA 4YG2F 1IZ1A 2ESNA 3SHFA 2F5DA 4OMYA 1HXDA 3M7GA 4A0XA 1FYMA 2RKHA 3WG9A 4WF2A 1DPRA 1XGSA 1BBYA 4BQAA 4A6EA 2E1NA 5CVJA 4OU0A 2ZBKA 1FZPB 2VE8A 3I59B 2RDPA 4OIOF 4BH9A 3IRRA 3WTWC 2QVOA 4LLLA 2V1DA 1WKMA 3F6OA 4HA8A 1TW3A 2MBFA 4L9NA 1I27A 1EH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  1G3T A;  3WGH A;  3HRM A;  2FOK A;  4CYD A;  1F1Z A;  2HZT A;  1HW1 A;  2UXN A;  5L3D A;  4EJU A;  5DD4 A;  3KZZ A;  4IRG A;  1I1G A;  4PGH A;  2K27 A;  5E1Z B;  4L5I A;  5DYM A;  5FLX Z;  5FLX K;  2O3F A;  2EJR A;  3Q9S A;  2MA3 A;  2AXL A;  3K9T A;  2EA4 A;  2LF8 A;  4ENK A;  4ZYH A;  4ENM A;  1R5G A;  3DQV C;  2R7D A;  3ZP5 A;  3RKY A;  1HST A;  1RIO H;  3J81 K;  3I59 A;  1R22 A;  4CZZ A;  1LVA A;  4L9V A;  2IP2 A;  1I6X A;  3GFM A;  3GWZ A;  3ABT A;  1B4A A;  1J9I A;  2EWN A;  4RB1 A;  3BJO A;  2P7V B;  2FEZ A;  3H3Z A;  3MAJ A;  4GO1 A;  3RI4 A;  5A2Q Z;  1IN5 A;  2AS5 F;  4WK8 F;  4BNC A;  1HKS A;  3N4M A;  1XD7 A;  1YW9 A;  3RJP A;  2V79 A;  5BOX A;  1XSD A;  2P5V A;  2J5O A;  2XHK A;  5DCM B;  1MJB A;  1X3U A;  3LAP A;  2PI0 A;  1V3F A;  2A61 A;  4Q47 A;  1LB2 A;  2YSR A;  4HV6 A;  5FO5 A;  4LLN A;  3P9K A;  3KCC A;  2XAQ A;  3QRF F;  2FBK A;  5ILV A;  3RDI A;  1ZRF A;  3CO6 C;  1REP C;  5JR3 A;  2ZNZ A;  2PLY A;  2PJP A;  3HRT A;  3KP6 A;  4ZYD A;  1CF7 B;  1SMY F;  1OR7 A;  2C6Y A;  2EV5 A;  2A07 F;  1R1V A;  3K1N A;  3WTY C;  1KA8 A;  2V6C A;  2DK8 A;  2D1H A;  3LQR A;  4YIF A;  1P4X A;  2NAZ A;  5DDG A;  3K69 A;  1MKM A;  2XKO A;  1P4W A;  2BEO A;  4U0Y A;  3ZMS A;  4LB6 B;  1HSJ A;  1S7O A;  4M6X A;  5IT3 A;  5DCM A;  4P9F A;  3PQK A;  4EM2 A;  4HW0 A;  3CDH A;  3I0T A;  1UHW A;  3WTU C;  1Z91 A;  3FXQ A;  5LRS A;  2MLK A;  3PFI A;  3Q9V A;  3HOS A;  1CF7 A;  1JGS A;  2XIG A;  1BI0 A;  3DPL C;  2EFO A;  4KIF A;  1GVJ A;  1FSH A;  3F8N A;  3E6C C;  3I4P A;  4IF4 A;  3WU1 B;  3LAJ A;  1BC8 C;  2XAF A;  1F4K A;  3ERE D;  4KNY A;  5F1R A;  1W7P D;  1FPQ A;  2HKO A;  3GFJ A;  2Q2E A;  4HLX A;  3FWE A;  3V8K A;  4TV7 A;  4UVB A;  1UFM A;  4Q5S F;  1QQI A;  4WX9 A;  2PEX A;  3DP7 A;  4UVA A;  5E18 F;  1U2W A;  1U3E M;  1H0M A;  3OV8 A;  5LEJ A;  2BGC A;  3TOB A;  1MDM B;  2M1B A;  4CGZ A;  2YX4 A;  5K1Y A;  1J75 A;  3KLO A;  4MEY F;  2ETH A;  3F21 A;  5E1X A;  3F72 A;  4RAY A;  1K78 B;  1IW7 F;  3ZMU A;  3EYY A;  2HQR A;  3DPT A;  1B9M A;  5TRD A;  1Z1D A;  2HS5 A;  4LFU A;  5DUK A;  3TGN A;  3MZY A;  2QWW A;  1W7P B;  3H92 A;  3NQO A;  4BYY A;  1KU7 A;  2BV6 A;  4FHT A;  1TW2 A;  2P5L C;  2Y48 A;  1H9G A;  4A5M A;  4EJO A;  4HOB A;  2JZY A;  3QPT A;  1AWC A;  4ENN A;  5CVI A;  3JSP A;  4AIJ A;  1O3Q A;  2MLG A;  2BBY A;  2H94 A;  2ZFW A;  5LGN A;  4H0E A;  1B9N A;  5DEQ A;  1F9N A;  2QYO A;  5BPD A;  2XVC A;  2QQA A;  1T6S A;  4WWC A;  1K78 A;  2M5W A;  1ZRD A;  1XDS A;  4LGW A;  2L4A A;  2HEO A;  2NNN A;  1D8J A;  5J6X A;  3KZY A;  4OIQ F;  3SZT A;  2O0Y A;  3M8E A;  2QEN A;  3R6S A;  1YS7 A;  4M74 A;  1T2K A;  3C3W A;  4JBA A;  1W7P A;  3V8L A;  1FBU A;  1FY7 A;  1VTN C;  2HFH A;  3IKT A;  3EDP A;  3JW4 A;  2EFQ A;  2OD5 A;  3F23 A;  5CVV A;  1B6A A;  1DPU A;  1KQ9 A;  1IXR C;  5F64 A;  1MJA A;  1R00 A;  4YFX F;  3Q5F A;  3TDZ C;  3C18 A;  2X0L A;  1IXS B;  3DKW A;  5E8I A;  3JTH A;  2D1V A;  1Q1H A;  3HSF A;  1FYK A;  3N97 A;  2STT A;  1ULY A;  1O57 A;  3IL2 A;  1BM9 A;  2K7L A;  4G94 A;  5ICG A;  4RB2 C;  1TTY A;  2R3S A;  4UV9 A;  4GCV A;  5ILU A;  4JQF A;  4CO8 A;  1Z9C A;  3QP5 A;  2WTE A;  2UWM A;  4HBL A;  5E20 A;  1G3S A;  1BC7 C;  3WTV C;  3KEO A;  1U6G A;  3NRV A;  1XMA A;  4Q48 A;  4RB3 C;  1ZG3 A;  2QM3 A;  3CUO A;  1YO5 C;  4YII A;  1YTY A;  2VOD A;  2CO5 A;  4S05 A;  4RB0 A;  4LJZ F;  5DD8 A;  4U7B A;  4ZZD A;  3BWG A;  1TQP A;  1PUE E;  4LG0 B;  4WCG A;  2PFB A;  3QPH A;  3CLO A;  2OZU A;  1D3Y A;  2P8T A;  2QZ8 A;  1XCB A;  4N9I A;  5LBQ A;  2NRA C;  1O7F A;  1YFH A;  2ZCW A;  3J7A O;  1QNT A;  5J8C A;  4RGU A;  2XGX A;  5IT9 K;  5IT9 Z;  2K4J A;  4JK1 X;  3FMR A;  4RGR A;  1KGS A;  5HOO A;  2CYY A;  4BHP A;  1D8K A;  1BN5 A;  2RV8 A;  1A04 A;  2FMY A;  2QBY B;  3ELK A;  2YPR A;  3BOQ A;  5HS7 A;  1IAW A;  2HYG D;  2YU3 A;  3KE2 A;  1WWX A;  4LMY A;  1ZRC A;  2VOP A;  5D8L B;  4I01 A;  2O6G E;  5D5V B;  3M8F A;  4GYG A;  1SAX A;  4A0Z A;  1RUO A;  3ZMZ A;  2P7C B;  4O3M A;  2XRO A;  2JPC A;  2W85 A;  2VBW A;  2LNB A;  5EEG A;  1YLF A;  4EJW A;  3F3X A;  3HTS B;  2M8E A;  4EVI A;  3CUQ B;  4LG0 A;  3R0A A;  3T1B A;  3FXU A;  1PP7 U;  3RPU A;  2E7X A;  2X4H A;  1OYY A;  3B02 A;  3FXR A;  1QGP A;  2ZKZ A;  3TO6 A;  5LGT A;  3QAH A;  2VT2 A;  1OYI A;  5L3E A;  4MTE A;  2EB7 A;  1KYZ A;  3VEP A;  2WV0 A;  2VC1 A;  2QBY A;  1XDU A;  3RKW A;  2EV0 A;  4ZYE A;  1FYL A;  4ZYG A;  5BMZ A;  4BHC A;  4UHT A;  3E97 A;  2GZW A;  4I2O A;  2Y0M A;  1OPC A;  5LHI A;  2DO7 A;  5ICC A;  3J81 Z;  1WI9 A;  2FNA A;  2XAS A;  4FT8 A;  3O2P E;  1OYW A;  2JRT A;  3NEU A;  3CUQ A;  1FBS A;  3EYI A;  1IUY A;  4HAM A;  2KRF A;  4KN4 X;  1KU2 A;  2A6E F;  2B0L A;  2UZK A;  5L3B A;  3O6B B;  3R4K A;  5FGM A;  3TKY A;  3MQ0 A;  1JHF A;  1WQ2 A;  4XSX F;  5D8K B;  1FLI A;  1XGO A;  1QO0 D;  2FBI A;  3ECO A;  3FZV A;  4A5N A;  2DBB A;  2VON A;  1YS6 A;  4WXH A;  1EV7 A;  2OAZ A;  2IT0 A;  1JE8 A;  1U8R A;  1TBX A;  1XMK A;  2K4B A;  4ENJ A;  1YYV A;  1W5T A;  2VT3 A;  3MFK A;  3RYR A;  2BE5 F;  2ZNY A;  1TNT A;  5LHH A;  2VN2 A;  3BPV A;  5HLI A;  1QPM A;  2IPQ X;  3QP6 A;  1PP8 F;  4XSZ F;  4AIH A;  2ZME A;  4L0Y B;  4GYI A;  2XRN A;  3HIF A;  3SFZ A;  4G8X A;  1T0F A;  4IVN A;  3BZ6 A;  4HDV A;  2VC0 A;  1I5Z A;  3P9I A;  2LDU A;  4FX0 A;  3MZH A;  4I0A A;  1P6R A;  2ZO4 A;  2IJL A;  3U9G A;  1YG2 A;  2MD5 A;  1S6L A;  2L02 A;  3T5X A;  1NHA A;  4YFN F;  4AIK A;  3FM3 A;  5KK1 A;  2IA0 A;  3REO A;  3FMS A;  3ROU A;  4M72 A;  3L2C A;  1HBX G;  4PGG A;  4OIN F;  2F5E A;  1ZHF A;  2KIU A;  5H6R A;  4E70 A;  3KP2 A;  4I02 A;  4HX7 A;  5D5W B;  4IRI A;  3GZ5 A;  4ETS A;  2F5C A;  3K1M A;  3EQL F;  1TNS A;  1XSV A;  4I98 B;  4M9X A;  3WGG A;  4WXD A;  3HHG A;  4KIG A;  3K0L A;  4MGR A;  1IXC A;  4EM1 A;  3GF2 A;  1R5H A;  4IPA A;  3GFL A;  1E2X A;  2K86 A;  1U5T A;  5HS9 A;  3GVA A;  4KT5 C;  1BI2 A;  1J5Y A;  3R61 A;  4P96 A;  5CVR A;  4EGY A;  4HV5 A;  1O3R A;  3AAF A;  4UV8 A;  5JVT A;  2P6T A;  2W24 A;  2O8X A;  5ICF A;  2D2W A;  3GW2 A;  4Z2Y A;  5HLG A;  3HTU A;  4LLG F;  2IVM A;  2FA5 A;  4PCQ A;  3FX3 A;  3V7S A;  3IWZ A;  3V7C A;  1SFE A;  3QU6 A;  2JSC A;  6PAX A;  2DPU A;  3SQN A;  1XN7 A;  5L3C A;  3GZ6 A;  3P7N A;  3LA2 A;  1U78 A;  3RYP A;  3TOA A;  1KYW A;  3KP7 A;  2CW0 F;  2EFW A;  2YR2 A;  4HLY A;  3BDD A;  4ZH4 F;  4KMF A;  3U2R A;  3GEZ A;  1BIB A;  2GAU A;  1ZLJ A;  1ZYR F;  3GXO A;  1YW8 A;  3M9A A;  4UUV A;  3KP5 A;  3R60 A;  5DV5 A;  5ED4 A;  3LA3 A;  1ON1 A;  3WTS C;  4XRF A;  3E5U A;  3K2Z A;  1B59 A;  2FF4 A;  3DV8 A;  1IF1 A;  3WGI A;  1RNL A;  1SMT A;  1Z05 A;  4KN7 X;  4M6Y A;  3BJ6 A;  1KU9 A;  3ZN1 A;  3GX4 X;  4ESB A;  2FQ3 A;  2RGV A;  2HGC A;  1MJ9 A;  1LNW A;  3WTT C;  1ZG5 A;  3DXJ F;  4MTD A;  1CGP A;  1GHC A;  3ECH A;  3KEQ A;  1ZH5 A;  2HKX A;  3H3U A;  1YIO A;  2TDX A;  3I54 A;  5L3G A;  2QLZ A;  4MEX F;  2W84 A;  1GXP A;  2ISY A;  2M30 A;  1OMI A;  2PMU A;  2VE9 A;  3GLX A;  3T8T A;  2CFX A;  4IHS A;  1ZAO A;  1LDJ A;  3M1E A;  4RGS A;  2H09 A;  3BPX A;  3DFG A;  2Z99 A;  4P9U A;  3HRS A;  1YQA A;  4Y13 A;  3I64 A;  1RUN A;  3CTA A;  1S7A A;  1K79 A;  4DNC A;  1K7A A;  4G7H F;  5FB2 A;  3D5L A;  2EA2 A;  2W25 A;  4DQ2 A;  1MZB A;  5ILS A;  3CO7 C;  1UST A;  1E17 A;  4PDK A;  1ODD A;  2XV4 S;  4G7Z F;  3F8M A;  3MCZ A;  2DQR A;  1LEB A;  2PN6 A;  1IN4 A;  2DTR A;  1USS A;  1FOK A;  5BQT A;  2MH2 A;  1WSU A;  4HX4 A;  2VBY A;  1UCR A;  1FP2 A;  3QU3 A;  3W6J B;  1R23 A;  2GQQ A;  3DF8 A;  4ASN A;  3B73 A;  1J7K A;  2GIV A;  5DCF A;  1GXQ A;  2DPD A;  4P5O A;  3TO9 A;  4Y17 A;  2VOO A;  3WE3 A;  2A68 F;  3P9C A;  2XKP A;  2XAG A;  3KP4 A;  4MQ9 F;  4U7D A;  2D45 A;  1R1T A;  3ULQ B;  3BRO A;  4M9S A;  1BI1 A;  2EK5 A;  2Z9O A;  4XLN F;  4G6D A;  3HUG A;  1KU3 A;  1ZAR A;  3IC7 A;  5CVU A;  5FD5 A;  3C1D A;  1BOA A;  3F8F A;  5D5X B;  5JHU A;  3G3Z A;  2STW A;  1SFX A;  1SD6 A;  3IRQ A;  2HR3 A;  3I53 A;  1SD5 A;  4LK1 F;  1IRG A;  5BPI A;  5JI6 A;  1MD0 A;  1IRF A;  3J80 K;  4GXO A;  4IXA A;  1C0W A;  3ABU A;  2O03 A;  2EFP A;  4KIB A;  3K1P A;  1R58 A;  2VBX A;  2IA2 A;  3QOP A;  4MQV A;  4K2E A;  3KET A;  4A12 A;  2Q0O A;  2NYX A;  1HW5 A;  5LGU A;  1P4A A;  5E17 F;  1LDD A;  4S04 A;  5D6E A;  4R79 A;  1B1B A;  3HRU A;  1J0R A;  1T38 A;  3WTX C;  2HOE A;  5HLH A;  2CG4 A;  1LDK B;  2KIM A;  2Z3Y A;  5HS8 A;  4A6D A;  3E6M A;  4LK0 F;  4MHG A;  2EFN A;  3TO7 A;  1Z6R A;  2OQG A;  4D0P A;  1FC3 A;  3W6K B;  3F22 A;  4L0Z B;  1QZY A;  2XAJ A;  1G3W A;  2F2E A;  2FU4 A;  5K5Q A;  3L09 A;  4BHB A;  4NB5 A;  1SFU A;  2M45 A;  1IN8 A;  3GFI A;  2G7U A;  4L9T A;  3VB2 A;  4EMS A;  2E1C A;  3PQJ A;  2F5F A;  3JAM K;  3JAM Z;  1I1S A;  3V7R A;  2KIF A;  4IJA A;  2HTJ A;  2PBI A;  4CDG A;  2FXA A;  4UNO A;  4RAZ A;  1DDN A;  4KMU X;  4ON0 A;  2UXX A;  3ZMT A;  1RZ4 A;  3E3V A;  4HF0 A;  2ZXJ A;  3FHZ A;  4EJT A;  1Z7U A;  2JPB A;  3VOD A;  2ZME B;  1ZGJ A;  4R8H A;  1HW2 A;  3L00 A;  2QQB A;  5TJJ A;  1G6N A;  5CYV A;  4NQW A;  2DQL A;  4LB5 A;  2L4M A;  4B09 A;  4HF1 A;  4I09 A;  3SZP A;  2LF7 A;  2J5P A;  1RI7 A;  1ZGA A;  1EH8 A;  2GXB A;  2L3D A;  2MC3 A;  2IRF G;  2COM A;  1F5T A;  1S3J A;  3LA7 A;  3BJA A;  2OA4 A;  4O5V A;  1G3Y A;  1TLH B;  2ACJ A;  2ISZ A;  1K6O A;  2DFI A;  4EM0 B;  1QBJ A;  5A2Q K;  4MNU A;  1SD7 A;  2KJB A;  4R1H A;  4WXC A;  3WE2 A;  3OOP A;  3I58 A;  1XGM A;  5K5R A;  2V1U A;  4ESJ A;  5E1W A;  3T0Y A;  3KP3 A;  4L9J A;  4ZZL A;  4F7Z A;  2Y75 A;  5HDG A;  2OQR A;  5LLQ A;  5E8G A;  2DT5 A;  3RKX A;  2BYV E;  3CUQ C;  3U1D A;  1J2X A;  2RNJ A;  4YFK F;  1HQC A;  4U0W A;  3KFW X;  1U5T B;  1H9T A;  3ZPL A;  1SD4 A;  2FSW A;  2PG4 A;  2HTS A;  3LWF A;  2QQ9 A;  4OMZ A;  1LEA A;  4I7H A;  1OKR A;  4HDU A;  2EV6 A;  1D5V A;  5FFX A;  1LJ9 A;  2V9V A;  3RTR A;  4G6Q A;  5L3F A;  3WTZ A;  4KYW A;  2GWR A;  2A69 F;  5JFR A;  4U0V A;  4HX8 A;  4P55 A;  4HYE A;  3ZMD A;  2NS0 A;  3D0S A;  2MH9 A;  4IHT A;  2OZ6 A;  5F6F A;  5AIP A;  5D6F A;  5K5O A;  1FP1 D;  2FNP A;  2FRH A;  2O61 A;  1EH7 A;  2ZJ2 A;  2CGP A;  4OOI A;  5LRR A;  2L54 A;  3WU0 A;  3FM5 A;  4U88 A;  1FNN A;  3V8J A;  3ZMV A;  5AON A;  5KVR A;  1ON2 A;  3L9F A;  3GO5 A;  4KFC A;  3WOD F;  4I0B A;  3E5Q A;  4KA4 A;  2HDC A;  2ADU A;  4G9Y A;  3ZQ7 A;  3FMQ A;  2R7F A;  1DUX C;  1XCV A;  3S2W A;  5AIQ A;  2RC4 A;  2P4W A;  5LHG A;  2FBH A;  2A3S A;  3DEU A;  3F8B A;  1R7J A;  3LQQ A;  2KJC A;  2V1X A;  2FML A;  2DK5 A;  3HSE A;  2DAO A;  2VXZ A;  2E7W A;  1BJA A;  4UXN A;  2Q8K A;  5LEK A;  1W4M A;  1BIA A;  1FSE A;  2WWY A;  1KQ8 A;  2IA1 A;  1ONV A;  3O3K A;  4OIP F;  3RPQ A;  2LSO A;  2KKO A;  5CLS A;  4B8X A;  1IN7 A;  2H6C A;  4N9H A;  4OIR F;  4O6J A;  1FBQ A;  1P92 A;  3E6B A;  3F6V A;  5CJ9 A;  4CXF A;  3IHU A;  4PZJ A;  3E5X A;  2GXG A;  3JSO A;  1U5T C;  4L18 B;  2Z5U A;  2P5K A;  3IKV A;  1JHH A;  4Y15 A;  5J8F A;  2NNY A;  3COA C;  3MEX A;  5D4S A;  2DI3 A;  2RN7 A;  4M73 A;  1O3S A;  1ZN2 A;  3LST A;  2CSO A;  3CJN A;  2P6S A;  2RVC A;  3GYH X;  1HKT A;  1FX7 A;  4LD5 A;  2K02 A;  3BY6 A;  4M9Z A;  3EET A;  1STZ A;  1P2F A;  1FT9 A;  4QLC U;  3BP8 A;  4EQQ A;  5H20 A;  2L01 A;  4L5J A;  1QZZ A;  5HVQ C;  1R36 A;  2JT1 A;  1UHM A;  3TQN A;  2RQP A;  3HHH A;  5FFZ A;  3HOT A;  1MDM A;  1J59 A;  2A6H F;  3GUD A;  4HQM A;  5HDK A;  5ICE A;  2QUF A;  1ZG1 A;  1JXS A;  2DLL A;  2OU2 A;  3HSR A;  4QWQ A;  1W5S A;  2HQN A;  5EEH A;  1Z6T A;  5DUI A;  3G73 A;  4RS8 A;  2VBZ A;  5D5U B;  4HQE A;  4XLP F;  1UB9 A;  1ZLK A;  4EJV A;  4Q4Z F;  1PDN C;  4A0Y A;  2G9W A;  4AWX B;  3LFK A;  1BI3 A;  2M87 A;  1L3L A;  1S8N A;  4KIC A;  4A2U A;  2CQK A;  4BXU A;  3R0J A;  4M71 A;  3EUH A;  4KDP A;  1AOY A;  1KQ0 A;  4IRH A;  2A5Y B;  4CHU A;  4G7O F;  1V4R A;  2DU9 A;  3TDU C;  2G7H A;  2XUB A;  5D4R A;  1Y0U A;  4NHJ A;  3KLN A;  1L0O C;  2W57 A;  4AVP A;  2H27 A;  2IW5 A;  4BAY A;  1DP7 P;  2GA1 A;  1G4D A;  3VFZ A;  4XBF A;  1WRJ A;  2CWE A;  1XB4 A;  3I5U A;  5ERI A;  5FD6 A;  1FWZ A;  3ML6 A;  2XAH A;  4EV0 A;  4KUM A;  2Z33 A;  2PMH A;  3JTG A;  2ELH A;  3ZN0 A;  1TQM A;  5BS6 A;  2LKP A;  3E6D A;  2PQ8 A;  4N0B A;  1YW7 A;  2GA2 A;  3RIR A;  2WC2 A;  1HKQ A;  1LQ1 A;  1IN6 A;  2HYF A;  4GGG A;  1XGN A;  3I71 A;  4HZF A;  4ESF A;  1XSX A;  1T98 A;  3IWF A;  1MGT A;  1ZRE A;  1O3T A;  2JTV A;  4RGX A;  2H6B A;  3T8R A;  5H6Q A;  3F8C A;  4EGZ A;  3ISP A;  4CIC A;  4HF2 A;  3C7J A;  3MWM A;  1O7L A;  3L7W A;  3VOE A;  2HWV A;  3SXY A;  1TQI A;  2ESH A;  3HYI A;  3J80 Z;  5HDN A;  2DW4 A;  4UVC A;  1R1U A;  1S29 A;  4AD9 A;  1T39 A;  3FF5 A;  4FX4 A;  2YX7 A;  2FE3 A;  2OBP A;  4YG2 F;  1IZ1 A;  2ESN A;  3SHF A;  2F5D A;  4OMY A;  1HXD A;  3M7G A;  4A0X A;  1FYM A;  2RKH A;  3WG9 A;  4WF2 A;  1DPR A;  1XGS A;  1BBY A;  4BQA A;  4A6E A;  2E1N A;  5CVJ A;  4OU0 A;  2ZBK A;  1FZP B;  2VE8 A;  3I59 B;  2RDP A;  4OIO F;  4BH9 A;  3IRR A;  3WTW C;  2QVO A;  4LLL A;  2V1D A;  1WKM A;  3F6O A;  4HA8 A;  1TW3 A;  2MBF A;  4L9N A;  1I27 A;  1EH6 A; 
#chains in the Genus database with same CATH topology
 3RZD J;  2OJE D;  1PVE A;  2LH9 A;  2P0W A;  2VXD A;  3V4G A;  1G3T A;  3WGH A;  2B63 J;  3HRM A;  2YU9 J;  2FOK A;  4CYD A;  4ZC3 A;  3CCE I;  2EQR A;  1F1Z A;  2HZT A;  1HW1 A;  1ETV A;  3FK6 A;  2UXN A;  5L3D A;  1MW7 A;  4EJU A;  5DD4 A;  3KZZ A;  4IRG A;  2WV1 A;  1I1G A;  2KRH A;  4PGH A;  2K27 A;  3VWB A;  5E1Z B;  4L5I A;  5DYM A;  5FLX Z;  5FLX K;  1WJA A;  1YE9 A;  2HDW A;  3OR1 C;  1RKT A;  2O3F A;  1QHG A;  1XS9 A;  2GLO A;  2EJR A;  3Q9S A;  2MA3 A;  5IP9 J;  5TIS C;  2AXL A;  4EEF G;  3K9T A;  2EA4 A;  2LF8 A;  4IQ4 A;  3ZQI A;  3GLL A;  4ZYH A;  4ENK A;  3GCM A;  4ENM A;  1R5G A;  3BR6 A;  2DA6 A;  2ME6 A;  4DYR A;  3DQV C;  2R7T A;  4XLH A;  2WAE A;  5HOO A;  2NS8 A;  2R7D A;  4BXX J;  3ZP5 A;  3RKY A;  1HST A;  1RIO H;  3J81 K;  2LD5 A;  2XDV A;  2WBM A;  3TMO A;  2M2E A;  3I59 A;  3IAS 2;  3OOU A;  3K2A A;  1UG0 A;  1R22 A;  2KMU A;  4CZZ A;  1LVA A;  4L9V A;  2IP2 A;  1I6X A;  1MBJ A;  2G0E A;  3GFM A;  1T8I A;  3AG1 H;  4DOZ A;  4G12 A;  4NBQ A;  3GWZ A;  3VYU B;  3ABT A;  1B4A A;  4IHV A;  1J9I A;  2EWN A;  1SFO J;  4RB1 A;  3BJO A;  2P7V B;  3TP3 A;  2FEZ A;  2KIS A;  2ZXH A;  5E3O A;  2ZXW H;  3H3Z A;  2R7O A;  3MAJ A;  2M7A A;  5J3L A;  4X0G A;  1JKQ C;  4GO1 A;  3GTP J;  3RI4 A;  1UMQ A;  5A2Q Z;  1IN5 A;  2AS5 F;  2AXT C;  2OTJ I;  1X2M A;  4WK8 F;  1YI2 I;  1U0J A;  4BNC A;  1HKS A;  3N4M A;  1UHS A;  1XD7 A;  2WY8 Q;  5FRO A;  5IPA A;  1YW9 A;  3RJP A;  2V79 A;  4KT6 A;  1JT6 A;  4F3Q A;  5BOX A;  1XSD A;  2RAE A;  2P5V A;  2J5O A;  2XHK A;  5DCM B;  1MJB A;  1X3U A;  3OYB A;  2PX9 A;  3LAP A;  2PI0 A;  1F43 A;  2HXO A;  1V3F A;  5M3M J;  2A61 A;  4Q47 A;  3G6E I;  1LB2 A;  2YSR A;  2A6T A;  4HV6 A;  5FO5 A;  4LLN A;  3P9K A;  1JTX A;  3KCC A;  1Y1V J;  2XAQ A;  3QRF F;  1W36 C;  1HA8 A;  3UR3 C;  4BS9 A;  2FBK A;  1MBE A;  1ZTR A;  3PNY A;  5ILV A;  1D0Z A;  3RDI A;  1LPQ A;  1ZRF A;  3CO6 C;  1REP C;  5JR3 A;  2ZNZ A;  4CZC A;  3B6C A;  3HM5 A;  2PLY A;  3HOX J;  1JUS A;  4J01 A;  2PJP A;  1DGR M;  3HRT A;  5GAH J;  3KP6 A;  4ZYD A;  1CF7 B;  1SMY F;  3OYH A;  4H4K C;  1B8I B;  1OR7 A;  2C6Y A;  2EV5 A;  2A07 F;  1R1V A;  1Z67 A;  3K1N A;  2CV1 A;  4A3K J;  3WTY C;  1KA8 A;  4N4O B;  1LUJ B;  2QF7 A;  1Z21 A;  2X6Y A;  1X4P A;  3TBI A;  2Z16 A;  2IGN A;  3AFH A;  2V6C A;  2DK8 A;  1TWH J;  4DJA A;  2BVM A;  2D1H A;  3LQR A;  4YIF A;  1P4X A;  2NAZ A;  2R7X A;  2BOL A;  5DDG A;  3K69 A;  3FIS A;  4PFP A;  2E1M C;  1MKM A;  3HJE A;  2OTL I;  2XKO A;  2MW8 A;  1P4W A;  2BEO A;  4D5C A;  4U0Y A;  4J00 A;  2RQQ A;  2V9K A;  1F36 A;  3ZMS A;  4A3J J;  4LB6 B;  2E2H J;  1T08 B;  1HSJ A;  1S7O A;  2M0C A;  2ECB A;  4BEH A;  1TWC J;  3BLY A;  4A3C J;  4IOA F;  4M6X A;  3K4M A;  2H8W A;  4DBR A;  5IT3 A;  5DCM A;  4P9F A;  3PQK A;  4EM2 A;  4HW0 A;  3CDH A;  3CC2 I;  3I0T A;  1X1A A;  1UHW A;  1HDP A;  3BG7 A;  5C4X J;  3J7Y J;  3WTU C;  2E35 A;  1Z91 A;  3FXQ A;  2FX0 A;  5LRS A;  1S5L C;  4AC0 A;  2MLK A;  3PFI A;  1ITY A;  1ZK8 A;  2HI3 A;  3LSI A;  3GBG A;  3Q9V A;  3O8H A;  2RNG A;  1RC9 A;  2XPU A;  5F1J A;  3AL0 B;  3HOS A;  1XTA A;  4XN3 A;  2O7O A;  3FKJ A;  1CF7 A;  4PJJ A;  4BY1 J;  1JGS A;  2XIG A;  1BI0 A;  3DPL C;  2XGD A;  3DBR B;  3HPH A;  1HF0 A;  2EFO A;  2DJN A;  1ETX A;  3H5N A;  4KIF A;  1JJ6 C;  1HDD C;  4BY7 J;  4AUX A;  2IS4 A;  2AHQ A;  1GVJ A;  2W82 A;  1FSH A;  3GTM J;  3F8N A;  3E6C C;  3I4P A;  4IF4 A;  3WU1 B;  3LAJ A;  2X85 A;  3KYC B;  2XAF A;  4RM2 A;  1F4K A;  1B72 B;  1BC8 C;  3ERE D;  3IH3 A;  2AQF A;  1WJ5 A;  1MBF A;  4KNY A;  5F1R A;  2XF5 A;  1VQ4 I;  1W7P D;  1FPQ A;  3G1M A;  2HKO A;  5J4Y A;  4AU7 A;  3GFJ A;  5FLV A;  4PSX A;  2ZB9 A;  1MNM C;  2EIJ H;  2Q2E A;  4HLX A;  1JUM A;  3FWE A;  2Y9Z A;  2LOO A;  3M8J A;  3V8K A;  1DQU A;  4TV7 A;  3ZQH A;  4UVB A;  1UFM A;  4A3D J;  1EKE A;  2LVS A;  4Q5S F;  1QQI A;  4WX9 A;  2PEX A;  3CDL A;  3DP7 A;  4UVA A;  5E18 F;  1JKP C;  3G71 I;  1U2W A;  4PJN A;  2KRC A;  1U3E M;  1H0M A;  1GUU A;  3OV8 A;  5LEJ A;  1LVK A;  3OYG A;  4B47 A;  2BGC A;  3TOB A;  1MDM B;  1FMW A;  2M1B A;  1JI8 A;  4ZYA A;  4CGZ A;  1TWA J;  2LKS A;  3GTL J;  2YX4 A;  3ASN H;  3FXO A;  1D1C A;  5K1Y A;  1J75 A;  3KLO A;  2KZV A;  1S7E A;  1E0E A;  1APL C;  4MEY F;  2ETH A;  2L7M P;  5FJ8 J;  3F21 A;  2COB A;  5E1X A;  3F72 A;  3M3Y J;  3K7A J;  1X4O A;  5J1U A;  2FUG 2;  4RAY A;  1K78 B;  1WCM J;  1A35 A;  1IW7 F;  4QPO A;  3ZMU A;  2W7N A;  3EYY A;  4JOM A;  2HQR A;  3DPT A;  1B9M A;  1RPW A;  5TRD A;  3S16 J;  1Z1D A;  3C2G A;  2HS5 A;  5K7Z A;  3QWL A;  3WHB A;  4LFU A;  3L2V A;  5DUK A;  3TGN A;  4IEJ A;  3CJQ B;  4A3L J;  2CUJ A;  1B72 A;  3MZY A;  2QWW A;  1D0X A;  2KT0 A;  1RES A;  3BG3 A;  1W7P B;  5FKN A;  2DFF A;  3H92 A;  3NQO A;  4BYY A;  2M9H A;  1KU7 A;  2BV6 A;  5B5E C;  4FHT A;  2NVU B;  1TW2 A;  1EF4 A;  2P5L C;  4C9Y A;  2Y48 A;  1H9G A;  4A5M A;  4EJO A;  4HOB A;  5DM7 F;  2JZY A;  4IQJ A;  5C44 J;  3LOC A;  4GRI A;  5EZH A;  3QPT A;  1TWF J;  1AWC A;  2MSY A;  3FK7 A;  1MMS A;  1R4N B;  3PL8 A;  2KIQ A;  2R4G A;  4NDL A;  4ENN A;  5CVI A;  3JSP A;  5IP6 A;  4ZJZ A;  4AIJ A;  1O3Q A;  2MLG A;  3KX2 A;  2BBY A;  1BL0 A;  1JGG A;  1LKX A;  2H94 A;  3PO2 J;  2ZFW A;  3S17 J;  5LGN A;  4H0E A;  3K6G A;  2ME0 A;  4C3J J;  3HDD A;  2M3A A;  3H3V K;  1B9N A;  3KZI C;  5DEQ A;  2LY1 A;  1F9N A;  2QYO A;  5BPD A;  5EGO B;  2XVC A;  2PJR B;  2QQA A;  3ABK H;  1T6S A;  4XKC A;  1POG A;  4WWC A;  2K9N A;  3RKQ A;  1K78 A;  2M5W A;  1ZRD A;  3AL0 C;  5F0F A;  1UJ8 A;  1XDS A;  2L4A A;  3DKY A;  2NNN A;  4LGW A;  1A36 A;  2HEO A;  1D8J A;  5J6X A;  3KZY A;  4OIQ F;  3SZT A;  2O0Y A;  1LFB A;  4M3G A;  3CCV I;  3M8E A;  2QEN A;  5CKT A;  3R6S A;  2OCC H;  4IL6 C;  1YS7 A;  4M74 A;  2IBD A;  5J40 A;  1VQN I;  2QCO A;  1T2K A;  3C3W A;  4JBA A;  3AG4 H;  4FE7 A;  3VYT B;  1W7P A;  3BC8 A;  3V8L A;  2GOM A;  2XPV A;  3VPR A;  1FBU A;  2DOE A;  1IRX A;  2HPM A;  1FY7 A;  3CME I;  1VTN C;  2HFH A;  3LSP A;  1R5I D;  2HNH A;  3IKT A;  2K40 A;  3OSG A;  3EDP A;  4E7L A;  4BE1 A;  2CFO A;  3X2Q H;  2R7R A;  5HLT A;  3D5R C;  3JW4 A;  3QOD A;  2EFQ A;  2NXN B;  2OD5 A;  3F23 A;  5CVV A;  1B6A A;  1DPU A;  4PUS A;  1KQ9 A;  5GTI C;  2XSD C;  1IXR C;  3CCL I;  1OCP A;  1MJA A;  5F64 A;  2BXY A;  1R00 A;  4FE4 A;  4YFX F;  3Q5F A;  3TDZ C;  3C18 A;  1FTT A;  3FXL A;  1X3W B;  5HOD A;  2X0L A;  2IAI A;  1IXS B;  3RPU D;  3DKW A;  5E8I A;  5EGO A;  3JTH A;  2D1V A;  1Q1H A;  3K4N A;  3ZQF A;  3HSF A;  2XSJ C;  3H5R A;  1FYK A;  3CCR I;  3ABL H;  3N97 A;  2STT A;  1ULY A;  3U21 A;  3OYN A;  1VQ5 I;  1O57 A;  1WI3 A;  4UUS A;  3IL2 A;  3TED A;  1BM9 A;  2K7L A;  1BR2 A;  4G94 A;  2ELK A;  2A05 A;  5ICG A;  4RB2 C;  1TTY A;  2R3S A;  1QU3 A;  4UV9 A;  2MC4 A;  4CCM A;  2EIL H;  3CJT B;  3IP4 B;  4GCV A;  5ILU A;  2LYC A;  3TW7 A;  2VJ4 A;  4MFE A;  1TL8 A;  2WAD A;  3HZJ A;  2HXI A;  4JQF A;  1N77 A;  3SEQ A;  4CO8 A;  1Z9C A;  1ACI A;  3QP5 A;  1YHQ I;  2WTE A;  2UWM A;  2CW7 A;  4HBL A;  5E20 A;  3ZRG A;  3I55 I;  1G3S A;  1BC7 C;  4XLA A;  3WTV C;  3A2K A;  1K4S A;  3EUH C;  3KEO A;  1WZ2 A;  4AM3 A;  3DPU A;  1U6G A;  3NRV A;  2GM4 A;  5IYB J;  4M3E A;  1XMA A;  4Q48 A;  4UB6 C;  4RB3 C;  4N4N B;  1ZG3 A;  2ZJP F;  4IX7 A;  2QM3 A;  3CUO A;  1H88 C;  3GTQ J;  3B6A A;  1FEX A;  1TT5 B;  1YO5 C;  4YII A;  1FIA A;  1YTY A;  3DCF A;  5GP9 A;  5FKL A;  2VOD A;  2CS3 A;  2CO5 A;  4S05 A;  4RB0 A;  4LJZ F;  5DD8 A;  1A5J A;  4U7B A;  2HU9 A;  4ZZD A;  3BWG A;  3OYI A;  1TQP A;  1PUE E;  4LG0 B;  3Q0U A;  1WPK A;  2JSP A;  4WCG A;  2PFB A;  3QPH A;  3CLO A;  4DGW B;  2OZU A;  5C3E J;  4D7N A;  2ZJQ F;  1MSF C;  1D3Y A;  2P8T A;  2QZ8 A;  1SVL A;  3JRB A;  1XCB A;  2IGO A;  4HST A;  4C30 A;  4N9I A;  4CCK A;  3L2W A;  1K61 A;  1K6Y A;  1UZC A;  3MKL A;  5LBQ A;  2NOJ B;  5EG0 A;  2NRA C;  2X9D A;  2LY2 A;  1O7F A;  2QA4 I;  1YFH A;  4CH7 A;  2ZCW A;  3VSL A;  4I6Z A;  1VQ9 I;  3J7A O;  1MBK A;  4F93 B;  2F4O B;  4OAZ A;  2CRG A;  1QNT A;  3JRD A;  5J8C A;  2HOA A;  4RGU A;  1JTY A;  3DEE A;  4B44 A;  2XGX A;  5IT9 K;  5IT9 Z;  1BOB A;  3CCM I;  2K4J A;  2DJI A;  1VQK I;  1MH4 A;  4JK1 X;  3FMR A;  4M6V A;  4RGR A;  2NVX J;  1KGS A;  3BT9 A;  2CYY A;  3Q0W A;  1D8K A;  1BN5 A;  2RV8 A;  4V2G A;  1A04 A;  2FMY A;  4BHP A;  2QBY B;  3ELK A;  2YPR A;  2OF7 A;  3OL3 A;  3BOQ A;  5HS7 A;  1IAW A;  3AG2 H;  1SFK A;  2JRM A;  4XRS A;  2HYG D;  1SVO A;  2YU3 A;  3KE2 A;  1WWX A;  4IOC F;  4LMY A;  1ZRC A;  2VOP A;  5D8L B;  1ETK A;  4I01 A;  2O6G E;  5D5V B;  4GDF A;  1G8X A;  3M8F A;  2KPM A;  4GYG A;  3BR0 A;  3F0C A;  1SAX A;  4A0Z A;  2IS1 A;  2VQH A;  1RUO A;  4A69 C;  3ZMZ A;  2P7C B;  4O3M A;  2XRO A;  2JPC A;  3QYF A;  3K70 C;  2W85 A;  2VBW A;  2LNB A;  4RDU A;  5EEG A;  2CQX A;  1YLF A;  4EJW A;  3F3X A;  4BBS J;  3HTS B;  2M8E A;  4EVI A;  3CUQ B;  4LG0 A;  3R0A A;  2K9S A;  4IKF A;  3T1B A;  2A5W A;  4Y4R A;  3G4S I;  3FXU A;  1PP7 U;  3RPU A;  1EA3 A;  2E7X A;  2X4H A;  1OYY A;  3B02 A;  3FXR A;  3PNV A;  1QGP A;  2ZKZ A;  3MVP A;  3TO6 A;  5LGT A;  3HOY J;  3QAH A;  3H35 A;  2VT2 A;  1OYI A;  3DBL B;  1U9O A;  5L3E A;  4MTE A;  2VJ5 A;  1T33 A;  3A4C A;  3QOE A;  5GPC A;  2M7B A;  2EB7 A;  3HL2 A;  2X6X A;  1KYZ A;  2M0M A;  1ERD A;  3SJM A;  3TL4 X;  1Y56 A;  3VEP A;  1ZQ3 P;  2WV0 A;  2VC1 A;  4RA2 A;  2QBY A;  4LOC A;  1XDU A;  3RKW A;  2EV0 A;  3W2A A;  4NNJ A;  2JJ7 A;  2JN6 A;  2X51 A;  4ZYE A;  3S14 J;  1FYL A;  2M4G A;  2E60 A;  4A3B J;  3FIW A;  2F6C A;  3PUB A;  2Z2S B;  2XF6 A;  5EJC A;  3PIO F;  4ZYG A;  2V26 A;  5BMZ A;  4XLC A;  4BHC A;  4UHT A;  3E97 A;  1W0T A;  2QQ8 A;  2YS9 A;  1N78 A;  2GZW A;  3H5A A;  4F91 B;  4I2O A;  2Y0M A;  1OPC A;  2VPR A;  5LHI A;  2DO7 A;  5ICC A;  3J81 Z;  1WI9 A;  1OJL A;  2FNA A;  2LKX A;  4XID A;  2XAS A;  4FT8 A;  3RQI A;  2R7V A;  5BNG A;  2IS6 A;  3O2P E;  2Y0S A;  1OYW A;  3CP2 A;  2JRT A;  2EZL A;  3NEU A;  3CUQ A;  1FBS A;  3EYI A;  2WA0 A;  1IUY A;  4HAM A;  2KRF A;  4KN4 X;  2ID6 A;  3H9Q A;  5F27 A;  3A0H C;  1KU2 A;  2A6E F;  1Y8Q B;  2B0L A;  2UZK A;  2BXZ A;  2BY3 A;  5L3B A;  3O6B B;  3R4K A;  5FGM A;  3TKY A;  1JKO C;  3MQ0 A;  3QPS A;  4RAG A;  1JHF A;  3S93 A;  1WQ2 A;  3I3L A;  4XSX F;  2O9L A;  1FOX A;  1JUP A;  3SYT A;  2P81 A;  5D8K B;  1FLI A;  1XGO A;  1M1E B;  1QO0 D;  2X1D A;  3LL7 A;  2FBI A;  3W2W A;  1IGN A;  3ECO A;  3FZV A;  3IUO A;  1XG1 A;  4A5N A;  2DBB A;  2VON A;  4V2F A;  1PUF A;  4U87 A;  2JUC A;  1YS6 A;  3LSH A;  4WXH A;  1EV7 A;  2OAZ A;  4RM3 A;  2IT0 A;  2OPT A;  5C4J J;  1TP4 A;  1JE8 A;  1U8R A;  1DU0 A;  3K4K A;  3FHN A;  5GAD J;  1MIJ A;  4BEH B;  3PSF A;  4IHY A;  2CMP A;  1TBX A;  1OQY A;  1XMK A;  1O4X A;  2K4B A;  3H9J A;  1YYV A;  1W5T A;  2VT3 A;  3MFK A;  4ENJ A;  4BU2 A;  1WFX A;  4RMN A;  3RYR A;  1QZE A;  2BE5 F;  2ZNY A;  5JLX A;  1TNT A;  5LHH A;  2VN2 A;  3BPV A;  3AG3 H;  3O8G A;  5HLI A;  1QPM A;  4ZDP A;  2IPQ X;  3QP6 A;  4D1Q A;  1MBH A;  4UUT A;  1PP8 F;  4XSZ F;  4AIH A;  1GLN A;  2ZME A;  2UUZ A;  4L0Y B;  2LLK A;  4GYI A;  2DMQ A;  1A6I A;  2XRN A;  3HIF A;  3SFZ A;  4G8X A;  1T0F A;  2E36 A;  4IVN A;  1YJ9 I;  1Y1W J;  3BZ6 A;  4HDV A;  2Y31 A;  2VC0 A;  1I5Z A;  3P9I A;  2AO9 A;  2LDU A;  3S32 A;  4F55 A;  9ANT A;  1VQ7 I;  3CJR B;  4FX0 A;  3MZH A;  4I0A A;  1P6R A;  1Y39 A;  2QKM B;  2ZO4 A;  2IJL A;  3U9G A;  4BGD A;  4RBO A;  1YG2 A;  3DTI A;  2MD5 A;  1S6L A;  2L02 A;  3M1C A;  2Q1Z B;  5KCM A;  3T5X A;  3DKX A;  1W0U A;  1NHA A;  2EZK A;  4YFN F;  5K7H A;  3G2B A;  4X1E A;  2Q2E B;  4AIK A;  3FM3 A;  2X1E A;  5KK1 A;  4BQN A;  2IA0 A;  2ZFU A;  4G6T B;  2DMP A;  1PJR A;  3REO A;  1IRZ A;  5TGT A;  3FMS A;  2LK2 A;  3ROU A;  4M72 A;  3JRA A;  3QPL A;  3L2C A;  1HBX G;  1AHD P;  2KP6 A;  1DGW Y;  4PGG A;  5EDN A;  2OV7 A;  3K4B A;  4OIN F;  1R9T J;  2F5E A;  1ZHF A;  2HQA A;  2MGQ A;  1WJE A;  1I3A A;  5IYC J;  3HBL A;  2QEX I;  1OCO H;  4E7Z A;  2KIU A;  2XF7 A;  5H6R A;  2R92 J;  4E70 A;  3KP2 A;  2CJJ A;  4I02 A;  5B66 C;  4HX7 A;  2E71 A;  3EUA A;  2DMN A;  5D5W B;  1ZR2 A;  2R93 J;  3HG9 A;  4IRI A;  2OC6 A;  3GZ5 A;  4ETS A;  2F5C A;  3K1M A;  4W1U A;  3EQL F;  3S15 J;  1TNS A;  1H8A C;  1XSV A;  4M3F A;  2IEK A;  2VQL A;  4I98 B;  4M9X A;  3WGG A;  4WXD A;  3HHG A;  4KIG A;  4LG3 A;  1V5E A;  4Y33 A;  2KFD A;  3K0L A;  2XAU A;  1X2N A;  2NVT J;  4CYC B;  2WB1 N;  4MGR A;  1IXC A;  1OR7 C;  4EM1 A;  1H89 C;  3GF2 A;  1MSE C;  4NC7 A;  1R5H A;  3FKI J;  5B1A H;  5GPA A;  4IPA A;  2EIN H;  3GFL A;  1E2X A;  5B1B H;  2K86 A;  3JRE A;  1VZ0 A;  3I4N J;  2VIX A;  1U5T A;  5HS9 A;  3GVA A;  4KT5 C;  2DYR H;  2XB0 X;  1BI2 A;  1X19 A;  2O8K A;  1J5Y A;  3BTI A;  3R61 A;  5EYR A;  4XKB A;  4A3G J;  3OS0 A;  1T56 A;  4P96 A;  5CVR A;  1PYV A;  3HC7 A;  4HV5 A;  4ITV A;  4W97 A;  5DS9 A;  4EGY A;  1O3R A;  3AAF A;  4UV8 A;  5JVT A;  2NVY J;  3SEZ A;  2P6T A;  4JYK A;  4CUG A;  2W24 A;  2O8X A;  2HZD A;  2N8G A;  4RAF A;  5ICF A;  3OYA A;  1VQ8 I;  3BZC A;  2D2W A;  2OUM A;  3A1Y A;  3GW2 A;  4HEA 2;  1LFU P;  1DU6 A;  1FIP A;  3PM1 A;  4Z2Y A;  5HLG A;  3HTU A;  4LLG F;  2IVM A;  2FA5 A;  4PCQ A;  4Y3O A;  3FX3 A;  3V7S A;  3IWZ A;  3V7C A;  2BHZ A;  3Q3S A;  2NS7 A;  1SFE A;  3QU6 A;  2JSC A;  2WB1 A;  2DT7 B;  4A93 J;  6PAX A;  5KAF C;  2DPU A;  3SQN A;  1XN7 A;  1K4T A;  5L3C A;  3GZ6 A;  1VQL I;  3P7N A;  1MBG A;  2R7Q A;  3LA2 A;  1U78 A;  4BQQ A;  2F4I A;  3RYP A;  1XMX A;  3NWT A;  1NTC A;  3TOA A;  2V6E A;  1KYW A;  3KP7 A;  3SFI A;  2CW0 F;  4NC8 A;  1MND A;  2EFW A;  2YR2 A;  4CYC A;  4HLY A;  2K9L A;  3A01 B;  3BDD A;  4ZH4 F;  4KMF A;  1P7I A;  4MO7 A;  3U2R A;  3GEZ A;  4BE2 A;  2K9Q A;  1BIB A;  2GAU A;  2H8R A;  2FJ1 A;  1Y0N A;  1ZLJ A;  5E3N A;  3S1M J;  1ZYR F;  4V19 K;  3GXO A;  1YW8 A;  3M9A A;  1E3H A;  4UUV A;  3KP5 A;  3R60 A;  1IJW C;  5DV5 A;  5ED4 A;  3LA3 A;  4MLO A;  4GFB A;  2HVS A;  2V4J C;  1ON1 A;  3WTS C;  4XRF A;  3E5U A;  3MZ8 A;  3K2Z A;  1B59 A;  2R7U A;  2FF4 A;  3DV8 A;  4BAC A;  1IF1 A;  1RET A;  1V5F A;  1ZEL A;  1RNL A;  1SMT A;  1Z05 A;  4KN7 X;  4M6Y A;  4ANJ A;  3WGI A;  2CQ7 A;  3H9G A;  3BJ6 A;  3KYD B;  1KU9 A;  3ZN1 A;  1ETQ A;  3GX4 X;  3H1C A;  1I6H J;  4YEJ A;  4ESB A;  2ZJR F;  2IGM A;  2FQ3 A;  2JA6 J;  1I3Q J;  2RGV A;  3OYJ A;  4XM3 A;  2HGC A;  1MJ9 A;  3A02 A;  1Z3Y A;  1LNW A;  1RR8 C;  1D0Y A;  3WTT C;  1ZG5 A;  3DXJ F;  4HRI A;  4MTD A;  3HEF A;  1CGP A;  2KL4 A;  1GHC A;  3ECH A;  2DN0 A;  2GXA A;  3BG5 A;  3KEQ A;  1ZH5 A;  1Z0X A;  3GTG J;  1RRJ A;  2HKX A;  3H3U A;  5J4V A;  5IP7 J;  2L7K A;  4UUS B;  1YIO A;  2TDX A;  3I54 A;  4C2M J;  1YJW I;  5L3G A;  4XR6 A;  4ZTJ A;  5GAE J;  1KZH A;  3OL4 A;  1BW6 A;  2V7F A;  2E34 A;  1QVU A;  2QLZ A;  3E0J B;  4MEX F;  1YRN B;  2HOT A;  3DBH B;  3L2U A;  3A01 A;  2W84 A;  3UKG A;  3VYS B;  4Y7N J;  1GXP A;  2LC2 A;  4XL9 A;  2ISY A;  2M30 A;  3CMA I;  1YX5 A;  1OMI A;  2Y30 A;  1XX5 A;  2PMU A;  3E7L A;  2VE9 A;  3GLX A;  1WGX A;  3BR3 A;  3I4M J;  3T8T A;  2CFX A;  4IHS A;  1ZAO A;  1LDJ A;  3M1E A;  4RGS A;  2H09 A;  4E6K G;  3BPX A;  1V5G A;  2BW3 A;  2F4M B;  1N75 A;  3DFG A;  2Z99 A;  4P9U A;  4II3 A;  3HRS A;  1YQA A;  4Y13 A;  4LIU A;  3I64 A;  3CCS I;  1RUN A;  3CTA A;  1S7A A;  2MAB A;  2DOD A;  1K79 A;  5E3M A;  3PIP F;  4DNC A;  1A31 A;  3G1L A;  1LFP A;  1K7A A;  1P7J A;  5FB2 A;  4G7H F;  2BY1 A;  3D5L A;  2EA2 A;  3HUG B;  2W25 A;  3MKW B;  1VQP I;  4DQ2 A;  1MZB A;  5ILS A;  3CO7 C;  1IV8 A;  1UST A;  3SDB A;  2IGK A;  4BDY A;  1E17 A;  1EJ9 A;  3ZOB A;  3W6V A;  2VI6 A;  2MG4 A;  4PDK A;  1ODD A;  1WH7 A;  1MNE A;  2XV4 S;  4G7Z F;  5IOY A;  3F8M A;  3MCZ A;  2NVQ J;  1I39 A;  2DQR A;  1LEB A;  1Y8R B;  2PN6 A;  5EG0 B;  1IN4 A;  5JLW A;  2VB6 A;  1J09 A;  1USS A;  2DTR A;  1FOK A;  2ZXI A;  5BQT A;  2MH2 A;  1WSU A;  2JK3 A;  4HX4 A;  2VBY A;  1VI0 A;  3FDY A;  1UCR A;  1OCT C;  3ZCO A;  1FP2 A;  3CF2 A;  3QU3 A;  3W6J B;  2R5Z B;  2XPW A;  3CZ6 A;  5F08 A;  1R23 A;  5B3S H;  1YRN A;  2GQQ A;  5IYD J;  3DF8 A;  1WH5 A;  2UV1 A;  4ASN A;  4D5F A;  3B73 A;  4M3B A;  2VUM J;  1J7K A;  2GIV A;  4FIS A;  1GXQ A;  5DCF A;  4JX5 A;  2DPD A;  4P5O A;  3TO9 A;  4Y17 A;  1I50 J;  2EPF A;  2VOO A;  3WE3 A;  2A68 F;  4XON A;  3NWS A;  3P9C A;  2O5R A;  2XKP A;  2XAG A;  3KP4 A;  1DP3 A;  4MQ9 F;  4U7D A;  2D45 A;  1R1T A;  3ULQ B;  3S3O A;  3M4O J;  3BRO A;  3CES A;  4M9S A;  3ESW B;  2QSF X;  1BI1 A;  3W3C A;  2EK5 A;  5J1Y A;  3HXL A;  2Z9O A;  4XLN F;  4G6D A;  3FXJ A;  3HUG A;  1AU7 A;  2QSH X;  1MMG A;  2BVL A;  4PJ0 C;  4A3M J;  1KU3 A;  1ZAR A;  1ZGW A;  1SEU A;  3RSN A;  3IC7 A;  2CW8 A;  2K85 A;  1SVM A;  2W48 A;  5CVU A;  5FD5 A;  1W36 D;  3OYE A;  4HPQ A;  3ONQ A;  4FTH A;  3C1D A;  1BOA A;  3GME A;  1X3Z B;  3QQA A;  3F8F A;  4L5E A;  5D5X B;  4BQO A;  5JHU A;  3G3Z A;  1IV6 A;  2STW A;  2X6W A;  1SFX A;  3DLA A;  1XPX A;  1SD6 A;  1NK3 P;  3IRQ A;  2I10 A;  1NG7 A;  4MIM A;  1SAN A;  2HR3 A;  3I53 A;  3OYC A;  3W2V A;  2KDZ A;  1SD5 A;  5H2F C;  3OYK A;  4LK1 F;  3BR1 A;  4BBR J;  4XRM A;  1IRG A;  5BPI A;  5JI6 A;  2R7S A;  3C2H A;  1MD0 A;  1IRF A;  3IAM 2;  2R5Z A;  3HOW J;  3QYB A;  1VQO I;  4CSW A;  3DU5 A;  3J80 K;  1E3P A;  4GXO A;  5F0H A;  4IXA A;  1C0W A;  1FMV A;  3ABU A;  1R6R A;  4QPQ A;  1A6Q A;  2L9R A;  2O03 A;  4BJT A;  4A3E J;  2EBI A;  2EFP A;  4KIB A;  3K1P A;  1V55 H;  5IOZ A;  1R58 A;  3HGY A;  4B1R A;  2CV0 A;  2VBX A;  1VFC A;  2IA2 A;  4XQF A;  3QOP A;  2XRL A;  1ZKG A;  4MQV A;  2HVR A;  2CQQ A;  4B43 A;  1U8B A;  5JHF A;  4K2E A;  2X48 A;  3KET A;  2M34 A;  1BJZ A;  4XMY A;  4A12 A;  2Q0O A;  2HOS A;  2GBY A;  2W00 A;  2NYX A;  1HW5 A;  5LGU A;  3DTK A;  3KYL A;  1P4A A;  2LBF A;  5E17 F;  1LDD A;  1TC3 C;  4S04 A;  5D6E A;  1YOV B;  2X1C A;  3S8P A;  4R79 A;  1B1B A;  2M4K A;  3HRU A;  1J0R A;  3PO3 J;  4X6A J;  2VL8 A;  2E2I J;  1T38 A;  3V42 A;  4BL0 B;  3WTX C;  2JVG A;  4AID A;  2HOE A;  1MH3 A;  3ABM H;  5HLH A;  2CG4 A;  5IY5 H;  1OCZ H;  1LDK B;  2KIM A;  2YUS A;  3S2H J;  2Z3Y A;  5HS8 A;  4A6D A;  3E6M A;  4LK0 F;  4NQW B;  4MHG A;  2EFN A;  3TO7 A;  1ORK A;  5F04 A;  3JRI A;  1Z6R A;  4XRS G;  2OQG A;  4D0P A;  1FC3 A;  3FXK A;  3W6K B;  3F22 A;  4P1W A;  2DA1 A;  2LG4 A;  2Y0S N;  4L0Z B;  3MN2 A;  3LSR A;  1IDY A;  3H36 A;  1QZY A;  2XAJ A;  1ETO A;  1G3W A;  2F2E A;  4I76 A;  3WU2 C;  2FU4 A;  3ZQQ A;  5K5Q A;  1ENH A;  3PSI A;  3L09 A;  3M07 A;  4BHB A;  4PK4 A;  2CUE A;  2DCE A;  4C3I J;  1PUF B;  3CD6 I;  3ZGK A;  4NB5 A;  2FQ4 A;  1SFU A;  2M45 A;  4B4C A;  1IN8 A;  1GVD A;  2G7U A;  3GFI A;  1X1D A;  4D9J A;  4L9T A;  3VDX A;  3BCA A;  3VB2 A;  5FKK A;  3HKZ A;  4EMS A;  1WHU A;  2E1M B;  2E1C A;  5KHD A;  3PQJ A;  2I8D A;  2F5F A;  4C3H J;  2VKD A;  3JAM Z;  3JAM K;  1I1S A;  3BG6 A;  2DA5 A;  3LMM A;  3V7R A;  2KIF A;  4IJA A;  2HTJ A;  5J1R A;  2PBI A;  4YEL A;  1OLT A;  1D1A A;  4CDG A;  3L1P A;  2FXA A;  4UNO A;  4RAZ A;  4KIS A;  2JUG A;  4ZDL A;  1FOY A;  1DDN A;  2L9N A;  4KMU X;  2UXX A;  2BY2 A;  4ON0 A;  2R7Z J;  3OYL A;  3ZMT A;  5GTH C;  2DMT A;  3IV5 A;  1RZ4 A;  3E3V A;  3K10 A;  2ZXJ A;  4HF0 A;  3FHZ A;  1Z7U A;  2JPB A;  4EJT A;  3VOD A;  2ZME B;  3MKZ A;  2EIM H;  1ZGJ A;  2IXS A;  4R8H A;  4BE0 A;  3ZR8 X;  4E7H A;  1HW2 A;  5E3L A;  2B7E A;  4FET A;  3L00 A;  2QQB A;  5TJJ A;  1G6N A;  5CYV A;  4RLQ A;  4NQW A;  1TZL A;  3K4J A;  2DQL A;  3HB9 A;  3IH2 A;  2L4M A;  3JRH A;  4LB5 A;  3CQZ J;  3OY9 A;  3AKZ A;  1HLV A;  4JP0 A;  4B09 A;  2CUF A;  4BKX A;  4HF1 A;  4I09 A;  3I9V 2;  3SZP A;  4HNV A;  2LF7 A;  1BA5 A;  2J5P A;  2KZG A;  1RI7 A;  1ZGA A;  2DYS H;  4XKV A;  1EH8 A;  2GXB A;  4XLF A;  1QRY A;  3S1Q J;  2L3D A;  4QIW N;  3H0G J;  2MC3 A;  3OWT A;  5DTD A;  4FAS D;  3HOU J;  5E79 C;  2IRF G;  5JVG F;  1X58 A;  2COM A;  1F5T A;  2GIZ A;  5FKM A;  1S3J A;  3LSJ A;  4CCL A;  2DFH A;  3LA7 A;  3BJA A;  2CUZ A;  1JKR C;  2OA4 A;  3CMY A;  3OIO A;  4O5V A;  1G3Y A;  2LY9 A;  1TLH B;  2KLO A;  2VQG A;  4BUP A;  3KIO A;  2ACJ A;  1K6O A;  3N05 A;  2ISZ A;  1UG2 A;  1VF9 A;  2TRT A;  2DFI A;  4EM0 B;  1QBJ A;  5A2Q K;  4F52 A;  4MNU A;  1SD7 A;  2KJB A;  3ERM A;  4R1H A;  4WXC A;  5KNL A;  3OYD A;  3WE2 A;  1LE8 B;  1NK2 P;  3OOP A;  1TWG J;  1QHH D;  3I58 A;  2LRD A;  1QVT A;  1XGM A;  5EZG A;  5K5R A;  4E7K A;  2V1U A;  2K3P A;  4ESJ A;  1P9Q C;  5E1W A;  4HSR A;  3T0Y A;  5M5X J;  3KP3 A;  4UY8 I;  1QPI A;  4L9J A;  4ZZL A;  4F7Z A;  5LD2 C;  1YIJ I;  3CP8 A;  2Y75 A;  5HDG A;  1VQ6 I;  2OQR A;  5LLQ A;  5HNH A;  5E8G A;  2K3F A;  2DT5 A;  3RKX A;  4CCO A;  2BYV E;  1AA7 A;  2V9P A;  4OWR B;  3CUQ C;  3OYF A;  3U1D A;  3CMM A;  1J2X A;  3DEW A;  2RNJ A;  4PJL A;  4YFK F;  2JWT A;  1HQC A;  4U0W A;  3KFW X;  1U5T B;  2JA5 J;  1H9T A;  3ZPL A;  4Y52 J;  1SD4 A;  2FSW A;  2PG4 A;  4NUB A;  3CC4 I;  2HTS A;  4XNF A;  3LWF A;  2QQ9 A;  4OMZ A;  4IZZ A;  3HGG A;  1LEA A;  1ETW A;  2MD0 A;  4I7H A;  3SDG A;  1OKR A;  2ZSH B;  4HDU A;  2EV6 A;  4XKW A;  1D5V A;  5FFX A;  1LJ9 A;  2DXI A;  4C2U A;  2V9V A;  3RTR A;  3DWL E;  4G6Q A;  1IC8 A;  3OIQ A;  1UAA A;  5L3F A;  3H0D A;  4XK4 A;  3WTZ A;  4KYW A;  2GWR A;  3QYE A;  2A69 F;  5JFR A;  4U0V A;  3A0B C;  3CCU I;  2VKE A;  4HX8 A;  3RQ4 A;  1G59 A;  3BCB A;  4Z6Y A;  4P55 A;  4HYE A;  3ZMD A;  2QSG X;  1ETY A;  2K5C A;  2E1O A;  1UEL B;  2NS0 A;  3U1K A;  3D0S A;  2MH9 A;  4IHT A;  4HNT A;  5CQG A;  2OZ6 A;  5F6F A;  4S0H B;  2Y9Y A;  2VQC A;  5AIP A;  5D6F A;  1LE8 A;  2ELJ A;  2E19 A;  4LIV A;  5K5O A;  1FP1 D;  2FNP A;  2FRH A;  2EZI A;  4A3I J;  1X1B A;  2O61 A;  1EH7 A;  2ZJ2 A;  1XC5 A;  2CGP A;  1Z3X A;  4OOI A;  2EZH A;  5LRR A;  2L54 A;  3WU0 A;  3FM5 A;  4U88 A;  1YX3 A;  1FNN A;  1R4M B;  2E2J J;  4ZDO A;  5CPR B;  1VND A;  1HC8 A;  2L9S A;  4DBQ A;  1VQM I;  2ZME C;  2VLA A;  3CC7 I;  2WY7 Q;  3V8J A;  5FRM A;  2XGC A;  3ZMV A;  5AON A;  5KVR A;  1ON2 A;  1T0F C;  3L9F A;  1T95 A;  2Z1D A;  2DA4 A;  3GO5 A;  4KFC A;  4JX6 A;  3UNG C;  3PJR A;  3WOD F;  4I0B A;  3E5Q A;  2GOX B;  2RRE A;  2LR8 A;  3K4L A;  4KA4 A;  2HDC A;  2ADU A;  4G9Y A;  3ZQ7 A;  1B8I A;  4JX4 A;  3FMQ A;  2R7F A;  2VJJ A;  1DUX C;  1XCV A;  4HG2 A;  3S2W A;  3S1R J;  3L2Q A;  1Z77 A;  5AIQ A;  3LSK A;  2JMW A;  2XGE A;  3FXM A;  4YRV A;  2RC4 A;  2P4W A;  2FBH A;  5LHG A;  2A3S A;  3DEU A;  1IDZ A;  3F8B A;  1R7J A;  3LQQ A;  2KJC A;  3TP0 A;  2V1X A;  2R7W A;  3L2R A;  3BTC A;  2FML A;  4KIT B;  1MMD A;  3HOV J;  2DK5 A;  2H1L A;  1FOW A;  3HSE A;  2DAO A;  2H1K A;  2VXZ A;  3DU6 A;  3KPH A;  2E7W A;  4E7S A;  1BJA A;  4UXN A;  2XC7 A;  3ASO H;  1QA6 A;  1FJL A;  1BR1 A;  3EPZ A;  2Q8K A;  5LEK A;  1E3O C;  4IHW A;  4BDZ A;  1W4M A;  2R5Y B;  5F0C A;  1BIA A;  2ID3 A;  1FSE A;  1RKW A;  2WWY A;  3PNT A;  2WAQ N;  1IG7 A;  1KQ8 A;  2IA1 A;  1ONV A;  2L2O A;  2BHY A;  3O3K A;  4OIP F;  3OYM A;  3ZQG A;  3RPQ A;  1TT0 A;  1X1P A;  2WAF A;  3JRG A;  3HOZ J;  2LSO A;  3GTJ J;  2QKL B;  2KKO A;  5CLS A;  4B8X A;  1IN7 A;  1WJB A;  3J7Z I;  2H6C A;  4N9H A;  4OIR F;  4O6J A;  3IH4 A;  1FBQ A;  4E7J A;  1P92 A;  3PFY A;  3E6B A;  3F6V A;  4NC6 A;  5CJ9 A;  4CXF A;  3IHU A;  3NAU A;  4PZJ A;  5FKO A;  3E5X A;  4D7M A;  2GXG A;  1BW5 A;  1OIS A;  3JSO A;  2CH0 A;  1U5T C;  1AKH B;  1WJC A;  4L18 B;  2Z5U A;  2FD5 A;  2P5K A;  2L0K A;  3IKV A;  1JHH A;  4Y15 A;  5J8F A;  2NNY A;  3COA C;  1HCR A;  3C2B A;  5CQE A;  4XOT A;  3MEX A;  5D4S A;  2DI3 A;  2BW3 B;  3LSG A;  2RN7 A;  3WG7 H;  4HNU A;  2JA8 J;  2DFE A;  3FBN B;  4M73 A;  3WHC A;  1O3S A;  3E1S A;  4II2 A;  2JVH A;  3A03 A;  1ZN2 A;  3LST A;  2CSO A;  3CJN A;  2FOW A;  2WAQ A;  3BG9 A;  4B3X A;  2P6S A;  2RVC A;  4DIQ A;  3GYH X;  1HKT A;  2EH3 A;  1FX7 A;  4LD5 A;  2ZC2 A;  2AQE A;  2K02 A;  2CU7 A;  3BY6 A;  4M9Z A;  3PUF A;  3EET A;  1STZ A;  1P2F A;  4QSH A;  1OCC H;  3MKY B;  1GT0 C;  1FT9 A;  2R5Y A;  1K83 J;  4XOR A;  2JA7 J;  2BZT A;  1GDT A;  1WVR A;  4QLC U;  3BP8 A;  4EQQ A;  5H20 A;  2L01 A;  2L9V A;  1QZZ A;  4L5J A;  5HVQ C;  3K70 D;  3S2D J;  3VYR B;  1R36 A;  2JT1 A;  3BZK A;  1UHM A;  2CQN A;  3TQN A;  2RQP A;  3HHH A;  5FFZ A;  3HOT A;  1MDM A;  3DTE A;  5M5Y J;  5M5W J;  2A6H F;  1J59 A;  3MMY B;  3GUD A;  4HQM A;  5HDK A;  5ICE A;  4C2T A;  4DYQ A;  2QUF A;  1ZG1 A;  5LFA A;  2DLL A;  1JXS A;  5K7F A;  2OU2 A;  4I99 C;  3HSR A;  4QWQ A;  1W5S A;  2HQN A;  5EEH A;  3CLQ A;  3ZXS A;  1Z6T A;  2PMZ N;  2Y69 H;  5DUI A;  3G73 A;  4RS8 A;  1Y6I A;  3OR2 C;  1S9H A;  2VBZ A;  5D5U B;  3BQY A;  2F5V A;  2HDD A;  4HQE A;  2VKV A;  4XLP F;  1UB9 A;  1N25 A;  4FCY A;  2JQ7 A;  2VPL A;  1AKH A;  1ZLK A;  4EJV A;  3DLL F;  4Q4Z F;  2X6O A;  1PDN C;  2V1N A;  3BR2 A;  2HYJ A;  2LRE A;  4A0Y A;  2G9W A;  1RR7 A;  5KAI C;  4AWX B;  3LFK A;  1BI3 A;  2M87 A;  1FTZ A;  1L3L A;  2K9M A;  1OFC X;  1S8N A;  3OS1 A;  3LFU A;  3F9K A;  4KIC A;  4A2U A;  5HNF A;  3D1N I;  2CQK A;  4AYB N;  2ZSI B;  3OMY A;  4BXU A;  3RZO J;  3R0J A;  4M71 A;  2L7Z A;  3EUH A;  2DDB A;  4KDP A;  1AOY A;  1KQ0 A;  4IRH A;  2A5Y B;  3GTO J;  4CHU A;  3RCO A;  4G7O F;  1V4R A;  2DU9 A;  3TDU C;  2G7H A;  3TW6 A;  2DA3 A;  2DA7 A;  2QGU A;  5EF6 A;  2XUB A;  3S3M A;  5D4R A;  1Y0U A;  4QTR A;  4NHJ A;  3BQZ A;  1L0O C;  3KLN A;  2W57 A;  1Z7L A;  2DA2 A;  4AVP A;  1GV5 A;  2W1O A;  2H27 A;  3S1N J;  2IW5 A;  4E7I A;  4DYC A;  2PMZ A;  4BAY A;  1W1W E;  1DP7 P;  2B9S A;  5J47 A;  2GA1 A;  1HOM A;  1G4D A;  2BY0 A;  3VFZ A;  4XBF A;  2L7F P;  1WRJ A;  2CWE A;  1U9N A;  2M8G X;  1NG6 A;  4XOP A;  4CCJ A;  4UB8 C;  1XB4 A;  2IS2 A;  3I5U A;  1MMN A;  2DOA A;  3J7A Y;  5ERI A;  3ZQL A;  3FBI B;  2HVQ A;  5FD6 A;  1FWZ A;  3ML6 A;  3BR5 A;  2XAH A;  4EV0 A;  2PJR A;  4KUM A;  3GTK J;  2DTZ A;  3JTG A;  1SAU A;  2PMH A;  2Z33 A;  3K4C A;  4A3F J;  2ELH A;  3KEY A;  2LMD A;  4AYB A;  3ZN0 A;  1JJ8 C;  4PJM A;  1YIT I;  1TQM A;  1Q1V A;  2VJI A;  5BS6 A;  2LKP A;  3E6D A;  2D5V A;  4BJ6 C;  2PQ8 A;  4N0B A;  4XIC A;  1YW7 A;  2ICW G;  1WJD A;  2Y2Z A;  3Q0V A;  4BJ5 C;  2GA2 A;  3RIR A;  2WC2 A;  1HKQ A;  2CV2 A;  3OS2 A;  1LQ1 A;  1IN6 A;  2HYF A;  4GGG A;  4J19 A;  2LBF B;  5M3F J;  1XGN A;  3I71 A;  2NOG A;  4HZF A;  2KHM A;  2TCT A;  4DW6 A;  4PSW A;  4ESF A;  1XSX A;  4BXF A;  1T98 A;  2VAS A;  4LIT A;  3JCU C;  3IWF A;  1ZR4 A;  1D1B A;  1MGT A;  1ZRE A;  3G1O A;  1SC7 A;  1O3T A;  2JTV A;  2LFB A;  4RGX A;  2H6B A;  2DMU A;  1MMA A;  3T8R A;  4KJZ A;  4F92 B;  3LNQ A;  3CDI A;  2DT6 A;  3GZN B;  5H6Q A;  4IO9 F;  2LP0 A;  3D5S C;  3F8C A;  3CCY A;  2DOF A;  4RLF A;  3OSF A;  2DDA A;  3JRC A;  4EGZ A;  5FRN A;  3ISP A;  4CIC A;  4HF2 A;  4OAY A;  3C7J A;  3MWM A;  2W4S A;  2R0Q C;  4XLE A;  1O7L A;  3L7W A;  3VOE A;  2HWV A;  3SXY A;  4DZJ A;  1TQI A;  2ESH A;  3JR9 A;  3CCJ I;  4M3D A;  1V54 H;  3HYI A;  4YIR X;  3J80 Z;  3OIP A;  5HDN A;  5EEA A;  1D5Y A;  2DW4 A;  2MYS A;  1YJN I;  1S72 I;  3NAR A;  3JRF A;  4UVC A;  1R1U A;  2HPI A;  2F48 A;  3S3N A;  1G2H A;  3SZG A;  1S29 A;  4AD9 A;  4CA0 A;  4PFO A;  1JT0 A;  4CCN A;  1T39 A;  1NH3 A;  3FF5 A;  2JA2 A;  3MD2 A;  4FX4 A;  4B48 A;  2YX7 A;  1GV2 A;  2FE3 A;  3LSM A;  2OBP A;  4YG2 F;  1IZ1 A;  2ESN A;  3SHF A;  2F5D A;  1KON A;  2E5N A;  4OMY A;  1HXD A;  2MFZ A;  3ZQC A;  3HKZ N;  4DZP A;  3M7G A;  4A0X A;  2OCE A;  1FYM A;  2RKH A;  3P5J A;  3WG9 A;  3HPG A;  4EAT A;  1IO2 A;  3CF5 F;  4IHX A;  4WF2 A;  4MFD A;  1DPR A;  1BR4 A;  5FLM J;  1XGS A;  4ZTF A;  1OCR H;  3CCQ I;  2LTP A;  1BBY A;  3I56 I;  2EIK H;  4BQA A;  4AVZ A;  1R71 A;  1R49 A;  1CQT A;  4A6E A;  2ECC A;  2XB5 A;  4ABZ A;  2E1N A;  5CVJ A;  4XN0 A;  5GAG J;  4OU0 A;  1W5C C;  2ZBK A;  4E4H A;  2L5Q A;  3EUK L;  2VKH A;  1FZP B;  2VE8 A;  3I59 B;  2RDP A;  3BTL A;  3VSK A;  4OIO F;  2KQR A;  3BTJ A;  2HQ5 A;  4BH9 A;  3IRR A;  2KDO A;  3WTW C;  2QVO A;  4LLL A;  1WJF A;  2V1D A;  1WKM A;  3F6O A;  1IUF A;  1X1C A;  4FQG A;  4HA8 A;  5DM6 F;  1TW3 A;  2E5Z A;  2MBF A;  4L9N A;  1I27 A;  1EH6 A;  4B3A A;  2I5U A; 
#chains in the Genus database with same CATH homology
 3V4G A;  1G3T A;  3WGH A;  3HRM A;  2FOK A;  4CYD A;  1F1Z A;  2HZT A;  1HW1 A;  2UXN A;  5L3D A;  4EJU A;  5DD4 A;  3KZZ A;  4IRG A;  1I1G A;  4PGH A;  2K27 A;  5E1Z B;  4L5I A;  5DYM A;  5FLX Z;  5FLX K;  2O3F A;  2EJR A;  3Q9S A;  2MA3 A;  2AXL A;  3K9T A;  2EA4 A;  2LF8 A;  4ENK A;  4ZYH A;  4ENM A;  1R5G A;  3DQV C;  2R7D A;  3ZP5 A;  3RKY A;  1HST A;  1RIO H;  3J81 K;  3I59 A;  1R22 A;  4CZZ A;  1LVA A;  4L9V A;  2IP2 A;  1I6X A;  3GFM A;  3GWZ A;  3ABT A;  1B4A A;  1J9I A;  2EWN A;  4RB1 A;  3BJO A;  2P7V B;  2FEZ A;  3H3Z A;  3MAJ A;  4GO1 A;  3RI4 A;  5A2Q Z;  1IN5 A;  2AS5 F;  4WK8 F;  4BNC A;  1HKS A;  3N4M A;  1XD7 A;  1YW9 A;  3RJP A;  2V79 A;  5BOX A;  1XSD A;  2P5V A;  2J5O A;  2XHK A;  5DCM B;  1MJB A;  1X3U A;  3LAP A;  2PI0 A;  1V3F A;  2A61 A;  4Q47 A;  1LB2 A;  2YSR A;  4HV6 A;  5FO5 A;  4LLN A;  3P9K A;  3KCC A;  2XAQ A;  3QRF F;  2FBK A;  5ILV A;  3RDI A;  1ZRF A;  3CO6 C;  1REP C;  5JR3 A;  2ZNZ A;  2PLY A;  2PJP A;  3HRT A;  3KP6 A;  4ZYD A;  1CF7 B;  1SMY F;  1OR7 A;  2C6Y A;  2EV5 A;  2A07 F;  1R1V A;  3K1N A;  3WTY C;  1KA8 A;  2V6C A;  2DK8 A;  2D1H A;  3LQR A;  4YIF A;  1P4X A;  2NAZ A;  5DDG A;  3K69 A;  1MKM A;  2XKO A;  1P4W A;  2BEO A;  4U0Y A;  3ZMS A;  4LB6 B;  1HSJ A;  1S7O A;  4M6X A;  5IT3 A;  5DCM A;  4P9F A;  3PQK A;  4EM2 A;  4HW0 A;  3CDH A;  3I0T A;  1UHW A;  3WTU C;  1Z91 A;  3FXQ A;  5LRS A;  2MLK A;  3PFI A;  3Q9V A;  3HOS A;  1CF7 A;  1JGS A;  2XIG A;  1BI0 A;  3DPL C;  2EFO A;  4KIF A;  1GVJ A;  1FSH A;  3F8N A;  3E6C C;  3I4P A;  4IF4 A;  3WU1 B;  3LAJ A;  1BC8 C;  2XAF A;  1F4K A;  3ERE D;  4KNY A;  5F1R A;  1W7P D;  1FPQ A;  2HKO A;  3GFJ A;  2Q2E A;  4HLX A;  3FWE A;  3V8K A;  4TV7 A;  4UVB A;  1UFM A;  4Q5S F;  1QQI A;  4WX9 A;  2PEX A;  3DP7 A;  4UVA A;  5E18 F;  1U2W A;  1U3E M;  1H0M A;  3OV8 A;  5LEJ A;  2BGC A;  3TOB A;  1MDM B;  2M1B A;  4CGZ A;  2YX4 A;  5K1Y A;  1J75 A;  3KLO A;  4MEY F;  2ETH A;  3F21 A;  5E1X A;  3F72 A;  4RAY A;  1K78 B;  1IW7 F;  3ZMU A;  3EYY A;  2HQR A;  3DPT A;  1B9M A;  5TRD A;  1Z1D A;  2HS5 A;  4LFU A;  5DUK A;  3TGN A;  3MZY A;  2QWW A;  1W7P B;  3H92 A;  3NQO A;  4BYY A;  1KU7 A;  2BV6 A;  4FHT A;  1TW2 A;  2P5L C;  2Y48 A;  1H9G A;  4A5M A;  4EJO A;  4HOB A;  2JZY A;  3QPT A;  1AWC A;  4ENN A;  5CVI A;  3JSP A;  4AIJ A;  1O3Q A;  2MLG A;  2BBY A;  2H94 A;  2ZFW A;  5LGN A;  4H0E A;  1B9N A;  5DEQ A;  1F9N A;  2QYO A;  5BPD A;  2XVC A;  2QQA A;  1T6S A;  4WWC A;  1K78 A;  2M5W A;  1ZRD A;  1XDS A;  4LGW A;  2L4A A;  2HEO A;  2NNN A;  1D8J A;  5J6X A;  3KZY A;  4OIQ F;  3SZT A;  2O0Y A;  3M8E A;  2QEN A;  3R6S A;  1YS7 A;  4M74 A;  1T2K A;  3C3W A;  4JBA A;  1W7P A;  3V8L A;  1FBU A;  1FY7 A;  1VTN C;  2HFH A;  3IKT A;  3EDP A;  3JW4 A;  2EFQ A;  2OD5 A;  3F23 A;  5CVV A;  1B6A A;  1DPU A;  1KQ9 A;  1IXR C;  5F64 A;  1MJA A;  1R00 A;  4YFX F;  3Q5F A;  3TDZ C;  3C18 A;  2X0L A;  1IXS B;  3DKW A;  5E8I A;  3JTH A;  2D1V A;  1Q1H A;  3HSF A;  1FYK A;  3N97 A;  2STT A;  1ULY A;  1O57 A;  3IL2 A;  1BM9 A;  2K7L A;  4G94 A;  5ICG A;  4RB2 C;  1TTY A;  2R3S A;  4UV9 A;  4GCV A;  5ILU A;  4JQF A;  4CO8 A;  1Z9C A;  3QP5 A;  2WTE A;  2UWM A;  4HBL A;  5E20 A;  1G3S A;  1BC7 C;  3WTV C;  3KEO A;  1U6G A;  3NRV A;  1XMA A;  4Q48 A;  4RB3 C;  1ZG3 A;  2QM3 A;  3CUO A;  1YO5 C;  4YII A;  1YTY A;  2VOD A;  2CO5 A;  4S05 A;  4RB0 A;  4LJZ F;  5DD8 A;  4U7B A;  4ZZD A;  3BWG A;  1TQP A;  1PUE E;  4LG0 B;  4WCG A;  2PFB A;  3QPH A;  3CLO A;  2OZU A;  1D3Y A;  2P8T A;  2QZ8 A;  1XCB A;  4N9I A;  5LBQ A;  2NRA C;  1O7F A;  1YFH A;  2ZCW A;  3J7A O;  1QNT A;  5J8C A;  4RGU A;  2XGX A;  5IT9 K;  5IT9 Z;  2K4J A;  4JK1 X;  3FMR A;  4RGR A;  1KGS A;  5HOO A;  2CYY A;  4BHP A;  1D8K A;  1BN5 A;  2RV8 A;  1A04 A;  2FMY A;  2QBY B;  3ELK A;  2YPR A;  3BOQ A;  5HS7 A;  1IAW A;  2HYG D;  2YU3 A;  3KE2 A;  1WWX A;  4LMY A;  1ZRC A;  2VOP A;  5D8L B;  4I01 A;  2O6G E;  5D5V B;  3M8F A;  4GYG A;  1SAX A;  4A0Z A;  1RUO A;  3ZMZ A;  2P7C B;  4O3M A;  2XRO A;  2JPC A;  2W85 A;  2VBW A;  2LNB A;  5EEG A;  1YLF A;  4EJW A;  3F3X A;  3HTS B;  2M8E A;  4EVI A;  3CUQ B;  4LG0 A;  3R0A A;  3T1B A;  3FXU A;  1PP7 U;  3RPU A;  2E7X A;  2X4H A;  1OYY A;  3B02 A;  3FXR A;  1QGP A;  2ZKZ A;  3TO6 A;  5LGT A;  3QAH A;  2VT2 A;  1OYI A;  5L3E A;  4MTE A;  2EB7 A;  1KYZ A;  3VEP A;  2WV0 A;  2VC1 A;  2QBY A;  1XDU A;  3RKW A;  2EV0 A;  4ZYE A;  1FYL A;  4ZYG A;  5BMZ A;  4BHC A;  4UHT A;  3E97 A;  2GZW A;  4I2O A;  2Y0M A;  1OPC A;  5LHI A;  2DO7 A;  5ICC A;  3J81 Z;  1WI9 A;  2FNA A;  2XAS A;  4FT8 A;  3O2P E;  1OYW A;  2JRT A;  3NEU A;  3CUQ A;  1FBS A;  3EYI A;  1IUY A;  4HAM A;  2KRF A;  4KN4 X;  1KU2 A;  2A6E F;  2B0L A;  2UZK A;  5L3B A;  3O6B B;  3R4K A;  5FGM A;  3TKY A;  3MQ0 A;  1JHF A;  1WQ2 A;  4XSX F;  5D8K B;  1FLI A;  1XGO A;  1QO0 D;  2FBI A;  3ECO A;  3FZV A;  4A5N A;  2DBB A;  2VON A;  1YS6 A;  4WXH A;  1EV7 A;  2OAZ A;  2IT0 A;  1JE8 A;  1U8R A;  1TBX A;  1XMK A;  2K4B A;  4ENJ A;  1YYV A;  1W5T A;  2VT3 A;  3MFK A;  3RYR A;  2BE5 F;  2ZNY A;  1TNT A;  5LHH A;  2VN2 A;  3BPV A;  5HLI A;  1QPM A;  2IPQ X;  3QP6 A;  1PP8 F;  4XSZ F;  4AIH A;  2ZME A;  4L0Y B;  4GYI A;  2XRN A;  3HIF A;  3SFZ A;  4G8X A;  1T0F A;  4IVN A;  3BZ6 A;  4HDV A;  2VC0 A;  1I5Z A;  3P9I A;  2LDU A;  4FX0 A;  3MZH A;  4I0A A;  1P6R A;  2ZO4 A;  2IJL A;  3U9G A;  1YG2 A;  2MD5 A;  1S6L A;  2L02 A;  3T5X A;  1NHA A;  4YFN F;  4AIK A;  3FM3 A;  5KK1 A;  2IA0 A;  3REO A;  3FMS A;  3ROU A;  4M72 A;  3L2C A;  1HBX G;  4PGG A;  4OIN F;  2F5E A;  1ZHF A;  2KIU A;  5H6R A;  4E70 A;  3KP2 A;  4I02 A;  4HX7 A;  5D5W B;  4IRI A;  3GZ5 A;  4ETS A;  2F5C A;  3K1M A;  3EQL F;  1TNS A;  1XSV A;  4I98 B;  4M9X A;  3WGG A;  4WXD A;  3HHG A;  4KIG A;  3K0L A;  4MGR A;  1IXC A;  4EM1 A;  3GF2 A;  1R5H A;  4IPA A;  3GFL A;  1E2X A;  2K86 A;  1U5T A;  5HS9 A;  3GVA A;  4KT5 C;  1BI2 A;  1J5Y A;  3R61 A;  4P96 A;  5CVR A;  4EGY A;  4HV5 A;  1O3R A;  3AAF A;  4UV8 A;  5JVT A;  2P6T A;  2W24 A;  2O8X A;  5ICF A;  2D2W A;  3GW2 A;  4Z2Y A;  5HLG A;  3HTU A;  4LLG F;  2IVM A;  2FA5 A;  4PCQ A;  3FX3 A;  3V7S A;  3IWZ A;  3V7C A;  1SFE A;  3QU6 A;  2JSC A;  6PAX A;  2DPU A;  3SQN A;  1XN7 A;  5L3C A;  3GZ6 A;  3P7N A;  3LA2 A;  1U78 A;  3RYP A;  3TOA A;  1KYW A;  3KP7 A;  2CW0 F;  2EFW A;  2YR2 A;  4HLY A;  3BDD A;  4ZH4 F;  4KMF A;  3U2R A;  3GEZ A;  1BIB A;  2GAU A;  1ZLJ A;  1ZYR F;  3GXO A;  1YW8 A;  3M9A A;  4UUV A;  3KP5 A;  3R60 A;  5DV5 A;  5ED4 A;  3LA3 A;  1ON1 A;  3WTS C;  4XRF A;  3E5U A;  3K2Z A;  1B59 A;  2FF4 A;  3DV8 A;  1IF1 A;  3WGI A;  1RNL A;  1SMT A;  1Z05 A;  4KN7 X;  4M6Y A;  3BJ6 A;  1KU9 A;  3ZN1 A;  3GX4 X;  4ESB A;  2FQ3 A;  2RGV A;  2HGC A;  1MJ9 A;  1LNW A;  3WTT C;  1ZG5 A;  3DXJ F;  4MTD A;  1CGP A;  1GHC A;  3ECH A;  3KEQ A;  1ZH5 A;  2HKX A;  3H3U A;  1YIO A;  2TDX A;  3I54 A;  5L3G A;  2QLZ A;  4MEX F;  2W84 A;  1GXP A;  2ISY A;  2M30 A;  1OMI A;  2PMU A;  2VE9 A;  3GLX A;  3T8T A;  2CFX A;  4IHS A;  1ZAO A;  1LDJ A;  3M1E A;  4RGS A;  2H09 A;  3BPX A;  3DFG A;  2Z99 A;  4P9U A;  3HRS A;  1YQA A;  4Y13 A;  3I64 A;  1RUN A;  3CTA A;  1S7A A;  1K79 A;  4DNC A;  1K7A A;  4G7H F;  5FB2 A;  3D5L A;  2EA2 A;  2W25 A;  4DQ2 A;  1MZB A;  5ILS A;  3CO7 C;  1UST A;  1E17 A;  4PDK A;  1ODD A;  2XV4 S;  4G7Z F;  3F8M A;  3MCZ A;  2DQR A;  1LEB A;  2PN6 A;  1IN4 A;  2DTR A;  1USS A;  1FOK A;  5BQT A;  2MH2 A;  1WSU A;  4HX4 A;  2VBY A;  1UCR A;  1FP2 A;  3QU3 A;  3W6J B;  1R23 A;  2GQQ A;  3DF8 A;  4ASN A;  3B73 A;  1J7K A;  2GIV A;  5DCF A;  1GXQ A;  2DPD A;  4P5O A;  3TO9 A;  4Y17 A;  2VOO A;  3WE3 A;  2A68 F;  3P9C A;  2XKP A;  2XAG A;  3KP4 A;  4MQ9 F;  4U7D A;  2D45 A;  1R1T A;  3ULQ B;  3BRO A;  4M9S A;  1BI1 A;  2EK5 A;  2Z9O A;  4XLN F;  4G6D A;  3HUG A;  1KU3 A;  1ZAR A;  3IC7 A;  5CVU A;  5FD5 A;  3C1D A;  1BOA A;  3F8F A;  5D5X B;  5JHU A;  3G3Z A;  2STW A;  1SFX A;  1SD6 A;  3IRQ A;  2HR3 A;  3I53 A;  1SD5 A;  4LK1 F;  1IRG A;  5BPI A;  5JI6 A;  1MD0 A;  1IRF A;  3J80 K;  4GXO A;  4IXA A;  1C0W A;  3ABU A;  2O03 A;  2EFP A;  4KIB A;  3K1P A;  1R58 A;  2VBX A;  2IA2 A;  3QOP A;  4MQV A;  4K2E A;  3KET A;  4A12 A;  2Q0O A;  2NYX A;  1HW5 A;  5LGU A;  1P4A A;  5E17 F;  1LDD A;  4S04 A;  5D6E A;  4R79 A;  1B1B A;  3HRU A;  1J0R A;  1T38 A;  3WTX C;  2HOE A;  5HLH A;  2CG4 A;  1LDK B;  2KIM A;  2Z3Y A;  5HS8 A;  4A6D A;  3E6M A;  4LK0 F;  4MHG A;  2EFN A;  3TO7 A;  1Z6R A;  2OQG A;  4D0P A;  1FC3 A;  3W6K B;  3F22 A;  4L0Z B;  1QZY A;  2XAJ A;  1G3W A;  2F2E A;  2FU4 A;  5K5Q A;  3L09 A;  4BHB A;  4NB5 A;  1SFU A;  2M45 A;  1IN8 A;  3GFI A;  2G7U A;  4L9T A;  3VB2 A;  4EMS A;  2E1C A;  3PQJ A;  2F5F A;  3JAM K;  3JAM Z;  1I1S A;  3V7R A;  2KIF A;  4IJA A;  2HTJ A;  2PBI A;  4CDG A;  2FXA A;  4UNO A;  4RAZ A;  1DDN A;  4KMU X;  4ON0 A;  2UXX A;  3ZMT A;  1RZ4 A;  3E3V A;  4HF0 A;  2ZXJ A;  3FHZ A;  4EJT A;  1Z7U A;  2JPB A;  3VOD A;  2ZME B;  1ZGJ A;  4R8H A;  1HW2 A;  3L00 A;  2QQB A;  5TJJ A;  1G6N A;  5CYV A;  4NQW A;  2DQL A;  4LB5 A;  2L4M A;  4B09 A;  4HF1 A;  4I09 A;  3SZP A;  2LF7 A;  2J5P A;  1RI7 A;  1ZGA A;  1EH8 A;  2GXB A;  2L3D A;  2MC3 A;  2IRF G;  2COM A;  1F5T A;  1S3J A;  3LA7 A;  3BJA A;  2OA4 A;  4O5V A;  1G3Y A;  1TLH B;  2ACJ A;  2ISZ A;  1K6O A;  2DFI A;  4EM0 B;  1QBJ A;  5A2Q K;  4MNU A;  1SD7 A;  2KJB A;  4R1H A;  4WXC A;  3WE2 A;  3OOP A;  3I58 A;  1XGM A;  5K5R A;  2V1U A;  4ESJ A;  5E1W A;  3T0Y A;  3KP3 A;  4L9J A;  4ZZL A;  4F7Z A;  2Y75 A;  5HDG A;  2OQR A;  5LLQ A;  5E8G A;  2DT5 A;  3RKX A;  2BYV E;  3CUQ C;  3U1D A;  1J2X A;  2RNJ A;  4YFK F;  1HQC A;  4U0W A;  3KFW X;  1U5T B;  1H9T A;  3ZPL A;  1SD4 A;  2FSW A;  2PG4 A;  2HTS A;  3LWF A;  2QQ9 A;  4OMZ A;  1LEA A;  4I7H A;  1OKR A;  4HDU A;  2EV6 A;  1D5V A;  5FFX A;  1LJ9 A;  2V9V A;  3RTR A;  4G6Q A;  5L3F A;  3WTZ A;  4KYW A;  2GWR A;  2A69 F;  5JFR A;  4U0V A;  4HX8 A;  4P55 A;  4HYE A;  3ZMD A;  2NS0 A;  3D0S A;  2MH9 A;  4IHT A;  2OZ6 A;  5F6F A;  5AIP A;  5D6F A;  5K5O A;  1FP1 D;  2FNP A;  2FRH A;  2O61 A;  1EH7 A;  2ZJ2 A;  2CGP A;  4OOI A;  5LRR A;  2L54 A;  3WU0 A;  3FM5 A;  4U88 A;  1FNN A;  3V8J A;  3ZMV A;  5AON A;  5KVR A;  1ON2 A;  3L9F A;  3GO5 A;  4KFC A;  3WOD F;  4I0B A;  3E5Q A;  4KA4 A;  2HDC A;  2ADU A;  4G9Y A;  3ZQ7 A;  3FMQ A;  2R7F A;  1DUX C;  1XCV A;  3S2W A;  5AIQ A;  2RC4 A;  2P4W A;  5LHG A;  2FBH A;  2A3S A;  3DEU A;  3F8B A;  1R7J A;  3LQQ A;  2KJC A;  2V1X A;  2FML A;  2DK5 A;  3HSE A;  2DAO A;  2VXZ A;  2E7W A;  1BJA A;  4UXN A;  2Q8K A;  5LEK A;  1W4M A;  1BIA A;  1FSE A;  2WWY A;  1KQ8 A;  2IA1 A;  1ONV A;  3O3K A;  4OIP F;  3RPQ A;  2LSO A;  2KKO A;  5CLS A;  4B8X A;  1IN7 A;  2H6C A;  4N9H A;  4OIR F;  4O6J A;  1FBQ A;  1P92 A;  3E6B A;  3F6V A;  5CJ9 A;  4CXF A;  3IHU A;  4PZJ A;  3E5X A;  2GXG A;  3JSO A;  1U5T C;  4L18 B;  2Z5U A;  2P5K A;  3IKV A;  1JHH A;  4Y15 A;  5J8F A;  2NNY A;  3COA C;  3MEX A;  5D4S A;  2DI3 A;  2RN7 A;  4M73 A;  1O3S A;  1ZN2 A;  3LST A;  2CSO A;  3CJN A;  2P6S A;  2RVC A;  3GYH X;  1HKT A;  1FX7 A;  4LD5 A;  2K02 A;  3BY6 A;  4M9Z A;  3EET A;  1STZ A;  1P2F A;  1FT9 A;  4QLC U;  3BP8 A;  4EQQ A;  5H20 A;  2L01 A;  4L5J A;  1QZZ A;  5HVQ C;  1R36 A;  2JT1 A;  1UHM A;  3TQN A;  2RQP A;  3HHH A;  5FFZ A;  3HOT A;  1MDM A;  1J59 A;  2A6H F;  3GUD A;  4HQM A;  5HDK A;  5ICE A;  2QUF A;  1ZG1 A;  1JXS A;  2DLL A;  2OU2 A;  3HSR A;  4QWQ A;  1W5S A;  2HQN A;  5EEH A;  1Z6T A;  5DUI A;  3G73 A;  4RS8 A;  2VBZ A;  5D5U B;  4HQE A;  4XLP F;  1UB9 A;  1ZLK A;  4EJV A;  4Q4Z F;  1PDN C;  4A0Y A;  2G9W A;  4AWX B;  3LFK A;  1BI3 A;  2M87 A;  1L3L A;  1S8N A;  4KIC A;  4A2U A;  2CQK A;  4BXU A;  3R0J A;  4M71 A;  3EUH A;  4KDP A;  1AOY A;  1KQ0 A;  4IRH A;  2A5Y B;  4CHU A;  4G7O F;  1V4R A;  2DU9 A;  3TDU C;  2G7H A;  2XUB A;  5D4R A;  1Y0U A;  4NHJ A;  3KLN A;  1L0O C;  2W57 A;  4AVP A;  2H27 A;  2IW5 A;  4BAY A;  1DP7 P;  2GA1 A;  1G4D A;  3VFZ A;  4XBF A;  1WRJ A;  2CWE A;  1XB4 A;  3I5U A;  5ERI A;  5FD6 A;  1FWZ A;  3ML6 A;  2XAH A;  4EV0 A;  4KUM A;  2Z33 A;  2PMH A;  3JTG A;  2ELH A;  3ZN0 A;  1TQM A;  5BS6 A;  2LKP A;  3E6D A;  2PQ8 A;  4N0B A;  1YW7 A;  2GA2 A;  3RIR A;  2WC2 A;  1HKQ A;  1LQ1 A;  1IN6 A;  2HYF A;  4GGG A;  1XGN A;  3I71 A;  4HZF A;  4ESF A;  1XSX A;  1T98 A;  3IWF A;  1MGT A;  1ZRE A;  1O3T A;  2JTV A;  4RGX A;  2H6B A;  3T8R A;  5H6Q A;  3F8C A;  4EGZ A;  3ISP A;  4CIC A;  4HF2 A;  3C7J A;  3MWM A;  1O7L A;  3L7W A;  3VOE A;  2HWV A;  3SXY A;  1TQI A;  2ESH A;  3HYI A;  3J80 Z;  5HDN A;  2DW4 A;  4UVC A;  1R1U A;  1S29 A;  4AD9 A;  1T39 A;  3FF5 A;  4FX4 A;  2YX7 A;  2FE3 A;  2OBP A;  4YG2 F;  1IZ1 A;  2ESN A;  3SHF A;  2F5D A;  4OMY A;  1HXD A;  3M7G A;  4A0X A;  1FYM A;  2RKH A;  3WG9 A;  4WF2 A;  1DPR A;  1XGS A;  1BBY A;  4BQA A;  4A6E A;  2E1N A;  5CVJ A;  4OU0 A;  2ZBK A;  1FZP B;  2VE8 A;  3I59 B;  2RDP A;  4OIO F;  4BH9 A;  3IRR A;  3WTW C;  2QVO A;  4LLL A;  2V1D A;  1WKM A;  3F6O A;  4HA8 A;  1TW3 A;  2MBF A;  4L9N A;  1I27 A;  1EH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...