4J01A

Crystal structure of fischerella transcription factor hetr complexed with 29mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 62
structure length 294
sequence length 294
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A02
4IZZA 4YRVA 4J00A 3QOEA 4HRIA 3QODA 4J01A
chains in the Genus database with same CATH superfamily
5J40A 2D1VA 3J81K 3BJAA 1D0ZA 2Y30A 2K3FA 4RB3C 1FP1D 2Z3YA 5L3FA 3DEEA 5A2QZ 2JA6J 2XPWA 1YE9A 1KU3A 2JRTA 2BXZA 3TOBA 4HNUA 1YJ9I 3RQ4A 2XROA 3O3KA 5GP9A 2VJ5A 1K6YA 2EZKA 2JN6A 2WAQN 3GBGA 1MBJA 1D0XA 4J00A 1QZYA 2HS5A 2HI3A 4CSWA 3RIRA 3F22A 3Q3SA 4XMYA 1E2XA 1XTAA 3U1DA 4FCYA 1U0JA 3G1LA 1AKHA 1FX7A 3R6SA 1Z3YA 3VFZA 6PAXA 3O2PE 1KYWA 1W5TA 2CG4A 2R7UA 2HYGD 1FP2A 2LH9A 5FKNA 2VXDA 1Z0XA 1P6RA 1FIPA 3OS1A 2EFNA 4A69C 1BR2A 3K4JA 1HW2A 2DQRA 3S16J 3C18A 3NEUA 2KMUA 3OYMA 4IRHA 3TP0A 2M30A 4A3LJ 2YR2A 1LFBA 2NVYJ 4RB1A 1ZTRA 4IO9F 1K4TA 2JPBA 3CMMA 3P9KA 2X48A 3B6AA 3QOPA 4PJJA 1GVDA 2ZJPF 1Z6TA 1G3TA 1MMNA 2DMQA 1XSXA 2ZNYA 2VE9A 3KZIC 5M5XJ 2NS0A 2JZYA 3BCBA 5LEJA 1X3UA 1XDUA 3FXRA 3SDBA 5D5WB 4FTHA 1DUXC 2ZFUA 5FLVA 1Z77A 5H6QA 2BHZA 2F5FA 2K9LA 5E1WA 1SVMA 2QSFX 2IGOA 4X0GA 2EFOA 2O8XA 2IS6A 1Z91A 4OU0A 4A2UA 2R7XA 2M3AA 2LF8A 1PUEE 2M34A 2YSRA 2L3DA 2PLYA 4IHVA 2MLKA 1MJAA 2OZ6A 1KU7A 2X6XA 4E7SA 5F1RA 5JLXA 2QCOA 3KYDB 4GYGA 4P5OA 5LD2C 5EG0B 5GAGJ 3TDUC 3FXUA 3S93A 4ZJZA 4HOBA 4V2GA 1FBQA 2O8KA 2LY9A 3HB9A 4A3DJ 3BLYA 3VSLA 4F7ZA 3DKWA 4B1RA 1TTYA 5FKMA 1ORKA 3GTQJ 2L02A 4D5FA 2DA5A 4DW6A 4OMYA 1YG2A 3MZYA 1PP8F 3HRMA 1F9NA 3B73A 4GGGA 4IVNA 4NC6A 1JJ8C 1GLNA 4M3DA 3S3OA 2V1XA 1JKOC 3WGIA 2TRTA 2MC3A 3RKYA 1J7KA 4EM2A 2RV8A 1Y56A 1WHUA 2ZJRF 1O3TA 1ZREA 3H5NA 4X6AJ 1K78B 5D5XB 3IH2A 2QQ8A 5D4SA 5F08A 3LWFA 2DJNA 1I3AA 4CH7A 4CA0A 3TEDA 1RR7A 4O3MA 1FSEA 3K4MA 4G7ZF 2FNPA 3WTSC 1POGA 2ETHA 4AYBN 1P4XA 4JX5A 2Y75A 1OCRH 1TQPA 3E6BA 4G12A 2MSYA 4V2FA 2E71A 4XL9A 3GCMA 1CF7B 3VPRA 3KP6A 1X4PA 1O4XA 4HX8A 3ZN0A 3LFKA 3WTTC 4EEFG 4L5EA 1QU3A 5BPIA 5K5QA 4M3FA 1T2KA 4MGRA 1E3PA 1GT0C 1JJ6C 2Z33A 1WJAA 1L0OC 2DFFA 3HGYA 3FDYA 2K4BA 2CFXA 3C3WA 1HC8A 4KIFA 2XF6A 1ZK8A 1YQAA 4U0YA 4RS8A 5LGUA 4KN7X 1IXCA 4U0WA 1HA8A 1YW7A 4NDLA 1KQ9A 3F8FA 1A5JA 4PFOA 1MGTA 2VKHA 1NH3A 4MFEA 5DEQA 2GXAA 3RPUD 3SQNA 1RNLA 4FASD 4ENNA 3BZ6A 2CS3A 1ACIA 4E7HA 3ABLH 4I6ZA 1USTA 4DZPA 2WADA 2G9WA 4RGUA 9ANTA 5IYDJ 4JQFA 1Z9CA 1OR7C 2AO9A 5FB2A 2LFBA 3QAHA 2P8TA 3E7LA 3TO9A 3HPHA 5E1ZB 1XS9A 4P9FA 4Y4RA 2V4JC 1XCVA 3LSTA 4IQJA 1Q1HA 2K7LA 1X3WB 2NVUB 3TP3A 1S8NA 4XKWA 4XRSA 3H35A 4HG2A 4KIBA 3ZXSA 2FBIA 2IEKA 3S3MA 2QYOA 3S1NJ 2R7ZJ 1MBHA 4ASNA 2R7TA 3SZTA 4RLFA 5HDKA 1XX5A 4QLCU 3I59B 3H1CA 1TT0A 4RAZA 1V3FA 2P6SA 1MBEA 2JRMA 2ZSHB 1FYKA 2VONA 1MMDA 1K6OA 4TV7A 3GXOA 1YS6A 2W4SA 1IXSB 3I5UA 3IAM2 3ONQA 3UR3C 1KYZA 4R79A 2W48A 2CH0A 2DOFA 1F5TA 2H1LA 1T33A 4DQ2A 3COAC 1S3JA 2FF4A 3I9V2 5AIQA 2VKDA 5BMZA 1AA7A 3HKZN 2CJJA 2YX4A 1OYYA 3DTKA 3RYPA 2K85A 3CJRB 3F23A 2STTA 1ULYA 2HTSA 1B72B 3BT9A 1FLIA 2OQRA 4CCKA 3FWEA 3KEQA 5A2QK 1VQ4I 2RC4A 2VUMJ 2BW3B 3TGNA 5LHGA 5FROA 4LFUA 4I98B 3I4PA 5M5WJ 2CQXA 3D1NI 3DXJF 1LE8B 3ZQLA 4BEHB 3W6VA 1MZBA 3PFIA 4ZZDA 1ON1A 2M7BA 2DXIA 2A6TA 4UHTA 2HWVA 1T6SA 1O7LA 1YJNI 2CQQA 3QU3A 2FRHA 3SFIA 3V8JA 5H2FC 3OSGA 2JSCA 3CC2I 4NUBA 2AQEA 4AIHA 3RCOA 2QZ8A 3A03A 2HEOA 5L3CA 2MC4A 2UXXA 2P0WA 2JA2A 2FX0A 2EILH 1BOBA 4LIVA 5J8CA 3F3XA 1ZN2A 2H1KA 1E17A 5FJ8J 2QSGX 1WJEA 3GTKJ 1R23A 4LJZF 3PM1A 3MZHA 3KIOA 2KZVA 4DOZA 2LREA 1ERDA 2LY2A 2R7QA 1JGGA 4A6DA 3RTRA 1W5CC 2KL4A 2AHQA 4ZYEA 4RA2A 3GWZA 2TCTA 2P6TA 2YX7A 4CO8A 5F0HA 2DFEA 2K9MA 4E7LA 3LFUA 5KNLA 4NNJA 1UB9A 1AWCA 2DA4A 3ZR8X 2CV0A 4BDZA 2WTEA 2ZSIB 3VB2A 2QENA 3HSRA 3T8TA 5E1XA 3W6JB 3U1KA 2W24A 1CQTA 3TO7A 3CJTB 2X1DA 2MFZA 2IVMA 2DOAA 3NARA 3V4GA 2KIMA 4DIQA 4OWRB 3CDIA 3EUAA 4JBAA 1IUFA 2L4AA 3S2DJ 3K6GA 2ELHA 2IAIA 3GLXA 1QHGA 2RNGA 3RPUA 3SZGA 2DDAA 3ABKH 1VQOI 2PMZA 1JKRC 2BVLA 2EIKH 5GPAA 4RDUA 4LMYA 2YPRA 4OIOF 3TW7A 4HAMA 3TOAA 3R0AA 3I56I 3BR6A 1DPUA 2HXIA 2O5RA 2FMLA 3ASOH 3H92A 3TQNA 1HSTA 4A0XA 3OV8A 2HOSA 3L9FA 4YFKF 2BY0A 3HL2A 1QVUA 2O3FA 3CMYA 2BV6A 3LAPA 3D0SA 4M73A 3DBHB 4HV5A 2A61A 3A01B 3K4BA 2OQGA 2VXZA 2VC1A 3LQRA 4IKFA 3TKYA 4UY8I 2L4MA 1Z05A 3C2BA 4IPAA 1JUPA 1KGSA 3OYBA 5E8GA 2R0QC 4UUTA 2DMTA 2ZO4A 3CCJI 1QZZA 2IGMA 2GLOA 1IV8A 2FNAA 3LQQA 5BS6A 2CU7A 2KIQA 1S9HA 2NXNB 3E6DA 4C2MJ 3NWSA 3BY6A 3K1NA 3OWTA 3BG9A 1NTCA 3WU2C 2VT2A 2NS7A 3DEWA 5F27A 2FOKA 4EATA 3NAUA 4IHSA 3FIWA 3OYCA 4Q5SF 4BU2A 3MEXA 1IO2A 2K5CA 3OYJA 1LUJB 2L7ZA 2M8GX 4PJNA 3G71I 4RBOA 4BGDA 1SD7A 3A1YA 2CRGA 2LK2A 2HZDA 3V8KA 2VBZA 2PEXA 1YO5C 1N75A 4L18B 3K10A 4N9IA 1EJ9A 1BBYA 3E0JB 4MNUA 3CC4I 5CLSA 5E8IA 4EJVA 2DODA 2HQ5A 5FLXZ 3WTVC 1OCPA 1RUNA 3D5RC 4M71A 4XN3A 1DDNA 3Q9VA 4CCJA 3EUHA 3ZRGA 3IWFA 1K4SA 5IP9J 2PJPA 1IF1A 3VSKA 4KMUX 4A3IJ 3P5JA 2VBXA 1ETWA 2XHKA 3E97A 1S7EA 2H94A 2DI3A 4NC8A 3VYTB 4C2UA 2XGXA 3GFIA 3NQOA 4I09A 2X1EA 3BG7A 2O9LA 3LSRA 1Y0NA 4AIKA 4CCOA 2KKOA 3K70D 3BTIA 1RUOA 4N4OB 5CVIA 4EJOA 5DDGA 2JWTA 4C9YA 3Q0UA 4IF4A 1X3ZB 3PSFA 3OYAA 1MNEA 1W5SA 3I71A 2HNHA 1MMAA 4QTRA 5CPRB 1UCRA 2CO5A 1TNSA 3OYLA 3I55I 2H6BA 3BG3A 5ERIA 1D5VA 5D5UB 4BH9A 5HS7A 3WTXC 3RZDJ 3ZMVA 1NK3P 3FMRA 2I8DA 4ZYDA 1HDDC 3DU5A 2UWMA 3ZMUA 2Y2ZA 1YITI 1KZHA 1WCMJ 3JSPA 1DGWY 1MIJA 4S0HB 2ESHA 2DA3A 4F92B 1X4OA 3K1MA 5JHFA 3CQZJ 3J7ZI 1MNDA 5EF6A 4L9JA 3PIPF 3FF5A 2R5YA 3DF8A 2PJRB 3CC7I 4ZTFA 4EM1A 5CYVA 2K9QA 2FU4A 4AC0A 3AFHA 3DPTA 3DTIA 4LK1F 4XBFA 1OQYA 1R4MB 1KQ8A 4GXOA 2DQLA 2DTRA 2PN6A 1I6HJ 3HSFA 3FBIB 1GHCA 3HPGA 5DYMA 5J8FA 2ZMEC 1TQIA 1B8IB 5D6FA 3RKWA 1ZGAA 2F4MB 4XLAA 3WU0A 4RB2C 3M7GA 2K4JA 2E7XA 2KRFA 2QBYB 3M4OJ 2VI6A 4BE1A 5J3LA 1YRNA 1U5TA 3LSGA 3K1PA 4ZDPA 3I54A 4IOCF 1ODDA 2HOEA 4RGSA 5JFRA 1JKPC 1YYVA 3QWLA 2NVXJ 1SVOA 3VYUB 1ZG5A 1F4KA 4YRVA 5KAIC 2VPLA 3MD2A 3ZN1A 3DEUA 3QOEA 4Y3OA 1ZH5A 1X1CA 2OD5A 3HOXJ 3OR2C 4AVPA 4NQWA 2D45A 1G3SA 4UUSB 3BG6A 4E7JA 3GZNB 2DDBA 2MD5A 4ZZLA 4BJ6C 4CYCA 3DLLF 2L7KA 1TLHB 2OJED 2EV6A 3DBLB 3ZP5A 3EQLF 5HDNA 2CV1A 3KEYA 3J80Z 1LJ9A 3JW4A 1B9NA 2E34A 2HDWA 2L7FP 3RJPA 3H0DA 2GA2A 2DPUA 1TP4A 4A3KJ 2ZMEB 1BR1A 2ID6A 4IRGA 4O6JA 3RSNA 3OYFA 4BKXA 4EJWA 4FT8A 3FK7A 5IP7J 4RGRA 4HF0A 1K83J 4EM0B 2D1HA 3H3ZA 2FMYA 1LDJA 2PMUA 2XGCA 4I0BA 2Z9OA 3EYYA 3DFGA 2Z1DA 4PK4A 2K27A 4Q48A 5GPCA 3OYGA 3HOWJ 2BXYA 3ABUA 3BR1A 2E19A 1YOVB 2DT5A 4NB5A 3F8CA 3ZQQA 1UJ8A 2HKOA 1BI0A 2JA8J 4P55A 4HSRA 3FX3A 2LMDA 1W7PB 2FOWA 3GTGJ 3CTAA 1QRYA 4S05A 3KZYA 1Z6RA 4D9JA 4A3BJ 2FBKA 4IOAF 4XLFA 1P7JA 5EJCA 4LLLA 3SFZA 2J5PA 3DPLC 3K0LA 2A5YB 1V4RA 2VODA 3GTJJ 2F48A 1P2FA 4G7OF 3CCLI 3GTMJ 1IRFA 3WGHA 1FEXA 4ITVA 2KRCA 3N05A 3ISPA 5DD8A 2KFDA 2JMWA 2Z16A 3E6MA 4CUGA 3E5XA 1Y39A 1DU0A 5L3EA 3ZGKA 4UB6C 1FT9A 4M9ZA 4HDVA 4PJ0C 2HTJA 2DOEA 2XDVA 3KFWX 4HEA2 1ETVA 1T39A 3ULQB 1K61A 4KICA 1WPKA 4UVBA 2OPTA 3WTZA 1H9GA 3DV8A 4DYCA 1XMAA 2JSPA 2FUG2 2QGUA 4ON0A 4M3EA 1LFUP 3A0HC 3ZQCA 2GAUA 3BQYA 1XSVA 1Q1VA 2V1UA 4OIRF 3QPHA 1OFCX 3W2WA 3CCYA 4N4NB 4GDFA 3W2AA 4W97A 3JREA 1J5YA 2QEXI 1MBGA 5LGNA 3I4MJ 5LHIA 4JX6A 2ZXWH 1TNTA 1YI2I 2YU9J 2EZIA 4CCNA 2CQKA 3OS0A 1TWAJ 3RZOJ 4PDKA 3S1QJ 2QM3A 1XPXA 4UVCA 5LBQA 2V7FA 2MGQA 3WTWC 2FSWA 2RREA 4HYEA 5M5YJ 4MTEA 1GUUA 5L3DA 4OINF 2XPVA 4I76A 1FJLA 1VQNI 1UFMA 5FLXK 3BOQA 2JUCA 5HDGA 5B3SH 1JE8A 2E60A 1IDYA 1I50J 1RR8C 3WG7H 1O3SA 1XC5A 4GCVA 2KT0A 4J01A 3KLNA 3LSIA 3WHBA 3CO7C 4A93J 5JHUA 4ZYHA 4BYYA 4WXCA 1X19A 2I10A 1AU7A 2W57A 1SD5A 4Z6YA 3S8PA 3N4MA 1E0EA 1W1WE 2BHYA 5DM7F 1P9QC 3IAS2 1MNMC 3U9GA 1ETKA 1SFXA 2VQGA 5D8KB 1JHHA 2OUMA 1X1DA 2IBDA 2M5WA 3FBNB 3FXLA 2MBFA 4MFDA 3OMYA 1JGSA 1ZRFA 1E3HA 1HKSA 3HG9A 3H9QA 4EGZA 1ZLJA 1JHFA 3BTLA 2XAJA 3MAJA 3GTLJ 4XKCA 4WXHA 4H4KC 2BY2A 4QWQA 1FZPB 2E1CA 4XORA 5K5RA 2WAFA 3ZOBA 1LNWA 3WU1B 1P4AA 1HQCA 3FXOA 3C2GA 3SYTA 1QBJA 4IQ4A 2WA0A 2XB5A 4KN4X 3ESWB 5CKTA 1BW5A 3SJMA 1FY7A 1FPQA 2L54A 1PDNC 4WWCA 4GYIA 3OL3A 5C4XJ 2A05A 1MD0A 5BPDA 1R1VA 4MIMA 2E1NA 1H88C 2X85A 2X1CA 5DUKA 2FE3A 2V26A 1YTYA 4ZYAA 1VQ6I 3CDHA 1G2HA 2ZFWA 3CMEI 4BXUA 2VQLA 4ENJA 1FTZA 3C1DA 3ERED 3LL7A 4BNCA 3FM5A 2XC7A 2IT0A 4KFCA 4XLPF 4C3IJ 1SEUA 4PGHA 1XGNA 1FIAA 3H3VK 1OJLA 2QQAA 3C7JA 2GBYA 1A35A 2MYSA 3GO5A 1VZ0A 2DYRH 1SVLA 4IX7A 5IT3A 1R5GA 3GTPJ 2VC0A 1U2WA 4A12A 4DGWB 3J7AO 4L9NA 5AONA 3TW6A 2WY7Q 1PVEA 3F21A 3N97A 1T08B 3QP6A 4N0BA 2M87A 4QPOA 4LIUA 1Y8RB 1A31A 4XLEA 2VB6A 3GX4X 2R5ZB 4BQQA 1T98A 4XOPA 2H6CA 4AYBA 3LMMA 2VLAA 4UVAA 1PUFB 2ME6A 1BIBA 1KA8A 2R4GA 3K4KA 2XAUA 3G1OA 5TJJA 3G73A 3J80K 4E7IA 1ON2A 5J1YA 5D6EA 3CJQB 1WH7A 1TWHJ 3ZMTA 4L9TA 3BR2A 2DMNA 2IS4A 2FEZA 5F6FA 2B63J 2K9NA 3E1SA 2W7NA 3DP7A 3KYCB 5E3NA 3L2UA 4A3CJ 2M4KA 5HNFA 4L0YB 4LLNA 1BC7C 2R7RA 3F8NA 4UXNA 3ZMSA 1U3EM 3CF5F 1FOKA 1KU9A 3DTEA 2ISZA 2BYVE 1LKXA 2F5VA 4LG0B 1K78A 1LVAA 1BIAA 1TW2A 4II2A 3SZPA 2FQ3A 1WVRA 2R3SA 5C44J 2ZJ2A 2ESNA 4HX4A 2LBFB 2V9VA 1SMYF 5FKKA 2XASA 2KZGA 2KISA 1ZR2A 2CSOA 4BS9A 4O5VA 2QVOA 1RESA 1UZCA 1RPWA 2QKLB 3Q5FA 2E1OA 2JVGA 4MQVA 1MDMB 5FFZA 3BPVA 1ZLKA 1BJAA 2EFQA 3OYHA 5FKLA 4YIRX 4U87A 1WJBA 4DNCA 4F93B 4IEJA 1D3YA 2DYSH 3RI4A 5CVUA 4MQ9F 2ZXIA 1S72I 2DU9A 2FBHA 2NRAC 4A0ZA 3S15J 5LFAA 5C4JJ 3BTJA 5CVJA 5LHHA 1IAWA 1WJDA 4E7ZA 3FISA 3CCVI 2Z2SB 4BE0A 1IRGA 3CCUI 3R4KA 3PL8A 1JTYA 4XICA 1EKEA 4FX0A 2XKPA 3UNGC 2VKVA 1LDKB 2L2OA 3D5SC 3HKZA 3P9IA 1IXRC 4MLOA 4CICA 1B59A 1R58A 4BQOA 1ZG3A 4NC7A 4A0YA 1A6QA 3DPUA 2K9SA 4PSXA 2O0YA 3C2HA 2R93J 2B0LA 2DA7A 3ZPLA 4M3GA 5JVTA 3WG9A 2LRDA 2Q1ZB 2IW5A 1B4AA 3QPTA 1YHQI 1APLC 1DP3A 3HZJA 1I3QJ 2FQ4A 2XRLA 4XQFA 4PJLA 1SANA 1VQ5I 3IKVA 1T0FC 1VQLI 2XIGA 3HGGA 3V7CA 3GW2A 3MFKA 2PI0A 3I59A 2XUBA 3PJRA 2OTLI 1ZGJA 2JA5J 1B1BA 1EV7A 5IOZA 2ADUA 3RPQA 3OYIA 3OY9A 2BGCA 5IPAA 4DBQA 3WTUC 2DK8A 2X6YA 3FZVA 3HJEA 3IP4B 1YS7A 4LK0F 1QNTA 5IYCJ 3I64A 5EZHA 2OBPA 1DU6A 1D1CA 3HUGA 4P9UA 1ZAOA 2IGKA 3CUQC 4EQQA 4M9SA 2CQNA 2OAZA 2GOXB 2VJJA 2Y0MA 1U78A 5J1UA 1RIOH 1B72A 1OR7A 2HQRA 4FE4A 4CDGA 3R0JA 3CZ6A 5EGOB 1HLVA 2E1MC 2D2WA 5LGTA 3IL2A 2CWEA 2HYJA 2HDCA 2A69F 3MKWB 3CO6C 2BW3A 2E2HJ 1GDTA 5DCMA 1Z3XA 4YFXF 2JUGA 3A2KA 2Z99A 1LE8A 3JAMZ 2HYFA 1NK2P 4CHUA 2CQ7A 4WK8F 3OYDA 2O7OA 3L2RA 4ETSA 5GTIC 4XN0A 5GADJ 2WB1N 4YEJA 2BE5F 3HSEA 4QIWN 3FHNA 4LD5A 4ABZA 3EPZA 3WODF 2KHMA 4ESFA 1G8XA 5FRMA 2JTVA 2ZXJA 4N9HA 2XSDC 3ELKA 2RKHA 1BI3A 4JK1X 2Y9YA 5H6RA 2GOMA 2ISYA 3CUQB 2L01A 2M0MA 4E7KA 1ZARA 2NOGA 3V7SA 1R71A 4IHYA 2VASA 2K3PA 1UG0A 3AKZA 4YELA 1FSHA 1FOXA 1WZ2A 1O57A 3QYBA 2JPCA 2E1MB 3IC7A 1KQ0A 3R60A 4G94A 3B02A 3H5AA 3PQJA 4PUSA 2F2EA 2MLGA 1ETOA 1OKRA 4UUVA 3E5UA 5E20A 2VQHA 5FKOA 2DPDA 2OA4A 4BACA 4M6XA 3JRBA 3RKQA 4AIDA 1WFXA 4Y52J 1B6AA 2LNBA 3A0BC 2XGDA 3L2QA 3GTOJ 3HEFA 3FK6A 4BXXJ 1F43A 4LLGF 1LFPA 3L1PA 1GVJA 4HX7A 1DP7P 4K2EA 4EJTA 3SHFA 3H3UA 3ZMZA 3V42A 3F8BA 3ZQ7A 1V55H 4C2TA 2R5YB 4F52A 3K2ZA 1HDPA 3HDDA 1REPC 1R00A 3CF2A 3X2QH 2WV0A 5D5VB 2IA2A 1VQPI 3RDIA 3V7RA 5FFXA 2B9SA 3EUKL 3HHHA 4B3XA 2EV0A 2B7EA 3HM5A 5M3MJ 4IHXA 1XDSA 4OMZA 1IW7F 1R22A 4DYRA 4WX9A 2A6HF 3MQ0A 1SD6A 3M1CA 4FETA 3K7AJ 1IN6A 2CUZA 3KP7A 4F55A 4KYWA 4B48A 1X2MA 4KA4A 2IJLA 3S2WA 4AIJA 1QQIA 1OMIA 2P5KA 2PFBA 2NNYA 3IRRA 2JT1A 5HVQC 3EYIA 1TWFJ 3FM3A 5BNGA 3B6CA 3QP5A 3CMAI 2XV4S 1FOYA 1QZEA 3JCUC 3RQIA 3T8RA 5ICFA 4C3HJ 3WE3A 3M1EA 1JTXA 2EJRA 1XG1A 3K9TA 1WI9A 3BPXA 1WGXA 2CGPA 2H09A 1WSUA 4Y13A 4YFNF 4F91B 4NQWB 3W3CA 3I4NJ 4B09A 1NG7A 5E79C 2J5OA 3P7NA 3HOTA 1SAXA 3GZ6A 2HPIA 4ZYGA 3BQZA 3MMYB 3IH4A 1ENHA 1TWCJ 1HSJA 2RDPA 3AG3H 1R5ID 3U2RA 1Y6IA 1DGRM 5DS9A 5DV5A 1PYVA 2GIZA 3GZ5A 1M1EB 3KP2A 4Z2YA 1FBUA 1JT6A 2KIFA 3AL0C 4B4CA 4BBSJ 2W1OA 4BQAA 2X0LA 3PNYA 1Z1DA 3LSMA 2ZB9A 2Q2EB 1DPRA 2CW0F 2OCCH 1U9NA 2ECBA 2Y0SN 4D7MA 3L2WA 3BZCA 4ESJA 3J7YJ 2JK3A 2OF7A 3MWMA 1W7PD 2BEOA 4HNVA 1V54H 3BZKA 1P92A 3CLQA 2LP0A 2OV7A 1J2XA 4G6DA 2XF7A 1AHDP 1MH3A 2BZTA 4X1EA 1OPCA 1RKWA 2KPMA 3PFYA 4U88A 4D1QA 1YIJI 4F3QA 2XPUA 1RKTA 3M8JA 3GMEA 1E3OC 1P7IA 1HW1A 4YIFA 2A68F 4S04A 3LA3A 1B9MA 4PZJA 1IUYA 3PIOF 1MSEC 2W82A 2L9NA 4QSHA 2BBYA 2PMHA 4G7HF 3QQAA 4HV6A 5TGTA 4BE2A 2MH2A 4BAYA 4HNTA 2VKEA 1O3RA 2VJ4A 3S32A 4WCGA 2XRNA 1V5FA 4KT6A 2ZBKA 4KISA 1Y8QB 4EGYA 1BR4A 3H5RA 2DMUA 2HXOA 2UUZA 2X9DA 5HLHA 1SMTA 3KX2A 3EDPA 2DA6A 2MH9A 2HOTA 3U21A 2A07F 2KQRA 4OIQF 1TZLA 2O6GE 1U9OA 1IN8A 2L0KA 2P5VA 4M6YA 2EV5A 4B43A 2PJRA 3SDGA 2EIMH 1AKHB 2WY8Q 4FQGA 4ANJA 3G3ZA 3LSHA 3O6BB 1WQ2A 2LC2A 2M7AA 1PP7U 1ZELA 1G59A 2UXNA 4P96A 5KK1A 4EJUA 3F8MA 4RMNA 4HDUA 4Y7NJ 2BVMA 2IA0A 5E3MA 2GXBA 3K4NA 2Z5UA 3W2VA 2QBYA 5J1RA 3PO3J 3QU6A 2DAOA 2EINH 2OTJI 3F6OA 4G6TB 3S1MJ 3JRFA 2GQQA 1O7FA 1UG2A 3OOUA 3JAMK 2V6EA 3IH3A 1RI7A 1HW5A 1UHSA 3HRUA 4MO7A 4PSWA 3OIQA 3S3NA 4A3MJ 1LEAA 4XNFA 5IT9Z 1ZGWA 2QA4I 3BP8A 4GRIA 3OS2A 1STZA 3S17J 2LKXA 3OOPA 1OLTA 1LPQA 3BWGA 1W36C 3QODA 3H36A 5E3LA 3K69A 4MEXF 2VQCA 4QPQA 4DBRA 2KLOA 4UUSA 2M4GA 2NAZA 1R5HA 3H9JA 4AU7A 4BQNA 4E6KG 3LSJA 4A3EJ 3CP2A 3OR1C 5D4RA 2ZJQF 2V1DA 1IJWC 1SC7A 1EH8A 1QGPA 5EYRA 3CCMI 2UZKA 2ZMEA 2DK5A 5F1JA 1IZ1A 4IJAA 3G6EI 2DMPA 4B8XA 2QF7A 2W00A 5EDNA 3ERMA 4G8XA 2G7HA 1I39A 3FHZA 2E7WA 4A6EA 1L3LA 2EH3A 1FYMA 4JX4A 4RLQA 2A3SA 5HLTA 2WAQA 2HVRA 1T38A 1TW3A 3HRSA 5LEKA 1F36A 2BOLA 4R1HA 1HBXG 4AD9A 5DUIA 4OAZA 1W7PA 3MVPA 3TL4X 3FMQA 4OAYA 3OYKA 2JQ7A 2OU2A 4M3BA 1MKMA 4L9VA 1MSFC 2PX9A 1S7OA 5EZGA 4HW0A 3JTGA 5J47A 2O03A 3GEZA 1IV6A 1BJZA 2CUJA 3Q9SA 5LLQA 1TL8A 1UHMA 3TBIA 2WAEA 3HOSA 2KRHA 1KU2A 3QYFA 2EFPA 3BJOA 4CXFA 2DFHA 3A4CA 2N8GA 1Y0UA 1ZYRF 2E5ZA 1X1AA 4IHTA 4KJZA 2DW4A 3I0TA 4HF1A 4DJAA 1R9TJ 4I2OA 2AQFA 2ZCWA 1YW8A 4HLXA 3ECOA 4KNYA 1VI0A 4A5NA 5D8LB 3BG5A 3G2BA 3T5XA 1H0MA 5JR3A 1FBSA 3VOEA 2XGEA 2CUEA 2DT6A 5L3GA 1BI2A 3TMOA 3LNQA 1RZ4A 1IDZA 1I1GA 3DCFA 2EA2A 4XRSG 2E5NA 1N25A 5KVRA 2Y31A 4ZDLA 2GA1A 1VF9A 3G1MA 2R7FA 3PNTA 1ZG1A 3OSFA 4XLHA 1NHAA 4XRMA 1G3YA 2GWRA 4XLCA 1Z7UA 1A04A 2HGCA 5GAEJ 1C0WA 1SAUA 3R61A 1BA5A 3DBRB 2G0EA 2VBYA 1TQMA 2M9HA 4D7NA 3KP4A 4NBQA 5IYBJ 4HSTA 2JVHA 4JYKA 5GAHJ 2LR8A 2X51A 5FD6A 3DQVC 3T0YA 1XSDA 1GXPA 2CMPA 1I1SA 3BR0A 1ITYA 3VODA 2JA7J 3WE2A 1XGMA 1D1AA 1YLFA 3A02A 4E70A 2OCEA 3ECHA 1TBXA 3GUDA 3OIOA 4RM2A 4KIGA 5L3BA 5KAFC 4XM3A 2F5DA 1IGNA 4KDPA 3UKGA 4XKBA 3CP8A 2CYYA 3CDLA 3KE2A 5K7HA 1J75A 5GTHC 5EEGA 4BUPA 4XIDA 1W0TA 1HKTA 1IN5A 3F72A 1QHHD 3L7WA 3GYHX 2L9SA 4C30A 1OYWA 2DJIA 2V79A 2DA1A 2DBBA 4EV0A 4HZFA 1WRJA 1H89C 4EMSA 2W85A 5CVRA 5HS8A 2IGNA 4KUMA 4ESBA 1QPIA 3MCZA 2R7OA 3IWZA 3HOUJ 2M45A 2NNNA 4WF2A 2OC6A 1G6NA 3IV5A 1LB2A 2NOJB 3GFMA 1G4DA 1R1TA 1I5ZA 3IHUA 4M9XA 4YIIA 5H20A 1LEBA 3DKXA 3IKTA 2P7VB 4BHPA 2VIXA 2EZHA 3ASNH 5ILVA 5EG0A 1IN4A 2X6OA 2DLLA 2L7MP 3WTYC 3JRGA 4RAFA 1BI1A 4G6QA 2L5QA 3D5LA 5E17F 5KCMA 1R6RA 3CCEI 2EK5A 2RAEA 3CD6I 2V1NA 1EH7A 1ETQA 2P81A 2IA1A 4D5CA 3E6CC 3QRFF 5B5EC 3O8GA 3AG2H 5JVGF 1TWGJ 1VQ8I 5HS9A 3FXQA 1XD7A 4AVZA 2Y9ZA 2RVCA 1BL0A 3LAJA 4HPQA 5E18F 4XONA 4KMFA 4CCMA 2HU9A 2PQ8A 1SFOJ 2Y69H 2NVQJ 1GV5A 1MW7A 1XMKA 4OOIA 4W1UA 4UNOA 4FISA 3JR9A 2R7DA 2XVCA 5FO5A 2V9KA 1VQ9I 3ZQFA 2F5CA 4IHWA 3HYIA 3KLOA 1ETYA 2EFWA 4H0EA 4DZJA 2HPMA 4V19K 4GFBA 2WV1A 3W6KB 1I27A 1D0YA 1SFUA 3GF2A 4U7BA 2Q8KA 1K79A 1ZRDA 4LB6B 2LLKA 2ICWG 1VFCA 2GIVA 3OIPA 2E2JJ 3PO2J 1YIOA 2P7CB 1S6LA 5CQGA 4PJMA 2X4HA 4AWXB 1K7AA 2VBWA 2E35A 3PSIA 3HBLA 4A5MA 5F64A 2CUFA 1LQ1A 2VT3A 2GXGA 1CF7A 5K7ZA 3FXJA 3OL4A 4XSZF 3VYSB 4CZCA 1JUSA 4XK4A 5IP6A 1WWXA 2LG4A 1Z67A 3ABMH 1J9IA 3L09A 1JKQC 2AS5F 3LA2A 2IPQX 5E3OA 1Y1VJ 2A6EF 3H0GJ 2EQRA 2VN2A 1WI3A 1R7JA 1IN7A 2L9VA 4A3FJ 5IT9K 3BCAA 4BL0B 1SD4A 1H8AC 1JUMA 4B44A 3Q0VA 1S7AA 3RKXA 2R5ZA 4M74A 4ZH4F 2FJ1A 2JJ7A 1DQUA 4XKVA 3HUGB 2COMA 3HOYJ 3ROUA 1BC8C 5HLGA 3CCRI 3JTHA 1PUFA 2KDOA 5CQEA 3G4SI 5IY5H 4MEYF 3L00A 2EZLA 1U8BA 3ABTA 3JRIA 1N77A 2CW8A 1D5YA 1J09A 2R7WA 4Q4ZF 1FTTA 1R4NB 1WH5A 1X1BA 1S5LC 5K7FA 2EB7A 2TDXA 3QYEA 2CW7A 5DCMB 1VQMI 2HKXA 2CFOA 5HOOA 2HQAA 3JRDA 4XLNF 4WXDA 2ZC2A 1ZR4A 2UV1A 1X1PA 4CZZA 3HXLA 2MABA 3S14J 1SFEA 2IP2A 4HBLA 3J7AY 4LOCA 2Q0OA 4Y15A 2I5UA 4LG0A 1R36A 1TT5B 1JI8A 5DTDA 3TO6A 2MD0A 4MTDA 1MJBA 1OYIA 4G9YA 1IC8A 3EUHC 3M07A 2H8RA 3GLLA 4BJ5C 1VQKI 1LDDA 2LBFA 5ED4A 1RRJA 2EBIA 2ZNZA 3DKYA 3MKZA 2ELJA 2PG4A 2VJIA 1MMSA 2ACJA 1XCBA 2M1BA 1YX5A 2EWNA 1JT0A 2BY3A 1HOMA 2QUFA 3MKLA 1WJFA 2PBIA 3GVAA 4HQMA 3E3VA 1MDMA 1GXQA 1XGSA 1IRXA 2E36A 2F4IA 2VL8A 3DLAA 3F6VA 2AXTC 1QA6A 3IUOA 4YG2F 2XF5A 5TRDA 3NWTA 4XOTA 4OIPF 2LDUA 5B1BH 3PUFA 2RQQA 2PMZN 3FKJA 5CJ9A 3S2HJ 4BXFA 1ZQ3P 2IRFG 1MH4A 5ICEA 3CUOA 2FA5A 4Q47A 1OCTC 5B1AH 4BEHA 4A3GJ 3E5QA 4IXAA 2WBMA 3M8FA 4BDYA 2XAHA 3DWLE 1FOWA 1UHWA 3FKIJ 4ZTJA 1U8RA 2HR3A 1N78A 3GFLA 3K2AA 2ECCA 4BY1J 2P4WA 2LF7A 1T56A 2R7VA 1A6IA 1Z21A 3KCCA 5ILUA 5HODA 5TISC 4L5JA 2XAQA 2FD5A 3BDDA 1ZKGA 3J81Z 4UV8A 1MBKA 3QPLA 2MG4A 1FNNA 2XAGA 4I02A 4U0VA 1FMVA 1QPMA 1YFHA 2KJBA 2O61A 1VNDA 4ENKA 2ZKZA 1UMQA 4BY7J 4J19A 2WB1A 3H9GA 3KP3A 2G7UA 4LGWA 2K02A 1O3QA 3I3LA 2NYXA 3M3YJ 1D1BA 2DN0A 2RNJA 4LG3A 5DCFA 1FMWA 2QQBA 3SEZA 1HKQA 4BHCA 1OCZH 2A5WA 1U5TC 3ZCOA 4I01A 3PQKA 4XSXF 2LYCA 1EA3A 3BROA 2IXSA 3JSOA 3V8LA 4LB5A 3GFJA 2IS2A 4M72A 5BOXA 2XSJC 2R92J 1QO0D 1GV2A 2L9RA 1TC3C 4RAYA 1WJCA 2VOPA 3DU6A 2HVQA 3MZ8A 3LOCA 1J59A 3CLOA 1PJRA 2F4OB 2QQ9A 2YS9A 3BJ6A 4D0PA 2WWYA 2P5LC 1RC9A 5ILSA 5EGOA 4E4HA 1VQ7I 2DA2A 1G3WA 1HXDA 4R8HA 2E2IJ 2GZWA 4ZC3A 3LSPA 1F1ZA 4JP0A 1IG7A 2HZTA 1FC3A 5B66C 4GO1A 3ZQIA 4II3A 1T0FA 3LA7A 3OYNA 4L0ZB 1U6GA 5HNHA 2H27A 3K4CA 4FX4A 2V9PA 2X6WA 4HA8A 4XR6A 3F0CA 1LVKA 3HRTA 4UV9A 3A01A 2K40A 2LY1A 2D5VA 1YW9A 1YRNB 1A36A 1U5TB 1X58A 1NG6A 1ONVA 3AG1H 3LSKA 1D8JA 3MN2A 1KONA 1I6XA 3BR5A 3I58A 4HLYA 2K86A 4PCQA 3ZQHA 2GM4A 1P4WA 2COBA 4IRIA 1EF4A 2AXLA 3FXMA 2RN7A 4A3JJ 3CUQA 4I99C 1FWZA 1OCCH 5J4YA 2HQNA 4ENMA 5FD5A 2QSHX 1XB4A 3KP5A 4PGGA 2STWA 2VE8A 3FXKA 3I53A 3HIFA 4Y17A 4KITB 2W25A 4UB8C 5J6XA 2DCEA 3ZQGA 2LOOA 5CVVA 1CGPA 4JOMA 2QKMB 3K70C 4CYCB 4RB0A 3HOZJ 4PFPA 3F9KA 1QVTA 4ZDOA 1V5GA 3VEPA 4C3JJ 2WC2A 4BHBA 1BN5A 2YU3A 4FHTA 2DTZA 2LKPA 4RGXA 3REOA 2NVTJ 4MHGA 3KYLA 4HF2A 3JRAA 4P1WA 5ICCA 3MKYB 1UELB 5BQTA 3FMSA 5K5OA 1USSA 5LRRA 1SFKA 4IZZA 3KPHA 3P9CA 2QLZA 5FRNA 2IS1A 3Q0WA 4BJTA 2KIUA 2EPFA 4B47A 4FE7A 3ZMDA 2XAFA 5KHDA 2DO7A 5F0FA 1T8IA 2LD5A 1OISA 2F5EA 1JXSA 2RQPA 3L2CA 3TDZC 5IOYA 5FGMA 2HOAA 1XMXA 1R49A 1MMGA 2DT7B 3M8EA 3HHGA 5ICGA 4AM3A 5JI6A 5F04A 1EH6A 3KZZA 2V6CA 4Y33A 4NHJA 5AIPA 4EVIA 2Y0SA 4B3AA 3WHCA 3AAFA 5EEHA 1BM9A 2EA4A 3HTUA 4CYDA 4XRFA 1HCRA 1YJWI 1D8KA 1UAAA 1HF0A 1XGOA 3AL0B 3VWBA 2QWWA 3CCSI 3BR3A 5K1YA 3RYRA 1T95A 2DFIA 2M0CA 1AOYA 1OCOH 2NS8A 1R1UA 4I7HA 4U7DA 4HQEA 1Y1WJ 2ELKA 2FXAA 1MBFA 4IL6C 3SEQA 3CCQI 3ML6A 5M3FJ 1BOAA 2HDDA 1W4MA 3VDXA 2HVSA 5C3EJ 3HOVJ 3KEOA 3T1BA 2XKOA 1FYLA 2W84A 2Y48A 3PUBA 2R7SA 4L5IA 1ZRCA 1H9TA 5JLWA 4KT5C 2VOOA 1X2NA 2F6CA 1J0RA 3OYEA 1ETXA 1S29A 3PNVA 4CCLA 3HTSB 3IRQA 2KP6A 1IRZA 2MW8A 2CV2A 3HC7A 1Z7LA 3M9AA 2Q2EA 1B8IA 3NRVA 2VPRA 3VYRB 2ME0A 2RGVA 2C6YA 4HRIA 2EIJH 2ID3A 3K4LA 5J4VA 4LITA 3EETA 2XB0X 3CESA 4CGZA 3KETA 3AG4H 2LKSA 3WGGA 2LTPA 3JRCA 3QPSA 1WKMA 1MJ9A 3L2VA 1V5EA 1BW6A 2M2EA 1W36D 5DD4A 2MA3A 4RM3A 1VTNC 5LRSA 4BBRJ 2LVSA 1YX3A 2M8EA 2KDZA 4RAGA 2HFHA 3SXYA 1WJ5A 3JRHA 4M6VA 1ZHFA 2KJCA 3BC8A 2LSOA 5F0CA 3CJNA 2ZXHA 4DYQA 2OZUA 5EEAA 4I0AA 3BTCA 2YUSA 2H8WA 3O8HA 5HLIA 5FLMJ 3S1RJ 1W0UA 5DM6F 2BY1A 4AUXA 1RETA 1XN7A
chains in the Genus database with same CATH topology
3PJRA 3OYLA 2R7OA 1D0ZA 3OYIA 3DEEA 3OY9A 2OC6A 2UWMA 2NOJB 4DBQA 1YE9A 2I8DA 3DU5A 2X6YA 3IP4B 3DKXA 4HNUA 1DGWY 3RQ4A 2VIXA 1D1CA 2VJ5A 1K6YA 3GBGA 4J00A 1D0XA 2IGKA 4F92B 1X4OA 4CSWA 4XMYA 5JHFA 1MNDA 2GOXB 2VJJA 1U0JA 2L5QA 3D5LA 3CZ6A 2PJRB 5KCMA 1R6RA 2E1MC 1Z3YA 4ZTFA 3MKWB 2BW3A 2V1NA 1Z3XA 3AFHA 2JUGA 3DPTA 3DTIA 3A2KA 4AVZA 2LH9A 3OYDA 2VXDA 3L2RA 3FBIB 4HPQA 4XN0A 4XONA 4CCMA 2HU9A 3HPGA 1MW7A 3OS1A 4YEJA 4XLAA 2V9KA 1BR2A 3FHNA 3K4JA 3EPZA 4BE1A 2KMUA 2KHMA 3OYMA 3LSGA 2HPMA 4ZDPA 1G8XA 5FRMA 1D0YA 3CMMA 4U7BA 4PJJA 3OIPA 3VYUB 4YRVA 2GOMA 5CQGA 1MMNA 4PJMA 2VPLA 3MD2A 3BCBA 3PSIA 2M0MA 3SDBA 4E7KA 3QOEA 4Y3OA 2VASA 2K3PA 1UG0A 1X1CA 3AKZA 4YELA 3OR2C 2ZFUA 3OL4A 3QYBA 2E1MB 3VYSB 4CZCA 3BG6A 4E7JA 2LG4A 3H5AA 2K9LA 4PUSA 4X0GA 2IGOA 4BJ6C 2L7KA 2IS6A 2R7XA 2VQHA 2CV1A 2M3AA 3KEYA 3BCAA 2HDWA 4BL0B 4BACA 3H0DA 1WFXA 4B44A 1BR1A 3L2QA 2X6XA 4E7SA 3RSNA 3OYFA 4P5OA 5LD2C 1DQUA 4XKVA 3HUGB 1LFPA 3S93A 4ZJZA 2KDOA 5CQEA 2Z1DA 4PK4A 3V42A 1N77A 2CW8A 1J09A 2R7WA 3OYGA 3BLYA 3VSLA 4C2TA 4F52A 1X1BA 3QYEA 3CF2A 3ZQQA 2CW7A 4HSRA 2CFOA 3EUKL 4B3XA 5HOOA 2HQAA 4D9JA 1GLNA 2UV1A 3S3OA 3HXLA 2MABA 3M1CA 4FETA 2CUZA 4XLFA 4F55A 3J7AY 1Y56A 3DPLC 4B48A 3H5NA 1JI8A 2MD0A 5HVQC 4ITVA 2KRCA 3EUHC 4CH7A 3N05A 4CA0A 4BJ5C 2LBFA 2Z16A 3DKYA 3K4MA 3MKZA 4CUGA 2ELJA 2VJIA 1YX5A 3ZGKA 1WJFA 4XL9A 1IRXA 2VL8A 2F4IA 2XDVA 3DLAA 4HEA2 4F91B 1X4PA 4NQWB 3IUOA 2XF5A 3W3CA 3NWTA 4XOTA 1NG7A 3HOTA 2RQQA 1QU3A 2HPIA 3FKJA 4BXFA 1WJAA 2JSPA 3MMYB 2FUG2 3FDYA 1Y6IA 1DGRM 2XF6A 1PYVA 4BEHA 3AL0C 2W1OA 2WBMA 4BDYA 1HA8A 3PNYA 3LSMA 3W2WA 3DWLE 4N4NB 4PFOA 2Q2EB 2VKHA 3W2AA 3L2WA 3RPUD 4ZTJA 4FASD 1N78A 2CS3A 4CCNA 4E7HA 3OS0A 2R7VA 1Z21A 2WADA 2OV7A 4JQFA 2V7FA 1OR7C 2XF7A 2RREA 3HPHA 2KPMA 4Y4RA 3PFYA 2V4JC 4D1QA 4F3QA 4IQJA 1FMVA 2E60A 3M8JA 4XKWA 3H35A 4HG2A 3ZXSA 4J01A 2W82A 2L9NA 3S3MA 2WB1A 3H9GA 3LSIA 2R7TA 3I3LA 4RLFA 5TGTA 1D1BA 4BE2A 1X19A 4HNTA 1TT0A 4LG3A 1FMWA 2ZSHB 3SEZA 2VJ4A 3S8PA 3S32A 1E0EA 2A5WA 1MMDA 3ZCOA 1V5FA 1P9QC 3IAM2 2W4SA 3IAS2 3ONQA 4KT6A 3UR3C 4R79A 4KISA 2VQGA 2CH0A 2LYCA 1EA3A 1BR4A 1X1DA 2OUMA 3H5RA 3FBNB 2IXSA 2UUZA 3I9V2 2VKDA 3KX2A 2IS2A 3OMYA 1AA7A 2XSJC 3DTKA 3U21A 3HG9A 3CJRB 1WJCA 3H9QA 3DU6A 2HVQA 2KQRA 1TZLA 1PJRA 4XKCA 4CCKA 4B43A 4E4HA 2PJRA 4H4KC 2WY8Q 4ANJA 3LSHA 2BW3B 2LC2A 4XORA 2WAFA 2M7AA 4ZC3A 5FROA 1ZELA 3C2GA 1G59A 3SYTA 4IQ4A 2WA0A 5CKTA 4BEHB 4RMNA 2M7BA 3OL3A 4II3A 2DXIA 2A6TA 2BVMA 3OYNA 3K4NA 5HNHA 3K4CA 2X85A 2X1CA 2X6WA 2V26A 3W2VA 4XR6A 4ZYAA 2VQLA 1LVKA 4G6TB 2LY1A 3LL7A 4NUBA 2AQEA 3RCOA 1NG6A 3OOUA 2XC7A 3LSKA 2V6EA 2MC4A 1KONA 2P0WA 2JA2A 4PSWA 3OIQA 3S3NA 4XNFA 1BOBA 4LIVA 3OS2A 4GRIA 2MYSA 1WJEA 1VZ0A 1OLTA 4IX7A 1W36C 3QODA 2KZVA 2VQCA 4QPQA 4DOZA 4DBRA 2KLOA 4KITB 2M4GA 4DGWB 2DCEA 2LREA 1ERDA 2LOOA 2LY2A 2R7QA 2WY7Q 4JOMA 2QKMB 3H9JA 3RTRA 3K70C 2KL4A 4PFPA 3F9KA 4AU7A 4BQNA 4E6KG 3CP2A 3OR1C 4ZDOA 1V5GA 4QPOA 4LIUA 2K9MA 4E7LA 3LFUA 5KNLA 4NNJA 4XLEA 2VB6A 3ZR8X 3KYLA 2CV0A 4BDZA 2ZSIB 4P1WA 4BQQA 4XOPA 3MKYB 1UELB 2W00A 4AYBA 3LMMA 4IZZA 1SFKA 2VLAA 2X1DA 2MFZA 5FRNA 2DOAA 2IS1A 4RLQA 4BJTA 4DIQA 4OWRB 4B47A 3K4KA 2R4GA 3EUAA 2WAQA 2XAUA 5HLTA 3K6GA 5KHDA 4E7IA 1QHGA 2HVRA 2RNGA 2BOLA 3CJQB 3SZGA 4OAZA 2PMZA 2IS4A 2BVLA 3TL4X 4OAYA 3OYKA 3E1SA 2W7NA 1MMGA 2O5RA 3L2UA 2DT7B 2M4KA 5HNFA 2R7RA 3HL2A 3DTEA 4Y33A 1LKXA 2CUJA 2F5VA 3TBIA 2WAEA 3HOSA 2Y0SA 3K4BA 2KRHA 2VXZA 3QYFA 4II2A 4IKFA 3A4CA 3OYBA 1UAAA 2E5ZA 1X1AA 2LBFB 3VWBA 3AL0B 4KJZA 2IGMA 4BS9A 4DJAA 1S9HA 2AQFA 3NWSA 3OWTA 2QKLB 1T95A 3G2BA 2JVGA 4EATA 3OYCA 4BU2A 3OYHA 2DT6A 3TMOA 2K5CA 1WJBA 4U87A 4F93B 3OYJA 3SEQA 2HVSA 4PJNA 2R7UA 2E5NA 3VDXA 4ZDLA 3PUBA 4BGDA 2R7SA 2ZXIA 3A1YA 3PNTA 5LFAA 2HZDA 4XLHA 4XLCA 2F6CA 1N75A 1WJDA 1SAUA 4E7ZA 3K10A 3OYEA 3PNVA 4CCLA 2Z2SB 2KP6A 3E0JB 4BE0A 2CV2A 3PL8A 4HSTA 2JVHA 3HC7A 1Z7LA 2X51A 3DQVC 3UNGC 3VYRB 3D5RC 4HRIA 1LDKB 2L2OA 2CMPA 3D5SC 3K4LA 4XN3A 4CCJA 3HKZA 3ZRGA 4LITA 4MLOA 3CESA 3VSKA 4BQOA 1D1AA 4NC8A 3VYTB 4C2UA 3L2VA 1V5EA 4NC7A 1W36D 2X1EA 3BG7A 4RM2A 3DPUA 4PSXA 4XM3A 4RM3A 3C2HA 4CCOA 4XKBA 3CP8A 1YX3A 3K70D 4BUPA 1WJ5A 2LRDA 1QHHD 2Q1ZB 2L9SA 4C30A 4N4OB 2DJIA 1DP3A 3BC8A 4C9YA 4XQFA 2ZXHA 4PJLA 3PSFA 3OYAA 1MNEA 1T0FC 2HNHA 1MMAA 5CPRB 2IGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZZ A;  4YRV A;  4J00 A;  3QOE A;  4HRI A;  3QOD A;  4J01 A; 
#chains in the Genus database with same CATH topology
 5J40 A;  2D1V A;  3J81 K;  3BJA A;  1D0Z A;  2Y30 A;  2K3F A;  4RB3 C;  1FP1 D;  2Z3Y A;  5L3F A;  3DEE A;  5A2Q Z;  2JA6 J;  2XPW A;  1YE9 A;  1KU3 A;  2JRT A;  2BXZ A;  3TOB A;  4HNU A;  1YJ9 I;  3RQ4 A;  2XRO A;  3O3K A;  5GP9 A;  2VJ5 A;  1K6Y A;  2EZK A;  2JN6 A;  2WAQ N;  3GBG A;  1MBJ A;  1D0X A;  4J00 A;  1QZY A;  2HS5 A;  2HI3 A;  4CSW A;  3RIR A;  3F22 A;  3Q3S A;  4XMY A;  1E2X A;  1XTA A;  3U1D A;  4FCY A;  1U0J A;  3G1L A;  1AKH A;  1FX7 A;  3R6S A;  1Z3Y A;  3VFZ A;  6PAX A;  3O2P E;  1KYW A;  1W5T A;  2CG4 A;  2R7U A;  2HYG D;  1FP2 A;  2LH9 A;  5FKN A;  2VXD A;  1Z0X A;  1P6R A;  1FIP A;  3OS1 A;  2EFN A;  4A69 C;  1BR2 A;  3K4J A;  1HW2 A;  2DQR A;  3S16 J;  3C18 A;  3NEU A;  2KMU A;  3OYM A;  4IRH A;  3TP0 A;  2M30 A;  4A3L J;  2YR2 A;  1LFB A;  2NVY J;  4RB1 A;  1ZTR A;  4IO9 F;  1K4T A;  2JPB A;  3CMM A;  3P9K A;  2X48 A;  3B6A A;  3QOP A;  4PJJ A;  1GVD A;  2ZJP F;  1Z6T A;  1G3T A;  1MMN A;  2DMQ A;  1XSX A;  2ZNY A;  2VE9 A;  3KZI C;  5M5X J;  2NS0 A;  2JZY A;  3BCB A;  5LEJ A;  1X3U A;  1XDU A;  3FXR A;  3SDB A;  5D5W B;  4FTH A;  1DUX C;  2ZFU A;  5FLV A;  1Z77 A;  5H6Q A;  2BHZ A;  2F5F A;  2K9L A;  5E1W A;  1SVM A;  2QSF X;  2IGO A;  4X0G A;  2EFO A;  2O8X A;  2IS6 A;  1Z91 A;  4OU0 A;  4A2U A;  2R7X A;  2M3A A;  2LF8 A;  1PUE E;  2M34 A;  2YSR A;  2L3D A;  2PLY A;  4IHV A;  2MLK A;  1MJA A;  2OZ6 A;  1KU7 A;  2X6X A;  4E7S A;  5F1R A;  5JLX A;  2QCO A;  3KYD B;  4GYG A;  4P5O A;  5LD2 C;  5EG0 B;  5GAG J;  3TDU C;  3FXU A;  3S93 A;  4ZJZ A;  4HOB A;  4V2G A;  1FBQ A;  2O8K A;  2LY9 A;  3HB9 A;  4A3D J;  3BLY A;  3VSL A;  4F7Z A;  3DKW A;  4B1R A;  1TTY A;  5FKM A;  1ORK A;  3GTQ J;  2L02 A;  4D5F A;  2DA5 A;  4DW6 A;  4OMY A;  1YG2 A;  3MZY A;  1PP8 F;  3HRM A;  1F9N A;  3B73 A;  4GGG A;  4IVN A;  4NC6 A;  1JJ8 C;  1GLN A;  4M3D A;  3S3O A;  2V1X A;  1JKO C;  3WGI A;  2TRT A;  2MC3 A;  3RKY A;  1J7K A;  4EM2 A;  2RV8 A;  1Y56 A;  1WHU A;  2ZJR F;  1O3T A;  1ZRE A;  3H5N A;  4X6A J;  1K78 B;  5D5X B;  3IH2 A;  2QQ8 A;  5D4S A;  5F08 A;  3LWF A;  2DJN A;  1I3A A;  4CH7 A;  4CA0 A;  3TED A;  1RR7 A;  4O3M A;  1FSE A;  3K4M A;  4G7Z F;  2FNP A;  3WTS C;  1POG A;  2ETH A;  4AYB N;  1P4X A;  4JX5 A;  2Y75 A;  1OCR H;  1TQP A;  3E6B A;  4G12 A;  2MSY A;  4V2F A;  2E71 A;  4XL9 A;  3GCM A;  1CF7 B;  3VPR A;  3KP6 A;  1X4P A;  1O4X A;  4HX8 A;  3ZN0 A;  3LFK A;  3WTT C;  4EEF G;  4L5E A;  1QU3 A;  5BPI A;  5K5Q A;  4M3F A;  1T2K A;  4MGR A;  1E3P A;  1GT0 C;  1JJ6 C;  2Z33 A;  1WJA A;  1L0O C;  2DFF A;  3HGY A;  3FDY A;  2K4B A;  2CFX A;  3C3W A;  1HC8 A;  4KIF A;  2XF6 A;  1ZK8 A;  1YQA A;  4U0Y A;  4RS8 A;  5LGU A;  4KN7 X;  1IXC A;  4U0W A;  1HA8 A;  1YW7 A;  4NDL A;  1KQ9 A;  3F8F A;  1A5J A;  4PFO A;  1MGT A;  2VKH A;  1NH3 A;  4MFE A;  5DEQ A;  2GXA A;  3RPU D;  3SQN A;  1RNL A;  4FAS D;  4ENN A;  3BZ6 A;  2CS3 A;  1ACI A;  4E7H A;  3ABL H;  4I6Z A;  1UST A;  4DZP A;  2WAD A;  2G9W A;  4RGU A;  9ANT A;  5IYD J;  4JQF A;  1Z9C A;  1OR7 C;  2AO9 A;  5FB2 A;  2LFB A;  3QAH A;  2P8T A;  3E7L A;  3TO9 A;  3HPH A;  5E1Z B;  1XS9 A;  4P9F A;  4Y4R A;  2V4J C;  1XCV A;  3LST A;  4IQJ A;  1Q1H A;  2K7L A;  1X3W B;  2NVU B;  3TP3 A;  1S8N A;  4XKW A;  4XRS A;  3H35 A;  4HG2 A;  4KIB A;  3ZXS A;  2FBI A;  2IEK A;  3S3M A;  2QYO A;  3S1N J;  2R7Z J;  1MBH A;  4ASN A;  2R7T A;  3SZT A;  4RLF A;  5HDK A;  1XX5 A;  4QLC U;  3I59 B;  3H1C A;  1TT0 A;  4RAZ A;  1V3F A;  2P6S A;  1MBE A;  2JRM A;  2ZSH B;  1FYK A;  2VON A;  1MMD A;  1K6O A;  4TV7 A;  3GXO A;  1YS6 A;  2W4S A;  1IXS B;  3I5U A;  3IAM 2;  3ONQ A;  3UR3 C;  1KYZ A;  4R79 A;  2W48 A;  2CH0 A;  2DOF A;  1F5T A;  2H1L A;  1T33 A;  4DQ2 A;  3COA C;  1S3J A;  2FF4 A;  3I9V 2;  5AIQ A;  2VKD A;  5BMZ A;  1AA7 A;  3HKZ N;  2CJJ A;  2YX4 A;  1OYY A;  3DTK A;  3RYP A;  2K85 A;  3CJR B;  3F23 A;  2STT A;  1ULY A;  2HTS A;  1B72 B;  3BT9 A;  1FLI A;  2OQR A;  4CCK A;  3FWE A;  3KEQ A;  5A2Q K;  1VQ4 I;  2RC4 A;  2VUM J;  2BW3 B;  3TGN A;  5LHG A;  5FRO A;  4LFU A;  4I98 B;  3I4P A;  5M5W J;  2CQX A;  3D1N I;  3DXJ F;  1LE8 B;  3ZQL A;  4BEH B;  3W6V A;  1MZB A;  3PFI A;  4ZZD A;  1ON1 A;  2M7B A;  2DXI A;  2A6T A;  4UHT A;  2HWV A;  1T6S A;  1O7L A;  1YJN I;  2CQQ A;  3QU3 A;  2FRH A;  3SFI A;  3V8J A;  5H2F C;  3OSG A;  2JSC A;  3CC2 I;  4NUB A;  2AQE A;  4AIH A;  3RCO A;  2QZ8 A;  3A03 A;  2HEO A;  5L3C A;  2MC4 A;  2UXX A;  2P0W A;  2JA2 A;  2FX0 A;  2EIL H;  1BOB A;  4LIV A;  5J8C A;  3F3X A;  1ZN2 A;  2H1K A;  1E17 A;  5FJ8 J;  2QSG X;  1WJE A;  3GTK J;  1R23 A;  4LJZ F;  3PM1 A;  3MZH A;  3KIO A;  2KZV A;  4DOZ A;  2LRE A;  1ERD A;  2LY2 A;  2R7Q A;  1JGG A;  4A6D A;  3RTR A;  1W5C C;  2KL4 A;  2AHQ A;  4ZYE A;  4RA2 A;  3GWZ A;  2TCT A;  2P6T A;  2YX7 A;  4CO8 A;  5F0H A;  2DFE A;  2K9M A;  4E7L A;  3LFU A;  5KNL A;  4NNJ A;  1UB9 A;  1AWC A;  2DA4 A;  3ZR8 X;  2CV0 A;  4BDZ A;  2WTE A;  2ZSI B;  3VB2 A;  2QEN A;  3HSR A;  3T8T A;  5E1X A;  3W6J B;  3U1K A;  2W24 A;  1CQT A;  3TO7 A;  3CJT B;  2X1D A;  2MFZ A;  2IVM A;  2DOA A;  3NAR A;  3V4G A;  2KIM A;  4DIQ A;  4OWR B;  3CDI A;  3EUA A;  4JBA A;  1IUF A;  2L4A A;  3S2D J;  3K6G A;  2ELH A;  2IAI A;  3GLX A;  1QHG A;  2RNG A;  3RPU A;  3SZG A;  2DDA A;  3ABK H;  1VQO I;  2PMZ A;  1JKR C;  2BVL A;  2EIK H;  5GPA A;  4RDU A;  4LMY A;  2YPR A;  4OIO F;  3TW7 A;  4HAM A;  3TOA A;  3R0A A;  3I56 I;  3BR6 A;  1DPU A;  2HXI A;  2O5R A;  2FML A;  3ASO H;  3H92 A;  3TQN A;  1HST A;  4A0X A;  3OV8 A;  2HOS A;  3L9F A;  4YFK F;  2BY0 A;  3HL2 A;  1QVU A;  2O3F A;  3CMY A;  2BV6 A;  3LAP A;  3D0S A;  4M73 A;  3DBH B;  4HV5 A;  2A61 A;  3A01 B;  3K4B A;  2OQG A;  2VXZ A;  2VC1 A;  3LQR A;  4IKF A;  3TKY A;  4UY8 I;  2L4M A;  1Z05 A;  3C2B A;  4IPA A;  1JUP A;  1KGS A;  3OYB A;  5E8G A;  2R0Q C;  4UUT A;  2DMT A;  2ZO4 A;  3CCJ I;  1QZZ A;  2IGM A;  2GLO A;  1IV8 A;  2FNA A;  3LQQ A;  5BS6 A;  2CU7 A;  2KIQ A;  1S9H A;  2NXN B;  3E6D A;  4C2M J;  3NWS A;  3BY6 A;  3K1N A;  3OWT A;  3BG9 A;  1NTC A;  3WU2 C;  2VT2 A;  2NS7 A;  3DEW A;  5F27 A;  2FOK A;  4EAT A;  3NAU A;  4IHS A;  3FIW A;  3OYC A;  4Q5S F;  4BU2 A;  3MEX A;  1IO2 A;  2K5C A;  3OYJ A;  1LUJ B;  2L7Z A;  2M8G X;  4PJN A;  3G71 I;  4RBO A;  4BGD A;  1SD7 A;  3A1Y A;  2CRG A;  2LK2 A;  2HZD A;  3V8K A;  2VBZ A;  2PEX A;  1YO5 C;  1N75 A;  4L18 B;  3K10 A;  4N9I A;  1EJ9 A;  1BBY A;  3E0J B;  4MNU A;  3CC4 I;  5CLS A;  5E8I A;  4EJV A;  2DOD A;  2HQ5 A;  5FLX Z;  3WTV C;  1OCP A;  1RUN A;  3D5R C;  4M71 A;  4XN3 A;  1DDN A;  3Q9V A;  4CCJ A;  3EUH A;  3ZRG A;  3IWF A;  1K4S A;  5IP9 J;  2PJP A;  1IF1 A;  3VSK A;  4KMU X;  4A3I J;  3P5J A;  2VBX A;  1ETW A;  2XHK A;  3E97 A;  1S7E A;  2H94 A;  2DI3 A;  4NC8 A;  3VYT B;  4C2U A;  2XGX A;  3GFI A;  3NQO A;  4I09 A;  2X1E A;  3BG7 A;  2O9L A;  3LSR A;  1Y0N A;  4AIK A;  4CCO A;  2KKO A;  3K70 D;  3BTI A;  1RUO A;  4N4O B;  5CVI A;  4EJO A;  5DDG A;  2JWT A;  4C9Y A;  3Q0U A;  4IF4 A;  1X3Z B;  3PSF A;  3OYA A;  1MNE A;  1W5S A;  3I71 A;  2HNH A;  1MMA A;  4QTR A;  5CPR B;  1UCR A;  2CO5 A;  1TNS A;  3OYL A;  3I55 I;  2H6B A;  3BG3 A;  5ERI A;  1D5V A;  5D5U B;  4BH9 A;  5HS7 A;  3WTX C;  3RZD J;  3ZMV A;  1NK3 P;  3FMR A;  2I8D A;  4ZYD A;  1HDD C;  3DU5 A;  2UWM A;  3ZMU A;  2Y2Z A;  1YIT I;  1KZH A;  1WCM J;  3JSP A;  1DGW Y;  1MIJ A;  4S0H B;  2ESH A;  2DA3 A;  4F92 B;  1X4O A;  3K1M A;  5JHF A;  3CQZ J;  3J7Z I;  1MND A;  5EF6 A;  4L9J A;  3PIP F;  3FF5 A;  2R5Y A;  3DF8 A;  2PJR B;  3CC7 I;  4ZTF A;  4EM1 A;  5CYV A;  2K9Q A;  2FU4 A;  4AC0 A;  3AFH A;  3DPT A;  3DTI A;  4LK1 F;  4XBF A;  1OQY A;  1R4M B;  1KQ8 A;  4GXO A;  2DQL A;  2DTR A;  2PN6 A;  1I6H J;  3HSF A;  3FBI B;  1GHC A;  3HPG A;  5DYM A;  5J8F A;  2ZME C;  1TQI A;  1B8I B;  5D6F A;  3RKW A;  1ZGA A;  2F4M B;  4XLA A;  3WU0 A;  4RB2 C;  3M7G A;  2K4J A;  2E7X A;  2KRF A;  2QBY B;  3M4O J;  2VI6 A;  4BE1 A;  5J3L A;  1YRN A;  1U5T A;  3LSG A;  3K1P A;  4ZDP A;  3I54 A;  4IOC F;  1ODD A;  2HOE A;  4RGS A;  5JFR A;  1JKP C;  1YYV A;  3QWL A;  2NVX J;  1SVO A;  3VYU B;  1ZG5 A;  1F4K A;  4YRV A;  5KAI C;  2VPL A;  3MD2 A;  3ZN1 A;  3DEU A;  3QOE A;  4Y3O A;  1ZH5 A;  1X1C A;  2OD5 A;  3HOX J;  3OR2 C;  4AVP A;  4NQW A;  2D45 A;  1G3S A;  4UUS B;  3BG6 A;  4E7J A;  3GZN B;  2DDB A;  2MD5 A;  4ZZL A;  4BJ6 C;  4CYC A;  3DLL F;  2L7K A;  1TLH B;  2OJE D;  2EV6 A;  3DBL B;  3ZP5 A;  3EQL F;  5HDN A;  2CV1 A;  3KEY A;  3J80 Z;  1LJ9 A;  3JW4 A;  1B9N A;  2E34 A;  2HDW A;  2L7F P;  3RJP A;  3H0D A;  2GA2 A;  2DPU A;  1TP4 A;  4A3K J;  2ZME B;  1BR1 A;  2ID6 A;  4IRG A;  4O6J A;  3RSN A;  3OYF A;  4BKX A;  4EJW A;  4FT8 A;  3FK7 A;  5IP7 J;  4RGR A;  4HF0 A;  1K83 J;  4EM0 B;  2D1H A;  3H3Z A;  2FMY A;  1LDJ A;  2PMU A;  2XGC A;  4I0B A;  2Z9O A;  3EYY A;  3DFG A;  2Z1D A;  4PK4 A;  2K27 A;  4Q48 A;  5GPC A;  3OYG A;  3HOW J;  2BXY A;  3ABU A;  3BR1 A;  2E19 A;  1YOV B;  2DT5 A;  4NB5 A;  3F8C A;  3ZQQ A;  1UJ8 A;  2HKO A;  1BI0 A;  2JA8 J;  4P55 A;  4HSR A;  3FX3 A;  2LMD A;  1W7P B;  2FOW A;  3GTG J;  3CTA A;  1QRY A;  4S05 A;  3KZY A;  1Z6R A;  4D9J A;  4A3B J;  2FBK A;  4IOA F;  4XLF A;  1P7J A;  5EJC A;  4LLL A;  3SFZ A;  2J5P A;  3DPL C;  3K0L A;  2A5Y B;  1V4R A;  2VOD A;  3GTJ J;  2F48 A;  1P2F A;  4G7O F;  3CCL I;  3GTM J;  1IRF A;  3WGH A;  1FEX A;  4ITV A;  2KRC A;  3N05 A;  3ISP A;  5DD8 A;  2KFD A;  2JMW A;  2Z16 A;  3E6M A;  4CUG A;  3E5X A;  1Y39 A;  1DU0 A;  5L3E A;  3ZGK A;  4UB6 C;  1FT9 A;  4M9Z A;  4HDV A;  4PJ0 C;  2HTJ A;  2DOE A;  2XDV A;  3KFW X;  4HEA 2;  1ETV A;  1T39 A;  3ULQ B;  1K61 A;  4KIC A;  1WPK A;  4UVB A;  2OPT A;  3WTZ A;  1H9G A;  3DV8 A;  4DYC A;  1XMA A;  2JSP A;  2FUG 2;  2QGU A;  4ON0 A;  4M3E A;  1LFU P;  3A0H C;  3ZQC A;  2GAU A;  3BQY A;  1XSV A;  1Q1V A;  2V1U A;  4OIR F;  3QPH A;  1OFC X;  3W2W A;  3CCY A;  4N4N B;  4GDF A;  3W2A A;  4W97 A;  3JRE A;  1J5Y A;  2QEX I;  1MBG A;  5LGN A;  3I4M J;  5LHI A;  4JX6 A;  2ZXW H;  1TNT A;  1YI2 I;  2YU9 J;  2EZI A;  4CCN A;  2CQK A;  3OS0 A;  1TWA J;  3RZO J;  4PDK A;  3S1Q J;  2QM3 A;  1XPX A;  4UVC A;  5LBQ A;  2V7F A;  2MGQ A;  3WTW C;  2FSW A;  2RRE A;  4HYE A;  5M5Y J;  4MTE A;  1GUU A;  5L3D A;  4OIN F;  2XPV A;  4I76 A;  1FJL A;  1VQN I;  1UFM A;  5FLX K;  3BOQ A;  2JUC A;  5HDG A;  5B3S H;  1JE8 A;  2E60 A;  1IDY A;  1I50 J;  1RR8 C;  3WG7 H;  1O3S A;  1XC5 A;  4GCV A;  2KT0 A;  4J01 A;  3KLN A;  3LSI A;  3WHB A;  3CO7 C;  4A93 J;  5JHU A;  4ZYH A;  4BYY A;  4WXC A;  1X19 A;  2I10 A;  1AU7 A;  2W57 A;  1SD5 A;  4Z6Y A;  3S8P A;  3N4M A;  1E0E A;  1W1W E;  2BHY A;  5DM7 F;  1P9Q C;  3IAS 2;  1MNM C;  3U9G A;  1ETK A;  1SFX A;  2VQG A;  5D8K B;  1JHH A;  2OUM A;  1X1D A;  2IBD A;  2M5W A;  3FBN B;  3FXL A;  2MBF A;  4MFD A;  3OMY A;  1JGS A;  1ZRF A;  1E3H A;  1HKS A;  3HG9 A;  3H9Q A;  4EGZ A;  1ZLJ A;  1JHF A;  3BTL A;  2XAJ A;  3MAJ A;  3GTL J;  4XKC A;  4WXH A;  4H4K C;  2BY2 A;  4QWQ A;  1FZP B;  2E1C A;  4XOR A;  5K5R A;  2WAF A;  3ZOB A;  1LNW A;  3WU1 B;  1P4A A;  1HQC A;  3FXO A;  3C2G A;  3SYT A;  1QBJ A;  4IQ4 A;  2WA0 A;  2XB5 A;  4KN4 X;  3ESW B;  5CKT A;  1BW5 A;  3SJM A;  1FY7 A;  1FPQ A;  2L54 A;  1PDN C;  4WWC A;  4GYI A;  3OL3 A;  5C4X J;  2A05 A;  1MD0 A;  5BPD A;  1R1V A;  4MIM A;  2E1N A;  1H88 C;  2X85 A;  2X1C A;  5DUK A;  2FE3 A;  2V26 A;  1YTY A;  4ZYA A;  1VQ6 I;  3CDH A;  1G2H A;  2ZFW A;  3CME I;  4BXU A;  2VQL A;  4ENJ A;  1FTZ A;  3C1D A;  3ERE D;  3LL7 A;  4BNC A;  3FM5 A;  2XC7 A;  2IT0 A;  4KFC A;  4XLP F;  4C3I J;  1SEU A;  4PGH A;  1XGN A;  1FIA A;  3H3V K;  1OJL A;  2QQA A;  3C7J A;  2GBY A;  1A35 A;  2MYS A;  3GO5 A;  1VZ0 A;  2DYR H;  1SVL A;  4IX7 A;  5IT3 A;  1R5G A;  3GTP J;  2VC0 A;  1U2W A;  4A12 A;  4DGW B;  3J7A O;  4L9N A;  5AON A;  3TW6 A;  2WY7 Q;  1PVE A;  3F21 A;  3N97 A;  1T08 B;  3QP6 A;  4N0B A;  2M87 A;  4QPO A;  4LIU A;  1Y8R B;  1A31 A;  4XLE A;  2VB6 A;  3GX4 X;  2R5Z B;  4BQQ A;  1T98 A;  4XOP A;  2H6C A;  4AYB A;  3LMM A;  2VLA A;  4UVA A;  1PUF B;  2ME6 A;  1BIB A;  1KA8 A;  2R4G A;  3K4K A;  2XAU A;  3G1O A;  5TJJ A;  3G73 A;  3J80 K;  4E7I A;  1ON2 A;  5J1Y A;  5D6E A;  3CJQ B;  1WH7 A;  1TWH J;  3ZMT A;  4L9T A;  3BR2 A;  2DMN A;  2IS4 A;  2FEZ A;  5F6F A;  2B63 J;  2K9N A;  3E1S A;  2W7N A;  3DP7 A;  3KYC B;  5E3N A;  3L2U A;  4A3C J;  2M4K A;  5HNF A;  4L0Y B;  4LLN A;  1BC7 C;  2R7R A;  3F8N A;  4UXN A;  3ZMS A;  1U3E M;  3CF5 F;  1FOK A;  1KU9 A;  3DTE A;  2ISZ A;  2BYV E;  1LKX A;  2F5V A;  4LG0 B;  1K78 A;  1LVA A;  1BIA A;  1TW2 A;  4II2 A;  3SZP A;  2FQ3 A;  1WVR A;  2R3S A;  5C44 J;  2ZJ2 A;  2ESN A;  4HX4 A;  2LBF B;  2V9V A;  1SMY F;  5FKK A;  2XAS A;  2KZG A;  2KIS A;  1ZR2 A;  2CSO A;  4BS9 A;  4O5V A;  2QVO A;  1RES A;  1UZC A;  1RPW A;  2QKL B;  3Q5F A;  2E1O A;  2JVG A;  4MQV A;  1MDM B;  5FFZ A;  3BPV A;  1ZLK A;  1BJA A;  2EFQ A;  3OYH A;  5FKL A;  4YIR X;  4U87 A;  1WJB A;  4DNC A;  4F93 B;  4IEJ A;  1D3Y A;  2DYS H;  3RI4 A;  5CVU A;  4MQ9 F;  2ZXI A;  1S72 I;  2DU9 A;  2FBH A;  2NRA C;  4A0Z A;  3S15 J;  5LFA A;  5C4J J;  3BTJ A;  5CVJ A;  5LHH A;  1IAW A;  1WJD A;  4E7Z A;  3FIS A;  3CCV I;  2Z2S B;  4BE0 A;  1IRG A;  3CCU I;  3R4K A;  3PL8 A;  1JTY A;  4XIC A;  1EKE A;  4FX0 A;  2XKP A;  3UNG C;  2VKV A;  1LDK B;  2L2O A;  3D5S C;  3HKZ A;  3P9I A;  1IXR C;  4MLO A;  4CIC A;  1B59 A;  1R58 A;  4BQO A;  1ZG3 A;  4NC7 A;  4A0Y A;  1A6Q A;  3DPU A;  2K9S A;  4PSX A;  2O0Y A;  3C2H A;  2R93 J;  2B0L A;  2DA7 A;  3ZPL A;  4M3G A;  5JVT A;  3WG9 A;  2LRD A;  2Q1Z B;  2IW5 A;  1B4A A;  3QPT A;  1YHQ I;  1APL C;  1DP3 A;  3HZJ A;  1I3Q J;  2FQ4 A;  2XRL A;  4XQF A;  4PJL A;  1SAN A;  1VQ5 I;  3IKV A;  1T0F C;  1VQL I;  2XIG A;  3HGG A;  3V7C A;  3GW2 A;  3MFK A;  2PI0 A;  3I59 A;  2XUB A;  3PJR A;  2OTL I;  1ZGJ A;  2JA5 J;  1B1B A;  1EV7 A;  5IOZ A;  2ADU A;  3RPQ A;  3OYI A;  3OY9 A;  2BGC A;  5IPA A;  4DBQ A;  3WTU C;  2DK8 A;  2X6Y A;  3FZV A;  3HJE A;  3IP4 B;  1YS7 A;  4LK0 F;  1QNT A;  5IYC J;  3I64 A;  5EZH A;  2OBP A;  1DU6 A;  1D1C A;  3HUG A;  4P9U A;  1ZAO A;  2IGK A;  3CUQ C;  4EQQ A;  4M9S A;  2CQN A;  2OAZ A;  2GOX B;  2VJJ A;  2Y0M A;  1U78 A;  5J1U A;  1RIO H;  1B72 A;  1OR7 A;  2HQR A;  4FE4 A;  4CDG A;  3R0J A;  3CZ6 A;  5EGO B;  1HLV A;  2E1M C;  2D2W A;  5LGT A;  3IL2 A;  2CWE A;  2HYJ A;  2HDC A;  2A69 F;  3MKW B;  3CO6 C;  2BW3 A;  2E2H J;  1GDT A;  5DCM A;  1Z3X A;  4YFX F;  2JUG A;  3A2K A;  2Z99 A;  1LE8 A;  3JAM Z;  2HYF A;  1NK2 P;  4CHU A;  2CQ7 A;  4WK8 F;  3OYD A;  2O7O A;  3L2R A;  4ETS A;  5GTI C;  4XN0 A;  5GAD J;  2WB1 N;  4YEJ A;  2BE5 F;  3HSE A;  4QIW N;  3FHN A;  4LD5 A;  4ABZ A;  3EPZ A;  3WOD F;  2KHM A;  4ESF A;  1G8X A;  5FRM A;  2JTV A;  2ZXJ A;  4N9H A;  2XSD C;  3ELK A;  2RKH A;  1BI3 A;  4JK1 X;  2Y9Y A;  5H6R A;  2GOM A;  2ISY A;  3CUQ B;  2L01 A;  2M0M A;  4E7K A;  1ZAR A;  2NOG A;  3V7S A;  1R71 A;  4IHY A;  2VAS A;  2K3P A;  1UG0 A;  3AKZ A;  4YEL A;  1FSH A;  1FOX A;  1WZ2 A;  1O57 A;  3QYB A;  2JPC A;  2E1M B;  3IC7 A;  1KQ0 A;  3R60 A;  4G94 A;  3B02 A;  3H5A A;  3PQJ A;  4PUS A;  2F2E A;  2MLG A;  1ETO A;  1OKR A;  4UUV A;  3E5U A;  5E20 A;  2VQH A;  5FKO A;  2DPD A;  2OA4 A;  4BAC A;  4M6X A;  3JRB A;  3RKQ A;  4AID A;  1WFX A;  4Y52 J;  1B6A A;  2LNB A;  3A0B C;  2XGD A;  3L2Q A;  3GTO J;  3HEF A;  3FK6 A;  4BXX J;  1F43 A;  4LLG F;  1LFP A;  3L1P A;  1GVJ A;  4HX7 A;  1DP7 P;  4K2E A;  4EJT A;  3SHF A;  3H3U A;  3ZMZ A;  3V42 A;  3F8B A;  3ZQ7 A;  1V55 H;  4C2T A;  2R5Y B;  4F52 A;  3K2Z A;  1HDP A;  3HDD A;  1REP C;  1R00 A;  3CF2 A;  3X2Q H;  2WV0 A;  5D5V B;  2IA2 A;  1VQP I;  3RDI A;  3V7R A;  5FFX A;  2B9S A;  3EUK L;  3HHH A;  4B3X A;  2EV0 A;  2B7E A;  3HM5 A;  5M3M J;  4IHX A;  1XDS A;  4OMZ A;  1IW7 F;  1R22 A;  4DYR A;  4WX9 A;  2A6H F;  3MQ0 A;  1SD6 A;  3M1C A;  4FET A;  3K7A J;  1IN6 A;  2CUZ A;  3KP7 A;  4F55 A;  4KYW A;  4B48 A;  1X2M A;  4KA4 A;  2IJL A;  3S2W A;  4AIJ A;  1QQI A;  1OMI A;  2P5K A;  2PFB A;  2NNY A;  3IRR A;  2JT1 A;  5HVQ C;  3EYI A;  1TWF J;  3FM3 A;  5BNG A;  3B6C A;  3QP5 A;  3CMA I;  2XV4 S;  1FOY A;  1QZE A;  3JCU C;  3RQI A;  3T8R A;  5ICF A;  4C3H J;  3WE3 A;  3M1E A;  1JTX A;  2EJR A;  1XG1 A;  3K9T A;  1WI9 A;  3BPX A;  1WGX A;  2CGP A;  2H09 A;  1WSU A;  4Y13 A;  4YFN F;  4F91 B;  4NQW B;  3W3C A;  3I4N J;  4B09 A;  1NG7 A;  5E79 C;  2J5O A;  3P7N A;  3HOT A;  1SAX A;  3GZ6 A;  2HPI A;  4ZYG A;  3BQZ A;  3MMY B;  3IH4 A;  1ENH A;  1TWC J;  1HSJ A;  2RDP A;  3AG3 H;  1R5I D;  3U2R A;  1Y6I A;  1DGR M;  5DS9 A;  5DV5 A;  1PYV A;  2GIZ A;  3GZ5 A;  1M1E B;  3KP2 A;  4Z2Y A;  1FBU A;  1JT6 A;  2KIF A;  3AL0 C;  4B4C A;  4BBS J;  2W1O A;  4BQA A;  2X0L A;  3PNY A;  1Z1D A;  3LSM A;  2ZB9 A;  2Q2E B;  1DPR A;  2CW0 F;  2OCC H;  1U9N A;  2ECB A;  2Y0S N;  4D7M A;  3L2W A;  3BZC A;  4ESJ A;  3J7Y J;  2JK3 A;  2OF7 A;  3MWM A;  1W7P D;  2BEO A;  4HNV A;  1V54 H;  3BZK A;  1P92 A;  3CLQ A;  2LP0 A;  2OV7 A;  1J2X A;  4G6D A;  2XF7 A;  1AHD P;  1MH3 A;  2BZT A;  4X1E A;  1OPC A;  1RKW A;  2KPM A;  3PFY A;  4U88 A;  4D1Q A;  1YIJ I;  4F3Q A;  2XPU A;  1RKT A;  3M8J A;  3GME A;  1E3O C;  1P7I A;  1HW1 A;  4YIF A;  2A68 F;  4S04 A;  3LA3 A;  1B9M A;  4PZJ A;  1IUY A;  3PIO F;  1MSE C;  2W82 A;  2L9N A;  4QSH A;  2BBY A;  2PMH A;  4G7H F;  3QQA A;  4HV6 A;  5TGT A;  4BE2 A;  2MH2 A;  4BAY A;  4HNT A;  2VKE A;  1O3R A;  2VJ4 A;  3S32 A;  4WCG A;  2XRN A;  1V5F A;  4KT6 A;  2ZBK A;  4KIS A;  1Y8Q B;  4EGY A;  1BR4 A;  3H5R A;  2DMU A;  2HXO A;  2UUZ A;  2X9D A;  5HLH A;  1SMT A;  3KX2 A;  3EDP A;  2DA6 A;  2MH9 A;  2HOT A;  3U21 A;  2A07 F;  2KQR A;  4OIQ F;  1TZL A;  2O6G E;  1U9O A;  1IN8 A;  2L0K A;  2P5V A;  4M6Y A;  2EV5 A;  4B43 A;  2PJR A;  3SDG A;  2EIM H;  1AKH B;  2WY8 Q;  4FQG A;  4ANJ A;  3G3Z A;  3LSH A;  3O6B B;  1WQ2 A;  2LC2 A;  2M7A A;  1PP7 U;  1ZEL A;  1G59 A;  2UXN A;  4P96 A;  5KK1 A;  4EJU A;  3F8M A;  4RMN A;  4HDU A;  4Y7N J;  2BVM A;  2IA0 A;  5E3M A;  2GXB A;  3K4N A;  2Z5U A;  3W2V A;  2QBY A;  5J1R A;  3PO3 J;  3QU6 A;  2DAO A;  2EIN H;  2OTJ I;  3F6O A;  4G6T B;  3S1M J;  3JRF A;  2GQQ A;  1O7F A;  1UG2 A;  3OOU A;  3JAM K;  2V6E A;  3IH3 A;  1RI7 A;  1HW5 A;  1UHS A;  3HRU A;  4MO7 A;  4PSW A;  3OIQ A;  3S3N A;  4A3M J;  1LEA A;  4XNF A;  5IT9 Z;  1ZGW A;  2QA4 I;  3BP8 A;  4GRI A;  3OS2 A;  1STZ A;  3S17 J;  2LKX A;  3OOP A;  1OLT A;  1LPQ A;  3BWG A;  1W36 C;  3QOD A;  3H36 A;  5E3L A;  3K69 A;  4MEX F;  2VQC A;  4QPQ A;  4DBR A;  2KLO A;  4UUS A;  2M4G A;  2NAZ A;  1R5H A;  3H9J A;  4AU7 A;  4BQN A;  4E6K G;  3LSJ A;  4A3E J;  3CP2 A;  3OR1 C;  5D4R A;  2ZJQ F;  2V1D A;  1IJW C;  1SC7 A;  1EH8 A;  1QGP A;  5EYR A;  3CCM I;  2UZK A;  2ZME A;  2DK5 A;  5F1J A;  1IZ1 A;  4IJA A;  3G6E I;  2DMP A;  4B8X A;  2QF7 A;  2W00 A;  5EDN A;  3ERM A;  4G8X A;  2G7H A;  1I39 A;  3FHZ A;  2E7W A;  4A6E A;  1L3L A;  2EH3 A;  1FYM A;  4JX4 A;  4RLQ A;  2A3S A;  5HLT A;  2WAQ A;  2HVR A;  1T38 A;  1TW3 A;  3HRS A;  5LEK A;  1F36 A;  2BOL A;  4R1H A;  1HBX G;  4AD9 A;  5DUI A;  4OAZ A;  1W7P A;  3MVP A;  3TL4 X;  3FMQ A;  4OAY A;  3OYK A;  2JQ7 A;  2OU2 A;  4M3B A;  1MKM A;  4L9V A;  1MSF C;  2PX9 A;  1S7O A;  5EZG A;  4HW0 A;  3JTG A;  5J47 A;  2O03 A;  3GEZ A;  1IV6 A;  1BJZ A;  2CUJ A;  3Q9S A;  5LLQ A;  1TL8 A;  1UHM A;  3TBI A;  2WAE A;  3HOS A;  2KRH A;  1KU2 A;  3QYF A;  2EFP A;  3BJO A;  4CXF A;  2DFH A;  3A4C A;  2N8G A;  1Y0U A;  1ZYR F;  2E5Z A;  1X1A A;  4IHT A;  4KJZ A;  2DW4 A;  3I0T A;  4HF1 A;  4DJA A;  1R9T J;  4I2O A;  2AQF A;  2ZCW A;  1YW8 A;  4HLX A;  3ECO A;  4KNY A;  1VI0 A;  4A5N A;  5D8L B;  3BG5 A;  3G2B A;  3T5X A;  1H0M A;  5JR3 A;  1FBS A;  3VOE A;  2XGE A;  2CUE A;  2DT6 A;  5L3G A;  1BI2 A;  3TMO A;  3LNQ A;  1RZ4 A;  1IDZ A;  1I1G A;  3DCF A;  2EA2 A;  4XRS G;  2E5N A;  1N25 A;  5KVR A;  2Y31 A;  4ZDL A;  2GA1 A;  1VF9 A;  3G1M A;  2R7F A;  3PNT A;  1ZG1 A;  3OSF A;  4XLH A;  1NHA A;  4XRM A;  1G3Y A;  2GWR A;  4XLC A;  1Z7U A;  1A04 A;  2HGC A;  5GAE J;  1C0W A;  1SAU A;  3R61 A;  1BA5 A;  3DBR B;  2G0E A;  2VBY A;  1TQM A;  2M9H A;  4D7N A;  3KP4 A;  4NBQ A;  5IYB J;  4HST A;  2JVH A;  4JYK A;  5GAH J;  2LR8 A;  2X51 A;  5FD6 A;  3DQV C;  3T0Y A;  1XSD A;  1GXP A;  2CMP A;  1I1S A;  3BR0 A;  1ITY A;  3VOD A;  2JA7 J;  3WE2 A;  1XGM A;  1D1A A;  1YLF A;  3A02 A;  4E70 A;  2OCE A;  3ECH A;  1TBX A;  3GUD A;  3OIO A;  4RM2 A;  4KIG A;  5L3B A;  5KAF C;  4XM3 A;  2F5D A;  1IGN A;  4KDP A;  3UKG A;  4XKB A;  3CP8 A;  2CYY A;  3CDL A;  3KE2 A;  5K7H A;  1J75 A;  5GTH C;  5EEG A;  4BUP A;  4XID A;  1W0T A;  1HKT A;  1IN5 A;  3F72 A;  1QHH D;  3L7W A;  3GYH X;  2L9S A;  4C30 A;  1OYW A;  2DJI A;  2V79 A;  2DA1 A;  2DBB A;  4EV0 A;  4HZF A;  1WRJ A;  1H89 C;  4EMS A;  2W85 A;  5CVR A;  5HS8 A;  2IGN A;  4KUM A;  4ESB A;  1QPI A;  3MCZ A;  2R7O A;  3IWZ A;  3HOU J;  2M45 A;  2NNN A;  4WF2 A;  2OC6 A;  1G6N A;  3IV5 A;  1LB2 A;  2NOJ B;  3GFM A;  1G4D A;  1R1T A;  1I5Z A;  3IHU A;  4M9X A;  4YII A;  5H20 A;  1LEB A;  3DKX A;  3IKT A;  2P7V B;  4BHP A;  2VIX A;  2EZH A;  3ASN H;  5ILV A;  5EG0 A;  1IN4 A;  2X6O A;  2DLL A;  2L7M P;  3WTY C;  3JRG A;  4RAF A;  1BI1 A;  4G6Q A;  2L5Q A;  3D5L A;  5E17 F;  5KCM A;  1R6R A;  3CCE I;  2EK5 A;  2RAE A;  3CD6 I;  2V1N A;  1EH7 A;  1ETQ A;  2P81 A;  2IA1 A;  4D5C A;  3E6C C;  3QRF F;  5B5E C;  3O8G A;  3AG2 H;  5JVG F;  1TWG J;  1VQ8 I;  5HS9 A;  3FXQ A;  1XD7 A;  4AVZ A;  2Y9Z A;  2RVC A;  1BL0 A;  3LAJ A;  4HPQ A;  5E18 F;  4XON A;  4KMF A;  4CCM A;  2HU9 A;  2PQ8 A;  1SFO J;  2Y69 H;  2NVQ J;  1GV5 A;  1MW7 A;  1XMK A;  4OOI A;  4W1U A;  4UNO A;  4FIS A;  3JR9 A;  2R7D A;  2XVC A;  5FO5 A;  2V9K A;  1VQ9 I;  3ZQF A;  2F5C A;  4IHW A;  3HYI A;  3KLO A;  1ETY A;  2EFW A;  4H0E A;  4DZJ A;  2HPM A;  4V19 K;  4GFB A;  2WV1 A;  3W6K B;  1I27 A;  1D0Y A;  1SFU A;  3GF2 A;  4U7B A;  2Q8K A;  1K79 A;  1ZRD A;  4LB6 B;  2LLK A;  2ICW G;  1VFC A;  2GIV A;  3OIP A;  2E2J J;  3PO2 J;  1YIO A;  2P7C B;  1S6L A;  5CQG A;  4PJM A;  2X4H A;  4AWX B;  1K7A A;  2VBW A;  2E35 A;  3PSI A;  3HBL A;  4A5M A;  5F64 A;  2CUF A;  1LQ1 A;  2VT3 A;  2GXG A;  1CF7 A;  5K7Z A;  3FXJ A;  3OL4 A;  4XSZ F;  3VYS B;  4CZC A;  1JUS A;  4XK4 A;  5IP6 A;  1WWX A;  2LG4 A;  1Z67 A;  3ABM H;  1J9I A;  3L09 A;  1JKQ C;  2AS5 F;  3LA2 A;  2IPQ X;  5E3O A;  1Y1V J;  2A6E F;  3H0G J;  2EQR A;  2VN2 A;  1WI3 A;  1R7J A;  1IN7 A;  2L9V A;  4A3F J;  5IT9 K;  3BCA A;  4BL0 B;  1SD4 A;  1H8A C;  1JUM A;  4B44 A;  3Q0V A;  1S7A A;  3RKX A;  2R5Z A;  4M74 A;  4ZH4 F;  2FJ1 A;  2JJ7 A;  1DQU A;  4XKV A;  3HUG B;  2COM A;  3HOY J;  3ROU A;  1BC8 C;  5HLG A;  3CCR I;  3JTH A;  1PUF A;  2KDO A;  5CQE A;  3G4S I;  5IY5 H;  4MEY F;  3L00 A;  2EZL A;  1U8B A;  3ABT A;  3JRI A;  1N77 A;  2CW8 A;  1D5Y A;  1J09 A;  2R7W A;  4Q4Z F;  1FTT A;  1R4N B;  1WH5 A;  1X1B A;  1S5L C;  5K7F A;  2EB7 A;  2TDX A;  3QYE A;  2CW7 A;  5DCM B;  1VQM I;  2HKX A;  2CFO A;  5HOO A;  2HQA A;  3JRD A;  4XLN F;  4WXD A;  2ZC2 A;  1ZR4 A;  2UV1 A;  1X1P A;  4CZZ A;  3HXL A;  2MAB A;  3S14 J;  1SFE A;  2IP2 A;  4HBL A;  3J7A Y;  4LOC A;  2Q0O A;  4Y15 A;  2I5U A;  4LG0 A;  1R36 A;  1TT5 B;  1JI8 A;  5DTD A;  3TO6 A;  2MD0 A;  4MTD A;  1MJB A;  1OYI A;  4G9Y A;  1IC8 A;  3EUH C;  3M07 A;  2H8R A;  3GLL A;  4BJ5 C;  1VQK I;  1LDD A;  2LBF A;  5ED4 A;  1RRJ A;  2EBI A;  2ZNZ A;  3DKY A;  3MKZ A;  2ELJ A;  2PG4 A;  2VJI A;  1MMS A;  2ACJ A;  1XCB A;  2M1B A;  1YX5 A;  2EWN A;  1JT0 A;  2BY3 A;  1HOM A;  2QUF A;  3MKL A;  1WJF A;  2PBI A;  3GVA A;  4HQM A;  3E3V A;  1MDM A;  1GXQ A;  1XGS A;  1IRX A;  2E36 A;  2F4I A;  2VL8 A;  3DLA A;  3F6V A;  2AXT C;  1QA6 A;  3IUO A;  4YG2 F;  2XF5 A;  5TRD A;  3NWT A;  4XOT A;  4OIP F;  2LDU A;  5B1B H;  3PUF A;  2RQQ A;  2PMZ N;  3FKJ A;  5CJ9 A;  3S2H J;  4BXF A;  1ZQ3 P;  2IRF G;  1MH4 A;  5ICE A;  3CUO A;  2FA5 A;  4Q47 A;  1OCT C;  5B1A H;  4BEH A;  4A3G J;  3E5Q A;  4IXA A;  2WBM A;  3M8F A;  4BDY A;  2XAH A;  3DWL E;  1FOW A;  1UHW A;  3FKI J;  4ZTJ A;  1U8R A;  2HR3 A;  1N78 A;  3GFL A;  3K2A A;  2ECC A;  4BY1 J;  2P4W A;  2LF7 A;  1T56 A;  2R7V A;  1A6I A;  1Z21 A;  3KCC A;  5ILU A;  5HOD A;  5TIS C;  4L5J A;  2XAQ A;  2FD5 A;  3BDD A;  1ZKG A;  3J81 Z;  4UV8 A;  1MBK A;  3QPL A;  2MG4 A;  1FNN A;  2XAG A;  4I02 A;  4U0V A;  1FMV A;  1QPM A;  1YFH A;  2KJB A;  2O61 A;  1VND A;  4ENK A;  2ZKZ A;  1UMQ A;  4BY7 J;  4J19 A;  2WB1 A;  3H9G A;  3KP3 A;  2G7U A;  4LGW A;  2K02 A;  1O3Q A;  3I3L A;  2NYX A;  3M3Y J;  1D1B A;  2DN0 A;  2RNJ A;  4LG3 A;  5DCF A;  1FMW A;  2QQB A;  3SEZ A;  1HKQ A;  4BHC A;  1OCZ H;  2A5W A;  1U5T C;  3ZCO A;  4I01 A;  3PQK A;  4XSX F;  2LYC A;  1EA3 A;  3BRO A;  2IXS A;  3JSO A;  3V8L A;  4LB5 A;  3GFJ A;  2IS2 A;  4M72 A;  5BOX A;  2XSJ C;  2R92 J;  1QO0 D;  1GV2 A;  2L9R A;  1TC3 C;  4RAY A;  1WJC A;  2VOP A;  3DU6 A;  2HVQ A;  3MZ8 A;  3LOC A;  1J59 A;  3CLO A;  1PJR A;  2F4O B;  2QQ9 A;  2YS9 A;  3BJ6 A;  4D0P A;  2WWY A;  2P5L C;  1RC9 A;  5ILS A;  5EGO A;  4E4H A;  1VQ7 I;  2DA2 A;  1G3W A;  1HXD A;  4R8H A;  2E2I J;  2GZW A;  4ZC3 A;  3LSP A;  1F1Z A;  4JP0 A;  1IG7 A;  2HZT A;  1FC3 A;  5B66 C;  4GO1 A;  3ZQI A;  4II3 A;  1T0F A;  3LA7 A;  3OYN A;  4L0Z B;  1U6G A;  5HNH A;  2H27 A;  3K4C A;  4FX4 A;  2V9P A;  2X6W A;  4HA8 A;  4XR6 A;  3F0C A;  1LVK A;  3HRT A;  4UV9 A;  3A01 A;  2K40 A;  2LY1 A;  2D5V A;  1YW9 A;  1YRN B;  1A36 A;  1U5T B;  1X58 A;  1NG6 A;  1ONV A;  3AG1 H;  3LSK A;  1D8J A;  3MN2 A;  1KON A;  1I6X A;  3BR5 A;  3I58 A;  4HLY A;  2K86 A;  4PCQ A;  3ZQH A;  2GM4 A;  1P4W A;  2COB A;  4IRI A;  1EF4 A;  2AXL A;  3FXM A;  2RN7 A;  4A3J J;  3CUQ A;  4I99 C;  1FWZ A;  1OCC H;  5J4Y A;  2HQN A;  4ENM A;  5FD5 A;  2QSH X;  1XB4 A;  3KP5 A;  4PGG A;  2STW A;  2VE8 A;  3FXK A;  3I53 A;  3HIF A;  4Y17 A;  4KIT B;  2W25 A;  4UB8 C;  5J6X A;  2DCE A;  3ZQG A;  2LOO A;  5CVV A;  1CGP A;  4JOM A;  2QKM B;  3K70 C;  4CYC B;  4RB0 A;  3HOZ J;  4PFP A;  3F9K A;  1QVT A;  4ZDO A;  1V5G A;  3VEP A;  4C3J J;  2WC2 A;  4BHB A;  1BN5 A;  2YU3 A;  4FHT A;  2DTZ A;  2LKP A;  4RGX A;  3REO A;  2NVT J;  4MHG A;  3KYL A;  4HF2 A;  3JRA A;  4P1W A;  5ICC A;  3MKY B;  1UEL B;  5BQT A;  3FMS A;  5K5O A;  1USS A;  5LRR A;  1SFK A;  4IZZ A;  3KPH A;  3P9C A;  2QLZ A;  5FRN A;  2IS1 A;  3Q0W A;  4BJT A;  2KIU A;  2EPF A;  4B47 A;  4FE7 A;  3ZMD A;  2XAF A;  5KHD A;  2DO7 A;  5F0F A;  1T8I A;  2LD5 A;  1OIS A;  2F5E A;  1JXS A;  2RQP A;  3L2C A;  3TDZ C;  5IOY A;  5FGM A;  2HOA A;  1XMX A;  1R49 A;  1MMG A;  2DT7 B;  3M8E A;  3HHG A;  5ICG A;  4AM3 A;  5JI6 A;  5F04 A;  1EH6 A;  3KZZ A;  2V6C A;  4Y33 A;  4NHJ A;  5AIP A;  4EVI A;  2Y0S A;  4B3A A;  3WHC A;  3AAF A;  5EEH A;  1BM9 A;  2EA4 A;  3HTU A;  4CYD A;  4XRF A;  1HCR A;  1YJW I;  1D8K A;  1UAA A;  1HF0 A;  1XGO A;  3AL0 B;  3VWB A;  2QWW A;  3CCS I;  3BR3 A;  5K1Y A;  3RYR A;  1T95 A;  2DFI A;  2M0C A;  1AOY A;  1OCO H;  2NS8 A;  1R1U A;  4I7H A;  4U7D A;  4HQE A;  1Y1W J;  2ELK A;  2FXA A;  1MBF A;  4IL6 C;  3SEQ A;  3CCQ I;  3ML6 A;  5M3F J;  1BOA A;  2HDD A;  1W4M A;  3VDX A;  2HVS A;  5C3E J;  3HOV J;  3KEO A;  3T1B A;  2XKO A;  1FYL A;  2W84 A;  2Y48 A;  3PUB A;  2R7S A;  4L5I A;  1ZRC A;  1H9T A;  5JLW A;  4KT5 C;  2VOO A;  1X2N A;  2F6C A;  1J0R A;  3OYE A;  1ETX A;  1S29 A;  3PNV A;  4CCL A;  3HTS B;  3IRQ A;  2KP6 A;  1IRZ A;  2MW8 A;  2CV2 A;  3HC7 A;  1Z7L A;  3M9A A;  2Q2E A;  1B8I A;  3NRV A;  2VPR A;  3VYR B;  2ME0 A;  2RGV A;  2C6Y A;  4HRI A;  2EIJ H;  2ID3 A;  3K4L A;  5J4V A;  4LIT A;  3EET A;  2XB0 X;  3CES A;  4CGZ A;  3KET A;  3AG4 H;  2LKS A;  3WGG A;  2LTP A;  3JRC A;  3QPS A;  1WKM A;  1MJ9 A;  3L2V A;  1V5E A;  1BW6 A;  2M2E A;  1W36 D;  5DD4 A;  2MA3 A;  4RM3 A;  1VTN C;  5LRS A;  4BBR J;  2LVS A;  1YX3 A;  2M8E A;  2KDZ A;  4RAG A;  2HFH A;  3SXY A;  1WJ5 A;  3JRH A;  4M6V A;  1ZHF A;  2KJC A;  3BC8 A;  2LSO A;  5F0C A;  3CJN A;  2ZXH A;  4DYQ A;  2OZU A;  5EEA A;  4I0A A;  3BTC A;  2YUS A;  2H8W A;  3O8H A;  5HLI A;  5FLM J;  3S1R J;  1W0U A;  5DM6 F;  2BY1 A;  4AUX A;  1RET A;  1XN7 A; 
#chains in the Genus database with same CATH homology
 3PJR A;  3OYL A;  2R7O A;  1D0Z A;  3OYI A;  3DEE A;  3OY9 A;  2OC6 A;  2UWM A;  2NOJ B;  4DBQ A;  1YE9 A;  2I8D A;  3DU5 A;  2X6Y A;  3IP4 B;  3DKX A;  4HNU A;  1DGW Y;  3RQ4 A;  2VIX A;  1D1C A;  2VJ5 A;  1K6Y A;  3GBG A;  4J00 A;  1D0X A;  2IGK A;  4F92 B;  1X4O A;  4CSW A;  4XMY A;  5JHF A;  1MND A;  2GOX B;  2VJJ A;  1U0J A;  2L5Q A;  3D5L A;  3CZ6 A;  2PJR B;  5KCM A;  1R6R A;  2E1M C;  1Z3Y A;  4ZTF A;  3MKW B;  2BW3 A;  2V1N A;  1Z3X A;  3AFH A;  2JUG A;  3DPT A;  3DTI A;  3A2K A;  4AVZ A;  2LH9 A;  3OYD A;  2VXD A;  3L2R A;  3FBI B;  4HPQ A;  4XN0 A;  4XON A;  4CCM A;  2HU9 A;  3HPG A;  1MW7 A;  3OS1 A;  4YEJ A;  4XLA A;  2V9K A;  1BR2 A;  3FHN A;  3K4J A;  3EPZ A;  4BE1 A;  2KMU A;  2KHM A;  3OYM A;  3LSG A;  2HPM A;  4ZDP A;  1G8X A;  5FRM A;  1D0Y A;  3CMM A;  4U7B A;  4PJJ A;  3OIP A;  3VYU B;  4YRV A;  2GOM A;  5CQG A;  1MMN A;  4PJM A;  2VPL A;  3MD2 A;  3BCB A;  3PSI A;  2M0M A;  3SDB A;  4E7K A;  3QOE A;  4Y3O A;  2VAS A;  2K3P A;  1UG0 A;  1X1C A;  3AKZ A;  4YEL A;  3OR2 C;  2ZFU A;  3OL4 A;  3QYB A;  2E1M B;  3VYS B;  4CZC A;  3BG6 A;  4E7J A;  2LG4 A;  3H5A A;  2K9L A;  4PUS A;  4X0G A;  2IGO A;  4BJ6 C;  2L7K A;  2IS6 A;  2R7X A;  2VQH A;  2CV1 A;  2M3A A;  3KEY A;  3BCA A;  2HDW A;  4BL0 B;  4BAC A;  3H0D A;  1WFX A;  4B44 A;  1BR1 A;  3L2Q A;  2X6X A;  4E7S A;  3RSN A;  3OYF A;  4P5O A;  5LD2 C;  1DQU A;  4XKV A;  3HUG B;  1LFP A;  3S93 A;  4ZJZ A;  2KDO A;  5CQE A;  2Z1D A;  4PK4 A;  3V42 A;  1N77 A;  2CW8 A;  1J09 A;  2R7W A;  3OYG A;  3BLY A;  3VSL A;  4C2T A;  4F52 A;  1X1B A;  3QYE A;  3CF2 A;  3ZQQ A;  2CW7 A;  4HSR A;  2CFO A;  3EUK L;  4B3X A;  5HOO A;  2HQA A;  4D9J A;  1GLN A;  2UV1 A;  3S3O A;  3HXL A;  2MAB A;  3M1C A;  4FET A;  2CUZ A;  4XLF A;  4F55 A;  3J7A Y;  1Y56 A;  3DPL C;  4B48 A;  3H5N A;  1JI8 A;  2MD0 A;  5HVQ C;  4ITV A;  2KRC A;  3EUH C;  4CH7 A;  3N05 A;  4CA0 A;  4BJ5 C;  2LBF A;  2Z16 A;  3DKY A;  3K4M A;  3MKZ A;  4CUG A;  2ELJ A;  2VJI A;  1YX5 A;  3ZGK A;  1WJF A;  4XL9 A;  1IRX A;  2VL8 A;  2F4I A;  2XDV A;  3DLA A;  4HEA 2;  4F91 B;  1X4P A;  4NQW B;  3IUO A;  2XF5 A;  3W3C A;  3NWT A;  4XOT A;  1NG7 A;  3HOT A;  2RQQ A;  1QU3 A;  2HPI A;  3FKJ A;  4BXF A;  1WJA A;  2JSP A;  3MMY B;  2FUG 2;  3FDY A;  1Y6I A;  1DGR M;  2XF6 A;  1PYV A;  4BEH A;  3AL0 C;  2W1O A;  2WBM A;  4BDY A;  1HA8 A;  3PNY A;  3LSM A;  3W2W A;  3DWL E;  4N4N B;  4PFO A;  2Q2E B;  2VKH A;  3W2A A;  3L2W A;  3RPU D;  4ZTJ A;  4FAS D;  1N78 A;  2CS3 A;  4CCN A;  4E7H A;  3OS0 A;  2R7V A;  1Z21 A;  2WAD A;  2OV7 A;  4JQF A;  2V7F A;  1OR7 C;  2XF7 A;  2RRE A;  3HPH A;  2KPM A;  4Y4R A;  3PFY A;  2V4J C;  4D1Q A;  4F3Q A;  4IQJ A;  1FMV A;  2E60 A;  3M8J A;  4XKW A;  3H35 A;  4HG2 A;  3ZXS A;  4J01 A;  2W82 A;  2L9N A;  3S3M A;  2WB1 A;  3H9G A;  3LSI A;  2R7T A;  3I3L A;  4RLF A;  5TGT A;  1D1B A;  4BE2 A;  1X19 A;  4HNT A;  1TT0 A;  4LG3 A;  1FMW A;  2ZSH B;  3SEZ A;  2VJ4 A;  3S8P A;  3S32 A;  1E0E A;  2A5W A;  1MMD A;  3ZCO A;  1V5F A;  1P9Q C;  3IAM 2;  2W4S A;  3IAS 2;  3ONQ A;  4KT6 A;  3UR3 C;  4R79 A;  4KIS A;  2VQG A;  2CH0 A;  2LYC A;  1EA3 A;  1BR4 A;  1X1D A;  2OUM A;  3H5R A;  3FBN B;  2IXS A;  2UUZ A;  3I9V 2;  2VKD A;  3KX2 A;  2IS2 A;  3OMY A;  1AA7 A;  2XSJ C;  3DTK A;  3U21 A;  3HG9 A;  3CJR B;  1WJC A;  3H9Q A;  3DU6 A;  2HVQ A;  2KQR A;  1TZL A;  1PJR A;  4XKC A;  4CCK A;  4B43 A;  4E4H A;  2PJR A;  4H4K C;  2WY8 Q;  4ANJ A;  3LSH A;  2BW3 B;  2LC2 A;  4XOR A;  2WAF A;  2M7A A;  4ZC3 A;  5FRO A;  1ZEL A;  3C2G A;  1G59 A;  3SYT A;  4IQ4 A;  2WA0 A;  5CKT A;  4BEH B;  4RMN A;  2M7B A;  3OL3 A;  4II3 A;  2DXI A;  2A6T A;  2BVM A;  3OYN A;  3K4N A;  5HNH A;  3K4C A;  2X85 A;  2X1C A;  2X6W A;  2V26 A;  3W2V A;  4XR6 A;  4ZYA A;  2VQL A;  1LVK A;  4G6T B;  2LY1 A;  3LL7 A;  4NUB A;  2AQE A;  3RCO A;  1NG6 A;  3OOU A;  2XC7 A;  3LSK A;  2V6E A;  2MC4 A;  1KON A;  2P0W A;  2JA2 A;  4PSW A;  3OIQ A;  3S3N A;  4XNF A;  1BOB A;  4LIV A;  3OS2 A;  4GRI A;  2MYS A;  1WJE A;  1VZ0 A;  1OLT A;  4IX7 A;  1W36 C;  3QOD A;  2KZV A;  2VQC A;  4QPQ A;  4DOZ A;  4DBR A;  2KLO A;  4KIT B;  2M4G A;  4DGW B;  2DCE A;  2LRE A;  1ERD A;  2LOO A;  2LY2 A;  2R7Q A;  2WY7 Q;  4JOM A;  2QKM B;  3H9J A;  3RTR A;  3K70 C;  2KL4 A;  4PFP A;  3F9K A;  4AU7 A;  4BQN A;  4E6K G;  3CP2 A;  3OR1 C;  4ZDO A;  1V5G A;  4QPO A;  4LIU A;  2K9M A;  4E7L A;  3LFU A;  5KNL A;  4NNJ A;  4XLE A;  2VB6 A;  3ZR8 X;  3KYL A;  2CV0 A;  4BDZ A;  2ZSI B;  4P1W A;  4BQQ A;  4XOP A;  3MKY B;  1UEL B;  2W00 A;  4AYB A;  3LMM A;  4IZZ A;  1SFK A;  2VLA A;  2X1D A;  2MFZ A;  5FRN A;  2DOA A;  2IS1 A;  4RLQ A;  4BJT A;  4DIQ A;  4OWR B;  4B47 A;  3K4K A;  2R4G A;  3EUA A;  2WAQ A;  2XAU A;  5HLT A;  3K6G A;  5KHD A;  4E7I A;  1QHG A;  2HVR A;  2RNG A;  2BOL A;  3CJQ B;  3SZG A;  4OAZ A;  2PMZ A;  2IS4 A;  2BVL A;  3TL4 X;  4OAY A;  3OYK A;  3E1S A;  2W7N A;  1MMG A;  2O5R A;  3L2U A;  2DT7 B;  2M4K A;  5HNF A;  2R7R A;  3HL2 A;  3DTE A;  4Y33 A;  1LKX A;  2CUJ A;  2F5V A;  3TBI A;  2WAE A;  3HOS A;  2Y0S A;  3K4B A;  2KRH A;  2VXZ A;  3QYF A;  4II2 A;  4IKF A;  3A4C A;  3OYB A;  1UAA A;  2E5Z A;  1X1A A;  2LBF B;  3VWB A;  3AL0 B;  4KJZ A;  2IGM A;  4BS9 A;  4DJA A;  1S9H A;  2AQF A;  3NWS A;  3OWT A;  2QKL B;  1T95 A;  3G2B A;  2JVG A;  4EAT A;  3OYC A;  4BU2 A;  3OYH A;  2DT6 A;  3TMO A;  2K5C A;  1WJB A;  4U87 A;  4F93 B;  3OYJ A;  3SEQ A;  2HVS A;  4PJN A;  2R7U A;  2E5N A;  3VDX A;  4ZDL A;  3PUB A;  4BGD A;  2R7S A;  2ZXI A;  3A1Y A;  3PNT A;  5LFA A;  2HZD A;  4XLH A;  4XLC A;  2F6C A;  1N75 A;  1WJD A;  1SAU A;  4E7Z A;  3K10 A;  3OYE A;  3PNV A;  4CCL A;  2Z2S B;  2KP6 A;  3E0J B;  4BE0 A;  2CV2 A;  3PL8 A;  4HST A;  2JVH A;  3HC7 A;  1Z7L A;  2X51 A;  3DQV C;  3UNG C;  3VYR B;  3D5R C;  4HRI A;  1LDK B;  2L2O A;  2CMP A;  3D5S C;  3K4L A;  4XN3 A;  4CCJ A;  3HKZ A;  3ZRG A;  4LIT A;  4MLO A;  3CES A;  3VSK A;  4BQO A;  1D1A A;  4NC8 A;  3VYT B;  4C2U A;  3L2V A;  1V5E A;  4NC7 A;  1W36 D;  2X1E A;  3BG7 A;  4RM2 A;  3DPU A;  4PSX A;  4XM3 A;  4RM3 A;  3C2H A;  4CCO A;  4XKB A;  3CP8 A;  1YX3 A;  3K70 D;  4BUP A;  1WJ5 A;  2LRD A;  1QHH D;  2Q1Z B;  2L9S A;  4C30 A;  4N4O B;  2DJI A;  1DP3 A;  3BC8 A;  4C9Y A;  4XQF A;  2ZXH A;  4PJL A;  3PSF A;  3OYA A;  1MNE A;  1T0F C;  2HNH A;  1MMA A;  5CPR B;  2IGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...