1WSUA

C-terminal domain of elongation factor selb complexed with secis rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
GSETQKKLLKDLEDKYRVSRWQPPSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDEFYWHRQALGEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDKRVVVGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation/rna
molecule keywords 5'-R(*GP*GP*CP*GP*UP*UP*GP*CP*CP*GP*GP*UP*CP*U*GP*GP*CP*AP*A
publication title Structural basis for mRNA recognition by elongation factor SelB
pubmed doi rcsb
source organism Moorella thermoacetica
total genus 45
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09107 SelB-wing_3 Elongation factor SelB, winged helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wsuA02
5E1ZB 5EEHA 2EJRA 3LAJA 1FP2A 1XCBA 1XD7A 1KQ8A 1LB2A 4ENJA 1RZ4A 3HHGA 3RIRA 2O03A 4ENKA 3H3UA 1HW5A 2RVCA 2W24A 1ODDA 1SAXA 5J8FA 4GGGA 2HQNA 1Z6RA 3KP2A 4UV9A 3NEUA 4KT5C 3ZMVA 2YR2A 5DUKA 2K02A 3L9FA 1R1VA 5DYMA 3VB2A 3G73A 2W84A 4YFXF 4PZJA 3CTAA 4ZZDA 3E6CC 4XRFA 2Z33A 3HTUA 2ZO4A 1BOAA 5D8LB 5CVJA 4P5OA 1OYYA 2NYXA 2Q8KA 1T98A 1WQ2A 4KUMA 2ISYA 4XSZF 2HKXA 3U1DA 4G94A 2JTVA 1CGPA 4U0WA 2A5YB 3W6JB 3IC7A 3IHUA 4OIOF 2FNAA 4IRGA 2P8TA 4IRIA 2AXLA 1ZG1A 2VT3A 1BC8C 3FF5A 4BHBA 2EFQA 4N9HA 3C18A 3LA7A 1USTA 5D8KB 4KA4A 3T8RA 2CW0F 3ERED 1G3SA 3RKYA 5ICGA 3QPHA 2GA1A 4HDVA 1H9GA 4UXNA 4LG0A 3L7WA 1HKTA 2YSRA 4OU0A 1T0FA 3D0SA 1MKMA 3DQVC 5D6EA 2LF8A 3M1EA 2ETHA 4E70A 1HXDA 1B4AA 4LB5A 2F5CA 3KZYA 1IF1A 2HR3A 5IT9Z 4KIGA 2PI0A 2GZWA 2O8XA 2ZNYA 3O6BB 5KVRA 4MGRA 2ADUA 2HWVA 4JBAA 1FSHA 4I02A 4UUVA 3F22A 2HTSA 3DEUA 1PP7U 2OU2A 1IN7A 1TQMA 1Z05A 3WTUC 2Z99A 4L9NA 5JHUA 5D5UB 1LNWA 4NHJA 3ZMSA 2GWRA 1YQAA 1BI3A 4WXCA 4KFCA 3LWFA 5E8GA 1R5GA 4K2EA 5ICEA 3T0YA 4AWXB 1C0WA 2MLGA 2FRHA 2LDUA 3KETA 3VFZA 4OINF 4L9JA 5HDNA 5F6FA 4S05A 2Q0OA 1XMAA 3SQNA 4YG2F 2FQ3A 3L00A 4JQFA 2FBKA 1W7PB 3CO7C 2JPBA 3CUQB 3DXJF 2DK5A 3BP8A 4RAZA 4U88A 3GLXA 2CYYA 3F23A 2H94A 2L4AA 1KU7A 5FFZA 1LDKB 1Z9CA 5E18F 2E7XA 3P9KA 5HDKA 1IZ1A 3R0JA 3RKWA 2UXXA 3ML6A 1SD4A 2GXBA 2J5OA 4HF2A 1O3QA 1FX7A 4YFKF 5D5XB 4G7ZF 2OA4A 4HDUA 4CXFA 3CUOA 4DNCA 2F2EA 2OBPA 3BY6A 1QPMA 2VOPA 5LLQA 2VONA 1FP1D 4RGXA 2EB7A 5LEJA 4Q48A 2VC0A 3HSFA 2A69F 1BJAA 3M9AA 1FPQA 4HQMA 2Y0MA 1IN6A 1RUNA 2FBIA 1G6NA 2YX4A 2PFBA 3KFWX 3TO9A 5LGUA 1SFEA 1MD0A 2IT0A 1LEBA 3DF8A 3FXQA 2V6CA 2XAHA 3TGNA 3O3KA 2HKOA 4RGSA 2KKOA 4ON0A 3IRQA 4M6YA 1LQ1A 3NRVA 2VXZA 2HYGD 4G6DA 4KDPA 3I59B 4CDGA 1K7AA 2XAFA 3LQRA 5TJJA 2XVCA 3ZMTA 2CQKA 2TDXA 1W4MA 3CO6C 2RN7A 1O7LA 3H3ZA 3BZ6A 2MH9A 1GHCA 3VODA 2HEOA 5LHIA 1JHFA 3N4MA 2XKPA 4EMSA 2COMA 2GAUA 3HRMA 1FBSA 2PMHA 5FLXK 4NB5A 1I27A 1OYWA 2EA4A 4UVBA 3E3VA 5H20A 1G3TA 5LEKA 3EQLF 2PLYA 4LJZF 3FMRA 5K1YA 3BJ6A 3QU3A 2VT2A 5DD4A 1S3JA 3DPTA 2OAZA 1Q1HA 1Z91A 4CHUA 4YIIA 2RDPA 2O6GE 4ENMA 3ABTA 4AIJA 4MTEA 3R61A 1U5TA 4BXUA 3F8CA 3KP5A 5H6RA 1HKQA 4O3MA 1BBYA 2ISZA 2AS5F 2R7DA 1MDMB 3LSTA 2MBFA 1DPRA 2CSOA 2HS5A 3P9IA 1JGSA 3J81K 3T8TA 2VBZA 1KYWA 2CGPA 3Q5FA 2UXNA 1F9NA 1ZRDA 2DFIA 3GXOA 2PJPA 2O0YA 1KGSA 3I53A 2BV6A 4KN4X 5KK1A 2L4MA 2QQAA 4M6XA 2D1VA 5CVUA 4A5NA 3HRSA 1TLHB 3KCCA 4HLXA 2DQRA 5FO5A 5K5OA 3BPXA 2LKPA 2ZMEA 3QP6A 2CO5A 2JZYA 2M30A 1IXSB 1YFHA 4IRHA 1W7PA 5E1XA 1I1GA 1XSDA 3QU6A 5K5RA 4PCQA 1G4DA 2H6CA 3KP3A 2A6EF 1G3YA 1TNSA 1TW2A 4G7HF 4G7OF 2IA1A 2QWWA 2VOOA 3SZTA 3K69A 5E1WA 4Q4ZF 3WTTC 3ROUA 5F1RA 4AIKA 4GCVA 2QBYB 3EYYA 4LLLA 1U5TC 4Q47A 5ERIA 2CG4A 1YIOA 1WSUA 1Z6TA 2P4WA 1P6RA 4YFNF 3OV8A 3F72A 4P55A 1B9NA 1B1BA 2BE5F 4A0ZA 1EH6A 2XAQA 4UVAA 4D0PA 4L9VA 4M9XA 4KNYA 1WI9A 4CYDA 2EA2A 3CLOA 3M7GA 2FF4A 1MGTA 1T2KA 4KIBA 1L3LA 2QENA 2OQRA 2DI3A 1IRGA 4EVIA 4HF0A 2F5FA 5ICCA 4G8XA 1HBXG 3B73A 4L0YB 4LGWA 4BNCA 2DU9A 1KU9A 3ZN0A 3F21A 1WRJA 1R22A 3T1BA 4KICA 3H92A 4EM2A 2STTA 3REOA 3B02A 2P5VA 3E5XA 5DCMA 2L3DA 3R60A 2EK5A 2K4JA 4DQ2A 3HYIA 5A2QK 2LSOA 4MNUA 5DUIA 5LGNA 3M8FA 3I59A 4I09A 4ZYDA 1T39A 1RIOH 5D4SA 3O2PE 2H09A 1ZGAA 1J0RA 5FLXZ 1K78A 2QLZA 3BROA 2QYOA 2V9VA 4P9UA 1OYIA 1R7JA 3MAJA 4BAYA 3DKWA 2IA2A 3FM3A 1UHMA 3MEXA 4I0BA 1UHWA 1DDNA 1ZAOA 2QVOA 4HOBA 4U0VA 4TV7A 2EFNA 4Q5SF 2HTJA 4N9IA 2IRFG 4RAYA 1YS6A 2RGVA 5D6FA 5LRRA 4PGHA 2PQ8A 2YU3A 3ELKA 1LEAA 2Z5UA 3ZP5A 2DO7A 4WXHA 5FGMA 2V1DA 1HQCA 5LHHA 1Z7UA 5CYVA 4EQQA 3J81Z 4PGGA 4LB6B 1ON1A 1DPUA 2K4BA 5IT3A 3IKTA 3KZZA 1G3WA 2DW4A 2X4HA 4HBLA 2ZFWA 4I2OA 3RPQA 1IUYA 3HTSB 1O57A 4HX7A 3HRTA 1B9MA 2WV0A 2JT1A 2EWNA 2DLLA 3QPTA 5K5QA 1E2XA 4EV0A 3JAMK 3DFGA 3F3XA 3CDHA 3C7JA 3WU1B 4I98B 1QBJA 2KIUA 4RB3C 3E97A 2X0LA 1XGNA 4EJVA 2XGXA 3MQ0A 3FX3A 1UCRA 3RJPA 2W57A 4IVNA 4A0YA 3DP7A 1TTYA 1MJAA 2HQRA 2FSWA 3RI4A 1S7OA 4UNOA 5DCFA 1PP8F 1U8RA 3V7RA 3WG9A 2OZ6A 1CF7A 4OMYA 3QP5A 2VBYA 5BOXA 3CJNA 5D5WB 5CJ9A 2JPCA 3KLOA 1FYMA 2QZ8A 4RB2C 2XROA 3V7SA 4HQEA 4OIPF 2M45A 5JR3A 2Y75A 1P92A 2IPQX 3WGHA 2GA2A 3L2CA 1KQ0A 1O3SA 5BS6A 5LHGA 2FBHA 1B6AA 3R6SA 4HAMA 1STZA 5JVTA 1AOYA 5D5VB 4Y15A 4F7ZA 2FNPA 1TQPA 5F64A 3I54A 3VOEA 2D2WA 3C1DA 3V7CA 5ILUA 1YG2A 2KRFA 5L3CA 2ZCWA 5LBQA 1TNTA 4OIQF 3AAFA 1XSXA 1E17A 3TQNA 3HIFA 4AD9A 1LDDA 2EV0A 4EM0B 1KU2A 2R3SA 2D1HA 4BH9A 3KLNA 3BJOA 2FOKA 2IP2A 4CZZA 3ZN1A 3IWZA 1D8JA 1OPCA 3KEQA 1EH7A 4EJUA 3KEOA 2V1UA 2OD5A 3DV8A 3HSRA 1ZLJA 3F8NA 4M9ZA 1KA8A 3MZYA 2JRTA 2MC3A 2DBBA 3RYRA 5DDGA 4HYEA 5AONA 1BIBA 5L3BA 2FEZA 3ZMZA 5L3GA 2FXAA 2ZBKA 1FBUA 2E1NA 4L5IA 3FM5A 5L3DA 2L02A 4H0EA 2HOEA 3K2ZA 5HS7A 1WKMA 1FT9A 4G6QA 2QQ9A 1XDSA 1YYVA 2XV4S 3VEPA 2NNNA 3KP6A 3JAMZ 4ZZLA 2NS0A 4KMFA 1JE8A 2K86A 4XBFA 3GYHX 3KP4A 5HS9A 1SMTA 2RV8A 5D4RA 4RB1A 1LJ9A 1YTYA 1AWCA 3R0AA 3ZMDA 3R4KA 3QAHA 2P7CB 3E5QA 5ICFA 1YW8A 4WK8F 3QOPA 1W5TA 1B59A 2HZTA 3ABUA 3HRUA 4ZH4F 2BBYA 3ECHA 2EFOA 2Q2EA 2ESHA 2VODA 3FMSA 3GO5A 2P5KA 3E6BA 2KIMA 2OZUA 1LDJA 4LD5A 2J5PA 2G9WA 3FMQA 3K0LA 4EJWA 3NQOA 2ZKZA 1XDUA 4ESBA 2NRAC 3N97A 5L3FA 4A12A 1U2WA 1J5YA 2HDCA 3P7NA 3G3ZA 2A61A 2XIGA 3WTWC 3BJAA 4MTDA 5ILVA 4EGYA 3LA3A 3GZ6A 4NQWA 3E5UA 1I1SA 2FMYA 3FWEA 2E7WA 1HW1A 1FYLA 3T5XA 4FX0A 4PDKA 2NAZA 3SZPA 4O5VA 1SD5A 2EV5A 3RTRA 2V79A 5CVIA 1W7PD 5AIQA 4B8XA 3F8FA 1XGSA 3WODF 1V4RA 1XB4A 4M9SA 5BPDA 1IRFA 5DV5A 5HVQC 2Z3YA 3HOTA 1XN7A 4FHTA 1GVJA 4R79A 4ZYHA 3CUQA 1ON2A 2DT5A 3TKYA 4EGZA 1J59A 4HLYA 2W85A 5ILSA 3SFZA 4CICA 1U78A 4P9FA 2VC1A 1OR7A 1JXSA 1SFUA 5EEGA 1SD6A 4XLNF 4XSXF 2B0LA 3TOBA 2EV6A 1J7KA 3GVAA 4ZYGA 3RPUA 5E17F 4IHTA 2DTRA 1BI0A 5LGTA 1HSJA 5AIPA 5JFRA 1XGOA 4S04A 3QRFF 2VN2A 1RNLA 1R5HA 3JSOA 5HOOA 5FD6A 3GX4X 2R7FA 2XUBA 3FXUA 4IJAA 4KYWA 1NHAA 3LA2A 3GZ5A 2LF7A 2DPUA 1Y0UA 4JK1X 1OKRA 1ZARA 3GFMA 3TOAA 4I0AA 3I58A 4CGZA 4HA8A 2XRNA 2W25A 2STWA 4HV5A 1J75A 5HLIA 5ED4A 2DK8A 4L18B 1S6LA 4HW0A 1ONVA 1EH8A 3K1MA 1YW7A 3Q9VA 2H27A 2K27A 3COAC 1S7AA 4UVCA 2P7VB 2H6BA 4A2UA 3V8JA 1BI1A 3L09A 3CUQC 1F1ZA 3F8BA 3JTGA 1D8KA 1TBXA 2V1XA 4HV6A 3K1PA 3PQKA 2QM3A 3GEZA 2QQBA 2MLKA 3HSEA 4EJOA 2EFPA 1O3RA 2XAGA 1MZBA 4BHCA 1FYKA 2A68F 1JHHA 3BDDA 4BYYA 1YW9A 4I01A 2PEXA 3ECOA 5HDGA 5H6QA 2JSCA 2A6HF 3U2RA 2UWMA 1T6SA 2O3FA 5L3EA 2IJLA 1R1UA 2CFXA 3JSPA 1VTNC 1R1TA 2XAJA 3I5UA 3FXRA 1EV7A 3WTXC 4IXAA 3LFKA 5CVVA 1TQIA 3HHHA 1I5ZA 1YLFA 2GIVA 1F5TA 1QGPA 4ASNA 1FC3A 4N0BA 3FZVA 1RI7A 2IW5A 4FX4A 5BMZA 2DPDA 1USSA 1DP7P 2ACJA 1H0MA 4MEYF 2BGCA 2HYFA 3I64A 1QNTA 3LQQA 1IN4A 1MDMA 4OMZA 3IRRA 2PMUA 3D5LA 2ZNZA 5BQTA 1BC7C 2A07F 1HW2A 3HUGA 4HX4A 5E20A 4HF1A 2FA5A 3WTZA 5LRSA 1ZGJA 3GUDA 1U3EM 1KQ9A 3TDUC 2NNYA 1OMIA 4EJTA 2M87A 4M71A 4CO8A 2IVMA 1FNNA 2UZKA 2M8EA 4ESJA 2M5WA 5J6XA 4KMUX 4KIFA 3ZMUA 2MD5A 1ZYRF 1IN5A 1R00A 5TRDA 4A5MA 5J8CA 1GXQA 1UB9A 1IW7F 5JI6A 4P96A 1I6XA 2QBYA 4FT8A 1A04A 3GFIA 4I7HA 1BIAA 1REPC 2L54A 3MCZA 1U5TB 2VBWA 3J80K 2VE9A 4HX8A 3OOPA 4EM1A 1LVAA 3GWZA 4XLPF 1ZRFA 1DUXC 2BYVE 4M73A 1T38A 3IWFA 3TO6A 2HFHA 1SFXA 3KE2A 1P4WA 4OOIA 5A2QZ 1QZZA 2PBIA 1XGMA 3JTHA 2ESNA 2ZMEB 4QLCU 1O3TA 5FB2A 2VE8A 5CVRA 3F6VA 4LLNA 1FBQA 3MWMA 2P6SA 1GXPA 3RKXA 1SMYF 4A6EA 1FY7A 1HSTA 3EYIA 3WE3A 4U0YA 3BWGA 4RB0A 4OIRF 4MQ9F 1ZRCA 2FMLA 1ZG3A 1K6OA 4ZYEA 1D3YA 4WCGA 3BPVA 4WXDA 4ESFA 1ZHFA 2P5LC 5E8IA 2ZXJA 1R58A 3V4GA 3DPLC 3WTVC 3ZQ7A 4O6JA 2IA0A 1ZH5A 4UV8A 2ELHA 3MZHA 4GO1A 2DAOA 4UHTA 1YO5C 1QZYA 3K9TA 1R23A 1SD7A 1J2XA 4RS8A 3C3WA 4AIHA 1ZG5A 4LK1F 1S8NA 2GQQA 1P4AA 1KU3A 1BI2A 4L9TA 4RGUA 2L01A 1FLIA 1D5VA 2XASA 3ULQB 3WU0A 1ZREA 4LMYA 4GXOA 3V8LA 4M74A 1ULYA 1FOKA 1L0OC 5FD5A 4R8HA 3EDPA 1HKSA 3WGIA 5DCMB 3GFLA 5DD8A 1ZN2A 2GXGA 1FSEA 1WWXA 2E1CA 4RGRA 4IF4A 3RYPA 3FHZA 2DQLA 1V3FA 4GYIA 4ETSA 1K78B 1P2FA 2ZJ2A 2YX7A 4QWQA 2KJCA 1S29A 2MH2A 4WWCA 1F4KA 3RDIA 1IN8A 2WC2A 3KP7A 4Z2YA 1YS7A 1UFMA 5HLGA 3U9GA 1BN5A 2LNBA 2RNJA 3IKVA 4LFUA 3I0TA 3MFKA 3IL2A 1IXRC 1U6GA 1PDNC 3GFJA 3E6DA 1MJ9A 3J80Z 1MJBA 3GW2A 2Z9OA 1IAWA 2F5DA 4IHSA 4BQAA 2QUFA 3P9CA 5DEQA 3EUHA 3K1NA 3EETA 2PG4A 1P4XA 4A0XA 3ZPLA 2F5EA 4Y17A 3GF2A 3PFIA 4BHPA 3S2WA 3F6OA 4GYGA 3PQJA 2C6YA 2PN6A 4U7BA 4HZFA 2P6TA 1PUEE 5FFXA 2A3SA 4MHGA 1QQIA 2FU4A 3M8EA 3WTSC 3W6KB 2EFWA 5HS8A 1Z1DA 2XKOA 5HLHA 3F8MA 3V8KA 2M1BA 4KN7X 2RQPA 2MA3A 1X3UA 1FWZA 1XCVA 1QO0D 2RC4A 4LLGF 4R1HA 2G7HA 4LG0B 1J9IA 2WWYA 2OQGA 2VBXA 2KIFA 1W5SA 2BEOA 4A6DA 3J7AO 4LK0F 3E6MA 4IPAA 1TW3A 3Q9SA 4WX9A 5BPIA 2O61A 1CF7B 1BM9A 4U7DA 1FZPB 5CLSA 5IT9K 2CWEA 3LAPA 3WGGA 3SXYA 3JW4A 6PAXA 3WE2A 2K7LA 1R36A 3I4PA 1IXCA 4Y13A 1H9TA 4B09A 2XHKA 3BOQA 3WTYC 4MQVA 1ZLKA 1XSVA 4L5JA 2G7UA 4M72A 2FE3A 2D45A 1RUOA 3TO7A 1K79A 4G9YA 2WTEA 4AVPA 4ENNA 4YIFA 4L0ZB 3ISPA 3HOSA 2Y48A 4WF2A 2YPRA 1XMKA 2HGCA 1KYZA 2RKHA 3I71A 2KJBA 4MEXF 1O7FA 3TDZC 3SHFA
chains in the Genus database with same CATH superfamily
5E1ZB 1SVOA 4BE1A 4IOCF 3WG7H 5EEHA 3W2VA 2LP0A 2R7UA 4AVZA 2EJRA 3MKWB 1S7EA 3EUAA 3LAJA 1MMSA 3RQIA 1FP2A 1XCBA 3X2QH 1XD7A 4A69C 3FKJA 2VQHA 1KQ8A 2K85A 3QYFA 1LB2A 4ENJA 1RZ4A 3HHGA 3RIRA 2O03A 4ENKA 3H3UA 1HW5A 3A02A 4BEHB 2RVCA 5GPCA 3H3VK 2WAFA 3RZDJ 2W24A 4BL0B 1ODDA 4F92B 1SAXA 3OYMA 3G1MA 3I9V2 5J8FA 3HOWJ 1DGWY 3KYDB 4GGGA 2HQNA 1Z6RA 2KQRA 2L9SA 4D5FA 3KP2A 3RZOJ 4UV9A 3NEUA 4KT5C 2Z2SB 3ZMVA 1TWAJ 2YR2A 5DUKA 2K02A 3L9FA 1R1VA 5DYMA 3VB2A 3G73A 3HXLA 4A3EJ 2W84A 4PSWA 4YFXF 1B72B 4PZJA 3K4KA 3V42A 3CTAA 4ZZDA 3E6CC 4XRFA 2Z33A 3HTUA 1T08B 2ZO4A 3BG5A 3KZIC 1BOAA 5D8LB 2MSYA 5DM7F 5CVJA 4P5OA 1VFCA 4OAZA 1OYYA 2NYXA 2Q8KA 1PUFA 1T98A 1WQ2A 2QF7A 3S1NJ 4PSXA 2CQNA 2A6TA 1APLC 2XPWA 4KUMA 2ISYA 4XSZF 2HKXA 3U1DA 1JKRC 2LK2A 2HVSA 1R5ID 4W1UA 4G94A 3ZXSA 2JTVA 3BG3A 1CGPA 4U0WA 2A5YB 3W6JB 3BTIA 3IC7A 4YEJA 4H4KC 4BBRJ 1X2NA 3LSRA 4BQOA 3IHUA 2LTPA 4OIOF 2HOAA 2FNAA 4IRGA 2P8TA 2X6YA 2EH3A 4IRIA 4RAFA 2AXLA 1ZG1A 2VT3A 2DJNA 1BC8C 5B1BH 3FF5A 4BHBA 1VQNI 1OCCH 4W97A 2EFQA 4N9HA 4DYRA 2W00A 3C18A 2L0KA 4YIRX 3OWTA 3FHNA 2NVTJ 3H36A 3LA7A 1USTA 3CCLI 3LSHA 2CQXA 5D8KB 3JCUC 1K83J 3T8RA 4KA4A 2CW0F 3OS1A 3OSFA 3ERED 1G3SA 3RKYA 5ICGA 3QPHA 2GA1A 4HDVA 1H9GA 4UXNA 4LG0A 3L7WA 3E0JB 1HKTA 1A6QA 2YSRA 4OU0A 1T0FA 3D0SA 1MKMA 2Y2ZA 3DQVC 5D6EA 3PNTA 1BOBA 4BBSJ 2LF8A 3M1EA 2ETHA 4E70A 1HXDA 1B4AA 4LB5A 2F5CA 2Q2EB 4UUSA 2NOGA 2ZFUA 2XSJC 1Z77A 3VYTB 3L2RA 1VQOI 3KZYA 3CESA 5IY5H 4BXFA 1IF1A 1UJ8A 2X85A 2HR3A 1YI2I 2E1MC 5IT9Z 4KIGA 2PI0A 2IGKA 2GZWA 2O8XA 2R92J 2ZNYA 1MBHA 1IUFA 3O6BB 5KVRA 4MGRA 2ADUA 2HWVA 4JBAA 1FSHA 1LKXA 1YE9A 4I02A 4UUVA 3F22A 2HTSA 3DEUA 1PP7U 2OU2A 1IN7A 2ECBA 2W48A 1TQMA 3C2GA 1Z05A 4D9JA 3DU6A 3WTUC 2Z99A 2W7NA 4L9NA 5JHUA 5D5UB 3GMEA 2BXYA 1LNWA 2DA1A 4NHJA 3WHCA 3ZMSA 2NVYJ 2GWRA 3S2HJ 2KDZA 4CCOA 4Y3OA 2JK3A 2M4KA 2OTLI 1YQAA 1BI3A 1DQUA 4NQWB 2DOAA 2RNGA 2ZSIB 4QPOA 4WXCA 4S0HB 2DCEA 3K4NA 2VQGA 4KFCA 3LWFA 1MBFA 2JWTA 3QWLA 5E8GA 1R5GA 4K2EA 5F04A 1OJLA 5ICEA 3T0YA 4BDYA 1SFKA 4AWXB 3OYLA 2CQ7A 1C0WA 2MLGA 1XTAA 2LC2A 5IOZA 3ZQLA 2FRHA 2LDUA 4NDLA 3KETA 4FE4A 3VFZA 2LREA 4PJJA 4RLFA 1W0TA 4KITB 4OINF 4L9JA 5HDNA 5F6FA 4S05A 4E7HA 2Q0OA 1XMAA 3HC7A 2K9QA 4OAYA 3SQNA 1Y39A 4YG2F 2FQ3A 3BQZA 3L00A 2KZGA 4JQFA 2FBKA 1W7PB 3A4CA 3CO7C 2JPBA 1T0FC 2MFZA 4IQ4A 3CUQB 3DXJF 2DK5A 3BP8A 4RAZA 2UV1A 5CKTA 1VQ5I 4U88A 3GLXA 2CYYA 3LL7A 3F23A 2H94A 2L4AA 1KU7A 5FFZA 1LDKB 1Z9CA 2L9NA 3D1NI 5E18F 4IZZA 1GV5A 2PJRA 2E7XA 2LFBA 3BG6A 3P9KA 4C2UA 5HDKA 1IZ1A 3R0JA 1Z3YA 2BW3A 3RKWA 2UXXA 3ML6A 1SD4A 2GXBA 2J5OA 4HF2A 1O3QA 5IYBJ 5KNLA 1FX7A 4YFKF 1A31A 5D5XB 2CV2A 1YRNB 1X58A 1WH7A 2JMWA 1AU7A 4G7ZF 2OV7A 3LSPA 2VLAA 2OA4A 4HDUA 2WV1A 3AFHA 1YITI 3ZQHA 4CXFA 3CUOA 2M9HA 2VJ5A 4X0GA 2DA6A 4BACA 3S2DJ 4DNCA 1MMGA 2F2EA 4CCLA 3FXOA 5J1UA 2OBPA 3SEZA 1FMVA 3BY6A 3DWLE 1QPMA 2Z16A 3CF5F 2VPLA 2VKHA 2VOPA 5LLQA 1VQ8I 3PJRA 2VONA 1ZTRA 4PK4A 1FP1D 1QVUA 1TWGJ 3D5SC 4RGXA 2EB7A 2OCCH 3C2HA 1Q1VA 5LEJA 4QTRA 1MH3A 4Y7NJ 1MBGA 3K4JA 4Q48A 4C2TA 2VC0A 3HSFA 2A69F 1T8IA 4Y33A 2M7AA 3HM5A 2HOSA 3OR1C 2MABA 3H35A 1BJAA 3M9AA 2JA2A 1B72A 2E2JJ 3J7ZI 2JA6J 1FPQA 1OQYA 4HQMA 3F9KA 1FOXA 2IAIA 4Y4RA 2Y0MA 4F93B 1IDYA 1IN6A 2M7BA 1RUNA 4DJAA 2B9SA 2FBIA 1G6NA 2QQ8A 2YX4A 2PFBA 3KFWX 3AKZA 4RM3A 1FTTA 3TO9A 3UNGC 5LGUA 2M34A 2E36A 4BJ5C 1SFEA 3CC4I 2CV1A 1LFBA 1MD0A 2IT0A 1B8IB 1LEBA 3DF8A 4LIUA 1MBKA 3FXQA 1D0YA 2V6CA 2XAHA 3TGNA 2QGUA 4D1QA 3AL0B 3CCRI 4D5CA 3O3KA 2HKOA 4RGSA 2KKOA 3FXJA 4ON0A 4B3AA 4CUGA 2E35A 3IRQA 4M6YA 1LQ1A 4E7ZA 1UG0A 3MZ8A 2FOWA 4IKFA 1K4TA 3NRVA 2VXZA 2HYGD 4G6DA 4KDPA 1X1BA 3I59B 3MMYB 4CDGA 4AUXA 1K7AA 2XAFA 3LQRA 5TJJA 2XVCA 3ZMTA 3OIQA 3OYAA 2CQKA 4FETA 2TDXA 3CC2I 1W4MA 4X1EA 3CO6C 2RN7A 3DBHB 4PFOA 2LG4A 1JJ6C 1O7LA 3H3ZA 3BZ6A 1E0EA 3K4CA 3KYLA 2MH9A 1JUPA 2R5YB 2LKXA 4LOCA 1GHCA 3VODA 1WJDA 2KL4A 2HXOA 2HEOA 5LHIA 1U9NA 2XF7A 2X51A 2HPIA 4XORA 2KRHA 1JHFA 5JVGF 3BQYA 3N4MA 2XKPA 4EMSA 4XKVA 3DLLF 2R5ZA 2COMA 2GAUA 3C2BA 1UAAA 3HRMA 1FBSA 2PMHA 4CCJA 5FLXK 1WPKA 4NB5A 1I27A 1OYWA 2CS3A 3OL3A 2JUCA 2L7MP 2EA4A 2MC4A 1W36D 4HEA2 4UVBA 3E3VA 4EATA 4JX4A 2DODA 5H20A 1G3TA 5LEKA 4RA2A 3EQLF 2PLYA 1ZELA 4LJZF 3FMRA 5K1YA 3BJ6A 3QU3A 2VT2A 3M4OJ 2NXNB 2VXDA 5DD4A 1S3JA 2V7FA 3DPTA 2OAZA 1Q1HA 4BS9A 1Z91A 1VQ4I 4CHUA 4YIIA 2RDPA 2O6GE 3P5JA 3LOCA 4ENMA 3ABTA 2OTJI 3JRIA 4AIJA 2BY2A 4MTEA 3R61A 4DW6A 3BR0A 1X1CA 1U5TA 4M3BA 1BL0A 4E7JA 3OY9A 1V5FA 4BXUA 3F8CA 3S3OA 2KRCA 5EF6A 4BJTA 3W3CA 2QCOA 3KP5A 5H6RA 3FXMA 3BR6A 1HKQA 2E71A 4O3MA 1BBYA 1ZQ3P 2ISZA 3K4MA 2AS5F 2R7DA 3BG9A 3LSTA 5HODA 1MDMB 2ZC2A 2MBFA 1DPRA 2CSOA 2KLOA 1WH5A 2HS5A 3P9IA 1IDZA 1JGSA 3J81K 2VBZA 4M3EA 1QHHD 3DCFA 3T8TA 1KYWA 5EZGA 2CGPA 1JTYA 4M3GA 3Q5FA 5F1JA 1YJ9I 2UXNA 5J1YA 1F9NA 1ZRDA 2DFIA 3ABMH 3GXOA 3HUGB 3AG4H 2PJPA 1W1WE 2O0YA 1KGSA 3I53A 2BV6A 4KN4X 5KK1A 3A01A 1VQMI 3BC8A 1U8BA 4A3JJ 3DU5A 2L4MA 2ICWG 2QQAA 4M6XA 5M5WJ 2D1VA 5CVUA 4A5NA 5DTDA 5JLXA 2K9LA 1QHGA 3ZQGA 3HRSA 1TLHB 2QSHX 3KCCA 5EYRA 4HLXA 1MMDA 2DQRA 5FO5A 5K5OA 3BPXA 1HF0A 4BJ6C 2Y69H 1FTZA 2LKPA 2ZMEA 4IHYA 3QP6A 3J7AY 2CO5A 2JZYA 2M30A 1IXSB 1GLNA 3NARA 1YFHA 4IRHA 1W7PA 5E1XA 1I1GA 1Z21A 1XSDA 3QU6A 3PIOF 5K5RA 4PCQA 3U1KA 1G4DA 3S1QJ 2H6CA 4XMYA 1VZ0A 3KP3A 1D1AA 2A6EF 1G3YA 1SC7A 2P0WA 3A1YA 1TNSA 2KZVA 2CU7A 2W1OA 2BOLA 1TW2A 2LR8A 3QPLA 4G7HF 4G7OF 2JA7J 1FOWA 2IA1A 2QWWA 3IAM2 2VOOA 4CSWA 2VB6A 3SZTA 2DMTA 5FJ8J 1W36C 3K69A 5E1WA 1T33A 4Q4ZF 3WTTC 3ONQA 3ROUA 5F1RA 5FLMJ 4AIKA 3QQAA 4N4NB 4M3DA 4GCVA 1HC8A 2QBYB 2COBA 3EYYA 4LLLA 1U5TC 4Q47A 2LY9A 5ERIA 2CG4A 1YIOA 1WSUA 3KEYA 1UHSA 1Z6TA 1CQTA 2P4WA 1M1EB 1P6RA 2YUSA 4YFNF 2EIJH 2XF6A 1ETXA 3OV8A 2FUG2 3VPRA 3F72A 2HQ5A 3CCJI 4P55A 1B9NA 1B1BA 2VKEA 1V55H 2BE5F 2FJ1A 4A0ZA 3I55I 4AC0A 1EH6A 2XAQA 3AG1H 4UVAA 4UUTA 4D0PA 4L9VA 4M9XA 3K7AJ 2DA2A 5EGOA 4ZJZA 4KNYA 1WI9A 4B48A 4CYDA 5IPAA 4XLFA 2EA2A 3CLOA 2Q1ZB 2FF4A 1MGTA 3M7GA 4I76A 5J1RA 1T2KA 3Q0WA 1W0UA 2LBFB 4KIBA 1L3LA 2QENA 3H5AA 2IS6A 2F48A 2OQRA 9ANTA 5FKLA 2DA5A 2IS1A 2HZDA 2DI3A 1IRGA 4EVIA 4HF0A 2F5FA 5ICCA 4G8XA 1HBXG 3B73A 3OMYA 4L0YB 4LGWA 4BNCA 2DU9A 1KU9A 3ZN0A 3LSIA 2VQCA 3EPZA 2ZMEC 3F21A 1HDPA 1WRJA 5IOYA 2VKDA 1R22A 2DFEA 2KP6A 4NNJA 1JTXA 1NG6A 3T1BA 4KICA 1D1CA 1B8IA 3H92A 4EM2A 4IO9F 2STTA 3REOA 3B02A 2P5VA 3E5XA 5DCMA 4XOTA 2ZXIA 2EZLA 5TISC 2L3DA 3R60A 2EK5A 2K4JA 4DQ2A 3HYIA 3PO3J 5A2QK 2LSOA 4MNUA 5DUIA 3PFYA 5LGNA 3SYTA 3HOUJ 3M8FA 2LYCA 1ZR2A 5J3LA 1PVEA 2RQQA 3I59A 4F3QA 3OYEA 4GFBA 4I09A 4ZYDA 1T39A 1RIOH 5D4SA 4C3JJ 2ELKA 1JI8A 2XRLA 3O2PE 2H09A 1ZGAA 1J0RA 5FLXZ 1K78A 2QLZA 1IV8A 3BROA 4PFPA 3BCAA 2QYOA 2V9VA 1K61A 4P9UA 3GLLA 5C4JJ 1OYIA 1R7JA 5GADJ 3MAJA 4EEFG 4BAYA 3DKWA 1Y6IA 3BZKA 2IA2A 2R5YA 1X2MA 1QVTA 3FM3A 3SDBA 2HU9A 1UHMA 3MEXA 4I0BA 1UHWA 2NVQJ 2L7KA 1DDNA 1ZAOA 2QVOA 3FIWA 4HOBA 4U0VA 4TV7A 1ZGWA 2EFNA 4Q5SF 2HTJA 2JJ7A 4N9IA 2IRFG 5EJCA 4RAYA 3BTLA 1YS6A 3M8JA 3CZ6A 2RGVA 1VQ6I 1FIPA 5D6FA 2Y0SA 5LRRA 4J01A 4PGHA 2PQ8A 2YU3A 4II2A 3ELKA 1LEAA 2Z5UA 2E60A 3ZP5A 2K3FA 2DO7A 3H1CA 2QSFX 3I4NJ 3OS0A 2AQFA 3IUOA 4WXHA 1WFXA 3O8GA 5IP6A 2JN6A 5FGMA 2L7FP 1HQCA 2V1DA 3MKLA 5LHHA 1Z7UA 5EG0A 3SJMA 1GV2A 1TC3C 5CYVA 4EQQA 3J81Z 4PGGA 4LB6B 1ON1A 4MO7A 2CUJA 2MYSA 1DPUA 4KT6A 2K4BA 1BW6A 2DN0A 5IT3A 3IKTA 4XKBA 1TZLA 3KZZA 4BE0A 2DTZA 2O9LA 4PJMA 3IP4B 1G3WA 2DW4A 2X48A 5DS9A 2X4HA 2NVXJ 4HBLA 3BR5A 2ZFWA 4PJ0C 4G6TB 4I2OA 1SVLA 4JYKA 4DOZA 3RPQA 1IUYA 1EJ9A 2AO9A 4QIWN 2ZXWH 1LFUP 3HTSB 2CRGA 1O57A 3EUKL 3HRTA 4HX7A 2NS8A 2V9KA 4CCNA 2V9PA 1B9MA 2WV0A 1BW5A 2XPUA 2JT1A 5M5YJ 2EWNA 2DLLA 5F27A 3QPTA 5FKMA 5K5QA 1E2XA 4BUPA 4EV0A 3JAMK 1TWFJ 3DFGA 1A5JA 3JREA 2HXIA 3F3XA 3CDHA 4CA0A 3C7JA 2W82A 4BQNA 3WU1B 4I98B 1QBJA 3GTJJ 1OCPA 2KIUA 4RB3C 3E97A 1RKTA 2X0LA 1XGNA 2K3PA 4EJVA 2XGXA 3LSMA 3S1MJ 3MQ0A 3FX3A 1UCRA 3RJPA 2W57A 4IVNA 2FQ4A 2BVMA 3L2QA 4A0YA 3DP7A 3CCQI 1TTYA 1MJAA 2HQRA 3OOUA 4BQQA 2FSWA 1J09A 3RI4A 2M8GX 1S7OA 1NH3A 1D1BA 4UNOA 5DCFA 1PP8F 1R4NB 1U8RA 4ZYAA 3V7RA 4I6ZA 1E3PA 5KAFC 1P9QC 1LE8A 2UUZA 3WG9A 4E7LA 3AG3H 3M3YJ 3BTCA 3H5NA 2RREA 5LFAA 3HJEA 4XM3A 2OZ6A 3BR2A 1CF7A 4OMYA 4F55A 3QP5A 2VBYA 5F0FA 4RMNA 3VWBA 2CUFA 3TBIA 2D5VA 5BOXA 3CJNA 5D5WB 3GTOJ 3DKXA 1N25A 5CJ9A 2JPCA 4CCKA 3KLOA 2M2EA 3A0HC 1FYMA 2QZ8A 4U87A 4RB2C 1HOMA 1V5EA 1LUJB 3CD6I 3TMOA 1JT0A 2XROA 2WBMA 3V7SA 4HQEA 4OIPF 2M45A 1OCZH 2VIXA 5JR3A 2Y75A 3Q0UA 1WJEA 4ABZA 1P92A 2IPQX 1HLVA 3WGHA 4HNUA 2GA2A 2N8GA 3L2CA 1KQ0A 2EZIA 1O3SA 1TT0A 2GBYA 1HDDC 5BS6A 3DPUA 2L7ZA 5LHGA 2R7QA 1IRXA 2FBHA 2IGNA 1B6AA 3R6SA 3DLAA 4HAMA 1STZA 1MNEA 2XF5A 1A6IA 2EPFA 3QODA 5JVTA 1AOYA 2HVRA 1Y56A 5D5VB 2NS7A 3HDDA 2BHYA 2Y9ZA 2DYSH 2IBDA 4Y15A 4F7ZA 5JLWA 3CMYA 5EZHA 1X3WB 2FNPA 1KONA 3S93A 1TQPA 1WJBA 4RDUA 1VQ7I 1G59A 5F64A 4IEJA 3I54A 5E3NA 2RAEA 3OYCA 3VOEA 4E7SA 3BCBA 4DYCA 2D2WA 3C1DA 3V7CA 5ILUA 1YG2A 3OIOA 3LFUA 2HOTA 3DTIA 2DA4A 2KRFA 5L3CA 3GZNB 3HZJA 2ZCWA 1BR4A 5LBQA 1TNTA 4OIQF 3AAFA 1ITYA 4YRVA 1XSXA 1E17A 2PX9A 3TQNA 3HIFA 1RESA 4A3LJ 4AD9A 5FKOA 1LDDA 2EV0A 4EM0B 1YHQI 1KU2A 3RSNA 2R3SA 2D1HA 4BH9A 3KLNA 1WJFA 5CQEA 3VSKA 1IJWC 3BJOA 1IGNA 2FOKA 2IP2A 2H1LA 1Z0XA 2VPRA 3IAS2 4CZZA 3ZN1A 1ZK8A 4MLOA 3DKYA 1R9TJ 3JRBA 3IWZA 1D8JA 2K9SA 4DZPA 1UZCA 1OPCA 2IGMA 3KEQA 1EH7A 4BEHA 3DBLB 4XONA 4EJUA 3ZGKA 1Z3XA 2ZXHA 3KEOA 4RLQA 2V1UA 2OD5A 3PUFA 3DV8A 2BZTA 3HSRA 4HRIA 3CMAI 1ZLJA 3F8NA 3HPGA 4DBRA 1X4PA 4M9ZA 1MNMC 1KA8A 3MZYA 1OCOH 2ID6A 3GCMA 2JRTA 2MC3A 2ZJPF 2LVSA 2IGOA 3QYBA 2FD5A 3SEQA 2DBBA 1SAUA 3RYRA 3W6VA 1JGGA 3VYUB 2XB0X 2CH0A 5DDGA 4HYEA 5AONA 1JJ8C 1BIBA 5FLVA 3GTQJ 5L3BA 2DA3A 2FEZA 3ZMZA 5L3GA 2FXAA 2ZBKA 1FBUA 5EEAA 2E1NA 4L5IA 3FM5A 5L3DA 2L02A 3HGGA 1QRYA 1D0XA 1A35A 4H0EA 2HOEA 4CH7A 1NG7A 3HPHA 2X1CA 3K2ZA 3UR3C 5HS7A 4CYCB 1ACIA 4PJLA 1WKMA 2IEKA 1FT9A 1MW7A 3FBIB 2KISA 4G6QA 1N77A 2QQ9A 2HYJA 1XDSA 1YYVA 3OYGA 2XV4S 3MN2A 1K6YA 3VYRB 3VEPA 1TWCJ 2NNNA 3KP6A 3N05A 3BT9A 3FXLA 3QOEA 3JAMZ 4ZZLA 2NS0A 4HPQA 1YIJI 2LLKA 4KMFA 2Y0SN 1JE8A 2M0CA 2K86A 1MH4A 4C3HJ 3FDYA 4XBFA 1JKQC 4J19A 3GYHX 1P7IA 4BDZA 3KP4A 1OISA 5HS9A 2LMDA 1SMTA 2RV8A 5D4RA 2B7EA 5HNHA 1LJ9A 4RB1A 4LIVA 1YTYA 1AWCA 3R0AA 3ZMDA 3R4KA 1Y0NA 3QAHA 2VI6A 2HDDA 2P7CB 3E5QA 5ICFA 2ZJQF 1YW8A 4WK8F 3PNYA 3QOPA 1JT6A 2XGCA 1W5TA 4DBQA 1H88C 3H0DA 2JUGA 1B59A 1OCTC 2HZTA 4HG2A 3ABUA 4XN3A 5C3EJ 3HRUA 4ZH4F 2Z1DA 2A5WA 2BBYA 3OYIA 1X1DA 3ECHA 3LSGA 3OYDA 2EFOA 3CCUI 2Q2EA 1WJCA 2ESHA 2WB1A 4F91B 2K9MA 3FMSA 2VODA 3ZQQA 3GO5A 2P5KA 2XGDA 2WAQA 3E6BA 2KIMA 2OZUA 3GBGA 1LDJA 3HOYJ 4LD5A 2J5PA 3JR9A 1DU6A 2G9WA 5IYDJ 2E1MB 1YX5A 2KFDA 2X1DA 3FMQA 3H5RA 4XKWA 3K0LA 4EJWA 3NQOA 4XKCA 2ZKZA 3JRDA 1XDUA 4ESBA 3BLYA 2NRAC 3N97A 5L3FA 4A12A 4E4HA 1U2WA 1J5YA 1MIJA 3PSIA 2HDCA 3P7NA 3G3ZA 3FBNB 3ERMA 3PM1A 3TL4X 1PUFB 3KIOA 2A61A 2XIGA 1E3HA 1FMWA 3DEWA 3WTWC 3NWSA 1RR8C 3BJAA 2IS4A 1ORKA 4MTDA 1RRJA 1ETYA 5ILVA 4EGYA 4QSHA 2EIKH 5B5EC 1N78A 3LA3A 4RM2A 3GZ6A 4NQWA 1JKPC 3E5UA 4A3FJ 1I1SA 2FMYA 3FWEA 3JRFA 2E7WA 1HW1A 5K7HA 3TEDA 1FYLA 3VYSB 2I10A 3T5XA 4FX0A 2LD5A 1SEUA 3S14J 1OLTA 4PDKA 2NAZA 4B47A 4FISA 5JHFA 3SZPA 1F36A 2CJJA 4JOMA 2JRMA 4O5VA 1Y8RB 3G4SI 3GTLJ 1SD5A 2EV5A 3RTRA 2V79A 5CVIA 1W7PD 2W4SA 4AYBA 5AIQA 4B8XA 1OFCX 2FX0A 2R7ZJ 3F8FA 3ZR8X 2DMUA 1SANA 1XGSA 3WODF 5CPRB 1V4RA 4C3IJ 2R4GA 1XB4A 4M9SA 4NBQA 5BPDA 1IRFA 5DV5A 5HVQC 3S8PA 1LPQA 2Z3YA 3HOTA 2LY1A 4XRSA 5FROA 1XN7A 1I50J 4XLEA 3MKZA 3G1LA 3I56I 3HG9A 4FHTA 2XGEA 4KISA 1F43A 1GVJA 4R79A 1PYVA 4ZYHA 3CUQA 1ON2A 2DT5A 3TKYA 2R7WA 4EGZA 3DTKA 3F0CA 3K4LA 4MIMA 1Y1VJ 1J59A 4HLYA 2W85A 3KYCB 5ILSA 2LH9A 2Y9YA 2CUEA 3SFZA 4UUSB 4CICA 1U78A 4P9FA 2VC1A 1WCMJ 1OR7A 1JXSA 4ZC3A 2KHMA 1SFUA 5EEGA 1SD6A 4XLNF 4XSXF 3JRHA 2B0LA 3TOBA 2BXZA 2EV6A 2KPMA 4JX6A 1MSFC 1J7KA 4ZDOA 1YRNA 1VQKI 3DTEA 3GVAA 4ZYGA 3RPUA 4HSRA 5E17F 5E3OA 3L2UA 4IHTA 2R7OA 3CP8A 5KAIC 2DTRA 1BI0A 2PMZA 1HSJA 5LGTA 3FXKA 5AIPA 5JFRA 2YU9J 1XGOA 2MGQA 4S04A 5E3LA 1YOVB 1FEXA 3QRFF 1KZHA 2VN2A 1U9OA 1RNLA 1R5HA 3S15J 3JSOA 1WI3A 5HOOA 1VF9A 5FD6A 2VUMJ 5GAHJ 1WGXA 3GTKJ 3GX4X 3CMEI 2R7FA 1MSEC 3SZGA 2XUBA 3S1RJ 3FXUA 4IJAA 2K5CA 4DZJA 3QYEA 4KYWA 1NHAA 1VNDA 3LA2A 3GZ5A 4B43A 2LF7A 2DPUA 3HKZA 1Y0UA 4JK1X 3FISA 1OKRA 4V2FA 2DT7B 1YJNI 1ZARA 3GFMA 3TOAA 4I0AA 4A3MJ 4LG3A 1EF4A 4XRMA 3I58A 4CGZA 3PUBA 1U0JA 4HA8A 2XRNA 2W25A 3HOZJ 1X1AA 2STWA 4HV5A 1SFOJ 1J75A 3BZCA 4CCMA 1A36A 5HLIA 1VI0A 4M3FA 5ED4A 3ZQCA 1TT5B 4BXXJ 1YX3A 2NOJB 2DK8A 2WY8Q 4L18B 2X6OA 1S6LA 4HW0A 1ONVA 1EH8A 1G8XA 1YW7A 1S9HA 3K1MA 1ETWA 3Q9VA 2H27A 2K27A 3COAC 1S7AA 4UVCA 3IH2A 2P7VB 2H6BA 4A2UA 5F0CA 3BR1A 3V8JA 1BI1A 3L09A 3CUQC 1F1ZA 2XAUA 5B1AH 1AA7A 3JRAA 3CF2A 3F8BA 2BY1A 4HNVA 5IP7J 3JTGA 1H8AC 3TP0A 4ZTJA 4M6VA 1D8KA 4HSTA 1TBXA 2WADA 2EIMH 2VKVA 2F5VA 2V1XA 4A3GJ 2KIQA 2BY0A 5IYCJ 2OCEA 4HV6A 3CDIA 3LSJA 1OR7C 4IQJA 3K1PA 2MW8A 2QA4I 3PQKA 2QM3A 2R7TA 3GEZA 3QPSA 2PJRB 2K40A 2QQBA 3G2BA 3G6EI 2DMNA 2MLKA 3HSEA 4EJOA 2EFPA 4OWRB 4BGDA 1O3RA 2EBIA 2CQQA 2XAGA 2BW3B 1MZBA 3TW7A 4BHCA 1FYKA 2A68F 1LVKA 4FE7A 1JHHA 3BDDA 1XMXA 2DA7A 4BYYA 1YW9A 1X3ZB 1BR2A 4I01A 4F52A 2I8DA 3Q3SA 2PEXA 5C4XJ 3ECOA 2V4JC 5HDGA 1G2HA 5H6QA 2JSCA 2A6HF 2TCTA 3U2RA 2UWMA 3A03A 3G1OA 1T6SA 2O3FA 5L3EA 2JA5J 5J4VA 2IJLA 1R1UA 2CFXA 3JSPA 1VTNC 1FIAA 1R1TA 3VDXA 2XAJA 3I5UA 3FXRA 1EV7A 2X1EA 3WTXC 4IXAA 1ETKA 3LFKA 5CVVA 2ZSHB 1XG1A 3OYNA 1D5YA 1WZ2A 1TQIA 4DYQA 1I3AA 3PL8A 3HHHA 1I5ZA 1YLFA 2GIVA 2JVGA 1F5TA 3K2AA 2BY3A 1QGPA 4ASNA 2R7VA 1FC3A 2OC6A 3FZVA 4N0BA 3JRGA 2WA0A 1RI7A 1V54H 2IW5A 4FX4A 5BMZA 2DPDA 3CQZJ 3O8HA 1USSA 1DP7P 2ACJA 4ANJA 3S16J 1AKHB 3S3NA 3TP3A 2JSPA 3JRCA 4IHVA 1H0MA 4MEYF 3ASOH 2BGCA 2HYFA 3M07A 2H8RA 3KX2A 1AHDP 1P7JA 1GUUA 3I64A 2DFFA 2E2IJ 1QNTA 3AL0C 1D0ZA 3LQQA 1I39A 1IN4A 4E6KG 2ZJRF 1MDMA 2WB1N 3L1PA 2X9DA 4OMZA 5HLTA 3IRRA 1BA5A 2GIZA 2L5QA 2PMUA 2WAQN 3D5LA 2CW7A 4A3BJ 2ZNZA 5BQTA 1BC7C 2A07F 1HW2A 2XPVA 3HUGA 4QPQA 1IRZA 4HX4A 5E20A 4HF1A 1X1PA 2FA5A 1V5GA 3BG7A 3WTZA 5LRSA 1ZGJA 4UB8C 3FK7A 5GP9A 3RQ4A 3GUDA 1U3EM 1KQ9A 3TDUC 5J47A 1OMIA 2NNYA 2CUZA 4L5EA 4IL6C 4EJTA 2JA8J 2M87A 4M71A 4CO8A 3CCEI 4XR6A 2IVMA 1FNNA 2KMUA 2M3AA 3I4MJ 1N75A 2DMPA 4IX7A 2V6EA 2UZKA 2M8EA 4ESJA 1IV6A 2R5ZB 2M5WA 4AM3A 5J6XA 5C44J 4KMUX 1VQ9I 2O5RA 4KIFA 3ZCOA 3DEEA 3ZMUA 2MD5A 1ZYRF 3CCVI 4X6AJ 2QSGX 3OYJA 4AYBN 1IN5A 1R00A 4XLHA 3OYKA 2DDBA 3ABKH 4BY7J 5TRDA 4A5MA 4UY8I 1ERDA 2DT6A 5J8CA 1GXQA 5EDNA 3IH3A 1UB9A 4XICA 2HNHA 1IW7F 3CJRB 5JI6A 1T56A 1MMAA 4P96A 4BE2A 1I6XA 2QBYA 4NUBA 1IG7A 4FT8A 1A04A 3TW6A 4I7HA 1BIAA 3GFIA 2DDAA 1TWHJ 1REPC 4ZDPA 2L54A 3MCZA 3S3MA 1U5TB 3CP2A 4CZCA 3SFIA 2VBWA 3J80K 2L9VA 2WAEA 1R6RA 3D5RC 2VE9A 2VJ4A 1WJAA 4HX8A 3OOPA 3L2WA 1PJRA 1TL8A 4JP0A 4EM1A 1QA6A 1LVAA 3GWZA 2LOOA 3CMMA 3I3LA 4BU2A 1IC8A 1WHUA 2DMQA 2OPTA 2NVUB 4XLPF 1BR1A 1ZRFA 2GM4A 4IHXA 5J40A 1DUXC 2BYVE 4M73A 1T38A 3NAUA 1VQLI 1H89C 3WU2C 2LBFA 4XL9A 3LNQA 3IWFA 2A05A 2OJED 3Q0VA 3TO6A 2HFHA 2JVHA 2PMZN 1SFXA 3OS2A 3A01B 2E5ZA 3KE2A 1P4WA 4OOIA 1POGA 2EILH 3FK6A 5A2QZ 3M1CA 4GDFA 1QZZA 3H0GJ 2PBIA 1XGMA 2VQLA 3OIPA 3JTHA 1MNDA 4G12A 2R0QC 2ESNA 4GRIA 3OSGA 3A2KA 1XS9A 2K9NA 5B3SH 2R93J 2ZMEB 4XOPA 4QLCU 1O3TA 5FB2A 2VE8A 5CVRA 3F6VA 4LLNA 1FBQA 1WJ5A 1Z7LA 3OYHA 3HKZN 3HEFA 3MWMA 2P6SA 1S5LC 1GXPA 1RPWA 3RKXA 1JUMA 1SMYF 4A6EA 5GAGJ 1FY7A 1HSTA 4XIDA 3EYIA 3WE3A 1ETQA 1TP4A 2XDVA 4U0YA 3BWGA 4RB0A 4OIRF 4MQ9F 3HOVJ 4A3IJ 2KT0A 5F0HA 2FMLA 1ZG3A 1K6OA 1ZRCA 4ZYEA 1D3YA 4WCGA 2Y30A 3BPVA 4WXDA 4ESFA 5M5XJ 2OF7A 1ZHFA 2VASA 3CCYA 2P5LC 5E8IA 1DGRM 1FOYA 3E7LA 2ZXJA 1R58A 3K6GA 3V4GA 3DPLC 3WHBA 1XX5A 2GXAA 3WTVC 3ZQ7A 4O6JA 2IA0A 2ME0A 1OCRH 1ZH5A 5K7ZA 4FQGA 4UV8A 4UB6C 3KPHA 2ELHA 3H9QA 4RBOA 2MD0A 3IH4A 3W2AA 3MZHA 4GO1A 1YJWI 3ZRGA 1R71A 2DAOA 4UHTA 1YO5C 1QZYA 1NTCA 3K9TA 3GTPJ 2H8WA 2I5UA 1R23A 1SD7A 1J2XA 4RS8A 1GT0C 5FRNA 2LKSA 3C3WA 1S72I 2V26A 4AIHA 1ZG5A 4LK1F 4KJZA 4XK4A 4FTHA 1RETA 4II3A 5B66C 1S8NA 2M0MA 3HL2A 5EGOB 2JQ7A 2GQQA 5M3MJ 3IV5A 1LFPA 1P4AA 2HDWA 1KU3A 3CJQB 1BI2A 4L9TA 4RGUA 4XLAA 1ZR4A 2L01A 3E1SA 4RAGA 1FLIA 3HOXJ 2CW8A 2HVQA 4C9YA 3S32A 3ZQFA 1D5VA 2XASA 3K70D 2TRTA 3ULQB 3WU0A 1AKHA 2M4GA 1ZREA 1RKWA 4LMYA 3PNVA 4NC6A 4B1RA 2E2HJ 1I6HJ 2XC7A 2HQAA 4GXOA 3V8LA 1XPXA 1WVRA 2XSDC 4M74A 1ULYA 1FOKA 2EQRA 1L0OC 4DGWB 2R7RA 5FD5A 4R8HA 3EDPA 1HKSA 2KDOA 3CDLA 3WGIA 5DCMB 1ENHA 2VJJA 1UELB 3GFLA 5DD8A 1ZN2A 3HB9A 5LD2C 5GTIC 3LMMA 4HNTA 2GXGA 1FSEA 4XLCA 1WWXA 2HPMA 2E1CA 4V19K 1ZKGA 2LY2A 3CJTB 2EINH 2O8KA 5IP9J 4RGRA 4Y52J 4A3CJ 4IF4A 3RYPA 3FHZA 4PJNA 4ITVA 4C30A 1O4XA 2DQLA 1V3FA 1X19A 4GYIA 5E79C 4ETSA 1K78B 1P2FA 2ZJ2A 2YX7A 4QWQA 3BTJA 1E3OC 2KJCA 3GTGJ 1S29A 2MH2A 3S17J 3RKQA 1ETOA 4WWCA 2E34A 3RCOA 1F4KA 3RDIA 1IN8A 4D7NA 3OR2C 4PUSA 2WC2A 3KP7A 4Z2YA 1YS7A 1UFMA 5HLGA 2OUMA 3U9GA 1BN5A 2LNBA 2RNJA 1W5CC 2DOFA 5TGTA 4AIDA 3IKVA 4LFUA 3I0TA 3MFKA 3IL2A 3OYFA 1IXRC 1EA3A 2F4OB 3ABLH 4V2GA 1I3QJ 2EZHA 1U6GA 1PDNC 3GFJA 2ECCA 3E6DA 1MJ9A 1UMQA 3J80Z 3GTMJ 2ID3A 1MJBA 1X4OA 3GW2A 4XN0A 2L9RA 2Z9OA 1IAWA 2E5NA 2F5DA 3ASNH 2L2OA 4BQAA 3J7YJ 4IHSA 2X6WA 2QUFA 1Y1WJ 3P9CA 1QPIA 3PSFA 1IO2A 5DEQA 5EG0B 2CV0A 5KCMA 2QKLB 3EUHA 3K1NA 3EETA 2PG4A 3K10A 4N4OB 2AXTC 1HA8A 1P4XA 4A0XA 3ZPLA 2ME6A 2F5EA 4Y17A 5DM6F 3GF2A 3PFIA 4BHPA 1NK2P 3S2WA 1QZEA 3F6OA 4GYGA 3PQJA 4LITA 4Z6YA 2R7SA 3K70C 5FRMA 2C6YA 2GLOA 2PN6A 4U7BA 4HZFA 2QEXI 1K4SA 4E7KA 3MD2A 2E1OA 2P6TA 1RC9A 1PUEE 2YS9A 5FFXA 3PIPF 2BHZA 1ETVA 5F08A 2A3SA 2CFOA 4B3XA 4MHGA 1QQIA 3PO2J 1XC5A 2GOXB 5M3FJ 5HNFA 2FU4A 3M8EA 3WTSC 4IHWA 3W6KB 3VSLA 2EFWA 5HS8A 2IXSA 1Z1DA 2XKOA 5HLHA 3F8MA 4P1WA 3U21A 2M1BA 4KN7X 3V8KA 4FCYA 4ZTFA 1BJZA 3MVPA 2RQPA 2MA3A 3L2VA 4XQFA 2R7XA 2AQEA 2QKMB 1X3UA 1FWZA 1XCVA 1QO0D 3ZQIA 4ZDLA 2RC4A 4LLGF 4R1HA 2G7HA 4LG0B 1J9IA 2P81A 5FKNA 2WWYA 2OQGA 4JX5A 4A3KJ 2VL8A 2VBXA 3CC7I 1Y8QB 2X6XA 3ESWB 3RPUD 2KIFA 4MFEA 1DU0A 2DXIA 1W5SA 2WY7Q 3OL4A 2BEOA 4A6DA 2CMPA 4IOAF 3K4BA 4MFDA 4NC7A 4B44A 4DIQA 3OYBA 4A3DJ 3SDGA 4LK0F 3J7AO 2GOMA 3E6MA 2H1KA 2LRDA 4A93J 2E19A 2EZKA 4IPAA 4I99C 1TW3A 1LE8B 1EKEA 3HBLA 3Q9SA 4BY1J 1R49A 5K7FA 3DBRB 4WX9A 5KHDA 5GPAA 5BPIA 2O61A 1CF7B 1Z67A 3A0BC 3FKIJ 2V1NA 1BM9A 3B6CA 4U7DA 1FZPB 4FASD 2F4IA 1SVMA 3LSKA 2BVLA 2XB5A 5BNGA 5CLSA 2DOEA 5CQGA 5E3MA 2ELJA 3NWTA 3EUHC 5IT9K 2CWEA 3BR3A 3LAPA 4C2MJ 4YELA 4B4CA 4J00A 3CCMI 1FJLA 3WGGA 1JKOC 3SXYA 3H9GA 3ZOBA 2ZB9A 3JW4A 6PAXA 1MBJA 3WE2A 2DJIA 2K7LA 2VJIA 1R36A 3I4PA 1IXCA 4Y13A 2DYRH 1H9TA 1UG2A 3AG2H 1RR7A 2G0EA 4B09A 5H2FC 3W2WA 3H9JA 2XHKA 3BOQA 4XNFA 1QU3A 1DP3A 3UKGA 3MKYB 3WTYC 4MQVA 1ZLKA 1XSVA 4L5JA 1HCRA 2G7UA 2AHQA 4M72A 1NK3P 1T95A 2FE3A 2DFHA 2MG4A 3TO7A 4D7MA 2D45A 1K79A 1RUOA 3HGYA 4G9YA 1JUSA 1MBEA 2HI3A 2WTEA 4AVPA 5GTHC 4CYCA 4YIFA 4ENNA 3ISPA 5GAEJ 3G71I 4L0ZB 1R4MB 4XRSG 2IS2A 2F4MB 3HOSA 2O7OA 2Y48A 4AU7A 2Y31A 3B6AA 4WF2A 2YPRA 5J4YA 1GVDA 3CLQA 1GDTA 1XMKA 4NC8A 5FKKA 2HGCA 1KYZA 4E7IA 1MMNA 2RKHA 2F6CA 4BKXA 3I71A 3CCSI 1VQPI 2KJBA 4MEXF 1O7FA 3TDZC 3SHFA 2B63J
chains in the Genus database with same CATH topology
5E1ZB 5EEHA 2EJRA 3LAJA 1FP2A 1XCBA 1XD7A 1KQ8A 1LB2A 4ENJA 1RZ4A 3HHGA 3RIRA 2O03A 4ENKA 3H3UA 1HW5A 2RVCA 2W24A 1ODDA 1SAXA 5J8FA 4GGGA 2HQNA 1Z6RA 3KP2A 4UV9A 3NEUA 4KT5C 3ZMVA 2YR2A 5DUKA 2K02A 3L9FA 1R1VA 5DYMA 3VB2A 3G73A 2W84A 4YFXF 4PZJA 3CTAA 4ZZDA 3E6CC 4XRFA 2Z33A 3HTUA 2ZO4A 1BOAA 5D8LB 5CVJA 4P5OA 1OYYA 2NYXA 2Q8KA 1T98A 1WQ2A 4KUMA 2ISYA 4XSZF 2HKXA 3U1DA 4G94A 2JTVA 1CGPA 4U0WA 2A5YB 3W6JB 3IC7A 3IHUA 4OIOF 2FNAA 4IRGA 2P8TA 4IRIA 2AXLA 1ZG1A 2VT3A 1BC8C 3FF5A 4BHBA 2EFQA 4N9HA 3C18A 3LA7A 1USTA 5D8KB 4KA4A 3T8RA 2CW0F 3ERED 1G3SA 3RKYA 5ICGA 3QPHA 2GA1A 4HDVA 1H9GA 4UXNA 4LG0A 3L7WA 1HKTA 2YSRA 4OU0A 1T0FA 3D0SA 1MKMA 3DQVC 5D6EA 2LF8A 3M1EA 2ETHA 4E70A 1HXDA 1B4AA 4LB5A 2F5CA 3KZYA 1IF1A 2HR3A 5IT9Z 4KIGA 2PI0A 2GZWA 2O8XA 2ZNYA 3O6BB 5KVRA 4MGRA 2ADUA 2HWVA 4JBAA 1FSHA 4I02A 4UUVA 3F22A 2HTSA 3DEUA 1PP7U 2OU2A 1IN7A 1TQMA 1Z05A 3WTUC 2Z99A 4L9NA 5JHUA 5D5UB 1LNWA 4NHJA 3ZMSA 2GWRA 1YQAA 1BI3A 4WXCA 4KFCA 3LWFA 5E8GA 1R5GA 4K2EA 5ICEA 3T0YA 4AWXB 1C0WA 2MLGA 2FRHA 2LDUA 3KETA 3VFZA 4OINF 4L9JA 5HDNA 5F6FA 4S05A 2Q0OA 1XMAA 3SQNA 4YG2F 2FQ3A 3L00A 4JQFA 2FBKA 1W7PB 3CO7C 2JPBA 3CUQB 3DXJF 2DK5A 3BP8A 4RAZA 4U88A 3GLXA 2CYYA 3F23A 2H94A 2L4AA 1KU7A 5FFZA 1LDKB 1Z9CA 5E18F 2E7XA 3P9KA 5HDKA 1IZ1A 3R0JA 3RKWA 2UXXA 3ML6A 1SD4A 2GXBA 2J5OA 4HF2A 1O3QA 1FX7A 4YFKF 5D5XB 4G7ZF 2OA4A 4HDUA 4CXFA 3CUOA 4DNCA 2F2EA 2OBPA 3BY6A 1QPMA 2VOPA 5LLQA 2VONA 1FP1D 4RGXA 2EB7A 5LEJA 4Q48A 2VC0A 3HSFA 2A69F 1BJAA 3M9AA 1FPQA 4HQMA 2Y0MA 1IN6A 1RUNA 2FBIA 1G6NA 2YX4A 2PFBA 3KFWX 3TO9A 5LGUA 1SFEA 1MD0A 2IT0A 1LEBA 3DF8A 3FXQA 2V6CA 2XAHA 3TGNA 3O3KA 2HKOA 4RGSA 2KKOA 4ON0A 3IRQA 4M6YA 1LQ1A 3NRVA 2VXZA 2HYGD 4G6DA 4KDPA 3I59B 4CDGA 1K7AA 2XAFA 3LQRA 5TJJA 2XVCA 3ZMTA 2CQKA 2TDXA 1W4MA 3CO6C 2RN7A 1O7LA 3H3ZA 3BZ6A 2MH9A 1GHCA 3VODA 2HEOA 5LHIA 1JHFA 3N4MA 2XKPA 4EMSA 2COMA 2GAUA 3HRMA 1FBSA 2PMHA 5FLXK 4NB5A 1I27A 1OYWA 2EA4A 4UVBA 3E3VA 5H20A 1G3TA 5LEKA 3EQLF 2PLYA 4LJZF 3FMRA 5K1YA 3BJ6A 3QU3A 2VT2A 5DD4A 1S3JA 3DPTA 2OAZA 1Q1HA 1Z91A 4CHUA 4YIIA 2RDPA 2O6GE 4ENMA 3ABTA 4AIJA 4MTEA 3R61A 1U5TA 4BXUA 3F8CA 3KP5A 5H6RA 1HKQA 4O3MA 1BBYA 2ISZA 2AS5F 2R7DA 1MDMB 3LSTA 2MBFA 1DPRA 2CSOA 2HS5A 3P9IA 1JGSA 3J81K 3T8TA 2VBZA 1KYWA 2CGPA 3Q5FA 2UXNA 1F9NA 1ZRDA 2DFIA 3GXOA 2PJPA 2O0YA 1KGSA 3I53A 2BV6A 4KN4X 5KK1A 2L4MA 2QQAA 4M6XA 2D1VA 5CVUA 4A5NA 3HRSA 1TLHB 3KCCA 4HLXA 2DQRA 5FO5A 5K5OA 3BPXA 2LKPA 2ZMEA 3QP6A 2CO5A 2JZYA 2M30A 1IXSB 1YFHA 4IRHA 1W7PA 5E1XA 1I1GA 1XSDA 3QU6A 5K5RA 4PCQA 1G4DA 2H6CA 3KP3A 2A6EF 1G3YA 1TNSA 1TW2A 4G7HF 4G7OF 2IA1A 2QWWA 2VOOA 3SZTA 3K69A 5E1WA 4Q4ZF 3WTTC 3ROUA 5F1RA 4AIKA 4GCVA 2QBYB 3EYYA 4LLLA 1U5TC 4Q47A 5ERIA 2CG4A 1YIOA 1WSUA 1Z6TA 2P4WA 1P6RA 4YFNF 3OV8A 3F72A 4P55A 1B9NA 1B1BA 2BE5F 4A0ZA 1EH6A 2XAQA 4UVAA 4D0PA 4L9VA 4M9XA 4KNYA 1WI9A 4CYDA 2EA2A 3CLOA 3M7GA 2FF4A 1MGTA 1T2KA 4KIBA 1L3LA 2QENA 2OQRA 2DI3A 1IRGA 4EVIA 4HF0A 2F5FA 5ICCA 4G8XA 1HBXG 3B73A 4L0YB 4LGWA 4BNCA 2DU9A 1KU9A 3ZN0A 3F21A 1WRJA 1R22A 3T1BA 4KICA 3H92A 4EM2A 2STTA 3REOA 3B02A 2P5VA 3E5XA 5DCMA 2L3DA 3R60A 2EK5A 2K4JA 4DQ2A 3HYIA 5A2QK 2LSOA 4MNUA 5DUIA 5LGNA 3M8FA 3I59A 4I09A 4ZYDA 1T39A 1RIOH 5D4SA 3O2PE 2H09A 1ZGAA 1J0RA 5FLXZ 1K78A 2QLZA 3BROA 2QYOA 2V9VA 4P9UA 1OYIA 1R7JA 3MAJA 4BAYA 3DKWA 2IA2A 3FM3A 1UHMA 3MEXA 4I0BA 1UHWA 1DDNA 1ZAOA 2QVOA 4HOBA 4U0VA 4TV7A 2EFNA 4Q5SF 2HTJA 4N9IA 2IRFG 4RAYA 1YS6A 2RGVA 5D6FA 5LRRA 4PGHA 2PQ8A 2YU3A 3ELKA 1LEAA 2Z5UA 3ZP5A 2DO7A 4WXHA 5FGMA 2V1DA 1HQCA 5LHHA 1Z7UA 5CYVA 4EQQA 3J81Z 4PGGA 4LB6B 1ON1A 1DPUA 2K4BA 5IT3A 3IKTA 3KZZA 1G3WA 2DW4A 2X4HA 4HBLA 2ZFWA 4I2OA 3RPQA 1IUYA 3HTSB 1O57A 4HX7A 3HRTA 1B9MA 2WV0A 2JT1A 2EWNA 2DLLA 3QPTA 5K5QA 1E2XA 4EV0A 3JAMK 3DFGA 3F3XA 3CDHA 3C7JA 3WU1B 4I98B 1QBJA 2KIUA 4RB3C 3E97A 2X0LA 1XGNA 4EJVA 2XGXA 3MQ0A 3FX3A 1UCRA 3RJPA 2W57A 4IVNA 4A0YA 3DP7A 1TTYA 1MJAA 2HQRA 2FSWA 3RI4A 1S7OA 4UNOA 5DCFA 1PP8F 1U8RA 3V7RA 3WG9A 2OZ6A 1CF7A 4OMYA 3QP5A 2VBYA 5BOXA 3CJNA 5D5WB 5CJ9A 2JPCA 3KLOA 1FYMA 2QZ8A 4RB2C 2XROA 3V7SA 4HQEA 4OIPF 2M45A 5JR3A 2Y75A 1P92A 2IPQX 3WGHA 2GA2A 3L2CA 1KQ0A 1O3SA 5BS6A 5LHGA 2FBHA 1B6AA 3R6SA 4HAMA 1STZA 5JVTA 1AOYA 5D5VB 4Y15A 4F7ZA 2FNPA 1TQPA 5F64A 3I54A 3VOEA 2D2WA 3C1DA 3V7CA 5ILUA 1YG2A 2KRFA 5L3CA 2ZCWA 5LBQA 1TNTA 4OIQF 3AAFA 1XSXA 1E17A 3TQNA 3HIFA 4AD9A 1LDDA 2EV0A 4EM0B 1KU2A 2R3SA 2D1HA 4BH9A 3KLNA 3BJOA 2FOKA 2IP2A 4CZZA 3ZN1A 3IWZA 1D8JA 1OPCA 3KEQA 1EH7A 4EJUA 3KEOA 2V1UA 2OD5A 3DV8A 3HSRA 1ZLJA 3F8NA 4M9ZA 1KA8A 3MZYA 2JRTA 2MC3A 2DBBA 3RYRA 5DDGA 4HYEA 5AONA 1BIBA 5L3BA 2FEZA 3ZMZA 5L3GA 2FXAA 2ZBKA 1FBUA 2E1NA 4L5IA 3FM5A 5L3DA 2L02A 4H0EA 2HOEA 3K2ZA 5HS7A 1WKMA 1FT9A 4G6QA 2QQ9A 1XDSA 1YYVA 2XV4S 3VEPA 2NNNA 3KP6A 3JAMZ 4ZZLA 2NS0A 4KMFA 1JE8A 2K86A 4XBFA 3GYHX 3KP4A 5HS9A 1SMTA 2RV8A 5D4RA 4RB1A 1LJ9A 1YTYA 1AWCA 3R0AA 3ZMDA 3R4KA 3QAHA 2P7CB 3E5QA 5ICFA 1YW8A 4WK8F 3QOPA 1W5TA 1B59A 2HZTA 3ABUA 3HRUA 4ZH4F 2BBYA 3ECHA 2EFOA 2Q2EA 2ESHA 2VODA 3FMSA 3GO5A 2P5KA 3E6BA 2KIMA 2OZUA 1LDJA 4LD5A 2J5PA 2G9WA 3FMQA 3K0LA 4EJWA 3NQOA 2ZKZA 1XDUA 4ESBA 2NRAC 3N97A 5L3FA 4A12A 1U2WA 1J5YA 2HDCA 3P7NA 3G3ZA 2A61A 2XIGA 3WTWC 3BJAA 4MTDA 5ILVA 4EGYA 3LA3A 3GZ6A 4NQWA 3E5UA 1I1SA 2FMYA 3FWEA 2E7WA 1HW1A 1FYLA 3T5XA 4FX0A 4PDKA 2NAZA 3SZPA 4O5VA 1SD5A 2EV5A 3RTRA 2V79A 5CVIA 1W7PD 5AIQA 4B8XA 3F8FA 1XGSA 3WODF 1V4RA 1XB4A 4M9SA 5BPDA 1IRFA 5DV5A 5HVQC 2Z3YA 3HOTA 1XN7A 4FHTA 1GVJA 4R79A 4ZYHA 3CUQA 1ON2A 2DT5A 3TKYA 4EGZA 1J59A 4HLYA 2W85A 5ILSA 3SFZA 4CICA 1U78A 4P9FA 2VC1A 1OR7A 1JXSA 1SFUA 5EEGA 1SD6A 4XLNF 4XSXF 2B0LA 3TOBA 2EV6A 1J7KA 3GVAA 4ZYGA 3RPUA 5E17F 4IHTA 2DTRA 1BI0A 5LGTA 1HSJA 5AIPA 5JFRA 1XGOA 4S04A 3QRFF 2VN2A 1RNLA 1R5HA 3JSOA 5HOOA 5FD6A 3GX4X 2R7FA 2XUBA 3FXUA 4IJAA 4KYWA 1NHAA 3LA2A 3GZ5A 2LF7A 2DPUA 1Y0UA 4JK1X 1OKRA 1ZARA 3GFMA 3TOAA 4I0AA 3I58A 4CGZA 4HA8A 2XRNA 2W25A 2STWA 4HV5A 1J75A 5HLIA 5ED4A 2DK8A 4L18B 1S6LA 4HW0A 1ONVA 1EH8A 3K1MA 1YW7A 3Q9VA 2H27A 2K27A 3COAC 1S7AA 4UVCA 2P7VB 2H6BA 4A2UA 3V8JA 1BI1A 3L09A 3CUQC 1F1ZA 3F8BA 3JTGA 1D8KA 1TBXA 2V1XA 4HV6A 3K1PA 3PQKA 2QM3A 3GEZA 2QQBA 2MLKA 3HSEA 4EJOA 2EFPA 1O3RA 2XAGA 1MZBA 4BHCA 1FYKA 2A68F 1JHHA 3BDDA 4BYYA 1YW9A 4I01A 2PEXA 3ECOA 5HDGA 5H6QA 2JSCA 2A6HF 3U2RA 2UWMA 1T6SA 2O3FA 5L3EA 2IJLA 1R1UA 2CFXA 3JSPA 1VTNC 1R1TA 2XAJA 3I5UA 3FXRA 1EV7A 3WTXC 4IXAA 3LFKA 5CVVA 1TQIA 3HHHA 1I5ZA 1YLFA 2GIVA 1F5TA 1QGPA 4ASNA 1FC3A 4N0BA 3FZVA 1RI7A 2IW5A 4FX4A 5BMZA 2DPDA 1USSA 1DP7P 2ACJA 1H0MA 4MEYF 2BGCA 2HYFA 3I64A 1QNTA 3LQQA 1IN4A 1MDMA 4OMZA 3IRRA 2PMUA 3D5LA 2ZNZA 5BQTA 1BC7C 2A07F 1HW2A 3HUGA 4HX4A 5E20A 4HF1A 2FA5A 3WTZA 5LRSA 1ZGJA 3GUDA 1U3EM 1KQ9A 3TDUC 2NNYA 1OMIA 4EJTA 2M87A 4M71A 4CO8A 2IVMA 1FNNA 2UZKA 2M8EA 4ESJA 2M5WA 5J6XA 4KMUX 4KIFA 3ZMUA 2MD5A 1ZYRF 1IN5A 1R00A 5TRDA 4A5MA 5J8CA 1GXQA 1UB9A 1IW7F 5JI6A 4P96A 1I6XA 2QBYA 4FT8A 1A04A 3GFIA 4I7HA 1BIAA 1REPC 2L54A 3MCZA 1U5TB 2VBWA 3J80K 2VE9A 4HX8A 3OOPA 4EM1A 1LVAA 3GWZA 4XLPF 1ZRFA 1DUXC 2BYVE 4M73A 1T38A 3IWFA 3TO6A 2HFHA 1SFXA 3KE2A 1P4WA 4OOIA 5A2QZ 1QZZA 2PBIA 1XGMA 3JTHA 2ESNA 2ZMEB 4QLCU 1O3TA 5FB2A 2VE8A 5CVRA 3F6VA 4LLNA 1FBQA 3MWMA 2P6SA 1GXPA 3RKXA 1SMYF 4A6EA 1FY7A 1HSTA 3EYIA 3WE3A 4U0YA 3BWGA 4RB0A 4OIRF 4MQ9F 1ZRCA 2FMLA 1ZG3A 1K6OA 4ZYEA 1D3YA 4WCGA 3BPVA 4WXDA 4ESFA 1ZHFA 2P5LC 5E8IA 2ZXJA 1R58A 3V4GA 3DPLC 3WTVC 3ZQ7A 4O6JA 2IA0A 1ZH5A 4UV8A 2ELHA 3MZHA 4GO1A 2DAOA 4UHTA 1YO5C 1QZYA 3K9TA 1R23A 1SD7A 1J2XA 4RS8A 3C3WA 4AIHA 1ZG5A 4LK1F 1S8NA 2GQQA 1P4AA 1KU3A 1BI2A 4L9TA 4RGUA 2L01A 1FLIA 1D5VA 2XASA 3ULQB 3WU0A 1ZREA 4LMYA 4GXOA 3V8LA 4M74A 1ULYA 1FOKA 1L0OC 5FD5A 4R8HA 3EDPA 1HKSA 3WGIA 5DCMB 3GFLA 5DD8A 1ZN2A 2GXGA 1FSEA 1WWXA 2E1CA 4RGRA 4IF4A 3RYPA 3FHZA 2DQLA 1V3FA 4GYIA 4ETSA 1K78B 1P2FA 2ZJ2A 2YX7A 4QWQA 2KJCA 1S29A 2MH2A 4WWCA 1F4KA 3RDIA 1IN8A 2WC2A 3KP7A 4Z2YA 1YS7A 1UFMA 5HLGA 3U9GA 1BN5A 2LNBA 2RNJA 3IKVA 4LFUA 3I0TA 3MFKA 3IL2A 1IXRC 1U6GA 1PDNC 3GFJA 3E6DA 1MJ9A 3J80Z 1MJBA 3GW2A 2Z9OA 1IAWA 2F5DA 4IHSA 4BQAA 2QUFA 3P9CA 5DEQA 3EUHA 3K1NA 3EETA 2PG4A 1P4XA 4A0XA 3ZPLA 2F5EA 4Y17A 3GF2A 3PFIA 4BHPA 3S2WA 3F6OA 4GYGA 3PQJA 2C6YA 2PN6A 4U7BA 4HZFA 2P6TA 1PUEE 5FFXA 2A3SA 4MHGA 1QQIA 2FU4A 3M8EA 3WTSC 3W6KB 2EFWA 5HS8A 1Z1DA 2XKOA 5HLHA 3F8MA 3V8KA 2M1BA 4KN7X 2RQPA 2MA3A 1X3UA 1FWZA 1XCVA 1QO0D 2RC4A 4LLGF 4R1HA 2G7HA 4LG0B 1J9IA 2WWYA 2OQGA 2VBXA 2KIFA 1W5SA 2BEOA 4A6DA 3J7AO 4LK0F 3E6MA 4IPAA 1TW3A 3Q9SA 4WX9A 5BPIA 2O61A 1CF7B 1BM9A 4U7DA 1FZPB 5CLSA 5IT9K 2CWEA 3LAPA 3WGGA 3SXYA 3JW4A 6PAXA 3WE2A 2K7LA 1R36A 3I4PA 1IXCA 4Y13A 1H9TA 4B09A 2XHKA 3BOQA 3WTYC 4MQVA 1ZLKA 1XSVA 4L5JA 2G7UA 4M72A 2FE3A 2D45A 1RUOA 3TO7A 1K79A 4G9YA 2WTEA 4AVPA 4ENNA 4YIFA 4L0ZB 3ISPA 3HOSA 2Y48A 4WF2A 2YPRA 1XMKA 2HGCA 1KYZA 2RKHA 3I71A 2KJBA 4MEXF 1O7FA 3TDZC 3SHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1Z B;  5EEH A;  2EJR A;  3LAJ A;  1FP2 A;  1XCB A;  1XD7 A;  1KQ8 A;  1LB2 A;  4ENJ A;  1RZ4 A;  3HHG A;  3RIR A;  2O03 A;  4ENK A;  3H3U A;  1HW5 A;  2RVC A;  2W24 A;  1ODD A;  1SAX A;  5J8F A;  4GGG A;  2HQN A;  1Z6R A;  3KP2 A;  4UV9 A;  3NEU A;  4KT5 C;  3ZMV A;  2YR2 A;  5DUK A;  2K02 A;  3L9F A;  1R1V A;  5DYM A;  3VB2 A;  3G73 A;  2W84 A;  4YFX F;  4PZJ A;  3CTA A;  4ZZD A;  3E6C C;  4XRF A;  2Z33 A;  3HTU A;  2ZO4 A;  1BOA A;  5D8L B;  5CVJ A;  4P5O A;  1OYY A;  2NYX A;  2Q8K A;  1T98 A;  1WQ2 A;  4KUM A;  2ISY A;  4XSZ F;  2HKX A;  3U1D A;  4G94 A;  2JTV A;  1CGP A;  4U0W A;  2A5Y B;  3W6J B;  3IC7 A;  3IHU A;  4OIO F;  2FNA A;  4IRG A;  2P8T A;  4IRI A;  2AXL A;  1ZG1 A;  2VT3 A;  1BC8 C;  3FF5 A;  4BHB A;  2EFQ A;  4N9H A;  3C18 A;  3LA7 A;  1UST A;  5D8K B;  4KA4 A;  3T8R A;  2CW0 F;  3ERE D;  1G3S A;  3RKY A;  5ICG A;  3QPH A;  2GA1 A;  4HDV A;  1H9G A;  4UXN A;  4LG0 A;  3L7W A;  1HKT A;  2YSR A;  4OU0 A;  1T0F A;  3D0S A;  1MKM A;  3DQV C;  5D6E A;  2LF8 A;  3M1E A;  2ETH A;  4E70 A;  1HXD A;  1B4A A;  4LB5 A;  2F5C A;  3KZY A;  1IF1 A;  2HR3 A;  5IT9 Z;  4KIG A;  2PI0 A;  2GZW A;  2O8X A;  2ZNY A;  3O6B B;  5KVR A;  4MGR A;  2ADU A;  2HWV A;  4JBA A;  1FSH A;  4I02 A;  4UUV A;  3F22 A;  2HTS A;  3DEU A;  1PP7 U;  2OU2 A;  1IN7 A;  1TQM A;  1Z05 A;  3WTU C;  2Z99 A;  4L9N A;  5JHU A;  5D5U B;  1LNW A;  4NHJ A;  3ZMS A;  2GWR A;  1YQA A;  1BI3 A;  4WXC A;  4KFC A;  3LWF A;  5E8G A;  1R5G A;  4K2E A;  5ICE A;  3T0Y A;  4AWX B;  1C0W A;  2MLG A;  2FRH A;  2LDU A;  3KET A;  3VFZ A;  4OIN F;  4L9J A;  5HDN A;  5F6F A;  4S05 A;  2Q0O A;  1XMA A;  3SQN A;  4YG2 F;  2FQ3 A;  3L00 A;  4JQF A;  2FBK A;  1W7P B;  3CO7 C;  2JPB A;  3CUQ B;  3DXJ F;  2DK5 A;  3BP8 A;  4RAZ A;  4U88 A;  3GLX A;  2CYY A;  3F23 A;  2H94 A;  2L4A A;  1KU7 A;  5FFZ A;  1LDK B;  1Z9C A;  5E18 F;  2E7X A;  3P9K A;  5HDK A;  1IZ1 A;  3R0J A;  3RKW A;  2UXX A;  3ML6 A;  1SD4 A;  2GXB A;  2J5O A;  4HF2 A;  1O3Q A;  1FX7 A;  4YFK F;  5D5X B;  4G7Z F;  2OA4 A;  4HDU A;  4CXF A;  3CUO A;  4DNC A;  2F2E A;  2OBP A;  3BY6 A;  1QPM A;  2VOP A;  5LLQ A;  2VON A;  1FP1 D;  4RGX A;  2EB7 A;  5LEJ A;  4Q48 A;  2VC0 A;  3HSF A;  2A69 F;  1BJA A;  3M9A A;  1FPQ A;  4HQM A;  2Y0M A;  1IN6 A;  1RUN A;  2FBI A;  1G6N A;  2YX4 A;  2PFB A;  3KFW X;  3TO9 A;  5LGU A;  1SFE A;  1MD0 A;  2IT0 A;  1LEB A;  3DF8 A;  3FXQ A;  2V6C A;  2XAH A;  3TGN A;  3O3K A;  2HKO A;  4RGS A;  2KKO A;  4ON0 A;  3IRQ A;  4M6Y A;  1LQ1 A;  3NRV A;  2VXZ A;  2HYG D;  4G6D A;  4KDP A;  3I59 B;  4CDG A;  1K7A A;  2XAF A;  3LQR A;  5TJJ A;  2XVC A;  3ZMT A;  2CQK A;  2TDX A;  1W4M A;  3CO6 C;  2RN7 A;  1O7L A;  3H3Z A;  3BZ6 A;  2MH9 A;  1GHC A;  3VOD A;  2HEO A;  5LHI A;  1JHF A;  3N4M A;  2XKP A;  4EMS A;  2COM A;  2GAU A;  3HRM A;  1FBS A;  2PMH A;  5FLX K;  4NB5 A;  1I27 A;  1OYW A;  2EA4 A;  4UVB A;  3E3V A;  5H20 A;  1G3T A;  5LEK A;  3EQL F;  2PLY A;  4LJZ F;  3FMR A;  5K1Y A;  3BJ6 A;  3QU3 A;  2VT2 A;  5DD4 A;  1S3J A;  3DPT A;  2OAZ A;  1Q1H A;  1Z91 A;  4CHU A;  4YII A;  2RDP A;  2O6G E;  4ENM A;  3ABT A;  4AIJ A;  4MTE A;  3R61 A;  1U5T A;  4BXU A;  3F8C A;  3KP5 A;  5H6R A;  1HKQ A;  4O3M A;  1BBY A;  2ISZ A;  2AS5 F;  2R7D A;  1MDM B;  3LST A;  2MBF A;  1DPR A;  2CSO A;  2HS5 A;  3P9I A;  1JGS A;  3J81 K;  3T8T A;  2VBZ A;  1KYW A;  2CGP A;  3Q5F A;  2UXN A;  1F9N A;  1ZRD A;  2DFI A;  3GXO A;  2PJP A;  2O0Y A;  1KGS A;  3I53 A;  2BV6 A;  4KN4 X;  5KK1 A;  2L4M A;  2QQA A;  4M6X A;  2D1V A;  5CVU A;  4A5N A;  3HRS A;  1TLH B;  3KCC A;  4HLX A;  2DQR A;  5FO5 A;  5K5O A;  3BPX A;  2LKP A;  2ZME A;  3QP6 A;  2CO5 A;  2JZY A;  2M30 A;  1IXS B;  1YFH A;  4IRH A;  1W7P A;  5E1X A;  1I1G A;  1XSD A;  3QU6 A;  5K5R A;  4PCQ A;  1G4D A;  2H6C A;  3KP3 A;  2A6E F;  1G3Y A;  1TNS A;  1TW2 A;  4G7H F;  4G7O F;  2IA1 A;  2QWW A;  2VOO A;  3SZT A;  3K69 A;  5E1W A;  4Q4Z F;  3WTT C;  3ROU A;  5F1R A;  4AIK A;  4GCV A;  2QBY B;  3EYY A;  4LLL A;  1U5T C;  4Q47 A;  5ERI A;  2CG4 A;  1YIO A;  1WSU A;  1Z6T A;  2P4W A;  1P6R A;  4YFN F;  3OV8 A;  3F72 A;  4P55 A;  1B9N A;  1B1B A;  2BE5 F;  4A0Z A;  1EH6 A;  2XAQ A;  4UVA A;  4D0P A;  4L9V A;  4M9X A;  4KNY A;  1WI9 A;  4CYD A;  2EA2 A;  3CLO A;  3M7G A;  2FF4 A;  1MGT A;  1T2K A;  4KIB A;  1L3L A;  2QEN A;  2OQR A;  2DI3 A;  1IRG A;  4EVI A;  4HF0 A;  2F5F A;  5ICC A;  4G8X A;  1HBX G;  3B73 A;  4L0Y B;  4LGW A;  4BNC A;  2DU9 A;  1KU9 A;  3ZN0 A;  3F21 A;  1WRJ A;  1R22 A;  3T1B A;  4KIC A;  3H92 A;  4EM2 A;  2STT A;  3REO A;  3B02 A;  2P5V A;  3E5X A;  5DCM A;  2L3D A;  3R60 A;  2EK5 A;  2K4J A;  4DQ2 A;  3HYI A;  5A2Q K;  2LSO A;  4MNU A;  5DUI A;  5LGN A;  3M8F A;  3I59 A;  4I09 A;  4ZYD A;  1T39 A;  1RIO H;  5D4S A;  3O2P E;  2H09 A;  1ZGA A;  1J0R A;  5FLX Z;  1K78 A;  2QLZ A;  3BRO A;  2QYO A;  2V9V A;  4P9U A;  1OYI A;  1R7J A;  3MAJ A;  4BAY A;  3DKW A;  2IA2 A;  3FM3 A;  1UHM A;  3MEX A;  4I0B A;  1UHW A;  1DDN A;  1ZAO A;  2QVO A;  4HOB A;  4U0V A;  4TV7 A;  2EFN A;  4Q5S F;  2HTJ A;  4N9I A;  2IRF G;  4RAY A;  1YS6 A;  2RGV A;  5D6F A;  5LRR A;  4PGH A;  2PQ8 A;  2YU3 A;  3ELK A;  1LEA A;  2Z5U A;  3ZP5 A;  2DO7 A;  4WXH A;  5FGM A;  2V1D A;  1HQC A;  5LHH A;  1Z7U A;  5CYV A;  4EQQ A;  3J81 Z;  4PGG A;  4LB6 B;  1ON1 A;  1DPU A;  2K4B A;  5IT3 A;  3IKT A;  3KZZ A;  1G3W A;  2DW4 A;  2X4H A;  4HBL A;  2ZFW A;  4I2O A;  3RPQ A;  1IUY A;  3HTS B;  1O57 A;  4HX7 A;  3HRT A;  1B9M A;  2WV0 A;  2JT1 A;  2EWN A;  2DLL A;  3QPT A;  5K5Q A;  1E2X A;  4EV0 A;  3JAM K;  3DFG A;  3F3X A;  3CDH A;  3C7J A;  3WU1 B;  4I98 B;  1QBJ A;  2KIU A;  4RB3 C;  3E97 A;  2X0L A;  1XGN A;  4EJV A;  2XGX A;  3MQ0 A;  3FX3 A;  1UCR A;  3RJP A;  2W57 A;  4IVN A;  4A0Y A;  3DP7 A;  1TTY A;  1MJA A;  2HQR A;  2FSW A;  3RI4 A;  1S7O A;  4UNO A;  5DCF A;  1PP8 F;  1U8R A;  3V7R A;  3WG9 A;  2OZ6 A;  1CF7 A;  4OMY A;  3QP5 A;  2VBY A;  5BOX A;  3CJN A;  5D5W B;  5CJ9 A;  2JPC A;  3KLO A;  1FYM A;  2QZ8 A;  4RB2 C;  2XRO A;  3V7S A;  4HQE A;  4OIP F;  2M45 A;  5JR3 A;  2Y75 A;  1P92 A;  2IPQ X;  3WGH A;  2GA2 A;  3L2C A;  1KQ0 A;  1O3S A;  5BS6 A;  5LHG A;  2FBH A;  1B6A A;  3R6S A;  4HAM A;  1STZ A;  5JVT A;  1AOY A;  5D5V B;  4Y15 A;  4F7Z A;  2FNP A;  1TQP A;  5F64 A;  3I54 A;  3VOE A;  2D2W A;  3C1D A;  3V7C A;  5ILU A;  1YG2 A;  2KRF A;  5L3C A;  2ZCW A;  5LBQ A;  1TNT A;  4OIQ F;  3AAF A;  1XSX A;  1E17 A;  3TQN A;  3HIF A;  4AD9 A;  1LDD A;  2EV0 A;  4EM0 B;  1KU2 A;  2R3S A;  2D1H A;  4BH9 A;  3KLN A;  3BJO A;  2FOK A;  2IP2 A;  4CZZ A;  3ZN1 A;  3IWZ A;  1D8J A;  1OPC A;  3KEQ A;  1EH7 A;  4EJU A;  3KEO A;  2V1U A;  2OD5 A;  3DV8 A;  3HSR A;  1ZLJ A;  3F8N A;  4M9Z A;  1KA8 A;  3MZY A;  2JRT A;  2MC3 A;  2DBB A;  3RYR A;  5DDG A;  4HYE A;  5AON A;  1BIB A;  5L3B A;  2FEZ A;  3ZMZ A;  5L3G A;  2FXA A;  2ZBK A;  1FBU A;  2E1N A;  4L5I A;  3FM5 A;  5L3D A;  2L02 A;  4H0E A;  2HOE A;  3K2Z A;  5HS7 A;  1WKM A;  1FT9 A;  4G6Q A;  2QQ9 A;  1XDS A;  1YYV A;  2XV4 S;  3VEP A;  2NNN A;  3KP6 A;  3JAM Z;  4ZZL A;  2NS0 A;  4KMF A;  1JE8 A;  2K86 A;  4XBF A;  3GYH X;  3KP4 A;  5HS9 A;  1SMT A;  2RV8 A;  5D4R A;  4RB1 A;  1LJ9 A;  1YTY A;  1AWC A;  3R0A A;  3ZMD A;  3R4K A;  3QAH A;  2P7C B;  3E5Q A;  5ICF A;  1YW8 A;  4WK8 F;  3QOP A;  1W5T A;  1B59 A;  2HZT A;  3ABU A;  3HRU A;  4ZH4 F;  2BBY A;  3ECH A;  2EFO A;  2Q2E A;  2ESH A;  2VOD A;  3FMS A;  3GO5 A;  2P5K A;  3E6B A;  2KIM A;  2OZU A;  1LDJ A;  4LD5 A;  2J5P A;  2G9W A;  3FMQ A;  3K0L A;  4EJW A;  3NQO A;  2ZKZ A;  1XDU A;  4ESB A;  2NRA C;  3N97 A;  5L3F A;  4A12 A;  1U2W A;  1J5Y A;  2HDC A;  3P7N A;  3G3Z A;  2A61 A;  2XIG A;  3WTW C;  3BJA A;  4MTD A;  5ILV A;  4EGY A;  3LA3 A;  3GZ6 A;  4NQW A;  3E5U A;  1I1S A;  2FMY A;  3FWE A;  2E7W A;  1HW1 A;  1FYL A;  3T5X A;  4FX0 A;  4PDK A;  2NAZ A;  3SZP A;  4O5V A;  1SD5 A;  2EV5 A;  3RTR A;  2V79 A;  5CVI A;  1W7P D;  5AIQ A;  4B8X A;  3F8F A;  1XGS A;  3WOD F;  1V4R A;  1XB4 A;  4M9S A;  5BPD A;  1IRF A;  5DV5 A;  5HVQ C;  2Z3Y A;  3HOT A;  1XN7 A;  4FHT A;  1GVJ A;  4R79 A;  4ZYH A;  3CUQ A;  1ON2 A;  2DT5 A;  3TKY A;  4EGZ A;  1J59 A;  4HLY A;  2W85 A;  5ILS A;  3SFZ A;  4CIC A;  1U78 A;  4P9F A;  2VC1 A;  1OR7 A;  1JXS A;  1SFU A;  5EEG A;  1SD6 A;  4XLN F;  4XSX F;  2B0L A;  3TOB A;  2EV6 A;  1J7K A;  3GVA A;  4ZYG A;  3RPU A;  5E17 F;  4IHT A;  2DTR A;  1BI0 A;  5LGT A;  1HSJ A;  5AIP A;  5JFR A;  1XGO A;  4S04 A;  3QRF F;  2VN2 A;  1RNL A;  1R5H A;  3JSO A;  5HOO A;  5FD6 A;  3GX4 X;  2R7F A;  2XUB A;  3FXU A;  4IJA A;  4KYW A;  1NHA A;  3LA2 A;  3GZ5 A;  2LF7 A;  2DPU A;  1Y0U A;  4JK1 X;  1OKR A;  1ZAR A;  3GFM A;  3TOA A;  4I0A A;  3I58 A;  4CGZ A;  4HA8 A;  2XRN A;  2W25 A;  2STW A;  4HV5 A;  1J75 A;  5HLI A;  5ED4 A;  2DK8 A;  4L18 B;  1S6L A;  4HW0 A;  1ONV A;  1EH8 A;  3K1M A;  1YW7 A;  3Q9V A;  2H27 A;  2K27 A;  3COA C;  1S7A A;  4UVC A;  2P7V B;  2H6B A;  4A2U A;  3V8J A;  1BI1 A;  3L09 A;  3CUQ C;  1F1Z A;  3F8B A;  3JTG A;  1D8K A;  1TBX A;  2V1X A;  4HV6 A;  3K1P A;  3PQK A;  2QM3 A;  3GEZ A;  2QQB A;  2MLK A;  3HSE A;  4EJO A;  2EFP A;  1O3R A;  2XAG A;  1MZB A;  4BHC A;  1FYK A;  2A68 F;  1JHH A;  3BDD A;  4BYY A;  1YW9 A;  4I01 A;  2PEX A;  3ECO A;  5HDG A;  5H6Q A;  2JSC A;  2A6H F;  3U2R A;  2UWM A;  1T6S A;  2O3F A;  5L3E A;  2IJL A;  1R1U A;  2CFX A;  3JSP A;  1VTN C;  1R1T A;  2XAJ A;  3I5U A;  3FXR A;  1EV7 A;  3WTX C;  4IXA A;  3LFK A;  5CVV A;  1TQI A;  3HHH A;  1I5Z A;  1YLF A;  2GIV A;  1F5T A;  1QGP A;  4ASN A;  1FC3 A;  4N0B A;  3FZV A;  1RI7 A;  2IW5 A;  4FX4 A;  5BMZ A;  2DPD A;  1USS A;  1DP7 P;  2ACJ A;  1H0M A;  4MEY F;  2BGC A;  2HYF A;  3I64 A;  1QNT A;  3LQQ A;  1IN4 A;  1MDM A;  4OMZ A;  3IRR A;  2PMU A;  3D5L A;  2ZNZ A;  5BQT A;  1BC7 C;  2A07 F;  1HW2 A;  3HUG A;  4HX4 A;  5E20 A;  4HF1 A;  2FA5 A;  3WTZ A;  5LRS A;  1ZGJ A;  3GUD A;  1U3E M;  1KQ9 A;  3TDU C;  2NNY A;  1OMI A;  4EJT A;  2M87 A;  4M71 A;  4CO8 A;  2IVM A;  1FNN A;  2UZK A;  2M8E A;  4ESJ A;  2M5W A;  5J6X A;  4KMU X;  4KIF A;  3ZMU A;  2MD5 A;  1ZYR F;  1IN5 A;  1R00 A;  5TRD A;  4A5M A;  5J8C A;  1GXQ A;  1UB9 A;  1IW7 F;  5JI6 A;  4P96 A;  1I6X A;  2QBY A;  4FT8 A;  1A04 A;  3GFI A;  4I7H A;  1BIA A;  1REP C;  2L54 A;  3MCZ A;  1U5T B;  2VBW A;  3J80 K;  2VE9 A;  4HX8 A;  3OOP A;  4EM1 A;  1LVA A;  3GWZ A;  4XLP F;  1ZRF A;  1DUX C;  2BYV E;  4M73 A;  1T38 A;  3IWF A;  3TO6 A;  2HFH A;  1SFX A;  3KE2 A;  1P4W A;  4OOI A;  5A2Q Z;  1QZZ A;  2PBI A;  1XGM A;  3JTH A;  2ESN A;  2ZME B;  4QLC U;  1O3T A;  5FB2 A;  2VE8 A;  5CVR A;  3F6V A;  4LLN A;  1FBQ A;  3MWM A;  2P6S A;  1GXP A;  3RKX A;  1SMY F;  4A6E A;  1FY7 A;  1HST A;  3EYI A;  3WE3 A;  4U0Y A;  3BWG A;  4RB0 A;  4OIR F;  4MQ9 F;  1ZRC A;  2FML A;  1ZG3 A;  1K6O A;  4ZYE A;  1D3Y A;  4WCG A;  3BPV A;  4WXD A;  4ESF A;  1ZHF A;  2P5L C;  5E8I A;  2ZXJ A;  1R58 A;  3V4G A;  3DPL C;  3WTV C;  3ZQ7 A;  4O6J A;  2IA0 A;  1ZH5 A;  4UV8 A;  2ELH A;  3MZH A;  4GO1 A;  2DAO A;  4UHT A;  1YO5 C;  1QZY A;  3K9T A;  1R23 A;  1SD7 A;  1J2X A;  4RS8 A;  3C3W A;  4AIH A;  1ZG5 A;  4LK1 F;  1S8N A;  2GQQ A;  1P4A A;  1KU3 A;  1BI2 A;  4L9T A;  4RGU A;  2L01 A;  1FLI A;  1D5V A;  2XAS A;  3ULQ B;  3WU0 A;  1ZRE A;  4LMY A;  4GXO A;  3V8L A;  4M74 A;  1ULY A;  1FOK A;  1L0O C;  5FD5 A;  4R8H A;  3EDP A;  1HKS A;  3WGI A;  5DCM B;  3GFL A;  5DD8 A;  1ZN2 A;  2GXG A;  1FSE A;  1WWX A;  2E1C A;  4RGR A;  4IF4 A;  3RYP A;  3FHZ A;  2DQL A;  1V3F A;  4GYI A;  4ETS A;  1K78 B;  1P2F A;  2ZJ2 A;  2YX7 A;  4QWQ A;  2KJC A;  1S29 A;  2MH2 A;  4WWC A;  1F4K A;  3RDI A;  1IN8 A;  2WC2 A;  3KP7 A;  4Z2Y A;  1YS7 A;  1UFM A;  5HLG A;  3U9G A;  1BN5 A;  2LNB A;  2RNJ A;  3IKV A;  4LFU A;  3I0T A;  3MFK A;  3IL2 A;  1IXR C;  1U6G A;  1PDN C;  3GFJ A;  3E6D A;  1MJ9 A;  3J80 Z;  1MJB A;  3GW2 A;  2Z9O A;  1IAW A;  2F5D A;  4IHS A;  4BQA A;  2QUF A;  3P9C A;  5DEQ A;  3EUH A;  3K1N A;  3EET A;  2PG4 A;  1P4X A;  4A0X A;  3ZPL A;  2F5E A;  4Y17 A;  3GF2 A;  3PFI A;  4BHP A;  3S2W A;  3F6O A;  4GYG A;  3PQJ A;  2C6Y A;  2PN6 A;  4U7B A;  4HZF A;  2P6T A;  1PUE E;  5FFX A;  2A3S A;  4MHG A;  1QQI A;  2FU4 A;  3M8E A;  3WTS C;  3W6K B;  2EFW A;  5HS8 A;  1Z1D A;  2XKO A;  5HLH A;  3F8M A;  3V8K A;  2M1B A;  4KN7 X;  2RQP A;  2MA3 A;  1X3U A;  1FWZ A;  1XCV A;  1QO0 D;  2RC4 A;  4LLG F;  4R1H A;  2G7H A;  4LG0 B;  1J9I A;  2WWY A;  2OQG A;  2VBX A;  2KIF A;  1W5S A;  2BEO A;  4A6D A;  3J7A O;  4LK0 F;  3E6M A;  4IPA A;  1TW3 A;  3Q9S A;  4WX9 A;  5BPI A;  2O61 A;  1CF7 B;  1BM9 A;  4U7D A;  1FZP B;  5CLS A;  5IT9 K;  2CWE A;  3LAP A;  3WGG A;  3SXY A;  3JW4 A;  6PAX A;  3WE2 A;  2K7L A;  1R36 A;  3I4P A;  1IXC A;  4Y13 A;  1H9T A;  4B09 A;  2XHK A;  3BOQ A;  3WTY C;  4MQV A;  1ZLK A;  1XSV A;  4L5J A;  2G7U A;  4M72 A;  2FE3 A;  2D45 A;  1RUO A;  3TO7 A;  1K79 A;  4G9Y A;  2WTE A;  4AVP A;  4ENN A;  4YIF A;  4L0Z B;  3ISP A;  3HOS A;  2Y48 A;  4WF2 A;  2YPR A;  1XMK A;  2HGC A;  1KYZ A;  2RKH A;  3I71 A;  2KJB A;  4MEX F;  1O7F A;  3TDZ C;  3SHF A; 
#chains in the Genus database with same CATH topology
 5E1Z B;  1SVO A;  4BE1 A;  4IOC F;  3WG7 H;  5EEH A;  3W2V A;  2LP0 A;  2R7U A;  4AVZ A;  2EJR A;  3MKW B;  1S7E A;  3EUA A;  3LAJ A;  1MMS A;  3RQI A;  1FP2 A;  1XCB A;  3X2Q H;  1XD7 A;  4A69 C;  3FKJ A;  2VQH A;  1KQ8 A;  2K85 A;  3QYF A;  1LB2 A;  4ENJ A;  1RZ4 A;  3HHG A;  3RIR A;  2O03 A;  4ENK A;  3H3U A;  1HW5 A;  3A02 A;  4BEH B;  2RVC A;  5GPC A;  3H3V K;  2WAF A;  3RZD J;  2W24 A;  4BL0 B;  1ODD A;  4F92 B;  1SAX A;  3OYM A;  3G1M A;  3I9V 2;  5J8F A;  3HOW J;  1DGW Y;  3KYD B;  4GGG A;  2HQN A;  1Z6R A;  2KQR A;  2L9S A;  4D5F A;  3KP2 A;  3RZO J;  4UV9 A;  3NEU A;  4KT5 C;  2Z2S B;  3ZMV A;  1TWA J;  2YR2 A;  5DUK A;  2K02 A;  3L9F A;  1R1V A;  5DYM A;  3VB2 A;  3G73 A;  3HXL A;  4A3E J;  2W84 A;  4PSW A;  4YFX F;  1B72 B;  4PZJ A;  3K4K A;  3V42 A;  3CTA A;  4ZZD A;  3E6C C;  4XRF A;  2Z33 A;  3HTU A;  1T08 B;  2ZO4 A;  3BG5 A;  3KZI C;  1BOA A;  5D8L B;  2MSY A;  5DM7 F;  5CVJ A;  4P5O A;  1VFC A;  4OAZ A;  1OYY A;  2NYX A;  2Q8K A;  1PUF A;  1T98 A;  1WQ2 A;  2QF7 A;  3S1N J;  4PSX A;  2CQN A;  2A6T A;  1APL C;  2XPW A;  4KUM A;  2ISY A;  4XSZ F;  2HKX A;  3U1D A;  1JKR C;  2LK2 A;  2HVS A;  1R5I D;  4W1U A;  4G94 A;  3ZXS A;  2JTV A;  3BG3 A;  1CGP A;  4U0W A;  2A5Y B;  3W6J B;  3BTI A;  3IC7 A;  4YEJ A;  4H4K C;  4BBR J;  1X2N A;  3LSR A;  4BQO A;  3IHU A;  2LTP A;  4OIO F;  2HOA A;  2FNA A;  4IRG A;  2P8T A;  2X6Y A;  2EH3 A;  4IRI A;  4RAF A;  2AXL A;  1ZG1 A;  2VT3 A;  2DJN A;  1BC8 C;  5B1B H;  3FF5 A;  4BHB A;  1VQN I;  1OCC H;  4W97 A;  2EFQ A;  4N9H A;  4DYR A;  2W00 A;  3C18 A;  2L0K A;  4YIR X;  3OWT A;  3FHN A;  2NVT J;  3H36 A;  3LA7 A;  1UST A;  3CCL I;  3LSH A;  2CQX A;  5D8K B;  3JCU C;  1K83 J;  3T8R A;  4KA4 A;  2CW0 F;  3OS1 A;  3OSF A;  3ERE D;  1G3S A;  3RKY A;  5ICG A;  3QPH A;  2GA1 A;  4HDV A;  1H9G A;  4UXN A;  4LG0 A;  3L7W A;  3E0J B;  1HKT A;  1A6Q A;  2YSR A;  4OU0 A;  1T0F A;  3D0S A;  1MKM A;  2Y2Z A;  3DQV C;  5D6E A;  3PNT A;  1BOB A;  4BBS J;  2LF8 A;  3M1E A;  2ETH A;  4E70 A;  1HXD A;  1B4A A;  4LB5 A;  2F5C A;  2Q2E B;  4UUS A;  2NOG A;  2ZFU A;  2XSJ C;  1Z77 A;  3VYT B;  3L2R A;  1VQO I;  3KZY A;  3CES A;  5IY5 H;  4BXF A;  1IF1 A;  1UJ8 A;  2X85 A;  2HR3 A;  1YI2 I;  2E1M C;  5IT9 Z;  4KIG A;  2PI0 A;  2IGK A;  2GZW A;  2O8X A;  2R92 J;  2ZNY A;  1MBH A;  1IUF A;  3O6B B;  5KVR A;  4MGR A;  2ADU A;  2HWV A;  4JBA A;  1FSH A;  1LKX A;  1YE9 A;  4I02 A;  4UUV A;  3F22 A;  2HTS A;  3DEU A;  1PP7 U;  2OU2 A;  1IN7 A;  2ECB A;  2W48 A;  1TQM A;  3C2G A;  1Z05 A;  4D9J A;  3DU6 A;  3WTU C;  2Z99 A;  2W7N A;  4L9N A;  5JHU A;  5D5U B;  3GME A;  2BXY A;  1LNW A;  2DA1 A;  4NHJ A;  3WHC A;  3ZMS A;  2NVY J;  2GWR A;  3S2H J;  2KDZ A;  4CCO A;  4Y3O A;  2JK3 A;  2M4K A;  2OTL I;  1YQA A;  1BI3 A;  1DQU A;  4NQW B;  2DOA A;  2RNG A;  2ZSI B;  4QPO A;  4WXC A;  4S0H B;  2DCE A;  3K4N A;  2VQG A;  4KFC A;  3LWF A;  1MBF A;  2JWT A;  3QWL A;  5E8G A;  1R5G A;  4K2E A;  5F04 A;  1OJL A;  5ICE A;  3T0Y A;  4BDY A;  1SFK A;  4AWX B;  3OYL A;  2CQ7 A;  1C0W A;  2MLG A;  1XTA A;  2LC2 A;  5IOZ A;  3ZQL A;  2FRH A;  2LDU A;  4NDL A;  3KET A;  4FE4 A;  3VFZ A;  2LRE A;  4PJJ A;  4RLF A;  1W0T A;  4KIT B;  4OIN F;  4L9J A;  5HDN A;  5F6F A;  4S05 A;  4E7H A;  2Q0O A;  1XMA A;  3HC7 A;  2K9Q A;  4OAY A;  3SQN A;  1Y39 A;  4YG2 F;  2FQ3 A;  3BQZ A;  3L00 A;  2KZG A;  4JQF A;  2FBK A;  1W7P B;  3A4C A;  3CO7 C;  2JPB A;  1T0F C;  2MFZ A;  4IQ4 A;  3CUQ B;  3DXJ F;  2DK5 A;  3BP8 A;  4RAZ A;  2UV1 A;  5CKT A;  1VQ5 I;  4U88 A;  3GLX A;  2CYY A;  3LL7 A;  3F23 A;  2H94 A;  2L4A A;  1KU7 A;  5FFZ A;  1LDK B;  1Z9C A;  2L9N A;  3D1N I;  5E18 F;  4IZZ A;  1GV5 A;  2PJR A;  2E7X A;  2LFB A;  3BG6 A;  3P9K A;  4C2U A;  5HDK A;  1IZ1 A;  3R0J A;  1Z3Y A;  2BW3 A;  3RKW A;  2UXX A;  3ML6 A;  1SD4 A;  2GXB A;  2J5O A;  4HF2 A;  1O3Q A;  5IYB J;  5KNL A;  1FX7 A;  4YFK F;  1A31 A;  5D5X B;  2CV2 A;  1YRN B;  1X58 A;  1WH7 A;  2JMW A;  1AU7 A;  4G7Z F;  2OV7 A;  3LSP A;  2VLA A;  2OA4 A;  4HDU A;  2WV1 A;  3AFH A;  1YIT I;  3ZQH A;  4CXF A;  3CUO A;  2M9H A;  2VJ5 A;  4X0G A;  2DA6 A;  4BAC A;  3S2D J;  4DNC A;  1MMG A;  2F2E A;  4CCL A;  3FXO A;  5J1U A;  2OBP A;  3SEZ A;  1FMV A;  3BY6 A;  3DWL E;  1QPM A;  2Z16 A;  3CF5 F;  2VPL A;  2VKH A;  2VOP A;  5LLQ A;  1VQ8 I;  3PJR A;  2VON A;  1ZTR A;  4PK4 A;  1FP1 D;  1QVU A;  1TWG J;  3D5S C;  4RGX A;  2EB7 A;  2OCC H;  3C2H A;  1Q1V A;  5LEJ A;  4QTR A;  1MH3 A;  4Y7N J;  1MBG A;  3K4J A;  4Q48 A;  4C2T A;  2VC0 A;  3HSF A;  2A69 F;  1T8I A;  4Y33 A;  2M7A A;  3HM5 A;  2HOS A;  3OR1 C;  2MAB A;  3H35 A;  1BJA A;  3M9A A;  2JA2 A;  1B72 A;  2E2J J;  3J7Z I;  2JA6 J;  1FPQ A;  1OQY A;  4HQM A;  3F9K A;  1FOX A;  2IAI A;  4Y4R A;  2Y0M A;  4F93 B;  1IDY A;  1IN6 A;  2M7B A;  1RUN A;  4DJA A;  2B9S A;  2FBI A;  1G6N A;  2QQ8 A;  2YX4 A;  2PFB A;  3KFW X;  3AKZ A;  4RM3 A;  1FTT A;  3TO9 A;  3UNG C;  5LGU A;  2M34 A;  2E36 A;  4BJ5 C;  1SFE A;  3CC4 I;  2CV1 A;  1LFB A;  1MD0 A;  2IT0 A;  1B8I B;  1LEB A;  3DF8 A;  4LIU A;  1MBK A;  3FXQ A;  1D0Y A;  2V6C A;  2XAH A;  3TGN A;  2QGU A;  4D1Q A;  3AL0 B;  3CCR I;  4D5C A;  3O3K A;  2HKO A;  4RGS A;  2KKO A;  3FXJ A;  4ON0 A;  4B3A A;  4CUG A;  2E35 A;  3IRQ A;  4M6Y A;  1LQ1 A;  4E7Z A;  1UG0 A;  3MZ8 A;  2FOW A;  4IKF A;  1K4T A;  3NRV A;  2VXZ A;  2HYG D;  4G6D A;  4KDP A;  1X1B A;  3I59 B;  3MMY B;  4CDG A;  4AUX A;  1K7A A;  2XAF A;  3LQR A;  5TJJ A;  2XVC A;  3ZMT A;  3OIQ A;  3OYA A;  2CQK A;  4FET A;  2TDX A;  3CC2 I;  1W4M A;  4X1E A;  3CO6 C;  2RN7 A;  3DBH B;  4PFO A;  2LG4 A;  1JJ6 C;  1O7L A;  3H3Z A;  3BZ6 A;  1E0E A;  3K4C A;  3KYL A;  2MH9 A;  1JUP A;  2R5Y B;  2LKX A;  4LOC A;  1GHC A;  3VOD A;  1WJD A;  2KL4 A;  2HXO A;  2HEO A;  5LHI A;  1U9N A;  2XF7 A;  2X51 A;  2HPI A;  4XOR A;  2KRH A;  1JHF A;  5JVG F;  3BQY A;  3N4M A;  2XKP A;  4EMS A;  4XKV A;  3DLL F;  2R5Z A;  2COM A;  2GAU A;  3C2B A;  1UAA A;  3HRM A;  1FBS A;  2PMH A;  4CCJ A;  5FLX K;  1WPK A;  4NB5 A;  1I27 A;  1OYW A;  2CS3 A;  3OL3 A;  2JUC A;  2L7M P;  2EA4 A;  2MC4 A;  1W36 D;  4HEA 2;  4UVB A;  3E3V A;  4EAT A;  4JX4 A;  2DOD A;  5H20 A;  1G3T A;  5LEK A;  4RA2 A;  3EQL F;  2PLY A;  1ZEL A;  4LJZ F;  3FMR A;  5K1Y A;  3BJ6 A;  3QU3 A;  2VT2 A;  3M4O J;  2NXN B;  2VXD A;  5DD4 A;  1S3J A;  2V7F A;  3DPT A;  2OAZ A;  1Q1H A;  4BS9 A;  1Z91 A;  1VQ4 I;  4CHU A;  4YII A;  2RDP A;  2O6G E;  3P5J A;  3LOC A;  4ENM A;  3ABT A;  2OTJ I;  3JRI A;  4AIJ A;  2BY2 A;  4MTE A;  3R61 A;  4DW6 A;  3BR0 A;  1X1C A;  1U5T A;  4M3B A;  1BL0 A;  4E7J A;  3OY9 A;  1V5F A;  4BXU A;  3F8C A;  3S3O A;  2KRC A;  5EF6 A;  4BJT A;  3W3C A;  2QCO A;  3KP5 A;  5H6R A;  3FXM A;  3BR6 A;  1HKQ A;  2E71 A;  4O3M A;  1BBY A;  1ZQ3 P;  2ISZ A;  3K4M A;  2AS5 F;  2R7D A;  3BG9 A;  3LST A;  5HOD A;  1MDM B;  2ZC2 A;  2MBF A;  1DPR A;  2CSO A;  2KLO A;  1WH5 A;  2HS5 A;  3P9I A;  1IDZ A;  1JGS A;  3J81 K;  2VBZ A;  4M3E A;  1QHH D;  3DCF A;  3T8T A;  1KYW A;  5EZG A;  2CGP A;  1JTY A;  4M3G A;  3Q5F A;  5F1J A;  1YJ9 I;  2UXN A;  5J1Y A;  1F9N A;  1ZRD A;  2DFI A;  3ABM H;  3GXO A;  3HUG B;  3AG4 H;  2PJP A;  1W1W E;  2O0Y A;  1KGS A;  3I53 A;  2BV6 A;  4KN4 X;  5KK1 A;  3A01 A;  1VQM I;  3BC8 A;  1U8B A;  4A3J J;  3DU5 A;  2L4M A;  2ICW G;  2QQA A;  4M6X A;  5M5W J;  2D1V A;  5CVU A;  4A5N A;  5DTD A;  5JLX A;  2K9L A;  1QHG A;  3ZQG A;  3HRS A;  1TLH B;  2QSH X;  3KCC A;  5EYR A;  4HLX A;  1MMD A;  2DQR A;  5FO5 A;  5K5O A;  3BPX A;  1HF0 A;  4BJ6 C;  2Y69 H;  1FTZ A;  2LKP A;  2ZME A;  4IHY A;  3QP6 A;  3J7A Y;  2CO5 A;  2JZY A;  2M30 A;  1IXS B;  1GLN A;  3NAR A;  1YFH A;  4IRH A;  1W7P A;  5E1X A;  1I1G A;  1Z21 A;  1XSD A;  3QU6 A;  3PIO F;  5K5R A;  4PCQ A;  3U1K A;  1G4D A;  3S1Q J;  2H6C A;  4XMY A;  1VZ0 A;  3KP3 A;  1D1A A;  2A6E F;  1G3Y A;  1SC7 A;  2P0W A;  3A1Y A;  1TNS A;  2KZV A;  2CU7 A;  2W1O A;  2BOL A;  1TW2 A;  2LR8 A;  3QPL A;  4G7H F;  4G7O F;  2JA7 J;  1FOW A;  2IA1 A;  2QWW A;  3IAM 2;  2VOO A;  4CSW A;  2VB6 A;  3SZT A;  2DMT A;  5FJ8 J;  1W36 C;  3K69 A;  5E1W A;  1T33 A;  4Q4Z F;  3WTT C;  3ONQ A;  3ROU A;  5F1R A;  5FLM J;  4AIK A;  3QQA A;  4N4N B;  4M3D A;  4GCV A;  1HC8 A;  2QBY B;  2COB A;  3EYY A;  4LLL A;  1U5T C;  4Q47 A;  2LY9 A;  5ERI A;  2CG4 A;  1YIO A;  1WSU A;  3KEY A;  1UHS A;  1Z6T A;  1CQT A;  2P4W A;  1M1E B;  1P6R A;  2YUS A;  4YFN F;  2EIJ H;  2XF6 A;  1ETX A;  3OV8 A;  2FUG 2;  3VPR A;  3F72 A;  2HQ5 A;  3CCJ I;  4P55 A;  1B9N A;  1B1B A;  2VKE A;  1V55 H;  2BE5 F;  2FJ1 A;  4A0Z A;  3I55 I;  4AC0 A;  1EH6 A;  2XAQ A;  3AG1 H;  4UVA A;  4UUT A;  4D0P A;  4L9V A;  4M9X A;  3K7A J;  2DA2 A;  5EGO A;  4ZJZ A;  4KNY A;  1WI9 A;  4B48 A;  4CYD A;  5IPA A;  4XLF A;  2EA2 A;  3CLO A;  2Q1Z B;  2FF4 A;  1MGT A;  3M7G A;  4I76 A;  5J1R A;  1T2K A;  3Q0W A;  1W0U A;  2LBF B;  4KIB A;  1L3L A;  2QEN A;  3H5A A;  2IS6 A;  2F48 A;  2OQR A;  9ANT A;  5FKL A;  2DA5 A;  2IS1 A;  2HZD A;  2DI3 A;  1IRG A;  4EVI A;  4HF0 A;  2F5F A;  5ICC A;  4G8X A;  1HBX G;  3B73 A;  3OMY A;  4L0Y B;  4LGW A;  4BNC A;  2DU9 A;  1KU9 A;  3ZN0 A;  3LSI A;  2VQC A;  3EPZ A;  2ZME C;  3F21 A;  1HDP A;  1WRJ A;  5IOY A;  2VKD A;  1R22 A;  2DFE A;  2KP6 A;  4NNJ A;  1JTX A;  1NG6 A;  3T1B A;  4KIC A;  1D1C A;  1B8I A;  3H92 A;  4EM2 A;  4IO9 F;  2STT A;  3REO A;  3B02 A;  2P5V A;  3E5X A;  5DCM A;  4XOT A;  2ZXI A;  2EZL A;  5TIS C;  2L3D A;  3R60 A;  2EK5 A;  2K4J A;  4DQ2 A;  3HYI A;  3PO3 J;  5A2Q K;  2LSO A;  4MNU A;  5DUI A;  3PFY A;  5LGN A;  3SYT A;  3HOU J;  3M8F A;  2LYC A;  1ZR2 A;  5J3L A;  1PVE A;  2RQQ A;  3I59 A;  4F3Q A;  3OYE A;  4GFB A;  4I09 A;  4ZYD A;  1T39 A;  1RIO H;  5D4S A;  4C3J J;  2ELK A;  1JI8 A;  2XRL A;  3O2P E;  2H09 A;  1ZGA A;  1J0R A;  5FLX Z;  1K78 A;  2QLZ A;  1IV8 A;  3BRO A;  4PFP A;  3BCA A;  2QYO A;  2V9V A;  1K61 A;  4P9U A;  3GLL A;  5C4J J;  1OYI A;  1R7J A;  5GAD J;  3MAJ A;  4EEF G;  4BAY A;  3DKW A;  1Y6I A;  3BZK A;  2IA2 A;  2R5Y A;  1X2M A;  1QVT A;  3FM3 A;  3SDB A;  2HU9 A;  1UHM A;  3MEX A;  4I0B A;  1UHW A;  2NVQ J;  2L7K A;  1DDN A;  1ZAO A;  2QVO A;  3FIW A;  4HOB A;  4U0V A;  4TV7 A;  1ZGW A;  2EFN A;  4Q5S F;  2HTJ A;  2JJ7 A;  4N9I A;  2IRF G;  5EJC A;  4RAY A;  3BTL A;  1YS6 A;  3M8J A;  3CZ6 A;  2RGV A;  1VQ6 I;  1FIP A;  5D6F A;  2Y0S A;  5LRR A;  4J01 A;  4PGH A;  2PQ8 A;  2YU3 A;  4II2 A;  3ELK A;  1LEA A;  2Z5U A;  2E60 A;  3ZP5 A;  2K3F A;  2DO7 A;  3H1C A;  2QSF X;  3I4N J;  3OS0 A;  2AQF A;  3IUO A;  4WXH A;  1WFX A;  3O8G A;  5IP6 A;  2JN6 A;  5FGM A;  2L7F P;  1HQC A;  2V1D A;  3MKL A;  5LHH A;  1Z7U A;  5EG0 A;  3SJM A;  1GV2 A;  1TC3 C;  5CYV A;  4EQQ A;  3J81 Z;  4PGG A;  4LB6 B;  1ON1 A;  4MO7 A;  2CUJ A;  2MYS A;  1DPU A;  4KT6 A;  2K4B A;  1BW6 A;  2DN0 A;  5IT3 A;  3IKT A;  4XKB A;  1TZL A;  3KZZ A;  4BE0 A;  2DTZ A;  2O9L A;  4PJM A;  3IP4 B;  1G3W A;  2DW4 A;  2X48 A;  5DS9 A;  2X4H A;  2NVX J;  4HBL A;  3BR5 A;  2ZFW A;  4PJ0 C;  4G6T B;  4I2O A;  1SVL A;  4JYK A;  4DOZ A;  3RPQ A;  1IUY A;  1EJ9 A;  2AO9 A;  4QIW N;  2ZXW H;  1LFU P;  3HTS B;  2CRG A;  1O57 A;  3EUK L;  3HRT A;  4HX7 A;  2NS8 A;  2V9K A;  4CCN A;  2V9P A;  1B9M A;  2WV0 A;  1BW5 A;  2XPU A;  2JT1 A;  5M5Y J;  2EWN A;  2DLL A;  5F27 A;  3QPT A;  5FKM A;  5K5Q A;  1E2X A;  4BUP A;  4EV0 A;  3JAM K;  1TWF J;  3DFG A;  1A5J A;  3JRE A;  2HXI A;  3F3X A;  3CDH A;  4CA0 A;  3C7J A;  2W82 A;  4BQN A;  3WU1 B;  4I98 B;  1QBJ A;  3GTJ J;  1OCP A;  2KIU A;  4RB3 C;  3E97 A;  1RKT A;  2X0L A;  1XGN A;  2K3P A;  4EJV A;  2XGX A;  3LSM A;  3S1M J;  3MQ0 A;  3FX3 A;  1UCR A;  3RJP A;  2W57 A;  4IVN A;  2FQ4 A;  2BVM A;  3L2Q A;  4A0Y A;  3DP7 A;  3CCQ I;  1TTY A;  1MJA A;  2HQR A;  3OOU A;  4BQQ A;  2FSW A;  1J09 A;  3RI4 A;  2M8G X;  1S7O A;  1NH3 A;  1D1B A;  4UNO A;  5DCF A;  1PP8 F;  1R4N B;  1U8R A;  4ZYA A;  3V7R A;  4I6Z A;  1E3P A;  5KAF C;  1P9Q C;  1LE8 A;  2UUZ A;  3WG9 A;  4E7L A;  3AG3 H;  3M3Y J;  3BTC A;  3H5N A;  2RRE A;  5LFA A;  3HJE A;  4XM3 A;  2OZ6 A;  3BR2 A;  1CF7 A;  4OMY A;  4F55 A;  3QP5 A;  2VBY A;  5F0F A;  4RMN A;  3VWB A;  2CUF A;  3TBI A;  2D5V A;  5BOX A;  3CJN A;  5D5W B;  3GTO J;  3DKX A;  1N25 A;  5CJ9 A;  2JPC A;  4CCK A;  3KLO A;  2M2E A;  3A0H C;  1FYM A;  2QZ8 A;  4U87 A;  4RB2 C;  1HOM A;  1V5E A;  1LUJ B;  3CD6 I;  3TMO A;  1JT0 A;  2XRO A;  2WBM A;  3V7S A;  4HQE A;  4OIP F;  2M45 A;  1OCZ H;  2VIX A;  5JR3 A;  2Y75 A;  3Q0U A;  1WJE A;  4ABZ A;  1P92 A;  2IPQ X;  1HLV A;  3WGH A;  4HNU A;  2GA2 A;  2N8G A;  3L2C A;  1KQ0 A;  2EZI A;  1O3S A;  1TT0 A;  2GBY A;  1HDD C;  5BS6 A;  3DPU A;  2L7Z A;  5LHG A;  2R7Q A;  1IRX A;  2FBH A;  2IGN A;  1B6A A;  3R6S A;  3DLA A;  4HAM A;  1STZ A;  1MNE A;  2XF5 A;  1A6I A;  2EPF A;  3QOD A;  5JVT A;  1AOY A;  2HVR A;  1Y56 A;  5D5V B;  2NS7 A;  3HDD A;  2BHY A;  2Y9Z A;  2DYS H;  2IBD A;  4Y15 A;  4F7Z A;  5JLW A;  3CMY A;  5EZH A;  1X3W B;  2FNP A;  1KON A;  3S93 A;  1TQP A;  1WJB A;  4RDU A;  1VQ7 I;  1G59 A;  5F64 A;  4IEJ A;  3I54 A;  5E3N A;  2RAE A;  3OYC A;  3VOE A;  4E7S A;  3BCB A;  4DYC A;  2D2W A;  3C1D A;  3V7C A;  5ILU A;  1YG2 A;  3OIO A;  3LFU A;  2HOT A;  3DTI A;  2DA4 A;  2KRF A;  5L3C A;  3GZN B;  3HZJ A;  2ZCW A;  1BR4 A;  5LBQ A;  1TNT A;  4OIQ F;  3AAF A;  1ITY A;  4YRV A;  1XSX A;  1E17 A;  2PX9 A;  3TQN A;  3HIF A;  1RES A;  4A3L J;  4AD9 A;  5FKO A;  1LDD A;  2EV0 A;  4EM0 B;  1YHQ I;  1KU2 A;  3RSN A;  2R3S A;  2D1H A;  4BH9 A;  3KLN A;  1WJF A;  5CQE A;  3VSK A;  1IJW C;  3BJO A;  1IGN A;  2FOK A;  2IP2 A;  2H1L A;  1Z0X A;  2VPR A;  3IAS 2;  4CZZ A;  3ZN1 A;  1ZK8 A;  4MLO A;  3DKY A;  1R9T J;  3JRB A;  3IWZ A;  1D8J A;  2K9S A;  4DZP A;  1UZC A;  1OPC A;  2IGM A;  3KEQ A;  1EH7 A;  4BEH A;  3DBL B;  4XON A;  4EJU A;  3ZGK A;  1Z3X A;  2ZXH A;  3KEO A;  4RLQ A;  2V1U A;  2OD5 A;  3PUF A;  3DV8 A;  2BZT A;  3HSR A;  4HRI A;  3CMA I;  1ZLJ A;  3F8N A;  3HPG A;  4DBR A;  1X4P A;  4M9Z A;  1MNM C;  1KA8 A;  3MZY A;  1OCO H;  2ID6 A;  3GCM A;  2JRT A;  2MC3 A;  2ZJP F;  2LVS A;  2IGO A;  3QYB A;  2FD5 A;  3SEQ A;  2DBB A;  1SAU A;  3RYR A;  3W6V A;  1JGG A;  3VYU B;  2XB0 X;  2CH0 A;  5DDG A;  4HYE A;  5AON A;  1JJ8 C;  1BIB A;  5FLV A;  3GTQ J;  5L3B A;  2DA3 A;  2FEZ A;  3ZMZ A;  5L3G A;  2FXA A;  2ZBK A;  1FBU A;  5EEA A;  2E1N A;  4L5I A;  3FM5 A;  5L3D A;  2L02 A;  3HGG A;  1QRY A;  1D0X A;  1A35 A;  4H0E A;  2HOE A;  4CH7 A;  1NG7 A;  3HPH A;  2X1C A;  3K2Z A;  3UR3 C;  5HS7 A;  4CYC B;  1ACI A;  4PJL A;  1WKM A;  2IEK A;  1FT9 A;  1MW7 A;  3FBI B;  2KIS A;  4G6Q A;  1N77 A;  2QQ9 A;  2HYJ A;  1XDS A;  1YYV A;  3OYG A;  2XV4 S;  3MN2 A;  1K6Y A;  3VYR B;  3VEP A;  1TWC J;  2NNN A;  3KP6 A;  3N05 A;  3BT9 A;  3FXL A;  3QOE A;  3JAM Z;  4ZZL A;  2NS0 A;  4HPQ A;  1YIJ I;  2LLK A;  4KMF A;  2Y0S N;  1JE8 A;  2M0C A;  2K86 A;  1MH4 A;  4C3H J;  3FDY A;  4XBF A;  1JKQ C;  4J19 A;  3GYH X;  1P7I A;  4BDZ A;  3KP4 A;  1OIS A;  5HS9 A;  2LMD A;  1SMT A;  2RV8 A;  5D4R A;  2B7E A;  5HNH A;  1LJ9 A;  4RB1 A;  4LIV A;  1YTY A;  1AWC A;  3R0A A;  3ZMD A;  3R4K A;  1Y0N A;  3QAH A;  2VI6 A;  2HDD A;  2P7C B;  3E5Q A;  5ICF A;  2ZJQ F;  1YW8 A;  4WK8 F;  3PNY A;  3QOP A;  1JT6 A;  2XGC A;  1W5T A;  4DBQ A;  1H88 C;  3H0D A;  2JUG A;  1B59 A;  1OCT C;  2HZT A;  4HG2 A;  3ABU A;  4XN3 A;  5C3E J;  3HRU A;  4ZH4 F;  2Z1D A;  2A5W A;  2BBY A;  3OYI A;  1X1D A;  3ECH A;  3LSG A;  3OYD A;  2EFO A;  3CCU I;  2Q2E A;  1WJC A;  2ESH A;  2WB1 A;  4F91 B;  2K9M A;  3FMS A;  2VOD A;  3ZQQ A;  3GO5 A;  2P5K A;  2XGD A;  2WAQ A;  3E6B A;  2KIM A;  2OZU A;  3GBG A;  1LDJ A;  3HOY J;  4LD5 A;  2J5P A;  3JR9 A;  1DU6 A;  2G9W A;  5IYD J;  2E1M B;  1YX5 A;  2KFD A;  2X1D A;  3FMQ A;  3H5R A;  4XKW A;  3K0L A;  4EJW A;  3NQO A;  4XKC A;  2ZKZ A;  3JRD A;  1XDU A;  4ESB A;  3BLY A;  2NRA C;  3N97 A;  5L3F A;  4A12 A;  4E4H A;  1U2W A;  1J5Y A;  1MIJ A;  3PSI A;  2HDC A;  3P7N A;  3G3Z A;  3FBN B;  3ERM A;  3PM1 A;  3TL4 X;  1PUF B;  3KIO A;  2A61 A;  2XIG A;  1E3H A;  1FMW A;  3DEW A;  3WTW C;  3NWS A;  1RR8 C;  3BJA A;  2IS4 A;  1ORK A;  4MTD A;  1RRJ A;  1ETY A;  5ILV A;  4EGY A;  4QSH A;  2EIK H;  5B5E C;  1N78 A;  3LA3 A;  4RM2 A;  3GZ6 A;  4NQW A;  1JKP C;  3E5U A;  4A3F J;  1I1S A;  2FMY A;  3FWE A;  3JRF A;  2E7W A;  1HW1 A;  5K7H A;  3TED A;  1FYL A;  3VYS B;  2I10 A;  3T5X A;  4FX0 A;  2LD5 A;  1SEU A;  3S14 J;  1OLT A;  4PDK A;  2NAZ A;  4B47 A;  4FIS A;  5JHF A;  3SZP A;  1F36 A;  2CJJ A;  4JOM A;  2JRM A;  4O5V A;  1Y8R B;  3G4S I;  3GTL J;  1SD5 A;  2EV5 A;  3RTR A;  2V79 A;  5CVI A;  1W7P D;  2W4S A;  4AYB A;  5AIQ A;  4B8X A;  1OFC X;  2FX0 A;  2R7Z J;  3F8F A;  3ZR8 X;  2DMU A;  1SAN A;  1XGS A;  3WOD F;  5CPR B;  1V4R A;  4C3I J;  2R4G A;  1XB4 A;  4M9S A;  4NBQ A;  5BPD A;  1IRF A;  5DV5 A;  5HVQ C;  3S8P A;  1LPQ A;  2Z3Y A;  3HOT A;  2LY1 A;  4XRS A;  5FRO A;  1XN7 A;  1I50 J;  4XLE A;  3MKZ A;  3G1L A;  3I56 I;  3HG9 A;  4FHT A;  2XGE A;  4KIS A;  1F43 A;  1GVJ A;  4R79 A;  1PYV A;  4ZYH A;  3CUQ A;  1ON2 A;  2DT5 A;  3TKY A;  2R7W A;  4EGZ A;  3DTK A;  3F0C A;  3K4L A;  4MIM A;  1Y1V J;  1J59 A;  4HLY A;  2W85 A;  3KYC B;  5ILS A;  2LH9 A;  2Y9Y A;  2CUE A;  3SFZ A;  4UUS B;  4CIC A;  1U78 A;  4P9F A;  2VC1 A;  1WCM J;  1OR7 A;  1JXS A;  4ZC3 A;  2KHM A;  1SFU A;  5EEG A;  1SD6 A;  4XLN F;  4XSX F;  3JRH A;  2B0L A;  3TOB A;  2BXZ A;  2EV6 A;  2KPM A;  4JX6 A;  1MSF C;  1J7K A;  4ZDO A;  1YRN A;  1VQK I;  3DTE A;  3GVA A;  4ZYG A;  3RPU A;  4HSR A;  5E17 F;  5E3O A;  3L2U A;  4IHT A;  2R7O A;  3CP8 A;  5KAI C;  2DTR A;  1BI0 A;  2PMZ A;  1HSJ A;  5LGT A;  3FXK A;  5AIP A;  5JFR A;  2YU9 J;  1XGO A;  2MGQ A;  4S04 A;  5E3L A;  1YOV B;  1FEX A;  3QRF F;  1KZH A;  2VN2 A;  1U9O A;  1RNL A;  1R5H A;  3S15 J;  3JSO A;  1WI3 A;  5HOO A;  1VF9 A;  5FD6 A;  2VUM J;  5GAH J;  1WGX A;  3GTK J;  3GX4 X;  3CME I;  2R7F A;  1MSE C;  3SZG A;  2XUB A;  3S1R J;  3FXU A;  4IJA A;  2K5C A;  4DZJ A;  3QYE A;  4KYW A;  1NHA A;  1VND A;  3LA2 A;  3GZ5 A;  4B43 A;  2LF7 A;  2DPU A;  3HKZ A;  1Y0U A;  4JK1 X;  3FIS A;  1OKR A;  4V2F A;  2DT7 B;  1YJN I;  1ZAR A;  3GFM A;  3TOA A;  4I0A A;  4A3M J;  4LG3 A;  1EF4 A;  4XRM A;  3I58 A;  4CGZ A;  3PUB A;  1U0J A;  4HA8 A;  2XRN A;  2W25 A;  3HOZ J;  1X1A A;  2STW A;  4HV5 A;  1SFO J;  1J75 A;  3BZC A;  4CCM A;  1A36 A;  5HLI A;  1VI0 A;  4M3F A;  5ED4 A;  3ZQC A;  1TT5 B;  4BXX J;  1YX3 A;  2NOJ B;  2DK8 A;  2WY8 Q;  4L18 B;  2X6O A;  1S6L A;  4HW0 A;  1ONV A;  1EH8 A;  1G8X A;  1YW7 A;  1S9H A;  3K1M A;  1ETW A;  3Q9V A;  2H27 A;  2K27 A;  3COA C;  1S7A A;  4UVC A;  3IH2 A;  2P7V B;  2H6B A;  4A2U A;  5F0C A;  3BR1 A;  3V8J A;  1BI1 A;  3L09 A;  3CUQ C;  1F1Z A;  2XAU A;  5B1A H;  1AA7 A;  3JRA A;  3CF2 A;  3F8B A;  2BY1 A;  4HNV A;  5IP7 J;  3JTG A;  1H8A C;  3TP0 A;  4ZTJ A;  4M6V A;  1D8K A;  4HST A;  1TBX A;  2WAD A;  2EIM H;  2VKV A;  2F5V A;  2V1X A;  4A3G J;  2KIQ A;  2BY0 A;  5IYC J;  2OCE A;  4HV6 A;  3CDI A;  3LSJ A;  1OR7 C;  4IQJ A;  3K1P A;  2MW8 A;  2QA4 I;  3PQK A;  2QM3 A;  2R7T A;  3GEZ A;  3QPS A;  2PJR B;  2K40 A;  2QQB A;  3G2B A;  3G6E I;  2DMN A;  2MLK A;  3HSE A;  4EJO A;  2EFP A;  4OWR B;  4BGD A;  1O3R A;  2EBI A;  2CQQ A;  2XAG A;  2BW3 B;  1MZB A;  3TW7 A;  4BHC A;  1FYK A;  2A68 F;  1LVK A;  4FE7 A;  1JHH A;  3BDD A;  1XMX A;  2DA7 A;  4BYY A;  1YW9 A;  1X3Z B;  1BR2 A;  4I01 A;  4F52 A;  2I8D A;  3Q3S A;  2PEX A;  5C4X J;  3ECO A;  2V4J C;  5HDG A;  1G2H A;  5H6Q A;  2JSC A;  2A6H F;  2TCT A;  3U2R A;  2UWM A;  3A03 A;  3G1O A;  1T6S A;  2O3F A;  5L3E A;  2JA5 J;  5J4V A;  2IJL A;  1R1U A;  2CFX A;  3JSP A;  1VTN C;  1FIA A;  1R1T A;  3VDX A;  2XAJ A;  3I5U A;  3FXR A;  1EV7 A;  2X1E A;  3WTX C;  4IXA A;  1ETK A;  3LFK A;  5CVV A;  2ZSH B;  1XG1 A;  3OYN A;  1D5Y A;  1WZ2 A;  1TQI A;  4DYQ A;  1I3A A;  3PL8 A;  3HHH A;  1I5Z A;  1YLF A;  2GIV A;  2JVG A;  1F5T A;  3K2A A;  2BY3 A;  1QGP A;  4ASN A;  2R7V A;  1FC3 A;  2OC6 A;  3FZV A;  4N0B A;  3JRG A;  2WA0 A;  1RI7 A;  1V54 H;  2IW5 A;  4FX4 A;  5BMZ A;  2DPD A;  3CQZ J;  3O8H A;  1USS A;  1DP7 P;  2ACJ A;  4ANJ A;  3S16 J;  1AKH B;  3S3N A;  3TP3 A;  2JSP A;  3JRC A;  4IHV A;  1H0M A;  4MEY F;  3ASO H;  2BGC A;  2HYF A;  3M07 A;  2H8R A;  3KX2 A;  1AHD P;  1P7J A;  1GUU A;  3I64 A;  2DFF A;  2E2I J;  1QNT A;  3AL0 C;  1D0Z A;  3LQQ A;  1I39 A;  1IN4 A;  4E6K G;  2ZJR F;  1MDM A;  2WB1 N;  3L1P A;  2X9D A;  4OMZ A;  5HLT A;  3IRR A;  1BA5 A;  2GIZ A;  2L5Q A;  2PMU A;  2WAQ N;  3D5L A;  2CW7 A;  4A3B J;  2ZNZ A;  5BQT A;  1BC7 C;  2A07 F;  1HW2 A;  2XPV A;  3HUG A;  4QPQ A;  1IRZ A;  4HX4 A;  5E20 A;  4HF1 A;  1X1P A;  2FA5 A;  1V5G A;  3BG7 A;  3WTZ A;  5LRS A;  1ZGJ A;  4UB8 C;  3FK7 A;  5GP9 A;  3RQ4 A;  3GUD A;  1U3E M;  1KQ9 A;  3TDU C;  5J47 A;  1OMI A;  2NNY A;  2CUZ A;  4L5E A;  4IL6 C;  4EJT A;  2JA8 J;  2M87 A;  4M71 A;  4CO8 A;  3CCE I;  4XR6 A;  2IVM A;  1FNN A;  2KMU A;  2M3A A;  3I4M J;  1N75 A;  2DMP A;  4IX7 A;  2V6E A;  2UZK A;  2M8E A;  4ESJ A;  1IV6 A;  2R5Z B;  2M5W A;  4AM3 A;  5J6X A;  5C44 J;  4KMU X;  1VQ9 I;  2O5R A;  4KIF A;  3ZCO A;  3DEE A;  3ZMU A;  2MD5 A;  1ZYR F;  3CCV I;  4X6A J;  2QSG X;  3OYJ A;  4AYB N;  1IN5 A;  1R00 A;  4XLH A;  3OYK A;  2DDB A;  3ABK H;  4BY7 J;  5TRD A;  4A5M A;  4UY8 I;  1ERD A;  2DT6 A;  5J8C A;  1GXQ A;  5EDN A;  3IH3 A;  1UB9 A;  4XIC A;  2HNH A;  1IW7 F;  3CJR B;  5JI6 A;  1T56 A;  1MMA A;  4P96 A;  4BE2 A;  1I6X A;  2QBY A;  4NUB A;  1IG7 A;  4FT8 A;  1A04 A;  3TW6 A;  4I7H A;  1BIA A;  3GFI A;  2DDA A;  1TWH J;  1REP C;  4ZDP A;  2L54 A;  3MCZ A;  3S3M A;  1U5T B;  3CP2 A;  4CZC A;  3SFI A;  2VBW A;  3J80 K;  2L9V A;  2WAE A;  1R6R A;  3D5R C;  2VE9 A;  2VJ4 A;  1WJA A;  4HX8 A;  3OOP A;  3L2W A;  1PJR A;  1TL8 A;  4JP0 A;  4EM1 A;  1QA6 A;  1LVA A;  3GWZ A;  2LOO A;  3CMM A;  3I3L A;  4BU2 A;  1IC8 A;  1WHU A;  2DMQ A;  2OPT A;  2NVU B;  4XLP F;  1BR1 A;  1ZRF A;  2GM4 A;  4IHX A;  5J40 A;  1DUX C;  2BYV E;  4M73 A;  1T38 A;  3NAU A;  1VQL I;  1H89 C;  3WU2 C;  2LBF A;  4XL9 A;  3LNQ A;  3IWF A;  2A05 A;  2OJE D;  3Q0V A;  3TO6 A;  2HFH A;  2JVH A;  2PMZ N;  1SFX A;  3OS2 A;  3A01 B;  2E5Z A;  3KE2 A;  1P4W A;  4OOI A;  1POG A;  2EIL H;  3FK6 A;  5A2Q Z;  3M1C A;  4GDF A;  1QZZ A;  3H0G J;  2PBI A;  1XGM A;  2VQL A;  3OIP A;  3JTH A;  1MND A;  4G12 A;  2R0Q C;  2ESN A;  4GRI A;  3OSG A;  3A2K A;  1XS9 A;  2K9N A;  5B3S H;  2R93 J;  2ZME B;  4XOP A;  4QLC U;  1O3T A;  5FB2 A;  2VE8 A;  5CVR A;  3F6V A;  4LLN A;  1FBQ A;  1WJ5 A;  1Z7L A;  3OYH A;  3HKZ N;  3HEF A;  3MWM A;  2P6S A;  1S5L C;  1GXP A;  1RPW A;  3RKX A;  1JUM A;  1SMY F;  4A6E A;  5GAG J;  1FY7 A;  1HST A;  4XID A;  3EYI A;  3WE3 A;  1ETQ A;  1TP4 A;  2XDV A;  4U0Y A;  3BWG A;  4RB0 A;  4OIR F;  4MQ9 F;  3HOV J;  4A3I J;  2KT0 A;  5F0H A;  2FML A;  1ZG3 A;  1K6O A;  1ZRC A;  4ZYE A;  1D3Y A;  4WCG A;  2Y30 A;  3BPV A;  4WXD A;  4ESF A;  5M5X J;  2OF7 A;  1ZHF A;  2VAS A;  3CCY A;  2P5L C;  5E8I A;  1DGR M;  1FOY A;  3E7L A;  2ZXJ A;  1R58 A;  3K6G A;  3V4G A;  3DPL C;  3WHB A;  1XX5 A;  2GXA A;  3WTV C;  3ZQ7 A;  4O6J A;  2IA0 A;  2ME0 A;  1OCR H;  1ZH5 A;  5K7Z A;  4FQG A;  4UV8 A;  4UB6 C;  3KPH A;  2ELH A;  3H9Q A;  4RBO A;  2MD0 A;  3IH4 A;  3W2A A;  3MZH A;  4GO1 A;  1YJW I;  3ZRG A;  1R71 A;  2DAO A;  4UHT A;  1YO5 C;  1QZY A;  1NTC A;  3K9T A;  3GTP J;  2H8W A;  2I5U A;  1R23 A;  1SD7 A;  1J2X A;  4RS8 A;  1GT0 C;  5FRN A;  2LKS A;  3C3W A;  1S72 I;  2V26 A;  4AIH A;  1ZG5 A;  4LK1 F;  4KJZ A;  4XK4 A;  4FTH A;  1RET A;  4II3 A;  5B66 C;  1S8N A;  2M0M A;  3HL2 A;  5EGO B;  2JQ7 A;  2GQQ A;  5M3M J;  3IV5 A;  1LFP A;  1P4A A;  2HDW A;  1KU3 A;  3CJQ B;  1BI2 A;  4L9T A;  4RGU A;  4XLA A;  1ZR4 A;  2L01 A;  3E1S A;  4RAG A;  1FLI A;  3HOX J;  2CW8 A;  2HVQ A;  4C9Y A;  3S32 A;  3ZQF A;  1D5V A;  2XAS A;  3K70 D;  2TRT A;  3ULQ B;  3WU0 A;  1AKH A;  2M4G A;  1ZRE A;  1RKW A;  4LMY A;  3PNV A;  4NC6 A;  4B1R A;  2E2H J;  1I6H J;  2XC7 A;  2HQA A;  4GXO A;  3V8L A;  1XPX A;  1WVR A;  2XSD C;  4M74 A;  1ULY A;  1FOK A;  2EQR A;  1L0O C;  4DGW B;  2R7R A;  5FD5 A;  4R8H A;  3EDP A;  1HKS A;  2KDO A;  3CDL A;  3WGI A;  5DCM B;  1ENH A;  2VJJ A;  1UEL B;  3GFL A;  5DD8 A;  1ZN2 A;  3HB9 A;  5LD2 C;  5GTI C;  3LMM A;  4HNT A;  2GXG A;  1FSE A;  4XLC A;  1WWX A;  2HPM A;  2E1C A;  4V19 K;  1ZKG A;  2LY2 A;  3CJT B;  2EIN H;  2O8K A;  5IP9 J;  4RGR A;  4Y52 J;  4A3C J;  4IF4 A;  3RYP A;  3FHZ A;  4PJN A;  4ITV A;  4C30 A;  1O4X A;  2DQL A;  1V3F A;  1X19 A;  4GYI A;  5E79 C;  4ETS A;  1K78 B;  1P2F A;  2ZJ2 A;  2YX7 A;  4QWQ A;  3BTJ A;  1E3O C;  2KJC A;  3GTG J;  1S29 A;  2MH2 A;  3S17 J;  3RKQ A;  1ETO A;  4WWC A;  2E34 A;  3RCO A;  1F4K A;  3RDI A;  1IN8 A;  4D7N A;  3OR2 C;  4PUS A;  2WC2 A;  3KP7 A;  4Z2Y A;  1YS7 A;  1UFM A;  5HLG A;  2OUM A;  3U9G A;  1BN5 A;  2LNB A;  2RNJ A;  1W5C C;  2DOF A;  5TGT A;  4AID A;  3IKV A;  4LFU A;  3I0T A;  3MFK A;  3IL2 A;  3OYF A;  1IXR C;  1EA3 A;  2F4O B;  3ABL H;  4V2G A;  1I3Q J;  2EZH A;  1U6G A;  1PDN C;  3GFJ A;  2ECC A;  3E6D A;  1MJ9 A;  1UMQ A;  3J80 Z;  3GTM J;  2ID3 A;  1MJB A;  1X4O A;  3GW2 A;  4XN0 A;  2L9R A;  2Z9O A;  1IAW A;  2E5N A;  2F5D A;  3ASN H;  2L2O A;  4BQA A;  3J7Y J;  4IHS A;  2X6W A;  2QUF A;  1Y1W J;  3P9C A;  1QPI A;  3PSF A;  1IO2 A;  5DEQ A;  5EG0 B;  2CV0 A;  5KCM A;  2QKL B;  3EUH A;  3K1N A;  3EET A;  2PG4 A;  3K10 A;  4N4O B;  2AXT C;  1HA8 A;  1P4X A;  4A0X A;  3ZPL A;  2ME6 A;  2F5E A;  4Y17 A;  5DM6 F;  3GF2 A;  3PFI A;  4BHP A;  1NK2 P;  3S2W A;  1QZE A;  3F6O A;  4GYG A;  3PQJ A;  4LIT A;  4Z6Y A;  2R7S A;  3K70 C;  5FRM A;  2C6Y A;  2GLO A;  2PN6 A;  4U7B A;  4HZF A;  2QEX I;  1K4S A;  4E7K A;  3MD2 A;  2E1O A;  2P6T A;  1RC9 A;  1PUE E;  2YS9 A;  5FFX A;  3PIP F;  2BHZ A;  1ETV A;  5F08 A;  2A3S A;  2CFO A;  4B3X A;  4MHG A;  1QQI A;  3PO2 J;  1XC5 A;  2GOX B;  5M3F J;  5HNF A;  2FU4 A;  3M8E A;  3WTS C;  4IHW A;  3W6K B;  3VSL A;  2EFW A;  5HS8 A;  2IXS A;  1Z1D A;  2XKO A;  5HLH A;  3F8M A;  4P1W A;  3U21 A;  2M1B A;  4KN7 X;  3V8K A;  4FCY A;  4ZTF A;  1BJZ A;  3MVP A;  2RQP A;  2MA3 A;  3L2V A;  4XQF A;  2R7X A;  2AQE A;  2QKM B;  1X3U A;  1FWZ A;  1XCV A;  1QO0 D;  3ZQI A;  4ZDL A;  2RC4 A;  4LLG F;  4R1H A;  2G7H A;  4LG0 B;  1J9I A;  2P81 A;  5FKN A;  2WWY A;  2OQG A;  4JX5 A;  4A3K J;  2VL8 A;  2VBX A;  3CC7 I;  1Y8Q B;  2X6X A;  3ESW B;  3RPU D;  2KIF A;  4MFE A;  1DU0 A;  2DXI A;  1W5S A;  2WY7 Q;  3OL4 A;  2BEO A;  4A6D A;  2CMP A;  4IOA F;  3K4B A;  4MFD A;  4NC7 A;  4B44 A;  4DIQ A;  3OYB A;  4A3D J;  3SDG A;  4LK0 F;  3J7A O;  2GOM A;  3E6M A;  2H1K A;  2LRD A;  4A93 J;  2E19 A;  2EZK A;  4IPA A;  4I99 C;  1TW3 A;  1LE8 B;  1EKE A;  3HBL A;  3Q9S A;  4BY1 J;  1R49 A;  5K7F A;  3DBR B;  4WX9 A;  5KHD A;  5GPA A;  5BPI A;  2O61 A;  1CF7 B;  1Z67 A;  3A0B C;  3FKI J;  2V1N A;  1BM9 A;  3B6C A;  4U7D A;  1FZP B;  4FAS D;  2F4I A;  1SVM A;  3LSK A;  2BVL A;  2XB5 A;  5BNG A;  5CLS A;  2DOE A;  5CQG A;  5E3M A;  2ELJ A;  3NWT A;  3EUH C;  5IT9 K;  2CWE A;  3BR3 A;  3LAP A;  4C2M J;  4YEL A;  4B4C A;  4J00 A;  3CCM I;  1FJL A;  3WGG A;  1JKO C;  3SXY A;  3H9G A;  3ZOB A;  2ZB9 A;  3JW4 A;  6PAX A;  1MBJ A;  3WE2 A;  2DJI A;  2K7L A;  2VJI A;  1R36 A;  3I4P A;  1IXC A;  4Y13 A;  2DYR H;  1H9T A;  1UG2 A;  3AG2 H;  1RR7 A;  2G0E A;  4B09 A;  5H2F C;  3W2W A;  3H9J A;  2XHK A;  3BOQ A;  4XNF A;  1QU3 A;  1DP3 A;  3UKG A;  3MKY B;  3WTY C;  4MQV A;  1ZLK A;  1XSV A;  4L5J A;  1HCR A;  2G7U A;  2AHQ A;  4M72 A;  1NK3 P;  1T95 A;  2FE3 A;  2DFH A;  2MG4 A;  3TO7 A;  4D7M A;  2D45 A;  1K79 A;  1RUO A;  3HGY A;  4G9Y A;  1JUS A;  1MBE A;  2HI3 A;  2WTE A;  4AVP A;  5GTH C;  4CYC A;  4YIF A;  4ENN A;  3ISP A;  5GAE J;  3G71 I;  4L0Z B;  1R4M B;  4XRS G;  2IS2 A;  2F4M B;  3HOS A;  2O7O A;  2Y48 A;  4AU7 A;  2Y31 A;  3B6A A;  4WF2 A;  2YPR A;  5J4Y A;  1GVD A;  3CLQ A;  1GDT A;  1XMK A;  4NC8 A;  5FKK A;  2HGC A;  1KYZ A;  4E7I A;  1MMN A;  2RKH A;  2F6C A;  4BKX A;  3I71 A;  3CCS I;  1VQP I;  2KJB A;  4MEX F;  1O7F A;  3TDZ C;  3SHF A;  2B63 J; 
#chains in the Genus database with same CATH homology
 5E1Z B;  5EEH A;  2EJR A;  3LAJ A;  1FP2 A;  1XCB A;  1XD7 A;  1KQ8 A;  1LB2 A;  4ENJ A;  1RZ4 A;  3HHG A;  3RIR A;  2O03 A;  4ENK A;  3H3U A;  1HW5 A;  2RVC A;  2W24 A;  1ODD A;  1SAX A;  5J8F A;  4GGG A;  2HQN A;  1Z6R A;  3KP2 A;  4UV9 A;  3NEU A;  4KT5 C;  3ZMV A;  2YR2 A;  5DUK A;  2K02 A;  3L9F A;  1R1V A;  5DYM A;  3VB2 A;  3G73 A;  2W84 A;  4YFX F;  4PZJ A;  3CTA A;  4ZZD A;  3E6C C;  4XRF A;  2Z33 A;  3HTU A;  2ZO4 A;  1BOA A;  5D8L B;  5CVJ A;  4P5O A;  1OYY A;  2NYX A;  2Q8K A;  1T98 A;  1WQ2 A;  4KUM A;  2ISY A;  4XSZ F;  2HKX A;  3U1D A;  4G94 A;  2JTV A;  1CGP A;  4U0W A;  2A5Y B;  3W6J B;  3IC7 A;  3IHU A;  4OIO F;  2FNA A;  4IRG A;  2P8T A;  4IRI A;  2AXL A;  1ZG1 A;  2VT3 A;  1BC8 C;  3FF5 A;  4BHB A;  2EFQ A;  4N9H A;  3C18 A;  3LA7 A;  1UST A;  5D8K B;  4KA4 A;  3T8R A;  2CW0 F;  3ERE D;  1G3S A;  3RKY A;  5ICG A;  3QPH A;  2GA1 A;  4HDV A;  1H9G A;  4UXN A;  4LG0 A;  3L7W A;  1HKT A;  2YSR A;  4OU0 A;  1T0F A;  3D0S A;  1MKM A;  3DQV C;  5D6E A;  2LF8 A;  3M1E A;  2ETH A;  4E70 A;  1HXD A;  1B4A A;  4LB5 A;  2F5C A;  3KZY A;  1IF1 A;  2HR3 A;  5IT9 Z;  4KIG A;  2PI0 A;  2GZW A;  2O8X A;  2ZNY A;  3O6B B;  5KVR A;  4MGR A;  2ADU A;  2HWV A;  4JBA A;  1FSH A;  4I02 A;  4UUV A;  3F22 A;  2HTS A;  3DEU A;  1PP7 U;  2OU2 A;  1IN7 A;  1TQM A;  1Z05 A;  3WTU C;  2Z99 A;  4L9N A;  5JHU A;  5D5U B;  1LNW A;  4NHJ A;  3ZMS A;  2GWR A;  1YQA A;  1BI3 A;  4WXC A;  4KFC A;  3LWF A;  5E8G A;  1R5G A;  4K2E A;  5ICE A;  3T0Y A;  4AWX B;  1C0W A;  2MLG A;  2FRH A;  2LDU A;  3KET A;  3VFZ A;  4OIN F;  4L9J A;  5HDN A;  5F6F A;  4S05 A;  2Q0O A;  1XMA A;  3SQN A;  4YG2 F;  2FQ3 A;  3L00 A;  4JQF A;  2FBK A;  1W7P B;  3CO7 C;  2JPB A;  3CUQ B;  3DXJ F;  2DK5 A;  3BP8 A;  4RAZ A;  4U88 A;  3GLX A;  2CYY A;  3F23 A;  2H94 A;  2L4A A;  1KU7 A;  5FFZ A;  1LDK B;  1Z9C A;  5E18 F;  2E7X A;  3P9K A;  5HDK A;  1IZ1 A;  3R0J A;  3RKW A;  2UXX A;  3ML6 A;  1SD4 A;  2GXB A;  2J5O A;  4HF2 A;  1O3Q A;  1FX7 A;  4YFK F;  5D5X B;  4G7Z F;  2OA4 A;  4HDU A;  4CXF A;  3CUO A;  4DNC A;  2F2E A;  2OBP A;  3BY6 A;  1QPM A;  2VOP A;  5LLQ A;  2VON A;  1FP1 D;  4RGX A;  2EB7 A;  5LEJ A;  4Q48 A;  2VC0 A;  3HSF A;  2A69 F;  1BJA A;  3M9A A;  1FPQ A;  4HQM A;  2Y0M A;  1IN6 A;  1RUN A;  2FBI A;  1G6N A;  2YX4 A;  2PFB A;  3KFW X;  3TO9 A;  5LGU A;  1SFE A;  1MD0 A;  2IT0 A;  1LEB A;  3DF8 A;  3FXQ A;  2V6C A;  2XAH A;  3TGN A;  3O3K A;  2HKO A;  4RGS A;  2KKO A;  4ON0 A;  3IRQ A;  4M6Y A;  1LQ1 A;  3NRV A;  2VXZ A;  2HYG D;  4G6D A;  4KDP A;  3I59 B;  4CDG A;  1K7A A;  2XAF A;  3LQR A;  5TJJ A;  2XVC A;  3ZMT A;  2CQK A;  2TDX A;  1W4M A;  3CO6 C;  2RN7 A;  1O7L A;  3H3Z A;  3BZ6 A;  2MH9 A;  1GHC A;  3VOD A;  2HEO A;  5LHI A;  1JHF A;  3N4M A;  2XKP A;  4EMS A;  2COM A;  2GAU A;  3HRM A;  1FBS A;  2PMH A;  5FLX K;  4NB5 A;  1I27 A;  1OYW A;  2EA4 A;  4UVB A;  3E3V A;  5H20 A;  1G3T A;  5LEK A;  3EQL F;  2PLY A;  4LJZ F;  3FMR A;  5K1Y A;  3BJ6 A;  3QU3 A;  2VT2 A;  5DD4 A;  1S3J A;  3DPT A;  2OAZ A;  1Q1H A;  1Z91 A;  4CHU A;  4YII A;  2RDP A;  2O6G E;  4ENM A;  3ABT A;  4AIJ A;  4MTE A;  3R61 A;  1U5T A;  4BXU A;  3F8C A;  3KP5 A;  5H6R A;  1HKQ A;  4O3M A;  1BBY A;  2ISZ A;  2AS5 F;  2R7D A;  1MDM B;  3LST A;  2MBF A;  1DPR A;  2CSO A;  2HS5 A;  3P9I A;  1JGS A;  3J81 K;  3T8T A;  2VBZ A;  1KYW A;  2CGP A;  3Q5F A;  2UXN A;  1F9N A;  1ZRD A;  2DFI A;  3GXO A;  2PJP A;  2O0Y A;  1KGS A;  3I53 A;  2BV6 A;  4KN4 X;  5KK1 A;  2L4M A;  2QQA A;  4M6X A;  2D1V A;  5CVU A;  4A5N A;  3HRS A;  1TLH B;  3KCC A;  4HLX A;  2DQR A;  5FO5 A;  5K5O A;  3BPX A;  2LKP A;  2ZME A;  3QP6 A;  2CO5 A;  2JZY A;  2M30 A;  1IXS B;  1YFH A;  4IRH A;  1W7P A;  5E1X A;  1I1G A;  1XSD A;  3QU6 A;  5K5R A;  4PCQ A;  1G4D A;  2H6C A;  3KP3 A;  2A6E F;  1G3Y A;  1TNS A;  1TW2 A;  4G7H F;  4G7O F;  2IA1 A;  2QWW A;  2VOO A;  3SZT A;  3K69 A;  5E1W A;  4Q4Z F;  3WTT C;  3ROU A;  5F1R A;  4AIK A;  4GCV A;  2QBY B;  3EYY A;  4LLL A;  1U5T C;  4Q47 A;  5ERI A;  2CG4 A;  1YIO A;  1WSU A;  1Z6T A;  2P4W A;  1P6R A;  4YFN F;  3OV8 A;  3F72 A;  4P55 A;  1B9N A;  1B1B A;  2BE5 F;  4A0Z A;  1EH6 A;  2XAQ A;  4UVA A;  4D0P A;  4L9V A;  4M9X A;  4KNY A;  1WI9 A;  4CYD A;  2EA2 A;  3CLO A;  3M7G A;  2FF4 A;  1MGT A;  1T2K A;  4KIB A;  1L3L A;  2QEN A;  2OQR A;  2DI3 A;  1IRG A;  4EVI A;  4HF0 A;  2F5F A;  5ICC A;  4G8X A;  1HBX G;  3B73 A;  4L0Y B;  4LGW A;  4BNC A;  2DU9 A;  1KU9 A;  3ZN0 A;  3F21 A;  1WRJ A;  1R22 A;  3T1B A;  4KIC A;  3H92 A;  4EM2 A;  2STT A;  3REO A;  3B02 A;  2P5V A;  3E5X A;  5DCM A;  2L3D A;  3R60 A;  2EK5 A;  2K4J A;  4DQ2 A;  3HYI A;  5A2Q K;  2LSO A;  4MNU A;  5DUI A;  5LGN A;  3M8F A;  3I59 A;  4I09 A;  4ZYD A;  1T39 A;  1RIO H;  5D4S A;  3O2P E;  2H09 A;  1ZGA A;  1J0R A;  5FLX Z;  1K78 A;  2QLZ A;  3BRO A;  2QYO A;  2V9V A;  4P9U A;  1OYI A;  1R7J A;  3MAJ A;  4BAY A;  3DKW A;  2IA2 A;  3FM3 A;  1UHM A;  3MEX A;  4I0B A;  1UHW A;  1DDN A;  1ZAO A;  2QVO A;  4HOB A;  4U0V A;  4TV7 A;  2EFN A;  4Q5S F;  2HTJ A;  4N9I A;  2IRF G;  4RAY A;  1YS6 A;  2RGV A;  5D6F A;  5LRR A;  4PGH A;  2PQ8 A;  2YU3 A;  3ELK A;  1LEA A;  2Z5U A;  3ZP5 A;  2DO7 A;  4WXH A;  5FGM A;  2V1D A;  1HQC A;  5LHH A;  1Z7U A;  5CYV A;  4EQQ A;  3J81 Z;  4PGG A;  4LB6 B;  1ON1 A;  1DPU A;  2K4B A;  5IT3 A;  3IKT A;  3KZZ A;  1G3W A;  2DW4 A;  2X4H A;  4HBL A;  2ZFW A;  4I2O A;  3RPQ A;  1IUY A;  3HTS B;  1O57 A;  4HX7 A;  3HRT A;  1B9M A;  2WV0 A;  2JT1 A;  2EWN A;  2DLL A;  3QPT A;  5K5Q A;  1E2X A;  4EV0 A;  3JAM K;  3DFG A;  3F3X A;  3CDH A;  3C7J A;  3WU1 B;  4I98 B;  1QBJ A;  2KIU A;  4RB3 C;  3E97 A;  2X0L A;  1XGN A;  4EJV A;  2XGX A;  3MQ0 A;  3FX3 A;  1UCR A;  3RJP A;  2W57 A;  4IVN A;  4A0Y A;  3DP7 A;  1TTY A;  1MJA A;  2HQR A;  2FSW A;  3RI4 A;  1S7O A;  4UNO A;  5DCF A;  1PP8 F;  1U8R A;  3V7R A;  3WG9 A;  2OZ6 A;  1CF7 A;  4OMY A;  3QP5 A;  2VBY A;  5BOX A;  3CJN A;  5D5W B;  5CJ9 A;  2JPC A;  3KLO A;  1FYM A;  2QZ8 A;  4RB2 C;  2XRO A;  3V7S A;  4HQE A;  4OIP F;  2M45 A;  5JR3 A;  2Y75 A;  1P92 A;  2IPQ X;  3WGH A;  2GA2 A;  3L2C A;  1KQ0 A;  1O3S A;  5BS6 A;  5LHG A;  2FBH A;  1B6A A;  3R6S A;  4HAM A;  1STZ A;  5JVT A;  1AOY A;  5D5V B;  4Y15 A;  4F7Z A;  2FNP A;  1TQP A;  5F64 A;  3I54 A;  3VOE A;  2D2W A;  3C1D A;  3V7C A;  5ILU A;  1YG2 A;  2KRF A;  5L3C A;  2ZCW A;  5LBQ A;  1TNT A;  4OIQ F;  3AAF A;  1XSX A;  1E17 A;  3TQN A;  3HIF A;  4AD9 A;  1LDD A;  2EV0 A;  4EM0 B;  1KU2 A;  2R3S A;  2D1H A;  4BH9 A;  3KLN A;  3BJO A;  2FOK A;  2IP2 A;  4CZZ A;  3ZN1 A;  3IWZ A;  1D8J A;  1OPC A;  3KEQ A;  1EH7 A;  4EJU A;  3KEO A;  2V1U A;  2OD5 A;  3DV8 A;  3HSR A;  1ZLJ A;  3F8N A;  4M9Z A;  1KA8 A;  3MZY A;  2JRT A;  2MC3 A;  2DBB A;  3RYR A;  5DDG A;  4HYE A;  5AON A;  1BIB A;  5L3B A;  2FEZ A;  3ZMZ A;  5L3G A;  2FXA A;  2ZBK A;  1FBU A;  2E1N A;  4L5I A;  3FM5 A;  5L3D A;  2L02 A;  4H0E A;  2HOE A;  3K2Z A;  5HS7 A;  1WKM A;  1FT9 A;  4G6Q A;  2QQ9 A;  1XDS A;  1YYV A;  2XV4 S;  3VEP A;  2NNN A;  3KP6 A;  3JAM Z;  4ZZL A;  2NS0 A;  4KMF A;  1JE8 A;  2K86 A;  4XBF A;  3GYH X;  3KP4 A;  5HS9 A;  1SMT A;  2RV8 A;  5D4R A;  4RB1 A;  1LJ9 A;  1YTY A;  1AWC A;  3R0A A;  3ZMD A;  3R4K A;  3QAH A;  2P7C B;  3E5Q A;  5ICF A;  1YW8 A;  4WK8 F;  3QOP A;  1W5T A;  1B59 A;  2HZT A;  3ABU A;  3HRU A;  4ZH4 F;  2BBY A;  3ECH A;  2EFO A;  2Q2E A;  2ESH A;  2VOD A;  3FMS A;  3GO5 A;  2P5K A;  3E6B A;  2KIM A;  2OZU A;  1LDJ A;  4LD5 A;  2J5P A;  2G9W A;  3FMQ A;  3K0L A;  4EJW A;  3NQO A;  2ZKZ A;  1XDU A;  4ESB A;  2NRA C;  3N97 A;  5L3F A;  4A12 A;  1U2W A;  1J5Y A;  2HDC A;  3P7N A;  3G3Z A;  2A61 A;  2XIG A;  3WTW C;  3BJA A;  4MTD A;  5ILV A;  4EGY A;  3LA3 A;  3GZ6 A;  4NQW A;  3E5U A;  1I1S A;  2FMY A;  3FWE A;  2E7W A;  1HW1 A;  1FYL A;  3T5X A;  4FX0 A;  4PDK A;  2NAZ A;  3SZP A;  4O5V A;  1SD5 A;  2EV5 A;  3RTR A;  2V79 A;  5CVI A;  1W7P D;  5AIQ A;  4B8X A;  3F8F A;  1XGS A;  3WOD F;  1V4R A;  1XB4 A;  4M9S A;  5BPD A;  1IRF A;  5DV5 A;  5HVQ C;  2Z3Y A;  3HOT A;  1XN7 A;  4FHT A;  1GVJ A;  4R79 A;  4ZYH A;  3CUQ A;  1ON2 A;  2DT5 A;  3TKY A;  4EGZ A;  1J59 A;  4HLY A;  2W85 A;  5ILS A;  3SFZ A;  4CIC A;  1U78 A;  4P9F A;  2VC1 A;  1OR7 A;  1JXS A;  1SFU A;  5EEG A;  1SD6 A;  4XLN F;  4XSX F;  2B0L A;  3TOB A;  2EV6 A;  1J7K A;  3GVA A;  4ZYG A;  3RPU A;  5E17 F;  4IHT A;  2DTR A;  1BI0 A;  5LGT A;  1HSJ A;  5AIP A;  5JFR A;  1XGO A;  4S04 A;  3QRF F;  2VN2 A;  1RNL A;  1R5H A;  3JSO A;  5HOO A;  5FD6 A;  3GX4 X;  2R7F A;  2XUB A;  3FXU A;  4IJA A;  4KYW A;  1NHA A;  3LA2 A;  3GZ5 A;  2LF7 A;  2DPU A;  1Y0U A;  4JK1 X;  1OKR A;  1ZAR A;  3GFM A;  3TOA A;  4I0A A;  3I58 A;  4CGZ A;  4HA8 A;  2XRN A;  2W25 A;  2STW A;  4HV5 A;  1J75 A;  5HLI A;  5ED4 A;  2DK8 A;  4L18 B;  1S6L A;  4HW0 A;  1ONV A;  1EH8 A;  3K1M A;  1YW7 A;  3Q9V A;  2H27 A;  2K27 A;  3COA C;  1S7A A;  4UVC A;  2P7V B;  2H6B A;  4A2U A;  3V8J A;  1BI1 A;  3L09 A;  3CUQ C;  1F1Z A;  3F8B A;  3JTG A;  1D8K A;  1TBX A;  2V1X A;  4HV6 A;  3K1P A;  3PQK A;  2QM3 A;  3GEZ A;  2QQB A;  2MLK A;  3HSE A;  4EJO A;  2EFP A;  1O3R A;  2XAG A;  1MZB A;  4BHC A;  1FYK A;  2A68 F;  1JHH A;  3BDD A;  4BYY A;  1YW9 A;  4I01 A;  2PEX A;  3ECO A;  5HDG A;  5H6Q A;  2JSC A;  2A6H F;  3U2R A;  2UWM A;  1T6S A;  2O3F A;  5L3E A;  2IJL A;  1R1U A;  2CFX A;  3JSP A;  1VTN C;  1R1T A;  2XAJ A;  3I5U A;  3FXR A;  1EV7 A;  3WTX C;  4IXA A;  3LFK A;  5CVV A;  1TQI A;  3HHH A;  1I5Z A;  1YLF A;  2GIV A;  1F5T A;  1QGP A;  4ASN A;  1FC3 A;  4N0B A;  3FZV A;  1RI7 A;  2IW5 A;  4FX4 A;  5BMZ A;  2DPD A;  1USS A;  1DP7 P;  2ACJ A;  1H0M A;  4MEY F;  2BGC A;  2HYF A;  3I64 A;  1QNT A;  3LQQ A;  1IN4 A;  1MDM A;  4OMZ A;  3IRR A;  2PMU A;  3D5L A;  2ZNZ A;  5BQT A;  1BC7 C;  2A07 F;  1HW2 A;  3HUG A;  4HX4 A;  5E20 A;  4HF1 A;  2FA5 A;  3WTZ A;  5LRS A;  1ZGJ A;  3GUD A;  1U3E M;  1KQ9 A;  3TDU C;  2NNY A;  1OMI A;  4EJT A;  2M87 A;  4M71 A;  4CO8 A;  2IVM A;  1FNN A;  2UZK A;  2M8E A;  4ESJ A;  2M5W A;  5J6X A;  4KMU X;  4KIF A;  3ZMU A;  2MD5 A;  1ZYR F;  1IN5 A;  1R00 A;  5TRD A;  4A5M A;  5J8C A;  1GXQ A;  1UB9 A;  1IW7 F;  5JI6 A;  4P96 A;  1I6X A;  2QBY A;  4FT8 A;  1A04 A;  3GFI A;  4I7H A;  1BIA A;  1REP C;  2L54 A;  3MCZ A;  1U5T B;  2VBW A;  3J80 K;  2VE9 A;  4HX8 A;  3OOP A;  4EM1 A;  1LVA A;  3GWZ A;  4XLP F;  1ZRF A;  1DUX C;  2BYV E;  4M73 A;  1T38 A;  3IWF A;  3TO6 A;  2HFH A;  1SFX A;  3KE2 A;  1P4W A;  4OOI A;  5A2Q Z;  1QZZ A;  2PBI A;  1XGM A;  3JTH A;  2ESN A;  2ZME B;  4QLC U;  1O3T A;  5FB2 A;  2VE8 A;  5CVR A;  3F6V A;  4LLN A;  1FBQ A;  3MWM A;  2P6S A;  1GXP A;  3RKX A;  1SMY F;  4A6E A;  1FY7 A;  1HST A;  3EYI A;  3WE3 A;  4U0Y A;  3BWG A;  4RB0 A;  4OIR F;  4MQ9 F;  1ZRC A;  2FML A;  1ZG3 A;  1K6O A;  4ZYE A;  1D3Y A;  4WCG A;  3BPV A;  4WXD A;  4ESF A;  1ZHF A;  2P5L C;  5E8I A;  2ZXJ A;  1R58 A;  3V4G A;  3DPL C;  3WTV C;  3ZQ7 A;  4O6J A;  2IA0 A;  1ZH5 A;  4UV8 A;  2ELH A;  3MZH A;  4GO1 A;  2DAO A;  4UHT A;  1YO5 C;  1QZY A;  3K9T A;  1R23 A;  1SD7 A;  1J2X A;  4RS8 A;  3C3W A;  4AIH A;  1ZG5 A;  4LK1 F;  1S8N A;  2GQQ A;  1P4A A;  1KU3 A;  1BI2 A;  4L9T A;  4RGU A;  2L01 A;  1FLI A;  1D5V A;  2XAS A;  3ULQ B;  3WU0 A;  1ZRE A;  4LMY A;  4GXO A;  3V8L A;  4M74 A;  1ULY A;  1FOK A;  1L0O C;  5FD5 A;  4R8H A;  3EDP A;  1HKS A;  3WGI A;  5DCM B;  3GFL A;  5DD8 A;  1ZN2 A;  2GXG A;  1FSE A;  1WWX A;  2E1C A;  4RGR A;  4IF4 A;  3RYP A;  3FHZ A;  2DQL A;  1V3F A;  4GYI A;  4ETS A;  1K78 B;  1P2F A;  2ZJ2 A;  2YX7 A;  4QWQ A;  2KJC A;  1S29 A;  2MH2 A;  4WWC A;  1F4K A;  3RDI A;  1IN8 A;  2WC2 A;  3KP7 A;  4Z2Y A;  1YS7 A;  1UFM A;  5HLG A;  3U9G A;  1BN5 A;  2LNB A;  2RNJ A;  3IKV A;  4LFU A;  3I0T A;  3MFK A;  3IL2 A;  1IXR C;  1U6G A;  1PDN C;  3GFJ A;  3E6D A;  1MJ9 A;  3J80 Z;  1MJB A;  3GW2 A;  2Z9O A;  1IAW A;  2F5D A;  4IHS A;  4BQA A;  2QUF A;  3P9C A;  5DEQ A;  3EUH A;  3K1N A;  3EET A;  2PG4 A;  1P4X A;  4A0X A;  3ZPL A;  2F5E A;  4Y17 A;  3GF2 A;  3PFI A;  4BHP A;  3S2W A;  3F6O A;  4GYG A;  3PQJ A;  2C6Y A;  2PN6 A;  4U7B A;  4HZF A;  2P6T A;  1PUE E;  5FFX A;  2A3S A;  4MHG A;  1QQI A;  2FU4 A;  3M8E A;  3WTS C;  3W6K B;  2EFW A;  5HS8 A;  1Z1D A;  2XKO A;  5HLH A;  3F8M A;  3V8K A;  2M1B A;  4KN7 X;  2RQP A;  2MA3 A;  1X3U A;  1FWZ A;  1XCV A;  1QO0 D;  2RC4 A;  4LLG F;  4R1H A;  2G7H A;  4LG0 B;  1J9I A;  2WWY A;  2OQG A;  2VBX A;  2KIF A;  1W5S A;  2BEO A;  4A6D A;  3J7A O;  4LK0 F;  3E6M A;  4IPA A;  1TW3 A;  3Q9S A;  4WX9 A;  5BPI A;  2O61 A;  1CF7 B;  1BM9 A;  4U7D A;  1FZP B;  5CLS A;  5IT9 K;  2CWE A;  3LAP A;  3WGG A;  3SXY A;  3JW4 A;  6PAX A;  3WE2 A;  2K7L A;  1R36 A;  3I4P A;  1IXC A;  4Y13 A;  1H9T A;  4B09 A;  2XHK A;  3BOQ A;  3WTY C;  4MQV A;  1ZLK A;  1XSV A;  4L5J A;  2G7U A;  4M72 A;  2FE3 A;  2D45 A;  1RUO A;  3TO7 A;  1K79 A;  4G9Y A;  2WTE A;  4AVP A;  4ENN A;  4YIF A;  4L0Z B;  3ISP A;  3HOS A;  2Y48 A;  4WF2 A;  2YPR A;  1XMK A;  2HGC A;  1KYZ A;  2RKH A;  3I71 A;  2KJB A;  4MEX F;  1O7F A;  3TDZ C;  3SHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...