2JUCA

Urn1 ff domain yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DIDERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the yeast URN1 splicing factor FF domain: Comparative analysis of charge distributions in FF domain structures-FFs and SURPs, two domains with a similar fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Pre-mRNA-splicing factor URN1
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2jucA00
1UZCA 2K85A 2DODA 2CQNA 2DOFA 2LKSA 4FQGA 2E71A 2KFDA 2KIQA 2KISA 2L9VA 2DOEA 2KZGA 2B7EA 2JUCA
chains in the Genus database with same CATH superfamily
3MZ8A 2K86A 4UVBA 1P7JA 3C2GA 2O8XA 4AIHA 1B8IB 3HUGB 3BP8A 5FJ8J 3CCMI 4G7HF 1WI3A 2ZCWA 2ZMEB 3BG7A 3L7WA 4M3DA 5K7HA 1YW7A 3GTJJ 3TO6A 2BGCA 4XLNF 4J19A 2HGCA 4RDUA 4A3KJ 3DFGA 3FMRA 3QU6A 2FOWA 2CQQA 4RGUA 3S2WA 2F5FA 4N4OB 3P9IA 5FKOA 3H9JA 2CUFA 1O3QA 3S15J 5F0CA 4IKFA 3DBLB 4CCLA 2X85A 1IV8A 3DEUA 2R7WA 2RNJA 2HR3A 4O5VA 3GXOA 4BE1A 2F6CA 2XDVA 3KEQA 2KQRA 2VJJA 2P8TA 3NQOA 2PJRB 3GYHX 2HFHA 2F5VA 2HDCA 2IRFG 4H4KC 2F5EA 3CJRB 5DTDA 1DGRM 3DTEA 1JKOC 4I99C 5EDNA 3NAUA 4L5JA 2RNGA 2XSJC 4IX7A 2DOFA 3QOEA 5J4VA 3QQAA 2BW3B 2EB7A 3J80Z 4NQWA 2HOSA 1IUFA 2KDZA 4HEA2 3OL4A 4ENKA 2Y0MA 4CH7A 2PMZN 1MBHA 2AQEA 3FF5A 5CVJA 3F0CA 2VXZA 2AHQA 1VQ4I 3IRQA 1W36D 3WU1B 3EDPA 2WV0A 3ZMTA 2BBYA 3DBRB 5H6RA 3B73A 2JN6A 4CO8A 3SDGA 5M5XJ 1IN6A 4DJAA 5BOXA 2DODA 3TP3A 4IQJA 3KP5A 3RKYA 3MKWB 3OYEA 2P6SA 3ML6A 4HDVA 1W5SA 1UMQA 3AG2H 2LF8A 1LFUP 5E17F 3Q3SA 2M34A 5B1AH 2ACJA 3WTZA 5CVIA 2HQNA 3IH4A 1QO0D 1TZLA 3LSIA 2XPVA 2K3PA 3JRHA 2DCEA 3H5AA 4BEHB 2OTJI 2H1KA 4EJUA 1FMVA 2LNBA 3K69A 2MC3A 1FTTA 3ECOA 1GXQA 3U9GA 3QYEA 4K2EA 1KU7A 1WCMJ 2N8GA 2G0EA 2E71A 4RB2C 3FXQA 4P1WA 5E8GA 2NVQJ 2XPWA 3JRDA 5FO5A 3OSGA 2BZTA 2LY1A 5K5RA 3LQRA 1DP7P 3GTMJ 1SD5A 2IA1A 3C7JA 3H9GA 3S3OA 2EA2A 1IAWA 2DJNA 5CLSA 1W5TA 3FHZA 1H9GA 4XKWA 3C3WA 4BJ6C 4DIQA 1A6IA 4UVCA 2E2HJ 2E1NA 3S1RJ 1LEBA 2R5YA 4QLCU 3OV8A 1H88C 1QVUA 2CFOA 1YIJI 3LSJA 4PJMA 1JKRC 5FKMA 1APLC 3K6GA 3R61A 3LSMA 3CJQB 1E0EA 2X48A 5GTIC 2CG4A 2VBYA 1BOAA 2XAQA 2IJLA 2QA4I 2LVSA 4B43A 2LY9A 3SJMA 2HYJA 2ZNYA 1DDNA 1TWHJ 4M9ZA 2W25A 1OISA 3IUOA 2WAEA 5EEAA 1MSEC 1HA8A 1Z7UA 5J1RA 4HAMA 1IG7A 5DM6F 1D0ZA 3BR2A 3K2AA 2QKLB 3J7AY 1HKQA 4RGSA 1FY7A 3BTLA 4P9FA 1BW6A 4KIFA 4BQAA 1N78A 2A69F 1MDMB 1T95A 5IYBJ 4PJ0C 5C44J 2DOAA 4XBFA 3E7LA 1I5ZA 1DU6A 3FK6A 4C9YA 2L7FP 3L2QA 3QP5A 1WH7A 4BU2A 1ETOA 2DA7A 4XRSG 3CESA 4KICA 3RKWA 3GX4X 4ZDOA 1HW5A 3RKQA 1I50J 2DQLA 2RDPA 1SAUA 1JE8A 2LP0A 2WTEA 4U87A 5E3OA 4Y4RA 2DA5A 2CQ7A 3ABMH 5E3NA 1SFUA 2WY7Q 3CMYA 1HKSA 4E7KA 1IZ1A 4CXFA 4UNOA 1J59A 1T0FC 5A2QZ 2VLAA 4CCMA 3S3MA 2STWA 4A3CJ 3L2CA 1R5HA 1K78A 3ZQIA 3WGGA 3HDDA 4PJLA 3EYYA 2L4AA 2CMPA 3V4GA 3OYLA 1OCZH 2KRHA 2HKXA 3OYAA 1XGOA 2NVYJ 2P81A 3G3ZA 2ZJQF 3OYHA 4PZJA 1IJWC 2RQQA 2IGOA 4LOCA 4BE0A 4F7ZA 5IOYA 4CYCB 4PUSA 3Q5FA 4ZTFA 2XB0X 2AXLA 2BY2A 1LE8A 3HRMA 3LNQA 2CQKA 3G1OA 3LSGA 3FMQA 2HXOA 2HPIA 3UR3C 1T38A 1U8BA 4CSWA 2LRDA 4PFPA 3FKJA 2XPUA 1IC8A 2LTPA 3GTGJ 3B6AA 5LRSA 1MGTA 1FC3A 1N77A 2L5QA 3NWSA 4B48A 2DYSH 2PFBA 3PNYA 3QWLA 2ZB9A 2R7OA 4N9IA 2R5ZB 1CGPA 3A01B 3BDDA 5BMZA 5L3DA 3JRBA 3F21A 2XASA 2OA4A 2IW5A 1BI0A 2VPRA 4HBLA 5LD2C 4HQEA 3GTOJ 1LJ9A 2HOEA 5FROA 2HEOA 4V2FA 4XR6A 1K7AA 4R79A 2DFEA 4MGRA 4O6JA 3SFZA 4CZZA 2FJ1A 4P9UA 4V2GA 2COBA 2CJJA 4AVPA 4M9XA 3GEZA 3KYCB 1SEUA 2Q2EB 2KL4A 2VBWA 4UUSA 4JX6A 2DO7A 3FXOA 1I27A 1UCRA 3KYLA 2QCOA 2ID6A 5JLXA 1YIOA 3TO9A 3OS0A 1R6RA 1A04A 2LSOA 3OIPA 3BZKA 4II2A 1W4MA 1X3ZB 3D5LA 2LKPA 1R00A 1G3WA 1ZGAA 5HDGA 1IGNA 2JT1A 1BI3A 4G6QA 4B3XA 1FX7A 3O2PE 1ZARA 2CH0A 2W85A 3FXJA 1EF4A 3L2UA 1P2FA 2M5WA 4M72A 5FKKA 3M1CA 3L9FA 3M8FA 3CMEI 2J5OA 5FGMA 2PEXA 4M3BA 2LMDA 3ERMA 2O7OA 4M3GA 3U1KA 2OCEA 4I02A 3IKTA 4L5EA 4ZYDA 2RQPA 3W2WA 4E7LA 1Z67A 3CO7C 4ESJA 1T8IA 3FBNB 4HSRA 2LR8A 5F1RA 2JA8J 1R1UA 3TGNA 3OMYA 4DBRA 4JX4A 3OS2A 1SFEA 4KT5C 5LEJA 4HV5A 1R23A 5FD5A 2ICWG 3GF2A 4FX0A 2L7MP 5F0HA 4M3EA 2W48A 2CYYA 3ZPLA 1MNDA 4U0WA 1X2NA 1U78A 4JYKA 1DP3A 1J7KA 4UUVA 1FZPB 2M3AA 2XIGA 4DOZA 3ZMZA 2Z9OA 3DU6A 1YFHA 4CDGA 5M3FJ 1X4PA 1I1GA 1QHGA 3S2DJ 1D5VA 3JREA 1X1BA 1DUXC 2O3FA 1ZHFA 4C2TA 3GZ5A 1XGNA 4AU7A 3HTUA 2JVGA 3K4NA 3KEOA 1JKQC 2JK3A 2PBIA 2RN7A 2W00A 4EGYA 4ESFA 2JPCA 2RREA 5HOOA 1XMXA 2MLKA 1ZH5A 1Z0XA 1FWZA 1TNTA 5J1YA 2XF5A 3I55I 3RZOJ 3PM1A 3BR3A 4IZZA 1G3SA 1K6YA 3M07A 3GZ6A 4FETA 2VONA 1REPC 1AOYA 3HSRA 3DPLC 3K1PA 1WHUA 4BDZA 2DK8A 4NB5A 1K4TA 3AG3H 5EEGA 1TW2A 5DDGA 3O3KA 1FIAA 3BY6A 1O3TA 2JWTA 1O3RA 4HF2A 4G6TB 3OS1A 3S1NJ 3OYNA 3KLOA 2QEXI 3I58A 4IL6C 4B1RA 3N05A 4KDPA 1S9HA 2VIXA 1B4AA 2LLKA 3MZYA 3V8KA 4ZYHA 3BCBA 3H0GJ 2ESNA 1F1ZA 1KA8A 2IS1A 1JT6A 4KYWA 4H0EA 4B09A 2FOKA 2A6EF 4KJZA 2IPQX 3OYIA 4EMSA 1YQAA 1ODDA 1FBSA 4XORA 3RZDJ 1LEAA 2VUMJ 3QAHA 5L3EA 1GVJA 3I4MJ 3F8MA 5ICEA 2DW4A 1ZGWA 5E1WA 2X51A 4AIDA 2CS3A 2JUCA 2PLYA 2D2WA 5FLXZ 2R7VA 2RAEA 1U8RA 2LY2A 1FTZA 3Q0UA 3RPQA 5AONA 3WTTC 1ZGJA 1WGXA 3W6VA 1WVRA 2UZKA 5KCMA 1K4SA 5E3LA 2IGMA 4ESBA 2DU9A 4ASNA 3K7AJ 2VL8A 4EGZA 1UJ8A 2R7RA 2VT2A 4LK1F 4RAYA 2LF7A 2DTZA 4LLLA 4L0ZB 4LMYA 2VT3A 1A6QA 1LE8B 3RI4A 2JA2A 2KKOA 3D5RC 2VBXA 3R0AA 4KA4A 1T39A 4U0VA 2YS9A 4WWCA 3ZQQA 1VQ7I 1OCCH 4DQ2A 1HDPA 2RV8A 3I9V2 4II3A 4CICA 1VQKI 1RUNA 1UZCA 2M45A 1TQMA 1S29A 1O7LA 3SYTA 1BC8C 4LFUA 3F72A 2FRHA 1R5GA 4MEYF 4PSXA 1EH7A 2K40A 3DPTA 1S8NA 2K7LA 2DLLA 3S32A 2X1EA 1S72I 3DKXA 4DZJA 5EGOB 4BBSJ 2EIMH 4KIBA 5CVUA 2E2IJ 3T0YA 1Y0UA 1IDZA 3KZIC 4Q5SF 1P7IA 3CF5F 1RIOH 1TNSA 3H5RA 3ZMDA 2E1MB 4ITVA 2X6YA 1WZ2A 2K9SA 2ID3A 2UXXA 1EH6A 4L9TA 3LMMA 5LGNA 4IHSA 1WJBA 3TDZC 2A5WA 1ZG3A 2Y69H 2M4KA 3AL0B 4HX4A 5LHGA 2OAZA 4QWQA 3GTQJ 4XLCA 4ETSA 4NDLA 4NC8A 1GXPA 4HV6A 4QIWN 1RR7A 1IRFA 1FBUA 2FU4A 5BPIA 1XSXA 1TQPA 3FHNA 3I53A 3IC7A 1Y1WJ 1AWCA 1U9OA 3GFMA 1TQIA 2VKDA 3IV5A 5IT3A 4LLNA 1R58A 2YPRA 2IXSA 1K6OA 1X4OA 4A0YA 1G2HA 3V7SA 2L9NA 3FK7A 4BE2A 1YS6A 4M6XA 5TISC 2E60A 1UG0A 3CCQI 1OKRA 3JAMZ 2ZO4A 1FYLA 2CFXA 4C3IJ 4ZYGA 4IF4A 5LLQA 4MQVA 3SDBA 2VE9A 5C4JJ 1XCBA 3JRFA 4BL0B 2BYVE 4BKXA 2F5CA 2G7UA 3BCAA 3VEPA 4CYDA 1NG6A 1QNTA 3CDLA 1S6LA 4A3MJ 4KMFA 2HQ5A 1AKHB 1NG7A 2ZXJA 2QUFA 5KHDA 1QBJA 2VODA 1SC7A 1MKMA 1XTAA 1BN5A 4DW6A 1YOVB 2LFBA 1LPQA 3TKYA 3TDUC 1O4XA 3VDXA 5FD6A 2DA3A 5GADJ 3QPSA 3SXYA 2Y31A 4GGGA 3CUQB 4CCKA 3BJ6A 3KP2A 1ZREA 1D1AA 3MCZA 4N4NB 1C0WA 2XAFA 3KLNA 3LSRA 2B9SA 2DA4A 2R5YB 2QQ9A 1J9IA 4XMYA 3DTKA 4XLPF 1R71A 3S17J 3BQZA 5IY5H 4FT8A 2A6TA 3CTAA 2OPTA 2M1BA 2QSHX 3DP7A 3KP4A 3H35A 2K9MA 2CV0A 3AG1H 3IWZA 4XLHA 5D6EA 3CLQA 2WV1A 1SD4A 2BY1A 4RM3A 4EM2A 2KMUA 4MNUA 2LREA 2FQ3A 3IP4B 1PUFA 3BOQA 2CGPA 1WH5A 2ZC2A 1B1BA 3JTGA 3F23A 3KZZA 2GXAA 4WK8F 2PMZA 3HIFA 5LRRA 3SZTA 3S93A 3RJPA 3I4NJ 5JVTA 4EQQA 2WB1A 1IXSB 2WY8Q 1UFMA 3VSKA 2R7SA 1GV2A 3TQNA 4BAYA 4MIMA 3CMMA 2P7VB 2GQQA 3BC8A 3DPUA 4AUXA 4HDUA 1ZG1A 2HTSA 4OMYA 1Y1VJ 4BHCA 3M4OJ 1S7OA 1HXDA 2OZUA 1D8JA 5F6FA 4LB6B 2HYFA 3HOZJ 2HS5A 1GT0C 2D5VA 1JJ8C 1IRZA 2IBDA 3GTPJ 1PP7U 1H89C 5EG0A 3F8BA 1V5FA 2VBZA 2Y2ZA 2WB1N 1O57A 1YE9A 2CUZA 4YIIA 3K9TA 4A3DJ 3HKZA 4ZH4F 5B5EC 2YU9J 3OR1C 4NUBA 1HF0A 4J00A 1LQ1A 2ZMEC 2R7ZJ 2QSFX 4WCGA 2R5ZA 1D5YA 3OYJA 3E1SA 1Y39A 3HSFA 5GTHC 5IYDJ 1OPCA 2V1UA 3REOA 5FFZA 3FXRA 4BDYA 1YTYA 2RC4A 2VC0A 1SVOA 4PGHA 4BGDA 3CCLI 4C2UA 2PMUA 1FOXA 3FXKA 4D0PA 1KU9A 1LFPA 1QVTA 4KT6A 1BI2A 1R22A 3GO5A 3RKXA 4D9JA 4YFKF 4S04A 3CCJI 2HI3A 4UVAA 1I6XA 3DTIA 3CUQC 5IT9K 3PL8A 1IUYA 3MN2A 4YIRX 2OQRA 1HOMA 4ANJA 5HLHA 2RKHA 2L9SA 3OYFA 4QTRA 5ED4A 1JUPA 4E70A 1JT0A 1R4NB 4ENNA 3HEFA 3K4BA 4RB1A 4IOCF 2PX9A 4YIFA 4ZZDA 1NHAA 2W82A 4RLQA 1RESA 1VQ5I 1J5YA 5IP6A 5DUKA 3V8JA 2O03A 3ZP5A 2MW8A 3K1NA 1FJLA 3EYIA 2B7EA 1UG2A 2AQFA 2XGXA 3WTUC 5JLWA 3HGYA 2EIKH 3LFKA 2L54A 3HOWJ 4ZC3A 1L0OC 5DCMB 2KIQA 3SEZA 4HX8A 1BW5A 3L2WA 2KZGA 3DCFA 3RPUD 3VPRA 1D0XA 2HPMA 1R5ID 1PUFB 1D1CA 1V54H 1A36A 2FUG2 3EUKL 1VQOI 2HU9A 1YX3A 2FXAA 4IRHA 1MZBA 1JUMA 3E3VA 2HOTA 1FYKA 1MIJA 4D7NA 4WXDA 2H8WA 1P4AA 2QZ8A 2Z5UA 1P4WA 5F27A 4Q48A 2D1VA 3PQJA 1ZN2A 3PJRA 3MZHA 3UNGC 1FOKA 4Q47A 2BVMA 4PSWA 1FIPA 1M1EB 4KITB 4I2OA 1BIBA 3HG9A 3ASNH 1LDJA 3ZMVA 2IGKA 2MFZA 4X1EA 2R7FA 1RZ4A 4I0AA 4Y17A 3LWFA 3SFIA 4BH9A 2XAHA 1QZEA 5TRDA 1D0YA 2BW3A 1XGSA 2R7UA 5CYVA 3R4KA 2DMPA 1QRYA 4LK0F 3ZRGA 1U3EM 3A0HC 3FXLA 2H27A 1MNEA 1W7PA 2ESHA 3A4CA 1KGSA 2V1NA 2CUEA 1IRGA 4N9HA 4XN0A 2ZXWH 2V79A 1VQPI 1J2XA 2JQ7A 3GW2A 1WJAA 5HS9A 2DT6A 3L00A 1PP8F 4E4HA 2KLOA 4M73A 2BOLA 3WU2C 1QHHD 1X3UA 5IOZA 4S0HB 1E17A 1PVEA 3VOEA 4Z6YA 4ZZLA 2UXNA 2JRMA 5L3GA 5EF6A 4HNVA 1KU2A 4GRIA 2V9PA 4RGRA 2IVMA 4RAFA 1SD6A 4G8XA 2COMA 2VN2A 3ABTA 4X0GA 5JI6A 1CQTA 4A3BJ 2YX7A 1MH4A 2DFIA 2EFNA 4FASD 3T1BA 4I0BA 4XIDA 1SVLA 5D5VB 2H6BA 4XLEA 2FMLA 4A6EA 1SANA 1YS7A 4FISA 2Q1ZB 3TP0A 1FT9A 4GCVA 4G9YA 4A3EJ 3CCEI 3CO6C 2CWEA 3LSTA 2K02A 2Y48A 5ICGA 1YI2I 3DXJF 1W36C 1ZLKA 2XV4S 2L0KA 1MJAA 3GMEA 2GA1A 3U1DA 3OIOA 4FX4A 2XUBA 3RSNA 2E2JJ 1OQYA 1G8XA 3BJOA 3OYDA 3IL2A 2EA4A 2OBPA 4I01A 4KN7X 5B66C 4WXHA 4XL9A 2IGNA 2QSGX 1FOYA 5LHHA 1BR2A 1BC7C 5DCMA 3OL3A 5DD8A 3HHHA 4JOMA 3MEXA 3K4LA 5GAEJ 2MG4A 5E1XA 1SMTA 2VPLA 4EM1A 4ENJA 1Z05A 4F52A 4XICA 1KQ8A 4XKVA 2BVLA 2K85A 3LSKA 4IVNA 4BHPA 1DPRA 2HDDA 2OF7A 4BEHA 2EV0A 1IV6A 3BR1A 4HPQA 1E3OC 2KT0A 3E6CC 2BE5F 2YU3A 3QYBA 3ZQFA 4HLYA 4DZPA 4RM2A 1UHMA 5DS9A 2O0YA 3CC2I 4HLXA 4A0ZA 5AIQA 1OCRH 1AHDP 2FMYA 1FPQA 4I76A 3P5JA 3ZCOA 3Q0WA 1L3LA 4DBQA 2JSCA 3PUFA 4RBOA 4ZDLA 3K70D 3OYCA 1HW2A 2NOGA 2ME6A 1G4DA 2HZTA 1LUJB 3FXMA 3I0TA 2A07F 4I7HA 2QF7A 2RGVA 3BPXA 3OOUA 2NAZA 4FE4A 4Y7NJ 2CV2A 1ZTRA 3S8PA 1BBYA 2A05A 3BTIA 1BR4A 1JTXA 2P6TA 3WTVC 3HKZN 4G6DA 1ZLJA 3QYFA 4XKBA 3TMOA 1EJ9A 2IS4A 1HQCA 2R3SA 1ITYA 3ECHA 2VJ4A 2R93J 1VI0A 1MMAA 1HC8A 1TL8A 1XDSA 4N0BA 1I3AA 4IEJA 3M9AA 4WX9A 1WJCA 3FMSA 2Z33A 3Q9SA 3HOYJ 3QPLA 4A3JJ 2K3FA 2PI0A 1X1CA 4NNJA 3PFYA 4P55A 4ZYEA 4DYRA 2ECCA 2NNYA 4AWXB 5LEKA 2KIMA 3HC7A 5FLMJ 2ZSHB 2NOJB 3DEEA 3GUDA 4OIPF 2CQXA 4XKCA 5HS7A 4D5FA 4J01A 2E1MC 2V4JC 1SFOJ 1FBQA 5D5XB 2MBFA 1ETKA 2FBHA 3CCSI 4F91B 2EH3A 2GOMA 3ZMSA 4A5NA 2PJPA 1B9NA 4DGWB 2E34A 1XMAA 3PNTA 3KZYA 1X3WB 2VC1A 2H6CA 3SZGA 5L3FA 2XKPA 1TP4A 2OTLI 5HDKA 2KPMA 3C2BA 1S7AA 5FKLA 2F5DA 2MABA 3FKIJ 5B1BH 4C2MJ 4ZDPA 1TWGJ 4WF2A 5TJJA 4FHTA 3JCUC 2JMWA 4BY7J 1X1AA 2GXGA 2DQRA 2V7FA 3B6CA 3ONQA 3QRFF 2EFQA 4I98B 4XM3A 4RB3C 1DQUA 1PJRA 3LA2A 4B4CA 1KYZA 1Z3XA 1AU7A 2V6EA 3PO2J 1FEXA 2MD5A 2HNHA 3BG5A 3DLAA 3EQLF 4LLGF 2A6HF 2XRLA 2X6OA 2M7BA 2DMUA 4JP0A 4PDKA 2D45A 1Y6IA 3BPVA 1EH8A 2EFOA 2L9VA 4TV7A 1NK2P 4CCNA 2DTRA 5F04A 3OWTA 3PIPF 2CW0F 2WAFA 2IEKA 5KAIC 1BM9A 3A03A 2R92J 4X6AJ 2KFDA 3GWZA 3ZOBA 2E19A 1MJ9A 4IJAA 3MMYB 2JUGA 4A5MA 5JHUA 1R36A 1WJ5A 3P9KA 1A35A 1POGA 2EV6A 4HX7A 1I3QJ 3LFUA 2EWNA 4EV0A 3M7GA 2LBFB 3CP2A 1IDYA 1IW7F 3KP7A 1WSUA 4A0XA 3VYSB 2HVSA 4QPOA 1S5LC 3JRGA 5LGTA 2X1DA 1Y8QB 5JVGF 1JUSA 3FX3A 5LHIA 1MBGA 2PJRA 3IAS2 4QSHA 4U0YA 3M1EA 1MMGA 3R6SA 1A5JA 1SFKA 1YW9A 5ILVA 4YRVA 2EV5A 2NS0A 2K9LA 3HOTA 1PYVA 1VQ6I 1WKMA 2M0MA 1JGSA 3EPZA 1USSA 2CUJA 2R4GA 5DV5A 1XC5A 2FA5A 3B02A 2YSRA 3ISPA 2CU7A 3I64A 4V19K 1KQ0A 2WBMA 3AAFA 1ZR4A 2OZ6A 3TO7A 5HLTA 1VNDA 3W3CA 3F6OA 3JSOA 2IA2A 2L7KA 1RUOA 4XOPA 1XMKA 1WI9A 2EK5A 2K4JA 1IO2A 5JR3A 2STTA 3HOUJ 2QQBA 4BS9A 3CJNA 4W97A 3DF8A 1YX5A 1YW8A 4LIUA 2V26A 4PK4A 1B72B 4DYQA 5F1JA 3F6VA 3J80K 3S14J 4AIJA 2XROA 2M2EA 3PSIA 1DGWY 4IRGA 4PCQA 4G12A 2HYGD 2Q2EA 4C30A 4MHGA 1BOBA 1K61A 2NXNB 3H5NA 3DU5A 3U2RA 3F22A 1MBEA 3CC7I 3D1NI 3HTSB 3BG6A 2V1XA 4YG2F 2TCTA 1U5TC 2P5KA 2A5YB 2IT0A 3S1MJ 2HQAA 3HPHA 2R7TA 1T0FA 4LD5A 1QGPA 3MKLA 3E0JB 1EKEA 5EZGA 4OIQF 3ULQB 3CJTB 2BXYA 2QQAA 5EEHA 4XLAA 3VYTB 2BEOA 1Z91A 3HL2A 4A3IJ 2GAUA 4E7ZA 3QPHA 5DEQA 4UV8A 1OR7A 2KRCA 3SQNA 2BXZA 4XRSA 1YO5C 2FNPA 1B59A 1MD0A 1V3FA 2IA0A 4HOBA 4P96A 3OSFA 1UB9A 1CF7B 9ANTA 4BQOA 5D8LB 2H1LA 5GPCA 4YELA 4BNCA 3ZN1A 3HXLA 5DUIA 5GAHJ 3MKZA 4I6ZA 2M7AA 4IPAA 3RPUA 4BJ5C 4MEXF 1TT5B 3PFIA 3W2VA 1UHWA 3RTRA 4XRMA 3F8CA 4ZTJA 1X1DA 5HLGA 1ONVA 1A31A 3TBIA 1ETQA 3Q9VA 1Y56A 3GFJA 2CQNA 4RB0A 3DKWA 4L9NA 2QVOA 4JX5A 1YRNB 1LNWA 2EJRA 1Z6TA 1ULYA 3C18A 4YEJA 2Z1DA 1Z3YA 2CW7A 1ERDA 2R7QA 3V7RA 1F5TA 3ESWB 4I09A 2BV6A 2L9RA 2TDXA 1G59A 2E35A 3WTSC 4FTHA 1I6HJ 1B9MA 1UELB 3A0BC 4UUSB 1VQMI 3RYPA 5BPDA 3DEWA 2I5UA 2QWWA 4UUTA 5FB2A 2V9VA 2PG4A 2E36A 4M6YA 4RA2A 3WHBA 1RKWA 2DK5A 3CQZJ 5FLXK 3CC4I 4RLFA 2LKXA 4JK1X 2GXBA 5F08A 2XGDA 1EV7A 3PUBA 1YJWI 3TOAA 3FIWA 2Z16A 2MH9A 2D1HA 1XSDA 1OCOH 1VQLI 4GO1A 1OMIA 1KZHA 2Y0SN 3I59B 2Y9ZA 1BA5A 1QQIA 3QP6A 5TGTA 4YFNF 1ZRDA 3U21A 2DA2A 3WE3A 4BQNA 3DBHB 1GV5A 2L4MA 5ILUA 4HNTA 4L18B 3AFHA 4UB8C 3CD6I 2B63J 1MMNA 4LGWA 1SMYF 1Z77A 3G1MA 3N97A 1ETXA 3LSPA 1GHCA 1STZA 1JHFA 2DT5A 3QODA 1LKXA 2FNAA 4B3AA 2B0LA 5CQEA 3BLYA 4LITA 2O5RA 1OR7C 4Q4ZF 2GLOA 1IXRC 3WTWC 1X58A 3H92A 3WTYC 1R1VA 2KJBA 1MNMC 3BG3A 2IS2A 1DPUA 6PAXA 1KU3A 2E1OA 4Y15A 5D5UB 3ZQLA 5CJ9A 2EPFA 3M3YJ 2Y75A 3P7NA 1RPWA 2KJCA 2DOEA 1NH3A 5J6XA 1H9TA 2R7DA 3LL7A 3KP6A 1E3PA 4C3HJ 2CW8A 5LGUA 2XC7A 1FYMA 1ZKGA 4BJTA 4L9VA 4OWRB 4Y13A 3J81K 3EETA 1XSVA 3BWGA 4PJJA 2YR2A 1B72A 1Z6RA 3DLLF 5D4RA 3DQVC 2OU2A 2LBFA 2DFFA 1TT0A 3GBGA 3WHCA 1BL0A 1FMWA 3KP3A 2ZJRF 1G3TA 5B3SH 3K4MA 2ISZA 1IRXA 3A1YA 1GVDA 4Y33A 4F55A 2MH2A 4XQFA 2XHKA 1S3JA 2P5LC 2XAJA 4EATA 2M8EA 3OR2C 1HW1A 4XSZF 3HRTA 3KPHA 3MQ0A 2Z2SB 5FFXA 4F3QA 1ZR2A 2O61A 2F48A 3PQKA 2X0LA 2DDAA 1B6AA 4A6DA 4UB6C 3BJAA 4DYCA 3HZJA 3V8LA 4AD9A 3MFKA 1U0JA 1K78B 2KIUA 3T8TA 4Y52J 4HZFA 4BACA 1XS9A 2F4OB 3HPGA 5EJCA 3KYDB 5BS6A 3M8JA 1F43A 1T08B 4HW0A 2X6WA 5HNFA 1W7PB 4EJWA 3S1QJ 3M8EA 3IWFA 2K5CA 3UKGA 5KVRA 1FSHA 5EYRA 2OD5A 5J8CA 1YJNI 1XD7A 4G7OF 2DPUA 4HA8A 1TBXA 1VZ0A 1HKTA 3G71I 2AO9A 2JVHA 3KETA 3COAC 3OY9A 3DKYA 4BHBA 3IKVA 3WG9A 3HRUA 4AIKA 1OYYA 2XRNA 3HJEA 3AL0C 4WXCA 3VSLA 3I54A 2GIZA 3BR6A 2DMTA 3RYRA 5IP7J 1F9NA 2WWYA 3BR5A 5CVRA 2NVTJ 1U6GA 5J40A 1FOWA 1Y8RB 4MFEA 3J7YJ 1SAXA 1P6RA 2OC6A 4HF1A 4AYBA 5FRNA 3O8GA 2F2EA 3F8FA 1OCPA 1Q1HA 1ZYRF 4EEFG 3EUAA 2FE3A 3GLXA 3LSHA 5EZHA 3TEDA 1RI7A 3K1MA 4ENMA 1MBJA 4P5OA 3FBIB 5DM7F 2XKOA 3CZ6A 2E7XA 3CUOA 2JTVA 2JZYA 3KCCA 2MA3A 1E3HA 2VOOA 4R1HA 1SVMA 4PFOA 1N25A 3OYMA 1TWFJ 4RS8A 5KAFC 2EZKA 4HF0A 4F93B 4M9SA 2LD5A 1X19A 4D5CA 1JKPC 1OFCX 4YFXF 4E7SA 5J8FA 3PSFA 1WRJA 1RETA 3KIOA 5K1YA 4HRIA 2OCCH 4CCJA 2LC2A 2MYSA 2VKEA 4KISA 3QU3A 2H09A 4B44A 3LAPA 4XK4A 4BUPA 1U2WA 3L2RA 2K4BA 1LVAA 3CCVI 2LKSA 1X2MA 2VI6A 2BY3A 2L01A 3K4CA 2OJED 3A2KA 3BR0A 2JPBA 3FWEA 3BZ6A 3WE2A 2QENA 4RAZA 2DPDA 5IT9Z 2FSWA 2X6XA 1WFXA 2HVQA 2HZDA 1TW3A 1XN7A 1YG2A 3MKYB 4M3FA 1VFCA 3GFIA 5F0FA 3MD2A 1RNLA 1J09A 2FEZA 1EA3A 3T5XA 2XAUA 1NTCA 2WC2A 2ZMEA 4L5IA 3K4KA 3FDYA 3WODF 3H9QA 3ZQGA 4IQ4A 1X1PA 2OV7A 4HG2A 2G7HA 1U9NA 3GLLA 4KN4X 1W0UA 3ZGKA 3E5QA 2V1DA 2ISYA 2HXIA 5IP9J 1XGMA 1TTYA 4O3MA 2YX4A 3O8HA 4FCYA 3PIOF 5E79C 1MMSA 4CUGA 1AA7A 2GZWA 2KRFA 1QA6A 5F64A 2I8DA 2NNNA 3K10A 4GYGA 1HLVA 1TC3C 4D7MA 2W1OA 2JSPA 3E5UA 2MSYA 2WA0A 3QOPA 3RCOA 2KZVA 4KNYA 4ON0A 1IXCA 3H0DA 2BHZA 3FM3A 3TL4X 1JGGA 1TWAJ 2VQHA 3R0JA 2HDWA 3E6DA 2Q8KA 2JJ7A 2DXIA 3H3VK 5DYMA 2XB5A 2Z99A 3G6EI 1MBFA 3I56I 1N75A 4AC0A 1UAAA 5FLVA 2ZXIA 2FX0A 2X9DA 3BTCA 3BZCA 3SZPA 1W7PD 1U5TB 2VXDA 4IHTA 1IN7A 5HLIA 2G9WA 3ZQHA 5L3BA 4LB5A 5LFAA 2A3SA 2AS5F 2F4MB 4M71A 3S3NA 4AM3A 3PO3J 3V42A 4A3LJ 2DMNA 4BXUA 4A2UA 1Z7LA 3LOCA 5E18F 3JR9A 2NVUB 5CQGA 3WGHA 1V4RA 5M5WJ 1Z21A 5IYCJ 3OOPA 2H94A 1R49A 2M87A 1P4XA 1T98A 3RDIA 3VODA 3CLOA 5JHFA 1R7JA 2FF4A 3IRRA 3G1LA 1KONA 3H1CA 5D5WB 1LDKB 5E8IA 3G73A 2WAQN 3BROA 2E5NA 2E5ZA 5J47A 2L3DA 4GDFA 2NRAC 2EZLA 3HOSA 2L2OA 2LH9A 4OAZA 4BYYA 1LB2A 4E6KG 5HVQC 4EJOA 2GOXB 1YYVA 2XAGA 2CSOA 5K7FA 2KHMA 3D5SC 3W2AA 1ON2A 3FZVA 4LJZF 4RMNA 1MMDA 2ELJA 3GFLA 4JBAA 3WGIA 4KFCA 4HYEA 2KIFA 3CF2A 5GP9A 3OYKA 3O6BB 1U5TA 3EUHC 3I71A 2DI3A 1YITI 1IF1A 1XG1A 3WG7H 2NS7A 1YJ9I 4CGZA 4EVIA 1J75A 1JI8A 2CV1A 2RVCA 1HBXG 5ICFA 5L3CA 3HYIA 4U88A 2ZBKA 3F9KA 3MVPA 1MDMA 1T56A 1JJ6C 4AVZA 1BI1A 3OYBA 1WQ2A 1VF9A 3DWLE 3MWMA 1T2KA 3F3XA 2M30A 4ZYAA 2JRTA 1QZYA 1PDNC 1FSEA 2W84A 4UXNA 5J4YA 1UHSA 3MAJA 2X1CA 3BTJA 4Z2YA 3TOBA 4CA0A 1OLTA 2BHYA 3FXUA 2W4SA 3K0LA 3OYGA 3K70C 1MW7A 2DDBA 2EILH 2H8RA 4EJTA 2PQ8A 2MC4A 2WADA 4XOTA 3S2HJ 3CDHA 1PUEE 1OCTC 1Z9CA 4M6VA 1D3YA 1XCVA 4RGXA 1YHQI 1GUUA 3JRIA 4BY1J 1SFXA 1XB4A 2XGCA 3HGGA 1T33A 5CKTA 1FLIA 4IHWA 2E7WA 2ELKA 2XVCA 4IHXA 4NHJA 2VKHA 4A69C 4IHVA 1O7FA 4NC6A 3BG9A 2EINH 2TRTA 3LAJA 2MD0A 3NEUA 5E20A 4UHTA 2LYCA 1VQ9I 2M8GX 1V55H 4U7BA 2XSDC 1WWXA 2V6CA 3JRCA 3BQYA 5H20A 4ZJZA 4IHYA 4A3GJ 5K7ZA 3ABUA 2UUZA 5D6FA 1F36A 5C3EJ 2C6YA 4MLOA 4A93J 4BQQA 2A61A 2QYOA 2GA2A 2R0QC 3G4SI 4E7HA 3GTLJ 5C4XJ 4E7JA 2NVXJ 1D1BA 3ABLH 2W24A 5J3LA 3CCUI 4OAYA 1BR1A 1R4MB 3ERED 3HBLA 3I4PA 3NRVA 3I59A 3ZQ7A 3C2HA 4XN3A 2GM4A 5EGOA 1RC9A 2DAOA 2K9NA 2GIVA 3J7ZI 3VFZA 3LA3A 5HDNA 1G6NA 2PN6A 2A68F 3E6BA 4UV9A 2ELHA 3ZR8X 3E5XA 2DJIA 4HQMA 3ZMUA 3HHGA 2KISA 3C1DA 4XSXF 2QBYB 4OOIA 3HOXJ 5BNGA 2VASA 3X2QH 2HVRA 5JFRA 4R8HA 4LG3A 2XGEA 3QPTA 2I10A 4UY8I 3JSPA 1QPIA 1SD7A 3GVAA 2ZFWA 2NYXA 1HDDC 5M5YJ 4M74A 1I1SA 4F92B 3OIQA 2L7ZA 2ZSIB 1FNNA 4XONA 2ZNZA 3KX2A 5A2QK 1MBKA 2F4IA 3P9CA 2FBKA 2DN0A 4BBRJ 3JTHA 3K4JA 3CUQA 5DCFA 3R60A 1DU0A 4XNFA 1RKTA 4BXFA 2GWRA 3ABKH 2ME0A 5E3MA 3AG4H 3J7AO 2DMQA 4PJNA 3BT9A 4AYBN 3CCRI 4IO9F 3H3ZA 2NS8A 2MLGA 4MO7A 3HUGA 5GAGJ 3CCYA 4QPQA 2Z3YA 1W1WE 3JW4A 1WPKA 3ELKA 1QU3A 5AIPA 1QZZA 2VB6A 1O3SA 5HNHA 1ETVA 2QLZA 1AKHA 1S7EA 4A12A 4Y3OA 1MJBA 3W6JB 2O8KA 4S05A 1NK3P 2HOAA 2Y9YA 2O6GE 4CZCA 3ASOH 3SHFA 1G3YA 1YRNA 1XDUA 2IP2A 3H3UA 2R7XA 1HSJA 1XX5A 1IN4A 2CO5A 2ECBA 1F4KA 5GPAA 1LDDA 1V5GA 2XF7A 4DNCA 3JRAA 2ZFUA 5K5OA 4MTEA 3RQIA 4W1UA 1R1TA 3RIRA 3Q0VA 1R9TJ 2FD5A 1J0RA 2Y30A 4C3JJ 4BXXJ 1T6SA 4NC7A 2WAQA 5M3MJ 2VJ5A 3VYUB 3ZN0A 1WJDA 3LA7A 3VWBA 4CYCA 1VTNC 4OINF 1Z1DA 5CPRB 4JQFA 2HQRA 4HSTA 1ACIA 2JA5J 5ILSA 5J1UA 4NQWB 1IN5A 5D4SA 1GDTA 2Q0OA 1K79A 4HNUA 1JXSA 4FQGA 3SEQA 4EM0B 3I3LA 2QQ8A 5E1ZB 3HB9A 1B8IA 4OIRF 1P9QC 1KQ9A 3A01A 3ZXSA 1ZRFA 2Y0SA 1I39A 2VOPA 2DFHA 5CVVA 1E2XA 2EZIA 2EQRA 5KK1A 4KUMA 5H2FC 2ZKZA 3H36A 2QKMB 4CCOA 2MGQA 2OQGA 4NBQA 1OJLA 1MH3A 3W6KB 2ADUA 3IHUA 1ZRCA 3N4MA 1WJEA 2KP6A 2M9HA 3VB2A 2EFPA 3IH2A 5HODA 1BJZA 1ON1A 1P92A 3HSEA 4MFDA 2KDOA 2OUMA 1K83J 3KFWX 1VQNI 5KNLA 2QBYA 4LG0A 1BJAA 3L09A 1ETYA 5EG0B 1W5CC 5HS8A 1ETWA 4U7DA 2VE8A 4G7ZF 1MSFC 1W0TA 3FM5A 5DD4A 1RR8C 3KEYA 2YUSA 3A02A 1Y0NA 3L2VA 2JA6J 1JTYA 2ZXHA 3JAMK 3T8RA 3FISA 4G94A 2ETHA 4L0YB 2IAIA 3J81Z 2VJIA 3E6MA 2GBYA 4B47A 2LK2A 3RQ4A 3NARA 2P5VA 1TWCJ 3E97A 1ZQ3P 4GYIA 1RRJA 1ZK8A 4MTDA 5ICCA 3WTXC 4EJVA 2VKVA 2ZJPF 4RAGA 1IN8A 4MQ9F 3V7CA 4OIOF 1D8KA 4IXAA 4CHUA 3IAM2 2DT7B 3CDIA 4GFBA 2UWMA 1FP2A 2EBIA 4IRIA 3TW7A 2M0CA 1TLHB 3D0SA 4GXOA 1HCRA 5LBQA 1USTA 4OU0A 2W57A 2DBBA 1YLFA 2VQGA 3GTKJ 3S16J 4KIGA 4LG0B 2QGUA 2BY0A 5ERIA 1LVKA 3LQQA 2J5PA 2PMHA 4ABZA 1H8AC 2EZHA 1FP1D 3TW6A 2DA6A 2IS6A 1ENHA 2CRGA 2E1CA 2P4WA 1JHHA 1OYIA 1GLNA 2X4HA 4B8XA 3HRSA 2DYRH 3ROUA 1CF7A 4D1QA 4OMZA 4KMUX 5H6QA 2VQCA 3I5UA 2K27A 1ZAOA 2V9KA 3AKZA 5BQTA 2L02A 1V5EA 2AXTC 3EUHA 3VYRB 4E7IA 3WU0A 1OYWA 1H0MA 3IH3A 5FKNA 3HM5A 3HOVJ 4L9JA 1ZELA 5K5QA 2EIJH 3GZNB 3K2ZA 2HKOA 4XLFA 1ZG5A 3F8NA 3DV8A 1XPXA 2LDUA 2EFWA 4FE7A 1LFBA 2M4GA 5D8KB 4A3FJ 2ZJ2A 1QPMA 4PGGA 1WJFA 4IOAF 5FRMA 3NWTA 2W7NA 2O9LA 1Q1VA 2HTJA 3CMAI 3ZQCA 2DA1A 2P0WA 2VQLA 2XF6A 3KE2A 2LOOA 3L1PA 3G2BA 3CP8A 2FBIA 2LG4A 4LIVA 2HWVA 3GCMA 1VQ8I 2FQ4A 1KYWA 2UV1A 3PNVA 2QM3A 2K9QA 2JA7J 5IPAA 1BIAA 2P7CB 4XRFA 1ORKA 1HSTA
chains in the Genus database with same CATH topology
1UZCA 2K85A 2DODA 2CQNA 2DOFA 2LKSA 4FQGA 2E71A 2KFDA 2KIQA 2KISA 2L9VA 2DOEA 2KZGA 2B7EA 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZC A;  2K85 A;  2DOD A;  2CQN A;  2DOF A;  2LKS A;  4FQG A;  2E71 A;  2KFD A;  2KIQ A;  2KIS A;  2L9V A;  2DOE A;  2KZG A;  2B7E A;  2JUC A; 
#chains in the Genus database with same CATH topology
 3MZ8 A;  2K86 A;  4UVB A;  1P7J A;  3C2G A;  2O8X A;  4AIH A;  1B8I B;  3HUG B;  3BP8 A;  5FJ8 J;  3CCM I;  4G7H F;  1WI3 A;  2ZCW A;  2ZME B;  3BG7 A;  3L7W A;  4M3D A;  5K7H A;  1YW7 A;  3GTJ J;  3TO6 A;  2BGC A;  4XLN F;  4J19 A;  2HGC A;  4RDU A;  4A3K J;  3DFG A;  3FMR A;  3QU6 A;  2FOW A;  2CQQ A;  4RGU A;  3S2W A;  2F5F A;  4N4O B;  3P9I A;  5FKO A;  3H9J A;  2CUF A;  1O3Q A;  3S15 J;  5F0C A;  4IKF A;  3DBL B;  4CCL A;  2X85 A;  1IV8 A;  3DEU A;  2R7W A;  2RNJ A;  2HR3 A;  4O5V A;  3GXO A;  4BE1 A;  2F6C A;  2XDV A;  3KEQ A;  2KQR A;  2VJJ A;  2P8T A;  3NQO A;  2PJR B;  3GYH X;  2HFH A;  2F5V A;  2HDC A;  2IRF G;  4H4K C;  2F5E A;  3CJR B;  5DTD A;  1DGR M;  3DTE A;  1JKO C;  4I99 C;  5EDN A;  3NAU A;  4L5J A;  2RNG A;  2XSJ C;  4IX7 A;  2DOF A;  3QOE A;  5J4V A;  3QQA A;  2BW3 B;  2EB7 A;  3J80 Z;  4NQW A;  2HOS A;  1IUF A;  2KDZ A;  4HEA 2;  3OL4 A;  4ENK A;  2Y0M A;  4CH7 A;  2PMZ N;  1MBH A;  2AQE A;  3FF5 A;  5CVJ A;  3F0C A;  2VXZ A;  2AHQ A;  1VQ4 I;  3IRQ A;  1W36 D;  3WU1 B;  3EDP A;  2WV0 A;  3ZMT A;  2BBY A;  3DBR B;  5H6R A;  3B73 A;  2JN6 A;  4CO8 A;  3SDG A;  5M5X J;  1IN6 A;  4DJA A;  5BOX A;  2DOD A;  3TP3 A;  4IQJ A;  3KP5 A;  3RKY A;  3MKW B;  3OYE A;  2P6S A;  3ML6 A;  4HDV A;  1W5S A;  1UMQ A;  3AG2 H;  2LF8 A;  1LFU P;  5E17 F;  3Q3S A;  2M34 A;  5B1A H;  2ACJ A;  3WTZ A;  5CVI A;  2HQN A;  3IH4 A;  1QO0 D;  1TZL A;  3LSI A;  2XPV A;  2K3P A;  3JRH A;  2DCE A;  3H5A A;  4BEH B;  2OTJ I;  2H1K A;  4EJU A;  1FMV A;  2LNB A;  3K69 A;  2MC3 A;  1FTT A;  3ECO A;  1GXQ A;  3U9G A;  3QYE A;  4K2E A;  1KU7 A;  1WCM J;  2N8G A;  2G0E A;  2E71 A;  4RB2 C;  3FXQ A;  4P1W A;  5E8G A;  2NVQ J;  2XPW A;  3JRD A;  5FO5 A;  3OSG A;  2BZT A;  2LY1 A;  5K5R A;  3LQR A;  1DP7 P;  3GTM J;  1SD5 A;  2IA1 A;  3C7J A;  3H9G A;  3S3O A;  2EA2 A;  1IAW A;  2DJN A;  5CLS A;  1W5T A;  3FHZ A;  1H9G A;  4XKW A;  3C3W A;  4BJ6 C;  4DIQ A;  1A6I A;  4UVC A;  2E2H J;  2E1N A;  3S1R J;  1LEB A;  2R5Y A;  4QLC U;  3OV8 A;  1H88 C;  1QVU A;  2CFO A;  1YIJ I;  3LSJ A;  4PJM A;  1JKR C;  5FKM A;  1APL C;  3K6G A;  3R61 A;  3LSM A;  3CJQ B;  1E0E A;  2X48 A;  5GTI C;  2CG4 A;  2VBY A;  1BOA A;  2XAQ A;  2IJL A;  2QA4 I;  2LVS A;  4B43 A;  2LY9 A;  3SJM A;  2HYJ A;  2ZNY A;  1DDN A;  1TWH J;  4M9Z A;  2W25 A;  1OIS A;  3IUO A;  2WAE A;  5EEA A;  1MSE C;  1HA8 A;  1Z7U A;  5J1R A;  4HAM A;  1IG7 A;  5DM6 F;  1D0Z A;  3BR2 A;  3K2A A;  2QKL B;  3J7A Y;  1HKQ A;  4RGS A;  1FY7 A;  3BTL A;  4P9F A;  1BW6 A;  4KIF A;  4BQA A;  1N78 A;  2A69 F;  1MDM B;  1T95 A;  5IYB J;  4PJ0 C;  5C44 J;  2DOA A;  4XBF A;  3E7L A;  1I5Z A;  1DU6 A;  3FK6 A;  4C9Y A;  2L7F P;  3L2Q A;  3QP5 A;  1WH7 A;  4BU2 A;  1ETO A;  2DA7 A;  4XRS G;  3CES A;  4KIC A;  3RKW A;  3GX4 X;  4ZDO A;  1HW5 A;  3RKQ A;  1I50 J;  2DQL A;  2RDP A;  1SAU A;  1JE8 A;  2LP0 A;  2WTE A;  4U87 A;  5E3O A;  4Y4R A;  2DA5 A;  2CQ7 A;  3ABM H;  5E3N A;  1SFU A;  2WY7 Q;  3CMY A;  1HKS A;  4E7K A;  1IZ1 A;  4CXF A;  4UNO A;  1J59 A;  1T0F C;  5A2Q Z;  2VLA A;  4CCM A;  3S3M A;  2STW A;  4A3C J;  3L2C A;  1R5H A;  1K78 A;  3ZQI A;  3WGG A;  3HDD A;  4PJL A;  3EYY A;  2L4A A;  2CMP A;  3V4G A;  3OYL A;  1OCZ H;  2KRH A;  2HKX A;  3OYA A;  1XGO A;  2NVY J;  2P81 A;  3G3Z A;  2ZJQ F;  3OYH A;  4PZJ A;  1IJW C;  2RQQ A;  2IGO A;  4LOC A;  4BE0 A;  4F7Z A;  5IOY A;  4CYC B;  4PUS A;  3Q5F A;  4ZTF A;  2XB0 X;  2AXL A;  2BY2 A;  1LE8 A;  3HRM A;  3LNQ A;  2CQK A;  3G1O A;  3LSG A;  3FMQ A;  2HXO A;  2HPI A;  3UR3 C;  1T38 A;  1U8B A;  4CSW A;  2LRD A;  4PFP A;  3FKJ A;  2XPU A;  1IC8 A;  2LTP A;  3GTG J;  3B6A A;  5LRS A;  1MGT A;  1FC3 A;  1N77 A;  2L5Q A;  3NWS A;  4B48 A;  2DYS H;  2PFB A;  3PNY A;  3QWL A;  2ZB9 A;  2R7O A;  4N9I A;  2R5Z B;  1CGP A;  3A01 B;  3BDD A;  5BMZ A;  5L3D A;  3JRB A;  3F21 A;  2XAS A;  2OA4 A;  2IW5 A;  1BI0 A;  2VPR A;  4HBL A;  5LD2 C;  4HQE A;  3GTO J;  1LJ9 A;  2HOE A;  5FRO A;  2HEO A;  4V2F A;  4XR6 A;  1K7A A;  4R79 A;  2DFE A;  4MGR A;  4O6J A;  3SFZ A;  4CZZ A;  2FJ1 A;  4P9U A;  4V2G A;  2COB A;  2CJJ A;  4AVP A;  4M9X A;  3GEZ A;  3KYC B;  1SEU A;  2Q2E B;  2KL4 A;  2VBW A;  4UUS A;  4JX6 A;  2DO7 A;  3FXO A;  1I27 A;  1UCR A;  3KYL A;  2QCO A;  2ID6 A;  5JLX A;  1YIO A;  3TO9 A;  3OS0 A;  1R6R A;  1A04 A;  2LSO A;  3OIP A;  3BZK A;  4II2 A;  1W4M A;  1X3Z B;  3D5L A;  2LKP A;  1R00 A;  1G3W A;  1ZGA A;  5HDG A;  1IGN A;  2JT1 A;  1BI3 A;  4G6Q A;  4B3X A;  1FX7 A;  3O2P E;  1ZAR A;  2CH0 A;  2W85 A;  3FXJ A;  1EF4 A;  3L2U A;  1P2F A;  2M5W A;  4M72 A;  5FKK A;  3M1C A;  3L9F A;  3M8F A;  3CME I;  2J5O A;  5FGM A;  2PEX A;  4M3B A;  2LMD A;  3ERM A;  2O7O A;  4M3G A;  3U1K A;  2OCE A;  4I02 A;  3IKT A;  4L5E A;  4ZYD A;  2RQP A;  3W2W A;  4E7L A;  1Z67 A;  3CO7 C;  4ESJ A;  1T8I A;  3FBN B;  4HSR A;  2LR8 A;  5F1R A;  2JA8 J;  1R1U A;  3TGN A;  3OMY A;  4DBR A;  4JX4 A;  3OS2 A;  1SFE A;  4KT5 C;  5LEJ A;  4HV5 A;  1R23 A;  5FD5 A;  2ICW G;  3GF2 A;  4FX0 A;  2L7M P;  5F0H A;  4M3E A;  2W48 A;  2CYY A;  3ZPL A;  1MND A;  4U0W A;  1X2N A;  1U78 A;  4JYK A;  1DP3 A;  1J7K A;  4UUV A;  1FZP B;  2M3A A;  2XIG A;  4DOZ A;  3ZMZ A;  2Z9O A;  3DU6 A;  1YFH A;  4CDG A;  5M3F J;  1X4P A;  1I1G A;  1QHG A;  3S2D J;  1D5V A;  3JRE A;  1X1B A;  1DUX C;  2O3F A;  1ZHF A;  4C2T A;  3GZ5 A;  1XGN A;  4AU7 A;  3HTU A;  2JVG A;  3K4N A;  3KEO A;  1JKQ C;  2JK3 A;  2PBI A;  2RN7 A;  2W00 A;  4EGY A;  4ESF A;  2JPC A;  2RRE A;  5HOO A;  1XMX A;  2MLK A;  1ZH5 A;  1Z0X A;  1FWZ A;  1TNT A;  5J1Y A;  2XF5 A;  3I55 I;  3RZO J;  3PM1 A;  3BR3 A;  4IZZ A;  1G3S A;  1K6Y A;  3M07 A;  3GZ6 A;  4FET A;  2VON A;  1REP C;  1AOY A;  3HSR A;  3DPL C;  3K1P A;  1WHU A;  4BDZ A;  2DK8 A;  4NB5 A;  1K4T A;  3AG3 H;  5EEG A;  1TW2 A;  5DDG A;  3O3K A;  1FIA A;  3BY6 A;  1O3T A;  2JWT A;  1O3R A;  4HF2 A;  4G6T B;  3OS1 A;  3S1N J;  3OYN A;  3KLO A;  2QEX I;  3I58 A;  4IL6 C;  4B1R A;  3N05 A;  4KDP A;  1S9H A;  2VIX A;  1B4A A;  2LLK A;  3MZY A;  3V8K A;  4ZYH A;  3BCB A;  3H0G J;  2ESN A;  1F1Z A;  1KA8 A;  2IS1 A;  1JT6 A;  4KYW A;  4H0E A;  4B09 A;  2FOK A;  2A6E F;  4KJZ A;  2IPQ X;  3OYI A;  4EMS A;  1YQA A;  1ODD A;  1FBS A;  4XOR A;  3RZD J;  1LEA A;  2VUM J;  3QAH A;  5L3E A;  1GVJ A;  3I4M J;  3F8M A;  5ICE A;  2DW4 A;  1ZGW A;  5E1W A;  2X51 A;  4AID A;  2CS3 A;  2JUC A;  2PLY A;  2D2W A;  5FLX Z;  2R7V A;  2RAE A;  1U8R A;  2LY2 A;  1FTZ A;  3Q0U A;  3RPQ A;  5AON A;  3WTT C;  1ZGJ A;  1WGX A;  3W6V A;  1WVR A;  2UZK A;  5KCM A;  1K4S A;  5E3L A;  2IGM A;  4ESB A;  2DU9 A;  4ASN A;  3K7A J;  2VL8 A;  4EGZ A;  1UJ8 A;  2R7R A;  2VT2 A;  4LK1 F;  4RAY A;  2LF7 A;  2DTZ A;  4LLL A;  4L0Z B;  4LMY A;  2VT3 A;  1A6Q A;  1LE8 B;  3RI4 A;  2JA2 A;  2KKO A;  3D5R C;  2VBX A;  3R0A A;  4KA4 A;  1T39 A;  4U0V A;  2YS9 A;  4WWC A;  3ZQQ A;  1VQ7 I;  1OCC H;  4DQ2 A;  1HDP A;  2RV8 A;  3I9V 2;  4II3 A;  4CIC A;  1VQK I;  1RUN A;  1UZC A;  2M45 A;  1TQM A;  1S29 A;  1O7L A;  3SYT A;  1BC8 C;  4LFU A;  3F72 A;  2FRH A;  1R5G A;  4MEY F;  4PSX A;  1EH7 A;  2K40 A;  3DPT A;  1S8N A;  2K7L A;  2DLL A;  3S32 A;  2X1E A;  1S72 I;  3DKX A;  4DZJ A;  5EGO B;  4BBS J;  2EIM H;  4KIB A;  5CVU A;  2E2I J;  3T0Y A;  1Y0U A;  1IDZ A;  3KZI C;  4Q5S F;  1P7I A;  3CF5 F;  1RIO H;  1TNS A;  3H5R A;  3ZMD A;  2E1M B;  4ITV A;  2X6Y A;  1WZ2 A;  2K9S A;  2ID3 A;  2UXX A;  1EH6 A;  4L9T A;  3LMM A;  5LGN A;  4IHS A;  1WJB A;  3TDZ C;  2A5W A;  1ZG3 A;  2Y69 H;  2M4K A;  3AL0 B;  4HX4 A;  5LHG A;  2OAZ A;  4QWQ A;  3GTQ J;  4XLC A;  4ETS A;  4NDL A;  4NC8 A;  1GXP A;  4HV6 A;  4QIW N;  1RR7 A;  1IRF A;  1FBU A;  2FU4 A;  5BPI A;  1XSX A;  1TQP A;  3FHN A;  3I53 A;  3IC7 A;  1Y1W J;  1AWC A;  1U9O A;  3GFM A;  1TQI A;  2VKD A;  3IV5 A;  5IT3 A;  4LLN A;  1R58 A;  2YPR A;  2IXS A;  1K6O A;  1X4O A;  4A0Y A;  1G2H A;  3V7S A;  2L9N A;  3FK7 A;  4BE2 A;  1YS6 A;  4M6X A;  5TIS C;  2E60 A;  1UG0 A;  3CCQ I;  1OKR A;  3JAM Z;  2ZO4 A;  1FYL A;  2CFX A;  4C3I J;  4ZYG A;  4IF4 A;  5LLQ A;  4MQV A;  3SDB A;  2VE9 A;  5C4J J;  1XCB A;  3JRF A;  4BL0 B;  2BYV E;  4BKX A;  2F5C A;  2G7U A;  3BCA A;  3VEP A;  4CYD A;  1NG6 A;  1QNT A;  3CDL A;  1S6L A;  4A3M J;  4KMF A;  2HQ5 A;  1AKH B;  1NG7 A;  2ZXJ A;  2QUF A;  5KHD A;  1QBJ A;  2VOD A;  1SC7 A;  1MKM A;  1XTA A;  1BN5 A;  4DW6 A;  1YOV B;  2LFB A;  1LPQ A;  3TKY A;  3TDU C;  1O4X A;  3VDX A;  5FD6 A;  2DA3 A;  5GAD J;  3QPS A;  3SXY A;  2Y31 A;  4GGG A;  3CUQ B;  4CCK A;  3BJ6 A;  3KP2 A;  1ZRE A;  1D1A A;  3MCZ A;  4N4N B;  1C0W A;  2XAF A;  3KLN A;  3LSR A;  2B9S A;  2DA4 A;  2R5Y B;  2QQ9 A;  1J9I A;  4XMY A;  3DTK A;  4XLP F;  1R71 A;  3S17 J;  3BQZ A;  5IY5 H;  4FT8 A;  2A6T A;  3CTA A;  2OPT A;  2M1B A;  2QSH X;  3DP7 A;  3KP4 A;  3H35 A;  2K9M A;  2CV0 A;  3AG1 H;  3IWZ A;  4XLH A;  5D6E A;  3CLQ A;  2WV1 A;  1SD4 A;  2BY1 A;  4RM3 A;  4EM2 A;  2KMU A;  4MNU A;  2LRE A;  2FQ3 A;  3IP4 B;  1PUF A;  3BOQ A;  2CGP A;  1WH5 A;  2ZC2 A;  1B1B A;  3JTG A;  3F23 A;  3KZZ A;  2GXA A;  4WK8 F;  2PMZ A;  3HIF A;  5LRR A;  3SZT A;  3S93 A;  3RJP A;  3I4N J;  5JVT A;  4EQQ A;  2WB1 A;  1IXS B;  2WY8 Q;  1UFM A;  3VSK A;  2R7S A;  1GV2 A;  3TQN A;  4BAY A;  4MIM A;  3CMM A;  2P7V B;  2GQQ A;  3BC8 A;  3DPU A;  4AUX A;  4HDU A;  1ZG1 A;  2HTS A;  4OMY A;  1Y1V J;  4BHC A;  3M4O J;  1S7O A;  1HXD A;  2OZU A;  1D8J A;  5F6F A;  4LB6 B;  2HYF A;  3HOZ J;  2HS5 A;  1GT0 C;  2D5V A;  1JJ8 C;  1IRZ A;  2IBD A;  3GTP J;  1PP7 U;  1H89 C;  5EG0 A;  3F8B A;  1V5F A;  2VBZ A;  2Y2Z A;  2WB1 N;  1O57 A;  1YE9 A;  2CUZ A;  4YII A;  3K9T A;  4A3D J;  3HKZ A;  4ZH4 F;  5B5E C;  2YU9 J;  3OR1 C;  4NUB A;  1HF0 A;  4J00 A;  1LQ1 A;  2ZME C;  2R7Z J;  2QSF X;  4WCG A;  2R5Z A;  1D5Y A;  3OYJ A;  3E1S A;  1Y39 A;  3HSF A;  5GTH C;  5IYD J;  1OPC A;  2V1U A;  3REO A;  5FFZ A;  3FXR A;  4BDY A;  1YTY A;  2RC4 A;  2VC0 A;  1SVO A;  4PGH A;  4BGD A;  3CCL I;  4C2U A;  2PMU A;  1FOX A;  3FXK A;  4D0P A;  1KU9 A;  1LFP A;  1QVT A;  4KT6 A;  1BI2 A;  1R22 A;  3GO5 A;  3RKX A;  4D9J A;  4YFK F;  4S04 A;  3CCJ I;  2HI3 A;  4UVA A;  1I6X A;  3DTI A;  3CUQ C;  5IT9 K;  3PL8 A;  1IUY A;  3MN2 A;  4YIR X;  2OQR A;  1HOM A;  4ANJ A;  5HLH A;  2RKH A;  2L9S A;  3OYF A;  4QTR A;  5ED4 A;  1JUP A;  4E70 A;  1JT0 A;  1R4N B;  4ENN A;  3HEF A;  3K4B A;  4RB1 A;  4IOC F;  2PX9 A;  4YIF A;  4ZZD A;  1NHA A;  2W82 A;  4RLQ A;  1RES A;  1VQ5 I;  1J5Y A;  5IP6 A;  5DUK A;  3V8J A;  2O03 A;  3ZP5 A;  2MW8 A;  3K1N A;  1FJL A;  3EYI A;  2B7E A;  1UG2 A;  2AQF A;  2XGX A;  3WTU C;  5JLW A;  3HGY A;  2EIK H;  3LFK A;  2L54 A;  3HOW J;  4ZC3 A;  1L0O C;  5DCM B;  2KIQ A;  3SEZ A;  4HX8 A;  1BW5 A;  3L2W A;  2KZG A;  3DCF A;  3RPU D;  3VPR A;  1D0X A;  2HPM A;  1R5I D;  1PUF B;  1D1C A;  1V54 H;  1A36 A;  2FUG 2;  3EUK L;  1VQO I;  2HU9 A;  1YX3 A;  2FXA A;  4IRH A;  1MZB A;  1JUM A;  3E3V A;  2HOT A;  1FYK A;  1MIJ A;  4D7N A;  4WXD A;  2H8W A;  1P4A A;  2QZ8 A;  2Z5U A;  1P4W A;  5F27 A;  4Q48 A;  2D1V A;  3PQJ A;  1ZN2 A;  3PJR A;  3MZH A;  3UNG C;  1FOK A;  4Q47 A;  2BVM A;  4PSW A;  1FIP A;  1M1E B;  4KIT B;  4I2O A;  1BIB A;  3HG9 A;  3ASN H;  1LDJ A;  3ZMV A;  2IGK A;  2MFZ A;  4X1E A;  2R7F A;  1RZ4 A;  4I0A A;  4Y17 A;  3LWF A;  3SFI A;  4BH9 A;  2XAH A;  1QZE A;  5TRD A;  1D0Y A;  2BW3 A;  1XGS A;  2R7U A;  5CYV A;  3R4K A;  2DMP A;  1QRY A;  4LK0 F;  3ZRG A;  1U3E M;  3A0H C;  3FXL A;  2H27 A;  1MNE A;  1W7P A;  2ESH A;  3A4C A;  1KGS A;  2V1N A;  2CUE A;  1IRG A;  4N9H A;  4XN0 A;  2ZXW H;  2V79 A;  1VQP I;  1J2X A;  2JQ7 A;  3GW2 A;  1WJA A;  5HS9 A;  2DT6 A;  3L00 A;  1PP8 F;  4E4H A;  2KLO A;  4M73 A;  2BOL A;  3WU2 C;  1QHH D;  1X3U A;  5IOZ A;  4S0H B;  1E17 A;  1PVE A;  3VOE A;  4Z6Y A;  4ZZL A;  2UXN A;  2JRM A;  5L3G A;  5EF6 A;  4HNV A;  1KU2 A;  4GRI A;  2V9P A;  4RGR A;  2IVM A;  4RAF A;  1SD6 A;  4G8X A;  2COM A;  2VN2 A;  3ABT A;  4X0G A;  5JI6 A;  1CQT A;  4A3B J;  2YX7 A;  1MH4 A;  2DFI A;  2EFN A;  4FAS D;  3T1B A;  4I0B A;  4XID A;  1SVL A;  5D5V B;  2H6B A;  4XLE A;  2FML A;  4A6E A;  1SAN A;  1YS7 A;  4FIS A;  2Q1Z B;  3TP0 A;  1FT9 A;  4GCV A;  4G9Y A;  4A3E J;  3CCE I;  3CO6 C;  2CWE A;  3LST A;  2K02 A;  2Y48 A;  5ICG A;  1YI2 I;  3DXJ F;  1W36 C;  1ZLK A;  2XV4 S;  2L0K A;  1MJA A;  3GME A;  2GA1 A;  3U1D A;  3OIO A;  4FX4 A;  2XUB A;  3RSN A;  2E2J J;  1OQY A;  1G8X A;  3BJO A;  3OYD A;  3IL2 A;  2EA4 A;  2OBP A;  4I01 A;  4KN7 X;  5B66 C;  4WXH A;  4XL9 A;  2IGN A;  2QSG X;  1FOY A;  5LHH A;  1BR2 A;  1BC7 C;  5DCM A;  3OL3 A;  5DD8 A;  3HHH A;  4JOM A;  3MEX A;  3K4L A;  5GAE J;  2MG4 A;  5E1X A;  1SMT A;  2VPL A;  4EM1 A;  4ENJ A;  1Z05 A;  4F52 A;  4XIC A;  1KQ8 A;  4XKV A;  2BVL A;  2K85 A;  3LSK A;  4IVN A;  4BHP A;  1DPR A;  2HDD A;  2OF7 A;  4BEH A;  2EV0 A;  1IV6 A;  3BR1 A;  4HPQ A;  1E3O C;  2KT0 A;  3E6C C;  2BE5 F;  2YU3 A;  3QYB A;  3ZQF A;  4HLY A;  4DZP A;  4RM2 A;  1UHM A;  5DS9 A;  2O0Y A;  3CC2 I;  4HLX A;  4A0Z A;  5AIQ A;  1OCR H;  1AHD P;  2FMY A;  1FPQ A;  4I76 A;  3P5J A;  3ZCO A;  3Q0W A;  1L3L A;  4DBQ A;  2JSC A;  3PUF A;  4RBO A;  4ZDL A;  3K70 D;  3OYC A;  1HW2 A;  2NOG A;  2ME6 A;  1G4D A;  2HZT A;  1LUJ B;  3FXM A;  3I0T A;  2A07 F;  4I7H A;  2QF7 A;  2RGV A;  3BPX A;  3OOU A;  2NAZ A;  4FE4 A;  4Y7N J;  2CV2 A;  1ZTR A;  3S8P A;  1BBY A;  2A05 A;  3BTI A;  1BR4 A;  1JTX A;  2P6T A;  3WTV C;  3HKZ N;  4G6D A;  1ZLJ A;  3QYF A;  4XKB A;  3TMO A;  1EJ9 A;  2IS4 A;  1HQC A;  2R3S A;  1ITY A;  3ECH A;  2VJ4 A;  2R93 J;  1VI0 A;  1MMA A;  1HC8 A;  1TL8 A;  1XDS A;  4N0B A;  1I3A A;  4IEJ A;  3M9A A;  4WX9 A;  1WJC A;  3FMS A;  2Z33 A;  3Q9S A;  3HOY J;  3QPL A;  4A3J J;  2K3F A;  2PI0 A;  1X1C A;  4NNJ A;  3PFY A;  4P55 A;  4ZYE A;  4DYR A;  2ECC A;  2NNY A;  4AWX B;  5LEK A;  2KIM A;  3HC7 A;  5FLM J;  2ZSH B;  2NOJ B;  3DEE A;  3GUD A;  4OIP F;  2CQX A;  4XKC A;  5HS7 A;  4D5F A;  4J01 A;  2E1M C;  2V4J C;  1SFO J;  1FBQ A;  5D5X B;  2MBF A;  1ETK A;  2FBH A;  3CCS I;  4F91 B;  2EH3 A;  2GOM A;  3ZMS A;  4A5N A;  2PJP A;  1B9N A;  4DGW B;  2E34 A;  1XMA A;  3PNT A;  3KZY A;  1X3W B;  2VC1 A;  2H6C A;  3SZG A;  5L3F A;  2XKP A;  1TP4 A;  2OTL I;  5HDK A;  2KPM A;  3C2B A;  1S7A A;  5FKL A;  2F5D A;  2MAB A;  3FKI J;  5B1B H;  4C2M J;  4ZDP A;  1TWG J;  4WF2 A;  5TJJ A;  4FHT A;  3JCU C;  2JMW A;  4BY7 J;  1X1A A;  2GXG A;  2DQR A;  2V7F A;  3B6C A;  3ONQ A;  3QRF F;  2EFQ A;  4I98 B;  4XM3 A;  4RB3 C;  1DQU A;  1PJR A;  3LA2 A;  4B4C A;  1KYZ A;  1Z3X A;  1AU7 A;  2V6E A;  3PO2 J;  1FEX A;  2MD5 A;  2HNH A;  3BG5 A;  3DLA A;  3EQL F;  4LLG F;  2A6H F;  2XRL A;  2X6O A;  2M7B A;  2DMU A;  4JP0 A;  4PDK A;  2D45 A;  1Y6I A;  3BPV A;  1EH8 A;  2EFO A;  2L9V A;  4TV7 A;  1NK2 P;  4CCN A;  2DTR A;  5F04 A;  3OWT A;  3PIP F;  2CW0 F;  2WAF A;  2IEK A;  5KAI C;  1BM9 A;  3A03 A;  2R92 J;  4X6A J;  2KFD A;  3GWZ A;  3ZOB A;  2E19 A;  1MJ9 A;  4IJA A;  3MMY B;  2JUG A;  4A5M A;  5JHU A;  1R36 A;  1WJ5 A;  3P9K A;  1A35 A;  1POG A;  2EV6 A;  4HX7 A;  1I3Q J;  3LFU A;  2EWN A;  4EV0 A;  3M7G A;  2LBF B;  3CP2 A;  1IDY A;  1IW7 F;  3KP7 A;  1WSU A;  4A0X A;  3VYS B;  2HVS A;  4QPO A;  1S5L C;  3JRG A;  5LGT A;  2X1D A;  1Y8Q B;  5JVG F;  1JUS A;  3FX3 A;  5LHI A;  1MBG A;  2PJR A;  3IAS 2;  4QSH A;  4U0Y A;  3M1E A;  1MMG A;  3R6S A;  1A5J A;  1SFK A;  1YW9 A;  5ILV A;  4YRV A;  2EV5 A;  2NS0 A;  2K9L A;  3HOT A;  1PYV A;  1VQ6 I;  1WKM A;  2M0M A;  1JGS A;  3EPZ A;  1USS A;  2CUJ A;  2R4G A;  5DV5 A;  1XC5 A;  2FA5 A;  3B02 A;  2YSR A;  3ISP A;  2CU7 A;  3I64 A;  4V19 K;  1KQ0 A;  2WBM A;  3AAF A;  1ZR4 A;  2OZ6 A;  3TO7 A;  5HLT A;  1VND A;  3W3C A;  3F6O A;  3JSO A;  2IA2 A;  2L7K A;  1RUO A;  4XOP A;  1XMK A;  1WI9 A;  2EK5 A;  2K4J A;  1IO2 A;  5JR3 A;  2STT A;  3HOU J;  2QQB A;  4BS9 A;  3CJN A;  4W97 A;  3DF8 A;  1YX5 A;  1YW8 A;  4LIU A;  2V26 A;  4PK4 A;  1B72 B;  4DYQ A;  5F1J A;  3F6V A;  3J80 K;  3S14 J;  4AIJ A;  2XRO A;  2M2E A;  3PSI A;  1DGW Y;  4IRG A;  4PCQ A;  4G12 A;  2HYG D;  2Q2E A;  4C30 A;  4MHG A;  1BOB A;  1K61 A;  2NXN B;  3H5N A;  3DU5 A;  3U2R A;  3F22 A;  1MBE A;  3CC7 I;  3D1N I;  3HTS B;  3BG6 A;  2V1X A;  4YG2 F;  2TCT A;  1U5T C;  2P5K A;  2A5Y B;  2IT0 A;  3S1M J;  2HQA A;  3HPH A;  2R7T A;  1T0F A;  4LD5 A;  1QGP A;  3MKL A;  3E0J B;  1EKE A;  5EZG A;  4OIQ F;  3ULQ B;  3CJT B;  2BXY A;  2QQA A;  5EEH A;  4XLA A;  3VYT B;  2BEO A;  1Z91 A;  3HL2 A;  4A3I J;  2GAU A;  4E7Z A;  3QPH A;  5DEQ A;  4UV8 A;  1OR7 A;  2KRC A;  3SQN A;  2BXZ A;  4XRS A;  1YO5 C;  2FNP A;  1B59 A;  1MD0 A;  1V3F A;  2IA0 A;  4HOB A;  4P96 A;  3OSF A;  1UB9 A;  1CF7 B;  9ANT A;  4BQO A;  5D8L B;  2H1L A;  5GPC A;  4YEL A;  4BNC A;  3ZN1 A;  3HXL A;  5DUI A;  5GAH J;  3MKZ A;  4I6Z A;  2M7A A;  4IPA A;  3RPU A;  4BJ5 C;  4MEX F;  1TT5 B;  3PFI A;  3W2V A;  1UHW A;  3RTR A;  4XRM A;  3F8C A;  4ZTJ A;  1X1D A;  5HLG A;  1ONV A;  1A31 A;  3TBI A;  1ETQ A;  3Q9V A;  1Y56 A;  3GFJ A;  2CQN A;  4RB0 A;  3DKW A;  4L9N A;  2QVO A;  4JX5 A;  1YRN B;  1LNW A;  2EJR A;  1Z6T A;  1ULY A;  3C18 A;  4YEJ A;  2Z1D A;  1Z3Y A;  2CW7 A;  1ERD A;  2R7Q A;  3V7R A;  1F5T A;  3ESW B;  4I09 A;  2BV6 A;  2L9R A;  2TDX A;  1G59 A;  2E35 A;  3WTS C;  4FTH A;  1I6H J;  1B9M A;  1UEL B;  3A0B C;  4UUS B;  1VQM I;  3RYP A;  5BPD A;  3DEW A;  2I5U A;  2QWW A;  4UUT A;  5FB2 A;  2V9V A;  2PG4 A;  2E36 A;  4M6Y A;  4RA2 A;  3WHB A;  1RKW A;  2DK5 A;  3CQZ J;  5FLX K;  3CC4 I;  4RLF A;  2LKX A;  4JK1 X;  2GXB A;  5F08 A;  2XGD A;  1EV7 A;  3PUB A;  1YJW I;  3TOA A;  3FIW A;  2Z16 A;  2MH9 A;  2D1H A;  1XSD A;  1OCO H;  1VQL I;  4GO1 A;  1OMI A;  1KZH A;  2Y0S N;  3I59 B;  2Y9Z A;  1BA5 A;  1QQI A;  3QP6 A;  5TGT A;  4YFN F;  1ZRD A;  3U21 A;  2DA2 A;  3WE3 A;  4BQN A;  3DBH B;  1GV5 A;  2L4M A;  5ILU A;  4HNT A;  4L18 B;  3AFH A;  4UB8 C;  3CD6 I;  2B63 J;  1MMN A;  4LGW A;  1SMY F;  1Z77 A;  3G1M A;  3N97 A;  1ETX A;  3LSP A;  1GHC A;  1STZ A;  1JHF A;  2DT5 A;  3QOD A;  1LKX A;  2FNA A;  4B3A A;  2B0L A;  5CQE A;  3BLY A;  4LIT A;  2O5R A;  1OR7 C;  4Q4Z F;  2GLO A;  1IXR C;  3WTW C;  1X58 A;  3H92 A;  3WTY C;  1R1V A;  2KJB A;  1MNM C;  3BG3 A;  2IS2 A;  1DPU A;  6PAX A;  1KU3 A;  2E1O A;  4Y15 A;  5D5U B;  3ZQL A;  5CJ9 A;  2EPF A;  3M3Y J;  2Y75 A;  3P7N A;  1RPW A;  2KJC A;  2DOE A;  1NH3 A;  5J6X A;  1H9T A;  2R7D A;  3LL7 A;  3KP6 A;  1E3P A;  4C3H J;  2CW8 A;  5LGU A;  2XC7 A;  1FYM A;  1ZKG A;  4BJT A;  4L9V A;  4OWR B;  4Y13 A;  3J81 K;  3EET A;  1XSV A;  3BWG A;  4PJJ A;  2YR2 A;  1B72 A;  1Z6R A;  3DLL F;  5D4R A;  3DQV C;  2OU2 A;  2LBF A;  2DFF A;  1TT0 A;  3GBG A;  3WHC A;  1BL0 A;  1FMW A;  3KP3 A;  2ZJR F;  1G3T A;  5B3S H;  3K4M A;  2ISZ A;  1IRX A;  3A1Y A;  1GVD A;  4Y33 A;  4F55 A;  2MH2 A;  4XQF A;  2XHK A;  1S3J A;  2P5L C;  2XAJ A;  4EAT A;  2M8E A;  3OR2 C;  1HW1 A;  4XSZ F;  3HRT A;  3KPH A;  3MQ0 A;  2Z2S B;  5FFX A;  4F3Q A;  1ZR2 A;  2O61 A;  2F48 A;  3PQK A;  2X0L A;  2DDA A;  1B6A A;  4A6D A;  4UB6 C;  3BJA A;  4DYC A;  3HZJ A;  3V8L A;  4AD9 A;  3MFK A;  1U0J A;  1K78 B;  2KIU A;  3T8T A;  4Y52 J;  4HZF A;  4BAC A;  1XS9 A;  2F4O B;  3HPG A;  5EJC A;  3KYD B;  5BS6 A;  3M8J A;  1F43 A;  1T08 B;  4HW0 A;  2X6W A;  5HNF A;  1W7P B;  4EJW A;  3S1Q J;  3M8E A;  3IWF A;  2K5C A;  3UKG A;  5KVR A;  1FSH A;  5EYR A;  2OD5 A;  5J8C A;  1YJN I;  1XD7 A;  4G7O F;  2DPU A;  4HA8 A;  1TBX A;  1VZ0 A;  1HKT A;  3G71 I;  2AO9 A;  2JVH A;  3KET A;  3COA C;  3OY9 A;  3DKY A;  4BHB A;  3IKV A;  3WG9 A;  3HRU A;  4AIK A;  1OYY A;  2XRN A;  3HJE A;  3AL0 C;  4WXC A;  3VSL A;  3I54 A;  2GIZ A;  3BR6 A;  2DMT A;  3RYR A;  5IP7 J;  1F9N A;  2WWY A;  3BR5 A;  5CVR A;  2NVT J;  1U6G A;  5J40 A;  1FOW A;  1Y8R B;  4MFE A;  3J7Y J;  1SAX A;  1P6R A;  2OC6 A;  4HF1 A;  4AYB A;  5FRN A;  3O8G A;  2F2E A;  3F8F A;  1OCP A;  1Q1H A;  1ZYR F;  4EEF G;  3EUA A;  2FE3 A;  3GLX A;  3LSH A;  5EZH A;  3TED A;  1RI7 A;  3K1M A;  4ENM A;  1MBJ A;  4P5O A;  3FBI B;  5DM7 F;  2XKO A;  3CZ6 A;  2E7X A;  3CUO A;  2JTV A;  2JZY A;  3KCC A;  2MA3 A;  1E3H A;  2VOO A;  4R1H A;  1SVM A;  4PFO A;  1N25 A;  3OYM A;  1TWF J;  4RS8 A;  5KAF C;  2EZK A;  4HF0 A;  4F93 B;  4M9S A;  2LD5 A;  1X19 A;  4D5C A;  1JKP C;  1OFC X;  4YFX F;  4E7S A;  5J8F A;  3PSF A;  1WRJ A;  1RET A;  3KIO A;  5K1Y A;  4HRI A;  2OCC H;  4CCJ A;  2LC2 A;  2MYS A;  2VKE A;  4KIS A;  3QU3 A;  2H09 A;  4B44 A;  3LAP A;  4XK4 A;  4BUP A;  1U2W A;  3L2R A;  2K4B A;  1LVA A;  3CCV I;  2LKS A;  1X2M A;  2VI6 A;  2BY3 A;  2L01 A;  3K4C A;  2OJE D;  3A2K A;  3BR0 A;  2JPB A;  3FWE A;  3BZ6 A;  3WE2 A;  2QEN A;  4RAZ A;  2DPD A;  5IT9 Z;  2FSW A;  2X6X A;  1WFX A;  2HVQ A;  2HZD A;  1TW3 A;  1XN7 A;  1YG2 A;  3MKY B;  4M3F A;  1VFC A;  3GFI A;  5F0F A;  3MD2 A;  1RNL A;  1J09 A;  2FEZ A;  1EA3 A;  3T5X A;  2XAU A;  1NTC A;  2WC2 A;  2ZME A;  4L5I A;  3K4K A;  3FDY A;  3WOD F;  3H9Q A;  3ZQG A;  4IQ4 A;  1X1P A;  2OV7 A;  4HG2 A;  2G7H A;  1U9N A;  3GLL A;  4KN4 X;  1W0U A;  3ZGK A;  3E5Q A;  2V1D A;  2ISY A;  2HXI A;  5IP9 J;  1XGM A;  1TTY A;  4O3M A;  2YX4 A;  3O8H A;  4FCY A;  3PIO F;  5E79 C;  1MMS A;  4CUG A;  1AA7 A;  2GZW A;  2KRF A;  1QA6 A;  5F64 A;  2I8D A;  2NNN A;  3K10 A;  4GYG A;  1HLV A;  1TC3 C;  4D7M A;  2W1O A;  2JSP A;  3E5U A;  2MSY A;  2WA0 A;  3QOP A;  3RCO A;  2KZV A;  4KNY A;  4ON0 A;  1IXC A;  3H0D A;  2BHZ A;  3FM3 A;  3TL4 X;  1JGG A;  1TWA J;  2VQH A;  3R0J A;  2HDW A;  3E6D A;  2Q8K A;  2JJ7 A;  2DXI A;  3H3V K;  5DYM A;  2XB5 A;  2Z99 A;  3G6E I;  1MBF A;  3I56 I;  1N75 A;  4AC0 A;  1UAA A;  5FLV A;  2ZXI A;  2FX0 A;  2X9D A;  3BTC A;  3BZC A;  3SZP A;  1W7P D;  1U5T B;  2VXD A;  4IHT A;  1IN7 A;  5HLI A;  2G9W A;  3ZQH A;  5L3B A;  4LB5 A;  5LFA A;  2A3S A;  2AS5 F;  2F4M B;  4M71 A;  3S3N A;  4AM3 A;  3PO3 J;  3V42 A;  4A3L J;  2DMN A;  4BXU A;  4A2U A;  1Z7L A;  3LOC A;  5E18 F;  3JR9 A;  2NVU B;  5CQG A;  3WGH A;  1V4R A;  5M5W J;  1Z21 A;  5IYC J;  3OOP A;  2H94 A;  1R49 A;  2M87 A;  1P4X A;  1T98 A;  3RDI A;  3VOD A;  3CLO A;  5JHF A;  1R7J A;  2FF4 A;  3IRR A;  3G1L A;  1KON A;  3H1C A;  5D5W B;  1LDK B;  5E8I A;  3G73 A;  2WAQ N;  3BRO A;  2E5N A;  2E5Z A;  5J47 A;  2L3D A;  4GDF A;  2NRA C;  2EZL A;  3HOS A;  2L2O A;  2LH9 A;  4OAZ A;  4BYY A;  1LB2 A;  4E6K G;  5HVQ C;  4EJO A;  2GOX B;  1YYV A;  2XAG A;  2CSO A;  5K7F A;  2KHM A;  3D5S C;  3W2A A;  1ON2 A;  3FZV A;  4LJZ F;  4RMN A;  1MMD A;  2ELJ A;  3GFL A;  4JBA A;  3WGI A;  4KFC A;  4HYE A;  2KIF A;  3CF2 A;  5GP9 A;  3OYK A;  3O6B B;  1U5T A;  3EUH C;  3I71 A;  2DI3 A;  1YIT I;  1IF1 A;  1XG1 A;  3WG7 H;  2NS7 A;  1YJ9 I;  4CGZ A;  4EVI A;  1J75 A;  1JI8 A;  2CV1 A;  2RVC A;  1HBX G;  5ICF A;  5L3C A;  3HYI A;  4U88 A;  2ZBK A;  3F9K A;  3MVP A;  1MDM A;  1T56 A;  1JJ6 C;  4AVZ A;  1BI1 A;  3OYB A;  1WQ2 A;  1VF9 A;  3DWL E;  3MWM A;  1T2K A;  3F3X A;  2M30 A;  4ZYA A;  2JRT A;  1QZY A;  1PDN C;  1FSE A;  2W84 A;  4UXN A;  5J4Y A;  1UHS A;  3MAJ A;  2X1C A;  3BTJ A;  4Z2Y A;  3TOB A;  4CA0 A;  1OLT A;  2BHY A;  3FXU A;  2W4S A;  3K0L A;  3OYG A;  3K70 C;  1MW7 A;  2DDB A;  2EIL H;  2H8R A;  4EJT A;  2PQ8 A;  2MC4 A;  2WAD A;  4XOT A;  3S2H J;  3CDH A;  1PUE E;  1OCT C;  1Z9C A;  4M6V A;  1D3Y A;  1XCV A;  4RGX A;  1YHQ I;  1GUU A;  3JRI A;  4BY1 J;  1SFX A;  1XB4 A;  2XGC A;  3HGG A;  1T33 A;  5CKT A;  1FLI A;  4IHW A;  2E7W A;  2ELK A;  2XVC A;  4IHX A;  4NHJ A;  2VKH A;  4A69 C;  4IHV A;  1O7F A;  4NC6 A;  3BG9 A;  2EIN H;  2TRT A;  3LAJ A;  2MD0 A;  3NEU A;  5E20 A;  4UHT A;  2LYC A;  1VQ9 I;  2M8G X;  1V55 H;  4U7B A;  2XSD C;  1WWX A;  2V6C A;  3JRC A;  3BQY A;  5H20 A;  4ZJZ A;  4IHY A;  4A3G J;  5K7Z A;  3ABU A;  2UUZ A;  5D6F A;  1F36 A;  5C3E J;  2C6Y A;  4MLO A;  4A93 J;  4BQQ A;  2A61 A;  2QYO A;  2GA2 A;  2R0Q C;  3G4S I;  4E7H A;  3GTL J;  5C4X J;  4E7J A;  2NVX J;  1D1B A;  3ABL H;  2W24 A;  5J3L A;  3CCU I;  4OAY A;  1BR1 A;  1R4M B;  3ERE D;  3HBL A;  3I4P A;  3NRV A;  3I59 A;  3ZQ7 A;  3C2H A;  4XN3 A;  2GM4 A;  5EGO A;  1RC9 A;  2DAO A;  2K9N A;  2GIV A;  3J7Z I;  3VFZ A;  3LA3 A;  5HDN A;  1G6N A;  2PN6 A;  2A68 F;  3E6B A;  4UV9 A;  2ELH A;  3ZR8 X;  3E5X A;  2DJI A;  4HQM A;  3ZMU A;  3HHG A;  2KIS A;  3C1D A;  4XSX F;  2QBY B;  4OOI A;  3HOX J;  5BNG A;  2VAS A;  3X2Q H;  2HVR A;  5JFR A;  4R8H A;  4LG3 A;  2XGE A;  3QPT A;  2I10 A;  4UY8 I;  3JSP A;  1QPI A;  1SD7 A;  3GVA A;  2ZFW A;  2NYX A;  1HDD C;  5M5Y J;  4M74 A;  1I1S A;  4F92 B;  3OIQ A;  2L7Z A;  2ZSI B;  1FNN A;  4XON A;  2ZNZ A;  3KX2 A;  5A2Q K;  1MBK A;  2F4I A;  3P9C A;  2FBK A;  2DN0 A;  4BBR J;  3JTH A;  3K4J A;  3CUQ A;  5DCF A;  3R60 A;  1DU0 A;  4XNF A;  1RKT A;  4BXF A;  2GWR A;  3ABK H;  2ME0 A;  5E3M A;  3AG4 H;  3J7A O;  2DMQ A;  4PJN A;  3BT9 A;  4AYB N;  3CCR I;  4IO9 F;  3H3Z A;  2NS8 A;  2MLG A;  4MO7 A;  3HUG A;  5GAG J;  3CCY A;  4QPQ A;  2Z3Y A;  1W1W E;  3JW4 A;  1WPK A;  3ELK A;  1QU3 A;  5AIP A;  1QZZ A;  2VB6 A;  1O3S A;  5HNH A;  1ETV A;  2QLZ A;  1AKH A;  1S7E A;  4A12 A;  4Y3O A;  1MJB A;  3W6J B;  2O8K A;  4S05 A;  1NK3 P;  2HOA A;  2Y9Y A;  2O6G E;  4CZC A;  3ASO H;  3SHF A;  1G3Y A;  1YRN A;  1XDU A;  2IP2 A;  3H3U A;  2R7X A;  1HSJ A;  1XX5 A;  1IN4 A;  2CO5 A;  2ECB A;  1F4K A;  5GPA A;  1LDD A;  1V5G A;  2XF7 A;  4DNC A;  3JRA A;  2ZFU A;  5K5O A;  4MTE A;  3RQI A;  4W1U A;  1R1T A;  3RIR A;  3Q0V A;  1R9T J;  2FD5 A;  1J0R A;  2Y30 A;  4C3J J;  4BXX J;  1T6S A;  4NC7 A;  2WAQ A;  5M3M J;  2VJ5 A;  3VYU B;  3ZN0 A;  1WJD A;  3LA7 A;  3VWB A;  4CYC A;  1VTN C;  4OIN F;  1Z1D A;  5CPR B;  4JQF A;  2HQR A;  4HST A;  1ACI A;  2JA5 J;  5ILS A;  5J1U A;  4NQW B;  1IN5 A;  5D4S A;  1GDT A;  2Q0O A;  1K79 A;  4HNU A;  1JXS A;  4FQG A;  3SEQ A;  4EM0 B;  3I3L A;  2QQ8 A;  5E1Z B;  3HB9 A;  1B8I A;  4OIR F;  1P9Q C;  1KQ9 A;  3A01 A;  3ZXS A;  1ZRF A;  2Y0S A;  1I39 A;  2VOP A;  2DFH A;  5CVV A;  1E2X A;  2EZI A;  2EQR A;  5KK1 A;  4KUM A;  5H2F C;  2ZKZ A;  3H36 A;  2QKM B;  4CCO A;  2MGQ A;  2OQG A;  4NBQ A;  1OJL A;  1MH3 A;  3W6K B;  2ADU A;  3IHU A;  1ZRC A;  3N4M A;  1WJE A;  2KP6 A;  2M9H A;  3VB2 A;  2EFP A;  3IH2 A;  5HOD A;  1BJZ A;  1ON1 A;  1P92 A;  3HSE A;  4MFD A;  2KDO A;  2OUM A;  1K83 J;  3KFW X;  1VQN I;  5KNL A;  2QBY A;  4LG0 A;  1BJA A;  3L09 A;  1ETY A;  5EG0 B;  1W5C C;  5HS8 A;  1ETW A;  4U7D A;  2VE8 A;  4G7Z F;  1MSF C;  1W0T A;  3FM5 A;  5DD4 A;  1RR8 C;  3KEY A;  2YUS A;  3A02 A;  1Y0N A;  3L2V A;  2JA6 J;  1JTY A;  2ZXH A;  3JAM K;  3T8R A;  3FIS A;  4G94 A;  2ETH A;  4L0Y B;  2IAI A;  3J81 Z;  2VJI A;  3E6M A;  2GBY A;  4B47 A;  2LK2 A;  3RQ4 A;  3NAR A;  2P5V A;  1TWC J;  3E97 A;  1ZQ3 P;  4GYI A;  1RRJ A;  1ZK8 A;  4MTD A;  5ICC A;  3WTX C;  4EJV A;  2VKV A;  2ZJP F;  4RAG A;  1IN8 A;  4MQ9 F;  3V7C A;  4OIO F;  1D8K A;  4IXA A;  4CHU A;  3IAM 2;  2DT7 B;  3CDI A;  4GFB A;  2UWM A;  1FP2 A;  2EBI A;  4IRI A;  3TW7 A;  2M0C A;  1TLH B;  3D0S A;  4GXO A;  1HCR A;  5LBQ A;  1UST A;  4OU0 A;  2W57 A;  2DBB A;  1YLF A;  2VQG A;  3GTK J;  3S16 J;  4KIG A;  4LG0 B;  2QGU A;  2BY0 A;  5ERI A;  1LVK A;  3LQQ A;  2J5P A;  2PMH A;  4ABZ A;  1H8A C;  2EZH A;  1FP1 D;  3TW6 A;  2DA6 A;  2IS6 A;  1ENH A;  2CRG A;  2E1C A;  2P4W A;  1JHH A;  1OYI A;  1GLN A;  2X4H A;  4B8X A;  3HRS A;  2DYR H;  3ROU A;  1CF7 A;  4D1Q A;  4OMZ A;  4KMU X;  5H6Q A;  2VQC A;  3I5U A;  2K27 A;  1ZAO A;  2V9K A;  3AKZ A;  5BQT A;  2L02 A;  1V5E A;  2AXT C;  3EUH A;  3VYR B;  4E7I A;  3WU0 A;  1OYW A;  1H0M A;  3IH3 A;  5FKN A;  3HM5 A;  3HOV J;  4L9J A;  1ZEL A;  5K5Q A;  2EIJ H;  3GZN B;  3K2Z A;  2HKO A;  4XLF A;  1ZG5 A;  3F8N A;  3DV8 A;  1XPX A;  2LDU A;  2EFW A;  4FE7 A;  1LFB A;  2M4G A;  5D8K B;  4A3F J;  2ZJ2 A;  1QPM A;  4PGG A;  1WJF A;  4IOA F;  5FRM A;  3NWT A;  2W7N A;  2O9L A;  1Q1V A;  2HTJ A;  3CMA I;  3ZQC A;  2DA1 A;  2P0W A;  2VQL A;  2XF6 A;  3KE2 A;  2LOO A;  3L1P A;  3G2B A;  3CP8 A;  2FBI A;  2LG4 A;  4LIV A;  2HWV A;  3GCM A;  1VQ8 I;  2FQ4 A;  1KYW A;  2UV1 A;  3PNV A;  2QM3 A;  2K9Q A;  2JA7 J;  5IPA A;  1BIA A;  2P7C B;  4XRF A;  1ORK A;  1HST A; 
#chains in the Genus database with same CATH homology
 1UZC A;  2K85 A;  2DOD A;  2CQN A;  2DOF A;  2LKS A;  4FQG A;  2E71 A;  2KFD A;  2KIQ A;  2KIS A;  2L9V A;  2DOE A;  2KZG A;  2B7E A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...