2KIMA

1.7-mm microcryoprobe solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Solution NMR structure of an O6-methylguanine DNA methyltransferase family protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium target VpR247.
rcsb
source organism Vibrio parahaemolyticus aq3810
total genus 27
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kimA00
3WGIA 2M45A 3ZQ7A 1ZRDA 2HQNA 1R00A 5DCFA 2FEZA 3E3VA 2VONA 2ZMEA 3WE3A 1MGTA 1ZREA 1STZA 3J80Z 1BC8C 5LGUA 3REOA 1Z91A 3N4MA 3HHHA 2VODA 3M8FA 4AD9A 2QYOA 3CDHA 2XROA 2GXGA 4M6YA 1ZLKA 5E8IA 2DK8A 2FBHA 3ABUA 1YW9A 2PMUA 1RUNA 3WG9A 1FBSA 4ENJA 4HDUA 3EDPA 1V3FA 3ABTA 2KIMA 4MQVA 4CXFA 5HVQC 3OV8A 2VOOA 1WI9A 2QLZA 3FMQA 1I1GA 2MH9A 4IRHA 5FB2A 2K02A 2XIGA 2G7HA 5HS8A 3FX3A 1P4AA 5CVIA 3I64A 5CVVA 2MBFA 4ZYHA 1XN7A 1MDMB 2L4AA 1AOYA 3VOEA 2OQGA 3ZMZA 1FWZA 1W7PD 5HLGA 3GXOA 1Z6RA 4LLLA 5JR3A 1O7FA 2LF8A 2RNJA 5BS6A 2L01A 2IRFG 3I54A 5JVTA 2Z5UA 1EH8A 1U8RA 2PI0A 4JK1X 4HX4A 2X4HA 1OPCA 3JTHA 2BEOA 1SFXA 5BPDA 4MQ9F 2GA1A 1FZPB 2A68F 2FE3A 3ZN0A 3KE2A 4DQ2A 3RKXA 1IUYA 2O8XA 2VT2A 3QPHA 2ZXJA 4EJVA 2JTVA 1IN6A 2WWYA 3NRVA 5K5OA 5DD4A 4WK8F 1FBQA 1J2XA 3R61A 3DF8A 5JI6A 5IT9K 2EWNA 1ZGJA 2STTA 2M87A 2HYFA 4OOIA 3P9KA 4K2EA 4G7OF 4G7HF 2GIVA 2RVCA 2P7VB 4XLPF 1MKMA 5K5RA 2W24A 1OYIA 1W5SA 2XV4S 3GYHX 1XGMA 2Y48A 1S3JA 2YPRA 1UHWA 3GW2A 3D5LA 5LGTA 1TW2A 2OA4A 2QZ8A 3GFJA 4B8XA 4UVCA 1G4DA 3TOBA 3HUGA 1KQ9A 3SXYA 3E5QA 2OAZA 4YFXF 5TJJA 4KT5C 4Q48A 4NB5A 2NRAC 2PQ8A 2FNPA 4ENNA 2JT1A 3I4PA 2M30A 3WTVC 1U5TC 4EM1A 2YR2A 2M1BA 3LWFA 3PFIA 2V1XA 4I2OA 5J8FA 2PLYA 1W7PA 2HKOA 1BM9A 1CF7B 3ULQB 4RGXA 1SD7A 2TDXA 1JHFA 3NQOA 1RUOA 1GVJA 3GZ5A 3MWMA 3ZPLA 1SMYF 2Q8KA 5E8GA 2PG4A 4U0WA 2EV0A 3KP6A 2FMLA 1Z6TA 4A6DA 2ZFWA 4HV5A 2K4BA 4R79A 3HHGA 4H0EA 5DDGA 1QO0D 3HTSB 4R8HA 2FOKA 3F72A 3GFLA 3BPXA 3J81K 4Y17A 4OIRF 3KP5A 5FO5A 2CYYA 2EFPA 4OIQF 2ELHA 2YX7A 5K5QA 1RIOH 2Z33A 3R0AA 4WXDA 1HQCA 2GZWA 1J0RA 1MDMA 4ZZLA 3VB2A 3MZYA 3HTUA 2V6CA 2IA2A 2CW0F 3JSPA 2OZ6A 5IT3A 3HRUA 1GXQA 1EH6A 1FNNA 3RJPA 1KU7A 4AIKA 4RB3C 4ESJA 3FXRA 3DQVC 2A5YB 3LQQA 1NHAA 5FFZA 2HFHA 5BOXA 2KJBA 3EYIA 5HDNA 3T0YA 4HBLA 2VT3A 4BAYA 1WWXA 3P7NA 4Q47A 5CVUA 1T38A 5A2QK 1S7OA 5EEHA 2XKPA 4HX8A 3FMRA 4I01A 4LG0A 5CVRA 3LAPA 2VE8A 1G3YA 1FPQA 3DP7A 4N0BA 4PCQA 3F8MA 1HKSA 2GXBA 2H27A 4L0ZB 4YFKF 3LQRA 2IP2A 4UUVA 2GAUA 2KIUA 5F6FA 1P6RA 2O61A 5LHHA 1H0MA 3GEZA 4A0ZA 3GUDA 5HOOA 2W85A 2LF7A 2IA0A 2W84A 1BI3A 1LEBA 1FBUA 3K1MA 3WGHA 4BYYA 5CVJA 2GA2A 2JRTA 2NNNA 1U3EM 1YS7A 3OOPA 4MGRA 5LLQA 4PGHA 1FT9A 2EJRA 3H3ZA 4XSZF 4RGUA 2BGCA 2L54A 1FP1D 4M6XA 3K9TA 1K79A 4ZYDA 2HEOA 3CJNA 1QGPA 5FGMA 3KZYA 4G8XA 1DP7P 3GWZA 2BV6A 2L02A 4ZYGA 1I5ZA 1W4MA 1Q1HA 1YW8A 2O6GE 3K69A 3HSFA 4RB1A 4L5JA 1CF7A 5DCMB 3TO9A 2VBWA 3WU0A 2EFNA 3K1PA 1W5TA 2FQ3A 4I09A 1HW1A 5J8CA 3HOSA 1R22A 5D5UB 2OQRA 2FRHA 1UB9A 2XAGA 3GZ6A 3KP4A 4PGGA 5LEKA 1H9TA 4NQWA 2OD5A 1J59A 3O6BB 4P9UA 3L00A 5D8LB 5LHGA 3BWGA 2DQRA 4E70A 3FWEA 1T2KA 3I58A 1F1ZA 1R36A 3LA7A 2FBIA 2P5LC 3BJAA 2P4WA 3QU6A 4RS8A 5H6RA 3TDZC 1ZG3A 3J80K 1ZG1A 3F8FA 3O3KA 4P9FA 1ZGAA 1ZHFA 1G3TA 4IHTA 1S29A 1YYVA 4WXHA 1DPRA 3BOQA 2EV6A 3FXUA 2ACJA 2W25A 4ZYEA 3FF5A 3RPUA 1B4AA 2ADUA 4BXUA 4HF1A 3D0SA 3T8RA 2LSOA 3KEQA 4KN7X 3BPVA 3DEUA 5KVRA 3HSRA 1P4WA 3F6VA 2XAJA 1FY7A 4U0VA 3T5XA 2VOPA 1IXRC 1TW3A 2CO5A 3L2CA 3H3UA 3T8TA 2K7LA 2A69F 3JAMZ 4EJWA 1RI7A 5LEJA 2FBKA 4EJTA 3F8NA 1CGPA 3E6BA 2EV5A 2KIFA 2CQKA 1AWCA 3MZHA 4ENMA 1HKQA 1SD4A 1PUEE 1LDDA 1QPMA 4WX9A 5E1WA 4Q5SF 5LRRA 5D5WB 4I98B 2FU4A 5CJ9A 2ETHA 4KICA 5D4SA 1MZBA 5D6FA 2MC3A 1Y0UA 1IW7F 4KFCA 4LB5A 3CUOA 2RQPA 4UNOA 3E5UA 5ICCA 2L4MA 4HQEA 1ULYA 5F64A 3CUQB 1U2WA 4L9JA 1O7LA 1SD5A 2WTEA 2RV8A 3HRSA 1WKMA 3I0TA 2YSRA 3I59B 4LFUA 5HDKA 5FLXK 1K7AA 3TO6A 4KA4A 1T0FA 4BNCA 1Z9CA 2CG4A 1HSJA 4QLCU 2DPDA 3BP8A 1TQMA 3BDDA 4L5IA 2ESHA 2ESNA 3RKYA 2YX4A 3F21A 2WV0A 5AIPA 3QRFF 1UCRA 3DPTA 3E6DA 2AS5F 3J7AO 3V7SA 1SFUA 3GX4X 2QM3A 3ZMSA 3IRRA 3FZVA 2B0LA 5ICFA 2LKPA 4EQQA 4O5VA 4RB2C 3F23A 3VODA 1O3RA 4OIPF 2ISZA 5DEQA 4MEXF 4R1HA 1FP2A 4OINF 3RPQA 1XMKA 4M9XA 1J75A 3ECHA 1FOKA 2R7DA 4A0XA 4ASNA 3GLXA 3QPTA 1D8JA 1FYMA 3M1EA 1EH7A 2XASA 2YU3A 4IVNA 2E7WA 3NEUA 1YS6A 3MQ0A 2HS5A 3DKWA 1QZZA 2Y75A 5ILVA 1P4XA 2XAHA 3CO6C 1ONVA 3CO7C 5H6QA 1FSHA 4RAZA 3W6KB 3V8KA 3ML6A 6PAXA 2FNAA 2QVOA 2QENA 2QWWA 3SZPA 3GO5A 1L3LA 4I02A 2A3SA 1J9IA 2Z99A 4A12A 4UV9A 5IT9Z 1XDSA 2UXXA 1XGNA 1ON2A 2H94A 2CGPA 2AXLA 4XLNF 5CLSA 1HW2A 2UZKA 4MEYF 2IA1A 1QQIA 1Z1DA 4A0YA 2DI3A 1YTYA 5L3DA 4FHTA 1TNTA 3PQKA 2RC4A 1ZLJA 2D1HA 2QQAA 4EV0A 1ON1A 4HW0A 1TTYA 2GWRA 1OYWA 3HRTA 3IHUA 3KZZA 2HDCA 5HS9A 1ZG5A 2MA3A 1KU2A 5ILUA 4LK0F 2M5WA 3WTTC 2JSCA 2NNYA 4N9IA 1IN5A 1UHMA 1F9NA 2ZCWA 2EA2A 2EA4A 2JZYA 4UV8A 3CLOA 5E18F 2O3FA 1KYWA 1DUXC 2UXNA 1XSVA 3CUQA 5LGNA 5ERIA 2V1DA 1XGOA 5L3BA 2QQBA 1V4RA 4HF0A 2J5OA 1OYYA 1TLHB 3I59A 4HZFA 3EETA 5EEGA 1LDJA 1SAXA 3E5XA 1JHHA 2VE9A 1SD6A 4HA8A 3MFKA 4ZH4F 3U9GA 4OMYA 2W57A 4ESFA 1IN4A 5J6XA 2QBYB 5JFRA 4CGZA 2D1VA 4MHGA 2F5FA 4IF4A 1R7JA 1VTNC 3ZMUA 2EFQA 3IWZA 5JHUA 3DV8A 3LA3A 4LGWA 2IVMA 3V7RA 4JQFA 1S6LA 4LD5A 4RB0A 1BI1A 3KETA 4CICA 5LBQA 5KK1A 4HDVA 1TQIA 4AVPA 2QUFA 4YIIA 3IWFA 1T98A 2J5PA 2KRFA 4O6JA 2XAFA 3F8CA 2STWA 2L3DA 3QU3A 1LQ1A 4IHSA 3KP2A 2RDPA 1USTA 3Q9VA 4ENKA 3JW4A 4CYDA 3K1NA 1KU3A 2DLLA 5A2QZ 4TV7A 1QNTA 5ILSA 4LB6B 1IN7A 3ZN1A 3GVAA 1LNWA 1USSA 2P6TA 5BQTA 3BJOA 1RNLA 2DU9A 5BMZA 3RDIA 4WCGA 3HOTA 2ZO4A 1YLFA 2DTRA 2XKOA 3RYRA 2F5DA 1E2XA 2HQRA 2Y0MA 3BJ6A 2ISYA 2QQ9A 2CFXA 3GFMA 5BPIA 3RIRA 2EB7A 3HYIA 2XHKA 1TNSA 3RI4A 3FMSA 5L3GA 2EK5A 2RN7A 1H9GA 5HLIA 3DFGA 2H6BA 1R23A 4A2UA 4GYIA 2LDUA 3HRMA 5L3FA 1SMTA 3KLNA 1HXDA 4IJAA 1O3SA 2MLGA 1B9NA 4L18B 1KA8A 2BBYA 1XB4A 1LB2A 4U7BA 1JE8A 4RAYA 1JXSA 1FSEA 1IF1A 2A61A 1BJAA 4M73A 4GO1A 1YIOA 4KIFA 3ZMVA 4EJOA 4BHPA 4HLYA 1OKRA 1RZ4A 4Y13A 1O3TA 4P55A 5LRSA 1FX7A 1Z05A 3L09A 4MTEA 4ZZDA 3R6SA 4L9VA 3ZMDA 1QZYA 2ZNZA 1I1SA 4PZJA 3WU1B 1J5YA 1ZH5A 1T39A 1KQ0A 2DFIA 5L3CA 4KMFA 2VXZA 2VN2A 4L9TA 2G9WA 2IPQX 3I5UA 4OMZA 3RKWA 2FMYA 1X3UA 1U6GA 3Q5FA 1XMAA 2FA5A 4PDKA 2R7FA 4QWQA 4IRIA 3WTWC 1KGSA 2DQLA 3TGNA 1B9MA 1LJ9A 3CUQC 5HS7A 2Q0OA 4Z2YA 2PMHA 2PFBA 1REPC 1YFHA 1S7AA 2XUBA 3BY6A 3R60A 3SZTA 1OR7A 2QBYA 3TOAA 3MEXA 1LEAA 1E17A 1P92A 2CWEA 2DK5A 2P7CB 1I6XA 2NAZA 4HLXA 4P5OA 2CSOA 3GFIA 2VC0A 2V1UA 4M9ZA 4WXCA 2D45A 3WE2A 2HTSA 1BIAA 1B1BA 2ZBKA 3W6JB 5ICEA 2IJLA 1W7PB 3K2ZA 1Z7UA 3V4GA 2XVCA 2F2EA 3KCCA 3P9CA 1GXPA 5DUIA 3SHFA 2PEXA 2MH2A 3VFZA 4S05A 1MJ9A 3ELKA 5D5VB 1G3WA 5AIQA 4CZZA 1O3QA 4B09A 1ZARA 2LNBA 1BN5A 3ROUA 1IN8A 1F4KA 1MD0A 5AONA 1BI2A 4F7ZA 1BI0A 1YO5C 2Z9OA 5K1YA 4EMSA 1IXCA 1B59A 3T1BA 4HV6A 5E1ZB 2K86A 2DW4A 1WRJA 5E20A 3KFWX 3WTZA 4NHJA 4ETSA 4YIFA 2XRNA 3U1DA 2D2WA 3KP7A 3AAFA 1HKTA 2FXAA 1P2FA 1XCBA 2JPBA 4WWCA 1HSTA 3WGGA 4EJUA 3LFKA 3H92A 4CO8A 2BYVE 2A07F 5FLXZ 3B02A 1ODDA 4XBFA 3TO7A 2VBXA 5DCMA 3V8JA 4N9HA 1PP7U 2M8EA 4MNUA 2HGCA 2DAOA 3M8EA 5D4RA 2O03A 1K78B 1HBXG 2ZJ2A 4U0YA 4L0YB 1PP8F 1XCVA 4IRGA 4LK1F 2PN6A 2NYXA 1A04A 3HSEA 3BROA 1D5VA 4LG0B 5FD6A 4I7HA 3Q9SA 4MTDA 4KDPA 3R4KA 3LAJA 4YFNF 3I53A 4EM2A 1S8NA 1I27A 4RGRA 4G6DA 1PDNC 4LLNA 2V9VA 3HIFA 2DBBA 3FHZA 2IT0A 1ZYRF 2P5KA 2HR3A 4AIJA 4BHBA 2E1CA 3MCZA 4HQMA 1T6SA 3VEPA 2MD5A 3EUHA 4Q4ZF 1ZAOA 1FYLA 1XGSA 4G7ZF 2A6EF 2MLKA 5FD5A 3P9IA 3F8BA 1XD7A 4KYWA 1SFEA 1ZN2A 2HKXA 4Y15A 5E17F 4O3MA 2OU2A 1MJBA 2COMA 3PQJA 1C0WA 3BZ6A 2HWVA 4FX0A 1R1VA 3I71A 4A5MA 1MJAA 2A6HF 4M71A 3ISPA 2OZUA 2KJCA 4D0PA 4KN4X 2C6YA 2H6CA 1YQAA 4HX7A 3LA2A 3V8LA 5HDGA 3SFZA 3F3XA 3RTRA 4HF2A 3C7JA 4UXNA 2ZKZA 2IW5A 4G94A 1LDKB 4G9YA 1GHCA 4RGSA 2FF4A 5L3EA 1DPUA 3EYYA 4BQAA 4M74A 3L9FA 4EGZA 3K0LA 5TRDA 4HOBA 5H20A 1KU9A 3B73A 4S04A 4CDGA 4WF2A 2VC1A 3M9AA 2R3SA 1QBJA 3WTUC 1IRFA 2EFOA 1ZRCA 1R1TA 3TKYA 4I0BA 1R5GA 2HOEA 4XRFA 4GYGA 4A5NA 1BC7C 4FT8A 3FM3A 4JBAA 2Q2EA 3E97A 4U88A 2VBZA 3DPLC 3FM5A 5ICGA 4BH9A 5D8KB 4DNCA 4KUMA 4IXAA 1R1UA 3JSOA 4GXOA 2X0LA 5DYMA 2K27A 3J81Z 3R0JA 1U5TB 4EM0B 4BHCA 3KEOA 2RGVA 2ZNYA 4KNYA 1JGSA 1FLIA 4U7DA 1FC3A 1ZRFA 4AWXB 5D5XB 2HZTA 1HW5A 2ZMEB 3F6OA 5FFXA 4EVIA 3SQNA 1IZ1A 1XDUA 3IC7A 3C18A 2V79A 3JTGA 2KKOA 1G6NA 1L0OC 2P6SA 2PJPA 2H09A 1BIBA 1K78A 4HYEA 2F5EA 2BE5F 4AIHA 3E6CC 4GGGA 1WSUA 3ZMTA 3S2WA 5DV5A 3CTAA 4UVAA 1EV7A 5CYVA 1IXSB 1IRGA 3EQLF 2OBPA 3LSTA 3G73A 2PBIA 2FSWA 3O2PE 1BOAA 3IL2A 2VBYA 2P5VA 1D8KA 1B6AA 3FXQA 4LLGF 2E7XA 4M72A 3TQNA 4LMYA 4KMUX 1BBYA 4ON0A 4GCVA 3ZP5A 3U2RA 3KLOA 3RYPA 4M9SA 3ECOA 2G7UA 5DD8A 1FYKA 4CHUA 3L7WA 3KP3A 1DDNA 2P8TA 4OIOF 4HAMA 4UHTA 2F5CA 2Z3YA 1YG2A 3IKVA 4IPAA 4FX4A 5ED4A 4P96A 2UWMA 3WTXC 2GQQA 1WQ2A 4I0AA 2DPUA 2K4JA 1D3YA 2NS0A 1F5TA 3G3ZA 1KQ8A 1J7KA 3IKTA 1OMIA 5F1RA 1IAWA 5D6EA 3WODF 4LJZF 2XGXA 1R58A 5DUKA 2XAQA 2HTJA 4EGYA 1UFMA 3MAJA 4OU0A 1LVAA 3C1DA 3N97A 1U78A 1TQPA 1K6OA 3IRQA 5HLHA 1O57A 2E1NA 3E6MA 4L9NA 3GF2A 1KYZA 3DXJF 3TDUC 3QOPA 1G3SA 3COAC 5LHIA 3QP6A 2EFWA 4G6QA 3M7GA 4KIGA 2RKHA 1XSDA 2HYGD 3QAHA 1TBXA 1YW7A 2DO7A 5E1XA 4YG2F 4UVBA 1R5HA 2DT5A 3V7CA 2WC2A 4ESBA 3C3WA 4A6EA 1XSXA 4KIBA 3QP5A 1U5TA 3JAMK 3ERED 3F22A 3WTSC 2JPCA 3WTYC 4XSXF 2O0YA
chains in the Genus database with same CATH superfamily
3WGIA 1GT0C 2DT6A 2M45A 2XSJC 4FE4A 3ZQ7A 4DGWB 1ZRDA 2HQNA 2QQ8A 4XN3A 1N78A 1R00A 4I99C 1I39A 2FEZA 3E3VA 4XORA 5DCFA 3M07A 2ZMEA 2VONA 4CSWA 4A3LJ 3WE3A 1MGTA 1ZREA 1STZA 2EINH 3J80Z 1BC8C 5LGUA 2JUCA 4D5FA 3REOA 1Z91A 2VXDA 2H8RA 2KZVA 3N4MA 3HHHA 2VODA 3S2DJ 3M8FA 4AD9A 1B72A 2ZSHB 3V42A 2QYOA 3CDHA 2EIJH 1FEXA 5FKOA 4X1EA 4IL6C 2CFOA 2XROA 4XKVA 3S15J 2GXGA 4M6YA 1SVLA 1X19A 3ONQA 1ZLKA 5B3SH 1JKPC 3BG3A 1GVDA 1JJ8C 1V54H 5E8IA 4F91B 4XOPA 2DK8A 2FBHA 3DBLB 2ME0A 1LE8A 3ABUA 1X3WB 1YW9A 2BY1A 4AC0A 1T08B 2PMUA 1RUNA 3TBIA 5KNLA 4I76A 3WG9A 1FBSA 2OUMA 1XC5A 2FUG2 3PL8A 4ENJA 2JA5J 4HDUA 3EDPA 3JCUC 2F5VA 2LLKA 1V3FA 1MIJA 3ABTA 4GRIA 2KIMA 4MQVA 1OCPA 3I3LA 4CXFA 1IRZA 1A6IA 5HVQC 3KYCB 3OV8A 4X0GA 2VOOA 1WI9A 2V9KA 2QLZA 2WY8Q 2BY3A 2L9RA 2ZJRF 1FTZA 3FMQA 3HJEA 4Y52J 1I1GA 1MW7A 2MH9A 4IRHA 5FB2A 5FKNA 2K02A 3LSKA 2XIGA 2G7HA 4XRSA 1VQLI 2L7MP 1OCOH 1Y39A 5HS8A 3FX3A 1P4AA 5CVIA 2EIMH 3I64A 3QPSA 5CVVA 4C30A 3GBGA 1X4PA 3K70C 1BJZA 4A3MJ 2MBFA 4ZYHA 1XN7A 3UR3C 3BT9A 1MDMB 2L4AA 4CCLA 3A02A 1AOYA 2VJJA 3VOEA 4XKBA 1AKHA 2AHQA 2OQGA 3ZMZA 1FWZA 1TZLA 1W7PD 3X2QH 5HLGA 2V7FA 3GXOA 1Z6RA 2TCTA 2LVSA 2E1OA 2LY9A 4LLLA 1OISA 2F4OB 4ITVA 4LITA 5JR3A 4BJ5C 1O7FA 2LF8A 2H1LA 2DCEA 4YIRX 4IHXA 2RNJA 5BS6A 2L01A 3W3CA 2IRFG 1YX3A 1VQ5I 2OJED 3I54A 3BTIA 2VKDA 5JVTA 5J4YA 2Z5UA 4NC7A 1EH8A 1U8RA 2PI0A 1X1CA 2MABA 2LC2A 4JK1X 4HX4A 2X4HA 3KIOA 5J40A 5IP7J 1OPCA 1UG2A 1W1WE 5EEAA 1TWFJ 4C2MJ 3JTHA 4FTHA 1POGA 4Y7NJ 2VJIA 2BEOA 3TL4X 3FKIJ 1SFXA 2K5CA 5BPDA 2R7SA 4UUTA 3H5RA 3HKZN 3ZQFA 1OFCX 2B7EA 4MQ9F 2NVUB 3VYTB 2GA1A 3S8PA 2ZJQF 5EZHA 2M0MA 1FZPB 2O8KA 2A68F 3MD2A 3W2AA 2FE3A 3OOUA 2ZXIA 3PFYA 3ZN0A 3HZJA 3KE2A 4DQ2A 3DTIA 3RKXA 1IUYA 1SAUA 1X3ZB 2K3FA 1FIAA 4RBOA 2O8XA 5DM7F 5C4XJ 3CJQB 3DLLF 5HODA 1TWAJ 1BOBA 1A36A 4YRVA 2VT2A 3QPHA 2ZXJA 4EJVA 4IO9F 2JTVA 2DA7A 2VQHA 1IN6A 1FMWA 2WWYA 3NRVA 2LREA 5K5OA 5DD4A 5DM6F 2HVQA 3CCYA 4WK8F 3QPLA 2FJ1A 3BR1A 3AG4H 1FBQA 2ELKA 1J2XA 1X58A 3R61A 3DF8A 5JI6A 1KONA 5IT9K 2L7FP 2LMDA 2EWNA 1VQ7I 1RKWA 1ZGJA 1OCTC 2BOLA 5JVGF 2OF7A 2STTA 1R71A 1HOMA 2M87A 2HYFA 4OOIA 4ZDPA 5GP9A 2XPVA 2QKLB 3P9KA 4K2EA 2JUGA 4G7OF 2V6EA 2BVMA 1E3OC 3BR6A 2MGQA 4G7HF 1ETYA 2GIVA 2RVCA 2P7VB 3K4JA 1MBKA 1RESA 3Q0WA 4XLPF 2OTLI 2ZJPF 1MKMA 2W24A 3K4KA 5K5RA 1OYIA 1W5SA 4M3BA 2XV4S 1IO2A 3GYHX 1XGMA 2Y48A 1S3JA 2YPRA 1UHWA 3GW2A 3D5LA 1TW2A 2OA4A 3GFJA 2LK2A 2QZ8A 5LGTA 4B8XA 2R7WA 3A0HC 2H1KA 4MIMA 4UVCA 1G4DA 3TOBA 3HUGA 3FDYA 1KQ9A 3SXYA 3U1KA 1ITYA 1WI3A 3E5QA 2OAZA 4YFXF 3Q0VA 5TJJA 1P7JA 4KT5C 4Q48A 4NB5A 1DU6A 2NRAC 3CMAI 2E19A 4XR6A 2DJIA 2PQ8A 2BY2A 4B1RA 1NK2P 2FNPA 2DOAA 5B1AH 2CS3A 2KDOA 3G1MA 1X1AA 2EZIA 4ENNA 2JT1A 3I4PA 2M30A 4RDUA 3WTVC 2X6OA 3K4NA 1U5TC 3A4CA 4EM1A 2YR2A 4D9JA 2M1BA 1TWHJ 3LWFA 3DEWA 3PFIA 2V1XA 3IAS2 2GM4A 4I2OA 4IQ4A 1YJWI 3OIQA 5J8FA 3HL2A 3DBHB 2PLYA 2WA0A 1W7PA 3OSFA 2HKOA 2V9PA 2ZMEC 1BM9A 3CCLI 5JLWA 1CF7B 3MKYB 1P7IA 1R4MB 2L7KA 3ULQB 4RGXA 5E3LA 1SD7A 2NS8A 3L2WA 2DA3A 2TDXA 1I6HJ 1JHFA 3NQOA 4B3XA 1GVJA 1RUOA 3GZ5A 3MWMA 2LKXA 3ZPLA 2IS2A 1SMYF 2X48A 2Q8KA 5E8GA 2PG4A 4U0WA 1W5CC 2EV0A 3KP6A 2FMLA 1Z6TA 2XF7A 2XGDA 4NQWB 2BHYA 2ZFWA 4HV5A 4A6DA 2JQ7A 2K4BA 1EA3A 4R79A 3HHGA 3JRHA 4H0EA 2FQ4A 5DDGA 1QO0D 2K85A 2O7OA 3HTSB 4R8HA 3FXOA 4G6TB 4DJAA 2FOKA 3F72A 1Y8QB 3GFLA 3BPXA 5IP6A 3J81K 1ZTRA 4Y17A 4OIRF 1SVMA 3KP5A 2X1DA 1P9QC 3HB9A 5FO5A 3NARA 2CYYA 5TGTA 2EFPA 9ANTA 2V4JC 3HPGA 3L2UA 2VUMJ 4EATA 1XX5A 4XKWA 4OIQF 4E7LA 2ELHA 4IOAF 2YX7A 3PUBA 1WCMJ 5K5QA 4CH7A 1RIOH 2Z33A 2W1OA 3R0AA 4WXDA 2HQAA 2M8GX 1HQCA 2GZWA 1J0RA 1MDMA 4ZZLA 3WU2C 3VB2A 3MZYA 4PK4A 3HTUA 3CMEI 2V6CA 2IA2A 2CW0F 1WH5A 2RNGA 3LL7A 3JSPA 2OZ6A 3OY9A 5IT3A 2HQ5A 3HRUA 2HI3A 4XLFA 2O5RA 1W0TA 1GXQA 1EH6A 1FNNA 2EPFA 1H89C 1S7EA 3RJPA 2R7VA 3DTKA 3HM5A 3L2RA 2YUSA 1KU7A 3S32A 2M0CA 4AIKA 2XSDC 4RB3C 3OYIA 4ESJA 2MC4A 3FXRA 3DQVC 1EF4A 2A5YB 2K9SA 3LQQA 1YJ9I 1NHAA 4PJJA 4KISA 5FFZA 2WB1A 2LOOA 1QRYA 4Y33A 2HFHA 5BOXA 2KJBA 3EYIA 5HDNA 3T0YA 4HBLA 2VT3A 4BAYA 1WWXA 3P7NA 4Q47A 5CVUA 1PUFB 4BE2A 1T38A 1GV5A 3OYFA 5A2QK 1S7OA 3J7AY 2HZDA 1BW6A 5FLMJ 5EEHA 5EYRA 2XKPA 3OIOA 4HX8A 3CCJI 3BTLA 3FBIB 3FMRA 4I01A 1JKQC 4LG0A 5CVRA 3LAPA 2VE8A 2M4KA 1X1BA 5IPAA 1IV8A 1V5GA 3A03A 1G3YA 5M3FJ 1NG7A 2WAQA 1FPQA 3FXLA 3DP7A 3S3OA 4N0BA 4PCQA 1R4NB 3F8MA 1HKSA 2GXBA 4XONA 3HGYA 2H27A 4V19K 2KRCA 2QCOA 4L0ZB 4YFKF 2VKEA 2IP2A 2X6YA 3LQRA 4YELA 3SFIA 4ZJZA 4UUVA 4BBSJ 5B5EC 2GAUA 2KIUA 5F6FA 1P6RA 1A6QA 2O61A 5LHHA 1ZR2A 4AYBA 3GEZA 4M3FA 1H0MA 1BW5A 1WJ5A 3GUDA 4A0ZA 2LY2A 1B8IB 3ZCOA 1IRXA 5HOOA 4C2TA 2W85A 2DDBA 4IX7A 3OYMA 2LF7A 4UY8I 3M8JA 2IA0A 1ETWA 2L9VA 2W84A 4E7IA 4M3EA 3A2KA 1BI3A 1LEBA 2VKVA 3LSIA 2OC6A 1FBUA 1FOWA 3K1MA 3WGHA 2HOAA 4BYYA 1BL0A 1WJCA 2DA2A 1Z7LA 2GA2A 2JRTA 5CVJA 2NNNA 1R5ID 4MLOA 1U3EM 1YS7A 3OOPA 4MGRA 5LLQA 3H1CA 4PGHA 1FT9A 2VQCA 1VFCA 2EJRA 3H3ZA 5M5YJ 2ZB9A 4XSZF 4RGUA 2BGCA 4XMYA 1BR4A 3PNVA 2L54A 1FP1D 4M6XA 3K9TA 1K79A 1WJBA 3ZGKA 3FXKA 4NNJA 4ZYDA 2HEOA 2CJJA 3CJNA 2XPWA 3TP0A 4DBQA 1GDTA 1QGPA 4Y3OA 5FGMA 3BLYA 2ZXHA 2W4SA 3S3NA 3KZYA 3M1CA 3WHCA 4E4HA 4G8XA 1DP7P 3GWZA 5GAGJ 2BV6A 2L02A 2R5ZB 4ZYGA 1I5ZA 3CESA 1W4MA 2V1NA 4PJLA 2QSHX 1Q1HA 2F4IA 4B48A 1YW8A 2R7UA 3ESWB 2O6GE 3K69A 2HDDA 3CCEI 3HSFA 1K83J 4RB1A 2IGMA 4L5JA 1CF7A 5DCMB 3TO9A 2VBWA 4DIQA 1VQ8I 3WU0A 2EFNA 3K1PA 2Y30A 1W5TA 2FQ3A 4I09A 1HW1A 3GLLA 5J8CA 3HOSA 3JRIA 3PSIA 3K2AA 1JJ6C 3RSNA 4GDFA 1R22A 2OQRA 4H4KC 5D5UB 2PJRA 2FRHA 4KITB 1UB9A 1YHQI 2XAGA 3RQIA 3GZ6A 3KP4A 4PGGA 5LEKA 2KLOA 2COBA 1H88C 1H9TA 4NQWA 4BXXJ 4PUSA 3SZGA 2R92J 4BUPA 2OD5A 4XK4A 4BQNA 1J59A 2JMWA 4UB6C 4OAYA 3O6BB 2WADA 3FISA 3KYDB 4P9UA 3NWSA 4XN0A 2L7ZA 3L00A 3GTJJ 5JLXA 1U0JA 1E0EA 1M1EB 5D8LB 5LHGA 3BWGA 3F9KA 2DQRA 2KT0A 3LSJA 4E70A 3JRCA 2PMZN 4XL9A 2LY1A 3FWEA 4A3BJ 2OV7A 5KAFC 2NVTJ 1T2KA 3I58A 1F1ZA 1R36A 3JREA 2KPMA 2I10A 3LA7A 2FBIA 2P5LC 2HYJA 3HOZJ 3BJAA 5GAEJ 2DDAA 2P4WA 3QU6A 4RS8A 5H6RA 2CQ7A 1ZG3A 3TDZC 1ZELA 3ZQHA 4L5EA 3J80K 2UUZA 3F8FA 3O3KA 4P9FA 3EPZA 1ZGAA 4HNTA 1ZG1A 3I4MJ 1ZHFA 4RAFA 4G12A 1G3TA 4IHTA 4OWRB 3I9V2 1ZR4A 5F0HA 1S29A 1YYVA 4WXHA 1DPRA 3BOQA 3S93A 1I3AA 2EV6A 3FXUA 4AU7A 2ACJA 5EDNA 1X4OA 1IDZA 2W25A 4ZYEA 3FF5A 3RPUA 5LFAA 3CCVI 1B4AA 5F04A 2WV1A 3JRBA 2ADUA 4BXUA 4HF1A 3D0SA 3OS2A 2OCCH 2LSOA 3T8RA 3KEQA 2HU9A 3H9GA 4IEJA 4KN7X 3BPVA 3CCRI 3DEUA 5KVRA 5CQEA 3S1RJ 3BQYA 3HSRA 1MMGA 1W0UA 1P4WA 3F6VA 4J19A 4A3DJ 3JRAA 1G2HA 1HDDC 4LIUA 2XAJA 1FY7A 4U0VA 3T5XA 2VOPA 1PUFA 1IXRC 1TW3A 2CO5A 2XGEA 3KYLA 3L2CA 3H3UA 3T8TA 2K7LA 3SYTA 5J1YA 2A69F 4XLAA 3JAMZ 4EJWA 1RI7A 1QPIA 1SFKA 2FBKA 5LEJA 1U9OA 3Q3SA 4EJTA 3F8NA 1CGPA 1Q1VA 3KX2A 1Y6IA 3E6BA 4F93B 2EV5A 2H8WA 2CW8A 1RRJA 5K7HA 2KIFA 2XF5A 2CMPA 2VIXA 3ERMA 2CQKA 3VSLA 1AWCA 3K4MA 3MZHA 1ETQA 4ENMA 1HKQA 5IOYA 1ENHA 1LFBA 1SD4A 2DA5A 3ZR8X 1PUEE 1LDDA 1QPMA 3JRDA 4WX9A 3IH4A 5E1WA 2QSGX 2CUFA 4Q5SF 3AL0B 5LRRA 5D5WB 1FOXA 4I98B 2FU4A 5CJ9A 3KPHA 2ETHA 2B63J 4KICA 5D4SA 1MH3A 1BA5A 1Z0XA 3OYHA 1MZBA 2LR8A 2MC3A 5D6FA 2UV1A 1Y0UA 4XQFA 1IW7F 4KFCA 1MNDA 2RAEA 2CQQA 4LB5A 3CUOA 2RQPA 4UNOA 3E5UA 5ICCA 4RA2A 1BR1A 3ZRGA 2L4MA 3L2QA 4HQEA 5GTHC 2P0WA 1ULYA 1PVEA 5F64A 3CUQB 4CCOA 2CUZA 5K7ZA 2E1MB 1U2WA 4L9JA 1O7LA 3U21A 1SD5A 2IGKA 3AKZA 1GLNA 4RAGA 3CDLA 2WTEA 5CQGA 2RV8A 4A3JJ 3HRSA 1WKMA 3I0TA 2YSRA 3I59B 4LFUA 5HDKA 5FLXK 3MKZA 1QZEA 1K7AA 1OCZH 4JX6A 3TO6A 4KA4A 1T0FA 4BNCA 3CJTB 1Z9CA 2CG4A 2ID6A 5B66C 1HSJA 4QLCU 2DPDA 2QGUA 3BP8A 4C3JJ 1TQMA 3BDDA 4L5IA 4Y4RA 2G0EA 2ESHA 3ASOH 2ESNA 3RKYA 2YX4A 3F21A 3IH3A 2WV0A 5AIPA 3QRFF 2VPRA 1UCRA 1MBJA 3VPRA 3DPTA 1MBFA 3E6DA 2AXTC 2AS5F 3CF5F 4AUXA 3J7AO 3WHBA 3V7SA 2R5ZA 1SFUA 2L5QA 3GX4X 1Y1VJ 2RREA 2QM3A 3ZMSA 5CKTA 3JR9A 3IRRA 3FZVA 2B0LA 4NC8A 1XG1A 1W36D 5ICFA 2LKPA 3CP8A 4EQQA 2KZGA 4O5VA 4RB2C 1TL8A 3F23A 1EJ9A 3VODA 3OYJA 1O3RA 3HOVJ 3OYLA 3OYBA 4ZTJA 2Y9ZA 4OIPF 2ISZA 5DEQA 3HKZA 2QA4I 4MEXF 3S2HJ 4R1HA 1FP2A 4OINF 3RPQA 2KFDA 4S0HB 1XMKA 2WBMA 3TP3A 3SEQA 4M9XA 1RC9A 1I3QJ 1J75A 3ECHA 1FOKA 2R7DA 1S9HA 3I56I 4A0XA 4ASNA 3GLXA 2NVQJ 3QPTA 3C2BA 1D8JA 1FYMA 2K9QA 3M1EA 1XTAA 2B9SA 2IXSA 3S17J 1EH7A 4BL0B 2XASA 2YU3A 4IVNA 1VQMI 2E7WA 1YS6A 3MQ0A 2HS5A 3DKWA 3NEUA 1QZZA 4OAZA 2Y75A 2LH9A 4JP0A 5ILVA 3MMYB 1P4XA 2XAHA 4HSTA 4II3A 3CO6C 1ONVA 3LMMA 3CO7C 5H6QA 1FSHA 4RAZA 3W6KB 1X1PA 1HLVA 2AQFA 3V8KA 3ML6A 1WJEA 3HC7A 6PAXA 2E71A 2FNAA 3CMYA 5GAHJ 2CUJA 2VQLA 3OL4A 2QVOA 4PJMA 2F4MB 2QENA 2QWWA 2CQXA 3SZPA 3GO5A 4B44A 5C44J 1L3LA 4I02A 2A3SA 1J9IA 1JT6A 5GPCA 2Z99A 4A12A 4UV9A 3CJRB 5IT9Z 3QYFA 1XDSA 2E35A 2UXXA 1UG0A 1XGNA 2QEXI 1ON2A 2H94A 1HCRA 2CGPA 2AXLA 4XLNF 5CLSA 1HW2A 2UZKA 3QYEA 4MEYF 1JT0A 2IA1A 3CCSI 2JSPA 4ZYAA 1QQIA 1Z1DA 2XC7A 1ZK8A 1MMAA 1X2NA 2Y2ZA 2R7ZJ 4A0YA 2DI3A 4BXFA 1YTYA 5L3DA 4FHTA 1OQYA 1TNTA 3PQKA 3ZQGA 4E7JA 4F3QA 4EEFG 1UAAA 2XB0X 2RC4A 1ZLJA 2AO9A 5J47A 2E2HJ 2D1HA 1QA6A 2QQAA 5FKKA 4EV0A 1IUFA 1ON1A 5TISC 4HW0A 1TTYA 3UNGC 2GWRA 3BTJA 3BZCA 1OYWA 3HRTA 3IHUA 1VNDA 3KZZA 2HDCA 5HS9A 2W00A 4XLEA 1ZG5A 2MA3A 1KU2A 5ILUA 1MMNA 1UHSA 4LK0F 1A31A 4E7KA 1BR2A 4A3KJ 3DPUA 1D1BA 3S1QJ 2M5WA 3QQAA 3WTTC 4D7MA 1WPKA 2JSCA 4DBRA 2NNYA 1VI0A 3GCMA 4N9IA 4ABZA 1IN5A 4DZPA 4ZTFA 2MG4A 1UHMA 1F9NA 2ZCWA 2EA2A 4DYQA 2EA4A 2JZYA 4UV8A 3QOEA 3PO2J 4YEJA 1ZGWA 4QSHA 2LBFB 1OJLA 3PNYA 3SEZA 3CLOA 2D5VA 5E18F 1R49A 2O3FA 4DZJA 1KYWA 2DA1A 4A93J 1DUXC 2UXNA 5GPAA 4D1QA 1XSVA 1X1DA 3CUQA 1MH4A 3SDGA 5LGNA 1QHGA 2WY7Q 5ERIA 2V1DA 1XGOA 2R7QA 5L3BA 2QQBA 1V4RA 4HF0A 2J5OA 1EKEA 2M4GA 3OL3A 1OYYA 2DMPA 1TLHB 3UKGA 3IAM2 4LOCA 3I59A 3ZQIA 3A01B 4A3IJ 4HZFA 3LSRA 2WAEA 3C2HA 3EETA 5EEGA 4BGDA 1LDJA 2HNHA 1YIJI 2CV2A 3GTOJ 1SAXA 3E5XA 4PJ0C 1K4TA 3A0BC 1JHHA 3LSPA 1LFPA 2VE9A 1IV6A 4BDZA 3S1NJ 1MBGA 1SD6A 2VLAA 4HA8A 3MFKA 2K9NA 2M7BA 4ZH4F 2Y0SN 1QU3A 2OTJI 3U9GA 2DYSH 4OMYA 2W57A 3F0CA 4NC6A 4ESFA 1IN4A 5J6XA 3FK7A 4CCKA 2QBYB 5JFRA 4CGZA 2D1VA 4MHGA 3GTKJ 1N75A 4MFDA 3CD6I 5F08A 2F5FA 1T0FC 4IF4A 1R7JA 1VTNC 3ZMUA 2X85A 2EFQA 1MBEA 3D5SC 3BQZA 3IWZA 5IP9J 5JHUA 3DV8A 3LA3A 4LGWA 2IVMA 3OMYA 3V7RA 4JQFA 1S6LA 1APLC 4UB8C 3G1LA 4LD5A 4RB0A 4M3DA 1BI1A 2DMNA 3KETA 3W2WA 4CICA 5LBQA 2KRHA 5KK1A 4ZDOA 4A3FJ 3H0GJ 4HDVA 1TQIA 2DFFA 5IOZA 4AVPA 2QUFA 4YIIA 3IWFA 4JX5A 3VYRB 4B4CA 1T98A 2AQEA 4IQJA 4QIWN 3DBRB 4FISA 1Z3XA 2J5PA 2KRFA 4O6JA 2K3PA 3CCUI 2XAFA 5M3MJ 3BCBA 3F8CA 3G1OA 5F0CA 2STWA 2L3DA 3QU3A 2HVRA 4IKFA 1LQ1A 5DTDA 1E3HA 2P81A 5B1BH 4IHSA 3KP2A 2R7RA 5GADJ 2RDPA 1USTA 3VDXA 3Q9VA 4ENKA 4UUSB 2KQRA 3PM1A 2BY0A 1Z3YA 3JW4A 4JOMA 4CYDA 4FCYA 2IGOA 2DMQA 3K1NA 4RLQA 1KU3A 3DLAA 3RPUD 3BTCA 2DLLA 1MSFC 3OYGA 2R4GA 5A2QZ 4TV7A 1QNTA 5ILSA 4LB6B 3TEDA 1IN7A 2Y9YA 3ZN1A 4PJNA 3GVAA 5E79C 3VYUB 1LNWA 1USSA 2P6TA 1HDPA 5BQTA 5FRNA 3BJOA 1RNLA 2DU9A 2CRGA 1D5YA 3IH2A 3CDIA 2DYRH 5BMZA 3GTQJ 3RDIA 1TT5B 4WCGA 3RZOJ 4HNUA 3HOTA 5C3EJ 2ZO4A 1JUMA 1D1AA 1YLFA 2DTRA 3GTGJ 2XKOA 3RYRA 1DP3A 2F5DA 1IJWC 5IY5H 1E2XA 1HA8A 3DKYA 2W82A 2HQRA 2Y0MA 3BJ6A 2ISYA 2QQ9A 1YE9A 2NOGA 3Q0UA 2CFXA 3GFMA 5BPIA 5IYBJ 3RIRA 2EB7A 3HYIA 2XHKA 5GTIC 4DOZA 5F0FA 1TNSA 3RI4A 1V5FA 3FMSA 5L3GA 1ETOA 2DFHA 2EK5A 2RN7A 5E3MA 1H9GA 5HLIA 1UMQA 1ETXA 2IBDA 2W48A 1FIPA 4LG3A 3DFGA 3DCFA 1U8BA 3ZXSA 3MKLA 2HDWA 2H6BA 1IDYA 4FETA 2CV1A 1R23A 4A2UA 4BKXA 1SANA 5KHDA 4GYIA 2LDUA 3HRMA 5L3FA 1SMTA 1MMSA 2ICWG 1JI8A 4XRMA 3G4SI 3KLNA 1HXDA 2NOJB 4IJAA 1JUSA 5EJCA 1O3SA 4N4OB 2MLGA 3BG5A 2ELJA 1B9NA 4L18B 3HOWJ 4D5CA 1KA8A 2BBYA 1XB4A 2O9LA 1LB2A 1YITI 3QWLA 1Z77A 4CA0A 4U7BA 3J7YJ 4RAYA 1JE8A 1JXSA 1FSEA 4DYCA 1GV2A 1IF1A 4Z6YA 4IOCF 2A61A 4ZDLA 1BJAA 2L2OA 4M73A 5FJ8J 1XMXA 4GO1A 1YIOA 3CC2I 4KIFA 3ZMVA 4EJOA 2HPIA 1LPQA 4BHPA 2VB6A 4HLYA 3SJMA 1OKRA 1RZ4A 1HC8A 4Y13A 2HXOA 1O3TA 2FX0A 4FQGA 4P55A 3DU6A 5LRSA 4HNVA 1ETVA 4QTRA 1FX7A 1Z05A 2KDZA 1JKRC 3L09A 4MTEA 2HXIA 4ZZDA 2IS1A 3R6SA 2DT7B 4L9VA 4V2FA 2RQQA 4LIVA 3ZMDA 3PIPF 1QZYA 1D1CA 2OCEA 3CQZJ 2ZNZA 2KIQA 2R7XA 1I1SA 4PZJA 2BVLA 3WU1B 3IP4B 1J5YA 1ZH5A 1T39A 1X2MA 1KQ0A 2DFIA 5L3CA 1XPXA 4KMFA 2VXZA 2VN2A 3EUAA 4L9TA 3RQ4A 3BG6A 2XF6A 2G9WA 4I6ZA 2E2IJ 2IPQX 3PUFA 1SC7A 3I5UA 1K6YA 4OMZA 1K61A 3RKWA 3AL0C 2FMYA 1X3UA 2WAFA 1U6GA 3A01A 3Q5FA 1XMAA 2FA5A 2KL4A 2R7FA 4PDKA 1S72I 4QWQA 1TWCJ 3ZQCA 1CQTA 1T33A 4IRIA 3QODA 3WTWC 3D5RC 2KP6A 2PMZA 1KGSA 1TC3C 2DQLA 2DMUA 3TGNA 2BXYA 1B9MA 1LJ9A 4FASD 1W36C 1AHDP 5J4VA 3CUQC 2M2EA 5HS7A 3CZ6A 2Q0OA 1TP4A 4Z2YA 2E1MC 2PMHA 2PFBA 1WJFA 3P5JA 1LVKA 1Y8RB 1REPC 1YFHA 1S7AA 2XUBA 3BY6A 3R60A 1UJ8A 3SZTA 1OR7A 2QBYA 3TOAA 4C3HJ 3MEXA 2E5ZA 1A5JA 1LEAA 1FOYA 1E17A 1P92A 2CWEA 4BJ6C 2DK5A 2P7CB 3LNQA 1I6XA 2NAZA 4HLXA 2CH0A 2ZSIB 3ABKH 4KJZA 4P5OA 3WG7H 4BY1J 1PYVA 4B47A 3OYAA 3H35A 2CSOA 3GFIA 3I55I 4CUGA 2R93J 2VC0A 2KHMA 2V1UA 4M9ZA 4WXCA 2D45A 2YS9A 3WE2A 4W97A 1ORKA 2HTSA 1BIAA 1B1BA 2ZBKA 3W6JB 2M7AA 2NVXJ 5ICEA 1YI2I 1OCCH 3GTPJ 1MBHA 2LP0A 4NBQA 3RKQA 1VQPI 4IHWA 3S14J 2IJLA 3HPHA 3OYKA 1D0ZA 2L9SA 3B6AA 1LFUP 4MO7A 5F1JA 1W7PB 3W2VA 3K2ZA 1Z7UA 1XS9A 2IAIA 1RR7A 3ABLH 2JVHA 3V4GA 1AA7A 1ETKA 2XVCA 1WFXA 2JJ7A 1H8AC 2XGCA 2F2EA 4F92B 3HOUJ 3E0JB 4UUSA 1IC8A 4BE1A 2K9LA 3KCCA 1NG6A 3P9CA 1Z67A 5DUIA 1GXPA 3O8GA 3SHFA 2PEXA 2MH2A 1B8IA 3VFZA 4AIDA 4S05A 3LSGA 2BHZA 1MJ9A 3K4BA 3ELKA 4II2A 2DA6A 5D5VB 2PX9A 1ERDA 1G3WA 2XRLA 2VL8A 4RMNA 5AIQA 3VYSB 4CZZA 5KCMA 4B09A 1WJDA 4CYCB 1O3QA 1ZARA 2LNBA 1BN5A 2ZFUA 3ROUA 1IN8A 2MSYA 1SFOJ 1F4KA 5EZGA 2VJ5A 1MD0A 5AONA 4PFOA 4CCNA 2VJ4A 3K4LA 1BI2A 4F7ZA 2Q2EB 1BI0A 5BNGA 2DN0A 3H5AA 3N05A 1YO5C 1ZKGA 2Z9OA 3IV5A 5K1YA 4EMSA 3OYNA 1IXCA 2IEKA 1B59A 2LFBA 3T1BA 2A6TA 4HV6A 3M4OJ 2BXZA 5E1ZB 2DOFA 2Z16A 2K86A 2DW4A 1S5LC 1WRJA 3MN2A 3HBLA 3E1SA 2MYSA 1Y56A 5E20A 2CU7A 3JRGA 2N8GA 3M3YJ 2R5YB 4AVZA 2LTPA 3KFWX 1WH7A 3WTZA 4XKCA 4NHJA 4ETSA 3LSMA 4YIFA 2DA4A 1DQUA 2XRNA 2D2WA 3KP7A 3U1DA 3AAFA 2K40A 1FJLA 2HOTA 1HKTA 2FXAA 1P2FA 2JRMA 2F48A 1XCBA 2JPBA 1G59A 4WWCA 4N4NB 1HSTA 3WGGA 4EJUA 3LFKA 1UELB 3J7ZI 1VZ0A 4BQOA 1V5EA 3H92A 4CO8A 2BYVE 2A07F 5FLXZ 3B02A 1JTXA 1ODDA 4XBFA 3L2VA 3TO7A 2R7TA 3HEFA 3ZQLA 2VBXA 1KZHA 4ZC3A 3K10A 2DMTA 5DCMA 1N25A 3V8JA 4N9HA 2M3AA 1O4XA 1PP7U 2M8EA 4MNUA 1F36A 2HGCA 2DAOA 3M8EA 5D4RA 4AM3A 2JN6A 2O03A 4XIDA 4BU2A 1K78B 1HBXG 2W7NA 4RM2A 2CW7A 2ZJ2A 4U0YA 4L0YB 1PP8F 1XCVA 4IRGA 4LK1F 3HOXJ 2PN6A 3FIWA 2NYXA 1A04A 2E34A 3LSHA 3HSEA 3BROA 3B6CA 1D5VA 4LG0B 4A3GJ 3FXJA 5J1RA 4HEA2 4I7HA 3Q9SA 5FD6A 4MTDA 5FKMA 2XAUA 3R4KA 2R7OA 3LAJA 4KDPA 4YFNF 3I53A 4EM2A 1S8NA 1I27A 2ZXWH 3TW7A 2I8DA 3DU5A 1SEUA 1WZ2A 3H9JA 4RGRA 4G6DA 5J1UA 2GIZA 1PDNC 4LLNA 3BZKA 1LUJB 2V9VA 3BR0A 4HG2A 3HIFA 3BC8A 2DBBA 3FK6A 3FHZA 2IT0A 1ZYRF 2P5KA 2HR3A 2E36A 4AIJA 4BHBA 1FMVA 1T95A 2E1CA 2JA7J 2KMUA 2DTZA 3MCZA 4HQMA 3OYCA 1T6SA 3VEPA 4BQQA 2MD5A 3EUHA 2EIKH 4B43A 4Q4ZF 4CCMA 2NS7A 3CC7I 3BR2A 1ZAOA 3H5NA 2CUEA 1FYLA 1XGSA 4G7ZF 4XOTA 2A6EF 2M9HA 2MLKA 4DW6A 1D0YA 1V55H 5FD5A 4U87A 3P9IA 2EBIA 4XLHA 1PJRA 2GBYA 3F8BA 1XD7A 2ID3A 5HLTA 1SFEA 1ZN2A 2HKXA 4Y15A 4KYWA 5E17F 4O3MA 1VQ4I 2X1CA 1G8XA 2OU2A 2F6CA 1MJBA 2COMA 3PQJA 1QVUA 4RLFA 4DYRA 3CMMA 1C0WA 1A35A 3BZ6A 2HWVA 3HDDA 4FX0A 1R1VA 3HGGA 3I71A 2DJNA 5EGOB 4J01A 3GMEA 2JA2A 2LKSA 2X1EA 1U9NA 4A5MA 2NVYJ 1MJAA 2A6HF 4M71A 1TWGJ 3ISPA 2OZUA 2CQNA 2KJCA 3K70D 2DODA 4D0PA 4KN4X 2C6YA 2H6CA 4M3GA 2M34A 2BW3B 1YQAA 4NDLA 4HX7A 3LA2A 2DOEA 2IGNA 3E7LA 3NAUA 5HDGA 3V8LA 2BZTA 1MSEC 3SFZA 3F3XA 3RTRA 5C4JJ 4HF2A 3C7JA 2JVGA 2QKMB 2JK3A 1OR7C 3JRFA 4UXNA 2ZKZA 5IYCJ 2IW5A 3D1NI 2MD0A 4G94A 1R6RA 1LDKB 4G9YA 4HSRA 2E2JJ 4RGSA 1GHCA 4BE0A 2NXNB 2FF4A 1MNMC 5L3EA 1DPUA 3EYYA 3L1PA 4M74A 4BQAA 3L9FA 4P1WA 4EGZA 1HF0A 3K0LA 5TRDA 4F52A 2A5WA 4HOBA 5H20A 1WJAA 1KU9A 1YX5A 1VQOI 5E3OA 1RKTA 3B73A 3AFHA 4S04A 4CDGA 5EG0B 4FE7A 3SDBA 2QSFX 3K7AJ 4WF2A 2VC1A 3M9AA 2R3SA 2PJRB 3CCQI 4MFEA 1QBJA 3WTUC 1ZQ3P 3OYDA 1IRFA 2EFOA 4XRSG 4GFBA 1ZRCA 3ASNH 1JUPA 1R1TA 3TKYA 4I0BA 4CYCA 1R5GA 2ECCA 2HOEA 4XRFA 1OLTA 1I50J 4QPQA 2R0QC 4GYGA 3ZOBA 4A5NA 1BC7C 3OS1A 4FT8A 3DTEA 3FM3A 4JBAA 2Q2EA 3E97A 4U88A 2XDVA 2VBZA 3DPLC 3FM5A 4PFPA 5ICGA 4BH9A 3K4CA 4BBRJ 5D8KB 2EH3A 2GXAA 4XLCA 4DNCA 4CCJA 4ANJA 4E7ZA 3G6EI 4KUMA 4A69C 2JA8J 4IXAA 3ABMH 1AU7A 5M5WJ 1ACIA 1TT0A 3BCAA 1R1UA 3JSOA 4GXOA 1YRNB 2VPLA 4IHYA 2QF7A 2X0LA 5DYMA 2K27A 3J81Z 2Q1ZB 1LKXA 2R5YA 3R0JA 1FTTA 3G2BA 3MZ8A 1U5TB 2XPUA 4EM0B 4BHCA 1JGGA 3KEOA 2RGVA 2ZNYA 4QPOA 2WB1N 2EZKA 2EQRA 4KNYA 4BEHB 1F43A 1JKOC 2MW8A 1JGSA 3DEEA 1FLIA 4U7DA 5FLVA 3HXLA 1FC3A 1ZRFA 2JA6J 4AWXB 5D5XB 4B3AA 2DXIA 3HOYJ 2HZTA 1VQ9I 1HW5A 2ZMEB 2IS4A 3F6OA 5FFXA 4EVIA 3SQNA 1IZ1A 1VF9A 2Y0SA 4CZCA 1XDUA 2TRTA 4BY7J 5DS9A 3IC7A 3C18A 2Y69H 4A3EJ 3S1MJ 1RR8C 2HVSA 2V79A 1B72B 3JTGA 1Y1WJ 2WAQN 2KKOA 1G6NA 1L0OC 1RPWA 3TMOA 1VQKI 2P6SA 2PJPA 3H36A 2H09A 2V26A 1BIBA 3KZIC 2JWTA 1K78A 4HYEA 1WHUA 2F5EA 3PNTA 2IS6A 2BE5F 1K4SA 1QVTA 2YU9J 4BS9A 4X6AJ 4AIHA 3FHNA 3LOCA 3E6CC 2L0KA 4GGGA 3PO3J 1E3PA 1LE8B 4AYBN 1WSUA 3ZMTA 2FD5A 2ECBA 3S2WA 5DV5A 5M5XJ 3CTAA 5KAIC 1MMDA 5F27A 4BACA 4UVAA 1EV7A 5LD2C 1N77A 5CYVA 3PIOF 1IXSB 5J3LA 4IHVA 5FRMA 1IRGA 3EQLF 2OBPA 3GZNB 3S16J 3LSTA 3AG2H 3G73A 2LRDA 2FSWA 2PBIA 3DKXA 1SVOA 3O2PE 4W1UA 1BOAA 3GTLJ 3LFUA 3IL2A 2VI6A 2VBYA 5HNHA 2P5VA 1D8KA 1Y0NA 1B6AA 4E7SA 3FXQA 3CCMI 3G71I 2OPTA 4LLGF 2E7XA 4V2GA 3OSGA 1R9TJ 4M72A 3TQNA 4LMYA 4KMUX 1T8IA 1BBYA 4ON0A 1J09A 4GCVA 4F55A 3ZP5A 3QYBA 1IG7A 5FKLA 3H9QA 4KT6A 3U2RA 3KLOA 3RYPA 2E5NA 4M9SA 4A3CJ 1QHHD 3ECOA 2G7UA 3H0DA 1D0XA 5DD8A 5K7FA 1FYKA 3IUOA 5FROA 4CHUA 3MVPA 1DU0A 3L7WA 1AKHB 4C3IJ 2L9NA 3KP3A 3C2GA 2CV0A 1YJNI 2E60A 3BG7A 3OWTA 3TW6A 1DDNA 2XB5A 3KEYA 2P8TA 4OIOF 1DGRM 2X6XA 5EGOA 4HAMA 3EUHC 1Z21A 4UHTA 3EUKL 2F5CA 4PSWA 5E3NA 2Z3YA 2X51A 3OR2C 3MKWB 4E6KG 1YG2A 2LYCA 3IKVA 3BR5A 4IPAA 5H2FC 5JHFA 4FX4A 5ED4A 4NUBA 4P96A 3PJRA 3GTMJ 2UWMA 2BW3A 5HNFA 2LG4A 4HPQA 3WTXC 5IYDJ 2GQQA 3RZDJ 3CF2A 3VSKA 1WVRA 1WQ2A 4XNFA 1MNEA 4I0AA 4BJTA 5CPRB 1NK3P 1RETA 2I5UA 2K4JA 4BDYA 2HPMA 3FBNB 2DPUA 3NWTA 1D3YA 2EZLA 3RCOA 3OS0A 2NS0A 1F5TA 1YOVB 3G3ZA 1KQ8A 3ZQQA 1J7KA 3IKTA 1OMIA 5F1RA 1IAWA 5D6EA 3WODF 2VASA 3H3VK 4LJZF 2EILH 2XGXA 2K9MA 4JYKA 1R58A 2ME6A 2FOWA 5DUKA 3FKJA 2KISA 4M6VA 1VQ6I 2XAQA 4XM3A 2HTJA 4EGYA 1UFMA 3MAJA 3O8HA 4OU0A 3I4NJ 2A05A 2MFZA 1LVAA 3C1DA 3CC4I 5EG0A 2LBFA 2Z1DA 3AG1H 1OCRH 3OIPA 4XICA 3BR3A 3OR1C 5EF6A 1TQPA 3N97A 2LD5A 1U78A 1K6OA 3IRQA 1DGWY 1O57A 3BG9A 5HLHA 1VQNI 2E1NA 2X9DA 3E6MA 3S3MA 2X6WA 4JX4A 3CLQA 4L9NA 3GF2A 2Z2SB 1KYZA 3DXJF 1JTYA 3TDUC 2GLOA 3QOPA 1G3SA 1WGXA 4D7NA 3COAC 2EZHA 4IZZA 3K6GA 3VWBA 2VQGA 5LHIA 4J00A 4E7HA 3QP6A 3OYEA 2EFWA 1NH3A 4G6QA 3W6VA 3M7GA 4KIGA 2RKHA 1T56A 2VKHA 1XSDA 2DFEA 2GOMA 2Y31A 2HYGD 3QAHA 3FXMA 1TBXA 1YW7A 2DO7A 2GOXB 5E1XA 4YG2F 1GUUA 4UVBA 1R5HA 1YRNA 2ZC2A 2DT5A 2HOSA 3V7CA 2WC2A 3HG9A 4ESBA 4C2UA 3C3WA 4HRIA 3A1YA 4A6EA 3PSFA 1NTCA 1XSXA 4KIBA 3DWLE 1UZCA 4PSXA 3CP2A 1U5TA 3QP5A 3JAMK 1IGNA 4RM3A 3ERED 3HUGB 3F22A 3WTSC 4BEHA 2JPCA 4C9YA 3WTYC 4XSXF 2O0YA 3AG3H
chains in the Genus database with same CATH topology
3WGIA 2M45A 3ZQ7A 1ZRDA 2HQNA 1R00A 5DCFA 2FEZA 3E3VA 2VONA 2ZMEA 3WE3A 1MGTA 1ZREA 1STZA 3J80Z 1BC8C 5LGUA 3REOA 1Z91A 3N4MA 3HHHA 2VODA 3M8FA 4AD9A 2QYOA 3CDHA 2XROA 2GXGA 4M6YA 1ZLKA 5E8IA 2DK8A 2FBHA 3ABUA 1YW9A 2PMUA 1RUNA 3WG9A 1FBSA 4ENJA 4HDUA 3EDPA 1V3FA 3ABTA 2KIMA 4MQVA 4CXFA 5HVQC 3OV8A 2VOOA 1WI9A 2QLZA 3FMQA 1I1GA 2MH9A 4IRHA 5FB2A 2K02A 2XIGA 2G7HA 5HS8A 3FX3A 1P4AA 5CVIA 3I64A 5CVVA 2MBFA 4ZYHA 1XN7A 1MDMB 2L4AA 1AOYA 3VOEA 2OQGA 3ZMZA 1FWZA 1W7PD 5HLGA 3GXOA 1Z6RA 4LLLA 5JR3A 1O7FA 2LF8A 2RNJA 5BS6A 2L01A 2IRFG 3I54A 5JVTA 2Z5UA 1EH8A 1U8RA 2PI0A 4JK1X 4HX4A 2X4HA 1OPCA 3JTHA 2BEOA 1SFXA 5BPDA 4MQ9F 2GA1A 1FZPB 2A68F 2FE3A 3ZN0A 3KE2A 4DQ2A 3RKXA 1IUYA 2O8XA 2VT2A 3QPHA 2ZXJA 4EJVA 2JTVA 1IN6A 2WWYA 3NRVA 5K5OA 5DD4A 4WK8F 1FBQA 1J2XA 3R61A 3DF8A 5JI6A 5IT9K 2EWNA 1ZGJA 2STTA 2M87A 2HYFA 4OOIA 3P9KA 4K2EA 4G7OF 4G7HF 2GIVA 2RVCA 2P7VB 4XLPF 1MKMA 5K5RA 2W24A 1OYIA 1W5SA 2XV4S 3GYHX 1XGMA 2Y48A 1S3JA 2YPRA 1UHWA 3GW2A 3D5LA 5LGTA 1TW2A 2OA4A 2QZ8A 3GFJA 4B8XA 4UVCA 1G4DA 3TOBA 3HUGA 1KQ9A 3SXYA 3E5QA 2OAZA 4YFXF 5TJJA 4KT5C 4Q48A 4NB5A 2NRAC 2PQ8A 2FNPA 4ENNA 2JT1A 3I4PA 2M30A 3WTVC 1U5TC 4EM1A 2YR2A 2M1BA 3LWFA 3PFIA 2V1XA 4I2OA 5J8FA 2PLYA 1W7PA 2HKOA 1BM9A 1CF7B 3ULQB 4RGXA 1SD7A 2TDXA 1JHFA 3NQOA 1RUOA 1GVJA 3GZ5A 3MWMA 3ZPLA 1SMYF 2Q8KA 5E8GA 2PG4A 4U0WA 2EV0A 3KP6A 2FMLA 1Z6TA 4A6DA 2ZFWA 4HV5A 2K4BA 4R79A 3HHGA 4H0EA 5DDGA 1QO0D 3HTSB 4R8HA 2FOKA 3F72A 3GFLA 3BPXA 3J81K 4Y17A 4OIRF 3KP5A 5FO5A 2CYYA 2EFPA 4OIQF 2ELHA 2YX7A 5K5QA 1RIOH 2Z33A 3R0AA 4WXDA 1HQCA 2GZWA 1J0RA 1MDMA 4ZZLA 3VB2A 3MZYA 3HTUA 2V6CA 2IA2A 2CW0F 3JSPA 2OZ6A 5IT3A 3HRUA 1GXQA 1EH6A 1FNNA 3RJPA 1KU7A 4AIKA 4RB3C 4ESJA 3FXRA 3DQVC 2A5YB 3LQQA 1NHAA 5FFZA 2HFHA 5BOXA 2KJBA 3EYIA 5HDNA 3T0YA 4HBLA 2VT3A 4BAYA 1WWXA 3P7NA 4Q47A 5CVUA 1T38A 5A2QK 1S7OA 5EEHA 2XKPA 4HX8A 3FMRA 4I01A 4LG0A 5CVRA 3LAPA 2VE8A 1G3YA 1FPQA 3DP7A 4N0BA 4PCQA 3F8MA 1HKSA 2GXBA 2H27A 4L0ZB 4YFKF 3LQRA 2IP2A 4UUVA 2GAUA 2KIUA 5F6FA 1P6RA 2O61A 5LHHA 1H0MA 3GEZA 4A0ZA 3GUDA 5HOOA 2W85A 2LF7A 2IA0A 2W84A 1BI3A 1LEBA 1FBUA 3K1MA 3WGHA 4BYYA 5CVJA 2GA2A 2JRTA 2NNNA 1U3EM 1YS7A 3OOPA 4MGRA 5LLQA 4PGHA 1FT9A 2EJRA 3H3ZA 4XSZF 4RGUA 2BGCA 2L54A 1FP1D 4M6XA 3K9TA 1K79A 4ZYDA 2HEOA 3CJNA 1QGPA 5FGMA 3KZYA 4G8XA 1DP7P 3GWZA 2BV6A 2L02A 4ZYGA 1I5ZA 1W4MA 1Q1HA 1YW8A 2O6GE 3K69A 3HSFA 4RB1A 4L5JA 1CF7A 5DCMB 3TO9A 2VBWA 3WU0A 2EFNA 3K1PA 1W5TA 2FQ3A 4I09A 1HW1A 5J8CA 3HOSA 1R22A 5D5UB 2OQRA 2FRHA 1UB9A 2XAGA 3GZ6A 3KP4A 4PGGA 5LEKA 1H9TA 4NQWA 2OD5A 1J59A 3O6BB 4P9UA 3L00A 5D8LB 5LHGA 3BWGA 2DQRA 4E70A 3FWEA 1T2KA 3I58A 1F1ZA 1R36A 3LA7A 2FBIA 2P5LC 3BJAA 2P4WA 3QU6A 4RS8A 5H6RA 3TDZC 1ZG3A 3J80K 1ZG1A 3F8FA 3O3KA 4P9FA 1ZGAA 1ZHFA 1G3TA 4IHTA 1S29A 1YYVA 4WXHA 1DPRA 3BOQA 2EV6A 3FXUA 2ACJA 2W25A 4ZYEA 3FF5A 3RPUA 1B4AA 2ADUA 4BXUA 4HF1A 3D0SA 3T8RA 2LSOA 3KEQA 4KN7X 3BPVA 3DEUA 5KVRA 3HSRA 1P4WA 3F6VA 2XAJA 1FY7A 4U0VA 3T5XA 2VOPA 1IXRC 1TW3A 2CO5A 3L2CA 3H3UA 3T8TA 2K7LA 2A69F 3JAMZ 4EJWA 1RI7A 5LEJA 2FBKA 4EJTA 3F8NA 1CGPA 3E6BA 2EV5A 2KIFA 2CQKA 1AWCA 3MZHA 4ENMA 1HKQA 1SD4A 1PUEE 1LDDA 1QPMA 4WX9A 5E1WA 4Q5SF 5LRRA 5D5WB 4I98B 2FU4A 5CJ9A 2ETHA 4KICA 5D4SA 1MZBA 5D6FA 2MC3A 1Y0UA 1IW7F 4KFCA 4LB5A 3CUOA 2RQPA 4UNOA 3E5UA 5ICCA 2L4MA 4HQEA 1ULYA 5F64A 3CUQB 1U2WA 4L9JA 1O7LA 1SD5A 2WTEA 2RV8A 3HRSA 1WKMA 3I0TA 2YSRA 3I59B 4LFUA 5HDKA 5FLXK 1K7AA 3TO6A 4KA4A 1T0FA 4BNCA 1Z9CA 2CG4A 1HSJA 4QLCU 2DPDA 3BP8A 1TQMA 3BDDA 4L5IA 2ESHA 2ESNA 3RKYA 2YX4A 3F21A 2WV0A 5AIPA 3QRFF 1UCRA 3DPTA 3E6DA 2AS5F 3J7AO 3V7SA 1SFUA 3GX4X 2QM3A 3ZMSA 3IRRA 3FZVA 2B0LA 5ICFA 2LKPA 4EQQA 4O5VA 4RB2C 3F23A 3VODA 1O3RA 4OIPF 2ISZA 5DEQA 4MEXF 4R1HA 1FP2A 4OINF 3RPQA 1XMKA 4M9XA 1J75A 3ECHA 1FOKA 2R7DA 4A0XA 4ASNA 3GLXA 3QPTA 1D8JA 1FYMA 3M1EA 1EH7A 2XASA 2YU3A 4IVNA 2E7WA 3NEUA 1YS6A 3MQ0A 2HS5A 3DKWA 1QZZA 2Y75A 5ILVA 1P4XA 2XAHA 3CO6C 1ONVA 3CO7C 5H6QA 1FSHA 4RAZA 3W6KB 3V8KA 3ML6A 6PAXA 2FNAA 2QVOA 2QENA 2QWWA 3SZPA 3GO5A 1L3LA 4I02A 2A3SA 1J9IA 2Z99A 4A12A 4UV9A 5IT9Z 1XDSA 2UXXA 1XGNA 1ON2A 2H94A 2CGPA 2AXLA 4XLNF 5CLSA 1HW2A 2UZKA 4MEYF 2IA1A 1QQIA 1Z1DA 4A0YA 2DI3A 1YTYA 5L3DA 4FHTA 1TNTA 3PQKA 2RC4A 1ZLJA 2D1HA 2QQAA 4EV0A 1ON1A 4HW0A 1TTYA 2GWRA 1OYWA 3HRTA 3IHUA 3KZZA 2HDCA 5HS9A 1ZG5A 2MA3A 1KU2A 5ILUA 4LK0F 2M5WA 3WTTC 2JSCA 2NNYA 4N9IA 1IN5A 1UHMA 1F9NA 2ZCWA 2EA2A 2EA4A 2JZYA 4UV8A 3CLOA 5E18F 2O3FA 1KYWA 1DUXC 2UXNA 1XSVA 3CUQA 5LGNA 5ERIA 2V1DA 1XGOA 5L3BA 2QQBA 1V4RA 4HF0A 2J5OA 1OYYA 1TLHB 3I59A 4HZFA 3EETA 5EEGA 1LDJA 1SAXA 3E5XA 1JHHA 2VE9A 1SD6A 4HA8A 3MFKA 4ZH4F 3U9GA 4OMYA 2W57A 4ESFA 1IN4A 5J6XA 2QBYB 5JFRA 4CGZA 2D1VA 4MHGA 2F5FA 4IF4A 1R7JA 1VTNC 3ZMUA 2EFQA 3IWZA 5JHUA 3DV8A 3LA3A 4LGWA 2IVMA 3V7RA 4JQFA 1S6LA 4LD5A 4RB0A 1BI1A 3KETA 4CICA 5LBQA 5KK1A 4HDVA 1TQIA 4AVPA 2QUFA 4YIIA 3IWFA 1T98A 2J5PA 2KRFA 4O6JA 2XAFA 3F8CA 2STWA 2L3DA 3QU3A 1LQ1A 4IHSA 3KP2A 2RDPA 1USTA 3Q9VA 4ENKA 3JW4A 4CYDA 3K1NA 1KU3A 2DLLA 5A2QZ 4TV7A 1QNTA 5ILSA 4LB6B 1IN7A 3ZN1A 3GVAA 1LNWA 1USSA 2P6TA 5BQTA 3BJOA 1RNLA 2DU9A 5BMZA 3RDIA 4WCGA 3HOTA 2ZO4A 1YLFA 2DTRA 2XKOA 3RYRA 2F5DA 1E2XA 2HQRA 2Y0MA 3BJ6A 2ISYA 2QQ9A 2CFXA 3GFMA 5BPIA 3RIRA 2EB7A 3HYIA 2XHKA 1TNSA 3RI4A 3FMSA 5L3GA 2EK5A 2RN7A 1H9GA 5HLIA 3DFGA 2H6BA 1R23A 4A2UA 4GYIA 2LDUA 3HRMA 5L3FA 1SMTA 3KLNA 1HXDA 4IJAA 1O3SA 2MLGA 1B9NA 4L18B 1KA8A 2BBYA 1XB4A 1LB2A 4U7BA 1JE8A 4RAYA 1JXSA 1FSEA 1IF1A 2A61A 1BJAA 4M73A 4GO1A 1YIOA 4KIFA 3ZMVA 4EJOA 4BHPA 4HLYA 1OKRA 1RZ4A 4Y13A 1O3TA 4P55A 5LRSA 1FX7A 1Z05A 3L09A 4MTEA 4ZZDA 3R6SA 4L9VA 3ZMDA 1QZYA 2ZNZA 1I1SA 4PZJA 3WU1B 1J5YA 1ZH5A 1T39A 1KQ0A 2DFIA 5L3CA 4KMFA 2VXZA 2VN2A 4L9TA 2G9WA 2IPQX 3I5UA 4OMZA 3RKWA 2FMYA 1X3UA 1U6GA 3Q5FA 1XMAA 2FA5A 4PDKA 2R7FA 4QWQA 4IRIA 3WTWC 1KGSA 2DQLA 3TGNA 1B9MA 1LJ9A 3CUQC 5HS7A 2Q0OA 4Z2YA 2PMHA 2PFBA 1REPC 1YFHA 1S7AA 2XUBA 3BY6A 3R60A 3SZTA 1OR7A 2QBYA 3TOAA 3MEXA 1LEAA 1E17A 1P92A 2CWEA 2DK5A 2P7CB 1I6XA 2NAZA 4HLXA 4P5OA 2CSOA 3GFIA 2VC0A 2V1UA 4M9ZA 4WXCA 2D45A 3WE2A 2HTSA 1BIAA 1B1BA 2ZBKA 3W6JB 5ICEA 2IJLA 1W7PB 3K2ZA 1Z7UA 3V4GA 2XVCA 2F2EA 3KCCA 3P9CA 1GXPA 5DUIA 3SHFA 2PEXA 2MH2A 3VFZA 4S05A 1MJ9A 3ELKA 5D5VB 1G3WA 5AIQA 4CZZA 1O3QA 4B09A 1ZARA 2LNBA 1BN5A 3ROUA 1IN8A 1F4KA 1MD0A 5AONA 1BI2A 4F7ZA 1BI0A 1YO5C 2Z9OA 5K1YA 4EMSA 1IXCA 1B59A 3T1BA 4HV6A 5E1ZB 2K86A 2DW4A 1WRJA 5E20A 3KFWX 3WTZA 4NHJA 4ETSA 4YIFA 2XRNA 3U1DA 2D2WA 3KP7A 3AAFA 1HKTA 2FXAA 1P2FA 1XCBA 2JPBA 4WWCA 1HSTA 3WGGA 4EJUA 3LFKA 3H92A 4CO8A 2BYVE 2A07F 5FLXZ 3B02A 1ODDA 4XBFA 3TO7A 2VBXA 5DCMA 3V8JA 4N9HA 1PP7U 2M8EA 4MNUA 2HGCA 2DAOA 3M8EA 5D4RA 2O03A 1K78B 1HBXG 2ZJ2A 4U0YA 4L0YB 1PP8F 1XCVA 4IRGA 4LK1F 2PN6A 2NYXA 1A04A 3HSEA 3BROA 1D5VA 4LG0B 5FD6A 4I7HA 3Q9SA 4MTDA 4KDPA 3R4KA 3LAJA 4YFNF 3I53A 4EM2A 1S8NA 1I27A 4RGRA 4G6DA 1PDNC 4LLNA 2V9VA 3HIFA 2DBBA 3FHZA 2IT0A 1ZYRF 2P5KA 2HR3A 4AIJA 4BHBA 2E1CA 3MCZA 4HQMA 1T6SA 3VEPA 2MD5A 3EUHA 4Q4ZF 1ZAOA 1FYLA 1XGSA 4G7ZF 2A6EF 2MLKA 5FD5A 3P9IA 3F8BA 1XD7A 4KYWA 1SFEA 1ZN2A 2HKXA 4Y15A 5E17F 4O3MA 2OU2A 1MJBA 2COMA 3PQJA 1C0WA 3BZ6A 2HWVA 4FX0A 1R1VA 3I71A 4A5MA 1MJAA 2A6HF 4M71A 3ISPA 2OZUA 2KJCA 4D0PA 4KN4X 2C6YA 2H6CA 1YQAA 4HX7A 3LA2A 3V8LA 5HDGA 3SFZA 3F3XA 3RTRA 4HF2A 3C7JA 4UXNA 2ZKZA 2IW5A 4G94A 1LDKB 4G9YA 1GHCA 4RGSA 2FF4A 5L3EA 1DPUA 3EYYA 4BQAA 4M74A 3L9FA 4EGZA 3K0LA 5TRDA 4HOBA 5H20A 1KU9A 3B73A 4S04A 4CDGA 4WF2A 2VC1A 3M9AA 2R3SA 1QBJA 3WTUC 1IRFA 2EFOA 1ZRCA 1R1TA 3TKYA 4I0BA 1R5GA 2HOEA 4XRFA 4GYGA 4A5NA 1BC7C 4FT8A 3FM3A 4JBAA 2Q2EA 3E97A 4U88A 2VBZA 3DPLC 3FM5A 5ICGA 4BH9A 5D8KB 4DNCA 4KUMA 4IXAA 1R1UA 3JSOA 4GXOA 2X0LA 5DYMA 2K27A 3J81Z 3R0JA 1U5TB 4EM0B 4BHCA 3KEOA 2RGVA 2ZNYA 4KNYA 1JGSA 1FLIA 4U7DA 1FC3A 1ZRFA 4AWXB 5D5XB 2HZTA 1HW5A 2ZMEB 3F6OA 5FFXA 4EVIA 3SQNA 1IZ1A 1XDUA 3IC7A 3C18A 2V79A 3JTGA 2KKOA 1G6NA 1L0OC 2P6SA 2PJPA 2H09A 1BIBA 1K78A 4HYEA 2F5EA 2BE5F 4AIHA 3E6CC 4GGGA 1WSUA 3ZMTA 3S2WA 5DV5A 3CTAA 4UVAA 1EV7A 5CYVA 1IXSB 1IRGA 3EQLF 2OBPA 3LSTA 3G73A 2PBIA 2FSWA 3O2PE 1BOAA 3IL2A 2VBYA 2P5VA 1D8KA 1B6AA 3FXQA 4LLGF 2E7XA 4M72A 3TQNA 4LMYA 4KMUX 1BBYA 4ON0A 4GCVA 3ZP5A 3U2RA 3KLOA 3RYPA 4M9SA 3ECOA 2G7UA 5DD8A 1FYKA 4CHUA 3L7WA 3KP3A 1DDNA 2P8TA 4OIOF 4HAMA 4UHTA 2F5CA 2Z3YA 1YG2A 3IKVA 4IPAA 4FX4A 5ED4A 4P96A 2UWMA 3WTXC 2GQQA 1WQ2A 4I0AA 2DPUA 2K4JA 1D3YA 2NS0A 1F5TA 3G3ZA 1KQ8A 1J7KA 3IKTA 1OMIA 5F1RA 1IAWA 5D6EA 3WODF 4LJZF 2XGXA 1R58A 5DUKA 2XAQA 2HTJA 4EGYA 1UFMA 3MAJA 4OU0A 1LVAA 3C1DA 3N97A 1U78A 1TQPA 1K6OA 3IRQA 5HLHA 1O57A 2E1NA 3E6MA 4L9NA 3GF2A 1KYZA 3DXJF 3TDUC 3QOPA 1G3SA 3COAC 5LHIA 3QP6A 2EFWA 4G6QA 3M7GA 4KIGA 2RKHA 1XSDA 2HYGD 3QAHA 1TBXA 1YW7A 2DO7A 5E1XA 4YG2F 4UVBA 1R5HA 2DT5A 3V7CA 2WC2A 4ESBA 3C3WA 4A6EA 1XSXA 4KIBA 3QP5A 1U5TA 3JAMK 3ERED 3F22A 3WTSC 2JPCA 3WTYC 4XSXF 2O0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGI A;  2M45 A;  3ZQ7 A;  1ZRD A;  2HQN A;  1R00 A;  5DCF A;  2FEZ A;  3E3V A;  2VON A;  2ZME A;  3WE3 A;  1MGT A;  1ZRE A;  1STZ A;  3J80 Z;  1BC8 C;  5LGU A;  3REO A;  1Z91 A;  3N4M A;  3HHH A;  2VOD A;  3M8F A;  4AD9 A;  2QYO A;  3CDH A;  2XRO A;  2GXG A;  4M6Y A;  1ZLK A;  5E8I A;  2DK8 A;  2FBH A;  3ABU A;  1YW9 A;  2PMU A;  1RUN A;  3WG9 A;  1FBS A;  4ENJ A;  4HDU A;  3EDP A;  1V3F A;  3ABT A;  2KIM A;  4MQV A;  4CXF A;  5HVQ C;  3OV8 A;  2VOO A;  1WI9 A;  2QLZ A;  3FMQ A;  1I1G A;  2MH9 A;  4IRH A;  5FB2 A;  2K02 A;  2XIG A;  2G7H A;  5HS8 A;  3FX3 A;  1P4A A;  5CVI A;  3I64 A;  5CVV A;  2MBF A;  4ZYH A;  1XN7 A;  1MDM B;  2L4A A;  1AOY A;  3VOE A;  2OQG A;  3ZMZ A;  1FWZ A;  1W7P D;  5HLG A;  3GXO A;  1Z6R A;  4LLL A;  5JR3 A;  1O7F A;  2LF8 A;  2RNJ A;  5BS6 A;  2L01 A;  2IRF G;  3I54 A;  5JVT A;  2Z5U A;  1EH8 A;  1U8R A;  2PI0 A;  4JK1 X;  4HX4 A;  2X4H A;  1OPC A;  3JTH A;  2BEO A;  1SFX A;  5BPD A;  4MQ9 F;  2GA1 A;  1FZP B;  2A68 F;  2FE3 A;  3ZN0 A;  3KE2 A;  4DQ2 A;  3RKX A;  1IUY A;  2O8X A;  2VT2 A;  3QPH A;  2ZXJ A;  4EJV A;  2JTV A;  1IN6 A;  2WWY A;  3NRV A;  5K5O A;  5DD4 A;  4WK8 F;  1FBQ A;  1J2X A;  3R61 A;  3DF8 A;  5JI6 A;  5IT9 K;  2EWN A;  1ZGJ A;  2STT A;  2M87 A;  2HYF A;  4OOI A;  3P9K A;  4K2E A;  4G7O F;  4G7H F;  2GIV A;  2RVC A;  2P7V B;  4XLP F;  1MKM A;  5K5R A;  2W24 A;  1OYI A;  1W5S A;  2XV4 S;  3GYH X;  1XGM A;  2Y48 A;  1S3J A;  2YPR A;  1UHW A;  3GW2 A;  3D5L A;  5LGT A;  1TW2 A;  2OA4 A;  2QZ8 A;  3GFJ A;  4B8X A;  4UVC A;  1G4D A;  3TOB A;  3HUG A;  1KQ9 A;  3SXY A;  3E5Q A;  2OAZ A;  4YFX F;  5TJJ A;  4KT5 C;  4Q48 A;  4NB5 A;  2NRA C;  2PQ8 A;  2FNP A;  4ENN A;  2JT1 A;  3I4P A;  2M30 A;  3WTV C;  1U5T C;  4EM1 A;  2YR2 A;  2M1B A;  3LWF A;  3PFI A;  2V1X A;  4I2O A;  5J8F A;  2PLY A;  1W7P A;  2HKO A;  1BM9 A;  1CF7 B;  3ULQ B;  4RGX A;  1SD7 A;  2TDX A;  1JHF A;  3NQO A;  1RUO A;  1GVJ A;  3GZ5 A;  3MWM A;  3ZPL A;  1SMY F;  2Q8K A;  5E8G A;  2PG4 A;  4U0W A;  2EV0 A;  3KP6 A;  2FML A;  1Z6T A;  4A6D A;  2ZFW A;  4HV5 A;  2K4B A;  4R79 A;  3HHG A;  4H0E A;  5DDG A;  1QO0 D;  3HTS B;  4R8H A;  2FOK A;  3F72 A;  3GFL A;  3BPX A;  3J81 K;  4Y17 A;  4OIR F;  3KP5 A;  5FO5 A;  2CYY A;  2EFP A;  4OIQ F;  2ELH A;  2YX7 A;  5K5Q A;  1RIO H;  2Z33 A;  3R0A A;  4WXD A;  1HQC A;  2GZW A;  1J0R A;  1MDM A;  4ZZL A;  3VB2 A;  3MZY A;  3HTU A;  2V6C A;  2IA2 A;  2CW0 F;  3JSP A;  2OZ6 A;  5IT3 A;  3HRU A;  1GXQ A;  1EH6 A;  1FNN A;  3RJP A;  1KU7 A;  4AIK A;  4RB3 C;  4ESJ A;  3FXR A;  3DQV C;  2A5Y B;  3LQQ A;  1NHA A;  5FFZ A;  2HFH A;  5BOX A;  2KJB A;  3EYI A;  5HDN A;  3T0Y A;  4HBL A;  2VT3 A;  4BAY A;  1WWX A;  3P7N A;  4Q47 A;  5CVU A;  1T38 A;  5A2Q K;  1S7O A;  5EEH A;  2XKP A;  4HX8 A;  3FMR A;  4I01 A;  4LG0 A;  5CVR A;  3LAP A;  2VE8 A;  1G3Y A;  1FPQ A;  3DP7 A;  4N0B A;  4PCQ A;  3F8M A;  1HKS A;  2GXB A;  2H27 A;  4L0Z B;  4YFK F;  3LQR A;  2IP2 A;  4UUV A;  2GAU A;  2KIU A;  5F6F A;  1P6R A;  2O61 A;  5LHH A;  1H0M A;  3GEZ A;  4A0Z A;  3GUD A;  5HOO A;  2W85 A;  2LF7 A;  2IA0 A;  2W84 A;  1BI3 A;  1LEB A;  1FBU A;  3K1M A;  3WGH A;  4BYY A;  5CVJ A;  2GA2 A;  2JRT A;  2NNN A;  1U3E M;  1YS7 A;  3OOP A;  4MGR A;  5LLQ A;  4PGH A;  1FT9 A;  2EJR A;  3H3Z A;  4XSZ F;  4RGU A;  2BGC A;  2L54 A;  1FP1 D;  4M6X A;  3K9T A;  1K79 A;  4ZYD A;  2HEO A;  3CJN A;  1QGP A;  5FGM A;  3KZY A;  4G8X A;  1DP7 P;  3GWZ A;  2BV6 A;  2L02 A;  4ZYG A;  1I5Z A;  1W4M A;  1Q1H A;  1YW8 A;  2O6G E;  3K69 A;  3HSF A;  4RB1 A;  4L5J A;  1CF7 A;  5DCM B;  3TO9 A;  2VBW A;  3WU0 A;  2EFN A;  3K1P A;  1W5T A;  2FQ3 A;  4I09 A;  1HW1 A;  5J8C A;  3HOS A;  1R22 A;  5D5U B;  2OQR A;  2FRH A;  1UB9 A;  2XAG A;  3GZ6 A;  3KP4 A;  4PGG A;  5LEK A;  1H9T A;  4NQW A;  2OD5 A;  1J59 A;  3O6B B;  4P9U A;  3L00 A;  5D8L B;  5LHG A;  3BWG A;  2DQR A;  4E70 A;  3FWE A;  1T2K A;  3I58 A;  1F1Z A;  1R36 A;  3LA7 A;  2FBI A;  2P5L C;  3BJA A;  2P4W A;  3QU6 A;  4RS8 A;  5H6R A;  3TDZ C;  1ZG3 A;  3J80 K;  1ZG1 A;  3F8F A;  3O3K A;  4P9F A;  1ZGA A;  1ZHF A;  1G3T A;  4IHT A;  1S29 A;  1YYV A;  4WXH A;  1DPR A;  3BOQ A;  2EV6 A;  3FXU A;  2ACJ A;  2W25 A;  4ZYE A;  3FF5 A;  3RPU A;  1B4A A;  2ADU A;  4BXU A;  4HF1 A;  3D0S A;  3T8R A;  2LSO A;  3KEQ A;  4KN7 X;  3BPV A;  3DEU A;  5KVR A;  3HSR A;  1P4W A;  3F6V A;  2XAJ A;  1FY7 A;  4U0V A;  3T5X A;  2VOP A;  1IXR C;  1TW3 A;  2CO5 A;  3L2C A;  3H3U A;  3T8T A;  2K7L A;  2A69 F;  3JAM Z;  4EJW A;  1RI7 A;  5LEJ A;  2FBK A;  4EJT A;  3F8N A;  1CGP A;  3E6B A;  2EV5 A;  2KIF A;  2CQK A;  1AWC A;  3MZH A;  4ENM A;  1HKQ A;  1SD4 A;  1PUE E;  1LDD A;  1QPM A;  4WX9 A;  5E1W A;  4Q5S F;  5LRR A;  5D5W B;  4I98 B;  2FU4 A;  5CJ9 A;  2ETH A;  4KIC A;  5D4S A;  1MZB A;  5D6F A;  2MC3 A;  1Y0U A;  1IW7 F;  4KFC A;  4LB5 A;  3CUO A;  2RQP A;  4UNO A;  3E5U A;  5ICC A;  2L4M A;  4HQE A;  1ULY A;  5F64 A;  3CUQ B;  1U2W A;  4L9J A;  1O7L A;  1SD5 A;  2WTE A;  2RV8 A;  3HRS A;  1WKM A;  3I0T A;  2YSR A;  3I59 B;  4LFU A;  5HDK A;  5FLX K;  1K7A A;  3TO6 A;  4KA4 A;  1T0F A;  4BNC A;  1Z9C A;  2CG4 A;  1HSJ A;  4QLC U;  2DPD A;  3BP8 A;  1TQM A;  3BDD A;  4L5I A;  2ESH A;  2ESN A;  3RKY A;  2YX4 A;  3F21 A;  2WV0 A;  5AIP A;  3QRF F;  1UCR A;  3DPT A;  3E6D A;  2AS5 F;  3J7A O;  3V7S A;  1SFU A;  3GX4 X;  2QM3 A;  3ZMS A;  3IRR A;  3FZV A;  2B0L A;  5ICF A;  2LKP A;  4EQQ A;  4O5V A;  4RB2 C;  3F23 A;  3VOD A;  1O3R A;  4OIP F;  2ISZ A;  5DEQ A;  4MEX F;  4R1H A;  1FP2 A;  4OIN F;  3RPQ A;  1XMK A;  4M9X A;  1J75 A;  3ECH A;  1FOK A;  2R7D A;  4A0X A;  4ASN A;  3GLX A;  3QPT A;  1D8J A;  1FYM A;  3M1E A;  1EH7 A;  2XAS A;  2YU3 A;  4IVN A;  2E7W A;  3NEU A;  1YS6 A;  3MQ0 A;  2HS5 A;  3DKW A;  1QZZ A;  2Y75 A;  5ILV A;  1P4X A;  2XAH A;  3CO6 C;  1ONV A;  3CO7 C;  5H6Q A;  1FSH A;  4RAZ A;  3W6K B;  3V8K A;  3ML6 A;  6PAX A;  2FNA A;  2QVO A;  2QEN A;  2QWW A;  3SZP A;  3GO5 A;  1L3L A;  4I02 A;  2A3S A;  1J9I A;  2Z99 A;  4A12 A;  4UV9 A;  5IT9 Z;  1XDS A;  2UXX A;  1XGN A;  1ON2 A;  2H94 A;  2CGP A;  2AXL A;  4XLN F;  5CLS A;  1HW2 A;  2UZK A;  4MEY F;  2IA1 A;  1QQI A;  1Z1D A;  4A0Y A;  2DI3 A;  1YTY A;  5L3D A;  4FHT A;  1TNT A;  3PQK A;  2RC4 A;  1ZLJ A;  2D1H A;  2QQA A;  4EV0 A;  1ON1 A;  4HW0 A;  1TTY A;  2GWR A;  1OYW A;  3HRT A;  3IHU A;  3KZZ A;  2HDC A;  5HS9 A;  1ZG5 A;  2MA3 A;  1KU2 A;  5ILU A;  4LK0 F;  2M5W A;  3WTT C;  2JSC A;  2NNY A;  4N9I A;  1IN5 A;  1UHM A;  1F9N A;  2ZCW A;  2EA2 A;  2EA4 A;  2JZY A;  4UV8 A;  3CLO A;  5E18 F;  2O3F A;  1KYW A;  1DUX C;  2UXN A;  1XSV A;  3CUQ A;  5LGN A;  5ERI A;  2V1D A;  1XGO A;  5L3B A;  2QQB A;  1V4R A;  4HF0 A;  2J5O A;  1OYY A;  1TLH B;  3I59 A;  4HZF A;  3EET A;  5EEG A;  1LDJ A;  1SAX A;  3E5X A;  1JHH A;  2VE9 A;  1SD6 A;  4HA8 A;  3MFK A;  4ZH4 F;  3U9G A;  4OMY A;  2W57 A;  4ESF A;  1IN4 A;  5J6X A;  2QBY B;  5JFR A;  4CGZ A;  2D1V A;  4MHG A;  2F5F A;  4IF4 A;  1R7J A;  1VTN C;  3ZMU A;  2EFQ A;  3IWZ A;  5JHU A;  3DV8 A;  3LA3 A;  4LGW A;  2IVM A;  3V7R A;  4JQF A;  1S6L A;  4LD5 A;  4RB0 A;  1BI1 A;  3KET A;  4CIC A;  5LBQ A;  5KK1 A;  4HDV A;  1TQI A;  4AVP A;  2QUF A;  4YII A;  3IWF A;  1T98 A;  2J5P A;  2KRF A;  4O6J A;  2XAF A;  3F8C A;  2STW A;  2L3D A;  3QU3 A;  1LQ1 A;  4IHS A;  3KP2 A;  2RDP A;  1UST A;  3Q9V A;  4ENK A;  3JW4 A;  4CYD A;  3K1N A;  1KU3 A;  2DLL A;  5A2Q Z;  4TV7 A;  1QNT A;  5ILS A;  4LB6 B;  1IN7 A;  3ZN1 A;  3GVA A;  1LNW A;  1USS A;  2P6T A;  5BQT A;  3BJO A;  1RNL A;  2DU9 A;  5BMZ A;  3RDI A;  4WCG A;  3HOT A;  2ZO4 A;  1YLF A;  2DTR A;  2XKO A;  3RYR A;  2F5D A;  1E2X A;  2HQR A;  2Y0M A;  3BJ6 A;  2ISY A;  2QQ9 A;  2CFX A;  3GFM A;  5BPI A;  3RIR A;  2EB7 A;  3HYI A;  2XHK A;  1TNS A;  3RI4 A;  3FMS A;  5L3G A;  2EK5 A;  2RN7 A;  1H9G A;  5HLI A;  3DFG A;  2H6B A;  1R23 A;  4A2U A;  4GYI A;  2LDU A;  3HRM A;  5L3F A;  1SMT A;  3KLN A;  1HXD A;  4IJA A;  1O3S A;  2MLG A;  1B9N A;  4L18 B;  1KA8 A;  2BBY A;  1XB4 A;  1LB2 A;  4U7B A;  1JE8 A;  4RAY A;  1JXS A;  1FSE A;  1IF1 A;  2A61 A;  1BJA A;  4M73 A;  4GO1 A;  1YIO A;  4KIF A;  3ZMV A;  4EJO A;  4BHP A;  4HLY A;  1OKR A;  1RZ4 A;  4Y13 A;  1O3T A;  4P55 A;  5LRS A;  1FX7 A;  1Z05 A;  3L09 A;  4MTE A;  4ZZD A;  3R6S A;  4L9V A;  3ZMD A;  1QZY A;  2ZNZ A;  1I1S A;  4PZJ A;  3WU1 B;  1J5Y A;  1ZH5 A;  1T39 A;  1KQ0 A;  2DFI A;  5L3C A;  4KMF A;  2VXZ A;  2VN2 A;  4L9T A;  2G9W A;  2IPQ X;  3I5U A;  4OMZ A;  3RKW A;  2FMY A;  1X3U A;  1U6G A;  3Q5F A;  1XMA A;  2FA5 A;  4PDK A;  2R7F A;  4QWQ A;  4IRI A;  3WTW C;  1KGS A;  2DQL A;  3TGN A;  1B9M A;  1LJ9 A;  3CUQ C;  5HS7 A;  2Q0O A;  4Z2Y A;  2PMH A;  2PFB A;  1REP C;  1YFH A;  1S7A A;  2XUB A;  3BY6 A;  3R60 A;  3SZT A;  1OR7 A;  2QBY A;  3TOA A;  3MEX A;  1LEA A;  1E17 A;  1P92 A;  2CWE A;  2DK5 A;  2P7C B;  1I6X A;  2NAZ A;  4HLX A;  4P5O A;  2CSO A;  3GFI A;  2VC0 A;  2V1U A;  4M9Z A;  4WXC A;  2D45 A;  3WE2 A;  2HTS A;  1BIA A;  1B1B A;  2ZBK A;  3W6J B;  5ICE A;  2IJL A;  1W7P B;  3K2Z A;  1Z7U A;  3V4G A;  2XVC A;  2F2E A;  3KCC A;  3P9C A;  1GXP A;  5DUI A;  3SHF A;  2PEX A;  2MH2 A;  3VFZ A;  4S05 A;  1MJ9 A;  3ELK A;  5D5V B;  1G3W A;  5AIQ A;  4CZZ A;  1O3Q A;  4B09 A;  1ZAR A;  2LNB A;  1BN5 A;  3ROU A;  1IN8 A;  1F4K A;  1MD0 A;  5AON A;  1BI2 A;  4F7Z A;  1BI0 A;  1YO5 C;  2Z9O A;  5K1Y A;  4EMS A;  1IXC A;  1B59 A;  3T1B A;  4HV6 A;  5E1Z B;  2K86 A;  2DW4 A;  1WRJ A;  5E20 A;  3KFW X;  3WTZ A;  4NHJ A;  4ETS A;  4YIF A;  2XRN A;  3U1D A;  2D2W A;  3KP7 A;  3AAF A;  1HKT A;  2FXA A;  1P2F A;  1XCB A;  2JPB A;  4WWC A;  1HST A;  3WGG A;  4EJU A;  3LFK A;  3H92 A;  4CO8 A;  2BYV E;  2A07 F;  5FLX Z;  3B02 A;  1ODD A;  4XBF A;  3TO7 A;  2VBX A;  5DCM A;  3V8J A;  4N9H A;  1PP7 U;  2M8E A;  4MNU A;  2HGC A;  2DAO A;  3M8E A;  5D4R A;  2O03 A;  1K78 B;  1HBX G;  2ZJ2 A;  4U0Y A;  4L0Y B;  1PP8 F;  1XCV A;  4IRG A;  4LK1 F;  2PN6 A;  2NYX A;  1A04 A;  3HSE A;  3BRO A;  1D5V A;  4LG0 B;  5FD6 A;  4I7H A;  3Q9S A;  4MTD A;  4KDP A;  3R4K A;  3LAJ A;  4YFN F;  3I53 A;  4EM2 A;  1S8N A;  1I27 A;  4RGR A;  4G6D A;  1PDN C;  4LLN A;  2V9V A;  3HIF A;  2DBB A;  3FHZ A;  2IT0 A;  1ZYR F;  2P5K A;  2HR3 A;  4AIJ A;  4BHB A;  2E1C A;  3MCZ A;  4HQM A;  1T6S A;  3VEP A;  2MD5 A;  3EUH A;  4Q4Z F;  1ZAO A;  1FYL A;  1XGS A;  4G7Z F;  2A6E F;  2MLK A;  5FD5 A;  3P9I A;  3F8B A;  1XD7 A;  4KYW A;  1SFE A;  1ZN2 A;  2HKX A;  4Y15 A;  5E17 F;  4O3M A;  2OU2 A;  1MJB A;  2COM A;  3PQJ A;  1C0W A;  3BZ6 A;  2HWV A;  4FX0 A;  1R1V A;  3I71 A;  4A5M A;  1MJA A;  2A6H F;  4M71 A;  3ISP A;  2OZU A;  2KJC A;  4D0P A;  4KN4 X;  2C6Y A;  2H6C A;  1YQA A;  4HX7 A;  3LA2 A;  3V8L A;  5HDG A;  3SFZ A;  3F3X A;  3RTR A;  4HF2 A;  3C7J A;  4UXN A;  2ZKZ A;  2IW5 A;  4G94 A;  1LDK B;  4G9Y A;  1GHC A;  4RGS A;  2FF4 A;  5L3E A;  1DPU A;  3EYY A;  4BQA A;  4M74 A;  3L9F A;  4EGZ A;  3K0L A;  5TRD A;  4HOB A;  5H20 A;  1KU9 A;  3B73 A;  4S04 A;  4CDG A;  4WF2 A;  2VC1 A;  3M9A A;  2R3S A;  1QBJ A;  3WTU C;  1IRF A;  2EFO A;  1ZRC A;  1R1T A;  3TKY A;  4I0B A;  1R5G A;  2HOE A;  4XRF A;  4GYG A;  4A5N A;  1BC7 C;  4FT8 A;  3FM3 A;  4JBA A;  2Q2E A;  3E97 A;  4U88 A;  2VBZ A;  3DPL C;  3FM5 A;  5ICG A;  4BH9 A;  5D8K B;  4DNC A;  4KUM A;  4IXA A;  1R1U A;  3JSO A;  4GXO A;  2X0L A;  5DYM A;  2K27 A;  3J81 Z;  3R0J A;  1U5T B;  4EM0 B;  4BHC A;  3KEO A;  2RGV A;  2ZNY A;  4KNY A;  1JGS A;  1FLI A;  4U7D A;  1FC3 A;  1ZRF A;  4AWX B;  5D5X B;  2HZT A;  1HW5 A;  2ZME B;  3F6O A;  5FFX A;  4EVI A;  3SQN A;  1IZ1 A;  1XDU A;  3IC7 A;  3C18 A;  2V79 A;  3JTG A;  2KKO A;  1G6N A;  1L0O C;  2P6S A;  2PJP A;  2H09 A;  1BIB A;  1K78 A;  4HYE A;  2F5E A;  2BE5 F;  4AIH A;  3E6C C;  4GGG A;  1WSU A;  3ZMT A;  3S2W A;  5DV5 A;  3CTA A;  4UVA A;  1EV7 A;  5CYV A;  1IXS B;  1IRG A;  3EQL F;  2OBP A;  3LST A;  3G73 A;  2PBI A;  2FSW A;  3O2P E;  1BOA A;  3IL2 A;  2VBY A;  2P5V A;  1D8K A;  1B6A A;  3FXQ A;  4LLG F;  2E7X A;  4M72 A;  3TQN A;  4LMY A;  4KMU X;  1BBY A;  4ON0 A;  4GCV A;  3ZP5 A;  3U2R A;  3KLO A;  3RYP A;  4M9S A;  3ECO A;  2G7U A;  5DD8 A;  1FYK A;  4CHU A;  3L7W A;  3KP3 A;  1DDN A;  2P8T A;  4OIO F;  4HAM A;  4UHT A;  2F5C A;  2Z3Y A;  1YG2 A;  3IKV A;  4IPA A;  4FX4 A;  5ED4 A;  4P96 A;  2UWM A;  3WTX C;  2GQQ A;  1WQ2 A;  4I0A A;  2DPU A;  2K4J A;  1D3Y A;  2NS0 A;  1F5T A;  3G3Z A;  1KQ8 A;  1J7K A;  3IKT A;  1OMI A;  5F1R A;  1IAW A;  5D6E A;  3WOD F;  4LJZ F;  2XGX A;  1R58 A;  5DUK A;  2XAQ A;  2HTJ A;  4EGY A;  1UFM A;  3MAJ A;  4OU0 A;  1LVA A;  3C1D A;  3N97 A;  1U78 A;  1TQP A;  1K6O A;  3IRQ A;  5HLH A;  1O57 A;  2E1N A;  3E6M A;  4L9N A;  3GF2 A;  1KYZ A;  3DXJ F;  3TDU C;  3QOP A;  1G3S A;  3COA C;  5LHI A;  3QP6 A;  2EFW A;  4G6Q A;  3M7G A;  4KIG A;  2RKH A;  1XSD A;  2HYG D;  3QAH A;  1TBX A;  1YW7 A;  2DO7 A;  5E1X A;  4YG2 F;  4UVB A;  1R5H A;  2DT5 A;  3V7C A;  2WC2 A;  4ESB A;  3C3W A;  4A6E A;  1XSX A;  4KIB A;  3QP5 A;  1U5T A;  3JAM K;  3ERE D;  3F22 A;  3WTS C;  2JPC A;  3WTY C;  4XSX F;  2O0Y A; 
#chains in the Genus database with same CATH topology
 3WGI A;  1GT0 C;  2DT6 A;  2M45 A;  2XSJ C;  4FE4 A;  3ZQ7 A;  4DGW B;  1ZRD A;  2HQN A;  2QQ8 A;  4XN3 A;  1N78 A;  1R00 A;  4I99 C;  1I39 A;  2FEZ A;  3E3V A;  4XOR A;  5DCF A;  3M07 A;  2ZME A;  2VON A;  4CSW A;  4A3L J;  3WE3 A;  1MGT A;  1ZRE A;  1STZ A;  2EIN H;  3J80 Z;  1BC8 C;  5LGU A;  2JUC A;  4D5F A;  3REO A;  1Z91 A;  2VXD A;  2H8R A;  2KZV A;  3N4M A;  3HHH A;  2VOD A;  3S2D J;  3M8F A;  4AD9 A;  1B72 A;  2ZSH B;  3V42 A;  2QYO A;  3CDH A;  2EIJ H;  1FEX A;  5FKO A;  4X1E A;  4IL6 C;  2CFO A;  2XRO A;  4XKV A;  3S15 J;  2GXG A;  4M6Y A;  1SVL A;  1X19 A;  3ONQ A;  1ZLK A;  5B3S H;  1JKP C;  3BG3 A;  1GVD A;  1JJ8 C;  1V54 H;  5E8I A;  4F91 B;  4XOP A;  2DK8 A;  2FBH A;  3DBL B;  2ME0 A;  1LE8 A;  3ABU A;  1X3W B;  1YW9 A;  2BY1 A;  4AC0 A;  1T08 B;  2PMU A;  1RUN A;  3TBI A;  5KNL A;  4I76 A;  3WG9 A;  1FBS A;  2OUM A;  1XC5 A;  2FUG 2;  3PL8 A;  4ENJ A;  2JA5 J;  4HDU A;  3EDP A;  3JCU C;  2F5V A;  2LLK A;  1V3F A;  1MIJ A;  3ABT A;  4GRI A;  2KIM A;  4MQV A;  1OCP A;  3I3L A;  4CXF A;  1IRZ A;  1A6I A;  5HVQ C;  3KYC B;  3OV8 A;  4X0G A;  2VOO A;  1WI9 A;  2V9K A;  2QLZ A;  2WY8 Q;  2BY3 A;  2L9R A;  2ZJR F;  1FTZ A;  3FMQ A;  3HJE A;  4Y52 J;  1I1G A;  1MW7 A;  2MH9 A;  4IRH A;  5FB2 A;  5FKN A;  2K02 A;  3LSK A;  2XIG A;  2G7H A;  4XRS A;  1VQL I;  2L7M P;  1OCO H;  1Y39 A;  5HS8 A;  3FX3 A;  1P4A A;  5CVI A;  2EIM H;  3I64 A;  3QPS A;  5CVV A;  4C30 A;  3GBG A;  1X4P A;  3K70 C;  1BJZ A;  4A3M J;  2MBF A;  4ZYH A;  1XN7 A;  3UR3 C;  3BT9 A;  1MDM B;  2L4A A;  4CCL A;  3A02 A;  1AOY A;  2VJJ A;  3VOE A;  4XKB A;  1AKH A;  2AHQ A;  2OQG A;  3ZMZ A;  1FWZ A;  1TZL A;  1W7P D;  3X2Q H;  5HLG A;  2V7F A;  3GXO A;  1Z6R A;  2TCT A;  2LVS A;  2E1O A;  2LY9 A;  4LLL A;  1OIS A;  2F4O B;  4ITV A;  4LIT A;  5JR3 A;  4BJ5 C;  1O7F A;  2LF8 A;  2H1L A;  2DCE A;  4YIR X;  4IHX A;  2RNJ A;  5BS6 A;  2L01 A;  3W3C A;  2IRF G;  1YX3 A;  1VQ5 I;  2OJE D;  3I54 A;  3BTI A;  2VKD A;  5JVT A;  5J4Y A;  2Z5U A;  4NC7 A;  1EH8 A;  1U8R A;  2PI0 A;  1X1C A;  2MAB A;  2LC2 A;  4JK1 X;  4HX4 A;  2X4H A;  3KIO A;  5J40 A;  5IP7 J;  1OPC A;  1UG2 A;  1W1W E;  5EEA A;  1TWF J;  4C2M J;  3JTH A;  4FTH A;  1POG A;  4Y7N J;  2VJI A;  2BEO A;  3TL4 X;  3FKI J;  1SFX A;  2K5C A;  5BPD A;  2R7S A;  4UUT A;  3H5R A;  3HKZ N;  3ZQF A;  1OFC X;  2B7E A;  4MQ9 F;  2NVU B;  3VYT B;  2GA1 A;  3S8P A;  2ZJQ F;  5EZH A;  2M0M A;  1FZP B;  2O8K A;  2A68 F;  3MD2 A;  3W2A A;  2FE3 A;  3OOU A;  2ZXI A;  3PFY A;  3ZN0 A;  3HZJ A;  3KE2 A;  4DQ2 A;  3DTI A;  3RKX A;  1IUY A;  1SAU A;  1X3Z B;  2K3F A;  1FIA A;  4RBO A;  2O8X A;  5DM7 F;  5C4X J;  3CJQ B;  3DLL F;  5HOD A;  1TWA J;  1BOB A;  1A36 A;  4YRV A;  2VT2 A;  3QPH A;  2ZXJ A;  4EJV A;  4IO9 F;  2JTV A;  2DA7 A;  2VQH A;  1IN6 A;  1FMW A;  2WWY A;  3NRV A;  2LRE A;  5K5O A;  5DD4 A;  5DM6 F;  2HVQ A;  3CCY A;  4WK8 F;  3QPL A;  2FJ1 A;  3BR1 A;  3AG4 H;  1FBQ A;  2ELK A;  1J2X A;  1X58 A;  3R61 A;  3DF8 A;  5JI6 A;  1KON A;  5IT9 K;  2L7F P;  2LMD A;  2EWN A;  1VQ7 I;  1RKW A;  1ZGJ A;  1OCT C;  2BOL A;  5JVG F;  2OF7 A;  2STT A;  1R71 A;  1HOM A;  2M87 A;  2HYF A;  4OOI A;  4ZDP A;  5GP9 A;  2XPV A;  2QKL B;  3P9K A;  4K2E A;  2JUG A;  4G7O F;  2V6E A;  2BVM A;  1E3O C;  3BR6 A;  2MGQ A;  4G7H F;  1ETY A;  2GIV A;  2RVC A;  2P7V B;  3K4J A;  1MBK A;  1RES A;  3Q0W A;  4XLP F;  2OTL I;  2ZJP F;  1MKM A;  2W24 A;  3K4K A;  5K5R A;  1OYI A;  1W5S A;  4M3B A;  2XV4 S;  1IO2 A;  3GYH X;  1XGM A;  2Y48 A;  1S3J A;  2YPR A;  1UHW A;  3GW2 A;  3D5L A;  1TW2 A;  2OA4 A;  3GFJ A;  2LK2 A;  2QZ8 A;  5LGT A;  4B8X A;  2R7W A;  3A0H C;  2H1K A;  4MIM A;  4UVC A;  1G4D A;  3TOB A;  3HUG A;  3FDY A;  1KQ9 A;  3SXY A;  3U1K A;  1ITY A;  1WI3 A;  3E5Q A;  2OAZ A;  4YFX F;  3Q0V A;  5TJJ A;  1P7J A;  4KT5 C;  4Q48 A;  4NB5 A;  1DU6 A;  2NRA C;  3CMA I;  2E19 A;  4XR6 A;  2DJI A;  2PQ8 A;  2BY2 A;  4B1R A;  1NK2 P;  2FNP A;  2DOA A;  5B1A H;  2CS3 A;  2KDO A;  3G1M A;  1X1A A;  2EZI A;  4ENN A;  2JT1 A;  3I4P A;  2M30 A;  4RDU A;  3WTV C;  2X6O A;  3K4N A;  1U5T C;  3A4C A;  4EM1 A;  2YR2 A;  4D9J A;  2M1B A;  1TWH J;  3LWF A;  3DEW A;  3PFI A;  2V1X A;  3IAS 2;  2GM4 A;  4I2O A;  4IQ4 A;  1YJW I;  3OIQ A;  5J8F A;  3HL2 A;  3DBH B;  2PLY A;  2WA0 A;  1W7P A;  3OSF A;  2HKO A;  2V9P A;  2ZME C;  1BM9 A;  3CCL I;  5JLW A;  1CF7 B;  3MKY B;  1P7I A;  1R4M B;  2L7K A;  3ULQ B;  4RGX A;  5E3L A;  1SD7 A;  2NS8 A;  3L2W A;  2DA3 A;  2TDX A;  1I6H J;  1JHF A;  3NQO A;  4B3X A;  1GVJ A;  1RUO A;  3GZ5 A;  3MWM A;  2LKX A;  3ZPL A;  2IS2 A;  1SMY F;  2X48 A;  2Q8K A;  5E8G A;  2PG4 A;  4U0W A;  1W5C C;  2EV0 A;  3KP6 A;  2FML A;  1Z6T A;  2XF7 A;  2XGD A;  4NQW B;  2BHY A;  2ZFW A;  4HV5 A;  4A6D A;  2JQ7 A;  2K4B A;  1EA3 A;  4R79 A;  3HHG A;  3JRH A;  4H0E A;  2FQ4 A;  5DDG A;  1QO0 D;  2K85 A;  2O7O A;  3HTS B;  4R8H A;  3FXO A;  4G6T B;  4DJA A;  2FOK A;  3F72 A;  1Y8Q B;  3GFL A;  3BPX A;  5IP6 A;  3J81 K;  1ZTR A;  4Y17 A;  4OIR F;  1SVM A;  3KP5 A;  2X1D A;  1P9Q C;  3HB9 A;  5FO5 A;  3NAR A;  2CYY A;  5TGT A;  2EFP A;  9ANT A;  2V4J C;  3HPG A;  3L2U A;  2VUM J;  4EAT A;  1XX5 A;  4XKW A;  4OIQ F;  4E7L A;  2ELH A;  4IOA F;  2YX7 A;  3PUB A;  1WCM J;  5K5Q A;  4CH7 A;  1RIO H;  2Z33 A;  2W1O A;  3R0A A;  4WXD A;  2HQA A;  2M8G X;  1HQC A;  2GZW A;  1J0R A;  1MDM A;  4ZZL A;  3WU2 C;  3VB2 A;  3MZY A;  4PK4 A;  3HTU A;  3CME I;  2V6C A;  2IA2 A;  2CW0 F;  1WH5 A;  2RNG A;  3LL7 A;  3JSP A;  2OZ6 A;  3OY9 A;  5IT3 A;  2HQ5 A;  3HRU A;  2HI3 A;  4XLF A;  2O5R A;  1W0T A;  1GXQ A;  1EH6 A;  1FNN A;  2EPF A;  1H89 C;  1S7E A;  3RJP A;  2R7V A;  3DTK A;  3HM5 A;  3L2R A;  2YUS A;  1KU7 A;  3S32 A;  2M0C A;  4AIK A;  2XSD C;  4RB3 C;  3OYI A;  4ESJ A;  2MC4 A;  3FXR A;  3DQV C;  1EF4 A;  2A5Y B;  2K9S A;  3LQQ A;  1YJ9 I;  1NHA A;  4PJJ A;  4KIS A;  5FFZ A;  2WB1 A;  2LOO A;  1QRY A;  4Y33 A;  2HFH A;  5BOX A;  2KJB A;  3EYI A;  5HDN A;  3T0Y A;  4HBL A;  2VT3 A;  4BAY A;  1WWX A;  3P7N A;  4Q47 A;  5CVU A;  1PUF B;  4BE2 A;  1T38 A;  1GV5 A;  3OYF A;  5A2Q K;  1S7O A;  3J7A Y;  2HZD A;  1BW6 A;  5FLM J;  5EEH A;  5EYR A;  2XKP A;  3OIO A;  4HX8 A;  3CCJ I;  3BTL A;  3FBI B;  3FMR A;  4I01 A;  1JKQ C;  4LG0 A;  5CVR A;  3LAP A;  2VE8 A;  2M4K A;  1X1B A;  5IPA A;  1IV8 A;  1V5G A;  3A03 A;  1G3Y A;  5M3F J;  1NG7 A;  2WAQ A;  1FPQ A;  3FXL A;  3DP7 A;  3S3O A;  4N0B A;  4PCQ A;  1R4N B;  3F8M A;  1HKS A;  2GXB A;  4XON A;  3HGY A;  2H27 A;  4V19 K;  2KRC A;  2QCO A;  4L0Z B;  4YFK F;  2VKE A;  2IP2 A;  2X6Y A;  3LQR A;  4YEL A;  3SFI A;  4ZJZ A;  4UUV A;  4BBS J;  5B5E C;  2GAU A;  2KIU A;  5F6F A;  1P6R A;  1A6Q A;  2O61 A;  5LHH A;  1ZR2 A;  4AYB A;  3GEZ A;  4M3F A;  1H0M A;  1BW5 A;  1WJ5 A;  3GUD A;  4A0Z A;  2LY2 A;  1B8I B;  3ZCO A;  1IRX A;  5HOO A;  4C2T A;  2W85 A;  2DDB A;  4IX7 A;  3OYM A;  2LF7 A;  4UY8 I;  3M8J A;  2IA0 A;  1ETW A;  2L9V A;  2W84 A;  4E7I A;  4M3E A;  3A2K A;  1BI3 A;  1LEB A;  2VKV A;  3LSI A;  2OC6 A;  1FBU A;  1FOW A;  3K1M A;  3WGH A;  2HOA A;  4BYY A;  1BL0 A;  1WJC A;  2DA2 A;  1Z7L A;  2GA2 A;  2JRT A;  5CVJ A;  2NNN A;  1R5I D;  4MLO A;  1U3E M;  1YS7 A;  3OOP A;  4MGR A;  5LLQ A;  3H1C A;  4PGH A;  1FT9 A;  2VQC A;  1VFC A;  2EJR A;  3H3Z A;  5M5Y J;  2ZB9 A;  4XSZ F;  4RGU A;  2BGC A;  4XMY A;  1BR4 A;  3PNV A;  2L54 A;  1FP1 D;  4M6X A;  3K9T A;  1K79 A;  1WJB A;  3ZGK A;  3FXK A;  4NNJ A;  4ZYD A;  2HEO A;  2CJJ A;  3CJN A;  2XPW A;  3TP0 A;  4DBQ A;  1GDT A;  1QGP A;  4Y3O A;  5FGM A;  3BLY A;  2ZXH A;  2W4S A;  3S3N A;  3KZY A;  3M1C A;  3WHC A;  4E4H A;  4G8X A;  1DP7 P;  3GWZ A;  5GAG J;  2BV6 A;  2L02 A;  2R5Z B;  4ZYG A;  1I5Z A;  3CES A;  1W4M A;  2V1N A;  4PJL A;  2QSH X;  1Q1H A;  2F4I A;  4B48 A;  1YW8 A;  2R7U A;  3ESW B;  2O6G E;  3K69 A;  2HDD A;  3CCE I;  3HSF A;  1K83 J;  4RB1 A;  2IGM A;  4L5J A;  1CF7 A;  5DCM B;  3TO9 A;  2VBW A;  4DIQ A;  1VQ8 I;  3WU0 A;  2EFN A;  3K1P A;  2Y30 A;  1W5T A;  2FQ3 A;  4I09 A;  1HW1 A;  3GLL A;  5J8C A;  3HOS A;  3JRI A;  3PSI A;  3K2A A;  1JJ6 C;  3RSN A;  4GDF A;  1R22 A;  2OQR A;  4H4K C;  5D5U B;  2PJR A;  2FRH A;  4KIT B;  1UB9 A;  1YHQ I;  2XAG A;  3RQI A;  3GZ6 A;  3KP4 A;  4PGG A;  5LEK A;  2KLO A;  2COB A;  1H88 C;  1H9T A;  4NQW A;  4BXX J;  4PUS A;  3SZG A;  2R92 J;  4BUP A;  2OD5 A;  4XK4 A;  4BQN A;  1J59 A;  2JMW A;  4UB6 C;  4OAY A;  3O6B B;  2WAD A;  3FIS A;  3KYD B;  4P9U A;  3NWS A;  4XN0 A;  2L7Z A;  3L00 A;  3GTJ J;  5JLX A;  1U0J A;  1E0E A;  1M1E B;  5D8L B;  5LHG A;  3BWG A;  3F9K A;  2DQR A;  2KT0 A;  3LSJ A;  4E70 A;  3JRC A;  2PMZ N;  4XL9 A;  2LY1 A;  3FWE A;  4A3B J;  2OV7 A;  5KAF C;  2NVT J;  1T2K A;  3I58 A;  1F1Z A;  1R36 A;  3JRE A;  2KPM A;  2I10 A;  3LA7 A;  2FBI A;  2P5L C;  2HYJ A;  3HOZ J;  3BJA A;  5GAE J;  2DDA A;  2P4W A;  3QU6 A;  4RS8 A;  5H6R A;  2CQ7 A;  1ZG3 A;  3TDZ C;  1ZEL A;  3ZQH A;  4L5E A;  3J80 K;  2UUZ A;  3F8F A;  3O3K A;  4P9F A;  3EPZ A;  1ZGA A;  4HNT A;  1ZG1 A;  3I4M J;  1ZHF A;  4RAF A;  4G12 A;  1G3T A;  4IHT A;  4OWR B;  3I9V 2;  1ZR4 A;  5F0H A;  1S29 A;  1YYV A;  4WXH A;  1DPR A;  3BOQ A;  3S93 A;  1I3A A;  2EV6 A;  3FXU A;  4AU7 A;  2ACJ A;  5EDN A;  1X4O A;  1IDZ A;  2W25 A;  4ZYE A;  3FF5 A;  3RPU A;  5LFA A;  3CCV I;  1B4A A;  5F04 A;  2WV1 A;  3JRB A;  2ADU A;  4BXU A;  4HF1 A;  3D0S A;  3OS2 A;  2OCC H;  2LSO A;  3T8R A;  3KEQ A;  2HU9 A;  3H9G A;  4IEJ A;  4KN7 X;  3BPV A;  3CCR I;  3DEU A;  5KVR A;  5CQE A;  3S1R J;  3BQY A;  3HSR A;  1MMG A;  1W0U A;  1P4W A;  3F6V A;  4J19 A;  4A3D J;  3JRA A;  1G2H A;  1HDD C;  4LIU A;  2XAJ A;  1FY7 A;  4U0V A;  3T5X A;  2VOP A;  1PUF A;  1IXR C;  1TW3 A;  2CO5 A;  2XGE A;  3KYL A;  3L2C A;  3H3U A;  3T8T A;  2K7L A;  3SYT A;  5J1Y A;  2A69 F;  4XLA A;  3JAM Z;  4EJW A;  1RI7 A;  1QPI A;  1SFK A;  2FBK A;  5LEJ A;  1U9O A;  3Q3S A;  4EJT A;  3F8N A;  1CGP A;  1Q1V A;  3KX2 A;  1Y6I A;  3E6B A;  4F93 B;  2EV5 A;  2H8W A;  2CW8 A;  1RRJ A;  5K7H A;  2KIF A;  2XF5 A;  2CMP A;  2VIX A;  3ERM A;  2CQK A;  3VSL A;  1AWC A;  3K4M A;  3MZH A;  1ETQ A;  4ENM A;  1HKQ A;  5IOY A;  1ENH A;  1LFB A;  1SD4 A;  2DA5 A;  3ZR8 X;  1PUE E;  1LDD A;  1QPM A;  3JRD A;  4WX9 A;  3IH4 A;  5E1W A;  2QSG X;  2CUF A;  4Q5S F;  3AL0 B;  5LRR A;  5D5W B;  1FOX A;  4I98 B;  2FU4 A;  5CJ9 A;  3KPH A;  2ETH A;  2B63 J;  4KIC A;  5D4S A;  1MH3 A;  1BA5 A;  1Z0X A;  3OYH A;  1MZB A;  2LR8 A;  2MC3 A;  5D6F A;  2UV1 A;  1Y0U A;  4XQF A;  1IW7 F;  4KFC A;  1MND A;  2RAE A;  2CQQ A;  4LB5 A;  3CUO A;  2RQP A;  4UNO A;  3E5U A;  5ICC A;  4RA2 A;  1BR1 A;  3ZRG A;  2L4M A;  3L2Q A;  4HQE A;  5GTH C;  2P0W A;  1ULY A;  1PVE A;  5F64 A;  3CUQ B;  4CCO A;  2CUZ A;  5K7Z A;  2E1M B;  1U2W A;  4L9J A;  1O7L A;  3U21 A;  1SD5 A;  2IGK A;  3AKZ A;  1GLN A;  4RAG A;  3CDL A;  2WTE A;  5CQG A;  2RV8 A;  4A3J J;  3HRS A;  1WKM A;  3I0T A;  2YSR A;  3I59 B;  4LFU A;  5HDK A;  5FLX K;  3MKZ A;  1QZE A;  1K7A A;  1OCZ H;  4JX6 A;  3TO6 A;  4KA4 A;  1T0F A;  4BNC A;  3CJT B;  1Z9C A;  2CG4 A;  2ID6 A;  5B66 C;  1HSJ A;  4QLC U;  2DPD A;  2QGU A;  3BP8 A;  4C3J J;  1TQM A;  3BDD A;  4L5I A;  4Y4R A;  2G0E A;  2ESH A;  3ASO H;  2ESN A;  3RKY A;  2YX4 A;  3F21 A;  3IH3 A;  2WV0 A;  5AIP A;  3QRF F;  2VPR A;  1UCR A;  1MBJ A;  3VPR A;  3DPT A;  1MBF A;  3E6D A;  2AXT C;  2AS5 F;  3CF5 F;  4AUX A;  3J7A O;  3WHB A;  3V7S A;  2R5Z A;  1SFU A;  2L5Q A;  3GX4 X;  1Y1V J;  2RRE A;  2QM3 A;  3ZMS A;  5CKT A;  3JR9 A;  3IRR A;  3FZV A;  2B0L A;  4NC8 A;  1XG1 A;  1W36 D;  5ICF A;  2LKP A;  3CP8 A;  4EQQ A;  2KZG A;  4O5V A;  4RB2 C;  1TL8 A;  3F23 A;  1EJ9 A;  3VOD A;  3OYJ A;  1O3R A;  3HOV J;  3OYL A;  3OYB A;  4ZTJ A;  2Y9Z A;  4OIP F;  2ISZ A;  5DEQ A;  3HKZ A;  2QA4 I;  4MEX F;  3S2H J;  4R1H A;  1FP2 A;  4OIN F;  3RPQ A;  2KFD A;  4S0H B;  1XMK A;  2WBM A;  3TP3 A;  3SEQ A;  4M9X A;  1RC9 A;  1I3Q J;  1J75 A;  3ECH A;  1FOK A;  2R7D A;  1S9H A;  3I56 I;  4A0X A;  4ASN A;  3GLX A;  2NVQ J;  3QPT A;  3C2B A;  1D8J A;  1FYM A;  2K9Q A;  3M1E A;  1XTA A;  2B9S A;  2IXS A;  3S17 J;  1EH7 A;  4BL0 B;  2XAS A;  2YU3 A;  4IVN A;  1VQM I;  2E7W A;  1YS6 A;  3MQ0 A;  2HS5 A;  3DKW A;  3NEU A;  1QZZ A;  4OAZ A;  2Y75 A;  2LH9 A;  4JP0 A;  5ILV A;  3MMY B;  1P4X A;  2XAH A;  4HST A;  4II3 A;  3CO6 C;  1ONV A;  3LMM A;  3CO7 C;  5H6Q A;  1FSH A;  4RAZ A;  3W6K B;  1X1P A;  1HLV A;  2AQF A;  3V8K A;  3ML6 A;  1WJE A;  3HC7 A;  6PAX A;  2E71 A;  2FNA A;  3CMY A;  5GAH J;  2CUJ A;  2VQL A;  3OL4 A;  2QVO A;  4PJM A;  2F4M B;  2QEN A;  2QWW A;  2CQX A;  3SZP A;  3GO5 A;  4B44 A;  5C44 J;  1L3L A;  4I02 A;  2A3S A;  1J9I A;  1JT6 A;  5GPC A;  2Z99 A;  4A12 A;  4UV9 A;  3CJR B;  5IT9 Z;  3QYF A;  1XDS A;  2E35 A;  2UXX A;  1UG0 A;  1XGN A;  2QEX I;  1ON2 A;  2H94 A;  1HCR A;  2CGP A;  2AXL A;  4XLN F;  5CLS A;  1HW2 A;  2UZK A;  3QYE A;  4MEY F;  1JT0 A;  2IA1 A;  3CCS I;  2JSP A;  4ZYA A;  1QQI A;  1Z1D A;  2XC7 A;  1ZK8 A;  1MMA A;  1X2N A;  2Y2Z A;  2R7Z J;  4A0Y A;  2DI3 A;  4BXF A;  1YTY A;  5L3D A;  4FHT A;  1OQY A;  1TNT A;  3PQK A;  3ZQG A;  4E7J A;  4F3Q A;  4EEF G;  1UAA A;  2XB0 X;  2RC4 A;  1ZLJ A;  2AO9 A;  5J47 A;  2E2H J;  2D1H A;  1QA6 A;  2QQA A;  5FKK A;  4EV0 A;  1IUF A;  1ON1 A;  5TIS C;  4HW0 A;  1TTY A;  3UNG C;  2GWR A;  3BTJ A;  3BZC A;  1OYW A;  3HRT A;  3IHU A;  1VND A;  3KZZ A;  2HDC A;  5HS9 A;  2W00 A;  4XLE A;  1ZG5 A;  2MA3 A;  1KU2 A;  5ILU A;  1MMN A;  1UHS A;  4LK0 F;  1A31 A;  4E7K A;  1BR2 A;  4A3K J;  3DPU A;  1D1B A;  3S1Q J;  2M5W A;  3QQA A;  3WTT C;  4D7M A;  1WPK A;  2JSC A;  4DBR A;  2NNY A;  1VI0 A;  3GCM A;  4N9I A;  4ABZ A;  1IN5 A;  4DZP A;  4ZTF A;  2MG4 A;  1UHM A;  1F9N A;  2ZCW A;  2EA2 A;  4DYQ A;  2EA4 A;  2JZY A;  4UV8 A;  3QOE A;  3PO2 J;  4YEJ A;  1ZGW A;  4QSH A;  2LBF B;  1OJL A;  3PNY A;  3SEZ A;  3CLO A;  2D5V A;  5E18 F;  1R49 A;  2O3F A;  4DZJ A;  1KYW A;  2DA1 A;  4A93 J;  1DUX C;  2UXN A;  5GPA A;  4D1Q A;  1XSV A;  1X1D A;  3CUQ A;  1MH4 A;  3SDG A;  5LGN A;  1QHG A;  2WY7 Q;  5ERI A;  2V1D A;  1XGO A;  2R7Q A;  5L3B A;  2QQB A;  1V4R A;  4HF0 A;  2J5O A;  1EKE A;  2M4G A;  3OL3 A;  1OYY A;  2DMP A;  1TLH B;  3UKG A;  3IAM 2;  4LOC A;  3I59 A;  3ZQI A;  3A01 B;  4A3I J;  4HZF A;  3LSR A;  2WAE A;  3C2H A;  3EET A;  5EEG A;  4BGD A;  1LDJ A;  2HNH A;  1YIJ I;  2CV2 A;  3GTO J;  1SAX A;  3E5X A;  4PJ0 C;  1K4T A;  3A0B C;  1JHH A;  3LSP A;  1LFP A;  2VE9 A;  1IV6 A;  4BDZ A;  3S1N J;  1MBG A;  1SD6 A;  2VLA A;  4HA8 A;  3MFK A;  2K9N A;  2M7B A;  4ZH4 F;  2Y0S N;  1QU3 A;  2OTJ I;  3U9G A;  2DYS H;  4OMY A;  2W57 A;  3F0C A;  4NC6 A;  4ESF A;  1IN4 A;  5J6X A;  3FK7 A;  4CCK A;  2QBY B;  5JFR A;  4CGZ A;  2D1V A;  4MHG A;  3GTK J;  1N75 A;  4MFD A;  3CD6 I;  5F08 A;  2F5F A;  1T0F C;  4IF4 A;  1R7J A;  1VTN C;  3ZMU A;  2X85 A;  2EFQ A;  1MBE A;  3D5S C;  3BQZ A;  3IWZ A;  5IP9 J;  5JHU A;  3DV8 A;  3LA3 A;  4LGW A;  2IVM A;  3OMY A;  3V7R A;  4JQF A;  1S6L A;  1APL C;  4UB8 C;  3G1L A;  4LD5 A;  4RB0 A;  4M3D A;  1BI1 A;  2DMN A;  3KET A;  3W2W A;  4CIC A;  5LBQ A;  2KRH A;  5KK1 A;  4ZDO A;  4A3F J;  3H0G J;  4HDV A;  1TQI A;  2DFF A;  5IOZ A;  4AVP A;  2QUF A;  4YII A;  3IWF A;  4JX5 A;  3VYR B;  4B4C A;  1T98 A;  2AQE A;  4IQJ A;  4QIW N;  3DBR B;  4FIS A;  1Z3X A;  2J5P A;  2KRF A;  4O6J A;  2K3P A;  3CCU I;  2XAF A;  5M3M J;  3BCB A;  3F8C A;  3G1O A;  5F0C A;  2STW A;  2L3D A;  3QU3 A;  2HVR A;  4IKF A;  1LQ1 A;  5DTD A;  1E3H A;  2P81 A;  5B1B H;  4IHS A;  3KP2 A;  2R7R A;  5GAD J;  2RDP A;  1UST A;  3VDX A;  3Q9V A;  4ENK A;  4UUS B;  2KQR A;  3PM1 A;  2BY0 A;  1Z3Y A;  3JW4 A;  4JOM A;  4CYD A;  4FCY A;  2IGO A;  2DMQ A;  3K1N A;  4RLQ A;  1KU3 A;  3DLA A;  3RPU D;  3BTC A;  2DLL A;  1MSF C;  3OYG A;  2R4G A;  5A2Q Z;  4TV7 A;  1QNT A;  5ILS A;  4LB6 B;  3TED A;  1IN7 A;  2Y9Y A;  3ZN1 A;  4PJN A;  3GVA A;  5E79 C;  3VYU B;  1LNW A;  1USS A;  2P6T A;  1HDP A;  5BQT A;  5FRN A;  3BJO A;  1RNL A;  2DU9 A;  2CRG A;  1D5Y A;  3IH2 A;  3CDI A;  2DYR H;  5BMZ A;  3GTQ J;  3RDI A;  1TT5 B;  4WCG A;  3RZO J;  4HNU A;  3HOT A;  5C3E J;  2ZO4 A;  1JUM A;  1D1A A;  1YLF A;  2DTR A;  3GTG J;  2XKO A;  3RYR A;  1DP3 A;  2F5D A;  1IJW C;  5IY5 H;  1E2X A;  1HA8 A;  3DKY A;  2W82 A;  2HQR A;  2Y0M A;  3BJ6 A;  2ISY A;  2QQ9 A;  1YE9 A;  2NOG A;  3Q0U A;  2CFX A;  3GFM A;  5BPI A;  5IYB J;  3RIR A;  2EB7 A;  3HYI A;  2XHK A;  5GTI C;  4DOZ A;  5F0F A;  1TNS A;  3RI4 A;  1V5F A;  3FMS A;  5L3G A;  1ETO A;  2DFH A;  2EK5 A;  2RN7 A;  5E3M A;  1H9G A;  5HLI A;  1UMQ A;  1ETX A;  2IBD A;  2W48 A;  1FIP A;  4LG3 A;  3DFG A;  3DCF A;  1U8B A;  3ZXS A;  3MKL A;  2HDW A;  2H6B A;  1IDY A;  4FET A;  2CV1 A;  1R23 A;  4A2U A;  4BKX A;  1SAN A;  5KHD A;  4GYI A;  2LDU A;  3HRM A;  5L3F A;  1SMT A;  1MMS A;  2ICW G;  1JI8 A;  4XRM A;  3G4S I;  3KLN A;  1HXD A;  2NOJ B;  4IJA A;  1JUS A;  5EJC A;  1O3S A;  4N4O B;  2MLG A;  3BG5 A;  2ELJ A;  1B9N A;  4L18 B;  3HOW J;  4D5C A;  1KA8 A;  2BBY A;  1XB4 A;  2O9L A;  1LB2 A;  1YIT I;  3QWL A;  1Z77 A;  4CA0 A;  4U7B A;  3J7Y J;  4RAY A;  1JE8 A;  1JXS A;  1FSE A;  4DYC A;  1GV2 A;  1IF1 A;  4Z6Y A;  4IOC F;  2A61 A;  4ZDL A;  1BJA A;  2L2O A;  4M73 A;  5FJ8 J;  1XMX A;  4GO1 A;  1YIO A;  3CC2 I;  4KIF A;  3ZMV A;  4EJO A;  2HPI A;  1LPQ A;  4BHP A;  2VB6 A;  4HLY A;  3SJM A;  1OKR A;  1RZ4 A;  1HC8 A;  4Y13 A;  2HXO A;  1O3T A;  2FX0 A;  4FQG A;  4P55 A;  3DU6 A;  5LRS A;  4HNV A;  1ETV A;  4QTR A;  1FX7 A;  1Z05 A;  2KDZ A;  1JKR C;  3L09 A;  4MTE A;  2HXI A;  4ZZD A;  2IS1 A;  3R6S A;  2DT7 B;  4L9V A;  4V2F A;  2RQQ A;  4LIV A;  3ZMD A;  3PIP F;  1QZY A;  1D1C A;  2OCE A;  3CQZ J;  2ZNZ A;  2KIQ A;  2R7X A;  1I1S A;  4PZJ A;  2BVL A;  3WU1 B;  3IP4 B;  1J5Y A;  1ZH5 A;  1T39 A;  1X2M A;  1KQ0 A;  2DFI A;  5L3C A;  1XPX A;  4KMF A;  2VXZ A;  2VN2 A;  3EUA A;  4L9T A;  3RQ4 A;  3BG6 A;  2XF6 A;  2G9W A;  4I6Z A;  2E2I J;  2IPQ X;  3PUF A;  1SC7 A;  3I5U A;  1K6Y A;  4OMZ A;  1K61 A;  3RKW A;  3AL0 C;  2FMY A;  1X3U A;  2WAF A;  1U6G A;  3A01 A;  3Q5F A;  1XMA A;  2FA5 A;  2KL4 A;  2R7F A;  4PDK A;  1S72 I;  4QWQ A;  1TWC J;  3ZQC A;  1CQT A;  1T33 A;  4IRI A;  3QOD A;  3WTW C;  3D5R C;  2KP6 A;  2PMZ A;  1KGS A;  1TC3 C;  2DQL A;  2DMU A;  3TGN A;  2BXY A;  1B9M A;  1LJ9 A;  4FAS D;  1W36 C;  1AHD P;  5J4V A;  3CUQ C;  2M2E A;  5HS7 A;  3CZ6 A;  2Q0O A;  1TP4 A;  4Z2Y A;  2E1M C;  2PMH A;  2PFB A;  1WJF A;  3P5J A;  1LVK A;  1Y8R B;  1REP C;  1YFH A;  1S7A A;  2XUB A;  3BY6 A;  3R60 A;  1UJ8 A;  3SZT A;  1OR7 A;  2QBY A;  3TOA A;  4C3H J;  3MEX A;  2E5Z A;  1A5J A;  1LEA A;  1FOY A;  1E17 A;  1P92 A;  2CWE A;  4BJ6 C;  2DK5 A;  2P7C B;  3LNQ A;  1I6X A;  2NAZ A;  4HLX A;  2CH0 A;  2ZSI B;  3ABK H;  4KJZ A;  4P5O A;  3WG7 H;  4BY1 J;  1PYV A;  4B47 A;  3OYA A;  3H35 A;  2CSO A;  3GFI A;  3I55 I;  4CUG A;  2R93 J;  2VC0 A;  2KHM A;  2V1U A;  4M9Z A;  4WXC A;  2D45 A;  2YS9 A;  3WE2 A;  4W97 A;  1ORK A;  2HTS A;  1BIA A;  1B1B A;  2ZBK A;  3W6J B;  2M7A A;  2NVX J;  5ICE A;  1YI2 I;  1OCC H;  3GTP J;  1MBH A;  2LP0 A;  4NBQ A;  3RKQ A;  1VQP I;  4IHW A;  3S14 J;  2IJL A;  3HPH A;  3OYK A;  1D0Z A;  2L9S A;  3B6A A;  1LFU P;  4MO7 A;  5F1J A;  1W7P B;  3W2V A;  3K2Z A;  1Z7U A;  1XS9 A;  2IAI A;  1RR7 A;  3ABL H;  2JVH A;  3V4G A;  1AA7 A;  1ETK A;  2XVC A;  1WFX A;  2JJ7 A;  1H8A C;  2XGC A;  2F2E A;  4F92 B;  3HOU J;  3E0J B;  4UUS A;  1IC8 A;  4BE1 A;  2K9L A;  3KCC A;  1NG6 A;  3P9C A;  1Z67 A;  5DUI A;  1GXP A;  3O8G A;  3SHF A;  2PEX A;  2MH2 A;  1B8I A;  3VFZ A;  4AID A;  4S05 A;  3LSG A;  2BHZ A;  1MJ9 A;  3K4B A;  3ELK A;  4II2 A;  2DA6 A;  5D5V B;  2PX9 A;  1ERD A;  1G3W A;  2XRL A;  2VL8 A;  4RMN A;  5AIQ A;  3VYS B;  4CZZ A;  5KCM A;  4B09 A;  1WJD A;  4CYC B;  1O3Q A;  1ZAR A;  2LNB A;  1BN5 A;  2ZFU A;  3ROU A;  1IN8 A;  2MSY A;  1SFO J;  1F4K A;  5EZG A;  2VJ5 A;  1MD0 A;  5AON A;  4PFO A;  4CCN A;  2VJ4 A;  3K4L A;  1BI2 A;  4F7Z A;  2Q2E B;  1BI0 A;  5BNG A;  2DN0 A;  3H5A A;  3N05 A;  1YO5 C;  1ZKG A;  2Z9O A;  3IV5 A;  5K1Y A;  4EMS A;  3OYN A;  1IXC A;  2IEK A;  1B59 A;  2LFB A;  3T1B A;  2A6T A;  4HV6 A;  3M4O J;  2BXZ A;  5E1Z B;  2DOF A;  2Z16 A;  2K86 A;  2DW4 A;  1S5L C;  1WRJ A;  3MN2 A;  3HBL A;  3E1S A;  2MYS A;  1Y56 A;  5E20 A;  2CU7 A;  3JRG A;  2N8G A;  3M3Y J;  2R5Y B;  4AVZ A;  2LTP A;  3KFW X;  1WH7 A;  3WTZ A;  4XKC A;  4NHJ A;  4ETS A;  3LSM A;  4YIF A;  2DA4 A;  1DQU A;  2XRN A;  2D2W A;  3KP7 A;  3U1D A;  3AAF A;  2K40 A;  1FJL A;  2HOT A;  1HKT A;  2FXA A;  1P2F A;  2JRM A;  2F48 A;  1XCB A;  2JPB A;  1G59 A;  4WWC A;  4N4N B;  1HST A;  3WGG A;  4EJU A;  3LFK A;  1UEL B;  3J7Z I;  1VZ0 A;  4BQO A;  1V5E A;  3H92 A;  4CO8 A;  2BYV E;  2A07 F;  5FLX Z;  3B02 A;  1JTX A;  1ODD A;  4XBF A;  3L2V A;  3TO7 A;  2R7T A;  3HEF A;  3ZQL A;  2VBX A;  1KZH A;  4ZC3 A;  3K10 A;  2DMT A;  5DCM A;  1N25 A;  3V8J A;  4N9H A;  2M3A A;  1O4X A;  1PP7 U;  2M8E A;  4MNU A;  1F36 A;  2HGC A;  2DAO A;  3M8E A;  5D4R A;  4AM3 A;  2JN6 A;  2O03 A;  4XID A;  4BU2 A;  1K78 B;  1HBX G;  2W7N A;  4RM2 A;  2CW7 A;  2ZJ2 A;  4U0Y A;  4L0Y B;  1PP8 F;  1XCV A;  4IRG A;  4LK1 F;  3HOX J;  2PN6 A;  3FIW A;  2NYX A;  1A04 A;  2E34 A;  3LSH A;  3HSE A;  3BRO A;  3B6C A;  1D5V A;  4LG0 B;  4A3G J;  3FXJ A;  5J1R A;  4HEA 2;  4I7H A;  3Q9S A;  5FD6 A;  4MTD A;  5FKM A;  2XAU A;  3R4K A;  2R7O A;  3LAJ A;  4KDP A;  4YFN F;  3I53 A;  4EM2 A;  1S8N A;  1I27 A;  2ZXW H;  3TW7 A;  2I8D A;  3DU5 A;  1SEU A;  1WZ2 A;  3H9J A;  4RGR A;  4G6D A;  5J1U A;  2GIZ A;  1PDN C;  4LLN A;  3BZK A;  1LUJ B;  2V9V A;  3BR0 A;  4HG2 A;  3HIF A;  3BC8 A;  2DBB A;  3FK6 A;  3FHZ A;  2IT0 A;  1ZYR F;  2P5K A;  2HR3 A;  2E36 A;  4AIJ A;  4BHB A;  1FMV A;  1T95 A;  2E1C A;  2JA7 J;  2KMU A;  2DTZ A;  3MCZ A;  4HQM A;  3OYC A;  1T6S A;  3VEP A;  4BQQ A;  2MD5 A;  3EUH A;  2EIK H;  4B43 A;  4Q4Z F;  4CCM A;  2NS7 A;  3CC7 I;  3BR2 A;  1ZAO A;  3H5N A;  2CUE A;  1FYL A;  1XGS A;  4G7Z F;  4XOT A;  2A6E F;  2M9H A;  2MLK A;  4DW6 A;  1D0Y A;  1V55 H;  5FD5 A;  4U87 A;  3P9I A;  2EBI A;  4XLH A;  1PJR A;  2GBY A;  3F8B A;  1XD7 A;  2ID3 A;  5HLT A;  1SFE A;  1ZN2 A;  2HKX A;  4Y15 A;  4KYW A;  5E17 F;  4O3M A;  1VQ4 I;  2X1C A;  1G8X A;  2OU2 A;  2F6C A;  1MJB A;  2COM A;  3PQJ A;  1QVU A;  4RLF A;  4DYR A;  3CMM A;  1C0W A;  1A35 A;  3BZ6 A;  2HWV A;  3HDD A;  4FX0 A;  1R1V A;  3HGG A;  3I71 A;  2DJN A;  5EGO B;  4J01 A;  3GME A;  2JA2 A;  2LKS A;  2X1E A;  1U9N A;  4A5M A;  2NVY J;  1MJA A;  2A6H F;  4M71 A;  1TWG J;  3ISP A;  2OZU A;  2CQN A;  2KJC A;  3K70 D;  2DOD A;  4D0P A;  4KN4 X;  2C6Y A;  2H6C A;  4M3G A;  2M34 A;  2BW3 B;  1YQA A;  4NDL A;  4HX7 A;  3LA2 A;  2DOE A;  2IGN A;  3E7L A;  3NAU A;  5HDG A;  3V8L A;  2BZT A;  1MSE C;  3SFZ A;  3F3X A;  3RTR A;  5C4J J;  4HF2 A;  3C7J A;  2JVG A;  2QKM B;  2JK3 A;  1OR7 C;  3JRF A;  4UXN A;  2ZKZ A;  5IYC J;  2IW5 A;  3D1N I;  2MD0 A;  4G94 A;  1R6R A;  1LDK B;  4G9Y A;  4HSR A;  2E2J J;  4RGS A;  1GHC A;  4BE0 A;  2NXN B;  2FF4 A;  1MNM C;  5L3E A;  1DPU A;  3EYY A;  3L1P A;  4M74 A;  4BQA A;  3L9F A;  4P1W A;  4EGZ A;  1HF0 A;  3K0L A;  5TRD A;  4F52 A;  2A5W A;  4HOB A;  5H20 A;  1WJA A;  1KU9 A;  1YX5 A;  1VQO I;  5E3O A;  1RKT A;  3B73 A;  3AFH A;  4S04 A;  4CDG A;  5EG0 B;  4FE7 A;  3SDB A;  2QSF X;  3K7A J;  4WF2 A;  2VC1 A;  3M9A A;  2R3S A;  2PJR B;  3CCQ I;  4MFE A;  1QBJ A;  3WTU C;  1ZQ3 P;  3OYD A;  1IRF A;  2EFO A;  4XRS G;  4GFB A;  1ZRC A;  3ASN H;  1JUP A;  1R1T A;  3TKY A;  4I0B A;  4CYC A;  1R5G A;  2ECC A;  2HOE A;  4XRF A;  1OLT A;  1I50 J;  4QPQ A;  2R0Q C;  4GYG A;  3ZOB A;  4A5N A;  1BC7 C;  3OS1 A;  4FT8 A;  3DTE A;  3FM3 A;  4JBA A;  2Q2E A;  3E97 A;  4U88 A;  2XDV A;  2VBZ A;  3DPL C;  3FM5 A;  4PFP A;  5ICG A;  4BH9 A;  3K4C A;  4BBR J;  5D8K B;  2EH3 A;  2GXA A;  4XLC A;  4DNC A;  4CCJ A;  4ANJ A;  4E7Z A;  3G6E I;  4KUM A;  4A69 C;  2JA8 J;  4IXA A;  3ABM H;  1AU7 A;  5M5W J;  1ACI A;  1TT0 A;  3BCA A;  1R1U A;  3JSO A;  4GXO A;  1YRN B;  2VPL A;  4IHY A;  2QF7 A;  2X0L A;  5DYM A;  2K27 A;  3J81 Z;  2Q1Z B;  1LKX A;  2R5Y A;  3R0J A;  1FTT A;  3G2B A;  3MZ8 A;  1U5T B;  2XPU A;  4EM0 B;  4BHC A;  1JGG A;  3KEO A;  2RGV A;  2ZNY A;  4QPO A;  2WB1 N;  2EZK A;  2EQR A;  4KNY A;  4BEH B;  1F43 A;  1JKO C;  2MW8 A;  1JGS A;  3DEE A;  1FLI A;  4U7D A;  5FLV A;  3HXL A;  1FC3 A;  1ZRF A;  2JA6 J;  4AWX B;  5D5X B;  4B3A A;  2DXI A;  3HOY J;  2HZT A;  1VQ9 I;  1HW5 A;  2ZME B;  2IS4 A;  3F6O A;  5FFX A;  4EVI A;  3SQN A;  1IZ1 A;  1VF9 A;  2Y0S A;  4CZC A;  1XDU A;  2TRT A;  4BY7 J;  5DS9 A;  3IC7 A;  3C18 A;  2Y69 H;  4A3E J;  3S1M J;  1RR8 C;  2HVS A;  2V79 A;  1B72 B;  3JTG A;  1Y1W J;  2WAQ N;  2KKO A;  1G6N A;  1L0O C;  1RPW A;  3TMO A;  1VQK I;  2P6S A;  2PJP A;  3H36 A;  2H09 A;  2V26 A;  1BIB A;  3KZI C;  2JWT A;  1K78 A;  4HYE A;  1WHU A;  2F5E A;  3PNT A;  2IS6 A;  2BE5 F;  1K4S A;  1QVT A;  2YU9 J;  4BS9 A;  4X6A J;  4AIH A;  3FHN A;  3LOC A;  3E6C C;  2L0K A;  4GGG A;  3PO3 J;  1E3P A;  1LE8 B;  4AYB N;  1WSU A;  3ZMT A;  2FD5 A;  2ECB A;  3S2W A;  5DV5 A;  5M5X J;  3CTA A;  5KAI C;  1MMD A;  5F27 A;  4BAC A;  4UVA A;  1EV7 A;  5LD2 C;  1N77 A;  5CYV A;  3PIO F;  1IXS B;  5J3L A;  4IHV A;  5FRM A;  1IRG A;  3EQL F;  2OBP A;  3GZN B;  3S16 J;  3LST A;  3AG2 H;  3G73 A;  2LRD A;  2FSW A;  2PBI A;  3DKX A;  1SVO A;  3O2P E;  4W1U A;  1BOA A;  3GTL J;  3LFU A;  3IL2 A;  2VI6 A;  2VBY A;  5HNH A;  2P5V A;  1D8K A;  1Y0N A;  1B6A A;  4E7S A;  3FXQ A;  3CCM I;  3G71 I;  2OPT A;  4LLG F;  2E7X A;  4V2G A;  3OSG A;  1R9T J;  4M72 A;  3TQN A;  4LMY A;  4KMU X;  1T8I A;  1BBY A;  4ON0 A;  1J09 A;  4GCV A;  4F55 A;  3ZP5 A;  3QYB A;  1IG7 A;  5FKL A;  3H9Q A;  4KT6 A;  3U2R A;  3KLO A;  3RYP A;  2E5N A;  4M9S A;  4A3C J;  1QHH D;  3ECO A;  2G7U A;  3H0D A;  1D0X A;  5DD8 A;  5K7F A;  1FYK A;  3IUO A;  5FRO A;  4CHU A;  3MVP A;  1DU0 A;  3L7W A;  1AKH B;  4C3I J;  2L9N A;  3KP3 A;  3C2G A;  2CV0 A;  1YJN I;  2E60 A;  3BG7 A;  3OWT A;  3TW6 A;  1DDN A;  2XB5 A;  3KEY A;  2P8T A;  4OIO F;  1DGR M;  2X6X A;  5EGO A;  4HAM A;  3EUH C;  1Z21 A;  4UHT A;  3EUK L;  2F5C A;  4PSW A;  5E3N A;  2Z3Y A;  2X51 A;  3OR2 C;  3MKW B;  4E6K G;  1YG2 A;  2LYC A;  3IKV A;  3BR5 A;  4IPA A;  5H2F C;  5JHF A;  4FX4 A;  5ED4 A;  4NUB A;  4P96 A;  3PJR A;  3GTM J;  2UWM A;  2BW3 A;  5HNF A;  2LG4 A;  4HPQ A;  3WTX C;  5IYD J;  2GQQ A;  3RZD J;  3CF2 A;  3VSK A;  1WVR A;  1WQ2 A;  4XNF A;  1MNE A;  4I0A A;  4BJT A;  5CPR B;  1NK3 P;  1RET A;  2I5U A;  2K4J A;  4BDY A;  2HPM A;  3FBN B;  2DPU A;  3NWT A;  1D3Y A;  2EZL A;  3RCO A;  3OS0 A;  2NS0 A;  1F5T A;  1YOV B;  3G3Z A;  1KQ8 A;  3ZQQ A;  1J7K A;  3IKT A;  1OMI A;  5F1R A;  1IAW A;  5D6E A;  3WOD F;  2VAS A;  3H3V K;  4LJZ F;  2EIL H;  2XGX A;  2K9M A;  4JYK A;  1R58 A;  2ME6 A;  2FOW A;  5DUK A;  3FKJ A;  2KIS A;  4M6V A;  1VQ6 I;  2XAQ A;  4XM3 A;  2HTJ A;  4EGY A;  1UFM A;  3MAJ A;  3O8H A;  4OU0 A;  3I4N J;  2A05 A;  2MFZ A;  1LVA A;  3C1D A;  3CC4 I;  5EG0 A;  2LBF A;  2Z1D A;  3AG1 H;  1OCR H;  3OIP A;  4XIC A;  3BR3 A;  3OR1 C;  5EF6 A;  1TQP A;  3N97 A;  2LD5 A;  1U78 A;  1K6O A;  3IRQ A;  1DGW Y;  1O57 A;  3BG9 A;  5HLH A;  1VQN I;  2E1N A;  2X9D A;  3E6M A;  3S3M A;  2X6W A;  4JX4 A;  3CLQ A;  4L9N A;  3GF2 A;  2Z2S B;  1KYZ A;  3DXJ F;  1JTY A;  3TDU C;  2GLO A;  3QOP A;  1G3S A;  1WGX A;  4D7N A;  3COA C;  2EZH A;  4IZZ A;  3K6G A;  3VWB A;  2VQG A;  5LHI A;  4J00 A;  4E7H A;  3QP6 A;  3OYE A;  2EFW A;  1NH3 A;  4G6Q A;  3W6V A;  3M7G A;  4KIG A;  2RKH A;  1T56 A;  2VKH A;  1XSD A;  2DFE A;  2GOM A;  2Y31 A;  2HYG D;  3QAH A;  3FXM A;  1TBX A;  1YW7 A;  2DO7 A;  2GOX B;  5E1X A;  4YG2 F;  1GUU A;  4UVB A;  1R5H A;  1YRN A;  2ZC2 A;  2DT5 A;  2HOS A;  3V7C A;  2WC2 A;  3HG9 A;  4ESB A;  4C2U A;  3C3W A;  4HRI A;  3A1Y A;  4A6E A;  3PSF A;  1NTC A;  1XSX A;  4KIB A;  3DWL E;  1UZC A;  4PSX A;  3CP2 A;  1U5T A;  3QP5 A;  3JAM K;  1IGN A;  4RM3 A;  3ERE D;  3HUG B;  3F22 A;  3WTS C;  4BEH A;  2JPC A;  4C9Y A;  3WTY C;  4XSX F;  2O0Y A;  3AG3 H; 
#chains in the Genus database with same CATH homology
 3WGI A;  2M45 A;  3ZQ7 A;  1ZRD A;  2HQN A;  1R00 A;  5DCF A;  2FEZ A;  3E3V A;  2VON A;  2ZME A;  3WE3 A;  1MGT A;  1ZRE A;  1STZ A;  3J80 Z;  1BC8 C;  5LGU A;  3REO A;  1Z91 A;  3N4M A;  3HHH A;  2VOD A;  3M8F A;  4AD9 A;  2QYO A;  3CDH A;  2XRO A;  2GXG A;  4M6Y A;  1ZLK A;  5E8I A;  2DK8 A;  2FBH A;  3ABU A;  1YW9 A;  2PMU A;  1RUN A;  3WG9 A;  1FBS A;  4ENJ A;  4HDU A;  3EDP A;  1V3F A;  3ABT A;  2KIM A;  4MQV A;  4CXF A;  5HVQ C;  3OV8 A;  2VOO A;  1WI9 A;  2QLZ A;  3FMQ A;  1I1G A;  2MH9 A;  4IRH A;  5FB2 A;  2K02 A;  2XIG A;  2G7H A;  5HS8 A;  3FX3 A;  1P4A A;  5CVI A;  3I64 A;  5CVV A;  2MBF A;  4ZYH A;  1XN7 A;  1MDM B;  2L4A A;  1AOY A;  3VOE A;  2OQG A;  3ZMZ A;  1FWZ A;  1W7P D;  5HLG A;  3GXO A;  1Z6R A;  4LLL A;  5JR3 A;  1O7F A;  2LF8 A;  2RNJ A;  5BS6 A;  2L01 A;  2IRF G;  3I54 A;  5JVT A;  2Z5U A;  1EH8 A;  1U8R A;  2PI0 A;  4JK1 X;  4HX4 A;  2X4H A;  1OPC A;  3JTH A;  2BEO A;  1SFX A;  5BPD A;  4MQ9 F;  2GA1 A;  1FZP B;  2A68 F;  2FE3 A;  3ZN0 A;  3KE2 A;  4DQ2 A;  3RKX A;  1IUY A;  2O8X A;  2VT2 A;  3QPH A;  2ZXJ A;  4EJV A;  2JTV A;  1IN6 A;  2WWY A;  3NRV A;  5K5O A;  5DD4 A;  4WK8 F;  1FBQ A;  1J2X A;  3R61 A;  3DF8 A;  5JI6 A;  5IT9 K;  2EWN A;  1ZGJ A;  2STT A;  2M87 A;  2HYF A;  4OOI A;  3P9K A;  4K2E A;  4G7O F;  4G7H F;  2GIV A;  2RVC A;  2P7V B;  4XLP F;  1MKM A;  5K5R A;  2W24 A;  1OYI A;  1W5S A;  2XV4 S;  3GYH X;  1XGM A;  2Y48 A;  1S3J A;  2YPR A;  1UHW A;  3GW2 A;  3D5L A;  5LGT A;  1TW2 A;  2OA4 A;  2QZ8 A;  3GFJ A;  4B8X A;  4UVC A;  1G4D A;  3TOB A;  3HUG A;  1KQ9 A;  3SXY A;  3E5Q A;  2OAZ A;  4YFX F;  5TJJ A;  4KT5 C;  4Q48 A;  4NB5 A;  2NRA C;  2PQ8 A;  2FNP A;  4ENN A;  2JT1 A;  3I4P A;  2M30 A;  3WTV C;  1U5T C;  4EM1 A;  2YR2 A;  2M1B A;  3LWF A;  3PFI A;  2V1X A;  4I2O A;  5J8F A;  2PLY A;  1W7P A;  2HKO A;  1BM9 A;  1CF7 B;  3ULQ B;  4RGX A;  1SD7 A;  2TDX A;  1JHF A;  3NQO A;  1RUO A;  1GVJ A;  3GZ5 A;  3MWM A;  3ZPL A;  1SMY F;  2Q8K A;  5E8G A;  2PG4 A;  4U0W A;  2EV0 A;  3KP6 A;  2FML A;  1Z6T A;  4A6D A;  2ZFW A;  4HV5 A;  2K4B A;  4R79 A;  3HHG A;  4H0E A;  5DDG A;  1QO0 D;  3HTS B;  4R8H A;  2FOK A;  3F72 A;  3GFL A;  3BPX A;  3J81 K;  4Y17 A;  4OIR F;  3KP5 A;  5FO5 A;  2CYY A;  2EFP A;  4OIQ F;  2ELH A;  2YX7 A;  5K5Q A;  1RIO H;  2Z33 A;  3R0A A;  4WXD A;  1HQC A;  2GZW A;  1J0R A;  1MDM A;  4ZZL A;  3VB2 A;  3MZY A;  3HTU A;  2V6C A;  2IA2 A;  2CW0 F;  3JSP A;  2OZ6 A;  5IT3 A;  3HRU A;  1GXQ A;  1EH6 A;  1FNN A;  3RJP A;  1KU7 A;  4AIK A;  4RB3 C;  4ESJ A;  3FXR A;  3DQV C;  2A5Y B;  3LQQ A;  1NHA A;  5FFZ A;  2HFH A;  5BOX A;  2KJB A;  3EYI A;  5HDN A;  3T0Y A;  4HBL A;  2VT3 A;  4BAY A;  1WWX A;  3P7N A;  4Q47 A;  5CVU A;  1T38 A;  5A2Q K;  1S7O A;  5EEH A;  2XKP A;  4HX8 A;  3FMR A;  4I01 A;  4LG0 A;  5CVR A;  3LAP A;  2VE8 A;  1G3Y A;  1FPQ A;  3DP7 A;  4N0B A;  4PCQ A;  3F8M A;  1HKS A;  2GXB A;  2H27 A;  4L0Z B;  4YFK F;  3LQR A;  2IP2 A;  4UUV A;  2GAU A;  2KIU A;  5F6F A;  1P6R A;  2O61 A;  5LHH A;  1H0M A;  3GEZ A;  4A0Z A;  3GUD A;  5HOO A;  2W85 A;  2LF7 A;  2IA0 A;  2W84 A;  1BI3 A;  1LEB A;  1FBU A;  3K1M A;  3WGH A;  4BYY A;  5CVJ A;  2GA2 A;  2JRT A;  2NNN A;  1U3E M;  1YS7 A;  3OOP A;  4MGR A;  5LLQ A;  4PGH A;  1FT9 A;  2EJR A;  3H3Z A;  4XSZ F;  4RGU A;  2BGC A;  2L54 A;  1FP1 D;  4M6X A;  3K9T A;  1K79 A;  4ZYD A;  2HEO A;  3CJN A;  1QGP A;  5FGM A;  3KZY A;  4G8X A;  1DP7 P;  3GWZ A;  2BV6 A;  2L02 A;  4ZYG A;  1I5Z A;  1W4M A;  1Q1H A;  1YW8 A;  2O6G E;  3K69 A;  3HSF A;  4RB1 A;  4L5J A;  1CF7 A;  5DCM B;  3TO9 A;  2VBW A;  3WU0 A;  2EFN A;  3K1P A;  1W5T A;  2FQ3 A;  4I09 A;  1HW1 A;  5J8C A;  3HOS A;  1R22 A;  5D5U B;  2OQR A;  2FRH A;  1UB9 A;  2XAG A;  3GZ6 A;  3KP4 A;  4PGG A;  5LEK A;  1H9T A;  4NQW A;  2OD5 A;  1J59 A;  3O6B B;  4P9U A;  3L00 A;  5D8L B;  5LHG A;  3BWG A;  2DQR A;  4E70 A;  3FWE A;  1T2K A;  3I58 A;  1F1Z A;  1R36 A;  3LA7 A;  2FBI A;  2P5L C;  3BJA A;  2P4W A;  3QU6 A;  4RS8 A;  5H6R A;  3TDZ C;  1ZG3 A;  3J80 K;  1ZG1 A;  3F8F A;  3O3K A;  4P9F A;  1ZGA A;  1ZHF A;  1G3T A;  4IHT A;  1S29 A;  1YYV A;  4WXH A;  1DPR A;  3BOQ A;  2EV6 A;  3FXU A;  2ACJ A;  2W25 A;  4ZYE A;  3FF5 A;  3RPU A;  1B4A A;  2ADU A;  4BXU A;  4HF1 A;  3D0S A;  3T8R A;  2LSO A;  3KEQ A;  4KN7 X;  3BPV A;  3DEU A;  5KVR A;  3HSR A;  1P4W A;  3F6V A;  2XAJ A;  1FY7 A;  4U0V A;  3T5X A;  2VOP A;  1IXR C;  1TW3 A;  2CO5 A;  3L2C A;  3H3U A;  3T8T A;  2K7L A;  2A69 F;  3JAM Z;  4EJW A;  1RI7 A;  5LEJ A;  2FBK A;  4EJT A;  3F8N A;  1CGP A;  3E6B A;  2EV5 A;  2KIF A;  2CQK A;  1AWC A;  3MZH A;  4ENM A;  1HKQ A;  1SD4 A;  1PUE E;  1LDD A;  1QPM A;  4WX9 A;  5E1W A;  4Q5S F;  5LRR A;  5D5W B;  4I98 B;  2FU4 A;  5CJ9 A;  2ETH A;  4KIC A;  5D4S A;  1MZB A;  5D6F A;  2MC3 A;  1Y0U A;  1IW7 F;  4KFC A;  4LB5 A;  3CUO A;  2RQP A;  4UNO A;  3E5U A;  5ICC A;  2L4M A;  4HQE A;  1ULY A;  5F64 A;  3CUQ B;  1U2W A;  4L9J A;  1O7L A;  1SD5 A;  2WTE A;  2RV8 A;  3HRS A;  1WKM A;  3I0T A;  2YSR A;  3I59 B;  4LFU A;  5HDK A;  5FLX K;  1K7A A;  3TO6 A;  4KA4 A;  1T0F A;  4BNC A;  1Z9C A;  2CG4 A;  1HSJ A;  4QLC U;  2DPD A;  3BP8 A;  1TQM A;  3BDD A;  4L5I A;  2ESH A;  2ESN A;  3RKY A;  2YX4 A;  3F21 A;  2WV0 A;  5AIP A;  3QRF F;  1UCR A;  3DPT A;  3E6D A;  2AS5 F;  3J7A O;  3V7S A;  1SFU A;  3GX4 X;  2QM3 A;  3ZMS A;  3IRR A;  3FZV A;  2B0L A;  5ICF A;  2LKP A;  4EQQ A;  4O5V A;  4RB2 C;  3F23 A;  3VOD A;  1O3R A;  4OIP F;  2ISZ A;  5DEQ A;  4MEX F;  4R1H A;  1FP2 A;  4OIN F;  3RPQ A;  1XMK A;  4M9X A;  1J75 A;  3ECH A;  1FOK A;  2R7D A;  4A0X A;  4ASN A;  3GLX A;  3QPT A;  1D8J A;  1FYM A;  3M1E A;  1EH7 A;  2XAS A;  2YU3 A;  4IVN A;  2E7W A;  3NEU A;  1YS6 A;  3MQ0 A;  2HS5 A;  3DKW A;  1QZZ A;  2Y75 A;  5ILV A;  1P4X A;  2XAH A;  3CO6 C;  1ONV A;  3CO7 C;  5H6Q A;  1FSH A;  4RAZ A;  3W6K B;  3V8K A;  3ML6 A;  6PAX A;  2FNA A;  2QVO A;  2QEN A;  2QWW A;  3SZP A;  3GO5 A;  1L3L A;  4I02 A;  2A3S A;  1J9I A;  2Z99 A;  4A12 A;  4UV9 A;  5IT9 Z;  1XDS A;  2UXX A;  1XGN A;  1ON2 A;  2H94 A;  2CGP A;  2AXL A;  4XLN F;  5CLS A;  1HW2 A;  2UZK A;  4MEY F;  2IA1 A;  1QQI A;  1Z1D A;  4A0Y A;  2DI3 A;  1YTY A;  5L3D A;  4FHT A;  1TNT A;  3PQK A;  2RC4 A;  1ZLJ A;  2D1H A;  2QQA A;  4EV0 A;  1ON1 A;  4HW0 A;  1TTY A;  2GWR A;  1OYW A;  3HRT A;  3IHU A;  3KZZ A;  2HDC A;  5HS9 A;  1ZG5 A;  2MA3 A;  1KU2 A;  5ILU A;  4LK0 F;  2M5W A;  3WTT C;  2JSC A;  2NNY A;  4N9I A;  1IN5 A;  1UHM A;  1F9N A;  2ZCW A;  2EA2 A;  2EA4 A;  2JZY A;  4UV8 A;  3CLO A;  5E18 F;  2O3F A;  1KYW A;  1DUX C;  2UXN A;  1XSV A;  3CUQ A;  5LGN A;  5ERI A;  2V1D A;  1XGO A;  5L3B A;  2QQB A;  1V4R A;  4HF0 A;  2J5O A;  1OYY A;  1TLH B;  3I59 A;  4HZF A;  3EET A;  5EEG A;  1LDJ A;  1SAX A;  3E5X A;  1JHH A;  2VE9 A;  1SD6 A;  4HA8 A;  3MFK A;  4ZH4 F;  3U9G A;  4OMY A;  2W57 A;  4ESF A;  1IN4 A;  5J6X A;  2QBY B;  5JFR A;  4CGZ A;  2D1V A;  4MHG A;  2F5F A;  4IF4 A;  1R7J A;  1VTN C;  3ZMU A;  2EFQ A;  3IWZ A;  5JHU A;  3DV8 A;  3LA3 A;  4LGW A;  2IVM A;  3V7R A;  4JQF A;  1S6L A;  4LD5 A;  4RB0 A;  1BI1 A;  3KET A;  4CIC A;  5LBQ A;  5KK1 A;  4HDV A;  1TQI A;  4AVP A;  2QUF A;  4YII A;  3IWF A;  1T98 A;  2J5P A;  2KRF A;  4O6J A;  2XAF A;  3F8C A;  2STW A;  2L3D A;  3QU3 A;  1LQ1 A;  4IHS A;  3KP2 A;  2RDP A;  1UST A;  3Q9V A;  4ENK A;  3JW4 A;  4CYD A;  3K1N A;  1KU3 A;  2DLL A;  5A2Q Z;  4TV7 A;  1QNT A;  5ILS A;  4LB6 B;  1IN7 A;  3ZN1 A;  3GVA A;  1LNW A;  1USS A;  2P6T A;  5BQT A;  3BJO A;  1RNL A;  2DU9 A;  5BMZ A;  3RDI A;  4WCG A;  3HOT A;  2ZO4 A;  1YLF A;  2DTR A;  2XKO A;  3RYR A;  2F5D A;  1E2X A;  2HQR A;  2Y0M A;  3BJ6 A;  2ISY A;  2QQ9 A;  2CFX A;  3GFM A;  5BPI A;  3RIR A;  2EB7 A;  3HYI A;  2XHK A;  1TNS A;  3RI4 A;  3FMS A;  5L3G A;  2EK5 A;  2RN7 A;  1H9G A;  5HLI A;  3DFG A;  2H6B A;  1R23 A;  4A2U A;  4GYI A;  2LDU A;  3HRM A;  5L3F A;  1SMT A;  3KLN A;  1HXD A;  4IJA A;  1O3S A;  2MLG A;  1B9N A;  4L18 B;  1KA8 A;  2BBY A;  1XB4 A;  1LB2 A;  4U7B A;  1JE8 A;  4RAY A;  1JXS A;  1FSE A;  1IF1 A;  2A61 A;  1BJA A;  4M73 A;  4GO1 A;  1YIO A;  4KIF A;  3ZMV A;  4EJO A;  4BHP A;  4HLY A;  1OKR A;  1RZ4 A;  4Y13 A;  1O3T A;  4P55 A;  5LRS A;  1FX7 A;  1Z05 A;  3L09 A;  4MTE A;  4ZZD A;  3R6S A;  4L9V A;  3ZMD A;  1QZY A;  2ZNZ A;  1I1S A;  4PZJ A;  3WU1 B;  1J5Y A;  1ZH5 A;  1T39 A;  1KQ0 A;  2DFI A;  5L3C A;  4KMF A;  2VXZ A;  2VN2 A;  4L9T A;  2G9W A;  2IPQ X;  3I5U A;  4OMZ A;  3RKW A;  2FMY A;  1X3U A;  1U6G A;  3Q5F A;  1XMA A;  2FA5 A;  4PDK A;  2R7F A;  4QWQ A;  4IRI A;  3WTW C;  1KGS A;  2DQL A;  3TGN A;  1B9M A;  1LJ9 A;  3CUQ C;  5HS7 A;  2Q0O A;  4Z2Y A;  2PMH A;  2PFB A;  1REP C;  1YFH A;  1S7A A;  2XUB A;  3BY6 A;  3R60 A;  3SZT A;  1OR7 A;  2QBY A;  3TOA A;  3MEX A;  1LEA A;  1E17 A;  1P92 A;  2CWE A;  2DK5 A;  2P7C B;  1I6X A;  2NAZ A;  4HLX A;  4P5O A;  2CSO A;  3GFI A;  2VC0 A;  2V1U A;  4M9Z A;  4WXC A;  2D45 A;  3WE2 A;  2HTS A;  1BIA A;  1B1B A;  2ZBK A;  3W6J B;  5ICE A;  2IJL A;  1W7P B;  3K2Z A;  1Z7U A;  3V4G A;  2XVC A;  2F2E A;  3KCC A;  3P9C A;  1GXP A;  5DUI A;  3SHF A;  2PEX A;  2MH2 A;  3VFZ A;  4S05 A;  1MJ9 A;  3ELK A;  5D5V B;  1G3W A;  5AIQ A;  4CZZ A;  1O3Q A;  4B09 A;  1ZAR A;  2LNB A;  1BN5 A;  3ROU A;  1IN8 A;  1F4K A;  1MD0 A;  5AON A;  1BI2 A;  4F7Z A;  1BI0 A;  1YO5 C;  2Z9O A;  5K1Y A;  4EMS A;  1IXC A;  1B59 A;  3T1B A;  4HV6 A;  5E1Z B;  2K86 A;  2DW4 A;  1WRJ A;  5E20 A;  3KFW X;  3WTZ A;  4NHJ A;  4ETS A;  4YIF A;  2XRN A;  3U1D A;  2D2W A;  3KP7 A;  3AAF A;  1HKT A;  2FXA A;  1P2F A;  1XCB A;  2JPB A;  4WWC A;  1HST A;  3WGG A;  4EJU A;  3LFK A;  3H92 A;  4CO8 A;  2BYV E;  2A07 F;  5FLX Z;  3B02 A;  1ODD A;  4XBF A;  3TO7 A;  2VBX A;  5DCM A;  3V8J A;  4N9H A;  1PP7 U;  2M8E A;  4MNU A;  2HGC A;  2DAO A;  3M8E A;  5D4R A;  2O03 A;  1K78 B;  1HBX G;  2ZJ2 A;  4U0Y A;  4L0Y B;  1PP8 F;  1XCV A;  4IRG A;  4LK1 F;  2PN6 A;  2NYX A;  1A04 A;  3HSE A;  3BRO A;  1D5V A;  4LG0 B;  5FD6 A;  4I7H A;  3Q9S A;  4MTD A;  4KDP A;  3R4K A;  3LAJ A;  4YFN F;  3I53 A;  4EM2 A;  1S8N A;  1I27 A;  4RGR A;  4G6D A;  1PDN C;  4LLN A;  2V9V A;  3HIF A;  2DBB A;  3FHZ A;  2IT0 A;  1ZYR F;  2P5K A;  2HR3 A;  4AIJ A;  4BHB A;  2E1C A;  3MCZ A;  4HQM A;  1T6S A;  3VEP A;  2MD5 A;  3EUH A;  4Q4Z F;  1ZAO A;  1FYL A;  1XGS A;  4G7Z F;  2A6E F;  2MLK A;  5FD5 A;  3P9I A;  3F8B A;  1XD7 A;  4KYW A;  1SFE A;  1ZN2 A;  2HKX A;  4Y15 A;  5E17 F;  4O3M A;  2OU2 A;  1MJB A;  2COM A;  3PQJ A;  1C0W A;  3BZ6 A;  2HWV A;  4FX0 A;  1R1V A;  3I71 A;  4A5M A;  1MJA A;  2A6H F;  4M71 A;  3ISP A;  2OZU A;  2KJC A;  4D0P A;  4KN4 X;  2C6Y A;  2H6C A;  1YQA A;  4HX7 A;  3LA2 A;  3V8L A;  5HDG A;  3SFZ A;  3F3X A;  3RTR A;  4HF2 A;  3C7J A;  4UXN A;  2ZKZ A;  2IW5 A;  4G94 A;  1LDK B;  4G9Y A;  1GHC A;  4RGS A;  2FF4 A;  5L3E A;  1DPU A;  3EYY A;  4BQA A;  4M74 A;  3L9F A;  4EGZ A;  3K0L A;  5TRD A;  4HOB A;  5H20 A;  1KU9 A;  3B73 A;  4S04 A;  4CDG A;  4WF2 A;  2VC1 A;  3M9A A;  2R3S A;  1QBJ A;  3WTU C;  1IRF A;  2EFO A;  1ZRC A;  1R1T A;  3TKY A;  4I0B A;  1R5G A;  2HOE A;  4XRF A;  4GYG A;  4A5N A;  1BC7 C;  4FT8 A;  3FM3 A;  4JBA A;  2Q2E A;  3E97 A;  4U88 A;  2VBZ A;  3DPL C;  3FM5 A;  5ICG A;  4BH9 A;  5D8K B;  4DNC A;  4KUM A;  4IXA A;  1R1U A;  3JSO A;  4GXO A;  2X0L A;  5DYM A;  2K27 A;  3J81 Z;  3R0J A;  1U5T B;  4EM0 B;  4BHC A;  3KEO A;  2RGV A;  2ZNY A;  4KNY A;  1JGS A;  1FLI A;  4U7D A;  1FC3 A;  1ZRF A;  4AWX B;  5D5X B;  2HZT A;  1HW5 A;  2ZME B;  3F6O A;  5FFX A;  4EVI A;  3SQN A;  1IZ1 A;  1XDU A;  3IC7 A;  3C18 A;  2V79 A;  3JTG A;  2KKO A;  1G6N A;  1L0O C;  2P6S A;  2PJP A;  2H09 A;  1BIB A;  1K78 A;  4HYE A;  2F5E A;  2BE5 F;  4AIH A;  3E6C C;  4GGG A;  1WSU A;  3ZMT A;  3S2W A;  5DV5 A;  3CTA A;  4UVA A;  1EV7 A;  5CYV A;  1IXS B;  1IRG A;  3EQL F;  2OBP A;  3LST A;  3G73 A;  2PBI A;  2FSW A;  3O2P E;  1BOA A;  3IL2 A;  2VBY A;  2P5V A;  1D8K A;  1B6A A;  3FXQ A;  4LLG F;  2E7X A;  4M72 A;  3TQN A;  4LMY A;  4KMU X;  1BBY A;  4ON0 A;  4GCV A;  3ZP5 A;  3U2R A;  3KLO A;  3RYP A;  4M9S A;  3ECO A;  2G7U A;  5DD8 A;  1FYK A;  4CHU A;  3L7W A;  3KP3 A;  1DDN A;  2P8T A;  4OIO F;  4HAM A;  4UHT A;  2F5C A;  2Z3Y A;  1YG2 A;  3IKV A;  4IPA A;  4FX4 A;  5ED4 A;  4P96 A;  2UWM A;  3WTX C;  2GQQ A;  1WQ2 A;  4I0A A;  2DPU A;  2K4J A;  1D3Y A;  2NS0 A;  1F5T A;  3G3Z A;  1KQ8 A;  1J7K A;  3IKT A;  1OMI A;  5F1R A;  1IAW A;  5D6E A;  3WOD F;  4LJZ F;  2XGX A;  1R58 A;  5DUK A;  2XAQ A;  2HTJ A;  4EGY A;  1UFM A;  3MAJ A;  4OU0 A;  1LVA A;  3C1D A;  3N97 A;  1U78 A;  1TQP A;  1K6O A;  3IRQ A;  5HLH A;  1O57 A;  2E1N A;  3E6M A;  4L9N A;  3GF2 A;  1KYZ A;  3DXJ F;  3TDU C;  3QOP A;  1G3S A;  3COA C;  5LHI A;  3QP6 A;  2EFW A;  4G6Q A;  3M7G A;  4KIG A;  2RKH A;  1XSD A;  2HYG D;  3QAH A;  1TBX A;  1YW7 A;  2DO7 A;  5E1X A;  4YG2 F;  4UVB A;  1R5H A;  2DT5 A;  3V7C A;  2WC2 A;  4ESB A;  3C3W A;  4A6E A;  1XSX A;  4KIB A;  3QP5 A;  1U5T A;  3JAM K;  3ERE D;  3F22 A;  3WTS C;  2JPC A;  3WTY C;  4XSX F;  2O0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...