3HOXJ

Complete rna polymerase ii elongation complex v
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hoxJ00
2QF7A 1QVTA 3HOUJ 2LD5A 5FKMA 2DMPA 5C4JJ 2XPUA 3E7LA 1HDDC 2NOGA 2CUEA 1RR7A 3LSGA 1Y1WJ 1MBFA 4BY7J 3I4NJ 1JUPA 4IHVA 1TWHJ 2L7ZA 2CU7A 4B3AA 1IDZA 1YRNA 1JTYA 3WHCA 3HKZN 4B4CA 4IHYA 4A3DJ 5C4XJ 2HQ5A 1R9TJ 1XS9A 2HOAA 3Q3SA 1GV2A 1FIPA 1FIAA 5IP6A 1UMQA 4D7MA 4XK4A 2AO9A 4MLOA 5FLVA 4A93J 2GM4A 3QPSA 2NVTJ 3IH4A 2L7FP 2N8GA 1G2HA 2HDDA 1ZTRA 2HXIA 3GTMJ 3JRBA 1MH4A 3GTJJ 2EBIA 4MFEA 2HI3A 1I3QJ 2JWTA 3TP3A 1IDYA 2H1KA 1UHSA 4DYQA 4W1UA 2OPTA 2Y2ZA 3LSJA 5DS9A 5M3FJ 3IH2A 4EEFG 2D5VA 1IJWC 1QPIA 4JYKA 4AC0A 1B8IA 1TC3C 5EGOB 1NK2P 3TEDA 1Z77A 5IOYA 1RESA 2YS9A 1BW6A 2L7MP 5EZHA 2KDZA 2LLKA 2JMWA 4XRSG 1U8BA 3OSGA 2FX0A 3I4MJ 2XRLA 3O8GA 5FJ8J 3M4OJ 2DMUA 2ELKA 4C2MJ 4A3BJ 3BQYA 3TW7A 4QSHA 1P7IA 4XICA 1E3OC 2O8KA 1S7EA 5J1YA 5IOZA 3HBLA 3BQZA 2X6OA 3JREA 1VNDA 2K40A 4XRSA 1MBEA 3G1OA 4J19A 3IV5A 1ETWA 3PO3J 2CJJA 5GPCA 2LVSA 3D1NI 1PUFB 2JK3A 2X9DA 4L5EA 1OJLA 5GPAA 3BTJA 5FKKA 2VPRA 3A01A 5IYCJ 4HNVA 3BG5A 2K9SA 1I6HJ 2ID6A 3BR0A 4MO7A 3Q0VA 3JRCA 2E2JJ 1HLVA 5K7FA 2FJ1A 1JUMA 5EYRA 5JLWA 1BA5A 1MSFC 2M34A 1WPKA 1YRNB 2TCTA 3BG9A 1LFUP 2E2HJ 2EH3A 1CQTA 1T56A 4I6ZA 3K7AJ 2P81A 4XRMA 2DMTA 2H8RA 3G1LA 1X2MA 5K7HA 3B6CA 3FISA 3VPRA 2LK2A 4A3GJ 1BW5A 5M5WJ 1MBKA 1MBJA 1XC5A 5K7ZA 1MSEC 2JA8J 5EDNA 2JA6J 5JLXA 1SANA 1GUUA 3JRIA 2VUMJ 1AKHA 1OCPA 3QQAA 4DW6A 2AHQA 2Y9YA 1ZR2A 1P7JA 3HOXJ 4M3GA 2XB5A 1H89C 3RZOJ 4FISA 1H8AC 1TWCJ 3FIWA 1VF9A 1ETYA 2VI6A 1HCRA 3Q0WA 1ETVA 2ID3A 4QTRA 2YU9J 3G1MA 1WGXA 1RKWA 2Y9ZA 3A02A 1WH5A 4X1EA 1MH3A 3S1RJ 2E2IJ 4QIWN 4FTHA 5IP7J 3JRHA 2Y31A 2O9LA 4FE4A 1BJZA 4C3IJ 4B1RA 2E19A 4M3BA 2WV1A 4M3DA 2CQXA 3HB9A 1JKQC 5FLMJ 2JA7J 9ANTA 3QPLA 4IEJA 4MIMA 1IUFA 1ORKA 4AYBN 3ZQGA 2NVXJ 1QRYA 1OFCX 2DJNA 3HEFA 1W0TA 3NARA 3MN2A 2CUFA 1U9NA 3A03A 3O8HA 3S17J 4DYRA 1LE8A 4LOCA 4BBRJ 2HOTA 2XGEA 5F1JA 1AU7A 2R5YA 2O7OA 1TWAJ 5E3LA 4A3IJ 5EG0B 2XPWA 5F0CA 4Y52J 2QCOA 5F0HA 3JRAA 1OCTC 4S0HB 4G12A 2CQQA 1K61A 3ZOBA 2CRGA 2EZIA 3S14J 1X2NA 3MKLA 2DA2A 3A01B 3TP0A 4XIDA 4UUSA 2ECCA 2HXOA 3GTKJ 3Q0UA 3L1PA 3ZQLA 4FCYA 1ETQA 5J1RA 2ZB9A 4DZPA 1RPWA 1MBGA 5F04A 4ABZA 3CQZJ 1APLC 2R5ZA 1ZGWA 2NS7A 2NVYJ 1TWFJ 1MNMC 1WH7A 3WHBA 4JP0A 4M3FA 4Y7NJ 5IP9J 3SJMA 4A3LJ 5EZGA 1UG2A 3MVPA 3JRGA 1AKHB 4UUTA 3W6VA 2DN0A 3BR2A 3IH3A 3S2HJ 1DU0A 2IEKA 1ZR4A 2JJ7A 1K83J 1WCMJ 2PMZN 5FKOA 3NAUA 1GDTA 3C2BA 4BKXA 5E3MA 4GFBA 4NDLA 3BTIA 4MFDA 3S1NJ 1JKRC 1JJ8C 2EZKA 5J3LA 3GTGJ 5IYBJ 4IHXA 2JN6A 3S16J 3BR3A 2IAIA 4RDUA 1GT0C 3BR6A 2DMNA 3HOYJ 1ETKA 1RKTA 3FK6A 5F27A 3HOVJ 3HOZJ 1QVUA 1XG1A 2L9RA 3CMYA 2GLOA 5J1UA 1POGA 2M8GX 2TRTA 2FQ4A 2MSYA 3H0GJ 2WB1N 4RBOA 3JRDA 1LE8B 2EQRA 3ZQHA 2G0EA 3F0CA 2LY9A 1A6IA 4JX5A 1X58A 2DA7A 1Z0XA 2M0CA 2MW8A 2R92J 1A5JA 4DZJA 1JJ6C 1B8IB 1FEXA 4BBSJ 1T33A 2E1OA 3UKGA 1IV6A 1IRZA 4UUSB 1LFBA 2K9QA 3CDLA 4FE7A 3ZQIA 1W0UA 3TW6A 1TWGJ 3LSRA 2EZLA 3HM5A 4CYCA 1Q1VA 3HDDA 1HOMA 3HOWJ 1ENHA 4JX6A 4A3KJ 2R5ZB 1FTZA 2MG4A 3RKQA 2NVQJ 3S1MJ 1I50J 1NTCA 1B72A 4C3JJ 1HDPA 2VKVA 5E3NA 4AUXA 4M3EA 5FKLA 2FD5A 1GVDA 5EF6A 1FTTA 3HGYA 3OOUA 2NS8A 5DTDA 3LSPA 2ME6A 1Y1VJ 5F0FA 2LP0A 4M6VA 3FK7A 1DU6A 3LOCA 3BG3A 2IBDA 5F08A 2MGQA 3RQIA 4D5FA 3JRFA 4W97A 1O4XA 4BY1J 3GTQJ 5C3EJ 5C44J 1JT0A 3M3YJ 1ZKGA 1FJLA 1U78A 4A3FJ 1ZQ3P 1VFCA 1ZK8A 1HF0A 2OF7A 3K2AA 2W48A 4IHWA 3S1QJ 5M5YJ 1F43A 2ECBA 3SDGA 3H3VK 5M5XJ 2R93J 2DA6A 2LFBA 3HGGA 3S2DJ 5E3OA 1GV5A 2M9HA 3GTLJ 5GP9A 2WAQN 2B63J 3DEWA 5IPAA 2XSDC 2XGCA 2DA3A 2RAEA 5IYDJ 1JKOC 1MBHA 2M2EA 3OIOA 1ETOA 2R7ZJ 3S15J 2Y0SN 4A69C 2Y30A 2YUSA 3DCFA 1ETXA 4A3JJ 1H88C 5EG0A 1AHDP 1BL0A 5M3MJ 1IC8A 2R0QC 2ME0A 2KT0A 5EGOA 4I76A 1IG7A 2I10A 1F36A 2COBA 2DA5A 4V2GA 1JT6A 3CCYA 3RZDJ 2GBYA 4D5CA 2JA5J 3ZQFA 4V2FA 3SFIA 3PM1A 3FKIJ 5EEAA 2DA1A 2HYJA 2XPVA 3BR1A 5HODA 1D5YA 2XB0X 2HOSA 4JX4A 1NK3P 2LTPA 5FKNA 1SFOJ 3BTCA 1ITYA 3GTPJ 1VI0A 3BTLA 3OSFA 2DMQA 2XGDA 4A3EJ 4CYCB 1JUSA 4A3MJ 1U9OA 3B6AA 2K9NA 1WI3A 2LR8A 4C3HJ 2DA4A 3PO2J 2LKXA 3GBGA 3BT9A 1RETA 5BNGA 1EF4A 1B72B 2DTZA 3BR5A 1JGGA 3JR9A 2R5YB 4D7NA 1JTXA 2EZHA 4DYCA 3GTOJ 4X6AJ 4BXXJ 2VKEA 1JKPC 3ZQCA 2X48A 1PUFA 2L0KA 4A3CJ 1IGNA 3LNQA
chains in the Genus database with same CATH superfamily
5LFAA 1B4AA 2PN6A 2LD5A 1XX5A 2OQRA 5C4JJ 3PFIA 3DU5A 1ZREA 3JAMK 2W00A 1MBFA 2H8WA 4LLNA 1JUPA 2A07F 2K9LA 5BMZA 4RAYA 4IHTA 2CU7A 4P5OA 3CCEI 3H35A 1LVAA 2NNYA 4HPQA 5C4XJ 3RI4A 2K3PA 4R8HA 3J80Z 3U21A 5D4RA 1D5VA 2KHMA 4DIQA 3BZKA 1AA7A 1GV2A 1FIPA 2Y69H 4KN7X 1UMQA 3OYFA 1C0WA 3F8BA 4XK4A 4HG2A 3VYSB 2GOXB 2LC2A 4A93J 2NVTJ 3IH4A 4HDUA 4BE2A 2HS5A 1CGPA 2L7FP 4M74A 3I56I 3MD2A 1LKXA 2BY3A 3MCZA 2EA2A 3BDDA 1W1WE 2DXIA 2HXIA 4PJNA 3GTJJ 2EBIA 2KJBA 1DPUA 2CUZA 3ZMZA 3TKYA 2K02A 3I3LA 3LSJA 3BROA 3SZTA 2W84A 1IN7A 3COAC 3IH2A 5M3FJ 3UNGC 2D5VA 1IJWC 1QPIA 5HS7A 4HF2A 1IZ1A 1TC3C 5EGOB 2DT6A 2KIMA 1NK2P 3BPVA 2G7HA 3CUQC 1RRJA 5IOYA 4IXAA 2YS9A 3FXMA 1BM9A 2QQAA 2FE3A 4PDKA 2E34A 1R49A 2XRLA 3O8GA 5JR3A 2CG4A 3M4OJ 5E79C 5FGMA 4AWXB 2OAZA 4C2MJ 1HC8A 2A6HF 2DLLA 2RDPA 3PSIA 4KJZA 1S7EA 2LY2A 5IOZA 1BI1A 2QM3A 3VOEA 4U7BA 3JREA 2K40A 3KP3A 3KCCA 2MFZA 3CC4I 3EUHC 3G1OA 2L54A 2M30A 1HSJA 2A69F 1X1BA 4J19A 2XRNA 3NQOA 5H2FC 1A36A 2QSGX 1N75A 3IV5A 4NBQA 2MC3A 4AD9A 4CYDA 4XSZF 3SFZA 3CCJI 1QHHD 3I55I 4U0YA 3E6DA 4L5EA 3HOSA 3P5JA 3BTJA 5IYCJ 3CF5F 2K9SA 2HVQA 2HU9A 3P9CA 3TDUC 3BR0A 2KDOA 3M9AA 2XGXA 3JRCA 4FETA 3KETA 1Z91A 2EFNA 3F9KA 1HLVA 2FMYA 3SXYA 5EYRA 2DK8A 1BA5A 4PGGA 3MZYA 5LEKA 4Q5SF 2GA2A 4LB6B 5D5UB 1YRNB 2TCTA 2X1EA 1YJWI 5BPIA 2GXAA 1MW7A 4A0YA 2X6YA 2ZNZA 4BJ5C 1T56A 2XHKA 2M4KA 1XD7A 2P81A 1OCOH 4ZYDA 3KPHA 3FMRA 2STTA 1WJ5A 2DMTA 2QA4I 4A3GJ 3FISA 2LK2A 1MBJA 2VXZA 1IW7F 3FM3A 2R7WA 5JLXA 2P8TA 2KKOA 1YE9A 2M4GA 3QQAA 4DW6A 5DUIA 2OQGA 2DQRA 1ZR2A 4S05A 1P7JA 2XB5A 1ODDA 1LDDA 3HRMA 1LEBA 1TWCJ 3FIWA 3U1DA 3S8PA 1R1VA 3FXJA 4IRIA 2LH9A 4XRFA 4E6KG 4CCJA 4P9FA 4QTRA 1QHGA 1WGXA 3G1MA 1V5EA 4XLAA 4XKVA 2NVUB 5ICFA 4XMYA 4YEJA 3ULQB 1WHUA 2X1CA 4CUGA 4UNOA 5L3BA 1SFKA 3KYDB 4KT5C 5DCFA 3MWMA 5IP7J 4IRGA 1QPMA 1IRFA 4FE4A 2E19A 3LA2A 4MTEA 3CUQA 1YW9A 2CQXA 9ANTA 3CJQB 1Z3XA 2MABA 1CF7B 4P55A 1ON2A 2UWMA 3OR1C 3HEFA 4IPAA 1T39A 3DF8A 3HHHA 2VBWA 1A04A 1U9NA 4OIRF 3GX4X 3GVAA 1K6YA 4DYRA 2JRTA 2GAUA 2KRFA 2P4WA 2XGEA 5A2QZ 2NS0A 4G7HF 3MZ8A 2O7OA 2VB6A 1B9MA 5E3LA 3KP4A 3WTSC 4Y52J 5F0HA 2BY0A 2F4IA 4C2UA 1MJBA 1D0XA 2CQQA 2G9WA 5FLXZ 3EUHA 2BYVE 3RCOA 1UB9A 2DA2A 2QYOA 3A01B 3CDHA 5LEJA 2JPBA 3T8TA 3TP0A 1ULYA 2ECCA 5E8IA 3L1PA 4U0WA 1JGSA 2FF4A 3ZQLA 2BVLA 2E60A 2OC6A 1ETQA 4KIGA 1J5YA 5IT3A 2XF7A 4UVAA 1Z6RA 2FBHA 3VB2A 2V4JC 4KIBA 1DPRA 5L3GA 1O7FA 3HC7A 1WFXA 3CCQI 1ZGWA 3KP7A 4BEHA 4BHBA 1XGNA 2OJED 3J80K 3C3WA 2DDAA 3CJRB 1KONA 1K78B 5F64A 1MNMC 3WHBA 3ABUA 3HRUA 5F6FA 4M9ZA 1OKRA 4ON0A 1S5LC 3U2RA 1LDKB 4Y7NJ 2YX7A 4A3LJ 3O3KA 1OCZH 3JRGA 2JZYA 3LSTA 3D5SC 1A31A 3BR2A 2IS6A 2PMUA 3WU1B 1L0OC 2VJ5A 3ZMVA 5FKOA 4UY8I 2VBYA 2QWWA 5E3MA 4MFDA 3K6GA 3RIRA 5B3SH 3T0YA 1IXSB 5J3LA 1TNSA 3BOQA 4QPQA 1Y8RB 1H0MA 4LITA 2VJ4A 1GT0C 3LFKA 1IV8A 2DMNA 2HPIA 1RR8C 4MEYF 3C18A 1ETKA 3HOZJ 5D8LB 2O8XA 3I64A 4PGHA 2L9RA 3CCRI 2E1MC 4BHPA 5FD6A 2M8GX 2OZ6A 3H0GJ 3JRDA 1ZRDA 1LE8B 2VL8A 3V4GA 3GZ5A 3HPHA 1LJ9A 3CCLI 4F55A 3EUKL 1YIJI 1S72I 2DPUA 2A6EF 1BR2A 4BH9A 2QVOA 4ETSA 1IXRC 3VFZA 4IOCF 3S3MA 3KYCB 4ENNA 2E1OA 5L3DA 2ETHA 2OCCH 3F8MA 1T2KA 2DBBA 3K1NA 4PCQA 4RGSA 1ZRCA 1XPXA 2MBFA 4FE7A 3ZQIA 2QSHX 4B8XA 4GXOA 2W25A 2LSOA 3TW6A 3HM5A 4IVNA 4LIVA 4CYCA 1Q1VA 3E6MA 5FFXA 1RUNA 2DFEA 2E1CA 2NRAC 3HOWJ 2HTSA 5B5EC 3DTIA 2K3FA 1TQMA 2L4AA 3R60A 4I99C 1I50J 4MGRA 2CW0F 1G3TA 3RSNA 3KP6A 4A2UA 2VKVA 4F7ZA 5FD5A 1WSUA 2F4MB 5FKLA 5CVIA 1OISA 3T1BA 2BY2A 3HGYA 2AXTC 3C1DA 3QODA 5DCMA 3C2GA 1UCRA 1A35A 1EV7A 2ME6A 2K7LA 3KLOA 2LP0A 4M6VA 4CCOA 3RKYA 2WWYA 3LOCA 2IBDA 2JUCA 1USTA 2MGQA 3OL4A 5KAIC 4D5FA 3JRFA 3ZMDA 3M3YJ 5AIQA 3BG6A 1ZKGA 3BLYA 1G6NA 4HX8A 1FJLA 3DWLE 3OWTA 4A3FJ 2V1UA 4U87A 3J7ZI 2V9PA 1FYKA 4IOAF 1ONVA 2ZC2A 1ZK8A 2O6GE 1ZAOA 3GCMA 1TW3A 3PNVA 1HF0A 5D5XB 2JA2A 1RIOH 1L3LA 3OYAA 2JTVA 2X1DA 3BJAA 1YTYA 5M5XJ 3NRVA 2DDBA 1ZGAA 1B59A 4RA2A 2L7KA 3WTXC 2M9HA 3WGGA 2E5ZA 1S29A 2B63J 4HA8A 4F92B 1KU7A 3F72A 2DA3A 4M9XA 1O7LA 2P5KA 3QOEA 2E7XA 3JAMZ 4H4KC 2R7ZJ 4KT6A 3S15J 1Y0NA 4KISA 4A69C 2VONA 3F8NA 3K1MA 3C7JA 1MJAA 2E71A 4ENMA 2F6CA 3IHUA 5GAHJ 1Q1HA 5DD8A 3WG7H 1H88C 3DPTA 2Z33A 2FOWA 5M3MJ 4WX9A 1EH8A 4KN4X 4ZYHA 3ERMA 2VASA 5ERIA 1EJ9A 5EGOA 1G3WA 4BE0A 1IG7A 1F36A 4V2GA 2DA5A 3BWGA 3K1PA 3Q5FA 1FNNA 3DTKA 4HAMA 2VN2A 5LGUA 4WXDA 1QBJA 1IO2A 2JUGA 4QPOA 3ZQFA 2EV6A 1GXPA 1Z21A 2CV0A 3PM1A 1EH6A 2XB0X 2LTPA 2QUFA 3ECOA 3LA7A 3BTCA 4CXFA 4AIKA 5EEGA 2LG4A 1A6QA 2ZXHA 4L5JA 3L00A 4C9YA 1JUSA 1SD4A 3KX2A 2PQ8A 3B6AA 1E3PA 2K9NA 1WI3A 2LR8A 2DA4A 1VQ6I 2LKXA 3WE3A 2DTZA 3BR5A 3H9QA 2HDWA 2BW3B 2IJLA 1JGGA 3A1YA 3ZR8X 2EZHA 2R7TA 4HV5A 2Q0OA 2HWVA 3GTOJ 3ZQCA 4BQQA 1IGNA 4XOTA 4RLFA 3UR3C 2GA1A 3H5AA 2Z3YA 1QVTA 2KIFA 2ZMEC 1VQ4I 2BXYA 2DMPA 4XKBA 4Q4ZF 4XLCA 3E7LA 3LSMA 4Y15A 3ZPLA 3LSGA 3I4NJ 4IHVA 3OYDA 2ICWG 2NXNB 3O2PE 3G6EI 1YRNA 1JTYA 1IDZA 1M1EB 2UZKA 5HLGA 4IHYA 3RJPA 1R9TJ 4BEHB 4BS9A 2FUG2 3DKWA 2DCEA 3KP2A 2D1VA 2HOAA 4XONA 5KHDA 2PMZA 3GLXA 3HSEA 1FIAA 5IP6A 2RV8A 1PVEA 4II3A 2Q8KA 1B6AA 1HKSA 1TW2A 2OBPA 1WJFA 2DFHA 2HYGD 3LSHA 1DGWY 2HNHA 4ZZLA 1QA6A 1JHFA 4WXHA 2RVCA 2K4BA 2N8GA 4I0BA 2EFWA 4IHSA 1ZTRA 3QU3A 2CS3A 5E17F 1G59A 2L01A 3PNYA 4OWRB 4AVPA 1IRXA 2YSRA 5TJJA 3PJRA 4CCNA 2YPRA 2IP2A 3RKXA 3TP3A 3V7CA 3SEZA 2H1KA 3AG2H 4KICA 5IT9K 3LFUA 2JPCA 4HSRA 2OPTA 4G7OF 2V1NA 3AAFA 3L2VA 3OS2A 1TL8A 1LB2A 1VQ7I 2GXBA 4JYKA 3G73A 1HA8A 1OR7C 2CW8A 2JSCA 2OV7A 1BIBA 2WB1A 1NHAA 4I98B 2Z1DA 4HOBA 1YFHA 2B9SA 2CYYA 2X0LA 2JMWA 4DBRA 3OSGA 4AIJA 4DQ2A 2HZTA 4EJUA 1CF7A 2ELKA 4BXUA 2VKHA 4A3BJ 3SEQA 4QSHA 2F5EA 4JOMA 4Q47A 3TW7A 4E7IA 1AOYA 3S2WA 2O8KA 2V7FA 5D8KB 5LHIA 2A3SA 1ERDA 4IL6C 4M9SA 3BQZA 5CVJA 4HF1A 3L9FA 2X6OA 1VNDA 1I1SA 2GIZA 4F91B 1FOYA 4E7ZA 2AXLA 4C30A 2AS5F 2A5YB 2VIXA 2OCEA 1ETWA 4O6JA 4F52A 5GPCA 3OYBA 2LVSA 4LFUA 5DM6F 3D1NI 1PUFB 2JK3A 4XL9A 4E7SA 2JRMA 3OYEA 3CF2A 3K70C 3A01A 3DEEA 4I01A 4HNVA 3BG5A 2ID6A 2KIUA 2VBXA 3TDZC 3Q0VA 2HQNA 3FXQA 4GCVA 3I5UA 3CZ6A 5JHFA 1TZLA 2FJ1A 5JLWA 3VYRB 2HYFA 2DOFA 1WPKA 4PJLA 5TGTA 1YYVA 5FO5A 4NQWB 2L9VA 4XLPF 2MD5A 1CQTA 5FRMA 1PUEE 5HLHA 2MLKA 4XRMA 1K78A 3PQKA 1JHHA 2KRCA 1X2MA 5D5VB 3VYTB 1BW5A 1K7AA 2VC0A 3N05A 3HHGA 3A2KA 3U9GA 2JA6J 1IAWA 5DCMB 1KU3A 2AHQA 1D8KA 1N25A 3H1CA 3RZOJ 5H20A 1H8AC 4HEA2 4FX0A 1ETYA 3JW4A 3IWFA 4DGWB 2VI6A 1HCRA 1ETVA 1XGOA 4NC7A 5CLSA 3VWBA 1HW5A 1I39A 2M1BA 2ID3A 3M8JA 3M07A 2Y9ZA 1XDSA 3U1KA 1WH5A 4X1EA 1IUYA 3HOTA 3H9JA 3IRQA 3S1RJ 2E2IJ 1SD7A 1B1BA 4FTHA 2HFHA 1Z6TA 4E4HA 3JRHA 1D0YA 1W36C 4ZDLA 1OR7A 2V9VA 2WV1A 2WA0A 2JA7J 2WAFA 5LRRA 1VQOI 1NH3A 3QPLA 4IEJA 2EK5A 4BQOA 1IUFA 1ORKA 4X0GA 5ILSA 3CCSI 1OFCX 5EJCA 3OYCA 2NAZA 5GADJ 3HSRA 3S17J 1LE8A 2C6YA 3W2AA 4GRIA 2E1MB 2HOTA 5F1JA 2A05A 3M1CA 1TWAJ 4A3IJ 2FEZA 1ZG1A 3IWZA 3DLAA 3FXKA 3DPUA 2EJRA 3GLLA 4CGZA 1OCTC 1BIAA 2CQKA 3WTYC 4MQVA 4BDZA 3S14J 1OPCA 2HTJA 2Q1ZB 3Q0UA 3FXLA 4R79A 4FCYA 3H3UA 5J1RA 1PJRA 1X3UA 3IL2A 1IN4A 2E7WA 2R7RA 1MBGA 4ABZA 3A0BC 3KIOA 4HDVA 3KEYA 4I02A 5GTHC 1FWZA 1XMXA 4P9UA 1F1ZA 2IS4A 2TDXA 3M1EA 4D9JA 3HUGB 3NEUA 1Z9CA 2HZDA 3KLNA 3ZMUA 1HKQA 4JP0A 3SJMA 1WJEA 1ON1A 5EZGA 3E3VA 1HSTA 2L4MA 3LQRA 1Y8QB 3MVPA 1AKHB 4UUTA 5GAEJ 2PEXA 3W6JB 2F5CA 4H0EA 1OCCH 1KQ8A 1WJAA 3S2HJ 1P92A 2IEKA 1XGMA 4EMSA 3FHZA 3CC2I 1WCMJ 2PMZN 5E1ZB 3NAUA 1WRJA 1FY7A 2OTLI 1U3EM 4NDLA 1OYYA 3TOBA 4Y3OA 4EQQA 1FOWA 3DFGA 1Z7UA 3J7YJ 4ENKA 3GFIA 1SMTA 2E35A 1WWXA 1T08B 3M8EA 3L2UA 1X1DA 3S16J 3BR3A 2IAIA 1G3SA 1ZARA 1R5HA 1UELB 1Z67A 3OYNA 3ABLH 3FK6A 5F27A 2IVMA 1V4RA 2LMDA 2M87A 3ISPA 1SFUA 5ILVA 4IKFA 2IPQX 5L3FA 1POGA 4G7ZF 2TRTA 2FQ4A 1UHMA 4I7HA 1W7PB 1S9HA 3EYIA 2WB1N 4O5VA 1QNTA 1HBXG 2HDCA 3CCMI 3KYLA 1TNTA 5HVQC 1YX5A 1FC3A 3R4KA 1UFMA 1X58A 2DFFA 4IQJA 2DA7A 4EJOA 1SMYF 1HXDA 2M0CA 2R92J 1A5JA 3FF5A 3OYGA 1R4MB 4UB6C 3WGHA 4BBSJ 4KIFA 4YIIA 2H6BA 1T33A 2DU9A 1RUOA 1FX7A 1TT0A 1UZCA 4UUSB 3PQJA 3CESA 2K9QA 3FXRA 2ZCWA 1IN5A 1V5GA 4DNCA 3DV8A 2BHYA 3IP4B 5J40A 4E7KA 1W0UA 5LLQA 5HDNA 3LSRA 2QQBA 5LGNA 1YJ9I 4OMYA 4CDGA 4AM3A 2ZFWA 2NVQJ 1K4TA 3S1MJ 1NTCA 2XROA 3DPLC 2BW3A 1HDPA 2F2EA 2MH9A 4II2A 5E3NA 4M3EA 1ZG5A 2FD5A 1VQMI 1GVDA 4NNJA 5EF6A 2Y0MA 3R0JA 3D0SA 3LSPA 1X1PA 2OUMA 3FK7A 3I9V2 4RS8A 1P2FA 1SVLA 2EV5A 3F3XA 1OQYA 3PIOF 5JFRA 5HS8A 2VQLA 4XLNF 1H9GA 4NUBA 1O4XA 2CMPA 4BYYA 2O3FA 3KZZA 5HNHA 4QLCU 2GQQA 4BDYA 2ZMEB 3GEZA 2WBMA 3H36A 3E97A 4XN0A 5DM7F 2YX4A 1XTAA 3QYEA 3PL8A 3ZQ7A 4L9JA 5CKTA 3K2AA 2W48A 4E7HA 1N77A 4GYIA 4IHWA 2ECBA 3S1QJ 3CMMA 3CMAI 1HKTA 1N78A 2CQNA 4Y4RA 4N4OB 2VLAA 2KPMA 4YFNF 4L18B 1HQCA 4NC6A 3ABTA 5CVVA 1TTYA 5IPAA 2XSDC 2O03A 2XIGA 1E0EA 2IA1A 5HNFA 2VJIA 1P4AA 2Y0SN 4IF4A 2Y30A 1X4PA 4ITVA 4A5NA 3K2ZA 1AWCA 1UAAA 3CDIA 2VODA 5EG0A 1AHDP 2FQ3A 1VQLI 2ME0A 3HTUA 4M72A 4LB5A 2KL4A 2I10A 2COBA 2WADA 4ZH4F 1DP7P 3CCYA 3G2BA 4D5CA 4A0ZA 1FP2A 2PMHA 1R1TA 3F23A 1G8XA 4V2FA 3W2WA 1FSEA 2L5QA 2XKOA 5L3EA 5ED4A 5EEAA 3QU6A 5HODA 2HOSA 1NK3P 2O61A 3J81Z 1SFOJ 1ITYA 3WG9A 3WTUC 1VI0A 3OSFA 2DMQA 4L9NA 4BNCA 2EINH 2CFOA 3JTGA 3K69A 4F93B 2DOAA 4AIDA 4BUPA 1VQKI 2VQHA 4A12A 2ACJA 5IT9Z 1YIOA 5HDGA 3GBGA 4YFXF 1I5ZA 3H5RA 5GTIC 1B72B 3CTAA 1SC7A 3V8JA 3JR9A 1U5TC 2QKMB 5E18F 4D7NA 3ZQQA 1JTXA 1YQAA 2IGMA 4DYCA 4ENJA 2R7XA 1MMAA 2FBKA 4LG3A 3LL7A 1J09A 1Y0UA 2E1NA 2XV4S 3HJEA 1PUFA 2K86A 4MNUA 5HOOA 1XSDA 2HGCA 4PJJA 3A4CA 3JCUC 4QWQA 1WQ2A 2XPUA 1STZA 3LSIA 3WTTC 5B1AH 4GGGA 4HF0A 1Y1WJ 2DFIA 5CQEA 4BY7J 2FNAA 1R7JA 5KNLA 3OR2C 1Z05A 1T6SA 1MD0A 1U8RA 3EUAA 3WHCA 1BR4A 4DOZA 4A3DJ 4NQWA 3QP5A 1TQPA 3H3ZA 4JBAA 5H6QA 1W5TA 4XR6A 1XS9A 2HVSA 3EPZA 4ZC3A 3K70D 4D7MA 4XORA 1W5CC 2AO9A 1RNLA 3BJ6A 4B43A 4KDPA 3OOPA 2GM4A 2GWRA 4XLFA 2P0WA 3OYHA 2OZUA 2QGUA 3C2HA 1J2XA 4RB0A 1MGTA 4OMZA 1D8JA 4PJ0C 1G2HA 2HDDA 3EYYA 3ERED 3GTMJ 5DYMA 3WE2A 5DUKA 4MTDA 3PIPF 3BZCA 4MFEA 1XMAA 2D2WA 4B48A 2HKXA 1I3QJ 1F5TA 2JWTA 5L3CA 4XKWA 4DYQA 4W1UA 2GXGA 5DS9A 1FOXA 2R7UA 1D1AA 1ZN2A 4PZJA 2DTRA 3TQNA 3IAM2 1WVRA 3CUOA 4AC0A 3VODA 6PAXA 4N9HA 3TEDA 3LWFA 3SZPA 1RESA 2UUZA 1BW6A 1ACIA 2FOKA 2L7MP 2KDZA 4XRSG 1QU3A 3MKZA 3I4MJ 2RN7A 2VE9A 1BC8C 4I09A 4DJAA 3BQYA 5J8FA 1P7IA 3GW2A 4XICA 2W1OA 1E3OC 1P4WA 5BS6A 2RC4A 3TGNA 2WTEA 3IKVA 3G4SI 4EM1A 2NNNA 2VKDA 3RTRA 3JSPA 2PBIA 1R1UA 2X6WA 3DLLF 1XB4A 1X3ZB 4CCMA 2DOEA 1W36D 3PO3J 1UJ8A 2ZXWH 3OYLA 1S3JA 3QYFA 2X9DA 2VBZA 1ZH5A 4ZYGA 4DBQA 1U5TA 5GPAA 2EA4A 2BZTA 1VQPI 4HZFA 2VPRA 4E70A 3PNTA 2XDVA 5K5OA 3RDIA 2VPLA 1I1GA 1DGRM 2X4HA 3IC7A 2PLYA 2Z9OA 3ZN0A 2GIVA 4Q48A 2LREA 1YLFA 3AL0C 1JUMA 1O3SA 4ZYAA 1MSFC 2HOEA 1XN7A 2M34A 2XAJA 3GZNB 3ASNH 3QYBA 2W82A 3E5UA 4M6XA 3SQNA 2QENA 2E2HJ 2DPDA 2EH3A 4YFKF 3HUGA 2H8RA 3G1LA 3ZN1A 3B6CA 1XC5A 2LNBA 1QO0D 2EPFA 2H94A 4G94A 4XLEA 1X4OA 3JRIA 2VUMJ 1AKHA 1OCPA 3PUFA 2XKPA 2R7OA 2Y9YA 3I58A 4EJTA 4M3GA 3A0HC 5TRDA 2R4GA 1VF9A 5FRNA 1MMDA 4M71A 4PFPA 2WY8Q 4BE1A 3FWEA 2KLOA 2UXXA 5FROA 3IRRA 1O3RA 1U2WA 3ABMH 3A02A 2QEXI 2DQLA 2Z99A 1MH3A 1KQ9A 1DQUA 4A0XA 3OYKA 3OYIA 3D5RC 5D5WB 4QIWN 4BXFA 3CO7C 1PP7U 3TO7A 2Y31A 3BJOA 5LGTA 2O9LA 1KYZA 3VYUB 1BJZA 3BP8A 4C3IJ 2STWA 4G6TB 4M3DA 4OAZA 3HB9A 4BACA 2H27A 4HNTA 4UUVA 4PSWA 3RYRA 4AYBN 3CCVI 3ZQGA 3J81K 1YI2I 1QRYA 1QZEA 1Y56A 1W0TA 2KISA 3QPTA 2RREA 3QWLA 1W7PA 5J8CA 3MN2A 5HLTA 3TBIA 3A03A 1PDNC 3O8HA 4ZYEA 4LOCA 3TL4X 3D5LA 5KK1A 4O3MA 5J47A 1OCRH 4Z2YA 5KCMA 4K2EA 1AU7A 2W85A 4I0AA 4TV7A 4U7DA 1ZYRF 5EG0B 2XPWA 3WTVC 2QCOA 2R7FA 3QAHA 4CA0A 4ZZDA 4J00A 4JK1X 2J5OA 2JVHA 5BQTA 3AFHA 1G4DA 2ISZA 4S0HB 4G12A 4FASD 1K61A 2JSPA 3WU2C 3ZOBA 1E17A 1IN8A 2X51A 2W7NA 4OIOF 4P1WA 2ZKZA 4GO1A 4KNYA 2R3SA 3E6CC 1X1CA 4UUSA 4UV8A 2H09A 2HXOA 4OIPF 1JI8A 3CMEI 3I59B 1BN5A 5LRSA 4KITB 3ROUA 2I8DA 3ZMTA 1ZELA 1MNDA 2XAUA 4DZPA 1R71A 4BQAA 2K4JA 1APLC 4RM2A 2NS7A 3WODF 2NVYJ 3S3NA 2ZJPF 4Y17A 1TWFJ 4NB5A 1TP4A 2CWEA 2VC1A 4JQFA 3FMQA 4XM3A 2EIJH 2UXNA 1REPC 2FA5A 5JHUA 5IP9J 2UV1A 3HKZA 1XMKA 3N4MA 2HKOA 3F6VA 1I27A 2DN0A 2EB7A 3IH3A 4M73A 1JXSA 3CCUI 3K10A 2CQ7A 4BL0B 1ZR4A 5LBQA 3FKJA 2EFPA 3AKZA 2BE5F 3E0JB 5HS9A 4BKXA 1MZBA 1XGSA 2D1HA 3BTIA 4G6DA 2ZMEA 4U0VA 4RB2C 1YX3A 4HBLA 3R0AA 2XC7A 3OIPA 5IY5H 4ZJZA 2XAFA 3W3CA 3GTGJ 2ELJA 3IKTA 2V6CA 2Y75A 5IYBJ 2OA4A 4IHXA 4ASNA 2P6SA 4J01A 4Y13A 3BR6A 3M8FA 2DAOA 4Y33A 1RKTA 4YRVA 1LPQA 1QVUA 1XG1A 2QKLB 3OV8A 3TMOA 1KZHA 3DTEA 3DBRB 1H9TA 5JI6A 3CMYA 2GLOA 5J1UA 2BGCA 3FXOA 3QPHA 1X3WB 1TLHB 3P7NA 4RBOA 4CO8A 3L2QA 3V8KA 2EQRA 1XCBA 3DBLB 3ZQHA 3VDXA 4ZTJA 1Z3YA 1QZZA 2G0EA 3B73A 5D6EA 3TO6A 3F0CA 3L2WA 3HL2A 1KGSA 1A6IA 4JX5A 4A5MA 2M7AA 3K4CA 4HQEA 3ML6A 1SD5A 1UG0A 3ZMSA 1U6GA 2MW8A 4B44A 1KQ0A 4DZJA 1YITI 1JJ6C 4WK8F 1FEXA 2VE8A 2JT1A 2QZ8A 5KVRA 4EM0B 2KZGA 2Y0SA 3H5NA 2DYSH 2P7CB 2GOMA 3W6KB 1IV6A 1LFBA 2ESHA 4XOPA 4L9VA 1UHWA 1JE8A 4EJWA 2V1DA 4XSXF 4ZDOA 1TWGJ 2EZLA 2R7DA 1R36A 3HDDA 2XUBA 1ENHA 3JTHA 4A3KJ 2R5ZB 2MG4A 2LKPA 3FM5A 1BI3A 4HX4A 1B72A 1YJNI 3E6BA 4AUXA 1O3QA 3WGIA 5H6RA 3LAJA 3HTSB 4IX7A 3WTZA 1YHQI 3OOUA 2NS8A 3BC8A 3SDBA 4YG2F 2FNPA 2KIQA 5F0FA 4XN3A 1TBXA 4UHTA 1U5TB 4RB3C 3S93A 1YS7A 3RQIA 2AQEA 4BU2A 4KYWA 5FFZA 2DODA 5C3EJ 4PK4A 2EV0A 2XVCA 4RB1A 1U78A 2M0MA 2W4SA 5ICEA 5J4YA 1VQ8I 2CV1A 2QBYB 1ZQ3P 1ZLKA 2KQRA 4LJZF 1IF1A 4HNUA 1FT9A 1WKMA 2QSFX 2Z2SB 1NG7A 3LMMA 3I0TA 3ZCOA 1G3YA 1BC7C 1J75A 1F43A 2FSWA 3SDGA 4G8XA 1MKMA 3EQLF 4RAFA 2DA6A 2LFBA 3HGGA 5CVRA 3S2DJ 2F5DA 5E3OA 3AG3H 4AIHA 2EWNA 3H9GA 3I71A 3KEOA 2LY1A 1FLIA 1T98A 4OAYA 4ESFA 1PYVA 2M7BA 5D4SA 4N4NB 3OS1A 3DEWA 4FT8A 2XGCA 2O0YA 3EETA 5DD4A 3CLOA 4EJVA 5LHGA 3S3OA 1I3AA 2M8EA 2ZXIA 1MMSA 1ETOA 3JSOA 1KU9A 2HR3A 2XASA 2RQQA 3HRTA 3DCFA 1LEAA 2NOJB 4A3JJ 1D1CA 3CP2A 2QLZA 3R6SA 1YW7A 2FXAA 1SD6A 2L9NA 1T8IA 3MQ0A 1IC8A 2R0QC 1Y6IA 4LIUA 4FHTA 2P5LC 3P9IA 4YELA 4LG0B 4GYGA 4PSXA 2IRFG 2ZJRF 2LYCA 5KAFC 4HQMA 4WCGA 1MNEA 3QRFF 3SFIA 1O3TA 4OU0A 2DA1A 3EDPA 3HG9A 1MDMB 2PG4A 3DKXA 1D5YA 5AIPA 2WC2A 4JX4A 2F5VA 5FKNA 2DT7B 2QQ9A 4LK1F 1R00A 3BTLA 4N9IA 3OS0A 4LLLA 5K1YA 3MFKA 3LAPA 2ZJQF 1V54H 3RQ4A 2MD0A 4PJMA 1S8NA 1U9OA 4C3HJ 1BOBA 3PO2J 3FDYA 1RETA 4XLHA 2R7QA 1W4MA 3OYJA 2R7SA 5CPRB 3SHFA 4X6AJ 4HRIA 1W7PD 2VKEA 4EV0A 2IXSA 1JKPC 3F8CA 4BQNA 2PJRB 2X48A 2L0KA 4A3CJ 3L7WA 5E20A 1FYLA 1R5ID 2QF7A 3NWSA 5FB2A 2L02A 2K9MA 3HOUJ 3AG1H 5FKMA 2BY1A 1LUJB 4OIQF 4CHUA 2RNJA 2V79A 1HDDC 1XSXA 2CUEA 1RR7A 2MA3A 2NOGA 4OOIA 3L2RA 1Y39A 1QGPA 4LK0F 2BOLA 1TWHJ 2IW5A 1FBQA 2L7ZA 2BXZA 3GXOA 4B3AA 3HKZN 4B4CA 4CICA 1S6LA 2HQ5A 3IAS2 3VSLA 1SFEA 1FZPB 1S7AA 4N0BA 1XDUA 5CYVA 1YS6A 3DEUA 3AL0B 1SAUA 3Q3SA 3K9TA 1T95A 3BCBA 3BG7A 1EH7A 4ESBA 4MLOA 3DBHB 2IGKA 2VT2A 3HIFA 3LA3A 4NC8A 5FLVA 3QPSA 4P96A 3F8FA 4RAZA 3L09A 1GXQA 3F6OA 2X85A 1IN6A 2ZSHB 1MJ9A 2ZNYA 2Z5UA 1YW8A 1ZHFA 1FOKA 1DUXC 1DP3A 1SVOA 3JRBA 1MH4A 4C2TA 2IT0A 3K4MA 2HI3A 1QZYA 1RI7A 3KE2A 4HV6A 1D0ZA 4ZTFA 1IDYA 1W5SA 4RGUA 3OY9A 1MMNA 1UHSA 3GO5A 2Y2ZA 2LKSA 3RKWA 3OIQA 4KMUX 5J4VA 4EEFG 1RZ4A 2XAQA 4E7JA 3H92A 3I54A 1B8IA 3MKWB 1P4XA 1Z77A 1R5GA 2WY7Q 2CSOA 3BCAA 5EZHA 2M45A 1BI0A 2LLKA 3R61A 4UVBA 1U8BA 3T8RA 2JVGA 1WJCA 4CH7A 2LBFB 2FX0A 2VQCA 2HQRA 2P5VA 1WJDA 2KZVA 3ZXSA 5FJ8J 2DMUA 3OYMA 5GAGJ 2KJCA 2M3AA 1I6XA 2Q2EB 2WAEA 3MAJA 1BBYA 1MMGA 2CH0A 5J1YA 1OLTA 3FBIB 1LQ1A 2BEOA 3HBLA 3CC7I 4HLYA 1ZLJA 2H6CA 4LD5A 2W57A 2EILH 4XRSA 1MBEA 3K4LA 3HRSA 3KP5A 3L2CA 2COMA 3BZ6A 1BOAA 4AYBA 1E2XA 2YR2A 2CJJA 3WTWC 4IQ4A 2LOOA 2J5PA 4HYEA 1FBUA 1OJLA 2KMUA 3H0DA 2IGNA 3ECHA 2M5WA 2DK5A 5FKKA 4S04A 5JVGF 1XSVA 3FZVA 2K27A 1R23A 4KFCA 1I6HJ 3I59A 2O5RA 1D1BA 4MO7A 2V9KA 2F5FA 3DP7A 2RGVA 4ANJA 2E2JJ 4M6YA 4UB8C 5K7FA 1P9QC 3G71I 3HYIA 2JQ7A 2F4OB 4UXNA 2CUJA 3BG9A 3MKYB 1LFUP 3S32A 4B47A 5BPDA 2ZBKA 1KYWA 3K7AJ 4I6ZA 4RGXA 1J9IA 4LLGF 5ILUA 3MEXA 4CZCA 2A6TA 5K7HA 3VPRA 5M5WJ 2ZO4A 1MBKA 1V55H 5K7ZA 1MSEC 2JA8J 1WI9A 3GYHX 2NYXA 5EDNA 3ZP5A 2MC4A 5ICCA 2H1LA 1SANA 1GUUA 2F48A 1LNWA 4IRHA 4B09A 2CW7A 1BJAA 4IZZA 4I2OA 2IA0A 3HOXJ 4NHJA 4L0YB 3Q9VA 1H89C 4FISA 3ZRGA 3GZ6A 2DI3A 2RKHA 2IA2A 1LVKA 3TO9A 1B9NA 3REOA 3Q0WA 4UVCA 3F22A 1YOVB 2WAQA 1SVMA 2EIKH 5DDGA 2YU9J 3OL3A 1RKWA 3CJNA 2CGPA 2MLGA 4HLXA 4B3XA 2ELHA 4L9TA 1MIJA 1FSHA 3CD6I 5JVTA 4EGZA 2XF5A 2D45A 4B1RA 2XAGA 4M3BA 1T0FC 4KUMA 1QQIA 5FLMJ 1JKQC 2LRDA 3HSFA 4MIMA 4ZDPA 4HW0A 3PSFA 3VEPA 1VQ5I 1F4KA 2NVXJ 4BJTA 3FBNB 2DJNA 4AVZA 3NARA 2CUFA 2V1XA 2MH2A 4MHGA 3RPUA 3I53A 2VQGA 4V19K 4BBRJ 4XNFA 3GUDA 2ESNA 2R5YA 5CJ9A 3DXJF 5F0CA 3JRAA 3J7AY 2R7VA 1Z7LA 2FBIA 1J7KA 4BAYA 1D3YA 5AONA 1GVJA 1FMWA 2CRGA 3LQQA 3V7RA 2EZIA 5B1BH 4GDFA 1X2NA 2Z16A 3MKLA 3K4KA 3V42A 4XIDA 2L9SA 3GTKJ 4KMFA 3FXUA 4Z6YA 4D0PA 1PP8F 3N97A 2ZB9A 3KEQA 4XQFA 2K85A 5HDKA 1RPWA 1OYWA 5F04A 5HLIA 3CQZJ 5TISC 1X19A 2R5ZA 3FX3A 2A5WA 2Y48A 1LDJA 3W2VA 2V26A 1WH7A 3P9KA 1VZ0A 3BY6A 4HSTA 4L5IA 2FRHA 4F3QA 4M3FA 1ZG3A 2OU2A 1BR1A 2BV6A 2X6XA 4CCLA 1UG2A 3DU6A 2B0LA 3W6VA 2LF8A 2WV0A 3GFJA 2BBYA 1IRGA 1SAXA 1DU0A 3FMSA 2OTJI 4PUSA 1EA3A 2JJ7A 3DQVC 5K5RA 1K83J 1GDTA 2PI0A 1DDNA 3C2BA 5BOXA 4AU7A 4GFBA 3S1NJ 2ADUA 4FX4A 1JKRC 2QBYA 3RPQA 1P6RA 1JJ8C 2V6EA 5A2QK 2PX9A 2EZKA 1KU2A 3CLQA 1WJBA 2RQPA 2E5NA 1R6RA 3GFMA 3SYTA 2JN6A 5FLXK 3G3ZA 1K4SA 3X2QH 5LD2C 2I5UA 4RDUA 2HPMA 3HOYJ 4BHCA 3E5XA 3HOVJ 3CUQB 1WZ2A 3I4PA 4BJ6C 3VSKA 3KZYA 5F1RA 1R58A 3FHNA 1LFPA 2KP6A 1U0JA 3QP6A 2HVRA 2MSYA 2IGOA 1T0FA 2DW4A 5B66C 3K0LA 3CO6C 2ZFUA 1FYMA 3GMEA 2XF6A 2LY9A 3E5QA 3QOPA 2KFDA 1OYIA 1R4NB 2DYRH 1XCVA 3V7SA 3ZGKA 3M7GA 1FMVA 1Z0XA 4LG0A 3HXLA 4MQ9F 4EVIA 1B8IB 4RGRA 4ESJA 2A68F 3ESWB 5D6FA 1SEUA 4R1HA 1E3HA 3UKGA 1V5FA 3IUOA 1IRZA 2OD5A 1MDMA 2L2OA 2LF7A 2VOPA 2XSJC 2BHZA 1RC9A 2P7VB 3CDLA 3GWZA 1J59A 2YU3A 1K79A 1R22A 1T38A 3ONQA 3J7AO 2CFXA 5K5QA 2XAHA 5E1WA 4RAGA 4YIRX 1HOMA 4RLQA 3T5XA 4JX6A 2KRHA 4WXCA 2E36A 1FTZA 3RKQA 2B7EA 3NWTA 1TQIA 4A6EA 4C3JJ 4XBFA 2DO7A 1EKEA 5DV5A 2FMLA 1J0RA 2HEOA 3KFWX 5CVUA 1S7OA 3PFYA 1X1AA 2PJPA 2PJRA 1FTTA 4L0ZB 3K4BA 4BGDA 1YO5C 5DTDA 5LHHA 1F9NA 1Y1VJ 3CP8A 1OMIA 3B02A 1DU6A 4G6QA 1VTNC 3BG3A 1O57A 4UV9A 3Q9SA 5F08A 4RM3A 4LGWA 4KA4A 5ICGA 4W97A 3MZHA 5EEHA 3OMYA 4BY1J 3GTQJ 3LSKA 4XKCA 5C44J 1JT0A 2IS2A 2ISYA 4D1QA 2EIMH 3V8LA 2W24A 1VFCA 2L3DA 2VJJA 1VQNI 4EM2A 2OF7A 1GLNA 2ZSIB 3WU0A 4FQGA 5M5YJ 3H3VK 4EGYA 2R93J 2ZJ2A 2QQ8A 2IS1A 1GV5A 4YIFA 2HQAA 2VXDA 1HW1A 3GTLJ 5GP9A 2K5CA 2WAQN 2GZWA 2VT3A 4RMNA 3RYPA 2EFQA 2RAEA 1VQ9I 5IYDJ 4CCKA 5J6XA 3MMYB 1JKOC 3K4NA 1ZRFA 1MBHA 2M2EA 3OIOA 2PFBA 3K4JA 3HPGA 1ZGJA 2YUSA 3F21A 4IO9F 3GF2A 1ETXA 3SZGA 2BVMA 1BL0A 2MYSA 2LDUA 4EATA 3AG4H 2KT0A 4I76A 4OINF 1SFXA 2DT5A 1JT6A 3RZDJ 2CO5A 2GBYA 4A6DA 2A61A 3PUBA 2JA5J 2EFOA 2ZXJA 3GFLA 3KZIC 3FKIJ 2HYJA 4IJAA 4G9YA 2LBFA 2XPVA 4CSWA 1FP1D 3BR1A 1USSA 5E1XA 3GTPJ 3CJTB 1GHCA 2Q2EA 3ELKA 4MEXF 2VOOA 2XGDA 1V3FA 4A3EJ 4CYCB 4HX7A 4A3MJ 1FPQA 1YG2A 5E8GA 1Z1DA 2P6TA 3O6BB 1BI2A 3DKYA 3BT9A 1KA8A 5BNGA 1EF4A 1IXCA 4CZZA 3HZJA 1HW2A 3ABKH 2R5YB 4LMYA 1K6OA 2G7UA 4U88A 2RNGA 2AQFA 1FBSA 3E1SA 5CQGA 3BPXA 4WF2A 5DEQA 4BXXJ 1TT5B 1NG6A 3ASOH 4E7LA 3TOAA 2CV2A 4PFOA 4WWCA 2DJIA 3RPUD 3LNQA 2FU4A
chains in the Genus database with same CATH topology
2QF7A 1QVTA 3HOUJ 2LD5A 5FKMA 2DMPA 5C4JJ 2XPUA 3E7LA 1HDDC 2NOGA 2CUEA 1RR7A 3LSGA 1Y1WJ 1MBFA 4BY7J 3I4NJ 1JUPA 4IHVA 1TWHJ 2L7ZA 2CU7A 4B3AA 1IDZA 1YRNA 1JTYA 3WHCA 3HKZN 4B4CA 4IHYA 4A3DJ 5C4XJ 2HQ5A 1R9TJ 1XS9A 2HOAA 3Q3SA 1GV2A 1FIPA 1FIAA 5IP6A 1UMQA 4D7MA 4XK4A 2AO9A 4MLOA 5FLVA 4A93J 2GM4A 3QPSA 2NVTJ 3IH4A 2L7FP 2N8GA 1G2HA 2HDDA 1ZTRA 2HXIA 3GTMJ 3JRBA 1MH4A 3GTJJ 2EBIA 4MFEA 2HI3A 1I3QJ 2JWTA 3TP3A 1IDYA 2H1KA 1UHSA 4DYQA 4W1UA 2OPTA 2Y2ZA 3LSJA 5DS9A 5M3FJ 3IH2A 4EEFG 2D5VA 1IJWC 1QPIA 4JYKA 4AC0A 1B8IA 1TC3C 5EGOB 1NK2P 3TEDA 1Z77A 5IOYA 1RESA 2YS9A 1BW6A 2L7MP 5EZHA 2KDZA 2LLKA 2JMWA 4XRSG 1U8BA 3OSGA 2FX0A 3I4MJ 2XRLA 3O8GA 5FJ8J 3M4OJ 2DMUA 2ELKA 4C2MJ 4A3BJ 3BQYA 3TW7A 4QSHA 1P7IA 4XICA 1E3OC 2O8KA 1S7EA 5J1YA 5IOZA 3HBLA 3BQZA 2X6OA 3JREA 1VNDA 2K40A 4XRSA 1MBEA 3G1OA 4J19A 3IV5A 1ETWA 3PO3J 2CJJA 5GPCA 2LVSA 3D1NI 1PUFB 2JK3A 2X9DA 4L5EA 1OJLA 5GPAA 3BTJA 5FKKA 2VPRA 3A01A 5IYCJ 4HNVA 3BG5A 2K9SA 1I6HJ 2ID6A 3BR0A 4MO7A 3Q0VA 3JRCA 2E2JJ 1HLVA 5K7FA 2FJ1A 1JUMA 5EYRA 5JLWA 1BA5A 1MSFC 2M34A 1WPKA 1YRNB 2TCTA 3BG9A 1LFUP 2E2HJ 2EH3A 1CQTA 1T56A 4I6ZA 3K7AJ 2P81A 4XRMA 2DMTA 2H8RA 3G1LA 1X2MA 5K7HA 3B6CA 3FISA 3VPRA 2LK2A 4A3GJ 1BW5A 5M5WJ 1MBKA 1MBJA 1XC5A 5K7ZA 1MSEC 2JA8J 5EDNA 2JA6J 5JLXA 1SANA 1GUUA 3JRIA 2VUMJ 1AKHA 1OCPA 3QQAA 4DW6A 2AHQA 2Y9YA 1ZR2A 1P7JA 3HOXJ 4M3GA 2XB5A 1H89C 3RZOJ 4FISA 1H8AC 1TWCJ 3FIWA 1VF9A 1ETYA 2VI6A 1HCRA 3Q0WA 1ETVA 2ID3A 4QTRA 2YU9J 3G1MA 1WGXA 1RKWA 2Y9ZA 3A02A 1WH5A 4X1EA 1MH3A 3S1RJ 2E2IJ 4QIWN 4FTHA 5IP7J 3JRHA 2Y31A 2O9LA 4FE4A 1BJZA 4C3IJ 4B1RA 2E19A 4M3BA 2WV1A 4M3DA 2CQXA 3HB9A 1JKQC 5FLMJ 2JA7J 9ANTA 3QPLA 4IEJA 4MIMA 1IUFA 1ORKA 4AYBN 3ZQGA 2NVXJ 1QRYA 1OFCX 2DJNA 3HEFA 1W0TA 3NARA 3MN2A 2CUFA 1U9NA 3A03A 3O8HA 3S17J 4DYRA 1LE8A 4LOCA 4BBRJ 2HOTA 2XGEA 5F1JA 1AU7A 2R5YA 2O7OA 1TWAJ 5E3LA 4A3IJ 5EG0B 2XPWA 5F0CA 4Y52J 2QCOA 5F0HA 3JRAA 1OCTC 4S0HB 4G12A 2CQQA 1K61A 3ZOBA 2CRGA 2EZIA 3S14J 1X2NA 3MKLA 2DA2A 3A01B 3TP0A 4XIDA 4UUSA 2ECCA 2HXOA 3GTKJ 3Q0UA 3L1PA 3ZQLA 4FCYA 1ETQA 5J1RA 2ZB9A 4DZPA 1RPWA 1MBGA 5F04A 4ABZA 3CQZJ 1APLC 2R5ZA 1ZGWA 2NS7A 2NVYJ 1TWFJ 1MNMC 1WH7A 3WHBA 4JP0A 4M3FA 4Y7NJ 5IP9J 3SJMA 4A3LJ 5EZGA 1UG2A 3MVPA 3JRGA 1AKHB 4UUTA 3W6VA 2DN0A 3BR2A 3IH3A 3S2HJ 1DU0A 2IEKA 1ZR4A 2JJ7A 1K83J 1WCMJ 2PMZN 5FKOA 3NAUA 1GDTA 3C2BA 4BKXA 5E3MA 4GFBA 4NDLA 3BTIA 4MFDA 3S1NJ 1JKRC 1JJ8C 2EZKA 5J3LA 3GTGJ 5IYBJ 4IHXA 2JN6A 3S16J 3BR3A 2IAIA 4RDUA 1GT0C 3BR6A 2DMNA 3HOYJ 1ETKA 1RKTA 3FK6A 5F27A 3HOVJ 3HOZJ 1QVUA 1XG1A 2L9RA 3CMYA 2GLOA 5J1UA 1POGA 2M8GX 2TRTA 2FQ4A 2MSYA 3H0GJ 2WB1N 4RBOA 3JRDA 1LE8B 2EQRA 3ZQHA 2G0EA 3F0CA 2LY9A 1A6IA 4JX5A 1X58A 2DA7A 1Z0XA 2M0CA 2MW8A 2R92J 1A5JA 4DZJA 1JJ6C 1B8IB 1FEXA 4BBSJ 1T33A 2E1OA 3UKGA 1IV6A 1IRZA 4UUSB 1LFBA 2K9QA 3CDLA 4FE7A 3ZQIA 1W0UA 3TW6A 1TWGJ 3LSRA 2EZLA 3HM5A 4CYCA 1Q1VA 3HDDA 1HOMA 3HOWJ 1ENHA 4JX6A 4A3KJ 2R5ZB 1FTZA 2MG4A 3RKQA 2NVQJ 3S1MJ 1I50J 1NTCA 1B72A 4C3JJ 1HDPA 2VKVA 5E3NA 4AUXA 4M3EA 5FKLA 2FD5A 1GVDA 5EF6A 1FTTA 3HGYA 3OOUA 2NS8A 5DTDA 3LSPA 2ME6A 1Y1VJ 5F0FA 2LP0A 4M6VA 3FK7A 1DU6A 3LOCA 3BG3A 2IBDA 5F08A 2MGQA 3RQIA 4D5FA 3JRFA 4W97A 1O4XA 4BY1J 3GTQJ 5C3EJ 5C44J 1JT0A 3M3YJ 1ZKGA 1FJLA 1U78A 4A3FJ 1ZQ3P 1VFCA 1ZK8A 1HF0A 2OF7A 3K2AA 2W48A 4IHWA 3S1QJ 5M5YJ 1F43A 2ECBA 3SDGA 3H3VK 5M5XJ 2R93J 2DA6A 2LFBA 3HGGA 3S2DJ 5E3OA 1GV5A 2M9HA 3GTLJ 5GP9A 2WAQN 2B63J 3DEWA 5IPAA 2XSDC 2XGCA 2DA3A 2RAEA 5IYDJ 1JKOC 1MBHA 2M2EA 3OIOA 1ETOA 2R7ZJ 3S15J 2Y0SN 4A69C 2Y30A 2YUSA 3DCFA 1ETXA 4A3JJ 1H88C 5EG0A 1AHDP 1BL0A 5M3MJ 1IC8A 2R0QC 2ME0A 2KT0A 5EGOA 4I76A 1IG7A 2I10A 1F36A 2COBA 2DA5A 4V2GA 1JT6A 3CCYA 3RZDJ 2GBYA 4D5CA 2JA5J 3ZQFA 4V2FA 3SFIA 3PM1A 3FKIJ 5EEAA 2DA1A 2HYJA 2XPVA 3BR1A 5HODA 1D5YA 2XB0X 2HOSA 4JX4A 1NK3P 2LTPA 5FKNA 1SFOJ 3BTCA 1ITYA 3GTPJ 1VI0A 3BTLA 3OSFA 2DMQA 2XGDA 4A3EJ 4CYCB 1JUSA 4A3MJ 1U9OA 3B6AA 2K9NA 1WI3A 2LR8A 4C3HJ 2DA4A 3PO2J 2LKXA 3GBGA 3BT9A 1RETA 5BNGA 1EF4A 1B72B 2DTZA 3BR5A 1JGGA 3JR9A 2R5YB 4D7NA 1JTXA 2EZHA 4DYCA 3GTOJ 4X6AJ 4BXXJ 2VKEA 1JKPC 3ZQCA 2X48A 1PUFA 2L0KA 4A3CJ 1IGNA 3LNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF7 A;  1QVT A;  3HOU J;  2LD5 A;  5FKM A;  2DMP A;  5C4J J;  2XPU A;  3E7L A;  1HDD C;  2NOG A;  2CUE A;  1RR7 A;  3LSG A;  1Y1W J;  1MBF A;  4BY7 J;  3I4N J;  1JUP A;  4IHV A;  1TWH J;  2L7Z A;  2CU7 A;  4B3A A;  1IDZ A;  1YRN A;  1JTY A;  3WHC A;  3HKZ N;  4B4C A;  4IHY A;  4A3D J;  5C4X J;  2HQ5 A;  1R9T J;  1XS9 A;  2HOA A;  3Q3S A;  1GV2 A;  1FIP A;  1FIA A;  5IP6 A;  1UMQ A;  4D7M A;  4XK4 A;  2AO9 A;  4MLO A;  5FLV A;  4A93 J;  2GM4 A;  3QPS A;  2NVT J;  3IH4 A;  2L7F P;  2N8G A;  1G2H A;  2HDD A;  1ZTR A;  2HXI A;  3GTM J;  3JRB A;  1MH4 A;  3GTJ J;  2EBI A;  4MFE A;  2HI3 A;  1I3Q J;  2JWT A;  3TP3 A;  1IDY A;  2H1K A;  1UHS A;  4DYQ A;  4W1U A;  2OPT A;  2Y2Z A;  3LSJ A;  5DS9 A;  5M3F J;  3IH2 A;  4EEF G;  2D5V A;  1IJW C;  1QPI A;  4JYK A;  4AC0 A;  1B8I A;  1TC3 C;  5EGO B;  1NK2 P;  3TED A;  1Z77 A;  5IOY A;  1RES A;  2YS9 A;  1BW6 A;  2L7M P;  5EZH A;  2KDZ A;  2LLK A;  2JMW A;  4XRS G;  1U8B A;  3OSG A;  2FX0 A;  3I4M J;  2XRL A;  3O8G A;  5FJ8 J;  3M4O J;  2DMU A;  2ELK A;  4C2M J;  4A3B J;  3BQY A;  3TW7 A;  4QSH A;  1P7I A;  4XIC A;  1E3O C;  2O8K A;  1S7E A;  5J1Y A;  5IOZ A;  3HBL A;  3BQZ A;  2X6O A;  3JRE A;  1VND A;  2K40 A;  4XRS A;  1MBE A;  3G1O A;  4J19 A;  3IV5 A;  1ETW A;  3PO3 J;  2CJJ A;  5GPC A;  2LVS A;  3D1N I;  1PUF B;  2JK3 A;  2X9D A;  4L5E A;  1OJL A;  5GPA A;  3BTJ A;  5FKK A;  2VPR A;  3A01 A;  5IYC J;  4HNV A;  3BG5 A;  2K9S A;  1I6H J;  2ID6 A;  3BR0 A;  4MO7 A;  3Q0V A;  3JRC A;  2E2J J;  1HLV A;  5K7F A;  2FJ1 A;  1JUM A;  5EYR A;  5JLW A;  1BA5 A;  1MSF C;  2M34 A;  1WPK A;  1YRN B;  2TCT A;  3BG9 A;  1LFU P;  2E2H J;  2EH3 A;  1CQT A;  1T56 A;  4I6Z A;  3K7A J;  2P81 A;  4XRM A;  2DMT A;  2H8R A;  3G1L A;  1X2M A;  5K7H A;  3B6C A;  3FIS A;  3VPR A;  2LK2 A;  4A3G J;  1BW5 A;  5M5W J;  1MBK A;  1MBJ A;  1XC5 A;  5K7Z A;  1MSE C;  2JA8 J;  5EDN A;  2JA6 J;  5JLX A;  1SAN A;  1GUU A;  3JRI A;  2VUM J;  1AKH A;  1OCP A;  3QQA A;  4DW6 A;  2AHQ A;  2Y9Y A;  1ZR2 A;  1P7J A;  3HOX J;  4M3G A;  2XB5 A;  1H89 C;  3RZO J;  4FIS A;  1H8A C;  1TWC J;  3FIW A;  1VF9 A;  1ETY A;  2VI6 A;  1HCR A;  3Q0W A;  1ETV A;  2ID3 A;  4QTR A;  2YU9 J;  3G1M A;  1WGX A;  1RKW A;  2Y9Z A;  3A02 A;  1WH5 A;  4X1E A;  1MH3 A;  3S1R J;  2E2I J;  4QIW N;  4FTH A;  5IP7 J;  3JRH A;  2Y31 A;  2O9L A;  4FE4 A;  1BJZ A;  4C3I J;  4B1R A;  2E19 A;  4M3B A;  2WV1 A;  4M3D A;  2CQX A;  3HB9 A;  1JKQ C;  5FLM J;  2JA7 J;  9ANT A;  3QPL A;  4IEJ A;  4MIM A;  1IUF A;  1ORK A;  4AYB N;  3ZQG A;  2NVX J;  1QRY A;  1OFC X;  2DJN A;  3HEF A;  1W0T A;  3NAR A;  3MN2 A;  2CUF A;  1U9N A;  3A03 A;  3O8H A;  3S17 J;  4DYR A;  1LE8 A;  4LOC A;  4BBR J;  2HOT A;  2XGE A;  5F1J A;  1AU7 A;  2R5Y A;  2O7O A;  1TWA J;  5E3L A;  4A3I J;  5EG0 B;  2XPW A;  5F0C A;  4Y52 J;  2QCO A;  5F0H A;  3JRA A;  1OCT C;  4S0H B;  4G12 A;  2CQQ A;  1K61 A;  3ZOB A;  2CRG A;  2EZI A;  3S14 J;  1X2N A;  3MKL A;  2DA2 A;  3A01 B;  3TP0 A;  4XID A;  4UUS A;  2ECC A;  2HXO A;  3GTK J;  3Q0U A;  3L1P A;  3ZQL A;  4FCY A;  1ETQ A;  5J1R A;  2ZB9 A;  4DZP A;  1RPW A;  1MBG A;  5F04 A;  4ABZ A;  3CQZ J;  1APL C;  2R5Z A;  1ZGW A;  2NS7 A;  2NVY J;  1TWF J;  1MNM C;  1WH7 A;  3WHB A;  4JP0 A;  4M3F A;  4Y7N J;  5IP9 J;  3SJM A;  4A3L J;  5EZG A;  1UG2 A;  3MVP A;  3JRG A;  1AKH B;  4UUT A;  3W6V A;  2DN0 A;  3BR2 A;  3IH3 A;  3S2H J;  1DU0 A;  2IEK A;  1ZR4 A;  2JJ7 A;  1K83 J;  1WCM J;  2PMZ N;  5FKO A;  3NAU A;  1GDT A;  3C2B A;  4BKX A;  5E3M A;  4GFB A;  4NDL A;  3BTI A;  4MFD A;  3S1N J;  1JKR C;  1JJ8 C;  2EZK A;  5J3L A;  3GTG J;  5IYB J;  4IHX A;  2JN6 A;  3S16 J;  3BR3 A;  2IAI A;  4RDU A;  1GT0 C;  3BR6 A;  2DMN A;  3HOY J;  1ETK A;  1RKT A;  3FK6 A;  5F27 A;  3HOV J;  3HOZ J;  1QVU A;  1XG1 A;  2L9R A;  3CMY A;  2GLO A;  5J1U A;  1POG A;  2M8G X;  2TRT A;  2FQ4 A;  2MSY A;  3H0G J;  2WB1 N;  4RBO A;  3JRD A;  1LE8 B;  2EQR A;  3ZQH A;  2G0E A;  3F0C A;  2LY9 A;  1A6I A;  4JX5 A;  1X58 A;  2DA7 A;  1Z0X A;  2M0C A;  2MW8 A;  2R92 J;  1A5J A;  4DZJ A;  1JJ6 C;  1B8I B;  1FEX A;  4BBS J;  1T33 A;  2E1O A;  3UKG A;  1IV6 A;  1IRZ A;  4UUS B;  1LFB A;  2K9Q A;  3CDL A;  4FE7 A;  3ZQI A;  1W0U A;  3TW6 A;  1TWG J;  3LSR A;  2EZL A;  3HM5 A;  4CYC A;  1Q1V A;  3HDD A;  1HOM A;  3HOW J;  1ENH A;  4JX6 A;  4A3K J;  2R5Z B;  1FTZ A;  2MG4 A;  3RKQ A;  2NVQ J;  3S1M J;  1I50 J;  1NTC A;  1B72 A;  4C3J J;  1HDP A;  2VKV A;  5E3N A;  4AUX A;  4M3E A;  5FKL A;  2FD5 A;  1GVD A;  5EF6 A;  1FTT A;  3HGY A;  3OOU A;  2NS8 A;  5DTD A;  3LSP A;  2ME6 A;  1Y1V J;  5F0F A;  2LP0 A;  4M6V A;  3FK7 A;  1DU6 A;  3LOC A;  3BG3 A;  2IBD A;  5F08 A;  2MGQ A;  3RQI A;  4D5F A;  3JRF A;  4W97 A;  1O4X A;  4BY1 J;  3GTQ J;  5C3E J;  5C44 J;  1JT0 A;  3M3Y J;  1ZKG A;  1FJL A;  1U78 A;  4A3F J;  1ZQ3 P;  1VFC A;  1ZK8 A;  1HF0 A;  2OF7 A;  3K2A A;  2W48 A;  4IHW A;  3S1Q J;  5M5Y J;  1F43 A;  2ECB A;  3SDG A;  3H3V K;  5M5X J;  2R93 J;  2DA6 A;  2LFB A;  3HGG A;  3S2D J;  5E3O A;  1GV5 A;  2M9H A;  3GTL J;  5GP9 A;  2WAQ N;  2B63 J;  3DEW A;  5IPA A;  2XSD C;  2XGC A;  2DA3 A;  2RAE A;  5IYD J;  1JKO C;  1MBH A;  2M2E A;  3OIO A;  1ETO A;  2R7Z J;  3S15 J;  2Y0S N;  4A69 C;  2Y30 A;  2YUS A;  3DCF A;  1ETX A;  4A3J J;  1H88 C;  5EG0 A;  1AHD P;  1BL0 A;  5M3M J;  1IC8 A;  2R0Q C;  2ME0 A;  2KT0 A;  5EGO A;  4I76 A;  1IG7 A;  2I10 A;  1F36 A;  2COB A;  2DA5 A;  4V2G A;  1JT6 A;  3CCY A;  3RZD J;  2GBY A;  4D5C A;  2JA5 J;  3ZQF A;  4V2F A;  3SFI A;  3PM1 A;  3FKI J;  5EEA A;  2DA1 A;  2HYJ A;  2XPV A;  3BR1 A;  5HOD A;  1D5Y A;  2XB0 X;  2HOS A;  4JX4 A;  1NK3 P;  2LTP A;  5FKN A;  1SFO J;  3BTC A;  1ITY A;  3GTP J;  1VI0 A;  3BTL A;  3OSF A;  2DMQ A;  2XGD A;  4A3E J;  4CYC B;  1JUS A;  4A3M J;  1U9O A;  3B6A A;  2K9N A;  1WI3 A;  2LR8 A;  4C3H J;  2DA4 A;  3PO2 J;  2LKX A;  3GBG A;  3BT9 A;  1RET A;  5BNG A;  1EF4 A;  1B72 B;  2DTZ A;  3BR5 A;  1JGG A;  3JR9 A;  2R5Y B;  4D7N A;  1JTX A;  2EZH A;  4DYC A;  3GTO J;  4X6A J;  4BXX J;  2VKE A;  1JKP C;  3ZQC A;  2X48 A;  1PUF A;  2L0K A;  4A3C J;  1IGN A;  3LNQ A; 
#chains in the Genus database with same CATH topology
 5LFA A;  1B4A A;  2PN6 A;  2LD5 A;  1XX5 A;  2OQR A;  5C4J J;  3PFI A;  3DU5 A;  1ZRE A;  3JAM K;  2W00 A;  1MBF A;  2H8W A;  4LLN A;  1JUP A;  2A07 F;  2K9L A;  5BMZ A;  4RAY A;  4IHT A;  2CU7 A;  4P5O A;  3CCE I;  3H35 A;  1LVA A;  2NNY A;  4HPQ A;  5C4X J;  3RI4 A;  2K3P A;  4R8H A;  3J80 Z;  3U21 A;  5D4R A;  1D5V A;  2KHM A;  4DIQ A;  3BZK A;  1AA7 A;  1GV2 A;  1FIP A;  2Y69 H;  4KN7 X;  1UMQ A;  3OYF A;  1C0W A;  3F8B A;  4XK4 A;  4HG2 A;  3VYS B;  2GOX B;  2LC2 A;  4A93 J;  2NVT J;  3IH4 A;  4HDU A;  4BE2 A;  2HS5 A;  1CGP A;  2L7F P;  4M74 A;  3I56 I;  3MD2 A;  1LKX A;  2BY3 A;  3MCZ A;  2EA2 A;  3BDD A;  1W1W E;  2DXI A;  2HXI A;  4PJN A;  3GTJ J;  2EBI A;  2KJB A;  1DPU A;  2CUZ A;  3ZMZ A;  3TKY A;  2K02 A;  3I3L A;  3LSJ A;  3BRO A;  3SZT A;  2W84 A;  1IN7 A;  3COA C;  3IH2 A;  5M3F J;  3UNG C;  2D5V A;  1IJW C;  1QPI A;  5HS7 A;  4HF2 A;  1IZ1 A;  1TC3 C;  5EGO B;  2DT6 A;  2KIM A;  1NK2 P;  3BPV A;  2G7H A;  3CUQ C;  1RRJ A;  5IOY A;  4IXA A;  2YS9 A;  3FXM A;  1BM9 A;  2QQA A;  2FE3 A;  4PDK A;  2E34 A;  1R49 A;  2XRL A;  3O8G A;  5JR3 A;  2CG4 A;  3M4O J;  5E79 C;  5FGM A;  4AWX B;  2OAZ A;  4C2M J;  1HC8 A;  2A6H F;  2DLL A;  2RDP A;  3PSI A;  4KJZ A;  1S7E A;  2LY2 A;  5IOZ A;  1BI1 A;  2QM3 A;  3VOE A;  4U7B A;  3JRE A;  2K40 A;  3KP3 A;  3KCC A;  2MFZ A;  3CC4 I;  3EUH C;  3G1O A;  2L54 A;  2M30 A;  1HSJ A;  2A69 F;  1X1B A;  4J19 A;  2XRN A;  3NQO A;  5H2F C;  1A36 A;  2QSG X;  1N75 A;  3IV5 A;  4NBQ A;  2MC3 A;  4AD9 A;  4CYD A;  4XSZ F;  3SFZ A;  3CCJ I;  1QHH D;  3I55 I;  4U0Y A;  3E6D A;  4L5E A;  3HOS A;  3P5J A;  3BTJ A;  5IYC J;  3CF5 F;  2K9S A;  2HVQ A;  2HU9 A;  3P9C A;  3TDU C;  3BR0 A;  2KDO A;  3M9A A;  2XGX A;  3JRC A;  4FET A;  3KET A;  1Z91 A;  2EFN A;  3F9K A;  1HLV A;  2FMY A;  3SXY A;  5EYR A;  2DK8 A;  1BA5 A;  4PGG A;  3MZY A;  5LEK A;  4Q5S F;  2GA2 A;  4LB6 B;  5D5U B;  1YRN B;  2TCT A;  2X1E A;  1YJW I;  5BPI A;  2GXA A;  1MW7 A;  4A0Y A;  2X6Y A;  2ZNZ A;  4BJ5 C;  1T56 A;  2XHK A;  2M4K A;  1XD7 A;  2P81 A;  1OCO H;  4ZYD A;  3KPH A;  3FMR A;  2STT A;  1WJ5 A;  2DMT A;  2QA4 I;  4A3G J;  3FIS A;  2LK2 A;  1MBJ A;  2VXZ A;  1IW7 F;  3FM3 A;  2R7W A;  5JLX A;  2P8T A;  2KKO A;  1YE9 A;  2M4G A;  3QQA A;  4DW6 A;  5DUI A;  2OQG A;  2DQR A;  1ZR2 A;  4S05 A;  1P7J A;  2XB5 A;  1ODD A;  1LDD A;  3HRM A;  1LEB A;  1TWC J;  3FIW A;  3U1D A;  3S8P A;  1R1V A;  3FXJ A;  4IRI A;  2LH9 A;  4XRF A;  4E6K G;  4CCJ A;  4P9F A;  4QTR A;  1QHG A;  1WGX A;  3G1M A;  1V5E A;  4XLA A;  4XKV A;  2NVU B;  5ICF A;  4XMY A;  4YEJ A;  3ULQ B;  1WHU A;  2X1C A;  4CUG A;  4UNO A;  5L3B A;  1SFK A;  3KYD B;  4KT5 C;  5DCF A;  3MWM A;  5IP7 J;  4IRG A;  1QPM A;  1IRF A;  4FE4 A;  2E19 A;  3LA2 A;  4MTE A;  3CUQ A;  1YW9 A;  2CQX A;  9ANT A;  3CJQ B;  1Z3X A;  2MAB A;  1CF7 B;  4P55 A;  1ON2 A;  2UWM A;  3OR1 C;  3HEF A;  4IPA A;  1T39 A;  3DF8 A;  3HHH A;  2VBW A;  1A04 A;  1U9N A;  4OIR F;  3GX4 X;  3GVA A;  1K6Y A;  4DYR A;  2JRT A;  2GAU A;  2KRF A;  2P4W A;  2XGE A;  5A2Q Z;  2NS0 A;  4G7H F;  3MZ8 A;  2O7O A;  2VB6 A;  1B9M A;  5E3L A;  3KP4 A;  3WTS C;  4Y52 J;  5F0H A;  2BY0 A;  2F4I A;  4C2U A;  1MJB A;  1D0X A;  2CQQ A;  2G9W A;  5FLX Z;  3EUH A;  2BYV E;  3RCO A;  1UB9 A;  2DA2 A;  2QYO A;  3A01 B;  3CDH A;  5LEJ A;  2JPB A;  3T8T A;  3TP0 A;  1ULY A;  2ECC A;  5E8I A;  3L1P A;  4U0W A;  1JGS A;  2FF4 A;  3ZQL A;  2BVL A;  2E60 A;  2OC6 A;  1ETQ A;  4KIG A;  1J5Y A;  5IT3 A;  2XF7 A;  4UVA A;  1Z6R A;  2FBH A;  3VB2 A;  2V4J C;  4KIB A;  1DPR A;  5L3G A;  1O7F A;  3HC7 A;  1WFX A;  3CCQ I;  1ZGW A;  3KP7 A;  4BEH A;  4BHB A;  1XGN A;  2OJE D;  3J80 K;  3C3W A;  2DDA A;  3CJR B;  1KON A;  1K78 B;  5F64 A;  1MNM C;  3WHB A;  3ABU A;  3HRU A;  5F6F A;  4M9Z A;  1OKR A;  4ON0 A;  1S5L C;  3U2R A;  1LDK B;  4Y7N J;  2YX7 A;  4A3L J;  3O3K A;  1OCZ H;  3JRG A;  2JZY A;  3LST A;  3D5S C;  1A31 A;  3BR2 A;  2IS6 A;  2PMU A;  3WU1 B;  1L0O C;  2VJ5 A;  3ZMV A;  5FKO A;  4UY8 I;  2VBY A;  2QWW A;  5E3M A;  4MFD A;  3K6G A;  3RIR A;  5B3S H;  3T0Y A;  1IXS B;  5J3L A;  1TNS A;  3BOQ A;  4QPQ A;  1Y8R B;  1H0M A;  4LIT A;  2VJ4 A;  1GT0 C;  3LFK A;  1IV8 A;  2DMN A;  2HPI A;  1RR8 C;  4MEY F;  3C18 A;  1ETK A;  3HOZ J;  5D8L B;  2O8X A;  3I64 A;  4PGH A;  2L9R A;  3CCR I;  2E1M C;  4BHP A;  5FD6 A;  2M8G X;  2OZ6 A;  3H0G J;  3JRD A;  1ZRD A;  1LE8 B;  2VL8 A;  3V4G A;  3GZ5 A;  3HPH A;  1LJ9 A;  3CCL I;  4F55 A;  3EUK L;  1YIJ I;  1S72 I;  2DPU A;  2A6E F;  1BR2 A;  4BH9 A;  2QVO A;  4ETS A;  1IXR C;  3VFZ A;  4IOC F;  3S3M A;  3KYC B;  4ENN A;  2E1O A;  5L3D A;  2ETH A;  2OCC H;  3F8M A;  1T2K A;  2DBB A;  3K1N A;  4PCQ A;  4RGS A;  1ZRC A;  1XPX A;  2MBF A;  4FE7 A;  3ZQI A;  2QSH X;  4B8X A;  4GXO A;  2W25 A;  2LSO A;  3TW6 A;  3HM5 A;  4IVN A;  4LIV A;  4CYC A;  1Q1V A;  3E6M A;  5FFX A;  1RUN A;  2DFE A;  2E1C A;  2NRA C;  3HOW J;  2HTS A;  5B5E C;  3DTI A;  2K3F A;  1TQM A;  2L4A A;  3R60 A;  4I99 C;  1I50 J;  4MGR A;  2CW0 F;  1G3T A;  3RSN A;  3KP6 A;  4A2U A;  2VKV A;  4F7Z A;  5FD5 A;  1WSU A;  2F4M B;  5FKL A;  5CVI A;  1OIS A;  3T1B A;  2BY2 A;  3HGY A;  2AXT C;  3C1D A;  3QOD A;  5DCM A;  3C2G A;  1UCR A;  1A35 A;  1EV7 A;  2ME6 A;  2K7L A;  3KLO A;  2LP0 A;  4M6V A;  4CCO A;  3RKY A;  2WWY A;  3LOC A;  2IBD A;  2JUC A;  1UST A;  2MGQ A;  3OL4 A;  5KAI C;  4D5F A;  3JRF A;  3ZMD A;  3M3Y J;  5AIQ A;  3BG6 A;  1ZKG A;  3BLY A;  1G6N A;  4HX8 A;  1FJL A;  3DWL E;  3OWT A;  4A3F J;  2V1U A;  4U87 A;  3J7Z I;  2V9P A;  1FYK A;  4IOA F;  1ONV A;  2ZC2 A;  1ZK8 A;  2O6G E;  1ZAO A;  3GCM A;  1TW3 A;  3PNV A;  1HF0 A;  5D5X B;  2JA2 A;  1RIO H;  1L3L A;  3OYA A;  2JTV A;  2X1D A;  3BJA A;  1YTY A;  5M5X J;  3NRV A;  2DDB A;  1ZGA A;  1B59 A;  4RA2 A;  2L7K A;  3WTX C;  2M9H A;  3WGG A;  2E5Z A;  1S29 A;  2B63 J;  4HA8 A;  4F92 B;  1KU7 A;  3F72 A;  2DA3 A;  4M9X A;  1O7L A;  2P5K A;  3QOE A;  2E7X A;  3JAM Z;  4H4K C;  2R7Z J;  4KT6 A;  3S15 J;  1Y0N A;  4KIS A;  4A69 C;  2VON A;  3F8N A;  3K1M A;  3C7J A;  1MJA A;  2E71 A;  4ENM A;  2F6C A;  3IHU A;  5GAH J;  1Q1H A;  5DD8 A;  3WG7 H;  1H88 C;  3DPT A;  2Z33 A;  2FOW A;  5M3M J;  4WX9 A;  1EH8 A;  4KN4 X;  4ZYH A;  3ERM A;  2VAS A;  5ERI A;  1EJ9 A;  5EGO A;  1G3W A;  4BE0 A;  1IG7 A;  1F36 A;  4V2G A;  2DA5 A;  3BWG A;  3K1P A;  3Q5F A;  1FNN A;  3DTK A;  4HAM A;  2VN2 A;  5LGU A;  4WXD A;  1QBJ A;  1IO2 A;  2JUG A;  4QPO A;  3ZQF A;  2EV6 A;  1GXP A;  1Z21 A;  2CV0 A;  3PM1 A;  1EH6 A;  2XB0 X;  2LTP A;  2QUF A;  3ECO A;  3LA7 A;  3BTC A;  4CXF A;  4AIK A;  5EEG A;  2LG4 A;  1A6Q A;  2ZXH A;  4L5J A;  3L00 A;  4C9Y A;  1JUS A;  1SD4 A;  3KX2 A;  2PQ8 A;  3B6A A;  1E3P A;  2K9N A;  1WI3 A;  2LR8 A;  2DA4 A;  1VQ6 I;  2LKX A;  3WE3 A;  2DTZ A;  3BR5 A;  3H9Q A;  2HDW A;  2BW3 B;  2IJL A;  1JGG A;  3A1Y A;  3ZR8 X;  2EZH A;  2R7T A;  4HV5 A;  2Q0O A;  2HWV A;  3GTO J;  3ZQC A;  4BQQ A;  1IGN A;  4XOT A;  4RLF A;  3UR3 C;  2GA1 A;  3H5A A;  2Z3Y A;  1QVT A;  2KIF A;  2ZME C;  1VQ4 I;  2BXY A;  2DMP A;  4XKB A;  4Q4Z F;  4XLC A;  3E7L A;  3LSM A;  4Y15 A;  3ZPL A;  3LSG A;  3I4N J;  4IHV A;  3OYD A;  2ICW G;  2NXN B;  3O2P E;  3G6E I;  1YRN A;  1JTY A;  1IDZ A;  1M1E B;  2UZK A;  5HLG A;  4IHY A;  3RJP A;  1R9T J;  4BEH B;  4BS9 A;  2FUG 2;  3DKW A;  2DCE A;  3KP2 A;  2D1V A;  2HOA A;  4XON A;  5KHD A;  2PMZ A;  3GLX A;  3HSE A;  1FIA A;  5IP6 A;  2RV8 A;  1PVE A;  4II3 A;  2Q8K A;  1B6A A;  1HKS A;  1TW2 A;  2OBP A;  1WJF A;  2DFH A;  2HYG D;  3LSH A;  1DGW Y;  2HNH A;  4ZZL A;  1QA6 A;  1JHF A;  4WXH A;  2RVC A;  2K4B A;  2N8G A;  4I0B A;  2EFW A;  4IHS A;  1ZTR A;  3QU3 A;  2CS3 A;  5E17 F;  1G59 A;  2L01 A;  3PNY A;  4OWR B;  4AVP A;  1IRX A;  2YSR A;  5TJJ A;  3PJR A;  4CCN A;  2YPR A;  2IP2 A;  3RKX A;  3TP3 A;  3V7C A;  3SEZ A;  2H1K A;  3AG2 H;  4KIC A;  5IT9 K;  3LFU A;  2JPC A;  4HSR A;  2OPT A;  4G7O F;  2V1N A;  3AAF A;  3L2V A;  3OS2 A;  1TL8 A;  1LB2 A;  1VQ7 I;  2GXB A;  4JYK A;  3G73 A;  1HA8 A;  1OR7 C;  2CW8 A;  2JSC A;  2OV7 A;  1BIB A;  2WB1 A;  1NHA A;  4I98 B;  2Z1D A;  4HOB A;  1YFH A;  2B9S A;  2CYY A;  2X0L A;  2JMW A;  4DBR A;  3OSG A;  4AIJ A;  4DQ2 A;  2HZT A;  4EJU A;  1CF7 A;  2ELK A;  4BXU A;  2VKH A;  4A3B J;  3SEQ A;  4QSH A;  2F5E A;  4JOM A;  4Q47 A;  3TW7 A;  4E7I A;  1AOY A;  3S2W A;  2O8K A;  2V7F A;  5D8K B;  5LHI A;  2A3S A;  1ERD A;  4IL6 C;  4M9S A;  3BQZ A;  5CVJ A;  4HF1 A;  3L9F A;  2X6O A;  1VND A;  1I1S A;  2GIZ A;  4F91 B;  1FOY A;  4E7Z A;  2AXL A;  4C30 A;  2AS5 F;  2A5Y B;  2VIX A;  2OCE A;  1ETW A;  4O6J A;  4F52 A;  5GPC A;  3OYB A;  2LVS A;  4LFU A;  5DM6 F;  3D1N I;  1PUF B;  2JK3 A;  4XL9 A;  4E7S A;  2JRM A;  3OYE A;  3CF2 A;  3K70 C;  3A01 A;  3DEE A;  4I01 A;  4HNV A;  3BG5 A;  2ID6 A;  2KIU A;  2VBX A;  3TDZ C;  3Q0V A;  2HQN A;  3FXQ A;  4GCV A;  3I5U A;  3CZ6 A;  5JHF A;  1TZL A;  2FJ1 A;  5JLW A;  3VYR B;  2HYF A;  2DOF A;  1WPK A;  4PJL A;  5TGT A;  1YYV A;  5FO5 A;  4NQW B;  2L9V A;  4XLP F;  2MD5 A;  1CQT A;  5FRM A;  1PUE E;  5HLH A;  2MLK A;  4XRM A;  1K78 A;  3PQK A;  1JHH A;  2KRC A;  1X2M A;  5D5V B;  3VYT B;  1BW5 A;  1K7A A;  2VC0 A;  3N05 A;  3HHG A;  3A2K A;  3U9G A;  2JA6 J;  1IAW A;  5DCM B;  1KU3 A;  2AHQ A;  1D8K A;  1N25 A;  3H1C A;  3RZO J;  5H20 A;  1H8A C;  4HEA 2;  4FX0 A;  1ETY A;  3JW4 A;  3IWF A;  4DGW B;  2VI6 A;  1HCR A;  1ETV A;  1XGO A;  4NC7 A;  5CLS A;  3VWB A;  1HW5 A;  1I39 A;  2M1B A;  2ID3 A;  3M8J A;  3M07 A;  2Y9Z A;  1XDS A;  3U1K A;  1WH5 A;  4X1E A;  1IUY A;  3HOT A;  3H9J A;  3IRQ A;  3S1R J;  2E2I J;  1SD7 A;  1B1B A;  4FTH A;  2HFH A;  1Z6T A;  4E4H A;  3JRH A;  1D0Y A;  1W36 C;  4ZDL A;  1OR7 A;  2V9V A;  2WV1 A;  2WA0 A;  2JA7 J;  2WAF A;  5LRR A;  1VQO I;  1NH3 A;  3QPL A;  4IEJ A;  2EK5 A;  4BQO A;  1IUF A;  1ORK A;  4X0G A;  5ILS A;  3CCS I;  1OFC X;  5EJC A;  3OYC A;  2NAZ A;  5GAD J;  3HSR A;  3S17 J;  1LE8 A;  2C6Y A;  3W2A A;  4GRI A;  2E1M B;  2HOT A;  5F1J A;  2A05 A;  3M1C A;  1TWA J;  4A3I J;  2FEZ A;  1ZG1 A;  3IWZ A;  3DLA A;  3FXK A;  3DPU A;  2EJR A;  3GLL A;  4CGZ A;  1OCT C;  1BIA A;  2CQK A;  3WTY C;  4MQV A;  4BDZ A;  3S14 J;  1OPC A;  2HTJ A;  2Q1Z B;  3Q0U A;  3FXL A;  4R79 A;  4FCY A;  3H3U A;  5J1R A;  1PJR A;  1X3U A;  3IL2 A;  1IN4 A;  2E7W A;  2R7R A;  1MBG A;  4ABZ A;  3A0B C;  3KIO A;  4HDV A;  3KEY A;  4I02 A;  5GTH C;  1FWZ A;  1XMX A;  4P9U A;  1F1Z A;  2IS4 A;  2TDX A;  3M1E A;  4D9J A;  3HUG B;  3NEU A;  1Z9C A;  2HZD A;  3KLN A;  3ZMU A;  1HKQ A;  4JP0 A;  3SJM A;  1WJE A;  1ON1 A;  5EZG A;  3E3V A;  1HST A;  2L4M A;  3LQR A;  1Y8Q B;  3MVP A;  1AKH B;  4UUT A;  5GAE J;  2PEX A;  3W6J B;  2F5C A;  4H0E A;  1OCC H;  1KQ8 A;  1WJA A;  3S2H J;  1P92 A;  2IEK A;  1XGM A;  4EMS A;  3FHZ A;  3CC2 I;  1WCM J;  2PMZ N;  5E1Z B;  3NAU A;  1WRJ A;  1FY7 A;  2OTL I;  1U3E M;  4NDL A;  1OYY A;  3TOB A;  4Y3O A;  4EQQ A;  1FOW A;  3DFG A;  1Z7U A;  3J7Y J;  4ENK A;  3GFI A;  1SMT A;  2E35 A;  1WWX A;  1T08 B;  3M8E A;  3L2U A;  1X1D A;  3S16 J;  3BR3 A;  2IAI A;  1G3S A;  1ZAR A;  1R5H A;  1UEL B;  1Z67 A;  3OYN A;  3ABL H;  3FK6 A;  5F27 A;  2IVM A;  1V4R A;  2LMD A;  2M87 A;  3ISP A;  1SFU A;  5ILV A;  4IKF A;  2IPQ X;  5L3F A;  1POG A;  4G7Z F;  2TRT A;  2FQ4 A;  1UHM A;  4I7H A;  1W7P B;  1S9H A;  3EYI A;  2WB1 N;  4O5V A;  1QNT A;  1HBX G;  2HDC A;  3CCM I;  3KYL A;  1TNT A;  5HVQ C;  1YX5 A;  1FC3 A;  3R4K A;  1UFM A;  1X58 A;  2DFF A;  4IQJ A;  2DA7 A;  4EJO A;  1SMY F;  1HXD A;  2M0C A;  2R92 J;  1A5J A;  3FF5 A;  3OYG A;  1R4M B;  4UB6 C;  3WGH A;  4BBS J;  4KIF A;  4YII A;  2H6B A;  1T33 A;  2DU9 A;  1RUO A;  1FX7 A;  1TT0 A;  1UZC A;  4UUS B;  3PQJ A;  3CES A;  2K9Q A;  3FXR A;  2ZCW A;  1IN5 A;  1V5G A;  4DNC A;  3DV8 A;  2BHY A;  3IP4 B;  5J40 A;  4E7K A;  1W0U A;  5LLQ A;  5HDN A;  3LSR A;  2QQB A;  5LGN A;  1YJ9 I;  4OMY A;  4CDG A;  4AM3 A;  2ZFW A;  2NVQ J;  1K4T A;  3S1M J;  1NTC A;  2XRO A;  3DPL C;  2BW3 A;  1HDP A;  2F2E A;  2MH9 A;  4II2 A;  5E3N A;  4M3E A;  1ZG5 A;  2FD5 A;  1VQM I;  1GVD A;  4NNJ A;  5EF6 A;  2Y0M A;  3R0J A;  3D0S A;  3LSP A;  1X1P A;  2OUM A;  3FK7 A;  3I9V 2;  4RS8 A;  1P2F A;  1SVL A;  2EV5 A;  3F3X A;  1OQY A;  3PIO F;  5JFR A;  5HS8 A;  2VQL A;  4XLN F;  1H9G A;  4NUB A;  1O4X A;  2CMP A;  4BYY A;  2O3F A;  3KZZ A;  5HNH A;  4QLC U;  2GQQ A;  4BDY A;  2ZME B;  3GEZ A;  2WBM A;  3H36 A;  3E97 A;  4XN0 A;  5DM7 F;  2YX4 A;  1XTA A;  3QYE A;  3PL8 A;  3ZQ7 A;  4L9J A;  5CKT A;  3K2A A;  2W48 A;  4E7H A;  1N77 A;  4GYI A;  4IHW A;  2ECB A;  3S1Q J;  3CMM A;  3CMA I;  1HKT A;  1N78 A;  2CQN A;  4Y4R A;  4N4O B;  2VLA A;  2KPM A;  4YFN F;  4L18 B;  1HQC A;  4NC6 A;  3ABT A;  5CVV A;  1TTY A;  5IPA A;  2XSD C;  2O03 A;  2XIG A;  1E0E A;  2IA1 A;  5HNF A;  2VJI A;  1P4A A;  2Y0S N;  4IF4 A;  2Y30 A;  1X4P A;  4ITV A;  4A5N A;  3K2Z A;  1AWC A;  1UAA A;  3CDI A;  2VOD A;  5EG0 A;  1AHD P;  2FQ3 A;  1VQL I;  2ME0 A;  3HTU A;  4M72 A;  4LB5 A;  2KL4 A;  2I10 A;  2COB A;  2WAD A;  4ZH4 F;  1DP7 P;  3CCY A;  3G2B A;  4D5C A;  4A0Z A;  1FP2 A;  2PMH A;  1R1T A;  3F23 A;  1G8X A;  4V2F A;  3W2W A;  1FSE A;  2L5Q A;  2XKO A;  5L3E A;  5ED4 A;  5EEA A;  3QU6 A;  5HOD A;  2HOS A;  1NK3 P;  2O61 A;  3J81 Z;  1SFO J;  1ITY A;  3WG9 A;  3WTU C;  1VI0 A;  3OSF A;  2DMQ A;  4L9N A;  4BNC A;  2EIN H;  2CFO A;  3JTG A;  3K69 A;  4F93 B;  2DOA A;  4AID A;  4BUP A;  1VQK I;  2VQH A;  4A12 A;  2ACJ A;  5IT9 Z;  1YIO A;  5HDG A;  3GBG A;  4YFX F;  1I5Z A;  3H5R A;  5GTI C;  1B72 B;  3CTA A;  1SC7 A;  3V8J A;  3JR9 A;  1U5T C;  2QKM B;  5E18 F;  4D7N A;  3ZQQ A;  1JTX A;  1YQA A;  2IGM A;  4DYC A;  4ENJ A;  2R7X A;  1MMA A;  2FBK A;  4LG3 A;  3LL7 A;  1J09 A;  1Y0U A;  2E1N A;  2XV4 S;  3HJE A;  1PUF A;  2K86 A;  4MNU A;  5HOO A;  1XSD A;  2HGC A;  4PJJ A;  3A4C A;  3JCU C;  4QWQ A;  1WQ2 A;  2XPU A;  1STZ A;  3LSI A;  3WTT C;  5B1A H;  4GGG A;  4HF0 A;  1Y1W J;  2DFI A;  5CQE A;  4BY7 J;  2FNA A;  1R7J A;  5KNL A;  3OR2 C;  1Z05 A;  1T6S A;  1MD0 A;  1U8R A;  3EUA A;  3WHC A;  1BR4 A;  4DOZ A;  4A3D J;  4NQW A;  3QP5 A;  1TQP A;  3H3Z A;  4JBA A;  5H6Q A;  1W5T A;  4XR6 A;  1XS9 A;  2HVS A;  3EPZ A;  4ZC3 A;  3K70 D;  4D7M A;  4XOR A;  1W5C C;  2AO9 A;  1RNL A;  3BJ6 A;  4B43 A;  4KDP A;  3OOP A;  2GM4 A;  2GWR A;  4XLF A;  2P0W A;  3OYH A;  2OZU A;  2QGU A;  3C2H A;  1J2X A;  4RB0 A;  1MGT A;  4OMZ A;  1D8J A;  4PJ0 C;  1G2H A;  2HDD A;  3EYY A;  3ERE D;  3GTM J;  5DYM A;  3WE2 A;  5DUK A;  4MTD A;  3PIP F;  3BZC A;  4MFE A;  1XMA A;  2D2W A;  4B48 A;  2HKX A;  1I3Q J;  1F5T A;  2JWT A;  5L3C A;  4XKW A;  4DYQ A;  4W1U A;  2GXG A;  5DS9 A;  1FOX A;  2R7U A;  1D1A A;  1ZN2 A;  4PZJ A;  2DTR A;  3TQN A;  3IAM 2;  1WVR A;  3CUO A;  4AC0 A;  3VOD A;  6PAX A;  4N9H A;  3TED A;  3LWF A;  3SZP A;  1RES A;  2UUZ A;  1BW6 A;  1ACI A;  2FOK A;  2L7M P;  2KDZ A;  4XRS G;  1QU3 A;  3MKZ A;  3I4M J;  2RN7 A;  2VE9 A;  1BC8 C;  4I09 A;  4DJA A;  3BQY A;  5J8F A;  1P7I A;  3GW2 A;  4XIC A;  2W1O A;  1E3O C;  1P4W A;  5BS6 A;  2RC4 A;  3TGN A;  2WTE A;  3IKV A;  3G4S I;  4EM1 A;  2NNN A;  2VKD A;  3RTR A;  3JSP A;  2PBI A;  1R1U A;  2X6W A;  3DLL F;  1XB4 A;  1X3Z B;  4CCM A;  2DOE A;  1W36 D;  3PO3 J;  1UJ8 A;  2ZXW H;  3OYL A;  1S3J A;  3QYF A;  2X9D A;  2VBZ A;  1ZH5 A;  4ZYG A;  4DBQ A;  1U5T A;  5GPA A;  2EA4 A;  2BZT A;  1VQP I;  4HZF A;  2VPR A;  4E70 A;  3PNT A;  2XDV A;  5K5O A;  3RDI A;  2VPL A;  1I1G A;  1DGR M;  2X4H A;  3IC7 A;  2PLY A;  2Z9O A;  3ZN0 A;  2GIV A;  4Q48 A;  2LRE A;  1YLF A;  3AL0 C;  1JUM A;  1O3S A;  4ZYA A;  1MSF C;  2HOE A;  1XN7 A;  2M34 A;  2XAJ A;  3GZN B;  3ASN H;  3QYB A;  2W82 A;  3E5U A;  4M6X A;  3SQN A;  2QEN A;  2E2H J;  2DPD A;  2EH3 A;  4YFK F;  3HUG A;  2H8R A;  3G1L A;  3ZN1 A;  3B6C A;  1XC5 A;  2LNB A;  1QO0 D;  2EPF A;  2H94 A;  4G94 A;  4XLE A;  1X4O A;  3JRI A;  2VUM J;  1AKH A;  1OCP A;  3PUF A;  2XKP A;  2R7O A;  2Y9Y A;  3I58 A;  4EJT A;  4M3G A;  3A0H C;  5TRD A;  2R4G A;  1VF9 A;  5FRN A;  1MMD A;  4M71 A;  4PFP A;  2WY8 Q;  4BE1 A;  3FWE A;  2KLO A;  2UXX A;  5FRO A;  3IRR A;  1O3R A;  1U2W A;  3ABM H;  3A02 A;  2QEX I;  2DQL A;  2Z99 A;  1MH3 A;  1KQ9 A;  1DQU A;  4A0X A;  3OYK A;  3OYI A;  3D5R C;  5D5W B;  4QIW N;  4BXF A;  3CO7 C;  1PP7 U;  3TO7 A;  2Y31 A;  3BJO A;  5LGT A;  2O9L A;  1KYZ A;  3VYU B;  1BJZ A;  3BP8 A;  4C3I J;  2STW A;  4G6T B;  4M3D A;  4OAZ A;  3HB9 A;  4BAC A;  2H27 A;  4HNT A;  4UUV A;  4PSW A;  3RYR A;  4AYB N;  3CCV I;  3ZQG A;  3J81 K;  1YI2 I;  1QRY A;  1QZE A;  1Y56 A;  1W0T A;  2KIS A;  3QPT A;  2RRE A;  3QWL A;  1W7P A;  5J8C A;  3MN2 A;  5HLT A;  3TBI A;  3A03 A;  1PDN C;  3O8H A;  4ZYE A;  4LOC A;  3TL4 X;  3D5L A;  5KK1 A;  4O3M A;  5J47 A;  1OCR H;  4Z2Y A;  5KCM A;  4K2E A;  1AU7 A;  2W85 A;  4I0A A;  4TV7 A;  4U7D A;  1ZYR F;  5EG0 B;  2XPW A;  3WTV C;  2QCO A;  2R7F A;  3QAH A;  4CA0 A;  4ZZD A;  4J00 A;  4JK1 X;  2J5O A;  2JVH A;  5BQT A;  3AFH A;  1G4D A;  2ISZ A;  4S0H B;  4G12 A;  4FAS D;  1K61 A;  2JSP A;  3WU2 C;  3ZOB A;  1E17 A;  1IN8 A;  2X51 A;  2W7N A;  4OIO F;  4P1W A;  2ZKZ A;  4GO1 A;  4KNY A;  2R3S A;  3E6C C;  1X1C A;  4UUS A;  4UV8 A;  2H09 A;  2HXO A;  4OIP F;  1JI8 A;  3CME I;  3I59 B;  1BN5 A;  5LRS A;  4KIT B;  3ROU A;  2I8D A;  3ZMT A;  1ZEL A;  1MND A;  2XAU A;  4DZP A;  1R71 A;  4BQA A;  2K4J A;  1APL C;  4RM2 A;  2NS7 A;  3WOD F;  2NVY J;  3S3N A;  2ZJP F;  4Y17 A;  1TWF J;  4NB5 A;  1TP4 A;  2CWE A;  2VC1 A;  4JQF A;  3FMQ A;  4XM3 A;  2EIJ H;  2UXN A;  1REP C;  2FA5 A;  5JHU A;  5IP9 J;  2UV1 A;  3HKZ A;  1XMK A;  3N4M A;  2HKO A;  3F6V A;  1I27 A;  2DN0 A;  2EB7 A;  3IH3 A;  4M73 A;  1JXS A;  3CCU I;  3K10 A;  2CQ7 A;  4BL0 B;  1ZR4 A;  5LBQ A;  3FKJ A;  2EFP A;  3AKZ A;  2BE5 F;  3E0J B;  5HS9 A;  4BKX A;  1MZB A;  1XGS A;  2D1H A;  3BTI A;  4G6D A;  2ZME A;  4U0V A;  4RB2 C;  1YX3 A;  4HBL A;  3R0A A;  2XC7 A;  3OIP A;  5IY5 H;  4ZJZ A;  2XAF A;  3W3C A;  3GTG J;  2ELJ A;  3IKT A;  2V6C A;  2Y75 A;  5IYB J;  2OA4 A;  4IHX A;  4ASN A;  2P6S A;  4J01 A;  4Y13 A;  3BR6 A;  3M8F A;  2DAO A;  4Y33 A;  1RKT A;  4YRV A;  1LPQ A;  1QVU A;  1XG1 A;  2QKL B;  3OV8 A;  3TMO A;  1KZH A;  3DTE A;  3DBR B;  1H9T A;  5JI6 A;  3CMY A;  2GLO A;  5J1U A;  2BGC A;  3FXO A;  3QPH A;  1X3W B;  1TLH B;  3P7N A;  4RBO A;  4CO8 A;  3L2Q A;  3V8K A;  2EQR A;  1XCB A;  3DBL B;  3ZQH A;  3VDX A;  4ZTJ A;  1Z3Y A;  1QZZ A;  2G0E A;  3B73 A;  5D6E A;  3TO6 A;  3F0C A;  3L2W A;  3HL2 A;  1KGS A;  1A6I A;  4JX5 A;  4A5M A;  2M7A A;  3K4C A;  4HQE A;  3ML6 A;  1SD5 A;  1UG0 A;  3ZMS A;  1U6G A;  2MW8 A;  4B44 A;  1KQ0 A;  4DZJ A;  1YIT I;  1JJ6 C;  4WK8 F;  1FEX A;  2VE8 A;  2JT1 A;  2QZ8 A;  5KVR A;  4EM0 B;  2KZG A;  2Y0S A;  3H5N A;  2DYS H;  2P7C B;  2GOM A;  3W6K B;  1IV6 A;  1LFB A;  2ESH A;  4XOP A;  4L9V A;  1UHW A;  1JE8 A;  4EJW A;  2V1D A;  4XSX F;  4ZDO A;  1TWG J;  2EZL A;  2R7D A;  1R36 A;  3HDD A;  2XUB A;  1ENH A;  3JTH A;  4A3K J;  2R5Z B;  2MG4 A;  2LKP A;  3FM5 A;  1BI3 A;  4HX4 A;  1B72 A;  1YJN I;  3E6B A;  4AUX A;  1O3Q A;  3WGI A;  5H6R A;  3LAJ A;  3HTS B;  4IX7 A;  3WTZ A;  1YHQ I;  3OOU A;  2NS8 A;  3BC8 A;  3SDB A;  4YG2 F;  2FNP A;  2KIQ A;  5F0F A;  4XN3 A;  1TBX A;  4UHT A;  1U5T B;  4RB3 C;  3S93 A;  1YS7 A;  3RQI A;  2AQE A;  4BU2 A;  4KYW A;  5FFZ A;  2DOD A;  5C3E J;  4PK4 A;  2EV0 A;  2XVC A;  4RB1 A;  1U78 A;  2M0M A;  2W4S A;  5ICE A;  5J4Y A;  1VQ8 I;  2CV1 A;  2QBY B;  1ZQ3 P;  1ZLK A;  2KQR A;  4LJZ F;  1IF1 A;  4HNU A;  1FT9 A;  1WKM A;  2QSF X;  2Z2S B;  1NG7 A;  3LMM A;  3I0T A;  3ZCO A;  1G3Y A;  1BC7 C;  1J75 A;  1F43 A;  2FSW A;  3SDG A;  4G8X A;  1MKM A;  3EQL F;  4RAF A;  2DA6 A;  2LFB A;  3HGG A;  5CVR A;  3S2D J;  2F5D A;  5E3O A;  3AG3 H;  4AIH A;  2EWN A;  3H9G A;  3I71 A;  3KEO A;  2LY1 A;  1FLI A;  1T98 A;  4OAY A;  4ESF A;  1PYV A;  2M7B A;  5D4S A;  4N4N B;  3OS1 A;  3DEW A;  4FT8 A;  2XGC A;  2O0Y A;  3EET A;  5DD4 A;  3CLO A;  4EJV A;  5LHG A;  3S3O A;  1I3A A;  2M8E A;  2ZXI A;  1MMS A;  1ETO A;  3JSO A;  1KU9 A;  2HR3 A;  2XAS A;  2RQQ A;  3HRT A;  3DCF A;  1LEA A;  2NOJ B;  4A3J J;  1D1C A;  3CP2 A;  2QLZ A;  3R6S A;  1YW7 A;  2FXA A;  1SD6 A;  2L9N A;  1T8I A;  3MQ0 A;  1IC8 A;  2R0Q C;  1Y6I A;  4LIU A;  4FHT A;  2P5L C;  3P9I A;  4YEL A;  4LG0 B;  4GYG A;  4PSX A;  2IRF G;  2ZJR F;  2LYC A;  5KAF C;  4HQM A;  4WCG A;  1MNE A;  3QRF F;  3SFI A;  1O3T A;  4OU0 A;  2DA1 A;  3EDP A;  3HG9 A;  1MDM B;  2PG4 A;  3DKX A;  1D5Y A;  5AIP A;  2WC2 A;  4JX4 A;  2F5V A;  5FKN A;  2DT7 B;  2QQ9 A;  4LK1 F;  1R00 A;  3BTL A;  4N9I A;  3OS0 A;  4LLL A;  5K1Y A;  3MFK A;  3LAP A;  2ZJQ F;  1V54 H;  3RQ4 A;  2MD0 A;  4PJM A;  1S8N A;  1U9O A;  4C3H J;  1BOB A;  3PO2 J;  3FDY A;  1RET A;  4XLH A;  2R7Q A;  1W4M A;  3OYJ A;  2R7S A;  5CPR B;  3SHF A;  4X6A J;  4HRI A;  1W7P D;  2VKE A;  4EV0 A;  2IXS A;  1JKP C;  3F8C A;  4BQN A;  2PJR B;  2X48 A;  2L0K A;  4A3C J;  3L7W A;  5E20 A;  1FYL A;  1R5I D;  2QF7 A;  3NWS A;  5FB2 A;  2L02 A;  2K9M A;  3HOU J;  3AG1 H;  5FKM A;  2BY1 A;  1LUJ B;  4OIQ F;  4CHU A;  2RNJ A;  2V79 A;  1HDD C;  1XSX A;  2CUE A;  1RR7 A;  2MA3 A;  2NOG A;  4OOI A;  3L2R A;  1Y39 A;  1QGP A;  4LK0 F;  2BOL A;  1TWH J;  2IW5 A;  1FBQ A;  2L7Z A;  2BXZ A;  3GXO A;  4B3A A;  3HKZ N;  4B4C A;  4CIC A;  1S6L A;  2HQ5 A;  3IAS 2;  3VSL A;  1SFE A;  1FZP B;  1S7A A;  4N0B A;  1XDU A;  5CYV A;  1YS6 A;  3DEU A;  3AL0 B;  1SAU A;  3Q3S A;  3K9T A;  1T95 A;  3BCB A;  3BG7 A;  1EH7 A;  4ESB A;  4MLO A;  3DBH B;  2IGK A;  2VT2 A;  3HIF A;  3LA3 A;  4NC8 A;  5FLV A;  3QPS A;  4P96 A;  3F8F A;  4RAZ A;  3L09 A;  1GXQ A;  3F6O A;  2X85 A;  1IN6 A;  2ZSH B;  1MJ9 A;  2ZNY A;  2Z5U A;  1YW8 A;  1ZHF A;  1FOK A;  1DUX C;  1DP3 A;  1SVO A;  3JRB A;  1MH4 A;  4C2T A;  2IT0 A;  3K4M A;  2HI3 A;  1QZY A;  1RI7 A;  3KE2 A;  4HV6 A;  1D0Z A;  4ZTF A;  1IDY A;  1W5S A;  4RGU A;  3OY9 A;  1MMN A;  1UHS A;  3GO5 A;  2Y2Z A;  2LKS A;  3RKW A;  3OIQ A;  4KMU X;  5J4V A;  4EEF G;  1RZ4 A;  2XAQ A;  4E7J A;  3H92 A;  3I54 A;  1B8I A;  3MKW B;  1P4X A;  1Z77 A;  1R5G A;  2WY7 Q;  2CSO A;  3BCA A;  5EZH A;  2M45 A;  1BI0 A;  2LLK A;  3R61 A;  4UVB A;  1U8B A;  3T8R A;  2JVG A;  1WJC A;  4CH7 A;  2LBF B;  2FX0 A;  2VQC A;  2HQR A;  2P5V A;  1WJD A;  2KZV A;  3ZXS A;  5FJ8 J;  2DMU A;  3OYM A;  5GAG J;  2KJC A;  2M3A A;  1I6X A;  2Q2E B;  2WAE A;  3MAJ A;  1BBY A;  1MMG A;  2CH0 A;  5J1Y A;  1OLT A;  3FBI B;  1LQ1 A;  2BEO A;  3HBL A;  3CC7 I;  4HLY A;  1ZLJ A;  2H6C A;  4LD5 A;  2W57 A;  2EIL H;  4XRS A;  1MBE A;  3K4L A;  3HRS A;  3KP5 A;  3L2C A;  2COM A;  3BZ6 A;  1BOA A;  4AYB A;  1E2X A;  2YR2 A;  2CJJ A;  3WTW C;  4IQ4 A;  2LOO A;  2J5P A;  4HYE A;  1FBU A;  1OJL A;  2KMU A;  3H0D A;  2IGN A;  3ECH A;  2M5W A;  2DK5 A;  5FKK A;  4S04 A;  5JVG F;  1XSV A;  3FZV A;  2K27 A;  1R23 A;  4KFC A;  1I6H J;  3I59 A;  2O5R A;  1D1B A;  4MO7 A;  2V9K A;  2F5F A;  3DP7 A;  2RGV A;  4ANJ A;  2E2J J;  4M6Y A;  4UB8 C;  5K7F A;  1P9Q C;  3G71 I;  3HYI A;  2JQ7 A;  2F4O B;  4UXN A;  2CUJ A;  3BG9 A;  3MKY B;  1LFU P;  3S32 A;  4B47 A;  5BPD A;  2ZBK A;  1KYW A;  3K7A J;  4I6Z A;  4RGX A;  1J9I A;  4LLG F;  5ILU A;  3MEX A;  4CZC A;  2A6T A;  5K7H A;  3VPR A;  5M5W J;  2ZO4 A;  1MBK A;  1V55 H;  5K7Z A;  1MSE C;  2JA8 J;  1WI9 A;  3GYH X;  2NYX A;  5EDN A;  3ZP5 A;  2MC4 A;  5ICC A;  2H1L A;  1SAN A;  1GUU A;  2F48 A;  1LNW A;  4IRH A;  4B09 A;  2CW7 A;  1BJA A;  4IZZ A;  4I2O A;  2IA0 A;  3HOX J;  4NHJ A;  4L0Y B;  3Q9V A;  1H89 C;  4FIS A;  3ZRG A;  3GZ6 A;  2DI3 A;  2RKH A;  2IA2 A;  1LVK A;  3TO9 A;  1B9N A;  3REO A;  3Q0W A;  4UVC A;  3F22 A;  1YOV B;  2WAQ A;  1SVM A;  2EIK H;  5DDG A;  2YU9 J;  3OL3 A;  1RKW A;  3CJN A;  2CGP A;  2MLG A;  4HLX A;  4B3X A;  2ELH A;  4L9T A;  1MIJ A;  1FSH A;  3CD6 I;  5JVT A;  4EGZ A;  2XF5 A;  2D45 A;  4B1R A;  2XAG A;  4M3B A;  1T0F C;  4KUM A;  1QQI A;  5FLM J;  1JKQ C;  2LRD A;  3HSF A;  4MIM A;  4ZDP A;  4HW0 A;  3PSF A;  3VEP A;  1VQ5 I;  1F4K A;  2NVX J;  4BJT A;  3FBN B;  2DJN A;  4AVZ A;  3NAR A;  2CUF A;  2V1X A;  2MH2 A;  4MHG A;  3RPU A;  3I53 A;  2VQG A;  4V19 K;  4BBR J;  4XNF A;  3GUD A;  2ESN A;  2R5Y A;  5CJ9 A;  3DXJ F;  5F0C A;  3JRA A;  3J7A Y;  2R7V A;  1Z7L A;  2FBI A;  1J7K A;  4BAY A;  1D3Y A;  5AON A;  1GVJ A;  1FMW A;  2CRG A;  3LQQ A;  3V7R A;  2EZI A;  5B1B H;  4GDF A;  1X2N A;  2Z16 A;  3MKL A;  3K4K A;  3V42 A;  4XID A;  2L9S A;  3GTK J;  4KMF A;  3FXU A;  4Z6Y A;  4D0P A;  1PP8 F;  3N97 A;  2ZB9 A;  3KEQ A;  4XQF A;  2K85 A;  5HDK A;  1RPW A;  1OYW A;  5F04 A;  5HLI A;  3CQZ J;  5TIS C;  1X19 A;  2R5Z A;  3FX3 A;  2A5W A;  2Y48 A;  1LDJ A;  3W2V A;  2V26 A;  1WH7 A;  3P9K A;  1VZ0 A;  3BY6 A;  4HST A;  4L5I A;  2FRH A;  4F3Q A;  4M3F A;  1ZG3 A;  2OU2 A;  1BR1 A;  2BV6 A;  2X6X A;  4CCL A;  1UG2 A;  3DU6 A;  2B0L A;  3W6V A;  2LF8 A;  2WV0 A;  3GFJ A;  2BBY A;  1IRG A;  1SAX A;  1DU0 A;  3FMS A;  2OTJ I;  4PUS A;  1EA3 A;  2JJ7 A;  3DQV C;  5K5R A;  1K83 J;  1GDT A;  2PI0 A;  1DDN A;  3C2B A;  5BOX A;  4AU7 A;  4GFB A;  3S1N J;  2ADU A;  4FX4 A;  1JKR C;  2QBY A;  3RPQ A;  1P6R A;  1JJ8 C;  2V6E A;  5A2Q K;  2PX9 A;  2EZK A;  1KU2 A;  3CLQ A;  1WJB A;  2RQP A;  2E5N A;  1R6R A;  3GFM A;  3SYT A;  2JN6 A;  5FLX K;  3G3Z A;  1K4S A;  3X2Q H;  5LD2 C;  2I5U A;  4RDU A;  2HPM A;  3HOY J;  4BHC A;  3E5X A;  3HOV J;  3CUQ B;  1WZ2 A;  3I4P A;  4BJ6 C;  3VSK A;  3KZY A;  5F1R A;  1R58 A;  3FHN A;  1LFP A;  2KP6 A;  1U0J A;  3QP6 A;  2HVR A;  2MSY A;  2IGO A;  1T0F A;  2DW4 A;  5B66 C;  3K0L A;  3CO6 C;  2ZFU A;  1FYM A;  3GME A;  2XF6 A;  2LY9 A;  3E5Q A;  3QOP A;  2KFD A;  1OYI A;  1R4N B;  2DYR H;  1XCV A;  3V7S A;  3ZGK A;  3M7G A;  1FMV A;  1Z0X A;  4LG0 A;  3HXL A;  4MQ9 F;  4EVI A;  1B8I B;  4RGR A;  4ESJ A;  2A68 F;  3ESW B;  5D6F A;  1SEU A;  4R1H A;  1E3H A;  3UKG A;  1V5F A;  3IUO A;  1IRZ A;  2OD5 A;  1MDM A;  2L2O A;  2LF7 A;  2VOP A;  2XSJ C;  2BHZ A;  1RC9 A;  2P7V B;  3CDL A;  3GWZ A;  1J59 A;  2YU3 A;  1K79 A;  1R22 A;  1T38 A;  3ONQ A;  3J7A O;  2CFX A;  5K5Q A;  2XAH A;  5E1W A;  4RAG A;  4YIR X;  1HOM A;  4RLQ A;  3T5X A;  4JX6 A;  2KRH A;  4WXC A;  2E36 A;  1FTZ A;  3RKQ A;  2B7E A;  3NWT A;  1TQI A;  4A6E A;  4C3J J;  4XBF A;  2DO7 A;  1EKE A;  5DV5 A;  2FML A;  1J0R A;  2HEO A;  3KFW X;  5CVU A;  1S7O A;  3PFY A;  1X1A A;  2PJP A;  2PJR A;  1FTT A;  4L0Z B;  3K4B A;  4BGD A;  1YO5 C;  5DTD A;  5LHH A;  1F9N A;  1Y1V J;  3CP8 A;  1OMI A;  3B02 A;  1DU6 A;  4G6Q A;  1VTN C;  3BG3 A;  1O57 A;  4UV9 A;  3Q9S A;  5F08 A;  4RM3 A;  4LGW A;  4KA4 A;  5ICG A;  4W97 A;  3MZH A;  5EEH A;  3OMY A;  4BY1 J;  3GTQ J;  3LSK A;  4XKC A;  5C44 J;  1JT0 A;  2IS2 A;  2ISY A;  4D1Q A;  2EIM H;  3V8L A;  2W24 A;  1VFC A;  2L3D A;  2VJJ A;  1VQN I;  4EM2 A;  2OF7 A;  1GLN A;  2ZSI B;  3WU0 A;  4FQG A;  5M5Y J;  3H3V K;  4EGY A;  2R93 J;  2ZJ2 A;  2QQ8 A;  2IS1 A;  1GV5 A;  4YIF A;  2HQA A;  2VXD A;  1HW1 A;  3GTL J;  5GP9 A;  2K5C A;  2WAQ N;  2GZW A;  2VT3 A;  4RMN A;  3RYP A;  2EFQ A;  2RAE A;  1VQ9 I;  5IYD J;  4CCK A;  5J6X A;  3MMY B;  1JKO C;  3K4N A;  1ZRF A;  1MBH A;  2M2E A;  3OIO A;  2PFB A;  3K4J A;  3HPG A;  1ZGJ A;  2YUS A;  3F21 A;  4IO9 F;  3GF2 A;  1ETX A;  3SZG A;  2BVM A;  1BL0 A;  2MYS A;  2LDU A;  4EAT A;  3AG4 H;  2KT0 A;  4I76 A;  4OIN F;  1SFX A;  2DT5 A;  1JT6 A;  3RZD J;  2CO5 A;  2GBY A;  4A6D A;  2A61 A;  3PUB A;  2JA5 J;  2EFO A;  2ZXJ A;  3GFL A;  3KZI C;  3FKI J;  2HYJ A;  4IJA A;  4G9Y A;  2LBF A;  2XPV A;  4CSW A;  1FP1 D;  3BR1 A;  1USS A;  5E1X A;  3GTP J;  3CJT B;  1GHC A;  2Q2E A;  3ELK A;  4MEX F;  2VOO A;  2XGD A;  1V3F A;  4A3E J;  4CYC B;  4HX7 A;  4A3M J;  1FPQ A;  1YG2 A;  5E8G A;  1Z1D A;  2P6T A;  3O6B B;  1BI2 A;  3DKY A;  3BT9 A;  1KA8 A;  5BNG A;  1EF4 A;  1IXC A;  4CZZ A;  3HZJ A;  1HW2 A;  3ABK H;  2R5Y B;  4LMY A;  1K6O A;  2G7U A;  4U88 A;  2RNG A;  2AQF A;  1FBS A;  3E1S A;  5CQG A;  3BPX A;  4WF2 A;  5DEQ A;  4BXX J;  1TT5 B;  1NG6 A;  3ASO H;  4E7L A;  3TOA A;  2CV2 A;  4PFO A;  4WWC A;  2DJI A;  3RPU D;  3LNQ A;  2FU4 A; 
#chains in the Genus database with same CATH homology
 2QF7 A;  1QVT A;  3HOU J;  2LD5 A;  5FKM A;  2DMP A;  5C4J J;  2XPU A;  3E7L A;  1HDD C;  2NOG A;  2CUE A;  1RR7 A;  3LSG A;  1Y1W J;  1MBF A;  4BY7 J;  3I4N J;  1JUP A;  4IHV A;  1TWH J;  2L7Z A;  2CU7 A;  4B3A A;  1IDZ A;  1YRN A;  1JTY A;  3WHC A;  3HKZ N;  4B4C A;  4IHY A;  4A3D J;  5C4X J;  2HQ5 A;  1R9T J;  1XS9 A;  2HOA A;  3Q3S A;  1GV2 A;  1FIP A;  1FIA A;  5IP6 A;  1UMQ A;  4D7M A;  4XK4 A;  2AO9 A;  4MLO A;  5FLV A;  4A93 J;  2GM4 A;  3QPS A;  2NVT J;  3IH4 A;  2L7F P;  2N8G A;  1G2H A;  2HDD A;  1ZTR A;  2HXI A;  3GTM J;  3JRB A;  1MH4 A;  3GTJ J;  2EBI A;  4MFE A;  2HI3 A;  1I3Q J;  2JWT A;  3TP3 A;  1IDY A;  2H1K A;  1UHS A;  4DYQ A;  4W1U A;  2OPT A;  2Y2Z A;  3LSJ A;  5DS9 A;  5M3F J;  3IH2 A;  4EEF G;  2D5V A;  1IJW C;  1QPI A;  4JYK A;  4AC0 A;  1B8I A;  1TC3 C;  5EGO B;  1NK2 P;  3TED A;  1Z77 A;  5IOY A;  1RES A;  2YS9 A;  1BW6 A;  2L7M P;  5EZH A;  2KDZ A;  2LLK A;  2JMW A;  4XRS G;  1U8B A;  3OSG A;  2FX0 A;  3I4M J;  2XRL A;  3O8G A;  5FJ8 J;  3M4O J;  2DMU A;  2ELK A;  4C2M J;  4A3B J;  3BQY A;  3TW7 A;  4QSH A;  1P7I A;  4XIC A;  1E3O C;  2O8K A;  1S7E A;  5J1Y A;  5IOZ A;  3HBL A;  3BQZ A;  2X6O A;  3JRE A;  1VND A;  2K40 A;  4XRS A;  1MBE A;  3G1O A;  4J19 A;  3IV5 A;  1ETW A;  3PO3 J;  2CJJ A;  5GPC A;  2LVS A;  3D1N I;  1PUF B;  2JK3 A;  2X9D A;  4L5E A;  1OJL A;  5GPA A;  3BTJ A;  5FKK A;  2VPR A;  3A01 A;  5IYC J;  4HNV A;  3BG5 A;  2K9S A;  1I6H J;  2ID6 A;  3BR0 A;  4MO7 A;  3Q0V A;  3JRC A;  2E2J J;  1HLV A;  5K7F A;  2FJ1 A;  1JUM A;  5EYR A;  5JLW A;  1BA5 A;  1MSF C;  2M34 A;  1WPK A;  1YRN B;  2TCT A;  3BG9 A;  1LFU P;  2E2H J;  2EH3 A;  1CQT A;  1T56 A;  4I6Z A;  3K7A J;  2P81 A;  4XRM A;  2DMT A;  2H8R A;  3G1L A;  1X2M A;  5K7H A;  3B6C A;  3FIS A;  3VPR A;  2LK2 A;  4A3G J;  1BW5 A;  5M5W J;  1MBK A;  1MBJ A;  1XC5 A;  5K7Z A;  1MSE C;  2JA8 J;  5EDN A;  2JA6 J;  5JLX A;  1SAN A;  1GUU A;  3JRI A;  2VUM J;  1AKH A;  1OCP A;  3QQA A;  4DW6 A;  2AHQ A;  2Y9Y A;  1ZR2 A;  1P7J A;  3HOX J;  4M3G A;  2XB5 A;  1H89 C;  3RZO J;  4FIS A;  1H8A C;  1TWC J;  3FIW A;  1VF9 A;  1ETY A;  2VI6 A;  1HCR A;  3Q0W A;  1ETV A;  2ID3 A;  4QTR A;  2YU9 J;  3G1M A;  1WGX A;  1RKW A;  2Y9Z A;  3A02 A;  1WH5 A;  4X1E A;  1MH3 A;  3S1R J;  2E2I J;  4QIW N;  4FTH A;  5IP7 J;  3JRH A;  2Y31 A;  2O9L A;  4FE4 A;  1BJZ A;  4C3I J;  4B1R A;  2E19 A;  4M3B A;  2WV1 A;  4M3D A;  2CQX A;  3HB9 A;  1JKQ C;  5FLM J;  2JA7 J;  9ANT A;  3QPL A;  4IEJ A;  4MIM A;  1IUF A;  1ORK A;  4AYB N;  3ZQG A;  2NVX J;  1QRY A;  1OFC X;  2DJN A;  3HEF A;  1W0T A;  3NAR A;  3MN2 A;  2CUF A;  1U9N A;  3A03 A;  3O8H A;  3S17 J;  4DYR A;  1LE8 A;  4LOC A;  4BBR J;  2HOT A;  2XGE A;  5F1J A;  1AU7 A;  2R5Y A;  2O7O A;  1TWA J;  5E3L A;  4A3I J;  5EG0 B;  2XPW A;  5F0C A;  4Y52 J;  2QCO A;  5F0H A;  3JRA A;  1OCT C;  4S0H B;  4G12 A;  2CQQ A;  1K61 A;  3ZOB A;  2CRG A;  2EZI A;  3S14 J;  1X2N A;  3MKL A;  2DA2 A;  3A01 B;  3TP0 A;  4XID A;  4UUS A;  2ECC A;  2HXO A;  3GTK J;  3Q0U A;  3L1P A;  3ZQL A;  4FCY A;  1ETQ A;  5J1R A;  2ZB9 A;  4DZP A;  1RPW A;  1MBG A;  5F04 A;  4ABZ A;  3CQZ J;  1APL C;  2R5Z A;  1ZGW A;  2NS7 A;  2NVY J;  1TWF J;  1MNM C;  1WH7 A;  3WHB A;  4JP0 A;  4M3F A;  4Y7N J;  5IP9 J;  3SJM A;  4A3L J;  5EZG A;  1UG2 A;  3MVP A;  3JRG A;  1AKH B;  4UUT A;  3W6V A;  2DN0 A;  3BR2 A;  3IH3 A;  3S2H J;  1DU0 A;  2IEK A;  1ZR4 A;  2JJ7 A;  1K83 J;  1WCM J;  2PMZ N;  5FKO A;  3NAU A;  1GDT A;  3C2B A;  4BKX A;  5E3M A;  4GFB A;  4NDL A;  3BTI A;  4MFD A;  3S1N J;  1JKR C;  1JJ8 C;  2EZK A;  5J3L A;  3GTG J;  5IYB J;  4IHX A;  2JN6 A;  3S16 J;  3BR3 A;  2IAI A;  4RDU A;  1GT0 C;  3BR6 A;  2DMN A;  3HOY J;  1ETK A;  1RKT A;  3FK6 A;  5F27 A;  3HOV J;  3HOZ J;  1QVU A;  1XG1 A;  2L9R A;  3CMY A;  2GLO A;  5J1U A;  1POG A;  2M8G X;  2TRT A;  2FQ4 A;  2MSY A;  3H0G J;  2WB1 N;  4RBO A;  3JRD A;  1LE8 B;  2EQR A;  3ZQH A;  2G0E A;  3F0C A;  2LY9 A;  1A6I A;  4JX5 A;  1X58 A;  2DA7 A;  1Z0X A;  2M0C A;  2MW8 A;  2R92 J;  1A5J A;  4DZJ A;  1JJ6 C;  1B8I B;  1FEX A;  4BBS J;  1T33 A;  2E1O A;  3UKG A;  1IV6 A;  1IRZ A;  4UUS B;  1LFB A;  2K9Q A;  3CDL A;  4FE7 A;  3ZQI A;  1W0U A;  3TW6 A;  1TWG J;  3LSR A;  2EZL A;  3HM5 A;  4CYC A;  1Q1V A;  3HDD A;  1HOM A;  3HOW J;  1ENH A;  4JX6 A;  4A3K J;  2R5Z B;  1FTZ A;  2MG4 A;  3RKQ A;  2NVQ J;  3S1M J;  1I50 J;  1NTC A;  1B72 A;  4C3J J;  1HDP A;  2VKV A;  5E3N A;  4AUX A;  4M3E A;  5FKL A;  2FD5 A;  1GVD A;  5EF6 A;  1FTT A;  3HGY A;  3OOU A;  2NS8 A;  5DTD A;  3LSP A;  2ME6 A;  1Y1V J;  5F0F A;  2LP0 A;  4M6V A;  3FK7 A;  1DU6 A;  3LOC A;  3BG3 A;  2IBD A;  5F08 A;  2MGQ A;  3RQI A;  4D5F A;  3JRF A;  4W97 A;  1O4X A;  4BY1 J;  3GTQ J;  5C3E J;  5C44 J;  1JT0 A;  3M3Y J;  1ZKG A;  1FJL A;  1U78 A;  4A3F J;  1ZQ3 P;  1VFC A;  1ZK8 A;  1HF0 A;  2OF7 A;  3K2A A;  2W48 A;  4IHW A;  3S1Q J;  5M5Y J;  1F43 A;  2ECB A;  3SDG A;  3H3V K;  5M5X J;  2R93 J;  2DA6 A;  2LFB A;  3HGG A;  3S2D J;  5E3O A;  1GV5 A;  2M9H A;  3GTL J;  5GP9 A;  2WAQ N;  2B63 J;  3DEW A;  5IPA A;  2XSD C;  2XGC A;  2DA3 A;  2RAE A;  5IYD J;  1JKO C;  1MBH A;  2M2E A;  3OIO A;  1ETO A;  2R7Z J;  3S15 J;  2Y0S N;  4A69 C;  2Y30 A;  2YUS A;  3DCF A;  1ETX A;  4A3J J;  1H88 C;  5EG0 A;  1AHD P;  1BL0 A;  5M3M J;  1IC8 A;  2R0Q C;  2ME0 A;  2KT0 A;  5EGO A;  4I76 A;  1IG7 A;  2I10 A;  1F36 A;  2COB A;  2DA5 A;  4V2G A;  1JT6 A;  3CCY A;  3RZD J;  2GBY A;  4D5C A;  2JA5 J;  3ZQF A;  4V2F A;  3SFI A;  3PM1 A;  3FKI J;  5EEA A;  2DA1 A;  2HYJ A;  2XPV A;  3BR1 A;  5HOD A;  1D5Y A;  2XB0 X;  2HOS A;  4JX4 A;  1NK3 P;  2LTP A;  5FKN A;  1SFO J;  3BTC A;  1ITY A;  3GTP J;  1VI0 A;  3BTL A;  3OSF A;  2DMQ A;  2XGD A;  4A3E J;  4CYC B;  1JUS A;  4A3M J;  1U9O A;  3B6A A;  2K9N A;  1WI3 A;  2LR8 A;  4C3H J;  2DA4 A;  3PO2 J;  2LKX A;  3GBG A;  3BT9 A;  1RET A;  5BNG A;  1EF4 A;  1B72 B;  2DTZ A;  3BR5 A;  1JGG A;  3JR9 A;  2R5Y B;  4D7N A;  1JTX A;  2EZH A;  4DYC A;  3GTO J;  4X6A J;  4BXX J;  2VKE A;  1JKP C;  3ZQC A;  2X48 A;  1PUF A;  2L0K A;  4A3C J;  1IGN A;  3LNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...