2JUCA

Urn1 ff domain yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DIDERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Pre-mRNA-splicing factor URN1
publication title Solution structure of the yeast URN1 splicing factor FF domain: Comparative analysis of charge distributions in FF domain structures-FFs and SURPs, two domains with a similar fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2jucA00
2KFDA 2CQNA 2JUCA 2KISA 2L9VA 1UZCA 4FQGA 2DOFA 2KIQA 2KZGA 2LKSA 2DODA 2E71A 2K85A 2B7EA 2DOEA
chains in the Genus database with same CATH superfamily
2HVSA 2ESHA 3DKXA 1ETVA 3D1NI 1OLTA 2ZXJA 5LRRA 3RCOA 3F6OA 2ECBA 1G2HA 3DKWA 3LSKA 1IGNA 1MIJA 4ON0A 3G4SI 4I0AA 5ILSA 3PJRA 5EEHA 1ZGAA 4ESBA 3CMYA 1K4SA 3KFWX 3WE2A 1XGSA 4P9UA 2GLOA 1MDMA 2EFOA 1IW7F 4ESJA 2O7OA 4LG0A 2Z5UA 2A6TA 2DA1A 1LEBA 2MW8A 3E6BA 1JE8A 1REPC 3BG9A 1D3YA 3L09A 3PUBA 2HPMA 2HYGD 2EZLA 4C2TA 2XB5A 2CV0A 1O3SA 3T1BA 3ONQA 4RM2A 1YI2I 1FBUA 3RZOJ 2W4SA 1IDYA 2Q2EA 1Z21A 2KFDA 4A3MJ 2VE8A 3FK7A 2IW5A 4YELA 2FBKA 3VB2A 1FOYA 2RN7A 4GDFA 1E17A 1P6RA 3H5AA 5CKTA 3LSGA 4XM3A 2PG4A 1Z0XA 3HHHA 4I2OA 3QWLA 2RGVA 2BHYA 1YG2A 1L3LA 1I3QJ 3PL8A 1NHAA 1CQTA 4HLXA 2EQRA 2KP6A 4UUSB 4QPQA 2CFOA 1Y0UA 3S1RJ 2CW7A 3I64A 2R7TA 3EUHC 2K3PA 1Z6TA 2XUBA 5E8IA 1U78A 1R7JA 1ZRCA 3JAMZ 3MD2A 2COBA 4M3GA 1QPIA 2DPUA 2H09A 5ILUA 3C18A 4RB0A 1RUNA 2GQQA 1GV5A 4OMYA 3H1CA 1WKMA 3NWTA 2R5YA 1U9NA 5FJ8J 3IH2A 2HFHA 1D8JA 2JWTA 2RV8A 2VKEA 3M1EA 2F4IA 4D5FA 3HL2A 3G1OA 3HRUA 3DP7A 5J1YA 3H0DA 1UFMA 1WH5A 2KRHA 4MQ9F 2EFWA 2M1BA 3A03A 3CCYA 3KP4A 4RGSA 5DM7F 1JKRC 1C0WA 1OCRH 3R0AA 1IV6A 2EPFA 2FE3A 2V1UA 1LFBA 3M9AA 1R22A 2JK3A 1ETQA 3KETA 3DEWA 5J1UA 1MDMB 3G2BA 4IHSA 4LG0B 3CO7C 2PI0A 4U0VA 1Y39A 2GXAA 4L5EA 5LEJA 3ZRGA 1YRNB 4HNVA 3C1DA 5F0CA 1MJAA 1ONVA 4JQFA 1VQPI 2M4GA 2Q2EB 4IHYA 3CCVI 1MH3A 3NARA 4CCOA 3E6MA 3ZQQA 1EJ9A 4F52A 3O8GA 3ABKH 4MFDA 2ME6A 1Z9CA 2Z9OA 1WI3A 1RUOA 4OAYA 2BXYA 5ICCA 3OYBA 4CXFA 2LF8A 4CCNA 3LA7A 4RAZA 1ZR4A 4DJAA 3CCEI 2AS5F 4NQWA 2VBYA 4JYKA 4LLNA 2DODA 4OAZA 3LSMA 5C3EJ 3VFZA 2DA4A 2WAEA 2VQGA 2ZMEC 3CO6C 1QVUA 2EJRA 1FYMA 3BCBA 2M8EA 1FTTA 3K6GA 3WTWC 1VQ8I 3O2PE 4QLCU 2NS7A 1GHCA 1XD7A 2F48A 1GXPA 5DUKA 3COAC 4IQJA 3CC7I 3K2AA 3WTSC 4A2UA 2WAQA 2X1DA 1WI9A 4UY8I 2R5YB 3HIFA 1MSEC 2MH2A 1B9MA 3KP3A 3OL4A 5BPDA 3BQZA 3F72A 2GIVA 2IGNA 2QWWA 3D5RC 3O6BB 4PUSA 3ZQFA 1TZLA 2R7OA 5F0HA 1R6RA 1W4MA 2AXTC 2NNYA 3C2BA 1B1BA 2FEZA 4A3KJ 5F64A 2JMWA 3CC2I 1PYVA 1HKSA 4ZYGA 2XF7A 3CCQI 1HDDC 3S14J 4I01A 2M87A 1LJ9A 4G9YA 4KUMA 2JRMA 2OZ6A 5EG0A 4L9TA 5FO5A 3RKYA 3GXOA 5KNLA 1MNDA 1IUFA 1K83J 3IHUA 4Q48A 3J7AY 2TDXA 1BW6A 5L3FA 2E7XA 1SAUA 5TGTA 1U9OA 3S3OA 4EM2A 2QKMB 2M0MA 5LGTA 1M1EB 3ZQ7A 5LGNA 2XAFA 2E1MC 2J5OA 3A02A 3QYFA 3S2HJ 1QGPA 3WGIA 1H89C 2P4WA 5EDNA 4D5CA 1A04A 1BC7C 2IA1A 2R7DA 1DU6A 3PUFA 4NQWB 4BE2A 2L9VA 3Q9SA 4DQ2A 1ZH5A 3K4KA 2DN0A 4B3XA 2HOTA 3CMEI 3H92A 5E20A 3AG4H 4H4KC 3M1CA 3R61A 3Q3SA 1QO0D 1K4TA 3V8JA 1T95A 1XMKA 1Z7LA 1X1DA 2YX4A 3V8LA 4AD9A 1HSTA 4IRIA 3HDDA 2JRTA 2H94A 2IXSA 1RKWA 1P9QC 3PSIA 3IL2A 3I4MJ 4IHXA 3MZ8A 1AWCA 2DFEA 4Y13A 4XSXF 1WFXA 2HZTA 3ZGKA 2VBZA 4KIFA 3JR9A 1MGTA 3F0CA 5LBQA 2VLAA 4QWQA 4YFKF 4BE1A 3ELKA 5CVRA 2LBFA 1R5GA 3PIOF 4IVNA 4XN0A 2UZKA 1ZG1A 2V7FA 3KZYA 3ASNH 3WTYC 3S1MJ 1POGA 3WTXC 4IOAF 1QU3A 3K4CA 3EUKL 3PNVA 1D1BA 1I1SA 5EG0B 2OF7A 4MEXF 3GLXA 3EUAA 2FQ3A 5BMZA 2AO9A 4XK4A 1BIBA 3DXJF 4MIMA 1WSUA 5JVTA 1OR7A 2E36A 1BI0A 4OIQF 3OR2C 4B3AA 5F27A 2IGMA 3O8HA 2O6GE 1IC8A 3H5RA 2HOSA 1HXDA 2YSRA 3NWSA 5EZGA 2P5KA 3C3WA 4JP0A 2CFXA 3JRGA 3IP4B 3LAPA 1HW5A 3W2VA 3DF8A 4PCQA 4HSTA 2ELHA 2QQBA 4KMFA 2R7FA 2CQQA 4OOIA 2M30A 3G3ZA 4LITA 4CSWA 2E7WA 2ACJA 4XKBA 3H3VK 2GIZA 1H88C 3DPTA 4F7ZA 2YUSA 3BR1A 5LHGA 1YQAA 2OBPA 4QPOA 1WRJA 3GTQJ 2VKHA 2PLYA 3CUQA 4LB6B 1GLNA 2K5CA 2RQQA 3OWTA 2Y2ZA 3GFJA 3MVPA 4BL0B 3J81K 2OPTA 1IDZA 3HKZN 5FKOA 3BROA 3A1YA 1W0TA 1U8RA 4FQGA 1K6YA 4E7SA 3HTUA 4F92B 2XPUA 3DPUA 4HPQA 3LSJA 1G6NA 3IKTA 3WTZA 2X6XA 5CVJA 3OIOA 2HDWA 3BR5A 2QQ8A 2Z33A 3RPQA 4J19A 2XF5A 1MJBA 2KDOA 3KP7A 3NRVA 3U2RA 1OCOH 5FFZA 3FXOA 1ZREA 2DYRH 4IO9F 4WXCA 2DQRA 5DCFA 1Z3YA 2QCOA 1ZK8A 3RYPA 3SQNA 2N8GA 4BGDA 2PBIA 2HYFA 2NS0A 2CYYA 3S1NJ 2LSOA 3I53A 2W57A 1DGRM 2L4MA 2OQGA 2K7LA 4PDKA 3GLLA 4EJWA 3N97A 3CJQB 5FLVA 2R7UA 1TTYA 3ZQHA 2DMNA 3F23A 2Y9ZA 1S5LC 4ZYHA 2XDVA 3LSHA 1IXCA 1S7AA 3A4CA 1P7IA 5F6FA 3S2WA 4GRIA 5HVQC 4KIGA 1FJLA 2BW3A 3DWLE 4ZDPA 2HS5A 3HOYJ 1WH7A 1MBFA 2XC7A 5IT3A 1R4MB 2Y75A 3LWFA 4KICA 1P2FA 3VEPA 1U5TA 3SEQA 4UXNA 1ZG5A 4IHWA 1OKRA 3CDHA 1YW7A 4II3A 1LKXA 3G71I 4XNFA 3CUQB 1TNSA 4HQMA 3T8RA 3KEQA 2WY8Q 3SZTA 3BZCA 2H6CA 4CCJA 2EFNA 2MD0A 5B1AH 4D9JA 5AIQA 3V7CA 2CUEA 4ZC3A 2P7VB 5H2FC 2ZXHA 3LFUA 4GGGA 2LY2A 1Y56A 3JRIA 2YPRA 2WAFA 4IF4A 3FXJA 3EQLF 4HF2A 4EGZA 1H8AC 1WJCA 1E2XA 2YX7A 2EILH 4U7DA 4KISA 4B4CA 2JA5J 3IH4A 2F4OB 3GTKJ 2VPLA 4ENKA 4CGZA 4MO7A 3PSFA 2L9RA 2R7VA 2V9PA 4I76A 3HB9A 5D4SA 2B63J 5ICFA 2A5WA 2QKLB 4ZYDA 2IEKA 4A3IJ 3BG5A 3JRHA 2OUMA 4A3BJ 2E5ZA 2HZDA 1NH3A 1I27A 2F5DA 4PFPA 3ZN0A 4CDGA 3BZ6A 3I55I 3L9FA 3QAHA 2V9KA 1FBSA 1WPKA 5E18F 1ZR2A 4E7ZA 3I0TA 2K9QA 3GW2A 2DU9A 3BTIA 4B43A 2PFBA 4FHTA 2VKVA 4YIFA 4FX0A 1I1GA 2P5VA 3JAMK 5JR3A 3JRDA 2OQRA 2JSPA 1T6SA 4B48A 1F1ZA 1FY7A 2P7CB 2BW3B 2CV2A 1UAAA 1GVDA 2NYXA 1MMDA 4XLAA 5ILVA 2EV6A 3A0BC 3ZMSA 3D5SC 1GDTA 4F55A 1WCMJ 5L3CA 1TWCJ 2QF7A 4LIVA 1U5TB 5J40A 1I6HJ 3JTGA 5C4XJ 2VT2A 1NK3P 2GOXB 2GA1A 2M7AA 4A3JJ 5DDGA 1IUYA 4C30A 3D5LA 3AL0C 1LFUP 4DBRA 5B1BH 1ZTRA 5HNFA 3OV8A 2GOMA 2WV0A 4OMZA 2NOGA 1SD6A 4N9HA 3CTAA 5HNHA 3KLOA 1EV7A 3HKZA 1WJAA 1G3WA 2DA2A 2KJBA 3ABTA 1J5YA 1NG7A 2ZCWA 3ZPLA 3U9GA 2JA6J 4A6DA 4GYIA 2DMPA 1TT0A 3CLOA 3CMMA 2F4MB 2EIJH 1WJ5A 1RPWA 2CQKA 3DQVC 2VIXA 4C3HJ 1DUXC 2X6OA 1BW5A 1N78A 2TCTA 2IGKA 2KKOA 2XPWA 5F1RA 2L54A 2CRGA 3FKJA 4IPAA 1SMYF 3MZYA 2XAQA 1ZGWA 1HSJA 2Y69H 1X1BA 1YX3A 4AIHA 2Y0SN 3J7ZI 5K5RA 5GAHJ 3OOPA 2ZJPF 2CMPA 4BUPA 2HGCA 1YTYA 2ZC2A 4S0HB 1D0ZA 1FOXA 5IY5H 2DW4A 4EM1A 1MJ9A 2K27A 2O0YA 3FF5A 3SJMA 1ZN2A 3K0LA 2Q0OA 1I6XA 1VQOI 3BC8A 1HQCA 4LD5A 4WXHA 4HDVA 1BR4A 2JPBA 1RR8C 4XLNF 2E34A 1VQNI 2R7XA 1EH7A 1H9TA 1KONA 4BY7J 2HOAA 1Q1HA 3BZKA 3TOBA 2H27A 1LB2A 2R0QC 2QM3A 3SZPA 1ZGJA 1Z1DA 2M2EA 2QQAA 4FTHA 3RKWA 3W6KB 2VXDA 5DV5A 3VSLA 1XMXA 5EF6A 4UUVA 3ABUA 2D1VA 4CICA 3RIRA 1VQ7I 3IWFA 2CQ7A 1AHDP 2ETHA 4L0ZB 2XVCA 1YJWI 3DCFA 3EDPA 1GV2A 4V19K 3BPXA 3RQ4A 3Q0VA 1CF7A 4BHBA 3HOSA 3FXQA 4HV6A 2WA0A 5CQEA 2V1NA 3FM3A 2HVQA 4AUXA 5J47A 2DMUA 2MA3A 4D7NA 2EBIA 2O3FA 2FUG2 3I9V2 1QVTA 2IVMA 2H8RA 3MN2A 3IKVA 5CLSA 2OTJI 1S29A 3DU6A 2E71A 1ZKGA 3DBLB 4XLHA 5IOZA 1PJRA 2WTEA 2L7MP 5KHDA 3BG3A 4Z2YA 1G59A 2GZWA 3WE3A 1IRFA 3OYJA 2LOOA 4FETA 2X6YA 1PUEE 1T8IA 1D5YA 4YIIA 3ASOH 1TNTA 2NAZA 3HTSB 3QRFF 2EH3A 4WX9A 1YRNA 4B44A 5HLIA 2P6SA 4H0EA 1RR7A 3GO5A 4IJAA 4TV7A 2CUFA 2LFBA 3BJAA 3KEYA 4JX6A 1BR1A 4HNTA 4AIJA 4M74A 1KU7A 2DI3A 4U87A 4LK0F 1XGMA 2BHZA 2YR2A 3FZVA 4M3DA 1U3EM 3F21A 1X3WB 1MMSA 1XC5A 1USSA 2JJ7A 4ZDOA 5CPRB 3BP8A 5J8CA 2VPRA 2MABA 1E3HA 1SMTA 3QODA 5BNGA 1S9HA 4F3QA 3WU1B 4ZTFA 2K4JA 2QGUA 1B9NA 2H6BA 1WZ2A 1W1WE 4RA2A 1VQLI 2LYCA 3ZQIA 1CF7B 4MEYF 3J7AO 1QHHD 4Q5SF 2KDZA 1B4AA 4BU2A 2GXBA 2E1CA 4NC7A 2E1OA 3L2WA 5E79C 2FJ1A 5K1YA 1ZARA 2DA5A 2DO7A 3K4MA 5FLXK 2OV7A 4A69C 1LDJA 2G7HA 4DNCA 3BDDA 3REOA 2DA3A 2YS9A 2FSWA 3GEZA 5AIPA 2ZSIB 2WWYA 1ETWA 1RRJA 3TMOA 1ENHA 2EV0A 2FNAA 4BEHA 1B8IA 4I02A 4HX8A 2QZ8A 3QYBA 2JA8J 1O3RA 5BPIA 2IS6A 2DYSH 1Q1VA 4G7OF 4KN7X 4Y7NJ 1FYLA 4V2FA 3KZIC 1W36D 1YYVA 4UHTA 1XCBA 2Y48A 2Z1DA 2Y0SA 1NG6A 4IX7A 4ENJA 4PZJA 4CCLA 5DM6F 3PO2J 1FWZA 2ZKZA 3KYDB 4YG2F 1QQIA 1R5HA 3BOQA 5E1WA 3CCLI 3VODA 3P7NA 4II2A 1Y8RB 3I56I 9ANTA 1LDKB 3GZ5A 4WCGA 3DEEA 1R36A 4UB6C 4M72A 4XLCA 1TW3A 5E1XA 1ZRFA 4F91B 2V1DA 4M6XA 1TBXA 1SVOA 4XLPF 3ZN1A 3CJNA 1G3SA 1FMWA 4LGWA 4U7BA 1KU3A 1YE9A 1T33A 1IXSB 5EGOA 4E7LA 1NTCA 4OU0A 4ZYEA 2Z99A 1J0RA 3OL3A 3G1MA 5BOXA 5IT9Z 3O3KA 5J6XA 1O3TA 5FKKA 5KAIC 3RYRA 5JLXA 1IN7A 4HW0A 2DQLA 1EA3A 2ZFUA 4FCYA 1T08B 3ERMA 4XRSG 2IAIA 2CW8A 1ITYA 3WU0A 1IN8A 3MKZA 5M5XJ 4C9YA 2KQRA 1ETXA 1ZELA 2ZFWA 2WC2A 4N0BA 2CUZA 2UUZA 1Y1VJ 4YFXF 1Z7UA 2VQHA 5JI6A 4HG2A 3V7RA 3CUQC 1Y1WJ 3HSEA 2Q1ZB 1OYYA 4RS8A 3QOEA 4IRHA 3K70D 4MQVA 4BEHB 1XSDA 1B8IB 3OS2A 2A68F 2VJJA 2HDDA 3LSPA 5FD6A 1X1AA 5HS7A 2KRFA 5FLMJ 4N4OB 2L0KA 3MZHA 1TL8A 5L3DA 1D0XA 1I3AA 2GXGA 2R7ZJ 4KT6A 3K1NA 5A2QK 1A35A 3KPHA 5BQTA 2CSOA 3TOAA 4U88A 3RPUD 1J7KA 3RKXA 5D8LB 4Q4ZF 4V2GA 5DEQA 5HLGA 1MBHA 2EIMH 1IRGA 3GVAA 3DFGA 4CZCA 4GCVA 3U1KA 4P1WA 1MBEA 5B5EC 3BLYA 5HDKA 4XIDA 4KA4A 5EGOB 4B8XA 2HNHA 2L2OA 2XGDA 4XL9A 1UHSA 3ZXSA 1G3TA 4LIUA 1VQ6I 1D5VA 2RREA 1I39A 1OYIA 2GBYA 3KP5A 1FP2A 4RB1A 3L7WA 1PP7U 3FXKA 2BVLA 2PQ8A 2JQ7A 3FXRA 5E3OA 1SFEA 3T0YA 3IRRA 3ECHA 4A5MA 3GTPJ 1JXSA 4CYCA 3EETA 1T2KA 2JT1A 3KCCA 2LDUA 1AOYA 4L5IA 1J2XA 2HOEA 2XGCA 2XAJA 1SFXA 2XKPA 1KA8A 1U5TC 3RQIA 1OCTC 2PJRA 2JUCA 2B9SA 3K4BA 2XSDC 3OYKA 2XHKA 3H35A 2ISZA 4AU7A 1SFKA 5ED4A 3HRMA 1MMGA 5H6QA 4L9JA 4Q47A 4EJVA 3KYLA 2RAEA 2RKHA 2O61A 1MNEA 1BI2A 1XTAA 4M9ZA 4QTRA 1J59A 4XOPA 5D5WB 2OJED 1V5FA 2H1KA 3FHNA 3ZMDA 1QBJA 2BBYA 3PM1A 2BY0A 1UMQA 3HM5A 4Y15A 2MC3A 2XAHA 5LGUA 5F08A 2DJIA 4OWRB 4G7HF 3NQOA 4CO8A 2HXOA 2LLKA 1TC3C 2F5VA 5L3EA 5JVGF 2VXZA 4M73A 2QBYA 2DT7B 4GXOA 3AAFA 2K9LA 3U21A 3OYAA 5L3BA 2PX9A 3L2UA 1ZLKA 3E1SA 1W5SA 3DV8A 4JX5A 1QRYA 5FRNA 5C4JJ 2D45A 3LA2A 1TWHJ 4OINF 1MNMC 3HJEA 1UG0A 2VN2A 4L18B 3GBGA 4A3EJ 1S6LA 4FE7A 1X4PA 3ULQB 1AKHA 5D8KB 2UXNA 3HZJA 2RVCA 5D4RA 2ZXWH 3KIOA 4I0BA 1ZYRF 4DYCA 2AQFA 3BPVA 2QA4I 2HTJA 3HRSA 4CYCB 2HI3A 1D8KA 2A61A 1FT9A 2VONA 3HSRA 1GUUA 5EYRA 4A0ZA 3H9GA 2DFFA 1JTXA 3FXLA 3GYHX 5FKNA 3E3VA 1RC9A 3FMRA 4AYBN 4WWCA 4XOTA 4KYWA 1ZQ3P 2PJRB 3FMQA 4HV5A 3CCMI 1TWAJ 1V5GA 4B47A 5JFRA 2HKXA 4BYYA 5HLHA 3ECOA 1V54H 2HDCA 4BXXJ 4KIBA 2ELKA 3I5UA 4Y52J 3CZ6A 2IS1A 4IRGA 1K6OA 2YU9J 3FMSA 3OYHA 1PP8F 4M9XA 1Z77A 2BE5F 4S05A 4LJZF 1WVRA 1LFPA 4ESFA 2DDAA 1X1PA 4O5VA 3WG7H 1X3UA 2FD5A 2XV4S 1RNLA 3FXUA 2AXLA 5KAFC 3KP2A 3LA3A 1ETKA 2Q8KA 1B6AA 2M0CA 3RPUA 3JRBA 3CCJI 2VBWA 4O6JA 2IGOA 2LNBA 2QBYB 1MMAA 3FDYA 2D5VA 2R93J 2W25A 5J8FA 1RETA 4A0YA 4R79A 3ZMZA 5B66C 4IXAA 4BHCA 2K86A 3SZGA 1B59A 5LHHA 3J80Z 2VJ4A 3F3XA 2XAGA 1J09A 1BC8C 1TWFJ 2M8GX 1YW8A 2VB6A 3VYSB 4HX4A 4BJTA 4A3FJ 1AKHB 4XR6A 2EFQA 3DLLF 3GTLJ 5FD5A 3S3NA 4CCMA 3UR3C 3K4LA 4M9SA 4HF0A 2NVXJ 2KZVA 1MBGA 2ZXIA 1J9IA 1U0JA 2MGQA 3GFIA 4RLFA 4RBOA 4A6EA 3OYLA 2F2EA 3TW7A 3K2ZA 1KQ8A 3LSRA 4AM3A 4HZFA 2X6WA 3OSFA 5J4VA 4PJMA 1KQ9A 2ZMEB 5HLTA 1BN5A 2ZB9A 4AVZA 1WWXA 3K7AJ 3L2VA 2OCCH 1IN4A 3KX2A 4EJOA 1Z6RA 3AFHA 3MAJA 1FSHA 2LY9A 2MFZA 4XMYA 4NBQA 2HPIA 2EINH 3K4NA 2ID6A 2X4HA 4RGRA 1VNDA 5GADJ 1PDNC 2NVUB 3WTVC 1BOAA 1KYZA 1CGPA 1FOKA 1IJWC 2W84A 2Y9YA 2QENA 3V8KA 2VE9A 5ERIA 4HBLA 3WG9A 4C3IJ 3I71A 1DGWY 3PQKA 5GPAA 1ZG3A 2DAOA 1DU0A 2X48A 3PNYA 1I50J 1TT5B 3AKZA 1IG7A 2FXAA 4WK8F 3F8BA 3OYMA 1DPUA 4HQEA 2IS2A 5FFXA 5EZHA 2M9HA 2ISYA 3AG3H 3U1DA 3HOZJ 1MKMA 2I10A 2VUMJ 3UKGA 2K02A 1IXRC 4HRIA 3KYCB 5IYBJ 4X6AJ 4UUTA 1LPQA 1UB9A 4ENNA 1XG1A 1N75A 3IUOA 2W7NA 4BBSJ 2KIUA 1QZZA 3I59A 3FKIJ 4KDPA 4LOCA 1R1VA 1TQPA 1YX5A 3BJ6A 5LRSA 1WJFA 2V79A 3OIQA 2LVSA 3RI4A 1SFOJ 2M3AA 2JA2A 4PK4A 3RDIA 1A6QA 3T8TA 2LC2A 5IYDJ 4D0PA 4E70A 1IO2A 1FPQA 5D5VB 3S16J 2K40A 4XKCA 1KYWA 1UG2A 3L2QA 3MFKA 3OYIA 3MKWB 2KL4A 4DYQA 1S7EA 4AYBA 1XDUA 2KJCA 2Y0MA 4XKWA 4LMYA 3BR6A 1YLFA 3ZQLA 2QSFX 2ID3A 4Y3OA 3CMAI 1IN6A 4AIDA 1FLIA 3TO7A 3GCMA 4G8XA 4S04A 4RDUA 3GTJJ 3NEUA 2EV5A 1X19A 3K4JA 5GP9A 4AWXB 4EJUA 1SD7A 2BZTA 3I4PA 4YRVA 1X2MA 1MH4A 2JSCA 2BXZA 3F8FA 3GFLA 4WF2A 3E6DA 4XLEA 3BG6A 3BTJA 2DK5A 3SYTA 5JHFA 2MC4A 3MCZA 4A93J 1YIOA 4CH7A 2A69F 3HRTA 4IHTA 2O5RA 3GX4X 4I98B 5C44J 1MW7A 2VOOA 3OR1C 3SDGA 4EQQA 1UHWA 1W0UA 5IT9K 1K79A 2O03A 4Y17A 5BS6A 1MD0A 3I4NJ 1UZCA 2DMTA 1OPCA 1KZHA 4A3GJ 5IPAA 3CD6I 2LKSA 3DPLC 4RMNA 1HKQA 1FIPA 2XRNA 3M7GA 3IV5A 1XPXA 1MZBA 1R4NB 3HHGA 5F0FA 3V7SA 4MFEA 4I99C 3M3YJ 2LTPA 2RNGA 3GMEA 4HEA2 4IHVA 3K9TA 1N77A 2Z3YA 2E35A 1Z05A 4C3JJ 3I59B 1W7PA 4OIOF 1TQMA 2NVTJ 2EA4A 4PGGA 2K9MA 1A31A 4A5NA 5E3LA 4KT5C 3HGGA 5DYMA 1SEUA 3A0HC 2DPDA 4HAMA 2HQNA 1FIAA 3BR2A 2DT6A 2IBDA 4EV0A 1A6IA 3SHFA 2VJ5A 5K5QA 1VI0A 5L3GA 2HQRA 2NS8A 1YHQI 1O7LA 1ZAOA 5DD4A 1EF4A 1JHFA 4RAFA 3AG1H 1S3JA 1FZPB 1ERDA 5CYVA 5D5XB 3GTGJ 2E5NA 4PFOA 2A05A 2CWEA 5HODA 1P92A 4ZJZA 4BAYA 2YU3A 4U0YA 3DTIA 4NNJA 3OYGA 3C2GA 1Y8QB 1WJBA 2LRDA 1UCRA 4UB8C 1IN5A 3P9CA 3R6SA 4P9FA 5CVUA 2D2WA 3JCUC 2OTLI 2JPCA 1YFHA 2KMUA 3A01A 3E6CC 3R4KA 1I5ZA 3B6AA 2DMQA 2JVHA 1USTA 2OU2A 2QSGX 2R7QA 1ETYA 3OS1A 2K3FA 3L2CA 4ZTJA 3B6CA 4ITVA 2ZBKA 3CJTB 4G12A 2GM4A 5FKMA 5HDGA 3OYEA 3NAUA 1U6GA 1R5ID 2H1LA 4HX7A 3N05A 2IA2A 3ZOBA 2UWMA 3GTOJ 2MH9A 4MHGA 4DZJA 2EWNA 1K7AA 2STWA 2M45A 1YITI 1HA8A 3MKYB 1ULYA 2EZHA 3TQNA 1IRZA 2LG4A 3E5XA 2P0WA 1D1AA 2FNPA 2PMZN 5HS8A 4RM3A 1JKPC 4EGYA 2XF6A 1YJNI 1H9GA 4DOZA 2OCEA 2R7RA 5HDNA 2ESNA 2OZUA 1JGSA 3ZMUA 4I09A 3HEFA 1W7PB 4M3BA 4FX4A 2P81A 1G8XA 2HQ5A 4R1HA 4DBQA 2VASA 3VOEA 1JJ8C 4I7HA 1MBJA 1P4WA 1FP1D 2HYJA 3R0JA 4M6YA 4IOCF 1R9TJ 4HYEA 2D1HA 5GTHC 2PMUA 2RNJA 3KLNA 2HU9A 1IV8A 1ORKA 5KCMA 4BS9A 2Z2SB 4BQQA 1XN7A 2L02A 3BT9A 3H9QA 4AIKA 4XLFA 3PFYA 4IL6C 3HPHA 1JJ6C 3HUGB 3FX3A 5CVIA 2ME0A 4D1QA 2MSYA 1Z67A 2RQPA 3GUDA 2QVOA 1P4XA 3EYYA 5KVRA 4F93B 1F4KA 3T5XA 3CDLA 2MG4A 4XORA 3CUOA 4MLOA 3DTEA 1JKQC 3GWZA 5IP9J 2LKXA 1V3FA 1TP4A 1F36A 2BOLA 1E3OC 3IAM2 1W5TA 3WTUC 3VYRB 2VQCA 2LP0A 1LNWA 4KITB 2ZJQF 1P4AA 5K7ZA 4RGUA 1G4DA 4XN3A 1X4OA 4QSHA 1TQIA 3F8MA 1R00A 3G73A 3DLAA 5E1ZB 3A01B 3F9KA 4GFBA 2ICWG 2M7BA 3ZMVA 4P5OA 1KU2A 2XIGA 1PUFA 4UV8A 3LFKA 2GWRA 2L5QA 2L4AA 1BI3A 4PGHA 1RKTA 4J01A 3CC4I 4BJ6C 3FK6A 3CCSI 3I58A 3CLQA 4BY1J 3QPTA 2KIFA 2BYVE 4HOBA 1W36C 4G6QA 3BQYA 3ERED 4PSXA 4NC6A 3DTKA 4K2EA 1V4RA 4EATA 3ZMTA 4XSZF 1PVEA 5CJ9A 4P96A 3ESWB 2Y31A 3BG7A 4BDZA 4G6TB 3HOUJ 2CUJA 1X58A 1VQ9I 1LVKA 5TRDA 4R8HA 2NRAC 2CV1A 1T39A 3MKLA 4G7ZF 2IA0A 4IQ4A 4CZZA 2QSHX 1IF1A 1XX5A 1OR7C 4DW6A 2LK2A 4ZH4F 4RB3C 2VT3A 4FISA 3X2QH 3CESA 5FROA 6PAXA 1Y6IA 3ISPA 1ZLJA 2E19A 4PJLA 1GXQA 4D7MA 2CQNA 3QOPA 3FBNB 4MTDA 3ZQGA 2EB7A 2ELJA 2WY7Q 3VDXA 3ABLH 1BJZA 5M5WJ 3TEDA 1V5EA 2QYOA 2XROA 4L0YB 4KFCA 1T0FA 3S15J 1JI8A 4FE4A 2OD5A 2MYSA 2DLLA 2ECCA 2QUFA 4W1UA 5M5YJ 3OYFA 1HBXG 3PQJA 3BR3A 1T56A 2CGPA 1HOMA 4M3FA 4UVAA 5FGMA 3VPRA 4CA0A 1BJAA 4JBAA 2XB0X 3W2AA 4BDYA 3AL0B 4ZZLA 3LSIA 2DOFA 3W6JB 1SD5A 5IOYA 3JRAA 4XBFA 2J5PA 2QQ9A 4U0WA 4PSWA 2L9NA 2AHQA 1STZA 3SDBA 2K85A 3S32A 2KHMA 3PNTA 4BACA 3ABMH 2STTA 2G9WA 1JKOC 5GPCA 2FQ4A 1Y0NA 2K4BA 3HOWJ 3K70C 5DD8A 1PUFB 2WV1A 3J80K 3S2DJ 4HF1A 2DOEA 1LEAA 3QP5A 2LREA 2FF4A 3L2RA 2PJPA 1XCVA 3ML6A 2MLKA 5D5UB 1QA6A 1IAWA 1HW2A 1YS7A 1EKEA 3QPLA 1W5CC 2A3SA 1K78A 4XRMA 2WBMA 3BWGA 4KNYA 1VTNC 2XGXA 1YOVB 4X1EA 1HKTA 5KK1A 4M71A 4BQNA 4LLGF 2KIMA 1IRXA 1YO5C 3WODF 2LD5A 1J75A 2JUGA 2QEXI 2VOPA 2DA6A 3WTTC 1OFCX 1E3PA 2E2JJ 2HEOA 2X1EA 4Z6YA 5LEKA 3VYTB 2QLZA 2OAZA 5CVVA 2V6EA 2GAUA 1RIOH 2PMZA 3EPZA 2W1OA 2F5EA 2FX0A 5D6FA 4YFNF 1H0MA 1OYWA 3IWZA 3L00A 4MGRA 1JT0A 1L0OC 3LSTA 5TISC 4UVBA 3TDUC 1Z91A 3TKYA 2V6CA 3H5NA 4UNOA 1R58A 2DTRA 3M8FA 1O3QA 3DU5A 3MQ0A 2BEOA 3F8CA 2JA7J 1OCPA 1ZHFA 2DCEA 4KMUX 1WJEA 2DBBA 2X0LA 3QU3A 3JRFA 1VQ4I 1XMAA 1F9NA 2R4GA 5TJJA 2ZJ2A 1YJ9I 3AG2H 1LVAA 2UXXA 4CUGA 1SFUA 3HC7A 4FT8A 2P8TA 3DKYA 3OYDA 3OY9A 1QZYA 3EUHA 3GZ6A 4EJTA 2IRFG 2X85A 3LOCA 3OYNA 2DK8A 2VJIA 3TL4X 1HC8A 1BI1A 1SC7A 1BIAA 1SVLA 1XDSA 1VQMI 2KT0A 4KJZA 3H3ZA 3IAS2 3GTMJ 2CO5A 2E1NA 3LL7A 2E60A 4E7HA 2XPVA 3G1LA 1RI7A 3FBIB 2VBXA 3CQZJ 1FTZA 1HLVA 5CQGA 5F04A 2DXIA 1R71A 3S8PA 1SAXA 4C2MJ 4UVCA 4OIPF 4NDLA 3K1PA 2MLGA 2NOJB 3GF2A 2LMDA 1K78B 2V26A 1GT0C 2XRLA 3LMMA 5E8GA 2F5FA 3QU6A 1X1CA 1R1TA 1MMNA 2O8KA 4RAGA 3L1PA 2ZJRF 1OCZH 2ZO4A 2W85A 2FMYA 3K1MA 4E7JA 2XAUA 1D0YA 2EA2A 3UNGC 2L9SA 3BTCA 4KN4X 3RJPA 3G6EI 3ZR8X 2BGCA 3QPHA 1QZEA 1FEXA 3PFIA 1AA7A 4XICA 3LAJA 5DUIA 2R5ZA 3K69A 2OA4A 4DGWB 4WXDA 4E7KA 2IT0A 2EFPA 3MMYB 2E2HJ 4CCKA 2HKOA 2V1XA 1HDPA 1R1UA 3CJRB 1LUJB 3TW6A 5FLXZ 5GAEJ 5IP6A 2M34A 5IP7J 2KLOA 4JK1X 3H9JA 2KIQA 2FBIA 4MNUA 2MBFA 3HSFA 2TRTA 1YW9A 3DEUA 4E7IA 5JHUA 3SFZA 4BH9A 2XASA 3FM5A 2CW0F 1F43A 4QIWN 2ZMEA 3P5JA 4EEFG 2VC1A 1FNNA 1JUMA 4BKXA 1VQ5I 3S1QJ 3SFIA 3LQRA 1WGXA 2CG4A 4ZDLA 4LG3A 2A6EF 4M6VA 4N4NB 3RSNA 1APLC 4IKFA 5FB2A 3QP6A 1EH8A 5LD2C 3CCRI 3MEXA 2V9VA 1O7FA 1X2NA 2O8XA 4ENMA 1XSXA 1QNTA 4RGXA 1JT6A 4BJ5C 5J4YA 1DPRA 5HS9A 2CS3A 2FMLA 3CP8A 2FOWA 3KE2A 3OSGA 3Q0UA 3DBHB 4G94A 4XRFA 1F5TA 3FWEA 2UV1A 5J1RA 1P7JA 3B73A 1R49A 4B1RA 1VF9A 3EYIA 5FRMA 3IRQA 5J3LA 2LBFB 4GO1A 3SEZA 2Y30A 3TP0A 3JTHA 1WJDA 2F5CA 4BXUA 3V42A 3F22A 3TDZC 2PMHA 2C6YA 1RZ4A 4HNUA 1K61A 1KGSA 2HQAA 1AU7A 3E5QA 3P9IA 2AQEA 2VI6A 2EK5A 2R5ZB 2WADA 3LQQA 4A12A 1DP3A 3E7LA 1LDDA 3S3MA 2WB1N 4Y33A 2RC4A 2W24A 2W48A 1FX7A 1ON1A 2DT5A 2BV6A 3M8EA 3OYCA 4O3MA 4NHJA 3W3CA 4Y4RA 2IS4A 1HF0A 4G6DA 5K7HA 1W7PD 5HOOA 4RAYA 2W00A 4W97A 4MTEA 1IZ1A 4LFUA 1XSVA 3Q0WA 5K5OA 2P6TA 5EJCA 4EVIA 3PIPF 1DDNA 2EZKA 4BXFA 3ZP5A 1E0EA 1BL0A 2FU4A 4P55A 4LB5A 2F6CA 2VODA 2BY2A 2X1CA 3KP6A 1U8BA 4ZZDA 1QPMA 3FXMA 5DCMA 5H20A 5AONA 5A2QZ 2KISA 5GAGJ 2L7FP 2VQLA 3BCAA 4HA8A 4N9IA 1JUSA 4A3CJ 3BJOA 3GFMA 2ADUA 5EEGA 4IZZA 2V4JC 3ZQCA 3FISA 4I6ZA 3Q5FA 1TWGJ 3HYIA 2DOAA 1BR2A 3RKQA 1HCRA 3CP2A 3I54A 2GA2A 3C2HA 1DQUA 1TLHB 1TW2A 2BY3A 5E3NA 1JGGA 4J00A 4PJNA 2R7WA 4BHPA 4HLYA 3M4OJ 2IJLA 2VL8A 1GVJA 1VFCA 3I3LA 1FC3A 3H36A 3E0JB 2FA5A 5FKLA 4LLLA 1JTYA 2JTVA 2LKPA 1VZ0A 1OMIA 1A5JA 2DFHA 3KEOA 4E6KG 1KQ0A 2R92J 4DYRA 3HPGA 1R23A 1XGNA 5JLWA 3CDIA 2K9SA 4JOMA 1UHMA 2L7ZA 1JUPA 2CJJA 2BY1A 3E5UA 1RESA 2G0EA 3QYEA 3SXYA 1LE8A 2A07F 5IYCJ 1FSEA 2B0LA 5DS9A 4BQOA 3P9KA 2E1MB 5DTDA 2HVRA 3HGYA 3OS0A 3V4GA 4BQAA 2KZGA 3E97A 4DIQA 1EH6A 2EIKH 1YIJI 4UV9A 2P5LC 2OC6A 3CF5F 1QHGA 3S93A 1WHUA 1X3ZB 1MSFC 2XKOA 4YEJA 3IH3A 2XGEA 2A5YB 2DTZA 2LY1A 3W2WA 1FOWA 3OOUA 5GTIC 1XS9A 1JHHA 3HG9A 3IC7A 3HXLA 1O4XA 1UJ8A 2NVQJ 2NNNA 4ASNA 2FRHA 4A0XA 4M3EA 3BTLA 2H8WA 5LHIA 1BM9A 1S72I 3TBIA 1T38A 3CCUI 4XRSA 2PN6A 3RTRA 1B72A 5D6EA 2VKDA 3WU2C 4RB2C 2JN6A 5M3FJ 2LR8A 2FOKA 2M5WA 5DCMB 3MWMA 3LNQA 5K7FA 1BA5A 2A6HF 3VSKA 1D1CA 1OCCH 2NVYJ 3JW4A 3WHBA 1BOBA 4BE0A 2L7KA 1A36A 2ZSHB 4NUBA 3QQAA 3Q9VA 5ICEA 1ODDA 2RDPA 1ACIA 2KPMA 3QPSA 4NB5A 3ZCOA 2I8DA 4IEJA 2R3SA 2COMA 1XB4A 4HDUA 1WQ2A 2HXIA 4LK1F 4CYDA 1ON2A 1KU9A 2HTSA 3A2KA 5B3SH 1ETOA 3C7JA 3OMYA 2DFIA 2DJNA 2LF7A 4L9NA 2HWVA 2X9DA 2JVGA 2ZNYA 4ANJA 4L9VA 2G7UA 3HOTA 1NK2P 3R60A 3TP3A 3BY6A 1N25A 4C2UA 3HOXJ 4NC8A 4XONA 3HOVJ 4BNCA 5ICGA 1LE8B 5M3MJ 4L5JA 1ZRDA 2CU7A 4A3DJ 2XSJC 1O57A 4XQFA 2BVMA 4RLQA 3J81Z 5H6RA 1U2WA 3GZNB 1YS6A 3S17J 4PJJA 2CH0A 2O9LA 2ZNZA 2X51A 3HBLA 3BR0A 4BBRJ 2PEXA 1HW1A 2WB1A 2EZIA 2VC0A 2JZYA 5LLQA 3N4MA 3FHZA 2W82A 2CQXA 4B09A 1S7OA 1SVMA 3H3UA 2IP2A 4ZYAA 4EM0B 2R7SA 1BBYA 4AC0A 4X0GA 1V55H 4AVPA 4EMSA 3TGNA 3WGGA 3JREA 3M8JA 3F8NA 3JRCA 2KRCA 3JSPA 1FMVA 4PJ0C 5E17F 3H0GJ 5EEAA 1SD4A 3OIPA 4GYGA 1B72B 1LQ1A 4E4HA 3TO6A 2HR3A 2I5UA 2IPQX 3WHCA 3WGHA 5F1JA 3HUGA 3J7YJ 3B02A 3VYUB 1T0FC 5LFAA 4OIRF 3ROUA 3JSOA 4ABZA 1S8NA 3D0SA 1DP7P 1T98A 4XKVA 2L01A 3FIWA 2M4KA 5E3MA 4CHUA 1OQYA 4UUSA 2B7EA 1FBQA 1SANA 1Z3XA 3VWBA 1FYKA 2DA7A 1XGOA 2NXNB 2Z16A 2DDBA 4ETSA 1VQKI 3KZZA 4HSRA 3PO3J 1OJLA 4JX4A 3K10A 1UELB 4DZPA 2WAQN 1G3YA 2LH9A 4YIRX 2K9NA 2FBHA 3RZDJ 4A3LJ 3F6VA 2E2IJ 2L3DA 3W6VA 4FASD 3M07A 2MD5A 1OISA 3DBRB 1MBKA 3TO9A 3CF2A
chains in the Genus database with same CATH topology
2KFDA 2CQNA 2JUCA 2KISA 2L9VA 1UZCA 4FQGA 2DOFA 2KIQA 2KZGA 2LKSA 2DODA 2E71A 2K85A 2B7EA 2DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFD A;  2CQN A;  2JUC A;  2KIS A;  2L9V A;  1UZC A;  4FQG A;  2DOF A;  2KIQ A;  2KZG A;  2LKS A;  2DOD A;  2E71 A;  2K85 A;  2B7E A;  2DOE A; 
#chains in the Genus database with same CATH topology
 2HVS A;  2ESH A;  3DKX A;  1ETV A;  3D1N I;  1OLT A;  2ZXJ A;  5LRR A;  3RCO A;  3F6O A;  2ECB A;  1G2H A;  3DKW A;  3LSK A;  1IGN A;  1MIJ A;  4ON0 A;  3G4S I;  4I0A A;  5ILS A;  3PJR A;  5EEH A;  1ZGA A;  4ESB A;  3CMY A;  1K4S A;  3KFW X;  3WE2 A;  1XGS A;  4P9U A;  2GLO A;  1MDM A;  2EFO A;  1IW7 F;  4ESJ A;  2O7O A;  4LG0 A;  2Z5U A;  2A6T A;  2DA1 A;  1LEB A;  2MW8 A;  3E6B A;  1JE8 A;  1REP C;  3BG9 A;  1D3Y A;  3L09 A;  3PUB A;  2HPM A;  2HYG D;  2EZL A;  4C2T A;  2XB5 A;  2CV0 A;  1O3S A;  3T1B A;  3ONQ A;  4RM2 A;  1YI2 I;  1FBU A;  3RZO J;  2W4S A;  1IDY A;  2Q2E A;  1Z21 A;  2KFD A;  4A3M J;  2VE8 A;  3FK7 A;  2IW5 A;  4YEL A;  2FBK A;  3VB2 A;  1FOY A;  2RN7 A;  4GDF A;  1E17 A;  1P6R A;  3H5A A;  5CKT A;  3LSG A;  4XM3 A;  2PG4 A;  1Z0X A;  3HHH A;  4I2O A;  3QWL A;  2RGV A;  2BHY A;  1YG2 A;  1L3L A;  1I3Q J;  3PL8 A;  1NHA A;  1CQT A;  4HLX A;  2EQR A;  2KP6 A;  4UUS B;  4QPQ A;  2CFO A;  1Y0U A;  3S1R J;  2CW7 A;  3I64 A;  2R7T A;  3EUH C;  2K3P A;  1Z6T A;  2XUB A;  5E8I A;  1U78 A;  1R7J A;  1ZRC A;  3JAM Z;  3MD2 A;  2COB A;  4M3G A;  1QPI A;  2DPU A;  2H09 A;  5ILU A;  3C18 A;  4RB0 A;  1RUN A;  2GQQ A;  1GV5 A;  4OMY A;  3H1C A;  1WKM A;  3NWT A;  2R5Y A;  1U9N A;  5FJ8 J;  3IH2 A;  2HFH A;  1D8J A;  2JWT A;  2RV8 A;  2VKE A;  3M1E A;  2F4I A;  4D5F A;  3HL2 A;  3G1O A;  3HRU A;  3DP7 A;  5J1Y A;  3H0D A;  1UFM A;  1WH5 A;  2KRH A;  4MQ9 F;  2EFW A;  2M1B A;  3A03 A;  3CCY A;  3KP4 A;  4RGS A;  5DM7 F;  1JKR C;  1C0W A;  1OCR H;  3R0A A;  1IV6 A;  2EPF A;  2FE3 A;  2V1U A;  1LFB A;  3M9A A;  1R22 A;  2JK3 A;  1ETQ A;  3KET A;  3DEW A;  5J1U A;  1MDM B;  3G2B A;  4IHS A;  4LG0 B;  3CO7 C;  2PI0 A;  4U0V A;  1Y39 A;  2GXA A;  4L5E A;  5LEJ A;  3ZRG A;  1YRN B;  4HNV A;  3C1D A;  5F0C A;  1MJA A;  1ONV A;  4JQF A;  1VQP I;  2M4G A;  2Q2E B;  4IHY A;  3CCV I;  1MH3 A;  3NAR A;  4CCO A;  3E6M A;  3ZQQ A;  1EJ9 A;  4F52 A;  3O8G A;  3ABK H;  4MFD A;  2ME6 A;  1Z9C A;  2Z9O A;  1WI3 A;  1RUO A;  4OAY A;  2BXY A;  5ICC A;  3OYB A;  4CXF A;  2LF8 A;  4CCN A;  3LA7 A;  4RAZ A;  1ZR4 A;  4DJA A;  3CCE I;  2AS5 F;  4NQW A;  2VBY A;  4JYK A;  4LLN A;  2DOD A;  4OAZ A;  3LSM A;  5C3E J;  3VFZ A;  2DA4 A;  2WAE A;  2VQG A;  2ZME C;  3CO6 C;  1QVU A;  2EJR A;  1FYM A;  3BCB A;  2M8E A;  1FTT A;  3K6G A;  3WTW C;  1VQ8 I;  3O2P E;  4QLC U;  2NS7 A;  1GHC A;  1XD7 A;  2F48 A;  1GXP A;  5DUK A;  3COA C;  4IQJ A;  3CC7 I;  3K2A A;  3WTS C;  4A2U A;  2WAQ A;  2X1D A;  1WI9 A;  4UY8 I;  2R5Y B;  3HIF A;  1MSE C;  2MH2 A;  1B9M A;  3KP3 A;  3OL4 A;  5BPD A;  3BQZ A;  3F72 A;  2GIV A;  2IGN A;  2QWW A;  3D5R C;  3O6B B;  4PUS A;  3ZQF A;  1TZL A;  2R7O A;  5F0H A;  1R6R A;  1W4M A;  2AXT C;  2NNY A;  3C2B A;  1B1B A;  2FEZ A;  4A3K J;  5F64 A;  2JMW A;  3CC2 I;  1PYV A;  1HKS A;  4ZYG A;  2XF7 A;  3CCQ I;  1HDD C;  3S14 J;  4I01 A;  2M87 A;  1LJ9 A;  4G9Y A;  4KUM A;  2JRM A;  2OZ6 A;  5EG0 A;  4L9T A;  5FO5 A;  3RKY A;  3GXO A;  5KNL A;  1MND A;  1IUF A;  1K83 J;  3IHU A;  4Q48 A;  3J7A Y;  2TDX A;  1BW6 A;  5L3F A;  2E7X A;  1SAU A;  5TGT A;  1U9O A;  3S3O A;  4EM2 A;  2QKM B;  2M0M A;  5LGT A;  1M1E B;  3ZQ7 A;  5LGN A;  2XAF A;  2E1M C;  2J5O A;  3A02 A;  3QYF A;  3S2H J;  1QGP A;  3WGI A;  1H89 C;  2P4W A;  5EDN A;  4D5C A;  1A04 A;  1BC7 C;  2IA1 A;  2R7D A;  1DU6 A;  3PUF A;  4NQW B;  4BE2 A;  2L9V A;  3Q9S A;  4DQ2 A;  1ZH5 A;  3K4K A;  2DN0 A;  4B3X A;  2HOT A;  3CME I;  3H92 A;  5E20 A;  3AG4 H;  4H4K C;  3M1C A;  3R61 A;  3Q3S A;  1QO0 D;  1K4T A;  3V8J A;  1T95 A;  1XMK A;  1Z7L A;  1X1D A;  2YX4 A;  3V8L A;  4AD9 A;  1HST A;  4IRI A;  3HDD A;  2JRT A;  2H94 A;  2IXS A;  1RKW A;  1P9Q C;  3PSI A;  3IL2 A;  3I4M J;  4IHX A;  3MZ8 A;  1AWC A;  2DFE A;  4Y13 A;  4XSX F;  1WFX A;  2HZT A;  3ZGK A;  2VBZ A;  4KIF A;  3JR9 A;  1MGT A;  3F0C A;  5LBQ A;  2VLA A;  4QWQ A;  4YFK F;  4BE1 A;  3ELK A;  5CVR A;  2LBF A;  1R5G A;  3PIO F;  4IVN A;  4XN0 A;  2UZK A;  1ZG1 A;  2V7F A;  3KZY A;  3ASN H;  3WTY C;  3S1M J;  1POG A;  3WTX C;  4IOA F;  1QU3 A;  3K4C A;  3EUK L;  3PNV A;  1D1B A;  1I1S A;  5EG0 B;  2OF7 A;  4MEX F;  3GLX A;  3EUA A;  2FQ3 A;  5BMZ A;  2AO9 A;  4XK4 A;  1BIB A;  3DXJ F;  4MIM A;  1WSU A;  5JVT A;  1OR7 A;  2E36 A;  1BI0 A;  4OIQ F;  3OR2 C;  4B3A A;  5F27 A;  2IGM A;  3O8H A;  2O6G E;  1IC8 A;  3H5R A;  2HOS A;  1HXD A;  2YSR A;  3NWS A;  5EZG A;  2P5K A;  3C3W A;  4JP0 A;  2CFX A;  3JRG A;  3IP4 B;  3LAP A;  1HW5 A;  3W2V A;  3DF8 A;  4PCQ A;  4HST A;  2ELH A;  2QQB A;  4KMF A;  2R7F A;  2CQQ A;  4OOI A;  2M30 A;  3G3Z A;  4LIT A;  4CSW A;  2E7W A;  2ACJ A;  4XKB A;  3H3V K;  2GIZ A;  1H88 C;  3DPT A;  4F7Z A;  2YUS A;  3BR1 A;  5LHG A;  1YQA A;  2OBP A;  4QPO A;  1WRJ A;  3GTQ J;  2VKH A;  2PLY A;  3CUQ A;  4LB6 B;  1GLN A;  2K5C A;  2RQQ A;  3OWT A;  2Y2Z A;  3GFJ A;  3MVP A;  4BL0 B;  3J81 K;  2OPT A;  1IDZ A;  3HKZ N;  5FKO A;  3BRO A;  3A1Y A;  1W0T A;  1U8R A;  4FQG A;  1K6Y A;  4E7S A;  3HTU A;  4F92 B;  2XPU A;  3DPU A;  4HPQ A;  3LSJ A;  1G6N A;  3IKT A;  3WTZ A;  2X6X A;  5CVJ A;  3OIO A;  2HDW A;  3BR5 A;  2QQ8 A;  2Z33 A;  3RPQ A;  4J19 A;  2XF5 A;  1MJB A;  2KDO A;  3KP7 A;  3NRV A;  3U2R A;  1OCO H;  5FFZ A;  3FXO A;  1ZRE A;  2DYR H;  4IO9 F;  4WXC A;  2DQR A;  5DCF A;  1Z3Y A;  2QCO A;  1ZK8 A;  3RYP A;  3SQN A;  2N8G A;  4BGD A;  2PBI A;  2HYF A;  2NS0 A;  2CYY A;  3S1N J;  2LSO A;  3I53 A;  2W57 A;  1DGR M;  2L4M A;  2OQG A;  2K7L A;  4PDK A;  3GLL A;  4EJW A;  3N97 A;  3CJQ B;  5FLV A;  2R7U A;  1TTY A;  3ZQH A;  2DMN A;  3F23 A;  2Y9Z A;  1S5L C;  4ZYH A;  2XDV A;  3LSH A;  1IXC A;  1S7A A;  3A4C A;  1P7I A;  5F6F A;  3S2W A;  4GRI A;  5HVQ C;  4KIG A;  1FJL A;  2BW3 A;  3DWL E;  4ZDP A;  2HS5 A;  3HOY J;  1WH7 A;  1MBF A;  2XC7 A;  5IT3 A;  1R4M B;  2Y75 A;  3LWF A;  4KIC A;  1P2F A;  3VEP A;  1U5T A;  3SEQ A;  4UXN A;  1ZG5 A;  4IHW A;  1OKR A;  3CDH A;  1YW7 A;  4II3 A;  1LKX A;  3G71 I;  4XNF A;  3CUQ B;  1TNS A;  4HQM A;  3T8R A;  3KEQ A;  2WY8 Q;  3SZT A;  3BZC A;  2H6C A;  4CCJ A;  2EFN A;  2MD0 A;  5B1A H;  4D9J A;  5AIQ A;  3V7C A;  2CUE A;  4ZC3 A;  2P7V B;  5H2F C;  2ZXH A;  3LFU A;  4GGG A;  2LY2 A;  1Y56 A;  3JRI A;  2YPR A;  2WAF A;  4IF4 A;  3FXJ A;  3EQL F;  4HF2 A;  4EGZ A;  1H8A C;  1WJC A;  1E2X A;  2YX7 A;  2EIL H;  4U7D A;  4KIS A;  4B4C A;  2JA5 J;  3IH4 A;  2F4O B;  3GTK J;  2VPL A;  4ENK A;  4CGZ A;  4MO7 A;  3PSF A;  2L9R A;  2R7V A;  2V9P A;  4I76 A;  3HB9 A;  5D4S A;  2B63 J;  5ICF A;  2A5W A;  2QKL B;  4ZYD A;  2IEK A;  4A3I J;  3BG5 A;  3JRH A;  2OUM A;  4A3B J;  2E5Z A;  2HZD A;  1NH3 A;  1I27 A;  2F5D A;  4PFP A;  3ZN0 A;  4CDG A;  3BZ6 A;  3I55 I;  3L9F A;  3QAH A;  2V9K A;  1FBS A;  1WPK A;  5E18 F;  1ZR2 A;  4E7Z A;  3I0T A;  2K9Q A;  3GW2 A;  2DU9 A;  3BTI A;  4B43 A;  2PFB A;  4FHT A;  2VKV A;  4YIF A;  4FX0 A;  1I1G A;  2P5V A;  3JAM K;  5JR3 A;  3JRD A;  2OQR A;  2JSP A;  1T6S A;  4B48 A;  1F1Z A;  1FY7 A;  2P7C B;  2BW3 B;  2CV2 A;  1UAA A;  1GVD A;  2NYX A;  1MMD A;  4XLA A;  5ILV A;  2EV6 A;  3A0B C;  3ZMS A;  3D5S C;  1GDT A;  4F55 A;  1WCM J;  5L3C A;  1TWC J;  2QF7 A;  4LIV A;  1U5T B;  5J40 A;  1I6H J;  3JTG A;  5C4X J;  2VT2 A;  1NK3 P;  2GOX B;  2GA1 A;  2M7A A;  4A3J J;  5DDG A;  1IUY A;  4C30 A;  3D5L A;  3AL0 C;  1LFU P;  4DBR A;  5B1B H;  1ZTR A;  5HNF A;  3OV8 A;  2GOM A;  2WV0 A;  4OMZ A;  2NOG A;  1SD6 A;  4N9H A;  3CTA A;  5HNH A;  3KLO A;  1EV7 A;  3HKZ A;  1WJA A;  1G3W A;  2DA2 A;  2KJB A;  3ABT A;  1J5Y A;  1NG7 A;  2ZCW A;  3ZPL A;  3U9G A;  2JA6 J;  4A6D A;  4GYI A;  2DMP A;  1TT0 A;  3CLO A;  3CMM A;  2F4M B;  2EIJ H;  1WJ5 A;  1RPW A;  2CQK A;  3DQV C;  2VIX A;  4C3H J;  1DUX C;  2X6O A;  1BW5 A;  1N78 A;  2TCT A;  2IGK A;  2KKO A;  2XPW A;  5F1R A;  2L54 A;  2CRG A;  3FKJ A;  4IPA A;  1SMY F;  3MZY A;  2XAQ A;  1ZGW A;  1HSJ A;  2Y69 H;  1X1B A;  1YX3 A;  4AIH A;  2Y0S N;  3J7Z I;  5K5R A;  5GAH J;  3OOP A;  2ZJP F;  2CMP A;  4BUP A;  2HGC A;  1YTY A;  2ZC2 A;  4S0H B;  1D0Z A;  1FOX A;  5IY5 H;  2DW4 A;  4EM1 A;  1MJ9 A;  2K27 A;  2O0Y A;  3FF5 A;  3SJM A;  1ZN2 A;  3K0L A;  2Q0O A;  1I6X A;  1VQO I;  3BC8 A;  1HQC A;  4LD5 A;  4WXH A;  4HDV A;  1BR4 A;  2JPB A;  1RR8 C;  4XLN F;  2E34 A;  1VQN I;  2R7X A;  1EH7 A;  1H9T A;  1KON A;  4BY7 J;  2HOA A;  1Q1H A;  3BZK A;  3TOB A;  2H27 A;  1LB2 A;  2R0Q C;  2QM3 A;  3SZP A;  1ZGJ A;  1Z1D A;  2M2E A;  2QQA A;  4FTH A;  3RKW A;  3W6K B;  2VXD A;  5DV5 A;  3VSL A;  1XMX A;  5EF6 A;  4UUV A;  3ABU A;  2D1V A;  4CIC A;  3RIR A;  1VQ7 I;  3IWF A;  2CQ7 A;  1AHD P;  2ETH A;  4L0Z B;  2XVC A;  1YJW I;  3DCF A;  3EDP A;  1GV2 A;  4V19 K;  3BPX A;  3RQ4 A;  3Q0V A;  1CF7 A;  4BHB A;  3HOS A;  3FXQ A;  4HV6 A;  2WA0 A;  5CQE A;  2V1N A;  3FM3 A;  2HVQ A;  4AUX A;  5J47 A;  2DMU A;  2MA3 A;  4D7N A;  2EBI A;  2O3F A;  2FUG 2;  3I9V 2;  1QVT A;  2IVM A;  2H8R A;  3MN2 A;  3IKV A;  5CLS A;  2OTJ I;  1S29 A;  3DU6 A;  2E71 A;  1ZKG A;  3DBL B;  4XLH A;  5IOZ A;  1PJR A;  2WTE A;  2L7M P;  5KHD A;  3BG3 A;  4Z2Y A;  1G59 A;  2GZW A;  3WE3 A;  1IRF A;  3OYJ A;  2LOO A;  4FET A;  2X6Y A;  1PUE E;  1T8I A;  1D5Y A;  4YII A;  3ASO H;  1TNT A;  2NAZ A;  3HTS B;  3QRF F;  2EH3 A;  4WX9 A;  1YRN A;  4B44 A;  5HLI A;  2P6S A;  4H0E A;  1RR7 A;  3GO5 A;  4IJA A;  4TV7 A;  2CUF A;  2LFB A;  3BJA A;  3KEY A;  4JX6 A;  1BR1 A;  4HNT A;  4AIJ A;  4M74 A;  1KU7 A;  2DI3 A;  4U87 A;  4LK0 F;  1XGM A;  2BHZ A;  2YR2 A;  3FZV A;  4M3D A;  1U3E M;  3F21 A;  1X3W B;  1MMS A;  1XC5 A;  1USS A;  2JJ7 A;  4ZDO A;  5CPR B;  3BP8 A;  5J8C A;  2VPR A;  2MAB A;  1E3H A;  1SMT A;  3QOD A;  5BNG A;  1S9H A;  4F3Q A;  3WU1 B;  4ZTF A;  2K4J A;  2QGU A;  1B9N A;  2H6B A;  1WZ2 A;  1W1W E;  4RA2 A;  1VQL I;  2LYC A;  3ZQI A;  1CF7 B;  4MEY F;  3J7A O;  1QHH D;  4Q5S F;  2KDZ A;  1B4A A;  4BU2 A;  2GXB A;  2E1C A;  4NC7 A;  2E1O A;  3L2W A;  5E79 C;  2FJ1 A;  5K1Y A;  1ZAR A;  2DA5 A;  2DO7 A;  3K4M A;  5FLX K;  2OV7 A;  4A69 C;  1LDJ A;  2G7H A;  4DNC A;  3BDD A;  3REO A;  2DA3 A;  2YS9 A;  2FSW A;  3GEZ A;  5AIP A;  2ZSI B;  2WWY A;  1ETW A;  1RRJ A;  3TMO A;  1ENH A;  2EV0 A;  2FNA A;  4BEH A;  1B8I A;  4I02 A;  4HX8 A;  2QZ8 A;  3QYB A;  2JA8 J;  1O3R A;  5BPI A;  2IS6 A;  2DYS H;  1Q1V A;  4G7O F;  4KN7 X;  4Y7N J;  1FYL A;  4V2F A;  3KZI C;  1W36 D;  1YYV A;  4UHT A;  1XCB A;  2Y48 A;  2Z1D A;  2Y0S A;  1NG6 A;  4IX7 A;  4ENJ A;  4PZJ A;  4CCL A;  5DM6 F;  3PO2 J;  1FWZ A;  2ZKZ A;  3KYD B;  4YG2 F;  1QQI A;  1R5H A;  3BOQ A;  5E1W A;  3CCL I;  3VOD A;  3P7N A;  4II2 A;  1Y8R B;  3I56 I;  9ANT A;  1LDK B;  3GZ5 A;  4WCG A;  3DEE A;  1R36 A;  4UB6 C;  4M72 A;  4XLC A;  1TW3 A;  5E1X A;  1ZRF A;  4F91 B;  2V1D A;  4M6X A;  1TBX A;  1SVO A;  4XLP F;  3ZN1 A;  3CJN A;  1G3S A;  1FMW A;  4LGW A;  4U7B A;  1KU3 A;  1YE9 A;  1T33 A;  1IXS B;  5EGO A;  4E7L A;  1NTC A;  4OU0 A;  4ZYE A;  2Z99 A;  1J0R A;  3OL3 A;  3G1M A;  5BOX A;  5IT9 Z;  3O3K A;  5J6X A;  1O3T A;  5FKK A;  5KAI C;  3RYR A;  5JLX A;  1IN7 A;  4HW0 A;  2DQL A;  1EA3 A;  2ZFU A;  4FCY A;  1T08 B;  3ERM A;  4XRS G;  2IAI A;  2CW8 A;  1ITY A;  3WU0 A;  1IN8 A;  3MKZ A;  5M5X J;  4C9Y A;  2KQR A;  1ETX A;  1ZEL A;  2ZFW A;  2WC2 A;  4N0B A;  2CUZ A;  2UUZ A;  1Y1V J;  4YFX F;  1Z7U A;  2VQH A;  5JI6 A;  4HG2 A;  3V7R A;  3CUQ C;  1Y1W J;  3HSE A;  2Q1Z B;  1OYY A;  4RS8 A;  3QOE A;  4IRH A;  3K70 D;  4MQV A;  4BEH B;  1XSD A;  1B8I B;  3OS2 A;  2A68 F;  2VJJ A;  2HDD A;  3LSP A;  5FD6 A;  1X1A A;  5HS7 A;  2KRF A;  5FLM J;  4N4O B;  2L0K A;  3MZH A;  1TL8 A;  5L3D A;  1D0X A;  1I3A A;  2GXG A;  2R7Z J;  4KT6 A;  3K1N A;  5A2Q K;  1A35 A;  3KPH A;  5BQT A;  2CSO A;  3TOA A;  4U88 A;  3RPU D;  1J7K A;  3RKX A;  5D8L B;  4Q4Z F;  4V2G A;  5DEQ A;  5HLG A;  1MBH A;  2EIM H;  1IRG A;  3GVA A;  3DFG A;  4CZC A;  4GCV A;  3U1K A;  4P1W A;  1MBE A;  5B5E C;  3BLY A;  5HDK A;  4XID A;  4KA4 A;  5EGO B;  4B8X A;  2HNH A;  2L2O A;  2XGD A;  4XL9 A;  1UHS A;  3ZXS A;  1G3T A;  4LIU A;  1VQ6 I;  1D5V A;  2RRE A;  1I39 A;  1OYI A;  2GBY A;  3KP5 A;  1FP2 A;  4RB1 A;  3L7W A;  1PP7 U;  3FXK A;  2BVL A;  2PQ8 A;  2JQ7 A;  3FXR A;  5E3O A;  1SFE A;  3T0Y A;  3IRR A;  3ECH A;  4A5M A;  3GTP J;  1JXS A;  4CYC A;  3EET A;  1T2K A;  2JT1 A;  3KCC A;  2LDU A;  1AOY A;  4L5I A;  1J2X A;  2HOE A;  2XGC A;  2XAJ A;  1SFX A;  2XKP A;  1KA8 A;  1U5T C;  3RQI A;  1OCT C;  2PJR A;  2JUC A;  2B9S A;  3K4B A;  2XSD C;  3OYK A;  2XHK A;  3H35 A;  2ISZ A;  4AU7 A;  1SFK A;  5ED4 A;  3HRM A;  1MMG A;  5H6Q A;  4L9J A;  4Q47 A;  4EJV A;  3KYL A;  2RAE A;  2RKH A;  2O61 A;  1MNE A;  1BI2 A;  1XTA A;  4M9Z A;  4QTR A;  1J59 A;  4XOP A;  5D5W B;  2OJE D;  1V5F A;  2H1K A;  3FHN A;  3ZMD A;  1QBJ A;  2BBY A;  3PM1 A;  2BY0 A;  1UMQ A;  3HM5 A;  4Y15 A;  2MC3 A;  2XAH A;  5LGU A;  5F08 A;  2DJI A;  4OWR B;  4G7H F;  3NQO A;  4CO8 A;  2HXO A;  2LLK A;  1TC3 C;  2F5V A;  5L3E A;  5JVG F;  2VXZ A;  4M73 A;  2QBY A;  2DT7 B;  4GXO A;  3AAF A;  2K9L A;  3U21 A;  3OYA A;  5L3B A;  2PX9 A;  3L2U A;  1ZLK A;  3E1S A;  1W5S A;  3DV8 A;  4JX5 A;  1QRY A;  5FRN A;  5C4J J;  2D45 A;  3LA2 A;  1TWH J;  4OIN F;  1MNM C;  3HJE A;  1UG0 A;  2VN2 A;  4L18 B;  3GBG A;  4A3E J;  1S6L A;  4FE7 A;  1X4P A;  3ULQ B;  1AKH A;  5D8K B;  2UXN A;  3HZJ A;  2RVC A;  5D4R A;  2ZXW H;  3KIO A;  4I0B A;  1ZYR F;  4DYC A;  2AQF A;  3BPV A;  2QA4 I;  2HTJ A;  3HRS A;  4CYC B;  2HI3 A;  1D8K A;  2A61 A;  1FT9 A;  2VON A;  3HSR A;  1GUU A;  5EYR A;  4A0Z A;  3H9G A;  2DFF A;  1JTX A;  3FXL A;  3GYH X;  5FKN A;  3E3V A;  1RC9 A;  3FMR A;  4AYB N;  4WWC A;  4XOT A;  4KYW A;  1ZQ3 P;  2PJR B;  3FMQ A;  4HV5 A;  3CCM I;  1TWA J;  1V5G A;  4B47 A;  5JFR A;  2HKX A;  4BYY A;  5HLH A;  3ECO A;  1V54 H;  2HDC A;  4BXX J;  4KIB A;  2ELK A;  3I5U A;  4Y52 J;  3CZ6 A;  2IS1 A;  4IRG A;  1K6O A;  2YU9 J;  3FMS A;  3OYH A;  1PP8 F;  4M9X A;  1Z77 A;  2BE5 F;  4S05 A;  4LJZ F;  1WVR A;  1LFP A;  4ESF A;  2DDA A;  1X1P A;  4O5V A;  3WG7 H;  1X3U A;  2FD5 A;  2XV4 S;  1RNL A;  3FXU A;  2AXL A;  5KAF C;  3KP2 A;  3LA3 A;  1ETK A;  2Q8K A;  1B6A A;  2M0C A;  3RPU A;  3JRB A;  3CCJ I;  2VBW A;  4O6J A;  2IGO A;  2LNB A;  2QBY B;  1MMA A;  3FDY A;  2D5V A;  2R93 J;  2W25 A;  5J8F A;  1RET A;  4A0Y A;  4R79 A;  3ZMZ A;  5B66 C;  4IXA A;  4BHC A;  2K86 A;  3SZG A;  1B59 A;  5LHH A;  3J80 Z;  2VJ4 A;  3F3X A;  2XAG A;  1J09 A;  1BC8 C;  1TWF J;  2M8G X;  1YW8 A;  2VB6 A;  3VYS B;  4HX4 A;  4BJT A;  4A3F J;  1AKH B;  4XR6 A;  2EFQ A;  3DLL F;  3GTL J;  5FD5 A;  3S3N A;  4CCM A;  3UR3 C;  3K4L A;  4M9S A;  4HF0 A;  2NVX J;  2KZV A;  1MBG A;  2ZXI A;  1J9I A;  1U0J A;  2MGQ A;  3GFI A;  4RLF A;  4RBO A;  4A6E A;  3OYL A;  2F2E A;  3TW7 A;  3K2Z A;  1KQ8 A;  3LSR A;  4AM3 A;  4HZF A;  2X6W A;  3OSF A;  5J4V A;  4PJM A;  1KQ9 A;  2ZME B;  5HLT A;  1BN5 A;  2ZB9 A;  4AVZ A;  1WWX A;  3K7A J;  3L2V A;  2OCC H;  1IN4 A;  3KX2 A;  4EJO A;  1Z6R A;  3AFH A;  3MAJ A;  1FSH A;  2LY9 A;  2MFZ A;  4XMY A;  4NBQ A;  2HPI A;  2EIN H;  3K4N A;  2ID6 A;  2X4H A;  4RGR A;  1VND A;  5GAD J;  1PDN C;  2NVU B;  3WTV C;  1BOA A;  1KYZ A;  1CGP A;  1FOK A;  1IJW C;  2W84 A;  2Y9Y A;  2QEN A;  3V8K A;  2VE9 A;  5ERI A;  4HBL A;  3WG9 A;  4C3I J;  3I71 A;  1DGW Y;  3PQK A;  5GPA A;  1ZG3 A;  2DAO A;  1DU0 A;  2X48 A;  3PNY A;  1I50 J;  1TT5 B;  3AKZ A;  1IG7 A;  2FXA A;  4WK8 F;  3F8B A;  3OYM A;  1DPU A;  4HQE A;  2IS2 A;  5FFX A;  5EZH A;  2M9H A;  2ISY A;  3AG3 H;  3U1D A;  3HOZ J;  1MKM A;  2I10 A;  2VUM J;  3UKG A;  2K02 A;  1IXR C;  4HRI A;  3KYC B;  5IYB J;  4X6A J;  4UUT A;  1LPQ A;  1UB9 A;  4ENN A;  1XG1 A;  1N75 A;  3IUO A;  2W7N A;  4BBS J;  2KIU A;  1QZZ A;  3I59 A;  3FKI J;  4KDP A;  4LOC A;  1R1V A;  1TQP A;  1YX5 A;  3BJ6 A;  5LRS A;  1WJF A;  2V79 A;  3OIQ A;  2LVS A;  3RI4 A;  1SFO J;  2M3A A;  2JA2 A;  4PK4 A;  3RDI A;  1A6Q A;  3T8T A;  2LC2 A;  5IYD J;  4D0P A;  4E70 A;  1IO2 A;  1FPQ A;  5D5V B;  3S16 J;  2K40 A;  4XKC A;  1KYW A;  1UG2 A;  3L2Q A;  3MFK A;  3OYI A;  3MKW B;  2KL4 A;  4DYQ A;  1S7E A;  4AYB A;  1XDU A;  2KJC A;  2Y0M A;  4XKW A;  4LMY A;  3BR6 A;  1YLF A;  3ZQL A;  2QSF X;  2ID3 A;  4Y3O A;  3CMA I;  1IN6 A;  4AID A;  1FLI A;  3TO7 A;  3GCM A;  4G8X A;  4S04 A;  4RDU A;  3GTJ J;  3NEU A;  2EV5 A;  1X19 A;  3K4J A;  5GP9 A;  4AWX B;  4EJU A;  1SD7 A;  2BZT A;  3I4P A;  4YRV A;  1X2M A;  1MH4 A;  2JSC A;  2BXZ A;  3F8F A;  3GFL A;  4WF2 A;  3E6D A;  4XLE A;  3BG6 A;  3BTJ A;  2DK5 A;  3SYT A;  5JHF A;  2MC4 A;  3MCZ A;  4A93 J;  1YIO A;  4CH7 A;  2A69 F;  3HRT A;  4IHT A;  2O5R A;  3GX4 X;  4I98 B;  5C44 J;  1MW7 A;  2VOO A;  3OR1 C;  3SDG A;  4EQQ A;  1UHW A;  1W0U A;  5IT9 K;  1K79 A;  2O03 A;  4Y17 A;  5BS6 A;  1MD0 A;  3I4N J;  1UZC A;  2DMT A;  1OPC A;  1KZH A;  4A3G J;  5IPA A;  3CD6 I;  2LKS A;  3DPL C;  4RMN A;  1HKQ A;  1FIP A;  2XRN A;  3M7G A;  3IV5 A;  1XPX A;  1MZB A;  1R4N B;  3HHG A;  5F0F A;  3V7S A;  4MFE A;  4I99 C;  3M3Y J;  2LTP A;  2RNG A;  3GME A;  4HEA 2;  4IHV A;  3K9T A;  1N77 A;  2Z3Y A;  2E35 A;  1Z05 A;  4C3J J;  3I59 B;  1W7P A;  4OIO F;  1TQM A;  2NVT J;  2EA4 A;  4PGG A;  2K9M A;  1A31 A;  4A5N A;  5E3L A;  4KT5 C;  3HGG A;  5DYM A;  1SEU A;  3A0H C;  2DPD A;  4HAM A;  2HQN A;  1FIA A;  3BR2 A;  2DT6 A;  2IBD A;  4EV0 A;  1A6I A;  3SHF A;  2VJ5 A;  5K5Q A;  1VI0 A;  5L3G A;  2HQR A;  2NS8 A;  1YHQ I;  1O7L A;  1ZAO A;  5DD4 A;  1EF4 A;  1JHF A;  4RAF A;  3AG1 H;  1S3J A;  1FZP B;  1ERD A;  5CYV A;  5D5X B;  3GTG J;  2E5N A;  4PFO A;  2A05 A;  2CWE A;  5HOD A;  1P92 A;  4ZJZ A;  4BAY A;  2YU3 A;  4U0Y A;  3DTI A;  4NNJ A;  3OYG A;  3C2G A;  1Y8Q B;  1WJB A;  2LRD A;  1UCR A;  4UB8 C;  1IN5 A;  3P9C A;  3R6S A;  4P9F A;  5CVU A;  2D2W A;  3JCU C;  2OTL I;  2JPC A;  1YFH A;  2KMU A;  3A01 A;  3E6C C;  3R4K A;  1I5Z A;  3B6A A;  2DMQ A;  2JVH A;  1UST A;  2OU2 A;  2QSG X;  2R7Q A;  1ETY A;  3OS1 A;  2K3F A;  3L2C A;  4ZTJ A;  3B6C A;  4ITV A;  2ZBK A;  3CJT B;  4G12 A;  2GM4 A;  5FKM A;  5HDG A;  3OYE A;  3NAU A;  1U6G A;  1R5I D;  2H1L A;  4HX7 A;  3N05 A;  2IA2 A;  3ZOB A;  2UWM A;  3GTO J;  2MH9 A;  4MHG A;  4DZJ A;  2EWN A;  1K7A A;  2STW A;  2M45 A;  1YIT I;  1HA8 A;  3MKY B;  1ULY A;  2EZH A;  3TQN A;  1IRZ A;  2LG4 A;  3E5X A;  2P0W A;  1D1A A;  2FNP A;  2PMZ N;  5HS8 A;  4RM3 A;  1JKP C;  4EGY A;  2XF6 A;  1YJN I;  1H9G A;  4DOZ A;  2OCE A;  2R7R A;  5HDN A;  2ESN A;  2OZU A;  1JGS A;  3ZMU A;  4I09 A;  3HEF A;  1W7P B;  4M3B A;  4FX4 A;  2P81 A;  1G8X A;  2HQ5 A;  4R1H A;  4DBQ A;  2VAS A;  3VOE A;  1JJ8 C;  4I7H A;  1MBJ A;  1P4W A;  1FP1 D;  2HYJ A;  3R0J A;  4M6Y A;  4IOC F;  1R9T J;  4HYE A;  2D1H A;  5GTH C;  2PMU A;  2RNJ A;  3KLN A;  2HU9 A;  1IV8 A;  1ORK A;  5KCM A;  4BS9 A;  2Z2S B;  4BQQ A;  1XN7 A;  2L02 A;  3BT9 A;  3H9Q A;  4AIK A;  4XLF A;  3PFY A;  4IL6 C;  3HPH A;  1JJ6 C;  3HUG B;  3FX3 A;  5CVI A;  2ME0 A;  4D1Q A;  2MSY A;  1Z67 A;  2RQP A;  3GUD A;  2QVO A;  1P4X A;  3EYY A;  5KVR A;  4F93 B;  1F4K A;  3T5X A;  3CDL A;  2MG4 A;  4XOR A;  3CUO A;  4MLO A;  3DTE A;  1JKQ C;  3GWZ A;  5IP9 J;  2LKX A;  1V3F A;  1TP4 A;  1F36 A;  2BOL A;  1E3O C;  3IAM 2;  1W5T A;  3WTU C;  3VYR B;  2VQC A;  2LP0 A;  1LNW A;  4KIT B;  2ZJQ F;  1P4A A;  5K7Z A;  4RGU A;  1G4D A;  4XN3 A;  1X4O A;  4QSH A;  1TQI A;  3F8M A;  1R00 A;  3G73 A;  3DLA A;  5E1Z B;  3A01 B;  3F9K A;  4GFB A;  2ICW G;  2M7B A;  3ZMV A;  4P5O A;  1KU2 A;  2XIG A;  1PUF A;  4UV8 A;  3LFK A;  2GWR A;  2L5Q A;  2L4A A;  1BI3 A;  4PGH A;  1RKT A;  4J01 A;  3CC4 I;  4BJ6 C;  3FK6 A;  3CCS I;  3I58 A;  3CLQ A;  4BY1 J;  3QPT A;  2KIF A;  2BYV E;  4HOB A;  1W36 C;  4G6Q A;  3BQY A;  3ERE D;  4PSX A;  4NC6 A;  3DTK A;  4K2E A;  1V4R A;  4EAT A;  3ZMT A;  4XSZ F;  1PVE A;  5CJ9 A;  4P96 A;  3ESW B;  2Y31 A;  3BG7 A;  4BDZ A;  4G6T B;  3HOU J;  2CUJ A;  1X58 A;  1VQ9 I;  1LVK A;  5TRD A;  4R8H A;  2NRA C;  2CV1 A;  1T39 A;  3MKL A;  4G7Z F;  2IA0 A;  4IQ4 A;  4CZZ A;  2QSH X;  1IF1 A;  1XX5 A;  1OR7 C;  4DW6 A;  2LK2 A;  4ZH4 F;  4RB3 C;  2VT3 A;  4FIS A;  3X2Q H;  3CES A;  5FRO A;  6PAX A;  1Y6I A;  3ISP A;  1ZLJ A;  2E19 A;  4PJL A;  1GXQ A;  4D7M A;  2CQN A;  3QOP A;  3FBN B;  4MTD A;  3ZQG A;  2EB7 A;  2ELJ A;  2WY7 Q;  3VDX A;  3ABL H;  1BJZ A;  5M5W J;  3TED A;  1V5E A;  2QYO A;  2XRO A;  4L0Y B;  4KFC A;  1T0F A;  3S15 J;  1JI8 A;  4FE4 A;  2OD5 A;  2MYS A;  2DLL A;  2ECC A;  2QUF A;  4W1U A;  5M5Y J;  3OYF A;  1HBX G;  3PQJ A;  3BR3 A;  1T56 A;  2CGP A;  1HOM A;  4M3F A;  4UVA A;  5FGM A;  3VPR A;  4CA0 A;  1BJA A;  4JBA A;  2XB0 X;  3W2A A;  4BDY A;  3AL0 B;  4ZZL A;  3LSI A;  2DOF A;  3W6J B;  1SD5 A;  5IOY A;  3JRA A;  4XBF A;  2J5P A;  2QQ9 A;  4U0W A;  4PSW A;  2L9N A;  2AHQ A;  1STZ A;  3SDB A;  2K85 A;  3S32 A;  2KHM A;  3PNT A;  4BAC A;  3ABM H;  2STT A;  2G9W A;  1JKO C;  5GPC A;  2FQ4 A;  1Y0N A;  2K4B A;  3HOW J;  3K70 C;  5DD8 A;  1PUF B;  2WV1 A;  3J80 K;  3S2D J;  4HF1 A;  2DOE A;  1LEA A;  3QP5 A;  2LRE A;  2FF4 A;  3L2R A;  2PJP A;  1XCV A;  3ML6 A;  2MLK A;  5D5U B;  1QA6 A;  1IAW A;  1HW2 A;  1YS7 A;  1EKE A;  3QPL A;  1W5C C;  2A3S A;  1K78 A;  4XRM A;  2WBM A;  3BWG A;  4KNY A;  1VTN C;  2XGX A;  1YOV B;  4X1E A;  1HKT A;  5KK1 A;  4M71 A;  4BQN A;  4LLG F;  2KIM A;  1IRX A;  1YO5 C;  3WOD F;  2LD5 A;  1J75 A;  2JUG A;  2QEX I;  2VOP A;  2DA6 A;  3WTT C;  1OFC X;  1E3P A;  2E2J J;  2HEO A;  2X1E A;  4Z6Y A;  5LEK A;  3VYT B;  2QLZ A;  2OAZ A;  5CVV A;  2V6E A;  2GAU A;  1RIO H;  2PMZ A;  3EPZ A;  2W1O A;  2F5E A;  2FX0 A;  5D6F A;  4YFN F;  1H0M A;  1OYW A;  3IWZ A;  3L00 A;  4MGR A;  1JT0 A;  1L0O C;  3LST A;  5TIS C;  4UVB A;  3TDU C;  1Z91 A;  3TKY A;  2V6C A;  3H5N A;  4UNO A;  1R58 A;  2DTR A;  3M8F A;  1O3Q A;  3DU5 A;  3MQ0 A;  2BEO A;  3F8C A;  2JA7 J;  1OCP A;  1ZHF A;  2DCE A;  4KMU X;  1WJE A;  2DBB A;  2X0L A;  3QU3 A;  3JRF A;  1VQ4 I;  1XMA A;  1F9N A;  2R4G A;  5TJJ A;  2ZJ2 A;  1YJ9 I;  3AG2 H;  1LVA A;  2UXX A;  4CUG A;  1SFU A;  3HC7 A;  4FT8 A;  2P8T A;  3DKY A;  3OYD A;  3OY9 A;  1QZY A;  3EUH A;  3GZ6 A;  4EJT A;  2IRF G;  2X85 A;  3LOC A;  3OYN A;  2DK8 A;  2VJI A;  3TL4 X;  1HC8 A;  1BI1 A;  1SC7 A;  1BIA A;  1SVL A;  1XDS A;  1VQM I;  2KT0 A;  4KJZ A;  3H3Z A;  3IAS 2;  3GTM J;  2CO5 A;  2E1N A;  3LL7 A;  2E60 A;  4E7H A;  2XPV A;  3G1L A;  1RI7 A;  3FBI B;  2VBX A;  3CQZ J;  1FTZ A;  1HLV A;  5CQG A;  5F04 A;  2DXI A;  1R71 A;  3S8P A;  1SAX A;  4C2M J;  4UVC A;  4OIP F;  4NDL A;  3K1P A;  2MLG A;  2NOJ B;  3GF2 A;  2LMD A;  1K78 B;  2V26 A;  1GT0 C;  2XRL A;  3LMM A;  5E8G A;  2F5F A;  3QU6 A;  1X1C A;  1R1T A;  1MMN A;  2O8K A;  4RAG A;  3L1P A;  2ZJR F;  1OCZ H;  2ZO4 A;  2W85 A;  2FMY A;  3K1M A;  4E7J A;  2XAU A;  1D0Y A;  2EA2 A;  3UNG C;  2L9S A;  3BTC A;  4KN4 X;  3RJP A;  3G6E I;  3ZR8 X;  2BGC A;  3QPH A;  1QZE A;  1FEX A;  3PFI A;  1AA7 A;  4XIC A;  3LAJ A;  5DUI A;  2R5Z A;  3K69 A;  2OA4 A;  4DGW B;  4WXD A;  4E7K A;  2IT0 A;  2EFP A;  3MMY B;  2E2H J;  4CCK A;  2HKO A;  2V1X A;  1HDP A;  1R1U A;  3CJR B;  1LUJ B;  3TW6 A;  5FLX Z;  5GAE J;  5IP6 A;  2M34 A;  5IP7 J;  2KLO A;  4JK1 X;  3H9J A;  2KIQ A;  2FBI A;  4MNU A;  2MBF A;  3HSF A;  2TRT A;  1YW9 A;  3DEU A;  4E7I A;  5JHU A;  3SFZ A;  4BH9 A;  2XAS A;  3FM5 A;  2CW0 F;  1F43 A;  4QIW N;  2ZME A;  3P5J A;  4EEF G;  2VC1 A;  1FNN A;  1JUM A;  4BKX A;  1VQ5 I;  3S1Q J;  3SFI A;  3LQR A;  1WGX A;  2CG4 A;  4ZDL A;  4LG3 A;  2A6E F;  4M6V A;  4N4N B;  3RSN A;  1APL C;  4IKF A;  5FB2 A;  3QP6 A;  1EH8 A;  5LD2 C;  3CCR I;  3MEX A;  2V9V A;  1O7F A;  1X2N A;  2O8X A;  4ENM A;  1XSX A;  1QNT A;  4RGX A;  1JT6 A;  4BJ5 C;  5J4Y A;  1DPR A;  5HS9 A;  2CS3 A;  2FML A;  3CP8 A;  2FOW A;  3KE2 A;  3OSG A;  3Q0U A;  3DBH B;  4G94 A;  4XRF A;  1F5T A;  3FWE A;  2UV1 A;  5J1R A;  1P7J A;  3B73 A;  1R49 A;  4B1R A;  1VF9 A;  3EYI A;  5FRM A;  3IRQ A;  5J3L A;  2LBF B;  4GO1 A;  3SEZ A;  2Y30 A;  3TP0 A;  3JTH A;  1WJD A;  2F5C A;  4BXU A;  3V42 A;  3F22 A;  3TDZ C;  2PMH A;  2C6Y A;  1RZ4 A;  4HNU A;  1K61 A;  1KGS A;  2HQA A;  1AU7 A;  3E5Q A;  3P9I A;  2AQE A;  2VI6 A;  2EK5 A;  2R5Z B;  2WAD A;  3LQQ A;  4A12 A;  1DP3 A;  3E7L A;  1LDD A;  3S3M A;  2WB1 N;  4Y33 A;  2RC4 A;  2W24 A;  2W48 A;  1FX7 A;  1ON1 A;  2DT5 A;  2BV6 A;  3M8E A;  3OYC A;  4O3M A;  4NHJ A;  3W3C A;  4Y4R A;  2IS4 A;  1HF0 A;  4G6D A;  5K7H A;  1W7P D;  5HOO A;  4RAY A;  2W00 A;  4W97 A;  4MTE A;  1IZ1 A;  4LFU A;  1XSV A;  3Q0W A;  5K5O A;  2P6T A;  5EJC A;  4EVI A;  3PIP F;  1DDN A;  2EZK A;  4BXF A;  3ZP5 A;  1E0E A;  1BL0 A;  2FU4 A;  4P55 A;  4LB5 A;  2F6C A;  2VOD A;  2BY2 A;  2X1C A;  3KP6 A;  1U8B A;  4ZZD A;  1QPM A;  3FXM A;  5DCM A;  5H20 A;  5AON A;  5A2Q Z;  2KIS A;  5GAG J;  2L7F P;  2VQL A;  3BCA A;  4HA8 A;  4N9I A;  1JUS A;  4A3C J;  3BJO A;  3GFM A;  2ADU A;  5EEG A;  4IZZ A;  2V4J C;  3ZQC A;  3FIS A;  4I6Z A;  3Q5F A;  1TWG J;  3HYI A;  2DOA A;  1BR2 A;  3RKQ A;  1HCR A;  3CP2 A;  3I54 A;  2GA2 A;  3C2H A;  1DQU A;  1TLH B;  1TW2 A;  2BY3 A;  5E3N A;  1JGG A;  4J00 A;  4PJN A;  2R7W A;  4BHP A;  4HLY A;  3M4O J;  2IJL A;  2VL8 A;  1GVJ A;  1VFC A;  3I3L A;  1FC3 A;  3H36 A;  3E0J B;  2FA5 A;  5FKL A;  4LLL A;  1JTY A;  2JTV A;  2LKP A;  1VZ0 A;  1OMI A;  1A5J A;  2DFH A;  3KEO A;  4E6K G;  1KQ0 A;  2R92 J;  4DYR A;  3HPG A;  1R23 A;  1XGN A;  5JLW A;  3CDI A;  2K9S A;  4JOM A;  1UHM A;  2L7Z A;  1JUP A;  2CJJ A;  2BY1 A;  3E5U A;  1RES A;  2G0E A;  3QYE A;  3SXY A;  1LE8 A;  2A07 F;  5IYC J;  1FSE A;  2B0L A;  5DS9 A;  4BQO A;  3P9K A;  2E1M B;  5DTD A;  2HVR A;  3HGY A;  3OS0 A;  3V4G A;  4BQA A;  2KZG A;  3E97 A;  4DIQ A;  1EH6 A;  2EIK H;  1YIJ I;  4UV9 A;  2P5L C;  2OC6 A;  3CF5 F;  1QHG A;  3S93 A;  1WHU A;  1X3Z B;  1MSF C;  2XKO A;  4YEJ A;  3IH3 A;  2XGE A;  2A5Y B;  2DTZ A;  2LY1 A;  3W2W A;  1FOW A;  3OOU A;  5GTI C;  1XS9 A;  1JHH A;  3HG9 A;  3IC7 A;  3HXL A;  1O4X A;  1UJ8 A;  2NVQ J;  2NNN A;  4ASN A;  2FRH A;  4A0X A;  4M3E A;  3BTL A;  2H8W A;  5LHI A;  1BM9 A;  1S72 I;  3TBI A;  1T38 A;  3CCU I;  4XRS A;  2PN6 A;  3RTR A;  1B72 A;  5D6E A;  2VKD A;  3WU2 C;  4RB2 C;  2JN6 A;  5M3F J;  2LR8 A;  2FOK A;  2M5W A;  5DCM B;  3MWM A;  3LNQ A;  5K7F A;  1BA5 A;  2A6H F;  3VSK A;  1D1C A;  1OCC H;  2NVY J;  3JW4 A;  3WHB A;  1BOB A;  4BE0 A;  2L7K A;  1A36 A;  2ZSH B;  4NUB A;  3QQA A;  3Q9V A;  5ICE A;  1ODD A;  2RDP A;  1ACI A;  2KPM A;  3QPS A;  4NB5 A;  3ZCO A;  2I8D A;  4IEJ A;  2R3S A;  2COM A;  1XB4 A;  4HDU A;  1WQ2 A;  2HXI A;  4LK1 F;  4CYD A;  1ON2 A;  1KU9 A;  2HTS A;  3A2K A;  5B3S H;  1ETO A;  3C7J A;  3OMY A;  2DFI A;  2DJN A;  2LF7 A;  4L9N A;  2HWV A;  2X9D A;  2JVG A;  2ZNY A;  4ANJ A;  4L9V A;  2G7U A;  3HOT A;  1NK2 P;  3R60 A;  3TP3 A;  3BY6 A;  1N25 A;  4C2U A;  3HOX J;  4NC8 A;  4XON A;  3HOV J;  4BNC A;  5ICG A;  1LE8 B;  5M3M J;  4L5J A;  1ZRD A;  2CU7 A;  4A3D J;  2XSJ C;  1O57 A;  4XQF A;  2BVM A;  4RLQ A;  3J81 Z;  5H6R A;  1U2W A;  3GZN B;  1YS6 A;  3S17 J;  4PJJ A;  2CH0 A;  2O9L A;  2ZNZ A;  2X51 A;  3HBL A;  3BR0 A;  4BBR J;  2PEX A;  1HW1 A;  2WB1 A;  2EZI A;  2VC0 A;  2JZY A;  5LLQ A;  3N4M A;  3FHZ A;  2W82 A;  2CQX A;  4B09 A;  1S7O A;  1SVM A;  3H3U A;  2IP2 A;  4ZYA A;  4EM0 B;  2R7S A;  1BBY A;  4AC0 A;  4X0G A;  1V55 H;  4AVP A;  4EMS A;  3TGN A;  3WGG A;  3JRE A;  3M8J A;  3F8N A;  3JRC A;  2KRC A;  3JSP A;  1FMV A;  4PJ0 C;  5E17 F;  3H0G J;  5EEA A;  1SD4 A;  3OIP A;  4GYG A;  1B72 B;  1LQ1 A;  4E4H A;  3TO6 A;  2HR3 A;  2I5U A;  2IPQ X;  3WHC A;  3WGH A;  5F1J A;  3HUG A;  3J7Y J;  3B02 A;  3VYU B;  1T0F C;  5LFA A;  4OIR F;  3ROU A;  3JSO A;  4ABZ A;  1S8N A;  3D0S A;  1DP7 P;  1T98 A;  4XKV A;  2L01 A;  3FIW A;  2M4K A;  5E3M A;  4CHU A;  1OQY A;  4UUS A;  2B7E A;  1FBQ A;  1SAN A;  1Z3X A;  3VWB A;  1FYK A;  2DA7 A;  1XGO A;  2NXN B;  2Z16 A;  2DDB A;  4ETS A;  1VQK I;  3KZZ A;  4HSR A;  3PO3 J;  1OJL A;  4JX4 A;  3K10 A;  1UEL B;  4DZP A;  2WAQ N;  1G3Y A;  2LH9 A;  4YIR X;  2K9N A;  2FBH A;  3RZD J;  4A3L J;  3F6V A;  2E2I J;  2L3D A;  3W6V A;  4FAS D;  3M07 A;  2MD5 A;  1OIS A;  3DBR B;  1MBK A;  3TO9 A;  3CF2 A; 
#chains in the Genus database with same CATH homology
 2KFD A;  2CQN A;  2JUC A;  2KIS A;  2L9V A;  1UZC A;  4FQG A;  2DOF A;  2KIQ A;  2KZG A;  2LKS A;  2DOD A;  2E71 A;  2K85 A;  2B7E A;  2DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...