2KIMA

1.7-mm microcryoprobe solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Solution NMR structure of an O6-methylguanine DNA methyltransferase family protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium target VpR247.
rcsb
source organism Vibrio parahaemolyticus aq3810
molecule tags Transferase
total genus 27
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kimA00
2DQRA 2F5DA 2JPBA 1PUEE 2VC0A 5DUKA 5JR3A 2HZTA 2Y75A 5CJ9A 2CW0F 3DPTA 2FF4A 2XGXA 4I7HA 3F72A 2V1UA 2CFXA 2ESHA 4GGGA 4ASNA 3T8TA 1S3JA 1BJAA 1W5TA 4RGUA 3ZMUA 2OU2A 3GLXA 3EYIA 3F8FA 1B6AA 2RQPA 1S7OA 4EJUA 2UZKA 4AVPA 3KP3A 4ESBA 1JHHA 5HDNA 1V4RA 2EA4A 3O6BB 4HQEA 3RPUA 5BS6A 2EV0A 1O3QA 4Y13A 1BC7C 2O03A 4RB1A 1BBYA 3NEUA 1ZH5A 1LQ1A 4KMFA 1ZRFA 5L3CA 1TQMA 3ZN0A 3MZHA 3D5LA 3R4KA 1OPCA 4LG0A 3F21A 3K69A 2VN2A 2DK8A 4A0YA 2OBPA 2YSRA 4I0BA 2XROA 4L9TA 4O3MA 3H3ZA 1BM9A 5HS7A 3C7JA 2ZKZA 1IZ1A 3JAMZ 1ZYRF 4EVIA 1FT9A 2EJRA 3O3KA 3ZMVA 2VODA 5L3FA 3J81K 3V8JA 3DKWA 4LB6B 1CGPA 1DDNA 5D6EA 4HQMA 2J5OA 4L9JA 2HQNA 2HTJA 3ISPA 5F1RA 1CF7A 4M6YA 1WKMA 5ICEA 1R1VA 5EEGA 1ZREA 3GF2A 3SZPA 3DEUA 1O57A 2D45A 4D0PA 2CGPA 2R7DA 2W84A 4RAYA 4BAYA 4ENNA 2YX7A 1S8NA 3BY6A 4KNYA 2F5FA 2FU4A 2PQ8A 4G9YA 1LB2A 2A07F 1IW7F 1S6LA 2CO5A 2HFHA 3F8MA 2R7FA 3RKXA 4BNCA 3ECHA 4CGZA 4L9NA 1F9NA 4NHJA 5JHUA 5HLHA 1TBXA 5E1XA 2ELHA 2IVMA 5AIQA 1U78A 2E1NA 4GO1A 5LHGA 3F22A 2ESNA 4U0WA 4EJWA 5DUIA 1RI7A 2Q8KA 2OAZA 2M87A 2KRFA 4DNCA 1XD7A 4MTEA 5AIPA 5CVJA 3RJPA 2RDPA 3I59A 4KDPA 2M8EA 4MHGA 1P92A 2PI0A 3FMSA 4UVCA 2UWMA 5H6RA 1FYLA 1BOAA 1P4WA 2VT2A 2RC4A 2PEXA 2QENA 1H9TA 2MH9A 4M9ZA 1R22A 3C1DA 1YFHA 2XAQA 3QPHA 3V4GA 4LG0B 3N4MA 3BJ6A 3GZ5A 4U88A 3IKTA 3RPQA 3FX3A 5DD8A 3ZMSA 3RTRA 3EYYA 5HVQC 2V6CA 1HXDA 4MEXF 3EQLF 3HRSA 2E7XA 2XAHA 1BIAA 4RAZA 4AIHA 1MDMA 2Q2EA 1KQ8A 1XDSA 2HOEA 4FHTA 4XRFA 5HS8A 1P6RA 2KIUA 2VBXA 4NQWA 3B73A 2QYOA 4LLLA 4KYWA 4RGSA 5HLGA 2KIFA 5F6FA 5K5RA 3KCCA 4N9HA 4OIRF 4OMYA 5ILUA 3CLOA 2Y0MA 3RI4A 3WTZA 4KFCA 3S2WA 1FZPB 3IC7A 1QZZA 4CDGA 3TOAA 2Z9OA 4IVNA 1T39A 2NNNA 3HRUA 2DLLA 1USSA 1R58A 2PBIA 2XKOA 3ROUA 3E6BA 4Q5SF 2OA4A 2EA2A 3WU0A 4P96A 4LFUA 1JHFA 3R0JA 1G6NA 5FB2A 3W6KB 1B9NA 5K1YA 2AXLA 3QOPA 4PGGA 3MCZA 1HW5A 4RB3C 3HSFA 1BN5A 4P5OA 5KVRA 4WXDA 5ERIA 3E5XA 2LDUA 4HF1A 3R0AA 2OQGA 3MWMA 2PMHA 1YS6A 4M71A 1YW7A 2Y48A 2RVCA 2J5PA 3TO7A 2P7CB 5TJJA 1YQAA 3M8EA 1AOYA 3T0YA 1IXRC 4L18B 1U3EM 3KZYA 4YIIA 4B09A 6PAXA 3GWZA 1J9IA 2GXGA 3CDHA 4EQQA 3VOEA 3D0SA 1OR7A 2DO7A 2HEOA 2K27A 1LVAA 3JAMK 2OZ6A 1IXCA 1J75A 4L5JA 3WGHA 1T2KA 4KIGA 1ON1A 3E6MA 1ODDA 3W6JB 3ECOA 2IP2A 2H6BA 4UUVA 2IA1A 1JXSA 2P6SA 3TDZC 3PQJA 4HYEA 1Z9CA 4H0EA 1QPMA 3KLNA 1XGOA 4ENMA 1UHWA 3BZ6A 1ZRDA 3GO5A 4B8XA 3QPTA 4OIPF 3R60A 5LHIA 1U8RA 4I02A 4A2UA 1TQPA 2MH2A 4U0YA 1OYWA 2HR3A 1KU2A 1F4KA 3LA2A 3BPVA 3VFZA 3U9GA 3EDPA 3WTSC 2QM3A 2EK5A 3PFIA 2VOPA 1GVJA 4ESFA 2STTA 1UB9A 5D6FA 3GFIA 1KU9A 3REOA 5CVIA 1R5HA 2FOKA 3CUOA 1SD6A 4O5VA 3V8KA 3G73A 3T8RA 4UXNA 2XAJA 1QZYA 2G7UA 4EJVA 4S04A 1TNTA 2O0YA 5DCMB 1ZHFA 1J59A 2DI3A 3SZTA 1FPQA 5E18F 1E2XA 4ZZLA 3F8NA 1XDUA 5E1WA 1SFEA 2FBKA 5D8LB 1FBSA 1P4AA 1Z6RA 4LLGF 4IHTA 4OOIA 1QO0D 1G3WA 2MLKA 4EV0A 4CO8A 4JBAA 5J8FA 2QLZA 3E5QA 2JSCA 2A3SA 3T1BA 1LNWA 2H6CA 5DCFA 4MQ9F 1HW2A 2QUFA 5IT9Z 3HOTA 4Q48A 4KUMA 4G8XA 4MNUA 4EJTA 1HKTA 2QQBA 1I6XA 3WTVC 2FSWA 3C3WA 1BI0A 3AAFA 5BPIA 1J7KA 1GXPA 2Q0OA 3VODA 1B59A 3P7NA 2HKXA 4BH9A 1I1SA 4WX9A 2A68F 3ZMDA 4UNOA 5F64A 3DF8A 1FWZA 3P9KA 1J0RA 4YFXF 3MAJA 4M74A 4OU0A 5BQTA 3RKWA 1O3SA 3FM3A 2L4MA 4LK1F 3DFGA 5K5OA 1U6GA 1WWXA 2COMA 4PCQA 1XCVA 2FBIA 2CSOA 3LA3A 5E1ZB 3CO6C 2YU3A 2NNYA 3SHFA 5ICGA 3QP5A 5LRSA 5H20A 3FXUA 3GVAA 5ILSA 2HDCA 5A2QZ 4N9IA 3U2RA 2W85A 4KT5C 4BHPA 5LEKA 1UHMA 4Z2YA 4G6QA 5CYVA 4BQAA 2DFIA 3IL2A 5L3DA 3RYRA 4XBFA 5H6QA 1FNNA 2BBYA 5D5VB 4QLCU 2H94A 1ZGJA 2LF8A 3K1NA 2FNAA 3FM5A 3F3XA 2OQRA 1Z05A 2O61A 4M6XA 1G4DA 3WTXC 1H9GA 4M73A 5KK1A 3TO9A 1KQ0A 2D2WA 4I0AA 3ELKA 4M9SA 1TW2A 2DPUA 3ZN1A 5ED4A 5LGUA 3BOQA 2V1DA 1IN5A 1UCRA 5E8IA 3GZ6A 1EV7A 4G7HF 4I2OA 5FO5A 2EV5A 2QQAA 3BJOA 2VC1A 3I64A 4LGWA 4RS8A 1BI3A 4JK1X 4A0XA 2IA0A 3Q5FA 1GHCA 2W57A 4WXCA 1DPUA 2E1CA 2IPQX 3JSPA 1IRGA 4CICA 4Q47A 2M1BA 1P4XA 4XSZF 2LF7A 4XLPF 4FX4A 3CUQA 1YYVA 1NHAA 4EGYA 5JI6A 5HLIA 1L0OC 2L4AA 2K4BA 4Q4ZF 4U7BA 4UHTA 1O7LA 4R1HA 3F8CA 1FYMA 5D5WB 1R1TA 3K0LA 1I1GA 4UV8A 1XMAA 4LJZF 2YR2A 4A0ZA 2LKPA 2BE5F 5D5XB 5D4RA 3C18A 5TRDA 1FSHA 5FFXA 3JTHA 2P5KA 1OKRA 3BWGA 2IW5A 1E17A 4G7OF 3VB2A 3LWFA 1WI9A 4LK0F 2A5YB 4MEYF 1TLHB 4G6DA 1MZBA 1R23A 3COAC 3HRMA 1FP2A 4KIBA 1O7FA 2EFWA 4A6EA 2VOOA 3WTYC 3ABUA 3CJNA 2W24A 1ZN2A 4HLXA 3LQQA 1XSDA 4HBLA 3JSOA 2ZXJA 1MKMA 1R7JA 3RIRA 2CWEA 3TKYA 4ESJA 2A69F 3WU1B 3HUGA 4K2EA 2L01A 3K2ZA 1IN6A 4OIOF 3FF5A 4EM2A 2VXZA 5EEHA 2EFPA 2K02A 5FD6A 2GQQA 4BXUA 1QBJA 1WQ2A 3IRRA 5IT9K 2Z3YA 4UV9A 3SQNA 2DK5A 5DCMA 2M45A 1EH7A 4U7DA 2GZWA 2EFOA 2JT1A 2D1HA 2XASA 2QBYB 2EWNA 4YIFA 2MD5A 2F5CA 1H0MA 4I01A 1K6OA 3OOPA 1EH8A 5J8CA 3HIFA 3L7WA 2HTSA 3K1MA 5LBQA 3ULQB 3M1EA 3GFJA 2FMYA 4A5MA 2PG4A 2VBYA 2JRTA 2D1VA 1SMYF 3QU3A 4EM1A 2EB7A 3LFKA 3JW4A 1W5SA 1V3FA 3KP5A 1UFMA 3GEZA 2GIVA 3HSRA 5K5QA 3KEOA 1BC8C 2UXXA 2GAUA 4IRGA 2HYFA 1FC3A 3WODF 2EV6A 3CUQB 1D8JA 2XAGA 4LLNA 3GXOA 3M9AA 1LEBA 1RIOH 1PP7U 4KICA 1S29A 3H3UA 3I4PA 1KQ9A 1F1ZA 2BYVE 5DV5A 1RZ4A 1SD4A 4GYGA 2FMLA 2NS0A 1IAWA 5A2QK 2DT5A 3E6DA 1KU3A 1KYZA 4S05A 4HAMA 1XCBA 1IUYA 2PN6A 2IA2A 2PJPA 3KETA 2W25A 3K1PA 3Q9VA 3Q9SA 3GFLA 5E8GA 3SFZA 4CZZA 1U2WA 4UVBA 4HF0A 2NAZA 3J80Z 1XGSA 3CUQC 1HSJA 4KN7X 1TW3A 3HOSA 3KP2A 2B0LA 2P6TA 2QQ9A 4ZH4F 2CG4A 4KN4X 1BI2A 1LDKB 4YFKF 3N97A 4ZYHA 1O3TA 4HV6A 3BROA 3NRVA 3ABTA 2VBWA 4HOBA 1SD7A 3FXRA 3L2CA 4P9UA 1XGMA 4Y15A 1R5GA 1I27A 2QVOA 2DQLA 3ZQ7A 1K7AA 1RNLA 2Z99A 2O6GE 5HDKA 4KIFA 1YG2A 3MFKA 3QAHA 1STZA 1HQCA 4EMSA 3K9TA 4PZJA 2ZO4A 2IJLA 4BYYA 4WWCA 3KE2A 2VT3A 1HSTA 3IKVA 3F6VA 4HZFA 4ENJA 2A6EF 3V7SA 2XVCA 3O2PE 4IPAA 1JGSA 2P5LC 1XSVA 2XHKA 1U5TA 2ACJA 3I58A 2BGCA 3GFMA 4CHUA 5DD4A 4AIKA 2ZFWA 3HHGA 5CVUA 2DAOA 5HOOA 2QWWA 1ZRCA 3KP4A 3QU6A 1MJBA 3RKYA 2M5WA 2RKHA 2P8TA 4F7ZA 1R00A 4RGXA 3L09A 2XAFA 5IT3A 1LDJA 2LSOA 3TGNA 3E3VA 1BIBA 1HKSA 3FHZA 1FY7A 1OMIA 2R3SA 2FBHA 5L3GA 1YIOA 1FOKA 3MZYA 4EM0B 2F5EA 5CLSA 2DW4A 2IRFG 2STWA 1Q1HA 3WG9A 2WV0A 2RN7A 3LAJA 2OZUA 2KJBA 3E97A 4QWQA 2YX4A 2XUBA 3IRQA 1JE8A 1SMTA 4IRHA 1YS7A 3ML6A 4E70A 4EJOA 5D8KB 1RUOA 1LEAA 3ZPLA 2VE8A 4U0VA 1T38A 3ERED 3KFWX 2ZBKA 2KIMA 1FBUA 4R8HA 5FLXZ 3E6CC 4IJAA 2C6YA 1IXSB 4I09A 2AS5F 3EETA 1SFXA 1W7PB 4AWXB 1KA8A 2V79A 1QGPA 1DP7P 1Y0UA 3WE3A 1FLIA 1LDDA 3KP7A 3NQOA 1X3UA 4MGRA 4RB2C 2ZCWA 1ON2A 1XMKA 3FZVA 2ZMEB 3QRFF 3I53A 2ISYA 3WTUC 4HF2A 3DXJF 4HX8A 1QQIA 2UXNA 5JVTA 4MTDA 3HSEA 1MGTA 4OIQF 2EFQA 2HYGD 4JQFA 3DP7A 1MD0A 5LRRA 3F6OA 4G7ZF 1PDNC 4YG2F 2FA5A 4HW0A 1T6SA 1U5TB 1XGNA 3HTSB 2P5VA 5J6XA 5FD5A 4HDUA 5L3BA 4G94A 4KA4A 1W4MA 3F23A 1REPC 4HA8A 4A5NA 2K4JA 1BI1A 4UVAA 2FRHA 3G3ZA 2FNPA 1YW9A 4ON0A 5LEJA 4O6JA 2GXBA 1WRJA 3QP6A 4L9VA 3TOBA 2BV6A 2QBYA 2ZNYA 3LA7A 2Z33A 2P4WA 3IWZA 3E5UA 3OV8A 4Y17A 2GA1A 2KJCA 1Z7UA 1L3LA 3WTWC 3KLOA 1U5TC 2WTEA 1ZG3A 1K78B 2A61A 2Z5UA 3J80K 1D3YA 1PP8F 4CYDA 2VONA 4R79A 5LGNA 1XSXA 4P9FA 4MQVA 2OD5A 1R1UA 3KP6A 2DBBA 1IN7A 3P9CA 4WF2A 4IXAA 1HBXG 2WWYA 3GW2A 4BHCA 4HX7A 2F2EA 2ZNZA 4IF4A 4P55A 4OINF 3DV8A 1ZG1A 1K79A 3L00A 2TDXA 5ICCA 3WTTC 5D5UB 5BOXA 2RNJA 1ZGAA 1IN4A 2GWRA 2MC3A 1SD5A 2JZYA 3RYPA 1Z91A 2MBFA 1QNTA 1KGSA 4I98B 1Z1DA 1SFUA 2XIGA 2VE9A 2FXAA 4ETSA 3HYIA 3HTUA 1OYIA 3KEQA 2L54A 1DUXC 2O8XA 1D8KA 1FP1D 3MQ0A 1G3SA 5AONA 2ETHA 3LAPA 2P7VB 5LLQA 4PGHA 2L3DA 3J7AO 2CYYA 4L0YB 4ZYDA 3U1DA 1YLFA 3JTGA 5L3EA 2H27A 1I5ZA 2NYXA 4HLYA 3LSTA 3FMQA 1Z6TA 4RB0A 2PFBA 2V1XA 1USTA 2M30A 2LNBA 2G9WA 4HV5A 1S7AA 2H09A 1TNSA 3RDIA 1FYKA 2PLYA 3TO6A 3HRTA 1T98A 5E17F 1KYWA 2IT0A 1HKQA 2K86A 2X4HA 5FFZA 3FMRA 1CF7B 4A6DA 3TQNA 4HX4A 4GYIA 1SAXA 4GXOA 1IF1A 1IRFA 3I54A 3FWEA 1B9MA 5HS9A 2NRAC 5JFRA 1J2XA 1J5YA 3DPLC 3I0TA 2HKOA 3ZMZA 3PQKA 2FE3A 1P2FA 1TTYA 2JTVA 3KZZA 3MEXA 2HGCA 3T5XA 3GYHX 2L02A 4WK8F 4N0BA 1YO5C 2ISZA 3ZP5A 2K7LA 5FLXK 3BP8A 3VEPA 4XLNF 3WE2A 1C0WA 2ADUA 3J81Z 5LGTA 1ULYA 3IWFA 3BPXA 5BMZA 3L9FA 4WCGA 4OMZA 2A6HF 4IRIA 3P9IA 3B02A 1ZLJA 4RGRA 3IHUA 3I5UA 1YTYA 1G3YA 3EUHA 4AD9A 1O3RA 1ZARA 2X0LA 1F5TA 3DQVC 1T0FA 1RUNA 3WGIA 1MJAA 5DYMA 1GXQA 3I59B 1ZG5A 2E7WA 4WXHA 4A12A 1ONVA 5FGMA 5DEQA 2XV4S 3BDDA 2PMUA 3HHHA 5BPDA 4BHBA 1FBQA 2EFNA 3GX4X 3TDUC 4LMYA 1G3TA 1W7PA 1VTNC 1AWCA 2BEOA 2GA2A 5E20A 1B4AA 1LJ9A 1DPRA 3FXQA 2O3FA 1XB4A 2CQKA 1ZAOA 2VBZA 4L0ZB 2ZMEA 5D4SA 2XKPA 4ZZDA 3CTAA 3LQRA 4L5IA 2V9VA 2RGVA 1EH6A 5LHHA 5CVRA 3CO7C 1R36A 2FEZA 4XSXF 4IHSA 2G7HA 2JPCA 1B1BA 4TV7A 1IN8A 3M8FA 1MDMB 4CXFA 1YW8A 2MLGA 2HQRA 4ENKA 4PDKA 4FT8A 1KU7A 3SXYA 5ILVA 3ZMTA 1FSEA 5CVVA 3F8BA 2FQ3A 1MJ9A 4YFNF 2KKOA 3M7GA 3R6SA 1XN7A 4ZYEA 1FX7A 4GCVA 4LD5A 1WSUA 2QZ8A 1TQIA 4FX0A 5HDGA 1HW1A 2WC2A 4LB5A 3V8LA 4AIJA 3BJAA 2RV8A 4ZYGA 3WGGA 2HS5A 4KMUX 4HDVA 1W7PD 1ZLKA 3H92A 2YPRA 2ZJ2A 2XRNA 3GUDA 2MA3A 2DTRA 4M9XA 4EGZA 1K78A 2DPDA 2HWVA 1D5VA 3V7CA 3R61A 5DDGA 3V7RA 3I71A 4NB5A 1A04A 4M72A 5ICFA 2DU9A 4DQ2A 1OYYA
chains in the Genus database with same CATH superfamily
3H9GA 2DQRA 3K7AJ 1BR1A 5FJ8J 1HDDC 1OCRH 5E3MA 2KP6A 3RSNA 3FHNA 2LLKA 2LK2A 5F0FA 5E3NA 2F5DA 1VQOI 2JPBA 1PUEE 1YITI 3SEQA 2YU9J 2X1CA 2VC0A 5DUKA 5JR3A 3CCJI 2HZTA 1WCMJ 2Y75A 5CJ9A 2R0QC 1B72A 4GDFA 2CW0F 2DOFA 3TW7A 3DPTA 2FF4A 4BE0A 2XGXA 1OFCX 4I7HA 3F72A 2V1UA 2CFXA 1WZ2A 1TL8A 2ESHA 4GGGA 1ETVA 3IAS2 4ASNA 4CCNA 2CV2A 1DQUA 3T8TA 1S3JA 5F0HA 1BJAA 1MBHA 1W5TA 2X9DA 3CJQB 4PJJA 1LFBA 4RGUA 3ZMUA 3BLYA 2OU2A 3GLXA 2LVSA 3EYIA 1EF4A 3F8FA 1B6AA 2RQPA 1KZHA 2BY0A 3LSHA 1S7OA 4G12A 4EJUA 2UZKA 4AVPA 3KP3A 2GOXB 2NS7A 3BC8A 5IP6A 3Q0VA 1JHHA 4ESBA 2MSYA 1K83J 3PSFA 1Z67A 4Y33A 5HDNA 1V4RA 2I8DA 3DCFA 2EA4A 3O6BB 4HQEA 3OR1C 4YEJA 3RPUA 5BS6A 4UY8I 2L2OA 1UG0A 2EV0A 2VPRA 1O3QA 1IRZA 4RM2A 4Y13A 2KPMA 1BC7C 2O03A 4RB1A 2WB1A 1BBYA 3NEUA 3FDYA 3K70D 1LQ1A 4KMFA 4IL6C 4BE2A 1ZH5A 1ZRFA 3CC4I 4UUSB 2VQCA 2HQ5A 5L3CA 3RQIA 1TQMA 3ZN0A 3MZHA 3D5LA 3R4KA 5CQEA 3FXKA 1Z7LA 2AXTC 2WV1A 1OPCA 3E1SA 4LG0A 1WGXA 3F21A 2ZSIB 3K69A 4E4HA 2VN2A 2DK8A 1PYVA 3S1RJ 4A0YA 1LFUP 1XC5A 2OBPA 2YSRA 4I0BA 1VQ6I 2XROA 4L9TA 1ZELA 1EA3A 4O3MA 1G59A 3H3ZA 1BM9A 5HS7A 1A35A 1SVLA 3RZOJ 3C7JA 2ZKZA 1IZ1A 3JAMZ 1ZYRF 4EVIA 3PFYA 3FISA 1FT9A 2EJRA 2M7BA 2R7XA 2HPMA 3BR0A 3LL7A 3O3KA 2EIJH 3ZMVA 2MD0A 5TGTA 2VODA 5L3FA 3J81K 3V8JA 1N25A 1Y8QB 2HQAA 3DKWA 4LB6B 2VQLA 3J7YJ 5D6EA 1ZR4A 1DDNA 1CGPA 1YJNI 4HQMA 1MIJA 2J5OA 5J1YA 3IV5A 3BR5A 3H9JA 4L9JA 2HQNA 2W7NA 2HTJA 1V55H 3PM1A 3ISPA 5F0CA 4J00A 4D5CA 1NK3P 5F1RA 1OCPA 3BG7A 1VQLI 1CF7A 1T08B 3W6VA 4M6YA 2HDDA 4IHVA 1WKMA 5ICEA 2H1LA 1R1VA 5EEGA 2A6TA 4HNUA 2AQEA 1ZREA 2VJ5A 2GIZA 3GF2A 3SZPA 3VSLA 1XMXA 4J01A 5HNHA 3DEUA 2W82A 1O57A 2H8WA 3RPUD 1FEXA 2D45A 1G2HA 4D0PA 2CGPA 3G1OA 3TW6A 2EPFA 2R7ZJ 2L7ZA 2R7DA 2W84A 2VKVA 4RAYA 4CCOA 1VF9A 3MKYB 4BAYA 4ENNA 3CCUI 1YRNB 2CUZA 1H8AC 4BQQA 2V6EA 2L5QA 2FOWA 2YX7A 1S8NA 3BY6A 4KNYA 2NOGA 4DGWB 3CESA 2F5FA 1HF0A 5EYRA 4MLOA 3VYRB 2FU4A 2PQ8A 4G9YA 5J3LA 5B66C 1LB2A 2A07F 5EF6A 1D1CA 1IW7F 4W1UA 1S6LA 2DOEA 2HXOA 2CO5A 2CUEA 2HFHA 3F8MA 3BCAA 2R7FA 2WADA 3RKXA 2XSDC 4B43A 2EZKA 3VYUB 4BNCA 3ECHA 4XORA 4L9NA 4IOCF 4CGZA 1F9NA 3OL4A 4NHJA 5JHUA 5HLHA 3K70C 1TBXA 4A69C 2CFOA 4CCJA 3CMAI 1QZEA 2VKHA 4BXXJ 2ELHA 5E1XA 2IVMA 1H88C 1QU3A 2VL8A 5AIQA 4KITB 2K3PA 1U78A 2LY9A 2IGOA 2E1NA 3CCRI 2EQRA 4BJ6C 4P1WA 4XL9A 4GO1A 4FCYA 5LHGA 3F22A 2ESNA 4U0WA 4EJWA 2Z16A 3RZDJ 3CD6I 4MFDA 3S17J 5DUIA 1RI7A 2Q8KA 3KYLA 2OAZA 1VQKI 2LG4A 1RR8C 2VB6A 4BDZA 2M87A 2RAEA 2KRFA 3CP2A 2X6XA 4DNCA 1XD7A 4MTEA 2XPVA 5AIPA 4MFEA 5CVJA 4F92B 3RJPA 5FKLA 1YE9A 2RDPA 3I59A 1XPXA 4KDPA 2M8EA 3PUFA 3LFUA 2VJ4A 4MHGA 4A3MJ 4XK4A 1P92A 2PI0A 3FMSA 4UVCA 2AO9A 2Y0SA 2UWMA 1IO2A 2ZC2A 3F0CA 5H6RA 1FYLA 1BR4A 2OF7A 3H3VK 4CA0A 1GV5A 4PJLA 3M4OJ 1BOAA 1P4WA 2VT2A 2RC4A 1BA5A 2PEXA 2QENA 1H9TA 2MH9A 2P0WA 4M9ZA 1R22A 3HG9A 3C1DA 1YFHA 2XAQA 3QPHA 2ICWG 3C2GA 4L5EA 3V4GA 1MMAA 4HNVA 3BJ6A 3N4MA 4LG0B 1VQ8I 3GZ5A 2JA5J 3CCQI 2DN0A 2W00A 4U88A 3IKTA 3RPQA 2W48A 1H89C 3FX3A 5DD8A 4F91B 3OYDA 3ZMSA 2QKLB 3RTRA 2M4KA 3EYYA 1QRYA 1Z3YA 5CKTA 5HVQC 1R6RA 3G2BA 2V6CA 2LD5A 4BBSJ 1YX3A 2MFZA 1TP4A 1HXDA 4M3GA 2YUSA 4PUSA 2DA7A 2DJIA 4MEXF 2H8RA 3DU6A 3EQLF 5B1AH 3D5RC 3HRSA 2E7XA 3H5AA 1IUFA 5DM7F 4JX4A 2HI3A 3VYSB 2XAHA 1BIAA 4PSXA 4RAZA 4AIHA 1MDMA 2BY1A 3C2HA 2Q2EA 5B1BH 1KQ8A 1XDSA 2HOEA 2X6WA 4FHTA 4FQGA 2K9MA 4XRFA 5HS8A 2HOSA 1P6RA 2KIUA 2VBXA 4NQWA 3MVPA 5EGOA 3B73A 2QYOA 3HOVJ 1FIPA 2V9KA 2LREA 1ETKA 2R7TA 4LLLA 1VQ7I 4KYWA 4RGSA 4FE7A 2LBFA 3HKZN 2I10A 4YRVA 4II3A 5HLGA 1Y39A 2KIFA 3GTQJ 1S9HA 3M1CA 5F6FA 2ZB9A 5K5RA 3KCCA 5J1UA 4N9HA 4OIRF 4OMYA 4XR6A 3W2WA 1LVKA 5ILUA 3CLOA 2Y0MA 3DBHB 3RI4A 3W3CA 4A3JJ 3WTZA 1IJWC 3RQ4A 1YX5A 3E7LA 4KFCA 3MKWB 5KNLA 3OS1A 2DDBA 3S2WA 2CQ7A 4A3BJ 2CQXA 2KQRA 1FZPB 3DWLE 3IC7A 4IQ4A 1QZZA 1Y0NA 4CDGA 3TOAA 1WFXA 2Z9OA 4IVNA 1T39A 1AHDP 2NNNA 3HRUA 2DLLA 1USSA 2XKOA 1GLNA 1R58A 2PBIA 1JUPA 2XC7A 3SDGA 3ROUA 1Z21A 3E6BA 4Q5SF 1I6HJ 3BQYA 2OA4A 2EA2A 4HSTA 3WU0A 4P96A 4C9YA 2M2EA 1IDYA 4LFUA 1JHFA 2L9SA 3HC7A 3R0JA 1G6NA 5FB2A 3W6KB 1B9NA 5K1YA 1JKQC 2AXLA 3QOPA 1BW5A 4PGGA 3HB9A 1HW5A 3MCZA 4RB3C 4I6ZA 3HSFA 2ECCA 4Y3OA 4AUXA 3JRAA 1BN5A 4P5OA 3O8GA 5KVRA 4WXDA 5ERIA 3E5XA 1K4TA 4EEFG 1ETXA 2LDUA 3WHBA 4HF1A 3R0AA 2DTZA 2OQGA 3X2QH 1O4XA 3MWMA 3JRDA 3C2BA 2PMHA 1YS6A 4M71A 1YW7A 2Y48A 2RVCA 1WJBA 2J5PA 3TO7A 2P7CB 3CF5F 5TJJA 4E7JA 1UG2A 1YQAA 3M8EA 1AOYA 4A3FJ 1FMWA 3T0YA 3S14J 1IXRC 4XRSA 1VFCA 5EZHA 4L18B 2NS8A 4ITVA 1U3EM 2DFHA 3BT9A 3KZYA 4YIIA 4B09A 2F6CA 3S93A 6PAXA 2D5VA 2V1NA 3GWZA 1J9IA 2GXGA 3BTJA 3VSKA 2VQGA 3CDHA 4CZCA 2IXSA 1S72I 1JT6A 5C3EJ 2OTLI 4EQQA 3VOEA 4FASD 3D0SA 1OR7A 1MBGA 1HLVA 2DO7A 2HEOA 3S2DJ 2X51A 2K27A 1TWAJ 1LVAA 3JAMK 2OZ6A 1IXCA 1J75A 4L5JA 4D1QA 3WGHA 1T2KA 4KIGA 1ON1A 3E6MA 1ODDA 3W6JB 3ECOA 2K85A 4MO7A 1F43A 2IP2A 2H6BA 4UUVA 2IA1A 2CRGA 1JXSA 3DKXA 1RKWA 2P6SA 3TDZC 3D5SC 1FOYA 3PQJA 5F1JA 4HYEA 1Z9CA 1ZGWA 2VJJA 3DEWA 3GBGA 4H0EA 1QPMA 3KLNA 4XLAA 1XGOA 1FMVA 4C30A 2OTJI 2K9LA 4ENMA 2VPLA 2JSPA 2TRTA 3OYIA 2VIXA 1UHWA 4CYCB 3BZ6A 1ZRDA 3HOXJ 3GO5A 4B8XA 3QPTA 4EATA 4RAFA 3CCMI 4UUSA 2R7OA 4OIPF 3R60A 2F4IA 3GTPJ 3JREA 3NWTA 5LHIA 1U8RA 2ZXWH 2IBDA 4I02A 2CJJA 5GTIC 4A2UA 2MG4A 1TQPA 2MH2A 4XKVA 4PJMA 3OYKA 3DKYA 1OYWA 5B5EC 4U0YA 3DBRB 2DT6A 1WI3A 2HR3A 3CCVI 1KU2A 4OAYA 1F4KA 3ESWB 3LA2A 3PNVA 2WBMA 3BPVA 3VFZA 3U9GA 3EDPA 3WTSC 2QM3A 2EK5A 2Q2EB 3HUGB 3PFIA 2WB1N 2VOPA 1GVJA 2E5ZA 4ESFA 2STTA 1WH7A 4XN0A 1UB9A 5D6FA 1WJEA 3GFIA 1KU9A 3REOA 3H35A 1R5HA 5CVIA 3BCBA 4HNTA 2FOKA 3CUOA 1SD6A 4O5VA 5M3FJ 3V8KA 3G73A 3ERMA 2DMUA 2MW8A 2LFBA 2LBFB 3T8RA 4IQJA 4UXNA 2XAJA 1QZYA 4U87A 1X1BA 2G7UA 4EJVA 3ZQGA 1U8BA 3QQAA 5FRMA 4S04A 3AG4H 1TNTA 2O0YA 5DCMB 2IS4A 4AC0A 3ZQHA 3OYJA 4BBRJ 1R5ID 1ZHFA 1J59A 2DI3A 3SZTA 1FPQA 3BTIA 5E18F 3DLAA 1E2XA 4ZZLA 3F8NA 4RDUA 1XDUA 2XAUA 4E7ZA 2KRHA 3JRFA 2HVQA 5E1WA 2R4GA 1SFEA 4ANJA 2FBKA 1T8IA 5D8LB 1FBSA 1P4AA 1Z6RA 2RNGA 4LLGF 4A3CJ 2PX9A 5KAIC 1HA8A 3OY9A 2JUCA 2HVSA 4IHTA 1SVOA 1X1PA 1PUFB 5IYCJ 1RC9A 4OOIA 5F08A 4QIWN 5IYDJ 1QO0D 1G3WA 2MLKA 4BKXA 4EV0A 4BGDA 3JRIA 4CO8A 4JBAA 5J8FA 3QYEA 2Y30A 2QLZA 3E5QA 2JSCA 1YRNA 2A3SA 1TT0A 3T1BA 1LNWA 4X1EA 2H6CA 5M5WJ 2LTPA 5DCFA 3A0BC 1OCCH 4KT6A 4MQ9F 5EG0B 1JTYA 1HW2A 1PVEA 1MBKA 2Y9YA 1UZCA 2NVQJ 4BACA 2QUFA 5IT9Z 3GTOJ 3HOTA 1IDZA 4Q48A 4KUMA 1ORKA 3K6GA 4G8XA 1JUMA 4JX6A 4MNUA 4EJTA 1HKTA 2QQBA 2DOAA 1I6XA 3BR6A 1I50J 3WTVC 2FSWA 3C3WA 5IOZA 1BI0A 1P9QC 3OIOA 2V26A 3AAFA 4LIVA 4B1RA 5BPIA 5GTHC 1J7KA 4ZDOA 1GXPA 1I3AA 2Q0OA 3VODA 4IO9F 1B59A 3P7NA 2HKXA 1QVUA 4BH9A 1I1SA 3PJRA 1MMDA 2WA0A 3V42A 4WX9A 2EZIA 4X0GA 2V4JC 3BQZA 4JP0A 5C4XJ 2OCCH 2A68F 3ZMDA 3BTCA 4UNOA 2KISA 2OUMA 2KZVA 5F64A 3DF8A 3S32A 1FWZA 1JKRC 3P9KA 1IGNA 5KAFC 1J0RA 1OLTA 3ONQA 1RKTA 4YFXF 1PJRA 4II2A 1WJCA 1I39A 3MAJA 1D1BA 3J7ZI 2LY2A 4M74A 2IGNA 4OU0A 5BQTA 2QF7A 3RKWA 1VNDA 3MN2A 1O3SA 3FM3A 1E3OC 2L4MA 2JUGA 4LK1F 3DFGA 5K5OA 3H5RA 2Y9ZA 1U6GA 4DIQA 3CQZJ 2ZJQF 1WWXA 2COMA 2JVHA 4PCQA 2E2JJ 1XCVA 2O7OA 5M5YJ 2FBIA 4A3LJ 2CSOA 3K4MA 3LA3A 4H4KC 5E1ZB 2N8GA 3CO6C 4C2TA 2YU3A 2M9HA 3DTIA 4BL0B 3BZCA 3SHFA 2NNYA 5ICGA 3QP5A 3I4NJ 5FROA 5LRSA 2E1OA 5H20A 3FXUA 3CMMA 3I56I 3GVAA 4RAGA 2E2IJ 2VI6A 5ILSA 2B7EA 2HDCA 5A2QZ 2M7AA 4N9IA 3U2RA 2W85A 1OR7C 4KT5C 4BHPA 5LEKA 1UHMA 2Y2ZA 5DTDA 4Z2YA 4Y7NJ 3DLLF 2Y0SN 1VZ0A 4G6QA 1TT5B 1ZQ3P 4IZZA 5CYVA 4BQAA 2DFIA 2ME6A 5L3DA 3RYRA 3IL2A 3S2HJ 3AL0B 4XBFA 3H5NA 3IH4A 5H6QA 4XONA 1FNNA 1MSFC 2BBYA 4BU2A 2E71A 5K7ZA 5D5VB 2MGQA 3HM5A 4QLCU 1K61A 2H94A 1ZGJA 2R5YA 5H2FC 3ABKH 2LF8A 1OISA 3K1NA 3TEDA 2FNAA 3FM5A 1GDTA 2DMTA 2EINH 1MMNA 2MC4A 3F3XA 4V19K 2ID6A 2OQRA 1Z05A 3M8JA 3UR3C 4M6XA 4C3IJ 1CQTA 2O61A 1G4DA 3WTXC 4CSWA 1H9GA 3OS0A 2WY8Q 2BY2A 4M73A 2KLOA 3H0DA 5KK1A 2CW8A 2JMWA 1OQYA 1Z77A 3TO9A 4B4CA 1KQ0A 2D2WA 4I0AA 4ZTFA 3ELKA 3HOZJ 1E0EA 4M9SA 1TW2A 4CCMA 2L0KA 2DPUA 1LKXA 3ZN1A 2TCTA 5ED4A 3K4KA 5LGUA 3GTLJ 3BOQA 2XGEA 2V1DA 3WU2C 2ELJA 2E2HJ 4FETA 1WHUA 1IN5A 1UCRA 2BVLA 4S0HB 5E8IA 2XDVA 3GZ6A 1APLC 3TMOA 1EV7A 2DYRH 4G7HF 2L9RA 4XLEA 1TWGJ 4I2OA 5FO5A 2EV5A 3QPSA 3AL0C 2QQAA 3BJOA 1FOXA 1ETOA 2VC1A 3I64A 4LGWA 1QVTA 3W2AA 3H36A 3VPRA 4RS8A 1RRJA 1BI3A 2JA8J 2XB0X 3U1KA 4JK1X 4A0XA 4D5FA 2IA0A 4XKCA 3Q5FA 1GHCA 3GTGJ 2X1EA 2W57A 4UUTA 4WXCA 1DPUA 2EH3A 2E1CA 2IPQX 1WVRA 1R9TJ 3JSPA 4CUGA 1IRGA 4CICA 1FTTA 4Q47A 2M1BA 3FXLA 3TP3A 3CC7I 5EDNA 3IP4B 2QEXI 4HRIA 1P4XA 4HG2A 5J47A 1OCTC 1LUJB 1ENHA 4XSZF 2LF7A 1WH5A 4XLPF 1D0ZA 1XX5A 4FX4A 1DGRM 3CUQA 4DOZA 4B3XA 2NVXJ 1YYVA 1M1EB 1NHAA 4EGYA 3OSFA 2HOTA 1ITYA 5JI6A 5HLIA 2KT0A 1L0OC 2L4AA 1POGA 2K4BA 5J1RA 4NC8A 3HBLA 4Q4ZF 1VQMI 4QPQA 4U7BA 3KPHA 4B3AA 4UHTA 3L2QA 2DA1A 1D0YA 5M3MJ 4IHXA 1O7LA 3H9QA 2OC6A 2I5UA 4R1HA 3F8CA 1FYMA 5D5WB 1R1TA 3K0LA 4M3EA 1I1GA 4UV8A 4BQOA 3CP8A 2L9NA 4I76A 1YIJI 2NVYJ 4ZTJA 4HEA2 1XMAA 4LJZF 2YR2A 3HDDA 4A0ZA 2LKPA 1S5LC 4KJZA 3RKQA 2BE5F 1BR2A 5D5XB 3LMMA 5D4RA 1DU0A 3C18A 3OYMA 3AKZA 5TRDA 1FSHA 5FFXA 3JTHA 2P5KA 3S1NJ 2CU7A 2COBA 2DA4A 3OL3A 5KCMA 5IP7J 1OKRA 3CCLI 2NVUB 3BWGA 2IW5A 3S3OA 2X6OA 1E17A 2B9SA 2LOOA 3VB2A 3LWFA 2DJNA 4G7OF 1WI9A 4B48A 4LK0F 2A5YB 4QSHA 4MEYF 4CYCA 1TLHB 1MNDA 1X1CA 4G6DA 2E1MB 4XQFA 1MZBA 1R23A 3COAC 3PUBA 5TISC 3HRMA 1FP2A 4KIBA 1O7FA 2LMDA 2EFWA 4A6EA 2EIMH 2VOOA 3J7AY 3WTYC 3ABUA 5JLWA 4RLFA 1ETQA 3IH3A 2GM4A 1X58A 3CJNA 3ASNH 2W24A 1T56A 1ZN2A 4HLXA 3LQQA 1X2MA 3SJMA 4HBLA 1XSDA 2JJ7A 3JSOA 3LSJA 2ZXJA 1MKMA 1R7JA 3RIRA 2ZXIA 1GV2A 2CWEA 3TKYA 4XICA 4ESJA 2R7SA 2A69F 1OCOH 1T33A 2R5YB 3HUGA 5BNGA 3WU1B 4K2EA 3BR1A 1NH3A 2L01A 3K2ZA 2QSFX 1IN6A 3LNQA 4OIOF 3KEYA 1ETYA 3GTJJ 1TZLA 3FF5A 5IY5H 4EM2A 2VXZA 5EEHA 2EFPA 1BW6A 2K02A 5FD6A 2GQQA 2Q1ZB 4BXUA 1QBJA 5CQGA 1WQ2A 2L7KA 3A01B 3IRRA 3O8HA 5IT9K 2Z3YA 3RCOA 4UV9A 3S3NA 3SQNA 5EZGA 2CUFA 4V2FA 2DK5A 1K6YA 2R5ZA 5DCMA 2M45A 4BE1A 1EH7A 4U7DA 1BOBA 2GZWA 3SDBA 2EFOA 3DBLB 4XMYA 2JT1A 2D1HA 2XASA 4ZC3A 2FQ4A 3MKLA 2EWNA 2QBYB 4YIFA 2MD5A 2F5CA 1P7IA 3FBIB 2DA2A 1H0MA 1X4PA 2DDAA 2VKEA 1WJAA 2YS9A 3P5JA 4I01A 1K6OA 3HOYJ 3OOPA 3ZQIA 1MMSA 1EH8A 5J8CA 3HIFA 1PUFA 2E5NA 2Z1DA 3A02A 3L7WA 2HTSA 1JJ8C 3K1MA 4PK4A 4N4OB 4YELA 5LBQA 3LSRA 3ULQB 3M1EA 3AG2H 3B6AA 3GFJA 2FMYA 2Z2SB 3K4CA 4A5MA 2PG4A 2VBYA 2JRTA 2D1VA 1SMYF 3QU3A 3QYFA 4EM1A 2EB7A 3EPZA 2O5RA 3M07A 3LFKA 3JW4A 3E0JB 5HODA 4E7LA 2V7FA 1W5SA 1U9OA 2Y69H 1V3FA 3KP5A 1UFMA 3GEZA 2GIVA 3HSRA 4Z6YA 5K5QA 3KEOA 1BC8C 5DS9A 2UXXA 2GAUA 4I99C 1TWFJ 4IRGA 2HYFA 3FXOA 1FC3A 3WODF 2EV6A 3CUQB 5EG0A 1D8JA 3KZIC 3PNTA 2XAGA 4LLNA 3OYLA 3GXOA 4JX5A 3M9AA 2LR8A 3OR2C 1LEBA 4A3IJ 2LKXA 1RIOH 2OCEA 2RREA 1PP7U 2BY3A 4KICA 1S29A 2WAQA 3DEEA 1BL0A 3H3UA 3I4PA 1KQ9A 2LYCA 1F1ZA 2BYVE 1K4SA 5DV5A 4QTRA 1RZ4A 5GP9A 1SD4A 4GYGA 2FMLA 2NS0A 1IAWA 5A2QK 2DT5A 2M0MA 3E6DA 2WAEA 1KU3A 1KYZA 4S05A 1ZK8A 4HAMA 1XCBA 2QCOA 3L1PA 2DXIA 1IUYA 3A03A 2PN6A 4CCKA 1X19A 2IA2A 2GXAA 2PJPA 4XKBA 2M8GX 1R71A 3KETA 1JKPC 3PL8A 2F4OB 2W25A 3K1PA 4YIRX 3Q9VA 3TP0A 2EBIA 1Z0XA 1S7EA 2LRDA 3VYTB 3Q9SA 2CV0A 1E3PA 4AIDA 4GRIA 3GFLA 5E8GA 1NG7A 2BXYA 2HXIA 3SFZA 1U2WA 2K9NA 4CZZA 2KDOA 1TC3C 4UVBA 4HF0A 2DYSH 2NAZA 1XTAA 3J80Z 1XGSA 3CUQC 3BG6A 1HSJA 4DBQA 2VLAA 4KN7X 2KDZA 1MH3A 1TW3A 3HOSA 3KP2A 3HGGA 3HEFA 1RR7A 3S8PA 1OCZH 3FXMA 2B0LA 2KZGA 2P6TA 4OAZA 3VDXA 2QQ9A 5LFAA 4DBRA 4ZH4F 2CG4A 4KN4X 1BI2A 1LDKB 3CZ6A 4E7IA 4YFKF 3N97A 2A05A 4ZYHA 1O3TA 4HV6A 1JUSA 2DMNA 3NARA 2PMZA 4XOPA 1LFPA 3BROA 3NRVA 3ABTA 2F4MB 2VBWA 4HOBA 1SD7A 3FXRA 3L2CA 1Y56A 3OSGA 3PIPF 4P9UA 1XGMA 3ZCOA 4Y15A 1R5GA 2MYSA 3D1NI 2UUZA 4M3DA 1I27A 3LSKA 2BVMA 1B8IB 2QVOA 2DQLA 3ZQ7A 3HL2A 2E36A 1K7AA 1RNLA 2Z99A 2ECBA 2O6GE 1FTZA 3G71I 3CCYA 5HDKA 4KIFA 1YG2A 5F27A 3MFKA 3QAHA 1STZA 1HQCA 1YI2I 2E19A 1UMQA 4E7HA 3ZQFA 1IRXA 4F93B 1A31A 4EMSA 1MH4A 2PJRB 3K9TA 4PZJA 2ZO4A 2IJLA 4BYYA 4WWCA 3KE2A 2VT3A 3ABLH 3HPGA 1HSTA 3IKVA 3F6VA 3GMEA 4C2MJ 2R93J 4BUPA 4HZFA 2F5VA 2A6EF 3LSMA 3V7SA 2XVCA 3O2PE 4IPAA 4ENJA 1MNMC 1JGSA 2P5LC 2XB5A 1XSVA 2XHKA 1U5TA 1W1WE 2ACJA 3DTEA 3A1YA 3PIOF 2R5ZB 3I58A 3LSIA 1R49A 2CMPA 3I9V2 2BGCA 3U21A 4BS9A 1QHGA 2ZJPF 3CMYA 3I55I 1W36D 5JLXA 3GFMA 4CHUA 5IYBJ 3S15J 4X6AJ 5DD4A 4AIKA 2ZFWA 3LOCA 2VUMJ 1JI8A 2BZTA 2OV7A 3HHGA 5CVUA 2DAOA 4XLHA 5HOOA 2QWWA 4FE4A 3KP4A 2BHYA 1ZRCA 2V9PA 3QU6A 4UB6C 1MJBA 3AG3H 3RKYA 5F04A 1UAAA 2ELKA 1MW7A 2M5WA 3BR3A 1MBEA 4NBQA 2RKHA 2VKDA 2P8TA 4F7ZA 2IEKA 1R00A 4RGXA 1XS9A 1DU6A 2VQHA 3L09A 4ABZA 5J40A 2XAFA 1E3HA 1X4OA 1N77A 5IT3A 1LDJA 2LSOA 4PJNA 3OWTA 1TWHJ 3EUKL 3TGNA 4E7KA 5FLMJ 1IC8A 4C3HJ 3G1LA 1U9NA 3JCUC 3E3VA 1BIBA 3BG3A 1HKSA 3FHZA 3DU5A 1Q1VA 1FY7A 4UB8C 4HPQA 1OMIA 2R3SA 3Q3SA 2FBHA 3BG9A 1R4NB 4GFBA 4CCLA 4Y4RA 1AKHA 4XLCA 4DYRA 2BW3B 5L3GA 1YIOA 2IAIA 1FOKA 3MZYA 4EM0B 5GAHJ 3L2RA 4C3JJ 2F5EA 1JKOC 4LOCA 2QGUA 1WPKA 5CLSA 2DW4A 3FBNB 1X1AA 5GAGJ 4D9JA 2IRFG 2STWA 1Q1HA 4ZJZA 3WG9A 2WV0A 2RN7A 3LAJA 1OJLA 2OZUA 5EJCA 2KJBA 3A0HC 3E97A 2EZHA 2L7MP 4B47A 3I4MJ 1LE8B 1MMGA 4QWQA 2YX4A 2XUBA 3IRQA 3K4BA 4G6TB 1SMTA 2CQNA 4IRHA 1JE8A 2CW7A 1YS7A 4IKFA 3ML6A 4E70A 4RMNA 4EJOA 2JWTA 2O9LA 5D8KB 1RUOA 1LEAA 3ZPLA 4IOAF 2VE8A 2QKMB 4U0VA 3G6EI 1T38A 3ERED 1D1AA 4FTHA 3KFWX 3N05A 3BZKA 4AYBA 1NG6A 2ZBKA 2KIMA 1FBUA 5JVGF 4R8HA 3HOWJ 5FLXZ 3E6CC 4IJAA 2C6YA 1IXSB 2JA2A 3JRCA 3OYNA 1T95A 1ZKGA 4I09A 4M6VA 3GLLA 2UV1A 1W0UA 3EETA 2AS5F 1SFXA 2XPUA 1W7PB 1MSEC 2NVTJ 1RETA 2CS3A 5KHDA 1YJ9I 4AWXB 1KA8A 2V79A 2FD5A 4DZJA 1QPIA 1QGPA 1YHQI 1Y0UA 1DP7P 3WE3A 4A3EJ 1A36A 1LDDA 1DP3A 9ANTA 3KP7A 1FLIA 2AQFA 3NQOA 2JQ7A 1X3UA 4MGRA 2XRLA 3QODA 4RB2C 1WJFA 2ZCWA 2HOAA 5E3LA 3EUHC 5B3SH 3EUAA 1ON2A 2WAFA 1XMKA 3FZVA 2H1KA 2IGKA 1W36C 2EILH 2ME0A 4A3DJ 2ZMEB 3HOUJ 1V5FA 2X48A 2DMPA 3QRFF 4QPOA 2ID3A 4D7MA 4BY1J 3I53A 2ISYA 3TL4X 3WTUC 1T0FC 4HF2A 2IS1A 1YOVB 4RA2A 3DXJF 2QQ8A 2ZFUA 1HCRA 2DFEA 3S3MA 4HX8A 1QQIA 3MKZA 1V5GA 2OPTA 2UXNA 3HSEA 5JVTA 5C44J 1MGTA 4MTDA 4OIQF 2EFQA 2HYGD 3GTMJ 4JQFA 3TBIA 3DP7A 1MD0A 5LRRA 1SC7A 3F6OA 4G7ZF 1PDNC 4YG2F 2FA5A 1IG7A 4HW0A 1JGGA 3QPLA 1T6SA 3IUOA 4RLQA 1U5TB 1XGNA 3HTSB 4FISA 2P5VA 5J6XA 3ZRGA 1HDPA 2P81A 5FD5A 4HDUA 3M3YJ 4A93J 3NAUA 5E79C 1VQ4I 2IS2A 4BQNA 5L3BA 4G94A 3G1MA 4KA4A 1W4MA 3F23A 2B63J 1REPC 4HA8A 3OYGA 1A6IA 2K4JA 4A5NA 4E7SA 3A01A 2ZSHB 1BI1A 2JK3A 4UVAA 2FRHA 3G3ZA 2FJ1A 4A3GJ 1ERDA 2FNPA 1YW9A 2ZMEC 4ON0A 5LEJA 2XSJC 3S16J 4O6JA 2GXBA 1WRJA 2AHQA 2M4GA 3ZXSA 2XPWA 3QP6A 2KFDA 4L9VA 3TOBA 5EEAA 2JN6A 1WJDA 2BV6A 2R7RA 2LY1A 5K7HA 2QBYA 2ZNYA 3LA7A 2ZJRF 3CCSI 1I3QJ 4DYQA 2Z33A 2P4WA 3IWZA 3E5UA 2NOJB 4XN3A 3OV8A 3GZNB 1EJ9A 1X2NA 1A6QA 3FK6A 4Y17A 1ZTRA 3L2WA 2GA1A 2KJCA 2DODA 3WHCA 3OYAA 3QOEA 3QYBA 2QSHX 3OIQA 1Z7UA 1L3LA 4BEHA 3WTWC 3KLOA 1U5TC 3HXLA 2IS6A 1VQNI 2G0EA 2WTEA 1AKHB 1ZG3A 3HJEA 3SYTA 1K78B 2A61A 2HYJA 2Z5UA 3H1CA 3J80K 1D3YA 2VASA 3BTLA 1PP8F 1QA6A 4CYDA 5JHFA 2JA6J 2VONA 4R79A 3OIPA 5LGNA 1XSXA 5FKMA 5HLTA 2VXDA 4P9FA 3ZQCA 4LITA 3Q0UA 3K2AA 1JTXA 2OD5A 4MQVA 4V2GA 4E6KG 1R1UA 2HU9A 3KP6A 2DBBA 1IN7A 3P9CA 1FOWA 4WF2A 4IXAA 1HBXG 1G8XA 2WWYA 3GW2A 4BHCA 3OYFA 4HX7A 3BG5A 1HOMA 2F2EA 3MD2A 4ZYAA 2JRMA 2ZNZA 3HGYA 1N78A 4IF4A 4P55A 1B72B 4IEJA 4OINF 1EKEA 2HZDA 2KHMA 3DV8A 1ZG1A 1K79A 4NNJA 2LC2A 1A5JA 2NXNB 3FIWA 3L00A 2TDXA 2CV1A 5ICCA 3WTTC 5D5UB 5BOXA 1ACIA 2RNJA 1ZGAA 3VWBA 1IN4A 2GWRA 4AVZA 2MC3A 2WAQN 1SD5A 5FKKA 5LD2C 2JZYA 3OS2A 3RYPA 4RBOA 1Z91A 2M34A 4A3KJ 1RESA 2MBFA 1QNTA 1KGSA 2X85A 4I98B 1AU7A 1Z1DA 4RM3A 1SFUA 5M5XJ 4XNFA 2XIGA 2DA6A 4NUBA 4AM3A 2VE9A 2FXAA 4ETSA 3HYIA 2FX0A 1QHHD 4JOMA 3HTUA 1OYIA 1NTCA 3KEQA 4LG3A 4DYCA 5FKOA 4F3QA 2L54A 4DW6A 3PNYA 2XF5A 3JRBA 4M3FA 1DUXC 1NK2P 5GPAA 2O8XA 3ABMH 1D8KA 3PO2J 1GT0C 2FUG2 2BHZA 1FP1D 2LH9A 1GUUA 3MQ0A 1G3SA 5AONA 1JJ6C 4LIUA 3AG1H 2ETHA 4N4NB 3LAPA 3K4NA 3SEZA 2P7VB 1B8IA 3LSGA 5LLQA 4PGHA 2DT7B 4W97A 3H0GJ 1UHSA 3Q0WA 4PFOA 2L3DA 1FIAA 4J19A 3ZQQA 3J7AO 2CYYA 4L0YB 4ZYDA 3U1DA 4CH7A 3WG7H 1YLFA 3JTGA 1W5CC 3UKGA 2K40A 2PMZN 5L3EA 2H27A 2R7VA 2PJRA 1I5ZA 2NYXA 4HLYA 2EIKH 2A5WA 3LSPA 4DJAA 3LSTA 3FMQA 3CMEI 5GAEJ 3ZGKA 2L9VA 3HZJA 2K3FA 1Z6TA 2LP0A 4AU7A 3FKIJ 3GTKJ 2E1MC 2EZLA 4RB0A 2PFBA 4D7NA 2V1XA 1USTA 4F55A 2M30A 1R4MB 2LNBA 4Y52J 2G9WA 2HDWA 3A4CA 4HV5A 1S7AA 2H09A 2L7FP 1TNSA 3RDIA 1FYKA 3IH2A 2PLYA 2XGDA 2OJED 3TO6A 3HRTA 1T98A 5E17F 1KYWA 2IT0A 1HKQA 2K86A 1IV6A 3ZOBA 2X4HA 5FFZA 3CC2I 2GBYA 3FMRA 1CF7B 4A6DA 3CDIA 3TQNA 4XKWA 4HX4A 1DGWY 5E3OA 4GYIA 1SAXA 4GXOA 2BXZA 2LKSA 2QSGX 1IF1A 1IRFA 3I54A 3FWEA 4XRMA 1B9MA 3K4JA 5CPRB 5HS9A 1SFKA 1IV8A 2Y31A 5JFRA 2NRAC 1J2XA 1J5YA 3DPLC 3I0TA 2HKOA 2KRCA 3PQKA 3ZMZA 4BEHB 2FE3A 1P2FA 1TTYA 1FJLA 4PFPA 2JTVA 3KZZA 3MEXA 2HGCA 3T5XA 3PO3J 1VQ9I 3GYHX 3KYDB 2L02A 2GLOA 4HSRA 1X1DA 3AFHA 4WK8F 5C4JJ 3BR2A 1D5YA 4N0BA 1YO5C 2ISZA 3ZP5A 2K7LA 3OOUA 2F48A 5FLXK 3BP8A 3JR9A 3VEPA 4XLNF 3WE2A 1C0WA 4BY7J 1SAUA 2ADUA 4B44A 3J81Z 3OYBA 2BW3A 2WY7Q 5LGTA 2W4SA 1GVDA 1ULYA 3IWFA 3BPXA 2R7QA 5BMZA 3L9FA 4WCGA 4OMZA 4NC7A 4XM3A 2A6HF 1XG1A 4IRIA 3P9IA 3B02A 2RQQA 1ZLJA 4RGRA 5IP9J 3DPUA 1BJZA 3IHUA 2M3AA 1SANA 1U0JA 3I5UA 1YTYA 1D0XA 1G3YA 1LE8A 3EUHA 1WJ5A 3MMYB 1X3WB 2R7UA 3OYHA 5K7FA 4AD9A 1VQPI 1O3RA 1ZARA 1ETWA 2DFFA 1SEUA 2X0LA 1F5TA 3DQVC 1T0FA 4XOTA 3JRGA 1RUNA 2E60A 3OMYA 3WGIA 4XRSG 1MJAA 3F9KA 5DYMA 3K10A 3L2UA 4F52A 3K4LA 4NDLA 4BJTA 2DA3A 1GXQA 3I59B 1ZG5A 5J4VA 2E7WA 4WXHA 2K5CA 4A12A 1ONVA 1W0TA 1P7JA 5FGMA 4ZDLA 5J4YA 5DEQA 2XV4S 3BDDA 1KONA 1V5EA 2DA5A 2PMUA 3MZ8A 3HHHA 3I3LA 5BPDA 4BHBA 4DZPA 2XF6A 1FBQA 2EFNA 4NC6A 4PJ0C 3GX4X 1J09A 4C2UA 1MNEA 3TDUC 4LMYA 1G3TA 1W7PA 3CJTB 1VTNC 1AWCA 2BEOA 2CQQA 2GA2A 3B6CA 1B4AA 1LJ9A 1DPRA 1F36A 3FXQA 5E20A 5DM6F 2O3FA 1HC8A 3SZGA 3KX2A 1XB4A 2CQKA 3S1QJ 1ZAOA 2VBZA 1Y1VJ 4PSWA 4L0ZB 1X3ZB 3W2VA 1Z3XA 2KIQA 2ZMEA 5D4SA 2XKPA 4AYBN 4ZZDA 3NWSA 4IX7A 3JRHA 3CTAA 4XIDA 3LQRA 1UJ8A 2GOMA 4L5IA 2V9VA 2RGVA 1EH6A 2DMQA 3FXJA 1V54H 5CVRA 4BXFA 5LHHA 2HNHA 2IGMA 1N75A 3OYEA 1JT0A 1SVMA 3HKZA 1R36A 3CO7C 2DCEA 2M0CA 2K9SA 3L2VA 2FEZA 4XSXF 4IHSA 2HVRA 3PSIA 2G7HA 2XF7A 4MIMA 5IPAA 2JPCA 4KISA 3UNGC 1B1BA 2K9QA 1IN8A 3HPHA 4TV7A 1YJWI 3M8FA 2E34A 4XLFA 1MDMB 2CUJA 4JYKA 4CXFA 2CH0A 2R7WA 3S1MJ 1MBJA 1YW8A 2MLGA 3FKJA 2HQRA 4NQWB 5EGOB 3CJRB 4ENKA 4PDKA 4BDYA 4IHYA 4FT8A 1KU7A 2X1DA 3SXYA 3G4SI 4ZDPA 3FK7A 5ILVA 2HPIA 3ZMTA 5IOYA 1FSEA 2QA4I 5CVVA 3KIOA 1UELB 2W1OA 3F8BA 3SFIA 2FQ3A 4M3BA 1MJ9A 4YFNF 4BJ5C 5GADJ 3ASOH 2KKOA 3M7GA 3R6SA 3QWLA 1XN7A 2KMUA 4ZYEA 1FX7A 2VJIA 2XGCA 5FKNA 4GCVA 4LD5A 1ZR2A 1WSUA 2QZ8A 4IHWA 1TQIA 4FX0A 3ZR8X 5HDGA 1Y8RB 3IAM2 2MABA 1TWCJ 1HW1A 2WC2A 4LB5A 3V8LA 4AIJA 3BJAA 2RV8A 3CLQA 4ZYGA 2O8KA 3WGGA 2HS5A 3GCMA 3OYCA 4KMUX 4HDVA 2JA7J 3CCEI 2ZXHA 1W7PD 1VI0A 3CF2A 1ZLKA 3H92A 2YPRA 2ZJ2A 2XRNA 3GUDA 5GPCA 2R92J 1RPWA 2MA3A 2DTRA 5FLVA 4M9XA 4EGZA 1K78A 1Y6IA 2DPDA 2HWVA 1D5VA 3V7CA 3R61A 2X6YA 2KL4A 3CDLA 2BOLA 5DDGA 3V7RA 3A2KA 4OWRB 1Y1WJ 1VQ5I 2JVGA 3I71A 4NB5A 1LPQA 1A04A 2E35A 4M72A 3ZQLA 5FRNA 1SFOJ 5ICFA 2DU9A 3DTKA 5HNFA 1AA7A 4DQ2A 1OYYA 3KYCB 1MBFA
chains in the Genus database with same CATH topology
2DQRA 2F5DA 2JPBA 1PUEE 2VC0A 5DUKA 5JR3A 2HZTA 2Y75A 5CJ9A 2CW0F 3DPTA 2FF4A 2XGXA 4I7HA 3F72A 2V1UA 2CFXA 2ESHA 4GGGA 4ASNA 3T8TA 1S3JA 1BJAA 1W5TA 4RGUA 3ZMUA 2OU2A 3GLXA 3EYIA 3F8FA 1B6AA 2RQPA 1S7OA 4EJUA 2UZKA 4AVPA 3KP3A 4ESBA 1JHHA 5HDNA 1V4RA 2EA4A 3O6BB 4HQEA 3RPUA 5BS6A 2EV0A 1O3QA 4Y13A 1BC7C 2O03A 4RB1A 1BBYA 3NEUA 1ZH5A 1LQ1A 4KMFA 1ZRFA 5L3CA 1TQMA 3ZN0A 3MZHA 3D5LA 3R4KA 1OPCA 4LG0A 3F21A 3K69A 2VN2A 2DK8A 4A0YA 2OBPA 2YSRA 4I0BA 2XROA 4L9TA 4O3MA 3H3ZA 1BM9A 5HS7A 3C7JA 2ZKZA 1IZ1A 3JAMZ 1ZYRF 4EVIA 1FT9A 2EJRA 3O3KA 3ZMVA 2VODA 5L3FA 3J81K 3V8JA 3DKWA 4LB6B 1CGPA 1DDNA 5D6EA 4HQMA 2J5OA 4L9JA 2HQNA 2HTJA 3ISPA 5F1RA 1CF7A 4M6YA 1WKMA 5ICEA 1R1VA 5EEGA 1ZREA 3GF2A 3SZPA 3DEUA 1O57A 2D45A 4D0PA 2CGPA 2R7DA 2W84A 4RAYA 4BAYA 4ENNA 2YX7A 1S8NA 3BY6A 4KNYA 2F5FA 2FU4A 2PQ8A 4G9YA 1LB2A 2A07F 1IW7F 1S6LA 2CO5A 2HFHA 3F8MA 2R7FA 3RKXA 4BNCA 3ECHA 4CGZA 4L9NA 1F9NA 4NHJA 5JHUA 5HLHA 1TBXA 5E1XA 2ELHA 2IVMA 5AIQA 1U78A 2E1NA 4GO1A 5LHGA 3F22A 2ESNA 4U0WA 4EJWA 5DUIA 1RI7A 2Q8KA 2OAZA 2M87A 2KRFA 4DNCA 1XD7A 4MTEA 5AIPA 5CVJA 3RJPA 2RDPA 3I59A 4KDPA 2M8EA 4MHGA 1P92A 2PI0A 3FMSA 4UVCA 2UWMA 5H6RA 1FYLA 1BOAA 1P4WA 2VT2A 2RC4A 2PEXA 2QENA 1H9TA 2MH9A 4M9ZA 1R22A 3C1DA 1YFHA 2XAQA 3QPHA 3V4GA 4LG0B 3N4MA 3BJ6A 3GZ5A 4U88A 3IKTA 3RPQA 3FX3A 5DD8A 3ZMSA 3RTRA 3EYYA 5HVQC 2V6CA 1HXDA 4MEXF 3EQLF 3HRSA 2E7XA 2XAHA 1BIAA 4RAZA 4AIHA 1MDMA 2Q2EA 1KQ8A 1XDSA 2HOEA 4FHTA 4XRFA 5HS8A 1P6RA 2KIUA 2VBXA 4NQWA 3B73A 2QYOA 4LLLA 4KYWA 4RGSA 5HLGA 2KIFA 5F6FA 5K5RA 3KCCA 4N9HA 4OIRF 4OMYA 5ILUA 3CLOA 2Y0MA 3RI4A 3WTZA 4KFCA 3S2WA 1FZPB 3IC7A 1QZZA 4CDGA 3TOAA 2Z9OA 4IVNA 1T39A 2NNNA 3HRUA 2DLLA 1USSA 1R58A 2PBIA 2XKOA 3ROUA 3E6BA 4Q5SF 2OA4A 2EA2A 3WU0A 4P96A 4LFUA 1JHFA 3R0JA 1G6NA 5FB2A 3W6KB 1B9NA 5K1YA 2AXLA 3QOPA 4PGGA 3MCZA 1HW5A 4RB3C 3HSFA 1BN5A 4P5OA 5KVRA 4WXDA 5ERIA 3E5XA 2LDUA 4HF1A 3R0AA 2OQGA 3MWMA 2PMHA 1YS6A 4M71A 1YW7A 2Y48A 2RVCA 2J5PA 3TO7A 2P7CB 5TJJA 1YQAA 3M8EA 1AOYA 3T0YA 1IXRC 4L18B 1U3EM 3KZYA 4YIIA 4B09A 6PAXA 3GWZA 1J9IA 2GXGA 3CDHA 4EQQA 3VOEA 3D0SA 1OR7A 2DO7A 2HEOA 2K27A 1LVAA 3JAMK 2OZ6A 1IXCA 1J75A 4L5JA 3WGHA 1T2KA 4KIGA 1ON1A 3E6MA 1ODDA 3W6JB 3ECOA 2IP2A 2H6BA 4UUVA 2IA1A 1JXSA 2P6SA 3TDZC 3PQJA 4HYEA 1Z9CA 4H0EA 1QPMA 3KLNA 1XGOA 4ENMA 1UHWA 3BZ6A 1ZRDA 3GO5A 4B8XA 3QPTA 4OIPF 3R60A 5LHIA 1U8RA 4I02A 4A2UA 1TQPA 2MH2A 4U0YA 1OYWA 2HR3A 1KU2A 1F4KA 3LA2A 3BPVA 3VFZA 3U9GA 3EDPA 3WTSC 2QM3A 2EK5A 3PFIA 2VOPA 1GVJA 4ESFA 2STTA 1UB9A 5D6FA 3GFIA 1KU9A 3REOA 5CVIA 1R5HA 2FOKA 3CUOA 1SD6A 4O5VA 3V8KA 3G73A 3T8RA 4UXNA 2XAJA 1QZYA 2G7UA 4EJVA 4S04A 1TNTA 2O0YA 5DCMB 1ZHFA 1J59A 2DI3A 3SZTA 1FPQA 5E18F 1E2XA 4ZZLA 3F8NA 1XDUA 5E1WA 1SFEA 2FBKA 5D8LB 1FBSA 1P4AA 1Z6RA 4LLGF 4IHTA 4OOIA 1QO0D 1G3WA 2MLKA 4EV0A 4CO8A 4JBAA 5J8FA 2QLZA 3E5QA 2JSCA 2A3SA 3T1BA 1LNWA 2H6CA 5DCFA 4MQ9F 1HW2A 2QUFA 5IT9Z 3HOTA 4Q48A 4KUMA 4G8XA 4MNUA 4EJTA 1HKTA 2QQBA 1I6XA 3WTVC 2FSWA 3C3WA 1BI0A 3AAFA 5BPIA 1J7KA 1GXPA 2Q0OA 3VODA 1B59A 3P7NA 2HKXA 4BH9A 1I1SA 4WX9A 2A68F 3ZMDA 4UNOA 5F64A 3DF8A 1FWZA 3P9KA 1J0RA 4YFXF 3MAJA 4M74A 4OU0A 5BQTA 3RKWA 1O3SA 3FM3A 2L4MA 4LK1F 3DFGA 5K5OA 1U6GA 1WWXA 2COMA 4PCQA 1XCVA 2FBIA 2CSOA 3LA3A 5E1ZB 3CO6C 2YU3A 2NNYA 3SHFA 5ICGA 3QP5A 5LRSA 5H20A 3FXUA 3GVAA 5ILSA 2HDCA 5A2QZ 4N9IA 3U2RA 2W85A 4KT5C 4BHPA 5LEKA 1UHMA 4Z2YA 4G6QA 5CYVA 4BQAA 2DFIA 3IL2A 5L3DA 3RYRA 4XBFA 5H6QA 1FNNA 2BBYA 5D5VB 4QLCU 2H94A 1ZGJA 2LF8A 3K1NA 2FNAA 3FM5A 3F3XA 2OQRA 1Z05A 2O61A 4M6XA 1G4DA 3WTXC 1H9GA 4M73A 5KK1A 3TO9A 1KQ0A 2D2WA 4I0AA 3ELKA 4M9SA 1TW2A 2DPUA 3ZN1A 5ED4A 5LGUA 3BOQA 2V1DA 1IN5A 1UCRA 5E8IA 3GZ6A 1EV7A 4G7HF 4I2OA 5FO5A 2EV5A 2QQAA 3BJOA 2VC1A 3I64A 4LGWA 4RS8A 1BI3A 4JK1X 4A0XA 2IA0A 3Q5FA 1GHCA 2W57A 4WXCA 1DPUA 2E1CA 2IPQX 3JSPA 1IRGA 4CICA 4Q47A 2M1BA 1P4XA 4XSZF 2LF7A 4XLPF 4FX4A 3CUQA 1YYVA 1NHAA 4EGYA 5JI6A 5HLIA 1L0OC 2L4AA 2K4BA 4Q4ZF 4U7BA 4UHTA 1O7LA 4R1HA 3F8CA 1FYMA 5D5WB 1R1TA 3K0LA 1I1GA 4UV8A 1XMAA 4LJZF 2YR2A 4A0ZA 2LKPA 2BE5F 5D5XB 5D4RA 3C18A 5TRDA 1FSHA 5FFXA 3JTHA 2P5KA 1OKRA 3BWGA 2IW5A 1E17A 4G7OF 3VB2A 3LWFA 1WI9A 4LK0F 2A5YB 4MEYF 1TLHB 4G6DA 1MZBA 1R23A 3COAC 3HRMA 1FP2A 4KIBA 1O7FA 2EFWA 4A6EA 2VOOA 3WTYC 3ABUA 3CJNA 2W24A 1ZN2A 4HLXA 3LQQA 1XSDA 4HBLA 3JSOA 2ZXJA 1MKMA 1R7JA 3RIRA 2CWEA 3TKYA 4ESJA 2A69F 3WU1B 3HUGA 4K2EA 2L01A 3K2ZA 1IN6A 4OIOF 3FF5A 4EM2A 2VXZA 5EEHA 2EFPA 2K02A 5FD6A 2GQQA 4BXUA 1QBJA 1WQ2A 3IRRA 5IT9K 2Z3YA 4UV9A 3SQNA 2DK5A 5DCMA 2M45A 1EH7A 4U7DA 2GZWA 2EFOA 2JT1A 2D1HA 2XASA 2QBYB 2EWNA 4YIFA 2MD5A 2F5CA 1H0MA 4I01A 1K6OA 3OOPA 1EH8A 5J8CA 3HIFA 3L7WA 2HTSA 3K1MA 5LBQA 3ULQB 3M1EA 3GFJA 2FMYA 4A5MA 2PG4A 2VBYA 2JRTA 2D1VA 1SMYF 3QU3A 4EM1A 2EB7A 3LFKA 3JW4A 1W5SA 1V3FA 3KP5A 1UFMA 3GEZA 2GIVA 3HSRA 5K5QA 3KEOA 1BC8C 2UXXA 2GAUA 4IRGA 2HYFA 1FC3A 3WODF 2EV6A 3CUQB 1D8JA 2XAGA 4LLNA 3GXOA 3M9AA 1LEBA 1RIOH 1PP7U 4KICA 1S29A 3H3UA 3I4PA 1KQ9A 1F1ZA 2BYVE 5DV5A 1RZ4A 1SD4A 4GYGA 2FMLA 2NS0A 1IAWA 5A2QK 2DT5A 3E6DA 1KU3A 1KYZA 4S05A 4HAMA 1XCBA 1IUYA 2PN6A 2IA2A 2PJPA 3KETA 2W25A 3K1PA 3Q9VA 3Q9SA 3GFLA 5E8GA 3SFZA 4CZZA 1U2WA 4UVBA 4HF0A 2NAZA 3J80Z 1XGSA 3CUQC 1HSJA 4KN7X 1TW3A 3HOSA 3KP2A 2B0LA 2P6TA 2QQ9A 4ZH4F 2CG4A 4KN4X 1BI2A 1LDKB 4YFKF 3N97A 4ZYHA 1O3TA 4HV6A 3BROA 3NRVA 3ABTA 2VBWA 4HOBA 1SD7A 3FXRA 3L2CA 4P9UA 1XGMA 4Y15A 1R5GA 1I27A 2QVOA 2DQLA 3ZQ7A 1K7AA 1RNLA 2Z99A 2O6GE 5HDKA 4KIFA 1YG2A 3MFKA 3QAHA 1STZA 1HQCA 4EMSA 3K9TA 4PZJA 2ZO4A 2IJLA 4BYYA 4WWCA 3KE2A 2VT3A 1HSTA 3IKVA 3F6VA 4HZFA 4ENJA 2A6EF 3V7SA 2XVCA 3O2PE 4IPAA 1JGSA 2P5LC 1XSVA 2XHKA 1U5TA 2ACJA 3I58A 2BGCA 3GFMA 4CHUA 5DD4A 4AIKA 2ZFWA 3HHGA 5CVUA 2DAOA 5HOOA 2QWWA 1ZRCA 3KP4A 3QU6A 1MJBA 3RKYA 2M5WA 2RKHA 2P8TA 4F7ZA 1R00A 4RGXA 3L09A 2XAFA 5IT3A 1LDJA 2LSOA 3TGNA 3E3VA 1BIBA 1HKSA 3FHZA 1FY7A 1OMIA 2R3SA 2FBHA 5L3GA 1YIOA 1FOKA 3MZYA 4EM0B 2F5EA 5CLSA 2DW4A 2IRFG 2STWA 1Q1HA 3WG9A 2WV0A 2RN7A 3LAJA 2OZUA 2KJBA 3E97A 4QWQA 2YX4A 2XUBA 3IRQA 1JE8A 1SMTA 4IRHA 1YS7A 3ML6A 4E70A 4EJOA 5D8KB 1RUOA 1LEAA 3ZPLA 2VE8A 4U0VA 1T38A 3ERED 3KFWX 2ZBKA 2KIMA 1FBUA 4R8HA 5FLXZ 3E6CC 4IJAA 2C6YA 1IXSB 4I09A 2AS5F 3EETA 1SFXA 1W7PB 4AWXB 1KA8A 2V79A 1QGPA 1DP7P 1Y0UA 3WE3A 1FLIA 1LDDA 3KP7A 3NQOA 1X3UA 4MGRA 4RB2C 2ZCWA 1ON2A 1XMKA 3FZVA 2ZMEB 3QRFF 3I53A 2ISYA 3WTUC 4HF2A 3DXJF 4HX8A 1QQIA 2UXNA 5JVTA 4MTDA 3HSEA 1MGTA 4OIQF 2EFQA 2HYGD 4JQFA 3DP7A 1MD0A 5LRRA 3F6OA 4G7ZF 1PDNC 4YG2F 2FA5A 4HW0A 1T6SA 1U5TB 1XGNA 3HTSB 2P5VA 5J6XA 5FD5A 4HDUA 5L3BA 4G94A 4KA4A 1W4MA 3F23A 1REPC 4HA8A 4A5NA 2K4JA 1BI1A 4UVAA 2FRHA 3G3ZA 2FNPA 1YW9A 4ON0A 5LEJA 4O6JA 2GXBA 1WRJA 3QP6A 4L9VA 3TOBA 2BV6A 2QBYA 2ZNYA 3LA7A 2Z33A 2P4WA 3IWZA 3E5UA 3OV8A 4Y17A 2GA1A 2KJCA 1Z7UA 1L3LA 3WTWC 3KLOA 1U5TC 2WTEA 1ZG3A 1K78B 2A61A 2Z5UA 3J80K 1D3YA 1PP8F 4CYDA 2VONA 4R79A 5LGNA 1XSXA 4P9FA 4MQVA 2OD5A 1R1UA 3KP6A 2DBBA 1IN7A 3P9CA 4WF2A 4IXAA 1HBXG 2WWYA 3GW2A 4BHCA 4HX7A 2F2EA 2ZNZA 4IF4A 4P55A 4OINF 3DV8A 1ZG1A 1K79A 3L00A 2TDXA 5ICCA 3WTTC 5D5UB 5BOXA 2RNJA 1ZGAA 1IN4A 2GWRA 2MC3A 1SD5A 2JZYA 3RYPA 1Z91A 2MBFA 1QNTA 1KGSA 4I98B 1Z1DA 1SFUA 2XIGA 2VE9A 2FXAA 4ETSA 3HYIA 3HTUA 1OYIA 3KEQA 2L54A 1DUXC 2O8XA 1D8KA 1FP1D 3MQ0A 1G3SA 5AONA 2ETHA 3LAPA 2P7VB 5LLQA 4PGHA 2L3DA 3J7AO 2CYYA 4L0YB 4ZYDA 3U1DA 1YLFA 3JTGA 5L3EA 2H27A 1I5ZA 2NYXA 4HLYA 3LSTA 3FMQA 1Z6TA 4RB0A 2PFBA 2V1XA 1USTA 2M30A 2LNBA 2G9WA 4HV5A 1S7AA 2H09A 1TNSA 3RDIA 1FYKA 2PLYA 3TO6A 3HRTA 1T98A 5E17F 1KYWA 2IT0A 1HKQA 2K86A 2X4HA 5FFZA 3FMRA 1CF7B 4A6DA 3TQNA 4HX4A 4GYIA 1SAXA 4GXOA 1IF1A 1IRFA 3I54A 3FWEA 1B9MA 5HS9A 2NRAC 5JFRA 1J2XA 1J5YA 3DPLC 3I0TA 2HKOA 3ZMZA 3PQKA 2FE3A 1P2FA 1TTYA 2JTVA 3KZZA 3MEXA 2HGCA 3T5XA 3GYHX 2L02A 4WK8F 4N0BA 1YO5C 2ISZA 3ZP5A 2K7LA 5FLXK 3BP8A 3VEPA 4XLNF 3WE2A 1C0WA 2ADUA 3J81Z 5LGTA 1ULYA 3IWFA 3BPXA 5BMZA 3L9FA 4WCGA 4OMZA 2A6HF 4IRIA 3P9IA 3B02A 1ZLJA 4RGRA 3IHUA 3I5UA 1YTYA 1G3YA 3EUHA 4AD9A 1O3RA 1ZARA 2X0LA 1F5TA 3DQVC 1T0FA 1RUNA 3WGIA 1MJAA 5DYMA 1GXQA 3I59B 1ZG5A 2E7WA 4WXHA 4A12A 1ONVA 5FGMA 5DEQA 2XV4S 3BDDA 2PMUA 3HHHA 5BPDA 4BHBA 1FBQA 2EFNA 3GX4X 3TDUC 4LMYA 1G3TA 1W7PA 1VTNC 1AWCA 2BEOA 2GA2A 5E20A 1B4AA 1LJ9A 1DPRA 3FXQA 2O3FA 1XB4A 2CQKA 1ZAOA 2VBZA 4L0ZB 2ZMEA 5D4SA 2XKPA 4ZZDA 3CTAA 3LQRA 4L5IA 2V9VA 2RGVA 1EH6A 5LHHA 5CVRA 3CO7C 1R36A 2FEZA 4XSXF 4IHSA 2G7HA 2JPCA 1B1BA 4TV7A 1IN8A 3M8FA 1MDMB 4CXFA 1YW8A 2MLGA 2HQRA 4ENKA 4PDKA 4FT8A 1KU7A 3SXYA 5ILVA 3ZMTA 1FSEA 5CVVA 3F8BA 2FQ3A 1MJ9A 4YFNF 2KKOA 3M7GA 3R6SA 1XN7A 4ZYEA 1FX7A 4GCVA 4LD5A 1WSUA 2QZ8A 1TQIA 4FX0A 5HDGA 1HW1A 2WC2A 4LB5A 3V8LA 4AIJA 3BJAA 2RV8A 4ZYGA 3WGGA 2HS5A 4KMUX 4HDVA 1W7PD 1ZLKA 3H92A 2YPRA 2ZJ2A 2XRNA 3GUDA 2MA3A 2DTRA 4M9XA 4EGZA 1K78A 2DPDA 2HWVA 1D5VA 3V7CA 3R61A 5DDGA 3V7RA 3I71A 4NB5A 1A04A 4M72A 5ICFA 2DU9A 4DQ2A 1OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQR A;  2F5D A;  2JPB A;  1PUE E;  2VC0 A;  5DUK A;  5JR3 A;  2HZT A;  2Y75 A;  5CJ9 A;  2CW0 F;  3DPT A;  2FF4 A;  2XGX A;  4I7H A;  3F72 A;  2V1U A;  2CFX A;  2ESH A;  4GGG A;  4ASN A;  3T8T A;  1S3J A;  1BJA A;  1W5T A;  4RGU A;  3ZMU A;  2OU2 A;  3GLX A;  3EYI A;  3F8F A;  1B6A A;  2RQP A;  1S7O A;  4EJU A;  2UZK A;  4AVP A;  3KP3 A;  4ESB A;  1JHH A;  5HDN A;  1V4R A;  2EA4 A;  3O6B B;  4HQE A;  3RPU A;  5BS6 A;  2EV0 A;  1O3Q A;  4Y13 A;  1BC7 C;  2O03 A;  4RB1 A;  1BBY A;  3NEU A;  1ZH5 A;  1LQ1 A;  4KMF A;  1ZRF A;  5L3C A;  1TQM A;  3ZN0 A;  3MZH A;  3D5L A;  3R4K A;  1OPC A;  4LG0 A;  3F21 A;  3K69 A;  2VN2 A;  2DK8 A;  4A0Y A;  2OBP A;  2YSR A;  4I0B A;  2XRO A;  4L9T A;  4O3M A;  3H3Z A;  1BM9 A;  5HS7 A;  3C7J A;  2ZKZ A;  1IZ1 A;  3JAM Z;  1ZYR F;  4EVI A;  1FT9 A;  2EJR A;  3O3K A;  3ZMV A;  2VOD A;  5L3F A;  3J81 K;  3V8J A;  3DKW A;  4LB6 B;  1CGP A;  1DDN A;  5D6E A;  4HQM A;  2J5O A;  4L9J A;  2HQN A;  2HTJ A;  3ISP A;  5F1R A;  1CF7 A;  4M6Y A;  1WKM A;  5ICE A;  1R1V A;  5EEG A;  1ZRE A;  3GF2 A;  3SZP A;  3DEU A;  1O57 A;  2D45 A;  4D0P A;  2CGP A;  2R7D A;  2W84 A;  4RAY A;  4BAY A;  4ENN A;  2YX7 A;  1S8N A;  3BY6 A;  4KNY A;  2F5F A;  2FU4 A;  2PQ8 A;  4G9Y A;  1LB2 A;  2A07 F;  1IW7 F;  1S6L A;  2CO5 A;  2HFH A;  3F8M A;  2R7F A;  3RKX A;  4BNC A;  3ECH A;  4CGZ A;  4L9N A;  1F9N A;  4NHJ A;  5JHU A;  5HLH A;  1TBX A;  5E1X A;  2ELH A;  2IVM A;  5AIQ A;  1U78 A;  2E1N A;  4GO1 A;  5LHG A;  3F22 A;  2ESN A;  4U0W A;  4EJW A;  5DUI A;  1RI7 A;  2Q8K A;  2OAZ A;  2M87 A;  2KRF A;  4DNC A;  1XD7 A;  4MTE A;  5AIP A;  5CVJ A;  3RJP A;  2RDP A;  3I59 A;  4KDP A;  2M8E A;  4MHG A;  1P92 A;  2PI0 A;  3FMS A;  4UVC A;  2UWM A;  5H6R A;  1FYL A;  1BOA A;  1P4W A;  2VT2 A;  2RC4 A;  2PEX A;  2QEN A;  1H9T A;  2MH9 A;  4M9Z A;  1R22 A;  3C1D A;  1YFH A;  2XAQ A;  3QPH A;  3V4G A;  4LG0 B;  3N4M A;  3BJ6 A;  3GZ5 A;  4U88 A;  3IKT A;  3RPQ A;  3FX3 A;  5DD8 A;  3ZMS A;  3RTR A;  3EYY A;  5HVQ C;  2V6C A;  1HXD A;  4MEX F;  3EQL F;  3HRS A;  2E7X A;  2XAH A;  1BIA A;  4RAZ A;  4AIH A;  1MDM A;  2Q2E A;  1KQ8 A;  1XDS A;  2HOE A;  4FHT A;  4XRF A;  5HS8 A;  1P6R A;  2KIU A;  2VBX A;  4NQW A;  3B73 A;  2QYO A;  4LLL A;  4KYW A;  4RGS A;  5HLG A;  2KIF A;  5F6F A;  5K5R A;  3KCC A;  4N9H A;  4OIR F;  4OMY A;  5ILU A;  3CLO A;  2Y0M A;  3RI4 A;  3WTZ A;  4KFC A;  3S2W A;  1FZP B;  3IC7 A;  1QZZ A;  4CDG A;  3TOA A;  2Z9O A;  4IVN A;  1T39 A;  2NNN A;  3HRU A;  2DLL A;  1USS A;  1R58 A;  2PBI A;  2XKO A;  3ROU A;  3E6B A;  4Q5S F;  2OA4 A;  2EA2 A;  3WU0 A;  4P96 A;  4LFU A;  1JHF A;  3R0J A;  1G6N A;  5FB2 A;  3W6K B;  1B9N A;  5K1Y A;  2AXL A;  3QOP A;  4PGG A;  3MCZ A;  1HW5 A;  4RB3 C;  3HSF A;  1BN5 A;  4P5O A;  5KVR A;  4WXD A;  5ERI A;  3E5X A;  2LDU A;  4HF1 A;  3R0A A;  2OQG A;  3MWM A;  2PMH A;  1YS6 A;  4M71 A;  1YW7 A;  2Y48 A;  2RVC A;  2J5P A;  3TO7 A;  2P7C B;  5TJJ A;  1YQA A;  3M8E A;  1AOY A;  3T0Y A;  1IXR C;  4L18 B;  1U3E M;  3KZY A;  4YII A;  4B09 A;  6PAX A;  3GWZ A;  1J9I A;  2GXG A;  3CDH A;  4EQQ A;  3VOE A;  3D0S A;  1OR7 A;  2DO7 A;  2HEO A;  2K27 A;  1LVA A;  3JAM K;  2OZ6 A;  1IXC A;  1J75 A;  4L5J A;  3WGH A;  1T2K A;  4KIG A;  1ON1 A;  3E6M A;  1ODD A;  3W6J B;  3ECO A;  2IP2 A;  2H6B A;  4UUV A;  2IA1 A;  1JXS A;  2P6S A;  3TDZ C;  3PQJ A;  4HYE A;  1Z9C A;  4H0E A;  1QPM A;  3KLN A;  1XGO A;  4ENM A;  1UHW A;  3BZ6 A;  1ZRD A;  3GO5 A;  4B8X A;  3QPT A;  4OIP F;  3R60 A;  5LHI A;  1U8R A;  4I02 A;  4A2U A;  1TQP A;  2MH2 A;  4U0Y A;  1OYW A;  2HR3 A;  1KU2 A;  1F4K A;  3LA2 A;  3BPV A;  3VFZ A;  3U9G A;  3EDP A;  3WTS C;  2QM3 A;  2EK5 A;  3PFI A;  2VOP A;  1GVJ A;  4ESF A;  2STT A;  1UB9 A;  5D6F A;  3GFI A;  1KU9 A;  3REO A;  5CVI A;  1R5H A;  2FOK A;  3CUO A;  1SD6 A;  4O5V A;  3V8K A;  3G73 A;  3T8R A;  4UXN A;  2XAJ A;  1QZY A;  2G7U A;  4EJV A;  4S04 A;  1TNT A;  2O0Y A;  5DCM B;  1ZHF A;  1J59 A;  2DI3 A;  3SZT A;  1FPQ A;  5E18 F;  1E2X A;  4ZZL A;  3F8N A;  1XDU A;  5E1W A;  1SFE A;  2FBK A;  5D8L B;  1FBS A;  1P4A A;  1Z6R A;  4LLG F;  4IHT A;  4OOI A;  1QO0 D;  1G3W A;  2MLK A;  4EV0 A;  4CO8 A;  4JBA A;  5J8F A;  2QLZ A;  3E5Q A;  2JSC A;  2A3S A;  3T1B A;  1LNW A;  2H6C A;  5DCF A;  4MQ9 F;  1HW2 A;  2QUF A;  5IT9 Z;  3HOT A;  4Q48 A;  4KUM A;  4G8X A;  4MNU A;  4EJT A;  1HKT A;  2QQB A;  1I6X A;  3WTV C;  2FSW A;  3C3W A;  1BI0 A;  3AAF A;  5BPI A;  1J7K A;  1GXP A;  2Q0O A;  3VOD A;  1B59 A;  3P7N A;  2HKX A;  4BH9 A;  1I1S A;  4WX9 A;  2A68 F;  3ZMD A;  4UNO A;  5F64 A;  3DF8 A;  1FWZ A;  3P9K A;  1J0R A;  4YFX F;  3MAJ A;  4M74 A;  4OU0 A;  5BQT A;  3RKW A;  1O3S A;  3FM3 A;  2L4M A;  4LK1 F;  3DFG A;  5K5O A;  1U6G A;  1WWX A;  2COM A;  4PCQ A;  1XCV A;  2FBI A;  2CSO A;  3LA3 A;  5E1Z B;  3CO6 C;  2YU3 A;  2NNY A;  3SHF A;  5ICG A;  3QP5 A;  5LRS A;  5H20 A;  3FXU A;  3GVA A;  5ILS A;  2HDC A;  5A2Q Z;  4N9I A;  3U2R A;  2W85 A;  4KT5 C;  4BHP A;  5LEK A;  1UHM A;  4Z2Y A;  4G6Q A;  5CYV A;  4BQA A;  2DFI A;  3IL2 A;  5L3D A;  3RYR A;  4XBF A;  5H6Q A;  1FNN A;  2BBY A;  5D5V B;  4QLC U;  2H94 A;  1ZGJ A;  2LF8 A;  3K1N A;  2FNA A;  3FM5 A;  3F3X A;  2OQR A;  1Z05 A;  2O61 A;  4M6X A;  1G4D A;  3WTX C;  1H9G A;  4M73 A;  5KK1 A;  3TO9 A;  1KQ0 A;  2D2W A;  4I0A A;  3ELK A;  4M9S A;  1TW2 A;  2DPU A;  3ZN1 A;  5ED4 A;  5LGU A;  3BOQ A;  2V1D A;  1IN5 A;  1UCR A;  5E8I A;  3GZ6 A;  1EV7 A;  4G7H F;  4I2O A;  5FO5 A;  2EV5 A;  2QQA A;  3BJO A;  2VC1 A;  3I64 A;  4LGW A;  4RS8 A;  1BI3 A;  4JK1 X;  4A0X A;  2IA0 A;  3Q5F A;  1GHC A;  2W57 A;  4WXC A;  1DPU A;  2E1C A;  2IPQ X;  3JSP A;  1IRG A;  4CIC A;  4Q47 A;  2M1B A;  1P4X A;  4XSZ F;  2LF7 A;  4XLP F;  4FX4 A;  3CUQ A;  1YYV A;  1NHA A;  4EGY A;  5JI6 A;  5HLI A;  1L0O C;  2L4A A;  2K4B A;  4Q4Z F;  4U7B A;  4UHT A;  1O7L A;  4R1H A;  3F8C A;  1FYM A;  5D5W B;  1R1T A;  3K0L A;  1I1G A;  4UV8 A;  1XMA A;  4LJZ F;  2YR2 A;  4A0Z A;  2LKP A;  2BE5 F;  5D5X B;  5D4R A;  3C18 A;  5TRD A;  1FSH A;  5FFX A;  3JTH A;  2P5K A;  1OKR A;  3BWG A;  2IW5 A;  1E17 A;  4G7O F;  3VB2 A;  3LWF A;  1WI9 A;  4LK0 F;  2A5Y B;  4MEY F;  1TLH B;  4G6D A;  1MZB A;  1R23 A;  3COA C;  3HRM A;  1FP2 A;  4KIB A;  1O7F A;  2EFW A;  4A6E A;  2VOO A;  3WTY C;  3ABU A;  3CJN A;  2W24 A;  1ZN2 A;  4HLX A;  3LQQ A;  1XSD A;  4HBL A;  3JSO A;  2ZXJ A;  1MKM A;  1R7J A;  3RIR A;  2CWE A;  3TKY A;  4ESJ A;  2A69 F;  3WU1 B;  3HUG A;  4K2E A;  2L01 A;  3K2Z A;  1IN6 A;  4OIO F;  3FF5 A;  4EM2 A;  2VXZ A;  5EEH A;  2EFP A;  2K02 A;  5FD6 A;  2GQQ A;  4BXU A;  1QBJ A;  1WQ2 A;  3IRR A;  5IT9 K;  2Z3Y A;  4UV9 A;  3SQN A;  2DK5 A;  5DCM A;  2M45 A;  1EH7 A;  4U7D A;  2GZW A;  2EFO A;  2JT1 A;  2D1H A;  2XAS A;  2QBY B;  2EWN A;  4YIF A;  2MD5 A;  2F5C A;  1H0M A;  4I01 A;  1K6O A;  3OOP A;  1EH8 A;  5J8C A;  3HIF A;  3L7W A;  2HTS A;  3K1M A;  5LBQ A;  3ULQ B;  3M1E A;  3GFJ A;  2FMY A;  4A5M A;  2PG4 A;  2VBY A;  2JRT A;  2D1V A;  1SMY F;  3QU3 A;  4EM1 A;  2EB7 A;  3LFK A;  3JW4 A;  1W5S A;  1V3F A;  3KP5 A;  1UFM A;  3GEZ A;  2GIV A;  3HSR A;  5K5Q A;  3KEO A;  1BC8 C;  2UXX A;  2GAU A;  4IRG A;  2HYF A;  1FC3 A;  3WOD F;  2EV6 A;  3CUQ B;  1D8J A;  2XAG A;  4LLN A;  3GXO A;  3M9A A;  1LEB A;  1RIO H;  1PP7 U;  4KIC A;  1S29 A;  3H3U A;  3I4P A;  1KQ9 A;  1F1Z A;  2BYV E;  5DV5 A;  1RZ4 A;  1SD4 A;  4GYG A;  2FML A;  2NS0 A;  1IAW A;  5A2Q K;  2DT5 A;  3E6D A;  1KU3 A;  1KYZ A;  4S05 A;  4HAM A;  1XCB A;  1IUY A;  2PN6 A;  2IA2 A;  2PJP A;  3KET A;  2W25 A;  3K1P A;  3Q9V A;  3Q9S A;  3GFL A;  5E8G A;  3SFZ A;  4CZZ A;  1U2W A;  4UVB A;  4HF0 A;  2NAZ A;  3J80 Z;  1XGS A;  3CUQ C;  1HSJ A;  4KN7 X;  1TW3 A;  3HOS A;  3KP2 A;  2B0L A;  2P6T A;  2QQ9 A;  4ZH4 F;  2CG4 A;  4KN4 X;  1BI2 A;  1LDK B;  4YFK F;  3N97 A;  4ZYH A;  1O3T A;  4HV6 A;  3BRO A;  3NRV A;  3ABT A;  2VBW A;  4HOB A;  1SD7 A;  3FXR A;  3L2C A;  4P9U A;  1XGM A;  4Y15 A;  1R5G A;  1I27 A;  2QVO A;  2DQL A;  3ZQ7 A;  1K7A A;  1RNL A;  2Z99 A;  2O6G E;  5HDK A;  4KIF A;  1YG2 A;  3MFK A;  3QAH A;  1STZ A;  1HQC A;  4EMS A;  3K9T A;  4PZJ A;  2ZO4 A;  2IJL A;  4BYY A;  4WWC A;  3KE2 A;  2VT3 A;  1HST A;  3IKV A;  3F6V A;  4HZF A;  4ENJ A;  2A6E F;  3V7S A;  2XVC A;  3O2P E;  4IPA A;  1JGS A;  2P5L C;  1XSV A;  2XHK A;  1U5T A;  2ACJ A;  3I58 A;  2BGC A;  3GFM A;  4CHU A;  5DD4 A;  4AIK A;  2ZFW A;  3HHG A;  5CVU A;  2DAO A;  5HOO A;  2QWW A;  1ZRC A;  3KP4 A;  3QU6 A;  1MJB A;  3RKY A;  2M5W A;  2RKH A;  2P8T A;  4F7Z A;  1R00 A;  4RGX A;  3L09 A;  2XAF A;  5IT3 A;  1LDJ A;  2LSO A;  3TGN A;  3E3V A;  1BIB A;  1HKS A;  3FHZ A;  1FY7 A;  1OMI A;  2R3S A;  2FBH A;  5L3G A;  1YIO A;  1FOK A;  3MZY A;  4EM0 B;  2F5E A;  5CLS A;  2DW4 A;  2IRF G;  2STW A;  1Q1H A;  3WG9 A;  2WV0 A;  2RN7 A;  3LAJ A;  2OZU A;  2KJB A;  3E97 A;  4QWQ A;  2YX4 A;  2XUB A;  3IRQ A;  1JE8 A;  1SMT A;  4IRH A;  1YS7 A;  3ML6 A;  4E70 A;  4EJO A;  5D8K B;  1RUO A;  1LEA A;  3ZPL A;  2VE8 A;  4U0V A;  1T38 A;  3ERE D;  3KFW X;  2ZBK A;  2KIM A;  1FBU A;  4R8H A;  5FLX Z;  3E6C C;  4IJA A;  2C6Y A;  1IXS B;  4I09 A;  2AS5 F;  3EET A;  1SFX A;  1W7P B;  4AWX B;  1KA8 A;  2V79 A;  1QGP A;  1DP7 P;  1Y0U A;  3WE3 A;  1FLI A;  1LDD A;  3KP7 A;  3NQO A;  1X3U A;  4MGR A;  4RB2 C;  2ZCW A;  1ON2 A;  1XMK A;  3FZV A;  2ZME B;  3QRF F;  3I53 A;  2ISY A;  3WTU C;  4HF2 A;  3DXJ F;  4HX8 A;  1QQI A;  2UXN A;  5JVT A;  4MTD A;  3HSE A;  1MGT A;  4OIQ F;  2EFQ A;  2HYG D;  4JQF A;  3DP7 A;  1MD0 A;  5LRR A;  3F6O A;  4G7Z F;  1PDN C;  4YG2 F;  2FA5 A;  4HW0 A;  1T6S A;  1U5T B;  1XGN A;  3HTS B;  2P5V A;  5J6X A;  5FD5 A;  4HDU A;  5L3B A;  4G94 A;  4KA4 A;  1W4M A;  3F23 A;  1REP C;  4HA8 A;  4A5N A;  2K4J A;  1BI1 A;  4UVA A;  2FRH A;  3G3Z A;  2FNP A;  1YW9 A;  4ON0 A;  5LEJ A;  4O6J A;  2GXB A;  1WRJ A;  3QP6 A;  4L9V A;  3TOB A;  2BV6 A;  2QBY A;  2ZNY A;  3LA7 A;  2Z33 A;  2P4W A;  3IWZ A;  3E5U A;  3OV8 A;  4Y17 A;  2GA1 A;  2KJC A;  1Z7U A;  1L3L A;  3WTW C;  3KLO A;  1U5T C;  2WTE A;  1ZG3 A;  1K78 B;  2A61 A;  2Z5U A;  3J80 K;  1D3Y A;  1PP8 F;  4CYD A;  2VON A;  4R79 A;  5LGN A;  1XSX A;  4P9F A;  4MQV A;  2OD5 A;  1R1U A;  3KP6 A;  2DBB A;  1IN7 A;  3P9C A;  4WF2 A;  4IXA A;  1HBX G;  2WWY A;  3GW2 A;  4BHC A;  4HX7 A;  2F2E A;  2ZNZ A;  4IF4 A;  4P55 A;  4OIN F;  3DV8 A;  1ZG1 A;  1K79 A;  3L00 A;  2TDX A;  5ICC A;  3WTT C;  5D5U B;  5BOX A;  2RNJ A;  1ZGA A;  1IN4 A;  2GWR A;  2MC3 A;  1SD5 A;  2JZY A;  3RYP A;  1Z91 A;  2MBF A;  1QNT A;  1KGS A;  4I98 B;  1Z1D A;  1SFU A;  2XIG A;  2VE9 A;  2FXA A;  4ETS A;  3HYI A;  3HTU A;  1OYI A;  3KEQ A;  2L54 A;  1DUX C;  2O8X A;  1D8K A;  1FP1 D;  3MQ0 A;  1G3S A;  5AON A;  2ETH A;  3LAP A;  2P7V B;  5LLQ A;  4PGH A;  2L3D A;  3J7A O;  2CYY A;  4L0Y B;  4ZYD A;  3U1D A;  1YLF A;  3JTG A;  5L3E A;  2H27 A;  1I5Z A;  2NYX A;  4HLY A;  3LST A;  3FMQ A;  1Z6T A;  4RB0 A;  2PFB A;  2V1X A;  1UST A;  2M30 A;  2LNB A;  2G9W A;  4HV5 A;  1S7A A;  2H09 A;  1TNS A;  3RDI A;  1FYK A;  2PLY A;  3TO6 A;  3HRT A;  1T98 A;  5E17 F;  1KYW A;  2IT0 A;  1HKQ A;  2K86 A;  2X4H A;  5FFZ A;  3FMR A;  1CF7 B;  4A6D A;  3TQN A;  4HX4 A;  4GYI A;  1SAX A;  4GXO A;  1IF1 A;  1IRF A;  3I54 A;  3FWE A;  1B9M A;  5HS9 A;  2NRA C;  5JFR A;  1J2X A;  1J5Y A;  3DPL C;  3I0T A;  2HKO A;  3ZMZ A;  3PQK A;  2FE3 A;  1P2F A;  1TTY A;  2JTV A;  3KZZ A;  3MEX A;  2HGC A;  3T5X A;  3GYH X;  2L02 A;  4WK8 F;  4N0B A;  1YO5 C;  2ISZ A;  3ZP5 A;  2K7L A;  5FLX K;  3BP8 A;  3VEP A;  4XLN F;  3WE2 A;  1C0W A;  2ADU A;  3J81 Z;  5LGT A;  1ULY A;  3IWF A;  3BPX A;  5BMZ A;  3L9F A;  4WCG A;  4OMZ A;  2A6H F;  4IRI A;  3P9I A;  3B02 A;  1ZLJ A;  4RGR A;  3IHU A;  3I5U A;  1YTY A;  1G3Y A;  3EUH A;  4AD9 A;  1O3R A;  1ZAR A;  2X0L A;  1F5T A;  3DQV C;  1T0F A;  1RUN A;  3WGI A;  1MJA A;  5DYM A;  1GXQ A;  3I59 B;  1ZG5 A;  2E7W A;  4WXH A;  4A12 A;  1ONV A;  5FGM A;  5DEQ A;  2XV4 S;  3BDD A;  2PMU A;  3HHH A;  5BPD A;  4BHB A;  1FBQ A;  2EFN A;  3GX4 X;  3TDU C;  4LMY A;  1G3T A;  1W7P A;  1VTN C;  1AWC A;  2BEO A;  2GA2 A;  5E20 A;  1B4A A;  1LJ9 A;  1DPR A;  3FXQ A;  2O3F A;  1XB4 A;  2CQK A;  1ZAO A;  2VBZ A;  4L0Z B;  2ZME A;  5D4S A;  2XKP A;  4ZZD A;  3CTA A;  3LQR A;  4L5I A;  2V9V A;  2RGV A;  1EH6 A;  5LHH A;  5CVR A;  3CO7 C;  1R36 A;  2FEZ A;  4XSX F;  4IHS A;  2G7H A;  2JPC A;  1B1B A;  4TV7 A;  1IN8 A;  3M8F A;  1MDM B;  4CXF A;  1YW8 A;  2MLG A;  2HQR A;  4ENK A;  4PDK A;  4FT8 A;  1KU7 A;  3SXY A;  5ILV A;  3ZMT A;  1FSE A;  5CVV A;  3F8B A;  2FQ3 A;  1MJ9 A;  4YFN F;  2KKO A;  3M7G A;  3R6S A;  1XN7 A;  4ZYE A;  1FX7 A;  4GCV A;  4LD5 A;  1WSU A;  2QZ8 A;  1TQI A;  4FX0 A;  5HDG A;  1HW1 A;  2WC2 A;  4LB5 A;  3V8L A;  4AIJ A;  3BJA A;  2RV8 A;  4ZYG A;  3WGG A;  2HS5 A;  4KMU X;  4HDV A;  1W7P D;  1ZLK A;  3H92 A;  2YPR A;  2ZJ2 A;  2XRN A;  3GUD A;  2MA3 A;  2DTR A;  4M9X A;  4EGZ A;  1K78 A;  2DPD A;  2HWV A;  1D5V A;  3V7C A;  3R61 A;  5DDG A;  3V7R A;  3I71 A;  4NB5 A;  1A04 A;  4M72 A;  5ICF A;  2DU9 A;  4DQ2 A;  1OYY A; 
#chains in the Genus database with same CATH topology
 3H9G A;  2DQR A;  3K7A J;  1BR1 A;  5FJ8 J;  1HDD C;  1OCR H;  5E3M A;  2KP6 A;  3RSN A;  3FHN A;  2LLK A;  2LK2 A;  5F0F A;  5E3N A;  2F5D A;  1VQO I;  2JPB A;  1PUE E;  1YIT I;  3SEQ A;  2YU9 J;  2X1C A;  2VC0 A;  5DUK A;  5JR3 A;  3CCJ I;  2HZT A;  1WCM J;  2Y75 A;  5CJ9 A;  2R0Q C;  1B72 A;  4GDF A;  2CW0 F;  2DOF A;  3TW7 A;  3DPT A;  2FF4 A;  4BE0 A;  2XGX A;  1OFC X;  4I7H A;  3F72 A;  2V1U A;  2CFX A;  1WZ2 A;  1TL8 A;  2ESH A;  4GGG A;  1ETV A;  3IAS 2;  4ASN A;  4CCN A;  2CV2 A;  1DQU A;  3T8T A;  1S3J A;  5F0H A;  1BJA A;  1MBH A;  1W5T A;  2X9D A;  3CJQ B;  4PJJ A;  1LFB A;  4RGU A;  3ZMU A;  3BLY A;  2OU2 A;  3GLX A;  2LVS A;  3EYI A;  1EF4 A;  3F8F A;  1B6A A;  2RQP A;  1KZH A;  2BY0 A;  3LSH A;  1S7O A;  4G12 A;  4EJU A;  2UZK A;  4AVP A;  3KP3 A;  2GOX B;  2NS7 A;  3BC8 A;  5IP6 A;  3Q0V A;  1JHH A;  4ESB A;  2MSY A;  1K83 J;  3PSF A;  1Z67 A;  4Y33 A;  5HDN A;  1V4R A;  2I8D A;  3DCF A;  2EA4 A;  3O6B B;  4HQE A;  3OR1 C;  4YEJ A;  3RPU A;  5BS6 A;  4UY8 I;  2L2O A;  1UG0 A;  2EV0 A;  2VPR A;  1O3Q A;  1IRZ A;  4RM2 A;  4Y13 A;  2KPM A;  1BC7 C;  2O03 A;  4RB1 A;  2WB1 A;  1BBY A;  3NEU A;  3FDY A;  3K70 D;  1LQ1 A;  4KMF A;  4IL6 C;  4BE2 A;  1ZH5 A;  1ZRF A;  3CC4 I;  4UUS B;  2VQC A;  2HQ5 A;  5L3C A;  3RQI A;  1TQM A;  3ZN0 A;  3MZH A;  3D5L A;  3R4K A;  5CQE A;  3FXK A;  1Z7L A;  2AXT C;  2WV1 A;  1OPC A;  3E1S A;  4LG0 A;  1WGX A;  3F21 A;  2ZSI B;  3K69 A;  4E4H A;  2VN2 A;  2DK8 A;  1PYV A;  3S1R J;  4A0Y A;  1LFU P;  1XC5 A;  2OBP A;  2YSR A;  4I0B A;  1VQ6 I;  2XRO A;  4L9T A;  1ZEL A;  1EA3 A;  4O3M A;  1G59 A;  3H3Z A;  1BM9 A;  5HS7 A;  1A35 A;  1SVL A;  3RZO J;  3C7J A;  2ZKZ A;  1IZ1 A;  3JAM Z;  1ZYR F;  4EVI A;  3PFY A;  3FIS A;  1FT9 A;  2EJR A;  2M7B A;  2R7X A;  2HPM A;  3BR0 A;  3LL7 A;  3O3K A;  2EIJ H;  3ZMV A;  2MD0 A;  5TGT A;  2VOD A;  5L3F A;  3J81 K;  3V8J A;  1N25 A;  1Y8Q B;  2HQA A;  3DKW A;  4LB6 B;  2VQL A;  3J7Y J;  5D6E A;  1ZR4 A;  1DDN A;  1CGP A;  1YJN I;  4HQM A;  1MIJ A;  2J5O A;  5J1Y A;  3IV5 A;  3BR5 A;  3H9J A;  4L9J A;  2HQN A;  2W7N A;  2HTJ A;  1V55 H;  3PM1 A;  3ISP A;  5F0C A;  4J00 A;  4D5C A;  1NK3 P;  5F1R A;  1OCP A;  3BG7 A;  1VQL I;  1CF7 A;  1T08 B;  3W6V A;  4M6Y A;  2HDD A;  4IHV A;  1WKM A;  5ICE A;  2H1L A;  1R1V A;  5EEG A;  2A6T A;  4HNU A;  2AQE A;  1ZRE A;  2VJ5 A;  2GIZ A;  3GF2 A;  3SZP A;  3VSL A;  1XMX A;  4J01 A;  5HNH A;  3DEU A;  2W82 A;  1O57 A;  2H8W A;  3RPU D;  1FEX A;  2D45 A;  1G2H A;  4D0P A;  2CGP A;  3G1O A;  3TW6 A;  2EPF A;  2R7Z J;  2L7Z A;  2R7D A;  2W84 A;  2VKV A;  4RAY A;  4CCO A;  1VF9 A;  3MKY B;  4BAY A;  4ENN A;  3CCU I;  1YRN B;  2CUZ A;  1H8A C;  4BQQ A;  2V6E A;  2L5Q A;  2FOW A;  2YX7 A;  1S8N A;  3BY6 A;  4KNY A;  2NOG A;  4DGW B;  3CES A;  2F5F A;  1HF0 A;  5EYR A;  4MLO A;  3VYR B;  2FU4 A;  2PQ8 A;  4G9Y A;  5J3L A;  5B66 C;  1LB2 A;  2A07 F;  5EF6 A;  1D1C A;  1IW7 F;  4W1U A;  1S6L A;  2DOE A;  2HXO A;  2CO5 A;  2CUE A;  2HFH A;  3F8M A;  3BCA A;  2R7F A;  2WAD A;  3RKX A;  2XSD C;  4B43 A;  2EZK A;  3VYU B;  4BNC A;  3ECH A;  4XOR A;  4L9N A;  4IOC F;  4CGZ A;  1F9N A;  3OL4 A;  4NHJ A;  5JHU A;  5HLH A;  3K70 C;  1TBX A;  4A69 C;  2CFO A;  4CCJ A;  3CMA I;  1QZE A;  2VKH A;  4BXX J;  2ELH A;  5E1X A;  2IVM A;  1H88 C;  1QU3 A;  2VL8 A;  5AIQ A;  4KIT B;  2K3P A;  1U78 A;  2LY9 A;  2IGO A;  2E1N A;  3CCR I;  2EQR A;  4BJ6 C;  4P1W A;  4XL9 A;  4GO1 A;  4FCY A;  5LHG A;  3F22 A;  2ESN A;  4U0W A;  4EJW A;  2Z16 A;  3RZD J;  3CD6 I;  4MFD A;  3S17 J;  5DUI A;  1RI7 A;  2Q8K A;  3KYL A;  2OAZ A;  1VQK I;  2LG4 A;  1RR8 C;  2VB6 A;  4BDZ A;  2M87 A;  2RAE A;  2KRF A;  3CP2 A;  2X6X A;  4DNC A;  1XD7 A;  4MTE A;  2XPV A;  5AIP A;  4MFE A;  5CVJ A;  4F92 B;  3RJP A;  5FKL A;  1YE9 A;  2RDP A;  3I59 A;  1XPX A;  4KDP A;  2M8E A;  3PUF A;  3LFU A;  2VJ4 A;  4MHG A;  4A3M J;  4XK4 A;  1P92 A;  2PI0 A;  3FMS A;  4UVC A;  2AO9 A;  2Y0S A;  2UWM A;  1IO2 A;  2ZC2 A;  3F0C A;  5H6R A;  1FYL A;  1BR4 A;  2OF7 A;  3H3V K;  4CA0 A;  1GV5 A;  4PJL A;  3M4O J;  1BOA A;  1P4W A;  2VT2 A;  2RC4 A;  1BA5 A;  2PEX A;  2QEN A;  1H9T A;  2MH9 A;  2P0W A;  4M9Z A;  1R22 A;  3HG9 A;  3C1D A;  1YFH A;  2XAQ A;  3QPH A;  2ICW G;  3C2G A;  4L5E A;  3V4G A;  1MMA A;  4HNV A;  3BJ6 A;  3N4M A;  4LG0 B;  1VQ8 I;  3GZ5 A;  2JA5 J;  3CCQ I;  2DN0 A;  2W00 A;  4U88 A;  3IKT A;  3RPQ A;  2W48 A;  1H89 C;  3FX3 A;  5DD8 A;  4F91 B;  3OYD A;  3ZMS A;  2QKL B;  3RTR A;  2M4K A;  3EYY A;  1QRY A;  1Z3Y A;  5CKT A;  5HVQ C;  1R6R A;  3G2B A;  2V6C A;  2LD5 A;  4BBS J;  1YX3 A;  2MFZ A;  1TP4 A;  1HXD A;  4M3G A;  2YUS A;  4PUS A;  2DA7 A;  2DJI A;  4MEX F;  2H8R A;  3DU6 A;  3EQL F;  5B1A H;  3D5R C;  3HRS A;  2E7X A;  3H5A A;  1IUF A;  5DM7 F;  4JX4 A;  2HI3 A;  3VYS B;  2XAH A;  1BIA A;  4PSX A;  4RAZ A;  4AIH A;  1MDM A;  2BY1 A;  3C2H A;  2Q2E A;  5B1B H;  1KQ8 A;  1XDS A;  2HOE A;  2X6W A;  4FHT A;  4FQG A;  2K9M A;  4XRF A;  5HS8 A;  2HOS A;  1P6R A;  2KIU A;  2VBX A;  4NQW A;  3MVP A;  5EGO A;  3B73 A;  2QYO A;  3HOV J;  1FIP A;  2V9K A;  2LRE A;  1ETK A;  2R7T A;  4LLL A;  1VQ7 I;  4KYW A;  4RGS A;  4FE7 A;  2LBF A;  3HKZ N;  2I10 A;  4YRV A;  4II3 A;  5HLG A;  1Y39 A;  2KIF A;  3GTQ J;  1S9H A;  3M1C A;  5F6F A;  2ZB9 A;  5K5R A;  3KCC A;  5J1U A;  4N9H A;  4OIR F;  4OMY A;  4XR6 A;  3W2W A;  1LVK A;  5ILU A;  3CLO A;  2Y0M A;  3DBH B;  3RI4 A;  3W3C A;  4A3J J;  3WTZ A;  1IJW C;  3RQ4 A;  1YX5 A;  3E7L A;  4KFC A;  3MKW B;  5KNL A;  3OS1 A;  2DDB A;  3S2W A;  2CQ7 A;  4A3B J;  2CQX A;  2KQR A;  1FZP B;  3DWL E;  3IC7 A;  4IQ4 A;  1QZZ A;  1Y0N A;  4CDG A;  3TOA A;  1WFX A;  2Z9O A;  4IVN A;  1T39 A;  1AHD P;  2NNN A;  3HRU A;  2DLL A;  1USS A;  2XKO A;  1GLN A;  1R58 A;  2PBI A;  1JUP A;  2XC7 A;  3SDG A;  3ROU A;  1Z21 A;  3E6B A;  4Q5S F;  1I6H J;  3BQY A;  2OA4 A;  2EA2 A;  4HST A;  3WU0 A;  4P96 A;  4C9Y A;  2M2E A;  1IDY A;  4LFU A;  1JHF A;  2L9S A;  3HC7 A;  3R0J A;  1G6N A;  5FB2 A;  3W6K B;  1B9N A;  5K1Y A;  1JKQ C;  2AXL A;  3QOP A;  1BW5 A;  4PGG A;  3HB9 A;  1HW5 A;  3MCZ A;  4RB3 C;  4I6Z A;  3HSF A;  2ECC A;  4Y3O A;  4AUX A;  3JRA A;  1BN5 A;  4P5O A;  3O8G A;  5KVR A;  4WXD A;  5ERI A;  3E5X A;  1K4T A;  4EEF G;  1ETX A;  2LDU A;  3WHB A;  4HF1 A;  3R0A A;  2DTZ A;  2OQG A;  3X2Q H;  1O4X A;  3MWM A;  3JRD A;  3C2B A;  2PMH A;  1YS6 A;  4M71 A;  1YW7 A;  2Y48 A;  2RVC A;  1WJB A;  2J5P A;  3TO7 A;  2P7C B;  3CF5 F;  5TJJ A;  4E7J A;  1UG2 A;  1YQA A;  3M8E A;  1AOY A;  4A3F J;  1FMW A;  3T0Y A;  3S14 J;  1IXR C;  4XRS A;  1VFC A;  5EZH A;  4L18 B;  2NS8 A;  4ITV A;  1U3E M;  2DFH A;  3BT9 A;  3KZY A;  4YII A;  4B09 A;  2F6C A;  3S93 A;  6PAX A;  2D5V A;  2V1N A;  3GWZ A;  1J9I A;  2GXG A;  3BTJ A;  3VSK A;  2VQG A;  3CDH A;  4CZC A;  2IXS A;  1S72 I;  1JT6 A;  5C3E J;  2OTL I;  4EQQ A;  3VOE A;  4FAS D;  3D0S A;  1OR7 A;  1MBG A;  1HLV A;  2DO7 A;  2HEO A;  3S2D J;  2X51 A;  2K27 A;  1TWA J;  1LVA A;  3JAM K;  2OZ6 A;  1IXC A;  1J75 A;  4L5J A;  4D1Q A;  3WGH A;  1T2K A;  4KIG A;  1ON1 A;  3E6M A;  1ODD A;  3W6J B;  3ECO A;  2K85 A;  4MO7 A;  1F43 A;  2IP2 A;  2H6B A;  4UUV A;  2IA1 A;  2CRG A;  1JXS A;  3DKX A;  1RKW A;  2P6S A;  3TDZ C;  3D5S C;  1FOY A;  3PQJ A;  5F1J A;  4HYE A;  1Z9C A;  1ZGW A;  2VJJ A;  3DEW A;  3GBG A;  4H0E A;  1QPM A;  3KLN A;  4XLA A;  1XGO A;  1FMV A;  4C30 A;  2OTJ I;  2K9L A;  4ENM A;  2VPL A;  2JSP A;  2TRT A;  3OYI A;  2VIX A;  1UHW A;  4CYC B;  3BZ6 A;  1ZRD A;  3HOX J;  3GO5 A;  4B8X A;  3QPT A;  4EAT A;  4RAF A;  3CCM I;  4UUS A;  2R7O A;  4OIP F;  3R60 A;  2F4I A;  3GTP J;  3JRE A;  3NWT A;  5LHI A;  1U8R A;  2ZXW H;  2IBD A;  4I02 A;  2CJJ A;  5GTI C;  4A2U A;  2MG4 A;  1TQP A;  2MH2 A;  4XKV A;  4PJM A;  3OYK A;  3DKY A;  1OYW A;  5B5E C;  4U0Y A;  3DBR B;  2DT6 A;  1WI3 A;  2HR3 A;  3CCV I;  1KU2 A;  4OAY A;  1F4K A;  3ESW B;  3LA2 A;  3PNV A;  2WBM A;  3BPV A;  3VFZ A;  3U9G A;  3EDP A;  3WTS C;  2QM3 A;  2EK5 A;  2Q2E B;  3HUG B;  3PFI A;  2WB1 N;  2VOP A;  1GVJ A;  2E5Z A;  4ESF A;  2STT A;  1WH7 A;  4XN0 A;  1UB9 A;  5D6F A;  1WJE A;  3GFI A;  1KU9 A;  3REO A;  3H35 A;  1R5H A;  5CVI A;  3BCB A;  4HNT A;  2FOK A;  3CUO A;  1SD6 A;  4O5V A;  5M3F J;  3V8K A;  3G73 A;  3ERM A;  2DMU A;  2MW8 A;  2LFB A;  2LBF B;  3T8R A;  4IQJ A;  4UXN A;  2XAJ A;  1QZY A;  4U87 A;  1X1B A;  2G7U A;  4EJV A;  3ZQG A;  1U8B A;  3QQA A;  5FRM A;  4S04 A;  3AG4 H;  1TNT A;  2O0Y A;  5DCM B;  2IS4 A;  4AC0 A;  3ZQH A;  3OYJ A;  4BBR J;  1R5I D;  1ZHF A;  1J59 A;  2DI3 A;  3SZT A;  1FPQ A;  3BTI A;  5E18 F;  3DLA A;  1E2X A;  4ZZL A;  3F8N A;  4RDU A;  1XDU A;  2XAU A;  4E7Z A;  2KRH A;  3JRF A;  2HVQ A;  5E1W A;  2R4G A;  1SFE A;  4ANJ A;  2FBK A;  1T8I A;  5D8L B;  1FBS A;  1P4A A;  1Z6R A;  2RNG A;  4LLG F;  4A3C J;  2PX9 A;  5KAI C;  1HA8 A;  3OY9 A;  2JUC A;  2HVS A;  4IHT A;  1SVO A;  1X1P A;  1PUF B;  5IYC J;  1RC9 A;  4OOI A;  5F08 A;  4QIW N;  5IYD J;  1QO0 D;  1G3W A;  2MLK A;  4BKX A;  4EV0 A;  4BGD A;  3JRI A;  4CO8 A;  4JBA A;  5J8F A;  3QYE A;  2Y30 A;  2QLZ A;  3E5Q A;  2JSC A;  1YRN A;  2A3S A;  1TT0 A;  3T1B A;  1LNW A;  4X1E A;  2H6C A;  5M5W J;  2LTP A;  5DCF A;  3A0B C;  1OCC H;  4KT6 A;  4MQ9 F;  5EG0 B;  1JTY A;  1HW2 A;  1PVE A;  1MBK A;  2Y9Y A;  1UZC A;  2NVQ J;  4BAC A;  2QUF A;  5IT9 Z;  3GTO J;  3HOT A;  1IDZ A;  4Q48 A;  4KUM A;  1ORK A;  3K6G A;  4G8X A;  1JUM A;  4JX6 A;  4MNU A;  4EJT A;  1HKT A;  2QQB A;  2DOA A;  1I6X A;  3BR6 A;  1I50 J;  3WTV C;  2FSW A;  3C3W A;  5IOZ A;  1BI0 A;  1P9Q C;  3OIO A;  2V26 A;  3AAF A;  4LIV A;  4B1R A;  5BPI A;  5GTH C;  1J7K A;  4ZDO A;  1GXP A;  1I3A A;  2Q0O A;  3VOD A;  4IO9 F;  1B59 A;  3P7N A;  2HKX A;  1QVU A;  4BH9 A;  1I1S A;  3PJR A;  1MMD A;  2WA0 A;  3V42 A;  4WX9 A;  2EZI A;  4X0G A;  2V4J C;  3BQZ A;  4JP0 A;  5C4X J;  2OCC H;  2A68 F;  3ZMD A;  3BTC A;  4UNO A;  2KIS A;  2OUM A;  2KZV A;  5F64 A;  3DF8 A;  3S32 A;  1FWZ A;  1JKR C;  3P9K A;  1IGN A;  5KAF C;  1J0R A;  1OLT A;  3ONQ A;  1RKT A;  4YFX F;  1PJR A;  4II2 A;  1WJC A;  1I39 A;  3MAJ A;  1D1B A;  3J7Z I;  2LY2 A;  4M74 A;  2IGN A;  4OU0 A;  5BQT A;  2QF7 A;  3RKW A;  1VND A;  3MN2 A;  1O3S A;  3FM3 A;  1E3O C;  2L4M A;  2JUG A;  4LK1 F;  3DFG A;  5K5O A;  3H5R A;  2Y9Z A;  1U6G A;  4DIQ A;  3CQZ J;  2ZJQ F;  1WWX A;  2COM A;  2JVH A;  4PCQ A;  2E2J J;  1XCV A;  2O7O A;  5M5Y J;  2FBI A;  4A3L J;  2CSO A;  3K4M A;  3LA3 A;  4H4K C;  5E1Z B;  2N8G A;  3CO6 C;  4C2T A;  2YU3 A;  2M9H A;  3DTI A;  4BL0 B;  3BZC A;  3SHF A;  2NNY A;  5ICG A;  3QP5 A;  3I4N J;  5FRO A;  5LRS A;  2E1O A;  5H20 A;  3FXU A;  3CMM A;  3I56 I;  3GVA A;  4RAG A;  2E2I J;  2VI6 A;  5ILS A;  2B7E A;  2HDC A;  5A2Q Z;  2M7A A;  4N9I A;  3U2R A;  2W85 A;  1OR7 C;  4KT5 C;  4BHP A;  5LEK A;  1UHM A;  2Y2Z A;  5DTD A;  4Z2Y A;  4Y7N J;  3DLL F;  2Y0S N;  1VZ0 A;  4G6Q A;  1TT5 B;  1ZQ3 P;  4IZZ A;  5CYV A;  4BQA A;  2DFI A;  2ME6 A;  5L3D A;  3RYR A;  3IL2 A;  3S2H J;  3AL0 B;  4XBF A;  3H5N A;  3IH4 A;  5H6Q A;  4XON A;  1FNN A;  1MSF C;  2BBY A;  4BU2 A;  2E71 A;  5K7Z A;  5D5V B;  2MGQ A;  3HM5 A;  4QLC U;  1K61 A;  2H94 A;  1ZGJ A;  2R5Y A;  5H2F C;  3ABK H;  2LF8 A;  1OIS A;  3K1N A;  3TED A;  2FNA A;  3FM5 A;  1GDT A;  2DMT A;  2EIN H;  1MMN A;  2MC4 A;  3F3X A;  4V19 K;  2ID6 A;  2OQR A;  1Z05 A;  3M8J A;  3UR3 C;  4M6X A;  4C3I J;  1CQT A;  2O61 A;  1G4D A;  3WTX C;  4CSW A;  1H9G A;  3OS0 A;  2WY8 Q;  2BY2 A;  4M73 A;  2KLO A;  3H0D A;  5KK1 A;  2CW8 A;  2JMW A;  1OQY A;  1Z77 A;  3TO9 A;  4B4C A;  1KQ0 A;  2D2W A;  4I0A A;  4ZTF A;  3ELK A;  3HOZ J;  1E0E A;  4M9S A;  1TW2 A;  4CCM A;  2L0K A;  2DPU A;  1LKX A;  3ZN1 A;  2TCT A;  5ED4 A;  3K4K A;  5LGU A;  3GTL J;  3BOQ A;  2XGE A;  2V1D A;  3WU2 C;  2ELJ A;  2E2H J;  4FET A;  1WHU A;  1IN5 A;  1UCR A;  2BVL A;  4S0H B;  5E8I A;  2XDV A;  3GZ6 A;  1APL C;  3TMO A;  1EV7 A;  2DYR H;  4G7H F;  2L9R A;  4XLE A;  1TWG J;  4I2O A;  5FO5 A;  2EV5 A;  3QPS A;  3AL0 C;  2QQA A;  3BJO A;  1FOX A;  1ETO A;  2VC1 A;  3I64 A;  4LGW A;  1QVT A;  3W2A A;  3H36 A;  3VPR A;  4RS8 A;  1RRJ A;  1BI3 A;  2JA8 J;  2XB0 X;  3U1K A;  4JK1 X;  4A0X A;  4D5F A;  2IA0 A;  4XKC A;  3Q5F A;  1GHC A;  3GTG J;  2X1E A;  2W57 A;  4UUT A;  4WXC A;  1DPU A;  2EH3 A;  2E1C A;  2IPQ X;  1WVR A;  1R9T J;  3JSP A;  4CUG A;  1IRG A;  4CIC A;  1FTT A;  4Q47 A;  2M1B A;  3FXL A;  3TP3 A;  3CC7 I;  5EDN A;  3IP4 B;  2QEX I;  4HRI A;  1P4X A;  4HG2 A;  5J47 A;  1OCT C;  1LUJ B;  1ENH A;  4XSZ F;  2LF7 A;  1WH5 A;  4XLP F;  1D0Z A;  1XX5 A;  4FX4 A;  1DGR M;  3CUQ A;  4DOZ A;  4B3X A;  2NVX J;  1YYV A;  1M1E B;  1NHA A;  4EGY A;  3OSF A;  2HOT A;  1ITY A;  5JI6 A;  5HLI A;  2KT0 A;  1L0O C;  2L4A A;  1POG A;  2K4B A;  5J1R A;  4NC8 A;  3HBL A;  4Q4Z F;  1VQM I;  4QPQ A;  4U7B A;  3KPH A;  4B3A A;  4UHT A;  3L2Q A;  2DA1 A;  1D0Y A;  5M3M J;  4IHX A;  1O7L A;  3H9Q A;  2OC6 A;  2I5U A;  4R1H A;  3F8C A;  1FYM A;  5D5W B;  1R1T A;  3K0L A;  4M3E A;  1I1G A;  4UV8 A;  4BQO A;  3CP8 A;  2L9N A;  4I76 A;  1YIJ I;  2NVY J;  4ZTJ A;  4HEA 2;  1XMA A;  4LJZ F;  2YR2 A;  3HDD A;  4A0Z A;  2LKP A;  1S5L C;  4KJZ A;  3RKQ A;  2BE5 F;  1BR2 A;  5D5X B;  3LMM A;  5D4R A;  1DU0 A;  3C18 A;  3OYM A;  3AKZ A;  5TRD A;  1FSH A;  5FFX A;  3JTH A;  2P5K A;  3S1N J;  2CU7 A;  2COB A;  2DA4 A;  3OL3 A;  5KCM A;  5IP7 J;  1OKR A;  3CCL I;  2NVU B;  3BWG A;  2IW5 A;  3S3O A;  2X6O A;  1E17 A;  2B9S A;  2LOO A;  3VB2 A;  3LWF A;  2DJN A;  4G7O F;  1WI9 A;  4B48 A;  4LK0 F;  2A5Y B;  4QSH A;  4MEY F;  4CYC A;  1TLH B;  1MND A;  1X1C A;  4G6D A;  2E1M B;  4XQF A;  1MZB A;  1R23 A;  3COA C;  3PUB A;  5TIS C;  3HRM A;  1FP2 A;  4KIB A;  1O7F A;  2LMD A;  2EFW A;  4A6E A;  2EIM H;  2VOO A;  3J7A Y;  3WTY C;  3ABU A;  5JLW A;  4RLF A;  1ETQ A;  3IH3 A;  2GM4 A;  1X58 A;  3CJN A;  3ASN H;  2W24 A;  1T56 A;  1ZN2 A;  4HLX A;  3LQQ A;  1X2M A;  3SJM A;  4HBL A;  1XSD A;  2JJ7 A;  3JSO A;  3LSJ A;  2ZXJ A;  1MKM A;  1R7J A;  3RIR A;  2ZXI A;  1GV2 A;  2CWE A;  3TKY A;  4XIC A;  4ESJ A;  2R7S A;  2A69 F;  1OCO H;  1T33 A;  2R5Y B;  3HUG A;  5BNG A;  3WU1 B;  4K2E A;  3BR1 A;  1NH3 A;  2L01 A;  3K2Z A;  2QSF X;  1IN6 A;  3LNQ A;  4OIO F;  3KEY A;  1ETY A;  3GTJ J;  1TZL A;  3FF5 A;  5IY5 H;  4EM2 A;  2VXZ A;  5EEH A;  2EFP A;  1BW6 A;  2K02 A;  5FD6 A;  2GQQ A;  2Q1Z B;  4BXU A;  1QBJ A;  5CQG A;  1WQ2 A;  2L7K A;  3A01 B;  3IRR A;  3O8H A;  5IT9 K;  2Z3Y A;  3RCO A;  4UV9 A;  3S3N A;  3SQN A;  5EZG A;  2CUF A;  4V2F A;  2DK5 A;  1K6Y A;  2R5Z A;  5DCM A;  2M45 A;  4BE1 A;  1EH7 A;  4U7D A;  1BOB A;  2GZW A;  3SDB A;  2EFO A;  3DBL B;  4XMY A;  2JT1 A;  2D1H A;  2XAS A;  4ZC3 A;  2FQ4 A;  3MKL A;  2EWN A;  2QBY B;  4YIF A;  2MD5 A;  2F5C A;  1P7I A;  3FBI B;  2DA2 A;  1H0M A;  1X4P A;  2DDA A;  2VKE A;  1WJA A;  2YS9 A;  3P5J A;  4I01 A;  1K6O A;  3HOY J;  3OOP A;  3ZQI A;  1MMS A;  1EH8 A;  5J8C A;  3HIF A;  1PUF A;  2E5N A;  2Z1D A;  3A02 A;  3L7W A;  2HTS A;  1JJ8 C;  3K1M A;  4PK4 A;  4N4O B;  4YEL A;  5LBQ A;  3LSR A;  3ULQ B;  3M1E A;  3AG2 H;  3B6A A;  3GFJ A;  2FMY A;  2Z2S B;  3K4C A;  4A5M A;  2PG4 A;  2VBY A;  2JRT A;  2D1V A;  1SMY F;  3QU3 A;  3QYF A;  4EM1 A;  2EB7 A;  3EPZ A;  2O5R A;  3M07 A;  3LFK A;  3JW4 A;  3E0J B;  5HOD A;  4E7L A;  2V7F A;  1W5S A;  1U9O A;  2Y69 H;  1V3F A;  3KP5 A;  1UFM A;  3GEZ A;  2GIV A;  3HSR A;  4Z6Y A;  5K5Q A;  3KEO A;  1BC8 C;  5DS9 A;  2UXX A;  2GAU A;  4I99 C;  1TWF J;  4IRG A;  2HYF A;  3FXO A;  1FC3 A;  3WOD F;  2EV6 A;  3CUQ B;  5EG0 A;  1D8J A;  3KZI C;  3PNT A;  2XAG A;  4LLN A;  3OYL A;  3GXO A;  4JX5 A;  3M9A A;  2LR8 A;  3OR2 C;  1LEB A;  4A3I J;  2LKX A;  1RIO H;  2OCE A;  2RRE A;  1PP7 U;  2BY3 A;  4KIC A;  1S29 A;  2WAQ A;  3DEE A;  1BL0 A;  3H3U A;  3I4P A;  1KQ9 A;  2LYC A;  1F1Z A;  2BYV E;  1K4S A;  5DV5 A;  4QTR A;  1RZ4 A;  5GP9 A;  1SD4 A;  4GYG A;  2FML A;  2NS0 A;  1IAW A;  5A2Q K;  2DT5 A;  2M0M A;  3E6D A;  2WAE A;  1KU3 A;  1KYZ A;  4S05 A;  1ZK8 A;  4HAM A;  1XCB A;  2QCO A;  3L1P A;  2DXI A;  1IUY A;  3A03 A;  2PN6 A;  4CCK A;  1X19 A;  2IA2 A;  2GXA A;  2PJP A;  4XKB A;  2M8G X;  1R71 A;  3KET A;  1JKP C;  3PL8 A;  2F4O B;  2W25 A;  3K1P A;  4YIR X;  3Q9V A;  3TP0 A;  2EBI A;  1Z0X A;  1S7E A;  2LRD A;  3VYT B;  3Q9S A;  2CV0 A;  1E3P A;  4AID A;  4GRI A;  3GFL A;  5E8G A;  1NG7 A;  2BXY A;  2HXI A;  3SFZ A;  1U2W A;  2K9N A;  4CZZ A;  2KDO A;  1TC3 C;  4UVB A;  4HF0 A;  2DYS H;  2NAZ A;  1XTA A;  3J80 Z;  1XGS A;  3CUQ C;  3BG6 A;  1HSJ A;  4DBQ A;  2VLA A;  4KN7 X;  2KDZ A;  1MH3 A;  1TW3 A;  3HOS A;  3KP2 A;  3HGG A;  3HEF A;  1RR7 A;  3S8P A;  1OCZ H;  3FXM A;  2B0L A;  2KZG A;  2P6T A;  4OAZ A;  3VDX A;  2QQ9 A;  5LFA A;  4DBR A;  4ZH4 F;  2CG4 A;  4KN4 X;  1BI2 A;  1LDK B;  3CZ6 A;  4E7I A;  4YFK F;  3N97 A;  2A05 A;  4ZYH A;  1O3T A;  4HV6 A;  1JUS A;  2DMN A;  3NAR A;  2PMZ A;  4XOP A;  1LFP A;  3BRO A;  3NRV A;  3ABT A;  2F4M B;  2VBW A;  4HOB A;  1SD7 A;  3FXR A;  3L2C A;  1Y56 A;  3OSG A;  3PIP F;  4P9U A;  1XGM A;  3ZCO A;  4Y15 A;  1R5G A;  2MYS A;  3D1N I;  2UUZ A;  4M3D A;  1I27 A;  3LSK A;  2BVM A;  1B8I B;  2QVO A;  2DQL A;  3ZQ7 A;  3HL2 A;  2E36 A;  1K7A A;  1RNL A;  2Z99 A;  2ECB A;  2O6G E;  1FTZ A;  3G71 I;  3CCY A;  5HDK A;  4KIF A;  1YG2 A;  5F27 A;  3MFK A;  3QAH A;  1STZ A;  1HQC A;  1YI2 I;  2E19 A;  1UMQ A;  4E7H A;  3ZQF A;  1IRX A;  4F93 B;  1A31 A;  4EMS A;  1MH4 A;  2PJR B;  3K9T A;  4PZJ A;  2ZO4 A;  2IJL A;  4BYY A;  4WWC A;  3KE2 A;  2VT3 A;  3ABL H;  3HPG A;  1HST A;  3IKV A;  3F6V A;  3GME A;  4C2M J;  2R93 J;  4BUP A;  4HZF A;  2F5V A;  2A6E F;  3LSM A;  3V7S A;  2XVC A;  3O2P E;  4IPA A;  4ENJ A;  1MNM C;  1JGS A;  2P5L C;  2XB5 A;  1XSV A;  2XHK A;  1U5T A;  1W1W E;  2ACJ A;  3DTE A;  3A1Y A;  3PIO F;  2R5Z B;  3I58 A;  3LSI A;  1R49 A;  2CMP A;  3I9V 2;  2BGC A;  3U21 A;  4BS9 A;  1QHG A;  2ZJP F;  3CMY A;  3I55 I;  1W36 D;  5JLX A;  3GFM A;  4CHU A;  5IYB J;  3S15 J;  4X6A J;  5DD4 A;  4AIK A;  2ZFW A;  3LOC A;  2VUM J;  1JI8 A;  2BZT A;  2OV7 A;  3HHG A;  5CVU A;  2DAO A;  4XLH A;  5HOO A;  2QWW A;  4FE4 A;  3KP4 A;  2BHY A;  1ZRC A;  2V9P A;  3QU6 A;  4UB6 C;  1MJB A;  3AG3 H;  3RKY A;  5F04 A;  1UAA A;  2ELK A;  1MW7 A;  2M5W A;  3BR3 A;  1MBE A;  4NBQ A;  2RKH A;  2VKD A;  2P8T A;  4F7Z A;  2IEK A;  1R00 A;  4RGX A;  1XS9 A;  1DU6 A;  2VQH A;  3L09 A;  4ABZ A;  5J40 A;  2XAF A;  1E3H A;  1X4O A;  1N77 A;  5IT3 A;  1LDJ A;  2LSO A;  4PJN A;  3OWT A;  1TWH J;  3EUK L;  3TGN A;  4E7K A;  5FLM J;  1IC8 A;  4C3H J;  3G1L A;  1U9N A;  3JCU C;  3E3V A;  1BIB A;  3BG3 A;  1HKS A;  3FHZ A;  3DU5 A;  1Q1V A;  1FY7 A;  4UB8 C;  4HPQ A;  1OMI A;  2R3S A;  3Q3S A;  2FBH A;  3BG9 A;  1R4N B;  4GFB A;  4CCL A;  4Y4R A;  1AKH A;  4XLC A;  4DYR A;  2BW3 B;  5L3G A;  1YIO A;  2IAI A;  1FOK A;  3MZY A;  4EM0 B;  5GAH J;  3L2R A;  4C3J J;  2F5E A;  1JKO C;  4LOC A;  2QGU A;  1WPK A;  5CLS A;  2DW4 A;  3FBN B;  1X1A A;  5GAG J;  4D9J A;  2IRF G;  2STW A;  1Q1H A;  4ZJZ A;  3WG9 A;  2WV0 A;  2RN7 A;  3LAJ A;  1OJL A;  2OZU A;  5EJC A;  2KJB A;  3A0H C;  3E97 A;  2EZH A;  2L7M P;  4B47 A;  3I4M J;  1LE8 B;  1MMG A;  4QWQ A;  2YX4 A;  2XUB A;  3IRQ A;  3K4B A;  4G6T B;  1SMT A;  2CQN A;  4IRH A;  1JE8 A;  2CW7 A;  1YS7 A;  4IKF A;  3ML6 A;  4E70 A;  4RMN A;  4EJO A;  2JWT A;  2O9L A;  5D8K B;  1RUO A;  1LEA A;  3ZPL A;  4IOA F;  2VE8 A;  2QKM B;  4U0V A;  3G6E I;  1T38 A;  3ERE D;  1D1A A;  4FTH A;  3KFW X;  3N05 A;  3BZK A;  4AYB A;  1NG6 A;  2ZBK A;  2KIM A;  1FBU A;  5JVG F;  4R8H A;  3HOW J;  5FLX Z;  3E6C C;  4IJA A;  2C6Y A;  1IXS B;  2JA2 A;  3JRC A;  3OYN A;  1T95 A;  1ZKG A;  4I09 A;  4M6V A;  3GLL A;  2UV1 A;  1W0U A;  3EET A;  2AS5 F;  1SFX A;  2XPU A;  1W7P B;  1MSE C;  2NVT J;  1RET A;  2CS3 A;  5KHD A;  1YJ9 I;  4AWX B;  1KA8 A;  2V79 A;  2FD5 A;  4DZJ A;  1QPI A;  1QGP A;  1YHQ I;  1Y0U A;  1DP7 P;  3WE3 A;  4A3E J;  1A36 A;  1LDD A;  1DP3 A;  9ANT A;  3KP7 A;  1FLI A;  2AQF A;  3NQO A;  2JQ7 A;  1X3U A;  4MGR A;  2XRL A;  3QOD A;  4RB2 C;  1WJF A;  2ZCW A;  2HOA A;  5E3L A;  3EUH C;  5B3S H;  3EUA A;  1ON2 A;  2WAF A;  1XMK A;  3FZV A;  2H1K A;  2IGK A;  1W36 C;  2EIL H;  2ME0 A;  4A3D J;  2ZME B;  3HOU J;  1V5F A;  2X48 A;  2DMP A;  3QRF F;  4QPO A;  2ID3 A;  4D7M A;  4BY1 J;  3I53 A;  2ISY A;  3TL4 X;  3WTU C;  1T0F C;  4HF2 A;  2IS1 A;  1YOV B;  4RA2 A;  3DXJ F;  2QQ8 A;  2ZFU A;  1HCR A;  2DFE A;  3S3M A;  4HX8 A;  1QQI A;  3MKZ A;  1V5G A;  2OPT A;  2UXN A;  3HSE A;  5JVT A;  5C44 J;  1MGT A;  4MTD A;  4OIQ F;  2EFQ A;  2HYG D;  3GTM J;  4JQF A;  3TBI A;  3DP7 A;  1MD0 A;  5LRR A;  1SC7 A;  3F6O A;  4G7Z F;  1PDN C;  4YG2 F;  2FA5 A;  1IG7 A;  4HW0 A;  1JGG A;  3QPL A;  1T6S A;  3IUO A;  4RLQ A;  1U5T B;  1XGN A;  3HTS B;  4FIS A;  2P5V A;  5J6X A;  3ZRG A;  1HDP A;  2P81 A;  5FD5 A;  4HDU A;  3M3Y J;  4A93 J;  3NAU A;  5E79 C;  1VQ4 I;  2IS2 A;  4BQN A;  5L3B A;  4G94 A;  3G1M A;  4KA4 A;  1W4M A;  3F23 A;  2B63 J;  1REP C;  4HA8 A;  3OYG A;  1A6I A;  2K4J A;  4A5N A;  4E7S A;  3A01 A;  2ZSH B;  1BI1 A;  2JK3 A;  4UVA A;  2FRH A;  3G3Z A;  2FJ1 A;  4A3G J;  1ERD A;  2FNP A;  1YW9 A;  2ZME C;  4ON0 A;  5LEJ A;  2XSJ C;  3S16 J;  4O6J A;  2GXB A;  1WRJ A;  2AHQ A;  2M4G A;  3ZXS A;  2XPW A;  3QP6 A;  2KFD A;  4L9V A;  3TOB A;  5EEA A;  2JN6 A;  1WJD A;  2BV6 A;  2R7R A;  2LY1 A;  5K7H A;  2QBY A;  2ZNY A;  3LA7 A;  2ZJR F;  3CCS I;  1I3Q J;  4DYQ A;  2Z33 A;  2P4W A;  3IWZ A;  3E5U A;  2NOJ B;  4XN3 A;  3OV8 A;  3GZN B;  1EJ9 A;  1X2N A;  1A6Q A;  3FK6 A;  4Y17 A;  1ZTR A;  3L2W A;  2GA1 A;  2KJC A;  2DOD A;  3WHC A;  3OYA A;  3QOE A;  3QYB A;  2QSH X;  3OIQ A;  1Z7U A;  1L3L A;  4BEH A;  3WTW C;  3KLO A;  1U5T C;  3HXL A;  2IS6 A;  1VQN I;  2G0E A;  2WTE A;  1AKH B;  1ZG3 A;  3HJE A;  3SYT A;  1K78 B;  2A61 A;  2HYJ A;  2Z5U A;  3H1C A;  3J80 K;  1D3Y A;  2VAS A;  3BTL A;  1PP8 F;  1QA6 A;  4CYD A;  5JHF A;  2JA6 J;  2VON A;  4R79 A;  3OIP A;  5LGN A;  1XSX A;  5FKM A;  5HLT A;  2VXD A;  4P9F A;  3ZQC A;  4LIT A;  3Q0U A;  3K2A A;  1JTX A;  2OD5 A;  4MQV A;  4V2G A;  4E6K G;  1R1U A;  2HU9 A;  3KP6 A;  2DBB A;  1IN7 A;  3P9C A;  1FOW A;  4WF2 A;  4IXA A;  1HBX G;  1G8X A;  2WWY A;  3GW2 A;  4BHC A;  3OYF A;  4HX7 A;  3BG5 A;  1HOM A;  2F2E A;  3MD2 A;  4ZYA A;  2JRM A;  2ZNZ A;  3HGY A;  1N78 A;  4IF4 A;  4P55 A;  1B72 B;  4IEJ A;  4OIN F;  1EKE A;  2HZD A;  2KHM A;  3DV8 A;  1ZG1 A;  1K79 A;  4NNJ A;  2LC2 A;  1A5J A;  2NXN B;  3FIW A;  3L00 A;  2TDX A;  2CV1 A;  5ICC A;  3WTT C;  5D5U B;  5BOX A;  1ACI A;  2RNJ A;  1ZGA A;  3VWB A;  1IN4 A;  2GWR A;  4AVZ A;  2MC3 A;  2WAQ N;  1SD5 A;  5FKK A;  5LD2 C;  2JZY A;  3OS2 A;  3RYP A;  4RBO A;  1Z91 A;  2M34 A;  4A3K J;  1RES A;  2MBF A;  1QNT A;  1KGS A;  2X85 A;  4I98 B;  1AU7 A;  1Z1D A;  4RM3 A;  1SFU A;  5M5X J;  4XNF A;  2XIG A;  2DA6 A;  4NUB A;  4AM3 A;  2VE9 A;  2FXA A;  4ETS A;  3HYI A;  2FX0 A;  1QHH D;  4JOM A;  3HTU A;  1OYI A;  1NTC A;  3KEQ A;  4LG3 A;  4DYC A;  5FKO A;  4F3Q A;  2L54 A;  4DW6 A;  3PNY A;  2XF5 A;  3JRB A;  4M3F A;  1DUX C;  1NK2 P;  5GPA A;  2O8X A;  3ABM H;  1D8K A;  3PO2 J;  1GT0 C;  2FUG 2;  2BHZ A;  1FP1 D;  2LH9 A;  1GUU A;  3MQ0 A;  1G3S A;  5AON A;  1JJ6 C;  4LIU A;  3AG1 H;  2ETH A;  4N4N B;  3LAP A;  3K4N A;  3SEZ A;  2P7V B;  1B8I A;  3LSG A;  5LLQ A;  4PGH A;  2DT7 B;  4W97 A;  3H0G J;  1UHS A;  3Q0W A;  4PFO A;  2L3D A;  1FIA A;  4J19 A;  3ZQQ A;  3J7A O;  2CYY A;  4L0Y B;  4ZYD A;  3U1D A;  4CH7 A;  3WG7 H;  1YLF A;  3JTG A;  1W5C C;  3UKG A;  2K40 A;  2PMZ N;  5L3E A;  2H27 A;  2R7V A;  2PJR A;  1I5Z A;  2NYX A;  4HLY A;  2EIK H;  2A5W A;  3LSP A;  4DJA A;  3LST A;  3FMQ A;  3CME I;  5GAE J;  3ZGK A;  2L9V A;  3HZJ A;  2K3F A;  1Z6T A;  2LP0 A;  4AU7 A;  3FKI J;  3GTK J;  2E1M C;  2EZL A;  4RB0 A;  2PFB A;  4D7N A;  2V1X A;  1UST A;  4F55 A;  2M30 A;  1R4M B;  2LNB A;  4Y52 J;  2G9W A;  2HDW A;  3A4C A;  4HV5 A;  1S7A A;  2H09 A;  2L7F P;  1TNS A;  3RDI A;  1FYK A;  3IH2 A;  2PLY A;  2XGD A;  2OJE D;  3TO6 A;  3HRT A;  1T98 A;  5E17 F;  1KYW A;  2IT0 A;  1HKQ A;  2K86 A;  1IV6 A;  3ZOB A;  2X4H A;  5FFZ A;  3CC2 I;  2GBY A;  3FMR A;  1CF7 B;  4A6D A;  3CDI A;  3TQN A;  4XKW A;  4HX4 A;  1DGW Y;  5E3O A;  4GYI A;  1SAX A;  4GXO A;  2BXZ A;  2LKS A;  2QSG X;  1IF1 A;  1IRF A;  3I54 A;  3FWE A;  4XRM A;  1B9M A;  3K4J A;  5CPR B;  5HS9 A;  1SFK A;  1IV8 A;  2Y31 A;  5JFR A;  2NRA C;  1J2X A;  1J5Y A;  3DPL C;  3I0T A;  2HKO A;  2KRC A;  3PQK A;  3ZMZ A;  4BEH B;  2FE3 A;  1P2F A;  1TTY A;  1FJL A;  4PFP A;  2JTV A;  3KZZ A;  3MEX A;  2HGC A;  3T5X A;  3PO3 J;  1VQ9 I;  3GYH X;  3KYD B;  2L02 A;  2GLO A;  4HSR A;  1X1D A;  3AFH A;  4WK8 F;  5C4J J;  3BR2 A;  1D5Y A;  4N0B A;  1YO5 C;  2ISZ A;  3ZP5 A;  2K7L A;  3OOU A;  2F48 A;  5FLX K;  3BP8 A;  3JR9 A;  3VEP A;  4XLN F;  3WE2 A;  1C0W A;  4BY7 J;  1SAU A;  2ADU A;  4B44 A;  3J81 Z;  3OYB A;  2BW3 A;  2WY7 Q;  5LGT A;  2W4S A;  1GVD A;  1ULY A;  3IWF A;  3BPX A;  2R7Q A;  5BMZ A;  3L9F A;  4WCG A;  4OMZ A;  4NC7 A;  4XM3 A;  2A6H F;  1XG1 A;  4IRI A;  3P9I A;  3B02 A;  2RQQ A;  1ZLJ A;  4RGR A;  5IP9 J;  3DPU A;  1BJZ A;  3IHU A;  2M3A A;  1SAN A;  1U0J A;  3I5U A;  1YTY A;  1D0X A;  1G3Y A;  1LE8 A;  3EUH A;  1WJ5 A;  3MMY B;  1X3W B;  2R7U A;  3OYH A;  5K7F A;  4AD9 A;  1VQP I;  1O3R A;  1ZAR A;  1ETW A;  2DFF A;  1SEU A;  2X0L A;  1F5T A;  3DQV C;  1T0F A;  4XOT A;  3JRG A;  1RUN A;  2E60 A;  3OMY A;  3WGI A;  4XRS G;  1MJA A;  3F9K A;  5DYM A;  3K10 A;  3L2U A;  4F52 A;  3K4L A;  4NDL A;  4BJT A;  2DA3 A;  1GXQ A;  3I59 B;  1ZG5 A;  5J4V A;  2E7W A;  4WXH A;  2K5C A;  4A12 A;  1ONV A;  1W0T A;  1P7J A;  5FGM A;  4ZDL A;  5J4Y A;  5DEQ A;  2XV4 S;  3BDD A;  1KON A;  1V5E A;  2DA5 A;  2PMU A;  3MZ8 A;  3HHH A;  3I3L A;  5BPD A;  4BHB A;  4DZP A;  2XF6 A;  1FBQ A;  2EFN A;  4NC6 A;  4PJ0 C;  3GX4 X;  1J09 A;  4C2U A;  1MNE A;  3TDU C;  4LMY A;  1G3T A;  1W7P A;  3CJT B;  1VTN C;  1AWC A;  2BEO A;  2CQQ A;  2GA2 A;  3B6C A;  1B4A A;  1LJ9 A;  1DPR A;  1F36 A;  3FXQ A;  5E20 A;  5DM6 F;  2O3F A;  1HC8 A;  3SZG A;  3KX2 A;  1XB4 A;  2CQK A;  3S1Q J;  1ZAO A;  2VBZ A;  1Y1V J;  4PSW A;  4L0Z B;  1X3Z B;  3W2V A;  1Z3X A;  2KIQ A;  2ZME A;  5D4S A;  2XKP A;  4AYB N;  4ZZD A;  3NWS A;  4IX7 A;  3JRH A;  3CTA A;  4XID A;  3LQR A;  1UJ8 A;  2GOM A;  4L5I A;  2V9V A;  2RGV A;  1EH6 A;  2DMQ A;  3FXJ A;  1V54 H;  5CVR A;  4BXF A;  5LHH A;  2HNH A;  2IGM A;  1N75 A;  3OYE A;  1JT0 A;  1SVM A;  3HKZ A;  1R36 A;  3CO7 C;  2DCE A;  2M0C A;  2K9S A;  3L2V A;  2FEZ A;  4XSX F;  4IHS A;  2HVR A;  3PSI A;  2G7H A;  2XF7 A;  4MIM A;  5IPA A;  2JPC A;  4KIS A;  3UNG C;  1B1B A;  2K9Q A;  1IN8 A;  3HPH A;  4TV7 A;  1YJW I;  3M8F A;  2E34 A;  4XLF A;  1MDM B;  2CUJ A;  4JYK A;  4CXF A;  2CH0 A;  2R7W A;  3S1M J;  1MBJ A;  1YW8 A;  2MLG A;  3FKJ A;  2HQR A;  4NQW B;  5EGO B;  3CJR B;  4ENK A;  4PDK A;  4BDY A;  4IHY A;  4FT8 A;  1KU7 A;  2X1D A;  3SXY A;  3G4S I;  4ZDP A;  3FK7 A;  5ILV A;  2HPI A;  3ZMT A;  5IOY A;  1FSE A;  2QA4 I;  5CVV A;  3KIO A;  1UEL B;  2W1O A;  3F8B A;  3SFI A;  2FQ3 A;  4M3B A;  1MJ9 A;  4YFN F;  4BJ5 C;  5GAD J;  3ASO H;  2KKO A;  3M7G A;  3R6S A;  3QWL A;  1XN7 A;  2KMU A;  4ZYE A;  1FX7 A;  2VJI A;  2XGC A;  5FKN A;  4GCV A;  4LD5 A;  1ZR2 A;  1WSU A;  2QZ8 A;  4IHW A;  1TQI A;  4FX0 A;  3ZR8 X;  5HDG A;  1Y8R B;  3IAM 2;  2MAB A;  1TWC J;  1HW1 A;  2WC2 A;  4LB5 A;  3V8L A;  4AIJ A;  3BJA A;  2RV8 A;  3CLQ A;  4ZYG A;  2O8K A;  3WGG A;  2HS5 A;  3GCM A;  3OYC A;  4KMU X;  4HDV A;  2JA7 J;  3CCE I;  2ZXH A;  1W7P D;  1VI0 A;  3CF2 A;  1ZLK A;  3H92 A;  2YPR A;  2ZJ2 A;  2XRN A;  3GUD A;  5GPC A;  2R92 J;  1RPW A;  2MA3 A;  2DTR A;  5FLV A;  4M9X A;  4EGZ A;  1K78 A;  1Y6I A;  2DPD A;  2HWV A;  1D5V A;  3V7C A;  3R61 A;  2X6Y A;  2KL4 A;  3CDL A;  2BOL A;  5DDG A;  3V7R A;  3A2K A;  4OWR B;  1Y1W J;  1VQ5 I;  2JVG A;  3I71 A;  4NB5 A;  1LPQ A;  1A04 A;  2E35 A;  4M72 A;  3ZQL A;  5FRN A;  1SFO J;  5ICF A;  2DU9 A;  3DTK A;  5HNF A;  1AA7 A;  4DQ2 A;  1OYY A;  3KYC B;  1MBF A; 
#chains in the Genus database with same CATH homology
 2DQR A;  2F5D A;  2JPB A;  1PUE E;  2VC0 A;  5DUK A;  5JR3 A;  2HZT A;  2Y75 A;  5CJ9 A;  2CW0 F;  3DPT A;  2FF4 A;  2XGX A;  4I7H A;  3F72 A;  2V1U A;  2CFX A;  2ESH A;  4GGG A;  4ASN A;  3T8T A;  1S3J A;  1BJA A;  1W5T A;  4RGU A;  3ZMU A;  2OU2 A;  3GLX A;  3EYI A;  3F8F A;  1B6A A;  2RQP A;  1S7O A;  4EJU A;  2UZK A;  4AVP A;  3KP3 A;  4ESB A;  1JHH A;  5HDN A;  1V4R A;  2EA4 A;  3O6B B;  4HQE A;  3RPU A;  5BS6 A;  2EV0 A;  1O3Q A;  4Y13 A;  1BC7 C;  2O03 A;  4RB1 A;  1BBY A;  3NEU A;  1ZH5 A;  1LQ1 A;  4KMF A;  1ZRF A;  5L3C A;  1TQM A;  3ZN0 A;  3MZH A;  3D5L A;  3R4K A;  1OPC A;  4LG0 A;  3F21 A;  3K69 A;  2VN2 A;  2DK8 A;  4A0Y A;  2OBP A;  2YSR A;  4I0B A;  2XRO A;  4L9T A;  4O3M A;  3H3Z A;  1BM9 A;  5HS7 A;  3C7J A;  2ZKZ A;  1IZ1 A;  3JAM Z;  1ZYR F;  4EVI A;  1FT9 A;  2EJR A;  3O3K A;  3ZMV A;  2VOD A;  5L3F A;  3J81 K;  3V8J A;  3DKW A;  4LB6 B;  1CGP A;  1DDN A;  5D6E A;  4HQM A;  2J5O A;  4L9J A;  2HQN A;  2HTJ A;  3ISP A;  5F1R A;  1CF7 A;  4M6Y A;  1WKM A;  5ICE A;  1R1V A;  5EEG A;  1ZRE A;  3GF2 A;  3SZP A;  3DEU A;  1O57 A;  2D45 A;  4D0P A;  2CGP A;  2R7D A;  2W84 A;  4RAY A;  4BAY A;  4ENN A;  2YX7 A;  1S8N A;  3BY6 A;  4KNY A;  2F5F A;  2FU4 A;  2PQ8 A;  4G9Y A;  1LB2 A;  2A07 F;  1IW7 F;  1S6L A;  2CO5 A;  2HFH A;  3F8M A;  2R7F A;  3RKX A;  4BNC A;  3ECH A;  4CGZ A;  4L9N A;  1F9N A;  4NHJ A;  5JHU A;  5HLH A;  1TBX A;  5E1X A;  2ELH A;  2IVM A;  5AIQ A;  1U78 A;  2E1N A;  4GO1 A;  5LHG A;  3F22 A;  2ESN A;  4U0W A;  4EJW A;  5DUI A;  1RI7 A;  2Q8K A;  2OAZ A;  2M87 A;  2KRF A;  4DNC A;  1XD7 A;  4MTE A;  5AIP A;  5CVJ A;  3RJP A;  2RDP A;  3I59 A;  4KDP A;  2M8E A;  4MHG A;  1P92 A;  2PI0 A;  3FMS A;  4UVC A;  2UWM A;  5H6R A;  1FYL A;  1BOA A;  1P4W A;  2VT2 A;  2RC4 A;  2PEX A;  2QEN A;  1H9T A;  2MH9 A;  4M9Z A;  1R22 A;  3C1D A;  1YFH A;  2XAQ A;  3QPH A;  3V4G A;  4LG0 B;  3N4M A;  3BJ6 A;  3GZ5 A;  4U88 A;  3IKT A;  3RPQ A;  3FX3 A;  5DD8 A;  3ZMS A;  3RTR A;  3EYY A;  5HVQ C;  2V6C A;  1HXD A;  4MEX F;  3EQL F;  3HRS A;  2E7X A;  2XAH A;  1BIA A;  4RAZ A;  4AIH A;  1MDM A;  2Q2E A;  1KQ8 A;  1XDS A;  2HOE A;  4FHT A;  4XRF A;  5HS8 A;  1P6R A;  2KIU A;  2VBX A;  4NQW A;  3B73 A;  2QYO A;  4LLL A;  4KYW A;  4RGS A;  5HLG A;  2KIF A;  5F6F A;  5K5R A;  3KCC A;  4N9H A;  4OIR F;  4OMY A;  5ILU A;  3CLO A;  2Y0M A;  3RI4 A;  3WTZ A;  4KFC A;  3S2W A;  1FZP B;  3IC7 A;  1QZZ A;  4CDG A;  3TOA A;  2Z9O A;  4IVN A;  1T39 A;  2NNN A;  3HRU A;  2DLL A;  1USS A;  1R58 A;  2PBI A;  2XKO A;  3ROU A;  3E6B A;  4Q5S F;  2OA4 A;  2EA2 A;  3WU0 A;  4P96 A;  4LFU A;  1JHF A;  3R0J A;  1G6N A;  5FB2 A;  3W6K B;  1B9N A;  5K1Y A;  2AXL A;  3QOP A;  4PGG A;  3MCZ A;  1HW5 A;  4RB3 C;  3HSF A;  1BN5 A;  4P5O A;  5KVR A;  4WXD A;  5ERI A;  3E5X A;  2LDU A;  4HF1 A;  3R0A A;  2OQG A;  3MWM A;  2PMH A;  1YS6 A;  4M71 A;  1YW7 A;  2Y48 A;  2RVC A;  2J5P A;  3TO7 A;  2P7C B;  5TJJ A;  1YQA A;  3M8E A;  1AOY A;  3T0Y A;  1IXR C;  4L18 B;  1U3E M;  3KZY A;  4YII A;  4B09 A;  6PAX A;  3GWZ A;  1J9I A;  2GXG A;  3CDH A;  4EQQ A;  3VOE A;  3D0S A;  1OR7 A;  2DO7 A;  2HEO A;  2K27 A;  1LVA A;  3JAM K;  2OZ6 A;  1IXC A;  1J75 A;  4L5J A;  3WGH A;  1T2K A;  4KIG A;  1ON1 A;  3E6M A;  1ODD A;  3W6J B;  3ECO A;  2IP2 A;  2H6B A;  4UUV A;  2IA1 A;  1JXS A;  2P6S A;  3TDZ C;  3PQJ A;  4HYE A;  1Z9C A;  4H0E A;  1QPM A;  3KLN A;  1XGO A;  4ENM A;  1UHW A;  3BZ6 A;  1ZRD A;  3GO5 A;  4B8X A;  3QPT A;  4OIP F;  3R60 A;  5LHI A;  1U8R A;  4I02 A;  4A2U A;  1TQP A;  2MH2 A;  4U0Y A;  1OYW A;  2HR3 A;  1KU2 A;  1F4K A;  3LA2 A;  3BPV A;  3VFZ A;  3U9G A;  3EDP A;  3WTS C;  2QM3 A;  2EK5 A;  3PFI A;  2VOP A;  1GVJ A;  4ESF A;  2STT A;  1UB9 A;  5D6F A;  3GFI A;  1KU9 A;  3REO A;  5CVI A;  1R5H A;  2FOK A;  3CUO A;  1SD6 A;  4O5V A;  3V8K A;  3G73 A;  3T8R A;  4UXN A;  2XAJ A;  1QZY A;  2G7U A;  4EJV A;  4S04 A;  1TNT A;  2O0Y A;  5DCM B;  1ZHF A;  1J59 A;  2DI3 A;  3SZT A;  1FPQ A;  5E18 F;  1E2X A;  4ZZL A;  3F8N A;  1XDU A;  5E1W A;  1SFE A;  2FBK A;  5D8L B;  1FBS A;  1P4A A;  1Z6R A;  4LLG F;  4IHT A;  4OOI A;  1QO0 D;  1G3W A;  2MLK A;  4EV0 A;  4CO8 A;  4JBA A;  5J8F A;  2QLZ A;  3E5Q A;  2JSC A;  2A3S A;  3T1B A;  1LNW A;  2H6C A;  5DCF A;  4MQ9 F;  1HW2 A;  2QUF A;  5IT9 Z;  3HOT A;  4Q48 A;  4KUM A;  4G8X A;  4MNU A;  4EJT A;  1HKT A;  2QQB A;  1I6X A;  3WTV C;  2FSW A;  3C3W A;  1BI0 A;  3AAF A;  5BPI A;  1J7K A;  1GXP A;  2Q0O A;  3VOD A;  1B59 A;  3P7N A;  2HKX A;  4BH9 A;  1I1S A;  4WX9 A;  2A68 F;  3ZMD A;  4UNO A;  5F64 A;  3DF8 A;  1FWZ A;  3P9K A;  1J0R A;  4YFX F;  3MAJ A;  4M74 A;  4OU0 A;  5BQT A;  3RKW A;  1O3S A;  3FM3 A;  2L4M A;  4LK1 F;  3DFG A;  5K5O A;  1U6G A;  1WWX A;  2COM A;  4PCQ A;  1XCV A;  2FBI A;  2CSO A;  3LA3 A;  5E1Z B;  3CO6 C;  2YU3 A;  2NNY A;  3SHF A;  5ICG A;  3QP5 A;  5LRS A;  5H20 A;  3FXU A;  3GVA A;  5ILS A;  2HDC A;  5A2Q Z;  4N9I A;  3U2R A;  2W85 A;  4KT5 C;  4BHP A;  5LEK A;  1UHM A;  4Z2Y A;  4G6Q A;  5CYV A;  4BQA A;  2DFI A;  3IL2 A;  5L3D A;  3RYR A;  4XBF A;  5H6Q A;  1FNN A;  2BBY A;  5D5V B;  4QLC U;  2H94 A;  1ZGJ A;  2LF8 A;  3K1N A;  2FNA A;  3FM5 A;  3F3X A;  2OQR A;  1Z05 A;  2O61 A;  4M6X A;  1G4D A;  3WTX C;  1H9G A;  4M73 A;  5KK1 A;  3TO9 A;  1KQ0 A;  2D2W A;  4I0A A;  3ELK A;  4M9S A;  1TW2 A;  2DPU A;  3ZN1 A;  5ED4 A;  5LGU A;  3BOQ A;  2V1D A;  1IN5 A;  1UCR A;  5E8I A;  3GZ6 A;  1EV7 A;  4G7H F;  4I2O A;  5FO5 A;  2EV5 A;  2QQA A;  3BJO A;  2VC1 A;  3I64 A;  4LGW A;  4RS8 A;  1BI3 A;  4JK1 X;  4A0X A;  2IA0 A;  3Q5F A;  1GHC A;  2W57 A;  4WXC A;  1DPU A;  2E1C A;  2IPQ X;  3JSP A;  1IRG A;  4CIC A;  4Q47 A;  2M1B A;  1P4X A;  4XSZ F;  2LF7 A;  4XLP F;  4FX4 A;  3CUQ A;  1YYV A;  1NHA A;  4EGY A;  5JI6 A;  5HLI A;  1L0O C;  2L4A A;  2K4B A;  4Q4Z F;  4U7B A;  4UHT A;  1O7L A;  4R1H A;  3F8C A;  1FYM A;  5D5W B;  1R1T A;  3K0L A;  1I1G A;  4UV8 A;  1XMA A;  4LJZ F;  2YR2 A;  4A0Z A;  2LKP A;  2BE5 F;  5D5X B;  5D4R A;  3C18 A;  5TRD A;  1FSH A;  5FFX A;  3JTH A;  2P5K A;  1OKR A;  3BWG A;  2IW5 A;  1E17 A;  4G7O F;  3VB2 A;  3LWF A;  1WI9 A;  4LK0 F;  2A5Y B;  4MEY F;  1TLH B;  4G6D A;  1MZB A;  1R23 A;  3COA C;  3HRM A;  1FP2 A;  4KIB A;  1O7F A;  2EFW A;  4A6E A;  2VOO A;  3WTY C;  3ABU A;  3CJN A;  2W24 A;  1ZN2 A;  4HLX A;  3LQQ A;  1XSD A;  4HBL A;  3JSO A;  2ZXJ A;  1MKM A;  1R7J A;  3RIR A;  2CWE A;  3TKY A;  4ESJ A;  2A69 F;  3WU1 B;  3HUG A;  4K2E A;  2L01 A;  3K2Z A;  1IN6 A;  4OIO F;  3FF5 A;  4EM2 A;  2VXZ A;  5EEH A;  2EFP A;  2K02 A;  5FD6 A;  2GQQ A;  4BXU A;  1QBJ A;  1WQ2 A;  3IRR A;  5IT9 K;  2Z3Y A;  4UV9 A;  3SQN A;  2DK5 A;  5DCM A;  2M45 A;  1EH7 A;  4U7D A;  2GZW A;  2EFO A;  2JT1 A;  2D1H A;  2XAS A;  2QBY B;  2EWN A;  4YIF A;  2MD5 A;  2F5C A;  1H0M A;  4I01 A;  1K6O A;  3OOP A;  1EH8 A;  5J8C A;  3HIF A;  3L7W A;  2HTS A;  3K1M A;  5LBQ A;  3ULQ B;  3M1E A;  3GFJ A;  2FMY A;  4A5M A;  2PG4 A;  2VBY A;  2JRT A;  2D1V A;  1SMY F;  3QU3 A;  4EM1 A;  2EB7 A;  3LFK A;  3JW4 A;  1W5S A;  1V3F A;  3KP5 A;  1UFM A;  3GEZ A;  2GIV A;  3HSR A;  5K5Q A;  3KEO A;  1BC8 C;  2UXX A;  2GAU A;  4IRG A;  2HYF A;  1FC3 A;  3WOD F;  2EV6 A;  3CUQ B;  1D8J A;  2XAG A;  4LLN A;  3GXO A;  3M9A A;  1LEB A;  1RIO H;  1PP7 U;  4KIC A;  1S29 A;  3H3U A;  3I4P A;  1KQ9 A;  1F1Z A;  2BYV E;  5DV5 A;  1RZ4 A;  1SD4 A;  4GYG A;  2FML A;  2NS0 A;  1IAW A;  5A2Q K;  2DT5 A;  3E6D A;  1KU3 A;  1KYZ A;  4S05 A;  4HAM A;  1XCB A;  1IUY A;  2PN6 A;  2IA2 A;  2PJP A;  3KET A;  2W25 A;  3K1P A;  3Q9V A;  3Q9S A;  3GFL A;  5E8G A;  3SFZ A;  4CZZ A;  1U2W A;  4UVB A;  4HF0 A;  2NAZ A;  3J80 Z;  1XGS A;  3CUQ C;  1HSJ A;  4KN7 X;  1TW3 A;  3HOS A;  3KP2 A;  2B0L A;  2P6T A;  2QQ9 A;  4ZH4 F;  2CG4 A;  4KN4 X;  1BI2 A;  1LDK B;  4YFK F;  3N97 A;  4ZYH A;  1O3T A;  4HV6 A;  3BRO A;  3NRV A;  3ABT A;  2VBW A;  4HOB A;  1SD7 A;  3FXR A;  3L2C A;  4P9U A;  1XGM A;  4Y15 A;  1R5G A;  1I27 A;  2QVO A;  2DQL A;  3ZQ7 A;  1K7A A;  1RNL A;  2Z99 A;  2O6G E;  5HDK A;  4KIF A;  1YG2 A;  3MFK A;  3QAH A;  1STZ A;  1HQC A;  4EMS A;  3K9T A;  4PZJ A;  2ZO4 A;  2IJL A;  4BYY A;  4WWC A;  3KE2 A;  2VT3 A;  1HST A;  3IKV A;  3F6V A;  4HZF A;  4ENJ A;  2A6E F;  3V7S A;  2XVC A;  3O2P E;  4IPA A;  1JGS A;  2P5L C;  1XSV A;  2XHK A;  1U5T A;  2ACJ A;  3I58 A;  2BGC A;  3GFM A;  4CHU A;  5DD4 A;  4AIK A;  2ZFW A;  3HHG A;  5CVU A;  2DAO A;  5HOO A;  2QWW A;  1ZRC A;  3KP4 A;  3QU6 A;  1MJB A;  3RKY A;  2M5W A;  2RKH A;  2P8T A;  4F7Z A;  1R00 A;  4RGX A;  3L09 A;  2XAF A;  5IT3 A;  1LDJ A;  2LSO A;  3TGN A;  3E3V A;  1BIB A;  1HKS A;  3FHZ A;  1FY7 A;  1OMI A;  2R3S A;  2FBH A;  5L3G A;  1YIO A;  1FOK A;  3MZY A;  4EM0 B;  2F5E A;  5CLS A;  2DW4 A;  2IRF G;  2STW A;  1Q1H A;  3WG9 A;  2WV0 A;  2RN7 A;  3LAJ A;  2OZU A;  2KJB A;  3E97 A;  4QWQ A;  2YX4 A;  2XUB A;  3IRQ A;  1JE8 A;  1SMT A;  4IRH A;  1YS7 A;  3ML6 A;  4E70 A;  4EJO A;  5D8K B;  1RUO A;  1LEA A;  3ZPL A;  2VE8 A;  4U0V A;  1T38 A;  3ERE D;  3KFW X;  2ZBK A;  2KIM A;  1FBU A;  4R8H A;  5FLX Z;  3E6C C;  4IJA A;  2C6Y A;  1IXS B;  4I09 A;  2AS5 F;  3EET A;  1SFX A;  1W7P B;  4AWX B;  1KA8 A;  2V79 A;  1QGP A;  1DP7 P;  1Y0U A;  3WE3 A;  1FLI A;  1LDD A;  3KP7 A;  3NQO A;  1X3U A;  4MGR A;  4RB2 C;  2ZCW A;  1ON2 A;  1XMK A;  3FZV A;  2ZME B;  3QRF F;  3I53 A;  2ISY A;  3WTU C;  4HF2 A;  3DXJ F;  4HX8 A;  1QQI A;  2UXN A;  5JVT A;  4MTD A;  3HSE A;  1MGT A;  4OIQ F;  2EFQ A;  2HYG D;  4JQF A;  3DP7 A;  1MD0 A;  5LRR A;  3F6O A;  4G7Z F;  1PDN C;  4YG2 F;  2FA5 A;  4HW0 A;  1T6S A;  1U5T B;  1XGN A;  3HTS B;  2P5V A;  5J6X A;  5FD5 A;  4HDU A;  5L3B A;  4G94 A;  4KA4 A;  1W4M A;  3F23 A;  1REP C;  4HA8 A;  4A5N A;  2K4J A;  1BI1 A;  4UVA A;  2FRH A;  3G3Z A;  2FNP A;  1YW9 A;  4ON0 A;  5LEJ A;  4O6J A;  2GXB A;  1WRJ A;  3QP6 A;  4L9V A;  3TOB A;  2BV6 A;  2QBY A;  2ZNY A;  3LA7 A;  2Z33 A;  2P4W A;  3IWZ A;  3E5U A;  3OV8 A;  4Y17 A;  2GA1 A;  2KJC A;  1Z7U A;  1L3L A;  3WTW C;  3KLO A;  1U5T C;  2WTE A;  1ZG3 A;  1K78 B;  2A61 A;  2Z5U A;  3J80 K;  1D3Y A;  1PP8 F;  4CYD A;  2VON A;  4R79 A;  5LGN A;  1XSX A;  4P9F A;  4MQV A;  2OD5 A;  1R1U A;  3KP6 A;  2DBB A;  1IN7 A;  3P9C A;  4WF2 A;  4IXA A;  1HBX G;  2WWY A;  3GW2 A;  4BHC A;  4HX7 A;  2F2E A;  2ZNZ A;  4IF4 A;  4P55 A;  4OIN F;  3DV8 A;  1ZG1 A;  1K79 A;  3L00 A;  2TDX A;  5ICC A;  3WTT C;  5D5U B;  5BOX A;  2RNJ A;  1ZGA A;  1IN4 A;  2GWR A;  2MC3 A;  1SD5 A;  2JZY A;  3RYP A;  1Z91 A;  2MBF A;  1QNT A;  1KGS A;  4I98 B;  1Z1D A;  1SFU A;  2XIG A;  2VE9 A;  2FXA A;  4ETS A;  3HYI A;  3HTU A;  1OYI A;  3KEQ A;  2L54 A;  1DUX C;  2O8X A;  1D8K A;  1FP1 D;  3MQ0 A;  1G3S A;  5AON A;  2ETH A;  3LAP A;  2P7V B;  5LLQ A;  4PGH A;  2L3D A;  3J7A O;  2CYY A;  4L0Y B;  4ZYD A;  3U1D A;  1YLF A;  3JTG A;  5L3E A;  2H27 A;  1I5Z A;  2NYX A;  4HLY A;  3LST A;  3FMQ A;  1Z6T A;  4RB0 A;  2PFB A;  2V1X A;  1UST A;  2M30 A;  2LNB A;  2G9W A;  4HV5 A;  1S7A A;  2H09 A;  1TNS A;  3RDI A;  1FYK A;  2PLY A;  3TO6 A;  3HRT A;  1T98 A;  5E17 F;  1KYW A;  2IT0 A;  1HKQ A;  2K86 A;  2X4H A;  5FFZ A;  3FMR A;  1CF7 B;  4A6D A;  3TQN A;  4HX4 A;  4GYI A;  1SAX A;  4GXO A;  1IF1 A;  1IRF A;  3I54 A;  3FWE A;  1B9M A;  5HS9 A;  2NRA C;  5JFR A;  1J2X A;  1J5Y A;  3DPL C;  3I0T A;  2HKO A;  3ZMZ A;  3PQK A;  2FE3 A;  1P2F A;  1TTY A;  2JTV A;  3KZZ A;  3MEX A;  2HGC A;  3T5X A;  3GYH X;  2L02 A;  4WK8 F;  4N0B A;  1YO5 C;  2ISZ A;  3ZP5 A;  2K7L A;  5FLX K;  3BP8 A;  3VEP A;  4XLN F;  3WE2 A;  1C0W A;  2ADU A;  3J81 Z;  5LGT A;  1ULY A;  3IWF A;  3BPX A;  5BMZ A;  3L9F A;  4WCG A;  4OMZ A;  2A6H F;  4IRI A;  3P9I A;  3B02 A;  1ZLJ A;  4RGR A;  3IHU A;  3I5U A;  1YTY A;  1G3Y A;  3EUH A;  4AD9 A;  1O3R A;  1ZAR A;  2X0L A;  1F5T A;  3DQV C;  1T0F A;  1RUN A;  3WGI A;  1MJA A;  5DYM A;  1GXQ A;  3I59 B;  1ZG5 A;  2E7W A;  4WXH A;  4A12 A;  1ONV A;  5FGM A;  5DEQ A;  2XV4 S;  3BDD A;  2PMU A;  3HHH A;  5BPD A;  4BHB A;  1FBQ A;  2EFN A;  3GX4 X;  3TDU C;  4LMY A;  1G3T A;  1W7P A;  1VTN C;  1AWC A;  2BEO A;  2GA2 A;  5E20 A;  1B4A A;  1LJ9 A;  1DPR A;  3FXQ A;  2O3F A;  1XB4 A;  2CQK A;  1ZAO A;  2VBZ A;  4L0Z B;  2ZME A;  5D4S A;  2XKP A;  4ZZD A;  3CTA A;  3LQR A;  4L5I A;  2V9V A;  2RGV A;  1EH6 A;  5LHH A;  5CVR A;  3CO7 C;  1R36 A;  2FEZ A;  4XSX F;  4IHS A;  2G7H A;  2JPC A;  1B1B A;  4TV7 A;  1IN8 A;  3M8F A;  1MDM B;  4CXF A;  1YW8 A;  2MLG A;  2HQR A;  4ENK A;  4PDK A;  4FT8 A;  1KU7 A;  3SXY A;  5ILV A;  3ZMT A;  1FSE A;  5CVV A;  3F8B A;  2FQ3 A;  1MJ9 A;  4YFN F;  2KKO A;  3M7G A;  3R6S A;  1XN7 A;  4ZYE A;  1FX7 A;  4GCV A;  4LD5 A;  1WSU A;  2QZ8 A;  1TQI A;  4FX0 A;  5HDG A;  1HW1 A;  2WC2 A;  4LB5 A;  3V8L A;  4AIJ A;  3BJA A;  2RV8 A;  4ZYG A;  3WGG A;  2HS5 A;  4KMU X;  4HDV A;  1W7P D;  1ZLK A;  3H92 A;  2YPR A;  2ZJ2 A;  2XRN A;  3GUD A;  2MA3 A;  2DTR A;  4M9X A;  4EGZ A;  1K78 A;  2DPD A;  2HWV A;  1D5V A;  3V7C A;  3R61 A;  5DDG A;  3V7R A;  3I71 A;  4NB5 A;  1A04 A;  4M72 A;  5ICF A;  2DU9 A;  4DQ2 A;  1OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...