4J01A

Crystal structure of fischerella transcription factor hetr complexed with 29mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
total genus 62
structure length 294
sequence length 294
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j01A02
4J01A 4HRIA 4IZZA 4J00A 3QODA 4YRVA 3QOEA
chains in the Genus database with same CATH superfamily
2NVTJ 2QSHX 1R6RA 2EFNA 4K2EA 5DDGA 2CQ7A 4O5VA 2LP0A 5EGOA 3J81Z 2CV1A 3GZ6A 1MMGA 3VFZA 2ME0A 1X2NA 1FC3A 5JHFA 1BN5A 3WU0A 1ODDA 2GBYA 2XF5A 2K40A 4ZYHA 2RGVA 3K9TA 5CVRA 2LMDA 4Y15A 4M72A 3A01B 3ECOA 3U1KA 3R6SA 1MGTA 1D0YA 3I58A 3O8GA 1W1WE 1Q1VA 5JVGF 2TRTA 3O2PE 4KIGA 1VI0A 2A5YB 3OYDA 1WJEA 2RQQA 1MH4A 1KZHA 2BHZA 1IXRC 5F27A 4PJMA 4D9JA 1BR2A 2CSOA 3AG1H 5DCFA 5FD5A 2QSFX 3BQYA 4MIMA 1RETA 1FZPB 1IRGA 4IOCF 4I0BA 2BW3A 3CQZJ 2MSYA 2JA8J 1B6AA 4B43A 2DQRA 4OMYA 3OYKA 3OYFA 3ELKA 3FISA 4CYCB 3OIOA 4PCQA 3T5XA 4RBOA 3VSLA 3JSOA 4W97A 3DEUA 2LREA 1FBSA 1O4XA 1ETXA 3RPUA 2D5VA 1BBYA 4RGSA 4BAYA 2Y69H 3QPSA 1SVMA 1T0FA 4P5OA 5D5WB 4X0GA 1W7PB 1K83J 4E4HA 3BOQA 3EUKL 4HX7A 2CQQA 1MDMB 2KJCA 5J1YA 1U78A 5LGNA 4IVNA 3H92A 1N75A 3CF5F 1J2XA 4A93J 3QRFF 2OA4A 3LL7A 5A2QZ 3CCYA 3PNVA 3BR1A 1VQLI 2PLYA 5CVUA 4BGDA 2DAOA 2FBHA 3LAJA 3L1PA 5LRSA 2A69F 2KZVA 1OYIA 3A0HC 3DKXA 1N77A 2W1OA 2HZTA 1IN7A 1X2MA 4CCNA 3WU2C 3ZMVA 3HYIA 4A0YA 1YQAA 2E2HJ 1R49A 2V7FA 3CZ6A 5JR3A 1O7FA 2FBKA 2VXDA 3R0AA 2KKOA 2K9MA 3CDLA 2JA7J 2FMYA 3W6JB 5GTIC 3QODA 1LB2A 2JVHA 4DBQA 3S1RJ 1T2KA 1CGPA 4N0BA 3JRHA 3TL4X 2VN2A 3PIPF 3PL8A 1YRNA 1DP3A 4UUSB 3O3KA 1I6HJ 1VQMI 3FWEA 5JLXA 1G3TA 3W2WA 2OU2A 3KEQA 2IS1A 1FIAA 1PP7U 4DZJA 1E2XA 1GV5A 3DP7A 2XB5A 2E35A 1R00A 2LY1A 2GWRA 4BQQA 5E17F 4N4NB 2R7UA 4WK8F 4GDFA 1QVTA 3CLOA 2FU4A 4BS9A 3DBHB 3I0TA 5M3MJ 1JKQC 1D1CA 1ZRFA 3DTKA 2BHYA 2BOLA 2E7XA 3HRSA 1TW3A 3QP5A 4XM3A 4BJTA 4HLYA 2GQQA 2LYCA 3OYNA 1V54H 1FTTA 1KQ8A 2WV1A 4HV5A 2K9SA 5IYDJ 2DYSH 2ZO4A 1V4RA 4MGRA 1IN5A 4M3EA 1YLFA 3T8RA 1W0UA 4BBRJ 2VJJA 2ELKA 4V2FA 5HDGA 1TT0A 4LIUA 1HLVA 3BROA 1JUPA 1ACIA 1T6SA 4G9YA 3OL4A 4U87A 3HOYJ 1MJ9A 4FX0A 2IGNA 1A04A 2PMZN 4LK0F 4M9ZA 3GTGJ 2NVQJ 1MDMA 4FHTA 2XHKA 3OMYA 4HX4A 1I3AA 2HPIA 3B73A 3GO5A 4TV7A 2M4GA 1X3WB 3C2BA 2HZDA 3TDUC 1FX7A 2X48A 3A0BC 3ZXSA 1SVLA 4NQWA 4UHTA 2M0MA 2DA2A 2ZSIB 4J00A 2PG4A 4XOPA 4Z6YA 3IH2A 4ON0A 5KAIC 1X3ZB 4G12A 2MC3A 1S7EA 1B72B 4D7MA 3E5XA 5E18F 3BR3A 1R9TJ 3I71A 2Z33A 3DPTA 3ZQGA 3GXOA 2BW3B 2D45A 4MEYF 1PUFA 1O3RA 5IY5H 3L7WA 4L5IA 2WV0A 3KP6A 4HNVA 2X9DA 2DT5A 3S3MA 1AKHA 2E2JJ 3OYIA 4DYCA 3DKYA 4MFDA 3K7AJ 4KDPA 2MH2A 4P1WA 3SEZA 4ENKA 3EUAA 1EV7A 3RYPA 2FX0A 3HL2A 1MBFA 1ZGWA 3OYGA 5H6QA 2XF6A 3SZPA 4UV9A 5K1YA 5FKNA 2J5PA 2EV6A 5FD6A 5TISC 3B02A 4F52A 1I1GA 4QLCU 2QCOA 3FXUA 4XK4A 3DLAA 1B4AA 1KU3A 2LDUA 5GADJ 3C2HA 2ID6A 2K85A 1D5YA 3VPRA 3CJQB 3HGGA 3EYYA 4E70A 1XSVA 4B3AA 3PO2J 1DPUA 4A3CJ 1FNNA 2EQRA 3CMAI 5DM7F 1XDUA 1SMYF 3ZMTA 2XASA 2COMA 1WVRA 3VDXA 5IOYA 4KA4A 1LVKA 1TQPA 2ZFWA 2NRAC 1KU2A 1VF9A 4Z2YA 1BJZA 3SFIA 2LRDA 2JVGA 4KN7X 1R36A 1EH8A 2EJRA 1GV2A 2JZYA 1R22A 2QZ8A 4L9TA 1ZKGA 3TO9A 3LSPA 1FYLA 2HQAA 2OAZA 2JN6A 3MMYB 4AYBA 5E8GA 5JI6A 2ICWG 3JREA 4AIJA 4NB5A 5HLGA 1MIJA 1MMAA 5J3LA 3U9GA 3BR6A 2XAGA 1TWAJ 3HJEA 5HS7A 1QGPA 1KU9A 2UUZA 2IVMA 4XSZF 4E7SA 1U5TC 3GTJJ 5J40A 3LNQA 2HYJA 4YEJA 3A2KA 2XKPA 1K61A 1YO5C 5D8LB 4HZFA 4L9JA 3R0JA 4Y7NJ 1J9IA 3RKWA 2R7FA 3I54A 2VUMJ 1TBXA 1YS6A 2R7TA 3E6BA 4Q47A 1IC8A 2CW0F 4CCOA 1Z1DA 5HVQC 5HDNA 1BOAA 3WTWC 3HSFA 1LDDA 4G6TB 4UVCA 3LAPA 5IPAA 3KFWX 3V8JA 3K0LA 3CP8A 1WKMA 2JQ7A 4ZYGA 2IA0A 3VB2A 3GVAA 2A6HF 2LVSA 3F6OA 3B6CA 3TEDA 2BV6A 1IXCA 1JT0A 4G7ZF 3IAS2 1ETOA 1GHCA 3V4GA 3N97A 2CRGA 3I5UA 1FOKA 2XRLA 3MD2A 9ANTA 3E0JB 1XC5A 3GEZA 4G8XA 4I0AA 4ZC3A 1SD7A 2EWNA 1IUFA 4HOBA 3KZIC 4F3QA 2Y30A 4L5JA 1HOMA 2XV4S 1QU3A 1VQ9I 4LG0A 2F5VA 2YR2A 3TW6A 1EF4A 3WTYC 2CO5A 1GXQA 1X58A 2IS6A 3OYMA 1A35A 2A05A 2A5WA 4JQFA 4EGYA 2QM3A 4B44A 1PP8F 4Q48A 1W4MA 2O8KA 4P9UA 1LJ9A 1FPQA 1E0EA 2V9KA 3MWMA 1HW5A 5LGTA 2FBIA 2HI3A 2OF7A 4F55A 1B8IA 1WHUA 1U5TB 4M6XA 1S8NA 3JRGA 3TBIA 4I09A 4I6ZA 4JK1X 2OJED 2WY7Q 3IWFA 1DGRM 1HKTA 3W2VA 4OIQF 2J5OA 2FJ1A 3F21A 1FTZA 2HNHA 3K69A 2MC4A 3IC7A 4M9SA 1OCCH 4XRSG 4HDUA 2DA5A 5LGUA 2DMQA 3E7LA 2DA6A 1QHHD 2L02A 2PN6A 5FROA 3EETA 2YSRA 2DOEA 3S14J 1BR4A 1YITI 3E5UA 4ABZA 2NNNA 4GCVA 3EQLF 4UUTA 2ME6A 1ZRDA 4IOAF 4A0ZA 2M34A 4BQOA 1FYMA 1MZBA 3HUGB 3QU3A 1XB4A 4IHTA 4M6VA 3CLQA 3WGHA 2PJRA 5IT9K 2X0LA 4BJ6C 1FP2A 1IN4A 3DPLC 3IWZA 3J7AO 3V7CA 5CLSA 3OS2A 4IJAA 3UNGC 3ECHA 3B6AA 1K4TA 2LKPA 4F7ZA 2R4GA 3F8NA 3AKZA 3G73A 4HEA2 5J4YA 4HBLA 1R5GA 4CUGA 4WXDA 2NOGA 4AC0A 4LG0B 3QPTA 5IYBJ 4IF4A 1TC3C 1OR7C 3PFIA 1UMQA 2BY1A 4CICA 1LVAA 3OYHA 1JXSA 3L2QA 3ZRGA 4EEFG 3K10A 3JR9A 4HSTA 4KITB 2LBFA 4V2GA 1UHSA 3WTXC 2AXLA 1XTAA 1XGSA 2H8RA 2EBIA 4NC8A 2DU9A 1RKWA 2P8TA 4CDGA 3IKVA 5FO5A 2OZ6A 1D0ZA 1NG7A 2K4JA 3R61A 2OTJI 1XMAA 5AONA 3HOUJ 1TW2A 3FIWA 4KJZA 1XD7A 2V26A 3F8CA 4IX7A 3OS1A 4NBQA 3F6VA 2EFPA 3RJPA 5BMZA 2L9RA 3NWTA 3V7RA 3HB9A 5DM6F 2MGQA 1KONA 2EFQA 1BI3A 2V9VA 1I1SA 3ROUA 2R7SA 3TO7A 4U0VA 2CS3A 3RSNA 1BR1A 4CZZA 1AWCA 1WI9A 1B9MA 2P7VB 3CUOA 1H0MA 1EA3A 2F4MB 3LA2A 2FNPA 1YS7A 1W7PA 1Z3XA 2E1MB 2ESNA 3HPGA 2DMUA 2MBFA 3DWLE 2O8XA 2DA3A 1VTNC 3BZ6A 3CESA 2GA2A 4BYYA 3CMYA 4PUSA 1WH5A 5HNHA 1AA7A 3WU1B 4KUMA 2DFIA 4BBSJ 3MKYB 1BL0A 3OL3A 1NH3A 5EG0B 2D1VA 5DTDA 3CC2I 3CCUI 1YIJI 4L0YB 1Z6RA 3IUOA 2BBYA 4BY1J 2OCCH 3CDIA 2DO7A 4FX4A 3CMMA 3WGIA 1ITYA 3Q0WA 2XSJC 4EJVA 2M1BA 2ISYA 5F6FA 1LEBA 4JX6A 4XR6A 3CO6C 1J59A 3DU6A 4PJNA 2LLKA 2OD5A 1P6RA 5BPDA 5JFRA 3KIOA 1SFUA 1KQ9A 1ZQ3P 1TWFJ 1TZLA 2O61A 2X1EA 2PBIA 2JPBA 1IV8A 2XAFA 2NAZA 2GIZA 2RAEA 2Z5UA 4G94A 5FFZA 4IZZA 2Y75A 1H89C 2V4JC 2E5ZA 4JYKA 2DJNA 1IV6A 2OQGA 4HQMA 1ZR2A 2L01A 2O3FA 2OBPA 4BE2A 1DQUA 2PEXA 4G7OF 4NC6A 3J7ZI 4IQJA 4XRSA 1AKHB 2P6TA 2KRCA 1JI8A 2M8GX 1Q1HA 1FY7A 4I99C 2R5ZB 4XOTA 3KYDB 3GFMA 3IV5A 3N4MA 5CQGA 5GTHC 5HLIA 1IF1A 3FHZA 4OWRB 3ZOBA 5K5QA 3GFLA 4BHPA 4CYCA 3LSGA 3F9KA 2CQNA 5CYVA 2HXIA 3SDBA 4HA8A 4HV6A 1LFUP 4BEHB 1A31A 5ED4A 1UHMA 5D4RA 3M3YJ 5GPCA 1YRNB 5BQTA 1EH6A 4E7KA 1KYWA 1W36D 3H9JA 4E7LA 1HQCA 4CZCA 1XMXA 3HRTA 3TP3A 3M7GA 2BEOA 2O7OA 4OIRF 1AU7A 1A6IA 1Z9CA 4EATA 3OOUA 4HDVA 1RRJA 2LD5A 3IRQA 4UNOA 4Y52J 4BDYA 1K78A 4OAZA 4AU7A 1JKPC 1CF7B 1VQPI 3W6KB 3HOSA 4D1QA 2Z3YA 1NK2P 3S15J 4AIKA 3G3ZA 3A1YA 2FEZA 2IJLA 1IZ1A 3TGNA 3MVPA 3TQNA 5E3LA 1WPKA 1S7AA 1CF7A 3P7NA 3BC8A 3V42A 2VPLA 3K6GA 3KETA 4M74A 5IP6A 2X6XA 4NDLA 2XPUA 3Q5FA 5CKTA 3RQIA 2I5UA 4E6KG 1ONVA 1XG1A 2A6EF 4ZDPA 1MMDA 3DBRB 4EGZA 4UY8I 4M3GA 2OZUA 5EEHA 1APLC 3BR2A 2VL8A 2ZXJA 3FZVA 2RKHA 3I4PA 2KLOA 3FHNA 4DBRA 5B1BH 2E2IJ 4XKVA 1FEXA 2WADA 2LTPA 3EUHC 3MQ0A 4C30A 1FOYA 1Z05A 2ZXHA 3OV8A 3C1DA 2JA6J 3OWTA 5ERIA 3M9AA 2FD5A 4XL9A 1FSEA 3KP3A 3BPXA 2K9NA 2PJRB 4RM3A 2IRFG 3CCJI 2GOXB 3L09A 5FKMA 1FT9A 3RZDJ 2P0WA 5ILVA 3ZP5A 2XPWA 1DUXC 1R7JA 2W00A 1X1BA 1R5ID 2QVOA 1TNTA 2A68F 5J6XA 2F5FA 3ABLH 1JE8A 3RKYA 4OMZA 4IL6C 4LB6B 3BTIA 1CQTA 4KMFA 1X1DA 3RKXA 1HKSA 1E3OC 1B9NA 2A61A 4WWCA 2EA4A 3H5NA 4PJ0C 4LJZF 3ZGKA 2CQKA 3JW4A 1VQ4I 1Y56A 4MTEA 1WRJA 1JT6A 4DJAA 3W3CA 4Q4ZF 3S17J 1J0RA 5D5XB 1X1CA 3K4MA 2L4AA 1T0FC 1G3SA 1X1PA 5BS6A 3GW2A 2NYXA 5FJ8J 3HG9A 2L9VA 2R7WA 1P92A 3DU5A 5LD2C 5ICGA 2HKOA 2KL4A 1QA6A 4MO7A 3FDYA 3D5LA 4CH7A 1LEAA 1ZAOA 1K79A 4Y3OA 3OYJA 3MCZA 2JPCA 4ANJA 3JRAA 2FXAA 4Y17A 1HF0A 1R4MB 3F8BA 1MJAA 3S3OA 1U2WA 3D0SA 1YOVB 4MNUA 1Z0XA 2M8EA 4KMUX 2CW7A 2M45A 4CYDA 1GUUA 2XPVA 5C4XJ 2H1LA 3ZQQA 4U88A 3OYEA 2IS4A 1FOWA 1T08B 5DYMA 2EZKA 3H5RA 4L0ZB 3A01A 4XNFA 2HXOA 2KIUA 1H9TA 1X19A 4GRIA 4L9NA 2CV2A 1ZYRF 4FE4A 1MBKA 4BXFA 3HHHA 2KQRA 1YE9A 3I59A 4RGXA 2QF7A 2PFBA 5IYCJ 4XKBA 2AO9A 5F08A 4KYWA 4HF1A 2DMTA 4A3FJ 1F36A 1G4DA 3IHUA 2ZXIA 4PFOA 2VKEA 5IP9J 2VBYA 3AL0B 4X6AJ 4RGUA 4EM2A 1P4WA 2BYVE 3DBLB 2CUJA 5DV5A 1KYZA 3JCUC 3SXYA 4JX4A 4CGZA 2IGKA 3ABTA 3FM5A 2BXZA 3KLNA 1IDYA 1VQ6I 3CUQA 2CFOA 5DCMA 2WA0A 2ELJA 4LK1F 1W5CC 4I01A 2E5NA 2BY3A 1F4KA 3P5JA 3QPLA 2IGMA 3OYCA 2IA2A 1BIAA 3E6MA 4FASD 4B1RA 4GYIA 1IRFA 1USTA 3ZQLA 1QPMA 4PJLA 2L5QA 2E1NA 3BLYA 5FKOA 3BG6A 3HZJA 3OY9A 3S8PA 1VQOI 2M7AA 3HOXJ 5M5WJ 5GAEJ 5C3EJ 3RZOJ 2VQLA 3C3WA 3TOBA 3JRBA 4L18B 5FGMA 4HX8A 3WHCA 2XAJA 3WHBA 4CCKA 4XIDA 2I8DA 2MG4A 4P9FA 4ZYDA 5LEKA 2HPMA 4XLPF 2R93J 3MFKA 1K7AA 1A6QA 2WAQA 3QYBA 3KEYA 1YFHA 3FMQA 1S6LA 2LH9A 1WJCA 3GLLA 1IW7F 1OYWA 1P4AA 1E17A 1O57A 1OKRA 4IRIA 4A6DA 1K4SA 3BTCA 1SC7A 2WAQN 4ZYAA 2MD0A 2KDOA 2VKHA 1A36A 2F2EA 3KP7A 1IRXA 5J1RA 2R0QC 2XAQA 3BZCA 1SVOA 5IOZA 4YELA 4MTDA 1FIPA 3IKTA 4DIQA 2VE9A 1SANA 3L9FA 1T95A 2WWYA 4D0PA 5E20A 4BACA 2X4HA 4EMSA 2IT0A 4YIRX 2EPFA 2ZMEC 2ACJA 4UVAA 2OV7A 3JTHA 1YJWI 2OQRA 3DKWA 2A3SA 3DEEA 3J7YJ 4KT6A 1HA8A 2PQ8A 3M8FA 4OOIA 5L3EA 3P9IA 1T98A 4DW6A 2QA4I 3PJRA 2QBYB 1YIOA 1L3LA 2IEKA 4O6JA 1ZH5A 1N78A 2STTA 4RM2A 2CQXA 2ZXWH 3CJTB 4DYRA 2RDPA 1ETVA 4PJJA 3KZYA 2Z99A 5B5EC 3E97A 1VQNI 2VBZA 3CDHA 5LEJA 4UVBA 5DCMB 3VSKA 4C2UA 2H94A 3OS0A 3MZYA 2AHQA 4EJTA 2IGOA 1YYVA 2DI3A 3GX4X 2M2EA 3SZTA 2VC1A 3QOEA 4ZZLA 2XSDC 3CD6I 3H9QA 1JJ6C 3CUQB 3RKQA 3K2AA 2FMLA 3HRMA 2R7VA 3W6VA 2ZB9A 2PX9A 3S32A 2QQ9A 2LNBA 3ZQ7A 3GTKJ 2CW8A 2FRHA 2PMHA 2LFBA 2RNJA 2VQCA 5AIPA 4RAFA 4UB6C 4IHXA 1T33A 5FKKA 1WI3A 2L4MA 1XGNA 2X1CA 3COAC 1JUSA 3DTEA 3CCQI 2CG4A 2N8GA 4XRMA 1MKMA 5DUKA 3UKGA 1TL8A 2O6GE 3KLOA 2KMUA 4D7NA 5J8CA 5F04A 4HNTA 1WSUA 2MLGA 3K1MA 2HOSA 2W24A 2DDAA 3VYTB 2AS5F 4RAYA 2JRTA 2YX4A 1ORKA 2E60A 4I76A 2Z1DA 1XPXA 1T38A 3K1NA 3M8EA 4XKWA 2E7WA 3WTSC 4IPAA 1Z7UA 3GMEA 1ON2A 2G9WA 4UUSA 2ELHA 1G2HA 3OR1C 3OSGA 3BY6A 5KK1A 2DJIA 2FSWA 3AG3H 2VB6A 4KNYA 4LFUA 3FX3A 1V5EA 3HM5A 2DA7A 1K6OA 3ZN1A 3ONQA 5B3SH 1P7IA 3S2HJ 4BY7J 5ICCA 1OYYA 2OC6A 4GGGA 2IP2A 4A3DJ 4BNCA 2Y48A 3BCBA 3I3LA 3PUFA 1RESA 2H8WA 1JGGA 2EZHA 2XAUA 4EV0A 2K27A 3DF8A 2HFHA 3PUBA 1HDPA 2LG4A 4PSXA 5CJ9A 3QYFA 1U9OA 2O03A 4H0EA 4WXCA 2M9HA 1ZK8A 3GF2A 3IL2A 4DQ2A 3LFKA 2Z9OA 2KRHA 4JOMA 2ZCWA 3S3NA 3BZKA 3QAHA 2DCEA 3KYLA 3FBNB 4A3LJ 4XLHA 2LOOA 5TGTA 3F3XA 2Q1ZB 1XGOA 4AWXB 3FMRA 1TQMA 1TT5B 2VOOA 1W7PD 1XCVA 3DPUA 3I64A 4MQ9F 3KYCB 2BE5F 4ZDLA 3J80K 4B47A 2YU3A 5HS9A 5E3OA 3FBIB 1BI0A 4HYEA 3PM1A 5HNFA 1B59A 1RIOH 1ENHA 3O6BB 1UG0A 2L0KA 3JAMK 3A03A 2DBBA 3GTLJ 3ABKH 2LKSA 2GM4A 2WAEA 1FYKA 3NRVA 1FP1D 2ESHA 2I10A 3SJMA 2V79A 1FBUA 1UAAA 2LY2A 2P6SA 5LHGA 2HWVA 4DGWB 1Y0NA 2LKXA 3QQAA 5KVRA 4Q5SF 2ZNYA 3GTOJ 3D5SC 2DMNA 4A3EJ 2O9LA 1YX3A 3WE2A 3K70D 4FETA 1TWCJ 4CSWA 2HQNA 1WCMJ 1Y0UA 2XAHA 3KP4A 5ILUA 2IA1A 4JP0A 2DXIA 2Q0OA 4AVZA 2IW5A 1FMVA 2DT6A 3DQVC 1ZLJA 2K3PA 2R7QA 3VYUB 3C18A 1F43A 1EKEA 3KPHA 2P81A 2HVQA 5DD8A 1MSEC 2DA1A 4EJOA 1WH7A 2VPRA 4WF2A 2YU9J 3TDZC 3KE2A 1XDSA 1F9NA 2DTRA 3OIPA 4E7HA 3Q0VA 4BXUA 4LLNA 2MLKA 1U3EM 1XGMA 1DPRA 4HG2A 4N9HA 2GLOA 2VJ5A 4F92B 2MABA 3HSRA 5E3MA 2R7RA 3QWLA 4BL0B 3BJOA 2XKOA 4FQGA 3M1EA 4UV8A 3I59B 3E1SA 5IT3A 3HBLA 2DFHA 5LFAA 4KT5C 3TKYA 1R71A 3BJ6A 4M3BA 1XN7A 1YG2A 5E79C 1SD4A 3OOPA 4IO9F 3ZQIA 4RAZA 2KP6A 3P9CA 2NXNB 3NQOA 1GVJA 1QVUA 1F1ZA 2VBXA 2G7HA 3VWBA 2HQ5A 3CCSI 1B72A 2FUG2 2RV8A 2R7OA 2KIFA 1BC8C 2DLLA 3ISPA 3S1NJ 3FKJA 4NUBA 1RUNA 3H9GA 3FXOA 3SFZA 1ETWA 5FLXZ 4LLGF 4A2UA 3GTPJ 3M8JA 3Q0UA 3QPHA 4XQFA 1KA8A 5J8FA 3CCLI 1WGXA 3JTGA 1XSDA 2V1DA 2GA1A 1LNWA 1OFCX 3L2CA 2K9QA 2F48A 2QYOA 2R5ZA 1R5HA 2QKLB 4A6EA 1UCRA 3FXRA 3H0DA 3NARA 1OCZH 1Z91A 2KHMA 4OIOF 5L3FA 1K6YA 3V8LA 4S0HB 2QWWA 3AFHA 2K7LA 4BHCA 1G6NA 4AM3A 1TP4A 2KZGA 2OCEA 1MNEA 4M71A 3ZQFA 5M5XJ 3R4KA 4XLCA 3N05A 1UHWA 3HRUA 3K2ZA 1VNDA 3BG7A 4Y33A 1K78B 2H09A 3IRRA 1WJAA 4HW0A 3RQ4A 3J7AY 5HLHA 1ETYA 2WB1N 3F23A 2ZMEA 5KCMA 1REPC 5D6FA 1GLNA 3G1MA 3IH4A 2ZFUA 3HKZA 3LSRA 3JRCA 2C6YA 3LSKA 1XX5A 2ETHA 3E6DA 5EF6A 2DPUA 1STZA 5HDKA 1G3YA 2DTZA 5IP7J 2IXSA 4HNUA 5D8KB 4Y4RA 5EG0A 3M07A 5E3NA 4ETSA 1S7OA 3GFJA 1MNMC 2VC0A 1UFMA 4WX9A 3TMOA 2PI0A 1D1AA 3BPVA 3D1NI 1DDNA 4HSRA 4RB0A 2K02A 1U8BA 1TWHJ 3E3VA 3EDPA 1MH3A 1R23A 2Y0SN 2Y9YA 3QYEA 4E7JA 2XGCA 2JA2A 1RKTA 1VQ7I 4BE1A 1T8IA 1MSFC 2BY2A 3OYAA 3BTLA 3ESWB 5ICEA 1W0TA 3WTTC 2BGCA 3WG7H 3GFIA 1ZHFA 3T1BA 4OAYA 3MKLA 2ZBKA 3HTSB 4R1HA 2XVCA 3WE3A 4AUXA 2D1HA 2E71A 1SFEA 1NK3P 2ZJQF 4F93B 1Y6IA 3BG9A 4XLNF 5FRNA 1HBXG 3L2VA 1HW2A 2LBFB 4CCJA 3BTJA 3K4NA 4ENNA 3A02A 4FISA 2DMPA 2M4KA 3K4BA 4R8HA 1JGSA 2Y0MA 4ZTFA 4QWQA 2JT1A 2COBA 4ZYEA 1OLTA 3MEXA 2V1XA 2P5LC 2XUBA 3G4SI 3BR0A 3H0GJ 4LOCA 4HAMA 5F64A 1MBEA 3RDIA 3AAFA 3PIOF 1MMSA 4L9VA 1JKOC 2NVYJ 3RI4A 1YI2I 1WFXA 3K4JA 1BW5A 2CWEA 1UELB 2JSPA 2ZSHB 1AHDP 3CJNA 5K7HA 1ULYA 1POGA 3LSIA 1DU6A 3U1DA 5CVIA 2VQGA 1S3JA 2VJ4A 3MAJA 1IUYA 4NNJA 2FE3A 2HDDA 2ZJRF 1GDTA 2A07F 3OIQA 4XICA 4ENMA 3H3UA 4IQ4A 3LQRA 4II2A 2WAFA 1QNTA 3AG2H 2QQBA 3CC4I 3REOA 1J5YA 2UXXA 4CA0A 4FE7A 3FF5A 2M5WA 3PNTA 3U2RA 4DYQA 3GUDA 3RCOA 5J47A 2XB0X 2VODA 4NHJA 4HF2A 3S93A 4ZJZA 1Z67A 4EQQA 4R79A 1TLHB 3I53A 2CH0A 5M5YJ 4IXAA 5GAGJ 3EPZA 2JK3A 4KISA 4AD9A 2K3FA 3BWGA 1E3HA 1JUMA 1BW6A 1FSHA 1RI7A 3RYRA 1JHHA 3ZPLA 2GXBA 1YJ9I 5DD4A 2MD5A 1OISA 3V8KA 5FLMJ 2W4SA 1SD5A 2QEXI 3QOPA 2XGXA 2UWMA 5CPRB 1OMIA 2CU7A 5E1WA 4XBFA 1ON1A 3ASNH 3I9V2 3TP0A 1ZRCA 4XRFA 3ABUA 2DK5A 4YFNF 1HSTA 1PDNC 3F22A 2NS0A 3HEFA 2QBYA 2L7ZA 3CCVI 2ZKZA 3GZ5A 3BT9A 5D6EA 4IHYA 5EJCA 3HDDA 2DK8A 1UZCA 1ZELA 5ILSA 3A4CA 1I6XA 3FXJA 3PFYA 2NVXJ 1BI2A 4CCLA 4KICA 4AVPA 3LA3A 3MZHA 4XORA 2A6TA 2Y9ZA 4LB5A 4U0YA 1BI1A 1ZN2A 3OSFA 1AOYA 2DOAA 4PGHA 4IKFA 5E1ZB 4FT8A 5H6RA 3FKIJ 3PO3J 3PQKA 3J80Z 1OCPA 3D5RC 4JX5A 1LFPA 2V9PA 1T39A 4ASNA 2VE8A 1TNSA 4HLXA 1Z7LA 2H1KA 1YW7A 2B63J 4RA2A 1WJBA 3LSTA 2HOAA 2L9NA 4C2TA 2CUZA 4ZDOA 3JAMZ 2QSGX 2RNGA 1E3PA 4HRIA 1DGWY 2FQ3A 1MW7A 3IP4B 4G6DA 4RGRA 3SQNA 2F5EA 1SAUA 2Y2ZA 4AIDA 3CC7I 2WTEA 4GO1A 1IJWC 1PUFB 5HODA 4RS8A 4MHGA 1GT0C 4ZTJA 2KJBA 4D5FA 2V1NA 3RTRA 5GAHJ 1WJFA 2QLZA 3CCMI 2Y31A 3WODF 4C3JJ 3DFGA 1OR7A 4PGGA 4BU2A 5CVJA 3KP2A 2LC2A 3BP8A 4QSHA 4W1UA 4AYBN 2W7NA 3RIRA 1ZGAA 4MLOA 4C2MJ 3ULQB 3JRIA 4YRVA 1IDZA 1LFBA 4B09A 1Z77A 2CJJA 2XGDA 3LWFA 4HQEA 2V6EA 3J81K 2OUMA 1R1TA 3SZGA 4ITVA 1N25A 4BDZA 2AXTC 4A3BJ 1PJRA 2K4BA 3MZ8A 1S72I 2GOMA 3ZMDA 3F0CA 3ZN0A 2UXNA 2PJPA 2Q2EB 4J19A 2E19A 1VQKI 1XSXA 2O0YA 1BIBA 1O3TA 3HXLA 1O3QA 1Y1VJ 4XMYA 2HOTA 4RLQA 1X4OA 2KIMA 2RREA 3QP6A 3GCMA 3IAM2 3CP2A 2VBWA 4KFCA 1GXPA 1RPWA 5K5OA 2ZJPF 1HCRA 3NEUA 4RB3C 4LD5A 4E7ZA 4XKCA 3MN2A 4XONA 4B48A 3ABMH 3FXKA 2X6OA 1ZG1A 2HU9A 3ZMZA 3HPHA 3LFUA 4LITA 3ZQCA 2R7DA 2G0EA 1D1BA 1BJAA 3G71I 2VLAA 5DEQA 4BEHA 4DOZA 2WB1A 1U8RA 4ESFA 3GZNB 1WQ2A 5F1JA 3S1QJ 2LY9A 2RVCA 2EILH 4M3DA 1Y39A 2MFZA 4QPQA 4ZH4F 5GPAA 4IEJA 4NC7A 2G7UA 5KNLA 3LSJA 2KIQA 1MBHA 2IPQX 1Z21A 2VT2A 5DS9A 2HR3A 3NWSA 4B3XA 2B9SA 1UB9A 4IHSA 2EK5A 4A5MA 2H6BA 2GXGA 4YFKF 2MW8A 3SYTA 1HDDC 2NS7A 2BZTA 3WGGA 2FQ4A 5L3CA 4A69C 5LHHA 1H8AC 4DNCA 2CV0A 4ZZDA 2JUCA 4PFPA 2EFWA 5EZGA 5LHIA 4LG3A 2PMUA 1IXSB 3LSHA 4XSXF 5L3BA 5EEGA 3DLLF 2DT7B 4C9YA 1OCTC 4BE0A 1T56A 1W5SA 1FBQA 1PVEA 2M87A 1V55H 1R1VA 1QZEA 1QQIA 3R60A 4N9IA 2P4WA 4DZPA 4XN3A 2ISZA 4M73A 2HDCA 1YW8A 3BCAA 3C7JA 3OYLA 3VOEA 2XDVA 3GTMJ 4A3GJ 3ZCOA 5F0HA 3EYIA 1UJ8A 1FWZA 2V1UA 2L3DA 3M4OJ 1U5TA 4XLAA 1VFCA 3S1MJ 2FOWA 1ZARA 4U7BA 2VXZA 1G8XA 3ASOH 3ZMSA 1IAWA 1LE8B 2JMWA 2KFDA 2X85A 1PUEE 2HYGD 2P7CB 3RPQA 2D2WA 2VASA 3FXMA 1SD6A 2YPRA 1YTYA 4CHUA 1IN8A 2VKDA 3HTUA 4J01A 4ESJA 4B4CA 5FLVA 3PSIA 4CCMA 2XGEA 2QKMB 1FLIA 2GXAA 1RR7A 1JTYA 4YG2F 2IS2A 2F4OB 2XIGA 1Y8QB 5FKLA 1OPCA 5FFXA 1ZR4A 4RLFA 2RC4A 1I5ZA 5TJJA 3X2QH 1HC8A 5C4JJ 3CMEI 3G1OA 3Q3SA 1W5TA 3VODA 4F91B 2FNAA 3CTAA 4LMYA 1KQ0A 2FOKA 4QIWN 4YIFA 3PNYA 2UZKA 4X1EA 2CUFA 2E1OA 3PQJA 3G1LA 5JLWA 5F0FA 4C3HJ 1RUOA 4FCYA 4KN4X 4B8XA 2OPTA 4RB1A 2BY0A 3AG4H 2XF7A 3EUHA 2L2OA 4GFBA 4XLEA 1BOBA 3T8TA 2NS8A 2W82A 1XCBA 2P5KA 1TWGJ 2IAIA 2LF7A 5A2QK 5CQEA 1QZZA 5B66C 1MJBA 4IHVA 2W84A 5J1UA 1LDJA 3HHGA 1S29A 2VI6A 2P5VA 3SDGA 2M3AA 3BG5A 3K4KA 4I2OA 4QTRA 1O7LA 2ZJ2A 4P96A 3V7SA 2OTLI 1R4NB 3CF2A 2GZWA 3HOZJ 5D5VB 3E6CC 1J7KA 2JTVA 4E7IA 4S05A 2WBMA 5K5RA 4BH9A 2HVSA 4AIHA 3GYHX 2DFEA 2DPDA 5IT9Z 3I55I 1WJ5A 1IG7A 4U7DA 2NVUB 1IGNA 2JRMA 3CCEI 4IRGA 2M0CA 2L7MP 1HW1A 2X1DA 4A5NA 1P2FA 5LLQA 1LE8A 4PSWA 2EH3A 3TO6A 2HTSA 2VT3A 3HUGA 4II3A 2EZLA 4OINF 4C3IJ 1USSA 1B1BA 4LIVA 3GBGA 4Y13A 2LSOA 4UUVA 3DCFA 1SAXA 3HOTA 1TQIA 1QZYA 3FXLA 3RPUD 3SHFA 2EIJH 4PDKA 4I98B 5JVTA 3K1PA 5E1XA 2HOEA 2VKVA 2WC2A 3L2RA 3FMSA 4M6YA 1ZG5A 1GVDA 3KP5A 1JKRC 3ML6A 1OJLA 4A3MJ 1V5GA 4YIIA 4MEXF 2VOPA 2HS5A 1MNDA 1R58A 2ID3A 5JHUA 1ERDA 1NTCA 1P9QC 3BQZA 3DTIA 5HOOA 1IO2A 1RNLA 2AQEA 4P55A 3LA7A 1SFOJ 2RQPA 1ZG3A 1S9HA 5GP9A 2XC7A 1B8IB 3P9KA 3LQQA 1C0WA 5EDNA 5BNGA 1ZLKA 2O5RA 1A5JA 1X1AA 2JJ7A 1I50J 4EVIA 5B1AH 2L7KA 3L2UA 2TCTA 3H1CA 2QQAA 5J4VA 5AIQA 4BJ5C 3DV8A 2KRFA 1Y8RB 3G2BA 2M30A 2BVLA 4HF0A 4BXXJ 1MMNA 1D8KA 2QENA 4CO8A 1KGSA 1LKXA 3BDDA 1YW9A 5EZHA 4M9XA 2EINH 3T0YA 4N4OB 2EFOA 4A3JJ 1ZGJA 4NQWB 1W36C 5M3FJ 1LQ1A 2EB7A 3F72A 1ETKA 4YFXF 5BOXA 3DEWA 4ESBA 1I39A 2LF8A 3KEOA 2ECBA 2CUEA 4XN0A 2ZMEB 1V5FA 2L9SA 3W2AA 2ZC2A 1OCOH 2GIVA 1BC7C 2DDBA 3WTVC 3UR3C 5EYRA 5FLXK 3U21A 2VONA 1ETQA 4XLFA 2W25A 3FK7A 3PSFA 5L3DA 1RC9A 1U6GA 4BQNA 2HVRA 4H4KC 2HTJA 1JTXA 4HPQA 1FJLA 4LLLA 2RN7A 1IRZA 2BXYA 3CCRI 2M7BA 2EA2A 2K86A 2KPMA 3HIFA 3JSPA 2PMZA 2DODA 2Q8KA 1IN6A 3HOVJ 1QO0D 2HYFA 4A12A 4A3IJ 2YS9A 5L3GA 1Y1WJ 2W85A 2E1MC 3H3ZA 1P4XA 4V19K 2DFFA 3OR2C 4EM0B 3CUQC 3CO7C 1J09A 2VIXA 4U0WA 2Z16A 2GAUA 3SEQA 3O8HA 4PK4A 1D8JA 2CYYA 4I02A 1VQ8I 3TW7A 3L00A 4EJWA 2NOJB 3ZMUA 1OQYA 1TTYA 1F5TA 1PYVA 2JWTA 1M1EB 1QHGA 1JJ8C 1NHAA 1WWXA 4IRHA 3VYRB 5E8IA 2QGUA 2L54A 1G3WA 3VEPA 2CFXA 5LBQA 1Z6TA 5FRMA 1HXDA 5KHDA 2XRNA 3KX2A 1MBJA 1SFXA 3CJRB 2STWA 4IHWA 3HOWJ 1H88C 3FK6A 4QPOA 3K70C 1V3FA 2R5YA 3BG3A 3BR5A 3S2WA 5HS8A 3BJAA 5K7ZA 4PZJA 5FB2A 1QBJA 5H20A 1LPQA 2IBDA 1U0JA 2LK2A 1D3YA 2DOFA 3GWZA 2DA4A 1MD0A 2MH9A 3H5AA 5CVVA 1Z3YA 2EV5A 4WCGA 2R5YB 3ZR8X 5H2FC 1HKQA 1I27A 4M3FA 2L7FP 2DQLA 1EH7A 2F5CA 2HKXA 5KAFC 3LSMA 3ZQHA 3ERMA 5C44J 3LOCA 1DU0A 1BM9A 2E36A 4GXOA 3KZZA 3JRDA 1DP7P 3AL0C 3KCCA 2YUSA 2ADUA 4MFEA 2Z2SB 4RDUA 2MYSA 3E5QA 2R3SA 3H35A 3Q9VA 2FA5A 1FOXA 3HC7A 4MQVA 2AQFA 3M1CA 5F1RA 3VYSB 4WXHA 1RZ4A 2EIMH 3H36A 2JA5J 5TRDA 4GYGA 2W57A 4RMNA 4UB8C 3I4NJ 3MKZA 2X51A 1G59A 1O3SA 1NG6A 1YJNI 4I7HA 1VQ5I 2YX7A 4BQAA 3L2WA 3S16J 3ERED 1P7JA 2H6CA 4G7HF 2HQRA 2X6WA 3WTZA 1WJDA 2R7ZJ 4BKXA 1SEUA 4OIPF 1X4PA 1LUJB 5D4SA 3MKWB 2WY8Q 1SFKA 2QUFA 4LGWA 1LDKB 2EV0A 2Y0SA 4BHBA 4BUPA 2JUGA 2KISA 3HGYA 1S5LC 2VJIA 1D5VA 5ICFA 1H9GA 3GLXA 3Q9SA 4L5EA 2K9LA 2E1CA 2BVMA 2CMPA 3FM3A 5HLTA 5LRRA 4OU0A 4G6QA 4A0XA 5EGOB 2Q2EA 1XMKA 4RB2C 3FXQA 2DW4A 2EIKH 3IH3A 4FTHA 6PAXA 3WG9A 3G6EI 2JSCA 1MBGA 1HSJA 4O3MA 3K4CA 1VZ0A 1SMTA 1QPIA 2KT0A 2HDWA 1U9NA 1J75A 4D5CA 4EM1A 4KIBA 1BA5A 1QRYA 3K4LA 3F8FA 3DXJF 3HKZN 1OCRH 2DN0A 2HGCA 2ECCA 2FF4A 3F8MA 5K7FA 4S04A 3WTUC 3H3VK 1ZTRA 3QU6A 2B0LA 2F6CA 1L0OC 2F5DA 2E34A 2H27A 4CXFA 5DUIA 1X3UA 1FMWA 2CGPA 2VQHA 3TOAA 2B7EA 2EZIA 1YHQI 2KDZA 5BPIA 2R92J 5EEAA 2R7XA 2MA3A 2K5CA 3OYBA 1EJ9A 5F0CA 2X6YA 2QQ8A 3I4MJ 3LMMA 1RR8C 1ZREA 3C2GA 1XS9A 2ZNZA 4EJUA 1JHFA 1WZ2A 2HEOA 4A3KJ 1D0XA 3S2DJ 3NAUA 2DYRH 3GTQJ 4UXNA 2TDXA 1I3QJ 2UV1A 2NNYA 4JBAA 1UG2A 3I56I 3JRFA 4ENJA 3HSEA 2XROA 2F4IA 4RAGA 1R1UA 2LR8A 2V6CA 2W48A 5D5UB 1KU7A 1YX5A 4KIFA
chains in the Genus database with same CATH topology
4XONA 4B48A 3CESA 2KRHA 4JOMA 2HU9A 1R6RA 3HPHA 3LFUA 4LITA 3S3NA 4PUSA 2DCEA 1D1BA 5HNHA 3KYLA 1AA7A 2VLAA 3FBNB 4BEHA 4DOZA 2WB1A 3MKYB 3OL3A 2CV1A 4XLHA 1MMGA 2LOOA 5TGTA 5JHFA 2Q1ZB 2XF5A 3IUOA 2MFZA 4QPQA 3DPUA 3CMMA 4NC7A 4ZDLA 4B47A 2XSJC 5KNLA 3FBIB 1D0YA 5HNFA 1Z21A 4XR6A 3NWSA 4B3XA 1UG0A 3DU6A 4PJNA 3OYDA 1WJEA 2RQQA 3SYTA 1TZLA 4PJMA 2X1EA 1BR2A 4D9JA 2WAEA 1UAAA 4IZZA 2CV0A 2LY2A 2V4JC 2E5ZA 4PFPA 2BW3A 4DGWB 4LG3A 4B43A 3D5SC 3LSHA 3OYKA 3OYFA 1YX3A 1DQUA 2DT7B 4BE2A 3K70D 4FETA 4C9YA 4CSWA 3VSLA 4BE0A 2LREA 4IQJA 2KRCA 2DXIA 1JI8A 4AVZA 4XN3A 4XOTA 1FMVA 2DT6A 5CQGA 4P5OA 3DQVC 2K3PA 2R7QA 3BCAA 4OWRB 3VYUB 3OYLA 4X0GA 4E4HA 2XDVA 2HVQA 3LSGA 3ZCOA 3F9KA 3EUKL 3SDBA 4BEHB 4XLAA 3OIPA 4E7HA 1N75A 4U7BA 2VXZA 1G8XA 3LL7A 2X85A 3PNVA 4HG2A 4E7KA 2VASA 1W36D 2VJ5A 4F92B 2MABA 3H9JA 4BGDA 2R7RA 4E7LA 2VKDA 4BL0B 4CZCA 1N77A 2KZVA 4J01A 3DKXA 2W1OA 3PSIA 4CCMA 3E1SA 4CCNA 2QKMB 5LFAA 4EATA 3OOUA 2V7FA 3CZ6A 2IS2A 2VXDA 4BDYA 4OAZA 4RLFA 4AU7A 2K9MA 2KP6A 3QODA 4F91B 3HOSA 2JVHA 4D1QA 4DBQA 3VWBA 3PNYA 3TL4X 3A1YA 2FUG2 3PL8A 2R7OA 1DP3A 3FKJA 4NUBA 3W2WA 3H9GA 2XF7A 2L2OA 2IS1A 3V42A 3BC8A 4XLEA 1BOBA 2VPLA 3K6GA 2W82A 3M8JA 4XQFA 2X6XA 2LY1A 5CKTA 4BQQA 4E6KG 4N4NB 5CQEA 2R7UA 4ZDPA 1MMDA 2QKLB 4BS9A 1D1CA 3H0DA 2M3AA 3K4KA 3DTKA 2KHMA 2VL8A 2BOLA 1K6YA 2KLOA 3CF2A 4XM3A 3AFHA 3FHNA 4BJTA 4DBRA 2LYCA 4E7IA 3OYNA 2WBMA 4XKVA 2HVSA 2WADA 3EUHC 1MNEA 1WJ5A 4C30A 2ZXHA 3OWTA 4XLCA 2VJJA 1TT0A 3N05A 4LIUA 4XL9A 4Y33A 3BG7A 2X1DA 2PJRB 4PSWA 4RM3A 1WJAA 3OL4A 2GOXB 4U87A 4II3A 3RQ4A 2IGNA 3J7AY 2P0WA 4LIVA 3OMYA 3GBGA 2W00A 1X1BA 5KCMA 3HOTA 2HPIA 1GLNA 2ZFUA 3HKZA 2M4GA 3LSKA 2HZDA 3RPUD 3ZXSA 2M0MA 3L2RA 1X1DA 2ZSIB 4J00A 2IXSA 4XOPA 4HNUA 3H5NA 4Y4RA 3ZGKA 1V5GA 1Y56A 3DPTA 1MNDA 4DJAA 3W3CA 2BW3B 1ERDA 1P9QC 3DTIA 1D1AA 3TMOA 5HOOA 1X1CA 3K4MA 1T0FC 2AQEA 4HSRA 3S3MA 1S9HA 2XC7A 3OYIA 3HG9A 3DKYA 3QYEA 2R7WA 4E7JA 3DU5A 2JA2A 2O5RA 5LD2C 4P1WA 3SEZA 1X1AA 2KL4A 4BE1A 3EUAA 2L7KA 3HL2A 3FDYA 3OYAA 3D5LA 2XF6A 4CH7A 3OYGA 3L2UA 4BJ5C 4Y3OA 4F52A 3OYJA 3G2BA 4OAYA 4ANJA 2BVLA 1MMNA 3DLAA 3S3OA 1LKXA 3C2HA 3CJQB 4N4OB 4F93B 1Y6IA 2CW7A 4NQWB 1W36C 5FRNA 3L2VA 3ZQQA 3OYEA 2IS4A 2LBFB 4CCJA 3H5RA 4XN0A 3VDXA 3K4NA 1V5FA 2L9SA 4XNFA 3W2AA 2M4KA 3K4BA 1LVKA 1X19A 4GRIA 3UR3C 4ZTFA 2CV2A 3U21A 4XLFA 3PSFA 1OLTA 2LRDA 2JVGA 4BXFA 2KQRA 1YE9A 2HVRA 4BQNA 2HQAA 3MMYB 4AYBA 4H4KC 4XKBA 1MMAA 4HPQA 2ZXIA 4PFOA 2UUZA 3AL0B 4E7SA 1WFXA 2M7BA 3K4JA 1UELB 2JSPA 2ZSHB 2KPMA 4YEJA 3A2KA 2PMZA 2CUJA 3LSIA 2IGKA 2E1MC 2VQGA 2VJ4A 3OR2C 2R7TA 4NNJA 2CFOA 1J09A 2VIXA 2ELJA 2WA0A 2Z16A 4CCOA 3SEQA 5HVQC 2E5NA 3OIQA 4PK4A 4G6TB 4IQ4A 4II2A 2WAFA 2IGMA 3OYCA 2NOJB 4FASD 3CP8A 4CA0A 4PJLA 2L5QA 3BLYA 3PNTA 3BG6A 3RCOA 3OY9A 1PYVA 1QHGA 3S8PA 3S93A 2M7AA 4ZJZA 2VQLA 4R79A 2CH0A 3IAS2 3VYRB 4CCKA 3EPZA 2I8DA 5FRMA 5KHDA 3MD2A 3KX2A 3E0JB 2HPMA 4KISA 2WAQA 3CJRB 3QYBA 4ZC3A 3KEYA 2LH9A 1WJCA 4QPOA 3K70C 4F3QA 2W4SA 1QU3A 2F5VA 2UWMA 5CPRB 4ZYAA 2IS6A 2MD0A 3I9V2 3OYMA 1U0JA 2KDOA 2VKHA 2A5WA 1IRXA 4JQFA 3H5AA 4B44A 1Z3YA 3ZR8X 4YELA 1E0EA 2V9KA 4DIQA 1T95A 3LSMA 4BACA 4F55A 3AL0C 3TBIA 1ZELA 2OV7A 2Z2SB 2MYSA 2WY7Q 1DGRM 3A4CA 3DEEA 4KT6A 3H35A 3PFYA 1HA8A 3W2VA 2HNHA 4CCLA 3PJRA 2MC4A 3HC7A 4XORA 2A6TA 2AQFA 3M1CA 3VYSB 1N78A 2DOAA 4IKFA 4RM2A 3D5RC 1LFPA 4PJJA 1QHHD 4RMNA 5FROA 3MKZA 2X51A 1G59A 1BR4A 3VSKA 4C2UA 1Z7LA 1NG6A 3OS0A 2IGOA 1WJBA 3L2WA 2L9NA 4BQOA 4C2TA 2CUZA 3QOEA 4ZDOA 2RNGA 3HUGB 3H9QA 4HRIA 1DGWY 2X6WA 1MW7A 1WJDA 3IP4B 2PJRA 2R7VA 1X4PA 4BJ6C 3MKWB 2WY8Q 1SFKA 3DPLC 3S32A 1SAUA 1LDKB 2Y0SA 4BUPA 2JUGA 2VJIA 3OS2A 3UNGC 2CW8A 2R4GA 2K9LA 3AKZA 4ZTJA 4HEA2 2BVMA 2CMPA 4CUGA 2VQCA 5HLTA 2V1NA 3RTRA 1WJFA 1OR7C 2X1CA 4BU2A 3DTEA 2LC2A 3OYHA 3L2QA 2KMUA 3ZRGA 3K10A 3K4CA 1VZ0A 2W7NA 4HNTA 4HSTA 4KITB 2HDWA 4MLOA 2LBFA 4YRVA 3VYTB 3K4LA 2E60A 2Z1DA 4NC8A 4XKWA 2V6EA 2OUMA 2F6CA 1D0ZA 1NG7A 3SZGA 4ITVA 3OR1C 4BDZA 1FMWA 2VQHA 1PJRA 2DJIA 2VB6A 2R7XA 4KJZA 1V5EA 2GOMA 2K5CA 2V26A 4IX7A 3OYBA 3OS1A 2X6YA 3ONQA 2Q2EB 3LMMA 3NWTA 1KONA 3C2GA 3HXLA 2OC6A 1D0XA 3BCBA 3I3LA 4XMYA 2R7SA 2CS3A 4RLQA 3RSNA 1BR1A 1X4OA 2RREA 2UV1A 2XAUA 3PUBA 3IAM2 1EA3A 3CP2A 2LG4A 4PSXA 2F4IA 3QYFA 1Z3XA 2E1MB 3HPGA 4E7ZA 4XKCA 1YX5A 3DWLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J01 A;  4HRI A;  4IZZ A;  4J00 A;  3QOD A;  4YRV A;  3QOE A; 
#chains in the Genus database with same CATH topology
 2NVT J;  2QSH X;  1R6R A;  2EFN A;  4K2E A;  5DDG A;  2CQ7 A;  4O5V A;  2LP0 A;  5EGO A;  3J81 Z;  2CV1 A;  3GZ6 A;  1MMG A;  3VFZ A;  2ME0 A;  1X2N A;  1FC3 A;  5JHF A;  1BN5 A;  3WU0 A;  1ODD A;  2GBY A;  2XF5 A;  2K40 A;  4ZYH A;  2RGV A;  3K9T A;  5CVR A;  2LMD A;  4Y15 A;  4M72 A;  3A01 B;  3ECO A;  3U1K A;  3R6S A;  1MGT A;  1D0Y A;  3I58 A;  3O8G A;  1W1W E;  1Q1V A;  5JVG F;  2TRT A;  3O2P E;  4KIG A;  1VI0 A;  2A5Y B;  3OYD A;  1WJE A;  2RQQ A;  1MH4 A;  1KZH A;  2BHZ A;  1IXR C;  5F27 A;  4PJM A;  4D9J A;  1BR2 A;  2CSO A;  3AG1 H;  5DCF A;  5FD5 A;  2QSF X;  3BQY A;  4MIM A;  1RET A;  1FZP B;  1IRG A;  4IOC F;  4I0B A;  2BW3 A;  3CQZ J;  2MSY A;  2JA8 J;  1B6A A;  4B43 A;  2DQR A;  4OMY A;  3OYK A;  3OYF A;  3ELK A;  3FIS A;  4CYC B;  3OIO A;  4PCQ A;  3T5X A;  4RBO A;  3VSL A;  3JSO A;  4W97 A;  3DEU A;  2LRE A;  1FBS A;  1O4X A;  1ETX A;  3RPU A;  2D5V A;  1BBY A;  4RGS A;  4BAY A;  2Y69 H;  3QPS A;  1SVM A;  1T0F A;  4P5O A;  5D5W B;  4X0G A;  1W7P B;  1K83 J;  4E4H A;  3BOQ A;  3EUK L;  4HX7 A;  2CQQ A;  1MDM B;  2KJC A;  5J1Y A;  1U78 A;  5LGN A;  4IVN A;  3H92 A;  1N75 A;  3CF5 F;  1J2X A;  4A93 J;  3QRF F;  2OA4 A;  3LL7 A;  5A2Q Z;  3CCY A;  3PNV A;  3BR1 A;  1VQL I;  2PLY A;  5CVU A;  4BGD A;  2DAO A;  2FBH A;  3LAJ A;  3L1P A;  5LRS A;  2A69 F;  2KZV A;  1OYI A;  3A0H C;  3DKX A;  1N77 A;  2W1O A;  2HZT A;  1IN7 A;  1X2M A;  4CCN A;  3WU2 C;  3ZMV A;  3HYI A;  4A0Y A;  1YQA A;  2E2H J;  1R49 A;  2V7F A;  3CZ6 A;  5JR3 A;  1O7F A;  2FBK A;  2VXD A;  3R0A A;  2KKO A;  2K9M A;  3CDL A;  2JA7 J;  2FMY A;  3W6J B;  5GTI C;  3QOD A;  1LB2 A;  2JVH A;  4DBQ A;  3S1R J;  1T2K A;  1CGP A;  4N0B A;  3JRH A;  3TL4 X;  2VN2 A;  3PIP F;  3PL8 A;  1YRN A;  1DP3 A;  4UUS B;  3O3K A;  1I6H J;  1VQM I;  3FWE A;  5JLX A;  1G3T A;  3W2W A;  2OU2 A;  3KEQ A;  2IS1 A;  1FIA A;  1PP7 U;  4DZJ A;  1E2X A;  1GV5 A;  3DP7 A;  2XB5 A;  2E35 A;  1R00 A;  2LY1 A;  2GWR A;  4BQQ A;  5E17 F;  4N4N B;  2R7U A;  4WK8 F;  4GDF A;  1QVT A;  3CLO A;  2FU4 A;  4BS9 A;  3DBH B;  3I0T A;  5M3M J;  1JKQ C;  1D1C A;  1ZRF A;  3DTK A;  2BHY A;  2BOL A;  2E7X A;  3HRS A;  1TW3 A;  3QP5 A;  4XM3 A;  4BJT A;  4HLY A;  2GQQ A;  2LYC A;  3OYN A;  1V54 H;  1FTT A;  1KQ8 A;  2WV1 A;  4HV5 A;  2K9S A;  5IYD J;  2DYS H;  2ZO4 A;  1V4R A;  4MGR A;  1IN5 A;  4M3E A;  1YLF A;  3T8R A;  1W0U A;  4BBR J;  2VJJ A;  2ELK A;  4V2F A;  5HDG A;  1TT0 A;  4LIU A;  1HLV A;  3BRO A;  1JUP A;  1ACI A;  1T6S A;  4G9Y A;  3OL4 A;  4U87 A;  3HOY J;  1MJ9 A;  4FX0 A;  2IGN A;  1A04 A;  2PMZ N;  4LK0 F;  4M9Z A;  3GTG J;  2NVQ J;  1MDM A;  4FHT A;  2XHK A;  3OMY A;  4HX4 A;  1I3A A;  2HPI A;  3B73 A;  3GO5 A;  4TV7 A;  2M4G A;  1X3W B;  3C2B A;  2HZD A;  3TDU C;  1FX7 A;  2X48 A;  3A0B C;  3ZXS A;  1SVL A;  4NQW A;  4UHT A;  2M0M A;  2DA2 A;  2ZSI B;  4J00 A;  2PG4 A;  4XOP A;  4Z6Y A;  3IH2 A;  4ON0 A;  5KAI C;  1X3Z B;  4G12 A;  2MC3 A;  1S7E A;  1B72 B;  4D7M A;  3E5X A;  5E18 F;  3BR3 A;  1R9T J;  3I71 A;  2Z33 A;  3DPT A;  3ZQG A;  3GXO A;  2BW3 B;  2D45 A;  4MEY F;  1PUF A;  1O3R A;  5IY5 H;  3L7W A;  4L5I A;  2WV0 A;  3KP6 A;  4HNV A;  2X9D A;  2DT5 A;  3S3M A;  1AKH A;  2E2J J;  3OYI A;  4DYC A;  3DKY A;  4MFD A;  3K7A J;  4KDP A;  2MH2 A;  4P1W A;  3SEZ A;  4ENK A;  3EUA A;  1EV7 A;  3RYP A;  2FX0 A;  3HL2 A;  1MBF A;  1ZGW A;  3OYG A;  5H6Q A;  2XF6 A;  3SZP A;  4UV9 A;  5K1Y A;  5FKN A;  2J5P A;  2EV6 A;  5FD6 A;  5TIS C;  3B02 A;  4F52 A;  1I1G A;  4QLC U;  2QCO A;  3FXU A;  4XK4 A;  3DLA A;  1B4A A;  1KU3 A;  2LDU A;  5GAD J;  3C2H A;  2ID6 A;  2K85 A;  1D5Y A;  3VPR A;  3CJQ B;  3HGG A;  3EYY A;  4E70 A;  1XSV A;  4B3A A;  3PO2 J;  1DPU A;  4A3C J;  1FNN A;  2EQR A;  3CMA I;  5DM7 F;  1XDU A;  1SMY F;  3ZMT A;  2XAS A;  2COM A;  1WVR A;  3VDX A;  5IOY A;  4KA4 A;  1LVK A;  1TQP A;  2ZFW A;  2NRA C;  1KU2 A;  1VF9 A;  4Z2Y A;  1BJZ A;  3SFI A;  2LRD A;  2JVG A;  4KN7 X;  1R36 A;  1EH8 A;  2EJR A;  1GV2 A;  2JZY A;  1R22 A;  2QZ8 A;  4L9T A;  1ZKG A;  3TO9 A;  3LSP A;  1FYL A;  2HQA A;  2OAZ A;  2JN6 A;  3MMY B;  4AYB A;  5E8G A;  5JI6 A;  2ICW G;  3JRE A;  4AIJ A;  4NB5 A;  5HLG A;  1MIJ A;  1MMA A;  5J3L A;  3U9G A;  3BR6 A;  2XAG A;  1TWA J;  3HJE A;  5HS7 A;  1QGP A;  1KU9 A;  2UUZ A;  2IVM A;  4XSZ F;  4E7S A;  1U5T C;  3GTJ J;  5J40 A;  3LNQ A;  2HYJ A;  4YEJ A;  3A2K A;  2XKP A;  1K61 A;  1YO5 C;  5D8L B;  4HZF A;  4L9J A;  3R0J A;  4Y7N J;  1J9I A;  3RKW A;  2R7F A;  3I54 A;  2VUM J;  1TBX A;  1YS6 A;  2R7T A;  3E6B A;  4Q47 A;  1IC8 A;  2CW0 F;  4CCO A;  1Z1D A;  5HVQ C;  5HDN A;  1BOA A;  3WTW C;  3HSF A;  1LDD A;  4G6T B;  4UVC A;  3LAP A;  5IPA A;  3KFW X;  3V8J A;  3K0L A;  3CP8 A;  1WKM A;  2JQ7 A;  4ZYG A;  2IA0 A;  3VB2 A;  3GVA A;  2A6H F;  2LVS A;  3F6O A;  3B6C A;  3TED A;  2BV6 A;  1IXC A;  1JT0 A;  4G7Z F;  3IAS 2;  1ETO A;  1GHC A;  3V4G A;  3N97 A;  2CRG A;  3I5U A;  1FOK A;  2XRL A;  3MD2 A;  9ANT A;  3E0J B;  1XC5 A;  3GEZ A;  4G8X A;  4I0A A;  4ZC3 A;  1SD7 A;  2EWN A;  1IUF A;  4HOB A;  3KZI C;  4F3Q A;  2Y30 A;  4L5J A;  1HOM A;  2XV4 S;  1QU3 A;  1VQ9 I;  4LG0 A;  2F5V A;  2YR2 A;  3TW6 A;  1EF4 A;  3WTY C;  2CO5 A;  1GXQ A;  1X58 A;  2IS6 A;  3OYM A;  1A35 A;  2A05 A;  2A5W A;  4JQF A;  4EGY A;  2QM3 A;  4B44 A;  1PP8 F;  4Q48 A;  1W4M A;  2O8K A;  4P9U A;  1LJ9 A;  1FPQ A;  1E0E A;  2V9K A;  3MWM A;  1HW5 A;  5LGT A;  2FBI A;  2HI3 A;  2OF7 A;  4F55 A;  1B8I A;  1WHU A;  1U5T B;  4M6X A;  1S8N A;  3JRG A;  3TBI A;  4I09 A;  4I6Z A;  4JK1 X;  2OJE D;  2WY7 Q;  3IWF A;  1DGR M;  1HKT A;  3W2V A;  4OIQ F;  2J5O A;  2FJ1 A;  3F21 A;  1FTZ A;  2HNH A;  3K69 A;  2MC4 A;  3IC7 A;  4M9S A;  1OCC H;  4XRS G;  4HDU A;  2DA5 A;  5LGU A;  2DMQ A;  3E7L A;  2DA6 A;  1QHH D;  2L02 A;  2PN6 A;  5FRO A;  3EET A;  2YSR A;  2DOE A;  3S14 J;  1BR4 A;  1YIT I;  3E5U A;  4ABZ A;  2NNN A;  4GCV A;  3EQL F;  4UUT A;  2ME6 A;  1ZRD A;  4IOA F;  4A0Z A;  2M34 A;  4BQO A;  1FYM A;  1MZB A;  3HUG B;  3QU3 A;  1XB4 A;  4IHT A;  4M6V A;  3CLQ A;  3WGH A;  2PJR A;  5IT9 K;  2X0L A;  4BJ6 C;  1FP2 A;  1IN4 A;  3DPL C;  3IWZ A;  3J7A O;  3V7C A;  5CLS A;  3OS2 A;  4IJA A;  3UNG C;  3ECH A;  3B6A A;  1K4T A;  2LKP A;  4F7Z A;  2R4G A;  3F8N A;  3AKZ A;  3G73 A;  4HEA 2;  5J4Y A;  4HBL A;  1R5G A;  4CUG A;  4WXD A;  2NOG A;  4AC0 A;  4LG0 B;  3QPT A;  5IYB J;  4IF4 A;  1TC3 C;  1OR7 C;  3PFI A;  1UMQ A;  2BY1 A;  4CIC A;  1LVA A;  3OYH A;  1JXS A;  3L2Q A;  3ZRG A;  4EEF G;  3K10 A;  3JR9 A;  4HST A;  4KIT B;  2LBF A;  4V2G A;  1UHS A;  3WTX C;  2AXL A;  1XTA A;  1XGS A;  2H8R A;  2EBI A;  4NC8 A;  2DU9 A;  1RKW A;  2P8T A;  4CDG A;  3IKV A;  5FO5 A;  2OZ6 A;  1D0Z A;  1NG7 A;  2K4J A;  3R61 A;  2OTJ I;  1XMA A;  5AON A;  3HOU J;  1TW2 A;  3FIW A;  4KJZ A;  1XD7 A;  2V26 A;  3F8C A;  4IX7 A;  3OS1 A;  4NBQ A;  3F6V A;  2EFP A;  3RJP A;  5BMZ A;  2L9R A;  3NWT A;  3V7R A;  3HB9 A;  5DM6 F;  2MGQ A;  1KON A;  2EFQ A;  1BI3 A;  2V9V A;  1I1S A;  3ROU A;  2R7S A;  3TO7 A;  4U0V A;  2CS3 A;  3RSN A;  1BR1 A;  4CZZ A;  1AWC A;  1WI9 A;  1B9M A;  2P7V B;  3CUO A;  1H0M A;  1EA3 A;  2F4M B;  3LA2 A;  2FNP A;  1YS7 A;  1W7P A;  1Z3X A;  2E1M B;  2ESN A;  3HPG A;  2DMU A;  2MBF A;  3DWL E;  2O8X A;  2DA3 A;  1VTN C;  3BZ6 A;  3CES A;  2GA2 A;  4BYY A;  3CMY A;  4PUS A;  1WH5 A;  5HNH A;  1AA7 A;  3WU1 B;  4KUM A;  2DFI A;  4BBS J;  3MKY B;  1BL0 A;  3OL3 A;  1NH3 A;  5EG0 B;  2D1V A;  5DTD A;  3CC2 I;  3CCU I;  1YIJ I;  4L0Y B;  1Z6R A;  3IUO A;  2BBY A;  4BY1 J;  2OCC H;  3CDI A;  2DO7 A;  4FX4 A;  3CMM A;  3WGI A;  1ITY A;  3Q0W A;  2XSJ C;  4EJV A;  2M1B A;  2ISY A;  5F6F A;  1LEB A;  4JX6 A;  4XR6 A;  3CO6 C;  1J59 A;  3DU6 A;  4PJN A;  2LLK A;  2OD5 A;  1P6R A;  5BPD A;  5JFR A;  3KIO A;  1SFU A;  1KQ9 A;  1ZQ3 P;  1TWF J;  1TZL A;  2O61 A;  2X1E A;  2PBI A;  2JPB A;  1IV8 A;  2XAF A;  2NAZ A;  2GIZ A;  2RAE A;  2Z5U A;  4G94 A;  5FFZ A;  4IZZ A;  2Y75 A;  1H89 C;  2V4J C;  2E5Z A;  4JYK A;  2DJN A;  1IV6 A;  2OQG A;  4HQM A;  1ZR2 A;  2L01 A;  2O3F A;  2OBP A;  4BE2 A;  1DQU A;  2PEX A;  4G7O F;  4NC6 A;  3J7Z I;  4IQJ A;  4XRS A;  1AKH B;  2P6T A;  2KRC A;  1JI8 A;  2M8G X;  1Q1H A;  1FY7 A;  4I99 C;  2R5Z B;  4XOT A;  3KYD B;  3GFM A;  3IV5 A;  3N4M A;  5CQG A;  5GTH C;  5HLI A;  1IF1 A;  3FHZ A;  4OWR B;  3ZOB A;  5K5Q A;  3GFL A;  4BHP A;  4CYC A;  3LSG A;  3F9K A;  2CQN A;  5CYV A;  2HXI A;  3SDB A;  4HA8 A;  4HV6 A;  1LFU P;  4BEH B;  1A31 A;  5ED4 A;  1UHM A;  5D4R A;  3M3Y J;  5GPC A;  1YRN B;  5BQT A;  1EH6 A;  4E7K A;  1KYW A;  1W36 D;  3H9J A;  4E7L A;  1HQC A;  4CZC A;  1XMX A;  3HRT A;  3TP3 A;  3M7G A;  2BEO A;  2O7O A;  4OIR F;  1AU7 A;  1A6I A;  1Z9C A;  4EAT A;  3OOU A;  4HDV A;  1RRJ A;  2LD5 A;  3IRQ A;  4UNO A;  4Y52 J;  4BDY A;  1K78 A;  4OAZ A;  4AU7 A;  1JKP C;  1CF7 B;  1VQP I;  3W6K B;  3HOS A;  4D1Q A;  2Z3Y A;  1NK2 P;  3S15 J;  4AIK A;  3G3Z A;  3A1Y A;  2FEZ A;  2IJL A;  1IZ1 A;  3TGN A;  3MVP A;  3TQN A;  5E3L A;  1WPK A;  1S7A A;  1CF7 A;  3P7N A;  3BC8 A;  3V42 A;  2VPL A;  3K6G A;  3KET A;  4M74 A;  5IP6 A;  2X6X A;  4NDL A;  2XPU A;  3Q5F A;  5CKT A;  3RQI A;  2I5U A;  4E6K G;  1ONV A;  1XG1 A;  2A6E F;  4ZDP A;  1MMD A;  3DBR B;  4EGZ A;  4UY8 I;  4M3G A;  2OZU A;  5EEH A;  1APL C;  3BR2 A;  2VL8 A;  2ZXJ A;  3FZV A;  2RKH A;  3I4P A;  2KLO A;  3FHN A;  4DBR A;  5B1B H;  2E2I J;  4XKV A;  1FEX A;  2WAD A;  2LTP A;  3EUH C;  3MQ0 A;  4C30 A;  1FOY A;  1Z05 A;  2ZXH A;  3OV8 A;  3C1D A;  2JA6 J;  3OWT A;  5ERI A;  3M9A A;  2FD5 A;  4XL9 A;  1FSE A;  3KP3 A;  3BPX A;  2K9N A;  2PJR B;  4RM3 A;  2IRF G;  3CCJ I;  2GOX B;  3L09 A;  5FKM A;  1FT9 A;  3RZD J;  2P0W A;  5ILV A;  3ZP5 A;  2XPW A;  1DUX C;  1R7J A;  2W00 A;  1X1B A;  1R5I D;  2QVO A;  1TNT A;  2A68 F;  5J6X A;  2F5F A;  3ABL H;  1JE8 A;  3RKY A;  4OMZ A;  4IL6 C;  4LB6 B;  3BTI A;  1CQT A;  4KMF A;  1X1D A;  3RKX A;  1HKS A;  1E3O C;  1B9N A;  2A61 A;  4WWC A;  2EA4 A;  3H5N A;  4PJ0 C;  4LJZ F;  3ZGK A;  2CQK A;  3JW4 A;  1VQ4 I;  1Y56 A;  4MTE A;  1WRJ A;  1JT6 A;  4DJA A;  3W3C A;  4Q4Z F;  3S17 J;  1J0R A;  5D5X B;  1X1C A;  3K4M A;  2L4A A;  1T0F C;  1G3S A;  1X1P A;  5BS6 A;  3GW2 A;  2NYX A;  5FJ8 J;  3HG9 A;  2L9V A;  2R7W A;  1P92 A;  3DU5 A;  5LD2 C;  5ICG A;  2HKO A;  2KL4 A;  1QA6 A;  4MO7 A;  3FDY A;  3D5L A;  4CH7 A;  1LEA A;  1ZAO A;  1K79 A;  4Y3O A;  3OYJ A;  3MCZ A;  2JPC A;  4ANJ A;  3JRA A;  2FXA A;  4Y17 A;  1HF0 A;  1R4M B;  3F8B A;  1MJA A;  3S3O A;  1U2W A;  3D0S A;  1YOV B;  4MNU A;  1Z0X A;  2M8E A;  4KMU X;  2CW7 A;  2M45 A;  4CYD A;  1GUU A;  2XPV A;  5C4X J;  2H1L A;  3ZQQ A;  4U88 A;  3OYE A;  2IS4 A;  1FOW A;  1T08 B;  5DYM A;  2EZK A;  3H5R A;  4L0Z B;  3A01 A;  4XNF A;  2HXO A;  2KIU A;  1H9T A;  1X19 A;  4GRI A;  4L9N A;  2CV2 A;  1ZYR F;  4FE4 A;  1MBK A;  4BXF A;  3HHH A;  2KQR A;  1YE9 A;  3I59 A;  4RGX A;  2QF7 A;  2PFB A;  5IYC J;  4XKB A;  2AO9 A;  5F08 A;  4KYW A;  4HF1 A;  2DMT A;  4A3F J;  1F36 A;  1G4D A;  3IHU A;  2ZXI A;  4PFO A;  2VKE A;  5IP9 J;  2VBY A;  3AL0 B;  4X6A J;  4RGU A;  4EM2 A;  1P4W A;  2BYV E;  3DBL B;  2CUJ A;  5DV5 A;  1KYZ A;  3JCU C;  3SXY A;  4JX4 A;  4CGZ A;  2IGK A;  3ABT A;  3FM5 A;  2BXZ A;  3KLN A;  1IDY A;  1VQ6 I;  3CUQ A;  2CFO A;  5DCM A;  2WA0 A;  2ELJ A;  4LK1 F;  1W5C C;  4I01 A;  2E5N A;  2BY3 A;  1F4K A;  3P5J A;  3QPL A;  2IGM A;  3OYC A;  2IA2 A;  1BIA A;  3E6M A;  4FAS D;  4B1R A;  4GYI A;  1IRF A;  1UST A;  3ZQL A;  1QPM A;  4PJL A;  2L5Q A;  2E1N A;  3BLY A;  5FKO A;  3BG6 A;  3HZJ A;  3OY9 A;  3S8P A;  1VQO I;  2M7A A;  3HOX J;  5M5W J;  5GAE J;  5C3E J;  3RZO J;  2VQL A;  3C3W A;  3TOB A;  3JRB A;  4L18 B;  5FGM A;  4HX8 A;  3WHC A;  2XAJ A;  3WHB A;  4CCK A;  4XID A;  2I8D A;  2MG4 A;  4P9F A;  4ZYD A;  5LEK A;  2HPM A;  4XLP F;  2R93 J;  3MFK A;  1K7A A;  1A6Q A;  2WAQ A;  3QYB A;  3KEY A;  1YFH A;  3FMQ A;  1S6L A;  2LH9 A;  1WJC A;  3GLL A;  1IW7 F;  1OYW A;  1P4A A;  1E17 A;  1O57 A;  1OKR A;  4IRI A;  4A6D A;  1K4S A;  3BTC A;  1SC7 A;  2WAQ N;  4ZYA A;  2MD0 A;  2KDO A;  2VKH A;  1A36 A;  2F2E A;  3KP7 A;  1IRX A;  5J1R A;  2R0Q C;  2XAQ A;  3BZC A;  1SVO A;  5IOZ A;  4YEL A;  4MTD A;  1FIP A;  3IKT A;  4DIQ A;  2VE9 A;  1SAN A;  3L9F A;  1T95 A;  2WWY A;  4D0P A;  5E20 A;  4BAC A;  2X4H A;  4EMS A;  2IT0 A;  4YIR X;  2EPF A;  2ZME C;  2ACJ A;  4UVA A;  2OV7 A;  3JTH A;  1YJW I;  2OQR A;  3DKW A;  2A3S A;  3DEE A;  3J7Y J;  4KT6 A;  1HA8 A;  2PQ8 A;  3M8F A;  4OOI A;  5L3E A;  3P9I A;  1T98 A;  4DW6 A;  2QA4 I;  3PJR A;  2QBY B;  1YIO A;  1L3L A;  2IEK A;  4O6J A;  1ZH5 A;  1N78 A;  2STT A;  4RM2 A;  2CQX A;  2ZXW H;  3CJT B;  4DYR A;  2RDP A;  1ETV A;  4PJJ A;  3KZY A;  2Z99 A;  5B5E C;  3E97 A;  1VQN I;  2VBZ A;  3CDH A;  5LEJ A;  4UVB A;  5DCM B;  3VSK A;  4C2U A;  2H94 A;  3OS0 A;  3MZY A;  2AHQ A;  4EJT A;  2IGO A;  1YYV A;  2DI3 A;  3GX4 X;  2M2E A;  3SZT A;  2VC1 A;  3QOE A;  4ZZL A;  2XSD C;  3CD6 I;  3H9Q A;  1JJ6 C;  3CUQ B;  3RKQ A;  3K2A A;  2FML A;  3HRM A;  2R7V A;  3W6V A;  2ZB9 A;  2PX9 A;  3S32 A;  2QQ9 A;  2LNB A;  3ZQ7 A;  3GTK J;  2CW8 A;  2FRH A;  2PMH A;  2LFB A;  2RNJ A;  2VQC A;  5AIP A;  4RAF A;  4UB6 C;  4IHX A;  1T33 A;  5FKK A;  1WI3 A;  2L4M A;  1XGN A;  2X1C A;  3COA C;  1JUS A;  3DTE A;  3CCQ I;  2CG4 A;  2N8G A;  4XRM A;  1MKM A;  5DUK A;  3UKG A;  1TL8 A;  2O6G E;  3KLO A;  2KMU A;  4D7N A;  5J8C A;  5F04 A;  4HNT A;  1WSU A;  2MLG A;  3K1M A;  2HOS A;  2W24 A;  2DDA A;  3VYT B;  2AS5 F;  4RAY A;  2JRT A;  2YX4 A;  1ORK A;  2E60 A;  4I76 A;  2Z1D A;  1XPX A;  1T38 A;  3K1N A;  3M8E A;  4XKW A;  2E7W A;  3WTS C;  4IPA A;  1Z7U A;  3GME A;  1ON2 A;  2G9W A;  4UUS A;  2ELH A;  1G2H A;  3OR1 C;  3OSG A;  3BY6 A;  5KK1 A;  2DJI A;  2FSW A;  3AG3 H;  2VB6 A;  4KNY A;  4LFU A;  3FX3 A;  1V5E A;  3HM5 A;  2DA7 A;  1K6O A;  3ZN1 A;  3ONQ A;  5B3S H;  1P7I A;  3S2H J;  4BY7 J;  5ICC A;  1OYY A;  2OC6 A;  4GGG A;  2IP2 A;  4A3D J;  4BNC A;  2Y48 A;  3BCB A;  3I3L A;  3PUF A;  1RES A;  2H8W A;  1JGG A;  2EZH A;  2XAU A;  4EV0 A;  2K27 A;  3DF8 A;  2HFH A;  3PUB A;  1HDP A;  2LG4 A;  4PSX A;  5CJ9 A;  3QYF A;  1U9O A;  2O03 A;  4H0E A;  4WXC A;  2M9H A;  1ZK8 A;  3GF2 A;  3IL2 A;  4DQ2 A;  3LFK A;  2Z9O A;  2KRH A;  4JOM A;  2ZCW A;  3S3N A;  3BZK A;  3QAH A;  2DCE A;  3KYL A;  3FBN B;  4A3L J;  4XLH A;  2LOO A;  5TGT A;  3F3X A;  2Q1Z B;  1XGO A;  4AWX B;  3FMR A;  1TQM A;  1TT5 B;  2VOO A;  1W7P D;  1XCV A;  3DPU A;  3I64 A;  4MQ9 F;  3KYC B;  2BE5 F;  4ZDL A;  3J80 K;  4B47 A;  2YU3 A;  5HS9 A;  5E3O A;  3FBI B;  1BI0 A;  4HYE A;  3PM1 A;  5HNF A;  1B59 A;  1RIO H;  1ENH A;  3O6B B;  1UG0 A;  2L0K A;  3JAM K;  3A03 A;  2DBB A;  3GTL J;  3ABK H;  2LKS A;  2GM4 A;  2WAE A;  1FYK A;  3NRV A;  1FP1 D;  2ESH A;  2I10 A;  3SJM A;  2V79 A;  1FBU A;  1UAA A;  2LY2 A;  2P6S A;  5LHG A;  2HWV A;  4DGW B;  1Y0N A;  2LKX A;  3QQA A;  5KVR A;  4Q5S F;  2ZNY A;  3GTO J;  3D5S C;  2DMN A;  4A3E J;  2O9L A;  1YX3 A;  3WE2 A;  3K70 D;  4FET A;  1TWC J;  4CSW A;  2HQN A;  1WCM J;  1Y0U A;  2XAH A;  3KP4 A;  5ILU A;  2IA1 A;  4JP0 A;  2DXI A;  2Q0O A;  4AVZ A;  2IW5 A;  1FMV A;  2DT6 A;  3DQV C;  1ZLJ A;  2K3P A;  2R7Q A;  3VYU B;  3C18 A;  1F43 A;  1EKE A;  3KPH A;  2P81 A;  2HVQ A;  5DD8 A;  1MSE C;  2DA1 A;  4EJO A;  1WH7 A;  2VPR A;  4WF2 A;  2YU9 J;  3TDZ C;  3KE2 A;  1XDS A;  1F9N A;  2DTR A;  3OIP A;  4E7H A;  3Q0V A;  4BXU A;  4LLN A;  2MLK A;  1U3E M;  1XGM A;  1DPR A;  4HG2 A;  4N9H A;  2GLO A;  2VJ5 A;  4F92 B;  2MAB A;  3HSR A;  5E3M A;  2R7R A;  3QWL A;  4BL0 B;  3BJO A;  2XKO A;  4FQG A;  3M1E A;  4UV8 A;  3I59 B;  3E1S A;  5IT3 A;  3HBL A;  2DFH A;  5LFA A;  4KT5 C;  3TKY A;  1R71 A;  3BJ6 A;  4M3B A;  1XN7 A;  1YG2 A;  5E79 C;  1SD4 A;  3OOP A;  4IO9 F;  3ZQI A;  4RAZ A;  2KP6 A;  3P9C A;  2NXN B;  3NQO A;  1GVJ A;  1QVU A;  1F1Z A;  2VBX A;  2G7H A;  3VWB A;  2HQ5 A;  3CCS I;  1B72 A;  2FUG 2;  2RV8 A;  2R7O A;  2KIF A;  1BC8 C;  2DLL A;  3ISP A;  3S1N J;  3FKJ A;  4NUB A;  1RUN A;  3H9G A;  3FXO A;  3SFZ A;  1ETW A;  5FLX Z;  4LLG F;  4A2U A;  3GTP J;  3M8J A;  3Q0U A;  3QPH A;  4XQF A;  1KA8 A;  5J8F A;  3CCL I;  1WGX A;  3JTG A;  1XSD A;  2V1D A;  2GA1 A;  1LNW A;  1OFC X;  3L2C A;  2K9Q A;  2F48 A;  2QYO A;  2R5Z A;  1R5H A;  2QKL B;  4A6E A;  1UCR A;  3FXR A;  3H0D A;  3NAR A;  1OCZ H;  1Z91 A;  2KHM A;  4OIO F;  5L3F A;  1K6Y A;  3V8L A;  4S0H B;  2QWW A;  3AFH A;  2K7L A;  4BHC A;  1G6N A;  4AM3 A;  1TP4 A;  2KZG A;  2OCE A;  1MNE A;  4M71 A;  3ZQF A;  5M5X J;  3R4K A;  4XLC A;  3N05 A;  1UHW A;  3HRU A;  3K2Z A;  1VND A;  3BG7 A;  4Y33 A;  1K78 B;  2H09 A;  3IRR A;  1WJA A;  4HW0 A;  3RQ4 A;  3J7A Y;  5HLH A;  1ETY A;  2WB1 N;  3F23 A;  2ZME A;  5KCM A;  1REP C;  5D6F A;  1GLN A;  3G1M A;  3IH4 A;  2ZFU A;  3HKZ A;  3LSR A;  3JRC A;  2C6Y A;  3LSK A;  1XX5 A;  2ETH A;  3E6D A;  5EF6 A;  2DPU A;  1STZ A;  5HDK A;  1G3Y A;  2DTZ A;  5IP7 J;  2IXS A;  4HNU A;  5D8K B;  4Y4R A;  5EG0 A;  3M07 A;  5E3N A;  4ETS A;  1S7O A;  3GFJ A;  1MNM C;  2VC0 A;  1UFM A;  4WX9 A;  3TMO A;  2PI0 A;  1D1A A;  3BPV A;  3D1N I;  1DDN A;  4HSR A;  4RB0 A;  2K02 A;  1U8B A;  1TWH J;  3E3V A;  3EDP A;  1MH3 A;  1R23 A;  2Y0S N;  2Y9Y A;  3QYE A;  4E7J A;  2XGC A;  2JA2 A;  1RKT A;  1VQ7 I;  4BE1 A;  1T8I A;  1MSF C;  2BY2 A;  3OYA A;  3BTL A;  3ESW B;  5ICE A;  1W0T A;  3WTT C;  2BGC A;  3WG7 H;  3GFI A;  1ZHF A;  3T1B A;  4OAY A;  3MKL A;  2ZBK A;  3HTS B;  4R1H A;  2XVC A;  3WE3 A;  4AUX A;  2D1H A;  2E71 A;  1SFE A;  1NK3 P;  2ZJQ F;  4F93 B;  1Y6I A;  3BG9 A;  4XLN F;  5FRN A;  1HBX G;  3L2V A;  1HW2 A;  2LBF B;  4CCJ A;  3BTJ A;  3K4N A;  4ENN A;  3A02 A;  4FIS A;  2DMP A;  2M4K A;  3K4B A;  4R8H A;  1JGS A;  2Y0M A;  4ZTF A;  4QWQ A;  2JT1 A;  2COB A;  4ZYE A;  1OLT A;  3MEX A;  2V1X A;  2P5L C;  2XUB A;  3G4S I;  3BR0 A;  3H0G J;  4LOC A;  4HAM A;  5F64 A;  1MBE A;  3RDI A;  3AAF A;  3PIO F;  1MMS A;  4L9V A;  1JKO C;  2NVY J;  3RI4 A;  1YI2 I;  1WFX A;  3K4J A;  1BW5 A;  2CWE A;  1UEL B;  2JSP A;  2ZSH B;  1AHD P;  3CJN A;  5K7H A;  1ULY A;  1POG A;  3LSI A;  1DU6 A;  3U1D A;  5CVI A;  2VQG A;  1S3J A;  2VJ4 A;  3MAJ A;  1IUY A;  4NNJ A;  2FE3 A;  2HDD A;  2ZJR F;  1GDT A;  2A07 F;  3OIQ A;  4XIC A;  4ENM A;  3H3U A;  4IQ4 A;  3LQR A;  4II2 A;  2WAF A;  1QNT A;  3AG2 H;  2QQB A;  3CC4 I;  3REO A;  1J5Y A;  2UXX A;  4CA0 A;  4FE7 A;  3FF5 A;  2M5W A;  3PNT A;  3U2R A;  4DYQ A;  3GUD A;  3RCO A;  5J47 A;  2XB0 X;  2VOD A;  4NHJ A;  4HF2 A;  3S93 A;  4ZJZ A;  1Z67 A;  4EQQ A;  4R79 A;  1TLH B;  3I53 A;  2CH0 A;  5M5Y J;  4IXA A;  5GAG J;  3EPZ A;  2JK3 A;  4KIS A;  4AD9 A;  2K3F A;  3BWG A;  1E3H A;  1JUM A;  1BW6 A;  1FSH A;  1RI7 A;  3RYR A;  1JHH A;  3ZPL A;  2GXB A;  1YJ9 I;  5DD4 A;  2MD5 A;  1OIS A;  3V8K A;  5FLM J;  2W4S A;  1SD5 A;  2QEX I;  3QOP A;  2XGX A;  2UWM A;  5CPR B;  1OMI A;  2CU7 A;  5E1W A;  4XBF A;  1ON1 A;  3ASN H;  3I9V 2;  3TP0 A;  1ZRC A;  4XRF A;  3ABU A;  2DK5 A;  4YFN F;  1HST A;  1PDN C;  3F22 A;  2NS0 A;  3HEF A;  2QBY A;  2L7Z A;  3CCV I;  2ZKZ A;  3GZ5 A;  3BT9 A;  5D6E A;  4IHY A;  5EJC A;  3HDD A;  2DK8 A;  1UZC A;  1ZEL A;  5ILS A;  3A4C A;  1I6X A;  3FXJ A;  3PFY A;  2NVX J;  1BI2 A;  4CCL A;  4KIC A;  4AVP A;  3LA3 A;  3MZH A;  4XOR A;  2A6T A;  2Y9Z A;  4LB5 A;  4U0Y A;  1BI1 A;  1ZN2 A;  3OSF A;  1AOY A;  2DOA A;  4PGH A;  4IKF A;  5E1Z B;  4FT8 A;  5H6R A;  3FKI J;  3PO3 J;  3PQK A;  3J80 Z;  1OCP A;  3D5R C;  4JX5 A;  1LFP A;  2V9P A;  1T39 A;  4ASN A;  2VE8 A;  1TNS A;  4HLX A;  1Z7L A;  2H1K A;  1YW7 A;  2B63 J;  4RA2 A;  1WJB A;  3LST A;  2HOA A;  2L9N A;  4C2T A;  2CUZ A;  4ZDO A;  3JAM Z;  2QSG X;  2RNG A;  1E3P A;  4HRI A;  1DGW Y;  2FQ3 A;  1MW7 A;  3IP4 B;  4G6D A;  4RGR A;  3SQN A;  2F5E A;  1SAU A;  2Y2Z A;  4AID A;  3CC7 I;  2WTE A;  4GO1 A;  1IJW C;  1PUF B;  5HOD A;  4RS8 A;  4MHG A;  1GT0 C;  4ZTJ A;  2KJB A;  4D5F A;  2V1N A;  3RTR A;  5GAH J;  1WJF A;  2QLZ A;  3CCM I;  2Y31 A;  3WOD F;  4C3J J;  3DFG A;  1OR7 A;  4PGG A;  4BU2 A;  5CVJ A;  3KP2 A;  2LC2 A;  3BP8 A;  4QSH A;  4W1U A;  4AYB N;  2W7N A;  3RIR A;  1ZGA A;  4MLO A;  4C2M J;  3ULQ B;  3JRI A;  4YRV A;  1IDZ A;  1LFB A;  4B09 A;  1Z77 A;  2CJJ A;  2XGD A;  3LWF A;  4HQE A;  2V6E A;  3J81 K;  2OUM A;  1R1T A;  3SZG A;  4ITV A;  1N25 A;  4BDZ A;  2AXT C;  4A3B J;  1PJR A;  2K4B A;  3MZ8 A;  1S72 I;  2GOM A;  3ZMD A;  3F0C A;  3ZN0 A;  2UXN A;  2PJP A;  2Q2E B;  4J19 A;  2E19 A;  1VQK I;  1XSX A;  2O0Y A;  1BIB A;  1O3T A;  3HXL A;  1O3Q A;  1Y1V J;  4XMY A;  2HOT A;  4RLQ A;  1X4O A;  2KIM A;  2RRE A;  3QP6 A;  3GCM A;  3IAM 2;  3CP2 A;  2VBW A;  4KFC A;  1GXP A;  1RPW A;  5K5O A;  2ZJP F;  1HCR A;  3NEU A;  4RB3 C;  4LD5 A;  4E7Z A;  4XKC A;  3MN2 A;  4XON A;  4B48 A;  3ABM H;  3FXK A;  2X6O A;  1ZG1 A;  2HU9 A;  3ZMZ A;  3HPH A;  3LFU A;  4LIT A;  3ZQC A;  2R7D A;  2G0E A;  1D1B A;  1BJA A;  3G71 I;  2VLA A;  5DEQ A;  4BEH A;  4DOZ A;  2WB1 A;  1U8R A;  4ESF A;  3GZN B;  1WQ2 A;  5F1J A;  3S1Q J;  2LY9 A;  2RVC A;  2EIL H;  4M3D A;  1Y39 A;  2MFZ A;  4QPQ A;  4ZH4 F;  5GPA A;  4IEJ A;  4NC7 A;  2G7U A;  5KNL A;  3LSJ A;  2KIQ A;  1MBH A;  2IPQ X;  1Z21 A;  2VT2 A;  5DS9 A;  2HR3 A;  3NWS A;  4B3X A;  2B9S A;  1UB9 A;  4IHS A;  2EK5 A;  4A5M A;  2H6B A;  2GXG A;  4YFK F;  2MW8 A;  3SYT A;  1HDD C;  2NS7 A;  2BZT A;  3WGG A;  2FQ4 A;  5L3C A;  4A69 C;  5LHH A;  1H8A C;  4DNC A;  2CV0 A;  4ZZD A;  2JUC A;  4PFP A;  2EFW A;  5EZG A;  5LHI A;  4LG3 A;  2PMU A;  1IXS B;  3LSH A;  4XSX F;  5L3B A;  5EEG A;  3DLL F;  2DT7 B;  4C9Y A;  1OCT C;  4BE0 A;  1T56 A;  1W5S A;  1FBQ A;  1PVE A;  2M87 A;  1V55 H;  1R1V A;  1QZE A;  1QQI A;  3R60 A;  4N9I A;  2P4W A;  4DZP A;  4XN3 A;  2ISZ A;  4M73 A;  2HDC A;  1YW8 A;  3BCA A;  3C7J A;  3OYL A;  3VOE A;  2XDV A;  3GTM J;  4A3G J;  3ZCO A;  5F0H A;  3EYI A;  1UJ8 A;  1FWZ A;  2V1U A;  2L3D A;  3M4O J;  1U5T A;  4XLA A;  1VFC A;  3S1M J;  2FOW A;  1ZAR A;  4U7B A;  2VXZ A;  1G8X A;  3ASO H;  3ZMS A;  1IAW A;  1LE8 B;  2JMW A;  2KFD A;  2X85 A;  1PUE E;  2HYG D;  2P7C B;  3RPQ A;  2D2W A;  2VAS A;  3FXM A;  1SD6 A;  2YPR A;  1YTY A;  4CHU A;  1IN8 A;  2VKD A;  3HTU A;  4J01 A;  4ESJ A;  4B4C A;  5FLV A;  3PSI A;  4CCM A;  2XGE A;  2QKM B;  1FLI A;  2GXA A;  1RR7 A;  1JTY A;  4YG2 F;  2IS2 A;  2F4O B;  2XIG A;  1Y8Q B;  5FKL A;  1OPC A;  5FFX A;  1ZR4 A;  4RLF A;  2RC4 A;  1I5Z A;  5TJJ A;  3X2Q H;  1HC8 A;  5C4J J;  3CME I;  3G1O A;  3Q3S A;  1W5T A;  3VOD A;  4F91 B;  2FNA A;  3CTA A;  4LMY A;  1KQ0 A;  2FOK A;  4QIW N;  4YIF A;  3PNY A;  2UZK A;  4X1E A;  2CUF A;  2E1O A;  3PQJ A;  3G1L A;  5JLW A;  5F0F A;  4C3H J;  1RUO A;  4FCY A;  4KN4 X;  4B8X A;  2OPT A;  4RB1 A;  2BY0 A;  3AG4 H;  2XF7 A;  3EUH A;  2L2O A;  4GFB A;  4XLE A;  1BOB A;  3T8T A;  2NS8 A;  2W82 A;  1XCB A;  2P5K A;  1TWG J;  2IAI A;  2LF7 A;  5A2Q K;  5CQE A;  1QZZ A;  5B66 C;  1MJB A;  4IHV A;  2W84 A;  5J1U A;  1LDJ A;  3HHG A;  1S29 A;  2VI6 A;  2P5V A;  3SDG A;  2M3A A;  3BG5 A;  3K4K A;  4I2O A;  4QTR A;  1O7L A;  2ZJ2 A;  4P96 A;  3V7S A;  2OTL I;  1R4N B;  3CF2 A;  2GZW A;  3HOZ J;  5D5V B;  3E6C C;  1J7K A;  2JTV A;  4E7I A;  4S05 A;  2WBM A;  5K5R A;  4BH9 A;  2HVS A;  4AIH A;  3GYH X;  2DFE A;  2DPD A;  5IT9 Z;  3I55 I;  1WJ5 A;  1IG7 A;  4U7D A;  2NVU B;  1IGN A;  2JRM A;  3CCE I;  4IRG A;  2M0C A;  2L7M P;  1HW1 A;  2X1D A;  4A5N A;  1P2F A;  5LLQ A;  1LE8 A;  4PSW A;  2EH3 A;  3TO6 A;  2HTS A;  2VT3 A;  3HUG A;  4II3 A;  2EZL A;  4OIN F;  4C3I J;  1USS A;  1B1B A;  4LIV A;  3GBG A;  4Y13 A;  2LSO A;  4UUV A;  3DCF A;  1SAX A;  3HOT A;  1TQI A;  1QZY A;  3FXL A;  3RPU D;  3SHF A;  2EIJ H;  4PDK A;  4I98 B;  5JVT A;  3K1P A;  5E1X A;  2HOE A;  2VKV A;  2WC2 A;  3L2R A;  3FMS A;  4M6Y A;  1ZG5 A;  1GVD A;  3KP5 A;  1JKR C;  3ML6 A;  1OJL A;  4A3M J;  1V5G A;  4YII A;  4MEX F;  2VOP A;  2HS5 A;  1MND A;  1R58 A;  2ID3 A;  5JHU A;  1ERD A;  1NTC A;  1P9Q C;  3BQZ A;  3DTI A;  5HOO A;  1IO2 A;  1RNL A;  2AQE A;  4P55 A;  3LA7 A;  1SFO J;  2RQP A;  1ZG3 A;  1S9H A;  5GP9 A;  2XC7 A;  1B8I B;  3P9K A;  3LQQ A;  1C0W A;  5EDN A;  5BNG A;  1ZLK A;  2O5R A;  1A5J A;  1X1A A;  2JJ7 A;  1I50 J;  4EVI A;  5B1A H;  2L7K A;  3L2U A;  2TCT A;  3H1C A;  2QQA A;  5J4V A;  5AIQ A;  4BJ5 C;  3DV8 A;  2KRF A;  1Y8R B;  3G2B A;  2M30 A;  2BVL A;  4HF0 A;  4BXX J;  1MMN A;  1D8K A;  2QEN A;  4CO8 A;  1KGS A;  1LKX A;  3BDD A;  1YW9 A;  5EZH A;  4M9X A;  2EIN H;  3T0Y A;  4N4O B;  2EFO A;  4A3J J;  1ZGJ A;  4NQW B;  1W36 C;  5M3F J;  1LQ1 A;  2EB7 A;  3F72 A;  1ETK A;  4YFX F;  5BOX A;  3DEW A;  4ESB A;  1I39 A;  2LF8 A;  3KEO A;  2ECB A;  2CUE A;  4XN0 A;  2ZME B;  1V5F A;  2L9S A;  3W2A A;  2ZC2 A;  1OCO H;  2GIV A;  1BC7 C;  2DDB A;  3WTV C;  3UR3 C;  5EYR A;  5FLX K;  3U21 A;  2VON A;  1ETQ A;  4XLF A;  2W25 A;  3FK7 A;  3PSF A;  5L3D A;  1RC9 A;  1U6G A;  4BQN A;  2HVR A;  4H4K C;  2HTJ A;  1JTX A;  4HPQ A;  1FJL A;  4LLL A;  2RN7 A;  1IRZ A;  2BXY A;  3CCR I;  2M7B A;  2EA2 A;  2K86 A;  2KPM A;  3HIF A;  3JSP A;  2PMZ A;  2DOD A;  2Q8K A;  1IN6 A;  3HOV J;  1QO0 D;  2HYF A;  4A12 A;  4A3I J;  2YS9 A;  5L3G A;  1Y1W J;  2W85 A;  2E1M C;  3H3Z A;  1P4X A;  4V19 K;  2DFF A;  3OR2 C;  4EM0 B;  3CUQ C;  3CO7 C;  1J09 A;  2VIX A;  4U0W A;  2Z16 A;  2GAU A;  3SEQ A;  3O8H A;  4PK4 A;  1D8J A;  2CYY A;  4I02 A;  1VQ8 I;  3TW7 A;  3L00 A;  4EJW A;  2NOJ B;  3ZMU A;  1OQY A;  1TTY A;  1F5T A;  1PYV A;  2JWT A;  1M1E B;  1QHG A;  1JJ8 C;  1NHA A;  1WWX A;  4IRH A;  3VYR B;  5E8I A;  2QGU A;  2L54 A;  1G3W A;  3VEP A;  2CFX A;  5LBQ A;  1Z6T A;  5FRM A;  1HXD A;  5KHD A;  2XRN A;  3KX2 A;  1MBJ A;  1SFX A;  3CJR B;  2STW A;  4IHW A;  3HOW J;  1H88 C;  3FK6 A;  4QPO A;  3K70 C;  1V3F A;  2R5Y A;  3BG3 A;  3BR5 A;  3S2W A;  5HS8 A;  3BJA A;  5K7Z A;  4PZJ A;  5FB2 A;  1QBJ A;  5H20 A;  1LPQ A;  2IBD A;  1U0J A;  2LK2 A;  1D3Y A;  2DOF A;  3GWZ A;  2DA4 A;  1MD0 A;  2MH9 A;  3H5A A;  5CVV A;  1Z3Y A;  2EV5 A;  4WCG A;  2R5Y B;  3ZR8 X;  5H2F C;  1HKQ A;  1I27 A;  4M3F A;  2L7F P;  2DQL A;  1EH7 A;  2F5C A;  2HKX A;  5KAF C;  3LSM A;  3ZQH A;  3ERM A;  5C44 J;  3LOC A;  1DU0 A;  1BM9 A;  2E36 A;  4GXO A;  3KZZ A;  3JRD A;  1DP7 P;  3AL0 C;  3KCC A;  2YUS A;  2ADU A;  4MFE A;  2Z2S B;  4RDU A;  2MYS A;  3E5Q A;  2R3S A;  3H35 A;  3Q9V A;  2FA5 A;  1FOX A;  3HC7 A;  4MQV A;  2AQF A;  3M1C A;  5F1R A;  3VYS B;  4WXH A;  1RZ4 A;  2EIM H;  3H36 A;  2JA5 J;  5TRD A;  4GYG A;  2W57 A;  4RMN A;  4UB8 C;  3I4N J;  3MKZ A;  2X51 A;  1G59 A;  1O3S A;  1NG6 A;  1YJN I;  4I7H A;  1VQ5 I;  2YX7 A;  4BQA A;  3L2W A;  3S16 J;  3ERE D;  1P7J A;  2H6C A;  4G7H F;  2HQR A;  2X6W A;  3WTZ A;  1WJD A;  2R7Z J;  4BKX A;  1SEU A;  4OIP F;  1X4P A;  1LUJ B;  5D4S A;  3MKW B;  2WY8 Q;  1SFK A;  2QUF A;  4LGW A;  1LDK B;  2EV0 A;  2Y0S A;  4BHB A;  4BUP A;  2JUG A;  2KIS A;  3HGY A;  1S5L C;  2VJI A;  1D5V A;  5ICF A;  1H9G A;  3GLX A;  3Q9S A;  4L5E A;  2K9L A;  2E1C A;  2BVM A;  2CMP A;  3FM3 A;  5HLT A;  5LRR A;  4OU0 A;  4G6Q A;  4A0X A;  5EGO B;  2Q2E A;  1XMK A;  4RB2 C;  3FXQ A;  2DW4 A;  2EIK H;  3IH3 A;  4FTH A;  6PAX A;  3WG9 A;  3G6E I;  2JSC A;  1MBG A;  1HSJ A;  4O3M A;  3K4C A;  1VZ0 A;  1SMT A;  1QPI A;  2KT0 A;  2HDW A;  1U9N A;  1J75 A;  4D5C A;  4EM1 A;  4KIB A;  1BA5 A;  1QRY A;  3K4L A;  3F8F A;  3DXJ F;  3HKZ N;  1OCR H;  2DN0 A;  2HGC A;  2ECC A;  2FF4 A;  3F8M A;  5K7F A;  4S04 A;  3WTU C;  3H3V K;  1ZTR A;  3QU6 A;  2B0L A;  2F6C A;  1L0O C;  2F5D A;  2E34 A;  2H27 A;  4CXF A;  5DUI A;  1X3U A;  1FMW A;  2CGP A;  2VQH A;  3TOA A;  2B7E A;  2EZI A;  1YHQ I;  2KDZ A;  5BPI A;  2R92 J;  5EEA A;  2R7X A;  2MA3 A;  2K5C A;  3OYB A;  1EJ9 A;  5F0C A;  2X6Y A;  2QQ8 A;  3I4M J;  3LMM A;  1RR8 C;  1ZRE A;  3C2G A;  1XS9 A;  2ZNZ A;  4EJU A;  1JHF A;  1WZ2 A;  2HEO A;  4A3K J;  1D0X A;  3S2D J;  3NAU A;  2DYR H;  3GTQ J;  4UXN A;  2TDX A;  1I3Q J;  2UV1 A;  2NNY A;  4JBA A;  1UG2 A;  3I56 I;  3JRF A;  4ENJ A;  3HSE A;  2XRO A;  2F4I A;  4RAG A;  1R1U A;  2LR8 A;  2V6C A;  2W48 A;  5D5U B;  1KU7 A;  1YX5 A;  4KIF A; 
#chains in the Genus database with same CATH homology
 4XON A;  4B48 A;  3CES A;  2KRH A;  4JOM A;  2HU9 A;  1R6R A;  3HPH A;  3LFU A;  4LIT A;  3S3N A;  4PUS A;  2DCE A;  1D1B A;  5HNH A;  3KYL A;  1AA7 A;  2VLA A;  3FBN B;  4BEH A;  4DOZ A;  2WB1 A;  3MKY B;  3OL3 A;  2CV1 A;  4XLH A;  1MMG A;  2LOO A;  5TGT A;  5JHF A;  2Q1Z B;  2XF5 A;  3IUO A;  2MFZ A;  4QPQ A;  3DPU A;  3CMM A;  4NC7 A;  4ZDL A;  4B47 A;  2XSJ C;  5KNL A;  3FBI B;  1D0Y A;  5HNF A;  1Z21 A;  4XR6 A;  3NWS A;  4B3X A;  1UG0 A;  3DU6 A;  4PJN A;  3OYD A;  1WJE A;  2RQQ A;  3SYT A;  1TZL A;  4PJM A;  2X1E A;  1BR2 A;  4D9J A;  2WAE A;  1UAA A;  4IZZ A;  2CV0 A;  2LY2 A;  2V4J C;  2E5Z A;  4PFP A;  2BW3 A;  4DGW B;  4LG3 A;  4B43 A;  3D5S C;  3LSH A;  3OYK A;  3OYF A;  1YX3 A;  1DQU A;  2DT7 B;  4BE2 A;  3K70 D;  4FET A;  4C9Y A;  4CSW A;  3VSL A;  4BE0 A;  2LRE A;  4IQJ A;  2KRC A;  2DXI A;  1JI8 A;  4AVZ A;  4XN3 A;  4XOT A;  1FMV A;  2DT6 A;  5CQG A;  4P5O A;  3DQV C;  2K3P A;  2R7Q A;  3BCA A;  4OWR B;  3VYU B;  3OYL A;  4X0G A;  4E4H A;  2XDV A;  2HVQ A;  3LSG A;  3ZCO A;  3F9K A;  3EUK L;  3SDB A;  4BEH B;  4XLA A;  3OIP A;  4E7H A;  1N75 A;  4U7B A;  2VXZ A;  1G8X A;  3LL7 A;  2X85 A;  3PNV A;  4HG2 A;  4E7K A;  2VAS A;  1W36 D;  2VJ5 A;  4F92 B;  2MAB A;  3H9J A;  4BGD A;  2R7R A;  4E7L A;  2VKD A;  4BL0 B;  4CZC A;  1N77 A;  2KZV A;  4J01 A;  3DKX A;  2W1O A;  3PSI A;  4CCM A;  3E1S A;  4CCN A;  2QKM B;  5LFA A;  4EAT A;  3OOU A;  2V7F A;  3CZ6 A;  2IS2 A;  2VXD A;  4BDY A;  4OAZ A;  4RLF A;  4AU7 A;  2K9M A;  2KP6 A;  3QOD A;  4F91 B;  3HOS A;  2JVH A;  4D1Q A;  4DBQ A;  3VWB A;  3PNY A;  3TL4 X;  3A1Y A;  2FUG 2;  3PL8 A;  2R7O A;  1DP3 A;  3FKJ A;  4NUB A;  3W2W A;  3H9G A;  2XF7 A;  2L2O A;  2IS1 A;  3V42 A;  3BC8 A;  4XLE A;  1BOB A;  2VPL A;  3K6G A;  2W82 A;  3M8J A;  4XQF A;  2X6X A;  2LY1 A;  5CKT A;  4BQQ A;  4E6K G;  4N4N B;  5CQE A;  2R7U A;  4ZDP A;  1MMD A;  2QKL B;  4BS9 A;  1D1C A;  3H0D A;  2M3A A;  3K4K A;  3DTK A;  2KHM A;  2VL8 A;  2BOL A;  1K6Y A;  2KLO A;  3CF2 A;  4XM3 A;  3AFH A;  3FHN A;  4BJT A;  4DBR A;  2LYC A;  4E7I A;  3OYN A;  2WBM A;  4XKV A;  2HVS A;  2WAD A;  3EUH C;  1MNE A;  1WJ5 A;  4C30 A;  2ZXH A;  3OWT A;  4XLC A;  2VJJ A;  1TT0 A;  3N05 A;  4LIU A;  4XL9 A;  4Y33 A;  3BG7 A;  2X1D A;  2PJR B;  4PSW A;  4RM3 A;  1WJA A;  3OL4 A;  2GOX B;  4U87 A;  4II3 A;  3RQ4 A;  2IGN A;  3J7A Y;  2P0W A;  4LIV A;  3OMY A;  3GBG A;  2W00 A;  1X1B A;  5KCM A;  3HOT A;  2HPI A;  1GLN A;  2ZFU A;  3HKZ A;  2M4G A;  3LSK A;  2HZD A;  3RPU D;  3ZXS A;  2M0M A;  3L2R A;  1X1D A;  2ZSI B;  4J00 A;  2IXS A;  4XOP A;  4HNU A;  3H5N A;  4Y4R A;  3ZGK A;  1V5G A;  1Y56 A;  3DPT A;  1MND A;  4DJA A;  3W3C A;  2BW3 B;  1ERD A;  1P9Q C;  3DTI A;  1D1A A;  3TMO A;  5HOO A;  1X1C A;  3K4M A;  1T0F C;  2AQE A;  4HSR A;  3S3M A;  1S9H A;  2XC7 A;  3OYI A;  3HG9 A;  3DKY A;  3QYE A;  2R7W A;  4E7J A;  3DU5 A;  2JA2 A;  2O5R A;  5LD2 C;  4P1W A;  3SEZ A;  1X1A A;  2KL4 A;  4BE1 A;  3EUA A;  2L7K A;  3HL2 A;  3FDY A;  3OYA A;  3D5L A;  2XF6 A;  4CH7 A;  3OYG A;  3L2U A;  4BJ5 C;  4Y3O A;  4F52 A;  3OYJ A;  3G2B A;  4OAY A;  4ANJ A;  2BVL A;  1MMN A;  3DLA A;  3S3O A;  1LKX A;  3C2H A;  3CJQ B;  4N4O B;  4F93 B;  1Y6I A;  2CW7 A;  4NQW B;  1W36 C;  5FRN A;  3L2V A;  3ZQQ A;  3OYE A;  2IS4 A;  2LBF B;  4CCJ A;  3H5R A;  4XN0 A;  3VDX A;  3K4N A;  1V5F A;  2L9S A;  4XNF A;  3W2A A;  2M4K A;  3K4B A;  1LVK A;  1X19 A;  4GRI A;  3UR3 C;  4ZTF A;  2CV2 A;  3U21 A;  4XLF A;  3PSF A;  1OLT A;  2LRD A;  2JVG A;  4BXF A;  2KQR A;  1YE9 A;  2HVR A;  4BQN A;  2HQA A;  3MMY B;  4AYB A;  4H4K C;  4XKB A;  1MMA A;  4HPQ A;  2ZXI A;  4PFO A;  2UUZ A;  3AL0 B;  4E7S A;  1WFX A;  2M7B A;  3K4J A;  1UEL B;  2JSP A;  2ZSH B;  2KPM A;  4YEJ A;  3A2K A;  2PMZ A;  2CUJ A;  3LSI A;  2IGK A;  2E1M C;  2VQG A;  2VJ4 A;  3OR2 C;  2R7T A;  4NNJ A;  2CFO A;  1J09 A;  2VIX A;  2ELJ A;  2WA0 A;  2Z16 A;  4CCO A;  3SEQ A;  5HVQ C;  2E5N A;  3OIQ A;  4PK4 A;  4G6T B;  4IQ4 A;  4II2 A;  2WAF A;  2IGM A;  3OYC A;  2NOJ B;  4FAS D;  3CP8 A;  4CA0 A;  4PJL A;  2L5Q A;  3BLY A;  3PNT A;  3BG6 A;  3RCO A;  3OY9 A;  1PYV A;  1QHG A;  3S8P A;  3S93 A;  2M7A A;  4ZJZ A;  2VQL A;  4R79 A;  2CH0 A;  3IAS 2;  3VYR B;  4CCK A;  3EPZ A;  2I8D A;  5FRM A;  5KHD A;  3MD2 A;  3KX2 A;  3E0J B;  2HPM A;  4KIS A;  2WAQ A;  3CJR B;  3QYB A;  4ZC3 A;  3KEY A;  2LH9 A;  1WJC A;  4QPO A;  3K70 C;  4F3Q A;  2W4S A;  1QU3 A;  2F5V A;  2UWM A;  5CPR B;  4ZYA A;  2IS6 A;  2MD0 A;  3I9V 2;  3OYM A;  1U0J A;  2KDO A;  2VKH A;  2A5W A;  1IRX A;  4JQF A;  3H5A A;  4B44 A;  1Z3Y A;  3ZR8 X;  4YEL A;  1E0E A;  2V9K A;  4DIQ A;  1T95 A;  3LSM A;  4BAC A;  4F55 A;  3AL0 C;  3TBI A;  1ZEL A;  2OV7 A;  2Z2S B;  2MYS A;  2WY7 Q;  1DGR M;  3A4C A;  3DEE A;  4KT6 A;  3H35 A;  3PFY A;  1HA8 A;  3W2V A;  2HNH A;  4CCL A;  3PJR A;  2MC4 A;  3HC7 A;  4XOR A;  2A6T A;  2AQF A;  3M1C A;  3VYS B;  1N78 A;  2DOA A;  4IKF A;  4RM2 A;  3D5R C;  1LFP A;  4PJJ A;  1QHH D;  4RMN A;  5FRO A;  3MKZ A;  2X51 A;  1G59 A;  1BR4 A;  3VSK A;  4C2U A;  1Z7L A;  1NG6 A;  3OS0 A;  2IGO A;  1WJB A;  3L2W A;  2L9N A;  4BQO A;  4C2T A;  2CUZ A;  3QOE A;  4ZDO A;  2RNG A;  3HUG B;  3H9Q A;  4HRI A;  1DGW Y;  2X6W A;  1MW7 A;  1WJD A;  3IP4 B;  2PJR A;  2R7V A;  1X4P A;  4BJ6 C;  3MKW B;  2WY8 Q;  1SFK A;  3DPL C;  3S32 A;  1SAU A;  1LDK B;  2Y0S A;  4BUP A;  2JUG A;  2VJI A;  3OS2 A;  3UNG C;  2CW8 A;  2R4G A;  2K9L A;  3AKZ A;  4ZTJ A;  4HEA 2;  2BVM A;  2CMP A;  4CUG A;  2VQC A;  5HLT A;  2V1N A;  3RTR A;  1WJF A;  1OR7 C;  2X1C A;  4BU2 A;  3DTE A;  2LC2 A;  3OYH A;  3L2Q A;  2KMU A;  3ZRG A;  3K10 A;  3K4C A;  1VZ0 A;  2W7N A;  4HNT A;  4HST A;  4KIT B;  2HDW A;  4MLO A;  2LBF A;  4YRV A;  3VYT B;  3K4L A;  2E60 A;  2Z1D A;  4NC8 A;  4XKW A;  2V6E A;  2OUM A;  2F6C A;  1D0Z A;  1NG7 A;  3SZG A;  4ITV A;  3OR1 C;  4BDZ A;  1FMW A;  2VQH A;  1PJR A;  2DJI A;  2VB6 A;  2R7X A;  4KJZ A;  1V5E A;  2GOM A;  2K5C A;  2V26 A;  4IX7 A;  3OYB A;  3OS1 A;  2X6Y A;  3ONQ A;  2Q2E B;  3LMM A;  3NWT A;  1KON A;  3C2G A;  3HXL A;  2OC6 A;  1D0X A;  3BCB A;  3I3L A;  4XMY A;  2R7S A;  2CS3 A;  4RLQ A;  3RSN A;  1BR1 A;  1X4O A;  2RRE A;  2UV1 A;  2XAU A;  3PUB A;  3IAM 2;  1EA3 A;  3CP2 A;  2LG4 A;  4PSX A;  2F4I A;  3QYF A;  1Z3X A;  2E1M B;  3HPG A;  4E7Z A;  4XKC A;  1YX5 A;  3DWL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...