1WSUA

C-terminal domain of elongation factor selb complexed with secis rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
GSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDEFYWHRQALGEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDKRVVVGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for mRNA recognition by elongation factor SelB
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Translation/rna
molecule keywords 5'-R(*GP*GP*CP*GP*UP*UP*GP*CP*CP*GP*GP*UP*CP*U*GP*GP*CP*AP*A
total genus 45
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09107 SelB-wing_3 Elongation factor SelB, winged helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA02
3MEXA 5J8CA 3HSFA 3I53A 1T39A 4L9JA 4IVNA 4GCVA 2FEZA 4IRHA 4I02A 3WTTC 2V1DA 1JGSA 1XCVA 4M9SA 5ICGA 1F4KA 3KZYA 4AWXB 3COAC 4LD5A 1TQIA 3FMRA 3HRSA 2DAOA 2QQBA 4L18B 5FLXK 2O3FA 1FNNA 1LEBA 2FXAA 1OPCA 2KRFA 2KKOA 1U5TC 3BY6A 3B02A 2P7CB 2F5FA 1J75A 2RN7A 4ASNA 2QBYA 1XB4A 2RV8A 2XAHA 2OZ6A 1ZH5A 1FLIA 1Z6RA 2F5DA 2FF4A 1SD7A 2ZCWA 4YIFA 1B1BA 3B73A 2A69F 2ZJ2A 3M8FA 1IN7A 1YW7A 4HX8A 3CUQA 1FY7A 2STTA 2E7XA 3ZMUA 3E5XA 4A12A 5TRDA 3D0SA 4EJWA 4HX4A 3L7WA 2CWEA 2NS0A 3Q9SA 4A6DA 4WXHA 3BP8A 2Z99A 5BS6A 1RI7A 2DQLA 3C18A 1RIOH 3GZ6A 5DUKA 5ILUA 4KFCA 2QYOA 3K0LA 1MDMB 2VE9A 5H6RA 1EH7A 2V9VA 3IKTA 2LNBA 3M9AA 2OQRA 4K2EA 3ERED 3F6OA 2FRHA 4Y15A 2RQPA 4I7HA 1JHHA 2HEOA 5DEQA 2EFPA 1FSHA 5H20A 4LB6B 4HDUA 1A04A 1B6AA 1J59A 3T1BA 1UCRA 2D2WA 1BIAA 3LQQA 3WODF 3W6KB 3TO7A 4RS8A 2X4HA 5L3CA 2FBHA 2DPUA 4M6YA 5AIPA 3E97A 5DD8A 1KU9A 1KU2A 2UZKA 3C3WA 1B9NA 1XSXA 2QVOA 1DPRA 3TOAA 2E1NA 1IN8A 5BPIA 2XUBA 2L02A 4M9ZA 4EJUA 3O3KA 4R79A 1C0WA 4M9XA 4CO8A 4ZYEA 1ZYRF 2LF8A 3V4GA 1P4WA 2Q2EA 1PUEE 3GFLA 1SD5A 3Q9VA 4KA4A 3CDHA 5CJ9A 1ZGAA 3HHHA 2ADUA 5ERIA 5ICFA 3JSPA 1B59A 3GUDA 2VN2A 1GVJA 5HLGA 3T5XA 3M7GA 1BOAA 5CYVA 3LA7A 5FLXZ 4UV8A 5LHIA 4YIIA 4YG2F 1FSEA 3ML6A 1K7AA 1ZARA 2A5YB 3RYPA 1TLHB 1O3SA 1YG2A 5L3DA 5K5QA 2EV6A 1OKRA 5JR3A 1FBUA 3DQVC 4YFNF 4MGRA 1PP7U 4HQEA 1R22A 2DT5A 3I59A 4HZFA 4OINF 2IT0A 2PEXA 4XSXF 1MJAA 4S05A 1ULYA 3L9FA 3JAMZ 3U2RA 1TNSA 5K5RA 4L9TA 1U5TB 2M5WA 4OIOF 1Z7UA 2VOOA 3FMSA 2QUFA 1W4MA 3NRVA 5ILSA 3EETA 4ESJA 4XLNF 2XKPA 4ENNA 4R1HA 3FXUA 2DK5A 3RPUA 1XN7A 3KEOA 1TBXA 1G3SA 2GXBA 1HBXG 1W5SA 4I09A 2LF7A 5DCMA 1J2XA 2IW5A 3KP7A 5FFXA 1QPMA 3HSEA 3ISPA 5F64A 3QPHA 3ZQ7A 2ZXJA 4FT8A 2IVMA 3EYYA 1S8NA 2EV5A 1J9IA 4LK1F 4EM2A 3SFZA 4U7BA 4UXNA 2ACJA 1SFUA 1HW2A 3TKYA 3REOA 4MNUA 2JSCA 2KIFA 1HSTA 3ZMZA 4AVPA 3BOQA 4L5JA 3HSRA 5CVVA 3SZPA 2P5VA 2XKOA 1TW2A 1TTYA 3KP5A 3V7CA 3V8JA 1JE8A 3J81Z 5EEHA 1BN5A 4G7HF 3ROUA 1UHMA 3E6BA 3WTZA 5CVUA 4NQWA 3MCZA 1PDNC 3R4KA 4DNCA 4LLGF 1TNTA 4LGWA 2EFQA 1P4XA 1STZA 4I2OA 3HTUA 1FZPB 3R60A 1WSUA 4UVAA 3QRFF 5FGMA 3RYRA 4HQMA 2CG4A 2CGPA 2HYFA 1QQIA 5BOXA 2DFIA 3GWZA 4LLLA 4G7OF 1U8RA 2ISYA 4ETSA 4MEXF 1XGNA 4LB5A 2YU3A 1IXRC 2Q0OA 3CUQC 5LEKA 2NRAC 1YS7A 4BQAA 3E6MA 5LRSA 3DPTA 4H0EA 3E5QA 4FHTA 5E1ZB 2G9WA 2M45A 2VONA 5ED4A 4MTDA 4HX7A 2ELHA 4KIGA 1JXSA 1R58A 4RGSA 3O2PE 3TO9A 4KUMA 3G3ZA 2JPCA 4RGRA 5L3GA 3VEPA 1QGPA 3QPTA 5FFZA 4HV6A 2RGVA 3TQNA 4P55A 2EJRA 1MDMA 1MJBA 2M8EA 3WGGA 1DPUA 3C1DA 1WWXA 1U2WA 2R3SA 3ECHA 4MQVA 4YFXF 2H27A 1ZGJA 5E8IA 2L4AA 1HSJA 1UFMA 4I0AA 5KVRA 1FBQA 2RVCA 3K1MA 3FM3A 3GW2A 3VFZA 2EFWA 4HOBA 2MH2A 3MFKA 4PGHA 3NQOA 1IW7F 3DEUA 2PLYA 1KA8A 4M71A 3RKYA 1HQCA 4OIQF 3I59B 2COMA 3CO6C 2XAQA 4KYWA 3L00A 4LMYA 2M87A 2ESHA 2XAGA 1FBSA 5HS8A 3FF5A 4A6EA 1YIOA 3R0JA 2G7UA 5LGTA 4LK0F 4KT5C 4XRFA 2P6TA 1MKMA 3R61A 5D4RA 4A0ZA 5AONA 2MH9A 4EGYA 3HIFA 2GXGA 4G94A 1LVAA 4BAYA 3GVAA 4EVIA 5JVTA 3GEZA 2P6SA 2WTEA 3BWGA 4GYGA 4RGXA 2QBYB 4UHTA 2QM3A 4KIBA 4UV9A 3L09A 2D1HA 3FM5A 4AIJA 1SD4A 1DUXC 4WF2A 1WKMA 1ZG5A 1S3JA 1Y0UA 1O3QA 2F2EA 2RC4A 4UVCA 1YTYA 3F8FA 4QWQA 1IXSB 3LA2A 2HTJA 4BHCA 5JI6A 2IP2A 2OZUA 1IRGA 1CF7B 2ZO4A 4IF4A 3GF2A 3DPLC 2PI0A 5J8FA 4CZZA 4Y17A 3EYIA 2P4WA 1F5TA 3NEUA 3PFIA 1UB9A 2WV0A 2PFBA 4RB2C 1S29A 3F8MA 3F3XA 2EFNA 1SMYF 1LEAA 5DDGA 1IXCA 2EA4A 4RB3C 4HLXA 2DW4A 2XIGA 1XSVA 4KIFA 1ZAOA 3Q5FA 1I1SA 5ILVA 3WTYC 2NNNA 5E1XA 3FX3A 2HKOA 2OQGA 3K9TA 1LQ1A 1EV7A 2MA3A 3IWZA 3CTAA 2CO5A 2LSOA 4L0ZB 2YR2A 3BDDA 5LEJA 1X3UA 2H09A 2VC0A 3LSTA 3KP2A 1TW3A 2ZNZA 5DCMB 1XMAA 2MC3A 4WXCA 2FOKA 1BBYA 3P9CA 2H6BA 5HDKA 1E2XA 4G7ZF 3CO7C 5E8GA 1P4AA 4L5IA 4P96A 3G73A 1REPC 1L3LA 2VBYA 5FB2A 4LG0A 2HDCA 2VBWA 1O7LA 4G6QA 2GIVA 4GGGA 3HOTA 3SQNA 1R00A 3E3VA 2IA2A 4M72A 2R7FA 3ZN1A 3GLXA 2PMHA 4IPAA 3TOBA 2YSRA 4WCGA 2L3DA 1MJ9A 2W85A 2DLLA 3DP7A 2EB7A 3RTRA 3D5LA 1XMKA 3EDPA 1BM9A 1LDDA 2W24A 5HDGA 2FSWA 4FX0A 4BH9A 3TO6A 1O7FA 4G6DA 3HRTA 5HVQC 1P92A 3HYIA 3RKWA 1J0RA 2WC2A 2LDUA 4N9IA 1KYZA 3I0TA 3GFJA 4IJAA 4M6XA 4RAZA 4OIPF 3K1PA 3WE2A 5IT9Z 2X0LA 1D5VA 5EEGA 2F5CA 3VOEA 2GWRA 3F23A 5DYMA 1R1UA 2K27A 2QQ9A 3BROA 3L2CA 4HF1A 2XVCA 4IHSA 4UNOA 3ZMDA 5LGNA 4AIHA 2ZMEB 3ZN0A 4YFKF 1H9GA 1T38A 1P6RA 3QOPA 3IKVA 2BGCA 4GYIA 2YX7A 2HKXA 2IA0A 1GXQA 2A3SA 2R7DA 3GX4X 1ON1A 1F9NA 4KMFA 1FX7A 3CJNA 4ZZDA 4RB0A 4CDGA 3T8RA 3MQ0A 4IHTA 2PBIA 3H3ZA 4I0BA 5D5UB 1U78A 1IN5A 4L9NA 1LDKB 1K78B 1FYKA 1FP1D 1SFEA 1R5GA 3PQJA 1EH6A 2OAZA 1IUYA 3C7JA 2QENA 4WXDA 2Y75A 3K1NA 4UUVA 1BI3A 4CGZA 5HS7A 3HRUA 2VE8A 1K6OA 1USTA 3VODA 4ENMA 3ELKA 1XGSA 4B8XA 3M1EA 3V8LA 3KEQA 2GQQA 4EM0B 4WK8F 3KCCA 3WTSC 3RPQA 1BIBA 4Y13A 5D8KB 3AAFA 2QLZA 2YPRA 1HKSA 2Z5UA 4HAMA 2CFXA 4KN4X 2O8XA 3HUGA 5HS9A 2WWYA 3BPXA 2VBZA 3LQRA 1IZ1A 1YYVA 2A6HF 3N4MA 4G8XA 4O6JA 3QU6A 1IRFA 1RZ4A 4OU0A 1USSA 1AWCA 3WG9A 1W7PA 4ESBA 3LWFA 1FT9A 1FOKA 5L3FA 1R1TA 1Z9CA 3F6VA 4G9YA 2RKHA 1O57A 1RUNA 3W6JB 4BNCA 4AIKA 2XROA 2GA2A 2MD5A 1KQ0A 2JRTA 3FMQA 1G3YA 2HOEA 4IRIA 5J6XA 3H3UA 4PZJA 4MQ9F 2QQAA 2OU2A 2H6CA 4IXAA 4OMYA 2MLGA 5CVJA 1T2KA 1O3RA 4XSZF 5E20A 4M73A 3V7SA 1FPQA 2K4BA 1ZG3A 1UHWA 1DP7P 2E7WA 2DO7A 2HWVA 2ZBKA 1T0FA 2JTVA 5FO5A 3LA3A 3HOSA 3IL2A 3TGNA 1I1GA 3F72A 3KZZA 5LLQA 4ZYDA 3R0AA 3DKWA 3RJPA 4DQ2A 5H6QA 1YS6A 5LGUA 1HKQA 2QZ8A 2VT3A 1HW1A 4LJZF 1U6GA 1PP8F 1BJAA 2CSOA 2CW0F 4B09A 1RNLA 4A0XA 2ZFWA 3T8TA 4U88A 1FP2A 5L3BA 3HHGA 3WTVC 4KICA 3BJ6A 3DXJF 3RIRA 1R7JA 2J5PA 1TQPA 2QWWA 1IN4A 2P5KA 1D3YA 5D5WB 2C6YA 1U5TA 1KQ8A 3SXYA 1CGPA 2O6GE 2Q8KA 2FMYA 5D6FA 1EH8A 4LG0B 4HLYA 5CVIA 1YW9A 2JPBA 2O0YA 1G3TA 5IT9K 1AOYA 2M30A 2AXLA 3GO5A 5BPDA 2HTSA 2Y48A 4D0PA 1FYLA 1QZYA 3IRQA 2K02A 3FXRA 3IC7A 4U0VA 4A5NA 4Q5SF 4NB5A 5DUIA 1ZG1A 1LNWA 5LBQA 2HFHA 1YQAA 4EJTA 3HRMA 5FD5A 5D8LB 3ECOA 2KJBA 1SD6A 2FA5A 1HW5A 1S7OA 1E17A 2XV4S 1GHCA 3QAHA 1ZRCA 2ESNA 2DU9A 4BXUA 3E5UA 3E6CC 1BI1A 4TV7A 4ZZLA 1DDNA 5A2QK 2XHKA 1MD0A 3GXOA 4HDVA 3JSOA 4A2UA 4S04A 5K5OA 4EMSA 1XSDA 1Z91A 2ETHA 4UVBA 2ZKZA 1WRJA 1JHFA 2HZTA 3K2ZA 4LLNA 4KMUX 1F1ZA 1OYYA 1R36A 1W7PD 2FNAA 3PQKA 1ZRFA 3QU3A 2W57A 2K4JA 2DI3A 3I4PA 3JW4A 4XBFA 1G4DA 2CYYA 2XRNA 2FU4A 3KE2A 2OBPA 2Z9OA 2DBBA 3CLOA 2GAUA 4JK1X 3DF8A 4Q47A 4EQQA 3U9GA 4HYEA 3GFIA 3J7AO 1IN6A 1YW8A 1XGMA 5D5VB 1Z6TA 2BYVE 3H92A 5KK1A 3KP3A 1KGSA 1ODDA 2UXXA 4EJVA 2H94A 1SAXA 2IA1A 2XAJA 5E18F 4N0BA 2KIUA 3OV8A 3P9IA 2HQRA 4I01A 3WU1B 4O5VA 4JBAA 1I5ZA 3KLNA 4MHGA 1G6NA 1J5YA 2L54A 5CLSA 4IRGA 2BEOA 3QP5A 3BJOA 1FYMA 3P9KA 2Z33A 2DPDA 2BV6A 2KJCA 4P9FA 3WGIA 2OA4A 3V7RA 1Z05A 2BBYA 2IJLA 2A6EF 1SFXA 1FC3A 1TQMA 1MZBA 5F6FA 3I5UA 4P5OA 1LB2A 1O3TA 2UWMA 1ON2A 3N97A 3I71A 2VBXA 2LKPA 3KP4A 3LAJA 2V1XA 3MAJA 1YLFA 3DV8A 1QBJA 2DTRA 3DFGA 5IT3A 3ZMTA 2MLKA 4HW0A 5JFRA 2FQ3A 4OOIA 4LFUA 3WU0A 1ZRDA 4EJOA 5D5XB 4EGZA 1HKTA 3ZMSA 2EV0A 1BI2A 1ZN2A 3KLOA 5F1RA 3TDZC 2MBFA 2F5EA 4CICA 1XCBA 2L4MA 1IF1A 4M74A 1I6XA 1R23A 3RKXA 5LRRA 2BE5F 2P7VB 4ENKA 3ULQB 3MZYA 5HLHA 4R8HA 4E70A 2VC1A 4CHUA 4JQFA 2ZMEA 3F8CA 3GFMA 1WQ2A 1H9TA 2XGXA 1U3EM 3RDIA 3VB2A 2EA2A 4BYYA 2D1VA 3MZHA 1RUOA 1KU3A 4BHPA 4Z2YA 1GXPA 4WX9A 3M8EA 3GYHX 2XASA 4ENJA 2B0LA 2HGCA 1ZLKA 2EFOA 2V79A 2A68F 3ZPLA 1B9MA 4KNYA 3EQLF 4MTEA 4EV0A 1R5HA 2NAZA 5HOOA 4XLPF 3SHFA 1KYWA 2K86A 3SZTA 2V1UA 2FBKA 2PN6A 2NNYA 1QZZA 2E1CA 4GXOA 2XAFA 1W5TA 4ZYHA 2W84A 2GA1A 2VODA 3CUQB 4HF0A 1OR7A 3J80Z 1XD7A 2O03A 4CYDA 2P8TA 4KDPA 1B4AA 4P9UA 1IAWA 2PMUA 2PG4A 4OIRF 5ICEA 3IHUA 5JHUA 5LHHA 1OYWA 2HYGD 5A2QZ 3WTXC 2RNJA 3MWMA 3LAPA 2G7HA 5HLIA 4AD9A 4A5MA 1ONVA 4WWCA 1D8JA 5DD4A 1WI9A 5HDNA 3IWFA 4U7DA 3CUOA 4RAYA 2CQKA 5DV5A 2J5OA 1YFHA 3F8NA 2O61A 5AIQA 3U1DA 3WTWC 4U0YA 4ON0A 3TDUC 1MGTA 1QO0D 5E1WA 2JZYA 4RGUA 5DCFA 1K79A 2IRFG 3FWEA 3FZVA 4RB1A 1FWZA 2A07F 3I58A 3T0YA 4CXFA 3I54A 1Z1DA 1D8KA 3QP6A 4BHBA 1V4RA 1Q1HA 1K78A 2FNPA 3KETA 2Y0MA 5D6EA 3JTHA 2HQNA 3J80K 3IRRA 2IPQX 4GO1A 4FX4A 6PAXA 3WE3A 3HTSB 2P5LC 5E17F 1LJ9A 4O3MA 1S6LA 2HR3A 1S7AA 3WGHA 2DQRA 3ABUA 4L9VA 1L0OC 1ZHFA 2V6CA 4NHJA 4MEYF 2D45A 5L3EA 2ZNYA 2VOPA 2ISZA 2TDXA 5BQTA 2VT2A 2L01A 2M1BA 1W7PB 4PDKA 3BPVA 4QLCU 1VTNC 1YO5C 1ZLJA 4HBLA 1NHAA 4A0YA 1T98A 2KIMA 3FHZA 1H0MA 1OYIA 2OD5A 3F8BA 1I27A 5FD6A 3ZMVA 2FBIA 3LFKA 4HV5A 3BJAA 3ZP5A 1P2FA 3J81K 2VXZA 3KP6A 2GZWA 5K1YA 3K69A 3JAMK 1KQ9A 1V3FA 1J7KA 2NYXA 1R1VA 4PCQA 2FMLA 1T6SA 4F7ZA 5BMZA 2DK8A 2JT1A 1OMIA 1G3WA 3O6BB 3OOPA 4HA8A 4KN7X 5D4SA 3F22A 1ZREA 4U0WA 3R6SA 2Z3YA 1BI0A 4Q48A 3F21A 3V8KA 1KU7A 2PJPA 1XDUA 4N9HA 3BZ6A 4ESFA 4ZH4F 2FE3A 4L0YB 2EK5A 1LDJA 4ZYGA 1BC8C 3ABTA 1XGOA 1HXDA 3S2WA 3I64A 2A61A 2YX4A 5ICCA 1BC7C 4EM1A 4I98B 2EWNA 1CF7A 3FXQA 4PGGA 3GZ5A 3WTUC 2STWA 2K7LA 2W25A 1SMTA 1XDSA 2AS5F 5TJJA 5LHGA 2PQ8A 4OMZA 2RDPA 3E6DA 5CVRA 4HF2A 4Q4ZF 3KFWX 3EUHA 3JTGA 2HS5A 2UXNA 3P7NA 1QNTA 3RI4A
chains in the Genus database with same CATH superfamily
3MEXA 5J8CA 3IV5A 3HSFA 3I53A 4MLOA 1H89C 1LPQA 1T39A 4L9JA 4IVNA 4GCVA 1QPIA 2FEZA 3PSIA 4IRHA 4I02A 4LIVA 4KJZA 3HGYA 2V1DA 3WTTC 1JGSA 1XCVA 4M9SA 5ICGA 1F4KA 3V42A 2M9HA 3KZYA 4AWXB 3COAC 4E7KA 1JJ6C 4LD5A 4D1QA 2DDBA 1TQIA 5GTHC 3FMRA 3HRSA 5GP9A 2DAOA 3K6GA 2QQBA 4DBQA 3GTLJ 3OYIA 4L18B 2HVRA 5FLXK 1IO2A 2O3FA 2JK3A 3A01A 1FNNA 2DXIA 1LEBA 2FXAA 1A35A 1A36A 2KPMA 4W97A 1NK2P 3KIOA 1OPCA 2KRFA 2KKOA 1U5TC 3OIOA 3BY6A 3B02A 3CMYA 3GCMA 3S3NA 4FETA 4UUSB 2P7CB 2OUMA 3BLYA 2F5FA 1J75A 5C4XJ 2RN7A 4ASNA 1MIJA 3PL8A 4C9YA 2K9MA 4F92B 2QBYA 3H5NA 1XB4A 3BG7A 2RV8A 2W1OA 2XAHA 1V55H 1MMAA 2OZ6A 1ZH5A 4PSWA 3HZJA 1FLIA 2LREA 1QHHD 1ZK8A 1GV5A 1Z6RA 2F5DA 4CSWA 4UY8I 2FF4A 1SD7A 2ZCWA 3OS2A 3L2RA 3SJMA 4YIFA 2E1OA 1B1BA 3B73A 2A69F 3CESA 2ZJ2A 1PUFA 1I50J 1FJLA 1V5FA 3M8FA 5GPAA 2DMUA 2W82A 1IN7A 1YW7A 2O8KA 4RLFA 4HX8A 1Z3YA 2HDWA 4DZPA 3CUQA 4X0GA 4II2A 3WHBA 1FY7A 3UR3C 2STTA 2E7XA 1N25A 3ZMUA 3E5XA 4A12A 5C4JJ 2E1MC 4MO7A 3H3VK 2HI3A 1F36A 3TBIA 1D0ZA 2JUGA 5TRDA 3D0SA 3WHCA 5IYCJ 2A6TA 1HF0A 2RREA 1NK3P 1DU6A 4EJWA 2R5ZA 1Y8QB 2XPUA 4HX4A 3ABLH 2HOTA 2DOAA 3L7WA 4A3LJ 4B43A 2CWEA 2NS0A 1HLVA 3AG1H 3Q9SA 1QU3A 4A6DA 2HPMA 2D5VA 3K4MA 4WXHA 3BP8A 2EZLA 3ZQIA 2Z99A 4ZDPA 5BS6A 4YEJA 1RI7A 2DQLA 3C18A 1RIOH 3GZ6A 3FBIB 5DUKA 5ILUA 1YX3A 4KFCA 2XGDA 5F0HA 3GTGJ 2QYOA 3K0LA 2K5CA 4LITA 1MDMB 2KHMA 2VE9A 5H6RA 1EH7A 3C2HA 1AKHA 2V9VA 1TWAJ 4BY7J 4DJAA 3IKTA 1X2MA 2LNBA 3M9AA 5J1UA 4F91B 2OQRA 2V1NA 4K2EA 1VZ0A 1BR4A 3TW7A 2L9NA 3ERED 3N05A 2ZJPF 2V4JC 3F6OA 2FRHA 4Y15A 2GIZA 1ZQ3P 3L2WA 2RQPA 4I7HA 1GVDA 1JHHA 3A4CA 3H5AA 2HEOA 4GDFA 2M3AA 2Z2SB 4HPQA 2EFPA 5DEQA 1ZR4A 1FSHA 4L5EA 5H20A 4LB6B 4HDUA 1A04A 1B6AA 3LSRA 1J59A 2HXIA 4GRIA 2FQ4A 3T1BA 1UCRA 2D2WA 1XC5A 1BIAA 2LLKA 3LQQA 4PK4A 1Y1WJ 2CQ7A 3WODF 3W6KB 3TO7A 4JYKA 4RS8A 2X4HA 5L3CA 2FBHA 1VI0A 1K4TA 2DPUA 4M6YA 5AIPA 4HNUA 3G1LA 3OOUA 3DU5A 4XRSA 3E97A 3IUOA 5DD8A 2K85A 1KU9A 2DJNA 1KU2A 1I6HJ 2QGUA 3O8GA 3JRCA 1FOYA 2VJ5A 2UZKA 3C3WA 1B9NA 4FE7A 1XSXA 2QVOA 1DPRA 2IBDA 1MMDA 2E1NA 2DYSH 2VL8A 4YELA 1IN8A 3TOAA 5BPIA 2XUBA 2L02A 4M9ZA 2FX0A 4EJUA 3O3KA 2M8GX 4R79A 1C0WA 4M9XA 2AO9A 4CO8A 4ZYEA 1ZYRF 4BDZA 1WH7A 2ZMEC 2V7FA 2LF8A 4BU2A 3V4GA 1P4WA 3K4BA 2X51A 2Q2EA 2B9SA 1OCRH 1SD5A 3GFLA 1X1PA 4XKVA 1PUEE 2DMQA 3Q9VA 2K9QA 4KA4A 3CDHA 2RQQA 2PMZN 5CJ9A 1ZGAA 3HHHA 2ADUA 5ERIA 5ICFA 5J1YA 3JSPA 3I56I 2ICWG 3CF5F 3PO2J 2ZSHB 3BQYA 2O9LA 1B59A 3GUDA 2VN2A 1GVJA 5HLGA 4PJNA 3T5XA 3M7GA 3M4OJ 2V9KA 5GADJ 5J40A 1BOAA 5CYVA 3LA7A 1NTCA 1Z7LA 3OYHA 3PNTA 4OAZA 5FKMA 4C30A 5FLXZ 3OY9A 3PJRA 3RQ4A 2CQNA 1VNDA 4RAGA 4UV8A 4ZJZA 5LHIA 1IDZA 2E34A 1R49A 4QPQA 4YIIA 4YG2F 3EUAA 1FSEA 3ML6A 1K7AA 1ZARA 2A5YB 3OR2C 1DU0A 3RYPA 1TLHB 1O3SA 2XSDC 1YG2A 5L3DA 4PJJA 5K5QA 3AKZA 2EV6A 1OKRA 3JRAA 5JR3A 1FBUA 3DQVC 1VQLI 2P81A 4YFNF 4MGRA 3WU2C 5KAFC 2Z1DA 2X6XA 3CCRI 1YI2I 4BJ6C 2LY2A 2MSYA 2R5ZB 1PP7U 4I6ZA 3TL4X 1UJ8A 4HQEA 4M3FA 1R22A 1OLTA 2DT5A 3I59A 3L1PA 4HZFA 3C2BA 4OINF 3ABMH 2IT0A 2PEXA 1RESA 4XSXF 3HOZJ 3QYEA 1MJAA 4YIRX 2A05A 3BR0A 1YHQI 4S05A 1QA6A 2BHZA 1ULYA 2EQRA 3L9FA 5GAGJ 3JAMZ 3U2RA 4XM3A 1TNSA 5K5RA 4L9TA 2F6CA 1U5TB 2M5WA 2VUMJ 4OIOF 3QQAA 1Z7UA 2VOOA 3FMSA 5M3FJ 2MG4A 2QUFA 1JKRC 3L2QA 1W4MA 3NRVA 5ILSA 4GFBA 3EETA 4ESJA 4XLHA 4XLNF 2XKPA 2OTJI 4ENNA 4R1HA 4IHXA 3H5RA 4KT6A 3FXUA 5K7FA 2DK5A 2EZKA 3RPUA 1XN7A 3KEOA 1TBXA 1G3SA 1JKPC 3Q0UA 2GXBA 3S1MJ 1ITYA 5GAEJ 1HBXG 1W5SA 1RPWA 3CCMI 3NWTA 3M07A 4I09A 1XG1A 2IGMA 2LF7A 5HLTA 5DCMA 4JP0A 1Y0NA 4CYCB 2CUZA 1J2XA 2IW5A 3KP7A 5FFXA 1QPMA 3HSEA 3ISPA 3LSMA 3QPHA 5F64A 3ZQ7A 3HOWJ 1K6YA 2ZXJA 2LH9A 2GOMA 3D5RC 4FT8A 1JGGA 2IVMA 3EYYA 2DA6A 1S8NA 2EV5A 1J9IA 1X4PA 4LK1F 4EM2A 4IQJA 4PFOA 4Y4RA 3SFZA 3G1MA 1B72B 3CC2I 1P9QC 4U7BA 2DA7A 2MD0A 5B1AH 5FKOA 3DPUA 1IGNA 1MSFC 1OISA 4UXNA 2ACJA 1SFUA 3DBHB 4B3AA 3G4SI 1MBKA 1HW2A 3TKYA 3CC4I 3REOA 3GTOJ 3S15J 3K7AJ 2LYCA 5E3NA 4MNUA 2JSCA 2KIFA 1K83J 3LSPA 1HSTA 3ZMZA 1D1CA 4AVPA 3J7AY 3BOQA 4L5JA 2R5YB 2EIMH 3HSRA 5F0CA 5CVVA 2KDOA 3SZPA 2P5VA 2XKOA 2XDVA 3OYGA 4XOTA 2QKMB 4XKBA 3QODA 1TW2A 2UV1A 4XRMA 1JT6A 3SEQA 3U1KA 3CMAI 1TTYA 3KP5A 3V7CA 3V8JA 1JE8A 3J81Z 2ECBA 3ASNH 3CC7I 1YJNI 5EEHA 1BN5A 2EZIA 4RDUA 4G7HF 3ROUA 1UHMA 1XMXA 2HNHA 3DEWA 3E6BA 3WTZA 2E1MB 3MKWB 5CVUA 5GTIC 3LMMA 5JHFA 4NQWA 1OCZH 3S1RJ 3MCZA 4ZTJA 1HDDC 1HA8A 1PDNC 2YUSA 3R4KA 4DNCA 4LLGF 1FOWA 1IDYA 1TNTA 4LGWA 2EFQA 2NS8A 1P4XA 1STZA 4E4HA 4I2OA 1X3ZB 3HTUA 1FZPB 3R60A 3CDLA 1DGRM 1WSUA 4UVAA 3QRFF 5FGMA 3RYRA 3QOEA 5EZHA 1IRZA 3P5JA 1JTYA 2VIXA 2X6OA 4HQMA 2CG4A 2Y31A 1S5LC 2CGPA 1MNDA 1SFOJ 3H9GA 2HYFA 4IHVA 1QQIA 1WJEA 1BR1A 5BOXA 2DFIA 3GWZA 4B3XA 4LLLA 1VQNI 4G7OF 1FIAA 3AL0B 3VSKA 4M3BA 2E36A 1U8RA 2ISYA 1HDPA 2F4IA 2Y69H 4NQWB 4XLEA 1MNMC 4ETSA 4MEXF 2LP0A 1ETXA 1T33A 1XGNA 4LB5A 2DMTA 3J7YJ 2YU3A 4J19A 1IXRC 2Q0OA 3CUQC 5LEKA 1IC8A 3S3OA 2E2IJ 2NRAC 1PUFB 1YS7A 1HOMA 3FBNB 4BQAA 1V5GA 1JI8A 2WAQA 3CMMA 3A0BC 3E6MA 1T95A 1MMNA 1XTAA 2FJ1A 5LRSA 3DPTA 3MKZA 4H0EA 4UUSA 3E5QA 4FHTA 3RPUD 2GOXB 5E1ZB 2ME6A 1SAUA 2G9WA 2VPLA 3DBLB 2M45A 2VONA 5ED4A 3VYUB 4MTDA 2NOJB 4B1RA 1J09A 4HX7A 2ELHA 2LMDA 1POGA 4KIGA 4IZZA 3HOYJ 1PJRA 3ZCOA 1JXSA 1R58A 2ZC2A 2MGQA 4RGSA 3I4NJ 2JQ7A 3JR9A 1IRXA 3O2PE 3TO9A 4KUMA 3FXOA 3G3ZA 2JPCA 1ZTRA 3K4LA 4RGRA 3HC7A 2CW7A 3CCSI 5L3GA 3VEPA 4OAYA 1QGPA 3QPTA 5FFZA 4HV6A 2X1EA 2RGVA 3TQNA 2K3FA 4P55A 2EJRA 2IGKA 1TWFJ 4IL6C 1MDMA 1VQPI 1MJBA 2M8EA 2ZXHA 3WGGA 2R5YA 1DPUA 3B6CA 1WWXA 1U2WA 2R3SA 3C1DA 4KITB 3ECHA 4XQFA 4MQVA 2B63J 4YFXF 4CCOA 4BQNA 1FOXA 2AQFA 1E0EA 2EINH 3G2BA 2H27A 1ZGJA 2VASA 5E8IA 2L4AA 1HSJA 1UFMA 3EUHC 1U9NA 4I0AA 5KVRA 1FBQA 3BR1A 4IEJA 2RVCA 3K1MA 5C3EJ 1MBFA 3SEZA 4AUXA 3FM3A 3GW2A 2VQCA 3VFZA 2EFWA 4J01A 3FHNA 4HOBA 2MH2A 3RKQA 2H8RA 3MFKA 3LSKA 4PGHA 4EEFG 3NQOA 1X19A 1Z0XA 1IW7F 3DEUA 2DDAA 1XPXA 3ZQCA 2PLYA 3S14J 2VPRA 2LTPA 1KA8A 5K7HA 4M71A 3RKYA 3JCUC 1HQCA 4OIQF 3I59B 1D5YA 2COMA 2R92J 3CO6C 2XAQA 4KYWA 2JUCA 3DTKA 3L00A 4A3JJ 4LMYA 3PO3J 2M87A 4IHYA 3IH2A 4N4NB 2VKDA 2ESHA 3HOXJ 1TT0A 2XAGA 2GBYA 1EF4A 2M4KA 1VQ5I 1RETA 1FBSA 2LKSA 5HS8A 3FF5A 5J4VA 4A6EA 3S2HJ 3OYAA 3A0HC 1YIOA 3R0JA 2G7UA 1WFXA 5LGTA 2NXNB 4LK0F 4HRIA 4KT5C 1TP4A 4XRFA 3OYEA 3DKXA 2P6TA 1MKMA 3R61A 5D4RA 4A0ZA 3MD2A 5AONA 2MH9A 4EGYA 3HIFA 2DT7B 2CQQA 2NOGA 2GXGA 4FISA 5J47A 4G94A 1LVAA 4BAYA 4NC8A 3X2QH 4IQ4A 3GVAA 5DM7F 4FE4A 4G6TB 4EVIA 5JVTA 3PSFA 3GEZA 2P6SA 2WTEA 3BWGA 4GYGA 4Y52J 3KZIC 4II3A 4RGXA 5HNHA 2QBYB 4H4KC 1E3HA 4UHTA 2QM3A 5C44J 3ZQGA 4KIBA 4UV9A 1A31A 2WBMA 3BTLA 2D1HA 3L09A 2OV7A 4ABZA 2R7QA 3FM5A 3OYDA 4AIJA 1SD4A 1W0UA 1DUXC 4WF2A 2XB5A 1WKMA 3H0GJ 1ZG5A 2KZGA 1S3JA 1Y0UA 1O3QA 2F2EA 4FQGA 2RC4A 4UVCA 4XN3A 1YTYA 3F8FA 4QWQA 1IXSB 3LA2A 2HTJA 2IS4A 5IYDJ 4BHCA 1NG6A 4FASD 3K2AA 2RNGA 2XGEA 3K4KA 5EG0A 5JI6A 2IP2A 1W1WE 2M2EA 4JX6A 2OZUA 1IRGA 3MKLA 2ELKA 1AU7A 1X3WB 1B72A 2MW8A 2WY8Q 1CF7B 2ZO4A 2K9NA 4IF4A 5EF6A 3GF2A 3OR1C 2XPVA 4BY1J 5TGTA 3DPLC 2PI0A 5J8FA 4CZZA 1G59A 2QSGX 4Y17A 2HOAA 3EYIA 5KHDA 2P4WA 4D9JA 1F5TA 2LBFB 3NEUA 3PFIA 3DWLE 1UB9A 2WV0A 2PFBA 1S7EA 4A69C 4RB2C 1S29A 3RI4A 3F8MA 2AHQA 4BJTA 3DEEA 3F3XA 2EFNA 1SMYF 1LEAA 4I99C 5DDGA 1IXCA 1ZGWA 2EA4A 4RB3C 4HLXA 2DW4A 4A3DJ 4QIWN 2XIGA 1XSVA 3IAM2 2JA6J 4KIFA 3TMOA 1ZAOA 3Q5FA 1I1SA 3G1OA 5ILVA 3S1NJ 3WTYC 2NNNA 2ME0A 5E1XA 3FX3A 1ZELA 2HKOA 3BCBA 1R4NB 2OQGA 2ZFUA 3K9TA 1EV7A 1YE9A 2MA3A 3IWZA 3CTAA 1LQ1A 1DP3A 2CO5A 2LSOA 2IS2A 3BR6A 3HOVJ 3HXLA 4L0ZB 2YR2A 2EBIA 3BDDA 5LEJA 1F43A 4QTRA 4NUBA 1X3UA 1SVLA 2H09A 2VC0A 1Z77A 3LSTA 2WAEA 2LD5A 2MFZA 3KP2A 4Z6YA 2DFHA 2JRMA 5KAIC 2HXOA 4PJMA 1TW3A 2BW3A 2ZNZA 5DCMB 2O7OA 1XMAA 2MC3A 3PNYA 4WXCA 1ZR2A 2FOKA 1BBYA 3P9CA 2R93J 2H6BA 1P7JA 5HDKA 1E2XA 2L2OA 4G7ZF 1H8AC 3CO7C 5E8GA 1NG7A 1P4AA 4L5IA 4NDLA 4D7MA 2WADA 1D1AA 1LFUP 4P1WA 4P96A 5H2FC 3Q0WA 1VQ7I 3GBGA 3G73A 1REPC 1L3LA 2WB1A 2VBYA 5FB2A 4LG0A 2HVSA 2HDCA 1TT5B 3FKJA 4C3IJ 3E0JB 2VBWA 4ZDOA 2JA2A 1O7LA 4G6QA 2GIVA 2L0KA 4GGGA 5TISC 3HOTA 3SQNA 1R00A 2VKVA 3ASOH 3E3VA 2IA2A 3H9JA 3KPHA 3LSGA 4M72A 2R7FA 3ZN1A 4BE2A 3GLXA 1E3OC 2PMHA 4IPAA 3TOBA 2YSRA 3K70D 3SDBA 4WCGA 2L3DA 3CJQB 9ANTA 3CCVI 2W85A 1MJ9A 2V26A 2XB0X 2DLLA 2KMUA 3DP7A 2V9PA 2V6EA 2X1CA 3K4CA 4F3QA 2EB7A 1ETOA 2W00A 3OL3A 3RTRA 3D5LA 4U87A 4JX5A 1XMKA 2GXAA 3EDPA 3S93A 1BM9A 2LRDA 1JUMA 1LDDA 2W24A 4BXXJ 4BQOA 2L5QA 5HDGA 3CF2A 2FSWA 4FX0A 4BH9A 2BVLA 1VFCA 2VQHA 2XAUA 3TO6A 1RKTA 1O7FA 4G6DA 5EEAA 3HRTA 5HVQC 2QSFX 2N8GA 3CZ6A 1P92A 4BGDA 3HYIA 3G71I 3EPZA 3OL4A 1SANA 3RKWA 3DKYA 2XRLA 1IG7A 1J0RA 2ECCA 2WC2A 4HNTA 5E3MA 4E7HA 2LDUA 4N9IA 4A3FJ 2DMPA 1KYZA 3CCEI 5E3OA 3I0TA 3GFJA 3BTJA 3KX2A 4IJAA 4XORA 2QQ8A 4UB6C 4M6XA 2DN0A 4RAZA 2LC2A 1UZCA 3K1PA 3WE2A 5FKLA 4OIPF 3M8JA 1VQ6I 5IT9Z 2X0LA 1D5VA 5EEGA 2F5CA 4CH7A 2ZXIA 3LFUA 3VOEA 2GWRA 3F23A 2F4OB 3PIOF 5DYMA 1R1UA 1WJ5A 2K27A 2QQ9A 3EUKL 3BROA 3L2CA 4HF1A 4B4CA 2UUZA 2XVCA 4IHSA 2QCOA 1WH5A 4UNOA 2OJED 3CLQA 3ZMDA 1BR2A 4XICA 4A3BJ 5LGNA 4CA0A 3A01B 4AIHA 2A5WA 2ZMEB 3CQZJ 1Z3XA 4ZYAA 2BW3B 3ZN0A 2K3PA 1H9GA 4YFKF 2BY2A 2KRHA 1T38A 1P6RA 3QOPA 3IKVA 1ETKA 2BGCA 4GYIA 3I9V2 3GTMJ 5CQGA 1I39A 2YX7A 2M0CA 3SYTA 2HKXA 2IA0A 1GXQA 2A3SA 5B1BH 1OCOH 1UG0A 3DLLF 2M0MA 2R7DA 3GX4X 1ON1A 1LKXA 1F9NA 4KMFA 3OYNA 2Y0SN 1FX7A 3CJNA 4PSXA 4ZZDA 1MMSA 4RB0A 4CDGA 1AA7A 1OCTC 3T8RA 3MQ0A 4IHTA 2PBIA 3H3ZA 3SDGA 3B6AA 4I0BA 3MZ8A 5D5UB 1U78A 1U8BA 1UG2A 2E5NA 2F4MB 1IN5A 4L9NA 1OCCH 1W36C 3BC8A 3KEYA 1LDKB 1K78B 4E7SA 2E5ZA 1FYKA 3HEFA 3I3LA 1FP1D 1SFEA 2G0EA 1R5GA 3PQJA 1EA3A 2CV1A 1EH6A 2OAZA 2I8DA 3C7JA 1IUYA 3KYCB 4NC6A 2DFFA 5FLMJ 2QENA 4WXDA 1HC8A 4E7IA 4RBOA 2QSHX 4BBSJ 2Y75A 3K1NA 5J1RA 4UUVA 1BI3A 4CGZA 1MMGA 3HB9A 4X1EA 3ERMA 5HS7A 1T0FC 2BZTA 4XLCA 3HRUA 4CCKA 2HPIA 4BUPA 3S32A 1OR7C 2PMZA 4RMNA 3VDXA 2VE8A 1K6OA 1USTA 2NVQJ 3QWLA 5EG0B 3VODA 4ENMA 3ELKA 3KYDB 1XGSA 1O4XA 3BTIA 1G2HA 4B8XA 3M1EA 3OYCA 3V8LA 3KEQA 4ANJA 2GQQA 4EM0B 4WK8F 3KCCA 3WTSC 3HL2A 3RPQA 1BIBA 4Y13A 2CUFA 5D8KB 3AAFA 4BXFA 2QLZA 1Z21A 2YPRA 2KLOA 3BTCA 4M3GA 5F08A 1HKSA 2Z5UA 1BA5A 4HAMA 2ELJA 1WHUA 2CFXA 3SFIA 3CCYA 4KN4X 1A6IA 2O8XA 3HUGA 5EDNA 5HS9A 3ONQA 3S1QJ 2WWYA 3BPXA 2VBZA 3QYBA 3LQRA 1ENHA 3RQIA 1IZ1A 1JUSA 1YYVA 2A6HF 1MW7A 3N4MA 4AYBN 4ZTFA 3ABKH 2OPTA 4G8XA 1KONA 5EJCA 2OC6A 2OCCH 2CMPA 4O6JA 3MKYB 3QU6A 2Z16A 1IRFA 1RZ4A 4D5FA 4OU0A 4BE1A 1ETVA 1USSA 1AWCA 3WG9A 1W7PA 2VLAA 1D0YA 2M34A 2KISA 4ESBA 3LWFA 4D7NA 5FKNA 1FT9A 1FOKA 3HGGA 2L7FP 4BEHB 5L3FA 1R1TA 1Z9CA 2ZXWH 2JA5J 1ETQA 3I55I 1YRNB 3F6VA 1OQYA 4G9YA 2RKHA 2DA2A 3MN2A 2IS6A 2I5UA 1O57A 2JMWA 2XPWA 3GTQJ 1VQ8I 4CYCA 1RUNA 1DQUA 1FMWA 3W6JB 4BNCA 4AM3A 4CCNA 4AIKA 1MH4A 3HOUJ 2XROA 2GA2A 3CDIA 2MD5A 1JTXA 1KQ0A 2JRTA 1I3QJ 4BACA 2IAIA 3FMQA 1VQKI 4HG2A 1G3YA 2HOEA 4AU7A 4DZJA 4IRIA 3DCFA 5J6XA 3H3UA 4PZJA 4ITVA 3BZKA 3ZQFA 1W36D 3RZDJ 1VF9A 4MQ9F 2HDDA 2QQAA 2OU2A 4W1UA 2HZDA 2H6CA 3JRIA 4KISA 4IXAA 2X85A 5M5WJ 4OMYA 3BG6A 2MLGA 5CVJA 1T2KA 2L9VA 1O3RA 3DTIA 4XSZF 5E20A 4MFEA 2BOLA 3F9KA 2HVQA 4M73A 3V7SA 1FPQA 1TZLA 2K4BA 3ZR8X 2JVGA 3TEDA 1ZG3A 1UHWA 1DP7P 2MABA 2E7WA 1MH3A 2DO7A 5IP7J 2HWVA 2W4SA 2ZBKA 1T0FA 1VQOI 2JTVA 2EIJH 3CD6I 2XSJC 5FO5A 3GZNB 3MMYB 3AG4H 3LA3A 3HOSA 3IL2A 4C3JJ 3CP2A 3AG2H 2IGOA 4IHWA 3TGNA 1I1GA 3F72A 3KZZA 5LLQA 4ZYDA 4Y7NJ 3BR5A 5LD2C 2F48A 2MYSA 3R0AA 3DKWA 3IAS2 3IP4B 2K9SA 3RJPA 3W6VA 4DQ2A 4A3IJ 3PNVA 4UUTA 5H6QA 1YS6A 2LBFA 3CMEI 5FRNA 5LGUA 1YX5A 1HKQA 2DA4A 2QZ8A 2BY1A 2VT3A 5B3SH 1HW1A 4LJZF 1U6GA 5CKTA 1BJAA 1PP8F 4V19K 1U9OA 2CSOA 3H0DA 4CCMA 1VQ4I 1RR8C 2CW0F 4B09A 1RNLA 4A0XA 2ZFWA 3T8TA 4M3DA 4U88A 1FP2A 5L3BA 3HHGA 5FRMA 1LFBA 1D1BA 1ORKA 3WTVC 4KICA 1QVUA 4XN0A 3W2AA 3BJ6A 4OWRB 3DXJF 3OYJA 3RIRA 2DT6A 1R7JA 2EILH 2ZJQF 2J5PA 1TQPA 4BL0B 3L2UA 1K4SA 2Q1ZB 2QWWA 1IN4A 2P5KA 1D3YA 2R7VA 5D5WB 2C6YA 1NH3A 1U5TA 1T8IA 1KQ8A 3SXYA 1CGPA 4DGWB 2O6GE 2Q8KA 2FMYA 5D6FA 2LFBA 1EH8A 4LG0B 4HLYA 5CVIA 3RSNA 5K7ZA 1RRJA 2R7SA 1YW9A 2JPBA 2O0YA 2CJJA 1G3TA 5IT9K 1AOYA 2Y9YA 2M30A 2AXLA 3GO5A 5BPDA 2CRGA 1X1CA 2HTSA 2Y48A 4D0PA 3QPLA 1QZYA 2OCEA 1FYLA 2LG4A 1X58A 1P7IA 2CUEA 3IRQA 2DODA 2K02A 2WB1N 1JKOC 2JSPA 3FXRA 1BW5A 3CCQI 1MBGA 1RKWA 2MC4A 2KZVA 3IC7A 4NC7A 2R7WA 2XF7A 4B44A 4U0VA 4A5NA 2JN6A 4Q5SF 3PUBA 3DBRB 1KZHA 5EGOB 4FTHA 3OYLA 4NB5A 5DUIA 2WAQN 1ZG1A 1LNWA 5LBQA 2R7ZJ 1MBJA 1D0XA 2HFHA 2QEXI 4XONA 1YQAA 2CFOA 4EJTA 3HRMA 5FD5A 5D8LB 3ECOA 2KJBA 2IXSA 1SD6A 3W3CA 2FA5A 1EKEA 1HW5A 2CW8A 2ZB9A 1S7OA 2ID6A 1E17A 2XV4S 4A3CJ 3CCUI 2TCTA 1GHCA 2M7BA 3QAHA 2YS9A 1ZRCA 2DTZA 4AC0A 2JA8J 3OYFA 2DMNA 2ESNA 1IV6A 4C2MJ 2I10A 2DU9A 3D1NI 2Y2ZA 4BXUA 3E5UA 3E6CC 1WJAA 1BI1A 4TV7A 4ZZLA 1DDNA 2FOWA 4BQQA 5A2QK 3BR3A 2XHKA 1MD0A 3ZQLA 2DA5A 3AFHA 3GXOA 2R4GA 5IPAA 4HDVA 3BZCA 3JSOA 2JA7J 2L7ZA 2NVUB 4A2UA 2X48A 4S04A 5K5OA 1LE8B 4EMSA 2EH3A 1XSDA 3FXJA 1Z91A 4NNJA 2LY1A 2ETHA 4RA2A 4UVBA 4IO9F 3H36A 4XKWA 5FJ8J 4XK4A 2ZKZA 2VXDA 2BXZA 3U21A 2NVTJ 1WRJA 1JHFA 3DU6A 2EZHA 4A3MJ 2HZTA 3K2ZA 4LLNA 1WZ2A 4KMUX 1F1ZA 3OYKA 1OYYA 1R36A 1EJ9A 5E3LA 1W7PD 2XF6A 4BS9A 3OWTA 2FNAA 3PQKA 1ZRFA 4XOPA 3QU3A 2W57A 2K4JA 2DI3A 2E2HJ 2PJRB 1YOVB 3BG5A 3I4PA 3JW4A 4XBFA 1G4DA 2CYYA 2OF7A 3FKIJ 2XRNA 2R7TA 2FU4A 3KE2A 2Y0SA 1R6RA 3BG9A 2GM4A 2OBPA 2Z9OA 5J4YA 2DBBA 3FK6A 3CLOA 2GAUA 4JK1X 4LIUA 3DF8A 3TP3A 4Q47A 1B8IB 4EQQA 1N77A 3U9GA 5GAHJ 1X1DA 4HYEA 3GFIA 3J7AO 1IN6A 1YW8A 1AHDP 1XGMA 1IV8A 1ERDA 2IGNA 5D5VB 3H35A 1JUPA 5CQEA 5HODA 1Z6TA 2BYVE 2KIQA 4IOCF 3ZRGA 3PIPF 3H92A 5KK1A 2NS7A 2O5RA 3A02A 3CJTB 3L2VA 2LOOA 3M3YJ 4LOCA 3KP3A 1KGSA 1ODDA 2UXXA 3OIPA 4EJVA 2H94A 1SAXA 2CU7A 2IA1A 2XAJA 5E18F 4QPOA 2OTLI 4N0BA 2RAEA 2W48A 2KIUA 3JRHA 3OV8A 4BEHA 1LUJB 2HQRA 3P9IA 4I01A 4O5VA 3WU1B 3HJEA 4JBAA 1WGXA 2XC7A 3IH3A 3VYSB 4B48A 4F55A 4M6VA 1I5ZA 1RC9A 3KLNA 5KNLA 4MHGA 4BJ5C 1G6NA 1J5YA 1M1EB 3FXMA 2L54A 1SFKA 2VKEA 4XKCA 5CLSA 3A2KA 4IRGA 2BEOA 3ZQHA 3QP5A 4AYBA 3LL7A 5EGOA 3BJOA 3RZOJ 5DS9A 1FYMA 3A1YA 3P9KA 2Z33A 2WY7Q 2DPDA 1ACIA 4XRSG 3QPSA 5IOZA 2BV6A 2KJCA 4P9FA 2H8WA 3WGIA 3O8HA 2OA4A 3V7RA 1Z05A 2BBYA 3G6EI 3S17J 1MBEA 4F93B 2IJLA 2AQEA 2A6EF 1SFXA 5IOYA 1FC3A 2VQLA 1TQMA 3M1CA 3OYBA 1MZBA 4E6KG 5F6FA 3I5UA 2Q2EB 4P5OA 1LB2A 3OS1A 5IY5H 3NARA 1O3TA 3NWSA 2UWMA 3FXLA 1ON2A 3N97A 2WV1A 3I71A 2VBXA 1U0JA 2LKPA 3KP4A 3JRBA 3LAJA 2DA1A 1OJLA 3CJRB 4D5CA 2V1XA 1SVMA 3MAJA 4MIMA 4AVZA 2R7OA 1YLFA 3DV8A 1QBJA 2DTRA 1JJ8C 3DFGA 1Y39A 5IT3A 2Y9ZA 3ZMTA 2MLKA 3GTKJ 1QHGA 4HW0A 3W2VA 5JFRA 2FQ3A 1GT0C 4OOIA 1X1BA 4JX4A 1FEXA 4LFUA 3WU0A 2CH0A 4EJOA 5D5XB 3J7ZI 4EGZA 4BDYA 3OSGA 1WPKA 1ZRDA 4E7ZA 1BJZA 3ZMSA 2YU9J 1HKTA 2EV0A 1BI2A 2L9SA 4M3EA 4V2FA 3S8PA 3FK7A 3OS0A 1R9TJ 1ZN2A 2NVXJ 3UNGC 1UMQA 1BW6A 3KLOA 5F1RA 3GTPJ 3TDZC 5FKKA 2MBFA 1K61A 2F5EA 4CICA 3CCJI 1XCBA 3ZQQA 2L4MA 1IF1A 4M74A 3JREA 3K4NA 2L7KA 1I6XA 1R23A 2KFDA 3FXKA 3RKXA 5GPCA 3OYMA 1YITI 5LRRA 2BE5F 2P7VB 1N75A 1WJBA 4ENKA 3ULQB 3MZYA 5HLHA 4PUSA 2QA4I 4R8HA 4E70A 2VC1A 3C2GA 4CHUA 4IOAF 2PX9A 4JQFA 2ZMEA 3F8CA 4XMYA 3GFMA 1WQ2A 4XNFA 1H9TA 2XGXA 2LR8A 1U3EM 4G12A 3RDIA 3VB2A 2EA2A 3FISA 4BYYA 2D1VA 2VJIA 2DA3A 2TRTA 1ZKGA 3MZHA 1RUOA 1KU3A 4BHPA 3HM5A 3TP0A 4Z2YA 3K70C 1GXPA 3FIWA 4FCYA 3KYLA 4WX9A 2B7EA 2DFEA 3M8EA 3GYHX 2DOEA 2HQAA 2K40A 1WJCA 2XASA 5B5EC 4ENJA 3VPRA 1H88C 2B0LA 2KQRA 3VSLA 2HGCA 1ZLKA 1OFCX 2EFOA 2GLOA 2X9DA 2V79A 1WJFA 2BY3A 2KT0A 2A68F 3HPHA 3ZPLA 1B9MA 3H9QA 2KP6A 3JRGA 1APLC 1N78A 1FTZA 4KNYA 3EQLF 4MTEA 2K9LA 3GLLA 4EV0A 1RR7A 2VJJA 1R5HA 3S16J 2HQ5A 2NAZA 5HOOA 4XLPF 3SHFA 4CCJA 2FD5A 1LFPA 1KYWA 1SVOA 2K86A 3SZTA 2V1UA 4F52A 2FBKA 2JJ7A 2PN6A 1XX5A 2AXTC 2NNYA 1I3AA 3BG3A 1QZZA 3ESWB 2HOSA 5IP6A 2E1CA 4GXOA 4ZC3A 2XAFA 1TWCJ 1Y56A 3BR2A 3TW6A 2DJIA 2M4GA 1W5TA 1UELB 2LY9A 4ZYHA 2W84A 1TC3C 2FUG2 2GA1A 2VODA 4HNVA 3CUQB 1E3PA 4HF0A 1OR7A 3J80Z 1XD7A 3HKZA 4A3KJ 1X2NA 1T56A 1Z67A 2O03A 3SZGA 1IUFA 1QZEA 2P8TA 3ZXSA 4CYDA 4KDPA 2ID3A 4DYCA 1B4AA 4XLFA 1Q1VA 4P9UA 1IAWA 2PMUA 4CZCA 4DOZA 5F04A 1FMVA 1SC7A 4Y3OA 2PG4A 1S9HA 2VKHA 4OIRF 5ICEA 1AKHB 4DBRA 2E71A 3IHUA 5JHUA 5LHHA 2VI6A 4HSTA 1OYWA 2HYGD 1GLNA 5A2QZ 3Q3SA 4DW6A 3WTXC 2RNJA 3MWMA 3LAPA 4Y33A 2G7HA 4IKFA 5HLIA 2LK2A 5IP9J 4X6AJ 4AD9A 4A5MA 1JT0A 5M5XJ 2LKXA 1ONVA 1W0TA 4WWCA 3LSIA 5FLVA 1D8JA 5DD4A 1WI9A 5HDNA 2CQXA 3LOCA 2PJRA 3IWFA 1FTTA 4U7DA 3DLAA 2XGCA 3CUOA 3BQZA 3JRDA 4J00A 4RAYA 2CQKA 5DV5A 2J5OA 1YFHA 3A03A 3VYRB 3NAUA 4XR6A 3F8NA 2O61A 1UAAA 1GUUA 1WI3A 3E7LA 5AIQA 2CV0A 1OCPA 3U1DA 1A6QA 4E7JA 2X6YA 4A3EJ 2DYRH 3WTWC 4U0YA 4ON0A 3TDUC 2E35A 2DCEA 1MGTA 1QO0D 4NBQA 1UHSA 3PM1A 5E1WA 2JZYA 4RGUA 4A3GJ 3PFYA 3BCAA 3K4JA 5DCFA 1K79A 2IRFG 3FWEA 1VQ9I 3FZVA 5JLWA 4RB1A 1FWZA 1BL0A 5CPRB 2A07F 3I58A 3T0YA 4MFDA 4CXFA 3I54A 1Z1DA 1D8KA 2WAFA 3QP6A 4PJ0C 4BHBA 2R0QC 1V4RA 4HSRA 2BXYA 1Q1HA 1BOBA 1K78A 1ETYA 2L7MP 2FNPA 3KETA 3HDDA 1QVTA 1X1AA 2Y0MA 5D6EA 2LVSA 3JTHA 2HQNA 1Y8RB 3J80K 3IRRA 1GV2A 3VWBA 4PJLA 2IPQX 5DTDA 4RM2A 4GO1A 1YJWI 2BVMA 4FX4A 2E2JJ 1MNEA 2W7NA 6PAXA 3WE3A 3HTSB 1V5EA 2E19A 4N4OB 2P5LC 3LSJA 1LE8A 3HKZN 5E17F 1GDTA 1LJ9A 5F1JA 4BE0A 4O3MA 1R4MB 2VJ4A 3H1CA 1S6LA 2HR3A 4A93J 1WVRA 1S7AA 3WGHA 2DQRA 3ABUA 4L9VA 4ZDLA 3S2DJ 5BNGA 2KRCA 3HBLA 4RLQA 1L0OC 4HEA2 1ZHFA 2V6CA 1VQMI 5FROA 4JOMA 5IYBJ 4NHJA 5M3MJ 4MEYF 4C3HJ 4B47A 4C2TA 3CP8A 2D45A 2QF7A 1FIPA 2KL4A 5L3EA 2CV2A 2VB6A 5KCMA 2ZNYA 1HCRA 1QRYA 4CUGA 2VOPA 3JRFA 3OMYA 3OIQA 2R7XA 2R7RA 2ISZA 2TDXA 5BQTA 2VT2A 2L01A 2M1BA 5EZGA 1MBHA 1W7PB 3D5SC 4PDKA 1YRNA 1R71A 3BPVA 4QLCU 1S72I 2H1KA 2CUJA 1TL8A 4BBRJ 1VTNC 3AL0C 2EPFA 1YO5C 3HUGB 1ZLJA 4HBLA 1NHAA 1CQTA 4A0YA 5LFAA 1T98A 2KIMA 3LSHA 3FDYA 3FHZA 1H0MA 5M5YJ 1OYIA 3WG7H 3IH4A 2L9RA 2JVHA 3F8BA 1WCMJ 2OD5A 2VQGA 1JKQC 3MVPA 1I27A 5FD6A 3ZMVA 2FBIA 3ZOBA 1WJDA 3LFKA 4HV5A 2X1DA 3BJAA 3CCLI 3ZP5A 1P2FA 2EIKH 2XF5A 5JVGF 4XL9A 3GMEA 3BT9A 3J81K 1V54H 2VXZA 3KP6A 5EYRA 2GZWA 5JLXA 4DYQA 5K1YA 3K69A 2ZJRF 3UKGA 3JAMK 1KQ9A 3AG3H 1IJWC 1V3FA 1J7KA 2NYXA 5E79C 1R1VA 2BY0A 4PCQA 2H1LA 2FMLA 1T6SA 4F7ZA 5BMZA 2DK8A 1MSEC 1Y6IA 4BKXA 1B8IA 2JT1A 1YJ9I 1OMIA 2IEKA 4RAFA 4YRVA 5F27A 1G3WA 4LG3A 2WA0A 4RM3A 2Y30A 1G8XA 1PYVA 4CCLA 3O6BB 2F5VA 3OOPA 4HA8A 4KN7X 5D4SA 4IX7A 4XIDA 3F0CA 4QSHA 4U0WA 3R6SA 3F22A 2Z3YA 1BI0A 1ZREA 4Q48A 4C2UA 4PFPA 3F21A 1SEUA 2IS1A 3V8KA 1KU7A 2PJPA 2R7UA 1XS9A 1XDUA 3K10A 4N9HA 5DM6F 3BZ6A 3E1SA 4ESFA 4ZH4F 2FE3A 5J3LA 3I4MJ 1YIJI 4L0YB 2X6WA 2EK5A 2HYJA 1LDJA 3VYTB 3DTEA 4ZYGA 3W2WA 1BC8C 3ABTA 1XGOA 1HXDA 4AIDA 1DGWY 5B66C 1X4OA 2ZSIB 3OSFA 3S2WA 2E60A 5F0FA 2CS3A 3I64A 2A61A 2YX4A 5ICCA 2M7AA 3HG9A 1A5JA 3Q0VA 1BC7C 2BHYA 3RCOA 2JWTA 4EM1A 4DIQA 3LNQA 1W5CC 3PUFA 2P0WA 2EWNA 4I98B 4S0HB 1TWHJ 1CF7A 3FXQA 4PGGA 1ETWA 1LVKA 3GZ5A 3WTUC 2STWA 2K7LA 4DYRA 2W25A 3ZGKA 4I76A 1SMTA 1XDSA 2AS5F 5TJJA 5LHGA 2PQ8A 4OMZA 2RDPA 3HPGA 4UB8C 3QYFA 4EATA 2KDZA 1PVEA 2COBA 3E6DA 3S3MA 5CVRA 4HF2A 3GTJJ 4Q4ZF 2NVYJ 4XLAA 1TWGJ 3KFWX 3EUHA 3JTGA 1Y1VJ 2HS5A 2UXNA 2QKLB 3P7NA 1QNTA 4V2GA 2HU9A 2DOFA 1T08B 5HNFA 4E7LA 1R5ID
chains in the Genus database with same CATH topology
3MEXA 5J8CA 3HSFA 3I53A 1T39A 4L9JA 4IVNA 4GCVA 2FEZA 4IRHA 4I02A 3WTTC 2V1DA 1JGSA 1XCVA 4M9SA 5ICGA 1F4KA 3KZYA 4AWXB 3COAC 4LD5A 1TQIA 3FMRA 3HRSA 2DAOA 2QQBA 4L18B 5FLXK 2O3FA 1FNNA 1LEBA 2FXAA 1OPCA 2KRFA 2KKOA 1U5TC 3BY6A 3B02A 2P7CB 2F5FA 1J75A 2RN7A 4ASNA 2QBYA 1XB4A 2RV8A 2XAHA 2OZ6A 1ZH5A 1FLIA 1Z6RA 2F5DA 2FF4A 1SD7A 2ZCWA 4YIFA 1B1BA 3B73A 2A69F 2ZJ2A 3M8FA 1IN7A 1YW7A 4HX8A 3CUQA 1FY7A 2STTA 2E7XA 3ZMUA 3E5XA 4A12A 5TRDA 3D0SA 4EJWA 4HX4A 3L7WA 2CWEA 2NS0A 3Q9SA 4A6DA 4WXHA 3BP8A 2Z99A 5BS6A 1RI7A 2DQLA 3C18A 1RIOH 3GZ6A 5DUKA 5ILUA 4KFCA 2QYOA 3K0LA 1MDMB 2VE9A 5H6RA 1EH7A 2V9VA 3IKTA 2LNBA 3M9AA 2OQRA 4K2EA 3ERED 3F6OA 2FRHA 4Y15A 2RQPA 4I7HA 1JHHA 2HEOA 5DEQA 2EFPA 1FSHA 5H20A 4LB6B 4HDUA 1A04A 1B6AA 1J59A 3T1BA 1UCRA 2D2WA 1BIAA 3LQQA 3WODF 3W6KB 3TO7A 4RS8A 2X4HA 5L3CA 2FBHA 2DPUA 4M6YA 5AIPA 3E97A 5DD8A 1KU9A 1KU2A 2UZKA 3C3WA 1B9NA 1XSXA 2QVOA 1DPRA 3TOAA 2E1NA 1IN8A 5BPIA 2XUBA 2L02A 4M9ZA 4EJUA 3O3KA 4R79A 1C0WA 4M9XA 4CO8A 4ZYEA 1ZYRF 2LF8A 3V4GA 1P4WA 2Q2EA 1PUEE 3GFLA 1SD5A 3Q9VA 4KA4A 3CDHA 5CJ9A 1ZGAA 3HHHA 2ADUA 5ERIA 5ICFA 3JSPA 1B59A 3GUDA 2VN2A 1GVJA 5HLGA 3T5XA 3M7GA 1BOAA 5CYVA 3LA7A 5FLXZ 4UV8A 5LHIA 4YIIA 4YG2F 1FSEA 3ML6A 1K7AA 1ZARA 2A5YB 3RYPA 1TLHB 1O3SA 1YG2A 5L3DA 5K5QA 2EV6A 1OKRA 5JR3A 1FBUA 3DQVC 4YFNF 4MGRA 1PP7U 4HQEA 1R22A 2DT5A 3I59A 4HZFA 4OINF 2IT0A 2PEXA 4XSXF 1MJAA 4S05A 1ULYA 3L9FA 3JAMZ 3U2RA 1TNSA 5K5RA 4L9TA 1U5TB 2M5WA 4OIOF 1Z7UA 2VOOA 3FMSA 2QUFA 1W4MA 3NRVA 5ILSA 3EETA 4ESJA 4XLNF 2XKPA 4ENNA 4R1HA 3FXUA 2DK5A 3RPUA 1XN7A 3KEOA 1TBXA 1G3SA 2GXBA 1HBXG 1W5SA 4I09A 2LF7A 5DCMA 1J2XA 2IW5A 3KP7A 5FFXA 1QPMA 3HSEA 3ISPA 5F64A 3QPHA 3ZQ7A 2ZXJA 4FT8A 2IVMA 3EYYA 1S8NA 2EV5A 1J9IA 4LK1F 4EM2A 3SFZA 4U7BA 4UXNA 2ACJA 1SFUA 1HW2A 3TKYA 3REOA 4MNUA 2JSCA 2KIFA 1HSTA 3ZMZA 4AVPA 3BOQA 4L5JA 3HSRA 5CVVA 3SZPA 2P5VA 2XKOA 1TW2A 1TTYA 3KP5A 3V7CA 3V8JA 1JE8A 3J81Z 5EEHA 1BN5A 4G7HF 3ROUA 1UHMA 3E6BA 3WTZA 5CVUA 4NQWA 3MCZA 1PDNC 3R4KA 4DNCA 4LLGF 1TNTA 4LGWA 2EFQA 1P4XA 1STZA 4I2OA 3HTUA 1FZPB 3R60A 1WSUA 4UVAA 3QRFF 5FGMA 3RYRA 4HQMA 2CG4A 2CGPA 2HYFA 1QQIA 5BOXA 2DFIA 3GWZA 4LLLA 4G7OF 1U8RA 2ISYA 4ETSA 4MEXF 1XGNA 4LB5A 2YU3A 1IXRC 2Q0OA 3CUQC 5LEKA 2NRAC 1YS7A 4BQAA 3E6MA 5LRSA 3DPTA 4H0EA 3E5QA 4FHTA 5E1ZB 2G9WA 2M45A 2VONA 5ED4A 4MTDA 4HX7A 2ELHA 4KIGA 1JXSA 1R58A 4RGSA 3O2PE 3TO9A 4KUMA 3G3ZA 2JPCA 4RGRA 5L3GA 3VEPA 1QGPA 3QPTA 5FFZA 4HV6A 2RGVA 3TQNA 4P55A 2EJRA 1MDMA 1MJBA 2M8EA 3WGGA 1DPUA 3C1DA 1WWXA 1U2WA 2R3SA 3ECHA 4MQVA 4YFXF 2H27A 1ZGJA 5E8IA 2L4AA 1HSJA 1UFMA 4I0AA 5KVRA 1FBQA 2RVCA 3K1MA 3FM3A 3GW2A 3VFZA 2EFWA 4HOBA 2MH2A 3MFKA 4PGHA 3NQOA 1IW7F 3DEUA 2PLYA 1KA8A 4M71A 3RKYA 1HQCA 4OIQF 3I59B 2COMA 3CO6C 2XAQA 4KYWA 3L00A 4LMYA 2M87A 2ESHA 2XAGA 1FBSA 5HS8A 3FF5A 4A6EA 1YIOA 3R0JA 2G7UA 5LGTA 4LK0F 4KT5C 4XRFA 2P6TA 1MKMA 3R61A 5D4RA 4A0ZA 5AONA 2MH9A 4EGYA 3HIFA 2GXGA 4G94A 1LVAA 4BAYA 3GVAA 4EVIA 5JVTA 3GEZA 2P6SA 2WTEA 3BWGA 4GYGA 4RGXA 2QBYB 4UHTA 2QM3A 4KIBA 4UV9A 3L09A 2D1HA 3FM5A 4AIJA 1SD4A 1DUXC 4WF2A 1WKMA 1ZG5A 1S3JA 1Y0UA 1O3QA 2F2EA 2RC4A 4UVCA 1YTYA 3F8FA 4QWQA 1IXSB 3LA2A 2HTJA 4BHCA 5JI6A 2IP2A 2OZUA 1IRGA 1CF7B 2ZO4A 4IF4A 3GF2A 3DPLC 2PI0A 5J8FA 4CZZA 4Y17A 3EYIA 2P4WA 1F5TA 3NEUA 3PFIA 1UB9A 2WV0A 2PFBA 4RB2C 1S29A 3F8MA 3F3XA 2EFNA 1SMYF 1LEAA 5DDGA 1IXCA 2EA4A 4RB3C 4HLXA 2DW4A 2XIGA 1XSVA 4KIFA 1ZAOA 3Q5FA 1I1SA 5ILVA 3WTYC 2NNNA 5E1XA 3FX3A 2HKOA 2OQGA 3K9TA 1LQ1A 1EV7A 2MA3A 3IWZA 3CTAA 2CO5A 2LSOA 4L0ZB 2YR2A 3BDDA 5LEJA 1X3UA 2H09A 2VC0A 3LSTA 3KP2A 1TW3A 2ZNZA 5DCMB 1XMAA 2MC3A 4WXCA 2FOKA 1BBYA 3P9CA 2H6BA 5HDKA 1E2XA 4G7ZF 3CO7C 5E8GA 1P4AA 4L5IA 4P96A 3G73A 1REPC 1L3LA 2VBYA 5FB2A 4LG0A 2HDCA 2VBWA 1O7LA 4G6QA 2GIVA 4GGGA 3HOTA 3SQNA 1R00A 3E3VA 2IA2A 4M72A 2R7FA 3ZN1A 3GLXA 2PMHA 4IPAA 3TOBA 2YSRA 4WCGA 2L3DA 1MJ9A 2W85A 2DLLA 3DP7A 2EB7A 3RTRA 3D5LA 1XMKA 3EDPA 1BM9A 1LDDA 2W24A 5HDGA 2FSWA 4FX0A 4BH9A 3TO6A 1O7FA 4G6DA 3HRTA 5HVQC 1P92A 3HYIA 3RKWA 1J0RA 2WC2A 2LDUA 4N9IA 1KYZA 3I0TA 3GFJA 4IJAA 4M6XA 4RAZA 4OIPF 3K1PA 3WE2A 5IT9Z 2X0LA 1D5VA 5EEGA 2F5CA 3VOEA 2GWRA 3F23A 5DYMA 1R1UA 2K27A 2QQ9A 3BROA 3L2CA 4HF1A 2XVCA 4IHSA 4UNOA 3ZMDA 5LGNA 4AIHA 2ZMEB 3ZN0A 4YFKF 1H9GA 1T38A 1P6RA 3QOPA 3IKVA 2BGCA 4GYIA 2YX7A 2HKXA 2IA0A 1GXQA 2A3SA 2R7DA 3GX4X 1ON1A 1F9NA 4KMFA 1FX7A 3CJNA 4ZZDA 4RB0A 4CDGA 3T8RA 3MQ0A 4IHTA 2PBIA 3H3ZA 4I0BA 5D5UB 1U78A 1IN5A 4L9NA 1LDKB 1K78B 1FYKA 1FP1D 1SFEA 1R5GA 3PQJA 1EH6A 2OAZA 1IUYA 3C7JA 2QENA 4WXDA 2Y75A 3K1NA 4UUVA 1BI3A 4CGZA 5HS7A 3HRUA 2VE8A 1K6OA 1USTA 3VODA 4ENMA 3ELKA 1XGSA 4B8XA 3M1EA 3V8LA 3KEQA 2GQQA 4EM0B 4WK8F 3KCCA 3WTSC 3RPQA 1BIBA 4Y13A 5D8KB 3AAFA 2QLZA 2YPRA 1HKSA 2Z5UA 4HAMA 2CFXA 4KN4X 2O8XA 3HUGA 5HS9A 2WWYA 3BPXA 2VBZA 3LQRA 1IZ1A 1YYVA 2A6HF 3N4MA 4G8XA 4O6JA 3QU6A 1IRFA 1RZ4A 4OU0A 1USSA 1AWCA 3WG9A 1W7PA 4ESBA 3LWFA 1FT9A 1FOKA 5L3FA 1R1TA 1Z9CA 3F6VA 4G9YA 2RKHA 1O57A 1RUNA 3W6JB 4BNCA 4AIKA 2XROA 2GA2A 2MD5A 1KQ0A 2JRTA 3FMQA 1G3YA 2HOEA 4IRIA 5J6XA 3H3UA 4PZJA 4MQ9F 2QQAA 2OU2A 2H6CA 4IXAA 4OMYA 2MLGA 5CVJA 1T2KA 1O3RA 4XSZF 5E20A 4M73A 3V7SA 1FPQA 2K4BA 1ZG3A 1UHWA 1DP7P 2E7WA 2DO7A 2HWVA 2ZBKA 1T0FA 2JTVA 5FO5A 3LA3A 3HOSA 3IL2A 3TGNA 1I1GA 3F72A 3KZZA 5LLQA 4ZYDA 3R0AA 3DKWA 3RJPA 4DQ2A 5H6QA 1YS6A 5LGUA 1HKQA 2QZ8A 2VT3A 1HW1A 4LJZF 1U6GA 1PP8F 1BJAA 2CSOA 2CW0F 4B09A 1RNLA 4A0XA 2ZFWA 3T8TA 4U88A 1FP2A 5L3BA 3HHGA 3WTVC 4KICA 3BJ6A 3DXJF 3RIRA 1R7JA 2J5PA 1TQPA 2QWWA 1IN4A 2P5KA 1D3YA 5D5WB 2C6YA 1U5TA 1KQ8A 3SXYA 1CGPA 2O6GE 2Q8KA 2FMYA 5D6FA 1EH8A 4LG0B 4HLYA 5CVIA 1YW9A 2JPBA 2O0YA 1G3TA 5IT9K 1AOYA 2M30A 2AXLA 3GO5A 5BPDA 2HTSA 2Y48A 4D0PA 1FYLA 1QZYA 3IRQA 2K02A 3FXRA 3IC7A 4U0VA 4A5NA 4Q5SF 4NB5A 5DUIA 1ZG1A 1LNWA 5LBQA 2HFHA 1YQAA 4EJTA 3HRMA 5FD5A 5D8LB 3ECOA 2KJBA 1SD6A 2FA5A 1HW5A 1S7OA 1E17A 2XV4S 1GHCA 3QAHA 1ZRCA 2ESNA 2DU9A 4BXUA 3E5UA 3E6CC 1BI1A 4TV7A 4ZZLA 1DDNA 5A2QK 2XHKA 1MD0A 3GXOA 4HDVA 3JSOA 4A2UA 4S04A 5K5OA 4EMSA 1XSDA 1Z91A 2ETHA 4UVBA 2ZKZA 1WRJA 1JHFA 2HZTA 3K2ZA 4LLNA 4KMUX 1F1ZA 1OYYA 1R36A 1W7PD 2FNAA 3PQKA 1ZRFA 3QU3A 2W57A 2K4JA 2DI3A 3I4PA 3JW4A 4XBFA 1G4DA 2CYYA 2XRNA 2FU4A 3KE2A 2OBPA 2Z9OA 2DBBA 3CLOA 2GAUA 4JK1X 3DF8A 4Q47A 4EQQA 3U9GA 4HYEA 3GFIA 3J7AO 1IN6A 1YW8A 1XGMA 5D5VB 1Z6TA 2BYVE 3H92A 5KK1A 3KP3A 1KGSA 1ODDA 2UXXA 4EJVA 2H94A 1SAXA 2IA1A 2XAJA 5E18F 4N0BA 2KIUA 3OV8A 3P9IA 2HQRA 4I01A 3WU1B 4O5VA 4JBAA 1I5ZA 3KLNA 4MHGA 1G6NA 1J5YA 2L54A 5CLSA 4IRGA 2BEOA 3QP5A 3BJOA 1FYMA 3P9KA 2Z33A 2DPDA 2BV6A 2KJCA 4P9FA 3WGIA 2OA4A 3V7RA 1Z05A 2BBYA 2IJLA 2A6EF 1SFXA 1FC3A 1TQMA 1MZBA 5F6FA 3I5UA 4P5OA 1LB2A 1O3TA 2UWMA 1ON2A 3N97A 3I71A 2VBXA 2LKPA 3KP4A 3LAJA 2V1XA 3MAJA 1YLFA 3DV8A 1QBJA 2DTRA 3DFGA 5IT3A 3ZMTA 2MLKA 4HW0A 5JFRA 2FQ3A 4OOIA 4LFUA 3WU0A 1ZRDA 4EJOA 5D5XB 4EGZA 1HKTA 3ZMSA 2EV0A 1BI2A 1ZN2A 3KLOA 5F1RA 3TDZC 2MBFA 2F5EA 4CICA 1XCBA 2L4MA 1IF1A 4M74A 1I6XA 1R23A 3RKXA 5LRRA 2BE5F 2P7VB 4ENKA 3ULQB 3MZYA 5HLHA 4R8HA 4E70A 2VC1A 4CHUA 4JQFA 2ZMEA 3F8CA 3GFMA 1WQ2A 1H9TA 2XGXA 1U3EM 3RDIA 3VB2A 2EA2A 4BYYA 2D1VA 3MZHA 1RUOA 1KU3A 4BHPA 4Z2YA 1GXPA 4WX9A 3M8EA 3GYHX 2XASA 4ENJA 2B0LA 2HGCA 1ZLKA 2EFOA 2V79A 2A68F 3ZPLA 1B9MA 4KNYA 3EQLF 4MTEA 4EV0A 1R5HA 2NAZA 5HOOA 4XLPF 3SHFA 1KYWA 2K86A 3SZTA 2V1UA 2FBKA 2PN6A 2NNYA 1QZZA 2E1CA 4GXOA 2XAFA 1W5TA 4ZYHA 2W84A 2GA1A 2VODA 3CUQB 4HF0A 1OR7A 3J80Z 1XD7A 2O03A 4CYDA 2P8TA 4KDPA 1B4AA 4P9UA 1IAWA 2PMUA 2PG4A 4OIRF 5ICEA 3IHUA 5JHUA 5LHHA 1OYWA 2HYGD 5A2QZ 3WTXC 2RNJA 3MWMA 3LAPA 2G7HA 5HLIA 4AD9A 4A5MA 1ONVA 4WWCA 1D8JA 5DD4A 1WI9A 5HDNA 3IWFA 4U7DA 3CUOA 4RAYA 2CQKA 5DV5A 2J5OA 1YFHA 3F8NA 2O61A 5AIQA 3U1DA 3WTWC 4U0YA 4ON0A 3TDUC 1MGTA 1QO0D 5E1WA 2JZYA 4RGUA 5DCFA 1K79A 2IRFG 3FWEA 3FZVA 4RB1A 1FWZA 2A07F 3I58A 3T0YA 4CXFA 3I54A 1Z1DA 1D8KA 3QP6A 4BHBA 1V4RA 1Q1HA 1K78A 2FNPA 3KETA 2Y0MA 5D6EA 3JTHA 2HQNA 3J80K 3IRRA 2IPQX 4GO1A 4FX4A 6PAXA 3WE3A 3HTSB 2P5LC 5E17F 1LJ9A 4O3MA 1S6LA 2HR3A 1S7AA 3WGHA 2DQRA 3ABUA 4L9VA 1L0OC 1ZHFA 2V6CA 4NHJA 4MEYF 2D45A 5L3EA 2ZNYA 2VOPA 2ISZA 2TDXA 5BQTA 2VT2A 2L01A 2M1BA 1W7PB 4PDKA 3BPVA 4QLCU 1VTNC 1YO5C 1ZLJA 4HBLA 1NHAA 4A0YA 1T98A 2KIMA 3FHZA 1H0MA 1OYIA 2OD5A 3F8BA 1I27A 5FD6A 3ZMVA 2FBIA 3LFKA 4HV5A 3BJAA 3ZP5A 1P2FA 3J81K 2VXZA 3KP6A 2GZWA 5K1YA 3K69A 3JAMK 1KQ9A 1V3FA 1J7KA 2NYXA 1R1VA 4PCQA 2FMLA 1T6SA 4F7ZA 5BMZA 2DK8A 2JT1A 1OMIA 1G3WA 3O6BB 3OOPA 4HA8A 4KN7X 5D4SA 3F22A 1ZREA 4U0WA 3R6SA 2Z3YA 1BI0A 4Q48A 3F21A 3V8KA 1KU7A 2PJPA 1XDUA 4N9HA 3BZ6A 4ESFA 4ZH4F 2FE3A 4L0YB 2EK5A 1LDJA 4ZYGA 1BC8C 3ABTA 1XGOA 1HXDA 3S2WA 3I64A 2A61A 2YX4A 5ICCA 1BC7C 4EM1A 4I98B 2EWNA 1CF7A 3FXQA 4PGGA 3GZ5A 3WTUC 2STWA 2K7LA 2W25A 1SMTA 1XDSA 2AS5F 5TJJA 5LHGA 2PQ8A 4OMZA 2RDPA 3E6DA 5CVRA 4HF2A 4Q4ZF 3KFWX 3EUHA 3JTGA 2HS5A 2UXNA 3P7NA 1QNTA 3RI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEX A;  5J8C A;  3HSF A;  3I53 A;  1T39 A;  4L9J A;  4IVN A;  4GCV A;  2FEZ A;  4IRH A;  4I02 A;  3WTT C;  2V1D A;  1JGS A;  1XCV A;  4M9S A;  5ICG A;  1F4K A;  3KZY A;  4AWX B;  3COA C;  4LD5 A;  1TQI A;  3FMR A;  3HRS A;  2DAO A;  2QQB A;  4L18 B;  5FLX K;  2O3F A;  1FNN A;  1LEB A;  2FXA A;  1OPC A;  2KRF A;  2KKO A;  1U5T C;  3BY6 A;  3B02 A;  2P7C B;  2F5F A;  1J75 A;  2RN7 A;  4ASN A;  2QBY A;  1XB4 A;  2RV8 A;  2XAH A;  2OZ6 A;  1ZH5 A;  1FLI A;  1Z6R A;  2F5D A;  2FF4 A;  1SD7 A;  2ZCW A;  4YIF A;  1B1B A;  3B73 A;  2A69 F;  2ZJ2 A;  3M8F A;  1IN7 A;  1YW7 A;  4HX8 A;  3CUQ A;  1FY7 A;  2STT A;  2E7X A;  3ZMU A;  3E5X A;  4A12 A;  5TRD A;  3D0S A;  4EJW A;  4HX4 A;  3L7W A;  2CWE A;  2NS0 A;  3Q9S A;  4A6D A;  4WXH A;  3BP8 A;  2Z99 A;  5BS6 A;  1RI7 A;  2DQL A;  3C18 A;  1RIO H;  3GZ6 A;  5DUK A;  5ILU A;  4KFC A;  2QYO A;  3K0L A;  1MDM B;  2VE9 A;  5H6R A;  1EH7 A;  2V9V A;  3IKT A;  2LNB A;  3M9A A;  2OQR A;  4K2E A;  3ERE D;  3F6O A;  2FRH A;  4Y15 A;  2RQP A;  4I7H A;  1JHH A;  2HEO A;  5DEQ A;  2EFP A;  1FSH A;  5H20 A;  4LB6 B;  4HDU A;  1A04 A;  1B6A A;  1J59 A;  3T1B A;  1UCR A;  2D2W A;  1BIA A;  3LQQ A;  3WOD F;  3W6K B;  3TO7 A;  4RS8 A;  2X4H A;  5L3C A;  2FBH A;  2DPU A;  4M6Y A;  5AIP A;  3E97 A;  5DD8 A;  1KU9 A;  1KU2 A;  2UZK A;  3C3W A;  1B9N A;  1XSX A;  2QVO A;  1DPR A;  3TOA A;  2E1N A;  1IN8 A;  5BPI A;  2XUB A;  2L02 A;  4M9Z A;  4EJU A;  3O3K A;  4R79 A;  1C0W A;  4M9X A;  4CO8 A;  4ZYE A;  1ZYR F;  2LF8 A;  3V4G A;  1P4W A;  2Q2E A;  1PUE E;  3GFL A;  1SD5 A;  3Q9V A;  4KA4 A;  3CDH A;  5CJ9 A;  1ZGA A;  3HHH A;  2ADU A;  5ERI A;  5ICF A;  3JSP A;  1B59 A;  3GUD A;  2VN2 A;  1GVJ A;  5HLG A;  3T5X A;  3M7G A;  1BOA A;  5CYV A;  3LA7 A;  5FLX Z;  4UV8 A;  5LHI A;  4YII A;  4YG2 F;  1FSE A;  3ML6 A;  1K7A A;  1ZAR A;  2A5Y B;  3RYP A;  1TLH B;  1O3S A;  1YG2 A;  5L3D A;  5K5Q A;  2EV6 A;  1OKR A;  5JR3 A;  1FBU A;  3DQV C;  4YFN F;  4MGR A;  1PP7 U;  4HQE A;  1R22 A;  2DT5 A;  3I59 A;  4HZF A;  4OIN F;  2IT0 A;  2PEX A;  4XSX F;  1MJA A;  4S05 A;  1ULY A;  3L9F A;  3JAM Z;  3U2R A;  1TNS A;  5K5R A;  4L9T A;  1U5T B;  2M5W A;  4OIO F;  1Z7U A;  2VOO A;  3FMS A;  2QUF A;  1W4M A;  3NRV A;  5ILS A;  3EET A;  4ESJ A;  4XLN F;  2XKP A;  4ENN A;  4R1H A;  3FXU A;  2DK5 A;  3RPU A;  1XN7 A;  3KEO A;  1TBX A;  1G3S A;  2GXB A;  1HBX G;  1W5S A;  4I09 A;  2LF7 A;  5DCM A;  1J2X A;  2IW5 A;  3KP7 A;  5FFX A;  1QPM A;  3HSE A;  3ISP A;  5F64 A;  3QPH A;  3ZQ7 A;  2ZXJ A;  4FT8 A;  2IVM A;  3EYY A;  1S8N A;  2EV5 A;  1J9I A;  4LK1 F;  4EM2 A;  3SFZ A;  4U7B A;  4UXN A;  2ACJ A;  1SFU A;  1HW2 A;  3TKY A;  3REO A;  4MNU A;  2JSC A;  2KIF A;  1HST A;  3ZMZ A;  4AVP A;  3BOQ A;  4L5J A;  3HSR A;  5CVV A;  3SZP A;  2P5V A;  2XKO A;  1TW2 A;  1TTY A;  3KP5 A;  3V7C A;  3V8J A;  1JE8 A;  3J81 Z;  5EEH A;  1BN5 A;  4G7H F;  3ROU A;  1UHM A;  3E6B A;  3WTZ A;  5CVU A;  4NQW A;  3MCZ A;  1PDN C;  3R4K A;  4DNC A;  4LLG F;  1TNT A;  4LGW A;  2EFQ A;  1P4X A;  1STZ A;  4I2O A;  3HTU A;  1FZP B;  3R60 A;  1WSU A;  4UVA A;  3QRF F;  5FGM A;  3RYR A;  4HQM A;  2CG4 A;  2CGP A;  2HYF A;  1QQI A;  5BOX A;  2DFI A;  3GWZ A;  4LLL A;  4G7O F;  1U8R A;  2ISY A;  4ETS A;  4MEX F;  1XGN A;  4LB5 A;  2YU3 A;  1IXR C;  2Q0O A;  3CUQ C;  5LEK A;  2NRA C;  1YS7 A;  4BQA A;  3E6M A;  5LRS A;  3DPT A;  4H0E A;  3E5Q A;  4FHT A;  5E1Z B;  2G9W A;  2M45 A;  2VON A;  5ED4 A;  4MTD A;  4HX7 A;  2ELH A;  4KIG A;  1JXS A;  1R58 A;  4RGS A;  3O2P E;  3TO9 A;  4KUM A;  3G3Z A;  2JPC A;  4RGR A;  5L3G A;  3VEP A;  1QGP A;  3QPT A;  5FFZ A;  4HV6 A;  2RGV A;  3TQN A;  4P55 A;  2EJR A;  1MDM A;  1MJB A;  2M8E A;  3WGG A;  1DPU A;  3C1D A;  1WWX A;  1U2W A;  2R3S A;  3ECH A;  4MQV A;  4YFX F;  2H27 A;  1ZGJ A;  5E8I A;  2L4A A;  1HSJ A;  1UFM A;  4I0A A;  5KVR A;  1FBQ A;  2RVC A;  3K1M A;  3FM3 A;  3GW2 A;  3VFZ A;  2EFW A;  4HOB A;  2MH2 A;  3MFK A;  4PGH A;  3NQO A;  1IW7 F;  3DEU A;  2PLY A;  1KA8 A;  4M71 A;  3RKY A;  1HQC A;  4OIQ F;  3I59 B;  2COM A;  3CO6 C;  2XAQ A;  4KYW A;  3L00 A;  4LMY A;  2M87 A;  2ESH A;  2XAG A;  1FBS A;  5HS8 A;  3FF5 A;  4A6E A;  1YIO A;  3R0J A;  2G7U A;  5LGT A;  4LK0 F;  4KT5 C;  4XRF A;  2P6T A;  1MKM A;  3R61 A;  5D4R A;  4A0Z A;  5AON A;  2MH9 A;  4EGY A;  3HIF A;  2GXG A;  4G94 A;  1LVA A;  4BAY A;  3GVA A;  4EVI A;  5JVT A;  3GEZ A;  2P6S A;  2WTE A;  3BWG A;  4GYG A;  4RGX A;  2QBY B;  4UHT A;  2QM3 A;  4KIB A;  4UV9 A;  3L09 A;  2D1H A;  3FM5 A;  4AIJ A;  1SD4 A;  1DUX C;  4WF2 A;  1WKM A;  1ZG5 A;  1S3J A;  1Y0U A;  1O3Q A;  2F2E A;  2RC4 A;  4UVC A;  1YTY A;  3F8F A;  4QWQ A;  1IXS B;  3LA2 A;  2HTJ A;  4BHC A;  5JI6 A;  2IP2 A;  2OZU A;  1IRG A;  1CF7 B;  2ZO4 A;  4IF4 A;  3GF2 A;  3DPL C;  2PI0 A;  5J8F A;  4CZZ A;  4Y17 A;  3EYI A;  2P4W A;  1F5T A;  3NEU A;  3PFI A;  1UB9 A;  2WV0 A;  2PFB A;  4RB2 C;  1S29 A;  3F8M A;  3F3X A;  2EFN A;  1SMY F;  1LEA A;  5DDG A;  1IXC A;  2EA4 A;  4RB3 C;  4HLX A;  2DW4 A;  2XIG A;  1XSV A;  4KIF A;  1ZAO A;  3Q5F A;  1I1S A;  5ILV A;  3WTY C;  2NNN A;  5E1X A;  3FX3 A;  2HKO A;  2OQG A;  3K9T A;  1LQ1 A;  1EV7 A;  2MA3 A;  3IWZ A;  3CTA A;  2CO5 A;  2LSO A;  4L0Z B;  2YR2 A;  3BDD A;  5LEJ A;  1X3U A;  2H09 A;  2VC0 A;  3LST A;  3KP2 A;  1TW3 A;  2ZNZ A;  5DCM B;  1XMA A;  2MC3 A;  4WXC A;  2FOK A;  1BBY A;  3P9C A;  2H6B A;  5HDK A;  1E2X A;  4G7Z F;  3CO7 C;  5E8G A;  1P4A A;  4L5I A;  4P96 A;  3G73 A;  1REP C;  1L3L A;  2VBY A;  5FB2 A;  4LG0 A;  2HDC A;  2VBW A;  1O7L A;  4G6Q A;  2GIV A;  4GGG A;  3HOT A;  3SQN A;  1R00 A;  3E3V A;  2IA2 A;  4M72 A;  2R7F A;  3ZN1 A;  3GLX A;  2PMH A;  4IPA A;  3TOB A;  2YSR A;  4WCG A;  2L3D A;  1MJ9 A;  2W85 A;  2DLL A;  3DP7 A;  2EB7 A;  3RTR A;  3D5L A;  1XMK A;  3EDP A;  1BM9 A;  1LDD A;  2W24 A;  5HDG A;  2FSW A;  4FX0 A;  4BH9 A;  3TO6 A;  1O7F A;  4G6D A;  3HRT A;  5HVQ C;  1P92 A;  3HYI A;  3RKW A;  1J0R A;  2WC2 A;  2LDU A;  4N9I A;  1KYZ A;  3I0T A;  3GFJ A;  4IJA A;  4M6X A;  4RAZ A;  4OIP F;  3K1P A;  3WE2 A;  5IT9 Z;  2X0L A;  1D5V A;  5EEG A;  2F5C A;  3VOE A;  2GWR A;  3F23 A;  5DYM A;  1R1U A;  2K27 A;  2QQ9 A;  3BRO A;  3L2C A;  4HF1 A;  2XVC A;  4IHS A;  4UNO A;  3ZMD A;  5LGN A;  4AIH A;  2ZME B;  3ZN0 A;  4YFK F;  1H9G A;  1T38 A;  1P6R A;  3QOP A;  3IKV A;  2BGC A;  4GYI A;  2YX7 A;  2HKX A;  2IA0 A;  1GXQ A;  2A3S A;  2R7D A;  3GX4 X;  1ON1 A;  1F9N A;  4KMF A;  1FX7 A;  3CJN A;  4ZZD A;  4RB0 A;  4CDG A;  3T8R A;  3MQ0 A;  4IHT A;  2PBI A;  3H3Z A;  4I0B A;  5D5U B;  1U78 A;  1IN5 A;  4L9N A;  1LDK B;  1K78 B;  1FYK A;  1FP1 D;  1SFE A;  1R5G A;  3PQJ A;  1EH6 A;  2OAZ A;  1IUY A;  3C7J A;  2QEN A;  4WXD A;  2Y75 A;  3K1N A;  4UUV A;  1BI3 A;  4CGZ A;  5HS7 A;  3HRU A;  2VE8 A;  1K6O A;  1UST A;  3VOD A;  4ENM A;  3ELK A;  1XGS A;  4B8X A;  3M1E A;  3V8L A;  3KEQ A;  2GQQ A;  4EM0 B;  4WK8 F;  3KCC A;  3WTS C;  3RPQ A;  1BIB A;  4Y13 A;  5D8K B;  3AAF A;  2QLZ A;  2YPR A;  1HKS A;  2Z5U A;  4HAM A;  2CFX A;  4KN4 X;  2O8X A;  3HUG A;  5HS9 A;  2WWY A;  3BPX A;  2VBZ A;  3LQR A;  1IZ1 A;  1YYV A;  2A6H F;  3N4M A;  4G8X A;  4O6J A;  3QU6 A;  1IRF A;  1RZ4 A;  4OU0 A;  1USS A;  1AWC A;  3WG9 A;  1W7P A;  4ESB A;  3LWF A;  1FT9 A;  1FOK A;  5L3F A;  1R1T A;  1Z9C A;  3F6V A;  4G9Y A;  2RKH A;  1O57 A;  1RUN A;  3W6J B;  4BNC A;  4AIK A;  2XRO A;  2GA2 A;  2MD5 A;  1KQ0 A;  2JRT A;  3FMQ A;  1G3Y A;  2HOE A;  4IRI A;  5J6X A;  3H3U A;  4PZJ A;  4MQ9 F;  2QQA A;  2OU2 A;  2H6C A;  4IXA A;  4OMY A;  2MLG A;  5CVJ A;  1T2K A;  1O3R A;  4XSZ F;  5E20 A;  4M73 A;  3V7S A;  1FPQ A;  2K4B A;  1ZG3 A;  1UHW A;  1DP7 P;  2E7W A;  2DO7 A;  2HWV A;  2ZBK A;  1T0F A;  2JTV A;  5FO5 A;  3LA3 A;  3HOS A;  3IL2 A;  3TGN A;  1I1G A;  3F72 A;  3KZZ A;  5LLQ A;  4ZYD A;  3R0A A;  3DKW A;  3RJP A;  4DQ2 A;  5H6Q A;  1YS6 A;  5LGU A;  1HKQ A;  2QZ8 A;  2VT3 A;  1HW1 A;  4LJZ F;  1U6G A;  1PP8 F;  1BJA A;  2CSO A;  2CW0 F;  4B09 A;  1RNL A;  4A0X A;  2ZFW A;  3T8T A;  4U88 A;  1FP2 A;  5L3B A;  3HHG A;  3WTV C;  4KIC A;  3BJ6 A;  3DXJ F;  3RIR A;  1R7J A;  2J5P A;  1TQP A;  2QWW A;  1IN4 A;  2P5K A;  1D3Y A;  5D5W B;  2C6Y A;  1U5T A;  1KQ8 A;  3SXY A;  1CGP A;  2O6G E;  2Q8K A;  2FMY A;  5D6F A;  1EH8 A;  4LG0 B;  4HLY A;  5CVI A;  1YW9 A;  2JPB A;  2O0Y A;  1G3T A;  5IT9 K;  1AOY A;  2M30 A;  2AXL A;  3GO5 A;  5BPD A;  2HTS A;  2Y48 A;  4D0P A;  1FYL A;  1QZY A;  3IRQ A;  2K02 A;  3FXR A;  3IC7 A;  4U0V A;  4A5N A;  4Q5S F;  4NB5 A;  5DUI A;  1ZG1 A;  1LNW A;  5LBQ A;  2HFH A;  1YQA A;  4EJT A;  3HRM A;  5FD5 A;  5D8L B;  3ECO A;  2KJB A;  1SD6 A;  2FA5 A;  1HW5 A;  1S7O A;  1E17 A;  2XV4 S;  1GHC A;  3QAH A;  1ZRC A;  2ESN A;  2DU9 A;  4BXU A;  3E5U A;  3E6C C;  1BI1 A;  4TV7 A;  4ZZL A;  1DDN A;  5A2Q K;  2XHK A;  1MD0 A;  3GXO A;  4HDV A;  3JSO A;  4A2U A;  4S04 A;  5K5O A;  4EMS A;  1XSD A;  1Z91 A;  2ETH A;  4UVB A;  2ZKZ A;  1WRJ A;  1JHF A;  2HZT A;  3K2Z A;  4LLN A;  4KMU X;  1F1Z A;  1OYY A;  1R36 A;  1W7P D;  2FNA A;  3PQK A;  1ZRF A;  3QU3 A;  2W57 A;  2K4J A;  2DI3 A;  3I4P A;  3JW4 A;  4XBF A;  1G4D A;  2CYY A;  2XRN A;  2FU4 A;  3KE2 A;  2OBP A;  2Z9O A;  2DBB A;  3CLO A;  2GAU A;  4JK1 X;  3DF8 A;  4Q47 A;  4EQQ A;  3U9G A;  4HYE A;  3GFI A;  3J7A O;  1IN6 A;  1YW8 A;  1XGM A;  5D5V B;  1Z6T A;  2BYV E;  3H92 A;  5KK1 A;  3KP3 A;  1KGS A;  1ODD A;  2UXX A;  4EJV A;  2H94 A;  1SAX A;  2IA1 A;  2XAJ A;  5E18 F;  4N0B A;  2KIU A;  3OV8 A;  3P9I A;  2HQR A;  4I01 A;  3WU1 B;  4O5V A;  4JBA A;  1I5Z A;  3KLN A;  4MHG A;  1G6N A;  1J5Y A;  2L54 A;  5CLS A;  4IRG A;  2BEO A;  3QP5 A;  3BJO A;  1FYM A;  3P9K A;  2Z33 A;  2DPD A;  2BV6 A;  2KJC A;  4P9F A;  3WGI A;  2OA4 A;  3V7R A;  1Z05 A;  2BBY A;  2IJL A;  2A6E F;  1SFX A;  1FC3 A;  1TQM A;  1MZB A;  5F6F A;  3I5U A;  4P5O A;  1LB2 A;  1O3T A;  2UWM A;  1ON2 A;  3N97 A;  3I71 A;  2VBX A;  2LKP A;  3KP4 A;  3LAJ A;  2V1X A;  3MAJ A;  1YLF A;  3DV8 A;  1QBJ A;  2DTR A;  3DFG A;  5IT3 A;  3ZMT A;  2MLK A;  4HW0 A;  5JFR A;  2FQ3 A;  4OOI A;  4LFU A;  3WU0 A;  1ZRD A;  4EJO A;  5D5X B;  4EGZ A;  1HKT A;  3ZMS A;  2EV0 A;  1BI2 A;  1ZN2 A;  3KLO A;  5F1R A;  3TDZ C;  2MBF A;  2F5E A;  4CIC A;  1XCB A;  2L4M A;  1IF1 A;  4M74 A;  1I6X A;  1R23 A;  3RKX A;  5LRR A;  2BE5 F;  2P7V B;  4ENK A;  3ULQ B;  3MZY A;  5HLH A;  4R8H A;  4E70 A;  2VC1 A;  4CHU A;  4JQF A;  2ZME A;  3F8C A;  3GFM A;  1WQ2 A;  1H9T A;  2XGX A;  1U3E M;  3RDI A;  3VB2 A;  2EA2 A;  4BYY A;  2D1V A;  3MZH A;  1RUO A;  1KU3 A;  4BHP A;  4Z2Y A;  1GXP A;  4WX9 A;  3M8E A;  3GYH X;  2XAS A;  4ENJ A;  2B0L A;  2HGC A;  1ZLK A;  2EFO A;  2V79 A;  2A68 F;  3ZPL A;  1B9M A;  4KNY A;  3EQL F;  4MTE A;  4EV0 A;  1R5H A;  2NAZ A;  5HOO A;  4XLP F;  3SHF A;  1KYW A;  2K86 A;  3SZT A;  2V1U A;  2FBK A;  2PN6 A;  2NNY A;  1QZZ A;  2E1C A;  4GXO A;  2XAF A;  1W5T A;  4ZYH A;  2W84 A;  2GA1 A;  2VOD A;  3CUQ B;  4HF0 A;  1OR7 A;  3J80 Z;  1XD7 A;  2O03 A;  4CYD A;  2P8T A;  4KDP A;  1B4A A;  4P9U A;  1IAW A;  2PMU A;  2PG4 A;  4OIR F;  5ICE A;  3IHU A;  5JHU A;  5LHH A;  1OYW A;  2HYG D;  5A2Q Z;  3WTX C;  2RNJ A;  3MWM A;  3LAP A;  2G7H A;  5HLI A;  4AD9 A;  4A5M A;  1ONV A;  4WWC A;  1D8J A;  5DD4 A;  1WI9 A;  5HDN A;  3IWF A;  4U7D A;  3CUO A;  4RAY A;  2CQK A;  5DV5 A;  2J5O A;  1YFH A;  3F8N A;  2O61 A;  5AIQ A;  3U1D A;  3WTW C;  4U0Y A;  4ON0 A;  3TDU C;  1MGT A;  1QO0 D;  5E1W A;  2JZY A;  4RGU A;  5DCF A;  1K79 A;  2IRF G;  3FWE A;  3FZV A;  4RB1 A;  1FWZ A;  2A07 F;  3I58 A;  3T0Y A;  4CXF A;  3I54 A;  1Z1D A;  1D8K A;  3QP6 A;  4BHB A;  1V4R A;  1Q1H A;  1K78 A;  2FNP A;  3KET A;  2Y0M A;  5D6E A;  3JTH A;  2HQN A;  3J80 K;  3IRR A;  2IPQ X;  4GO1 A;  4FX4 A;  6PAX A;  3WE3 A;  3HTS B;  2P5L C;  5E17 F;  1LJ9 A;  4O3M A;  1S6L A;  2HR3 A;  1S7A A;  3WGH A;  2DQR A;  3ABU A;  4L9V A;  1L0O C;  1ZHF A;  2V6C A;  4NHJ A;  4MEY F;  2D45 A;  5L3E A;  2ZNY A;  2VOP A;  2ISZ A;  2TDX A;  5BQT A;  2VT2 A;  2L01 A;  2M1B A;  1W7P B;  4PDK A;  3BPV A;  4QLC U;  1VTN C;  1YO5 C;  1ZLJ A;  4HBL A;  1NHA A;  4A0Y A;  1T98 A;  2KIM A;  3FHZ A;  1H0M A;  1OYI A;  2OD5 A;  3F8B A;  1I27 A;  5FD6 A;  3ZMV A;  2FBI A;  3LFK A;  4HV5 A;  3BJA A;  3ZP5 A;  1P2F A;  3J81 K;  2VXZ A;  3KP6 A;  2GZW A;  5K1Y A;  3K69 A;  3JAM K;  1KQ9 A;  1V3F A;  1J7K A;  2NYX A;  1R1V A;  4PCQ A;  2FML A;  1T6S A;  4F7Z A;  5BMZ A;  2DK8 A;  2JT1 A;  1OMI A;  1G3W A;  3O6B B;  3OOP A;  4HA8 A;  4KN7 X;  5D4S A;  3F22 A;  1ZRE A;  4U0W A;  3R6S A;  2Z3Y A;  1BI0 A;  4Q48 A;  3F21 A;  3V8K A;  1KU7 A;  2PJP A;  1XDU A;  4N9H A;  3BZ6 A;  4ESF A;  4ZH4 F;  2FE3 A;  4L0Y B;  2EK5 A;  1LDJ A;  4ZYG A;  1BC8 C;  3ABT A;  1XGO A;  1HXD A;  3S2W A;  3I64 A;  2A61 A;  2YX4 A;  5ICC A;  1BC7 C;  4EM1 A;  4I98 B;  2EWN A;  1CF7 A;  3FXQ A;  4PGG A;  3GZ5 A;  3WTU C;  2STW A;  2K7L A;  2W25 A;  1SMT A;  1XDS A;  2AS5 F;  5TJJ A;  5LHG A;  2PQ8 A;  4OMZ A;  2RDP A;  3E6D A;  5CVR A;  4HF2 A;  4Q4Z F;  3KFW X;  3EUH A;  3JTG A;  2HS5 A;  2UXN A;  3P7N A;  1QNT A;  3RI4 A; 
#chains in the Genus database with same CATH topology
 3MEX A;  5J8C A;  3IV5 A;  3HSF A;  3I53 A;  4MLO A;  1H89 C;  1LPQ A;  1T39 A;  4L9J A;  4IVN A;  4GCV A;  1QPI A;  2FEZ A;  3PSI A;  4IRH A;  4I02 A;  4LIV A;  4KJZ A;  3HGY A;  2V1D A;  3WTT C;  1JGS A;  1XCV A;  4M9S A;  5ICG A;  1F4K A;  3V42 A;  2M9H A;  3KZY A;  4AWX B;  3COA C;  4E7K A;  1JJ6 C;  4LD5 A;  4D1Q A;  2DDB A;  1TQI A;  5GTH C;  3FMR A;  3HRS A;  5GP9 A;  2DAO A;  3K6G A;  2QQB A;  4DBQ A;  3GTL J;  3OYI A;  4L18 B;  2HVR A;  5FLX K;  1IO2 A;  2O3F A;  2JK3 A;  3A01 A;  1FNN A;  2DXI A;  1LEB A;  2FXA A;  1A35 A;  1A36 A;  2KPM A;  4W97 A;  1NK2 P;  3KIO A;  1OPC A;  2KRF A;  2KKO A;  1U5T C;  3OIO A;  3BY6 A;  3B02 A;  3CMY A;  3GCM A;  3S3N A;  4FET A;  4UUS B;  2P7C B;  2OUM A;  3BLY A;  2F5F A;  1J75 A;  5C4X J;  2RN7 A;  4ASN A;  1MIJ A;  3PL8 A;  4C9Y A;  2K9M A;  4F92 B;  2QBY A;  3H5N A;  1XB4 A;  3BG7 A;  2RV8 A;  2W1O A;  2XAH A;  1V55 H;  1MMA A;  2OZ6 A;  1ZH5 A;  4PSW A;  3HZJ A;  1FLI A;  2LRE A;  1QHH D;  1ZK8 A;  1GV5 A;  1Z6R A;  2F5D A;  4CSW A;  4UY8 I;  2FF4 A;  1SD7 A;  2ZCW A;  3OS2 A;  3L2R A;  3SJM A;  4YIF A;  2E1O A;  1B1B A;  3B73 A;  2A69 F;  3CES A;  2ZJ2 A;  1PUF A;  1I50 J;  1FJL A;  1V5F A;  3M8F A;  5GPA A;  2DMU A;  2W82 A;  1IN7 A;  1YW7 A;  2O8K A;  4RLF A;  4HX8 A;  1Z3Y A;  2HDW A;  4DZP A;  3CUQ A;  4X0G A;  4II2 A;  3WHB A;  1FY7 A;  3UR3 C;  2STT A;  2E7X A;  1N25 A;  3ZMU A;  3E5X A;  4A12 A;  5C4J J;  2E1M C;  4MO7 A;  3H3V K;  2HI3 A;  1F36 A;  3TBI A;  1D0Z A;  2JUG A;  5TRD A;  3D0S A;  3WHC A;  5IYC J;  2A6T A;  1HF0 A;  2RRE A;  1NK3 P;  1DU6 A;  4EJW A;  2R5Z A;  1Y8Q B;  2XPU A;  4HX4 A;  3ABL H;  2HOT A;  2DOA A;  3L7W A;  4A3L J;  4B43 A;  2CWE A;  2NS0 A;  1HLV A;  3AG1 H;  3Q9S A;  1QU3 A;  4A6D A;  2HPM A;  2D5V A;  3K4M A;  4WXH A;  3BP8 A;  2EZL A;  3ZQI A;  2Z99 A;  4ZDP A;  5BS6 A;  4YEJ A;  1RI7 A;  2DQL A;  3C18 A;  1RIO H;  3GZ6 A;  3FBI B;  5DUK A;  5ILU A;  1YX3 A;  4KFC A;  2XGD A;  5F0H A;  3GTG J;  2QYO A;  3K0L A;  2K5C A;  4LIT A;  1MDM B;  2KHM A;  2VE9 A;  5H6R A;  1EH7 A;  3C2H A;  1AKH A;  2V9V A;  1TWA J;  4BY7 J;  4DJA A;  3IKT A;  1X2M A;  2LNB A;  3M9A A;  5J1U A;  4F91 B;  2OQR A;  2V1N A;  4K2E A;  1VZ0 A;  1BR4 A;  3TW7 A;  2L9N A;  3ERE D;  3N05 A;  2ZJP F;  2V4J C;  3F6O A;  2FRH A;  4Y15 A;  2GIZ A;  1ZQ3 P;  3L2W A;  2RQP A;  4I7H A;  1GVD A;  1JHH A;  3A4C A;  3H5A A;  2HEO A;  4GDF A;  2M3A A;  2Z2S B;  4HPQ A;  2EFP A;  5DEQ A;  1ZR4 A;  1FSH A;  4L5E A;  5H20 A;  4LB6 B;  4HDU A;  1A04 A;  1B6A A;  3LSR A;  1J59 A;  2HXI A;  4GRI A;  2FQ4 A;  3T1B A;  1UCR A;  2D2W A;  1XC5 A;  1BIA A;  2LLK A;  3LQQ A;  4PK4 A;  1Y1W J;  2CQ7 A;  3WOD F;  3W6K B;  3TO7 A;  4JYK A;  4RS8 A;  2X4H A;  5L3C A;  2FBH A;  1VI0 A;  1K4T A;  2DPU A;  4M6Y A;  5AIP A;  4HNU A;  3G1L A;  3OOU A;  3DU5 A;  4XRS A;  3E97 A;  3IUO A;  5DD8 A;  2K85 A;  1KU9 A;  2DJN A;  1KU2 A;  1I6H J;  2QGU A;  3O8G A;  3JRC A;  1FOY A;  2VJ5 A;  2UZK A;  3C3W A;  1B9N A;  4FE7 A;  1XSX A;  2QVO A;  1DPR A;  2IBD A;  1MMD A;  2E1N A;  2DYS H;  2VL8 A;  4YEL A;  1IN8 A;  3TOA A;  5BPI A;  2XUB A;  2L02 A;  4M9Z A;  2FX0 A;  4EJU A;  3O3K A;  2M8G X;  4R79 A;  1C0W A;  4M9X A;  2AO9 A;  4CO8 A;  4ZYE A;  1ZYR F;  4BDZ A;  1WH7 A;  2ZME C;  2V7F A;  2LF8 A;  4BU2 A;  3V4G A;  1P4W A;  3K4B A;  2X51 A;  2Q2E A;  2B9S A;  1OCR H;  1SD5 A;  3GFL A;  1X1P A;  4XKV A;  1PUE E;  2DMQ A;  3Q9V A;  2K9Q A;  4KA4 A;  3CDH A;  2RQQ A;  2PMZ N;  5CJ9 A;  1ZGA A;  3HHH A;  2ADU A;  5ERI A;  5ICF A;  5J1Y A;  3JSP A;  3I56 I;  2ICW G;  3CF5 F;  3PO2 J;  2ZSH B;  3BQY A;  2O9L A;  1B59 A;  3GUD A;  2VN2 A;  1GVJ A;  5HLG A;  4PJN A;  3T5X A;  3M7G A;  3M4O J;  2V9K A;  5GAD J;  5J40 A;  1BOA A;  5CYV A;  3LA7 A;  1NTC A;  1Z7L A;  3OYH A;  3PNT A;  4OAZ A;  5FKM A;  4C30 A;  5FLX Z;  3OY9 A;  3PJR A;  3RQ4 A;  2CQN A;  1VND A;  4RAG A;  4UV8 A;  4ZJZ A;  5LHI A;  1IDZ A;  2E34 A;  1R49 A;  4QPQ A;  4YII A;  4YG2 F;  3EUA A;  1FSE A;  3ML6 A;  1K7A A;  1ZAR A;  2A5Y B;  3OR2 C;  1DU0 A;  3RYP A;  1TLH B;  1O3S A;  2XSD C;  1YG2 A;  5L3D A;  4PJJ A;  5K5Q A;  3AKZ A;  2EV6 A;  1OKR A;  3JRA A;  5JR3 A;  1FBU A;  3DQV C;  1VQL I;  2P81 A;  4YFN F;  4MGR A;  3WU2 C;  5KAF C;  2Z1D A;  2X6X A;  3CCR I;  1YI2 I;  4BJ6 C;  2LY2 A;  2MSY A;  2R5Z B;  1PP7 U;  4I6Z A;  3TL4 X;  1UJ8 A;  4HQE A;  4M3F A;  1R22 A;  1OLT A;  2DT5 A;  3I59 A;  3L1P A;  4HZF A;  3C2B A;  4OIN F;  3ABM H;  2IT0 A;  2PEX A;  1RES A;  4XSX F;  3HOZ J;  3QYE A;  1MJA A;  4YIR X;  2A05 A;  3BR0 A;  1YHQ I;  4S05 A;  1QA6 A;  2BHZ A;  1ULY A;  2EQR A;  3L9F A;  5GAG J;  3JAM Z;  3U2R A;  4XM3 A;  1TNS A;  5K5R A;  4L9T A;  2F6C A;  1U5T B;  2M5W A;  2VUM J;  4OIO F;  3QQA A;  1Z7U A;  2VOO A;  3FMS A;  5M3F J;  2MG4 A;  2QUF A;  1JKR C;  3L2Q A;  1W4M A;  3NRV A;  5ILS A;  4GFB A;  3EET A;  4ESJ A;  4XLH A;  4XLN F;  2XKP A;  2OTJ I;  4ENN A;  4R1H A;  4IHX A;  3H5R A;  4KT6 A;  3FXU A;  5K7F A;  2DK5 A;  2EZK A;  3RPU A;  1XN7 A;  3KEO A;  1TBX A;  1G3S A;  1JKP C;  3Q0U A;  2GXB A;  3S1M J;  1ITY A;  5GAE J;  1HBX G;  1W5S A;  1RPW A;  3CCM I;  3NWT A;  3M07 A;  4I09 A;  1XG1 A;  2IGM A;  2LF7 A;  5HLT A;  5DCM A;  4JP0 A;  1Y0N A;  4CYC B;  2CUZ A;  1J2X A;  2IW5 A;  3KP7 A;  5FFX A;  1QPM A;  3HSE A;  3ISP A;  3LSM A;  3QPH A;  5F64 A;  3ZQ7 A;  3HOW J;  1K6Y A;  2ZXJ A;  2LH9 A;  2GOM A;  3D5R C;  4FT8 A;  1JGG A;  2IVM A;  3EYY A;  2DA6 A;  1S8N A;  2EV5 A;  1J9I A;  1X4P A;  4LK1 F;  4EM2 A;  4IQJ A;  4PFO A;  4Y4R A;  3SFZ A;  3G1M A;  1B72 B;  3CC2 I;  1P9Q C;  4U7B A;  2DA7 A;  2MD0 A;  5B1A H;  5FKO A;  3DPU A;  1IGN A;  1MSF C;  1OIS A;  4UXN A;  2ACJ A;  1SFU A;  3DBH B;  4B3A A;  3G4S I;  1MBK A;  1HW2 A;  3TKY A;  3CC4 I;  3REO A;  3GTO J;  3S15 J;  3K7A J;  2LYC A;  5E3N A;  4MNU A;  2JSC A;  2KIF A;  1K83 J;  3LSP A;  1HST A;  3ZMZ A;  1D1C A;  4AVP A;  3J7A Y;  3BOQ A;  4L5J A;  2R5Y B;  2EIM H;  3HSR A;  5F0C A;  5CVV A;  2KDO A;  3SZP A;  2P5V A;  2XKO A;  2XDV A;  3OYG A;  4XOT A;  2QKM B;  4XKB A;  3QOD A;  1TW2 A;  2UV1 A;  4XRM A;  1JT6 A;  3SEQ A;  3U1K A;  3CMA I;  1TTY A;  3KP5 A;  3V7C A;  3V8J A;  1JE8 A;  3J81 Z;  2ECB A;  3ASN H;  3CC7 I;  1YJN I;  5EEH A;  1BN5 A;  2EZI A;  4RDU A;  4G7H F;  3ROU A;  1UHM A;  1XMX A;  2HNH A;  3DEW A;  3E6B A;  3WTZ A;  2E1M B;  3MKW B;  5CVU A;  5GTI C;  3LMM A;  5JHF A;  4NQW A;  1OCZ H;  3S1R J;  3MCZ A;  4ZTJ A;  1HDD C;  1HA8 A;  1PDN C;  2YUS A;  3R4K A;  4DNC A;  4LLG F;  1FOW A;  1IDY A;  1TNT A;  4LGW A;  2EFQ A;  2NS8 A;  1P4X A;  1STZ A;  4E4H A;  4I2O A;  1X3Z B;  3HTU A;  1FZP B;  3R60 A;  3CDL A;  1DGR M;  1WSU A;  4UVA A;  3QRF F;  5FGM A;  3RYR A;  3QOE A;  5EZH A;  1IRZ A;  3P5J A;  1JTY A;  2VIX A;  2X6O A;  4HQM A;  2CG4 A;  2Y31 A;  1S5L C;  2CGP A;  1MND A;  1SFO J;  3H9G A;  2HYF A;  4IHV A;  1QQI A;  1WJE A;  1BR1 A;  5BOX A;  2DFI A;  3GWZ A;  4B3X A;  4LLL A;  1VQN I;  4G7O F;  1FIA A;  3AL0 B;  3VSK A;  4M3B A;  2E36 A;  1U8R A;  2ISY A;  1HDP A;  2F4I A;  2Y69 H;  4NQW B;  4XLE A;  1MNM C;  4ETS A;  4MEX F;  2LP0 A;  1ETX A;  1T33 A;  1XGN A;  4LB5 A;  2DMT A;  3J7Y J;  2YU3 A;  4J19 A;  1IXR C;  2Q0O A;  3CUQ C;  5LEK A;  1IC8 A;  3S3O A;  2E2I J;  2NRA C;  1PUF B;  1YS7 A;  1HOM A;  3FBN B;  4BQA A;  1V5G A;  1JI8 A;  2WAQ A;  3CMM A;  3A0B C;  3E6M A;  1T95 A;  1MMN A;  1XTA A;  2FJ1 A;  5LRS A;  3DPT A;  3MKZ A;  4H0E A;  4UUS A;  3E5Q A;  4FHT A;  3RPU D;  2GOX B;  5E1Z B;  2ME6 A;  1SAU A;  2G9W A;  2VPL A;  3DBL B;  2M45 A;  2VON A;  5ED4 A;  3VYU B;  4MTD A;  2NOJ B;  4B1R A;  1J09 A;  4HX7 A;  2ELH A;  2LMD A;  1POG A;  4KIG A;  4IZZ A;  3HOY J;  1PJR A;  3ZCO A;  1JXS A;  1R58 A;  2ZC2 A;  2MGQ A;  4RGS A;  3I4N J;  2JQ7 A;  3JR9 A;  1IRX A;  3O2P E;  3TO9 A;  4KUM A;  3FXO A;  3G3Z A;  2JPC A;  1ZTR A;  3K4L A;  4RGR A;  3HC7 A;  2CW7 A;  3CCS I;  5L3G A;  3VEP A;  4OAY A;  1QGP A;  3QPT A;  5FFZ A;  4HV6 A;  2X1E A;  2RGV A;  3TQN A;  2K3F A;  4P55 A;  2EJR A;  2IGK A;  1TWF J;  4IL6 C;  1MDM A;  1VQP I;  1MJB A;  2M8E A;  2ZXH A;  3WGG A;  2R5Y A;  1DPU A;  3B6C A;  1WWX A;  1U2W A;  2R3S A;  3C1D A;  4KIT B;  3ECH A;  4XQF A;  4MQV A;  2B63 J;  4YFX F;  4CCO A;  4BQN A;  1FOX A;  2AQF A;  1E0E A;  2EIN H;  3G2B A;  2H27 A;  1ZGJ A;  2VAS A;  5E8I A;  2L4A A;  1HSJ A;  1UFM A;  3EUH C;  1U9N A;  4I0A A;  5KVR A;  1FBQ A;  3BR1 A;  4IEJ A;  2RVC A;  3K1M A;  5C3E J;  1MBF A;  3SEZ A;  4AUX A;  3FM3 A;  3GW2 A;  2VQC A;  3VFZ A;  2EFW A;  4J01 A;  3FHN A;  4HOB A;  2MH2 A;  3RKQ A;  2H8R A;  3MFK A;  3LSK A;  4PGH A;  4EEF G;  3NQO A;  1X19 A;  1Z0X A;  1IW7 F;  3DEU A;  2DDA A;  1XPX A;  3ZQC A;  2PLY A;  3S14 J;  2VPR A;  2LTP A;  1KA8 A;  5K7H A;  4M71 A;  3RKY A;  3JCU C;  1HQC A;  4OIQ F;  3I59 B;  1D5Y A;  2COM A;  2R92 J;  3CO6 C;  2XAQ A;  4KYW A;  2JUC A;  3DTK A;  3L00 A;  4A3J J;  4LMY A;  3PO3 J;  2M87 A;  4IHY A;  3IH2 A;  4N4N B;  2VKD A;  2ESH A;  3HOX J;  1TT0 A;  2XAG A;  2GBY A;  1EF4 A;  2M4K A;  1VQ5 I;  1RET A;  1FBS A;  2LKS A;  5HS8 A;  3FF5 A;  5J4V A;  4A6E A;  3S2H J;  3OYA A;  3A0H C;  1YIO A;  3R0J A;  2G7U A;  1WFX A;  5LGT A;  2NXN B;  4LK0 F;  4HRI A;  4KT5 C;  1TP4 A;  4XRF A;  3OYE A;  3DKX A;  2P6T A;  1MKM A;  3R61 A;  5D4R A;  4A0Z A;  3MD2 A;  5AON A;  2MH9 A;  4EGY A;  3HIF A;  2DT7 B;  2CQQ A;  2NOG A;  2GXG A;  4FIS A;  5J47 A;  4G94 A;  1LVA A;  4BAY A;  4NC8 A;  3X2Q H;  4IQ4 A;  3GVA A;  5DM7 F;  4FE4 A;  4G6T B;  4EVI A;  5JVT A;  3PSF A;  3GEZ A;  2P6S A;  2WTE A;  3BWG A;  4GYG A;  4Y52 J;  3KZI C;  4II3 A;  4RGX A;  5HNH A;  2QBY B;  4H4K C;  1E3H A;  4UHT A;  2QM3 A;  5C44 J;  3ZQG A;  4KIB A;  4UV9 A;  1A31 A;  2WBM A;  3BTL A;  2D1H A;  3L09 A;  2OV7 A;  4ABZ A;  2R7Q A;  3FM5 A;  3OYD A;  4AIJ A;  1SD4 A;  1W0U A;  1DUX C;  4WF2 A;  2XB5 A;  1WKM A;  3H0G J;  1ZG5 A;  2KZG A;  1S3J A;  1Y0U A;  1O3Q A;  2F2E A;  4FQG A;  2RC4 A;  4UVC A;  4XN3 A;  1YTY A;  3F8F A;  4QWQ A;  1IXS B;  3LA2 A;  2HTJ A;  2IS4 A;  5IYD J;  4BHC A;  1NG6 A;  4FAS D;  3K2A A;  2RNG A;  2XGE A;  3K4K A;  5EG0 A;  5JI6 A;  2IP2 A;  1W1W E;  2M2E A;  4JX6 A;  2OZU A;  1IRG A;  3MKL A;  2ELK A;  1AU7 A;  1X3W B;  1B72 A;  2MW8 A;  2WY8 Q;  1CF7 B;  2ZO4 A;  2K9N A;  4IF4 A;  5EF6 A;  3GF2 A;  3OR1 C;  2XPV A;  4BY1 J;  5TGT A;  3DPL C;  2PI0 A;  5J8F A;  4CZZ A;  1G59 A;  2QSG X;  4Y17 A;  2HOA A;  3EYI A;  5KHD A;  2P4W A;  4D9J A;  1F5T A;  2LBF B;  3NEU A;  3PFI A;  3DWL E;  1UB9 A;  2WV0 A;  2PFB A;  1S7E A;  4A69 C;  4RB2 C;  1S29 A;  3RI4 A;  3F8M A;  2AHQ A;  4BJT A;  3DEE A;  3F3X A;  2EFN A;  1SMY F;  1LEA A;  4I99 C;  5DDG A;  1IXC A;  1ZGW A;  2EA4 A;  4RB3 C;  4HLX A;  2DW4 A;  4A3D J;  4QIW N;  2XIG A;  1XSV A;  3IAM 2;  2JA6 J;  4KIF A;  3TMO A;  1ZAO A;  3Q5F A;  1I1S A;  3G1O A;  5ILV A;  3S1N J;  3WTY C;  2NNN A;  2ME0 A;  5E1X A;  3FX3 A;  1ZEL A;  2HKO A;  3BCB A;  1R4N B;  2OQG A;  2ZFU A;  3K9T A;  1EV7 A;  1YE9 A;  2MA3 A;  3IWZ A;  3CTA A;  1LQ1 A;  1DP3 A;  2CO5 A;  2LSO A;  2IS2 A;  3BR6 A;  3HOV J;  3HXL A;  4L0Z B;  2YR2 A;  2EBI A;  3BDD A;  5LEJ A;  1F43 A;  4QTR A;  4NUB A;  1X3U A;  1SVL A;  2H09 A;  2VC0 A;  1Z77 A;  3LST A;  2WAE A;  2LD5 A;  2MFZ A;  3KP2 A;  4Z6Y A;  2DFH A;  2JRM A;  5KAI C;  2HXO A;  4PJM A;  1TW3 A;  2BW3 A;  2ZNZ A;  5DCM B;  2O7O A;  1XMA A;  2MC3 A;  3PNY A;  4WXC A;  1ZR2 A;  2FOK A;  1BBY A;  3P9C A;  2R93 J;  2H6B A;  1P7J A;  5HDK A;  1E2X A;  2L2O A;  4G7Z F;  1H8A C;  3CO7 C;  5E8G A;  1NG7 A;  1P4A A;  4L5I A;  4NDL A;  4D7M A;  2WAD A;  1D1A A;  1LFU P;  4P1W A;  4P96 A;  5H2F C;  3Q0W A;  1VQ7 I;  3GBG A;  3G73 A;  1REP C;  1L3L A;  2WB1 A;  2VBY A;  5FB2 A;  4LG0 A;  2HVS A;  2HDC A;  1TT5 B;  3FKJ A;  4C3I J;  3E0J B;  2VBW A;  4ZDO A;  2JA2 A;  1O7L A;  4G6Q A;  2GIV A;  2L0K A;  4GGG A;  5TIS C;  3HOT A;  3SQN A;  1R00 A;  2VKV A;  3ASO H;  3E3V A;  2IA2 A;  3H9J A;  3KPH A;  3LSG A;  4M72 A;  2R7F A;  3ZN1 A;  4BE2 A;  3GLX A;  1E3O C;  2PMH A;  4IPA A;  3TOB A;  2YSR A;  3K70 D;  3SDB A;  4WCG A;  2L3D A;  3CJQ B;  9ANT A;  3CCV I;  2W85 A;  1MJ9 A;  2V26 A;  2XB0 X;  2DLL A;  2KMU A;  3DP7 A;  2V9P A;  2V6E A;  2X1C A;  3K4C A;  4F3Q A;  2EB7 A;  1ETO A;  2W00 A;  3OL3 A;  3RTR A;  3D5L A;  4U87 A;  4JX5 A;  1XMK A;  2GXA A;  3EDP A;  3S93 A;  1BM9 A;  2LRD A;  1JUM A;  1LDD A;  2W24 A;  4BXX J;  4BQO A;  2L5Q A;  5HDG A;  3CF2 A;  2FSW A;  4FX0 A;  4BH9 A;  2BVL A;  1VFC A;  2VQH A;  2XAU A;  3TO6 A;  1RKT A;  1O7F A;  4G6D A;  5EEA A;  3HRT A;  5HVQ C;  2QSF X;  2N8G A;  3CZ6 A;  1P92 A;  4BGD A;  3HYI A;  3G71 I;  3EPZ A;  3OL4 A;  1SAN A;  3RKW A;  3DKY A;  2XRL A;  1IG7 A;  1J0R A;  2ECC A;  2WC2 A;  4HNT A;  5E3M A;  4E7H A;  2LDU A;  4N9I A;  4A3F J;  2DMP A;  1KYZ A;  3CCE I;  5E3O A;  3I0T A;  3GFJ A;  3BTJ A;  3KX2 A;  4IJA A;  4XOR A;  2QQ8 A;  4UB6 C;  4M6X A;  2DN0 A;  4RAZ A;  2LC2 A;  1UZC A;  3K1P A;  3WE2 A;  5FKL A;  4OIP F;  3M8J A;  1VQ6 I;  5IT9 Z;  2X0L A;  1D5V A;  5EEG A;  2F5C A;  4CH7 A;  2ZXI A;  3LFU A;  3VOE A;  2GWR A;  3F23 A;  2F4O B;  3PIO F;  5DYM A;  1R1U A;  1WJ5 A;  2K27 A;  2QQ9 A;  3EUK L;  3BRO A;  3L2C A;  4HF1 A;  4B4C A;  2UUZ A;  2XVC A;  4IHS A;  2QCO A;  1WH5 A;  4UNO A;  2OJE D;  3CLQ A;  3ZMD A;  1BR2 A;  4XIC A;  4A3B J;  5LGN A;  4CA0 A;  3A01 B;  4AIH A;  2A5W A;  2ZME B;  3CQZ J;  1Z3X A;  4ZYA A;  2BW3 B;  3ZN0 A;  2K3P A;  1H9G A;  4YFK F;  2BY2 A;  2KRH A;  1T38 A;  1P6R A;  3QOP A;  3IKV A;  1ETK A;  2BGC A;  4GYI A;  3I9V 2;  3GTM J;  5CQG A;  1I39 A;  2YX7 A;  2M0C A;  3SYT A;  2HKX A;  2IA0 A;  1GXQ A;  2A3S A;  5B1B H;  1OCO H;  1UG0 A;  3DLL F;  2M0M A;  2R7D A;  3GX4 X;  1ON1 A;  1LKX A;  1F9N A;  4KMF A;  3OYN A;  2Y0S N;  1FX7 A;  3CJN A;  4PSX A;  4ZZD A;  1MMS A;  4RB0 A;  4CDG A;  1AA7 A;  1OCT C;  3T8R A;  3MQ0 A;  4IHT A;  2PBI A;  3H3Z A;  3SDG A;  3B6A A;  4I0B A;  3MZ8 A;  5D5U B;  1U78 A;  1U8B A;  1UG2 A;  2E5N A;  2F4M B;  1IN5 A;  4L9N A;  1OCC H;  1W36 C;  3BC8 A;  3KEY A;  1LDK B;  1K78 B;  4E7S A;  2E5Z A;  1FYK A;  3HEF A;  3I3L A;  1FP1 D;  1SFE A;  2G0E A;  1R5G A;  3PQJ A;  1EA3 A;  2CV1 A;  1EH6 A;  2OAZ A;  2I8D A;  3C7J A;  1IUY A;  3KYC B;  4NC6 A;  2DFF A;  5FLM J;  2QEN A;  4WXD A;  1HC8 A;  4E7I A;  4RBO A;  2QSH X;  4BBS J;  2Y75 A;  3K1N A;  5J1R A;  4UUV A;  1BI3 A;  4CGZ A;  1MMG A;  3HB9 A;  4X1E A;  3ERM A;  5HS7 A;  1T0F C;  2BZT A;  4XLC A;  3HRU A;  4CCK A;  2HPI A;  4BUP A;  3S32 A;  1OR7 C;  2PMZ A;  4RMN A;  3VDX A;  2VE8 A;  1K6O A;  1UST A;  2NVQ J;  3QWL A;  5EG0 B;  3VOD A;  4ENM A;  3ELK A;  3KYD B;  1XGS A;  1O4X A;  3BTI A;  1G2H A;  4B8X A;  3M1E A;  3OYC A;  3V8L A;  3KEQ A;  4ANJ A;  2GQQ A;  4EM0 B;  4WK8 F;  3KCC A;  3WTS C;  3HL2 A;  3RPQ A;  1BIB A;  4Y13 A;  2CUF A;  5D8K B;  3AAF A;  4BXF A;  2QLZ A;  1Z21 A;  2YPR A;  2KLO A;  3BTC A;  4M3G A;  5F08 A;  1HKS A;  2Z5U A;  1BA5 A;  4HAM A;  2ELJ A;  1WHU A;  2CFX A;  3SFI A;  3CCY A;  4KN4 X;  1A6I A;  2O8X A;  3HUG A;  5EDN A;  5HS9 A;  3ONQ A;  3S1Q J;  2WWY A;  3BPX A;  2VBZ A;  3QYB A;  3LQR A;  1ENH A;  3RQI A;  1IZ1 A;  1JUS A;  1YYV A;  2A6H F;  1MW7 A;  3N4M A;  4AYB N;  4ZTF A;  3ABK H;  2OPT A;  4G8X A;  1KON A;  5EJC A;  2OC6 A;  2OCC H;  2CMP A;  4O6J A;  3MKY B;  3QU6 A;  2Z16 A;  1IRF A;  1RZ4 A;  4D5F A;  4OU0 A;  4BE1 A;  1ETV A;  1USS A;  1AWC A;  3WG9 A;  1W7P A;  2VLA A;  1D0Y A;  2M34 A;  2KIS A;  4ESB A;  3LWF A;  4D7N A;  5FKN A;  1FT9 A;  1FOK A;  3HGG A;  2L7F P;  4BEH B;  5L3F A;  1R1T A;  1Z9C A;  2ZXW H;  2JA5 J;  1ETQ A;  3I55 I;  1YRN B;  3F6V A;  1OQY A;  4G9Y A;  2RKH A;  2DA2 A;  3MN2 A;  2IS6 A;  2I5U A;  1O57 A;  2JMW A;  2XPW A;  3GTQ J;  1VQ8 I;  4CYC A;  1RUN A;  1DQU A;  1FMW A;  3W6J B;  4BNC A;  4AM3 A;  4CCN A;  4AIK A;  1MH4 A;  3HOU J;  2XRO A;  2GA2 A;  3CDI A;  2MD5 A;  1JTX A;  1KQ0 A;  2JRT A;  1I3Q J;  4BAC A;  2IAI A;  3FMQ A;  1VQK I;  4HG2 A;  1G3Y A;  2HOE A;  4AU7 A;  4DZJ A;  4IRI A;  3DCF A;  5J6X A;  3H3U A;  4PZJ A;  4ITV A;  3BZK A;  3ZQF A;  1W36 D;  3RZD J;  1VF9 A;  4MQ9 F;  2HDD A;  2QQA A;  2OU2 A;  4W1U A;  2HZD A;  2H6C A;  3JRI A;  4KIS A;  4IXA A;  2X85 A;  5M5W J;  4OMY A;  3BG6 A;  2MLG A;  5CVJ A;  1T2K A;  2L9V A;  1O3R A;  3DTI A;  4XSZ F;  5E20 A;  4MFE A;  2BOL A;  3F9K A;  2HVQ A;  4M73 A;  3V7S A;  1FPQ A;  1TZL A;  2K4B A;  3ZR8 X;  2JVG A;  3TED A;  1ZG3 A;  1UHW A;  1DP7 P;  2MAB A;  2E7W A;  1MH3 A;  2DO7 A;  5IP7 J;  2HWV A;  2W4S A;  2ZBK A;  1T0F A;  1VQO I;  2JTV A;  2EIJ H;  3CD6 I;  2XSJ C;  5FO5 A;  3GZN B;  3MMY B;  3AG4 H;  3LA3 A;  3HOS A;  3IL2 A;  4C3J J;  3CP2 A;  3AG2 H;  2IGO A;  4IHW A;  3TGN A;  1I1G A;  3F72 A;  3KZZ A;  5LLQ A;  4ZYD A;  4Y7N J;  3BR5 A;  5LD2 C;  2F48 A;  2MYS A;  3R0A A;  3DKW A;  3IAS 2;  3IP4 B;  2K9S A;  3RJP A;  3W6V A;  4DQ2 A;  4A3I J;  3PNV A;  4UUT A;  5H6Q A;  1YS6 A;  2LBF A;  3CME I;  5FRN A;  5LGU A;  1YX5 A;  1HKQ A;  2DA4 A;  2QZ8 A;  2BY1 A;  2VT3 A;  5B3S H;  1HW1 A;  4LJZ F;  1U6G A;  5CKT A;  1BJA A;  1PP8 F;  4V19 K;  1U9O A;  2CSO A;  3H0D A;  4CCM A;  1VQ4 I;  1RR8 C;  2CW0 F;  4B09 A;  1RNL A;  4A0X A;  2ZFW A;  3T8T A;  4M3D A;  4U88 A;  1FP2 A;  5L3B A;  3HHG A;  5FRM A;  1LFB A;  1D1B A;  1ORK A;  3WTV C;  4KIC A;  1QVU A;  4XN0 A;  3W2A A;  3BJ6 A;  4OWR B;  3DXJ F;  3OYJ A;  3RIR A;  2DT6 A;  1R7J A;  2EIL H;  2ZJQ F;  2J5P A;  1TQP A;  4BL0 B;  3L2U A;  1K4S A;  2Q1Z B;  2QWW A;  1IN4 A;  2P5K A;  1D3Y A;  2R7V A;  5D5W B;  2C6Y A;  1NH3 A;  1U5T A;  1T8I A;  1KQ8 A;  3SXY A;  1CGP A;  4DGW B;  2O6G E;  2Q8K A;  2FMY A;  5D6F A;  2LFB A;  1EH8 A;  4LG0 B;  4HLY A;  5CVI A;  3RSN A;  5K7Z A;  1RRJ A;  2R7S A;  1YW9 A;  2JPB A;  2O0Y A;  2CJJ A;  1G3T A;  5IT9 K;  1AOY A;  2Y9Y A;  2M30 A;  2AXL A;  3GO5 A;  5BPD A;  2CRG A;  1X1C A;  2HTS A;  2Y48 A;  4D0P A;  3QPL A;  1QZY A;  2OCE A;  1FYL A;  2LG4 A;  1X58 A;  1P7I A;  2CUE A;  3IRQ A;  2DOD A;  2K02 A;  2WB1 N;  1JKO C;  2JSP A;  3FXR A;  1BW5 A;  3CCQ I;  1MBG A;  1RKW A;  2MC4 A;  2KZV A;  3IC7 A;  4NC7 A;  2R7W A;  2XF7 A;  4B44 A;  4U0V A;  4A5N A;  2JN6 A;  4Q5S F;  3PUB A;  3DBR B;  1KZH A;  5EGO B;  4FTH A;  3OYL A;  4NB5 A;  5DUI A;  2WAQ N;  1ZG1 A;  1LNW A;  5LBQ A;  2R7Z J;  1MBJ A;  1D0X A;  2HFH A;  2QEX I;  4XON A;  1YQA A;  2CFO A;  4EJT A;  3HRM A;  5FD5 A;  5D8L B;  3ECO A;  2KJB A;  2IXS A;  1SD6 A;  3W3C A;  2FA5 A;  1EKE A;  1HW5 A;  2CW8 A;  2ZB9 A;  1S7O A;  2ID6 A;  1E17 A;  2XV4 S;  4A3C J;  3CCU I;  2TCT A;  1GHC A;  2M7B A;  3QAH A;  2YS9 A;  1ZRC A;  2DTZ A;  4AC0 A;  2JA8 J;  3OYF A;  2DMN A;  2ESN A;  1IV6 A;  4C2M J;  2I10 A;  2DU9 A;  3D1N I;  2Y2Z A;  4BXU A;  3E5U A;  3E6C C;  1WJA A;  1BI1 A;  4TV7 A;  4ZZL A;  1DDN A;  2FOW A;  4BQQ A;  5A2Q K;  3BR3 A;  2XHK A;  1MD0 A;  3ZQL A;  2DA5 A;  3AFH A;  3GXO A;  2R4G A;  5IPA A;  4HDV A;  3BZC A;  3JSO A;  2JA7 J;  2L7Z A;  2NVU B;  4A2U A;  2X48 A;  4S04 A;  5K5O A;  1LE8 B;  4EMS A;  2EH3 A;  1XSD A;  3FXJ A;  1Z91 A;  4NNJ A;  2LY1 A;  2ETH A;  4RA2 A;  4UVB A;  4IO9 F;  3H36 A;  4XKW A;  5FJ8 J;  4XK4 A;  2ZKZ A;  2VXD A;  2BXZ A;  3U21 A;  2NVT J;  1WRJ A;  1JHF A;  3DU6 A;  2EZH A;  4A3M J;  2HZT A;  3K2Z A;  4LLN A;  1WZ2 A;  4KMU X;  1F1Z A;  3OYK A;  1OYY A;  1R36 A;  1EJ9 A;  5E3L A;  1W7P D;  2XF6 A;  4BS9 A;  3OWT A;  2FNA A;  3PQK A;  1ZRF A;  4XOP A;  3QU3 A;  2W57 A;  2K4J A;  2DI3 A;  2E2H J;  2PJR B;  1YOV B;  3BG5 A;  3I4P A;  3JW4 A;  4XBF A;  1G4D A;  2CYY A;  2OF7 A;  3FKI J;  2XRN A;  2R7T A;  2FU4 A;  3KE2 A;  2Y0S A;  1R6R A;  3BG9 A;  2GM4 A;  2OBP A;  2Z9O A;  5J4Y A;  2DBB A;  3FK6 A;  3CLO A;  2GAU A;  4JK1 X;  4LIU A;  3DF8 A;  3TP3 A;  4Q47 A;  1B8I B;  4EQQ A;  1N77 A;  3U9G A;  5GAH J;  1X1D A;  4HYE A;  3GFI A;  3J7A O;  1IN6 A;  1YW8 A;  1AHD P;  1XGM A;  1IV8 A;  1ERD A;  2IGN A;  5D5V B;  3H35 A;  1JUP A;  5CQE A;  5HOD A;  1Z6T A;  2BYV E;  2KIQ A;  4IOC F;  3ZRG A;  3PIP F;  3H92 A;  5KK1 A;  2NS7 A;  2O5R A;  3A02 A;  3CJT B;  3L2V A;  2LOO A;  3M3Y J;  4LOC A;  3KP3 A;  1KGS A;  1ODD A;  2UXX A;  3OIP A;  4EJV A;  2H94 A;  1SAX A;  2CU7 A;  2IA1 A;  2XAJ A;  5E18 F;  4QPO A;  2OTL I;  4N0B A;  2RAE A;  2W48 A;  2KIU A;  3JRH A;  3OV8 A;  4BEH A;  1LUJ B;  2HQR A;  3P9I A;  4I01 A;  4O5V A;  3WU1 B;  3HJE A;  4JBA A;  1WGX A;  2XC7 A;  3IH3 A;  3VYS B;  4B48 A;  4F55 A;  4M6V A;  1I5Z A;  1RC9 A;  3KLN A;  5KNL A;  4MHG A;  4BJ5 C;  1G6N A;  1J5Y A;  1M1E B;  3FXM A;  2L54 A;  1SFK A;  2VKE A;  4XKC A;  5CLS A;  3A2K A;  4IRG A;  2BEO A;  3ZQH A;  3QP5 A;  4AYB A;  3LL7 A;  5EGO A;  3BJO A;  3RZO J;  5DS9 A;  1FYM A;  3A1Y A;  3P9K A;  2Z33 A;  2WY7 Q;  2DPD A;  1ACI A;  4XRS G;  3QPS A;  5IOZ A;  2BV6 A;  2KJC A;  4P9F A;  2H8W A;  3WGI A;  3O8H A;  2OA4 A;  3V7R A;  1Z05 A;  2BBY A;  3G6E I;  3S17 J;  1MBE A;  4F93 B;  2IJL A;  2AQE A;  2A6E F;  1SFX A;  5IOY A;  1FC3 A;  2VQL A;  1TQM A;  3M1C A;  3OYB A;  1MZB A;  4E6K G;  5F6F A;  3I5U A;  2Q2E B;  4P5O A;  1LB2 A;  3OS1 A;  5IY5 H;  3NAR A;  1O3T A;  3NWS A;  2UWM A;  3FXL A;  1ON2 A;  3N97 A;  2WV1 A;  3I71 A;  2VBX A;  1U0J A;  2LKP A;  3KP4 A;  3JRB A;  3LAJ A;  2DA1 A;  1OJL A;  3CJR B;  4D5C A;  2V1X A;  1SVM A;  3MAJ A;  4MIM A;  4AVZ A;  2R7O A;  1YLF A;  3DV8 A;  1QBJ A;  2DTR A;  1JJ8 C;  3DFG A;  1Y39 A;  5IT3 A;  2Y9Z A;  3ZMT A;  2MLK A;  3GTK J;  1QHG A;  4HW0 A;  3W2V A;  5JFR A;  2FQ3 A;  1GT0 C;  4OOI A;  1X1B A;  4JX4 A;  1FEX A;  4LFU A;  3WU0 A;  2CH0 A;  4EJO A;  5D5X B;  3J7Z I;  4EGZ A;  4BDY A;  3OSG A;  1WPK A;  1ZRD A;  4E7Z A;  1BJZ A;  3ZMS A;  2YU9 J;  1HKT A;  2EV0 A;  1BI2 A;  2L9S A;  4M3E A;  4V2F A;  3S8P A;  3FK7 A;  3OS0 A;  1R9T J;  1ZN2 A;  2NVX J;  3UNG C;  1UMQ A;  1BW6 A;  3KLO A;  5F1R A;  3GTP J;  3TDZ C;  5FKK A;  2MBF A;  1K61 A;  2F5E A;  4CIC A;  3CCJ I;  1XCB A;  3ZQQ A;  2L4M A;  1IF1 A;  4M74 A;  3JRE A;  3K4N A;  2L7K A;  1I6X A;  1R23 A;  2KFD A;  3FXK A;  3RKX A;  5GPC A;  3OYM A;  1YIT I;  5LRR A;  2BE5 F;  2P7V B;  1N75 A;  1WJB A;  4ENK A;  3ULQ B;  3MZY A;  5HLH A;  4PUS A;  2QA4 I;  4R8H A;  4E70 A;  2VC1 A;  3C2G A;  4CHU A;  4IOA F;  2PX9 A;  4JQF A;  2ZME A;  3F8C A;  4XMY A;  3GFM A;  1WQ2 A;  4XNF A;  1H9T A;  2XGX A;  2LR8 A;  1U3E M;  4G12 A;  3RDI A;  3VB2 A;  2EA2 A;  3FIS A;  4BYY A;  2D1V A;  2VJI A;  2DA3 A;  2TRT A;  1ZKG A;  3MZH A;  1RUO A;  1KU3 A;  4BHP A;  3HM5 A;  3TP0 A;  4Z2Y A;  3K70 C;  1GXP A;  3FIW A;  4FCY A;  3KYL A;  4WX9 A;  2B7E A;  2DFE A;  3M8E A;  3GYH X;  2DOE A;  2HQA A;  2K40 A;  1WJC A;  2XAS A;  5B5E C;  4ENJ A;  3VPR A;  1H88 C;  2B0L A;  2KQR A;  3VSL A;  2HGC A;  1ZLK A;  1OFC X;  2EFO A;  2GLO A;  2X9D A;  2V79 A;  1WJF A;  2BY3 A;  2KT0 A;  2A68 F;  3HPH A;  3ZPL A;  1B9M A;  3H9Q A;  2KP6 A;  3JRG A;  1APL C;  1N78 A;  1FTZ A;  4KNY A;  3EQL F;  4MTE A;  2K9L A;  3GLL A;  4EV0 A;  1RR7 A;  2VJJ A;  1R5H A;  3S16 J;  2HQ5 A;  2NAZ A;  5HOO A;  4XLP F;  3SHF A;  4CCJ A;  2FD5 A;  1LFP A;  1KYW A;  1SVO A;  2K86 A;  3SZT A;  2V1U A;  4F52 A;  2FBK A;  2JJ7 A;  2PN6 A;  1XX5 A;  2AXT C;  2NNY A;  1I3A A;  3BG3 A;  1QZZ A;  3ESW B;  2HOS A;  5IP6 A;  2E1C A;  4GXO A;  4ZC3 A;  2XAF A;  1TWC J;  1Y56 A;  3BR2 A;  3TW6 A;  2DJI A;  2M4G A;  1W5T A;  1UEL B;  2LY9 A;  4ZYH A;  2W84 A;  1TC3 C;  2FUG 2;  2GA1 A;  2VOD A;  4HNV A;  3CUQ B;  1E3P A;  4HF0 A;  1OR7 A;  3J80 Z;  1XD7 A;  3HKZ A;  4A3K J;  1X2N A;  1T56 A;  1Z67 A;  2O03 A;  3SZG A;  1IUF A;  1QZE A;  2P8T A;  3ZXS A;  4CYD A;  4KDP A;  2ID3 A;  4DYC A;  1B4A A;  4XLF A;  1Q1V A;  4P9U A;  1IAW A;  2PMU A;  4CZC A;  4DOZ A;  5F04 A;  1FMV A;  1SC7 A;  4Y3O A;  2PG4 A;  1S9H A;  2VKH A;  4OIR F;  5ICE A;  1AKH B;  4DBR A;  2E71 A;  3IHU A;  5JHU A;  5LHH A;  2VI6 A;  4HST A;  1OYW A;  2HYG D;  1GLN A;  5A2Q Z;  3Q3S A;  4DW6 A;  3WTX C;  2RNJ A;  3MWM A;  3LAP A;  4Y33 A;  2G7H A;  4IKF A;  5HLI A;  2LK2 A;  5IP9 J;  4X6A J;  4AD9 A;  4A5M A;  1JT0 A;  5M5X J;  2LKX A;  1ONV A;  1W0T A;  4WWC A;  3LSI A;  5FLV A;  1D8J A;  5DD4 A;  1WI9 A;  5HDN A;  2CQX A;  3LOC A;  2PJR A;  3IWF A;  1FTT A;  4U7D A;  3DLA A;  2XGC A;  3CUO A;  3BQZ A;  3JRD A;  4J00 A;  4RAY A;  2CQK A;  5DV5 A;  2J5O A;  1YFH A;  3A03 A;  3VYR B;  3NAU A;  4XR6 A;  3F8N A;  2O61 A;  1UAA A;  1GUU A;  1WI3 A;  3E7L A;  5AIQ A;  2CV0 A;  1OCP A;  3U1D A;  1A6Q A;  4E7J A;  2X6Y A;  4A3E J;  2DYR H;  3WTW C;  4U0Y A;  4ON0 A;  3TDU C;  2E35 A;  2DCE A;  1MGT A;  1QO0 D;  4NBQ A;  1UHS A;  3PM1 A;  5E1W A;  2JZY A;  4RGU A;  4A3G J;  3PFY A;  3BCA A;  3K4J A;  5DCF A;  1K79 A;  2IRF G;  3FWE A;  1VQ9 I;  3FZV A;  5JLW A;  4RB1 A;  1FWZ A;  1BL0 A;  5CPR B;  2A07 F;  3I58 A;  3T0Y A;  4MFD A;  4CXF A;  3I54 A;  1Z1D A;  1D8K A;  2WAF A;  3QP6 A;  4PJ0 C;  4BHB A;  2R0Q C;  1V4R A;  4HSR A;  2BXY A;  1Q1H A;  1BOB A;  1K78 A;  1ETY A;  2L7M P;  2FNP A;  3KET A;  3HDD A;  1QVT A;  1X1A A;  2Y0M A;  5D6E A;  2LVS A;  3JTH A;  2HQN A;  1Y8R B;  3J80 K;  3IRR A;  1GV2 A;  3VWB A;  4PJL A;  2IPQ X;  5DTD A;  4RM2 A;  4GO1 A;  1YJW I;  2BVM A;  4FX4 A;  2E2J J;  1MNE A;  2W7N A;  6PAX A;  3WE3 A;  3HTS B;  1V5E A;  2E19 A;  4N4O B;  2P5L C;  3LSJ A;  1LE8 A;  3HKZ N;  5E17 F;  1GDT A;  1LJ9 A;  5F1J A;  4BE0 A;  4O3M A;  1R4M B;  2VJ4 A;  3H1C A;  1S6L A;  2HR3 A;  4A93 J;  1WVR A;  1S7A A;  3WGH A;  2DQR A;  3ABU A;  4L9V A;  4ZDL A;  3S2D J;  5BNG A;  2KRC A;  3HBL A;  4RLQ A;  1L0O C;  4HEA 2;  1ZHF A;  2V6C A;  1VQM I;  5FRO A;  4JOM A;  5IYB J;  4NHJ A;  5M3M J;  4MEY F;  4C3H J;  4B47 A;  4C2T A;  3CP8 A;  2D45 A;  2QF7 A;  1FIP A;  2KL4 A;  5L3E A;  2CV2 A;  2VB6 A;  5KCM A;  2ZNY A;  1HCR A;  1QRY A;  4CUG A;  2VOP A;  3JRF A;  3OMY A;  3OIQ A;  2R7X A;  2R7R A;  2ISZ A;  2TDX A;  5BQT A;  2VT2 A;  2L01 A;  2M1B A;  5EZG A;  1MBH A;  1W7P B;  3D5S C;  4PDK A;  1YRN A;  1R71 A;  3BPV A;  4QLC U;  1S72 I;  2H1K A;  2CUJ A;  1TL8 A;  4BBR J;  1VTN C;  3AL0 C;  2EPF A;  1YO5 C;  3HUG B;  1ZLJ A;  4HBL A;  1NHA A;  1CQT A;  4A0Y A;  5LFA A;  1T98 A;  2KIM A;  3LSH A;  3FDY A;  3FHZ A;  1H0M A;  5M5Y J;  1OYI A;  3WG7 H;  3IH4 A;  2L9R A;  2JVH A;  3F8B A;  1WCM J;  2OD5 A;  2VQG A;  1JKQ C;  3MVP A;  1I27 A;  5FD6 A;  3ZMV A;  2FBI A;  3ZOB A;  1WJD A;  3LFK A;  4HV5 A;  2X1D A;  3BJA A;  3CCL I;  3ZP5 A;  1P2F A;  2EIK H;  2XF5 A;  5JVG F;  4XL9 A;  3GME A;  3BT9 A;  3J81 K;  1V54 H;  2VXZ A;  3KP6 A;  5EYR A;  2GZW A;  5JLX A;  4DYQ A;  5K1Y A;  3K69 A;  2ZJR F;  3UKG A;  3JAM K;  1KQ9 A;  3AG3 H;  1IJW C;  1V3F A;  1J7K A;  2NYX A;  5E79 C;  1R1V A;  2BY0 A;  4PCQ A;  2H1L A;  2FML A;  1T6S A;  4F7Z A;  5BMZ A;  2DK8 A;  1MSE C;  1Y6I A;  4BKX A;  1B8I A;  2JT1 A;  1YJ9 I;  1OMI A;  2IEK A;  4RAF A;  4YRV A;  5F27 A;  1G3W A;  4LG3 A;  2WA0 A;  4RM3 A;  2Y30 A;  1G8X A;  1PYV A;  4CCL A;  3O6B B;  2F5V A;  3OOP A;  4HA8 A;  4KN7 X;  5D4S A;  4IX7 A;  4XID A;  3F0C A;  4QSH A;  4U0W A;  3R6S A;  3F22 A;  2Z3Y A;  1BI0 A;  1ZRE A;  4Q48 A;  4C2U A;  4PFP A;  3F21 A;  1SEU A;  2IS1 A;  3V8K A;  1KU7 A;  2PJP A;  2R7U A;  1XS9 A;  1XDU A;  3K10 A;  4N9H A;  5DM6 F;  3BZ6 A;  3E1S A;  4ESF A;  4ZH4 F;  2FE3 A;  5J3L A;  3I4M J;  1YIJ I;  4L0Y B;  2X6W A;  2EK5 A;  2HYJ A;  1LDJ A;  3VYT B;  3DTE A;  4ZYG A;  3W2W A;  1BC8 C;  3ABT A;  1XGO A;  1HXD A;  4AID A;  1DGW Y;  5B66 C;  1X4O A;  2ZSI B;  3OSF A;  3S2W A;  2E60 A;  5F0F A;  2CS3 A;  3I64 A;  2A61 A;  2YX4 A;  5ICC A;  2M7A A;  3HG9 A;  1A5J A;  3Q0V A;  1BC7 C;  2BHY A;  3RCO A;  2JWT A;  4EM1 A;  4DIQ A;  3LNQ A;  1W5C C;  3PUF A;  2P0W A;  2EWN A;  4I98 B;  4S0H B;  1TWH J;  1CF7 A;  3FXQ A;  4PGG A;  1ETW A;  1LVK A;  3GZ5 A;  3WTU C;  2STW A;  2K7L A;  4DYR A;  2W25 A;  3ZGK A;  4I76 A;  1SMT A;  1XDS A;  2AS5 F;  5TJJ A;  5LHG A;  2PQ8 A;  4OMZ A;  2RDP A;  3HPG A;  4UB8 C;  3QYF A;  4EAT A;  2KDZ A;  1PVE A;  2COB A;  3E6D A;  3S3M A;  5CVR A;  4HF2 A;  3GTJ J;  4Q4Z F;  2NVY J;  4XLA A;  1TWG J;  3KFW X;  3EUH A;  3JTG A;  1Y1V J;  2HS5 A;  2UXN A;  2QKL B;  3P7N A;  1QNT A;  4V2G A;  2HU9 A;  2DOF A;  1T08 B;  5HNF A;  4E7L A;  1R5I D; 
#chains in the Genus database with same CATH homology
 3MEX A;  5J8C A;  3HSF A;  3I53 A;  1T39 A;  4L9J A;  4IVN A;  4GCV A;  2FEZ A;  4IRH A;  4I02 A;  3WTT C;  2V1D A;  1JGS A;  1XCV A;  4M9S A;  5ICG A;  1F4K A;  3KZY A;  4AWX B;  3COA C;  4LD5 A;  1TQI A;  3FMR A;  3HRS A;  2DAO A;  2QQB A;  4L18 B;  5FLX K;  2O3F A;  1FNN A;  1LEB A;  2FXA A;  1OPC A;  2KRF A;  2KKO A;  1U5T C;  3BY6 A;  3B02 A;  2P7C B;  2F5F A;  1J75 A;  2RN7 A;  4ASN A;  2QBY A;  1XB4 A;  2RV8 A;  2XAH A;  2OZ6 A;  1ZH5 A;  1FLI A;  1Z6R A;  2F5D A;  2FF4 A;  1SD7 A;  2ZCW A;  4YIF A;  1B1B A;  3B73 A;  2A69 F;  2ZJ2 A;  3M8F A;  1IN7 A;  1YW7 A;  4HX8 A;  3CUQ A;  1FY7 A;  2STT A;  2E7X A;  3ZMU A;  3E5X A;  4A12 A;  5TRD A;  3D0S A;  4EJW A;  4HX4 A;  3L7W A;  2CWE A;  2NS0 A;  3Q9S A;  4A6D A;  4WXH A;  3BP8 A;  2Z99 A;  5BS6 A;  1RI7 A;  2DQL A;  3C18 A;  1RIO H;  3GZ6 A;  5DUK A;  5ILU A;  4KFC A;  2QYO A;  3K0L A;  1MDM B;  2VE9 A;  5H6R A;  1EH7 A;  2V9V A;  3IKT A;  2LNB A;  3M9A A;  2OQR A;  4K2E A;  3ERE D;  3F6O A;  2FRH A;  4Y15 A;  2RQP A;  4I7H A;  1JHH A;  2HEO A;  5DEQ A;  2EFP A;  1FSH A;  5H20 A;  4LB6 B;  4HDU A;  1A04 A;  1B6A A;  1J59 A;  3T1B A;  1UCR A;  2D2W A;  1BIA A;  3LQQ A;  3WOD F;  3W6K B;  3TO7 A;  4RS8 A;  2X4H A;  5L3C A;  2FBH A;  2DPU A;  4M6Y A;  5AIP A;  3E97 A;  5DD8 A;  1KU9 A;  1KU2 A;  2UZK A;  3C3W A;  1B9N A;  1XSX A;  2QVO A;  1DPR A;  3TOA A;  2E1N A;  1IN8 A;  5BPI A;  2XUB A;  2L02 A;  4M9Z A;  4EJU A;  3O3K A;  4R79 A;  1C0W A;  4M9X A;  4CO8 A;  4ZYE A;  1ZYR F;  2LF8 A;  3V4G A;  1P4W A;  2Q2E A;  1PUE E;  3GFL A;  1SD5 A;  3Q9V A;  4KA4 A;  3CDH A;  5CJ9 A;  1ZGA A;  3HHH A;  2ADU A;  5ERI A;  5ICF A;  3JSP A;  1B59 A;  3GUD A;  2VN2 A;  1GVJ A;  5HLG A;  3T5X A;  3M7G A;  1BOA A;  5CYV A;  3LA7 A;  5FLX Z;  4UV8 A;  5LHI A;  4YII A;  4YG2 F;  1FSE A;  3ML6 A;  1K7A A;  1ZAR A;  2A5Y B;  3RYP A;  1TLH B;  1O3S A;  1YG2 A;  5L3D A;  5K5Q A;  2EV6 A;  1OKR A;  5JR3 A;  1FBU A;  3DQV C;  4YFN F;  4MGR A;  1PP7 U;  4HQE A;  1R22 A;  2DT5 A;  3I59 A;  4HZF A;  4OIN F;  2IT0 A;  2PEX A;  4XSX F;  1MJA A;  4S05 A;  1ULY A;  3L9F A;  3JAM Z;  3U2R A;  1TNS A;  5K5R A;  4L9T A;  1U5T B;  2M5W A;  4OIO F;  1Z7U A;  2VOO A;  3FMS A;  2QUF A;  1W4M A;  3NRV A;  5ILS A;  3EET A;  4ESJ A;  4XLN F;  2XKP A;  4ENN A;  4R1H A;  3FXU A;  2DK5 A;  3RPU A;  1XN7 A;  3KEO A;  1TBX A;  1G3S A;  2GXB A;  1HBX G;  1W5S A;  4I09 A;  2LF7 A;  5DCM A;  1J2X A;  2IW5 A;  3KP7 A;  5FFX A;  1QPM A;  3HSE A;  3ISP A;  5F64 A;  3QPH A;  3ZQ7 A;  2ZXJ A;  4FT8 A;  2IVM A;  3EYY A;  1S8N A;  2EV5 A;  1J9I A;  4LK1 F;  4EM2 A;  3SFZ A;  4U7B A;  4UXN A;  2ACJ A;  1SFU A;  1HW2 A;  3TKY A;  3REO A;  4MNU A;  2JSC A;  2KIF A;  1HST A;  3ZMZ A;  4AVP A;  3BOQ A;  4L5J A;  3HSR A;  5CVV A;  3SZP A;  2P5V A;  2XKO A;  1TW2 A;  1TTY A;  3KP5 A;  3V7C A;  3V8J A;  1JE8 A;  3J81 Z;  5EEH A;  1BN5 A;  4G7H F;  3ROU A;  1UHM A;  3E6B A;  3WTZ A;  5CVU A;  4NQW A;  3MCZ A;  1PDN C;  3R4K A;  4DNC A;  4LLG F;  1TNT A;  4LGW A;  2EFQ A;  1P4X A;  1STZ A;  4I2O A;  3HTU A;  1FZP B;  3R60 A;  1WSU A;  4UVA A;  3QRF F;  5FGM A;  3RYR A;  4HQM A;  2CG4 A;  2CGP A;  2HYF A;  1QQI A;  5BOX A;  2DFI A;  3GWZ A;  4LLL A;  4G7O F;  1U8R A;  2ISY A;  4ETS A;  4MEX F;  1XGN A;  4LB5 A;  2YU3 A;  1IXR C;  2Q0O A;  3CUQ C;  5LEK A;  2NRA C;  1YS7 A;  4BQA A;  3E6M A;  5LRS A;  3DPT A;  4H0E A;  3E5Q A;  4FHT A;  5E1Z B;  2G9W A;  2M45 A;  2VON A;  5ED4 A;  4MTD A;  4HX7 A;  2ELH A;  4KIG A;  1JXS A;  1R58 A;  4RGS A;  3O2P E;  3TO9 A;  4KUM A;  3G3Z A;  2JPC A;  4RGR A;  5L3G A;  3VEP A;  1QGP A;  3QPT A;  5FFZ A;  4HV6 A;  2RGV A;  3TQN A;  4P55 A;  2EJR A;  1MDM A;  1MJB A;  2M8E A;  3WGG A;  1DPU A;  3C1D A;  1WWX A;  1U2W A;  2R3S A;  3ECH A;  4MQV A;  4YFX F;  2H27 A;  1ZGJ A;  5E8I A;  2L4A A;  1HSJ A;  1UFM A;  4I0A A;  5KVR A;  1FBQ A;  2RVC A;  3K1M A;  3FM3 A;  3GW2 A;  3VFZ A;  2EFW A;  4HOB A;  2MH2 A;  3MFK A;  4PGH A;  3NQO A;  1IW7 F;  3DEU A;  2PLY A;  1KA8 A;  4M71 A;  3RKY A;  1HQC A;  4OIQ F;  3I59 B;  2COM A;  3CO6 C;  2XAQ A;  4KYW A;  3L00 A;  4LMY A;  2M87 A;  2ESH A;  2XAG A;  1FBS A;  5HS8 A;  3FF5 A;  4A6E A;  1YIO A;  3R0J A;  2G7U A;  5LGT A;  4LK0 F;  4KT5 C;  4XRF A;  2P6T A;  1MKM A;  3R61 A;  5D4R A;  4A0Z A;  5AON A;  2MH9 A;  4EGY A;  3HIF A;  2GXG A;  4G94 A;  1LVA A;  4BAY A;  3GVA A;  4EVI A;  5JVT A;  3GEZ A;  2P6S A;  2WTE A;  3BWG A;  4GYG A;  4RGX A;  2QBY B;  4UHT A;  2QM3 A;  4KIB A;  4UV9 A;  3L09 A;  2D1H A;  3FM5 A;  4AIJ A;  1SD4 A;  1DUX C;  4WF2 A;  1WKM A;  1ZG5 A;  1S3J A;  1Y0U A;  1O3Q A;  2F2E A;  2RC4 A;  4UVC A;  1YTY A;  3F8F A;  4QWQ A;  1IXS B;  3LA2 A;  2HTJ A;  4BHC A;  5JI6 A;  2IP2 A;  2OZU A;  1IRG A;  1CF7 B;  2ZO4 A;  4IF4 A;  3GF2 A;  3DPL C;  2PI0 A;  5J8F A;  4CZZ A;  4Y17 A;  3EYI A;  2P4W A;  1F5T A;  3NEU A;  3PFI A;  1UB9 A;  2WV0 A;  2PFB A;  4RB2 C;  1S29 A;  3F8M A;  3F3X A;  2EFN A;  1SMY F;  1LEA A;  5DDG A;  1IXC A;  2EA4 A;  4RB3 C;  4HLX A;  2DW4 A;  2XIG A;  1XSV A;  4KIF A;  1ZAO A;  3Q5F A;  1I1S A;  5ILV A;  3WTY C;  2NNN A;  5E1X A;  3FX3 A;  2HKO A;  2OQG A;  3K9T A;  1LQ1 A;  1EV7 A;  2MA3 A;  3IWZ A;  3CTA A;  2CO5 A;  2LSO A;  4L0Z B;  2YR2 A;  3BDD A;  5LEJ A;  1X3U A;  2H09 A;  2VC0 A;  3LST A;  3KP2 A;  1TW3 A;  2ZNZ A;  5DCM B;  1XMA A;  2MC3 A;  4WXC A;  2FOK A;  1BBY A;  3P9C A;  2H6B A;  5HDK A;  1E2X A;  4G7Z F;  3CO7 C;  5E8G A;  1P4A A;  4L5I A;  4P96 A;  3G73 A;  1REP C;  1L3L A;  2VBY A;  5FB2 A;  4LG0 A;  2HDC A;  2VBW A;  1O7L A;  4G6Q A;  2GIV A;  4GGG A;  3HOT A;  3SQN A;  1R00 A;  3E3V A;  2IA2 A;  4M72 A;  2R7F A;  3ZN1 A;  3GLX A;  2PMH A;  4IPA A;  3TOB A;  2YSR A;  4WCG A;  2L3D A;  1MJ9 A;  2W85 A;  2DLL A;  3DP7 A;  2EB7 A;  3RTR A;  3D5L A;  1XMK A;  3EDP A;  1BM9 A;  1LDD A;  2W24 A;  5HDG A;  2FSW A;  4FX0 A;  4BH9 A;  3TO6 A;  1O7F A;  4G6D A;  3HRT A;  5HVQ C;  1P92 A;  3HYI A;  3RKW A;  1J0R A;  2WC2 A;  2LDU A;  4N9I A;  1KYZ A;  3I0T A;  3GFJ A;  4IJA A;  4M6X A;  4RAZ A;  4OIP F;  3K1P A;  3WE2 A;  5IT9 Z;  2X0L A;  1D5V A;  5EEG A;  2F5C A;  3VOE A;  2GWR A;  3F23 A;  5DYM A;  1R1U A;  2K27 A;  2QQ9 A;  3BRO A;  3L2C A;  4HF1 A;  2XVC A;  4IHS A;  4UNO A;  3ZMD A;  5LGN A;  4AIH A;  2ZME B;  3ZN0 A;  4YFK F;  1H9G A;  1T38 A;  1P6R A;  3QOP A;  3IKV A;  2BGC A;  4GYI A;  2YX7 A;  2HKX A;  2IA0 A;  1GXQ A;  2A3S A;  2R7D A;  3GX4 X;  1ON1 A;  1F9N A;  4KMF A;  1FX7 A;  3CJN A;  4ZZD A;  4RB0 A;  4CDG A;  3T8R A;  3MQ0 A;  4IHT A;  2PBI A;  3H3Z A;  4I0B A;  5D5U B;  1U78 A;  1IN5 A;  4L9N A;  1LDK B;  1K78 B;  1FYK A;  1FP1 D;  1SFE A;  1R5G A;  3PQJ A;  1EH6 A;  2OAZ A;  1IUY A;  3C7J A;  2QEN A;  4WXD A;  2Y75 A;  3K1N A;  4UUV A;  1BI3 A;  4CGZ A;  5HS7 A;  3HRU A;  2VE8 A;  1K6O A;  1UST A;  3VOD A;  4ENM A;  3ELK A;  1XGS A;  4B8X A;  3M1E A;  3V8L A;  3KEQ A;  2GQQ A;  4EM0 B;  4WK8 F;  3KCC A;  3WTS C;  3RPQ A;  1BIB A;  4Y13 A;  5D8K B;  3AAF A;  2QLZ A;  2YPR A;  1HKS A;  2Z5U A;  4HAM A;  2CFX A;  4KN4 X;  2O8X A;  3HUG A;  5HS9 A;  2WWY A;  3BPX A;  2VBZ A;  3LQR A;  1IZ1 A;  1YYV A;  2A6H F;  3N4M A;  4G8X A;  4O6J A;  3QU6 A;  1IRF A;  1RZ4 A;  4OU0 A;  1USS A;  1AWC A;  3WG9 A;  1W7P A;  4ESB A;  3LWF A;  1FT9 A;  1FOK A;  5L3F A;  1R1T A;  1Z9C A;  3F6V A;  4G9Y A;  2RKH A;  1O57 A;  1RUN A;  3W6J B;  4BNC A;  4AIK A;  2XRO A;  2GA2 A;  2MD5 A;  1KQ0 A;  2JRT A;  3FMQ A;  1G3Y A;  2HOE A;  4IRI A;  5J6X A;  3H3U A;  4PZJ A;  4MQ9 F;  2QQA A;  2OU2 A;  2H6C A;  4IXA A;  4OMY A;  2MLG A;  5CVJ A;  1T2K A;  1O3R A;  4XSZ F;  5E20 A;  4M73 A;  3V7S A;  1FPQ A;  2K4B A;  1ZG3 A;  1UHW A;  1DP7 P;  2E7W A;  2DO7 A;  2HWV A;  2ZBK A;  1T0F A;  2JTV A;  5FO5 A;  3LA3 A;  3HOS A;  3IL2 A;  3TGN A;  1I1G A;  3F72 A;  3KZZ A;  5LLQ A;  4ZYD A;  3R0A A;  3DKW A;  3RJP A;  4DQ2 A;  5H6Q A;  1YS6 A;  5LGU A;  1HKQ A;  2QZ8 A;  2VT3 A;  1HW1 A;  4LJZ F;  1U6G A;  1PP8 F;  1BJA A;  2CSO A;  2CW0 F;  4B09 A;  1RNL A;  4A0X A;  2ZFW A;  3T8T A;  4U88 A;  1FP2 A;  5L3B A;  3HHG A;  3WTV C;  4KIC A;  3BJ6 A;  3DXJ F;  3RIR A;  1R7J A;  2J5P A;  1TQP A;  2QWW A;  1IN4 A;  2P5K A;  1D3Y A;  5D5W B;  2C6Y A;  1U5T A;  1KQ8 A;  3SXY A;  1CGP A;  2O6G E;  2Q8K A;  2FMY A;  5D6F A;  1EH8 A;  4LG0 B;  4HLY A;  5CVI A;  1YW9 A;  2JPB A;  2O0Y A;  1G3T A;  5IT9 K;  1AOY A;  2M30 A;  2AXL A;  3GO5 A;  5BPD A;  2HTS A;  2Y48 A;  4D0P A;  1FYL A;  1QZY A;  3IRQ A;  2K02 A;  3FXR A;  3IC7 A;  4U0V A;  4A5N A;  4Q5S F;  4NB5 A;  5DUI A;  1ZG1 A;  1LNW A;  5LBQ A;  2HFH A;  1YQA A;  4EJT A;  3HRM A;  5FD5 A;  5D8L B;  3ECO A;  2KJB A;  1SD6 A;  2FA5 A;  1HW5 A;  1S7O A;  1E17 A;  2XV4 S;  1GHC A;  3QAH A;  1ZRC A;  2ESN A;  2DU9 A;  4BXU A;  3E5U A;  3E6C C;  1BI1 A;  4TV7 A;  4ZZL A;  1DDN A;  5A2Q K;  2XHK A;  1MD0 A;  3GXO A;  4HDV A;  3JSO A;  4A2U A;  4S04 A;  5K5O A;  4EMS A;  1XSD A;  1Z91 A;  2ETH A;  4UVB A;  2ZKZ A;  1WRJ A;  1JHF A;  2HZT A;  3K2Z A;  4LLN A;  4KMU X;  1F1Z A;  1OYY A;  1R36 A;  1W7P D;  2FNA A;  3PQK A;  1ZRF A;  3QU3 A;  2W57 A;  2K4J A;  2DI3 A;  3I4P A;  3JW4 A;  4XBF A;  1G4D A;  2CYY A;  2XRN A;  2FU4 A;  3KE2 A;  2OBP A;  2Z9O A;  2DBB A;  3CLO A;  2GAU A;  4JK1 X;  3DF8 A;  4Q47 A;  4EQQ A;  3U9G A;  4HYE A;  3GFI A;  3J7A O;  1IN6 A;  1YW8 A;  1XGM A;  5D5V B;  1Z6T A;  2BYV E;  3H92 A;  5KK1 A;  3KP3 A;  1KGS A;  1ODD A;  2UXX A;  4EJV A;  2H94 A;  1SAX A;  2IA1 A;  2XAJ A;  5E18 F;  4N0B A;  2KIU A;  3OV8 A;  3P9I A;  2HQR A;  4I01 A;  3WU1 B;  4O5V A;  4JBA A;  1I5Z A;  3KLN A;  4MHG A;  1G6N A;  1J5Y A;  2L54 A;  5CLS A;  4IRG A;  2BEO A;  3QP5 A;  3BJO A;  1FYM A;  3P9K A;  2Z33 A;  2DPD A;  2BV6 A;  2KJC A;  4P9F A;  3WGI A;  2OA4 A;  3V7R A;  1Z05 A;  2BBY A;  2IJL A;  2A6E F;  1SFX A;  1FC3 A;  1TQM A;  1MZB A;  5F6F A;  3I5U A;  4P5O A;  1LB2 A;  1O3T A;  2UWM A;  1ON2 A;  3N97 A;  3I71 A;  2VBX A;  2LKP A;  3KP4 A;  3LAJ A;  2V1X A;  3MAJ A;  1YLF A;  3DV8 A;  1QBJ A;  2DTR A;  3DFG A;  5IT3 A;  3ZMT A;  2MLK A;  4HW0 A;  5JFR A;  2FQ3 A;  4OOI A;  4LFU A;  3WU0 A;  1ZRD A;  4EJO A;  5D5X B;  4EGZ A;  1HKT A;  3ZMS A;  2EV0 A;  1BI2 A;  1ZN2 A;  3KLO A;  5F1R A;  3TDZ C;  2MBF A;  2F5E A;  4CIC A;  1XCB A;  2L4M A;  1IF1 A;  4M74 A;  1I6X A;  1R23 A;  3RKX A;  5LRR A;  2BE5 F;  2P7V B;  4ENK A;  3ULQ B;  3MZY A;  5HLH A;  4R8H A;  4E70 A;  2VC1 A;  4CHU A;  4JQF A;  2ZME A;  3F8C A;  3GFM A;  1WQ2 A;  1H9T A;  2XGX A;  1U3E M;  3RDI A;  3VB2 A;  2EA2 A;  4BYY A;  2D1V A;  3MZH A;  1RUO A;  1KU3 A;  4BHP A;  4Z2Y A;  1GXP A;  4WX9 A;  3M8E A;  3GYH X;  2XAS A;  4ENJ A;  2B0L A;  2HGC A;  1ZLK A;  2EFO A;  2V79 A;  2A68 F;  3ZPL A;  1B9M A;  4KNY A;  3EQL F;  4MTE A;  4EV0 A;  1R5H A;  2NAZ A;  5HOO A;  4XLP F;  3SHF A;  1KYW A;  2K86 A;  3SZT A;  2V1U A;  2FBK A;  2PN6 A;  2NNY A;  1QZZ A;  2E1C A;  4GXO A;  2XAF A;  1W5T A;  4ZYH A;  2W84 A;  2GA1 A;  2VOD A;  3CUQ B;  4HF0 A;  1OR7 A;  3J80 Z;  1XD7 A;  2O03 A;  4CYD A;  2P8T A;  4KDP A;  1B4A A;  4P9U A;  1IAW A;  2PMU A;  2PG4 A;  4OIR F;  5ICE A;  3IHU A;  5JHU A;  5LHH A;  1OYW A;  2HYG D;  5A2Q Z;  3WTX C;  2RNJ A;  3MWM A;  3LAP A;  2G7H A;  5HLI A;  4AD9 A;  4A5M A;  1ONV A;  4WWC A;  1D8J A;  5DD4 A;  1WI9 A;  5HDN A;  3IWF A;  4U7D A;  3CUO A;  4RAY A;  2CQK A;  5DV5 A;  2J5O A;  1YFH A;  3F8N A;  2O61 A;  5AIQ A;  3U1D A;  3WTW C;  4U0Y A;  4ON0 A;  3TDU C;  1MGT A;  1QO0 D;  5E1W A;  2JZY A;  4RGU A;  5DCF A;  1K79 A;  2IRF G;  3FWE A;  3FZV A;  4RB1 A;  1FWZ A;  2A07 F;  3I58 A;  3T0Y A;  4CXF A;  3I54 A;  1Z1D A;  1D8K A;  3QP6 A;  4BHB A;  1V4R A;  1Q1H A;  1K78 A;  2FNP A;  3KET A;  2Y0M A;  5D6E A;  3JTH A;  2HQN A;  3J80 K;  3IRR A;  2IPQ X;  4GO1 A;  4FX4 A;  6PAX A;  3WE3 A;  3HTS B;  2P5L C;  5E17 F;  1LJ9 A;  4O3M A;  1S6L A;  2HR3 A;  1S7A A;  3WGH A;  2DQR A;  3ABU A;  4L9V A;  1L0O C;  1ZHF A;  2V6C A;  4NHJ A;  4MEY F;  2D45 A;  5L3E A;  2ZNY A;  2VOP A;  2ISZ A;  2TDX A;  5BQT A;  2VT2 A;  2L01 A;  2M1B A;  1W7P B;  4PDK A;  3BPV A;  4QLC U;  1VTN C;  1YO5 C;  1ZLJ A;  4HBL A;  1NHA A;  4A0Y A;  1T98 A;  2KIM A;  3FHZ A;  1H0M A;  1OYI A;  2OD5 A;  3F8B A;  1I27 A;  5FD6 A;  3ZMV A;  2FBI A;  3LFK A;  4HV5 A;  3BJA A;  3ZP5 A;  1P2F A;  3J81 K;  2VXZ A;  3KP6 A;  2GZW A;  5K1Y A;  3K69 A;  3JAM K;  1KQ9 A;  1V3F A;  1J7K A;  2NYX A;  1R1V A;  4PCQ A;  2FML A;  1T6S A;  4F7Z A;  5BMZ A;  2DK8 A;  2JT1 A;  1OMI A;  1G3W A;  3O6B B;  3OOP A;  4HA8 A;  4KN7 X;  5D4S A;  3F22 A;  1ZRE A;  4U0W A;  3R6S A;  2Z3Y A;  1BI0 A;  4Q48 A;  3F21 A;  3V8K A;  1KU7 A;  2PJP A;  1XDU A;  4N9H A;  3BZ6 A;  4ESF A;  4ZH4 F;  2FE3 A;  4L0Y B;  2EK5 A;  1LDJ A;  4ZYG A;  1BC8 C;  3ABT A;  1XGO A;  1HXD A;  3S2W A;  3I64 A;  2A61 A;  2YX4 A;  5ICC A;  1BC7 C;  4EM1 A;  4I98 B;  2EWN A;  1CF7 A;  3FXQ A;  4PGG A;  3GZ5 A;  3WTU C;  2STW A;  2K7L A;  2W25 A;  1SMT A;  1XDS A;  2AS5 F;  5TJJ A;  5LHG A;  2PQ8 A;  4OMZ A;  2RDP A;  3E6D A;  5CVR A;  4HF2 A;  4Q4Z F;  3KFW X;  3EUH A;  3JTG A;  2HS5 A;  2UXN A;  3P7N A;  1QNT A;  3RI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...