3HOXJ

Complete rna polymerase ii elongation complex v
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hoxJ00
5IYCJ 2VUMJ 1IUFA 1FTZA 1GT0C 3Q0UA 5J3LA 1MSFC 2ID3A 1LE8B 2DA6A 1AKHB 3BTJA 4NDLA 2DA4A 1MH3A 1B8IA 2OPTA 2E2JJ 3ZQHA 1OCTC 4IHWA 2DA7A 2WB1N 5FLMJ 2Y31A 4Y52J 1FIAA 4M3DA 1ETVA 1MBHA 5EG0B 1LE8A 1AKHA 2R7ZJ 3BR5A 5DTDA 3BQYA 4C2MJ 5F27A 2VKVA 2XGDA 2CU7A 2E2HJ 3G1MA 1JKPC 1TWAJ 2M2EA 1B72B 3MN2A 1BL0A 1BW5A 2HXIA 3GTOJ 3GTMJ 4HNVA 5EG0A 2RAEA 5IYBJ 3TEDA 3TW7A 3H3VK 2JA7J 4M3GA 4C3IJ 1B72A 4A93J 4DYQA 5GP9A 3GTLJ 1JUSA 3HBLA 2P81A 4V2GA 3S1QJ 1QVUA 2Y9YA 3HOUJ 3RQIA 1X2NA 2LFBA 3IH4A 4QIWN 4I6ZA 3BTCA 3HKZN 1ETKA 2LR8A 2E1OA 2EH3A 3JRFA 2WAQN 2CQXA 1RR7A 1HDDC 1IDYA 4B4CA 3BQZA 4MFDA 1U78A 4A3EJ 2CQQA 3M3YJ 2ZB9A 5GPCA 3JREA 4IHXA 4JYKA 4GFBA 3CCYA 3FIWA 5F0CA 3RKQA 1ZTRA 1E3OC 4B1RA 2ECBA 3S15J 3S1MJ 3BR0A 2E19A 1IGNA 1OJLA 1APLC 3BR6A 5EF6A 4D7MA 5F08A 4IHYA 2AO9A 2L9RA 5K7FA 3LSRA 1WCMJ 3BT9A 2R0QC 3ZQLA 1MSEC 2XGCA 3GTPJ 1X2MA 3Q0VA 2H1KA 2JA6J 4IHVA 1XC5A 2LLKA 1CQTA 2R5ZB 4ABZA 9ANTA 2OF7A 4M3BA 1GV5A 2N8GA 4W97A 1T56A 5FKNA 5EZGA 4A3BJ 3OSFA 1U8BA 4JX6A 2M0CA 1Z77A 1MBFA 2H8RA 4XIDA 2M34A 2R5ZA 3S16J 1NTCA 3JRDA 1F36A 1GVDA 2XB5A 1BJZA 2PMZN 3WHCA 2NVYJ 1TWGJ 1LFUP 1A6IA 2YU9J 5FKMA 4FE4A 1SANA 2EZIA 3O8GA 3CQZJ 1IG7A 1XG1A 4A3JJ 1ZR4A 5E3OA 3FKIJ 3WHBA 3HOWJ 1FIPA 1ZGWA 1JKOC 2GBYA 3QPLA 2O9LA 2JA5J 1OFCX 2JA8J 3IH2A 2XB0X 3GTGJ 2CUFA 5C44J 3LSPA 3B6CA 4UUSB 1TWHJ 5IP7J 3SDGA 1Z0XA 2NVTJ 3W6VA 4EEFG 1H89C 3JRGA 3BG5A 2ME0A 4A3LJ 1SFOJ 4QSHA 3LOCA 4LOCA 1ETWA 1RPWA 2DJNA 4D5FA 3FK6A 1ETOA 4DZPA 3F0CA 3HEFA 1ENHA 4XRSG 2MG4A 5M5WJ 4FTHA 1MBJA 2LD5A 3LSGA 4MFEA 2FJ1A 1I50J 1FEXA 4V2FA 1D5YA 3K2AA 2LVSA 2XPUA 1JKRC 3MKLA 2DN0A 2M9HA 1HCRA 1MBKA 3S1RJ 5JLXA 3CMYA 1MNMC 5EYRA 2NS8A 5F0HA 3JRIA 2NVQJ 3DCFA 1VF9A 2Y0SN 4JX4A 3S14J 3UKGA 1I3QJ 3LSJA 5K7ZA 1H8AC 3I4NJ 2HOSA 4D5CA 1ORKA 1IJWC 2YUSA 3HDDA 2TRTA 3BR3A 2ECCA 3E7LA 3RZDJ 2B63J 4G12A 2M8GX 1TWFJ 5EGOB 2MGQA 1P7JA 3BR1A 3K7AJ 5J1UA 5IPAA 4DYRA 1MBGA 2NOGA 2XRLA 1MH4A 2DTZA 1A5JA 4Y7NJ 5IP9J 1UHSA 3PO3J 3A01A 4AYBN 5F04A 1ZR2A 4A3CJ 1GUUA 3JRHA 2DMPA 1AHDP 5BNGA 1WGXA 2GM4A 3ZQIA 5J1RA 2ELKA 5IOYA 1RKTA 2DMTA 5M3FJ 1HF0A 3O8HA 2COBA 3ZQFA 1U9NA 3FK7A 3A02A 2EBIA 3OOUA 4XRMA 1WH5A 2KDZA 2K9QA 3JRCA 3FISA 1F43A 3HGGA 1GDTA 1NK3P 4MO7A 3VPRA 1BW6A 2DMNA 2G0EA 3HGYA 1BA5A 1AU7A 1W0TA 5IYDJ 2MSYA 1NK2P 5FKKA 3HOYJ 4BKXA 3HOZJ 3BR2A 3CDLA 4BY7J 1Q1VA 4XRSA 2JN6A 3JRAA 4UUTA 2K9NA 1YRNB 2WV1A 4M3FA 4BBSJ 4FISA 2GLOA 3QPSA 1ETYA 4MLOA 5FJ8J 3ZQGA 2CJJA 1GV2A 2HQ5A 2KT0A 3IH3A 2DA2A 3HM5A 4A3GJ 2I10A 2ID6A 1LFBA 1YRNA 3JR9A 2FX0A 3GBGA 2E2IJ 4MIMA 1FTTA 5DS9A 4DW6A 4XK4A 2R5YB 1ZK8A 3TW6A 2IBDA 2LTPA 3S2DJ 2JWTA 4D7NA 5C4JJ 4XICA 1XS9A 2DA3A 4A3FJ 3GTKJ 5E3MA 4CYCB 1ETXA 5HODA 3G1LA 2MW8A 2EZHA 1JTYA 4L5EA 2DMQA 1QRYA 5EDNA 1TC3C 2NVXJ 4X6AJ 2W48A 2R92J 3PM1A 4B3AA 1U9OA 4UUSA 4A3MJ 1I6HJ 1Y1WJ 2LY9A 2VI6A 2HOTA 1JJ8C 1B8IB 1UG2A 3H0GJ 5C3EJ 3ZQCA 1JTXA 4FE7A 3OSGA 5E3LA 1RESA 4BXXJ 1JJ6C 1G2HA 3GTJJ 1ITYA 1S7EA 1JUMA 3NARA 5IOZA 5F1JA 2D5VA 1TWCJ 3Q0WA 1IRZA 2L7FP 2L7ZA 3DEWA 1R9TJ 1ETQA 2R93J 2IEKA 1WPKA 2LK2A 2XGEA 4M3EA 4FCYA 4J19A 3S2HJ 4QTRA 4IEJA 2DA5A 5M5XJ 3TP0A 1EF4A 4RDUA 3NAUA 2EQRA 2HYJA 3D1NI 2LP0A 1JGGA 3SFIA 4A3KJ 4C3HJ 2HXOA 4A3IJ 1RETA 4X1EA 1IV6A 1HOMA 4DYCA 4M6VA 3GTQJ 5JLWA 2X9DA 3G1OA 3L1PA 3B6AA 3BG9A 2HDDA 1PUFB 1T33A 1POGA 5EGOA 4AC0A 1K83J 1IC8A 3HOVJ 2YS9A 2Y9ZA 1JT0A 1UMQA 2QF7A 3ZOBA 1VFCA 5K7HA 1VI0A 1DU6A 1PUFA 3RZOJ 5C4XJ 3BTIA 2NS7A 1IDZA 2CUEA 2JK3A 1W0UA 4C3JJ 3BG3A 2VKEA 2X6OA 3QQAA 3OIOA 1FJLA 2HI3A 5M5YJ 1RKWA 5F0FA 2K40A 1JT6A 2LKXA 2X48A 1WI3A 4BBRJ 2IAIA 2TCTA 4W1UA 5FKLA 2JMWA 5J1YA 3M4OJ 2FQ4A 5FKOA 4JP0A 2EZLA 2L0KA 4S0HB 2EZKA 2VPRA 1O4XA 1K61A 5GPAA 5M3MJ 3A03A 3S17J 4A69C 1HDPA 3IV5A 2Y2ZA 1HLVA 1QVTA 5E3NA 3HOXJ 2XPVA 4BY1J 3C2BA 2XPWA 1P7IA 1JUPA 3PO2J 1WH7A 1OCPA 5FLVA 2DA1A 1H88C 2O8KA 5EZHA 2DMUA 4A3DJ 2Y30A 1DU0A 3MVPA 4I76A 2XSDC 3I4MJ 3SJMA 4AUXA 2QCOA 4DZJA 2CRGA 2O7OA 1ZQ3P 1JKQC 5IP6A 1VNDA 2HOAA 2JJ7A 3A01B 3JRBA 3TP3A 2R5YA 3BTLA 4JX5A 2FD5A 5EEAA 1QPIA 3S1NJ 1MBEA 4CYCA 1X58A 1ZKGA 1Y1VJ 2K9SA 2ME6A 4RBOA 3LNQA 2AHQA 2L7MP 3HB9A 3Q3SA
chains in the Genus database with same CATH superfamily
4HG2A 2VUMJ 4O6JA 2E60A 2VT2A 2V1UA 3X2QH 1H9TA 5J3LA 2DT5A 2BW3A 2DA6A 3BTJA 4ZTJA 1YW8A 4BYYA 1AA7A 1B8IA 1MH3A 3PIPF 2OPTA 4OINF 4N9HA 1YLFA 2WB1N 1F9NA 4EJUA 2G7UA 4M3DA 3CJTB 1NHAA 4XKCA 1A6QA 4F3QA 3IRRA 2KIQA 5LGTA 3BQYA 4HDUA 1YE9A 2ZO4A 2VKVA 1PP8F 2STTA 1P9QC 3MN2A 1LFPA 4ZYHA 2EFQA 4OIRF 3F22A 2DXIA 4IHTA 5IYBJ 3TW7A 1S7AA 3H3VK 1XX5A 2VXDA 3QYFA 5CYVA 3QP6A 3F9KA 3MZ8A 2VBZA 3E6CC 2FNPA 2QSHX 2YX4A 2OV7A 1U0JA 3S1QJ 3MQ0A 2EB7A 3SXYA 4PJ0C 4AIDA 1HBXG 3RQIA 1X2NA 2LFBA 1J59A 2W4SA 5E8GA 3PJRA 1SFUA 3KYDB 1S7OA 1X1BA 1G6NA 2FBKA 1TT5B 3E6MA 4YG2F 3PUFA 2EH3A 3JAMK 4HA8A 1Z7UA 3S32A 1X4OA 1HDDC 3HL2A 4B4CA 3BQZA 2DOEA 2M1BA 2WY7Q 2DT7B 4A3EJ 4L9VA 5BS6A 1YJWI 5H2FC 3FIWA 1ZRCA 2E71A 3HRUA 2V9PA 1YJ9I 1OJLA 1Z3YA 1APLC 1SAXA 3PQKA 4DIQA 2OD5A 3GW2A 2BVLA 2VB6A 5D5UB 1X2MA 2KJCA 2X6YA 3MKWB 3CC2I 2JA6J 3GFLA 4IHVA 4P96A 2EIKH 2F4IA 1JGSA 1QU3A 1S6LA 4M3BA 1GV5A 1S3JA 2N8GA 1DPRA 4IO9F 3NQOA 3SQNA 3OSFA 2ADUA 2AQEA 2OQRA 3F8NA 4JX6A 2M0CA 1Z77A 1MBFA 2PJRB 3JRDA 4N4OB 1LVKA 1F36A 1GVDA 2XB5A 1BJZA 5A2QZ 5E1ZB 3DU5A 5D4RA 2JUGA 2MBFA 2NVYJ 1LFUP 1A6IA 4MTEA 2WV0A 3FXMA 1EH7A 2PJRA 2ZMEB 4RB2C 5FKMA 3DPUA 1VZ0A 3K2ZA 3O8GA 3CQZJ 2BBYA 1IG7A 1XG1A 3PSIA 1VQLI 3KE2A 2R7WA 1ZR4A 3GXOA 4GCVA 2KRHA 1OR7A 2RNGA 2DU9A 3F6VA 3IAS2 1R58A 2ZMEA 4ZDPA 5FB2A 1IN6A 4ESBA 1ZGWA 2BOLA 1F1ZA 2E7WA 4G8XA 4CH7A 2JA5J 1VQNI 3LA2A 3HSEA 2QKLB 3DWLE 1S29A 1NH3A 1FT9A 4XLNF 5LBQA 2DO7A 3V7CA 1WRJA 3NWTA 2CUFA 1HKQA 4ZYDA 3I9V2 5C44J 3WU1B 2DI3A 3FMQA 3LSPA 4H0EA 4HPQA 1SC7A 3HHGA 4ENJA 3VEPA 1X3ZB 5KHDA 3BROA 5CKTA 3JRGA 2OU2A 3T0YA 2I8DA 4QSHA 4L9JA 1Z6RA 2A68F 4U0YA 1O7LA 3KEYA 4UNOA 1ETWA 3HRMA 2XAFA 2UUZA 1RPWA 4PSWA 3J7AY 2DJNA 1R5HA 1IF1A 5A2QK 2W1OA 4XRSG 4LB6B 1K6OA 3LFUA 3KEQA 5D5WB 2KPMA 2IP2A 1WJEA 4YIIA 2LD5A 4BAYA 1LUJB 3I3LA 5ILSA 4HDVA 1D0YA 2XPUA 2V1NA 1OYWA 4XLHA 2CS3A 4DGWB 5DD4A 3CMYA 3OL4A 1MNMC 1WQ2A 3JRIA 3ECOA 2DFFA 2L3DA 2BY2A 2VQGA 2PJPA 3F72A 2HOSA 4D5CA 1PYVA 1ORKA 3CP2A 3HDDA 3E7LA 1MNDA 3BLYA 1NG6A 3HUGB 3Q9VA 3ASNH 3MD2A 3HSRA 5EGOB 2A61A 1O3TA 2MGQA 5J1UA 4UV8A 1A31A 5FO5A 4JBAA 5BPDA 5IPAA 3BY6A 4DYRA 3E5UA 3RI4A 3IKTA 4HQMA 1A04A 2PQ8A 1N25A 2DTZA 3HUGA 1A5JA 1FP2A 3KP5A 2QBYB 5F1RA 2JPBA 1S9HA 2L2OA 2CW7A 1R5GA 3HC7A 2ESHA 2E1CA 4HX8A 3CUQB 3PIOF 1GUUA 3DU6A 2L5QA 3DBHB 1I39A 2RGVA 5BNGA 1WKMA 4I99C 1W7PB 2P5VA 1Y39A 2ELKA 4KFCA 4YFXF 1RKTA 1J0RA 2XASA 3CUQA 4XOPA 4JOMA 3ASOH 2COBA 3M8JA 1QBJA 2DFEA 1W7PA 2HYGD 5J8CA 2VODA 2WC2A 1J09A 1WH5A 2KDZA 4OAZA 5FD6A 5HS9A 2HR3A 1OQYA 3E6BA 4AVZA 1F43A 4IZZA 3W2AA 3HGGA 1GDTA 2GOMA 1RNLA 3TO9A 3CJRB 3BG6A 1SEUA 1AU7A 3EUAA 1K7AA 2E36A 4HRIA 2DFIA 3VSKA 1FYKA 1I27A 2HS5A 4XRSA 1EH8A 1XGOA 4DJAA 2ACJA 2CGPA 4BBSJ 2GLOA 3OIPA 1I1SA 1ETYA 3CLQA 2D1HA 2XUBA 5HOOA 2KT0A 3G4SI 2DA2A 4RLQA 4IQJA 4A3GJ 2I10A 4GRIA 4KIGA 1U5TB 1R00A 2Y69H 3L2QA 5CVVA 4X0GA 4LK1F 1HQCA 4MIMA 4BEHB 4DW6A 1OCOH 3TW6A 2EJRA 4UHTA 1TZLA 2BHZA 1XPXA 3J80K 5D5XB 3GTKJ 4GYIA 5BPIA 4KDPA 5HODA 3G1LA 2ZXIA 2EZHA 2RNJA 3DBRB 1T39A 2O3FA 5L3BA 4NUBA 5FD5A 1U9OA 2ZCWA 2R7SA 2M8EA 1YHQI 2HVRA 2BEOA 2W57A 3FDYA 2HGCA 5E79C 2VI6A 2L4MA 1ON1A 2AXLA 3ZMUA 3H0GJ 2VASA 1JTXA 4FE7A 1Z91A 1WI9A 1RESA 2NOJB 2Q8KA 1JJ6C 3FHNA 3GTJJ 1J2XA 5J6XA 2YPRA 5CQEA 2EFWA 2CV2A 1RZ4A 1W7PD 2L7ZA 4R8HA 1OR7C 5HLTA 1R9TJ 1ETQA 1TLHB 2V9VA 2R7QA 3ZMDA 4KYWA 2XGEA 4OOIA 3FMSA 3S2HJ 4IEJA 4Q5SF 3H3ZA 2HTSA 1X1DA 2KZVA 1EF4A 3NAUA 3M7GA 4CHUA 1G3WA 2HYJA 2F5CA 2H6BA 2LP0A 3QU6A 1ZHFA 3SFIA 3VDXA 4XQFA 2VJ5A 4C3HJ 1LPQA 1JHHA 2WB1A 2L01A 3F23A 3K4LA 5CVRA 4X1EA 1I5ZA 3IC7A 1G3TA 4DYCA 3JCUC 1ZRFA 2MH9A 1ACIA 3IP4B 4WXDA 2X9DA 2LC2A 4GO1A 4CCOA 4UVCA 3B6AA 4HV6A 3BG9A 1PUFB 2EK5A 4B09A 4EV0A 3HRSA 1KZHA 4OIPF 2RV8A 2H1LA 2XC7A 4HX4A 1KQ0A 1VI0A 2JUCA 2Q2EB 5DD8A 1PUFA 1J7KA 3ERED 5DYMA 4MNUA 2KISA 3M07A 2NS7A 3K6GA 3W2VA 1IXSB 2CUEA 4LJZF 3FM5A 1W0UA 2Q2EA 1IXRC 3DXJF 3BG3A 4L0YB 2UWMA 4B8XA 3L2CA 2FQ3A 4XONA 3GX4X 2FBIA 4EJTA 5D5VB 1MDMB 1V4RA 1RKWA 5F0FA 4M6YA 4XR6A 3K69A 3UNGC 4HQEA 3OYCA 2BHYA 2K40A 1XD7A 2IS2A 3HRTA 5B1AH 3I71A 5DCMB 4BBRJ 1O3QA 4BNCA 2KLOA 4W1UA 3EUHA 1IO2A 3M4OJ 2XF5A 4PJLA 2EZKA 2VPRA 1YG2A 5GPAA 1FBQA 1R6RA 4ANJA 4NHJA 3IV5A 2Y2ZA 4RS8A 3CZ6A 3HOXJ 1P4AA 3I58A 3C2BA 4UV9A 4V19K 2ZC2A 1P7IA 1JUPA 3PUBA 5FLVA 2DA1A 1H88C 1R71A 1OPCA 1SD4A 4A3DJ 2IGOA 2Y30A 1DU0A 4AD9A 2OJED 2K86A 1VTNC 2AXTC 5TGTA 3SZTA 4F92B 3OYKA 3BCBA 5CPRB 4NC8A 3ZMTA 2MD0A 2K85A 2XIGA 3RDIA 1HKSA 1T2KA 3F8CA 1X19A 1R36A 3BTLA 4PJMA 1EA3A 1FX7A 5HVQC 2FD5A 5FLXZ 4E6KG 4CYCA 1X58A 1R23A 1ZKGA 3SEQA 4RBOA 3LNQA 3FF5A 3WGGA 2M30A 2JPCA 2OCCH 3Q3SA 5IYCJ 2ZFUA 1WJFA 3CDIA 2GXAA 1FTZA 2AQFA 3E6DA 1MIJA 3Q0UA 3ULQB 1D1AA 2HVQA 2IW5A 2E2JJ 4EGZA 3ZQHA 5HDKA 1OCTC 4IHWA 3DKWA 1GHCA 2Z3YA 3S93A 2GOXB 1FIAA 2FE3A 3CF5F 2V7FA 4A6EA 4U7BA 5EG0B 1SMYF 1IUYA 3MKZA 3FXLA 2XAHA 5HNFA 2CU7A 1JKPC 2M2EA 2P5LC 1BC7C 3GTMJ 1WJCA 5EG0A 2LSOA 3VSLA 1ZGAA 2H27A 3KP4A 3OOPA 4I7HA 3HHHA 2COMA 3ZCOA 4BQAA 2M3AA 2JA7J 2GQQA 3DKXA 5LFAA 2RREA 4L18B 4UXNA 4DYQA 3GLLA 2VQLA 2ZXHA 3F6OA 1X3UA 3HOUJ 4OWRB 5LGUA 1K4TA 1FBSA 2DFHA 3IH4A 3BTCA 2DOAA 5LLQA 1XN7A 2R7UA 2LR8A 2E1OA 1J5YA 4HEA2 5ILUA 2IT0A 2VJ4A 4PZJA 1TQMA 4A0YA 1IDYA 3G73A 4UUVA 5JHUA 3TOBA 1U3EM 4BQNA 2R4GA 1Z21A 2KP6A 3JREA 2NXNB 3CCJI 2B7EA 2IGMA 3CCEI 1XSDA 3RKQA 4XLEA 3NRVA 3LSMA 3TL4X 4B1RA 2ECBA 2R7VA 3S15J 2X6XA 4CUGA 3G6EI 1XDUA 4ZC3A 5EF6A 3OYIA 4IHYA 3K9TA 3C2HA 4MEXF 3LSRA 3ZQLA 1WCMJ 3BT9A 3GTPJ 2E1MC 4R1HA 3K4JA 2P0WA 3EYYA 1SVLA 3RCOA 4UB8C 4ZJZA 2WBMA 2LLKA 1BR2A 1CQTA 4ABZA 2EFOA 4IOCF 3FXJA 1UHMA 3I54A 1O57A 2PMUA 1T56A 4EJOA 5JR3A 1IAWA 5D4SA 1U8BA 4I01A 1IXCA 2H8RA 4XIDA 2M34A 1BI3A 3K4CA 3S3OA 5FRMA 3WHCA 3ZMVA 4KJZA 2DOFA 1W4MA 3CCVI 1X1PA 2A69F 2E34A 2L9NA 3EETA 5KK1A 4WK8F 2BYVE 2L02A 2P6SA 2XKPA 3GYHX 3DTKA 4FE4A 1SANA 3E1SA 4MEYF 3K4MA 1TW3A 3IL2A 1IV8A 2D2WA 3AL0C 4WXCA 3JW4A 3QAHA 3U2RA 4Z6YA 2O61A 4B44A 4G6QA 1JKOC 2GBYA 2K7LA 1B6AA 2JA8J 4F91B 2QKMB 2E5ZA 4BHBA 4AU7A 2F4MB 1MJAA 5E1XA 3PSFA 4DBQA 3B6CA 2WADA 1FMVA 4HX7A 3BZKA 4BH9A 2P6TA 1YIJI 4EMSA 2OTLI 2FNAA 4HYEA 5FROA 1FOXA 2HVSA 4A3LJ 4F7ZA 4H4KC 3WTSC 2CW0F 5E20A 4D5FA 3RSNA 1OKRA 3OYEA 4XM3A 2F6CA 1ENHA 1SD5A 2MG4A 2QQ8A 1WZ2A 2C6YA 3KP2A 1KQ9A 3QODA 2HDCA 2D45A 3LSGA 4MFEA 4AIKA 2FJ1A 2DK5A 4XNFA 3I64A 1JKRC 3MKLA 3RPQA 3LQQA 5GADJ 3WG9A 1MBKA 1HSTA 4HAMA 2QUFA 2K4JA 2LY1A 4KMFA 3TGNA 3QRFF 3L9FA 3PFIA 4L0ZB 5EYRA 3ZQQA 3TDUC 2Y0SN 4BXUA 1VQ7I 4JX4A 3S8PA 4LD5A 4WXHA 2DTRA 3I4NJ 5HS8A 2DDAA 2FMLA 3BR3A 2ECCA 1RIOH 2J5OA 2W25A 2V1XA 4FX0A 4DNCA 3E0JB 2M7BA 2M8GX 3AFHA 3PL8A 3QYBA 1TWFJ 1RUNA 4J01A 4XBFA 3KPHA 2OA4A 2DAOA 1IN8A 2NOGA 1FZPB 2XRLA 1J75A 1MH4A 1ZH5A 2HZTA 4XL9A 3PO3J 2L54A 4IJAA 1TBXA 1EJ9A 2QEXI 4BE2A 3AG3H 5HLIA 1MGTA 1E17A 1X1AA 2GA2A 5EEHA 3KP7A 3RPUD 2GM4A 3OMYA 2VXZA 2VONA 3OV8A 2XHKA 5HLGA 2LG4A 4DOZA 1I6XA 1ON2A 3ZQFA 1VQMI 1YS6A 1GVJA 2DCEA 1K6YA 2CSOA 3A02A 2EBIA 3OOUA 1TW2A 1FOYA 3PFYA 2K9QA 2RQPA 3K70C 4XLFA 3FISA 3AG1H 5LHHA 2PI0A 2LKSA 5K5RA 2O6GE 1NK3P 4MO7A 1BW6A 5J40A 1CF7B 1BA5A 2MSYA 1PP7U 2GAUA 4B47A 4E70A 3HOSA 3QYEA 1W5TA 3CDLA 4HLYA 2E35A 3PNYA 1D8KA 2JN6A 4ZH4F 3JRAA 4UUTA 1CF7A 2K9NA 2MFZA 2OBPA 4RB0A 3G71I 4M3FA 3G2BA 4FISA 3QPSA 3BJAA 4MLOA 5DM6F 2CJJA 1GV2A 3KEOA 3IH3A 5K5QA 2CQNA 4PFOA 3LL7A 5J4VA 1QGPA 2ID6A 1LFBA 3JR9A 2IGNA 3GBGA 5LHIA 5H20A 4BQQA 1R22A 3TOAA 1FTTA 3GLXA 2RDPA 5DS9A 3Q5FA 2VBXA 2PEXA 2JWTA 3KETA 3DP7A 4U0VA 1XS9A 2IS4A 1JHFA 1U2WA 2UXXA 2X1EA 3BPVA 3FXQA 3I59B 3K10A 4B48A 3JSPA 1Z9CA 1JTYA 4PGGA 1QRYA 2W48A 1VQKI 4XMYA 3PM1A 4QWQA 4B3AA 1Z05A 2R7FA 4XLAA 1DDNA 1I6HJ 3I59A 1VQ5I 2EIJH 2LY9A 1DPUA 4ESJA 4BQOA 3ABLH 1UG2A 1VQPI 2QQAA 3HPHA 2BY1A 3OWTA 3OSGA 1IN5A 2V26A 3WTXC 3ELKA 1WWXA 5E3LA 3ML6A 2XAJA 1QZEA 2JA2A 2L4AA 2HKOA 2D5VA 4FQGA 2IJLA 5L3DA 1IRZA 2PMHA 2P7VB 2CFXA 3DEWA 3U9GA 3U1KA 4OU0A 2P7CB 2R93J 2IEKA 2W24A 3DTEA 4LIUA 1SVOA 4FCYA 4J19A 5AIQA 3OYNA 2P5KA 3BOQA 3ONQA 3S3MA 2CUJA 3DEEA 2E1NA 4RDUA 2EQRA 1ZGJA 4U87A 3ERMA 3CCUI 3GF2A 2HPMA 4RAZA 2GXBA 3K4BA 1EH6A 4A3KJ 4Y13A 4CICA 1C0WA 2KRCA 4I0AA 4XOTA 2A3SA 1HW2A 2FSWA 2IS6A 1QHHD 1RETA 5HS7A 1GXPA 3DEUA 4KNYA 1ODDA 5JLWA 3G1OA 3BZ6A 3L1PA 3CJQB 4CDGA 2J5PA 2V6CA 2HDDA 2XF6A 1LDDA 5EGOA 3MAJA 3RTRA 1P92A 5J47A 2YS9A 3HOVJ 3TBIA 1ZG5A 4IL6C 2Y9ZA 3ZOBA 1S8NA 4E7HA 5K7HA 2RVCA 1G4DA 1DU6A 2H6CA 4HSTA 2QBYA 1YTYA 1IZ1A 1MD0A 5C4XJ 1ONVA 1STZA 3BTIA 3KCCA 1BBYA 1JXSA 2JK3A 3WODF 3WTWC 2XAUA 2ZNZA 4KIBA 3W3CA 4RB1A 4B43A 1USTA 4LLLA 3HTSB 3I0TA 3QQAA 3OIOA 3P7NA 1FJLA 1WFXA 5M5YJ 1GLNA 2GIVA 2ZSHB 1K79A 2I5UA 3IUOA 1A36A 4HNUA 2JTVA 1VQ4I 4WWCA 3WTUC 4KISA 3V4GA 4F52A 2LRDA 3S3NA 3VWBA 1OYYA 2TCTA 4PUSA 3SEZA 3OYDA 1V5EA 2ISZA 3CUOA 3FM3A 3Q9SA 4HBLA 5L3GA 4DBRA 1O4XA 4BU2A 3A03A 4I2OA 4ZYEA 3K1MA 4GYGA 2ZNYA 3U1DA 1HLVA 2ZFWA 3OYBA 2PG4A 5CVIA 1YOVB 4KUMA 3W6KB 5E3NA 2DBBA 2E7XA 3WU0A 1XTAA 3PO2J 1WH7A 3L09A 2MABA 4OMZA 4HSRA 3MVPA 2EWNA 2XSDC 4OMYA 2ISYA 3DFGA 4CCJA 3KFWX 3LWFA 3HSFA 5KAFC 1S72I 4A12A 2WAEA 3WE3A 4MHGA 1K78B 2O7OA 1BIAA 2K3FA 1FBUA 3CESA 3H92A 5IP6A 1U5TA 2LOOA 2ZBKA 1Z3XA 1FYMA 2H09A 3UR3C 4EM0B 4YIFA 2K3PA 4MQVA 1MMGA 3LSHA 3QWLA 3W6JB 3M1CA 3WTZA 4BEHA 3L2VA 1H0MA 1MJBA 2Z99A 2VLAA 3TP3A 3BPXA 2QSGX 3DLLF 5HDNA 1UFMA 1K78A 1Z1DA 4JX5A 4A0XA 3HJEA 3T1BA 2VBWA 2ME6A 3JSOA 5ICEA 2IGKA 2NAZA 2AHQA 4N0BA 2LMDA 5TJJA 1LJ9A 3HB9A 5JFRA 2XRNA 3WE2A 2FOWA 1IUFA 1T95A 3W2WA 2UXNA 4ITVA 2GWRA 5B1BH 4CCKA 1MSFC 3TO6A 3LSIA 1REPC 1AKHB 3KX2A 3RKYA 1WJDA 4NDLA 3P9IA 1R4NB 2QZ8A 1SMTA 1XSXA 2DA7A 1OCRH 1ETVA 2ZMEC 1MBHA 1WJ5A 4BJ5C 1YS7A 1AKHA 3BR5A 2X85A 5DTDA 3I53A 2H94A 2KHMA 3N97A 3BCAA 2GIZA 1FOWA 2XGDA 1ZELA 2CV0A 3EYIA 2E2HJ 3G1MA 1YW9A 2GA1A 1P6RA 3HIFA 4O3MA 1BW5A 1YW7A 1Y8RB 1KYZA 3TMOA 4HNVA 2HWVA 4RMNA 1W5CC 2DPDA 1SFXA 3TEDA 4IOAF 2Z1DA 3O6BB 2FBHA 1DUXC 4Y4RA 4M3GA 4C3IJ 4ZTFA 3JTHA 3IWZA 3LSTA 3I5UA 5GP9A 3LMMA 4QLCU 3GTLJ 3AKZA 1FSEA 4V2GA 3EUKL 3C2GA 3CC7I 2D1VA 2Y9YA 1TNTA 5DUKA 2MD5A 3C7JA 2LF7A 4RGXA 3H9JA 1SFKA 2EA2A 2KIMA 2NNNA 5H6RA 2Q1ZB 5IT9Z 2K9LA 2Z5UA 1HXDA 3JRFA 2PLYA 2CQXA 3M9AA 1RR7A 4BS9A 2CO5A 2Y0SA 3WTTC 1KU3A 3FXKA 3VOEA 1U78A 2CQQA 3M3YJ 1UB9A 4II2A 5GPCA 3LAJA 4IHXA 4M6XA 4BL0B 1WSUA 1LB2A 3CCYA 1ZTRA 3JTGA 1QO0D 4BJTA 3ZRGA 3BR0A 2E19A 3H9GA 3VYUB 4HNTA 3M1EA 3ABUA 5F08A 2L9RA 5K7FA 4R79A 2R0QC 5BQTA 1MSEC 2HQRA 2ESNA 2FEZA 4KA4A 1MDMA 1V3FA 3H9QA 2ZJPF 1F4KA 1BR1A 2RQQA 4G7OF 2OF7A 3P5JA 1Z7LA 2DYRH 5DCMA 3A2KA 4RAFA 4W97A 3K1PA 2Z2SB 4A3BJ 4M9SA 2HKXA 1UJ8A 2X6WA 2ETHA 4KT6A 1ZG1A 4FETA 3GVAA 5IT9K 3DLAA 3KP3A 5HNHA 3S16J 1NTCA 2H8WA 3LA7A 1V5FA 3DQVC 4F55A 3OYJA 1DP3A 2M5WA 3RYRA 1JE8A 2ZKZA 3BJ6A 1XMKA 4EGYA 4NC7A 5FFZA 2BE5F 3EQLF 2IA1A 3CUQC 1TQIA 3GMEA 4HW0A 3LAPA 4IRGA 2V6EA 4FHTA 4K2EA 5LEJA 2DQRA 4A0ZA 4Y15A 1U8RA 3HTUA 3KYCB 4YIRX 4CCNA 5E3OA 3WHBA 1OISA 3HOWJ 2NS0A 3A4CA 4E7LA 4LG0B 2EV6A 4RGSA 1BI2A 2VT3A 3R60A 3QPLA 2O9LA 2XSJC 4LITA 4XKWA 1OFCX 4WF2A 2VL8A 2OQGA 4M9XA 4CZZA 1KA8A 3PQJA 4ZYAA 1FYLA 1W36D 2Z9OA 4LLNA 2DJIA 4LG0A 1TL8A 3FXUA 4UUSB 1B9MA 2MYSA 1ZARA 3ZN1A 5IP7J 4HF2A 4EEFG 2IPQX 1H89C 2FU4A 5L3CA 3BG5A 2ME0A 1MKMA 2YSRA 2KIFA 3J81Z 2XDVA 2VJJA 2UV1A 4RGRA 1HKTA 5DDGA 3FXOA 3LOCA 5FRNA 3WTYC 3T5XA 3FK6A 1ZRDA 2LNBA 3DF8A 3F0CA 3HEFA 1KU7A 5M5WJ 1T38A 1MBJA 3J7YJ 1N75A 1R7JA 4I0BA 4RAGA 2O03A 5K5OA 1MJ9A 1FEXA 4V2FA 3K2AA 1TT0A 2OAZA 1U5TC 3EDPA 2Y0MA 2DN0A 3PNTA 2M9HA 1S5LC 1HCRA 1UELB 1G3SA 2QQBA 3KLOA 3I56I 3FX3A 5JLXA 4CXFA 5FLXK 1KGSA 3F8BA 3U21A 3C3WA 2QSFX 3DCFA 3MFKA 1VF9A 4O5VA 4HF0A 4OAYA 1MMSA 2VC1A 2HQAA 2NRAC 1I3QJ 5K7ZA 1H8AC 1R5ID 4MGRA 4P9FA 4TV7A 1IJWC 4BGDA 1Y0UA 2TRTA 1QPMA 4IVNA 4BDYA 4G12A 4FASD 1O3SA 2A6HF 2JT1A 2ZSIB 2KIUA 4M9ZA 1B4AA 2ICWG 1P7JA 3TKYA 3K7AJ 1X3WB 1D8JA 2QQ9A 3ABTA 2EV0A 1B59A 1KU2A 2JVGA 4U88A 1HC8A 3H1CA 4MTDA 3RIRA 3ROUA 3ISPA 4HLXA 2IA0A 1J9IA 5IP9J 1O7FA 3GFIA 1X1CA 2VBYA 4AYBN 5F04A 2GZWA 4OIQF 3K4NA 4I09A 1VQ6I 3FXRA 2A07F 3VB2A 3JRHA 2JSCA 2DMPA 2LF8A 1T6SA 1RRJA 2M87A 1RR8C 4KN4X 5IOYA 2ELJA 1R1TA 2DMTA 1PUEE 5J8FA 5M3FJ 3OR2C 3F8FA 1HF0A 3O8HA 4Y33A 4IHSA 3V7RA 1U9NA 3FK7A 4S05A 2HOEA 1WJAA 4XRMA 3H36A 1SFEA 1D1BA 2OC6A 4Q47A 4YFNF 3WG7H 3L2RA 3IRQA 3JRCA 2A05A 4G94A 4M74A 2OZ6A 3OS2A 4QPOA 3VPRA 3TO7A 3CO6C 4GDFA 2WTEA 1LEAA 2BXYA 5IYDJ 4PDKA 2F2EA 3MCZA 2XGXA 4HF1A 3QP5A 4XLCA 4BY7J 1Q1VA 5DUIA 4P5OA 3D5LA 1YRNB 4PSXA 3VFZA 5FJ8J 1YQAA 2P8TA 2HQ5A 1I3AA 3CCQI 3HM5A 3LA3A 4C2UA 2MA3A 1YRNA 2FX0A 2E2IJ 3BJOA 3KZZA 1LVAA 1FY7A 3EUHC 4KMUX 2R5YB 1ZK8A 2VPLA 2IBDA 2LTPA 3V8LA 5C4JJ 4ZDLA 1D0XA 4XICA 4E4HA 3RPUA 1QHGA 4II3A 4AIJA 2LBFB 3QPTA 3ZQ7A 4AM3A 4L5EA 2NVXJ 3DPTA 2HYFA 4WCGA 4NB5A 2FF4A 4A3MJ 2V9KA 4KN7X 3K70D 1SAUA 2VC0A 1PDNC 2BW3B 2LBFA 1SD7A 3DKYA 5ICCA 1DQUA 3H5NA 4XN3A 3QU3A 1JJ8C 1B8IB 1P4XA 2MLKA 1YX3A 4U0WA 2VOPA 2O8XA 1QZZA 3LQRA 3CC4I 5ED4A 2A5WA 5DCFA 4JK1X 1FWZA 3FMRA 4IPAA 4BXFA 1HW5A 1S7EA 1JUMA 2Z16A 5IOZA 1USSA 5F1JA 3JAMZ 1TWCJ 5DEQA 3RJPA 3Q0WA 2L7FP 3QOPA 1EV7A 3CMMA 1H9GA 3OYFA 2CYYA 1WPKA 2LK2A 1ZYRF 1MNEA 2IXSA 4Y17A 1Y56A 4QTRA 1A35A 3TP0A 3OIQA 4XORA 5LHGA 1U6GA 4IX7A 2HPIA 4S04A 2X4HA 4LIVA 5J4YA 1XGNA 3K4KA 1UZCA 3TQNA 3LFKA 2X51A 2HXOA 2KL4A 2E5NA 3ABMH 4AIHA 4CGZA 4MQ9F 1IV6A 2BV6A 4M6VA 1VQ8I 2CG4A 4AWXB 2HNHA 2PFBA 4DQ2A 1HSJA 1HW1A 2MLGA 1BI0A 1B9NA 2HU9A 1T33A 1POGA 1YJNI 3GZ6A 2OUMA 4D1QA 1JI8A 1UMQA 2QF7A 1L0OC 1K4SA 1PVEA 1QNTA 2P4WA 3RZOJ 1Q1HA 1T08B 3RQ4A 2KZGA 2R3SA 3COAC 4BACA 5GAGJ 1IDZA 2R7TA 2CH0A 2PBIA 5JHFA 3DBLB 1T8IA 2VKEA 2X6OA 4RLFA 3CCRI 5ICFA 4EQQA 1QA6A 5IT3A 1DGWY 1NG7A 2DYSH 3KIOA 3P9KA 5GAEJ 3BG7A 2LKXA 1BC8C 4PJNA 3OS0A 5E8IA 4UVBA 4E7SA 4Q48A 2QENA 5DM7F 2GXGA 3KP6A 4E7KA 5FKLA 2XVCA 2JMWA 2M4KA 4JQFA 2FQ4A 3FBIB 2HDWA 2DQLA 2EZLA 3DTIA 4S0HB 2R7RA 3S17J 1K61A 5M3MJ 5LRRA 4A69C 1IN7A 4IKFA 2KKOA 2A6EF 2IVMA 2VN2A 3L7WA 1ZLKA 4BY1J 3KYLA 4L9TA 4AVPA 1OCPA 2JVHA 3ZP5A 3CDHA 4G7HF 3OS1A 2NYXA 5EZHA 2DMUA 1M1EB 2BY3A 2NNYA 3AG2H 3R0AA 2EILH 2W84A 2K4BA 3SJMA 1OLTA 3M8FA 4L5JA 4EM2A 5GTHC 2K5CA 4DZJA 1ZREA 1VQ9I 2CRGA 1JKQC 1RUOA 3E5QA 1VNDA 2L9VA 1LEBA 4D9JA 3A1YA 2F48A 2JJ7A 4B3XA 1T98A 2A5YB 2WA0A 5E17F 3H5AA 3FKJA 4PFPA 1AWCA 3WU2C 5EEAA 3OYAA 1QPIA 1MBEA 3SYTA 1Y1VJ 2K9SA 1DP7P 5JVTA 2QA4I 2L7MP 5D6FA 4U7DA 1N77A 2OZUA 1GT0C 2ID3A 3NEUA 1LE8B 4RM3A 2JRMA 3A0BC 2DA4A 1XDSA 2KRFA 2LREA 3CCMI 5BMZA 2EFNA 3FBNB 4ETSA 2ZJRF 5FLMJ 2Y31A 2EFPA 4Y52J 4RM2A 1FLIA 4ENMA 5D8KB 5KNLA 1T0FA 3KZYA 3HG9A 4CYDA 1LE8A 1P4WA 5E1WA 1MZBA 3V42A 2WWYA 2R7ZJ 3G3ZA 2CMPA 4C2MJ 5AIPA 5F27A 5HDGA 5HLHA 2ZJ2A 5LD2C 1TWAJ 2QVOA 1QZYA 1BR4A 1B72B 1BL0A 2HXIA 3SHFA 3GTOJ 4N4NB 2RAEA 3GWZA 1FOKA 1G8XA 2A6TA 1R49A 1G59A 4IRIA 5D8LB 4NBQA 4LFUA 1B72A 1BJAA 2YR2A 1RI7A 1BOAA 4A93J 3BDDA 3B02A 3V8JA 1TP4A 1JUSA 3HBLA 2EPFA 2P81A 1YFHA 4WX9A 1QVUA 3BZCA 4YELA 3FWEA 3MWMA 1W1WE 5F64A 4QIWN 4I6ZA 3HKZN 1ETKA 1E3HA 1VQOI 2WAQN 2VE8A 3DPLC 1ZN2A 2Y48A 4MFDA 2VIXA 1D3YA 1FPQA 2EV5A 3BP8A 2ZB9A 2XAQA 4BE1A 1TQPA 1TNSA 4JYKA 3MZHA 4GFBA 1OCCH 4BUPA 5F0CA 2NVUB 3ZXSA 4XKVA 1E3OC 3S1MJ 1IGNA 3DV8A 3BR6A 1SVMA 4D7MA 2AO9A 2XGCA 2IA2A 4IXAA 3Q0VA 2H1KA 2VOOA 2JRTA 1FNNA 3HPGA 1WVRA 4UB6C 1BM9A 5JI6A 3OYMA 3KZIC 4LB5A 2Y75A 4AYBA 4J00A 1XC5A 2FOKA 1KYWA 4XRFA 2M0MA 3J7ZI 2BXZA 3R6SA 2R5ZB 3J80Z 9ANTA 5EEGA 3REOA 5ERIA 1MMAA 3AG4H 1FP1D 2CWEA 5EZGA 5FKNA 1E3PA 2M7AA 2ZXJA 1R1UA 3CD6I 4LK0F 2R5ZA 1OYIA 2QWWA 4Y3OA 1R4MB 4KICA 4PJJA 3K0LA 4ENNA 4PCQA 4ENKA 4PK4A 5AONA 4C9YA 2PMZN 5ICGA 2HTJA 2LYCA 1UHWA 2F5VA 3HYIA 4BHCA 3WTVC 1TWGJ 2FA5A 2AS5F 2CQ7A 2K02A 5TRDA 2YU9J 2VE9A 3GEZA 1LNWA 4GXOA 2EZIA 2CW8A 3EPZA 4N9IA 1N78A 1IRGA 3D0SA 3IHUA 4A3JJ 2BZTA 4ZDOA 3MKYB 3FKIJ 1E0EA 4A2UA 1FIPA 2G9WA 1KONA 2FUG2 5EJCA 1UAAA 3IH2A 2XB0X 3GTGJ 5ILVA 3L2UA 1XSVA 3J7AO 2DDBA 1FMWA 2JQ7A 1YX5A 2R7OA 1TWHJ 2BVMA 3SDGA 5B66C 1Z0XA 2JZYA 2NVTJ 3RKWA 3W6VA 4RA2A 2CFOA 2DT6A 2B9SA 5E18F 2IRFG 1SFOJ 2F5EA 5LRSA 3H35A 2W7NA 4LOCA 2K9MA 2X1CA 2LDUA 2ZJQF 2F4OB 2XKOA 5GAHJ 1ETOA 4DZPA 2Z33A 2O5RA 4EJWA 2FXAA 3GUDA 3CJNA 2RKHA 3B73A 5B5EC 2CQKA 2WY8Q 5KAIC 5LEKA 4FTHA 1Y0NA 2L7KA 3K1NA 4XSZF 2VQHA 4F93B 1I50J 1D5YA 4G9YA 3CCSI 2LVSA 5DV5A 4IRHA 3FZVA 2EIMH 2X1DA 3R61A 3CMEI 4C30A 3H3UA 3S1RJ 5KVRA 4CO8A 1XGMA 4IF4A 3T8TA 3MMYB 2OCEA 1L3LA 2NS8A 2E1MB 5F0HA 2NVQJ 4CCMA 1V55H 1Z6TA 4RGUA 3FHZA 3S14J 3VODA 3KLNA 3UKGA 2R7DA 3LSJA 3VYRB 2DODA 2YUSA 3OYGA 1WJBA 3RZDJ 2B63J 4XLPF 4EVIA 4C2TA 1YIOA 3BR1A 1MBGA 3IKVA 4CZCA 4ZZLA 1IW7F 1ERDA 1I1GA 1T0FC 1OCZH 3CLOA 4Y7NJ 1LDJA 2RN7A 4LLGF 4PGHA 1F5TA 3I55I 1UHSA 5TISC 3R0JA 5CVJA 3GZ5A 5JVGF 1ZR2A 1OMIA 3CF2A 4A3CJ 2QGUA 4ASNA 4QPQA 1AHDP 1WGXA 3ECHA 2VJIA 4XSXF 3ZQIA 5J1RA 1ZLJA 3AL0B 4XKBA 2B0LA 1RC9A 1W5SA 3F3XA 1KU9A 3D5SC 1D1CA 1LKXA 5CLSA 3WGHA 4BE0A 2HFHA 3HOTA 2WAFA 1XMAA 5GTIC 4NC6A 3TDZC 4P55A 1EKEA 4BHPA 2W85A 3H0DA 4D0PA 4FT8A 2KJBA 1E2XA 2DMNA 4M71A 1UCRA 2ELHA 2G0EA 3HGYA 5CQGA 1XCBA 3V7SA 1W0TA 1NK2P 4EATA 5FKKA 3HOYJ 4BKXA 2M45A 3HOZJ 3BR2A 3ZN0A 1YI2I 1SD6A 1ZAOA 3MEXA 1UG0A 2L9SA 5BOXA 4I98B 2R7XA 3WGIA 1IRXA 4GGGA 2WV1A 2M4GA 1PJRA 3RYPA 2HEOA 4G6DA 4OIOF 3ZQGA 3N4MA 4HOBA 4L9NA 2CV1A 3BC8A 1MMDA 1X4PA 3MZYA 2CUZA 3T8RA 1Z67A 3O3KA 3SZGA 4RAYA 3AAFA 3OYLA 4ON0A 3QOEA 4XK4A 2DW4A 3S2DJ 4D7NA 4RB3C 4BDZA 4ZYGA 2LY2A 2DA3A 2X0LA 4A3FJ 2MC4A 5E3MA 4CYCB 4LMYA 4P1WA 1ETXA 4KT5C 2QM3A 2MW8A 2RC4A 2MH2A 3D5RC 5LGNA 3PNVA 2DMQA 5EDNA 1TC3C 3RKXA 3ZGKA 4UY8I 2R92J 4X6AJ 5H6QA 4ZZDA 3GZNB 2KMUA 4UUSA 1D0ZA 3OYHA 5FGMA 1BIBA 1Y1WJ 3HZJA 3GO5A 2HOTA 1LDKB 5K1YA 2OTJI 5L3FA 1V5GA 1XMXA 4IQ4A 2BGCA 5C3EJ 3ZQCA 4M73A 1ULYA 1B1BA 2V79A 1FC3A 1ZG3A 1BOBA 3M8EA 2LH9A 4BXXJ 1G2HA 1ITYA 4FX4A 3NARA 3BWGA 2BY0A 2KQRA 3C18A 3I4PA 3ZMZA 4M3EA 2IS1A 3CCLI 3SFZA 2DA5A 3SZPA 5M5XJ 1Y8QB 1FSHA 4E7ZA 4P9UA 3D1NI 3V8KA 4A5NA 1JGGA 2HQNA 2FRHA 3E97A 4M72A 3OY9A 4I02A 2DPUA 3ZPLA 3R4KA 4A3IJ 2W82A 2EINH 3E3VA 3J81K 1HOMA 2VKDA 5B3SH 2STWA 3GTQJ 1DGRM 5KCMA 1MMNA 6PAXA 3P9CA 4A5MA 3GCMA 4CA0A 1CGPA 1KQ8A 4Q4ZF 2F5FA 1XB4A 1K83J 1Y6IA 4AC0A 1IC8A 1D5VA 1HA8A 4XN0A 1XCVA 4HZFA 4G7ZF 3O2PE 1JT0A 5FFXA 1VFCA 4L5IA 1IN4A 2G7HA 3ZMSA 2F5DA 4NNJA 2KFDA 3GFJA 2ZXWH 4Z2YA 4E7JA 2VKHA 4KIFA 4ESFA 3GFMA 1BN5A 3VYSB 3L2WA 4NQWB 4C3JJ 3N05A 2YU3A 5CVUA 2HZDA 4YFKF 3CMAI 3HKZA 3OR1C 2JSPA 5L3EA 2YX7A 3F21A 1O3RA 2HI3A 1XGSA 2WAQA 2XV4S 3ESWB 1JT6A 4LGWA 2PN6A 4NQWA 2X48A 1WI3A 4LG3A 5F6FA 1AOYA 3ABKH 2IAIA 1W36C 2QYOA 5J1YA 1YO5C 2XAGA 3CO7C 2EA4A 4CCLA 5FKOA 2V4JC 4JP0A 4UVAA 3H5RA 2KDOA 2L0KA 3IAM2 1QQIA 2Q0OA 3LSKA 2QLZA 1MW7A 3A0HC 1YITI 1HDPA 3QPHA 1QVTA 2UZKA 5D6EA 1BI1A 4E7IA 2XPVA 2O0YA 2K27A 2XPWA 2LKPA 1P2FA 2XF7A 3HXLA 2O8KA 3E5XA 2V1DA 4EM1A 1WHUA 2PX9A 3CP8A 3IWFA 2XROA 4I76A 3I4MJ 1R1VA 2VQCA 3NWSA 4AUXA 1V54H 2QCOA 4EJVA 1G3YA 2DLLA 2FMYA 1YYVA 1ZQ3P 3SDBA 2W00A 3C1DA 1IRFA 4A6DA 3S2WA 4KITB 2HOAA 3CTAA 4HV5A 4YEJA 2PMZA 3A01B 1GXQA 5IY5H 3JRBA 2R5YA 3L00A 4BJ6C 3OL3A 3F8MA 3S1NJ 3ZR8X 1LQ1A 3VYTB 1TTYA 2TDXA 5CJ9A 4YRVA 2MC3A 3A01A 2DK8A 4CSWA 4G6TB
chains in the Genus database with same CATH topology
5IYCJ 2VUMJ 1IUFA 1FTZA 1GT0C 3Q0UA 5J3LA 1MSFC 2ID3A 1LE8B 2DA6A 1AKHB 3BTJA 4NDLA 2DA4A 1MH3A 1B8IA 2OPTA 2E2JJ 3ZQHA 1OCTC 4IHWA 2DA7A 2WB1N 5FLMJ 2Y31A 4Y52J 1FIAA 4M3DA 1ETVA 1MBHA 5EG0B 1LE8A 1AKHA 2R7ZJ 3BR5A 5DTDA 3BQYA 4C2MJ 5F27A 2VKVA 2XGDA 2CU7A 2E2HJ 3G1MA 1JKPC 1TWAJ 2M2EA 1B72B 3MN2A 1BL0A 1BW5A 2HXIA 3GTOJ 3GTMJ 4HNVA 5EG0A 2RAEA 5IYBJ 3TEDA 3TW7A 3H3VK 2JA7J 4M3GA 4C3IJ 1B72A 4A93J 4DYQA 5GP9A 3GTLJ 1JUSA 3HBLA 2P81A 4V2GA 3S1QJ 1QVUA 2Y9YA 3HOUJ 3RQIA 1X2NA 2LFBA 3IH4A 4QIWN 4I6ZA 3BTCA 3HKZN 1ETKA 2LR8A 2E1OA 2EH3A 3JRFA 2WAQN 2CQXA 1RR7A 1HDDC 1IDYA 4B4CA 3BQZA 4MFDA 1U78A 4A3EJ 2CQQA 3M3YJ 2ZB9A 5GPCA 3JREA 4IHXA 4JYKA 4GFBA 3CCYA 3FIWA 5F0CA 3RKQA 1ZTRA 1E3OC 4B1RA 2ECBA 3S15J 3S1MJ 3BR0A 2E19A 1IGNA 1OJLA 1APLC 3BR6A 5EF6A 4D7MA 5F08A 4IHYA 2AO9A 2L9RA 5K7FA 3LSRA 1WCMJ 3BT9A 2R0QC 3ZQLA 1MSEC 2XGCA 3GTPJ 1X2MA 3Q0VA 2H1KA 2JA6J 4IHVA 1XC5A 2LLKA 1CQTA 2R5ZB 4ABZA 9ANTA 2OF7A 4M3BA 1GV5A 2N8GA 4W97A 1T56A 5FKNA 5EZGA 4A3BJ 3OSFA 1U8BA 4JX6A 2M0CA 1Z77A 1MBFA 2H8RA 4XIDA 2M34A 2R5ZA 3S16J 1NTCA 3JRDA 1F36A 1GVDA 2XB5A 1BJZA 2PMZN 3WHCA 2NVYJ 1TWGJ 1LFUP 1A6IA 2YU9J 5FKMA 4FE4A 1SANA 2EZIA 3O8GA 3CQZJ 1IG7A 1XG1A 4A3JJ 1ZR4A 5E3OA 3FKIJ 3WHBA 3HOWJ 1FIPA 1ZGWA 1JKOC 2GBYA 3QPLA 2O9LA 2JA5J 1OFCX 2JA8J 3IH2A 2XB0X 3GTGJ 2CUFA 5C44J 3LSPA 3B6CA 4UUSB 1TWHJ 5IP7J 3SDGA 1Z0XA 2NVTJ 3W6VA 4EEFG 1H89C 3JRGA 3BG5A 2ME0A 4A3LJ 1SFOJ 4QSHA 3LOCA 4LOCA 1ETWA 1RPWA 2DJNA 4D5FA 3FK6A 1ETOA 4DZPA 3F0CA 3HEFA 1ENHA 4XRSG 2MG4A 5M5WJ 4FTHA 1MBJA 2LD5A 3LSGA 4MFEA 2FJ1A 1I50J 1FEXA 4V2FA 1D5YA 3K2AA 2LVSA 2XPUA 1JKRC 3MKLA 2DN0A 2M9HA 1HCRA 1MBKA 3S1RJ 5JLXA 3CMYA 1MNMC 5EYRA 2NS8A 5F0HA 3JRIA 2NVQJ 3DCFA 1VF9A 2Y0SN 4JX4A 3S14J 3UKGA 1I3QJ 3LSJA 5K7ZA 1H8AC 3I4NJ 2HOSA 4D5CA 1ORKA 1IJWC 2YUSA 3HDDA 2TRTA 3BR3A 2ECCA 3E7LA 3RZDJ 2B63J 4G12A 2M8GX 1TWFJ 5EGOB 2MGQA 1P7JA 3BR1A 3K7AJ 5J1UA 5IPAA 4DYRA 1MBGA 2NOGA 2XRLA 1MH4A 2DTZA 1A5JA 4Y7NJ 5IP9J 1UHSA 3PO3J 3A01A 4AYBN 5F04A 1ZR2A 4A3CJ 1GUUA 3JRHA 2DMPA 1AHDP 5BNGA 1WGXA 2GM4A 3ZQIA 5J1RA 2ELKA 5IOYA 1RKTA 2DMTA 5M3FJ 1HF0A 3O8HA 2COBA 3ZQFA 1U9NA 3FK7A 3A02A 2EBIA 3OOUA 4XRMA 1WH5A 2KDZA 2K9QA 3JRCA 3FISA 1F43A 3HGGA 1GDTA 1NK3P 4MO7A 3VPRA 1BW6A 2DMNA 2G0EA 3HGYA 1BA5A 1AU7A 1W0TA 5IYDJ 2MSYA 1NK2P 5FKKA 3HOYJ 4BKXA 3HOZJ 3BR2A 3CDLA 4BY7J 1Q1VA 4XRSA 2JN6A 3JRAA 4UUTA 2K9NA 1YRNB 2WV1A 4M3FA 4BBSJ 4FISA 2GLOA 3QPSA 1ETYA 4MLOA 5FJ8J 3ZQGA 2CJJA 1GV2A 2HQ5A 2KT0A 3IH3A 2DA2A 3HM5A 4A3GJ 2I10A 2ID6A 1LFBA 1YRNA 3JR9A 2FX0A 3GBGA 2E2IJ 4MIMA 1FTTA 5DS9A 4DW6A 4XK4A 2R5YB 1ZK8A 3TW6A 2IBDA 2LTPA 3S2DJ 2JWTA 4D7NA 5C4JJ 4XICA 1XS9A 2DA3A 4A3FJ 3GTKJ 5E3MA 4CYCB 1ETXA 5HODA 3G1LA 2MW8A 2EZHA 1JTYA 4L5EA 2DMQA 1QRYA 5EDNA 1TC3C 2NVXJ 4X6AJ 2W48A 2R92J 3PM1A 4B3AA 1U9OA 4UUSA 4A3MJ 1I6HJ 1Y1WJ 2LY9A 2VI6A 2HOTA 1JJ8C 1B8IB 1UG2A 3H0GJ 5C3EJ 3ZQCA 1JTXA 4FE7A 3OSGA 5E3LA 1RESA 4BXXJ 1JJ6C 1G2HA 3GTJJ 1ITYA 1S7EA 1JUMA 3NARA 5IOZA 5F1JA 2D5VA 1TWCJ 3Q0WA 1IRZA 2L7FP 2L7ZA 3DEWA 1R9TJ 1ETQA 2R93J 2IEKA 1WPKA 2LK2A 2XGEA 4M3EA 4FCYA 4J19A 3S2HJ 4QTRA 4IEJA 2DA5A 5M5XJ 3TP0A 1EF4A 4RDUA 3NAUA 2EQRA 2HYJA 3D1NI 2LP0A 1JGGA 3SFIA 4A3KJ 4C3HJ 2HXOA 4A3IJ 1RETA 4X1EA 1IV6A 1HOMA 4DYCA 4M6VA 3GTQJ 5JLWA 2X9DA 3G1OA 3L1PA 3B6AA 3BG9A 2HDDA 1PUFB 1T33A 1POGA 5EGOA 4AC0A 1K83J 1IC8A 3HOVJ 2YS9A 2Y9ZA 1JT0A 1UMQA 2QF7A 3ZOBA 1VFCA 5K7HA 1VI0A 1DU6A 1PUFA 3RZOJ 5C4XJ 3BTIA 2NS7A 1IDZA 2CUEA 2JK3A 1W0UA 4C3JJ 3BG3A 2VKEA 2X6OA 3QQAA 3OIOA 1FJLA 2HI3A 5M5YJ 1RKWA 5F0FA 2K40A 1JT6A 2LKXA 2X48A 1WI3A 4BBRJ 2IAIA 2TCTA 4W1UA 5FKLA 2JMWA 5J1YA 3M4OJ 2FQ4A 5FKOA 4JP0A 2EZLA 2L0KA 4S0HB 2EZKA 2VPRA 1O4XA 1K61A 5GPAA 5M3MJ 3A03A 3S17J 4A69C 1HDPA 3IV5A 2Y2ZA 1HLVA 1QVTA 5E3NA 3HOXJ 2XPVA 4BY1J 3C2BA 2XPWA 1P7IA 1JUPA 3PO2J 1WH7A 1OCPA 5FLVA 2DA1A 1H88C 2O8KA 5EZHA 2DMUA 4A3DJ 2Y30A 1DU0A 3MVPA 4I76A 2XSDC 3I4MJ 3SJMA 4AUXA 2QCOA 4DZJA 2CRGA 2O7OA 1ZQ3P 1JKQC 5IP6A 1VNDA 2HOAA 2JJ7A 3A01B 3JRBA 3TP3A 2R5YA 3BTLA 4JX5A 2FD5A 5EEAA 1QPIA 3S1NJ 1MBEA 4CYCA 1X58A 1ZKGA 1Y1VJ 2K9SA 2ME6A 4RBOA 3LNQA 2AHQA 2L7MP 3HB9A 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC J;  2VUM J;  1IUF A;  1FTZ A;  1GT0 C;  3Q0U A;  5J3L A;  1MSF C;  2ID3 A;  1LE8 B;  2DA6 A;  1AKH B;  3BTJ A;  4NDL A;  2DA4 A;  1MH3 A;  1B8I A;  2OPT A;  2E2J J;  3ZQH A;  1OCT C;  4IHW A;  2DA7 A;  2WB1 N;  5FLM J;  2Y31 A;  4Y52 J;  1FIA A;  4M3D A;  1ETV A;  1MBH A;  5EG0 B;  1LE8 A;  1AKH A;  2R7Z J;  3BR5 A;  5DTD A;  3BQY A;  4C2M J;  5F27 A;  2VKV A;  2XGD A;  2CU7 A;  2E2H J;  3G1M A;  1JKP C;  1TWA J;  2M2E A;  1B72 B;  3MN2 A;  1BL0 A;  1BW5 A;  2HXI A;  3GTO J;  3GTM J;  4HNV A;  5EG0 A;  2RAE A;  5IYB J;  3TED A;  3TW7 A;  3H3V K;  2JA7 J;  4M3G A;  4C3I J;  1B72 A;  4A93 J;  4DYQ A;  5GP9 A;  3GTL J;  1JUS A;  3HBL A;  2P81 A;  4V2G A;  3S1Q J;  1QVU A;  2Y9Y A;  3HOU J;  3RQI A;  1X2N A;  2LFB A;  3IH4 A;  4QIW N;  4I6Z A;  3BTC A;  3HKZ N;  1ETK A;  2LR8 A;  2E1O A;  2EH3 A;  3JRF A;  2WAQ N;  2CQX A;  1RR7 A;  1HDD C;  1IDY A;  4B4C A;  3BQZ A;  4MFD A;  1U78 A;  4A3E J;  2CQQ A;  3M3Y J;  2ZB9 A;  5GPC A;  3JRE A;  4IHX A;  4JYK A;  4GFB A;  3CCY A;  3FIW A;  5F0C A;  3RKQ A;  1ZTR A;  1E3O C;  4B1R A;  2ECB A;  3S15 J;  3S1M J;  3BR0 A;  2E19 A;  1IGN A;  1OJL A;  1APL C;  3BR6 A;  5EF6 A;  4D7M A;  5F08 A;  4IHY A;  2AO9 A;  2L9R A;  5K7F A;  3LSR A;  1WCM J;  3BT9 A;  2R0Q C;  3ZQL A;  1MSE C;  2XGC A;  3GTP J;  1X2M A;  3Q0V A;  2H1K A;  2JA6 J;  4IHV A;  1XC5 A;  2LLK A;  1CQT A;  2R5Z B;  4ABZ A;  9ANT A;  2OF7 A;  4M3B A;  1GV5 A;  2N8G A;  4W97 A;  1T56 A;  5FKN A;  5EZG A;  4A3B J;  3OSF A;  1U8B A;  4JX6 A;  2M0C A;  1Z77 A;  1MBF A;  2H8R A;  4XID A;  2M34 A;  2R5Z A;  3S16 J;  1NTC A;  3JRD A;  1F36 A;  1GVD A;  2XB5 A;  1BJZ A;  2PMZ N;  3WHC A;  2NVY J;  1TWG J;  1LFU P;  1A6I A;  2YU9 J;  5FKM A;  4FE4 A;  1SAN A;  2EZI A;  3O8G A;  3CQZ J;  1IG7 A;  1XG1 A;  4A3J J;  1ZR4 A;  5E3O A;  3FKI J;  3WHB A;  3HOW J;  1FIP A;  1ZGW A;  1JKO C;  2GBY A;  3QPL A;  2O9L A;  2JA5 J;  1OFC X;  2JA8 J;  3IH2 A;  2XB0 X;  3GTG J;  2CUF A;  5C44 J;  3LSP A;  3B6C A;  4UUS B;  1TWH J;  5IP7 J;  3SDG A;  1Z0X A;  2NVT J;  3W6V A;  4EEF G;  1H89 C;  3JRG A;  3BG5 A;  2ME0 A;  4A3L J;  1SFO J;  4QSH A;  3LOC A;  4LOC A;  1ETW A;  1RPW A;  2DJN A;  4D5F A;  3FK6 A;  1ETO A;  4DZP A;  3F0C A;  3HEF A;  1ENH A;  4XRS G;  2MG4 A;  5M5W J;  4FTH A;  1MBJ A;  2LD5 A;  3LSG A;  4MFE A;  2FJ1 A;  1I50 J;  1FEX A;  4V2F A;  1D5Y A;  3K2A A;  2LVS A;  2XPU A;  1JKR C;  3MKL A;  2DN0 A;  2M9H A;  1HCR A;  1MBK A;  3S1R J;  5JLX A;  3CMY A;  1MNM C;  5EYR A;  2NS8 A;  5F0H A;  3JRI A;  2NVQ J;  3DCF A;  1VF9 A;  2Y0S N;  4JX4 A;  3S14 J;  3UKG A;  1I3Q J;  3LSJ A;  5K7Z A;  1H8A C;  3I4N J;  2HOS A;  4D5C A;  1ORK A;  1IJW C;  2YUS A;  3HDD A;  2TRT A;  3BR3 A;  2ECC A;  3E7L A;  3RZD J;  2B63 J;  4G12 A;  2M8G X;  1TWF J;  5EGO B;  2MGQ A;  1P7J A;  3BR1 A;  3K7A J;  5J1U A;  5IPA A;  4DYR A;  1MBG A;  2NOG A;  2XRL A;  1MH4 A;  2DTZ A;  1A5J A;  4Y7N J;  5IP9 J;  1UHS A;  3PO3 J;  3A01 A;  4AYB N;  5F04 A;  1ZR2 A;  4A3C J;  1GUU A;  3JRH A;  2DMP A;  1AHD P;  5BNG A;  1WGX A;  2GM4 A;  3ZQI A;  5J1R A;  2ELK A;  5IOY A;  1RKT A;  2DMT A;  5M3F J;  1HF0 A;  3O8H A;  2COB A;  3ZQF A;  1U9N A;  3FK7 A;  3A02 A;  2EBI A;  3OOU A;  4XRM A;  1WH5 A;  2KDZ A;  2K9Q A;  3JRC A;  3FIS A;  1F43 A;  3HGG A;  1GDT A;  1NK3 P;  4MO7 A;  3VPR A;  1BW6 A;  2DMN A;  2G0E A;  3HGY A;  1BA5 A;  1AU7 A;  1W0T A;  5IYD J;  2MSY A;  1NK2 P;  5FKK A;  3HOY J;  4BKX A;  3HOZ J;  3BR2 A;  3CDL A;  4BY7 J;  1Q1V A;  4XRS A;  2JN6 A;  3JRA A;  4UUT A;  2K9N A;  1YRN B;  2WV1 A;  4M3F A;  4BBS J;  4FIS A;  2GLO A;  3QPS A;  1ETY A;  4MLO A;  5FJ8 J;  3ZQG A;  2CJJ A;  1GV2 A;  2HQ5 A;  2KT0 A;  3IH3 A;  2DA2 A;  3HM5 A;  4A3G J;  2I10 A;  2ID6 A;  1LFB A;  1YRN A;  3JR9 A;  2FX0 A;  3GBG A;  2E2I J;  4MIM A;  1FTT A;  5DS9 A;  4DW6 A;  4XK4 A;  2R5Y B;  1ZK8 A;  3TW6 A;  2IBD A;  2LTP A;  3S2D J;  2JWT A;  4D7N A;  5C4J J;  4XIC A;  1XS9 A;  2DA3 A;  4A3F J;  3GTK J;  5E3M A;  4CYC B;  1ETX A;  5HOD A;  3G1L A;  2MW8 A;  2EZH A;  1JTY A;  4L5E A;  2DMQ A;  1QRY A;  5EDN A;  1TC3 C;  2NVX J;  4X6A J;  2W48 A;  2R92 J;  3PM1 A;  4B3A A;  1U9O A;  4UUS A;  4A3M J;  1I6H J;  1Y1W J;  2LY9 A;  2VI6 A;  2HOT A;  1JJ8 C;  1B8I B;  1UG2 A;  3H0G J;  5C3E J;  3ZQC A;  1JTX A;  4FE7 A;  3OSG A;  5E3L A;  1RES A;  4BXX J;  1JJ6 C;  1G2H A;  3GTJ J;  1ITY A;  1S7E A;  1JUM A;  3NAR A;  5IOZ A;  5F1J A;  2D5V A;  1TWC J;  3Q0W A;  1IRZ A;  2L7F P;  2L7Z A;  3DEW A;  1R9T J;  1ETQ A;  2R93 J;  2IEK A;  1WPK A;  2LK2 A;  2XGE A;  4M3E A;  4FCY A;  4J19 A;  3S2H J;  4QTR A;  4IEJ A;  2DA5 A;  5M5X J;  3TP0 A;  1EF4 A;  4RDU A;  3NAU A;  2EQR A;  2HYJ A;  3D1N I;  2LP0 A;  1JGG A;  3SFI A;  4A3K J;  4C3H J;  2HXO A;  4A3I J;  1RET A;  4X1E A;  1IV6 A;  1HOM A;  4DYC A;  4M6V A;  3GTQ J;  5JLW A;  2X9D A;  3G1O A;  3L1P A;  3B6A A;  3BG9 A;  2HDD A;  1PUF B;  1T33 A;  1POG A;  5EGO A;  4AC0 A;  1K83 J;  1IC8 A;  3HOV J;  2YS9 A;  2Y9Z A;  1JT0 A;  1UMQ A;  2QF7 A;  3ZOB A;  1VFC A;  5K7H A;  1VI0 A;  1DU6 A;  1PUF A;  3RZO J;  5C4X J;  3BTI A;  2NS7 A;  1IDZ A;  2CUE A;  2JK3 A;  1W0U A;  4C3J J;  3BG3 A;  2VKE A;  2X6O A;  3QQA A;  3OIO A;  1FJL A;  2HI3 A;  5M5Y J;  1RKW A;  5F0F A;  2K40 A;  1JT6 A;  2LKX A;  2X48 A;  1WI3 A;  4BBR J;  2IAI A;  2TCT A;  4W1U A;  5FKL A;  2JMW A;  5J1Y A;  3M4O J;  2FQ4 A;  5FKO A;  4JP0 A;  2EZL A;  2L0K A;  4S0H B;  2EZK A;  2VPR A;  1O4X A;  1K61 A;  5GPA A;  5M3M J;  3A03 A;  3S17 J;  4A69 C;  1HDP A;  3IV5 A;  2Y2Z A;  1HLV A;  1QVT A;  5E3N A;  3HOX J;  2XPV A;  4BY1 J;  3C2B A;  2XPW A;  1P7I A;  1JUP A;  3PO2 J;  1WH7 A;  1OCP A;  5FLV A;  2DA1 A;  1H88 C;  2O8K A;  5EZH A;  2DMU A;  4A3D J;  2Y30 A;  1DU0 A;  3MVP A;  4I76 A;  2XSD C;  3I4M J;  3SJM A;  4AUX A;  2QCO A;  4DZJ A;  2CRG A;  2O7O A;  1ZQ3 P;  1JKQ C;  5IP6 A;  1VND A;  2HOA A;  2JJ7 A;  3A01 B;  3JRB A;  3TP3 A;  2R5Y A;  3BTL A;  4JX5 A;  2FD5 A;  5EEA A;  1QPI A;  3S1N J;  1MBE A;  4CYC A;  1X58 A;  1ZKG A;  1Y1V J;  2K9S A;  2ME6 A;  4RBO A;  3LNQ A;  2AHQ A;  2L7M P;  3HB9 A;  3Q3S A; 
#chains in the Genus database with same CATH topology
 4HG2 A;  2VUM J;  4O6J A;  2E60 A;  2VT2 A;  2V1U A;  3X2Q H;  1H9T A;  5J3L A;  2DT5 A;  2BW3 A;  2DA6 A;  3BTJ A;  4ZTJ A;  1YW8 A;  4BYY A;  1AA7 A;  1B8I A;  1MH3 A;  3PIP F;  2OPT A;  4OIN F;  4N9H A;  1YLF A;  2WB1 N;  1F9N A;  4EJU A;  2G7U A;  4M3D A;  3CJT B;  1NHA A;  4XKC A;  1A6Q A;  4F3Q A;  3IRR A;  2KIQ A;  5LGT A;  3BQY A;  4HDU A;  1YE9 A;  2ZO4 A;  2VKV A;  1PP8 F;  2STT A;  1P9Q C;  3MN2 A;  1LFP A;  4ZYH A;  2EFQ A;  4OIR F;  3F22 A;  2DXI A;  4IHT A;  5IYB J;  3TW7 A;  1S7A A;  3H3V K;  1XX5 A;  2VXD A;  3QYF A;  5CYV A;  3QP6 A;  3F9K A;  3MZ8 A;  2VBZ A;  3E6C C;  2FNP A;  2QSH X;  2YX4 A;  2OV7 A;  1U0J A;  3S1Q J;  3MQ0 A;  2EB7 A;  3SXY A;  4PJ0 C;  4AID A;  1HBX G;  3RQI A;  1X2N A;  2LFB A;  1J59 A;  2W4S A;  5E8G A;  3PJR A;  1SFU A;  3KYD B;  1S7O A;  1X1B A;  1G6N A;  2FBK A;  1TT5 B;  3E6M A;  4YG2 F;  3PUF A;  2EH3 A;  3JAM K;  4HA8 A;  1Z7U A;  3S32 A;  1X4O A;  1HDD C;  3HL2 A;  4B4C A;  3BQZ A;  2DOE A;  2M1B A;  2WY7 Q;  2DT7 B;  4A3E J;  4L9V A;  5BS6 A;  1YJW I;  5H2F C;  3FIW A;  1ZRC A;  2E71 A;  3HRU A;  2V9P A;  1YJ9 I;  1OJL A;  1Z3Y A;  1APL C;  1SAX A;  3PQK A;  4DIQ A;  2OD5 A;  3GW2 A;  2BVL A;  2VB6 A;  5D5U B;  1X2M A;  2KJC A;  2X6Y A;  3MKW B;  3CC2 I;  2JA6 J;  3GFL A;  4IHV A;  4P96 A;  2EIK H;  2F4I A;  1JGS A;  1QU3 A;  1S6L A;  4M3B A;  1GV5 A;  1S3J A;  2N8G A;  1DPR A;  4IO9 F;  3NQO A;  3SQN A;  3OSF A;  2ADU A;  2AQE A;  2OQR A;  3F8N A;  4JX6 A;  2M0C A;  1Z77 A;  1MBF A;  2PJR B;  3JRD A;  4N4O B;  1LVK A;  1F36 A;  1GVD A;  2XB5 A;  1BJZ A;  5A2Q Z;  5E1Z B;  3DU5 A;  5D4R A;  2JUG A;  2MBF A;  2NVY J;  1LFU P;  1A6I A;  4MTE A;  2WV0 A;  3FXM A;  1EH7 A;  2PJR A;  2ZME B;  4RB2 C;  5FKM A;  3DPU A;  1VZ0 A;  3K2Z A;  3O8G A;  3CQZ J;  2BBY A;  1IG7 A;  1XG1 A;  3PSI A;  1VQL I;  3KE2 A;  2R7W A;  1ZR4 A;  3GXO A;  4GCV A;  2KRH A;  1OR7 A;  2RNG A;  2DU9 A;  3F6V A;  3IAS 2;  1R58 A;  2ZME A;  4ZDP A;  5FB2 A;  1IN6 A;  4ESB A;  1ZGW A;  2BOL A;  1F1Z A;  2E7W A;  4G8X A;  4CH7 A;  2JA5 J;  1VQN I;  3LA2 A;  3HSE A;  2QKL B;  3DWL E;  1S29 A;  1NH3 A;  1FT9 A;  4XLN F;  5LBQ A;  2DO7 A;  3V7C A;  1WRJ A;  3NWT A;  2CUF A;  1HKQ A;  4ZYD A;  3I9V 2;  5C44 J;  3WU1 B;  2DI3 A;  3FMQ A;  3LSP A;  4H0E A;  4HPQ A;  1SC7 A;  3HHG A;  4ENJ A;  3VEP A;  1X3Z B;  5KHD A;  3BRO A;  5CKT A;  3JRG A;  2OU2 A;  3T0Y A;  2I8D A;  4QSH A;  4L9J A;  1Z6R A;  2A68 F;  4U0Y A;  1O7L A;  3KEY A;  4UNO A;  1ETW A;  3HRM A;  2XAF A;  2UUZ A;  1RPW A;  4PSW A;  3J7A Y;  2DJN A;  1R5H A;  1IF1 A;  5A2Q K;  2W1O A;  4XRS G;  4LB6 B;  1K6O A;  3LFU A;  3KEQ A;  5D5W B;  2KPM A;  2IP2 A;  1WJE A;  4YII A;  2LD5 A;  4BAY A;  1LUJ B;  3I3L A;  5ILS A;  4HDV A;  1D0Y A;  2XPU A;  2V1N A;  1OYW A;  4XLH A;  2CS3 A;  4DGW B;  5DD4 A;  3CMY A;  3OL4 A;  1MNM C;  1WQ2 A;  3JRI A;  3ECO A;  2DFF A;  2L3D A;  2BY2 A;  2VQG A;  2PJP A;  3F72 A;  2HOS A;  4D5C A;  1PYV A;  1ORK A;  3CP2 A;  3HDD A;  3E7L A;  1MND A;  3BLY A;  1NG6 A;  3HUG B;  3Q9V A;  3ASN H;  3MD2 A;  3HSR A;  5EGO B;  2A61 A;  1O3T A;  2MGQ A;  5J1U A;  4UV8 A;  1A31 A;  5FO5 A;  4JBA A;  5BPD A;  5IPA A;  3BY6 A;  4DYR A;  3E5U A;  3RI4 A;  3IKT A;  4HQM A;  1A04 A;  2PQ8 A;  1N25 A;  2DTZ A;  3HUG A;  1A5J A;  1FP2 A;  3KP5 A;  2QBY B;  5F1R A;  2JPB A;  1S9H A;  2L2O A;  2CW7 A;  1R5G A;  3HC7 A;  2ESH A;  2E1C A;  4HX8 A;  3CUQ B;  3PIO F;  1GUU A;  3DU6 A;  2L5Q A;  3DBH B;  1I39 A;  2RGV A;  5BNG A;  1WKM A;  4I99 C;  1W7P B;  2P5V A;  1Y39 A;  2ELK A;  4KFC A;  4YFX F;  1RKT A;  1J0R A;  2XAS A;  3CUQ A;  4XOP A;  4JOM A;  3ASO H;  2COB A;  3M8J A;  1QBJ A;  2DFE A;  1W7P A;  2HYG D;  5J8C A;  2VOD A;  2WC2 A;  1J09 A;  1WH5 A;  2KDZ A;  4OAZ A;  5FD6 A;  5HS9 A;  2HR3 A;  1OQY A;  3E6B A;  4AVZ A;  1F43 A;  4IZZ A;  3W2A A;  3HGG A;  1GDT A;  2GOM A;  1RNL A;  3TO9 A;  3CJR B;  3BG6 A;  1SEU A;  1AU7 A;  3EUA A;  1K7A A;  2E36 A;  4HRI A;  2DFI A;  3VSK A;  1FYK A;  1I27 A;  2HS5 A;  4XRS A;  1EH8 A;  1XGO A;  4DJA A;  2ACJ A;  2CGP A;  4BBS J;  2GLO A;  3OIP A;  1I1S A;  1ETY A;  3CLQ A;  2D1H A;  2XUB A;  5HOO A;  2KT0 A;  3G4S I;  2DA2 A;  4RLQ A;  4IQJ A;  4A3G J;  2I10 A;  4GRI A;  4KIG A;  1U5T B;  1R00 A;  2Y69 H;  3L2Q A;  5CVV A;  4X0G A;  4LK1 F;  1HQC A;  4MIM A;  4BEH B;  4DW6 A;  1OCO H;  3TW6 A;  2EJR A;  4UHT A;  1TZL A;  2BHZ A;  1XPX A;  3J80 K;  5D5X B;  3GTK J;  4GYI A;  5BPI A;  4KDP A;  5HOD A;  3G1L A;  2ZXI A;  2EZH A;  2RNJ A;  3DBR B;  1T39 A;  2O3F A;  5L3B A;  4NUB A;  5FD5 A;  1U9O A;  2ZCW A;  2R7S A;  2M8E A;  1YHQ I;  2HVR A;  2BEO A;  2W57 A;  3FDY A;  2HGC A;  5E79 C;  2VI6 A;  2L4M A;  1ON1 A;  2AXL A;  3ZMU A;  3H0G J;  2VAS A;  1JTX A;  4FE7 A;  1Z91 A;  1WI9 A;  1RES A;  2NOJ B;  2Q8K A;  1JJ6 C;  3FHN A;  3GTJ J;  1J2X A;  5J6X A;  2YPR A;  5CQE A;  2EFW A;  2CV2 A;  1RZ4 A;  1W7P D;  2L7Z A;  4R8H A;  1OR7 C;  5HLT A;  1R9T J;  1ETQ A;  1TLH B;  2V9V A;  2R7Q A;  3ZMD A;  4KYW A;  2XGE A;  4OOI A;  3FMS A;  3S2H J;  4IEJ A;  4Q5S F;  3H3Z A;  2HTS A;  1X1D A;  2KZV A;  1EF4 A;  3NAU A;  3M7G A;  4CHU A;  1G3W A;  2HYJ A;  2F5C A;  2H6B A;  2LP0 A;  3QU6 A;  1ZHF A;  3SFI A;  3VDX A;  4XQF A;  2VJ5 A;  4C3H J;  1LPQ A;  1JHH A;  2WB1 A;  2L01 A;  3F23 A;  3K4L A;  5CVR A;  4X1E A;  1I5Z A;  3IC7 A;  1G3T A;  4DYC A;  3JCU C;  1ZRF A;  2MH9 A;  1ACI A;  3IP4 B;  4WXD A;  2X9D A;  2LC2 A;  4GO1 A;  4CCO A;  4UVC A;  3B6A A;  4HV6 A;  3BG9 A;  1PUF B;  2EK5 A;  4B09 A;  4EV0 A;  3HRS A;  1KZH A;  4OIP F;  2RV8 A;  2H1L A;  2XC7 A;  4HX4 A;  1KQ0 A;  1VI0 A;  2JUC A;  2Q2E B;  5DD8 A;  1PUF A;  1J7K A;  3ERE D;  5DYM A;  4MNU A;  2KIS A;  3M07 A;  2NS7 A;  3K6G A;  3W2V A;  1IXS B;  2CUE A;  4LJZ F;  3FM5 A;  1W0U A;  2Q2E A;  1IXR C;  3DXJ F;  3BG3 A;  4L0Y B;  2UWM A;  4B8X A;  3L2C A;  2FQ3 A;  4XON A;  3GX4 X;  2FBI A;  4EJT A;  5D5V B;  1MDM B;  1V4R A;  1RKW A;  5F0F A;  4M6Y A;  4XR6 A;  3K69 A;  3UNG C;  4HQE A;  3OYC A;  2BHY A;  2K40 A;  1XD7 A;  2IS2 A;  3HRT A;  5B1A H;  3I71 A;  5DCM B;  4BBR J;  1O3Q A;  4BNC A;  2KLO A;  4W1U A;  3EUH A;  1IO2 A;  3M4O J;  2XF5 A;  4PJL A;  2EZK A;  2VPR A;  1YG2 A;  5GPA A;  1FBQ A;  1R6R A;  4ANJ A;  4NHJ A;  3IV5 A;  2Y2Z A;  4RS8 A;  3CZ6 A;  3HOX J;  1P4A A;  3I58 A;  3C2B A;  4UV9 A;  4V19 K;  2ZC2 A;  1P7I A;  1JUP A;  3PUB A;  5FLV A;  2DA1 A;  1H88 C;  1R71 A;  1OPC A;  1SD4 A;  4A3D J;  2IGO A;  2Y30 A;  1DU0 A;  4AD9 A;  2OJE D;  2K86 A;  1VTN C;  2AXT C;  5TGT A;  3SZT A;  4F92 B;  3OYK A;  3BCB A;  5CPR B;  4NC8 A;  3ZMT A;  2MD0 A;  2K85 A;  2XIG A;  3RDI A;  1HKS A;  1T2K A;  3F8C A;  1X19 A;  1R36 A;  3BTL A;  4PJM A;  1EA3 A;  1FX7 A;  5HVQ C;  2FD5 A;  5FLX Z;  4E6K G;  4CYC A;  1X58 A;  1R23 A;  1ZKG A;  3SEQ A;  4RBO A;  3LNQ A;  3FF5 A;  3WGG A;  2M30 A;  2JPC A;  2OCC H;  3Q3S A;  5IYC J;  2ZFU A;  1WJF A;  3CDI A;  2GXA A;  1FTZ A;  2AQF A;  3E6D A;  1MIJ A;  3Q0U A;  3ULQ B;  1D1A A;  2HVQ A;  2IW5 A;  2E2J J;  4EGZ A;  3ZQH A;  5HDK A;  1OCT C;  4IHW A;  3DKW A;  1GHC A;  2Z3Y A;  3S93 A;  2GOX B;  1FIA A;  2FE3 A;  3CF5 F;  2V7F A;  4A6E A;  4U7B A;  5EG0 B;  1SMY F;  1IUY A;  3MKZ A;  3FXL A;  2XAH A;  5HNF A;  2CU7 A;  1JKP C;  2M2E A;  2P5L C;  1BC7 C;  3GTM J;  1WJC A;  5EG0 A;  2LSO A;  3VSL A;  1ZGA A;  2H27 A;  3KP4 A;  3OOP A;  4I7H A;  3HHH A;  2COM A;  3ZCO A;  4BQA A;  2M3A A;  2JA7 J;  2GQQ A;  3DKX A;  5LFA A;  2RRE A;  4L18 B;  4UXN A;  4DYQ A;  3GLL A;  2VQL A;  2ZXH A;  3F6O A;  1X3U A;  3HOU J;  4OWR B;  5LGU A;  1K4T A;  1FBS A;  2DFH A;  3IH4 A;  3BTC A;  2DOA A;  5LLQ A;  1XN7 A;  2R7U A;  2LR8 A;  2E1O A;  1J5Y A;  4HEA 2;  5ILU A;  2IT0 A;  2VJ4 A;  4PZJ A;  1TQM A;  4A0Y A;  1IDY A;  3G73 A;  4UUV A;  5JHU A;  3TOB A;  1U3E M;  4BQN A;  2R4G A;  1Z21 A;  2KP6 A;  3JRE A;  2NXN B;  3CCJ I;  2B7E A;  2IGM A;  3CCE I;  1XSD A;  3RKQ A;  4XLE A;  3NRV A;  3LSM A;  3TL4 X;  4B1R A;  2ECB A;  2R7V A;  3S15 J;  2X6X A;  4CUG A;  3G6E I;  1XDU A;  4ZC3 A;  5EF6 A;  3OYI A;  4IHY A;  3K9T A;  3C2H A;  4MEX F;  3LSR A;  3ZQL A;  1WCM J;  3BT9 A;  3GTP J;  2E1M C;  4R1H A;  3K4J A;  2P0W A;  3EYY A;  1SVL A;  3RCO A;  4UB8 C;  4ZJZ A;  2WBM A;  2LLK A;  1BR2 A;  1CQT A;  4ABZ A;  2EFO A;  4IOC F;  3FXJ A;  1UHM A;  3I54 A;  1O57 A;  2PMU A;  1T56 A;  4EJO A;  5JR3 A;  1IAW A;  5D4S A;  1U8B A;  4I01 A;  1IXC A;  2H8R A;  4XID A;  2M34 A;  1BI3 A;  3K4C A;  3S3O A;  5FRM A;  3WHC A;  3ZMV A;  4KJZ A;  2DOF A;  1W4M A;  3CCV I;  1X1P A;  2A69 F;  2E34 A;  2L9N A;  3EET A;  5KK1 A;  4WK8 F;  2BYV E;  2L02 A;  2P6S A;  2XKP A;  3GYH X;  3DTK A;  4FE4 A;  1SAN A;  3E1S A;  4MEY F;  3K4M A;  1TW3 A;  3IL2 A;  1IV8 A;  2D2W A;  3AL0 C;  4WXC A;  3JW4 A;  3QAH A;  3U2R A;  4Z6Y A;  2O61 A;  4B44 A;  4G6Q A;  1JKO C;  2GBY A;  2K7L A;  1B6A A;  2JA8 J;  4F91 B;  2QKM B;  2E5Z A;  4BHB A;  4AU7 A;  2F4M B;  1MJA A;  5E1X A;  3PSF A;  4DBQ A;  3B6C A;  2WAD A;  1FMV A;  4HX7 A;  3BZK A;  4BH9 A;  2P6T A;  1YIJ I;  4EMS A;  2OTL I;  2FNA A;  4HYE A;  5FRO A;  1FOX A;  2HVS A;  4A3L J;  4F7Z A;  4H4K C;  3WTS C;  2CW0 F;  5E20 A;  4D5F A;  3RSN A;  1OKR A;  3OYE A;  4XM3 A;  2F6C A;  1ENH A;  1SD5 A;  2MG4 A;  2QQ8 A;  1WZ2 A;  2C6Y A;  3KP2 A;  1KQ9 A;  3QOD A;  2HDC A;  2D45 A;  3LSG A;  4MFE A;  4AIK A;  2FJ1 A;  2DK5 A;  4XNF A;  3I64 A;  1JKR C;  3MKL A;  3RPQ A;  3LQQ A;  5GAD J;  3WG9 A;  1MBK A;  1HST A;  4HAM A;  2QUF A;  2K4J A;  2LY1 A;  4KMF A;  3TGN A;  3QRF F;  3L9F A;  3PFI A;  4L0Z B;  5EYR A;  3ZQQ A;  3TDU C;  2Y0S N;  4BXU A;  1VQ7 I;  4JX4 A;  3S8P A;  4LD5 A;  4WXH A;  2DTR A;  3I4N J;  5HS8 A;  2DDA A;  2FML A;  3BR3 A;  2ECC A;  1RIO H;  2J5O A;  2W25 A;  2V1X A;  4FX0 A;  4DNC A;  3E0J B;  2M7B A;  2M8G X;  3AFH A;  3PL8 A;  3QYB A;  1TWF J;  1RUN A;  4J01 A;  4XBF A;  3KPH A;  2OA4 A;  2DAO A;  1IN8 A;  2NOG A;  1FZP B;  2XRL A;  1J75 A;  1MH4 A;  1ZH5 A;  2HZT A;  4XL9 A;  3PO3 J;  2L54 A;  4IJA A;  1TBX A;  1EJ9 A;  2QEX I;  4BE2 A;  3AG3 H;  5HLI A;  1MGT A;  1E17 A;  1X1A A;  2GA2 A;  5EEH A;  3KP7 A;  3RPU D;  2GM4 A;  3OMY A;  2VXZ A;  2VON A;  3OV8 A;  2XHK A;  5HLG A;  2LG4 A;  4DOZ A;  1I6X A;  1ON2 A;  3ZQF A;  1VQM I;  1YS6 A;  1GVJ A;  2DCE A;  1K6Y A;  2CSO A;  3A02 A;  2EBI A;  3OOU A;  1TW2 A;  1FOY A;  3PFY A;  2K9Q A;  2RQP A;  3K70 C;  4XLF A;  3FIS A;  3AG1 H;  5LHH A;  2PI0 A;  2LKS A;  5K5R A;  2O6G E;  1NK3 P;  4MO7 A;  1BW6 A;  5J40 A;  1CF7 B;  1BA5 A;  2MSY A;  1PP7 U;  2GAU A;  4B47 A;  4E70 A;  3HOS A;  3QYE A;  1W5T A;  3CDL A;  4HLY A;  2E35 A;  3PNY A;  1D8K A;  2JN6 A;  4ZH4 F;  3JRA A;  4UUT A;  1CF7 A;  2K9N A;  2MFZ A;  2OBP A;  4RB0 A;  3G71 I;  4M3F A;  3G2B A;  4FIS A;  3QPS A;  3BJA A;  4MLO A;  5DM6 F;  2CJJ A;  1GV2 A;  3KEO A;  3IH3 A;  5K5Q A;  2CQN A;  4PFO A;  3LL7 A;  5J4V A;  1QGP A;  2ID6 A;  1LFB A;  3JR9 A;  2IGN A;  3GBG A;  5LHI A;  5H20 A;  4BQQ A;  1R22 A;  3TOA A;  1FTT A;  3GLX A;  2RDP A;  5DS9 A;  3Q5F A;  2VBX A;  2PEX A;  2JWT A;  3KET A;  3DP7 A;  4U0V A;  1XS9 A;  2IS4 A;  1JHF A;  1U2W A;  2UXX A;  2X1E A;  3BPV A;  3FXQ A;  3I59 B;  3K10 A;  4B48 A;  3JSP A;  1Z9C A;  1JTY A;  4PGG A;  1QRY A;  2W48 A;  1VQK I;  4XMY A;  3PM1 A;  4QWQ A;  4B3A A;  1Z05 A;  2R7F A;  4XLA A;  1DDN A;  1I6H J;  3I59 A;  1VQ5 I;  2EIJ H;  2LY9 A;  1DPU A;  4ESJ A;  4BQO A;  3ABL H;  1UG2 A;  1VQP I;  2QQA A;  3HPH A;  2BY1 A;  3OWT A;  3OSG A;  1IN5 A;  2V26 A;  3WTX C;  3ELK A;  1WWX A;  5E3L A;  3ML6 A;  2XAJ A;  1QZE A;  2JA2 A;  2L4A A;  2HKO A;  2D5V A;  4FQG A;  2IJL A;  5L3D A;  1IRZ A;  2PMH A;  2P7V B;  2CFX A;  3DEW A;  3U9G A;  3U1K A;  4OU0 A;  2P7C B;  2R93 J;  2IEK A;  2W24 A;  3DTE A;  4LIU A;  1SVO A;  4FCY A;  4J19 A;  5AIQ A;  3OYN A;  2P5K A;  3BOQ A;  3ONQ A;  3S3M A;  2CUJ A;  3DEE A;  2E1N A;  4RDU A;  2EQR A;  1ZGJ A;  4U87 A;  3ERM A;  3CCU I;  3GF2 A;  2HPM A;  4RAZ A;  2GXB A;  3K4B A;  1EH6 A;  4A3K J;  4Y13 A;  4CIC A;  1C0W A;  2KRC A;  4I0A A;  4XOT A;  2A3S A;  1HW2 A;  2FSW A;  2IS6 A;  1QHH D;  1RET A;  5HS7 A;  1GXP A;  3DEU A;  4KNY A;  1ODD A;  5JLW A;  3G1O A;  3BZ6 A;  3L1P A;  3CJQ B;  4CDG A;  2J5P A;  2V6C A;  2HDD A;  2XF6 A;  1LDD A;  5EGO A;  3MAJ A;  3RTR A;  1P92 A;  5J47 A;  2YS9 A;  3HOV J;  3TBI A;  1ZG5 A;  4IL6 C;  2Y9Z A;  3ZOB A;  1S8N A;  4E7H A;  5K7H A;  2RVC A;  1G4D A;  1DU6 A;  2H6C A;  4HST A;  2QBY A;  1YTY A;  1IZ1 A;  1MD0 A;  5C4X J;  1ONV A;  1STZ A;  3BTI A;  3KCC A;  1BBY A;  1JXS A;  2JK3 A;  3WOD F;  3WTW C;  2XAU A;  2ZNZ A;  4KIB A;  3W3C A;  4RB1 A;  4B43 A;  1UST A;  4LLL A;  3HTS B;  3I0T A;  3QQA A;  3OIO A;  3P7N A;  1FJL A;  1WFX A;  5M5Y J;  1GLN A;  2GIV A;  2ZSH B;  1K79 A;  2I5U A;  3IUO A;  1A36 A;  4HNU A;  2JTV A;  1VQ4 I;  4WWC A;  3WTU C;  4KIS A;  3V4G A;  4F52 A;  2LRD A;  3S3N A;  3VWB A;  1OYY A;  2TCT A;  4PUS A;  3SEZ A;  3OYD A;  1V5E A;  2ISZ A;  3CUO A;  3FM3 A;  3Q9S A;  4HBL A;  5L3G A;  4DBR A;  1O4X A;  4BU2 A;  3A03 A;  4I2O A;  4ZYE A;  3K1M A;  4GYG A;  2ZNY A;  3U1D A;  1HLV A;  2ZFW A;  3OYB A;  2PG4 A;  5CVI A;  1YOV B;  4KUM A;  3W6K B;  5E3N A;  2DBB A;  2E7X A;  3WU0 A;  1XTA A;  3PO2 J;  1WH7 A;  3L09 A;  2MAB A;  4OMZ A;  4HSR A;  3MVP A;  2EWN A;  2XSD C;  4OMY A;  2ISY A;  3DFG A;  4CCJ A;  3KFW X;  3LWF A;  3HSF A;  5KAF C;  1S72 I;  4A12 A;  2WAE A;  3WE3 A;  4MHG A;  1K78 B;  2O7O A;  1BIA A;  2K3F A;  1FBU A;  3CES A;  3H92 A;  5IP6 A;  1U5T A;  2LOO A;  2ZBK A;  1Z3X A;  1FYM A;  2H09 A;  3UR3 C;  4EM0 B;  4YIF A;  2K3P A;  4MQV A;  1MMG A;  3LSH A;  3QWL A;  3W6J B;  3M1C A;  3WTZ A;  4BEH A;  3L2V A;  1H0M A;  1MJB A;  2Z99 A;  2VLA A;  3TP3 A;  3BPX A;  2QSG X;  3DLL F;  5HDN A;  1UFM A;  1K78 A;  1Z1D A;  4JX5 A;  4A0X A;  3HJE A;  3T1B A;  2VBW A;  2ME6 A;  3JSO A;  5ICE A;  2IGK A;  2NAZ A;  2AHQ A;  4N0B A;  2LMD A;  5TJJ A;  1LJ9 A;  3HB9 A;  5JFR A;  2XRN A;  3WE2 A;  2FOW A;  1IUF A;  1T95 A;  3W2W A;  2UXN A;  4ITV A;  2GWR A;  5B1B H;  4CCK A;  1MSF C;  3TO6 A;  3LSI A;  1REP C;  1AKH B;  3KX2 A;  3RKY A;  1WJD A;  4NDL A;  3P9I A;  1R4N B;  2QZ8 A;  1SMT A;  1XSX A;  2DA7 A;  1OCR H;  1ETV A;  2ZME C;  1MBH A;  1WJ5 A;  4BJ5 C;  1YS7 A;  1AKH A;  3BR5 A;  2X85 A;  5DTD A;  3I53 A;  2H94 A;  2KHM A;  3N97 A;  3BCA A;  2GIZ A;  1FOW A;  2XGD A;  1ZEL A;  2CV0 A;  3EYI A;  2E2H J;  3G1M A;  1YW9 A;  2GA1 A;  1P6R A;  3HIF A;  4O3M A;  1BW5 A;  1YW7 A;  1Y8R B;  1KYZ A;  3TMO A;  4HNV A;  2HWV A;  4RMN A;  1W5C C;  2DPD A;  1SFX A;  3TED A;  4IOA F;  2Z1D A;  3O6B B;  2FBH A;  1DUX C;  4Y4R A;  4M3G A;  4C3I J;  4ZTF A;  3JTH A;  3IWZ A;  3LST A;  3I5U A;  5GP9 A;  3LMM A;  4QLC U;  3GTL J;  3AKZ A;  1FSE A;  4V2G A;  3EUK L;  3C2G A;  3CC7 I;  2D1V A;  2Y9Y A;  1TNT A;  5DUK A;  2MD5 A;  3C7J A;  2LF7 A;  4RGX A;  3H9J A;  1SFK A;  2EA2 A;  2KIM A;  2NNN A;  5H6R A;  2Q1Z B;  5IT9 Z;  2K9L A;  2Z5U A;  1HXD A;  3JRF A;  2PLY A;  2CQX A;  3M9A A;  1RR7 A;  4BS9 A;  2CO5 A;  2Y0S A;  3WTT C;  1KU3 A;  3FXK A;  3VOE A;  1U78 A;  2CQQ A;  3M3Y J;  1UB9 A;  4II2 A;  5GPC A;  3LAJ A;  4IHX A;  4M6X A;  4BL0 B;  1WSU A;  1LB2 A;  3CCY A;  1ZTR A;  3JTG A;  1QO0 D;  4BJT A;  3ZRG A;  3BR0 A;  2E19 A;  3H9G A;  3VYU B;  4HNT A;  3M1E A;  3ABU A;  5F08 A;  2L9R A;  5K7F A;  4R79 A;  2R0Q C;  5BQT A;  1MSE C;  2HQR A;  2ESN A;  2FEZ A;  4KA4 A;  1MDM A;  1V3F A;  3H9Q A;  2ZJP F;  1F4K A;  1BR1 A;  2RQQ A;  4G7O F;  2OF7 A;  3P5J A;  1Z7L A;  2DYR H;  5DCM A;  3A2K A;  4RAF A;  4W97 A;  3K1P A;  2Z2S B;  4A3B J;  4M9S A;  2HKX A;  1UJ8 A;  2X6W A;  2ETH A;  4KT6 A;  1ZG1 A;  4FET A;  3GVA A;  5IT9 K;  3DLA A;  3KP3 A;  5HNH A;  3S16 J;  1NTC A;  2H8W A;  3LA7 A;  1V5F A;  3DQV C;  4F55 A;  3OYJ A;  1DP3 A;  2M5W A;  3RYR A;  1JE8 A;  2ZKZ A;  3BJ6 A;  1XMK A;  4EGY A;  4NC7 A;  5FFZ A;  2BE5 F;  3EQL F;  2IA1 A;  3CUQ C;  1TQI A;  3GME A;  4HW0 A;  3LAP A;  4IRG A;  2V6E A;  4FHT A;  4K2E A;  5LEJ A;  2DQR A;  4A0Z A;  4Y15 A;  1U8R A;  3HTU A;  3KYC B;  4YIR X;  4CCN A;  5E3O A;  3WHB A;  1OIS A;  3HOW J;  2NS0 A;  3A4C A;  4E7L A;  4LG0 B;  2EV6 A;  4RGS A;  1BI2 A;  2VT3 A;  3R60 A;  3QPL A;  2O9L A;  2XSJ C;  4LIT A;  4XKW A;  1OFC X;  4WF2 A;  2VL8 A;  2OQG A;  4M9X A;  4CZZ A;  1KA8 A;  3PQJ A;  4ZYA A;  1FYL A;  1W36 D;  2Z9O A;  4LLN A;  2DJI A;  4LG0 A;  1TL8 A;  3FXU A;  4UUS B;  1B9M A;  2MYS A;  1ZAR A;  3ZN1 A;  5IP7 J;  4HF2 A;  4EEF G;  2IPQ X;  1H89 C;  2FU4 A;  5L3C A;  3BG5 A;  2ME0 A;  1MKM A;  2YSR A;  2KIF A;  3J81 Z;  2XDV A;  2VJJ A;  2UV1 A;  4RGR A;  1HKT A;  5DDG A;  3FXO A;  3LOC A;  5FRN A;  3WTY C;  3T5X A;  3FK6 A;  1ZRD A;  2LNB A;  3DF8 A;  3F0C A;  3HEF A;  1KU7 A;  5M5W J;  1T38 A;  1MBJ A;  3J7Y J;  1N75 A;  1R7J A;  4I0B A;  4RAG A;  2O03 A;  5K5O A;  1MJ9 A;  1FEX A;  4V2F A;  3K2A A;  1TT0 A;  2OAZ A;  1U5T C;  3EDP A;  2Y0M A;  2DN0 A;  3PNT A;  2M9H A;  1S5L C;  1HCR A;  1UEL B;  1G3S A;  2QQB A;  3KLO A;  3I56 I;  3FX3 A;  5JLX A;  4CXF A;  5FLX K;  1KGS A;  3F8B A;  3U21 A;  3C3W A;  2QSF X;  3DCF A;  3MFK A;  1VF9 A;  4O5V A;  4HF0 A;  4OAY A;  1MMS A;  2VC1 A;  2HQA A;  2NRA C;  1I3Q J;  5K7Z A;  1H8A C;  1R5I D;  4MGR A;  4P9F A;  4TV7 A;  1IJW C;  4BGD A;  1Y0U A;  2TRT A;  1QPM A;  4IVN A;  4BDY A;  4G12 A;  4FAS D;  1O3S A;  2A6H F;  2JT1 A;  2ZSI B;  2KIU A;  4M9Z A;  1B4A A;  2ICW G;  1P7J A;  3TKY A;  3K7A J;  1X3W B;  1D8J A;  2QQ9 A;  3ABT A;  2EV0 A;  1B59 A;  1KU2 A;  2JVG A;  4U88 A;  1HC8 A;  3H1C A;  4MTD A;  3RIR A;  3ROU A;  3ISP A;  4HLX A;  2IA0 A;  1J9I A;  5IP9 J;  1O7F A;  3GFI A;  1X1C A;  2VBY A;  4AYB N;  5F04 A;  2GZW A;  4OIQ F;  3K4N A;  4I09 A;  1VQ6 I;  3FXR A;  2A07 F;  3VB2 A;  3JRH A;  2JSC A;  2DMP A;  2LF8 A;  1T6S A;  1RRJ A;  2M87 A;  1RR8 C;  4KN4 X;  5IOY A;  2ELJ A;  1R1T A;  2DMT A;  1PUE E;  5J8F A;  5M3F J;  3OR2 C;  3F8F A;  1HF0 A;  3O8H A;  4Y33 A;  4IHS A;  3V7R A;  1U9N A;  3FK7 A;  4S05 A;  2HOE A;  1WJA A;  4XRM A;  3H36 A;  1SFE A;  1D1B A;  2OC6 A;  4Q47 A;  4YFN F;  3WG7 H;  3L2R A;  3IRQ A;  3JRC A;  2A05 A;  4G94 A;  4M74 A;  2OZ6 A;  3OS2 A;  4QPO A;  3VPR A;  3TO7 A;  3CO6 C;  4GDF A;  2WTE A;  1LEA A;  2BXY A;  5IYD J;  4PDK A;  2F2E A;  3MCZ A;  2XGX A;  4HF1 A;  3QP5 A;  4XLC A;  4BY7 J;  1Q1V A;  5DUI A;  4P5O A;  3D5L A;  1YRN B;  4PSX A;  3VFZ A;  5FJ8 J;  1YQA A;  2P8T A;  2HQ5 A;  1I3A A;  3CCQ I;  3HM5 A;  3LA3 A;  4C2U A;  2MA3 A;  1YRN A;  2FX0 A;  2E2I J;  3BJO A;  3KZZ A;  1LVA A;  1FY7 A;  3EUH C;  4KMU X;  2R5Y B;  1ZK8 A;  2VPL A;  2IBD A;  2LTP A;  3V8L A;  5C4J J;  4ZDL A;  1D0X A;  4XIC A;  4E4H A;  3RPU A;  1QHG A;  4II3 A;  4AIJ A;  2LBF B;  3QPT A;  3ZQ7 A;  4AM3 A;  4L5E A;  2NVX J;  3DPT A;  2HYF A;  4WCG A;  4NB5 A;  2FF4 A;  4A3M J;  2V9K A;  4KN7 X;  3K70 D;  1SAU A;  2VC0 A;  1PDN C;  2BW3 B;  2LBF A;  1SD7 A;  3DKY A;  5ICC A;  1DQU A;  3H5N A;  4XN3 A;  3QU3 A;  1JJ8 C;  1B8I B;  1P4X A;  2MLK A;  1YX3 A;  4U0W A;  2VOP A;  2O8X A;  1QZZ A;  3LQR A;  3CC4 I;  5ED4 A;  2A5W A;  5DCF A;  4JK1 X;  1FWZ A;  3FMR A;  4IPA A;  4BXF A;  1HW5 A;  1S7E A;  1JUM A;  2Z16 A;  5IOZ A;  1USS A;  5F1J A;  3JAM Z;  1TWC J;  5DEQ A;  3RJP A;  3Q0W A;  2L7F P;  3QOP A;  1EV7 A;  3CMM A;  1H9G A;  3OYF A;  2CYY A;  1WPK A;  2LK2 A;  1ZYR F;  1MNE A;  2IXS A;  4Y17 A;  1Y56 A;  4QTR A;  1A35 A;  3TP0 A;  3OIQ A;  4XOR A;  5LHG A;  1U6G A;  4IX7 A;  2HPI A;  4S04 A;  2X4H A;  4LIV A;  5J4Y A;  1XGN A;  3K4K A;  1UZC A;  3TQN A;  3LFK A;  2X51 A;  2HXO A;  2KL4 A;  2E5N A;  3ABM H;  4AIH A;  4CGZ A;  4MQ9 F;  1IV6 A;  2BV6 A;  4M6V A;  1VQ8 I;  2CG4 A;  4AWX B;  2HNH A;  2PFB A;  4DQ2 A;  1HSJ A;  1HW1 A;  2MLG A;  1BI0 A;  1B9N A;  2HU9 A;  1T33 A;  1POG A;  1YJN I;  3GZ6 A;  2OUM A;  4D1Q A;  1JI8 A;  1UMQ A;  2QF7 A;  1L0O C;  1K4S A;  1PVE A;  1QNT A;  2P4W A;  3RZO J;  1Q1H A;  1T08 B;  3RQ4 A;  2KZG A;  2R3S A;  3COA C;  4BAC A;  5GAG J;  1IDZ A;  2R7T A;  2CH0 A;  2PBI A;  5JHF A;  3DBL B;  1T8I A;  2VKE A;  2X6O A;  4RLF A;  3CCR I;  5ICF A;  4EQQ A;  1QA6 A;  5IT3 A;  1DGW Y;  1NG7 A;  2DYS H;  3KIO A;  3P9K A;  5GAE J;  3BG7 A;  2LKX A;  1BC8 C;  4PJN A;  3OS0 A;  5E8I A;  4UVB A;  4E7S A;  4Q48 A;  2QEN A;  5DM7 F;  2GXG A;  3KP6 A;  4E7K A;  5FKL A;  2XVC A;  2JMW A;  2M4K A;  4JQF A;  2FQ4 A;  3FBI B;  2HDW A;  2DQL A;  2EZL A;  3DTI A;  4S0H B;  2R7R A;  3S17 J;  1K61 A;  5M3M J;  5LRR A;  4A69 C;  1IN7 A;  4IKF A;  2KKO A;  2A6E F;  2IVM A;  2VN2 A;  3L7W A;  1ZLK A;  4BY1 J;  3KYL A;  4L9T A;  4AVP A;  1OCP A;  2JVH A;  3ZP5 A;  3CDH A;  4G7H F;  3OS1 A;  2NYX A;  5EZH A;  2DMU A;  1M1E B;  2BY3 A;  2NNY A;  3AG2 H;  3R0A A;  2EIL H;  2W84 A;  2K4B A;  3SJM A;  1OLT A;  3M8F A;  4L5J A;  4EM2 A;  5GTH C;  2K5C A;  4DZJ A;  1ZRE A;  1VQ9 I;  2CRG A;  1JKQ C;  1RUO A;  3E5Q A;  1VND A;  2L9V A;  1LEB A;  4D9J A;  3A1Y A;  2F48 A;  2JJ7 A;  4B3X A;  1T98 A;  2A5Y B;  2WA0 A;  5E17 F;  3H5A A;  3FKJ A;  4PFP A;  1AWC A;  3WU2 C;  5EEA A;  3OYA A;  1QPI A;  1MBE A;  3SYT A;  1Y1V J;  2K9S A;  1DP7 P;  5JVT A;  2QA4 I;  2L7M P;  5D6F A;  4U7D A;  1N77 A;  2OZU A;  1GT0 C;  2ID3 A;  3NEU A;  1LE8 B;  4RM3 A;  2JRM A;  3A0B C;  2DA4 A;  1XDS A;  2KRF A;  2LRE A;  3CCM I;  5BMZ A;  2EFN A;  3FBN B;  4ETS A;  2ZJR F;  5FLM J;  2Y31 A;  2EFP A;  4Y52 J;  4RM2 A;  1FLI A;  4ENM A;  5D8K B;  5KNL A;  1T0F A;  3KZY A;  3HG9 A;  4CYD A;  1LE8 A;  1P4W A;  5E1W A;  1MZB A;  3V42 A;  2WWY A;  2R7Z J;  3G3Z A;  2CMP A;  4C2M J;  5AIP A;  5F27 A;  5HDG A;  5HLH A;  2ZJ2 A;  5LD2 C;  1TWA J;  2QVO A;  1QZY A;  1BR4 A;  1B72 B;  1BL0 A;  2HXI A;  3SHF A;  3GTO J;  4N4N B;  2RAE A;  3GWZ A;  1FOK A;  1G8X A;  2A6T A;  1R49 A;  1G59 A;  4IRI A;  5D8L B;  4NBQ A;  4LFU A;  1B72 A;  1BJA A;  2YR2 A;  1RI7 A;  1BOA A;  4A93 J;  3BDD A;  3B02 A;  3V8J A;  1TP4 A;  1JUS A;  3HBL A;  2EPF A;  2P81 A;  1YFH A;  4WX9 A;  1QVU A;  3BZC A;  4YEL A;  3FWE A;  3MWM A;  1W1W E;  5F64 A;  4QIW N;  4I6Z A;  3HKZ N;  1ETK A;  1E3H A;  1VQO I;  2WAQ N;  2VE8 A;  3DPL C;  1ZN2 A;  2Y48 A;  4MFD A;  2VIX A;  1D3Y A;  1FPQ A;  2EV5 A;  3BP8 A;  2ZB9 A;  2XAQ A;  4BE1 A;  1TQP A;  1TNS A;  4JYK A;  3MZH A;  4GFB A;  1OCC H;  4BUP A;  5F0C A;  2NVU B;  3ZXS A;  4XKV A;  1E3O C;  3S1M J;  1IGN A;  3DV8 A;  3BR6 A;  1SVM A;  4D7M A;  2AO9 A;  2XGC A;  2IA2 A;  4IXA A;  3Q0V A;  2H1K A;  2VOO A;  2JRT A;  1FNN A;  3HPG A;  1WVR A;  4UB6 C;  1BM9 A;  5JI6 A;  3OYM A;  3KZI C;  4LB5 A;  2Y75 A;  4AYB A;  4J00 A;  1XC5 A;  2FOK A;  1KYW A;  4XRF A;  2M0M A;  3J7Z I;  2BXZ A;  3R6S A;  2R5Z B;  3J80 Z;  9ANT A;  5EEG A;  3REO A;  5ERI A;  1MMA A;  3AG4 H;  1FP1 D;  2CWE A;  5EZG A;  5FKN A;  1E3P A;  2M7A A;  2ZXJ A;  1R1U A;  3CD6 I;  4LK0 F;  2R5Z A;  1OYI A;  2QWW A;  4Y3O A;  1R4M B;  4KIC A;  4PJJ A;  3K0L A;  4ENN A;  4PCQ A;  4ENK A;  4PK4 A;  5AON A;  4C9Y A;  2PMZ N;  5ICG A;  2HTJ A;  2LYC A;  1UHW A;  2F5V A;  3HYI A;  4BHC A;  3WTV C;  1TWG J;  2FA5 A;  2AS5 F;  2CQ7 A;  2K02 A;  5TRD A;  2YU9 J;  2VE9 A;  3GEZ A;  1LNW A;  4GXO A;  2EZI A;  2CW8 A;  3EPZ A;  4N9I A;  1N78 A;  1IRG A;  3D0S A;  3IHU A;  4A3J J;  2BZT A;  4ZDO A;  3MKY B;  3FKI J;  1E0E A;  4A2U A;  1FIP A;  2G9W A;  1KON A;  2FUG 2;  5EJC A;  1UAA A;  3IH2 A;  2XB0 X;  3GTG J;  5ILV A;  3L2U A;  1XSV A;  3J7A O;  2DDB A;  1FMW A;  2JQ7 A;  1YX5 A;  2R7O A;  1TWH J;  2BVM A;  3SDG A;  5B66 C;  1Z0X A;  2JZY A;  2NVT J;  3RKW A;  3W6V A;  4RA2 A;  2CFO A;  2DT6 A;  2B9S A;  5E18 F;  2IRF G;  1SFO J;  2F5E A;  5LRS A;  3H35 A;  2W7N A;  4LOC A;  2K9M A;  2X1C A;  2LDU A;  2ZJQ F;  2F4O B;  2XKO A;  5GAH J;  1ETO A;  4DZP A;  2Z33 A;  2O5R A;  4EJW A;  2FXA A;  3GUD A;  3CJN A;  2RKH A;  3B73 A;  5B5E C;  2CQK A;  2WY8 Q;  5KAI C;  5LEK A;  4FTH A;  1Y0N A;  2L7K A;  3K1N A;  4XSZ F;  2VQH A;  4F93 B;  1I50 J;  1D5Y A;  4G9Y A;  3CCS I;  2LVS A;  5DV5 A;  4IRH A;  3FZV A;  2EIM H;  2X1D A;  3R61 A;  3CME I;  4C30 A;  3H3U A;  3S1R J;  5KVR A;  4CO8 A;  1XGM A;  4IF4 A;  3T8T A;  3MMY B;  2OCE A;  1L3L A;  2NS8 A;  2E1M B;  5F0H A;  2NVQ J;  4CCM A;  1V55 H;  1Z6T A;  4RGU A;  3FHZ A;  3S14 J;  3VOD A;  3KLN A;  3UKG A;  2R7D A;  3LSJ A;  3VYR B;  2DOD A;  2YUS A;  3OYG A;  1WJB A;  3RZD J;  2B63 J;  4XLP F;  4EVI A;  4C2T A;  1YIO A;  3BR1 A;  1MBG A;  3IKV A;  4CZC A;  4ZZL A;  1IW7 F;  1ERD A;  1I1G A;  1T0F C;  1OCZ H;  3CLO A;  4Y7N J;  1LDJ A;  2RN7 A;  4LLG F;  4PGH A;  1F5T A;  3I55 I;  1UHS A;  5TIS C;  3R0J A;  5CVJ A;  3GZ5 A;  5JVG F;  1ZR2 A;  1OMI A;  3CF2 A;  4A3C J;  2QGU A;  4ASN A;  4QPQ A;  1AHD P;  1WGX A;  3ECH A;  2VJI A;  4XSX F;  3ZQI A;  5J1R A;  1ZLJ A;  3AL0 B;  4XKB A;  2B0L A;  1RC9 A;  1W5S A;  3F3X A;  1KU9 A;  3D5S C;  1D1C A;  1LKX A;  5CLS A;  3WGH A;  4BE0 A;  2HFH A;  3HOT A;  2WAF A;  1XMA A;  5GTI C;  4NC6 A;  3TDZ C;  4P55 A;  1EKE A;  4BHP A;  2W85 A;  3H0D A;  4D0P A;  4FT8 A;  2KJB A;  1E2X A;  2DMN A;  4M71 A;  1UCR A;  2ELH A;  2G0E A;  3HGY A;  5CQG A;  1XCB A;  3V7S A;  1W0T A;  1NK2 P;  4EAT A;  5FKK A;  3HOY J;  4BKX A;  2M45 A;  3HOZ J;  3BR2 A;  3ZN0 A;  1YI2 I;  1SD6 A;  1ZAO A;  3MEX A;  1UG0 A;  2L9S A;  5BOX A;  4I98 B;  2R7X A;  3WGI A;  1IRX A;  4GGG A;  2WV1 A;  2M4G A;  1PJR A;  3RYP A;  2HEO A;  4G6D A;  4OIO F;  3ZQG A;  3N4M A;  4HOB A;  4L9N A;  2CV1 A;  3BC8 A;  1MMD A;  1X4P A;  3MZY A;  2CUZ A;  3T8R A;  1Z67 A;  3O3K A;  3SZG A;  4RAY A;  3AAF A;  3OYL A;  4ON0 A;  3QOE A;  4XK4 A;  2DW4 A;  3S2D J;  4D7N A;  4RB3 C;  4BDZ A;  4ZYG A;  2LY2 A;  2DA3 A;  2X0L A;  4A3F J;  2MC4 A;  5E3M A;  4CYC B;  4LMY A;  4P1W A;  1ETX A;  4KT5 C;  2QM3 A;  2MW8 A;  2RC4 A;  2MH2 A;  3D5R C;  5LGN A;  3PNV A;  2DMQ A;  5EDN A;  1TC3 C;  3RKX A;  3ZGK A;  4UY8 I;  2R92 J;  4X6A J;  5H6Q A;  4ZZD A;  3GZN B;  2KMU A;  4UUS A;  1D0Z A;  3OYH A;  5FGM A;  1BIB A;  1Y1W J;  3HZJ A;  3GO5 A;  2HOT A;  1LDK B;  5K1Y A;  2OTJ I;  5L3F A;  1V5G A;  1XMX A;  4IQ4 A;  2BGC A;  5C3E J;  3ZQC A;  4M73 A;  1ULY A;  1B1B A;  2V79 A;  1FC3 A;  1ZG3 A;  1BOB A;  3M8E A;  2LH9 A;  4BXX J;  1G2H A;  1ITY A;  4FX4 A;  3NAR A;  3BWG A;  2BY0 A;  2KQR A;  3C18 A;  3I4P A;  3ZMZ A;  4M3E A;  2IS1 A;  3CCL I;  3SFZ A;  2DA5 A;  3SZP A;  5M5X J;  1Y8Q B;  1FSH A;  4E7Z A;  4P9U A;  3D1N I;  3V8K A;  4A5N A;  1JGG A;  2HQN A;  2FRH A;  3E97 A;  4M72 A;  3OY9 A;  4I02 A;  2DPU A;  3ZPL A;  3R4K A;  4A3I J;  2W82 A;  2EIN H;  3E3V A;  3J81 K;  1HOM A;  2VKD A;  5B3S H;  2STW A;  3GTQ J;  1DGR M;  5KCM A;  1MMN A;  6PAX A;  3P9C A;  4A5M A;  3GCM A;  4CA0 A;  1CGP A;  1KQ8 A;  4Q4Z F;  2F5F A;  1XB4 A;  1K83 J;  1Y6I A;  4AC0 A;  1IC8 A;  1D5V A;  1HA8 A;  4XN0 A;  1XCV A;  4HZF A;  4G7Z F;  3O2P E;  1JT0 A;  5FFX A;  1VFC A;  4L5I A;  1IN4 A;  2G7H A;  3ZMS A;  2F5D A;  4NNJ A;  2KFD A;  3GFJ A;  2ZXW H;  4Z2Y A;  4E7J A;  2VKH A;  4KIF A;  4ESF A;  3GFM A;  1BN5 A;  3VYS B;  3L2W A;  4NQW B;  4C3J J;  3N05 A;  2YU3 A;  5CVU A;  2HZD A;  4YFK F;  3CMA I;  3HKZ A;  3OR1 C;  2JSP A;  5L3E A;  2YX7 A;  3F21 A;  1O3R A;  2HI3 A;  1XGS A;  2WAQ A;  2XV4 S;  3ESW B;  1JT6 A;  4LGW A;  2PN6 A;  4NQW A;  2X48 A;  1WI3 A;  4LG3 A;  5F6F A;  1AOY A;  3ABK H;  2IAI A;  1W36 C;  2QYO A;  5J1Y A;  1YO5 C;  2XAG A;  3CO7 C;  2EA4 A;  4CCL A;  5FKO A;  2V4J C;  4JP0 A;  4UVA A;  3H5R A;  2KDO A;  2L0K A;  3IAM 2;  1QQI A;  2Q0O A;  3LSK A;  2QLZ A;  1MW7 A;  3A0H C;  1YIT I;  1HDP A;  3QPH A;  1QVT A;  2UZK A;  5D6E A;  1BI1 A;  4E7I A;  2XPV A;  2O0Y A;  2K27 A;  2XPW A;  2LKP A;  1P2F A;  2XF7 A;  3HXL A;  2O8K A;  3E5X A;  2V1D A;  4EM1 A;  1WHU A;  2PX9 A;  3CP8 A;  3IWF A;  2XRO A;  4I76 A;  3I4M J;  1R1V A;  2VQC A;  3NWS A;  4AUX A;  1V54 H;  2QCO A;  4EJV A;  1G3Y A;  2DLL A;  2FMY A;  1YYV A;  1ZQ3 P;  3SDB A;  2W00 A;  3C1D A;  1IRF A;  4A6D A;  3S2W A;  4KIT B;  2HOA A;  3CTA A;  4HV5 A;  4YEJ A;  2PMZ A;  3A01 B;  1GXQ A;  5IY5 H;  3JRB A;  2R5Y A;  3L00 A;  4BJ6 C;  3OL3 A;  3F8M A;  3S1N J;  3ZR8 X;  1LQ1 A;  3VYT B;  1TTY A;  2TDX A;  5CJ9 A;  4YRV A;  2MC3 A;  3A01 A;  2DK8 A;  4CSW A;  4G6T B; 
#chains in the Genus database with same CATH homology
 5IYC J;  2VUM J;  1IUF A;  1FTZ A;  1GT0 C;  3Q0U A;  5J3L A;  1MSF C;  2ID3 A;  1LE8 B;  2DA6 A;  1AKH B;  3BTJ A;  4NDL A;  2DA4 A;  1MH3 A;  1B8I A;  2OPT A;  2E2J J;  3ZQH A;  1OCT C;  4IHW A;  2DA7 A;  2WB1 N;  5FLM J;  2Y31 A;  4Y52 J;  1FIA A;  4M3D A;  1ETV A;  1MBH A;  5EG0 B;  1LE8 A;  1AKH A;  2R7Z J;  3BR5 A;  5DTD A;  3BQY A;  4C2M J;  5F27 A;  2VKV A;  2XGD A;  2CU7 A;  2E2H J;  3G1M A;  1JKP C;  1TWA J;  2M2E A;  1B72 B;  3MN2 A;  1BL0 A;  1BW5 A;  2HXI A;  3GTO J;  3GTM J;  4HNV A;  5EG0 A;  2RAE A;  5IYB J;  3TED A;  3TW7 A;  3H3V K;  2JA7 J;  4M3G A;  4C3I J;  1B72 A;  4A93 J;  4DYQ A;  5GP9 A;  3GTL J;  1JUS A;  3HBL A;  2P81 A;  4V2G A;  3S1Q J;  1QVU A;  2Y9Y A;  3HOU J;  3RQI A;  1X2N A;  2LFB A;  3IH4 A;  4QIW N;  4I6Z A;  3BTC A;  3HKZ N;  1ETK A;  2LR8 A;  2E1O A;  2EH3 A;  3JRF A;  2WAQ N;  2CQX A;  1RR7 A;  1HDD C;  1IDY A;  4B4C A;  3BQZ A;  4MFD A;  1U78 A;  4A3E J;  2CQQ A;  3M3Y J;  2ZB9 A;  5GPC A;  3JRE A;  4IHX A;  4JYK A;  4GFB A;  3CCY A;  3FIW A;  5F0C A;  3RKQ A;  1ZTR A;  1E3O C;  4B1R A;  2ECB A;  3S15 J;  3S1M J;  3BR0 A;  2E19 A;  1IGN A;  1OJL A;  1APL C;  3BR6 A;  5EF6 A;  4D7M A;  5F08 A;  4IHY A;  2AO9 A;  2L9R A;  5K7F A;  3LSR A;  1WCM J;  3BT9 A;  2R0Q C;  3ZQL A;  1MSE C;  2XGC A;  3GTP J;  1X2M A;  3Q0V A;  2H1K A;  2JA6 J;  4IHV A;  1XC5 A;  2LLK A;  1CQT A;  2R5Z B;  4ABZ A;  9ANT A;  2OF7 A;  4M3B A;  1GV5 A;  2N8G A;  4W97 A;  1T56 A;  5FKN A;  5EZG A;  4A3B J;  3OSF A;  1U8B A;  4JX6 A;  2M0C A;  1Z77 A;  1MBF A;  2H8R A;  4XID A;  2M34 A;  2R5Z A;  3S16 J;  1NTC A;  3JRD A;  1F36 A;  1GVD A;  2XB5 A;  1BJZ A;  2PMZ N;  3WHC A;  2NVY J;  1TWG J;  1LFU P;  1A6I A;  2YU9 J;  5FKM A;  4FE4 A;  1SAN A;  2EZI A;  3O8G A;  3CQZ J;  1IG7 A;  1XG1 A;  4A3J J;  1ZR4 A;  5E3O A;  3FKI J;  3WHB A;  3HOW J;  1FIP A;  1ZGW A;  1JKO C;  2GBY A;  3QPL A;  2O9L A;  2JA5 J;  1OFC X;  2JA8 J;  3IH2 A;  2XB0 X;  3GTG J;  2CUF A;  5C44 J;  3LSP A;  3B6C A;  4UUS B;  1TWH J;  5IP7 J;  3SDG A;  1Z0X A;  2NVT J;  3W6V A;  4EEF G;  1H89 C;  3JRG A;  3BG5 A;  2ME0 A;  4A3L J;  1SFO J;  4QSH A;  3LOC A;  4LOC A;  1ETW A;  1RPW A;  2DJN A;  4D5F A;  3FK6 A;  1ETO A;  4DZP A;  3F0C A;  3HEF A;  1ENH A;  4XRS G;  2MG4 A;  5M5W J;  4FTH A;  1MBJ A;  2LD5 A;  3LSG A;  4MFE A;  2FJ1 A;  1I50 J;  1FEX A;  4V2F A;  1D5Y A;  3K2A A;  2LVS A;  2XPU A;  1JKR C;  3MKL A;  2DN0 A;  2M9H A;  1HCR A;  1MBK A;  3S1R J;  5JLX A;  3CMY A;  1MNM C;  5EYR A;  2NS8 A;  5F0H A;  3JRI A;  2NVQ J;  3DCF A;  1VF9 A;  2Y0S N;  4JX4 A;  3S14 J;  3UKG A;  1I3Q J;  3LSJ A;  5K7Z A;  1H8A C;  3I4N J;  2HOS A;  4D5C A;  1ORK A;  1IJW C;  2YUS A;  3HDD A;  2TRT A;  3BR3 A;  2ECC A;  3E7L A;  3RZD J;  2B63 J;  4G12 A;  2M8G X;  1TWF J;  5EGO B;  2MGQ A;  1P7J A;  3BR1 A;  3K7A J;  5J1U A;  5IPA A;  4DYR A;  1MBG A;  2NOG A;  2XRL A;  1MH4 A;  2DTZ A;  1A5J A;  4Y7N J;  5IP9 J;  1UHS A;  3PO3 J;  3A01 A;  4AYB N;  5F04 A;  1ZR2 A;  4A3C J;  1GUU A;  3JRH A;  2DMP A;  1AHD P;  5BNG A;  1WGX A;  2GM4 A;  3ZQI A;  5J1R A;  2ELK A;  5IOY A;  1RKT A;  2DMT A;  5M3F J;  1HF0 A;  3O8H A;  2COB A;  3ZQF A;  1U9N A;  3FK7 A;  3A02 A;  2EBI A;  3OOU A;  4XRM A;  1WH5 A;  2KDZ A;  2K9Q A;  3JRC A;  3FIS A;  1F43 A;  3HGG A;  1GDT A;  1NK3 P;  4MO7 A;  3VPR A;  1BW6 A;  2DMN A;  2G0E A;  3HGY A;  1BA5 A;  1AU7 A;  1W0T A;  5IYD J;  2MSY A;  1NK2 P;  5FKK A;  3HOY J;  4BKX A;  3HOZ J;  3BR2 A;  3CDL A;  4BY7 J;  1Q1V A;  4XRS A;  2JN6 A;  3JRA A;  4UUT A;  2K9N A;  1YRN B;  2WV1 A;  4M3F A;  4BBS J;  4FIS A;  2GLO A;  3QPS A;  1ETY A;  4MLO A;  5FJ8 J;  3ZQG A;  2CJJ A;  1GV2 A;  2HQ5 A;  2KT0 A;  3IH3 A;  2DA2 A;  3HM5 A;  4A3G J;  2I10 A;  2ID6 A;  1LFB A;  1YRN A;  3JR9 A;  2FX0 A;  3GBG A;  2E2I J;  4MIM A;  1FTT A;  5DS9 A;  4DW6 A;  4XK4 A;  2R5Y B;  1ZK8 A;  3TW6 A;  2IBD A;  2LTP A;  3S2D J;  2JWT A;  4D7N A;  5C4J J;  4XIC A;  1XS9 A;  2DA3 A;  4A3F J;  3GTK J;  5E3M A;  4CYC B;  1ETX A;  5HOD A;  3G1L A;  2MW8 A;  2EZH A;  1JTY A;  4L5E A;  2DMQ A;  1QRY A;  5EDN A;  1TC3 C;  2NVX J;  4X6A J;  2W48 A;  2R92 J;  3PM1 A;  4B3A A;  1U9O A;  4UUS A;  4A3M J;  1I6H J;  1Y1W J;  2LY9 A;  2VI6 A;  2HOT A;  1JJ8 C;  1B8I B;  1UG2 A;  3H0G J;  5C3E J;  3ZQC A;  1JTX A;  4FE7 A;  3OSG A;  5E3L A;  1RES A;  4BXX J;  1JJ6 C;  1G2H A;  3GTJ J;  1ITY A;  1S7E A;  1JUM A;  3NAR A;  5IOZ A;  5F1J A;  2D5V A;  1TWC J;  3Q0W A;  1IRZ A;  2L7F P;  2L7Z A;  3DEW A;  1R9T J;  1ETQ A;  2R93 J;  2IEK A;  1WPK A;  2LK2 A;  2XGE A;  4M3E A;  4FCY A;  4J19 A;  3S2H J;  4QTR A;  4IEJ A;  2DA5 A;  5M5X J;  3TP0 A;  1EF4 A;  4RDU A;  3NAU A;  2EQR A;  2HYJ A;  3D1N I;  2LP0 A;  1JGG A;  3SFI A;  4A3K J;  4C3H J;  2HXO A;  4A3I J;  1RET A;  4X1E A;  1IV6 A;  1HOM A;  4DYC A;  4M6V A;  3GTQ J;  5JLW A;  2X9D A;  3G1O A;  3L1P A;  3B6A A;  3BG9 A;  2HDD A;  1PUF B;  1T33 A;  1POG A;  5EGO A;  4AC0 A;  1K83 J;  1IC8 A;  3HOV J;  2YS9 A;  2Y9Z A;  1JT0 A;  1UMQ A;  2QF7 A;  3ZOB A;  1VFC A;  5K7H A;  1VI0 A;  1DU6 A;  1PUF A;  3RZO J;  5C4X J;  3BTI A;  2NS7 A;  1IDZ A;  2CUE A;  2JK3 A;  1W0U A;  4C3J J;  3BG3 A;  2VKE A;  2X6O A;  3QQA A;  3OIO A;  1FJL A;  2HI3 A;  5M5Y J;  1RKW A;  5F0F A;  2K40 A;  1JT6 A;  2LKX A;  2X48 A;  1WI3 A;  4BBR J;  2IAI A;  2TCT A;  4W1U A;  5FKL A;  2JMW A;  5J1Y A;  3M4O J;  2FQ4 A;  5FKO A;  4JP0 A;  2EZL A;  2L0K A;  4S0H B;  2EZK A;  2VPR A;  1O4X A;  1K61 A;  5GPA A;  5M3M J;  3A03 A;  3S17 J;  4A69 C;  1HDP A;  3IV5 A;  2Y2Z A;  1HLV A;  1QVT A;  5E3N A;  3HOX J;  2XPV A;  4BY1 J;  3C2B A;  2XPW A;  1P7I A;  1JUP A;  3PO2 J;  1WH7 A;  1OCP A;  5FLV A;  2DA1 A;  1H88 C;  2O8K A;  5EZH A;  2DMU A;  4A3D J;  2Y30 A;  1DU0 A;  3MVP A;  4I76 A;  2XSD C;  3I4M J;  3SJM A;  4AUX A;  2QCO A;  4DZJ A;  2CRG A;  2O7O A;  1ZQ3 P;  1JKQ C;  5IP6 A;  1VND A;  2HOA A;  2JJ7 A;  3A01 B;  3JRB A;  3TP3 A;  2R5Y A;  3BTL A;  4JX5 A;  2FD5 A;  5EEA A;  1QPI A;  3S1N J;  1MBE A;  4CYC A;  1X58 A;  1ZKG A;  1Y1V J;  2K9S A;  2ME6 A;  4RBO A;  3LNQ A;  2AHQ A;  2L7M P;  3HB9 A;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...