2JUCA

Urn1 ff domain yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DIDERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor URN1
publication title Solution structure of the yeast URN1 splicing factor FF domain: Comparative analysis of charge distributions in FF domain structures-FFs and SURPs, two domains with a similar fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2jucA00
2B7EA 2CQNA 2DOFA 2KIQA 2DODA 2E71A 2KFDA 2KISA 2K85A 4FQGA 1UZCA 2KZGA 2JUCA 2LKSA 2DOEA 2L9VA
chains in the Genus database with same CATH superfamily
3R0AA 4F7ZA 4U88A 4ON0A 2VKDA 1R5HA 5JVGF 4L0ZB 3FK6A 4RS8A 1KONA 1LFBA 3K70C 2XAGA 4N4OB 1ENHA 1WJAA 2RNJA 4P9FA 1J75A 4GXOA 4R8HA 3CCMI 4QTRA 1NHAA 2DBBA 5J6XA 2BOLA 2JMWA 2KL4A 2Z1DA 3BROA 2W57A 3LQRA 3PSIA 1DQUA 4A6EA 2HI3A 3H9GA 3W2AA 3IKVA 1T0FA 4CDGA 3FBNB 2YR2A 2RN7A 5J3LA 2HOEA 3EPZA 3V8LA 4IRIA 1ETWA 4IF4A 2E7XA 2HZTA 3KLOA 1T56A 2RAEA 3BTIA 5ED4A 4XLPF 3D1NI 2NS8A 3S2WA 3V7SA 3CDLA 5B1BH 4BQOA 2WBMA 3CO7C 1SVLA 4BHPA 3RZOJ 2OTJI 4B47A 4L0YB 1RR7A 3OIPA 5FROA 2VC1A 4IKFA 3HYIA 1G3TA 2K85A 3M4OJ 3DLLF 2D1HA 5B3SH 1NK3P 1SD5A 1QZZA 2IPQX 4CCMA 4S04A 3WU0A 1D1BA 1DPUA 3KYLA 3S3OA 1R23A 3S14J 3BDDA 1F5TA 3GBGA 4DYRA 4F55A 5D4RA 3IRQA 4G7OF 2YU3A 2BY1A 3J81K 3QP6A 1BW6A 2AO9A 1UG0A 4CCLA 2JJ7A 1Z6TA 3JAMZ 3HOYJ 2M2EA 3KX2A 2FBKA 4KIFA 4DQ2A 5DS9A 4RA2A 1B9MA 3UKGA 2R7FA 4QPQA 3HM5A 4XOTA 3PFIA 4G94A 3TO6A 4E7JA 2Y48A 3KP5A 4YG2F 2E2IJ 1K79A 3ELKA 4B48A 3HEFA 4HA8A 5K5RA 2F48A 3HXLA 4BE1A 3S1QJ 1V5FA 4B43A 5GAEJ 5M3FJ 1PVEA 1T2KA 1BOAA 1ZLJA 2DJIA 3I56I 1TW3A 3WTWC 1Z77A 2P81A 1UZCA 5HVQC 2P8TA 3DKXA 1YIOA 2CWEA 1D0XA 5LEJA 1D3YA 1OFCX 4OMZA 5F08A 2V9PA 3KE2A 1U3EM 4EEFG 1I39A 1R22A 2W00A 3DPTA 3RTRA 2CFOA 3TL4X 1K7AA 3HIFA 4LMYA 1ON2A 3R0JA 2JRMA 3OMYA 3OYJA 2H8WA 2CFXA 2P6SA 3L00A 2KMUA 2MD5A 4DZPA 1LUJB 2X1CA 4ZTJA 3Q0WA 1WFXA 1MJAA 2R7ZJ 4C2UA 5EEGA 4AIKA 1O4XA 2DPUA 2A5YB 1VF9A 3D5LA 2Q2EA 3WHBA 3QPSA 4RM3A 2HQAA 4AYBN 2L54A 3MAJA 2W85A 1MBEA 4Z2YA 4I0AA 2EWNA 3B73A 4OAZA 1TWFJ 2F4MB 2D45A 4FX4A 1RETA 3DLAA 2RDPA 4BXFA 4WF2A 4OMYA 2VODA 5FKLA 5KCMA 3TGNA 1RR8C 1D0YA 1MW7A 1I3QJ 2X1EA 3PM1A 4PFPA 2RC4A 2XB0X 2R7OA 3GFMA 1VQMI 6PAXA 3F22A 1MDMA 3E97A 2MC3A 3BR0A 1OCOH 4BDZA 2EIMH 3M8FA 2EH3A 4XM3A 2PJPA 2QQAA 3VODA 2WAQA 3LA2A 3ZN1A 1BC8C 2HKXA 3I3LA 4M9ZA 4JK1X 4OAYA 2MW8A 5DUIA 4MQVA 2LREA 2KIFA 2FA5A 2RKHA 1PP8F 4CHUA 4UY8I 4GO1A 4EMSA 2MYSA 2G7UA 2LTPA 5DTDA 2DPDA 1S8NA 1FSEA 2X6YA 2NNYA 2KZVA 1G2HA 3SDBA 3T5XA 1N77A 1N25A 2CUZA 3CF2A 1BBYA 4A5MA 2XF7A 2EILH 2E5ZA 4I76A 3H3ZA 4G7HF 3S17J 1G59A 5IOYA 2OZUA 3MVPA 3K69A 3Q5FA 1VQPI 2XGCA 1ITYA 3A02A 2Y0SN 5L3DA 2DMNA 1WJFA 3FK7A 4PJLA 2NS0A 1ZAOA 2OCCH 1IV6A 1IUYA 3QQAA 3BZ6A 2EA2A 4YIRX 1Y0UA 1EF4A 4E7IA 2R3SA 3SZTA 2IAIA 4LOCA 1YITI 1FJLA 2GXBA 3V8JA 1MMSA 4JYKA 3GZ6A 4ESJA 2M8GX 3OS2A 1FSHA 2LOOA 4EJOA 2F6CA 4G8XA 1O3SA 2LDUA 3L2RA 1LJ9A 2G9WA 2CQXA 2ZFUA 1SMTA 1D8JA 2Y9ZA 3K7AJ 3EYYA 3ZOBA 2DA7A 4M74A 4WX9A 1R36A 2ZXIA 1LFPA 2FRHA 2K3PA 4FX0A 4DOZA 4EJWA 4LFUA 2H6BA 5LEKA 2ZCWA 5HS7A 2FOKA 3LL7A 1VQ8I 5CJ9A 2VPLA 2QEXI 2VIXA 1RNLA 4FT8A 4RGSA 2NS7A 4BL0B 2VBXA 2H6CA 4S0HB 3CCQI 2DFFA 4A69C 2GOXB 1KQ9A 2BVMA 4W97A 3W6KB 3BG9A 3FISA 2A07F 3WE3A 2GA2A 1BA5A 3VYTB 2HR3A 1LE8B 1G8XA 4AIJA 2KT0A 2X48A 4A3BJ 2XHKA 2MBFA 4HBLA 4MTDA 4QWQA 1FBSA 2E5NA 1YW8A 1N78A 4KT5C 5HLIA 1HC8A 4HPQA 4P1WA 1UB9A 2PEXA 2K9QA 1OCCH 2WB1A 4JBAA 3LSMA 3TP3A 3ZGKA 5HLHA 4XRSG 4CYCA 3ZR8X 2COMA 1JE8A 3K4KA 3CCJI 5HOOA 2EV6A 4RLQA 3RJPA 1A36A 3DCFA 3ZMDA 4J00A 3OL3A 1Z7LA 3LOCA 2XAHA 1XGNA 2ICWG 2F2EA 1KU9A 1MD0A 1S9HA 3QAHA 3CP8A 2XKPA 4M3DA 4IZZA 3OSFA 2QKLB 2DOAA 1BI3A 3GTOJ 4NDLA 4OIOF 2L7FP 3T0YA 2EZHA 3LSJA 2L9VA 3AG1H 4Q47A 3NARA 2WC2A 2IGNA 4M9XA 5BOXA 2BHYA 2XPWA 3ZXSA 5JLXA 1WRJA 2LLKA 3CTAA 3CUQC 3F3XA 4BJ5C 4RDUA 1WWXA 3I58A 2XUBA 4C3HJ 3M8EA 4F91B 3TW7A 3CDIA 1IN4A 1SAUA 2L01A 1R6RA 4LIVA 4DYQA 1XSDA 3QYBA 5C4JJ 1S7OA 2B63J 1SVOA 3DKYA 2HTJA 4Q4ZF 3BCBA 4IHXA 1WJDA 1FYMA 4KUMA 2HQ5A 3SHFA 2KDZA 4PJMA 1IJWC 2OC6A 3BTCA 2HOAA 3QPHA 4A6DA 4Y13A 4Y52J 4AC0A 2PI0A 1GHCA 4HYEA 1TWGJ 3FXRA 3FXOA 5ERIA 2EB7A 1TT5B 3D5RC 3JRHA 5E8GA 3K2AA 1HKQA 2LYCA 1TZLA 5LGUA 3FMRA 1OJLA 3G1MA 3L2QA 4DW6A 3X2QH 1IUFA 1B1BA 2CO5A 1MNDA 5HODA 1B9NA 1DGWY 1R1VA 2CQQA 2DDAA 1U9NA 1VQNI 2OBPA 2V79A 2EIKH 1EH8A 2IA1A 4GYGA 2OTLI 1FIPA 1ETXA 2DN0A 4E6KG 3MWMA 4V2GA 4A93J 1XS9A 4O5VA 3I4MJ 5EGOB 2OQRA 4RMNA 2F4OB 1ZTRA 2KRHA 1I6HJ 4Y3OA 1YRNB 4BAYA 1OQYA 1SD6A 1TWHJ 2R7SA 2ME6A 4UNOA 1UHSA 4IVNA 3JRIA 2JA7J 4XBFA 2GXAA 2Z2SB 3MD2A 4Q5SF 4LJZF 1V5GA 3G1LA 1WCMJ 1QHGA 4D0PA 2O0YA 4AM3A 1EA3A 1WVRA 2VJ5A 3RI4A 2HQRA 3HKZN 2ID6A 2X4HA 1OMIA 4MEYF 3IH3A 4PZJA 1H89C 1BR4A 4HEA2 4H4KC 2M87A 3HOUJ 3ECHA 3E6MA 4JP0A 5JHFA 3GTLJ 2ZJRF 2JK3A 2HVQA 3KPHA 4KT6A 1X2MA 2KKOA 1YO5C 1IAWA 3O8HA 2TDXA 2O9LA 2WV1A 2NVQJ 1BI1A 4RAYA 4L9JA 1ZREA 1Y8QB 3E3VA 5FO5A 2H1LA 1X1DA 5AIPA 2Z99A 1AA7A 3K4BA 4M3EA 2BZTA 2YS9A 1ORKA 2BXZA 2Y30A 4FETA 3HOWJ 2JSCA 4LLGF 3AKZA 3A4CA 3DEUA 4X1EA 4KYWA 2DA2A 5ICEA 5H6RA 4A0YA 2DFHA 3U9GA 1H8AC 4EM1A 1MBFA 5A2QK 2HYJA 1ZHFA 2OD5A 4IJAA 3U2RA 2XAJA 5AIQA 3GF2A 2A6HF 2HKOA 3IV5A 3CCSI 2O8KA 5K1YA 2HS5A 2IW5A 1V55H 4D5FA 1Q1VA 1U2WA 4QPOA 1Y6IA 5K7ZA 1PDNC 1FTZA 1IRGA 1MSEC 5E1ZB 3J81Z 3CMYA 1WPKA 3EDPA 3W2WA 2Y2ZA 1ZYRF 4FCYA 1WQ2A 1VQKI 1J9IA 2HDCA 2V9VA 2YX7A 4XRMA 1S6LA 3CCYA 1K78A 1HQCA 3N05A 4ZYEA 4XORA 1FC3A 1OISA 1JUMA 3OWTA 5FRNA 1B72B 1JKQC 2JWTA 2JTVA 4XLHA 3S3NA 1P7IA 1T8IA 2R5YB 1POGA 1XCVA 1F1ZA 2KIUA 1WJCA 4RB3C 1FP1D 2IA0A 1MMAA 3E6BA 3DBHB 2HFHA 2E1OA 3I59A 3BZKA 1FY7A 3MFKA 1WSUA 4FTHA 1S3JA 4MEXF 2ZSHB 2JQ7A 3WG9A 3ZQQA 3NWSA 2DQRA 2E35A 2FQ3A 5DV5A 3DF8A 4HNTA 1MNMC 4BY1J 1T98A 1KYWA 1J0RA 4X0GA 1IF1A 3RYPA 4LD5A 1XGMA 1YG2A 2M30A 3I0TA 3GTJJ 3BQYA 3FIWA 2HZDA 3CUOA 5J8FA 4A3KJ 3HC7A 3K4NA 4AD9A 3C1DA 1VZ0A 2L3DA 3MCZA 2IVMA 3FM3A 1W4MA 2K02A 3CCEI 1VTNC 2L7ZA 4CGZA 2RQQA 3REOA 3HB9A 1VFCA 2LSOA 5DM6F 4BE2A 3I71A 5FLMJ 1KYZA 5J1UA 4A12A 3KP3A 4NHJA 3KEOA 1E3HA 3F72A 3IHUA 1O3TA 2RVCA 3WTYC 4BQQA 1G3SA 4UVAA 1QA6A 3W2VA 5LFAA 1I5ZA 5LHGA 2DLLA 2QUFA 4HQMA 3IH2A 2D5VA 2XAFA 1Z05A 3KETA 1P6RA 3JRCA 1ZLKA 2LK2A 1R49A 4DYCA 1RI7A 2A61A 2E60A 3PSFA 1IRZA 2XASA 1X1BA 2OJED 5EJCA 5LD2C 1YFHA 2DW4A 2HYFA 2PMZN 1FOKA 3H0DA 2VOPA 3DTEA 2M45A 2E7WA 3ERMA 4CZCA 2R5ZB 1LDKB 4BACA 5CVJA 2ZJPF 3K4CA 5CYVA 4L5JA 2VLAA 3GWZA 4NQWB 2CU7A 2ZJQF 3WGHA 3LSPA 1UG2A 2LVSA 4EJVA 4F92B 4GDFA 1WJEA 2W1OA 5FD5A 1SANA 4KN4X 2X1DA 5D6FA 2R7WA 2XIGA 5ICCA 4IOCF 3F9KA 3BG3A 2W4SA 4XLEA 3ZMUA 2KJCA 1EH7A 3ZMZA 2P0WA 4HF1A 4L18B 1Z21A 4XNFA 1PUFB 4A0XA 5IYBJ 3I9V2 1FOXA 1X3WB 2GQQA 5J47A 3HZJA 4I0BA 1RUNA 4HF2A 1PP7U 3TO7A 2Y0MA 5H2FC 3HUGA 3J7AO 2G7HA 1P7JA 1J2XA 5HDGA 2E1CA 1MIJA 4RB2C 3H5RA 4UUSB 2MG4A 3HOSA 3BG5A 3ZCOA 3QPLA 2V1NA 2KJBA 4BEHB 1OYYA 4ZDLA 4MHGA 3U1KA 1ZARA 5DDGA 1ZGJA 4LLLA 2WV0A 2K9LA 1SEUA 4XONA 3AL0B 3HGGA 1XD7A 4XLFA 4KNYA 1IDZA 2HQNA 4I01A 4ASNA 2D1VA 4NC8A 4DBQA 2DK8A 4JOMA 3BR6A 3OYDA 1IXSB 1DPRA 1JT6A 1GVDA 1ZKGA 2EQRA 4ESFA 4BBRJ 1AU7A 4YFNF 4BHBA 4HV5A 1Z3XA 4LITA 5F64A 2E19A 3ML6A 3P9CA 3TW6A 2H27A 3ZRGA 4D7MA 1X4OA 4BBSJ 4A3CJ 2XRNA 4PFOA 3QOEA 4Q48A 4XLNF 3D0SA 3DWLE 2O8XA 4AIDA 5LGTA 3GYHX 2GLOA 1FOYA 4M3FA 3T8RA 5JR3A 2OQGA 2EJRA 3O3KA 2QKMB 4ZH4F 1IDYA 3NAUA 2VB6A 4AWXB 2A3SA 3M8JA 3G73A 3SEZA 4KDPA 2A68F 4CH7A 1CF7A 1W7PB 4EJTA 2PJRB 1HSJA 3DQVC 1V54H 2DA5A 2K4JA 4LB5A 3S1MJ 3ABKH 1UHWA 1FPQA 3RYRA 4A0ZA 2IRFG 3SZPA 4UB6C 3HRTA 3WE2A 3O6BB 4ZZLA 4B1RA 4P9UA 2DMTA 3RPQA 2AHQA 1NG7A 4YIIA 1XX5A 1OYWA 2PX9A 3CMEI 1MKMA 2ZXJA 3SQNA 4LB6B 3ZPLA 3VOEA 4ABZA 1ZK8A 4GFBA 3VPRA 1XMKA 3BWGA 3QPTA 4S05A 2P5LC 2HNHA 1JJ6C 1U8RA 4UB8C 4Y17A 3PUBA 2LBFB 3IP4B 4XRSA 5TGTA 2HEOA 1WKMA 1B8IB 1O57A 1VNDA 2WA0A 2K40A 1F4KA 3BJAA 3ZMSA 4CCOA 2OA4A 2OPTA 3K0LA 4E7SA 3B6AA 2QSHX 1LPQA 1OCPA 2LRDA 4ZDOA 5CKTA 3KEYA 3PNYA 3DBLB 1T38A 1ZRCA 1ETKA 1QQIA 3JW4A 3QYFA 3R61A 1TNTA 2ZC2A 1XB4A 2DT7B 4ZC3A 3GTGJ 4A5NA 2M4GA 2Z5UA 5IP9J 1YHQI 3GTMJ 1RPWA 2CQKA 5DCMB 5H6QA 3VB2A 1YX3A 2L5QA 1HBXG 4ZTFA 1R1TA 4HOBA 2VBZA 3HRMA 2R7RA 1SD7A 2XPVA 3LSTA 3ASNH 1GXQA 1K4SA 5HDKA 2LY2A 3IH4A 3JSPA 1ZG5A 2XB5A 1HKSA 3LSHA 2IP2A 2H94A 3C2HA 3LNQA 2A5WA 4XR6A 4FE7A 2D2WA 2MH2A 3KP7A 4C9YA 3OS1A 2DU9A 2F5DA 2MLGA 1JKPC 4GYIA 1FBQA 3OYCA 2EINH 1EKEA 3LSKA 4CCNA 4HLXA 3D5SC 4CXFA 2JT1A 1FTTA 4L9TA 4ETSA 2CYYA 4ENNA 2EFQA 1TC3C 1HOMA 1MJ9A 4CYDA 3E1SA 3MZ8A 4II2A 1IW7F 4P96A 2X0LA 4M6XA 3GX4X 1PUEE 1Z0XA 2NNNA 2OCEA 3F8MA 1ZH5A 2HWVA 4ESBA 5LHIA 3A1YA 2H09A 4JX5A 3M1CA 4AUXA 4KIGA 2WTEA 1OCTC 5IYCJ 3ISPA 3K1NA 2HVSA 1OCRH 2CH0A 2JPCA 2VQLA 2X51A 3K1PA 3S15J 4BQNA 2O6GE 1IG7A 3OYAA 2VJ4A 1P9QC 2NOGA 1RUOA 1T95A 1S7EA 4MO7A 2HGCA 3AG4H 1IRXA 1MMNA 4B4CA 1UFMA 1E17A 2VBYA 3K1MA 3H5AA 4CUGA 3WG7H 5E1WA 4RAZA 2VPRA 3DFGA 3Q9VA 2V1DA 5L3FA 1JT0A 4HX7A 1K4TA 1P92A 5DD8A 2LR8A 3KP4A 3PQJA 5A2QZ 1R7JA 1UJ8A 2LFBA 1VQ6I 2WWYA 2BV6A 1VQLI 2HDWA 3JRDA 4U0VA 2XSDC 3ASOH 3WTVC 1EJ9A 1MBJA 1FNNA 1S5LC 2M1BA 2PLYA 1I3AA 1VQOI 1HXDA 2NVTJ 3T8TA 5ICGA 3ESWB 2PQ8A 1WGXA 2E36A 3FXUA 1LFUP 1QZEA 3KZYA 4WXHA 4AVZA 2F5VA 1SVMA 4JX4A 1SAXA 2M7AA 3HSFA 5LRSA 1IZ1A 3LSGA 4O6JA 2LKPA 4BU2A 4HNVA 3TOBA 2VQGA 4V2FA 2A05A 2ELHA 4IQ4A 4BXUA 1YTYA 1HDPA 2IJLA 2IT0A 4XSXF 1QRYA 5IOZA 4AIHA 3FKJA 3KCCA 4NC6A 1FMVA 3V4GA 1T6SA 3BTJA 3P9KA 3IAS2 2ZNZA 2FU4A 3OYBA 1DUXC 1T08B 2W24A 5DUKA 1YI2I 5D6EA 3G6EI 2WB1N 1GVJA 3CC4I 5J4YA 1U5TB 3TKYA 2GOMA 1AWCA 4WCGA 5LRRA 1I6XA 5D5UB 3E6CC 3JTHA 2FX0A 2VOOA 2K9NA 5IT3A 1ZELA 3IWZA 3GTQJ 2EV5A 4XN3A 5KVRA 3VEPA 4HX4A 1FOWA 5FB2A 3WTTC 2EBIA 3CCLI 4E7HA 5EDNA 4BYYA 2Z3YA 2O5RA 1FMWA 5EZHA 3OYIA 3DEWA 1T39A 5BMZA 5LGNA 5DCFA 2HOTA 1A5JA 2LD5A 4CA0A 1ACIA 2W25A 3RSNA 1EH6A 4II3A 3J7ZI 4GRIA 4XN0A 4A3MJ 3VYUB 5E18F 3VDXA 1UHMA 3CQZJ 4KIBA 3HSEA 3VYRB 2L9NA 1S72I 2M34A 2LY1A 4EGZA 2XKOA 4XL9A 4ZYAA 2NVUB 1AOYA 3S32A 9ANTA 2LC2A 1Z91A 1ZN2A 4Y33A 3T1BA 1YQAA 3WGGA 1MH3A 4PSWA 2HXIA 2LNBA 5D4SA 5L3EA 1JGGA 4WXDA 4A3GJ 3FXKA 1LE8A 3V7CA 3RKYA 2RQPA 3JRAA 3TO9A 1J7KA 2BVLA 4AU7A 2XC7A 2UV1A 5FD6A 1UMQA 1IGNA 5K7HA 1YJWI 3HTSB 2BY0A 3Q3SA 2H8RA 2JA2A 5CVUA 1TQPA 5F0HA 1TTYA 1P2FA 4BQAA 4I99C 1F9NA 3SXYA 3F21A 1SMYF 3BCAA 4JQFA 5B66C 3TQNA 5CPRB 2X6XA 5EEAA 3ZP5A 5L3BA 2R7VA 1S29A 4IOAF 4ENMA 2DI3A 2FOWA 3N97A 1ZRDA 1E0EA 2CG4A 2NVYJ 3GMEA 2OU2A 3IC7A 4I09A 4NBQA 4NUBA 3MKZA 1HSTA 5FKKA 2XAUA 2BW3B 3FHZA 2DT5A 2UXNA 3ECOA 3I53A 4KMUX 2JA6J 1S7AA 2PBIA 4DJAA 1ETVA 1IO2A 1WI3A 3I5UA 4B3XA 3G4SI 3EETA 3ZQLA 1JUSA 2TCTA 2XGEA 2R0QC 2YPRA 3OR1C 2ESHA 4E7LA 5CVIA 3DV8A 5JFRA 4WXCA 4IO9F 4DGWB 1WH7A 3GVAA 5C44J 1BIAA 4QIWN 1GV2A 1U8BA 3ABUA 2DYRH 3CUQB 2DA3A 3ZQHA 3A03A 4D7NA 3TBIA 4M9SA 1OCZH 5L3CA 4OIPF 3SEQA 3LA7A 3LWFA 3CMAI 1FIAA 2W7NA 3CCVI 1CGPA 2IXSA 2FJ1A 4ZYDA 1QVUA 5IT9Z 1W5SA 3BG7A 2IS6A 1ETQA 5DEQA 5C3EJ 2DJNA 3LAJA 3CLQA 1Y1WJ 3BR3A 4LG0B 3LMMA 5AONA 5GPAA 2KRCA 4MNUA 5KAFC 3BTLA 2M0CA 2Q1ZB 5F0CA 2PG4A 2VL8A 4FE4A 1KGSA 1H9GA 1MGTA 4OOIA 3B6CA 3SFIA 3RPUA 1VQ9I 4HRIA 2K86A 3A01B 2ZJ2A 2WY8Q 5LLQA 2NVXJ 4RLFA 3W3CA 4BNCA 3AG3H 5FFXA 2ZKZA 2W82A 4M73A 3K9TA 4EJUA 2F5FA 2N8GA 4CCJA 3K4LA 2E1MC 5EG0B 3S16J 1HF0A 1JUPA 2NAZA 2CS3A 1USSA 5E3NA 2QENA 3UNGC 2HOSA 3F8NA 3BLYA 1IXRC 5CQGA 1BJAA 5EGOA 3BR5A 3RDIA 4ZYGA 1YRNA 3R60A 2VI6A 1FYKA 2FSWA 4MTEA 3L2VA 2E2HJ 2UXXA 4LK0F 4D5CA 2R7DA 3I54A 4CO8A 5IP7J 5FJ8J 1RRJA 2LF8A 2L2OA 5CVRA 3V7RA 3MZHA 3NRVA 1AKHB 3P9IA 4OU0A 3O8GA 4RGRA 1RESA 3S2HJ 5B5EC 3CMMA 2O7OA 3BJ6A 5LBQA 5EYRA 4C3JJ 2KRFA 2NXNB 4WWCA 2STWA 5J1YA 1E3PA 3SZGA 2JSPA 5FLXZ 1HW5A 2X6WA 4A3JJ 2PFBA 2QF7A 1XPXA 1K61A 3RKXA 1V3FA 2ZNYA 2M9HA 2R7QA 3E0JB 4CCKA 3ZQGA 2P5KA 4PSXA 1L3LA 1H9TA 2JA5J 2QQ9A 2A6EF 5J1RA 1R5GA 4MGRA 3W6VA 1VQ4I 2VONA 3ZMVA 4HG2A 3ERED 1XMAA 2IS4A 3E7LA 5D5XB 1W36D 3WU1B 3KYDB 3C2GA 3RCOA 5IYDJ 3TMOA 2MSYA 4NC7A 1KU3A 3BP8A 3FZVA 5BNGA 3K10A 3TEDA 5LHHA 3OOPA 2ISYA 1AHDP 2VKHA 3ABLH 1R00A 4R79A 3CJTB 2E71A 3H0GJ 2YU9J 2ZMEB 3IAM2 3C7JA 3NQOA 4G7ZF 4E7KA 2P6TA 2AQEA 2W48A 1D1CA 5J40A 4KA4A 1A6QA 1G3YA 4L5IA 2Z16A 1H88C 1M1EB 1XDUA 2AS5F 2QBYB 1JKRC 3CLOA 2VBWA 1XGSA 5HLTA 4Y15A 3OS0A 2VQCA 1HLVA 3KZIC 3HOVJ 4ANJA 4NB5A 1NG6A 3HUGB 3GZNB 2YUSA 4UV8A 1FEXA 2FMYA 2BHZA 4B09A 1WJBA 1X1PA 4RGUA 3GO5A 4PDKA 2R93J 3RPUD 2LY9A 1PJRA 5ILVA 3CC2I 1U0JA 3HHGA 3HL2A 3HBLA 3KP6A 4C3IJ 3P5JA 1QBJA 3AL0C 1D8KA 2XGDA 2Y69H 3GFIA 1B72A 2IS1A 4MLOA 2ESNA 2LF7A 1DDNA 1MBGA 1BJZA 1OLTA 2L0KA 4PK4A 5TRDA 3B02A 1JJ8C 4HW0A 1OR7C 2E1NA 1SFXA 5ICFA 1IN6A 2FBHA 2K9SA 4M3GA 3GFJA 2R5YA 2Q0OA 3Q9SA 5K5OA 1TWAJ 1XSVA 3WODF 2MA3A 3H9JA 5TJJA 4EATA 5GADJ 4ITVA 5B1AH 2DMQA 5FRMA 2K5CA 3DEEA 3CF5F 1I50J 4G6QA 1TLHB 4HX8A 5E8IA 1A04A 2F4IA 1QNTA 3H92A 2GBYA 4BGDA 3I55I 2HVRA 2KFDA 2DTRA 2PMZA 2ACJA 4P5OA 4M72A 3HOXJ 3F6OA 3MKWB 5BPIA 2XGXA 3DBRB 5JLWA 2BEOA 4CSWA 2CW7A 3MZYA 4F3QA 4PCQA 3F8FA 2XROA 4EV0A 1LNWA 1KQ0A 3HG9A 1VI0A 2K27A 1U78A 1TL8A 3SDGA 2R7UA 3R6SA 2V1XA 2DA4A 3FX3A 1GXPA 1Y8RB 2DO7A 2TRTA 3ROUA 2E2JJ 3KLNA 2GAUA 4A3LJ 2VUMJ 3PJRA 1YS7A 3AFHA 2C6YA 1R9TJ 2DODA 5E3MA 3COAC 2B9SA 3TP0A 2M7BA 3BY6A 2DK5A 3RQ4A 4N4NB 5KAIC 1OYIA 1Y56A 1TQMA 2ECCA 2ZXWH 2KZGA 2UZKA 4R1HA 2I5UA 1O3RA 1X2NA 4N9HA 2DT6A 2M0MA 3M07A 3JRFA 1A6IA 2IEKA 3DPLC 2L9SA 4A3EJ 1U9OA 2VE9A 3CCRI 3PNTA 3RQIA 2A6TA 1Q1HA 3GFLA 4ZDPA 2J5PA 4GGGA 1W0UA 2DOEA 4XLCA 4C30A 2DCEA 5IT9K 1WHUA 1Z6RA 1LB2A 1MSFC 3FXJA 3L09A 5BQTA 1RZ4A 1K83J 4WK8F 3K2ZA 2XSJC 2G0EA 2VQHA 1ONVA 2QGUA 3I64A 2R5ZA 1LDJA 2VXZA 1W5TA 3E5UA 3ZQIA 3QOPA 4OWRB 2BBYA 3OYEA 1X19A 4RB1A 4NQWA 2K4BA 3N4MA 4P55A 2A69F 1X58A 4YIFA 3S3MA 4KMFA 3G1OA 1YW7A 3FHNA 1G3WA 2FEZA 3I4PA 1IN7A 1G4DA 2CGPA 1D5YA 4MFDA 5GPCA 1DGRM 2RV8A 2Y75A 2RREA 1O7FA 5DYMA 4BJTA 3ULQB 2PN6A 2MC4A 3A2KA 3FXLA 3SYTA 2BGCA 2WAFA 2LG4A 2V9KA 3F8BA 3F23A 1PUFA 2Z33A 3OYKA 5FGMA 3M9AA 1IRFA 2E34A 3EUHA 3G2BA 2UUZA 2Q2EB 3MMYB 4N0BA 4U0YA 2STTA 2JPBA 4EGYA 5F0FA 5E79C 3H3UA 3UR3C 3DXJF 3RZDJ 1FLIA 3Q0VA 1Z9CA 3A0BC 5E3OA 1KU7A 3F0CA 2MABA 3JREA 4UUSA 3OYHA 1ZGWA 2X6OA 2XV4S 3OIQA 2QCOA 2CMPA 2MFZA 5GTIC 1MDMB 3OL4A 4BEHA 5HNFA 2AXLA 1FBUA 1ON1A 3BQZA 5FLXK 2IGKA 5J8CA 2YX4A 5EF6A 1A31A 5D5VB 1XTAA 1O7LA 1YIJI 3K4MA 1O3QA 5E20A 1OR7A 3FKIJ 2YSRA 2EV0A 2MD0A 3BR1A 1HDDC 3AG2H 4BH9A 2DMPA 3CJNA 3HGYA 5L3GA 3BPVA 5BPDA 4PJNA 2I10A 1ZG1A 2BYVE 2VC0A 3BG6A 5GTHC 1USTA 3GCMA 1GT0C 4HAMA 4G6DA 3IL2A 3DU6A 4C2TA 4O3MA 4U87A 4U7DA 4HV6A 1X1AA 3GTPJ 1P4AA 3IKTA 3SJMA 4M3BA 4I6ZA 3G71I 1ETYA 5DM7F 1B59A 4KITB 2XF6A 2FQ4A 1FWZA 2IBDA 4EQQA 3LQQA 1W7PA 2PJRA 2ID3A 1TNSA 1KZHA 4BKXA 1R71A 4A2UA 4UHTA 5JI6A 1SFEA 1J59A 4B8XA 4YEJA 2K9MA 2V4JC 4XQFA 3QWLA 2DXIA 3LFKA 4FHTA 3OOUA 1OKRA 5ILSA 3HJEA 2B7EA 1R1UA 1DP7P 1QU3A 4AYBA 4D9JA 1IV8A 2VASA 2WAQN 3ZMTA 3GLXA 1IN8A 3C3WA 4L9VA 2O61A 2ZSIB 4XKWA 5M5YJ 2K7LA 3GLLA 1MZBA 5TISC 2HXOA 4UUVA 4BJ6C 1V4RA 4HSRA 3F6VA 1LEAA 2QWWA 2LP0A 1BI2A 1NTCA 4UXNA 2L4AA 3GUDA 2RNGA 1W0TA 2LBFA 2L9RA 2QQ8A 2VKEA 3E6DA 1B8IA 2F5CA 3OYGA 2QVOA 4ENJA 3WTXC 1LDDA 3JCUC 1APLC 2EK5A 2XAQA 2X85A 4FASD 5HLGA 4B3AA 3W6JB 1NK2P 5EEHA 3MEXA 2IA2A 3HOTA 1XSXA 2DMUA 1I27A 4RB0A 3PO3J 2CRGA 2KHMA 1U5TC 4DBRA 2XF5A 2JZYA 2P7CB 3CDHA 4IHWA 1D0ZA 4XKCA 1HW2A 4IPAA 4CICA 4EM0B 4CYCB 1WI9A 1E2XA 2WAEA 5DCMA 2Q8KA 2CV0A 4BE0A 2GIVA 4YFXF 4L9NA 2Y0SA 4HZFA 3FF5A 1P4WA 5DD4A 4I2OA 1MBKA 1KQ8A 4RAFA 3CCUI 1UELB 4E70A 4IHTA 5KNLA 1YE9A 1QO0D 3VFZA 3PUFA 5FFZA 3CO6C 4BXXJ 5CVVA 1W36C 1MBHA 3LAPA 4M6YA 1GUUA 2M8EA 3DU5A 3FXQA 2M3AA 3LA3A 2HDDA 1L0OC 3GZ5A 1KA8A 2MLKA 3VSKA 3U21A 1R5ID 4RAGA 5M3MJ 2RGVA 2ZBKA 1FX7A 4JX6A 5CQEA 5F1JA 1RIOH 3ZQFA 3L1PA 1W7PD 1MMGA 3WGIA 4EM2A 3JTGA 2AQFA 3MKLA 4RBOA 3H35A 3V42A 1J5YA 1K6OA 4CZZA 1I1GA 1DU6A 1U6GA 1BR1A 4XK4A 4XLAA 5FKNA 3WTZA 2CUJA 1Y1VJ 3M1EA 1SC7A 2MGQA 3KZZA 3HDDA 2CQNA 3PIOF 5M5XJ 3S2DJ 5D8KB 5E17F 4I02A 4YRVA 4HDUA 2P4WA 3ZQCA 5M5WJ 1YJNI 3M3YJ 1LVKA 2ELJA 3QODA 3CZ6A 1G6NA 5GP9A 1ZGAA 1KU2A 1X1CA 2BY2A 3ZN0A 2JN6A 2EZIA 2XRLA 5K7FA 4YFKF 3BT9A 1QZYA 3GEZA 3F8CA 4XOPA 1JTXA 5FLVA 4HF0A 3VSLA 4PJJA 4BUPA 1X3ZB 5FKMA 1HW1A 2OF7A 2QLZA 3DP7A 1TP4A 3WU2C 2AXTC 1A35A 2CW0F 2DFEA 4MFEA 4F93B 2FBIA 3KP2A 2ZB9A 3EYIA 2VN2A 2FF4A 4LK1F 1WJ5A 2ZXHA 3DPUA 1Y0NA 3L9FA 3PO2J 1SFUA 5IY5H 2R4GA 3J7AY 2FMLA 1MMDA 1RKTA 5ILUA 3NWTA 3JAMK 3PNVA 2DYSH 2V7FA 2EA4A 3QYEA 1N75A 5GAGJ 2Y9YA 1TW2A 5F1RA 2EPFA 2GM4A 4BHCA 2JVGA 2DA6A 3BZCA 2QQBA 4D1QA 2L02A 5D5WB 1X4PA 3J80Z 1IC8A 2ME0A 3BPXA 4QSHA 2ZO4A 4U0WA 2ECBA 3WHCA 2XVCA 1JGSA 2R7XA 2P5VA 1D5VA 2Y31A 1QGPA 2QM3A 2LH9A 2VXDA 2KDOA 1RC9A 1Z7UA 4KJZA 3RKWA 3DKWA 2XDVA 4LLNA 1TQIA 3QU3A 4DNCA 2L4MA 2ELKA 4ZYHA 3TDUC 3GXOA 3JSOA 2PMHA 1B4AA 5IPAA 3DTIA 2UWMA 4F52A 2FXAA 2EFOA 1FYLA 1SD4A 2VJJA 5F6FA 4ZZDA 1HCRA 1U5TA 5E1XA 2M4KA 4HLYA 4TV7A 3QRFF 1E3OC 3HRUA 3EUKL 1XDSA 3K4JA 4XMYA 3OYFA 3JRBA 2QA4I 3H1CA 4LIUA 2FE3A 4XIDA 2EFWA 3ONQA 4BS9A 4A3FJ 2FD5A 3LSIA 3ABTA 5KHDA 1JTYA 1B6AA 3L2WA 2DTZA 4GCVA 2LKXA 2R7TA 4J19A 3IWFA 4OIQF 1HKTA 1LVAA 1BR2A 4PUSA 3PQKA 2CV2A 4XICA 3MQ0A 4DZJA 2OV7A 1OPCA 1MH4A 3U1DA 1GLNA 1JI8A 4C2MJ 4Y4RA 2HPIA 3L2UA 1QVTA 1TWCJ 4KICA 2EFPA 4W1UA 3RIRA 4OINF 2QSFX 3L2CA 2HYGD 3HRSA 2I8DA 2Z9OA 1T33A 4PJ0C 2ISZA 1F43A 1PYVA 2GWRA 1Z3YA 2FUG2 5D8LB 1BL0A 5HS9A 1K78B 2DAOA 5FKOA 2LMDA 5BS6A 3OYLA 3KYCB 1DP3A 1J09A 3FMQA 2CUFA 2KIMA 1ZR2A 1LKXA 3BC8A 5IP6A 3IUOA 3HKZA 2CQ7A 3S1RJ 3S1NJ 1RKWA 3EUAA 3PIPF 2M5WA 3L7WA 3FXMA 3MN2A 2ADUA 1ZQ3P 2K3FA 1F36A 1XCBA 1JKOC 1UAAA 3I4NJ 2CV1A 3OR2C 1EV7A 3RKQA 4B44A 1XG1A 3I59B 2HTSA 1STZA 3WTUC 3FBIB 2JVHA 1VQ7I 4X6AJ 3CD6I 1Z67A 1FZPB 3HOZJ 4LG3A 1SFKA 3M7GA 4EVIA 3C18A 4XKBA 4J01A 3HPHA 3FDYA 4IHVA 1W5CC 2L7KA 4UVBA 1CQTA 3FWEA 3BOQA 4UV9A 2ZFWA 3GTKJ 4E7ZA 1R4NB 1TT0A 1BC7C 3KEQA 5GAHJ 1LQ1A 1XN7A 1VQ5I 3TDZC 3JRGA 1R58A 1XGOA 3JR9A 4IL6C 2CJJA 2ZMEC 4PGGA 4G6TB 2KIQA 2PMUA 1BM9A 1JHFA 2EFNA 4HDVA 4XRFA 3H36A 2DDBA 3QP5A 2BW3A 4AVPA 2OAZA 2GIZA 3OY9A 2IGMA 5HDNA 1YW9A 3MKYB 4KN7X 3OV8A 2H1KA 2NOJB 3WTSC 1MJBA 4Z6YA 3P7NA 4U7BA 1FT9A 3H9QA 3Q0UA 1BW5A 3LFUA 2COBA 1HA8A 2DOFA 2KP6A 2O03A 1QHHD 3HPGA 2EZKA 2FNAA 2NRAC 2LKSA 2GA1A 1D1AA 1YX5A 5HNHA 1V5EA 3PFYA 4NNJA 1BOBA 3CUQA 5J4VA 4ENKA 3OYMA 4XKVA 2VKVA 4RM2A 4BY7J 4IRGA 4V19K 3LSRA 5HS8A 1ODDA 1P4XA 1BI0A 1T0FC 3S8PA 1QPMA 4N9IA 2V6EA 2BY3A 2ETHA 4A3DJ 1YOVB 2QYOA 3NEUA 3SFZA 2KPMA 1JXSA 5KK1A 1R4MB 3ABMH 2CUEA 3E5QA 4LG0A 4K2EA 2FNPA 5H20A 5CLSA 4UUTA 3IRRA 1ERDA 3AAFA 2X9DA 4I7HA 1K6YA 3A01A 4IHSA 3KIOA 2CSOA 4LGWA 3EUHC 1JHHA 5F27A 2V6CA 3K70D 3EQLF 3E5XA 3BR2A 4PGHA 5EG0A 1ZR4A 4I98B 1UCRA 4IRHA 2HPMA 3H3VK 2DFIA 2IGOA 2VE8A 2P7VB 2QSGX 1IXCA 3FMSA 1I1SA 1H0MA 2KISA 1C0WA 2OZ6A 2HU9A 2KQRA 2E1MB 1X3UA 4E4HA 3CJQB 1QPIA 4G12A 2VT2A 2NYXA 4HNUA 1BN5A 1XC5A 2VT3A 3HHHA 3TOAA 1ZRFA 4L5EA 1BIBA 3J80K 1AKHA 1GDTA 5C4XJ 4HSTA 3R4KA 3KFWX 4QLCU 3OYNA 1YJ9I 4M71A 2W84A 1FP2A 2GZWA 2V26A 5JVTA 4IXAA 1XMXA 1ZG3A 2BE5F 4MQ9F 2JRTA 2EIJH 1Y39A 2XPUA 3ZQ7A 4RGXA 4M6VA 1ETOA 4KFCA 2GXGA 1ULYA 3O2PE 1SFOJ 1YLFA 3OIOA 4IQJA 3G3ZA 5JHUA 3C2BA 1GV5A 5F04A 2IS2A 2L7MP 3K6GA 5EZGA 4HQEA 2F5EA 3HSRA 3H5NA 2JA8J 2DA1A 2B0LA 1WH5A 3CESA 1MNEA 3V8KA 2V1UA 1Z1DA 5K5QA 1NH3A 1LEBA 4A3IJ 2WADA 4UVCA 4BDYA 1REPC 3DTKA 2DQLA 4MIMA 2O3FA 3CC7I 3VWBA 3S93A 4H0EA 3GW2A 3QU6A 1CF7B 3CJRB 2OUMA 4G9YA 2BXYA 2VJIA 4OIRF 3J7YJ 4IX7A 1YYVA 4FISA 2ZMEA 2JUCA 4IHYA 3A0HC 2R92J 3CP2A 3VYSB 1W1WE 3HTUA 1DU0A 2KLOA 2WY7Q 4XSZF 1WZ2A 3BJOA 4ZJZA 4KISA 3OSGA 2EZLA 1TBXA 2MH9A 4IEJA 3PL8A 2QBYA 3FM5A 4DIQA 1YS6A 2J5OA 1IN5A 2CW8A 4YELA 5E3LA 4Y7NJ 2QZ8A 4FQGA 2JUGA
chains in the Genus database with same CATH topology
2B7EA 2CQNA 2DOFA 2KIQA 2DODA 2E71A 2KFDA 2KISA 2K85A 4FQGA 1UZCA 2KZGA 2JUCA 2LKSA 2DOEA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2CQN A;  2DOF A;  2KIQ A;  2DOD A;  2E71 A;  2KFD A;  2KIS A;  2K85 A;  4FQG A;  1UZC A;  2KZG A;  2JUC A;  2LKS A;  2DOE A;  2L9V A; 
#chains in the Genus database with same CATH topology
 3R0A A;  4F7Z A;  4U88 A;  4ON0 A;  2VKD A;  1R5H A;  5JVG F;  4L0Z B;  3FK6 A;  4RS8 A;  1KON A;  1LFB A;  3K70 C;  2XAG A;  4N4O B;  1ENH A;  1WJA A;  2RNJ A;  4P9F A;  1J75 A;  4GXO A;  4R8H A;  3CCM I;  4QTR A;  1NHA A;  2DBB A;  5J6X A;  2BOL A;  2JMW A;  2KL4 A;  2Z1D A;  3BRO A;  2W57 A;  3LQR A;  3PSI A;  1DQU A;  4A6E A;  2HI3 A;  3H9G A;  3W2A A;  3IKV A;  1T0F A;  4CDG A;  3FBN B;  2YR2 A;  2RN7 A;  5J3L A;  2HOE A;  3EPZ A;  3V8L A;  4IRI A;  1ETW A;  4IF4 A;  2E7X A;  2HZT A;  3KLO A;  1T56 A;  2RAE A;  3BTI A;  5ED4 A;  4XLP F;  3D1N I;  2NS8 A;  3S2W A;  3V7S A;  3CDL A;  5B1B H;  4BQO A;  2WBM A;  3CO7 C;  1SVL A;  4BHP A;  3RZO J;  2OTJ I;  4B47 A;  4L0Y B;  1RR7 A;  3OIP A;  5FRO A;  2VC1 A;  4IKF A;  3HYI A;  1G3T A;  2K85 A;  3M4O J;  3DLL F;  2D1H A;  5B3S H;  1NK3 P;  1SD5 A;  1QZZ A;  2IPQ X;  4CCM A;  4S04 A;  3WU0 A;  1D1B A;  1DPU A;  3KYL A;  3S3O A;  1R23 A;  3S14 J;  3BDD A;  1F5T A;  3GBG A;  4DYR A;  4F55 A;  5D4R A;  3IRQ A;  4G7O F;  2YU3 A;  2BY1 A;  3J81 K;  3QP6 A;  1BW6 A;  2AO9 A;  1UG0 A;  4CCL A;  2JJ7 A;  1Z6T A;  3JAM Z;  3HOY J;  2M2E A;  3KX2 A;  2FBK A;  4KIF A;  4DQ2 A;  5DS9 A;  4RA2 A;  1B9M A;  3UKG A;  2R7F A;  4QPQ A;  3HM5 A;  4XOT A;  3PFI A;  4G94 A;  3TO6 A;  4E7J A;  2Y48 A;  3KP5 A;  4YG2 F;  2E2I J;  1K79 A;  3ELK A;  4B48 A;  3HEF A;  4HA8 A;  5K5R A;  2F48 A;  3HXL A;  4BE1 A;  3S1Q J;  1V5F A;  4B43 A;  5GAE J;  5M3F J;  1PVE A;  1T2K A;  1BOA A;  1ZLJ A;  2DJI A;  3I56 I;  1TW3 A;  3WTW C;  1Z77 A;  2P81 A;  1UZC A;  5HVQ C;  2P8T A;  3DKX A;  1YIO A;  2CWE A;  1D0X A;  5LEJ A;  1D3Y A;  1OFC X;  4OMZ A;  5F08 A;  2V9P A;  3KE2 A;  1U3E M;  4EEF G;  1I39 A;  1R22 A;  2W00 A;  3DPT A;  3RTR A;  2CFO A;  3TL4 X;  1K7A A;  3HIF A;  4LMY A;  1ON2 A;  3R0J A;  2JRM A;  3OMY A;  3OYJ A;  2H8W A;  2CFX A;  2P6S A;  3L00 A;  2KMU A;  2MD5 A;  4DZP A;  1LUJ B;  2X1C A;  4ZTJ A;  3Q0W A;  1WFX A;  1MJA A;  2R7Z J;  4C2U A;  5EEG A;  4AIK A;  1O4X A;  2DPU A;  2A5Y B;  1VF9 A;  3D5L A;  2Q2E A;  3WHB A;  3QPS A;  4RM3 A;  2HQA A;  4AYB N;  2L54 A;  3MAJ A;  2W85 A;  1MBE A;  4Z2Y A;  4I0A A;  2EWN A;  3B73 A;  4OAZ A;  1TWF J;  2F4M B;  2D45 A;  4FX4 A;  1RET A;  3DLA A;  2RDP A;  4BXF A;  4WF2 A;  4OMY A;  2VOD A;  5FKL A;  5KCM A;  3TGN A;  1RR8 C;  1D0Y A;  1MW7 A;  1I3Q J;  2X1E A;  3PM1 A;  4PFP A;  2RC4 A;  2XB0 X;  2R7O A;  3GFM A;  1VQM I;  6PAX A;  3F22 A;  1MDM A;  3E97 A;  2MC3 A;  3BR0 A;  1OCO H;  4BDZ A;  2EIM H;  3M8F A;  2EH3 A;  4XM3 A;  2PJP A;  2QQA A;  3VOD A;  2WAQ A;  3LA2 A;  3ZN1 A;  1BC8 C;  2HKX A;  3I3L A;  4M9Z A;  4JK1 X;  4OAY A;  2MW8 A;  5DUI A;  4MQV A;  2LRE A;  2KIF A;  2FA5 A;  2RKH A;  1PP8 F;  4CHU A;  4UY8 I;  4GO1 A;  4EMS A;  2MYS A;  2G7U A;  2LTP A;  5DTD A;  2DPD A;  1S8N A;  1FSE A;  2X6Y A;  2NNY A;  2KZV A;  1G2H A;  3SDB A;  3T5X A;  1N77 A;  1N25 A;  2CUZ A;  3CF2 A;  1BBY A;  4A5M A;  2XF7 A;  2EIL H;  2E5Z A;  4I76 A;  3H3Z A;  4G7H F;  3S17 J;  1G59 A;  5IOY A;  2OZU A;  3MVP A;  3K69 A;  3Q5F A;  1VQP I;  2XGC A;  1ITY A;  3A02 A;  2Y0S N;  5L3D A;  2DMN A;  1WJF A;  3FK7 A;  4PJL A;  2NS0 A;  1ZAO A;  2OCC H;  1IV6 A;  1IUY A;  3QQA A;  3BZ6 A;  2EA2 A;  4YIR X;  1Y0U A;  1EF4 A;  4E7I A;  2R3S A;  3SZT A;  2IAI A;  4LOC A;  1YIT I;  1FJL A;  2GXB A;  3V8J A;  1MMS A;  4JYK A;  3GZ6 A;  4ESJ A;  2M8G X;  3OS2 A;  1FSH A;  2LOO A;  4EJO A;  2F6C A;  4G8X A;  1O3S A;  2LDU A;  3L2R A;  1LJ9 A;  2G9W A;  2CQX A;  2ZFU A;  1SMT A;  1D8J A;  2Y9Z A;  3K7A J;  3EYY A;  3ZOB A;  2DA7 A;  4M74 A;  4WX9 A;  1R36 A;  2ZXI A;  1LFP A;  2FRH A;  2K3P A;  4FX0 A;  4DOZ A;  4EJW A;  4LFU A;  2H6B A;  5LEK A;  2ZCW A;  5HS7 A;  2FOK A;  3LL7 A;  1VQ8 I;  5CJ9 A;  2VPL A;  2QEX I;  2VIX A;  1RNL A;  4FT8 A;  4RGS A;  2NS7 A;  4BL0 B;  2VBX A;  2H6C A;  4S0H B;  3CCQ I;  2DFF A;  4A69 C;  2GOX B;  1KQ9 A;  2BVM A;  4W97 A;  3W6K B;  3BG9 A;  3FIS A;  2A07 F;  3WE3 A;  2GA2 A;  1BA5 A;  3VYT B;  2HR3 A;  1LE8 B;  1G8X A;  4AIJ A;  2KT0 A;  2X48 A;  4A3B J;  2XHK A;  2MBF A;  4HBL A;  4MTD A;  4QWQ A;  1FBS A;  2E5N A;  1YW8 A;  1N78 A;  4KT5 C;  5HLI A;  1HC8 A;  4HPQ A;  4P1W A;  1UB9 A;  2PEX A;  2K9Q A;  1OCC H;  2WB1 A;  4JBA A;  3LSM A;  3TP3 A;  3ZGK A;  5HLH A;  4XRS G;  4CYC A;  3ZR8 X;  2COM A;  1JE8 A;  3K4K A;  3CCJ I;  5HOO A;  2EV6 A;  4RLQ A;  3RJP A;  1A36 A;  3DCF A;  3ZMD A;  4J00 A;  3OL3 A;  1Z7L A;  3LOC A;  2XAH A;  1XGN A;  2ICW G;  2F2E A;  1KU9 A;  1MD0 A;  1S9H A;  3QAH A;  3CP8 A;  2XKP A;  4M3D A;  4IZZ A;  3OSF A;  2QKL B;  2DOA A;  1BI3 A;  3GTO J;  4NDL A;  4OIO F;  2L7F P;  3T0Y A;  2EZH A;  3LSJ A;  2L9V A;  3AG1 H;  4Q47 A;  3NAR A;  2WC2 A;  2IGN A;  4M9X A;  5BOX A;  2BHY A;  2XPW A;  3ZXS A;  5JLX A;  1WRJ A;  2LLK A;  3CTA A;  3CUQ C;  3F3X A;  4BJ5 C;  4RDU A;  1WWX A;  3I58 A;  2XUB A;  4C3H J;  3M8E A;  4F91 B;  3TW7 A;  3CDI A;  1IN4 A;  1SAU A;  2L01 A;  1R6R A;  4LIV A;  4DYQ A;  1XSD A;  3QYB A;  5C4J J;  1S7O A;  2B63 J;  1SVO A;  3DKY A;  2HTJ A;  4Q4Z F;  3BCB A;  4IHX A;  1WJD A;  1FYM A;  4KUM A;  2HQ5 A;  3SHF A;  2KDZ A;  4PJM A;  1IJW C;  2OC6 A;  3BTC A;  2HOA A;  3QPH A;  4A6D A;  4Y13 A;  4Y52 J;  4AC0 A;  2PI0 A;  1GHC A;  4HYE A;  1TWG J;  3FXR A;  3FXO A;  5ERI A;  2EB7 A;  1TT5 B;  3D5R C;  3JRH A;  5E8G A;  3K2A A;  1HKQ A;  2LYC A;  1TZL A;  5LGU A;  3FMR A;  1OJL A;  3G1M A;  3L2Q A;  4DW6 A;  3X2Q H;  1IUF A;  1B1B A;  2CO5 A;  1MND A;  5HOD A;  1B9N A;  1DGW Y;  1R1V A;  2CQQ A;  2DDA A;  1U9N A;  1VQN I;  2OBP A;  2V79 A;  2EIK H;  1EH8 A;  2IA1 A;  4GYG A;  2OTL I;  1FIP A;  1ETX A;  2DN0 A;  4E6K G;  3MWM A;  4V2G A;  4A93 J;  1XS9 A;  4O5V A;  3I4M J;  5EGO B;  2OQR A;  4RMN A;  2F4O B;  1ZTR A;  2KRH A;  1I6H J;  4Y3O A;  1YRN B;  4BAY A;  1OQY A;  1SD6 A;  1TWH J;  2R7S A;  2ME6 A;  4UNO A;  1UHS A;  4IVN A;  3JRI A;  2JA7 J;  4XBF A;  2GXA A;  2Z2S B;  3MD2 A;  4Q5S F;  4LJZ F;  1V5G A;  3G1L A;  1WCM J;  1QHG A;  4D0P A;  2O0Y A;  4AM3 A;  1EA3 A;  1WVR A;  2VJ5 A;  3RI4 A;  2HQR A;  3HKZ N;  2ID6 A;  2X4H A;  1OMI A;  4MEY F;  3IH3 A;  4PZJ A;  1H89 C;  1BR4 A;  4HEA 2;  4H4K C;  2M87 A;  3HOU J;  3ECH A;  3E6M A;  4JP0 A;  5JHF A;  3GTL J;  2ZJR F;  2JK3 A;  2HVQ A;  3KPH A;  4KT6 A;  1X2M A;  2KKO A;  1YO5 C;  1IAW A;  3O8H A;  2TDX A;  2O9L A;  2WV1 A;  2NVQ J;  1BI1 A;  4RAY A;  4L9J A;  1ZRE A;  1Y8Q B;  3E3V A;  5FO5 A;  2H1L A;  1X1D A;  5AIP A;  2Z99 A;  1AA7 A;  3K4B A;  4M3E A;  2BZT A;  2YS9 A;  1ORK A;  2BXZ A;  2Y30 A;  4FET A;  3HOW J;  2JSC A;  4LLG F;  3AKZ A;  3A4C A;  3DEU A;  4X1E A;  4KYW A;  2DA2 A;  5ICE A;  5H6R A;  4A0Y A;  2DFH A;  3U9G A;  1H8A C;  4EM1 A;  1MBF A;  5A2Q K;  2HYJ A;  1ZHF A;  2OD5 A;  4IJA A;  3U2R A;  2XAJ A;  5AIQ A;  3GF2 A;  2A6H F;  2HKO A;  3IV5 A;  3CCS I;  2O8K A;  5K1Y A;  2HS5 A;  2IW5 A;  1V55 H;  4D5F A;  1Q1V A;  1U2W A;  4QPO A;  1Y6I A;  5K7Z A;  1PDN C;  1FTZ A;  1IRG A;  1MSE C;  5E1Z B;  3J81 Z;  3CMY A;  1WPK A;  3EDP A;  3W2W A;  2Y2Z A;  1ZYR F;  4FCY A;  1WQ2 A;  1VQK I;  1J9I A;  2HDC A;  2V9V A;  2YX7 A;  4XRM A;  1S6L A;  3CCY A;  1K78 A;  1HQC A;  3N05 A;  4ZYE A;  4XOR A;  1FC3 A;  1OIS A;  1JUM A;  3OWT A;  5FRN A;  1B72 B;  1JKQ C;  2JWT A;  2JTV A;  4XLH A;  3S3N A;  1P7I A;  1T8I A;  2R5Y B;  1POG A;  1XCV A;  1F1Z A;  2KIU A;  1WJC A;  4RB3 C;  1FP1 D;  2IA0 A;  1MMA A;  3E6B A;  3DBH B;  2HFH A;  2E1O A;  3I59 A;  3BZK A;  1FY7 A;  3MFK A;  1WSU A;  4FTH A;  1S3J A;  4MEX F;  2ZSH B;  2JQ7 A;  3WG9 A;  3ZQQ A;  3NWS A;  2DQR A;  2E35 A;  2FQ3 A;  5DV5 A;  3DF8 A;  4HNT A;  1MNM C;  4BY1 J;  1T98 A;  1KYW A;  1J0R A;  4X0G A;  1IF1 A;  3RYP A;  4LD5 A;  1XGM A;  1YG2 A;  2M30 A;  3I0T A;  3GTJ J;  3BQY A;  3FIW A;  2HZD A;  3CUO A;  5J8F A;  4A3K J;  3HC7 A;  3K4N A;  4AD9 A;  3C1D A;  1VZ0 A;  2L3D A;  3MCZ A;  2IVM A;  3FM3 A;  1W4M A;  2K02 A;  3CCE I;  1VTN C;  2L7Z A;  4CGZ A;  2RQQ A;  3REO A;  3HB9 A;  1VFC A;  2LSO A;  5DM6 F;  4BE2 A;  3I71 A;  5FLM J;  1KYZ A;  5J1U A;  4A12 A;  3KP3 A;  4NHJ A;  3KEO A;  1E3H A;  3F72 A;  3IHU A;  1O3T A;  2RVC A;  3WTY C;  4BQQ A;  1G3S A;  4UVA A;  1QA6 A;  3W2V A;  5LFA A;  1I5Z A;  5LHG A;  2DLL A;  2QUF A;  4HQM A;  3IH2 A;  2D5V A;  2XAF A;  1Z05 A;  3KET A;  1P6R A;  3JRC A;  1ZLK A;  2LK2 A;  1R49 A;  4DYC A;  1RI7 A;  2A61 A;  2E60 A;  3PSF A;  1IRZ A;  2XAS A;  1X1B A;  2OJE D;  5EJC A;  5LD2 C;  1YFH A;  2DW4 A;  2HYF A;  2PMZ N;  1FOK A;  3H0D A;  2VOP A;  3DTE A;  2M45 A;  2E7W A;  3ERM A;  4CZC A;  2R5Z B;  1LDK B;  4BAC A;  5CVJ A;  2ZJP F;  3K4C A;  5CYV A;  4L5J A;  2VLA A;  3GWZ A;  4NQW B;  2CU7 A;  2ZJQ F;  3WGH A;  3LSP A;  1UG2 A;  2LVS A;  4EJV A;  4F92 B;  4GDF A;  1WJE A;  2W1O A;  5FD5 A;  1SAN A;  4KN4 X;  2X1D A;  5D6F A;  2R7W A;  2XIG A;  5ICC A;  4IOC F;  3F9K A;  3BG3 A;  2W4S A;  4XLE A;  3ZMU A;  2KJC A;  1EH7 A;  3ZMZ A;  2P0W A;  4HF1 A;  4L18 B;  1Z21 A;  4XNF A;  1PUF B;  4A0X A;  5IYB J;  3I9V 2;  1FOX A;  1X3W B;  2GQQ A;  5J47 A;  3HZJ A;  4I0B A;  1RUN A;  4HF2 A;  1PP7 U;  3TO7 A;  2Y0M A;  5H2F C;  3HUG A;  3J7A O;  2G7H A;  1P7J A;  1J2X A;  5HDG A;  2E1C A;  1MIJ A;  4RB2 C;  3H5R A;  4UUS B;  2MG4 A;  3HOS A;  3BG5 A;  3ZCO A;  3QPL A;  2V1N A;  2KJB A;  4BEH B;  1OYY A;  4ZDL A;  4MHG A;  3U1K A;  1ZAR A;  5DDG A;  1ZGJ A;  4LLL A;  2WV0 A;  2K9L A;  1SEU A;  4XON A;  3AL0 B;  3HGG A;  1XD7 A;  4XLF A;  4KNY A;  1IDZ A;  2HQN A;  4I01 A;  4ASN A;  2D1V A;  4NC8 A;  4DBQ A;  2DK8 A;  4JOM A;  3BR6 A;  3OYD A;  1IXS B;  1DPR A;  1JT6 A;  1GVD A;  1ZKG A;  2EQR A;  4ESF A;  4BBR J;  1AU7 A;  4YFN F;  4BHB A;  4HV5 A;  1Z3X A;  4LIT A;  5F64 A;  2E19 A;  3ML6 A;  3P9C A;  3TW6 A;  2H27 A;  3ZRG A;  4D7M A;  1X4O A;  4BBS J;  4A3C J;  2XRN A;  4PFO A;  3QOE A;  4Q48 A;  4XLN F;  3D0S A;  3DWL E;  2O8X A;  4AID A;  5LGT A;  3GYH X;  2GLO A;  1FOY A;  4M3F A;  3T8R A;  5JR3 A;  2OQG A;  2EJR A;  3O3K A;  2QKM B;  4ZH4 F;  1IDY A;  3NAU A;  2VB6 A;  4AWX B;  2A3S A;  3M8J A;  3G73 A;  3SEZ A;  4KDP A;  2A68 F;  4CH7 A;  1CF7 A;  1W7P B;  4EJT A;  2PJR B;  1HSJ A;  3DQV C;  1V54 H;  2DA5 A;  2K4J A;  4LB5 A;  3S1M J;  3ABK H;  1UHW A;  1FPQ A;  3RYR A;  4A0Z A;  2IRF G;  3SZP A;  4UB6 C;  3HRT A;  3WE2 A;  3O6B B;  4ZZL A;  4B1R A;  4P9U A;  2DMT A;  3RPQ A;  2AHQ A;  1NG7 A;  4YII A;  1XX5 A;  1OYW A;  2PX9 A;  3CME I;  1MKM A;  2ZXJ A;  3SQN A;  4LB6 B;  3ZPL A;  3VOE A;  4ABZ A;  1ZK8 A;  4GFB A;  3VPR A;  1XMK A;  3BWG A;  3QPT A;  4S05 A;  2P5L C;  2HNH A;  1JJ6 C;  1U8R A;  4UB8 C;  4Y17 A;  3PUB A;  2LBF B;  3IP4 B;  4XRS A;  5TGT A;  2HEO A;  1WKM A;  1B8I B;  1O57 A;  1VND A;  2WA0 A;  2K40 A;  1F4K A;  3BJA A;  3ZMS A;  4CCO A;  2OA4 A;  2OPT A;  3K0L A;  4E7S A;  3B6A A;  2QSH X;  1LPQ A;  1OCP A;  2LRD A;  4ZDO A;  5CKT A;  3KEY A;  3PNY A;  3DBL B;  1T38 A;  1ZRC A;  1ETK A;  1QQI A;  3JW4 A;  3QYF A;  3R61 A;  1TNT A;  2ZC2 A;  1XB4 A;  2DT7 B;  4ZC3 A;  3GTG J;  4A5N A;  2M4G A;  2Z5U A;  5IP9 J;  1YHQ I;  3GTM J;  1RPW A;  2CQK A;  5DCM B;  5H6Q A;  3VB2 A;  1YX3 A;  2L5Q A;  1HBX G;  4ZTF A;  1R1T A;  4HOB A;  2VBZ A;  3HRM A;  2R7R A;  1SD7 A;  2XPV A;  3LST A;  3ASN H;  1GXQ A;  1K4S A;  5HDK A;  2LY2 A;  3IH4 A;  3JSP A;  1ZG5 A;  2XB5 A;  1HKS A;  3LSH A;  2IP2 A;  2H94 A;  3C2H A;  3LNQ A;  2A5W A;  4XR6 A;  4FE7 A;  2D2W A;  2MH2 A;  3KP7 A;  4C9Y A;  3OS1 A;  2DU9 A;  2F5D A;  2MLG A;  1JKP C;  4GYI A;  1FBQ A;  3OYC A;  2EIN H;  1EKE A;  3LSK A;  4CCN A;  4HLX A;  3D5S C;  4CXF A;  2JT1 A;  1FTT A;  4L9T A;  4ETS A;  2CYY A;  4ENN A;  2EFQ A;  1TC3 C;  1HOM A;  1MJ9 A;  4CYD A;  3E1S A;  3MZ8 A;  4II2 A;  1IW7 F;  4P96 A;  2X0L A;  4M6X A;  3GX4 X;  1PUE E;  1Z0X A;  2NNN A;  2OCE A;  3F8M A;  1ZH5 A;  2HWV A;  4ESB A;  5LHI A;  3A1Y A;  2H09 A;  4JX5 A;  3M1C A;  4AUX A;  4KIG A;  2WTE A;  1OCT C;  5IYC J;  3ISP A;  3K1N A;  2HVS A;  1OCR H;  2CH0 A;  2JPC A;  2VQL A;  2X51 A;  3K1P A;  3S15 J;  4BQN A;  2O6G E;  1IG7 A;  3OYA A;  2VJ4 A;  1P9Q C;  2NOG A;  1RUO A;  1T95 A;  1S7E A;  4MO7 A;  2HGC A;  3AG4 H;  1IRX A;  1MMN A;  4B4C A;  1UFM A;  1E17 A;  2VBY A;  3K1M A;  3H5A A;  4CUG A;  3WG7 H;  5E1W A;  4RAZ A;  2VPR A;  3DFG A;  3Q9V A;  2V1D A;  5L3F A;  1JT0 A;  4HX7 A;  1K4T A;  1P92 A;  5DD8 A;  2LR8 A;  3KP4 A;  3PQJ A;  5A2Q Z;  1R7J A;  1UJ8 A;  2LFB A;  1VQ6 I;  2WWY A;  2BV6 A;  1VQL I;  2HDW A;  3JRD A;  4U0V A;  2XSD C;  3ASO H;  3WTV C;  1EJ9 A;  1MBJ A;  1FNN A;  1S5L C;  2M1B A;  2PLY A;  1I3A A;  1VQO I;  1HXD A;  2NVT J;  3T8T A;  5ICG A;  3ESW B;  2PQ8 A;  1WGX A;  2E36 A;  3FXU A;  1LFU P;  1QZE A;  3KZY A;  4WXH A;  4AVZ A;  2F5V A;  1SVM A;  4JX4 A;  1SAX A;  2M7A A;  3HSF A;  5LRS A;  1IZ1 A;  3LSG A;  4O6J A;  2LKP A;  4BU2 A;  4HNV A;  3TOB A;  2VQG A;  4V2F A;  2A05 A;  2ELH A;  4IQ4 A;  4BXU A;  1YTY A;  1HDP A;  2IJL A;  2IT0 A;  4XSX F;  1QRY A;  5IOZ A;  4AIH A;  3FKJ A;  3KCC A;  4NC6 A;  1FMV A;  3V4G A;  1T6S A;  3BTJ A;  3P9K A;  3IAS 2;  2ZNZ A;  2FU4 A;  3OYB A;  1DUX C;  1T08 B;  2W24 A;  5DUK A;  1YI2 I;  5D6E A;  3G6E I;  2WB1 N;  1GVJ A;  3CC4 I;  5J4Y A;  1U5T B;  3TKY A;  2GOM A;  1AWC A;  4WCG A;  5LRR A;  1I6X A;  5D5U B;  3E6C C;  3JTH A;  2FX0 A;  2VOO A;  2K9N A;  5IT3 A;  1ZEL A;  3IWZ A;  3GTQ J;  2EV5 A;  4XN3 A;  5KVR A;  3VEP A;  4HX4 A;  1FOW A;  5FB2 A;  3WTT C;  2EBI A;  3CCL I;  4E7H A;  5EDN A;  4BYY A;  2Z3Y A;  2O5R A;  1FMW A;  5EZH A;  3OYI A;  3DEW A;  1T39 A;  5BMZ A;  5LGN A;  5DCF A;  2HOT A;  1A5J A;  2LD5 A;  4CA0 A;  1ACI A;  2W25 A;  3RSN A;  1EH6 A;  4II3 A;  3J7Z I;  4GRI A;  4XN0 A;  4A3M J;  3VYU B;  5E18 F;  3VDX A;  1UHM A;  3CQZ J;  4KIB A;  3HSE A;  3VYR B;  2L9N A;  1S72 I;  2M34 A;  2LY1 A;  4EGZ A;  2XKO A;  4XL9 A;  4ZYA A;  2NVU B;  1AOY A;  3S32 A;  9ANT A;  2LC2 A;  1Z91 A;  1ZN2 A;  4Y33 A;  3T1B A;  1YQA A;  3WGG A;  1MH3 A;  4PSW A;  2HXI A;  2LNB A;  5D4S A;  5L3E A;  1JGG A;  4WXD A;  4A3G J;  3FXK A;  1LE8 A;  3V7C A;  3RKY A;  2RQP A;  3JRA A;  3TO9 A;  1J7K A;  2BVL A;  4AU7 A;  2XC7 A;  2UV1 A;  5FD6 A;  1UMQ A;  1IGN A;  5K7H A;  1YJW I;  3HTS B;  2BY0 A;  3Q3S A;  2H8R A;  2JA2 A;  5CVU A;  1TQP A;  5F0H A;  1TTY A;  1P2F A;  4BQA A;  4I99 C;  1F9N A;  3SXY A;  3F21 A;  1SMY F;  3BCA A;  4JQF A;  5B66 C;  3TQN A;  5CPR B;  2X6X A;  5EEA A;  3ZP5 A;  5L3B A;  2R7V A;  1S29 A;  4IOA F;  4ENM A;  2DI3 A;  2FOW A;  3N97 A;  1ZRD A;  1E0E A;  2CG4 A;  2NVY J;  3GME A;  2OU2 A;  3IC7 A;  4I09 A;  4NBQ A;  4NUB A;  3MKZ A;  1HST A;  5FKK A;  2XAU A;  2BW3 B;  3FHZ A;  2DT5 A;  2UXN A;  3ECO A;  3I53 A;  4KMU X;  2JA6 J;  1S7A A;  2PBI A;  4DJA A;  1ETV A;  1IO2 A;  1WI3 A;  3I5U A;  4B3X A;  3G4S I;  3EET A;  3ZQL A;  1JUS A;  2TCT A;  2XGE A;  2R0Q C;  2YPR A;  3OR1 C;  2ESH A;  4E7L A;  5CVI A;  3DV8 A;  5JFR A;  4WXC A;  4IO9 F;  4DGW B;  1WH7 A;  3GVA A;  5C44 J;  1BIA A;  4QIW N;  1GV2 A;  1U8B A;  3ABU A;  2DYR H;  3CUQ B;  2DA3 A;  3ZQH A;  3A03 A;  4D7N A;  3TBI A;  4M9S A;  1OCZ H;  5L3C A;  4OIP F;  3SEQ A;  3LA7 A;  3LWF A;  3CMA I;  1FIA A;  2W7N A;  3CCV I;  1CGP A;  2IXS A;  2FJ1 A;  4ZYD A;  1QVU A;  5IT9 Z;  1W5S A;  3BG7 A;  2IS6 A;  1ETQ A;  5DEQ A;  5C3E J;  2DJN A;  3LAJ A;  3CLQ A;  1Y1W J;  3BR3 A;  4LG0 B;  3LMM A;  5AON A;  5GPA A;  2KRC A;  4MNU A;  5KAF C;  3BTL A;  2M0C A;  2Q1Z B;  5F0C A;  2PG4 A;  2VL8 A;  4FE4 A;  1KGS A;  1H9G A;  1MGT A;  4OOI A;  3B6C A;  3SFI A;  3RPU A;  1VQ9 I;  4HRI A;  2K86 A;  3A01 B;  2ZJ2 A;  2WY8 Q;  5LLQ A;  2NVX J;  4RLF A;  3W3C A;  4BNC A;  3AG3 H;  5FFX A;  2ZKZ A;  2W82 A;  4M73 A;  3K9T A;  4EJU A;  2F5F A;  2N8G A;  4CCJ A;  3K4L A;  2E1M C;  5EG0 B;  3S16 J;  1HF0 A;  1JUP A;  2NAZ A;  2CS3 A;  1USS A;  5E3N A;  2QEN A;  3UNG C;  2HOS A;  3F8N A;  3BLY A;  1IXR C;  5CQG A;  1BJA A;  5EGO A;  3BR5 A;  3RDI A;  4ZYG A;  1YRN A;  3R60 A;  2VI6 A;  1FYK A;  2FSW A;  4MTE A;  3L2V A;  2E2H J;  2UXX A;  4LK0 F;  4D5C A;  2R7D A;  3I54 A;  4CO8 A;  5IP7 J;  5FJ8 J;  1RRJ A;  2LF8 A;  2L2O A;  5CVR A;  3V7R A;  3MZH A;  3NRV A;  1AKH B;  3P9I A;  4OU0 A;  3O8G A;  4RGR A;  1RES A;  3S2H J;  5B5E C;  3CMM A;  2O7O A;  3BJ6 A;  5LBQ A;  5EYR A;  4C3J J;  2KRF A;  2NXN B;  4WWC A;  2STW A;  5J1Y A;  1E3P A;  3SZG A;  2JSP A;  5FLX Z;  1HW5 A;  2X6W A;  4A3J J;  2PFB A;  2QF7 A;  1XPX A;  1K61 A;  3RKX A;  1V3F A;  2ZNY A;  2M9H A;  2R7Q A;  3E0J B;  4CCK A;  3ZQG A;  2P5K A;  4PSX A;  1L3L A;  1H9T A;  2JA5 J;  2QQ9 A;  2A6E F;  5J1R A;  1R5G A;  4MGR A;  3W6V A;  1VQ4 I;  2VON A;  3ZMV A;  4HG2 A;  3ERE D;  1XMA A;  2IS4 A;  3E7L A;  5D5X B;  1W36 D;  3WU1 B;  3KYD B;  3C2G A;  3RCO A;  5IYD J;  3TMO A;  2MSY A;  4NC7 A;  1KU3 A;  3BP8 A;  3FZV A;  5BNG A;  3K10 A;  3TED A;  5LHH A;  3OOP A;  2ISY A;  1AHD P;  2VKH A;  3ABL H;  1R00 A;  4R79 A;  3CJT B;  2E71 A;  3H0G J;  2YU9 J;  2ZME B;  3IAM 2;  3C7J A;  3NQO A;  4G7Z F;  4E7K A;  2P6T A;  2AQE A;  2W48 A;  1D1C A;  5J40 A;  4KA4 A;  1A6Q A;  1G3Y A;  4L5I A;  2Z16 A;  1H88 C;  1M1E B;  1XDU A;  2AS5 F;  2QBY B;  1JKR C;  3CLO A;  2VBW A;  1XGS A;  5HLT A;  4Y15 A;  3OS0 A;  2VQC A;  1HLV A;  3KZI C;  3HOV J;  4ANJ A;  4NB5 A;  1NG6 A;  3HUG B;  3GZN B;  2YUS A;  4UV8 A;  1FEX A;  2FMY A;  2BHZ A;  4B09 A;  1WJB A;  1X1P A;  4RGU A;  3GO5 A;  4PDK A;  2R93 J;  3RPU D;  2LY9 A;  1PJR A;  5ILV A;  3CC2 I;  1U0J A;  3HHG A;  3HL2 A;  3HBL A;  3KP6 A;  4C3I J;  3P5J A;  1QBJ A;  3AL0 C;  1D8K A;  2XGD A;  2Y69 H;  3GFI A;  1B72 A;  2IS1 A;  4MLO A;  2ESN A;  2LF7 A;  1DDN A;  1MBG A;  1BJZ A;  1OLT A;  2L0K A;  4PK4 A;  5TRD A;  3B02 A;  1JJ8 C;  4HW0 A;  1OR7 C;  2E1N A;  1SFX A;  5ICF A;  1IN6 A;  2FBH A;  2K9S A;  4M3G A;  3GFJ A;  2R5Y A;  2Q0O A;  3Q9S A;  5K5O A;  1TWA J;  1XSV A;  3WOD F;  2MA3 A;  3H9J A;  5TJJ A;  4EAT A;  5GAD J;  4ITV A;  5B1A H;  2DMQ A;  5FRM A;  2K5C A;  3DEE A;  3CF5 F;  1I50 J;  4G6Q A;  1TLH B;  4HX8 A;  5E8I A;  1A04 A;  2F4I A;  1QNT A;  3H92 A;  2GBY A;  4BGD A;  3I55 I;  2HVR A;  2KFD A;  2DTR A;  2PMZ A;  2ACJ A;  4P5O A;  4M72 A;  3HOX J;  3F6O A;  3MKW B;  5BPI A;  2XGX A;  3DBR B;  5JLW A;  2BEO A;  4CSW A;  2CW7 A;  3MZY A;  4F3Q A;  4PCQ A;  3F8F A;  2XRO A;  4EV0 A;  1LNW A;  1KQ0 A;  3HG9 A;  1VI0 A;  2K27 A;  1U78 A;  1TL8 A;  3SDG A;  2R7U A;  3R6S A;  2V1X A;  2DA4 A;  3FX3 A;  1GXP A;  1Y8R B;  2DO7 A;  2TRT A;  3ROU A;  2E2J J;  3KLN A;  2GAU A;  4A3L J;  2VUM J;  3PJR A;  1YS7 A;  3AFH A;  2C6Y A;  1R9T J;  2DOD A;  5E3M A;  3COA C;  2B9S A;  3TP0 A;  2M7B A;  3BY6 A;  2DK5 A;  3RQ4 A;  4N4N B;  5KAI C;  1OYI A;  1Y56 A;  1TQM A;  2ECC A;  2ZXW H;  2KZG A;  2UZK A;  4R1H A;  2I5U A;  1O3R A;  1X2N A;  4N9H A;  2DT6 A;  2M0M A;  3M07 A;  3JRF A;  1A6I A;  2IEK A;  3DPL C;  2L9S A;  4A3E J;  1U9O A;  2VE9 A;  3CCR I;  3PNT A;  3RQI A;  2A6T A;  1Q1H A;  3GFL A;  4ZDP A;  2J5P A;  4GGG A;  1W0U A;  2DOE A;  4XLC A;  4C30 A;  2DCE A;  5IT9 K;  1WHU A;  1Z6R A;  1LB2 A;  1MSF C;  3FXJ A;  3L09 A;  5BQT A;  1RZ4 A;  1K83 J;  4WK8 F;  3K2Z A;  2XSJ C;  2G0E A;  2VQH A;  1ONV A;  2QGU A;  3I64 A;  2R5Z A;  1LDJ A;  2VXZ A;  1W5T A;  3E5U A;  3ZQI A;  3QOP A;  4OWR B;  2BBY A;  3OYE A;  1X19 A;  4RB1 A;  4NQW A;  2K4B A;  3N4M A;  4P55 A;  2A69 F;  1X58 A;  4YIF A;  3S3M A;  4KMF A;  3G1O A;  1YW7 A;  3FHN A;  1G3W A;  2FEZ A;  3I4P A;  1IN7 A;  1G4D A;  2CGP A;  1D5Y A;  4MFD A;  5GPC A;  1DGR M;  2RV8 A;  2Y75 A;  2RRE A;  1O7F A;  5DYM A;  4BJT A;  3ULQ B;  2PN6 A;  2MC4 A;  3A2K A;  3FXL A;  3SYT A;  2BGC A;  2WAF A;  2LG4 A;  2V9K A;  3F8B A;  3F23 A;  1PUF A;  2Z33 A;  3OYK A;  5FGM A;  3M9A A;  1IRF A;  2E34 A;  3EUH A;  3G2B A;  2UUZ A;  2Q2E B;  3MMY B;  4N0B A;  4U0Y A;  2STT A;  2JPB A;  4EGY A;  5F0F A;  5E79 C;  3H3U A;  3UR3 C;  3DXJ F;  3RZD J;  1FLI A;  3Q0V A;  1Z9C A;  3A0B C;  5E3O A;  1KU7 A;  3F0C A;  2MAB A;  3JRE A;  4UUS A;  3OYH A;  1ZGW A;  2X6O A;  2XV4 S;  3OIQ A;  2QCO A;  2CMP A;  2MFZ A;  5GTI C;  1MDM B;  3OL4 A;  4BEH A;  5HNF A;  2AXL A;  1FBU A;  1ON1 A;  3BQZ A;  5FLX K;  2IGK A;  5J8C A;  2YX4 A;  5EF6 A;  1A31 A;  5D5V B;  1XTA A;  1O7L A;  1YIJ I;  3K4M A;  1O3Q A;  5E20 A;  1OR7 A;  3FKI J;  2YSR A;  2EV0 A;  2MD0 A;  3BR1 A;  1HDD C;  3AG2 H;  4BH9 A;  2DMP A;  3CJN A;  3HGY A;  5L3G A;  3BPV A;  5BPD A;  4PJN A;  2I10 A;  1ZG1 A;  2BYV E;  2VC0 A;  3BG6 A;  5GTH C;  1UST A;  3GCM A;  1GT0 C;  4HAM A;  4G6D A;  3IL2 A;  3DU6 A;  4C2T A;  4O3M A;  4U87 A;  4U7D A;  4HV6 A;  1X1A A;  3GTP J;  1P4A A;  3IKT A;  3SJM A;  4M3B A;  4I6Z A;  3G71 I;  1ETY A;  5DM7 F;  1B59 A;  4KIT B;  2XF6 A;  2FQ4 A;  1FWZ A;  2IBD A;  4EQQ A;  3LQQ A;  1W7P A;  2PJR A;  2ID3 A;  1TNS A;  1KZH A;  4BKX A;  1R71 A;  4A2U A;  4UHT A;  5JI6 A;  1SFE A;  1J59 A;  4B8X A;  4YEJ A;  2K9M A;  2V4J C;  4XQF A;  3QWL A;  2DXI A;  3LFK A;  4FHT A;  3OOU A;  1OKR A;  5ILS A;  3HJE A;  2B7E A;  1R1U A;  1DP7 P;  1QU3 A;  4AYB A;  4D9J A;  1IV8 A;  2VAS A;  2WAQ N;  3ZMT A;  3GLX A;  1IN8 A;  3C3W A;  4L9V A;  2O61 A;  2ZSI B;  4XKW A;  5M5Y J;  2K7L A;  3GLL A;  1MZB A;  5TIS C;  2HXO A;  4UUV A;  4BJ6 C;  1V4R A;  4HSR A;  3F6V A;  1LEA A;  2QWW A;  2LP0 A;  1BI2 A;  1NTC A;  4UXN A;  2L4A A;  3GUD A;  2RNG A;  1W0T A;  2LBF A;  2L9R A;  2QQ8 A;  2VKE A;  3E6D A;  1B8I A;  2F5C A;  3OYG A;  2QVO A;  4ENJ A;  3WTX C;  1LDD A;  3JCU C;  1APL C;  2EK5 A;  2XAQ A;  2X85 A;  4FAS D;  5HLG A;  4B3A A;  3W6J B;  1NK2 P;  5EEH A;  3MEX A;  2IA2 A;  3HOT A;  1XSX A;  2DMU A;  1I27 A;  4RB0 A;  3PO3 J;  2CRG A;  2KHM A;  1U5T C;  4DBR A;  2XF5 A;  2JZY A;  2P7C B;  3CDH A;  4IHW A;  1D0Z A;  4XKC A;  1HW2 A;  4IPA A;  4CIC A;  4EM0 B;  4CYC B;  1WI9 A;  1E2X A;  2WAE A;  5DCM A;  2Q8K A;  2CV0 A;  4BE0 A;  2GIV A;  4YFX F;  4L9N A;  2Y0S A;  4HZF A;  3FF5 A;  1P4W A;  5DD4 A;  4I2O A;  1MBK A;  1KQ8 A;  4RAF A;  3CCU I;  1UEL B;  4E70 A;  4IHT A;  5KNL A;  1YE9 A;  1QO0 D;  3VFZ A;  3PUF A;  5FFZ A;  3CO6 C;  4BXX J;  5CVV A;  1W36 C;  1MBH A;  3LAP A;  4M6Y A;  1GUU A;  2M8E A;  3DU5 A;  3FXQ A;  2M3A A;  3LA3 A;  2HDD A;  1L0O C;  3GZ5 A;  1KA8 A;  2MLK A;  3VSK A;  3U21 A;  1R5I D;  4RAG A;  5M3M J;  2RGV A;  2ZBK A;  1FX7 A;  4JX6 A;  5CQE A;  5F1J A;  1RIO H;  3ZQF A;  3L1P A;  1W7P D;  1MMG A;  3WGI A;  4EM2 A;  3JTG A;  2AQF A;  3MKL A;  4RBO A;  3H35 A;  3V42 A;  1J5Y A;  1K6O A;  4CZZ A;  1I1G A;  1DU6 A;  1U6G A;  1BR1 A;  4XK4 A;  4XLA A;  5FKN A;  3WTZ A;  2CUJ A;  1Y1V J;  3M1E A;  1SC7 A;  2MGQ A;  3KZZ A;  3HDD A;  2CQN A;  3PIO F;  5M5X J;  3S2D J;  5D8K B;  5E17 F;  4I02 A;  4YRV A;  4HDU A;  2P4W A;  3ZQC A;  5M5W J;  1YJN I;  3M3Y J;  1LVK A;  2ELJ A;  3QOD A;  3CZ6 A;  1G6N A;  5GP9 A;  1ZGA A;  1KU2 A;  1X1C A;  2BY2 A;  3ZN0 A;  2JN6 A;  2EZI A;  2XRL A;  5K7F A;  4YFK F;  3BT9 A;  1QZY A;  3GEZ A;  3F8C A;  4XOP A;  1JTX A;  5FLV A;  4HF0 A;  3VSL A;  4PJJ A;  4BUP A;  1X3Z B;  5FKM A;  1HW1 A;  2OF7 A;  2QLZ A;  3DP7 A;  1TP4 A;  3WU2 C;  2AXT C;  1A35 A;  2CW0 F;  2DFE A;  4MFE A;  4F93 B;  2FBI A;  3KP2 A;  2ZB9 A;  3EYI A;  2VN2 A;  2FF4 A;  4LK1 F;  1WJ5 A;  2ZXH A;  3DPU A;  1Y0N A;  3L9F A;  3PO2 J;  1SFU A;  5IY5 H;  2R4G A;  3J7A Y;  2FML A;  1MMD A;  1RKT A;  5ILU A;  3NWT A;  3JAM K;  3PNV A;  2DYS H;  2V7F A;  2EA4 A;  3QYE A;  1N75 A;  5GAG J;  2Y9Y A;  1TW2 A;  5F1R A;  2EPF A;  2GM4 A;  4BHC A;  2JVG A;  2DA6 A;  3BZC A;  2QQB A;  4D1Q A;  2L02 A;  5D5W B;  1X4P A;  3J80 Z;  1IC8 A;  2ME0 A;  3BPX A;  4QSH A;  2ZO4 A;  4U0W A;  2ECB A;  3WHC A;  2XVC A;  1JGS A;  2R7X A;  2P5V A;  1D5V A;  2Y31 A;  1QGP A;  2QM3 A;  2LH9 A;  2VXD A;  2KDO A;  1RC9 A;  1Z7U A;  4KJZ A;  3RKW A;  3DKW A;  2XDV A;  4LLN A;  1TQI A;  3QU3 A;  4DNC A;  2L4M A;  2ELK A;  4ZYH A;  3TDU C;  3GXO A;  3JSO A;  2PMH A;  1B4A A;  5IPA A;  3DTI A;  2UWM A;  4F52 A;  2FXA A;  2EFO A;  1FYL A;  1SD4 A;  2VJJ A;  5F6F A;  4ZZD A;  1HCR A;  1U5T A;  5E1X A;  2M4K A;  4HLY A;  4TV7 A;  3QRF F;  1E3O C;  3HRU A;  3EUK L;  1XDS A;  3K4J A;  4XMY A;  3OYF A;  3JRB A;  2QA4 I;  3H1C A;  4LIU A;  2FE3 A;  4XID A;  2EFW A;  3ONQ A;  4BS9 A;  4A3F J;  2FD5 A;  3LSI A;  3ABT A;  5KHD A;  1JTY A;  1B6A A;  3L2W A;  2DTZ A;  4GCV A;  2LKX A;  2R7T A;  4J19 A;  3IWF A;  4OIQ F;  1HKT A;  1LVA A;  1BR2 A;  4PUS A;  3PQK A;  2CV2 A;  4XIC A;  3MQ0 A;  4DZJ A;  2OV7 A;  1OPC A;  1MH4 A;  3U1D A;  1GLN A;  1JI8 A;  4C2M J;  4Y4R A;  2HPI A;  3L2U A;  1QVT A;  1TWC J;  4KIC A;  2EFP A;  4W1U A;  3RIR A;  4OIN F;  2QSF X;  3L2C A;  2HYG D;  3HRS A;  2I8D A;  2Z9O A;  1T33 A;  4PJ0 C;  2ISZ A;  1F43 A;  1PYV A;  2GWR A;  1Z3Y A;  2FUG 2;  5D8L B;  1BL0 A;  5HS9 A;  1K78 B;  2DAO A;  5FKO A;  2LMD A;  5BS6 A;  3OYL A;  3KYC B;  1DP3 A;  1J09 A;  3FMQ A;  2CUF A;  2KIM A;  1ZR2 A;  1LKX A;  3BC8 A;  5IP6 A;  3IUO A;  3HKZ A;  2CQ7 A;  3S1R J;  3S1N J;  1RKW A;  3EUA A;  3PIP F;  2M5W A;  3L7W A;  3FXM A;  3MN2 A;  2ADU A;  1ZQ3 P;  2K3F A;  1F36 A;  1XCB A;  1JKO C;  1UAA A;  3I4N J;  2CV1 A;  3OR2 C;  1EV7 A;  3RKQ A;  4B44 A;  1XG1 A;  3I59 B;  2HTS A;  1STZ A;  3WTU C;  3FBI B;  2JVH A;  1VQ7 I;  4X6A J;  3CD6 I;  1Z67 A;  1FZP B;  3HOZ J;  4LG3 A;  1SFK A;  3M7G A;  4EVI A;  3C18 A;  4XKB A;  4J01 A;  3HPH A;  3FDY A;  4IHV A;  1W5C C;  2L7K A;  4UVB A;  1CQT A;  3FWE A;  3BOQ A;  4UV9 A;  2ZFW A;  3GTK J;  4E7Z A;  1R4N B;  1TT0 A;  1BC7 C;  3KEQ A;  5GAH J;  1LQ1 A;  1XN7 A;  1VQ5 I;  3TDZ C;  3JRG A;  1R58 A;  1XGO A;  3JR9 A;  4IL6 C;  2CJJ A;  2ZME C;  4PGG A;  4G6T B;  2KIQ A;  2PMU A;  1BM9 A;  1JHF A;  2EFN A;  4HDV A;  4XRF A;  3H36 A;  2DDB A;  3QP5 A;  2BW3 A;  4AVP A;  2OAZ A;  2GIZ A;  3OY9 A;  2IGM A;  5HDN A;  1YW9 A;  3MKY B;  4KN7 X;  3OV8 A;  2H1K A;  2NOJ B;  3WTS C;  1MJB A;  4Z6Y A;  3P7N A;  4U7B A;  1FT9 A;  3H9Q A;  3Q0U A;  1BW5 A;  3LFU A;  2COB A;  1HA8 A;  2DOF A;  2KP6 A;  2O03 A;  1QHH D;  3HPG A;  2EZK A;  2FNA A;  2NRA C;  2LKS A;  2GA1 A;  1D1A A;  1YX5 A;  5HNH A;  1V5E A;  3PFY A;  4NNJ A;  1BOB A;  3CUQ A;  5J4V A;  4ENK A;  3OYM A;  4XKV A;  2VKV A;  4RM2 A;  4BY7 J;  4IRG A;  4V19 K;  3LSR A;  5HS8 A;  1ODD A;  1P4X A;  1BI0 A;  1T0F C;  3S8P A;  1QPM A;  4N9I A;  2V6E A;  2BY3 A;  2ETH A;  4A3D J;  1YOV B;  2QYO A;  3NEU A;  3SFZ A;  2KPM A;  1JXS A;  5KK1 A;  1R4M B;  3ABM H;  2CUE A;  3E5Q A;  4LG0 A;  4K2E A;  2FNP A;  5H20 A;  5CLS A;  4UUT A;  3IRR A;  1ERD A;  3AAF A;  2X9D A;  4I7H A;  1K6Y A;  3A01 A;  4IHS A;  3KIO A;  2CSO A;  4LGW A;  3EUH C;  1JHH A;  5F27 A;  2V6C A;  3K70 D;  3EQL F;  3E5X A;  3BR2 A;  4PGH A;  5EG0 A;  1ZR4 A;  4I98 B;  1UCR A;  4IRH A;  2HPM A;  3H3V K;  2DFI A;  2IGO A;  2VE8 A;  2P7V B;  2QSG X;  1IXC A;  3FMS A;  1I1S A;  1H0M A;  2KIS A;  1C0W A;  2OZ6 A;  2HU9 A;  2KQR A;  2E1M B;  1X3U A;  4E4H A;  3CJQ B;  1QPI A;  4G12 A;  2VT2 A;  2NYX A;  4HNU A;  1BN5 A;  1XC5 A;  2VT3 A;  3HHH A;  3TOA A;  1ZRF A;  4L5E A;  1BIB A;  3J80 K;  1AKH A;  1GDT A;  5C4X J;  4HST A;  3R4K A;  3KFW X;  4QLC U;  3OYN A;  1YJ9 I;  4M71 A;  2W84 A;  1FP2 A;  2GZW A;  2V26 A;  5JVT A;  4IXA A;  1XMX A;  1ZG3 A;  2BE5 F;  4MQ9 F;  2JRT A;  2EIJ H;  1Y39 A;  2XPU A;  3ZQ7 A;  4RGX A;  4M6V A;  1ETO A;  4KFC A;  2GXG A;  1ULY A;  3O2P E;  1SFO J;  1YLF A;  3OIO A;  4IQJ A;  3G3Z A;  5JHU A;  3C2B A;  1GV5 A;  5F04 A;  2IS2 A;  2L7M P;  3K6G A;  5EZG A;  4HQE A;  2F5E A;  3HSR A;  3H5N A;  2JA8 J;  2DA1 A;  2B0L A;  1WH5 A;  3CES A;  1MNE A;  3V8K A;  2V1U A;  1Z1D A;  5K5Q A;  1NH3 A;  1LEB A;  4A3I J;  2WAD A;  4UVC A;  4BDY A;  1REP C;  3DTK A;  2DQL A;  4MIM A;  2O3F A;  3CC7 I;  3VWB A;  3S93 A;  4H0E A;  3GW2 A;  3QU6 A;  1CF7 B;  3CJR B;  2OUM A;  4G9Y A;  2BXY A;  2VJI A;  4OIR F;  3J7Y J;  4IX7 A;  1YYV A;  4FIS A;  2ZME A;  2JUC A;  4IHY A;  3A0H C;  2R92 J;  3CP2 A;  3VYS B;  1W1W E;  3HTU A;  1DU0 A;  2KLO A;  2WY7 Q;  4XSZ F;  1WZ2 A;  3BJO A;  4ZJZ A;  4KIS A;  3OSG A;  2EZL A;  1TBX A;  2MH9 A;  4IEJ A;  3PL8 A;  2QBY A;  3FM5 A;  4DIQ A;  1YS6 A;  2J5O A;  1IN5 A;  2CW8 A;  4YEL A;  5E3L A;  4Y7N J;  2QZ8 A;  4FQG A;  2JUG A; 
#chains in the Genus database with same CATH homology
 2B7E A;  2CQN A;  2DOF A;  2KIQ A;  2DOD A;  2E71 A;  2KFD A;  2KIS A;  2K85 A;  4FQG A;  1UZC A;  2KZG A;  2JUC A;  2LKS A;  2DOE A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...