2KIMA

1.7-mm microcryoprobe solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of an O6-methylguanine DNA methyltransferase family protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium target VpR247.
rcsb
source organism Vibrio parahaemolyticus aq3810
molecule tags Transferase
molecule keywords O6-methylguanine-DNA methyltransferase
total genus 27
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kimA00
4Y17A 3HSRA 1SD5A 3PQJA 1KA8A 1R23A 2FEZA 2GXGA 1G3WA 3JSPA 3HTSB 3WE3A 1YS7A 1GHCA 3J81K 3BWGA 2F5EA 2D1VA 2KIMA 3HUGA 2HS5A 4JQFA 1OYIA 1G3YA 4WX9A 5DUIA 3W6KB 3B02A 2K27A 3BZ6A 3EETA 1J9IA 2X0LA 1QNTA 5ILSA 1LQ1A 5H6RA 3I59B 4GGGA 1DPUA 3BJ6A 4EGZA 2O3FA 1BI3A 1JHFA 4RB2C 3CO7C 3QAHA 3KP6A 4A0XA 5ICGA 2GZWA 2Z9OA 1W7PD 3SXYA 2XHKA 1D3YA 3F8MA 5LRRA 4YFNF 5K5RA 2HZTA 2H09A 2DAOA 3O3KA 5E1WA 3RTRA 1G6NA 1V4RA 4MQVA 2HYGD 4RGUA 1EH6A 2BEOA 3BJAA 2EFOA 1B59A 2KRFA 2VONA 2W84A 1IXCA 1F5TA 3RPUA 3IL2A 3J80Z 5JFRA 5DD4A 1B6AA 1FLIA 4YIIA 1DP7P 3HHGA 2XAHA 3ZMDA 2A5YB 4Y13A 2STWA 2QBYA 3BJOA 3LAPA 2OQGA 5LRSA 5H6QA 4KIBA 2VT2A 1REPC 3WTZA 1Y0UA 2H6CA 4XSZF 2MD5A 1MGTA 3ML6A 1KQ0A 4AWXB 3FHZA 3GF2A 2FBHA 4HF2A 4KA4A 1G4DA 2MH2A 4PCQA 3I58A 3LA7A 2M87A 4KDPA 1BJAA 1FBUA 2FSWA 5KK1A 4ETSA 4G6DA 5FGMA 4S05A 3BROA 4YFKF 4HLXA 3NQOA 5EEGA 4BHPA 1SFXA 5E1ZB 3KFWX 1BIAA 1WI9A 2P5VA 2Z33A 1ULYA 1OPCA 3TO6A 1LVAA 1FY7A 2PN6A 3TGNA 5LHHA 2PJPA 2H6BA 4HF0A 2QQ9A 1ZG1A 2HDCA 4AIKA 4A12A 2A61A 3J7AO 1ZGJA 2O03A 3J81Z 2CGPA 4G7HF 4H0EA 5L3GA 3DF8A 4ESJA 2Z99A 2M45A 2KKOA 2HKXA 2EK5A 1BN5A 3O2PE 2VODA 3QU3A 4CYDA 4I0BA 5DDGA 4KN7X 3BPXA 3FZVA 4L18B 3ECHA 3QPTA 5CVUA 5HDKA 5LHIA 4UVAA 5F1RA 2RV8A 1XDSA 5D5VB 3HOTA 3LA3A 4UVBA 1Z6TA 1W5TA 4CXFA 1UB9A 3GFIA 3IWZA 1ZRCA 2W57A 4A0YA 3VOEA 4EJUA 1KQ9A 5DV5A 1VTNC 2VE9A 1I1GA 3I54A 1IN7A 3CUQB 3QP6A 3CUOA 2E7XA 2NNYA 2XV4S 1FYLA 1TLHB 4WWCA 4WXHA 4GCVA 2FU4A 1HQCA 1KYWA 2X4HA 2EJRA 4UXNA 3I71A 4LLLA 1STZA 4M6XA 4R1HA 2TDXA 4HX8A 4MQ9F 3FXUA 2A6EF 4OIPF 1ZG5A 1B9NA 1OMIA 3GXOA 4IRGA 4MHGA 2V1UA 2P5KA 1J5YA 3KETA 4OIOF 4BQAA 2PI0A 1YO5C 5IT9K 4XSXF 1FZPB 3DP7A 1U6GA 4EV0A 1QBJA 1C0WA 5CVRA 2HWVA 1IRGA 5D4RA 3M9AA 1ZHFA 2K86A 1XDUA 1Z1DA 3MWMA 5FFXA 3FM5A 1DPRA 2MA3A 4LLNA 4M71A 1UHMA 1PP7U 1LB2A 3DPTA 5L3EA 4G7OF 3S2WA 1FNNA 2QQAA 4ON0A 4WXDA 1R5GA 1USSA 5JR3A 3ZN0A 1P6RA 4WCGA 1IW7F 4G6QA 3F21A 5E18F 1XGOA 2P6TA 1GXQA 1HW5A 3N97A 4O3MA 1TQIA 2DTRA 1GVJA 1XD7A 1U5TC 5CLSA 1XB4A 4P5OA 3GW2A 1NHAA 1W5SA 2H27A 1SMTA 1SFEA 5JHUA 1MJ9A 2HOEA 1AOYA 2AS5F 3E3VA 1W7PB 1QZZA 1R36A 4JBAA 3TDUC 1J0RA 2GIVA 4U7BA 3WU1B 2EWNA 3GFMA 1BBYA 1P4XA 1SD6A 1BM9A 4MEYF 3TQNA 4HOBA 4ENKA 1I6XA 5HOOA 2EA2A 3BOQA 3E6MA 5HS8A 1FYKA 2D45A 4DQ2A 3P9IA 4L9NA 4HX4A 5LGUA 1OYWA 1SD7A 4PDKA 1V3FA 2Q8KA 1O57A 3DQVC 2Q0OA 2ESNA 1B4AA 2IVMA 1KU7A 1IF1A 1Z91A 1W7PA 4LG0B 3E6BA 2RGVA 2EV5A 3D0SA 4XRFA 3I4PA 1XN7A 3RYPA 5F6FA 4OINF 3ZMSA 3QPHA 4I02A 5A2QZ 4A5NA 3RYRA 4NQWA 4G94A 2JRTA 2E1CA 3FX3A 2MBFA 3GFLA 3T8TA 2OQRA 1MZBA 5L3DA 2XKOA 3G73A 3TOBA 3RPQA 5LGNA 3BP8A 2O0YA 4M74A 4ENJA 2FF4A 5DYMA 4M73A 1JGSA 5CVJA 3IC7A 4XBFA 2LSOA 5BQTA 3H3UA 1HSJA 2VOOA 1FSEA 3GO5A 5DCMB 2DW4A 6PAXA 2QLZA 1BC7C 2J5OA 3KP4A 1I5ZA 2VBXA 4OMZA 1R1UA 3ZMUA 3MEXA 1QGPA 3WGGA 2PLYA 3WODF 2W24A 3DPLC 3MAJA 3GYHX 2RN7A 1TNTA 3Q9VA 2M1BA 3FWEA 1WWXA 4FX0A 2W25A 1CGPA 1U5TA 3E97A 4KFCA 1LNWA 1SMYF 1XSVA 1BI0A 5BS6A 1K78A 4WXCA 2GWRA 5FD6A 2IW5A 1LJ9A 4ASNA 4N9HA 2EA4A 3DV8A 2XGXA 2COMA 3GVAA 3TO7A 3HOSA 1QO0D 3F6VA 3WTVC 4L9VA 3KP2A 5KVRA 5F64A 3JTGA 1BI1A 1ON1A 3QOPA 5BMZA 2QYOA 4UVCA 1YW9A 2ZXJA 3WTSC 2V1DA 5E17F 2IP2A 4QWQA 1DUXC 4ENNA 2HEOA 2EB7A 3HSEA 3K0LA 4I01A 4NB5A 3ISPA 1TW2A 4RS8A 2CW0F 1IXSB 1XSXA 2NS0A 1YQAA 1FP2A 1T39A 3ERED 4Y15A 2KIFA 3F8NA 4UHTA 1FWZA 5DCFA 2F5FA 2UWMA 3TKYA 4ESFA 2H94A 2J5PA 4M6YA 2PQ8A 1QZYA 4LLGF 2PBIA 2JTVA 2FBIA 2B0LA 2LKPA 1L0OC 2QM3A 3WGIA 3IRRA 3R6SA 3TDZC 5HDGA 4CDGA 1KYZA 2IA1A 4BXUA 5EEHA 4I98B 3SZTA 5JI6A 4P55A 4MTDA 3H92A 3LAJA 1FX7A 2RC4A 4HV6A 2DPDA 4LB6B 2XAFA 4LGWA 2IJLA 3CTAA 4F7ZA 3NEUA 4M9ZA 3HYIA 2DT5A 3M1EA 5ICCA 3EYYA 3WU0A 1LEAA 1R1VA 3RIRA 1R58A 4LB5A 1Z05A 2V6CA 1KU3A 3H3ZA 2RVCA 1K78B 2DLLA 1IN6A 1K7AA 4A5MA 4YFXF 2XAJA 1RNLA 3R4KA 4PGGA 2STTA 2DFIA 2P7VB 1MKMA 4LK0F 5HS7A 1HW2A 2P7CB 2HTSA 2M5WA 3SFZA 3RJPA 4XLPF 1IN8A 4O6JA 1Q1HA 1U78A 1LDDA 3M8FA 2F2EA 2FMLA 1HKTA 2VE8A 2PEXA 2RKHA 3F8CA 1BIBA 3U9GA 5J6XA 2UXXA 4L0ZB 3VODA 1XMKA 2EFWA 3LFKA 1QPMA 2DK8A 3TOAA 4CHUA 3FMRA 5L3BA 4BYYA 1I27A 2Y48A 1O7LA 2K4JA 1WKMA 2ZBKA 3KZYA 3V7RA 1DDNA 3HRMA 1X3UA 5HLHA 1FP1D 1ON2A 2JPCA 3N4MA 3IKVA 2FE3A 1ZN2A 3CO6C 1K79A 2QZ8A 3EUHA 3ZQ7A 4KIFA 3Q5FA 4I0AA 4BHBA 4EM2A 4HF1A 2Q2EA 3MQ0A 1I1SA 4Z2YA 5ICFA 2YR2A 2ISYA 2ETHA 1FT9A 4IPAA 3KLOA 2L02A 3ABTA 4K2EA 4L0YB 4LG0A 2A6HF 4ZYDA 4ZZDA 2WWYA 3LSTA 2M30A 3EDPA 3KE2A 4RGXA 3ROUA 1WSUA 2K02A 2HTJA 4B09A 2EFNA 4FT8A 4CO8A 2DK5A 2WV0A 4ZZLA 4BAYA 3L09A 3WTXC 2CWEA 5ERIA 2LNBA 3P7NA 2RDPA 5AIPA 1RI7A 3SZPA 2DPUA 2ESHA 2VBYA 4BHCA 2XIGA 5CJ9A 5D6FA 1MDMA 3SHFA 5FB2A 4KN4X 3PQKA 2V79A 2BGCA 1TW3A 4HDUA 1OR7A 3K1PA 3CUQA 1O3TA 4KICA 3KP3A 3BY6A 5D5XB 1F4KA 1Z7UA 4IHSA 2CQKA 2FRHA 4U0YA 2A3SA 4A0ZA 2OU2A 2VOPA 2BYVE 1ZG3A 1FSHA 2BV6A 1ZREA 3JAMK 2C6YA 3Q9SA 4IXAA 4L9TA 2R3SA 4EQQA 2ZCWA 3E6CC 1YFHA 1E17A 3DXJF 3KP5A 5LLQA 3ULQB 2MLGA 1USTA 1OYYA 1SFUA 2JPBA 3U2RA 3ZP5A 5IT9Z 5BPIA 1T98A 3KEQA 1YLFA 4GYGA 1P2FA 3PFIA 4EM0B 4EJOA 4U88A 4HDVA 1OKRA 1TQMA 2ZFWA 3R61A 2YU3A 4P96A 5ICEA 2YX4A 5LGTA 3JAMZ 1YIOA 4CICA 1KGSA 3HTUA 4P9UA 2OBPA 1Z9CA 3V8KA 1G3TA 3HHHA 4AVPA 4IRHA 3HSFA 1G3SA 3IHUA 1ONVA 1A04A 5D8KB 4CZZA 1HW1A 3C3WA 3P9KA 3GUDA 4DNCA 1R7JA 1T38A 3JTHA 4OMYA 1JXSA 5FLXZ 4G9YA 2FMYA 1RIOH 3GLXA 3FXRA 5FFZA 2G9WA 2G7UA 2A68F 5D4SA 4HQEA 2M8EA 5HVQC 1IXRC 2XAQA 2YSRA 3WE2A 4HV5A 1J59A 4OIQF 4PGHA 4IF4A 1MJAA 3O6BB 1FPQA 2FQ3A 3KZZA 4M72A 5H20A 1Z6RA 5IT3A 4N9IA 2G7HA 3RKXA 3K69A 4YIFA 3HRUA 2D2WA 4Q47A 4YG2F 1S29A 1ZRFA 3REOA 1RUNA 3WTTC 1YYVA 4I7HA 1TBXA 4KMFA 2P6SA 3K1MA 3GFJA 2QBYB 4RGSA 1K6OA 1HKSA 3RDIA 2IA2A 5L3CA 4MTEA 1H9TA 3MCZA 4QLCU 3DFGA 2P4WA 5D5WB 1ODDA 3FM3A 3BPVA 1EV7A 4EJTA 4JK1X 2F5DA 2OA4A 3RKYA 1UHWA 1T2KA 4RAYA 1R1TA 4AIJA 2QQBA 3HIFA 1U2WA 3KCCA 3MZHA 3E5QA 2ISZA 2K7LA 2PFBA 3L9FA 1D5VA 2EV0A 3HRSA 4HYEA 2DO7A 3GEZA 1B9MA 2IRFG 1XGMA 2ZJ2A 2LF8A 1O7FA 3F8FA 3I59A 2A69F 5E8IA 1CF7A 4AD9A 2VBZA 4MNUA 3C7JA 3T8RA 4WK8F 3COAC 4MGRA 2Y75A 3CLOA 2LF7A 1P4WA 1FBSA 4Q4ZF 4Q5SF 4HA8A 3W6JB 5DD8A 5K1YA 5LEJA 3DKWA 2XVCA 1T0FA 4KMUX 4KIGA 3E5XA 4S04A 5LBQA 3B73A 2XRNA 1RZ4A 1U3EM 1ZYRF 2PMUA 2NNNA 2VBWA 1O3QA 4ZYHA 3T1BA 5HS9A 3ECOA 2ZMEA 1H9GA 4EMSA 1S6LA 4L5JA 1TTYA 2E7WA 3JSOA 1ZGAA 3C1DA 4GO1A 5D8LB 3WG9A 1J2XA 3QU6A 4KUMA 3GZ5A 2VC0A 4U0WA 3GX4X 2GAUA 2Y0MA 4BH9A 1IUYA 4LMYA 2DI3A 2OZ6A 4AIHA 2R7DA 2FOKA 1T6SA 2L01A 3WTUC 2JZYA 1L3LA 3QP5A 4GXOA 5E8GA 3SQNA 2ZO4A 2FNAA 4KT5C 3L00A 5FO5A 5D6EA 2FNPA 2WTEA 3MFKA 2L54A 4GYIA 3CJNA 1FYMA 3R0JA 2BBYA 3EQLF 2E1NA 2UXNA 3FMQA 4LD5A 3U1DA 2UZKA 5E1XA 1JE8A 4KNYA 3AAFA 4B8XA 3VFZA 2GA1A 2DQLA 4HBLA 1EH8A 1EH7A 2YX7A 3JW4A 2BE5F 1U8RA 2ZNYA 3WGHA 3P9CA 4WF2A 1W4MA 1ZLKA 2EV6A 2FA5A 1HXDA 4HLYA 2W85A 3K2ZA 4M9XA 4CGZA 3BDDA 5HDNA 2IA0A 4MEXF 3I0TA 1MJBA 3KP7A 3TO9A 2FXAA 3I5UA 3OOPA 1XCVA 1JHHA 1IRFA 2ACJA 5CYVA 1FBQA 3LA2A 3R0AA 5J8CA 1YTYA 4TV7A 4PZJA 2DQRA 1XCBA 2QWWA 1IZ1A 3V8JA 3M8EA 2HR3A 1YW7A 1SD4A 1YG2A 2MH9A 1F9NA 3G3ZA 3NRVA 5ILVA 5TRDA 1MD0A 2NAZA 4LK1F 1XSDA 2HFHA 3I64A 4OU0A 2PMHA 1TNSA 3K1NA 3D5LA 2O61A 4XLNF 1ZARA 5JVTA 5BOXA 3FF5A 2OD5A 3EYIA 4IJAA 1IAWA 1IN4A 2KJBA 2RNJA 1S7OA 3T0YA 4UUVA 4RAZA 3OV8A 2NYXA 4U7DA 1PUEE 1ZAOA 4E70A 1UCRA 4OOIA 3ZMTA 1P92A 2VC1A 2HGCA 2D1HA 3LQQA 2PG4A 1J75A 5CVIA 3T5XA 1J7KA 2VT3A 3V8LA 5A2QK 4HQMA 1PP8F 2MC3A 4EJWA 2EFPA 5TJJA 5D5UB 5HLIA 3RKWA 4EVIA 4UNOA 4FX4A 2ELHA 3GWZA 1AWCA 4UV9A 1WRJA 3K9TA 3ZMVA 1O3SA 3V7CA 2QVOA 4A6DA 1O3RA 4A2UA 4M9SA 3HRTA 1LDJA 4D0PA 3GZ6A 2KJCA 4HW0A 2GXBA 2A07F 1RUOA 2XAGA 1S8NA 4L5IA 2IPQX 3ZN1A 4LJZF 4KYWA 3V7SA 2MLKA 2P5LC 2ZNZA 1F1ZA 3IWFA 4HX7A 1IN5A 1CF7B 1XGSA 4EGYA 2FBKA 3KLNA 2Z5UA 4FHTA 1MDMB 4I09A 3E6DA 5DEQA 2OZUA 3ELKA 3IRQA 2WC2A 3FXQA 2VXZA 2JT1A 2CO5A 4HZFA 1GXPA 3F23A 3QRFF 2RQPA 2EFQA 2XASA 4R8HA 5K5QA 2CYYA 3MZYA 2ADUA 3V4GA 2XROA 2VN2A 3F6OA 2XUBA 2HQNA 3L2CA 3VEPA 4EJVA 1LDKB 1LEBA 3RI4A 2Z3YA 3F22A 4IVNA 5E20A 2OAZA 2YPRA 2O6GE 3C18A 2QENA 4L9JA 2HKOA 2L4MA 3F3XA 2AXLA 1BOAA 1YS6A 4BNCA 1U5TB 1D8KA 5L3FA 3R60A 4IHTA 1WQ2A 1H0MA 1B1BA 2V1XA 5HLGA 2LDUA 2R7FA 4A6EA 3ZPLA 4ESBA 4EM1A 1SAXA 3L7WA 3M7GA 2K4BA 2F5CA 4ZYEA 3WTWC 4P9FA 5K5OA 3WTYC 2ZKZA 5DCMA 1YW8A 1BC8C 1HSTA 3E5UA 4RB3C 5J8FA 3F8BA 4OIRF 1QQIA 1R22A 1D8JA 4RB1A 2ZMEB 1HBXG 2CFXA 3LWFA 1KU2A 3DEUA 1PDNC 1KQ8A 1ZRDA 5ED4A 3ABUA 4G7ZF 4ZH4F 2L3DA 5AONA 1S7AA 4NHJA 4ZYGA 4O5VA 5AIQA 1TQPA 1ZLJA 2CG4A 1FC3A 2DBBA 1BI2A 2GQQA 2P8TA 1UFMA 1XMAA 3FMSA 2HQRA 4IRIA 5ILUA 3IKTA 2CSOA 3J80K 4RB0A 2V9VA 4ENMA 5LEKA 3KEOA 1S3JA 2IT0A 1ZH5A 5FLXK 5BPDA 3F72A 1P4AA 1E2XA 5CVVA 3CDHA 4RGRA 1KU9A 2HYFA 1XGNA 4U0VA 3LQRA 4UV8A 4G8XA 4Q48A 5DUKA 4N0BA 3ZMZA 4HAMA 1R5HA 3VB2A 2QUFA 4LFUA 5FD5A 2O8XA 1HKQA 1FOKA 3I53A 1R00A 2XKPA 4I2OA 2KIUA 2L4AA 3CUQC 5LHGA 4R79A 2GA2A 2NRAC 2JSCA 2DU9A
chains in the Genus database with same CATH superfamily
2A05A 2LY2A 2ELKA 2IAIA 4Y17A 3HSRA 2DOEA 2QEXI 1SD5A 3PQJA 4XK4A 3U21A 1SVLA 1KA8A 1R23A 2B7EA 3PNTA 5J3LA 2FEZA 2GXGA 2M0CA 1G3WA 3JSPA 3HTSB 3WE3A 1YS7A 1GHCA 2E19A 2XPWA 5CQGA 3J81K 2DFHA 3BWGA 2F5EA 2D1VA 2KIMA 3HUGA 2HS5A 5IPAA 1ZK8A 2WAQN 4JQFA 1OYIA 3KIOA 1G3YA 2M0MA 3PSIA 4WX9A 5DUIA 3W6KB 3HXLA 3B02A 4XN0A 2K27A 3BZ6A 2VQHA 3EETA 1J9IA 1UG2A 2X0LA 1QNTA 2M4GA 5ILSA 1YJ9I 1LQ1A 1G59A 1Y39A 5H6RA 3I59B 2HNHA 4GGGA 2JN6A 1IGNA 1DPUA 3BJ6A 2BY3A 2KT0A 3Q0VA 2X1EA 2E1MC 1V5FA 3OYMA 4HNUA 4EGZA 5J40A 2O3FA 1BI3A 1JHFA 4RB2C 1GV2A 3CO7C 2I8DA 3QAHA 2BHYA 1JI8A 2V26A 3KP6A 4E7SA 4A0XA 5ICGA 2M4KA 3OYKA 2GZWA 4C3JJ 5IYDJ 2Z9OA 2R4GA 1W7PD 3SXYA 3CJRB 2KISA 2XHKA 4NBQA 3CC7I 4FQGA 1D3YA 3F8MA 3NWTA 5LRRA 3DPUA 1R9TJ 2MGQA 2ECCA 2HZTA 4YFNF 2H09A 2DAOA 3HGGA 5K5RA 1V5EA 3O3KA 2WY7Q 3CP8A 5E1WA 2COBA 3RTRA 1G6NA 1V4RA 2QF7A 4MQVA 2N8GA 4MLOA 2HYGD 2OPTA 4RGUA 4F92B 1YOVB 1YIJI 1EH6A 2BEOA 3BJAA 2EFOA 1B59A 4PJNA 3A01B 2KRFA 2VONA 2ZXHA 1JTYA 2W84A 1IXCA 1F5TA 2K9QA 3RPUA 5FLVA 3KYCB 3IL2A 2L7FP 3J80Z 2V1NA 5JFRA 5DD4A 1LUJB 1B6AA 1IRZA 1JKOC 1UG0A 3I55I 1A6IA 3CMEI 4YIIA 2IS2A 1FLIA 1DP7P 3HHGA 3FDYA 2XAHA 4ZC3A 2WAFA 3ZMDA 2EQRA 2A5YB 4Y13A 2STWA 4II2A 2QBYA 1BL0A 3BJOA 3LSIA 3LAPA 2OQGA 5EZHA 5H6QA 5LRSA 1LFBA 4KIBA 2VT2A 1REPC 3WTZA 1FMWA 1W5CC 1Y0UA 3OS0A 2CQNA 4DYRA 2H6CA 1WPKA 4XSZF 4BEHA 2E5NA 1MGTA 2MD5A 3ML6A 1KQ0A 4AWXB 2QCOA 2VB6A 3SFIA 5FROA 1T56A 3FHZA 3GF2A 1X4PA 1WJEA 2FBHA 2DA6A 1LE8A 4HF2A 4KA4A 5B1AH 3S2DJ 1BA5A 1G4DA 2IXSA 3ABKH 2WV1A 2MH2A 2X1DA 4PCQA 3I58A 3GTGJ 3GLLA 3QODA 3LA7A 2M87A 5LFAA 1VQKI 4B4CA 3S3NA 3CF2A 3H0DA 1TC3C 2JA5J 4KDPA 1BJAA 1FBUA 2FSWA 5KK1A 3LNQA 4ETSA 4G6DA 2WB1N 3I9V2 2M34A 1YHQI 1Y8QB 2X6WA 5FGMA 4S05A 3JRIA 3BROA 4B3AA 4YFKF 2KFDA 4HLXA 3HDDA 1H89C 3BTLA 3CF5F 1SEUA 3NQOA 5EEGA 4FE4A 4BHPA 2XF5A 2XC7A 1D5YA 1SFXA 2A5WA 2CW7A 5E1ZB 1BW5A 3KFWX 4XR6A 3M4OJ 3L2RA 1Y56A 1DU0A 3A0BC 1BIAA 2X6XA 1T33A 1WI9A 2P5VA 2Z33A 1MBGA 3S3OA 1ULYA 4BUPA 1OPCA 3KX2A 1H88C 3TO6A 3BQZA 3K4JA 4Y7NJ 1LVAA 1FY7A 2PN6A 2QA4I 4FASD 3TGNA 3K4MA 1VQ8I 3QPSA 1DU6A 5M5XJ 5LHHA 2PJPA 2H6BA 4E4HA 2CRGA 4ZTFA 2E60A 4HF0A 1HDDC 2QQ9A 2R7QA 1ZG1A 2HDCA 4AIKA 4A12A 1WH7A 2A61A 4UUTA 2XB5A 4Y4RA 3SEQA 4D1QA 2X51A 4CSWA 3BG9A 3J7AO 5LD2C 1ZGJA 2O03A 3J81Z 2CGPA 4G7HF 4W97A 3EUHC 5FKNA 4H0EA 4E7IA 5L3GA 3DF8A 3HKZA 5IP7J 1FOXA 4ESJA 2X9DA 2Z99A 3S1RJ 3GTLJ 2LY1A 2M45A 2VL8A 3BZCA 1GT0C 2KKOA 2HKXA 3HBLA 2EK5A 1BN5A 2PMZN 3O2PE 2KMUA 4C2UA 2VODA 3QU3A 4CYDA 3OWTA 3S8PA 4ZYAA 1VQ5I 4I0BA 2W1OA 3UR3C 5DDGA 3K4KA 4KN7X 3BPXA 3FZVA 5JLWA 4L18B 3ECHA 3QPTA 4CYCA 5CVUA 2OC6A 5HDKA 1IDYA 4BGDA 3V42A 5LHIA 1XMXA 4UVAA 5F1RA 3W3CA 2RV8A 1XDSA 5D5VB 3HOTA 4A3IJ 3BLYA 3LA3A 4UVBA 1GDTA 1Z6TA 2CUEA 3ONQA 1HDPA 1W5TA 4BQOA 4CXFA 1UB9A 2JSPA 5M5YJ 3GFIA 3BR1A 2KPMA 3IWZA 1ZRCA 2H1KA 2W57A 4A0YA 3VOEA 3HJEA 1TWCJ 4EJUA 3A2KA 3Q3SA 4A3GJ 1KQ9A 5DV5A 1VTNC 2VE9A 1I1GA 3I54A 1IN7A 2GOMA 3HL2A 1FMVA 3FKJA 5HNFA 3CUQB 2NOGA 3QP6A 1ETOA 4XLFA 1Z67A 4E7LA 2UV1A 4D5CA 3CUOA 2VASA 4M3EA 2E7XA 2NNYA 2XV4S 1FYLA 4CCMA 1TLHB 3A4CA 4WWCA 4WXHA 2E2IJ 2JJ7A 4BXXJ 1P7IA 3GMEA 4GCVA 2L7KA 2FU4A 4ZJZA 1HQCA 4GDFA 2JA2A 1ZQ3P 1T08B 4FETA 1KYWA 1OCZH 4BY1J 2X4HA 2FD5A 2EJRA 4UXNA 3I71A 1K83J 4LLLA 5F08A 4M6VA 1STZA 4M6XA 1B8IB 4R1HA 2TDXA 4HX8A 4BDZA 4MQ9F 3FXUA 2A6EF 2HI3A 4XIDA 4OIPF 2JA8J 4PJJA 1QVUA 3G71I 2ZSIB 2DMUA 1ZG5A 1VQLI 4DIQA 2IGMA 3KYDB 1B9NA 1OMIA 1X1DA 3GXOA 1V54H 2XPUA 4QSHA 4IRGA 4MHGA 1WZ2A 2V1UA 2P5KA 4DYQA 1Z3XA 1J5YA 3KETA 3RZOJ 4HRIA 1TT0A 4OIOF 2HQ5A 1JUPA 4BQAA 2PI0A 1YRNB 2R7ZJ 2CUJA 2R93J 1YO5C 5IT9K 3HB9A 1OCRH 3H5RA 4XSXF 4IKFA 1R49A 1FZPB 3BCAA 3DP7A 3KYLA 1U6GA 4EV0A 1QBJA 1C0WA 2F4MB 1FIPA 5CVRA 2BW3A 2HWVA 3H5AA 1IRGA 5D4RA 1XG1A 3O8HA 3M9AA 1ZHFA 2Q2EB 5DTDA 2K86A 2R7VA 1XDUA 2OTJI 1Z1DA 3MWMA 1W36D 5FFXA 1T0FC 3FM5A 3OIQA 1DPRA 3NWSA 2V4JC 3H0GJ 2DTZA 3H9JA 5BNGA 1OISA 1ZR2A 1BOBA 3FXKA 2MA3A 4LLNA 4M71A 1UHMA 4ZDLA 5C4XJ 4JOMA 1DGWY 3MZ8A 1PP7U 1LB2A 2LH9A 1OFCX 3DPTA 1F43A 5L3EA 1WJ5A 4BDYA 4G7OF 2KL4A 4I99C 5GTHC 2KZVA 2LC2A 3SZGA 4B1RA 5E3NA 3S2WA 1FNNA 2QQAA 4ON0A 2ZFUA 2LYCA 4RM3A 3VYTB 3CJTB 1GV5A 1OCOH 3K4LA 4WXDA 1R5GA 3TEDA 1USSA 2WA0A 2XRLA 2CS3A 3LMMA 3OL3A 5JR3A 3ZN0A 1P6RA 5K7ZA 2K85A 4E7JA 4WCGA 1IW7F 2VIXA 4G6QA 3F21A 4IZZA 5E18F 1M1EB 1XGOA 2R7UA 1MH3A 1BJZA 1PYVA 2KQRA 3LFUA 2P6TA 1GXQA 1HW5A 2MW8A 3N97A 3M07A 1TQIA 4O3MA 2DTRA 1IDZA 1GVJA 1XD7A 1U5TC 3S1NJ 5CLSA 1XB4A 4E6KG 4P5OA 4P1WA 3GW2A 1NHAA 2AQFA 2K5CA 4AM3A 1W5SA 4AVZA 2H27A 4ZDPA 1SMTA 1SFEA 5JHUA 2JRMA 1IRXA 3BR5A 1MJ9A 2HOEA 2QSHX 2R7SA 3BG3A 4CZCA 2V6EA 4X1EA 3BTIA 1AOYA 2AS5F 2OV7A 1P7JA 3FK6A 3E3VA 4IO9F 1W7PB 5IP6A 1QZZA 1R36A 4JBAA 2XB0X 3ZXSA 3G1LA 3TDUC 1J0RA 1YX5A 4PJ0C 2GIVA 1WH5A 2L9NA 3RKQA 4U7BA 3DTEA 1WJCA 2DODA 3WU1B 3J7AY 1H8AC 3UNGC 3CP2A 3UKGA 2EWNA 3GFMA 1NG6A 1BBYA 1P4XA 1SD6A 1BM9A 4MEYF 4XNFA 4I76A 3TQNA 4RDUA 4HOBA 4C3HJ 4ENKA 1I6XA 5HOOA 2EA2A 3JRBA 1X1BA 3JRFA 2ZJRF 1HA8A 3DLAA 3BOQA 3E6MA 5HS8A 1FYKA 2D45A 4DQ2A 4DYCA 3P9IA 4L9NA 2BZTA 3KPHA 4HX4A 4V2FA 1PUFA 1WFXA 5LGUA 4J19A 2WADA 4IL6C 2CMPA 1VQ6I 1OYWA 1SD7A 4PDKA 1AU7A 1J09A 1V3FA 2MABA 3ZRGA 2Q8KA 1O57A 4BE2A 3DQVC 1AA7A 2Q0OA 2TRTA 3I3LA 2ESNA 1B4AA 2IVMA 3GCMA 1KU7A 2VKVA 1IF1A 2CV0A 2M7BA 2W00A 2HXOA 2MYSA 1Z91A 1W7PA 4L5EA 4LG0B 3E6BA 2RGVA 2EV5A 3D0SA 4BU2A 4LIVA 4X6AJ 4XRFA 1PJRA 5CQEA 3I4PA 1XN7A 3RYPA 5F6FA 4OINF 2L9RA 3ZMSA 3O8GA 3PL8A 2VQGA 4Y3OA 1SANA 3QPHA 2ZJPF 4A3BJ 4DOZA 4I02A 5A2QZ 4A5NA 3RYRA 4NQWA 5EG0B 2GBYA 4G94A 2JRTA 2E1CA 3FX3A 2MBFA 3GFLA 3T8TA 2OQRA 1MZBA 2A6TA 2FUG2 5L3DA 3BTJA 4PFPA 1V5GA 2XKOA 4DBRA 1R4NB 2F4OB 2HDWA 3G73A 3TOBA 3RPQA 2XGEA 4QPOA 5LGNA 3RSNA 2JWTA 3BP8A 2O0YA 3K4BA 4BS9A 2XGDA 1D0ZA 3LSKA 4M74A 4ENJA 1WGXA 2L0KA 4UUSB 1VQPI 1MMDA 2FF4A 5HLTA 5DYMA 4M73A 2Y9YA 1RR8C 1JT0A 1JGSA 4KISA 2RREA 5CVJA 3FXLA 3IC7A 4BY7J 5GPCA 1RRJA 4XBFA 1HC8A 2XAUA 2LSOA 2DA1A 4CCKA 3JRHA 2E5ZA 5BQTA 2W82A 3H3UA 1HSJA 2O5RA 2LRDA 2VOOA 5IOZA 1FSEA 2K9MA 3BG7A 3GO5A 2OUMA 4II3A 3AL0C 2PX9A 5EJCA 3OY9A 5DCMB 2DW4A 2WY8Q 6PAXA 3WG7H 4C3IJ 2QLZA 1BC7C 5FRNA 2J5OA 1JJ6C 3KP4A 4ANJA 3H1CA 1MNDA 5JHFA 1I5ZA 2VBXA 4JX4A 4OMZA 1R1UA 3ZMUA 2JQ7A 3MEXA 1QGPA 3WGGA 4CUGA 2PLYA 3C2GA 3WODF 2W24A 1DGRM 3DPLC 3MAJA 3D5SC 3GYHX 3RQ4A 2RN7A 2NOJB 1TNTA 4HSRA 4PK4A 5TISC 3Q9VA 5E3MA 4J00A 2VPRA 3ASNH 2M1BA 3FWEA 4C2TA 1WWXA 4FX0A 1WHUA 5EG0A 2W25A 3ZQHA 4LG3A 1CGPA 1U5TA 3E97A 2ZXIA 4KFCA 2IGOA 1LNWA 1LPQA 2E1OA 3TMOA 1SMYF 1PVEA 1XSVA 3OR1C 1F36A 1BI0A 4QTRA 3PJRA 3EUAA 5DM6F 1BW6A 5BS6A 1ZGWA 3C2BA 1K78A 4WXCA 4DBQA 2GWRA 5FD6A 3MKWB 4M3BA 2IW5A 1LJ9A 4ASNA 3KEYA 2BHZA 4N9HA 2EA4A 4XOPA 3DV8A 4IHVA 2XGXA 2BOLA 2EZLA 2COMA 3H3VK 4IQJA 1NTCA 1Q1VA 3GVAA 3A03A 4IEJA 5J1RA 2CH0A 3TO7A 3HOSA 1MMGA 1Z7LA 1QO0D 2Y0SN 3BC8A 2VPLA 3F6VA 2P0WA 3WTVC 1W0UA 4L9VA 3KP2A 1VFCA 5KVRA 5F64A 2LLKA 2VKEA 4D7MA 1BI1A 2DYSH 3JTGA 1ON1A 4W1UA 1X3WB 1YX3A 4UB8C 3QOPA 5BMZA 2QYOA 2WB1A 4UVCA 1YW9A 3OIOA 4PSXA 2E2HJ 4CCNA 2ZXJA 3WTSC 2V1DA 5E17F 2IP2A 4BBSJ 4KJZA 4QWQA 2DCEA 2DYRH 3CCSI 3S15J 1DUXC 3SJMA 4ENNA 2HEOA 2EB7A 3OYGA 3HSEA 3K0LA 2ID6A 4I01A 4NB5A 3ISPA 3VYRB 2K40A 1TW2A 4RS8A 2LTPA 2CW0F 1IXSB 1ERDA 3S93A 2KIQA 2Y2ZA 3H5NA 4A3KJ 1XSXA 2BVLA 2DJIA 2NS0A 1FEXA 1YQAA 2LK2A 1FP2A 1T39A 3ERED 1WI3A 4DJAA 4Y15A 3CQZJ 2D5VA 4OAYA 2EZIA 2XSDC 2KIFA 3F8NA 3W6VA 2DJNA 4UHTA 1QZEA 4GRIA 1VQMI 1FWZA 5DCFA 4RBOA 2F5FA 2UWMA 4MIMA 3Q0UA 3RCOA 3TKYA 4ESFA 1VF9A 2H94A 2J5PA 3AG1H 4M6YA 3WHBA 2PQ8A 3JRGA 1QZYA 2VQLA 3NARA 3HKZN 1IV6A 4LLGF 2PBIA 2JTVA 2FBIA 1Y6IA 2VXDA 2ICWG 3OR2C 2LY9A 2AHQA 2B0LA 2LKPA 1L0OC 2QM3A 5F0CA 3GTKJ 3CJQB 3WGIA 3HPHA 1S7EA 3K6GA 3OYBA 3IRRA 3DBHB 2NVXJ 3K10A 3RZDJ 5F04A 5IYCJ 3DEEA 3R6SA 3TDZC 5HDGA 4CDGA 5DM7F 2I5UA 1KYZA 5J47A 2HDDA 1E0EA 4CH7A 4BL0B 3HOVJ 3ABMH 2IA1A 4BXUA 1FIAA 3DTIA 4XKVA 5EEHA 4I98B 3SZTA 3CLQA 2VI6A 5JI6A 4P55A 4MTDA 3H92A 3BZKA 3LAJA 1FX7A 4KITB 1QRYA 4AIDA 4RLFA 2RC4A 4I6ZA 2WBMA 4YELA 5FKLA 4HV6A 2DPDA 2M8GX 3DU5A 2R0QC 4LB6B 2XAFA 4LGWA 3CTAA 2IJLA 2DMPA 4F7ZA 2DMTA 3NEUA 3HYIA 4M9ZA 2DT5A 1AHDP 3M1EA 2DA5A 5ICCA 3EYYA 3S16J 3ERMA 3WU0A 3HEFA 1LEAA 1BR4A 1R1VA 2HPIA 2E36A 3RIRA 1HLVA 4A93J 1R58A 4LB5A 4UB6C 4DGWB 2B63J 1Z05A 2V6CA 3K70D 4BE1A 3CCRI 1KU3A 2M9HA 3H3ZA 2NXNB 3PFYA 2EINH 2RVCA 1K78B 2DLLA 2MC4A 1LFPA 1IN6A 2BW3B 1GUUA 4YRVA 3ZQLA 1K7AA 1OLTA 3Q0WA 4A5MA 4YFXF 2XAJA 2BXZA 1RNLA 3R4KA 2R92J 4PGGA 2STTA 3K2AA 2DFIA 2P7VB 1MKMA 4HSTA 4LK0F 1XPXA 2XPVA 3SDBA 3OYCA 1MW7A 5HS7A 1HW2A 2P7CB 3HC7A 2HTSA 2M5WA 1X4OA 3SFZA 2CUZA 2MD0A 2X6YA 4MO7A 3RJPA 4XLPF 4G6TB 1IN8A 4O6JA 1Q1HA 3VSLA 1LDDA 1U78A 3M8FA 2F2EA 2LG4A 2FMLA 2IS1A 5C44J 1HKTA 2VE8A 1SFKA 2PEXA 2RKHA 3F8CA 1BIBA 3U9GA 5J6XA 2UXXA 2Y0SA 4CCLA 4L0ZB 3VODA 1XMKA 3PSFA 2EFWA 2HVSA 3LFKA 1QPMA 2DK8A 3KZIC 3TOAA 4CHUA 1EA3A 3FMRA 5IOYA 5L3BA 5FLMJ 1LE8B 4BYYA 1I27A 4M3DA 1T8IA 2Y48A 1APLC 2L7MP 1EJ9A 1O7LA 4B44A 1U0JA 2K4JA 1WKMA 3AL0B 2OCEA 2ZBKA 1MBFA 3KZYA 3V7RA 3L2WA 1DDNA 3HRMA 3CMAI 1X3UA 5HLHA 1FP1D 2GLOA 4BJTA 1ON2A 1EKEA 2PMZA 5J4YA 2JPCA 3IKVA 1X58A 3JRAA 3N4MA 5CKTA 2FE3A 1A31A 1ZN2A 3CO6C 5GPAA 4RLQA 1X1AA 1NK2P 1K79A 2LOOA 1S72I 2QZ8A 1XC5A 2HZDA 1HF0A 1RC9A 3EUHA 3ZQ7A 2ZC2A 4KIFA 3Q5FA 2O9LA 1MH4A 3HOXJ 4A3LJ 4I0AA 4BHBA 4EM2A 4HF1A 2Q2EA 3MQ0A 3E7LA 4NC6A 1I1SA 2Y30A 1O4XA 1MNMC 4Z2YA 1MBKA 5ICFA 2YR2A 3DBRB 3DLLF 3RQIA 2BY2A 2NVTJ 3DEWA 2ISYA 2ETHA 4XRSA 3DKYA 1NK3P 1FT9A 4IPAA 3TW7A 2O8KA 3KLOA 4HNTA 5DS9A 4F93B 2L02A 3S1MJ 5EZGA 1QU3A 5KNLA 1MMAA 3ABTA 4NNJA 2LKXA 4K2EA 1TWHJ 3K4NA 4L0YB 4LG0A 2A6HF 4Y52J 5E3LA 2QSFX 4ZYDA 1I6HJ 2H8WA 1FTTA 1D1BA 3X2QH 4ZZDA 1BR2A 5K7FA 2WWYA 5GADJ 2E1MB 3LSTA 3OYFA 2F4IA 2M30A 3EDPA 5F0HA 1LKXA 3KE2A 4XICA 3J7ZI 4RGXA 1TL8A 1FTZA 3ROUA 4BQNA 3JRCA 1WSUA 2K02A 2HTJA 4B09A 2EFNA 1K4SA 4FT8A 4DZPA 4CO8A 2DK5A 2WV0A 3AG4H 3FHNA 4ZZLA 1PUFB 4BAYA 2JA7J 3L09A 4FISA 2HOTA 4IHXA 4RMNA 4CA0A 3WTXC 4HG2A 2CWEA 3MVPA 1RKTA 1Y0NA 5ERIA 3OYLA 3M3YJ 2LNBA 3P7NA 5J4VA 1RKWA 2RDPA 4N4OB 2HQAA 3OSGA 5AIPA 2NS7A 1RI7A 3SZPA 3FXMA 4D9JA 3LSPA 2DPUA 2ESHA 2EIMH 2VBYA 2X48A 4BHCA 3HUGB 2XIGA 3ZQCA 1UAAA 5CJ9A 1W36C 2DDBA 5C3EJ 5D6FA 4AYBA 1MDMA 2LR8A 3QYBA 3SHFA 4A69C 3OYDA 5FB2A 4KN4X 3PQKA 4ABZA 3JREA 1ETKA 2E34A 2V79A 3ZCOA 2BGCA 1TW3A 4HDUA 1OR7A 3K1PA 3CUQA 1O3TA 4KICA 3WHCA 3KP3A 4E7ZA 3BY6A 5D5XB 3W2AA 1F4KA 1Z7UA 4IHSA 1OQYA 4XLHA 2CQKA 1SFOJ 4A3JJ 2FRHA 4U0YA 4V2GA 2A3SA 4A0ZA 2OU2A 3PUBA 2VOPA 2BYVE 2HVQA 2RNGA 1ZG3A 5TGTA 2HOAA 1FSHA 2BV6A 2Z1DA 1ZREA 3JAMK 1RETA 1OCCH 2K9LA 3VSKA 3EUKL 4Z6YA 2C6YA 3Q9SA 1MNEA 4IXAA 3AKZA 4L9TA 2R3SA 3GBGA 4EQQA 2ZCWA 5FKMA 1VQOI 2CU7A 3B6CA 3JR9A 3E6CC 2M2EA 1YFHA 1E17A 2OCCH 3DXJF 2JUCA 3AG2H 3LSRA 4C30A 1S9HA 5IYBJ 3KP5A 5LLQA 3ULQB 2MLGA 1USTA 1OYYA 3BG6A 1SFUA 2JPBA 3U2RA 2CUFA 3BTCA 3ZP5A 3OYHA 1Y8RB 3F9KA 2IBDA 3LSJA 3DWLE 5E3OA 5IT9Z 5BPIA 1T98A 2EBIA 1W1WE 2WAQA 1YLFA 3KEQA 4GYGA 3BG5A 2JUGA 2Y31A 1P2FA 4BEHB 3PFIA 1OJLA 4EM0B 4EJOA 3I4MJ 4U88A 4N4NB 1OKRA 4HDVA 1TQMA 2ZFWA 3R61A 5EF6A 3CCJI 2YU3A 4P96A 2HYJA 2YX4A 5ICEA 5LGTA 2CV1A 3JAMZ 1YIOA 3BCBA 4CICA 2XGCA 3P5JA 1KGSA 1MMNA 3GTPJ 3OOUA 4GFBA 3HTUA 4P9UA 2OBPA 1Z9CA 4PJMA 3PNYA 3V8KA 3PO2J 4LOCA 1G3TA 3HHHA 2CFOA 4AVPA 4IRHA 3HSFA 1G3SA 1WVRA 1IV8A 3IHUA 1ONVA 1A04A 5D8KB 4CZZA 4XQFA 2FQ4A 1HW1A 3C3WA 5C4JJ 3P9KA 3GUDA 2OF7A 1R7JA 4DNCA 1T38A 2K3PA 3JTHA 4OMYA 3G1OA 1JXSA 2VJ4A 3FBNB 5FLXZ 3A01A 4G9YA 2FMYA 3FK7A 3GLXA 1RIOH 3FXRA 5B66C 3JRDA 5FFZA 3H35A 2PJRA 4A3CJ 2G9WA 5IP9J 2G7UA 2A68F 5D4SA 4HQEA 3DKXA 2M8EA 5HVQC 1IXRC 2XAQA 2YU9J 2DFFA 3CCYA 2XDVA 2ME0A 2YSRA 1YRNA 4V19K 3WE2A 4HV5A 1G2HA 1J59A 3N05A 4OIQF 4PGHA 2X1CA 1IG7A 4IHWA 2LKSA 2EILH 4IF4A 1MJAA 3O6BB 1FPQA 5M3FJ 2FQ3A 3KZZA 1UZCA 4M72A 1ENHA 5H20A 1Z6RA 2WAEA 5IT3A 2CW8A 4N9IA 2E35A 1JKPC 2G7HA 1R5ID 4YEJA 3RKXA 4E7KA 3K69A 5EGOA 3BR0A 4YIFA 4JX6A 2VLAA 2ZMEC 3FIWA 2D2WA 3FXJA 3HRUA 4Q47A 4YG2F 1ETQA 2M7AA 1D0YA 1S29A 1ZRFA 1YI2I 3REOA 1RUNA 3S32A 2JMWA 3WTTC 1YYVA 4I7HA 1TBXA 4KMFA 2H1LA 2P6SA 3K1MA 4NQWB 5EEAA 3GFJA 5EGOB 2QBYB 4RGSA 1K6OA 1VQ9I 1GVDA 1HKSA 3RDIA 2IA2A 5L3CA 4MTEA 1H9TA 3MCZA 2IGKA 4F91B 1UJ8A 3M1CA 3GTQJ 4QLCU 3DFGA 3AG3H 1ZR4A 2AXTC 1E3OC 5FKKA 1MSEC 2BXYA 3CC4I 2P4WA 1XTAA 3CCQI 4XN3A 1E3HA 5D5WB 4XLCA 4PFOA 1ODDA 3FM3A 1S5LC 3BPVA 1EV7A 4JP0A 4A3EJ 2EZKA 4BKXA 2Z2SB 4EJTA 1IO2A 4JK1X 3OYJA 4A3DJ 3OSFA 2F5DA 4ITVA 2OA4A 1A36A 3RKYA 4J01A 2O7OA 1UHWA 4A3FJ 5HNHA 3TP3A 1T2KA 1I50J 3U1KA 4RAYA 1R1TA 5JLXA 4AIJA 2QQBA 3HIFA 4CYCB 1U2WA 1WCMJ 3I4NJ 2P81A 3KCCA 3MZHA 3E5QA 3CMMA 1N78A 2ISZA 2K7LA 3VPRA 2GXAA 1K61A 2PFBA 3OYNA 2OJED 3L9FA 1D5VA 2EV0A 3HRSA 4HYEA 1VNDA 2DO7A 3GEZA 1B9MA 2IRFG 1Z3YA 1ACIA 3LSMA 4E7HA 3HZJA 1XGMA 4IHYA 3GTOJ 2DA2A 1VI0A 1SVOA 2GM4A 3OS2A 2ZJ2A 2LF8A 1O7FA 3F8FA 1B72B 1ETYA 3BT9A 3I59A 2A69F 3TBIA 1VQ7I 5E8IA 1CF7A 4AD9A 2VBZA 4XL9A 4MNUA 3C7JA 3L2VA 3T8RA 1Z77A 4WK8F 1JUMA 2DMNA 3COAC 1RR7A 4MGRA 2Y75A 3CLOA 1R6RA 2LF7A 2GOXB 2VKDA 1P4WA 4C2MJ 1FBSA 4Q4ZF 4Q5SF 3C2HA 4HA8A 3W6JB 5DD8A 1QHHD 2JVHA 3GZNB 3ZR8X 5K1YA 2VJIA 5F0FA 5LEJA 1ZKGA 3MN2A 4B47A 1JKQC 4B3XA 3DKWA 2XVCA 3IAM2 1T0FA 4KMUX 3PIPF 4KIGA 3E5XA 4S04A 2EH3A 5LBQA 1TP4A 2L5QA 2XRNA 3B73A 4LIUA 3QWLA 1POGA 1RZ4A 2VUMJ 3CDLA 1U3EM 1ZYRF 3ZGKA 2R5YA 2PMUA 2NNNA 1X19A 1UELB 2VBWA 2V9PA 3ZQIA 2E71A 4IX7A 1O3QA 2DFEA 3T1BA 4ZYHA 5HS9A 3ECOA 2ZMEA 1H9GA 4EMSA 2R7WA 1S6LA 4L5JA 1TTYA 2QKLB 4QIWN 1JGGA 2E7WA 3JSOA 1ZGAA 4RM2A 1N77A 2MG4A 1I3AA 3C1DA 4GO1A 5D8LB 3WG9A 3IH3A 1J2XA 2YUSA 3QU6A 5EYRA 1GLNA 5E79C 4EEFG 4KUMA 2CV2A 3GZ5A 2VC0A 4U0WA 1X1CA 2HU9A 2L7ZA 3GX4X 2L9SA 2GAUA 2Y0MA 4BH9A 4RAFA 4F55A 1IUYA 2R5ZB 1MIJA 4LMYA 2DI3A 2OZ6A 4AIHA 2R7DA 2FOKA 4XONA 1T6SA 2L01A 3WTUC 2JZYA 1L3LA 1ORKA 1X2NA 3QP5A 4GXOA 5E8GA 1X1PA 1N75A 3B6AA 1YJNI 3SQNA 2ZO4A 2FNAA 4KT5C 3L00A 5FO5A 5D6EA 3FKIJ 2FNPA 2WTEA 3S14J 2LBFB 2W4SA 2L54A 4GYIA 2EIKH 3CJNA 2BVMA 4PUSA 1WJBA 4AC0A 3MFKA 3QOEA 1FYMA 3HOUJ 2LD5A 3R0JA 3SEZA 2JK3A 2BBYA 3EQLF 2E1NA 2UXNA 3FMQA 4LD5A 3U1DA 2UZKA 4NUBA 5E1XA 4BE0A 1JE8A 4KNYA 1B72A 3AAFA 1ETXA 3K70C 4B8XA 2F5VA 3VFZA 1YITI 1JTXA 3CCUI 2IS6A 2Q1ZB 2GA1A 2DQLA 3IUOA 4AUXA 1OCTC 5F1JA 4HBLA 1YE9A 2XSJC 3BR3A 1ZTRA 1EH8A 2JVGA 3CZ6A 4UY8I 5KAIC 3CCVI 3TW6A 1EH7A 1VZ0A 2YX7A 4OAZA 3JW4A 3GTJJ 5GTIC 2BE5F 1I39A 1U8RA 2ZNYA 3WGHA 2BY0A 3P9CA 4WF2A 2V9KA 1W4MA 2CJJA 1ZLKA 2EV6A 2FA5A 1HXDA 4HLYA 3A0HC 2IS4A 3OYIA 4OWRB 5JVGF 2W85A 3LOCA 2X6OA 3ZQQA 3K2ZA 1B8IA 1FJLA 4M9XA 4CGZA 3BDDA 5HDNA 3MKYB 2IA0A 2K9SA 3H9GA 4BJ6C 2LREA 2LVSA 4XORA 4HEA2 4MEXF 3I0TA 1MJBA 3KP7A 3BQYA 3TO9A 2FXAA 3I5UA 2LMDA 3A1YA 3OOPA 1XCVA 4NDLA 1JHHA 4BJ5C 1IRFA 2ACJA 5CYVA 4UUSA 1FBQA 3LA2A 1Y1WJ 3R0AA 3NAUA 1DQUA 2E2JJ 5J8CA 3ZQFA 1YTYA 4TV7A 3A02A 4PZJA 4CCOA 3L2UA 2DQRA 1V55H 1A5JA 1LFUP 3L1PA 3GTMJ 5J1UA 3L2QA 4H4KC 1XCBA 2QWWA 4U87A 1NH3A 1IZ1A 1X3ZB 2VJJA 1MBJA 3PO3J 1UHSA 2HVRA 3V8JA 3ASOH 1XS9A 3QQAA 3M8EA 1JJ8C 3G4SI 1QHGA 2HR3A 5IY5H 1YW7A 1SD4A 3ZOBA 1YG2A 2MH9A 1F9NA 3I56I 3S17J 3G3ZA 3NRVA 4MFDA 3W2WA 5ILVA 2NVYJ 2R7RA 4M3GA 3OS1A 2QQ8A 5TRDA 3MMYB 3S3MA 4YIRX 4PSWA 1MD0A 2NAZA 4LK1F 3OIPA 1N25A 1XSDA 2DT6A 2HFHA 2V7FA 4CCJA 3I64A 4OU0A 1JT6A 1U8BA 1IUFA 2PMHA 1TNSA 3K1NA 3D5LA 3G2BA 4B43A 5KAFC 2O61A 4XLNF 1ZARA 5JVTA 5BOXA 2L2OA 3FF5A 3HOZJ 3HM5A 3QPLA 4DZJA 4MFEA 2OD5A 3CCLI 2Y9ZA 3M8JA 2KDZA 4IJAA 3EYIA 1IAWA 1IN4A 4X0GA 3PNVA 2KJBA 3WU2C 4BXFA 2RNJA 3OYAA 2CQ7A 2G0EA 4M3FA 3HOYJ 1S7OA 3T0YA 3VYSB 2ID3A 4UUVA 2R7TA 2DN0A 4RAZA 1I3QJ 3OV8A 2NYXA 2UUZA 4F3QA 4U7DA 1PUEE 1ZAOA 4XMYA 2Z16A 4E70A 5HODA 5FJ8J 1UCRA 2KRHA 1R4MB 1IJWC 4OOIA 3ZMTA 1P92A 2VC1A 2HGCA 4HPQA 5FKOA 2D1HA 3DCFA 3LQQA 2PG4A 1J75A 3CDIA 3PUFA 5CVIA 3T5XA 1J7KA 2VT3A 1ZELA 3V8LA 5A2QK 2XF6A 4G12A 4HQMA 1AKHB 1EF4A 1PP8F 3SDGA 1IC8A 2ELJA 3ESWB 2MC3A 5F27A 3ZQGA 4EJWA 2EFPA 5TJJA 5D5UB 4PJLA 5HLIA 3RKWA 2KHMA 2DA7A 4EVIA 2F6CA 2DOFA 4UNOA 4NC8A 4FX4A 2ELHA 3GWZA 4XLAA 1AWCA 4UV9A 1WRJA 4RA2A 3K9TA 1U9OA 5GAGJ 3VDXA 3ZMVA 1O3SA 3QYFA 3V7CA 2QVOA 2KDOA 2R5YB 4A6DA 2DOAA 1O3RA 4A2UA 4M9SA 1DP3A 3HRTA 1LDJA 4D0PA 3GZ6A 2KJCA 2CQXA 4IOAF 3S2HJ 4HW0A 5J1YA 2F48A 2GXBA 2I10A 1Z0XA 2A07F 1RUOA 4IQ4A 2XAGA 2VKHA 2BY1A 1S8NA 4L5IA 2IPQX 3D1NI 4KT6A 4JX5A 1ITYA 3ZN1A 4XRSG 2DT7B 1K6YA 2AO9A 2ZJQF 2X85A 3MKLA 4LJZF 4KYWA 2TCTA 3V7SA 3CCMI 1MMSA 2MLKA 2P5LC 3E0JB 1KONA 1TWAJ 2DXIA 2ZNZA 1F1ZA 3K7AJ 2YS9A 2M3AA 3IWFA 1P9QC 5KCMA 4HX7A 2NVUB 1IN5A 2W7NA 4B48A 1CF7B 2KZGA 4XLEA 1XGSA 4XOTA 4EGYA 3VYUB 2ME6A 2FBKA 3KLNA 2KRCA 2Z5UA 4FHTA 4BBRJ 1MDMB 4I09A 1D1CA 3E6DA 5DEQA 3FBIB 2OZUA 1ETWA 3ELKA 4HNVA 3IRQA 5CPRB 3FXQA 2WC2A 2VXZA 2JT1A 1XX5A 2CO5A 4HZFA 1GXPA 5GAEJ 3F23A 3HGYA 3QRFF 2RQPA 2KLOA 4A3MJ 1D0XA 2EFQA 2IGNA 2XASA 2RAEA 4R8HA 5K5QA 3MKZA 3VWBA 2CYYA 3MZYA 2CQQA 2QGUA 2ADUA 3V4GA 4RAGA 4FE7A 2XROA 2VN2A 3F6OA 2R7OA 2XUBA 2HQNA 3L2CA 3PM1A 4JYKA 3VEPA 4EJVA 1LDKB 3IH2A 3QYEA 2K3FA 1LEBA 4XRMA 1R71A 1MBEA 3RI4A 2AQEA 2DDAA 2Z3YA 3CMYA 3F22A 2ECBA 1JUSA 5B1BH 4IVNA 2EPFA 4DW6A 5E20A 2OAZA 4XM3A 2YPRA 3DTKA 3DBLB 2RQQA 2HPMA 4S0HB 3C18A 2O6GE 2QENA 4L9JA 1K4TA 2EZHA 3BR6A 3FXOA 2NVQJ 1VQ4I 2ZSHB 3IAS2 2HKOA 2FOWA 2L4MA 3F3XA 2AXLA 1BOAA 3PIOF 1OR7C 1YS6A 4IOCF 4BNCA 1U5TB 3OL4A 3SYTA 1D8KA 5L3FA 3R60A 3LSHA 3HG9A 4IHTA 1WQ2A 5KHDA 1H0MA 1B1BA 1Y1VJ 2V1XA 3G6EI 5HLGA 2LDUA 2OTLI 2R7FA 4A6EA 3ZPLA 4ESBA 1RPWA 2DMQA 1T95A 4EM1A 1SAXA 3G1MA 1SC7A 4D7NA 3OYEA 3L7WA 3M7GA 2K4BA 2F5CA 3CESA 4ZYEA 3WTWC 1A35A 4P9FA 4AU7A 1WJDA 5K5OA 1ETVA 1HOMA 4F52A 1RESA 1VQNI 3DU6A 3JCUC 1QA6A 3WTYC 2ZXWH 2ZKZA 5H2FC 4EATA 5DCMA 1FOYA 3TP0A 1YW8A 1BC8C 3ABLH 1TZLA 4BACA 1HSTA 1MSFC 3MD2A 3E5UA 3CD6I 4RB3C 5J8FA 1MBHA 3F8BA 4OIRF 5B5EC 2VQCA 1QQIA 1QVTA 1R22A 4C9YA 1UMQA 1D8JA 2GIZA 2B9SA 4RB1A 2ZMEB 1HBXG 2CFXA 2R7XA 2ZB9A 3LWFA 1G8XA 1QPIA 3D5RC 3K4CA 2HXIA 2IEKA 1KU2A 1WJAA 3DEUA 1JKRC 4D5FA 1PDNC 1YJWI 3H9QA 1ZRDA 1KQ8A 5FRMA 1SVMA 5ED4A 3S1QJ 3ABUA 4BQQA 4G7ZF 4ZH4F 3FISA 2PJRB 3IV5A 2L3DA 1OCPA 1S7AA 1TWFJ 3IH4A 5AONA 4QPQA 2JA6J 5EDNA 4NHJA 1W0TA 4ZYGA 1LVKA 4O5VA 5AIQA 1TQPA 4ZDOA 2K9NA 5GP9A 3IP4B 1Z21A 1ZLJA 2LP0A 2FX0A 2CG4A 1FC3A 2DBBA 4ZTJA 1BI2A 2GQQA 2P8TA 1UFMA 1XMAA 3FMSA 2HQRA 4IRIA 2DA3A 5ILUA 3IKTA 2XF7A 1D1AA 1E3PA 2CSOA 4XKBA 4FCYA 1AKHA 3J80K 4RB0A 2LBFA 2V9VA 4ENMA 3RPUD 2NS8A 1FOWA 4Y33A 3KEOA 5LEKA 1S3JA 2EIJH 2IT0A 1ZH5A 3CC2I 5FLXK 1KZHA 4FTHA 5BPDA 1BR1A 3F72A 1P4AA 2LFBA 3EPZA 1E2XA 2W48A 5CVVA 3CDHA 4RGRA 2Y69H 1TWGJ 1KU9A 1NG7A 4LITA 2HYFA 3HOWJ 1XGNA 4U0VA 3LQRA 2QSGX 3W2VA 4UV8A 5M3MJ 2VJ5A 4AYBN 2R5ZA 2KP6A 3AFHA 3CCEI 4G8XA 4Q48A 2MFZA 4N0BA 5DUKA 4HAMA 3ZMZA 3OMYA 9ANTA 5K7HA 1R5HA 1X2MA 3HPGA 3VB2A 2MSYA 1CQTA 2QUFA 4LFUA 2H8RA 5FD5A 2HOSA 2O8XA 1TT5B 1HKQA 5GAHJ 3J7YJ 1FOKA 2FJ1A 2L9VA 1R00A 3I53A 4NC7A 3TL4X 2XKPA 1HCRA 4I2OA 3BR2A 3E1SA 2KIUA 3F0CA 2QKMB 5M5WJ 3LSGA 1SAUA 4XKWA 4XKCA 3LL7A 2L4AA 3CUQC 5LHGA 1U9NA 3H36A 1A6QA 4R79A 2GA2A 2NRAC 2DA4A 2JSCA 2DU9A 1WJFA 5B3SH
chains in the Genus database with same CATH topology
4Y17A 3HSRA 1SD5A 3PQJA 1KA8A 1R23A 2FEZA 2GXGA 1G3WA 3JSPA 3HTSB 3WE3A 1YS7A 1GHCA 3J81K 3BWGA 2F5EA 2D1VA 2KIMA 3HUGA 2HS5A 4JQFA 1OYIA 1G3YA 4WX9A 5DUIA 3W6KB 3B02A 2K27A 3BZ6A 3EETA 1J9IA 2X0LA 1QNTA 5ILSA 1LQ1A 5H6RA 3I59B 4GGGA 1DPUA 3BJ6A 4EGZA 2O3FA 1BI3A 1JHFA 4RB2C 3CO7C 3QAHA 3KP6A 4A0XA 5ICGA 2GZWA 2Z9OA 1W7PD 3SXYA 2XHKA 1D3YA 3F8MA 5LRRA 4YFNF 5K5RA 2HZTA 2H09A 2DAOA 3O3KA 5E1WA 3RTRA 1G6NA 1V4RA 4MQVA 2HYGD 4RGUA 1EH6A 2BEOA 3BJAA 2EFOA 1B59A 2KRFA 2VONA 2W84A 1IXCA 1F5TA 3RPUA 3IL2A 3J80Z 5JFRA 5DD4A 1B6AA 1FLIA 4YIIA 1DP7P 3HHGA 2XAHA 3ZMDA 2A5YB 4Y13A 2STWA 2QBYA 3BJOA 3LAPA 2OQGA 5LRSA 5H6QA 4KIBA 2VT2A 1REPC 3WTZA 1Y0UA 2H6CA 4XSZF 2MD5A 1MGTA 3ML6A 1KQ0A 4AWXB 3FHZA 3GF2A 2FBHA 4HF2A 4KA4A 1G4DA 2MH2A 4PCQA 3I58A 3LA7A 2M87A 4KDPA 1BJAA 1FBUA 2FSWA 5KK1A 4ETSA 4G6DA 5FGMA 4S05A 3BROA 4YFKF 4HLXA 3NQOA 5EEGA 4BHPA 1SFXA 5E1ZB 3KFWX 1BIAA 1WI9A 2P5VA 2Z33A 1ULYA 1OPCA 3TO6A 1LVAA 1FY7A 2PN6A 3TGNA 5LHHA 2PJPA 2H6BA 4HF0A 2QQ9A 1ZG1A 2HDCA 4AIKA 4A12A 2A61A 3J7AO 1ZGJA 2O03A 3J81Z 2CGPA 4G7HF 4H0EA 5L3GA 3DF8A 4ESJA 2Z99A 2M45A 2KKOA 2HKXA 2EK5A 1BN5A 3O2PE 2VODA 3QU3A 4CYDA 4I0BA 5DDGA 4KN7X 3BPXA 3FZVA 4L18B 3ECHA 3QPTA 5CVUA 5HDKA 5LHIA 4UVAA 5F1RA 2RV8A 1XDSA 5D5VB 3HOTA 3LA3A 4UVBA 1Z6TA 1W5TA 4CXFA 1UB9A 3GFIA 3IWZA 1ZRCA 2W57A 4A0YA 3VOEA 4EJUA 1KQ9A 5DV5A 1VTNC 2VE9A 1I1GA 3I54A 1IN7A 3CUQB 3QP6A 3CUOA 2E7XA 2NNYA 2XV4S 1FYLA 1TLHB 4WWCA 4WXHA 4GCVA 2FU4A 1HQCA 1KYWA 2X4HA 2EJRA 4UXNA 3I71A 4LLLA 1STZA 4M6XA 4R1HA 2TDXA 4HX8A 4MQ9F 3FXUA 2A6EF 4OIPF 1ZG5A 1B9NA 1OMIA 3GXOA 4IRGA 4MHGA 2V1UA 2P5KA 1J5YA 3KETA 4OIOF 4BQAA 2PI0A 1YO5C 5IT9K 4XSXF 1FZPB 3DP7A 1U6GA 4EV0A 1QBJA 1C0WA 5CVRA 2HWVA 1IRGA 5D4RA 3M9AA 1ZHFA 2K86A 1XDUA 1Z1DA 3MWMA 5FFXA 3FM5A 1DPRA 2MA3A 4LLNA 4M71A 1UHMA 1PP7U 1LB2A 3DPTA 5L3EA 4G7OF 3S2WA 1FNNA 2QQAA 4ON0A 4WXDA 1R5GA 1USSA 5JR3A 3ZN0A 1P6RA 4WCGA 1IW7F 4G6QA 3F21A 5E18F 1XGOA 2P6TA 1GXQA 1HW5A 3N97A 4O3MA 1TQIA 2DTRA 1GVJA 1XD7A 1U5TC 5CLSA 1XB4A 4P5OA 3GW2A 1NHAA 1W5SA 2H27A 1SMTA 1SFEA 5JHUA 1MJ9A 2HOEA 1AOYA 2AS5F 3E3VA 1W7PB 1QZZA 1R36A 4JBAA 3TDUC 1J0RA 2GIVA 4U7BA 3WU1B 2EWNA 3GFMA 1BBYA 1P4XA 1SD6A 1BM9A 4MEYF 3TQNA 4HOBA 4ENKA 1I6XA 5HOOA 2EA2A 3BOQA 3E6MA 5HS8A 1FYKA 2D45A 4DQ2A 3P9IA 4L9NA 4HX4A 5LGUA 1OYWA 1SD7A 4PDKA 1V3FA 2Q8KA 1O57A 3DQVC 2Q0OA 2ESNA 1B4AA 2IVMA 1KU7A 1IF1A 1Z91A 1W7PA 4LG0B 3E6BA 2RGVA 2EV5A 3D0SA 4XRFA 3I4PA 1XN7A 3RYPA 5F6FA 4OINF 3ZMSA 3QPHA 4I02A 5A2QZ 4A5NA 3RYRA 4NQWA 4G94A 2JRTA 2E1CA 3FX3A 2MBFA 3GFLA 3T8TA 2OQRA 1MZBA 5L3DA 2XKOA 3G73A 3TOBA 3RPQA 5LGNA 3BP8A 2O0YA 4M74A 4ENJA 2FF4A 5DYMA 4M73A 1JGSA 5CVJA 3IC7A 4XBFA 2LSOA 5BQTA 3H3UA 1HSJA 2VOOA 1FSEA 3GO5A 5DCMB 2DW4A 6PAXA 2QLZA 1BC7C 2J5OA 3KP4A 1I5ZA 2VBXA 4OMZA 1R1UA 3ZMUA 3MEXA 1QGPA 3WGGA 2PLYA 3WODF 2W24A 3DPLC 3MAJA 3GYHX 2RN7A 1TNTA 3Q9VA 2M1BA 3FWEA 1WWXA 4FX0A 2W25A 1CGPA 1U5TA 3E97A 4KFCA 1LNWA 1SMYF 1XSVA 1BI0A 5BS6A 1K78A 4WXCA 2GWRA 5FD6A 2IW5A 1LJ9A 4ASNA 4N9HA 2EA4A 3DV8A 2XGXA 2COMA 3GVAA 3TO7A 3HOSA 1QO0D 3F6VA 3WTVC 4L9VA 3KP2A 5KVRA 5F64A 3JTGA 1BI1A 1ON1A 3QOPA 5BMZA 2QYOA 4UVCA 1YW9A 2ZXJA 3WTSC 2V1DA 5E17F 2IP2A 4QWQA 1DUXC 4ENNA 2HEOA 2EB7A 3HSEA 3K0LA 4I01A 4NB5A 3ISPA 1TW2A 4RS8A 2CW0F 1IXSB 1XSXA 2NS0A 1YQAA 1FP2A 1T39A 3ERED 4Y15A 2KIFA 3F8NA 4UHTA 1FWZA 5DCFA 2F5FA 2UWMA 3TKYA 4ESFA 2H94A 2J5PA 4M6YA 2PQ8A 1QZYA 4LLGF 2PBIA 2JTVA 2FBIA 2B0LA 2LKPA 1L0OC 2QM3A 3WGIA 3IRRA 3R6SA 3TDZC 5HDGA 4CDGA 1KYZA 2IA1A 4BXUA 5EEHA 4I98B 3SZTA 5JI6A 4P55A 4MTDA 3H92A 3LAJA 1FX7A 2RC4A 4HV6A 2DPDA 4LB6B 2XAFA 4LGWA 2IJLA 3CTAA 4F7ZA 3NEUA 4M9ZA 3HYIA 2DT5A 3M1EA 5ICCA 3EYYA 3WU0A 1LEAA 1R1VA 3RIRA 1R58A 4LB5A 1Z05A 2V6CA 1KU3A 3H3ZA 2RVCA 1K78B 2DLLA 1IN6A 1K7AA 4A5MA 4YFXF 2XAJA 1RNLA 3R4KA 4PGGA 2STTA 2DFIA 2P7VB 1MKMA 4LK0F 5HS7A 1HW2A 2P7CB 2HTSA 2M5WA 3SFZA 3RJPA 4XLPF 1IN8A 4O6JA 1Q1HA 1U78A 1LDDA 3M8FA 2F2EA 2FMLA 1HKTA 2VE8A 2PEXA 2RKHA 3F8CA 1BIBA 3U9GA 5J6XA 2UXXA 4L0ZB 3VODA 1XMKA 2EFWA 3LFKA 1QPMA 2DK8A 3TOAA 4CHUA 3FMRA 5L3BA 4BYYA 1I27A 2Y48A 1O7LA 2K4JA 1WKMA 2ZBKA 3KZYA 3V7RA 1DDNA 3HRMA 1X3UA 5HLHA 1FP1D 1ON2A 2JPCA 3N4MA 3IKVA 2FE3A 1ZN2A 3CO6C 1K79A 2QZ8A 3EUHA 3ZQ7A 4KIFA 3Q5FA 4I0AA 4BHBA 4EM2A 4HF1A 2Q2EA 3MQ0A 1I1SA 4Z2YA 5ICFA 2YR2A 2ISYA 2ETHA 1FT9A 4IPAA 3KLOA 2L02A 3ABTA 4K2EA 4L0YB 4LG0A 2A6HF 4ZYDA 4ZZDA 2WWYA 3LSTA 2M30A 3EDPA 3KE2A 4RGXA 3ROUA 1WSUA 2K02A 2HTJA 4B09A 2EFNA 4FT8A 4CO8A 2DK5A 2WV0A 4ZZLA 4BAYA 3L09A 3WTXC 2CWEA 5ERIA 2LNBA 3P7NA 2RDPA 5AIPA 1RI7A 3SZPA 2DPUA 2ESHA 2VBYA 4BHCA 2XIGA 5CJ9A 5D6FA 1MDMA 3SHFA 5FB2A 4KN4X 3PQKA 2V79A 2BGCA 1TW3A 4HDUA 1OR7A 3K1PA 3CUQA 1O3TA 4KICA 3KP3A 3BY6A 5D5XB 1F4KA 1Z7UA 4IHSA 2CQKA 2FRHA 4U0YA 2A3SA 4A0ZA 2OU2A 2VOPA 2BYVE 1ZG3A 1FSHA 2BV6A 1ZREA 3JAMK 2C6YA 3Q9SA 4IXAA 4L9TA 2R3SA 4EQQA 2ZCWA 3E6CC 1YFHA 1E17A 3DXJF 3KP5A 5LLQA 3ULQB 2MLGA 1USTA 1OYYA 1SFUA 2JPBA 3U2RA 3ZP5A 5IT9Z 5BPIA 1T98A 3KEQA 1YLFA 4GYGA 1P2FA 3PFIA 4EM0B 4EJOA 4U88A 4HDVA 1OKRA 1TQMA 2ZFWA 3R61A 2YU3A 4P96A 5ICEA 2YX4A 5LGTA 3JAMZ 1YIOA 4CICA 1KGSA 3HTUA 4P9UA 2OBPA 1Z9CA 3V8KA 1G3TA 3HHHA 4AVPA 4IRHA 3HSFA 1G3SA 3IHUA 1ONVA 1A04A 5D8KB 4CZZA 1HW1A 3C3WA 3P9KA 3GUDA 4DNCA 1R7JA 1T38A 3JTHA 4OMYA 1JXSA 5FLXZ 4G9YA 2FMYA 1RIOH 3GLXA 3FXRA 5FFZA 2G9WA 2G7UA 2A68F 5D4SA 4HQEA 2M8EA 5HVQC 1IXRC 2XAQA 2YSRA 3WE2A 4HV5A 1J59A 4OIQF 4PGHA 4IF4A 1MJAA 3O6BB 1FPQA 2FQ3A 3KZZA 4M72A 5H20A 1Z6RA 5IT3A 4N9IA 2G7HA 3RKXA 3K69A 4YIFA 3HRUA 2D2WA 4Q47A 4YG2F 1S29A 1ZRFA 3REOA 1RUNA 3WTTC 1YYVA 4I7HA 1TBXA 4KMFA 2P6SA 3K1MA 3GFJA 2QBYB 4RGSA 1K6OA 1HKSA 3RDIA 2IA2A 5L3CA 4MTEA 1H9TA 3MCZA 4QLCU 3DFGA 2P4WA 5D5WB 1ODDA 3FM3A 3BPVA 1EV7A 4EJTA 4JK1X 2F5DA 2OA4A 3RKYA 1UHWA 1T2KA 4RAYA 1R1TA 4AIJA 2QQBA 3HIFA 1U2WA 3KCCA 3MZHA 3E5QA 2ISZA 2K7LA 2PFBA 3L9FA 1D5VA 2EV0A 3HRSA 4HYEA 2DO7A 3GEZA 1B9MA 2IRFG 1XGMA 2ZJ2A 2LF8A 1O7FA 3F8FA 3I59A 2A69F 5E8IA 1CF7A 4AD9A 2VBZA 4MNUA 3C7JA 3T8RA 4WK8F 3COAC 4MGRA 2Y75A 3CLOA 2LF7A 1P4WA 1FBSA 4Q4ZF 4Q5SF 4HA8A 3W6JB 5DD8A 5K1YA 5LEJA 3DKWA 2XVCA 1T0FA 4KMUX 4KIGA 3E5XA 4S04A 5LBQA 3B73A 2XRNA 1RZ4A 1U3EM 1ZYRF 2PMUA 2NNNA 2VBWA 1O3QA 4ZYHA 3T1BA 5HS9A 3ECOA 2ZMEA 1H9GA 4EMSA 1S6LA 4L5JA 1TTYA 2E7WA 3JSOA 1ZGAA 3C1DA 4GO1A 5D8LB 3WG9A 1J2XA 3QU6A 4KUMA 3GZ5A 2VC0A 4U0WA 3GX4X 2GAUA 2Y0MA 4BH9A 1IUYA 4LMYA 2DI3A 2OZ6A 4AIHA 2R7DA 2FOKA 1T6SA 2L01A 3WTUC 2JZYA 1L3LA 3QP5A 4GXOA 5E8GA 3SQNA 2ZO4A 2FNAA 4KT5C 3L00A 5FO5A 5D6EA 2FNPA 2WTEA 3MFKA 2L54A 4GYIA 3CJNA 1FYMA 3R0JA 2BBYA 3EQLF 2E1NA 2UXNA 3FMQA 4LD5A 3U1DA 2UZKA 5E1XA 1JE8A 4KNYA 3AAFA 4B8XA 3VFZA 2GA1A 2DQLA 4HBLA 1EH8A 1EH7A 2YX7A 3JW4A 2BE5F 1U8RA 2ZNYA 3WGHA 3P9CA 4WF2A 1W4MA 1ZLKA 2EV6A 2FA5A 1HXDA 4HLYA 2W85A 3K2ZA 4M9XA 4CGZA 3BDDA 5HDNA 2IA0A 4MEXF 3I0TA 1MJBA 3KP7A 3TO9A 2FXAA 3I5UA 3OOPA 1XCVA 1JHHA 1IRFA 2ACJA 5CYVA 1FBQA 3LA2A 3R0AA 5J8CA 1YTYA 4TV7A 4PZJA 2DQRA 1XCBA 2QWWA 1IZ1A 3V8JA 3M8EA 2HR3A 1YW7A 1SD4A 1YG2A 2MH9A 1F9NA 3G3ZA 3NRVA 5ILVA 5TRDA 1MD0A 2NAZA 4LK1F 1XSDA 2HFHA 3I64A 4OU0A 2PMHA 1TNSA 3K1NA 3D5LA 2O61A 4XLNF 1ZARA 5JVTA 5BOXA 3FF5A 2OD5A 3EYIA 4IJAA 1IAWA 1IN4A 2KJBA 2RNJA 1S7OA 3T0YA 4UUVA 4RAZA 3OV8A 2NYXA 4U7DA 1PUEE 1ZAOA 4E70A 1UCRA 4OOIA 3ZMTA 1P92A 2VC1A 2HGCA 2D1HA 3LQQA 2PG4A 1J75A 5CVIA 3T5XA 1J7KA 2VT3A 3V8LA 5A2QK 4HQMA 1PP8F 2MC3A 4EJWA 2EFPA 5TJJA 5D5UB 5HLIA 3RKWA 4EVIA 4UNOA 4FX4A 2ELHA 3GWZA 1AWCA 4UV9A 1WRJA 3K9TA 3ZMVA 1O3SA 3V7CA 2QVOA 4A6DA 1O3RA 4A2UA 4M9SA 3HRTA 1LDJA 4D0PA 3GZ6A 2KJCA 4HW0A 2GXBA 2A07F 1RUOA 2XAGA 1S8NA 4L5IA 2IPQX 3ZN1A 4LJZF 4KYWA 3V7SA 2MLKA 2P5LC 2ZNZA 1F1ZA 3IWFA 4HX7A 1IN5A 1CF7B 1XGSA 4EGYA 2FBKA 3KLNA 2Z5UA 4FHTA 1MDMB 4I09A 3E6DA 5DEQA 2OZUA 3ELKA 3IRQA 2WC2A 3FXQA 2VXZA 2JT1A 2CO5A 4HZFA 1GXPA 3F23A 3QRFF 2RQPA 2EFQA 2XASA 4R8HA 5K5QA 2CYYA 3MZYA 2ADUA 3V4GA 2XROA 2VN2A 3F6OA 2XUBA 2HQNA 3L2CA 3VEPA 4EJVA 1LDKB 1LEBA 3RI4A 2Z3YA 3F22A 4IVNA 5E20A 2OAZA 2YPRA 2O6GE 3C18A 2QENA 4L9JA 2HKOA 2L4MA 3F3XA 2AXLA 1BOAA 1YS6A 4BNCA 1U5TB 1D8KA 5L3FA 3R60A 4IHTA 1WQ2A 1H0MA 1B1BA 2V1XA 5HLGA 2LDUA 2R7FA 4A6EA 3ZPLA 4ESBA 4EM1A 1SAXA 3L7WA 3M7GA 2K4BA 2F5CA 4ZYEA 3WTWC 4P9FA 5K5OA 3WTYC 2ZKZA 5DCMA 1YW8A 1BC8C 1HSTA 3E5UA 4RB3C 5J8FA 3F8BA 4OIRF 1QQIA 1R22A 1D8JA 4RB1A 2ZMEB 1HBXG 2CFXA 3LWFA 1KU2A 3DEUA 1PDNC 1KQ8A 1ZRDA 5ED4A 3ABUA 4G7ZF 4ZH4F 2L3DA 5AONA 1S7AA 4NHJA 4ZYGA 4O5VA 5AIQA 1TQPA 1ZLJA 2CG4A 1FC3A 2DBBA 1BI2A 2GQQA 2P8TA 1UFMA 1XMAA 3FMSA 2HQRA 4IRIA 5ILUA 3IKTA 2CSOA 3J80K 4RB0A 2V9VA 4ENMA 5LEKA 3KEOA 1S3JA 2IT0A 1ZH5A 5FLXK 5BPDA 3F72A 1P4AA 1E2XA 5CVVA 3CDHA 4RGRA 1KU9A 2HYFA 1XGNA 4U0VA 3LQRA 4UV8A 4G8XA 4Q48A 5DUKA 4N0BA 3ZMZA 4HAMA 1R5HA 3VB2A 2QUFA 4LFUA 5FD5A 2O8XA 1HKQA 1FOKA 3I53A 1R00A 2XKPA 4I2OA 2KIUA 2L4AA 3CUQC 5LHGA 4R79A 2GA2A 2NRAC 2JSCA 2DU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  3HSR A;  1SD5 A;  3PQJ A;  1KA8 A;  1R23 A;  2FEZ A;  2GXG A;  1G3W A;  3JSP A;  3HTS B;  3WE3 A;  1YS7 A;  1GHC A;  3J81 K;  3BWG A;  2F5E A;  2D1V A;  2KIM A;  3HUG A;  2HS5 A;  4JQF A;  1OYI A;  1G3Y A;  4WX9 A;  5DUI A;  3W6K B;  3B02 A;  2K27 A;  3BZ6 A;  3EET A;  1J9I A;  2X0L A;  1QNT A;  5ILS A;  1LQ1 A;  5H6R A;  3I59 B;  4GGG A;  1DPU A;  3BJ6 A;  4EGZ A;  2O3F A;  1BI3 A;  1JHF A;  4RB2 C;  3CO7 C;  3QAH A;  3KP6 A;  4A0X A;  5ICG A;  2GZW A;  2Z9O A;  1W7P D;  3SXY A;  2XHK A;  1D3Y A;  3F8M A;  5LRR A;  4YFN F;  5K5R A;  2HZT A;  2H09 A;  2DAO A;  3O3K A;  5E1W A;  3RTR A;  1G6N A;  1V4R A;  4MQV A;  2HYG D;  4RGU A;  1EH6 A;  2BEO A;  3BJA A;  2EFO A;  1B59 A;  2KRF A;  2VON A;  2W84 A;  1IXC A;  1F5T A;  3RPU A;  3IL2 A;  3J80 Z;  5JFR A;  5DD4 A;  1B6A A;  1FLI A;  4YII A;  1DP7 P;  3HHG A;  2XAH A;  3ZMD A;  2A5Y B;  4Y13 A;  2STW A;  2QBY A;  3BJO A;  3LAP A;  2OQG A;  5LRS A;  5H6Q A;  4KIB A;  2VT2 A;  1REP C;  3WTZ A;  1Y0U A;  2H6C A;  4XSZ F;  2MD5 A;  1MGT A;  3ML6 A;  1KQ0 A;  4AWX B;  3FHZ A;  3GF2 A;  2FBH A;  4HF2 A;  4KA4 A;  1G4D A;  2MH2 A;  4PCQ A;  3I58 A;  3LA7 A;  2M87 A;  4KDP A;  1BJA A;  1FBU A;  2FSW A;  5KK1 A;  4ETS A;  4G6D A;  5FGM A;  4S05 A;  3BRO A;  4YFK F;  4HLX A;  3NQO A;  5EEG A;  4BHP A;  1SFX A;  5E1Z B;  3KFW X;  1BIA A;  1WI9 A;  2P5V A;  2Z33 A;  1ULY A;  1OPC A;  3TO6 A;  1LVA A;  1FY7 A;  2PN6 A;  3TGN A;  5LHH A;  2PJP A;  2H6B A;  4HF0 A;  2QQ9 A;  1ZG1 A;  2HDC A;  4AIK A;  4A12 A;  2A61 A;  3J7A O;  1ZGJ A;  2O03 A;  3J81 Z;  2CGP A;  4G7H F;  4H0E A;  5L3G A;  3DF8 A;  4ESJ A;  2Z99 A;  2M45 A;  2KKO A;  2HKX A;  2EK5 A;  1BN5 A;  3O2P E;  2VOD A;  3QU3 A;  4CYD A;  4I0B A;  5DDG A;  4KN7 X;  3BPX A;  3FZV A;  4L18 B;  3ECH A;  3QPT A;  5CVU A;  5HDK A;  5LHI A;  4UVA A;  5F1R A;  2RV8 A;  1XDS A;  5D5V B;  3HOT A;  3LA3 A;  4UVB A;  1Z6T A;  1W5T A;  4CXF A;  1UB9 A;  3GFI A;  3IWZ A;  1ZRC A;  2W57 A;  4A0Y A;  3VOE A;  4EJU A;  1KQ9 A;  5DV5 A;  1VTN C;  2VE9 A;  1I1G A;  3I54 A;  1IN7 A;  3CUQ B;  3QP6 A;  3CUO A;  2E7X A;  2NNY A;  2XV4 S;  1FYL A;  1TLH B;  4WWC A;  4WXH A;  4GCV A;  2FU4 A;  1HQC A;  1KYW A;  2X4H A;  2EJR A;  4UXN A;  3I71 A;  4LLL A;  1STZ A;  4M6X A;  4R1H A;  2TDX A;  4HX8 A;  4MQ9 F;  3FXU A;  2A6E F;  4OIP F;  1ZG5 A;  1B9N A;  1OMI A;  3GXO A;  4IRG A;  4MHG A;  2V1U A;  2P5K A;  1J5Y A;  3KET A;  4OIO F;  4BQA A;  2PI0 A;  1YO5 C;  5IT9 K;  4XSX F;  1FZP B;  3DP7 A;  1U6G A;  4EV0 A;  1QBJ A;  1C0W A;  5CVR A;  2HWV A;  1IRG A;  5D4R A;  3M9A A;  1ZHF A;  2K86 A;  1XDU A;  1Z1D A;  3MWM A;  5FFX A;  3FM5 A;  1DPR A;  2MA3 A;  4LLN A;  4M71 A;  1UHM A;  1PP7 U;  1LB2 A;  3DPT A;  5L3E A;  4G7O F;  3S2W A;  1FNN A;  2QQA A;  4ON0 A;  4WXD A;  1R5G A;  1USS A;  5JR3 A;  3ZN0 A;  1P6R A;  4WCG A;  1IW7 F;  4G6Q A;  3F21 A;  5E18 F;  1XGO A;  2P6T A;  1GXQ A;  1HW5 A;  3N97 A;  4O3M A;  1TQI A;  2DTR A;  1GVJ A;  1XD7 A;  1U5T C;  5CLS A;  1XB4 A;  4P5O A;  3GW2 A;  1NHA A;  1W5S A;  2H27 A;  1SMT A;  1SFE A;  5JHU A;  1MJ9 A;  2HOE A;  1AOY A;  2AS5 F;  3E3V A;  1W7P B;  1QZZ A;  1R36 A;  4JBA A;  3TDU C;  1J0R A;  2GIV A;  4U7B A;  3WU1 B;  2EWN A;  3GFM A;  1BBY A;  1P4X A;  1SD6 A;  1BM9 A;  4MEY F;  3TQN A;  4HOB A;  4ENK A;  1I6X A;  5HOO A;  2EA2 A;  3BOQ A;  3E6M A;  5HS8 A;  1FYK A;  2D45 A;  4DQ2 A;  3P9I A;  4L9N A;  4HX4 A;  5LGU A;  1OYW A;  1SD7 A;  4PDK A;  1V3F A;  2Q8K A;  1O57 A;  3DQV C;  2Q0O A;  2ESN A;  1B4A A;  2IVM A;  1KU7 A;  1IF1 A;  1Z91 A;  1W7P A;  4LG0 B;  3E6B A;  2RGV A;  2EV5 A;  3D0S A;  4XRF A;  3I4P A;  1XN7 A;  3RYP A;  5F6F A;  4OIN F;  3ZMS A;  3QPH A;  4I02 A;  5A2Q Z;  4A5N A;  3RYR A;  4NQW A;  4G94 A;  2JRT A;  2E1C A;  3FX3 A;  2MBF A;  3GFL A;  3T8T A;  2OQR A;  1MZB A;  5L3D A;  2XKO A;  3G73 A;  3TOB A;  3RPQ A;  5LGN A;  3BP8 A;  2O0Y A;  4M74 A;  4ENJ A;  2FF4 A;  5DYM A;  4M73 A;  1JGS A;  5CVJ A;  3IC7 A;  4XBF A;  2LSO A;  5BQT A;  3H3U A;  1HSJ A;  2VOO A;  1FSE A;  3GO5 A;  5DCM B;  2DW4 A;  6PAX A;  2QLZ A;  1BC7 C;  2J5O A;  3KP4 A;  1I5Z A;  2VBX A;  4OMZ A;  1R1U A;  3ZMU A;  3MEX A;  1QGP A;  3WGG A;  2PLY A;  3WOD F;  2W24 A;  3DPL C;  3MAJ A;  3GYH X;  2RN7 A;  1TNT A;  3Q9V A;  2M1B A;  3FWE A;  1WWX A;  4FX0 A;  2W25 A;  1CGP A;  1U5T A;  3E97 A;  4KFC A;  1LNW A;  1SMY F;  1XSV A;  1BI0 A;  5BS6 A;  1K78 A;  4WXC A;  2GWR A;  5FD6 A;  2IW5 A;  1LJ9 A;  4ASN A;  4N9H A;  2EA4 A;  3DV8 A;  2XGX A;  2COM A;  3GVA A;  3TO7 A;  3HOS A;  1QO0 D;  3F6V A;  3WTV C;  4L9V A;  3KP2 A;  5KVR A;  5F64 A;  3JTG A;  1BI1 A;  1ON1 A;  3QOP A;  5BMZ A;  2QYO A;  4UVC A;  1YW9 A;  2ZXJ A;  3WTS C;  2V1D A;  5E17 F;  2IP2 A;  4QWQ A;  1DUX C;  4ENN A;  2HEO A;  2EB7 A;  3HSE A;  3K0L A;  4I01 A;  4NB5 A;  3ISP A;  1TW2 A;  4RS8 A;  2CW0 F;  1IXS B;  1XSX A;  2NS0 A;  1YQA A;  1FP2 A;  1T39 A;  3ERE D;  4Y15 A;  2KIF A;  3F8N A;  4UHT A;  1FWZ A;  5DCF A;  2F5F A;  2UWM A;  3TKY A;  4ESF A;  2H94 A;  2J5P A;  4M6Y A;  2PQ8 A;  1QZY A;  4LLG F;  2PBI A;  2JTV A;  2FBI A;  2B0L A;  2LKP A;  1L0O C;  2QM3 A;  3WGI A;  3IRR A;  3R6S A;  3TDZ C;  5HDG A;  4CDG A;  1KYZ A;  2IA1 A;  4BXU A;  5EEH A;  4I98 B;  3SZT A;  5JI6 A;  4P55 A;  4MTD A;  3H92 A;  3LAJ A;  1FX7 A;  2RC4 A;  4HV6 A;  2DPD A;  4LB6 B;  2XAF A;  4LGW A;  2IJL A;  3CTA A;  4F7Z A;  3NEU A;  4M9Z A;  3HYI A;  2DT5 A;  3M1E A;  5ICC A;  3EYY A;  3WU0 A;  1LEA A;  1R1V A;  3RIR A;  1R58 A;  4LB5 A;  1Z05 A;  2V6C A;  1KU3 A;  3H3Z A;  2RVC A;  1K78 B;  2DLL A;  1IN6 A;  1K7A A;  4A5M A;  4YFX F;  2XAJ A;  1RNL A;  3R4K A;  4PGG A;  2STT A;  2DFI A;  2P7V B;  1MKM A;  4LK0 F;  5HS7 A;  1HW2 A;  2P7C B;  2HTS A;  2M5W A;  3SFZ A;  3RJP A;  4XLP F;  1IN8 A;  4O6J A;  1Q1H A;  1U78 A;  1LDD A;  3M8F A;  2F2E A;  2FML A;  1HKT A;  2VE8 A;  2PEX A;  2RKH A;  3F8C A;  1BIB A;  3U9G A;  5J6X A;  2UXX A;  4L0Z B;  3VOD A;  1XMK A;  2EFW A;  3LFK A;  1QPM A;  2DK8 A;  3TOA A;  4CHU A;  3FMR A;  5L3B A;  4BYY A;  1I27 A;  2Y48 A;  1O7L A;  2K4J A;  1WKM A;  2ZBK A;  3KZY A;  3V7R A;  1DDN A;  3HRM A;  1X3U A;  5HLH A;  1FP1 D;  1ON2 A;  2JPC A;  3N4M A;  3IKV A;  2FE3 A;  1ZN2 A;  3CO6 C;  1K79 A;  2QZ8 A;  3EUH A;  3ZQ7 A;  4KIF A;  3Q5F A;  4I0A A;  4BHB A;  4EM2 A;  4HF1 A;  2Q2E A;  3MQ0 A;  1I1S A;  4Z2Y A;  5ICF A;  2YR2 A;  2ISY A;  2ETH A;  1FT9 A;  4IPA A;  3KLO A;  2L02 A;  3ABT A;  4K2E A;  4L0Y B;  4LG0 A;  2A6H F;  4ZYD A;  4ZZD A;  2WWY A;  3LST A;  2M30 A;  3EDP A;  3KE2 A;  4RGX A;  3ROU A;  1WSU A;  2K02 A;  2HTJ A;  4B09 A;  2EFN A;  4FT8 A;  4CO8 A;  2DK5 A;  2WV0 A;  4ZZL A;  4BAY A;  3L09 A;  3WTX C;  2CWE A;  5ERI A;  2LNB A;  3P7N A;  2RDP A;  5AIP A;  1RI7 A;  3SZP A;  2DPU A;  2ESH A;  2VBY A;  4BHC A;  2XIG A;  5CJ9 A;  5D6F A;  1MDM A;  3SHF A;  5FB2 A;  4KN4 X;  3PQK A;  2V79 A;  2BGC A;  1TW3 A;  4HDU A;  1OR7 A;  3K1P A;  3CUQ A;  1O3T A;  4KIC A;  3KP3 A;  3BY6 A;  5D5X B;  1F4K A;  1Z7U A;  4IHS A;  2CQK A;  2FRH A;  4U0Y A;  2A3S A;  4A0Z A;  2OU2 A;  2VOP A;  2BYV E;  1ZG3 A;  1FSH A;  2BV6 A;  1ZRE A;  3JAM K;  2C6Y A;  3Q9S A;  4IXA A;  4L9T A;  2R3S A;  4EQQ A;  2ZCW A;  3E6C C;  1YFH A;  1E17 A;  3DXJ F;  3KP5 A;  5LLQ A;  3ULQ B;  2MLG A;  1UST A;  1OYY A;  1SFU A;  2JPB A;  3U2R A;  3ZP5 A;  5IT9 Z;  5BPI A;  1T98 A;  3KEQ A;  1YLF A;  4GYG A;  1P2F A;  3PFI A;  4EM0 B;  4EJO A;  4U88 A;  4HDV A;  1OKR A;  1TQM A;  2ZFW A;  3R61 A;  2YU3 A;  4P96 A;  5ICE A;  2YX4 A;  5LGT A;  3JAM Z;  1YIO A;  4CIC A;  1KGS A;  3HTU A;  4P9U A;  2OBP A;  1Z9C A;  3V8K A;  1G3T A;  3HHH A;  4AVP A;  4IRH A;  3HSF A;  1G3S A;  3IHU A;  1ONV A;  1A04 A;  5D8K B;  4CZZ A;  1HW1 A;  3C3W A;  3P9K A;  3GUD A;  4DNC A;  1R7J A;  1T38 A;  3JTH A;  4OMY A;  1JXS A;  5FLX Z;  4G9Y A;  2FMY A;  1RIO H;  3GLX A;  3FXR A;  5FFZ A;  2G9W A;  2G7U A;  2A68 F;  5D4S A;  4HQE A;  2M8E A;  5HVQ C;  1IXR C;  2XAQ A;  2YSR A;  3WE2 A;  4HV5 A;  1J59 A;  4OIQ F;  4PGH A;  4IF4 A;  1MJA A;  3O6B B;  1FPQ A;  2FQ3 A;  3KZZ A;  4M72 A;  5H20 A;  1Z6R A;  5IT3 A;  4N9I A;  2G7H A;  3RKX A;  3K69 A;  4YIF A;  3HRU A;  2D2W A;  4Q47 A;  4YG2 F;  1S29 A;  1ZRF A;  3REO A;  1RUN A;  3WTT C;  1YYV A;  4I7H A;  1TBX A;  4KMF A;  2P6S A;  3K1M A;  3GFJ A;  2QBY B;  4RGS A;  1K6O A;  1HKS A;  3RDI A;  2IA2 A;  5L3C A;  4MTE A;  1H9T A;  3MCZ A;  4QLC U;  3DFG A;  2P4W A;  5D5W B;  1ODD A;  3FM3 A;  3BPV A;  1EV7 A;  4EJT A;  4JK1 X;  2F5D A;  2OA4 A;  3RKY A;  1UHW A;  1T2K A;  4RAY A;  1R1T A;  4AIJ A;  2QQB A;  3HIF A;  1U2W A;  3KCC A;  3MZH A;  3E5Q A;  2ISZ A;  2K7L A;  2PFB A;  3L9F A;  1D5V A;  2EV0 A;  3HRS A;  4HYE A;  2DO7 A;  3GEZ A;  1B9M A;  2IRF G;  1XGM A;  2ZJ2 A;  2LF8 A;  1O7F A;  3F8F A;  3I59 A;  2A69 F;  5E8I A;  1CF7 A;  4AD9 A;  2VBZ A;  4MNU A;  3C7J A;  3T8R A;  4WK8 F;  3COA C;  4MGR A;  2Y75 A;  3CLO A;  2LF7 A;  1P4W A;  1FBS A;  4Q4Z F;  4Q5S F;  4HA8 A;  3W6J B;  5DD8 A;  5K1Y A;  5LEJ A;  3DKW A;  2XVC A;  1T0F A;  4KMU X;  4KIG A;  3E5X A;  4S04 A;  5LBQ A;  3B73 A;  2XRN A;  1RZ4 A;  1U3E M;  1ZYR F;  2PMU A;  2NNN A;  2VBW A;  1O3Q A;  4ZYH A;  3T1B A;  5HS9 A;  3ECO A;  2ZME A;  1H9G A;  4EMS A;  1S6L A;  4L5J A;  1TTY A;  2E7W A;  3JSO A;  1ZGA A;  3C1D A;  4GO1 A;  5D8L B;  3WG9 A;  1J2X A;  3QU6 A;  4KUM A;  3GZ5 A;  2VC0 A;  4U0W A;  3GX4 X;  2GAU A;  2Y0M A;  4BH9 A;  1IUY A;  4LMY A;  2DI3 A;  2OZ6 A;  4AIH A;  2R7D A;  2FOK A;  1T6S A;  2L01 A;  3WTU C;  2JZY A;  1L3L A;  3QP5 A;  4GXO A;  5E8G A;  3SQN A;  2ZO4 A;  2FNA A;  4KT5 C;  3L00 A;  5FO5 A;  5D6E A;  2FNP A;  2WTE A;  3MFK A;  2L54 A;  4GYI A;  3CJN A;  1FYM A;  3R0J A;  2BBY A;  3EQL F;  2E1N A;  2UXN A;  3FMQ A;  4LD5 A;  3U1D A;  2UZK A;  5E1X A;  1JE8 A;  4KNY A;  3AAF A;  4B8X A;  3VFZ A;  2GA1 A;  2DQL A;  4HBL A;  1EH8 A;  1EH7 A;  2YX7 A;  3JW4 A;  2BE5 F;  1U8R A;  2ZNY A;  3WGH A;  3P9C A;  4WF2 A;  1W4M A;  1ZLK A;  2EV6 A;  2FA5 A;  1HXD A;  4HLY A;  2W85 A;  3K2Z A;  4M9X A;  4CGZ A;  3BDD A;  5HDN A;  2IA0 A;  4MEX F;  3I0T A;  1MJB A;  3KP7 A;  3TO9 A;  2FXA A;  3I5U A;  3OOP A;  1XCV A;  1JHH A;  1IRF A;  2ACJ A;  5CYV A;  1FBQ A;  3LA2 A;  3R0A A;  5J8C A;  1YTY A;  4TV7 A;  4PZJ A;  2DQR A;  1XCB A;  2QWW A;  1IZ1 A;  3V8J A;  3M8E A;  2HR3 A;  1YW7 A;  1SD4 A;  1YG2 A;  2MH9 A;  1F9N A;  3G3Z A;  3NRV A;  5ILV A;  5TRD A;  1MD0 A;  2NAZ A;  4LK1 F;  1XSD A;  2HFH A;  3I64 A;  4OU0 A;  2PMH A;  1TNS A;  3K1N A;  3D5L A;  2O61 A;  4XLN F;  1ZAR A;  5JVT A;  5BOX A;  3FF5 A;  2OD5 A;  3EYI A;  4IJA A;  1IAW A;  1IN4 A;  2KJB A;  2RNJ A;  1S7O A;  3T0Y A;  4UUV A;  4RAZ A;  3OV8 A;  2NYX A;  4U7D A;  1PUE E;  1ZAO A;  4E70 A;  1UCR A;  4OOI A;  3ZMT A;  1P92 A;  2VC1 A;  2HGC A;  2D1H A;  3LQQ A;  2PG4 A;  1J75 A;  5CVI A;  3T5X A;  1J7K A;  2VT3 A;  3V8L A;  5A2Q K;  4HQM A;  1PP8 F;  2MC3 A;  4EJW A;  2EFP A;  5TJJ A;  5D5U B;  5HLI A;  3RKW A;  4EVI A;  4UNO A;  4FX4 A;  2ELH A;  3GWZ A;  1AWC A;  4UV9 A;  1WRJ A;  3K9T A;  3ZMV A;  1O3S A;  3V7C A;  2QVO A;  4A6D A;  1O3R A;  4A2U A;  4M9S A;  3HRT A;  1LDJ A;  4D0P A;  3GZ6 A;  2KJC A;  4HW0 A;  2GXB A;  2A07 F;  1RUO A;  2XAG A;  1S8N A;  4L5I A;  2IPQ X;  3ZN1 A;  4LJZ F;  4KYW A;  3V7S A;  2MLK A;  2P5L C;  2ZNZ A;  1F1Z A;  3IWF A;  4HX7 A;  1IN5 A;  1CF7 B;  1XGS A;  4EGY A;  2FBK A;  3KLN A;  2Z5U A;  4FHT A;  1MDM B;  4I09 A;  3E6D A;  5DEQ A;  2OZU A;  3ELK A;  3IRQ A;  2WC2 A;  3FXQ A;  2VXZ A;  2JT1 A;  2CO5 A;  4HZF A;  1GXP A;  3F23 A;  3QRF F;  2RQP A;  2EFQ A;  2XAS A;  4R8H A;  5K5Q A;  2CYY A;  3MZY A;  2ADU A;  3V4G A;  2XRO A;  2VN2 A;  3F6O A;  2XUB A;  2HQN A;  3L2C A;  3VEP A;  4EJV A;  1LDK B;  1LEB A;  3RI4 A;  2Z3Y A;  3F22 A;  4IVN A;  5E20 A;  2OAZ A;  2YPR A;  2O6G E;  3C18 A;  2QEN A;  4L9J A;  2HKO A;  2L4M A;  3F3X A;  2AXL A;  1BOA A;  1YS6 A;  4BNC A;  1U5T B;  1D8K A;  5L3F A;  3R60 A;  4IHT A;  1WQ2 A;  1H0M A;  1B1B A;  2V1X A;  5HLG A;  2LDU A;  2R7F A;  4A6E A;  3ZPL A;  4ESB A;  4EM1 A;  1SAX A;  3L7W A;  3M7G A;  2K4B A;  2F5C A;  4ZYE A;  3WTW C;  4P9F A;  5K5O A;  3WTY C;  2ZKZ A;  5DCM A;  1YW8 A;  1BC8 C;  1HST A;  3E5U A;  4RB3 C;  5J8F A;  3F8B A;  4OIR F;  1QQI A;  1R22 A;  1D8J A;  4RB1 A;  2ZME B;  1HBX G;  2CFX A;  3LWF A;  1KU2 A;  3DEU A;  1PDN C;  1KQ8 A;  1ZRD A;  5ED4 A;  3ABU A;  4G7Z F;  4ZH4 F;  2L3D A;  5AON A;  1S7A A;  4NHJ A;  4ZYG A;  4O5V A;  5AIQ A;  1TQP A;  1ZLJ A;  2CG4 A;  1FC3 A;  2DBB A;  1BI2 A;  2GQQ A;  2P8T A;  1UFM A;  1XMA A;  3FMS A;  2HQR A;  4IRI A;  5ILU A;  3IKT A;  2CSO A;  3J80 K;  4RB0 A;  2V9V A;  4ENM A;  5LEK A;  3KEO A;  1S3J A;  2IT0 A;  1ZH5 A;  5FLX K;  5BPD A;  3F72 A;  1P4A A;  1E2X A;  5CVV A;  3CDH A;  4RGR A;  1KU9 A;  2HYF A;  1XGN A;  4U0V A;  3LQR A;  4UV8 A;  4G8X A;  4Q48 A;  5DUK A;  4N0B A;  3ZMZ A;  4HAM A;  1R5H A;  3VB2 A;  2QUF A;  4LFU A;  5FD5 A;  2O8X A;  1HKQ A;  1FOK A;  3I53 A;  1R00 A;  2XKP A;  4I2O A;  2KIU A;  2L4A A;  3CUQ C;  5LHG A;  4R79 A;  2GA2 A;  2NRA C;  2JSC A;  2DU9 A; 
#chains in the Genus database with same CATH topology
 2A05 A;  2LY2 A;  2ELK A;  2IAI A;  4Y17 A;  3HSR A;  2DOE A;  2QEX I;  1SD5 A;  3PQJ A;  4XK4 A;  3U21 A;  1SVL A;  1KA8 A;  1R23 A;  2B7E A;  3PNT A;  5J3L A;  2FEZ A;  2GXG A;  2M0C A;  1G3W A;  3JSP A;  3HTS B;  3WE3 A;  1YS7 A;  1GHC A;  2E19 A;  2XPW A;  5CQG A;  3J81 K;  2DFH A;  3BWG A;  2F5E A;  2D1V A;  2KIM A;  3HUG A;  2HS5 A;  5IPA A;  1ZK8 A;  2WAQ N;  4JQF A;  1OYI A;  3KIO A;  1G3Y A;  2M0M A;  3PSI A;  4WX9 A;  5DUI A;  3W6K B;  3HXL A;  3B02 A;  4XN0 A;  2K27 A;  3BZ6 A;  2VQH A;  3EET A;  1J9I A;  1UG2 A;  2X0L A;  1QNT A;  2M4G A;  5ILS A;  1YJ9 I;  1LQ1 A;  1G59 A;  1Y39 A;  5H6R A;  3I59 B;  2HNH A;  4GGG A;  2JN6 A;  1IGN A;  1DPU A;  3BJ6 A;  2BY3 A;  2KT0 A;  3Q0V A;  2X1E A;  2E1M C;  1V5F A;  3OYM A;  4HNU A;  4EGZ A;  5J40 A;  2O3F A;  1BI3 A;  1JHF A;  4RB2 C;  1GV2 A;  3CO7 C;  2I8D A;  3QAH A;  2BHY A;  1JI8 A;  2V26 A;  3KP6 A;  4E7S A;  4A0X A;  5ICG A;  2M4K A;  3OYK A;  2GZW A;  4C3J J;  5IYD J;  2Z9O A;  2R4G A;  1W7P D;  3SXY A;  3CJR B;  2KIS A;  2XHK A;  4NBQ A;  3CC7 I;  4FQG A;  1D3Y A;  3F8M A;  3NWT A;  5LRR A;  3DPU A;  1R9T J;  2MGQ A;  2ECC A;  2HZT A;  4YFN F;  2H09 A;  2DAO A;  3HGG A;  5K5R A;  1V5E A;  3O3K A;  2WY7 Q;  3CP8 A;  5E1W A;  2COB A;  3RTR A;  1G6N A;  1V4R A;  2QF7 A;  4MQV A;  2N8G A;  4MLO A;  2HYG D;  2OPT A;  4RGU A;  4F92 B;  1YOV B;  1YIJ I;  1EH6 A;  2BEO A;  3BJA A;  2EFO A;  1B59 A;  4PJN A;  3A01 B;  2KRF A;  2VON A;  2ZXH A;  1JTY A;  2W84 A;  1IXC A;  1F5T A;  2K9Q A;  3RPU A;  5FLV A;  3KYC B;  3IL2 A;  2L7F P;  3J80 Z;  2V1N A;  5JFR A;  5DD4 A;  1LUJ B;  1B6A A;  1IRZ A;  1JKO C;  1UG0 A;  3I55 I;  1A6I A;  3CME I;  4YII A;  2IS2 A;  1FLI A;  1DP7 P;  3HHG A;  3FDY A;  2XAH A;  4ZC3 A;  2WAF A;  3ZMD A;  2EQR A;  2A5Y B;  4Y13 A;  2STW A;  4II2 A;  2QBY A;  1BL0 A;  3BJO A;  3LSI A;  3LAP A;  2OQG A;  5EZH A;  5H6Q A;  5LRS A;  1LFB A;  4KIB A;  2VT2 A;  1REP C;  3WTZ A;  1FMW A;  1W5C C;  1Y0U A;  3OS0 A;  2CQN A;  4DYR A;  2H6C A;  1WPK A;  4XSZ F;  4BEH A;  2E5N A;  1MGT A;  2MD5 A;  3ML6 A;  1KQ0 A;  4AWX B;  2QCO A;  2VB6 A;  3SFI A;  5FRO A;  1T56 A;  3FHZ A;  3GF2 A;  1X4P A;  1WJE A;  2FBH A;  2DA6 A;  1LE8 A;  4HF2 A;  4KA4 A;  5B1A H;  3S2D J;  1BA5 A;  1G4D A;  2IXS A;  3ABK H;  2WV1 A;  2MH2 A;  2X1D A;  4PCQ A;  3I58 A;  3GTG J;  3GLL A;  3QOD A;  3LA7 A;  2M87 A;  5LFA A;  1VQK I;  4B4C A;  3S3N A;  3CF2 A;  3H0D A;  1TC3 C;  2JA5 J;  4KDP A;  1BJA A;  1FBU A;  2FSW A;  5KK1 A;  3LNQ A;  4ETS A;  4G6D A;  2WB1 N;  3I9V 2;  2M34 A;  1YHQ I;  1Y8Q B;  2X6W A;  5FGM A;  4S05 A;  3JRI A;  3BRO A;  4B3A A;  4YFK F;  2KFD A;  4HLX A;  3HDD A;  1H89 C;  3BTL A;  3CF5 F;  1SEU A;  3NQO A;  5EEG A;  4FE4 A;  4BHP A;  2XF5 A;  2XC7 A;  1D5Y A;  1SFX A;  2A5W A;  2CW7 A;  5E1Z B;  1BW5 A;  3KFW X;  4XR6 A;  3M4O J;  3L2R A;  1Y56 A;  1DU0 A;  3A0B C;  1BIA A;  2X6X A;  1T33 A;  1WI9 A;  2P5V A;  2Z33 A;  1MBG A;  3S3O A;  1ULY A;  4BUP A;  1OPC A;  3KX2 A;  1H88 C;  3TO6 A;  3BQZ A;  3K4J A;  4Y7N J;  1LVA A;  1FY7 A;  2PN6 A;  2QA4 I;  4FAS D;  3TGN A;  3K4M A;  1VQ8 I;  3QPS A;  1DU6 A;  5M5X J;  5LHH A;  2PJP A;  2H6B A;  4E4H A;  2CRG A;  4ZTF A;  2E60 A;  4HF0 A;  1HDD C;  2QQ9 A;  2R7Q A;  1ZG1 A;  2HDC A;  4AIK A;  4A12 A;  1WH7 A;  2A61 A;  4UUT A;  2XB5 A;  4Y4R A;  3SEQ A;  4D1Q A;  2X51 A;  4CSW A;  3BG9 A;  3J7A O;  5LD2 C;  1ZGJ A;  2O03 A;  3J81 Z;  2CGP A;  4G7H F;  4W97 A;  3EUH C;  5FKN A;  4H0E A;  4E7I A;  5L3G A;  3DF8 A;  3HKZ A;  5IP7 J;  1FOX A;  4ESJ A;  2X9D A;  2Z99 A;  3S1R J;  3GTL J;  2LY1 A;  2M45 A;  2VL8 A;  3BZC A;  1GT0 C;  2KKO A;  2HKX A;  3HBL A;  2EK5 A;  1BN5 A;  2PMZ N;  3O2P E;  2KMU A;  4C2U A;  2VOD A;  3QU3 A;  4CYD A;  3OWT A;  3S8P A;  4ZYA A;  1VQ5 I;  4I0B A;  2W1O A;  3UR3 C;  5DDG A;  3K4K A;  4KN7 X;  3BPX A;  3FZV A;  5JLW A;  4L18 B;  3ECH A;  3QPT A;  4CYC A;  5CVU A;  2OC6 A;  5HDK A;  1IDY A;  4BGD A;  3V42 A;  5LHI A;  1XMX A;  4UVA A;  5F1R A;  3W3C A;  2RV8 A;  1XDS A;  5D5V B;  3HOT A;  4A3I J;  3BLY A;  3LA3 A;  4UVB A;  1GDT A;  1Z6T A;  2CUE A;  3ONQ A;  1HDP A;  1W5T A;  4BQO A;  4CXF A;  1UB9 A;  2JSP A;  5M5Y J;  3GFI A;  3BR1 A;  2KPM A;  3IWZ A;  1ZRC A;  2H1K A;  2W57 A;  4A0Y A;  3VOE A;  3HJE A;  1TWC J;  4EJU A;  3A2K A;  3Q3S A;  4A3G J;  1KQ9 A;  5DV5 A;  1VTN C;  2VE9 A;  1I1G A;  3I54 A;  1IN7 A;  2GOM A;  3HL2 A;  1FMV A;  3FKJ A;  5HNF A;  3CUQ B;  2NOG A;  3QP6 A;  1ETO A;  4XLF A;  1Z67 A;  4E7L A;  2UV1 A;  4D5C A;  3CUO A;  2VAS A;  4M3E A;  2E7X A;  2NNY A;  2XV4 S;  1FYL A;  4CCM A;  1TLH B;  3A4C A;  4WWC A;  4WXH A;  2E2I J;  2JJ7 A;  4BXX J;  1P7I A;  3GME A;  4GCV A;  2L7K A;  2FU4 A;  4ZJZ A;  1HQC A;  4GDF A;  2JA2 A;  1ZQ3 P;  1T08 B;  4FET A;  1KYW A;  1OCZ H;  4BY1 J;  2X4H A;  2FD5 A;  2EJR A;  4UXN A;  3I71 A;  1K83 J;  4LLL A;  5F08 A;  4M6V A;  1STZ A;  4M6X A;  1B8I B;  4R1H A;  2TDX A;  4HX8 A;  4BDZ A;  4MQ9 F;  3FXU A;  2A6E F;  2HI3 A;  4XID A;  4OIP F;  2JA8 J;  4PJJ A;  1QVU A;  3G71 I;  2ZSI B;  2DMU A;  1ZG5 A;  1VQL I;  4DIQ A;  2IGM A;  3KYD B;  1B9N A;  1OMI A;  1X1D A;  3GXO A;  1V54 H;  2XPU A;  4QSH A;  4IRG A;  4MHG A;  1WZ2 A;  2V1U A;  2P5K A;  4DYQ A;  1Z3X A;  1J5Y A;  3KET A;  3RZO J;  4HRI A;  1TT0 A;  4OIO F;  2HQ5 A;  1JUP A;  4BQA A;  2PI0 A;  1YRN B;  2R7Z J;  2CUJ A;  2R93 J;  1YO5 C;  5IT9 K;  3HB9 A;  1OCR H;  3H5R A;  4XSX F;  4IKF A;  1R49 A;  1FZP B;  3BCA A;  3DP7 A;  3KYL A;  1U6G A;  4EV0 A;  1QBJ A;  1C0W A;  2F4M B;  1FIP A;  5CVR A;  2BW3 A;  2HWV A;  3H5A A;  1IRG A;  5D4R A;  1XG1 A;  3O8H A;  3M9A A;  1ZHF A;  2Q2E B;  5DTD A;  2K86 A;  2R7V A;  1XDU A;  2OTJ I;  1Z1D A;  3MWM A;  1W36 D;  5FFX A;  1T0F C;  3FM5 A;  3OIQ A;  1DPR A;  3NWS A;  2V4J C;  3H0G J;  2DTZ A;  3H9J A;  5BNG A;  1OIS A;  1ZR2 A;  1BOB A;  3FXK A;  2MA3 A;  4LLN A;  4M71 A;  1UHM A;  4ZDL A;  5C4X J;  4JOM A;  1DGW Y;  3MZ8 A;  1PP7 U;  1LB2 A;  2LH9 A;  1OFC X;  3DPT A;  1F43 A;  5L3E A;  1WJ5 A;  4BDY A;  4G7O F;  2KL4 A;  4I99 C;  5GTH C;  2KZV A;  2LC2 A;  3SZG A;  4B1R A;  5E3N A;  3S2W A;  1FNN A;  2QQA A;  4ON0 A;  2ZFU A;  2LYC A;  4RM3 A;  3VYT B;  3CJT B;  1GV5 A;  1OCO H;  3K4L A;  4WXD A;  1R5G A;  3TED A;  1USS A;  2WA0 A;  2XRL A;  2CS3 A;  3LMM A;  3OL3 A;  5JR3 A;  3ZN0 A;  1P6R A;  5K7Z A;  2K85 A;  4E7J A;  4WCG A;  1IW7 F;  2VIX A;  4G6Q A;  3F21 A;  4IZZ A;  5E18 F;  1M1E B;  1XGO A;  2R7U A;  1MH3 A;  1BJZ A;  1PYV A;  2KQR A;  3LFU A;  2P6T A;  1GXQ A;  1HW5 A;  2MW8 A;  3N97 A;  3M07 A;  1TQI A;  4O3M A;  2DTR A;  1IDZ A;  1GVJ A;  1XD7 A;  1U5T C;  3S1N J;  5CLS A;  1XB4 A;  4E6K G;  4P5O A;  4P1W A;  3GW2 A;  1NHA A;  2AQF A;  2K5C A;  4AM3 A;  1W5S A;  4AVZ A;  2H27 A;  4ZDP A;  1SMT A;  1SFE A;  5JHU A;  2JRM A;  1IRX A;  3BR5 A;  1MJ9 A;  2HOE A;  2QSH X;  2R7S A;  3BG3 A;  4CZC A;  2V6E A;  4X1E A;  3BTI A;  1AOY A;  2AS5 F;  2OV7 A;  1P7J A;  3FK6 A;  3E3V A;  4IO9 F;  1W7P B;  5IP6 A;  1QZZ A;  1R36 A;  4JBA A;  2XB0 X;  3ZXS A;  3G1L A;  3TDU C;  1J0R A;  1YX5 A;  4PJ0 C;  2GIV A;  1WH5 A;  2L9N A;  3RKQ A;  4U7B A;  3DTE A;  1WJC A;  2DOD A;  3WU1 B;  3J7A Y;  1H8A C;  3UNG C;  3CP2 A;  3UKG A;  2EWN A;  3GFM A;  1NG6 A;  1BBY A;  1P4X A;  1SD6 A;  1BM9 A;  4MEY F;  4XNF A;  4I76 A;  3TQN A;  4RDU A;  4HOB A;  4C3H J;  4ENK A;  1I6X A;  5HOO A;  2EA2 A;  3JRB A;  1X1B A;  3JRF A;  2ZJR F;  1HA8 A;  3DLA A;  3BOQ A;  3E6M A;  5HS8 A;  1FYK A;  2D45 A;  4DQ2 A;  4DYC A;  3P9I A;  4L9N A;  2BZT A;  3KPH A;  4HX4 A;  4V2F A;  1PUF A;  1WFX A;  5LGU A;  4J19 A;  2WAD A;  4IL6 C;  2CMP A;  1VQ6 I;  1OYW A;  1SD7 A;  4PDK A;  1AU7 A;  1J09 A;  1V3F A;  2MAB A;  3ZRG A;  2Q8K A;  1O57 A;  4BE2 A;  3DQV C;  1AA7 A;  2Q0O A;  2TRT A;  3I3L A;  2ESN A;  1B4A A;  2IVM A;  3GCM A;  1KU7 A;  2VKV A;  1IF1 A;  2CV0 A;  2M7B A;  2W00 A;  2HXO A;  2MYS A;  1Z91 A;  1W7P A;  4L5E A;  4LG0 B;  3E6B A;  2RGV A;  2EV5 A;  3D0S A;  4BU2 A;  4LIV A;  4X6A J;  4XRF A;  1PJR A;  5CQE A;  3I4P A;  1XN7 A;  3RYP A;  5F6F A;  4OIN F;  2L9R A;  3ZMS A;  3O8G A;  3PL8 A;  2VQG A;  4Y3O A;  1SAN A;  3QPH A;  2ZJP F;  4A3B J;  4DOZ A;  4I02 A;  5A2Q Z;  4A5N A;  3RYR A;  4NQW A;  5EG0 B;  2GBY A;  4G94 A;  2JRT A;  2E1C A;  3FX3 A;  2MBF A;  3GFL A;  3T8T A;  2OQR A;  1MZB A;  2A6T A;  2FUG 2;  5L3D A;  3BTJ A;  4PFP A;  1V5G A;  2XKO A;  4DBR A;  1R4N B;  2F4O B;  2HDW A;  3G73 A;  3TOB A;  3RPQ A;  2XGE A;  4QPO A;  5LGN A;  3RSN A;  2JWT A;  3BP8 A;  2O0Y A;  3K4B A;  4BS9 A;  2XGD A;  1D0Z A;  3LSK A;  4M74 A;  4ENJ A;  1WGX A;  2L0K A;  4UUS B;  1VQP I;  1MMD A;  2FF4 A;  5HLT A;  5DYM A;  4M73 A;  2Y9Y A;  1RR8 C;  1JT0 A;  1JGS A;  4KIS A;  2RRE A;  5CVJ A;  3FXL A;  3IC7 A;  4BY7 J;  5GPC A;  1RRJ A;  4XBF A;  1HC8 A;  2XAU A;  2LSO A;  2DA1 A;  4CCK A;  3JRH A;  2E5Z A;  5BQT A;  2W82 A;  3H3U A;  1HSJ A;  2O5R A;  2LRD A;  2VOO A;  5IOZ A;  1FSE A;  2K9M A;  3BG7 A;  3GO5 A;  2OUM A;  4II3 A;  3AL0 C;  2PX9 A;  5EJC A;  3OY9 A;  5DCM B;  2DW4 A;  2WY8 Q;  6PAX A;  3WG7 H;  4C3I J;  2QLZ A;  1BC7 C;  5FRN A;  2J5O A;  1JJ6 C;  3KP4 A;  4ANJ A;  3H1C A;  1MND A;  5JHF A;  1I5Z A;  2VBX A;  4JX4 A;  4OMZ A;  1R1U A;  3ZMU A;  2JQ7 A;  3MEX A;  1QGP A;  3WGG A;  4CUG A;  2PLY A;  3C2G A;  3WOD F;  2W24 A;  1DGR M;  3DPL C;  3MAJ A;  3D5S C;  3GYH X;  3RQ4 A;  2RN7 A;  2NOJ B;  1TNT A;  4HSR A;  4PK4 A;  5TIS C;  3Q9V A;  5E3M A;  4J00 A;  2VPR A;  3ASN H;  2M1B A;  3FWE A;  4C2T A;  1WWX A;  4FX0 A;  1WHU A;  5EG0 A;  2W25 A;  3ZQH A;  4LG3 A;  1CGP A;  1U5T A;  3E97 A;  2ZXI A;  4KFC A;  2IGO A;  1LNW A;  1LPQ A;  2E1O A;  3TMO A;  1SMY F;  1PVE A;  1XSV A;  3OR1 C;  1F36 A;  1BI0 A;  4QTR A;  3PJR A;  3EUA A;  5DM6 F;  1BW6 A;  5BS6 A;  1ZGW A;  3C2B A;  1K78 A;  4WXC A;  4DBQ A;  2GWR A;  5FD6 A;  3MKW B;  4M3B A;  2IW5 A;  1LJ9 A;  4ASN A;  3KEY A;  2BHZ A;  4N9H A;  2EA4 A;  4XOP A;  3DV8 A;  4IHV A;  2XGX A;  2BOL A;  2EZL A;  2COM A;  3H3V K;  4IQJ A;  1NTC A;  1Q1V A;  3GVA A;  3A03 A;  4IEJ A;  5J1R A;  2CH0 A;  3TO7 A;  3HOS A;  1MMG A;  1Z7L A;  1QO0 D;  2Y0S N;  3BC8 A;  2VPL A;  3F6V A;  2P0W A;  3WTV C;  1W0U A;  4L9V A;  3KP2 A;  1VFC A;  5KVR A;  5F64 A;  2LLK A;  2VKE A;  4D7M A;  1BI1 A;  2DYS H;  3JTG A;  1ON1 A;  4W1U A;  1X3W B;  1YX3 A;  4UB8 C;  3QOP A;  5BMZ A;  2QYO A;  2WB1 A;  4UVC A;  1YW9 A;  3OIO A;  4PSX A;  2E2H J;  4CCN A;  2ZXJ A;  3WTS C;  2V1D A;  5E17 F;  2IP2 A;  4BBS J;  4KJZ A;  4QWQ A;  2DCE A;  2DYR H;  3CCS I;  3S15 J;  1DUX C;  3SJM A;  4ENN A;  2HEO A;  2EB7 A;  3OYG A;  3HSE A;  3K0L A;  2ID6 A;  4I01 A;  4NB5 A;  3ISP A;  3VYR B;  2K40 A;  1TW2 A;  4RS8 A;  2LTP A;  2CW0 F;  1IXS B;  1ERD A;  3S93 A;  2KIQ A;  2Y2Z A;  3H5N A;  4A3K J;  1XSX A;  2BVL A;  2DJI A;  2NS0 A;  1FEX A;  1YQA A;  2LK2 A;  1FP2 A;  1T39 A;  3ERE D;  1WI3 A;  4DJA A;  4Y15 A;  3CQZ J;  2D5V A;  4OAY A;  2EZI A;  2XSD C;  2KIF A;  3F8N A;  3W6V A;  2DJN A;  4UHT A;  1QZE A;  4GRI A;  1VQM I;  1FWZ A;  5DCF A;  4RBO A;  2F5F A;  2UWM A;  4MIM A;  3Q0U A;  3RCO A;  3TKY A;  4ESF A;  1VF9 A;  2H94 A;  2J5P A;  3AG1 H;  4M6Y A;  3WHB A;  2PQ8 A;  3JRG A;  1QZY A;  2VQL A;  3NAR A;  3HKZ N;  1IV6 A;  4LLG F;  2PBI A;  2JTV A;  2FBI A;  1Y6I A;  2VXD A;  2ICW G;  3OR2 C;  2LY9 A;  2AHQ A;  2B0L A;  2LKP A;  1L0O C;  2QM3 A;  5F0C A;  3GTK J;  3CJQ B;  3WGI A;  3HPH A;  1S7E A;  3K6G A;  3OYB A;  3IRR A;  3DBH B;  2NVX J;  3K10 A;  3RZD J;  5F04 A;  5IYC J;  3DEE A;  3R6S A;  3TDZ C;  5HDG A;  4CDG A;  5DM7 F;  2I5U A;  1KYZ A;  5J47 A;  2HDD A;  1E0E A;  4CH7 A;  4BL0 B;  3HOV J;  3ABM H;  2IA1 A;  4BXU A;  1FIA A;  3DTI A;  4XKV A;  5EEH A;  4I98 B;  3SZT A;  3CLQ A;  2VI6 A;  5JI6 A;  4P55 A;  4MTD A;  3H92 A;  3BZK A;  3LAJ A;  1FX7 A;  4KIT B;  1QRY A;  4AID A;  4RLF A;  2RC4 A;  4I6Z A;  2WBM A;  4YEL A;  5FKL A;  4HV6 A;  2DPD A;  2M8G X;  3DU5 A;  2R0Q C;  4LB6 B;  2XAF A;  4LGW A;  3CTA A;  2IJL A;  2DMP A;  4F7Z A;  2DMT A;  3NEU A;  3HYI A;  4M9Z A;  2DT5 A;  1AHD P;  3M1E A;  2DA5 A;  5ICC A;  3EYY A;  3S16 J;  3ERM A;  3WU0 A;  3HEF A;  1LEA A;  1BR4 A;  1R1V A;  2HPI A;  2E36 A;  3RIR A;  1HLV A;  4A93 J;  1R58 A;  4LB5 A;  4UB6 C;  4DGW B;  2B63 J;  1Z05 A;  2V6C A;  3K70 D;  4BE1 A;  3CCR I;  1KU3 A;  2M9H A;  3H3Z A;  2NXN B;  3PFY A;  2EIN H;  2RVC A;  1K78 B;  2DLL A;  2MC4 A;  1LFP A;  1IN6 A;  2BW3 B;  1GUU A;  4YRV A;  3ZQL A;  1K7A A;  1OLT A;  3Q0W A;  4A5M A;  4YFX F;  2XAJ A;  2BXZ A;  1RNL A;  3R4K A;  2R92 J;  4PGG A;  2STT A;  3K2A A;  2DFI A;  2P7V B;  1MKM A;  4HST A;  4LK0 F;  1XPX A;  2XPV A;  3SDB A;  3OYC A;  1MW7 A;  5HS7 A;  1HW2 A;  2P7C B;  3HC7 A;  2HTS A;  2M5W A;  1X4O A;  3SFZ A;  2CUZ A;  2MD0 A;  2X6Y A;  4MO7 A;  3RJP A;  4XLP F;  4G6T B;  1IN8 A;  4O6J A;  1Q1H A;  3VSL A;  1LDD A;  1U78 A;  3M8F A;  2F2E A;  2LG4 A;  2FML A;  2IS1 A;  5C44 J;  1HKT A;  2VE8 A;  1SFK A;  2PEX A;  2RKH A;  3F8C A;  1BIB A;  3U9G A;  5J6X A;  2UXX A;  2Y0S A;  4CCL A;  4L0Z B;  3VOD A;  1XMK A;  3PSF A;  2EFW A;  2HVS A;  3LFK A;  1QPM A;  2DK8 A;  3KZI C;  3TOA A;  4CHU A;  1EA3 A;  3FMR A;  5IOY A;  5L3B A;  5FLM J;  1LE8 B;  4BYY A;  1I27 A;  4M3D A;  1T8I A;  2Y48 A;  1APL C;  2L7M P;  1EJ9 A;  1O7L A;  4B44 A;  1U0J A;  2K4J A;  1WKM A;  3AL0 B;  2OCE A;  2ZBK A;  1MBF A;  3KZY A;  3V7R A;  3L2W A;  1DDN A;  3HRM A;  3CMA I;  1X3U A;  5HLH A;  1FP1 D;  2GLO A;  4BJT A;  1ON2 A;  1EKE A;  2PMZ A;  5J4Y A;  2JPC A;  3IKV A;  1X58 A;  3JRA A;  3N4M A;  5CKT A;  2FE3 A;  1A31 A;  1ZN2 A;  3CO6 C;  5GPA A;  4RLQ A;  1X1A A;  1NK2 P;  1K79 A;  2LOO A;  1S72 I;  2QZ8 A;  1XC5 A;  2HZD A;  1HF0 A;  1RC9 A;  3EUH A;  3ZQ7 A;  2ZC2 A;  4KIF A;  3Q5F A;  2O9L A;  1MH4 A;  3HOX J;  4A3L J;  4I0A A;  4BHB A;  4EM2 A;  4HF1 A;  2Q2E A;  3MQ0 A;  3E7L A;  4NC6 A;  1I1S A;  2Y30 A;  1O4X A;  1MNM C;  4Z2Y A;  1MBK A;  5ICF A;  2YR2 A;  3DBR B;  3DLL F;  3RQI A;  2BY2 A;  2NVT J;  3DEW A;  2ISY A;  2ETH A;  4XRS A;  3DKY A;  1NK3 P;  1FT9 A;  4IPA A;  3TW7 A;  2O8K A;  3KLO A;  4HNT A;  5DS9 A;  4F93 B;  2L02 A;  3S1M J;  5EZG A;  1QU3 A;  5KNL A;  1MMA A;  3ABT A;  4NNJ A;  2LKX A;  4K2E A;  1TWH J;  3K4N A;  4L0Y B;  4LG0 A;  2A6H F;  4Y52 J;  5E3L A;  2QSF X;  4ZYD A;  1I6H J;  2H8W A;  1FTT A;  1D1B A;  3X2Q H;  4ZZD A;  1BR2 A;  5K7F A;  2WWY A;  5GAD J;  2E1M B;  3LST A;  3OYF A;  2F4I A;  2M30 A;  3EDP A;  5F0H A;  1LKX A;  3KE2 A;  4XIC A;  3J7Z I;  4RGX A;  1TL8 A;  1FTZ A;  3ROU A;  4BQN A;  3JRC A;  1WSU A;  2K02 A;  2HTJ A;  4B09 A;  2EFN A;  1K4S A;  4FT8 A;  4DZP A;  4CO8 A;  2DK5 A;  2WV0 A;  3AG4 H;  3FHN A;  4ZZL A;  1PUF B;  4BAY A;  2JA7 J;  3L09 A;  4FIS A;  2HOT A;  4IHX A;  4RMN A;  4CA0 A;  3WTX C;  4HG2 A;  2CWE A;  3MVP A;  1RKT A;  1Y0N A;  5ERI A;  3OYL A;  3M3Y J;  2LNB A;  3P7N A;  5J4V A;  1RKW A;  2RDP A;  4N4O B;  2HQA A;  3OSG A;  5AIP A;  2NS7 A;  1RI7 A;  3SZP A;  3FXM A;  4D9J A;  3LSP A;  2DPU A;  2ESH A;  2EIM H;  2VBY A;  2X48 A;  4BHC A;  3HUG B;  2XIG A;  3ZQC A;  1UAA A;  5CJ9 A;  1W36 C;  2DDB A;  5C3E J;  5D6F A;  4AYB A;  1MDM A;  2LR8 A;  3QYB A;  3SHF A;  4A69 C;  3OYD A;  5FB2 A;  4KN4 X;  3PQK A;  4ABZ A;  3JRE A;  1ETK A;  2E34 A;  2V79 A;  3ZCO A;  2BGC A;  1TW3 A;  4HDU A;  1OR7 A;  3K1P A;  3CUQ A;  1O3T A;  4KIC A;  3WHC A;  3KP3 A;  4E7Z A;  3BY6 A;  5D5X B;  3W2A A;  1F4K A;  1Z7U A;  4IHS A;  1OQY A;  4XLH A;  2CQK A;  1SFO J;  4A3J J;  2FRH A;  4U0Y A;  4V2G A;  2A3S A;  4A0Z A;  2OU2 A;  3PUB A;  2VOP A;  2BYV E;  2HVQ A;  2RNG A;  1ZG3 A;  5TGT A;  2HOA A;  1FSH A;  2BV6 A;  2Z1D A;  1ZRE A;  3JAM K;  1RET A;  1OCC H;  2K9L A;  3VSK A;  3EUK L;  4Z6Y A;  2C6Y A;  3Q9S A;  1MNE A;  4IXA A;  3AKZ A;  4L9T A;  2R3S A;  3GBG A;  4EQQ A;  2ZCW A;  5FKM A;  1VQO I;  2CU7 A;  3B6C A;  3JR9 A;  3E6C C;  2M2E A;  1YFH A;  1E17 A;  2OCC H;  3DXJ F;  2JUC A;  3AG2 H;  3LSR A;  4C30 A;  1S9H A;  5IYB J;  3KP5 A;  5LLQ A;  3ULQ B;  2MLG A;  1UST A;  1OYY A;  3BG6 A;  1SFU A;  2JPB A;  3U2R A;  2CUF A;  3BTC A;  3ZP5 A;  3OYH A;  1Y8R B;  3F9K A;  2IBD A;  3LSJ A;  3DWL E;  5E3O A;  5IT9 Z;  5BPI A;  1T98 A;  2EBI A;  1W1W E;  2WAQ A;  1YLF A;  3KEQ A;  4GYG A;  3BG5 A;  2JUG A;  2Y31 A;  1P2F A;  4BEH B;  3PFI A;  1OJL A;  4EM0 B;  4EJO A;  3I4M J;  4U88 A;  4N4N B;  1OKR A;  4HDV A;  1TQM A;  2ZFW A;  3R61 A;  5EF6 A;  3CCJ I;  2YU3 A;  4P96 A;  2HYJ A;  2YX4 A;  5ICE A;  5LGT A;  2CV1 A;  3JAM Z;  1YIO A;  3BCB A;  4CIC A;  2XGC A;  3P5J A;  1KGS A;  1MMN A;  3GTP J;  3OOU A;  4GFB A;  3HTU A;  4P9U A;  2OBP A;  1Z9C A;  4PJM A;  3PNY A;  3V8K A;  3PO2 J;  4LOC A;  1G3T A;  3HHH A;  2CFO A;  4AVP A;  4IRH A;  3HSF A;  1G3S A;  1WVR A;  1IV8 A;  3IHU A;  1ONV A;  1A04 A;  5D8K B;  4CZZ A;  4XQF A;  2FQ4 A;  1HW1 A;  3C3W A;  5C4J J;  3P9K A;  3GUD A;  2OF7 A;  1R7J A;  4DNC A;  1T38 A;  2K3P A;  3JTH A;  4OMY A;  3G1O A;  1JXS A;  2VJ4 A;  3FBN B;  5FLX Z;  3A01 A;  4G9Y A;  2FMY A;  3FK7 A;  3GLX A;  1RIO H;  3FXR A;  5B66 C;  3JRD A;  5FFZ A;  3H35 A;  2PJR A;  4A3C J;  2G9W A;  5IP9 J;  2G7U A;  2A68 F;  5D4S A;  4HQE A;  3DKX A;  2M8E A;  5HVQ C;  1IXR C;  2XAQ A;  2YU9 J;  2DFF A;  3CCY A;  2XDV A;  2ME0 A;  2YSR A;  1YRN A;  4V19 K;  3WE2 A;  4HV5 A;  1G2H A;  1J59 A;  3N05 A;  4OIQ F;  4PGH A;  2X1C A;  1IG7 A;  4IHW A;  2LKS A;  2EIL H;  4IF4 A;  1MJA A;  3O6B B;  1FPQ A;  5M3F J;  2FQ3 A;  3KZZ A;  1UZC A;  4M72 A;  1ENH A;  5H20 A;  1Z6R A;  2WAE A;  5IT3 A;  2CW8 A;  4N9I A;  2E35 A;  1JKP C;  2G7H A;  1R5I D;  4YEJ A;  3RKX A;  4E7K A;  3K69 A;  5EGO A;  3BR0 A;  4YIF A;  4JX6 A;  2VLA A;  2ZME C;  3FIW A;  2D2W A;  3FXJ A;  3HRU A;  4Q47 A;  4YG2 F;  1ETQ A;  2M7A A;  1D0Y A;  1S29 A;  1ZRF A;  1YI2 I;  3REO A;  1RUN A;  3S32 A;  2JMW A;  3WTT C;  1YYV A;  4I7H A;  1TBX A;  4KMF A;  2H1L A;  2P6S A;  3K1M A;  4NQW B;  5EEA A;  3GFJ A;  5EGO B;  2QBY B;  4RGS A;  1K6O A;  1VQ9 I;  1GVD A;  1HKS A;  3RDI A;  2IA2 A;  5L3C A;  4MTE A;  1H9T A;  3MCZ A;  2IGK A;  4F91 B;  1UJ8 A;  3M1C A;  3GTQ J;  4QLC U;  3DFG A;  3AG3 H;  1ZR4 A;  2AXT C;  1E3O C;  5FKK A;  1MSE C;  2BXY A;  3CC4 I;  2P4W A;  1XTA A;  3CCQ I;  4XN3 A;  1E3H A;  5D5W B;  4XLC A;  4PFO A;  1ODD A;  3FM3 A;  1S5L C;  3BPV A;  1EV7 A;  4JP0 A;  4A3E J;  2EZK A;  4BKX A;  2Z2S B;  4EJT A;  1IO2 A;  4JK1 X;  3OYJ A;  4A3D J;  3OSF A;  2F5D A;  4ITV A;  2OA4 A;  1A36 A;  3RKY A;  4J01 A;  2O7O A;  1UHW A;  4A3F J;  5HNH A;  3TP3 A;  1T2K A;  1I50 J;  3U1K A;  4RAY A;  1R1T A;  5JLX A;  4AIJ A;  2QQB A;  3HIF A;  4CYC B;  1U2W A;  1WCM J;  3I4N J;  2P81 A;  3KCC A;  3MZH A;  3E5Q A;  3CMM A;  1N78 A;  2ISZ A;  2K7L A;  3VPR A;  2GXA A;  1K61 A;  2PFB A;  3OYN A;  2OJE D;  3L9F A;  1D5V A;  2EV0 A;  3HRS A;  4HYE A;  1VND A;  2DO7 A;  3GEZ A;  1B9M A;  2IRF G;  1Z3Y A;  1ACI A;  3LSM A;  4E7H A;  3HZJ A;  1XGM A;  4IHY A;  3GTO J;  2DA2 A;  1VI0 A;  1SVO A;  2GM4 A;  3OS2 A;  2ZJ2 A;  2LF8 A;  1O7F A;  3F8F A;  1B72 B;  1ETY A;  3BT9 A;  3I59 A;  2A69 F;  3TBI A;  1VQ7 I;  5E8I A;  1CF7 A;  4AD9 A;  2VBZ A;  4XL9 A;  4MNU A;  3C7J A;  3L2V A;  3T8R A;  1Z77 A;  4WK8 F;  1JUM A;  2DMN A;  3COA C;  1RR7 A;  4MGR A;  2Y75 A;  3CLO A;  1R6R A;  2LF7 A;  2GOX B;  2VKD A;  1P4W A;  4C2M J;  1FBS A;  4Q4Z F;  4Q5S F;  3C2H A;  4HA8 A;  3W6J B;  5DD8 A;  1QHH D;  2JVH A;  3GZN B;  3ZR8 X;  5K1Y A;  2VJI A;  5F0F A;  5LEJ A;  1ZKG A;  3MN2 A;  4B47 A;  1JKQ C;  4B3X A;  3DKW A;  2XVC A;  3IAM 2;  1T0F A;  4KMU X;  3PIP F;  4KIG A;  3E5X A;  4S04 A;  2EH3 A;  5LBQ A;  1TP4 A;  2L5Q A;  2XRN A;  3B73 A;  4LIU A;  3QWL A;  1POG A;  1RZ4 A;  2VUM J;  3CDL A;  1U3E M;  1ZYR F;  3ZGK A;  2R5Y A;  2PMU A;  2NNN A;  1X19 A;  1UEL B;  2VBW A;  2V9P A;  3ZQI A;  2E71 A;  4IX7 A;  1O3Q A;  2DFE A;  3T1B A;  4ZYH A;  5HS9 A;  3ECO A;  2ZME A;  1H9G A;  4EMS A;  2R7W A;  1S6L A;  4L5J A;  1TTY A;  2QKL B;  4QIW N;  1JGG A;  2E7W A;  3JSO A;  1ZGA A;  4RM2 A;  1N77 A;  2MG4 A;  1I3A A;  3C1D A;  4GO1 A;  5D8L B;  3WG9 A;  3IH3 A;  1J2X A;  2YUS A;  3QU6 A;  5EYR A;  1GLN A;  5E79 C;  4EEF G;  4KUM A;  2CV2 A;  3GZ5 A;  2VC0 A;  4U0W A;  1X1C A;  2HU9 A;  2L7Z A;  3GX4 X;  2L9S A;  2GAU A;  2Y0M A;  4BH9 A;  4RAF A;  4F55 A;  1IUY A;  2R5Z B;  1MIJ A;  4LMY A;  2DI3 A;  2OZ6 A;  4AIH A;  2R7D A;  2FOK A;  4XON A;  1T6S A;  2L01 A;  3WTU C;  2JZY A;  1L3L A;  1ORK A;  1X2N A;  3QP5 A;  4GXO A;  5E8G A;  1X1P A;  1N75 A;  3B6A A;  1YJN I;  3SQN A;  2ZO4 A;  2FNA A;  4KT5 C;  3L00 A;  5FO5 A;  5D6E A;  3FKI J;  2FNP A;  2WTE A;  3S14 J;  2LBF B;  2W4S A;  2L54 A;  4GYI A;  2EIK H;  3CJN A;  2BVM A;  4PUS A;  1WJB A;  4AC0 A;  3MFK A;  3QOE A;  1FYM A;  3HOU J;  2LD5 A;  3R0J A;  3SEZ A;  2JK3 A;  2BBY A;  3EQL F;  2E1N A;  2UXN A;  3FMQ A;  4LD5 A;  3U1D A;  2UZK A;  4NUB A;  5E1X A;  4BE0 A;  1JE8 A;  4KNY A;  1B72 A;  3AAF A;  1ETX A;  3K70 C;  4B8X A;  2F5V A;  3VFZ A;  1YIT I;  1JTX A;  3CCU I;  2IS6 A;  2Q1Z B;  2GA1 A;  2DQL A;  3IUO A;  4AUX A;  1OCT C;  5F1J A;  4HBL A;  1YE9 A;  2XSJ C;  3BR3 A;  1ZTR A;  1EH8 A;  2JVG A;  3CZ6 A;  4UY8 I;  5KAI C;  3CCV I;  3TW6 A;  1EH7 A;  1VZ0 A;  2YX7 A;  4OAZ A;  3JW4 A;  3GTJ J;  5GTI C;  2BE5 F;  1I39 A;  1U8R A;  2ZNY A;  3WGH A;  2BY0 A;  3P9C A;  4WF2 A;  2V9K A;  1W4M A;  2CJJ A;  1ZLK A;  2EV6 A;  2FA5 A;  1HXD A;  4HLY A;  3A0H C;  2IS4 A;  3OYI A;  4OWR B;  5JVG F;  2W85 A;  3LOC A;  2X6O A;  3ZQQ A;  3K2Z A;  1B8I A;  1FJL A;  4M9X A;  4CGZ A;  3BDD A;  5HDN A;  3MKY B;  2IA0 A;  2K9S A;  3H9G A;  4BJ6 C;  2LRE A;  2LVS A;  4XOR A;  4HEA 2;  4MEX F;  3I0T A;  1MJB A;  3KP7 A;  3BQY A;  3TO9 A;  2FXA A;  3I5U A;  2LMD A;  3A1Y A;  3OOP A;  1XCV A;  4NDL A;  1JHH A;  4BJ5 C;  1IRF A;  2ACJ A;  5CYV A;  4UUS A;  1FBQ A;  3LA2 A;  1Y1W J;  3R0A A;  3NAU A;  1DQU A;  2E2J J;  5J8C A;  3ZQF A;  1YTY A;  4TV7 A;  3A02 A;  4PZJ A;  4CCO A;  3L2U A;  2DQR A;  1V55 H;  1A5J A;  1LFU P;  3L1P A;  3GTM J;  5J1U A;  3L2Q A;  4H4K C;  1XCB A;  2QWW A;  4U87 A;  1NH3 A;  1IZ1 A;  1X3Z B;  2VJJ A;  1MBJ A;  3PO3 J;  1UHS A;  2HVR A;  3V8J A;  3ASO H;  1XS9 A;  3QQA A;  3M8E A;  1JJ8 C;  3G4S I;  1QHG A;  2HR3 A;  5IY5 H;  1YW7 A;  1SD4 A;  3ZOB A;  1YG2 A;  2MH9 A;  1F9N A;  3I56 I;  3S17 J;  3G3Z A;  3NRV A;  4MFD A;  3W2W A;  5ILV A;  2NVY J;  2R7R A;  4M3G A;  3OS1 A;  2QQ8 A;  5TRD A;  3MMY B;  3S3M A;  4YIR X;  4PSW A;  1MD0 A;  2NAZ A;  4LK1 F;  3OIP A;  1N25 A;  1XSD A;  2DT6 A;  2HFH A;  2V7F A;  4CCJ A;  3I64 A;  4OU0 A;  1JT6 A;  1U8B A;  1IUF A;  2PMH A;  1TNS A;  3K1N A;  3D5L A;  3G2B A;  4B43 A;  5KAF C;  2O61 A;  4XLN F;  1ZAR A;  5JVT A;  5BOX A;  2L2O A;  3FF5 A;  3HOZ J;  3HM5 A;  3QPL A;  4DZJ A;  4MFE A;  2OD5 A;  3CCL I;  2Y9Z A;  3M8J A;  2KDZ A;  4IJA A;  3EYI A;  1IAW A;  1IN4 A;  4X0G A;  3PNV A;  2KJB A;  3WU2 C;  4BXF A;  2RNJ A;  3OYA A;  2CQ7 A;  2G0E A;  4M3F A;  3HOY J;  1S7O A;  3T0Y A;  3VYS B;  2ID3 A;  4UUV A;  2R7T A;  2DN0 A;  4RAZ A;  1I3Q J;  3OV8 A;  2NYX A;  2UUZ A;  4F3Q A;  4U7D A;  1PUE E;  1ZAO A;  4XMY A;  2Z16 A;  4E70 A;  5HOD A;  5FJ8 J;  1UCR A;  2KRH A;  1R4M B;  1IJW C;  4OOI A;  3ZMT A;  1P92 A;  2VC1 A;  2HGC A;  4HPQ A;  5FKO A;  2D1H A;  3DCF A;  3LQQ A;  2PG4 A;  1J75 A;  3CDI A;  3PUF A;  5CVI A;  3T5X A;  1J7K A;  2VT3 A;  1ZEL A;  3V8L A;  5A2Q K;  2XF6 A;  4G12 A;  4HQM A;  1AKH B;  1EF4 A;  1PP8 F;  3SDG A;  1IC8 A;  2ELJ A;  3ESW B;  2MC3 A;  5F27 A;  3ZQG A;  4EJW A;  2EFP A;  5TJJ A;  5D5U B;  4PJL A;  5HLI A;  3RKW A;  2KHM A;  2DA7 A;  4EVI A;  2F6C A;  2DOF A;  4UNO A;  4NC8 A;  4FX4 A;  2ELH A;  3GWZ A;  4XLA A;  1AWC A;  4UV9 A;  1WRJ A;  4RA2 A;  3K9T A;  1U9O A;  5GAG J;  3VDX A;  3ZMV A;  1O3S A;  3QYF A;  3V7C A;  2QVO A;  2KDO A;  2R5Y B;  4A6D A;  2DOA A;  1O3R A;  4A2U A;  4M9S A;  1DP3 A;  3HRT A;  1LDJ A;  4D0P A;  3GZ6 A;  2KJC A;  2CQX A;  4IOA F;  3S2H J;  4HW0 A;  5J1Y A;  2F48 A;  2GXB A;  2I10 A;  1Z0X A;  2A07 F;  1RUO A;  4IQ4 A;  2XAG A;  2VKH A;  2BY1 A;  1S8N A;  4L5I A;  2IPQ X;  3D1N I;  4KT6 A;  4JX5 A;  1ITY A;  3ZN1 A;  4XRS G;  2DT7 B;  1K6Y A;  2AO9 A;  2ZJQ F;  2X85 A;  3MKL A;  4LJZ F;  4KYW A;  2TCT A;  3V7S A;  3CCM I;  1MMS A;  2MLK A;  2P5L C;  3E0J B;  1KON A;  1TWA J;  2DXI A;  2ZNZ A;  1F1Z A;  3K7A J;  2YS9 A;  2M3A A;  3IWF A;  1P9Q C;  5KCM A;  4HX7 A;  2NVU B;  1IN5 A;  2W7N A;  4B48 A;  1CF7 B;  2KZG A;  4XLE A;  1XGS A;  4XOT A;  4EGY A;  3VYU B;  2ME6 A;  2FBK A;  3KLN A;  2KRC A;  2Z5U A;  4FHT A;  4BBR J;  1MDM B;  4I09 A;  1D1C A;  3E6D A;  5DEQ A;  3FBI B;  2OZU A;  1ETW A;  3ELK A;  4HNV A;  3IRQ A;  5CPR B;  3FXQ A;  2WC2 A;  2VXZ A;  2JT1 A;  1XX5 A;  2CO5 A;  4HZF A;  1GXP A;  5GAE J;  3F23 A;  3HGY A;  3QRF F;  2RQP A;  2KLO A;  4A3M J;  1D0X A;  2EFQ A;  2IGN A;  2XAS A;  2RAE A;  4R8H A;  5K5Q A;  3MKZ A;  3VWB A;  2CYY A;  3MZY A;  2CQQ A;  2QGU A;  2ADU A;  3V4G A;  4RAG A;  4FE7 A;  2XRO A;  2VN2 A;  3F6O A;  2R7O A;  2XUB A;  2HQN A;  3L2C A;  3PM1 A;  4JYK A;  3VEP A;  4EJV A;  1LDK B;  3IH2 A;  3QYE A;  2K3F A;  1LEB A;  4XRM A;  1R71 A;  1MBE A;  3RI4 A;  2AQE A;  2DDA A;  2Z3Y A;  3CMY A;  3F22 A;  2ECB A;  1JUS A;  5B1B H;  4IVN A;  2EPF A;  4DW6 A;  5E20 A;  2OAZ A;  4XM3 A;  2YPR A;  3DTK A;  3DBL B;  2RQQ A;  2HPM A;  4S0H B;  3C18 A;  2O6G E;  2QEN A;  4L9J A;  1K4T A;  2EZH A;  3BR6 A;  3FXO A;  2NVQ J;  1VQ4 I;  2ZSH B;  3IAS 2;  2HKO A;  2FOW A;  2L4M A;  3F3X A;  2AXL A;  1BOA A;  3PIO F;  1OR7 C;  1YS6 A;  4IOC F;  4BNC A;  1U5T B;  3OL4 A;  3SYT A;  1D8K A;  5L3F A;  3R60 A;  3LSH A;  3HG9 A;  4IHT A;  1WQ2 A;  5KHD A;  1H0M A;  1B1B A;  1Y1V J;  2V1X A;  3G6E I;  5HLG A;  2LDU A;  2OTL I;  2R7F A;  4A6E A;  3ZPL A;  4ESB A;  1RPW A;  2DMQ A;  1T95 A;  4EM1 A;  1SAX A;  3G1M A;  1SC7 A;  4D7N A;  3OYE A;  3L7W A;  3M7G A;  2K4B A;  2F5C A;  3CES A;  4ZYE A;  3WTW C;  1A35 A;  4P9F A;  4AU7 A;  1WJD A;  5K5O A;  1ETV A;  1HOM A;  4F52 A;  1RES A;  1VQN I;  3DU6 A;  3JCU C;  1QA6 A;  3WTY C;  2ZXW H;  2ZKZ A;  5H2F C;  4EAT A;  5DCM A;  1FOY A;  3TP0 A;  1YW8 A;  1BC8 C;  3ABL H;  1TZL A;  4BAC A;  1HST A;  1MSF C;  3MD2 A;  3E5U A;  3CD6 I;  4RB3 C;  5J8F A;  1MBH A;  3F8B A;  4OIR F;  5B5E C;  2VQC A;  1QQI A;  1QVT A;  1R22 A;  4C9Y A;  1UMQ A;  1D8J A;  2GIZ A;  2B9S A;  4RB1 A;  2ZME B;  1HBX G;  2CFX A;  2R7X A;  2ZB9 A;  3LWF A;  1G8X A;  1QPI A;  3D5R C;  3K4C A;  2HXI A;  2IEK A;  1KU2 A;  1WJA A;  3DEU A;  1JKR C;  4D5F A;  1PDN C;  1YJW I;  3H9Q A;  1ZRD A;  1KQ8 A;  5FRM A;  1SVM A;  5ED4 A;  3S1Q J;  3ABU A;  4BQQ A;  4G7Z F;  4ZH4 F;  3FIS A;  2PJR B;  3IV5 A;  2L3D A;  1OCP A;  1S7A A;  1TWF J;  3IH4 A;  5AON A;  4QPQ A;  2JA6 J;  5EDN A;  4NHJ A;  1W0T A;  4ZYG A;  1LVK A;  4O5V A;  5AIQ A;  1TQP A;  4ZDO A;  2K9N A;  5GP9 A;  3IP4 B;  1Z21 A;  1ZLJ A;  2LP0 A;  2FX0 A;  2CG4 A;  1FC3 A;  2DBB A;  4ZTJ A;  1BI2 A;  2GQQ A;  2P8T A;  1UFM A;  1XMA A;  3FMS A;  2HQR A;  4IRI A;  2DA3 A;  5ILU A;  3IKT A;  2XF7 A;  1D1A A;  1E3P A;  2CSO A;  4XKB A;  4FCY A;  1AKH A;  3J80 K;  4RB0 A;  2LBF A;  2V9V A;  4ENM A;  3RPU D;  2NS8 A;  1FOW A;  4Y33 A;  3KEO A;  5LEK A;  1S3J A;  2EIJ H;  2IT0 A;  1ZH5 A;  3CC2 I;  5FLX K;  1KZH A;  4FTH A;  5BPD A;  1BR1 A;  3F72 A;  1P4A A;  2LFB A;  3EPZ A;  1E2X A;  2W48 A;  5CVV A;  3CDH A;  4RGR A;  2Y69 H;  1TWG J;  1KU9 A;  1NG7 A;  4LIT A;  2HYF A;  3HOW J;  1XGN A;  4U0V A;  3LQR A;  2QSG X;  3W2V A;  4UV8 A;  5M3M J;  2VJ5 A;  4AYB N;  2R5Z A;  2KP6 A;  3AFH A;  3CCE I;  4G8X A;  4Q48 A;  2MFZ A;  4N0B A;  5DUK A;  4HAM A;  3ZMZ A;  3OMY A;  9ANT A;  5K7H A;  1R5H A;  1X2M A;  3HPG A;  3VB2 A;  2MSY A;  1CQT A;  2QUF A;  4LFU A;  2H8R A;  5FD5 A;  2HOS A;  2O8X A;  1TT5 B;  1HKQ A;  5GAH J;  3J7Y J;  1FOK A;  2FJ1 A;  2L9V A;  1R00 A;  3I53 A;  4NC7 A;  3TL4 X;  2XKP A;  1HCR A;  4I2O A;  3BR2 A;  3E1S A;  2KIU A;  3F0C A;  2QKM B;  5M5W J;  3LSG A;  1SAU A;  4XKW A;  4XKC A;  3LL7 A;  2L4A A;  3CUQ C;  5LHG A;  1U9N A;  3H36 A;  1A6Q A;  4R79 A;  2GA2 A;  2NRA C;  2DA4 A;  2JSC A;  2DU9 A;  1WJF A;  5B3S H; 
#chains in the Genus database with same CATH homology
 4Y17 A;  3HSR A;  1SD5 A;  3PQJ A;  1KA8 A;  1R23 A;  2FEZ A;  2GXG A;  1G3W A;  3JSP A;  3HTS B;  3WE3 A;  1YS7 A;  1GHC A;  3J81 K;  3BWG A;  2F5E A;  2D1V A;  2KIM A;  3HUG A;  2HS5 A;  4JQF A;  1OYI A;  1G3Y A;  4WX9 A;  5DUI A;  3W6K B;  3B02 A;  2K27 A;  3BZ6 A;  3EET A;  1J9I A;  2X0L A;  1QNT A;  5ILS A;  1LQ1 A;  5H6R A;  3I59 B;  4GGG A;  1DPU A;  3BJ6 A;  4EGZ A;  2O3F A;  1BI3 A;  1JHF A;  4RB2 C;  3CO7 C;  3QAH A;  3KP6 A;  4A0X A;  5ICG A;  2GZW A;  2Z9O A;  1W7P D;  3SXY A;  2XHK A;  1D3Y A;  3F8M A;  5LRR A;  4YFN F;  5K5R A;  2HZT A;  2H09 A;  2DAO A;  3O3K A;  5E1W A;  3RTR A;  1G6N A;  1V4R A;  4MQV A;  2HYG D;  4RGU A;  1EH6 A;  2BEO A;  3BJA A;  2EFO A;  1B59 A;  2KRF A;  2VON A;  2W84 A;  1IXC A;  1F5T A;  3RPU A;  3IL2 A;  3J80 Z;  5JFR A;  5DD4 A;  1B6A A;  1FLI A;  4YII A;  1DP7 P;  3HHG A;  2XAH A;  3ZMD A;  2A5Y B;  4Y13 A;  2STW A;  2QBY A;  3BJO A;  3LAP A;  2OQG A;  5LRS A;  5H6Q A;  4KIB A;  2VT2 A;  1REP C;  3WTZ A;  1Y0U A;  2H6C A;  4XSZ F;  2MD5 A;  1MGT A;  3ML6 A;  1KQ0 A;  4AWX B;  3FHZ A;  3GF2 A;  2FBH A;  4HF2 A;  4KA4 A;  1G4D A;  2MH2 A;  4PCQ A;  3I58 A;  3LA7 A;  2M87 A;  4KDP A;  1BJA A;  1FBU A;  2FSW A;  5KK1 A;  4ETS A;  4G6D A;  5FGM A;  4S05 A;  3BRO A;  4YFK F;  4HLX A;  3NQO A;  5EEG A;  4BHP A;  1SFX A;  5E1Z B;  3KFW X;  1BIA A;  1WI9 A;  2P5V A;  2Z33 A;  1ULY A;  1OPC A;  3TO6 A;  1LVA A;  1FY7 A;  2PN6 A;  3TGN A;  5LHH A;  2PJP A;  2H6B A;  4HF0 A;  2QQ9 A;  1ZG1 A;  2HDC A;  4AIK A;  4A12 A;  2A61 A;  3J7A O;  1ZGJ A;  2O03 A;  3J81 Z;  2CGP A;  4G7H F;  4H0E A;  5L3G A;  3DF8 A;  4ESJ A;  2Z99 A;  2M45 A;  2KKO A;  2HKX A;  2EK5 A;  1BN5 A;  3O2P E;  2VOD A;  3QU3 A;  4CYD A;  4I0B A;  5DDG A;  4KN7 X;  3BPX A;  3FZV A;  4L18 B;  3ECH A;  3QPT A;  5CVU A;  5HDK A;  5LHI A;  4UVA A;  5F1R A;  2RV8 A;  1XDS A;  5D5V B;  3HOT A;  3LA3 A;  4UVB A;  1Z6T A;  1W5T A;  4CXF A;  1UB9 A;  3GFI A;  3IWZ A;  1ZRC A;  2W57 A;  4A0Y A;  3VOE A;  4EJU A;  1KQ9 A;  5DV5 A;  1VTN C;  2VE9 A;  1I1G A;  3I54 A;  1IN7 A;  3CUQ B;  3QP6 A;  3CUO A;  2E7X A;  2NNY A;  2XV4 S;  1FYL A;  1TLH B;  4WWC A;  4WXH A;  4GCV A;  2FU4 A;  1HQC A;  1KYW A;  2X4H A;  2EJR A;  4UXN A;  3I71 A;  4LLL A;  1STZ A;  4M6X A;  4R1H A;  2TDX A;  4HX8 A;  4MQ9 F;  3FXU A;  2A6E F;  4OIP F;  1ZG5 A;  1B9N A;  1OMI A;  3GXO A;  4IRG A;  4MHG A;  2V1U A;  2P5K A;  1J5Y A;  3KET A;  4OIO F;  4BQA A;  2PI0 A;  1YO5 C;  5IT9 K;  4XSX F;  1FZP B;  3DP7 A;  1U6G A;  4EV0 A;  1QBJ A;  1C0W A;  5CVR A;  2HWV A;  1IRG A;  5D4R A;  3M9A A;  1ZHF A;  2K86 A;  1XDU A;  1Z1D A;  3MWM A;  5FFX A;  3FM5 A;  1DPR A;  2MA3 A;  4LLN A;  4M71 A;  1UHM A;  1PP7 U;  1LB2 A;  3DPT A;  5L3E A;  4G7O F;  3S2W A;  1FNN A;  2QQA A;  4ON0 A;  4WXD A;  1R5G A;  1USS A;  5JR3 A;  3ZN0 A;  1P6R A;  4WCG A;  1IW7 F;  4G6Q A;  3F21 A;  5E18 F;  1XGO A;  2P6T A;  1GXQ A;  1HW5 A;  3N97 A;  4O3M A;  1TQI A;  2DTR A;  1GVJ A;  1XD7 A;  1U5T C;  5CLS A;  1XB4 A;  4P5O A;  3GW2 A;  1NHA A;  1W5S A;  2H27 A;  1SMT A;  1SFE A;  5JHU A;  1MJ9 A;  2HOE A;  1AOY A;  2AS5 F;  3E3V A;  1W7P B;  1QZZ A;  1R36 A;  4JBA A;  3TDU C;  1J0R A;  2GIV A;  4U7B A;  3WU1 B;  2EWN A;  3GFM A;  1BBY A;  1P4X A;  1SD6 A;  1BM9 A;  4MEY F;  3TQN A;  4HOB A;  4ENK A;  1I6X A;  5HOO A;  2EA2 A;  3BOQ A;  3E6M A;  5HS8 A;  1FYK A;  2D45 A;  4DQ2 A;  3P9I A;  4L9N A;  4HX4 A;  5LGU A;  1OYW A;  1SD7 A;  4PDK A;  1V3F A;  2Q8K A;  1O57 A;  3DQV C;  2Q0O A;  2ESN A;  1B4A A;  2IVM A;  1KU7 A;  1IF1 A;  1Z91 A;  1W7P A;  4LG0 B;  3E6B A;  2RGV A;  2EV5 A;  3D0S A;  4XRF A;  3I4P A;  1XN7 A;  3RYP A;  5F6F A;  4OIN F;  3ZMS A;  3QPH A;  4I02 A;  5A2Q Z;  4A5N A;  3RYR A;  4NQW A;  4G94 A;  2JRT A;  2E1C A;  3FX3 A;  2MBF A;  3GFL A;  3T8T A;  2OQR A;  1MZB A;  5L3D A;  2XKO A;  3G73 A;  3TOB A;  3RPQ A;  5LGN A;  3BP8 A;  2O0Y A;  4M74 A;  4ENJ A;  2FF4 A;  5DYM A;  4M73 A;  1JGS A;  5CVJ A;  3IC7 A;  4XBF A;  2LSO A;  5BQT A;  3H3U A;  1HSJ A;  2VOO A;  1FSE A;  3GO5 A;  5DCM B;  2DW4 A;  6PAX A;  2QLZ A;  1BC7 C;  2J5O A;  3KP4 A;  1I5Z A;  2VBX A;  4OMZ A;  1R1U A;  3ZMU A;  3MEX A;  1QGP A;  3WGG A;  2PLY A;  3WOD F;  2W24 A;  3DPL C;  3MAJ A;  3GYH X;  2RN7 A;  1TNT A;  3Q9V A;  2M1B A;  3FWE A;  1WWX A;  4FX0 A;  2W25 A;  1CGP A;  1U5T A;  3E97 A;  4KFC A;  1LNW A;  1SMY F;  1XSV A;  1BI0 A;  5BS6 A;  1K78 A;  4WXC A;  2GWR A;  5FD6 A;  2IW5 A;  1LJ9 A;  4ASN A;  4N9H A;  2EA4 A;  3DV8 A;  2XGX A;  2COM A;  3GVA A;  3TO7 A;  3HOS A;  1QO0 D;  3F6V A;  3WTV C;  4L9V A;  3KP2 A;  5KVR A;  5F64 A;  3JTG A;  1BI1 A;  1ON1 A;  3QOP A;  5BMZ A;  2QYO A;  4UVC A;  1YW9 A;  2ZXJ A;  3WTS C;  2V1D A;  5E17 F;  2IP2 A;  4QWQ A;  1DUX C;  4ENN A;  2HEO A;  2EB7 A;  3HSE A;  3K0L A;  4I01 A;  4NB5 A;  3ISP A;  1TW2 A;  4RS8 A;  2CW0 F;  1IXS B;  1XSX A;  2NS0 A;  1YQA A;  1FP2 A;  1T39 A;  3ERE D;  4Y15 A;  2KIF A;  3F8N A;  4UHT A;  1FWZ A;  5DCF A;  2F5F A;  2UWM A;  3TKY A;  4ESF A;  2H94 A;  2J5P A;  4M6Y A;  2PQ8 A;  1QZY A;  4LLG F;  2PBI A;  2JTV A;  2FBI A;  2B0L A;  2LKP A;  1L0O C;  2QM3 A;  3WGI A;  3IRR A;  3R6S A;  3TDZ C;  5HDG A;  4CDG A;  1KYZ A;  2IA1 A;  4BXU A;  5EEH A;  4I98 B;  3SZT A;  5JI6 A;  4P55 A;  4MTD A;  3H92 A;  3LAJ A;  1FX7 A;  2RC4 A;  4HV6 A;  2DPD A;  4LB6 B;  2XAF A;  4LGW A;  2IJL A;  3CTA A;  4F7Z A;  3NEU A;  4M9Z A;  3HYI A;  2DT5 A;  3M1E A;  5ICC A;  3EYY A;  3WU0 A;  1LEA A;  1R1V A;  3RIR A;  1R58 A;  4LB5 A;  1Z05 A;  2V6C A;  1KU3 A;  3H3Z A;  2RVC A;  1K78 B;  2DLL A;  1IN6 A;  1K7A A;  4A5M A;  4YFX F;  2XAJ A;  1RNL A;  3R4K A;  4PGG A;  2STT A;  2DFI A;  2P7V B;  1MKM A;  4LK0 F;  5HS7 A;  1HW2 A;  2P7C B;  2HTS A;  2M5W A;  3SFZ A;  3RJP A;  4XLP F;  1IN8 A;  4O6J A;  1Q1H A;  1U78 A;  1LDD A;  3M8F A;  2F2E A;  2FML A;  1HKT A;  2VE8 A;  2PEX A;  2RKH A;  3F8C A;  1BIB A;  3U9G A;  5J6X A;  2UXX A;  4L0Z B;  3VOD A;  1XMK A;  2EFW A;  3LFK A;  1QPM A;  2DK8 A;  3TOA A;  4CHU A;  3FMR A;  5L3B A;  4BYY A;  1I27 A;  2Y48 A;  1O7L A;  2K4J A;  1WKM A;  2ZBK A;  3KZY A;  3V7R A;  1DDN A;  3HRM A;  1X3U A;  5HLH A;  1FP1 D;  1ON2 A;  2JPC A;  3N4M A;  3IKV A;  2FE3 A;  1ZN2 A;  3CO6 C;  1K79 A;  2QZ8 A;  3EUH A;  3ZQ7 A;  4KIF A;  3Q5F A;  4I0A A;  4BHB A;  4EM2 A;  4HF1 A;  2Q2E A;  3MQ0 A;  1I1S A;  4Z2Y A;  5ICF A;  2YR2 A;  2ISY A;  2ETH A;  1FT9 A;  4IPA A;  3KLO A;  2L02 A;  3ABT A;  4K2E A;  4L0Y B;  4LG0 A;  2A6H F;  4ZYD A;  4ZZD A;  2WWY A;  3LST A;  2M30 A;  3EDP A;  3KE2 A;  4RGX A;  3ROU A;  1WSU A;  2K02 A;  2HTJ A;  4B09 A;  2EFN A;  4FT8 A;  4CO8 A;  2DK5 A;  2WV0 A;  4ZZL A;  4BAY A;  3L09 A;  3WTX C;  2CWE A;  5ERI A;  2LNB A;  3P7N A;  2RDP A;  5AIP A;  1RI7 A;  3SZP A;  2DPU A;  2ESH A;  2VBY A;  4BHC A;  2XIG A;  5CJ9 A;  5D6F A;  1MDM A;  3SHF A;  5FB2 A;  4KN4 X;  3PQK A;  2V79 A;  2BGC A;  1TW3 A;  4HDU A;  1OR7 A;  3K1P A;  3CUQ A;  1O3T A;  4KIC A;  3KP3 A;  3BY6 A;  5D5X B;  1F4K A;  1Z7U A;  4IHS A;  2CQK A;  2FRH A;  4U0Y A;  2A3S A;  4A0Z A;  2OU2 A;  2VOP A;  2BYV E;  1ZG3 A;  1FSH A;  2BV6 A;  1ZRE A;  3JAM K;  2C6Y A;  3Q9S A;  4IXA A;  4L9T A;  2R3S A;  4EQQ A;  2ZCW A;  3E6C C;  1YFH A;  1E17 A;  3DXJ F;  3KP5 A;  5LLQ A;  3ULQ B;  2MLG A;  1UST A;  1OYY A;  1SFU A;  2JPB A;  3U2R A;  3ZP5 A;  5IT9 Z;  5BPI A;  1T98 A;  3KEQ A;  1YLF A;  4GYG A;  1P2F A;  3PFI A;  4EM0 B;  4EJO A;  4U88 A;  4HDV A;  1OKR A;  1TQM A;  2ZFW A;  3R61 A;  2YU3 A;  4P96 A;  5ICE A;  2YX4 A;  5LGT A;  3JAM Z;  1YIO A;  4CIC A;  1KGS A;  3HTU A;  4P9U A;  2OBP A;  1Z9C A;  3V8K A;  1G3T A;  3HHH A;  4AVP A;  4IRH A;  3HSF A;  1G3S A;  3IHU A;  1ONV A;  1A04 A;  5D8K B;  4CZZ A;  1HW1 A;  3C3W A;  3P9K A;  3GUD A;  4DNC A;  1R7J A;  1T38 A;  3JTH A;  4OMY A;  1JXS A;  5FLX Z;  4G9Y A;  2FMY A;  1RIO H;  3GLX A;  3FXR A;  5FFZ A;  2G9W A;  2G7U A;  2A68 F;  5D4S A;  4HQE A;  2M8E A;  5HVQ C;  1IXR C;  2XAQ A;  2YSR A;  3WE2 A;  4HV5 A;  1J59 A;  4OIQ F;  4PGH A;  4IF4 A;  1MJA A;  3O6B B;  1FPQ A;  2FQ3 A;  3KZZ A;  4M72 A;  5H20 A;  1Z6R A;  5IT3 A;  4N9I A;  2G7H A;  3RKX A;  3K69 A;  4YIF A;  3HRU A;  2D2W A;  4Q47 A;  4YG2 F;  1S29 A;  1ZRF A;  3REO A;  1RUN A;  3WTT C;  1YYV A;  4I7H A;  1TBX A;  4KMF A;  2P6S A;  3K1M A;  3GFJ A;  2QBY B;  4RGS A;  1K6O A;  1HKS A;  3RDI A;  2IA2 A;  5L3C A;  4MTE A;  1H9T A;  3MCZ A;  4QLC U;  3DFG A;  2P4W A;  5D5W B;  1ODD A;  3FM3 A;  3BPV A;  1EV7 A;  4EJT A;  4JK1 X;  2F5D A;  2OA4 A;  3RKY A;  1UHW A;  1T2K A;  4RAY A;  1R1T A;  4AIJ A;  2QQB A;  3HIF A;  1U2W A;  3KCC A;  3MZH A;  3E5Q A;  2ISZ A;  2K7L A;  2PFB A;  3L9F A;  1D5V A;  2EV0 A;  3HRS A;  4HYE A;  2DO7 A;  3GEZ A;  1B9M A;  2IRF G;  1XGM A;  2ZJ2 A;  2LF8 A;  1O7F A;  3F8F A;  3I59 A;  2A69 F;  5E8I A;  1CF7 A;  4AD9 A;  2VBZ A;  4MNU A;  3C7J A;  3T8R A;  4WK8 F;  3COA C;  4MGR A;  2Y75 A;  3CLO A;  2LF7 A;  1P4W A;  1FBS A;  4Q4Z F;  4Q5S F;  4HA8 A;  3W6J B;  5DD8 A;  5K1Y A;  5LEJ A;  3DKW A;  2XVC A;  1T0F A;  4KMU X;  4KIG A;  3E5X A;  4S04 A;  5LBQ A;  3B73 A;  2XRN A;  1RZ4 A;  1U3E M;  1ZYR F;  2PMU A;  2NNN A;  2VBW A;  1O3Q A;  4ZYH A;  3T1B A;  5HS9 A;  3ECO A;  2ZME A;  1H9G A;  4EMS A;  1S6L A;  4L5J A;  1TTY A;  2E7W A;  3JSO A;  1ZGA A;  3C1D A;  4GO1 A;  5D8L B;  3WG9 A;  1J2X A;  3QU6 A;  4KUM A;  3GZ5 A;  2VC0 A;  4U0W A;  3GX4 X;  2GAU A;  2Y0M A;  4BH9 A;  1IUY A;  4LMY A;  2DI3 A;  2OZ6 A;  4AIH A;  2R7D A;  2FOK A;  1T6S A;  2L01 A;  3WTU C;  2JZY A;  1L3L A;  3QP5 A;  4GXO A;  5E8G A;  3SQN A;  2ZO4 A;  2FNA A;  4KT5 C;  3L00 A;  5FO5 A;  5D6E A;  2FNP A;  2WTE A;  3MFK A;  2L54 A;  4GYI A;  3CJN A;  1FYM A;  3R0J A;  2BBY A;  3EQL F;  2E1N A;  2UXN A;  3FMQ A;  4LD5 A;  3U1D A;  2UZK A;  5E1X A;  1JE8 A;  4KNY A;  3AAF A;  4B8X A;  3VFZ A;  2GA1 A;  2DQL A;  4HBL A;  1EH8 A;  1EH7 A;  2YX7 A;  3JW4 A;  2BE5 F;  1U8R A;  2ZNY A;  3WGH A;  3P9C A;  4WF2 A;  1W4M A;  1ZLK A;  2EV6 A;  2FA5 A;  1HXD A;  4HLY A;  2W85 A;  3K2Z A;  4M9X A;  4CGZ A;  3BDD A;  5HDN A;  2IA0 A;  4MEX F;  3I0T A;  1MJB A;  3KP7 A;  3TO9 A;  2FXA A;  3I5U A;  3OOP A;  1XCV A;  1JHH A;  1IRF A;  2ACJ A;  5CYV A;  1FBQ A;  3LA2 A;  3R0A A;  5J8C A;  1YTY A;  4TV7 A;  4PZJ A;  2DQR A;  1XCB A;  2QWW A;  1IZ1 A;  3V8J A;  3M8E A;  2HR3 A;  1YW7 A;  1SD4 A;  1YG2 A;  2MH9 A;  1F9N A;  3G3Z A;  3NRV A;  5ILV A;  5TRD A;  1MD0 A;  2NAZ A;  4LK1 F;  1XSD A;  2HFH A;  3I64 A;  4OU0 A;  2PMH A;  1TNS A;  3K1N A;  3D5L A;  2O61 A;  4XLN F;  1ZAR A;  5JVT A;  5BOX A;  3FF5 A;  2OD5 A;  3EYI A;  4IJA A;  1IAW A;  1IN4 A;  2KJB A;  2RNJ A;  1S7O A;  3T0Y A;  4UUV A;  4RAZ A;  3OV8 A;  2NYX A;  4U7D A;  1PUE E;  1ZAO A;  4E70 A;  1UCR A;  4OOI A;  3ZMT A;  1P92 A;  2VC1 A;  2HGC A;  2D1H A;  3LQQ A;  2PG4 A;  1J75 A;  5CVI A;  3T5X A;  1J7K A;  2VT3 A;  3V8L A;  5A2Q K;  4HQM A;  1PP8 F;  2MC3 A;  4EJW A;  2EFP A;  5TJJ A;  5D5U B;  5HLI A;  3RKW A;  4EVI A;  4UNO A;  4FX4 A;  2ELH A;  3GWZ A;  1AWC A;  4UV9 A;  1WRJ A;  3K9T A;  3ZMV A;  1O3S A;  3V7C A;  2QVO A;  4A6D A;  1O3R A;  4A2U A;  4M9S A;  3HRT A;  1LDJ A;  4D0P A;  3GZ6 A;  2KJC A;  4HW0 A;  2GXB A;  2A07 F;  1RUO A;  2XAG A;  1S8N A;  4L5I A;  2IPQ X;  3ZN1 A;  4LJZ F;  4KYW A;  3V7S A;  2MLK A;  2P5L C;  2ZNZ A;  1F1Z A;  3IWF A;  4HX7 A;  1IN5 A;  1CF7 B;  1XGS A;  4EGY A;  2FBK A;  3KLN A;  2Z5U A;  4FHT A;  1MDM B;  4I09 A;  3E6D A;  5DEQ A;  2OZU A;  3ELK A;  3IRQ A;  2WC2 A;  3FXQ A;  2VXZ A;  2JT1 A;  2CO5 A;  4HZF A;  1GXP A;  3F23 A;  3QRF F;  2RQP A;  2EFQ A;  2XAS A;  4R8H A;  5K5Q A;  2CYY A;  3MZY A;  2ADU A;  3V4G A;  2XRO A;  2VN2 A;  3F6O A;  2XUB A;  2HQN A;  3L2C A;  3VEP A;  4EJV A;  1LDK B;  1LEB A;  3RI4 A;  2Z3Y A;  3F22 A;  4IVN A;  5E20 A;  2OAZ A;  2YPR A;  2O6G E;  3C18 A;  2QEN A;  4L9J A;  2HKO A;  2L4M A;  3F3X A;  2AXL A;  1BOA A;  1YS6 A;  4BNC A;  1U5T B;  1D8K A;  5L3F A;  3R60 A;  4IHT A;  1WQ2 A;  1H0M A;  1B1B A;  2V1X A;  5HLG A;  2LDU A;  2R7F A;  4A6E A;  3ZPL A;  4ESB A;  4EM1 A;  1SAX A;  3L7W A;  3M7G A;  2K4B A;  2F5C A;  4ZYE A;  3WTW C;  4P9F A;  5K5O A;  3WTY C;  2ZKZ A;  5DCM A;  1YW8 A;  1BC8 C;  1HST A;  3E5U A;  4RB3 C;  5J8F A;  3F8B A;  4OIR F;  1QQI A;  1R22 A;  1D8J A;  4RB1 A;  2ZME B;  1HBX G;  2CFX A;  3LWF A;  1KU2 A;  3DEU A;  1PDN C;  1KQ8 A;  1ZRD A;  5ED4 A;  3ABU A;  4G7Z F;  4ZH4 F;  2L3D A;  5AON A;  1S7A A;  4NHJ A;  4ZYG A;  4O5V A;  5AIQ A;  1TQP A;  1ZLJ A;  2CG4 A;  1FC3 A;  2DBB A;  1BI2 A;  2GQQ A;  2P8T A;  1UFM A;  1XMA A;  3FMS A;  2HQR A;  4IRI A;  5ILU A;  3IKT A;  2CSO A;  3J80 K;  4RB0 A;  2V9V A;  4ENM A;  5LEK A;  3KEO A;  1S3J A;  2IT0 A;  1ZH5 A;  5FLX K;  5BPD A;  3F72 A;  1P4A A;  1E2X A;  5CVV A;  3CDH A;  4RGR A;  1KU9 A;  2HYF A;  1XGN A;  4U0V A;  3LQR A;  4UV8 A;  4G8X A;  4Q48 A;  5DUK A;  4N0B A;  3ZMZ A;  4HAM A;  1R5H A;  3VB2 A;  2QUF A;  4LFU A;  5FD5 A;  2O8X A;  1HKQ A;  1FOK A;  3I53 A;  1R00 A;  2XKP A;  4I2O A;  2KIU A;  2L4A A;  3CUQ C;  5LHG A;  4R79 A;  2GA2 A;  2NRA C;  2JSC A;  2DU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...