1FOYA

The rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, minimized average structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN L11
publication title The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosome
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1foyA00
5DM7F 3G71I 2QA4I 5DM6F 3CMAI 2H8WA 3CCEI 4IOCF 4IO9F 3PIOF 2E34A 1VQMI 1VQ7I 5GAHJ 1YIJI 2OTJI 1YJ9I 1VQ9I 1VQNI 1VQPI 2K3FA 3CC7I 1VQ6I 3CC2I 1FOWA 2ZJQF 3G6EI 3CCUI 2NXNB 3DLLF 1YJWI 2JQ7A 1HC8A 1ACIA 1VQLI 1MMSA 3CJTB 1YJNI 3CCQI 3G4SI 2E35A 3CCLI 3PIPF 3I56I 5GADJ 1QA6A 2OTLI 1YI2I 2FOWA 3CD6I 4IOAF 3I55I 1S72I 3CCVI 1FOXA 3CC4I 3CF5F 3CCSI 3CCRI 1VQ4I 2ZJPF 5GAGJ 1YHQI 3CCMI 3CCJI 2QEXI 1VQ5I 4UY8I 4V19K 3CMEI 1VQOI 1Y39A 1YITI 2E36A 1VQ8I 3J7ZI 1FOYA 5JVGF 3J7YJ 1VQKI 5GAEJ 2ZJRF
chains in the Genus database with same CATH superfamily
5DM7F 1YE9A 2HVSA 5ICFA 2LH9A 2P81A 3TDZC 2COMA 3AFHA 4LGWA 3ERED 3QWLA 5GP9A 5J47A 3HOXJ 4XLPF 5LHGA 1O57A 1GHCA 3OYBA 2EQRA 1K6OA 2ECCA 2E2JJ 5F1RA 3E97A 1Y8QB 1HQCA 1M1EB 3KLOA 1JJ8C 4IHYA 2ZO4A 3HDDA 2W85A 2CGPA 3DQVC 2DLLA 2KZVA 2XGXA 3BR2A 4ZYGA 1X1BA 3D5SC 3JCUC 4BU2A 2DA2A 1VQLI 3QYBA 1JHHA 1GLNA 2DQRA 3IH3A 3HB9A 2DQLA 4PSWA 2CQQA 2R7SA 3LSJA 2HXOA 3EQLF 2FUG2 1I3QJ 3H5RA 3E0JB 5E3NA 4XSZF 3G1OA 2F5FA 5HS9A 3E6DA 1LDDA 2VIXA 2VJIA 3A03A 1ON1A 1BI2A 3GFIA 3IP4B 1PUEE 1T56A 3BC8A 3PNTA 5M5WJ 4EM1A 1WJAA 3FM3A 4HQMA 4C2TA 3OL3A 2E1CA 2EJRA 5ICGA 4KYWA 2JK3A 2DCEA 3TW6A 2EIJH 1JUSA 3NQOA 1Z3YA 1MJ9A 3KEYA 1FJLA 2DYSH 4HBLA 3ZXSA 2JSCA 3OYLA 2Z99A 2RAEA 1MBEA 5H2FC 2RV8A 4BY7J 1Y56A 3ZR8X 4BBRJ 2CQ7A 1W36C 2DTRA 2EINH 3AG4H 3CF5F 1AA7A 2IXSA 4I01A 3WG7H 2LF7A 1DQUA 1EH8A 2M34A 3GZ6A 3HRMA 3V8KA 1NTCA 1D3YA 2XIGA 2XUBA 4BE0A 1LFBA 2M2EA 1SAXA 4BHPA 4JOMA 3VB2A 3CCJI 4Y4RA 4UB8C 3EUKL 4QPOA 3LSRA 1IDYA 5IYDJ 2EK5A 2OAZA 1RR8C 1ONVA 3BR3A 2YX7A 2L7MP 3GBGA 1YITI 1JHFA 3HOVJ 2ECBA 3AG3H 1BOAA 2GOXB 2IGKA 1RIOH 1O3SA 3CJNA 2EZIA 4LJZF 2W1OA 1OCPA 4J01A 4P96A 5FD5A 2FE3A 3HXLA 2QBYA 4Q5SF 2EZKA 4F52A 5FKOA 3MEXA 3KETA 4KISA 1U9NA 2ZJRF 5IOYA 3BG5A 2FX0A 5EGOB 5GPCA 4EQQA 1UHMA 4XRFA 4IOCF 5C4JJ 2WTEA 4IO9F 2E1NA 2RQPA 2V1DA 4PJ0C 3DV8A 2E34A 2R5YB 4EGYA 1XSXA 4DIQA 5JLWA 3CO7C 3FK6A 2AXTC 5J1UA 3OYEA 3ZGKA 1CQTA 1IN7A 1WGXA 4ZYDA 3S32A 3KX2A 2X4HA 1X19A 1IJWC 2CFXA 1LDJA 5TJJA 2L54A 3V8JA 4D5CA 1MBGA 4EVIA 3DPTA 1XB4A 1HOMA 1B72B 1RKWA 3LL7A 1JI8A 2KRHA 3DEWA 1HW5A 3F21A 1LEAA 2LKXA 1H9GA 3ULQB 3J7AO 4PJJA 3BPVA 4S05A 4XICA 2QWWA 3K69A 5ILSA 4C30A 4NB5A 3Q3SA 4QLCU 2QZ8A 4RB2C 4J19A 3SHFA 1REPC 1TC3C 2UWMA 2HWVA 3CD6I 2W25A 2ADUA 1UAAA 2IA2A 3H3UA 2DOFA 3G1LA 2V7FA 2DW4A 3I53A 3SQNA 2R5ZB 2R0QC 4A12A 1U78A 2FMLA 3KIOA 4OIRF 4BJ5C 4AIJA 3RQIA 4RM2A 1S29A 3QP6A 4RM3A 4MFDA 2ID3A 2Z16A 2R7WA 5EYRA 3E1SA 4W97A 2PX9A 1TQPA 3OWTA 1L0OC 5D4RA 3GTGJ 3K4BA 4EEFG 3TP3A 2FSWA 2DA1A 5TISC 1O4XA 5LEKA 4XIDA 1PDNC 4F55A 3ZMUA 1FWZA 2NOJB 4AYBN 3GEZA 4WF2A 1X3ZB 3AL0B 3MVPA 5BNGA 2FQ3A 1V54H 1IGNA 4ENMA 3CUQB 4EATA 3QRFF 2XC7A 5ILUA 4ZTJA 3K4MA 3JSPA 2HEOA 2DA4A 1JTXA 2MH2A 2QQ8A 3BR1A 3FIWA 3KEQA 2PBIA 2Q2EA 2UXXA 4BHBA 2FJ1A 1G3SA 5HS8A 3ASOH 4ZZDA 5LBQA 4PGHA 1X3WB 2ZXIA 3GW2A 2DA5A 1A35A 4CCOA 2KL4A 5GAEJ 5KAIC 3NARA 3S3OA 1OCCH 2FRHA 3CJRB 3GFJA 1WH7A 1L3LA 5E8GA 1RRJA 1FNNA 1G8XA 4LOCA 2V1UA 4JP0A 2YSRA 2LK2A 2W48A 3K1MA 2JRMA 3TBIA 2A6HF 2KLOA 1MMDA 1VQMI 2JN6A 4NUBA 2J5OA 2K7LA 3L2QA 3WHBA 2XPUA 1SD4A 2A69F 4LLGF 4M6VA 2NS7A 2XGDA 4ITVA 3KYLA 2JA6J 2OPTA 4PCQA 3LWFA 3G6EI 2Q0OA 4E6KG 4RB1A 3R0JA 2ZXJA 4LIVA 2OCEA 4HNUA 1TNTA 2X6XA 3AL0C 1BL0A 2DT6A 3W2WA 2DBBA 4D0PA 2LDUA 3BR5A 4ON0A 5B66C 3J7AY 3KPHA 2F5EA 1GDTA 5DCMA 2GA2A 3L2CA 1YG2A 2P4WA 3CUQC 1XDUA 2CG4A 4IEJA 5B1BH 4A3MJ 3WTZA 4UXNA 4R8HA 1XX5A 3ELKA 2K9SA 2V79A 3ZPLA 1Z7LA 1FBSA 2UUZA 5J3LA 1QA6A 5TRDA 1XTAA 5L3BA 4G6TB 4KIFA 2LMDA 1N77A 4HA8A 4Z6YA 1FC3A 1V5GA 2A05A 4I98B 3I9V2 1VF9A 4CYDA 3W6KB 3A2KA 2BXYA 1FTZA 2ZMEA 5JHUA 3ECHA 4DYQA 1BI3A 4CCJA 4DZPA 2JA5J 3CTAA 3Q0VA 2IEKA 4OAYA 1T0FA 2EH3A 1TW3A 3MZYA 2RGVA 3O6BB 3LSTA 5TGTA 1G4DA 1TT0A 4RA2A 2K85A 4N4OB 4LB6B 4HF0A 2DFEA 1R5ID 2Y69H 1A04A 4BACA 3WGGA 1K7AA 4NHJA 2O0YA 3K4KA 1GXPA 2W82A 2NVUB 1ETYA 4GYGA 1QZYA 3DTEA 3IHUA 3ABKH 3T5XA 3LQRA 1GV2A 1SEUA 4DYCA 3FBNB 3W6VA 3CCYA 1K78B 2E5ZA 2BY3A 4Y33A 4HLYA 1QPIA 3SEQA 2HU9A 3KP7A 2R7TA 4KT6A 3IL2A 3G71I 2A6EF 3CMAI 1P9QC 3HC7A 2VN2A 5FRNA 2BYVE 4OAZA 1YIJI 1V4RA 3M8FA 3Q9SA 1VQNI 4KNYA 3GXOA 4UVBA 3PQKA 3CC7I 1WWXA 3TP0A 3CC2I 1X1DA 5HVQC 2ELHA 3L09A 3S2WA 5J1RA 3O8GA 1T8IA 3G2BA 1LQ1A 2GXBA 2W24A 2W7NA 4RGRA 1ERDA 1P4AA 5FGMA 5DEQA 1E3OC 2AHQA 3C7JA 3BY6A 3WU0A 2KJCA 4YFXF 3Q5FA 3CCQI 2CUFA 3T0YA 4EJOA 4W1UA 3TW7A 3OYIA 2YU9J 2FXAA 3BOQA 3JRHA 1FYMA 2RN7A 1ZQ3P 2W57A 3F8CA 2DDBA 2TCTA 3BG9A 5K7HA 2FA5A 2DT7B 2VLAA 4B43A 1LE8B 5B5EC 2L9NA 3DKYA 4V2FA 2WY8Q 5L3FA 1W1WE 2STTA 3S2HJ 3GFLA 3NWSA 3TOAA 5E1XA 4HW0A 2PMHA 3HSEA 1ETKA 2H09A 1WRJA 2P7CB 3QPSA 5EEHA 2ID6A 2M0MA 4GXOA 3KLNA 1IAWA 3DPUA 4IHTA 2F4OB 3SFZA 2JVGA 2HOSA 1U6GA 5GAGJ 1JUMA 2CV1A 5CVRA 3VYUB 1MDMA 1P4XA 5E1ZB 1MBJA 3QOEA 3G73A 2NVYJ 1KU7A 2F4IA 3SFIA 4A0XA 1Z7UA 3BR0A 4HRIA 4IL6C 4MQ9F 4XLNF 1LNWA 1KQ8A 1RUNA 1RZ4A 2BE5F 1FOYA 3RPQA 4XORA 4IQJA 3HBLA 3VPRA 1JT6A 3MAJA 5LLQA 1R7JA 4BQOA 2A61A 3VYRB 1Y1WJ 4L0ZB 3HOZJ 3P9KA 3Q9VA 1ZGJA 2V6EA 2RDPA 3BCAA 3S3NA 5FJ8J 2HKXA 4NC8A 4HAMA 3OYKA 1XGMA 5HLGA 2VQGA 3ZQ7A 1OCZH 1IRZA 3U1DA 2WAQA 3PL8A 1EH7A 3QQAA 1IN8A 1RETA 2LFBA 3V7RA 1B8IA 5CVJA 2WC2A 3TDUC 3BCBA 1J59A 1IUFA 2GBYA 5F0FA 3JAMZ 2M7BA 4CZZA 3H0GJ 4A6EA 2ZJQF 2HDDA 4WCGA 1BW6A 3KEOA 2VI6A 1JXSA 1JTYA 5CVVA 2QKMB 3JREA 2HOTA 2X6WA 1SMTA 3K7AJ 2HVRA 1FTTA 4GCVA 2EZLA 2XF5A 3CJQB 3OS1A 2E1OA 1YX5A 3IWZA 2IS6A 2M9HA 2WBMA 3H3VK 1E3HA 4BE1A 2O03A 4RAGA 2Y9YA 2KISA 3E7LA 5HLHA 4ZYAA 1XC5A 1I1SA 2BOLA 4LG0A 2EIKH 3S8PA 3D5LA 2HXIA 1MMGA 4XRSA 4LLLA 3F8BA 5BMZA 1HKSA 3COAC 1XMKA 3JRIA 2VUMJ 2MSYA 3GTQJ 4G7HF 2EA2A 1V5FA 1DP7P 3CCVI 3SJMA 1R00A 2MA3A 3CQZJ 4HEA2 3VEPA 2X48A 2IBDA 4HF2A 4GGGA 4BJTA 5FROA 2YPRA 1BM9A 3L2VA 3NWTA 3Q0UA 2GXAA 3UKGA 2L0KA 2ZNYA 4E7JA 1DPRA 1SVMA 3KCCA 1MSFC 2E5NA 1PP8F 3HUGA 1E0EA 1ZR4A 1R6RA 1T6SA 3O3KA 1W5CC 1OYYA 3DU5A 3FWEA 5FO5A 1RC9A 3HEFA 3ML6A 1TT5B 2V1XA 4ESJA 2HOEA 2QEXI 3WU1B 3EUHA 1UJ8A 2XGCA 4EJTA 1IN5A 1W5SA 4GO1A 3REOA 2UV1A 1WJ5A 1YTYA 2KT0A 1ZGWA 3S17J 3I4PA 2EILH 1LEBA 1R49A 1LDKB 2HVQA 4AWXB 4RGSA 1FIAA 2NRAC 5LRRA 4OIOF 2R7UA 2M5WA 1W5TA 4ZYHA 2P6SA 2K9QA 3GMEA 3S3MA 3RKYA 3NAUA 3IKTA 3PO2J 2M0CA 2FNPA 1E3PA 1IZ1A 2BBYA 3WGHA 4OINF 2STWA 4LLNA 4LK0F 1J75A 2F48A 1B1BA 3U21A 4WXCA 2O61A 3P5JA 3RKXA 2GOMA 1VQ9I 3KP3A 1QQIA 2MD0A 2HDCA 1F5TA 1ZN2A 2VKDA 4PK4A 2KJBA 2CQNA 5KCMA 3CCUI 4X1EA 4M9SA 3HOSA 2LSOA 4Q48A 3Q0WA 1QBJA 3T8RA 2DJNA 3ZQIA 1JKPC 1V55H 3SZGA 4BBSJ 4XKWA 4I0BA 2KIMA 3BPXA 1Z77A 3K70D 4XQFA 1WVRA 2QVOA 1E2XA 2Q8KA 2DODA 3FK7A 1LFPA 3MKLA 4PGGA 1ENHA 4XKVA 1X58A 3OL4A 4FX0A 4UUSA 1QZEA 2G9WA 3BG7A 3DWLE 4L9TA 4LG3A 4B8XA 1W7PD 3FF5A 4IOAF 3QYFA 4ANJA 2HYFA 4A3EJ 5C44J 4II2A 2AS5F 5E18F 2VJ4A 1D1AA 1R9TJ 1WHUA 1WPKA 1HSJA 2ZXWH 2DA7A 2OCCH 2OUMA 2CUEA 4JQFA 2WV1A 5D5XB 3M1CA 1YLFA 1MJBA 3C2HA 3LMMA 3SDGA 5HNHA 3DFGA 1Y8RB 2NVXJ 2O8XA 2A6TA 3OYAA 1CF7A 3V7SA 2NYXA 1H8AC 3PO3J 2LY1A 3NEUA 1ZR2A 3E3VA 2KKOA 2K3PA 2MBFA 3U9GA 1UG2A 2GA1A 5FLMJ 4L9NA 4A0YA 1JKRC 2ZC2A 4BXUA 1AWCA 1KU3A 4H0EA 2X6YA 3ECOA 1MGTA 1OCRH 1UB9A 2K9NA 4HX4A 5J1YA 3QYEA 2ESNA 4OWRB 1JJ6C 2NS8A 2XAHA 1BC8C 1QGPA 2JTVA 2P7VB 4BEHB 1X4OA 2I8DA 4L5JA 4ENJA 2XB0X 1ZRFA 4RB0A 2NVTJ 3E6CC 1W4MA 3RYPA 4IQ4A 4ESBA 3HTSB 1OCOH 2R4GA 1BIBA 2F4MB 3OIPA 3RTRA 3L2WA 5CPRB 1V5EA 5L3EA 1R71A 4RDUA 4B09A 2OTJI 4HX8A 4FE7A 4B47A 4U0VA 1OR7C 5J4YA 5DV5A 2R7QA 2KIQA 2B7EA 1D0ZA 2DMUA 4BDYA 5HODA 2YU3A 4F7ZA 1C0WA 4WXHA 2I5UA 2TRTA 3DTKA 2BHZA 3MFKA 3HTUA 1HC8A 1I39A 4G7OF 1LVKA 2XVCA 3K4CA 3PUBA 3V8LA 3ZQFA 2OU2A 1MMSA 4XKBA 3HRUA 4CYCA 3OV8A 4DZJA 5K7ZA 1QU3A 3V42A 2KFDA 1RESA 1QRYA 1SFOJ 3J81Z 2UZKA 3ZP5A 4A3CJ 4I0AA 4OIPF 3WE2A 4R1HA 3F0CA 3QP5A 3OYNA 4CHUA 2DA3A 2OBPA 2K02A 1YI2I 1TNSA 5AIPA 1W7PB 3AG2H 4FX4A 3H0DA 2DFHA 3J81K 2M45A 3ZN0A 3K0LA 3OS0A 3LAPA 3BTJA 2G0EA 1ZH5A 1TW2A 1WH5A 4IX7A 3CC4I 1FZPB 3VYSB 3IAM2 3RZOJ 5GTIC 4HX7A 1N25A 5DD4A 1MNEA 3K2AA 3S93A 1DGWY 1NG6A 3K4LA 4JX4A 3IC7A 1SFUA 2V9VA 1Y1VJ 1QVUA 4OMZA 2XRNA 4A3IJ 4QTRA 1F43A 3TL4X 5LGTA 2D2WA 3VSLA 2HGCA 2LYCA 1NK2P 2HZTA 1UFMA 4D1QA 1IN4A 4RAZA 3EYYA 3I4NJ 1GT0C 1VQOI 2VB6A 3R60A 2Z1DA 2ZMEB 3HOTA 4A3KJ 1QZZA 1CGPA 1FOXA 1WJBA 2OQGA 2VT2A 2PJRA 1S6LA 3LAJA 2XSDC 3UNGC 2XAGA 2IT0A 2H6CA 1R1TA 3O8HA 3K70C 1TQIA 3LSMA 1D5VA 3GWZA 1R58A 2A68F 2CQKA 4M9ZA 2QUFA 1JE8A 4CH7A 3PFIA 2V9PA 2WAFA 4BHCA 3FHZA 3FXRA 2QA4I 2E7WA 5M3FJ 4FQGA 2H8WA 3CCEI 3WHCA 1MKMA 3F8NA 2M87A 1UELB 5KK1A 2VKEA 4Y3OA 2QQ9A 5KVRA 2BY2A 2ME0A 3AG1H 2DN0A 3CF2A 1VFCA 3MKWB 3OOPA 3ZMSA 4A3DJ 1MJAA 3ZMDA 5BS6A 2KDOA 4G6QA 4F92B 3J80Z 1ETQA 2VBXA 3SYTA 4A3LJ 2ZCWA 1IUYA 3V7CA 1R5GA 2JMWA 3CP8A 4G12A 2DDAA 5D6FA 1EH6A 2DA6A 1HW2A 1I27A 1KQ9A 2ZMEC 5E17F 3WTXC 1D1BA 3P9CA 4GYIA 1SFEA 4KN7X 2PQ8A 3J80K 4MFEA 5EDNA 3QOPA 4EMSA 4E7SA 4LITA 1BW5A 1ON2A 3W2VA 1MD0A 2BVLA 1T0FC 3ZQCA 4E7IA 2R7DA 4CCMA 3HIFA 5F04A 4YIRX 2LTPA 5DYMA 2OQRA 2FOWA 4BNCA 3HPHA 4Y15A 2P8TA 4R79A 4HQEA 1YS6A 3GLXA 1RKTA 1HF0A 3M4OJ 1G6NA 1KA8A 3QPLA 4N0BA 4CSWA 2Y0SN 4N4NB 3RSNA 2VBYA 4EJWA 1R4MB 2D45A 3HG9A 2F5VA 4D9JA 2R5YA 2JT1A 3U2RA 2IGMA 4CDGA 1WJEA 2LY9A 3H1CA 3D0SA 5CVIA 4ZYEA 1Z3XA 1K6YA 3KZYA 3PSFA 1S5LC 1UZCA 2IW5A 4HOBA 1VZ0A 3UR3C 5K5OA 1YW7A 3CDHA 4KITB 4XLCA 3DBHB 3VWBA 1FSEA 1TTYA 5LFAA 4LK1F 2EWNA 3GTLJ 4A93J 4YFKF 2MC4A 1DGRM 5D4SA 4F93B 2GM4A 1B72A 3LA7A 4RMNA 2VQLA 2XPWA 1IC8A 3I64A 3VSKA 1KYWA 2VPRA 4HF1A 3ISPA 1IRXA 4KIBA 3I71A 4O3MA 3GTKJ 4RAYA 2HKOA 5D8LB 1K4SA 2IP2A 3SZPA 3DPLC 2BZTA 5F6FA 3U1KA 4Q47A 1YX3A 4C2UA 1JKQC 1ETOA 5M3MJ 4IHVA 2IVMA 1FMVA 3OR1C 4V2GA 4XRMA 3JRDA 2Y9ZA 4ZTFA 3PSIA 1QNTA 2GQQA 3H92A 3R61A 5F0CA 4YIIA 3K4JA 3RIRA 2QSGX 2JA8J 2B0LA 3OR2C 1A6IA 5FKMA 2Z3YA 3JTHA 1MMNA 1NK3P 2ISZA 1FBUA 1ZAOA 4AU7A 4GDFA 3A0BC 3DU6A 5FKNA 4DBRA 1I6HJ 3DP7A 5CQEA 1D8KA 3PUFA 2FNAA 2X85A 3OMYA 1P92A 2H94A 4X0GA 2NOGA 3K9TA 2CS3A 2EPFA 1Q1VA 2EZHA 4DNCA 5CKTA 1UHSA 1ZLKA 3E5QA 2Y2ZA 2Y48A 2COBA 1HA8A 2BW3B 1J9IA 2O6GE 1H0MA 2PI0A 3DBLB 2D1VA 3A02A 4FHTA 4CICA 4AIHA 4MEYF 1B8IB 1FT9A 4XSXF 2ME6A 4AYBA 3CUQA 4UV8A 4G8XA 5CQGA 1TL8A 1G2HA 5CVUA 2E2IJ 2WAEA 4IVNA 1QPMA 3PIPF 3KP2A 2ESHA 1WJCA 3IUOA 2DPDA 3FMSA 2DOAA 2HQ5A 2QENA 3KYCB 4LMYA 4XMYA 4M9XA 1G3YA 1MZBA 3DLAA 3VYTB 3JRFA 3JRAA 4JBAA 1UG0A 4MTDA 5JI6A 1BBYA 2MGQA 2IGOA 1D0YA 2ZSIB 2DFIA 3BJOA 3KP5A 5AIQA 3ABMH 3DKWA 3TGNA 1O7LA 4X6AJ 3OIQA 4L5EA 1TWHJ 1S72I 4ASNA 4HZFA 4AVZA 2E1MB 5LEJA 3RI4A 3JSOA 2Y75A 3FM5A 5F0HA 1TQMA 3FXQA 1S8NA 1S7EA 2V9KA 4PZJA 1LFUP 1WSUA 4LG0B 4IHWA 3W2AA 3EYIA 3S1NJ 2QGUA 3ZRGA 4AD9A 3HGGA 3WTVC 2P5KA 5C3EJ 1ZGAA 2YX4A 4NC7A 2ZJPF 2ACJA 4D7MA 2RVCA 3K1PA 3LSIA 2YUSA 3H5NA 2Y0MA 1YHQI 1ODDA 4LFUA 4XLEA 1O3RA 3KZZA 1NG7A 1JKOC 3ZMZA 1Y0NA 2IAIA 4BJ6C 4ZC3A 2E19A 1IXSB 2CJJA 3A4CA 5HDGA 2XPVA 2H6BA 5D8KB 1Y39A 3LNQA 5L3CA 1TZLA 2XAJA 1X1PA 4BE2A 1T98A 1N75A 4PJMA 3WE3A 1D0XA 4IXAA 3HL2A 3KYDB 2FU4A 3I59A 1VQKI 5GTHC 2EBIA 1XMXA 2DMQA 1N78A 2P5VA 5KAFC 4BAYA 2NAZA 2MD5A 3QAHA 2IS1A 2L3DA 3R6SA 5IYCJ 5HDNA 2M4GA 4XLAA 2JZYA 1Y0UA 3H35A 3RYRA 1ULYA 2WV0A 3BDDA 5E3OA 1R22A 1OQYA 3CUOA 5F1JA 2N8GA 2QSFX 2O7OA 2EFOA 5LRSA 2EFWA 4L9JA 2W84A 2E1MC 2VC0A 3LFUA 3LQQA 2HR3A 3F6OA 4QWQA 5IT9Z 3I58A 4S0HB 4DW6A 1FIPA 2V4JC 1LPQA 3V4GA 4HV5A 2MLGA 2IA0A 2VKHA 3TOBA 1FOWA 3IAS2 2PMUA 1PUFB 1OMIA 2XKOA 3HKZA 3H5AA 5EEGA 1ZYRF 1XDSA 4PJLA 4ABZA 3DF8A 4QSHA 4JX6A 1ACIA 1S7AA 1XGSA 1J09A 3F72A 3CJTB 5IY5H 2VPLA 3IRQA 2VKVA 5JVTA 1DPUA 1BN5A 1BJAA 2MW8A 4BL0B 4LIUA 4U0YA 2HTSA 2ZBKA 3F3XA 3N05A 4DQ2A 1TWGJ 3CCLI 2XB5A 5JR3A 2D5VA 5EF6A 1ZG3A 2X6OA 2YS9A 3GX4X 5D5UB 2XGEA 2F2EA 5J6XA 5ILVA 3FXOA 1K78A 1SD7A 1S3JA 2JJ7A 4P9UA 4MEXF 1SD6A 1Q1HA 2BHYA 2CMPA 3BR6A 5DUKA 1RR7A 4FT8A 1BI0A 1BR1A 2LR8A 4A3FJ 1AKHA 2W00A 5IP9J 2IJLA 3X2QH 3JAMK 2ZNZA 2BVMA 2DAOA 1YO5C 4RB3C 2EFQA 1TBXA 4XL9A 5ERIA 5DTDA 4BKXA 5IYBJ 2FOKA 4U7BA 1IDZA 3BZCA 2XF7A 3LOCA 4ZDLA 3L2UA 1T95A 2M30A 2LKPA 2MC3A 1X2MA 2EB7A 2ZFWA 3ASNH 2QKLB 4ETSA 2AQFA 4C3JJ 4L18B 1TWCJ 4XRSG 2DT5A 1YRNA 4FISA 1FX7A 4FETA 1BR2A 4EM0B 2KZGA 4UY8I 2V26A 3I4MJ 1PVEA 2B63J 4PFPA 1PP7U 4XN3A 2E36A 1FY7A 2R7RA 1F4KA 4TV7A 3OSFA 2LBFA 1IW7F 1MH4A 3FXLA 3G1MA 1XSVA 2XROA 5JVGF 3J7YJ 2GIVA 4NQWA 1F36A 1XD7A 4UVAA 1H89C 5E8IA 4XLHA 3L2RA 4BH9A 4I99C 4BGDA 1JUPA 3ESWB 3FXJA 2AQEA 3EETA 2GLOA 3EDPA 5EZGA 2GIZA 2Z2SB 2H1LA 1LE8A 4XR6A 1MBKA 3D1NI 4M3EA 3IH2A 3A01A 5C4XJ 3VFZA 3MMYB 4KJZA 2KPMA 3LSPA 1VTNC 4CXFA 3HYIA 4A3JJ 1OJLA 4I2OA 5EG0A 1X4PA 4G9YA 3JRCA 3WTUC 2VC1A 2E7XA 2CU7A 3F22A 4LB5A 2EFPA 1T08B 4G6DA 3CESA 2K27A 1ZK8A 3F8FA 3K10A 3ZQLA 1VQPI 1SD5A 3HRSA 2L7ZA 1YFHA 3JRBA 5HOOA 1J5YA 2PMZA 1XGOA 4BXFA 4HNTA 3HM5A 3TO9A 2RNJA 4XNFA 4CZCA 5L3GA 1KQ0A 4RLFA 1K4TA 2ICWG 1D5YA 2OZ6A 4MNUA 4FASD 5K5QA 3MN2A 4EJUA 3RQ4A 1KYZA 2FBIA 3CLOA 2BGCA 3G4SI 2QBYB 3WTYC 1WI9A 1WFXA 4YFNF 5LD2C 3KP4A 3M8EA 4B4CA 4CA0A 1J0RA 1FYKA 3CO6C 1UHWA 5IT3A 1R4NB 1B59A 1SVOA 4KMUX 2HQRA 3GTJJ 3S15J 1ZELA 4CYCB 1USTA 4ZH4F 2QLZA 2W4SA 2Y31A 4M3BA 3F8MA 3TO6A 1H88C 3CLQA 5DD8A 4C3IJ 5DDGA 4L9VA 4PUSA 4AIKA 3JR9A 3G3ZA 3C2BA 5LHIA 1BIAA 2O9LA 2XRLA 3N4MA 5LHHA 5A2QZ 3B73A 4CUGA 4HPQA 4U7DA 1J7KA 2EV5A 1B9MA 1U5TA 2ZJ2A 1OYWA 3H9QA 3M07A 1Z91A 2BY0A 4F3QA 2CO5A 1R5HA 5A2QK 5FLVA 1XCBA 2X1CA 3FHNA 2PJPA 4BQQA 3R0AA 3VDXA 2OZUA 4V19K 3SEZA 2CFOA 4M72A 2LVSA 1TP4A 1VI0A 1G3TA 4N9HA 3GYHX 4L0YB 2QF7A 2K5CA 4HNVA 1YQAA 2X9DA 1HKTA 3IKVA 3ABUA 1T2KA 2CUJA 4E7LA 4YEJA 5D5WB 1LB2A 4OIQF 1FMWA 3OS2A 4J00A 1I1GA 1IO2A 3FKIJ 4MO7A 2PJRB 4HDVA 3VODA 1LUJB 5DM6F 1PYVA 2X51A 1X1CA 3DCFA 3GVAA 4FCYA 2M8GX 5HS7A 4B3XA 1FSHA 3F9KA 1EKEA 2MABA 1VQ7I 3M9AA 2L7FP 2WB1A 4A0ZA 3QU6A 4KIGA 3P7NA 4PSXA 3GTOJ 2HDWA 1SC7A 3BG3A 4HDUA 2CW7A 2DMNA 2ELKA 5E79C 3H9GA 4L5IA 1ITYA 2GAUA 2L4AA 4A69C 2CH0A 2NVQJ 2LRDA 3SZTA 4MIMA 4M6YA 3IWFA 2HOAA 2BXZA 5EEAA 1YS7A 3GZ5A 5H6QA 2Q2EB 2L02A 3E5UA 2FBHA 2XSJC 2FD5A 3HHGA 2H27A 2XAUA 3BTIA 1XCVA 1MNMC 4IHXA 2F5CA 3TEDA 2KMUA 4MTEA 4XBFA 1BC7C 4IRIA 3LSGA 5E20A 3ZN1A 4G7ZF 1BOBA 3HSFA 1ZREA 2QSHX 2ZFUA 4U87A 3OYMA 2TDXA 4RBOA 3OSGA 1ZARA 1RUOA 5IP7J 2LKSA 3I3LA 4IKFA 3EUAA 1KZHA 4ZJZA 3R4KA 1E17A 1Z9CA 2E60A 3MD2A 3PJRA 4PFOA 5BOXA 1IRGA 1DUXC 2JVHA 2QCOA 1B9NA 1OPCA 5IOZA 3CCSI 3O2PE 3RJPA 1B6AA 1BJZA 3CCRI 1HBXG 1VQ4I 2CV0A 2LREA 4K2EA 4Z2YA 3HOYJ 2KIUA 3DTIA 4C3HJ 3FDYA 1JGGA 3DEEA 4A5NA 2KIFA 4DBQA 2NNNA 3JRGA 2DI3A 5DCMB 3TMOA 2R7FA 1X2NA 3CMEI 4IHSA 2R7ZJ 4KN4X 2MFZA 2LF8A 1XG1A 1YOVB 3H3ZA 2CRGA 4IRGA 3CMMA 3DXJF 2VOPA 4U88A 1U9OA 1EJ9A 2VL8A 2B9SA 2WWYA 2VT3A 1T33A 4E7HA 4Y13A 2RC4A 1OLTA 2KRFA 3L1PA 1WJDA 2VXZA 4XN0A 2J5PA 2ZSHB 3ZQQA 5GPAA 1IG7A 1FPQA 3WG9A 2L9VA 4IZZA 4HLXA 3GLLA 3A0HC 1I50J 4NDLA 4XM3A 5M5YJ 2FQ4A 1UCRA 4M74A 3FISA 3C2GA 2LNBA 1HW1A 1RNLA 2OF7A 3FXUA 2H1KA 4M71A 2HZDA 1GVDA 1ZLJA 3ERMA 3L9FA 3ZOBA 4RAFA 5KHDA 5GAHJ 4EM2A 4MLOA 3BJAA 2G7HA 1YJ9I 1GV5A 2DK5A 4A3GJ 2P5LC 1K83J 1OR7A 4HV6A 3RPUA 1JT0A 2PFBA 2EIMH 1ETXA 2MYSA 3CZ6A 3HOWJ 4BXXJ 1Z05A 5D6EA 2NXNB 3WU2C 3K1NA 3WTWC 4P9FA 4NNJA 2KDZA 1DDNA 1U0JA 3ABLH 2IPQX 2E2HJ 2BEOA 3HOUJ 2L7KA 4IPAA 2DK8A 3RKQA 1FOKA 2PLYA 5DCFA 4DYRA 3GTPJ 4IRHA 1ZG5A 4DOZA 1HKQA 2CV2A 1D8JA 4JYKA 2OV7A 4OU0A 5AONA 4UB6C 4PJNA 2RREA 3S1RJ 3AAFA 4ZZLA 3M3YJ 4E70A 1MW7A 1ZG1A 1T39A 2OTLI 1USSA 2Y30A 4UV9A 3CP2A 4BEHA 3MKZA 1MNDA 4OOIA 2R7XA 4BQAA 5CLSA 3CDLA 4F91B 2EFNA 3T8TA 4CCLA 2X1DA 4YRVA 3BJ6A 2K9LA 2M1BA 4HSRA 3D5RC 4XOPA 5H6RA 2OD5A 1IV8A 4C9YA 3OYFA 2L2OA 3GCMA 4RGXA 4NC6A 4XK4A 2LLKA 2VBZA 3HHHA 1Z21A 2EV0A 4A6DA 4XONA 2QM3A 1P7JA 2DTZA 5K7FA 1R1VA 3ZCOA 5HNFA 2R93J 5BPDA 1Z67A 1I3AA 1SFKA 4MGRA 2X1EA 4AUXA 1LJ9A 4E7KA 2H8RA 2OA4A 1OISA 3TKYA 1TLHB 1KU2A 3LA2A 3L7WA 5B3SH 5IP6A 3AKZA 3PQJA 3CCMI 4II3A 1HCRA 1VQ5I 2CSOA 2O8KA 3C18A 4XOTA 3KFWX 3QPTA 2WADA 2GWRA 5EGOA 5K1YA 1A6QA 1YW9A 2CYYA 3FZVA 4G94A 3M7GA 3J7ZI 1W0UA 2DYRH 3OIOA 4FE4A 4KDPA 1O7FA 1PJRA 2L01A 4BQNA 1NH3A 2IRFG 3OYHA 5E1WA 1KU9A 2M4KA 2O5RA 1ETVA 3KE2A 5KNLA 3MKYB 1A36A 3BWGA 2GXGA 2WY7Q 1YYVA 3JTGA 1ZRDA 2JA2A 4O6JA 1H9TA 1DU0A 1WZ2A 1U8BA 3ONQA 1W7PA 2RKHA 2HI3A 4M73A 5LGUA 5F08A 6PAXA 4UUTA 4Y7NJ 3I59B 4B44A 2EA4A 2L9RA 1G59A 4UHTA 1A5JA 2FF4A 4M3GA 2JSPA 4O5VA 2VJ5A 3HGYA 4YG2F 1X3UA 1X1AA 2XDVA 1IRFA 3FX3A 1GVJA 1MDMB 1B4AA 5CYVA 3MWMA 4KFCA 1GUUA 3F23A 4ZDPA 2F5DA 3OYCA 3GF2A 2O3FA 3BT9A 2MH9A 3HPGA 5ED4A 4I02A 3B6AA 4AVPA 3JW4A 2DPUA 3B02A 3M1EA 5E3MA 3RDIA 5EZHA 1D1CA 2FBKA 2R3SA 1Y6IA 2WA0A 2M7AA 3E6MA 1YJNI 3K6GA 1KONA 3GUDA 4LD5A 2JPCA 4B48A 2K9MA 2P6TA 1POGA 3HKZN 1XN7A 2R5ZA 2E35A 2JWTA 4H4KC 1R23A 1EV7A 5JFRA 3HRTA 3I56I 1HXDA 4AC0A 2R7VA 4EV0A 5CJ9A 4KUMA 5EJCA 2QQBA 2WAQN 1BR4A 3I55I 1ZRCA 1WQ2A 2EV6A 2F6CA 2GZWA 5B1AH 2K40A 1HDPA 3FBIB 3MZHA 3K2ZA 1ETWA 1A31A 4Q4ZF 4WXDA 3ZQHA 4ZDOA 3BLYA 2ZB9A 3KZIC 2AO9A 1P7IA 4BYYA 1YW8A 2NNYA 5HDKA 4CCKA 1VNDA 3MQ0A 4CO8A 2VXDA 3P9IA 3B6CA 2MLKA 4WK8F 3QU3A 1FBQA 3S16J 1AKHB 4JK1X 2VE8A 2R92J 1QVTA 1T38A 4ENKA 2ISYA 4I76A 4B1RA 2K4BA 2XF6A 2V6CA 1NHAA 5ICCA 2LD5A 4M3FA 3OYDA 1XMAA 1SVLA 2UXNA 1OYIA 4NBQA 1VQ8I 2XHKA 2M8EA 1APLC 1WI3A 2OJED 3A1YA 2DU9A 5DS9A 4XLFA 2JUGA 3I0TA 2Z5UA 4UVCA 2DXIA 2IA1A 3BROA 1U2WA 1YRNB 5H20A 3BTCA 3IH4A 3WTSC 2VOOA 3WTTC 3FKJA 2G7UA 1K61A 4GFBA 2YR2A 1OCTC 1DU6A 2L4MA 1WJFA 2XASA 2LBFB 5J8FA 1AU7A 5K5RA 3PFYA 2LOOA 5DUIA 2LC2A 1MSEC 4NQWB 2ELJA 1R1UA 3PM1A 1ZHFA 1IXRC 1LVAA 2RQQA 3GFMA 3HUGB 3OOUA 4BS9A 3OYJA 4E7ZA 4YELA 3VOEA 2HYJA 1W0TA 2K3FA 2VQHA 2ZKZA 4GRIA 2Y0SA 2HS5A 2PN6A 3A01B 3QPHA 3BQZA 1G3WA 5D5VB 5JLXA 2LP0A 2VE9A 3DLLF 1AOYA 2DO7A 2FMYA 3W3CA 3WGIA 5EG0B 1JGSA 1STZA 3HZJA 2XAQA 3S2DJ 1XPXA 4Y52J 2XAFA 3HSRA 1Z6RA 3BQYA 2PMZN 3GZNB 2FEZA 2VODA 4DJAA 3GTMJ 1DP3A 4P55A 3LSKA 5ICEA 1RPWA 2VONA 1Z6TA 4P5OA 4B3AA 1Z1DA 2A5YB 4MHGA 3N97A 3WODF 5FKLA 3RZDJ 5FKKA 4BUPA 3S1QJ 2XKPA 4KMFA 4CCNA 2CQXA 4S04A 5IT9K 1V3FA 5FFZA 2A07F 1FP1D 1EF4A 2HPIA 3QODA 4D7NA 3FXKA 3FMRA 3CMYA 4A5MA 1FLIA 4DGWB 3TO7A 1EA3A 3DEUA 1U8RA 5HLIA 3BP8A 4A2UA 4N9IA 3CDIA 2A5WA 4I6ZA 2D1HA 1I6XA 2JUCA 9ANTA 1AHDP 1ZTRA 4QPQA 4AIDA 2KP6A 1P4WA 2L9SA 3NRVA 3T1BA 5LGNA 3TQNA 1MBHA 4ESFA 1R36A 4ENNA 4RLQA 4UNOA 1WCMJ 3M8JA 4WWCA 1FYLA 1HSTA 3EUHC 5BPIA 1XS9A 4E4HA 5F64A 4YIFA 1GXQA 2PEXA 2HNHA 1HDDC 3GO5A 5FFXA 2BW3A 4IF4A 2CWEA 1S9HA 4HG2A 2C6YA 2HFHA 2KQRA 5J8CA 4AM3A 1U5TB 4OMYA 3KP6A 2JRTA 2E71A 4UUSB 2DFFA 1IXCA 3W6JB 5E3LA 4XKCA 2HPMA 1XGNA 3DBRB 4Y17A 2Q1ZB 3SXYA 2KRCA 3PNVA 4HSTA 2HQNA 3RCOA 3K4NA 1LKXA 3DKXA 4M6XA 3F6VA 4CGZA 4IJAA 5IPAA 1HLVA 1W36D 1WKMA 2CUZA 3PIOF 4RGUA 5L3DA 2I10A 3FMQA 3E6BA 5J40A 1MBFA 2HQAA 5FB2A 1YIOA 5FLXZ 3BZKA 2DMPA 5HLTA 1O3QA 3LA3A 1IF1A 3S1MJ 3OY9A 1K79A 1O3TA 1F1ZA 1CF7B 1VQ6I 4BDZA 2ZXHA 3SDBA 2VQCA 3ABTA 2OC6A 3C1DA 4WX9A 2WB1N 2IGNA 2JPBA 2PG4A 1YJWI 5FLXK 1TWAJ 2JQ7A 2VASA 1I5ZA 3E5XA 1Z0XA 2X0LA 2DMTA 1MH3A 3ZMVA 3ROUA 1RI7A 3H36A 1IV6A 3RPUD 4U0WA 2BV6A 3I54A 4P1WA 1U5TC 1MIJA 1BA5A 2HTJA 1J2XA 5GADJ 3LSHA 4A3BJ 3BZ6A 1F9NA 2K86A 1KGSA 1BI1A 1ZKGA 3FXMA 2VBWA 4D5FA 3MCZA 4HYEA 1MMAA 4FTHA 1P6RA 1FEXA 3IRRA 1U3EM 4KICA 1QO0D 4RS8A 1UMQA 2MG4A 2Z9OA 4UUVA 2DOEA 5FRMA 4KT5C 3IV5A 4MQVA 3C3WA 1OFCX 4JX5A 1ORKA 3BG6A 2IS4A 4I09A 1SAUA 4EGZA 1OKRA 5BQTA 4BY1J 2DJIA 2LY2A 2R7OA 3I5UA 3ZQGA 2ETHA 5JHFA 1PUFA 3RKWA 4QIWN 3LFKA 1SMYF 1S7OA 2HYGD 2A3SA 4M3DA 2LG4A 3HJEA 4C2MJ 2CW8A 4PDKA 2QYOA 5F27A 1SANA 2BY1A 3PNYA 2KHMA 3MZ8A 3OYGA 2JA7J 2RNGA 1FP2A 3ZMTA 5FD6A 3L00A 3EPZA 1SFXA 2P0WA 4KA4A 3S14J 2VJJA 2V1NA 4I7HA 2XV4S 4EJVA 2AXLA 2L5QA 3BTLA 1P2FA 2CW0F 1IN6A 2IS2A 5J4VA 2Z33A 1TWFJ 1QHGA 2K4JA 5M5XJ 3H9JA 2QQAA 2NS0A 2M3AA 1XSDA 1QHHD
chains in the Genus database with same CATH topology
5DM7F 3G71I 2QA4I 5DM6F 3CMAI 2H8WA 3CCEI 4IOCF 4IO9F 3PIOF 2E34A 1VQMI 1VQ7I 5GAHJ 1YIJI 2OTJI 1YJ9I 1VQ9I 1VQNI 1VQPI 2K3FA 3CC7I 1VQ6I 3CC2I 1FOWA 2ZJQF 3G6EI 3CCUI 2NXNB 3DLLF 1YJWI 2JQ7A 1HC8A 1ACIA 1VQLI 1MMSA 3CJTB 1YJNI 3CCQI 3G4SI 2E35A 3CCLI 3PIPF 3I56I 5GADJ 1QA6A 2OTLI 1YI2I 2FOWA 3CD6I 4IOAF 3I55I 1S72I 3CCVI 1FOXA 3CC4I 3CF5F 3CCSI 3CCRI 1VQ4I 2ZJPF 5GAGJ 1YHQI 3CCMI 3CCJI 2QEXI 1VQ5I 4UY8I 4V19K 3CMEI 1VQOI 1Y39A 1YITI 2E36A 1VQ8I 3J7ZI 1FOYA 5JVGF 3J7YJ 1VQKI 5GAEJ 2ZJRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 F;  3G71 I;  2QA4 I;  5DM6 F;  3CMA I;  2H8W A;  3CCE I;  4IOC F;  4IO9 F;  3PIO F;  2E34 A;  1VQM I;  1VQ7 I;  5GAH J;  1YIJ I;  2OTJ I;  1YJ9 I;  1VQ9 I;  1VQN I;  1VQP I;  2K3F A;  3CC7 I;  1VQ6 I;  3CC2 I;  1FOW A;  2ZJQ F;  3G6E I;  3CCU I;  2NXN B;  3DLL F;  1YJW I;  2JQ7 A;  1HC8 A;  1ACI A;  1VQL I;  1MMS A;  3CJT B;  1YJN I;  3CCQ I;  3G4S I;  2E35 A;  3CCL I;  3PIP F;  3I56 I;  5GAD J;  1QA6 A;  2OTL I;  1YI2 I;  2FOW A;  3CD6 I;  4IOA F;  3I55 I;  1S72 I;  3CCV I;  1FOX A;  3CC4 I;  3CF5 F;  3CCS I;  3CCR I;  1VQ4 I;  2ZJP F;  5GAG J;  1YHQ I;  3CCM I;  3CCJ I;  2QEX I;  1VQ5 I;  4UY8 I;  4V19 K;  3CME I;  1VQO I;  1Y39 A;  1YIT I;  2E36 A;  1VQ8 I;  3J7Z I;  1FOY A;  5JVG F;  3J7Y J;  1VQK I;  5GAE J;  2ZJR F; 
#chains in the Genus database with same CATH topology
 5DM7 F;  1YE9 A;  2HVS A;  5ICF A;  2LH9 A;  2P81 A;  3TDZ C;  2COM A;  3AFH A;  4LGW A;  3ERE D;  3QWL A;  5GP9 A;  5J47 A;  3HOX J;  4XLP F;  5LHG A;  1O57 A;  1GHC A;  3OYB A;  2EQR A;  1K6O A;  2ECC A;  2E2J J;  5F1R A;  3E97 A;  1Y8Q B;  1HQC A;  1M1E B;  3KLO A;  1JJ8 C;  4IHY A;  2ZO4 A;  3HDD A;  2W85 A;  2CGP A;  3DQV C;  2DLL A;  2KZV A;  2XGX A;  3BR2 A;  4ZYG A;  1X1B A;  3D5S C;  3JCU C;  4BU2 A;  2DA2 A;  1VQL I;  3QYB A;  1JHH A;  1GLN A;  2DQR A;  3IH3 A;  3HB9 A;  2DQL A;  4PSW A;  2CQQ A;  2R7S A;  3LSJ A;  2HXO A;  3EQL F;  2FUG 2;  1I3Q J;  3H5R A;  3E0J B;  5E3N A;  4XSZ F;  3G1O A;  2F5F A;  5HS9 A;  3E6D A;  1LDD A;  2VIX A;  2VJI A;  3A03 A;  1ON1 A;  1BI2 A;  3GFI A;  3IP4 B;  1PUE E;  1T56 A;  3BC8 A;  3PNT A;  5M5W J;  4EM1 A;  1WJA A;  3FM3 A;  4HQM A;  4C2T A;  3OL3 A;  2E1C A;  2EJR A;  5ICG A;  4KYW A;  2JK3 A;  2DCE A;  3TW6 A;  2EIJ H;  1JUS A;  3NQO A;  1Z3Y A;  1MJ9 A;  3KEY A;  1FJL A;  2DYS H;  4HBL A;  3ZXS A;  2JSC A;  3OYL A;  2Z99 A;  2RAE A;  1MBE A;  5H2F C;  2RV8 A;  4BY7 J;  1Y56 A;  3ZR8 X;  4BBR J;  2CQ7 A;  1W36 C;  2DTR A;  2EIN H;  3AG4 H;  3CF5 F;  1AA7 A;  2IXS A;  4I01 A;  3WG7 H;  2LF7 A;  1DQU A;  1EH8 A;  2M34 A;  3GZ6 A;  3HRM A;  3V8K A;  1NTC A;  1D3Y A;  2XIG A;  2XUB A;  4BE0 A;  1LFB A;  2M2E A;  1SAX A;  4BHP A;  4JOM A;  3VB2 A;  3CCJ I;  4Y4R A;  4UB8 C;  3EUK L;  4QPO A;  3LSR A;  1IDY A;  5IYD J;  2EK5 A;  2OAZ A;  1RR8 C;  1ONV A;  3BR3 A;  2YX7 A;  2L7M P;  3GBG A;  1YIT I;  1JHF A;  3HOV J;  2ECB A;  3AG3 H;  1BOA A;  2GOX B;  2IGK A;  1RIO H;  1O3S A;  3CJN A;  2EZI A;  4LJZ F;  2W1O A;  1OCP A;  4J01 A;  4P96 A;  5FD5 A;  2FE3 A;  3HXL A;  2QBY A;  4Q5S F;  2EZK A;  4F52 A;  5FKO A;  3MEX A;  3KET A;  4KIS A;  1U9N A;  2ZJR F;  5IOY A;  3BG5 A;  2FX0 A;  5EGO B;  5GPC A;  4EQQ A;  1UHM A;  4XRF A;  4IOC F;  5C4J J;  2WTE A;  4IO9 F;  2E1N A;  2RQP A;  2V1D A;  4PJ0 C;  3DV8 A;  2E34 A;  2R5Y B;  4EGY A;  1XSX A;  4DIQ A;  5JLW A;  3CO7 C;  3FK6 A;  2AXT C;  5J1U A;  3OYE A;  3ZGK A;  1CQT A;  1IN7 A;  1WGX A;  4ZYD A;  3S32 A;  3KX2 A;  2X4H A;  1X19 A;  1IJW C;  2CFX A;  1LDJ A;  5TJJ A;  2L54 A;  3V8J A;  4D5C A;  1MBG A;  4EVI A;  3DPT A;  1XB4 A;  1HOM A;  1B72 B;  1RKW A;  3LL7 A;  1JI8 A;  2KRH A;  3DEW A;  1HW5 A;  3F21 A;  1LEA A;  2LKX A;  1H9G A;  3ULQ B;  3J7A O;  4PJJ A;  3BPV A;  4S05 A;  4XIC A;  2QWW A;  3K69 A;  5ILS A;  4C30 A;  4NB5 A;  3Q3S A;  4QLC U;  2QZ8 A;  4RB2 C;  4J19 A;  3SHF A;  1REP C;  1TC3 C;  2UWM A;  2HWV A;  3CD6 I;  2W25 A;  2ADU A;  1UAA A;  2IA2 A;  3H3U A;  2DOF A;  3G1L A;  2V7F A;  2DW4 A;  3I53 A;  3SQN A;  2R5Z B;  2R0Q C;  4A12 A;  1U78 A;  2FML A;  3KIO A;  4OIR F;  4BJ5 C;  4AIJ A;  3RQI A;  4RM2 A;  1S29 A;  3QP6 A;  4RM3 A;  4MFD A;  2ID3 A;  2Z16 A;  2R7W A;  5EYR A;  3E1S A;  4W97 A;  2PX9 A;  1TQP A;  3OWT A;  1L0O C;  5D4R A;  3GTG J;  3K4B A;  4EEF G;  3TP3 A;  2FSW A;  2DA1 A;  5TIS C;  1O4X A;  5LEK A;  4XID A;  1PDN C;  4F55 A;  3ZMU A;  1FWZ A;  2NOJ B;  4AYB N;  3GEZ A;  4WF2 A;  1X3Z B;  3AL0 B;  3MVP A;  5BNG A;  2FQ3 A;  1V54 H;  1IGN A;  4ENM A;  3CUQ B;  4EAT A;  3QRF F;  2XC7 A;  5ILU A;  4ZTJ A;  3K4M A;  3JSP A;  2HEO A;  2DA4 A;  1JTX A;  2MH2 A;  2QQ8 A;  3BR1 A;  3FIW A;  3KEQ A;  2PBI A;  2Q2E A;  2UXX A;  4BHB A;  2FJ1 A;  1G3S A;  5HS8 A;  3ASO H;  4ZZD A;  5LBQ A;  4PGH A;  1X3W B;  2ZXI A;  3GW2 A;  2DA5 A;  1A35 A;  4CCO A;  2KL4 A;  5GAE J;  5KAI C;  3NAR A;  3S3O A;  1OCC H;  2FRH A;  3CJR B;  3GFJ A;  1WH7 A;  1L3L A;  5E8G A;  1RRJ A;  1FNN A;  1G8X A;  4LOC A;  2V1U A;  4JP0 A;  2YSR A;  2LK2 A;  2W48 A;  3K1M A;  2JRM A;  3TBI A;  2A6H F;  2KLO A;  1MMD A;  1VQM I;  2JN6 A;  4NUB A;  2J5O A;  2K7L A;  3L2Q A;  3WHB A;  2XPU A;  1SD4 A;  2A69 F;  4LLG F;  4M6V A;  2NS7 A;  2XGD A;  4ITV A;  3KYL A;  2JA6 J;  2OPT A;  4PCQ A;  3LWF A;  3G6E I;  2Q0O A;  4E6K G;  4RB1 A;  3R0J A;  2ZXJ A;  4LIV A;  2OCE A;  4HNU A;  1TNT A;  2X6X A;  3AL0 C;  1BL0 A;  2DT6 A;  3W2W A;  2DBB A;  4D0P A;  2LDU A;  3BR5 A;  4ON0 A;  5B66 C;  3J7A Y;  3KPH A;  2F5E A;  1GDT A;  5DCM A;  2GA2 A;  3L2C A;  1YG2 A;  2P4W A;  3CUQ C;  1XDU A;  2CG4 A;  4IEJ A;  5B1B H;  4A3M J;  3WTZ A;  4UXN A;  4R8H A;  1XX5 A;  3ELK A;  2K9S A;  2V79 A;  3ZPL A;  1Z7L A;  1FBS A;  2UUZ A;  5J3L A;  1QA6 A;  5TRD A;  1XTA A;  5L3B A;  4G6T B;  4KIF A;  2LMD A;  1N77 A;  4HA8 A;  4Z6Y A;  1FC3 A;  1V5G A;  2A05 A;  4I98 B;  3I9V 2;  1VF9 A;  4CYD A;  3W6K B;  3A2K A;  2BXY A;  1FTZ A;  2ZME A;  5JHU A;  3ECH A;  4DYQ A;  1BI3 A;  4CCJ A;  4DZP A;  2JA5 J;  3CTA A;  3Q0V A;  2IEK A;  4OAY A;  1T0F A;  2EH3 A;  1TW3 A;  3MZY A;  2RGV A;  3O6B B;  3LST A;  5TGT A;  1G4D A;  1TT0 A;  4RA2 A;  2K85 A;  4N4O B;  4LB6 B;  4HF0 A;  2DFE A;  1R5I D;  2Y69 H;  1A04 A;  4BAC A;  3WGG A;  1K7A A;  4NHJ A;  2O0Y A;  3K4K A;  1GXP A;  2W82 A;  2NVU B;  1ETY A;  4GYG A;  1QZY A;  3DTE A;  3IHU A;  3ABK H;  3T5X A;  3LQR A;  1GV2 A;  1SEU A;  4DYC A;  3FBN B;  3W6V A;  3CCY A;  1K78 B;  2E5Z A;  2BY3 A;  4Y33 A;  4HLY A;  1QPI A;  3SEQ A;  2HU9 A;  3KP7 A;  2R7T A;  4KT6 A;  3IL2 A;  3G71 I;  2A6E F;  3CMA I;  1P9Q C;  3HC7 A;  2VN2 A;  5FRN A;  2BYV E;  4OAZ A;  1YIJ I;  1V4R A;  3M8F A;  3Q9S A;  1VQN I;  4KNY A;  3GXO A;  4UVB A;  3PQK A;  3CC7 I;  1WWX A;  3TP0 A;  3CC2 I;  1X1D A;  5HVQ C;  2ELH A;  3L09 A;  3S2W A;  5J1R A;  3O8G A;  1T8I A;  3G2B A;  1LQ1 A;  2GXB A;  2W24 A;  2W7N A;  4RGR A;  1ERD A;  1P4A A;  5FGM A;  5DEQ A;  1E3O C;  2AHQ A;  3C7J A;  3BY6 A;  3WU0 A;  2KJC A;  4YFX F;  3Q5F A;  3CCQ I;  2CUF A;  3T0Y A;  4EJO A;  4W1U A;  3TW7 A;  3OYI A;  2YU9 J;  2FXA A;  3BOQ A;  3JRH A;  1FYM A;  2RN7 A;  1ZQ3 P;  2W57 A;  3F8C A;  2DDB A;  2TCT A;  3BG9 A;  5K7H A;  2FA5 A;  2DT7 B;  2VLA A;  4B43 A;  1LE8 B;  5B5E C;  2L9N A;  3DKY A;  4V2F A;  2WY8 Q;  5L3F A;  1W1W E;  2STT A;  3S2H J;  3GFL A;  3NWS A;  3TOA A;  5E1X A;  4HW0 A;  2PMH A;  3HSE A;  1ETK A;  2H09 A;  1WRJ A;  2P7C B;  3QPS A;  5EEH A;  2ID6 A;  2M0M A;  4GXO A;  3KLN A;  1IAW A;  3DPU A;  4IHT A;  2F4O B;  3SFZ A;  2JVG A;  2HOS A;  1U6G A;  5GAG J;  1JUM A;  2CV1 A;  5CVR A;  3VYU B;  1MDM A;  1P4X A;  5E1Z B;  1MBJ A;  3QOE A;  3G73 A;  2NVY J;  1KU7 A;  2F4I A;  3SFI A;  4A0X A;  1Z7U A;  3BR0 A;  4HRI A;  4IL6 C;  4MQ9 F;  4XLN F;  1LNW A;  1KQ8 A;  1RUN A;  1RZ4 A;  2BE5 F;  1FOY A;  3RPQ A;  4XOR A;  4IQJ A;  3HBL A;  3VPR A;  1JT6 A;  3MAJ A;  5LLQ A;  1R7J A;  4BQO A;  2A61 A;  3VYR B;  1Y1W J;  4L0Z B;  3HOZ J;  3P9K A;  3Q9V A;  1ZGJ A;  2V6E A;  2RDP A;  3BCA A;  3S3N A;  5FJ8 J;  2HKX A;  4NC8 A;  4HAM A;  3OYK A;  1XGM A;  5HLG A;  2VQG A;  3ZQ7 A;  1OCZ H;  1IRZ A;  3U1D A;  2WAQ A;  3PL8 A;  1EH7 A;  3QQA A;  1IN8 A;  1RET A;  2LFB A;  3V7R A;  1B8I A;  5CVJ A;  2WC2 A;  3TDU C;  3BCB A;  1J59 A;  1IUF A;  2GBY A;  5F0F A;  3JAM Z;  2M7B A;  4CZZ A;  3H0G J;  4A6E A;  2ZJQ F;  2HDD A;  4WCG A;  1BW6 A;  3KEO A;  2VI6 A;  1JXS A;  1JTY A;  5CVV A;  2QKM B;  3JRE A;  2HOT A;  2X6W A;  1SMT A;  3K7A J;  2HVR A;  1FTT A;  4GCV A;  2EZL A;  2XF5 A;  3CJQ B;  3OS1 A;  2E1O A;  1YX5 A;  3IWZ A;  2IS6 A;  2M9H A;  2WBM A;  3H3V K;  1E3H A;  4BE1 A;  2O03 A;  4RAG A;  2Y9Y A;  2KIS A;  3E7L A;  5HLH A;  4ZYA A;  1XC5 A;  1I1S A;  2BOL A;  4LG0 A;  2EIK H;  3S8P A;  3D5L A;  2HXI A;  1MMG A;  4XRS A;  4LLL A;  3F8B A;  5BMZ A;  1HKS A;  3COA C;  1XMK A;  3JRI A;  2VUM J;  2MSY A;  3GTQ J;  4G7H F;  2EA2 A;  1V5F A;  1DP7 P;  3CCV I;  3SJM A;  1R00 A;  2MA3 A;  3CQZ J;  4HEA 2;  3VEP A;  2X48 A;  2IBD A;  4HF2 A;  4GGG A;  4BJT A;  5FRO A;  2YPR A;  1BM9 A;  3L2V A;  3NWT A;  3Q0U A;  2GXA A;  3UKG A;  2L0K A;  2ZNY A;  4E7J A;  1DPR A;  1SVM A;  3KCC A;  1MSF C;  2E5N A;  1PP8 F;  3HUG A;  1E0E A;  1ZR4 A;  1R6R A;  1T6S A;  3O3K A;  1W5C C;  1OYY A;  3DU5 A;  3FWE A;  5FO5 A;  1RC9 A;  3HEF A;  3ML6 A;  1TT5 B;  2V1X A;  4ESJ A;  2HOE A;  2QEX I;  3WU1 B;  3EUH A;  1UJ8 A;  2XGC A;  4EJT A;  1IN5 A;  1W5S A;  4GO1 A;  3REO A;  2UV1 A;  1WJ5 A;  1YTY A;  2KT0 A;  1ZGW A;  3S17 J;  3I4P A;  2EIL H;  1LEB A;  1R49 A;  1LDK B;  2HVQ A;  4AWX B;  4RGS A;  1FIA A;  2NRA C;  5LRR A;  4OIO F;  2R7U A;  2M5W A;  1W5T A;  4ZYH A;  2P6S A;  2K9Q A;  3GME A;  3S3M A;  3RKY A;  3NAU A;  3IKT A;  3PO2 J;  2M0C A;  2FNP A;  1E3P A;  1IZ1 A;  2BBY A;  3WGH A;  4OIN F;  2STW A;  4LLN A;  4LK0 F;  1J75 A;  2F48 A;  1B1B A;  3U21 A;  4WXC A;  2O61 A;  3P5J A;  3RKX A;  2GOM A;  1VQ9 I;  3KP3 A;  1QQI A;  2MD0 A;  2HDC A;  1F5T A;  1ZN2 A;  2VKD A;  4PK4 A;  2KJB A;  2CQN A;  5KCM A;  3CCU I;  4X1E A;  4M9S A;  3HOS A;  2LSO A;  4Q48 A;  3Q0W A;  1QBJ A;  3T8R A;  2DJN A;  3ZQI A;  1JKP C;  1V55 H;  3SZG A;  4BBS J;  4XKW A;  4I0B A;  2KIM A;  3BPX A;  1Z77 A;  3K70 D;  4XQF A;  1WVR A;  2QVO A;  1E2X A;  2Q8K A;  2DOD A;  3FK7 A;  1LFP A;  3MKL A;  4PGG A;  1ENH A;  4XKV A;  1X58 A;  3OL4 A;  4FX0 A;  4UUS A;  1QZE A;  2G9W A;  3BG7 A;  3DWL E;  4L9T A;  4LG3 A;  4B8X A;  1W7P D;  3FF5 A;  4IOA F;  3QYF A;  4ANJ A;  2HYF A;  4A3E J;  5C44 J;  4II2 A;  2AS5 F;  5E18 F;  2VJ4 A;  1D1A A;  1R9T J;  1WHU A;  1WPK A;  1HSJ A;  2ZXW H;  2DA7 A;  2OCC H;  2OUM A;  2CUE A;  4JQF A;  2WV1 A;  5D5X B;  3M1C A;  1YLF A;  1MJB A;  3C2H A;  3LMM A;  3SDG A;  5HNH A;  3DFG A;  1Y8R B;  2NVX J;  2O8X A;  2A6T A;  3OYA A;  1CF7 A;  3V7S A;  2NYX A;  1H8A C;  3PO3 J;  2LY1 A;  3NEU A;  1ZR2 A;  3E3V A;  2KKO A;  2K3P A;  2MBF A;  3U9G A;  1UG2 A;  2GA1 A;  5FLM J;  4L9N A;  4A0Y A;  1JKR C;  2ZC2 A;  4BXU A;  1AWC A;  1KU3 A;  4H0E A;  2X6Y A;  3ECO A;  1MGT A;  1OCR H;  1UB9 A;  2K9N A;  4HX4 A;  5J1Y A;  3QYE A;  2ESN A;  4OWR B;  1JJ6 C;  2NS8 A;  2XAH A;  1BC8 C;  1QGP A;  2JTV A;  2P7V B;  4BEH B;  1X4O A;  2I8D A;  4L5J A;  4ENJ A;  2XB0 X;  1ZRF A;  4RB0 A;  2NVT J;  3E6C C;  1W4M A;  3RYP A;  4IQ4 A;  4ESB A;  3HTS B;  1OCO H;  2R4G A;  1BIB A;  2F4M B;  3OIP A;  3RTR A;  3L2W A;  5CPR B;  1V5E A;  5L3E A;  1R71 A;  4RDU A;  4B09 A;  2OTJ I;  4HX8 A;  4FE7 A;  4B47 A;  4U0V A;  1OR7 C;  5J4Y A;  5DV5 A;  2R7Q A;  2KIQ A;  2B7E A;  1D0Z A;  2DMU A;  4BDY A;  5HOD A;  2YU3 A;  4F7Z A;  1C0W A;  4WXH A;  2I5U A;  2TRT A;  3DTK A;  2BHZ A;  3MFK A;  3HTU A;  1HC8 A;  1I39 A;  4G7O F;  1LVK A;  2XVC A;  3K4C A;  3PUB A;  3V8L A;  3ZQF A;  2OU2 A;  1MMS A;  4XKB A;  3HRU A;  4CYC A;  3OV8 A;  4DZJ A;  5K7Z A;  1QU3 A;  3V42 A;  2KFD A;  1RES A;  1QRY A;  1SFO J;  3J81 Z;  2UZK A;  3ZP5 A;  4A3C J;  4I0A A;  4OIP F;  3WE2 A;  4R1H A;  3F0C A;  3QP5 A;  3OYN A;  4CHU A;  2DA3 A;  2OBP A;  2K02 A;  1YI2 I;  1TNS A;  5AIP A;  1W7P B;  3AG2 H;  4FX4 A;  3H0D A;  2DFH A;  3J81 K;  2M45 A;  3ZN0 A;  3K0L A;  3OS0 A;  3LAP A;  3BTJ A;  2G0E A;  1ZH5 A;  1TW2 A;  1WH5 A;  4IX7 A;  3CC4 I;  1FZP B;  3VYS B;  3IAM 2;  3RZO J;  5GTI C;  4HX7 A;  1N25 A;  5DD4 A;  1MNE A;  3K2A A;  3S93 A;  1DGW Y;  1NG6 A;  3K4L A;  4JX4 A;  3IC7 A;  1SFU A;  2V9V A;  1Y1V J;  1QVU A;  4OMZ A;  2XRN A;  4A3I J;  4QTR A;  1F43 A;  3TL4 X;  5LGT A;  2D2W A;  3VSL A;  2HGC A;  2LYC A;  1NK2 P;  2HZT A;  1UFM A;  4D1Q A;  1IN4 A;  4RAZ A;  3EYY A;  3I4N J;  1GT0 C;  1VQO I;  2VB6 A;  3R60 A;  2Z1D A;  2ZME B;  3HOT A;  4A3K J;  1QZZ A;  1CGP A;  1FOX A;  1WJB A;  2OQG A;  2VT2 A;  2PJR A;  1S6L A;  3LAJ A;  2XSD C;  3UNG C;  2XAG A;  2IT0 A;  2H6C A;  1R1T A;  3O8H A;  3K70 C;  1TQI A;  3LSM A;  1D5V A;  3GWZ A;  1R58 A;  2A68 F;  2CQK A;  4M9Z A;  2QUF A;  1JE8 A;  4CH7 A;  3PFI A;  2V9P A;  2WAF A;  4BHC A;  3FHZ A;  3FXR A;  2QA4 I;  2E7W A;  5M3F J;  4FQG A;  2H8W A;  3CCE I;  3WHC A;  1MKM A;  3F8N A;  2M87 A;  1UEL B;  5KK1 A;  2VKE A;  4Y3O A;  2QQ9 A;  5KVR A;  2BY2 A;  2ME0 A;  3AG1 H;  2DN0 A;  3CF2 A;  1VFC A;  3MKW B;  3OOP A;  3ZMS A;  4A3D J;  1MJA A;  3ZMD A;  5BS6 A;  2KDO A;  4G6Q A;  4F92 B;  3J80 Z;  1ETQ A;  2VBX A;  3SYT A;  4A3L J;  2ZCW A;  1IUY A;  3V7C A;  1R5G A;  2JMW A;  3CP8 A;  4G12 A;  2DDA A;  5D6F A;  1EH6 A;  2DA6 A;  1HW2 A;  1I27 A;  1KQ9 A;  2ZME C;  5E17 F;  3WTX C;  1D1B A;  3P9C A;  4GYI A;  1SFE A;  4KN7 X;  2PQ8 A;  3J80 K;  4MFE A;  5EDN A;  3QOP A;  4EMS A;  4E7S A;  4LIT A;  1BW5 A;  1ON2 A;  3W2V A;  1MD0 A;  2BVL A;  1T0F C;  3ZQC A;  4E7I A;  2R7D A;  4CCM A;  3HIF A;  5F04 A;  4YIR X;  2LTP A;  5DYM A;  2OQR A;  2FOW A;  4BNC A;  3HPH A;  4Y15 A;  2P8T A;  4R79 A;  4HQE A;  1YS6 A;  3GLX A;  1RKT A;  1HF0 A;  3M4O J;  1G6N A;  1KA8 A;  3QPL A;  4N0B A;  4CSW A;  2Y0S N;  4N4N B;  3RSN A;  2VBY A;  4EJW A;  1R4M B;  2D45 A;  3HG9 A;  2F5V A;  4D9J A;  2R5Y A;  2JT1 A;  3U2R A;  2IGM A;  4CDG A;  1WJE A;  2LY9 A;  3H1C A;  3D0S A;  5CVI A;  4ZYE A;  1Z3X A;  1K6Y A;  3KZY A;  3PSF A;  1S5L C;  1UZC A;  2IW5 A;  4HOB A;  1VZ0 A;  3UR3 C;  5K5O A;  1YW7 A;  3CDH A;  4KIT B;  4XLC A;  3DBH B;  3VWB A;  1FSE A;  1TTY A;  5LFA A;  4LK1 F;  2EWN A;  3GTL J;  4A93 J;  4YFK F;  2MC4 A;  1DGR M;  5D4S A;  4F93 B;  2GM4 A;  1B72 A;  3LA7 A;  4RMN A;  2VQL A;  2XPW A;  1IC8 A;  3I64 A;  3VSK A;  1KYW A;  2VPR A;  4HF1 A;  3ISP A;  1IRX A;  4KIB A;  3I71 A;  4O3M A;  3GTK J;  4RAY A;  2HKO A;  5D8L B;  1K4S A;  2IP2 A;  3SZP A;  3DPL C;  2BZT A;  5F6F A;  3U1K A;  4Q47 A;  1YX3 A;  4C2U A;  1JKQ C;  1ETO A;  5M3M J;  4IHV A;  2IVM A;  1FMV A;  3OR1 C;  4V2G A;  4XRM A;  3JRD A;  2Y9Z A;  4ZTF A;  3PSI A;  1QNT A;  2GQQ A;  3H92 A;  3R61 A;  5F0C A;  4YII A;  3K4J A;  3RIR A;  2QSG X;  2JA8 J;  2B0L A;  3OR2 C;  1A6I A;  5FKM A;  2Z3Y A;  3JTH A;  1MMN A;  1NK3 P;  2ISZ A;  1FBU A;  1ZAO A;  4AU7 A;  4GDF A;  3A0B C;  3DU6 A;  5FKN A;  4DBR A;  1I6H J;  3DP7 A;  5CQE A;  1D8K A;  3PUF A;  2FNA A;  2X85 A;  3OMY A;  1P92 A;  2H94 A;  4X0G A;  2NOG A;  3K9T A;  2CS3 A;  2EPF A;  1Q1V A;  2EZH A;  4DNC A;  5CKT A;  1UHS A;  1ZLK A;  3E5Q A;  2Y2Z A;  2Y48 A;  2COB A;  1HA8 A;  2BW3 B;  1J9I A;  2O6G E;  1H0M A;  2PI0 A;  3DBL B;  2D1V A;  3A02 A;  4FHT A;  4CIC A;  4AIH A;  4MEY F;  1B8I B;  1FT9 A;  4XSX F;  2ME6 A;  4AYB A;  3CUQ A;  4UV8 A;  4G8X A;  5CQG A;  1TL8 A;  1G2H A;  5CVU A;  2E2I J;  2WAE A;  4IVN A;  1QPM A;  3PIP F;  3KP2 A;  2ESH A;  1WJC A;  3IUO A;  2DPD A;  3FMS A;  2DOA A;  2HQ5 A;  2QEN A;  3KYC B;  4LMY A;  4XMY A;  4M9X A;  1G3Y A;  1MZB A;  3DLA A;  3VYT B;  3JRF A;  3JRA A;  4JBA A;  1UG0 A;  4MTD A;  5JI6 A;  1BBY A;  2MGQ A;  2IGO A;  1D0Y A;  2ZSI B;  2DFI A;  3BJO A;  3KP5 A;  5AIQ A;  3ABM H;  3DKW A;  3TGN A;  1O7L A;  4X6A J;  3OIQ A;  4L5E A;  1TWH J;  1S72 I;  4ASN A;  4HZF A;  4AVZ A;  2E1M B;  5LEJ A;  3RI4 A;  3JSO A;  2Y75 A;  3FM5 A;  5F0H A;  1TQM A;  3FXQ A;  1S8N A;  1S7E A;  2V9K A;  4PZJ A;  1LFU P;  1WSU A;  4LG0 B;  4IHW A;  3W2A A;  3EYI A;  3S1N J;  2QGU A;  3ZRG A;  4AD9 A;  3HGG A;  3WTV C;  2P5K A;  5C3E J;  1ZGA A;  2YX4 A;  4NC7 A;  2ZJP F;  2ACJ A;  4D7M A;  2RVC A;  3K1P A;  3LSI A;  2YUS A;  3H5N A;  2Y0M A;  1YHQ I;  1ODD A;  4LFU A;  4XLE A;  1O3R A;  3KZZ A;  1NG7 A;  1JKO C;  3ZMZ A;  1Y0N A;  2IAI A;  4BJ6 C;  4ZC3 A;  2E19 A;  1IXS B;  2CJJ A;  3A4C A;  5HDG A;  2XPV A;  2H6B A;  5D8K B;  1Y39 A;  3LNQ A;  5L3C A;  1TZL A;  2XAJ A;  1X1P A;  4BE2 A;  1T98 A;  1N75 A;  4PJM A;  3WE3 A;  1D0X A;  4IXA A;  3HL2 A;  3KYD B;  2FU4 A;  3I59 A;  1VQK I;  5GTH C;  2EBI A;  1XMX A;  2DMQ A;  1N78 A;  2P5V A;  5KAF C;  4BAY A;  2NAZ A;  2MD5 A;  3QAH A;  2IS1 A;  2L3D A;  3R6S A;  5IYC J;  5HDN A;  2M4G A;  4XLA A;  2JZY A;  1Y0U A;  3H35 A;  3RYR A;  1ULY A;  2WV0 A;  3BDD A;  5E3O A;  1R22 A;  1OQY A;  3CUO A;  5F1J A;  2N8G A;  2QSF X;  2O7O A;  2EFO A;  5LRS A;  2EFW A;  4L9J A;  2W84 A;  2E1M C;  2VC0 A;  3LFU A;  3LQQ A;  2HR3 A;  3F6O A;  4QWQ A;  5IT9 Z;  3I58 A;  4S0H B;  4DW6 A;  1FIP A;  2V4J C;  1LPQ A;  3V4G A;  4HV5 A;  2MLG A;  2IA0 A;  2VKH A;  3TOB A;  1FOW A;  3IAS 2;  2PMU A;  1PUF B;  1OMI A;  2XKO A;  3HKZ A;  3H5A A;  5EEG A;  1ZYR F;  1XDS A;  4PJL A;  4ABZ A;  3DF8 A;  4QSH A;  4JX6 A;  1ACI A;  1S7A A;  1XGS A;  1J09 A;  3F72 A;  3CJT B;  5IY5 H;  2VPL A;  3IRQ A;  2VKV A;  5JVT A;  1DPU A;  1BN5 A;  1BJA A;  2MW8 A;  4BL0 B;  4LIU A;  4U0Y A;  2HTS A;  2ZBK A;  3F3X A;  3N05 A;  4DQ2 A;  1TWG J;  3CCL I;  2XB5 A;  5JR3 A;  2D5V A;  5EF6 A;  1ZG3 A;  2X6O A;  2YS9 A;  3GX4 X;  5D5U B;  2XGE A;  2F2E A;  5J6X A;  5ILV A;  3FXO A;  1K78 A;  1SD7 A;  1S3J A;  2JJ7 A;  4P9U A;  4MEX F;  1SD6 A;  1Q1H A;  2BHY A;  2CMP A;  3BR6 A;  5DUK A;  1RR7 A;  4FT8 A;  1BI0 A;  1BR1 A;  2LR8 A;  4A3F J;  1AKH A;  2W00 A;  5IP9 J;  2IJL A;  3X2Q H;  3JAM K;  2ZNZ A;  2BVM A;  2DAO A;  1YO5 C;  4RB3 C;  2EFQ A;  1TBX A;  4XL9 A;  5ERI A;  5DTD A;  4BKX A;  5IYB J;  2FOK A;  4U7B A;  1IDZ A;  3BZC A;  2XF7 A;  3LOC A;  4ZDL A;  3L2U A;  1T95 A;  2M30 A;  2LKP A;  2MC3 A;  1X2M A;  2EB7 A;  2ZFW A;  3ASN H;  2QKL B;  4ETS A;  2AQF A;  4C3J J;  4L18 B;  1TWC J;  4XRS G;  2DT5 A;  1YRN A;  4FIS A;  1FX7 A;  4FET A;  1BR2 A;  4EM0 B;  2KZG A;  4UY8 I;  2V26 A;  3I4M J;  1PVE A;  2B63 J;  4PFP A;  1PP7 U;  4XN3 A;  2E36 A;  1FY7 A;  2R7R A;  1F4K A;  4TV7 A;  3OSF A;  2LBF A;  1IW7 F;  1MH4 A;  3FXL A;  3G1M A;  1XSV A;  2XRO A;  5JVG F;  3J7Y J;  2GIV A;  4NQW A;  1F36 A;  1XD7 A;  4UVA A;  1H89 C;  5E8I A;  4XLH A;  3L2R A;  4BH9 A;  4I99 C;  4BGD A;  1JUP A;  3ESW B;  3FXJ A;  2AQE A;  3EET A;  2GLO A;  3EDP A;  5EZG A;  2GIZ A;  2Z2S B;  2H1L A;  1LE8 A;  4XR6 A;  1MBK A;  3D1N I;  4M3E A;  3IH2 A;  3A01 A;  5C4X J;  3VFZ A;  3MMY B;  4KJZ A;  2KPM A;  3LSP A;  1VTN C;  4CXF A;  3HYI A;  4A3J J;  1OJL A;  4I2O A;  5EG0 A;  1X4P A;  4G9Y A;  3JRC A;  3WTU C;  2VC1 A;  2E7X A;  2CU7 A;  3F22 A;  4LB5 A;  2EFP A;  1T08 B;  4G6D A;  3CES A;  2K27 A;  1ZK8 A;  3F8F A;  3K10 A;  3ZQL A;  1VQP I;  1SD5 A;  3HRS A;  2L7Z A;  1YFH A;  3JRB A;  5HOO A;  1J5Y A;  2PMZ A;  1XGO A;  4BXF A;  4HNT A;  3HM5 A;  3TO9 A;  2RNJ A;  4XNF A;  4CZC A;  5L3G A;  1KQ0 A;  4RLF A;  1K4T A;  2ICW G;  1D5Y A;  2OZ6 A;  4MNU A;  4FAS D;  5K5Q A;  3MN2 A;  4EJU A;  3RQ4 A;  1KYZ A;  2FBI A;  3CLO A;  2BGC A;  3G4S I;  2QBY B;  3WTY C;  1WI9 A;  1WFX A;  4YFN F;  5LD2 C;  3KP4 A;  3M8E A;  4B4C A;  4CA0 A;  1J0R A;  1FYK A;  3CO6 C;  1UHW A;  5IT3 A;  1R4N B;  1B59 A;  1SVO A;  4KMU X;  2HQR A;  3GTJ J;  3S15 J;  1ZEL A;  4CYC B;  1UST A;  4ZH4 F;  2QLZ A;  2W4S A;  2Y31 A;  4M3B A;  3F8M A;  3TO6 A;  1H88 C;  3CLQ A;  5DD8 A;  4C3I J;  5DDG A;  4L9V A;  4PUS A;  4AIK A;  3JR9 A;  3G3Z A;  3C2B A;  5LHI A;  1BIA A;  2O9L A;  2XRL A;  3N4M A;  5LHH A;  5A2Q Z;  3B73 A;  4CUG A;  4HPQ A;  4U7D A;  1J7K A;  2EV5 A;  1B9M A;  1U5T A;  2ZJ2 A;  1OYW A;  3H9Q A;  3M07 A;  1Z91 A;  2BY0 A;  4F3Q A;  2CO5 A;  1R5H A;  5A2Q K;  5FLV A;  1XCB A;  2X1C A;  3FHN A;  2PJP A;  4BQQ A;  3R0A A;  3VDX A;  2OZU A;  4V19 K;  3SEZ A;  2CFO A;  4M72 A;  2LVS A;  1TP4 A;  1VI0 A;  1G3T A;  4N9H A;  3GYH X;  4L0Y B;  2QF7 A;  2K5C A;  4HNV A;  1YQA A;  2X9D A;  1HKT A;  3IKV A;  3ABU A;  1T2K A;  2CUJ A;  4E7L A;  4YEJ A;  5D5W B;  1LB2 A;  4OIQ F;  1FMW A;  3OS2 A;  4J00 A;  1I1G A;  1IO2 A;  3FKI J;  4MO7 A;  2PJR B;  4HDV A;  3VOD A;  1LUJ B;  5DM6 F;  1PYV A;  2X51 A;  1X1C A;  3DCF A;  3GVA A;  4FCY A;  2M8G X;  5HS7 A;  4B3X A;  1FSH A;  3F9K A;  1EKE A;  2MAB A;  1VQ7 I;  3M9A A;  2L7F P;  2WB1 A;  4A0Z A;  3QU6 A;  4KIG A;  3P7N A;  4PSX A;  3GTO J;  2HDW A;  1SC7 A;  3BG3 A;  4HDU A;  2CW7 A;  2DMN A;  2ELK A;  5E79 C;  3H9G A;  4L5I A;  1ITY A;  2GAU A;  2L4A A;  4A69 C;  2CH0 A;  2NVQ J;  2LRD A;  3SZT A;  4MIM A;  4M6Y A;  3IWF A;  2HOA A;  2BXZ A;  5EEA A;  1YS7 A;  3GZ5 A;  5H6Q A;  2Q2E B;  2L02 A;  3E5U A;  2FBH A;  2XSJ C;  2FD5 A;  3HHG A;  2H27 A;  2XAU A;  3BTI A;  1XCV A;  1MNM C;  4IHX A;  2F5C A;  3TED A;  2KMU A;  4MTE A;  4XBF A;  1BC7 C;  4IRI A;  3LSG A;  5E20 A;  3ZN1 A;  4G7Z F;  1BOB A;  3HSF A;  1ZRE A;  2QSH X;  2ZFU A;  4U87 A;  3OYM A;  2TDX A;  4RBO A;  3OSG A;  1ZAR A;  1RUO A;  5IP7 J;  2LKS A;  3I3L A;  4IKF A;  3EUA A;  1KZH A;  4ZJZ A;  3R4K A;  1E17 A;  1Z9C A;  2E60 A;  3MD2 A;  3PJR A;  4PFO A;  5BOX A;  1IRG A;  1DUX C;  2JVH A;  2QCO A;  1B9N A;  1OPC A;  5IOZ A;  3CCS I;  3O2P E;  3RJP A;  1B6A A;  1BJZ A;  3CCR I;  1HBX G;  1VQ4 I;  2CV0 A;  2LRE A;  4K2E A;  4Z2Y A;  3HOY J;  2KIU A;  3DTI A;  4C3H J;  3FDY A;  1JGG A;  3DEE A;  4A5N A;  2KIF A;  4DBQ A;  2NNN A;  3JRG A;  2DI3 A;  5DCM B;  3TMO A;  2R7F A;  1X2N A;  3CME I;  4IHS A;  2R7Z J;  4KN4 X;  2MFZ A;  2LF8 A;  1XG1 A;  1YOV B;  3H3Z A;  2CRG A;  4IRG A;  3CMM A;  3DXJ F;  2VOP A;  4U88 A;  1U9O A;  1EJ9 A;  2VL8 A;  2B9S A;  2WWY A;  2VT3 A;  1T33 A;  4E7H A;  4Y13 A;  2RC4 A;  1OLT A;  2KRF A;  3L1P A;  1WJD A;  2VXZ A;  4XN0 A;  2J5P A;  2ZSH B;  3ZQQ A;  5GPA A;  1IG7 A;  1FPQ A;  3WG9 A;  2L9V A;  4IZZ A;  4HLX A;  3GLL A;  3A0H C;  1I50 J;  4NDL A;  4XM3 A;  5M5Y J;  2FQ4 A;  1UCR A;  4M74 A;  3FIS A;  3C2G A;  2LNB A;  1HW1 A;  1RNL A;  2OF7 A;  3FXU A;  2H1K A;  4M71 A;  2HZD A;  1GVD A;  1ZLJ A;  3ERM A;  3L9F A;  3ZOB A;  4RAF A;  5KHD A;  5GAH J;  4EM2 A;  4MLO A;  3BJA A;  2G7H A;  1YJ9 I;  1GV5 A;  2DK5 A;  4A3G J;  2P5L C;  1K83 J;  1OR7 A;  4HV6 A;  3RPU A;  1JT0 A;  2PFB A;  2EIM H;  1ETX A;  2MYS A;  3CZ6 A;  3HOW J;  4BXX J;  1Z05 A;  5D6E A;  2NXN B;  3WU2 C;  3K1N A;  3WTW C;  4P9F A;  4NNJ A;  2KDZ A;  1DDN A;  1U0J A;  3ABL H;  2IPQ X;  2E2H J;  2BEO A;  3HOU J;  2L7K A;  4IPA A;  2DK8 A;  3RKQ A;  1FOK A;  2PLY A;  5DCF A;  4DYR A;  3GTP J;  4IRH A;  1ZG5 A;  4DOZ A;  1HKQ A;  2CV2 A;  1D8J A;  4JYK A;  2OV7 A;  4OU0 A;  5AON A;  4UB6 C;  4PJN A;  2RRE A;  3S1R J;  3AAF A;  4ZZL A;  3M3Y J;  4E70 A;  1MW7 A;  1ZG1 A;  1T39 A;  2OTL I;  1USS A;  2Y30 A;  4UV9 A;  3CP2 A;  4BEH A;  3MKZ A;  1MND A;  4OOI A;  2R7X A;  4BQA A;  5CLS A;  3CDL A;  4F91 B;  2EFN A;  3T8T A;  4CCL A;  2X1D A;  4YRV A;  3BJ6 A;  2K9L A;  2M1B A;  4HSR A;  3D5R C;  4XOP A;  5H6R A;  2OD5 A;  1IV8 A;  4C9Y A;  3OYF A;  2L2O A;  3GCM A;  4RGX A;  4NC6 A;  4XK4 A;  2LLK A;  2VBZ A;  3HHH A;  1Z21 A;  2EV0 A;  4A6D A;  4XON A;  2QM3 A;  1P7J A;  2DTZ A;  5K7F A;  1R1V A;  3ZCO A;  5HNF A;  2R93 J;  5BPD A;  1Z67 A;  1I3A A;  1SFK A;  4MGR A;  2X1E A;  4AUX A;  1LJ9 A;  4E7K A;  2H8R A;  2OA4 A;  1OIS A;  3TKY A;  1TLH B;  1KU2 A;  3LA2 A;  3L7W A;  5B3S H;  5IP6 A;  3AKZ A;  3PQJ A;  3CCM I;  4II3 A;  1HCR A;  1VQ5 I;  2CSO A;  2O8K A;  3C18 A;  4XOT A;  3KFW X;  3QPT A;  2WAD A;  2GWR A;  5EGO A;  5K1Y A;  1A6Q A;  1YW9 A;  2CYY A;  3FZV A;  4G94 A;  3M7G A;  3J7Z I;  1W0U A;  2DYR H;  3OIO A;  4FE4 A;  4KDP A;  1O7F A;  1PJR A;  2L01 A;  4BQN A;  1NH3 A;  2IRF G;  3OYH A;  5E1W A;  1KU9 A;  2M4K A;  2O5R A;  1ETV A;  3KE2 A;  5KNL A;  3MKY B;  1A36 A;  3BWG A;  2GXG A;  2WY7 Q;  1YYV A;  3JTG A;  1ZRD A;  2JA2 A;  4O6J A;  1H9T A;  1DU0 A;  1WZ2 A;  1U8B A;  3ONQ A;  1W7P A;  2RKH A;  2HI3 A;  4M73 A;  5LGU A;  5F08 A;  6PAX A;  4UUT A;  4Y7N J;  3I59 B;  4B44 A;  2EA4 A;  2L9R A;  1G59 A;  4UHT A;  1A5J A;  2FF4 A;  4M3G A;  2JSP A;  4O5V A;  2VJ5 A;  3HGY A;  4YG2 F;  1X3U A;  1X1A A;  2XDV A;  1IRF A;  3FX3 A;  1GVJ A;  1MDM B;  1B4A A;  5CYV A;  3MWM A;  4KFC A;  1GUU A;  3F23 A;  4ZDP A;  2F5D A;  3OYC A;  3GF2 A;  2O3F A;  3BT9 A;  2MH9 A;  3HPG A;  5ED4 A;  4I02 A;  3B6A A;  4AVP A;  3JW4 A;  2DPU A;  3B02 A;  3M1E A;  5E3M A;  3RDI A;  5EZH A;  1D1C A;  2FBK A;  2R3S A;  1Y6I A;  2WA0 A;  2M7A A;  3E6M A;  1YJN I;  3K6G A;  1KON A;  3GUD A;  4LD5 A;  2JPC A;  4B48 A;  2K9M A;  2P6T A;  1POG A;  3HKZ N;  1XN7 A;  2R5Z A;  2E35 A;  2JWT A;  4H4K C;  1R23 A;  1EV7 A;  5JFR A;  3HRT A;  3I56 I;  1HXD A;  4AC0 A;  2R7V A;  4EV0 A;  5CJ9 A;  4KUM A;  5EJC A;  2QQB A;  2WAQ N;  1BR4 A;  3I55 I;  1ZRC A;  1WQ2 A;  2EV6 A;  2F6C A;  2GZW A;  5B1A H;  2K40 A;  1HDP A;  3FBI B;  3MZH A;  3K2Z A;  1ETW A;  1A31 A;  4Q4Z F;  4WXD A;  3ZQH A;  4ZDO A;  3BLY A;  2ZB9 A;  3KZI C;  2AO9 A;  1P7I A;  4BYY A;  1YW8 A;  2NNY A;  5HDK A;  4CCK A;  1VND A;  3MQ0 A;  4CO8 A;  2VXD A;  3P9I A;  3B6C A;  2MLK A;  4WK8 F;  3QU3 A;  1FBQ A;  3S16 J;  1AKH B;  4JK1 X;  2VE8 A;  2R92 J;  1QVT A;  1T38 A;  4ENK A;  2ISY A;  4I76 A;  4B1R A;  2K4B A;  2XF6 A;  2V6C A;  1NHA A;  5ICC A;  2LD5 A;  4M3F A;  3OYD A;  1XMA A;  1SVL A;  2UXN A;  1OYI A;  4NBQ A;  1VQ8 I;  2XHK A;  2M8E A;  1APL C;  1WI3 A;  2OJE D;  3A1Y A;  2DU9 A;  5DS9 A;  4XLF A;  2JUG A;  3I0T A;  2Z5U A;  4UVC A;  2DXI A;  2IA1 A;  3BRO A;  1U2W A;  1YRN B;  5H20 A;  3BTC A;  3IH4 A;  3WTS C;  2VOO A;  3WTT C;  3FKJ A;  2G7U A;  1K61 A;  4GFB A;  2YR2 A;  1OCT C;  1DU6 A;  2L4M A;  1WJF A;  2XAS A;  2LBF B;  5J8F A;  1AU7 A;  5K5R A;  3PFY A;  2LOO A;  5DUI A;  2LC2 A;  1MSE C;  4NQW B;  2ELJ A;  1R1U A;  3PM1 A;  1ZHF A;  1IXR C;  1LVA A;  2RQQ A;  3GFM A;  3HUG B;  3OOU A;  4BS9 A;  3OYJ A;  4E7Z A;  4YEL A;  3VOE A;  2HYJ A;  1W0T A;  2K3F A;  2VQH A;  2ZKZ A;  4GRI A;  2Y0S A;  2HS5 A;  2PN6 A;  3A01 B;  3QPH A;  3BQZ A;  1G3W A;  5D5V B;  5JLX A;  2LP0 A;  2VE9 A;  3DLL F;  1AOY A;  2DO7 A;  2FMY A;  3W3C A;  3WGI A;  5EG0 B;  1JGS A;  1STZ A;  3HZJ A;  2XAQ A;  3S2D J;  1XPX A;  4Y52 J;  2XAF A;  3HSR A;  1Z6R A;  3BQY A;  2PMZ N;  3GZN B;  2FEZ A;  2VOD A;  4DJA A;  3GTM J;  1DP3 A;  4P55 A;  3LSK A;  5ICE A;  1RPW A;  2VON A;  1Z6T A;  4P5O A;  4B3A A;  1Z1D A;  2A5Y B;  4MHG A;  3N97 A;  3WOD F;  5FKL A;  3RZD J;  5FKK A;  4BUP A;  3S1Q J;  2XKP A;  4KMF A;  4CCN A;  2CQX A;  4S04 A;  5IT9 K;  1V3F A;  5FFZ A;  2A07 F;  1FP1 D;  1EF4 A;  2HPI A;  3QOD A;  4D7N A;  3FXK A;  3FMR A;  3CMY A;  4A5M A;  1FLI A;  4DGW B;  3TO7 A;  1EA3 A;  3DEU A;  1U8R A;  5HLI A;  3BP8 A;  4A2U A;  4N9I A;  3CDI A;  2A5W A;  4I6Z A;  2D1H A;  1I6X A;  2JUC A;  9ANT A;  1AHD P;  1ZTR A;  4QPQ A;  4AID A;  2KP6 A;  1P4W A;  2L9S A;  3NRV A;  3T1B A;  5LGN A;  3TQN A;  1MBH A;  4ESF A;  1R36 A;  4ENN A;  4RLQ A;  4UNO A;  1WCM J;  3M8J A;  4WWC A;  1FYL A;  1HST A;  3EUH C;  5BPI A;  1XS9 A;  4E4H A;  5F64 A;  4YIF A;  1GXQ A;  2PEX A;  2HNH A;  1HDD C;  3GO5 A;  5FFX A;  2BW3 A;  4IF4 A;  2CWE A;  1S9H A;  4HG2 A;  2C6Y A;  2HFH A;  2KQR A;  5J8C A;  4AM3 A;  1U5T B;  4OMY A;  3KP6 A;  2JRT A;  2E71 A;  4UUS B;  2DFF A;  1IXC A;  3W6J B;  5E3L A;  4XKC A;  2HPM A;  1XGN A;  3DBR B;  4Y17 A;  2Q1Z B;  3SXY A;  2KRC A;  3PNV A;  4HST A;  2HQN A;  3RCO A;  3K4N A;  1LKX A;  3DKX A;  4M6X A;  3F6V A;  4CGZ A;  4IJA A;  5IPA A;  1HLV A;  1W36 D;  1WKM A;  2CUZ A;  3PIO F;  4RGU A;  5L3D A;  2I10 A;  3FMQ A;  3E6B A;  5J40 A;  1MBF A;  2HQA A;  5FB2 A;  1YIO A;  5FLX Z;  3BZK A;  2DMP A;  5HLT A;  1O3Q A;  3LA3 A;  1IF1 A;  3S1M J;  3OY9 A;  1K79 A;  1O3T A;  1F1Z A;  1CF7 B;  1VQ6 I;  4BDZ A;  2ZXH A;  3SDB A;  2VQC A;  3ABT A;  2OC6 A;  3C1D A;  4WX9 A;  2WB1 N;  2IGN A;  2JPB A;  2PG4 A;  1YJW I;  5FLX K;  1TWA J;  2JQ7 A;  2VAS A;  1I5Z A;  3E5X A;  1Z0X A;  2X0L A;  2DMT A;  1MH3 A;  3ZMV A;  3ROU A;  1RI7 A;  3H36 A;  1IV6 A;  3RPU D;  4U0W A;  2BV6 A;  3I54 A;  4P1W A;  1U5T C;  1MIJ A;  1BA5 A;  2HTJ A;  1J2X A;  5GAD J;  3LSH A;  4A3B J;  3BZ6 A;  1F9N A;  2K86 A;  1KGS A;  1BI1 A;  1ZKG A;  3FXM A;  2VBW A;  4D5F A;  3MCZ A;  4HYE A;  1MMA A;  4FTH A;  1P6R A;  1FEX A;  3IRR A;  1U3E M;  4KIC A;  1QO0 D;  4RS8 A;  1UMQ A;  2MG4 A;  2Z9O A;  4UUV A;  2DOE A;  5FRM A;  4KT5 C;  3IV5 A;  4MQV A;  3C3W A;  1OFC X;  4JX5 A;  1ORK A;  3BG6 A;  2IS4 A;  4I09 A;  1SAU A;  4EGZ A;  1OKR A;  5BQT A;  4BY1 J;  2DJI A;  2LY2 A;  2R7O A;  3I5U A;  3ZQG A;  2ETH A;  5JHF A;  1PUF A;  3RKW A;  4QIW N;  3LFK A;  1SMY F;  1S7O A;  2HYG D;  2A3S A;  4M3D A;  2LG4 A;  3HJE A;  4C2M J;  2CW8 A;  4PDK A;  2QYO A;  5F27 A;  1SAN A;  2BY1 A;  3PNY A;  2KHM A;  3MZ8 A;  3OYG A;  2JA7 J;  2RNG A;  1FP2 A;  3ZMT A;  5FD6 A;  3L00 A;  3EPZ A;  1SFX A;  2P0W A;  4KA4 A;  3S14 J;  2VJJ A;  2V1N A;  4I7H A;  2XV4 S;  4EJV A;  2AXL A;  2L5Q A;  3BTL A;  1P2F A;  2CW0 F;  1IN6 A;  2IS2 A;  5J4V A;  2Z33 A;  1TWF J;  1QHG A;  2K4J A;  5M5X J;  3H9J A;  2QQA A;  2NS0 A;  2M3A A;  1XSD A;  1QHH D; 
#chains in the Genus database with same CATH homology
 5DM7 F;  3G71 I;  2QA4 I;  5DM6 F;  3CMA I;  2H8W A;  3CCE I;  4IOC F;  4IO9 F;  3PIO F;  2E34 A;  1VQM I;  1VQ7 I;  5GAH J;  1YIJ I;  2OTJ I;  1YJ9 I;  1VQ9 I;  1VQN I;  1VQP I;  2K3F A;  3CC7 I;  1VQ6 I;  3CC2 I;  1FOW A;  2ZJQ F;  3G6E I;  3CCU I;  2NXN B;  3DLL F;  1YJW I;  2JQ7 A;  1HC8 A;  1ACI A;  1VQL I;  1MMS A;  3CJT B;  1YJN I;  3CCQ I;  3G4S I;  2E35 A;  3CCL I;  3PIP F;  3I56 I;  5GAD J;  1QA6 A;  2OTL I;  1YI2 I;  2FOW A;  3CD6 I;  4IOA F;  3I55 I;  1S72 I;  3CCV I;  1FOX A;  3CC4 I;  3CF5 F;  3CCS I;  3CCR I;  1VQ4 I;  2ZJP F;  5GAG J;  1YHQ I;  3CCM I;  3CCJ I;  2QEX I;  1VQ5 I;  4UY8 I;  4V19 K;  3CME I;  1VQO I;  1Y39 A;  1YIT I;  2E36 A;  1VQ8 I;  3J7Z I;  1FOY A;  5JVG F;  3J7Y J;  1VQK I;  5GAE J;  2ZJR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...