3FM5A

X-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
131
Chain Sequence
MAESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title X-ray crystal structure of transcriptional regulator (MarR family) from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
total genus 41
structure length 131
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fm5A00
3E3VA 3R6SA 1J9IA 1YW7A 1ONVA 2HFHA 1R7JA 4OINF 1PP8F 1FZPB 1OYIA 5DUKA 2P8TA 4PGGA 2W85A 1P4AA 3F8FA 3WTXC 1G4DA 3F23A 4OIQF 3DV8A 3BPXA 3HOTA 1LDKB 4LB6B 5CVIA 4EJVA 1HXDA 1A04A 4KICA 3I71A 4MGRA 5LGUA 3ECHA 3GFIA 4UV9A 3FM5A 1F1ZA 1OYYA 3LA3A 2FXAA 2GXBA 2IW5A 5DDGA 5LRSA 3MZHA 4KIBA 3CLOA 2DO7A 2EFPA 3F8NA 4HZFA 4LK1F 2VBWA 3VODA 2GZWA 6PAXA 5HS7A 1I1GA 2HWVA 4CYDA 2QQAA 1OR7A 1R22A 5HOOA 4NHJA 1S7OA 1P6RA 2HOEA 1FP2A 1T38A 1IUYA 1JHHA 2STTA 4RB1A 1TW2A 4I0BA 2CYYA 5AIPA 1K78A 3EUHA 3K9TA 1QPMA 3IHUA 2QQ9A 3WTUC 3KP7A 1W7PD 2OA4A 2EK5A 3H3UA 4HLYA 1ZG3A 1FP1D 1U5TB 1ZGJA 4HAMA 3L7WA 3K69A 1K6OA 1SD6A 2QWWA 2FMYA 3L9FA 4EM2A 2J5PA 2FEZA 3LA7A 1IN8A 2PG4A 1D8KA 3NRVA 2IP2A 4RGRA 4ASNA 3OOPA 2H94A 3ROUA 3ISPA 2Z9OA 3IKVA 3PQKA 1HQCA 4XLNF 1QQIA 1XD7A 2IT0A 2VOOA 5D6EA 4ZZDA 2XROA 3TGNA 1BC8C 4L9NA 2MH2A 3LAJA 1WKMA 4EJUA 3I59A 3TKYA 5E20A 3HYIA 2BBYA 1P2FA 2QQBA 2H6BA 3HOSA 1O3SA 1XCVA 5FGMA 4WX9A 4ENMA 2FSWA 2JRTA 2P5KA 3K1NA 4RB0A 2YSRA 4G6QA 2HTJA 3T5XA 2O61A 2XKOA 4EM1A 1SD5A 3H3ZA 5FD5A 3GX4X 1KU7A 2GXGA 3BDDA 2K7LA 1Z6RA 2KJCA 2YX7A 1SFXA 3R60A 2ZKZA 1ZRDA 1EV7A 2CO5A 1J75A 1FBSA 1Q1HA 5D5VB 3V7CA 1W5TA 3J80K 2D1VA 1K78B 4M72A 1BJAA 1DPUA 2OAZA 4GCVA 2IA2A 3KLNA 1FWZA 2M30A 3GWZA 2ZO4A 2STWA 4MQVA 3I53A 2BGCA 5IT3A 3KP2A 2KRFA 3MQ0A 1ON2A 4Y13A 4BXUA 3B73A 2PI0A 1GXPA 4UHTA 4Q5SF 1FYKA 2FBIA 3KLOA 1JXSA 3EDPA 3RKYA 2QUFA 3ABUA 1HKSA 3Q9VA 3AAFA 2V1UA 1LEAA 2QZ8A 2M87A 3F3XA 3R0AA 5HVQC 1VTNC 4GYGA 3HRTA 1TBXA 2DI3A 2KJBA 3QOPA 3Q9SA 2R3SA 2COMA 5L3BA 4G7OF 4RGUA 3V7RA 5KK1A 2GQQA 2Q2EA 3BROA 4I0AA 2GA2A 2M5WA 4N0BA 2G7UA 2PMUA 3HHHA 3TO6A 1YLFA 1FSHA 3ZMSA 1O7FA 3BWGA 2B0LA 1XMAA 2OBPA 2WTEA 1J0RA 1K7AA 2YU3A 4O6JA 4EV0A 2V79A 4UV8A 1IAWA 5D8KB 5ILVA 1MKMA 2L54A 4EMSA 4IHTA 1QNTA 1LDJA 1ODDA 1XDSA 3R61A 2P7VB 4LLGF 2TDXA 5ILSA 1LQ1A 4OIOF 3QU3A 2KIUA 1BM9A 4A0ZA 5DD8A 1ZLJA 3WTVC 2IA1A 2OQRA 4LLLA 5BS6A 1PDNC 4D0PA 1KQ0A 1XGNA 2A6EF 3RYPA 4AIKA 4AWXB 2XVCA 4U0VA 3KZZA 3HSRA 1HKQA 3GXOA 1MDMB 5L3FA 4G6DA 2BEOA 2M1BA 1W5SA 4M9ZA 3BJ6A 1QZZA 1BBYA 2EV6A 1S7AA 1RI7A 2D1HA 1YS7A 4KDPA 2RKHA 3FMQA 3RDIA 1B4AA 1KYWA 2K4BA 4IRHA 2JZYA 3SQNA 1T6SA 4I02A 2IVMA 2VONA 1E17A 4B8XA 1IZ1A 4WF2A 4Y15A 1MD0A 3KETA 2EWNA 4FX4A 5ED4A 4TV7A 3EETA 1L0OC 2ZMEB 4M9XA 1OYWA 4ZYEA 3I54A 4IJAA 4HYEA 4HQMA 1Z6TA 3M7GA 3GEZA 2WV0A 5HLGA 4M6YA 2ZFWA 2RQPA 3HRUA 1GVJA 2KIMA 2IRFG 4EJWA 4BHBA 2LDUA 2C6YA 3IL2A 2W57A 2AXLA 4PZJA 4Q47A 2EV0A 2Y0MA 2VXZA 4CZZA 4HV5A 1OMIA 4HX8A 2CG4A 4LJZF 2UWMA 3K0LA 2HR3A 3E5QA 4A6EA 4ZYDA 1KU9A 4HV6A 4EJOA 3DFGA 4L5IA 5FLXK 4XSXF 4MTDA 1BIAA 5LGNA 2ZBKA 3ZPLA 1D8JA 3U2RA 1BOAA 3VOEA 1QZYA 4L9TA 1G3YA 4IRIA 4L9JA 2X4HA 1J2XA 3IWFA 2ISZA 3KP3A 1E2XA 5K5QA 5CLSA 4OOIA 4K2EA 2OQGA 1U5TA 2ELHA 5BPDA 1T0FA 4YIFA 5KVRA 1BI2A 3JW4A 2KIFA 1Z9CA 2QVOA 1DDNA 2GIVA 1SFEA 4PDKA 2MLGA 1IW7F 3WTZA 1FBUA 1RZ4A 1UCRA 3DQVC 5CVUA 5DCMA 2O3FA 2PBIA 2IJLA 2RC4A 3MEXA 5K5OA 1IN5A 5ERIA 3FHZA 3HTSB 2J5OA 4YFXF 2FQ3A 2O03A 1FBQA 3KP6A 2XAFA 4MTEA 3ZMUA 1CF7B 1LB2A 4KFCA 5K5RA 5DD4A 1BC7C 5FD6A 3ZMDA 3CO7C 3J7AO 4U0WA 5CVJA 3T8TA 4MHGA 2CQKA 5LEKA 3SHFA 4KMFA 4HF0A 1UB9A 1WRJA 4KMUX 4P9UA 3EQLF 4RAYA 3N4MA 2YPRA 2LF8A 3QP5A 2FF4A 2ACJA 2EJRA 1ZREA 1H9GA 1SMTA 2GA1A 3I64A 5D5XB 4KIGA 2WWYA 4XRFA 1HW2A 1TQIA 2NNYA 2RDPA 4WWCA 5LHHA 1XDUA 3RIRA 2XAGA 4YFNF 5DUIA 3BP8A 1SAXA 2OU2A 2K4JA 1EH8A 3R4KA 2PLYA 1FLIA 3B02A 1P4WA 1LDDA 2E1CA 3QRFF 3U9GA 3FM3A 5D6FA 4MEXF 4KA4A 4EJTA 1F5TA 2DPUA 3GUDA 1ZH5A 2MBFA 2G7HA 2Y48A 5DCMB 4UXNA 3U1DA 4KNYA 4U0YA 5HS8A 5BMZA 4P9FA 4IHSA 2XKPA 3ABTA 2RGVA 3E5XA 3CUQB 3W6KB 2HDCA 1J7KA 1HSJA 4A0XA 3WU1B 1D3YA 4IRGA 3LSTA 5HLIA 4I7HA 3WTYC 5LHGA 3C18A 5AONA 2F5DA 2XAJA 3GZ5A 4GXOA 5FFXA 1LNWA 3VFZA 1EH7A 1ZGAA 2O8XA 4UVBA 3L2CA 1BI0A 1R1TA 2F5CA 2NAZA 4PGHA 1YIOA 5TRDA 2HTSA 2MH9A 1K79A 1IRGA 1ZN2A 3E6MA 2MLKA 4EQQA 5FB2A 2E1NA 3F22A 4G9YA 3SXYA 4S05A 1FPQA 1YS6A 5HLHA 5BOXA 5JR3A 1MGTA 4FHTA 1XGMA 2ZXJA 1U5TC 5TJJA 5IT9K 3GVAA 1KQ8A 5AIQA 3I58A 1CGPA 2OZUA 2H6CA 5CJ9A 2O6GE 3DXJF 4KIFA 4ZH4F 3J80Z 1ULYA 3F8CA 3SZTA 2F5FA 2EFNA 4RGXA 3HHGA 1V4RA 3LQRA 2JSCA 4HBLA 5F64A 3V7SA 4HF1A 4HX7A 1ZG5A 1XSVA 1MDMA 2DQRA 2A61A 3GLXA 4JK1X 5D4SA 4WCGA 4CHUA 4AIHA 3P9KA 4XBFA 4UNOA 2MA3A 3W6JB 1Z7UA 4IF4A 3JTHA 1IF1A 4HDVA 3O2PE 3GFLA 2PFBA 5K1YA 2XGXA 2ESNA 3WODF 2A68F 4CO8A 2CW0F 5DCFA 1U8RA 5HDKA 3CO6C 2GWRA 2ZMEA 2HQRA 4M6XA 5E8IA 3PQJA 2FMLA 1TNTA 4M74A 1NHAA 2XIGA 2UZKA 3I0TA 4RAZA 3ZMVA 2ZNZA 3FXRA 2YR2A 1FC3A 2KKOA 5CVVA 4OIRF 4G8XA 3C3WA 5H6RA 4ESFA 4QWQA 1UFMA 1KA8A 1LVAA 4L9VA 5E1XA 3MAJA 5E8GA 1U3EM 4ZYGA 3KEQA 1SMYF 3E97A 1XGOA 1B9NA 1C0WA 1IN7A 2Y75A 3DF8A 1FYLA 3J81Z 3KEOA 2HS5A 3FXUA 2O0YA 4LMYA 2Z3YA 3RKWA 1RUNA 2Q8KA 1WSUA 2DAOA 2MC3A 3NQOA 1O57A 3ZP5A 3L00A 4KN7X 1PUEE 5EEHA 2Z99A 3O6BB 3D0SA 1YW9A 4KYWA 3HTUA 1B6AA 2JPBA 3WTWC 3GO5A 3MWMA 1YO5C 1BI3A 3JAMZ 2BV6A 4CICA 1IN4A 3M1EA 1BIBA 4A0YA 4WK8F 3QP6A 2ZJ2A 4I98B 4DNCA 1W4MA 1XCBA 2AS5F 2PJPA 4CXFA 1RNLA 2CGPA 1GXQA 3WGIA 1MJAA 2EA2A 1RIOH 3FWEA 2VC0A 2W24A 3ELKA 3MZYA 2XHKA 1HSTA 3ZMZA 4YIIA 4UVCA 5HDNA 4L5JA 2CFXA 4A12A 4A2UA 4LD5A 2DW4A 2PQ8A 1FSEA 4OMZA 1ZG1A 2P5LC 2P5VA 1QBJA 4WXHA 3BOQA 1T39A 2V9VA 2ISYA 2ZNYA 4P55A 4EVIA 4HW0A 1GHCA 5J8CA 3D5LA 3F72A 3P9IA 1CF7A 4R79A 3WTSC 3HRMA 1JGSA 1XMKA 2HGCA 5D4RA 5L3DA 5JHUA 2LSOA 1ON1A 4EM0B 4RB3C 5A2QZ 5JFRA 1IXSB 2L4MA 4GO1A 4EGYA 2DTRA 4OIPF 2X0LA 2HKOA 2Q0OA 3GZ6A 2FE3A 3TQNA 4ETSA 2K86A 2VODA 2VBZA 1SD7A 1O3RA 4P5OA 3TOBA 1R00A 1XSDA 2NNNA 1LJ9A 1R36A 3H92A 2QM3A 2QLZA 3TOAA 4OU0A 2W25A 3F21A 2ETHA 3I5UA 1KU3A 3FF5A 3RKXA 5CVRA 2WC2A 3FMRA 4F7ZA 3RTRA 1HKTA 5HDGA 2H27A 1T98A 2CWEA 1YW8A 3CTAA 4H0EA 3V4GA 4EGZA 4YG2F 2YX4A 4FX0A 3M8EA 4UVAA 5F6FA 3BJOA 1UHMA 4HDUA 3KFWX 1QO0D 2IPQX 1R1VA 2ZCWA 3HSEA 3K2ZA 2BYVE 1XB4A 3WG9A 5LGTA 3WU0A 3REOA 2FA5A 5F1RA 4ZZLA 2NYXA 3RI4A 5H20A 4ON0A 4S04A 3IRQA 3CJNA 3CUQA 1DP7P 2FNAA 2JTVA 1F9NA 3G73A 2QBYB 2A5YB 2FRHA 5BQTA 2L4AA 1RUOA 2XAQA 5ICCA 5E17F 1R23A 4I09A 2W84A 3F6OA 1FOKA 3KP4A 2R7FA 1LEBA 3GF2A 2P4WA 4FT8A 2A07F 1P4XA 4KN4X 5DYMA 3TO7A 5LLQA 1WQ2A 1G3TA 3L09A 3GW2A 1YFHA 4LGWA 4XSZF 4I01A 2DU9A 2HEOA 4G7ZF 3WE3A 1FT9A 3VB2A 1WWXA 3LWFA 2DPDA 3JSPA 4MEYF 4LG0A 2XRNA 4U7BA 2FBHA 3KCCA 1S6LA 1DUXC 3E6DA 5CYVA 2UXXA 3K1PA 3IWZA 3M8FA 1B59A 2XUBA 2F5EA 1HW5A 3WGGA 2PMHA 4GYIA 1FNNA 4BHCA 1ZARA 2Z33A 3BZ6A 4HF2A 3RPQA 1ZRFA 1MZBA 3BJAA 4OMYA 5EEGA 5LBQA 3LQQA 1G3WA 1UHWA 2DK5A 2LKPA 4R1HA 3IRRA 4WXCA 1D5VA 2D2WA 3ZMTA 2M8EA 3HIFA 3QPHA 1TTYA 2NRAC 4WXDA 4IXAA 2OD5A 1P92A 1KYZA 1TQPA 1AWCA 1TW3A 1S3JA 2P6SA 1O3QA 4LFUA 4MNUA 3ZQ7A 1QGPA 3RYRA 1IN6A 3COAC 2FNPA 1Z05A 4BYYA 3LFKA 2H09A 3R0JA 3WE2A 4YFKF 2VBYA 3HRSA 1Z1DA 1ZHFA 5ILUA 2LNBA 1HW1A 4P96A 3QAHA 3N97A 1O7LA 3WTTC 4N9HA 4L0YB 3T0YA 1BN5A 2DBBA 1JE8A 3C1DA 1ZAOA 1OKRA 1R5GA 2QYOA 3ULQB 3CUOA 4RB2C 3QPTA 2VN2A 1IRFA 1Y0UA 3FX3A 5D8LB 2K02A 1USSA 2RVCA 4ENJA 1L3LA 2L01A 3FZVA 2L02A 4KT5C 5ICFA 2A6HF 1FY7A 2LF7A 3V8JA 2DT5A 4HOBA 1I27A 2A3SA 1HBXG 4LG0B 2JT1A 1U2WA 3OV8A 3SZPA 4QLCU 3KZYA 1STZA 3GFJA 2CSOA 1YQAA 4Y17A 3VEPA 4L0ZB 3F8BA 2V1XA 3ML6A 1KGSA 1TLHB 2XV4S 4NQWA 1KQ9A 3T1BA 2EFWA 4Q4ZF 2EV5A 4MQ9F 1H9TA 1G6NA 5IT9Z 3DKWA 3ERED 5DV5A 4DQ2A 5HS9A 1J5YA 1S8NA 3LA2A 3V8KA 4BQAA 3JTGA 2NS0A 2BE5F 5J8FA 5JI6A 4UUVA 4HQEA 1I6XA 5LEJA 1J59A 1EH6A 4ZYHA 1G3SA 2VE9A 5DEQA 1PP7U 3EYIA 3CUQC 2VBXA 4XLPF 4BAYA 3MFKA 2FBKA 4ENKA 5J6XA 2HYGD 4M73A 2K27A 1SD4A 4U88A 2VT2A 4BNCA 4N9IA 3TDUC 3T8RA 1R58A 4BH9A 4HX4A 2R7DA 4M71A 2EFQA 2P7CB 5L3EA 3HSFA 2FU4A 4CGZA 1REPC 3MCZA 1OPCA 2OZ6A 1JHFA 2RNJA 1W7PA 1USTA 3WGHA 1SFUA 5LHIA 5L3CA 3JSOA 5ICEA 4ENNA 3I59B 2XAHA 2FOKA 2E7WA 3TO9A 3PFIA 3M9AA 1T2KA 2ADUA 5FFZA 2EB7A 4R8HA 1KU2A 4LB5A 3HUGA 4A5MA 3DP7A 3V8LA 1YTYA 4GGGA 2D45A 1ZLKA 2RV8A 1I1SA 1AOYA 3E6CC 2VC1A 2MD5A 3DEUA 2GAUA 2EA4A 1X3UA 4M9SA 2VT3A 5ICGA 3J81K 3F6VA 2XASA 5E1ZB 5D5UB 5FO5A 2ESHA 4NB5A 3F8MA 3G3ZA 2V1DA 1R1UA 2L3DA 3TDZC 1IXCA 2A69F 1V3FA 2IA0A 4BHPA 5L3GA 2P6TA 4AVPA 3JAMK 3SFZA 5BPIA 4A6DA 4CDGA 3RJPA 4G94A 4AIJA 2EFOA 2JPCA 1YG2A 4HLXA 3FMSA 3DPLC 4IVNA 1B1BA 3P7NA 4Z2YA 4Q48A 1IXRC 3BY6A 1WI9A 4JBAA 2G9WA 3GFMA 3BPVA 5JVTA 1YYVA 4O5VA 4E70A 1MJBA 3C7JA 5LRRA 1B9MA 5H6QA 4I2OA 2V6CA 2QBYA 3GYHX 1XSXA 3ZN0A 4U7DA 1F4KA 4ESJA 1W7PB 3P9CA 2HYFA 4RGSA 4ESBA 3ECOA 2E7XA 3KP5A 3EYYA 2DQLA 3CDHA 1FX7A 5D5WB 4RS8A 1Z91A 3QU6A 5E1WA 4G7HF 1U78A 3Q5FA 1R5HA 3IKTA 2VOPA 2RN7A 1ZRCA 4L18B 1XGSA 4A5NA 5A2QK 2HQNA 3I4PA 4O3MA 4LK0F 1U6GA 4KUMA 2VE8A 2Z5UA 1BI1A 3O3KA 3E6BA 2F2EA 4HA8A 1ZYRF 3NEUA 5FLXZ 2DLLA 2UXNA 4B09A 1FYMA 2HKXA 4LLNA 1I5ZA 2PEXA 3S2WA 1H0MA 2M45A 3DPTA 5E18F 1TNSA 3FXQA 3RPUA 1DPRA 3ZN1A 1O3TA 3IC7A 4AD9A 1TQMA 1XN7A 4IPAA 2HZTA 1MJ9A 3K1MA 3KE2A 1S29A 4PCQA 3E5UA 2PN6A 4JQFA 2QENA 2DK8A 2DFIA 3LAPA
chains in the Genus database with same CATH superfamily
3E3VA 3O8HA 3CC2I 3R6SA 1J9IA 3S1NJ 1YW7A 1R9TJ 5F08A 1ONVA 2HFHA 3CCLI 1R7JA 4HEA2 4OINF 1PP8F 3A03A 1FZPB 1OYIA 5DUKA 2JJ7A 4XQFA 3SEZA 2P8TA 1WH5A 3OSFA 4PGGA 2W85A 5KAIC 3BR2A 2EQRA 2WAQA 1P4AA 2AQFA 3K4JA 4IL6C 3F8FA 1J09A 3WTXC 5BNGA 1G4DA 2DT6A 2QA4I 5DM6F 1OCCH 3F23A 3NARA 4OIQF 3DV8A 3UR3C 5K7ZA 3BPXA 3D5SC 3FBIB 3HOTA 1GUUA 1LDKB 3DEWA 4LB6B 3BG5A 5CVIA 4EJVA 4BQOA 1BW5A 1UELB 1HXDA 1A04A 4KICA 3FK6A 3I71A 2JUGA 4KISA 4MGRA 4PSWA 2WY7Q 5J47A 5LGUA 3KPHA 1I3QJ 2XPVA 3ECHA 3GFIA 4UV9A 3FM5A 3DCFA 1F1ZA 1OYYA 3MMYB 3LA3A 2ZXIA 2XGEA 2FQ4A 2E1MC 2FXAA 2GXBA 2IW5A 5DDGA 5LRSA 3MZHA 3ABMH 4KIBA 3CLOA 5M3FJ 2JRMA 3CMMA 2DO7A 2EFPA 3F8NA 4HZFA 1XMXA 2V9KA 2M4KA 3DBRB 4LK1F 1I6HJ 3QPSA 3KYCB 5IOZA 2VBWA 3VODA 2GZWA 2LMDA 3L2QA 3CCSI 4J19A 6PAXA 2WV1A 5HS7A 1I1GA 1W5CC 2HWVA 5CKTA 2EZIA 4CYDA 2QQAA 1OR7A 2LG4A 2DN0A 4ANJA 4BGDA 2L9RA 1ZK8A 1QRYA 1R22A 3K70D 2X1DA 4ZDLA 5HOOA 4NHJA 1S7OA 2KHMA 3VYUB 3OYAA 3PJRA 1P6RA 3HDDA 3GBGA 2DODA 2HOEA 4RDUA 1FP2A 3H5RA 2O9LA 1T38A 2A5WA 5EJCA 1IUYA 1PVEA 2X9DA 3H5AA 1JHHA 2STTA 4C3JJ 4RB1A 2LLKA 1TW2A 5J1YA 4I0BA 2CYYA 2F4MB 2MABA 3GTQJ 5AIPA 1K78A 1OFCX 3EUHA 3K9TA 1LVKA 1QPMA 3CLQA 2PMZA 3IHUA 2QQ9A 3WTUC 1RR8C 3TW7A 3KP7A 4RLQA 3J7YJ 3DTKA 1W7PD 2AHQA 3KYDB 2OA4A 5EGOA 2EK5A 3H3UA 3H9JA 4HLYA 1ZG3A 4IHVA 3CF2A 1FP1D 3ONQA 1U5TB 1ZGJA 4HAMA 4JX4A 1LE8A 1NG7A 3SDBA 3L7WA 1P9QC 3K69A 1K6OA 1SD6A 2QWWA 2V1NA 2FMYA 3L9FA 4EM2A 3S32A 1RESA 4B3AA 2J5PA 2M7AA 3PSFA 2FEZA 1X2NA 1DU0A 3LA7A 3CCQI 1IN8A 2BXZA 3CMYA 2JA5J 2PG4A 3FDYA 1D8KA 2OTLI 3NRVA 4BACA 2IP2A 2X1EA 4RGRA 4S0HB 2DDAA 4ASNA 1ETXA 3OOPA 2R7OA 5GADJ 2H94A 3ROUA 3ISPA 2CV1A 2Z9OA 4UY8I 4XN0A 3IKVA 3PQKA 1HQCA 3ESWB 4XLNF 1QQIA 1XD7A 2K9MA 1I50J 1O4XA 1FTZA 4A3GJ 2IT0A 1ETOA 4PJJA 2VOOA 5D6EA 2K9QA 1JTYA 2DFEA 4ZZDA 4V19K 3CCYA 2GOMA 2KISA 2XROA 3TGNA 1MIJA 4XR6A 4L9NA 1BC8C 3WHBA 4GRIA 2MH2A 3LAJA 1WKMA 4EJUA 3I59A 3TKYA 1VQKI 2QQ8A 2IGNA 2VI6A 5E20A 3FXOA 3HYIA 1FOYA 2BBYA 2F6CA 1QA6A 2NS8A 1P2FA 2QQBA 2H6BA 4M3GA 3HOSA 1O3SA 1XCVA 5FGMA 4WX9A 4ENMA 5JLWA 1XG1A 2FSWA 5CPRB 2A05A 2L2OA 3OYFA 1GLNA 4G12A 3VYSB 2HOTA 2JRTA 2P0WA 2P5KA 2XF7A 3K1NA 1OLTA 1ZELA 2YSRA 4RB0A 4XKWA 4G6QA 2HTJA 3T5XA 3U1KA 4KJZA 4PFOA 2O61A 2XKOA 3OYLA 4EM1A 1SD5A 2ECBA 2LOOA 2V4JC 3H3ZA 2DCEA 3VYTB 2JSPA 5FD5A 3GX4X 1KU7A 1SC7A 1HLVA 2GXGA 3BDDA 2K7LA 4I76A 1Z6RA 2OV7A 1TT5B 3ZQFA 2KJCA 2V26A 2YX7A 1SFXA 3R60A 2ZKZA 4DYCA 1K4SA 1ZRDA 3RSNA 1EV7A 4BL0B 2CO5A 1YX5A 1J75A 1FBSA 1Q1HA 5D5VB 3V7CA 1W5TA 1YRNA 3J80K 2BY2A 1MMDA 2IBDA 2D1VA 1HA8A 2E2HJ 2LH9A 1K78B 4M72A 1S72I 1BJAA 5EZGA 1DPUA 2OAZA 2EINH 4A93J 1HOMA 4GCVA 1YIJI 2IA2A 3KLNA 3M07A 1BA5A 1FWZA 2M30A 2IS4A 2VKEA 5FROA 1S9HA 3GWZA 5EGOB 1AKHA 2ZO4A 4PJLA 5IPAA 1TL8A 2MYSA 2STWA 2NVTJ 1YHQI 4MQVA 1XPXA 1LE8B 2LREA 3HPGA 3I53A 1OCOH 4J01A 2BGCA 5IT3A 2KP6A 1IGNA 5F1JA 5F04A 5M5XJ 3KP2A 2KRFA 3MQ0A 1ON2A 1OCZH 3JRDA 2KRHA 3BLYA 4Y13A 4BXUA 2BXYA 3B73A 2PI0A 3VWBA 3E7LA 3K10A 4UHTA 1GXPA 4Q5SF 1FYKA 2FBIA 4Z6YA 4BDZA 4MFDA 1V5EA 3KLOA 1JXSA 3EDPA 3S3OA 4A3JJ 3RKYA 2QUFA 4BQQA 1APLC 3ABUA 5KCMA 1U0JA 3AFHA 1HKSA 1MBFA 4NBQA 3OYDA 3G4SI 2ZJRF 3Q9VA 3AAFA 2V1UA 1LEAA 1KONA 4X1EA 2QZ8A 4A3KJ 2M87A 4IZZA 1POGA 3F3XA 3R0AA 3HOZJ 2K3PA 1A6IA 5HVQC 1VTNC 4GYGA 3HRTA 3ZQHA 3FHNA 1TBXA 1NK3P 2QSGX 2DI3A 2KJBA 3QOPA 3Q9SA 3KIOA 3WHCA 2M2EA 4BUPA 2R3SA 2COMA 4B47A 3OIQA 2B9SA 2R7TA 5L3BA 1YJWI 4G7OF 4RGUA 4QSHA 3V7RA 2HU9A 5KK1A 4JYKA 2GQQA 2JMWA 2Q2EA 1QU3A 3BROA 5B5EC 4I0AA 2VJIA 2GA2A 2M5WA 4N0BA 4M3BA 2G7UA 2PMUA 3HHHA 5GTIC 3TO6A 3HOYJ 4BDYA 5HNHA 1YLFA 3S17J 1FSHA 3I56I 1MBEA 2ZFUA 3ZMSA 1O7FA 3BWGA 5EF6A 2B0LA 3B6AA 3OR1C 1XMAA 2OBPA 2WTEA 1IJWC 1ETWA 4W1UA 4XONA 1J0RA 1K7AA 2YU3A 2QGUA 3VSLA 4O6JA 2R7UA 2M4GA 4EV0A 2V79A 2JA8J 4UV8A 1IAWA 1SFKA 5D8KB 3M3YJ 5ILVA 4NNJA 1MKMA 2R7QA 2L54A 2PX9A 4YELA 4XLAA 4EMSA 4IHTA 5EEAA 3QOEA 2ZJQF 1MBKA 1QNTA 3EUHC 2R5ZA 1DU6A 2DMNA 2W00A 1LDJA 4CCJA 2EZLA 3AL0B 1ODDA 4N4NB 1XDSA 2CQNA 1F36A 2XRLA 2IGKA 3R61A 2P7VB 4LLGF 2TDXA 5ILSA 1LQ1A 1XC5A 4OIOF 3QU3A 2KIUA 1BM9A 2CW7A 2JVGA 3ABLH 2NOGA 2OCCH 3UNGC 3OYEA 3K6GA 2HOAA 2MFZA 4A0ZA 2FOWA 5DD8A 3CDLA 1ZLJA 2BZTA 3BR5A 1Y56A 3WTVC 2IA1A 2JK3A 3HM5A 3TW6A 3LSIA 2OQRA 4LLLA 1IV6A 2E5NA 4X6AJ 5BS6A 3FKIJ 4YIRX 4HNVA 1R49A 1AKHB 1ERDA 2R93J 1PDNC 3F9KA 1JKPC 4D0PA 3HJEA 2M8GX 2QSFX 2E71A 4XKCA 2KT0A 1KQ0A 1X1CA 1XGNA 2A6EF 3RYPA 4AIKA 2VIXA 3P5JA 2LTPA 1UG0A 1WJDA 1Z3XA 3HGGA 4AWXB 2XVCA 4NC6A 4U0VA 3KZZA 3HSRA 1HKQA 2KZVA 3GXOA 2GOXB 4XLEA 1I3AA 1MDMB 1YX3A 4G6DA 5L3FA 2BEOA 2M1BA 1W5SA 3PNTA 4M9ZA 3BJ6A 1W36D 2DJIA 1QZZA 1T8IA 1BBYA 2EV6A 3I4MJ 1S7AA 1RI7A 2D1HA 1XX5A 1YS7A 2ECCA 4KDPA 2JN6A 1N77A 1G8XA 2RKHA 3FMQA 3NAUA 3RDIA 1B4AA 3PUBA 1KYWA 2K4BA 4IRHA 1PJRA 2JZYA 1ZQ3P 2H8RA 2E36A 3SQNA 1T6SA 4I02A 3OL3A 2IVMA 2DOEA 2VONA 1IRZA 2I5UA 2EIKH 1E17A 1WJEA 5FJ8J 2HVQA 4B8XA 1IZ1A 1TC3C 2R7RA 2DA3A 2Q2EB 4WF2A 4Y15A 1K6YA 1MD0A 3KETA 2EWNA 4FX4A 5ED4A 3S1RJ 1T33A 1ITYA 4BJ6C 4TV7A 3EETA 1L0OC 2ZMEB 4M9XA 3QYFA 2GLOA 4BE1A 4MIMA 1OYWA 4ZYEA 2L5QA 3I54A 2R7XA 4IJAA 4HYEA 3W6VA 4HQMA 3PO3J 2B7EA 1Z6TA 3M7GA 3HG9A 3S8PA 3GEZA 2WV0A 1QHGA 4YEJA 1MBGA 3I3LA 1VQLI 5HLGA 4M6YA 3QWLA 2K5CA 2ZFWA 2RQPA 1D0XA 3BCAA 3HRUA 3OOUA 1GVJA 3PNVA 5JVGF 3I9V2 2KIMA 1BJZA 2IRFG 4EJWA 4BHBA 1WFXA 2X48A 2LDUA 4XOPA 3ZCOA 3IL2A 2C6YA 3HZJA 4BXXJ 2QKLB 2W57A 2R5ZB 1R5ID 3FBNB 2AXLA 4PZJA 4RBOA 1HDPA 2EV0A 4Q47A 2DTZA 2Y0MA 2VXZA 4CZZA 2E34A 2W48A 3H35A 4HV5A 1OMIA 1V54H 4HX8A 2CG4A 4LJZF 1WZ2A 2UWMA 3K0LA 2HR3A 2IS2A 5GTHC 3E5QA 4A6EA 3AG2H 4F3QA 4ZYDA 4C30A 1KU9A 3D5RC 4HV6A 4EJOA 3DFGA 4L5IA 4ZC3A 5FLXK 2BHYA 4XSXF 1D5YA 4MTDA 3Q0WA 1BIAA 2XSDC 3MKLA 2ZBKA 2KMUA 5LGNA 1DGWY 3ZPLA 1D8JA 3U2RA 1BOAA 4D7NA 4FETA 3VOEA 1EKEA 2F4OB 2ME0A 1QZYA 3BZCA 1G3YA 4L9TA 2DA5A 4IRIA 1X4OA 2ME6A 4L9JA 1ZR4A 1X4PA 2X4HA 2VJ5A 2EIJH 1J2XA 3IWFA 3A2KA 3K70C 2JA2A 4B1RA 3S2DJ 5EZHA 2ISZA 3OYJA 3KP3A 1E2XA 5K5QA 4JOMA 3CZ6A 5CLSA 4OOIA 4BY1J 3ZQGA 4K2EA 2OQGA 5J3LA 3A4CA 2EILH 3OYCA 1U5TA 2ELHA 4N4OB 2E35A 5M5WJ 2F5VA 2VKHA 4GDFA 5BPDA 1T0FA 3G71I 1YJ9I 3GLLA 4YIFA 5KVRA 1BI2A 3JW4A 2KIFA 1Z9CA 1MBJA 2QVOA 3O8GA 4II3A 4FTHA 1DDNA 5E3OA 2GIVA 3CCRI 3UKGA 1SFEA 4PDKA 2MLGA 4W97A 2L9NA 1YI2I 1MMGA 4UUTA 1IW7F 3KEYA 4BQNA 3JRCA 3NWSA 3WTZA 1FBUA 1BR4A 1RZ4A 2XAUA 1UCRA 3DQVC 1Z7LA 5CVUA 2ZB9A 4FE4A 1ZR2A 2IXSA 2H8WA 2WBMA 5DCMA 3M8JA 4BKXA 2CMPA 1ETVA 2O3FA 2CFOA 5TGTA 4XRSA 5IP9J 2PBIA 2VQLA 1YE9A 3S15J 2EH3A 2IJLA 2RC4A 3QODA 2G0EA 2K3FA 2X6XA 3MEXA 1ENHA 2CRGA 3HOWJ 5K5OA 1IN5A 2F4IA 2V9PA 2VKDA 5ERIA 4A3LJ 3FHZA 3RQ4A 5DM7F 3HTSB 2EBIA 3K4BA 3ZGKA 2J5OA 4YFXF 2FQ3A 4E7HA 1E3HA 2O03A 1S7EA 1ETYA 3Q3SA 3RKQA 1FBQA 4LOCA 3KP6A 3OS0A 2HDDA 1UG2A 2XAFA 4MTEA 1RR7A 3ZMUA 1CF7B 4BJ5C 1MSEC 1LB2A 4KFCA 5K5RA 3S1MJ 5DD4A 4E7LA 1E3OC 1BC7C 4QIWN 3HL2A 5FD6A 2BOLA 2DOFA 3ZMDA 3S2HJ 3CO7C 3SEQA 2RAEA 2Y30A 1WGXA 3ZQLA 2CQQA 3J7AO 4PJMA 4U0WA 5CVJA 2O7OA 4D9JA 3I55I 3T8TA 4MHGA 2CQKA 3SJMA 4XIDA 2R92J 5LEKA 3SYTA 3SHFA 4KMFA 2VJJA 4RA2A 4HF0A 1UB9A 1WRJA 4UB6C 4KMUX 4P9UA 3EQLF 4RAYA 4PK4A 2E2JJ 3N4MA 2VQGA 1RPWA 2YPRA 4II2A 1MBHA 3OL4A 2LF8A 3F0CA 1H8AC 3QP5A 2FF4A 2ACJA 3OYIA 3DTIA 3BG9A 2EJRA 2K9LA 1ZREA 4QPQA 2QEXI 3IAS2 3GTGJ 4XL9A 1H9GA 3HXLA 1SMTA 3OYHA 2GA1A 3OMYA 3I64A 3BR6A 5D5XB 4KIGA 2WWYA 4ABZA 1AHDP 4XRFA 1HW2A 3B6CA 1TQIA 3DKYA 3IH2A 1Y39A 2NNYA 2RDPA 4WWCA 5LHHA 1XDUA 2XF6A 3RIRA 4KITB 2ZSIB 2XAGA 4YFNF 5DUIA 4FQGA 3BP8A 3LL7A 1SAXA 2OU2A 1K83J 2K4JA 3U21A 1EH8A 3R4KA 2PLYA 4JX5A 1X19A 2LBFA 3PUFA 1TWGJ 1FLIA 5GPAA 5FLMJ 3B02A 3W2AA 4CH7A 1P4WA 1LDDA 3EUAA 2E1CA 3QRFF 3U9GA 3FM3A 1TP4A 5D6FA 3FXKA 1SAUA 4MEXF 4KA4A 2VPRA 4EJTA 3LMMA 3GCMA 1F5TA 2R5YB 2DPUA 3GUDA 1T95A 1ZH5A 4EATA 2MBFA 5E79C 2G7HA 2Y48A 5DCMB 3MZ8A 4FISA 4UXNA 3U1DA 2KDZA 4KNYA 4A3MJ 4U0YA 2E19A 2E60A 5HS8A 5BMZA 2XDVA 4P9FA 4IHSA 2XPWA 3H9GA 2XKPA 4RAGA 4DGWB 1MNMC 3ABTA 1NK2P 1MW7A 2RGVA 3E5XA 3CUQB 2DDBA 3MKWB 3W6KB 2HDCA 1J7KA 2DFHA 3K4MA 1HSJA 2OTJI 4F52A 4A0XA 3WU1B 5IY5H 3TL4X 2IGOA 1D3YA 3OSGA 3VPRA 2BY3A 3LSTA 4IRGA 5HLIA 4I7HA 1UAAA 3WTYC 5LHGA 3C18A 1GDTA 3BT9A 1JJ6C 3ZR8X 5AONA 3C2BA 4NC8A 2Y69H 2F5DA 3JREA 2XAJA 3GZ5A 4GXOA 5FFXA 1LNWA 5IYDJ 4XK4A 1Y0NA 3VFZA 5EYRA 1EH7A 1ZGAA 2O8XA 4UVBA 3L2CA 1U8BA 4AVZA 4B43A 1BI0A 1R1TA 2F5CA 1Z21A 2NAZA 4PGHA 1YIOA 2DA6A 5TRDA 2HTSA 2MH9A 2I8DA 2X6YA 1K79A 2L9SA 2FJ1A 1IRGA 1ZN2A 5EG0A 2HPMA 3E6MA 2D5VA 1ZTRA 2MLKA 3PNYA 2Q1ZB 3OS2A 1ORKA 4XOTA 4EQQA 5FB2A 2E1NA 2LD5A 3F22A 4DYQA 2L7KA 4G9YA 3SXYA 1RETA 3BR1A 4S05A 1FPQA 1YS6A 1JTXA 2LC2A 5HLHA 5BOXA 5JR3A 1MGTA 1ETQA 3S93A 4FHTA 2DYRH 2BW3A 2M0MA 2QCOA 4XLCA 5FKKA 4C3IJ 2MC4A 1XGMA 4L5EA 1Y8QB 2ZXJA 1U5TC 5TJJA 5IT9K 3GVAA 1KQ8A 5AIQA 2UUZA 3I58A 3VSKA 1CGPA 2OZUA 4HSRA 2H6CA 4P1WA 5CJ9A 2O6GE 1RC9A 1V5GA 3FK7A 1E3PA 2VB6A 1LFUP 3DXJF 4KIFA 1WJBA 4ZH4F 3RZOJ 3J80Z 1N78A 1ULYA 4NUBA 3F8CA 3SZTA 3ZRGA 2F5FA 2EFNA 4RGXA 1IRXA 1FMVA 4DBRA 1WVRA 3DU6A 3HB9A 2LBFB 1A5JA 1LFPA 3HHGA 1V4RA 3LQRA 1EA3A 2JSCA 4HBLA 3OYGA 1WJFA 2L7MP 5F64A 3V7SA 1EJ9A 4HF1A 5GPCA 1MH3A 4HX7A 1ZG5A 2DFFA 3PL8A 1XSVA 1XTAA 1MDMA 2DQRA 2A61A 2OJED 3GLXA 4AC0A 3G6EI 4JK1X 1MSFC 5D4SA 2H1LA 4WCGA 2HQ5A 5CQGA 3VDXA 4CHUA 3FIWA 2CV2A 3X2QH 4HRIA 3P9KA 3G1MA 1D1AA 4XBFA 4AIHA 4LIVA 4UNOA 3OYKA 4FE7A 2MA3A 4CUGA 2W82A 3W6JB 2H1KA 2OUMA 2XB0X 1N25A 1Z7UA 4E7JA 2CW8A 2XB5A 4C2MJ 3EUKL 1X3WB 2R7SA 4IF4A 3JTHA 1SVLA 1IF1A 3RZDJ 4HDVA 3O2PE 1B8IA 3GFLA 2PFBA 1W36C 5K1YA 2XGXA 4BE0A 3BR0A 2AQEA 3QQAA 2ESNA 3WODF 2LP0A 3CMAI 2A68F 3LSRA 4BBSJ 1G2HA 4CO8A 2CW0F 5DCFA 1U8RA 5HDKA 2CS3A 3CO6C 2DA4A 4B4CA 1NTCA 2GWRA 2ZMEA 2HQRA 4M6XA 5E8IA 5C3EJ 3PQJA 2FMLA 1TNTA 4M74A 4AYBN 1NHAA 3CCEI 2GIZA 1OR7C 2XIGA 2UZKA 3I0TA 4UUSA 2W4SA 2HI3A 3AG3H 4RAZA 4G6TB 3CESA 3ZMVA 2ZNZA 3FXRA 2YR2A 1FC3A 2KKOA 2V6EA 5CVVA 2RNGA 1T08B 4BS9A 1X1AA 2LFBA 4OIRF 2BY0A 4G8XA 4E6KG 3C3WA 1WJAA 5EG0B 1X1PA 3KYLA 5H6RA 4ESFA 4QWQA 2FX0A 1UFMA 4OAZA 1KA8A 1LVAA 4I6ZA 2QSHX 4FASD 4L9VA 2W7NA 1H89C 3ASNH 1G59A 5E1XA 3MAJA 2ZJPF 5E8GA 1Y1WJ 1FMWA 2ZXHA 3HC7A 4ZYGA 1U3EM 2M9HA 3KEQA 1SMYF 4C2UA 2BW3B 1TWCJ 3E97A 4ZJZA 3HOUJ 1XGOA 1B9NA 1W0UA 1IN7A 1C0WA 3V42A 2Y75A 4IHYA 4F91B 3DF8A 1FYLA 1IDZA 3J81Z 3KEOA 3AKZA 2X51A 2JWTA 2HS5A 2WB1N 3FXUA 2O0YA 4LMYA 2Z3YA 3RKWA 2VKVA 1RUNA 2Q8KA 4NQWB 5TISC 5LFAA 3HPHA 5EDNA 1WH7A 1LUJB 4PUSA 3S3NA 1BW6A 1WSUA 3LFUA 2DAOA 2MC3A 3BQYA 2VQHA 2VASA 3NQOA 1O57A 5M3MJ 3ZP5A 4IX7A 3H1CA 3L00A 4KN7X 4BY7J 1PUEE 4I99C 3FXLA 5EEHA 4CSWA 4FCYA 2Z99A 2PJRB 4IHXA 1H88C 1VI0A 3O6BB 3D0SA 1PYVA 1OISA 3SDGA 1YW9A 4KYWA 1SVMA 3J7ZI 1JUSA 4PFPA 3OS1A 3HTUA 1B6AA 2JPBA 4Y33A 3WTWC 3GO5A 3MWMA 3CMEI 1BI3A 1YO5C 3M1CA 3JAMZ 2BV6A 4CICA 3L2VA 1IN4A 1WJCA 3M1EA 3QYBA 3OYBA 3NWTA 5HODA 1BIBA 3GZNB 2HXOA 4A0YA 4WK8F 3BR3A 3QP6A 2L7FP 2ZJ2A 1U9NA 4I98B 4M3DA 3CP8A 4DNCA 2LKSA 3OIOA 1A6QA 1W4MA 1QZEA 2XPUA 1E0EA 1TT0A 1XCBA 2AS5F 2PJPA 2YS9A 1Z0XA 1MMSA 3DPUA 4CXFA 1RNLA 2CGPA 1GXQA 3WGIA 1SEUA 4DBQA 1MJAA 1VF9A 2EA2A 1RIOH 3DKXA 3FWEA 1VQ4I 2VC0A 2W24A 3MKZA 1B8IB 3ELKA 3MZYA 2VLAA 2XHKA 4DZPA 1HDDC 1QVUA 5HNFA 1HSTA 2MSYA 3ZMZA 3KX2A 4YIIA 4UVCA 3DEEA 1M1EB 5HDNA 4L5JA 2CFXA 3IUOA 4A12A 3QPLA 4A2UA 4LD5A 5J1RA 2DW4A 2PQ8A 1QVTA 2IEKA 1FSEA 4OMZA 2HVRA 1TZLA 1ZG1A 2P5LC 2P5VA 1QBJA 4WXHA 3BOQA 1T39A 2V9VA 2X85A 1A31A 2LKXA 2ISYA 2ZNYA 4P55A 4EVIA 4HW0A 3LSHA 2KIQA 4UUSB 1GHCA 1RKWA 5IOYA 4DW6A 5J8CA 5C4JJ 3D5LA 4DZJA 5J4VA 3F72A 3P9IA 4AYBA 1CF7A 4R79A 1K4TA 3WTSC 3DLLF 2CQXA 3HRMA 3AL0C 1JGSA 3AG4H 1XMKA 2HGCA 1R6RA 3CCUI 4RM3A 1IV8A 5D4RA 2WAFA 3PFYA 5L3DA 3A01B 5GP9A 1P7JA 5JHUA 1S5LC 2LSOA 2M34A 1ON1A 5F0FA 4EM0B 4DYRA 4RB3C 1VQOI 2KFDA 5A2QZ 2EZKA 5JFRA 2YU9J 3IP4B 2GBYA 1IXSB 5FRMA 2L4MA 4GO1A 3JRAA 3CP2A 5GAHJ 4EGYA 2DTRA 2L7ZA 4OIPF 1W0TA 2QKMB 2HKOA 2X0LA 2Q0OA 1HCRA 3GZ6A 2FE3A 2IAIA 4M3FA 4KT6A 3TQNA 4ETSA 2LK2A 2K86A 2VODA 2VBZA 2Z1DA 1SD7A 3JRBA 4P5OA 1O3RA 3BQZA 3KZIC 3TOBA 4LITA 1R00A 2E1MB 2NNNA 1XSDA 1LJ9A 1R36A 3H92A 2QM3A 2QLZA 1OCRH 3CDIA 3TOAA 3W2VA 1NG6A 2WB1A 4OU0A 4E7KA 2L9VA 2XF5A 1I39A 2I10A 2W25A 3F21A 5F0CA 2ETHA 3I5UA 2ELJA 2JA7J 1KU3A 3FF5A 4XMYA 3RKXA 5CVRA 4AM3A 1YJNI 2WC2A 3IV5A 3FMRA 3GTLJ 4F7ZA 3RTRA 1HKTA 5HDGA 3DWLE 2H27A 4IQ4A 1T98A 5J4YA 2CWEA 5B66C 1YW8A 4CCNA 4RAFA 3CTAA 2NS7A 2VUMJ 4H0EA 3GTPJ 3LSMA 4HNTA 3V4GA 4CYCA 1VQ5I 3DTEA 2JA6J 4NDLA 4EGZA 4YG2F 3CJTB 2YX4A 1SVOA 5JHFA 1SFOJ 4FX0A 3M8EA 4UVAA 2X6WA 1WCMJ 2N8GA 2ELKA 1UHMA 3BJOA 5F6FA 4A3CJ 4HDUA 3D1NI 1YITI 3KFWX 1QO0D 2IPQX 4HSTA 2R5YA 1X2MA 1R1VA 1D1CA 2ZMEC 2HQAA 2ZCWA 3HSEA 1OQYA 2WA0A 3K2ZA 3I4NJ 3HOXJ 2AXTC 1ZGWA 4ITVA 3DLAA 3E1SA 3FXJA 2BYVE 4IHWA 1XB4A 3WG9A 5LGTA 3WU0A 2FD5A 3REOA 2EZHA 5FKMA 4PSXA 2FA5A 5F1RA 4ZZLA 3AG1H 2NYXA 2NVUB 1IDYA 3RI4A 3K4CA 5H20A 3H0DA 4ON0A 2DXIA 4JX6A 3ZQQA 4S04A 3IRQA 3CJNA 3CUQA 3CQZJ 1DP7P 2FNAA 2JTVA 1F9NA 3G73A 3OYNA 2QBYB 2HXIA 2WADA 3GTJJ 4B3XA 2Y9ZA 2ICWG 2A5YB 1Z77A 2FRHA 5BQTA 2L4AA 2CH0A 4JP0A 1RUOA 2XAQA 5ICCA 5E17F 1R23A 4I09A 2JQ7A 2W84A 3F6OA 2EPFA 1FOKA 3KP4A 4QTRA 2R7FA 3MN2A 1LEBA 3GF2A 3L1PA 2P4WA 4LG3A 4FT8A 2A07F 2DMTA 1P4XA 5DS9A 4KN4X 5DYMA 3TO7A 5LLQA 1WQ2A 1G3TA 2X1CA 3L2WA 3L09A 3GW2A 1YFHA 3S1QJ 4LGWA 4PJNA 4XSZF 2A6TA 4Y4RA 4DOZA 4IOAF 4XN3A 4I01A 2DU9A 2Z2SB 4D5CA 4D7MA 2NOJB 2Y9YA 1JJ8C 2HEOA 4G7ZF 3WE3A 1FT9A 4C9YA 1GVDA 2CUEA 2W1OA 3JCUC 3VB2A 5FRNA 1WWXA 1D0ZA 2NVQJ 3LWFA 2DPDA 4E4HA 3JSPA 4IOCF 3H9QA 4MEYF 1VQ7I 4LG0A 3CCVI 9ANTA 1GV2A 4BE2A 2XRNA 1JKRC 1X58A 4U7BA 2FBHA 3KCCA 4PJ0C 2CV0A 2TRTA 2RQQA 2MG4A 1S6LA 1DUXC 1HC8A 3E6DA 5C4XJ 3MKYB 3PO2J 5CYVA 2BVMA 1DGRM 2UXXA 3K1PA 3ZQCA 3IWZA 3M8FA 1B59A 2XUBA 2HOSA 2F5EA 1HW5A 2BVLA 3WGGA 4HG2A 1DP3A 5FKOA 2PMHA 2ZXWH 4ZTFA 4GYIA 1FNNA 4BHCA 1ZARA 1JI8A 1VQNI 4MFEA 2Z33A 4BXFA 3BZ6A 4HF2A 3RPQA 1ZRFA 1MZBA 3BJAA 4OMYA 2LY9A 4E7SA 1AU7A 4F55A 5EEGA 5LBQA 1WI3A 3LQQA 1MNEA 1G3WA 1UHWA 2DK5A 2LKPA 3C2HA 4R1HA 1CQTA 3IRRA 1X1DA 4WXCA 1VQ9I 1D5VA 2D2WA 3ZMTA 1WHUA 5B1BH 4B48A 2M8EA 3HIFA 3QPHA 5C44J 1TTYA 5KHDA 1RKTA 4CYCB 4CCMA 2NRAC 5GAEJ 2VPLA 4WXDA 4IXAA 4ZYAA 1ZKGA 2OD5A 1P92A 1KYZA 1TQPA 3OIPA 2LY2A 1AWCA 3CCMI 1LKXA 1TW3A 2OC6A 2YUSA 1S3JA 2P6SA 1O3QA 1FJLA 2B63J 4LFUA 1QHHD 4MNUA 3ZQ7A 1QGPA 3RYRA 4BEHA 1IN6A 1UMQA 4XRMA 2Y2ZA 3COAC 1DQUA 1Q1VA 2FNPA 3CC4I 1Z05A 3SZGA 4BYYA 3PM1A 3LFKA 2H09A 3R0JA 1IC8A 2GM4A 3CD6I 4M3EA 3WE2A 2R7ZJ 4YFKF 2VBYA 5F27A 4XRSG 3HRSA 1TWAJ 2CU7A 1JT6A 1Z1DA 5FKLA 1ZHFA 2Z16A 1Z67A 4ZTJA 5ILUA 2LNBA 3BTIA 4MO7A 1D0YA 1HW1A 4P96A 3QAHA 2TCTA 3N97A 1O7LA 3WTTC 2O8KA 4N9HA 4L0YB 4CZCA 4X0GA 3T0YA 1BN5A 2DBBA 1JE8A 3OWTA 1Y1VJ 3C1DA 1MMAA 1ZAOA 1OKRA 1R5GA 4Y7NJ 5M5YJ 2DT7B 2QYOA 5E3LA 3CJRB 3LNQA 3ULQB 3PIPF 2E2IJ 3CUOA 4ZDOA 4C2TA 1IO2A 4IQJA 3DBLB 1OCPA 3ABKH 2VQCA 1JGGA 4RB2C 3QPTA 2VN2A 4OAYA 1IRFA 5FLVA 1Y0UA 3FX3A 5D8LB 2K02A 2XGCA 1JUMA 1USSA 2RVCA 3LSJA 4V2FA 3TP3A 4ENJA 2QF7A 1VQ8I 2HNHA 1L3LA 2L01A 3FISA 1BR1A 2CQ7A 3FZVA 1W1WE 2L02A 4KT5C 1BR2A 2A6HF 5ICFA 1FY7A 2LF7A 3K2AA 3V8JA 2DT5A 1XS9A 2MD0A 4HOBA 1WJ5A 2HYJA 4C3HJ 1I27A 2A3SA 1HBXG 3CC7I 1HF0A 4LG0B 2JT1A 3H5NA 2BHZA 4GFBA 3H36A 1U2WA 3OV8A 4XKBA 4CCOA 3SZPA 4E7IA 2NXNB 4QLCU 3KZYA 1STZA 3FKJA 3GFJA 2DJNA 3JRGA 2AO9A 2CSOA 5KAFC 1YQAA 4Y17A 5J40A 4BU2A 1UJ8A 5H2FC 1KZHA 1VFCA 3VEPA 4L0ZB 3QYEA 3F8BA 2V1XA 1T0FC 1FEXA 2JUCA 2KL4A 4E7ZA 3ML6A 1KGSA 3ZOBA 1TLHB 2XV4S 2K9SA 1KQ9A 1IUFA 3A0HC 4NQWA 3T1BA 2HZDA 4Q4ZF 2EFWA 2EV5A 1LFBA 4MQ9F 1H9TA 1G6NA 5IT9Z 3DKWA 3PSIA 1VQ6I 3ERED 5DV5A 4DQ2A 5HS9A 1J5YA 1S8NA 3HKZN 3LA2A 3V8KA 1PUFA 4BQAA 2R7WA 2PJRA 3JTGA 2NS0A 2BE5F 5J8FA 4B44A 2DA1A 2LRDA 5IP6A 2HVSA 1D1BA 3CF5F 2DYSH 5JI6A 1K61A 4UUVA 1TWHJ 2DA7A 5F0HA 3HGYA 1I6XA 5LEJA 4HQEA 1EH6A 1J59A 4ZYHA 2IS1A 2BY1A 3L2RA 4A3EJ 3TEDA 1G3SA 3BZKA 1A36A 4BEHB 4XORA 1WPKA 3VYRB 2VE9A 3MD2A 1A35A 3JRIA 5DEQA 1PP7U 4RMNA 3EYIA 3CUQC 3FXMA 3E0JB 3H3VK 2VBXA 4XLPF 4BAYA 3MFKA 2FBKA 4ENKA 5J6XA 2HYGD 3SFIA 4M73A 4U87A 4A69C 1RRJA 2K27A 1SD4A 4HNUA 3GMEA 3LSGA 1VQPI 4U88A 2VT2A 1F43A 2VJ4A 1BL0A 4BNCA 2KPMA 3LSPA 2R7VA 3PIOF 4N9IA 3TDUC 3K4LA 3T8RA 2K9NA 4AIDA 2LR8A 3A1YA 1R4NB 1R58A 4HX4A 4BH9A 2R7DA 1T56A 2Y0SN 2DMPA 2XC7A 4CA0A 3BCBA 4M71A 1UZCA 2EFQA 4XLHA 2DMUA 2P7CB 5L3EA 2ID3A 3HEFA 2DOAA 3HSFA 2VL8A 2FU4A 4DIQA 2HDWA 5GAGJ 4BJTA 1JKOC 5KNLA 5K7HA 4CGZA 1N75A 1MH4A 2ZSHB 3RQIA 1REPC 3MCZA 1OPCA 1V55H 3IAM2 2OZ6A 4XICA 1JHFA 2RNJA 3TP0A 1W7PA 1OCTC 1USTA 3WGHA 1SFUA 1B72A 5LHIA 5L3CA 3JSOA 5ICEA 4ENNA 3TBIA 3I59B 3H0GJ 2XAHA 1FTTA 2FOKA 3EPZA 2E7WA 3S14J 3TO9A 2XSJC 3PFIA 3M9AA 1R71A 3GTOJ 2KLOA 3A01A 2R0QC 1T2KA 2ADUA 4LIUA 5FFZA 3HBLA 5IYBJ 2OCEA 2EB7A 2UV1A 1GT0C 3MVPA 3C2GA 5E3NA 4R8HA 1KU2A 2Y31A 4LB5A 1JKQC 3HUGA 4A5MA 3DP7A 3V8LA 3RPUD 1YTYA 2WY8Q 4GGGA 2D45A 1ZLKA 3BTLA 1V5FA 2RV8A 3IH4A 3LOCA 4AU7A 1I1SA 1AOYA 3E6CC 2VC1A 2MD5A 3WG7H 3DEUA 2GAUA 1Z3YA 2RREA 3ASOH 2EA4A 1X3UA 4A3BJ 4M9SA 4A3FJ 2VT3A 3IH3A 5ICGA 1X1BA 2FUG2 3J81K 3F6VA 2XASA 5E1ZB 2COBA 4QPOA 5D5UB 2JVHA 5FO5A 5CQEA 2ESHA 4NB5A 3F8MA 2V7FA 4AUXA 2OPTA 1PUFB 3G3ZA 4OWRB 5FKNA 3G2BA 3K4NA 1YRNB 1FOXA 2V1DA 5IYCJ 1R1UA 1VQMI 2L3DA 3TDZC 2WAEA 1IXCA 2IS6A 2A69F 1MNDA 3HKZA 4ZDPA 5E3MA 1IG7A 3OYMA 1V3FA 2O5RA 1ACIA 2IA0A 4BHPA 2NVYJ 3Q0VA 5L3GA 2DA2A 5J1UA 2P6TA 4AVPA 3JAMK 3SFZA 5BPIA 2E5ZA 4A6DA 4CDGA 3RJPA 4G94A 4AIJA 2EFOA 2JPCA 3BC8A 3TMOA 2DMQA 5B1AH 2EIMH 5DTDA 1YG2A 4HLXA 3FMSA 1FOWA 4XNFA 1QPIA 3DPLC 5K7FA 2CUJA 4IVNA 4UB8C 1SANA 1B1BA 3P7NA 1Y6IA 4Z2YA 4Q48A 1IXRC 3BY6A 1BOBA 4H4KC 2CUZA 1WI9A 1NH3A 4JBAA 3G1LA 2G9WA 3BG3A 3DU5A 3GFMA 1MMNA 2KZGA 3K4KA 2KRCA 2WAQN 3BPVA 4RLFA 5JVTA 1YYVA 4XKVA 4O5VA 4E70A 4M6VA 4EEFG 1FIAA 1MJBA 2F48A 3C7JA 5LRRA 1B9MA 2M7BA 5H6QA 4I2OA 2Y0SA 1EF4A 2L0KA 4MLOA 2V6CA 3OY9A 2E1OA 2KDOA 4DJAA 5JLXA 2QBYA 2CUFA 3GYHX 1X3ZB 2XGDA 1XSXA 2P81A 3ZXSA 3ZN0A 4U7DA 1F4KA 4ESJA 2M3AA 4D1QA 1W7PB 1B72B 3P9CA 2HYFA 4RGSA 1P7IA 4NC7A 2R4GA 3ECOA 4Y3OA 4ESBA 4F92B 4IKFA 2E7XA 2ID6A 3KP5A 3EYYA 2DQLA 3CDHA 1FX7A 5D5WB 3ERMA 3WU2C 3J7AY 1FIPA 4RS8A 1Z91A 2OF7A 3QU6A 5E1WA 3GTKJ 4G7HF 1U78A 4HPQA 4RM2A 4XM3A 3Q5FA 3JRHA 2IGMA 3HUGB 1R5HA 2K40A 1JUPA 3IKTA 5LD2C 2VOPA 2RN7A 1ZRCA 4L18B 1XGSA 3CJQB 1GV5A 1OJLA 4A3IJ 4A5NA 5A2QK 2HQNA 3I4PA 4O3MA 4LK0F 2ZC2A 3L2UA 1U6GA 1VNDA 3M4OJ 4KUMA 2CJJA 3DBHB 3N05A 3BG7A 2VE8A 2Z5UA 3BTJA 2M0CA 4F93B 3G1OA 1BI1A 3O3KA 1LPQA 1Y8RB 4A3DJ 4CCLA 3E6BA 4BBRJ 4J00A 2K85A 2F2EA 4IEJA 1VZ0A 4HA8A 1ZYRF 1JT0A 2VXDA 3A02A 3NEUA 3Q0UA 1U9OA 2LY1A 3CCJI 5FLXZ 1YOVB 3BG6A 2DLLA 3K7AJ 2MW8A 2UXNA 4IO9F 3HOVJ 1TWFJ 4YRVA 3BTCA 4CCKA 4B09A 3JR9A 1FYMA 2LYCA 3LSKA 3S3MA 2HKXA 2GXAA 4LLNA 1I5ZA 2PMZN 1ETKA 3A0BC 2PEXA 3S2WA 2LVSA 2MGQA 2X6OA 3OR2C 1H0MA 3W2WA 2M45A 3DPTA 5E18F 1AA7A 3S16J 1TNSA 1UHSA 3GTMJ 1R4MB 3FXQA 2NVXJ 3RPUA 1DPRA 3ZQIA 3ZN1A 1O3TA 3IC7A 4AD9A 4D5FA 3W3CA 1TQMA 3RCOA 5HLTA 3JRFA 5B3SH 5IP7J 1XN7A 4IPAA 4V2GA 2HZTA 1MJ9A 3K1MA 3KE2A 1S29A 4PCQA 4XLFA 2HPIA 3E5UA 4Y52J 2PN6A 2KQRA 4JQFA 2QENA 2DK8A 2DFIA 3LAPA
chains in the Genus database with same CATH topology
3E3VA 3R6SA 1J9IA 1YW7A 1ONVA 2HFHA 1R7JA 4OINF 1PP8F 1FZPB 1OYIA 5DUKA 2P8TA 4PGGA 2W85A 1P4AA 3F8FA 3WTXC 1G4DA 3F23A 4OIQF 3DV8A 3BPXA 3HOTA 1LDKB 4LB6B 5CVIA 4EJVA 1HXDA 1A04A 4KICA 3I71A 4MGRA 5LGUA 3ECHA 3GFIA 4UV9A 3FM5A 1F1ZA 1OYYA 3LA3A 2FXAA 2GXBA 2IW5A 5DDGA 5LRSA 3MZHA 4KIBA 3CLOA 2DO7A 2EFPA 3F8NA 4HZFA 4LK1F 2VBWA 3VODA 2GZWA 6PAXA 5HS7A 1I1GA 2HWVA 4CYDA 2QQAA 1OR7A 1R22A 5HOOA 4NHJA 1S7OA 1P6RA 2HOEA 1FP2A 1T38A 1IUYA 1JHHA 2STTA 4RB1A 1TW2A 4I0BA 2CYYA 5AIPA 1K78A 3EUHA 3K9TA 1QPMA 3IHUA 2QQ9A 3WTUC 3KP7A 1W7PD 2OA4A 2EK5A 3H3UA 4HLYA 1ZG3A 1FP1D 1U5TB 1ZGJA 4HAMA 3L7WA 3K69A 1K6OA 1SD6A 2QWWA 2FMYA 3L9FA 4EM2A 2J5PA 2FEZA 3LA7A 1IN8A 2PG4A 1D8KA 3NRVA 2IP2A 4RGRA 4ASNA 3OOPA 2H94A 3ROUA 3ISPA 2Z9OA 3IKVA 3PQKA 1HQCA 4XLNF 1QQIA 1XD7A 2IT0A 2VOOA 5D6EA 4ZZDA 2XROA 3TGNA 1BC8C 4L9NA 2MH2A 3LAJA 1WKMA 4EJUA 3I59A 3TKYA 5E20A 3HYIA 2BBYA 1P2FA 2QQBA 2H6BA 3HOSA 1O3SA 1XCVA 5FGMA 4WX9A 4ENMA 2FSWA 2JRTA 2P5KA 3K1NA 4RB0A 2YSRA 4G6QA 2HTJA 3T5XA 2O61A 2XKOA 4EM1A 1SD5A 3H3ZA 5FD5A 3GX4X 1KU7A 2GXGA 3BDDA 2K7LA 1Z6RA 2KJCA 2YX7A 1SFXA 3R60A 2ZKZA 1ZRDA 1EV7A 2CO5A 1J75A 1FBSA 1Q1HA 5D5VB 3V7CA 1W5TA 3J80K 2D1VA 1K78B 4M72A 1BJAA 1DPUA 2OAZA 4GCVA 2IA2A 3KLNA 1FWZA 2M30A 3GWZA 2ZO4A 2STWA 4MQVA 3I53A 2BGCA 5IT3A 3KP2A 2KRFA 3MQ0A 1ON2A 4Y13A 4BXUA 3B73A 2PI0A 1GXPA 4UHTA 4Q5SF 1FYKA 2FBIA 3KLOA 1JXSA 3EDPA 3RKYA 2QUFA 3ABUA 1HKSA 3Q9VA 3AAFA 2V1UA 1LEAA 2QZ8A 2M87A 3F3XA 3R0AA 5HVQC 1VTNC 4GYGA 3HRTA 1TBXA 2DI3A 2KJBA 3QOPA 3Q9SA 2R3SA 2COMA 5L3BA 4G7OF 4RGUA 3V7RA 5KK1A 2GQQA 2Q2EA 3BROA 4I0AA 2GA2A 2M5WA 4N0BA 2G7UA 2PMUA 3HHHA 3TO6A 1YLFA 1FSHA 3ZMSA 1O7FA 3BWGA 2B0LA 1XMAA 2OBPA 2WTEA 1J0RA 1K7AA 2YU3A 4O6JA 4EV0A 2V79A 4UV8A 1IAWA 5D8KB 5ILVA 1MKMA 2L54A 4EMSA 4IHTA 1QNTA 1LDJA 1ODDA 1XDSA 3R61A 2P7VB 4LLGF 2TDXA 5ILSA 1LQ1A 4OIOF 3QU3A 2KIUA 1BM9A 4A0ZA 5DD8A 1ZLJA 3WTVC 2IA1A 2OQRA 4LLLA 5BS6A 1PDNC 4D0PA 1KQ0A 1XGNA 2A6EF 3RYPA 4AIKA 4AWXB 2XVCA 4U0VA 3KZZA 3HSRA 1HKQA 3GXOA 1MDMB 5L3FA 4G6DA 2BEOA 2M1BA 1W5SA 4M9ZA 3BJ6A 1QZZA 1BBYA 2EV6A 1S7AA 1RI7A 2D1HA 1YS7A 4KDPA 2RKHA 3FMQA 3RDIA 1B4AA 1KYWA 2K4BA 4IRHA 2JZYA 3SQNA 1T6SA 4I02A 2IVMA 2VONA 1E17A 4B8XA 1IZ1A 4WF2A 4Y15A 1MD0A 3KETA 2EWNA 4FX4A 5ED4A 4TV7A 3EETA 1L0OC 2ZMEB 4M9XA 1OYWA 4ZYEA 3I54A 4IJAA 4HYEA 4HQMA 1Z6TA 3M7GA 3GEZA 2WV0A 5HLGA 4M6YA 2ZFWA 2RQPA 3HRUA 1GVJA 2KIMA 2IRFG 4EJWA 4BHBA 2LDUA 2C6YA 3IL2A 2W57A 2AXLA 4PZJA 4Q47A 2EV0A 2Y0MA 2VXZA 4CZZA 4HV5A 1OMIA 4HX8A 2CG4A 4LJZF 2UWMA 3K0LA 2HR3A 3E5QA 4A6EA 4ZYDA 1KU9A 4HV6A 4EJOA 3DFGA 4L5IA 5FLXK 4XSXF 4MTDA 1BIAA 5LGNA 2ZBKA 3ZPLA 1D8JA 3U2RA 1BOAA 3VOEA 1QZYA 4L9TA 1G3YA 4IRIA 4L9JA 2X4HA 1J2XA 3IWFA 2ISZA 3KP3A 1E2XA 5K5QA 5CLSA 4OOIA 4K2EA 2OQGA 1U5TA 2ELHA 5BPDA 1T0FA 4YIFA 5KVRA 1BI2A 3JW4A 2KIFA 1Z9CA 2QVOA 1DDNA 2GIVA 1SFEA 4PDKA 2MLGA 1IW7F 3WTZA 1FBUA 1RZ4A 1UCRA 3DQVC 5CVUA 5DCMA 2O3FA 2PBIA 2IJLA 2RC4A 3MEXA 5K5OA 1IN5A 5ERIA 3FHZA 3HTSB 2J5OA 4YFXF 2FQ3A 2O03A 1FBQA 3KP6A 2XAFA 4MTEA 3ZMUA 1CF7B 1LB2A 4KFCA 5K5RA 5DD4A 1BC7C 5FD6A 3ZMDA 3CO7C 3J7AO 4U0WA 5CVJA 3T8TA 4MHGA 2CQKA 5LEKA 3SHFA 4KMFA 4HF0A 1UB9A 1WRJA 4KMUX 4P9UA 3EQLF 4RAYA 3N4MA 2YPRA 2LF8A 3QP5A 2FF4A 2ACJA 2EJRA 1ZREA 1H9GA 1SMTA 2GA1A 3I64A 5D5XB 4KIGA 2WWYA 4XRFA 1HW2A 1TQIA 2NNYA 2RDPA 4WWCA 5LHHA 1XDUA 3RIRA 2XAGA 4YFNF 5DUIA 3BP8A 1SAXA 2OU2A 2K4JA 1EH8A 3R4KA 2PLYA 1FLIA 3B02A 1P4WA 1LDDA 2E1CA 3QRFF 3U9GA 3FM3A 5D6FA 4MEXF 4KA4A 4EJTA 1F5TA 2DPUA 3GUDA 1ZH5A 2MBFA 2G7HA 2Y48A 5DCMB 4UXNA 3U1DA 4KNYA 4U0YA 5HS8A 5BMZA 4P9FA 4IHSA 2XKPA 3ABTA 2RGVA 3E5XA 3CUQB 3W6KB 2HDCA 1J7KA 1HSJA 4A0XA 3WU1B 1D3YA 4IRGA 3LSTA 5HLIA 4I7HA 3WTYC 5LHGA 3C18A 5AONA 2F5DA 2XAJA 3GZ5A 4GXOA 5FFXA 1LNWA 3VFZA 1EH7A 1ZGAA 2O8XA 4UVBA 3L2CA 1BI0A 1R1TA 2F5CA 2NAZA 4PGHA 1YIOA 5TRDA 2HTSA 2MH9A 1K79A 1IRGA 1ZN2A 3E6MA 2MLKA 4EQQA 5FB2A 2E1NA 3F22A 4G9YA 3SXYA 4S05A 1FPQA 1YS6A 5HLHA 5BOXA 5JR3A 1MGTA 4FHTA 1XGMA 2ZXJA 1U5TC 5TJJA 5IT9K 3GVAA 1KQ8A 5AIQA 3I58A 1CGPA 2OZUA 2H6CA 5CJ9A 2O6GE 3DXJF 4KIFA 4ZH4F 3J80Z 1ULYA 3F8CA 3SZTA 2F5FA 2EFNA 4RGXA 3HHGA 1V4RA 3LQRA 2JSCA 4HBLA 5F64A 3V7SA 4HF1A 4HX7A 1ZG5A 1XSVA 1MDMA 2DQRA 2A61A 3GLXA 4JK1X 5D4SA 4WCGA 4CHUA 4AIHA 3P9KA 4XBFA 4UNOA 2MA3A 3W6JB 1Z7UA 4IF4A 3JTHA 1IF1A 4HDVA 3O2PE 3GFLA 2PFBA 5K1YA 2XGXA 2ESNA 3WODF 2A68F 4CO8A 2CW0F 5DCFA 1U8RA 5HDKA 3CO6C 2GWRA 2ZMEA 2HQRA 4M6XA 5E8IA 3PQJA 2FMLA 1TNTA 4M74A 1NHAA 2XIGA 2UZKA 3I0TA 4RAZA 3ZMVA 2ZNZA 3FXRA 2YR2A 1FC3A 2KKOA 5CVVA 4OIRF 4G8XA 3C3WA 5H6RA 4ESFA 4QWQA 1UFMA 1KA8A 1LVAA 4L9VA 5E1XA 3MAJA 5E8GA 1U3EM 4ZYGA 3KEQA 1SMYF 3E97A 1XGOA 1B9NA 1C0WA 1IN7A 2Y75A 3DF8A 1FYLA 3J81Z 3KEOA 2HS5A 3FXUA 2O0YA 4LMYA 2Z3YA 3RKWA 1RUNA 2Q8KA 1WSUA 2DAOA 2MC3A 3NQOA 1O57A 3ZP5A 3L00A 4KN7X 1PUEE 5EEHA 2Z99A 3O6BB 3D0SA 1YW9A 4KYWA 3HTUA 1B6AA 2JPBA 3WTWC 3GO5A 3MWMA 1YO5C 1BI3A 3JAMZ 2BV6A 4CICA 1IN4A 3M1EA 1BIBA 4A0YA 4WK8F 3QP6A 2ZJ2A 4I98B 4DNCA 1W4MA 1XCBA 2AS5F 2PJPA 4CXFA 1RNLA 2CGPA 1GXQA 3WGIA 1MJAA 2EA2A 1RIOH 3FWEA 2VC0A 2W24A 3ELKA 3MZYA 2XHKA 1HSTA 3ZMZA 4YIIA 4UVCA 5HDNA 4L5JA 2CFXA 4A12A 4A2UA 4LD5A 2DW4A 2PQ8A 1FSEA 4OMZA 1ZG1A 2P5LC 2P5VA 1QBJA 4WXHA 3BOQA 1T39A 2V9VA 2ISYA 2ZNYA 4P55A 4EVIA 4HW0A 1GHCA 5J8CA 3D5LA 3F72A 3P9IA 1CF7A 4R79A 3WTSC 3HRMA 1JGSA 1XMKA 2HGCA 5D4RA 5L3DA 5JHUA 2LSOA 1ON1A 4EM0B 4RB3C 5A2QZ 5JFRA 1IXSB 2L4MA 4GO1A 4EGYA 2DTRA 4OIPF 2X0LA 2HKOA 2Q0OA 3GZ6A 2FE3A 3TQNA 4ETSA 2K86A 2VODA 2VBZA 1SD7A 1O3RA 4P5OA 3TOBA 1R00A 1XSDA 2NNNA 1LJ9A 1R36A 3H92A 2QM3A 2QLZA 3TOAA 4OU0A 2W25A 3F21A 2ETHA 3I5UA 1KU3A 3FF5A 3RKXA 5CVRA 2WC2A 3FMRA 4F7ZA 3RTRA 1HKTA 5HDGA 2H27A 1T98A 2CWEA 1YW8A 3CTAA 4H0EA 3V4GA 4EGZA 4YG2F 2YX4A 4FX0A 3M8EA 4UVAA 5F6FA 3BJOA 1UHMA 4HDUA 3KFWX 1QO0D 2IPQX 1R1VA 2ZCWA 3HSEA 3K2ZA 2BYVE 1XB4A 3WG9A 5LGTA 3WU0A 3REOA 2FA5A 5F1RA 4ZZLA 2NYXA 3RI4A 5H20A 4ON0A 4S04A 3IRQA 3CJNA 3CUQA 1DP7P 2FNAA 2JTVA 1F9NA 3G73A 2QBYB 2A5YB 2FRHA 5BQTA 2L4AA 1RUOA 2XAQA 5ICCA 5E17F 1R23A 4I09A 2W84A 3F6OA 1FOKA 3KP4A 2R7FA 1LEBA 3GF2A 2P4WA 4FT8A 2A07F 1P4XA 4KN4X 5DYMA 3TO7A 5LLQA 1WQ2A 1G3TA 3L09A 3GW2A 1YFHA 4LGWA 4XSZF 4I01A 2DU9A 2HEOA 4G7ZF 3WE3A 1FT9A 3VB2A 1WWXA 3LWFA 2DPDA 3JSPA 4MEYF 4LG0A 2XRNA 4U7BA 2FBHA 3KCCA 1S6LA 1DUXC 3E6DA 5CYVA 2UXXA 3K1PA 3IWZA 3M8FA 1B59A 2XUBA 2F5EA 1HW5A 3WGGA 2PMHA 4GYIA 1FNNA 4BHCA 1ZARA 2Z33A 3BZ6A 4HF2A 3RPQA 1ZRFA 1MZBA 3BJAA 4OMYA 5EEGA 5LBQA 3LQQA 1G3WA 1UHWA 2DK5A 2LKPA 4R1HA 3IRRA 4WXCA 1D5VA 2D2WA 3ZMTA 2M8EA 3HIFA 3QPHA 1TTYA 2NRAC 4WXDA 4IXAA 2OD5A 1P92A 1KYZA 1TQPA 1AWCA 1TW3A 1S3JA 2P6SA 1O3QA 4LFUA 4MNUA 3ZQ7A 1QGPA 3RYRA 1IN6A 3COAC 2FNPA 1Z05A 4BYYA 3LFKA 2H09A 3R0JA 3WE2A 4YFKF 2VBYA 3HRSA 1Z1DA 1ZHFA 5ILUA 2LNBA 1HW1A 4P96A 3QAHA 3N97A 1O7LA 3WTTC 4N9HA 4L0YB 3T0YA 1BN5A 2DBBA 1JE8A 3C1DA 1ZAOA 1OKRA 1R5GA 2QYOA 3ULQB 3CUOA 4RB2C 3QPTA 2VN2A 1IRFA 1Y0UA 3FX3A 5D8LB 2K02A 1USSA 2RVCA 4ENJA 1L3LA 2L01A 3FZVA 2L02A 4KT5C 5ICFA 2A6HF 1FY7A 2LF7A 3V8JA 2DT5A 4HOBA 1I27A 2A3SA 1HBXG 4LG0B 2JT1A 1U2WA 3OV8A 3SZPA 4QLCU 3KZYA 1STZA 3GFJA 2CSOA 1YQAA 4Y17A 3VEPA 4L0ZB 3F8BA 2V1XA 3ML6A 1KGSA 1TLHB 2XV4S 4NQWA 1KQ9A 3T1BA 2EFWA 4Q4ZF 2EV5A 4MQ9F 1H9TA 1G6NA 5IT9Z 3DKWA 3ERED 5DV5A 4DQ2A 5HS9A 1J5YA 1S8NA 3LA2A 3V8KA 4BQAA 3JTGA 2NS0A 2BE5F 5J8FA 5JI6A 4UUVA 4HQEA 1I6XA 5LEJA 1J59A 1EH6A 4ZYHA 1G3SA 2VE9A 5DEQA 1PP7U 3EYIA 3CUQC 2VBXA 4XLPF 4BAYA 3MFKA 2FBKA 4ENKA 5J6XA 2HYGD 4M73A 2K27A 1SD4A 4U88A 2VT2A 4BNCA 4N9IA 3TDUC 3T8RA 1R58A 4BH9A 4HX4A 2R7DA 4M71A 2EFQA 2P7CB 5L3EA 3HSFA 2FU4A 4CGZA 1REPC 3MCZA 1OPCA 2OZ6A 1JHFA 2RNJA 1W7PA 1USTA 3WGHA 1SFUA 5LHIA 5L3CA 3JSOA 5ICEA 4ENNA 3I59B 2XAHA 2FOKA 2E7WA 3TO9A 3PFIA 3M9AA 1T2KA 2ADUA 5FFZA 2EB7A 4R8HA 1KU2A 4LB5A 3HUGA 4A5MA 3DP7A 3V8LA 1YTYA 4GGGA 2D45A 1ZLKA 2RV8A 1I1SA 1AOYA 3E6CC 2VC1A 2MD5A 3DEUA 2GAUA 2EA4A 1X3UA 4M9SA 2VT3A 5ICGA 3J81K 3F6VA 2XASA 5E1ZB 5D5UB 5FO5A 2ESHA 4NB5A 3F8MA 3G3ZA 2V1DA 1R1UA 2L3DA 3TDZC 1IXCA 2A69F 1V3FA 2IA0A 4BHPA 5L3GA 2P6TA 4AVPA 3JAMK 3SFZA 5BPIA 4A6DA 4CDGA 3RJPA 4G94A 4AIJA 2EFOA 2JPCA 1YG2A 4HLXA 3FMSA 3DPLC 4IVNA 1B1BA 3P7NA 4Z2YA 4Q48A 1IXRC 3BY6A 1WI9A 4JBAA 2G9WA 3GFMA 3BPVA 5JVTA 1YYVA 4O5VA 4E70A 1MJBA 3C7JA 5LRRA 1B9MA 5H6QA 4I2OA 2V6CA 2QBYA 3GYHX 1XSXA 3ZN0A 4U7DA 1F4KA 4ESJA 1W7PB 3P9CA 2HYFA 4RGSA 4ESBA 3ECOA 2E7XA 3KP5A 3EYYA 2DQLA 3CDHA 1FX7A 5D5WB 4RS8A 1Z91A 3QU6A 5E1WA 4G7HF 1U78A 3Q5FA 1R5HA 3IKTA 2VOPA 2RN7A 1ZRCA 4L18B 1XGSA 4A5NA 5A2QK 2HQNA 3I4PA 4O3MA 4LK0F 1U6GA 4KUMA 2VE8A 2Z5UA 1BI1A 3O3KA 3E6BA 2F2EA 4HA8A 1ZYRF 3NEUA 5FLXZ 2DLLA 2UXNA 4B09A 1FYMA 2HKXA 4LLNA 1I5ZA 2PEXA 3S2WA 1H0MA 2M45A 3DPTA 5E18F 1TNSA 3FXQA 3RPUA 1DPRA 3ZN1A 1O3TA 3IC7A 4AD9A 1TQMA 1XN7A 4IPAA 2HZTA 1MJ9A 3K1MA 3KE2A 1S29A 4PCQA 3E5UA 2PN6A 4JQFA 2QENA 2DK8A 2DFIA 3LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3V A;  3R6S A;  1J9I A;  1YW7 A;  1ONV A;  2HFH A;  1R7J A;  4OIN F;  1PP8 F;  1FZP B;  1OYI A;  5DUK A;  2P8T A;  4PGG A;  2W85 A;  1P4A A;  3F8F A;  3WTX C;  1G4D A;  3F23 A;  4OIQ F;  3DV8 A;  3BPX A;  3HOT A;  1LDK B;  4LB6 B;  5CVI A;  4EJV A;  1HXD A;  1A04 A;  4KIC A;  3I71 A;  4MGR A;  5LGU A;  3ECH A;  3GFI A;  4UV9 A;  3FM5 A;  1F1Z A;  1OYY A;  3LA3 A;  2FXA A;  2GXB A;  2IW5 A;  5DDG A;  5LRS A;  3MZH A;  4KIB A;  3CLO A;  2DO7 A;  2EFP A;  3F8N A;  4HZF A;  4LK1 F;  2VBW A;  3VOD A;  2GZW A;  6PAX A;  5HS7 A;  1I1G A;  2HWV A;  4CYD A;  2QQA A;  1OR7 A;  1R22 A;  5HOO A;  4NHJ A;  1S7O A;  1P6R A;  2HOE A;  1FP2 A;  1T38 A;  1IUY A;  1JHH A;  2STT A;  4RB1 A;  1TW2 A;  4I0B A;  2CYY A;  5AIP A;  1K78 A;  3EUH A;  3K9T A;  1QPM A;  3IHU A;  2QQ9 A;  3WTU C;  3KP7 A;  1W7P D;  2OA4 A;  2EK5 A;  3H3U A;  4HLY A;  1ZG3 A;  1FP1 D;  1U5T B;  1ZGJ A;  4HAM A;  3L7W A;  3K69 A;  1K6O A;  1SD6 A;  2QWW A;  2FMY A;  3L9F A;  4EM2 A;  2J5P A;  2FEZ A;  3LA7 A;  1IN8 A;  2PG4 A;  1D8K A;  3NRV A;  2IP2 A;  4RGR A;  4ASN A;  3OOP A;  2H94 A;  3ROU A;  3ISP A;  2Z9O A;  3IKV A;  3PQK A;  1HQC A;  4XLN F;  1QQI A;  1XD7 A;  2IT0 A;  2VOO A;  5D6E A;  4ZZD A;  2XRO A;  3TGN A;  1BC8 C;  4L9N A;  2MH2 A;  3LAJ A;  1WKM A;  4EJU A;  3I59 A;  3TKY A;  5E20 A;  3HYI A;  2BBY A;  1P2F A;  2QQB A;  2H6B A;  3HOS A;  1O3S A;  1XCV A;  5FGM A;  4WX9 A;  4ENM A;  2FSW A;  2JRT A;  2P5K A;  3K1N A;  4RB0 A;  2YSR A;  4G6Q A;  2HTJ A;  3T5X A;  2O61 A;  2XKO A;  4EM1 A;  1SD5 A;  3H3Z A;  5FD5 A;  3GX4 X;  1KU7 A;  2GXG A;  3BDD A;  2K7L A;  1Z6R A;  2KJC A;  2YX7 A;  1SFX A;  3R60 A;  2ZKZ A;  1ZRD A;  1EV7 A;  2CO5 A;  1J75 A;  1FBS A;  1Q1H A;  5D5V B;  3V7C A;  1W5T A;  3J80 K;  2D1V A;  1K78 B;  4M72 A;  1BJA A;  1DPU A;  2OAZ A;  4GCV A;  2IA2 A;  3KLN A;  1FWZ A;  2M30 A;  3GWZ A;  2ZO4 A;  2STW A;  4MQV A;  3I53 A;  2BGC A;  5IT3 A;  3KP2 A;  2KRF A;  3MQ0 A;  1ON2 A;  4Y13 A;  4BXU A;  3B73 A;  2PI0 A;  1GXP A;  4UHT A;  4Q5S F;  1FYK A;  2FBI A;  3KLO A;  1JXS A;  3EDP A;  3RKY A;  2QUF A;  3ABU A;  1HKS A;  3Q9V A;  3AAF A;  2V1U A;  1LEA A;  2QZ8 A;  2M87 A;  3F3X A;  3R0A A;  5HVQ C;  1VTN C;  4GYG A;  3HRT A;  1TBX A;  2DI3 A;  2KJB A;  3QOP A;  3Q9S A;  2R3S A;  2COM A;  5L3B A;  4G7O F;  4RGU A;  3V7R A;  5KK1 A;  2GQQ A;  2Q2E A;  3BRO A;  4I0A A;  2GA2 A;  2M5W A;  4N0B A;  2G7U A;  2PMU A;  3HHH A;  3TO6 A;  1YLF A;  1FSH A;  3ZMS A;  1O7F A;  3BWG A;  2B0L A;  1XMA A;  2OBP A;  2WTE A;  1J0R A;  1K7A A;  2YU3 A;  4O6J A;  4EV0 A;  2V79 A;  4UV8 A;  1IAW A;  5D8K B;  5ILV A;  1MKM A;  2L54 A;  4EMS A;  4IHT A;  1QNT A;  1LDJ A;  1ODD A;  1XDS A;  3R61 A;  2P7V B;  4LLG F;  2TDX A;  5ILS A;  1LQ1 A;  4OIO F;  3QU3 A;  2KIU A;  1BM9 A;  4A0Z A;  5DD8 A;  1ZLJ A;  3WTV C;  2IA1 A;  2OQR A;  4LLL A;  5BS6 A;  1PDN C;  4D0P A;  1KQ0 A;  1XGN A;  2A6E F;  3RYP A;  4AIK A;  4AWX B;  2XVC A;  4U0V A;  3KZZ A;  3HSR A;  1HKQ A;  3GXO A;  1MDM B;  5L3F A;  4G6D A;  2BEO A;  2M1B A;  1W5S A;  4M9Z A;  3BJ6 A;  1QZZ A;  1BBY A;  2EV6 A;  1S7A A;  1RI7 A;  2D1H A;  1YS7 A;  4KDP A;  2RKH A;  3FMQ A;  3RDI A;  1B4A A;  1KYW A;  2K4B A;  4IRH A;  2JZY A;  3SQN A;  1T6S A;  4I02 A;  2IVM A;  2VON A;  1E17 A;  4B8X A;  1IZ1 A;  4WF2 A;  4Y15 A;  1MD0 A;  3KET A;  2EWN A;  4FX4 A;  5ED4 A;  4TV7 A;  3EET A;  1L0O C;  2ZME B;  4M9X A;  1OYW A;  4ZYE A;  3I54 A;  4IJA A;  4HYE A;  4HQM A;  1Z6T A;  3M7G A;  3GEZ A;  2WV0 A;  5HLG A;  4M6Y A;  2ZFW A;  2RQP A;  3HRU A;  1GVJ A;  2KIM A;  2IRF G;  4EJW A;  4BHB A;  2LDU A;  2C6Y A;  3IL2 A;  2W57 A;  2AXL A;  4PZJ A;  4Q47 A;  2EV0 A;  2Y0M A;  2VXZ A;  4CZZ A;  4HV5 A;  1OMI A;  4HX8 A;  2CG4 A;  4LJZ F;  2UWM A;  3K0L A;  2HR3 A;  3E5Q A;  4A6E A;  4ZYD A;  1KU9 A;  4HV6 A;  4EJO A;  3DFG A;  4L5I A;  5FLX K;  4XSX F;  4MTD A;  1BIA A;  5LGN A;  2ZBK A;  3ZPL A;  1D8J A;  3U2R A;  1BOA A;  3VOE A;  1QZY A;  4L9T A;  1G3Y A;  4IRI A;  4L9J A;  2X4H A;  1J2X A;  3IWF A;  2ISZ A;  3KP3 A;  1E2X A;  5K5Q A;  5CLS A;  4OOI A;  4K2E A;  2OQG A;  1U5T A;  2ELH A;  5BPD A;  1T0F A;  4YIF A;  5KVR A;  1BI2 A;  3JW4 A;  2KIF A;  1Z9C A;  2QVO A;  1DDN A;  2GIV A;  1SFE A;  4PDK A;  2MLG A;  1IW7 F;  3WTZ A;  1FBU A;  1RZ4 A;  1UCR A;  3DQV C;  5CVU A;  5DCM A;  2O3F A;  2PBI A;  2IJL A;  2RC4 A;  3MEX A;  5K5O A;  1IN5 A;  5ERI A;  3FHZ A;  3HTS B;  2J5O A;  4YFX F;  2FQ3 A;  2O03 A;  1FBQ A;  3KP6 A;  2XAF A;  4MTE A;  3ZMU A;  1CF7 B;  1LB2 A;  4KFC A;  5K5R A;  5DD4 A;  1BC7 C;  5FD6 A;  3ZMD A;  3CO7 C;  3J7A O;  4U0W A;  5CVJ A;  3T8T A;  4MHG A;  2CQK A;  5LEK A;  3SHF A;  4KMF A;  4HF0 A;  1UB9 A;  1WRJ A;  4KMU X;  4P9U A;  3EQL F;  4RAY A;  3N4M A;  2YPR A;  2LF8 A;  3QP5 A;  2FF4 A;  2ACJ A;  2EJR A;  1ZRE A;  1H9G A;  1SMT A;  2GA1 A;  3I64 A;  5D5X B;  4KIG A;  2WWY A;  4XRF A;  1HW2 A;  1TQI A;  2NNY A;  2RDP A;  4WWC A;  5LHH A;  1XDU A;  3RIR A;  2XAG A;  4YFN F;  5DUI A;  3BP8 A;  1SAX A;  2OU2 A;  2K4J A;  1EH8 A;  3R4K A;  2PLY A;  1FLI A;  3B02 A;  1P4W A;  1LDD A;  2E1C A;  3QRF F;  3U9G A;  3FM3 A;  5D6F A;  4MEX F;  4KA4 A;  4EJT A;  1F5T A;  2DPU A;  3GUD A;  1ZH5 A;  2MBF A;  2G7H A;  2Y48 A;  5DCM B;  4UXN A;  3U1D A;  4KNY A;  4U0Y A;  5HS8 A;  5BMZ A;  4P9F A;  4IHS A;  2XKP A;  3ABT A;  2RGV A;  3E5X A;  3CUQ B;  3W6K B;  2HDC A;  1J7K A;  1HSJ A;  4A0X A;  3WU1 B;  1D3Y A;  4IRG A;  3LST A;  5HLI A;  4I7H A;  3WTY C;  5LHG A;  3C18 A;  5AON A;  2F5D A;  2XAJ A;  3GZ5 A;  4GXO A;  5FFX A;  1LNW A;  3VFZ A;  1EH7 A;  1ZGA A;  2O8X A;  4UVB A;  3L2C A;  1BI0 A;  1R1T A;  2F5C A;  2NAZ A;  4PGH A;  1YIO A;  5TRD A;  2HTS A;  2MH9 A;  1K79 A;  1IRG A;  1ZN2 A;  3E6M A;  2MLK A;  4EQQ A;  5FB2 A;  2E1N A;  3F22 A;  4G9Y A;  3SXY A;  4S05 A;  1FPQ A;  1YS6 A;  5HLH A;  5BOX A;  5JR3 A;  1MGT A;  4FHT A;  1XGM A;  2ZXJ A;  1U5T C;  5TJJ A;  5IT9 K;  3GVA A;  1KQ8 A;  5AIQ A;  3I58 A;  1CGP A;  2OZU A;  2H6C A;  5CJ9 A;  2O6G E;  3DXJ F;  4KIF A;  4ZH4 F;  3J80 Z;  1ULY A;  3F8C A;  3SZT A;  2F5F A;  2EFN A;  4RGX A;  3HHG A;  1V4R A;  3LQR A;  2JSC A;  4HBL A;  5F64 A;  3V7S A;  4HF1 A;  4HX7 A;  1ZG5 A;  1XSV A;  1MDM A;  2DQR A;  2A61 A;  3GLX A;  4JK1 X;  5D4S A;  4WCG A;  4CHU A;  4AIH A;  3P9K A;  4XBF A;  4UNO A;  2MA3 A;  3W6J B;  1Z7U A;  4IF4 A;  3JTH A;  1IF1 A;  4HDV A;  3O2P E;  3GFL A;  2PFB A;  5K1Y A;  2XGX A;  2ESN A;  3WOD F;  2A68 F;  4CO8 A;  2CW0 F;  5DCF A;  1U8R A;  5HDK A;  3CO6 C;  2GWR A;  2ZME A;  2HQR A;  4M6X A;  5E8I A;  3PQJ A;  2FML A;  1TNT A;  4M74 A;  1NHA A;  2XIG A;  2UZK A;  3I0T A;  4RAZ A;  3ZMV A;  2ZNZ A;  3FXR A;  2YR2 A;  1FC3 A;  2KKO A;  5CVV A;  4OIR F;  4G8X A;  3C3W A;  5H6R A;  4ESF A;  4QWQ A;  1UFM A;  1KA8 A;  1LVA A;  4L9V A;  5E1X A;  3MAJ A;  5E8G A;  1U3E M;  4ZYG A;  3KEQ A;  1SMY F;  3E97 A;  1XGO A;  1B9N A;  1C0W A;  1IN7 A;  2Y75 A;  3DF8 A;  1FYL A;  3J81 Z;  3KEO A;  2HS5 A;  3FXU A;  2O0Y A;  4LMY A;  2Z3Y A;  3RKW A;  1RUN A;  2Q8K A;  1WSU A;  2DAO A;  2MC3 A;  3NQO A;  1O57 A;  3ZP5 A;  3L00 A;  4KN7 X;  1PUE E;  5EEH A;  2Z99 A;  3O6B B;  3D0S A;  1YW9 A;  4KYW A;  3HTU A;  1B6A A;  2JPB A;  3WTW C;  3GO5 A;  3MWM A;  1YO5 C;  1BI3 A;  3JAM Z;  2BV6 A;  4CIC A;  1IN4 A;  3M1E A;  1BIB A;  4A0Y A;  4WK8 F;  3QP6 A;  2ZJ2 A;  4I98 B;  4DNC A;  1W4M A;  1XCB A;  2AS5 F;  2PJP A;  4CXF A;  1RNL A;  2CGP A;  1GXQ A;  3WGI A;  1MJA A;  2EA2 A;  1RIO H;  3FWE A;  2VC0 A;  2W24 A;  3ELK A;  3MZY A;  2XHK A;  1HST A;  3ZMZ A;  4YII A;  4UVC A;  5HDN A;  4L5J A;  2CFX A;  4A12 A;  4A2U A;  4LD5 A;  2DW4 A;  2PQ8 A;  1FSE A;  4OMZ A;  1ZG1 A;  2P5L C;  2P5V A;  1QBJ A;  4WXH A;  3BOQ A;  1T39 A;  2V9V A;  2ISY A;  2ZNY A;  4P55 A;  4EVI A;  4HW0 A;  1GHC A;  5J8C A;  3D5L A;  3F72 A;  3P9I A;  1CF7 A;  4R79 A;  3WTS C;  3HRM A;  1JGS A;  1XMK A;  2HGC A;  5D4R A;  5L3D A;  5JHU A;  2LSO A;  1ON1 A;  4EM0 B;  4RB3 C;  5A2Q Z;  5JFR A;  1IXS B;  2L4M A;  4GO1 A;  4EGY A;  2DTR A;  4OIP F;  2X0L A;  2HKO A;  2Q0O A;  3GZ6 A;  2FE3 A;  3TQN A;  4ETS A;  2K86 A;  2VOD A;  2VBZ A;  1SD7 A;  1O3R A;  4P5O A;  3TOB A;  1R00 A;  1XSD A;  2NNN A;  1LJ9 A;  1R36 A;  3H92 A;  2QM3 A;  2QLZ A;  3TOA A;  4OU0 A;  2W25 A;  3F21 A;  2ETH A;  3I5U A;  1KU3 A;  3FF5 A;  3RKX A;  5CVR A;  2WC2 A;  3FMR A;  4F7Z A;  3RTR A;  1HKT A;  5HDG A;  2H27 A;  1T98 A;  2CWE A;  1YW8 A;  3CTA A;  4H0E A;  3V4G A;  4EGZ A;  4YG2 F;  2YX4 A;  4FX0 A;  3M8E A;  4UVA A;  5F6F A;  3BJO A;  1UHM A;  4HDU A;  3KFW X;  1QO0 D;  2IPQ X;  1R1V A;  2ZCW A;  3HSE A;  3K2Z A;  2BYV E;  1XB4 A;  3WG9 A;  5LGT A;  3WU0 A;  3REO A;  2FA5 A;  5F1R A;  4ZZL A;  2NYX A;  3RI4 A;  5H20 A;  4ON0 A;  4S04 A;  3IRQ A;  3CJN A;  3CUQ A;  1DP7 P;  2FNA A;  2JTV A;  1F9N A;  3G73 A;  2QBY B;  2A5Y B;  2FRH A;  5BQT A;  2L4A A;  1RUO A;  2XAQ A;  5ICC A;  5E17 F;  1R23 A;  4I09 A;  2W84 A;  3F6O A;  1FOK A;  3KP4 A;  2R7F A;  1LEB A;  3GF2 A;  2P4W A;  4FT8 A;  2A07 F;  1P4X A;  4KN4 X;  5DYM A;  3TO7 A;  5LLQ A;  1WQ2 A;  1G3T A;  3L09 A;  3GW2 A;  1YFH A;  4LGW A;  4XSZ F;  4I01 A;  2DU9 A;  2HEO A;  4G7Z F;  3WE3 A;  1FT9 A;  3VB2 A;  1WWX A;  3LWF A;  2DPD A;  3JSP A;  4MEY F;  4LG0 A;  2XRN A;  4U7B A;  2FBH A;  3KCC A;  1S6L A;  1DUX C;  3E6D A;  5CYV A;  2UXX A;  3K1P A;  3IWZ A;  3M8F A;  1B59 A;  2XUB A;  2F5E A;  1HW5 A;  3WGG A;  2PMH A;  4GYI A;  1FNN A;  4BHC A;  1ZAR A;  2Z33 A;  3BZ6 A;  4HF2 A;  3RPQ A;  1ZRF A;  1MZB A;  3BJA A;  4OMY A;  5EEG A;  5LBQ A;  3LQQ A;  1G3W A;  1UHW A;  2DK5 A;  2LKP A;  4R1H A;  3IRR A;  4WXC A;  1D5V A;  2D2W A;  3ZMT A;  2M8E A;  3HIF A;  3QPH A;  1TTY A;  2NRA C;  4WXD A;  4IXA A;  2OD5 A;  1P92 A;  1KYZ A;  1TQP A;  1AWC A;  1TW3 A;  1S3J A;  2P6S A;  1O3Q A;  4LFU A;  4MNU A;  3ZQ7 A;  1QGP A;  3RYR A;  1IN6 A;  3COA C;  2FNP A;  1Z05 A;  4BYY A;  3LFK A;  2H09 A;  3R0J A;  3WE2 A;  4YFK F;  2VBY A;  3HRS A;  1Z1D A;  1ZHF A;  5ILU A;  2LNB A;  1HW1 A;  4P96 A;  3QAH A;  3N97 A;  1O7L A;  3WTT C;  4N9H A;  4L0Y B;  3T0Y A;  1BN5 A;  2DBB A;  1JE8 A;  3C1D A;  1ZAO A;  1OKR A;  1R5G A;  2QYO A;  3ULQ B;  3CUO A;  4RB2 C;  3QPT A;  2VN2 A;  1IRF A;  1Y0U A;  3FX3 A;  5D8L B;  2K02 A;  1USS A;  2RVC A;  4ENJ A;  1L3L A;  2L01 A;  3FZV A;  2L02 A;  4KT5 C;  5ICF A;  2A6H F;  1FY7 A;  2LF7 A;  3V8J A;  2DT5 A;  4HOB A;  1I27 A;  2A3S A;  1HBX G;  4LG0 B;  2JT1 A;  1U2W A;  3OV8 A;  3SZP A;  4QLC U;  3KZY A;  1STZ A;  3GFJ A;  2CSO A;  1YQA A;  4Y17 A;  3VEP A;  4L0Z B;  3F8B A;  2V1X A;  3ML6 A;  1KGS A;  1TLH B;  2XV4 S;  4NQW A;  1KQ9 A;  3T1B A;  2EFW A;  4Q4Z F;  2EV5 A;  4MQ9 F;  1H9T A;  1G6N A;  5IT9 Z;  3DKW A;  3ERE D;  5DV5 A;  4DQ2 A;  5HS9 A;  1J5Y A;  1S8N A;  3LA2 A;  3V8K A;  4BQA A;  3JTG A;  2NS0 A;  2BE5 F;  5J8F A;  5JI6 A;  4UUV A;  4HQE A;  1I6X A;  5LEJ A;  1J59 A;  1EH6 A;  4ZYH A;  1G3S A;  2VE9 A;  5DEQ A;  1PP7 U;  3EYI A;  3CUQ C;  2VBX A;  4XLP F;  4BAY A;  3MFK A;  2FBK A;  4ENK A;  5J6X A;  2HYG D;  4M73 A;  2K27 A;  1SD4 A;  4U88 A;  2VT2 A;  4BNC A;  4N9I A;  3TDU C;  3T8R A;  1R58 A;  4BH9 A;  4HX4 A;  2R7D A;  4M71 A;  2EFQ A;  2P7C B;  5L3E A;  3HSF A;  2FU4 A;  4CGZ A;  1REP C;  3MCZ A;  1OPC A;  2OZ6 A;  1JHF A;  2RNJ A;  1W7P A;  1UST A;  3WGH A;  1SFU A;  5LHI A;  5L3C A;  3JSO A;  5ICE A;  4ENN A;  3I59 B;  2XAH A;  2FOK A;  2E7W A;  3TO9 A;  3PFI A;  3M9A A;  1T2K A;  2ADU A;  5FFZ A;  2EB7 A;  4R8H A;  1KU2 A;  4LB5 A;  3HUG A;  4A5M A;  3DP7 A;  3V8L A;  1YTY A;  4GGG A;  2D45 A;  1ZLK A;  2RV8 A;  1I1S A;  1AOY A;  3E6C C;  2VC1 A;  2MD5 A;  3DEU A;  2GAU A;  2EA4 A;  1X3U A;  4M9S A;  2VT3 A;  5ICG A;  3J81 K;  3F6V A;  2XAS A;  5E1Z B;  5D5U B;  5FO5 A;  2ESH A;  4NB5 A;  3F8M A;  3G3Z A;  2V1D A;  1R1U A;  2L3D A;  3TDZ C;  1IXC A;  2A69 F;  1V3F A;  2IA0 A;  4BHP A;  5L3G A;  2P6T A;  4AVP A;  3JAM K;  3SFZ A;  5BPI A;  4A6D A;  4CDG A;  3RJP A;  4G94 A;  4AIJ A;  2EFO A;  2JPC A;  1YG2 A;  4HLX A;  3FMS A;  3DPL C;  4IVN A;  1B1B A;  3P7N A;  4Z2Y A;  4Q48 A;  1IXR C;  3BY6 A;  1WI9 A;  4JBA A;  2G9W A;  3GFM A;  3BPV A;  5JVT A;  1YYV A;  4O5V A;  4E70 A;  1MJB A;  3C7J A;  5LRR A;  1B9M A;  5H6Q A;  4I2O A;  2V6C A;  2QBY A;  3GYH X;  1XSX A;  3ZN0 A;  4U7D A;  1F4K A;  4ESJ A;  1W7P B;  3P9C A;  2HYF A;  4RGS A;  4ESB A;  3ECO A;  2E7X A;  3KP5 A;  3EYY A;  2DQL A;  3CDH A;  1FX7 A;  5D5W B;  4RS8 A;  1Z91 A;  3QU6 A;  5E1W A;  4G7H F;  1U78 A;  3Q5F A;  1R5H A;  3IKT A;  2VOP A;  2RN7 A;  1ZRC A;  4L18 B;  1XGS A;  4A5N A;  5A2Q K;  2HQN A;  3I4P A;  4O3M A;  4LK0 F;  1U6G A;  4KUM A;  2VE8 A;  2Z5U A;  1BI1 A;  3O3K A;  3E6B A;  2F2E A;  4HA8 A;  1ZYR F;  3NEU A;  5FLX Z;  2DLL A;  2UXN A;  4B09 A;  1FYM A;  2HKX A;  4LLN A;  1I5Z A;  2PEX A;  3S2W A;  1H0M A;  2M45 A;  3DPT A;  5E18 F;  1TNS A;  3FXQ A;  3RPU A;  1DPR A;  3ZN1 A;  1O3T A;  3IC7 A;  4AD9 A;  1TQM A;  1XN7 A;  4IPA A;  2HZT A;  1MJ9 A;  3K1M A;  3KE2 A;  1S29 A;  4PCQ A;  3E5U A;  2PN6 A;  4JQF A;  2QEN A;  2DK8 A;  2DFI A;  3LAP A; 
#chains in the Genus database with same CATH topology
 3E3V A;  3O8H A;  3CC2 I;  3R6S A;  1J9I A;  3S1N J;  1YW7 A;  1R9T J;  5F08 A;  1ONV A;  2HFH A;  3CCL I;  1R7J A;  4HEA 2;  4OIN F;  1PP8 F;  3A03 A;  1FZP B;  1OYI A;  5DUK A;  2JJ7 A;  4XQF A;  3SEZ A;  2P8T A;  1WH5 A;  3OSF A;  4PGG A;  2W85 A;  5KAI C;  3BR2 A;  2EQR A;  2WAQ A;  1P4A A;  2AQF A;  3K4J A;  4IL6 C;  3F8F A;  1J09 A;  3WTX C;  5BNG A;  1G4D A;  2DT6 A;  2QA4 I;  5DM6 F;  1OCC H;  3F23 A;  3NAR A;  4OIQ F;  3DV8 A;  3UR3 C;  5K7Z A;  3BPX A;  3D5S C;  3FBI B;  3HOT A;  1GUU A;  1LDK B;  3DEW A;  4LB6 B;  3BG5 A;  5CVI A;  4EJV A;  4BQO A;  1BW5 A;  1UEL B;  1HXD A;  1A04 A;  4KIC A;  3FK6 A;  3I71 A;  2JUG A;  4KIS A;  4MGR A;  4PSW A;  2WY7 Q;  5J47 A;  5LGU A;  3KPH A;  1I3Q J;  2XPV A;  3ECH A;  3GFI A;  4UV9 A;  3FM5 A;  3DCF A;  1F1Z A;  1OYY A;  3MMY B;  3LA3 A;  2ZXI A;  2XGE A;  2FQ4 A;  2E1M C;  2FXA A;  2GXB A;  2IW5 A;  5DDG A;  5LRS A;  3MZH A;  3ABM H;  4KIB A;  3CLO A;  5M3F J;  2JRM A;  3CMM A;  2DO7 A;  2EFP A;  3F8N A;  4HZF A;  1XMX A;  2V9K A;  2M4K A;  3DBR B;  4LK1 F;  1I6H J;  3QPS A;  3KYC B;  5IOZ A;  2VBW A;  3VOD A;  2GZW A;  2LMD A;  3L2Q A;  3CCS I;  4J19 A;  6PAX A;  2WV1 A;  5HS7 A;  1I1G A;  1W5C C;  2HWV A;  5CKT A;  2EZI A;  4CYD A;  2QQA A;  1OR7 A;  2LG4 A;  2DN0 A;  4ANJ A;  4BGD A;  2L9R A;  1ZK8 A;  1QRY A;  1R22 A;  3K70 D;  2X1D A;  4ZDL A;  5HOO A;  4NHJ A;  1S7O A;  2KHM A;  3VYU B;  3OYA A;  3PJR A;  1P6R A;  3HDD A;  3GBG A;  2DOD A;  2HOE A;  4RDU A;  1FP2 A;  3H5R A;  2O9L A;  1T38 A;  2A5W A;  5EJC A;  1IUY A;  1PVE A;  2X9D A;  3H5A A;  1JHH A;  2STT A;  4C3J J;  4RB1 A;  2LLK A;  1TW2 A;  5J1Y A;  4I0B A;  2CYY A;  2F4M B;  2MAB A;  3GTQ J;  5AIP A;  1K78 A;  1OFC X;  3EUH A;  3K9T A;  1LVK A;  1QPM A;  3CLQ A;  2PMZ A;  3IHU A;  2QQ9 A;  3WTU C;  1RR8 C;  3TW7 A;  3KP7 A;  4RLQ A;  3J7Y J;  3DTK A;  1W7P D;  2AHQ A;  3KYD B;  2OA4 A;  5EGO A;  2EK5 A;  3H3U A;  3H9J A;  4HLY A;  1ZG3 A;  4IHV A;  3CF2 A;  1FP1 D;  3ONQ A;  1U5T B;  1ZGJ A;  4HAM A;  4JX4 A;  1LE8 A;  1NG7 A;  3SDB A;  3L7W A;  1P9Q C;  3K69 A;  1K6O A;  1SD6 A;  2QWW A;  2V1N A;  2FMY A;  3L9F A;  4EM2 A;  3S32 A;  1RES A;  4B3A A;  2J5P A;  2M7A A;  3PSF A;  2FEZ A;  1X2N A;  1DU0 A;  3LA7 A;  3CCQ I;  1IN8 A;  2BXZ A;  3CMY A;  2JA5 J;  2PG4 A;  3FDY A;  1D8K A;  2OTL I;  3NRV A;  4BAC A;  2IP2 A;  2X1E A;  4RGR A;  4S0H B;  2DDA A;  4ASN A;  1ETX A;  3OOP A;  2R7O A;  5GAD J;  2H94 A;  3ROU A;  3ISP A;  2CV1 A;  2Z9O A;  4UY8 I;  4XN0 A;  3IKV A;  3PQK A;  1HQC A;  3ESW B;  4XLN F;  1QQI A;  1XD7 A;  2K9M A;  1I50 J;  1O4X A;  1FTZ A;  4A3G J;  2IT0 A;  1ETO A;  4PJJ A;  2VOO A;  5D6E A;  2K9Q A;  1JTY A;  2DFE A;  4ZZD A;  4V19 K;  3CCY A;  2GOM A;  2KIS A;  2XRO A;  3TGN A;  1MIJ A;  4XR6 A;  4L9N A;  1BC8 C;  3WHB A;  4GRI A;  2MH2 A;  3LAJ A;  1WKM A;  4EJU A;  3I59 A;  3TKY A;  1VQK I;  2QQ8 A;  2IGN A;  2VI6 A;  5E20 A;  3FXO A;  3HYI A;  1FOY A;  2BBY A;  2F6C A;  1QA6 A;  2NS8 A;  1P2F A;  2QQB A;  2H6B A;  4M3G A;  3HOS A;  1O3S A;  1XCV A;  5FGM A;  4WX9 A;  4ENM A;  5JLW A;  1XG1 A;  2FSW A;  5CPR B;  2A05 A;  2L2O A;  3OYF A;  1GLN A;  4G12 A;  3VYS B;  2HOT A;  2JRT A;  2P0W A;  2P5K A;  2XF7 A;  3K1N A;  1OLT A;  1ZEL A;  2YSR A;  4RB0 A;  4XKW A;  4G6Q A;  2HTJ A;  3T5X A;  3U1K A;  4KJZ A;  4PFO A;  2O61 A;  2XKO A;  3OYL A;  4EM1 A;  1SD5 A;  2ECB A;  2LOO A;  2V4J C;  3H3Z A;  2DCE A;  3VYT B;  2JSP A;  5FD5 A;  3GX4 X;  1KU7 A;  1SC7 A;  1HLV A;  2GXG A;  3BDD A;  2K7L A;  4I76 A;  1Z6R A;  2OV7 A;  1TT5 B;  3ZQF A;  2KJC A;  2V26 A;  2YX7 A;  1SFX A;  3R60 A;  2ZKZ A;  4DYC A;  1K4S A;  1ZRD A;  3RSN A;  1EV7 A;  4BL0 B;  2CO5 A;  1YX5 A;  1J75 A;  1FBS A;  1Q1H A;  5D5V B;  3V7C A;  1W5T A;  1YRN A;  3J80 K;  2BY2 A;  1MMD A;  2IBD A;  2D1V A;  1HA8 A;  2E2H J;  2LH9 A;  1K78 B;  4M72 A;  1S72 I;  1BJA A;  5EZG A;  1DPU A;  2OAZ A;  2EIN H;  4A93 J;  1HOM A;  4GCV A;  1YIJ I;  2IA2 A;  3KLN A;  3M07 A;  1BA5 A;  1FWZ A;  2M30 A;  2IS4 A;  2VKE A;  5FRO A;  1S9H A;  3GWZ A;  5EGO B;  1AKH A;  2ZO4 A;  4PJL A;  5IPA A;  1TL8 A;  2MYS A;  2STW A;  2NVT J;  1YHQ I;  4MQV A;  1XPX A;  1LE8 B;  2LRE A;  3HPG A;  3I53 A;  1OCO H;  4J01 A;  2BGC A;  5IT3 A;  2KP6 A;  1IGN A;  5F1J A;  5F04 A;  5M5X J;  3KP2 A;  2KRF A;  3MQ0 A;  1ON2 A;  1OCZ H;  3JRD A;  2KRH A;  3BLY A;  4Y13 A;  4BXU A;  2BXY A;  3B73 A;  2PI0 A;  3VWB A;  3E7L A;  3K10 A;  4UHT A;  1GXP A;  4Q5S F;  1FYK A;  2FBI A;  4Z6Y A;  4BDZ A;  4MFD A;  1V5E A;  3KLO A;  1JXS A;  3EDP A;  3S3O A;  4A3J J;  3RKY A;  2QUF A;  4BQQ A;  1APL C;  3ABU A;  5KCM A;  1U0J A;  3AFH A;  1HKS A;  1MBF A;  4NBQ A;  3OYD A;  3G4S I;  2ZJR F;  3Q9V A;  3AAF A;  2V1U A;  1LEA A;  1KON A;  4X1E A;  2QZ8 A;  4A3K J;  2M87 A;  4IZZ A;  1POG A;  3F3X A;  3R0A A;  3HOZ J;  2K3P A;  1A6I A;  5HVQ C;  1VTN C;  4GYG A;  3HRT A;  3ZQH A;  3FHN A;  1TBX A;  1NK3 P;  2QSG X;  2DI3 A;  2KJB A;  3QOP A;  3Q9S A;  3KIO A;  3WHC A;  2M2E A;  4BUP A;  2R3S A;  2COM A;  4B47 A;  3OIQ A;  2B9S A;  2R7T A;  5L3B A;  1YJW I;  4G7O F;  4RGU A;  4QSH A;  3V7R A;  2HU9 A;  5KK1 A;  4JYK A;  2GQQ A;  2JMW A;  2Q2E A;  1QU3 A;  3BRO A;  5B5E C;  4I0A A;  2VJI A;  2GA2 A;  2M5W A;  4N0B A;  4M3B A;  2G7U A;  2PMU A;  3HHH A;  5GTI C;  3TO6 A;  3HOY J;  4BDY A;  5HNH A;  1YLF A;  3S17 J;  1FSH A;  3I56 I;  1MBE A;  2ZFU A;  3ZMS A;  1O7F A;  3BWG A;  5EF6 A;  2B0L A;  3B6A A;  3OR1 C;  1XMA A;  2OBP A;  2WTE A;  1IJW C;  1ETW A;  4W1U A;  4XON A;  1J0R A;  1K7A A;  2YU3 A;  2QGU A;  3VSL A;  4O6J A;  2R7U A;  2M4G A;  4EV0 A;  2V79 A;  2JA8 J;  4UV8 A;  1IAW A;  1SFK A;  5D8K B;  3M3Y J;  5ILV A;  4NNJ A;  1MKM A;  2R7Q A;  2L54 A;  2PX9 A;  4YEL A;  4XLA A;  4EMS A;  4IHT A;  5EEA A;  3QOE A;  2ZJQ F;  1MBK A;  1QNT A;  3EUH C;  2R5Z A;  1DU6 A;  2DMN A;  2W00 A;  1LDJ A;  4CCJ A;  2EZL A;  3AL0 B;  1ODD A;  4N4N B;  1XDS A;  2CQN A;  1F36 A;  2XRL A;  2IGK A;  3R61 A;  2P7V B;  4LLG F;  2TDX A;  5ILS A;  1LQ1 A;  1XC5 A;  4OIO F;  3QU3 A;  2KIU A;  1BM9 A;  2CW7 A;  2JVG A;  3ABL H;  2NOG A;  2OCC H;  3UNG C;  3OYE A;  3K6G A;  2HOA A;  2MFZ A;  4A0Z A;  2FOW A;  5DD8 A;  3CDL A;  1ZLJ A;  2BZT A;  3BR5 A;  1Y56 A;  3WTV C;  2IA1 A;  2JK3 A;  3HM5 A;  3TW6 A;  3LSI A;  2OQR A;  4LLL A;  1IV6 A;  2E5N A;  4X6A J;  5BS6 A;  3FKI J;  4YIR X;  4HNV A;  1R49 A;  1AKH B;  1ERD A;  2R93 J;  1PDN C;  3F9K A;  1JKP C;  4D0P A;  3HJE A;  2M8G X;  2QSF X;  2E71 A;  4XKC A;  2KT0 A;  1KQ0 A;  1X1C A;  1XGN A;  2A6E F;  3RYP A;  4AIK A;  2VIX A;  3P5J A;  2LTP A;  1UG0 A;  1WJD A;  1Z3X A;  3HGG A;  4AWX B;  2XVC A;  4NC6 A;  4U0V A;  3KZZ A;  3HSR A;  1HKQ A;  2KZV A;  3GXO A;  2GOX B;  4XLE A;  1I3A A;  1MDM B;  1YX3 A;  4G6D A;  5L3F A;  2BEO A;  2M1B A;  1W5S A;  3PNT A;  4M9Z A;  3BJ6 A;  1W36 D;  2DJI A;  1QZZ A;  1T8I A;  1BBY A;  2EV6 A;  3I4M J;  1S7A A;  1RI7 A;  2D1H A;  1XX5 A;  1YS7 A;  2ECC A;  4KDP A;  2JN6 A;  1N77 A;  1G8X A;  2RKH A;  3FMQ A;  3NAU A;  3RDI A;  1B4A A;  3PUB A;  1KYW A;  2K4B A;  4IRH A;  1PJR A;  2JZY A;  1ZQ3 P;  2H8R A;  2E36 A;  3SQN A;  1T6S A;  4I02 A;  3OL3 A;  2IVM A;  2DOE A;  2VON A;  1IRZ A;  2I5U A;  2EIK H;  1E17 A;  1WJE A;  5FJ8 J;  2HVQ A;  4B8X A;  1IZ1 A;  1TC3 C;  2R7R A;  2DA3 A;  2Q2E B;  4WF2 A;  4Y15 A;  1K6Y A;  1MD0 A;  3KET A;  2EWN A;  4FX4 A;  5ED4 A;  3S1R J;  1T33 A;  1ITY A;  4BJ6 C;  4TV7 A;  3EET A;  1L0O C;  2ZME B;  4M9X A;  3QYF A;  2GLO A;  4BE1 A;  4MIM A;  1OYW A;  4ZYE A;  2L5Q A;  3I54 A;  2R7X A;  4IJA A;  4HYE A;  3W6V A;  4HQM A;  3PO3 J;  2B7E A;  1Z6T A;  3M7G A;  3HG9 A;  3S8P A;  3GEZ A;  2WV0 A;  1QHG A;  4YEJ A;  1MBG A;  3I3L A;  1VQL I;  5HLG A;  4M6Y A;  3QWL A;  2K5C A;  2ZFW A;  2RQP A;  1D0X A;  3BCA A;  3HRU A;  3OOU A;  1GVJ A;  3PNV A;  5JVG F;  3I9V 2;  2KIM A;  1BJZ A;  2IRF G;  4EJW A;  4BHB A;  1WFX A;  2X48 A;  2LDU A;  4XOP A;  3ZCO A;  3IL2 A;  2C6Y A;  3HZJ A;  4BXX J;  2QKL B;  2W57 A;  2R5Z B;  1R5I D;  3FBN B;  2AXL A;  4PZJ A;  4RBO A;  1HDP A;  2EV0 A;  4Q47 A;  2DTZ A;  2Y0M A;  2VXZ A;  4CZZ A;  2E34 A;  2W48 A;  3H35 A;  4HV5 A;  1OMI A;  1V54 H;  4HX8 A;  2CG4 A;  4LJZ F;  1WZ2 A;  2UWM A;  3K0L A;  2HR3 A;  2IS2 A;  5GTH C;  3E5Q A;  4A6E A;  3AG2 H;  4F3Q A;  4ZYD A;  4C30 A;  1KU9 A;  3D5R C;  4HV6 A;  4EJO A;  3DFG A;  4L5I A;  4ZC3 A;  5FLX K;  2BHY A;  4XSX F;  1D5Y A;  4MTD A;  3Q0W A;  1BIA A;  2XSD C;  3MKL A;  2ZBK A;  2KMU A;  5LGN A;  1DGW Y;  3ZPL A;  1D8J A;  3U2R A;  1BOA A;  4D7N A;  4FET A;  3VOE A;  1EKE A;  2F4O B;  2ME0 A;  1QZY A;  3BZC A;  1G3Y A;  4L9T A;  2DA5 A;  4IRI A;  1X4O A;  2ME6 A;  4L9J A;  1ZR4 A;  1X4P A;  2X4H A;  2VJ5 A;  2EIJ H;  1J2X A;  3IWF A;  3A2K A;  3K70 C;  2JA2 A;  4B1R A;  3S2D J;  5EZH A;  2ISZ A;  3OYJ A;  3KP3 A;  1E2X A;  5K5Q A;  4JOM A;  3CZ6 A;  5CLS A;  4OOI A;  4BY1 J;  3ZQG A;  4K2E A;  2OQG A;  5J3L A;  3A4C A;  2EIL H;  3OYC A;  1U5T A;  2ELH A;  4N4O B;  2E35 A;  5M5W J;  2F5V A;  2VKH A;  4GDF A;  5BPD A;  1T0F A;  3G71 I;  1YJ9 I;  3GLL A;  4YIF A;  5KVR A;  1BI2 A;  3JW4 A;  2KIF A;  1Z9C A;  1MBJ A;  2QVO A;  3O8G A;  4II3 A;  4FTH A;  1DDN A;  5E3O A;  2GIV A;  3CCR I;  3UKG A;  1SFE A;  4PDK A;  2MLG A;  4W97 A;  2L9N A;  1YI2 I;  1MMG A;  4UUT A;  1IW7 F;  3KEY A;  4BQN A;  3JRC A;  3NWS A;  3WTZ A;  1FBU A;  1BR4 A;  1RZ4 A;  2XAU A;  1UCR A;  3DQV C;  1Z7L A;  5CVU A;  2ZB9 A;  4FE4 A;  1ZR2 A;  2IXS A;  2H8W A;  2WBM A;  5DCM A;  3M8J A;  4BKX A;  2CMP A;  1ETV A;  2O3F A;  2CFO A;  5TGT A;  4XRS A;  5IP9 J;  2PBI A;  2VQL A;  1YE9 A;  3S15 J;  2EH3 A;  2IJL A;  2RC4 A;  3QOD A;  2G0E A;  2K3F A;  2X6X A;  3MEX A;  1ENH A;  2CRG A;  3HOW J;  5K5O A;  1IN5 A;  2F4I A;  2V9P A;  2VKD A;  5ERI A;  4A3L J;  3FHZ A;  3RQ4 A;  5DM7 F;  3HTS B;  2EBI A;  3K4B A;  3ZGK A;  2J5O A;  4YFX F;  2FQ3 A;  4E7H A;  1E3H A;  2O03 A;  1S7E A;  1ETY A;  3Q3S A;  3RKQ A;  1FBQ A;  4LOC A;  3KP6 A;  3OS0 A;  2HDD A;  1UG2 A;  2XAF A;  4MTE A;  1RR7 A;  3ZMU A;  1CF7 B;  4BJ5 C;  1MSE C;  1LB2 A;  4KFC A;  5K5R A;  3S1M J;  5DD4 A;  4E7L A;  1E3O C;  1BC7 C;  4QIW N;  3HL2 A;  5FD6 A;  2BOL A;  2DOF A;  3ZMD A;  3S2H J;  3CO7 C;  3SEQ A;  2RAE A;  2Y30 A;  1WGX A;  3ZQL A;  2CQQ A;  3J7A O;  4PJM A;  4U0W A;  5CVJ A;  2O7O A;  4D9J A;  3I55 I;  3T8T A;  4MHG A;  2CQK A;  3SJM A;  4XID A;  2R92 J;  5LEK A;  3SYT A;  3SHF A;  4KMF A;  2VJJ A;  4RA2 A;  4HF0 A;  1UB9 A;  1WRJ A;  4UB6 C;  4KMU X;  4P9U A;  3EQL F;  4RAY A;  4PK4 A;  2E2J J;  3N4M A;  2VQG A;  1RPW A;  2YPR A;  4II2 A;  1MBH A;  3OL4 A;  2LF8 A;  3F0C A;  1H8A C;  3QP5 A;  2FF4 A;  2ACJ A;  3OYI A;  3DTI A;  3BG9 A;  2EJR A;  2K9L A;  1ZRE A;  4QPQ A;  2QEX I;  3IAS 2;  3GTG J;  4XL9 A;  1H9G A;  3HXL A;  1SMT A;  3OYH A;  2GA1 A;  3OMY A;  3I64 A;  3BR6 A;  5D5X B;  4KIG A;  2WWY A;  4ABZ A;  1AHD P;  4XRF A;  1HW2 A;  3B6C A;  1TQI A;  3DKY A;  3IH2 A;  1Y39 A;  2NNY A;  2RDP A;  4WWC A;  5LHH A;  1XDU A;  2XF6 A;  3RIR A;  4KIT B;  2ZSI B;  2XAG A;  4YFN F;  5DUI A;  4FQG A;  3BP8 A;  3LL7 A;  1SAX A;  2OU2 A;  1K83 J;  2K4J A;  3U21 A;  1EH8 A;  3R4K A;  2PLY A;  4JX5 A;  1X19 A;  2LBF A;  3PUF A;  1TWG J;  1FLI A;  5GPA A;  5FLM J;  3B02 A;  3W2A A;  4CH7 A;  1P4W A;  1LDD A;  3EUA A;  2E1C A;  3QRF F;  3U9G A;  3FM3 A;  1TP4 A;  5D6F A;  3FXK A;  1SAU A;  4MEX F;  4KA4 A;  2VPR A;  4EJT A;  3LMM A;  3GCM A;  1F5T A;  2R5Y B;  2DPU A;  3GUD A;  1T95 A;  1ZH5 A;  4EAT A;  2MBF A;  5E79 C;  2G7H A;  2Y48 A;  5DCM B;  3MZ8 A;  4FIS A;  4UXN A;  3U1D A;  2KDZ A;  4KNY A;  4A3M J;  4U0Y A;  2E19 A;  2E60 A;  5HS8 A;  5BMZ A;  2XDV A;  4P9F A;  4IHS A;  2XPW A;  3H9G A;  2XKP A;  4RAG A;  4DGW B;  1MNM C;  3ABT A;  1NK2 P;  1MW7 A;  2RGV A;  3E5X A;  3CUQ B;  2DDB A;  3MKW B;  3W6K B;  2HDC A;  1J7K A;  2DFH A;  3K4M A;  1HSJ A;  2OTJ I;  4F52 A;  4A0X A;  3WU1 B;  5IY5 H;  3TL4 X;  2IGO A;  1D3Y A;  3OSG A;  3VPR A;  2BY3 A;  3LST A;  4IRG A;  5HLI A;  4I7H A;  1UAA A;  3WTY C;  5LHG A;  3C18 A;  1GDT A;  3BT9 A;  1JJ6 C;  3ZR8 X;  5AON A;  3C2B A;  4NC8 A;  2Y69 H;  2F5D A;  3JRE A;  2XAJ A;  3GZ5 A;  4GXO A;  5FFX A;  1LNW A;  5IYD J;  4XK4 A;  1Y0N A;  3VFZ A;  5EYR A;  1EH7 A;  1ZGA A;  2O8X A;  4UVB A;  3L2C A;  1U8B A;  4AVZ A;  4B43 A;  1BI0 A;  1R1T A;  2F5C A;  1Z21 A;  2NAZ A;  4PGH A;  1YIO A;  2DA6 A;  5TRD A;  2HTS A;  2MH9 A;  2I8D A;  2X6Y A;  1K79 A;  2L9S A;  2FJ1 A;  1IRG A;  1ZN2 A;  5EG0 A;  2HPM A;  3E6M A;  2D5V A;  1ZTR A;  2MLK A;  3PNY A;  2Q1Z B;  3OS2 A;  1ORK A;  4XOT A;  4EQQ A;  5FB2 A;  2E1N A;  2LD5 A;  3F22 A;  4DYQ A;  2L7K A;  4G9Y A;  3SXY A;  1RET A;  3BR1 A;  4S05 A;  1FPQ A;  1YS6 A;  1JTX A;  2LC2 A;  5HLH A;  5BOX A;  5JR3 A;  1MGT A;  1ETQ A;  3S93 A;  4FHT A;  2DYR H;  2BW3 A;  2M0M A;  2QCO A;  4XLC A;  5FKK A;  4C3I J;  2MC4 A;  1XGM A;  4L5E A;  1Y8Q B;  2ZXJ A;  1U5T C;  5TJJ A;  5IT9 K;  3GVA A;  1KQ8 A;  5AIQ A;  2UUZ A;  3I58 A;  3VSK A;  1CGP A;  2OZU A;  4HSR A;  2H6C A;  4P1W A;  5CJ9 A;  2O6G E;  1RC9 A;  1V5G A;  3FK7 A;  1E3P A;  2VB6 A;  1LFU P;  3DXJ F;  4KIF A;  1WJB A;  4ZH4 F;  3RZO J;  3J80 Z;  1N78 A;  1ULY A;  4NUB A;  3F8C A;  3SZT A;  3ZRG A;  2F5F A;  2EFN A;  4RGX A;  1IRX A;  1FMV A;  4DBR A;  1WVR A;  3DU6 A;  3HB9 A;  2LBF B;  1A5J A;  1LFP A;  3HHG A;  1V4R A;  3LQR A;  1EA3 A;  2JSC A;  4HBL A;  3OYG A;  1WJF A;  2L7M P;  5F64 A;  3V7S A;  1EJ9 A;  4HF1 A;  5GPC A;  1MH3 A;  4HX7 A;  1ZG5 A;  2DFF A;  3PL8 A;  1XSV A;  1XTA A;  1MDM A;  2DQR A;  2A61 A;  2OJE D;  3GLX A;  4AC0 A;  3G6E I;  4JK1 X;  1MSF C;  5D4S A;  2H1L A;  4WCG A;  2HQ5 A;  5CQG A;  3VDX A;  4CHU A;  3FIW A;  2CV2 A;  3X2Q H;  4HRI A;  3P9K A;  3G1M A;  1D1A A;  4XBF A;  4AIH A;  4LIV A;  4UNO A;  3OYK A;  4FE7 A;  2MA3 A;  4CUG A;  2W82 A;  3W6J B;  2H1K A;  2OUM A;  2XB0 X;  1N25 A;  1Z7U A;  4E7J A;  2CW8 A;  2XB5 A;  4C2M J;  3EUK L;  1X3W B;  2R7S A;  4IF4 A;  3JTH A;  1SVL A;  1IF1 A;  3RZD J;  4HDV A;  3O2P E;  1B8I A;  3GFL A;  2PFB A;  1W36 C;  5K1Y A;  2XGX A;  4BE0 A;  3BR0 A;  2AQE A;  3QQA A;  2ESN A;  3WOD F;  2LP0 A;  3CMA I;  2A68 F;  3LSR A;  4BBS J;  1G2H A;  4CO8 A;  2CW0 F;  5DCF A;  1U8R A;  5HDK A;  2CS3 A;  3CO6 C;  2DA4 A;  4B4C A;  1NTC A;  2GWR A;  2ZME A;  2HQR A;  4M6X A;  5E8I A;  5C3E J;  3PQJ A;  2FML A;  1TNT A;  4M74 A;  4AYB N;  1NHA A;  3CCE I;  2GIZ A;  1OR7 C;  2XIG A;  2UZK A;  3I0T A;  4UUS A;  2W4S A;  2HI3 A;  3AG3 H;  4RAZ A;  4G6T B;  3CES A;  3ZMV A;  2ZNZ A;  3FXR A;  2YR2 A;  1FC3 A;  2KKO A;  2V6E A;  5CVV A;  2RNG A;  1T08 B;  4BS9 A;  1X1A A;  2LFB A;  4OIR F;  2BY0 A;  4G8X A;  4E6K G;  3C3W A;  1WJA A;  5EG0 B;  1X1P A;  3KYL A;  5H6R A;  4ESF A;  4QWQ A;  2FX0 A;  1UFM A;  4OAZ A;  1KA8 A;  1LVA A;  4I6Z A;  2QSH X;  4FAS D;  4L9V A;  2W7N A;  1H89 C;  3ASN H;  1G59 A;  5E1X A;  3MAJ A;  2ZJP F;  5E8G A;  1Y1W J;  1FMW A;  2ZXH A;  3HC7 A;  4ZYG A;  1U3E M;  2M9H A;  3KEQ A;  1SMY F;  4C2U A;  2BW3 B;  1TWC J;  3E97 A;  4ZJZ A;  3HOU J;  1XGO A;  1B9N A;  1W0U A;  1IN7 A;  1C0W A;  3V42 A;  2Y75 A;  4IHY A;  4F91 B;  3DF8 A;  1FYL A;  1IDZ A;  3J81 Z;  3KEO A;  3AKZ A;  2X51 A;  2JWT A;  2HS5 A;  2WB1 N;  3FXU A;  2O0Y A;  4LMY A;  2Z3Y A;  3RKW A;  2VKV A;  1RUN A;  2Q8K A;  4NQW B;  5TIS C;  5LFA A;  3HPH A;  5EDN A;  1WH7 A;  1LUJ B;  4PUS A;  3S3N A;  1BW6 A;  1WSU A;  3LFU A;  2DAO A;  2MC3 A;  3BQY A;  2VQH A;  2VAS A;  3NQO A;  1O57 A;  5M3M J;  3ZP5 A;  4IX7 A;  3H1C A;  3L00 A;  4KN7 X;  4BY7 J;  1PUE E;  4I99 C;  3FXL A;  5EEH A;  4CSW A;  4FCY A;  2Z99 A;  2PJR B;  4IHX A;  1H88 C;  1VI0 A;  3O6B B;  3D0S A;  1PYV A;  1OIS A;  3SDG A;  1YW9 A;  4KYW A;  1SVM A;  3J7Z I;  1JUS A;  4PFP A;  3OS1 A;  3HTU A;  1B6A A;  2JPB A;  4Y33 A;  3WTW C;  3GO5 A;  3MWM A;  3CME I;  1BI3 A;  1YO5 C;  3M1C A;  3JAM Z;  2BV6 A;  4CIC A;  3L2V A;  1IN4 A;  1WJC A;  3M1E A;  3QYB A;  3OYB A;  3NWT A;  5HOD A;  1BIB A;  3GZN B;  2HXO A;  4A0Y A;  4WK8 F;  3BR3 A;  3QP6 A;  2L7F P;  2ZJ2 A;  1U9N A;  4I98 B;  4M3D A;  3CP8 A;  4DNC A;  2LKS A;  3OIO A;  1A6Q A;  1W4M A;  1QZE A;  2XPU A;  1E0E A;  1TT0 A;  1XCB A;  2AS5 F;  2PJP A;  2YS9 A;  1Z0X A;  1MMS A;  3DPU A;  4CXF A;  1RNL A;  2CGP A;  1GXQ A;  3WGI A;  1SEU A;  4DBQ A;  1MJA A;  1VF9 A;  2EA2 A;  1RIO H;  3DKX A;  3FWE A;  1VQ4 I;  2VC0 A;  2W24 A;  3MKZ A;  1B8I B;  3ELK A;  3MZY A;  2VLA A;  2XHK A;  4DZP A;  1HDD C;  1QVU A;  5HNF A;  1HST A;  2MSY A;  3ZMZ A;  3KX2 A;  4YII A;  4UVC A;  3DEE A;  1M1E B;  5HDN A;  4L5J A;  2CFX A;  3IUO A;  4A12 A;  3QPL A;  4A2U A;  4LD5 A;  5J1R A;  2DW4 A;  2PQ8 A;  1QVT A;  2IEK A;  1FSE A;  4OMZ A;  2HVR A;  1TZL A;  1ZG1 A;  2P5L C;  2P5V A;  1QBJ A;  4WXH A;  3BOQ A;  1T39 A;  2V9V A;  2X85 A;  1A31 A;  2LKX A;  2ISY A;  2ZNY A;  4P55 A;  4EVI A;  4HW0 A;  3LSH A;  2KIQ A;  4UUS B;  1GHC A;  1RKW A;  5IOY A;  4DW6 A;  5J8C A;  5C4J J;  3D5L A;  4DZJ A;  5J4V A;  3F72 A;  3P9I A;  4AYB A;  1CF7 A;  4R79 A;  1K4T A;  3WTS C;  3DLL F;  2CQX A;  3HRM A;  3AL0 C;  1JGS A;  3AG4 H;  1XMK A;  2HGC A;  1R6R A;  3CCU I;  4RM3 A;  1IV8 A;  5D4R A;  2WAF A;  3PFY A;  5L3D A;  3A01 B;  5GP9 A;  1P7J A;  5JHU A;  1S5L C;  2LSO A;  2M34 A;  1ON1 A;  5F0F A;  4EM0 B;  4DYR A;  4RB3 C;  1VQO I;  2KFD A;  5A2Q Z;  2EZK A;  5JFR A;  2YU9 J;  3IP4 B;  2GBY A;  1IXS B;  5FRM A;  2L4M A;  4GO1 A;  3JRA A;  3CP2 A;  5GAH J;  4EGY A;  2DTR A;  2L7Z A;  4OIP F;  1W0T A;  2QKM B;  2HKO A;  2X0L A;  2Q0O A;  1HCR A;  3GZ6 A;  2FE3 A;  2IAI A;  4M3F A;  4KT6 A;  3TQN A;  4ETS A;  2LK2 A;  2K86 A;  2VOD A;  2VBZ A;  2Z1D A;  1SD7 A;  3JRB A;  4P5O A;  1O3R A;  3BQZ A;  3KZI C;  3TOB A;  4LIT A;  1R00 A;  2E1M B;  2NNN A;  1XSD A;  1LJ9 A;  1R36 A;  3H92 A;  2QM3 A;  2QLZ A;  1OCR H;  3CDI A;  3TOA A;  3W2V A;  1NG6 A;  2WB1 A;  4OU0 A;  4E7K A;  2L9V A;  2XF5 A;  1I39 A;  2I10 A;  2W25 A;  3F21 A;  5F0C A;  2ETH A;  3I5U A;  2ELJ A;  2JA7 J;  1KU3 A;  3FF5 A;  4XMY A;  3RKX A;  5CVR A;  4AM3 A;  1YJN I;  2WC2 A;  3IV5 A;  3FMR A;  3GTL J;  4F7Z A;  3RTR A;  1HKT A;  5HDG A;  3DWL E;  2H27 A;  4IQ4 A;  1T98 A;  5J4Y A;  2CWE A;  5B66 C;  1YW8 A;  4CCN A;  4RAF A;  3CTA A;  2NS7 A;  2VUM J;  4H0E A;  3GTP J;  3LSM A;  4HNT A;  3V4G A;  4CYC A;  1VQ5 I;  3DTE A;  2JA6 J;  4NDL A;  4EGZ A;  4YG2 F;  3CJT B;  2YX4 A;  1SVO A;  5JHF A;  1SFO J;  4FX0 A;  3M8E A;  4UVA A;  2X6W A;  1WCM J;  2N8G A;  2ELK A;  1UHM A;  3BJO A;  5F6F A;  4A3C J;  4HDU A;  3D1N I;  1YIT I;  3KFW X;  1QO0 D;  2IPQ X;  4HST A;  2R5Y A;  1X2M A;  1R1V A;  1D1C A;  2ZME C;  2HQA A;  2ZCW A;  3HSE A;  1OQY A;  2WA0 A;  3K2Z A;  3I4N J;  3HOX J;  2AXT C;  1ZGW A;  4ITV A;  3DLA A;  3E1S A;  3FXJ A;  2BYV E;  4IHW A;  1XB4 A;  3WG9 A;  5LGT A;  3WU0 A;  2FD5 A;  3REO A;  2EZH A;  5FKM A;  4PSX A;  2FA5 A;  5F1R A;  4ZZL A;  3AG1 H;  2NYX A;  2NVU B;  1IDY A;  3RI4 A;  3K4C A;  5H20 A;  3H0D A;  4ON0 A;  2DXI A;  4JX6 A;  3ZQQ A;  4S04 A;  3IRQ A;  3CJN A;  3CUQ A;  3CQZ J;  1DP7 P;  2FNA A;  2JTV A;  1F9N A;  3G73 A;  3OYN A;  2QBY B;  2HXI A;  2WAD A;  3GTJ J;  4B3X A;  2Y9Z A;  2ICW G;  2A5Y B;  1Z77 A;  2FRH A;  5BQT A;  2L4A A;  2CH0 A;  4JP0 A;  1RUO A;  2XAQ A;  5ICC A;  5E17 F;  1R23 A;  4I09 A;  2JQ7 A;  2W84 A;  3F6O A;  2EPF A;  1FOK A;  3KP4 A;  4QTR A;  2R7F A;  3MN2 A;  1LEB A;  3GF2 A;  3L1P A;  2P4W A;  4LG3 A;  4FT8 A;  2A07 F;  2DMT A;  1P4X A;  5DS9 A;  4KN4 X;  5DYM A;  3TO7 A;  5LLQ A;  1WQ2 A;  1G3T A;  2X1C A;  3L2W A;  3L09 A;  3GW2 A;  1YFH A;  3S1Q J;  4LGW A;  4PJN A;  4XSZ F;  2A6T A;  4Y4R A;  4DOZ A;  4IOA F;  4XN3 A;  4I01 A;  2DU9 A;  2Z2S B;  4D5C A;  4D7M A;  2NOJ B;  2Y9Y A;  1JJ8 C;  2HEO A;  4G7Z F;  3WE3 A;  1FT9 A;  4C9Y A;  1GVD A;  2CUE A;  2W1O A;  3JCU C;  3VB2 A;  5FRN A;  1WWX A;  1D0Z A;  2NVQ J;  3LWF A;  2DPD A;  4E4H A;  3JSP A;  4IOC F;  3H9Q A;  4MEY F;  1VQ7 I;  4LG0 A;  3CCV I;  9ANT A;  1GV2 A;  4BE2 A;  2XRN A;  1JKR C;  1X58 A;  4U7B A;  2FBH A;  3KCC A;  4PJ0 C;  2CV0 A;  2TRT A;  2RQQ A;  2MG4 A;  1S6L A;  1DUX C;  1HC8 A;  3E6D A;  5C4X J;  3MKY B;  3PO2 J;  5CYV A;  2BVM A;  1DGR M;  2UXX A;  3K1P A;  3ZQC A;  3IWZ A;  3M8F A;  1B59 A;  2XUB A;  2HOS A;  2F5E A;  1HW5 A;  2BVL A;  3WGG A;  4HG2 A;  1DP3 A;  5FKO A;  2PMH A;  2ZXW H;  4ZTF A;  4GYI A;  1FNN A;  4BHC A;  1ZAR A;  1JI8 A;  1VQN I;  4MFE A;  2Z33 A;  4BXF A;  3BZ6 A;  4HF2 A;  3RPQ A;  1ZRF A;  1MZB A;  3BJA A;  4OMY A;  2LY9 A;  4E7S A;  1AU7 A;  4F55 A;  5EEG A;  5LBQ A;  1WI3 A;  3LQQ A;  1MNE A;  1G3W A;  1UHW A;  2DK5 A;  2LKP A;  3C2H A;  4R1H A;  1CQT A;  3IRR A;  1X1D A;  4WXC A;  1VQ9 I;  1D5V A;  2D2W A;  3ZMT A;  1WHU A;  5B1B H;  4B48 A;  2M8E A;  3HIF A;  3QPH A;  5C44 J;  1TTY A;  5KHD A;  1RKT A;  4CYC B;  4CCM A;  2NRA C;  5GAE J;  2VPL A;  4WXD A;  4IXA A;  4ZYA A;  1ZKG A;  2OD5 A;  1P92 A;  1KYZ A;  1TQP A;  3OIP A;  2LY2 A;  1AWC A;  3CCM I;  1LKX A;  1TW3 A;  2OC6 A;  2YUS A;  1S3J A;  2P6S A;  1O3Q A;  1FJL A;  2B63 J;  4LFU A;  1QHH D;  4MNU A;  3ZQ7 A;  1QGP A;  3RYR A;  4BEH A;  1IN6 A;  1UMQ A;  4XRM A;  2Y2Z A;  3COA C;  1DQU A;  1Q1V A;  2FNP A;  3CC4 I;  1Z05 A;  3SZG A;  4BYY A;  3PM1 A;  3LFK A;  2H09 A;  3R0J A;  1IC8 A;  2GM4 A;  3CD6 I;  4M3E A;  3WE2 A;  2R7Z J;  4YFK F;  2VBY A;  5F27 A;  4XRS G;  3HRS A;  1TWA J;  2CU7 A;  1JT6 A;  1Z1D A;  5FKL A;  1ZHF A;  2Z16 A;  1Z67 A;  4ZTJ A;  5ILU A;  2LNB A;  3BTI A;  4MO7 A;  1D0Y A;  1HW1 A;  4P96 A;  3QAH A;  2TCT A;  3N97 A;  1O7L A;  3WTT C;  2O8K A;  4N9H A;  4L0Y B;  4CZC A;  4X0G A;  3T0Y A;  1BN5 A;  2DBB A;  1JE8 A;  3OWT A;  1Y1V J;  3C1D A;  1MMA A;  1ZAO A;  1OKR A;  1R5G A;  4Y7N J;  5M5Y J;  2DT7 B;  2QYO A;  5E3L A;  3CJR B;  3LNQ A;  3ULQ B;  3PIP F;  2E2I J;  3CUO A;  4ZDO A;  4C2T A;  1IO2 A;  4IQJ A;  3DBL B;  1OCP A;  3ABK H;  2VQC A;  1JGG A;  4RB2 C;  3QPT A;  2VN2 A;  4OAY A;  1IRF A;  5FLV A;  1Y0U A;  3FX3 A;  5D8L B;  2K02 A;  2XGC A;  1JUM A;  1USS A;  2RVC A;  3LSJ A;  4V2F A;  3TP3 A;  4ENJ A;  2QF7 A;  1VQ8 I;  2HNH A;  1L3L A;  2L01 A;  3FIS A;  1BR1 A;  2CQ7 A;  3FZV A;  1W1W E;  2L02 A;  4KT5 C;  1BR2 A;  2A6H F;  5ICF A;  1FY7 A;  2LF7 A;  3K2A A;  3V8J A;  2DT5 A;  1XS9 A;  2MD0 A;  4HOB A;  1WJ5 A;  2HYJ A;  4C3H J;  1I27 A;  2A3S A;  1HBX G;  3CC7 I;  1HF0 A;  4LG0 B;  2JT1 A;  3H5N A;  2BHZ A;  4GFB A;  3H36 A;  1U2W A;  3OV8 A;  4XKB A;  4CCO A;  3SZP A;  4E7I A;  2NXN B;  4QLC U;  3KZY A;  1STZ A;  3FKJ A;  3GFJ A;  2DJN A;  3JRG A;  2AO9 A;  2CSO A;  5KAF C;  1YQA A;  4Y17 A;  5J40 A;  4BU2 A;  1UJ8 A;  5H2F C;  1KZH A;  1VFC A;  3VEP A;  4L0Z B;  3QYE A;  3F8B A;  2V1X A;  1T0F C;  1FEX A;  2JUC A;  2KL4 A;  4E7Z A;  3ML6 A;  1KGS A;  3ZOB A;  1TLH B;  2XV4 S;  2K9S A;  1KQ9 A;  1IUF A;  3A0H C;  4NQW A;  3T1B A;  2HZD A;  4Q4Z F;  2EFW A;  2EV5 A;  1LFB A;  4MQ9 F;  1H9T A;  1G6N A;  5IT9 Z;  3DKW A;  3PSI A;  1VQ6 I;  3ERE D;  5DV5 A;  4DQ2 A;  5HS9 A;  1J5Y A;  1S8N A;  3HKZ N;  3LA2 A;  3V8K A;  1PUF A;  4BQA A;  2R7W A;  2PJR A;  3JTG A;  2NS0 A;  2BE5 F;  5J8F A;  4B44 A;  2DA1 A;  2LRD A;  5IP6 A;  2HVS A;  1D1B A;  3CF5 F;  2DYS H;  5JI6 A;  1K61 A;  4UUV A;  1TWH J;  2DA7 A;  5F0H A;  3HGY A;  1I6X A;  5LEJ A;  4HQE A;  1EH6 A;  1J59 A;  4ZYH A;  2IS1 A;  2BY1 A;  3L2R A;  4A3E J;  3TED A;  1G3S A;  3BZK A;  1A36 A;  4BEH B;  4XOR A;  1WPK A;  3VYR B;  2VE9 A;  3MD2 A;  1A35 A;  3JRI A;  5DEQ A;  1PP7 U;  4RMN A;  3EYI A;  3CUQ C;  3FXM A;  3E0J B;  3H3V K;  2VBX A;  4XLP F;  4BAY A;  3MFK A;  2FBK A;  4ENK A;  5J6X A;  2HYG D;  3SFI A;  4M73 A;  4U87 A;  4A69 C;  1RRJ A;  2K27 A;  1SD4 A;  4HNU A;  3GME A;  3LSG A;  1VQP I;  4U88 A;  2VT2 A;  1F43 A;  2VJ4 A;  1BL0 A;  4BNC A;  2KPM A;  3LSP A;  2R7V A;  3PIO F;  4N9I A;  3TDU C;  3K4L A;  3T8R A;  2K9N A;  4AID A;  2LR8 A;  3A1Y A;  1R4N B;  1R58 A;  4HX4 A;  4BH9 A;  2R7D A;  1T56 A;  2Y0S N;  2DMP A;  2XC7 A;  4CA0 A;  3BCB A;  4M71 A;  1UZC A;  2EFQ A;  4XLH A;  2DMU A;  2P7C B;  5L3E A;  2ID3 A;  3HEF A;  2DOA A;  3HSF A;  2VL8 A;  2FU4 A;  4DIQ A;  2HDW A;  5GAG J;  4BJT A;  1JKO C;  5KNL A;  5K7H A;  4CGZ A;  1N75 A;  1MH4 A;  2ZSH B;  3RQI A;  1REP C;  3MCZ A;  1OPC A;  1V55 H;  3IAM 2;  2OZ6 A;  4XIC A;  1JHF A;  2RNJ A;  3TP0 A;  1W7P A;  1OCT C;  1UST A;  3WGH A;  1SFU A;  1B72 A;  5LHI A;  5L3C A;  3JSO A;  5ICE A;  4ENN A;  3TBI A;  3I59 B;  3H0G J;  2XAH A;  1FTT A;  2FOK A;  3EPZ A;  2E7W A;  3S14 J;  3TO9 A;  2XSJ C;  3PFI A;  3M9A A;  1R71 A;  3GTO J;  2KLO A;  3A01 A;  2R0Q C;  1T2K A;  2ADU A;  4LIU A;  5FFZ A;  3HBL A;  5IYB J;  2OCE A;  2EB7 A;  2UV1 A;  1GT0 C;  3MVP A;  3C2G A;  5E3N A;  4R8H A;  1KU2 A;  2Y31 A;  4LB5 A;  1JKQ C;  3HUG A;  4A5M A;  3DP7 A;  3V8L A;  3RPU D;  1YTY A;  2WY8 Q;  4GGG A;  2D45 A;  1ZLK A;  3BTL A;  1V5F A;  2RV8 A;  3IH4 A;  3LOC A;  4AU7 A;  1I1S A;  1AOY A;  3E6C C;  2VC1 A;  2MD5 A;  3WG7 H;  3DEU A;  2GAU A;  1Z3Y A;  2RRE A;  3ASO H;  2EA4 A;  1X3U A;  4A3B J;  4M9S A;  4A3F J;  2VT3 A;  3IH3 A;  5ICG A;  1X1B A;  2FUG 2;  3J81 K;  3F6V A;  2XAS A;  5E1Z B;  2COB A;  4QPO A;  5D5U B;  2JVH A;  5FO5 A;  5CQE A;  2ESH A;  4NB5 A;  3F8M A;  2V7F A;  4AUX A;  2OPT A;  1PUF B;  3G3Z A;  4OWR B;  5FKN A;  3G2B A;  3K4N A;  1YRN B;  1FOX A;  2V1D A;  5IYC J;  1R1U A;  1VQM I;  2L3D A;  3TDZ C;  2WAE A;  1IXC A;  2IS6 A;  2A69 F;  1MND A;  3HKZ A;  4ZDP A;  5E3M A;  1IG7 A;  3OYM A;  1V3F A;  2O5R A;  1ACI A;  2IA0 A;  4BHP A;  2NVY J;  3Q0V A;  5L3G A;  2DA2 A;  5J1U A;  2P6T A;  4AVP A;  3JAM K;  3SFZ A;  5BPI A;  2E5Z A;  4A6D A;  4CDG A;  3RJP A;  4G94 A;  4AIJ A;  2EFO A;  2JPC A;  3BC8 A;  3TMO A;  2DMQ A;  5B1A H;  2EIM H;  5DTD A;  1YG2 A;  4HLX A;  3FMS A;  1FOW A;  4XNF A;  1QPI A;  3DPL C;  5K7F A;  2CUJ A;  4IVN A;  4UB8 C;  1SAN A;  1B1B A;  3P7N A;  1Y6I A;  4Z2Y A;  4Q48 A;  1IXR C;  3BY6 A;  1BOB A;  4H4K C;  2CUZ A;  1WI9 A;  1NH3 A;  4JBA A;  3G1L A;  2G9W A;  3BG3 A;  3DU5 A;  3GFM A;  1MMN A;  2KZG A;  3K4K A;  2KRC A;  2WAQ N;  3BPV A;  4RLF A;  5JVT A;  1YYV A;  4XKV A;  4O5V A;  4E70 A;  4M6V A;  4EEF G;  1FIA A;  1MJB A;  2F48 A;  3C7J A;  5LRR A;  1B9M A;  2M7B A;  5H6Q A;  4I2O A;  2Y0S A;  1EF4 A;  2L0K A;  4MLO A;  2V6C A;  3OY9 A;  2E1O A;  2KDO A;  4DJA A;  5JLX A;  2QBY A;  2CUF A;  3GYH X;  1X3Z B;  2XGD A;  1XSX A;  2P81 A;  3ZXS A;  3ZN0 A;  4U7D A;  1F4K A;  4ESJ A;  2M3A A;  4D1Q A;  1W7P B;  1B72 B;  3P9C A;  2HYF A;  4RGS A;  1P7I A;  4NC7 A;  2R4G A;  3ECO A;  4Y3O A;  4ESB A;  4F92 B;  4IKF A;  2E7X A;  2ID6 A;  3KP5 A;  3EYY A;  2DQL A;  3CDH A;  1FX7 A;  5D5W B;  3ERM A;  3WU2 C;  3J7A Y;  1FIP A;  4RS8 A;  1Z91 A;  2OF7 A;  3QU6 A;  5E1W A;  3GTK J;  4G7H F;  1U78 A;  4HPQ A;  4RM2 A;  4XM3 A;  3Q5F A;  3JRH A;  2IGM A;  3HUG B;  1R5H A;  2K40 A;  1JUP A;  3IKT A;  5LD2 C;  2VOP A;  2RN7 A;  1ZRC A;  4L18 B;  1XGS A;  3CJQ B;  1GV5 A;  1OJL A;  4A3I J;  4A5N A;  5A2Q K;  2HQN A;  3I4P A;  4O3M A;  4LK0 F;  2ZC2 A;  3L2U A;  1U6G A;  1VND A;  3M4O J;  4KUM A;  2CJJ A;  3DBH B;  3N05 A;  3BG7 A;  2VE8 A;  2Z5U A;  3BTJ A;  2M0C A;  4F93 B;  3G1O A;  1BI1 A;  3O3K A;  1LPQ A;  1Y8R B;  4A3D J;  4CCL A;  3E6B A;  4BBR J;  4J00 A;  2K85 A;  2F2E A;  4IEJ A;  1VZ0 A;  4HA8 A;  1ZYR F;  1JT0 A;  2VXD A;  3A02 A;  3NEU A;  3Q0U A;  1U9O A;  2LY1 A;  3CCJ I;  5FLX Z;  1YOV B;  3BG6 A;  2DLL A;  3K7A J;  2MW8 A;  2UXN A;  4IO9 F;  3HOV J;  1TWF J;  4YRV A;  3BTC A;  4CCK A;  4B09 A;  3JR9 A;  1FYM A;  2LYC A;  3LSK A;  3S3M A;  2HKX A;  2GXA A;  4LLN A;  1I5Z A;  2PMZ N;  1ETK A;  3A0B C;  2PEX A;  3S2W A;  2LVS A;  2MGQ A;  2X6O A;  3OR2 C;  1H0M A;  3W2W A;  2M45 A;  3DPT A;  5E18 F;  1AA7 A;  3S16 J;  1TNS A;  1UHS A;  3GTM J;  1R4M B;  3FXQ A;  2NVX J;  3RPU A;  1DPR A;  3ZQI A;  3ZN1 A;  1O3T A;  3IC7 A;  4AD9 A;  4D5F A;  3W3C A;  1TQM A;  3RCO A;  5HLT A;  3JRF A;  5B3S H;  5IP7 J;  1XN7 A;  4IPA A;  4V2G A;  2HZT A;  1MJ9 A;  3K1M A;  3KE2 A;  1S29 A;  4PCQ A;  4XLF A;  2HPI A;  3E5U A;  4Y52 J;  2PN6 A;  2KQR A;  4JQF A;  2QEN A;  2DK8 A;  2DFI A;  3LAP A; 
#chains in the Genus database with same CATH homology
 3E3V A;  3R6S A;  1J9I A;  1YW7 A;  1ONV A;  2HFH A;  1R7J A;  4OIN F;  1PP8 F;  1FZP B;  1OYI A;  5DUK A;  2P8T A;  4PGG A;  2W85 A;  1P4A A;  3F8F A;  3WTX C;  1G4D A;  3F23 A;  4OIQ F;  3DV8 A;  3BPX A;  3HOT A;  1LDK B;  4LB6 B;  5CVI A;  4EJV A;  1HXD A;  1A04 A;  4KIC A;  3I71 A;  4MGR A;  5LGU A;  3ECH A;  3GFI A;  4UV9 A;  3FM5 A;  1F1Z A;  1OYY A;  3LA3 A;  2FXA A;  2GXB A;  2IW5 A;  5DDG A;  5LRS A;  3MZH A;  4KIB A;  3CLO A;  2DO7 A;  2EFP A;  3F8N A;  4HZF A;  4LK1 F;  2VBW A;  3VOD A;  2GZW A;  6PAX A;  5HS7 A;  1I1G A;  2HWV A;  4CYD A;  2QQA A;  1OR7 A;  1R22 A;  5HOO A;  4NHJ A;  1S7O A;  1P6R A;  2HOE A;  1FP2 A;  1T38 A;  1IUY A;  1JHH A;  2STT A;  4RB1 A;  1TW2 A;  4I0B A;  2CYY A;  5AIP A;  1K78 A;  3EUH A;  3K9T A;  1QPM A;  3IHU A;  2QQ9 A;  3WTU C;  3KP7 A;  1W7P D;  2OA4 A;  2EK5 A;  3H3U A;  4HLY A;  1ZG3 A;  1FP1 D;  1U5T B;  1ZGJ A;  4HAM A;  3L7W A;  3K69 A;  1K6O A;  1SD6 A;  2QWW A;  2FMY A;  3L9F A;  4EM2 A;  2J5P A;  2FEZ A;  3LA7 A;  1IN8 A;  2PG4 A;  1D8K A;  3NRV A;  2IP2 A;  4RGR A;  4ASN A;  3OOP A;  2H94 A;  3ROU A;  3ISP A;  2Z9O A;  3IKV A;  3PQK A;  1HQC A;  4XLN F;  1QQI A;  1XD7 A;  2IT0 A;  2VOO A;  5D6E A;  4ZZD A;  2XRO A;  3TGN A;  1BC8 C;  4L9N A;  2MH2 A;  3LAJ A;  1WKM A;  4EJU A;  3I59 A;  3TKY A;  5E20 A;  3HYI A;  2BBY A;  1P2F A;  2QQB A;  2H6B A;  3HOS A;  1O3S A;  1XCV A;  5FGM A;  4WX9 A;  4ENM A;  2FSW A;  2JRT A;  2P5K A;  3K1N A;  4RB0 A;  2YSR A;  4G6Q A;  2HTJ A;  3T5X A;  2O61 A;  2XKO A;  4EM1 A;  1SD5 A;  3H3Z A;  5FD5 A;  3GX4 X;  1KU7 A;  2GXG A;  3BDD A;  2K7L A;  1Z6R A;  2KJC A;  2YX7 A;  1SFX A;  3R60 A;  2ZKZ A;  1ZRD A;  1EV7 A;  2CO5 A;  1J75 A;  1FBS A;  1Q1H A;  5D5V B;  3V7C A;  1W5T A;  3J80 K;  2D1V A;  1K78 B;  4M72 A;  1BJA A;  1DPU A;  2OAZ A;  4GCV A;  2IA2 A;  3KLN A;  1FWZ A;  2M30 A;  3GWZ A;  2ZO4 A;  2STW A;  4MQV A;  3I53 A;  2BGC A;  5IT3 A;  3KP2 A;  2KRF A;  3MQ0 A;  1ON2 A;  4Y13 A;  4BXU A;  3B73 A;  2PI0 A;  1GXP A;  4UHT A;  4Q5S F;  1FYK A;  2FBI A;  3KLO A;  1JXS A;  3EDP A;  3RKY A;  2QUF A;  3ABU A;  1HKS A;  3Q9V A;  3AAF A;  2V1U A;  1LEA A;  2QZ8 A;  2M87 A;  3F3X A;  3R0A A;  5HVQ C;  1VTN C;  4GYG A;  3HRT A;  1TBX A;  2DI3 A;  2KJB A;  3QOP A;  3Q9S A;  2R3S A;  2COM A;  5L3B A;  4G7O F;  4RGU A;  3V7R A;  5KK1 A;  2GQQ A;  2Q2E A;  3BRO A;  4I0A A;  2GA2 A;  2M5W A;  4N0B A;  2G7U A;  2PMU A;  3HHH A;  3TO6 A;  1YLF A;  1FSH A;  3ZMS A;  1O7F A;  3BWG A;  2B0L A;  1XMA A;  2OBP A;  2WTE A;  1J0R A;  1K7A A;  2YU3 A;  4O6J A;  4EV0 A;  2V79 A;  4UV8 A;  1IAW A;  5D8K B;  5ILV A;  1MKM A;  2L54 A;  4EMS A;  4IHT A;  1QNT A;  1LDJ A;  1ODD A;  1XDS A;  3R61 A;  2P7V B;  4LLG F;  2TDX A;  5ILS A;  1LQ1 A;  4OIO F;  3QU3 A;  2KIU A;  1BM9 A;  4A0Z A;  5DD8 A;  1ZLJ A;  3WTV C;  2IA1 A;  2OQR A;  4LLL A;  5BS6 A;  1PDN C;  4D0P A;  1KQ0 A;  1XGN A;  2A6E F;  3RYP A;  4AIK A;  4AWX B;  2XVC A;  4U0V A;  3KZZ A;  3HSR A;  1HKQ A;  3GXO A;  1MDM B;  5L3F A;  4G6D A;  2BEO A;  2M1B A;  1W5S A;  4M9Z A;  3BJ6 A;  1QZZ A;  1BBY A;  2EV6 A;  1S7A A;  1RI7 A;  2D1H A;  1YS7 A;  4KDP A;  2RKH A;  3FMQ A;  3RDI A;  1B4A A;  1KYW A;  2K4B A;  4IRH A;  2JZY A;  3SQN A;  1T6S A;  4I02 A;  2IVM A;  2VON A;  1E17 A;  4B8X A;  1IZ1 A;  4WF2 A;  4Y15 A;  1MD0 A;  3KET A;  2EWN A;  4FX4 A;  5ED4 A;  4TV7 A;  3EET A;  1L0O C;  2ZME B;  4M9X A;  1OYW A;  4ZYE A;  3I54 A;  4IJA A;  4HYE A;  4HQM A;  1Z6T A;  3M7G A;  3GEZ A;  2WV0 A;  5HLG A;  4M6Y A;  2ZFW A;  2RQP A;  3HRU A;  1GVJ A;  2KIM A;  2IRF G;  4EJW A;  4BHB A;  2LDU A;  2C6Y A;  3IL2 A;  2W57 A;  2AXL A;  4PZJ A;  4Q47 A;  2EV0 A;  2Y0M A;  2VXZ A;  4CZZ A;  4HV5 A;  1OMI A;  4HX8 A;  2CG4 A;  4LJZ F;  2UWM A;  3K0L A;  2HR3 A;  3E5Q A;  4A6E A;  4ZYD A;  1KU9 A;  4HV6 A;  4EJO A;  3DFG A;  4L5I A;  5FLX K;  4XSX F;  4MTD A;  1BIA A;  5LGN A;  2ZBK A;  3ZPL A;  1D8J A;  3U2R A;  1BOA A;  3VOE A;  1QZY A;  4L9T A;  1G3Y A;  4IRI A;  4L9J A;  2X4H A;  1J2X A;  3IWF A;  2ISZ A;  3KP3 A;  1E2X A;  5K5Q A;  5CLS A;  4OOI A;  4K2E A;  2OQG A;  1U5T A;  2ELH A;  5BPD A;  1T0F A;  4YIF A;  5KVR A;  1BI2 A;  3JW4 A;  2KIF A;  1Z9C A;  2QVO A;  1DDN A;  2GIV A;  1SFE A;  4PDK A;  2MLG A;  1IW7 F;  3WTZ A;  1FBU A;  1RZ4 A;  1UCR A;  3DQV C;  5CVU A;  5DCM A;  2O3F A;  2PBI A;  2IJL A;  2RC4 A;  3MEX A;  5K5O A;  1IN5 A;  5ERI A;  3FHZ A;  3HTS B;  2J5O A;  4YFX F;  2FQ3 A;  2O03 A;  1FBQ A;  3KP6 A;  2XAF A;  4MTE A;  3ZMU A;  1CF7 B;  1LB2 A;  4KFC A;  5K5R A;  5DD4 A;  1BC7 C;  5FD6 A;  3ZMD A;  3CO7 C;  3J7A O;  4U0W A;  5CVJ A;  3T8T A;  4MHG A;  2CQK A;  5LEK A;  3SHF A;  4KMF A;  4HF0 A;  1UB9 A;  1WRJ A;  4KMU X;  4P9U A;  3EQL F;  4RAY A;  3N4M A;  2YPR A;  2LF8 A;  3QP5 A;  2FF4 A;  2ACJ A;  2EJR A;  1ZRE A;  1H9G A;  1SMT A;  2GA1 A;  3I64 A;  5D5X B;  4KIG A;  2WWY A;  4XRF A;  1HW2 A;  1TQI A;  2NNY A;  2RDP A;  4WWC A;  5LHH A;  1XDU A;  3RIR A;  2XAG A;  4YFN F;  5DUI A;  3BP8 A;  1SAX A;  2OU2 A;  2K4J A;  1EH8 A;  3R4K A;  2PLY A;  1FLI A;  3B02 A;  1P4W A;  1LDD A;  2E1C A;  3QRF F;  3U9G A;  3FM3 A;  5D6F A;  4MEX F;  4KA4 A;  4EJT A;  1F5T A;  2DPU A;  3GUD A;  1ZH5 A;  2MBF A;  2G7H A;  2Y48 A;  5DCM B;  4UXN A;  3U1D A;  4KNY A;  4U0Y A;  5HS8 A;  5BMZ A;  4P9F A;  4IHS A;  2XKP A;  3ABT A;  2RGV A;  3E5X A;  3CUQ B;  3W6K B;  2HDC A;  1J7K A;  1HSJ A;  4A0X A;  3WU1 B;  1D3Y A;  4IRG A;  3LST A;  5HLI A;  4I7H A;  3WTY C;  5LHG A;  3C18 A;  5AON A;  2F5D A;  2XAJ A;  3GZ5 A;  4GXO A;  5FFX A;  1LNW A;  3VFZ A;  1EH7 A;  1ZGA A;  2O8X A;  4UVB A;  3L2C A;  1BI0 A;  1R1T A;  2F5C A;  2NAZ A;  4PGH A;  1YIO A;  5TRD A;  2HTS A;  2MH9 A;  1K79 A;  1IRG A;  1ZN2 A;  3E6M A;  2MLK A;  4EQQ A;  5FB2 A;  2E1N A;  3F22 A;  4G9Y A;  3SXY A;  4S05 A;  1FPQ A;  1YS6 A;  5HLH A;  5BOX A;  5JR3 A;  1MGT A;  4FHT A;  1XGM A;  2ZXJ A;  1U5T C;  5TJJ A;  5IT9 K;  3GVA A;  1KQ8 A;  5AIQ A;  3I58 A;  1CGP A;  2OZU A;  2H6C A;  5CJ9 A;  2O6G E;  3DXJ F;  4KIF A;  4ZH4 F;  3J80 Z;  1ULY A;  3F8C A;  3SZT A;  2F5F A;  2EFN A;  4RGX A;  3HHG A;  1V4R A;  3LQR A;  2JSC A;  4HBL A;  5F64 A;  3V7S A;  4HF1 A;  4HX7 A;  1ZG5 A;  1XSV A;  1MDM A;  2DQR A;  2A61 A;  3GLX A;  4JK1 X;  5D4S A;  4WCG A;  4CHU A;  4AIH A;  3P9K A;  4XBF A;  4UNO A;  2MA3 A;  3W6J B;  1Z7U A;  4IF4 A;  3JTH A;  1IF1 A;  4HDV A;  3O2P E;  3GFL A;  2PFB A;  5K1Y A;  2XGX A;  2ESN A;  3WOD F;  2A68 F;  4CO8 A;  2CW0 F;  5DCF A;  1U8R A;  5HDK A;  3CO6 C;  2GWR A;  2ZME A;  2HQR A;  4M6X A;  5E8I A;  3PQJ A;  2FML A;  1TNT A;  4M74 A;  1NHA A;  2XIG A;  2UZK A;  3I0T A;  4RAZ A;  3ZMV A;  2ZNZ A;  3FXR A;  2YR2 A;  1FC3 A;  2KKO A;  5CVV A;  4OIR F;  4G8X A;  3C3W A;  5H6R A;  4ESF A;  4QWQ A;  1UFM A;  1KA8 A;  1LVA A;  4L9V A;  5E1X A;  3MAJ A;  5E8G A;  1U3E M;  4ZYG A;  3KEQ A;  1SMY F;  3E97 A;  1XGO A;  1B9N A;  1C0W A;  1IN7 A;  2Y75 A;  3DF8 A;  1FYL A;  3J81 Z;  3KEO A;  2HS5 A;  3FXU A;  2O0Y A;  4LMY A;  2Z3Y A;  3RKW A;  1RUN A;  2Q8K A;  1WSU A;  2DAO A;  2MC3 A;  3NQO A;  1O57 A;  3ZP5 A;  3L00 A;  4KN7 X;  1PUE E;  5EEH A;  2Z99 A;  3O6B B;  3D0S A;  1YW9 A;  4KYW A;  3HTU A;  1B6A A;  2JPB A;  3WTW C;  3GO5 A;  3MWM A;  1YO5 C;  1BI3 A;  3JAM Z;  2BV6 A;  4CIC A;  1IN4 A;  3M1E A;  1BIB A;  4A0Y A;  4WK8 F;  3QP6 A;  2ZJ2 A;  4I98 B;  4DNC A;  1W4M A;  1XCB A;  2AS5 F;  2PJP A;  4CXF A;  1RNL A;  2CGP A;  1GXQ A;  3WGI A;  1MJA A;  2EA2 A;  1RIO H;  3FWE A;  2VC0 A;  2W24 A;  3ELK A;  3MZY A;  2XHK A;  1HST A;  3ZMZ A;  4YII A;  4UVC A;  5HDN A;  4L5J A;  2CFX A;  4A12 A;  4A2U A;  4LD5 A;  2DW4 A;  2PQ8 A;  1FSE A;  4OMZ A;  1ZG1 A;  2P5L C;  2P5V A;  1QBJ A;  4WXH A;  3BOQ A;  1T39 A;  2V9V A;  2ISY A;  2ZNY A;  4P55 A;  4EVI A;  4HW0 A;  1GHC A;  5J8C A;  3D5L A;  3F72 A;  3P9I A;  1CF7 A;  4R79 A;  3WTS C;  3HRM A;  1JGS A;  1XMK A;  2HGC A;  5D4R A;  5L3D A;  5JHU A;  2LSO A;  1ON1 A;  4EM0 B;  4RB3 C;  5A2Q Z;  5JFR A;  1IXS B;  2L4M A;  4GO1 A;  4EGY A;  2DTR A;  4OIP F;  2X0L A;  2HKO A;  2Q0O A;  3GZ6 A;  2FE3 A;  3TQN A;  4ETS A;  2K86 A;  2VOD A;  2VBZ A;  1SD7 A;  1O3R A;  4P5O A;  3TOB A;  1R00 A;  1XSD A;  2NNN A;  1LJ9 A;  1R36 A;  3H92 A;  2QM3 A;  2QLZ A;  3TOA A;  4OU0 A;  2W25 A;  3F21 A;  2ETH A;  3I5U A;  1KU3 A;  3FF5 A;  3RKX A;  5CVR A;  2WC2 A;  3FMR A;  4F7Z A;  3RTR A;  1HKT A;  5HDG A;  2H27 A;  1T98 A;  2CWE A;  1YW8 A;  3CTA A;  4H0E A;  3V4G A;  4EGZ A;  4YG2 F;  2YX4 A;  4FX0 A;  3M8E A;  4UVA A;  5F6F A;  3BJO A;  1UHM A;  4HDU A;  3KFW X;  1QO0 D;  2IPQ X;  1R1V A;  2ZCW A;  3HSE A;  3K2Z A;  2BYV E;  1XB4 A;  3WG9 A;  5LGT A;  3WU0 A;  3REO A;  2FA5 A;  5F1R A;  4ZZL A;  2NYX A;  3RI4 A;  5H20 A;  4ON0 A;  4S04 A;  3IRQ A;  3CJN A;  3CUQ A;  1DP7 P;  2FNA A;  2JTV A;  1F9N A;  3G73 A;  2QBY B;  2A5Y B;  2FRH A;  5BQT A;  2L4A A;  1RUO A;  2XAQ A;  5ICC A;  5E17 F;  1R23 A;  4I09 A;  2W84 A;  3F6O A;  1FOK A;  3KP4 A;  2R7F A;  1LEB A;  3GF2 A;  2P4W A;  4FT8 A;  2A07 F;  1P4X A;  4KN4 X;  5DYM A;  3TO7 A;  5LLQ A;  1WQ2 A;  1G3T A;  3L09 A;  3GW2 A;  1YFH A;  4LGW A;  4XSZ F;  4I01 A;  2DU9 A;  2HEO A;  4G7Z F;  3WE3 A;  1FT9 A;  3VB2 A;  1WWX A;  3LWF A;  2DPD A;  3JSP A;  4MEY F;  4LG0 A;  2XRN A;  4U7B A;  2FBH A;  3KCC A;  1S6L A;  1DUX C;  3E6D A;  5CYV A;  2UXX A;  3K1P A;  3IWZ A;  3M8F A;  1B59 A;  2XUB A;  2F5E A;  1HW5 A;  3WGG A;  2PMH A;  4GYI A;  1FNN A;  4BHC A;  1ZAR A;  2Z33 A;  3BZ6 A;  4HF2 A;  3RPQ A;  1ZRF A;  1MZB A;  3BJA A;  4OMY A;  5EEG A;  5LBQ A;  3LQQ A;  1G3W A;  1UHW A;  2DK5 A;  2LKP A;  4R1H A;  3IRR A;  4WXC A;  1D5V A;  2D2W A;  3ZMT A;  2M8E A;  3HIF A;  3QPH A;  1TTY A;  2NRA C;  4WXD A;  4IXA A;  2OD5 A;  1P92 A;  1KYZ A;  1TQP A;  1AWC A;  1TW3 A;  1S3J A;  2P6S A;  1O3Q A;  4LFU A;  4MNU A;  3ZQ7 A;  1QGP A;  3RYR A;  1IN6 A;  3COA C;  2FNP A;  1Z05 A;  4BYY A;  3LFK A;  2H09 A;  3R0J A;  3WE2 A;  4YFK F;  2VBY A;  3HRS A;  1Z1D A;  1ZHF A;  5ILU A;  2LNB A;  1HW1 A;  4P96 A;  3QAH A;  3N97 A;  1O7L A;  3WTT C;  4N9H A;  4L0Y B;  3T0Y A;  1BN5 A;  2DBB A;  1JE8 A;  3C1D A;  1ZAO A;  1OKR A;  1R5G A;  2QYO A;  3ULQ B;  3CUO A;  4RB2 C;  3QPT A;  2VN2 A;  1IRF A;  1Y0U A;  3FX3 A;  5D8L B;  2K02 A;  1USS A;  2RVC A;  4ENJ A;  1L3L A;  2L01 A;  3FZV A;  2L02 A;  4KT5 C;  5ICF A;  2A6H F;  1FY7 A;  2LF7 A;  3V8J A;  2DT5 A;  4HOB A;  1I27 A;  2A3S A;  1HBX G;  4LG0 B;  2JT1 A;  1U2W A;  3OV8 A;  3SZP A;  4QLC U;  3KZY A;  1STZ A;  3GFJ A;  2CSO A;  1YQA A;  4Y17 A;  3VEP A;  4L0Z B;  3F8B A;  2V1X A;  3ML6 A;  1KGS A;  1TLH B;  2XV4 S;  4NQW A;  1KQ9 A;  3T1B A;  2EFW A;  4Q4Z F;  2EV5 A;  4MQ9 F;  1H9T A;  1G6N A;  5IT9 Z;  3DKW A;  3ERE D;  5DV5 A;  4DQ2 A;  5HS9 A;  1J5Y A;  1S8N A;  3LA2 A;  3V8K A;  4BQA A;  3JTG A;  2NS0 A;  2BE5 F;  5J8F A;  5JI6 A;  4UUV A;  4HQE A;  1I6X A;  5LEJ A;  1J59 A;  1EH6 A;  4ZYH A;  1G3S A;  2VE9 A;  5DEQ A;  1PP7 U;  3EYI A;  3CUQ C;  2VBX A;  4XLP F;  4BAY A;  3MFK A;  2FBK A;  4ENK A;  5J6X A;  2HYG D;  4M73 A;  2K27 A;  1SD4 A;  4U88 A;  2VT2 A;  4BNC A;  4N9I A;  3TDU C;  3T8R A;  1R58 A;  4BH9 A;  4HX4 A;  2R7D A;  4M71 A;  2EFQ A;  2P7C B;  5L3E A;  3HSF A;  2FU4 A;  4CGZ A;  1REP C;  3MCZ A;  1OPC A;  2OZ6 A;  1JHF A;  2RNJ A;  1W7P A;  1UST A;  3WGH A;  1SFU A;  5LHI A;  5L3C A;  3JSO A;  5ICE A;  4ENN A;  3I59 B;  2XAH A;  2FOK A;  2E7W A;  3TO9 A;  3PFI A;  3M9A A;  1T2K A;  2ADU A;  5FFZ A;  2EB7 A;  4R8H A;  1KU2 A;  4LB5 A;  3HUG A;  4A5M A;  3DP7 A;  3V8L A;  1YTY A;  4GGG A;  2D45 A;  1ZLK A;  2RV8 A;  1I1S A;  1AOY A;  3E6C C;  2VC1 A;  2MD5 A;  3DEU A;  2GAU A;  2EA4 A;  1X3U A;  4M9S A;  2VT3 A;  5ICG A;  3J81 K;  3F6V A;  2XAS A;  5E1Z B;  5D5U B;  5FO5 A;  2ESH A;  4NB5 A;  3F8M A;  3G3Z A;  2V1D A;  1R1U A;  2L3D A;  3TDZ C;  1IXC A;  2A69 F;  1V3F A;  2IA0 A;  4BHP A;  5L3G A;  2P6T A;  4AVP A;  3JAM K;  3SFZ A;  5BPI A;  4A6D A;  4CDG A;  3RJP A;  4G94 A;  4AIJ A;  2EFO A;  2JPC A;  1YG2 A;  4HLX A;  3FMS A;  3DPL C;  4IVN A;  1B1B A;  3P7N A;  4Z2Y A;  4Q48 A;  1IXR C;  3BY6 A;  1WI9 A;  4JBA A;  2G9W A;  3GFM A;  3BPV A;  5JVT A;  1YYV A;  4O5V A;  4E70 A;  1MJB A;  3C7J A;  5LRR A;  1B9M A;  5H6Q A;  4I2O A;  2V6C A;  2QBY A;  3GYH X;  1XSX A;  3ZN0 A;  4U7D A;  1F4K A;  4ESJ A;  1W7P B;  3P9C A;  2HYF A;  4RGS A;  4ESB A;  3ECO A;  2E7X A;  3KP5 A;  3EYY A;  2DQL A;  3CDH A;  1FX7 A;  5D5W B;  4RS8 A;  1Z91 A;  3QU6 A;  5E1W A;  4G7H F;  1U78 A;  3Q5F A;  1R5H A;  3IKT A;  2VOP A;  2RN7 A;  1ZRC A;  4L18 B;  1XGS A;  4A5N A;  5A2Q K;  2HQN A;  3I4P A;  4O3M A;  4LK0 F;  1U6G A;  4KUM A;  2VE8 A;  2Z5U A;  1BI1 A;  3O3K A;  3E6B A;  2F2E A;  4HA8 A;  1ZYR F;  3NEU A;  5FLX Z;  2DLL A;  2UXN A;  4B09 A;  1FYM A;  2HKX A;  4LLN A;  1I5Z A;  2PEX A;  3S2W A;  1H0M A;  2M45 A;  3DPT A;  5E18 F;  1TNS A;  3FXQ A;  3RPU A;  1DPR A;  3ZN1 A;  1O3T A;  3IC7 A;  4AD9 A;  1TQM A;  1XN7 A;  4IPA A;  2HZT A;  1MJ9 A;  3K1M A;  3KE2 A;  1S29 A;  4PCQ A;  3E5U A;  2PN6 A;  4JQF A;  2QEN A;  2DK8 A;  2DFI A;  3LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...