4J01A

Crystal structure of fischerella transcription factor hetr complexed with 29mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
total genus 62
structure length 294
sequence length 294
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A02
4IZZA 4J00A 4J01A 3QODA 4YRVA 3QOEA 4HRIA
chains in the Genus database with same CATH superfamily
2V1XA 4XRSG 3PSIA 3QP5A 1A35A 3DKYA 1ZRFA 3G1OA 2E2HJ 1T56A 4HV5A 2JMWA 3SZTA 4D0PA 4RGSA 2VPLA 2TCTA 4ENMA 2OU2A 2IS6A 1FMWA 2IAIA 1PP8F 2JJ7A 2GAUA 3RKYA 1YS6A 3KETA 1REPC 1DGWY 3OYMA 3HB9A 3QWLA 5L3CA 1HKSA 2KRHA 3BQYA 4BNCA 2HTSA 2JA2A 3CCMI 4D9JA 2BHZA 3A02A 4ITVA 3GZ6A 4RAFA 2G7UA 2VONA 3J80K 2ZFUA 4LOCA 1Q1HA 4YFNF 2ZXHA 4BL0B 3FHZA 4R8HA 2ZXWH 5GP9A 4A6DA 2HQAA 1U9NA 2Z16A 2HTJA 1R23A 2HDWA 5E18F 5K7ZA 1XGSA 1VF9A 1RIOH 3FK7A 4B44A 1GT0C 1K4TA 2VOOA 4XRSA 4OWRB 2JTVA 4RLFA 4EGZA 4Q4ZF 4S05A 3FXLA 2M7BA 3HL2A 3S14J 2VQGA 3K7AJ 3A0BC 1P4XA 2DQLA 3T1BA 5ICEA 1F1ZA 4CCLA 3BJ6A 1YIOA 4M3EA 4CDGA 1R58A 2VPRA 2UWMA 4XONA 4OMYA 3C7JA 1ZK8A 1K61A 3JCUC 4QPOA 4U7BA 1USTA 5KCMA 4O3MA 2DT5A 2H6BA 4KN7X 5CQGA 1FOYA 3CQZJ 4IEJA 5GAHJ 4KITB 1JUPA 2A6EF 2EV0A 3R0JA 1W5CC 4UY8I 5C3EJ 2BY0A 2E35A 5KAFC 1IRZA 1X19A 3V7SA 4CCKA 3IH3A 4MO7A 3H5RA 5LGTA 2XAUA 3I4MJ 5FB2A 1FNNA 4IJAA 3CCEI 4ABZA 2FA5A 1MDMB 4A2UA 2VN2A 5B66C 5FD5A 4HBLA 4ZYHA 5HODA 1VI0A 5ICGA 3PQKA 4XRMA 4XSXF 1TNSA 5C44J 2O7OA 4ENNA 5HLIA 2JZYA 2NOJB 3K10A 3LA2A 4HOBA 3KX2A 1FBSA 4HLXA 2HOSA 3TBIA 1P9QC 1WQ2A 3FDYA 2DT7B 1YO5C 1BOBA 4G6TB 3KE2A 4RGUA 1EH8A 1YJ9I 1IW7F 4M6VA 4FT8A 1TWHJ 1WHUA 5J3LA 2EZIA 5CLSA 3RSNA 2HVRA 3BCAA 4E4HA 3OYAA 3CMEI 2ZCWA 3BJAA 2CQNA 3MZYA 4A5NA 1TP4A 5GADJ 5LD2C 1OCPA 1ZARA 2W57A 4BYYA 2KDZA 2VXDA 3OL3A 1WJCA 4OU0A 3GXOA 5A2QK 4A3KJ 3DCFA 1JKPC 1T0FA 1K6YA 3HHHA 2ZJRF 1GUUA 2HVQA 2JA7J 3GFIA 5D5WB 4Z6YA 3BG3A 2QZ8A 2STTA 4QPQA 4FCYA 2LYCA 1ZG1A 4I98B 4UXNA 5HDNA 4AIJA 1K7AA 5JI6A 1K78A 3NEUA 2YUSA 1LVAA 1WFXA 4QTRA 4V2FA 1RUNA 3JR9A 4CYCA 3D5SC 1WRJA 4HF0A 1D5VA 4YFKF 4EJWA 5FKLA 4A3GJ 1YI2I 2YU9J 2FBIA 2UZKA 1MMNA 2YSRA 4K2EA 2R7FA 5LHGA 2B9SA 5F0HA 4WCGA 1FT9A 3CMMA 2R7RA 4JP0A 4G8XA 2AQFA 2GIZA 1HBXG 3MVPA 2FMYA 3CF5F 5D6FA 1PUFA 1AHDP 2Z5UA 1T39A 2M2EA 3CP8A 1V5GA 5HNFA 4ON0A 3WGHA 4IQ4A 1WSUA 3T0YA 1JE8A 2IBDA 2FQ3A 4I76A 4XORA 3IWFA 5BPIA 5DTDA 1A36A 2GLOA 3L9FA 3LFUA 1UB9A 4X1EA 5K5RA 2DFEA 2OCEA 2XKOA 1F43A 1P7JA 4L5JA 4PJLA 4PJNA 2QQ8A 4ZYAA 1X1PA 1YLFA 3TKYA 4C2MJ 3GCMA 3OYHA 3VOEA 3I3LA 3CDLA 2XROA 4BE1A 3CJQB 1DUXC 1X4PA 1YRNA 1X3UA 2MD0A 1SC7A 4V19K 1PYVA 2WB1A 3L2VA 5D5VB 3D5LA 1LDDA 2QA4I 1Y39A 1S7EA 1SVLA 2FD5A 4PZJA 3PO3J 1Y8RB 3V8JA 2DMUA 3ULQB 2BXZA 2M87A 2H1KA 3EPZA 4EEFG 2E1CA 3VB2A 2R7SA 1YX3A 2BOLA 5DM6F 1N77A 4UB6C 4BJ5C 5IP6A 4KFCA 3WTTC 2IEKA 3OYDA 4L0ZB 2DA6A 1F36A 3B6CA 2F5FA 2A68F 2O61A 1O57A 2IW5A 5CVJA 1JGSA 2BVMA 2ZSHB 1FOWA 3J7YJ 2VIXA 4D5FA 1H0MA 1O7LA 2M0CA 3S3NA 4A3LJ 2OA4A 1A5JA 4R1HA 2A3SA 3G6EI 3JRIA 2L01A 3WODF 2XASA 1MH4A 2MLGA 4KT6A 4FTHA 2K9QA 3A03A 2HEOA 5CPRB 3JRGA 2IJLA 3FXQA 3BQZA 2X6WA 3LA7A 4HA8A 4BE2A 2OC6A 2ME6A 4WX9A 2OV7A 3K4BA 5CVRA 4ZDLA 4C2TA 1H89C 3LQRA 3M8JA 4GFBA 1EJ9A 4H4KC 4WXHA 5IYDJ 4FASD 3QYEA 2OZ6A 1IAWA 1APLC 2DOFA 2KPMA 4XL9A 5CKTA 1WJEA 2OZUA 3U2RA 3IKTA 1Y0NA 2AQEA 4RAZA 3DV8A 3OYJA 3FXRA 3K1NA 2VASA 3CCQI 1VTNC 4E7HA 4RS8A 4YRVA 2HOTA 1JKOC 1W4MA 2XB0X 1ZAOA 4XLFA 3SZPA 4RDUA 1G3YA 2Q2EA 2X85A 3K1PA 3K4NA 3BR3A 1D8KA 2JRMA 2ZJQF 4RBOA 3E5UA 4HQEA 2W48A 1IZ1A 2H27A 3DTIA 3W6KB 4KDPA 3UNGC 3CJNA 1FIPA 4G9YA 4Q47A 2XRNA 1LJ9A 5K5QA 4J19A 1I6HJ 2IPQX 4AVPA 3L1PA 4IKFA 4XLCA 1WWXA 4RAGA 2VJ4A 2EFWA 2X1DA 1BBYA 3H3UA 5IT3A 5L3EA 4ZYDA 1T08B 4ENJA 4G94A 1YW8A 3HKZN 1K6OA 4IOCF 1U5TB 4GYGA 3MCZA 4EJTA 2R7DA 4UUSB 3GW2A 3ZQGA 2CQKA 3L00A 2DA7A 3JAMZ 3MWMA 1S5LC 3OYEA 3KYLA 1CQTA 3OR1C 1JGGA 3AG2H 3QAHA 3BT9A 2KIQA 4U88A 1ZHFA 4BHCA 2H8WA 3WU0A 1N78A 3FWEA 3PSFA 4C3JJ 2HKOA 3ZR8X 3B6AA 3BZKA 1FY7A 1HQCA 1D1BA 1WI9A 2L7FP 2L5QA 3BCBA 3TEDA 2J5OA 2AS5F 2JT1A 2O5RA 2E71A 1OR7A 1R00A 4U87A 3U1DA 4BBRJ 1MJBA 5GPCA 1JHFA 4A3FJ 1OKRA 1FYMA 1TWGJ 3E0JB 3OS1A 3OYFA 3HOUJ 2E34A 2XF7A 3BR1A 3H5NA 2EV5A 4C2UA 1B72A 2CSOA 2CW7A 3VPRA 4BHPA 2XSJC 3FF5A 2LY1A 1S7OA 1STZA 4BQNA 2MG4A 2OD5A 3FHNA 3GZ5A 3F3XA 3CMYA 1W5SA 5D4RA 4RA2A 3O6BB 5CYVA 1O7FA 1XS9A 1FTZA 1Z05A 5EZHA 1QGPA 2CUFA 4B09A 2H8RA 2VODA 3H3ZA 3G71I 1XMXA 2JSCA 4IHSA 2K4BA 2LP0A 4DJAA 2ETHA 1OYIA 4BY7J 2ACJA 1RPWA 1MBFA 3MN2A 2W85A 2F4IA 1Z7LA 4DYQA 2E7XA 2V6EA 1QVUA 4FETA 1MBHA 3GF2A 4ENKA 3DEWA 4B1RA 5BQTA 2D5VA 4HEA2 3RPUA 2FE3A 4IHTA 3V8KA 1B8IB 5LFAA 3LMMA 2MD5A 3QP6A 2DN0A 4XKWA 2RQPA 1R1TA 2JN6A 4M3BA 3N97A 2DMTA 4AVZA 2L7ZA 2QBYB 4M6XA 3Q9VA 1BR2A 4F92B 1MBJA 2O8KA 2GWRA 4MIMA 2FUG2 5E1ZB 1FIAA 3M1EA 2MC4A 1GVDA 4F3QA 3GTLJ 1RETA 4ZYGA 2MSYA 3OIQA 2G9WA 3OOUA 2QENA 2VBZA 3BTLA 6PAXA 4UVBA 2UUZA 2QSHX 1UJ8A 2V9PA 2Y48A 3WGIA 1ON1A 1YW9A 1MH3A 3MQ0A 1MSEC 2QM3A 4XKVA 3ZQLA 2ZKZA 2WAQN 2PMZN 1NTCA 3TO9A 2Z2SB 2HYFA 2W82A 2ICWG 3L2UA 3M3YJ 1EKEA 3D1NI 2M1BA 1JHHA 1ZLJA 2B7EA 2YU3A 2HXOA 1MNDA 1XX5A 3HGGA 2XB5A 5F64A 2R3SA 1LNWA 2O0YA 4BXFA 2HZTA 3E6CC 3WE3A 5B3SH 2VXZA 2ECBA 3ABKH 5KVRA 1HA8A 4WF2A 2RKHA 4YFXF 3OYIA 4P9UA 3E1SA 2JA8J 2EIKH 3GFJA 2ZO4A 4ZH4F 3FBIB 5J1UA 1FBUA 4HW0A 4AD9A 4OAYA 2X9DA 2IP2A 1MD0A 1SD5A 2V1NA 4Y4RA 3GWZA 3HOZJ 1XDSA 2EIJH 2Q0OA 3TW7A 2NNNA 1LKXA 4FISA 4KJZA 1OCRH 3HM5A 1Z3YA 5DM7F 2XGDA 3S8PA 4CICA 5IT9K 1QHGA 3DXJF 3EUKL 3HRUA 1FPQA 3HSFA 2E36A 3OMYA 4N4NB 4NC7A 2M3AA 1MIJA 1D5YA 4OIQF 5CQEA 3RKXA 1P2FA 5M3MJ 5FO5A 1OISA 3NWTA 5DDGA 1JUMA 1R6RA 1S9HA 2GQQA 1S7AA 1MNEA 4XLHA 4IRHA 2VQCA 3S32A 2WV0A 5DCMA 2QCOA 4RGXA 4EVIA 4AM3A 4U7DA 3SEQA 2L9NA 1QZYA 3HKZA 1G8XA 3S1QJ 4NC6A 4HX4A 2DI3A 5J1RA 2KP6A 3LSPA 1ZGWA 1WVRA 2QEXI 2EFNA 3HPGA 1J2XA 1KA8A 1KONA 2N8GA 3CD6I 1ZGJA 3L2WA 3GTQJ 1QZZA 3HXLA 5F1JA 2LD5A 3A01A 3J7AY 2P81A 5EEGA 2ZNYA 4FE4A 5BNGA 4CHUA 1LDKB 1N75A 3GUDA 3ZN1A 4GRIA 1TBXA 4ESBA 1S72I 2F5DA 2NVTJ 1G3SA 3E6DA 2ESHA 3LAPA 1VFCA 3WTVC 2E1OA 3ZMZA 4XN3A 3NAUA 1X1DA 2P5VA 2XF5A 3MD2A 1O3RA 2PMUA 2EJRA 4I6ZA 4JBAA 3HSEA 4BAYA 3I59B 1WCMJ 3PUFA 3R61A 4ZDOA 5D8LB 1ORKA 4NQWA 3AL0B 2O6GE 2A05A 1ETOA 1EH7A 4Y15A 2HQRA 1ZQ3P 4U0VA 3WG9A 4M3GA 1J5YA 2OTLI 1X2MA 3H9GA 4ETSA 2QVOA 4OIPF 2EINH 2XHKA 3AKZA 4BDYA 2PG4A 3OL4A 3F6VA 3F8MA 2A69F 1LEBA 2CQQA 3H1CA 3PFIA 3DEEA 1HDPA 4NDLA 1TWCJ 3DLAA 3PJRA 2GXBA 4ZYEA 3Q9SA 1YS7A 2HR3A 3C18A 3HRSA 2W4SA 3HHGA 4B3XA 4CZZA 3EUHC 4HPQA 1ZGAA 2KHMA 4F7ZA 3DBLB 1I1SA 1FZPB 1IDZA 3OYCA 5IYCJ 1FYLA 2QLZA 4XIDA 1UCRA 5ILUA 4Z2YA 2GA1A 4Y33A 2DK8A 1Y8QB 2AXTC 2HXIA 3G2BA 2OUMA 2XPUA 4AYBN 1UMQA 1LFPA 2X6OA 3VSKA 3HDDA 4DW6A 1HW1A 3QPHA 3WGGA 3W6JB 3H0DA 3TP3A 2RAEA 5J4YA 4LG0A 2XGEA 4HF1A 1QPIA 3KPHA 1IRFA 2CW0F 1U5TC 4EJVA 1XSXA 2MLKA 1R71A 1HW5A 4DOZA 4DZPA 2DT6A 4XN0A 3FXJA 2HS5A 4E7IA 1SANA 1I27A 1YYVA 1ODDA 3OSFA 2WAQA 4I2OA 5E1XA 5JLWA 1VQ4I 3F21A 1D8JA 2MA3A 1XTAA 3KLNA 1IN7A 1Z77A 4A69C 2Y30A 3I71A 2DA1A 1BR4A 4OOIA 3F72A 4L18B 3KZIC 2JVHA 2Z99A 5LGUA 2X0LA 1B1BA 3QYFA 4CCNA 1O3TA 4DZJA 2K9LA 3OY9A 2EIMH 4UHTA 1NK2P 1LUJB 2F48A 5HS7A 1O3SA 2DMQA 3J80Z 2GIVA 3GVAA 1RR7A 3BY6A 1IV8A 2IS1A 3WTUC 1SVMA 2EFPA 3HUGA 2HPMA 4EM0B 4H0EA 2VJIA 4CO8A 1F9NA 1U2WA 2K40A 4PUSA 1DPRA 5K7HA 2GBYA 1WJ5A 4EM1A 2X1EA 1FJLA 3KFWX 4XNFA 2LC2A 4IVNA 4BEHA 1ONVA 5FD6A 3GZNB 4LIVA 2VC1A 4BE0A 3BDDA 2OQGA 3G1MA 3RQ4A 2RNJA 3HOWJ 2A6TA 4UUVA 2CV2A 4JQFA 2CU7A 2QKMB 2TDXA 2YR2A 4PSXA 1HXDA 1PUEE 3CLOA 5E79C 1A6IA 4XMYA 5FKMA 4IX7A 3CC7I 2VLAA 1ETWA 1V4RA 2M34A 5ERIA 2PI0A 2R7UA 3KCCA 3IRRA 2K86A 2EBIA 3G73A 1HC8A 2G7HA 4FQGA 3TO7A 4RB3C 3I56I 5DD8A 2K9MA 2JPBA 3ZQHA 1QNTA 1OMIA 1Z67A 1YJWI 2CQ7A 1ULYA 3V7CA 3COAC 4LB5A 3KP7A 3JTGA 4IRIA 4EJUA 1ZLKA 2KZVA 5F6FA 3AG1H 1F5TA 4L0YB 4HSRA 2LFBA 1WJDA 1ZR4A 5L3GA 2ID3A 2ELJA 3VEPA 4CA0A 2JA5J 5EG0B 2HOEA 1I3AA 3QPTA 4G6DA 3TO6A 1JKRC 2K85A 3HOVJ 1ZTRA 4A3IJ 1MZBA 2F4MB 3CCYA 1QU3A 4S04A 3V8LA 3CCVI 5E17F 2E1MB 2R92J 2JRTA 3VYSB 4E70A 2MGQA 4MHGA 1ZKGA 3FMRA 4YEJA 3V4GA 2Q8KA 2LRDA 3FMQA 1AKHB 5HS8A 3GX4X 5M5WJ 2DXIA 4QWQA 1IUFA 4ZTFA 1RC9A 3FXKA 2LTPA 3BTJA 4AWXB 2ZMEB 2JWTA 4O5VA 2V7FA 4NBQA 4W97A 3GLLA 3SDBA 4A0XA 1MMGA 4P5OA 3IP4B 2JQ7A 3S16J 1R4NB 2R7VA 3ZMTA 3T8RA 5GTIC 5A2QZ 2DOEA 3VYUB 2F5CA 2HVSA 1T98A 4DGWB 1HSJA 1Z6RA 2XGCA 4A12A 2P7CB 1CF7A 2VB6A 3CDHA 1X58A 1IDYA 3LSRA 3ZMDA 3QODA 2W1OA 4NHJA 2KIFA 2EV6A 5L3DA 3KIOA 1JT0A 1JXSA 3CTAA 2V1UA 1RR8C 4WXDA 4Y3OA 4HF2A 3ERMA 2PJRB 1I6XA 3KEOA 1HKTA 3CO7C 1H9TA 2EA4A 2LDUA 2PX9A 4JX6A 3A0HC 4XSZF 5EGOA 4CZCA 2W24A 4B3AA 4IZZA 2JUGA 3PL8A 4M9SA 4CSWA 2HDCA 2QKLB 3GTKJ 1Z3XA 2K5CA 3DLLF 4LITA 3WTWC 2NAZA 1MSFC 3E6BA 1V5FA 4BDZA 1W5TA 4GDFA 4JK1X 3ZPLA 2VT2A 2LK2A 4GCVA 1VQ9I 2R5ZB 1JKQC 2FOWA 4AYBA 2O03A 4N9IA 5LHIA 4BQQA 4PCQA 2OBPA 1U3EM 2XVCA 3ECHA 3N05A 3JRHA 1T2KA 5M3FJ 2BHYA 2OPTA 5HLGA 2YPRA 3Q3SA 1EF4A 1T6SA 2NVXJ 3DQVC 1L3LA 2Y0SN 3HTSB 2PMHA 5E8GA 2ZB9A 3ZP5A 2KJBA 3GLXA 2LG4A 3W2AA 2YX7A 1XMAA 2DPDA 3K4KA 2F5EA 3LSIA 3KZYA 3ZN0A 1VQLI 4RM3A 1ENHA 1J9IA 3OV8A 3RYRA 2RC4A 1QO0D 5FROA 5CJ9A 4C3IJ 3ZCOA 2FNPA 1W0TA 3DWLE 5E20A 4WWCA 3CUQB 4PGHA 3ZMVA 1ON2A 5FFXA 1YW7A 3M9AA 1NK3P 2BW3A 3AL0C 2KJCA 4BS9A 2P6TA 3D0SA 3N4MA 2RV8A 1EH6A 2R0QC 4I01A 1AA7A 2W00A 1ZG3A 1QHHD 2DA2A 1BI1A 2ZJ2A 1O3QA 1C0WA 4ESFA 4R79A 3P9IA 4EGYA 2IGKA 3QPLA 4U0WA 4C9YA 1YIJI 3RQIA 2V79A 3HSRA 4IRGA 5LGNA 2NNYA 1DQUA 2H6CA 3BR2A 4G12A 1LE8A 1X1BA 2R4GA 3IV5A 2ZSIB 4L9VA 1Y0UA 4XBFA 1OCCH 3QRFF 3ZQ7A 1Z1DA 1TT5B 4C3HJ 3BG6A 3K1MA 2NVYJ 3OIOA 2FX0A 2LY2A 2M4KA 1LFUP 2GZWA 2NXNB 1ZH5A 1ZRDA 1BM9A 1P7IA 3SYTA 3VYTB 3DFGA 2R7ZJ 2Y9ZA 2X1CA 1WJAA 4HV6A 1MBKA 2NVUB 1YG2A 2GA2A 1IRXA 3M1CA 1FX7A 1V5EA 2LOOA 4RGRA 2X4HA 3DU6A 2HYJA 1RKTA 1OCZH 2NS7A 1R1VA 2XGXA 2DA5A 4GGGA 4GO1A 2RQQA 2R7OA 1Y1VJ 2MH2A 3E6MA 2D1VA 2QQAA 2CG4A 2LBFA 1SMTA 2HFHA 2E5ZA 1H9GA 2WY8Q 2DFIA 3DF8A 1BA5A 4MEXF 1XGNA 2ECCA 2K3FA 3KP4A 3G3ZA 3G1LA 4P96A 3I58A 5TGTA 1B59A 3ZMSA 3KZZA 2FNAA 3FMSA 3J81K 1BI2A 1UELB 2H1LA 2ZNZA 5J8CA 1M1EB 4YIRX 3RI4A 3BWGA 1LB2A 1YE9A 3SQNA 1I1GA 4AC0A 2IGNA 3PFYA 2OF7A 4F52A 4I99C 1W7PA 4MTDA 2XKPA 2COBA 4BBSJ 1T38A 3CF2A 1FC3A 3RPQA 5BS6A 1LVKA 2V6CA 5JFRA 4G7HF 1F4KA 3F9KA 5K7FA 5HS9A 3T5XA 2NS8A 1VQ8I 1J09A 2QUFA 3M4OJ 1GDTA 2JSPA 5LRSA 3HBLA 1ETQA 2AO9A 3J7AO 1D1AA 3T8TA 4BU2A 1B6AA 4JOMA 1J59A 4Y17A 4MQ9F 1G2HA 2B63J 4X0GA 3DBHB 2V9KA 1QQIA 1VQKI 2BY3A 2EPFA 5DUIA 3JSPA 5D6EA 2WAEA 1TW3A 1D1CA 3SEZA 4AU7A 4IHVA 4LK0F 2DTZA 3ZMUA 1VQ5I 1OCOH 2BBYA 3WHBA 2Q1ZB 3SHFA 2E2IJ 3HYIA 2CWEA 3IHUA 2L2OA 2MH9A 1XCBA 4G7ZF 3H92A 4RB2C 3PIPF 3FKIJ 1OQYA 2E2JJ 1IUYA 1LDJA 4BHBA 5JVGF 1JTYA 3G4SI 4LJZF 2M8EA 2BE5F 5B1BH 2XDVA 3HJEA 4A93J 3RKQA 3NQOA 1VQ7I 2OTJI 5ICFA 3M8EA 1YJNI 1QVTA 3KYCB 2LF8A 2XAQA 4RM2A 4DBRA 1POGA 1Z21A 3OS2A 3U1KA 2ZBKA 3P9KA 2XF6A 3LNQA 1MBEA 4ZZLA 5J4VA 3ZGKA 2ADUA 2V26A 3H5AA 1Y1WJ 3K2ZA 2IS2A 4QLCU 4M74A 4MGRA 1D0ZA 1TLHB 4DQ2A 3LSJA 1A31A 3KP5A 1KU9A 4HDVA 4P1WA 3K2AA 2HWVA 4AIKA 1MDMA 1FTTA 2K7LA 2HDDA 3MZHA 3LQQA 3GTGJ 3M8FA 2E1MC 5GAGJ 2VBYA 1K79A 4JYKA 1H8AC 1K78B 2NOGA 3O8GA 1NG7A 1PP7U 4BACA 1WKMA 1NHAA 2IXSA 2M30A 4PSWA 5DYMA 1KYZA 1YTYA 3RKWA 3OYLA 4ZJZA 1P6RA 4F91B 4DNCA 4CYCB 1G3WA 2R7WA 1U9OA 2DFHA 1BJZA 1I3QJ 1XDUA 3KLOA 3PM1A 4D7MA 5E3NA 1MJ9A 2NYXA 2ZMEC 1KGSA 3GYHX 1J75A 1T33A 4RLQA 2CO5A 3JSOA 4B48A 4BQOA 3SFZA 1WZ2A 3L09A 5AONA 5HNHA 4GYIA 1GVJA 4J00A 4IL6C 3Q0WA 2FMLA 1V54H 2COMA 1FWZA 2A5YB 3CCJI 5IOYA 4LMYA 5GPAA 1PUFB 5IY5H 1FOKA 4BQAA 3JRBA 4IHYA 2FJ1A 5FLVA 1ETVA 1QPMA 2ID6A 4A3DJ 2BGCA 1PDNC 2XPWA 3ISPA 1BIAA 3U21A 1IC8A 3ZXSA 3HC7A 1XB4A 2JA6J 4A0YA 1BJAA 1YRNB 2F6CA 4A5MA 4AUXA 3OSGA 2MW8A 1R4MB 3BC8A 1BW6A 3CCUI 1AU7A 3FX3A 2W84A 3CC4I 5IT9Z 3BLYA 3KEQA 2OAZA 2K9SA 1LEAA 1ZYRF 2BV6A 2CFXA 5M5XJ 1W36C 2I8DA 3HOYJ 3TDUC 3K69A 3E3VA 1AWCA 3CCLI 2Y75A 1MGTA 3F22A 2AHQA 3BR6A 2NRAC 9ANTA 3ASOH 4MNUA 3SXYA 5F08A 3GTOJ 3BZ6A 4A3CJ 1SVOA 1ITYA 2LSOA 2K9NA 3RJPA 3E5XA 3LAJA 1W0UA 3CO6C 2FQ4A 2M0MA 2WA0A 3O8HA 5ILVA 3OYNA 5BMZA 3I55I 5KAIC 3IRQA 3HOSA 1U8BA 2EZHA 3HOTA 2JPCA 2DJNA 3C2HA 2FBKA 4LK1F 2P6SA 4FX4A 4XLPF 3ERED 2D1HA 1Q1VA 1XD7A 2DMPA 3KEYA 3GFLA 1X4OA 3R60A 1P4AA 3D5RC 3K4LA 4M9XA 4CH7A 2LKPA 2FXAA 1UHMA 1ERDA 3CUQC 3BJOA 3KP3A 1UAAA 2P8TA 5IOZA 3C2BA 1WJFA 2KT0A 1SAXA 1JT6A 1VQPI 3RDIA 1IN8A 5ED4A 3REOA 3PNVA 2RDPA 3FXUA 1Y56A 1KZHA 2RNGA 1Z91A 2R7QA 3MEXA 3TMOA 1E3HA 2HZDA 2KKOA 3F6OA 3WHCA 2D45A 2XIGA 4NNJA 1DU6A 5FKOA 2C6YA 1IF1A 2DPUA 1IO2A 3V7RA 2L4MA 5EDNA 2A07F 4WK8F 2R5YB 5FRNA 2F4OB 2FEZA 2Q2EB 4M3DA 5CVUA 3TW6A 3KYDB 3OYKA 2G0EA 3OIPA 1FMVA 2LLKA 5TJJA 3FK6A 1JJ8C 4FHTA 1HKQA 2DCEA 3FXMA 4GXOA 4MFEA 2CV0A 3LWFA 2HPIA 3CZ6A 4LLLA 4I09A 3PO2J 4HZFA 4HX7A 1DP3A 1XGOA 2WV1A 2FF4A 4P55A 2Z1DA 1BN5A 4UVCA 5HLTA 1YOVB 1KU7A 1Z7UA 4MLOA 4E6KG 3QOEA 3MKLA 3SJMA 4Q5SF 2WY7Q 4DYRA 5FGMA 2WC2A 1MBGA 3UKGA 1L0OC 4ZZDA 4NC8A 4HNUA 3F8CA 2PBIA 1R5ID 1ZELA 3RTRA 3CCRI 3PQJA 3EUHA 4M3FA 3VDXA 3WU1B 3DPLC 2CMPA 1JUSA 2EWNA 4Y13A 1X1CA 3HZJA 4ANJA 5E3MA 2CQXA 2VL8A 1Z0XA 1NH3A 4W1UA 3OS0A 5FFZA 1TW2A 2VKDA 2W7NA 1VQMI 2ME0A 1PJRA 2PMZA 2VT3A 3RPUD 5HOOA 1HF0A 5FRMA 5IP9J 4M72A 4AIHA 3IWZA 3HIFA 2CJJA 2BZTA 1LPQA 3SFIA 1SAUA 3WTXC 5KK1A 2WB1N 1X2NA 2PEXA 1B72B 3SDGA 1P92A 4UB8C 3RYPA 1IGNA 3NARA 1SD7A 1LFBA 2CFOA 3O2PE 3HRTA 2DLLA 1U5TA 2ZFWA 4XK4A 2MABA 2DW4A 5DD4A 2DJIA 4UUSA 1XC5A 1I5ZA 5IP7J 3LL7A 2R7TA 3IH4A 1OCTC 1EA3A 1T95A 1OPCA 1ZR2A 1B9NA 3F8FA 2DA3A 4LGWA 3DPUA 1GLNA 4D5CA 2PN6A 4OIRF 4OMZA 5KHDA 2STWA 3GTJJ 1DP7P 2ZJPF 5HVQC 4I0AA 3K0LA 3OYGA 2Y31A 3CDIA 4IHXA 2L9SA 2CW8A 4KMFA 4XR6A 2DDBA 1QRYA 1U0JA 3DTEA 4IXAA 5HLHA 1WJBA 3BOQA 4A3BJ 1UZCA 5LBQA 1RKWA 1QBJA 3NRVA 2AXLA 4B47A 3OYBA 1HOMA 5IPAA 1OJLA 4MEYF 4CCOA 2DTRA 3TQNA 4YIIA 4ZTJA 4DIQA 3FM5A 1ZRCA 4E7JA 4Y7NJ 1TWAJ 1ETKA 1J0RA 5H2FC 4RB0A 2E5NA 3AFHA 5LRRA 3E5QA 2D2WA 2HYGD 5LLQA 2O9LA 2HKXA 3EETA 1ETYA 2ZC2A 5DS9A 5EF6A 2BXYA 2GXGA 4IHWA 2RN7A 3RIRA 4X6AJ 3V42A 1JJ6C 4L5IA 2QWWA 1T0FC 1S8NA 2ELHA 2FU4A 2RREA 2L02A 4OINF 3W2WA 4U0YA 3I4NJ 3QU6A 1IN6A 4DBQA 2Z3YA 1B8IA 3ELKA 3HG9A 4HDUA 4XLNF 1IXRC 4CUGA 5HDGA 1DPUA 1XSVA 1SMYF 2QBYA 1SFEA 3CJRB 3EQLF 1K4SA 1VQOI 1BI0A 2DFFA 2BVLA 3OOPA 3GO5A 3VODA 4N9HA 5GTHC 3K70D 2RVCA 1W36D 3RZOJ 1MMSA 2VOPA 3JRDA 4ASNA 1MJAA 3R0AA 3MAJA 4HNTA 4V2GA 3S2HJ 3PUBA 2HQNA 2WAFA 2UXXA 2EFQA 3F8NA 2XSDC 2HOAA 5FJ8J 4N4OB 4G6QA 3FZVA 2Y69H 4M73A 2KFDA 3UR3C 3R6SA 1QZEA 1N25A 1V55H 2IGMA 4TV7A 3BR5A 3QYBA 4L9TA 1SEUA 3AG3H 2NVQJ 5BOXA 5J6XA 4A3JJ 2CUEA 3GEZA 3ML6A 4I02A 1MMAA 2CYYA 5EZGA 3FM3A 3Q5FA 3DKXA 1V3FA 3VWBA 3LSMA 2H94A 2EZLA 2IA2A 3U9GA 5E8IA 3F23A 4QIWN 3MFKA 1MMDA 2WTEA 1IV6A 1JTXA 4KN4X 1UG2A 3DBRB 1SD4A 4WXCA 5DCMB 1HSTA 1K83J 2R93J 5BPDA 2BY2A 4E7LA 1VQNI 3MKZA 2HU9A 4CXFA 1G6NA 4N0BA 3ZQQA 2VQLA 1ZN2A 2Z9OA 1RI7A 1IG7A 3B73A 2L54A 2LY9A 2L9VA 2DO7A 4HYEA 2DYRH 4XRFA 2YX4A 4BGDA 3A01B 3L2CA 2PQ8A 3LSHA 1BC7C 3TP0A 1RUOA 1E3PA 4MTEA 3H0GJ 3H9JA 1S6LA 5F0FA 4UUTA 4KUMA 1B4AA 2MYSA 3LFKA 2LH9A 3OWTA 4IF4A 2DODA 1O4XA 4UNOA 3A4CA 1I39A 1BIBA 3S17J 5JR3A 1E17A 5DEQA 1TZLA 1ACIA 4Y52J 2CH0A 1YITI 2QQ9A 3H35A 4LFUA 1IXSB 2J5PA 4B8XA 3IAM2 2PLYA 1BL0A 2ESNA 1P4WA 1KU3A 4PJ0C 4PGGA 3JTHA 3S1NJ 1TQIA 1TNTA 2DK5A 4NQWB 3JRCA 5D5XB 1EV7A 2CS3A 4HG2A 4A3EJ 1FBQA 4P9FA 1HLVA 3GMEA 4M9ZA 1DGRM 2IRFG 2MC3A 2LKXA 2CV1A 1JI8A 3TGNA 5B5EC 5CVVA 1UHWA 1WGXA 2KDOA 2XAFA 4CCMA 2ISYA 1IRGA 1GXPA 4CGZA 4OAZA 3FKJA 3IKVA 3L7WA 4S0HB 1BW5A 4E7ZA 4A6EA 2LVSA 1VZ0A 4BJTA 4J01A 3EDPA 3ECOA 4MFDA 4G7OF 5LEJA 2EILH 2KISA 3IC7A 3W2VA 3L2RA 3HRMA 3CLQA 5GAEJ 1BI3A 2L4AA 2FRHA 2CRGA 2EQRA 3F8BA 1WH5A 3ABLH 5J40A 3HOXJ 2LR8A 3BG5A 3CJTB 4XOPA 5TISC 1U8RA 1MKMA 3ZRGA 4II3A 3PNTA 2ZXJA 4QSHA 2XV4S 4I7HA 5EYRA 5F1RA 2WWYA 1KU2A 3AG4H 3I59A 5AIQA 4E7SA 2HI3A 4PJMA 5FKNA 3E7LA 2XC7A 4IO9F 4EQQA 2Y9YA 3C2GA 5E3LA 3LSGA 1HCRA 4KISA 4HLYA 2L7KA 3BZCA 3KP6A 4A3MJ 1TQPA 2KMUA 2HQ5A 1UFMA 4HQMA 3K4CA 3W3CA 3RZDJ 3A2KA 1FEXA 2M8GX 4LG0B 2IGOA 2VE9A 4D1QA 3BTIA 5F0CA 2EH3A 4UV8A 2GXAA 4FE7A 4M6YA 2V4JC 1WI3A 3S3MA 1SFUA 3S93A 5J8FA 5JLXA 3BROA 2R5YA 3TDZC 3S1RJ 3ESWB 3MZ8A 1R9TJ 4KYWA 3QPSA 1NG6A 5B1AH 2VBXA 1X1AA 2QYOA 3I64A 4MQVA 1FP2A 2M7AA 3PIOF 5JHUA 4XLAA 1MNMC 1BC8C 2GOMA 1WH7A 3DPTA 3LOCA 1R7JA 2EFOA 4KA4A 3ZOBA 2KRFA 3JAMK 3J7ZI 5F27A 5LHHA 5FLXK 2O3FA 3IAS2 2RGVA 3W6VA 3WTSC 5DCFA 4BJ6C 1TWFJ 3CMAI 5L3BA 4M71A 4L9NA 2QQBA 1IN5A 1OR7C 2H09A 2VKVA 3K4JA 1XGMA 2ELKA 3HUGB 3LSKA 5EJCA 1A04A 3J81Z 1OYYA 2L9RA 4KIBA 1GXQA 2LF7A 2B0LA 2VC0A 3CCSI 2CUJA 4B4CA 1X3ZB 1SFOJ 4PDKA 1MW7A 1G3TA 4XKCA 4BEHB 5FLXZ 2X51A 2DMNA 2DDAA 2LNBA 3QU3A 3WTZA 1A6QA 3FBNB 4UV9A 1D0YA 3FISA 4FX0A 1VQ6I 4XICA 4YIFA 3ABTA 2Y2ZA 2DOAA 4BY1J 3CP2A 1Y6IA 2X6XA 4IPAA 3O3KA 1R5HA 4II2A 2IA0A 2A61A 1TL8A 1LQ1A 1YQAA 3MKYB 2VI6A 1R22A 4ZC3A 2F2EA 1GV2A 3IUOA 2K02A 2QGUA 5ILSA 4KT5C 2M4GA 3WTYC 1T8IA 2P5LC 1AOYA 4OIOF 1R49A 4KICA 2K4JA 2VE8A 1I50J 2DQRA 2IA1A 2ZXIA 3X2QH 5E3OA 1J7KA 1D0XA 1XPXA 2P4WA 1QA6A 3JRFA 5JHFA 3L2QA 1U6GA 3WE2A 2UV1A 5H6QA 5C4XJ 3I9V2 4PFPA 2O8XA 3P5JA 5H20A 1E2XA 3HPHA 2BEOA 2Y0SA 5D8KB 2KIUA 2XRLA 3P9CA 3EUAA 2JUCA 2W25A 3FIWA 2EK5A 4LD5A 1DDNA 1FLIA 4L9JA 3H3VK 5DV5A 3DP7A 2CGPA 2EA2A 1FOXA 3BPXA 4RAYA 5HDKA 2PJPA 4AIDA 5EEHA 2XAHA 5FLMJ 3BP8A 3EYIA 3BR0A 1TTYA 3I54A 2VBWA 2MFZA 1FYKA 4BUPA 4UVAA 5L3FA 3S2WA 5JVTA 3I4PA 1HW2A 4O6JA 3WU2C 4EM2A 1CF7B 2VUMJ 2YS9A 3I5UA 1KYWA 3M7GA 3BTCA 2M45A 4KIGA 3HTUA 5M5YJ 4PJJA 5EG0A 5FKKA 4EATA 1HDDC 4BXXJ 2GOXB 4LIUA 3BG7A 3BPVA 2M9HA 3MKWB 5H6RA 1UG0A 1USSA 1XMKA 1FSHA 2P7VB 4KIFA 2OJED 2KRCA 2V9VA 2P0WA 1TT0A 1BOAA 5EGOB 3K6GA 1SFXA 3TOAA 2X48A 1S3JA 3ZQIA 5EEAA 3EYYA 4EMSA 1AKHA 1OYWA 2XPVA 2ISZA 3TOBA 5K5OA 2IS4A 3JRAA 2ZMEA 4EV0A 2P5KA 4XLEA 3CUOA 1FSEA 5E1WA 1RESA 1U78A 2IVMA 2R7XA 1XSDA 4KNYA 3K9TA 3VFZA 5DUKA 1KQ9A 3S3OA 2KZGA 3VSLA 1E0EA 4PFOA 3H9QA 4HX8A 2JVGA 1KQ0A 1PVEA 1XCVA 3TL4X 3ZQCA 4IQJA 2DA4A 5AIPA 2EZKA 2DAOA 2DYSH 2KIMA 1XG1A 3K70C 5D4SA 4NUBA 1IXCA 2WADA 1IN4A 3HGYA 2LMDA 1ZREA 2I10A 3S15J 2E1NA 2WBMA 2K27A 1Z6TA 3WG7H 4LB6B 2KL4A 4BH9A 1ZG5A 2X6YA 1UHSA 3NWSA 2PJRA 3S2DJ 1D3YA 2BY1A 2BYVE 2MBFA 3ONQA 1H88C 2FOKA 2Y0MA 2K3PA 5F04A 1TC3C 3GFMA 2E60A 3ASNH 3P7NA 2NS0A 2LKSA 1YX5A 1Z9CA 1SFKA 1R36A 1GV5A 2EB7A 4EJOA 3M07A 2LREA 3C1DA 2V1DA 5ICCA 5KNLA 2JK3A 2OQRA 2KQRA 4JX4A 3BG9A 3DU5A 2R5ZA 2BW3B 3GTMJ 4BKXA 1KQ8A 3MMYB 3B02A 2KLOA 1OLTA 1G4DA 2PFBA 3I0TA 4Q48A 2IT0A 3E97A 3ABUA 1WPKA 5J1YA 3CC2I 2QSFX 3GBGA 5D5UB 3LA3A 2QF7A 3C3WA 3KP2A 4CCJA 3SZGA 3F0CA 3PNYA 4HAMA 2FSWA 5TRDA 1FP1D 2QSGX 4HSTA 1X3WB 4I0BA 3AAFA 3K4MA 4NB5A 3ABMH 1LE8B 1SD6A 1R5GA 1E3OC 2DU9A 5CVIA 1W7PD 1VNDA 4KMUX 4LLNA 4A0ZA 1RNLA 3FXOA 3HEFA 2TRTA 4F55A 5J47A 2HNHA 1IJWC 2HGCA 2DBBA 3OR2C 2XUBA 4HRIA 3A1YA 4XKBA 4LG3A 4XOTA 1OFCX 4F93B 2VJJA 4XM3A 4D7NA 1XN7A 4RMNA 3DKWA 3JW4A 3CESA 3LSTA 4B43A 5IYBJ 1RZ4A 1B9MA 3GTPJ 3CUQA 3Q0VA 1W1WE 4IOAF 2L3DA 2GM4A 2I5UA 3Q0UA 3VYRB 5C4JJ 4ESJA 1G59A 4DYCA 2OCCH 4XQFA 4L5EA 2XAJA 4PK4A 3ROUA 2E7WA 2VQHA 2F5VA 3ZQFA 2M5WA 1ETXA 3IL2A 1CGPA 2FBHA 2Z33A 1R1UA 2UXNA 2LBFB 3DEUA 2L0KA 4HNVA 4BXUA 1RRJA 2CUZA 4E7KA 1TQMA 3DTKA 4LLGF 1YFHA 2L7MP 2VJ5A 3QOPA 3IH2A 2A6HF 3QQAA 2VKHA 4YELA 3I53A 1YHQI 5K1YA 1BR1A 4YG2F 1GHCA 1W7PB 1S29A 5LEKA 4CYDA 3R4KA 2XAGA 3H36A 3JREA 3S1MJ 4ZDPA 4RB1A 2A5WA 2E19A 3RCOA 4C30A 1DU0A 4JX5A 2VKEA
chains in the Genus database with same CATH topology
3E1SA 3PSIA 1MMAA 3DKYA 5TGTA 3FBIB 2VPLA 4OAYA 2IS6A 3DKXA 3VWBA 1FMWA 1UELB 3LSMA 2V1NA 1YE9A 4Y4RA 1DGWY 1MMDA 3OYMA 2IGNA 3PFYA 4F52A 2KRHA 2JA2A 4D9JA 1LKXA 4KJZA 1Z3YA 4ITVA 3S8PA 1QHGA 3EUKL 4E7LA 3MKZA 2HU9A 3OMYA 3CF2A 4N4NB 4NC7A 1LVKA 2M3AA 3ZQQA 2VQLA 2ZFUA 3F9KA 2ZXHA 5CQEA 4BL0B 2HQAA 2Z16A 1J09A 3NWTA 2HDWA 4BGDA 1R6RA 1S9HA 2JSPA 3LSHA 1MNEA 4XLHA 4B44A 1D1AA 2VQCA 3H9JA 3S32A 4BU2A 4JOMA 4OWRB 2MYSA 2LH9A 3OWTA 4RLFA 3SEQA 4X0GA 2L9NA 2V9KA 3HKZA 3A4CA 1G8XA 3HL2A 2M7BA 2VQGA 1TZLA 2CH0A 2KP6A 3H35A 2WAEA 3IAM2 4CCLA 1D1CA 3HPGA 3SEZA 1KONA 4AU7A 3L2WA 3HXLA 3J7AY 4NQWB 2UWMA 4XONA 2Q1ZB 1LDKB 1N75A 2CS3A 4HG2A 4GRIA 4QPOA 4U7BA 2L2OA 1DGRM 5KCMA 5CQGA 4KITB 2CV1A 1JI8A 1X19A 4XN3A 4CCKA 1X1DA 2KDOA 3H5RA 2XF5A 3MD2A 4CCMA 2XAUA 2XDVA 4OAZA 4ZDOA 3FKJA 3AL0B 4E7ZA 1VZ0A 4BJTA 4J01A 4RM2A 4DBRA 1Z21A 3OS2A 2XF6A 3W2VA 3L2RA 3H9GA 3ZGKA 3H5AA 2V26A 2NOJB 3K10A 3AKZA 4XOPA 4BDYA 3OL4A 2IS2A 3KX2A 1D0ZA 3ZRGA 4II3A 3TBIA 1P9QC 3PNTA 3FDYA 2DT7B 1BOBA 4G6TB 4P1WA 3DEEA 3DLAA 3PJRA 4E7SA 4PJMA 2XC7A 2W4SA 2E1MC 4B3XA 3RSNA 3C2GA 3BCAA 4E4HA 3OYAA 2HVRA 1NG7A 3EUHC 3LSGA 4HPQA 4BACA 4KISA 2IXSA 2KHMA 4PSWA 2L7KA 5LD2C 2KMUA 3OYLA 4ZJZA 2VXDA 4F91B 3OL3A 1WJCA 2R7WA 3K4CA 3W3CA 3A2KA 2IGOA 3OYCA 1K6YA 4D1QA 2HVQA 4RLQA 4B48A 4BQOA 2V4JC 4QPQA 3S3MA 5HNHA 2LYCA 3S93A 4J00A 4Y33A 1NG6A 3G2BA 1X1AA 1WFXA 2OUMA 2M7AA 1LFPA 3VSKA 4XLAA 2GOMA 3DPTA 3D5SC 3H0DA 1MMNA 3IAS2 4BJ6C 4DOZA 2DT6A 4XN0A 4E7IA 3CMMA 1OR7C 2R7RA 2WAQA 2AQFA 3K4JA 3LSKA 3HUGB 3U21A 3ZXSA 3HC7A 2CUJA 3CP8A 1V5GA 2F6CA 1BR4A 1MW7A 5HNFA 4IQ4A 3BC8A 4XKCA 4BEHB 2JVHA 2X51A 4XORA 3QYFA 4CCNA 3FBNB 1D0YA 3BLYA 2K9LA 3OY9A 1W36C 3LFUA 2I8DA 2DOAA 3CP2A 2IS1A 1Y6IA 4PJLA 2X6XA 2HPMA 4PJNA 2VJIA 4ZYAA 4II2A 3OYHA 4BE1A 3I3LA 4PUSA 3CJQB 1X4PA 1WJ5A 3MKYB 2X1EA 4ZC3A 2MD0A 4XNFA 2LC2A 4BEHA 4LIVA 3IUOA 4BE0A 2M0MA 1PYVA 2WA0A 2WB1A 3L2VA 3OYNA 3RQ4A 3D5LA 2A6TA 2M4GA 3HOSA 2CV2A 3HOTA 3C2HA 4JQFA 2QKMB 3EPZA 4PSXA 3KEYA 2ZXIA 4XMYA 1YX3A 2BOLA 4IX7A 2R7SA 2VLAA 1N77A 4BJ5C 1X4OA 3OYDA 2R7UA 3D5RC 1D0XA 3K4LA 4CH7A 5JHFA 2BVMA 2ZSHB 3L2QA 2VIXA 2UV1A 1ERDA 2K9MA 3S3NA 1UAAA 3I9V2 4PFPA 1WJFA 3HPHA 2Y0SA 3PNVA 2KZVA 1Y56A 3EUAA 2RNGA 2R7QA 4KT6A 3TMOA 2HZDA 4HSRA 1WJDA 5CPRB 2ELJA 4NNJA 4CA0A 2X6WA 4BE2A 2OC6A 5FRNA 2OV7A 3K4BA 2Q2EB 4ZDLA 4C2TA 3OYKA 3OIPA 1FMVA 3M8JA 4H4KC 1QU3A 4FASD 2E1MB 3QYEA 2DCEA 2CV0A 2KPMA 2MFZA 3VYSB 4BUPA 4XL9A 2HPIA 3CZ6A 4YEJA 5CKTA 1WJEA 2LRDA 2DXIA 2AQEA 1DP3A 4ZTFA 3OYJA 2Z1DA 2VASA 5HLTA 4PJJA 4E7HA 4YRVA 4MLOA 4E6KG 2V7FA 3QOEA 4EATA 4XLFA 2GOXB 4LIUA 2WY7Q 2X85A 3BG7A 1MMGA 3K4NA 3SDBA 4P5OA 3MKWB 3IP4B 1UG0A 4NC8A 2R7VA 4HNUA 2KRCA 3VYUB 1ZELA 2P0WA 3RTRA 2HVSA 1TT0A 3K6GA 3VDXA 4DGWB 3DTIA 3UNGC 3DPLC 2CMPA 2VB6A 1X1CA 4ANJA 2VL8A 3QODA 4IKFA 2W1OA 4XLCA 2IS4A 2VJ4A 2X1DA 3OS0A 2VKDA 4XLEA 2W7NA 2PMZA 1PJRA 5HOOA 3RPUD 5FRMA 4Y3OA 2R7XA 2PJRB 3S3OA 3VSLA 1E0EA 4PFOA 3H9QA 2JVGA 1SAUA 4CZCA 4IZZA 3OYEA 3KYLA 3TL4X 3OR1C 2JUGA 3PL8A 4IQJA 4CSWA 3K70C 4NUBA 2QKLB 2WADA 1Z3XA 2CFOA 2K5CA 4LITA 1N78A 3PSFA 3ZR8X 1V5FA 4BDZA 2WBMA 1D1BA 2MABA 3BCBA 2KL4A 2L5QA 2X6YA 3NWSA 2O5RA 2DJIA 2PJRA 4AYBA 4U87A 3LL7A 2R7TA 3ONQA 4BQQA 1EA3A 3E0JB 2K3PA 3OS1A 3OYFA 1T95A 3N05A 2XF7A 2E60A 3H5NA 1YX5A 4C2UA 1SFKA 2CW7A 2LREA 1GLNA 3DPUA 5KNLA 3DQVC 2XSJC 2LY1A 5KHDA 2KQRA 4BQNA 3FHNA 5HVQC 3DU5A 3OYGA 2BW3B 2L9SA 2CW8A 4XR6A 1U0JA 2LG4A 3DTEA 3MMYB 3W2AA 2KLOA 1OLTA 1WJBA 3K4KA 3LSIA 4DJAA 3GBGA 4RM3A 4CCJA 3SZGA 3PNYA 5FROA 4B47A 3OYBA 3ZCOA 2F4IA 1Z7LA 4HSTA 2V6EA 4FETA 3DWLE 3K4MA 4CCOA 4HEA2 4ZTJA 4DIQA 4E7JA 5LFAA 3LMMA 2BW3A 3AL0C 4BS9A 4XKWA 2E5NA 3AFHA 4F55A 2HNHA 4AVZA 1BR2A 4F92B 1AA7A 3OR2C 2W00A 2FUG2 1QHHD 4HRIA 3A1YA 4XKBA 4LG3A 4XOTA 2MC4A 3V42A 4F93B 2VJJA 4XM3A 1T0FC 2RREA 4F3QA 2IGKA 4R79A 4RMNA 3W2WA 4C9YA 3CESA 3OIQA 4B43A 1DQUA 3OOUA 4DBQA 1X1BA 2R4GA 2ZSIB 1G59A 3VYRB 2UUZA 3HG9A 4XQFA 4CUGA 4PK4A 2VQHA 2F5VA 3BG6A 4XKVA 2LBFB 2LY2A 2M4KA 3CJRB 2BVLA 2CUZA 2Z2SB 3SYTA 3VYTB 3K70D 1W36D 2W82A 3L2UA 4E7KA 2X1CA 1WJAA 4HNTA 1MNDA 3DTKA 3PUBA 2WAFA 1IRXA 2VJ5A 3M1CA 1V5EA 2LOOA 2VKHA 3DU6A 4YELA 4N4OB 1BR1A 4BXFA 2RQQA 2R7OA 2VXZA 3UR3C 2IGMA 2LBFA 3QYBA 4ZDPA 2E5ZA 1HA8A 2A5WA 3RCOA 4C30A 3OYIA 2WY8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZZ A;  4J00 A;  4J01 A;  3QOD A;  4YRV A;  3QOE A;  4HRI A; 
#chains in the Genus database with same CATH topology
 2V1X A;  4XRS G;  3PSI A;  3QP5 A;  1A35 A;  3DKY A;  1ZRF A;  3G1O A;  2E2H J;  1T56 A;  4HV5 A;  2JMW A;  3SZT A;  4D0P A;  4RGS A;  2VPL A;  2TCT A;  4ENM A;  2OU2 A;  2IS6 A;  1FMW A;  2IAI A;  1PP8 F;  2JJ7 A;  2GAU A;  3RKY A;  1YS6 A;  3KET A;  1REP C;  1DGW Y;  3OYM A;  3HB9 A;  3QWL A;  5L3C A;  1HKS A;  2KRH A;  3BQY A;  4BNC A;  2HTS A;  2JA2 A;  3CCM I;  4D9J A;  2BHZ A;  3A02 A;  4ITV A;  3GZ6 A;  4RAF A;  2G7U A;  2VON A;  3J80 K;  2ZFU A;  4LOC A;  1Q1H A;  4YFN F;  2ZXH A;  4BL0 B;  3FHZ A;  4R8H A;  2ZXW H;  5GP9 A;  4A6D A;  2HQA A;  1U9N A;  2Z16 A;  2HTJ A;  1R23 A;  2HDW A;  5E18 F;  5K7Z A;  1XGS A;  1VF9 A;  1RIO H;  3FK7 A;  4B44 A;  1GT0 C;  1K4T A;  2VOO A;  4XRS A;  4OWR B;  2JTV A;  4RLF A;  4EGZ A;  4Q4Z F;  4S05 A;  3FXL A;  2M7B A;  3HL2 A;  3S14 J;  2VQG A;  3K7A J;  3A0B C;  1P4X A;  2DQL A;  3T1B A;  5ICE A;  1F1Z A;  4CCL A;  3BJ6 A;  1YIO A;  4M3E A;  4CDG A;  1R58 A;  2VPR A;  2UWM A;  4XON A;  4OMY A;  3C7J A;  1ZK8 A;  1K61 A;  3JCU C;  4QPO A;  4U7B A;  1UST A;  5KCM A;  4O3M A;  2DT5 A;  2H6B A;  4KN7 X;  5CQG A;  1FOY A;  3CQZ J;  4IEJ A;  5GAH J;  4KIT B;  1JUP A;  2A6E F;  2EV0 A;  3R0J A;  1W5C C;  4UY8 I;  5C3E J;  2BY0 A;  2E35 A;  5KAF C;  1IRZ A;  1X19 A;  3V7S A;  4CCK A;  3IH3 A;  4MO7 A;  3H5R A;  5LGT A;  2XAU A;  3I4M J;  5FB2 A;  1FNN A;  4IJA A;  3CCE I;  4ABZ A;  2FA5 A;  1MDM B;  4A2U A;  2VN2 A;  5B66 C;  5FD5 A;  4HBL A;  4ZYH A;  5HOD A;  1VI0 A;  5ICG A;  3PQK A;  4XRM A;  4XSX F;  1TNS A;  5C44 J;  2O7O A;  4ENN A;  5HLI A;  2JZY A;  2NOJ B;  3K10 A;  3LA2 A;  4HOB A;  3KX2 A;  1FBS A;  4HLX A;  2HOS A;  3TBI A;  1P9Q C;  1WQ2 A;  3FDY A;  2DT7 B;  1YO5 C;  1BOB A;  4G6T B;  3KE2 A;  4RGU A;  1EH8 A;  1YJ9 I;  1IW7 F;  4M6V A;  4FT8 A;  1TWH J;  1WHU A;  5J3L A;  2EZI A;  5CLS A;  3RSN A;  2HVR A;  3BCA A;  4E4H A;  3OYA A;  3CME I;  2ZCW A;  3BJA A;  2CQN A;  3MZY A;  4A5N A;  1TP4 A;  5GAD J;  5LD2 C;  1OCP A;  1ZAR A;  2W57 A;  4BYY A;  2KDZ A;  2VXD A;  3OL3 A;  1WJC A;  4OU0 A;  3GXO A;  5A2Q K;  4A3K J;  3DCF A;  1JKP C;  1T0F A;  1K6Y A;  3HHH A;  2ZJR F;  1GUU A;  2HVQ A;  2JA7 J;  3GFI A;  5D5W B;  4Z6Y A;  3BG3 A;  2QZ8 A;  2STT A;  4QPQ A;  4FCY A;  2LYC A;  1ZG1 A;  4I98 B;  4UXN A;  5HDN A;  4AIJ A;  1K7A A;  5JI6 A;  1K78 A;  3NEU A;  2YUS A;  1LVA A;  1WFX A;  4QTR A;  4V2F A;  1RUN A;  3JR9 A;  4CYC A;  3D5S C;  1WRJ A;  4HF0 A;  1D5V A;  4YFK F;  4EJW A;  5FKL A;  4A3G J;  1YI2 I;  2YU9 J;  2FBI A;  2UZK A;  1MMN A;  2YSR A;  4K2E A;  2R7F A;  5LHG A;  2B9S A;  5F0H A;  4WCG A;  1FT9 A;  3CMM A;  2R7R A;  4JP0 A;  4G8X A;  2AQF A;  2GIZ A;  1HBX G;  3MVP A;  2FMY A;  3CF5 F;  5D6F A;  1PUF A;  1AHD P;  2Z5U A;  1T39 A;  2M2E A;  3CP8 A;  1V5G A;  5HNF A;  4ON0 A;  3WGH A;  4IQ4 A;  1WSU A;  3T0Y A;  1JE8 A;  2IBD A;  2FQ3 A;  4I76 A;  4XOR A;  3IWF A;  5BPI A;  5DTD A;  1A36 A;  2GLO A;  3L9F A;  3LFU A;  1UB9 A;  4X1E A;  5K5R A;  2DFE A;  2OCE A;  2XKO A;  1F43 A;  1P7J A;  4L5J A;  4PJL A;  4PJN A;  2QQ8 A;  4ZYA A;  1X1P A;  1YLF A;  3TKY A;  4C2M J;  3GCM A;  3OYH A;  3VOE A;  3I3L A;  3CDL A;  2XRO A;  4BE1 A;  3CJQ B;  1DUX C;  1X4P A;  1YRN A;  1X3U A;  2MD0 A;  1SC7 A;  4V19 K;  1PYV A;  2WB1 A;  3L2V A;  5D5V B;  3D5L A;  1LDD A;  2QA4 I;  1Y39 A;  1S7E A;  1SVL A;  2FD5 A;  4PZJ A;  3PO3 J;  1Y8R B;  3V8J A;  2DMU A;  3ULQ B;  2BXZ A;  2M87 A;  2H1K A;  3EPZ A;  4EEF G;  2E1C A;  3VB2 A;  2R7S A;  1YX3 A;  2BOL A;  5DM6 F;  1N77 A;  4UB6 C;  4BJ5 C;  5IP6 A;  4KFC A;  3WTT C;  2IEK A;  3OYD A;  4L0Z B;  2DA6 A;  1F36 A;  3B6C A;  2F5F A;  2A68 F;  2O61 A;  1O57 A;  2IW5 A;  5CVJ A;  1JGS A;  2BVM A;  2ZSH B;  1FOW A;  3J7Y J;  2VIX A;  4D5F A;  1H0M A;  1O7L A;  2M0C A;  3S3N A;  4A3L J;  2OA4 A;  1A5J A;  4R1H A;  2A3S A;  3G6E I;  3JRI A;  2L01 A;  3WOD F;  2XAS A;  1MH4 A;  2MLG A;  4KT6 A;  4FTH A;  2K9Q A;  3A03 A;  2HEO A;  5CPR B;  3JRG A;  2IJL A;  3FXQ A;  3BQZ A;  2X6W A;  3LA7 A;  4HA8 A;  4BE2 A;  2OC6 A;  2ME6 A;  4WX9 A;  2OV7 A;  3K4B A;  5CVR A;  4ZDL A;  4C2T A;  1H89 C;  3LQR A;  3M8J A;  4GFB A;  1EJ9 A;  4H4K C;  4WXH A;  5IYD J;  4FAS D;  3QYE A;  2OZ6 A;  1IAW A;  1APL C;  2DOF A;  2KPM A;  4XL9 A;  5CKT A;  1WJE A;  2OZU A;  3U2R A;  3IKT A;  1Y0N A;  2AQE A;  4RAZ A;  3DV8 A;  3OYJ A;  3FXR A;  3K1N A;  2VAS A;  3CCQ I;  1VTN C;  4E7H A;  4RS8 A;  4YRV A;  2HOT A;  1JKO C;  1W4M A;  2XB0 X;  1ZAO A;  4XLF A;  3SZP A;  4RDU A;  1G3Y A;  2Q2E A;  2X85 A;  3K1P A;  3K4N A;  3BR3 A;  1D8K A;  2JRM A;  2ZJQ F;  4RBO A;  3E5U A;  4HQE A;  2W48 A;  1IZ1 A;  2H27 A;  3DTI A;  3W6K B;  4KDP A;  3UNG C;  3CJN A;  1FIP A;  4G9Y A;  4Q47 A;  2XRN A;  1LJ9 A;  5K5Q A;  4J19 A;  1I6H J;  2IPQ X;  4AVP A;  3L1P A;  4IKF A;  4XLC A;  1WWX A;  4RAG A;  2VJ4 A;  2EFW A;  2X1D A;  1BBY A;  3H3U A;  5IT3 A;  5L3E A;  4ZYD A;  1T08 B;  4ENJ A;  4G94 A;  1YW8 A;  3HKZ N;  1K6O A;  4IOC F;  1U5T B;  4GYG A;  3MCZ A;  4EJT A;  2R7D A;  4UUS B;  3GW2 A;  3ZQG A;  2CQK A;  3L00 A;  2DA7 A;  3JAM Z;  3MWM A;  1S5L C;  3OYE A;  3KYL A;  1CQT A;  3OR1 C;  1JGG A;  3AG2 H;  3QAH A;  3BT9 A;  2KIQ A;  4U88 A;  1ZHF A;  4BHC A;  2H8W A;  3WU0 A;  1N78 A;  3FWE A;  3PSF A;  4C3J J;  2HKO A;  3ZR8 X;  3B6A A;  3BZK A;  1FY7 A;  1HQC A;  1D1B A;  1WI9 A;  2L7F P;  2L5Q A;  3BCB A;  3TED A;  2J5O A;  2AS5 F;  2JT1 A;  2O5R A;  2E71 A;  1OR7 A;  1R00 A;  4U87 A;  3U1D A;  4BBR J;  1MJB A;  5GPC A;  1JHF A;  4A3F J;  1OKR A;  1FYM A;  1TWG J;  3E0J B;  3OS1 A;  3OYF A;  3HOU J;  2E34 A;  2XF7 A;  3BR1 A;  3H5N A;  2EV5 A;  4C2U A;  1B72 A;  2CSO A;  2CW7 A;  3VPR A;  4BHP A;  2XSJ C;  3FF5 A;  2LY1 A;  1S7O A;  1STZ A;  4BQN A;  2MG4 A;  2OD5 A;  3FHN A;  3GZ5 A;  3F3X A;  3CMY A;  1W5S A;  5D4R A;  4RA2 A;  3O6B B;  5CYV A;  1O7F A;  1XS9 A;  1FTZ A;  1Z05 A;  5EZH A;  1QGP A;  2CUF A;  4B09 A;  2H8R A;  2VOD A;  3H3Z A;  3G71 I;  1XMX A;  2JSC A;  4IHS A;  2K4B A;  2LP0 A;  4DJA A;  2ETH A;  1OYI A;  4BY7 J;  2ACJ A;  1RPW A;  1MBF A;  3MN2 A;  2W85 A;  2F4I A;  1Z7L A;  4DYQ A;  2E7X A;  2V6E A;  1QVU A;  4FET A;  1MBH A;  3GF2 A;  4ENK A;  3DEW A;  4B1R A;  5BQT A;  2D5V A;  4HEA 2;  3RPU A;  2FE3 A;  4IHT A;  3V8K A;  1B8I B;  5LFA A;  3LMM A;  2MD5 A;  3QP6 A;  2DN0 A;  4XKW A;  2RQP A;  1R1T A;  2JN6 A;  4M3B A;  3N97 A;  2DMT A;  4AVZ A;  2L7Z A;  2QBY B;  4M6X A;  3Q9V A;  1BR2 A;  4F92 B;  1MBJ A;  2O8K A;  2GWR A;  4MIM A;  2FUG 2;  5E1Z B;  1FIA A;  3M1E A;  2MC4 A;  1GVD A;  4F3Q A;  3GTL J;  1RET A;  4ZYG A;  2MSY A;  3OIQ A;  2G9W A;  3OOU A;  2QEN A;  2VBZ A;  3BTL A;  6PAX A;  4UVB A;  2UUZ A;  2QSH X;  1UJ8 A;  2V9P A;  2Y48 A;  3WGI A;  1ON1 A;  1YW9 A;  1MH3 A;  3MQ0 A;  1MSE C;  2QM3 A;  4XKV A;  3ZQL A;  2ZKZ A;  2WAQ N;  2PMZ N;  1NTC A;  3TO9 A;  2Z2S B;  2HYF A;  2W82 A;  2ICW G;  3L2U A;  3M3Y J;  1EKE A;  3D1N I;  2M1B A;  1JHH A;  1ZLJ A;  2B7E A;  2YU3 A;  2HXO A;  1MND A;  1XX5 A;  3HGG A;  2XB5 A;  5F64 A;  2R3S A;  1LNW A;  2O0Y A;  4BXF A;  2HZT A;  3E6C C;  3WE3 A;  5B3S H;  2VXZ A;  2ECB A;  3ABK H;  5KVR A;  1HA8 A;  4WF2 A;  2RKH A;  4YFX F;  3OYI A;  4P9U A;  3E1S A;  2JA8 J;  2EIK H;  3GFJ A;  2ZO4 A;  4ZH4 F;  3FBI B;  5J1U A;  1FBU A;  4HW0 A;  4AD9 A;  4OAY A;  2X9D A;  2IP2 A;  1MD0 A;  1SD5 A;  2V1N A;  4Y4R A;  3GWZ A;  3HOZ J;  1XDS A;  2EIJ H;  2Q0O A;  3TW7 A;  2NNN A;  1LKX A;  4FIS A;  4KJZ A;  1OCR H;  3HM5 A;  1Z3Y A;  5DM7 F;  2XGD A;  3S8P A;  4CIC A;  5IT9 K;  1QHG A;  3DXJ F;  3EUK L;  3HRU A;  1FPQ A;  3HSF A;  2E36 A;  3OMY A;  4N4N B;  4NC7 A;  2M3A A;  1MIJ A;  1D5Y A;  4OIQ F;  5CQE A;  3RKX A;  1P2F A;  5M3M J;  5FO5 A;  1OIS A;  3NWT A;  5DDG A;  1JUM A;  1R6R A;  1S9H A;  2GQQ A;  1S7A A;  1MNE A;  4XLH A;  4IRH A;  2VQC A;  3S32 A;  2WV0 A;  5DCM A;  2QCO A;  4RGX A;  4EVI A;  4AM3 A;  4U7D A;  3SEQ A;  2L9N A;  1QZY A;  3HKZ A;  1G8X A;  3S1Q J;  4NC6 A;  4HX4 A;  2DI3 A;  5J1R A;  2KP6 A;  3LSP A;  1ZGW A;  1WVR A;  2QEX I;  2EFN A;  3HPG A;  1J2X A;  1KA8 A;  1KON A;  2N8G A;  3CD6 I;  1ZGJ A;  3L2W A;  3GTQ J;  1QZZ A;  3HXL A;  5F1J A;  2LD5 A;  3A01 A;  3J7A Y;  2P81 A;  5EEG A;  2ZNY A;  4FE4 A;  5BNG A;  4CHU A;  1LDK B;  1N75 A;  3GUD A;  3ZN1 A;  4GRI A;  1TBX A;  4ESB A;  1S72 I;  2F5D A;  2NVT J;  1G3S A;  3E6D A;  2ESH A;  3LAP A;  1VFC A;  3WTV C;  2E1O A;  3ZMZ A;  4XN3 A;  3NAU A;  1X1D A;  2P5V A;  2XF5 A;  3MD2 A;  1O3R A;  2PMU A;  2EJR A;  4I6Z A;  4JBA A;  3HSE A;  4BAY A;  3I59 B;  1WCM J;  3PUF A;  3R61 A;  4ZDO A;  5D8L B;  1ORK A;  4NQW A;  3AL0 B;  2O6G E;  2A05 A;  1ETO A;  1EH7 A;  4Y15 A;  2HQR A;  1ZQ3 P;  4U0V A;  3WG9 A;  4M3G A;  1J5Y A;  2OTL I;  1X2M A;  3H9G A;  4ETS A;  2QVO A;  4OIP F;  2EIN H;  2XHK A;  3AKZ A;  4BDY A;  2PG4 A;  3OL4 A;  3F6V A;  3F8M A;  2A69 F;  1LEB A;  2CQQ A;  3H1C A;  3PFI A;  3DEE A;  1HDP A;  4NDL A;  1TWC J;  3DLA A;  3PJR A;  2GXB A;  4ZYE A;  3Q9S A;  1YS7 A;  2HR3 A;  3C18 A;  3HRS A;  2W4S A;  3HHG A;  4B3X A;  4CZZ A;  3EUH C;  4HPQ A;  1ZGA A;  2KHM A;  4F7Z A;  3DBL B;  1I1S A;  1FZP B;  1IDZ A;  3OYC A;  5IYC J;  1FYL A;  2QLZ A;  4XID A;  1UCR A;  5ILU A;  4Z2Y A;  2GA1 A;  4Y33 A;  2DK8 A;  1Y8Q B;  2AXT C;  2HXI A;  3G2B A;  2OUM A;  2XPU A;  4AYB N;  1UMQ A;  1LFP A;  2X6O A;  3VSK A;  3HDD A;  4DW6 A;  1HW1 A;  3QPH A;  3WGG A;  3W6J B;  3H0D A;  3TP3 A;  2RAE A;  5J4Y A;  4LG0 A;  2XGE A;  4HF1 A;  1QPI A;  3KPH A;  1IRF A;  2CW0 F;  1U5T C;  4EJV A;  1XSX A;  2MLK A;  1R71 A;  1HW5 A;  4DOZ A;  4DZP A;  2DT6 A;  4XN0 A;  3FXJ A;  2HS5 A;  4E7I A;  1SAN A;  1I27 A;  1YYV A;  1ODD A;  3OSF A;  2WAQ A;  4I2O A;  5E1X A;  5JLW A;  1VQ4 I;  3F21 A;  1D8J A;  2MA3 A;  1XTA A;  3KLN A;  1IN7 A;  1Z77 A;  4A69 C;  2Y30 A;  3I71 A;  2DA1 A;  1BR4 A;  4OOI A;  3F72 A;  4L18 B;  3KZI C;  2JVH A;  2Z99 A;  5LGU A;  2X0L A;  1B1B A;  3QYF A;  4CCN A;  1O3T A;  4DZJ A;  2K9L A;  3OY9 A;  2EIM H;  4UHT A;  1NK2 P;  1LUJ B;  2F48 A;  5HS7 A;  1O3S A;  2DMQ A;  3J80 Z;  2GIV A;  3GVA A;  1RR7 A;  3BY6 A;  1IV8 A;  2IS1 A;  3WTU C;  1SVM A;  2EFP A;  3HUG A;  2HPM A;  4EM0 B;  4H0E A;  2VJI A;  4CO8 A;  1F9N A;  1U2W A;  2K40 A;  4PUS A;  1DPR A;  5K7H A;  2GBY A;  1WJ5 A;  4EM1 A;  2X1E A;  1FJL A;  3KFW X;  4XNF A;  2LC2 A;  4IVN A;  4BEH A;  1ONV A;  5FD6 A;  3GZN B;  4LIV A;  2VC1 A;  4BE0 A;  3BDD A;  2OQG A;  3G1M A;  3RQ4 A;  2RNJ A;  3HOW J;  2A6T A;  4UUV A;  2CV2 A;  4JQF A;  2CU7 A;  2QKM B;  2TDX A;  2YR2 A;  4PSX A;  1HXD A;  1PUE E;  3CLO A;  5E79 C;  1A6I A;  4XMY A;  5FKM A;  4IX7 A;  3CC7 I;  2VLA A;  1ETW A;  1V4R A;  2M34 A;  5ERI A;  2PI0 A;  2R7U A;  3KCC A;  3IRR A;  2K86 A;  2EBI A;  3G73 A;  1HC8 A;  2G7H A;  4FQG A;  3TO7 A;  4RB3 C;  3I56 I;  5DD8 A;  2K9M A;  2JPB A;  3ZQH A;  1QNT A;  1OMI A;  1Z67 A;  1YJW I;  2CQ7 A;  1ULY A;  3V7C A;  3COA C;  4LB5 A;  3KP7 A;  3JTG A;  4IRI A;  4EJU A;  1ZLK A;  2KZV A;  5F6F A;  3AG1 H;  1F5T A;  4L0Y B;  4HSR A;  2LFB A;  1WJD A;  1ZR4 A;  5L3G A;  2ID3 A;  2ELJ A;  3VEP A;  4CA0 A;  2JA5 J;  5EG0 B;  2HOE A;  1I3A A;  3QPT A;  4G6D A;  3TO6 A;  1JKR C;  2K85 A;  3HOV J;  1ZTR A;  4A3I J;  1MZB A;  2F4M B;  3CCY A;  1QU3 A;  4S04 A;  3V8L A;  3CCV I;  5E17 F;  2E1M B;  2R92 J;  2JRT A;  3VYS B;  4E70 A;  2MGQ A;  4MHG A;  1ZKG A;  3FMR A;  4YEJ A;  3V4G A;  2Q8K A;  2LRD A;  3FMQ A;  1AKH B;  5HS8 A;  3GX4 X;  5M5W J;  2DXI A;  4QWQ A;  1IUF A;  4ZTF A;  1RC9 A;  3FXK A;  2LTP A;  3BTJ A;  4AWX B;  2ZME B;  2JWT A;  4O5V A;  2V7F A;  4NBQ A;  4W97 A;  3GLL A;  3SDB A;  4A0X A;  1MMG A;  4P5O A;  3IP4 B;  2JQ7 A;  3S16 J;  1R4N B;  2R7V A;  3ZMT A;  3T8R A;  5GTI C;  5A2Q Z;  2DOE A;  3VYU B;  2F5C A;  2HVS A;  1T98 A;  4DGW B;  1HSJ A;  1Z6R A;  2XGC A;  4A12 A;  2P7C B;  1CF7 A;  2VB6 A;  3CDH A;  1X58 A;  1IDY A;  3LSR A;  3ZMD A;  3QOD A;  2W1O A;  4NHJ A;  2KIF A;  2EV6 A;  5L3D A;  3KIO A;  1JT0 A;  1JXS A;  3CTA A;  2V1U A;  1RR8 C;  4WXD A;  4Y3O A;  4HF2 A;  3ERM A;  2PJR B;  1I6X A;  3KEO A;  1HKT A;  3CO7 C;  1H9T A;  2EA4 A;  2LDU A;  2PX9 A;  4JX6 A;  3A0H C;  4XSZ F;  5EGO A;  4CZC A;  2W24 A;  4B3A A;  4IZZ A;  2JUG A;  3PL8 A;  4M9S A;  4CSW A;  2HDC A;  2QKL B;  3GTK J;  1Z3X A;  2K5C A;  3DLL F;  4LIT A;  3WTW C;  2NAZ A;  1MSF C;  3E6B A;  1V5F A;  4BDZ A;  1W5T A;  4GDF A;  4JK1 X;  3ZPL A;  2VT2 A;  2LK2 A;  4GCV A;  1VQ9 I;  2R5Z B;  1JKQ C;  2FOW A;  4AYB A;  2O03 A;  4N9I A;  5LHI A;  4BQQ A;  4PCQ A;  2OBP A;  1U3E M;  2XVC A;  3ECH A;  3N05 A;  3JRH A;  1T2K A;  5M3F J;  2BHY A;  2OPT A;  5HLG A;  2YPR A;  3Q3S A;  1EF4 A;  1T6S A;  2NVX J;  3DQV C;  1L3L A;  2Y0S N;  3HTS B;  2PMH A;  5E8G A;  2ZB9 A;  3ZP5 A;  2KJB A;  3GLX A;  2LG4 A;  3W2A A;  2YX7 A;  1XMA A;  2DPD A;  3K4K A;  2F5E A;  3LSI A;  3KZY A;  3ZN0 A;  1VQL I;  4RM3 A;  1ENH A;  1J9I A;  3OV8 A;  3RYR A;  2RC4 A;  1QO0 D;  5FRO A;  5CJ9 A;  4C3I J;  3ZCO A;  2FNP A;  1W0T A;  3DWL E;  5E20 A;  4WWC A;  3CUQ B;  4PGH A;  3ZMV A;  1ON2 A;  5FFX A;  1YW7 A;  3M9A A;  1NK3 P;  2BW3 A;  3AL0 C;  2KJC A;  4BS9 A;  2P6T A;  3D0S A;  3N4M A;  2RV8 A;  1EH6 A;  2R0Q C;  4I01 A;  1AA7 A;  2W00 A;  1ZG3 A;  1QHH D;  2DA2 A;  1BI1 A;  2ZJ2 A;  1O3Q A;  1C0W A;  4ESF A;  4R79 A;  3P9I A;  4EGY A;  2IGK A;  3QPL A;  4U0W A;  4C9Y A;  1YIJ I;  3RQI A;  2V79 A;  3HSR A;  4IRG A;  5LGN A;  2NNY A;  1DQU A;  2H6C A;  3BR2 A;  4G12 A;  1LE8 A;  1X1B A;  2R4G A;  3IV5 A;  2ZSI B;  4L9V A;  1Y0U A;  4XBF A;  1OCC H;  3QRF F;  3ZQ7 A;  1Z1D A;  1TT5 B;  4C3H J;  3BG6 A;  3K1M A;  2NVY J;  3OIO A;  2FX0 A;  2LY2 A;  2M4K A;  1LFU P;  2GZW A;  2NXN B;  1ZH5 A;  1ZRD A;  1BM9 A;  1P7I A;  3SYT A;  3VYT B;  3DFG A;  2R7Z J;  2Y9Z A;  2X1C A;  1WJA A;  4HV6 A;  1MBK A;  2NVU B;  1YG2 A;  2GA2 A;  1IRX A;  3M1C A;  1FX7 A;  1V5E A;  2LOO A;  4RGR A;  2X4H A;  3DU6 A;  2HYJ A;  1RKT A;  1OCZ H;  2NS7 A;  1R1V A;  2XGX A;  2DA5 A;  4GGG A;  4GO1 A;  2RQQ A;  2R7O A;  1Y1V J;  2MH2 A;  3E6M A;  2D1V A;  2QQA A;  2CG4 A;  2LBF A;  1SMT A;  2HFH A;  2E5Z A;  1H9G A;  2WY8 Q;  2DFI A;  3DF8 A;  1BA5 A;  4MEX F;  1XGN A;  2ECC A;  2K3F A;  3KP4 A;  3G3Z A;  3G1L A;  4P96 A;  3I58 A;  5TGT A;  1B59 A;  3ZMS A;  3KZZ A;  2FNA A;  3FMS A;  3J81 K;  1BI2 A;  1UEL B;  2H1L A;  2ZNZ A;  5J8C A;  1M1E B;  4YIR X;  3RI4 A;  3BWG A;  1LB2 A;  1YE9 A;  3SQN A;  1I1G A;  4AC0 A;  2IGN A;  3PFY A;  2OF7 A;  4F52 A;  4I99 C;  1W7P A;  4MTD A;  2XKP A;  2COB A;  4BBS J;  1T38 A;  3CF2 A;  1FC3 A;  3RPQ A;  5BS6 A;  1LVK A;  2V6C A;  5JFR A;  4G7H F;  1F4K A;  3F9K A;  5K7F A;  5HS9 A;  3T5X A;  2NS8 A;  1VQ8 I;  1J09 A;  2QUF A;  3M4O J;  1GDT A;  2JSP A;  5LRS A;  3HBL A;  1ETQ A;  2AO9 A;  3J7A O;  1D1A A;  3T8T A;  4BU2 A;  1B6A A;  4JOM A;  1J59 A;  4Y17 A;  4MQ9 F;  1G2H A;  2B63 J;  4X0G A;  3DBH B;  2V9K A;  1QQI A;  1VQK I;  2BY3 A;  2EPF A;  5DUI A;  3JSP A;  5D6E A;  2WAE A;  1TW3 A;  1D1C A;  3SEZ A;  4AU7 A;  4IHV A;  4LK0 F;  2DTZ A;  3ZMU A;  1VQ5 I;  1OCO H;  2BBY A;  3WHB A;  2Q1Z B;  3SHF A;  2E2I J;  3HYI A;  2CWE A;  3IHU A;  2L2O A;  2MH9 A;  1XCB A;  4G7Z F;  3H92 A;  4RB2 C;  3PIP F;  3FKI J;  1OQY A;  2E2J J;  1IUY A;  1LDJ A;  4BHB A;  5JVG F;  1JTY A;  3G4S I;  4LJZ F;  2M8E A;  2BE5 F;  5B1B H;  2XDV A;  3HJE A;  4A93 J;  3RKQ A;  3NQO A;  1VQ7 I;  2OTJ I;  5ICF A;  3M8E A;  1YJN I;  1QVT A;  3KYC B;  2LF8 A;  2XAQ A;  4RM2 A;  4DBR A;  1POG A;  1Z21 A;  3OS2 A;  3U1K A;  2ZBK A;  3P9K A;  2XF6 A;  3LNQ A;  1MBE A;  4ZZL A;  5J4V A;  3ZGK A;  2ADU A;  2V26 A;  3H5A A;  1Y1W J;  3K2Z A;  2IS2 A;  4QLC U;  4M74 A;  4MGR A;  1D0Z A;  1TLH B;  4DQ2 A;  3LSJ A;  1A31 A;  3KP5 A;  1KU9 A;  4HDV A;  4P1W A;  3K2A A;  2HWV A;  4AIK A;  1MDM A;  1FTT A;  2K7L A;  2HDD A;  3MZH A;  3LQQ A;  3GTG J;  3M8F A;  2E1M C;  5GAG J;  2VBY A;  1K79 A;  4JYK A;  1H8A C;  1K78 B;  2NOG A;  3O8G A;  1NG7 A;  1PP7 U;  4BAC A;  1WKM A;  1NHA A;  2IXS A;  2M30 A;  4PSW A;  5DYM A;  1KYZ A;  1YTY A;  3RKW A;  3OYL A;  4ZJZ A;  1P6R A;  4F91 B;  4DNC A;  4CYC B;  1G3W A;  2R7W A;  1U9O A;  2DFH A;  1BJZ A;  1I3Q J;  1XDU A;  3KLO A;  3PM1 A;  4D7M A;  5E3N A;  1MJ9 A;  2NYX A;  2ZME C;  1KGS A;  3GYH X;  1J75 A;  1T33 A;  4RLQ A;  2CO5 A;  3JSO A;  4B48 A;  4BQO A;  3SFZ A;  1WZ2 A;  3L09 A;  5AON A;  5HNH A;  4GYI A;  1GVJ A;  4J00 A;  4IL6 C;  3Q0W A;  2FML A;  1V54 H;  2COM A;  1FWZ A;  2A5Y B;  3CCJ I;  5IOY A;  4LMY A;  5GPA A;  1PUF B;  5IY5 H;  1FOK A;  4BQA A;  3JRB A;  4IHY A;  2FJ1 A;  5FLV A;  1ETV A;  1QPM A;  2ID6 A;  4A3D J;  2BGC A;  1PDN C;  2XPW A;  3ISP A;  1BIA A;  3U21 A;  1IC8 A;  3ZXS A;  3HC7 A;  1XB4 A;  2JA6 J;  4A0Y A;  1BJA A;  1YRN B;  2F6C A;  4A5M A;  4AUX A;  3OSG A;  2MW8 A;  1R4M B;  3BC8 A;  1BW6 A;  3CCU I;  1AU7 A;  3FX3 A;  2W84 A;  3CC4 I;  5IT9 Z;  3BLY A;  3KEQ A;  2OAZ A;  2K9S A;  1LEA A;  1ZYR F;  2BV6 A;  2CFX A;  5M5X J;  1W36 C;  2I8D A;  3HOY J;  3TDU C;  3K69 A;  3E3V A;  1AWC A;  3CCL I;  2Y75 A;  1MGT A;  3F22 A;  2AHQ A;  3BR6 A;  2NRA C;  9ANT A;  3ASO H;  4MNU A;  3SXY A;  5F08 A;  3GTO J;  3BZ6 A;  4A3C J;  1SVO A;  1ITY A;  2LSO A;  2K9N A;  3RJP A;  3E5X A;  3LAJ A;  1W0U A;  3CO6 C;  2FQ4 A;  2M0M A;  2WA0 A;  3O8H A;  5ILV A;  3OYN A;  5BMZ A;  3I55 I;  5KAI C;  3IRQ A;  3HOS A;  1U8B A;  2EZH A;  3HOT A;  2JPC A;  2DJN A;  3C2H A;  2FBK A;  4LK1 F;  2P6S A;  4FX4 A;  4XLP F;  3ERE D;  2D1H A;  1Q1V A;  1XD7 A;  2DMP A;  3KEY A;  3GFL A;  1X4O A;  3R60 A;  1P4A A;  3D5R C;  3K4L A;  4M9X A;  4CH7 A;  2LKP A;  2FXA A;  1UHM A;  1ERD A;  3CUQ C;  3BJO A;  3KP3 A;  1UAA A;  2P8T A;  5IOZ A;  3C2B A;  1WJF A;  2KT0 A;  1SAX A;  1JT6 A;  1VQP I;  3RDI A;  1IN8 A;  5ED4 A;  3REO A;  3PNV A;  2RDP A;  3FXU A;  1Y56 A;  1KZH A;  2RNG A;  1Z91 A;  2R7Q A;  3MEX A;  3TMO A;  1E3H A;  2HZD A;  2KKO A;  3F6O A;  3WHC A;  2D45 A;  2XIG A;  4NNJ A;  1DU6 A;  5FKO A;  2C6Y A;  1IF1 A;  2DPU A;  1IO2 A;  3V7R A;  2L4M A;  5EDN A;  2A07 F;  4WK8 F;  2R5Y B;  5FRN A;  2F4O B;  2FEZ A;  2Q2E B;  4M3D A;  5CVU A;  3TW6 A;  3KYD B;  3OYK A;  2G0E A;  3OIP A;  1FMV A;  2LLK A;  5TJJ A;  3FK6 A;  1JJ8 C;  4FHT A;  1HKQ A;  2DCE A;  3FXM A;  4GXO A;  4MFE A;  2CV0 A;  3LWF A;  2HPI A;  3CZ6 A;  4LLL A;  4I09 A;  3PO2 J;  4HZF A;  4HX7 A;  1DP3 A;  1XGO A;  2WV1 A;  2FF4 A;  4P55 A;  2Z1D A;  1BN5 A;  4UVC A;  5HLT A;  1YOV B;  1KU7 A;  1Z7U A;  4MLO A;  4E6K G;  3QOE A;  3MKL A;  3SJM A;  4Q5S F;  2WY7 Q;  4DYR A;  5FGM A;  2WC2 A;  1MBG A;  3UKG A;  1L0O C;  4ZZD A;  4NC8 A;  4HNU A;  3F8C A;  2PBI A;  1R5I D;  1ZEL A;  3RTR A;  3CCR I;  3PQJ A;  3EUH A;  4M3F A;  3VDX A;  3WU1 B;  3DPL C;  2CMP A;  1JUS A;  2EWN A;  4Y13 A;  1X1C A;  3HZJ A;  4ANJ A;  5E3M A;  2CQX A;  2VL8 A;  1Z0X A;  1NH3 A;  4W1U A;  3OS0 A;  5FFZ A;  1TW2 A;  2VKD A;  2W7N A;  1VQM I;  2ME0 A;  1PJR A;  2PMZ A;  2VT3 A;  3RPU D;  5HOO A;  1HF0 A;  5FRM A;  5IP9 J;  4M72 A;  4AIH A;  3IWZ A;  3HIF A;  2CJJ A;  2BZT A;  1LPQ A;  3SFI A;  1SAU A;  3WTX C;  5KK1 A;  2WB1 N;  1X2N A;  2PEX A;  1B72 B;  3SDG A;  1P92 A;  4UB8 C;  3RYP A;  1IGN A;  3NAR A;  1SD7 A;  1LFB A;  2CFO A;  3O2P E;  3HRT A;  2DLL A;  1U5T A;  2ZFW A;  4XK4 A;  2MAB A;  2DW4 A;  5DD4 A;  2DJI A;  4UUS A;  1XC5 A;  1I5Z A;  5IP7 J;  3LL7 A;  2R7T A;  3IH4 A;  1OCT C;  1EA3 A;  1T95 A;  1OPC A;  1ZR2 A;  1B9N A;  3F8F A;  2DA3 A;  4LGW A;  3DPU A;  1GLN A;  4D5C A;  2PN6 A;  4OIR F;  4OMZ A;  5KHD A;  2STW A;  3GTJ J;  1DP7 P;  2ZJP F;  5HVQ C;  4I0A A;  3K0L A;  3OYG A;  2Y31 A;  3CDI A;  4IHX A;  2L9S A;  2CW8 A;  4KMF A;  4XR6 A;  2DDB A;  1QRY A;  1U0J A;  3DTE A;  4IXA A;  5HLH A;  1WJB A;  3BOQ A;  4A3B J;  1UZC A;  5LBQ A;  1RKW A;  1QBJ A;  3NRV A;  2AXL A;  4B47 A;  3OYB A;  1HOM A;  5IPA A;  1OJL A;  4MEY F;  4CCO A;  2DTR A;  3TQN A;  4YII A;  4ZTJ A;  4DIQ A;  3FM5 A;  1ZRC A;  4E7J A;  4Y7N J;  1TWA J;  1ETK A;  1J0R A;  5H2F C;  4RB0 A;  2E5N A;  3AFH A;  5LRR A;  3E5Q A;  2D2W A;  2HYG D;  5LLQ A;  2O9L A;  2HKX A;  3EET A;  1ETY A;  2ZC2 A;  5DS9 A;  5EF6 A;  2BXY A;  2GXG A;  4IHW A;  2RN7 A;  3RIR A;  4X6A J;  3V42 A;  1JJ6 C;  4L5I A;  2QWW A;  1T0F C;  1S8N A;  2ELH A;  2FU4 A;  2RRE A;  2L02 A;  4OIN F;  3W2W A;  4U0Y A;  3I4N J;  3QU6 A;  1IN6 A;  4DBQ A;  2Z3Y A;  1B8I A;  3ELK A;  3HG9 A;  4HDU A;  4XLN F;  1IXR C;  4CUG A;  5HDG A;  1DPU A;  1XSV A;  1SMY F;  2QBY A;  1SFE A;  3CJR B;  3EQL F;  1K4S A;  1VQO I;  1BI0 A;  2DFF A;  2BVL A;  3OOP A;  3GO5 A;  3VOD A;  4N9H A;  5GTH C;  3K70 D;  2RVC A;  1W36 D;  3RZO J;  1MMS A;  2VOP A;  3JRD A;  4ASN A;  1MJA A;  3R0A A;  3MAJ A;  4HNT A;  4V2G A;  3S2H J;  3PUB A;  2HQN A;  2WAF A;  2UXX A;  2EFQ A;  3F8N A;  2XSD C;  2HOA A;  5FJ8 J;  4N4O B;  4G6Q A;  3FZV A;  2Y69 H;  4M73 A;  2KFD A;  3UR3 C;  3R6S A;  1QZE A;  1N25 A;  1V55 H;  2IGM A;  4TV7 A;  3BR5 A;  3QYB A;  4L9T A;  1SEU A;  3AG3 H;  2NVQ J;  5BOX A;  5J6X A;  4A3J J;  2CUE A;  3GEZ A;  3ML6 A;  4I02 A;  1MMA A;  2CYY A;  5EZG A;  3FM3 A;  3Q5F A;  3DKX A;  1V3F A;  3VWB A;  3LSM A;  2H94 A;  2EZL A;  2IA2 A;  3U9G A;  5E8I A;  3F23 A;  4QIW N;  3MFK A;  1MMD A;  2WTE A;  1IV6 A;  1JTX A;  4KN4 X;  1UG2 A;  3DBR B;  1SD4 A;  4WXC A;  5DCM B;  1HST A;  1K83 J;  2R93 J;  5BPD A;  2BY2 A;  4E7L A;  1VQN I;  3MKZ A;  2HU9 A;  4CXF A;  1G6N A;  4N0B A;  3ZQQ A;  2VQL A;  1ZN2 A;  2Z9O A;  1RI7 A;  1IG7 A;  3B73 A;  2L54 A;  2LY9 A;  2L9V A;  2DO7 A;  4HYE A;  2DYR H;  4XRF A;  2YX4 A;  4BGD A;  3A01 B;  3L2C A;  2PQ8 A;  3LSH A;  1BC7 C;  3TP0 A;  1RUO A;  1E3P A;  4MTE A;  3H0G J;  3H9J A;  1S6L A;  5F0F A;  4UUT A;  4KUM A;  1B4A A;  2MYS A;  3LFK A;  2LH9 A;  3OWT A;  4IF4 A;  2DOD A;  1O4X A;  4UNO A;  3A4C A;  1I39 A;  1BIB A;  3S17 J;  5JR3 A;  1E17 A;  5DEQ A;  1TZL A;  1ACI A;  4Y52 J;  2CH0 A;  1YIT I;  2QQ9 A;  3H35 A;  4LFU A;  1IXS B;  2J5P A;  4B8X A;  3IAM 2;  2PLY A;  1BL0 A;  2ESN A;  1P4W A;  1KU3 A;  4PJ0 C;  4PGG A;  3JTH A;  3S1N J;  1TQI A;  1TNT A;  2DK5 A;  4NQW B;  3JRC A;  5D5X B;  1EV7 A;  2CS3 A;  4HG2 A;  4A3E J;  1FBQ A;  4P9F A;  1HLV A;  3GME A;  4M9Z A;  1DGR M;  2IRF G;  2MC3 A;  2LKX A;  2CV1 A;  1JI8 A;  3TGN A;  5B5E C;  5CVV A;  1UHW A;  1WGX A;  2KDO A;  2XAF A;  4CCM A;  2ISY A;  1IRG A;  1GXP A;  4CGZ A;  4OAZ A;  3FKJ A;  3IKV A;  3L7W A;  4S0H B;  1BW5 A;  4E7Z A;  4A6E A;  2LVS A;  1VZ0 A;  4BJT A;  4J01 A;  3EDP A;  3ECO A;  4MFD A;  4G7O F;  5LEJ A;  2EIL H;  2KIS A;  3IC7 A;  3W2V A;  3L2R A;  3HRM A;  3CLQ A;  5GAE J;  1BI3 A;  2L4A A;  2FRH A;  2CRG A;  2EQR A;  3F8B A;  1WH5 A;  3ABL H;  5J40 A;  3HOX J;  2LR8 A;  3BG5 A;  3CJT B;  4XOP A;  5TIS C;  1U8R A;  1MKM A;  3ZRG A;  4II3 A;  3PNT A;  2ZXJ A;  4QSH A;  2XV4 S;  4I7H A;  5EYR A;  5F1R A;  2WWY A;  1KU2 A;  3AG4 H;  3I59 A;  5AIQ A;  4E7S A;  2HI3 A;  4PJM A;  5FKN A;  3E7L A;  2XC7 A;  4IO9 F;  4EQQ A;  2Y9Y A;  3C2G A;  5E3L A;  3LSG A;  1HCR A;  4KIS A;  4HLY A;  2L7K A;  3BZC A;  3KP6 A;  4A3M J;  1TQP A;  2KMU A;  2HQ5 A;  1UFM A;  4HQM A;  3K4C A;  3W3C A;  3RZD J;  3A2K A;  1FEX A;  2M8G X;  4LG0 B;  2IGO A;  2VE9 A;  4D1Q A;  3BTI A;  5F0C A;  2EH3 A;  4UV8 A;  2GXA A;  4FE7 A;  4M6Y A;  2V4J C;  1WI3 A;  3S3M A;  1SFU A;  3S93 A;  5J8F A;  5JLX A;  3BRO A;  2R5Y A;  3TDZ C;  3S1R J;  3ESW B;  3MZ8 A;  1R9T J;  4KYW A;  3QPS A;  1NG6 A;  5B1A H;  2VBX A;  1X1A A;  2QYO A;  3I64 A;  4MQV A;  1FP2 A;  2M7A A;  3PIO F;  5JHU A;  4XLA A;  1MNM C;  1BC8 C;  2GOM A;  1WH7 A;  3DPT A;  3LOC A;  1R7J A;  2EFO A;  4KA4 A;  3ZOB A;  2KRF A;  3JAM K;  3J7Z I;  5F27 A;  5LHH A;  5FLX K;  2O3F A;  3IAS 2;  2RGV A;  3W6V A;  3WTS C;  5DCF A;  4BJ6 C;  1TWF J;  3CMA I;  5L3B A;  4M71 A;  4L9N A;  2QQB A;  1IN5 A;  1OR7 C;  2H09 A;  2VKV A;  3K4J A;  1XGM A;  2ELK A;  3HUG B;  3LSK A;  5EJC A;  1A04 A;  3J81 Z;  1OYY A;  2L9R A;  4KIB A;  1GXQ A;  2LF7 A;  2B0L A;  2VC0 A;  3CCS I;  2CUJ A;  4B4C A;  1X3Z B;  1SFO J;  4PDK A;  1MW7 A;  1G3T A;  4XKC A;  4BEH B;  5FLX Z;  2X51 A;  2DMN A;  2DDA A;  2LNB A;  3QU3 A;  3WTZ A;  1A6Q A;  3FBN B;  4UV9 A;  1D0Y A;  3FIS A;  4FX0 A;  1VQ6 I;  4XIC A;  4YIF A;  3ABT A;  2Y2Z A;  2DOA A;  4BY1 J;  3CP2 A;  1Y6I A;  2X6X A;  4IPA A;  3O3K A;  1R5H A;  4II2 A;  2IA0 A;  2A61 A;  1TL8 A;  1LQ1 A;  1YQA A;  3MKY B;  2VI6 A;  1R22 A;  4ZC3 A;  2F2E A;  1GV2 A;  3IUO A;  2K02 A;  2QGU A;  5ILS A;  4KT5 C;  2M4G A;  3WTY C;  1T8I A;  2P5L C;  1AOY A;  4OIO F;  1R49 A;  4KIC A;  2K4J A;  2VE8 A;  1I50 J;  2DQR A;  2IA1 A;  2ZXI A;  3X2Q H;  5E3O A;  1J7K A;  1D0X A;  1XPX A;  2P4W A;  1QA6 A;  3JRF A;  5JHF A;  3L2Q A;  1U6G A;  3WE2 A;  2UV1 A;  5H6Q A;  5C4X J;  3I9V 2;  4PFP A;  2O8X A;  3P5J A;  5H20 A;  1E2X A;  3HPH A;  2BEO A;  2Y0S A;  5D8K B;  2KIU A;  2XRL A;  3P9C A;  3EUA A;  2JUC A;  2W25 A;  3FIW A;  2EK5 A;  4LD5 A;  1DDN A;  1FLI A;  4L9J A;  3H3V K;  5DV5 A;  3DP7 A;  2CGP A;  2EA2 A;  1FOX A;  3BPX A;  4RAY A;  5HDK A;  2PJP A;  4AID A;  5EEH A;  2XAH A;  5FLM J;  3BP8 A;  3EYI A;  3BR0 A;  1TTY A;  3I54 A;  2VBW A;  2MFZ A;  1FYK A;  4BUP A;  4UVA A;  5L3F A;  3S2W A;  5JVT A;  3I4P A;  1HW2 A;  4O6J A;  3WU2 C;  4EM2 A;  1CF7 B;  2VUM J;  2YS9 A;  3I5U A;  1KYW A;  3M7G A;  3BTC A;  2M45 A;  4KIG A;  3HTU A;  5M5Y J;  4PJJ A;  5EG0 A;  5FKK A;  4EAT A;  1HDD C;  4BXX J;  2GOX B;  4LIU A;  3BG7 A;  3BPV A;  2M9H A;  3MKW B;  5H6R A;  1UG0 A;  1USS A;  1XMK A;  1FSH A;  2P7V B;  4KIF A;  2OJE D;  2KRC A;  2V9V A;  2P0W A;  1TT0 A;  1BOA A;  5EGO B;  3K6G A;  1SFX A;  3TOA A;  2X48 A;  1S3J A;  3ZQI A;  5EEA A;  3EYY A;  4EMS A;  1AKH A;  1OYW A;  2XPV A;  2ISZ A;  3TOB A;  5K5O A;  2IS4 A;  3JRA A;  2ZME A;  4EV0 A;  2P5K A;  4XLE A;  3CUO A;  1FSE A;  5E1W A;  1RES A;  1U78 A;  2IVM A;  2R7X A;  1XSD A;  4KNY A;  3K9T A;  3VFZ A;  5DUK A;  1KQ9 A;  3S3O A;  2KZG A;  3VSL A;  1E0E A;  4PFO A;  3H9Q A;  4HX8 A;  2JVG A;  1KQ0 A;  1PVE A;  1XCV A;  3TL4 X;  3ZQC A;  4IQJ A;  2DA4 A;  5AIP A;  2EZK A;  2DAO A;  2DYS H;  2KIM A;  1XG1 A;  3K70 C;  5D4S A;  4NUB A;  1IXC A;  2WAD A;  1IN4 A;  3HGY A;  2LMD A;  1ZRE A;  2I10 A;  3S15 J;  2E1N A;  2WBM A;  2K27 A;  1Z6T A;  3WG7 H;  4LB6 B;  2KL4 A;  4BH9 A;  1ZG5 A;  2X6Y A;  1UHS A;  3NWS A;  2PJR A;  3S2D J;  1D3Y A;  2BY1 A;  2BYV E;  2MBF A;  3ONQ A;  1H88 C;  2FOK A;  2Y0M A;  2K3P A;  5F04 A;  1TC3 C;  3GFM A;  2E60 A;  3ASN H;  3P7N A;  2NS0 A;  2LKS A;  1YX5 A;  1Z9C A;  1SFK A;  1R36 A;  1GV5 A;  2EB7 A;  4EJO A;  3M07 A;  2LRE A;  3C1D A;  2V1D A;  5ICC A;  5KNL A;  2JK3 A;  2OQR A;  2KQR A;  4JX4 A;  3BG9 A;  3DU5 A;  2R5Z A;  2BW3 B;  3GTM J;  4BKX A;  1KQ8 A;  3MMY B;  3B02 A;  2KLO A;  1OLT A;  1G4D A;  2PFB A;  3I0T A;  4Q48 A;  2IT0 A;  3E97 A;  3ABU A;  1WPK A;  5J1Y A;  3CC2 I;  2QSF X;  3GBG A;  5D5U B;  3LA3 A;  2QF7 A;  3C3W A;  3KP2 A;  4CCJ A;  3SZG A;  3F0C A;  3PNY A;  4HAM A;  2FSW A;  5TRD A;  1FP1 D;  2QSG X;  4HST A;  1X3W B;  4I0B A;  3AAF A;  3K4M A;  4NB5 A;  3ABM H;  1LE8 B;  1SD6 A;  1R5G A;  1E3O C;  2DU9 A;  5CVI A;  1W7P D;  1VND A;  4KMU X;  4LLN A;  4A0Z A;  1RNL A;  3FXO A;  3HEF A;  2TRT A;  4F55 A;  5J47 A;  2HNH A;  1IJW C;  2HGC A;  2DBB A;  3OR2 C;  2XUB A;  4HRI A;  3A1Y A;  4XKB A;  4LG3 A;  4XOT A;  1OFC X;  4F93 B;  2VJJ A;  4XM3 A;  4D7N A;  1XN7 A;  4RMN A;  3DKW A;  3JW4 A;  3CES A;  3LST A;  4B43 A;  5IYB J;  1RZ4 A;  1B9M A;  3GTP J;  3CUQ A;  3Q0V A;  1W1W E;  4IOA F;  2L3D A;  2GM4 A;  2I5U A;  3Q0U A;  3VYR B;  5C4J J;  4ESJ A;  1G59 A;  4DYC A;  2OCC H;  4XQF A;  4L5E A;  2XAJ A;  4PK4 A;  3ROU A;  2E7W A;  2VQH A;  2F5V A;  3ZQF A;  2M5W A;  1ETX A;  3IL2 A;  1CGP A;  2FBH A;  2Z33 A;  1R1U A;  2UXN A;  2LBF B;  3DEU A;  2L0K A;  4HNV A;  4BXU A;  1RRJ A;  2CUZ A;  4E7K A;  1TQM A;  3DTK A;  4LLG F;  1YFH A;  2L7M P;  2VJ5 A;  3QOP A;  3IH2 A;  2A6H F;  3QQA A;  2VKH A;  4YEL A;  3I53 A;  1YHQ I;  5K1Y A;  1BR1 A;  4YG2 F;  1GHC A;  1W7P B;  1S29 A;  5LEK A;  4CYD A;  3R4K A;  2XAG A;  3H36 A;  3JRE A;  3S1M J;  4ZDP A;  4RB1 A;  2A5W A;  2E19 A;  3RCO A;  4C30 A;  1DU0 A;  4JX5 A;  2VKE A; 
#chains in the Genus database with same CATH homology
 3E1S A;  3PSI A;  1MMA A;  3DKY A;  5TGT A;  3FBI B;  2VPL A;  4OAY A;  2IS6 A;  3DKX A;  3VWB A;  1FMW A;  1UEL B;  3LSM A;  2V1N A;  1YE9 A;  4Y4R A;  1DGW Y;  1MMD A;  3OYM A;  2IGN A;  3PFY A;  4F52 A;  2KRH A;  2JA2 A;  4D9J A;  1LKX A;  4KJZ A;  1Z3Y A;  4ITV A;  3S8P A;  1QHG A;  3EUK L;  4E7L A;  3MKZ A;  2HU9 A;  3OMY A;  3CF2 A;  4N4N B;  4NC7 A;  1LVK A;  2M3A A;  3ZQQ A;  2VQL A;  2ZFU A;  3F9K A;  2ZXH A;  5CQE A;  4BL0 B;  2HQA A;  2Z16 A;  1J09 A;  3NWT A;  2HDW A;  4BGD A;  1R6R A;  1S9H A;  2JSP A;  3LSH A;  1MNE A;  4XLH A;  4B44 A;  1D1A A;  2VQC A;  3H9J A;  3S32 A;  4BU2 A;  4JOM A;  4OWR B;  2MYS A;  2LH9 A;  3OWT A;  4RLF A;  3SEQ A;  4X0G A;  2L9N A;  2V9K A;  3HKZ A;  3A4C A;  1G8X A;  3HL2 A;  2M7B A;  2VQG A;  1TZL A;  2CH0 A;  2KP6 A;  3H35 A;  2WAE A;  3IAM 2;  4CCL A;  1D1C A;  3HPG A;  3SEZ A;  1KON A;  4AU7 A;  3L2W A;  3HXL A;  3J7A Y;  4NQW B;  2UWM A;  4XON A;  2Q1Z B;  1LDK B;  1N75 A;  2CS3 A;  4HG2 A;  4GRI A;  4QPO A;  4U7B A;  2L2O A;  1DGR M;  5KCM A;  5CQG A;  4KIT B;  2CV1 A;  1JI8 A;  1X19 A;  4XN3 A;  4CCK A;  1X1D A;  2KDO A;  3H5R A;  2XF5 A;  3MD2 A;  4CCM A;  2XAU A;  2XDV A;  4OAZ A;  4ZDO A;  3FKJ A;  3AL0 B;  4E7Z A;  1VZ0 A;  4BJT A;  4J01 A;  4RM2 A;  4DBR A;  1Z21 A;  3OS2 A;  2XF6 A;  3W2V A;  3L2R A;  3H9G A;  3ZGK A;  3H5A A;  2V26 A;  2NOJ B;  3K10 A;  3AKZ A;  4XOP A;  4BDY A;  3OL4 A;  2IS2 A;  3KX2 A;  1D0Z A;  3ZRG A;  4II3 A;  3TBI A;  1P9Q C;  3PNT A;  3FDY A;  2DT7 B;  1BOB A;  4G6T B;  4P1W A;  3DEE A;  3DLA A;  3PJR A;  4E7S A;  4PJM A;  2XC7 A;  2W4S A;  2E1M C;  4B3X A;  3RSN A;  3C2G A;  3BCA A;  4E4H A;  3OYA A;  2HVR A;  1NG7 A;  3EUH C;  3LSG A;  4HPQ A;  4BAC A;  4KIS A;  2IXS A;  2KHM A;  4PSW A;  2L7K A;  5LD2 C;  2KMU A;  3OYL A;  4ZJZ A;  2VXD A;  4F91 B;  3OL3 A;  1WJC A;  2R7W A;  3K4C A;  3W3C A;  3A2K A;  2IGO A;  3OYC A;  1K6Y A;  4D1Q A;  2HVQ A;  4RLQ A;  4B48 A;  4BQO A;  2V4J C;  4QPQ A;  3S3M A;  5HNH A;  2LYC A;  3S93 A;  4J00 A;  4Y33 A;  1NG6 A;  3G2B A;  1X1A A;  1WFX A;  2OUM A;  2M7A A;  1LFP A;  3VSK A;  4XLA A;  2GOM A;  3DPT A;  3D5S C;  3H0D A;  1MMN A;  3IAS 2;  4BJ6 C;  4DOZ A;  2DT6 A;  4XN0 A;  4E7I A;  3CMM A;  1OR7 C;  2R7R A;  2WAQ A;  2AQF A;  3K4J A;  3LSK A;  3HUG B;  3U21 A;  3ZXS A;  3HC7 A;  2CUJ A;  3CP8 A;  1V5G A;  2F6C A;  1BR4 A;  1MW7 A;  5HNF A;  4IQ4 A;  3BC8 A;  4XKC A;  4BEH B;  2JVH A;  2X51 A;  4XOR A;  3QYF A;  4CCN A;  3FBN B;  1D0Y A;  3BLY A;  2K9L A;  3OY9 A;  1W36 C;  3LFU A;  2I8D A;  2DOA A;  3CP2 A;  2IS1 A;  1Y6I A;  4PJL A;  2X6X A;  2HPM A;  4PJN A;  2VJI A;  4ZYA A;  4II2 A;  3OYH A;  4BE1 A;  3I3L A;  4PUS A;  3CJQ B;  1X4P A;  1WJ5 A;  3MKY B;  2X1E A;  4ZC3 A;  2MD0 A;  4XNF A;  2LC2 A;  4BEH A;  4LIV A;  3IUO A;  4BE0 A;  2M0M A;  1PYV A;  2WA0 A;  2WB1 A;  3L2V A;  3OYN A;  3RQ4 A;  3D5L A;  2A6T A;  2M4G A;  3HOS A;  2CV2 A;  3HOT A;  3C2H A;  4JQF A;  2QKM B;  3EPZ A;  4PSX A;  3KEY A;  2ZXI A;  4XMY A;  1YX3 A;  2BOL A;  4IX7 A;  2R7S A;  2VLA A;  1N77 A;  4BJ5 C;  1X4O A;  3OYD A;  2R7U A;  3D5R C;  1D0X A;  3K4L A;  4CH7 A;  5JHF A;  2BVM A;  2ZSH B;  3L2Q A;  2VIX A;  2UV1 A;  1ERD A;  2K9M A;  3S3N A;  1UAA A;  3I9V 2;  4PFP A;  1WJF A;  3HPH A;  2Y0S A;  3PNV A;  2KZV A;  1Y56 A;  3EUA A;  2RNG A;  2R7Q A;  4KT6 A;  3TMO A;  2HZD A;  4HSR A;  1WJD A;  5CPR B;  2ELJ A;  4NNJ A;  4CA0 A;  2X6W A;  4BE2 A;  2OC6 A;  5FRN A;  2OV7 A;  3K4B A;  2Q2E B;  4ZDL A;  4C2T A;  3OYK A;  3OIP A;  1FMV A;  3M8J A;  4H4K C;  1QU3 A;  4FAS D;  2E1M B;  3QYE A;  2DCE A;  2CV0 A;  2KPM A;  2MFZ A;  3VYS B;  4BUP A;  4XL9 A;  2HPI A;  3CZ6 A;  4YEJ A;  5CKT A;  1WJE A;  2LRD A;  2DXI A;  2AQE A;  1DP3 A;  4ZTF A;  3OYJ A;  2Z1D A;  2VAS A;  5HLT A;  4PJJ A;  4E7H A;  4YRV A;  4MLO A;  4E6K G;  2V7F A;  3QOE A;  4EAT A;  4XLF A;  2GOX B;  4LIU A;  2WY7 Q;  2X85 A;  3BG7 A;  1MMG A;  3K4N A;  3SDB A;  4P5O A;  3MKW B;  3IP4 B;  1UG0 A;  4NC8 A;  2R7V A;  4HNU A;  2KRC A;  3VYU B;  1ZEL A;  2P0W A;  3RTR A;  2HVS A;  1TT0 A;  3K6G A;  3VDX A;  4DGW B;  3DTI A;  3UNG C;  3DPL C;  2CMP A;  2VB6 A;  1X1C A;  4ANJ A;  2VL8 A;  3QOD A;  4IKF A;  2W1O A;  4XLC A;  2IS4 A;  2VJ4 A;  2X1D A;  3OS0 A;  2VKD A;  4XLE A;  2W7N A;  2PMZ A;  1PJR A;  5HOO A;  3RPU D;  5FRM A;  4Y3O A;  2R7X A;  2PJR B;  3S3O A;  3VSL A;  1E0E A;  4PFO A;  3H9Q A;  2JVG A;  1SAU A;  4CZC A;  4IZZ A;  3OYE A;  3KYL A;  3TL4 X;  3OR1 C;  2JUG A;  3PL8 A;  4IQJ A;  4CSW A;  3K70 C;  4NUB A;  2QKL B;  2WAD A;  1Z3X A;  2CFO A;  2K5C A;  4LIT A;  1N78 A;  3PSF A;  3ZR8 X;  1V5F A;  4BDZ A;  2WBM A;  1D1B A;  2MAB A;  3BCB A;  2KL4 A;  2L5Q A;  2X6Y A;  3NWS A;  2O5R A;  2DJI A;  2PJR A;  4AYB A;  4U87 A;  3LL7 A;  2R7T A;  3ONQ A;  4BQQ A;  1EA3 A;  3E0J B;  2K3P A;  3OS1 A;  3OYF A;  1T95 A;  3N05 A;  2XF7 A;  2E60 A;  3H5N A;  1YX5 A;  4C2U A;  1SFK A;  2CW7 A;  2LRE A;  1GLN A;  3DPU A;  5KNL A;  3DQV C;  2XSJ C;  2LY1 A;  5KHD A;  2KQR A;  4BQN A;  3FHN A;  5HVQ C;  3DU5 A;  3OYG A;  2BW3 B;  2L9S A;  2CW8 A;  4XR6 A;  1U0J A;  2LG4 A;  3DTE A;  3MMY B;  3W2A A;  2KLO A;  1OLT A;  1WJB A;  3K4K A;  3LSI A;  4DJA A;  3GBG A;  4RM3 A;  4CCJ A;  3SZG A;  3PNY A;  5FRO A;  4B47 A;  3OYB A;  3ZCO A;  2F4I A;  1Z7L A;  4HST A;  2V6E A;  4FET A;  3DWL E;  3K4M A;  4CCO A;  4HEA 2;  4ZTJ A;  4DIQ A;  4E7J A;  5LFA A;  3LMM A;  2BW3 A;  3AL0 C;  4BS9 A;  4XKW A;  2E5N A;  3AFH A;  4F55 A;  2HNH A;  4AVZ A;  1BR2 A;  4F92 B;  1AA7 A;  3OR2 C;  2W00 A;  2FUG 2;  1QHH D;  4HRI A;  3A1Y A;  4XKB A;  4LG3 A;  4XOT A;  2MC4 A;  3V42 A;  4F93 B;  2VJJ A;  4XM3 A;  1T0F C;  2RRE A;  4F3Q A;  2IGK A;  4R79 A;  4RMN A;  3W2W A;  4C9Y A;  3CES A;  3OIQ A;  4B43 A;  1DQU A;  3OOU A;  4DBQ A;  1X1B A;  2R4G A;  2ZSI B;  1G59 A;  3VYR B;  2UUZ A;  3HG9 A;  4XQF A;  4CUG A;  4PK4 A;  2VQH A;  2F5V A;  3BG6 A;  4XKV A;  2LBF B;  2LY2 A;  2M4K A;  3CJR B;  2BVL A;  2CUZ A;  2Z2S B;  3SYT A;  3VYT B;  3K70 D;  1W36 D;  2W82 A;  3L2U A;  4E7K A;  2X1C A;  1WJA A;  4HNT A;  1MND A;  3DTK A;  3PUB A;  2WAF A;  1IRX A;  2VJ5 A;  3M1C A;  1V5E A;  2LOO A;  2VKH A;  3DU6 A;  4YEL A;  4N4O B;  1BR1 A;  4BXF A;  2RQQ A;  2R7O A;  2VXZ A;  3UR3 C;  2IGM A;  2LBF A;  3QYB A;  4ZDP A;  2E5Z A;  1HA8 A;  2A5W A;  3RCO A;  4C30 A;  3OYI A;  2WY8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...