3HOXJ

Complete rna polymerase ii elongation complex v
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hoxJ00
1BW5A 5FJ8J 1TWGJ 2ID6A 4L5EA 4JX5A 2FX0A 1X2MA 2L7FP 1WH7A 1BA5A 3RQIA 2Y9ZA 5J1RA 2XRLA 3LSJA 5EG0A 2R5ZA 3L1PA 4FTHA 2FQ4A 2DMUA 1APLC 1JJ8C 4A69C 2WV1A 2NVXJ 2E1OA 3OSGA 4RBOA 2KDZA 3OOUA 3HEFA 5EEAA 2LK2A 2LVSA 1RPWA 2GBYA 3QPLA 2RAEA 3B6AA 5GPCA 5IYCJ 1IC8A 1NK3P 3S1MJ 4A3MJ 4XIDA 3DEWA 2G0EA 4AYBN 2TRTA 3H0GJ 3HM5A 1OCPA 2LR8A 1AHDP 3BTLA 1U9OA 1IV6A 1ZGWA 1GV2A 1O4XA 3GTLJ 2H1KA 1NK2P 3JRIA 2XGDA 5IOYA 3C2BA 4FCYA 1ETKA 2DA3A 5FKLA 5EZGA 2NOGA 2MGQA 1XC5A 5M5WJ 1LFBA 5C4XJ 1GV5A 2MSYA 1NTCA 2R5YB 4CYCB 4NDLA 1RESA 3LSPA 5FKKA 4QTRA 2JN6A 3G1MA 3Q0VA 4BBSJ 3JRHA 3O8GA 1JKOC 1WCMJ 3HOUJ 4QSHA 2Y30A 5M5XJ 5EG0B 2R5ZB 4BXXJ 1OFCX 1T33A 2XB5A 2EQRA 3Q0WA 2NS8A 5IP7J 5FKOA 1X58A 3ZQCA 2IEKA 3S17J 2W48A 2YS9A 1GVDA 4M3EA 5C4JJ 1F36A 2LY9A 1DU6A 3GTJJ 1QRYA 1AKHA 1H8AC 2CU7A 2XGEA 1Q1VA 3D1NI 1Y1WJ 1Z77A 1HCRA 4XK4A 3LSGA 4IHWA 3HOXJ 3TEDA 1UMQA 1JUSA 3CQZJ 1ZR2A 4V2GA 1HDDC 3RKQA 1FJLA 3O8HA 1HDPA 5DTDA 2FJ1A 1IG7A 1TWHJ 2E2HJ 2YUSA 4MO7A 3FISA 4D7MA 2EZLA 3BR1A 2CQQA 1X2NA 3Q0UA 2DMNA 1MBFA 2XPUA 2HQ5A 1K61A 2VUMJ 1VI0A 1JTYA 3BQYA 2DA5A 3BR3A 4A3DJ 2LTPA 4DZJA 4BBRJ 2KT0A 3W6VA 1POGA 2NS7A 3BR5A 2LD5A 3ZQHA 4M3DA 3SJMA 5C3EJ 2DA1A 1K83J 5M5YJ 2XGCA 5IYDJ 3LOCA 2VKVA 1JKPC 1AKHB 1B72A 1OJLA 2HOSA 2VKEA 3JRDA 2K9SA 4ABZA 2XPVA 3ZQIA 1IDZA 2O8KA 4EEFG 1I50J 2TCTA 4HNVA 3DCFA 1PUFA 2OPTA 3VPRA 4C3IJ 1I3QJ 3GTQJ 4RDUA 3S14J 2VPRA 3JRAA 2MW8A 1UG2A 3LNQA 3S1NJ 4DW6A 1ETVA 3HBLA 3MKLA 2IBDA 1U8BA 4C3JJ 5E3NA 2X9DA 3BG5A 5DS9A 2O7OA 4G12A 3JR9A 5E3MA 2DMQA 3M3YJ 4V2FA 5M3FJ 5IP6A 2JA6J 3GTKJ 3S1QJ 2K40A 5K7HA 5HODA 2N8GA 3TW7A 4Y52J 1JUPA 1A5JA 1MBKA 4D5FA 4W1UA 2EH3A 1QPIA 4I76A 2CQXA 3BR2A 1XG1A 5F0FA 2WB1N 1MBEA 3TP0A 4XICA 2HOAA 5FKNA 3I4MJ 2DA6A 1B72B 1B8IA 3K2AA 3QQAA 1WH5A 4DYQA 4XRMA 4DYCA 2MG4A 2EZKA 1JGGA 5GP9A 5EDNA 2M8GX 2Y31A 1SANA 2WAQN 1PUFB 5EGOA 3IV5A 1ORKA 2HXIA 3UKGA 1MBGA 4A93J 4D7NA 2L7MP 2HYJA 3OSFA 2L0KA 2R92J 1FTTA 1MH3A 1JTXA 4JX6A 1ENHA 3S1RJ 1EF4A 2ECCA 2DA4A 1MSEC 4A3CJ 1GUUA 3S2HJ 2R7ZJ 3CCYA 2DMTA 9ANTA 3IH3A 3QPSA 4B4CA 5IP9J 2X6OA 2NVYJ 2E2IJ 4MFDA 3BQZA 4I6ZA 2JMWA 3A01A 1MNMC 3CDLA 1ZKGA 4JP0A 4MFEA 2ME0A 1FIPA 5IYBJ 3PO3J 3WHCA 1UHSA 5GPAA 3ZOBA 5K7ZA 1RETA 1WGXA 1BW6A 2K9QA 5IPAA 5EZHA 3S15J 4M6VA 2JK3A 3ZQGA 4C3HJ 3BG9A 1ZTRA 4DZPA 2R0QC 4B1RA 2B63J 4A3BJ 2JWTA 2HXOA 3BR6A 1FEXA 2AO9A 1VNDA 2DA7A 2L7ZA 2L9RA 4A3KJ 5M3MJ 5J3LA 2EBIA 4S0HB 2Y0SN 2M9HA 5J1UA 4IHVA 2NVTJ 1YRNA 1S7EA 2M0CA 4UUTA 1IDYA 5K7FA 5JLWA 3ZQFA 1SFOJ 1JKRC 5FLVA 4A3GJ 5EGOB 2PMZN 1H88C 4XRSG 3HDDA 3A02A 1RKTA 4M3FA 2NVQJ 1IJWC 2DTZA 4A3LJ 1F43A 1LE8A 4GFBA 1QVTA 3BR0A 1IRZA 2COBA 1QVUA 3BT9A 3HOWJ 2DJNA 1JT0A 4AC0A 2I10A 2ID3A 4J19A 3SDGA 1XS9A 4MLOA 3A01B 1CQTA 1Y1VJ 1ETXA 4JYKA 4BKXA 5EF6A 4FE7A 5EYRA 3F0CA 4FISA 4A3JJ 3G1OA 2GM4A 4CYCA 5F08A 4JX4A 3MN2A 3HOZJ 2XB0X 1HF0A 3G1LA 1TWCJ 2DMPA 3JRBA 2JA5J 2ZB9A 5F04A 2JA8J 5F0HA 4A3EJ 1HOMA 1WI3A 3HGYA 3IH2A 1YRNB 3FKIJ 1ZK8A 2OF7A 3GBGA 3S16J 3BTIA 1P7IA 4X6AJ 1E3OC 1TWFJ 1Z0XA 2Y2ZA 2HI3A 3HB9A 4M3BA 2YU9J 3TP3A 3GTOJ 2QCOA 5C44J 4X1EA 1BL0A 1D5YA 2H8RA 3GTGJ 4LOCA 1ETWA 4M3GA 4A3FJ 1MH4A 1AU7A 2E19A 1GDTA 2ELKA 4MIMA 2HDDA 4BY7J 1LE8B 1TC3C 1T56A 2VI6A 5BNGA 3Q3SA 2FD5A 2QF7A 1IUFA 2JA7J 4IHXA 3SFIA 2GLOA 1U9NA 2LKXA 4UUSA 1LFUP 1VF9A 3JREA 3B6CA 3BTCA 2CUEA 2JJ7A 3JRCA 1MBJA 2XSDC 2K9NA 3ZQLA 3S2DJ 2LP0A 4A3IJ 1U78A 2R93J 1R9TJ 5FKMA 2X48A 4XRSA 1W0UA 2LLKA 2M2EA 3IH4A 3JRFA 1H89C 4Y7NJ 2D5VA 1ETQA 3WHBA 3OIOA 3K7AJ 4QIWN 1RKWA 2EZHA 2CRGA 5F1JA 3E7LA 1TWAJ 2Y9YA 1DU0A 1GT0C 1JUMA 3FK7A 4D5CA 5F0CA 2AHQA 1W0TA 2XPWA 3JRGA 2IAIA 4IEJA 1A6IA 4DYRA 3HOYJ 1MBHA 4FE4A 1HLVA 5E3OA 3NARA 5E3LA 3RZDJ 3FK6A 1IGNA 1JKQC 1ETOA 3BTJA 5FLMJ 1ETYA 1VFCA 2CUFA 1BJZA 2ME6A 1B8IB 1MSFC 4W97A 2DN0A 2ECBA 1I6HJ 5F27A 2P81A 3TW6A 3A03A 1RR7A 4UUSB 2DA2A 1ITYA 5JLXA 1JJ6C 3I4NJ 1FTZA 5J1YA 4IHYA 1WPKA 2O9LA 1OCTC 2EZIA 3PO2J 3FIWA 3HOVJ 4BY1J 3HGGA 1P7JA 2CJJA 2LFBA 3MVPA 2HOTA 5IOZA 1ZQ3P 3GTPJ 3CMYA 3GTMJ 3M4OJ 4AUXA 2E2JJ 3PM1A 3RZOJ 2M34A 3LSRA 3NAUA 3BG3A 1FIAA 1ZR4A 1JT6A 2R5YA 3HKZN 3H3VK 1G2HA 4C2MJ 4B3AA
chains in the Genus database with same CATH superfamily
1R22A 2F5FA 2ID6A 3WTZA 1XDSA 4I09A 1R23A 2L7FP 5DYMA 5J6XA 3GFIA 4BNCA 4BH9A 2ZCWA 4NC8A 3OS0A 2BE5F 2OZUA 4XKBA 2FQ4A 1LDKB 4OU0A 3KYCB 3FXJA 1X1BA 5LLQA 3OYDA 1DUXC 2BXZA 3WG9A 4CXFA 3OOUA 1RI7A 4KT5C 1D1AA 1DPUA 3CZ6A 3HEFA 3FXKA 2R7QA 3UNGC 5EEAA 2LVSA 2R7UA 2IA1A 1YFHA 2EILH 2O03A 3QPLA 5LHIA 4AWXB 5GPCA 2AXTC 3S1MJ 2BW3B 2HQRA 3QYBA 4FHTA 3DEWA 4PJLA 3ZMUA 3VWBA 1CF7A 4A0YA 3H3ZA 1P4AA 3LL7A 1B9MA 4P9FA 1T0FC 2ADUA 1ZGWA 2HVRA 2KIMA 2VT3A 1O4XA 4XORA 3SZTA 2GXAA 3T0YA 3F8CA 3GTLJ 2H1KA 3Q9VA 2BVLA 1Y8QB 4LLLA 3ULQB 2M7AA 3C2BA 2KJCA 3AG3H 4HZFA 3RSNA 1ETKA 2F6CA 1RUNA 2NOGA 4IJAA 1XC5A 5M5WJ 2Y0MA 1LFBA 2PFBA 2L4MA 4B44A 1NTCA 2JRTA 2R5YB 1LVAA 4CYCB 3VOEA 3QYFA 1RESA 4NDLA 5DD8A 2CV1A 4HQEA 5J4YA 5E8GA 4X0GA 5FD6A 3O8GA 1JKOC 1KZHA 1S7AA 5M5XJ 1HXDA 2V4JC 1MGTA 3IKVA 1FY7A 1ZREA 5IT9K 1OFCX 1T33A 3BCAA 2EQRA 3HRTA 1YX5A 4LGWA 4XKCA 5FKOA 3ZQCA 2H94A 1DPRA 3OYMA 2P5KA 1TL8A 5C4JJ 4Q5SF 2QKMB 4KIGA 3S3OA 2PQ8A 2K85A 3DTEA 4GRIA 4LD5A 5HDKA 2DU9A 4N9HA 1K6OA 3GTJJ 1QRYA 1TTYA 3CJTB 4RA2A 3M8EA 3ZMSA 4F7ZA 1CF7B 3MQ0A 3RYRA 3ZPLA 2ACJA 1Z77A 3HHGA 1HCRA 4XK4A 4A6EA 2XF7A 1R36A 3TGNA 1QQIA 5ILUA 1WSUA 3KIOA 1Z9CA 1T2KA 3GW2A 4HF0A 4MTDA 2QUFA 1UMQA 1IXSB 2WY7Q 3LWFA 3KEYA 1ZR2A 2L01A 3K1PA 2VIXA 1SVLA 1FJLA 4QLCU 3RIRA 4R79A 1T38A 3ABLH 3MFKA 3OYCA 2DFEA 2ZSIB 2YX7A 1IG7A 3KP7A 5E17F 2M5WA 4PSWA 2E2HJ 2YUSA 4WCGA 2RDPA 2VQGA 1ZG1A 3F3XA 1K78A 2Q0OA 1X2NA 2J5PA 1R00A 2JPCA 3CJNA 2FEZA 3LQRA 2CW7A 2OQRA 2VUMJ 3ERMA 5CVRA 2QGUA 4NNJA 2DCEA 3V7RA 1XSDA 3AL0C 4LFUA 5DV5A 4ZZDA 3W2AA 5K5RA 2R7RA 2YU3A 4DZJA 2UXXA 4RGSA 1J9IA 3N4MA 1TQIA 2RREA 4GGGA 2ZJPF 2ZMEA 3BR5A 3ZQHA 4NUBA 3H92A 1V4RA 5D5WB 3DPUA 5J47A 3TDZC 1XD7A 1JKPC 1ZLKA 1KU9A 1B59A 1MMGA 2K9SA 3JRDA 2XC7A 1IDZA 4G7HF 2WV0A 1K4SA 4HNVA 3C2HA 4DNCA 2OPTA 3FWEA 3LSIA 1FP1D 1YQAA 2OTJI 2XRNA 2BHZA 4BE0A 4C3IJ 4OMYA 1WQ2A 1OKRA 3F8FA 2H09A 5GADJ 3CMEI 2NYXA 3G6EI 1QZEA 3LNQA 4XLAA 1YX3A 1ETVA 2DDBA 3K4LA 1EH6A 1WI9A 4E70A 5HOOA 4G94A 2V1XA 3BG5A 1EKEA 2PI0A 4HG2A 1K78B 3SFZA 5JVTA 4G12A 3R0JA 3ECOA 2JVGA 5M3FJ 1OPCA 1A35A 3GTKJ 2P8TA 3O3KA 1SFXA 5K7HA 3ZMZA 5HODA 3TW7A 3FXLA 3O6BB 3DU6A 1A5JA 5HLTA 4D5FA 1I1GA 5GAEJ 3WTYC 2ZMEB 3HRUA 2QKLB 4HQMA 1QPIA 4I76A 2CQXA 3MZ8A 3OYGA 5F0FA 2GOXB 2WB1N 5CVIA 3HC7A 1X1DA 1KU2A 4Q47A 2XHKA 3OYFA 1ACIA 2R7OA 4XRMA 3CCJI 2MG4A 2EZKA 4KFCA 4ZYGA 2FOKA 4RB3C 2VLAA 4ZTFA 4ANJA 5ILVA 5EGOA 3MZYA 2RGVA 4AM3A 1TT5B 3UKGA 1MBGA 2L7MP 2HYJA 3OSFA 2JUGA 1MH3A 3BG6A 5J8FA 4JX6A 1MSEC 2LKSA 3CCYA 3NEUA 4CCKA 4B4CA 4Y3OA 1B4AA 2DO7A 3LSKA 2NVYJ 3I55I 2E2IJ 1AA7A 2M8EA 2QLZA 4BJ6C 4I6ZA 3T5XA 3J80Z 3CDLA 2VB6A 5D4SA 1FIPA 1SD7A 3R0AA 1FNNA 3PO3J 3GXOA 2H8WA 3TQNA 1UHSA 2L02A 1BW6A 2DK8A 1IV8A 3FHNA 3GX4X 2R0QC 3CDIA 4XOTA 2CV0A 2LMDA 4A3BJ 2HXOA 3BR6A 4M9SA 5DD4A 2L7ZA 1NG6A 3RJPA 3FXOA 4A3KJ 5M3MJ 5J3LA 2EBIA 2COMA 3A1YA 1O3TA 4S0HB 4A5MA 1EA3A 5J1UA 4IHVA 1WKMA 3C18A 3GYHX 3CLOA 4KN4X 5TJJA 1IDYA 2F5CA 5JLWA 3BOQA 5EGOB 2A6EF 1S5LC 2YR2A 2W57A 4DIQA 2Y75A 1G4DA 3HDDA 3WTSC 3HKZA 5J40A 3T8RA 4U88A 3ZRGA 4AIJA 5D5UB 4M71A 1ZYRF 3FM5A 1F43A 1LE8A 5K5QA 3I9V2 2FMLA 1QVTA 3HIFA 3KLOA 3TDUC 4PJMA 3E97A 3F23A 4ZYDA 2ICWG 4J19A 2BVMA 3OYBA 2VBZA 4XN0A 5FD5A 1HA8A 2JSPA 1CQTA 1BR2A 2BY1A 1Y1VJ 1G6NA 3COAC 3QOPA 4FE7A 2LY1A 3F0CA 5GAHJ 3DKYA 1XN7A 5F08A 3PIPF 1V55H 2FUG2 2OCEA 3LA2A 4XNFA 2VQHA 3P7NA 1RR8C 1DP3A 4AYBA 4BS9A 2XSJC 3G1LA 1TWCJ 3E0JB 3H1CA 4EMSA 3VEPA 3N05A 5DEQA 1GLNA 3I71A 3FBNB 2JA8J 5AONA 2VC1A 4BEHA 3F22A 2K86A 3J7AY 4JQFA 3VB2A 2KIUA 2XAQA 5LGTA 1ZG3A 2VKHA 1YJ9I 1LPQA 1ZGJA 2HWVA 4OAZA 3M1EA 2RNJA 1X3UA 1Z6RA 1IRGA 4MHGA 1I27A 2XUBA 4M3BA 1R6RA 3G3ZA 3RPUD 3DKWA 3GTGJ 2LYCA 4LOCA 1OYWA 1QNTA 2XF6A 5DDGA 2BYVE 4JK1X 1PUEE 1YE9A 2JA2A 2HDDA 1OMIA 1LE8B 4L5IA 2VC0A 4H0EA 2CWEA 1T56A 5BNGA 3ELKA 3Q3SA 2FD5A 3S8PA 1K7AA 2Z9OA 4RB2C 3N97A 4IHXA 1G3YA 2LOOA 2X1DA 1VF9A 1R1TA 5HLHA 1W5TA 4ZZLA 2D45A 1G59A 2JJ7A 3LSTA 4BXUA 4IL6C 1FMVA 1KONA 2NRAC 2PLYA 3BY6A 2GIVA 2XDVA 2R7DA 1U78A 3TMOA 2R93J 1R71A 5ICGA 4G6TB 5FKMA 1FYMA 2B9SA 4PGHA 3PUFA 4M6XA 3S3MA 3A2KA 1KU3A 1W36D 5JFRA 4KUMA 4EATA 1ETQA 4BEHB 3S2WA 3QWLA 1FBQA 3E7LA 5LFAA 3SYTA 5KNLA 2F48A 4O5VA 1TWAJ 3TOAA 4ESBA 2K4BA 1JUMA 3FK7A 3BZ6A 4RB0A 2AHQA 3JTHA 1DP7P 3JRGA 2JSCA 3W6KB 3IKTA 1A6IA 3OR1C 2XIGA 2V1DA 2Q8KA 4C2UA 4IQJA 2K02A 1FWZA 2E1MB 3C2GA 3SXYA 1IGNA 2W82A 1ETOA 3G2BA 3BTJA 5HVQC 1B8IB 1BJZA 3OIPA 4W97A 1M1EB 2MLKA 2O0YA 4I01A 2R3SA 3SDBA 3V8JA 1E0EA 2DBBA 5D5VB 1RR7A 2HS5A 2VJ5A 4XKVA 5E79C 2M3AA 3EQLF 2EPFA 2NS0A 1V54H 1W36C 1F5TA 2O9LA 3ZN1A 1Z67A 2ZXWH 2B7EA 1Y0NA 3HGGA 1NH3A 1W5CC 4KICA 3HTSB 2ZNZA 3MVPA 3CCUI 3F6VA 3BWGA 2VKDA 4UHTA 4OIOF 2JVHA 3ZGKA 3GTMJ 4NB5A 2E2JJ 3GUDA 2VJJA 1OCOH 1MIJA 3HTUA 2EB7A 3U1DA 2X85A 3ZCOA 3BG3A 1N25A 2GQQA 4BUPA 1O3SA 1JT6A 2IXSA 3K4CA 4OIPF 3HKZN 1XPXA 4BDZA 3H3VK 1G2HA 2UV1A 5BQTA 3KP4A 4NC7A 5F64A 2GXGA 1OCZH 4UVBA 2FX0A 1WH7A 4IO9F 3L2WA 4ENJA 2Y9ZA 2HQNA 5KCMA 5J1RA 2DPDA 2YSRA 4HA8A 4A0XA 3LSJA 5EG0A 1BC8C 1APLC 2R7VA 4RAZA 1JJ8C 2NVXJ 2E1OA 1LVKA 5FLXZ 3HUGA 2E1CA 1RPWA 1S3JA 4U7BA 3IAS2 4M9ZA 5FRNA 2V1NA 3J80K 3CO6C 1IC8A 3K1NA 4A3MJ 4YIIA 4XIDA 5ED4A 5HS7A 3CC7I 2VQCA 2G0EA 5LRRA 4AYBN 2TRTA 4HX8A 3EYYA 4PJJA 4BACA 1U9OA 4DOZA 4S05A 3OOPA 3LSHA 4I7HA 1IV6A 1JI8A 3FX3A 2PX9A 4MGRA 2GA2A 2RN7A 2VOPA 1U3EM 2G9WA 3JRIA 3R61A 3J81K 1YW7A 4LB6B 3V7SA 3HOSA 4G7ZF 1ZH5A 2WAQA 2Z33A 4E6KG 4FCYA 2DA3A 2JTVA 1HC8A 1T98A 1A04A 3SEZA 2MGQA 2FBHA 2QQBA 1YS6A 5C4XJ 1XGNA 1GV5A 3FXUA 4BE1A 1GVJA 3K4JA 4FASD 4M74A 4CZZA 3TL4X 5BMZA 3IP4B 4QTRA 4KIFA 3NWTA 1ZGAA 2ETHA 3Q0VA 4BBSJ 2EA4A 1JHFA 3H35A 5TISC 3DU5A 3HOUJ 3DPTA 3ONQA 4CHUA 5EG0B 4BXXJ 1BIBA 4LIUA 1LDDA 3GVAA 3S17J 1X58A 2ELHA 4QWQA 2DFIA 3HUGB 4HNTA 2YS9A 3WU0A 2WAEA 1LJ9A 1F36A 2LY9A 3ASNH 1P2FA 3FDYA 2XVCA 2Y48A 3KZYA 4DJAA 2C6YA 3W3CA 1KU7A 4HSTA 4E7IA 1U5TA 1CGPA 1Y1WJ 1K6YA 4QPOA 3JAMZ 3LSGA 2HKXA 3EUKL 4IHWA 2Y0SA 5D6EA 1QZYA 4EVIA 3K69A 2L9SA 3L9FA 4E7HA 3CQZJ 2LBFA 3FKJA 2H6BA 1HDDC 1SFUA 3C7JA 5DCMB 4Z2YA 4CCOA 2PMZA 3OS1A 4JOMA 4BQAA 4BJTA 2XAJA 1TWHJ 3QRFF 1RRJA 1UHWA 4D7MA 2OTLI 5HNFA 2CQQA 3CJQB 2XPUA 2VN2A 3DEUA 3H9QA 5JR3A 1K61A 4L9TA 3I4PA 2P6SA 2DT7B 1JTYA 4NQWA 3LAJA 1T8IA 5HLGA 1OYYA 4A3DJ 1EV7A 2HZDA 2FNPA 2DXIA 2LTPA 3FF5A 2YX4A 1TLHB 2MFZA 3W6VA 2W84A 1JHHA 1P4XA 1SFKA 4M3DA 4Q4ZF 3SJMA 5C3EJ 1XMKA 2CMPA 1K79A 2ZMEC 2P5VA 4PJNA 2M4KA 2VKVA 1R1VA 2EV6A 4N9IA 2VKEA 5KAIC 3BP8A 2IPQX 2DI3A 3X2QH 4EEFG 2TCTA 1PUFA 2XROA 3ERED 1VQMI 2JT1A 5GTHC 5HNHA 3FMQA 3KPHA 1ULYA 3VPRA 2LBFB 1ZAOA 2A6HF 3ABUA 3WG7H 2ISZA 4RDUA 3S14J 2VPRA 2MW8A 3GLXA 1UG2A 2KKOA 4DW6A 3HBLA 3WGHA 2IBDA 4ZJZA 1VQLI 1XB4A 5E3NA 1J5YA 1VQ9I 2K27A 4MQVA 2WB1A 1E17A 3JR9A 2QSGX 5E20A 1Z3XA 2DMQA 3LFUA 4CZCA 2DPUA 2WY8Q 1Z05A 1B9NA 2CFOA 3EUAA 3V8LA 3F9KA 2JA6J 4PUSA 3EPZA 3MD2A 4NQWB 3WTXC 3IL2A 1L0OC 4CICA 3L09A 2I8DA 2UZKA 3KCCA 5KHDA 2EFWA 5LEJA 4Y52J 3DTIA 2OUMA 2PJRA 1MBKA 1BI1A 3JSPA 4W1UA 2KIQA 2RC4A 3HRMA 4BXFA 1XG1A 1MBEA 3GWZA 5FKNA 3ASOH 3I4MJ 2LC2A 3K2AA 3QQAA 3WTUC 4I0AA 1JGGA 2MC3A 2GOMA 2MYSA 2M8GX 2WAQN 1PUFB 3CCQI 4G9YA 3IV5A 1ORKA 1N75A 4HLYA 1VQ7I 4D7NA 2WADA 2XAHA 1HKTA 3EUHA 2QENA 1D5VA 2K4JA 2DA4A 5HDGA 3NQOA 2ZC2A 1GUUA 3H5AA 2P0WA 4I0BA 5D8LB 4CO8A 3S2HJ 3CLQA 1XMAA 2TDXA 2XAUA 1IO2A 1B6AA 4MFDA 4OINF 3DLAA 1T08B 5ICFA 3IUOA 3ZR8X 3WTWC 3M07A 4A5NA 4YFKF 5JHUA 1YLFA 4HV6A 3SQNA 3WHCA 4PSXA 2CUJA 5GPAA 4EV0A 1RETA 4ZYEA 2F4OB 2K9QA 5CVJA 2D2WA 2VJ4A 4M6VA 4AVPA 3OYJA 3ZQGA 1BOAA 4C3HJ 2R7XA 3BG9A 1W1WE 3D0SA 3KYLA 5FLXK 2P7CB 1H0MA 2PJRB 2JWTA 4HX4A 5LHHA 2AO9A 1VNDA 2DA7A 3I5UA 4HW0A 4Y15A 3PQKA 1WFXA 2Y0SN 4UXNA 2M9HA 3TO6A 2EV0A 2HYGD 4EGZA 2VXZA 3CF2A 4BYYA 1VZ0A 4UUTA 3MKYB 1GXQA 4A3GJ 5HDNA 5TGTA 2PMZN 4XRSG 3QPHA 1BJAA 1FOWA 3WU1B 4M3FA 4Y4RA 1IJWC 3CP2A 4GFBA 2ZFWA 3KP5A 4ZDPA 1QVUA 3HOWJ 4UVCA 4LB5A 4HV5A 1JT0A 4ZYHA 1ZRDA 2DYSH 2ZXHA 4MLOA 1XS9A 2G7HA 3RKYA 3ZMTA 2L4AA 3BPVA 1ETXA 2CH0A 4A0ZA 4BDYA 1IN6A 1OISA 2QBYA 2IJLA 3G1OA 5CJ9A 1R7JA 4XRFA 2GAUA 4JX4A 1S8NA 3MN2A 3LAPA 4FX0A 4F93B 1R58A 1ZN2A 2ZXJA 4U0YA 2AXLA 2DMPA 4DBQA 2VONA 2XKOA 3FM3A 4KJZA 1SD4A 2JA5J 5F04A 2JPBA 4XN3A 1OCCH 2P6TA 3CCRI 5F0HA 2W00A 2EK5A 4A3EJ 2PMUA 2PMHA 3IH2A 4HSRA 4D0PA 3GBGA 2QSFX 3JAMK 2XAFA 1TWFJ 3L7WA 2WWYA 3GTOJ 3HRSA 1BL0A 2EFPA 1D5YA 4LLNA 2V79A 5CQEA 2HTSA 4A3FJ 1AU7A 2L54A 3I0TA 1GDTA 3REOA 3F21A 1S9HA 1O7LA 2ELKA 4MIMA 4BAYA 3L2CA 1YIOA 1IUFA 2E1MC 2UUZA 3I58A 2JA7J 2AQEA 2GLOA 5B5EC 4HF2A 4BQQA 3CCMI 2LKXA 1LFUP 4Q48A 2K3PA 3B6CA 4HPQA 1MMDA 1I3AA 4B09A 4UVAA 4IX7A 3JRCA 1MBJA 4XOPA 2K9NA 2XSDC 2QBYB 1RC9A 3R4KA 3PQJA 2QM3A 4A3IJ 1REPC 2E34A 3OY9A 4LIVA 3ZXSA 1HKQA 3F8BA 3HXLA 2FMYA 2XGXA 1R9TJ 1BI2A 1TZLA 1Z7LA 4XRSA 3K4NA 2HVQA 4EQQA 4M73A 3DWLE 3BCBA 4IXAA 5GAGJ 3WGIA 3KEOA 2STTA 4Y7NJ 1VQ4I 3L00A 4RB1A 1J09A 4YRVA 4LLGF 4ENMA 3BJAA 3CUQC 1SFEA 3OIOA 3VYRB 2KJBA 4QIWN 5DM7F 5F1JA 1UG0A 1E2XA 2Y9YA 1DU0A 3BZKA 4A2UA 3CMAI 3WE2A 5B1AH 1W0TA 2X6XA 2RNGA 3BPXA 3MKWB 4IEJA 1Y56A 3VYTB 2DQRA 3T1BA 2CV2A 3C1DA 3J81Z 1MBHA 1S29A 1D1BA 1RNLA 3SHFA 5FO5A 3JW4A 3QOEA 5E3LA 2A07F 3D5RC 1WJEA 2NNNA 3PFIA 1MSFC 2IA2A 3WODF 5LD2C 2KDOA 5ILSA 1MMSA 3A4CA 3TW6A 2P81A 3A03A 2DA2A 2KZVA 1UAAA 4EJUA 4KITB 2HVSA 3I4NJ 5HLIA 4PDKA 2RQQA 1WJBA 4HEA2 4ZTJA 5J1YA 2BGCA 1O7FA 4U7DA 2EZIA 1SC7A 1A6QA 1A36A 2HR3A 4G6DA 3IRQA 4HF1A 1OR7C 4F92B 4AUXA 2EFOA 3PM1A 2DOAA 3RZOJ 3ROUA 1JE8A 2M34A 3DFGA 4KMFA 3LSRA 3L2RA 5BOXA 1ZR4A 4FETA 3HG9A 4KMUX 2IA0A 4EM1A 4C2MJ 2XASA 1H9TA 5FJ8J 3W2VA 2K9LA 1YHQI 2XRLA 1FOYA 4P9UA 2M4GA 2FA5A 2P5LC 2DMUA 2WV1A 1P4WA 4RBOA 3OSGA 2QZ8A 2IGKA 2KDZA 4HRIA 4ZDOA 4E7SA 5H2FC 1YOVB 5H6RA 5E1WA 5B66C 2GBYA 2RAEA 3VDXA 5IYCJ 2I5UA 1NK3P 3HJEA 5F6FA 4IVNA 4XBFA 1MDMA 3E6BA 1WWXA 1BC7C 5CVUA 3VODA 3CMMA 2LKPA 3H0GJ 2W4SA 1OCPA 2LR8A 1AHDP 1IAWA 4BHBA 1XGOA 3HSFA 3E6CC 4B8XA 2AS5F 4HDUA 1TW2A 1GV2A 2EWNA 3PNVA 4WX9A 2JQ7A 1UZCA 2RV8A 1NK2P 4F91B 4WXHA 3QP5A 1SD6A 4XSXF 4NC6A 1FYKA 2BV6A 1XTAA 3M9AA 4CYDA 1E3HA 2HOEA 2ELJA 2Z2SB 4OAYA 1FMWA 2ZJ2A 2MSYA 4F3QA 1ZRFA 1USSA 3BG7A 1HW2A 4CH7A 2BZTA 3LSPA 5FKKA 5E1XA 1JXSA 2MC4A 4ON0A 4O3MA 3SZGA 2DJIA 2Y30A 3FXRA 3AG2H 1VQKI 1UB9A 2K5CA 2OBPA 2X1CA 2JZYA 2W25A 2NS8A 2A6TA 2ZXIA 4LG3A 2M45A 2W48A 1Z3YA 4YEJA 3QYEA 2WTEA 2PEXA 4M3EA 1ODDA 3KX2A 1LFPA 4BGDA 2O6GE 4II2A 1EJ9A 1MDMB 4KISA 1ZELA 2VODA 1VQPI 2CU7A 2XGEA 3DP7A 4ITVA 1A31A 4UY8I 1Q1VA 2Z99A 2V9PA 2HTJA 4BU2A 3HOXJ 4RAYA 6PAXA 2L7KA 1JUSA 5E18F 3SZPA 1BBYA 1FYLA 2KPMA 1PJRA 2LDUA 4UNOA 5L3GA 1N77A 1YW9A 3O8HA 4XONA 2IS6A 2O5RA 5DTDA 2W7NA 3CTAA 3VYUB 1IXCA 1SVMA 4XLCA 5CPRB 4DQ2A 2ZFUA 2KRHA 2HDCA 2BY3A 2EZLA 3ABMH 1X1CA 3BR1A 3LMMA 4NBQA 5FFZA 3U9GA 2QQ9A 1YTYA 1I39A 2VXDA 1BN5A 1Z91A 2KMUA 1MBFA 4F52A 4HNUA 1P6RA 2L3DA 2LG4A 2H1LA 3BQYA 3U2RA 2DA5A 1UJ8A 1QHGA 2BHYA 2LNBA 3F6OA 2QEXI 3K4KA 4OMZA 2E1NA 1X4OA 5JHFA 2A5WA 5A2QK 1GHCA 1FBSA 4M9XA 4Y17A 2LREA 2NS7A 3S93A 4EJVA 4RAGA 3ABKH 1K83J 1I5ZA 2XGCA 5IYDJ 1WRJA 4Y13A 1G8XA 5LGUA 2OD5A 1OCRH 3H5NA 2MLGA 1HBXG 2FNAA 1OJLA 1B72A 4RGRA 4KN7X 4P96A 1G3TA 4ABZA 4YFXF 2IRFG 2O8KA 3KZIC 4WXDA 1I50J 5EJCA 3TO7A 3EETA 2LH9A 2VT2A 2W24A 3KZZA 5CVVA 1O57A 1D0XA 2O61A 3QU6A 1Q1HA 2G7UA 3H9GA 5DUKA 1I3QJ 3CF5F 1G3WA 3JRAA 3S1NJ 2ZO4A 4GCVA 1FOXA 4GXOA 1BIAA 4HLXA 3GZ5A 4CDGA 4XKWA 4N0BA 1DQUA 2O7OA 1UCRA 3W6JB 4FQGA 1F1ZA 5FFXA 4V2FA 3G4SI 1KGSA 5IP6A 2F5EA 3U1KA 4PJ0C 3WGGA 2K40A 2N8GA 5F1RA 4J01A 2DLLA 4IRGA 4YFNF 1V5FA 2X51A 3K4BA 3CD6I 5LHGA 2EH3A 4CCMA 3DBLB 3R60A 3FHZA 3TP0A 3PUBA 4L5JA 4XICA 2ZJQF 2HOAA 4TV7A 1XCBA 5BS6A 2DA6A 1B72B 1XDUA 2M1BA 3D5LA 1WH5A 3F8MA 4DYQA 2H6CA 2J5OA 5GP9A 1W4MA 2X1EA 3U21A 2Y31A 2MD5A 5EDNA 2VJIA 2QA4I 3Q5FA 4HBLA 3CCVI 4D1QA 4A6DA 4XSZF 1T95A 3PFYA 4A93J 2D1HA 3BJ6A 1L3LA 2M87A 3OYLA 2R92J 1FTTA 2HZTA 1JTXA 4IOCF 4RM3A 3CCSI 3S1RJ 1MJ9A 1EF4A 4AD9A 3EUHC 4A3CJ 1QHHD 2R7ZJ 3A0HC 4UB8C 3HOTA 4ZYAA 3AAFA 2X6OA 4PGGA 2JMWA 3WTTC 3M8FA 1MNMC 3OV8A 1FC3A 1ZKGA 1OLTA 3RTRA 3VSKA 5IYBJ 2P4WA 1LDJA 2VBYA 5HS8A 1J0RA 1YYVA 2L2OA 5E8IA 5K7ZA 3ZOBA 1XSVA 3CUOA 1RIOH 2GIZA 3GFJA 3S15J 3K6GA 2FF4A 3H3UA 2IGOA 2JK3A 1BM9A 1D0YA 4DZPA 5J8CA 4OIRF 4B1RA 3G73A 4XL9A 4IKFA 2H27A 1RZ4A 1SMTA 2QQAA 4G6QA 2CQNA 2KLOA 4CCLA 1MNDA 4O6JA 4RM2A 3EDPA 1Y8RB 2NVTJ 3DF8A 2WAFA 1C0WA 4XR6A 4BHPA 1YRNA 4V19K 2EINH 2OQGA 1YW8A 2XKPA 3EYIA 3ZQFA 3OYKA 1JKRC 5FLVA 4I2OA 4KYWA 2WBMA 1H88C 1V5EA 4HOBA 1RKTA 1MNEA 4AIHA 5E1ZB 1D1CA 2NVQJ 1MJAA 4B43A 2EFNA 1IN4A 3BR0A 4B48A 5B3SH 2COBA 3OR2C 2ZNYA 1ZARA 3DEEA 2DODA 1U5TB 3BROA 4IPAA 1VQOI 3BT9A 4LK0F 1WJCA 1WJFA 2DJNA 2R7FA 5ICEA 2ID3A 4WWCA 3AG4H 4KNYA 4XLPF 4NHJA 2HKOA 2RQPA 4C2TA 1X3ZB 3PL8A 1FOKA 4P55A 4EJWA 4FISA 4A3JJ 1SAXA 4CYCA 1IZ1A 3E6DA 4E7KA 3DPLC 5K5OA 1HF0A 4ENNA 4IRIA 1X3WB 4EJTA 3I53A 1SAUA 4DBRA 3JRBA 2ZB9A 1MJBA 1IRFA 1QGPA 1YIJI 2PJPA 2CW8A 1QBJA 1IW7F 4OWRB 1ONVA 5FB2A 5DCFA 1WI3A 1YRNB 2DDAA 1HSJA 1S7OA 4GDFA 2GZWA 2OF7A 4B3XA 2ESHA 3H9JA 3BTIA 2IS1A 1WJAA 3C3WA 2Y2ZA 3HB9A 2HI3A 4LJZF 1YJWI 3A0BC 5C44J 2H8RA 4K2EA 1LNWA 1ETWA 2EV5A 2E5ZA 2BXYA 2HQAA 2L5QA 2O8XA 1IXRC 2E19A 3LFKA 2XAGA 1D3YA 3KYDB 2BBYA 3OWTA 3TO9A 4BY7J 1S72I 1TC3C 3RKWA 2A61A 4LITA 1ON2A 2IP2A 3SFIA 1YJNI 3K1MA 4BQNA 5KAFC 1EH7A 1U9NA 3K0LA 4UUSA 2VASA 1HQCA 3ECHA 3JREA 1VQ5I 1Z7UA 4HAMA 4ZDLA 3GF2A 2DQLA 4L9JA 4MQ9F 1I6XA 3ZQLA 3S2DJ 5FROA 4PFPA 2LP0A 3FMRA 3NWSA 3V7CA 5TRDA 4GYIA 1QO0D 2DT5A 2IT0A 2EA2A 3OMYA 4KT6A 2KRFA 2HNHA 3L2QA 4UV9A 2CUZA 1FSHA 2CO5A 2M2EA 3E6MA 4YIFA 1UHMA 2FQ3A 2VQLA 1H89C 3HPGA 1PP7U 3MZHA 2CYYA 2DOFA 3WHBA 1D8JA 1IUYA 1TQMA 2NAZA 2GXBA 4AIDA 2A05A 3HL2A 4HDVA 4IQ4A 1HSTA 3HSRA 3PSFA 1GT0C 4D5CA 3AFHA 5F0CA 3L2VA 3VFZA 4A12A 2MA3A 2XPWA 2DYRH 2IAIA 1ERDA 2NNYA 3CP8A 4FE4A 1HLVA 3I59A 3IRRA 4WF2A 3NARA 3FK6A 4MEYF 2Z5UA 4E7JA 2DK5A 4EGYA 1VFCA 2CUFA 2NOJB 2ME6A 2ECBA 1I6HJ 4CSWA 5F27A 4UUSB 4XLEA 1ITYA 5JI6A 5JLXA 2FRHA 3HHHA 1W7PA 1B1BA 2MABA 1JJ6C 4FT8A 2GWRA 3SEQA 2ZKZA 4IRHA 1FTZA 3PO2J 2LRDA 3FIWA 5AIQA 3J7YJ 4BY1J 3HOVJ 1MKMA 1P7JA 1N78A 2CJJA 2LFBA 2VE8A 2HOTA 1SVOA 1SD5A 3B02A 3CJRB 3CMYA 3V4GA 5H6QA 2L9NA 2LF7A 1YG2A 2VOOA 4FX4A 3RI4A 3QAHA 3NAUA 5H20A 2IW5A 1QZZA 2V7FA 5D6FA 1FIAA 3G71I 1WHUA 3DV8A 2MD0A 2EIMH 3F8NA 1V3FA 4L9VA 4CA0A 1BW5A 2KISA 1TWGJ 3RDIA 4L5EA 4JX5A 1X2MA 4CUGA 1BA5A 3M7GA 4G8XA 2IS4A 3E5QA 3RQIA 3E5UA 1F9NA 1NG7A 2HPIA 2R5ZA 2OU2A 3TBIA 3L1PA 4D9JA 4P5OA 2JUCA 4FTHA 3I59B 4A69C 2V6CA 1LEAA 5L3BA 1P9QC 3HZJA 3ZP5A 2F5VA 2LK2A 2DAOA 4RS8A 2O3FA 2EJRA 3GO5A 1D8KA 3I3LA 3B6AA 3ZMDA 3ZQQA 3BZCA 3GZNB 4M72A 1R5GA 5HS9A 1T0FA 1W7PB 3HM5A 5FGMA 3BTLA 3E5XA 4ESFA 2R7TA 4AIKA 3GFLA 3ZQ7A 2PG4A 1G3SA 3QP6A 1T39A 5A2QZ 1DGWY 1QPMA 2XGDA 4DGWB 5IOYA 5KK1A 3TOBA 4N4OB 1J59A 5FKLA 2DOEA 5EZGA 3J7AO 4G7OF 2A5YB 4PZJA 4KDPA 3S3NA 4U0VA 2HGCA 1TNSA 1YS7A 3ISPA 4E7LA 2B0LA 1J75A 2BY2A 3PNYA 2K7LA 3RCOA 3IHUA 4ESJA 2JN6A 3G1MA 3JRHA 3CC2I 1WCMJ 4QSHA 1BR4A 1J2XA 1R4MB 5DUIA 2X4HA 3F72A 1P92A 2R5ZB 3HPHA 2CGPA 4R1HA 2JRMA 2XB5A 3Q0WA 4LK1F 2KIFA 5IP7J 3W2WA 2OZ6A 4RMNA 1I1SA 1FSEA 2IEKA 2KHMA 4RAFA 4XM3A 4JBAA 1Z21A 4EJOA 3GFMA 2E7WA 1FPQA 1XX5A 1GVDA 1OYIA 4M6YA 4ZC3A 3V8KA 2VBXA 3OIQA 4C30A 1PP8F 3FZVA 1U0JA 1PDNC 1DU6A 1AKHA 1H8AC 2LSOA 1FT9A 3DXJF 3MKZA 2Z3YA 2LY2A 3IWZA 3TKYA 3D1NI 2FXAA 1PVEA 2OCCH 4YELA 2PBIA 3J7ZI 4BQOA 4IF4A 4XLNF 3TEDA 2CQKA 2WC2A 3GEZA 2KFDA 2KRCA 1BI3A 4P1WA 4LG0A 3VSLA 4CCJA 4XLHA 4V2GA 3RKQA 1H9GA 1TQPA 1HDPA 2UXNA 2HU9A 5CKTA 3CESA 2FJ1A 3DBHB 4UV8A 1USTA 3I54A 1MW7A 3RYPA 4MO7A 1S6LA 3FISA 3OYHA 3Q9SA 4XQFA 4S04A 3Q0UA 2DMNA 4MEXF 2F4MB 2OA4A 1TNTA 2HQ5A 4MTEA 2BOLA 2R4GA 2K9MA 2HEOA 1VI0A 2L9VA 4HX7A 3CCEI 1KYZA 1TT0A 3KEQA 3BR3A 2X0LA 4BBRJ 2KT0A 5L3DA 2OJED 3MEXA 1POGA 1ZG5A 1SEUA 1VQ6I 3ABTA 2LD5A 2DA1A 1IN5A 2FBIA 2MH2A 4R8HA 5M5YJ 3K10A 3LOCA 2X6WA 1AKHB 2HOSA 3DQVC 2ZBKA 2F2EA 3I64A 2XPVA 3ZQIA 5BPIA 1VQ8I 3DCFA 2EIJH 4BL0B 4MNUA 1MMAA 1NHAA 2E7XA 5EEHA 5LEKA 4RLQA 4LG0B 1LEBA 3GTQJ 1R5ID 1X1AA 1X19A 3GCMA 5KVRA 4OOIA 2V26A 3FMSA 3ML6A 3MKLA 2NXNB 4L9NA 3QPTA 1U8BA 4C3JJ 2KZGA 3B73A 2X9DA 4E4HA 3E1SA 5LRSA 3JSOA 5DS9A 1BI0A 1QA6A 1KYWA 2FU4A 5E3MA 3PJRA 3M3YJ 1XCVA 4WXCA 5B1BH 3AL0B 2XF5A 1LB2A 3S1QJ 4GO1A 3P9CA 1PYVA 5CQGA 2VE9A 2EIKH 4EM0B 3K9TA 1JUPA 1WVRA 3BLYA 3K4MA 2E36A 2HYFA 5ERIA 2CG4A 1FZPB 1EH8A 3BR2A 2HFHA 3RKXA 3OS2A 5D8KB 3KE2A 3OYNA 2YPRA 5DM6F 1UFMA 1B8IA 5J4VA 2UWMA 4DYCA 4QPQA 2CS3A 5FRMA 1SANA 1XMXA 3UR3C 3IWFA 2IGNA 1KA8A 2HXIA 3MAJA 1D0ZA 1XSXA 3S32A 1O3RA 2V1UA 2L0KA 4ASNA 5D4RA 1ENHA 2Z16A 3H5RA 4CGZA 2ECCA 2M30A 1Y6IA 2V9KA 2DMTA 3BJOA 9ANTA 3IH3A 3QPSA 5IP9J 2ESNA 4RGXA 4J00A 1AOYA 1T6SA 2QQ8A 4GYGA 4PK4A 4ZH4F 3BQZA 1U5TC 1J7KA 3CUQA 3ESWB 3A01A 4XMYA 4I99C 4JP0A 4MFEA 2ME0A 3JTGA 3DKXA 4B47A 2OV7A 5GTIC 3I56I 3GZ6A 2A3SA 2EFQA 3E3VA 2CFXA 1LQ1A 1WGXA 2F4IA 5IPAA 5EZHA 4YIRX 2DT6A 2V9VA 5EEGA 1KQ9A 4PCQA 5ICCA 5LBQA 1ZTRA 1RUOA 3LA7A 3CC4I 2B63J 1ZLJA 3R6SA 2CQ7A 3IAM2 5IY5H 2DW4A 3PNTA 3MWMA 1FEXA 3FBIB 1F4KA 2L9RA 1Z6TA 4WK8F 4UUVA 2AQFA 2IS2A 3DBRB 1Y39A 1S7EA 2M0CA 3CO7C 2R7WA 3P9KA 2VPLA 5K7FA 1SFOJ 2R7SA 1KQ8A 2P7VB 1O3QA 3BDDA 4F55A 2VBWA 5JVGF 1QU3A 2FBKA 3OL4A 3A02A 3IC7A 2W85A 1WJ5A 1LUJB 2LF8A 5IT9Z 2Q1ZB 2QYOA 2DTZA 1FBUA 1W5SA 2HDWA 2Q2EA 4I02A 4ETSA 1OR7A 3RQ4A 4A3LJ 1WJDA 2KP6A 1TW3A 1IRZA 3LSMA 3KP6A 4I98B 4EM2A 1R49A 4AC0A 2I10A 3CUQB 3SDGA 4PFOA 3A01B 1R4NB 4II3A 5EF6A 4JYKA 4AU7A 4BKXA 3P5JA 2Y69H 5L3EA 1YI2I 4LMYA 5EYRA 4C9YA 2A68F 2GM4A 1DGRM 1KQ0A 3QODA 3K70D 1R5HA 3M1CA 3MCZA 5L3FA 3HOZJ 2XB0X 2IGMA 1ZRCA 2E5NA 3KFWX 3AG1H 2CW0F 3GLLA 1Y0UA 3BC8A 2QSHX 4L0YB 2CSOA 3WTVC 3FXMA 1X1PA 3PSIA 2BY0A 3OYAA 2X6YA 1ZHFA 1WZ2A 3CCLI 1HOMA 3HGYA 3H36A 3FKIJ 1ZK8A 4OIQF 3S16J 1P7IA 4X6AJ 2E71A 1E3OC 1Z0XA 4Z6YA 2YU9J 3TP3A 2QCOA 4X1EA 2FE3A 1U6GA 3PIOF 1XGSA 3VYSB 1FX7A 1X4PA 2M0MA 4M3GA 2STWA 1BOBA 4KIBA 1MZBA 1MH4A 3CDHA 2MH9A 4XLFA 1U2WA 2Q2EB 3KP3A 3DTKA 4RLFA 4U0WA 1LKXA 2VI6A 2MBFA 1MD0A 2WA0A 2K3FA 3K70C 2QF7A 4BE2A 3FXQA 5DCMA 2GA1A 1IF1A 4YG2F 4L18B 2FOWA 2F5DA 3MMYB 1FP2A 4IHSA 3BTCA 2W1OA 3HYIA 2CUEA 1MMNA 3O2PE 4N4NB 3GMEA 4IHTA 1HW5A 4H4KC 3WE3A 1GXPA 1Z1DA 2M7BA 2A69F 1YITI 1SMYF 1YO5C 4HYEA 1XGMA 2ISYA 2X48A 3RPUA 4KA4A 1W0UA 2FSWA 4BHCA 2LLKA 3IH4A 3LA3A 3JRFA 2V6EA 1OQYA 2KQRA 3OYEA 1R1UA 2D5VA 4IZZA 3M8JA 1W7PD 3QU3A 3K7AJ 3KETA 4ENKA 2DTRA 5K1YA 1RKWA 2EZHA 2CRGA 4BJ5C 4U87A 2QWWA 2RVCA 3K2ZA 5L3CA 5CLSA 3DLLF 4IOAF 3KP2A 3OYIA 2VL8A 3P9IA 1U8RA 2E60A 4DYRA 3HOYJ 2PN6A 3L2UA 1FLIA 5E3OA 2OC6A 2DFHA 3RZDJ 2ZJRF 2RKHA 1STZA 2QVOA 3WU2C 2KL4A 2XV4S 1JKQC 5BPDA 5IT3A 1V5GA 5FLMJ 1JGSA 1ETYA 2DN0A 2Z1DA 1HKSA 1ON1A 1TP4A 2BW3A 1AWCA 2DFFA 1DDNA 5AIPA 3H0DA 4Y33A 2BEOA 2NVUB 3ZN0A 2E35A 4E7ZA 2D1VA 5CYVA 3RPQA 1VTNC 4AVZA 1WPKA 4IHYA 1OCTC 3HSEA 3V42A 2HPMA 5D5XB 4L0ZB 1IN7A 2OAZA 1IN8A 1UELB 1TBXA 3NRVA 3T8TA 5LGNA 5IOZA 3OL3A 1ZQ3P 3GTPJ 3KLNA 3M4OJ 3JCUC 2IVMA 3LQQA 3AKZA 1HW1A 1K4TA 2ZSHB 3D5SC 1E3PA 1IRXA 4RGUA 4CCNA 2R5YA 3ZMVA 1VQNI 4UB6C 1BR1A 4B3AA
chains in the Genus database with same CATH topology
1BW5A 5FJ8J 1TWGJ 2ID6A 4L5EA 4JX5A 2FX0A 1X2MA 2L7FP 1WH7A 1BA5A 3RQIA 2Y9ZA 5J1RA 2XRLA 3LSJA 5EG0A 2R5ZA 3L1PA 4FTHA 2FQ4A 2DMUA 1APLC 1JJ8C 4A69C 2WV1A 2NVXJ 2E1OA 3OSGA 4RBOA 2KDZA 3OOUA 3HEFA 5EEAA 2LK2A 2LVSA 1RPWA 2GBYA 3QPLA 2RAEA 3B6AA 5GPCA 5IYCJ 1IC8A 1NK3P 3S1MJ 4A3MJ 4XIDA 3DEWA 2G0EA 4AYBN 2TRTA 3H0GJ 3HM5A 1OCPA 2LR8A 1AHDP 3BTLA 1U9OA 1IV6A 1ZGWA 1GV2A 1O4XA 3GTLJ 2H1KA 1NK2P 3JRIA 2XGDA 5IOYA 3C2BA 4FCYA 1ETKA 2DA3A 5FKLA 5EZGA 2NOGA 2MGQA 1XC5A 5M5WJ 1LFBA 5C4XJ 1GV5A 2MSYA 1NTCA 2R5YB 4CYCB 4NDLA 1RESA 3LSPA 5FKKA 4QTRA 2JN6A 3G1MA 3Q0VA 4BBSJ 3JRHA 3O8GA 1JKOC 1WCMJ 3HOUJ 4QSHA 2Y30A 5M5XJ 5EG0B 2R5ZB 4BXXJ 1OFCX 1T33A 2XB5A 2EQRA 3Q0WA 2NS8A 5IP7J 5FKOA 1X58A 3ZQCA 2IEKA 3S17J 2W48A 2YS9A 1GVDA 4M3EA 5C4JJ 1F36A 2LY9A 1DU6A 3GTJJ 1QRYA 1AKHA 1H8AC 2CU7A 2XGEA 1Q1VA 3D1NI 1Y1WJ 1Z77A 1HCRA 4XK4A 3LSGA 4IHWA 3HOXJ 3TEDA 1UMQA 1JUSA 3CQZJ 1ZR2A 4V2GA 1HDDC 3RKQA 1FJLA 3O8HA 1HDPA 5DTDA 2FJ1A 1IG7A 1TWHJ 2E2HJ 2YUSA 4MO7A 3FISA 4D7MA 2EZLA 3BR1A 2CQQA 1X2NA 3Q0UA 2DMNA 1MBFA 2XPUA 2HQ5A 1K61A 2VUMJ 1VI0A 1JTYA 3BQYA 2DA5A 3BR3A 4A3DJ 2LTPA 4DZJA 4BBRJ 2KT0A 3W6VA 1POGA 2NS7A 3BR5A 2LD5A 3ZQHA 4M3DA 3SJMA 5C3EJ 2DA1A 1K83J 5M5YJ 2XGCA 5IYDJ 3LOCA 2VKVA 1JKPC 1AKHB 1B72A 1OJLA 2HOSA 2VKEA 3JRDA 2K9SA 4ABZA 2XPVA 3ZQIA 1IDZA 2O8KA 4EEFG 1I50J 2TCTA 4HNVA 3DCFA 1PUFA 2OPTA 3VPRA 4C3IJ 1I3QJ 3GTQJ 4RDUA 3S14J 2VPRA 3JRAA 2MW8A 1UG2A 3LNQA 3S1NJ 4DW6A 1ETVA 3HBLA 3MKLA 2IBDA 1U8BA 4C3JJ 5E3NA 2X9DA 3BG5A 5DS9A 2O7OA 4G12A 3JR9A 5E3MA 2DMQA 3M3YJ 4V2FA 5M3FJ 5IP6A 2JA6J 3GTKJ 3S1QJ 2K40A 5K7HA 5HODA 2N8GA 3TW7A 4Y52J 1JUPA 1A5JA 1MBKA 4D5FA 4W1UA 2EH3A 1QPIA 4I76A 2CQXA 3BR2A 1XG1A 5F0FA 2WB1N 1MBEA 3TP0A 4XICA 2HOAA 5FKNA 3I4MJ 2DA6A 1B72B 1B8IA 3K2AA 3QQAA 1WH5A 4DYQA 4XRMA 4DYCA 2MG4A 2EZKA 1JGGA 5GP9A 5EDNA 2M8GX 2Y31A 1SANA 2WAQN 1PUFB 5EGOA 3IV5A 1ORKA 2HXIA 3UKGA 1MBGA 4A93J 4D7NA 2L7MP 2HYJA 3OSFA 2L0KA 2R92J 1FTTA 1MH3A 1JTXA 4JX6A 1ENHA 3S1RJ 1EF4A 2ECCA 2DA4A 1MSEC 4A3CJ 1GUUA 3S2HJ 2R7ZJ 3CCYA 2DMTA 9ANTA 3IH3A 3QPSA 4B4CA 5IP9J 2X6OA 2NVYJ 2E2IJ 4MFDA 3BQZA 4I6ZA 2JMWA 3A01A 1MNMC 3CDLA 1ZKGA 4JP0A 4MFEA 2ME0A 1FIPA 5IYBJ 3PO3J 3WHCA 1UHSA 5GPAA 3ZOBA 5K7ZA 1RETA 1WGXA 1BW6A 2K9QA 5IPAA 5EZHA 3S15J 4M6VA 2JK3A 3ZQGA 4C3HJ 3BG9A 1ZTRA 4DZPA 2R0QC 4B1RA 2B63J 4A3BJ 2JWTA 2HXOA 3BR6A 1FEXA 2AO9A 1VNDA 2DA7A 2L7ZA 2L9RA 4A3KJ 5M3MJ 5J3LA 2EBIA 4S0HB 2Y0SN 2M9HA 5J1UA 4IHVA 2NVTJ 1YRNA 1S7EA 2M0CA 4UUTA 1IDYA 5K7FA 5JLWA 3ZQFA 1SFOJ 1JKRC 5FLVA 4A3GJ 5EGOB 2PMZN 1H88C 4XRSG 3HDDA 3A02A 1RKTA 4M3FA 2NVQJ 1IJWC 2DTZA 4A3LJ 1F43A 1LE8A 4GFBA 1QVTA 3BR0A 1IRZA 2COBA 1QVUA 3BT9A 3HOWJ 2DJNA 1JT0A 4AC0A 2I10A 2ID3A 4J19A 3SDGA 1XS9A 4MLOA 3A01B 1CQTA 1Y1VJ 1ETXA 4JYKA 4BKXA 5EF6A 4FE7A 5EYRA 3F0CA 4FISA 4A3JJ 3G1OA 2GM4A 4CYCA 5F08A 4JX4A 3MN2A 3HOZJ 2XB0X 1HF0A 3G1LA 1TWCJ 2DMPA 3JRBA 2JA5J 2ZB9A 5F04A 2JA8J 5F0HA 4A3EJ 1HOMA 1WI3A 3HGYA 3IH2A 1YRNB 3FKIJ 1ZK8A 2OF7A 3GBGA 3S16J 3BTIA 1P7IA 4X6AJ 1E3OC 1TWFJ 1Z0XA 2Y2ZA 2HI3A 3HB9A 4M3BA 2YU9J 3TP3A 3GTOJ 2QCOA 5C44J 4X1EA 1BL0A 1D5YA 2H8RA 3GTGJ 4LOCA 1ETWA 4M3GA 4A3FJ 1MH4A 1AU7A 2E19A 1GDTA 2ELKA 4MIMA 2HDDA 4BY7J 1LE8B 1TC3C 1T56A 2VI6A 5BNGA 3Q3SA 2FD5A 2QF7A 1IUFA 2JA7J 4IHXA 3SFIA 2GLOA 1U9NA 2LKXA 4UUSA 1LFUP 1VF9A 3JREA 3B6CA 3BTCA 2CUEA 2JJ7A 3JRCA 1MBJA 2XSDC 2K9NA 3ZQLA 3S2DJ 2LP0A 4A3IJ 1U78A 2R93J 1R9TJ 5FKMA 2X48A 4XRSA 1W0UA 2LLKA 2M2EA 3IH4A 3JRFA 1H89C 4Y7NJ 2D5VA 1ETQA 3WHBA 3OIOA 3K7AJ 4QIWN 1RKWA 2EZHA 2CRGA 5F1JA 3E7LA 1TWAJ 2Y9YA 1DU0A 1GT0C 1JUMA 3FK7A 4D5CA 5F0CA 2AHQA 1W0TA 2XPWA 3JRGA 2IAIA 4IEJA 1A6IA 4DYRA 3HOYJ 1MBHA 4FE4A 1HLVA 5E3OA 3NARA 5E3LA 3RZDJ 3FK6A 1IGNA 1JKQC 1ETOA 3BTJA 5FLMJ 1ETYA 1VFCA 2CUFA 1BJZA 2ME6A 1B8IB 1MSFC 4W97A 2DN0A 2ECBA 1I6HJ 5F27A 2P81A 3TW6A 3A03A 1RR7A 4UUSB 2DA2A 1ITYA 5JLXA 1JJ6C 3I4NJ 1FTZA 5J1YA 4IHYA 1WPKA 2O9LA 1OCTC 2EZIA 3PO2J 3FIWA 3HOVJ 4BY1J 3HGGA 1P7JA 2CJJA 2LFBA 3MVPA 2HOTA 5IOZA 1ZQ3P 3GTPJ 3CMYA 3GTMJ 3M4OJ 4AUXA 2E2JJ 3PM1A 3RZOJ 2M34A 3LSRA 3NAUA 3BG3A 1FIAA 1ZR4A 1JT6A 2R5YA 3HKZN 3H3VK 1G2HA 4C2MJ 4B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW5 A;  5FJ8 J;  1TWG J;  2ID6 A;  4L5E A;  4JX5 A;  2FX0 A;  1X2M A;  2L7F P;  1WH7 A;  1BA5 A;  3RQI A;  2Y9Z A;  5J1R A;  2XRL A;  3LSJ A;  5EG0 A;  2R5Z A;  3L1P A;  4FTH A;  2FQ4 A;  2DMU A;  1APL C;  1JJ8 C;  4A69 C;  2WV1 A;  2NVX J;  2E1O A;  3OSG A;  4RBO A;  2KDZ A;  3OOU A;  3HEF A;  5EEA A;  2LK2 A;  2LVS A;  1RPW A;  2GBY A;  3QPL A;  2RAE A;  3B6A A;  5GPC A;  5IYC J;  1IC8 A;  1NK3 P;  3S1M J;  4A3M J;  4XID A;  3DEW A;  2G0E A;  4AYB N;  2TRT A;  3H0G J;  3HM5 A;  1OCP A;  2LR8 A;  1AHD P;  3BTL A;  1U9O A;  1IV6 A;  1ZGW A;  1GV2 A;  1O4X A;  3GTL J;  2H1K A;  1NK2 P;  3JRI A;  2XGD A;  5IOY A;  3C2B A;  4FCY A;  1ETK A;  2DA3 A;  5FKL A;  5EZG A;  2NOG A;  2MGQ A;  1XC5 A;  5M5W J;  1LFB A;  5C4X J;  1GV5 A;  2MSY A;  1NTC A;  2R5Y B;  4CYC B;  4NDL A;  1RES A;  3LSP A;  5FKK A;  4QTR A;  2JN6 A;  3G1M A;  3Q0V A;  4BBS J;  3JRH A;  3O8G A;  1JKO C;  1WCM J;  3HOU J;  4QSH A;  2Y30 A;  5M5X J;  5EG0 B;  2R5Z B;  4BXX J;  1OFC X;  1T33 A;  2XB5 A;  2EQR A;  3Q0W A;  2NS8 A;  5IP7 J;  5FKO A;  1X58 A;  3ZQC A;  2IEK A;  3S17 J;  2W48 A;  2YS9 A;  1GVD A;  4M3E A;  5C4J J;  1F36 A;  2LY9 A;  1DU6 A;  3GTJ J;  1QRY A;  1AKH A;  1H8A C;  2CU7 A;  2XGE A;  1Q1V A;  3D1N I;  1Y1W J;  1Z77 A;  1HCR A;  4XK4 A;  3LSG A;  4IHW A;  3HOX J;  3TED A;  1UMQ A;  1JUS A;  3CQZ J;  1ZR2 A;  4V2G A;  1HDD C;  3RKQ A;  1FJL A;  3O8H A;  1HDP A;  5DTD A;  2FJ1 A;  1IG7 A;  1TWH J;  2E2H J;  2YUS A;  4MO7 A;  3FIS A;  4D7M A;  2EZL A;  3BR1 A;  2CQQ A;  1X2N A;  3Q0U A;  2DMN A;  1MBF A;  2XPU A;  2HQ5 A;  1K61 A;  2VUM J;  1VI0 A;  1JTY A;  3BQY A;  2DA5 A;  3BR3 A;  4A3D J;  2LTP A;  4DZJ A;  4BBR J;  2KT0 A;  3W6V A;  1POG A;  2NS7 A;  3BR5 A;  2LD5 A;  3ZQH A;  4M3D A;  3SJM A;  5C3E J;  2DA1 A;  1K83 J;  5M5Y J;  2XGC A;  5IYD J;  3LOC A;  2VKV A;  1JKP C;  1AKH B;  1B72 A;  1OJL A;  2HOS A;  2VKE A;  3JRD A;  2K9S A;  4ABZ A;  2XPV A;  3ZQI A;  1IDZ A;  2O8K A;  4EEF G;  1I50 J;  2TCT A;  4HNV A;  3DCF A;  1PUF A;  2OPT A;  3VPR A;  4C3I J;  1I3Q J;  3GTQ J;  4RDU A;  3S14 J;  2VPR A;  3JRA A;  2MW8 A;  1UG2 A;  3LNQ A;  3S1N J;  4DW6 A;  1ETV A;  3HBL A;  3MKL A;  2IBD A;  1U8B A;  4C3J J;  5E3N A;  2X9D A;  3BG5 A;  5DS9 A;  2O7O A;  4G12 A;  3JR9 A;  5E3M A;  2DMQ A;  3M3Y J;  4V2F A;  5M3F J;  5IP6 A;  2JA6 J;  3GTK J;  3S1Q J;  2K40 A;  5K7H A;  5HOD A;  2N8G A;  3TW7 A;  4Y52 J;  1JUP A;  1A5J A;  1MBK A;  4D5F A;  4W1U A;  2EH3 A;  1QPI A;  4I76 A;  2CQX A;  3BR2 A;  1XG1 A;  5F0F A;  2WB1 N;  1MBE A;  3TP0 A;  4XIC A;  2HOA A;  5FKN A;  3I4M J;  2DA6 A;  1B72 B;  1B8I A;  3K2A A;  3QQA A;  1WH5 A;  4DYQ A;  4XRM A;  4DYC A;  2MG4 A;  2EZK A;  1JGG A;  5GP9 A;  5EDN A;  2M8G X;  2Y31 A;  1SAN A;  2WAQ N;  1PUF B;  5EGO A;  3IV5 A;  1ORK A;  2HXI A;  3UKG A;  1MBG A;  4A93 J;  4D7N A;  2L7M P;  2HYJ A;  3OSF A;  2L0K A;  2R92 J;  1FTT A;  1MH3 A;  1JTX A;  4JX6 A;  1ENH A;  3S1R J;  1EF4 A;  2ECC A;  2DA4 A;  1MSE C;  4A3C J;  1GUU A;  3S2H J;  2R7Z J;  3CCY A;  2DMT A;  9ANT A;  3IH3 A;  3QPS A;  4B4C A;  5IP9 J;  2X6O A;  2NVY J;  2E2I J;  4MFD A;  3BQZ A;  4I6Z A;  2JMW A;  3A01 A;  1MNM C;  3CDL A;  1ZKG A;  4JP0 A;  4MFE A;  2ME0 A;  1FIP A;  5IYB J;  3PO3 J;  3WHC A;  1UHS A;  5GPA A;  3ZOB A;  5K7Z A;  1RET A;  1WGX A;  1BW6 A;  2K9Q A;  5IPA A;  5EZH A;  3S15 J;  4M6V A;  2JK3 A;  3ZQG A;  4C3H J;  3BG9 A;  1ZTR A;  4DZP A;  2R0Q C;  4B1R A;  2B63 J;  4A3B J;  2JWT A;  2HXO A;  3BR6 A;  1FEX A;  2AO9 A;  1VND A;  2DA7 A;  2L7Z A;  2L9R A;  4A3K J;  5M3M J;  5J3L A;  2EBI A;  4S0H B;  2Y0S N;  2M9H A;  5J1U A;  4IHV A;  2NVT J;  1YRN A;  1S7E A;  2M0C A;  4UUT A;  1IDY A;  5K7F A;  5JLW A;  3ZQF A;  1SFO J;  1JKR C;  5FLV A;  4A3G J;  5EGO B;  2PMZ N;  1H88 C;  4XRS G;  3HDD A;  3A02 A;  1RKT A;  4M3F A;  2NVQ J;  1IJW C;  2DTZ A;  4A3L J;  1F43 A;  1LE8 A;  4GFB A;  1QVT A;  3BR0 A;  1IRZ A;  2COB A;  1QVU A;  3BT9 A;  3HOW J;  2DJN A;  1JT0 A;  4AC0 A;  2I10 A;  2ID3 A;  4J19 A;  3SDG A;  1XS9 A;  4MLO A;  3A01 B;  1CQT A;  1Y1V J;  1ETX A;  4JYK A;  4BKX A;  5EF6 A;  4FE7 A;  5EYR A;  3F0C A;  4FIS A;  4A3J J;  3G1O A;  2GM4 A;  4CYC A;  5F08 A;  4JX4 A;  3MN2 A;  3HOZ J;  2XB0 X;  1HF0 A;  3G1L A;  1TWC J;  2DMP A;  3JRB A;  2JA5 J;  2ZB9 A;  5F04 A;  2JA8 J;  5F0H A;  4A3E J;  1HOM A;  1WI3 A;  3HGY A;  3IH2 A;  1YRN B;  3FKI J;  1ZK8 A;  2OF7 A;  3GBG A;  3S16 J;  3BTI A;  1P7I A;  4X6A J;  1E3O C;  1TWF J;  1Z0X A;  2Y2Z A;  2HI3 A;  3HB9 A;  4M3B A;  2YU9 J;  3TP3 A;  3GTO J;  2QCO A;  5C44 J;  4X1E A;  1BL0 A;  1D5Y A;  2H8R A;  3GTG J;  4LOC A;  1ETW A;  4M3G A;  4A3F J;  1MH4 A;  1AU7 A;  2E19 A;  1GDT A;  2ELK A;  4MIM A;  2HDD A;  4BY7 J;  1LE8 B;  1TC3 C;  1T56 A;  2VI6 A;  5BNG A;  3Q3S A;  2FD5 A;  2QF7 A;  1IUF A;  2JA7 J;  4IHX A;  3SFI A;  2GLO A;  1U9N A;  2LKX A;  4UUS A;  1LFU P;  1VF9 A;  3JRE A;  3B6C A;  3BTC A;  2CUE A;  2JJ7 A;  3JRC A;  1MBJ A;  2XSD C;  2K9N A;  3ZQL A;  3S2D J;  2LP0 A;  4A3I J;  1U78 A;  2R93 J;  1R9T J;  5FKM A;  2X48 A;  4XRS A;  1W0U A;  2LLK A;  2M2E A;  3IH4 A;  3JRF A;  1H89 C;  4Y7N J;  2D5V A;  1ETQ A;  3WHB A;  3OIO A;  3K7A J;  4QIW N;  1RKW A;  2EZH A;  2CRG A;  5F1J A;  3E7L A;  1TWA J;  2Y9Y A;  1DU0 A;  1GT0 C;  1JUM A;  3FK7 A;  4D5C A;  5F0C A;  2AHQ A;  1W0T A;  2XPW A;  3JRG A;  2IAI A;  4IEJ A;  1A6I A;  4DYR A;  3HOY J;  1MBH A;  4FE4 A;  1HLV A;  5E3O A;  3NAR A;  5E3L A;  3RZD J;  3FK6 A;  1IGN A;  1JKQ C;  1ETO A;  3BTJ A;  5FLM J;  1ETY A;  1VFC A;  2CUF A;  1BJZ A;  2ME6 A;  1B8I B;  1MSF C;  4W97 A;  2DN0 A;  2ECB A;  1I6H J;  5F27 A;  2P81 A;  3TW6 A;  3A03 A;  1RR7 A;  4UUS B;  2DA2 A;  1ITY A;  5JLX A;  1JJ6 C;  3I4N J;  1FTZ A;  5J1Y A;  4IHY A;  1WPK A;  2O9L A;  1OCT C;  2EZI A;  3PO2 J;  3FIW A;  3HOV J;  4BY1 J;  3HGG A;  1P7J A;  2CJJ A;  2LFB A;  3MVP A;  2HOT A;  5IOZ A;  1ZQ3 P;  3GTP J;  3CMY A;  3GTM J;  3M4O J;  4AUX A;  2E2J J;  3PM1 A;  3RZO J;  2M34 A;  3LSR A;  3NAU A;  3BG3 A;  1FIA A;  1ZR4 A;  1JT6 A;  2R5Y A;  3HKZ N;  3H3V K;  1G2H A;  4C2M J;  4B3A A; 
#chains in the Genus database with same CATH topology
 1R22 A;  2F5F A;  2ID6 A;  3WTZ A;  1XDS A;  4I09 A;  1R23 A;  2L7F P;  5DYM A;  5J6X A;  3GFI A;  4BNC A;  4BH9 A;  2ZCW A;  4NC8 A;  3OS0 A;  2BE5 F;  2OZU A;  4XKB A;  2FQ4 A;  1LDK B;  4OU0 A;  3KYC B;  3FXJ A;  1X1B A;  5LLQ A;  3OYD A;  1DUX C;  2BXZ A;  3WG9 A;  4CXF A;  3OOU A;  1RI7 A;  4KT5 C;  1D1A A;  1DPU A;  3CZ6 A;  3HEF A;  3FXK A;  2R7Q A;  3UNG C;  5EEA A;  2LVS A;  2R7U A;  2IA1 A;  1YFH A;  2EIL H;  2O03 A;  3QPL A;  5LHI A;  4AWX B;  5GPC A;  2AXT C;  3S1M J;  2BW3 B;  2HQR A;  3QYB A;  4FHT A;  3DEW A;  4PJL A;  3ZMU A;  3VWB A;  1CF7 A;  4A0Y A;  3H3Z A;  1P4A A;  3LL7 A;  1B9M A;  4P9F A;  1T0F C;  2ADU A;  1ZGW A;  2HVR A;  2KIM A;  2VT3 A;  1O4X A;  4XOR A;  3SZT A;  2GXA A;  3T0Y A;  3F8C A;  3GTL J;  2H1K A;  3Q9V A;  2BVL A;  1Y8Q B;  4LLL A;  3ULQ B;  2M7A A;  3C2B A;  2KJC A;  3AG3 H;  4HZF A;  3RSN A;  1ETK A;  2F6C A;  1RUN A;  2NOG A;  4IJA A;  1XC5 A;  5M5W J;  2Y0M A;  1LFB A;  2PFB A;  2L4M A;  4B44 A;  1NTC A;  2JRT A;  2R5Y B;  1LVA A;  4CYC B;  3VOE A;  3QYF A;  1RES A;  4NDL A;  5DD8 A;  2CV1 A;  4HQE A;  5J4Y A;  5E8G A;  4X0G A;  5FD6 A;  3O8G A;  1JKO C;  1KZH A;  1S7A A;  5M5X J;  1HXD A;  2V4J C;  1MGT A;  3IKV A;  1FY7 A;  1ZRE A;  5IT9 K;  1OFC X;  1T33 A;  3BCA A;  2EQR A;  3HRT A;  1YX5 A;  4LGW A;  4XKC A;  5FKO A;  3ZQC A;  2H94 A;  1DPR A;  3OYM A;  2P5K A;  1TL8 A;  5C4J J;  4Q5S F;  2QKM B;  4KIG A;  3S3O A;  2PQ8 A;  2K85 A;  3DTE A;  4GRI A;  4LD5 A;  5HDK A;  2DU9 A;  4N9H A;  1K6O A;  3GTJ J;  1QRY A;  1TTY A;  3CJT B;  4RA2 A;  3M8E A;  3ZMS A;  4F7Z A;  1CF7 B;  3MQ0 A;  3RYR A;  3ZPL A;  2ACJ A;  1Z77 A;  3HHG A;  1HCR A;  4XK4 A;  4A6E A;  2XF7 A;  1R36 A;  3TGN A;  1QQI A;  5ILU A;  1WSU A;  3KIO A;  1Z9C A;  1T2K A;  3GW2 A;  4HF0 A;  4MTD A;  2QUF A;  1UMQ A;  1IXS B;  2WY7 Q;  3LWF A;  3KEY A;  1ZR2 A;  2L01 A;  3K1P A;  2VIX A;  1SVL A;  1FJL A;  4QLC U;  3RIR A;  4R79 A;  1T38 A;  3ABL H;  3MFK A;  3OYC A;  2DFE A;  2ZSI B;  2YX7 A;  1IG7 A;  3KP7 A;  5E17 F;  2M5W A;  4PSW A;  2E2H J;  2YUS A;  4WCG A;  2RDP A;  2VQG A;  1ZG1 A;  3F3X A;  1K78 A;  2Q0O A;  1X2N A;  2J5P A;  1R00 A;  2JPC A;  3CJN A;  2FEZ A;  3LQR A;  2CW7 A;  2OQR A;  2VUM J;  3ERM A;  5CVR A;  2QGU A;  4NNJ A;  2DCE A;  3V7R A;  1XSD A;  3AL0 C;  4LFU A;  5DV5 A;  4ZZD A;  3W2A A;  5K5R A;  2R7R A;  2YU3 A;  4DZJ A;  2UXX A;  4RGS A;  1J9I A;  3N4M A;  1TQI A;  2RRE A;  4GGG A;  2ZJP F;  2ZME A;  3BR5 A;  3ZQH A;  4NUB A;  3H92 A;  1V4R A;  5D5W B;  3DPU A;  5J47 A;  3TDZ C;  1XD7 A;  1JKP C;  1ZLK A;  1KU9 A;  1B59 A;  1MMG A;  2K9S A;  3JRD A;  2XC7 A;  1IDZ A;  4G7H F;  2WV0 A;  1K4S A;  4HNV A;  3C2H A;  4DNC A;  2OPT A;  3FWE A;  3LSI A;  1FP1 D;  1YQA A;  2OTJ I;  2XRN A;  2BHZ A;  4BE0 A;  4C3I J;  4OMY A;  1WQ2 A;  1OKR A;  3F8F A;  2H09 A;  5GAD J;  3CME I;  2NYX A;  3G6E I;  1QZE A;  3LNQ A;  4XLA A;  1YX3 A;  1ETV A;  2DDB A;  3K4L A;  1EH6 A;  1WI9 A;  4E70 A;  5HOO A;  4G94 A;  2V1X A;  3BG5 A;  1EKE A;  2PI0 A;  4HG2 A;  1K78 B;  3SFZ A;  5JVT A;  4G12 A;  3R0J A;  3ECO A;  2JVG A;  5M3F J;  1OPC A;  1A35 A;  3GTK J;  2P8T A;  3O3K A;  1SFX A;  5K7H A;  3ZMZ A;  5HOD A;  3TW7 A;  3FXL A;  3O6B B;  3DU6 A;  1A5J A;  5HLT A;  4D5F A;  1I1G A;  5GAE J;  3WTY C;  2ZME B;  3HRU A;  2QKL B;  4HQM A;  1QPI A;  4I76 A;  2CQX A;  3MZ8 A;  3OYG A;  5F0F A;  2GOX B;  2WB1 N;  5CVI A;  3HC7 A;  1X1D A;  1KU2 A;  4Q47 A;  2XHK A;  3OYF A;  1ACI A;  2R7O A;  4XRM A;  3CCJ I;  2MG4 A;  2EZK A;  4KFC A;  4ZYG A;  2FOK A;  4RB3 C;  2VLA A;  4ZTF A;  4ANJ A;  5ILV A;  5EGO A;  3MZY A;  2RGV A;  4AM3 A;  1TT5 B;  3UKG A;  1MBG A;  2L7M P;  2HYJ A;  3OSF A;  2JUG A;  1MH3 A;  3BG6 A;  5J8F A;  4JX6 A;  1MSE C;  2LKS A;  3CCY A;  3NEU A;  4CCK A;  4B4C A;  4Y3O A;  1B4A A;  2DO7 A;  3LSK A;  2NVY J;  3I55 I;  2E2I J;  1AA7 A;  2M8E A;  2QLZ A;  4BJ6 C;  4I6Z A;  3T5X A;  3J80 Z;  3CDL A;  2VB6 A;  5D4S A;  1FIP A;  1SD7 A;  3R0A A;  1FNN A;  3PO3 J;  3GXO A;  2H8W A;  3TQN A;  1UHS A;  2L02 A;  1BW6 A;  2DK8 A;  1IV8 A;  3FHN A;  3GX4 X;  2R0Q C;  3CDI A;  4XOT A;  2CV0 A;  2LMD A;  4A3B J;  2HXO A;  3BR6 A;  4M9S A;  5DD4 A;  2L7Z A;  1NG6 A;  3RJP A;  3FXO A;  4A3K J;  5M3M J;  5J3L A;  2EBI A;  2COM A;  3A1Y A;  1O3T A;  4S0H B;  4A5M A;  1EA3 A;  5J1U A;  4IHV A;  1WKM A;  3C18 A;  3GYH X;  3CLO A;  4KN4 X;  5TJJ A;  1IDY A;  2F5C A;  5JLW A;  3BOQ A;  5EGO B;  2A6E F;  1S5L C;  2YR2 A;  2W57 A;  4DIQ A;  2Y75 A;  1G4D A;  3HDD A;  3WTS C;  3HKZ A;  5J40 A;  3T8R A;  4U88 A;  3ZRG A;  4AIJ A;  5D5U B;  4M71 A;  1ZYR F;  3FM5 A;  1F43 A;  1LE8 A;  5K5Q A;  3I9V 2;  2FML A;  1QVT A;  3HIF A;  3KLO A;  3TDU C;  4PJM A;  3E97 A;  3F23 A;  4ZYD A;  2ICW G;  4J19 A;  2BVM A;  3OYB A;  2VBZ A;  4XN0 A;  5FD5 A;  1HA8 A;  2JSP A;  1CQT A;  1BR2 A;  2BY1 A;  1Y1V J;  1G6N A;  3COA C;  3QOP A;  4FE7 A;  2LY1 A;  3F0C A;  5GAH J;  3DKY A;  1XN7 A;  5F08 A;  3PIP F;  1V55 H;  2FUG 2;  2OCE A;  3LA2 A;  4XNF A;  2VQH A;  3P7N A;  1RR8 C;  1DP3 A;  4AYB A;  4BS9 A;  2XSJ C;  3G1L A;  1TWC J;  3E0J B;  3H1C A;  4EMS A;  3VEP A;  3N05 A;  5DEQ A;  1GLN A;  3I71 A;  3FBN B;  2JA8 J;  5AON A;  2VC1 A;  4BEH A;  3F22 A;  2K86 A;  3J7A Y;  4JQF A;  3VB2 A;  2KIU A;  2XAQ A;  5LGT A;  1ZG3 A;  2VKH A;  1YJ9 I;  1LPQ A;  1ZGJ A;  2HWV A;  4OAZ A;  3M1E A;  2RNJ A;  1X3U A;  1Z6R A;  1IRG A;  4MHG A;  1I27 A;  2XUB A;  4M3B A;  1R6R A;  3G3Z A;  3RPU D;  3DKW A;  3GTG J;  2LYC A;  4LOC A;  1OYW A;  1QNT A;  2XF6 A;  5DDG A;  2BYV E;  4JK1 X;  1PUE E;  1YE9 A;  2JA2 A;  2HDD A;  1OMI A;  1LE8 B;  4L5I A;  2VC0 A;  4H0E A;  2CWE A;  1T56 A;  5BNG A;  3ELK A;  3Q3S A;  2FD5 A;  3S8P A;  1K7A A;  2Z9O A;  4RB2 C;  3N97 A;  4IHX A;  1G3Y A;  2LOO A;  2X1D A;  1VF9 A;  1R1T A;  5HLH A;  1W5T A;  4ZZL A;  2D45 A;  1G59 A;  2JJ7 A;  3LST A;  4BXU A;  4IL6 C;  1FMV A;  1KON A;  2NRA C;  2PLY A;  3BY6 A;  2GIV A;  2XDV A;  2R7D A;  1U78 A;  3TMO A;  2R93 J;  1R71 A;  5ICG A;  4G6T B;  5FKM A;  1FYM A;  2B9S A;  4PGH A;  3PUF A;  4M6X A;  3S3M A;  3A2K A;  1KU3 A;  1W36 D;  5JFR A;  4KUM A;  4EAT A;  1ETQ A;  4BEH B;  3S2W A;  3QWL A;  1FBQ A;  3E7L A;  5LFA A;  3SYT A;  5KNL A;  2F48 A;  4O5V A;  1TWA J;  3TOA A;  4ESB A;  2K4B A;  1JUM A;  3FK7 A;  3BZ6 A;  4RB0 A;  2AHQ A;  3JTH A;  1DP7 P;  3JRG A;  2JSC A;  3W6K B;  3IKT A;  1A6I A;  3OR1 C;  2XIG A;  2V1D A;  2Q8K A;  4C2U A;  4IQJ A;  2K02 A;  1FWZ A;  2E1M B;  3C2G A;  3SXY A;  1IGN A;  2W82 A;  1ETO A;  3G2B A;  3BTJ A;  5HVQ C;  1B8I B;  1BJZ A;  3OIP A;  4W97 A;  1M1E B;  2MLK A;  2O0Y A;  4I01 A;  2R3S A;  3SDB A;  3V8J A;  1E0E A;  2DBB A;  5D5V B;  1RR7 A;  2HS5 A;  2VJ5 A;  4XKV A;  5E79 C;  2M3A A;  3EQL F;  2EPF A;  2NS0 A;  1V54 H;  1W36 C;  1F5T A;  2O9L A;  3ZN1 A;  1Z67 A;  2ZXW H;  2B7E A;  1Y0N A;  3HGG A;  1NH3 A;  1W5C C;  4KIC A;  3HTS B;  2ZNZ A;  3MVP A;  3CCU I;  3F6V A;  3BWG A;  2VKD A;  4UHT A;  4OIO F;  2JVH A;  3ZGK A;  3GTM J;  4NB5 A;  2E2J J;  3GUD A;  2VJJ A;  1OCO H;  1MIJ A;  3HTU A;  2EB7 A;  3U1D A;  2X85 A;  3ZCO A;  3BG3 A;  1N25 A;  2GQQ A;  4BUP A;  1O3S A;  1JT6 A;  2IXS A;  3K4C A;  4OIP F;  3HKZ N;  1XPX A;  4BDZ A;  3H3V K;  1G2H A;  2UV1 A;  5BQT A;  3KP4 A;  4NC7 A;  5F64 A;  2GXG A;  1OCZ H;  4UVB A;  2FX0 A;  1WH7 A;  4IO9 F;  3L2W A;  4ENJ A;  2Y9Z A;  2HQN A;  5KCM A;  5J1R A;  2DPD A;  2YSR A;  4HA8 A;  4A0X A;  3LSJ A;  5EG0 A;  1BC8 C;  1APL C;  2R7V A;  4RAZ A;  1JJ8 C;  2NVX J;  2E1O A;  1LVK A;  5FLX Z;  3HUG A;  2E1C A;  1RPW A;  1S3J A;  4U7B A;  3IAS 2;  4M9Z A;  5FRN A;  2V1N A;  3J80 K;  3CO6 C;  1IC8 A;  3K1N A;  4A3M J;  4YII A;  4XID A;  5ED4 A;  5HS7 A;  3CC7 I;  2VQC A;  2G0E A;  5LRR A;  4AYB N;  2TRT A;  4HX8 A;  3EYY A;  4PJJ A;  4BAC A;  1U9O A;  4DOZ A;  4S05 A;  3OOP A;  3LSH A;  4I7H A;  1IV6 A;  1JI8 A;  3FX3 A;  2PX9 A;  4MGR A;  2GA2 A;  2RN7 A;  2VOP A;  1U3E M;  2G9W A;  3JRI A;  3R61 A;  3J81 K;  1YW7 A;  4LB6 B;  3V7S A;  3HOS A;  4G7Z F;  1ZH5 A;  2WAQ A;  2Z33 A;  4E6K G;  4FCY A;  2DA3 A;  2JTV A;  1HC8 A;  1T98 A;  1A04 A;  3SEZ A;  2MGQ A;  2FBH A;  2QQB A;  1YS6 A;  5C4X J;  1XGN A;  1GV5 A;  3FXU A;  4BE1 A;  1GVJ A;  3K4J A;  4FAS D;  4M74 A;  4CZZ A;  3TL4 X;  5BMZ A;  3IP4 B;  4QTR A;  4KIF A;  3NWT A;  1ZGA A;  2ETH A;  3Q0V A;  4BBS J;  2EA4 A;  1JHF A;  3H35 A;  5TIS C;  3DU5 A;  3HOU J;  3DPT A;  3ONQ A;  4CHU A;  5EG0 B;  4BXX J;  1BIB A;  4LIU A;  1LDD A;  3GVA A;  3S17 J;  1X58 A;  2ELH A;  4QWQ A;  2DFI A;  3HUG B;  4HNT A;  2YS9 A;  3WU0 A;  2WAE A;  1LJ9 A;  1F36 A;  2LY9 A;  3ASN H;  1P2F A;  3FDY A;  2XVC A;  2Y48 A;  3KZY A;  4DJA A;  2C6Y A;  3W3C A;  1KU7 A;  4HST A;  4E7I A;  1U5T A;  1CGP A;  1Y1W J;  1K6Y A;  4QPO A;  3JAM Z;  3LSG A;  2HKX A;  3EUK L;  4IHW A;  2Y0S A;  5D6E A;  1QZY A;  4EVI A;  3K69 A;  2L9S A;  3L9F A;  4E7H A;  3CQZ J;  2LBF A;  3FKJ A;  2H6B A;  1HDD C;  1SFU A;  3C7J A;  5DCM B;  4Z2Y A;  4CCO A;  2PMZ A;  3OS1 A;  4JOM A;  4BQA A;  4BJT A;  2XAJ A;  1TWH J;  3QRF F;  1RRJ A;  1UHW A;  4D7M A;  2OTL I;  5HNF A;  2CQQ A;  3CJQ B;  2XPU A;  2VN2 A;  3DEU A;  3H9Q A;  5JR3 A;  1K61 A;  4L9T A;  3I4P A;  2P6S A;  2DT7 B;  1JTY A;  4NQW A;  3LAJ A;  1T8I A;  5HLG A;  1OYY A;  4A3D J;  1EV7 A;  2HZD A;  2FNP A;  2DXI A;  2LTP A;  3FF5 A;  2YX4 A;  1TLH B;  2MFZ A;  3W6V A;  2W84 A;  1JHH A;  1P4X A;  1SFK A;  4M3D A;  4Q4Z F;  3SJM A;  5C3E J;  1XMK A;  2CMP A;  1K79 A;  2ZME C;  2P5V A;  4PJN A;  2M4K A;  2VKV A;  1R1V A;  2EV6 A;  4N9I A;  2VKE A;  5KAI C;  3BP8 A;  2IPQ X;  2DI3 A;  3X2Q H;  4EEF G;  2TCT A;  1PUF A;  2XRO A;  3ERE D;  1VQM I;  2JT1 A;  5GTH C;  5HNH A;  3FMQ A;  3KPH A;  1ULY A;  3VPR A;  2LBF B;  1ZAO A;  2A6H F;  3ABU A;  3WG7 H;  2ISZ A;  4RDU A;  3S14 J;  2VPR A;  2MW8 A;  3GLX A;  1UG2 A;  2KKO A;  4DW6 A;  3HBL A;  3WGH A;  2IBD A;  4ZJZ A;  1VQL I;  1XB4 A;  5E3N A;  1J5Y A;  1VQ9 I;  2K27 A;  4MQV A;  2WB1 A;  1E17 A;  3JR9 A;  2QSG X;  5E20 A;  1Z3X A;  2DMQ A;  3LFU A;  4CZC A;  2DPU A;  2WY8 Q;  1Z05 A;  1B9N A;  2CFO A;  3EUA A;  3V8L A;  3F9K A;  2JA6 J;  4PUS A;  3EPZ A;  3MD2 A;  4NQW B;  3WTX C;  3IL2 A;  1L0O C;  4CIC A;  3L09 A;  2I8D A;  2UZK A;  3KCC A;  5KHD A;  2EFW A;  5LEJ A;  4Y52 J;  3DTI A;  2OUM A;  2PJR A;  1MBK A;  1BI1 A;  3JSP A;  4W1U A;  2KIQ A;  2RC4 A;  3HRM A;  4BXF A;  1XG1 A;  1MBE A;  3GWZ A;  5FKN A;  3ASO H;  3I4M J;  2LC2 A;  3K2A A;  3QQA A;  3WTU C;  4I0A A;  1JGG A;  2MC3 A;  2GOM A;  2MYS A;  2M8G X;  2WAQ N;  1PUF B;  3CCQ I;  4G9Y A;  3IV5 A;  1ORK A;  1N75 A;  4HLY A;  1VQ7 I;  4D7N A;  2WAD A;  2XAH A;  1HKT A;  3EUH A;  2QEN A;  1D5V A;  2K4J A;  2DA4 A;  5HDG A;  3NQO A;  2ZC2 A;  1GUU A;  3H5A A;  2P0W A;  4I0B A;  5D8L B;  4CO8 A;  3S2H J;  3CLQ A;  1XMA A;  2TDX A;  2XAU A;  1IO2 A;  1B6A A;  4MFD A;  4OIN F;  3DLA A;  1T08 B;  5ICF A;  3IUO A;  3ZR8 X;  3WTW C;  3M07 A;  4A5N A;  4YFK F;  5JHU A;  1YLF A;  4HV6 A;  3SQN A;  3WHC A;  4PSX A;  2CUJ A;  5GPA A;  4EV0 A;  1RET A;  4ZYE A;  2F4O B;  2K9Q A;  5CVJ A;  2D2W A;  2VJ4 A;  4M6V A;  4AVP A;  3OYJ A;  3ZQG A;  1BOA A;  4C3H J;  2R7X A;  3BG9 A;  1W1W E;  3D0S A;  3KYL A;  5FLX K;  2P7C B;  1H0M A;  2PJR B;  2JWT A;  4HX4 A;  5LHH A;  2AO9 A;  1VND A;  2DA7 A;  3I5U A;  4HW0 A;  4Y15 A;  3PQK A;  1WFX A;  2Y0S N;  4UXN A;  2M9H A;  3TO6 A;  2EV0 A;  2HYG D;  4EGZ A;  2VXZ A;  3CF2 A;  4BYY A;  1VZ0 A;  4UUT A;  3MKY B;  1GXQ A;  4A3G J;  5HDN A;  5TGT A;  2PMZ N;  4XRS G;  3QPH A;  1BJA A;  1FOW A;  3WU1 B;  4M3F A;  4Y4R A;  1IJW C;  3CP2 A;  4GFB A;  2ZFW A;  3KP5 A;  4ZDP A;  1QVU A;  3HOW J;  4UVC A;  4LB5 A;  4HV5 A;  1JT0 A;  4ZYH A;  1ZRD A;  2DYS H;  2ZXH A;  4MLO A;  1XS9 A;  2G7H A;  3RKY A;  3ZMT A;  2L4A A;  3BPV A;  1ETX A;  2CH0 A;  4A0Z A;  4BDY A;  1IN6 A;  1OIS A;  2QBY A;  2IJL A;  3G1O A;  5CJ9 A;  1R7J A;  4XRF A;  2GAU A;  4JX4 A;  1S8N A;  3MN2 A;  3LAP A;  4FX0 A;  4F93 B;  1R58 A;  1ZN2 A;  2ZXJ A;  4U0Y A;  2AXL A;  2DMP A;  4DBQ A;  2VON A;  2XKO A;  3FM3 A;  4KJZ A;  1SD4 A;  2JA5 J;  5F04 A;  2JPB A;  4XN3 A;  1OCC H;  2P6T A;  3CCR I;  5F0H A;  2W00 A;  2EK5 A;  4A3E J;  2PMU A;  2PMH A;  3IH2 A;  4HSR A;  4D0P A;  3GBG A;  2QSF X;  3JAM K;  2XAF A;  1TWF J;  3L7W A;  2WWY A;  3GTO J;  3HRS A;  1BL0 A;  2EFP A;  1D5Y A;  4LLN A;  2V79 A;  5CQE A;  2HTS A;  4A3F J;  1AU7 A;  2L54 A;  3I0T A;  1GDT A;  3REO A;  3F21 A;  1S9H A;  1O7L A;  2ELK A;  4MIM A;  4BAY A;  3L2C A;  1YIO A;  1IUF A;  2E1M C;  2UUZ A;  3I58 A;  2JA7 J;  2AQE A;  2GLO A;  5B5E C;  4HF2 A;  4BQQ A;  3CCM I;  2LKX A;  1LFU P;  4Q48 A;  2K3P A;  3B6C A;  4HPQ A;  1MMD A;  1I3A A;  4B09 A;  4UVA A;  4IX7 A;  3JRC A;  1MBJ A;  4XOP A;  2K9N A;  2XSD C;  2QBY B;  1RC9 A;  3R4K A;  3PQJ A;  2QM3 A;  4A3I J;  1REP C;  2E34 A;  3OY9 A;  4LIV A;  3ZXS A;  1HKQ A;  3F8B A;  3HXL A;  2FMY A;  2XGX A;  1R9T J;  1BI2 A;  1TZL A;  1Z7L A;  4XRS A;  3K4N A;  2HVQ A;  4EQQ A;  4M73 A;  3DWL E;  3BCB A;  4IXA A;  5GAG J;  3WGI A;  3KEO A;  2STT A;  4Y7N J;  1VQ4 I;  3L00 A;  4RB1 A;  1J09 A;  4YRV A;  4LLG F;  4ENM A;  3BJA A;  3CUQ C;  1SFE A;  3OIO A;  3VYR B;  2KJB A;  4QIW N;  5DM7 F;  5F1J A;  1UG0 A;  1E2X A;  2Y9Y A;  1DU0 A;  3BZK A;  4A2U A;  3CMA I;  3WE2 A;  5B1A H;  1W0T A;  2X6X A;  2RNG A;  3BPX A;  3MKW B;  4IEJ A;  1Y56 A;  3VYT B;  2DQR A;  3T1B A;  2CV2 A;  3C1D A;  3J81 Z;  1MBH A;  1S29 A;  1D1B A;  1RNL A;  3SHF A;  5FO5 A;  3JW4 A;  3QOE A;  5E3L A;  2A07 F;  3D5R C;  1WJE A;  2NNN A;  3PFI A;  1MSF C;  2IA2 A;  3WOD F;  5LD2 C;  2KDO A;  5ILS A;  1MMS A;  3A4C A;  3TW6 A;  2P81 A;  3A03 A;  2DA2 A;  2KZV A;  1UAA A;  4EJU A;  4KIT B;  2HVS A;  3I4N J;  5HLI A;  4PDK A;  2RQQ A;  1WJB A;  4HEA 2;  4ZTJ A;  5J1Y A;  2BGC A;  1O7F A;  4U7D A;  2EZI A;  1SC7 A;  1A6Q A;  1A36 A;  2HR3 A;  4G6D A;  3IRQ A;  4HF1 A;  1OR7 C;  4F92 B;  4AUX A;  2EFO A;  3PM1 A;  2DOA A;  3RZO J;  3ROU A;  1JE8 A;  2M34 A;  3DFG A;  4KMF A;  3LSR A;  3L2R A;  5BOX A;  1ZR4 A;  4FET A;  3HG9 A;  4KMU X;  2IA0 A;  4EM1 A;  4C2M J;  2XAS A;  1H9T A;  5FJ8 J;  3W2V A;  2K9L A;  1YHQ I;  2XRL A;  1FOY A;  4P9U A;  2M4G A;  2FA5 A;  2P5L C;  2DMU A;  2WV1 A;  1P4W A;  4RBO A;  3OSG A;  2QZ8 A;  2IGK A;  2KDZ A;  4HRI A;  4ZDO A;  4E7S A;  5H2F C;  1YOV B;  5H6R A;  5E1W A;  5B66 C;  2GBY A;  2RAE A;  3VDX A;  5IYC J;  2I5U A;  1NK3 P;  3HJE A;  5F6F A;  4IVN A;  4XBF A;  1MDM A;  3E6B A;  1WWX A;  1BC7 C;  5CVU A;  3VOD A;  3CMM A;  2LKP A;  3H0G J;  2W4S A;  1OCP A;  2LR8 A;  1AHD P;  1IAW A;  4BHB A;  1XGO A;  3HSF A;  3E6C C;  4B8X A;  2AS5 F;  4HDU A;  1TW2 A;  1GV2 A;  2EWN A;  3PNV A;  4WX9 A;  2JQ7 A;  1UZC A;  2RV8 A;  1NK2 P;  4F91 B;  4WXH A;  3QP5 A;  1SD6 A;  4XSX F;  4NC6 A;  1FYK A;  2BV6 A;  1XTA A;  3M9A A;  4CYD A;  1E3H A;  2HOE A;  2ELJ A;  2Z2S B;  4OAY A;  1FMW A;  2ZJ2 A;  2MSY A;  4F3Q A;  1ZRF A;  1USS A;  3BG7 A;  1HW2 A;  4CH7 A;  2BZT A;  3LSP A;  5FKK A;  5E1X A;  1JXS A;  2MC4 A;  4ON0 A;  4O3M A;  3SZG A;  2DJI A;  2Y30 A;  3FXR A;  3AG2 H;  1VQK I;  1UB9 A;  2K5C A;  2OBP A;  2X1C A;  2JZY A;  2W25 A;  2NS8 A;  2A6T A;  2ZXI A;  4LG3 A;  2M45 A;  2W48 A;  1Z3Y A;  4YEJ A;  3QYE A;  2WTE A;  2PEX A;  4M3E A;  1ODD A;  3KX2 A;  1LFP A;  4BGD A;  2O6G E;  4II2 A;  1EJ9 A;  1MDM B;  4KIS A;  1ZEL A;  2VOD A;  1VQP I;  2CU7 A;  2XGE A;  3DP7 A;  4ITV A;  1A31 A;  4UY8 I;  1Q1V A;  2Z99 A;  2V9P A;  2HTJ A;  4BU2 A;  3HOX J;  4RAY A;  6PAX A;  2L7K A;  1JUS A;  5E18 F;  3SZP A;  1BBY A;  1FYL A;  2KPM A;  1PJR A;  2LDU A;  4UNO A;  5L3G A;  1N77 A;  1YW9 A;  3O8H A;  4XON A;  2IS6 A;  2O5R A;  5DTD A;  2W7N A;  3CTA A;  3VYU B;  1IXC A;  1SVM A;  4XLC A;  5CPR B;  4DQ2 A;  2ZFU A;  2KRH A;  2HDC A;  2BY3 A;  2EZL A;  3ABM H;  1X1C A;  3BR1 A;  3LMM A;  4NBQ A;  5FFZ A;  3U9G A;  2QQ9 A;  1YTY A;  1I39 A;  2VXD A;  1BN5 A;  1Z91 A;  2KMU A;  1MBF A;  4F52 A;  4HNU A;  1P6R A;  2L3D A;  2LG4 A;  2H1L A;  3BQY A;  3U2R A;  2DA5 A;  1UJ8 A;  1QHG A;  2BHY A;  2LNB A;  3F6O A;  2QEX I;  3K4K A;  4OMZ A;  2E1N A;  1X4O A;  5JHF A;  2A5W A;  5A2Q K;  1GHC A;  1FBS A;  4M9X A;  4Y17 A;  2LRE A;  2NS7 A;  3S93 A;  4EJV A;  4RAG A;  3ABK H;  1K83 J;  1I5Z A;  2XGC A;  5IYD J;  1WRJ A;  4Y13 A;  1G8X A;  5LGU A;  2OD5 A;  1OCR H;  3H5N A;  2MLG A;  1HBX G;  2FNA A;  1OJL A;  1B72 A;  4RGR A;  4KN7 X;  4P96 A;  1G3T A;  4ABZ A;  4YFX F;  2IRF G;  2O8K A;  3KZI C;  4WXD A;  1I50 J;  5EJC A;  3TO7 A;  3EET A;  2LH9 A;  2VT2 A;  2W24 A;  3KZZ A;  5CVV A;  1O57 A;  1D0X A;  2O61 A;  3QU6 A;  1Q1H A;  2G7U A;  3H9G A;  5DUK A;  1I3Q J;  3CF5 F;  1G3W A;  3JRA A;  3S1N J;  2ZO4 A;  4GCV A;  1FOX A;  4GXO A;  1BIA A;  4HLX A;  3GZ5 A;  4CDG A;  4XKW A;  4N0B A;  1DQU A;  2O7O A;  1UCR A;  3W6J B;  4FQG A;  1F1Z A;  5FFX A;  4V2F A;  3G4S I;  1KGS A;  5IP6 A;  2F5E A;  3U1K A;  4PJ0 C;  3WGG A;  2K40 A;  2N8G A;  5F1R A;  4J01 A;  2DLL A;  4IRG A;  4YFN F;  1V5F A;  2X51 A;  3K4B A;  3CD6 I;  5LHG A;  2EH3 A;  4CCM A;  3DBL B;  3R60 A;  3FHZ A;  3TP0 A;  3PUB A;  4L5J A;  4XIC A;  2ZJQ F;  2HOA A;  4TV7 A;  1XCB A;  5BS6 A;  2DA6 A;  1B72 B;  1XDU A;  2M1B A;  3D5L A;  1WH5 A;  3F8M A;  4DYQ A;  2H6C A;  2J5O A;  5GP9 A;  1W4M A;  2X1E A;  3U21 A;  2Y31 A;  2MD5 A;  5EDN A;  2VJI A;  2QA4 I;  3Q5F A;  4HBL A;  3CCV I;  4D1Q A;  4A6D A;  4XSZ F;  1T95 A;  3PFY A;  4A93 J;  2D1H A;  3BJ6 A;  1L3L A;  2M87 A;  3OYL A;  2R92 J;  1FTT A;  2HZT A;  1JTX A;  4IOC F;  4RM3 A;  3CCS I;  3S1R J;  1MJ9 A;  1EF4 A;  4AD9 A;  3EUH C;  4A3C J;  1QHH D;  2R7Z J;  3A0H C;  4UB8 C;  3HOT A;  4ZYA A;  3AAF A;  2X6O A;  4PGG A;  2JMW A;  3WTT C;  3M8F A;  1MNM C;  3OV8 A;  1FC3 A;  1ZKG A;  1OLT A;  3RTR A;  3VSK A;  5IYB J;  2P4W A;  1LDJ A;  2VBY A;  5HS8 A;  1J0R A;  1YYV A;  2L2O A;  5E8I A;  5K7Z A;  3ZOB A;  1XSV A;  3CUO A;  1RIO H;  2GIZ A;  3GFJ A;  3S15 J;  3K6G A;  2FF4 A;  3H3U A;  2IGO A;  2JK3 A;  1BM9 A;  1D0Y A;  4DZP A;  5J8C A;  4OIR F;  4B1R A;  3G73 A;  4XL9 A;  4IKF A;  2H27 A;  1RZ4 A;  1SMT A;  2QQA A;  4G6Q A;  2CQN A;  2KLO A;  4CCL A;  1MND A;  4O6J A;  4RM2 A;  3EDP A;  1Y8R B;  2NVT J;  3DF8 A;  2WAF A;  1C0W A;  4XR6 A;  4BHP A;  1YRN A;  4V19 K;  2EIN H;  2OQG A;  1YW8 A;  2XKP A;  3EYI A;  3ZQF A;  3OYK A;  1JKR C;  5FLV A;  4I2O A;  4KYW A;  2WBM A;  1H88 C;  1V5E A;  4HOB A;  1RKT A;  1MNE A;  4AIH A;  5E1Z B;  1D1C A;  2NVQ J;  1MJA A;  4B43 A;  2EFN A;  1IN4 A;  3BR0 A;  4B48 A;  5B3S H;  2COB A;  3OR2 C;  2ZNY A;  1ZAR A;  3DEE A;  2DOD A;  1U5T B;  3BRO A;  4IPA A;  1VQO I;  3BT9 A;  4LK0 F;  1WJC A;  1WJF A;  2DJN A;  2R7F A;  5ICE A;  2ID3 A;  4WWC A;  3AG4 H;  4KNY A;  4XLP F;  4NHJ A;  2HKO A;  2RQP A;  4C2T A;  1X3Z B;  3PL8 A;  1FOK A;  4P55 A;  4EJW A;  4FIS A;  4A3J J;  1SAX A;  4CYC A;  1IZ1 A;  3E6D A;  4E7K A;  3DPL C;  5K5O A;  1HF0 A;  4ENN A;  4IRI A;  1X3W B;  4EJT A;  3I53 A;  1SAU A;  4DBR A;  3JRB A;  2ZB9 A;  1MJB A;  1IRF A;  1QGP A;  1YIJ I;  2PJP A;  2CW8 A;  1QBJ A;  1IW7 F;  4OWR B;  1ONV A;  5FB2 A;  5DCF A;  1WI3 A;  1YRN B;  2DDA A;  1HSJ A;  1S7O A;  4GDF A;  2GZW A;  2OF7 A;  4B3X A;  2ESH A;  3H9J A;  3BTI A;  2IS1 A;  1WJA A;  3C3W A;  2Y2Z A;  3HB9 A;  2HI3 A;  4LJZ F;  1YJW I;  3A0B C;  5C44 J;  2H8R A;  4K2E A;  1LNW A;  1ETW A;  2EV5 A;  2E5Z A;  2BXY A;  2HQA A;  2L5Q A;  2O8X A;  1IXR C;  2E19 A;  3LFK A;  2XAG A;  1D3Y A;  3KYD B;  2BBY A;  3OWT A;  3TO9 A;  4BY7 J;  1S72 I;  1TC3 C;  3RKW A;  2A61 A;  4LIT A;  1ON2 A;  2IP2 A;  3SFI A;  1YJN I;  3K1M A;  4BQN A;  5KAF C;  1EH7 A;  1U9N A;  3K0L A;  4UUS A;  2VAS A;  1HQC A;  3ECH A;  3JRE A;  1VQ5 I;  1Z7U A;  4HAM A;  4ZDL A;  3GF2 A;  2DQL A;  4L9J A;  4MQ9 F;  1I6X A;  3ZQL A;  3S2D J;  5FRO A;  4PFP A;  2LP0 A;  3FMR A;  3NWS A;  3V7C A;  5TRD A;  4GYI A;  1QO0 D;  2DT5 A;  2IT0 A;  2EA2 A;  3OMY A;  4KT6 A;  2KRF A;  2HNH A;  3L2Q A;  4UV9 A;  2CUZ A;  1FSH A;  2CO5 A;  2M2E A;  3E6M A;  4YIF A;  1UHM A;  2FQ3 A;  2VQL A;  1H89 C;  3HPG A;  1PP7 U;  3MZH A;  2CYY A;  2DOF A;  3WHB A;  1D8J A;  1IUY A;  1TQM A;  2NAZ A;  2GXB A;  4AID A;  2A05 A;  3HL2 A;  4HDV A;  4IQ4 A;  1HST A;  3HSR A;  3PSF A;  1GT0 C;  4D5C A;  3AFH A;  5F0C A;  3L2V A;  3VFZ A;  4A12 A;  2MA3 A;  2XPW A;  2DYR H;  2IAI A;  1ERD A;  2NNY A;  3CP8 A;  4FE4 A;  1HLV A;  3I59 A;  3IRR A;  4WF2 A;  3NAR A;  3FK6 A;  4MEY F;  2Z5U A;  4E7J A;  2DK5 A;  4EGY A;  1VFC A;  2CUF A;  2NOJ B;  2ME6 A;  2ECB A;  1I6H J;  4CSW A;  5F27 A;  4UUS B;  4XLE A;  1ITY A;  5JI6 A;  5JLX A;  2FRH A;  3HHH A;  1W7P A;  1B1B A;  2MAB A;  1JJ6 C;  4FT8 A;  2GWR A;  3SEQ A;  2ZKZ A;  4IRH A;  1FTZ A;  3PO2 J;  2LRD A;  3FIW A;  5AIQ A;  3J7Y J;  4BY1 J;  3HOV J;  1MKM A;  1P7J A;  1N78 A;  2CJJ A;  2LFB A;  2VE8 A;  2HOT A;  1SVO A;  1SD5 A;  3B02 A;  3CJR B;  3CMY A;  3V4G A;  5H6Q A;  2L9N A;  2LF7 A;  1YG2 A;  2VOO A;  4FX4 A;  3RI4 A;  3QAH A;  3NAU A;  5H20 A;  2IW5 A;  1QZZ A;  2V7F A;  5D6F A;  1FIA A;  3G71 I;  1WHU A;  3DV8 A;  2MD0 A;  2EIM H;  3F8N A;  1V3F A;  4L9V A;  4CA0 A;  1BW5 A;  2KIS A;  1TWG J;  3RDI A;  4L5E A;  4JX5 A;  1X2M A;  4CUG A;  1BA5 A;  3M7G A;  4G8X A;  2IS4 A;  3E5Q A;  3RQI A;  3E5U A;  1F9N A;  1NG7 A;  2HPI A;  2R5Z A;  2OU2 A;  3TBI A;  3L1P A;  4D9J A;  4P5O A;  2JUC A;  4FTH A;  3I59 B;  4A69 C;  2V6C A;  1LEA A;  5L3B A;  1P9Q C;  3HZJ A;  3ZP5 A;  2F5V A;  2LK2 A;  2DAO A;  4RS8 A;  2O3F A;  2EJR A;  3GO5 A;  1D8K A;  3I3L A;  3B6A A;  3ZMD A;  3ZQQ A;  3BZC A;  3GZN B;  4M72 A;  1R5G A;  5HS9 A;  1T0F A;  1W7P B;  3HM5 A;  5FGM A;  3BTL A;  3E5X A;  4ESF A;  2R7T A;  4AIK A;  3GFL A;  3ZQ7 A;  2PG4 A;  1G3S A;  3QP6 A;  1T39 A;  5A2Q Z;  1DGW Y;  1QPM A;  2XGD A;  4DGW B;  5IOY A;  5KK1 A;  3TOB A;  4N4O B;  1J59 A;  5FKL A;  2DOE A;  5EZG A;  3J7A O;  4G7O F;  2A5Y B;  4PZJ A;  4KDP A;  3S3N A;  4U0V A;  2HGC A;  1TNS A;  1YS7 A;  3ISP A;  4E7L A;  2B0L A;  1J75 A;  2BY2 A;  3PNY A;  2K7L A;  3RCO A;  3IHU A;  4ESJ A;  2JN6 A;  3G1M A;  3JRH A;  3CC2 I;  1WCM J;  4QSH A;  1BR4 A;  1J2X A;  1R4M B;  5DUI A;  2X4H A;  3F72 A;  1P92 A;  2R5Z B;  3HPH A;  2CGP A;  4R1H A;  2JRM A;  2XB5 A;  3Q0W A;  4LK1 F;  2KIF A;  5IP7 J;  3W2W A;  2OZ6 A;  4RMN A;  1I1S A;  1FSE A;  2IEK A;  2KHM A;  4RAF A;  4XM3 A;  4JBA A;  1Z21 A;  4EJO A;  3GFM A;  2E7W A;  1FPQ A;  1XX5 A;  1GVD A;  1OYI A;  4M6Y A;  4ZC3 A;  3V8K A;  2VBX A;  3OIQ A;  4C30 A;  1PP8 F;  3FZV A;  1U0J A;  1PDN C;  1DU6 A;  1AKH A;  1H8A C;  2LSO A;  1FT9 A;  3DXJ F;  3MKZ A;  2Z3Y A;  2LY2 A;  3IWZ A;  3TKY A;  3D1N I;  2FXA A;  1PVE A;  2OCC H;  4YEL A;  2PBI A;  3J7Z I;  4BQO A;  4IF4 A;  4XLN F;  3TED A;  2CQK A;  2WC2 A;  3GEZ A;  2KFD A;  2KRC A;  1BI3 A;  4P1W A;  4LG0 A;  3VSL A;  4CCJ A;  4XLH A;  4V2G A;  3RKQ A;  1H9G A;  1TQP A;  1HDP A;  2UXN A;  2HU9 A;  5CKT A;  3CES A;  2FJ1 A;  3DBH B;  4UV8 A;  1UST A;  3I54 A;  1MW7 A;  3RYP A;  4MO7 A;  1S6L A;  3FIS A;  3OYH A;  3Q9S A;  4XQF A;  4S04 A;  3Q0U A;  2DMN A;  4MEX F;  2F4M B;  2OA4 A;  1TNT A;  2HQ5 A;  4MTE A;  2BOL A;  2R4G A;  2K9M A;  2HEO A;  1VI0 A;  2L9V A;  4HX7 A;  3CCE I;  1KYZ A;  1TT0 A;  3KEQ A;  3BR3 A;  2X0L A;  4BBR J;  2KT0 A;  5L3D A;  2OJE D;  3MEX A;  1POG A;  1ZG5 A;  1SEU A;  1VQ6 I;  3ABT A;  2LD5 A;  2DA1 A;  1IN5 A;  2FBI A;  2MH2 A;  4R8H A;  5M5Y J;  3K10 A;  3LOC A;  2X6W A;  1AKH B;  2HOS A;  3DQV C;  2ZBK A;  2F2E A;  3I64 A;  2XPV A;  3ZQI A;  5BPI A;  1VQ8 I;  3DCF A;  2EIJ H;  4BL0 B;  4MNU A;  1MMA A;  1NHA A;  2E7X A;  5EEH A;  5LEK A;  4RLQ A;  4LG0 B;  1LEB A;  3GTQ J;  1R5I D;  1X1A A;  1X19 A;  3GCM A;  5KVR A;  4OOI A;  2V26 A;  3FMS A;  3ML6 A;  3MKL A;  2NXN B;  4L9N A;  3QPT A;  1U8B A;  4C3J J;  2KZG A;  3B73 A;  2X9D A;  4E4H A;  3E1S A;  5LRS A;  3JSO A;  5DS9 A;  1BI0 A;  1QA6 A;  1KYW A;  2FU4 A;  5E3M A;  3PJR A;  3M3Y J;  1XCV A;  4WXC A;  5B1B H;  3AL0 B;  2XF5 A;  1LB2 A;  3S1Q J;  4GO1 A;  3P9C A;  1PYV A;  5CQG A;  2VE9 A;  2EIK H;  4EM0 B;  3K9T A;  1JUP A;  1WVR A;  3BLY A;  3K4M A;  2E36 A;  2HYF A;  5ERI A;  2CG4 A;  1FZP B;  1EH8 A;  3BR2 A;  2HFH A;  3RKX A;  3OS2 A;  5D8K B;  3KE2 A;  3OYN A;  2YPR A;  5DM6 F;  1UFM A;  1B8I A;  5J4V A;  2UWM A;  4DYC A;  4QPQ A;  2CS3 A;  5FRM A;  1SAN A;  1XMX A;  3UR3 C;  3IWF A;  2IGN A;  1KA8 A;  2HXI A;  3MAJ A;  1D0Z A;  1XSX A;  3S32 A;  1O3R A;  2V1U A;  2L0K A;  4ASN A;  5D4R A;  1ENH A;  2Z16 A;  3H5R A;  4CGZ A;  2ECC A;  2M30 A;  1Y6I A;  2V9K A;  2DMT A;  3BJO A;  9ANT A;  3IH3 A;  3QPS A;  5IP9 J;  2ESN A;  4RGX A;  4J00 A;  1AOY A;  1T6S A;  2QQ8 A;  4GYG A;  4PK4 A;  4ZH4 F;  3BQZ A;  1U5T C;  1J7K A;  3CUQ A;  3ESW B;  3A01 A;  4XMY A;  4I99 C;  4JP0 A;  4MFE A;  2ME0 A;  3JTG A;  3DKX A;  4B47 A;  2OV7 A;  5GTI C;  3I56 I;  3GZ6 A;  2A3S A;  2EFQ A;  3E3V A;  2CFX A;  1LQ1 A;  1WGX A;  2F4I A;  5IPA A;  5EZH A;  4YIR X;  2DT6 A;  2V9V A;  5EEG A;  1KQ9 A;  4PCQ A;  5ICC A;  5LBQ A;  1ZTR A;  1RUO A;  3LA7 A;  3CC4 I;  2B63 J;  1ZLJ A;  3R6S A;  2CQ7 A;  3IAM 2;  5IY5 H;  2DW4 A;  3PNT A;  3MWM A;  1FEX A;  3FBI B;  1F4K A;  2L9R A;  1Z6T A;  4WK8 F;  4UUV A;  2AQF A;  2IS2 A;  3DBR B;  1Y39 A;  1S7E A;  2M0C A;  3CO7 C;  2R7W A;  3P9K A;  2VPL A;  5K7F A;  1SFO J;  2R7S A;  1KQ8 A;  2P7V B;  1O3Q A;  3BDD A;  4F55 A;  2VBW A;  5JVG F;  1QU3 A;  2FBK A;  3OL4 A;  3A02 A;  3IC7 A;  2W85 A;  1WJ5 A;  1LUJ B;  2LF8 A;  5IT9 Z;  2Q1Z B;  2QYO A;  2DTZ A;  1FBU A;  1W5S A;  2HDW A;  2Q2E A;  4I02 A;  4ETS A;  1OR7 A;  3RQ4 A;  4A3L J;  1WJD A;  2KP6 A;  1TW3 A;  1IRZ A;  3LSM A;  3KP6 A;  4I98 B;  4EM2 A;  1R49 A;  4AC0 A;  2I10 A;  3CUQ B;  3SDG A;  4PFO A;  3A01 B;  1R4N B;  4II3 A;  5EF6 A;  4JYK A;  4AU7 A;  4BKX A;  3P5J A;  2Y69 H;  5L3E A;  1YI2 I;  4LMY A;  5EYR A;  4C9Y A;  2A68 F;  2GM4 A;  1DGR M;  1KQ0 A;  3QOD A;  3K70 D;  1R5H A;  3M1C A;  3MCZ A;  5L3F A;  3HOZ J;  2XB0 X;  2IGM A;  1ZRC A;  2E5N A;  3KFW X;  3AG1 H;  2CW0 F;  3GLL A;  1Y0U A;  3BC8 A;  2QSH X;  4L0Y B;  2CSO A;  3WTV C;  3FXM A;  1X1P A;  3PSI A;  2BY0 A;  3OYA A;  2X6Y A;  1ZHF A;  1WZ2 A;  3CCL I;  1HOM A;  3HGY A;  3H36 A;  3FKI J;  1ZK8 A;  4OIQ F;  3S16 J;  1P7I A;  4X6A J;  2E71 A;  1E3O C;  1Z0X A;  4Z6Y A;  2YU9 J;  3TP3 A;  2QCO A;  4X1E A;  2FE3 A;  1U6G A;  3PIO F;  1XGS A;  3VYS B;  1FX7 A;  1X4P A;  2M0M A;  4M3G A;  2STW A;  1BOB A;  4KIB A;  1MZB A;  1MH4 A;  3CDH A;  2MH9 A;  4XLF A;  1U2W A;  2Q2E B;  3KP3 A;  3DTK A;  4RLF A;  4U0W A;  1LKX A;  2VI6 A;  2MBF A;  1MD0 A;  2WA0 A;  2K3F A;  3K70 C;  2QF7 A;  4BE2 A;  3FXQ A;  5DCM A;  2GA1 A;  1IF1 A;  4YG2 F;  4L18 B;  2FOW A;  2F5D A;  3MMY B;  1FP2 A;  4IHS A;  3BTC A;  2W1O A;  3HYI A;  2CUE A;  1MMN A;  3O2P E;  4N4N B;  3GME A;  4IHT A;  1HW5 A;  4H4K C;  3WE3 A;  1GXP A;  1Z1D A;  2M7B A;  2A69 F;  1YIT I;  1SMY F;  1YO5 C;  4HYE A;  1XGM A;  2ISY A;  2X48 A;  3RPU A;  4KA4 A;  1W0U A;  2FSW A;  4BHC A;  2LLK A;  3IH4 A;  3LA3 A;  3JRF A;  2V6E A;  1OQY A;  2KQR A;  3OYE A;  1R1U A;  2D5V A;  4IZZ A;  3M8J A;  1W7P D;  3QU3 A;  3K7A J;  3KET A;  4ENK A;  2DTR A;  5K1Y A;  1RKW A;  2EZH A;  2CRG A;  4BJ5 C;  4U87 A;  2QWW A;  2RVC A;  3K2Z A;  5L3C A;  5CLS A;  3DLL F;  4IOA F;  3KP2 A;  3OYI A;  2VL8 A;  3P9I A;  1U8R A;  2E60 A;  4DYR A;  3HOY J;  2PN6 A;  3L2U A;  1FLI A;  5E3O A;  2OC6 A;  2DFH A;  3RZD J;  2ZJR F;  2RKH A;  1STZ A;  2QVO A;  3WU2 C;  2KL4 A;  2XV4 S;  1JKQ C;  5BPD A;  5IT3 A;  1V5G A;  5FLM J;  1JGS A;  1ETY A;  2DN0 A;  2Z1D A;  1HKS A;  1ON1 A;  1TP4 A;  2BW3 A;  1AWC A;  2DFF A;  1DDN A;  5AIP A;  3H0D A;  4Y33 A;  2BEO A;  2NVU B;  3ZN0 A;  2E35 A;  4E7Z A;  2D1V A;  5CYV A;  3RPQ A;  1VTN C;  4AVZ A;  1WPK A;  4IHY A;  1OCT C;  3HSE A;  3V42 A;  2HPM A;  5D5X B;  4L0Z B;  1IN7 A;  2OAZ A;  1IN8 A;  1UEL B;  1TBX A;  3NRV A;  3T8T A;  5LGN A;  5IOZ A;  3OL3 A;  1ZQ3 P;  3GTP J;  3KLN A;  3M4O J;  3JCU C;  2IVM A;  3LQQ A;  3AKZ A;  1HW1 A;  1K4T A;  2ZSH B;  3D5S C;  1E3P A;  1IRX A;  4RGU A;  4CCN A;  2R5Y A;  3ZMV A;  1VQN I;  4UB6 C;  1BR1 A;  4B3A A; 
#chains in the Genus database with same CATH homology
 1BW5 A;  5FJ8 J;  1TWG J;  2ID6 A;  4L5E A;  4JX5 A;  2FX0 A;  1X2M A;  2L7F P;  1WH7 A;  1BA5 A;  3RQI A;  2Y9Z A;  5J1R A;  2XRL A;  3LSJ A;  5EG0 A;  2R5Z A;  3L1P A;  4FTH A;  2FQ4 A;  2DMU A;  1APL C;  1JJ8 C;  4A69 C;  2WV1 A;  2NVX J;  2E1O A;  3OSG A;  4RBO A;  2KDZ A;  3OOU A;  3HEF A;  5EEA A;  2LK2 A;  2LVS A;  1RPW A;  2GBY A;  3QPL A;  2RAE A;  3B6A A;  5GPC A;  5IYC J;  1IC8 A;  1NK3 P;  3S1M J;  4A3M J;  4XID A;  3DEW A;  2G0E A;  4AYB N;  2TRT A;  3H0G J;  3HM5 A;  1OCP A;  2LR8 A;  1AHD P;  3BTL A;  1U9O A;  1IV6 A;  1ZGW A;  1GV2 A;  1O4X A;  3GTL J;  2H1K A;  1NK2 P;  3JRI A;  2XGD A;  5IOY A;  3C2B A;  4FCY A;  1ETK A;  2DA3 A;  5FKL A;  5EZG A;  2NOG A;  2MGQ A;  1XC5 A;  5M5W J;  1LFB A;  5C4X J;  1GV5 A;  2MSY A;  1NTC A;  2R5Y B;  4CYC B;  4NDL A;  1RES A;  3LSP A;  5FKK A;  4QTR A;  2JN6 A;  3G1M A;  3Q0V A;  4BBS J;  3JRH A;  3O8G A;  1JKO C;  1WCM J;  3HOU J;  4QSH A;  2Y30 A;  5M5X J;  5EG0 B;  2R5Z B;  4BXX J;  1OFC X;  1T33 A;  2XB5 A;  2EQR A;  3Q0W A;  2NS8 A;  5IP7 J;  5FKO A;  1X58 A;  3ZQC A;  2IEK A;  3S17 J;  2W48 A;  2YS9 A;  1GVD A;  4M3E A;  5C4J J;  1F36 A;  2LY9 A;  1DU6 A;  3GTJ J;  1QRY A;  1AKH A;  1H8A C;  2CU7 A;  2XGE A;  1Q1V A;  3D1N I;  1Y1W J;  1Z77 A;  1HCR A;  4XK4 A;  3LSG A;  4IHW A;  3HOX J;  3TED A;  1UMQ A;  1JUS A;  3CQZ J;  1ZR2 A;  4V2G A;  1HDD C;  3RKQ A;  1FJL A;  3O8H A;  1HDP A;  5DTD A;  2FJ1 A;  1IG7 A;  1TWH J;  2E2H J;  2YUS A;  4MO7 A;  3FIS A;  4D7M A;  2EZL A;  3BR1 A;  2CQQ A;  1X2N A;  3Q0U A;  2DMN A;  1MBF A;  2XPU A;  2HQ5 A;  1K61 A;  2VUM J;  1VI0 A;  1JTY A;  3BQY A;  2DA5 A;  3BR3 A;  4A3D J;  2LTP A;  4DZJ A;  4BBR J;  2KT0 A;  3W6V A;  1POG A;  2NS7 A;  3BR5 A;  2LD5 A;  3ZQH A;  4M3D A;  3SJM A;  5C3E J;  2DA1 A;  1K83 J;  5M5Y J;  2XGC A;  5IYD J;  3LOC A;  2VKV A;  1JKP C;  1AKH B;  1B72 A;  1OJL A;  2HOS A;  2VKE A;  3JRD A;  2K9S A;  4ABZ A;  2XPV A;  3ZQI A;  1IDZ A;  2O8K A;  4EEF G;  1I50 J;  2TCT A;  4HNV A;  3DCF A;  1PUF A;  2OPT A;  3VPR A;  4C3I J;  1I3Q J;  3GTQ J;  4RDU A;  3S14 J;  2VPR A;  3JRA A;  2MW8 A;  1UG2 A;  3LNQ A;  3S1N J;  4DW6 A;  1ETV A;  3HBL A;  3MKL A;  2IBD A;  1U8B A;  4C3J J;  5E3N A;  2X9D A;  3BG5 A;  5DS9 A;  2O7O A;  4G12 A;  3JR9 A;  5E3M A;  2DMQ A;  3M3Y J;  4V2F A;  5M3F J;  5IP6 A;  2JA6 J;  3GTK J;  3S1Q J;  2K40 A;  5K7H A;  5HOD A;  2N8G A;  3TW7 A;  4Y52 J;  1JUP A;  1A5J A;  1MBK A;  4D5F A;  4W1U A;  2EH3 A;  1QPI A;  4I76 A;  2CQX A;  3BR2 A;  1XG1 A;  5F0F A;  2WB1 N;  1MBE A;  3TP0 A;  4XIC A;  2HOA A;  5FKN A;  3I4M J;  2DA6 A;  1B72 B;  1B8I A;  3K2A A;  3QQA A;  1WH5 A;  4DYQ A;  4XRM A;  4DYC A;  2MG4 A;  2EZK A;  1JGG A;  5GP9 A;  5EDN A;  2M8G X;  2Y31 A;  1SAN A;  2WAQ N;  1PUF B;  5EGO A;  3IV5 A;  1ORK A;  2HXI A;  3UKG A;  1MBG A;  4A93 J;  4D7N A;  2L7M P;  2HYJ A;  3OSF A;  2L0K A;  2R92 J;  1FTT A;  1MH3 A;  1JTX A;  4JX6 A;  1ENH A;  3S1R J;  1EF4 A;  2ECC A;  2DA4 A;  1MSE C;  4A3C J;  1GUU A;  3S2H J;  2R7Z J;  3CCY A;  2DMT A;  9ANT A;  3IH3 A;  3QPS A;  4B4C A;  5IP9 J;  2X6O A;  2NVY J;  2E2I J;  4MFD A;  3BQZ A;  4I6Z A;  2JMW A;  3A01 A;  1MNM C;  3CDL A;  1ZKG A;  4JP0 A;  4MFE A;  2ME0 A;  1FIP A;  5IYB J;  3PO3 J;  3WHC A;  1UHS A;  5GPA A;  3ZOB A;  5K7Z A;  1RET A;  1WGX A;  1BW6 A;  2K9Q A;  5IPA A;  5EZH A;  3S15 J;  4M6V A;  2JK3 A;  3ZQG A;  4C3H J;  3BG9 A;  1ZTR A;  4DZP A;  2R0Q C;  4B1R A;  2B63 J;  4A3B J;  2JWT A;  2HXO A;  3BR6 A;  1FEX A;  2AO9 A;  1VND A;  2DA7 A;  2L7Z A;  2L9R A;  4A3K J;  5M3M J;  5J3L A;  2EBI A;  4S0H B;  2Y0S N;  2M9H A;  5J1U A;  4IHV A;  2NVT J;  1YRN A;  1S7E A;  2M0C A;  4UUT A;  1IDY A;  5K7F A;  5JLW A;  3ZQF A;  1SFO J;  1JKR C;  5FLV A;  4A3G J;  5EGO B;  2PMZ N;  1H88 C;  4XRS G;  3HDD A;  3A02 A;  1RKT A;  4M3F A;  2NVQ J;  1IJW C;  2DTZ A;  4A3L J;  1F43 A;  1LE8 A;  4GFB A;  1QVT A;  3BR0 A;  1IRZ A;  2COB A;  1QVU A;  3BT9 A;  3HOW J;  2DJN A;  1JT0 A;  4AC0 A;  2I10 A;  2ID3 A;  4J19 A;  3SDG A;  1XS9 A;  4MLO A;  3A01 B;  1CQT A;  1Y1V J;  1ETX A;  4JYK A;  4BKX A;  5EF6 A;  4FE7 A;  5EYR A;  3F0C A;  4FIS A;  4A3J J;  3G1O A;  2GM4 A;  4CYC A;  5F08 A;  4JX4 A;  3MN2 A;  3HOZ J;  2XB0 X;  1HF0 A;  3G1L A;  1TWC J;  2DMP A;  3JRB A;  2JA5 J;  2ZB9 A;  5F04 A;  2JA8 J;  5F0H A;  4A3E J;  1HOM A;  1WI3 A;  3HGY A;  3IH2 A;  1YRN B;  3FKI J;  1ZK8 A;  2OF7 A;  3GBG A;  3S16 J;  3BTI A;  1P7I A;  4X6A J;  1E3O C;  1TWF J;  1Z0X A;  2Y2Z A;  2HI3 A;  3HB9 A;  4M3B A;  2YU9 J;  3TP3 A;  3GTO J;  2QCO A;  5C44 J;  4X1E A;  1BL0 A;  1D5Y A;  2H8R A;  3GTG J;  4LOC A;  1ETW A;  4M3G A;  4A3F J;  1MH4 A;  1AU7 A;  2E19 A;  1GDT A;  2ELK A;  4MIM A;  2HDD A;  4BY7 J;  1LE8 B;  1TC3 C;  1T56 A;  2VI6 A;  5BNG A;  3Q3S A;  2FD5 A;  2QF7 A;  1IUF A;  2JA7 J;  4IHX A;  3SFI A;  2GLO A;  1U9N A;  2LKX A;  4UUS A;  1LFU P;  1VF9 A;  3JRE A;  3B6C A;  3BTC A;  2CUE A;  2JJ7 A;  3JRC A;  1MBJ A;  2XSD C;  2K9N A;  3ZQL A;  3S2D J;  2LP0 A;  4A3I J;  1U78 A;  2R93 J;  1R9T J;  5FKM A;  2X48 A;  4XRS A;  1W0U A;  2LLK A;  2M2E A;  3IH4 A;  3JRF A;  1H89 C;  4Y7N J;  2D5V A;  1ETQ A;  3WHB A;  3OIO A;  3K7A J;  4QIW N;  1RKW A;  2EZH A;  2CRG A;  5F1J A;  3E7L A;  1TWA J;  2Y9Y A;  1DU0 A;  1GT0 C;  1JUM A;  3FK7 A;  4D5C A;  5F0C A;  2AHQ A;  1W0T A;  2XPW A;  3JRG A;  2IAI A;  4IEJ A;  1A6I A;  4DYR A;  3HOY J;  1MBH A;  4FE4 A;  1HLV A;  5E3O A;  3NAR A;  5E3L A;  3RZD J;  3FK6 A;  1IGN A;  1JKQ C;  1ETO A;  3BTJ A;  5FLM J;  1ETY A;  1VFC A;  2CUF A;  1BJZ A;  2ME6 A;  1B8I B;  1MSF C;  4W97 A;  2DN0 A;  2ECB A;  1I6H J;  5F27 A;  2P81 A;  3TW6 A;  3A03 A;  1RR7 A;  4UUS B;  2DA2 A;  1ITY A;  5JLX A;  1JJ6 C;  3I4N J;  1FTZ A;  5J1Y A;  4IHY A;  1WPK A;  2O9L A;  1OCT C;  2EZI A;  3PO2 J;  3FIW A;  3HOV J;  4BY1 J;  3HGG A;  1P7J A;  2CJJ A;  2LFB A;  3MVP A;  2HOT A;  5IOZ A;  1ZQ3 P;  3GTP J;  3CMY A;  3GTM J;  3M4O J;  4AUX A;  2E2J J;  3PM1 A;  3RZO J;  2M34 A;  3LSR A;  3NAU A;  3BG3 A;  1FIA A;  1ZR4 A;  1JT6 A;  2R5Y A;  3HKZ N;  3H3V K;  1G2H A;  4C2M J;  4B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...