3FM5A

X-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
131
Chain Sequence
MAESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title X-ray crystal structure of transcriptional regulator (MarR family) from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
total genus 41
structure length 131
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fm5A00
5BS6A 4HZFA 5HLHA 1OKRA 3PQKA 2NRAC 1YW8A 2EA2A 4AD9A 2VXZA 4LLNA 4HV5A 1P4XA 5E20A 4EJUA 5ILSA 3U1DA 4BH9A 5D6FA 2P5KA 1IN5A 4D0PA 1OYIA 2G7HA 2P5LC 5K5OA 2V1DA 4JK1X 2QQBA 2NNYA 2NYXA 4MEXF 2DO7A 1YIOA 2QWWA 1B9MA 3Q9VA 2Q2EA 2W85A 2RDPA 2ESNA 4CDGA 5DCMA 1O3RA 4FT8A 5DDGA 3F22A 2P5VA 2MLGA 2K27A 5E8GA 3KLOA 2UXNA 1SD5A 2M87A 5DD8A 4KUMA 1IXSB 1ONVA 3RYRA 2O6GE 1W7PA 1C0WA 4G9YA 1G3WA 4RB3C 1FP2A 5KK1A 4A5MA 2UXXA 4HV6A 1RI7A 1J5YA 4PGGA 4G8XA 4LLLA 2FQ3A 4L9VA 1T6SA 3ZN1A 3H92A 4GGGA 4R8HA 1R1TA 3I59A 1TW2A 2PEXA 2DBBA 2A69F 3KETA 3GFMA 3HYIA 4HAMA 3TDUC 2FF4A 4BYYA 5DCFA 2LKPA 3DEUA 4B09A 3GFIA 4ZYEA 1HBXG 2E7WA 3F8BA 1STZA 1GVJA 1YS7A 2PMHA 2STTA 3QOPA 4RGUA 3GYHX 4EGZA 5D5VB 4LG0B 3SQNA 4L5JA 2XAJA 3P7NA 1T38A 3CO6C 2GA2A 1TNTA 4WX9A 1ON2A 1FT9A 1R00A 2M1BA 2V79A 2HOEA 1EH8A 3FMQA 1K6OA 4BHPA 3GX4X 5E1ZB 5BQTA 3GFLA 1LJ9A 1ON1A 1T2KA 1IN4A 2O3FA 2HZTA 2RGVA 3VFZA 1PDNC 4M9ZA 4JQFA 1ZRFA 3K0LA 3WTTC 3J81K 2MH9A 1IRGA 4OU0A 3KP7A 2QBYA 3N97A 3LA2A 4Q4ZF 2H94A 4EVIA 3R0AA 2CO5A 3IC7A 1UB9A 4XBFA 2VONA 4I2OA 3DQVC 2F5FA 2XAFA 2F5DA 2ISZA 3ELKA 3HSFA 1QZZA 4UHTA 3TKYA 2DLLA 3WGHA 4Q48A 1O3TA 5CVRA 1ZH5A 1SMTA 3T8RA 1ZARA 3I58A 5H6RA 4M9XA 3WTYC 3GFJA 3EUHA 2QENA 4YG2F 2DK8A 2ZBKA 1B59A 2FA5A 5HDKA 5CVVA 3ULQB 1IF1A 5LHGA 3BJOA 3E5QA 1RUOA 1G4DA 4OIPF 1KYZA 3W6KB 1ZAOA 4RGRA 5LRSA 4WWCA 2XROA 3F8MA 2Q8KA 4EJWA 3L7WA 1ZLKA 2DPDA 3GXOA 4NB5A 1E2XA 2DU9A 1R5HA 4XSZF 1ZGJA 1H9TA 2VOPA 4I02A 3F21A 1FZPB 2DI3A 3I0TA 2KIFA 4K2EA 3BPVA 1MJAA 4IXAA 2FSWA 5HDGA 5FFZA 3HSEA 3QU6A 2Q0OA 2GQQA 5JR3A 4FX4A 3DFGA 2YU3A 1JXSA 4EV0A 3EETA 1TQMA 4A6EA 5E1XA 2EWNA 1XB4A 1IXCA 2KIMA 2HDCA 4CYDA 1O57A 5D5WB 2ZMEB 1KGSA 5LRRA 3CUQC 1V3FA 3KP4A 3RKYA 2ZNZA 4LLGF 2KJBA 4ZYGA 5L3BA 1G3SA 3BZ6A 4DQ2A 1B6AA 5CJ9A 3E6DA 2HTJA 3DF8A 5L3DA 1SD7A 1T98A 4EM1A 3WGIA 1B4AA 4KNYA 3V4GA 2E7XA 1S7AA 5F6FA 3WODF 3F23A 4L9NA 4KDPA 1LEAA 2EK5A 2P7VB 1DDNA 1TNSA 1KYWA 4EJVA 4UV8A 4IRGA 5DYMA 4HYEA 1OR7A 4KFCA 2A07F 1ZN2A 2EFWA 5JI6A 3HTSB 3MCZA 2XAHA 1YQAA 4IPAA 2IJLA 4H0EA 2PG4A 5LBQA 2V1UA 3JTGA 3L00A 3ZN0A 3NQOA 2CW0F 3KP6A 1BOAA 3CLOA 3LQQA 2A6HF 3CTAA 4O6JA 1XMKA 1HQCA 1U5TB 3WGGA 3J81Z 2PLYA 4UV9A 2ISYA 1Y0UA 4RAZA 4B8XA 3GF2A 2VODA 4ZH4F 3WE2A 3ERED 4A12A 4XRFA 4WCGA 1XCVA 3KP3A 3ZMSA 5LGUA 1OPCA 4S04A 2RNJA 3QPTA 3QPHA 2GAUA 3HOSA 2M45A 5L3GA 1BC7C 3K1PA 4Q47A 3BY6A 1BC8C 1FBUA 1FP1D 4ZZDA 2ETHA 4I01A 5LHIA 2HGCA 4L5IA 1SD4A 2KJCA 1F5TA 1KA8A 3FF5A 3HSRA 3K9TA 3J80K 2DT5A 2YPRA 4M6YA 3WU1B 1KQ8A 5D5UB 3TQNA 1U8RA 3SZPA 2Y75A 1BIAA 4LMYA 1I1SA 4ON0A 1FWZA 4OIRF 3I71A 3PFIA 4HBLA 2LDUA 3Q9SA 4P5OA 4EQQA 3HOTA 4UNOA 2PQ8A 4ENJA 1BBYA 1RUNA 4P96A 4OMZA 4ESBA 2HKXA 1QGPA 3RDIA 2DFIA 1W5TA 1KU7A 3I5UA 4EJOA 1IN8A 3FXQA 5AIQA 1Z6RA 1EV7A 1BI0A 2L54A 2VT2A 1I27A 2XV4S 3CDHA 2FNAA 2Z33A 3ZMVA 2X4HA 2XKPA 1U3EM 1OYYA 2Z99A 3E5XA 1ODDA 1XDSA 1ZGAA 3IRQA 5D8LB 2BV6A 3DV8A 1SFEA 2FEZA 4HF2A 2JZYA 1O7LA 1K78B 1ZREA 2RN7A 1GHCA 3WTXC 2A68F 2F5EA 4RAYA 1DPUA 4YFKF 2Z3YA 2V6CA 4XSXF 1D8JA 3NRVA 4Z2YA 4ENNA 2YX4A 2ZXJA 4IJAA 4MEYF 5DCMB 1DP7P 1F9NA 3F3XA 4M72A 2OQRA 3GUDA 1G3YA 2L4MA 2YX7A 3JW4A 3E5UA 2FNPA 3D0SA 3ZPLA 5H20A 3KE2A 2B0LA 3K69A 4Y13A 2UZKA 1R1VA 3IL2A 3HRTA 5CVUA 3T5XA 1W7PB 2R7FA 4L9TA 4L9JA 2P8TA 4BHCA 2VC1A 5EEHA 3FX3A 4IVNA 3CO7C 1TQPA 1HW5A 4YIFA 3V8LA 2FOKA 2JSCA 5E18F 4I0AA 1FYLA 2JPCA 1R22A 4N0BA 1Z9CA 1FBSA 3ZQ7A 3L9FA 3M8EA 3I59B 4UVAA 3RYPA 1Z7UA 2D1HA 2PMUA 3LA7A 1J75A 1FPQA 2PFBA 4I0BA 4N9HA 3H3ZA 1RNLA 2GIVA 4OINF 5AIPA 2BE5F 4MHGA 1WWXA 3R4KA 3T1BA 2ELHA 3FXRA 4RGSA 3KLNA 2MD5A 4L0YB 1JHHA 5HLGA 1XN7A 5LGNA 3DPLC 3WU0A 3BJAA 2PJPA 5J8CA 2NNNA 2XUBA 3V7RA 2VBWA 4ETSA 5LEKA 2IA1A 3BJ6A 3JAMZ 4KYWA 4A0YA 3DXJF 5L3EA 5BPIA 4U0VA 1W7PD 3F6OA 3TOBA 2PI0A 5H6QA 2OQGA 3J80Z 1J59A 4U0YA 3ZMDA 1PP7U 4YIIA 3U2RA 1WI9A 4R79A 2FE3A 2BBYA 2WV0A 2CWEA 4LB5A 1QQIA 3ECHA 2DW4A 2QVOA 1J7KA 3CUQA 3NEUA 4A5NA 2DAOA 2QBYB 5L3CA 2EV0A 2K86A 1DUXC 2P6SA 3GLXA 2J5OA 4ESFA 1FOKA 3V7CA 2QUFA 1YLFA 3MAJA 3BWGA 1P4AA 4EMSA 3KCCA 5TRDA 3C3WA 2E1NA 5A2QK 5E17F 3O2PE 1SMYF 1I5ZA 4P9FA 3W6JB 1MD0A 4YFNF 4GYIA 4M73A 1QBJA 2XRNA 2A3SA 1R7JA 2HKOA 4M6XA 1O3SA 1TQIA 1ZHFA 5K5QA 3I4PA 1KQ9A 3KEOA 4PCQA 3HRUA 1PUEE 4F7ZA 2JT1A 1YO5C 2CSOA 5IT3A 5BOXA 5D8KB 4HDVA 3LAJA 5DEQA 4KN7X 4BNCA 1FYKA 4BAYA 5BPDA 3F8NA 2LNBA 3R0JA 2W24A 2OAZA 2VE8A 4I7HA 3JSPA 4U0WA 3VODA 1J2XA 2ESHA 2GXBA 3FM5A 5ICEA 3C18A 3HHGA 4EM2A 3FWEA 5K5RA 2NS0A 3AAFA 2QZ8A 4TV7A 5LLQA 4IRHA 4KIBA 5HOOA 2MH2A 4WXHA 3T8TA 1HW2A 5DV5A 1FSEA 2H09A 5E8IA 2ADUA 5ILVA 2Y48A 3J7AO 4PGHA 2LSOA 1HKSA 5D4SA 4PDKA 2XASA 1IN7A 4RB2C 3P9IA 3PQJA 3TO7A 4KIFA 1FLIA 1WSUA 1LDKB 2ZNYA 2M8EA 2CG4A 5HDNA 4LK1F 2KRFA 1QO0D 2BGCA 4KMUX 1P4WA 4HLXA 5HS8A 1D8KA 3M1EA 2G9WA 4LK0F 2FXAA 3C7JA 2E1CA 1SFUA 1MJBA 1FY7A 3O3KA 1ULYA 5DUIA 1CGPA 3GWZA 4RS8A 3HHHA 4U88A 2GXGA 3HTUA 1Q1HA 3M9AA 4WXCA 4AIHA 2IW5A 4NQWA 4O5VA 2XAGA 4QLCU 2O03A 5D5XB 3OOPA 3R6SA 2VE9A 1XGNA 2BEOA 4P9UA 2K02A 2EA4A 2YSRA 1A04A 4CICA 3H3UA 3CUOA 4HW0A 4G7OF 4U7BA 2ZCWA 3BPXA 4G7HF 3HRMA 2O0YA 1XSDA 4RB1A 1ZG1A 1HKQA 3D5LA 1O7FA 2PN6A 1QZYA 2A6EF 1LVAA 1D3YA 3GO5A 2MBFA 1OYWA 3GZ5A 2WC2A 2DQRA 1ZYRF 1H9GA 1L0OC 3HUGA 2CYYA 3N4MA 5JVTA 5CVJA 2EFQA 1YW9A 3F6VA 4U7DA 1BI1A 4HF0A 4M74A 3E6BA 1MZBA 3IHUA 2FBIA 2HQRA 2A5YB 4KA4A 5E1WA 2FMLA 4M71A 4G7ZF 4AIKA 3JAMK 5A2QZ 4A0XA 1XGMA 4KMFA 2H6BA 1P92A 5AONA 2AS5F 4NHJA 3IRRA 3E6CC 2MC3A 3ZMUA 2UWMA 3BROA 4EM0B 4IF4A 5D4RA 2ZJ2A 1SAXA 1EH6A 1XCBA 2IPQX 4HLYA 1E17A 2R3SA 1EH7A 2D2WA 2M5WA 5DD4A 5IT9Z 3RTRA 1RIOH 1GXPA 1WQ2A 3R61A 4UXNA 5HS7A 1J9IA 1BI3A 1IXRC 1K7AA 2OZ6A 1XGOA 2M30A 3BOQA 3REOA 4A0ZA 3ROUA 2FBKA 1NHAA 3VEPA 4HX7A 2COMA 1QNTA 3VOEA 4ZZLA 4HQMA 2FMYA 2LF8A 1F4KA 3IWZA 3EYYA 5DUKA 2HYGD 1MDMB 3I54A 4DNCA 4HDUA 2DQLA 3BDDA 1KU3A 4A2UA 1YYVA 3QU3A 1BJAA 5HLIA 4MTEA 3MZHA 2STWA 3TOAA 1ZRCA 4OOIA 2GZWA 1CF7B 3RKXA 1ZLJA 2DK5A 2HEOA 3QP6A 2JRTA 1G6NA 2OBPA 1B1BA 1U5TC 1YG2A 1J0RA 4LB6B 1R23A 1D5VA 1XGSA 1K78A 5ED4A 1TW3A 3K2ZA 2D1VA 4BHBA 1KQ0A 1YFHA 1Z6TA 1LQ1A 2K4JA 2XGXA 1TLHB 5BMZA 3FM3A 2TDXA 3KP5A 4WXDA 2YR2A 3G73A 2W25A 2CFXA 5HVQC 5F64A 3FMRA 2KKOA 2IRFG 2QYOA 3LQRA 1IAWA 1V4RA 4XLPF 5CVIA 4HOBA 2XHKA 2J5PA 4PZJA 4ZYHA 5ICCA 5FLXZ 4A6DA 1FNNA 2EFOA 2AXLA 2Z9OA 2MLKA 2ZO4A 1MKMA 1XSXA 2HS5A 1U78A 2JTVA 4EGYA 5LHHA 2BYVE 4FX0A 4GCVA 4HQEA 3SFZA 4CHUA 5ILUA 4LGWA 1YS6A 2QLZA 1LNWA 1JE8A 4EJTA 1XMAA 3GVAA 3M7GA 2IP2A 3GEZA 3KZZA 4HF1A 5FD5A 5HS9A 2FBHA 4WF2A 4R1HA 1HKTA 3JSOA 2IA2A 3EDPA 4BXUA 2O8XA 4MGRA 2RKHA 1GXQA 3SHFA 1ZRDA 2EJRA 1XD7A 4LG0A 3L2CA 1UHWA 3DP7A 5ERIA 2VT3A 3ISPA 4P55A 2R7DA 1G3TA 4OIQF 5F1RA 4GXOA 3IKVA 2XAQA 1X3UA 2RC4A 2RVCA 1VTNC 1FYMA 4HX8A 5LEJA 2L01A 4E70A 3P9KA 2DTRA 4O3MA 4I98B 1R5GA 2W57A 2VBYA 2EV6A 5FD6A 2VOOA 3TO9A 2CQKA 1LDJA 2RV8A 1S6LA 1U6GA 5EEGA 1R1UA 1USTA 5FO5A 1W4MA 4ENMA 2JPBA 4FHTA 2QM3A 3K1NA 2VC0A 3ABUA 3CUQB 3ABTA 2V1XA 1R36A 3LFKA 3WG9A 2CGPA 2OZUA 4MTDA 2OA4A 4QWQA 4BQAA 4L18B 2Z5UA 1S7OA 3ZMTA 1U2WA 1OMIA 3RKWA 3TO6A 2H6CA 2MA3A 2Y0MA 3O6BB 3ZP5A 4I09A 5TJJA 4KICA 3RI4A 3ZMZA 3EYIA 2L02A 3LSTA 4GYGA 4Y15A 1QPMA 3U9GA 1DPRA 2GWRA 6PAXA 3MQ0A 5IT9K 1FC3A 1WKMA 2DPUA 3DKWA 5FB2A 1BI2A 1PP8F 1Z91A 4IHTA 3FMSA 4AIJA 4KT5C 2HTSA 5FGMA 3MFKA 4G6QA 2XKOA 5JHUA 3V8JA 3MEXA 3WE3A 2ZFWA 3DPTA 1LB2A 1XDUA 2G7UA 4ZYDA 2FRHA 3Q5FA 2GA1A 4YFXF 4UVBA 3FZVA 3KEQA 4HA8A 2LF7A 1XSVA 4JBAA 4WK8F 2K7LA 1REPC 3WTSC 5KVRA 1S8NA 2IT0A 3B02A 1FBQA 3QP5A 5L3FA 3BP8A 4M9SA 4OIOF 4S05A 2OU2A 3WTVC 1T39A 1T0FA 3E6MA 3SXYA 2ZMEA 4Y17A 3VB2A 4GO1A 2A61A 2RQPA 2EB7A 1LEBA 1IN6A 1AWCA 1L3LA 3WTWC 1UCRA 1HW1A 2EFPA 1S29A 1P6RA 2D45A 3ECOA 2K4BA 4MNUA 2F2EA 2EFNA 4IRIA 1K79A 3FXUA 5K1YA 2OD5A 3COAC 4ESJA 5ICFA 3EQLF 3G3ZA 1IZ1A 2ACJA 4MQVA 5J8FA 4CO8A 1Z05A 1LDDA 1SD6A 1RZ4A 1R58A 1BM9A 2W84A 3T0YA 1UHMA 3KP2A 1H0MA 3CJNA 3F72A 1BN5A 5CYVA 1AOYA 1HSTA 1JGSA 5FLXK 1UFMA 2EV5A 2P7CB 1F1ZA 4RB0A 1KU2A 1YTYA 2L4AA 4RGXA 1IUYA 2IVMA 3TDZC 2ZKZA 3GW2A 3MZYA 3FHZA 3QRFF 1IRFA 3IKTA 3P9CA 5J6XA 1TBXA 2KIUA 1WRJA 2L3DA 3K1MA 3S2WA 1IW7F 2P4WA 3M8FA 4KIGA 1U5TA 3SZTA 3E97A 4LD5A 4UUVA 4Q5SF 3RJPA 1USSA 1YW7A 1ZG5A 1Z1DA 2O61A 2VBXA 1I1GA 3HIFA 2QQ9A 2V9VA 3RPQA 3GZ6A 2HWVA 2IA0A 1O3QA 2H27A 3LAPA 1JHFA 1TTYA 2NAZA 3LA3A 3JTHA 2FU4A 4MQ9F 3LWFA 2QQAA 3OV8A 4LJZF 3RIRA 2X0LA 5FFXA 2F5CA 3F8CA 3KFWX 3TGNA 3V7SA 1SFXA 4ENKA 1HSJA 3WTZA 4CXFA 4CZZA 4G6DA 4KN4X 2HR3A 4LFUA 4AVPA 2XVCA 3ML6A 5D6EA 4N9IA 2HQNA 1P2FA 5CLSA 3E3VA 2HYFA 4CGZA 5JFRA 2WWYA 1FX7A 3B73A 3I64A 3RPUA 1BIBA 4XLNF 4L0ZB 2WTEA 4IHSA 4HX4A 3L09A 4OMYA 1W5SA 1MJ9A 1I6XA 3KZYA 3R60A 3I53A 1S3JA 2VBZA 1ZG3A 1KU9A 2P6TA 1FSHA 3HRSA 3C1DA 2VN2A 4G94A 3WTUC 4AWXB 2HFHA 5LGTA 3F8FA 1MDMA 3IWFA 1HXDA 1B9NA 4ASNA 4UVCA 2C6YA 5ICGA 2PBIA 3MWMA 2XIGA 1MGTA 3V8KA 3QAHA 1CF7A
chains in the Genus database with same CATH superfamily
5BS6A 4HZFA 5HLHA 1OKRA 3PQKA 3BC8A 2NRAC 5EG0B 1YW8A 2KMUA 2EA2A 4AD9A 5E3OA 4J00A 2VXZA 4LLNA 4HV5A 1P4XA 5E20A 4XKBA 4EJUA 5ILSA 3U1DA 1MIJA 4BH9A 5D6FA 2P5KA 4II2A 5K7HA 3A2KA 4QSHA 4CCKA 3FK6A 1IN5A 4D0PA 5KNLA 3GLLA 1GV5A 1OYIA 2G7HA 2P5LC 5K5OA 2V1DA 2DJNA 1M1EB 3K4KA 4JK1X 4F92B 2XC7A 2QQBA 4AIDA 2NNYA 2NYXA 3AG1H 2E5NA 4MEXF 2DO7A 3ASOH 2LH9A 1YIOA 3JRFA 2QWWA 1B9MA 1VQ6I 3Q9VA 4JP0A 1AU7A 2Q2EA 4NUBA 2W85A 2RDPA 1WH7A 1VQ8I 2ESNA 4CDGA 5GADJ 3CC2I 5DCMA 1O3RA 4FT8A 5DDGA 2MC4A 3F22A 1MBFA 2JVGA 1X4PA 2P5VA 2OJED 2MLGA 2K27A 2AHQA 5EGOA 1D0XA 3QYBA 5E8GA 3KLOA 2UXNA 3LL7A 4JYKA 1SD5A 1UHSA 4UB8C 2M87A 5DD8A 4KUMA 1IXSB 1ONVA 3S93A 1ZR4A 3RYRA 3CLQA 2O6GE 1W7PA 2Y2ZA 2R7WA 3QODA 3MKWB 2GXAA 1C0WA 1R71A 4G9YA 1G3WA 4RB3C 3S32A 1FP2A 2L9NA 5KK1A 4A5MA 2UXXA 4HV6A 1RI7A 1J5YA 4PGGA 5IP9J 4G8XA 4LLLA 1ERDA 2ME0A 2FQ3A 4L9VA 1T6SA 1OLTA 2M7BA 4UY8I 3ZN1A 2LY2A 3H92A 4GGGA 3QYEA 4R8HA 1U9OA 1V5FA 1R1TA 2E5ZA 3JREA 1D0YA 3JRIA 4XLHA 3CCVI 3I59A 1TW2A 4F55A 3UR3C 4G12A 2PEXA 2DBBA 2A69F 5K7FA 3KETA 3GFMA 1B8IB 1OCCH 3HYIA 4HAMA 3TDUC 3CMEI 3HKZN 2FF4A 2QSHX 1MNMC 4NC6A 4BYYA 5DCFA 2FJ1A 2LKPA 3DEUA 3BG5A 2BW3A 4B09A 3GFIA 2BY0A 4ZYEA 1A31A 1HBXG 2G0EA 2E7WA 1X3ZB 3F8BA 3PNYA 2COBA 3A02A 1STZA 1GVJA 1YS7A 2AO9A 2LFBA 2PMHA 2STTA 4EATA 3K7AJ 4DJAA 3QOPA 1BW6A 4CH7A 3IUOA 4RGUA 3GYHX 4EGZA 3CMYA 4XOTA 5D5VB 4LG0B 3SQNA 5J4YA 4L5JA 4ZDPA 2XAJA 1VFCA 2EIKH 2JA2A 2R5ZB 3P7NA 3D5RC 2YU9J 2BXYA 1T38A 1CQTA 3CO6C 2GA2A 1TNTA 1WGXA 1P9QC 4WX9A 1ON2A 1FT9A 1R00A 2M1BA 2V79A 2HOEA 2XPWA 1EH8A 3FMQA 1K6OA 3MKZA 1K4TA 4BHPA 3GX4X 1ETOA 2DTZA 5E1ZB 5GPAA 3GFLA 1OCOH 1Z0XA 5BQTA 1LJ9A 1ON1A 1T2KA 1IN4A 2O3FA 2HZTA 2RGVA 3VFZA 3I3LA 1PDNC 4QPQA 1DU0A 4RAGA 1LFBA 1ETQA 4M9ZA 2LY1A 1XMXA 4JQFA 1ZRFA 3K0LA 3H0DA 1W5CC 4KT6A 2VKVA 3WTTC 3BG3A 3J81K 2MH9A 1IRGA 3H5NA 4OU0A 2CV2A 3J7YJ 5IYDJ 1LVKA 1Z67A 3KP7A 5GPCA 4B3AA 2ZXIA 2QBYA 1QRYA 3N97A 2NS7A 3LA2A 4Q4ZF 5FKMA 3BR0A 2H94A 3OSFA 3A0HC 3VYTB 4EVIA 3R0AA 2CO5A 2R7UA 3IC7A 1UB9A 4BUPA 1VQ7I 4XBFA 2HVSA 2VONA 4I2OA 3DQVC 2F5FA 3AKZA 1WJDA 3CCLI 5C4JJ 2XAFA 1XC5A 3FISA 2F5DA 2DA5A 2ISZA 1I3AA 3D5SC 3ELKA 2XPUA 2LBFB 3HSFA 1QZZA 4UHTA 3TKYA 2DLLA 2F4MB 1EA3A 1MSFC 3WGHA 4Q48A 1SAUA 1O3TA 1MSEC 1GDTA 5CVRA 1ZH5A 3OYFA 1IDZA 2VI6A 1SMTA 3T8RA 1Z3XA 1ZARA 3I58A 5H6RA 4A3IJ 1DGWY 2BZTA 2W7NA 4RMNA 4KITB 4M9XA 3WTYC 2AXTC 3GFJA 3I4MJ 3JCUC 4C2TA 3EUHA 2QENA 2KT0A 4YG2F 2DK8A 3M3YJ 3G2BA 1ORKA 3S1RJ 1WJCA 2ZBKA 4LITA 3HXLA 3DCFA 3FKIJ 2E2IJ 1B59A 1G59A 3DKYA 2FA5A 1G8XA 5HDKA 2R7XA 3NWTA 5CVVA 1MNEA 3ULQB 1IF1A 2WAQN 3BG7A 5LHGA 1WJBA 1N78A 3BJOA 3E5QA 4MO7A 3V8KA 4A3KJ 1G4DA 1RUOA 2OTLI 4OIPF 3S1NJ 2E1MB 2M8GX 2DOEA 1KYZA 4MFDA 3W6KB 1ZAOA 1Y0NA 4RGRA 4BS9A 5LRSA 4WWCA 2XROA 4CUGA 4GRIA 3F8MA 3ABKH 2Q8KA 4BQOA 4EJWA 3O8HA 3VPRA 3L7WA 1ZLKA 4ANJA 4BJ6C 2DPDA 4A3GJ 2H1LA 1UG0A 3ZQLA 3GXOA 4NB5A 1E2XA 2DU9A 1R5HA 2I8DA 4XSZF 1ZGJA 2X48A 1H9TA 1HLVA 5KAIC 3S14J 1ETWA 2VOPA 1TWAJ 4I02A 4FE7A 3F21A 1FZPB 2DI3A 3I0TA 2KIFA 4DGWB 4K2EA 1TWCJ 3OYNA 3BPVA 2A6TA 2V4JC 1MJAA 4IXAA 3TP0A 2FSWA 5HDGA 4BKXA 5GAGJ 2ZSIB 2L7ZA 2JQ7A 1MMDA 2OUMA 3W6VA 2VQGA 5FFZA 3BR3A 2CRGA 2ZSHB 3HSEA 3QU6A 2Q0OA 4AYBA 2DMPA 2GQQA 5JR3A 4FX4A 3G6EI 2QKMB 1VQ9I 4I99C 2CFOA 1X1CA 1DQUA 3DFGA 1WI3A 2YU3A 1FJLA 1Y8QB 4FETA 5E79C 1JXSA 4EV0A 3OYLA 3CJTB 2JWTA 2WY7Q 3EETA 1TQMA 4A6EA 2ICWG 5E1XA 1N25A 2EWNA 1XB4A 2LKSA 2IAIA 1IXCA 2GOXB 2F6CA 4C3HJ 2KIMA 2HDCA 2BY2A 2K40A 2L2OA 1ZGWA 4CYDA 1R4MB 2QA4I 1O57A 5D5WB 1JKRC 1UG2A 2DMUA 2ZMEB 3M4OJ 4B3XA 1KGSA 2GM4A 1YRNA 3AL0B 3VDXA 5LRRA 3CUQC 1V3FA 3KP4A 5EF6A 3RKYA 1JJ8C 1X1AA 2ZNZA 1MBEA 5F0FA 4IQ4A 5EZHA 4IHYA 4Y33A 3WHCA 1A5JA 2LLKA 4LLGF 2KJBA 2M9HA 4ZYGA 1HF0A 1O4XA 1RKWA 1BW5A 1XX5A 5L3BA 1G3SA 4BBSJ 3BZ6A 4DQ2A 1B6AA 5CJ9A 3E6DA 2Q1ZB 2HTJA 3JRCA 3DF8A 5F1JA 4CZCA 1BR1A 5L3DA 3W2WA 1XS9A 2NOGA 1SD7A 1T98A 3RKQA 4EM1A 3WGIA 3HDDA 3W2AA 1B4AA 4KNYA 3V4GA 2E7XA 1S7AA 1PUFB 5C4XJ 1B72B 4ZYAA 3BG6A 5F6FA 3WODF 3F23A 4BL0B 4L9NA 3EUHC 4KDPA 2JN6A 1LEAA 4CYCA 2EK5A 3CCSI 2P7VB 1DDNA 2XDVA 2ZJRF 1XG1A 2N8GA 1TNSA 2OCEA 1UZCA 4CCNA 2EZKA 2VLAA 1KYWA 4EJVA 4HRIA 2L7MP 4UV8A 2BHYA 4IRGA 2HOTA 2W00A 4NQWB 3GTKJ 5DYMA 1MMGA 5J1YA 4HYEA 4KJZA 2KRHA 4BY7J 1OR7A 4KFCA 2R92J 2A07F 1ZN2A 2IGKA 1WJ5A 4FASD 1X3WB 2EFWA 3ZGKA 3FIWA 5JI6A 4V2GA 3HTSB 3MCZA 1E0EA 2HVQA 2XAHA 1YQAA 4NNJA 4IPAA 4XR6A 2IJLA 4H0EA 2PG4A 5LBQA 2V1UA 3JTGA 3L00A 3ZN0A 3NQOA 4CA0A 5KAFC 2CW0F 1X4OA 1IDYA 3KP6A 1BOAA 1VQOI 3CLOA 3LQQA 4XMYA 2A6HF 3CTAA 4O6JA 1XMKA 4FISA 1HQCA 2A05A 2LP0A 2WAEA 1U5TB 3MVPA 3WGGA 4C3JJ 3J81Z 2PLYA 3GMEA 4UV9A 2ISYA 1Y0UA 2HPMA 4RAZA 4B8XA 3GF2A 2QF7A 1R5ID 2VODA 1GUUA 3ZQIA 4ZH4F 4CCMA 3WE2A 1ZELA 3ERED 4A12A 4PK4A 5HLTA 3OSGA 2NVQJ 4XRFA 3BZKA 4WCGA 1XCVA 4ZTFA 3KP3A 5FRNA 4JX6A 2D5VA 3ZMSA 1N77A 3ZQHA 2E60A 2CQQA 5LGUA 1Y6IA 4XQFA 3QQAA 1OPCA 4S04A 2RNJA 1OFCX 3DKXA 2JA5J 1JKPC 3QPTA 1Y1WJ 3QPHA 2GAUA 3BLYA 3HOSA 2M45A 2JA8J 3OL4A 4BEHB 5L3GA 3H1CA 3JRHA 3CCUI 3S17J 1ZQ3P 1BC7C 2RQQA 3K1PA 4Q47A 3BY6A 1W0TA 2K5CA 1BC8C 2ID6A 1FBUA 4XLAA 1FP1D 4C9YA 4ZZDA 2ETHA 4I01A 5LHIA 2LK2A 2HGCA 3DBRB 4L5IA 3ZR8X 1SD4A 2KJCA 1F5TA 4CSWA 2EH3A 1KA8A 3FF5A 3HSRA 3K9TA 3J80K 4X0GA 3PIPF 5F27A 2MABA 2CH0A 3A01A 4XONA 1MMNA 2DT5A 2IXSA 3I55I 2R7QA 3RCOA 2YPRA 4IKFA 2H8RA 4M6YA 3WU1B 1KQ8A 3HGYA 2P0WA 5D5UB 1SEUA 3TQNA 1U8RA 3ONQA 4XM3A 3HOZJ 3SZPA 1IG7A 2Y75A 3MN2A 1BIAA 2W1OA 4LMYA 1I1SA 4ON0A 1FWZA 4OIRF 3I71A 2LY9A 3PFIA 4HBLA 2LDUA 1Y39A 3Q9SA 4P5OA 4EQQA 3HOTA 4UNOA 4DBQA 2PQ8A 4ENJA 1BBYA 2ZFUA 3GBGA 1TL8A 1U8BA 1RUNA 2CS3A 2HU9A 2W4SA 4P96A 4OMZA 4XLEA 5B1BH 1TP4A 4FCYA 1K83J 3GTQJ 3JRDA 4ESBA 2ZC2A 1OR7C 2HKXA 1QGPA 1YX5A 1Y8RB 4I6ZA 3RDIA 2V9PA 2DFIA 2VL8A 1W5TA 1KU7A 3I5UA 1EJ9A 2PMZA 4EJOA 1Z3YA 1ENHA 4IOCF 3A4CA 2OPTA 1IN8A 3QWLA 3MMYB 3OYIA 1S7EA 1XTAA 3FXQA 4E6KG 4DZPA 2LOOA 5AIQA 1Z6RA 1SVLA 1EV7A 1BI0A 5FKLA 2L54A 4BACA 2VT2A 1I27A 2XV4S 3CDHA 2FNAA 3EPZA 2Z33A 3ZMVA 2X4HA 5EEAA 2XKPA 2H8WA 1U3EM 1OYYA 4W97A 2Z99A 3E5XA 1ODDA 1XDSA 1ZGAA 3IRQA 2BV6A 5D8LB 3DV8A 3ZQCA 1SFEA 2FEZA 4IZZA 3OYHA 4HF2A 2JZYA 2M3AA 5FJ8J 4HSTA 3OS1A 1O7LA 4DW6A 3CP8A 5EG0A 1D1CA 1K78B 1ZREA 4XKCA 2RN7A 1GHCA 4DZJA 3L2RA 4A3EJ 2TCTA 4HNTA 3WTXC 2A68F 3TBIA 3FBIB 4II3A 5FKOA 2F5EA 3CCYA 4RAYA 5M3FJ 4E7ZA 5C3EJ 1DPUA 2Y9ZA 4YFKF 2V9KA 2Z3YA 4B44A 2V6CA 4XSXF 1D8JA 3NRVA 3RPUD 2LKXA 1A6IA 4Z2YA 3K70C 2M7AA 4ENNA 1RKTA 1WPKA 2YX4A 2ZJPF 2Q2EB 3G1LA 2HPIA 3CD6I 2HVRA 1V5GA 2ZXJA 4IJAA 2DDBA 4MEYF 5DCMB 3FXKA 1DP7P 1F9NA 3F3XA 4M72A 2XPVA 4PJNA 2OQRA 3GUDA 1G3YA 2L4MA 2YX7A 2NXNB 3JW4A 3E5UA 2WB1A 2EZIA 2FNPA 3D0SA 4RLQA 5H20A 3ZPLA 3KE2A 2EINH 2B0LA 1RC9A 3K69A 4RDUA 5K7ZA 4Y13A 2UZKA 2PJRA 4P1WA 1R1VA 5TISC 5EJCA 3IL2A 3HRTA 5CVUA 3CQZJ 1WCMJ 2XGDA 3T5XA 3H9GA 1W7PB 2R7FA 4L9TA 1TWHJ 4L9JA 2P8TA 4BHCA 1IO2A 1T33A 3LSIA 2VC1A 3CZ6A 3DEEA 5EEHA 3CCEI 3FX3A 4IVNA 2L9VA 1SANA 3CO7C 5CKTA 1OCPA 1TQPA 2KQRA 3UKGA 3GTGJ 3ESWB 1HW5A 4DYQA 4YIFA 3V8LA 2FOKA 2X6YA 2JSCA 5E18F 4I0AA 1FYLA 3LSHA 2NVXJ 2Y31A 5JVGF 2JPCA 1R22A 3FXJA 3ASNH 4N0BA 1Z9CA 1FBSA 1T08B 2FQ4A 1XPXA 3ZQ7A 4BDZA 1YHQI 1LUJB 3L9FA 3M8EA 3VYUB 2QEXI 3I59B 3DLLF 4UVAA 1PVEA 3RYPA 5M3MJ 1Z7UA 3H5RA 2D1HA 2PMUA 3LA7A 1YI2I 1J75A 1B8IA 1FPQA 2VIXA 2PFBA 4I0BA 4V19K 4N9HA 4BXXJ 3HGGA 1VNDA 3H3ZA 4FTHA 2MG4A 1RNLA 2GIVA 2VJIA 1SVMA 1QPIA 2OTJI 4OINF 5AIPA 2BE5F 5BNGA 4MHGA 1WWXA 4IHWA 4J01A 1JTXA 3K4MA 1YJ9I 3CCQI 5HNHA 3OYKA 3R4KA 2MGQA 3OIQA 3IAS2 3EUKL 4LIVA 5FKKA 5B66C 1D1BA 3T1BA 2ELHA 2JA7J 2QSFX 3FXRA 4RGSA 3KLNA 2MD5A 5M5YJ 3BTJA 2VKEA 4BBRJ 4L0YB 1JHHA 5HLGA 1XN7A 5LGNA 3DPLC 1P7IA 3WU0A 5DS9A 4IO9F 2CMPA 1VZ0A 3BJAA 2PJPA 3S16J 2NNNA 3V7RA 2XUBA 5J8CA 2KLOA 2VBWA 4ETSA 2B9SA 4J19A 4M3GA 5LEKA 1TZLA 2E19A 3I9V2 2IA1A 2R7SA 3BJ6A 3JAMZ 3OYCA 4KYWA 4A0YA 3DXJF 5L3EA 5BPIA 3L2VA 4U0VA 1W7PD 1MMSA 1ZKGA 4XLCA 3E0JB 1TWGJ 3F6OA 1RRJA 3TOBA 1VI0A 2XF5A 3ZCOA 2XGEA 3LMMA 2PI0A 4Y3OA 3LSGA 5H6QA 2R5YB 2OQGA 3J80Z 1J59A 4U0YA 3ZMDA 1PP7U 4YIIA 3U2RA 1WI9A 4R79A 1K61A 2FE3A 4DYRA 1A36A 4EEFG 2BBYA 3OOUA 2WV0A 2CWEA 4LB5A 1W36D 1QQIA 5IPAA 3HOVJ 3ECHA 2YUSA 3WG7H 2DW4A 2QVOA 2LVSA 1WFXA 1J7KA 3OS2A 3CUQA 3NEUA 3MKYB 1S9HA 2ELKA 4A5NA 3OYGA 3IH3A 4A69C 5IYCJ 4PUSA 2DAOA 3AG4H 3PNTA 2QBYB 4B1RA 5L3CA 3CDIA 3PO3J 2EV0A 1Z21A 2K86A 2CUFA 2P6SA 1DUXC 3GLXA 2J5OA 1P7JA 3HC7A 2RREA 4ESFA 2R93J 3SJMA 4X1EA 3V7CA 1FOKA 2QUFA 3OR1C 1YLFA 1RPWA 4AYBN 3MAJA 3BWGA 4PFPA 1P4AA 4EMSA 2DOFA 5HNFA 2WA0A 3GZNB 2LBFA 2M0CA 3KCCA 5TRDA 3CP2A 2V26A 3C3WA 2HDDA 3HJEA 2E1NA 3LSJA 3FDYA 5A2QK 5E17F 3C2HA 3O2PE 1F43A 4RAFA 1SMYF 2K9MA 4PSWA 1I5ZA 4P9FA 1WJAA 3OWTA 3W6JB 1MD0A 1LKXA 4HEA2 3VSLA 4YFNF 4GYIA 3DU5A 4PJJA 4M73A 1YE9A 1QBJA 2XRNA 3HM5A 2A3SA 1R7JA 1X2MA 2HKOA 4M6XA 1O3SA 1TQIA 1ZHFA 5K5QA 3OYBA 2DFFA 2W82A 4XORA 3HB9A 2VJ4A 2KPMA 3I4PA 2LMDA 1KQ9A 5J1UA 3KEOA 1ZK8A 2K9QA 4PCQA 4MLOA 1X1DA 1F36A 2EQRA 3HRUA 1PUEE 1OCTC 4F7ZA 3BT9A 2NS8A 2JT1A 2DT6A 4IQJA 1KZHA 1YO5C 2CSOA 5IT3A 5BOXA 5D8KB 2VKDA 1YJWI 2WY8Q 3KEYA 2Y69H 3CCJI 3LAJA 4HDVA 5DEQA 4KN7X 4BNCA 3K2AA 1FYKA 4BAYA 5BPDA 3F8NA 2LNBA 3H5AA 3R0JA 4XL9A 2W24A 2CUEA 2FD5A 2OAZA 3TEDA 2VE8A 1LPQA 4I7HA 4ZJZA 3JSPA 1LE8A 2XRLA 4U0WA 3VODA 1J2XA 1HC8A 2ESHA 2GXBA 2O5RA 1BR2A 3PO2J 4E7SA 3OMYA 3FM5A 5ICEA 3SEQA 3C18A 3NARA 3HHGA 4EM2A 5TGTA 3FWEA 2BY3A 3Q3SA 2NS0A 5K5RA 3AAFA 2QZ8A 2UUZA 2XSDC 4TV7A 2KDOA 3G1OA 1GVDA 4IRHA 4KIBA 2WADA 5LLQA 5E3NA 4BQQA 5HOOA 1MBGA 3FXLA 5JLWA 2MH2A 2ID3A 4RA2A 4WXHA 3K4CA 3J7ZI 3T8TA 3HL2A 2MSYA 1X58A 1HW2A 2DYRH 5FROA 3QYFA 5DV5A 3HOWJ 2CUZA 2CQNA 1FSEA 2H09A 4A3DJ 1WH5A 5GTHC 5DM6F 1U9NA 1FOWA 4FE4A 1UELB 2R7RA 5E8IA 3OYAA 2QGUA 1QA6A 1WHUA 4ZDOA 2ADUA 2VUMJ 3S1MJ 5ILVA 2Y48A 3J7AO 3GTJJ 4PGHA 1TT0A 1NTCA 2LSOA 2IBDA 3S2DJ 3DTEA 2L9SA 1HKSA 3TW6A 1SFOJ 4FQGA 5D4SA 3Q0WA 4PDKA 1ITYA 2XASA 1IN7A 1MBHA 2CW7A 4RB2C 2F4IA 3H9JA 3P9IA 1IUFA 3PQJA 3JR9A 1JGGA 3TO7A 1FOYA 1X2NA 3LSMA 4KIFA 1FLIA 4OAZA 1WSUA 1LDKB 2ZNYA 3IH2A 2M8EA 2CG4A 5HDNA 4LK1F 2KRFA 1QO0D 2BGCA 3SYTA 1ZTRA 2VXDA 4RBOA 4KMUX 2JA6J 1KONA 3LSRA 1P4WA 3VSKA 1OQYA 1A6QA 4HLXA 3JRGA 5HS8A 1D8KA 1J09A 5FKNA 1AKHA 1VQ4I 3M1EA 2G9WA 4LK0F 2FXAA 3C7JA 2E1CA 1IGNA 1SFUA 3TW7A 1MJBA 3DEWA 3I56I 1FY7A 2DT7B 1EF4A 2LC2A 3O3KA 1JT6A 1ULYA 5DUIA 1CGPA 5M5WJ 1FTZA 3BTLA 4F52A 4NC7A 2B7EA 3GWZA 3OIOA 4HSRA 4RS8A 2X6OA 3HHHA 4CYCB 3W2VA 4U88A 2GXGA 3HTUA 1Q1HA 3CDLA 1ZR2A 1Y56A 2L7FP 3M9AA 3W3CA 1FMVA 2W48A 3M8JA 1V54H 3L1PA 1MMAA 4WXCA 4AIHA 2VKHA 2IW5A 3X2QH 2CU7A 1HA8A 4NQWA 4O5VA 2XAGA 4QLCU 3BCAA 5GAEJ 1OISA 2O03A 2ME6A 2AQFA 5D5XB 3OOPA 3R6SA 2IS4A 2VE9A 1XGNA 2NVUB 2BEOA 4P9UA 1W0UA 3K4JA 1BJZA 5F04A 2UV1A 2E1MC 2K02A 2EA4A 2YS9A 4BQNA 2KFDA 2MD0A 2YSRA 1A04A 4CICA 2X1DA 3H3UA 2CQ7A 3DBHB 3K6GA 3CUOA 4HW0A 4G7OF 4U7BA 2ZJQF 2ZCWA 3BPXA 4G7HF 3HRMA 2V6EA 2O0YA 1XSDA 2CUJA 4RB1A 4HPQA 1ZG1A 3MZ8A 1HKQA 3D5LA 2M2EA 1JKOC 1O7FA 2PN6A 2ZXHA 1QZYA 1ETKA 2A6EF 1LVAA 4PSXA 1D3YA 4XK4A 1D1AA 3GO5A 1JUMA 1OYWA 2MBFA 3GZ5A 2WC2A 4OWRB 4XOPA 1HDDC 1NK3P 2DN0A 2DQRA 1PYVA 1ZYRF 1H9GA 1E3OC 2KZVA 2FX0A 1L0OC 3HOUJ 4UUSA 3HUGA 2DFHA 2CYYA 1R49A 2PMZN 2E35A 4BJ5C 3PNVA 5JVTA 3N4MA 1OJLA 3S15J 3AG2H 3OYDA 5CVJA 2EFQA 1YW9A 3F6VA 4U7DA 1QHGA 3KYCB 4IX7A 1BI1A 2O7OA 4HF0A 2BVMA 3PM1A 4M74A 2HQAA 1MZBA 3E6BA 3IHUA 2FBIA 3S3NA 2QSGX 4BEHA 3E1SA 2HQRA 1POGA 1VQMI 2A5YB 4KA4A 5E1WA 2HXIA 2FMLA 3RQ4A 1FTTA 3G4SI 5IP7J 3C2BA 4M71A 5GP9A 3TMOA 4AIKA 4G7ZF 5B1AH 3JAMK 5A2QZ 5DTDA 3H3VK 4A0XA 5FRMA 1XGMA 4KMFA 2NVYJ 2H6BA 1P92A 5AONA 3CCMI 1FOXA 1AHDP 2AS5F 4DIQA 4F3QA 3VYSB 2JJ7A 3AL0C 4NHJA 3IRRA 3E6CC 4KISA 2MC3A 3ZMUA 3VYRB 2VQLA 1S72I 5IYBJ 2UWMA 1UJ8A 2WBMA 4OAYA 5C44J 3BROA 3RQIA 5KCMA 4IF4A 4EM0B 4ITVA 1MH4A 5D4RA 4E7LA 4LIUA 1IV8A 2ZJ2A 3F0CA 1SAXA 3HPHA 3H36A 1EH6A 2CV1A 1XCBA 1JKQC 2GLOA 2IPQX 2VPLA 3S2HJ 4HLYA 4XRSA 1E17A 1NG7A 2R3SA 3PUFA 3BR1A 1EH7A 4Y52J 2D2WA 2M5WA 1FMWA 3JRAA 2HYJA 5DD4A 5IT9Z 3RTRA 1RIOH 2KP6A 3OY9A 1GXPA 1WQ2A 3R61A 4M3DA 4UXNA 4BJTA 4HNVA 1GLNA 5HS7A 5FLVA 1J9IA 1BI3A 1IXRC 1E3HA 1K7AA 1VQPI 4XICA 2XB0X 1SFKA 2OZ6A 1BL0A 2DA3A 1XGOA 2M30A 3BOQA 3REOA 2F48A 4A0ZA 3ROUA 2Z1DA 2FBKA 1NHAA 2JRMA 3VEPA 2IGNA 4HX7A 2COMA 1QNTA 2EBIA 4CCOA 4YIRX 4A3FJ 2E1OA 3VOEA 2Y9YA 4ZZLA 2WB1N 4HQMA 2FMYA 1RETA 2JUCA 1VQNI 4B48A 5IY5H 2LF8A 1F4KA 3BG9A 3GCMA 3IWZA 3EYYA 5DUKA 2HYGD 2E36A 1MDMB 1MH3A 2M4KA 3I54A 4DNCA 4HDUA 1QU3A 3BDDA 2DQLA 1U0JA 4ABZA 5J1RA 3FKJA 1H8AC 1KU3A 4MIMA 2X85A 2CJJA 4A2UA 1YYVA 2XAUA 3QU3A 1YX3A 1BJAA 5HLIA 3ZXSA 4MTEA 3MZHA 4YELA 2STWA 2AQEA 3TOAA 1ZRCA 3SDGA 1HDPA 2L0KA 3BCBA 3CJQB 4OOIA 4U87A 3SZGA 2GZWA 1CF7B 3RKXA 1Q1VA 1ZLJA 4E7KA 2DK5A 1HOMA 2I5UA 5JHFA 3L2UA 4IL6C 2HEOA 2R7VA 2DXIA 3QP6A 2R7ZJ 2JRTA 1G6NA 2OBPA 1B1BA 2PX9A 1U5TC 4C2UA 1YG2A 1IC8A 4N4NB 2KZGA 4BE2A 4IEJA 1J0RA 4LB6B 3DPUA 1R23A 3G71I 1D5VA 1XGSA 1K78A 5ED4A 4D7NA 1TW3A 4BXFA 3K2ZA 3QPLA 3DBLB 2D1VA 4DBRA 4BHBA 1KQ0A 2K9LA 1YFHA 1E3PA 1Z6TA 1LQ1A 3OL3A 2K4JA 2XGXA 1TLHB 5BMZA 3CC7I 3FM3A 3DLAA 2TDXA 3KP5A 1JTYA 3CJRB 4WXDA 2KL4A 1DP3A 1T95A 2YR2A 3G73A 4D9JA 2W25A 2Z16A 4QIWN 3G1MA 2CFXA 4A3CJ 1JUPA 5HVQC 5F64A 1H88C 3FMRA 5EGOB 4PJLA 3BTCA 1APLC 3HOYJ 2KKOA 3A1YA 5CQEA 2DDAA 2GOMA 2IRFG 2QYOA 3TL4X 1OCZH 3LQRA 1IAWA 2Y30A 1V4RA 2EPFA 4XLPF 3OR2C 5CVIA 2IGOA 3KYDB 1MW7A 3NAUA 4BE1A 4HOBA 2XHKA 2J5PA 4PZJA 2X6XA 2PJRB 4C30A 1FEXA 1FIAA 4XN0A 4ZYHA 5ICCA 3Q0UA 2EIMH 2DYSH 1JJ6C 2WV1A 4Y4RA 3ZQQA 5FLXZ 4A6DA 1FNNA 2EFOA 2AXLA 1QVTA 2BVLA 2HZDA 3AG3H 1HCRA 3KYLA 2KISA 3ABLH 2Z9OA 1R6RA 2MLKA 2ZO4A 4E4HA 4HNUA 1MKMA 1XSXA 5EZGA 3BTIA 2HS5A 4M3FA 1U78A 4GDFA 2JTVA 4EGYA 3FXMA 5LHHA 2BYVE 1I50J 2VJJA 5FLMJ 4FX0A 4GCVA 4HQEA 3SFZA 4CHUA 1D5YA 5ILUA 2HOSA 4LGWA 3F9KA 5EYRA 1JUSA 3P5JA 5E3LA 3O8GA 2NVTJ 1TWFJ 4AM3A 1YS6A 2X1CA 2QLZA 1LNWA 1JE8A 4EJTA 4W1UA 3HOXJ 4CCLA 1XMAA 3GVAA 5LD2C 2BW3B 3M7GA 2IP2A 3GEZA 3KZZA 4IOAF 4HF1A 5FD5A 5HS9A 3DWLE 2FBHA 4WF2A 2FUG2 4A3JJ 3ABMH 4R1HA 1HKTA 3JSOA 3J7AY 2IA2A 3EDPA 4BXUA 2O8XA 3LSKA 1NG6A 4MGRA 2RKHA 2DOAA 1SVOA 1GXQA 3SHFA 1ZRDA 4Y7NJ 2EJRA 1XD7A 4D1QA 4LG0A 3KIOA 3L2CA 1UHWA 3DP7A 3GTOJ 5ERIA 2R5ZA 2VT3A 2OF7A 1H89C 3ISPA 4P55A 2DA4A 2R7DA 1G3TA 4OIQF 4S0HB 5F1RA 1Y1VJ 4GXOA 2EIJH 3IKVA 4AVZA 2XAQA 1X3UA 2JVHA 3E7LA 3BQZA 3V42A 1DU6A 2HQ5A 2RC4A 2RVCA 3HPGA 2DMQA 3CF5F 1VTNC 3SFIA 1FYMA 4HX8A 2L9RA 3RZDJ 5LEJA 3LFUA 2L01A 4E70A 4B43A 3U21A 3P9KA 2DTRA 1BOBA 1RR7A 1A35A 4O3MA 2QQ8A 4I98B 1R5GA 3S1QJ 2W57A 2VBYA 4DOZA 2EV6A 2R0QC 3CMMA 1QVUA 5FD6A 2QCOA 3VWBA 2DCEA 3CCRI 1ETVA 2VOOA 3TO9A 3GTPJ 3S8PA 4BY1J 2CQKA 1LDJA 1TC3C 2R5YA 2RV8A 1S6LA 1U6GA 2I10A 2Z2SB 4E7HA 2IS1A 5EEGA 1R1UA 1DGRM 1USTA 2EZLA 5FO5A 1VQLI 1W4MA 4ENMA 2JPBA 4FHTA 2QM3A 3K4BA 4AU7A 5GAHJ 1IV6A 2DA1A 1GT0C 1RR8C 3K1NA 2VC0A 3ABUA 3CUQB 5M5XJ 4AC0A 3ABTA 2K9SA 2LG4A 2LR8A 2V1XA 1R36A 3LFKA 3WG9A 2CGPA 2OV7A 1VQ5I 3OIPA 2OZUA 4F93B 4PFOA 4MTDA 2R7OA 2OA4A 4QWQA 4BQAA 3HKZA 4L18B 1VQKI 3I4NJ 2Z5UA 1S7OA 3BR6A 3ZMTA 2HI3A 1U2WA 1OMIA 4UUTA 3HEFA 2XSJC 3CC4I 3RKWA 3IH4A 3TO6A 2H6CA 1BA5A 2MA3A 2OC6A 4V2FA 3S3MA 3FXOA 5KHDA 2Y0MA 3DU6A 2HNHA 3O6BB 2GBYA 5J3LA 1JT0A 3ZP5A 3SEZA 4BDYA 3DTIA 3K10A 4I09A 5TJJA 3MKLA 4KICA 2E34A 3RI4A 3ZMZA 3EYIA 3L2QA 2L02A 4M3BA 4QTRA 4L5EA 4ZC3A 1W36C 5J47A 3LSTA 4GYGA 4Y15A 1QPMA 4I76A 3PSFA 3U9GA 1DPRA 2GWRA 6PAXA 3MQ0A 5IT9K 1FC3A 1WKMA 1T56A 2DPUA 3OYJA 3DKWA 5FB2A 1BI2A 1PP8F 1Z91A 2V7FA 2BXZA 4IHTA 3ERMA 3FMSA 1T8IA 2K3FA 5EDNA 4AIJA 2WAFA 4KT5C 3BZCA 2HXOA 4RLFA 4UB6C 3ZQFA 2HTSA 5FGMA 3MFKA 2JMWA 4G6QA 3NWSA 2XKOA 1V5EA 2XF6A 4XKVA 1IRXA 5J4VA 5JHUA 1QZEA 3V8JA 3MEXA 2E2HJ 3WE3A 2ZFWA 2XGCA 3DPTA 1LE8B 1K4SA 1X1BA 3PL8A 3AFHA 1R4NB 5F08A 1LB2A 1XDUA 2G7UA 4ZYDA 4D7MA 1EKEA 2F4OB 2FRHA 3Q5FA 1TT5B 2GA1A 4YFXF 2ZB9A 4UVBA 2MFZA 1X19A 3FZVA 3KEQA 4HA8A 1NK2P 2IEKA 2TRTA 1IJWC 2LF7A 1XSVA 4JBAA 4WK8F 2E71A 3KZIC 1YITI 3HZJA 4IHXA 3OS0A 2O8KA 2K7LA 1REPC 1UMQA 3WTSC 5KVRA 1S8NA 3L2WA 5DM7F 3LOCA 3TP3A 2IT0A 3B02A 4RM3A 1FBQA 3QP5A 5L3FA 3IAM2 1BR4A 3BP8A 4B4CA 5HODA 2B63J 4XRMA 4M9SA 4OIOF 1QHHD 4S05A 2OU2A 3WTVC 1T39A 4ZTJA 1T0FA 3E6MA 4A3MJ 3SXYA 2ZMEA 3PJRA 5F0HA 2IS6A 4NC8A 1YRNB 2ELJA 4Y17A 3HG9A 2DMTA 4HG2A 3VB2A 4GO1A 2A61A 3GTMJ 2IS2A 2RQPA 1VF9A 2XB5A 4A3LJ 2EB7A 3B6CA 2LRDA 1IN6A 1R9TJ 1AWCA 1LEBA 1L3LA 3H0GJ 3WTWC 1UCRA 5B3SH 1HW1A 2EFPA 1S29A 4GFBA 5IOYA 1P6RA 1X1PA 3RZOJ 2D45A 3ECOA 2K4BA 2DA7A 1WJEA 4MNUA 2E2JJ 4E7JA 2F2EA 2WAQA 1YOVB 2EFNA 3QPSA 1YIJI 4IRIA 1K79A 3FXUA 5K1YA 2OD5A 3KX2A 3COAC 4ESJA 5ICFA 3EQLF 1OCRH 3FBNB 3G3ZA 2LD5A 1IZ1A 3RSNA 5LFAA 2ACJA 2ZXWH 1ETYA 4MQVA 4PJMA 4RM2A 4CO8A 5J8FA 1I6HJ 1Z05A 1PUFA 1LDDA 1ETXA 4C2MJ 3PFYA 1AKHB 2L7KA 1B72A 1SD6A 1RZ4A 1R58A 3CF2A 5F0CA 2LREA 2X1EA 1BM9A 2W84A 3T0YA 1UHMA 4CCJA 3KP2A 1H0MA 3CJNA 4XNFA 3KPHA 3F72A 1S5LC 3CMAI 2DA2A 5JLXA 1BN5A 5CYVA 4BGDA 1AOYA 3GTLJ 1HSTA 1JGSA 1LFPA 5FLXK 4AUXA 1UFMA 2EV5A 2P7CB 2X6WA 3K4NA 1F1ZA 2DJIA 4RB0A 1NH3A 5CQGA 2A5WA 3BR5A 2VQCA 1KU2A 1YTYA 1MNDA 2L4AA 4RGXA 3LSPA 1IUYA 3PIOF 2IVMA 2FOWA 2QKLB 3TDZC 4DYCA 2ZKZA 2M4GA 3GW2A 2CV0A 3MZYA 3FHZA 3EUAA 3PUBA 3CESA 4PJ0C 3WU2C 3QRFF 1WZ2A 1IRFA 3IKTA 4M6VA 2VJ5A 3P9CA 5CPRB 4NBQA 3ZQGA 2IGMA 1TBXA 2KIUA 5J6XA 1G2HA 1WRJA 2L3DA 3K1MA 2JK3A 3S2WA 1IW7F 2P4WA 2RAEA 4D5CA 3M8FA 4KIGA 2EILH 1U5TA 3A0BC 3BR2A 3SZTA 3N05A 2NOJB 2DA6A 3E97A 4LD5A 4UUVA 2VASA 3IP4B 2K9NA 4JOMA 2ECCA 4LOCA 2H1KA 4Q5SF 3RJPA 2VPRA 2EZHA 1YJNI 1USSA 4JX4A 5IOZA 1YW7A 1ZG5A 1Z1DA 2O61A 3HBLA 1I3QJ 2VBXA 2Y0SN 1I1GA 2DFEA 3HIFA 2QQ9A 2V9VA 1V55H 4XIDA 4YEJA 4NDLA 3RPQA 3HUGB 4XN3A 5E3MA 2X51A 4UUSB 3GZ6A 2HWVA 1MBKA 2IA0A 4QPOA 1O3QA 2O9LA 1SC7A 2H27A 3LAPA 3FHNA 2DODA 3FK7A 1JHFA 1TTYA 2NAZA 2V1NA 3LA3A 2XF7A 2BY1A 3JTHA 2FU4A 4MQ9F 1IRZA 2LTPA 4BE0A 2BHZA 3LWFA 1FIPA 2QQAA 3OV8A 4LJZF 3RIRA 2X0LA 5GTIC 5FFXA 2P81A 1WVRA 3A03A 3Q0VA 1T0FC 2F5CA 3SDBA 3IV5A 2MW8A 2ZMEC 3F8CA 3KFWX 3ZRGA 3TGNA 3V7SA 5H2FC 3OYEA 1SFXA 1ACIA 3M07A 4ENKA 4H4KC 4XLFA 1HSJA 3WTZA 2DMNA 1AA7A 4CXFA 2HDWA 4XKWA 2RNGA 4CZZA 4G6DA 2MYSA 3DTKA 1WJFA 4KN4X 2CW8A 3JRBA 2KHMA 3LNQA 2HR3A 4LFUA 4AVPA 2XVCA 4MFEA 3A01B 4IHVA 4Z6YA 3ML6A 5D6EA 4N9IA 2HQNA 1GV2A 3K4LA 1Z7LA 1P2FA 2L5QA 5CLSA 1Z77A 2HYFA 3E3VA 4CGZA 5JFRA 2WWYA 9ANTA 2K3PA 1FX7A 3B73A 3I64A 3RPUA 2LYCA 1BIBA 4BU2A 4XLNF 3S3OA 4L0ZB 3ZOBA 1W1WE 2WTEA 4A93J 2BOLA 2CQXA 4IHSA 4HX4A 4ZDLA 3UNGC 4F91B 3L09A 4OMYA 5J40A 2OCCH 3H35A 1W5SA 4E7IA 1K6YA 1MJ9A 1I39A 2R4GA 3WHBA 1N75A 2JSPA 2KRCA 3OYMA 5IP6A 1RESA 3M1CA 2KIQA 1I6XA 1D0ZA 2M0MA 3KZYA 2R7TA 3R60A 3I53A 4LG3A 1S3JA 2VBZA 2Y0SA 1ZG3A 1KU9A 2P6TA 3B6AA 3PSIA 1FSHA 2F5VA 3H9QA 5B5EC 3C2GA 3HRSA 4G6TB 3C1DA 2VN2A 2ECBA 2GIZA 2HOAA 4G94A 3WTUC 4M3EA 1LFUP 4D5FA 4AWXB 2HFHA 1JI8A 4X6AJ 3U1KA 4JX5A 4XRSG 5LGTA 3F8FA 1MDMA 4YRVA 3IWFA 2X9DA 2M34A 3K70D 2KDZA 1HXDA 3D1NI 4C3IJ 4B47A 2JUGA 1B9NA 4ASNA 4UVCA 3BQYA 1UAAA 2C6YA 4N4OB 2PBIA 3MD2A 5ICGA 2VQHA 4A3BJ 3QOEA 3MWMA 2VB6A 1MBJA 2XIGA 1MGTA 2K85A 3QAHA 1PJRA 1CF7A
chains in the Genus database with same CATH topology
5BS6A 4HZFA 5HLHA 1OKRA 3PQKA 2NRAC 1YW8A 2EA2A 4AD9A 2VXZA 4LLNA 4HV5A 1P4XA 5E20A 4EJUA 5ILSA 3U1DA 4BH9A 5D6FA 2P5KA 1IN5A 4D0PA 1OYIA 2G7HA 2P5LC 5K5OA 2V1DA 4JK1X 2QQBA 2NNYA 2NYXA 4MEXF 2DO7A 1YIOA 2QWWA 1B9MA 3Q9VA 2Q2EA 2W85A 2RDPA 2ESNA 4CDGA 5DCMA 1O3RA 4FT8A 5DDGA 3F22A 2P5VA 2MLGA 2K27A 5E8GA 3KLOA 2UXNA 1SD5A 2M87A 5DD8A 4KUMA 1IXSB 1ONVA 3RYRA 2O6GE 1W7PA 1C0WA 4G9YA 1G3WA 4RB3C 1FP2A 5KK1A 4A5MA 2UXXA 4HV6A 1RI7A 1J5YA 4PGGA 4G8XA 4LLLA 2FQ3A 4L9VA 1T6SA 3ZN1A 3H92A 4GGGA 4R8HA 1R1TA 3I59A 1TW2A 2PEXA 2DBBA 2A69F 3KETA 3GFMA 3HYIA 4HAMA 3TDUC 2FF4A 4BYYA 5DCFA 2LKPA 3DEUA 4B09A 3GFIA 4ZYEA 1HBXG 2E7WA 3F8BA 1STZA 1GVJA 1YS7A 2PMHA 2STTA 3QOPA 4RGUA 3GYHX 4EGZA 5D5VB 4LG0B 3SQNA 4L5JA 2XAJA 3P7NA 1T38A 3CO6C 2GA2A 1TNTA 4WX9A 1ON2A 1FT9A 1R00A 2M1BA 2V79A 2HOEA 1EH8A 3FMQA 1K6OA 4BHPA 3GX4X 5E1ZB 5BQTA 3GFLA 1LJ9A 1ON1A 1T2KA 1IN4A 2O3FA 2HZTA 2RGVA 3VFZA 1PDNC 4M9ZA 4JQFA 1ZRFA 3K0LA 3WTTC 3J81K 2MH9A 1IRGA 4OU0A 3KP7A 2QBYA 3N97A 3LA2A 4Q4ZF 2H94A 4EVIA 3R0AA 2CO5A 3IC7A 1UB9A 4XBFA 2VONA 4I2OA 3DQVC 2F5FA 2XAFA 2F5DA 2ISZA 3ELKA 3HSFA 1QZZA 4UHTA 3TKYA 2DLLA 3WGHA 4Q48A 1O3TA 5CVRA 1ZH5A 1SMTA 3T8RA 1ZARA 3I58A 5H6RA 4M9XA 3WTYC 3GFJA 3EUHA 2QENA 4YG2F 2DK8A 2ZBKA 1B59A 2FA5A 5HDKA 5CVVA 3ULQB 1IF1A 5LHGA 3BJOA 3E5QA 1RUOA 1G4DA 4OIPF 1KYZA 3W6KB 1ZAOA 4RGRA 5LRSA 4WWCA 2XROA 3F8MA 2Q8KA 4EJWA 3L7WA 1ZLKA 2DPDA 3GXOA 4NB5A 1E2XA 2DU9A 1R5HA 4XSZF 1ZGJA 1H9TA 2VOPA 4I02A 3F21A 1FZPB 2DI3A 3I0TA 2KIFA 4K2EA 3BPVA 1MJAA 4IXAA 2FSWA 5HDGA 5FFZA 3HSEA 3QU6A 2Q0OA 2GQQA 5JR3A 4FX4A 3DFGA 2YU3A 1JXSA 4EV0A 3EETA 1TQMA 4A6EA 5E1XA 2EWNA 1XB4A 1IXCA 2KIMA 2HDCA 4CYDA 1O57A 5D5WB 2ZMEB 1KGSA 5LRRA 3CUQC 1V3FA 3KP4A 3RKYA 2ZNZA 4LLGF 2KJBA 4ZYGA 5L3BA 1G3SA 3BZ6A 4DQ2A 1B6AA 5CJ9A 3E6DA 2HTJA 3DF8A 5L3DA 1SD7A 1T98A 4EM1A 3WGIA 1B4AA 4KNYA 3V4GA 2E7XA 1S7AA 5F6FA 3WODF 3F23A 4L9NA 4KDPA 1LEAA 2EK5A 2P7VB 1DDNA 1TNSA 1KYWA 4EJVA 4UV8A 4IRGA 5DYMA 4HYEA 1OR7A 4KFCA 2A07F 1ZN2A 2EFWA 5JI6A 3HTSB 3MCZA 2XAHA 1YQAA 4IPAA 2IJLA 4H0EA 2PG4A 5LBQA 2V1UA 3JTGA 3L00A 3ZN0A 3NQOA 2CW0F 3KP6A 1BOAA 3CLOA 3LQQA 2A6HF 3CTAA 4O6JA 1XMKA 1HQCA 1U5TB 3WGGA 3J81Z 2PLYA 4UV9A 2ISYA 1Y0UA 4RAZA 4B8XA 3GF2A 2VODA 4ZH4F 3WE2A 3ERED 4A12A 4XRFA 4WCGA 1XCVA 3KP3A 3ZMSA 5LGUA 1OPCA 4S04A 2RNJA 3QPTA 3QPHA 2GAUA 3HOSA 2M45A 5L3GA 1BC7C 3K1PA 4Q47A 3BY6A 1BC8C 1FBUA 1FP1D 4ZZDA 2ETHA 4I01A 5LHIA 2HGCA 4L5IA 1SD4A 2KJCA 1F5TA 1KA8A 3FF5A 3HSRA 3K9TA 3J80K 2DT5A 2YPRA 4M6YA 3WU1B 1KQ8A 5D5UB 3TQNA 1U8RA 3SZPA 2Y75A 1BIAA 4LMYA 1I1SA 4ON0A 1FWZA 4OIRF 3I71A 3PFIA 4HBLA 2LDUA 3Q9SA 4P5OA 4EQQA 3HOTA 4UNOA 2PQ8A 4ENJA 1BBYA 1RUNA 4P96A 4OMZA 4ESBA 2HKXA 1QGPA 3RDIA 2DFIA 1W5TA 1KU7A 3I5UA 4EJOA 1IN8A 3FXQA 5AIQA 1Z6RA 1EV7A 1BI0A 2L54A 2VT2A 1I27A 2XV4S 3CDHA 2FNAA 2Z33A 3ZMVA 2X4HA 2XKPA 1U3EM 1OYYA 2Z99A 3E5XA 1ODDA 1XDSA 1ZGAA 3IRQA 5D8LB 2BV6A 3DV8A 1SFEA 2FEZA 4HF2A 2JZYA 1O7LA 1K78B 1ZREA 2RN7A 1GHCA 3WTXC 2A68F 2F5EA 4RAYA 1DPUA 4YFKF 2Z3YA 2V6CA 4XSXF 1D8JA 3NRVA 4Z2YA 4ENNA 2YX4A 2ZXJA 4IJAA 4MEYF 5DCMB 1DP7P 1F9NA 3F3XA 4M72A 2OQRA 3GUDA 1G3YA 2L4MA 2YX7A 3JW4A 3E5UA 2FNPA 3D0SA 3ZPLA 5H20A 3KE2A 2B0LA 3K69A 4Y13A 2UZKA 1R1VA 3IL2A 3HRTA 5CVUA 3T5XA 1W7PB 2R7FA 4L9TA 4L9JA 2P8TA 4BHCA 2VC1A 5EEHA 3FX3A 4IVNA 3CO7C 1TQPA 1HW5A 4YIFA 3V8LA 2FOKA 2JSCA 5E18F 4I0AA 1FYLA 2JPCA 1R22A 4N0BA 1Z9CA 1FBSA 3ZQ7A 3L9FA 3M8EA 3I59B 4UVAA 3RYPA 1Z7UA 2D1HA 2PMUA 3LA7A 1J75A 1FPQA 2PFBA 4I0BA 4N9HA 3H3ZA 1RNLA 2GIVA 4OINF 5AIPA 2BE5F 4MHGA 1WWXA 3R4KA 3T1BA 2ELHA 3FXRA 4RGSA 3KLNA 2MD5A 4L0YB 1JHHA 5HLGA 1XN7A 5LGNA 3DPLC 3WU0A 3BJAA 2PJPA 5J8CA 2NNNA 2XUBA 3V7RA 2VBWA 4ETSA 5LEKA 2IA1A 3BJ6A 3JAMZ 4KYWA 4A0YA 3DXJF 5L3EA 5BPIA 4U0VA 1W7PD 3F6OA 3TOBA 2PI0A 5H6QA 2OQGA 3J80Z 1J59A 4U0YA 3ZMDA 1PP7U 4YIIA 3U2RA 1WI9A 4R79A 2FE3A 2BBYA 2WV0A 2CWEA 4LB5A 1QQIA 3ECHA 2DW4A 2QVOA 1J7KA 3CUQA 3NEUA 4A5NA 2DAOA 2QBYB 5L3CA 2EV0A 2K86A 1DUXC 2P6SA 3GLXA 2J5OA 4ESFA 1FOKA 3V7CA 2QUFA 1YLFA 3MAJA 3BWGA 1P4AA 4EMSA 3KCCA 5TRDA 3C3WA 2E1NA 5A2QK 5E17F 3O2PE 1SMYF 1I5ZA 4P9FA 3W6JB 1MD0A 4YFNF 4GYIA 4M73A 1QBJA 2XRNA 2A3SA 1R7JA 2HKOA 4M6XA 1O3SA 1TQIA 1ZHFA 5K5QA 3I4PA 1KQ9A 3KEOA 4PCQA 3HRUA 1PUEE 4F7ZA 2JT1A 1YO5C 2CSOA 5IT3A 5BOXA 5D8KB 4HDVA 3LAJA 5DEQA 4KN7X 4BNCA 1FYKA 4BAYA 5BPDA 3F8NA 2LNBA 3R0JA 2W24A 2OAZA 2VE8A 4I7HA 3JSPA 4U0WA 3VODA 1J2XA 2ESHA 2GXBA 3FM5A 5ICEA 3C18A 3HHGA 4EM2A 3FWEA 5K5RA 2NS0A 3AAFA 2QZ8A 4TV7A 5LLQA 4IRHA 4KIBA 5HOOA 2MH2A 4WXHA 3T8TA 1HW2A 5DV5A 1FSEA 2H09A 5E8IA 2ADUA 5ILVA 2Y48A 3J7AO 4PGHA 2LSOA 1HKSA 5D4SA 4PDKA 2XASA 1IN7A 4RB2C 3P9IA 3PQJA 3TO7A 4KIFA 1FLIA 1WSUA 1LDKB 2ZNYA 2M8EA 2CG4A 5HDNA 4LK1F 2KRFA 1QO0D 2BGCA 4KMUX 1P4WA 4HLXA 5HS8A 1D8KA 3M1EA 2G9WA 4LK0F 2FXAA 3C7JA 2E1CA 1SFUA 1MJBA 1FY7A 3O3KA 1ULYA 5DUIA 1CGPA 3GWZA 4RS8A 3HHHA 4U88A 2GXGA 3HTUA 1Q1HA 3M9AA 4WXCA 4AIHA 2IW5A 4NQWA 4O5VA 2XAGA 4QLCU 2O03A 5D5XB 3OOPA 3R6SA 2VE9A 1XGNA 2BEOA 4P9UA 2K02A 2EA4A 2YSRA 1A04A 4CICA 3H3UA 3CUOA 4HW0A 4G7OF 4U7BA 2ZCWA 3BPXA 4G7HF 3HRMA 2O0YA 1XSDA 4RB1A 1ZG1A 1HKQA 3D5LA 1O7FA 2PN6A 1QZYA 2A6EF 1LVAA 1D3YA 3GO5A 2MBFA 1OYWA 3GZ5A 2WC2A 2DQRA 1ZYRF 1H9GA 1L0OC 3HUGA 2CYYA 3N4MA 5JVTA 5CVJA 2EFQA 1YW9A 3F6VA 4U7DA 1BI1A 4HF0A 4M74A 3E6BA 1MZBA 3IHUA 2FBIA 2HQRA 2A5YB 4KA4A 5E1WA 2FMLA 4M71A 4G7ZF 4AIKA 3JAMK 5A2QZ 4A0XA 1XGMA 4KMFA 2H6BA 1P92A 5AONA 2AS5F 4NHJA 3IRRA 3E6CC 2MC3A 3ZMUA 2UWMA 3BROA 4EM0B 4IF4A 5D4RA 2ZJ2A 1SAXA 1EH6A 1XCBA 2IPQX 4HLYA 1E17A 2R3SA 1EH7A 2D2WA 2M5WA 5DD4A 5IT9Z 3RTRA 1RIOH 1GXPA 1WQ2A 3R61A 4UXNA 5HS7A 1J9IA 1BI3A 1IXRC 1K7AA 2OZ6A 1XGOA 2M30A 3BOQA 3REOA 4A0ZA 3ROUA 2FBKA 1NHAA 3VEPA 4HX7A 2COMA 1QNTA 3VOEA 4ZZLA 4HQMA 2FMYA 2LF8A 1F4KA 3IWZA 3EYYA 5DUKA 2HYGD 1MDMB 3I54A 4DNCA 4HDUA 2DQLA 3BDDA 1KU3A 4A2UA 1YYVA 3QU3A 1BJAA 5HLIA 4MTEA 3MZHA 2STWA 3TOAA 1ZRCA 4OOIA 2GZWA 1CF7B 3RKXA 1ZLJA 2DK5A 2HEOA 3QP6A 2JRTA 1G6NA 2OBPA 1B1BA 1U5TC 1YG2A 1J0RA 4LB6B 1R23A 1D5VA 1XGSA 1K78A 5ED4A 1TW3A 3K2ZA 2D1VA 4BHBA 1KQ0A 1YFHA 1Z6TA 1LQ1A 2K4JA 2XGXA 1TLHB 5BMZA 3FM3A 2TDXA 3KP5A 4WXDA 2YR2A 3G73A 2W25A 2CFXA 5HVQC 5F64A 3FMRA 2KKOA 2IRFG 2QYOA 3LQRA 1IAWA 1V4RA 4XLPF 5CVIA 4HOBA 2XHKA 2J5PA 4PZJA 4ZYHA 5ICCA 5FLXZ 4A6DA 1FNNA 2EFOA 2AXLA 2Z9OA 2MLKA 2ZO4A 1MKMA 1XSXA 2HS5A 1U78A 2JTVA 4EGYA 5LHHA 2BYVE 4FX0A 4GCVA 4HQEA 3SFZA 4CHUA 5ILUA 4LGWA 1YS6A 2QLZA 1LNWA 1JE8A 4EJTA 1XMAA 3GVAA 3M7GA 2IP2A 3GEZA 3KZZA 4HF1A 5FD5A 5HS9A 2FBHA 4WF2A 4R1HA 1HKTA 3JSOA 2IA2A 3EDPA 4BXUA 2O8XA 4MGRA 2RKHA 1GXQA 3SHFA 1ZRDA 2EJRA 1XD7A 4LG0A 3L2CA 1UHWA 3DP7A 5ERIA 2VT3A 3ISPA 4P55A 2R7DA 1G3TA 4OIQF 5F1RA 4GXOA 3IKVA 2XAQA 1X3UA 2RC4A 2RVCA 1VTNC 1FYMA 4HX8A 5LEJA 2L01A 4E70A 3P9KA 2DTRA 4O3MA 4I98B 1R5GA 2W57A 2VBYA 2EV6A 5FD6A 2VOOA 3TO9A 2CQKA 1LDJA 2RV8A 1S6LA 1U6GA 5EEGA 1R1UA 1USTA 5FO5A 1W4MA 4ENMA 2JPBA 4FHTA 2QM3A 3K1NA 2VC0A 3ABUA 3CUQB 3ABTA 2V1XA 1R36A 3LFKA 3WG9A 2CGPA 2OZUA 4MTDA 2OA4A 4QWQA 4BQAA 4L18B 2Z5UA 1S7OA 3ZMTA 1U2WA 1OMIA 3RKWA 3TO6A 2H6CA 2MA3A 2Y0MA 3O6BB 3ZP5A 4I09A 5TJJA 4KICA 3RI4A 3ZMZA 3EYIA 2L02A 3LSTA 4GYGA 4Y15A 1QPMA 3U9GA 1DPRA 2GWRA 6PAXA 3MQ0A 5IT9K 1FC3A 1WKMA 2DPUA 3DKWA 5FB2A 1BI2A 1PP8F 1Z91A 4IHTA 3FMSA 4AIJA 4KT5C 2HTSA 5FGMA 3MFKA 4G6QA 2XKOA 5JHUA 3V8JA 3MEXA 3WE3A 2ZFWA 3DPTA 1LB2A 1XDUA 2G7UA 4ZYDA 2FRHA 3Q5FA 2GA1A 4YFXF 4UVBA 3FZVA 3KEQA 4HA8A 2LF7A 1XSVA 4JBAA 4WK8F 2K7LA 1REPC 3WTSC 5KVRA 1S8NA 2IT0A 3B02A 1FBQA 3QP5A 5L3FA 3BP8A 4M9SA 4OIOF 4S05A 2OU2A 3WTVC 1T39A 1T0FA 3E6MA 3SXYA 2ZMEA 4Y17A 3VB2A 4GO1A 2A61A 2RQPA 2EB7A 1LEBA 1IN6A 1AWCA 1L3LA 3WTWC 1UCRA 1HW1A 2EFPA 1S29A 1P6RA 2D45A 3ECOA 2K4BA 4MNUA 2F2EA 2EFNA 4IRIA 1K79A 3FXUA 5K1YA 2OD5A 3COAC 4ESJA 5ICFA 3EQLF 3G3ZA 1IZ1A 2ACJA 4MQVA 5J8FA 4CO8A 1Z05A 1LDDA 1SD6A 1RZ4A 1R58A 1BM9A 2W84A 3T0YA 1UHMA 3KP2A 1H0MA 3CJNA 3F72A 1BN5A 5CYVA 1AOYA 1HSTA 1JGSA 5FLXK 1UFMA 2EV5A 2P7CB 1F1ZA 4RB0A 1KU2A 1YTYA 2L4AA 4RGXA 1IUYA 2IVMA 3TDZC 2ZKZA 3GW2A 3MZYA 3FHZA 3QRFF 1IRFA 3IKTA 3P9CA 5J6XA 1TBXA 2KIUA 1WRJA 2L3DA 3K1MA 3S2WA 1IW7F 2P4WA 3M8FA 4KIGA 1U5TA 3SZTA 3E97A 4LD5A 4UUVA 4Q5SF 3RJPA 1USSA 1YW7A 1ZG5A 1Z1DA 2O61A 2VBXA 1I1GA 3HIFA 2QQ9A 2V9VA 3RPQA 3GZ6A 2HWVA 2IA0A 1O3QA 2H27A 3LAPA 1JHFA 1TTYA 2NAZA 3LA3A 3JTHA 2FU4A 4MQ9F 3LWFA 2QQAA 3OV8A 4LJZF 3RIRA 2X0LA 5FFXA 2F5CA 3F8CA 3KFWX 3TGNA 3V7SA 1SFXA 4ENKA 1HSJA 3WTZA 4CXFA 4CZZA 4G6DA 4KN4X 2HR3A 4LFUA 4AVPA 2XVCA 3ML6A 5D6EA 4N9IA 2HQNA 1P2FA 5CLSA 3E3VA 2HYFA 4CGZA 5JFRA 2WWYA 1FX7A 3B73A 3I64A 3RPUA 1BIBA 4XLNF 4L0ZB 2WTEA 4IHSA 4HX4A 3L09A 4OMYA 1W5SA 1MJ9A 1I6XA 3KZYA 3R60A 3I53A 1S3JA 2VBZA 1ZG3A 1KU9A 2P6TA 1FSHA 3HRSA 3C1DA 2VN2A 4G94A 3WTUC 4AWXB 2HFHA 5LGTA 3F8FA 1MDMA 3IWFA 1HXDA 1B9NA 4ASNA 4UVCA 2C6YA 5ICGA 2PBIA 3MWMA 2XIGA 1MGTA 3V8KA 3QAHA 1CF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS6 A;  4HZF A;  5HLH A;  1OKR A;  3PQK A;  2NRA C;  1YW8 A;  2EA2 A;  4AD9 A;  2VXZ A;  4LLN A;  4HV5 A;  1P4X A;  5E20 A;  4EJU A;  5ILS A;  3U1D A;  4BH9 A;  5D6F A;  2P5K A;  1IN5 A;  4D0P A;  1OYI A;  2G7H A;  2P5L C;  5K5O A;  2V1D A;  4JK1 X;  2QQB A;  2NNY A;  2NYX A;  4MEX F;  2DO7 A;  1YIO A;  2QWW A;  1B9M A;  3Q9V A;  2Q2E A;  2W85 A;  2RDP A;  2ESN A;  4CDG A;  5DCM A;  1O3R A;  4FT8 A;  5DDG A;  3F22 A;  2P5V A;  2MLG A;  2K27 A;  5E8G A;  3KLO A;  2UXN A;  1SD5 A;  2M87 A;  5DD8 A;  4KUM A;  1IXS B;  1ONV A;  3RYR A;  2O6G E;  1W7P A;  1C0W A;  4G9Y A;  1G3W A;  4RB3 C;  1FP2 A;  5KK1 A;  4A5M A;  2UXX A;  4HV6 A;  1RI7 A;  1J5Y A;  4PGG A;  4G8X A;  4LLL A;  2FQ3 A;  4L9V A;  1T6S A;  3ZN1 A;  3H92 A;  4GGG A;  4R8H A;  1R1T A;  3I59 A;  1TW2 A;  2PEX A;  2DBB A;  2A69 F;  3KET A;  3GFM A;  3HYI A;  4HAM A;  3TDU C;  2FF4 A;  4BYY A;  5DCF A;  2LKP A;  3DEU A;  4B09 A;  3GFI A;  4ZYE A;  1HBX G;  2E7W A;  3F8B A;  1STZ A;  1GVJ A;  1YS7 A;  2PMH A;  2STT A;  3QOP A;  4RGU A;  3GYH X;  4EGZ A;  5D5V B;  4LG0 B;  3SQN A;  4L5J A;  2XAJ A;  3P7N A;  1T38 A;  3CO6 C;  2GA2 A;  1TNT A;  4WX9 A;  1ON2 A;  1FT9 A;  1R00 A;  2M1B A;  2V79 A;  2HOE A;  1EH8 A;  3FMQ A;  1K6O A;  4BHP A;  3GX4 X;  5E1Z B;  5BQT A;  3GFL A;  1LJ9 A;  1ON1 A;  1T2K A;  1IN4 A;  2O3F A;  2HZT A;  2RGV A;  3VFZ A;  1PDN C;  4M9Z A;  4JQF A;  1ZRF A;  3K0L A;  3WTT C;  3J81 K;  2MH9 A;  1IRG A;  4OU0 A;  3KP7 A;  2QBY A;  3N97 A;  3LA2 A;  4Q4Z F;  2H94 A;  4EVI A;  3R0A A;  2CO5 A;  3IC7 A;  1UB9 A;  4XBF A;  2VON A;  4I2O A;  3DQV C;  2F5F A;  2XAF A;  2F5D A;  2ISZ A;  3ELK A;  3HSF A;  1QZZ A;  4UHT A;  3TKY A;  2DLL A;  3WGH A;  4Q48 A;  1O3T A;  5CVR A;  1ZH5 A;  1SMT A;  3T8R A;  1ZAR A;  3I58 A;  5H6R A;  4M9X A;  3WTY C;  3GFJ A;  3EUH A;  2QEN A;  4YG2 F;  2DK8 A;  2ZBK A;  1B59 A;  2FA5 A;  5HDK A;  5CVV A;  3ULQ B;  1IF1 A;  5LHG A;  3BJO A;  3E5Q A;  1RUO A;  1G4D A;  4OIP F;  1KYZ A;  3W6K B;  1ZAO A;  4RGR A;  5LRS A;  4WWC A;  2XRO A;  3F8M A;  2Q8K A;  4EJW A;  3L7W A;  1ZLK A;  2DPD A;  3GXO A;  4NB5 A;  1E2X A;  2DU9 A;  1R5H A;  4XSZ F;  1ZGJ A;  1H9T A;  2VOP A;  4I02 A;  3F21 A;  1FZP B;  2DI3 A;  3I0T A;  2KIF A;  4K2E A;  3BPV A;  1MJA A;  4IXA A;  2FSW A;  5HDG A;  5FFZ A;  3HSE A;  3QU6 A;  2Q0O A;  2GQQ A;  5JR3 A;  4FX4 A;  3DFG A;  2YU3 A;  1JXS A;  4EV0 A;  3EET A;  1TQM A;  4A6E A;  5E1X A;  2EWN A;  1XB4 A;  1IXC A;  2KIM A;  2HDC A;  4CYD A;  1O57 A;  5D5W B;  2ZME B;  1KGS A;  5LRR A;  3CUQ C;  1V3F A;  3KP4 A;  3RKY A;  2ZNZ A;  4LLG F;  2KJB A;  4ZYG A;  5L3B A;  1G3S A;  3BZ6 A;  4DQ2 A;  1B6A A;  5CJ9 A;  3E6D A;  2HTJ A;  3DF8 A;  5L3D A;  1SD7 A;  1T98 A;  4EM1 A;  3WGI A;  1B4A A;  4KNY A;  3V4G A;  2E7X A;  1S7A A;  5F6F A;  3WOD F;  3F23 A;  4L9N A;  4KDP A;  1LEA A;  2EK5 A;  2P7V B;  1DDN A;  1TNS A;  1KYW A;  4EJV A;  4UV8 A;  4IRG A;  5DYM A;  4HYE A;  1OR7 A;  4KFC A;  2A07 F;  1ZN2 A;  2EFW A;  5JI6 A;  3HTS B;  3MCZ A;  2XAH A;  1YQA A;  4IPA A;  2IJL A;  4H0E A;  2PG4 A;  5LBQ A;  2V1U A;  3JTG A;  3L00 A;  3ZN0 A;  3NQO A;  2CW0 F;  3KP6 A;  1BOA A;  3CLO A;  3LQQ A;  2A6H F;  3CTA A;  4O6J A;  1XMK A;  1HQC A;  1U5T B;  3WGG A;  3J81 Z;  2PLY A;  4UV9 A;  2ISY A;  1Y0U A;  4RAZ A;  4B8X A;  3GF2 A;  2VOD A;  4ZH4 F;  3WE2 A;  3ERE D;  4A12 A;  4XRF A;  4WCG A;  1XCV A;  3KP3 A;  3ZMS A;  5LGU A;  1OPC A;  4S04 A;  2RNJ A;  3QPT A;  3QPH A;  2GAU A;  3HOS A;  2M45 A;  5L3G A;  1BC7 C;  3K1P A;  4Q47 A;  3BY6 A;  1BC8 C;  1FBU A;  1FP1 D;  4ZZD A;  2ETH A;  4I01 A;  5LHI A;  2HGC A;  4L5I A;  1SD4 A;  2KJC A;  1F5T A;  1KA8 A;  3FF5 A;  3HSR A;  3K9T A;  3J80 K;  2DT5 A;  2YPR A;  4M6Y A;  3WU1 B;  1KQ8 A;  5D5U B;  3TQN A;  1U8R A;  3SZP A;  2Y75 A;  1BIA A;  4LMY A;  1I1S A;  4ON0 A;  1FWZ A;  4OIR F;  3I71 A;  3PFI A;  4HBL A;  2LDU A;  3Q9S A;  4P5O A;  4EQQ A;  3HOT A;  4UNO A;  2PQ8 A;  4ENJ A;  1BBY A;  1RUN A;  4P96 A;  4OMZ A;  4ESB A;  2HKX A;  1QGP A;  3RDI A;  2DFI A;  1W5T A;  1KU7 A;  3I5U A;  4EJO A;  1IN8 A;  3FXQ A;  5AIQ A;  1Z6R A;  1EV7 A;  1BI0 A;  2L54 A;  2VT2 A;  1I27 A;  2XV4 S;  3CDH A;  2FNA A;  2Z33 A;  3ZMV A;  2X4H A;  2XKP A;  1U3E M;  1OYY A;  2Z99 A;  3E5X A;  1ODD A;  1XDS A;  1ZGA A;  3IRQ A;  5D8L B;  2BV6 A;  3DV8 A;  1SFE A;  2FEZ A;  4HF2 A;  2JZY A;  1O7L A;  1K78 B;  1ZRE A;  2RN7 A;  1GHC A;  3WTX C;  2A68 F;  2F5E A;  4RAY A;  1DPU A;  4YFK F;  2Z3Y A;  2V6C A;  4XSX F;  1D8J A;  3NRV A;  4Z2Y A;  4ENN A;  2YX4 A;  2ZXJ A;  4IJA A;  4MEY F;  5DCM B;  1DP7 P;  1F9N A;  3F3X A;  4M72 A;  2OQR A;  3GUD A;  1G3Y A;  2L4M A;  2YX7 A;  3JW4 A;  3E5U A;  2FNP A;  3D0S A;  3ZPL A;  5H20 A;  3KE2 A;  2B0L A;  3K69 A;  4Y13 A;  2UZK A;  1R1V A;  3IL2 A;  3HRT A;  5CVU A;  3T5X A;  1W7P B;  2R7F A;  4L9T A;  4L9J A;  2P8T A;  4BHC A;  2VC1 A;  5EEH A;  3FX3 A;  4IVN A;  3CO7 C;  1TQP A;  1HW5 A;  4YIF A;  3V8L A;  2FOK A;  2JSC A;  5E18 F;  4I0A A;  1FYL A;  2JPC A;  1R22 A;  4N0B A;  1Z9C A;  1FBS A;  3ZQ7 A;  3L9F A;  3M8E A;  3I59 B;  4UVA A;  3RYP A;  1Z7U A;  2D1H A;  2PMU A;  3LA7 A;  1J75 A;  1FPQ A;  2PFB A;  4I0B A;  4N9H A;  3H3Z A;  1RNL A;  2GIV A;  4OIN F;  5AIP A;  2BE5 F;  4MHG A;  1WWX A;  3R4K A;  3T1B A;  2ELH A;  3FXR A;  4RGS A;  3KLN A;  2MD5 A;  4L0Y B;  1JHH A;  5HLG A;  1XN7 A;  5LGN A;  3DPL C;  3WU0 A;  3BJA A;  2PJP A;  5J8C A;  2NNN A;  2XUB A;  3V7R A;  2VBW A;  4ETS A;  5LEK A;  2IA1 A;  3BJ6 A;  3JAM Z;  4KYW A;  4A0Y A;  3DXJ F;  5L3E A;  5BPI A;  4U0V A;  1W7P D;  3F6O A;  3TOB A;  2PI0 A;  5H6Q A;  2OQG A;  3J80 Z;  1J59 A;  4U0Y A;  3ZMD A;  1PP7 U;  4YII A;  3U2R A;  1WI9 A;  4R79 A;  2FE3 A;  2BBY A;  2WV0 A;  2CWE A;  4LB5 A;  1QQI A;  3ECH A;  2DW4 A;  2QVO A;  1J7K A;  3CUQ A;  3NEU A;  4A5N A;  2DAO A;  2QBY B;  5L3C A;  2EV0 A;  2K86 A;  1DUX C;  2P6S A;  3GLX A;  2J5O A;  4ESF A;  1FOK A;  3V7C A;  2QUF A;  1YLF A;  3MAJ A;  3BWG A;  1P4A A;  4EMS A;  3KCC A;  5TRD A;  3C3W A;  2E1N A;  5A2Q K;  5E17 F;  3O2P E;  1SMY F;  1I5Z A;  4P9F A;  3W6J B;  1MD0 A;  4YFN F;  4GYI A;  4M73 A;  1QBJ A;  2XRN A;  2A3S A;  1R7J A;  2HKO A;  4M6X A;  1O3S A;  1TQI A;  1ZHF A;  5K5Q A;  3I4P A;  1KQ9 A;  3KEO A;  4PCQ A;  3HRU A;  1PUE E;  4F7Z A;  2JT1 A;  1YO5 C;  2CSO A;  5IT3 A;  5BOX A;  5D8K B;  4HDV A;  3LAJ A;  5DEQ A;  4KN7 X;  4BNC A;  1FYK A;  4BAY A;  5BPD A;  3F8N A;  2LNB A;  3R0J A;  2W24 A;  2OAZ A;  2VE8 A;  4I7H A;  3JSP A;  4U0W A;  3VOD A;  1J2X A;  2ESH A;  2GXB A;  3FM5 A;  5ICE A;  3C18 A;  3HHG A;  4EM2 A;  3FWE A;  5K5R A;  2NS0 A;  3AAF A;  2QZ8 A;  4TV7 A;  5LLQ A;  4IRH A;  4KIB A;  5HOO A;  2MH2 A;  4WXH A;  3T8T A;  1HW2 A;  5DV5 A;  1FSE A;  2H09 A;  5E8I A;  2ADU A;  5ILV A;  2Y48 A;  3J7A O;  4PGH A;  2LSO A;  1HKS A;  5D4S A;  4PDK A;  2XAS A;  1IN7 A;  4RB2 C;  3P9I A;  3PQJ A;  3TO7 A;  4KIF A;  1FLI A;  1WSU A;  1LDK B;  2ZNY A;  2M8E A;  2CG4 A;  5HDN A;  4LK1 F;  2KRF A;  1QO0 D;  2BGC A;  4KMU X;  1P4W A;  4HLX A;  5HS8 A;  1D8K A;  3M1E A;  2G9W A;  4LK0 F;  2FXA A;  3C7J A;  2E1C A;  1SFU A;  1MJB A;  1FY7 A;  3O3K A;  1ULY A;  5DUI A;  1CGP A;  3GWZ A;  4RS8 A;  3HHH A;  4U88 A;  2GXG A;  3HTU A;  1Q1H A;  3M9A A;  4WXC A;  4AIH A;  2IW5 A;  4NQW A;  4O5V A;  2XAG A;  4QLC U;  2O03 A;  5D5X B;  3OOP A;  3R6S A;  2VE9 A;  1XGN A;  2BEO A;  4P9U A;  2K02 A;  2EA4 A;  2YSR A;  1A04 A;  4CIC A;  3H3U A;  3CUO A;  4HW0 A;  4G7O F;  4U7B A;  2ZCW A;  3BPX A;  4G7H F;  3HRM A;  2O0Y A;  1XSD A;  4RB1 A;  1ZG1 A;  1HKQ A;  3D5L A;  1O7F A;  2PN6 A;  1QZY A;  2A6E F;  1LVA A;  1D3Y A;  3GO5 A;  2MBF A;  1OYW A;  3GZ5 A;  2WC2 A;  2DQR A;  1ZYR F;  1H9G A;  1L0O C;  3HUG A;  2CYY A;  3N4M A;  5JVT A;  5CVJ A;  2EFQ A;  1YW9 A;  3F6V A;  4U7D A;  1BI1 A;  4HF0 A;  4M74 A;  3E6B A;  1MZB A;  3IHU A;  2FBI A;  2HQR A;  2A5Y B;  4KA4 A;  5E1W A;  2FML A;  4M71 A;  4G7Z F;  4AIK A;  3JAM K;  5A2Q Z;  4A0X A;  1XGM A;  4KMF A;  2H6B A;  1P92 A;  5AON A;  2AS5 F;  4NHJ A;  3IRR A;  3E6C C;  2MC3 A;  3ZMU A;  2UWM A;  3BRO A;  4EM0 B;  4IF4 A;  5D4R A;  2ZJ2 A;  1SAX A;  1EH6 A;  1XCB A;  2IPQ X;  4HLY A;  1E17 A;  2R3S A;  1EH7 A;  2D2W A;  2M5W A;  5DD4 A;  5IT9 Z;  3RTR A;  1RIO H;  1GXP A;  1WQ2 A;  3R61 A;  4UXN A;  5HS7 A;  1J9I A;  1BI3 A;  1IXR C;  1K7A A;  2OZ6 A;  1XGO A;  2M30 A;  3BOQ A;  3REO A;  4A0Z A;  3ROU A;  2FBK A;  1NHA A;  3VEP A;  4HX7 A;  2COM A;  1QNT A;  3VOE A;  4ZZL A;  4HQM A;  2FMY A;  2LF8 A;  1F4K A;  3IWZ A;  3EYY A;  5DUK A;  2HYG D;  1MDM B;  3I54 A;  4DNC A;  4HDU A;  2DQL A;  3BDD A;  1KU3 A;  4A2U A;  1YYV A;  3QU3 A;  1BJA A;  5HLI A;  4MTE A;  3MZH A;  2STW A;  3TOA A;  1ZRC A;  4OOI A;  2GZW A;  1CF7 B;  3RKX A;  1ZLJ A;  2DK5 A;  2HEO A;  3QP6 A;  2JRT A;  1G6N A;  2OBP A;  1B1B A;  1U5T C;  1YG2 A;  1J0R A;  4LB6 B;  1R23 A;  1D5V A;  1XGS A;  1K78 A;  5ED4 A;  1TW3 A;  3K2Z A;  2D1V A;  4BHB A;  1KQ0 A;  1YFH A;  1Z6T A;  1LQ1 A;  2K4J A;  2XGX A;  1TLH B;  5BMZ A;  3FM3 A;  2TDX A;  3KP5 A;  4WXD A;  2YR2 A;  3G73 A;  2W25 A;  2CFX A;  5HVQ C;  5F64 A;  3FMR A;  2KKO A;  2IRF G;  2QYO A;  3LQR A;  1IAW A;  1V4R A;  4XLP F;  5CVI A;  4HOB A;  2XHK A;  2J5P A;  4PZJ A;  4ZYH A;  5ICC A;  5FLX Z;  4A6D A;  1FNN A;  2EFO A;  2AXL A;  2Z9O A;  2MLK A;  2ZO4 A;  1MKM A;  1XSX A;  2HS5 A;  1U78 A;  2JTV A;  4EGY A;  5LHH A;  2BYV E;  4FX0 A;  4GCV A;  4HQE A;  3SFZ A;  4CHU A;  5ILU A;  4LGW A;  1YS6 A;  2QLZ A;  1LNW A;  1JE8 A;  4EJT A;  1XMA A;  3GVA A;  3M7G A;  2IP2 A;  3GEZ A;  3KZZ A;  4HF1 A;  5FD5 A;  5HS9 A;  2FBH A;  4WF2 A;  4R1H A;  1HKT A;  3JSO A;  2IA2 A;  3EDP A;  4BXU A;  2O8X A;  4MGR A;  2RKH A;  1GXQ A;  3SHF A;  1ZRD A;  2EJR A;  1XD7 A;  4LG0 A;  3L2C A;  1UHW A;  3DP7 A;  5ERI A;  2VT3 A;  3ISP A;  4P55 A;  2R7D A;  1G3T A;  4OIQ F;  5F1R A;  4GXO A;  3IKV A;  2XAQ A;  1X3U A;  2RC4 A;  2RVC A;  1VTN C;  1FYM A;  4HX8 A;  5LEJ A;  2L01 A;  4E70 A;  3P9K A;  2DTR A;  4O3M A;  4I98 B;  1R5G A;  2W57 A;  2VBY A;  2EV6 A;  5FD6 A;  2VOO A;  3TO9 A;  2CQK A;  1LDJ A;  2RV8 A;  1S6L A;  1U6G A;  5EEG A;  1R1U A;  1UST A;  5FO5 A;  1W4M A;  4ENM A;  2JPB A;  4FHT A;  2QM3 A;  3K1N A;  2VC0 A;  3ABU A;  3CUQ B;  3ABT A;  2V1X A;  1R36 A;  3LFK A;  3WG9 A;  2CGP A;  2OZU A;  4MTD A;  2OA4 A;  4QWQ A;  4BQA A;  4L18 B;  2Z5U A;  1S7O A;  3ZMT A;  1U2W A;  1OMI A;  3RKW A;  3TO6 A;  2H6C A;  2MA3 A;  2Y0M A;  3O6B B;  3ZP5 A;  4I09 A;  5TJJ A;  4KIC A;  3RI4 A;  3ZMZ A;  3EYI A;  2L02 A;  3LST A;  4GYG A;  4Y15 A;  1QPM A;  3U9G A;  1DPR A;  2GWR A;  6PAX A;  3MQ0 A;  5IT9 K;  1FC3 A;  1WKM A;  2DPU A;  3DKW A;  5FB2 A;  1BI2 A;  1PP8 F;  1Z91 A;  4IHT A;  3FMS A;  4AIJ A;  4KT5 C;  2HTS A;  5FGM A;  3MFK A;  4G6Q A;  2XKO A;  5JHU A;  3V8J A;  3MEX A;  3WE3 A;  2ZFW A;  3DPT A;  1LB2 A;  1XDU A;  2G7U A;  4ZYD A;  2FRH A;  3Q5F A;  2GA1 A;  4YFX F;  4UVB A;  3FZV A;  3KEQ A;  4HA8 A;  2LF7 A;  1XSV A;  4JBA A;  4WK8 F;  2K7L A;  1REP C;  3WTS C;  5KVR A;  1S8N A;  2IT0 A;  3B02 A;  1FBQ A;  3QP5 A;  5L3F A;  3BP8 A;  4M9S A;  4OIO F;  4S05 A;  2OU2 A;  3WTV C;  1T39 A;  1T0F A;  3E6M A;  3SXY A;  2ZME A;  4Y17 A;  3VB2 A;  4GO1 A;  2A61 A;  2RQP A;  2EB7 A;  1LEB A;  1IN6 A;  1AWC A;  1L3L A;  3WTW C;  1UCR A;  1HW1 A;  2EFP A;  1S29 A;  1P6R A;  2D45 A;  3ECO A;  2K4B A;  4MNU A;  2F2E A;  2EFN A;  4IRI A;  1K79 A;  3FXU A;  5K1Y A;  2OD5 A;  3COA C;  4ESJ A;  5ICF A;  3EQL F;  3G3Z A;  1IZ1 A;  2ACJ A;  4MQV A;  5J8F A;  4CO8 A;  1Z05 A;  1LDD A;  1SD6 A;  1RZ4 A;  1R58 A;  1BM9 A;  2W84 A;  3T0Y A;  1UHM A;  3KP2 A;  1H0M A;  3CJN A;  3F72 A;  1BN5 A;  5CYV A;  1AOY A;  1HST A;  1JGS A;  5FLX K;  1UFM A;  2EV5 A;  2P7C B;  1F1Z A;  4RB0 A;  1KU2 A;  1YTY A;  2L4A A;  4RGX A;  1IUY A;  2IVM A;  3TDZ C;  2ZKZ A;  3GW2 A;  3MZY A;  3FHZ A;  3QRF F;  1IRF A;  3IKT A;  3P9C A;  5J6X A;  1TBX A;  2KIU A;  1WRJ A;  2L3D A;  3K1M A;  3S2W A;  1IW7 F;  2P4W A;  3M8F A;  4KIG A;  1U5T A;  3SZT A;  3E97 A;  4LD5 A;  4UUV A;  4Q5S F;  3RJP A;  1USS A;  1YW7 A;  1ZG5 A;  1Z1D A;  2O61 A;  2VBX A;  1I1G A;  3HIF A;  2QQ9 A;  2V9V A;  3RPQ A;  3GZ6 A;  2HWV A;  2IA0 A;  1O3Q A;  2H27 A;  3LAP A;  1JHF A;  1TTY A;  2NAZ A;  3LA3 A;  3JTH A;  2FU4 A;  4MQ9 F;  3LWF A;  2QQA A;  3OV8 A;  4LJZ F;  3RIR A;  2X0L A;  5FFX A;  2F5C A;  3F8C A;  3KFW X;  3TGN A;  3V7S A;  1SFX A;  4ENK A;  1HSJ A;  3WTZ A;  4CXF A;  4CZZ A;  4G6D A;  4KN4 X;  2HR3 A;  4LFU A;  4AVP A;  2XVC A;  3ML6 A;  5D6E A;  4N9I A;  2HQN A;  1P2F A;  5CLS A;  3E3V A;  2HYF A;  4CGZ A;  5JFR A;  2WWY A;  1FX7 A;  3B73 A;  3I64 A;  3RPU A;  1BIB A;  4XLN F;  4L0Z B;  2WTE A;  4IHS A;  4HX4 A;  3L09 A;  4OMY A;  1W5S A;  1MJ9 A;  1I6X A;  3KZY A;  3R60 A;  3I53 A;  1S3J A;  2VBZ A;  1ZG3 A;  1KU9 A;  2P6T A;  1FSH A;  3HRS A;  3C1D A;  2VN2 A;  4G94 A;  3WTU C;  4AWX B;  2HFH A;  5LGT A;  3F8F A;  1MDM A;  3IWF A;  1HXD A;  1B9N A;  4ASN A;  4UVC A;  2C6Y A;  5ICG A;  2PBI A;  3MWM A;  2XIG A;  1MGT A;  3V8K A;  3QAH A;  1CF7 A; 
#chains in the Genus database with same CATH topology
 5BS6 A;  4HZF A;  5HLH A;  1OKR A;  3PQK A;  3BC8 A;  2NRA C;  5EG0 B;  1YW8 A;  2KMU A;  2EA2 A;  4AD9 A;  5E3O A;  4J00 A;  2VXZ A;  4LLN A;  4HV5 A;  1P4X A;  5E20 A;  4XKB A;  4EJU A;  5ILS A;  3U1D A;  1MIJ A;  4BH9 A;  5D6F A;  2P5K A;  4II2 A;  5K7H A;  3A2K A;  4QSH A;  4CCK A;  3FK6 A;  1IN5 A;  4D0P A;  5KNL A;  3GLL A;  1GV5 A;  1OYI A;  2G7H A;  2P5L C;  5K5O A;  2V1D A;  2DJN A;  1M1E B;  3K4K A;  4JK1 X;  4F92 B;  2XC7 A;  2QQB A;  4AID A;  2NNY A;  2NYX A;  3AG1 H;  2E5N A;  4MEX F;  2DO7 A;  3ASO H;  2LH9 A;  1YIO A;  3JRF A;  2QWW A;  1B9M A;  1VQ6 I;  3Q9V A;  4JP0 A;  1AU7 A;  2Q2E A;  4NUB A;  2W85 A;  2RDP A;  1WH7 A;  1VQ8 I;  2ESN A;  4CDG A;  5GAD J;  3CC2 I;  5DCM A;  1O3R A;  4FT8 A;  5DDG A;  2MC4 A;  3F22 A;  1MBF A;  2JVG A;  1X4P A;  2P5V A;  2OJE D;  2MLG A;  2K27 A;  2AHQ A;  5EGO A;  1D0X A;  3QYB A;  5E8G A;  3KLO A;  2UXN A;  3LL7 A;  4JYK A;  1SD5 A;  1UHS A;  4UB8 C;  2M87 A;  5DD8 A;  4KUM A;  1IXS B;  1ONV A;  3S93 A;  1ZR4 A;  3RYR A;  3CLQ A;  2O6G E;  1W7P A;  2Y2Z A;  2R7W A;  3QOD A;  3MKW B;  2GXA A;  1C0W A;  1R71 A;  4G9Y A;  1G3W A;  4RB3 C;  3S32 A;  1FP2 A;  2L9N A;  5KK1 A;  4A5M A;  2UXX A;  4HV6 A;  1RI7 A;  1J5Y A;  4PGG A;  5IP9 J;  4G8X A;  4LLL A;  1ERD A;  2ME0 A;  2FQ3 A;  4L9V A;  1T6S A;  1OLT A;  2M7B A;  4UY8 I;  3ZN1 A;  2LY2 A;  3H92 A;  4GGG A;  3QYE A;  4R8H A;  1U9O A;  1V5F A;  1R1T A;  2E5Z A;  3JRE A;  1D0Y A;  3JRI A;  4XLH A;  3CCV I;  3I59 A;  1TW2 A;  4F55 A;  3UR3 C;  4G12 A;  2PEX A;  2DBB A;  2A69 F;  5K7F A;  3KET A;  3GFM A;  1B8I B;  1OCC H;  3HYI A;  4HAM A;  3TDU C;  3CME I;  3HKZ N;  2FF4 A;  2QSH X;  1MNM C;  4NC6 A;  4BYY A;  5DCF A;  2FJ1 A;  2LKP A;  3DEU A;  3BG5 A;  2BW3 A;  4B09 A;  3GFI A;  2BY0 A;  4ZYE A;  1A31 A;  1HBX G;  2G0E A;  2E7W A;  1X3Z B;  3F8B A;  3PNY A;  2COB A;  3A02 A;  1STZ A;  1GVJ A;  1YS7 A;  2AO9 A;  2LFB A;  2PMH A;  2STT A;  4EAT A;  3K7A J;  4DJA A;  3QOP A;  1BW6 A;  4CH7 A;  3IUO A;  4RGU A;  3GYH X;  4EGZ A;  3CMY A;  4XOT A;  5D5V B;  4LG0 B;  3SQN A;  5J4Y A;  4L5J A;  4ZDP A;  2XAJ A;  1VFC A;  2EIK H;  2JA2 A;  2R5Z B;  3P7N A;  3D5R C;  2YU9 J;  2BXY A;  1T38 A;  1CQT A;  3CO6 C;  2GA2 A;  1TNT A;  1WGX A;  1P9Q C;  4WX9 A;  1ON2 A;  1FT9 A;  1R00 A;  2M1B A;  2V79 A;  2HOE A;  2XPW A;  1EH8 A;  3FMQ A;  1K6O A;  3MKZ A;  1K4T A;  4BHP A;  3GX4 X;  1ETO A;  2DTZ A;  5E1Z B;  5GPA A;  3GFL A;  1OCO H;  1Z0X A;  5BQT A;  1LJ9 A;  1ON1 A;  1T2K A;  1IN4 A;  2O3F A;  2HZT A;  2RGV A;  3VFZ A;  3I3L A;  1PDN C;  4QPQ A;  1DU0 A;  4RAG A;  1LFB A;  1ETQ A;  4M9Z A;  2LY1 A;  1XMX A;  4JQF A;  1ZRF A;  3K0L A;  3H0D A;  1W5C C;  4KT6 A;  2VKV A;  3WTT C;  3BG3 A;  3J81 K;  2MH9 A;  1IRG A;  3H5N A;  4OU0 A;  2CV2 A;  3J7Y J;  5IYD J;  1LVK A;  1Z67 A;  3KP7 A;  5GPC A;  4B3A A;  2ZXI A;  2QBY A;  1QRY A;  3N97 A;  2NS7 A;  3LA2 A;  4Q4Z F;  5FKM A;  3BR0 A;  2H94 A;  3OSF A;  3A0H C;  3VYT B;  4EVI A;  3R0A A;  2CO5 A;  2R7U A;  3IC7 A;  1UB9 A;  4BUP A;  1VQ7 I;  4XBF A;  2HVS A;  2VON A;  4I2O A;  3DQV C;  2F5F A;  3AKZ A;  1WJD A;  3CCL I;  5C4J J;  2XAF A;  1XC5 A;  3FIS A;  2F5D A;  2DA5 A;  2ISZ A;  1I3A A;  3D5S C;  3ELK A;  2XPU A;  2LBF B;  3HSF A;  1QZZ A;  4UHT A;  3TKY A;  2DLL A;  2F4M B;  1EA3 A;  1MSF C;  3WGH A;  4Q48 A;  1SAU A;  1O3T A;  1MSE C;  1GDT A;  5CVR A;  1ZH5 A;  3OYF A;  1IDZ A;  2VI6 A;  1SMT A;  3T8R A;  1Z3X A;  1ZAR A;  3I58 A;  5H6R A;  4A3I J;  1DGW Y;  2BZT A;  2W7N A;  4RMN A;  4KIT B;  4M9X A;  3WTY C;  2AXT C;  3GFJ A;  3I4M J;  3JCU C;  4C2T A;  3EUH A;  2QEN A;  2KT0 A;  4YG2 F;  2DK8 A;  3M3Y J;  3G2B A;  1ORK A;  3S1R J;  1WJC A;  2ZBK A;  4LIT A;  3HXL A;  3DCF A;  3FKI J;  2E2I J;  1B59 A;  1G59 A;  3DKY A;  2FA5 A;  1G8X A;  5HDK A;  2R7X A;  3NWT A;  5CVV A;  1MNE A;  3ULQ B;  1IF1 A;  2WAQ N;  3BG7 A;  5LHG A;  1WJB A;  1N78 A;  3BJO A;  3E5Q A;  4MO7 A;  3V8K A;  4A3K J;  1G4D A;  1RUO A;  2OTL I;  4OIP F;  3S1N J;  2E1M B;  2M8G X;  2DOE A;  1KYZ A;  4MFD A;  3W6K B;  1ZAO A;  1Y0N A;  4RGR A;  4BS9 A;  5LRS A;  4WWC A;  2XRO A;  4CUG A;  4GRI A;  3F8M A;  3ABK H;  2Q8K A;  4BQO A;  4EJW A;  3O8H A;  3VPR A;  3L7W A;  1ZLK A;  4ANJ A;  4BJ6 C;  2DPD A;  4A3G J;  2H1L A;  1UG0 A;  3ZQL A;  3GXO A;  4NB5 A;  1E2X A;  2DU9 A;  1R5H A;  2I8D A;  4XSZ F;  1ZGJ A;  2X48 A;  1H9T A;  1HLV A;  5KAI C;  3S14 J;  1ETW A;  2VOP A;  1TWA J;  4I02 A;  4FE7 A;  3F21 A;  1FZP B;  2DI3 A;  3I0T A;  2KIF A;  4DGW B;  4K2E A;  1TWC J;  3OYN A;  3BPV A;  2A6T A;  2V4J C;  1MJA A;  4IXA A;  3TP0 A;  2FSW A;  5HDG A;  4BKX A;  5GAG J;  2ZSI B;  2L7Z A;  2JQ7 A;  1MMD A;  2OUM A;  3W6V A;  2VQG A;  5FFZ A;  3BR3 A;  2CRG A;  2ZSH B;  3HSE A;  3QU6 A;  2Q0O A;  4AYB A;  2DMP A;  2GQQ A;  5JR3 A;  4FX4 A;  3G6E I;  2QKM B;  1VQ9 I;  4I99 C;  2CFO A;  1X1C A;  1DQU A;  3DFG A;  1WI3 A;  2YU3 A;  1FJL A;  1Y8Q B;  4FET A;  5E79 C;  1JXS A;  4EV0 A;  3OYL A;  3CJT B;  2JWT A;  2WY7 Q;  3EET A;  1TQM A;  4A6E A;  2ICW G;  5E1X A;  1N25 A;  2EWN A;  1XB4 A;  2LKS A;  2IAI A;  1IXC A;  2GOX B;  2F6C A;  4C3H J;  2KIM A;  2HDC A;  2BY2 A;  2K40 A;  2L2O A;  1ZGW A;  4CYD A;  1R4M B;  2QA4 I;  1O57 A;  5D5W B;  1JKR C;  1UG2 A;  2DMU A;  2ZME B;  3M4O J;  4B3X A;  1KGS A;  2GM4 A;  1YRN A;  3AL0 B;  3VDX A;  5LRR A;  3CUQ C;  1V3F A;  3KP4 A;  5EF6 A;  3RKY A;  1JJ8 C;  1X1A A;  2ZNZ A;  1MBE A;  5F0F A;  4IQ4 A;  5EZH A;  4IHY A;  4Y33 A;  3WHC A;  1A5J A;  2LLK A;  4LLG F;  2KJB A;  2M9H A;  4ZYG A;  1HF0 A;  1O4X A;  1RKW A;  1BW5 A;  1XX5 A;  5L3B A;  1G3S A;  4BBS J;  3BZ6 A;  4DQ2 A;  1B6A A;  5CJ9 A;  3E6D A;  2Q1Z B;  2HTJ A;  3JRC A;  3DF8 A;  5F1J A;  4CZC A;  1BR1 A;  5L3D A;  3W2W A;  1XS9 A;  2NOG A;  1SD7 A;  1T98 A;  3RKQ A;  4EM1 A;  3WGI A;  3HDD A;  3W2A A;  1B4A A;  4KNY A;  3V4G A;  2E7X A;  1S7A A;  1PUF B;  5C4X J;  1B72 B;  4ZYA A;  3BG6 A;  5F6F A;  3WOD F;  3F23 A;  4BL0 B;  4L9N A;  3EUH C;  4KDP A;  2JN6 A;  1LEA A;  4CYC A;  2EK5 A;  3CCS I;  2P7V B;  1DDN A;  2XDV A;  2ZJR F;  1XG1 A;  2N8G A;  1TNS A;  2OCE A;  1UZC A;  4CCN A;  2EZK A;  2VLA A;  1KYW A;  4EJV A;  4HRI A;  2L7M P;  4UV8 A;  2BHY A;  4IRG A;  2HOT A;  2W00 A;  4NQW B;  3GTK J;  5DYM A;  1MMG A;  5J1Y A;  4HYE A;  4KJZ A;  2KRH A;  4BY7 J;  1OR7 A;  4KFC A;  2R92 J;  2A07 F;  1ZN2 A;  2IGK A;  1WJ5 A;  4FAS D;  1X3W B;  2EFW A;  3ZGK A;  3FIW A;  5JI6 A;  4V2G A;  3HTS B;  3MCZ A;  1E0E A;  2HVQ A;  2XAH A;  1YQA A;  4NNJ A;  4IPA A;  4XR6 A;  2IJL A;  4H0E A;  2PG4 A;  5LBQ A;  2V1U A;  3JTG A;  3L00 A;  3ZN0 A;  3NQO A;  4CA0 A;  5KAF C;  2CW0 F;  1X4O A;  1IDY A;  3KP6 A;  1BOA A;  1VQO I;  3CLO A;  3LQQ A;  4XMY A;  2A6H F;  3CTA A;  4O6J A;  1XMK A;  4FIS A;  1HQC A;  2A05 A;  2LP0 A;  2WAE A;  1U5T B;  3MVP A;  3WGG A;  4C3J J;  3J81 Z;  2PLY A;  3GME A;  4UV9 A;  2ISY A;  1Y0U A;  2HPM A;  4RAZ A;  4B8X A;  3GF2 A;  2QF7 A;  1R5I D;  2VOD A;  1GUU A;  3ZQI A;  4ZH4 F;  4CCM A;  3WE2 A;  1ZEL A;  3ERE D;  4A12 A;  4PK4 A;  5HLT A;  3OSG A;  2NVQ J;  4XRF A;  3BZK A;  4WCG A;  1XCV A;  4ZTF A;  3KP3 A;  5FRN A;  4JX6 A;  2D5V A;  3ZMS A;  1N77 A;  3ZQH A;  2E60 A;  2CQQ A;  5LGU A;  1Y6I A;  4XQF A;  3QQA A;  1OPC A;  4S04 A;  2RNJ A;  1OFC X;  3DKX A;  2JA5 J;  1JKP C;  3QPT A;  1Y1W J;  3QPH A;  2GAU A;  3BLY A;  3HOS A;  2M45 A;  2JA8 J;  3OL4 A;  4BEH B;  5L3G A;  3H1C A;  3JRH A;  3CCU I;  3S17 J;  1ZQ3 P;  1BC7 C;  2RQQ A;  3K1P A;  4Q47 A;  3BY6 A;  1W0T A;  2K5C A;  1BC8 C;  2ID6 A;  1FBU A;  4XLA A;  1FP1 D;  4C9Y A;  4ZZD A;  2ETH A;  4I01 A;  5LHI A;  2LK2 A;  2HGC A;  3DBR B;  4L5I A;  3ZR8 X;  1SD4 A;  2KJC A;  1F5T A;  4CSW A;  2EH3 A;  1KA8 A;  3FF5 A;  3HSR A;  3K9T A;  3J80 K;  4X0G A;  3PIP F;  5F27 A;  2MAB A;  2CH0 A;  3A01 A;  4XON A;  1MMN A;  2DT5 A;  2IXS A;  3I55 I;  2R7Q A;  3RCO A;  2YPR A;  4IKF A;  2H8R A;  4M6Y A;  3WU1 B;  1KQ8 A;  3HGY A;  2P0W A;  5D5U B;  1SEU A;  3TQN A;  1U8R A;  3ONQ A;  4XM3 A;  3HOZ J;  3SZP A;  1IG7 A;  2Y75 A;  3MN2 A;  1BIA A;  2W1O A;  4LMY A;  1I1S A;  4ON0 A;  1FWZ A;  4OIR F;  3I71 A;  2LY9 A;  3PFI A;  4HBL A;  2LDU A;  1Y39 A;  3Q9S A;  4P5O A;  4EQQ A;  3HOT A;  4UNO A;  4DBQ A;  2PQ8 A;  4ENJ A;  1BBY A;  2ZFU A;  3GBG A;  1TL8 A;  1U8B A;  1RUN A;  2CS3 A;  2HU9 A;  2W4S A;  4P96 A;  4OMZ A;  4XLE A;  5B1B H;  1TP4 A;  4FCY A;  1K83 J;  3GTQ J;  3JRD A;  4ESB A;  2ZC2 A;  1OR7 C;  2HKX A;  1QGP A;  1YX5 A;  1Y8R B;  4I6Z A;  3RDI A;  2V9P A;  2DFI A;  2VL8 A;  1W5T A;  1KU7 A;  3I5U A;  1EJ9 A;  2PMZ A;  4EJO A;  1Z3Y A;  1ENH A;  4IOC F;  3A4C A;  2OPT A;  1IN8 A;  3QWL A;  3MMY B;  3OYI A;  1S7E A;  1XTA A;  3FXQ A;  4E6K G;  4DZP A;  2LOO A;  5AIQ A;  1Z6R A;  1SVL A;  1EV7 A;  1BI0 A;  5FKL A;  2L54 A;  4BAC A;  2VT2 A;  1I27 A;  2XV4 S;  3CDH A;  2FNA A;  3EPZ A;  2Z33 A;  3ZMV A;  2X4H A;  5EEA A;  2XKP A;  2H8W A;  1U3E M;  1OYY A;  4W97 A;  2Z99 A;  3E5X A;  1ODD A;  1XDS A;  1ZGA A;  3IRQ A;  2BV6 A;  5D8L B;  3DV8 A;  3ZQC A;  1SFE A;  2FEZ A;  4IZZ A;  3OYH A;  4HF2 A;  2JZY A;  2M3A A;  5FJ8 J;  4HST A;  3OS1 A;  1O7L A;  4DW6 A;  3CP8 A;  5EG0 A;  1D1C A;  1K78 B;  1ZRE A;  4XKC A;  2RN7 A;  1GHC A;  4DZJ A;  3L2R A;  4A3E J;  2TCT A;  4HNT A;  3WTX C;  2A68 F;  3TBI A;  3FBI B;  4II3 A;  5FKO A;  2F5E A;  3CCY A;  4RAY A;  5M3F J;  4E7Z A;  5C3E J;  1DPU A;  2Y9Z A;  4YFK F;  2V9K A;  2Z3Y A;  4B44 A;  2V6C A;  4XSX F;  1D8J A;  3NRV A;  3RPU D;  2LKX A;  1A6I A;  4Z2Y A;  3K70 C;  2M7A A;  4ENN A;  1RKT A;  1WPK A;  2YX4 A;  2ZJP F;  2Q2E B;  3G1L A;  2HPI A;  3CD6 I;  2HVR A;  1V5G A;  2ZXJ A;  4IJA A;  2DDB A;  4MEY F;  5DCM B;  3FXK A;  1DP7 P;  1F9N A;  3F3X A;  4M72 A;  2XPV A;  4PJN A;  2OQR A;  3GUD A;  1G3Y A;  2L4M A;  2YX7 A;  2NXN B;  3JW4 A;  3E5U A;  2WB1 A;  2EZI A;  2FNP A;  3D0S A;  4RLQ A;  5H20 A;  3ZPL A;  3KE2 A;  2EIN H;  2B0L A;  1RC9 A;  3K69 A;  4RDU A;  5K7Z A;  4Y13 A;  2UZK A;  2PJR A;  4P1W A;  1R1V A;  5TIS C;  5EJC A;  3IL2 A;  3HRT A;  5CVU A;  3CQZ J;  1WCM J;  2XGD A;  3T5X A;  3H9G A;  1W7P B;  2R7F A;  4L9T A;  1TWH J;  4L9J A;  2P8T A;  4BHC A;  1IO2 A;  1T33 A;  3LSI A;  2VC1 A;  3CZ6 A;  3DEE A;  5EEH A;  3CCE I;  3FX3 A;  4IVN A;  2L9V A;  1SAN A;  3CO7 C;  5CKT A;  1OCP A;  1TQP A;  2KQR A;  3UKG A;  3GTG J;  3ESW B;  1HW5 A;  4DYQ A;  4YIF A;  3V8L A;  2FOK A;  2X6Y A;  2JSC A;  5E18 F;  4I0A A;  1FYL A;  3LSH A;  2NVX J;  2Y31 A;  5JVG F;  2JPC A;  1R22 A;  3FXJ A;  3ASN H;  4N0B A;  1Z9C A;  1FBS A;  1T08 B;  2FQ4 A;  1XPX A;  3ZQ7 A;  4BDZ A;  1YHQ I;  1LUJ B;  3L9F A;  3M8E A;  3VYU B;  2QEX I;  3I59 B;  3DLL F;  4UVA A;  1PVE A;  3RYP A;  5M3M J;  1Z7U A;  3H5R A;  2D1H A;  2PMU A;  3LA7 A;  1YI2 I;  1J75 A;  1B8I A;  1FPQ A;  2VIX A;  2PFB A;  4I0B A;  4V19 K;  4N9H A;  4BXX J;  3HGG A;  1VND A;  3H3Z A;  4FTH A;  2MG4 A;  1RNL A;  2GIV A;  2VJI A;  1SVM A;  1QPI A;  2OTJ I;  4OIN F;  5AIP A;  2BE5 F;  5BNG A;  4MHG A;  1WWX A;  4IHW A;  4J01 A;  1JTX A;  3K4M A;  1YJ9 I;  3CCQ I;  5HNH A;  3OYK A;  3R4K A;  2MGQ A;  3OIQ A;  3IAS 2;  3EUK L;  4LIV A;  5FKK A;  5B66 C;  1D1B A;  3T1B A;  2ELH A;  2JA7 J;  2QSF X;  3FXR A;  4RGS A;  3KLN A;  2MD5 A;  5M5Y J;  3BTJ A;  2VKE A;  4BBR J;  4L0Y B;  1JHH A;  5HLG A;  1XN7 A;  5LGN A;  3DPL C;  1P7I A;  3WU0 A;  5DS9 A;  4IO9 F;  2CMP A;  1VZ0 A;  3BJA A;  2PJP A;  3S16 J;  2NNN A;  3V7R A;  2XUB A;  5J8C A;  2KLO A;  2VBW A;  4ETS A;  2B9S A;  4J19 A;  4M3G A;  5LEK A;  1TZL A;  2E19 A;  3I9V 2;  2IA1 A;  2R7S A;  3BJ6 A;  3JAM Z;  3OYC A;  4KYW A;  4A0Y A;  3DXJ F;  5L3E A;  5BPI A;  3L2V A;  4U0V A;  1W7P D;  1MMS A;  1ZKG A;  4XLC A;  3E0J B;  1TWG J;  3F6O A;  1RRJ A;  3TOB A;  1VI0 A;  2XF5 A;  3ZCO A;  2XGE A;  3LMM A;  2PI0 A;  4Y3O A;  3LSG A;  5H6Q A;  2R5Y B;  2OQG A;  3J80 Z;  1J59 A;  4U0Y A;  3ZMD A;  1PP7 U;  4YII A;  3U2R A;  1WI9 A;  4R79 A;  1K61 A;  2FE3 A;  4DYR A;  1A36 A;  4EEF G;  2BBY A;  3OOU A;  2WV0 A;  2CWE A;  4LB5 A;  1W36 D;  1QQI A;  5IPA A;  3HOV J;  3ECH A;  2YUS A;  3WG7 H;  2DW4 A;  2QVO A;  2LVS A;  1WFX A;  1J7K A;  3OS2 A;  3CUQ A;  3NEU A;  3MKY B;  1S9H A;  2ELK A;  4A5N A;  3OYG A;  3IH3 A;  4A69 C;  5IYC J;  4PUS A;  2DAO A;  3AG4 H;  3PNT A;  2QBY B;  4B1R A;  5L3C A;  3CDI A;  3PO3 J;  2EV0 A;  1Z21 A;  2K86 A;  2CUF A;  2P6S A;  1DUX C;  3GLX A;  2J5O A;  1P7J A;  3HC7 A;  2RRE A;  4ESF A;  2R93 J;  3SJM A;  4X1E A;  3V7C A;  1FOK A;  2QUF A;  3OR1 C;  1YLF A;  1RPW A;  4AYB N;  3MAJ A;  3BWG A;  4PFP A;  1P4A A;  4EMS A;  2DOF A;  5HNF A;  2WA0 A;  3GZN B;  2LBF A;  2M0C A;  3KCC A;  5TRD A;  3CP2 A;  2V26 A;  3C3W A;  2HDD A;  3HJE A;  2E1N A;  3LSJ A;  3FDY A;  5A2Q K;  5E17 F;  3C2H A;  3O2P E;  1F43 A;  4RAF A;  1SMY F;  2K9M A;  4PSW A;  1I5Z A;  4P9F A;  1WJA A;  3OWT A;  3W6J B;  1MD0 A;  1LKX A;  4HEA 2;  3VSL A;  4YFN F;  4GYI A;  3DU5 A;  4PJJ A;  4M73 A;  1YE9 A;  1QBJ A;  2XRN A;  3HM5 A;  2A3S A;  1R7J A;  1X2M A;  2HKO A;  4M6X A;  1O3S A;  1TQI A;  1ZHF A;  5K5Q A;  3OYB A;  2DFF A;  2W82 A;  4XOR A;  3HB9 A;  2VJ4 A;  2KPM A;  3I4P A;  2LMD A;  1KQ9 A;  5J1U A;  3KEO A;  1ZK8 A;  2K9Q A;  4PCQ A;  4MLO A;  1X1D A;  1F36 A;  2EQR A;  3HRU A;  1PUE E;  1OCT C;  4F7Z A;  3BT9 A;  2NS8 A;  2JT1 A;  2DT6 A;  4IQJ A;  1KZH A;  1YO5 C;  2CSO A;  5IT3 A;  5BOX A;  5D8K B;  2VKD A;  1YJW I;  2WY8 Q;  3KEY A;  2Y69 H;  3CCJ I;  3LAJ A;  4HDV A;  5DEQ A;  4KN7 X;  4BNC A;  3K2A A;  1FYK A;  4BAY A;  5BPD A;  3F8N A;  2LNB A;  3H5A A;  3R0J A;  4XL9 A;  2W24 A;  2CUE A;  2FD5 A;  2OAZ A;  3TED A;  2VE8 A;  1LPQ A;  4I7H A;  4ZJZ A;  3JSP A;  1LE8 A;  2XRL A;  4U0W A;  3VOD A;  1J2X A;  1HC8 A;  2ESH A;  2GXB A;  2O5R A;  1BR2 A;  3PO2 J;  4E7S A;  3OMY A;  3FM5 A;  5ICE A;  3SEQ A;  3C18 A;  3NAR A;  3HHG A;  4EM2 A;  5TGT A;  3FWE A;  2BY3 A;  3Q3S A;  2NS0 A;  5K5R A;  3AAF A;  2QZ8 A;  2UUZ A;  2XSD C;  4TV7 A;  2KDO A;  3G1O A;  1GVD A;  4IRH A;  4KIB A;  2WAD A;  5LLQ A;  5E3N A;  4BQQ A;  5HOO A;  1MBG A;  3FXL A;  5JLW A;  2MH2 A;  2ID3 A;  4RA2 A;  4WXH A;  3K4C A;  3J7Z I;  3T8T A;  3HL2 A;  2MSY A;  1X58 A;  1HW2 A;  2DYR H;  5FRO A;  3QYF A;  5DV5 A;  3HOW J;  2CUZ A;  2CQN A;  1FSE A;  2H09 A;  4A3D J;  1WH5 A;  5GTH C;  5DM6 F;  1U9N A;  1FOW A;  4FE4 A;  1UEL B;  2R7R A;  5E8I A;  3OYA A;  2QGU A;  1QA6 A;  1WHU A;  4ZDO A;  2ADU A;  2VUM J;  3S1M J;  5ILV A;  2Y48 A;  3J7A O;  3GTJ J;  4PGH A;  1TT0 A;  1NTC A;  2LSO A;  2IBD A;  3S2D J;  3DTE A;  2L9S A;  1HKS A;  3TW6 A;  1SFO J;  4FQG A;  5D4S A;  3Q0W A;  4PDK A;  1ITY A;  2XAS A;  1IN7 A;  1MBH A;  2CW7 A;  4RB2 C;  2F4I A;  3H9J A;  3P9I A;  1IUF A;  3PQJ A;  3JR9 A;  1JGG A;  3TO7 A;  1FOY A;  1X2N A;  3LSM A;  4KIF A;  1FLI A;  4OAZ A;  1WSU A;  1LDK B;  2ZNY A;  3IH2 A;  2M8E A;  2CG4 A;  5HDN A;  4LK1 F;  2KRF A;  1QO0 D;  2BGC A;  3SYT A;  1ZTR A;  2VXD A;  4RBO A;  4KMU X;  2JA6 J;  1KON A;  3LSR A;  1P4W A;  3VSK A;  1OQY A;  1A6Q A;  4HLX A;  3JRG A;  5HS8 A;  1D8K A;  1J09 A;  5FKN A;  1AKH A;  1VQ4 I;  3M1E A;  2G9W A;  4LK0 F;  2FXA A;  3C7J A;  2E1C A;  1IGN A;  1SFU A;  3TW7 A;  1MJB A;  3DEW A;  3I56 I;  1FY7 A;  2DT7 B;  1EF4 A;  2LC2 A;  3O3K A;  1JT6 A;  1ULY A;  5DUI A;  1CGP A;  5M5W J;  1FTZ A;  3BTL A;  4F52 A;  4NC7 A;  2B7E A;  3GWZ A;  3OIO A;  4HSR A;  4RS8 A;  2X6O A;  3HHH A;  4CYC B;  3W2V A;  4U88 A;  2GXG A;  3HTU A;  1Q1H A;  3CDL A;  1ZR2 A;  1Y56 A;  2L7F P;  3M9A A;  3W3C A;  1FMV A;  2W48 A;  3M8J A;  1V54 H;  3L1P A;  1MMA A;  4WXC A;  4AIH A;  2VKH A;  2IW5 A;  3X2Q H;  2CU7 A;  1HA8 A;  4NQW A;  4O5V A;  2XAG A;  4QLC U;  3BCA A;  5GAE J;  1OIS A;  2O03 A;  2ME6 A;  2AQF A;  5D5X B;  3OOP A;  3R6S A;  2IS4 A;  2VE9 A;  1XGN A;  2NVU B;  2BEO A;  4P9U A;  1W0U A;  3K4J A;  1BJZ A;  5F04 A;  2UV1 A;  2E1M C;  2K02 A;  2EA4 A;  2YS9 A;  4BQN A;  2KFD A;  2MD0 A;  2YSR A;  1A04 A;  4CIC A;  2X1D A;  3H3U A;  2CQ7 A;  3DBH B;  3K6G A;  3CUO A;  4HW0 A;  4G7O F;  4U7B A;  2ZJQ F;  2ZCW A;  3BPX A;  4G7H F;  3HRM A;  2V6E A;  2O0Y A;  1XSD A;  2CUJ A;  4RB1 A;  4HPQ A;  1ZG1 A;  3MZ8 A;  1HKQ A;  3D5L A;  2M2E A;  1JKO C;  1O7F A;  2PN6 A;  2ZXH A;  1QZY A;  1ETK A;  2A6E F;  1LVA A;  4PSX A;  1D3Y A;  4XK4 A;  1D1A A;  3GO5 A;  1JUM A;  1OYW A;  2MBF A;  3GZ5 A;  2WC2 A;  4OWR B;  4XOP A;  1HDD C;  1NK3 P;  2DN0 A;  2DQR A;  1PYV A;  1ZYR F;  1H9G A;  1E3O C;  2KZV A;  2FX0 A;  1L0O C;  3HOU J;  4UUS A;  3HUG A;  2DFH A;  2CYY A;  1R49 A;  2PMZ N;  2E35 A;  4BJ5 C;  3PNV A;  5JVT A;  3N4M A;  1OJL A;  3S15 J;  3AG2 H;  3OYD A;  5CVJ A;  2EFQ A;  1YW9 A;  3F6V A;  4U7D A;  1QHG A;  3KYC B;  4IX7 A;  1BI1 A;  2O7O A;  4HF0 A;  2BVM A;  3PM1 A;  4M74 A;  2HQA A;  1MZB A;  3E6B A;  3IHU A;  2FBI A;  3S3N A;  2QSG X;  4BEH A;  3E1S A;  2HQR A;  1POG A;  1VQM I;  2A5Y B;  4KA4 A;  5E1W A;  2HXI A;  2FML A;  3RQ4 A;  1FTT A;  3G4S I;  5IP7 J;  3C2B A;  4M71 A;  5GP9 A;  3TMO A;  4AIK A;  4G7Z F;  5B1A H;  3JAM K;  5A2Q Z;  5DTD A;  3H3V K;  4A0X A;  5FRM A;  1XGM A;  4KMF A;  2NVY J;  2H6B A;  1P92 A;  5AON A;  3CCM I;  1FOX A;  1AHD P;  2AS5 F;  4DIQ A;  4F3Q A;  3VYS B;  2JJ7 A;  3AL0 C;  4NHJ A;  3IRR A;  3E6C C;  4KIS A;  2MC3 A;  3ZMU A;  3VYR B;  2VQL A;  1S72 I;  5IYB J;  2UWM A;  1UJ8 A;  2WBM A;  4OAY A;  5C44 J;  3BRO A;  3RQI A;  5KCM A;  4IF4 A;  4EM0 B;  4ITV A;  1MH4 A;  5D4R A;  4E7L A;  4LIU A;  1IV8 A;  2ZJ2 A;  3F0C A;  1SAX A;  3HPH A;  3H36 A;  1EH6 A;  2CV1 A;  1XCB A;  1JKQ C;  2GLO A;  2IPQ X;  2VPL A;  3S2H J;  4HLY A;  4XRS A;  1E17 A;  1NG7 A;  2R3S A;  3PUF A;  3BR1 A;  1EH7 A;  4Y52 J;  2D2W A;  2M5W A;  1FMW A;  3JRA A;  2HYJ A;  5DD4 A;  5IT9 Z;  3RTR A;  1RIO H;  2KP6 A;  3OY9 A;  1GXP A;  1WQ2 A;  3R61 A;  4M3D A;  4UXN A;  4BJT A;  4HNV A;  1GLN A;  5HS7 A;  5FLV A;  1J9I A;  1BI3 A;  1IXR C;  1E3H A;  1K7A A;  1VQP I;  4XIC A;  2XB0 X;  1SFK A;  2OZ6 A;  1BL0 A;  2DA3 A;  1XGO A;  2M30 A;  3BOQ A;  3REO A;  2F48 A;  4A0Z A;  3ROU A;  2Z1D A;  2FBK A;  1NHA A;  2JRM A;  3VEP A;  2IGN A;  4HX7 A;  2COM A;  1QNT A;  2EBI A;  4CCO A;  4YIR X;  4A3F J;  2E1O A;  3VOE A;  2Y9Y A;  4ZZL A;  2WB1 N;  4HQM A;  2FMY A;  1RET A;  2JUC A;  1VQN I;  4B48 A;  5IY5 H;  2LF8 A;  1F4K A;  3BG9 A;  3GCM A;  3IWZ A;  3EYY A;  5DUK A;  2HYG D;  2E36 A;  1MDM B;  1MH3 A;  2M4K A;  3I54 A;  4DNC A;  4HDU A;  1QU3 A;  3BDD A;  2DQL A;  1U0J A;  4ABZ A;  5J1R A;  3FKJ A;  1H8A C;  1KU3 A;  4MIM A;  2X85 A;  2CJJ A;  4A2U A;  1YYV A;  2XAU A;  3QU3 A;  1YX3 A;  1BJA A;  5HLI A;  3ZXS A;  4MTE A;  3MZH A;  4YEL A;  2STW A;  2AQE A;  3TOA A;  1ZRC A;  3SDG A;  1HDP A;  2L0K A;  3BCB A;  3CJQ B;  4OOI A;  4U87 A;  3SZG A;  2GZW A;  1CF7 B;  3RKX A;  1Q1V A;  1ZLJ A;  4E7K A;  2DK5 A;  1HOM A;  2I5U A;  5JHF A;  3L2U A;  4IL6 C;  2HEO A;  2R7V A;  2DXI A;  3QP6 A;  2R7Z J;  2JRT A;  1G6N A;  2OBP A;  1B1B A;  2PX9 A;  1U5T C;  4C2U A;  1YG2 A;  1IC8 A;  4N4N B;  2KZG A;  4BE2 A;  4IEJ A;  1J0R A;  4LB6 B;  3DPU A;  1R23 A;  3G71 I;  1D5V A;  1XGS A;  1K78 A;  5ED4 A;  4D7N A;  1TW3 A;  4BXF A;  3K2Z A;  3QPL A;  3DBL B;  2D1V A;  4DBR A;  4BHB A;  1KQ0 A;  2K9L A;  1YFH A;  1E3P A;  1Z6T A;  1LQ1 A;  3OL3 A;  2K4J A;  2XGX A;  1TLH B;  5BMZ A;  3CC7 I;  3FM3 A;  3DLA A;  2TDX A;  3KP5 A;  1JTY A;  3CJR B;  4WXD A;  2KL4 A;  1DP3 A;  1T95 A;  2YR2 A;  3G73 A;  4D9J A;  2W25 A;  2Z16 A;  4QIW N;  3G1M A;  2CFX A;  4A3C J;  1JUP A;  5HVQ C;  5F64 A;  1H88 C;  3FMR A;  5EGO B;  4PJL A;  3BTC A;  1APL C;  3HOY J;  2KKO A;  3A1Y A;  5CQE A;  2DDA A;  2GOM A;  2IRF G;  2QYO A;  3TL4 X;  1OCZ H;  3LQR A;  1IAW A;  2Y30 A;  1V4R A;  2EPF A;  4XLP F;  3OR2 C;  5CVI A;  2IGO A;  3KYD B;  1MW7 A;  3NAU A;  4BE1 A;  4HOB A;  2XHK A;  2J5P A;  4PZJ A;  2X6X A;  2PJR B;  4C30 A;  1FEX A;  1FIA A;  4XN0 A;  4ZYH A;  5ICC A;  3Q0U A;  2EIM H;  2DYS H;  1JJ6 C;  2WV1 A;  4Y4R A;  3ZQQ A;  5FLX Z;  4A6D A;  1FNN A;  2EFO A;  2AXL A;  1QVT A;  2BVL A;  2HZD A;  3AG3 H;  1HCR A;  3KYL A;  2KIS A;  3ABL H;  2Z9O A;  1R6R A;  2MLK A;  2ZO4 A;  4E4H A;  4HNU A;  1MKM A;  1XSX A;  5EZG A;  3BTI A;  2HS5 A;  4M3F A;  1U78 A;  4GDF A;  2JTV A;  4EGY A;  3FXM A;  5LHH A;  2BYV E;  1I50 J;  2VJJ A;  5FLM J;  4FX0 A;  4GCV A;  4HQE A;  3SFZ A;  4CHU A;  1D5Y A;  5ILU A;  2HOS A;  4LGW A;  3F9K A;  5EYR A;  1JUS A;  3P5J A;  5E3L A;  3O8G A;  2NVT J;  1TWF J;  4AM3 A;  1YS6 A;  2X1C A;  2QLZ A;  1LNW A;  1JE8 A;  4EJT A;  4W1U A;  3HOX J;  4CCL A;  1XMA A;  3GVA A;  5LD2 C;  2BW3 B;  3M7G A;  2IP2 A;  3GEZ A;  3KZZ A;  4IOA F;  4HF1 A;  5FD5 A;  5HS9 A;  3DWL E;  2FBH A;  4WF2 A;  2FUG 2;  4A3J J;  3ABM H;  4R1H A;  1HKT A;  3JSO A;  3J7A Y;  2IA2 A;  3EDP A;  4BXU A;  2O8X A;  3LSK A;  1NG6 A;  4MGR A;  2RKH A;  2DOA A;  1SVO A;  1GXQ A;  3SHF A;  1ZRD A;  4Y7N J;  2EJR A;  1XD7 A;  4D1Q A;  4LG0 A;  3KIO A;  3L2C A;  1UHW A;  3DP7 A;  3GTO J;  5ERI A;  2R5Z A;  2VT3 A;  2OF7 A;  1H89 C;  3ISP A;  4P55 A;  2DA4 A;  2R7D A;  1G3T A;  4OIQ F;  4S0H B;  5F1R A;  1Y1V J;  4GXO A;  2EIJ H;  3IKV A;  4AVZ A;  2XAQ A;  1X3U A;  2JVH A;  3E7L A;  3BQZ A;  3V42 A;  1DU6 A;  2HQ5 A;  2RC4 A;  2RVC A;  3HPG A;  2DMQ A;  3CF5 F;  1VTN C;  3SFI A;  1FYM A;  4HX8 A;  2L9R A;  3RZD J;  5LEJ A;  3LFU A;  2L01 A;  4E70 A;  4B43 A;  3U21 A;  3P9K A;  2DTR A;  1BOB A;  1RR7 A;  1A35 A;  4O3M A;  2QQ8 A;  4I98 B;  1R5G A;  3S1Q J;  2W57 A;  2VBY A;  4DOZ A;  2EV6 A;  2R0Q C;  3CMM A;  1QVU A;  5FD6 A;  2QCO A;  3VWB A;  2DCE A;  3CCR I;  1ETV A;  2VOO A;  3TO9 A;  3GTP J;  3S8P A;  4BY1 J;  2CQK A;  1LDJ A;  1TC3 C;  2R5Y A;  2RV8 A;  1S6L A;  1U6G A;  2I10 A;  2Z2S B;  4E7H A;  2IS1 A;  5EEG A;  1R1U A;  1DGR M;  1UST A;  2EZL A;  5FO5 A;  1VQL I;  1W4M A;  4ENM A;  2JPB A;  4FHT A;  2QM3 A;  3K4B A;  4AU7 A;  5GAH J;  1IV6 A;  2DA1 A;  1GT0 C;  1RR8 C;  3K1N A;  2VC0 A;  3ABU A;  3CUQ B;  5M5X J;  4AC0 A;  3ABT A;  2K9S A;  2LG4 A;  2LR8 A;  2V1X A;  1R36 A;  3LFK A;  3WG9 A;  2CGP A;  2OV7 A;  1VQ5 I;  3OIP A;  2OZU A;  4F93 B;  4PFO A;  4MTD A;  2R7O A;  2OA4 A;  4QWQ A;  4BQA A;  3HKZ A;  4L18 B;  1VQK I;  3I4N J;  2Z5U A;  1S7O A;  3BR6 A;  3ZMT A;  2HI3 A;  1U2W A;  1OMI A;  4UUT A;  3HEF A;  2XSJ C;  3CC4 I;  3RKW A;  3IH4 A;  3TO6 A;  2H6C A;  1BA5 A;  2MA3 A;  2OC6 A;  4V2F A;  3S3M A;  3FXO A;  5KHD A;  2Y0M A;  3DU6 A;  2HNH A;  3O6B B;  2GBY A;  5J3L A;  1JT0 A;  3ZP5 A;  3SEZ A;  4BDY A;  3DTI A;  3K10 A;  4I09 A;  5TJJ A;  3MKL A;  4KIC A;  2E34 A;  3RI4 A;  3ZMZ A;  3EYI A;  3L2Q A;  2L02 A;  4M3B A;  4QTR A;  4L5E A;  4ZC3 A;  1W36 C;  5J47 A;  3LST A;  4GYG A;  4Y15 A;  1QPM A;  4I76 A;  3PSF A;  3U9G A;  1DPR A;  2GWR A;  6PAX A;  3MQ0 A;  5IT9 K;  1FC3 A;  1WKM A;  1T56 A;  2DPU A;  3OYJ A;  3DKW A;  5FB2 A;  1BI2 A;  1PP8 F;  1Z91 A;  2V7F A;  2BXZ A;  4IHT A;  3ERM A;  3FMS A;  1T8I A;  2K3F A;  5EDN A;  4AIJ A;  2WAF A;  4KT5 C;  3BZC A;  2HXO A;  4RLF A;  4UB6 C;  3ZQF A;  2HTS A;  5FGM A;  3MFK A;  2JMW A;  4G6Q A;  3NWS A;  2XKO A;  1V5E A;  2XF6 A;  4XKV A;  1IRX A;  5J4V A;  5JHU A;  1QZE A;  3V8J A;  3MEX A;  2E2H J;  3WE3 A;  2ZFW A;  2XGC A;  3DPT A;  1LE8 B;  1K4S A;  1X1B A;  3PL8 A;  3AFH A;  1R4N B;  5F08 A;  1LB2 A;  1XDU A;  2G7U A;  4ZYD A;  4D7M A;  1EKE A;  2F4O B;  2FRH A;  3Q5F A;  1TT5 B;  2GA1 A;  4YFX F;  2ZB9 A;  4UVB A;  2MFZ A;  1X19 A;  3FZV A;  3KEQ A;  4HA8 A;  1NK2 P;  2IEK A;  2TRT A;  1IJW C;  2LF7 A;  1XSV A;  4JBA A;  4WK8 F;  2E71 A;  3KZI C;  1YIT I;  3HZJ A;  4IHX A;  3OS0 A;  2O8K A;  2K7L A;  1REP C;  1UMQ A;  3WTS C;  5KVR A;  1S8N A;  3L2W A;  5DM7 F;  3LOC A;  3TP3 A;  2IT0 A;  3B02 A;  4RM3 A;  1FBQ A;  3QP5 A;  5L3F A;  3IAM 2;  1BR4 A;  3BP8 A;  4B4C A;  5HOD A;  2B63 J;  4XRM A;  4M9S A;  4OIO F;  1QHH D;  4S05 A;  2OU2 A;  3WTV C;  1T39 A;  4ZTJ A;  1T0F A;  3E6M A;  4A3M J;  3SXY A;  2ZME A;  3PJR A;  5F0H A;  2IS6 A;  4NC8 A;  1YRN B;  2ELJ A;  4Y17 A;  3HG9 A;  2DMT A;  4HG2 A;  3VB2 A;  4GO1 A;  2A61 A;  3GTM J;  2IS2 A;  2RQP A;  1VF9 A;  2XB5 A;  4A3L J;  2EB7 A;  3B6C A;  2LRD A;  1IN6 A;  1R9T J;  1AWC A;  1LEB A;  1L3L A;  3H0G J;  3WTW C;  1UCR A;  5B3S H;  1HW1 A;  2EFP A;  1S29 A;  4GFB A;  5IOY A;  1P6R A;  1X1P A;  3RZO J;  2D45 A;  3ECO A;  2K4B A;  2DA7 A;  1WJE A;  4MNU A;  2E2J J;  4E7J A;  2F2E A;  2WAQ A;  1YOV B;  2EFN A;  3QPS A;  1YIJ I;  4IRI A;  1K79 A;  3FXU A;  5K1Y A;  2OD5 A;  3KX2 A;  3COA C;  4ESJ A;  5ICF A;  3EQL F;  1OCR H;  3FBN B;  3G3Z A;  2LD5 A;  1IZ1 A;  3RSN A;  5LFA A;  2ACJ A;  2ZXW H;  1ETY A;  4MQV A;  4PJM A;  4RM2 A;  4CO8 A;  5J8F A;  1I6H J;  1Z05 A;  1PUF A;  1LDD A;  1ETX A;  4C2M J;  3PFY A;  1AKH B;  2L7K A;  1B72 A;  1SD6 A;  1RZ4 A;  1R58 A;  3CF2 A;  5F0C A;  2LRE A;  2X1E A;  1BM9 A;  2W84 A;  3T0Y A;  1UHM A;  4CCJ A;  3KP2 A;  1H0M A;  3CJN A;  4XNF A;  3KPH A;  3F72 A;  1S5L C;  3CMA I;  2DA2 A;  5JLX A;  1BN5 A;  5CYV A;  4BGD A;  1AOY A;  3GTL J;  1HST A;  1JGS A;  1LFP A;  5FLX K;  4AUX A;  1UFM A;  2EV5 A;  2P7C B;  2X6W A;  3K4N A;  1F1Z A;  2DJI A;  4RB0 A;  1NH3 A;  5CQG A;  2A5W A;  3BR5 A;  2VQC A;  1KU2 A;  1YTY A;  1MND A;  2L4A A;  4RGX A;  3LSP A;  1IUY A;  3PIO F;  2IVM A;  2FOW A;  2QKL B;  3TDZ C;  4DYC A;  2ZKZ A;  2M4G A;  3GW2 A;  2CV0 A;  3MZY A;  3FHZ A;  3EUA A;  3PUB A;  3CES A;  4PJ0 C;  3WU2 C;  3QRF F;  1WZ2 A;  1IRF A;  3IKT A;  4M6V A;  2VJ5 A;  3P9C A;  5CPR B;  4NBQ A;  3ZQG A;  2IGM A;  1TBX A;  2KIU A;  5J6X A;  1G2H A;  1WRJ A;  2L3D A;  3K1M A;  2JK3 A;  3S2W A;  1IW7 F;  2P4W A;  2RAE A;  4D5C A;  3M8F A;  4KIG A;  2EIL H;  1U5T A;  3A0B C;  3BR2 A;  3SZT A;  3N05 A;  2NOJ B;  2DA6 A;  3E97 A;  4LD5 A;  4UUV A;  2VAS A;  3IP4 B;  2K9N A;  4JOM A;  2ECC A;  4LOC A;  2H1K A;  4Q5S F;  3RJP A;  2VPR A;  2EZH A;  1YJN I;  1USS A;  4JX4 A;  5IOZ A;  1YW7 A;  1ZG5 A;  1Z1D A;  2O61 A;  3HBL A;  1I3Q J;  2VBX A;  2Y0S N;  1I1G A;  2DFE A;  3HIF A;  2QQ9 A;  2V9V A;  1V55 H;  4XID A;  4YEJ A;  4NDL A;  3RPQ A;  3HUG B;  4XN3 A;  5E3M A;  2X51 A;  4UUS B;  3GZ6 A;  2HWV A;  1MBK A;  2IA0 A;  4QPO A;  1O3Q A;  2O9L A;  1SC7 A;  2H27 A;  3LAP A;  3FHN A;  2DOD A;  3FK7 A;  1JHF A;  1TTY A;  2NAZ A;  2V1N A;  3LA3 A;  2XF7 A;  2BY1 A;  3JTH A;  2FU4 A;  4MQ9 F;  1IRZ A;  2LTP A;  4BE0 A;  2BHZ A;  3LWF A;  1FIP A;  2QQA A;  3OV8 A;  4LJZ F;  3RIR A;  2X0L A;  5GTI C;  5FFX A;  2P81 A;  1WVR A;  3A03 A;  3Q0V A;  1T0F C;  2F5C A;  3SDB A;  3IV5 A;  2MW8 A;  2ZME C;  3F8C A;  3KFW X;  3ZRG A;  3TGN A;  3V7S A;  5H2F C;  3OYE A;  1SFX A;  1ACI A;  3M07 A;  4ENK A;  4H4K C;  4XLF A;  1HSJ A;  3WTZ A;  2DMN A;  1AA7 A;  4CXF A;  2HDW A;  4XKW A;  2RNG A;  4CZZ A;  4G6D A;  2MYS A;  3DTK A;  1WJF A;  4KN4 X;  2CW8 A;  3JRB A;  2KHM A;  3LNQ A;  2HR3 A;  4LFU A;  4AVP A;  2XVC A;  4MFE A;  3A01 B;  4IHV A;  4Z6Y A;  3ML6 A;  5D6E A;  4N9I A;  2HQN A;  1GV2 A;  3K4L A;  1Z7L A;  1P2F A;  2L5Q A;  5CLS A;  1Z77 A;  2HYF A;  3E3V A;  4CGZ A;  5JFR A;  2WWY A;  9ANT A;  2K3P A;  1FX7 A;  3B73 A;  3I64 A;  3RPU A;  2LYC A;  1BIB A;  4BU2 A;  4XLN F;  3S3O A;  4L0Z B;  3ZOB A;  1W1W E;  2WTE A;  4A93 J;  2BOL A;  2CQX A;  4IHS A;  4HX4 A;  4ZDL A;  3UNG C;  4F91 B;  3L09 A;  4OMY A;  5J40 A;  2OCC H;  3H35 A;  1W5S A;  4E7I A;  1K6Y A;  1MJ9 A;  1I39 A;  2R4G A;  3WHB A;  1N75 A;  2JSP A;  2KRC A;  3OYM A;  5IP6 A;  1RES A;  3M1C A;  2KIQ A;  1I6X A;  1D0Z A;  2M0M A;  3KZY A;  2R7T A;  3R60 A;  3I53 A;  4LG3 A;  1S3J A;  2VBZ A;  2Y0S A;  1ZG3 A;  1KU9 A;  2P6T A;  3B6A A;  3PSI A;  1FSH A;  2F5V A;  3H9Q A;  5B5E C;  3C2G A;  3HRS A;  4G6T B;  3C1D A;  2VN2 A;  2ECB A;  2GIZ A;  2HOA A;  4G94 A;  3WTU C;  4M3E A;  1LFU P;  4D5F A;  4AWX B;  2HFH A;  1JI8 A;  4X6A J;  3U1K A;  4JX5 A;  4XRS G;  5LGT A;  3F8F A;  1MDM A;  4YRV A;  3IWF A;  2X9D A;  2M34 A;  3K70 D;  2KDZ A;  1HXD A;  3D1N I;  4C3I J;  4B47 A;  2JUG A;  1B9N A;  4ASN A;  4UVC A;  3BQY A;  1UAA A;  2C6Y A;  4N4O B;  2PBI A;  3MD2 A;  5ICG A;  2VQH A;  4A3B J;  3QOE A;  3MWM A;  2VB6 A;  1MBJ A;  2XIG A;  1MGT A;  2K85 A;  3QAH A;  1PJR A;  1CF7 A; 
#chains in the Genus database with same CATH homology
 5BS6 A;  4HZF A;  5HLH A;  1OKR A;  3PQK A;  2NRA C;  1YW8 A;  2EA2 A;  4AD9 A;  2VXZ A;  4LLN A;  4HV5 A;  1P4X A;  5E20 A;  4EJU A;  5ILS A;  3U1D A;  4BH9 A;  5D6F A;  2P5K A;  1IN5 A;  4D0P A;  1OYI A;  2G7H A;  2P5L C;  5K5O A;  2V1D A;  4JK1 X;  2QQB A;  2NNY A;  2NYX A;  4MEX F;  2DO7 A;  1YIO A;  2QWW A;  1B9M A;  3Q9V A;  2Q2E A;  2W85 A;  2RDP A;  2ESN A;  4CDG A;  5DCM A;  1O3R A;  4FT8 A;  5DDG A;  3F22 A;  2P5V A;  2MLG A;  2K27 A;  5E8G A;  3KLO A;  2UXN A;  1SD5 A;  2M87 A;  5DD8 A;  4KUM A;  1IXS B;  1ONV A;  3RYR A;  2O6G E;  1W7P A;  1C0W A;  4G9Y A;  1G3W A;  4RB3 C;  1FP2 A;  5KK1 A;  4A5M A;  2UXX A;  4HV6 A;  1RI7 A;  1J5Y A;  4PGG A;  4G8X A;  4LLL A;  2FQ3 A;  4L9V A;  1T6S A;  3ZN1 A;  3H92 A;  4GGG A;  4R8H A;  1R1T A;  3I59 A;  1TW2 A;  2PEX A;  2DBB A;  2A69 F;  3KET A;  3GFM A;  3HYI A;  4HAM A;  3TDU C;  2FF4 A;  4BYY A;  5DCF A;  2LKP A;  3DEU A;  4B09 A;  3GFI A;  4ZYE A;  1HBX G;  2E7W A;  3F8B A;  1STZ A;  1GVJ A;  1YS7 A;  2PMH A;  2STT A;  3QOP A;  4RGU A;  3GYH X;  4EGZ A;  5D5V B;  4LG0 B;  3SQN A;  4L5J A;  2XAJ A;  3P7N A;  1T38 A;  3CO6 C;  2GA2 A;  1TNT A;  4WX9 A;  1ON2 A;  1FT9 A;  1R00 A;  2M1B A;  2V79 A;  2HOE A;  1EH8 A;  3FMQ A;  1K6O A;  4BHP A;  3GX4 X;  5E1Z B;  5BQT A;  3GFL A;  1LJ9 A;  1ON1 A;  1T2K A;  1IN4 A;  2O3F A;  2HZT A;  2RGV A;  3VFZ A;  1PDN C;  4M9Z A;  4JQF A;  1ZRF A;  3K0L A;  3WTT C;  3J81 K;  2MH9 A;  1IRG A;  4OU0 A;  3KP7 A;  2QBY A;  3N97 A;  3LA2 A;  4Q4Z F;  2H94 A;  4EVI A;  3R0A A;  2CO5 A;  3IC7 A;  1UB9 A;  4XBF A;  2VON A;  4I2O A;  3DQV C;  2F5F A;  2XAF A;  2F5D A;  2ISZ A;  3ELK A;  3HSF A;  1QZZ A;  4UHT A;  3TKY A;  2DLL A;  3WGH A;  4Q48 A;  1O3T A;  5CVR A;  1ZH5 A;  1SMT A;  3T8R A;  1ZAR A;  3I58 A;  5H6R A;  4M9X A;  3WTY C;  3GFJ A;  3EUH A;  2QEN A;  4YG2 F;  2DK8 A;  2ZBK A;  1B59 A;  2FA5 A;  5HDK A;  5CVV A;  3ULQ B;  1IF1 A;  5LHG A;  3BJO A;  3E5Q A;  1RUO A;  1G4D A;  4OIP F;  1KYZ A;  3W6K B;  1ZAO A;  4RGR A;  5LRS A;  4WWC A;  2XRO A;  3F8M A;  2Q8K A;  4EJW A;  3L7W A;  1ZLK A;  2DPD A;  3GXO A;  4NB5 A;  1E2X A;  2DU9 A;  1R5H A;  4XSZ F;  1ZGJ A;  1H9T A;  2VOP A;  4I02 A;  3F21 A;  1FZP B;  2DI3 A;  3I0T A;  2KIF A;  4K2E A;  3BPV A;  1MJA A;  4IXA A;  2FSW A;  5HDG A;  5FFZ A;  3HSE A;  3QU6 A;  2Q0O A;  2GQQ A;  5JR3 A;  4FX4 A;  3DFG A;  2YU3 A;  1JXS A;  4EV0 A;  3EET A;  1TQM A;  4A6E A;  5E1X A;  2EWN A;  1XB4 A;  1IXC A;  2KIM A;  2HDC A;  4CYD A;  1O57 A;  5D5W B;  2ZME B;  1KGS A;  5LRR A;  3CUQ C;  1V3F A;  3KP4 A;  3RKY A;  2ZNZ A;  4LLG F;  2KJB A;  4ZYG A;  5L3B A;  1G3S A;  3BZ6 A;  4DQ2 A;  1B6A A;  5CJ9 A;  3E6D A;  2HTJ A;  3DF8 A;  5L3D A;  1SD7 A;  1T98 A;  4EM1 A;  3WGI A;  1B4A A;  4KNY A;  3V4G A;  2E7X A;  1S7A A;  5F6F A;  3WOD F;  3F23 A;  4L9N A;  4KDP A;  1LEA A;  2EK5 A;  2P7V B;  1DDN A;  1TNS A;  1KYW A;  4EJV A;  4UV8 A;  4IRG A;  5DYM A;  4HYE A;  1OR7 A;  4KFC A;  2A07 F;  1ZN2 A;  2EFW A;  5JI6 A;  3HTS B;  3MCZ A;  2XAH A;  1YQA A;  4IPA A;  2IJL A;  4H0E A;  2PG4 A;  5LBQ A;  2V1U A;  3JTG A;  3L00 A;  3ZN0 A;  3NQO A;  2CW0 F;  3KP6 A;  1BOA A;  3CLO A;  3LQQ A;  2A6H F;  3CTA A;  4O6J A;  1XMK A;  1HQC A;  1U5T B;  3WGG A;  3J81 Z;  2PLY A;  4UV9 A;  2ISY A;  1Y0U A;  4RAZ A;  4B8X A;  3GF2 A;  2VOD A;  4ZH4 F;  3WE2 A;  3ERE D;  4A12 A;  4XRF A;  4WCG A;  1XCV A;  3KP3 A;  3ZMS A;  5LGU A;  1OPC A;  4S04 A;  2RNJ A;  3QPT A;  3QPH A;  2GAU A;  3HOS A;  2M45 A;  5L3G A;  1BC7 C;  3K1P A;  4Q47 A;  3BY6 A;  1BC8 C;  1FBU A;  1FP1 D;  4ZZD A;  2ETH A;  4I01 A;  5LHI A;  2HGC A;  4L5I A;  1SD4 A;  2KJC A;  1F5T A;  1KA8 A;  3FF5 A;  3HSR A;  3K9T A;  3J80 K;  2DT5 A;  2YPR A;  4M6Y A;  3WU1 B;  1KQ8 A;  5D5U B;  3TQN A;  1U8R A;  3SZP A;  2Y75 A;  1BIA A;  4LMY A;  1I1S A;  4ON0 A;  1FWZ A;  4OIR F;  3I71 A;  3PFI A;  4HBL A;  2LDU A;  3Q9S A;  4P5O A;  4EQQ A;  3HOT A;  4UNO A;  2PQ8 A;  4ENJ A;  1BBY A;  1RUN A;  4P96 A;  4OMZ A;  4ESB A;  2HKX A;  1QGP A;  3RDI A;  2DFI A;  1W5T A;  1KU7 A;  3I5U A;  4EJO A;  1IN8 A;  3FXQ A;  5AIQ A;  1Z6R A;  1EV7 A;  1BI0 A;  2L54 A;  2VT2 A;  1I27 A;  2XV4 S;  3CDH A;  2FNA A;  2Z33 A;  3ZMV A;  2X4H A;  2XKP A;  1U3E M;  1OYY A;  2Z99 A;  3E5X A;  1ODD A;  1XDS A;  1ZGA A;  3IRQ A;  5D8L B;  2BV6 A;  3DV8 A;  1SFE A;  2FEZ A;  4HF2 A;  2JZY A;  1O7L A;  1K78 B;  1ZRE A;  2RN7 A;  1GHC A;  3WTX C;  2A68 F;  2F5E A;  4RAY A;  1DPU A;  4YFK F;  2Z3Y A;  2V6C A;  4XSX F;  1D8J A;  3NRV A;  4Z2Y A;  4ENN A;  2YX4 A;  2ZXJ A;  4IJA A;  4MEY F;  5DCM B;  1DP7 P;  1F9N A;  3F3X A;  4M72 A;  2OQR A;  3GUD A;  1G3Y A;  2L4M A;  2YX7 A;  3JW4 A;  3E5U A;  2FNP A;  3D0S A;  3ZPL A;  5H20 A;  3KE2 A;  2B0L A;  3K69 A;  4Y13 A;  2UZK A;  1R1V A;  3IL2 A;  3HRT A;  5CVU A;  3T5X A;  1W7P B;  2R7F A;  4L9T A;  4L9J A;  2P8T A;  4BHC A;  2VC1 A;  5EEH A;  3FX3 A;  4IVN A;  3CO7 C;  1TQP A;  1HW5 A;  4YIF A;  3V8L A;  2FOK A;  2JSC A;  5E18 F;  4I0A A;  1FYL A;  2JPC A;  1R22 A;  4N0B A;  1Z9C A;  1FBS A;  3ZQ7 A;  3L9F A;  3M8E A;  3I59 B;  4UVA A;  3RYP A;  1Z7U A;  2D1H A;  2PMU A;  3LA7 A;  1J75 A;  1FPQ A;  2PFB A;  4I0B A;  4N9H A;  3H3Z A;  1RNL A;  2GIV A;  4OIN F;  5AIP A;  2BE5 F;  4MHG A;  1WWX A;  3R4K A;  3T1B A;  2ELH A;  3FXR A;  4RGS A;  3KLN A;  2MD5 A;  4L0Y B;  1JHH A;  5HLG A;  1XN7 A;  5LGN A;  3DPL C;  3WU0 A;  3BJA A;  2PJP A;  5J8C A;  2NNN A;  2XUB A;  3V7R A;  2VBW A;  4ETS A;  5LEK A;  2IA1 A;  3BJ6 A;  3JAM Z;  4KYW A;  4A0Y A;  3DXJ F;  5L3E A;  5BPI A;  4U0V A;  1W7P D;  3F6O A;  3TOB A;  2PI0 A;  5H6Q A;  2OQG A;  3J80 Z;  1J59 A;  4U0Y A;  3ZMD A;  1PP7 U;  4YII A;  3U2R A;  1WI9 A;  4R79 A;  2FE3 A;  2BBY A;  2WV0 A;  2CWE A;  4LB5 A;  1QQI A;  3ECH A;  2DW4 A;  2QVO A;  1J7K A;  3CUQ A;  3NEU A;  4A5N A;  2DAO A;  2QBY B;  5L3C A;  2EV0 A;  2K86 A;  1DUX C;  2P6S A;  3GLX A;  2J5O A;  4ESF A;  1FOK A;  3V7C A;  2QUF A;  1YLF A;  3MAJ A;  3BWG A;  1P4A A;  4EMS A;  3KCC A;  5TRD A;  3C3W A;  2E1N A;  5A2Q K;  5E17 F;  3O2P E;  1SMY F;  1I5Z A;  4P9F A;  3W6J B;  1MD0 A;  4YFN F;  4GYI A;  4M73 A;  1QBJ A;  2XRN A;  2A3S A;  1R7J A;  2HKO A;  4M6X A;  1O3S A;  1TQI A;  1ZHF A;  5K5Q A;  3I4P A;  1KQ9 A;  3KEO A;  4PCQ A;  3HRU A;  1PUE E;  4F7Z A;  2JT1 A;  1YO5 C;  2CSO A;  5IT3 A;  5BOX A;  5D8K B;  4HDV A;  3LAJ A;  5DEQ A;  4KN7 X;  4BNC A;  1FYK A;  4BAY A;  5BPD A;  3F8N A;  2LNB A;  3R0J A;  2W24 A;  2OAZ A;  2VE8 A;  4I7H A;  3JSP A;  4U0W A;  3VOD A;  1J2X A;  2ESH A;  2GXB A;  3FM5 A;  5ICE A;  3C18 A;  3HHG A;  4EM2 A;  3FWE A;  5K5R A;  2NS0 A;  3AAF A;  2QZ8 A;  4TV7 A;  5LLQ A;  4IRH A;  4KIB A;  5HOO A;  2MH2 A;  4WXH A;  3T8T A;  1HW2 A;  5DV5 A;  1FSE A;  2H09 A;  5E8I A;  2ADU A;  5ILV A;  2Y48 A;  3J7A O;  4PGH A;  2LSO A;  1HKS A;  5D4S A;  4PDK A;  2XAS A;  1IN7 A;  4RB2 C;  3P9I A;  3PQJ A;  3TO7 A;  4KIF A;  1FLI A;  1WSU A;  1LDK B;  2ZNY A;  2M8E A;  2CG4 A;  5HDN A;  4LK1 F;  2KRF A;  1QO0 D;  2BGC A;  4KMU X;  1P4W A;  4HLX A;  5HS8 A;  1D8K A;  3M1E A;  2G9W A;  4LK0 F;  2FXA A;  3C7J A;  2E1C A;  1SFU A;  1MJB A;  1FY7 A;  3O3K A;  1ULY A;  5DUI A;  1CGP A;  3GWZ A;  4RS8 A;  3HHH A;  4U88 A;  2GXG A;  3HTU A;  1Q1H A;  3M9A A;  4WXC A;  4AIH A;  2IW5 A;  4NQW A;  4O5V A;  2XAG A;  4QLC U;  2O03 A;  5D5X B;  3OOP A;  3R6S A;  2VE9 A;  1XGN A;  2BEO A;  4P9U A;  2K02 A;  2EA4 A;  2YSR A;  1A04 A;  4CIC A;  3H3U A;  3CUO A;  4HW0 A;  4G7O F;  4U7B A;  2ZCW A;  3BPX A;  4G7H F;  3HRM A;  2O0Y A;  1XSD A;  4RB1 A;  1ZG1 A;  1HKQ A;  3D5L A;  1O7F A;  2PN6 A;  1QZY A;  2A6E F;  1LVA A;  1D3Y A;  3GO5 A;  2MBF A;  1OYW A;  3GZ5 A;  2WC2 A;  2DQR A;  1ZYR F;  1H9G A;  1L0O C;  3HUG A;  2CYY A;  3N4M A;  5JVT A;  5CVJ A;  2EFQ A;  1YW9 A;  3F6V A;  4U7D A;  1BI1 A;  4HF0 A;  4M74 A;  3E6B A;  1MZB A;  3IHU A;  2FBI A;  2HQR A;  2A5Y B;  4KA4 A;  5E1W A;  2FML A;  4M71 A;  4G7Z F;  4AIK A;  3JAM K;  5A2Q Z;  4A0X A;  1XGM A;  4KMF A;  2H6B A;  1P92 A;  5AON A;  2AS5 F;  4NHJ A;  3IRR A;  3E6C C;  2MC3 A;  3ZMU A;  2UWM A;  3BRO A;  4EM0 B;  4IF4 A;  5D4R A;  2ZJ2 A;  1SAX A;  1EH6 A;  1XCB A;  2IPQ X;  4HLY A;  1E17 A;  2R3S A;  1EH7 A;  2D2W A;  2M5W A;  5DD4 A;  5IT9 Z;  3RTR A;  1RIO H;  1GXP A;  1WQ2 A;  3R61 A;  4UXN A;  5HS7 A;  1J9I A;  1BI3 A;  1IXR C;  1K7A A;  2OZ6 A;  1XGO A;  2M30 A;  3BOQ A;  3REO A;  4A0Z A;  3ROU A;  2FBK A;  1NHA A;  3VEP A;  4HX7 A;  2COM A;  1QNT A;  3VOE A;  4ZZL A;  4HQM A;  2FMY A;  2LF8 A;  1F4K A;  3IWZ A;  3EYY A;  5DUK A;  2HYG D;  1MDM B;  3I54 A;  4DNC A;  4HDU A;  2DQL A;  3BDD A;  1KU3 A;  4A2U A;  1YYV A;  3QU3 A;  1BJA A;  5HLI A;  4MTE A;  3MZH A;  2STW A;  3TOA A;  1ZRC A;  4OOI A;  2GZW A;  1CF7 B;  3RKX A;  1ZLJ A;  2DK5 A;  2HEO A;  3QP6 A;  2JRT A;  1G6N A;  2OBP A;  1B1B A;  1U5T C;  1YG2 A;  1J0R A;  4LB6 B;  1R23 A;  1D5V A;  1XGS A;  1K78 A;  5ED4 A;  1TW3 A;  3K2Z A;  2D1V A;  4BHB A;  1KQ0 A;  1YFH A;  1Z6T A;  1LQ1 A;  2K4J A;  2XGX A;  1TLH B;  5BMZ A;  3FM3 A;  2TDX A;  3KP5 A;  4WXD A;  2YR2 A;  3G73 A;  2W25 A;  2CFX A;  5HVQ C;  5F64 A;  3FMR A;  2KKO A;  2IRF G;  2QYO A;  3LQR A;  1IAW A;  1V4R A;  4XLP F;  5CVI A;  4HOB A;  2XHK A;  2J5P A;  4PZJ A;  4ZYH A;  5ICC A;  5FLX Z;  4A6D A;  1FNN A;  2EFO A;  2AXL A;  2Z9O A;  2MLK A;  2ZO4 A;  1MKM A;  1XSX A;  2HS5 A;  1U78 A;  2JTV A;  4EGY A;  5LHH A;  2BYV E;  4FX0 A;  4GCV A;  4HQE A;  3SFZ A;  4CHU A;  5ILU A;  4LGW A;  1YS6 A;  2QLZ A;  1LNW A;  1JE8 A;  4EJT A;  1XMA A;  3GVA A;  3M7G A;  2IP2 A;  3GEZ A;  3KZZ A;  4HF1 A;  5FD5 A;  5HS9 A;  2FBH A;  4WF2 A;  4R1H A;  1HKT A;  3JSO A;  2IA2 A;  3EDP A;  4BXU A;  2O8X A;  4MGR A;  2RKH A;  1GXQ A;  3SHF A;  1ZRD A;  2EJR A;  1XD7 A;  4LG0 A;  3L2C A;  1UHW A;  3DP7 A;  5ERI A;  2VT3 A;  3ISP A;  4P55 A;  2R7D A;  1G3T A;  4OIQ F;  5F1R A;  4GXO A;  3IKV A;  2XAQ A;  1X3U A;  2RC4 A;  2RVC A;  1VTN C;  1FYM A;  4HX8 A;  5LEJ A;  2L01 A;  4E70 A;  3P9K A;  2DTR A;  4O3M A;  4I98 B;  1R5G A;  2W57 A;  2VBY A;  2EV6 A;  5FD6 A;  2VOO A;  3TO9 A;  2CQK A;  1LDJ A;  2RV8 A;  1S6L A;  1U6G A;  5EEG A;  1R1U A;  1UST A;  5FO5 A;  1W4M A;  4ENM A;  2JPB A;  4FHT A;  2QM3 A;  3K1N A;  2VC0 A;  3ABU A;  3CUQ B;  3ABT A;  2V1X A;  1R36 A;  3LFK A;  3WG9 A;  2CGP A;  2OZU A;  4MTD A;  2OA4 A;  4QWQ A;  4BQA A;  4L18 B;  2Z5U A;  1S7O A;  3ZMT A;  1U2W A;  1OMI A;  3RKW A;  3TO6 A;  2H6C A;  2MA3 A;  2Y0M A;  3O6B B;  3ZP5 A;  4I09 A;  5TJJ A;  4KIC A;  3RI4 A;  3ZMZ A;  3EYI A;  2L02 A;  3LST A;  4GYG A;  4Y15 A;  1QPM A;  3U9G A;  1DPR A;  2GWR A;  6PAX A;  3MQ0 A;  5IT9 K;  1FC3 A;  1WKM A;  2DPU A;  3DKW A;  5FB2 A;  1BI2 A;  1PP8 F;  1Z91 A;  4IHT A;  3FMS A;  4AIJ A;  4KT5 C;  2HTS A;  5FGM A;  3MFK A;  4G6Q A;  2XKO A;  5JHU A;  3V8J A;  3MEX A;  3WE3 A;  2ZFW A;  3DPT A;  1LB2 A;  1XDU A;  2G7U A;  4ZYD A;  2FRH A;  3Q5F A;  2GA1 A;  4YFX F;  4UVB A;  3FZV A;  3KEQ A;  4HA8 A;  2LF7 A;  1XSV A;  4JBA A;  4WK8 F;  2K7L A;  1REP C;  3WTS C;  5KVR A;  1S8N A;  2IT0 A;  3B02 A;  1FBQ A;  3QP5 A;  5L3F A;  3BP8 A;  4M9S A;  4OIO F;  4S05 A;  2OU2 A;  3WTV C;  1T39 A;  1T0F A;  3E6M A;  3SXY A;  2ZME A;  4Y17 A;  3VB2 A;  4GO1 A;  2A61 A;  2RQP A;  2EB7 A;  1LEB A;  1IN6 A;  1AWC A;  1L3L A;  3WTW C;  1UCR A;  1HW1 A;  2EFP A;  1S29 A;  1P6R A;  2D45 A;  3ECO A;  2K4B A;  4MNU A;  2F2E A;  2EFN A;  4IRI A;  1K79 A;  3FXU A;  5K1Y A;  2OD5 A;  3COA C;  4ESJ A;  5ICF A;  3EQL F;  3G3Z A;  1IZ1 A;  2ACJ A;  4MQV A;  5J8F A;  4CO8 A;  1Z05 A;  1LDD A;  1SD6 A;  1RZ4 A;  1R58 A;  1BM9 A;  2W84 A;  3T0Y A;  1UHM A;  3KP2 A;  1H0M A;  3CJN A;  3F72 A;  1BN5 A;  5CYV A;  1AOY A;  1HST A;  1JGS A;  5FLX K;  1UFM A;  2EV5 A;  2P7C B;  1F1Z A;  4RB0 A;  1KU2 A;  1YTY A;  2L4A A;  4RGX A;  1IUY A;  2IVM A;  3TDZ C;  2ZKZ A;  3GW2 A;  3MZY A;  3FHZ A;  3QRF F;  1IRF A;  3IKT A;  3P9C A;  5J6X A;  1TBX A;  2KIU A;  1WRJ A;  2L3D A;  3K1M A;  3S2W A;  1IW7 F;  2P4W A;  3M8F A;  4KIG A;  1U5T A;  3SZT A;  3E97 A;  4LD5 A;  4UUV A;  4Q5S F;  3RJP A;  1USS A;  1YW7 A;  1ZG5 A;  1Z1D A;  2O61 A;  2VBX A;  1I1G A;  3HIF A;  2QQ9 A;  2V9V A;  3RPQ A;  3GZ6 A;  2HWV A;  2IA0 A;  1O3Q A;  2H27 A;  3LAP A;  1JHF A;  1TTY A;  2NAZ A;  3LA3 A;  3JTH A;  2FU4 A;  4MQ9 F;  3LWF A;  2QQA A;  3OV8 A;  4LJZ F;  3RIR A;  2X0L A;  5FFX A;  2F5C A;  3F8C A;  3KFW X;  3TGN A;  3V7S A;  1SFX A;  4ENK A;  1HSJ A;  3WTZ A;  4CXF A;  4CZZ A;  4G6D A;  4KN4 X;  2HR3 A;  4LFU A;  4AVP A;  2XVC A;  3ML6 A;  5D6E A;  4N9I A;  2HQN A;  1P2F A;  5CLS A;  3E3V A;  2HYF A;  4CGZ A;  5JFR A;  2WWY A;  1FX7 A;  3B73 A;  3I64 A;  3RPU A;  1BIB A;  4XLN F;  4L0Z B;  2WTE A;  4IHS A;  4HX4 A;  3L09 A;  4OMY A;  1W5S A;  1MJ9 A;  1I6X A;  3KZY A;  3R60 A;  3I53 A;  1S3J A;  2VBZ A;  1ZG3 A;  1KU9 A;  2P6T A;  1FSH A;  3HRS A;  3C1D A;  2VN2 A;  4G94 A;  3WTU C;  4AWX B;  2HFH A;  5LGT A;  3F8F A;  1MDM A;  3IWF A;  1HXD A;  1B9N A;  4ASN A;  4UVC A;  2C6Y A;  5ICG A;  2PBI A;  3MWM A;  2XIG A;  1MGT A;  3V8K A;  3QAH A;  1CF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...