3FM5A

X-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
131
Chain Sequence
MAESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator
publication title X-ray crystal structure of transcriptional regulator (MarR family) from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus jostii
total genus 41
structure length 131
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fm5A00
4ENNA 2BEOA 4GYGA 3SQNA 5E1WA 3T1BA 4ON0A 1G3SA 1FBQA 5L3BA 4TV7A 2M1BA 2O3FA 3K1MA 3S2WA 4HZFA 3WTVC 2DBBA 1TLHB 1IN6A 3V7RA 2E7XA 2V9VA 3G3ZA 5HOOA 1JHFA 3DPTA 3CLOA 2EFWA 4RGXA 3SFZA 2L01A 1CF7B 2VE9A 2CWEA 2K02A 5D4SA 3V8KA 1B1BA 4BH9A 5L3GA 1FBUA 3EETA 4RB1A 1FYLA 3K1PA 1FSHA 2M45A 5DUKA 2W84A 1XSDA 4L18B 1XDUA 1YYVA 4N9IA 2F2EA 2MLKA 2VODA 1ODDA 3GLXA 4OMZA 3ROUA 3F8FA 3MEXA 1SFEA 2V1DA 3U2RA 2LDUA 2CG4A 5CLSA 3L7WA 4I98B 4BHBA 1FP2A 1P4XA 4OMYA 3BZ6A 1KGSA 1OYIA 1A04A 3TDUC 2HTSA 1D5VA 3P7NA 2KRFA 2W24A 3ZMSA 3QU6A 4G7ZF 4RAZA 4H0EA 2MBFA 2YPRA 2Y48A 1SD5A 3Q9SA 1LDDA 4I01A 5JR3A 1BC7C 4S05A 4KA4A 1REPC 5BPDA 3TO9A 5LRRA 2R7FA 2DAOA 4HW0A 1ZGAA 4LLGF 4DQ2A 3MCZA 3IWZA 5LBQA 2F5FA 3P9CA 3C7JA 1LDJA 4F7ZA 3LA3A 4MEYF 3WTUC 3FXQA 5E20A 2LSOA 2JTVA 2JPBA 1R7JA 2KJCA 1K7AA 1L0OC 1EV7A 1HW1A 3E6CC 2VOPA 3J80K 1U3EM 4AVPA 2F5DA 1IUYA 4UVBA 1FP1D 2IVMA 2HEOA 5DCMA 2DU9A 2ESNA 1LVAA 1BI0A 2FBHA 4CZZA 2NS0A 4WCGA 1W7PA 3WE2A 1ZARA 3ISPA 2HDCA 2G7HA 1AOYA 1OR7A 4ZYDA 1USTA 4P55A 1OKRA 1GHCA 3JTHA 1O3QA 2GWRA 3IRQA 2XHKA 5CVVA 5KVRA 4WXHA 4YG2F 4HQEA 3KP6A 5E1XA 1DP7P 2DK8A 5D5WB 5ICCA 5D6EA 1LQ1A 2GXGA 1O3SA 5D6FA 4Y17A 1QGPA 1FX7A 2GQQA 1KU9A 4EM2A 5CVUA 4IHTA 2FF4A 1TNSA 1TQIA 1KU3A 2XVCA 4LK1F 2JRTA 1UFMA 4IXAA 3LQQA 5D5VB 4I0BA 2ELHA 1G3WA 3ERED 1XD7A 3RJPA 4U7BA 3R61A 4KIBA 3LQRA 1PP8F 1UB9A 5LHGA 3RIRA 2ZKZA 3ZP5A 2FNPA 1I5ZA 4FX4A 4P96A 4UV8A 3REOA 2HZTA 5CVJA 3GYHX 1VTNC 3KP5A 2JPCA 3GZ6A 1P92A 1LNWA 3I5UA 2FSWA 2V6CA 4UVAA 5HLGA 3E5UA 3WE3A 1BC8C 4O6JA 5DDGA 1Z9CA 3CUQC 1U8RA 5L3DA 3NQOA 4ASNA 4IF4A 2Z5UA 3FMQA 4WX9A 2WWYA 5LGTA 2W85A 3QP6A 2OQRA 1MDMB 1I1GA 4XLPF 1ZN2A 3LFKA 2YR2A 4HF2A 3V7CA 1Q1HA 3DV8A 1IN5A 4P5OA 4Y15A 1BBYA 2WV0A 4XSXF 4UXNA 4LFUA 4HX4A 5BOXA 1KQ8A 1B4AA 3T8RA 4B09A 4QWQA 4G94A 2CO5A 4E70A 1YFHA 4KIFA 1MGTA 3GO5A 2KKOA 4XLNF 2K4BA 2H6CA 1S7AA 1FT9A 1U5TA 3H3ZA 1BIAA 4YFKF 1O7LA 4A6EA 5E18F 4RB2C 4L0ZB 3GX4X 1D8JA 2HQNA 5H6QA 3QRFF 1QO0D 1R5GA 1ON1A 2PG4A 3MQ0A 1G6NA 2EV0A 2O0YA 4N0BA 2K4JA 5HS8A 1T38A 2AS5F 4LLLA 4IVNA 4HDVA 4M6XA 2B0LA 2VT2A 1YW7A 2ZNYA 4R79A 4EM1A 5JHUA 2DFIA 5IT9K 3FHZA 2FEZA 2O61A 1W7PD 3T0YA 4RB0A 1K78A 1I1SA 1HBXG 3RPQA 5L3EA 3WU0A 2DK5A 4OU0A 4PCQA 3N97A 3NEUA 3FXRA 4HLXA 4EJTA 3F22A 2PBIA 2K7LA 5ILSA 4ENJA 2FA5A 1QZZA 1R1VA 2XRNA 5IT9Z 4WF2A 1J9IA 1HKQA 2FOKA 5ICFA 5HLIA 2VXZA 4BHPA 4L5JA 1KU7A 1HQCA 3O2PE 3NRVA 5K5OA 1WI9A 4G6DA 1F1ZA 1KU2A 1QPMA 2GA1A 2HFHA 4G7OF 4ESJA 2A5YB 2EFPA 1R58A 2Q2EA 2PQ8A 5BMZA 4U88A 1UHWA 1TQMA 3F8MA 1E2XA 2W25A 3GXOA 2QBYB 1XCVA 3F6VA 4YFXF 1YG2A 2MD5A 5BS6A 4EGZA 1TW2A 4Z2YA 4A2UA 1AWCA 4NQWA 4PZJA 3WODF 3KP4A 5D5XB 1OMIA 4HYEA 2XIGA 3O6BB 3ML6A 2R3SA 3F8BA 4PGHA 3U9GA 4RGUA 2RQPA 3BJ6A 2A6HF 3WTYC 2H94A 1TTYA 2PMHA 2GA2A 3JAMZ 1DPRA 4U0WA 3WTWC 5FD6A 5E1ZB 3R60A 1J0RA 2DPUA 4EJUA 2P5VA 5E17F 2E1NA 5EEGA 4ZYHA 4PDKA 4WK8F 3FXUA 2YSRA 1J7KA 2D1VA 2VC0A 2EB7A 3FWEA 3AAFA 4LJZF 5LEJA 2A68F 1TNTA 1BI1A 5HDKA 3RPUA 2ZNZA 3HSRA 4U0VA 2A07F 3E5XA 2ZMEA 3HIFA 4CICA 5ILVA 5DD8A 5HVQC 2MA3A 1BM9A 3RYRA 3GVAA 1FPQA 4KIGA 3TQNA 2CQKA 3IKVA 3I53A 1XGMA 2CGPA 3KE2A 5TRDA 3OV8A 3DPLC 4LG0A 2HKXA 3RI4A 3LSTA 3OOPA 4HX8A 2EV5A 3IC7A 3WGHA 3QAHA 3KETA 3I4PA 1W7PB 1WSUA 2HS5A 5HS9A 4HBLA 1ZGJA 4HAMA 2R7DA 3HOTA 4MHGA 1P6RA 1R1UA 2D1HA 5LLQA 2VONA 1F5TA 2J5OA 4Q47A 5L3CA 4LB5A 4EMSA 1EH8A 4M74A 1P2FA 4L0YB 1WRJA 4IJAA 2M8EA 4HLYA 2ACJA 3HYIA 2OA4A 1P4WA 3HTSB 5E8GA 5TJJA 3ECHA 1B9NA 3EYYA 5DV5A 2WC2A 3I54A 5H20A 2RKHA 1BJAA 2RV8A 1JXSA 6PAXA 4L9NA 3P9KA 2QVOA 1ON2A 3V4GA 1XMKA 3BY6A 4O3MA 1U5TC 4P9FA 3TO7A 1BI2A 4RGRA 2EFNA 4AD9A 4A6DA 3F6OA 3MZYA 5K1YA 2DI3A 1XN7A 2EWNA 2UWMA 1IN4A 4HOBA 1Z1DA 1CF7A 2XGXA 2ZXJA 4N9HA 3LWFA 4M6YA 3VOEA 5J8FA 2H6BA 2OD5A 4MQ9F 2OU2A 2YX7A 4IRIA 3DP7A 5DEQA 1XSVA 2E1CA 3VB2A 1ZG5A 1U2WA 4KFCA 1ZLJA 1J59A 3WGIA 4Q48A 3R0JA 4YIIA 5AIPA 3I59B 5ED4A 2ZJ2A 2FE3A 2Q0OA 1L3LA 3IWFA 5L3FA 4ENMA 2GIVA 3K9TA 3SXYA 1IZ1A 4YIFA 3KP2A 1SFUA 4IRGA 1XDSA 4AIKA 4M71A 1FZPB 2UZKA 4M9XA 4A0XA 2UXXA 1RZ4A 4RGSA 1HKSA 1QBJA 2PJPA 2XAJA 1YS6A 2DQLA 4WXDA 3VFZA 5D4RA 4JBAA 2CFXA 2YX4A 4I09A 3KLOA 1QQIA 3CO6C 4EVIA 4LB6B 1FC3A 4HV6A 1HSJA 1BI3A 2H09A 2OZUA 2H27A 3E6BA 1D3YA 1JE8A 2EV6A 1H9GA 5CVIA 3TDZC 3ZMDA 3WGGA 3CJNA 1FLIA 2D2WA 3ZMVA 3PFIA 2VBXA 4CXFA 2ISYA 4KMUX 1J5YA 3T8TA 5DUIA 2F5EA 2JZYA 3QOPA 2OQGA 3M7GA 1XSXA 1IF1A 2TDXA 4G7HF 1R5HA 3GFIA 4OIRF 2HKOA 3L9FA 4RAYA 2P7VB 3ZPLA 5DD4A 2FBIA 2IPQX 1T39A 2PEXA 1OPCA 1ULYA 3V7SA 3C1DA 3HRUA 2EFOA 2EA2A 2NNYA 4L5IA 3KEQA 3BP8A 3GF2A 3DKWA 2YU3A 2C6YA 3M1EA 1YW9A 1TW3A 1G3TA 4M72A 2DQRA 2MH9A 3ABUA 4M73A 1SD6A 3E5QA 1KYWA 2LKPA 4OIQF 5DCFA 5HDGA 2D45A 4U7DA 3W6KB 2NAZA 2GXBA 4O5VA 3IL2A 2V1XA 3I0TA 2P7CB 2M87A 3HRTA 1S7OA 3HUGA 5CYVA 2IA2A 2KIUA 1DPUA 1UCRA 2VC1A 2QWWA 3ZMTA 3HTUA 3E6MA 3RDIA 1STZA 3KZYA 4UNOA 1SFXA 4ZZDA 3K0LA 2FRHA 4ZYGA 1S3JA 3BROA 4XSZF 2XKOA 3CUQB 5D8KB 4LMYA 3QPHA 1FBSA 2DPDA 2BYVE 2M5WA 4IPAA 5FD5A 2QZ8A 3WG9A 3BJAA 2ZCWA 3SHFA 1RIOH 1MJ9A 4I7HA 3GFJA 5DYMA 5LHIA 2IRFG 1DDNA 2HWVA 3I64A 2O8XA 3F72A 4EJOA 3D5LA 4LGWA 2QYOA 2RVCA 5LGNA 3K2ZA 1V3FA 3KP7A 3MZHA 2E7WA 3KZZA 3BWGA 1R00A 3D0SA 4EJVA 1MZBA 3WU1B 2ETHA 3L2CA 3MAJA 2XV4S 1MDMA 1OYYA 4UVCA 2BE5F 3GW2A 5CJ9A 1ZRDA 1LJ9A 3GWZA 1ZG3A 2RC4A 4G9YA 5FFZA 2DO7A 3BPVA 3Q5FA 1MJAA 2HR3A 3CDHA 4FHTA 1FNNA 2X4HA 3DEUA 1ZREA 1WKMA 4U0YA 1ZH5A 5LEKA 3WTSC 1YIOA 3ZMZA 2VBWA 3KFWX 1FSEA 4L9TA 3QU3A 1ZAOA 4KNYA 4GYIA 2HQRA 2P5KA 2EFQA 2DT5A 3QPTA 1LDKB 3CUOA 3ABTA 3F8CA 3P9IA 3RKYA 4Q4ZF 4OIPF 2J5PA 1FYKA 2QM3A 5FGMA 1LEAA 2G9WA 4LK0F 3TKYA 2VE8A 3TO6A 3JAMK 1XGOA 5FLXK 2BBYA 5CVRA 3JSPA 2XROA 1R22A 3C3WA 2PN6A 1R1TA 2HYFA 4S04A 4NHJA 3F8NA 4EM0B 3PQJA 2PFBA 4KMFA 3GEZA 2A69F 3DXJF 1KQ0A 3ZMUA 3M9AA 3E3VA 1RUOA 3RKXA 4QLCU 1XGSA 1O3TA 5FLXZ 2EA4A 1YQAA 2A3SA 2X0LA 1BN5A 2P4WA 3LA7A 3K69A 3V8LA 4HA8A 4Q5SF 5J8CA 2Q8KA 5E8IA 3M8FA 2V79A 2LF7A 5ERIA 3HSFA 5F1RA 1IN8A 2JT1A 2XASA 5F64A 2NRAC 3JSOA 2M30A 4RS8A 4NB5A 3EYIA 4A0YA 3QP5A 4CHUA 4XBFA 4BXUA 3EUHA 1ZRCA 3MWMA 4MQVA 2MLGA 5LGUA 2MH2A 1XCBA 4KUMA 5LRSA 5H6RA 5F6FA 1SMYF 1Z6RA 1V4RA 4HDUA 3T5XA 2QBYA 3B73A 1YLFA 1F4KA 5DCMB 3HHHA 1Z91A 2VBZA 3TGNA 4OIOF 3MFKA 4EV0A 2CSOA 1GXQA 4MGRA 1JHHA 2LNBA 4EQQA 1PP7U 4HF1A 2L02A 3B02A 2LF8A 5KK1A 1IAWA 1WQ2A 5AIQA 1KA8A 3BJOA 2A6EF 2QUFA 2IA1A 1DUXC 3J81K 2NYXA 3FF5A 2IA0A 4FX0A 1IRFA 1MD0A 1TBXA 2BV6A 5FFXA 2XUBA 2DW4A 1T6SA 4FT8A 3W6JB 4KYWA 4KICA 4PGGA 4OOIA 2RDPA 4CYDA 4HF0A 3O3KA 2EJRA 2FQ3A 2V1UA 1LB2A 3BDDA 3IKTA 3TOBA 3J81Z 1MKMA 1D8KA 1RUNA 2ZFWA 1WWXA 2HOEA 4ZYEA 1EH6A 1YO5C 4MTDA 4JQFA 2DTRA 2G7UA 2F5CA 3FMSA 3K1NA 1IXSB 3ZQ7A 1U78A 4B8XA 3EQLF 5FB2A 1QZYA 3WTXC 2PMUA 1Z6TA 3V8JA 2KJBA 1GVJA 3KLNA 2VBYA 1RI7A 3J7AO 3HRSA 2O6GE 4BAYA 3RTRA 3L09A 5ICEA 2IJLA 3GFLA 4UUVA 2EK5A 1HKTA 3EDPA 3COAC 1I6XA 4HQMA 3SZTA 3FMRA 1XMAA 1XB4A 2OBPA 3DFGA 2HTJA 2Y0MA 3U1DA 2GAUA 2XKPA 2IT0A 1ONVA 1W5SA 2L4AA 4CO8A 4ZZLA 1B6AA 1K6OA 3PQKA 3VEPA 1IXCA 4YFNF 3J80Z 2PI0A 4AWXB 2QQAA 3F21A 1UHMA 5ICGA 1HXDA 1BIBA 2ISZA 2VN2A 2QLZA 1T98A 2RN7A 4MEXF 3H3UA 1U5TB 2Z3YA 4BYYA 2FXAA 2ZBKA 2OAZA 3E6DA 2FU4A 2NNNA 3C18A 1W4MA 3ELKA 5AONA 1FYMA 5HS7A 4M9SA 2Z33A 2XAFA 1G3YA 1T2KA 3RKWA 4LD5A 2P6SA 2VT3A 3F3XA 2QQ9A 1QNTA 2A61A 2IP2A 4IRHA 2MC3A 4DNCA 3CTAA 1PDNC 2PLYA 4ZH4F 4WWCA 1S8NA 2VOOA 3ECOA 1K78B 1F9NA 4KN7X 4CGZA 3R4KA 4AIJA 4I02A 2HGCA 1HW5A 4K2EA 3M8EA 5JI6A 2IW5A 3I59A 4G6QA 3FZVA 2STWA 2K86A 4CDGA 5J6XA 2OZ6A 3F23A 3HRMA 2COMA 3JW4A 2KIMA 2L54A 2KIFA 3FM3A 4OINF 5ILUA 1HW2A 1G4DA 3KCCA 4A12A 1IW7F 2P6TA 4L9VA 3HSEA 3WTTC 2RGVA 2L4MA 3H92A 3LAPA 3LAJA 3CO7C 1Y0UA 1Z7UA 1I27A 1USSA 5HDNA 3ULQB 1ZLKA 3RYPA 4I0AA 1KYZA 1SD7A 1O3RA 3TOAA 5BPIA 3HOSA 1K79A 1SAXA 2DLLA 4HX7A 2XAQA 4GCVA 4KT5C 2STTA 1J75A 4MTEA 2QQBA 1PUEE 2HYGD 1CGPA 1X3UA 1HSTA 4JK1X 1Z05A 4BNCA 4Y13A 2QENA 1ZRFA 1P4AA 2ADUA 1FY7A 1IN7A 2FMYA 4BHCA 4R1HA 4P9UA 1ZHFA 3SZPA 4WXCA 1O7FA 1YS7A 4IHSA 2O03A 5IT3A 1ZYRF 2RNJA 4GO1A 1J2XA 3JTGA 3DF8A 4ESFA 4KDPA 2FMLA 4KN4X 1E17A 4ETSA 3FX3A 2WTEA 3LA2A 3I58A 4RB3C 1W5TA 2FNAA 3GUDA 4ENKA 1B9MA 2XAGA 1SMTA 5A2QK 1MJBA 2Z99A 4MNUA 2CW0F 3VODA 1KQ9A 3ZN0A 4D0PA 3E97A 2ZMEB 3IHUA 3WTZA 1S6LA 2XAHA 4HV5A 1T0FA 2UXNA 1H9TA 5JFRA 1SD4A 2Z9OA 1BOAA 1NHAA 2P5LC 4ESBA 4XRFA 1LEBA 1TQPA 3BOQA 1FWZA 2Y75A 4BQAA 5LHHA 4AIHA 5EEHA 4EGYA 5D8LB 5A2QZ 1ZG1A 1OYWA 3KEOA 1RNLA 4LG0B 5FO5A 3GZ5A 4UV9A 1JGSA 3CUQA 1FOKA 2CYYA 2ZO4A 3IRRA 1IXRC 1R36A 2ESHA 3N4MA 2W57A 4M9ZA 5JVTA 4L9JA 3KP3A 2JSCA 2P8TA 4R8HA 3Q9VA 5HLHA 4UHTA 1YW8A 1EH7A 2L3DA 3DQVC 3G73A 4GXOA 2FBKA 2BGCA 3I71A 2GZWA 3GFMA 3L00A 1U6GA 4GGGA 3BPXA 1GXPA 3ZN1A 1B59A 1XGNA 1R23A 5K5QA 3FM5A 4EJWA 2AXLA 3R0AA 4A5NA 5K5RA 1O57A 2K27A 4A5MA 3R6SA 4I2OA 5BQTA 1C0WA 3HHGA 1S29A 1H0MA 5D5UB 4G8XA 4LLNA 1YTYA 1IRGA 4A0ZA
chains in the Genus database with same CATH superfamily
3ZQHA 4ENNA 4BEHB 3ZQIA 2BEOA 4GYGA 3SQNA 4J01A 1Z0XA 5E1WA 2X1DA 4IZZA 4XORA 4RMNA 4M3EA 3T1BA 3BR2A 4ON0A 3BG3A 4C30A 4AU7A 1G3SA 5J1YA 1MIJA 1FBQA 5L3BA 2XDVA 4TV7A 1RC9A 3CC4I 2M1BA 2O3FA 1G2HA 3K1MA 3S2WA 4HZFA 5GAHJ 5FJ8J 3WTVC 2DBBA 4G6TB 1TLHB 1IN6A 3V7RA 1Z3YA 2E7XA 2V9VA 3G3ZA 5HOOA 2IGKA 1JHFA 3DPTA 3CLOA 2EFWA 4RGXA 2WV1A 3SFZA 3LNQA 2L01A 1CF7B 2VE9A 5TISC 2CWEA 2K02A 2F5VA 5D4SA 2FQ4A 3V8KA 3AG3H 1XC5A 1B1BA 4BH9A 5L3GA 3NAUA 1FBUA 3EETA 4RB1A 1FYLA 3K1PA 3N05A 1FSHA 5E3MA 5IP9J 1YJWI 1Q1VA 2M45A 5DUKA 2W84A 1XSDA 4L18B 1XDUA 2KRCA 3S1QJ 1YYVA 2HDWA 4N9IA 2F2EA 3Q5FA 1AKHA 1OCPA 3Q3SA 4A3FJ 2F4MB 2MLKA 2LY9A 2X85A 5CKTA 1D0ZA 2VODA 1ODDA 3GLXA 3TBIA 4OMZA 1Y6IA 2Y31A 3ROUA 3F8FA 3MEXA 4I6ZA 1SFEA 2K3FA 2OJED 3K10A 2M8GX 2JK3A 2V1DA 3U2RA 2LDUA 3MKYB 2CG4A 5CLSA 3L7WA 2IBDA 4M3BA 4I98B 1X19A 4BHBA 4PJ0C 1FP2A 3OYDA 2WAQA 1JKQC 1P4XA 1VFCA 5IYDJ 4DBQA 2OV7A 4OMYA 3BZ6A 1KGSA 3K70C 1OYIA 2XF5A 2ZXIA 1A04A 2CH0A 3CDLA 1VQLI 3TDUC 3W2AA 3A1YA 2HTSA 1D5VA 3P7NA 3OR2C 4XLAA 2KRFA 2LG4A 2W24A 2GXAA 3A01A 3ZMSA 3QU6A 4G7ZF 4RAZA 4H0EA 2MBFA 4BKXA 1KZHA 2ZSHB 4YRVA 2YPRA 4BY1J 2Y48A 1SD5A 2YUSA 2QEXI 3Q9SA 1FJLA 1LDDA 4ZC3A 3H5AA 4I01A 2R4GA 3RCOA 5JR3A 1BC7C 4S05A 4KA4A 2M4GA 1REPC 5BPDA 2HVSA 5JHFA 3TO9A 5LRRA 2XF6A 3CF2A 2R7FA 2LVSA 2CQNA 2DAOA 5GTHC 2B7EA 4HW0A 4CCNA 1ZGAA 4LLGF 4DQ2A 3MCZA 3BTIA 3VWBA 3IWZA 5LBQA 2VUMJ 2F5FA 3P9CA 3C7JA 4NNJA 1LDJA 3BCBA 4QPQA 4F7ZA 3LA3A 4MEYF 3WTUC 3KIOA 3FXQA 5KAFC 5E20A 2LSOA 4E7ZA 2R5ZB 3ERMA 2JTVA 2JPBA 3MVPA 2CV2A 1R7JA 2KJCA 2K9LA 2VL8A 3SZGA 1K7AA 1L0OC 1EV7A 1HW1A 2DOAA 2OCCH 5M5WJ 3E6CC 4IKFA 2VOPA 3J80K 1U3EM 2HU9A 4AVPA 1LFBA 2HOAA 2DMNA 4BQNA 2F5DA 1IUYA 1X2MA 2BOLA 2VQLA 4UVBA 1FP1D 2IVMA 2HEOA 3IH2A 2DU9A 2ESNA 1LVAA 1BI0A 2LFBA 2FBHA 2Q1ZB 3EUAA 5DCMA 4CZZA 3AKZA 2NS0A 4WCGA 1OCOH 5CQGA 3FK7A 1W7PA 4S0HB 3WE2A 1ZARA 5GPAA 3ISPA 3DPUA 1IJWC 3FXMA 2HDCA 2L7FP 1X4OA 2G7HA 2TCTA 1AOYA 1OR7A 4IL6C 4ZYDA 2QSHX 5JVGF 1USTA 2E2IJ 4P55A 1UJ8A 2P81A 1OKRA 1GHCA 5KNLA 1HC8A 2NXNB 3JTHA 2GWRA 1O3QA 3CCYA 3IRQA 3HGYA 2XHKA 2BVMA 5CVVA 5KVRA 4WXHA 4PK4A 2K9QA 3KP6A 4YG2F 5E1XA 3HJEA 4HQEA 2DK8A 1DP7P 2BZTA 2BY1A 5D6EA 4BL0B 5ICCA 5HODA 5D5WB 1LQ1A 2V6EA 2GXGA 4OAYA 1O3SA 5D6FA 3PFYA 4Y17A 4NDLA 1QGPA 2DA7A 2JA6J 2XB0X 1FX7A 1UAAA 2M0MA 3H35A 2GQQA 1KU9A 2FJ1A 4E7JA 4EM2A 2LYCA 3PJRA 5CVUA 2NVYJ 4IHTA 2FF4A 2CMPA 1RPWA 1TNSA 1TQIA 1KU3A 3CP8A 2VASA 2XVCA 2ZJRF 4LK1F 2JRTA 2I10A 3BG5A 1UFMA 2QSGX 4IXAA 2IS2A 1IV8A 3LQQA 5D5VB 1A31A 4I0BA 2BW3B 2ELHA 1G3WA 2W7NA 3ERED 3OYHA 2LC2A 2V9KA 1R4MB 1XD7A 1R4NB 3RJPA 5B3SH 4IX7A 4U7BA 3R61A 4KIBA 3LQRA 1ZKGA 4II3A 1W5CC 1PP8F 1UB9A 5J4VA 5LHGA 1MBJA 3RIRA 2ZKZA 3I4MJ 3ZP5A 2FNPA 1I5ZA 4FX4A 4P96A 4UV8A 3REOA 4YIRX 2CU7A 2HZTA 5CVJA 3GYHX 1VTNC 3KP5A 1LUJB 1F36A 3A0HC 2JPCA 2VQGA 5J3LA 2BXYA 2VJJA 3GZ6A 1P92A 1K6YA 1LNWA 3I5UA 1D1BA 2FSWA 5EF6A 2V6CA 1NTCA 1YITI 4UVAA 5HLGA 3E5UA 3WE3A 3MD2A 3JRFA 3OYJA 2A6TA 2DXIA 1BC8C 4O6JA 1LE8A 1XG1A 5EG0B 4IO9F 2RREA 5DDGA 1Z9CA 3CUQC 2RNGA 3C2GA 1U8RA 2QKLB 3NQOA 5L3DA 4ASNA 5K7ZA 4IF4A 2Z5UA 3PL8A 3J7AY 3FMQA 4WX9A 2WWYA 4B4CA 2I8DA 5LGTA 2W85A 1YRNB 3QP6A 4UY8I 2OQRA 3GZNB 4DYRA 1FMVA 3UKGA 1MDMB 1Z77A 1V5FA 1DU6A 1I1GA 4XLPF 1ZN2A 3AG2H 3HKZA 3LFKA 2YR2A 4HF2A 2L7MP 2L0KA 3NWTA 3M1CA 3PNTA 3V7CA 1Q1HA 3DV8A 3F9KA 4A93J 1IN5A 4P5OA 1A5JA 4Y15A 1BBYA 2WV0A 4XSXF 4D5CA 4UXNA 3L1PA 4LFUA 2X1CA 3A03A 2JMWA 1PUFB 4C9YA 1N25A 4HX4A 2EBIA 5BOXA 1KQ8A 1B4AA 3VSLA 3T8RA 5FKLA 1XMXA 4G94A 4QWQA 4B09A 2CO5A 4E70A 1I6HJ 1YFHA 3OWTA 4KIFA 1MGTA 1PVEA 3GO5A 2KKOA 2R7UA 4XLNF 2K4BA 2H6CA 3OYEA 2L9NA 4DOZA 1S7AA 1FT9A 3DTKA 1U5TA 1FOYA 3H3ZA 4A3KJ 1BIAA 4YFKF 1O7LA 4A6EA 1UHSA 5E18F 4RB2C 4L0ZB 2DTZA 3GX4X 3HL2A 1D8JA 2KZGA 4L5EA 2HQNA 5H6QA 1FIAA 1W36C 3QRFF 2FUG2 5J40A 1MBGA 4DW6A 1QO0D 3K2AA 1R5GA 3WG7H 1ON1A 2DT7B 2PG4A 3DLLF 3ABKH 2NVXJ 3MQ0A 1JI8A 4ZDLA 1G6NA 2BHYA 4F3QA 2EV0A 1XTAA 2O0YA 4N0BA 2K4JA 4DYCA 5HS8A 2KPMA 1T38A 2AS5F 4LLLA 2ZB9A 4IVNA 4HDVA 3LL7A 4M6XA 3OYIA 3L2RA 2B0LA 2VT2A 1LVKA 1X4PA 1YW7A 2ZNYA 4BS9A 2ZMEC 3H5NA 3JRIA 1GT0C 4AYBN 4R79A 4M3DA 4EM1A 4F52A 3RSNA 5JHUA 2DFIA 1T08B 5IT9K 1SFKA 2K9SA 3FHZA 3D5SC 1MMAA 2FEZA 3JREA 4V19K 2O61A 4Y33A 4XNFA 3KPHA 5HNHA 1W7PD 3T0YA 4RB0A 3TW7A 2OF7A 1K78A 3CDIA 1I1SA 1HBXG 4C3JJ 3RPQA 5IY5H 5L3EA 3WU0A 2DK5A 4OU0A 4PCQA 2M7AA 3JRAA 1DGRM 3MMYB 2IEKA 3N97A 3NEUA 4OAZA 2X6OA 2K40A 4C2MJ 3FXRA 1E3HA 4XN0A 4HLXA 4EJTA 3F22A 1IG7A 1RETA 4XOPA 3CJRB 3CJTB 1ZK8A 2PBIA 2X1EA 2K7LA 5ILSA 3RQ4A 4ENJA 2FA5A 1QZZA 1R1VA 1OCRH 2CV0A 2E34A 2XRNA 2DA3A 3FIWA 5IT9Z 1I50J 4WF2A 2DA5A 3G1OA 1HKQA 2FOKA 1J9IA 2ME0A 1EKEA 2JSPA 5HLIA 5ICFA 2VXZA 3VYTB 2DCEA 1NG6A 3L2UA 1OISA 4BHPA 3OR1C 4L5JA 1KU7A 4MFDA 4BQQA 3CZ6A 4XQFA 1HQCA 3W6VA 1ETWA 3O2PE 3NRVA 3GTLJ 2NVUB 1X58A 5K5OA 3ZQQA 1WI9A 4G6DA 3HZJA 1F1ZA 1RESA 2UUZA 3JRHA 1VQNI 3I9V2 1T95A 2PX9A 4UUTA 1KU2A 2QGUA 1QPMA 2GA1A 2HFHA 4G7OF 4ESJA 2A5YB 2VJIA 3H5RA 2CJJA 4XN3A 2EFPA 1R58A 2Q2EA 2PQ8A 3K4LA 3W2VA 3LSRA 2N8GA 5BMZA 2X51A 3RZDJ 2R7XA 4U88A 1UHWA 2CW8A 2QA4I 1TQMA 3F8MA 1E2XA 2CRGA 1VI0A 4FTHA 4DZJA 2W25A 3E0JB 4B48A 3GXOA 2QBYB 2VKEA 1XCVA 2HOTA 3F6VA 4YFXF 1YG2A 2MD0A 2MD5A 4IHWA 3BZCA 5BS6A 2UV1A 4EGZA 1TW2A 4Z2YA 4A2UA 1AWCA 4NQWA 4RAGA 4PZJA 3WODF 3CLQA 2HXIA 3KP4A 5D5XB 1MH4A 1OMIA 2HXOA 4HYEA 2XIGA 4ZJZA 3O6BB 3ML6A 4A69C 2R0QC 4ANJA 2LP0A 3HG9A 2CW7A 3DLAA 2R3SA 3K70D 3PO3J 1YJNI 4AVZA 1K83J 4XICA 3F8BA 4PGHA 3GTMJ 3U9GA 4RGUA 2RQPA 5C4JJ 1NK2P 3BJ6A 2DA4A 5GP9A 5DTDA 2XPUA 3G1MA 3HOYJ 2A6HF 3WTYC 2H94A 2ELKA 2D5VA 1TTYA 2PMHA 4I76A 2L5QA 2QCOA 2GA2A 4B1RA 4QSHA 1DPRA 4U0WA 3JAMZ 5FD6A 3WTWC 5M3MJ 5E1ZB 3S15J 3OMYA 3R60A 4BE0A 1J0RA 1OR7C 2DPUA 4EJUA 2P5VA 5E17F 2E1NA 2GM4A 1SANA 2B9SA 5EEGA 4ZYHA 3HPGA 4PDKA 4WK8F 5F0HA 2Y9YA 3MKLA 3PSFA 2Y0SN 1E3PA 2XB5A 3FXUA 2YSRA 4IHVA 4W1UA 1VQOI 1J7KA 1SEUA 2D1VA 2VC0A 2EB7A 3H9GA 3UR3C 1VQ8I 3FWEA 1WGXA 2MW8A 3AAFA 2VJ4A 2EPFA 4LJZF 5LEJA 3DBRB 5IP6A 2A68F 1TNTA 1NG7A 3DU5A 1BI1A 5HDKA 4Y3OA 3RPUA 2ZNZA 3HSRA 1A36A 1DQUA 1N78A 4U0VA 1GUUA 2A07F 1T56A 3BLYA 3HDDA 3HC7A 4QPOA 3E5XA 4GRIA 2ZMEA 1MMNA 3HIFA 4CICA 3H0DA 5ILVA 9ANTA 5DD8A 5HVQC 4KJZA 2ZC2A 2MA3A 4RDUA 4JOMA 3FXJA 3CD6I 1BM9A 2KP6A 3RYRA 3BG7A 2YU9J 1OCCH 3GVAA 3M4OJ 2HZDA 2NOGA 1FPQA 2R5YB 3IV5A 4KIGA 3TQNA 2CQKA 3BG6A 3IKVA 4Y4RA 3OYKA 3I53A 2EH3A 5EYRA 1XGMA 2CGPA 1YHQI 3KE2A 3CMEI 5TRDA 3OV8A 2Y30A 3DPLC 4LG0A 2HKXA 4E7IA 3K4JA 3RI4A 2VQCA 4BXXJ 3LSTA 3OOPA 1ETKA 2QSFX 4RM2A 4HX8A 1MNEA 4LIUA 4FISA 1M1EB 2EV5A 2ZXWH 2FD5A 1BJZA 2XAUA 3IC7A 3WGHA 3QAHA 2LRDA 2ID3A 3KETA 1MBFA 2MFZA 2GIZA 3I4PA 1W7PB 1WSUA 2HS5A 3CMYA 5HS9A 3FXLA 2W48A 3L2VA 4HBLA 2X48A 1ZGJA 4HAMA 2R7DA 3HOTA 4MHGA 2IGMA 2QKMB 1PYVA 3QYFA 1P6RA 1D5YA 4AIDA 3RZOJ 5EGOA 1R1UA 3DEWA 2D1HA 5LLQA 2X6WA 4MFEA 4E6KG 2VONA 1X1DA 1X3WB 1N77A 3SEZA 1F5TA 2J5OA 5JLXA 4Q47A 1TT0A 5M5YJ 5L3CA 4LB5A 4EMSA 1EH8A 3K4BA 4M74A 2DJIA 4C2TA 1P2FA 4L0YB 2L2OA 3IP4B 1I39A 2PJRA 1QU3A 4BQOA 1WRJA 4IJAA 4XLHA 2M8EA 2K85A 1R49A 4A3GJ 4HLYA 4C3HJ 3DU6A 2WBMA 2JRMA 1MMSA 2ACJA 2VB6A 4F92B 5DM6F 3HYIA 2OA4A 4HEA2 2DODA 4BEHA 1ZELA 4A3DJ 1R6RA 3DKYA 1ACIA 2DFEA 1P4WA 3HTSB 5E8GA 5TJJA 2ZJPF 1WJCA 2B63J 3ECHA 1B9NA 3HOXJ 3EYYA 3K7AJ 5DV5A 4A3BJ 2WC2A 3I54A 1TWAJ 5K7HA 1JKPC 5H20A 2PMZA 2RKHA 1AA7A 3F0CA 1ORKA 1Y8RB 4B3XA 1BJAA 3LSGA 2RV8A 1JXSA 3P5JA 6PAXA 4L9NA 4CCMA 2QVOA 3P9KA 1ON2A 4FETA 3V4GA 4LOCA 2EZLA 2V4JC 1XMKA 2XGEA 3BY6A 4O3MA 1CQTA 3I56I 1U5TC 4P9FA 1V5GA 3DWLE 3TO7A 1BI2A 4RGRA 2EFNA 4AD9A 4A6DA 3F6OA 3MZYA 5K1YA 2DI3A 1XN7A 1S9HA 2LBFA 2WB1N 2EWNA 2E1OA 5HLTA 2UWMA 1IN4A 1RR7A 5LFAA 4HOBA 1Z1DA 1CF7A 3GTQJ 2XGXA 2ZXJA 4N9HA 3LWFA 4M6YA 3VOEA 5J8FA 4YEJA 2H6BA 2OD5A 4MQ9F 2CQ7A 1BW5A 2OU2A 2YX7A 2M9HA 3EPZA 3QPLA 2HNHA 3WHCA 4EATA 2X9DA 4IRIA 3DP7A 1VQ9I 2L7ZA 5DEQA 1PJRA 3M07A 1XSVA 2E1CA 5F0CA 3VB2A 1ZG5A 1U2WA 4KFCA 1ZLJA 1XS9A 2JN6A 3S17J 3OYNA 1V5EA 1J59A 4OWRB 3WGIA 4Q48A 2O9LA 3G1LA 3R0JA 4YIIA 5CQEA 5B66C 2GLOA 1S72I 4BACA 5AIPA 3I3LA 5C3EJ 2R7TA 3I59B 5ED4A 1Y8QB 2ZJ2A 4NC7A 1LFPA 4DYQA 3M8JA 2HQAA 5IPAA 2FE3A 2Q0OA 1TWFJ 1L3LA 3BQYA 5EJCA 5J1UA 2BXZA 3BTJA 3IWFA 5L3FA 4ENMA 1XX5A 2GIVA 4EEFG 3K9TA 3SXYA 2DFHA 2LD5A 2WAQN 1IZ1A 4YIFA 3KP2A 5E3NA 5LD2C 2NOJB 4IRGA 1XDSA 2FOWA 2DMUA 4D5FA 4AIKA 1SFUA 1B72B 1J09A 2EILH 4M71A 4RA2A 1FZPB 2F48A 2UZKA 1W36D 2VPLA 4M9XA 3G71I 2ECCA 4LG3A 4A0XA 2UXXA 1RZ4A 1OLTA 4CYCA 4RGSA 2DA1A 3IAM2 1HKSA 1QBJA 2PJPA 2XAJA 1YS6A 2DQLA 2KHMA 4WXDA 1QPIA 3K4MA 3VFZA 5D4RA 3VYUB 4JX4A 3RPUD 4JBAA 3LSPA 2CFXA 2ELJA 2LR8A 2YX4A 4I09A 1QRYA 4XK4A 5IOZA 3KLOA 1QQIA 3CO6C 4II2A 4EVIA 2GOMA 4LB6B 3LMMA 1FC3A 4HV6A 4IOCF 1IDZA 1HSJA 1BI3A 2CUJA 3FBNB 2HDDA 2H09A 2KT0A 2OZUA 4XRMA 2CUFA 2H27A 1JKRC 4IHXA 3E6BA 1D3YA 1LKXA 1JE8A 1K4SA 2EV6A 4XM3A 4CA0A 1H9GA 5CVIA 3TDZC 3L2QA 3ZMDA 3WGGA 4AUXA 3CCMI 2W00A 3CJNA 3GMEA 2D2WA 2DOEA 1FLIA 3S1RJ 4B43A 3K6GA 4CUGA 3ZMVA 3S3MA 3PFIA 2BHZA 2VBXA 4CXFA 2ISYA 2IAIA 1T33A 4KMUX 3OS1A 2H1KA 1J5YA 3OYGA 3T8TA 5DUIA 4CCJA 3QWLA 2F5EA 2JZYA 2DN0A 3QOPA 2OQGA 1EF4A 3BG9A 3M7GA 2F6CA 1B8IB 4HSRA 1XSXA 1U8BA 1IF1A 2RQQA 5GTIC 1SAUA 2TDXA 5F0FA 4G7HF 1R5HA 5C44J 4CSWA 3GFIA 1SVOA 4OIRF 1HDDC 2HKOA 3L9FA 4RAYA 1GLNA 2P7VB 4DJAA 3ZPLA 5DD4A 4AM3A 2FBIA 2IPQX 1FTZA 2DA6A 2JVHA 1QHGA 3WHBA 3A4CA 2HYJA 2OC6A 1T39A 4V2GA 3SFIA 2E19A 4A3IJ 2BY2A 1UG0A 2PEXA 4RM3A 3NARA 1OPCA 1ULYA 3V7SA 3C1DA 3HRUA 2EFOA 2FX0A 2EA2A 2NNYA 4L5IA 4BE2A 3KEQA 4UB8C 1JJ8C 1WJEA 3BP8A 3DKWA 3GF2A 3PNVA 2YU3A 1HLVA 1Y56A 3BQZA 2OCEA 1EJ9A 2C6YA 3M1EA 2OTLI 1YW9A 1TW3A 1KONA 1G3TA 4M72A 5H2FC 2DQRA 2MH9A 3ABUA 4M73A 3VPRA 1SD6A 3E5QA 4M3FA 4BU2A 1KYWA 2LKPA 1T8IA 3AL0C 3LOCA 4OIQF 3CF5F 5M3FJ 1X1PA 1VZ0A 3C2HA 5DCFA 1G8XA 5HDGA 2D45A 3W2WA 4U7DA 2DT6A 3W6KB 1HF0A 4HRIA 5DM7F 2QF7A 2NAZA 2GXBA 4O5VA 5FKKA 3IL2A 2NS8A 4XR6A 2V1XA 3I0TA 3GTGJ 2LREA 2EIJH 2BW3A 2XGDA 1DP3A 3BC8A 2P7CB 3QOEA 4Y52J 4A3CJ 2LMDA 3BR3A 2M87A 3HRTA 4NC8A 4XOTA 1S7OA 3HUGA 5CYVA 1Z7LA 2IA2A 2KIUA 1DPUA 5F27A 2JUGA 2E5NA 1WHUA 4CCKA 1UCRA 5EDNA 2VC1A 2QWWA 2E35A 3HTUA 3ZMTA 3E6MA 3RDIA 1STZA 3KZYA 4UNOA 2MYSA 1IV6A 3MKWB 1IDYA 1SFXA 4ZZDA 2CQXA 3K0LA 1MNDA 2FRHA 2XPVA 4ZYGA 1R71A 5KAIC 4HG2A 1S3JA 3BROA 2LTPA 5GAGJ 4XSZF 2XKOA 3J7YJ 1IRZA 5M5XJ 3CUQB 5D8KB 4FASD 3EUHC 4LMYA 4G12A 3QPHA 1FBSA 2DPDA 3A2KA 2BYVE 2COBA 2M5WA 4IPAA 5FD5A 2QZ8A 3WG9A 3BJAA 3PM1A 2ZCWA 2Z1DA 3SHFA 1RIOH 2EINH 2F4IA 3JCUC 1MJ9A 4I7HA 3GFJA 5DYMA 5LHIA 3I55I 1Z21A 1DDNA 2IRFG 2HWVA 2VQHA 3I64A 1GVDA 3SDBA 1WJ5A 3ZXSA 2O8XA 2M34A 2I5UA 3F72A 1NK3P 1U0JA 4EJOA 3D5LA 4LGWA 2QYOA 2RVCA 5LGNA 5EG0A 3K2ZA 1V3FA 1ETYA 3KP7A 1RR8C 2E7WA 3MZHA 1ETOA 3KZZA 3BWGA 2CV1A 1R00A 3D0SA 4EJVA 4XIDA 1X1BA 3U1KA 1MZBA 3WU1B 1YRNA 1WJDA 2ETHA 4A3MJ 3L2CA 3MAJA 3VDXA 1BOBA 2XV4S 1YE9A 2E1MB 3QYBA 5IP7J 1MDMA 3BTLA 1OYYA 4UVCA 3CCQI 2LKSA 1R5ID 1VNDA 3FISA 2E2JJ 2BE5F 1BR4A 1D1AA 2ZFUA 3OYLA 3GW2A 2O5RA 2KZVA 2V26A 3FK6A 3HKZN 2MABA 4PJNA 1WI3A 4E7KA 5CJ9A 2IS6A 1W0UA 3CC7I 1ZRDA 1LJ9A 3GWZA 1ZG3A 2RC4A 4BJ6C 5J1RA 1NH3A 4G9YA 3CCRI 5FFZA 2DO7A 2KMUA 3BPVA 1POGA 2IGOA 1MJAA 2M0CA 2HR3A 3CDHA 3IH4A 2KRHA 4FHTA 3VYSB 4C3IJ 1W0TA 1ETQA 1FNNA 5E3OA 2X4HA 1JT0A 4HNUA 3DEUA 3S93A 3QYEA 1ZREA 1OCZH 1JTYA 1N75A 2MGQA 1WKMA 2Y69H 1VQKI 4U0YA 4QIWN 1ZH5A 3CP2A 3GBGA 5LEKA 3WTSC 1YIOA 3ZMZA 2VBWA 4E4HA 3ZQLA 1K61A 1LPQA 1SVMA 2NVTJ 3KFWX 1FSEA 3QPSA 3TL4X 4L9TA 4F93B 3QU3A 3HOUJ 2KIQA 1ZAOA 4KNYA 4GYIA 2HQRA 2P5KA 2EFQA 3ZQGA 1ZTRA 3Q0UA 2DMQA 2DT5A 3QPTA 1LDKB 3RQIA 3HGGA 3DEEA 3CUOA 3ABTA 3F8CA 3P9IA 3RKYA 4Q4ZF 4OIPF 1HA8A 2J5PA 3HEFA 1FYKA 3HOVJ 2M4KA 2JJ7A 2QM3A 3OY9A 1TC3C 5FGMA 1LEAA 4RLFA 3DTEA 1D1CA 2G9WA 2IS1A 4LK0F 3TKYA 2R7SA 3BT9A 4N4OB 2VE8A 3S16J 3TO6A 3JAMK 5FRMA 4DGWB 2Y9ZA 4A3LJ 2G0EA 1XGOA 3H36A 5FLXK 4IQJA 2R93J 3S14J 2BBYA 5CVRA 2JUCA 3JSPA 2VKVA 2XROA 1R22A 3C3WA 2LY1A 2PN6A 2H8RA 1AKHB 3PIOF 5GADJ 1R1TA 3ZGKA 1ITYA 2HYFA 3UNGC 3FHNA 4S04A 2L9RA 4NHJA 2JA5J 3F8NA 4EM0B 3PQJA 4V2FA 2PFBA 5EZGA 1X2NA 2XGCA 1YX3A 5F04A 4KMFA 2W1OA 3CJQB 2A69F 3GEZA 2KDZA 3I4NJ 3DXJF 1YI2I 3OSFA 1KQ0A 3G2BA 4P1WA 3ZMUA 3S3OA 3M9AA 1BR1A 3BR5A 1S7EA 3E3VA 3GLLA 1MBKA 3PNYA 3RKXA 5IOYA 1RUOA 2OUMA 4N4NB 1BA5A 3MZ8A 1ENHA 1E3OC 4UUSA 4ZDPA 1TWGJ 2V7FA 4QLCU 1XGSA 4H4KC 3BZKA 3PUFA 1O3TA 5FLXZ 2EA4A 1XPXA 1HDPA 1FTTA 2DDAA 1YQAA 2ECBA 2A3SA 2X0LA 5GPCA 4BJTA 1BN5A 2P4WA 3PIPF 1MNMC 4PJMA 4HNTA 3DBHB 3LA7A 3K69A 3V8LA 3ABMH 4HA8A 4Q5SF 5J8CA 2Q8KA 2XF7A 5E8IA 5IYCJ 3M8FA 2V79A 3A01B 2LF7A 1ZR2A 2VPRA 5ERIA 3U21A 3X2QH 4F91B 3LSHA 3HSFA 5F1RA 2IGNA 1IN8A 1I3QJ 1WH5A 2JT1A 3HM5A 3H9JA 4JYKA 1RKTA 2XASA 5F64A 2NRAC 3JSOA 3OYFA 1GV2A 2M30A 4RS8A 3TP0A 4NB5A 3EYIA 4FCYA 3LSIA 4A0YA 3QP5A 1IUFA 1WCMJ 4CHUA 4XBFA 2DJNA 4BXUA 4PFPA 3EUHA 1ZRCA 2DMTA 3MWMA 2GBYA 4MQVA 2K5CA 1UMQA 1Z3XA 1TWCJ 3KEYA 2MLGA 5LGUA 3SEQA 2MH2A 4CH7A 5BNGA 1XCBA 3MN2A 4KUMA 3V42A 5H6RA 5LRSA 2WB1A 1TL8A 5F6FA 1SMYF 1Z6RA 1V4RA 4HDUA 2LBFB 3T5XA 3H0GJ 2QBYA 1ETVA 3B73A 3BR0A 1GDTA 1YLFA 1QHHD 2AQEA 1F4KA 3Q0VA 1P9QC 4BGDA 1G59A 4BXFA 2WY7Q 5DCMB 1QVUA 2W82A 3HHHA 1Z91A 2VBZA 3TGNA 4OIOF 3MFKA 4EV0A 2CSOA 1GXQA 4MGRA 1JHHA 3W3CA 4ZTFA 1JKOC 3CC2I 2W4SA 2LNBA 3DBLB 4XKBA 1IO2A 1P7IA 2CUEA 2DYSH 5IYBJ 4EQQA 5J4YA 1PP7U 3IH3A 1MMDA 1UELB 4HF1A 1WPKA 2L02A 2QQ8A 3JRBA 3B02A 4KITB 2LF8A 2L9SA 5KK1A 2JA7J 4U87A 2KISA 1IAWA 1WQ2A 1SVLA 5AIQA 1KA8A 3BJOA 2A6EF 4HSTA 2ME6A 2QUFA 2IA1A 3E7LA 1DUXC 1RRJA 2KLOA 3J81K 2NYXA 4B47A 3FF5A 1S5LC 2JQ7A 2IA0A 4FX0A 1A35A 4XLCA 1IRFA 5B5EC 1O4XA 1MD0A 1TBXA 2LLKA 1JJ6C 2BV6A 4NBQA 3CCSI 5FFXA 2XUBA 2BY3A 2DW4A 3ZR8X 3ZQCA 1T6SA 3OS0A 4FT8A 1VF9A 3LSKA 3W6JB 4KYWA 2WAEA 4KICA 4PGGA 4OOIA 2RDPA 4XLEA 5B1AH 4CYDA 4HF0A 4NUBA 3O3KA 4J19A 4CYCB 3O8GA 4DZPA 1DGWY 2EJRA 2FQ3A 3IUOA 1VQ7I 2BY0A 2Z16A 2V1UA 1LB2A 3BDDA 1WJFA 3IKTA 3WU2C 3TOBA 3J81Z 1MKMA 1D8KA 3ASNH 1RUNA 3QQAA 2ZFWA 4GFBA 1WWXA 2HOEA 4ZYEA 1EH6A 4PJJA 3ZCOA 1YO5C 1HOMA 5DS9A 1U9OA 2CFOA 4MTDA 4JQFA 3TEDA 2DTRA 2G7UA 2F5CA 3FMSA 1WZ2A 3K1NA 1IXSB 2M3AA 3ZQ7A 3QODA 1U78A 4B8XA 3EQLF 1A6IA 5FB2A 1H89C 4FE7A 1QZYA 4E7SA 3WTXC 2PMUA 2R5YA 1Z6TA 3V8JA 2KJBA 2VJ5A 5JLWA 1GVJA 2XRLA 3K4KA 3KX2A 3GTOJ 1GV5A 3KLNA 5FLVA 2M7BA 2VBYA 1RI7A 2F4OB 4M3GA 3J7AO 5C4XJ 4FE4A 3HRSA 1TP4A 2O6GE 4RLQA 4MIMA 5FKMA 4QTRA 1FOWA 3RTRA 4BAYA 3L09A 4BUPA 5ICEA 3SJMA 2IJLA 3OSGA 2MG4A 2M2EA 3GFLA 2R7OA 4AC0A 1BR2A 4UUVA 3B6CA 2EK5A 4I99C 1HKTA 1LE8B 2WA0A 1FIPA 2K3PA 1V55H 3CCUI 3OYMA 3EDPA 3COAC 1I6XA 3AG1H 3FXOA 4HQMA 3SZTA 4PSWA 3G4SI 2XSJC 1XMAA 3FMRA 4D7MA 4IHYA 1XB4A 2OBPA 3DFGA 3HOWJ 2HTJA 4D9JA 3J7ZI 2Y0MA 3U1DA 2GAUA 2XKPA 1ETXA 3H1CA 4XL9A 2XC7A 3JRDA 4ZTJA 1VQ5I 2IT0A 1ONVA 3GTPJ 1W5SA 2R7VA 2K9NA 5B1BH 4XKCA 4F55A 2L4AA 3CMMA 4CO8A 4ZZLA 1B6AA 4RAFA 1K6OA 1Y1VJ 1X1AA 4CZCA 1VQ6I 3PQKA 2A05A 1MW7A 3VEPA 1IXCA 1BL0A 4YFNF 3J80Z 1VQPI 2PI0A 4AWXB 2QQAA 3F21A 3ONQA 4JP0A 1UHMA 4Y7NJ 5ICGA 4PFOA 3KYLA 4DBRA 1HXDA 1BIBA 1K4TA 2O8KA 2ISZA 3E1SA 1Y0NA 4HPQA 3C2BA 2VN2A 1JUPA 2WAFA 3IAS2 2QLZA 1T98A 1MSEC 2BVLA 2RN7A 1E0EA 2Z2SB 1JT6A 4MEXF 1W1WE 1WJAA 3H3UA 1U5TB 1X1CA 2Z3YA 4BYYA 2FXAA 2ZBKA 1QZEA 1FEXA 1F43A 2OAZA 4KT6A 4X6AJ 2NVQJ 2TRTA 2L7KA 3S1NJ 1OQYA 3E6DA 2CS3A 2FU4A 1AHDP 2NNNA 4XKVA 1IGNA 2WY8Q 3C18A 1W4MA 2VKDA 3ELKA 2PMZN 4BDYA 5AONA 2JVGA 1FYMA 2VLAA 2WADA 5HS7A 2ZXHA 1FOXA 3HUGB 2JA8J 4M9SA 1UG2A 1YX5A 4M6VA 2KDOA 3OYCA 2R5ZA 4W97A 2O7OA 2Z33A 1UZCA 3TP3A 4ITVA 2HOSA 2XAFA 4UB6C 3JRGA 1YIJI 1LFUP 4ZDOA 4JX5A 1G3YA 1T2KA 5K7FA 4AYBA 3RKWA 4RBOA 4LD5A 2P6SA 2HI3A 2VT3A 3F3XA 2QQ9A 1QNTA 1T0FC 2A61A 2HQ5A 2IP2A 4IEJA 5FRNA 4IRHA 3TW6A 2MC3A 4DNCA 3CTAA 2V9PA 3FXKA 5EEAA 1PDNC 2PLYA 4ZH4F 3BR6A 1MH3A 2KFDA 3CCJI 4WWCA 3DKXA 3CESA 1S8NA 2VOOA 2R7ZJ 4BY7J 3ECOA 2LY2A 3S2DJ 5FKNA 1K78B 1F9NA 4KN7X 1AU7A 3JRCA 4CGZA 3R4KA 3S1MJ 4AIJA 3GTJJ 4I02A 2HGCA 1HW5A 4K2EA 1WFXA 1BW6A 2DYRH 2E36A 3AG4H 3M8EA 2IS4A 1Z67A 3OOUA 2EZIA 5JI6A 4E7HA 4XRSA 2IW5A 2DA2A 3I59A 4G6QA 3FZVA 1U9NA 1ZGWA 2STWA 1X3ZB 2K86A 3KZIC 2E71A 4CDGA 4X1EA 3G6EI 5J6XA 1VQMI 3CCVI 2Y2ZA 3OL4A 3ASOH 2OZ6A 3F23A 3HRMA 2COMA 3S32A 3JW4A 2KIMA 3K4NA 1D0XA 1RKWA 3VSKA 1JGGA 2L54A 3O8HA 1OCTC 2KIFA 1HCRA 3OIPA 1EA3A 2R7RA 2JWTA 2H8WA 4B44A 3FM3A 4OINF 1B72A 5ILUA 1HW2A 1G4DA 3M3YJ 3KCCA 4BBRJ 3LSJA 2OPTA 4A12A 1IW7F 2P6TA 3S3NA 4CCOA 4L9VA 1FMWA 2R7QA 3HB9A 2XSDC 2OTJI 1JUSA 3HSEA 3Q0WA 5F08A 2CUZA 3WTTC 3D1NI 1ERDA 2RGVA 1WVRA 2L4MA 2E1MC 3H92A 3LAPA 3LAJA 3CO7C 3AFHA 1Y0UA 3H9QA 2ZSIB 2HPIA 5FLMJ 2VI6A 1Z7UA 1MMGA 2H1LA 1I27A 1USSA 5FKOA 5HDNA 2Q2EB 3PSIA 3ULQB 3FDYA 1ZLKA 2AO9A 4HNVA 3EUKL 4I0AA 3RYPA 1KYZA 1SD7A 2ICWG 1O3RA 3TOAA 3MKZA 5BPIA 3HOSA 1K79A 1SAXA 2DLLA 2EIMH 4HX7A 5KCMA 3HPHA 3A02A 2XAQA 4GCVA 4KT5C 1APLC 2STTA 2E5ZA 2X6XA 3ABLH 3DTIA 1J75A 4MTEA 2DDBA 4PSXA 2QQBA 5HNFA 2E2HJ 1PUEE 3OYBA 2KL4A 2HYGD 1H88C 2V1NA 1CGPA 3DCFA 1X3UA 2AXTC 4YELA 1MSFC 2E60A 1ZR4A 1HSTA 5KHDA 3CQZJ 4JK1X 2HVRA 1Z05A 4NQWB 4BNCA 4Y13A 2LOOA 2QENA 2EQRA 2RAEA 4CCLA 1ZRFA 1OJLA 1P4AA 2ADUA 3S2HJ 3LSMA 1FY7A 1IN7A 1YOVB 4PUSA 3OS2A 2EIKH 2ZJQF 2FMYA 4BHCA 2K9MA 1B8IA 2AHQA 2VXDA 4R1HA 5GAEJ 1Y1WJ 4P9UA 1MBHA 1ZHFA 4D1QA 3SZPA 1IC8A 4WXCA 3HBLA 3CMAI 2R92J 1O7FA 4MLOA 1YS7A 4E7LA 1TZLA 1JTXA 4IHSA 1H8AC 2GOXB 2O03A 4BDZA 3CCEI 5IT3A 1ZYRF 2RNJA 4GO1A 1J2XA 2JA2A 5CPRB 3JTGA 1IRXA 3DF8A 4ESFA 3FBIB 4UUSB 3PUBA 1R9TJ 4IQ4A 3AL0B 4C2UA 4KDPA 2FMLA 4KN4X 1DU0A 1E17A 1PUFA 4ETSA 2Y0SA 2YS9A 1YJ9I 1WJBA 3FX3A 2WTEA 3LA2A 3I58A 3OIOA 4RB3C 3FKIJ 3ZQFA 1W5TA 3OL3A 2FNAA 3GUDA 4ENKA 1B9MA 2EZKA 2XAGA 1A6QA 3RKQA 3ZOBA 4DIQA 1SMTA 5A2QK 2DMPA 1MJBA 4BJ5C 3ESWB 2Z99A 4MNUA 3GTKJ 2CW0F 3VODA 2MC4A 1KQ9A 4XMYA 3LFUA 4LIVA 5E79C 3ZN0A 4D0PA 3E97A 3TMOA 1TT5B 3B6AA 2MSYA 4NC6A 2CQQA 2ZMEB 3IHUA 5EZHA 3WTZA 4IOAF 1S6LA 2XAHA 4HV5A 3VYRB 3SDGA 5J47A 1T0FA 2UXNA 3KYDB 1H9TA 5JFRA 1SD4A 2Z9OA 1BOAA 1NHAA 2P5LC 4ESBA 2DFFA 4XRFA 4B3AA 1LEBA 1TQPA 1SC7A 1QVTA 2ID6A 1OFCX 3BOQA 3NWSA 3HOZJ 4MO7A 1Y39A 1FWZA 2Y75A 4BQAA 1SFOJ 5LHHA 4AIHA 5E3LA 3ZRGA 3PO2J 5EEHA 2HVQA 4EGYA 1VQ4I 2AQFA 5D8LB 3L2WA 5A2QZ 1ZG1A 2A5WA 3GCMA 1P7JA 1OYWA 4KISA 3KEOA 4X0GA 1RNLA 4LG0B 5FO5A 1QA6A 3GZ5A 4UV9A 4ABZA 1JGSA 3CUQA 1FOKA 2P0WA 2CYYA 2ZO4A 3IRRA 1IXRC 1R36A 2ESHA 2X6YA 3BTCA 3N4MA 2W57A 4M9ZA 5JVTA 4L9JA 4XONA 3KP3A 2JSCA 3D5RC 2P8TA 4R8HA 3Q9VA 5HLHA 3SYTA 3OIQA 2VIXA 4UHTA 1YW8A 1EH7A 2NS7A 2L3DA 3DQVC 3G73A 4GXOA 2FBKA 2LK2A 4XLFA 1WH7A 4JX6A 1D0YA 2BGCA 2GZWA 3I71A 3KYCB 3GFMA 3L00A 5TGTA 4Z6YA 4GDFA 2LH9A 2XPWA 1U6GA 2KQRA 4GGGA 3JR9A 3BPXA 1GXPA 3ZN1A 1B59A 3BCAA 1JUMA 4A3JJ 2DOFA 2L9VA 3K4CA 5EGOB 1XGNA 1TWHJ 3CCLI 3HXLA 4J00A 1R23A 4ZYAA 2EZHA 5K5QA 3H3VK 3FM5A 4D7NA 3A0BC 4XKWA 4EJWA 5F1JA 2R7WA 4BE1A 2HPMA 2AXLA 1V54H 2IXSA 2VKHA 3R0AA 4A5NA 4XRSG 1MBEA 5K5RA 1O57A 1ZQ3P 2K27A 4A5MA 2LKXA 3R6SA 4I2OA 5FROA 3FKJA 5BQTA 1C0WA 3OYAA 2PJRB 3HHGA 1S29A 1H0MA 5D5UB 4G8XA 4LLNA 3BR1A 4FQGA 4BBSJ 3S8PA 1YTYA 1IRGA 4PJLA 1I3AA 4A3EJ 4LITA 4A0ZA
chains in the Genus database with same CATH topology
4ENNA 2BEOA 4GYGA 3SQNA 5E1WA 3T1BA 4ON0A 1G3SA 1FBQA 5L3BA 4TV7A 2M1BA 2O3FA 3K1MA 3S2WA 4HZFA 3WTVC 2DBBA 1TLHB 1IN6A 3V7RA 2E7XA 2V9VA 3G3ZA 5HOOA 1JHFA 3DPTA 3CLOA 2EFWA 4RGXA 3SFZA 2L01A 1CF7B 2VE9A 2CWEA 2K02A 5D4SA 3V8KA 1B1BA 4BH9A 5L3GA 1FBUA 3EETA 4RB1A 1FYLA 3K1PA 1FSHA 2M45A 5DUKA 2W84A 1XSDA 4L18B 1XDUA 1YYVA 4N9IA 2F2EA 2MLKA 2VODA 1ODDA 3GLXA 4OMZA 3ROUA 3F8FA 3MEXA 1SFEA 2V1DA 3U2RA 2LDUA 2CG4A 5CLSA 3L7WA 4I98B 4BHBA 1FP2A 1P4XA 4OMYA 3BZ6A 1KGSA 1OYIA 1A04A 3TDUC 2HTSA 1D5VA 3P7NA 2KRFA 2W24A 3ZMSA 3QU6A 4G7ZF 4RAZA 4H0EA 2MBFA 2YPRA 2Y48A 1SD5A 3Q9SA 1LDDA 4I01A 5JR3A 1BC7C 4S05A 4KA4A 1REPC 5BPDA 3TO9A 5LRRA 2R7FA 2DAOA 4HW0A 1ZGAA 4LLGF 4DQ2A 3MCZA 3IWZA 5LBQA 2F5FA 3P9CA 3C7JA 1LDJA 4F7ZA 3LA3A 4MEYF 3WTUC 3FXQA 5E20A 2LSOA 2JTVA 2JPBA 1R7JA 2KJCA 1K7AA 1L0OC 1EV7A 1HW1A 3E6CC 2VOPA 3J80K 1U3EM 4AVPA 2F5DA 1IUYA 4UVBA 1FP1D 2IVMA 2HEOA 5DCMA 2DU9A 2ESNA 1LVAA 1BI0A 2FBHA 4CZZA 2NS0A 4WCGA 1W7PA 3WE2A 1ZARA 3ISPA 2HDCA 2G7HA 1AOYA 1OR7A 4ZYDA 1USTA 4P55A 1OKRA 1GHCA 3JTHA 1O3QA 2GWRA 3IRQA 2XHKA 5CVVA 5KVRA 4WXHA 4YG2F 4HQEA 3KP6A 5E1XA 1DP7P 2DK8A 5D5WB 5ICCA 5D6EA 1LQ1A 2GXGA 1O3SA 5D6FA 4Y17A 1QGPA 1FX7A 2GQQA 1KU9A 4EM2A 5CVUA 4IHTA 2FF4A 1TNSA 1TQIA 1KU3A 2XVCA 4LK1F 2JRTA 1UFMA 4IXAA 3LQQA 5D5VB 4I0BA 2ELHA 1G3WA 3ERED 1XD7A 3RJPA 4U7BA 3R61A 4KIBA 3LQRA 1PP8F 1UB9A 5LHGA 3RIRA 2ZKZA 3ZP5A 2FNPA 1I5ZA 4FX4A 4P96A 4UV8A 3REOA 2HZTA 5CVJA 3GYHX 1VTNC 3KP5A 2JPCA 3GZ6A 1P92A 1LNWA 3I5UA 2FSWA 2V6CA 4UVAA 5HLGA 3E5UA 3WE3A 1BC8C 4O6JA 5DDGA 1Z9CA 3CUQC 1U8RA 5L3DA 3NQOA 4ASNA 4IF4A 2Z5UA 3FMQA 4WX9A 2WWYA 5LGTA 2W85A 3QP6A 2OQRA 1MDMB 1I1GA 4XLPF 1ZN2A 3LFKA 2YR2A 4HF2A 3V7CA 1Q1HA 3DV8A 1IN5A 4P5OA 4Y15A 1BBYA 2WV0A 4XSXF 4UXNA 4LFUA 4HX4A 5BOXA 1KQ8A 1B4AA 3T8RA 4B09A 4QWQA 4G94A 2CO5A 4E70A 1YFHA 4KIFA 1MGTA 3GO5A 2KKOA 4XLNF 2K4BA 2H6CA 1S7AA 1FT9A 1U5TA 3H3ZA 1BIAA 4YFKF 1O7LA 4A6EA 5E18F 4RB2C 4L0ZB 3GX4X 1D8JA 2HQNA 5H6QA 3QRFF 1QO0D 1R5GA 1ON1A 2PG4A 3MQ0A 1G6NA 2EV0A 2O0YA 4N0BA 2K4JA 5HS8A 1T38A 2AS5F 4LLLA 4IVNA 4HDVA 4M6XA 2B0LA 2VT2A 1YW7A 2ZNYA 4R79A 4EM1A 5JHUA 2DFIA 5IT9K 3FHZA 2FEZA 2O61A 1W7PD 3T0YA 4RB0A 1K78A 1I1SA 1HBXG 3RPQA 5L3EA 3WU0A 2DK5A 4OU0A 4PCQA 3N97A 3NEUA 3FXRA 4HLXA 4EJTA 3F22A 2PBIA 2K7LA 5ILSA 4ENJA 2FA5A 1QZZA 1R1VA 2XRNA 5IT9Z 4WF2A 1J9IA 1HKQA 2FOKA 5ICFA 5HLIA 2VXZA 4BHPA 4L5JA 1KU7A 1HQCA 3O2PE 3NRVA 5K5OA 1WI9A 4G6DA 1F1ZA 1KU2A 1QPMA 2GA1A 2HFHA 4G7OF 4ESJA 2A5YB 2EFPA 1R58A 2Q2EA 2PQ8A 5BMZA 4U88A 1UHWA 1TQMA 3F8MA 1E2XA 2W25A 3GXOA 2QBYB 1XCVA 3F6VA 4YFXF 1YG2A 2MD5A 5BS6A 4EGZA 1TW2A 4Z2YA 4A2UA 1AWCA 4NQWA 4PZJA 3WODF 3KP4A 5D5XB 1OMIA 4HYEA 2XIGA 3O6BB 3ML6A 2R3SA 3F8BA 4PGHA 3U9GA 4RGUA 2RQPA 3BJ6A 2A6HF 3WTYC 2H94A 1TTYA 2PMHA 2GA2A 3JAMZ 1DPRA 4U0WA 3WTWC 5FD6A 5E1ZB 3R60A 1J0RA 2DPUA 4EJUA 2P5VA 5E17F 2E1NA 5EEGA 4ZYHA 4PDKA 4WK8F 3FXUA 2YSRA 1J7KA 2D1VA 2VC0A 2EB7A 3FWEA 3AAFA 4LJZF 5LEJA 2A68F 1TNTA 1BI1A 5HDKA 3RPUA 2ZNZA 3HSRA 4U0VA 2A07F 3E5XA 2ZMEA 3HIFA 4CICA 5ILVA 5DD8A 5HVQC 2MA3A 1BM9A 3RYRA 3GVAA 1FPQA 4KIGA 3TQNA 2CQKA 3IKVA 3I53A 1XGMA 2CGPA 3KE2A 5TRDA 3OV8A 3DPLC 4LG0A 2HKXA 3RI4A 3LSTA 3OOPA 4HX8A 2EV5A 3IC7A 3WGHA 3QAHA 3KETA 3I4PA 1W7PB 1WSUA 2HS5A 5HS9A 4HBLA 1ZGJA 4HAMA 2R7DA 3HOTA 4MHGA 1P6RA 1R1UA 2D1HA 5LLQA 2VONA 1F5TA 2J5OA 4Q47A 5L3CA 4LB5A 4EMSA 1EH8A 4M74A 1P2FA 4L0YB 1WRJA 4IJAA 2M8EA 4HLYA 2ACJA 3HYIA 2OA4A 1P4WA 3HTSB 5E8GA 5TJJA 3ECHA 1B9NA 3EYYA 5DV5A 2WC2A 3I54A 5H20A 2RKHA 1BJAA 2RV8A 1JXSA 6PAXA 4L9NA 3P9KA 2QVOA 1ON2A 3V4GA 1XMKA 3BY6A 4O3MA 1U5TC 4P9FA 3TO7A 1BI2A 4RGRA 2EFNA 4AD9A 4A6DA 3F6OA 3MZYA 5K1YA 2DI3A 1XN7A 2EWNA 2UWMA 1IN4A 4HOBA 1Z1DA 1CF7A 2XGXA 2ZXJA 4N9HA 3LWFA 4M6YA 3VOEA 5J8FA 2H6BA 2OD5A 4MQ9F 2OU2A 2YX7A 4IRIA 3DP7A 5DEQA 1XSVA 2E1CA 3VB2A 1ZG5A 1U2WA 4KFCA 1ZLJA 1J59A 3WGIA 4Q48A 3R0JA 4YIIA 5AIPA 3I59B 5ED4A 2ZJ2A 2FE3A 2Q0OA 1L3LA 3IWFA 5L3FA 4ENMA 2GIVA 3K9TA 3SXYA 1IZ1A 4YIFA 3KP2A 1SFUA 4IRGA 1XDSA 4AIKA 4M71A 1FZPB 2UZKA 4M9XA 4A0XA 2UXXA 1RZ4A 4RGSA 1HKSA 1QBJA 2PJPA 2XAJA 1YS6A 2DQLA 4WXDA 3VFZA 5D4RA 4JBAA 2CFXA 2YX4A 4I09A 3KLOA 1QQIA 3CO6C 4EVIA 4LB6B 1FC3A 4HV6A 1HSJA 1BI3A 2H09A 2OZUA 2H27A 3E6BA 1D3YA 1JE8A 2EV6A 1H9GA 5CVIA 3TDZC 3ZMDA 3WGGA 3CJNA 1FLIA 2D2WA 3ZMVA 3PFIA 2VBXA 4CXFA 2ISYA 4KMUX 1J5YA 3T8TA 5DUIA 2F5EA 2JZYA 3QOPA 2OQGA 3M7GA 1XSXA 1IF1A 2TDXA 4G7HF 1R5HA 3GFIA 4OIRF 2HKOA 3L9FA 4RAYA 2P7VB 3ZPLA 5DD4A 2FBIA 2IPQX 1T39A 2PEXA 1OPCA 1ULYA 3V7SA 3C1DA 3HRUA 2EFOA 2EA2A 2NNYA 4L5IA 3KEQA 3BP8A 3GF2A 3DKWA 2YU3A 2C6YA 3M1EA 1YW9A 1TW3A 1G3TA 4M72A 2DQRA 2MH9A 3ABUA 4M73A 1SD6A 3E5QA 1KYWA 2LKPA 4OIQF 5DCFA 5HDGA 2D45A 4U7DA 3W6KB 2NAZA 2GXBA 4O5VA 3IL2A 2V1XA 3I0TA 2P7CB 2M87A 3HRTA 1S7OA 3HUGA 5CYVA 2IA2A 2KIUA 1DPUA 1UCRA 2VC1A 2QWWA 3ZMTA 3HTUA 3E6MA 3RDIA 1STZA 3KZYA 4UNOA 1SFXA 4ZZDA 3K0LA 2FRHA 4ZYGA 1S3JA 3BROA 4XSZF 2XKOA 3CUQB 5D8KB 4LMYA 3QPHA 1FBSA 2DPDA 2BYVE 2M5WA 4IPAA 5FD5A 2QZ8A 3WG9A 3BJAA 2ZCWA 3SHFA 1RIOH 1MJ9A 4I7HA 3GFJA 5DYMA 5LHIA 2IRFG 1DDNA 2HWVA 3I64A 2O8XA 3F72A 4EJOA 3D5LA 4LGWA 2QYOA 2RVCA 5LGNA 3K2ZA 1V3FA 3KP7A 3MZHA 2E7WA 3KZZA 3BWGA 1R00A 3D0SA 4EJVA 1MZBA 3WU1B 2ETHA 3L2CA 3MAJA 2XV4S 1MDMA 1OYYA 4UVCA 2BE5F 3GW2A 5CJ9A 1ZRDA 1LJ9A 3GWZA 1ZG3A 2RC4A 4G9YA 5FFZA 2DO7A 3BPVA 3Q5FA 1MJAA 2HR3A 3CDHA 4FHTA 1FNNA 2X4HA 3DEUA 1ZREA 1WKMA 4U0YA 1ZH5A 5LEKA 3WTSC 1YIOA 3ZMZA 2VBWA 3KFWX 1FSEA 4L9TA 3QU3A 1ZAOA 4KNYA 4GYIA 2HQRA 2P5KA 2EFQA 2DT5A 3QPTA 1LDKB 3CUOA 3ABTA 3F8CA 3P9IA 3RKYA 4Q4ZF 4OIPF 2J5PA 1FYKA 2QM3A 5FGMA 1LEAA 2G9WA 4LK0F 3TKYA 2VE8A 3TO6A 3JAMK 1XGOA 5FLXK 2BBYA 5CVRA 3JSPA 2XROA 1R22A 3C3WA 2PN6A 1R1TA 2HYFA 4S04A 4NHJA 3F8NA 4EM0B 3PQJA 2PFBA 4KMFA 3GEZA 2A69F 3DXJF 1KQ0A 3ZMUA 3M9AA 3E3VA 1RUOA 3RKXA 4QLCU 1XGSA 1O3TA 5FLXZ 2EA4A 1YQAA 2A3SA 2X0LA 1BN5A 2P4WA 3LA7A 3K69A 3V8LA 4HA8A 4Q5SF 5J8CA 2Q8KA 5E8IA 3M8FA 2V79A 2LF7A 5ERIA 3HSFA 5F1RA 1IN8A 2JT1A 2XASA 5F64A 2NRAC 3JSOA 2M30A 4RS8A 4NB5A 3EYIA 4A0YA 3QP5A 4CHUA 4XBFA 4BXUA 3EUHA 1ZRCA 3MWMA 4MQVA 2MLGA 5LGUA 2MH2A 1XCBA 4KUMA 5LRSA 5H6RA 5F6FA 1SMYF 1Z6RA 1V4RA 4HDUA 3T5XA 2QBYA 3B73A 1YLFA 1F4KA 5DCMB 3HHHA 1Z91A 2VBZA 3TGNA 4OIOF 3MFKA 4EV0A 2CSOA 1GXQA 4MGRA 1JHHA 2LNBA 4EQQA 1PP7U 4HF1A 2L02A 3B02A 2LF8A 5KK1A 1IAWA 1WQ2A 5AIQA 1KA8A 3BJOA 2A6EF 2QUFA 2IA1A 1DUXC 3J81K 2NYXA 3FF5A 2IA0A 4FX0A 1IRFA 1MD0A 1TBXA 2BV6A 5FFXA 2XUBA 2DW4A 1T6SA 4FT8A 3W6JB 4KYWA 4KICA 4PGGA 4OOIA 2RDPA 4CYDA 4HF0A 3O3KA 2EJRA 2FQ3A 2V1UA 1LB2A 3BDDA 3IKTA 3TOBA 3J81Z 1MKMA 1D8KA 1RUNA 2ZFWA 1WWXA 2HOEA 4ZYEA 1EH6A 1YO5C 4MTDA 4JQFA 2DTRA 2G7UA 2F5CA 3FMSA 3K1NA 1IXSB 3ZQ7A 1U78A 4B8XA 3EQLF 5FB2A 1QZYA 3WTXC 2PMUA 1Z6TA 3V8JA 2KJBA 1GVJA 3KLNA 2VBYA 1RI7A 3J7AO 3HRSA 2O6GE 4BAYA 3RTRA 3L09A 5ICEA 2IJLA 3GFLA 4UUVA 2EK5A 1HKTA 3EDPA 3COAC 1I6XA 4HQMA 3SZTA 3FMRA 1XMAA 1XB4A 2OBPA 3DFGA 2HTJA 2Y0MA 3U1DA 2GAUA 2XKPA 2IT0A 1ONVA 1W5SA 2L4AA 4CO8A 4ZZLA 1B6AA 1K6OA 3PQKA 3VEPA 1IXCA 4YFNF 3J80Z 2PI0A 4AWXB 2QQAA 3F21A 1UHMA 5ICGA 1HXDA 1BIBA 2ISZA 2VN2A 2QLZA 1T98A 2RN7A 4MEXF 3H3UA 1U5TB 2Z3YA 4BYYA 2FXAA 2ZBKA 2OAZA 3E6DA 2FU4A 2NNNA 3C18A 1W4MA 3ELKA 5AONA 1FYMA 5HS7A 4M9SA 2Z33A 2XAFA 1G3YA 1T2KA 3RKWA 4LD5A 2P6SA 2VT3A 3F3XA 2QQ9A 1QNTA 2A61A 2IP2A 4IRHA 2MC3A 4DNCA 3CTAA 1PDNC 2PLYA 4ZH4F 4WWCA 1S8NA 2VOOA 3ECOA 1K78B 1F9NA 4KN7X 4CGZA 3R4KA 4AIJA 4I02A 2HGCA 1HW5A 4K2EA 3M8EA 5JI6A 2IW5A 3I59A 4G6QA 3FZVA 2STWA 2K86A 4CDGA 5J6XA 2OZ6A 3F23A 3HRMA 2COMA 3JW4A 2KIMA 2L54A 2KIFA 3FM3A 4OINF 5ILUA 1HW2A 1G4DA 3KCCA 4A12A 1IW7F 2P6TA 4L9VA 3HSEA 3WTTC 2RGVA 2L4MA 3H92A 3LAPA 3LAJA 3CO7C 1Y0UA 1Z7UA 1I27A 1USSA 5HDNA 3ULQB 1ZLKA 3RYPA 4I0AA 1KYZA 1SD7A 1O3RA 3TOAA 5BPIA 3HOSA 1K79A 1SAXA 2DLLA 4HX7A 2XAQA 4GCVA 4KT5C 2STTA 1J75A 4MTEA 2QQBA 1PUEE 2HYGD 1CGPA 1X3UA 1HSTA 4JK1X 1Z05A 4BNCA 4Y13A 2QENA 1ZRFA 1P4AA 2ADUA 1FY7A 1IN7A 2FMYA 4BHCA 4R1HA 4P9UA 1ZHFA 3SZPA 4WXCA 1O7FA 1YS7A 4IHSA 2O03A 5IT3A 1ZYRF 2RNJA 4GO1A 1J2XA 3JTGA 3DF8A 4ESFA 4KDPA 2FMLA 4KN4X 1E17A 4ETSA 3FX3A 2WTEA 3LA2A 3I58A 4RB3C 1W5TA 2FNAA 3GUDA 4ENKA 1B9MA 2XAGA 1SMTA 5A2QK 1MJBA 2Z99A 4MNUA 2CW0F 3VODA 1KQ9A 3ZN0A 4D0PA 3E97A 2ZMEB 3IHUA 3WTZA 1S6LA 2XAHA 4HV5A 1T0FA 2UXNA 1H9TA 5JFRA 1SD4A 2Z9OA 1BOAA 1NHAA 2P5LC 4ESBA 4XRFA 1LEBA 1TQPA 3BOQA 1FWZA 2Y75A 4BQAA 5LHHA 4AIHA 5EEHA 4EGYA 5D8LB 5A2QZ 1ZG1A 1OYWA 3KEOA 1RNLA 4LG0B 5FO5A 3GZ5A 4UV9A 1JGSA 3CUQA 1FOKA 2CYYA 2ZO4A 3IRRA 1IXRC 1R36A 2ESHA 3N4MA 2W57A 4M9ZA 5JVTA 4L9JA 3KP3A 2JSCA 2P8TA 4R8HA 3Q9VA 5HLHA 4UHTA 1YW8A 1EH7A 2L3DA 3DQVC 3G73A 4GXOA 2FBKA 2BGCA 3I71A 2GZWA 3GFMA 3L00A 1U6GA 4GGGA 3BPXA 1GXPA 3ZN1A 1B59A 1XGNA 1R23A 5K5QA 3FM5A 4EJWA 2AXLA 3R0AA 4A5NA 5K5RA 1O57A 2K27A 4A5MA 3R6SA 4I2OA 5BQTA 1C0WA 3HHGA 1S29A 1H0MA 5D5UB 4G8XA 4LLNA 1YTYA 1IRGA 4A0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENN A;  2BEO A;  4GYG A;  3SQN A;  5E1W A;  3T1B A;  4ON0 A;  1G3S A;  1FBQ A;  5L3B A;  4TV7 A;  2M1B A;  2O3F A;  3K1M A;  3S2W A;  4HZF A;  3WTV C;  2DBB A;  1TLH B;  1IN6 A;  3V7R A;  2E7X A;  2V9V A;  3G3Z A;  5HOO A;  1JHF A;  3DPT A;  3CLO A;  2EFW A;  4RGX A;  3SFZ A;  2L01 A;  1CF7 B;  2VE9 A;  2CWE A;  2K02 A;  5D4S A;  3V8K A;  1B1B A;  4BH9 A;  5L3G A;  1FBU A;  3EET A;  4RB1 A;  1FYL A;  3K1P A;  1FSH A;  2M45 A;  5DUK A;  2W84 A;  1XSD A;  4L18 B;  1XDU A;  1YYV A;  4N9I A;  2F2E A;  2MLK A;  2VOD A;  1ODD A;  3GLX A;  4OMZ A;  3ROU A;  3F8F A;  3MEX A;  1SFE A;  2V1D A;  3U2R A;  2LDU A;  2CG4 A;  5CLS A;  3L7W A;  4I98 B;  4BHB A;  1FP2 A;  1P4X A;  4OMY A;  3BZ6 A;  1KGS A;  1OYI A;  1A04 A;  3TDU C;  2HTS A;  1D5V A;  3P7N A;  2KRF A;  2W24 A;  3ZMS A;  3QU6 A;  4G7Z F;  4RAZ A;  4H0E A;  2MBF A;  2YPR A;  2Y48 A;  1SD5 A;  3Q9S A;  1LDD A;  4I01 A;  5JR3 A;  1BC7 C;  4S05 A;  4KA4 A;  1REP C;  5BPD A;  3TO9 A;  5LRR A;  2R7F A;  2DAO A;  4HW0 A;  1ZGA A;  4LLG F;  4DQ2 A;  3MCZ A;  3IWZ A;  5LBQ A;  2F5F A;  3P9C A;  3C7J A;  1LDJ A;  4F7Z A;  3LA3 A;  4MEY F;  3WTU C;  3FXQ A;  5E20 A;  2LSO A;  2JTV A;  2JPB A;  1R7J A;  2KJC A;  1K7A A;  1L0O C;  1EV7 A;  1HW1 A;  3E6C C;  2VOP A;  3J80 K;  1U3E M;  4AVP A;  2F5D A;  1IUY A;  4UVB A;  1FP1 D;  2IVM A;  2HEO A;  5DCM A;  2DU9 A;  2ESN A;  1LVA A;  1BI0 A;  2FBH A;  4CZZ A;  2NS0 A;  4WCG A;  1W7P A;  3WE2 A;  1ZAR A;  3ISP A;  2HDC A;  2G7H A;  1AOY A;  1OR7 A;  4ZYD A;  1UST A;  4P55 A;  1OKR A;  1GHC A;  3JTH A;  1O3Q A;  2GWR A;  3IRQ A;  2XHK A;  5CVV A;  5KVR A;  4WXH A;  4YG2 F;  4HQE A;  3KP6 A;  5E1X A;  1DP7 P;  2DK8 A;  5D5W B;  5ICC A;  5D6E A;  1LQ1 A;  2GXG A;  1O3S A;  5D6F A;  4Y17 A;  1QGP A;  1FX7 A;  2GQQ A;  1KU9 A;  4EM2 A;  5CVU A;  4IHT A;  2FF4 A;  1TNS A;  1TQI A;  1KU3 A;  2XVC A;  4LK1 F;  2JRT A;  1UFM A;  4IXA A;  3LQQ A;  5D5V B;  4I0B A;  2ELH A;  1G3W A;  3ERE D;  1XD7 A;  3RJP A;  4U7B A;  3R61 A;  4KIB A;  3LQR A;  1PP8 F;  1UB9 A;  5LHG A;  3RIR A;  2ZKZ A;  3ZP5 A;  2FNP A;  1I5Z A;  4FX4 A;  4P96 A;  4UV8 A;  3REO A;  2HZT A;  5CVJ A;  3GYH X;  1VTN C;  3KP5 A;  2JPC A;  3GZ6 A;  1P92 A;  1LNW A;  3I5U A;  2FSW A;  2V6C A;  4UVA A;  5HLG A;  3E5U A;  3WE3 A;  1BC8 C;  4O6J A;  5DDG A;  1Z9C A;  3CUQ C;  1U8R A;  5L3D A;  3NQO A;  4ASN A;  4IF4 A;  2Z5U A;  3FMQ A;  4WX9 A;  2WWY A;  5LGT A;  2W85 A;  3QP6 A;  2OQR A;  1MDM B;  1I1G A;  4XLP F;  1ZN2 A;  3LFK A;  2YR2 A;  4HF2 A;  3V7C A;  1Q1H A;  3DV8 A;  1IN5 A;  4P5O A;  4Y15 A;  1BBY A;  2WV0 A;  4XSX F;  4UXN A;  4LFU A;  4HX4 A;  5BOX A;  1KQ8 A;  1B4A A;  3T8R A;  4B09 A;  4QWQ A;  4G94 A;  2CO5 A;  4E70 A;  1YFH A;  4KIF A;  1MGT A;  3GO5 A;  2KKO A;  4XLN F;  2K4B A;  2H6C A;  1S7A A;  1FT9 A;  1U5T A;  3H3Z A;  1BIA A;  4YFK F;  1O7L A;  4A6E A;  5E18 F;  4RB2 C;  4L0Z B;  3GX4 X;  1D8J A;  2HQN A;  5H6Q A;  3QRF F;  1QO0 D;  1R5G A;  1ON1 A;  2PG4 A;  3MQ0 A;  1G6N A;  2EV0 A;  2O0Y A;  4N0B A;  2K4J A;  5HS8 A;  1T38 A;  2AS5 F;  4LLL A;  4IVN A;  4HDV A;  4M6X A;  2B0L A;  2VT2 A;  1YW7 A;  2ZNY A;  4R79 A;  4EM1 A;  5JHU A;  2DFI A;  5IT9 K;  3FHZ A;  2FEZ A;  2O61 A;  1W7P D;  3T0Y A;  4RB0 A;  1K78 A;  1I1S A;  1HBX G;  3RPQ A;  5L3E A;  3WU0 A;  2DK5 A;  4OU0 A;  4PCQ A;  3N97 A;  3NEU A;  3FXR A;  4HLX A;  4EJT A;  3F22 A;  2PBI A;  2K7L A;  5ILS A;  4ENJ A;  2FA5 A;  1QZZ A;  1R1V A;  2XRN A;  5IT9 Z;  4WF2 A;  1J9I A;  1HKQ A;  2FOK A;  5ICF A;  5HLI A;  2VXZ A;  4BHP A;  4L5J A;  1KU7 A;  1HQC A;  3O2P E;  3NRV A;  5K5O A;  1WI9 A;  4G6D A;  1F1Z A;  1KU2 A;  1QPM A;  2GA1 A;  2HFH A;  4G7O F;  4ESJ A;  2A5Y B;  2EFP A;  1R58 A;  2Q2E A;  2PQ8 A;  5BMZ A;  4U88 A;  1UHW A;  1TQM A;  3F8M A;  1E2X A;  2W25 A;  3GXO A;  2QBY B;  1XCV A;  3F6V A;  4YFX F;  1YG2 A;  2MD5 A;  5BS6 A;  4EGZ A;  1TW2 A;  4Z2Y A;  4A2U A;  1AWC A;  4NQW A;  4PZJ A;  3WOD F;  3KP4 A;  5D5X B;  1OMI A;  4HYE A;  2XIG A;  3O6B B;  3ML6 A;  2R3S A;  3F8B A;  4PGH A;  3U9G A;  4RGU A;  2RQP A;  3BJ6 A;  2A6H F;  3WTY C;  2H94 A;  1TTY A;  2PMH A;  2GA2 A;  3JAM Z;  1DPR A;  4U0W A;  3WTW C;  5FD6 A;  5E1Z B;  3R60 A;  1J0R A;  2DPU A;  4EJU A;  2P5V A;  5E17 F;  2E1N A;  5EEG A;  4ZYH A;  4PDK A;  4WK8 F;  3FXU A;  2YSR A;  1J7K A;  2D1V A;  2VC0 A;  2EB7 A;  3FWE A;  3AAF A;  4LJZ F;  5LEJ A;  2A68 F;  1TNT A;  1BI1 A;  5HDK A;  3RPU A;  2ZNZ A;  3HSR A;  4U0V A;  2A07 F;  3E5X A;  2ZME A;  3HIF A;  4CIC A;  5ILV A;  5DD8 A;  5HVQ C;  2MA3 A;  1BM9 A;  3RYR A;  3GVA A;  1FPQ A;  4KIG A;  3TQN A;  2CQK A;  3IKV A;  3I53 A;  1XGM A;  2CGP A;  3KE2 A;  5TRD A;  3OV8 A;  3DPL C;  4LG0 A;  2HKX A;  3RI4 A;  3LST A;  3OOP A;  4HX8 A;  2EV5 A;  3IC7 A;  3WGH A;  3QAH A;  3KET A;  3I4P A;  1W7P B;  1WSU A;  2HS5 A;  5HS9 A;  4HBL A;  1ZGJ A;  4HAM A;  2R7D A;  3HOT A;  4MHG A;  1P6R A;  1R1U A;  2D1H A;  5LLQ A;  2VON A;  1F5T A;  2J5O A;  4Q47 A;  5L3C A;  4LB5 A;  4EMS A;  1EH8 A;  4M74 A;  1P2F A;  4L0Y B;  1WRJ A;  4IJA A;  2M8E A;  4HLY A;  2ACJ A;  3HYI A;  2OA4 A;  1P4W A;  3HTS B;  5E8G A;  5TJJ A;  3ECH A;  1B9N A;  3EYY A;  5DV5 A;  2WC2 A;  3I54 A;  5H20 A;  2RKH A;  1BJA A;  2RV8 A;  1JXS A;  6PAX A;  4L9N A;  3P9K A;  2QVO A;  1ON2 A;  3V4G A;  1XMK A;  3BY6 A;  4O3M A;  1U5T C;  4P9F A;  3TO7 A;  1BI2 A;  4RGR A;  2EFN A;  4AD9 A;  4A6D A;  3F6O A;  3MZY A;  5K1Y A;  2DI3 A;  1XN7 A;  2EWN A;  2UWM A;  1IN4 A;  4HOB A;  1Z1D A;  1CF7 A;  2XGX A;  2ZXJ A;  4N9H A;  3LWF A;  4M6Y A;  3VOE A;  5J8F A;  2H6B A;  2OD5 A;  4MQ9 F;  2OU2 A;  2YX7 A;  4IRI A;  3DP7 A;  5DEQ A;  1XSV A;  2E1C A;  3VB2 A;  1ZG5 A;  1U2W A;  4KFC A;  1ZLJ A;  1J59 A;  3WGI A;  4Q48 A;  3R0J A;  4YII A;  5AIP A;  3I59 B;  5ED4 A;  2ZJ2 A;  2FE3 A;  2Q0O A;  1L3L A;  3IWF A;  5L3F A;  4ENM A;  2GIV A;  3K9T A;  3SXY A;  1IZ1 A;  4YIF A;  3KP2 A;  1SFU A;  4IRG A;  1XDS A;  4AIK A;  4M71 A;  1FZP B;  2UZK A;  4M9X A;  4A0X A;  2UXX A;  1RZ4 A;  4RGS A;  1HKS A;  1QBJ A;  2PJP A;  2XAJ A;  1YS6 A;  2DQL A;  4WXD A;  3VFZ A;  5D4R A;  4JBA A;  2CFX A;  2YX4 A;  4I09 A;  3KLO A;  1QQI A;  3CO6 C;  4EVI A;  4LB6 B;  1FC3 A;  4HV6 A;  1HSJ A;  1BI3 A;  2H09 A;  2OZU A;  2H27 A;  3E6B A;  1D3Y A;  1JE8 A;  2EV6 A;  1H9G A;  5CVI A;  3TDZ C;  3ZMD A;  3WGG A;  3CJN A;  1FLI A;  2D2W A;  3ZMV A;  3PFI A;  2VBX A;  4CXF A;  2ISY A;  4KMU X;  1J5Y A;  3T8T A;  5DUI A;  2F5E A;  2JZY A;  3QOP A;  2OQG A;  3M7G A;  1XSX A;  1IF1 A;  2TDX A;  4G7H F;  1R5H A;  3GFI A;  4OIR F;  2HKO A;  3L9F A;  4RAY A;  2P7V B;  3ZPL A;  5DD4 A;  2FBI A;  2IPQ X;  1T39 A;  2PEX A;  1OPC A;  1ULY A;  3V7S A;  3C1D A;  3HRU A;  2EFO A;  2EA2 A;  2NNY A;  4L5I A;  3KEQ A;  3BP8 A;  3GF2 A;  3DKW A;  2YU3 A;  2C6Y A;  3M1E A;  1YW9 A;  1TW3 A;  1G3T A;  4M72 A;  2DQR A;  2MH9 A;  3ABU A;  4M73 A;  1SD6 A;  3E5Q A;  1KYW A;  2LKP A;  4OIQ F;  5DCF A;  5HDG A;  2D45 A;  4U7D A;  3W6K B;  2NAZ A;  2GXB A;  4O5V A;  3IL2 A;  2V1X A;  3I0T A;  2P7C B;  2M87 A;  3HRT A;  1S7O A;  3HUG A;  5CYV A;  2IA2 A;  2KIU A;  1DPU A;  1UCR A;  2VC1 A;  2QWW A;  3ZMT A;  3HTU A;  3E6M A;  3RDI A;  1STZ A;  3KZY A;  4UNO A;  1SFX A;  4ZZD A;  3K0L A;  2FRH A;  4ZYG A;  1S3J A;  3BRO A;  4XSZ F;  2XKO A;  3CUQ B;  5D8K B;  4LMY A;  3QPH A;  1FBS A;  2DPD A;  2BYV E;  2M5W A;  4IPA A;  5FD5 A;  2QZ8 A;  3WG9 A;  3BJA A;  2ZCW A;  3SHF A;  1RIO H;  1MJ9 A;  4I7H A;  3GFJ A;  5DYM A;  5LHI A;  2IRF G;  1DDN A;  2HWV A;  3I64 A;  2O8X A;  3F72 A;  4EJO A;  3D5L A;  4LGW A;  2QYO A;  2RVC A;  5LGN A;  3K2Z A;  1V3F A;  3KP7 A;  3MZH A;  2E7W A;  3KZZ A;  3BWG A;  1R00 A;  3D0S A;  4EJV A;  1MZB A;  3WU1 B;  2ETH A;  3L2C A;  3MAJ A;  2XV4 S;  1MDM A;  1OYY A;  4UVC A;  2BE5 F;  3GW2 A;  5CJ9 A;  1ZRD A;  1LJ9 A;  3GWZ A;  1ZG3 A;  2RC4 A;  4G9Y A;  5FFZ A;  2DO7 A;  3BPV A;  3Q5F A;  1MJA A;  2HR3 A;  3CDH A;  4FHT A;  1FNN A;  2X4H A;  3DEU A;  1ZRE A;  1WKM A;  4U0Y A;  1ZH5 A;  5LEK A;  3WTS C;  1YIO A;  3ZMZ A;  2VBW A;  3KFW X;  1FSE A;  4L9T A;  3QU3 A;  1ZAO A;  4KNY A;  4GYI A;  2HQR A;  2P5K A;  2EFQ A;  2DT5 A;  3QPT A;  1LDK B;  3CUO A;  3ABT A;  3F8C A;  3P9I A;  3RKY A;  4Q4Z F;  4OIP F;  2J5P A;  1FYK A;  2QM3 A;  5FGM A;  1LEA A;  2G9W A;  4LK0 F;  3TKY A;  2VE8 A;  3TO6 A;  3JAM K;  1XGO A;  5FLX K;  2BBY A;  5CVR A;  3JSP A;  2XRO A;  1R22 A;  3C3W A;  2PN6 A;  1R1T A;  2HYF A;  4S04 A;  4NHJ A;  3F8N A;  4EM0 B;  3PQJ A;  2PFB A;  4KMF A;  3GEZ A;  2A69 F;  3DXJ F;  1KQ0 A;  3ZMU A;  3M9A A;  3E3V A;  1RUO A;  3RKX A;  4QLC U;  1XGS A;  1O3T A;  5FLX Z;  2EA4 A;  1YQA A;  2A3S A;  2X0L A;  1BN5 A;  2P4W A;  3LA7 A;  3K69 A;  3V8L A;  4HA8 A;  4Q5S F;  5J8C A;  2Q8K A;  5E8I A;  3M8F A;  2V79 A;  2LF7 A;  5ERI A;  3HSF A;  5F1R A;  1IN8 A;  2JT1 A;  2XAS A;  5F64 A;  2NRA C;  3JSO A;  2M30 A;  4RS8 A;  4NB5 A;  3EYI A;  4A0Y A;  3QP5 A;  4CHU A;  4XBF A;  4BXU A;  3EUH A;  1ZRC A;  3MWM A;  4MQV A;  2MLG A;  5LGU A;  2MH2 A;  1XCB A;  4KUM A;  5LRS A;  5H6R A;  5F6F A;  1SMY F;  1Z6R A;  1V4R A;  4HDU A;  3T5X A;  2QBY A;  3B73 A;  1YLF A;  1F4K A;  5DCM B;  3HHH A;  1Z91 A;  2VBZ A;  3TGN A;  4OIO F;  3MFK A;  4EV0 A;  2CSO A;  1GXQ A;  4MGR A;  1JHH A;  2LNB A;  4EQQ A;  1PP7 U;  4HF1 A;  2L02 A;  3B02 A;  2LF8 A;  5KK1 A;  1IAW A;  1WQ2 A;  5AIQ A;  1KA8 A;  3BJO A;  2A6E F;  2QUF A;  2IA1 A;  1DUX C;  3J81 K;  2NYX A;  3FF5 A;  2IA0 A;  4FX0 A;  1IRF A;  1MD0 A;  1TBX A;  2BV6 A;  5FFX A;  2XUB A;  2DW4 A;  1T6S A;  4FT8 A;  3W6J B;  4KYW A;  4KIC A;  4PGG A;  4OOI A;  2RDP A;  4CYD A;  4HF0 A;  3O3K A;  2EJR A;  2FQ3 A;  2V1U A;  1LB2 A;  3BDD A;  3IKT A;  3TOB A;  3J81 Z;  1MKM A;  1D8K A;  1RUN A;  2ZFW A;  1WWX A;  2HOE A;  4ZYE A;  1EH6 A;  1YO5 C;  4MTD A;  4JQF A;  2DTR A;  2G7U A;  2F5C A;  3FMS A;  3K1N A;  1IXS B;  3ZQ7 A;  1U78 A;  4B8X A;  3EQL F;  5FB2 A;  1QZY A;  3WTX C;  2PMU A;  1Z6T A;  3V8J A;  2KJB A;  1GVJ A;  3KLN A;  2VBY A;  1RI7 A;  3J7A O;  3HRS A;  2O6G E;  4BAY A;  3RTR A;  3L09 A;  5ICE A;  2IJL A;  3GFL A;  4UUV A;  2EK5 A;  1HKT A;  3EDP A;  3COA C;  1I6X A;  4HQM A;  3SZT A;  3FMR A;  1XMA A;  1XB4 A;  2OBP A;  3DFG A;  2HTJ A;  2Y0M A;  3U1D A;  2GAU A;  2XKP A;  2IT0 A;  1ONV A;  1W5S A;  2L4A A;  4CO8 A;  4ZZL A;  1B6A A;  1K6O A;  3PQK A;  3VEP A;  1IXC A;  4YFN F;  3J80 Z;  2PI0 A;  4AWX B;  2QQA A;  3F21 A;  1UHM A;  5ICG A;  1HXD A;  1BIB A;  2ISZ A;  2VN2 A;  2QLZ A;  1T98 A;  2RN7 A;  4MEX F;  3H3U A;  1U5T B;  2Z3Y A;  4BYY A;  2FXA A;  2ZBK A;  2OAZ A;  3E6D A;  2FU4 A;  2NNN A;  3C18 A;  1W4M A;  3ELK A;  5AON A;  1FYM A;  5HS7 A;  4M9S A;  2Z33 A;  2XAF A;  1G3Y A;  1T2K A;  3RKW A;  4LD5 A;  2P6S A;  2VT3 A;  3F3X A;  2QQ9 A;  1QNT A;  2A61 A;  2IP2 A;  4IRH A;  2MC3 A;  4DNC A;  3CTA A;  1PDN C;  2PLY A;  4ZH4 F;  4WWC A;  1S8N A;  2VOO A;  3ECO A;  1K78 B;  1F9N A;  4KN7 X;  4CGZ A;  3R4K A;  4AIJ A;  4I02 A;  2HGC A;  1HW5 A;  4K2E A;  3M8E A;  5JI6 A;  2IW5 A;  3I59 A;  4G6Q A;  3FZV A;  2STW A;  2K86 A;  4CDG A;  5J6X A;  2OZ6 A;  3F23 A;  3HRM A;  2COM A;  3JW4 A;  2KIM A;  2L54 A;  2KIF A;  3FM3 A;  4OIN F;  5ILU A;  1HW2 A;  1G4D A;  3KCC A;  4A12 A;  1IW7 F;  2P6T A;  4L9V A;  3HSE A;  3WTT C;  2RGV A;  2L4M A;  3H92 A;  3LAP A;  3LAJ A;  3CO7 C;  1Y0U A;  1Z7U A;  1I27 A;  1USS A;  5HDN A;  3ULQ B;  1ZLK A;  3RYP A;  4I0A A;  1KYZ A;  1SD7 A;  1O3R A;  3TOA A;  5BPI A;  3HOS A;  1K79 A;  1SAX A;  2DLL A;  4HX7 A;  2XAQ A;  4GCV A;  4KT5 C;  2STT A;  1J75 A;  4MTE A;  2QQB A;  1PUE E;  2HYG D;  1CGP A;  1X3U A;  1HST A;  4JK1 X;  1Z05 A;  4BNC A;  4Y13 A;  2QEN A;  1ZRF A;  1P4A A;  2ADU A;  1FY7 A;  1IN7 A;  2FMY A;  4BHC A;  4R1H A;  4P9U A;  1ZHF A;  3SZP A;  4WXC A;  1O7F A;  1YS7 A;  4IHS A;  2O03 A;  5IT3 A;  1ZYR F;  2RNJ A;  4GO1 A;  1J2X A;  3JTG A;  3DF8 A;  4ESF A;  4KDP A;  2FML A;  4KN4 X;  1E17 A;  4ETS A;  3FX3 A;  2WTE A;  3LA2 A;  3I58 A;  4RB3 C;  1W5T A;  2FNA A;  3GUD A;  4ENK A;  1B9M A;  2XAG A;  1SMT A;  5A2Q K;  1MJB A;  2Z99 A;  4MNU A;  2CW0 F;  3VOD A;  1KQ9 A;  3ZN0 A;  4D0P A;  3E97 A;  2ZME B;  3IHU A;  3WTZ A;  1S6L A;  2XAH A;  4HV5 A;  1T0F A;  2UXN A;  1H9T A;  5JFR A;  1SD4 A;  2Z9O A;  1BOA A;  1NHA A;  2P5L C;  4ESB A;  4XRF A;  1LEB A;  1TQP A;  3BOQ A;  1FWZ A;  2Y75 A;  4BQA A;  5LHH A;  4AIH A;  5EEH A;  4EGY A;  5D8L B;  5A2Q Z;  1ZG1 A;  1OYW A;  3KEO A;  1RNL A;  4LG0 B;  5FO5 A;  3GZ5 A;  4UV9 A;  1JGS A;  3CUQ A;  1FOK A;  2CYY A;  2ZO4 A;  3IRR A;  1IXR C;  1R36 A;  2ESH A;  3N4M A;  2W57 A;  4M9Z A;  5JVT A;  4L9J A;  3KP3 A;  2JSC A;  2P8T A;  4R8H A;  3Q9V A;  5HLH A;  4UHT A;  1YW8 A;  1EH7 A;  2L3D A;  3DQV C;  3G73 A;  4GXO A;  2FBK A;  2BGC A;  3I71 A;  2GZW A;  3GFM A;  3L00 A;  1U6G A;  4GGG A;  3BPX A;  1GXP A;  3ZN1 A;  1B59 A;  1XGN A;  1R23 A;  5K5Q A;  3FM5 A;  4EJW A;  2AXL A;  3R0A A;  4A5N A;  5K5R A;  1O57 A;  2K27 A;  4A5M A;  3R6S A;  4I2O A;  5BQT A;  1C0W A;  3HHG A;  1S29 A;  1H0M A;  5D5U B;  4G8X A;  4LLN A;  1YTY A;  1IRG A;  4A0Z A; 
#chains in the Genus database with same CATH topology
 3ZQH A;  4ENN A;  4BEH B;  3ZQI A;  2BEO A;  4GYG A;  3SQN A;  4J01 A;  1Z0X A;  5E1W A;  2X1D A;  4IZZ A;  4XOR A;  4RMN A;  4M3E A;  3T1B A;  3BR2 A;  4ON0 A;  3BG3 A;  4C30 A;  4AU7 A;  1G3S A;  5J1Y A;  1MIJ A;  1FBQ A;  5L3B A;  2XDV A;  4TV7 A;  1RC9 A;  3CC4 I;  2M1B A;  2O3F A;  1G2H A;  3K1M A;  3S2W A;  4HZF A;  5GAH J;  5FJ8 J;  3WTV C;  2DBB A;  4G6T B;  1TLH B;  1IN6 A;  3V7R A;  1Z3Y A;  2E7X A;  2V9V A;  3G3Z A;  5HOO A;  2IGK A;  1JHF A;  3DPT A;  3CLO A;  2EFW A;  4RGX A;  2WV1 A;  3SFZ A;  3LNQ A;  2L01 A;  1CF7 B;  2VE9 A;  5TIS C;  2CWE A;  2K02 A;  2F5V A;  5D4S A;  2FQ4 A;  3V8K A;  3AG3 H;  1XC5 A;  1B1B A;  4BH9 A;  5L3G A;  3NAU A;  1FBU A;  3EET A;  4RB1 A;  1FYL A;  3K1P A;  3N05 A;  1FSH A;  5E3M A;  5IP9 J;  1YJW I;  1Q1V A;  2M45 A;  5DUK A;  2W84 A;  1XSD A;  4L18 B;  1XDU A;  2KRC A;  3S1Q J;  1YYV A;  2HDW A;  4N9I A;  2F2E A;  3Q5F A;  1AKH A;  1OCP A;  3Q3S A;  4A3F J;  2F4M B;  2MLK A;  2LY9 A;  2X85 A;  5CKT A;  1D0Z A;  2VOD A;  1ODD A;  3GLX A;  3TBI A;  4OMZ A;  1Y6I A;  2Y31 A;  3ROU A;  3F8F A;  3MEX A;  4I6Z A;  1SFE A;  2K3F A;  2OJE D;  3K10 A;  2M8G X;  2JK3 A;  2V1D A;  3U2R A;  2LDU A;  3MKY B;  2CG4 A;  5CLS A;  3L7W A;  2IBD A;  4M3B A;  4I98 B;  1X19 A;  4BHB A;  4PJ0 C;  1FP2 A;  3OYD A;  2WAQ A;  1JKQ C;  1P4X A;  1VFC A;  5IYD J;  4DBQ A;  2OV7 A;  4OMY A;  3BZ6 A;  1KGS A;  3K70 C;  1OYI A;  2XF5 A;  2ZXI A;  1A04 A;  2CH0 A;  3CDL A;  1VQL I;  3TDU C;  3W2A A;  3A1Y A;  2HTS A;  1D5V A;  3P7N A;  3OR2 C;  4XLA A;  2KRF A;  2LG4 A;  2W24 A;  2GXA A;  3A01 A;  3ZMS A;  3QU6 A;  4G7Z F;  4RAZ A;  4H0E A;  2MBF A;  4BKX A;  1KZH A;  2ZSH B;  4YRV A;  2YPR A;  4BY1 J;  2Y48 A;  1SD5 A;  2YUS A;  2QEX I;  3Q9S A;  1FJL A;  1LDD A;  4ZC3 A;  3H5A A;  4I01 A;  2R4G A;  3RCO A;  5JR3 A;  1BC7 C;  4S05 A;  4KA4 A;  2M4G A;  1REP C;  5BPD A;  2HVS A;  5JHF A;  3TO9 A;  5LRR A;  2XF6 A;  3CF2 A;  2R7F A;  2LVS A;  2CQN A;  2DAO A;  5GTH C;  2B7E A;  4HW0 A;  4CCN A;  1ZGA A;  4LLG F;  4DQ2 A;  3MCZ A;  3BTI A;  3VWB A;  3IWZ A;  5LBQ A;  2VUM J;  2F5F A;  3P9C A;  3C7J A;  4NNJ A;  1LDJ A;  3BCB A;  4QPQ A;  4F7Z A;  3LA3 A;  4MEY F;  3WTU C;  3KIO A;  3FXQ A;  5KAF C;  5E20 A;  2LSO A;  4E7Z A;  2R5Z B;  3ERM A;  2JTV A;  2JPB A;  3MVP A;  2CV2 A;  1R7J A;  2KJC A;  2K9L A;  2VL8 A;  3SZG A;  1K7A A;  1L0O C;  1EV7 A;  1HW1 A;  2DOA A;  2OCC H;  5M5W J;  3E6C C;  4IKF A;  2VOP A;  3J80 K;  1U3E M;  2HU9 A;  4AVP A;  1LFB A;  2HOA A;  2DMN A;  4BQN A;  2F5D A;  1IUY A;  1X2M A;  2BOL A;  2VQL A;  4UVB A;  1FP1 D;  2IVM A;  2HEO A;  3IH2 A;  2DU9 A;  2ESN A;  1LVA A;  1BI0 A;  2LFB A;  2FBH A;  2Q1Z B;  3EUA A;  5DCM A;  4CZZ A;  3AKZ A;  2NS0 A;  4WCG A;  1OCO H;  5CQG A;  3FK7 A;  1W7P A;  4S0H B;  3WE2 A;  1ZAR A;  5GPA A;  3ISP A;  3DPU A;  1IJW C;  3FXM A;  2HDC A;  2L7F P;  1X4O A;  2G7H A;  2TCT A;  1AOY A;  1OR7 A;  4IL6 C;  4ZYD A;  2QSH X;  5JVG F;  1UST A;  2E2I J;  4P55 A;  1UJ8 A;  2P81 A;  1OKR A;  1GHC A;  5KNL A;  1HC8 A;  2NXN B;  3JTH A;  2GWR A;  1O3Q A;  3CCY A;  3IRQ A;  3HGY A;  2XHK A;  2BVM A;  5CVV A;  5KVR A;  4WXH A;  4PK4 A;  2K9Q A;  3KP6 A;  4YG2 F;  5E1X A;  3HJE A;  4HQE A;  2DK8 A;  1DP7 P;  2BZT A;  2BY1 A;  5D6E A;  4BL0 B;  5ICC A;  5HOD A;  5D5W B;  1LQ1 A;  2V6E A;  2GXG A;  4OAY A;  1O3S A;  5D6F A;  3PFY A;  4Y17 A;  4NDL A;  1QGP A;  2DA7 A;  2JA6 J;  2XB0 X;  1FX7 A;  1UAA A;  2M0M A;  3H35 A;  2GQQ A;  1KU9 A;  2FJ1 A;  4E7J A;  4EM2 A;  2LYC A;  3PJR A;  5CVU A;  2NVY J;  4IHT A;  2FF4 A;  2CMP A;  1RPW A;  1TNS A;  1TQI A;  1KU3 A;  3CP8 A;  2VAS A;  2XVC A;  2ZJR F;  4LK1 F;  2JRT A;  2I10 A;  3BG5 A;  1UFM A;  2QSG X;  4IXA A;  2IS2 A;  1IV8 A;  3LQQ A;  5D5V B;  1A31 A;  4I0B A;  2BW3 B;  2ELH A;  1G3W A;  2W7N A;  3ERE D;  3OYH A;  2LC2 A;  2V9K A;  1R4M B;  1XD7 A;  1R4N B;  3RJP A;  5B3S H;  4IX7 A;  4U7B A;  3R61 A;  4KIB A;  3LQR A;  1ZKG A;  4II3 A;  1W5C C;  1PP8 F;  1UB9 A;  5J4V A;  5LHG A;  1MBJ A;  3RIR A;  2ZKZ A;  3I4M J;  3ZP5 A;  2FNP A;  1I5Z A;  4FX4 A;  4P96 A;  4UV8 A;  3REO A;  4YIR X;  2CU7 A;  2HZT A;  5CVJ A;  3GYH X;  1VTN C;  3KP5 A;  1LUJ B;  1F36 A;  3A0H C;  2JPC A;  2VQG A;  5J3L A;  2BXY A;  2VJJ A;  3GZ6 A;  1P92 A;  1K6Y A;  1LNW A;  3I5U A;  1D1B A;  2FSW A;  5EF6 A;  2V6C A;  1NTC A;  1YIT I;  4UVA A;  5HLG A;  3E5U A;  3WE3 A;  3MD2 A;  3JRF A;  3OYJ A;  2A6T A;  2DXI A;  1BC8 C;  4O6J A;  1LE8 A;  1XG1 A;  5EG0 B;  4IO9 F;  2RRE A;  5DDG A;  1Z9C A;  3CUQ C;  2RNG A;  3C2G A;  1U8R A;  2QKL B;  3NQO A;  5L3D A;  4ASN A;  5K7Z A;  4IF4 A;  2Z5U A;  3PL8 A;  3J7A Y;  3FMQ A;  4WX9 A;  2WWY A;  4B4C A;  2I8D A;  5LGT A;  2W85 A;  1YRN B;  3QP6 A;  4UY8 I;  2OQR A;  3GZN B;  4DYR A;  1FMV A;  3UKG A;  1MDM B;  1Z77 A;  1V5F A;  1DU6 A;  1I1G A;  4XLP F;  1ZN2 A;  3AG2 H;  3HKZ A;  3LFK A;  2YR2 A;  4HF2 A;  2L7M P;  2L0K A;  3NWT A;  3M1C A;  3PNT A;  3V7C A;  1Q1H A;  3DV8 A;  3F9K A;  4A93 J;  1IN5 A;  4P5O A;  1A5J A;  4Y15 A;  1BBY A;  2WV0 A;  4XSX F;  4D5C A;  4UXN A;  3L1P A;  4LFU A;  2X1C A;  3A03 A;  2JMW A;  1PUF B;  4C9Y A;  1N25 A;  4HX4 A;  2EBI A;  5BOX A;  1KQ8 A;  1B4A A;  3VSL A;  3T8R A;  5FKL A;  1XMX A;  4G94 A;  4QWQ A;  4B09 A;  2CO5 A;  4E70 A;  1I6H J;  1YFH A;  3OWT A;  4KIF A;  1MGT A;  1PVE A;  3GO5 A;  2KKO A;  2R7U A;  4XLN F;  2K4B A;  2H6C A;  3OYE A;  2L9N A;  4DOZ A;  1S7A A;  1FT9 A;  3DTK A;  1U5T A;  1FOY A;  3H3Z A;  4A3K J;  1BIA A;  4YFK F;  1O7L A;  4A6E A;  1UHS A;  5E18 F;  4RB2 C;  4L0Z B;  2DTZ A;  3GX4 X;  3HL2 A;  1D8J A;  2KZG A;  4L5E A;  2HQN A;  5H6Q A;  1FIA A;  1W36 C;  3QRF F;  2FUG 2;  5J40 A;  1MBG A;  4DW6 A;  1QO0 D;  3K2A A;  1R5G A;  3WG7 H;  1ON1 A;  2DT7 B;  2PG4 A;  3DLL F;  3ABK H;  2NVX J;  3MQ0 A;  1JI8 A;  4ZDL A;  1G6N A;  2BHY A;  4F3Q A;  2EV0 A;  1XTA A;  2O0Y A;  4N0B A;  2K4J A;  4DYC A;  5HS8 A;  2KPM A;  1T38 A;  2AS5 F;  4LLL A;  2ZB9 A;  4IVN A;  4HDV A;  3LL7 A;  4M6X A;  3OYI A;  3L2R A;  2B0L A;  2VT2 A;  1LVK A;  1X4P A;  1YW7 A;  2ZNY A;  4BS9 A;  2ZME C;  3H5N A;  3JRI A;  1GT0 C;  4AYB N;  4R79 A;  4M3D A;  4EM1 A;  4F52 A;  3RSN A;  5JHU A;  2DFI A;  1T08 B;  5IT9 K;  1SFK A;  2K9S A;  3FHZ A;  3D5S C;  1MMA A;  2FEZ A;  3JRE A;  4V19 K;  2O61 A;  4Y33 A;  4XNF A;  3KPH A;  5HNH A;  1W7P D;  3T0Y A;  4RB0 A;  3TW7 A;  2OF7 A;  1K78 A;  3CDI A;  1I1S A;  1HBX G;  4C3J J;  3RPQ A;  5IY5 H;  5L3E A;  3WU0 A;  2DK5 A;  4OU0 A;  4PCQ A;  2M7A A;  3JRA A;  1DGR M;  3MMY B;  2IEK A;  3N97 A;  3NEU A;  4OAZ A;  2X6O A;  2K40 A;  4C2M J;  3FXR A;  1E3H A;  4XN0 A;  4HLX A;  4EJT A;  3F22 A;  1IG7 A;  1RET A;  4XOP A;  3CJR B;  3CJT B;  1ZK8 A;  2PBI A;  2X1E A;  2K7L A;  5ILS A;  3RQ4 A;  4ENJ A;  2FA5 A;  1QZZ A;  1R1V A;  1OCR H;  2CV0 A;  2E34 A;  2XRN A;  2DA3 A;  3FIW A;  5IT9 Z;  1I50 J;  4WF2 A;  2DA5 A;  3G1O A;  1HKQ A;  2FOK A;  1J9I A;  2ME0 A;  1EKE A;  2JSP A;  5HLI A;  5ICF A;  2VXZ A;  3VYT B;  2DCE A;  1NG6 A;  3L2U A;  1OIS A;  4BHP A;  3OR1 C;  4L5J A;  1KU7 A;  4MFD A;  4BQQ A;  3CZ6 A;  4XQF A;  1HQC A;  3W6V A;  1ETW A;  3O2P E;  3NRV A;  3GTL J;  2NVU B;  1X58 A;  5K5O A;  3ZQQ A;  1WI9 A;  4G6D A;  3HZJ A;  1F1Z A;  1RES A;  2UUZ A;  3JRH A;  1VQN I;  3I9V 2;  1T95 A;  2PX9 A;  4UUT A;  1KU2 A;  2QGU A;  1QPM A;  2GA1 A;  2HFH A;  4G7O F;  4ESJ A;  2A5Y B;  2VJI A;  3H5R A;  2CJJ A;  4XN3 A;  2EFP A;  1R58 A;  2Q2E A;  2PQ8 A;  3K4L A;  3W2V A;  3LSR A;  2N8G A;  5BMZ A;  2X51 A;  3RZD J;  2R7X A;  4U88 A;  1UHW A;  2CW8 A;  2QA4 I;  1TQM A;  3F8M A;  1E2X A;  2CRG A;  1VI0 A;  4FTH A;  4DZJ A;  2W25 A;  3E0J B;  4B48 A;  3GXO A;  2QBY B;  2VKE A;  1XCV A;  2HOT A;  3F6V A;  4YFX F;  1YG2 A;  2MD0 A;  2MD5 A;  4IHW A;  3BZC A;  5BS6 A;  2UV1 A;  4EGZ A;  1TW2 A;  4Z2Y A;  4A2U A;  1AWC A;  4NQW A;  4RAG A;  4PZJ A;  3WOD F;  3CLQ A;  2HXI A;  3KP4 A;  5D5X B;  1MH4 A;  1OMI A;  2HXO A;  4HYE A;  2XIG A;  4ZJZ A;  3O6B B;  3ML6 A;  4A69 C;  2R0Q C;  4ANJ A;  2LP0 A;  3HG9 A;  2CW7 A;  3DLA A;  2R3S A;  3K70 D;  3PO3 J;  1YJN I;  4AVZ A;  1K83 J;  4XIC A;  3F8B A;  4PGH A;  3GTM J;  3U9G A;  4RGU A;  2RQP A;  5C4J J;  1NK2 P;  3BJ6 A;  2DA4 A;  5GP9 A;  5DTD A;  2XPU A;  3G1M A;  3HOY J;  2A6H F;  3WTY C;  2H94 A;  2ELK A;  2D5V A;  1TTY A;  2PMH A;  4I76 A;  2L5Q A;  2QCO A;  2GA2 A;  4B1R A;  4QSH A;  1DPR A;  4U0W A;  3JAM Z;  5FD6 A;  3WTW C;  5M3M J;  5E1Z B;  3S15 J;  3OMY A;  3R60 A;  4BE0 A;  1J0R A;  1OR7 C;  2DPU A;  4EJU A;  2P5V A;  5E17 F;  2E1N A;  2GM4 A;  1SAN A;  2B9S A;  5EEG A;  4ZYH A;  3HPG A;  4PDK A;  4WK8 F;  5F0H A;  2Y9Y A;  3MKL A;  3PSF A;  2Y0S N;  1E3P A;  2XB5 A;  3FXU A;  2YSR A;  4IHV A;  4W1U A;  1VQO I;  1J7K A;  1SEU A;  2D1V A;  2VC0 A;  2EB7 A;  3H9G A;  3UR3 C;  1VQ8 I;  3FWE A;  1WGX A;  2MW8 A;  3AAF A;  2VJ4 A;  2EPF A;  4LJZ F;  5LEJ A;  3DBR B;  5IP6 A;  2A68 F;  1TNT A;  1NG7 A;  3DU5 A;  1BI1 A;  5HDK A;  4Y3O A;  3RPU A;  2ZNZ A;  3HSR A;  1A36 A;  1DQU A;  1N78 A;  4U0V A;  1GUU A;  2A07 F;  1T56 A;  3BLY A;  3HDD A;  3HC7 A;  4QPO A;  3E5X A;  4GRI A;  2ZME A;  1MMN A;  3HIF A;  4CIC A;  3H0D A;  5ILV A;  9ANT A;  5DD8 A;  5HVQ C;  4KJZ A;  2ZC2 A;  2MA3 A;  4RDU A;  4JOM A;  3FXJ A;  3CD6 I;  1BM9 A;  2KP6 A;  3RYR A;  3BG7 A;  2YU9 J;  1OCC H;  3GVA A;  3M4O J;  2HZD A;  2NOG A;  1FPQ A;  2R5Y B;  3IV5 A;  4KIG A;  3TQN A;  2CQK A;  3BG6 A;  3IKV A;  4Y4R A;  3OYK A;  3I53 A;  2EH3 A;  5EYR A;  1XGM A;  2CGP A;  1YHQ I;  3KE2 A;  3CME I;  5TRD A;  3OV8 A;  2Y30 A;  3DPL C;  4LG0 A;  2HKX A;  4E7I A;  3K4J A;  3RI4 A;  2VQC A;  4BXX J;  3LST A;  3OOP A;  1ETK A;  2QSF X;  4RM2 A;  4HX8 A;  1MNE A;  4LIU A;  4FIS A;  1M1E B;  2EV5 A;  2ZXW H;  2FD5 A;  1BJZ A;  2XAU A;  3IC7 A;  3WGH A;  3QAH A;  2LRD A;  2ID3 A;  3KET A;  1MBF A;  2MFZ A;  2GIZ A;  3I4P A;  1W7P B;  1WSU A;  2HS5 A;  3CMY A;  5HS9 A;  3FXL A;  2W48 A;  3L2V A;  4HBL A;  2X48 A;  1ZGJ A;  4HAM A;  2R7D A;  3HOT A;  4MHG A;  2IGM A;  2QKM B;  1PYV A;  3QYF A;  1P6R A;  1D5Y A;  4AID A;  3RZO J;  5EGO A;  1R1U A;  3DEW A;  2D1H A;  5LLQ A;  2X6W A;  4MFE A;  4E6K G;  2VON A;  1X1D A;  1X3W B;  1N77 A;  3SEZ A;  1F5T A;  2J5O A;  5JLX A;  4Q47 A;  1TT0 A;  5M5Y J;  5L3C A;  4LB5 A;  4EMS A;  1EH8 A;  3K4B A;  4M74 A;  2DJI A;  4C2T A;  1P2F A;  4L0Y B;  2L2O A;  3IP4 B;  1I39 A;  2PJR A;  1QU3 A;  4BQO A;  1WRJ A;  4IJA A;  4XLH A;  2M8E A;  2K85 A;  1R49 A;  4A3G J;  4HLY A;  4C3H J;  3DU6 A;  2WBM A;  2JRM A;  1MMS A;  2ACJ A;  2VB6 A;  4F92 B;  5DM6 F;  3HYI A;  2OA4 A;  4HEA 2;  2DOD A;  4BEH A;  1ZEL A;  4A3D J;  1R6R A;  3DKY A;  1ACI A;  2DFE A;  1P4W A;  3HTS B;  5E8G A;  5TJJ A;  2ZJP F;  1WJC A;  2B63 J;  3ECH A;  1B9N A;  3HOX J;  3EYY A;  3K7A J;  5DV5 A;  4A3B J;  2WC2 A;  3I54 A;  1TWA J;  5K7H A;  1JKP C;  5H20 A;  2PMZ A;  2RKH A;  1AA7 A;  3F0C A;  1ORK A;  1Y8R B;  4B3X A;  1BJA A;  3LSG A;  2RV8 A;  1JXS A;  3P5J A;  6PAX A;  4L9N A;  4CCM A;  2QVO A;  3P9K A;  1ON2 A;  4FET A;  3V4G A;  4LOC A;  2EZL A;  2V4J C;  1XMK A;  2XGE A;  3BY6 A;  4O3M A;  1CQT A;  3I56 I;  1U5T C;  4P9F A;  1V5G A;  3DWL E;  3TO7 A;  1BI2 A;  4RGR A;  2EFN A;  4AD9 A;  4A6D A;  3F6O A;  3MZY A;  5K1Y A;  2DI3 A;  1XN7 A;  1S9H A;  2LBF A;  2WB1 N;  2EWN A;  2E1O A;  5HLT A;  2UWM A;  1IN4 A;  1RR7 A;  5LFA A;  4HOB A;  1Z1D A;  1CF7 A;  3GTQ J;  2XGX A;  2ZXJ A;  4N9H A;  3LWF A;  4M6Y A;  3VOE A;  5J8F A;  4YEJ A;  2H6B A;  2OD5 A;  4MQ9 F;  2CQ7 A;  1BW5 A;  2OU2 A;  2YX7 A;  2M9H A;  3EPZ A;  3QPL A;  2HNH A;  3WHC A;  4EAT A;  2X9D A;  4IRI A;  3DP7 A;  1VQ9 I;  2L7Z A;  5DEQ A;  1PJR A;  3M07 A;  1XSV A;  2E1C A;  5F0C A;  3VB2 A;  1ZG5 A;  1U2W A;  4KFC A;  1ZLJ A;  1XS9 A;  2JN6 A;  3S17 J;  3OYN A;  1V5E A;  1J59 A;  4OWR B;  3WGI A;  4Q48 A;  2O9L A;  3G1L A;  3R0J A;  4YII A;  5CQE A;  5B66 C;  2GLO A;  1S72 I;  4BAC A;  5AIP A;  3I3L A;  5C3E J;  2R7T A;  3I59 B;  5ED4 A;  1Y8Q B;  2ZJ2 A;  4NC7 A;  1LFP A;  4DYQ A;  3M8J A;  2HQA A;  5IPA A;  2FE3 A;  2Q0O A;  1TWF J;  1L3L A;  3BQY A;  5EJC A;  5J1U A;  2BXZ A;  3BTJ A;  3IWF A;  5L3F A;  4ENM A;  1XX5 A;  2GIV A;  4EEF G;  3K9T A;  3SXY A;  2DFH A;  2LD5 A;  2WAQ N;  1IZ1 A;  4YIF A;  3KP2 A;  5E3N A;  5LD2 C;  2NOJ B;  4IRG A;  1XDS A;  2FOW A;  2DMU A;  4D5F A;  4AIK A;  1SFU A;  1B72 B;  1J09 A;  2EIL H;  4M71 A;  4RA2 A;  1FZP B;  2F48 A;  2UZK A;  1W36 D;  2VPL A;  4M9X A;  3G71 I;  2ECC A;  4LG3 A;  4A0X A;  2UXX A;  1RZ4 A;  1OLT A;  4CYC A;  4RGS A;  2DA1 A;  3IAM 2;  1HKS A;  1QBJ A;  2PJP A;  2XAJ A;  1YS6 A;  2DQL A;  2KHM A;  4WXD A;  1QPI A;  3K4M A;  3VFZ A;  5D4R A;  3VYU B;  4JX4 A;  3RPU D;  4JBA A;  3LSP A;  2CFX A;  2ELJ A;  2LR8 A;  2YX4 A;  4I09 A;  1QRY A;  4XK4 A;  5IOZ A;  3KLO A;  1QQI A;  3CO6 C;  4II2 A;  4EVI A;  2GOM A;  4LB6 B;  3LMM A;  1FC3 A;  4HV6 A;  4IOC F;  1IDZ A;  1HSJ A;  1BI3 A;  2CUJ A;  3FBN B;  2HDD A;  2H09 A;  2KT0 A;  2OZU A;  4XRM A;  2CUF A;  2H27 A;  1JKR C;  4IHX A;  3E6B A;  1D3Y A;  1LKX A;  1JE8 A;  1K4S A;  2EV6 A;  4XM3 A;  4CA0 A;  1H9G A;  5CVI A;  3TDZ C;  3L2Q A;  3ZMD A;  3WGG A;  4AUX A;  3CCM I;  2W00 A;  3CJN A;  3GME A;  2D2W A;  2DOE A;  1FLI A;  3S1R J;  4B43 A;  3K6G A;  4CUG A;  3ZMV A;  3S3M A;  3PFI A;  2BHZ A;  2VBX A;  4CXF A;  2ISY A;  2IAI A;  1T33 A;  4KMU X;  3OS1 A;  2H1K A;  1J5Y A;  3OYG A;  3T8T A;  5DUI A;  4CCJ A;  3QWL A;  2F5E A;  2JZY A;  2DN0 A;  3QOP A;  2OQG A;  1EF4 A;  3BG9 A;  3M7G A;  2F6C A;  1B8I B;  4HSR A;  1XSX A;  1U8B A;  1IF1 A;  2RQQ A;  5GTI C;  1SAU A;  2TDX A;  5F0F A;  4G7H F;  1R5H A;  5C44 J;  4CSW A;  3GFI A;  1SVO A;  4OIR F;  1HDD C;  2HKO A;  3L9F A;  4RAY A;  1GLN A;  2P7V B;  4DJA A;  3ZPL A;  5DD4 A;  4AM3 A;  2FBI A;  2IPQ X;  1FTZ A;  2DA6 A;  2JVH A;  1QHG A;  3WHB A;  3A4C A;  2HYJ A;  2OC6 A;  1T39 A;  4V2G A;  3SFI A;  2E19 A;  4A3I J;  2BY2 A;  1UG0 A;  2PEX A;  4RM3 A;  3NAR A;  1OPC A;  1ULY A;  3V7S A;  3C1D A;  3HRU A;  2EFO A;  2FX0 A;  2EA2 A;  2NNY A;  4L5I A;  4BE2 A;  3KEQ A;  4UB8 C;  1JJ8 C;  1WJE A;  3BP8 A;  3DKW A;  3GF2 A;  3PNV A;  2YU3 A;  1HLV A;  1Y56 A;  3BQZ A;  2OCE A;  1EJ9 A;  2C6Y A;  3M1E A;  2OTL I;  1YW9 A;  1TW3 A;  1KON A;  1G3T A;  4M72 A;  5H2F C;  2DQR A;  2MH9 A;  3ABU A;  4M73 A;  3VPR A;  1SD6 A;  3E5Q A;  4M3F A;  4BU2 A;  1KYW A;  2LKP A;  1T8I A;  3AL0 C;  3LOC A;  4OIQ F;  3CF5 F;  5M3F J;  1X1P A;  1VZ0 A;  3C2H A;  5DCF A;  1G8X A;  5HDG A;  2D45 A;  3W2W A;  4U7D A;  2DT6 A;  3W6K B;  1HF0 A;  4HRI A;  5DM7 F;  2QF7 A;  2NAZ A;  2GXB A;  4O5V A;  5FKK A;  3IL2 A;  2NS8 A;  4XR6 A;  2V1X A;  3I0T A;  3GTG J;  2LRE A;  2EIJ H;  2BW3 A;  2XGD A;  1DP3 A;  3BC8 A;  2P7C B;  3QOE A;  4Y52 J;  4A3C J;  2LMD A;  3BR3 A;  2M87 A;  3HRT A;  4NC8 A;  4XOT A;  1S7O A;  3HUG A;  5CYV A;  1Z7L A;  2IA2 A;  2KIU A;  1DPU A;  5F27 A;  2JUG A;  2E5N A;  1WHU A;  4CCK A;  1UCR A;  5EDN A;  2VC1 A;  2QWW A;  2E35 A;  3HTU A;  3ZMT A;  3E6M A;  3RDI A;  1STZ A;  3KZY A;  4UNO A;  2MYS A;  1IV6 A;  3MKW B;  1IDY A;  1SFX A;  4ZZD A;  2CQX A;  3K0L A;  1MND A;  2FRH A;  2XPV A;  4ZYG A;  1R71 A;  5KAI C;  4HG2 A;  1S3J A;  3BRO A;  2LTP A;  5GAG J;  4XSZ F;  2XKO A;  3J7Y J;  1IRZ A;  5M5X J;  3CUQ B;  5D8K B;  4FAS D;  3EUH C;  4LMY A;  4G12 A;  3QPH A;  1FBS A;  2DPD A;  3A2K A;  2BYV E;  2COB A;  2M5W A;  4IPA A;  5FD5 A;  2QZ8 A;  3WG9 A;  3BJA A;  3PM1 A;  2ZCW A;  2Z1D A;  3SHF A;  1RIO H;  2EIN H;  2F4I A;  3JCU C;  1MJ9 A;  4I7H A;  3GFJ A;  5DYM A;  5LHI A;  3I55 I;  1Z21 A;  1DDN A;  2IRF G;  2HWV A;  2VQH A;  3I64 A;  1GVD A;  3SDB A;  1WJ5 A;  3ZXS A;  2O8X A;  2M34 A;  2I5U A;  3F72 A;  1NK3 P;  1U0J A;  4EJO A;  3D5L A;  4LGW A;  2QYO A;  2RVC A;  5LGN A;  5EG0 A;  3K2Z A;  1V3F A;  1ETY A;  3KP7 A;  1RR8 C;  2E7W A;  3MZH A;  1ETO A;  3KZZ A;  3BWG A;  2CV1 A;  1R00 A;  3D0S A;  4EJV A;  4XID A;  1X1B A;  3U1K A;  1MZB A;  3WU1 B;  1YRN A;  1WJD A;  2ETH A;  4A3M J;  3L2C A;  3MAJ A;  3VDX A;  1BOB A;  2XV4 S;  1YE9 A;  2E1M B;  3QYB A;  5IP7 J;  1MDM A;  3BTL A;  1OYY A;  4UVC A;  3CCQ I;  2LKS A;  1R5I D;  1VND A;  3FIS A;  2E2J J;  2BE5 F;  1BR4 A;  1D1A A;  2ZFU A;  3OYL A;  3GW2 A;  2O5R A;  2KZV A;  2V26 A;  3FK6 A;  3HKZ N;  2MAB A;  4PJN A;  1WI3 A;  4E7K A;  5CJ9 A;  2IS6 A;  1W0U A;  3CC7 I;  1ZRD A;  1LJ9 A;  3GWZ A;  1ZG3 A;  2RC4 A;  4BJ6 C;  5J1R A;  1NH3 A;  4G9Y A;  3CCR I;  5FFZ A;  2DO7 A;  2KMU A;  3BPV A;  1POG A;  2IGO A;  1MJA A;  2M0C A;  2HR3 A;  3CDH A;  3IH4 A;  2KRH A;  4FHT A;  3VYS B;  4C3I J;  1W0T A;  1ETQ A;  1FNN A;  5E3O A;  2X4H A;  1JT0 A;  4HNU A;  3DEU A;  3S93 A;  3QYE A;  1ZRE A;  1OCZ H;  1JTY A;  1N75 A;  2MGQ A;  1WKM A;  2Y69 H;  1VQK I;  4U0Y A;  4QIW N;  1ZH5 A;  3CP2 A;  3GBG A;  5LEK A;  3WTS C;  1YIO A;  3ZMZ A;  2VBW A;  4E4H A;  3ZQL A;  1K61 A;  1LPQ A;  1SVM A;  2NVT J;  3KFW X;  1FSE A;  3QPS A;  3TL4 X;  4L9T A;  4F93 B;  3QU3 A;  3HOU J;  2KIQ A;  1ZAO A;  4KNY A;  4GYI A;  2HQR A;  2P5K A;  2EFQ A;  3ZQG A;  1ZTR A;  3Q0U A;  2DMQ A;  2DT5 A;  3QPT A;  1LDK B;  3RQI A;  3HGG A;  3DEE A;  3CUO A;  3ABT A;  3F8C A;  3P9I A;  3RKY A;  4Q4Z F;  4OIP F;  1HA8 A;  2J5P A;  3HEF A;  1FYK A;  3HOV J;  2M4K A;  2JJ7 A;  2QM3 A;  3OY9 A;  1TC3 C;  5FGM A;  1LEA A;  4RLF A;  3DTE A;  1D1C A;  2G9W A;  2IS1 A;  4LK0 F;  3TKY A;  2R7S A;  3BT9 A;  4N4O B;  2VE8 A;  3S16 J;  3TO6 A;  3JAM K;  5FRM A;  4DGW B;  2Y9Z A;  4A3L J;  2G0E A;  1XGO A;  3H36 A;  5FLX K;  4IQJ A;  2R93 J;  3S14 J;  2BBY A;  5CVR A;  2JUC A;  3JSP A;  2VKV A;  2XRO A;  1R22 A;  3C3W A;  2LY1 A;  2PN6 A;  2H8R A;  1AKH B;  3PIO F;  5GAD J;  1R1T A;  3ZGK A;  1ITY A;  2HYF A;  3UNG C;  3FHN A;  4S04 A;  2L9R A;  4NHJ A;  2JA5 J;  3F8N A;  4EM0 B;  3PQJ A;  4V2F A;  2PFB A;  5EZG A;  1X2N A;  2XGC A;  1YX3 A;  5F04 A;  4KMF A;  2W1O A;  3CJQ B;  2A69 F;  3GEZ A;  2KDZ A;  3I4N J;  3DXJ F;  1YI2 I;  3OSF A;  1KQ0 A;  3G2B A;  4P1W A;  3ZMU A;  3S3O A;  3M9A A;  1BR1 A;  3BR5 A;  1S7E A;  3E3V A;  3GLL A;  1MBK A;  3PNY A;  3RKX A;  5IOY A;  1RUO A;  2OUM A;  4N4N B;  1BA5 A;  3MZ8 A;  1ENH A;  1E3O C;  4UUS A;  4ZDP A;  1TWG J;  2V7F A;  4QLC U;  1XGS A;  4H4K C;  3BZK A;  3PUF A;  1O3T A;  5FLX Z;  2EA4 A;  1XPX A;  1HDP A;  1FTT A;  2DDA A;  1YQA A;  2ECB A;  2A3S A;  2X0L A;  5GPC A;  4BJT A;  1BN5 A;  2P4W A;  3PIP F;  1MNM C;  4PJM A;  4HNT A;  3DBH B;  3LA7 A;  3K69 A;  3V8L A;  3ABM H;  4HA8 A;  4Q5S F;  5J8C A;  2Q8K A;  2XF7 A;  5E8I A;  5IYC J;  3M8F A;  2V79 A;  3A01 B;  2LF7 A;  1ZR2 A;  2VPR A;  5ERI A;  3U21 A;  3X2Q H;  4F91 B;  3LSH A;  3HSF A;  5F1R A;  2IGN A;  1IN8 A;  1I3Q J;  1WH5 A;  2JT1 A;  3HM5 A;  3H9J A;  4JYK A;  1RKT A;  2XAS A;  5F64 A;  2NRA C;  3JSO A;  3OYF A;  1GV2 A;  2M30 A;  4RS8 A;  3TP0 A;  4NB5 A;  3EYI A;  4FCY A;  3LSI A;  4A0Y A;  3QP5 A;  1IUF A;  1WCM J;  4CHU A;  4XBF A;  2DJN A;  4BXU A;  4PFP A;  3EUH A;  1ZRC A;  2DMT A;  3MWM A;  2GBY A;  4MQV A;  2K5C A;  1UMQ A;  1Z3X A;  1TWC J;  3KEY A;  2MLG A;  5LGU A;  3SEQ A;  2MH2 A;  4CH7 A;  5BNG A;  1XCB A;  3MN2 A;  4KUM A;  3V42 A;  5H6R A;  5LRS A;  2WB1 A;  1TL8 A;  5F6F A;  1SMY F;  1Z6R A;  1V4R A;  4HDU A;  2LBF B;  3T5X A;  3H0G J;  2QBY A;  1ETV A;  3B73 A;  3BR0 A;  1GDT A;  1YLF A;  1QHH D;  2AQE A;  1F4K A;  3Q0V A;  1P9Q C;  4BGD A;  1G59 A;  4BXF A;  2WY7 Q;  5DCM B;  1QVU A;  2W82 A;  3HHH A;  1Z91 A;  2VBZ A;  3TGN A;  4OIO F;  3MFK A;  4EV0 A;  2CSO A;  1GXQ A;  4MGR A;  1JHH A;  3W3C A;  4ZTF A;  1JKO C;  3CC2 I;  2W4S A;  2LNB A;  3DBL B;  4XKB A;  1IO2 A;  1P7I A;  2CUE A;  2DYS H;  5IYB J;  4EQQ A;  5J4Y A;  1PP7 U;  3IH3 A;  1MMD A;  1UEL B;  4HF1 A;  1WPK A;  2L02 A;  2QQ8 A;  3JRB A;  3B02 A;  4KIT B;  2LF8 A;  2L9S A;  5KK1 A;  2JA7 J;  4U87 A;  2KIS A;  1IAW A;  1WQ2 A;  1SVL A;  5AIQ A;  1KA8 A;  3BJO A;  2A6E F;  4HST A;  2ME6 A;  2QUF A;  2IA1 A;  3E7L A;  1DUX C;  1RRJ A;  2KLO A;  3J81 K;  2NYX A;  4B47 A;  3FF5 A;  1S5L C;  2JQ7 A;  2IA0 A;  4FX0 A;  1A35 A;  4XLC A;  1IRF A;  5B5E C;  1O4X A;  1MD0 A;  1TBX A;  2LLK A;  1JJ6 C;  2BV6 A;  4NBQ A;  3CCS I;  5FFX A;  2XUB A;  2BY3 A;  2DW4 A;  3ZR8 X;  3ZQC A;  1T6S A;  3OS0 A;  4FT8 A;  1VF9 A;  3LSK A;  3W6J B;  4KYW A;  2WAE A;  4KIC A;  4PGG A;  4OOI A;  2RDP A;  4XLE A;  5B1A H;  4CYD A;  4HF0 A;  4NUB A;  3O3K A;  4J19 A;  4CYC B;  3O8G A;  4DZP A;  1DGW Y;  2EJR A;  2FQ3 A;  3IUO A;  1VQ7 I;  2BY0 A;  2Z16 A;  2V1U A;  1LB2 A;  3BDD A;  1WJF A;  3IKT A;  3WU2 C;  3TOB A;  3J81 Z;  1MKM A;  1D8K A;  3ASN H;  1RUN A;  3QQA A;  2ZFW A;  4GFB A;  1WWX A;  2HOE A;  4ZYE A;  1EH6 A;  4PJJ A;  3ZCO A;  1YO5 C;  1HOM A;  5DS9 A;  1U9O A;  2CFO A;  4MTD A;  4JQF A;  3TED A;  2DTR A;  2G7U A;  2F5C A;  3FMS A;  1WZ2 A;  3K1N A;  1IXS B;  2M3A A;  3ZQ7 A;  3QOD A;  1U78 A;  4B8X A;  3EQL F;  1A6I A;  5FB2 A;  1H89 C;  4FE7 A;  1QZY A;  4E7S A;  3WTX C;  2PMU A;  2R5Y A;  1Z6T A;  3V8J A;  2KJB A;  2VJ5 A;  5JLW A;  1GVJ A;  2XRL A;  3K4K A;  3KX2 A;  3GTO J;  1GV5 A;  3KLN A;  5FLV A;  2M7B A;  2VBY A;  1RI7 A;  2F4O B;  4M3G A;  3J7A O;  5C4X J;  4FE4 A;  3HRS A;  1TP4 A;  2O6G E;  4RLQ A;  4MIM A;  5FKM A;  4QTR A;  1FOW A;  3RTR A;  4BAY A;  3L09 A;  4BUP A;  5ICE A;  3SJM A;  2IJL A;  3OSG A;  2MG4 A;  2M2E A;  3GFL A;  2R7O A;  4AC0 A;  1BR2 A;  4UUV A;  3B6C A;  2EK5 A;  4I99 C;  1HKT A;  1LE8 B;  2WA0 A;  1FIP A;  2K3P A;  1V55 H;  3CCU I;  3OYM A;  3EDP A;  3COA C;  1I6X A;  3AG1 H;  3FXO A;  4HQM A;  3SZT A;  4PSW A;  3G4S I;  2XSJ C;  1XMA A;  3FMR A;  4D7M A;  4IHY A;  1XB4 A;  2OBP A;  3DFG A;  3HOW J;  2HTJ A;  4D9J A;  3J7Z I;  2Y0M A;  3U1D A;  2GAU A;  2XKP A;  1ETX A;  3H1C A;  4XL9 A;  2XC7 A;  3JRD A;  4ZTJ A;  1VQ5 I;  2IT0 A;  1ONV A;  3GTP J;  1W5S A;  2R7V A;  2K9N A;  5B1B H;  4XKC A;  4F55 A;  2L4A A;  3CMM A;  4CO8 A;  4ZZL A;  1B6A A;  4RAF A;  1K6O A;  1Y1V J;  1X1A A;  4CZC A;  1VQ6 I;  3PQK A;  2A05 A;  1MW7 A;  3VEP A;  1IXC A;  1BL0 A;  4YFN F;  3J80 Z;  1VQP I;  2PI0 A;  4AWX B;  2QQA A;  3F21 A;  3ONQ A;  4JP0 A;  1UHM A;  4Y7N J;  5ICG A;  4PFO A;  3KYL A;  4DBR A;  1HXD A;  1BIB A;  1K4T A;  2O8K A;  2ISZ A;  3E1S A;  1Y0N A;  4HPQ A;  3C2B A;  2VN2 A;  1JUP A;  2WAF A;  3IAS 2;  2QLZ A;  1T98 A;  1MSE C;  2BVL A;  2RN7 A;  1E0E A;  2Z2S B;  1JT6 A;  4MEX F;  1W1W E;  1WJA A;  3H3U A;  1U5T B;  1X1C A;  2Z3Y A;  4BYY A;  2FXA A;  2ZBK A;  1QZE A;  1FEX A;  1F43 A;  2OAZ A;  4KT6 A;  4X6A J;  2NVQ J;  2TRT A;  2L7K A;  3S1N J;  1OQY A;  3E6D A;  2CS3 A;  2FU4 A;  1AHD P;  2NNN A;  4XKV A;  1IGN A;  2WY8 Q;  3C18 A;  1W4M A;  2VKD A;  3ELK A;  2PMZ N;  4BDY A;  5AON A;  2JVG A;  1FYM A;  2VLA A;  2WAD A;  5HS7 A;  2ZXH A;  1FOX A;  3HUG B;  2JA8 J;  4M9S A;  1UG2 A;  1YX5 A;  4M6V A;  2KDO A;  3OYC A;  2R5Z A;  4W97 A;  2O7O A;  2Z33 A;  1UZC A;  3TP3 A;  4ITV A;  2HOS A;  2XAF A;  4UB6 C;  3JRG A;  1YIJ I;  1LFU P;  4ZDO A;  4JX5 A;  1G3Y A;  1T2K A;  5K7F A;  4AYB A;  3RKW A;  4RBO A;  4LD5 A;  2P6S A;  2HI3 A;  2VT3 A;  3F3X A;  2QQ9 A;  1QNT A;  1T0F C;  2A61 A;  2HQ5 A;  2IP2 A;  4IEJ A;  5FRN A;  4IRH A;  3TW6 A;  2MC3 A;  4DNC A;  3CTA A;  2V9P A;  3FXK A;  5EEA A;  1PDN C;  2PLY A;  4ZH4 F;  3BR6 A;  1MH3 A;  2KFD A;  3CCJ I;  4WWC A;  3DKX A;  3CES A;  1S8N A;  2VOO A;  2R7Z J;  4BY7 J;  3ECO A;  2LY2 A;  3S2D J;  5FKN A;  1K78 B;  1F9N A;  4KN7 X;  1AU7 A;  3JRC A;  4CGZ A;  3R4K A;  3S1M J;  4AIJ A;  3GTJ J;  4I02 A;  2HGC A;  1HW5 A;  4K2E A;  1WFX A;  1BW6 A;  2DYR H;  2E36 A;  3AG4 H;  3M8E A;  2IS4 A;  1Z67 A;  3OOU A;  2EZI A;  5JI6 A;  4E7H A;  4XRS A;  2IW5 A;  2DA2 A;  3I59 A;  4G6Q A;  3FZV A;  1U9N A;  1ZGW A;  2STW A;  1X3Z B;  2K86 A;  3KZI C;  2E71 A;  4CDG A;  4X1E A;  3G6E I;  5J6X A;  1VQM I;  3CCV I;  2Y2Z A;  3OL4 A;  3ASO H;  2OZ6 A;  3F23 A;  3HRM A;  2COM A;  3S32 A;  3JW4 A;  2KIM A;  3K4N A;  1D0X A;  1RKW A;  3VSK A;  1JGG A;  2L54 A;  3O8H A;  1OCT C;  2KIF A;  1HCR A;  3OIP A;  1EA3 A;  2R7R A;  2JWT A;  2H8W A;  4B44 A;  3FM3 A;  4OIN F;  1B72 A;  5ILU A;  1HW2 A;  1G4D A;  3M3Y J;  3KCC A;  4BBR J;  3LSJ A;  2OPT A;  4A12 A;  1IW7 F;  2P6T A;  3S3N A;  4CCO A;  4L9V A;  1FMW A;  2R7Q A;  3HB9 A;  2XSD C;  2OTJ I;  1JUS A;  3HSE A;  3Q0W A;  5F08 A;  2CUZ A;  3WTT C;  3D1N I;  1ERD A;  2RGV A;  1WVR A;  2L4M A;  2E1M C;  3H92 A;  3LAP A;  3LAJ A;  3CO7 C;  3AFH A;  1Y0U A;  3H9Q A;  2ZSI B;  2HPI A;  5FLM J;  2VI6 A;  1Z7U A;  1MMG A;  2H1L A;  1I27 A;  1USS A;  5FKO A;  5HDN A;  2Q2E B;  3PSI A;  3ULQ B;  3FDY A;  1ZLK A;  2AO9 A;  4HNV A;  3EUK L;  4I0A A;  3RYP A;  1KYZ A;  1SD7 A;  2ICW G;  1O3R A;  3TOA A;  3MKZ A;  5BPI A;  3HOS A;  1K79 A;  1SAX A;  2DLL A;  2EIM H;  4HX7 A;  5KCM A;  3HPH A;  3A02 A;  2XAQ A;  4GCV A;  4KT5 C;  1APL C;  2STT A;  2E5Z A;  2X6X A;  3ABL H;  3DTI A;  1J75 A;  4MTE A;  2DDB A;  4PSX A;  2QQB A;  5HNF A;  2E2H J;  1PUE E;  3OYB A;  2KL4 A;  2HYG D;  1H88 C;  2V1N A;  1CGP A;  3DCF A;  1X3U A;  2AXT C;  4YEL A;  1MSF C;  2E60 A;  1ZR4 A;  1HST A;  5KHD A;  3CQZ J;  4JK1 X;  2HVR A;  1Z05 A;  4NQW B;  4BNC A;  4Y13 A;  2LOO A;  2QEN A;  2EQR A;  2RAE A;  4CCL A;  1ZRF A;  1OJL A;  1P4A A;  2ADU A;  3S2H J;  3LSM A;  1FY7 A;  1IN7 A;  1YOV B;  4PUS A;  3OS2 A;  2EIK H;  2ZJQ F;  2FMY A;  4BHC A;  2K9M A;  1B8I A;  2AHQ A;  2VXD A;  4R1H A;  5GAE J;  1Y1W J;  4P9U A;  1MBH A;  1ZHF A;  4D1Q A;  3SZP A;  1IC8 A;  4WXC A;  3HBL A;  3CMA I;  2R92 J;  1O7F A;  4MLO A;  1YS7 A;  4E7L A;  1TZL A;  1JTX A;  4IHS A;  1H8A C;  2GOX B;  2O03 A;  4BDZ A;  3CCE I;  5IT3 A;  1ZYR F;  2RNJ A;  4GO1 A;  1J2X A;  2JA2 A;  5CPR B;  3JTG A;  1IRX A;  3DF8 A;  4ESF A;  3FBI B;  4UUS B;  3PUB A;  1R9T J;  4IQ4 A;  3AL0 B;  4C2U A;  4KDP A;  2FML A;  4KN4 X;  1DU0 A;  1E17 A;  1PUF A;  4ETS A;  2Y0S A;  2YS9 A;  1YJ9 I;  1WJB A;  3FX3 A;  2WTE A;  3LA2 A;  3I58 A;  3OIO A;  4RB3 C;  3FKI J;  3ZQF A;  1W5T A;  3OL3 A;  2FNA A;  3GUD A;  4ENK A;  1B9M A;  2EZK A;  2XAG A;  1A6Q A;  3RKQ A;  3ZOB A;  4DIQ A;  1SMT A;  5A2Q K;  2DMP A;  1MJB A;  4BJ5 C;  3ESW B;  2Z99 A;  4MNU A;  3GTK J;  2CW0 F;  3VOD A;  2MC4 A;  1KQ9 A;  4XMY A;  3LFU A;  4LIV A;  5E79 C;  3ZN0 A;  4D0P A;  3E97 A;  3TMO A;  1TT5 B;  3B6A A;  2MSY A;  4NC6 A;  2CQQ A;  2ZME B;  3IHU A;  5EZH A;  3WTZ A;  4IOA F;  1S6L A;  2XAH A;  4HV5 A;  3VYR B;  3SDG A;  5J47 A;  1T0F A;  2UXN A;  3KYD B;  1H9T A;  5JFR A;  1SD4 A;  2Z9O A;  1BOA A;  1NHA A;  2P5L C;  4ESB A;  2DFF A;  4XRF A;  4B3A A;  1LEB A;  1TQP A;  1SC7 A;  1QVT A;  2ID6 A;  1OFC X;  3BOQ A;  3NWS A;  3HOZ J;  4MO7 A;  1Y39 A;  1FWZ A;  2Y75 A;  4BQA A;  1SFO J;  5LHH A;  4AIH A;  5E3L A;  3ZRG A;  3PO2 J;  5EEH A;  2HVQ A;  4EGY A;  1VQ4 I;  2AQF A;  5D8L B;  3L2W A;  5A2Q Z;  1ZG1 A;  2A5W A;  3GCM A;  1P7J A;  1OYW A;  4KIS A;  3KEO A;  4X0G A;  1RNL A;  4LG0 B;  5FO5 A;  1QA6 A;  3GZ5 A;  4UV9 A;  4ABZ A;  1JGS A;  3CUQ A;  1FOK A;  2P0W A;  2CYY A;  2ZO4 A;  3IRR A;  1IXR C;  1R36 A;  2ESH A;  2X6Y A;  3BTC A;  3N4M A;  2W57 A;  4M9Z A;  5JVT A;  4L9J A;  4XON A;  3KP3 A;  2JSC A;  3D5R C;  2P8T A;  4R8H A;  3Q9V A;  5HLH A;  3SYT A;  3OIQ A;  2VIX A;  4UHT A;  1YW8 A;  1EH7 A;  2NS7 A;  2L3D A;  3DQV C;  3G73 A;  4GXO A;  2FBK A;  2LK2 A;  4XLF A;  1WH7 A;  4JX6 A;  1D0Y A;  2BGC A;  2GZW A;  3I71 A;  3KYC B;  3GFM A;  3L00 A;  5TGT A;  4Z6Y A;  4GDF A;  2LH9 A;  2XPW A;  1U6G A;  2KQR A;  4GGG A;  3JR9 A;  3BPX A;  1GXP A;  3ZN1 A;  1B59 A;  3BCA A;  1JUM A;  4A3J J;  2DOF A;  2L9V A;  3K4C A;  5EGO B;  1XGN A;  1TWH J;  3CCL I;  3HXL A;  4J00 A;  1R23 A;  4ZYA A;  2EZH A;  5K5Q A;  3H3V K;  3FM5 A;  4D7N A;  3A0B C;  4XKW A;  4EJW A;  5F1J A;  2R7W A;  4BE1 A;  2HPM A;  2AXL A;  1V54 H;  2IXS A;  2VKH A;  3R0A A;  4A5N A;  4XRS G;  1MBE A;  5K5R A;  1O57 A;  1ZQ3 P;  2K27 A;  4A5M A;  2LKX A;  3R6S A;  4I2O A;  5FRO A;  3FKJ A;  5BQT A;  1C0W A;  3OYA A;  2PJR B;  3HHG A;  1S29 A;  1H0M A;  5D5U B;  4G8X A;  4LLN A;  3BR1 A;  4FQG A;  4BBS J;  3S8P A;  1YTY A;  1IRG A;  4PJL A;  1I3A A;  4A3E J;  4LIT A;  4A0Z A; 
#chains in the Genus database with same CATH homology
 4ENN A;  2BEO A;  4GYG A;  3SQN A;  5E1W A;  3T1B A;  4ON0 A;  1G3S A;  1FBQ A;  5L3B A;  4TV7 A;  2M1B A;  2O3F A;  3K1M A;  3S2W A;  4HZF A;  3WTV C;  2DBB A;  1TLH B;  1IN6 A;  3V7R A;  2E7X A;  2V9V A;  3G3Z A;  5HOO A;  1JHF A;  3DPT A;  3CLO A;  2EFW A;  4RGX A;  3SFZ A;  2L01 A;  1CF7 B;  2VE9 A;  2CWE A;  2K02 A;  5D4S A;  3V8K A;  1B1B A;  4BH9 A;  5L3G A;  1FBU A;  3EET A;  4RB1 A;  1FYL A;  3K1P A;  1FSH A;  2M45 A;  5DUK A;  2W84 A;  1XSD A;  4L18 B;  1XDU A;  1YYV A;  4N9I A;  2F2E A;  2MLK A;  2VOD A;  1ODD A;  3GLX A;  4OMZ A;  3ROU A;  3F8F A;  3MEX A;  1SFE A;  2V1D A;  3U2R A;  2LDU A;  2CG4 A;  5CLS A;  3L7W A;  4I98 B;  4BHB A;  1FP2 A;  1P4X A;  4OMY A;  3BZ6 A;  1KGS A;  1OYI A;  1A04 A;  3TDU C;  2HTS A;  1D5V A;  3P7N A;  2KRF A;  2W24 A;  3ZMS A;  3QU6 A;  4G7Z F;  4RAZ A;  4H0E A;  2MBF A;  2YPR A;  2Y48 A;  1SD5 A;  3Q9S A;  1LDD A;  4I01 A;  5JR3 A;  1BC7 C;  4S05 A;  4KA4 A;  1REP C;  5BPD A;  3TO9 A;  5LRR A;  2R7F A;  2DAO A;  4HW0 A;  1ZGA A;  4LLG F;  4DQ2 A;  3MCZ A;  3IWZ A;  5LBQ A;  2F5F A;  3P9C A;  3C7J A;  1LDJ A;  4F7Z A;  3LA3 A;  4MEY F;  3WTU C;  3FXQ A;  5E20 A;  2LSO A;  2JTV A;  2JPB A;  1R7J A;  2KJC A;  1K7A A;  1L0O C;  1EV7 A;  1HW1 A;  3E6C C;  2VOP A;  3J80 K;  1U3E M;  4AVP A;  2F5D A;  1IUY A;  4UVB A;  1FP1 D;  2IVM A;  2HEO A;  5DCM A;  2DU9 A;  2ESN A;  1LVA A;  1BI0 A;  2FBH A;  4CZZ A;  2NS0 A;  4WCG A;  1W7P A;  3WE2 A;  1ZAR A;  3ISP A;  2HDC A;  2G7H A;  1AOY A;  1OR7 A;  4ZYD A;  1UST A;  4P55 A;  1OKR A;  1GHC A;  3JTH A;  1O3Q A;  2GWR A;  3IRQ A;  2XHK A;  5CVV A;  5KVR A;  4WXH A;  4YG2 F;  4HQE A;  3KP6 A;  5E1X A;  1DP7 P;  2DK8 A;  5D5W B;  5ICC A;  5D6E A;  1LQ1 A;  2GXG A;  1O3S A;  5D6F A;  4Y17 A;  1QGP A;  1FX7 A;  2GQQ A;  1KU9 A;  4EM2 A;  5CVU A;  4IHT A;  2FF4 A;  1TNS A;  1TQI A;  1KU3 A;  2XVC A;  4LK1 F;  2JRT A;  1UFM A;  4IXA A;  3LQQ A;  5D5V B;  4I0B A;  2ELH A;  1G3W A;  3ERE D;  1XD7 A;  3RJP A;  4U7B A;  3R61 A;  4KIB A;  3LQR A;  1PP8 F;  1UB9 A;  5LHG A;  3RIR A;  2ZKZ A;  3ZP5 A;  2FNP A;  1I5Z A;  4FX4 A;  4P96 A;  4UV8 A;  3REO A;  2HZT A;  5CVJ A;  3GYH X;  1VTN C;  3KP5 A;  2JPC A;  3GZ6 A;  1P92 A;  1LNW A;  3I5U A;  2FSW A;  2V6C A;  4UVA A;  5HLG A;  3E5U A;  3WE3 A;  1BC8 C;  4O6J A;  5DDG A;  1Z9C A;  3CUQ C;  1U8R A;  5L3D A;  3NQO A;  4ASN A;  4IF4 A;  2Z5U A;  3FMQ A;  4WX9 A;  2WWY A;  5LGT A;  2W85 A;  3QP6 A;  2OQR A;  1MDM B;  1I1G A;  4XLP F;  1ZN2 A;  3LFK A;  2YR2 A;  4HF2 A;  3V7C A;  1Q1H A;  3DV8 A;  1IN5 A;  4P5O A;  4Y15 A;  1BBY A;  2WV0 A;  4XSX F;  4UXN A;  4LFU A;  4HX4 A;  5BOX A;  1KQ8 A;  1B4A A;  3T8R A;  4B09 A;  4QWQ A;  4G94 A;  2CO5 A;  4E70 A;  1YFH A;  4KIF A;  1MGT A;  3GO5 A;  2KKO A;  4XLN F;  2K4B A;  2H6C A;  1S7A A;  1FT9 A;  1U5T A;  3H3Z A;  1BIA A;  4YFK F;  1O7L A;  4A6E A;  5E18 F;  4RB2 C;  4L0Z B;  3GX4 X;  1D8J A;  2HQN A;  5H6Q A;  3QRF F;  1QO0 D;  1R5G A;  1ON1 A;  2PG4 A;  3MQ0 A;  1G6N A;  2EV0 A;  2O0Y A;  4N0B A;  2K4J A;  5HS8 A;  1T38 A;  2AS5 F;  4LLL A;  4IVN A;  4HDV A;  4M6X A;  2B0L A;  2VT2 A;  1YW7 A;  2ZNY A;  4R79 A;  4EM1 A;  5JHU A;  2DFI A;  5IT9 K;  3FHZ A;  2FEZ A;  2O61 A;  1W7P D;  3T0Y A;  4RB0 A;  1K78 A;  1I1S A;  1HBX G;  3RPQ A;  5L3E A;  3WU0 A;  2DK5 A;  4OU0 A;  4PCQ A;  3N97 A;  3NEU A;  3FXR A;  4HLX A;  4EJT A;  3F22 A;  2PBI A;  2K7L A;  5ILS A;  4ENJ A;  2FA5 A;  1QZZ A;  1R1V A;  2XRN A;  5IT9 Z;  4WF2 A;  1J9I A;  1HKQ A;  2FOK A;  5ICF A;  5HLI A;  2VXZ A;  4BHP A;  4L5J A;  1KU7 A;  1HQC A;  3O2P E;  3NRV A;  5K5O A;  1WI9 A;  4G6D A;  1F1Z A;  1KU2 A;  1QPM A;  2GA1 A;  2HFH A;  4G7O F;  4ESJ A;  2A5Y B;  2EFP A;  1R58 A;  2Q2E A;  2PQ8 A;  5BMZ A;  4U88 A;  1UHW A;  1TQM A;  3F8M A;  1E2X A;  2W25 A;  3GXO A;  2QBY B;  1XCV A;  3F6V A;  4YFX F;  1YG2 A;  2MD5 A;  5BS6 A;  4EGZ A;  1TW2 A;  4Z2Y A;  4A2U A;  1AWC A;  4NQW A;  4PZJ A;  3WOD F;  3KP4 A;  5D5X B;  1OMI A;  4HYE A;  2XIG A;  3O6B B;  3ML6 A;  2R3S A;  3F8B A;  4PGH A;  3U9G A;  4RGU A;  2RQP A;  3BJ6 A;  2A6H F;  3WTY C;  2H94 A;  1TTY A;  2PMH A;  2GA2 A;  3JAM Z;  1DPR A;  4U0W A;  3WTW C;  5FD6 A;  5E1Z B;  3R60 A;  1J0R A;  2DPU A;  4EJU A;  2P5V A;  5E17 F;  2E1N A;  5EEG A;  4ZYH A;  4PDK A;  4WK8 F;  3FXU A;  2YSR A;  1J7K A;  2D1V A;  2VC0 A;  2EB7 A;  3FWE A;  3AAF A;  4LJZ F;  5LEJ A;  2A68 F;  1TNT A;  1BI1 A;  5HDK A;  3RPU A;  2ZNZ A;  3HSR A;  4U0V A;  2A07 F;  3E5X A;  2ZME A;  3HIF A;  4CIC A;  5ILV A;  5DD8 A;  5HVQ C;  2MA3 A;  1BM9 A;  3RYR A;  3GVA A;  1FPQ A;  4KIG A;  3TQN A;  2CQK A;  3IKV A;  3I53 A;  1XGM A;  2CGP A;  3KE2 A;  5TRD A;  3OV8 A;  3DPL C;  4LG0 A;  2HKX A;  3RI4 A;  3LST A;  3OOP A;  4HX8 A;  2EV5 A;  3IC7 A;  3WGH A;  3QAH A;  3KET A;  3I4P A;  1W7P B;  1WSU A;  2HS5 A;  5HS9 A;  4HBL A;  1ZGJ A;  4HAM A;  2R7D A;  3HOT A;  4MHG A;  1P6R A;  1R1U A;  2D1H A;  5LLQ A;  2VON A;  1F5T A;  2J5O A;  4Q47 A;  5L3C A;  4LB5 A;  4EMS A;  1EH8 A;  4M74 A;  1P2F A;  4L0Y B;  1WRJ A;  4IJA A;  2M8E A;  4HLY A;  2ACJ A;  3HYI A;  2OA4 A;  1P4W A;  3HTS B;  5E8G A;  5TJJ A;  3ECH A;  1B9N A;  3EYY A;  5DV5 A;  2WC2 A;  3I54 A;  5H20 A;  2RKH A;  1BJA A;  2RV8 A;  1JXS A;  6PAX A;  4L9N A;  3P9K A;  2QVO A;  1ON2 A;  3V4G A;  1XMK A;  3BY6 A;  4O3M A;  1U5T C;  4P9F A;  3TO7 A;  1BI2 A;  4RGR A;  2EFN A;  4AD9 A;  4A6D A;  3F6O A;  3MZY A;  5K1Y A;  2DI3 A;  1XN7 A;  2EWN A;  2UWM A;  1IN4 A;  4HOB A;  1Z1D A;  1CF7 A;  2XGX A;  2ZXJ A;  4N9H A;  3LWF A;  4M6Y A;  3VOE A;  5J8F A;  2H6B A;  2OD5 A;  4MQ9 F;  2OU2 A;  2YX7 A;  4IRI A;  3DP7 A;  5DEQ A;  1XSV A;  2E1C A;  3VB2 A;  1ZG5 A;  1U2W A;  4KFC A;  1ZLJ A;  1J59 A;  3WGI A;  4Q48 A;  3R0J A;  4YII A;  5AIP A;  3I59 B;  5ED4 A;  2ZJ2 A;  2FE3 A;  2Q0O A;  1L3L A;  3IWF A;  5L3F A;  4ENM A;  2GIV A;  3K9T A;  3SXY A;  1IZ1 A;  4YIF A;  3KP2 A;  1SFU A;  4IRG A;  1XDS A;  4AIK A;  4M71 A;  1FZP B;  2UZK A;  4M9X A;  4A0X A;  2UXX A;  1RZ4 A;  4RGS A;  1HKS A;  1QBJ A;  2PJP A;  2XAJ A;  1YS6 A;  2DQL A;  4WXD A;  3VFZ A;  5D4R A;  4JBA A;  2CFX A;  2YX4 A;  4I09 A;  3KLO A;  1QQI A;  3CO6 C;  4EVI A;  4LB6 B;  1FC3 A;  4HV6 A;  1HSJ A;  1BI3 A;  2H09 A;  2OZU A;  2H27 A;  3E6B A;  1D3Y A;  1JE8 A;  2EV6 A;  1H9G A;  5CVI A;  3TDZ C;  3ZMD A;  3WGG A;  3CJN A;  1FLI A;  2D2W A;  3ZMV A;  3PFI A;  2VBX A;  4CXF A;  2ISY A;  4KMU X;  1J5Y A;  3T8T A;  5DUI A;  2F5E A;  2JZY A;  3QOP A;  2OQG A;  3M7G A;  1XSX A;  1IF1 A;  2TDX A;  4G7H F;  1R5H A;  3GFI A;  4OIR F;  2HKO A;  3L9F A;  4RAY A;  2P7V B;  3ZPL A;  5DD4 A;  2FBI A;  2IPQ X;  1T39 A;  2PEX A;  1OPC A;  1ULY A;  3V7S A;  3C1D A;  3HRU A;  2EFO A;  2EA2 A;  2NNY A;  4L5I A;  3KEQ A;  3BP8 A;  3GF2 A;  3DKW A;  2YU3 A;  2C6Y A;  3M1E A;  1YW9 A;  1TW3 A;  1G3T A;  4M72 A;  2DQR A;  2MH9 A;  3ABU A;  4M73 A;  1SD6 A;  3E5Q A;  1KYW A;  2LKP A;  4OIQ F;  5DCF A;  5HDG A;  2D45 A;  4U7D A;  3W6K B;  2NAZ A;  2GXB A;  4O5V A;  3IL2 A;  2V1X A;  3I0T A;  2P7C B;  2M87 A;  3HRT A;  1S7O A;  3HUG A;  5CYV A;  2IA2 A;  2KIU A;  1DPU A;  1UCR A;  2VC1 A;  2QWW A;  3ZMT A;  3HTU A;  3E6M A;  3RDI A;  1STZ A;  3KZY A;  4UNO A;  1SFX A;  4ZZD A;  3K0L A;  2FRH A;  4ZYG A;  1S3J A;  3BRO A;  4XSZ F;  2XKO A;  3CUQ B;  5D8K B;  4LMY A;  3QPH A;  1FBS A;  2DPD A;  2BYV E;  2M5W A;  4IPA A;  5FD5 A;  2QZ8 A;  3WG9 A;  3BJA A;  2ZCW A;  3SHF A;  1RIO H;  1MJ9 A;  4I7H A;  3GFJ A;  5DYM A;  5LHI A;  2IRF G;  1DDN A;  2HWV A;  3I64 A;  2O8X A;  3F72 A;  4EJO A;  3D5L A;  4LGW A;  2QYO A;  2RVC A;  5LGN A;  3K2Z A;  1V3F A;  3KP7 A;  3MZH A;  2E7W A;  3KZZ A;  3BWG A;  1R00 A;  3D0S A;  4EJV A;  1MZB A;  3WU1 B;  2ETH A;  3L2C A;  3MAJ A;  2XV4 S;  1MDM A;  1OYY A;  4UVC A;  2BE5 F;  3GW2 A;  5CJ9 A;  1ZRD A;  1LJ9 A;  3GWZ A;  1ZG3 A;  2RC4 A;  4G9Y A;  5FFZ A;  2DO7 A;  3BPV A;  3Q5F A;  1MJA A;  2HR3 A;  3CDH A;  4FHT A;  1FNN A;  2X4H A;  3DEU A;  1ZRE A;  1WKM A;  4U0Y A;  1ZH5 A;  5LEK A;  3WTS C;  1YIO A;  3ZMZ A;  2VBW A;  3KFW X;  1FSE A;  4L9T A;  3QU3 A;  1ZAO A;  4KNY A;  4GYI A;  2HQR A;  2P5K A;  2EFQ A;  2DT5 A;  3QPT A;  1LDK B;  3CUO A;  3ABT A;  3F8C A;  3P9I A;  3RKY A;  4Q4Z F;  4OIP F;  2J5P A;  1FYK A;  2QM3 A;  5FGM A;  1LEA A;  2G9W A;  4LK0 F;  3TKY A;  2VE8 A;  3TO6 A;  3JAM K;  1XGO A;  5FLX K;  2BBY A;  5CVR A;  3JSP A;  2XRO A;  1R22 A;  3C3W A;  2PN6 A;  1R1T A;  2HYF A;  4S04 A;  4NHJ A;  3F8N A;  4EM0 B;  3PQJ A;  2PFB A;  4KMF A;  3GEZ A;  2A69 F;  3DXJ F;  1KQ0 A;  3ZMU A;  3M9A A;  3E3V A;  1RUO A;  3RKX A;  4QLC U;  1XGS A;  1O3T A;  5FLX Z;  2EA4 A;  1YQA A;  2A3S A;  2X0L A;  1BN5 A;  2P4W A;  3LA7 A;  3K69 A;  3V8L A;  4HA8 A;  4Q5S F;  5J8C A;  2Q8K A;  5E8I A;  3M8F A;  2V79 A;  2LF7 A;  5ERI A;  3HSF A;  5F1R A;  1IN8 A;  2JT1 A;  2XAS A;  5F64 A;  2NRA C;  3JSO A;  2M30 A;  4RS8 A;  4NB5 A;  3EYI A;  4A0Y A;  3QP5 A;  4CHU A;  4XBF A;  4BXU A;  3EUH A;  1ZRC A;  3MWM A;  4MQV A;  2MLG A;  5LGU A;  2MH2 A;  1XCB A;  4KUM A;  5LRS A;  5H6R A;  5F6F A;  1SMY F;  1Z6R A;  1V4R A;  4HDU A;  3T5X A;  2QBY A;  3B73 A;  1YLF A;  1F4K A;  5DCM B;  3HHH A;  1Z91 A;  2VBZ A;  3TGN A;  4OIO F;  3MFK A;  4EV0 A;  2CSO A;  1GXQ A;  4MGR A;  1JHH A;  2LNB A;  4EQQ A;  1PP7 U;  4HF1 A;  2L02 A;  3B02 A;  2LF8 A;  5KK1 A;  1IAW A;  1WQ2 A;  5AIQ A;  1KA8 A;  3BJO A;  2A6E F;  2QUF A;  2IA1 A;  1DUX C;  3J81 K;  2NYX A;  3FF5 A;  2IA0 A;  4FX0 A;  1IRF A;  1MD0 A;  1TBX A;  2BV6 A;  5FFX A;  2XUB A;  2DW4 A;  1T6S A;  4FT8 A;  3W6J B;  4KYW A;  4KIC A;  4PGG A;  4OOI A;  2RDP A;  4CYD A;  4HF0 A;  3O3K A;  2EJR A;  2FQ3 A;  2V1U A;  1LB2 A;  3BDD A;  3IKT A;  3TOB A;  3J81 Z;  1MKM A;  1D8K A;  1RUN A;  2ZFW A;  1WWX A;  2HOE A;  4ZYE A;  1EH6 A;  1YO5 C;  4MTD A;  4JQF A;  2DTR A;  2G7U A;  2F5C A;  3FMS A;  3K1N A;  1IXS B;  3ZQ7 A;  1U78 A;  4B8X A;  3EQL F;  5FB2 A;  1QZY A;  3WTX C;  2PMU A;  1Z6T A;  3V8J A;  2KJB A;  1GVJ A;  3KLN A;  2VBY A;  1RI7 A;  3J7A O;  3HRS A;  2O6G E;  4BAY A;  3RTR A;  3L09 A;  5ICE A;  2IJL A;  3GFL A;  4UUV A;  2EK5 A;  1HKT A;  3EDP A;  3COA C;  1I6X A;  4HQM A;  3SZT A;  3FMR A;  1XMA A;  1XB4 A;  2OBP A;  3DFG A;  2HTJ A;  2Y0M A;  3U1D A;  2GAU A;  2XKP A;  2IT0 A;  1ONV A;  1W5S A;  2L4A A;  4CO8 A;  4ZZL A;  1B6A A;  1K6O A;  3PQK A;  3VEP A;  1IXC A;  4YFN F;  3J80 Z;  2PI0 A;  4AWX B;  2QQA A;  3F21 A;  1UHM A;  5ICG A;  1HXD A;  1BIB A;  2ISZ A;  2VN2 A;  2QLZ A;  1T98 A;  2RN7 A;  4MEX F;  3H3U A;  1U5T B;  2Z3Y A;  4BYY A;  2FXA A;  2ZBK A;  2OAZ A;  3E6D A;  2FU4 A;  2NNN A;  3C18 A;  1W4M A;  3ELK A;  5AON A;  1FYM A;  5HS7 A;  4M9S A;  2Z33 A;  2XAF A;  1G3Y A;  1T2K A;  3RKW A;  4LD5 A;  2P6S A;  2VT3 A;  3F3X A;  2QQ9 A;  1QNT A;  2A61 A;  2IP2 A;  4IRH A;  2MC3 A;  4DNC A;  3CTA A;  1PDN C;  2PLY A;  4ZH4 F;  4WWC A;  1S8N A;  2VOO A;  3ECO A;  1K78 B;  1F9N A;  4KN7 X;  4CGZ A;  3R4K A;  4AIJ A;  4I02 A;  2HGC A;  1HW5 A;  4K2E A;  3M8E A;  5JI6 A;  2IW5 A;  3I59 A;  4G6Q A;  3FZV A;  2STW A;  2K86 A;  4CDG A;  5J6X A;  2OZ6 A;  3F23 A;  3HRM A;  2COM A;  3JW4 A;  2KIM A;  2L54 A;  2KIF A;  3FM3 A;  4OIN F;  5ILU A;  1HW2 A;  1G4D A;  3KCC A;  4A12 A;  1IW7 F;  2P6T A;  4L9V A;  3HSE A;  3WTT C;  2RGV A;  2L4M A;  3H92 A;  3LAP A;  3LAJ A;  3CO7 C;  1Y0U A;  1Z7U A;  1I27 A;  1USS A;  5HDN A;  3ULQ B;  1ZLK A;  3RYP A;  4I0A A;  1KYZ A;  1SD7 A;  1O3R A;  3TOA A;  5BPI A;  3HOS A;  1K79 A;  1SAX A;  2DLL A;  4HX7 A;  2XAQ A;  4GCV A;  4KT5 C;  2STT A;  1J75 A;  4MTE A;  2QQB A;  1PUE E;  2HYG D;  1CGP A;  1X3U A;  1HST A;  4JK1 X;  1Z05 A;  4BNC A;  4Y13 A;  2QEN A;  1ZRF A;  1P4A A;  2ADU A;  1FY7 A;  1IN7 A;  2FMY A;  4BHC A;  4R1H A;  4P9U A;  1ZHF A;  3SZP A;  4WXC A;  1O7F A;  1YS7 A;  4IHS A;  2O03 A;  5IT3 A;  1ZYR F;  2RNJ A;  4GO1 A;  1J2X A;  3JTG A;  3DF8 A;  4ESF A;  4KDP A;  2FML A;  4KN4 X;  1E17 A;  4ETS A;  3FX3 A;  2WTE A;  3LA2 A;  3I58 A;  4RB3 C;  1W5T A;  2FNA A;  3GUD A;  4ENK A;  1B9M A;  2XAG A;  1SMT A;  5A2Q K;  1MJB A;  2Z99 A;  4MNU A;  2CW0 F;  3VOD A;  1KQ9 A;  3ZN0 A;  4D0P A;  3E97 A;  2ZME B;  3IHU A;  3WTZ A;  1S6L A;  2XAH A;  4HV5 A;  1T0F A;  2UXN A;  1H9T A;  5JFR A;  1SD4 A;  2Z9O A;  1BOA A;  1NHA A;  2P5L C;  4ESB A;  4XRF A;  1LEB A;  1TQP A;  3BOQ A;  1FWZ A;  2Y75 A;  4BQA A;  5LHH A;  4AIH A;  5EEH A;  4EGY A;  5D8L B;  5A2Q Z;  1ZG1 A;  1OYW A;  3KEO A;  1RNL A;  4LG0 B;  5FO5 A;  3GZ5 A;  4UV9 A;  1JGS A;  3CUQ A;  1FOK A;  2CYY A;  2ZO4 A;  3IRR A;  1IXR C;  1R36 A;  2ESH A;  3N4M A;  2W57 A;  4M9Z A;  5JVT A;  4L9J A;  3KP3 A;  2JSC A;  2P8T A;  4R8H A;  3Q9V A;  5HLH A;  4UHT A;  1YW8 A;  1EH7 A;  2L3D A;  3DQV C;  3G73 A;  4GXO A;  2FBK A;  2BGC A;  3I71 A;  2GZW A;  3GFM A;  3L00 A;  1U6G A;  4GGG A;  3BPX A;  1GXP A;  3ZN1 A;  1B59 A;  1XGN A;  1R23 A;  5K5Q A;  3FM5 A;  4EJW A;  2AXL A;  3R0A A;  4A5N A;  5K5R A;  1O57 A;  2K27 A;  4A5M A;  3R6S A;  4I2O A;  5BQT A;  1C0W A;  3HHG A;  1S29 A;  1H0M A;  5D5U B;  4G8X A;  4LLN A;  1YTY A;  1IRG A;  4A0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...