1WSUA

C-terminal domain of elongation factor selb complexed with secis rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
GSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDEFYWHRQALGEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDKRVVVGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*GP*GP*CP*GP*UP*UP*GP*CP*CP*GP*GP*UP*CP*U*GP*GP*CP*AP*A
publication title Structural basis for mRNA recognition by elongation factor SelB
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Translation/rna
total genus 45
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09107 SelB-wing_3 Elongation factor SelB, winged helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA02
5CVIA 3E6CC 1I1GA 2VONA 4LG0B 2CQKA 2YSRA 4QWQA 2FMYA 5D4RA 3JW4A 3WGGA 2RQPA 2E1CA 2EV5A 4G8XA 4ETSA 2R3SA 1QPMA 4I7HA 5BOXA 4L9NA 4U88A 2VBYA 3H3ZA 1FT9A 3QP6A 4KNYA 4G9YA 1I5ZA 3WODF 3MQ0A 2FNPA 3NEUA 2E7WA 3FXRA 5IT9Z 2NRAC 1TW3A 1W5SA 5D6FA 1O7LA 2HFHA 2C6YA 4HF0A 5FFZA 4UUVA 2BEOA 2ZBKA 1RIOH 5DCMA 1S7OA 4BHPA 1EH8A 1ZG5A 4P5OA 1HSJA 3LA3A 3TOAA 1FY7A 4G6QA 1ONVA 2A69F 3BP8A 1F5TA 5FLXZ 1K79A 3CO6C 1ZARA 3TDUC 1BI1A 5J6XA 4F7ZA 4XRFA 4N9IA 2DBBA 3P9KA 4BHCA 3KEOA 1YFHA 2P7VB 3KP6A 5LLQA 1R23A 1TBXA 3FXUA 1U78A 4ENKA 3F72A 1TNTA 2GWRA 2KJBA 3J80Z 2HYFA 4OOIA 4ESFA 4R1HA 4HX4A 1KQ0A 1Z05A 3ZQ7A 3SHFA 4BH9A 4HX7A 1Z6RA 1ZGAA 3CO7C 5FGMA 5J8FA 1Z9CA 1ZLJA 2O03A 2FA5A 3FX3A 3M8FA 1O57A 2XIGA 5L3CA 2JTVA 5LBQA 2GAUA 5CVJA 3FXQA 1XGMA 1UCRA 3EDPA 1FNNA 3ZMVA 2QQAA 1OPCA 2KKOA 4LLNA 4LK1F 2LKPA 3HTSB 4EJUA 1XDUA 2E7XA 2MLGA 3TO9A 2MD5A 3QOPA 4IPAA 2PLYA 5LEKA 2M87A 2K4BA 1YYVA 4YFNF 1MJ9A 5LGUA 1GXPA 3M8EA 2V79A 3DPTA 3VOEA 3HRUA 4ENMA 4HF2A 1U6GA 3AAFA 1XGOA 1G4DA 2P8TA 3KLOA 5E1WA 3EETA 5HLGA 3WTTC 2K4JA 1JHHA 4I09A 3CUQC 4N9HA 2M5WA 4U7BA 2FBKA 1XB4A 1SD6A 2QQBA 2YR2A 1TQIA 2V6CA 5FB2A 4A6DA 3ML6A 1ZGJA 2EJRA 3EYIA 5HLHA 2VBXA 3VEPA 5H20A 1UB9A 4FT8A 3GEZA 4LK0F 1CGPA 4U0WA 5AIQA 4I98B 1BJAA 4BYYA 3WTZA 1YTYA 4KN4X 4EV0A 1HW2A 1T0FA 2GXBA 3KLNA 2O3FA 1BIAA 4OU0A 1FX7A 3L9FA 2RDPA 3CUOA 3I5UA 2EK5A 2EFWA 4CO8A 2L01A 1UHMA 4TV7A 4KN7X 2VBWA 1DP7P 2ZCWA 3GF2A 1SD4A 2DQRA 2HS5A 2YU3A 2FE3A 4HV5A 5D5XB 1GHCA 1TNSA 1FYLA 1P4AA 1FPQA 3U1DA 1GVJA 4CZZA 1B4AA 4LFUA 4OIQF 3F8BA 2ZMEA 5DD8A 3QPTA 3I59A 3KZZA 5HOOA 3EYYA 2GXGA 3M1EA 5ERIA 2XROA 3V8JA 2OZ6A 3FMQA 1IXRC 4L0YB 2EV6A 1W7PD 1RUOA 1A04A 2LNBA 4RB0A 1ZHFA 4PGGA 1Z6TA 1R1VA 3OOPA 3TDZC 1BIBA 2MLKA 1O3RA 1G3TA 3BY6A 3IWFA 2P4WA 1LDDA 2G9WA 4O5VA 4RB2C 1I6XA 4L0ZB 2DT5A 2JPBA 4PZJA 4ASNA 2ESNA 2VOPA 2BBYA 1ODDA 4GO1A 2KIFA 5BMZA 1ZRDA 4AD9A 3E5UA 3C1DA 4ON0A 4IRIA 3WTSC 1T2KA 2VN2A 5FLXK 2UWMA 1U5TC 4M9XA 3QU3A 2OZUA 2HOEA 2HTSA 2RGVA 1HSTA 4HLYA 3RIRA 4KYWA 2A5YB 5E20A 4KIBA 1F9NA 3F8CA 4LLLA 2P7CB 1K6OA 3DFGA 2FU4A 4HF1A 1G3SA 3QU6A 4MGRA 1SFUA 2JSCA 1SFXA 5HDNA 1TQMA 2A6HF 4A12A 3JSPA 1PUEE 3O2PE 4M73A 3MWMA 3HTUA 2XAQA 2STTA 2BYVE 4QLCU 4HDUA 5ILVA 2QQ9A 4I2OA 1DDNA 3CTAA 3I59B 2Z99A 1YQAA 2DK8A 3KP2A 2VBZA 3B73A 5HDKA 2VOOA 2X4HA 3ZN0A 2Y0MA 1NHAA 5D8KB 3BOQA 1Z91A 4G6DA 4EM2A 1TW2A 3WG9A 2F5FA 2IVMA 4LLGF 1O3QA 1J75A 3KP7A 5DEQA 2Z5UA 1YLFA 4IXAA 2ZO4A 3GZ5A 4HDVA 4CXFA 3E6MA 4A5MA 1WKMA 4MTEA 1BC8C 5LGTA 2PEXA 2UXNA 4Q5SF 3RI4A 5LHIA 4UV8A 4IRGA 3NQOA 2R7DA 1U3EM 5E17F 2A07F 4XLPF 3KP4A 4Q48A 1O3TA 1SAXA 4D0PA 1FWZA 1HXDA 2K02A 3BPVA 2HQNA 4OMZA 2Z9OA 3GW2A 5D5WB 1OKRA 4GYGA 1YG2A 1J59A 3FMRA 2OQGA 2F5EA 2A68F 2FXAA 1XMKA 1SMYF 1D8KA 2DFIA 2D1VA 2CG4A 3HUGA 1XN7A 4ZYDA 2DPUA 1SD7A 5L3EA 4ZYHA 2OBPA 1YW8A 2ZNYA 3K9TA 5DYMA 3E5QA 2WC2A 4BNCA 2P6TA 1I27A 1XDSA 4G7ZF 1K78A 4Q4ZF 5AONA 1QBJA 4GYIA 2PMUA 5H6QA 2NAZA 4MTDA 1P4WA 2ELHA 4XBFA 1YW9A 3LAJA 1DPRA 4HW0A 2CYYA 4Y17A 3LFKA 3P7NA 3MZHA 5JR3A 4AIHA 1IXSB 2OU2A 3K1PA 2VT3A 3GX4X 1XGSA 3K2ZA 3L2CA 3KCCA 4HLXA 4U0VA 4IJAA 3MEXA 1FP1D 1TLHB 4GCVA 2M45A 5CVVA 1L0OC 1FBQA 3DP7A 1Y0UA 3GO5A 3DQVC 4RGXA 5HLIA 3KETA 2EA4A 5E1XA 1R1TA 1FYKA 2D45A 2LDUA 1J5YA 3WE2A 5LEJA 2MBFA 2G7HA 3HIFA 5FFXA 4M9ZA 5ILUA 5A2QZ 3Q9VA 2P5LC 4LB6B 3ELKA 4NB5A 4WF2A 4L9VA 3T0YA 1ZG3A 4R79A 2GA1A 2QYOA 2FRHA 1P2FA 2A61A 2UXXA 4LGWA 4CGZA 4HQMA 5K5OA 4IHTA 3COAC 5FD6A 2GQQA 1QZZA 2WV0A 4KT5C 4O3MA 3BJAA 2CO5A 1OYYA 2Z3YA 1WI9A 4N0BA 2RKHA 1OYIA 1ULYA 3E6BA 2IA1A 1LEAA 3VFZA 2ZFWA 3RDIA 1IN7A 1RI7A 2KJCA 4YIFA 4UNOA 4G7OF 4M6XA 2IW5A 2RNJA 1V4RA 1TTYA 1T39A 1Q1HA 3Q5FA 2HR3A 2JPCA 3G3ZA 2ZNZA 1K78B 3TO7A 5LRSA 3CUQB 5BQTA 4WXDA 1FC3A 2EB7A 2Y48A 4MEXF 3I4PA 5BPDA 5CJ9A 4U0YA 1R22A 3FWEA 3JSOA 4L18B 2L54A 3M7GA 1D3YA 2W24A 3ZMUA 4E70A 5FD5A 1UHWA 5L3FA 3QPHA 4I0AA 3HHHA 4WX9A 2RVCA 3ZP5A 2PMHA 3DV8A 2OQRA 4S04A 3LSTA 1RNLA 1DPUA 4CDGA 3PQJA 4L9JA 2H09A 4UXNA 2L4MA 1HKSA 2KRFA 4OIOF 3R4KA 3RPQA 4A0ZA 2XAJA 3WGHA 4RS8A 3F23A 4BXUA 3WGIA 2HZTA 1IF1A 1J7KA 4P9UA 3P9IA 2V1UA 2F5CA 2OA4A 2P6SA 4RGRA 3V7CA 4G7HF 1EV7A 1HKTA 1IXCA 4O6JA 3JTHA 5BS6A 5FO5A 3I0TA 1ON2A 4Y15A 5J8CA 2CGPA 2D2WA 3TO6A 1JGSA 3I64A 3KZYA 3F8NA 4P55A 1W5TA 4LB5A 1W7PB 2O0YA 2NNNA 4I01A 1XSDA 3HRSA 3HRMA 3T8TA 2TDXA 2HYGD 2DU9A 3V8LA 2Q8KA 2XKOA 2F5DA 3SZPA 1R58A 5KK1A 2QLZA 3T5XA 3PQKA 2R7FA 4OINF 3J81Z 4LJZF 2ZXJA 2OAZA 4M74A 1AOYA 1H9GA 3OV8A 2BE5F 1PP7U 1LJ9A 2XUBA 1W4MA 1CF7A 2AXLA 1IN5A 1YS7A 4UVAA 2ADUA 4R8HA 5IT3A 4K2EA 1KA8A 3DEUA 3GUDA 3V7RA 3M9AA 1MGTA 3F8FA 2VXZA 1IN4A 4Y13A 4KMUX 4S05A 1MZBA 5K1YA 3H92A 2QVOA 1ZREA 1QO0D 2DLLA 5CVRA 4JQFA 2DW4A 3ABTA 2AS5F 1IRFA 2EFPA 5JHUA 3EUHA 3R6SA 2EFQA 1O3SA 3WE3A 4HOBA 4HQEA 3R0AA 3I54A 5D5VB 3HYIA 2XGXA 4XSZF 3ZMTA 1T6SA 3ZMDA 2HTJA 2COMA 2O8XA 4A0YA 5ICCA 4KDPA 5HS9A 4MHGA 6PAXA 3FZVA 1JXSA 3TKYA 5EEGA 1GXQA 3U9GA 3IHUA 3LA2A 1S3JA 4P96A 3ISPA 1IAWA 3MFKA 3SQNA 1BC7C 5ED4A 2ZKZA 1RUNA 3T1BA 2VE9A 2RV8A 4HYEA 4RGUA 4M71A 4NQWA 3TOBA 2XHKA 3GFIA 5A2QK 5DCFA 3IRQA 4AIJA 2PFBA 4A2UA 2IA2A 4CHUA 1FSEA 4JK1X 3WTYC 1WSUA 1S7AA 2DO7A 1K7AA 1C0WA 5HVQC 3KE2A 1FZPB 3BWGA 4IVNA 4CYDA 2CW0F 2JT1A 3JAMZ 2DK5A 2D1HA 3ZMSA 3B02A 1FBSA 3RJPA 2ZJ2A 1ZN2A 3HRTA 2V1DA 4FX0A 1CF7B 2MH9A 1MJBA 4EJTA 2CWEA 1HQCA 1S29A 1MDMA 5HDGA 3O6BB 1QGPA 3F22A 2W25A 3ZPLA 4ENJA 4ENNA 4IHSA 2E1NA 2YPRA 4BAYA 1P4XA 1SD5A 1J9IA 2FOKA 1ON1A 2L3DA 2DTRA 2EV0A 2HQRA 4I02A 2BGCA 2HDCA 1IW7F 2DAOA 4ZZLA 1MJAA 2VT2A 3EQLF 3V8KA 4G94A 4GGGA 2Q0OA 5ILSA 4L5IA 3HSRA 2RC4A 1FLIA 4KA4A 3LAPA 2UZKA 4RB3C 3P9CA 2DPDA 4CICA 2LF8A 1DUXC 4DQ2A 3IC7A 3LQRA 1IZ1A 1LB2A 4RAYA 1D5VA 1BM9A 5HS7A 2H94A 3N97A 3TGNA 1J0RA 2V1XA 2HEOA 4EGZA 3GYHX 3IWZA 4B8XA 1ZG1A 1PP8F 5L3BA 5CYVA 1E2XA 3K1MA 1HBXG 1JE8A 3KFWX 5D6EA 2JZYA 1XCVA 4MNUA 3ZMZA 3FF5A 1BN5A 5TJJA 3HHGA 4KIFA 4M72A 2IP2A 2HKOA 2PN6A 4B09A 4EJVA 4PGHA 3DF8A 2Q2EA 4YG2F 4NHJA 3V4GA 4FHTA 2HWVA 5KVRA 2MA3A 4DNCA 4ESJA 4EM0B 4PDKA 1KU9A 5TRDA 4XLNF 5CLSA 2ISYA 2YX4A 1KYZA 3E97A 5E8GA 3CUQA 1MDMB 5D8LB 1R7JA 4EGYA 4WCGA 2V9VA 3LA7A 2VODA 5AIPA 1L3LA 4YFXF 2ACJA 2A6EF 3J81K 2K27A 5D5UB 3ECOA 3HOTA 1FBUA 2W57A 3GVAA 4GXOA 4UVBA 1S8NA 3DKWA 3SZTA 1LEBA 3GFMA 3N4MA 2QM3A 1EH6A 3TQNA 3VB2A 1H0MA 3LQQA 4WXCA 4XSXF 2BV6A 1BI0A 3CLOA 4I0BA 3L00A 4KUMA 3CJNA 3IKTA 3SFZA 2VE8A 1LNWA 1U8RA 4LD5A 2NYXA 1FOKA 1TQPA 4HBLA 3GLXA 4HA8A 5E18F 5JVTA 2XAGA 3KP5A 1XSXA 2Y75A 2KIUA 4AIKA 4YFKF 3WTXC 3ABUA 2PG4A 3HSFA 4MQVA 3GZ6A 5DUIA 1IRGA 2B0LA 1XGNA 2EFNA 4JBAA 4BQAA 1XSVA 2WWYA 1QNTA 2EWNA 1FP2A 5E1ZB 1FYMA 2QZ8A 1W7PA 1FSHA 1WQ2A 3RYPA 1G3YA 3ECHA 2FQ3A 3RKWA 3BROA 4U7DA 4PCQA 3D5LA 2XAFA 4UVCA 1STZA 1P6RA 2STWA 5ICFA 4EM1A 3GWZA 3E6DA 3ERED 2W85A 2K7LA 3C18A 2ISZA 4L9TA 1Z7UA 3O3KA 1SFEA 2W84A 4MQ9F 3IKVA 3WU0A 1EH7A 1KU7A 5F1RA 3IL2A 3RTRA 2LF7A 5DDGA 4EVIA 2GZWA 5BPIA 1B9NA 3VODA 4RGSA 2XAHA 2H27A 4KFCA 3S2WA 1ZH5A 5LRRA 4P9FA 4A5NA 3U2RA 4ESBA 1IUYA 1ZAOA 2YX7A 1ZYRF 5CVUA 2HKXA 5DCMB 3JAMK 3F21A 2XV4S 5K5QA 2IT0A 1MKMA 3F8MA 2WTEA 2ESHA 2M30A 3HOSA 2FF4A 1SMTA 2FBHA 2MC3A 2XRNA 3F6VA 2PJPA 3ROUA 1U5TA 1U2WA 1ZRFA 2X0LA 5ICEA 3KP3A 2XASA 4KIGA 3RPUA 3CDHA 1YS6A 4AWXB 3K1NA 4OIPF 1XCBA 3G73A 2EA2A 3I58A 4ZYGA 2NS0A 2A3SA 1B9MA 1P92A 4HX8A 2GA2A 1IN6A 3ZN1A 5LGNA 2O6GE 3BZ6A 4UV9A 3FHZA 2EFOA 3SXYA 2P5KA 3MZYA 3R0JA 1JHFA 3FMSA 1R5HA 1BOAA 2IA0A 1LQ1A 1MD0A 5DUKA 3QP5A 4FX4A 3GFLA 1KU2A 5F6FA 3RKXA 1KQ8A 4BHBA 5ICGA 5DD4A 5JI6A 2M1BA 1D8JA 1LDJA 3L09A 1ZRCA 2DI3A 1KQ9A 1B6AA 3K0LA 3K69A 2QENA 1BI3A 1YIOA 3QRFF 3R60A 4EJOA 4LMYA 5HS8A 2J5PA 3RYRA 3H3UA 2F2EA 1O7FA 3T8RA 1OMIA 1USTA 3W6JB 5DV5A 4A0XA 1BBYA 2DQLA 4EQQA 3IRRA 4KMFA 1LVAA 4HV6A 4EMSA 1QZYA 1LDKB 2PQ8A 5F64A 4UHTA 2G7UA 1F4KA 3Q9SA 5LHGA 3LWFA 1REPC 2ETHA 3V7SA 4H0EA 3RKYA 1WWXA 5IT9K 1T38A 2FNAA 2QUFA 4WK8F 4EJWA 3WTUC 1S6LA 1U5TB 3DXJF 2FBIA 3BDDA 3KEQA 1OYWA 3REOA 4HAMA 3I53A 1B59A 5LHHA 2CFXA 2FEZA 1WRJA 2IJLA 3E5XA 5EEHA 2VC0A 3DPLC 3GFJA 1R00A 1B1BA 2P5VA 2J5OA 2QBYA 2XKPA 3D0SA 2Z33A 2JRTA 2CSOA 4Q47A 4OIRF 1J2XA 4LG0A 2H6BA 2H6CA 5H6RA 4RB1A 2PBIA 3WTVC 2IPQX 4A6EA 4L5JA 5D4SA 2NNYA 4MEYF 4WWCA 1RZ4A 2M8EA 3W6KB 4KICA 2FMLA 1YO5C 1KYWA 4ZH4F 3E3VA 1OR7A 2XVCA 1R36A 4ZYEA 3C3WA 1R1UA 2O61A 2HGCA 1F1ZA 3FM3A 3JTGA 3J80K 2K86A 3PFIA 5K5RA 4WXHA 1V3FA 1I1SA 1YW7A 2L02A 1PDNC 1UFMA 1H9TA 3WU1B 1E17A 2PI0A 1AWCA 2ZMEB 1HKQA 4ZZDA 4Z2YA 3C7JA 3GXOA 4OMYA 1KU3A 3F3XA 4M9SA 5L3DA 1KGSA 4IF4A 4RAZA 2QWWA 2IRFG 3MAJA 3R61A 3J7AO 1VTNC 5E8IA 5JFRA 4YIIA 3ULQB 1HW1A 3BJOA 3I71A 3WTWC 2LSOA 1HW5A 2MH2A 2VC1A 3MCZA 2FSWA 1QQIA 1Z1DA 2GIVA 2KIMA 3L7WA 1G3WA 4HZFA 1R5GA 4AVPA 3F6OA 1T98A 3HSEA 1BI2A 1USSA 3QAHA 5L3GA 2L4AA 1X3UA 2OD5A 3BPXA 1XMAA 2RN7A 3NRVA 4IRHA 1G6NA 4M6YA 2QBYB 1IN8A 1ZLKA 1XD7A 3FM5A 3BJ6A
chains in the Genus database with same CATH superfamily
2MYSA 3JRGA 5CVIA 3E6CC 1I1GA 2VONA 2IGNA 4LG0B 5E3LA 3PO2J 2CQKA 5GPCA 3S16J 4E7IA 1LKXA 1JKPC 2YSRA 4QWQA 2FMYA 5D4RA 3JW4A 3WGGA 5DM6F 2K5CA 2DOFA 1G8XA 2RQPA 1YRNA 2DFEA 1MMGA 3G1MA 2E1CA 2EV5A 3QPLA 2ELKA 2ZXIA 4G8XA 4ETSA 2R3SA 5EEAA 4A3GJ 3G2BA 3OL3A 4GDFA 3MKYB 5IY5H 1QPMA 2MGQA 3P5JA 4I7HA 4XN3A 1YJWI 3ZQCA 5IYCJ 5BOXA 4L9NA 4U88A 2LYCA 2LKSA 3DU6A 2VBYA 3H3ZA 3K10A 1FT9A 3QP6A 4KNYA 1RR8C 4G9YA 1RKTA 1MNDA 1HDDC 1I5ZA 3WODF 3CCMI 3JRHA 3MQ0A 1E0EA 1WJDA 1T8IA 2FNPA 3NEUA 3K70C 2E7WA 3FXRA 2HNHA 5IT9Z 5FKMA 2Q1ZB 3ZQLA 2NRAC 3DLAA 1TW3A 2R7TA 1W5SA 2IEKA 5D6FA 1VF9A 1WFXA 3CCEI 1O7LA 3LSIA 3BQZA 2HFHA 3K4NA 2C6YA 1SANA 4HF0A 3OSFA 4XK4A 4BACA 1LE8B 3S15J 2IGOA 5FFZA 2A5WA 3HJEA 4QPQA 3TW6A 5IP9J 4UUVA 2BEOA 2L9VA 5J1UA 2ZBKA 1RIOH 5DCMA 2IGKA 2ID3A 3HPHA 1S7OA 4BHPA 5J1RA 1EH8A 1Z3YA 2V4JC 5J4VA 1ZG5A 4P5OA 5M5WJ 1HSJA 3QYFA 3LA3A 3D1NI 3TOAA 3H9GA 1FY7A 4G6QA 3IUOA 1ONVA 5C44J 2A69F 1MBJA 1X3ZB 2L0KA 2L7FP 3BP8A 3CCUI 5FLXZ 1F5TA 1K79A 3CO6C 2LK2A 1ZARA 3TDUC 1BI1A 2BZTA 1N78A 5J6XA 4F55A 4F7ZA 2EILH 4PFOA 4QSHA 2B9SA 3ESWB 4XRFA 2K9MA 4N9IA 1EKEA 3BR0A 2DBBA 3FISA 3P9KA 4BHCA 3KEOA 1YFHA 2P7VB 3KP6A 5LLQA 1R23A 1TBXA 3FXUA 2ZJQF 1U78A 3DTKA 4ENKA 5M3FJ 4XN0A 5DS9A 4I6ZA 3F72A 5K7ZA 1TNTA 3C2GA 2GWRA 1NK3P 2KJBA 1Z67A 3J80Z 2HYFA 4OOIA 4ESFA 4R1HA 3HEFA 2AHQA 2UUZA 4HX4A 1KQ0A 1ACIA 1Z05A 3ZQ7A 3SHFA 4BH9A 2CV2A 4HX7A 2CUFA 2NOGA 1Z6RA 3PIOF 1W0TA 2O9LA 1ZGAA 3CO7C 3QYBA 2KFDA 5FGMA 4RA2A 5J8FA 1Z9CA 4IHXA 1ZLJA 4XMYA 2O03A 3L1PA 3SEQA 2FA5A 3FX3A 3QPSA 2IAIA 2YUSA 1UAAA 4PSWA 3M8FA 3FK6A 2VPLA 1X19A 1O57A 2XIGA 4B3AA 5L3CA 5C4JJ 4HSRA 4N4NB 3H3VK 2JTVA 3BTLA 5LBQA 1YRNB 3C2HA 3HOYJ 2GAUA 3BZCA 5CVJA 2K3FA 3FXQA 1XGMA 2CQNA 3K2AA 3OYFA 1UZCA 1UCRA 1N25A 3EDPA 1FNNA 3ZMVA 1VI0A 2QQAA 3RQIA 2W4SA 3QYEA 1OPCA 4XLAA 2KKOA 3JR9A 4LLNA 1GT0C 1YJ9I 1PUFB 2ICWG 3I9V2 1A35A 1VQNI 2QF7A 4LK1F 2F4IA 5CQGA 2LKPA 1WVRA 4EEFG 2VLAA 4BY1J 3HTSB 4EJUA 4IHVA 3HUGB 2UV1A 2XPWA 1XDUA 2E7XA 2DFFA 2YU9J 2JUCA 2MLGA 3OYIA 3TO9A 2MD5A 3QOPA 4IPAA 3SEZA 2PLYA 3EUAA 5LEKA 1TP4A 2M87A 2X48A 2K4BA 2HXOA 5JHFA 1YYVA 4YFNF 1MJ9A 2JK3A 5LGUA 2VKVA 1GXPA 2ZSIB 3M8EA 3FXLA 4ZYAA 3DPUA 2QQ8A 2V79A 2H8WA 3DPTA 1BR4A 2F4OB 3VOEA 3HRUA 4ENMA 4HF2A 1U6GA 2DFHA 1ERDA 1IO2A 2I10A 1TWCJ 5CPRB 5EJCA 2WAQA 3AAFA 3GTKJ 3PL8A 1XGOA 1WJBA 2DOEA 4RMNA 1G4DA 4NBQA 2E36A 5FKKA 3S32A 4C3IJ 5M3MJ 4ZC3A 2P8TA 3KLOA 2ZJPF 5E1WA 3EETA 4DYRA 3B6CA 4XR6A 5HLGA 1VQKI 3DWLE 4A3DJ 3JRFA 3WTTC 2F48A 4LITA 1WCMJ 2AXTC 2K4JA 3FXMA 1JHHA 1SFKA 2Y9ZA 3QQAA 4I09A 3CUQC 4N9HA 2M5WA 4U7BA 2FBKA 4A3IJ 3MN2A 1XB4A 1AKHA 1SD6A 2QQBA 1UG0A 2HVRA 2YR2A 4C30A 1TQIA 3TEDA 1WJFA 2V6CA 2X6YA 5FB2A 4A6DA 3VYSB 4XRMA 3CJRB 3H0DA 4IKFA 1RRJA 2BW3A 3DCFA 4E6KG 2DYRH 3ML6A 4PUSA 1ZGJA 1YX5A 2EJRA 3GTMJ 1Y1VJ 3EYIA 5HLHA 2VBXA 2EZKA 3S8PA 3VEPA 5H20A 4KISA 2LY1A 1TL8A 3BR3A 1UB9A 2K9QA 1FTZA 4FT8A 3GEZA 4LK0F 3BLYA 1CGPA 3VWBA 4IHYA 1JTYA 4U0WA 3OYGA 5AIQA 4I98B 2ID6A 3GTOJ 2X6XA 1BJAA 2Y0SN 1JJ6C 4BYYA 3FBIB 3WTZA 4G12A 1YTYA 4KN4X 4EV0A 2LBFA 1HW2A 1T0FA 2GXBA 2ELJA 1VQ8I 3FHNA 2CRGA 2RREA 3KLNA 2O3FA 1BIAA 4Z6YA 4OU0A 1A36A 4M6VA 1FX7A 3L9FA 2RDPA 1WH5A 4PJLA 3CUOA 3I5UA 2EK5A 3OL4A 4DW6A 2EFWA 4CO8A 2L01A 1UHMA 4TV7A 4KN7X 3TBIA 3GTLJ 2E2HJ 2VBWA 4DJAA 1GUUA 4DBRA 1DP7P 2ZCWA 1DQUA 3M8JA 3S3NA 3GF2A 1SD4A 3Q0VA 2DQRA 2HS5A 2YU3A 4JX6A 2FE3A 1E3OC 1FJLA 3CC4I 2DMNA 2QKMB 4HV5A 5D5XB 1IV6A 1GHCA 5EZGA 1TNSA 1FYLA 5F0FA 1P4AA 2HI3A 1NG6A 1FPQA 3U1DA 3HOZJ 1GVJA 4CZZA 3PNTA 1UHSA 1B4AA 4II3A 2KDOA 4B43A 2E71A 4LFUA 1IDYA 4OIQF 2W48A 3F8BA 2M0CA 4RLFA 2X51A 2ZMEA 1WI3A 3CQZJ 2CQ7A 3GLLA 5DD8A 3QPTA 2KQRA 3I59A 3KZZA 5HOOA 3EYYA 4F3QA 2GXGA 2HQAA 3L2RA 3M1EA 1A6IA 5ERIA 2BHYA 1ZELA 2XROA 3OSGA 3V8JA 2OZ6A 3FMQA 2KZVA 2X9DA 2E1MC 3WHBA 1IXRC 1WGXA 2VPRA 4L0YB 2EV6A 2ME0A 1W7PD 2CS3A 1TWFJ 2AO9A 2L7KA 1RUOA 3Q0WA 1A04A 5GAHJ 2LNBA 1BOBA 2XPVA 3ABLH 3DTIA 2FD5A 4RB0A 1ZHFA 3ABMH 4PGGA 1Z6TA 1R1VA 3OOPA 3TDZC 1BIBA 5J3LA 2JWTA 1POGA 4XLHA 2MLKA 5HNFA 1O3RA 1AKHB 5K7FA 1G3TA 4LIVA 3BY6A 3VPRA 4X0GA 2DA4A 3KEYA 1HLVA 4UB6C 3BZKA 1AU7A 2R4GA 3IWFA 2P4WA 3OYJA 2EINH 1VZ0A 4HNTA 3LSPA 1LDDA 2G9WA 4GRIA 4O5VA 4RB2C 1I6XA 4L0ZB 2DT5A 2JPBA 4PZJA 3A0BC 2EZHA 1VNDA 3TL4X 4ASNA 2ESNA 2VOPA 2BBYA 1ODDA 4GO1A 3PIPF 1DU0A 2KIFA 2GLOA 5BMZA 3FKIJ 4BXXJ 1I3AA 3CDIA 1MIJA 1ZRDA 3GTJJ 5LFAA 4AD9A 3E5UA 3C1DA 2WADA 4ON0A 3LSJA 1G59A 4BXFA 4IRIA 3WTSC 4A93J 1WPKA 2R7VA 1T56A 3HB9A 2CQXA 1T2KA 1D0YA 2VN2A 5FLXK 2UWMA 4MLOA 1ORKA 3NWSA 1SC7A 1U5TC 4Y4RA 4M9XA 1O4XA 2LOOA 2NVQJ 1R5ID 3BCAA 1ETVA 4ZDOA 3KZIC 2L9SA 3S2DJ 2M7AA 3QU3A 2LBFB 2E2IJ 3RZOJ 2OZUA 1NK2P 2Y9YA 4FE7A 2WY8Q 1MMDA 3S2HJ 1VFCA 4J00A 2HOEA 2HTSA 4MIMA 2RGVA 1ZK8A 1HSTA 4HLYA 2W82A 3RIRA 4KYWA 2A5YB 5E20A 4KIBA 1F9NA 2VQCA 3F8CA 2IS2A 1YI2I 4LLLA 4RLQA 2P7CB 1K6OA 3DFGA 2OF7A 4CSWA 2FU4A 2NS7A 4HF1A 3TW7A 2XSJC 1G3SA 2OPTA 4XKCA 3QU6A 4IZZA 3RKQA 1IGNA 4MGRA 1SFUA 2JSCA 5GP9A 3DKYA 1HOMA 1SFXA 3RPUD 1IJWC 3A4CA 5HDNA 2DN0A 4A3JJ 1TQMA 2A6HF 1VQLI 3IH3A 4A12A 3JSPA 1PUEE 3IAM2 3O2PE 3DBRB 4M73A 3MWMA 3HTUA 4E7LA 2XAQA 2STTA 4CCJA 2BYVE 4AYBA 4QLCU 2JMWA 4HDUA 5ILVA 5KAFC 1LUJB 3W2AA 2QQ9A 4I2OA 1DDNA 4JYKA 3CTAA 3I59B 3EPZA 1H8AC 1HF0A 2Z99A 3IH2A 1YQAA 2DK8A 2MG4A 3KP2A 3JREA 2R93J 2VBZA 3B73A 3H0GJ 2LR8A 5HDKA 2VOOA 2X4HA 1OLTA 4NC8A 1XX5A 3CMYA 2X6OA 3ZN0A 2Y0MA 1JKQC 3UNGC 1W0UA 1LPQA 5F08A 1NHAA 5D8KB 3BOQA 5J47A 3GZNB 1Z91A 3GTQJ 4G6DA 4EM2A 2XC7A 1TW2A 3WG9A 2F5FA 2IVMA 4LLGF 3TP0A 3TMOA 5IP6A 2DA3A 1O3QA 2QSFX 1J75A 1H89C 3KP7A 2EIJH 3AL0B 5DEQA 4M3EA 2BY0A 2Z5UA 1YLFA 3L2QA 2K9LA 2JA5J 3CMEI 2JRMA 1Y39A 3SDBA 1MSEC 1OQYA 2LP0A 4IXAA 5JVGF 2ZO4A 3GZ5A 4BKXA 4M3GA 3K4LA 4HDVA 4CXFA 1IC8A 3A0HC 3E6MA 1BA5A 4A5MA 1WKMA 4MTEA 3PSFA 1X2NA 1BC8C 1R4NB 5LGTA 2PEXA 2KPMA 5E3OA 1ZTRA 3OYLA 3ZGKA 2CMPA 1W5CC 4FISA 2UXNA 4J01A 4Q5SF 2HOSA 4YRVA 1TWGJ 3RI4A 3CP2A 5LHIA 4QPOA 4UV8A 4IRGA 3NQOA 2R7DA 1U3EM 2R7XA 2A07F 5E17F 1JI8A 4XLPF 3KP4A 4Q48A 1O3TA 3HKZA 1NH3A 1SAXA 4D0PA 1FWZA 1HXDA 1V55H 2CH0A 1N75A 2K02A 4JOMA 1ETOA 3BPVA 1VQ6I 4Y7NJ 2HQNA 4CUGA 4XIDA 1Y0NA 2IBDA 2QGUA 4OMZA 3OS2A 2Z9OA 1H88C 3GW2A 1TWAJ 1PVEA 1HC8A 3K4MA 5D5WB 2KIQA 1OKRA 4GYGA 1YG2A 1J59A 3FMRA 3A03A 1V5GA 2OQGA 2HQ5A 2WAQN 2F5EA 1PUFA 2A68F 2VJ4A 2FXAA 1XMKA 1SMYF 2K85A 2WAEA 1D8KA 2DFIA 1YHQI 4NDLA 2D1VA 2WAFA 3K4BA 2CG4A 3HUGA 4RBOA 1XS9A 1XN7A 4YEJA 2K9NA 4ZYDA 3DU5A 2DPUA 2K3PA 2VASA 3K4CA 1SD7A 5E3NA 3CF5F 1JT6A 5L3EA 3PSIA 3ZXSA 2NOJB 1VQOI 4ZYHA 2OBPA 1YW8A 5FKNA 2ZNYA 3K9TA 5DYMA 4AUXA 4FASD 3E5QA 1P7IA 2WC2A 4BNCA 1OR7C 2P6TA 2VQLA 1LFPA 1I27A 4AU7A 1XDSA 2KLOA 4IQJA 4G7ZF 2K9SA 1GLNA 1YJNI 1K78A 3LL7A 3HL2A 4Q4ZF 5AONA 1QBJA 3K70D 4GYIA 2PMUA 5H6QA 3OYCA 2NAZA 1P4WA 4MTDA 2ELHA 4XBFA 1YW9A 3LAJA 1DPRA 4HW0A 2CYYA 1Z77A 4CYCB 3A02A 4Y17A 1LVKA 2EBIA 1ETYA 3LFKA 3P7NA 3MZHA 4CH7A 5JR3A 4AIHA 1IXSB 1BW6A 2OU2A 3K1PA 2M2EA 2W1OA 2VT3A 3GX4X 1XGSA 3K2ZA 3L2CA 3KCCA 2K40A 4HLXA 1FIPA 4IJAA 4U0VA 2MSYA 3MEXA 1FP1D 3H1CA 1TLHB 4GCVA 1A5JA 2M45A 5CVVA 1L0OC 4UUSA 5KCMA 1FBQA 3O8HA 3DP7A 1Y0UA 1APLC 2D5VA 3GO5A 3DQVC 4RGXA 1IRXA 5HLIA 3D5RC 3SDGA 3KETA 2O8KA 4CCOA 1QA6A 5DTDA 2EA4A 5E1XA 2VIXA 1R1TA 3LSMA 1MBFA 1FYKA 4YELA 2D45A 2MFZA 2LDUA 1J5YA 1ZR2A 1SFOJ 3WE2A 3KYDB 1IRZA 5LEJA 2MBFA 2G7HA 3CCQI 3HIFA 5K7HA 1JGGA 2KL4A 5FFXA 1X3WB 3G1OA 4M9ZA 5ILUA 3QODA 5A2QZ 1F36A 4E7KA 4LIUA 1IG7A 4F52A 2HDDA 3Q9VA 4XRSG 5B5EC 4Y3OA 2P5LC 4LB6B 4MFEA 4OWRB 3ELKA 4ZDLA 4NB5A 3JRIA 4WF2A 4L9VA 3T0YA 1ZG3A 3U1KA 4D7NA 4DBQA 4R79A 3JCUC 2GA1A 2QYOA 4IHWA 1D0ZA 2FRHA 4V2FA 3ZQHA 1TC3C 1P2FA 2A61A 2UXXA 3H5RA 3CF2A 4LGWA 4X1EA 2Z1DA 4LG3A 1U8BA 4CGZA 4HQMA 2M34A 5K5OA 2VUMJ 3CD6I 4IHTA 3COAC 4ZDPA 3C2BA 2IXSA 5FD6A 1K4SA 4D9JA 1Q1VA 2VKEA 3CDLA 2GQQA 1QZZA 2WV0A 4KT5C 2BXYA 5TISC 3OYDA 3S1MJ 4IOCF 2XF7A 3Q3SA 4O3MA 3BJAA 2VB6A 2CO5A 2P0WA 1OYYA 1TT5B 4F93B 2Z3YA 1WI9A 4N0BA 2N8GA 2RKHA 2DT7B 1OYIA 1ULYA 2DA2A 2X1DA 3E6BA 2IA1A 2QKLB 3J7AY 2HPMA 2V6EA 1LEAA 1Z0XA 3VFZA 2JVGA 2ZFWA 3RDIA 1IN7A 4AC0A 3OS0A 2PJRB 1RI7A 2DMQA 2Q2EB 2KJCA 2OCEA 4YIFA 2BHZA 4UNOA 4RM3A 4Y33A 4G7OF 4H4KC 4M6XA 2IW5A 3E0JB 3HXLA 2RNJA 2WBMA 2LMDA 1V4RA 1TTYA 1T39A 2OC6A 3AG2H 3LSGA 3ZCOA 3A2KA 1Q1HA 4AIDA 4A3KJ 3CESA 3Q5FA 2HR3A 2JPCA 3EUKL 4N4OB 3G3ZA 2L7ZA 4P1WA 2ZNZA 2Z2SB 3HC7A 3IAS2 1K78B 3I3LA 3TO7A 1QVTA 5LRSA 2F5VA 3CUQB 1IUFA 4A3EJ 5BQTA 4WXDA 2NVUB 1FC3A 2EB7A 2Y48A 4MEXF 2X1EA 2QSGX 3I4PA 3HOWJ 5BPDA 5CJ9A 4U0YA 1R22A 3OYNA 3FWEA 3JSOA 4L18B 2L54A 3OIQA 3M7GA 4D1QA 1D3YA 1MW7A 2W24A 3ZMUA 1JT0A 4E70A 2R7OA 4CCNA 5FD5A 3J7ZI 3S14J 1UHWA 5L3FA 2EPFA 3QPHA 4I0AA 3HHHA 3BR2A 4B4CA 1ZR4A 3CZ6A 4WX9A 2RVCA 3ZP5A 2A6TA 1UJ8A 4KT6A 2PMHA 4UUSB 1VQPI 1Y1WJ 3DV8A 2OQRA 2JQ7A 4S04A 1V5FA 1QHHD 1MNEA 3LSTA 1RNLA 4C9YA 1DPUA 1F43A 4CDGA 3LMMA 3PQJA 3JRAA 4L9JA 2H09A 4UXNA 1AA7A 2L4MA 3LSHA 4V19K 1HKSA 3QOEA 2KRFA 9ANTA 2P81A 3BG9A 4OIOF 3R4KA 3S1QJ 5BNGA 3RPQA 3CMAI 4A0ZA 2XAJA 3WGHA 5F1JA 2JA6J 2VKDA 2HVSA 1V5EA 4RS8A 4BXUA 3F23A 3WGIA 2HZTA 1IF1A 2M9HA 1J7KA 4XKBA 4P9UA 4XONA 3MD2A 3P9IA 4ZTFA 1M1EB 1WJEA 2V1UA 4BJTA 1MNMC 2F5CA 2OA4A 2P6SA 4RGRA 2VQGA 3V7CA 4G7HF 1Z7LA 1EV7A 5B66C 1QZEA 4XORA 2OTLI 1IXCA 1HA8A 4O6JA 1RR7A 3JTHA 5FO5A 5BS6A 1D0XA 3I0TA 2ZJRF 4PJJA 4J19A 1T95A 2FQ4A 4AYBN 1ON2A 4Y15A 4BBSJ 5J8CA 2CGPA 2D2WA 3TO6A 2VI6A 2WB1A 4FETA 2X6WA 2JJ7A 1JGSA 4XKWA 3I64A 5HLTA 3KZYA 3F8NA 3FXJA 2LY2A 3LOCA 1X1PA 5CQEA 2ZC2A 4P55A 1WHUA 1W5TA 4LB5A 5EZHA 1W7PB 2O0YA 2NNNA 4I01A 1GV2A 1XSDA 2XGEA 4BL0B 3HRSA 3HRMA 3T8TA 5IYDJ 2TDXA 2HYGD 2DU9A 3V8LA 2Q8KA 2XGCA 3RSNA 2XKOA 2F5DA 1SVMA 2VL8A 3SZPA 2EIMH 1R58A 5KK1A 1ZKGA 2QLZA 4BUPA 3T5XA 3PQKA 3BTIA 3GBGA 2R7FA 4OINF 2X1CA 3VYUB 4LJZF 3J81Z 2ZXJA 2M3AA 4E7JA 3FKJA 1SEUA 3ASNH 4PJNA 2GM4A 2H1LA 2OAZA 3VDXA 4M74A 4FQGA 1AOYA 4B44A 1H9GA 2PMZA 2BE5F 3OV8A 1LJ9A 2XUBA 1PP7U 1W4MA 1CF7A 3HDDA 3CMMA 1VQMI 2AXLA 3CJTB 2F6CA 1IN5A 1YS7A 4UVAA 3U21A 3K6GA 2ADUA 3OIPA 4R8HA 5IT3A 3CCSI 4K2EA 5KHDA 1KA8A 3DEUA 3GUDA 3V7RA 3M9AA 1MGTA 3F8FA 2VXZA 1IN4A 4Y13A 1GDTA 4KJZA 3ZOBA 4KMUX 5GAEJ 4BDZA 4S05A 1XPXA 1MZBA 5K1YA 3H92A 2QVOA 2LFBA 1ZREA 1QO0D 2DLLA 5CVRA 4JQFA 3J7YJ 1I50J 2DW4A 3OYEA 3AKZA 4A3BJ 3ABTA 3S3OA 2AS5F 2IS4A 1IRFA 2EFPA 4BBRJ 5JHUA 3E7LA 3EUHA 4E7SA 3R6SA 2EFQA 2L9RA 4HSTA 2EZIA 5B1BH 1O3SA 2LG4A 3SYTA 3I55I 3WE3A 4HOBA 5CKTA 2B7EA 4M3BA 3BG5A 4HQEA 4G6TB 4FTHA 1VQ4I 3IP4B 3R0AA 2ZXWH 2E5ZA 3HGGA 3I54A 5D5VB 4V2GA 5C3EJ 3OR2C 3HYIA 1I3QJ 4CZCA 2XGXA 3AG3H 3X2QH 4XSZF 3ZMTA 1T6SA 3VSLA 5M5XJ 1OCOH 3A1YA 2HZDA 4HG2A 3ZMDA 2I5UA 2HTJA 2COMA 1K6YA 2O8XA 3M4OJ 2LRDA 5FLMJ 4A0YA 5ICCA 4KDPA 5HS9A 5IOZA 1V54H 3MKWB 4MHGA 5GTHC 3BC8A 4BGDA 1OFCX 3W3CA 6PAXA 3FZVA 1JXSA 1X2MA 3TKYA 5EEGA 1FOXA 1GXQA 3U9GA 3IHUA 2ME6A 3LA2A 3HZJA 3OOUA 1MH4A 1S3JA 4P96A 3OYAA 3ISPA 2KDZA 2Y30A 1IAWA 3QWLA 4CCLA 3ASOH 3BG7A 3SQNA 3MFKA 3ZQGA 1BC7C 5ED4A 1YIJI 2ZKZA 3M07A 1RUNA 1CQTA 3T1BA 1X1DA 1MH3A 2VE9A 2RV8A 2TCTA 2CQQA 4HYEA 4JP0A 4RGUA 4M71A 4NQWA 5F04A 3TOBA 1A31A 2XHKA 3GFIA 2F4MB 3LSKA 5DCFA 3ZR8X 5A2QK 3IRQA 2OJED 2PFBA 4A2UA 2IA2A 2M4KA 4AIJA 4E7HA 1FSEA 4JK1X 3WTYC 1WSUA 4CHUA 1S7AA 2DO7A 3OYKA 2GOMA 1K7AA 1C0WA 5HVQC 3KE2A 2HYJA 3DEEA 1FZPB 1T0FC 2GIZA 5EG0B 3BWGA 1OJLA 1OCCH 1S7EA 2CW0F 4IVNA 2CJJA 2JT1A 4CYDA 3JAMZ 3DLLF 2DK5A 4BS9A 2D1HA 1E3HA 1FOWA 4JX4A 3ZMSA 3B02A 1FBSA 2WY7Q 3H9QA 4A3LJ 3RJPA 4D5FA 2ZJ2A 1ZN2A 3HRTA 4DZJA 5HODA 2V1DA 4FX0A 1CF7B 2HOTA 2MH9A 3SJMA 1MJBA 1E3PA 1WJCA 4EJTA 2HPIA 2CWEA 3CC7I 1X1CA 5KNLA 1HQCA 1S29A 1MDMA 5HDGA 3O6BB 1QGPA 1FIAA 4E7ZA 3F22A 2W25A 3ZPLA 4ENJA 4ENNA 4IHSA 2E1NA 5JLWA 2YPRA 4BAYA 4CYCA 4HEA2 1P4XA 3K7AJ 1R6RA 1U0JA 2LREA 1SD5A 1J9IA 2FOKA 1ON1A 2L3DA 4XOTA 4IOAF 2DTRA 3H35A 3H5AA 2LY9A 5GADJ 2EV0A 2HQRA 4I02A 2BGCA 4Y52J 2HDCA 1IW7F 2DAOA 4ITVA 3M1CA 1ETQA 4ZZLA 1MJAA 3WHCA 2VT2A 4UB8C 2CFOA 4BQNA 5JLXA 3EQLF 2ZMEC 2DMPA 3BT9A 3V8KA 4G94A 3GCMA 4GGGA 4RAFA 2E5NA 1FTTA 2Q0OA 1P9QC 5ILSA 1BW5A 4L5IA 3HSRA 5F0HA 4DIQA 2RC4A 1SVLA 1FLIA 4KA4A 2XB0X 3LAPA 2OTJI 4NUBA 2UZKA 4RB3C 3BTCA 1I6HJ 4BQQA 3P9CA 2DPDA 2COBA 2LF8A 4CICA 1ETWA 1DUXC 1T08B 4DQ2A 3FDYA 3IC7A 3LQRA 4IQ4A 5M5YJ 3NWTA 1IZ1A 2VJIA 1LB2A 5E79C 4RAYA 1D5VA 1RESA 1BM9A 2OCCH 3S1RJ 1FEXA 5HS7A 1OCTC 2H94A 1WJAA 2X85A 4W97A 4HNUA 3N97A 1MMSA 5KAIC 4L5EA 3TGNA 5IP7J 2Z16A 1J0RA 2V1XA 3I4MJ 3G1LA 3LSRA 3AL0C 3SZGA 3WU2C 2HEOA 1FMWA 3M3YJ 4EGZA 3IWZA 3GYHX 5EDNA 3NARA 4B8XA 1S9HA 3D5SC 2KT0A 1ZG1A 1PP8F 5L3BA 2XF6A 1D1BA 1E2XA 5CYVA 3K1MA 3TP3A 1JE8A 3KFWX 5D6EA 2JZYA 1HBXG 2H1KA 1XCVA 4MNUA 2KP6A 1MBEA 3FF5A 3ZMZA 4M3DA 1BN5A 5TJJA 3HHGA 1Z3XA 4KIFA 4NQWB 4M72A 2IP2A 2MABA 4BEHA 2XSDC 4A3FJ 2HKOA 2PN6A 1KZHA 4B09A 3DBHB 2R0QC 4EJVA 2DA6A 3BTJA 4PGHA 3HOVJ 4JX5A 1FOYA 2PJRA 2DMUA 2EZLA 3PUFA 3DF8A 2Q2EA 3KYCB 4YG2F 4HRIA 4NHJA 2GXAA 1JUPA 4BE1A 3V4GA 1IDZA 5EGOA 4FHTA 4S0HB 1RPWA 2HWVA 5KVRA 1D1CA 2MA3A 4DNCA 3S93A 3FXOA 4XRSA 2IGMA 3LFUA 4EM0B 4ESJA 4PDKA 2DXIA 2Y31A 1KU9A 5TRDA 4NC7A 1S5LC 1X4PA 3HPGA 4XLNF 4HPQA 3DTEA 5CLSA 2DA7A 2ISYA 2YX4A 3CCLI 2CV1A 1GV5A 2XPUA 4E4HA 3UR3C 1KYZA 1OISA 3E97A 1SVOA 5E8GA 3CUQA 1MDMB 4A3CJ 2IS6A 2FJ1A 5D8LB 1R7JA 2E60A 5FRMA 1KONA 4EGYA 4BE2A 4WCGA 2V9VA 3MKZA 3LA7A 3F9KA 4XLCA 2R7RA 2VODA 3CCVI 3BQYA 2DA5A 2CUZA 3K4JA 5IOYA 5AIPA 1L3LA 1ZGWA 3G71I 2NVTJ 4YFXF 2ACJA 1EF4A 2L5QA 3DBLB 3PJRA 2A6EF 1QVUA 2LC2A 3J81K 2CUJA 2K27A 2E1OA 5D5UB 2V9KA 2EIKH 3H5NA 2R7QA 3ECOA 3HOTA 1FBUA 2W57A 5GTIC 3GVAA 4GXOA 1OCZH 2XB5A 4UVBA 1S8NA 3CCJI 4X6AJ 3DKWA 3SZTA 1YITI 4AM3A 1A6QA 3GFMA 1LEBA 4M3FA 2JA2A 3N4MA 2GBYA 2QM3A 3DEWA 2WB1N 1EH6A 3MMYB 3TQNA 1VQ5I 2ECCA 2V7FA 3VB2A 1H0MA 3LQQA 1PYVA 4WXCA 4XSXF 4KITB 2R7ZJ 2BV6A 1BI0A 2GOXB 3CLOA 3H9JA 4I0BA 3L00A 1AHDP 4KUMA 3CJNA 2V26A 3IKTA 2DMTA 3SFZA 3CJQB 2VE8A 1FMVA 4OAYA 1LNWA 1U8RA 4LD5A 4CCMA 2NYXA 1TWHJ 5TGTA 1FOKA 1TQPA 4HBLA 3GLXA 2VKHA 1XMXA 2NXNB 4HA8A 2WA0A 4XQFA 5E18F 5JVTA 2E34A 2XAGA 5B1AH 3KP5A 1XSXA 1MSFC 2Y75A 1MBKA 2KIUA 2VQHA 2FOWA 4YFKF 2KISA 4AIKA 1ETKA 1TZLA 1Y8RB 3WTXC 3ABUA 4MFDA 2PG4A 3HSFA 4MQVA 5IPAA 3GZ6A 3H36A 5DUIA 1IRGA 2B0LA 1XGNA 2EFNA 4JBAA 4BQAA 1XSVA 2WWYA 1QNTA 2EWNA 1DGWY 2ZSHB 1FP2A 1XTAA 1Y56A 2PMZN 5E1ZB 4OAZA 2R92J 5B3SH 5DM7F 4ABZA 4RDUA 3KPHA 1FYMA 1BR1A 2E2JJ 1UMQA 2QZ8A 4BEHB 1W7PA 1FSHA 1WQ2A 2IS1A 3RYPA 1G3YA 3ECHA 2FQ3A 2XGDA 3RKWA 3BROA 3JRBA 4U7DA 1NTCA 4PCQA 1MMNA 3D5LA 2XAFA 4UVCA 1STZA 1P6RA 4F92B 2STWA 2I8DA 1D1AA 2ZFUA 5ICFA 4EM1A 3GWZA 3E6DA 2RQQA 3ERED 2W85A 2K7LA 3C18A 5EGOB 2CU7A 5FROA 2ISZA 1X58A 4IX7A 4L9TA 2LVSA 2HXIA 3RZDJ 1Z7UA 3O3KA 1SFEA 2W84A 4MQ9F 3IKVA 3WU0A 1EH7A 1KU7A 5F1RA 3A01A 3IL2A 3RTRA 2LF7A 1LFUP 5DDGA 4EVIA 2GZWA 5BPIA 1B9NA 3FBNB 3OS1A 3VODA 1QHGA 2XDVA 1BR2A 4F91B 2WV1A 1Y6IA 4RGSA 1Z21A 4MO7A 2XAHA 4XOPA 2H27A 3S2WA 4KFCA 1ZH5A 3OYHA 3AFHA 1QRYA 5LRRA 1XG1A 2XRLA 5LD2C 4P9FA 4A5NA 3U2RA 1BJZA 4ESBA 1IUYA 2E35A 1W1WE 3BCBA 1N77A 1P7JA 2FX0A 1ZAOA 2O7OA 2YX7A 1TT0A 4XKVA 1UG2A 1ZYRF 5CVUA 2HKXA 5DCMB 4A69C 3JAMK 1R71A 3F21A 3HOUJ 3V42A 3RCOA 2QSHX 4B1RA 4PJMA 3BG6A 2XV4S 3CLQA 5K5QA 3PM1A 2IT0A 1MKMA 2NVYJ 3F8MA 3KIOA 2CV0A 3UKGA 4C2TA 3W2WA 2WTEA 4RM2A 3FK7A 2ESHA 3Q0UA 1EJ9A 2M30A 3HOSA 3BR6A 2FF4A 1SMTA 2FBHA 2MC3A 3HGYA 4XM3A 2XRNA 3F6VA 2CW8A 4UY8I 1SAUA 2PJPA 3E1SA 4AVZA 3ROUA 1U5TA 1U2WA 2LH9A 1ZRFA 3MVPA 2X0LA 5ICEA 2FUG2 3KP3A 2XASA 4BE0A 2ZB9A 2XF5A 1J09A 4KIGA 4B3XA 2L9NA 3CDHA 3RPUA 1YS6A 4AWXB 1MMAA 1WJ5A 3K1NA 4FCYA 1U9NA 3B6AA 4OIPF 2ECBA 2MD0A 3OR1C 2DYSH 1XCBA 2BY3A 3BR5A 3G73A 1JKOC 2BOLA 2EA2A 3I58A 3S1NJ 4ZYGA 2EH3A 2NS0A 3LNQA 4BQOA 1JJ8C 1X1AA 2A3SA 3PO3J 1B9MA 1P92A 3AG1H 1X1BA 4DGWB 4HX8A 2GA2A 1YE9A 4II2A 1JUMA 1IN6A 3ZN1A 1I39A 5LGNA 2JSPA 4HNVA 2O6GE 1LFBA 2M4GA 2R5YA 2BY1A 3BZ6A 4UV9A 1S72I 2RAEA 2PX9A 3FHZA 2EFOA 3SXYA 2P5KA 3MZYA 3R0JA 3KYLA 1JHFA 2LD5A 2DCEA 5FKLA 3SFIA 4BJ5C 4IL6C 2W7NA 3CCYA 1R5HA 3FMSA 1ZQ3P 1JTXA 4C2UA 1JKRC 1BOAA 2IA0A 1LQ1A 4UUTA 3OYMA 4NC6A 1MD0A 2DOAA 5DUKA 3QP5A 2R7WA 4FX4A 1GVDA 3GFLA 1KU2A 5F6FA 3RKXA 1KQ8A 4BHBA 2A05A 3ONQA 5DD4A 4BU2A 4C3JJ 2M1BA 5ICGA 5JI6A 4GFBA 4PJ0C 2V9PA 1LDJA 1D8JA 3L09A 5EG0A 1MBHA 2DI3A 1ZRCA 1QPIA 1KQ9A 3PUBA 3ZQFA 2L7MP 3OY9A 2XAUA 5FLVA 2H8RA 1U9OA 2M7BA 1PJRA 3RQ4A 1XC5A 1B6AA 2DJNA 3K0LA 2R5ZA 5FRNA 3K69A 2E1MB 3IH4A 2QENA 1BI3A 3A01B 4D7MA 1YIOA 3QRFF 3R60A 4EJOA 4XLFA 4XL9A 4LMYA 5HS8A 2J5PA 3RYRA 3H3UA 2RNGA 2F2EA 1O7FA 3VSKA 5C4XJ 3T8RA 3K4KA 1OMIA 4BJ6C 1USTA 3W6JB 1K4TA 5DV5A 3VYRB 2DA1A 3DKXA 2HDWA 4A0XA 2O5RA 1BBYA 1WH7A 2DQLA 4I76A 4XNFA 5FJ8J 4PK4A 3HM5A 4EQQA 3IRRA 4KMFA 1RETA 1LVAA 4HV6A 4EMSA 1QZYA 1B72A 5F27A 1LDKB 3OIOA 2PQ8A 1ENHA 5F64A 2BVMA 4UHTA 2G7UA 1F4KA 5F0CA 1B8IA 3Q9SA 5LHGA 3LWFA 3O8GA 1REPC 5GAGJ 2ETHA 2NVXJ 4B48A 3L2VA 3G4SI 3V7SA 4H0EA 3RKYA 1ITYA 1R9TJ 3ERMA 3HKZN 3HOXJ 3W6VA 2JA8J 1WWXA 5FKOA 4ZJZA 2VJ5A 1T38A 2FNAA 5IT9K 2QUFA 3WG7H 4WK8F 4EJWA 1MBGA 3WTUC 1BL0A 1S6LA 4EATA 1U5TB 1UELB 3DXJF 4FE4A 2FBIA 3BDDA 3N05A 4XLEA 3KEQA 4DOZA 1OYWA 3REOA 1NG7A 4HAMA 2BW3B 3I53A 4LOCA 1B59A 4NNJA 3HBLA 1K61A 2AQEA 2JVHA 3W2VA 5LHHA 2CFXA 2FEZA 1OCRH 1WRJA 2IJLA 1HKTA 2CUEA 2DJIA 3E5XA 4IO9F 5EEHA 3FXKA 2VC0A 1IV8A 1RC9A 3DPLC 1DP3A 3KX2A 2LKXA 4D5CA 2VXDA 1D5YA 3ZQIA 3GFJA 1R00A 1B1BA 2KRCA 2P5VA 3S3MA 2J5OA 4DYCA 2QBYA 2DTZA 2XKPA 3D0SA 2Z33A 4A3MJ 2JRTA 4RAGA 2R5YB 2CSOA 4Q47A 1VQ9I 4OIRF 2BVLA 2MW8A 1J2XA 3OMYA 2MC4A 4PFPA 2KMUA 4LG0A 2VJJA 1DU6A 5EYRA 1OCPA 2H6BA 2KZGA 2R7SA 2H6CA 1DGRM 2V1NA 3PNYA 5H6RA 1EA3A 5J1YA 4RB1A 2PBIA 3WTVC 2IPQX 3ZQQA 4A6EA 4L5JA 5D4SA 2NNYA 3PFYA 4MEYF 4WWCA 1RZ4A 3L2WA 2M8EA 3W6KB 4KICA 2FMLA 2EQRA 1YO5C 4B47A 1KYWA 4ZH4F 3E3VA 2CW7A 4ANJA 1OR7A 2HOAA 2XVCA 4PSXA 2B63J 3I4NJ 3FIWA 4I99C 1R36A 2DT6A 3I56I 4ZYEA 2M8GX 3C3WA 1R1UA 2O61A 2HGCA 4YIRX 3CC2I 1F1ZA 3FM3A 3JTGA 2JA7J 1QU3A 3J80K 2K86A 3PFIA 2HU9A 4ZTJA 1YOVB 1R49A 3VYTB 3IV5A 2Y0SA 5K5RA 4BY7J 2R5ZB 4WXHA 2LLKA 3L2UA 4IEJA 1V3FA 1I1SA 4U87A 1HDPA 1YW7A 2L02A 3MZ8A 1PDNC 3OYBA 5E3MA 4XICA 1UFMA 2OV7A 2QA4I 1H9TA 3CCRI 1G2HA 3WU1B 4CA0A 2Y69H 2LTPA 2ZXHA 1E17A 2PI0A 2BXZA 1AWCA 3JRDA 4QTRA 2M0MA 3S17J 3MKLA 5EF6A 2ZMEB 1HKQA 4C3HJ 1RKWA 1LE8A 4ZZDA 4Z2YA 4DYQA 1B72B 2NS8A 3C7JA 4QIWN 3GXOA 3BG3A 4OMYA 1KU3A 4CCKA 2DODA 3F3XA 4M9SA 2R7UA 1K83J 5L3DA 1KGSA 2JUGA 2AQFA 1B8IB 4IF4A 4RAZA 1JUSA 2QWWA 2IRFG 5H2FC 3MAJA 2DDAA 3R61A 3ZRGA 3J7AO 5J4YA 1VTNC 1W36C 1Y8QB 5E8IA 5JFRA 1X4OA 2E19A 2G0EA 1T33A 4BDYA 4YIIA 3ULQB 1HW1A 3BJOA 3GTGJ 3I71A 3BR1A 3GTPJ 2W00A 2LSOA 3WTWC 1WZ2A 1HW5A 2MH2A 2VC1A 3MCZA 3NAUA 2FSWA 2KHMA 1QQIA 1Z1DA 2YS9A 2GIVA 2KIMA 2TRTA 5IYBJ 3L7WA 3OWTA 1G3WA 3HG9A 4HZFA 1HCRA 5GPAA 3AG4H 1R5GA 1VQ7I 4AVPA 2OUMA 1ETXA 3F6OA 1R4MB 1T98A 3HSEA 1BI2A 1USSA 3QAHA 5L3GA 2L4AA 4W1UA 1W36D 3ABKH 2QEXI 1X3UA 2OD5A 3GMEA 3BPXA 1YX3A 3CP8A 1XMAA 2RN7A 3NRVA 3G6EI 5HNHA 3EUHC 4C2MJ 2L2OA 2JN6A 2Y2ZA 4IRHA 3JRCA 1G6NA 4DZPA 5J40A 4M6YA 2QBYB 2HVQA 3F0CA 2BY2A 2QCOA 3PNVA 1IN8A 2KRHA 1ZLKA 1XD7A 3FM5A 2DDBA 3BJ6A
chains in the Genus database with same CATH topology
5CVIA 3E6CC 1I1GA 2VONA 4LG0B 2CQKA 2YSRA 4QWQA 2FMYA 5D4RA 3JW4A 3WGGA 2RQPA 2E1CA 2EV5A 4G8XA 4ETSA 2R3SA 1QPMA 4I7HA 5BOXA 4L9NA 4U88A 2VBYA 3H3ZA 1FT9A 3QP6A 4KNYA 4G9YA 1I5ZA 3WODF 3MQ0A 2FNPA 3NEUA 2E7WA 3FXRA 5IT9Z 2NRAC 1TW3A 1W5SA 5D6FA 1O7LA 2HFHA 2C6YA 4HF0A 5FFZA 4UUVA 2BEOA 2ZBKA 1RIOH 5DCMA 1S7OA 4BHPA 1EH8A 1ZG5A 4P5OA 1HSJA 3LA3A 3TOAA 1FY7A 4G6QA 1ONVA 2A69F 3BP8A 1F5TA 5FLXZ 1K79A 3CO6C 1ZARA 3TDUC 1BI1A 5J6XA 4F7ZA 4XRFA 4N9IA 2DBBA 3P9KA 4BHCA 3KEOA 1YFHA 2P7VB 3KP6A 5LLQA 1R23A 1TBXA 3FXUA 1U78A 4ENKA 3F72A 1TNTA 2GWRA 2KJBA 3J80Z 2HYFA 4OOIA 4ESFA 4R1HA 4HX4A 1KQ0A 1Z05A 3ZQ7A 3SHFA 4BH9A 4HX7A 1Z6RA 1ZGAA 3CO7C 5FGMA 5J8FA 1Z9CA 1ZLJA 2O03A 2FA5A 3FX3A 3M8FA 1O57A 2XIGA 5L3CA 2JTVA 5LBQA 2GAUA 5CVJA 3FXQA 1XGMA 1UCRA 3EDPA 1FNNA 3ZMVA 2QQAA 1OPCA 2KKOA 4LLNA 4LK1F 2LKPA 3HTSB 4EJUA 1XDUA 2E7XA 2MLGA 3TO9A 2MD5A 3QOPA 4IPAA 2PLYA 5LEKA 2M87A 2K4BA 1YYVA 4YFNF 1MJ9A 5LGUA 1GXPA 3M8EA 2V79A 3DPTA 3VOEA 3HRUA 4ENMA 4HF2A 1U6GA 3AAFA 1XGOA 1G4DA 2P8TA 3KLOA 5E1WA 3EETA 5HLGA 3WTTC 2K4JA 1JHHA 4I09A 3CUQC 4N9HA 2M5WA 4U7BA 2FBKA 1XB4A 1SD6A 2QQBA 2YR2A 1TQIA 2V6CA 5FB2A 4A6DA 3ML6A 1ZGJA 2EJRA 3EYIA 5HLHA 2VBXA 3VEPA 5H20A 1UB9A 4FT8A 3GEZA 4LK0F 1CGPA 4U0WA 5AIQA 4I98B 1BJAA 4BYYA 3WTZA 1YTYA 4KN4X 4EV0A 1HW2A 1T0FA 2GXBA 3KLNA 2O3FA 1BIAA 4OU0A 1FX7A 3L9FA 2RDPA 3CUOA 3I5UA 2EK5A 2EFWA 4CO8A 2L01A 1UHMA 4TV7A 4KN7X 2VBWA 1DP7P 2ZCWA 3GF2A 1SD4A 2DQRA 2HS5A 2YU3A 2FE3A 4HV5A 5D5XB 1GHCA 1TNSA 1FYLA 1P4AA 1FPQA 3U1DA 1GVJA 4CZZA 1B4AA 4LFUA 4OIQF 3F8BA 2ZMEA 5DD8A 3QPTA 3I59A 3KZZA 5HOOA 3EYYA 2GXGA 3M1EA 5ERIA 2XROA 3V8JA 2OZ6A 3FMQA 1IXRC 4L0YB 2EV6A 1W7PD 1RUOA 1A04A 2LNBA 4RB0A 1ZHFA 4PGGA 1Z6TA 1R1VA 3OOPA 3TDZC 1BIBA 2MLKA 1O3RA 1G3TA 3BY6A 3IWFA 2P4WA 1LDDA 2G9WA 4O5VA 4RB2C 1I6XA 4L0ZB 2DT5A 2JPBA 4PZJA 4ASNA 2ESNA 2VOPA 2BBYA 1ODDA 4GO1A 2KIFA 5BMZA 1ZRDA 4AD9A 3E5UA 3C1DA 4ON0A 4IRIA 3WTSC 1T2KA 2VN2A 5FLXK 2UWMA 1U5TC 4M9XA 3QU3A 2OZUA 2HOEA 2HTSA 2RGVA 1HSTA 4HLYA 3RIRA 4KYWA 2A5YB 5E20A 4KIBA 1F9NA 3F8CA 4LLLA 2P7CB 1K6OA 3DFGA 2FU4A 4HF1A 1G3SA 3QU6A 4MGRA 1SFUA 2JSCA 1SFXA 5HDNA 1TQMA 2A6HF 4A12A 3JSPA 1PUEE 3O2PE 4M73A 3MWMA 3HTUA 2XAQA 2STTA 2BYVE 4QLCU 4HDUA 5ILVA 2QQ9A 4I2OA 1DDNA 3CTAA 3I59B 2Z99A 1YQAA 2DK8A 3KP2A 2VBZA 3B73A 5HDKA 2VOOA 2X4HA 3ZN0A 2Y0MA 1NHAA 5D8KB 3BOQA 1Z91A 4G6DA 4EM2A 1TW2A 3WG9A 2F5FA 2IVMA 4LLGF 1O3QA 1J75A 3KP7A 5DEQA 2Z5UA 1YLFA 4IXAA 2ZO4A 3GZ5A 4HDVA 4CXFA 3E6MA 4A5MA 1WKMA 4MTEA 1BC8C 5LGTA 2PEXA 2UXNA 4Q5SF 3RI4A 5LHIA 4UV8A 4IRGA 3NQOA 2R7DA 1U3EM 5E17F 2A07F 4XLPF 3KP4A 4Q48A 1O3TA 1SAXA 4D0PA 1FWZA 1HXDA 2K02A 3BPVA 2HQNA 4OMZA 2Z9OA 3GW2A 5D5WB 1OKRA 4GYGA 1YG2A 1J59A 3FMRA 2OQGA 2F5EA 2A68F 2FXAA 1XMKA 1SMYF 1D8KA 2DFIA 2D1VA 2CG4A 3HUGA 1XN7A 4ZYDA 2DPUA 1SD7A 5L3EA 4ZYHA 2OBPA 1YW8A 2ZNYA 3K9TA 5DYMA 3E5QA 2WC2A 4BNCA 2P6TA 1I27A 1XDSA 4G7ZF 1K78A 4Q4ZF 5AONA 1QBJA 4GYIA 2PMUA 5H6QA 2NAZA 4MTDA 1P4WA 2ELHA 4XBFA 1YW9A 3LAJA 1DPRA 4HW0A 2CYYA 4Y17A 3LFKA 3P7NA 3MZHA 5JR3A 4AIHA 1IXSB 2OU2A 3K1PA 2VT3A 3GX4X 1XGSA 3K2ZA 3L2CA 3KCCA 4HLXA 4U0VA 4IJAA 3MEXA 1FP1D 1TLHB 4GCVA 2M45A 5CVVA 1L0OC 1FBQA 3DP7A 1Y0UA 3GO5A 3DQVC 4RGXA 5HLIA 3KETA 2EA4A 5E1XA 1R1TA 1FYKA 2D45A 2LDUA 1J5YA 3WE2A 5LEJA 2MBFA 2G7HA 3HIFA 5FFXA 4M9ZA 5ILUA 5A2QZ 3Q9VA 2P5LC 4LB6B 3ELKA 4NB5A 4WF2A 4L9VA 3T0YA 1ZG3A 4R79A 2GA1A 2QYOA 2FRHA 1P2FA 2A61A 2UXXA 4LGWA 4CGZA 4HQMA 5K5OA 4IHTA 3COAC 5FD6A 2GQQA 1QZZA 2WV0A 4KT5C 4O3MA 3BJAA 2CO5A 1OYYA 2Z3YA 1WI9A 4N0BA 2RKHA 1OYIA 1ULYA 3E6BA 2IA1A 1LEAA 3VFZA 2ZFWA 3RDIA 1IN7A 1RI7A 2KJCA 4YIFA 4UNOA 4G7OF 4M6XA 2IW5A 2RNJA 1V4RA 1TTYA 1T39A 1Q1HA 3Q5FA 2HR3A 2JPCA 3G3ZA 2ZNZA 1K78B 3TO7A 5LRSA 3CUQB 5BQTA 4WXDA 1FC3A 2EB7A 2Y48A 4MEXF 3I4PA 5BPDA 5CJ9A 4U0YA 1R22A 3FWEA 3JSOA 4L18B 2L54A 3M7GA 1D3YA 2W24A 3ZMUA 4E70A 5FD5A 1UHWA 5L3FA 3QPHA 4I0AA 3HHHA 4WX9A 2RVCA 3ZP5A 2PMHA 3DV8A 2OQRA 4S04A 3LSTA 1RNLA 1DPUA 4CDGA 3PQJA 4L9JA 2H09A 4UXNA 2L4MA 1HKSA 2KRFA 4OIOF 3R4KA 3RPQA 4A0ZA 2XAJA 3WGHA 4RS8A 3F23A 4BXUA 3WGIA 2HZTA 1IF1A 1J7KA 4P9UA 3P9IA 2V1UA 2F5CA 2OA4A 2P6SA 4RGRA 3V7CA 4G7HF 1EV7A 1HKTA 1IXCA 4O6JA 3JTHA 5BS6A 5FO5A 3I0TA 1ON2A 4Y15A 5J8CA 2CGPA 2D2WA 3TO6A 1JGSA 3I64A 3KZYA 3F8NA 4P55A 1W5TA 4LB5A 1W7PB 2O0YA 2NNNA 4I01A 1XSDA 3HRSA 3HRMA 3T8TA 2TDXA 2HYGD 2DU9A 3V8LA 2Q8KA 2XKOA 2F5DA 3SZPA 1R58A 5KK1A 2QLZA 3T5XA 3PQKA 2R7FA 4OINF 3J81Z 4LJZF 2ZXJA 2OAZA 4M74A 1AOYA 1H9GA 3OV8A 2BE5F 1PP7U 1LJ9A 2XUBA 1W4MA 1CF7A 2AXLA 1IN5A 1YS7A 4UVAA 2ADUA 4R8HA 5IT3A 4K2EA 1KA8A 3DEUA 3GUDA 3V7RA 3M9AA 1MGTA 3F8FA 2VXZA 1IN4A 4Y13A 4KMUX 4S05A 1MZBA 5K1YA 3H92A 2QVOA 1ZREA 1QO0D 2DLLA 5CVRA 4JQFA 2DW4A 3ABTA 2AS5F 1IRFA 2EFPA 5JHUA 3EUHA 3R6SA 2EFQA 1O3SA 3WE3A 4HOBA 4HQEA 3R0AA 3I54A 5D5VB 3HYIA 2XGXA 4XSZF 3ZMTA 1T6SA 3ZMDA 2HTJA 2COMA 2O8XA 4A0YA 5ICCA 4KDPA 5HS9A 4MHGA 6PAXA 3FZVA 1JXSA 3TKYA 5EEGA 1GXQA 3U9GA 3IHUA 3LA2A 1S3JA 4P96A 3ISPA 1IAWA 3MFKA 3SQNA 1BC7C 5ED4A 2ZKZA 1RUNA 3T1BA 2VE9A 2RV8A 4HYEA 4RGUA 4M71A 4NQWA 3TOBA 2XHKA 3GFIA 5A2QK 5DCFA 3IRQA 4AIJA 2PFBA 4A2UA 2IA2A 4CHUA 1FSEA 4JK1X 3WTYC 1WSUA 1S7AA 2DO7A 1K7AA 1C0WA 5HVQC 3KE2A 1FZPB 3BWGA 4IVNA 4CYDA 2CW0F 2JT1A 3JAMZ 2DK5A 2D1HA 3ZMSA 3B02A 1FBSA 3RJPA 2ZJ2A 1ZN2A 3HRTA 2V1DA 4FX0A 1CF7B 2MH9A 1MJBA 4EJTA 2CWEA 1HQCA 1S29A 1MDMA 5HDGA 3O6BB 1QGPA 3F22A 2W25A 3ZPLA 4ENJA 4ENNA 4IHSA 2E1NA 2YPRA 4BAYA 1P4XA 1SD5A 1J9IA 2FOKA 1ON1A 2L3DA 2DTRA 2EV0A 2HQRA 4I02A 2BGCA 2HDCA 1IW7F 2DAOA 4ZZLA 1MJAA 2VT2A 3EQLF 3V8KA 4G94A 4GGGA 2Q0OA 5ILSA 4L5IA 3HSRA 2RC4A 1FLIA 4KA4A 3LAPA 2UZKA 4RB3C 3P9CA 2DPDA 4CICA 2LF8A 1DUXC 4DQ2A 3IC7A 3LQRA 1IZ1A 1LB2A 4RAYA 1D5VA 1BM9A 5HS7A 2H94A 3N97A 3TGNA 1J0RA 2V1XA 2HEOA 4EGZA 3GYHX 3IWZA 4B8XA 1ZG1A 1PP8F 5L3BA 5CYVA 1E2XA 3K1MA 1HBXG 1JE8A 3KFWX 5D6EA 2JZYA 1XCVA 4MNUA 3ZMZA 3FF5A 1BN5A 5TJJA 3HHGA 4KIFA 4M72A 2IP2A 2HKOA 2PN6A 4B09A 4EJVA 4PGHA 3DF8A 2Q2EA 4YG2F 4NHJA 3V4GA 4FHTA 2HWVA 5KVRA 2MA3A 4DNCA 4ESJA 4EM0B 4PDKA 1KU9A 5TRDA 4XLNF 5CLSA 2ISYA 2YX4A 1KYZA 3E97A 5E8GA 3CUQA 1MDMB 5D8LB 1R7JA 4EGYA 4WCGA 2V9VA 3LA7A 2VODA 5AIPA 1L3LA 4YFXF 2ACJA 2A6EF 3J81K 2K27A 5D5UB 3ECOA 3HOTA 1FBUA 2W57A 3GVAA 4GXOA 4UVBA 1S8NA 3DKWA 3SZTA 1LEBA 3GFMA 3N4MA 2QM3A 1EH6A 3TQNA 3VB2A 1H0MA 3LQQA 4WXCA 4XSXF 2BV6A 1BI0A 3CLOA 4I0BA 3L00A 4KUMA 3CJNA 3IKTA 3SFZA 2VE8A 1LNWA 1U8RA 4LD5A 2NYXA 1FOKA 1TQPA 4HBLA 3GLXA 4HA8A 5E18F 5JVTA 2XAGA 3KP5A 1XSXA 2Y75A 2KIUA 4AIKA 4YFKF 3WTXC 3ABUA 2PG4A 3HSFA 4MQVA 3GZ6A 5DUIA 1IRGA 2B0LA 1XGNA 2EFNA 4JBAA 4BQAA 1XSVA 2WWYA 1QNTA 2EWNA 1FP2A 5E1ZB 1FYMA 2QZ8A 1W7PA 1FSHA 1WQ2A 3RYPA 1G3YA 3ECHA 2FQ3A 3RKWA 3BROA 4U7DA 4PCQA 3D5LA 2XAFA 4UVCA 1STZA 1P6RA 2STWA 5ICFA 4EM1A 3GWZA 3E6DA 3ERED 2W85A 2K7LA 3C18A 2ISZA 4L9TA 1Z7UA 3O3KA 1SFEA 2W84A 4MQ9F 3IKVA 3WU0A 1EH7A 1KU7A 5F1RA 3IL2A 3RTRA 2LF7A 5DDGA 4EVIA 2GZWA 5BPIA 1B9NA 3VODA 4RGSA 2XAHA 2H27A 4KFCA 3S2WA 1ZH5A 5LRRA 4P9FA 4A5NA 3U2RA 4ESBA 1IUYA 1ZAOA 2YX7A 1ZYRF 5CVUA 2HKXA 5DCMB 3JAMK 3F21A 2XV4S 5K5QA 2IT0A 1MKMA 3F8MA 2WTEA 2ESHA 2M30A 3HOSA 2FF4A 1SMTA 2FBHA 2MC3A 2XRNA 3F6VA 2PJPA 3ROUA 1U5TA 1U2WA 1ZRFA 2X0LA 5ICEA 3KP3A 2XASA 4KIGA 3RPUA 3CDHA 1YS6A 4AWXB 3K1NA 4OIPF 1XCBA 3G73A 2EA2A 3I58A 4ZYGA 2NS0A 2A3SA 1B9MA 1P92A 4HX8A 2GA2A 1IN6A 3ZN1A 5LGNA 2O6GE 3BZ6A 4UV9A 3FHZA 2EFOA 3SXYA 2P5KA 3MZYA 3R0JA 1JHFA 3FMSA 1R5HA 1BOAA 2IA0A 1LQ1A 1MD0A 5DUKA 3QP5A 4FX4A 3GFLA 1KU2A 5F6FA 3RKXA 1KQ8A 4BHBA 5ICGA 5DD4A 5JI6A 2M1BA 1D8JA 1LDJA 3L09A 1ZRCA 2DI3A 1KQ9A 1B6AA 3K0LA 3K69A 2QENA 1BI3A 1YIOA 3QRFF 3R60A 4EJOA 4LMYA 5HS8A 2J5PA 3RYRA 3H3UA 2F2EA 1O7FA 3T8RA 1OMIA 1USTA 3W6JB 5DV5A 4A0XA 1BBYA 2DQLA 4EQQA 3IRRA 4KMFA 1LVAA 4HV6A 4EMSA 1QZYA 1LDKB 2PQ8A 5F64A 4UHTA 2G7UA 1F4KA 3Q9SA 5LHGA 3LWFA 1REPC 2ETHA 3V7SA 4H0EA 3RKYA 1WWXA 5IT9K 1T38A 2FNAA 2QUFA 4WK8F 4EJWA 3WTUC 1S6LA 1U5TB 3DXJF 2FBIA 3BDDA 3KEQA 1OYWA 3REOA 4HAMA 3I53A 1B59A 5LHHA 2CFXA 2FEZA 1WRJA 2IJLA 3E5XA 5EEHA 2VC0A 3DPLC 3GFJA 1R00A 1B1BA 2P5VA 2J5OA 2QBYA 2XKPA 3D0SA 2Z33A 2JRTA 2CSOA 4Q47A 4OIRF 1J2XA 4LG0A 2H6BA 2H6CA 5H6RA 4RB1A 2PBIA 3WTVC 2IPQX 4A6EA 4L5JA 5D4SA 2NNYA 4MEYF 4WWCA 1RZ4A 2M8EA 3W6KB 4KICA 2FMLA 1YO5C 1KYWA 4ZH4F 3E3VA 1OR7A 2XVCA 1R36A 4ZYEA 3C3WA 1R1UA 2O61A 2HGCA 1F1ZA 3FM3A 3JTGA 3J80K 2K86A 3PFIA 5K5RA 4WXHA 1V3FA 1I1SA 1YW7A 2L02A 1PDNC 1UFMA 1H9TA 3WU1B 1E17A 2PI0A 1AWCA 2ZMEB 1HKQA 4ZZDA 4Z2YA 3C7JA 3GXOA 4OMYA 1KU3A 3F3XA 4M9SA 5L3DA 1KGSA 4IF4A 4RAZA 2QWWA 2IRFG 3MAJA 3R61A 3J7AO 1VTNC 5E8IA 5JFRA 4YIIA 3ULQB 1HW1A 3BJOA 3I71A 3WTWC 2LSOA 1HW5A 2MH2A 2VC1A 3MCZA 2FSWA 1QQIA 1Z1DA 2GIVA 2KIMA 3L7WA 1G3WA 4HZFA 1R5GA 4AVPA 3F6OA 1T98A 3HSEA 1BI2A 1USSA 3QAHA 5L3GA 2L4AA 1X3UA 2OD5A 3BPXA 1XMAA 2RN7A 3NRVA 4IRHA 1G6NA 4M6YA 2QBYB 1IN8A 1ZLKA 1XD7A 3FM5A 3BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVI A;  3E6C C;  1I1G A;  2VON A;  4LG0 B;  2CQK A;  2YSR A;  4QWQ A;  2FMY A;  5D4R A;  3JW4 A;  3WGG A;  2RQP A;  2E1C A;  2EV5 A;  4G8X A;  4ETS A;  2R3S A;  1QPM A;  4I7H A;  5BOX A;  4L9N A;  4U88 A;  2VBY A;  3H3Z A;  1FT9 A;  3QP6 A;  4KNY A;  4G9Y A;  1I5Z A;  3WOD F;  3MQ0 A;  2FNP A;  3NEU A;  2E7W A;  3FXR A;  5IT9 Z;  2NRA C;  1TW3 A;  1W5S A;  5D6F A;  1O7L A;  2HFH A;  2C6Y A;  4HF0 A;  5FFZ A;  4UUV A;  2BEO A;  2ZBK A;  1RIO H;  5DCM A;  1S7O A;  4BHP A;  1EH8 A;  1ZG5 A;  4P5O A;  1HSJ A;  3LA3 A;  3TOA A;  1FY7 A;  4G6Q A;  1ONV A;  2A69 F;  3BP8 A;  1F5T A;  5FLX Z;  1K79 A;  3CO6 C;  1ZAR A;  3TDU C;  1BI1 A;  5J6X A;  4F7Z A;  4XRF A;  4N9I A;  2DBB A;  3P9K A;  4BHC A;  3KEO A;  1YFH A;  2P7V B;  3KP6 A;  5LLQ A;  1R23 A;  1TBX A;  3FXU A;  1U78 A;  4ENK A;  3F72 A;  1TNT A;  2GWR A;  2KJB A;  3J80 Z;  2HYF A;  4OOI A;  4ESF A;  4R1H A;  4HX4 A;  1KQ0 A;  1Z05 A;  3ZQ7 A;  3SHF A;  4BH9 A;  4HX7 A;  1Z6R A;  1ZGA A;  3CO7 C;  5FGM A;  5J8F A;  1Z9C A;  1ZLJ A;  2O03 A;  2FA5 A;  3FX3 A;  3M8F A;  1O57 A;  2XIG A;  5L3C A;  2JTV A;  5LBQ A;  2GAU A;  5CVJ A;  3FXQ A;  1XGM A;  1UCR A;  3EDP A;  1FNN A;  3ZMV A;  2QQA A;  1OPC A;  2KKO A;  4LLN A;  4LK1 F;  2LKP A;  3HTS B;  4EJU A;  1XDU A;  2E7X A;  2MLG A;  3TO9 A;  2MD5 A;  3QOP A;  4IPA A;  2PLY A;  5LEK A;  2M87 A;  2K4B A;  1YYV A;  4YFN F;  1MJ9 A;  5LGU A;  1GXP A;  3M8E A;  2V79 A;  3DPT A;  3VOE A;  3HRU A;  4ENM A;  4HF2 A;  1U6G A;  3AAF A;  1XGO A;  1G4D A;  2P8T A;  3KLO A;  5E1W A;  3EET A;  5HLG A;  3WTT C;  2K4J A;  1JHH A;  4I09 A;  3CUQ C;  4N9H A;  2M5W A;  4U7B A;  2FBK A;  1XB4 A;  1SD6 A;  2QQB A;  2YR2 A;  1TQI A;  2V6C A;  5FB2 A;  4A6D A;  3ML6 A;  1ZGJ A;  2EJR A;  3EYI A;  5HLH A;  2VBX A;  3VEP A;  5H20 A;  1UB9 A;  4FT8 A;  3GEZ A;  4LK0 F;  1CGP A;  4U0W A;  5AIQ A;  4I98 B;  1BJA A;  4BYY A;  3WTZ A;  1YTY A;  4KN4 X;  4EV0 A;  1HW2 A;  1T0F A;  2GXB A;  3KLN A;  2O3F A;  1BIA A;  4OU0 A;  1FX7 A;  3L9F A;  2RDP A;  3CUO A;  3I5U A;  2EK5 A;  2EFW A;  4CO8 A;  2L01 A;  1UHM A;  4TV7 A;  4KN7 X;  2VBW A;  1DP7 P;  2ZCW A;  3GF2 A;  1SD4 A;  2DQR A;  2HS5 A;  2YU3 A;  2FE3 A;  4HV5 A;  5D5X B;  1GHC A;  1TNS A;  1FYL A;  1P4A A;  1FPQ A;  3U1D A;  1GVJ A;  4CZZ A;  1B4A A;  4LFU A;  4OIQ F;  3F8B A;  2ZME A;  5DD8 A;  3QPT A;  3I59 A;  3KZZ A;  5HOO A;  3EYY A;  2GXG A;  3M1E A;  5ERI A;  2XRO A;  3V8J A;  2OZ6 A;  3FMQ A;  1IXR C;  4L0Y B;  2EV6 A;  1W7P D;  1RUO A;  1A04 A;  2LNB A;  4RB0 A;  1ZHF A;  4PGG A;  1Z6T A;  1R1V A;  3OOP A;  3TDZ C;  1BIB A;  2MLK A;  1O3R A;  1G3T A;  3BY6 A;  3IWF A;  2P4W A;  1LDD A;  2G9W A;  4O5V A;  4RB2 C;  1I6X A;  4L0Z B;  2DT5 A;  2JPB A;  4PZJ A;  4ASN A;  2ESN A;  2VOP A;  2BBY A;  1ODD A;  4GO1 A;  2KIF A;  5BMZ A;  1ZRD A;  4AD9 A;  3E5U A;  3C1D A;  4ON0 A;  4IRI A;  3WTS C;  1T2K A;  2VN2 A;  5FLX K;  2UWM A;  1U5T C;  4M9X A;  3QU3 A;  2OZU A;  2HOE A;  2HTS A;  2RGV A;  1HST A;  4HLY A;  3RIR A;  4KYW A;  2A5Y B;  5E20 A;  4KIB A;  1F9N A;  3F8C A;  4LLL A;  2P7C B;  1K6O A;  3DFG A;  2FU4 A;  4HF1 A;  1G3S A;  3QU6 A;  4MGR A;  1SFU A;  2JSC A;  1SFX A;  5HDN A;  1TQM A;  2A6H F;  4A12 A;  3JSP A;  1PUE E;  3O2P E;  4M73 A;  3MWM A;  3HTU A;  2XAQ A;  2STT A;  2BYV E;  4QLC U;  4HDU A;  5ILV A;  2QQ9 A;  4I2O A;  1DDN A;  3CTA A;  3I59 B;  2Z99 A;  1YQA A;  2DK8 A;  3KP2 A;  2VBZ A;  3B73 A;  5HDK A;  2VOO A;  2X4H A;  3ZN0 A;  2Y0M A;  1NHA A;  5D8K B;  3BOQ A;  1Z91 A;  4G6D A;  4EM2 A;  1TW2 A;  3WG9 A;  2F5F A;  2IVM A;  4LLG F;  1O3Q A;  1J75 A;  3KP7 A;  5DEQ A;  2Z5U A;  1YLF A;  4IXA A;  2ZO4 A;  3GZ5 A;  4HDV A;  4CXF A;  3E6M A;  4A5M A;  1WKM A;  4MTE A;  1BC8 C;  5LGT A;  2PEX A;  2UXN A;  4Q5S F;  3RI4 A;  5LHI A;  4UV8 A;  4IRG A;  3NQO A;  2R7D A;  1U3E M;  5E17 F;  2A07 F;  4XLP F;  3KP4 A;  4Q48 A;  1O3T A;  1SAX A;  4D0P A;  1FWZ A;  1HXD A;  2K02 A;  3BPV A;  2HQN A;  4OMZ A;  2Z9O A;  3GW2 A;  5D5W B;  1OKR A;  4GYG A;  1YG2 A;  1J59 A;  3FMR A;  2OQG A;  2F5E A;  2A68 F;  2FXA A;  1XMK A;  1SMY F;  1D8K A;  2DFI A;  2D1V A;  2CG4 A;  3HUG A;  1XN7 A;  4ZYD A;  2DPU A;  1SD7 A;  5L3E A;  4ZYH A;  2OBP A;  1YW8 A;  2ZNY A;  3K9T A;  5DYM A;  3E5Q A;  2WC2 A;  4BNC A;  2P6T A;  1I27 A;  1XDS A;  4G7Z F;  1K78 A;  4Q4Z F;  5AON A;  1QBJ A;  4GYI A;  2PMU A;  5H6Q A;  2NAZ A;  4MTD A;  1P4W A;  2ELH A;  4XBF A;  1YW9 A;  3LAJ A;  1DPR A;  4HW0 A;  2CYY A;  4Y17 A;  3LFK A;  3P7N A;  3MZH A;  5JR3 A;  4AIH A;  1IXS B;  2OU2 A;  3K1P A;  2VT3 A;  3GX4 X;  1XGS A;  3K2Z A;  3L2C A;  3KCC A;  4HLX A;  4U0V A;  4IJA A;  3MEX A;  1FP1 D;  1TLH B;  4GCV A;  2M45 A;  5CVV A;  1L0O C;  1FBQ A;  3DP7 A;  1Y0U A;  3GO5 A;  3DQV C;  4RGX A;  5HLI A;  3KET A;  2EA4 A;  5E1X A;  1R1T A;  1FYK A;  2D45 A;  2LDU A;  1J5Y A;  3WE2 A;  5LEJ A;  2MBF A;  2G7H A;  3HIF A;  5FFX A;  4M9Z A;  5ILU A;  5A2Q Z;  3Q9V A;  2P5L C;  4LB6 B;  3ELK A;  4NB5 A;  4WF2 A;  4L9V A;  3T0Y A;  1ZG3 A;  4R79 A;  2GA1 A;  2QYO A;  2FRH A;  1P2F A;  2A61 A;  2UXX A;  4LGW A;  4CGZ A;  4HQM A;  5K5O A;  4IHT A;  3COA C;  5FD6 A;  2GQQ A;  1QZZ A;  2WV0 A;  4KT5 C;  4O3M A;  3BJA A;  2CO5 A;  1OYY A;  2Z3Y A;  1WI9 A;  4N0B A;  2RKH A;  1OYI A;  1ULY A;  3E6B A;  2IA1 A;  1LEA A;  3VFZ A;  2ZFW A;  3RDI A;  1IN7 A;  1RI7 A;  2KJC A;  4YIF A;  4UNO A;  4G7O F;  4M6X A;  2IW5 A;  2RNJ A;  1V4R A;  1TTY A;  1T39 A;  1Q1H A;  3Q5F A;  2HR3 A;  2JPC A;  3G3Z A;  2ZNZ A;  1K78 B;  3TO7 A;  5LRS A;  3CUQ B;  5BQT A;  4WXD A;  1FC3 A;  2EB7 A;  2Y48 A;  4MEX F;  3I4P A;  5BPD A;  5CJ9 A;  4U0Y A;  1R22 A;  3FWE A;  3JSO A;  4L18 B;  2L54 A;  3M7G A;  1D3Y A;  2W24 A;  3ZMU A;  4E70 A;  5FD5 A;  1UHW A;  5L3F A;  3QPH A;  4I0A A;  3HHH A;  4WX9 A;  2RVC A;  3ZP5 A;  2PMH A;  3DV8 A;  2OQR A;  4S04 A;  3LST A;  1RNL A;  1DPU A;  4CDG A;  3PQJ A;  4L9J A;  2H09 A;  4UXN A;  2L4M A;  1HKS A;  2KRF A;  4OIO F;  3R4K A;  3RPQ A;  4A0Z A;  2XAJ A;  3WGH A;  4RS8 A;  3F23 A;  4BXU A;  3WGI A;  2HZT A;  1IF1 A;  1J7K A;  4P9U A;  3P9I A;  2V1U A;  2F5C A;  2OA4 A;  2P6S A;  4RGR A;  3V7C A;  4G7H F;  1EV7 A;  1HKT A;  1IXC A;  4O6J A;  3JTH A;  5BS6 A;  5FO5 A;  3I0T A;  1ON2 A;  4Y15 A;  5J8C A;  2CGP A;  2D2W A;  3TO6 A;  1JGS A;  3I64 A;  3KZY A;  3F8N A;  4P55 A;  1W5T A;  4LB5 A;  1W7P B;  2O0Y A;  2NNN A;  4I01 A;  1XSD A;  3HRS A;  3HRM A;  3T8T A;  2TDX A;  2HYG D;  2DU9 A;  3V8L A;  2Q8K A;  2XKO A;  2F5D A;  3SZP A;  1R58 A;  5KK1 A;  2QLZ A;  3T5X A;  3PQK A;  2R7F A;  4OIN F;  3J81 Z;  4LJZ F;  2ZXJ A;  2OAZ A;  4M74 A;  1AOY A;  1H9G A;  3OV8 A;  2BE5 F;  1PP7 U;  1LJ9 A;  2XUB A;  1W4M A;  1CF7 A;  2AXL A;  1IN5 A;  1YS7 A;  4UVA A;  2ADU A;  4R8H A;  5IT3 A;  4K2E A;  1KA8 A;  3DEU A;  3GUD A;  3V7R A;  3M9A A;  1MGT A;  3F8F A;  2VXZ A;  1IN4 A;  4Y13 A;  4KMU X;  4S05 A;  1MZB A;  5K1Y A;  3H92 A;  2QVO A;  1ZRE A;  1QO0 D;  2DLL A;  5CVR A;  4JQF A;  2DW4 A;  3ABT A;  2AS5 F;  1IRF A;  2EFP A;  5JHU A;  3EUH A;  3R6S A;  2EFQ A;  1O3S A;  3WE3 A;  4HOB A;  4HQE A;  3R0A A;  3I54 A;  5D5V B;  3HYI A;  2XGX A;  4XSZ F;  3ZMT A;  1T6S A;  3ZMD A;  2HTJ A;  2COM A;  2O8X A;  4A0Y A;  5ICC A;  4KDP A;  5HS9 A;  4MHG A;  6PAX A;  3FZV A;  1JXS A;  3TKY A;  5EEG A;  1GXQ A;  3U9G A;  3IHU A;  3LA2 A;  1S3J A;  4P96 A;  3ISP A;  1IAW A;  3MFK A;  3SQN A;  1BC7 C;  5ED4 A;  2ZKZ A;  1RUN A;  3T1B A;  2VE9 A;  2RV8 A;  4HYE A;  4RGU A;  4M71 A;  4NQW A;  3TOB A;  2XHK A;  3GFI A;  5A2Q K;  5DCF A;  3IRQ A;  4AIJ A;  2PFB A;  4A2U A;  2IA2 A;  4CHU A;  1FSE A;  4JK1 X;  3WTY C;  1WSU A;  1S7A A;  2DO7 A;  1K7A A;  1C0W A;  5HVQ C;  3KE2 A;  1FZP B;  3BWG A;  4IVN A;  4CYD A;  2CW0 F;  2JT1 A;  3JAM Z;  2DK5 A;  2D1H A;  3ZMS A;  3B02 A;  1FBS A;  3RJP A;  2ZJ2 A;  1ZN2 A;  3HRT A;  2V1D A;  4FX0 A;  1CF7 B;  2MH9 A;  1MJB A;  4EJT A;  2CWE A;  1HQC A;  1S29 A;  1MDM A;  5HDG A;  3O6B B;  1QGP A;  3F22 A;  2W25 A;  3ZPL A;  4ENJ A;  4ENN A;  4IHS A;  2E1N A;  2YPR A;  4BAY A;  1P4X A;  1SD5 A;  1J9I A;  2FOK A;  1ON1 A;  2L3D A;  2DTR A;  2EV0 A;  2HQR A;  4I02 A;  2BGC A;  2HDC A;  1IW7 F;  2DAO A;  4ZZL A;  1MJA A;  2VT2 A;  3EQL F;  3V8K A;  4G94 A;  4GGG A;  2Q0O A;  5ILS A;  4L5I A;  3HSR A;  2RC4 A;  1FLI A;  4KA4 A;  3LAP A;  2UZK A;  4RB3 C;  3P9C A;  2DPD A;  4CIC A;  2LF8 A;  1DUX C;  4DQ2 A;  3IC7 A;  3LQR A;  1IZ1 A;  1LB2 A;  4RAY A;  1D5V A;  1BM9 A;  5HS7 A;  2H94 A;  3N97 A;  3TGN A;  1J0R A;  2V1X A;  2HEO A;  4EGZ A;  3GYH X;  3IWZ A;  4B8X A;  1ZG1 A;  1PP8 F;  5L3B A;  5CYV A;  1E2X A;  3K1M A;  1HBX G;  1JE8 A;  3KFW X;  5D6E A;  2JZY A;  1XCV A;  4MNU A;  3ZMZ A;  3FF5 A;  1BN5 A;  5TJJ A;  3HHG A;  4KIF A;  4M72 A;  2IP2 A;  2HKO A;  2PN6 A;  4B09 A;  4EJV A;  4PGH A;  3DF8 A;  2Q2E A;  4YG2 F;  4NHJ A;  3V4G A;  4FHT A;  2HWV A;  5KVR A;  2MA3 A;  4DNC A;  4ESJ A;  4EM0 B;  4PDK A;  1KU9 A;  5TRD A;  4XLN F;  5CLS A;  2ISY A;  2YX4 A;  1KYZ A;  3E97 A;  5E8G A;  3CUQ A;  1MDM B;  5D8L B;  1R7J A;  4EGY A;  4WCG A;  2V9V A;  3LA7 A;  2VOD A;  5AIP A;  1L3L A;  4YFX F;  2ACJ A;  2A6E F;  3J81 K;  2K27 A;  5D5U B;  3ECO A;  3HOT A;  1FBU A;  2W57 A;  3GVA A;  4GXO A;  4UVB A;  1S8N A;  3DKW A;  3SZT A;  1LEB A;  3GFM A;  3N4M A;  2QM3 A;  1EH6 A;  3TQN A;  3VB2 A;  1H0M A;  3LQQ A;  4WXC A;  4XSX F;  2BV6 A;  1BI0 A;  3CLO A;  4I0B A;  3L00 A;  4KUM A;  3CJN A;  3IKT A;  3SFZ A;  2VE8 A;  1LNW A;  1U8R A;  4LD5 A;  2NYX A;  1FOK A;  1TQP A;  4HBL A;  3GLX A;  4HA8 A;  5E18 F;  5JVT A;  2XAG A;  3KP5 A;  1XSX A;  2Y75 A;  2KIU A;  4AIK A;  4YFK F;  3WTX C;  3ABU A;  2PG4 A;  3HSF A;  4MQV A;  3GZ6 A;  5DUI A;  1IRG A;  2B0L A;  1XGN A;  2EFN A;  4JBA A;  4BQA A;  1XSV A;  2WWY A;  1QNT A;  2EWN A;  1FP2 A;  5E1Z B;  1FYM A;  2QZ8 A;  1W7P A;  1FSH A;  1WQ2 A;  3RYP A;  1G3Y A;  3ECH A;  2FQ3 A;  3RKW A;  3BRO A;  4U7D A;  4PCQ A;  3D5L A;  2XAF A;  4UVC A;  1STZ A;  1P6R A;  2STW A;  5ICF A;  4EM1 A;  3GWZ A;  3E6D A;  3ERE D;  2W85 A;  2K7L A;  3C18 A;  2ISZ A;  4L9T A;  1Z7U A;  3O3K A;  1SFE A;  2W84 A;  4MQ9 F;  3IKV A;  3WU0 A;  1EH7 A;  1KU7 A;  5F1R A;  3IL2 A;  3RTR A;  2LF7 A;  5DDG A;  4EVI A;  2GZW A;  5BPI A;  1B9N A;  3VOD A;  4RGS A;  2XAH A;  2H27 A;  4KFC A;  3S2W A;  1ZH5 A;  5LRR A;  4P9F A;  4A5N A;  3U2R A;  4ESB A;  1IUY A;  1ZAO A;  2YX7 A;  1ZYR F;  5CVU A;  2HKX A;  5DCM B;  3JAM K;  3F21 A;  2XV4 S;  5K5Q A;  2IT0 A;  1MKM A;  3F8M A;  2WTE A;  2ESH A;  2M30 A;  3HOS A;  2FF4 A;  1SMT A;  2FBH A;  2MC3 A;  2XRN A;  3F6V A;  2PJP A;  3ROU A;  1U5T A;  1U2W A;  1ZRF A;  2X0L A;  5ICE A;  3KP3 A;  2XAS A;  4KIG A;  3RPU A;  3CDH A;  1YS6 A;  4AWX B;  3K1N A;  4OIP F;  1XCB A;  3G73 A;  2EA2 A;  3I58 A;  4ZYG A;  2NS0 A;  2A3S A;  1B9M A;  1P92 A;  4HX8 A;  2GA2 A;  1IN6 A;  3ZN1 A;  5LGN A;  2O6G E;  3BZ6 A;  4UV9 A;  3FHZ A;  2EFO A;  3SXY A;  2P5K A;  3MZY A;  3R0J A;  1JHF A;  3FMS A;  1R5H A;  1BOA A;  2IA0 A;  1LQ1 A;  1MD0 A;  5DUK A;  3QP5 A;  4FX4 A;  3GFL A;  1KU2 A;  5F6F A;  3RKX A;  1KQ8 A;  4BHB A;  5ICG A;  5DD4 A;  5JI6 A;  2M1B A;  1D8J A;  1LDJ A;  3L09 A;  1ZRC A;  2DI3 A;  1KQ9 A;  1B6A A;  3K0L A;  3K69 A;  2QEN A;  1BI3 A;  1YIO A;  3QRF F;  3R60 A;  4EJO A;  4LMY A;  5HS8 A;  2J5P A;  3RYR A;  3H3U A;  2F2E A;  1O7F A;  3T8R A;  1OMI A;  1UST A;  3W6J B;  5DV5 A;  4A0X A;  1BBY A;  2DQL A;  4EQQ A;  3IRR A;  4KMF A;  1LVA A;  4HV6 A;  4EMS A;  1QZY A;  1LDK B;  2PQ8 A;  5F64 A;  4UHT A;  2G7U A;  1F4K A;  3Q9S A;  5LHG A;  3LWF A;  1REP C;  2ETH A;  3V7S A;  4H0E A;  3RKY A;  1WWX A;  5IT9 K;  1T38 A;  2FNA A;  2QUF A;  4WK8 F;  4EJW A;  3WTU C;  1S6L A;  1U5T B;  3DXJ F;  2FBI A;  3BDD A;  3KEQ A;  1OYW A;  3REO A;  4HAM A;  3I53 A;  1B59 A;  5LHH A;  2CFX A;  2FEZ A;  1WRJ A;  2IJL A;  3E5X A;  5EEH A;  2VC0 A;  3DPL C;  3GFJ A;  1R00 A;  1B1B A;  2P5V A;  2J5O A;  2QBY A;  2XKP A;  3D0S A;  2Z33 A;  2JRT A;  2CSO A;  4Q47 A;  4OIR F;  1J2X A;  4LG0 A;  2H6B A;  2H6C A;  5H6R A;  4RB1 A;  2PBI A;  3WTV C;  2IPQ X;  4A6E A;  4L5J A;  5D4S A;  2NNY A;  4MEY F;  4WWC A;  1RZ4 A;  2M8E A;  3W6K B;  4KIC A;  2FML A;  1YO5 C;  1KYW A;  4ZH4 F;  3E3V A;  1OR7 A;  2XVC A;  1R36 A;  4ZYE A;  3C3W A;  1R1U A;  2O61 A;  2HGC A;  1F1Z A;  3FM3 A;  3JTG A;  3J80 K;  2K86 A;  3PFI A;  5K5R A;  4WXH A;  1V3F A;  1I1S A;  1YW7 A;  2L02 A;  1PDN C;  1UFM A;  1H9T A;  3WU1 B;  1E17 A;  2PI0 A;  1AWC A;  2ZME B;  1HKQ A;  4ZZD A;  4Z2Y A;  3C7J A;  3GXO A;  4OMY A;  1KU3 A;  3F3X A;  4M9S A;  5L3D A;  1KGS A;  4IF4 A;  4RAZ A;  2QWW A;  2IRF G;  3MAJ A;  3R61 A;  3J7A O;  1VTN C;  5E8I A;  5JFR A;  4YII A;  3ULQ B;  1HW1 A;  3BJO A;  3I71 A;  3WTW C;  2LSO A;  1HW5 A;  2MH2 A;  2VC1 A;  3MCZ A;  2FSW A;  1QQI A;  1Z1D A;  2GIV A;  2KIM A;  3L7W A;  1G3W A;  4HZF A;  1R5G A;  4AVP A;  3F6O A;  1T98 A;  3HSE A;  1BI2 A;  1USS A;  3QAH A;  5L3G A;  2L4A A;  1X3U A;  2OD5 A;  3BPX A;  1XMA A;  2RN7 A;  3NRV A;  4IRH A;  1G6N A;  4M6Y A;  2QBY B;  1IN8 A;  1ZLK A;  1XD7 A;  3FM5 A;  3BJ6 A; 
#chains in the Genus database with same CATH topology
 2MYS A;  3JRG A;  5CVI A;  3E6C C;  1I1G A;  2VON A;  2IGN A;  4LG0 B;  5E3L A;  3PO2 J;  2CQK A;  5GPC A;  3S16 J;  4E7I A;  1LKX A;  1JKP C;  2YSR A;  4QWQ A;  2FMY A;  5D4R A;  3JW4 A;  3WGG A;  5DM6 F;  2K5C A;  2DOF A;  1G8X A;  2RQP A;  1YRN A;  2DFE A;  1MMG A;  3G1M A;  2E1C A;  2EV5 A;  3QPL A;  2ELK A;  2ZXI A;  4G8X A;  4ETS A;  2R3S A;  5EEA A;  4A3G J;  3G2B A;  3OL3 A;  4GDF A;  3MKY B;  5IY5 H;  1QPM A;  2MGQ A;  3P5J A;  4I7H A;  4XN3 A;  1YJW I;  3ZQC A;  5IYC J;  5BOX A;  4L9N A;  4U88 A;  2LYC A;  2LKS A;  3DU6 A;  2VBY A;  3H3Z A;  3K10 A;  1FT9 A;  3QP6 A;  4KNY A;  1RR8 C;  4G9Y A;  1RKT A;  1MND A;  1HDD C;  1I5Z A;  3WOD F;  3CCM I;  3JRH A;  3MQ0 A;  1E0E A;  1WJD A;  1T8I A;  2FNP A;  3NEU A;  3K70 C;  2E7W A;  3FXR A;  2HNH A;  5IT9 Z;  5FKM A;  2Q1Z B;  3ZQL A;  2NRA C;  3DLA A;  1TW3 A;  2R7T A;  1W5S A;  2IEK A;  5D6F A;  1VF9 A;  1WFX A;  3CCE I;  1O7L A;  3LSI A;  3BQZ A;  2HFH A;  3K4N A;  2C6Y A;  1SAN A;  4HF0 A;  3OSF A;  4XK4 A;  4BAC A;  1LE8 B;  3S15 J;  2IGO A;  5FFZ A;  2A5W A;  3HJE A;  4QPQ A;  3TW6 A;  5IP9 J;  4UUV A;  2BEO A;  2L9V A;  5J1U A;  2ZBK A;  1RIO H;  5DCM A;  2IGK A;  2ID3 A;  3HPH A;  1S7O A;  4BHP A;  5J1R A;  1EH8 A;  1Z3Y A;  2V4J C;  5J4V A;  1ZG5 A;  4P5O A;  5M5W J;  1HSJ A;  3QYF A;  3LA3 A;  3D1N I;  3TOA A;  3H9G A;  1FY7 A;  4G6Q A;  3IUO A;  1ONV A;  5C44 J;  2A69 F;  1MBJ A;  1X3Z B;  2L0K A;  2L7F P;  3BP8 A;  3CCU I;  5FLX Z;  1F5T A;  1K79 A;  3CO6 C;  2LK2 A;  1ZAR A;  3TDU C;  1BI1 A;  2BZT A;  1N78 A;  5J6X A;  4F55 A;  4F7Z A;  2EIL H;  4PFO A;  4QSH A;  2B9S A;  3ESW B;  4XRF A;  2K9M A;  4N9I A;  1EKE A;  3BR0 A;  2DBB A;  3FIS A;  3P9K A;  4BHC A;  3KEO A;  1YFH A;  2P7V B;  3KP6 A;  5LLQ A;  1R23 A;  1TBX A;  3FXU A;  2ZJQ F;  1U78 A;  3DTK A;  4ENK A;  5M3F J;  4XN0 A;  5DS9 A;  4I6Z A;  3F72 A;  5K7Z A;  1TNT A;  3C2G A;  2GWR A;  1NK3 P;  2KJB A;  1Z67 A;  3J80 Z;  2HYF A;  4OOI A;  4ESF A;  4R1H A;  3HEF A;  2AHQ A;  2UUZ A;  4HX4 A;  1KQ0 A;  1ACI A;  1Z05 A;  3ZQ7 A;  3SHF A;  4BH9 A;  2CV2 A;  4HX7 A;  2CUF A;  2NOG A;  1Z6R A;  3PIO F;  1W0T A;  2O9L A;  1ZGA A;  3CO7 C;  3QYB A;  2KFD A;  5FGM A;  4RA2 A;  5J8F A;  1Z9C A;  4IHX A;  1ZLJ A;  4XMY A;  2O03 A;  3L1P A;  3SEQ A;  2FA5 A;  3FX3 A;  3QPS A;  2IAI A;  2YUS A;  1UAA A;  4PSW A;  3M8F A;  3FK6 A;  2VPL A;  1X19 A;  1O57 A;  2XIG A;  4B3A A;  5L3C A;  5C4J J;  4HSR A;  4N4N B;  3H3V K;  2JTV A;  3BTL A;  5LBQ A;  1YRN B;  3C2H A;  3HOY J;  2GAU A;  3BZC A;  5CVJ A;  2K3F A;  3FXQ A;  1XGM A;  2CQN A;  3K2A A;  3OYF A;  1UZC A;  1UCR A;  1N25 A;  3EDP A;  1FNN A;  3ZMV A;  1VI0 A;  2QQA A;  3RQI A;  2W4S A;  3QYE A;  1OPC A;  4XLA A;  2KKO A;  3JR9 A;  4LLN A;  1GT0 C;  1YJ9 I;  1PUF B;  2ICW G;  3I9V 2;  1A35 A;  1VQN I;  2QF7 A;  4LK1 F;  2F4I A;  5CQG A;  2LKP A;  1WVR A;  4EEF G;  2VLA A;  4BY1 J;  3HTS B;  4EJU A;  4IHV A;  3HUG B;  2UV1 A;  2XPW A;  1XDU A;  2E7X A;  2DFF A;  2YU9 J;  2JUC A;  2MLG A;  3OYI A;  3TO9 A;  2MD5 A;  3QOP A;  4IPA A;  3SEZ A;  2PLY A;  3EUA A;  5LEK A;  1TP4 A;  2M87 A;  2X48 A;  2K4B A;  2HXO A;  5JHF A;  1YYV A;  4YFN F;  1MJ9 A;  2JK3 A;  5LGU A;  2VKV A;  1GXP A;  2ZSI B;  3M8E A;  3FXL A;  4ZYA A;  3DPU A;  2QQ8 A;  2V79 A;  2H8W A;  3DPT A;  1BR4 A;  2F4O B;  3VOE A;  3HRU A;  4ENM A;  4HF2 A;  1U6G A;  2DFH A;  1ERD A;  1IO2 A;  2I10 A;  1TWC J;  5CPR B;  5EJC A;  2WAQ A;  3AAF A;  3GTK J;  3PL8 A;  1XGO A;  1WJB A;  2DOE A;  4RMN A;  1G4D A;  4NBQ A;  2E36 A;  5FKK A;  3S32 A;  4C3I J;  5M3M J;  4ZC3 A;  2P8T A;  3KLO A;  2ZJP F;  5E1W A;  3EET A;  4DYR A;  3B6C A;  4XR6 A;  5HLG A;  1VQK I;  3DWL E;  4A3D J;  3JRF A;  3WTT C;  2F48 A;  4LIT A;  1WCM J;  2AXT C;  2K4J A;  3FXM A;  1JHH A;  1SFK A;  2Y9Z A;  3QQA A;  4I09 A;  3CUQ C;  4N9H A;  2M5W A;  4U7B A;  2FBK A;  4A3I J;  3MN2 A;  1XB4 A;  1AKH A;  1SD6 A;  2QQB A;  1UG0 A;  2HVR A;  2YR2 A;  4C30 A;  1TQI A;  3TED A;  1WJF A;  2V6C A;  2X6Y A;  5FB2 A;  4A6D A;  3VYS B;  4XRM A;  3CJR B;  3H0D A;  4IKF A;  1RRJ A;  2BW3 A;  3DCF A;  4E6K G;  2DYR H;  3ML6 A;  4PUS A;  1ZGJ A;  1YX5 A;  2EJR A;  3GTM J;  1Y1V J;  3EYI A;  5HLH A;  2VBX A;  2EZK A;  3S8P A;  3VEP A;  5H20 A;  4KIS A;  2LY1 A;  1TL8 A;  3BR3 A;  1UB9 A;  2K9Q A;  1FTZ A;  4FT8 A;  3GEZ A;  4LK0 F;  3BLY A;  1CGP A;  3VWB A;  4IHY A;  1JTY A;  4U0W A;  3OYG A;  5AIQ A;  4I98 B;  2ID6 A;  3GTO J;  2X6X A;  1BJA A;  2Y0S N;  1JJ6 C;  4BYY A;  3FBI B;  3WTZ A;  4G12 A;  1YTY A;  4KN4 X;  4EV0 A;  2LBF A;  1HW2 A;  1T0F A;  2GXB A;  2ELJ A;  1VQ8 I;  3FHN A;  2CRG A;  2RRE A;  3KLN A;  2O3F A;  1BIA A;  4Z6Y A;  4OU0 A;  1A36 A;  4M6V A;  1FX7 A;  3L9F A;  2RDP A;  1WH5 A;  4PJL A;  3CUO A;  3I5U A;  2EK5 A;  3OL4 A;  4DW6 A;  2EFW A;  4CO8 A;  2L01 A;  1UHM A;  4TV7 A;  4KN7 X;  3TBI A;  3GTL J;  2E2H J;  2VBW A;  4DJA A;  1GUU A;  4DBR A;  1DP7 P;  2ZCW A;  1DQU A;  3M8J A;  3S3N A;  3GF2 A;  1SD4 A;  3Q0V A;  2DQR A;  2HS5 A;  2YU3 A;  4JX6 A;  2FE3 A;  1E3O C;  1FJL A;  3CC4 I;  2DMN A;  2QKM B;  4HV5 A;  5D5X B;  1IV6 A;  1GHC A;  5EZG A;  1TNS A;  1FYL A;  5F0F A;  1P4A A;  2HI3 A;  1NG6 A;  1FPQ A;  3U1D A;  3HOZ J;  1GVJ A;  4CZZ A;  3PNT A;  1UHS A;  1B4A A;  4II3 A;  2KDO A;  4B43 A;  2E71 A;  4LFU A;  1IDY A;  4OIQ F;  2W48 A;  3F8B A;  2M0C A;  4RLF A;  2X51 A;  2ZME A;  1WI3 A;  3CQZ J;  2CQ7 A;  3GLL A;  5DD8 A;  3QPT A;  2KQR A;  3I59 A;  3KZZ A;  5HOO A;  3EYY A;  4F3Q A;  2GXG A;  2HQA A;  3L2R A;  3M1E A;  1A6I A;  5ERI A;  2BHY A;  1ZEL A;  2XRO A;  3OSG A;  3V8J A;  2OZ6 A;  3FMQ A;  2KZV A;  2X9D A;  2E1M C;  3WHB A;  1IXR C;  1WGX A;  2VPR A;  4L0Y B;  2EV6 A;  2ME0 A;  1W7P D;  2CS3 A;  1TWF J;  2AO9 A;  2L7K A;  1RUO A;  3Q0W A;  1A04 A;  5GAH J;  2LNB A;  1BOB A;  2XPV A;  3ABL H;  3DTI A;  2FD5 A;  4RB0 A;  1ZHF A;  3ABM H;  4PGG A;  1Z6T A;  1R1V A;  3OOP A;  3TDZ C;  1BIB A;  5J3L A;  2JWT A;  1POG A;  4XLH A;  2MLK A;  5HNF A;  1O3R A;  1AKH B;  5K7F A;  1G3T A;  4LIV A;  3BY6 A;  3VPR A;  4X0G A;  2DA4 A;  3KEY A;  1HLV A;  4UB6 C;  3BZK A;  1AU7 A;  2R4G A;  3IWF A;  2P4W A;  3OYJ A;  2EIN H;  1VZ0 A;  4HNT A;  3LSP A;  1LDD A;  2G9W A;  4GRI A;  4O5V A;  4RB2 C;  1I6X A;  4L0Z B;  2DT5 A;  2JPB A;  4PZJ A;  3A0B C;  2EZH A;  1VND A;  3TL4 X;  4ASN A;  2ESN A;  2VOP A;  2BBY A;  1ODD A;  4GO1 A;  3PIP F;  1DU0 A;  2KIF A;  2GLO A;  5BMZ A;  3FKI J;  4BXX J;  1I3A A;  3CDI A;  1MIJ A;  1ZRD A;  3GTJ J;  5LFA A;  4AD9 A;  3E5U A;  3C1D A;  2WAD A;  4ON0 A;  3LSJ A;  1G59 A;  4BXF A;  4IRI A;  3WTS C;  4A93 J;  1WPK A;  2R7V A;  1T56 A;  3HB9 A;  2CQX A;  1T2K A;  1D0Y A;  2VN2 A;  5FLX K;  2UWM A;  4MLO A;  1ORK A;  3NWS A;  1SC7 A;  1U5T C;  4Y4R A;  4M9X A;  1O4X A;  2LOO A;  2NVQ J;  1R5I D;  3BCA A;  1ETV A;  4ZDO A;  3KZI C;  2L9S A;  3S2D J;  2M7A A;  3QU3 A;  2LBF B;  2E2I J;  3RZO J;  2OZU A;  1NK2 P;  2Y9Y A;  4FE7 A;  2WY8 Q;  1MMD A;  3S2H J;  1VFC A;  4J00 A;  2HOE A;  2HTS A;  4MIM A;  2RGV A;  1ZK8 A;  1HST A;  4HLY A;  2W82 A;  3RIR A;  4KYW A;  2A5Y B;  5E20 A;  4KIB A;  1F9N A;  2VQC A;  3F8C A;  2IS2 A;  1YI2 I;  4LLL A;  4RLQ A;  2P7C B;  1K6O A;  3DFG A;  2OF7 A;  4CSW A;  2FU4 A;  2NS7 A;  4HF1 A;  3TW7 A;  2XSJ C;  1G3S A;  2OPT A;  4XKC A;  3QU6 A;  4IZZ A;  3RKQ A;  1IGN A;  4MGR A;  1SFU A;  2JSC A;  5GP9 A;  3DKY A;  1HOM A;  1SFX A;  3RPU D;  1IJW C;  3A4C A;  5HDN A;  2DN0 A;  4A3J J;  1TQM A;  2A6H F;  1VQL I;  3IH3 A;  4A12 A;  3JSP A;  1PUE E;  3IAM 2;  3O2P E;  3DBR B;  4M73 A;  3MWM A;  3HTU A;  4E7L A;  2XAQ A;  2STT A;  4CCJ A;  2BYV E;  4AYB A;  4QLC U;  2JMW A;  4HDU A;  5ILV A;  5KAF C;  1LUJ B;  3W2A A;  2QQ9 A;  4I2O A;  1DDN A;  4JYK A;  3CTA A;  3I59 B;  3EPZ A;  1H8A C;  1HF0 A;  2Z99 A;  3IH2 A;  1YQA A;  2DK8 A;  2MG4 A;  3KP2 A;  3JRE A;  2R93 J;  2VBZ A;  3B73 A;  3H0G J;  2LR8 A;  5HDK A;  2VOO A;  2X4H A;  1OLT A;  4NC8 A;  1XX5 A;  3CMY A;  2X6O A;  3ZN0 A;  2Y0M A;  1JKQ C;  3UNG C;  1W0U A;  1LPQ A;  5F08 A;  1NHA A;  5D8K B;  3BOQ A;  5J47 A;  3GZN B;  1Z91 A;  3GTQ J;  4G6D A;  4EM2 A;  2XC7 A;  1TW2 A;  3WG9 A;  2F5F A;  2IVM A;  4LLG F;  3TP0 A;  3TMO A;  5IP6 A;  2DA3 A;  1O3Q A;  2QSF X;  1J75 A;  1H89 C;  3KP7 A;  2EIJ H;  3AL0 B;  5DEQ A;  4M3E A;  2BY0 A;  2Z5U A;  1YLF A;  3L2Q A;  2K9L A;  2JA5 J;  3CME I;  2JRM A;  1Y39 A;  3SDB A;  1MSE C;  1OQY A;  2LP0 A;  4IXA A;  5JVG F;  2ZO4 A;  3GZ5 A;  4BKX A;  4M3G A;  3K4L A;  4HDV A;  4CXF A;  1IC8 A;  3A0H C;  3E6M A;  1BA5 A;  4A5M A;  1WKM A;  4MTE A;  3PSF A;  1X2N A;  1BC8 C;  1R4N B;  5LGT A;  2PEX A;  2KPM A;  5E3O A;  1ZTR A;  3OYL A;  3ZGK A;  2CMP A;  1W5C C;  4FIS A;  2UXN A;  4J01 A;  4Q5S F;  2HOS A;  4YRV A;  1TWG J;  3RI4 A;  3CP2 A;  5LHI A;  4QPO A;  4UV8 A;  4IRG A;  3NQO A;  2R7D A;  1U3E M;  2R7X A;  2A07 F;  5E17 F;  1JI8 A;  4XLP F;  3KP4 A;  4Q48 A;  1O3T A;  3HKZ A;  1NH3 A;  1SAX A;  4D0P A;  1FWZ A;  1HXD A;  1V55 H;  2CH0 A;  1N75 A;  2K02 A;  4JOM A;  1ETO A;  3BPV A;  1VQ6 I;  4Y7N J;  2HQN A;  4CUG A;  4XID A;  1Y0N A;  2IBD A;  2QGU A;  4OMZ A;  3OS2 A;  2Z9O A;  1H88 C;  3GW2 A;  1TWA J;  1PVE A;  1HC8 A;  3K4M A;  5D5W B;  2KIQ A;  1OKR A;  4GYG A;  1YG2 A;  1J59 A;  3FMR A;  3A03 A;  1V5G A;  2OQG A;  2HQ5 A;  2WAQ N;  2F5E A;  1PUF A;  2A68 F;  2VJ4 A;  2FXA A;  1XMK A;  1SMY F;  2K85 A;  2WAE A;  1D8K A;  2DFI A;  1YHQ I;  4NDL A;  2D1V A;  2WAF A;  3K4B A;  2CG4 A;  3HUG A;  4RBO A;  1XS9 A;  1XN7 A;  4YEJ A;  2K9N A;  4ZYD A;  3DU5 A;  2DPU A;  2K3P A;  2VAS A;  3K4C A;  1SD7 A;  5E3N A;  3CF5 F;  1JT6 A;  5L3E A;  3PSI A;  3ZXS A;  2NOJ B;  1VQO I;  4ZYH A;  2OBP A;  1YW8 A;  5FKN A;  2ZNY A;  3K9T A;  5DYM A;  4AUX A;  4FAS D;  3E5Q A;  1P7I A;  2WC2 A;  4BNC A;  1OR7 C;  2P6T A;  2VQL A;  1LFP A;  1I27 A;  4AU7 A;  1XDS A;  2KLO A;  4IQJ A;  4G7Z F;  2K9S A;  1GLN A;  1YJN I;  1K78 A;  3LL7 A;  3HL2 A;  4Q4Z F;  5AON A;  1QBJ A;  3K70 D;  4GYI A;  2PMU A;  5H6Q A;  3OYC A;  2NAZ A;  1P4W A;  4MTD A;  2ELH A;  4XBF A;  1YW9 A;  3LAJ A;  1DPR A;  4HW0 A;  2CYY A;  1Z77 A;  4CYC B;  3A02 A;  4Y17 A;  1LVK A;  2EBI A;  1ETY A;  3LFK A;  3P7N A;  3MZH A;  4CH7 A;  5JR3 A;  4AIH A;  1IXS B;  1BW6 A;  2OU2 A;  3K1P A;  2M2E A;  2W1O A;  2VT3 A;  3GX4 X;  1XGS A;  3K2Z A;  3L2C A;  3KCC A;  2K40 A;  4HLX A;  1FIP A;  4IJA A;  4U0V A;  2MSY A;  3MEX A;  1FP1 D;  3H1C A;  1TLH B;  4GCV A;  1A5J A;  2M45 A;  5CVV A;  1L0O C;  4UUS A;  5KCM A;  1FBQ A;  3O8H A;  3DP7 A;  1Y0U A;  1APL C;  2D5V A;  3GO5 A;  3DQV C;  4RGX A;  1IRX A;  5HLI A;  3D5R C;  3SDG A;  3KET A;  2O8K A;  4CCO A;  1QA6 A;  5DTD A;  2EA4 A;  5E1X A;  2VIX A;  1R1T A;  3LSM A;  1MBF A;  1FYK A;  4YEL A;  2D45 A;  2MFZ A;  2LDU A;  1J5Y A;  1ZR2 A;  1SFO J;  3WE2 A;  3KYD B;  1IRZ A;  5LEJ A;  2MBF A;  2G7H A;  3CCQ I;  3HIF A;  5K7H A;  1JGG A;  2KL4 A;  5FFX A;  1X3W B;  3G1O A;  4M9Z A;  5ILU A;  3QOD A;  5A2Q Z;  1F36 A;  4E7K A;  4LIU A;  1IG7 A;  4F52 A;  2HDD A;  3Q9V A;  4XRS G;  5B5E C;  4Y3O A;  2P5L C;  4LB6 B;  4MFE A;  4OWR B;  3ELK A;  4ZDL A;  4NB5 A;  3JRI A;  4WF2 A;  4L9V A;  3T0Y A;  1ZG3 A;  3U1K A;  4D7N A;  4DBQ A;  4R79 A;  3JCU C;  2GA1 A;  2QYO A;  4IHW A;  1D0Z A;  2FRH A;  4V2F A;  3ZQH A;  1TC3 C;  1P2F A;  2A61 A;  2UXX A;  3H5R A;  3CF2 A;  4LGW A;  4X1E A;  2Z1D A;  4LG3 A;  1U8B A;  4CGZ A;  4HQM A;  2M34 A;  5K5O A;  2VUM J;  3CD6 I;  4IHT A;  3COA C;  4ZDP A;  3C2B A;  2IXS A;  5FD6 A;  1K4S A;  4D9J A;  1Q1V A;  2VKE A;  3CDL A;  2GQQ A;  1QZZ A;  2WV0 A;  4KT5 C;  2BXY A;  5TIS C;  3OYD A;  3S1M J;  4IOC F;  2XF7 A;  3Q3S A;  4O3M A;  3BJA A;  2VB6 A;  2CO5 A;  2P0W A;  1OYY A;  1TT5 B;  4F93 B;  2Z3Y A;  1WI9 A;  4N0B A;  2N8G A;  2RKH A;  2DT7 B;  1OYI A;  1ULY A;  2DA2 A;  2X1D A;  3E6B A;  2IA1 A;  2QKL B;  3J7A Y;  2HPM A;  2V6E A;  1LEA A;  1Z0X A;  3VFZ A;  2JVG A;  2ZFW A;  3RDI A;  1IN7 A;  4AC0 A;  3OS0 A;  2PJR B;  1RI7 A;  2DMQ A;  2Q2E B;  2KJC A;  2OCE A;  4YIF A;  2BHZ A;  4UNO A;  4RM3 A;  4Y33 A;  4G7O F;  4H4K C;  4M6X A;  2IW5 A;  3E0J B;  3HXL A;  2RNJ A;  2WBM A;  2LMD A;  1V4R A;  1TTY A;  1T39 A;  2OC6 A;  3AG2 H;  3LSG A;  3ZCO A;  3A2K A;  1Q1H A;  4AID A;  4A3K J;  3CES A;  3Q5F A;  2HR3 A;  2JPC A;  3EUK L;  4N4O B;  3G3Z A;  2L7Z A;  4P1W A;  2ZNZ A;  2Z2S B;  3HC7 A;  3IAS 2;  1K78 B;  3I3L A;  3TO7 A;  1QVT A;  5LRS A;  2F5V A;  3CUQ B;  1IUF A;  4A3E J;  5BQT A;  4WXD A;  2NVU B;  1FC3 A;  2EB7 A;  2Y48 A;  4MEX F;  2X1E A;  2QSG X;  3I4P A;  3HOW J;  5BPD A;  5CJ9 A;  4U0Y A;  1R22 A;  3OYN A;  3FWE A;  3JSO A;  4L18 B;  2L54 A;  3OIQ A;  3M7G A;  4D1Q A;  1D3Y A;  1MW7 A;  2W24 A;  3ZMU A;  1JT0 A;  4E70 A;  2R7O A;  4CCN A;  5FD5 A;  3J7Z I;  3S14 J;  1UHW A;  5L3F A;  2EPF A;  3QPH A;  4I0A A;  3HHH A;  3BR2 A;  4B4C A;  1ZR4 A;  3CZ6 A;  4WX9 A;  2RVC A;  3ZP5 A;  2A6T A;  1UJ8 A;  4KT6 A;  2PMH A;  4UUS B;  1VQP I;  1Y1W J;  3DV8 A;  2OQR A;  2JQ7 A;  4S04 A;  1V5F A;  1QHH D;  1MNE A;  3LST A;  1RNL A;  4C9Y A;  1DPU A;  1F43 A;  4CDG A;  3LMM A;  3PQJ A;  3JRA A;  4L9J A;  2H09 A;  4UXN A;  1AA7 A;  2L4M A;  3LSH A;  4V19 K;  1HKS A;  3QOE A;  2KRF A;  9ANT A;  2P81 A;  3BG9 A;  4OIO F;  3R4K A;  3S1Q J;  5BNG A;  3RPQ A;  3CMA I;  4A0Z A;  2XAJ A;  3WGH A;  5F1J A;  2JA6 J;  2VKD A;  2HVS A;  1V5E A;  4RS8 A;  4BXU A;  3F23 A;  3WGI A;  2HZT A;  1IF1 A;  2M9H A;  1J7K A;  4XKB A;  4P9U A;  4XON A;  3MD2 A;  3P9I A;  4ZTF A;  1M1E B;  1WJE A;  2V1U A;  4BJT A;  1MNM C;  2F5C A;  2OA4 A;  2P6S A;  4RGR A;  2VQG A;  3V7C A;  4G7H F;  1Z7L A;  1EV7 A;  5B66 C;  1QZE A;  4XOR A;  2OTL I;  1IXC A;  1HA8 A;  4O6J A;  1RR7 A;  3JTH A;  5FO5 A;  5BS6 A;  1D0X A;  3I0T A;  2ZJR F;  4PJJ A;  4J19 A;  1T95 A;  2FQ4 A;  4AYB N;  1ON2 A;  4Y15 A;  4BBS J;  5J8C A;  2CGP A;  2D2W A;  3TO6 A;  2VI6 A;  2WB1 A;  4FET A;  2X6W A;  2JJ7 A;  1JGS A;  4XKW A;  3I64 A;  5HLT A;  3KZY A;  3F8N A;  3FXJ A;  2LY2 A;  3LOC A;  1X1P A;  5CQE A;  2ZC2 A;  4P55 A;  1WHU A;  1W5T A;  4LB5 A;  5EZH A;  1W7P B;  2O0Y A;  2NNN A;  4I01 A;  1GV2 A;  1XSD A;  2XGE A;  4BL0 B;  3HRS A;  3HRM A;  3T8T A;  5IYD J;  2TDX A;  2HYG D;  2DU9 A;  3V8L A;  2Q8K A;  2XGC A;  3RSN A;  2XKO A;  2F5D A;  1SVM A;  2VL8 A;  3SZP A;  2EIM H;  1R58 A;  5KK1 A;  1ZKG A;  2QLZ A;  4BUP A;  3T5X A;  3PQK A;  3BTI A;  3GBG A;  2R7F A;  4OIN F;  2X1C A;  3VYU B;  4LJZ F;  3J81 Z;  2ZXJ A;  2M3A A;  4E7J A;  3FKJ A;  1SEU A;  3ASN H;  4PJN A;  2GM4 A;  2H1L A;  2OAZ A;  3VDX A;  4M74 A;  4FQG A;  1AOY A;  4B44 A;  1H9G A;  2PMZ A;  2BE5 F;  3OV8 A;  1LJ9 A;  2XUB A;  1PP7 U;  1W4M A;  1CF7 A;  3HDD A;  3CMM A;  1VQM I;  2AXL A;  3CJT B;  2F6C A;  1IN5 A;  1YS7 A;  4UVA A;  3U21 A;  3K6G A;  2ADU A;  3OIP A;  4R8H A;  5IT3 A;  3CCS I;  4K2E A;  5KHD A;  1KA8 A;  3DEU A;  3GUD A;  3V7R A;  3M9A A;  1MGT A;  3F8F A;  2VXZ A;  1IN4 A;  4Y13 A;  1GDT A;  4KJZ A;  3ZOB A;  4KMU X;  5GAE J;  4BDZ A;  4S05 A;  1XPX A;  1MZB A;  5K1Y A;  3H92 A;  2QVO A;  2LFB A;  1ZRE A;  1QO0 D;  2DLL A;  5CVR A;  4JQF A;  3J7Y J;  1I50 J;  2DW4 A;  3OYE A;  3AKZ A;  4A3B J;  3ABT A;  3S3O A;  2AS5 F;  2IS4 A;  1IRF A;  2EFP A;  4BBR J;  5JHU A;  3E7L A;  3EUH A;  4E7S A;  3R6S A;  2EFQ A;  2L9R A;  4HST A;  2EZI A;  5B1B H;  1O3S A;  2LG4 A;  3SYT A;  3I55 I;  3WE3 A;  4HOB A;  5CKT A;  2B7E A;  4M3B A;  3BG5 A;  4HQE A;  4G6T B;  4FTH A;  1VQ4 I;  3IP4 B;  3R0A A;  2ZXW H;  2E5Z A;  3HGG A;  3I54 A;  5D5V B;  4V2G A;  5C3E J;  3OR2 C;  3HYI A;  1I3Q J;  4CZC A;  2XGX A;  3AG3 H;  3X2Q H;  4XSZ F;  3ZMT A;  1T6S A;  3VSL A;  5M5X J;  1OCO H;  3A1Y A;  2HZD A;  4HG2 A;  3ZMD A;  2I5U A;  2HTJ A;  2COM A;  1K6Y A;  2O8X A;  3M4O J;  2LRD A;  5FLM J;  4A0Y A;  5ICC A;  4KDP A;  5HS9 A;  5IOZ A;  1V54 H;  3MKW B;  4MHG A;  5GTH C;  3BC8 A;  4BGD A;  1OFC X;  3W3C A;  6PAX A;  3FZV A;  1JXS A;  1X2M A;  3TKY A;  5EEG A;  1FOX A;  1GXQ A;  3U9G A;  3IHU A;  2ME6 A;  3LA2 A;  3HZJ A;  3OOU A;  1MH4 A;  1S3J A;  4P96 A;  3OYA A;  3ISP A;  2KDZ A;  2Y30 A;  1IAW A;  3QWL A;  4CCL A;  3ASO H;  3BG7 A;  3SQN A;  3MFK A;  3ZQG A;  1BC7 C;  5ED4 A;  1YIJ I;  2ZKZ A;  3M07 A;  1RUN A;  1CQT A;  3T1B A;  1X1D A;  1MH3 A;  2VE9 A;  2RV8 A;  2TCT A;  2CQQ A;  4HYE A;  4JP0 A;  4RGU A;  4M71 A;  4NQW A;  5F04 A;  3TOB A;  1A31 A;  2XHK A;  3GFI A;  2F4M B;  3LSK A;  5DCF A;  3ZR8 X;  5A2Q K;  3IRQ A;  2OJE D;  2PFB A;  4A2U A;  2IA2 A;  2M4K A;  4AIJ A;  4E7H A;  1FSE A;  4JK1 X;  3WTY C;  1WSU A;  4CHU A;  1S7A A;  2DO7 A;  3OYK A;  2GOM A;  1K7A A;  1C0W A;  5HVQ C;  3KE2 A;  2HYJ A;  3DEE A;  1FZP B;  1T0F C;  2GIZ A;  5EG0 B;  3BWG A;  1OJL A;  1OCC H;  1S7E A;  2CW0 F;  4IVN A;  2CJJ A;  2JT1 A;  4CYD A;  3JAM Z;  3DLL F;  2DK5 A;  4BS9 A;  2D1H A;  1E3H A;  1FOW A;  4JX4 A;  3ZMS A;  3B02 A;  1FBS A;  2WY7 Q;  3H9Q A;  4A3L J;  3RJP A;  4D5F A;  2ZJ2 A;  1ZN2 A;  3HRT A;  4DZJ A;  5HOD A;  2V1D A;  4FX0 A;  1CF7 B;  2HOT A;  2MH9 A;  3SJM A;  1MJB A;  1E3P A;  1WJC A;  4EJT A;  2HPI A;  2CWE A;  3CC7 I;  1X1C A;  5KNL A;  1HQC A;  1S29 A;  1MDM A;  5HDG A;  3O6B B;  1QGP A;  1FIA A;  4E7Z A;  3F22 A;  2W25 A;  3ZPL A;  4ENJ A;  4ENN A;  4IHS A;  2E1N A;  5JLW A;  2YPR A;  4BAY A;  4CYC A;  4HEA 2;  1P4X A;  3K7A J;  1R6R A;  1U0J A;  2LRE A;  1SD5 A;  1J9I A;  2FOK A;  1ON1 A;  2L3D A;  4XOT A;  4IOA F;  2DTR A;  3H35 A;  3H5A A;  2LY9 A;  5GAD J;  2EV0 A;  2HQR A;  4I02 A;  2BGC A;  4Y52 J;  2HDC A;  1IW7 F;  2DAO A;  4ITV A;  3M1C A;  1ETQ A;  4ZZL A;  1MJA A;  3WHC A;  2VT2 A;  4UB8 C;  2CFO A;  4BQN A;  5JLX A;  3EQL F;  2ZME C;  2DMP A;  3BT9 A;  3V8K A;  4G94 A;  3GCM A;  4GGG A;  4RAF A;  2E5N A;  1FTT A;  2Q0O A;  1P9Q C;  5ILS A;  1BW5 A;  4L5I A;  3HSR A;  5F0H A;  4DIQ A;  2RC4 A;  1SVL A;  1FLI A;  4KA4 A;  2XB0 X;  3LAP A;  2OTJ I;  4NUB A;  2UZK A;  4RB3 C;  3BTC A;  1I6H J;  4BQQ A;  3P9C A;  2DPD A;  2COB A;  2LF8 A;  4CIC A;  1ETW A;  1DUX C;  1T08 B;  4DQ2 A;  3FDY A;  3IC7 A;  3LQR A;  4IQ4 A;  5M5Y J;  3NWT A;  1IZ1 A;  2VJI A;  1LB2 A;  5E79 C;  4RAY A;  1D5V A;  1RES A;  1BM9 A;  2OCC H;  3S1R J;  1FEX A;  5HS7 A;  1OCT C;  2H94 A;  1WJA A;  2X85 A;  4W97 A;  4HNU A;  3N97 A;  1MMS A;  5KAI C;  4L5E A;  3TGN A;  5IP7 J;  2Z16 A;  1J0R A;  2V1X A;  3I4M J;  3G1L A;  3LSR A;  3AL0 C;  3SZG A;  3WU2 C;  2HEO A;  1FMW A;  3M3Y J;  4EGZ A;  3IWZ A;  3GYH X;  5EDN A;  3NAR A;  4B8X A;  1S9H A;  3D5S C;  2KT0 A;  1ZG1 A;  1PP8 F;  5L3B A;  2XF6 A;  1D1B A;  1E2X A;  5CYV A;  3K1M A;  3TP3 A;  1JE8 A;  3KFW X;  5D6E A;  2JZY A;  1HBX G;  2H1K A;  1XCV A;  4MNU A;  2KP6 A;  1MBE A;  3FF5 A;  3ZMZ A;  4M3D A;  1BN5 A;  5TJJ A;  3HHG A;  1Z3X A;  4KIF A;  4NQW B;  4M72 A;  2IP2 A;  2MAB A;  4BEH A;  2XSD C;  4A3F J;  2HKO A;  2PN6 A;  1KZH A;  4B09 A;  3DBH B;  2R0Q C;  4EJV A;  2DA6 A;  3BTJ A;  4PGH A;  3HOV J;  4JX5 A;  1FOY A;  2PJR A;  2DMU A;  2EZL A;  3PUF A;  3DF8 A;  2Q2E A;  3KYC B;  4YG2 F;  4HRI A;  4NHJ A;  2GXA A;  1JUP A;  4BE1 A;  3V4G A;  1IDZ A;  5EGO A;  4FHT A;  4S0H B;  1RPW A;  2HWV A;  5KVR A;  1D1C A;  2MA3 A;  4DNC A;  3S93 A;  3FXO A;  4XRS A;  2IGM A;  3LFU A;  4EM0 B;  4ESJ A;  4PDK A;  2DXI A;  2Y31 A;  1KU9 A;  5TRD A;  4NC7 A;  1S5L C;  1X4P A;  3HPG A;  4XLN F;  4HPQ A;  3DTE A;  5CLS A;  2DA7 A;  2ISY A;  2YX4 A;  3CCL I;  2CV1 A;  1GV5 A;  2XPU A;  4E4H A;  3UR3 C;  1KYZ A;  1OIS A;  3E97 A;  1SVO A;  5E8G A;  3CUQ A;  1MDM B;  4A3C J;  2IS6 A;  2FJ1 A;  5D8L B;  1R7J A;  2E60 A;  5FRM A;  1KON A;  4EGY A;  4BE2 A;  4WCG A;  2V9V A;  3MKZ A;  3LA7 A;  3F9K A;  4XLC A;  2R7R A;  2VOD A;  3CCV I;  3BQY A;  2DA5 A;  2CUZ A;  3K4J A;  5IOY A;  5AIP A;  1L3L A;  1ZGW A;  3G71 I;  2NVT J;  4YFX F;  2ACJ A;  1EF4 A;  2L5Q A;  3DBL B;  3PJR A;  2A6E F;  1QVU A;  2LC2 A;  3J81 K;  2CUJ A;  2K27 A;  2E1O A;  5D5U B;  2V9K A;  2EIK H;  3H5N A;  2R7Q A;  3ECO A;  3HOT A;  1FBU A;  2W57 A;  5GTI C;  3GVA A;  4GXO A;  1OCZ H;  2XB5 A;  4UVB A;  1S8N A;  3CCJ I;  4X6A J;  3DKW A;  3SZT A;  1YIT I;  4AM3 A;  1A6Q A;  3GFM A;  1LEB A;  4M3F A;  2JA2 A;  3N4M A;  2GBY A;  2QM3 A;  3DEW A;  2WB1 N;  1EH6 A;  3MMY B;  3TQN A;  1VQ5 I;  2ECC A;  2V7F A;  3VB2 A;  1H0M A;  3LQQ A;  1PYV A;  4WXC A;  4XSX F;  4KIT B;  2R7Z J;  2BV6 A;  1BI0 A;  2GOX B;  3CLO A;  3H9J A;  4I0B A;  3L00 A;  1AHD P;  4KUM A;  3CJN A;  2V26 A;  3IKT A;  2DMT A;  3SFZ A;  3CJQ B;  2VE8 A;  1FMV A;  4OAY A;  1LNW A;  1U8R A;  4LD5 A;  4CCM A;  2NYX A;  1TWH J;  5TGT A;  1FOK A;  1TQP A;  4HBL A;  3GLX A;  2VKH A;  1XMX A;  2NXN B;  4HA8 A;  2WA0 A;  4XQF A;  5E18 F;  5JVT A;  2E34 A;  2XAG A;  5B1A H;  3KP5 A;  1XSX A;  1MSF C;  2Y75 A;  1MBK A;  2KIU A;  2VQH A;  2FOW A;  4YFK F;  2KIS A;  4AIK A;  1ETK A;  1TZL A;  1Y8R B;  3WTX C;  3ABU A;  4MFD A;  2PG4 A;  3HSF A;  4MQV A;  5IPA A;  3GZ6 A;  3H36 A;  5DUI A;  1IRG A;  2B0L A;  1XGN A;  2EFN A;  4JBA A;  4BQA A;  1XSV A;  2WWY A;  1QNT A;  2EWN A;  1DGW Y;  2ZSH B;  1FP2 A;  1XTA A;  1Y56 A;  2PMZ N;  5E1Z B;  4OAZ A;  2R92 J;  5B3S H;  5DM7 F;  4ABZ A;  4RDU A;  3KPH A;  1FYM A;  1BR1 A;  2E2J J;  1UMQ A;  2QZ8 A;  4BEH B;  1W7P A;  1FSH A;  1WQ2 A;  2IS1 A;  3RYP A;  1G3Y A;  3ECH A;  2FQ3 A;  2XGD A;  3RKW A;  3BRO A;  3JRB A;  4U7D A;  1NTC A;  4PCQ A;  1MMN A;  3D5L A;  2XAF A;  4UVC A;  1STZ A;  1P6R A;  4F92 B;  2STW A;  2I8D A;  1D1A A;  2ZFU A;  5ICF A;  4EM1 A;  3GWZ A;  3E6D A;  2RQQ A;  3ERE D;  2W85 A;  2K7L A;  3C18 A;  5EGO B;  2CU7 A;  5FRO A;  2ISZ A;  1X58 A;  4IX7 A;  4L9T A;  2LVS A;  2HXI A;  3RZD J;  1Z7U A;  3O3K A;  1SFE A;  2W84 A;  4MQ9 F;  3IKV A;  3WU0 A;  1EH7 A;  1KU7 A;  5F1R A;  3A01 A;  3IL2 A;  3RTR A;  2LF7 A;  1LFU P;  5DDG A;  4EVI A;  2GZW A;  5BPI A;  1B9N A;  3FBN B;  3OS1 A;  3VOD A;  1QHG A;  2XDV A;  1BR2 A;  4F91 B;  2WV1 A;  1Y6I A;  4RGS A;  1Z21 A;  4MO7 A;  2XAH A;  4XOP A;  2H27 A;  3S2W A;  4KFC A;  1ZH5 A;  3OYH A;  3AFH A;  1QRY A;  5LRR A;  1XG1 A;  2XRL A;  5LD2 C;  4P9F A;  4A5N A;  3U2R A;  1BJZ A;  4ESB A;  1IUY A;  2E35 A;  1W1W E;  3BCB A;  1N77 A;  1P7J A;  2FX0 A;  1ZAO A;  2O7O A;  2YX7 A;  1TT0 A;  4XKV A;  1UG2 A;  1ZYR F;  5CVU A;  2HKX A;  5DCM B;  4A69 C;  3JAM K;  1R71 A;  3F21 A;  3HOU J;  3V42 A;  3RCO A;  2QSH X;  4B1R A;  4PJM A;  3BG6 A;  2XV4 S;  3CLQ A;  5K5Q A;  3PM1 A;  2IT0 A;  1MKM A;  2NVY J;  3F8M A;  3KIO A;  2CV0 A;  3UKG A;  4C2T A;  3W2W A;  2WTE A;  4RM2 A;  3FK7 A;  2ESH A;  3Q0U A;  1EJ9 A;  2M30 A;  3HOS A;  3BR6 A;  2FF4 A;  1SMT A;  2FBH A;  2MC3 A;  3HGY A;  4XM3 A;  2XRN A;  3F6V A;  2CW8 A;  4UY8 I;  1SAU A;  2PJP A;  3E1S A;  4AVZ A;  3ROU A;  1U5T A;  1U2W A;  2LH9 A;  1ZRF A;  3MVP A;  2X0L A;  5ICE A;  2FUG 2;  3KP3 A;  2XAS A;  4BE0 A;  2ZB9 A;  2XF5 A;  1J09 A;  4KIG A;  4B3X A;  2L9N A;  3CDH A;  3RPU A;  1YS6 A;  4AWX B;  1MMA A;  1WJ5 A;  3K1N A;  4FCY A;  1U9N A;  3B6A A;  4OIP F;  2ECB A;  2MD0 A;  3OR1 C;  2DYS H;  1XCB A;  2BY3 A;  3BR5 A;  3G73 A;  1JKO C;  2BOL A;  2EA2 A;  3I58 A;  3S1N J;  4ZYG A;  2EH3 A;  2NS0 A;  3LNQ A;  4BQO A;  1JJ8 C;  1X1A A;  2A3S A;  3PO3 J;  1B9M A;  1P92 A;  3AG1 H;  1X1B A;  4DGW B;  4HX8 A;  2GA2 A;  1YE9 A;  4II2 A;  1JUM A;  1IN6 A;  3ZN1 A;  1I39 A;  5LGN A;  2JSP A;  4HNV A;  2O6G E;  1LFB A;  2M4G A;  2R5Y A;  2BY1 A;  3BZ6 A;  4UV9 A;  1S72 I;  2RAE A;  2PX9 A;  3FHZ A;  2EFO A;  3SXY A;  2P5K A;  3MZY A;  3R0J A;  3KYL A;  1JHF A;  2LD5 A;  2DCE A;  5FKL A;  3SFI A;  4BJ5 C;  4IL6 C;  2W7N A;  3CCY A;  1R5H A;  3FMS A;  1ZQ3 P;  1JTX A;  4C2U A;  1JKR C;  1BOA A;  2IA0 A;  1LQ1 A;  4UUT A;  3OYM A;  4NC6 A;  1MD0 A;  2DOA A;  5DUK A;  3QP5 A;  2R7W A;  4FX4 A;  1GVD A;  3GFL A;  1KU2 A;  5F6F A;  3RKX A;  1KQ8 A;  4BHB A;  2A05 A;  3ONQ A;  5DD4 A;  4BU2 A;  4C3J J;  2M1B A;  5ICG A;  5JI6 A;  4GFB A;  4PJ0 C;  2V9P A;  1LDJ A;  1D8J A;  3L09 A;  5EG0 A;  1MBH A;  2DI3 A;  1ZRC A;  1QPI A;  1KQ9 A;  3PUB A;  3ZQF A;  2L7M P;  3OY9 A;  2XAU A;  5FLV A;  2H8R A;  1U9O A;  2M7B A;  1PJR A;  3RQ4 A;  1XC5 A;  1B6A A;  2DJN A;  3K0L A;  2R5Z A;  5FRN A;  3K69 A;  2E1M B;  3IH4 A;  2QEN A;  1BI3 A;  3A01 B;  4D7M A;  1YIO A;  3QRF F;  3R60 A;  4EJO A;  4XLF A;  4XL9 A;  4LMY A;  5HS8 A;  2J5P A;  3RYR A;  3H3U A;  2RNG A;  2F2E A;  1O7F A;  3VSK A;  5C4X J;  3T8R A;  3K4K A;  1OMI A;  4BJ6 C;  1UST A;  3W6J B;  1K4T A;  5DV5 A;  3VYR B;  2DA1 A;  3DKX A;  2HDW A;  4A0X A;  2O5R A;  1BBY A;  1WH7 A;  2DQL A;  4I76 A;  4XNF A;  5FJ8 J;  4PK4 A;  3HM5 A;  4EQQ A;  3IRR A;  4KMF A;  1RET A;  1LVA A;  4HV6 A;  4EMS A;  1QZY A;  1B72 A;  5F27 A;  1LDK B;  3OIO A;  2PQ8 A;  1ENH A;  5F64 A;  2BVM A;  4UHT A;  2G7U A;  1F4K A;  5F0C A;  1B8I A;  3Q9S A;  5LHG A;  3LWF A;  3O8G A;  1REP C;  5GAG J;  2ETH A;  2NVX J;  4B48 A;  3L2V A;  3G4S I;  3V7S A;  4H0E A;  3RKY A;  1ITY A;  1R9T J;  3ERM A;  3HKZ N;  3HOX J;  3W6V A;  2JA8 J;  1WWX A;  5FKO A;  4ZJZ A;  2VJ5 A;  1T38 A;  2FNA A;  5IT9 K;  2QUF A;  3WG7 H;  4WK8 F;  4EJW A;  1MBG A;  3WTU C;  1BL0 A;  1S6L A;  4EAT A;  1U5T B;  1UEL B;  3DXJ F;  4FE4 A;  2FBI A;  3BDD A;  3N05 A;  4XLE A;  3KEQ A;  4DOZ A;  1OYW A;  3REO A;  1NG7 A;  4HAM A;  2BW3 B;  3I53 A;  4LOC A;  1B59 A;  4NNJ A;  3HBL A;  1K61 A;  2AQE A;  2JVH A;  3W2V A;  5LHH A;  2CFX A;  2FEZ A;  1OCR H;  1WRJ A;  2IJL A;  1HKT A;  2CUE A;  2DJI A;  3E5X A;  4IO9 F;  5EEH A;  3FXK A;  2VC0 A;  1IV8 A;  1RC9 A;  3DPL C;  1DP3 A;  3KX2 A;  2LKX A;  4D5C A;  2VXD A;  1D5Y A;  3ZQI A;  3GFJ A;  1R00 A;  1B1B A;  2KRC A;  2P5V A;  3S3M A;  2J5O A;  4DYC A;  2QBY A;  2DTZ A;  2XKP A;  3D0S A;  2Z33 A;  4A3M J;  2JRT A;  4RAG A;  2R5Y B;  2CSO A;  4Q47 A;  1VQ9 I;  4OIR F;  2BVL A;  2MW8 A;  1J2X A;  3OMY A;  2MC4 A;  4PFP A;  2KMU A;  4LG0 A;  2VJJ A;  1DU6 A;  5EYR A;  1OCP A;  2H6B A;  2KZG A;  2R7S A;  2H6C A;  1DGR M;  2V1N A;  3PNY A;  5H6R A;  1EA3 A;  5J1Y A;  4RB1 A;  2PBI A;  3WTV C;  2IPQ X;  3ZQQ A;  4A6E A;  4L5J A;  5D4S A;  2NNY A;  3PFY A;  4MEY F;  4WWC A;  1RZ4 A;  3L2W A;  2M8E A;  3W6K B;  4KIC A;  2FML A;  2EQR A;  1YO5 C;  4B47 A;  1KYW A;  4ZH4 F;  3E3V A;  2CW7 A;  4ANJ A;  1OR7 A;  2HOA A;  2XVC A;  4PSX A;  2B63 J;  3I4N J;  3FIW A;  4I99 C;  1R36 A;  2DT6 A;  3I56 I;  4ZYE A;  2M8G X;  3C3W A;  1R1U A;  2O61 A;  2HGC A;  4YIR X;  3CC2 I;  1F1Z A;  3FM3 A;  3JTG A;  2JA7 J;  1QU3 A;  3J80 K;  2K86 A;  3PFI A;  2HU9 A;  4ZTJ A;  1YOV B;  1R49 A;  3VYT B;  3IV5 A;  2Y0S A;  5K5R A;  4BY7 J;  2R5Z B;  4WXH A;  2LLK A;  3L2U A;  4IEJ A;  1V3F A;  1I1S A;  4U87 A;  1HDP A;  1YW7 A;  2L02 A;  3MZ8 A;  1PDN C;  3OYB A;  5E3M A;  4XIC A;  1UFM A;  2OV7 A;  2QA4 I;  1H9T A;  3CCR I;  1G2H A;  3WU1 B;  4CA0 A;  2Y69 H;  2LTP A;  2ZXH A;  1E17 A;  2PI0 A;  2BXZ A;  1AWC A;  3JRD A;  4QTR A;  2M0M A;  3S17 J;  3MKL A;  5EF6 A;  2ZME B;  1HKQ A;  4C3H J;  1RKW A;  1LE8 A;  4ZZD A;  4Z2Y A;  4DYQ A;  1B72 B;  2NS8 A;  3C7J A;  4QIW N;  3GXO A;  3BG3 A;  4OMY A;  1KU3 A;  4CCK A;  2DOD A;  3F3X A;  4M9S A;  2R7U A;  1K83 J;  5L3D A;  1KGS A;  2JUG A;  2AQF A;  1B8I B;  4IF4 A;  4RAZ A;  1JUS A;  2QWW A;  2IRF G;  5H2F C;  3MAJ A;  2DDA A;  3R61 A;  3ZRG A;  3J7A O;  5J4Y A;  1VTN C;  1W36 C;  1Y8Q B;  5E8I A;  5JFR A;  1X4O A;  2E19 A;  2G0E A;  1T33 A;  4BDY A;  4YII A;  3ULQ B;  1HW1 A;  3BJO A;  3GTG J;  3I71 A;  3BR1 A;  3GTP J;  2W00 A;  2LSO A;  3WTW C;  1WZ2 A;  1HW5 A;  2MH2 A;  2VC1 A;  3MCZ A;  3NAU A;  2FSW A;  2KHM A;  1QQI A;  1Z1D A;  2YS9 A;  2GIV A;  2KIM A;  2TRT A;  5IYB J;  3L7W A;  3OWT A;  1G3W A;  3HG9 A;  4HZF A;  1HCR A;  5GPA A;  3AG4 H;  1R5G A;  1VQ7 I;  4AVP A;  2OUM A;  1ETX A;  3F6O A;  1R4M B;  1T98 A;  3HSE A;  1BI2 A;  1USS A;  3QAH A;  5L3G A;  2L4A A;  4W1U A;  1W36 D;  3ABK H;  2QEX I;  1X3U A;  2OD5 A;  3GME A;  3BPX A;  1YX3 A;  3CP8 A;  1XMA A;  2RN7 A;  3NRV A;  3G6E I;  5HNH A;  3EUH C;  4C2M J;  2L2O A;  2JN6 A;  2Y2Z A;  4IRH A;  3JRC A;  1G6N A;  4DZP A;  5J40 A;  4M6Y A;  2QBY B;  2HVQ A;  3F0C A;  2BY2 A;  2QCO A;  3PNV A;  1IN8 A;  2KRH A;  1ZLK A;  1XD7 A;  3FM5 A;  2DDB A;  3BJ6 A; 
#chains in the Genus database with same CATH homology
 5CVI A;  3E6C C;  1I1G A;  2VON A;  4LG0 B;  2CQK A;  2YSR A;  4QWQ A;  2FMY A;  5D4R A;  3JW4 A;  3WGG A;  2RQP A;  2E1C A;  2EV5 A;  4G8X A;  4ETS A;  2R3S A;  1QPM A;  4I7H A;  5BOX A;  4L9N A;  4U88 A;  2VBY A;  3H3Z A;  1FT9 A;  3QP6 A;  4KNY A;  4G9Y A;  1I5Z A;  3WOD F;  3MQ0 A;  2FNP A;  3NEU A;  2E7W A;  3FXR A;  5IT9 Z;  2NRA C;  1TW3 A;  1W5S A;  5D6F A;  1O7L A;  2HFH A;  2C6Y A;  4HF0 A;  5FFZ A;  4UUV A;  2BEO A;  2ZBK A;  1RIO H;  5DCM A;  1S7O A;  4BHP A;  1EH8 A;  1ZG5 A;  4P5O A;  1HSJ A;  3LA3 A;  3TOA A;  1FY7 A;  4G6Q A;  1ONV A;  2A69 F;  3BP8 A;  1F5T A;  5FLX Z;  1K79 A;  3CO6 C;  1ZAR A;  3TDU C;  1BI1 A;  5J6X A;  4F7Z A;  4XRF A;  4N9I A;  2DBB A;  3P9K A;  4BHC A;  3KEO A;  1YFH A;  2P7V B;  3KP6 A;  5LLQ A;  1R23 A;  1TBX A;  3FXU A;  1U78 A;  4ENK A;  3F72 A;  1TNT A;  2GWR A;  2KJB A;  3J80 Z;  2HYF A;  4OOI A;  4ESF A;  4R1H A;  4HX4 A;  1KQ0 A;  1Z05 A;  3ZQ7 A;  3SHF A;  4BH9 A;  4HX7 A;  1Z6R A;  1ZGA A;  3CO7 C;  5FGM A;  5J8F A;  1Z9C A;  1ZLJ A;  2O03 A;  2FA5 A;  3FX3 A;  3M8F A;  1O57 A;  2XIG A;  5L3C A;  2JTV A;  5LBQ A;  2GAU A;  5CVJ A;  3FXQ A;  1XGM A;  1UCR A;  3EDP A;  1FNN A;  3ZMV A;  2QQA A;  1OPC A;  2KKO A;  4LLN A;  4LK1 F;  2LKP A;  3HTS B;  4EJU A;  1XDU A;  2E7X A;  2MLG A;  3TO9 A;  2MD5 A;  3QOP A;  4IPA A;  2PLY A;  5LEK A;  2M87 A;  2K4B A;  1YYV A;  4YFN F;  1MJ9 A;  5LGU A;  1GXP A;  3M8E A;  2V79 A;  3DPT A;  3VOE A;  3HRU A;  4ENM A;  4HF2 A;  1U6G A;  3AAF A;  1XGO A;  1G4D A;  2P8T A;  3KLO A;  5E1W A;  3EET A;  5HLG A;  3WTT C;  2K4J A;  1JHH A;  4I09 A;  3CUQ C;  4N9H A;  2M5W A;  4U7B A;  2FBK A;  1XB4 A;  1SD6 A;  2QQB A;  2YR2 A;  1TQI A;  2V6C A;  5FB2 A;  4A6D A;  3ML6 A;  1ZGJ A;  2EJR A;  3EYI A;  5HLH A;  2VBX A;  3VEP A;  5H20 A;  1UB9 A;  4FT8 A;  3GEZ A;  4LK0 F;  1CGP A;  4U0W A;  5AIQ A;  4I98 B;  1BJA A;  4BYY A;  3WTZ A;  1YTY A;  4KN4 X;  4EV0 A;  1HW2 A;  1T0F A;  2GXB A;  3KLN A;  2O3F A;  1BIA A;  4OU0 A;  1FX7 A;  3L9F A;  2RDP A;  3CUO A;  3I5U A;  2EK5 A;  2EFW A;  4CO8 A;  2L01 A;  1UHM A;  4TV7 A;  4KN7 X;  2VBW A;  1DP7 P;  2ZCW A;  3GF2 A;  1SD4 A;  2DQR A;  2HS5 A;  2YU3 A;  2FE3 A;  4HV5 A;  5D5X B;  1GHC A;  1TNS A;  1FYL A;  1P4A A;  1FPQ A;  3U1D A;  1GVJ A;  4CZZ A;  1B4A A;  4LFU A;  4OIQ F;  3F8B A;  2ZME A;  5DD8 A;  3QPT A;  3I59 A;  3KZZ A;  5HOO A;  3EYY A;  2GXG A;  3M1E A;  5ERI A;  2XRO A;  3V8J A;  2OZ6 A;  3FMQ A;  1IXR C;  4L0Y B;  2EV6 A;  1W7P D;  1RUO A;  1A04 A;  2LNB A;  4RB0 A;  1ZHF A;  4PGG A;  1Z6T A;  1R1V A;  3OOP A;  3TDZ C;  1BIB A;  2MLK A;  1O3R A;  1G3T A;  3BY6 A;  3IWF A;  2P4W A;  1LDD A;  2G9W A;  4O5V A;  4RB2 C;  1I6X A;  4L0Z B;  2DT5 A;  2JPB A;  4PZJ A;  4ASN A;  2ESN A;  2VOP A;  2BBY A;  1ODD A;  4GO1 A;  2KIF A;  5BMZ A;  1ZRD A;  4AD9 A;  3E5U A;  3C1D A;  4ON0 A;  4IRI A;  3WTS C;  1T2K A;  2VN2 A;  5FLX K;  2UWM A;  1U5T C;  4M9X A;  3QU3 A;  2OZU A;  2HOE A;  2HTS A;  2RGV A;  1HST A;  4HLY A;  3RIR A;  4KYW A;  2A5Y B;  5E20 A;  4KIB A;  1F9N A;  3F8C A;  4LLL A;  2P7C B;  1K6O A;  3DFG A;  2FU4 A;  4HF1 A;  1G3S A;  3QU6 A;  4MGR A;  1SFU A;  2JSC A;  1SFX A;  5HDN A;  1TQM A;  2A6H F;  4A12 A;  3JSP A;  1PUE E;  3O2P E;  4M73 A;  3MWM A;  3HTU A;  2XAQ A;  2STT A;  2BYV E;  4QLC U;  4HDU A;  5ILV A;  2QQ9 A;  4I2O A;  1DDN A;  3CTA A;  3I59 B;  2Z99 A;  1YQA A;  2DK8 A;  3KP2 A;  2VBZ A;  3B73 A;  5HDK A;  2VOO A;  2X4H A;  3ZN0 A;  2Y0M A;  1NHA A;  5D8K B;  3BOQ A;  1Z91 A;  4G6D A;  4EM2 A;  1TW2 A;  3WG9 A;  2F5F A;  2IVM A;  4LLG F;  1O3Q A;  1J75 A;  3KP7 A;  5DEQ A;  2Z5U A;  1YLF A;  4IXA A;  2ZO4 A;  3GZ5 A;  4HDV A;  4CXF A;  3E6M A;  4A5M A;  1WKM A;  4MTE A;  1BC8 C;  5LGT A;  2PEX A;  2UXN A;  4Q5S F;  3RI4 A;  5LHI A;  4UV8 A;  4IRG A;  3NQO A;  2R7D A;  1U3E M;  5E17 F;  2A07 F;  4XLP F;  3KP4 A;  4Q48 A;  1O3T A;  1SAX A;  4D0P A;  1FWZ A;  1HXD A;  2K02 A;  3BPV A;  2HQN A;  4OMZ A;  2Z9O A;  3GW2 A;  5D5W B;  1OKR A;  4GYG A;  1YG2 A;  1J59 A;  3FMR A;  2OQG A;  2F5E A;  2A68 F;  2FXA A;  1XMK A;  1SMY F;  1D8K A;  2DFI A;  2D1V A;  2CG4 A;  3HUG A;  1XN7 A;  4ZYD A;  2DPU A;  1SD7 A;  5L3E A;  4ZYH A;  2OBP A;  1YW8 A;  2ZNY A;  3K9T A;  5DYM A;  3E5Q A;  2WC2 A;  4BNC A;  2P6T A;  1I27 A;  1XDS A;  4G7Z F;  1K78 A;  4Q4Z F;  5AON A;  1QBJ A;  4GYI A;  2PMU A;  5H6Q A;  2NAZ A;  4MTD A;  1P4W A;  2ELH A;  4XBF A;  1YW9 A;  3LAJ A;  1DPR A;  4HW0 A;  2CYY A;  4Y17 A;  3LFK A;  3P7N A;  3MZH A;  5JR3 A;  4AIH A;  1IXS B;  2OU2 A;  3K1P A;  2VT3 A;  3GX4 X;  1XGS A;  3K2Z A;  3L2C A;  3KCC A;  4HLX A;  4U0V A;  4IJA A;  3MEX A;  1FP1 D;  1TLH B;  4GCV A;  2M45 A;  5CVV A;  1L0O C;  1FBQ A;  3DP7 A;  1Y0U A;  3GO5 A;  3DQV C;  4RGX A;  5HLI A;  3KET A;  2EA4 A;  5E1X A;  1R1T A;  1FYK A;  2D45 A;  2LDU A;  1J5Y A;  3WE2 A;  5LEJ A;  2MBF A;  2G7H A;  3HIF A;  5FFX A;  4M9Z A;  5ILU A;  5A2Q Z;  3Q9V A;  2P5L C;  4LB6 B;  3ELK A;  4NB5 A;  4WF2 A;  4L9V A;  3T0Y A;  1ZG3 A;  4R79 A;  2GA1 A;  2QYO A;  2FRH A;  1P2F A;  2A61 A;  2UXX A;  4LGW A;  4CGZ A;  4HQM A;  5K5O A;  4IHT A;  3COA C;  5FD6 A;  2GQQ A;  1QZZ A;  2WV0 A;  4KT5 C;  4O3M A;  3BJA A;  2CO5 A;  1OYY A;  2Z3Y A;  1WI9 A;  4N0B A;  2RKH A;  1OYI A;  1ULY A;  3E6B A;  2IA1 A;  1LEA A;  3VFZ A;  2ZFW A;  3RDI A;  1IN7 A;  1RI7 A;  2KJC A;  4YIF A;  4UNO A;  4G7O F;  4M6X A;  2IW5 A;  2RNJ A;  1V4R A;  1TTY A;  1T39 A;  1Q1H A;  3Q5F A;  2HR3 A;  2JPC A;  3G3Z A;  2ZNZ A;  1K78 B;  3TO7 A;  5LRS A;  3CUQ B;  5BQT A;  4WXD A;  1FC3 A;  2EB7 A;  2Y48 A;  4MEX F;  3I4P A;  5BPD A;  5CJ9 A;  4U0Y A;  1R22 A;  3FWE A;  3JSO A;  4L18 B;  2L54 A;  3M7G A;  1D3Y A;  2W24 A;  3ZMU A;  4E70 A;  5FD5 A;  1UHW A;  5L3F A;  3QPH A;  4I0A A;  3HHH A;  4WX9 A;  2RVC A;  3ZP5 A;  2PMH A;  3DV8 A;  2OQR A;  4S04 A;  3LST A;  1RNL A;  1DPU A;  4CDG A;  3PQJ A;  4L9J A;  2H09 A;  4UXN A;  2L4M A;  1HKS A;  2KRF A;  4OIO F;  3R4K A;  3RPQ A;  4A0Z A;  2XAJ A;  3WGH A;  4RS8 A;  3F23 A;  4BXU A;  3WGI A;  2HZT A;  1IF1 A;  1J7K A;  4P9U A;  3P9I A;  2V1U A;  2F5C A;  2OA4 A;  2P6S A;  4RGR A;  3V7C A;  4G7H F;  1EV7 A;  1HKT A;  1IXC A;  4O6J A;  3JTH A;  5BS6 A;  5FO5 A;  3I0T A;  1ON2 A;  4Y15 A;  5J8C A;  2CGP A;  2D2W A;  3TO6 A;  1JGS A;  3I64 A;  3KZY A;  3F8N A;  4P55 A;  1W5T A;  4LB5 A;  1W7P B;  2O0Y A;  2NNN A;  4I01 A;  1XSD A;  3HRS A;  3HRM A;  3T8T A;  2TDX A;  2HYG D;  2DU9 A;  3V8L A;  2Q8K A;  2XKO A;  2F5D A;  3SZP A;  1R58 A;  5KK1 A;  2QLZ A;  3T5X A;  3PQK A;  2R7F A;  4OIN F;  3J81 Z;  4LJZ F;  2ZXJ A;  2OAZ A;  4M74 A;  1AOY A;  1H9G A;  3OV8 A;  2BE5 F;  1PP7 U;  1LJ9 A;  2XUB A;  1W4M A;  1CF7 A;  2AXL A;  1IN5 A;  1YS7 A;  4UVA A;  2ADU A;  4R8H A;  5IT3 A;  4K2E A;  1KA8 A;  3DEU A;  3GUD A;  3V7R A;  3M9A A;  1MGT A;  3F8F A;  2VXZ A;  1IN4 A;  4Y13 A;  4KMU X;  4S05 A;  1MZB A;  5K1Y A;  3H92 A;  2QVO A;  1ZRE A;  1QO0 D;  2DLL A;  5CVR A;  4JQF A;  2DW4 A;  3ABT A;  2AS5 F;  1IRF A;  2EFP A;  5JHU A;  3EUH A;  3R6S A;  2EFQ A;  1O3S A;  3WE3 A;  4HOB A;  4HQE A;  3R0A A;  3I54 A;  5D5V B;  3HYI A;  2XGX A;  4XSZ F;  3ZMT A;  1T6S A;  3ZMD A;  2HTJ A;  2COM A;  2O8X A;  4A0Y A;  5ICC A;  4KDP A;  5HS9 A;  4MHG A;  6PAX A;  3FZV A;  1JXS A;  3TKY A;  5EEG A;  1GXQ A;  3U9G A;  3IHU A;  3LA2 A;  1S3J A;  4P96 A;  3ISP A;  1IAW A;  3MFK A;  3SQN A;  1BC7 C;  5ED4 A;  2ZKZ A;  1RUN A;  3T1B A;  2VE9 A;  2RV8 A;  4HYE A;  4RGU A;  4M71 A;  4NQW A;  3TOB A;  2XHK A;  3GFI A;  5A2Q K;  5DCF A;  3IRQ A;  4AIJ A;  2PFB A;  4A2U A;  2IA2 A;  4CHU A;  1FSE A;  4JK1 X;  3WTY C;  1WSU A;  1S7A A;  2DO7 A;  1K7A A;  1C0W A;  5HVQ C;  3KE2 A;  1FZP B;  3BWG A;  4IVN A;  4CYD A;  2CW0 F;  2JT1 A;  3JAM Z;  2DK5 A;  2D1H A;  3ZMS A;  3B02 A;  1FBS A;  3RJP A;  2ZJ2 A;  1ZN2 A;  3HRT A;  2V1D A;  4FX0 A;  1CF7 B;  2MH9 A;  1MJB A;  4EJT A;  2CWE A;  1HQC A;  1S29 A;  1MDM A;  5HDG A;  3O6B B;  1QGP A;  3F22 A;  2W25 A;  3ZPL A;  4ENJ A;  4ENN A;  4IHS A;  2E1N A;  2YPR A;  4BAY A;  1P4X A;  1SD5 A;  1J9I A;  2FOK A;  1ON1 A;  2L3D A;  2DTR A;  2EV0 A;  2HQR A;  4I02 A;  2BGC A;  2HDC A;  1IW7 F;  2DAO A;  4ZZL A;  1MJA A;  2VT2 A;  3EQL F;  3V8K A;  4G94 A;  4GGG A;  2Q0O A;  5ILS A;  4L5I A;  3HSR A;  2RC4 A;  1FLI A;  4KA4 A;  3LAP A;  2UZK A;  4RB3 C;  3P9C A;  2DPD A;  4CIC A;  2LF8 A;  1DUX C;  4DQ2 A;  3IC7 A;  3LQR A;  1IZ1 A;  1LB2 A;  4RAY A;  1D5V A;  1BM9 A;  5HS7 A;  2H94 A;  3N97 A;  3TGN A;  1J0R A;  2V1X A;  2HEO A;  4EGZ A;  3GYH X;  3IWZ A;  4B8X A;  1ZG1 A;  1PP8 F;  5L3B A;  5CYV A;  1E2X A;  3K1M A;  1HBX G;  1JE8 A;  3KFW X;  5D6E A;  2JZY A;  1XCV A;  4MNU A;  3ZMZ A;  3FF5 A;  1BN5 A;  5TJJ A;  3HHG A;  4KIF A;  4M72 A;  2IP2 A;  2HKO A;  2PN6 A;  4B09 A;  4EJV A;  4PGH A;  3DF8 A;  2Q2E A;  4YG2 F;  4NHJ A;  3V4G A;  4FHT A;  2HWV A;  5KVR A;  2MA3 A;  4DNC A;  4ESJ A;  4EM0 B;  4PDK A;  1KU9 A;  5TRD A;  4XLN F;  5CLS A;  2ISY A;  2YX4 A;  1KYZ A;  3E97 A;  5E8G A;  3CUQ A;  1MDM B;  5D8L B;  1R7J A;  4EGY A;  4WCG A;  2V9V A;  3LA7 A;  2VOD A;  5AIP A;  1L3L A;  4YFX F;  2ACJ A;  2A6E F;  3J81 K;  2K27 A;  5D5U B;  3ECO A;  3HOT A;  1FBU A;  2W57 A;  3GVA A;  4GXO A;  4UVB A;  1S8N A;  3DKW A;  3SZT A;  1LEB A;  3GFM A;  3N4M A;  2QM3 A;  1EH6 A;  3TQN A;  3VB2 A;  1H0M A;  3LQQ A;  4WXC A;  4XSX F;  2BV6 A;  1BI0 A;  3CLO A;  4I0B A;  3L00 A;  4KUM A;  3CJN A;  3IKT A;  3SFZ A;  2VE8 A;  1LNW A;  1U8R A;  4LD5 A;  2NYX A;  1FOK A;  1TQP A;  4HBL A;  3GLX A;  4HA8 A;  5E18 F;  5JVT A;  2XAG A;  3KP5 A;  1XSX A;  2Y75 A;  2KIU A;  4AIK A;  4YFK F;  3WTX C;  3ABU A;  2PG4 A;  3HSF A;  4MQV A;  3GZ6 A;  5DUI A;  1IRG A;  2B0L A;  1XGN A;  2EFN A;  4JBA A;  4BQA A;  1XSV A;  2WWY A;  1QNT A;  2EWN A;  1FP2 A;  5E1Z B;  1FYM A;  2QZ8 A;  1W7P A;  1FSH A;  1WQ2 A;  3RYP A;  1G3Y A;  3ECH A;  2FQ3 A;  3RKW A;  3BRO A;  4U7D A;  4PCQ A;  3D5L A;  2XAF A;  4UVC A;  1STZ A;  1P6R A;  2STW A;  5ICF A;  4EM1 A;  3GWZ A;  3E6D A;  3ERE D;  2W85 A;  2K7L A;  3C18 A;  2ISZ A;  4L9T A;  1Z7U A;  3O3K A;  1SFE A;  2W84 A;  4MQ9 F;  3IKV A;  3WU0 A;  1EH7 A;  1KU7 A;  5F1R A;  3IL2 A;  3RTR A;  2LF7 A;  5DDG A;  4EVI A;  2GZW A;  5BPI A;  1B9N A;  3VOD A;  4RGS A;  2XAH A;  2H27 A;  4KFC A;  3S2W A;  1ZH5 A;  5LRR A;  4P9F A;  4A5N A;  3U2R A;  4ESB A;  1IUY A;  1ZAO A;  2YX7 A;  1ZYR F;  5CVU A;  2HKX A;  5DCM B;  3JAM K;  3F21 A;  2XV4 S;  5K5Q A;  2IT0 A;  1MKM A;  3F8M A;  2WTE A;  2ESH A;  2M30 A;  3HOS A;  2FF4 A;  1SMT A;  2FBH A;  2MC3 A;  2XRN A;  3F6V A;  2PJP A;  3ROU A;  1U5T A;  1U2W A;  1ZRF A;  2X0L A;  5ICE A;  3KP3 A;  2XAS A;  4KIG A;  3RPU A;  3CDH A;  1YS6 A;  4AWX B;  3K1N A;  4OIP F;  1XCB A;  3G73 A;  2EA2 A;  3I58 A;  4ZYG A;  2NS0 A;  2A3S A;  1B9M A;  1P92 A;  4HX8 A;  2GA2 A;  1IN6 A;  3ZN1 A;  5LGN A;  2O6G E;  3BZ6 A;  4UV9 A;  3FHZ A;  2EFO A;  3SXY A;  2P5K A;  3MZY A;  3R0J A;  1JHF A;  3FMS A;  1R5H A;  1BOA A;  2IA0 A;  1LQ1 A;  1MD0 A;  5DUK A;  3QP5 A;  4FX4 A;  3GFL A;  1KU2 A;  5F6F A;  3RKX A;  1KQ8 A;  4BHB A;  5ICG A;  5DD4 A;  5JI6 A;  2M1B A;  1D8J A;  1LDJ A;  3L09 A;  1ZRC A;  2DI3 A;  1KQ9 A;  1B6A A;  3K0L A;  3K69 A;  2QEN A;  1BI3 A;  1YIO A;  3QRF F;  3R60 A;  4EJO A;  4LMY A;  5HS8 A;  2J5P A;  3RYR A;  3H3U A;  2F2E A;  1O7F A;  3T8R A;  1OMI A;  1UST A;  3W6J B;  5DV5 A;  4A0X A;  1BBY A;  2DQL A;  4EQQ A;  3IRR A;  4KMF A;  1LVA A;  4HV6 A;  4EMS A;  1QZY A;  1LDK B;  2PQ8 A;  5F64 A;  4UHT A;  2G7U A;  1F4K A;  3Q9S A;  5LHG A;  3LWF A;  1REP C;  2ETH A;  3V7S A;  4H0E A;  3RKY A;  1WWX A;  5IT9 K;  1T38 A;  2FNA A;  2QUF A;  4WK8 F;  4EJW A;  3WTU C;  1S6L A;  1U5T B;  3DXJ F;  2FBI A;  3BDD A;  3KEQ A;  1OYW A;  3REO A;  4HAM A;  3I53 A;  1B59 A;  5LHH A;  2CFX A;  2FEZ A;  1WRJ A;  2IJL A;  3E5X A;  5EEH A;  2VC0 A;  3DPL C;  3GFJ A;  1R00 A;  1B1B A;  2P5V A;  2J5O A;  2QBY A;  2XKP A;  3D0S A;  2Z33 A;  2JRT A;  2CSO A;  4Q47 A;  4OIR F;  1J2X A;  4LG0 A;  2H6B A;  2H6C A;  5H6R A;  4RB1 A;  2PBI A;  3WTV C;  2IPQ X;  4A6E A;  4L5J A;  5D4S A;  2NNY A;  4MEY F;  4WWC A;  1RZ4 A;  2M8E A;  3W6K B;  4KIC A;  2FML A;  1YO5 C;  1KYW A;  4ZH4 F;  3E3V A;  1OR7 A;  2XVC A;  1R36 A;  4ZYE A;  3C3W A;  1R1U A;  2O61 A;  2HGC A;  1F1Z A;  3FM3 A;  3JTG A;  3J80 K;  2K86 A;  3PFI A;  5K5R A;  4WXH A;  1V3F A;  1I1S A;  1YW7 A;  2L02 A;  1PDN C;  1UFM A;  1H9T A;  3WU1 B;  1E17 A;  2PI0 A;  1AWC A;  2ZME B;  1HKQ A;  4ZZD A;  4Z2Y A;  3C7J A;  3GXO A;  4OMY A;  1KU3 A;  3F3X A;  4M9S A;  5L3D A;  1KGS A;  4IF4 A;  4RAZ A;  2QWW A;  2IRF G;  3MAJ A;  3R61 A;  3J7A O;  1VTN C;  5E8I A;  5JFR A;  4YII A;  3ULQ B;  1HW1 A;  3BJO A;  3I71 A;  3WTW C;  2LSO A;  1HW5 A;  2MH2 A;  2VC1 A;  3MCZ A;  2FSW A;  1QQI A;  1Z1D A;  2GIV A;  2KIM A;  3L7W A;  1G3W A;  4HZF A;  1R5G A;  4AVP A;  3F6O A;  1T98 A;  3HSE A;  1BI2 A;  1USS A;  3QAH A;  5L3G A;  2L4A A;  1X3U A;  2OD5 A;  3BPX A;  1XMA A;  2RN7 A;  3NRV A;  4IRH A;  1G6N A;  4M6Y A;  2QBY B;  1IN8 A;  1ZLK A;  1XD7 A;  3FM5 A;  3BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...