4J01A

Crystal structure of fischerella transcription factor hetr complexed with 29mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 62
structure length 294
sequence length 294
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A02
4J00A 4HRIA 4J01A 4IZZA 4YRVA 3QOEA 3QODA
chains in the Genus database with same CATH superfamily
2Y9ZA 2VBWA 2F6CA 1MMNA 1ETQA 2HTSA 4LIUA 3KCCA 1R71A 1JT0A 2KDZA 4I6ZA 3C1DA 3KYLA 2OC6A 5HOOA 3HOTA 3BZ6A 4AYBA 4OMZA 3MKLA 3BG9A 2XAHA 1J2XA 5E18F 4GGGA 4BAYA 2BHZA 2UXXA 2M34A 3R60A 4A5NA 2LD5A 5CYVA 1IDZA 4AYBN 3KX2A 4ZDPA 2XAUA 4PCQA 1B8IA 4PUSA 3P9CA 3F23A 5DDGA 2BGCA 3S17J 4BKXA 1P4AA 4TV7A 3FXLA 4LJZF 3S1NJ 3EUHA 4G8XA 4LLGF 2ZJ2A 1GUUA 2IGMA 2DT5A 2FXAA 1A36A 2CQNA 1SFXA 1SMYF 4MIMA 1FMWA 3J7AO 4HDVA 5J1UA 1W7PB 5B5EC 3AL0C 4NHJA 2KL4A 5CVIA 2J5OA 2MH9A 2UXNA 4G7OF 2CWEA 3CDIA 1K79A 3IRRA 1GXPA 4GYIA 3OYHA 1P7JA 5JLWA 1XC5A 5D6FA 1ZRFA 1BA5A 3MN2A 4M73A 2E71A 4HQMA 3E6DA 4AIKA 2JUCA 4M6YA 1T0FC 3IUOA 4JX4A 4XKWA 2M8GX 2KIUA 1ZR2A 4ENNA 3LSGA 4O5VA 2LP0A 2X85A 3W3CA 3ZQGA 3U1DA 1XTAA 2DA7A 2A61A 4II3A 4UB8C 2RGVA 2XHKA 2JUGA 3KIOA 1JHHA 2A6EF 3JREA 2CGPA 4BE2A 1BN5A 1NG7A 3QWLA 5FO5A 4I0BA 5CQGA 2ZMEC 3H9QA 5H6RA 3VODA 3GX4X 4HA8A 3LOCA 4CCOA 5J8FA 2MC3A 2X9DA 1Y56A 4AVZA 4M3DA 5FKOA 4G6QA 1UCRA 4NC6A 5D5UB 2FQ3A 5K1YA 3HHHA 4HBLA 5BS6A 4B4CA 3Q5FA 4L9TA 5JHFA 2MG4A 3TBIA 3G4SI 3LNQA 3AL0B 2W1OA 2M4GA 2WAQA 4DBQA 4XONA 2MYSA 1RR7A 2TDXA 4YFXF 3FZVA 2RNJA 2K9MA 9ANTA 2WAQN 4FCYA 1J75A 1SD7A 1Z67A 4RS8A 1I1SA 5FGMA 3C2BA 2QQAA 2LBFA 3FHZA 1B8IB 1IXRC 1BI2A 3FX3A 3HIFA 1K6OA 1IN8A 1GXQA 4RLQA 3DXJF 2VJ5A 3MVPA 3ZQHA 2I5UA 5BPIA 1EH7A 2DA2A 4G9YA 2BVLA 1SC7A 3LA3A 3RYRA 4KYWA 4CGZA 3EUKL 2V9PA 1T33A 5GTIC 2RC4A 5DYMA 1R5ID 3G2BA 3H3UA 3HOSA 4XICA 3F6VA 3QPTA 3TL4X 2PLYA 2I8DA 3DV8A 5FB2A 1XMAA 4E7LA 1SD4A 1MMSA 4RAGA 3K0LA 1JUPA 1ENHA 5IYBJ 1OCRH 2FNAA 4CA0A 2XUBA 2KFDA 3W6KB 2O0YA 3OYDA 1X1BA 2ME6A 4EM2A 2H8RA 4I01A 3IL2A 1FLIA 3ELKA 1JJ6C 2LLKA 3R4KA 2Z1DA 3ZMDA 2K27A 3IH4A 2OJED 3QU6A 1HCRA 1WQ2A 1Y0NA 2GOXB 2NVQJ 3FXMA 4JBAA 2R5ZA 1YIJI 2E36A 5EJCA 1P7IA 3AG4H 2DOAA 2GAUA 3GFJA 5AONA 4ZYDA 3QPLA 1I5ZA 2DJIA 2OF7A 4NB5A 2AS5F 4XKBA 1FIPA 2Q2EA 3BG5A 5E20A 1XSDA 3HBLA 4Y52J 2OU2A 4NBQA 4XRSA 4L5EA 5KAIC 3ZMUA 5JVGF 2K9SA 2KZVA 3H92A 2R5YA 4KNYA 2E19A 5E1WA 1LB2A 5J4VA 2IGKA 1UAAA 3I4PA 4KN7X 5LEJA 4EM0B 3OS0A 2V6CA 4A2UA 5ILUA 1TWGJ 4HZFA 3S32A 1QZYA 1P92A 2HVSA 1WJDA 2FSWA 2QA4I 1USSA 4FHTA 4QPOA 4YIFA 1WH5A 1TQIA 4UVCA 2PJRA 2M30A 1CF7A 1SANA 3Q9SA 4BQAA 4HV6A 3ECHA 3F9KA 3IC7A 3SFIA 2ZSIB 3ZQCA 1OQYA 2GIVA 3FM5A 5J47A 2UZKA 4CCJA 3OYAA 1OMIA 4XLPF 4Y33A 4MGRA 2YPRA 3IAM2 1BR1A 1PP7U 4M9SA 2QZ8A 4L18B 2AO9A 2P8TA 1LPQA 3DBHB 1RKTA 2A6TA 4MFEA 1X3WB 4D0PA 2VB6A 2GLOA 4PFOA 1KGSA 1LDJA 4IXAA 3BTIA 3E6BA 3GTOJ 2WY7Q 3FHNA 1QBJA 3B6AA 2LC2A 5IOYA 3Q3SA 2QVOA 1N77A 3M8JA 1S7OA 4KICA 3RIRA 4YIRX 3WTVC 3OR2C 2HVQA 1IDYA 4F92B 1M1EB 1LVKA 1XCVA 3O3KA 5FLVA 4DZJA 1VQ6I 1EF4A 1J0RA 2HYGD 2L0KA 4AWXB 3HTSB 2F2EA 3HG9A 3LA7A 3HRUA 1DDNA 1BBYA 4IHTA 2XGDA 4GCVA 5HS7A 2ELKA 1ORKA 1YI2I 2L9NA 3FKIJ 1ZG5A 2BY3A 4HW0A 3CCQI 1YYVA 2A5YB 3OSFA 1LKXA 4WF2A 2L7MP 1W5TA 2VBZA 3E6CC 2HZTA 3H3VK 1XD7A 3KEQA 3CCYA 1UELB 2CUJA 2LREA 3KP7A 1B1BA 2LRDA 5DS9A 4OOIA 3FIWA 4BBRJ 4EEFG 3ZR8X 3GO5A 1QPIA 3GYHX 5HLGA 2MH2A 4UUTA 1UZCA 3OYIA 2XPUA 3SFZA 4EGYA 1JTYA 2AXTC 2WV1A 1VQNI 1ETXA 1W36C 3B73A 1I6HJ 3DU5A 2EZIA 5LGNA 1B9MA 3WTTC 3ZMSA 2F48A 2FNPA 1K4SA 2JTVA 1SD6A 5HS9A 2PJRB 2Y69H 2MABA 1CF7B 3VYSB 5JVTA 1X1DA 4RBOA 1NG6A 1ZYRF 1B72B 1LNWA 3QP6A 3SZTA 2E60A 1D1CA 4IX7A 1JUMA 1QGPA 2R92J 4Y7NJ 1Z05A 4ZTJA 2H1LA 5FJ8J 4UV8A 2DXIA 2GA1A 2OPTA 2FOKA 1USTA 3LSMA 4FT8A 4BXUA 3LSRA 2V1UA 2IGOA 4XIDA 1W1WE 1ZG3A 3GBGA 4LG0B 4L9VA 4JK1X 1U2WA 1RZ4A 2NAZA 2IS6A 1EKEA 1BW6A 1JTXA 3FXOA 5F1JA 1RIOH 1GVDA 1RRJA 3S93A 2JK3A 1SVMA 3S15J 3K4KA 4IF4A 3OSGA 1TQPA 3ZMTA 2OUMA 1D8JA 4UVAA 5EF6A 2XVCA 3I59B 3CMAI 1KQ9A 4KT5C 2YX4A 3VYUB 1WRJA 3MKWB 3L9FA 4YFKF 3M1CA 4F55A 2LY1A 2FEZA 3DCFA 4PJJA 3IAS2 3VSLA 4Q4ZF 5A2QZ 3PM1A 2F5CA 1OCCH 2Y0SA 2HYJA 2NRAC 1P2FA 1Y8QB 3FXRA 1N78A 2VOOA 2KP6A 1VQ8I 1MDMA 3WU0A 1Z3XA 3V4GA 1VQKI 4IKFA 1MNDA 2ECBA 3JR9A 1X4PA 4LLNA 5IP7J 4ESJA 1MJBA 1JKRC 4YG2F 4KIGA 1XDUA 3NQOA 1Z7LA 2G7UA 4NC7A 5EG0B 3I4MJ 2M5WA 1Y39A 4BJTA 1UHWA 1ZTRA 3S2DJ 3WHCA 4F3QA 4Y15A 1TWCJ 2YU3A 1FX7A 2FX0A 2P5KA 3QU3A 2ESHA 2LK2A 3ZQLA 2IS1A 4B48A 2EILH 1RKWA 1FP2A 1YS7A 3FK7A 3IWZA 5IT3A 3J80K 2R7ZJ 3PO2J 4CICA 1MIJA 2K9NA 3PFYA 4UXNA 2KRCA 1TTYA 2DO7A 4ITVA 2UV1A 4IPAA 5IOZA 1G3SA 3BTJA 1ETOA 5E3MA 3DPUA 2W85A 5IT9Z 2DMPA 4A6EA 5F1RA 2IA2A 1W0UA 3GXOA 3SHFA 2CUZA 5CQEA 1FP1D 2L4AA 5DCFA 1IC8A 4ZZDA 3J81K 1K6YA 5B1BH 3RJPA 3JSPA 3K4JA 2IS2A 1FT9A 3CLQA 3HJEA 2OZUA 2CV0A 2ZXJA 4BY7J 3FM3A 2DFIA 4AM3A 3VEPA 4MHGA 1XPXA 4BQQA 1FY7A 4EJUA 3HUGA 1I50J 2DN0A 3CF2A 3CESA 4M9ZA 5HDGA 4HNVA 3HRTA 2LY2A 4UUVA 2D2WA 4BQNA 2GXAA 3LMMA 2VE9A 1IGNA 2L02A 5LRRA 2EV6A 4KFCA 2HPIA 5D4RA 1EV7A 2K4BA 2FBIA 5E79C 1Z0XA 1FMVA 3DBLB 2PMZA 3A01A 1NK3P 1MDMB 3PL8A 5ICGA 5ED4A 4A3MJ 2A69F 5AIPA 5M5YJ 4CH7A 1IXSB 4Z6YA 2HU9A 4FTHA 2KQRA 3ONQA 2HOEA 1Q1VA 1Z21A 4P9FA 3ZCOA 2M8EA 2G7HA 5DTDA 1ZH5A 1HDPA 4ENKA 1AHDP 3EDPA 3AFHA 2COBA 2RKHA 4UHTA 3L2RA 1ETYA 2FF4A 2WV0A 2VI6A 3C2HA 3VOEA 2E7WA 3I53A 3UKGA 1ZK8A 2K3FA 1G59A 2J5PA 1GHCA 2E2JJ 1WJCA 2X1CA 4HX8A 4A0YA 1Z6RA 3JSOA 1D0XA 1ZGJA 3GW2A 1D5YA 1D1AA 2G0EA 5JI6A 3PIOF 2DU9A 2H6BA 4A6DA 2VQCA 4UB6C 2KRFA 3BR5A 1WFXA 1E17A 5GPCA 4XKCA 2ME0A 3ZXSA 5F27A 3OYCA 2BBYA 4KDPA 2W25A 1XX5A 3QPSA 3HOVJ 2BY0A 3HOXJ 4ON0A 3QYFA 1FSEA 4Z2YA 2F5VA 3WGGA 4M71A 3ABMH 1JUSA 1U5TC 1IUFA 3TP3A 5D6EA 3ZGKA 4RDUA 3KZIC 2EFNA 3BT9A 3PNYA 2DFHA 1FZPB 3NRVA 1WZ2A 5FKKA 3H5RA 4DBRA 4GO1A 3ZQQA 2DT7B 2XRLA 1MBEA 2CH0A 1BR2A 5FFXA 3E3VA 1HSJA 3WG9A 3CJQB 4PK4A 3KP2A 2DCEA 3HUGB 5FKNA 4G7HF 1W0TA 4YELA 4NC8A 4BJ5C 4CZCA 4L5JA 3LSHA 2DTRA 3M4OJ 1E3PA 3E1SA 2GXBA 3QYEA 1AA7A 1MGTA 2RDPA 3RDIA 3LAPA 4A0XA 5J3LA 2HFHA 4IQJA 2DI3A 4HF1A 3WE3A 3HHGA 3A01B 1HKQA 2MD0A 2BHYA 4U87A 2IT0A 3S1QJ 3C18A 3FXJA 2AQEA 4W1UA 2ZKZA 2F4IA 4XLAA 1AKHA 3FISA 3L09A 3SQNA 2B7EA 2R7WA 1MW7A 1POGA 2JWTA 2VQGA 2K9LA 1FJLA 2DA3A 1LEAA 2XV4S 3KP4A 2MFZA 3MWMA 5IP9J 4ETSA 2XAQA 4AD9A 1RESA 1IN7A 5EEAA 5B3SH 4EJTA 1EA3A 3HRSA 1F5TA 2M7BA 1OR7C 2CUFA 4LGWA 4PJMA 2L5QA 1PUFA 1QA6A 3PJRA 1ONVA 3IP4B 5LD2C 1R4NB 1S5LC 3V8KA 4BL0B 4A12A 3CDHA 5FLXK 5M3FJ 1UHMA 4B09A 4A5MA 5HLHA 4MNUA 4CCNA 3S16J 3BZCA 3K4NA 4XRFA 2VPLA 1LDDA 2QSFX 3QQAA 2B0LA 1B59A 2CS3A 2JSCA 5F08A 4UNOA 3RPQA 2D1HA 5DM7F 4P5OA 5A2QK 5HS8A 3GZ6A 1UFMA 4RLFA 4NUBA 5GAHJ 2E1MB 4KISA 5J1RA 1QRYA 3PQKA 2VC0A 2R7QA 4HLXA 5CJ9A 3KLOA 4RAYA 2QENA 4A3FJ 3DFGA 1W5SA 3NWSA 3BOQA 1VF9A 3I55I 2V7FA 1R1TA 3OMYA 5E3OA 2K40A 3CCRI 3JRDA 2VXZA 3HM5A 1BOBA 3N05A 2XDVA 1WKMA 2DQLA 3FMSA 1XGNA 1YX3A 5KVRA 2KJCA 1FYKA 1YS6A 2ID3A 2KJBA 5IYDJ 1FBSA 3CCSI 2BW3A 3W6JB 3O8GA 3HSFA 2DA1A 1OLTA 3MMYB 3ZMZA 1Z77A 1LVAA 1Z91A 1C0WA 2FUG2 1IRFA 2BE5F 2DMTA 4I98B 4M3BA 1DPRA 5TISC 4PFPA 2FU4A 4HX4A 1ZARA 4CUGA 4PJNA 4IHXA 2PFBA 1QHGA 2HGCA 1WJEA 3A2KA 3OS1A 3BCAA 5LFAA 3AAFA 1Z6TA 1B6AA 3F8MA 4HV5A 4X0GA 1AKHB 3DF8A 3HC7A 1G3TA 2DA5A 4F93B 1ZLJA 4KN4X 2MD5A 3L7WA 4DYCA 3PO3J 5IT9K 3ZN1A 3PNVA 5E17F 3TGNA 4ZZLA 3K2ZA 3JRGA 5HNFA 3JRHA 1FOXA 2ISYA 1OCTC 4I76A 2EFOA 2F5FA 4EJOA 2FE3A 3FWEA 3EUHC 5F0CA 2QCOA 3RKQA 3A02A 2PBIA 1PUFB 2W84A 3MAJA 3P5JA 1OCOH 2HOAA 3OYBA 2VE8A 3W2AA 1T2KA 3QPHA 3GMEA 4WXHA 5C4XJ 4I2OA 1FOWA 2CU7A 3LQQA 1IZ1A 2K5CA 3K4LA 2EIMH 3QAHA 3C3WA 2R5ZB 1QVTA 2PQ8A 2Y75A 1FIAA 4I99C 2HPMA 2IRFG 3JRBA 1JJ8C 4PJLA 2G9WA 1J7KA 4EVIA 2BXZA 3BR1A 3JRFA 3OYLA 3A4CA 2HYFA 2W00A 4BNCA 1D0ZA 4XN0A 5LEKA 1QVUA 2R7RA 2ZBKA 4B3XA 1G3WA 4E70A 2BV6A 3RQ4A 4AIDA 3KLNA 3IHUA 4DW6A 3VWBA 1TWFJ 1R23A 2OD5A 4XORA 3FF5A 4ESFA 1O57A 3HRMA 2IEKA 3S8PA 1YG2A 2BW3B 4YIIA 3RKXA 1YOVB 5L3BA 2H09A 1MJ9A 4L0ZB 3CDLA 3PQJA 3M8EA 2IPQX 3LSJA 3BDDA 3P9KA 1I3AA 3H0DA 1A6QA 1VQOI 3CQZJ 3BY6A 3GVAA 1ZQ3P 2E7XA 3R61A 4A3BJ 1FYMA 4HF0A 3N4MA 1EH8A 5BQTA 3J80Z 3VYTB 4E4HA 1JHFA 4KMFA 2DYSH 2OZ6A 4RGRA 4U0VA 2CJJA 1VNDA 1R9TJ 4IZZA 3FXUA 5GAGJ 1Z9CA 3RYPA 1ERDA 3U9GA 3MCZA 2C6YA 4BXFA 2Z16A 4D9JA 2TRTA 2ZXHA 1HKSA 2KIFA 4HEA2 1NHAA 2STTA 2V1XA 2DMQA 3S2HJ 4KIBA 3BG6A 5ICCA 5BOXA 3AG3H 3T5XA 1MJAA 1Z1DA 1EH6A 3WTWC 3J81Z 3JCUC 2BY2A 2QYOA 3ESWB 2A07F 1H88C 3F0CA 3V8JA 4GXOA 4A93J 4J01A 4B43A 3UR3C 2ZNZA 2XGCA 4EMSA 4YFNF 1H8AC 1LDKB 4IL6C 3E5UA 4IRIA 3JAMK 3NEUA 4JQFA 4F7ZA 4FX0A 2PEXA 2VLAA 2O6GE 2COMA 2DA4A 5H20A 1IJWC 4JYKA 3OYMA 1R49A 1A35A 2AHQA 2YUSA 4OWRB 3K70C 2H8WA 4LIVA 2LBFB 1S29A 3QODA 3RSNA 1OISA 4HSRA 4G6DA 3HSEA 2WTEA 2MLKA 2O61A 1JT6A 5L3FA 2H6CA 3CCEI 2DTZA 4OIOF 1LUJB 3K4MA 4BXXJ 2UUZA 1UB9A 3MKYB 2BYVE 2Q1ZB 1MNEA 1P9QC 1FYLA 1W4MA 1JGSA 1F4KA 2EBIA 1HDDC 4I0AA 2HKOA 2EZLA 2DPUA 2Z5UA 3KEYA 3PNTA 5J8CA 2QEXI 4ZDOA 1IRZA 3FBNB 3TOAA 2YU9J 2H1KA 2O8KA 3SEZA 1QO0D 4OAZA 3Q0UA 1I3QJ 3UNGC 2XAJA 2PJPA 1KYWA 3CJRB 2RREA 5J4YA 1DUXC 4HDUA 4BY1J 3TKYA 1MBKA 4GFBA 3TP0A 4IOCF 3BTLA 5FD6A 4E7SA 3HOYJ 2DYRH 1UG2A 2GIZA 3I54A 1K78A 3D5RC 4A3GJ 1FNNA 4Q5SF 4BQOA 2Q2EB 1OCZH 1V4RA 2V9VA 1G2HA 3HTUA 4UV9A 2QKMB 4ZTFA 1YJNI 4PGHA 3GLXA 1WJAA 3BTCA 1P4WA 1AOYA 2BVMA 1BJZA 1HW5A 1U9NA 5DUKA 2R5YB 1KU2A 2OV7A 5B66C 3L2UA 5TGTA 3A0BC 3O8HA 2IA0A 2E1NA 1RETA 3WTUC 4G94A 2EV0A 2LKSA 2EA4A 1SMTA 3V7SA 1TW3A 2DLLA 4G6TB 4UVBA 1MMGA 2HVRA 5L3GA 5D5XB 5CLSA 3GUDA 5LGTA 4LOCA 1WWXA 3CD6I 1ACIA 3K10A 4RAZA 2P4WA 2QGUA 1WGXA 1MD0A 1UHSA 1R22A 5H6QA 4A3IJ 2RNGA 2W4SA 3F6OA 4RMNA 4RB0A 2YR2A 5HDNA 5E1ZB 4ABZA 1VTNC 1YTYA 4Y3OA 5DD4A 2KMUA 3ABLH 1O3QA 4XN3A 1HF0A 2V26A 1T39A 1ETVA 3GCMA 3ASNH 4HRIA 2D1VA 2X4HA 2EPFA 5DD8A 3ABTA 2PI0A 2VJ4A 3OWTA 3R0JA 2LR8A 4M6VA 3WTZA 3NWTA 2DDAA 4XM3A 1OCPA 5F6FA 1YO5C 1ITYA 4KIFA 4BDYA 3LAJA 3ABKH 1F1ZA 3K1NA 5DM6F 2GBYA 5EEGA 2R3SA 5FLXZ 2CFOA 3OR1C 1O3SA 3I58A 3G73A 1T8IA 2VUMJ 2CFXA 1PJRA 3DKYA 4BHCA 4U7DA 1L0OC 1YW9A 5HNHA 5M5WJ 1BI3A 3S1MJ 3H5NA 2VT2A 1SD5A 2EINH 4PJ0C 3HGGA 4D5FA 4XQFA 2OBPA 1W36D 2DT6A 4RM2A 1FWZA 1OYIA 5FKLA 5KCMA 4RA2A 5D8KB 4UUSA 1X1CA 4RB1A 4YRVA 4L9NA 2Y0SN 3F8NA 4E7KA 2B63J 3ABUA 3IH2A 4KA4A 1P4XA 5F0HA 2XPWA 4Q48A 5BNGA 4P55A 1OFCX 4G7ZF 3FKJA 3HPGA 4HYEA 2EJRA 5ILSA 5M5XJ 2MA3A 1HBXG 2ZFWA 1YQAA 1XN7A 3JRCA 1HLVA 3B02A 4E7IA 4FISA 1J09A 1GDTA 2OTLI 5J1YA 3MZYA 5DUIA 3DPTA 1DQUA 3KYDB 2R7SA 1V55H 4BBSJ 1K83J 3E6MA 1BM9A 5J6XA 4V19K 1KZHA 1XSXA 2IP2A 3ZQ7A 1Y1VJ 4RB3C 1APLC 4A3KJ 2M0CA 3K2AA 4M3GA 1QZZA 3G71I 3RI4A 3GTMJ 2JRTA 3PFIA 1G4DA 1ZG1A 2BZTA 3GF2A 1G8XA 2A05A 2IW5A 3PSFA 5L3DA 4BHPA 3B6CA 3HOWJ 1B9NA 2EWNA 2VQHA 1DP7P 1WHUA 3HPHA 5TJJA 2HQ5A 1V5FA 4IJAA 2HEOA 2CQXA 2LVSA 4YEJA 2JMWA 1Z7UA 3TMOA 1EJ9A 2E5NA 3CP8A 1QQIA 4BEHA 2DOEA 3CCJI 3K6GA 5K7FA 2V6EA 2JA7J 4HSTA 2DFEA 1BL0A 3U2RA 1DGRM 1O7LA 4E7JA 3Q0WA 1PP8F 2M1BA 4ZYHA 5E1XA 3WU2C 2DAOA 1FPQA 2XGXA 2GQQA 2XIGA 3HEFA 4N4NB 4Q47A 1BR4A 2DODA 3SXYA 4D7NA 4OINF 5K5QA 4HQEA 4CCKA 2HDCA 2E34A 2I10A 3JW4A 2NVTJ 2LKPA 3H9GA 3CMMA 2HR3A 3R6SA 2VL8A 4CCMA 2R7VA 1BIAA 2A3SA 3P9IA 1X1AA 2CUEA 2MC4A 2JQ7A 2X6OA 2O8XA 3TOBA 2VC1A 4DJAA 2GXGA 3DKXA 3H0GJ 2XKOA 4UUSB 5CVUA 2P0WA 3HDDA 2JSPA 3KP5A 2HQRA 5LHGA 3HYIA 4C2TA 3H5AA 1IN5A 4I02A 5HLTA 3HXLA 2ELHA 2PMZN 4E6KG 2P7CB 1WH7A 1X1PA 4FETA 4C3HJ 4IVNA 1ZN2A 5D5VB 2F4OB 4U7BA 2FJ1A 2V4JC 4M3FA 4DYQA 2Z3YA 1T56A 1ZGWA 3L2QA 3HOUJ 2Y2ZA 3LQRA 3RQIA 5K7HA 2KT0A 3FMRA 4MEYF 2V79A 2RN7A 1P6RA 1R4MB 3KE2A 1Z3YA 1A5JA 4MO7A 4RGSA 3J7ZI 1X3UA 3QOPA 2XSDC 2YSRA 1HOMA 4C30A 3DTKA 4NDLA 4LG3A 2JRMA 1ODDA 1TWHJ 1YLFA 4PSWA 3U21A 5FROA 3HZJA 2QLZA 3T1BA 3GTPJ 3DWLE 5HDKA 1R5GA 3OIQA 1XMXA 4DIQA 4N4OB 3F22A 1MBFA 4CYCA 2MBFA 2XF5A 2GA2A 4AUXA 1WJ5A 3I4NJ 2VODA 2ECCA 1N75A 1QNTA 2CQQA 1IAWA 2OCCH 4HG2A 5KK1A 4QIWN 4N9IA 1KA8A 1XMKA 2NS8A 1R5HA 3F3XA 1D1BA 5JR3A 4DYRA 4BEHB 3HKZA 3LFUA 2X51A 2VASA 1X19A 2PMHA 4EM1A 4MFDA 3OYFA 3GFMA 5FD5A 3R0AA 3HOZJ 1SEUA 4HOBA 2P6SA 4LB5A 3DEUA 1KQ8A 3F8FA 2YX7A 3E7LA 2VQLA 3KP3A 1TQMA 1WVRA 3DLAA 3I64A 4A3JJ 2X6YA 2R7XA 5GPAA 4ZYAA 3CP2A 1U6GA 4Y17A 1MMDA 5AIQA 3JAMZ 2HXOA 1HSTA 4B8XA 2E1MC 2DMUA 3M07A 4OU0A 3SDBA 3ULQB 1IXCA 5K5RA 2H27A 1OKRA 3WGHA 4IQ4A 1MBJA 2R7OA 3VPRA 4WXCA 1KONA 3HSRA 4P96A 2W24A 3COAC 3CCMI 3I3LA 3GTLJ 2D5VA 3OOUA 5LHHA 5EDNA 3BQYA 1ULYA 4EJVA 4L9JA 2ZSHB 3BZKA 1VQ5I 1T98A 3K69A 2HQAA 3MQ0A 3W6VA 2IS4A 1TZLA 5EYRA 1WPKA 3CUQA 2ADUA 2CO5A 3KFWX 2CRGA 4XLNF 3OYEA 1HW1A 3H36A 2QSHX 4P1WA 3SJMA 1FOKA 2KKOA 4BDZA 1SAUA 3GLLA 5CVJA 1LE8A 4D7MA 5HLIA 2VT3A 2VJJA 5CKTA 4ZH4F 2HS5A 1Y1WJ 1ETKA 3D1NI 3VFZA 3DTEA 3LA2A 2EFPA 2OQGA 2EH3A 4LK1F 1DGWY 2ZC2A 1T08B 2R0QC 4MLOA 3FXQA 1IN6A 1BI0A 2PMUA 3RPUA 3OYKA 4LB6B 3NAUA 3WE2A 3ZQIA 4CYCB 2PX9A 2JJ7A 2VKDA 5JLXA 5E3LA 1IV8A 3BCBA 4FQGA 2CQKA 3L2WA 1U3EM 2R7FA 5GTHC 4D5CA 4H4KC 4HF2A 3EUAA 4AVPA 2NVXJ 2K3PA 2XB5A 4BUPA 1JKOC 2Y31A 4JP0A 2RQQA 1RI7A 3WG7H 3CCUI 2K7LA 2OAZA 5EEHA 1V5GA 3TO6A 3OYJA 1MH4A 3HL2A 5GAEJ 3TO9A 2LG4A 4CYDA 1DPUA 2FBKA 1QU3A 3F8CA 1WI9A 3TO7A 1KU9A 1YX5A 3JTHA 4S0HB 3D0SA 3KEOA 3QRFF 4CCLA 1CQTA 2JVGA 1G6NA 3EYIA 3TDUC 2JA2A 1DU0A 1STZA 4BE1A 1FBQA 1MMAA 3DKWA 4B47A 4E7ZA 3A1YA 3S3MA 1MSFC 3BR0A 1T0FA 3ML6A 4PDKA 1YIOA 3TW7A 2JPBA 1FSHA 2XPVA 2X48A 1HA8A 2VOPA 5LRSA 1YFHA 3ZQFA 4BYYA 3A0HC 3CLOA 2KDOA 4EV0A 1LJ9A 1DP3A 1X2MA 1T95A 2DOFA 4C3JJ 3FXKA 2KZGA 5D5WB 4I7HA 1W7PD 1BOAA 3IKTA 3PIPF 3TEDA 3MEXA 2DJNA 3F8BA 4HNUA 2ACJA 1RNLA 2UWMA 3FK6A 2ZMEA 2LY9A 5IYCJ 1ZKGA 2WWYA 3F21A 2WADA 3T8RA 3M3YJ 5C4JJ 3IKVA 1FOYA 3CUQB 1U8BA 1V54H 2WAFA 3WHBA 4GRIA 3G1OA 2K85A 2CW7A 3G1LA 3V7CA 5BPDA 1LE8B 3GTGJ 4JX5A 3VB2A 1FBUA 1YJWI 4PZJA 2E5ZA 3I56I 4DZPA 1VQ7I 2X6XA 3G1MA 3I71A 2BOLA 4LITA 3RPUD 1ZLKA 1U9OA 2V1NA 5TRDA 1R58A 3L00A 4LFUA 4QWQA 5E8GA 2QF7A 3W2VA 1AU7A 3DEEA 3BJAA 4XSZF 3G6EI 4JOMA 1R36A 2E1OA 5B1AH 2IA1A 3M9AA 3BROA 3OIPA 1GT0C 1BC7C 3LSTA 2XGEA 1IG7A 2EB7A 4OMYA 2HOSA 1HKTA 1LFPA 3H3ZA 5LLQA 2HNHA 3HGYA 5HVQC 4IHWA 4QSHA 4ESBA 4M3EA 1WJFA 3C2GA 1XG1A 2IAIA 5J40A 4RAFA 3WTXC 5F0FA 4WWCA 4A3CJ 3DBRB 2BXYA 2VPRA 3DQVC 1BI1A 2OA4A 2L54A 1YITI 5DEQA 2VXDA 1PDNC 2OCEA 3W2WA 4ENMA 1U78A 2ZNYA 2HXIA 2EQRA 3CO6C 5IY5H 2P7VB 4IRHA 2WY8Q 2P6TA 4DOZA 1F9NA 1XDSA 2FA5A 4WCGA 1JKPC 2NS0A 4DGWB 3GTJJ 3LSPA 2HOTA 2LYCA 3U1KA 1REPC 2QSGX 5C44J 1NTCA 2ZJPF 2F5DA 3E0JB 3DP7A 1O3RA 1S8NA 2ZMEB 2AQFA 2KHMA 1KYZA 1SAXA 3ISPA 3BPXA 2Q8KA 3TDZC 1HC8A 1A04A 4EJWA 4WX9A 3GFIA 2K4JA 1OYYA 1K7AA 1E3HA 6PAXA 2XAGA 1TT5B 2HI3A 1VQ9I 2VKVA 1J9IA 3RKWA 3OYGA 3BJOA 3GZ5A 5EZGA 2O03A 4A3EJ 5JFRA 5EGOA 1V3FA 1H0MA 1PUEE 2ZFUA 4AIHA 4C2UA 3PSIA 2DPDA 2ZJRF 1LFUP 3ZN0A 1KQ0A 1TNTA 2W48A 2Y48A 4CZZA 1VQLI 2FBHA 2AXLA 3G3ZA 4RM3A 3EQLF 2RAEA 4LMYA 4KMUX 2VBYA 3I9V2 1XCBA 3M8FA 1TP4A 3V8LA 4WK8F 4QPQA 4NNJA 2CYYA 3CTAA 1YRNA 3H35A 3P7NA 1L3LA 2FOWA 1B4AA 3CC2I 2V9KA 2N8GA 2NNYA 2IVMA 1MBHA 4IO9F 3GTQJ 4IHSA 2LNBA 1CGPA 4FE7A 3PUBA 1Y8RB 1RUOA 1PYVA 1I1GA 1T6SA 2NS7A 5E8IA 2ZXWH 1MZBA 1MKMA 3MZHA 4IOAF 3IV5A 2OQRA 2GZWA 3GWZA 1FTZA 2M45A 4FX4A 2RVCA 4LD5A 3EYYA 1O3TA 2MW8A 4MTEA 1GV2A 2LH9A 1B72A 4ZDLA 2Y30A 3K9TA 1LEBA 2K9QA 2XC7A 4AC0A 3CC7I 2GOMA 1JI8A 2QM3A 2OTJI 1FTTA 1O7FA 1KU7A 3MZ8A 3OS2A 3KZYA 3WGIA 1J59A 2A68F 4V2GA 4XRMA 3EPZA 3CCVI 1X3ZB 5L3CA 5BMZA 4LG0A 2QQBA 1RUNA 2KLOA 2CMPA 3E5QA 3FMQA 2W7NA 1XGOA 3GZNB 2L3DA 3I0TA 2D45A 1UMQA 3Q0VA 1JGGA 3QP5A 2VIXA 3T8TA 2F4MB 3CF5F 2M87A 2FRHA 2A5WA 3S3OA 1X2NA 5LBQA 1OJLA 3I59A 3RZDJ 3CCLI 2ZO4A 3GTKJ 1TT0A 4FASD 3D5LA 2LF8A 2LDUA 4M9XA 5EGOB 1LFBA 2W82A 3PUFA 1Q1HA 4AU7A 5FLMJ 1IUYA 3K70D 2M3AA 2XASA 2L9SA 4U0YA 4PGGA 2LF7A 4O6JA 2CW0F 3I5UA 1HW2A 3EETA 1A6IA 1R1UA 1VFCA 1SVLA 4ANJA 3O2PE 4KITB 4OAYA 1MNMC 1IN4A 4J19A 3BG3A 3RCOA 3IRQA 2EK5A 5KAFC 3J7AY 4CO8A 1TL8A 1G3YA 4XL9A 1GLNA 2EA2A 5FKMA 4CSWA 4N0BA 4E7HA 1YRNB 2ICWG 2STWA 1YW8A 3K7AJ 3RZOJ 3MFKA 1SFEA 1HXDA 2RQPA 4ASNA 3OYNA 2HWVA 4FE4A 5EG0A 4LLLA 5C3EJ 4IHVA 4A3LJ 2L7KA 1MSEC 4ZYEA 3TQNA 3BC8A 1AWCA 2XAFA 4ZJZA 1I39A 2X0LA 5CVRA 2P5VA 2VKEA 4MQVA 4ENJA 2H94A 2B9SA 2ZXIA 1K4TA 2LOOA 3BG7A 4CXFA 2GM4A 1FC3A 5D8LB 2NVUB 1YE9A 1GV5A 2EIJH 3V42A 1S7AA 2BY1A 3F72A 1R00A 3ERMA 2KIMA 5GP9A 2L7FP 3DLLF 3OY9A 1IRXA 1VI0A 4KT6A 2ID6A 2NYXA 5CPRB 4XRSG 3S1RJ 4BS9A 2Y9YA 4QLCU 5DV5A 4HAMA 2EIKH 2M9HA 1TWAJ 2FMLA 3K1PA 4XMYA 1O4XA 2JPCA 2CW8A 2L2OA 1YW7A 2ESNA 3BP8A 3D5SC 4RGXA 1QZEA 3ECOA 4LK0F 4V2FA 2L9VA 5H2FC 4G12A 1K78B 3BPVA 2Y0MA 4S05A 1YHQI 3WU1B 2L4MA 3LSKA 3BLYA 1DU6A 4RB2C 1BC8C 3WTYC 3KETA 2TCTA 3NARA 1SFOJ 1XS9A 2Z9OA 3CMYA 4U88A 3ZPLA 2FMYA 5IP6A 1Y0UA 3SZGA 2EFWA 2R7UA 1IF1A 2IXSA 4MQ9F 2IBDA 2E2HJ 2E35A 4XSXF 3VDXA 4XKVA 3CO7C 1IRGA 2X1DA 3AG1H 2CV2A 5IPAA 3SZPA 2DFFA 1NH3A 3SDGA 2KRHA 1SFKA 2Q0OA 1J5YA 3QOEA 4D1QA 1JXSA 1XB4A 2NVYJ 2NXNB 4C9YA 4IHYA 3CUOA 3IH3A 2QQ9A 2NNNA 1ZREA 2O3FA 4XBFA 1BIBA 4Y4RA 3MKZA 3BR2A 2QBYA 4EQQA 5ICFA 1UG0A 4EATA 3E5XA 4XLFA 1W5CC 1N25A 1ZRDA 2DK8A 2DQRA 5FRMA 5F04A 2YS9A 2HQNA 2QQ8A 2DBBA 2XKPA 2X1EA 2XF6A 1ON2A 2CQ7A 4A0ZA 2LMDA 4M6XA 2V1DA 2JA5J 2WA0A 4R79A 1X58A 3M7GA 3ZMVA 4N9HA 2HDWA 2XF7A 3S14J 2FQ4A 2R7DA 1ZGAA 4DNCA 5FRNA 4F91B 1XGSA 2KIQA 1QHHD 2NOGA 2A6HF 4XOPA 1UJ8A 3GEZA 4RGUA 1SFUA 1KU3A 3OV8A 3RTRA 2EFQA 1V5EA 4HX7A 2M4KA 2QWWA 2XROA 1E3OC 2BEOA 1XSVA 2MGQA 2RV8A 3CJTB 3DEWA 4NQWA 1VQPI 3WODF 3OIOA 3S3NA 2E2IJ 2IGNA 4IEJA 4XK4A 2DW4A 4K2EA 1ZR4A 1BJAA 4XLCA 1U8RA 2ZCWA 1TBXA 3JRAA 2JA6J 2GWRA 4WXDA 3TW6A 1VZ0A 1K61A 4C3IJ 4L5IA 2Z2SB 4Y13A 2W57A 3SEQA 3N97A 2O7OA 4ZYGA 2HTJA 1QPMA 4BGDA 1JKQC 5LHIA 3H9JA 3M1EA 3E97A 3K4BA 1HQCA 5E3NA 3O6BB 3A03A 3DTIA 3T0YA 3X2QH 1WCMJ 4R8HA 4ZC3A 2M7AA 4S04A 1X4OA 1ZAOA 4BH9A 4J00A 2K02A 4BHBA 2XRNA 3ZRGA 2P5LC 5KNLA 1TLHB 3DU6A 3ROUA 4C2MJ 1F36A 2M0MA 3BJ6A 4P9UA 3GFLA 2DDBA 3BQZA 3AG2H 2XB0X 2L9RA 3LL7A 2VONA 1S6LA 4BJ6C 5M3MJ 3J7YJ 1D5VA 2LKXA 5D4SA 1U5TA 3KP6A 1U0JA 2PG4A 2QBYB 4MTDA 1BW5A 2LTPA 5F64A 3WTSC 1SVOA 4XR6A 1D8KA 3ASOH 1WI3A 5GADJ 1VQ4I 4JX6A 4XLEA 3K1MA 2DK5A 5EZHA 2ETHA 1ZELA 3CC4I 2WB1A 4B3AA 4IRGA 4MEXF 5DCMA 3IWFA 5LGUA 2P81A 2VJIA 4M74A 3BR6A 1R6RA 4UY8I 2EZKA 1MH3A 2WB1N 3C7JA 3S2WA 5L3EA 2JT1A 2VBXA 4U0WA 4OIPF 1ZHFA 1A31A 4H0EA 3BR3A 2Z33A 2LSOA 2JVHA 2CG4A 2X6WA 2ZB9A 1FEXA 1WSUA 1IW7F 2XSJC 1OYWA 1D0YA 5K5OA 4X1EA 4KUMA 3L2CA 4B44A 1IV6A 1S72I 3JRIA 3HKZN 4NQWB 5KHDA 3KPHA 1I6XA 1OPCA 1TNSA 4I09A 4OIRF 3QYBA 4BU2A 4CDGA 3FDYA 2HDDA 4A3DJ 2MLGA 2R7TA 2QUFA 3BWGA 2ISZA 5ERIA 2IJLA 1MBGA 3VSKA 4HLYA 4B1RA 2KISA 2WAEA 2O9LA 1TC3C 2CV1A 3HB9A 2ZJQF 3MD2A 2WC2A 3CZ6A 1TW2A 1IO2A 4AIJA 5ILVA 1LQ1A 3ERED 2WBMA 5JHUA 4GDFA 1OR7A 1R1VA 1RC9A 4KJZA 1WJBA 2L7ZA 4BE0A 3V7RA 5FFZA 2DA6A 2M2EA 4X6AJ 3Q9VA 3ZOBA 2QKLB 4XLHA 3CJNA 2FD5A 3K4CA 1W7PA 3SYTA 4HNTA 2PN6A 3OL3A 2HKXA 1PVEA 2JZYA 1S3JA 1YJ9I 3DPLC 3RKYA 3JTGA 2F5EA 3KYCB 5HODA 2MSYA 3LSIA 3OOPA 3FBIB 3REOA 5K7ZA 5ICEA 1E2XA 1T38A 3LFKA 2KPMA 1JE8A 1XGMA 3VYRB 2Z99A 2NOJB 4EGZA 2K86A 1U5TB 1S7EA 3H1CA 4O3MA 1E0EA 3AKZA 1H89C 2DMNA 1ZRCA 4PSXA 3L2VA 4DQ2A 1NK2P 2R93J 4L0YB 1VQMI 2E1CA 3ZP5A 3KZZA 4XOTA 2CSOA 4QTRA 3CMEI 1H9GA 1RR8C 1ETWA 2ELJA 4XNFA 5CVVA 2EV5A 4II2A 1RPWA 1D3YA 5DCMB 1Y6IA 1R7JA 2VN2A 1I27A 4BACA 4R1HA 4OIQF 3LWFA 1H9TA 4A69C 2EZHA 4GYGA 2JA8J 3OL4A 2HZDA 4CHUA 2VKHA 2O5RA 1S9HA 4HPQA 1GVJA 3CUQC 2JN6A 2L01A 1F43A 1ON1A 4M72A 4W97A 2R4GA 3L1PA 4F52A 2LFBA
chains in the Genus database with same CATH topology
1FMVA 4Y3OA 2F6CA 1MMNA 2KMUA 2PMZA 4LIUA 4XN3A 2V26A 3PL8A 4CH7A 3OYGA 2HU9A 4HRIA 3KYLA 2OC6A 2KQRA 3ONQA 1Z21A 5HOOA 2VJ4A 3HOTA 3OWTA 4AYBA 3ZCOA 3NWTA 4XM3A 2ZFUA 3AFHA 3L2RA 4BDYA 4C2UA 3PSIA 3C2HA 3KX2A 4ZDPA 2XAUA 4PUSA 4RM3A 1G59A 1WJCA 3I9V2 2X1CA 2CFOA 4QPQA 3OR1C 4NNJA 1D0XA 3H35A 1D1AA 1PJRA 3DKYA 2IGMA 2VQCA 1WFXA 2V9KA 5HNHA 4XKCA 1FMWA 3ZXSA 3OYCA 3H5NA 3AL0C 4XQFA 2KL4A 1W36D 2DT6A 4RM2A 3QYFA 3PUBA 5KCMA 3OYHA 1X1CA 2F5VA 1PYVA 4YRVA 4E7KA 3ZGKA 1T0FC 3IUOA 3PNYA 4XKWA 3FKJA 3HPGA 3H5RA 3LSGA 4DBRA 3W3CA 2LH9A 2X85A 4ZDLA 3ZQQA 2DT7B 2XC7A 4II3A 2CH0A 2GOMA 1BR2A 2JUGA 1J09A 4E7IA 1JI8A 4BE2A 1NG7A 3CJQB 4PK4A 2DCEA 3HUGB 3DPTA 1DQUA 5CQGA 3OS2A 2R7SA 3H9QA 4YELA 4NC8A 4BJ5C 4CCOA 3EPZA 4CZCA 1Y56A 3LSHA 4AVZA 3E1SA 3QYEA 1AA7A 2KLOA 2CMPA 2W7NA 4IQJA 1G8XA 2VIXA 3PSFA 5JHFA 3TBIA 2MD0A 3AL0B 2A5WA 4U87A 3S3OA 2W1OA 2M4GA 2WAQA 4DBQA 4XONA 2MYSA 2AQEA 2F4IA 4XLAA 2VQHA 1TT0A 2K9MA 3D5LA 4FASD 3HPHA 2R7WA 1MW7A 1V5FA 2VQGA 2K9LA 2W82A 4AU7A 4YEJA 3TMOA 3K70D 2M3AA 2MFZA 2L9SA 2E5NA 3CP8A 4BEHA 3K6GA 2V6EA 2LBFA 4HSTA 4ANJA 1EA3A 4KITB 1DGRM 4OAYA 4E7JA 2M7BA 1OR7C 4PJMA 3RCOA 2L5QA 4RLQA 3J7AY 2VJ5A 3PJRA 4N4NB 1BR4A 4XL9A 1GLNA 2BVLA 3IP4B 4CSWA 4E7HA 4CCKA 5LD2C 4BL0B 3EUKL 3OYNA 3H9GA 3CMMA 2VL8A 3G2BA 4CCMA 4CCNA 3HOSA 3K4NA 1X1AA 2MC4A 3TL4X 2VPLA 2R7VA 2L7KA 2I8DA 4E7LA 2CS3A 3BC8A 4ZJZA 4P5OA 4CA0A 4DJAA 2ZXIA 3DKXA 2LOOA 2P0WA 2JSPA 4RLFA 3OYDA 1X1BA 3BG7A 4NUBA 4C2TA 2E1MB 3H5AA 5HLTA 4KISA 3HXLA 1YE9A 2Z1DA 3V42A 4E6KG 2R7QA 4FETA 2GOXB 3NWSA 2V7FA 4U7BA 2V4JC 1IRXA 4KT6A 3OMYA 3OY9A 2VXZA 1BOBA 3L2QA 2DOAA 3N05A 5CPRB 2XDVA 2DJIA 1YX3A 4XKBA 4BS9A 2BW3A 1Z3YA 1OLTA 3MMYB 4C30A 3DTKA 2KZVA 4LG3A 2FUG2 4XMYA 4PFPA 4CUGA 4PSWA 2CW8A 2L2OA 4PJNA 3U21A 5FROA 3D5SC 1QHGA 2IGKA 1UAAA 3DWLE 1WJEA 3A2KA 3OS1A 3BCAA 3OIQA 5LFAA 3OS0A 3LSKA 4DIQA 3BLYA 4N4OB 4X0GA 2XF5A 3S32A 1WJ5A 3HC7A 2HVSA 1WJDA 4F93B 1N75A 3SZGA 4QPOA 4HG2A 2PJRA 2R7UA 3PNVA 2IXSA 1D1BA 3F9KA 3VDXA 4BEHB 2ZSIB 4XKVA 5HNFA 3HKZA 3LFUA 2X1DA 2X51A 2CV2A 4CCJA 2VASA 1X19A 3OYAA 2KRHA 1SFKA 3QOEA 4Y33A 4D1QA 3EUHC 3IAM2 3OYFA 4C9YA 1BR1A 3OYBA 2A6TA 3W2AA 2VB6A 2VQLA 4PFOA 4Y4RA 3MKZA 2R7XA 3DLAA 2X6YA 1UG0A 2WY7Q 3FHNA 4ZYAA 4EATA 2LC2A 3CP2A 4XLFA 2K5CA 1MMDA 3K4LA 3M8JA 1N77A 5FRMA 2E1MC 3SDBA 2HPMA 3OR2C 2X1EA 2HVQA 2XF6A 4F92B 1LVKA 4IQ4A 2R7OA 4PJLA 2WA0A 4R79A 1KONA 3A4CA 3OYLA 2W00A 1D0ZA 3HG9A 2HDWA 3I3LA 2XF7A 4XN0A 3OOUA 5FRNA 4F91B 2R7RA 1QHHD 2ZSHB 4B3XA 2L9NA 3RQ4A 4XOPA 2HQAA 3VWBA 2IS4A 1TZLA 3RTRA 1LKXA 4XORA 3OYEA 1V5EA 3S8PA 2M4KA 4P1WA 2BW3B 4BDZA 1SAUA 3S3NA 1UELB 2CUJA 2LREA 2IGNA 2VJJA 2LRDA 5CKTA 3ZR8X 3DTEA 4XLCA 1DGWY 3H0DA 4MLOA 3OYIA 1W36C 1VZ0A 2Z2SB 3SEQA 3DU5A 3OYKA 3VYTB 4E4HA 2VKDA 3BCBA 4BGDA 3L2WA 3H9JA 4H4KC 4IZZA 3EUAA 3K4BA 2K3PA 2PJRB 1ERDA 4BUPA 4BXFA 2MABA 2RQQA 2Z16A 3DTIA 3VYSB 1X1DA 4D9JA 1NG6A 2ZXHA 3OYJA 1V5GA 4HEA2 4ZC3A 2M7AA 3HL2A 1X4OA 2E60A 2LG4A 1D1CA 4J00A 1QU3A 3BG6A 4IX7A 3ZRGA 5KNLA 1YX5A 4ZTJA 3DU6A 4CCLA 2DXIA 2JVGA 2M0MA 2JA2A 3LSMA 3LL7A 2IGOA 4BJ6C 4BE1A 3GBGA 1MMAA 1U0JA 4B47A 4E7ZA 3A1YA 4J01A 2IS6A 4B43A 3UR3C 3S3MA 4XR6A 4XLEA 1HA8A 3S93A 1ZELA 3K4KA 2WB1A 2OUMA 1LDKB 2KDOA 1DP3A 2VJIA 1T95A 4JQFA 1R6RA 2VLAA 3VYUB 4HNUA 3MKWB 3M1CA 2UWMA 4F55A 2LY1A 3OYMA 4PJJA 3IAS2 3VSLA 2JVHA 2X6WA 4OWRB 3K70C 2WADA 2Y0SA 4LIVA 2XSJC 2LBFB 1N78A 1D0YA 2KP6A 3QODA 3RSNA 2WAFA 4B44A 1Z3XA 4GRIA 4HSRA 4NQWB 5KHDA 4IKFA 1MNDA 2CW7A 3K4MA 3QYBA 4BU2A 1X4PA 3FDYA 2UUZA 3MKYB 2E5ZA 2Q1ZB 2R7TA 1MNEA 2X6XA 4LITA 1P9QC 1Z7LA 2BOLA 4NC7A 3RPUD 3VSKA 2V1NA 4BJTA 2WAEA 4F3QA 2CV1A 3MD2A 3CZ6A 3KEYA 3W2VA 3PNTA 3DEEA 4ZDOA 3FBNB 4JOMA 2WBMA 2IS1A 4B48A 3SEZA 3OIPA 4OAZA 4KJZA 1WJBA 3UNGC 4BE0A 3CJRB 2RREA 2QKLB 4XLHA 1LFPA 3PFYA 2HNHA 3K4CA 3SYTA 2KRCA 4HNTA 3OL3A 5HVQC 1WJFA 4ITVA 4E7SA 2UV1A 3DPLC 3C2GA 3D5RC 4BQOA 2Q2EB 3DPUA 3LSIA 3DQVC 2QKMB 4ZTFA 3FBIB 1WJAA 2BVMA 2VXDA 2KPMA 2CUZA 5CQEA 3VYRB 3W2WA 2NOJB 2OV7A 3L2UA 1E0EA 3AKZA 1K6YA 5TGTA 4PSXA 3L2VA 3K4JA 2IS2A 2WY8Q 4DOZA 4XOTA 2CV0A 4G6TB 2ELJA 4XNFA 1MMGA 4II2A 4DGWB 2HVRA 4BQQA 1Y6IA 4BACA 2LYCA 3CESA 3CF2A 3OL4A 2HZDA 2LY2A 2VKHA 2O5RA 3K10A 4BQNA 3LMMA 3E0JB 1S9HA 4HPQA 2AQFA 2KHMA 2RNGA 2W4SA 4RMNA 2HPIA 2R4GA 4F52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  4HRI A;  4J01 A;  4IZZ A;  4YRV A;  3QOE A;  3QOD A; 
#chains in the Genus database with same CATH topology
 2Y9Z A;  2VBW A;  2F6C A;  1MMN A;  1ETQ A;  2HTS A;  4LIU A;  3KCC A;  1R71 A;  1JT0 A;  2KDZ A;  4I6Z A;  3C1D A;  3KYL A;  2OC6 A;  5HOO A;  3HOT A;  3BZ6 A;  4AYB A;  4OMZ A;  3MKL A;  3BG9 A;  2XAH A;  1J2X A;  5E18 F;  4GGG A;  4BAY A;  2BHZ A;  2UXX A;  2M34 A;  3R60 A;  4A5N A;  2LD5 A;  5CYV A;  1IDZ A;  4AYB N;  3KX2 A;  4ZDP A;  2XAU A;  4PCQ A;  1B8I A;  4PUS A;  3P9C A;  3F23 A;  5DDG A;  2BGC A;  3S17 J;  4BKX A;  1P4A A;  4TV7 A;  3FXL A;  4LJZ F;  3S1N J;  3EUH A;  4G8X A;  4LLG F;  2ZJ2 A;  1GUU A;  2IGM A;  2DT5 A;  2FXA A;  1A36 A;  2CQN A;  1SFX A;  1SMY F;  4MIM A;  1FMW A;  3J7A O;  4HDV A;  5J1U A;  1W7P B;  5B5E C;  3AL0 C;  4NHJ A;  2KL4 A;  5CVI A;  2J5O A;  2MH9 A;  2UXN A;  4G7O F;  2CWE A;  3CDI A;  1K79 A;  3IRR A;  1GXP A;  4GYI A;  3OYH A;  1P7J A;  5JLW A;  1XC5 A;  5D6F A;  1ZRF A;  1BA5 A;  3MN2 A;  4M73 A;  2E71 A;  4HQM A;  3E6D A;  4AIK A;  2JUC A;  4M6Y A;  1T0F C;  3IUO A;  4JX4 A;  4XKW A;  2M8G X;  2KIU A;  1ZR2 A;  4ENN A;  3LSG A;  4O5V A;  2LP0 A;  2X85 A;  3W3C A;  3ZQG A;  3U1D A;  1XTA A;  2DA7 A;  2A61 A;  4II3 A;  4UB8 C;  2RGV A;  2XHK A;  2JUG A;  3KIO A;  1JHH A;  2A6E F;  3JRE A;  2CGP A;  4BE2 A;  1BN5 A;  1NG7 A;  3QWL A;  5FO5 A;  4I0B A;  5CQG A;  2ZME C;  3H9Q A;  5H6R A;  3VOD A;  3GX4 X;  4HA8 A;  3LOC A;  4CCO A;  5J8F A;  2MC3 A;  2X9D A;  1Y56 A;  4AVZ A;  4M3D A;  5FKO A;  4G6Q A;  1UCR A;  4NC6 A;  5D5U B;  2FQ3 A;  5K1Y A;  3HHH A;  4HBL A;  5BS6 A;  4B4C A;  3Q5F A;  4L9T A;  5JHF A;  2MG4 A;  3TBI A;  3G4S I;  3LNQ A;  3AL0 B;  2W1O A;  2M4G A;  2WAQ A;  4DBQ A;  4XON A;  2MYS A;  1RR7 A;  2TDX A;  4YFX F;  3FZV A;  2RNJ A;  2K9M A;  9ANT A;  2WAQ N;  4FCY A;  1J75 A;  1SD7 A;  1Z67 A;  4RS8 A;  1I1S A;  5FGM A;  3C2B A;  2QQA A;  2LBF A;  3FHZ A;  1B8I B;  1IXR C;  1BI2 A;  3FX3 A;  3HIF A;  1K6O A;  1IN8 A;  1GXQ A;  4RLQ A;  3DXJ F;  2VJ5 A;  3MVP A;  3ZQH A;  2I5U A;  5BPI A;  1EH7 A;  2DA2 A;  4G9Y A;  2BVL A;  1SC7 A;  3LA3 A;  3RYR A;  4KYW A;  4CGZ A;  3EUK L;  2V9P A;  1T33 A;  5GTI C;  2RC4 A;  5DYM A;  1R5I D;  3G2B A;  3H3U A;  3HOS A;  4XIC A;  3F6V A;  3QPT A;  3TL4 X;  2PLY A;  2I8D A;  3DV8 A;  5FB2 A;  1XMA A;  4E7L A;  1SD4 A;  1MMS A;  4RAG A;  3K0L A;  1JUP A;  1ENH A;  5IYB J;  1OCR H;  2FNA A;  4CA0 A;  2XUB A;  2KFD A;  3W6K B;  2O0Y A;  3OYD A;  1X1B A;  2ME6 A;  4EM2 A;  2H8R A;  4I01 A;  3IL2 A;  1FLI A;  3ELK A;  1JJ6 C;  2LLK A;  3R4K A;  2Z1D A;  3ZMD A;  2K27 A;  3IH4 A;  2OJE D;  3QU6 A;  1HCR A;  1WQ2 A;  1Y0N A;  2GOX B;  2NVQ J;  3FXM A;  4JBA A;  2R5Z A;  1YIJ I;  2E36 A;  5EJC A;  1P7I A;  3AG4 H;  2DOA A;  2GAU A;  3GFJ A;  5AON A;  4ZYD A;  3QPL A;  1I5Z A;  2DJI A;  2OF7 A;  4NB5 A;  2AS5 F;  4XKB A;  1FIP A;  2Q2E A;  3BG5 A;  5E20 A;  1XSD A;  3HBL A;  4Y52 J;  2OU2 A;  4NBQ A;  4XRS A;  4L5E A;  5KAI C;  3ZMU A;  5JVG F;  2K9S A;  2KZV A;  3H92 A;  2R5Y A;  4KNY A;  2E19 A;  5E1W A;  1LB2 A;  5J4V A;  2IGK A;  1UAA A;  3I4P A;  4KN7 X;  5LEJ A;  4EM0 B;  3OS0 A;  2V6C A;  4A2U A;  5ILU A;  1TWG J;  4HZF A;  3S32 A;  1QZY A;  1P92 A;  2HVS A;  1WJD A;  2FSW A;  2QA4 I;  1USS A;  4FHT A;  4QPO A;  4YIF A;  1WH5 A;  1TQI A;  4UVC A;  2PJR A;  2M30 A;  1CF7 A;  1SAN A;  3Q9S A;  4BQA A;  4HV6 A;  3ECH A;  3F9K A;  3IC7 A;  3SFI A;  2ZSI B;  3ZQC A;  1OQY A;  2GIV A;  3FM5 A;  5J47 A;  2UZK A;  4CCJ A;  3OYA A;  1OMI A;  4XLP F;  4Y33 A;  4MGR A;  2YPR A;  3IAM 2;  1BR1 A;  1PP7 U;  4M9S A;  2QZ8 A;  4L18 B;  2AO9 A;  2P8T A;  1LPQ A;  3DBH B;  1RKT A;  2A6T A;  4MFE A;  1X3W B;  4D0P A;  2VB6 A;  2GLO A;  4PFO A;  1KGS A;  1LDJ A;  4IXA A;  3BTI A;  3E6B A;  3GTO J;  2WY7 Q;  3FHN A;  1QBJ A;  3B6A A;  2LC2 A;  5IOY A;  3Q3S A;  2QVO A;  1N77 A;  3M8J A;  1S7O A;  4KIC A;  3RIR A;  4YIR X;  3WTV C;  3OR2 C;  2HVQ A;  1IDY A;  4F92 B;  1M1E B;  1LVK A;  1XCV A;  3O3K A;  5FLV A;  4DZJ A;  1VQ6 I;  1EF4 A;  1J0R A;  2HYG D;  2L0K A;  4AWX B;  3HTS B;  2F2E A;  3HG9 A;  3LA7 A;  3HRU A;  1DDN A;  1BBY A;  4IHT A;  2XGD A;  4GCV A;  5HS7 A;  2ELK A;  1ORK A;  1YI2 I;  2L9N A;  3FKI J;  1ZG5 A;  2BY3 A;  4HW0 A;  3CCQ I;  1YYV A;  2A5Y B;  3OSF A;  1LKX A;  4WF2 A;  2L7M P;  1W5T A;  2VBZ A;  3E6C C;  2HZT A;  3H3V K;  1XD7 A;  3KEQ A;  3CCY A;  1UEL B;  2CUJ A;  2LRE A;  3KP7 A;  1B1B A;  2LRD A;  5DS9 A;  4OOI A;  3FIW A;  4BBR J;  4EEF G;  3ZR8 X;  3GO5 A;  1QPI A;  3GYH X;  5HLG A;  2MH2 A;  4UUT A;  1UZC A;  3OYI A;  2XPU A;  3SFZ A;  4EGY A;  1JTY A;  2AXT C;  2WV1 A;  1VQN I;  1ETX A;  1W36 C;  3B73 A;  1I6H J;  3DU5 A;  2EZI A;  5LGN A;  1B9M A;  3WTT C;  3ZMS A;  2F48 A;  2FNP A;  1K4S A;  2JTV A;  1SD6 A;  5HS9 A;  2PJR B;  2Y69 H;  2MAB A;  1CF7 B;  3VYS B;  5JVT A;  1X1D A;  4RBO A;  1NG6 A;  1ZYR F;  1B72 B;  1LNW A;  3QP6 A;  3SZT A;  2E60 A;  1D1C A;  4IX7 A;  1JUM A;  1QGP A;  2R92 J;  4Y7N J;  1Z05 A;  4ZTJ A;  2H1L A;  5FJ8 J;  4UV8 A;  2DXI A;  2GA1 A;  2OPT A;  2FOK A;  1UST A;  3LSM A;  4FT8 A;  4BXU A;  3LSR A;  2V1U A;  2IGO A;  4XID A;  1W1W E;  1ZG3 A;  3GBG A;  4LG0 B;  4L9V A;  4JK1 X;  1U2W A;  1RZ4 A;  2NAZ A;  2IS6 A;  1EKE A;  1BW6 A;  1JTX A;  3FXO A;  5F1J A;  1RIO H;  1GVD A;  1RRJ A;  3S93 A;  2JK3 A;  1SVM A;  3S15 J;  3K4K A;  4IF4 A;  3OSG A;  1TQP A;  3ZMT A;  2OUM A;  1D8J A;  4UVA A;  5EF6 A;  2XVC A;  3I59 B;  3CMA I;  1KQ9 A;  4KT5 C;  2YX4 A;  3VYU B;  1WRJ A;  3MKW B;  3L9F A;  4YFK F;  3M1C A;  4F55 A;  2LY1 A;  2FEZ A;  3DCF A;  4PJJ A;  3IAS 2;  3VSL A;  4Q4Z F;  5A2Q Z;  3PM1 A;  2F5C A;  1OCC H;  2Y0S A;  2HYJ A;  2NRA C;  1P2F A;  1Y8Q B;  3FXR A;  1N78 A;  2VOO A;  2KP6 A;  1VQ8 I;  1MDM A;  3WU0 A;  1Z3X A;  3V4G A;  1VQK I;  4IKF A;  1MND A;  2ECB A;  3JR9 A;  1X4P A;  4LLN A;  5IP7 J;  4ESJ A;  1MJB A;  1JKR C;  4YG2 F;  4KIG A;  1XDU A;  3NQO A;  1Z7L A;  2G7U A;  4NC7 A;  5EG0 B;  3I4M J;  2M5W A;  1Y39 A;  4BJT A;  1UHW A;  1ZTR A;  3S2D J;  3WHC A;  4F3Q A;  4Y15 A;  1TWC J;  2YU3 A;  1FX7 A;  2FX0 A;  2P5K A;  3QU3 A;  2ESH A;  2LK2 A;  3ZQL A;  2IS1 A;  4B48 A;  2EIL H;  1RKW A;  1FP2 A;  1YS7 A;  3FK7 A;  3IWZ A;  5IT3 A;  3J80 K;  2R7Z J;  3PO2 J;  4CIC A;  1MIJ A;  2K9N A;  3PFY A;  4UXN A;  2KRC A;  1TTY A;  2DO7 A;  4ITV A;  2UV1 A;  4IPA A;  5IOZ A;  1G3S A;  3BTJ A;  1ETO A;  5E3M A;  3DPU A;  2W85 A;  5IT9 Z;  2DMP A;  4A6E A;  5F1R A;  2IA2 A;  1W0U A;  3GXO A;  3SHF A;  2CUZ A;  5CQE A;  1FP1 D;  2L4A A;  5DCF A;  1IC8 A;  4ZZD A;  3J81 K;  1K6Y A;  5B1B H;  3RJP A;  3JSP A;  3K4J A;  2IS2 A;  1FT9 A;  3CLQ A;  3HJE A;  2OZU A;  2CV0 A;  2ZXJ A;  4BY7 J;  3FM3 A;  2DFI A;  4AM3 A;  3VEP A;  4MHG A;  1XPX A;  4BQQ A;  1FY7 A;  4EJU A;  3HUG A;  1I50 J;  2DN0 A;  3CF2 A;  3CES A;  4M9Z A;  5HDG A;  4HNV A;  3HRT A;  2LY2 A;  4UUV A;  2D2W A;  4BQN A;  2GXA A;  3LMM A;  2VE9 A;  1IGN A;  2L02 A;  5LRR A;  2EV6 A;  4KFC A;  2HPI A;  5D4R A;  1EV7 A;  2K4B A;  2FBI A;  5E79 C;  1Z0X A;  1FMV A;  3DBL B;  2PMZ A;  3A01 A;  1NK3 P;  1MDM B;  3PL8 A;  5ICG A;  5ED4 A;  4A3M J;  2A69 F;  5AIP A;  5M5Y J;  4CH7 A;  1IXS B;  4Z6Y A;  2HU9 A;  4FTH A;  2KQR A;  3ONQ A;  2HOE A;  1Q1V A;  1Z21 A;  4P9F A;  3ZCO A;  2M8E A;  2G7H A;  5DTD A;  1ZH5 A;  1HDP A;  4ENK A;  1AHD P;  3EDP A;  3AFH A;  2COB A;  2RKH A;  4UHT A;  3L2R A;  1ETY A;  2FF4 A;  2WV0 A;  2VI6 A;  3C2H A;  3VOE A;  2E7W A;  3I53 A;  3UKG A;  1ZK8 A;  2K3F A;  1G59 A;  2J5P A;  1GHC A;  2E2J J;  1WJC A;  2X1C A;  4HX8 A;  4A0Y A;  1Z6R A;  3JSO A;  1D0X A;  1ZGJ A;  3GW2 A;  1D5Y A;  1D1A A;  2G0E A;  5JI6 A;  3PIO F;  2DU9 A;  2H6B A;  4A6D A;  2VQC A;  4UB6 C;  2KRF A;  3BR5 A;  1WFX A;  1E17 A;  5GPC A;  4XKC A;  2ME0 A;  3ZXS A;  5F27 A;  3OYC A;  2BBY A;  4KDP A;  2W25 A;  1XX5 A;  3QPS A;  3HOV J;  2BY0 A;  3HOX J;  4ON0 A;  3QYF A;  1FSE A;  4Z2Y A;  2F5V A;  3WGG A;  4M71 A;  3ABM H;  1JUS A;  1U5T C;  1IUF A;  3TP3 A;  5D6E A;  3ZGK A;  4RDU A;  3KZI C;  2EFN A;  3BT9 A;  3PNY A;  2DFH A;  1FZP B;  3NRV A;  1WZ2 A;  5FKK A;  3H5R A;  4DBR A;  4GO1 A;  3ZQQ A;  2DT7 B;  2XRL A;  1MBE A;  2CH0 A;  1BR2 A;  5FFX A;  3E3V A;  1HSJ A;  3WG9 A;  3CJQ B;  4PK4 A;  3KP2 A;  2DCE A;  3HUG B;  5FKN A;  4G7H F;  1W0T A;  4YEL A;  4NC8 A;  4BJ5 C;  4CZC A;  4L5J A;  3LSH A;  2DTR A;  3M4O J;  1E3P A;  3E1S A;  2GXB A;  3QYE A;  1AA7 A;  1MGT A;  2RDP A;  3RDI A;  3LAP A;  4A0X A;  5J3L A;  2HFH A;  4IQJ A;  2DI3 A;  4HF1 A;  3WE3 A;  3HHG A;  3A01 B;  1HKQ A;  2MD0 A;  2BHY A;  4U87 A;  2IT0 A;  3S1Q J;  3C18 A;  3FXJ A;  2AQE A;  4W1U A;  2ZKZ A;  2F4I A;  4XLA A;  1AKH A;  3FIS A;  3L09 A;  3SQN A;  2B7E A;  2R7W A;  1MW7 A;  1POG A;  2JWT A;  2VQG A;  2K9L A;  1FJL A;  2DA3 A;  1LEA A;  2XV4 S;  3KP4 A;  2MFZ A;  3MWM A;  5IP9 J;  4ETS A;  2XAQ A;  4AD9 A;  1RES A;  1IN7 A;  5EEA A;  5B3S H;  4EJT A;  1EA3 A;  3HRS A;  1F5T A;  2M7B A;  1OR7 C;  2CUF A;  4LGW A;  4PJM A;  2L5Q A;  1PUF A;  1QA6 A;  3PJR A;  1ONV A;  3IP4 B;  5LD2 C;  1R4N B;  1S5L C;  3V8K A;  4BL0 B;  4A12 A;  3CDH A;  5FLX K;  5M3F J;  1UHM A;  4B09 A;  4A5M A;  5HLH A;  4MNU A;  4CCN A;  3S16 J;  3BZC A;  3K4N A;  4XRF A;  2VPL A;  1LDD A;  2QSF X;  3QQA A;  2B0L A;  1B59 A;  2CS3 A;  2JSC A;  5F08 A;  4UNO A;  3RPQ A;  2D1H A;  5DM7 F;  4P5O A;  5A2Q K;  5HS8 A;  3GZ6 A;  1UFM A;  4RLF A;  4NUB A;  5GAH J;  2E1M B;  4KIS A;  5J1R A;  1QRY A;  3PQK A;  2VC0 A;  2R7Q A;  4HLX A;  5CJ9 A;  3KLO A;  4RAY A;  2QEN A;  4A3F J;  3DFG A;  1W5S A;  3NWS A;  3BOQ A;  1VF9 A;  3I55 I;  2V7F A;  1R1T A;  3OMY A;  5E3O A;  2K40 A;  3CCR I;  3JRD A;  2VXZ A;  3HM5 A;  1BOB A;  3N05 A;  2XDV A;  1WKM A;  2DQL A;  3FMS A;  1XGN A;  1YX3 A;  5KVR A;  2KJC A;  1FYK A;  1YS6 A;  2ID3 A;  2KJB A;  5IYD J;  1FBS A;  3CCS I;  2BW3 A;  3W6J B;  3O8G A;  3HSF A;  2DA1 A;  1OLT A;  3MMY B;  3ZMZ A;  1Z77 A;  1LVA A;  1Z91 A;  1C0W A;  2FUG 2;  1IRF A;  2BE5 F;  2DMT A;  4I98 B;  4M3B A;  1DPR A;  5TIS C;  4PFP A;  2FU4 A;  4HX4 A;  1ZAR A;  4CUG A;  4PJN A;  4IHX A;  2PFB A;  1QHG A;  2HGC A;  1WJE A;  3A2K A;  3OS1 A;  3BCA A;  5LFA A;  3AAF A;  1Z6T A;  1B6A A;  3F8M A;  4HV5 A;  4X0G A;  1AKH B;  3DF8 A;  3HC7 A;  1G3T A;  2DA5 A;  4F93 B;  1ZLJ A;  4KN4 X;  2MD5 A;  3L7W A;  4DYC A;  3PO3 J;  5IT9 K;  3ZN1 A;  3PNV A;  5E17 F;  3TGN A;  4ZZL A;  3K2Z A;  3JRG A;  5HNF A;  3JRH A;  1FOX A;  2ISY A;  1OCT C;  4I76 A;  2EFO A;  2F5F A;  4EJO A;  2FE3 A;  3FWE A;  3EUH C;  5F0C A;  2QCO A;  3RKQ A;  3A02 A;  2PBI A;  1PUF B;  2W84 A;  3MAJ A;  3P5J A;  1OCO H;  2HOA A;  3OYB A;  2VE8 A;  3W2A A;  1T2K A;  3QPH A;  3GME A;  4WXH A;  5C4X J;  4I2O A;  1FOW A;  2CU7 A;  3LQQ A;  1IZ1 A;  2K5C A;  3K4L A;  2EIM H;  3QAH A;  3C3W A;  2R5Z B;  1QVT A;  2PQ8 A;  2Y75 A;  1FIA A;  4I99 C;  2HPM A;  2IRF G;  3JRB A;  1JJ8 C;  4PJL A;  2G9W A;  1J7K A;  4EVI A;  2BXZ A;  3BR1 A;  3JRF A;  3OYL A;  3A4C A;  2HYF A;  2W00 A;  4BNC A;  1D0Z A;  4XN0 A;  5LEK A;  1QVU A;  2R7R A;  2ZBK A;  4B3X A;  1G3W A;  4E70 A;  2BV6 A;  3RQ4 A;  4AID A;  3KLN A;  3IHU A;  4DW6 A;  3VWB A;  1TWF J;  1R23 A;  2OD5 A;  4XOR A;  3FF5 A;  4ESF A;  1O57 A;  3HRM A;  2IEK A;  3S8P A;  1YG2 A;  2BW3 B;  4YII A;  3RKX A;  1YOV B;  5L3B A;  2H09 A;  1MJ9 A;  4L0Z B;  3CDL A;  3PQJ A;  3M8E A;  2IPQ X;  3LSJ A;  3BDD A;  3P9K A;  1I3A A;  3H0D A;  1A6Q A;  1VQO I;  3CQZ J;  3BY6 A;  3GVA A;  1ZQ3 P;  2E7X A;  3R61 A;  4A3B J;  1FYM A;  4HF0 A;  3N4M A;  1EH8 A;  5BQT A;  3J80 Z;  3VYT B;  4E4H A;  1JHF A;  4KMF A;  2DYS H;  2OZ6 A;  4RGR A;  4U0V A;  2CJJ A;  1VND A;  1R9T J;  4IZZ A;  3FXU A;  5GAG J;  1Z9C A;  3RYP A;  1ERD A;  3U9G A;  3MCZ A;  2C6Y A;  4BXF A;  2Z16 A;  4D9J A;  2TRT A;  2ZXH A;  1HKS A;  2KIF A;  4HEA 2;  1NHA A;  2STT A;  2V1X A;  2DMQ A;  3S2H J;  4KIB A;  3BG6 A;  5ICC A;  5BOX A;  3AG3 H;  3T5X A;  1MJA A;  1Z1D A;  1EH6 A;  3WTW C;  3J81 Z;  3JCU C;  2BY2 A;  2QYO A;  3ESW B;  2A07 F;  1H88 C;  3F0C A;  3V8J A;  4GXO A;  4A93 J;  4J01 A;  4B43 A;  3UR3 C;  2ZNZ A;  2XGC A;  4EMS A;  4YFN F;  1H8A C;  1LDK B;  4IL6 C;  3E5U A;  4IRI A;  3JAM K;  3NEU A;  4JQF A;  4F7Z A;  4FX0 A;  2PEX A;  2VLA A;  2O6G E;  2COM A;  2DA4 A;  5H20 A;  1IJW C;  4JYK A;  3OYM A;  1R49 A;  1A35 A;  2AHQ A;  2YUS A;  4OWR B;  3K70 C;  2H8W A;  4LIV A;  2LBF B;  1S29 A;  3QOD A;  3RSN A;  1OIS A;  4HSR A;  4G6D A;  3HSE A;  2WTE A;  2MLK A;  2O61 A;  1JT6 A;  5L3F A;  2H6C A;  3CCE I;  2DTZ A;  4OIO F;  1LUJ B;  3K4M A;  4BXX J;  2UUZ A;  1UB9 A;  3MKY B;  2BYV E;  2Q1Z B;  1MNE A;  1P9Q C;  1FYL A;  1W4M A;  1JGS A;  1F4K A;  2EBI A;  1HDD C;  4I0A A;  2HKO A;  2EZL A;  2DPU A;  2Z5U A;  3KEY A;  3PNT A;  5J8C A;  2QEX I;  4ZDO A;  1IRZ A;  3FBN B;  3TOA A;  2YU9 J;  2H1K A;  2O8K A;  3SEZ A;  1QO0 D;  4OAZ A;  3Q0U A;  1I3Q J;  3UNG C;  2XAJ A;  2PJP A;  1KYW A;  3CJR B;  2RRE A;  5J4Y A;  1DUX C;  4HDU A;  4BY1 J;  3TKY A;  1MBK A;  4GFB A;  3TP0 A;  4IOC F;  3BTL A;  5FD6 A;  4E7S A;  3HOY J;  2DYR H;  1UG2 A;  2GIZ A;  3I54 A;  1K78 A;  3D5R C;  4A3G J;  1FNN A;  4Q5S F;  4BQO A;  2Q2E B;  1OCZ H;  1V4R A;  2V9V A;  1G2H A;  3HTU A;  4UV9 A;  2QKM B;  4ZTF A;  1YJN I;  4PGH A;  3GLX A;  1WJA A;  3BTC A;  1P4W A;  1AOY A;  2BVM A;  1BJZ A;  1HW5 A;  1U9N A;  5DUK A;  2R5Y B;  1KU2 A;  2OV7 A;  5B66 C;  3L2U A;  5TGT A;  3A0B C;  3O8H A;  2IA0 A;  2E1N A;  1RET A;  3WTU C;  4G94 A;  2EV0 A;  2LKS A;  2EA4 A;  1SMT A;  3V7S A;  1TW3 A;  2DLL A;  4G6T B;  4UVB A;  1MMG A;  2HVR A;  5L3G A;  5D5X B;  5CLS A;  3GUD A;  5LGT A;  4LOC A;  1WWX A;  3CD6 I;  1ACI A;  3K10 A;  4RAZ A;  2P4W A;  2QGU A;  1WGX A;  1MD0 A;  1UHS A;  1R22 A;  5H6Q A;  4A3I J;  2RNG A;  2W4S A;  3F6O A;  4RMN A;  4RB0 A;  2YR2 A;  5HDN A;  5E1Z B;  4ABZ A;  1VTN C;  1YTY A;  4Y3O A;  5DD4 A;  2KMU A;  3ABL H;  1O3Q A;  4XN3 A;  1HF0 A;  2V26 A;  1T39 A;  1ETV A;  3GCM A;  3ASN H;  4HRI A;  2D1V A;  2X4H A;  2EPF A;  5DD8 A;  3ABT A;  2PI0 A;  2VJ4 A;  3OWT A;  3R0J A;  2LR8 A;  4M6V A;  3WTZ A;  3NWT A;  2DDA A;  4XM3 A;  1OCP A;  5F6F A;  1YO5 C;  1ITY A;  4KIF A;  4BDY A;  3LAJ A;  3ABK H;  1F1Z A;  3K1N A;  5DM6 F;  2GBY A;  5EEG A;  2R3S A;  5FLX Z;  2CFO A;  3OR1 C;  1O3S A;  3I58 A;  3G73 A;  1T8I A;  2VUM J;  2CFX A;  1PJR A;  3DKY A;  4BHC A;  4U7D A;  1L0O C;  1YW9 A;  5HNH A;  5M5W J;  1BI3 A;  3S1M J;  3H5N A;  2VT2 A;  1SD5 A;  2EIN H;  4PJ0 C;  3HGG A;  4D5F A;  4XQF A;  2OBP A;  1W36 D;  2DT6 A;  4RM2 A;  1FWZ A;  1OYI A;  5FKL A;  5KCM A;  4RA2 A;  5D8K B;  4UUS A;  1X1C A;  4RB1 A;  4YRV A;  4L9N A;  2Y0S N;  3F8N A;  4E7K A;  2B63 J;  3ABU A;  3IH2 A;  4KA4 A;  1P4X A;  5F0H A;  2XPW A;  4Q48 A;  5BNG A;  4P55 A;  1OFC X;  4G7Z F;  3FKJ A;  3HPG A;  4HYE A;  2EJR A;  5ILS A;  5M5X J;  2MA3 A;  1HBX G;  2ZFW A;  1YQA A;  1XN7 A;  3JRC A;  1HLV A;  3B02 A;  4E7I A;  4FIS A;  1J09 A;  1GDT A;  2OTL I;  5J1Y A;  3MZY A;  5DUI A;  3DPT A;  1DQU A;  3KYD B;  2R7S A;  1V55 H;  4BBS J;  1K83 J;  3E6M A;  1BM9 A;  5J6X A;  4V19 K;  1KZH A;  1XSX A;  2IP2 A;  3ZQ7 A;  1Y1V J;  4RB3 C;  1APL C;  4A3K J;  2M0C A;  3K2A A;  4M3G A;  1QZZ A;  3G71 I;  3RI4 A;  3GTM J;  2JRT A;  3PFI A;  1G4D A;  1ZG1 A;  2BZT A;  3GF2 A;  1G8X A;  2A05 A;  2IW5 A;  3PSF A;  5L3D A;  4BHP A;  3B6C A;  3HOW J;  1B9N A;  2EWN A;  2VQH A;  1DP7 P;  1WHU A;  3HPH A;  5TJJ A;  2HQ5 A;  1V5F A;  4IJA A;  2HEO A;  2CQX A;  2LVS A;  4YEJ A;  2JMW A;  1Z7U A;  3TMO A;  1EJ9 A;  2E5N A;  3CP8 A;  1QQI A;  4BEH A;  2DOE A;  3CCJ I;  3K6G A;  5K7F A;  2V6E A;  2JA7 J;  4HST A;  2DFE A;  1BL0 A;  3U2R A;  1DGR M;  1O7L A;  4E7J A;  3Q0W A;  1PP8 F;  2M1B A;  4ZYH A;  5E1X A;  3WU2 C;  2DAO A;  1FPQ A;  2XGX A;  2GQQ A;  2XIG A;  3HEF A;  4N4N B;  4Q47 A;  1BR4 A;  2DOD A;  3SXY A;  4D7N A;  4OIN F;  5K5Q A;  4HQE A;  4CCK A;  2HDC A;  2E34 A;  2I10 A;  3JW4 A;  2NVT J;  2LKP A;  3H9G A;  3CMM A;  2HR3 A;  3R6S A;  2VL8 A;  4CCM A;  2R7V A;  1BIA A;  2A3S A;  3P9I A;  1X1A A;  2CUE A;  2MC4 A;  2JQ7 A;  2X6O A;  2O8X A;  3TOB A;  2VC1 A;  4DJA A;  2GXG A;  3DKX A;  3H0G J;  2XKO A;  4UUS B;  5CVU A;  2P0W A;  3HDD A;  2JSP A;  3KP5 A;  2HQR A;  5LHG A;  3HYI A;  4C2T A;  3H5A A;  1IN5 A;  4I02 A;  5HLT A;  3HXL A;  2ELH A;  2PMZ N;  4E6K G;  2P7C B;  1WH7 A;  1X1P A;  4FET A;  4C3H J;  4IVN A;  1ZN2 A;  5D5V B;  2F4O B;  4U7B A;  2FJ1 A;  2V4J C;  4M3F A;  4DYQ A;  2Z3Y A;  1T56 A;  1ZGW A;  3L2Q A;  3HOU J;  2Y2Z A;  3LQR A;  3RQI A;  5K7H A;  2KT0 A;  3FMR A;  4MEY F;  2V79 A;  2RN7 A;  1P6R A;  1R4M B;  3KE2 A;  1Z3Y A;  1A5J A;  4MO7 A;  4RGS A;  3J7Z I;  1X3U A;  3QOP A;  2XSD C;  2YSR A;  1HOM A;  4C30 A;  3DTK A;  4NDL A;  4LG3 A;  2JRM A;  1ODD A;  1TWH J;  1YLF A;  4PSW A;  3U21 A;  5FRO A;  3HZJ A;  2QLZ A;  3T1B A;  3GTP J;  3DWL E;  5HDK A;  1R5G A;  3OIQ A;  1XMX A;  4DIQ A;  4N4O B;  3F22 A;  1MBF A;  4CYC A;  2MBF A;  2XF5 A;  2GA2 A;  4AUX A;  1WJ5 A;  3I4N J;  2VOD A;  2ECC A;  1N75 A;  1QNT A;  2CQQ A;  1IAW A;  2OCC H;  4HG2 A;  5KK1 A;  4QIW N;  4N9I A;  1KA8 A;  1XMK A;  2NS8 A;  1R5H A;  3F3X A;  1D1B A;  5JR3 A;  4DYR A;  4BEH B;  3HKZ A;  3LFU A;  2X51 A;  2VAS A;  1X19 A;  2PMH A;  4EM1 A;  4MFD A;  3OYF A;  3GFM A;  5FD5 A;  3R0A A;  3HOZ J;  1SEU A;  4HOB A;  2P6S A;  4LB5 A;  3DEU A;  1KQ8 A;  3F8F A;  2YX7 A;  3E7L A;  2VQL A;  3KP3 A;  1TQM A;  1WVR A;  3DLA A;  3I64 A;  4A3J J;  2X6Y A;  2R7X A;  5GPA A;  4ZYA A;  3CP2 A;  1U6G A;  4Y17 A;  1MMD A;  5AIQ A;  3JAM Z;  2HXO A;  1HST A;  4B8X A;  2E1M C;  2DMU A;  3M07 A;  4OU0 A;  3SDB A;  3ULQ B;  1IXC A;  5K5R A;  2H27 A;  1OKR A;  3WGH A;  4IQ4 A;  1MBJ A;  2R7O A;  3VPR A;  4WXC A;  1KON A;  3HSR A;  4P96 A;  2W24 A;  3COA C;  3CCM I;  3I3L A;  3GTL J;  2D5V A;  3OOU A;  5LHH A;  5EDN A;  3BQY A;  1ULY A;  4EJV A;  4L9J A;  2ZSH B;  3BZK A;  1VQ5 I;  1T98 A;  3K69 A;  2HQA A;  3MQ0 A;  3W6V A;  2IS4 A;  1TZL A;  5EYR A;  1WPK A;  3CUQ A;  2ADU A;  2CO5 A;  3KFW X;  2CRG A;  4XLN F;  3OYE A;  1HW1 A;  3H36 A;  2QSH X;  4P1W A;  3SJM A;  1FOK A;  2KKO A;  4BDZ A;  1SAU A;  3GLL A;  5CVJ A;  1LE8 A;  4D7M A;  5HLI A;  2VT3 A;  2VJJ A;  5CKT A;  4ZH4 F;  2HS5 A;  1Y1W J;  1ETK A;  3D1N I;  3VFZ A;  3DTE A;  3LA2 A;  2EFP A;  2OQG A;  2EH3 A;  4LK1 F;  1DGW Y;  2ZC2 A;  1T08 B;  2R0Q C;  4MLO A;  3FXQ A;  1IN6 A;  1BI0 A;  2PMU A;  3RPU A;  3OYK A;  4LB6 B;  3NAU A;  3WE2 A;  3ZQI A;  4CYC B;  2PX9 A;  2JJ7 A;  2VKD A;  5JLX A;  5E3L A;  1IV8 A;  3BCB A;  4FQG A;  2CQK A;  3L2W A;  1U3E M;  2R7F A;  5GTH C;  4D5C A;  4H4K C;  4HF2 A;  3EUA A;  4AVP A;  2NVX J;  2K3P A;  2XB5 A;  4BUP A;  1JKO C;  2Y31 A;  4JP0 A;  2RQQ A;  1RI7 A;  3WG7 H;  3CCU I;  2K7L A;  2OAZ A;  5EEH A;  1V5G A;  3TO6 A;  3OYJ A;  1MH4 A;  3HL2 A;  5GAE J;  3TO9 A;  2LG4 A;  4CYD A;  1DPU A;  2FBK A;  1QU3 A;  3F8C A;  1WI9 A;  3TO7 A;  1KU9 A;  1YX5 A;  3JTH A;  4S0H B;  3D0S A;  3KEO A;  3QRF F;  4CCL A;  1CQT A;  2JVG A;  1G6N A;  3EYI A;  3TDU C;  2JA2 A;  1DU0 A;  1STZ A;  4BE1 A;  1FBQ A;  1MMA A;  3DKW A;  4B47 A;  4E7Z A;  3A1Y A;  3S3M A;  1MSF C;  3BR0 A;  1T0F A;  3ML6 A;  4PDK A;  1YIO A;  3TW7 A;  2JPB A;  1FSH A;  2XPV A;  2X48 A;  1HA8 A;  2VOP A;  5LRS A;  1YFH A;  3ZQF A;  4BYY A;  3A0H C;  3CLO A;  2KDO A;  4EV0 A;  1LJ9 A;  1DP3 A;  1X2M A;  1T95 A;  2DOF A;  4C3J J;  3FXK A;  2KZG A;  5D5W B;  4I7H A;  1W7P D;  1BOA A;  3IKT A;  3PIP F;  3TED A;  3MEX A;  2DJN A;  3F8B A;  4HNU A;  2ACJ A;  1RNL A;  2UWM A;  3FK6 A;  2ZME A;  2LY9 A;  5IYC J;  1ZKG A;  2WWY A;  3F21 A;  2WAD A;  3T8R A;  3M3Y J;  5C4J J;  3IKV A;  1FOY A;  3CUQ B;  1U8B A;  1V54 H;  2WAF A;  3WHB A;  4GRI A;  3G1O A;  2K85 A;  2CW7 A;  3G1L A;  3V7C A;  5BPD A;  1LE8 B;  3GTG J;  4JX5 A;  3VB2 A;  1FBU A;  1YJW I;  4PZJ A;  2E5Z A;  3I56 I;  4DZP A;  1VQ7 I;  2X6X A;  3G1M A;  3I71 A;  2BOL A;  4LIT A;  3RPU D;  1ZLK A;  1U9O A;  2V1N A;  5TRD A;  1R58 A;  3L00 A;  4LFU A;  4QWQ A;  5E8G A;  2QF7 A;  3W2V A;  1AU7 A;  3DEE A;  3BJA A;  4XSZ F;  3G6E I;  4JOM A;  1R36 A;  2E1O A;  5B1A H;  2IA1 A;  3M9A A;  3BRO A;  3OIP A;  1GT0 C;  1BC7 C;  3LST A;  2XGE A;  1IG7 A;  2EB7 A;  4OMY A;  2HOS A;  1HKT A;  1LFP A;  3H3Z A;  5LLQ A;  2HNH A;  3HGY A;  5HVQ C;  4IHW A;  4QSH A;  4ESB A;  4M3E A;  1WJF A;  3C2G A;  1XG1 A;  2IAI A;  5J40 A;  4RAF A;  3WTX C;  5F0F A;  4WWC A;  4A3C J;  3DBR B;  2BXY A;  2VPR A;  3DQV C;  1BI1 A;  2OA4 A;  2L54 A;  1YIT I;  5DEQ A;  2VXD A;  1PDN C;  2OCE A;  3W2W A;  4ENM A;  1U78 A;  2ZNY A;  2HXI A;  2EQR A;  3CO6 C;  5IY5 H;  2P7V B;  4IRH A;  2WY8 Q;  2P6T A;  4DOZ A;  1F9N A;  1XDS A;  2FA5 A;  4WCG A;  1JKP C;  2NS0 A;  4DGW B;  3GTJ J;  3LSP A;  2HOT A;  2LYC A;  3U1K A;  1REP C;  2QSG X;  5C44 J;  1NTC A;  2ZJP F;  2F5D A;  3E0J B;  3DP7 A;  1O3R A;  1S8N A;  2ZME B;  2AQF A;  2KHM A;  1KYZ A;  1SAX A;  3ISP A;  3BPX A;  2Q8K A;  3TDZ C;  1HC8 A;  1A04 A;  4EJW A;  4WX9 A;  3GFI A;  2K4J A;  1OYY A;  1K7A A;  1E3H A;  6PAX A;  2XAG A;  1TT5 B;  2HI3 A;  1VQ9 I;  2VKV A;  1J9I A;  3RKW A;  3OYG A;  3BJO A;  3GZ5 A;  5EZG A;  2O03 A;  4A3E J;  5JFR A;  5EGO A;  1V3F A;  1H0M A;  1PUE E;  2ZFU A;  4AIH A;  4C2U A;  3PSI A;  2DPD A;  2ZJR F;  1LFU P;  3ZN0 A;  1KQ0 A;  1TNT A;  2W48 A;  2Y48 A;  4CZZ A;  1VQL I;  2FBH A;  2AXL A;  3G3Z A;  4RM3 A;  3EQL F;  2RAE A;  4LMY A;  4KMU X;  2VBY A;  3I9V 2;  1XCB A;  3M8F A;  1TP4 A;  3V8L A;  4WK8 F;  4QPQ A;  4NNJ A;  2CYY A;  3CTA A;  1YRN A;  3H35 A;  3P7N A;  1L3L A;  2FOW A;  1B4A A;  3CC2 I;  2V9K A;  2N8G A;  2NNY A;  2IVM A;  1MBH A;  4IO9 F;  3GTQ J;  4IHS A;  2LNB A;  1CGP A;  4FE7 A;  3PUB A;  1Y8R B;  1RUO A;  1PYV A;  1I1G A;  1T6S A;  2NS7 A;  5E8I A;  2ZXW H;  1MZB A;  1MKM A;  3MZH A;  4IOA F;  3IV5 A;  2OQR A;  2GZW A;  3GWZ A;  1FTZ A;  2M45 A;  4FX4 A;  2RVC A;  4LD5 A;  3EYY A;  1O3T A;  2MW8 A;  4MTE A;  1GV2 A;  2LH9 A;  1B72 A;  4ZDL A;  2Y30 A;  3K9T A;  1LEB A;  2K9Q A;  2XC7 A;  4AC0 A;  3CC7 I;  2GOM A;  1JI8 A;  2QM3 A;  2OTJ I;  1FTT A;  1O7F A;  1KU7 A;  3MZ8 A;  3OS2 A;  3KZY A;  3WGI A;  1J59 A;  2A68 F;  4V2G A;  4XRM A;  3EPZ A;  3CCV I;  1X3Z B;  5L3C A;  5BMZ A;  4LG0 A;  2QQB A;  1RUN A;  2KLO A;  2CMP A;  3E5Q A;  3FMQ A;  2W7N A;  1XGO A;  3GZN B;  2L3D A;  3I0T A;  2D45 A;  1UMQ A;  3Q0V A;  1JGG A;  3QP5 A;  2VIX A;  3T8T A;  2F4M B;  3CF5 F;  2M87 A;  2FRH A;  2A5W A;  3S3O A;  1X2N A;  5LBQ A;  1OJL A;  3I59 A;  3RZD J;  3CCL I;  2ZO4 A;  3GTK J;  1TT0 A;  4FAS D;  3D5L A;  2LF8 A;  2LDU A;  4M9X A;  5EGO B;  1LFB A;  2W82 A;  3PUF A;  1Q1H A;  4AU7 A;  5FLM J;  1IUY A;  3K70 D;  2M3A A;  2XAS A;  2L9S A;  4U0Y A;  4PGG A;  2LF7 A;  4O6J A;  2CW0 F;  3I5U A;  1HW2 A;  3EET A;  1A6I A;  1R1U A;  1VFC A;  1SVL A;  4ANJ A;  3O2P E;  4KIT B;  4OAY A;  1MNM C;  1IN4 A;  4J19 A;  3BG3 A;  3RCO A;  3IRQ A;  2EK5 A;  5KAF C;  3J7A Y;  4CO8 A;  1TL8 A;  1G3Y A;  4XL9 A;  1GLN A;  2EA2 A;  5FKM A;  4CSW A;  4N0B A;  4E7H A;  1YRN B;  2ICW G;  2STW A;  1YW8 A;  3K7A J;  3RZO J;  3MFK A;  1SFE A;  1HXD A;  2RQP A;  4ASN A;  3OYN A;  2HWV A;  4FE4 A;  5EG0 A;  4LLL A;  5C3E J;  4IHV A;  4A3L J;  2L7K A;  1MSE C;  4ZYE A;  3TQN A;  3BC8 A;  1AWC A;  2XAF A;  4ZJZ A;  1I39 A;  2X0L A;  5CVR A;  2P5V A;  2VKE A;  4MQV A;  4ENJ A;  2H94 A;  2B9S A;  2ZXI A;  1K4T A;  2LOO A;  3BG7 A;  4CXF A;  2GM4 A;  1FC3 A;  5D8L B;  2NVU B;  1YE9 A;  1GV5 A;  2EIJ H;  3V42 A;  1S7A A;  2BY1 A;  3F72 A;  1R00 A;  3ERM A;  2KIM A;  5GP9 A;  2L7F P;  3DLL F;  3OY9 A;  1IRX A;  1VI0 A;  4KT6 A;  2ID6 A;  2NYX A;  5CPR B;  4XRS G;  3S1R J;  4BS9 A;  2Y9Y A;  4QLC U;  5DV5 A;  4HAM A;  2EIK H;  2M9H A;  1TWA J;  2FML A;  3K1P A;  4XMY A;  1O4X A;  2JPC A;  2CW8 A;  2L2O A;  1YW7 A;  2ESN A;  3BP8 A;  3D5S C;  4RGX A;  1QZE A;  3ECO A;  4LK0 F;  4V2F A;  2L9V A;  5H2F C;  4G12 A;  1K78 B;  3BPV A;  2Y0M A;  4S05 A;  1YHQ I;  3WU1 B;  2L4M A;  3LSK A;  3BLY A;  1DU6 A;  4RB2 C;  1BC8 C;  3WTY C;  3KET A;  2TCT A;  3NAR A;  1SFO J;  1XS9 A;  2Z9O A;  3CMY A;  4U88 A;  3ZPL A;  2FMY A;  5IP6 A;  1Y0U A;  3SZG A;  2EFW A;  2R7U A;  1IF1 A;  2IXS A;  4MQ9 F;  2IBD A;  2E2H J;  2E35 A;  4XSX F;  3VDX A;  4XKV A;  3CO7 C;  1IRG A;  2X1D A;  3AG1 H;  2CV2 A;  5IPA A;  3SZP A;  2DFF A;  1NH3 A;  3SDG A;  2KRH A;  1SFK A;  2Q0O A;  1J5Y A;  3QOE A;  4D1Q A;  1JXS A;  1XB4 A;  2NVY J;  2NXN B;  4C9Y A;  4IHY A;  3CUO A;  3IH3 A;  2QQ9 A;  2NNN A;  1ZRE A;  2O3F A;  4XBF A;  1BIB A;  4Y4R A;  3MKZ A;  3BR2 A;  2QBY A;  4EQQ A;  5ICF A;  1UG0 A;  4EAT A;  3E5X A;  4XLF A;  1W5C C;  1N25 A;  1ZRD A;  2DK8 A;  2DQR A;  5FRM A;  5F04 A;  2YS9 A;  2HQN A;  2QQ8 A;  2DBB A;  2XKP A;  2X1E A;  2XF6 A;  1ON2 A;  2CQ7 A;  4A0Z A;  2LMD A;  4M6X A;  2V1D A;  2JA5 J;  2WA0 A;  4R79 A;  1X58 A;  3M7G A;  3ZMV A;  4N9H A;  2HDW A;  2XF7 A;  3S14 J;  2FQ4 A;  2R7D A;  1ZGA A;  4DNC A;  5FRN A;  4F91 B;  1XGS A;  2KIQ A;  1QHH D;  2NOG A;  2A6H F;  4XOP A;  1UJ8 A;  3GEZ A;  4RGU A;  1SFU A;  1KU3 A;  3OV8 A;  3RTR A;  2EFQ A;  1V5E A;  4HX7 A;  2M4K A;  2QWW A;  2XRO A;  1E3O C;  2BEO A;  1XSV A;  2MGQ A;  2RV8 A;  3CJT B;  3DEW A;  4NQW A;  1VQP I;  3WOD F;  3OIO A;  3S3N A;  2E2I J;  2IGN A;  4IEJ A;  4XK4 A;  2DW4 A;  4K2E A;  1ZR4 A;  1BJA A;  4XLC A;  1U8R A;  2ZCW A;  1TBX A;  3JRA A;  2JA6 J;  2GWR A;  4WXD A;  3TW6 A;  1VZ0 A;  1K61 A;  4C3I J;  4L5I A;  2Z2S B;  4Y13 A;  2W57 A;  3SEQ A;  3N97 A;  2O7O A;  4ZYG A;  2HTJ A;  1QPM A;  4BGD A;  1JKQ C;  5LHI A;  3H9J A;  3M1E A;  3E97 A;  3K4B A;  1HQC A;  5E3N A;  3O6B B;  3A03 A;  3DTI A;  3T0Y A;  3X2Q H;  1WCM J;  4R8H A;  4ZC3 A;  2M7A A;  4S04 A;  1X4O A;  1ZAO A;  4BH9 A;  4J00 A;  2K02 A;  4BHB A;  2XRN A;  3ZRG A;  2P5L C;  5KNL A;  1TLH B;  3DU6 A;  3ROU A;  4C2M J;  1F36 A;  2M0M A;  3BJ6 A;  4P9U A;  3GFL A;  2DDB A;  3BQZ A;  3AG2 H;  2XB0 X;  2L9R A;  3LL7 A;  2VON A;  1S6L A;  4BJ6 C;  5M3M J;  3J7Y J;  1D5V A;  2LKX A;  5D4S A;  1U5T A;  3KP6 A;  1U0J A;  2PG4 A;  2QBY B;  4MTD A;  1BW5 A;  2LTP A;  5F64 A;  3WTS C;  1SVO A;  4XR6 A;  1D8K A;  3ASO H;  1WI3 A;  5GAD J;  1VQ4 I;  4JX6 A;  4XLE A;  3K1M A;  2DK5 A;  5EZH A;  2ETH A;  1ZEL A;  3CC4 I;  2WB1 A;  4B3A A;  4IRG A;  4MEX F;  5DCM A;  3IWF A;  5LGU A;  2P81 A;  2VJI A;  4M74 A;  3BR6 A;  1R6R A;  4UY8 I;  2EZK A;  1MH3 A;  2WB1 N;  3C7J A;  3S2W A;  5L3E A;  2JT1 A;  2VBX A;  4U0W A;  4OIP F;  1ZHF A;  1A31 A;  4H0E A;  3BR3 A;  2Z33 A;  2LSO A;  2JVH A;  2CG4 A;  2X6W A;  2ZB9 A;  1FEX A;  1WSU A;  1IW7 F;  2XSJ C;  1OYW A;  1D0Y A;  5K5O A;  4X1E A;  4KUM A;  3L2C A;  4B44 A;  1IV6 A;  1S72 I;  3JRI A;  3HKZ N;  4NQW B;  5KHD A;  3KPH A;  1I6X A;  1OPC A;  1TNS A;  4I09 A;  4OIR F;  3QYB A;  4BU2 A;  4CDG A;  3FDY A;  2HDD A;  4A3D J;  2MLG A;  2R7T A;  2QUF A;  3BWG A;  2ISZ A;  5ERI A;  2IJL A;  1MBG A;  3VSK A;  4HLY A;  4B1R A;  2KIS A;  2WAE A;  2O9L A;  1TC3 C;  2CV1 A;  3HB9 A;  2ZJQ F;  3MD2 A;  2WC2 A;  3CZ6 A;  1TW2 A;  1IO2 A;  4AIJ A;  5ILV A;  1LQ1 A;  3ERE D;  2WBM A;  5JHU A;  4GDF A;  1OR7 A;  1R1V A;  1RC9 A;  4KJZ A;  1WJB A;  2L7Z A;  4BE0 A;  3V7R A;  5FFZ A;  2DA6 A;  2M2E A;  4X6A J;  3Q9V A;  3ZOB A;  2QKL B;  4XLH A;  3CJN A;  2FD5 A;  3K4C A;  1W7P A;  3SYT A;  4HNT A;  2PN6 A;  3OL3 A;  2HKX A;  1PVE A;  2JZY A;  1S3J A;  1YJ9 I;  3DPL C;  3RKY A;  3JTG A;  2F5E A;  3KYC B;  5HOD A;  2MSY A;  3LSI A;  3OOP A;  3FBI B;  3REO A;  5K7Z A;  5ICE A;  1E2X A;  1T38 A;  3LFK A;  2KPM A;  1JE8 A;  1XGM A;  3VYR B;  2Z99 A;  2NOJ B;  4EGZ A;  2K86 A;  1U5T B;  1S7E A;  3H1C A;  4O3M A;  1E0E A;  3AKZ A;  1H89 C;  2DMN A;  1ZRC A;  4PSX A;  3L2V A;  4DQ2 A;  1NK2 P;  2R93 J;  4L0Y B;  1VQM I;  2E1C A;  3ZP5 A;  3KZZ A;  4XOT A;  2CSO A;  4QTR A;  3CME I;  1H9G A;  1RR8 C;  1ETW A;  2ELJ A;  4XNF A;  5CVV A;  2EV5 A;  4II2 A;  1RPW A;  1D3Y A;  5DCM B;  1Y6I A;  1R7J A;  2VN2 A;  1I27 A;  4BAC A;  4R1H A;  4OIQ F;  3LWF A;  1H9T A;  4A69 C;  2EZH A;  4GYG A;  2JA8 J;  3OL4 A;  2HZD A;  4CHU A;  2VKH A;  2O5R A;  1S9H A;  4HPQ A;  1GVJ A;  3CUQ C;  2JN6 A;  2L01 A;  1F43 A;  1ON1 A;  4M72 A;  4W97 A;  2R4G A;  3L1P A;  4F52 A;  2LFB A; 
#chains in the Genus database with same CATH homology
 1FMV A;  4Y3O A;  2F6C A;  1MMN A;  2KMU A;  2PMZ A;  4LIU A;  4XN3 A;  2V26 A;  3PL8 A;  4CH7 A;  3OYG A;  2HU9 A;  4HRI A;  3KYL A;  2OC6 A;  2KQR A;  3ONQ A;  1Z21 A;  5HOO A;  2VJ4 A;  3HOT A;  3OWT A;  4AYB A;  3ZCO A;  3NWT A;  4XM3 A;  2ZFU A;  3AFH A;  3L2R A;  4BDY A;  4C2U A;  3PSI A;  3C2H A;  3KX2 A;  4ZDP A;  2XAU A;  4PUS A;  4RM3 A;  1G59 A;  1WJC A;  3I9V 2;  2X1C A;  2CFO A;  4QPQ A;  3OR1 C;  4NNJ A;  1D0X A;  3H35 A;  1D1A A;  1PJR A;  3DKY A;  2IGM A;  2VQC A;  1WFX A;  2V9K A;  5HNH A;  4XKC A;  1FMW A;  3ZXS A;  3OYC A;  3H5N A;  3AL0 C;  4XQF A;  2KL4 A;  1W36 D;  2DT6 A;  4RM2 A;  3QYF A;  3PUB A;  5KCM A;  3OYH A;  1X1C A;  2F5V A;  1PYV A;  4YRV A;  4E7K A;  3ZGK A;  1T0F C;  3IUO A;  3PNY A;  4XKW A;  3FKJ A;  3HPG A;  3H5R A;  3LSG A;  4DBR A;  3W3C A;  2LH9 A;  2X85 A;  4ZDL A;  3ZQQ A;  2DT7 B;  2XC7 A;  4II3 A;  2CH0 A;  2GOM A;  1BR2 A;  2JUG A;  1J09 A;  4E7I A;  1JI8 A;  4BE2 A;  1NG7 A;  3CJQ B;  4PK4 A;  2DCE A;  3HUG B;  3DPT A;  1DQU A;  5CQG A;  3OS2 A;  2R7S A;  3H9Q A;  4YEL A;  4NC8 A;  4BJ5 C;  4CCO A;  3EPZ A;  4CZC A;  1Y56 A;  3LSH A;  4AVZ A;  3E1S A;  3QYE A;  1AA7 A;  2KLO A;  2CMP A;  2W7N A;  4IQJ A;  1G8X A;  2VIX A;  3PSF A;  5JHF A;  3TBI A;  2MD0 A;  3AL0 B;  2A5W A;  4U87 A;  3S3O A;  2W1O A;  2M4G A;  2WAQ A;  4DBQ A;  4XON A;  2MYS A;  2AQE A;  2F4I A;  4XLA A;  2VQH A;  1TT0 A;  2K9M A;  3D5L A;  4FAS D;  3HPH A;  2R7W A;  1MW7 A;  1V5F A;  2VQG A;  2K9L A;  2W82 A;  4AU7 A;  4YEJ A;  3TMO A;  3K70 D;  2M3A A;  2MFZ A;  2L9S A;  2E5N A;  3CP8 A;  4BEH A;  3K6G A;  2V6E A;  2LBF A;  4HST A;  4ANJ A;  1EA3 A;  4KIT B;  1DGR M;  4OAY A;  4E7J A;  2M7B A;  1OR7 C;  4PJM A;  3RCO A;  2L5Q A;  4RLQ A;  3J7A Y;  2VJ5 A;  3PJR A;  4N4N B;  1BR4 A;  4XL9 A;  1GLN A;  2BVL A;  3IP4 B;  4CSW A;  4E7H A;  4CCK A;  5LD2 C;  4BL0 B;  3EUK L;  3OYN A;  3H9G A;  3CMM A;  2VL8 A;  3G2B A;  4CCM A;  4CCN A;  3HOS A;  3K4N A;  1X1A A;  2MC4 A;  3TL4 X;  2VPL A;  2R7V A;  2L7K A;  2I8D A;  4E7L A;  2CS3 A;  3BC8 A;  4ZJZ A;  4P5O A;  4CA0 A;  4DJA A;  2ZXI A;  3DKX A;  2LOO A;  2P0W A;  2JSP A;  4RLF A;  3OYD A;  1X1B A;  3BG7 A;  4NUB A;  4C2T A;  2E1M B;  3H5A A;  5HLT A;  4KIS A;  3HXL A;  1YE9 A;  2Z1D A;  3V42 A;  4E6K G;  2R7Q A;  4FET A;  2GOX B;  3NWS A;  2V7F A;  4U7B A;  2V4J C;  1IRX A;  4KT6 A;  3OMY A;  3OY9 A;  2VXZ A;  1BOB A;  3L2Q A;  2DOA A;  3N05 A;  5CPR B;  2XDV A;  2DJI A;  1YX3 A;  4XKB A;  4BS9 A;  2BW3 A;  1Z3Y A;  1OLT A;  3MMY B;  4C30 A;  3DTK A;  2KZV A;  4LG3 A;  2FUG 2;  4XMY A;  4PFP A;  4CUG A;  4PSW A;  2CW8 A;  2L2O A;  4PJN A;  3U21 A;  5FRO A;  3D5S C;  1QHG A;  2IGK A;  1UAA A;  3DWL E;  1WJE A;  3A2K A;  3OS1 A;  3BCA A;  3OIQ A;  5LFA A;  3OS0 A;  3LSK A;  4DIQ A;  3BLY A;  4N4O B;  4X0G A;  2XF5 A;  3S32 A;  1WJ5 A;  3HC7 A;  2HVS A;  1WJD A;  4F93 B;  1N75 A;  3SZG A;  4QPO A;  4HG2 A;  2PJR A;  2R7U A;  3PNV A;  2IXS A;  1D1B A;  3F9K A;  3VDX A;  4BEH B;  2ZSI B;  4XKV A;  5HNF A;  3HKZ A;  3LFU A;  2X1D A;  2X51 A;  2CV2 A;  4CCJ A;  2VAS A;  1X19 A;  3OYA A;  2KRH A;  1SFK A;  3QOE A;  4Y33 A;  4D1Q A;  3EUH C;  3IAM 2;  3OYF A;  4C9Y A;  1BR1 A;  3OYB A;  2A6T A;  3W2A A;  2VB6 A;  2VQL A;  4PFO A;  4Y4R A;  3MKZ A;  2R7X A;  3DLA A;  2X6Y A;  1UG0 A;  2WY7 Q;  3FHN A;  4ZYA A;  4EAT A;  2LC2 A;  3CP2 A;  4XLF A;  2K5C A;  1MMD A;  3K4L A;  3M8J A;  1N77 A;  5FRM A;  2E1M C;  3SDB A;  2HPM A;  3OR2 C;  2X1E A;  2HVQ A;  2XF6 A;  4F92 B;  1LVK A;  4IQ4 A;  2R7O A;  4PJL A;  2WA0 A;  4R79 A;  1KON A;  3A4C A;  3OYL A;  2W00 A;  1D0Z A;  3HG9 A;  2HDW A;  3I3L A;  2XF7 A;  4XN0 A;  3OOU A;  5FRN A;  4F91 B;  2R7R A;  1QHH D;  2ZSH B;  4B3X A;  2L9N A;  3RQ4 A;  4XOP A;  2HQA A;  3VWB A;  2IS4 A;  1TZL A;  3RTR A;  1LKX A;  4XOR A;  3OYE A;  1V5E A;  3S8P A;  2M4K A;  4P1W A;  2BW3 B;  4BDZ A;  1SAU A;  3S3N A;  1UEL B;  2CUJ A;  2LRE A;  2IGN A;  2VJJ A;  2LRD A;  5CKT A;  3ZR8 X;  3DTE A;  4XLC A;  1DGW Y;  3H0D A;  4MLO A;  3OYI A;  1W36 C;  1VZ0 A;  2Z2S B;  3SEQ A;  3DU5 A;  3OYK A;  3VYT B;  4E4H A;  2VKD A;  3BCB A;  4BGD A;  3L2W A;  3H9J A;  4H4K C;  4IZZ A;  3EUA A;  3K4B A;  2K3P A;  2PJR B;  1ERD A;  4BUP A;  4BXF A;  2MAB A;  2RQQ A;  2Z16 A;  3DTI A;  3VYS B;  1X1D A;  4D9J A;  1NG6 A;  2ZXH A;  3OYJ A;  1V5G A;  4HEA 2;  4ZC3 A;  2M7A A;  3HL2 A;  1X4O A;  2E60 A;  2LG4 A;  1D1C A;  4J00 A;  1QU3 A;  3BG6 A;  4IX7 A;  3ZRG A;  5KNL A;  1YX5 A;  4ZTJ A;  3DU6 A;  4CCL A;  2DXI A;  2JVG A;  2M0M A;  2JA2 A;  3LSM A;  3LL7 A;  2IGO A;  4BJ6 C;  4BE1 A;  3GBG A;  1MMA A;  1U0J A;  4B47 A;  4E7Z A;  3A1Y A;  4J01 A;  2IS6 A;  4B43 A;  3UR3 C;  3S3M A;  4XR6 A;  4XLE A;  1HA8 A;  3S93 A;  1ZEL A;  3K4K A;  2WB1 A;  2OUM A;  1LDK B;  2KDO A;  1DP3 A;  2VJI A;  1T95 A;  4JQF A;  1R6R A;  2VLA A;  3VYU B;  4HNU A;  3MKW B;  3M1C A;  2UWM A;  4F55 A;  2LY1 A;  3OYM A;  4PJJ A;  3IAS 2;  3VSL A;  2JVH A;  2X6W A;  4OWR B;  3K70 C;  2WAD A;  2Y0S A;  4LIV A;  2XSJ C;  2LBF B;  1N78 A;  1D0Y A;  2KP6 A;  3QOD A;  3RSN A;  2WAF A;  4B44 A;  1Z3X A;  4GRI A;  4HSR A;  4NQW B;  5KHD A;  4IKF A;  1MND A;  2CW7 A;  3K4M A;  3QYB A;  4BU2 A;  1X4P A;  3FDY A;  2UUZ A;  3MKY B;  2E5Z A;  2Q1Z B;  2R7T A;  1MNE A;  2X6X A;  4LIT A;  1P9Q C;  1Z7L A;  2BOL A;  4NC7 A;  3RPU D;  3VSK A;  2V1N A;  4BJT A;  2WAE A;  4F3Q A;  2CV1 A;  3MD2 A;  3CZ6 A;  3KEY A;  3W2V A;  3PNT A;  3DEE A;  4ZDO A;  3FBN B;  4JOM A;  2WBM A;  2IS1 A;  4B48 A;  3SEZ A;  3OIP A;  4OAZ A;  4KJZ A;  1WJB A;  3UNG C;  4BE0 A;  3CJR B;  2RRE A;  2QKL B;  4XLH A;  1LFP A;  3PFY A;  2HNH A;  3K4C A;  3SYT A;  2KRC A;  4HNT A;  3OL3 A;  5HVQ C;  1WJF A;  4ITV A;  4E7S A;  2UV1 A;  3DPL C;  3C2G A;  3D5R C;  4BQO A;  2Q2E B;  3DPU A;  3LSI A;  3DQV C;  2QKM B;  4ZTF A;  3FBI B;  1WJA A;  2BVM A;  2VXD A;  2KPM A;  2CUZ A;  5CQE A;  3VYR B;  3W2W A;  2NOJ B;  2OV7 A;  3L2U A;  1E0E A;  3AKZ A;  1K6Y A;  5TGT A;  4PSX A;  3L2V A;  3K4J A;  2IS2 A;  2WY8 Q;  4DOZ A;  4XOT A;  2CV0 A;  4G6T B;  2ELJ A;  4XNF A;  1MMG A;  4II2 A;  4DGW B;  2HVR A;  4BQQ A;  1Y6I A;  4BAC A;  2LYC A;  3CES A;  3CF2 A;  3OL4 A;  2HZD A;  2LY2 A;  2VKH A;  2O5R A;  3K10 A;  4BQN A;  3LMM A;  3E0J B;  1S9H A;  4HPQ A;  2AQF A;  2KHM A;  2RNG A;  2W4S A;  4RMN A;  2HPI A;  2R4G A;  4F52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...