2JUCA

Urn1 ff domain yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
b'DIDERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor URN1
publication title Solution structure of the yeast URN1 splicing factor FF domain: Comparative analysis of charge distributions in FF domain structures-FFs and SURPs, two domains with a similar fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2jucA00
2KISA 2CQNA 2KIQA 2KFDA 2DOFA 4FQGA 2JUCA 2K85A 2DODA 2KZGA 2B7EA 1UZCA 2LKSA 2E71A 2L9VA 2DOEA
chains in the Genus database with same CATH superfamily
2FQ3A 1W7PD 2X6XA 1U5TC 2STTA 3QQAA 4OIRF 2MH9A 2XGCA 5LRSA 1YE9A 2R7OA 1BOBA 2EBIA 2IPQX 3HUGB 3GFMA 1G3WA 3B73A 4AIJA 2MSYA 2Y0SN 2KIQA 5F0CA 4XLFA 5JI6A 3RKXA 3JRIA 1T33A 4HSRA 5B1BH 3LFUA 2H8WA 2ZSIB 1LVAA 4L0YB 4BAYA 5FJ8J 4YELA 2VLAA 4D0PA 3GF2A 2RVCA 2VQCA 4M3BA 1ZGJA 1JKQC 1YI2I 2H6CA 4HYEA 4I02A 5JHFA 4HV5A 4IJAA 3TW6A 2LFBA 3BR1A 3Q3SA 3RZDJ 1OCPA 1QU3A 3SYTA 3GTJJ 1VTNC 2M45A 3U2RA 5B66C 2M34A 3CCMI 1ZREA 1N77A 3RYPA 2AS5F 1U8BA 1SVOA 4XKWA 2XIGA 1W7PB 1N78A 2BHZA 4E4HA 2JJ7A 2DT5A 3HJEA 4KIGA 5DCMA 1X4OA 3FXLA 3RIRA 5IP6A 2XASA 2K9QA 2JTVA 3X2QH 2L01A 1KU7A 1LKXA 1D8KA 3HOUJ 4U0WA 4BE0A 4XLCA 4CA0A 4CXFA 2A61A 2RNJA 4F92B 1XGNA 2IA0A 3TOBA 4OIPF 1FIPA 4ABZA 1VQ9I 5TGTA 3HRTA 5K7ZA 5J8CA 2ETHA 3OL3A 1KA8A 3DTIA 1D8JA 6PAXA 1B9MA 2VL8A 2ZC2A 1IF1A 2DXIA 1HDPA 4L5EA 3NARA 5D6EA 3ZQGA 4OIOF 2PEXA 4UV8A 4HPQA 3FXOA 2OPTA 2Y9YA 1I3AA 4H4KC 1DU6A 1T56A 3L2VA 4PJMA 3DEEA 4NC7A 1QHHD 3OYCA 4A69C 1LE8B 4J01A 5DCFA 5FFXA 3WE2A 2CJJA 1WJ5A 2E1NA 3LAPA 3V4GA 1P7JA 4I09A 2COBA 1BC7C 2WC2A 4NQWB 1P9QC 3K1PA 4PGGA 2Z1DA 1KQ8A 1SAUA 5CVJA 4BEHA 3PNVA 2R7TA 4RS8A 1Z21A 1RRJA 2GLOA 3VFZA 2RV8A 3JRDA 4BDZA 3K1MA 2CV0A 3J7ZI 2W1OA 2DMNA 3F21A 4G7OF 2A07F 1USTA 2XUBA 3CUOA 1G8XA 3HOWJ 3SZPA 2ME6A 1VF9A 2Z2SB 3L2RA 1AWCA 4OIQF 1EH6A 1O7FA 1MH4A 1ONVA 4JYKA 3CC4I 3GLXA 3OL4A 5D6FA 1XS9A 2F4IA 4CDGA 1R36A 2NVXJ 1D1BA 3BCBA 4UV9A 3AKZA 2EZLA 1AOYA 5J4VA 2DO7A 2ACJA 2HOTA 1HW5A 2B0LA 2QENA 3WGGA 4HDUA 3S8PA 1W1WE 4S0HB 4D9JA 3ABMH 3I53A 5E18F 3IHUA 1LFUP 3GFJA 3Q0VA 4PJLA 1FBQA 1VQ8I 1Z91A 3E6BA 1Z9CA 2E2IJ 2QYOA 2R4GA 3IAM2 2IS2A 1Y8RB 3GXOA 4ZZDA 2LKXA 2A05A 2M2EA 3GTLJ 2F5DA 2XSJC 2CW7A 2CG4A 5CVIA 4HA8A 5ICFA 2R0QC 1I1GA 4LITA 5FKLA 3S3OA 2CSOA 1XDUA 5HLIA 4II3A 5GAEJ 3IRRA 2ECCA 3PSFA 5JR3A 2KJCA 1PYVA 2IGKA 3ZQLA 2K5CA 1ZQ3P 3BJOA 4B1RA 3JSPA 5TRDA 4UUSA 3WHBA 3JRHA 2PQ8A 4HRIA 4X1EA 2D1HA 2KHMA 2CH0A 4C3IJ 3GTOJ 2YR2A 3ZPLA 4XLEA 1Q1VA 4DBQA 4FT8A 1VQOI 3CMAI 3KLOA 1HCRA 2OTLI 3CC2I 2NVQJ 1I6HJ 4GFBA 3OV8A 3BQZA 1JUSA 2OC6A 4N0BA 5HS9A 4PK4A 1X1PA 2K9MA 5LHIA 4BYYA 2VKVA 3GFIA 2X6OA 3O6BB 4WX9A 1REPC 4D7NA 2WB1A 2XGXA 1BR1A 5TISC 1FC3A 3P9CA 2B9SA 3A2KA 3DWLE 3BROA 1S7OA 2FA5A 1HXDA 2BYVE 4L9TA 4F7ZA 1D5YA 3BR3A 2V4JC 2Z5UA 1ENHA 4MTDA 4JK1X 2DN0A 3OS2A 2F6CA 2P5VA 1T95A 3RI4A 3TGNA 4I0BA 2R7UA 1Z3XA 1OKRA 4GYIA 2IBDA 3ROUA 4U87A 4GCVA 5M3MJ 2YX7A 3FM3A 4Q47A 1IUFA 5H20A 1ZR2A 2JA6J 3BG5A 4CICA 2VI6A 2O0YA 1FOYA 5IOYA 1B8IA 2WBMA 3AAFA 4A0YA 4CUGA 1CF7B 3TO6A 2V6EA 1FPQA 2DFHA 5FLVA 2LSOA 3KX2A 2UZKA 2L7ZA 1D5VA 3LQQA 3I0TA 2W57A 1IV8A 4I01A 3S1RJ 1UMQA 4KJZA 1TL8A 4CYDA 2VONA 4XN3A 5EEHA 5KK1A 2PI0A 4YG2F 2ZXIA 1Z6TA 1JGGA 3DPUA 2Z3YA 2ZJPF 3EPZA 3M1EA 2UXXA 1IAWA 3S2HJ 1Z6RA 1HQCA 3FXMA 5E3NA 2KT0A 5IPAA 1XSDA 4IQ4A 5D5VB 2BZTA 2K40A 1X3WB 3FXQA 2R7VA 3DLLF 3I9V2 1YJ9I 1A04A 1FJLA 3M8JA 3V7RA 3BR6A 1W0UA 2UWMA 1PUFA 2K85A 2HR3A 2GZWA 3KP5A 3EYYA 3T8TA 5EF6A 4BXUA 1BBYA 2Q2EB 2DU9A 2XV4S 4XLNF 3CCUI 5IT9Z 2KISA 2AXLA 3WGHA 3KZZA 5GPAA 2LNBA 1Y1VJ 4TV7A 4F55A 4MTEA 3JW4A 3NRVA 1W36D 4RLQA 2QQAA 3OOPA 1JGSA 2X6WA 4S04A 4IZZA 2Z9OA 3Q5FA 4AC0A 3BZCA 2IS1A 1UB9A 2W24A 3FX3A 3BG7A 2MABA 3I58A 4M3DA 4RGSA 3MEXA 3BR2A 2VQLA 3G6EI 2WY7Q 5J1RA 4PDKA 1MBHA 5LEJA 1R5HA 2MLGA 3KE2A 4V2FA 4JBAA 3ZMSA 5JVTA 5HOOA 2BOLA 3BLYA 1TWAJ 1BOAA 2D45A 3M4OJ 3E5QA 5FKNA 2E2HJ 1FNNA 2HVQA 3QP6A 1LDKB 1SAXA 3WG9A 4DZJA 3KP4A 5F0HA 4L5JA 2EJRA 5H6RA 4BQNA 5K5RA 1V55H 2JUGA 2P4WA 4A2UA 4A3EJ 3W2AA 4D1QA 4M9XA 2D2WA 4RMNA 5GP9A 3OYBA 1KGSA 2FBKA 5JVGF 5F0FA 4AIHA 2QSGX 3K7AJ 2A3SA 3E7LA 3QPHA 3S1QJ 1XSVA 2L9RA 2CQKA 2OV7A 3TP3A 5B3SH 2DAOA 3LOCA 4Z6YA 4JX6A 3PIOF 3CCVI 1RR8C 2KZGA 1MDMA 2D1VA 1K4TA 2M87A 2ECBA 5CPRB 2LBFA 4NUBA 1A5JA 4NBQA 3JR9A 1LEBA 2K9SA 4M74A 3HKZA 4CSWA 2VKEA 1OYWA 1LB2A 1W36C 1ETOA 2Y75A 2X6YA 2WY8Q 3I54A 2HQ5A 2J5OA 2RDPA 5F04A 3S3MA 3H9JA 3SEQA 1JJ8C 3BPVA 4KIFA 4E7IA 4DGWB 2NS7A 2VQGA 2ZXJA 1SMYF 4J19A 3FXRA 2OCEA 2MH2A 3ABTA 3F9KA 3GYHX 2EIJH 5EEGA 1N25A 2QWWA 1XGOA 1Y8QB 4ESJA 3WODF 2PFBA 3RSNA 4XN0A 5FKOA 3V7CA 2CV2A 4BE1A 5E20A 4KT5C 4MO7A 1A35A 3CD6I 1BR2A 3MZ8A 2NVUB 5DM6F 2DPUA 1YRNA 4XK4A 2MLKA 4XICA 3M8FA 5M3FJ 3HOXJ 4BHPA 1P4AA 1FSEA 2VT3A 4XSZF 5FKMA 1UHSA 2EILH 3LA3A 4CCKA 4A3GJ 1GXPA 2O5RA 2QSHX 2V6CA 3W6VA 2G7HA 3S2DJ 5AONA 2LG4A 2GA2A 2D5VA 1ETYA 4DW6A 5K7FA 2LKSA 1BI3A 1QQIA 3GO5A 4QPOA 2A68F 3E3VA 4XKVA 4BQOA 2FU4A 4ZJZA 1S7AA 1ETXA 2NS0A 1W5CC 5FFZA 3HOSA 1J7KA 2WWYA 2H1KA 5LGTA 5J40A 3OR2C 1U2WA 2YPRA 4HQEA 4O3MA 3O3KA 4RGUA 4GRIA 2L4AA 1KYZA 2O8XA 1TT0A 1X1DA 2VT2A 1G3SA 1BR4A 5IT3A 4ENKA 1HKSA 2K4JA 2R7RA 3W6KB 2HVRA 1YQAA 4LK0F 4BY7J 4F93B 2EIKH 2IEKA 2KQRA 5DS9A 5JHUA 1Y39A 3D5SC 2HQRA 4LFUA 2L02A 2XHKA 2Y0SA 2PJRB 3EQLF 2QGUA 4XKBA 2WAEA 4AWXB 2GQQA 1B4AA 4XQFA 1MDMB 2KRHA 1RNLA 2O61A 2KMUA 2ZXWH 2KL4A 4PUSA 3U9GA 3MFKA 1EJ9A 3HRUA 3WTUC 2P81A 2WAFA 5BOXA 3R60A 5CVVA 3K9TA 1BC8C 5D5XB 2Z99A 5E3MA 2LH9A 1JKRC 2JT1A 5GTIC 1B1BA 1P7IA 1GT0C 1YIOA 1O4XA 2FD5A 4XLAA 3U1KA 4XRMA 4GXOA 2KDZA 3CJNA 2RQPA 2BXYA 5KNLA 4XR6A 1YG2A 4EVIA 1LQ1A 3VYTB 3AG3H 1FWZA 2BEOA 3LSPA 3H5RA 3W2WA 1K78A 4ENJA 1XMXA 4IRHA 1X1AA 2BE5F 1MNMC 3HEFA 2QKLB 5EZHA 3SDGA 3HTSB 5KCMA 1F43A 1IN7A 1EH8A 2ZCWA 4I7HA 4DOZA 1FOXA 1ETWA 2DQRA 1V3FA 3HUGA 1TWFJ 4XOTA 5DEQA 4YFKF 3MZHA 4HF0A 4ZH4F 2JVHA 5H6QA 2ID6A 4I0AA 3FIWA 2E2JJ 4XSXF 2EWNA 5E79C 3FBNB 3ZQQA 1YYVA 2X51A 3IKTA 3GUDA 1LDDA 3F6OA 1SEUA 4BE2A 4ETSA 4DYCA 2AQFA 2HWVA 3WHCA 5DTDA 4IHTA 1PVEA 4CZZA 1LNWA 2F5EA 4Q48A 2VJJA 1D0XA 4EV0A 3RQIA 4XIDA 3L2WA 2EFWA 2CQXA 2UUZA 5IYBJ 2FUG2 4ZDOA 2OZ6A 1JI8A 2I5UA 1EA3A 1RUNA 1IV6A 2HOEA 2F4MB 4GO1A 4N4NB 4BUPA 2JN6A 4MGRA 5JFRA 1RKTA 4HX4A 1Z0XA 2W85A 2VXZA 3MKLA 1OCCH 3RKYA 2QQ8A 4OAYA 2GOMA 3JRAA 2HNHA 3I4PA 3E6MA 4XBFA 4B44A 1T0FA 3RTRA 1VNDA 4IKFA 1MW7A 2FQ4A 3RJPA 9ANTA 4L9NA 4ZYEA 4OAZA 3PNTA 2IGMA 2A6HF 2EQRA 4NC8A 3PQKA 4P9UA 1R4NB 3WE3A 2KLOA 3JREA 1BIAA 3S32A 1DGRM 1SANA 2W82A 1WFXA 4WK8F 3S93A 3FXUA 5DUKA 4F91B 4G6TB 5ILSA 3L2CA 4JX5A 3R61A 4UVAA 1LEAA 2M0MA 4P1WA 3F22A 4IO9F 4A3CJ 3HDDA 2CFXA 4I6ZA 3E0JB 3K10A 1ZLJA 4NQWA 4XRSA 1R58A 1AHDP 2BHYA 3W3CA 2L9SA 3QOEA 2VC1A 2VB6A 1TNSA 3OYAA 2P0WA 3GVAA 2I8DA 1SD6A 2AXTC 1IZ1A 5BS6A 3GZ6A 4MFDA 3CQZJ 1WKMA 1Z7UA 4RB2C 1MBKA 1YJWI 3JAMZ 5HDNA 2K3PA 3M07A 4RB0A 2DMQA 2K4BA 4B09A 4QLCU 1X2MA 3L2UA 3CCJI 2LY1A 2E36A 4ESBA 3CCLI 4KITB 1TQPA 2JUCA 5E1WA 5HLTA 1A36A 3CO7C 1OCTC 2BY2A 3SXYA 3O2PE 2E34A 2GOXB 3ECOA 3LSIA 4BHBA 4BJ5C 2HQNA 3WTZA 2OA4A 3VDXA 1MGTA 3FZVA 2QVOA 4V2GA 2BGCA 5ILUA 1FX7A 2WADA 3W6JB 5IYDJ 1PP7U 1V5EA 1ON1A 1MNEA 5CVUA 5F1JA 4BQAA 2FJ1A 2EFOA 3QRFF 4FASD 5A2QK 4P96A 3TBIA 2MW8A 1J2XA 2V9KA 3PFIA 1ZYRF 3OIPA 2JA7J 2DT7B 3LSGA 1ULYA 3DBLB 2QF7A 2BY0A 3IAS2 1IO2A 5DM7F 1ERDA 3OSFA 4KIBA 1GDTA 1MJ9A 1E3PA 1WJAA 3GTMJ 1ZH5A 1DQUA 4ZYAA 2H1LA 3KFWX 4ZC3A 4B3XA 3ASNH 1G3TA 2XROA 1S7EA 1YITI 4QIWN 4FHTA 3K4JA 1Z67A 2XRNA 2HEOA 3LSKA 4XONA 3WTWC 1Z05A 1GV5A 2ZJ2A 4RM3A 5ED4A 3I5UA 3OYFA 4KMFA 4A3IJ 1ZG5A 4P55A 3I59B 1FP1D 1E0EA 2XDVA 3FM5A 2DMUA 4A3MJ 2F5CA 5L3CA 1RKWA 5HDKA 2MYSA 3CP8A 3OIQA 1PDNC 1IN5A 2QM3A 4ZTFA 4D5CA 4OU0A 1LVKA 1YIJI 3HB9A 1T0FC 1L0OC 2N8GA 4RAZA 2GXBA 3TL4X 4EQQA 3O8GA 2DA5A 1MBGA 3GTKJ 3PSIA 3J81Z 2ZNZA 4A6DA 4IHSA 2EFQA 2FOWA 3S16J 3F23A 3G1OA 5EG0B 5C4XJ 1FEXA 1VQ5I 3ERED 4XRSG 3KYDB 3HOVJ 5LRRA 4CCJA 4RDUA 2L7KA 4N9HA 5DD8A 1QPIA 3MWMA 4LJZF 1OYIA 3V8LA 1HDDC 1UG0A 3JSOA 4X6AJ 4QSHA 1YX3A 2LOOA 1F5TA 1WJEA 3DU6A 2V7FA 2NVTJ 1XGMA 3S14J 2FEZA 4AUXA 3JRFA 2AO9A 3PL8A 1VFCA 1CF7A 3CF5F 4QPQA 5KAFC 2ZJQF 2E60A 4HBLA 5EZGA 4M6XA 1UHMA 1WWXA 2XAFA 2RAEA 2OQRA 2NXNB 3VODA 4DYRA 1IJWC 1F4KA 1S5LC 1J9IA 4BHCA 3ZMUA 1RIOH 4YIRX 1EH7A 1VQPI 2LDUA 2ME0A 3QU3A 1MNDA 2JRMA 4KUMA 3B6CA 3Q0UA 2DDAA 1BW6A 5FLMJ 4NC6A 1DGWY 3TDZC 4EJTA 3HGYA 3HM5A 3P9IA 2HTSA 1R5ID 2VOOA 3T1BA 3E5XA 4J00A 2DA7A 4M9ZA 1B6AA 4CHUA 2DFFA 2BY1A 4M3GA 2R3SA 4EGYA 1ZARA 4C30A 3L2QA 3C7JA 2HTJA 4L9VA 3BZ6A 3F8CA 2OU2A 2CQNA 1OPCA 3RKWA 3I3LA 2M3AA 1K6YA 4IHXA 3CP2A 3A1YA 4DYQA 2FXAA 4WWCA 3S15J 4IHVA 3S1NJ 3C2BA 5CKTA 4N9IA 3FMRA 3MZYA 3HOTA 3ZOBA 1HLVA 2HXIA 1YS6A 3A0HC 3NEUA 2Q8KA 1NTCA 1IXRC 2KIMA 2MGQA 3E1SA 3ZN1A 5D4SA 3COAC 5FD5A 3IV5A 1OFCX 1R5GA 2Q2EA 5AIQA 1J09A 2GM4A 1X1CA 1BI0A 3HHGA 5LLQA 4C2TA 3C18A 5CYVA 3CC7I 1TWGJ 1D0ZA 2FSWA 4BJTA 3JTGA 3ULQB 2E5ZA 4P5OA 5FLXZ 2B63J 4R8HA 1LJ9A 3H5NA 3S1MJ 1STZA 3ERMA 2DODA 2HPMA 1L3LA 5HNFA 2OF7A 2M5WA 1JJ6C 1KU9A 5B5EC 3ABLH 5IP7J 4JX4A 1IW7F 1KONA 2FOKA 3OIOA 4L18B 3G73A 2HOAA 1ZTRA 3QYFA 3KZYA 2DFEA 1IRGA 2CWEA 2XAUA 3K6GA 3IC7A 2R5ZB 3VYRB 1HA8A 2PMUA 4I76A 3GWZA 1QHGA 2PMHA 2ESNA 1FYKA 3CCEI 4KFCA 3OYLA 2QZ8A 3J7YJ 1X1BA 2V79A 1H9TA 2CV1A 1DP3A 1KYWA 2O6GE 1P6RA 3UR3C 5IY5H 1X4PA 2COMA 2YU3A 3OYHA 3IUOA 3GFLA 1Z1DA 2IS4A 1GUUA 3K4NA 4IRIA 1HC8A 1QPMA 5CQGA 2CGPA 2HOSA 3LSMA 1W4MA 1JKPC 1WJFA 4HX8A 3ZMZA 3OWTA 2RN7A 3ZXSA 1WSUA 2TCTA 5F27A 5KHDA 2X85A 2DOAA 3U1DA 1MZBA 3OYGA 1OQYA 4E7SA 1YW9A 2ZFUA 3F8MA 3RPQA 5HVQC 5IP9J 5F64A 3FXJA 2KZVA 1GVDA 3DQVC 3MN2A 1BW5A 3ZQ7A 1D1CA 1FMVA 1TWCJ 1LUJB 4EJOA 1SVMA 2MD0A 2I10A 1FT9A 2DYSH 5ICGA 1DU0A 4FISA 4L5IA 1OCZH 2HXOA 2P5KA 1Y1WJ 3WTXC 1IN6A 3OS0A 1QBJA 3CLQA 3IWZA 2KDOA 3F8BA 4M71A 2NYXA 3FWEA 3RDIA 1JKOC 1EF4A 2X1DA 4EEFG 5HNHA 3LSRA 2ZFWA 1BA5A 4W97A 2F5FA 3EUKL 1YLFA 1QGPA 1WHUA 3DBHB 1NG6A 2XGDA 4RAYA 4AYBN 2G7UA 2JSPA 2E1MB 4FQGA 3SFZA 2NRAC 2H94A 3PNYA 4I2OA 4A6EA 1YTYA 1MSFC 1UHWA 1MD0A 1TZLA 1NHAA 4AVZA 2R7SA 4AU7A 4ENMA 3BT9A 2KRFA 3QOPA 3IRQA 1E2XA 1Y56A 3LNQA 2H27A 1B59A 2ZB9A 1U0JA 1SD4A 2NNNA 3OYDA 2M8GX 2VPRA 1FMWA 1YW8A 3MAJA 1YW7A 4IPAA 3CCSI 1ZK8A 5J1UA 5E17F 2E1MC 1VQMI 3RZOJ 3ISPA 2HYJA 1K79A 3KYCB 3BC8A 3KEOA 4E7JA 4B8XA 3H92A 2L3DA 5EGOB 5M5WJ 4PJ0C 3CCYA 3G2BA 2VBYA 3ZRGA 3H0DA 2ADUA 2XKOA 3DP7A 3HG9A 4CZCA 1U9OA 2EZIA 2IVMA 2STWA 1X3UA 4RGRA 2OAZA 4B48A 5BQTA 3BTJA 1TT5B 3FKIJ 1YX5A 1WI9A 4IRGA 3K4KA 3ZQHA 4EM2A 4QTRA 1K61A 2V1DA 2G9WA 4IEJA 3LSHA 2CQQA 4RM2A 4ZTJA 1R9TJ 2PJRA 3BR0A 1FP2A 1OR7A 4XLHA 2J5PA 4JOMA 3SFIA 3K4LA 2LY2A 4LLNA 1IN4A 1H89C 2L54A 1SD7A 2CW0F 2VXDA 2CUEA 3H9QA 3CMYA 1K6OA 4XLPF 2JRTA 2Y30A 3BCAA 5J1YA 3CDHA 3E5UA 3HXLA 1VQ4I 3IKVA 2RNGA 5EDNA 1JXSA 3Q9VA 2L9NA 1MBEA 2F5VA 3MQ0A 1U78A 3PFYA 1A31A 2JPCA 1VQNI 3FHNA 4RAGA 3DLAA 2WV0A 1MMAA 4EJVA 1N75A 3GTPJ 1UZCA 4LK1F 4D5FA 2FRHA 2YS9A 3VB2A 1YO5C 4DQ2A 4X0GA 5HODA 3CMMA 3H1CA 3FDYA 4LIVA 2CQ7A 1UJ8A 1TTYA 4PZJA 4ZYDA 4IVNA 5E8IA 2VBWA 1D3YA 2EIMH 1R7JA 2IW5A 5LD2C 4GGGA 4BACA 5HS8A 2WAQN 2RC4A 2V1XA 4N4OB 3CO6C 2L0KA 4I98B 5DYMA 1S29A 4AVPA 2MC4A 3RQ4A 2VPLA 4LB5A 1WQ2A 3KIOA 4YIIA 2W48A 1YHQI 2HGCA 4LG3A 3ZQFA 3MKWB 1R1TA 4UHTA 3CTAA 4AIDA 4BXFA 2ESHA 3WG7H 4EJWA 1B72B 2ZKZA 4FETA 2CU7A 4FTHA 3L7WA 5C44J 1BJAA 2GA1A 5DDGA 3CUQA 2CYYA 4PFOA 4FE7A 4A0ZA 3F6VA 3IH4A 3QPTA 4XORA 1ACIA 1QZZA 2O7OA 2DA1A 3N05A 1IC8A 1RUOA 4BU2A 3EETA 2DT6A 5JLWA 5K1YA 1FOWA 1RZ4A 4Y15A 5HLHA 3TO9A 5FROA 1U3EM 1QNTA 4RBOA 4C2UA 3EYIA 4CO8A 2DLLA 2LTPA 2EA4A 3A4CA 1IXCA 2HPIA 2EPFA 5L3GA 3WTTC 4ESFA 4G8XA 1SFOJ 2QQBA 4YRVA 5KVRA 1MMNA 3BTLA 4JP0A 3GZNB 4LLLA 2OZUA 2XB5A 1UELB 4UUVA 1ZHFA 2JPBA 3B02A 3HBLA 3SDBA 3G1LA 3IWFA 2FNAA 3KEQA 2LR8A 4WXHA 1Y0UA 2DJIA 5FO5A 3H5AA 3VEPA 4C3HJ 2MFZA 2E7XA 4KMUX 1H0MA 3I56I 2Y48A 4OOIA 1ORKA 2OD5A 2R5YB 3LL7A 1W5SA 3F0CA 3D5RC 3FF5A 3EDPA 3CF2A 4PGHA 1P92A 3DKWA 2XAQA 1OCRH 2XAGA 5D5UB 1MJBA 3BQYA 1H88C 1RETA 4HZFA 1HBXG 1OR7C 3VOEA 5LEKA 3FMQA 1AA7A 4CYCB 2QLZA 3CLOA 2LY9A 3HOZJ 1RI7A 3VYUB 2ZNYA 4XOPA 2KIFA 2DMPA 2BXZA 3BTCA 4O6JA 3CCRI 3IH2A 4OWRB 1LFBA 4HDVA 4A3KJ 2VKHA 4BJ6C 4Y33A 2LD5A 1E3HA 4BBSJ 1JUMA 1IRZA 3JCUC 3LWFA 4IX7A 2ZMEB 3G1MA 4XKCA 3RPUA 4EGZA 4PFPA 3AG2H 2HDWA 2RQQA 4DIQA 3KCCA 3C2HA 1TC3C 2BVMA 1M1EB 4E7LA 3GEZA 3SZGA 1ZG1A 1W0TA 4E6KG 1SD5A 1I39A 1QZYA 3ZQIA 3TQNA 5FGMA 2VASA 3FMSA 4LOCA 3I55I 2KJBA 3GX4X 3CUQB 2R7DA 1GXQA 1BN5A 4WF2A 1RR7A 3ESWB 2ZMEC 3TKYA 4HV6A 2DPDA 2NVYJ 4ZZLA 4W1UA 1XPXA 3A0BC 3GCMA 1WPKA 3HZJA 3DPLC 2L2OA 2DI3A 4B3AA 3H36A 4GYGA 4CCOA 4OMZA 4EJUA 3CJQB 4A5NA 2Q0OA 3HIFA 1TQMA 3B6AA 2W7NA 5BMZA 2P6SA 1HW1A 3HPGA 2M7AA 4B47A 3CUQC 2L7MP 3DPTA 2MA3A 1FY7A 2F48A 2Y0MA 3I4MJ 2ZO4A 5GPCA 2DA4A 1NG7A 2DA2A 1ZGAA 2V9PA 5CJ9A 1TW2A 1IRXA 3K2AA 2XF7A 1MBFA 4A93J 3I59A 2ZBKA 2XF6A 4LMYA 1T2KA 4IF4A 2M9HA 1KQ9A 1JTYA 2NOGA 2Y69H 3C1DA 3DTKA 1BL0A 1H8AC 4KICA 4BY1J 2HKOA 2LP0A 3RPUD 2E1OA 2VIXA 3KZIC 2HKXA 3PQJA 1V5GA 5BPIA 3F3XA 3L9FA 2P7CB 4ZYHA 3HRSA 2GIVA 2Z16A 2XRLA 5EG0A 1T98A 1O3SA 1SFEA 2W25A 1EV7A 1XMAA 3FK7A 3J80Z 5J47A 1G4DA 3OYNA 5IT9K 3R0JA 4F3QA 4HAMA 4CGZA 1S9HA 4IQJA 3HC7A 1YS7A 1NH3A 5J3LA 4AIKA 3GTGJ 3A02A 4IXAA 2PJPA 1P4XA 1GVJA 1WJCA 2CMPA 2RKHA 3SHFA 3K1NA 3ZCOA 1XD7A 2PLYA 3PM1A 1USSA 2OCCH 1SVLA 2LVSA 5ERIA 2HVSA 1QO0D 4G7ZF 4PSXA 2XC7A 1OISA 3UKGA 4IOAF 3BG9A 4M73A 5DUIA 4MHGA 1IG7A 3LFKA 2XKPA 3ZMVA 3GTQJ 1XDSA 5LFAA 4Q4ZF 4HNTA 3F72A 3JRBA 2DMTA 3K2ZA 5B1AH 1IDZA 3GZ5A 2VC0A 2VJIA 3DXJF 1K83J 3WTYC 2IGOA 3TDUC 3FISA 4HEA2 4MEXF 1G2HA 2FBHA 2PMZN 4KN7X 1NK2P 2ZXHA 4YFNF 3I64A 1IGNA 4WCGA 3IH3A 3TP0A 5E3OA 2ZJRF 1D1AA 1OLTA 3TOAA 4QWQA 2QEXI 2JSCA 2DA6A 4NHJA 1PJRA 4II2A 3AG4H 2GAUA 5AIPA 4BGDA 3HL2A 1RPWA 2QBYB 1VQ6I 1UCRA 2V9VA 3A01B 1FSHA 1WJBA 3HGGA 4BS9A 2O03A 2DW4A 2ELHA 4HG2A 3E6CC 4H0EA 1TWHJ 2O3FA 4EM0B 3U21A 5CVRA 1WCMJ 3ECHA 3FBIB 1X2NA 4A5MA 4ON0A 3REOA 3PIPF 3G4SI 1SC7A 4BXXJ 2X48A 2CRGA 2HU9A 5IYCJ 2KPMA 5FB2A 3ZQCA 3KP6A 3TO7A 4LG0B 4RLFA 2R5ZA 1WGXA 1G3YA 1FIAA 3NWSA 1TBXA 3CDLA 2IJLA 3H35A 3TMOA 1WVRA 3OR1C 5FRMA 4KNYA 2V26A 5GADJ 4BBRJ 5ICCA 3H3VK 1APLC 1F36A 3CDIA 4UVBA 3SQNA 4IOCF 3FHZA 1DUXC 3R6SA 2CFOA 3HRMA 1KU2A 3M7GA 5CLSA 1OJLA 5L3EA 3DFGA 1VZ0A 1VQ7I 4UUTA 1U9NA 2R92J 1BI2A 4C9YA 2PG4A 2CUFA 3LSTA 4AYBA 4UVCA 2WA0A 4M6YA 3KEYA 3MCZA 2R7FA 4NB5A 3LQRA 2GXGA 3ML6A 3A03A 3V8KA 2EZKA 1YFHA 1BI1A 1A6IA 4KYWA 3AFHA 4IHYA 3WU1B 3H3ZA 4G6DA 1XB4A 2LLKA 1E3OC 2DK8A 1CGPA 3E6DA 2DJNA 4M6VA 3OYEA 4KA4A 5FD6A 1HKQA 2M4GA 2K3FA 5CQEA 1I5ZA 1WH5A 2XB0X 4BH9A 3TEDA 3ZMTA 3KP7A 1QVTA 4EM1A 4BKXA 4IHWA 4UNOA 2HFHA 3HOYJ 2PX9A 1HF0A 5E1ZB 3HHHA 2QCOA 2JVGA 1SFKA 2VKDA 5K5OA 1O3RA 1FTZA 5K5QA 3SJMA 2GWRA 1U6GA 4FE4A 1O3TA 2Y31A 3M1CA 2XAHA 5EJCA 5M5XJ 1KZHA 1SFXA 3BY6A 5K7HA 1YOVB 3OMYA 4UB6C 2DFIA 2JA2A 2XPUA 3QPLA 1ZELA 1Z77A 2LK2A 4LLGF 2MD5A 3OS1A 2FMLA 4KT6A 4RA2A 4D7MA 5LGNA 3T5XA 2L9VA 2M4KA 1LFPA 4FX4A 1ZAOA 3HSFA 3NWTA 1S72I 2H09A 5DCMB 3VWBA 2QSFX 3OOUA 2BV6A 4ZDLA 4R1HA 1G6NA 1MMDA 1DDNA 2E19A 3R0AA 3D0SA 4MQ9F 3SEZA 1V4RA 1FOKA 2V1NA 3N4MA 4Y13A 4E7HA 3CCQI 5HS7A 1UG2A 1IN8A 3OY9A 3H9GA 1R6RA 4XNFA 2HS5A 5EGOA 1FBSA 1G59A 5D8LB 1UAAA 3ABKH 2DK5A 2VUMJ 1I6XA 1IDYA 1PP8F 1DPUA 1DP7P 3QYEA 2JK3A 5C4JJ 3L1PA 1WRJA 3W2VA 4L9JA 5FRNA 3RCOA 2A6TA 2IAIA 3ONQA 3HSRA 3T8RA 4A3LJ 1R1UA 1R1VA 2WAQA 2QA4I 1F9NA 4BEHB 3CMEI 1T08B 2LF8A 2EV0A 2EINH 1MMGA 1ZN2A 4U0VA 1GV2A 2QUFA 2M30A 3RKQA 4L0ZB 4DNCA 2RREA 4HW0A 3JRCA 1O57A 2LREA 3QYBA 3WTVC 1HSTA 1H9GA 1FYMA 2K9LA 2KFDA 4Y7NJ 3MKZA 3ZN0A 1R22A 4XL9A 4AM3A 4XMYA 3S17J 3DKYA 5LHHA 2IA1A 2FE3A 2NS8A 2Q1ZB 3MMYB 2L4MA 1VQLI 2DTRA 2ELKA 4DJAA 3EUHA 4Y4RA 2ZSHB 4BDYA 5F08A 1VQKI 2MC3A 3O8HA 2R7QA 4PCQA 2GIZA 2P5LC 4MFEA 2AHQA 4A3JJ 5M5YJ 3DV8A 2F4OB 4WXCA 1ZKGA 2HYGD 1F1ZA 3GMEA 5F6FA 1JE8A 1ZGWA 3BR5A 5C3EJ 3C3WA 2EH3A 3DEWA 1QVUA 3J80K 2M7BA 4K2EA 2VN2A 1B72A 5BPDA 3HPHA 1I1SA 2FNPA 1O3QA 4M72A 5ICEA 1MH3A 3BJAA 1W5TA 1P4WA 4UUSB 3PUBA 1XC5A 2K02A 2GXAA 4HSTA 3JAMK 1B9NA 1VI0A 2K86A 1XGSA 3GBGA 1FYLA 3J7AO 2W84A 3VSKA 1KU3A 1C0WA 1MSEC 1HW2A 5BNGA 3S2WA 2UXNA 1XTAA 1ETVA 4ANJA 4DZPA 4FCYA 1ETQA 3DU5A 3ZGKA 3DEUA 4YIFA 4G7HF 2O8KA 1E17A 2X4HA 3ABUA 2F2EA 1TLHB 3QPSA 3RYRA 2YU9J 1FTTA 2E71A 1X3ZB 1UFMA 1XN7A 1ZRCA 2R7XA 1OMIA 2G0EA 3HYIA 4U88A 5JLXA 5D8KB 3WU2C 3L09A 4Y52J 1Y0NA 2EV6A 2FBIA 5TJJA 3BJ6A 1ITYA 1HKTA 4LGWA 1Z7LA 2A5WA 4E70A 2VJ4A 5GAHJ 2TRTA 2YX4A 1R00A 1Y6IA 1HSJA 1LDJA 1I3QJ 1BJZA 4F52A 2ELJA 4G94A 3ZP5A 2LKPA 4E7ZA 1SFUA 2ISZA 5A2QZ 2R5YA 2NOJB 1T39A 1B8IB 2E35A 3LMMA 4HQMA 2H6BA 2BVLA 3NQOA 4EMSA 2PN6A 3QAHA 4EATA 2DA3A 1JHHA 2WTEA 1R71A 2MBFA 1LPQA 1POGA 2VOPA 3D1NI 2KP6A 5E8GA 3F8NA 2LMDA 4Q5SF 2OQGA 1SMTA 4CYCA 4NDLA 2W4SA 4A12A 1FBUA 2HZTA 3BPXA 3G3ZA 2NAZA 2XGEA 2OJED 5F1RA 2JQ7A 4HF2A 2XPWA 2WB1N 3ZMDA 1XCVA 2QQ9A 1DPRA 5DV5A 5LBQA 1QA6A 5IOZA 4V19K 5D5WB 1I50J 2L7FP 1XSXA 2ZMEA 5EEAA 4A0XA 3E97A 4HF1A 2HDDA 2K9NA 2AQEA 2R7ZJ 1JTXA 3OYJA 3K4MA 3J81K 4UB8C 1RC9A 1J0RA 3Q9SA 3KPHA 3P7NA 2Y9ZA 1WI3A 3AL0B 2LYCA 1XMKA 4GDFA 4NNJA 3R4KA 1BIBA 2VE9A 1PUFB 1ZRDA 1T6SA 2JMWA 1XCBA 3EUAA 3EUHC 3NAUA 3CJTB 3SZTA 4ITVA 3FK6A 5E3LA 4E7KA 4G12A 5E1XA 1IXSB 3HTUA 1V54H 4KN4X 4U7DA 1K4SA 3HSEA 2JA8J 1ZRFA 1J75A 2DOEA 2LF7A 3J7AY 2CUZA 2EB7A 2FF4A 3WTSC 4JQFA 2HZDA 5KAIC 1A6QA 2BY3A 5H2FC 3AL0C 5ILVA 2HYFA 2EK5A 4UXNA 3IP4B 1P2FA 1XX5A 2CUJA 3DBRB 3T0YA 4U0YA 3OYIA 1TNTA 1X58A 3VPRA 4S05A 3WGIA 2R93J 2M8EA 3I71A 2IXSA 2EA2A 1PUEE 2Z33A 4I99C 2OUMA 5GTHC 4Y3OA 1QZEA 4RAFA 3V8JA 3JRGA 2M1BA 2XPVA 2KIUA 1OYYA 4WXDA 4C3JJ 1KQ0A 3K4CA 2YUSA 3BG3A 4LIUA 2ICWG 4XM3A 1AU7A 3GLLA 3IL2A 5GAGJ 1ETKA 1R23A 2JA5J 1ZG3A 2X1CA 1WJDA 4MQVA 4M9SA 5HDGA 5J6XA 2OTJI 2L5QA 5HLGA 1OCOH 2CO5A 3QWLA 1FLIA 2X9DA 4PJJA 4LD5A 3PUFA 4BL0B 1Z3YA 3CESA 3BZKA 4CH7A 3LAJA 2CS3A 3QODA 4ZYGA 3BDDA 1MJAA 2HDCA 1HOMA 3VYSB 4RGXA 1D0YA 1TQIA 2DQLA 2XAJA 3KLNA 1U8RA 3LA2A 3KETA 1TP4A 1ON2A 1S8NA 4PJNA 4R79A 4M3FA 4HX7A 3WU0A 1R49A 4HLXA 2YSRA 3K69A 2X1EA 2VJ5A 3K0LA 4ASNA 1IUYA 2LBFB 3P5JA 2ID3A 4P9FA 5DD4A 1ZR4A 2PMZA 5L3BA 1MKMA 4RB3C 5FLXK 1AKHA 4AD9A 2E1CA 2QKMB 1U5TA 3KP2A 4KISA 1X19A 1QRYA 2JZYA 2XF5A 4FX0A 3V7SA 4A3FJ 1J59A 2HQAA 4Y17A 1CQTA 2VODA 5EYRA 4MEYF 3PO2J 2OBPA 3GW2A 2VQHA 4ZDPA 1YJNI 4B4CA 4ENNA 3QP5A 1J5YA 4A3DJ 3FKJA 3LA7A 2BW3A 1IRFA 3VSLA 2UV1A 4U7BA 2DDBA 2O9LA 3ASOH 3Q0WA 3TW7A 4KDPA 2P8TA 4RB1A 2CW8A 3OYKA 1S3JA 2EFPA 3G71I 2DOFA 2PBIA 4C2MJ 3I4NJ 3L00A 3PO3J 4MNUA 3MVPA 2LC2A 2DBBA 1YRNB 1WZ2A 1WH7A 2A6EF 1FZPB 4O5VA 4BNCA 1V5FA 2DTZA 2WV1A 4OINF 2BBYA 4BQQA 2RGVA 2R7WA 5J4YA 3K70D 3HKZN 2V1UA 3QU6A 5L3DA 3DCFA 2A69F 1RESA 3H3UA 3OYMA 1T8IA 1ODDA 2MG4A 4Z2YA 4A3BJ 5LHGA 2P7VB 1MIJA 3BTIA 2X0LA 3D5LA 1K7AA 4UY8I 1W7PA 2QBYA 3A01A 4IL6C 2VBZA 3DKXA 3V42A 4YFXF 3S3NA 1NK3P 3M3YJ 2DCEA 3PJRA 3MKYB 1R4MB 3DF8A 2EV5A 2IA2A 2P6TA 4YEJA 2VE8A 2IRFG 3F8FA 1JHFA 5LGUA 1O7LA 3BOQA 1T38A 3AG1H 2LRDA 3CJRB 2TDXA 2A5YB 2IGNA 2B7EA 2DYRH 2M0CA 3BP8A 4B43A 1Q1HA 4CCLA 3LSJA 2KRCA 2K27A 4LG0A 3ZR8X 4LB6B 2JWTA 2XVCA 2GBYA 3CZ6A 4MIMA 3BG6A 2W00A 3OSGA 2C6YA 4OMYA 3M9AA 1EKEA 3KP3A 4XRFA 1S6LA 2XSDC 1JT0A 2H8RA 5FKKA 2Y2ZA 3UNGC 3DTEA 3M8EA 4PSWA 2NNYA 3N97A 1ZLKA 3JTHA 2FX0A 2IT0A 1XG1A 1I27A 1GHCA 2EZHA 1BM9A 2FMYA 1LE8A 1AKHB 2ISYA 4G9YA 1U5TB 2HI3A 3K4BA 1TW3A 3MD2A 4MLOA 2KKOA 4CCMA 1JT6A 2IP2A 3K70C 3BWGA 2E5NA 1MMSA 4HOBA 4CCNA 5L3FA 4G6QA 3ELKA 2IS6A 4HLYA 1JUPA 3H0GJ 2VBXA 5D4RA 1GLNA 1MBJA 2EFNA 2K7LA 4M3EA 2BW3B 4DBRA 4HNUA 1K78B 2E7WA 3KYLA 3C2GA 5J8FA 4HNVA 3P9KA 3FXKA
chains in the Genus database with same CATH topology
2KISA 2CQNA 2KIQA 2KFDA 2DOFA 4FQGA 2JUCA 2K85A 2DODA 2KZGA 2B7EA 1UZCA 2LKSA 2E71A 2L9VA 2DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIS A;  2CQN A;  2KIQ A;  2KFD A;  2DOF A;  4FQG A;  2JUC A;  2K85 A;  2DOD A;  2KZG A;  2B7E A;  1UZC A;  2LKS A;  2E71 A;  2L9V A;  2DOE A; 
#chains in the Genus database with same CATH topology
 2FQ3 A;  1W7P D;  2X6X A;  1U5T C;  2STT A;  3QQA A;  4OIR F;  2MH9 A;  2XGC A;  5LRS A;  1YE9 A;  2R7O A;  1BOB A;  2EBI A;  2IPQ X;  3HUG B;  3GFM A;  1G3W A;  3B73 A;  4AIJ A;  2MSY A;  2Y0S N;  2KIQ A;  5F0C A;  4XLF A;  5JI6 A;  3RKX A;  3JRI A;  1T33 A;  4HSR A;  5B1B H;  3LFU A;  2H8W A;  2ZSI B;  1LVA A;  4L0Y B;  4BAY A;  5FJ8 J;  4YEL A;  2VLA A;  4D0P A;  3GF2 A;  2RVC A;  2VQC A;  4M3B A;  1ZGJ A;  1JKQ C;  1YI2 I;  2H6C A;  4HYE A;  4I02 A;  5JHF A;  4HV5 A;  4IJA A;  3TW6 A;  2LFB A;  3BR1 A;  3Q3S A;  3RZD J;  1OCP A;  1QU3 A;  3SYT A;  3GTJ J;  1VTN C;  2M45 A;  3U2R A;  5B66 C;  2M34 A;  3CCM I;  1ZRE A;  1N77 A;  3RYP A;  2AS5 F;  1U8B A;  1SVO A;  4XKW A;  2XIG A;  1W7P B;  1N78 A;  2BHZ A;  4E4H A;  2JJ7 A;  2DT5 A;  3HJE A;  4KIG A;  5DCM A;  1X4O A;  3FXL A;  3RIR A;  5IP6 A;  2XAS A;  2K9Q A;  2JTV A;  3X2Q H;  2L01 A;  1KU7 A;  1LKX A;  1D8K A;  3HOU J;  4U0W A;  4BE0 A;  4XLC A;  4CA0 A;  4CXF A;  2A61 A;  2RNJ A;  4F92 B;  1XGN A;  2IA0 A;  3TOB A;  4OIP F;  1FIP A;  4ABZ A;  1VQ9 I;  5TGT A;  3HRT A;  5K7Z A;  5J8C A;  2ETH A;  3OL3 A;  1KA8 A;  3DTI A;  1D8J A;  6PAX A;  1B9M A;  2VL8 A;  2ZC2 A;  1IF1 A;  2DXI A;  1HDP A;  4L5E A;  3NAR A;  5D6E A;  3ZQG A;  4OIO F;  2PEX A;  4UV8 A;  4HPQ A;  3FXO A;  2OPT A;  2Y9Y A;  1I3A A;  4H4K C;  1DU6 A;  1T56 A;  3L2V A;  4PJM A;  3DEE A;  4NC7 A;  1QHH D;  3OYC A;  4A69 C;  1LE8 B;  4J01 A;  5DCF A;  5FFX A;  3WE2 A;  2CJJ A;  1WJ5 A;  2E1N A;  3LAP A;  3V4G A;  1P7J A;  4I09 A;  2COB A;  1BC7 C;  2WC2 A;  4NQW B;  1P9Q C;  3K1P A;  4PGG A;  2Z1D A;  1KQ8 A;  1SAU A;  5CVJ A;  4BEH A;  3PNV A;  2R7T A;  4RS8 A;  1Z21 A;  1RRJ A;  2GLO A;  3VFZ A;  2RV8 A;  3JRD A;  4BDZ A;  3K1M A;  2CV0 A;  3J7Z I;  2W1O A;  2DMN A;  3F21 A;  4G7O F;  2A07 F;  1UST A;  2XUB A;  3CUO A;  1G8X A;  3HOW J;  3SZP A;  2ME6 A;  1VF9 A;  2Z2S B;  3L2R A;  1AWC A;  4OIQ F;  1EH6 A;  1O7F A;  1MH4 A;  1ONV A;  4JYK A;  3CC4 I;  3GLX A;  3OL4 A;  5D6F A;  1XS9 A;  2F4I A;  4CDG A;  1R36 A;  2NVX J;  1D1B A;  3BCB A;  4UV9 A;  3AKZ A;  2EZL A;  1AOY A;  5J4V A;  2DO7 A;  2ACJ A;  2HOT A;  1HW5 A;  2B0L A;  2QEN A;  3WGG A;  4HDU A;  3S8P A;  1W1W E;  4S0H B;  4D9J A;  3ABM H;  3I53 A;  5E18 F;  3IHU A;  1LFU P;  3GFJ A;  3Q0V A;  4PJL A;  1FBQ A;  1VQ8 I;  1Z91 A;  3E6B A;  1Z9C A;  2E2I J;  2QYO A;  2R4G A;  3IAM 2;  2IS2 A;  1Y8R B;  3GXO A;  4ZZD A;  2LKX A;  2A05 A;  2M2E A;  3GTL J;  2F5D A;  2XSJ C;  2CW7 A;  2CG4 A;  5CVI A;  4HA8 A;  5ICF A;  2R0Q C;  1I1G A;  4LIT A;  5FKL A;  3S3O A;  2CSO A;  1XDU A;  5HLI A;  4II3 A;  5GAE J;  3IRR A;  2ECC A;  3PSF A;  5JR3 A;  2KJC A;  1PYV A;  2IGK A;  3ZQL A;  2K5C A;  1ZQ3 P;  3BJO A;  4B1R A;  3JSP A;  5TRD A;  4UUS A;  3WHB A;  3JRH A;  2PQ8 A;  4HRI A;  4X1E A;  2D1H A;  2KHM A;  2CH0 A;  4C3I J;  3GTO J;  2YR2 A;  3ZPL A;  4XLE A;  1Q1V A;  4DBQ A;  4FT8 A;  1VQO I;  3CMA I;  3KLO A;  1HCR A;  2OTL I;  3CC2 I;  2NVQ J;  1I6H J;  4GFB A;  3OV8 A;  3BQZ A;  1JUS A;  2OC6 A;  4N0B A;  5HS9 A;  4PK4 A;  1X1P A;  2K9M A;  5LHI A;  4BYY A;  2VKV A;  3GFI A;  2X6O A;  3O6B B;  4WX9 A;  1REP C;  4D7N A;  2WB1 A;  2XGX A;  1BR1 A;  5TIS C;  1FC3 A;  3P9C A;  2B9S A;  3A2K A;  3DWL E;  3BRO A;  1S7O A;  2FA5 A;  1HXD A;  2BYV E;  4L9T A;  4F7Z A;  1D5Y A;  3BR3 A;  2V4J C;  2Z5U A;  1ENH A;  4MTD A;  4JK1 X;  2DN0 A;  3OS2 A;  2F6C A;  2P5V A;  1T95 A;  3RI4 A;  3TGN A;  4I0B A;  2R7U A;  1Z3X A;  1OKR A;  4GYI A;  2IBD A;  3ROU A;  4U87 A;  4GCV A;  5M3M J;  2YX7 A;  3FM3 A;  4Q47 A;  1IUF A;  5H20 A;  1ZR2 A;  2JA6 J;  3BG5 A;  4CIC A;  2VI6 A;  2O0Y A;  1FOY A;  5IOY A;  1B8I A;  2WBM A;  3AAF A;  4A0Y A;  4CUG A;  1CF7 B;  3TO6 A;  2V6E A;  1FPQ A;  2DFH A;  5FLV A;  2LSO A;  3KX2 A;  2UZK A;  2L7Z A;  1D5V A;  3LQQ A;  3I0T A;  2W57 A;  1IV8 A;  4I01 A;  3S1R J;  1UMQ A;  4KJZ A;  1TL8 A;  4CYD A;  2VON A;  4XN3 A;  5EEH A;  5KK1 A;  2PI0 A;  4YG2 F;  2ZXI A;  1Z6T A;  1JGG A;  3DPU A;  2Z3Y A;  2ZJP F;  3EPZ A;  3M1E A;  2UXX A;  1IAW A;  3S2H J;  1Z6R A;  1HQC A;  3FXM A;  5E3N A;  2KT0 A;  5IPA A;  1XSD A;  4IQ4 A;  5D5V B;  2BZT A;  2K40 A;  1X3W B;  3FXQ A;  2R7V A;  3DLL F;  3I9V 2;  1YJ9 I;  1A04 A;  1FJL A;  3M8J A;  3V7R A;  3BR6 A;  1W0U A;  2UWM A;  1PUF A;  2K85 A;  2HR3 A;  2GZW A;  3KP5 A;  3EYY A;  3T8T A;  5EF6 A;  4BXU A;  1BBY A;  2Q2E B;  2DU9 A;  2XV4 S;  4XLN F;  3CCU I;  5IT9 Z;  2KIS A;  2AXL A;  3WGH A;  3KZZ A;  5GPA A;  2LNB A;  1Y1V J;  4TV7 A;  4F55 A;  4MTE A;  3JW4 A;  3NRV A;  1W36 D;  4RLQ A;  2QQA A;  3OOP A;  1JGS A;  2X6W A;  4S04 A;  4IZZ A;  2Z9O A;  3Q5F A;  4AC0 A;  3BZC A;  2IS1 A;  1UB9 A;  2W24 A;  3FX3 A;  3BG7 A;  2MAB A;  3I58 A;  4M3D A;  4RGS A;  3MEX A;  3BR2 A;  2VQL A;  3G6E I;  2WY7 Q;  5J1R A;  4PDK A;  1MBH A;  5LEJ A;  1R5H A;  2MLG A;  3KE2 A;  4V2F A;  4JBA A;  3ZMS A;  5JVT A;  5HOO A;  2BOL A;  3BLY A;  1TWA J;  1BOA A;  2D45 A;  3M4O J;  3E5Q A;  5FKN A;  2E2H J;  1FNN A;  2HVQ A;  3QP6 A;  1LDK B;  1SAX A;  3WG9 A;  4DZJ A;  3KP4 A;  5F0H A;  4L5J A;  2EJR A;  5H6R A;  4BQN A;  5K5R A;  1V55 H;  2JUG A;  2P4W A;  4A2U A;  4A3E J;  3W2A A;  4D1Q A;  4M9X A;  2D2W A;  4RMN A;  5GP9 A;  3OYB A;  1KGS A;  2FBK A;  5JVG F;  5F0F A;  4AIH A;  2QSG X;  3K7A J;  2A3S A;  3E7L A;  3QPH A;  3S1Q J;  1XSV A;  2L9R A;  2CQK A;  2OV7 A;  3TP3 A;  5B3S H;  2DAO A;  3LOC A;  4Z6Y A;  4JX6 A;  3PIO F;  3CCV I;  1RR8 C;  2KZG A;  1MDM A;  2D1V A;  1K4T A;  2M87 A;  2ECB A;  5CPR B;  2LBF A;  4NUB A;  1A5J A;  4NBQ A;  3JR9 A;  1LEB A;  2K9S A;  4M74 A;  3HKZ A;  4CSW A;  2VKE A;  1OYW A;  1LB2 A;  1W36 C;  1ETO A;  2Y75 A;  2X6Y A;  2WY8 Q;  3I54 A;  2HQ5 A;  2J5O A;  2RDP A;  5F04 A;  3S3M A;  3H9J A;  3SEQ A;  1JJ8 C;  3BPV A;  4KIF A;  4E7I A;  4DGW B;  2NS7 A;  2VQG A;  2ZXJ A;  1SMY F;  4J19 A;  3FXR A;  2OCE A;  2MH2 A;  3ABT A;  3F9K A;  3GYH X;  2EIJ H;  5EEG A;  1N25 A;  2QWW A;  1XGO A;  1Y8Q B;  4ESJ A;  3WOD F;  2PFB A;  3RSN A;  4XN0 A;  5FKO A;  3V7C A;  2CV2 A;  4BE1 A;  5E20 A;  4KT5 C;  4MO7 A;  1A35 A;  3CD6 I;  1BR2 A;  3MZ8 A;  2NVU B;  5DM6 F;  2DPU A;  1YRN A;  4XK4 A;  2MLK A;  4XIC A;  3M8F A;  5M3F J;  3HOX J;  4BHP A;  1P4A A;  1FSE A;  2VT3 A;  4XSZ F;  5FKM A;  1UHS A;  2EIL H;  3LA3 A;  4CCK A;  4A3G J;  1GXP A;  2O5R A;  2QSH X;  2V6C A;  3W6V A;  2G7H A;  3S2D J;  5AON A;  2LG4 A;  2GA2 A;  2D5V A;  1ETY A;  4DW6 A;  5K7F A;  2LKS A;  1BI3 A;  1QQI A;  3GO5 A;  4QPO A;  2A68 F;  3E3V A;  4XKV A;  4BQO A;  2FU4 A;  4ZJZ A;  1S7A A;  1ETX A;  2NS0 A;  1W5C C;  5FFZ A;  3HOS A;  1J7K A;  2WWY A;  2H1K A;  5LGT A;  5J40 A;  3OR2 C;  1U2W A;  2YPR A;  4HQE A;  4O3M A;  3O3K A;  4RGU A;  4GRI A;  2L4A A;  1KYZ A;  2O8X A;  1TT0 A;  1X1D A;  2VT2 A;  1G3S A;  1BR4 A;  5IT3 A;  4ENK A;  1HKS A;  2K4J A;  2R7R A;  3W6K B;  2HVR A;  1YQA A;  4LK0 F;  4BY7 J;  4F93 B;  2EIK H;  2IEK A;  2KQR A;  5DS9 A;  5JHU A;  1Y39 A;  3D5S C;  2HQR A;  4LFU A;  2L02 A;  2XHK A;  2Y0S A;  2PJR B;  3EQL F;  2QGU A;  4XKB A;  2WAE A;  4AWX B;  2GQQ A;  1B4A A;  4XQF A;  1MDM B;  2KRH A;  1RNL A;  2O61 A;  2KMU A;  2ZXW H;  2KL4 A;  4PUS A;  3U9G A;  3MFK A;  1EJ9 A;  3HRU A;  3WTU C;  2P81 A;  2WAF A;  5BOX A;  3R60 A;  5CVV A;  3K9T A;  1BC8 C;  5D5X B;  2Z99 A;  5E3M A;  2LH9 A;  1JKR C;  2JT1 A;  5GTI C;  1B1B A;  1P7I A;  1GT0 C;  1YIO A;  1O4X A;  2FD5 A;  4XLA A;  3U1K A;  4XRM A;  4GXO A;  2KDZ A;  3CJN A;  2RQP A;  2BXY A;  5KNL A;  4XR6 A;  1YG2 A;  4EVI A;  1LQ1 A;  3VYT B;  3AG3 H;  1FWZ A;  2BEO A;  3LSP A;  3H5R A;  3W2W A;  1K78 A;  4ENJ A;  1XMX A;  4IRH A;  1X1A A;  2BE5 F;  1MNM C;  3HEF A;  2QKL B;  5EZH A;  3SDG A;  3HTS B;  5KCM A;  1F43 A;  1IN7 A;  1EH8 A;  2ZCW A;  4I7H A;  4DOZ A;  1FOX A;  1ETW A;  2DQR A;  1V3F A;  3HUG A;  1TWF J;  4XOT A;  5DEQ A;  4YFK F;  3MZH A;  4HF0 A;  4ZH4 F;  2JVH A;  5H6Q A;  2ID6 A;  4I0A A;  3FIW A;  2E2J J;  4XSX F;  2EWN A;  5E79 C;  3FBN B;  3ZQQ A;  1YYV A;  2X51 A;  3IKT A;  3GUD A;  1LDD A;  3F6O A;  1SEU A;  4BE2 A;  4ETS A;  4DYC A;  2AQF A;  2HWV A;  3WHC A;  5DTD A;  4IHT A;  1PVE A;  4CZZ A;  1LNW A;  2F5E A;  4Q48 A;  2VJJ A;  1D0X A;  4EV0 A;  3RQI A;  4XID A;  3L2W A;  2EFW A;  2CQX A;  2UUZ A;  5IYB J;  2FUG 2;  4ZDO A;  2OZ6 A;  1JI8 A;  2I5U A;  1EA3 A;  1RUN A;  1IV6 A;  2HOE A;  2F4M B;  4GO1 A;  4N4N B;  4BUP A;  2JN6 A;  4MGR A;  5JFR A;  1RKT A;  4HX4 A;  1Z0X A;  2W85 A;  2VXZ A;  3MKL A;  1OCC H;  3RKY A;  2QQ8 A;  4OAY A;  2GOM A;  3JRA A;  2HNH A;  3I4P A;  3E6M A;  4XBF A;  4B44 A;  1T0F A;  3RTR A;  1VND A;  4IKF A;  1MW7 A;  2FQ4 A;  3RJP A;  9ANT A;  4L9N A;  4ZYE A;  4OAZ A;  3PNT A;  2IGM A;  2A6H F;  2EQR A;  4NC8 A;  3PQK A;  4P9U A;  1R4N B;  3WE3 A;  2KLO A;  3JRE A;  1BIA A;  3S32 A;  1DGR M;  1SAN A;  2W82 A;  1WFX A;  4WK8 F;  3S93 A;  3FXU A;  5DUK A;  4F91 B;  4G6T B;  5ILS A;  3L2C A;  4JX5 A;  3R61 A;  4UVA A;  1LEA A;  2M0M A;  4P1W A;  3F22 A;  4IO9 F;  4A3C J;  3HDD A;  2CFX A;  4I6Z A;  3E0J B;  3K10 A;  1ZLJ A;  4NQW A;  4XRS A;  1R58 A;  1AHD P;  2BHY A;  3W3C A;  2L9S A;  3QOE A;  2VC1 A;  2VB6 A;  1TNS A;  3OYA A;  2P0W A;  3GVA A;  2I8D A;  1SD6 A;  2AXT C;  1IZ1 A;  5BS6 A;  3GZ6 A;  4MFD A;  3CQZ J;  1WKM A;  1Z7U A;  4RB2 C;  1MBK A;  1YJW I;  3JAM Z;  5HDN A;  2K3P A;  3M07 A;  4RB0 A;  2DMQ A;  2K4B A;  4B09 A;  4QLC U;  1X2M A;  3L2U A;  3CCJ I;  2LY1 A;  2E36 A;  4ESB A;  3CCL I;  4KIT B;  1TQP A;  2JUC A;  5E1W A;  5HLT A;  1A36 A;  3CO7 C;  1OCT C;  2BY2 A;  3SXY A;  3O2P E;  2E34 A;  2GOX B;  3ECO A;  3LSI A;  4BHB A;  4BJ5 C;  2HQN A;  3WTZ A;  2OA4 A;  3VDX A;  1MGT A;  3FZV A;  2QVO A;  4V2G A;  2BGC A;  5ILU A;  1FX7 A;  2WAD A;  3W6J B;  5IYD J;  1PP7 U;  1V5E A;  1ON1 A;  1MNE A;  5CVU A;  5F1J A;  4BQA A;  2FJ1 A;  2EFO A;  3QRF F;  4FAS D;  5A2Q K;  4P96 A;  3TBI A;  2MW8 A;  1J2X A;  2V9K A;  3PFI A;  1ZYR F;  3OIP A;  2JA7 J;  2DT7 B;  3LSG A;  1ULY A;  3DBL B;  2QF7 A;  2BY0 A;  3IAS 2;  1IO2 A;  5DM7 F;  1ERD A;  3OSF A;  4KIB A;  1GDT A;  1MJ9 A;  1E3P A;  1WJA A;  3GTM J;  1ZH5 A;  1DQU A;  4ZYA A;  2H1L A;  3KFW X;  4ZC3 A;  4B3X A;  3ASN H;  1G3T A;  2XRO A;  1S7E A;  1YIT I;  4QIW N;  4FHT A;  3K4J A;  1Z67 A;  2XRN A;  2HEO A;  3LSK A;  4XON A;  3WTW C;  1Z05 A;  1GV5 A;  2ZJ2 A;  4RM3 A;  5ED4 A;  3I5U A;  3OYF A;  4KMF A;  4A3I J;  1ZG5 A;  4P55 A;  3I59 B;  1FP1 D;  1E0E A;  2XDV A;  3FM5 A;  2DMU A;  4A3M J;  2F5C A;  5L3C A;  1RKW A;  5HDK A;  2MYS A;  3CP8 A;  3OIQ A;  1PDN C;  1IN5 A;  2QM3 A;  4ZTF A;  4D5C A;  4OU0 A;  1LVK A;  1YIJ I;  3HB9 A;  1T0F C;  1L0O C;  2N8G A;  4RAZ A;  2GXB A;  3TL4 X;  4EQQ A;  3O8G A;  2DA5 A;  1MBG A;  3GTK J;  3PSI A;  3J81 Z;  2ZNZ A;  4A6D A;  4IHS A;  2EFQ A;  2FOW A;  3S16 J;  3F23 A;  3G1O A;  5EG0 B;  5C4X J;  1FEX A;  1VQ5 I;  3ERE D;  4XRS G;  3KYD B;  3HOV J;  5LRR A;  4CCJ A;  4RDU A;  2L7K A;  4N9H A;  5DD8 A;  1QPI A;  3MWM A;  4LJZ F;  1OYI A;  3V8L A;  1HDD C;  1UG0 A;  3JSO A;  4X6A J;  4QSH A;  1YX3 A;  2LOO A;  1F5T A;  1WJE A;  3DU6 A;  2V7F A;  2NVT J;  1XGM A;  3S14 J;  2FEZ A;  4AUX A;  3JRF A;  2AO9 A;  3PL8 A;  1VFC A;  1CF7 A;  3CF5 F;  4QPQ A;  5KAF C;  2ZJQ F;  2E60 A;  4HBL A;  5EZG A;  4M6X A;  1UHM A;  1WWX A;  2XAF A;  2RAE A;  2OQR A;  2NXN B;  3VOD A;  4DYR A;  1IJW C;  1F4K A;  1S5L C;  1J9I A;  4BHC A;  3ZMU A;  1RIO H;  4YIR X;  1EH7 A;  1VQP I;  2LDU A;  2ME0 A;  3QU3 A;  1MND A;  2JRM A;  4KUM A;  3B6C A;  3Q0U A;  2DDA A;  1BW6 A;  5FLM J;  4NC6 A;  1DGW Y;  3TDZ C;  4EJT A;  3HGY A;  3HM5 A;  3P9I A;  2HTS A;  1R5I D;  2VOO A;  3T1B A;  3E5X A;  4J00 A;  2DA7 A;  4M9Z A;  1B6A A;  4CHU A;  2DFF A;  2BY1 A;  4M3G A;  2R3S A;  4EGY A;  1ZAR A;  4C30 A;  3L2Q A;  3C7J A;  2HTJ A;  4L9V A;  3BZ6 A;  3F8C A;  2OU2 A;  2CQN A;  1OPC A;  3RKW A;  3I3L A;  2M3A A;  1K6Y A;  4IHX A;  3CP2 A;  3A1Y A;  4DYQ A;  2FXA A;  4WWC A;  3S15 J;  4IHV A;  3S1N J;  3C2B A;  5CKT A;  4N9I A;  3FMR A;  3MZY A;  3HOT A;  3ZOB A;  1HLV A;  2HXI A;  1YS6 A;  3A0H C;  3NEU A;  2Q8K A;  1NTC A;  1IXR C;  2KIM A;  2MGQ A;  3E1S A;  3ZN1 A;  5D4S A;  3COA C;  5FD5 A;  3IV5 A;  1OFC X;  1R5G A;  2Q2E A;  5AIQ A;  1J09 A;  2GM4 A;  1X1C A;  1BI0 A;  3HHG A;  5LLQ A;  4C2T A;  3C18 A;  5CYV A;  3CC7 I;  1TWG J;  1D0Z A;  2FSW A;  4BJT A;  3JTG A;  3ULQ B;  2E5Z A;  4P5O A;  5FLX Z;  2B63 J;  4R8H A;  1LJ9 A;  3H5N A;  3S1M J;  1STZ A;  3ERM A;  2DOD A;  2HPM A;  1L3L A;  5HNF A;  2OF7 A;  2M5W A;  1JJ6 C;  1KU9 A;  5B5E C;  3ABL H;  5IP7 J;  4JX4 A;  1IW7 F;  1KON A;  2FOK A;  3OIO A;  4L18 B;  3G73 A;  2HOA A;  1ZTR A;  3QYF A;  3KZY A;  2DFE A;  1IRG A;  2CWE A;  2XAU A;  3K6G A;  3IC7 A;  2R5Z B;  3VYR B;  1HA8 A;  2PMU A;  4I76 A;  3GWZ A;  1QHG A;  2PMH A;  2ESN A;  1FYK A;  3CCE I;  4KFC A;  3OYL A;  2QZ8 A;  3J7Y J;  1X1B A;  2V79 A;  1H9T A;  2CV1 A;  1DP3 A;  1KYW A;  2O6G E;  1P6R A;  3UR3 C;  5IY5 H;  1X4P A;  2COM A;  2YU3 A;  3OYH A;  3IUO A;  3GFL A;  1Z1D A;  2IS4 A;  1GUU A;  3K4N A;  4IRI A;  1HC8 A;  1QPM A;  5CQG A;  2CGP A;  2HOS A;  3LSM A;  1W4M A;  1JKP C;  1WJF A;  4HX8 A;  3ZMZ A;  3OWT A;  2RN7 A;  3ZXS A;  1WSU A;  2TCT A;  5F27 A;  5KHD A;  2X85 A;  2DOA A;  3U1D A;  1MZB A;  3OYG A;  1OQY A;  4E7S A;  1YW9 A;  2ZFU A;  3F8M A;  3RPQ A;  5HVQ C;  5IP9 J;  5F64 A;  3FXJ A;  2KZV A;  1GVD A;  3DQV C;  3MN2 A;  1BW5 A;  3ZQ7 A;  1D1C A;  1FMV A;  1TWC J;  1LUJ B;  4EJO A;  1SVM A;  2MD0 A;  2I10 A;  1FT9 A;  2DYS H;  5ICG A;  1DU0 A;  4FIS A;  4L5I A;  1OCZ H;  2HXO A;  2P5K A;  1Y1W J;  3WTX C;  1IN6 A;  3OS0 A;  1QBJ A;  3CLQ A;  3IWZ A;  2KDO A;  3F8B A;  4M71 A;  2NYX A;  3FWE A;  3RDI A;  1JKO C;  1EF4 A;  2X1D A;  4EEF G;  5HNH A;  3LSR A;  2ZFW A;  1BA5 A;  4W97 A;  2F5F A;  3EUK L;  1YLF A;  1QGP A;  1WHU A;  3DBH B;  1NG6 A;  2XGD A;  4RAY A;  4AYB N;  2G7U A;  2JSP A;  2E1M B;  4FQG A;  3SFZ A;  2NRA C;  2H94 A;  3PNY A;  4I2O A;  4A6E A;  1YTY A;  1MSF C;  1UHW A;  1MD0 A;  1TZL A;  1NHA A;  4AVZ A;  2R7S A;  4AU7 A;  4ENM A;  3BT9 A;  2KRF A;  3QOP A;  3IRQ A;  1E2X A;  1Y56 A;  3LNQ A;  2H27 A;  1B59 A;  2ZB9 A;  1U0J A;  1SD4 A;  2NNN A;  3OYD A;  2M8G X;  2VPR A;  1FMW A;  1YW8 A;  3MAJ A;  1YW7 A;  4IPA A;  3CCS I;  1ZK8 A;  5J1U A;  5E17 F;  2E1M C;  1VQM I;  3RZO J;  3ISP A;  2HYJ A;  1K79 A;  3KYC B;  3BC8 A;  3KEO A;  4E7J A;  4B8X A;  3H92 A;  2L3D A;  5EGO B;  5M5W J;  4PJ0 C;  3CCY A;  3G2B A;  2VBY A;  3ZRG A;  3H0D A;  2ADU A;  2XKO A;  3DP7 A;  3HG9 A;  4CZC A;  1U9O A;  2EZI A;  2IVM A;  2STW A;  1X3U A;  4RGR A;  2OAZ A;  4B48 A;  5BQT A;  3BTJ A;  1TT5 B;  3FKI J;  1YX5 A;  1WI9 A;  4IRG A;  3K4K A;  3ZQH A;  4EM2 A;  4QTR A;  1K61 A;  2V1D A;  2G9W A;  4IEJ A;  3LSH A;  2CQQ A;  4RM2 A;  4ZTJ A;  1R9T J;  2PJR A;  3BR0 A;  1FP2 A;  1OR7 A;  4XLH A;  2J5P A;  4JOM A;  3SFI A;  3K4L A;  2LY2 A;  4LLN A;  1IN4 A;  1H89 C;  2L54 A;  1SD7 A;  2CW0 F;  2VXD A;  2CUE A;  3H9Q A;  3CMY A;  1K6O A;  4XLP F;  2JRT A;  2Y30 A;  3BCA A;  5J1Y A;  3CDH A;  3E5U A;  3HXL A;  1VQ4 I;  3IKV A;  2RNG A;  5EDN A;  1JXS A;  3Q9V A;  2L9N A;  1MBE A;  2F5V A;  3MQ0 A;  1U78 A;  3PFY A;  1A31 A;  2JPC A;  1VQN I;  3FHN A;  4RAG A;  3DLA A;  2WV0 A;  1MMA A;  4EJV A;  1N75 A;  3GTP J;  1UZC A;  4LK1 F;  4D5F A;  2FRH A;  2YS9 A;  3VB2 A;  1YO5 C;  4DQ2 A;  4X0G A;  5HOD A;  3CMM A;  3H1C A;  3FDY A;  4LIV A;  2CQ7 A;  1UJ8 A;  1TTY A;  4PZJ A;  4ZYD A;  4IVN A;  5E8I A;  2VBW A;  1D3Y A;  2EIM H;  1R7J A;  2IW5 A;  5LD2 C;  4GGG A;  4BAC A;  5HS8 A;  2WAQ N;  2RC4 A;  2V1X A;  4N4O B;  3CO6 C;  2L0K A;  4I98 B;  5DYM A;  1S29 A;  4AVP A;  2MC4 A;  3RQ4 A;  2VPL A;  4LB5 A;  1WQ2 A;  3KIO A;  4YII A;  2W48 A;  1YHQ I;  2HGC A;  4LG3 A;  3ZQF A;  3MKW B;  1R1T A;  4UHT A;  3CTA A;  4AID A;  4BXF A;  2ESH A;  3WG7 H;  4EJW A;  1B72 B;  2ZKZ A;  4FET A;  2CU7 A;  4FTH A;  3L7W A;  5C44 J;  1BJA A;  2GA1 A;  5DDG A;  3CUQ A;  2CYY A;  4PFO A;  4FE7 A;  4A0Z A;  3F6V A;  3IH4 A;  3QPT A;  4XOR A;  1ACI A;  1QZZ A;  2O7O A;  2DA1 A;  3N05 A;  1IC8 A;  1RUO A;  4BU2 A;  3EET A;  2DT6 A;  5JLW A;  5K1Y A;  1FOW A;  1RZ4 A;  4Y15 A;  5HLH A;  3TO9 A;  5FRO A;  1U3E M;  1QNT A;  4RBO A;  4C2U A;  3EYI A;  4CO8 A;  2DLL A;  2LTP A;  2EA4 A;  3A4C A;  1IXC A;  2HPI A;  2EPF A;  5L3G A;  3WTT C;  4ESF A;  4G8X A;  1SFO J;  2QQB A;  4YRV A;  5KVR A;  1MMN A;  3BTL A;  4JP0 A;  3GZN B;  4LLL A;  2OZU A;  2XB5 A;  1UEL B;  4UUV A;  1ZHF A;  2JPB A;  3B02 A;  3HBL A;  3SDB A;  3G1L A;  3IWF A;  2FNA A;  3KEQ A;  2LR8 A;  4WXH A;  1Y0U A;  2DJI A;  5FO5 A;  3H5A A;  3VEP A;  4C3H J;  2MFZ A;  2E7X A;  4KMU X;  1H0M A;  3I56 I;  2Y48 A;  4OOI A;  1ORK A;  2OD5 A;  2R5Y B;  3LL7 A;  1W5S A;  3F0C A;  3D5R C;  3FF5 A;  3EDP A;  3CF2 A;  4PGH A;  1P92 A;  3DKW A;  2XAQ A;  1OCR H;  2XAG A;  5D5U B;  1MJB A;  3BQY A;  1H88 C;  1RET A;  4HZF A;  1HBX G;  1OR7 C;  3VOE A;  5LEK A;  3FMQ A;  1AA7 A;  4CYC B;  2QLZ A;  3CLO A;  2LY9 A;  3HOZ J;  1RI7 A;  3VYU B;  2ZNY A;  4XOP A;  2KIF A;  2DMP A;  2BXZ A;  3BTC A;  4O6J A;  3CCR I;  3IH2 A;  4OWR B;  1LFB A;  4HDV A;  4A3K J;  2VKH A;  4BJ6 C;  4Y33 A;  2LD5 A;  1E3H A;  4BBS J;  1JUM A;  1IRZ A;  3JCU C;  3LWF A;  4IX7 A;  2ZME B;  3G1M A;  4XKC A;  3RPU A;  4EGZ A;  4PFP A;  3AG2 H;  2HDW A;  2RQQ A;  4DIQ A;  3KCC A;  3C2H A;  1TC3 C;  2BVM A;  1M1E B;  4E7L A;  3GEZ A;  3SZG A;  1ZG1 A;  1W0T A;  4E6K G;  1SD5 A;  1I39 A;  1QZY A;  3ZQI A;  3TQN A;  5FGM A;  2VAS A;  3FMS A;  4LOC A;  3I55 I;  2KJB A;  3GX4 X;  3CUQ B;  2R7D A;  1GXQ A;  1BN5 A;  4WF2 A;  1RR7 A;  3ESW B;  2ZME C;  3TKY A;  4HV6 A;  2DPD A;  2NVY J;  4ZZL A;  4W1U A;  1XPX A;  3A0B C;  3GCM A;  1WPK A;  3HZJ A;  3DPL C;  2L2O A;  2DI3 A;  4B3A A;  3H36 A;  4GYG A;  4CCO A;  4OMZ A;  4EJU A;  3CJQ B;  4A5N A;  2Q0O A;  3HIF A;  1TQM A;  3B6A A;  2W7N A;  5BMZ A;  2P6S A;  1HW1 A;  3HPG A;  2M7A A;  4B47 A;  3CUQ C;  2L7M P;  3DPT A;  2MA3 A;  1FY7 A;  2F48 A;  2Y0M A;  3I4M J;  2ZO4 A;  5GPC A;  2DA4 A;  1NG7 A;  2DA2 A;  1ZGA A;  2V9P A;  5CJ9 A;  1TW2 A;  1IRX A;  3K2A A;  2XF7 A;  1MBF A;  4A93 J;  3I59 A;  2ZBK A;  2XF6 A;  4LMY A;  1T2K A;  4IF4 A;  2M9H A;  1KQ9 A;  1JTY A;  2NOG A;  2Y69 H;  3C1D A;  3DTK A;  1BL0 A;  1H8A C;  4KIC A;  4BY1 J;  2HKO A;  2LP0 A;  3RPU D;  2E1O A;  2VIX A;  3KZI C;  2HKX A;  3PQJ A;  1V5G A;  5BPI A;  3F3X A;  3L9F A;  2P7C B;  4ZYH A;  3HRS A;  2GIV A;  2Z16 A;  2XRL A;  5EG0 A;  1T98 A;  1O3S A;  1SFE A;  2W25 A;  1EV7 A;  1XMA A;  3FK7 A;  3J80 Z;  5J47 A;  1G4D A;  3OYN A;  5IT9 K;  3R0J A;  4F3Q A;  4HAM A;  4CGZ A;  1S9H A;  4IQJ A;  3HC7 A;  1YS7 A;  1NH3 A;  5J3L A;  4AIK A;  3GTG J;  3A02 A;  4IXA A;  2PJP A;  1P4X A;  1GVJ A;  1WJC A;  2CMP A;  2RKH A;  3SHF A;  3K1N A;  3ZCO A;  1XD7 A;  2PLY A;  3PM1 A;  1USS A;  2OCC H;  1SVL A;  2LVS A;  5ERI A;  2HVS A;  1QO0 D;  4G7Z F;  4PSX A;  2XC7 A;  1OIS A;  3UKG A;  4IOA F;  3BG9 A;  4M73 A;  5DUI A;  4MHG A;  1IG7 A;  3LFK A;  2XKP A;  3ZMV A;  3GTQ J;  1XDS A;  5LFA A;  4Q4Z F;  4HNT A;  3F72 A;  3JRB A;  2DMT A;  3K2Z A;  5B1A H;  1IDZ A;  3GZ5 A;  2VC0 A;  2VJI A;  3DXJ F;  1K83 J;  3WTY C;  2IGO A;  3TDU C;  3FIS A;  4HEA 2;  4MEX F;  1G2H A;  2FBH A;  2PMZ N;  4KN7 X;  1NK2 P;  2ZXH A;  4YFN F;  3I64 A;  1IGN A;  4WCG A;  3IH3 A;  3TP0 A;  5E3O A;  2ZJR F;  1D1A A;  1OLT A;  3TOA A;  4QWQ A;  2QEX I;  2JSC A;  2DA6 A;  4NHJ A;  1PJR A;  4II2 A;  3AG4 H;  2GAU A;  5AIP A;  4BGD A;  3HL2 A;  1RPW A;  2QBY B;  1VQ6 I;  1UCR A;  2V9V A;  3A01 B;  1FSH A;  1WJB A;  3HGG A;  4BS9 A;  2O03 A;  2DW4 A;  2ELH A;  4HG2 A;  3E6C C;  4H0E A;  1TWH J;  2O3F A;  4EM0 B;  3U21 A;  5CVR A;  1WCM J;  3ECH A;  3FBI B;  1X2N A;  4A5M A;  4ON0 A;  3REO A;  3PIP F;  3G4S I;  1SC7 A;  4BXX J;  2X48 A;  2CRG A;  2HU9 A;  5IYC J;  2KPM A;  5FB2 A;  3ZQC A;  3KP6 A;  3TO7 A;  4LG0 B;  4RLF A;  2R5Z A;  1WGX A;  1G3Y A;  1FIA A;  3NWS A;  1TBX A;  3CDL A;  2IJL A;  3H35 A;  3TMO A;  1WVR A;  3OR1 C;  5FRM A;  4KNY A;  2V26 A;  5GAD J;  4BBR J;  5ICC A;  3H3V K;  1APL C;  1F36 A;  3CDI A;  4UVB A;  3SQN A;  4IOC F;  3FHZ A;  1DUX C;  3R6S A;  2CFO A;  3HRM A;  1KU2 A;  3M7G A;  5CLS A;  1OJL A;  5L3E A;  3DFG A;  1VZ0 A;  1VQ7 I;  4UUT A;  1U9N A;  2R92 J;  1BI2 A;  4C9Y A;  2PG4 A;  2CUF A;  3LST A;  4AYB A;  4UVC A;  2WA0 A;  4M6Y A;  3KEY A;  3MCZ A;  2R7F A;  4NB5 A;  3LQR A;  2GXG A;  3ML6 A;  3A03 A;  3V8K A;  2EZK A;  1YFH A;  1BI1 A;  1A6I A;  4KYW A;  3AFH A;  4IHY A;  3WU1 B;  3H3Z A;  4G6D A;  1XB4 A;  2LLK A;  1E3O C;  2DK8 A;  1CGP A;  3E6D A;  2DJN A;  4M6V A;  3OYE A;  4KA4 A;  5FD6 A;  1HKQ A;  2M4G A;  2K3F A;  5CQE A;  1I5Z A;  1WH5 A;  2XB0 X;  4BH9 A;  3TED A;  3ZMT A;  3KP7 A;  1QVT A;  4EM1 A;  4BKX A;  4IHW A;  4UNO A;  2HFH A;  3HOY J;  2PX9 A;  1HF0 A;  5E1Z B;  3HHH A;  2QCO A;  2JVG A;  1SFK A;  2VKD A;  5K5O A;  1O3R A;  1FTZ A;  5K5Q A;  3SJM A;  2GWR A;  1U6G A;  4FE4 A;  1O3T A;  2Y31 A;  3M1C A;  2XAH A;  5EJC A;  5M5X J;  1KZH A;  1SFX A;  3BY6 A;  5K7H A;  1YOV B;  3OMY A;  4UB6 C;  2DFI A;  2JA2 A;  2XPU A;  3QPL A;  1ZEL A;  1Z77 A;  2LK2 A;  4LLG F;  2MD5 A;  3OS1 A;  2FML A;  4KT6 A;  4RA2 A;  4D7M A;  5LGN A;  3T5X A;  2L9V A;  2M4K A;  1LFP A;  4FX4 A;  1ZAO A;  3HSF A;  3NWT A;  1S72 I;  2H09 A;  5DCM B;  3VWB A;  2QSF X;  3OOU A;  2BV6 A;  4ZDL A;  4R1H A;  1G6N A;  1MMD A;  1DDN A;  2E19 A;  3R0A A;  3D0S A;  4MQ9 F;  3SEZ A;  1V4R A;  1FOK A;  2V1N A;  3N4M A;  4Y13 A;  4E7H A;  3CCQ I;  5HS7 A;  1UG2 A;  1IN8 A;  3OY9 A;  3H9G A;  1R6R A;  4XNF A;  2HS5 A;  5EGO A;  1FBS A;  1G59 A;  5D8L B;  1UAA A;  3ABK H;  2DK5 A;  2VUM J;  1I6X A;  1IDY A;  1PP8 F;  1DPU A;  1DP7 P;  3QYE A;  2JK3 A;  5C4J J;  3L1P A;  1WRJ A;  3W2V A;  4L9J A;  5FRN A;  3RCO A;  2A6T A;  2IAI A;  3ONQ A;  3HSR A;  3T8R A;  4A3L J;  1R1U A;  1R1V A;  2WAQ A;  2QA4 I;  1F9N A;  4BEH B;  3CME I;  1T08 B;  2LF8 A;  2EV0 A;  2EIN H;  1MMG A;  1ZN2 A;  4U0V A;  1GV2 A;  2QUF A;  2M30 A;  3RKQ A;  4L0Z B;  4DNC A;  2RRE A;  4HW0 A;  3JRC A;  1O57 A;  2LRE A;  3QYB A;  3WTV C;  1HST A;  1H9G A;  1FYM A;  2K9L A;  2KFD A;  4Y7N J;  3MKZ A;  3ZN0 A;  1R22 A;  4XL9 A;  4AM3 A;  4XMY A;  3S17 J;  3DKY A;  5LHH A;  2IA1 A;  2FE3 A;  2NS8 A;  2Q1Z B;  3MMY B;  2L4M A;  1VQL I;  2DTR A;  2ELK A;  4DJA A;  3EUH A;  4Y4R A;  2ZSH B;  4BDY A;  5F08 A;  1VQK I;  2MC3 A;  3O8H A;  2R7Q A;  4PCQ A;  2GIZ A;  2P5L C;  4MFE A;  2AHQ A;  4A3J J;  5M5Y J;  3DV8 A;  2F4O B;  4WXC A;  1ZKG A;  2HYG D;  1F1Z A;  3GME A;  5F6F A;  1JE8 A;  1ZGW A;  3BR5 A;  5C3E J;  3C3W A;  2EH3 A;  3DEW A;  1QVU A;  3J80 K;  2M7B A;  4K2E A;  2VN2 A;  1B72 A;  5BPD A;  3HPH A;  1I1S A;  2FNP A;  1O3Q A;  4M72 A;  5ICE A;  1MH3 A;  3BJA A;  1W5T A;  1P4W A;  4UUS B;  3PUB A;  1XC5 A;  2K02 A;  2GXA A;  4HST A;  3JAM K;  1B9N A;  1VI0 A;  2K86 A;  1XGS A;  3GBG A;  1FYL A;  3J7A O;  2W84 A;  3VSK A;  1KU3 A;  1C0W A;  1MSE C;  1HW2 A;  5BNG A;  3S2W A;  2UXN A;  1XTA A;  1ETV A;  4ANJ A;  4DZP A;  4FCY A;  1ETQ A;  3DU5 A;  3ZGK A;  3DEU A;  4YIF A;  4G7H F;  2O8K A;  1E17 A;  2X4H A;  3ABU A;  2F2E A;  1TLH B;  3QPS A;  3RYR A;  2YU9 J;  1FTT A;  2E71 A;  1X3Z B;  1UFM A;  1XN7 A;  1ZRC A;  2R7X A;  1OMI A;  2G0E A;  3HYI A;  4U88 A;  5JLX A;  5D8K B;  3WU2 C;  3L09 A;  4Y52 J;  1Y0N A;  2EV6 A;  2FBI A;  5TJJ A;  3BJ6 A;  1ITY A;  1HKT A;  4LGW A;  1Z7L A;  2A5W A;  4E70 A;  2VJ4 A;  5GAH J;  2TRT A;  2YX4 A;  1R00 A;  1Y6I A;  1HSJ A;  1LDJ A;  1I3Q J;  1BJZ A;  4F52 A;  2ELJ A;  4G94 A;  3ZP5 A;  2LKP A;  4E7Z A;  1SFU A;  2ISZ A;  5A2Q Z;  2R5Y A;  2NOJ B;  1T39 A;  1B8I B;  2E35 A;  3LMM A;  4HQM A;  2H6B A;  2BVL A;  3NQO A;  4EMS A;  2PN6 A;  3QAH A;  4EAT A;  2DA3 A;  1JHH A;  2WTE A;  1R71 A;  2MBF A;  1LPQ A;  1POG A;  2VOP A;  3D1N I;  2KP6 A;  5E8G A;  3F8N A;  2LMD A;  4Q5S F;  2OQG A;  1SMT A;  4CYC A;  4NDL A;  2W4S A;  4A12 A;  1FBU A;  2HZT A;  3BPX A;  3G3Z A;  2NAZ A;  2XGE A;  2OJE D;  5F1R A;  2JQ7 A;  4HF2 A;  2XPW A;  2WB1 N;  3ZMD A;  1XCV A;  2QQ9 A;  1DPR A;  5DV5 A;  5LBQ A;  1QA6 A;  5IOZ A;  4V19 K;  5D5W B;  1I50 J;  2L7F P;  1XSX A;  2ZME A;  5EEA A;  4A0X A;  3E97 A;  4HF1 A;  2HDD A;  2K9N A;  2AQE A;  2R7Z J;  1JTX A;  3OYJ A;  3K4M A;  3J81 K;  4UB8 C;  1RC9 A;  1J0R A;  3Q9S A;  3KPH A;  3P7N A;  2Y9Z A;  1WI3 A;  3AL0 B;  2LYC A;  1XMK A;  4GDF A;  4NNJ A;  3R4K A;  1BIB A;  2VE9 A;  1PUF B;  1ZRD A;  1T6S A;  2JMW A;  1XCB A;  3EUA A;  3EUH C;  3NAU A;  3CJT B;  3SZT A;  4ITV A;  3FK6 A;  5E3L A;  4E7K A;  4G12 A;  5E1X A;  1IXS B;  3HTU A;  1V54 H;  4KN4 X;  4U7D A;  1K4S A;  3HSE A;  2JA8 J;  1ZRF A;  1J75 A;  2DOE A;  2LF7 A;  3J7A Y;  2CUZ A;  2EB7 A;  2FF4 A;  3WTS C;  4JQF A;  2HZD A;  5KAI C;  1A6Q A;  2BY3 A;  5H2F C;  3AL0 C;  5ILV A;  2HYF A;  2EK5 A;  4UXN A;  3IP4 B;  1P2F A;  1XX5 A;  2CUJ A;  3DBR B;  3T0Y A;  4U0Y A;  3OYI A;  1TNT A;  1X58 A;  3VPR A;  4S05 A;  3WGI A;  2R93 J;  2M8E A;  3I71 A;  2IXS A;  2EA2 A;  1PUE E;  2Z33 A;  4I99 C;  2OUM A;  5GTH C;  4Y3O A;  1QZE A;  4RAF A;  3V8J A;  3JRG A;  2M1B A;  2XPV A;  2KIU A;  1OYY A;  4WXD A;  4C3J J;  1KQ0 A;  3K4C A;  2YUS A;  3BG3 A;  4LIU A;  2ICW G;  4XM3 A;  1AU7 A;  3GLL A;  3IL2 A;  5GAG J;  1ETK A;  1R23 A;  2JA5 J;  1ZG3 A;  2X1C A;  1WJD A;  4MQV A;  4M9S A;  5HDG A;  5J6X A;  2OTJ I;  2L5Q A;  5HLG A;  1OCO H;  2CO5 A;  3QWL A;  1FLI A;  2X9D A;  4PJJ A;  4LD5 A;  3PUF A;  4BL0 B;  1Z3Y A;  3CES A;  3BZK A;  4CH7 A;  3LAJ A;  2CS3 A;  3QOD A;  4ZYG A;  3BDD A;  1MJA A;  2HDC A;  1HOM A;  3VYS B;  4RGX A;  1D0Y A;  1TQI A;  2DQL A;  2XAJ A;  3KLN A;  1U8R A;  3LA2 A;  3KET A;  1TP4 A;  1ON2 A;  1S8N A;  4PJN A;  4R79 A;  4M3F A;  4HX7 A;  3WU0 A;  1R49 A;  4HLX A;  2YSR A;  3K69 A;  2X1E A;  2VJ5 A;  3K0L A;  4ASN A;  1IUY A;  2LBF B;  3P5J A;  2ID3 A;  4P9F A;  5DD4 A;  1ZR4 A;  2PMZ A;  5L3B A;  1MKM A;  4RB3 C;  5FLX K;  1AKH A;  4AD9 A;  2E1C A;  2QKM B;  1U5T A;  3KP2 A;  4KIS A;  1X19 A;  1QRY A;  2JZY A;  2XF5 A;  4FX0 A;  3V7S A;  4A3F J;  1J59 A;  2HQA A;  4Y17 A;  1CQT A;  2VOD A;  5EYR A;  4MEY F;  3PO2 J;  2OBP A;  3GW2 A;  2VQH A;  4ZDP A;  1YJN I;  4B4C A;  4ENN A;  3QP5 A;  1J5Y A;  4A3D J;  3FKJ A;  3LA7 A;  2BW3 A;  1IRF A;  3VSL A;  2UV1 A;  4U7B A;  2DDB A;  2O9L A;  3ASO H;  3Q0W A;  3TW7 A;  4KDP A;  2P8T A;  4RB1 A;  2CW8 A;  3OYK A;  1S3J A;  2EFP A;  3G71 I;  2DOF A;  2PBI A;  4C2M J;  3I4N J;  3L00 A;  3PO3 J;  4MNU A;  3MVP A;  2LC2 A;  2DBB A;  1YRN B;  1WZ2 A;  1WH7 A;  2A6E F;  1FZP B;  4O5V A;  4BNC A;  1V5F A;  2DTZ A;  2WV1 A;  4OIN F;  2BBY A;  4BQQ A;  2RGV A;  2R7W A;  5J4Y A;  3K70 D;  3HKZ N;  2V1U A;  3QU6 A;  5L3D A;  3DCF A;  2A69 F;  1RES A;  3H3U A;  3OYM A;  1T8I A;  1ODD A;  2MG4 A;  4Z2Y A;  4A3B J;  5LHG A;  2P7V B;  1MIJ A;  3BTI A;  2X0L A;  3D5L A;  1K7A A;  4UY8 I;  1W7P A;  2QBY A;  3A01 A;  4IL6 C;  2VBZ A;  3DKX A;  3V42 A;  4YFX F;  3S3N A;  1NK3 P;  3M3Y J;  2DCE A;  3PJR A;  3MKY B;  1R4M B;  3DF8 A;  2EV5 A;  2IA2 A;  2P6T A;  4YEJ A;  2VE8 A;  2IRF G;  3F8F A;  1JHF A;  5LGU A;  1O7L A;  3BOQ A;  1T38 A;  3AG1 H;  2LRD A;  3CJR B;  2TDX A;  2A5Y B;  2IGN A;  2B7E A;  2DYR H;  2M0C A;  3BP8 A;  4B43 A;  1Q1H A;  4CCL A;  3LSJ A;  2KRC A;  2K27 A;  4LG0 A;  3ZR8 X;  4LB6 B;  2JWT A;  2XVC A;  2GBY A;  3CZ6 A;  4MIM A;  3BG6 A;  2W00 A;  3OSG A;  2C6Y A;  4OMY A;  3M9A A;  1EKE A;  3KP3 A;  4XRF A;  1S6L A;  2XSD C;  1JT0 A;  2H8R A;  5FKK A;  2Y2Z A;  3UNG C;  3DTE A;  3M8E A;  4PSW A;  2NNY A;  3N97 A;  1ZLK A;  3JTH A;  2FX0 A;  2IT0 A;  1XG1 A;  1I27 A;  1GHC A;  2EZH A;  1BM9 A;  2FMY A;  1LE8 A;  1AKH B;  2ISY A;  4G9Y A;  1U5T B;  2HI3 A;  3K4B A;  1TW3 A;  3MD2 A;  4MLO A;  2KKO A;  4CCM A;  1JT6 A;  2IP2 A;  3K70 C;  3BWG A;  2E5N A;  1MMS A;  4HOB A;  4CCN A;  5L3F A;  4G6Q A;  3ELK A;  2IS6 A;  4HLY A;  1JUP A;  3H0G J;  2VBX A;  5D4R A;  1GLN A;  1MBJ A;  2EFN A;  2K7L A;  4M3E A;  2BW3 B;  4DBR A;  4HNU A;  1K78 B;  2E7W A;  3KYL A;  3C2G A;  5J8F A;  4HNV A;  3P9K A;  3FXK A; 
#chains in the Genus database with same CATH homology
 2KIS A;  2CQN A;  2KIQ A;  2KFD A;  2DOF A;  4FQG A;  2JUC A;  2K85 A;  2DOD A;  2KZG A;  2B7E A;  1UZC A;  2LKS A;  2E71 A;  2L9V A;  2DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...