1FOYA

The rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, minimized average structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords RIBOSOMAL PROTEIN L11
publication title The RNA binding domain of ribosomal protein L11: three-dimensional structure of the RNA-bound form of the protein and its interaction with 23 S rRNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1foyA00
3CCRI 1VQ7I 2JQ7A 3CJTB 3CCUI 1VQ6I 1VQ4I 1YJWI 1VQPI 1VQOI 3J7ZI 1VQ5I 1VQNI 1VQ8I 1YJNI 3CD6I 3I55I 4IOCF 1FOXA 3CC2I 1YI2I 4V19K 2NXNB 3CMEI 1MMSA 2H8WA 3PIOF 1ACIA 3CC4I 5JVGF 3CCMI 3CC7I 1VQLI 2ZJRF 2E34A 3I56I 2QEXI 3J7YJ 1Y39A 3G71I 2E36A 3CCQI 1S72I 3CCJI 2E35A 3G6EI 3G4SI 5DM6F 1QA6A 1HC8A 4IO9F 5GADJ 2ZJQF 2ZJPF 5GAEJ 5DM7F 4IOAF 3CF5F 2K3FA 2QA4I 3PIPF 1YJ9I 3CCLI 1FOYA 3DLLF 3CMAI 3CCEI 1YHQI 3CCVI 5GAHJ 1VQKI 5GAGJ 3CCSI 1VQMI 2OTLI 1FOWA 2FOWA 1VQ9I 4UY8I 1YIJI 2OTJI 1YITI
chains in the Genus database with same CATH superfamily
2A5YB 1V4RA 4WCGA 1GVDA 4KITB 2R7UA 3CUQC 4RM3A 3MKLA 3GFLA 4BEHB 1W5SA 2CS3A 4G6DA 3A4CA 4XRFA 3F3XA 4LG0B 3M8EA 3GVAA 4E7KA 1OCZH 4P5OA 5DCMB 3G1LA 5ED4A 2M1BA 1KU3A 5E8IA 3ZMSA 4CXFA 1BR2A 5CLSA 2DO7A 2DDBA 4FE7A 3T1BA 4G7HF 5BQTA 3JRIA 1YW9A 3EQLF 2WV1A 4XLAA 2AS5F 3GFMA 1O7FA 2W24A 4FE4A 3ZP5A 2MH2A 3KP2A 4V19K 3HKZA 3GTGJ 3B6CA 2DA1A 4I7HA 4HEA2 2R93J 3KPHA 2DA5A 2VE9A 3PIOF 3IAM2 3KYDB 4C9YA 2R7WA 1O7LA 2ZSHB 4NUBA 2QBYB 2RQPA 5HS8A 1VZ0A 2PJRB 3HGYA 1JKQC 3K4BA 4F3QA 3OYIA 1NH3A 1LE8A 4HDUA 2K4BA 1NG6A 2GXBA 1G3WA 3HTUA 3TW7A 4HPQA 3S2WA 3SDBA 4MHGA 3WG9A 4UUSA 1CQTA 3Q0VA 2EFWA 3DPUA 4OAYA 1VI0A 2M5WA 2MD0A 3ZQ7A 4BJ6C 1IRGA 4IO9F 3ZCOA 2MG4A 2CRGA 2TDXA 3JSOA 4OAZA 1JGSA 3K4MA 1D0XA 5EGOA 1FYMA 2E60A 1IJWC 1R5GA 4BJTA 1YQAA 5A2QZ 5L3GA 2Q1ZB 4JX6A 5JHUA 1T38A 3NAUA 3C1DA 2CO5A 3R0JA 4RLQA 5EG0A 4LMYA 4WXCA 1A04A 1Z1DA 2OCEA 3G1OA 3VFZA 3A01A 3ZQQA 2LOOA 5D6EA 2Z2SB 3K4KA 5KAFC 2O8KA 3CCYA 3HSRA 1SFUA 2VKVA 3TOAA 2V6CA 2YSRA 3ZQHA 1YTYA 5F0FA 1TW3A 4D1QA 3HSFA 1WI9A 2X6YA 3BWGA 4YFNF 1MDMB 1SMTA 3V7RA 4KNYA 4CUGA 2EV0A 1F5TA 1MH4A 3VB2A 4U88A 4CCJA 3HYIA 1ZTRA 4G6TB 5IP6A 1X1AA 4XLHA 3DEEA 5IP9J 1J75A 2RREA 2NVQJ 3KEQA 3CJTB 3Q3SA 4D7MA 2GXAA 2IRFG 1GHCA 5HS9A 1X19A 2DOFA 3OL3A 4ZYGA 2QQAA 3DU5A 4ENNA 2FF4A 3R60A 4A0XA 1CGPA 1U0JA 1I3AA 4A0ZA 3BLYA 2LKSA 2CH0A 3PSFA 1ZR2A 3J80K 4MQ9F 2JRTA 1ON1A 1BIAA 4KN4X 5E3NA 1V5FA 5EYRA 4IOCF 2MC3A 3BJOA 1MMAA 2WY8Q 4DGWB 3DV8A 2PN6A 2FU4A 1IXCA 3OR1C 1X1CA 2NXNB 1DP3A 1MJAA 4M3FA 2OA4A 5EEGA 4U7BA 4A3JJ 1KU7A 2VKDA 5B5EC 1V55H 3S3OA 3O6BB 1G59A 3ABMH 3UNGC 2WB1A 4RAZA 3SFIA 2QSGX 1R71A 2VPLA 2M30A 1TZLA 3CCMI 4WXHA 3CC7I 3AL0B 4RMNA 1GV5A 5F0HA 2COMA 2ME6A 2YX7A 4XONA 2IGKA 3G71I 3IH3A 4ENMA 2V6EA 2DJNA 1QHHD 5JFRA 1S3JA 2K86A 5IYDJ 1JJ8C 4I2OA 4GYIA 3F23A 5ILVA 1HDDC 2YU3A 1XGOA 2DMNA 4JYKA 2M0MA 4CCLA 3FZVA 1TBXA 2HOTA 3HRMA 1E0EA 3R6SA 1UB9A 5GADJ 3L1PA 4XR6A 4PSWA 2M3AA 1KGSA 4L5EA 2K9QA 2KQRA 2Y48A 4BYYA 1D3YA 4A6EA 1ULYA 2QSFX 3TO6A 4CZZA 4RM2A 3LSPA 1VFCA 1WFXA 4E4HA 2P5LC 3LMMA 2RV8A 5ERIA 3I53A 2G9WA 1Z3YA 2OQRA 5K5OA 5FRNA 2QCOA 1V5GA 4YIIA 5ILUA 1IF1A 3ZPLA 3SQNA 1X2NA 3CCEI 1Z05A 2KLOA 4L18B 2ZCWA 2QZ8A 1DGRM 1TQMA 5GAGJ 4A3MJ 1H8AC 3NRVA 1UHWA 1JGGA 1I50J 2A05A 2DA7A 4EQQA 1U5TB 4QLCU 2DK5A 1IXSB 3O2PE 3MFKA 1ZGJA 5EZHA 4BBRJ 1JHFA 3H36A 1U6GA 4W1UA 1JUMA 3CF2A 2OC6A 3KYCB 5FLXK 3FMQA 1T08B 1R4MB 4DYQA 3EUAA 2K40A 1R6RA 2EPFA 3HOXJ 3ECOA 4RAYA 1B9NA 2VXZA 2PBIA 4AVPA 1IUYA 3MZ8A 3F8CA 2FMYA 2Y69H 3HDDA 4RAFA 4ZDOA 3G2BA 3OYNA 2DW4A 3HRSA 3S1RJ 2V1DA 2ESNA 3GTMJ 3F9KA 1IRXA 1F9NA 3L7WA 2BW3A 1SEUA 2EZIA 3I4MJ 2VQLA 2VJ5A 4QPOA 3CC2I 3LL7A 5FB2A 4XN3A 3VWBA 2VBZA 4IRHA 4CCKA 2E1CA 4Q5SF 1GUUA 1K7AA 4EJTA 2ICWG 1SFKA 2FQ4A 2LF7A 4K2EA 3DTEA 3IKVA 3I54A 1ACIA 4A3KJ 4BY7J 3WU0A 3RKYA 2EFOA 1OMIA 1ZAOA 4D5CA 3J7AO 1FP1D 1I5ZA 1UHMA 2DT7B 4B3XA 3E6BA 1Z77A 2A61A 2DBBA 2L7MP 1RI7A 2E35A 2GXGA 4G12A 2P7VB 2LMDA 4A0YA 5LEKA 1HC8A 3OIQA 1LKXA 1OJLA 1ZREA 1AWCA 3SJMA 2DT5A 2WA0A 3RPUA 5E3LA 1PUFB 3BR3A 2F48A 3HRTA 5HNFA 3ZQLA 1HLVA 2VBWA 1F36A 1OYIA 2F5DA 2ZKZA 2HDCA 3TOBA 2NS0A 2QQ8A 1Z3XA 3TEDA 2WTEA 2WAFA 3A0BC 3K2ZA 3WG7H 4CGZA 4DBQA 3S1QJ 2IS4A 2DA3A 5H20A 4IRIA 3EPZA 3S93A 2HQRA 4UB8C 2JA7J 2MBFA 4KIFA 3BR2A 3HJEA 1YG2A 2KZVA 1DU0A 3CJNA 3MZHA 2HKXA 5IT3A 1IO2A 2VODA 3FXMA 4UHTA 1TNSA 2JSPA 1RIOH 2XRLA 5J6XA 2FOWA 3R0AA 4RGUA 3OYMA 1FPQA 3HC7A 5D6FA 2OTLI 1FZPB 4Y17A 2CQNA 4DYCA 3E6DA 4A93J 2D1VA 3EUKL 3BROA 3PUFA 3GCMA 3VYTB 2R7RA 3L2UA 3ABUA 2E2IJ 2DTZA 3E5UA 5EF6A 2ADUA 2K9SA 1YJWI 1S6LA 1U78A 1DDNA 3HOYJ 2GBYA 1I1SA 2MLKA 2CGPA 3D5RC 3LAPA 1VQ5I 1P4WA 1R4NB 2JA2A 1G3TA 2E2HJ 1W0UA 1BW6A 5K7HA 2OJED 3ZMUA 1JTXA 2EV5A 2KFDA 4B47A 3QPTA 2L4MA 2X1EA 3KX2A 3V4GA 4I98B 1KQ9A 1MJBA 1VNDA 2KT0A 3HPGA 1D8KA 4IJAA 4PJJA 1KU2A 2TCTA 4KT5C 2CV2A 1T39A 1B8IB 5LRRA 1LFUP 3HG9A 2K3PA 4LB5A 2LLKA 2E1OA 2R4GA 3KZYA 1EF4A 1BOBA 2KMUA 5J47A 4IHYA 1J9IA 2GIVA 3FX3A 1ZARA 2ZJRF 2E34A 3HIFA 4DQ2A 2HKOA 3FXUA 2M7BA 1WJDA 1WH7A 1ETQA 1BR1A 3ERED 4UNOA 2O61A 5E79C 2QQ9A 4AIJA 2IT0A 4HX7A 2KIUA 4HNUA 3OMYA 4BH9A 4B09A 1DQUA 2A68F 4CYCB 2ZNZA 3LQQA 2X1CA 3DU6A 4IQ4A 4C3HJ 2NVUB 1FEXA 4F52A 2CQQA 4RGXA 3GLLA 5GPAA 4E7ZA 2BHZA 3BTIA 1XC5A 3G3ZA 1QVUA 3U1KA 3TO7A 1SD5A 4N4NB 3F6OA 3T0YA 3OYEA 3QYFA 2AHQA 3P9CA 1WJ5A 1W36C 2QA4I 3GMEA 2HPMA 2LREA 4B48A 3FF5A 1E3OC 3TGNA 3K4NA 3DLLF 2AXTC 4I01A 3LSJA 2JUGA 3KP7A 2VQGA 3V8KA 3D5SC 2RVCA 1OCOH 4MIMA 3CMAI 4BE2A 5IT9Z 3ZQGA 3KEOA 4XBFA 1IDYA 1U9NA 1VQKI 4JK1X 1FSHA 1QPIA 4PZJA 1LPQA 1MBGA 5DEQA 2CW8A 1YIOA 3FDYA 3E5XA 3E1SA 3FISA 3WU1B 1K6OA 1CF7B 2Y9YA 1Z91A 4C2MJ 2K27A 2HZDA 2MLGA 2FBHA 1ZR4A 2QYOA 1KYWA 1ZQ3P 1ETKA 1USSA 1BI2A 2F2EA 2ZJ2A 1WPKA 2Y75A 1WWXA 3SDGA 3ABTA 3BP8A 2HQAA 5F08A 1ETWA 1ZK8A 4RDUA 5F1JA 2XAGA 2H27A 1XGMA 2XROA 4CO8A 3J7ZI 4IHWA 1TC3C 1R49A 4YELA 3PNTA 2E1MC 1Z6RA 5F64A 1BL0A 2K9NA 2L0KA 2VKHA 3C3WA 3CD6I 3FKJA 2DMPA 3BOQA 1IUFA 2H94A 2VPRA 3I5UA 4IHVA 4J01A 3OIPA 4BXFA 4XKCA 1A5JA 4WK8F 2XIGA 9ANTA 3H9GA 3ZRGA 4RBOA 1AHDP 2VJ4A 3ABKH 4UVCA 2DMUA 1A6IA 2HQNA 2GA2A 2H6BA 5M3FJ 2BXYA 3BPXA 2JWTA 1YRNA 2R5YB 4FHTA 4RGRA 3CUQA 5HODA 2W57A 4B1RA 1IV8A 2F5FA 2D1HA 3AG3H 3OSFA 3JR9A 4WX9A 4GGGA 3WE2A 2J5PA 4YFKF 2QENA 2WADA 3REOA 3E6CC 2KHMA 1MD0A 2AQEA 4M6VA 3N97A 3OOPA 1EH7A 2XF7A 3H0GJ 4IHTA 4L5JA 3CCQI 3R4KA 3EETA 1HSTA 3TKYA 3K6GA 1USTA 1U2WA 4J19A 4R79A 3BJ6A 1XMXA 5BNGA 1WJCA 3PM1A 2VI6A 3PQKA 2L9SA 4U0WA 4ZTJA 4IKFA 1TLHB 2PG4A 2DA2A 4AU7A 3CF5F 4A3BJ 2ZMEA 5E1ZB 1QVTA 2XPVA 4BY1J 1X1BA 5F04A 3LSRA 2ZXIA 3B02A 4B8XA 5L3CA 1ZRFA 3S2DJ 1Z7UA 4ESBA 1QQIA 2F5CA 2YX4A 3GTQJ 3GEZA 3PO2J 5J8FA 3FMRA 3ZOBA 1Z21A 4MGRA 5GAHJ 4XKVA 3VPRA 3QYEA 3LFUA 2HOAA 1W36D 3EUHA 2I8DA 4U0YA 4E7IA 4I76A 1VQMI 3H3UA 2J5OA 1LUJB 1EKEA 1H9GA 3BTCA 2V1XA 3S1NJ 2A69F 4BGDA 3CP2A 2CFOA 2HR3A 3QP6A 1KQ8A 2KRFA 4D0PA 4CCMA 2VOPA 2ECCA 2F4OB 2NS7A 4RB0A 2CUJA 5KHDA 2Q2EA 1LE8B 1JJ6C 1O4XA 3I4PA 3PL8A 3G1MA 4A12A 1BW5A 2H8RA 1FBQA 4BHBA 2UZKA 3HOZJ 2VIXA 2R0QC 3ELKA 1U9OA 3QPSA 4NC6A 1FIPA 4U7DA 2GIZA 2L02A 2P5KA 3L00A 4XQFA 1APLC 3OYDA 3F0CA 5EGOB 3KP6A 2EA2A 1D0ZA 2R3SA 1D5VA 1E3PA 4R1HA 3GTKJ 5DS9A 3GBGA 1HSJA 1MKMA 4EJUA 3MKWB 4OIOF 5EG0B 3A1YA 2ZXWH 3RIRA 2X9DA 1MMSA 3WTTC 1LDKB 1OISA 1OR7C 2DYRH 1X2MA 1WQ2A 1P7JA 5C4JJ 3KP3A 2I5UA 3A01B 3K10A 2P0WA 1IW7F 2BE5F 1DGWY 4HSRA 2UV1A 4M9ZA 3I56I 3MD2A 1R1UA 4Q47A 5E1WA 5D5XB 4EV0A 5B1BH 1EH6A 3Q9VA 4HLYA 4G6QA 2PMZN 3RYRA 3OYGA 3G4SI 3E5QA 2X4HA 4RLFA 4NB5A 3S14J 4YG2F 2ZMEC 1IGNA 3GUDA 2JVHA 3V7CA 5HLGA 5M5XJ 1AKHA 3S16J 3RSNA 1PDNC 4UUVA 4H4KC 2C6YA 3C2GA 4IOAF 2XB0X 4HQEA 2EINH 1UCRA 3QQAA 2WAEA 4AC0A 4RGSA 3WODF 1MMDA 1WI3A 3OYLA 1YJ9I 1EJ9A 1FOYA 3KP5A 2XF6A 3EUHC 3C2HA 1O3QA 2EB7A 3CUOA 1MSEC 1WRJA 4ZYAA 2LY9A 3BDDA 2X85A 4A3FJ 1K78A 2KKOA 1YHQI 4NNJA 1C0WA 2DODA 3CCVI 4O6JA 2A6HF 3M8FA 1N75A 4LOCA 1QU3A 3EYYA 2XRNA 3VOEA 3WTVC 1OCRH 2DQLA 5TJJA 1F4KA 5J3LA 2IP2A 3SYTA 4QPQA 3MCZA 1W1WE 1DUXC 1ITYA 5ICCA 1FOWA 3DCFA 3W6VA 3SEZA 1FX7A 1JUSA 2BY0A 4ZDPA 1W4MA 5ICGA 2CMPA 4EM1A 2CSOA 2DT6A 4CA0A 1EV7A 2W7NA 5BOXA 2M9HA 2VC0A 4GRIA 3S1MJ 3WE3A 3M07A 4HQMA 1JHHA 4ITVA 2PI0A 3J81K 5TGTA 2BOLA 1SVOA 3L2RA 5LHIA 1X1DA 1Y8RB 1SD6A 1WKMA 5JHFA 3H5AA 2PQ8A 1DPUA 3I59A 1P92A 3WTZA 2GAUA 1ZG3A 1LEAA 2L7KA 2OPTA 3BR6A 3IL2A 3E97A 5TISC 3T8RA 1OYYA 2R7OA 4Y3OA 1U3EM 2V9KA 5M3MJ 3T5XA 1YI2I 2DN0A 5FO5A 3VODA 4L5IA 2X0LA 4HOBA 3CLQA 5FD5A 4D7NA 4A3EJ 1J5YA 1GDTA 1RUNA 1RUOA 1K61A 1XGSA 2CWEA 5FLXZ 4MQVA 1SC7A 3ZMTA 5K1YA 3CO7C 4NC7A 2IS2A 3FM3A 1WJEA 3KZZA 4JX5A 1SVMA 3J7YJ 1Z0XA 3DWLE 1W7PD 5L3DA 3JREA 5L3FA 1WSUA 1PJRA 3HGGA 3HOTA 3CJQB 3H92A 4PJLA 5CQGA 3NWTA 4A5NA 4YIRX 4OMZA 1HA8A 5DM6F 4BHPA 3I64A 3U2RA 3O8HA 1FOKA 4JBAA 2F4MB 1MSFC 3F8MA 3L2CA 4I02A 3VYSB 1YS6A 2H09A 2JT1A 1GT0C 2A3SA 2GWRA 2EIKH 1E3HA 1YX5A 3FK7A 1HCRA 2XF5A 3M7GA 5LFAA 2OU2A 2G7HA 4BACA 3K69A 3OYCA 3DTKA 3F8NA 1YFHA 1IV6A 4OMYA 2KDZA 4OWRB 3FXLA 2NOJB 2MW8A 3IUOA 4BQAA 5IPAA 1HW2A 1K79A 2VBYA 3P9KA 2BW3B 2WC2A 3K4LA 2V26A 3L2WA 5FKLA 1W5CC 2XSDC 1IN7A 4V2FA 3AAFA 5JI6A 2RC4A 3JRAA 1TWGJ 4XORA 3MKYB 3BG6A 3SZPA 5E17F 1FY7A 2R5ZA 2WV0A 2VC1A 2L9NA 3WHCA 3CP8A 4PFPA 1WJAA 4LK0F 1YITI 3FHZA 3BQZA 4FX4A 2MC4A 4GDFA 4S0HB 5A2QK 1Y0NA 2RKHA 4I0BA 2QGUA 1OCCH 3SFZA 4GCVA 2WBMA 3FXJA 1VQPI 4Z2YA 1BR4A 3FXKA 4KMUX 1E2XA 4IX7A 3IWZA 3M8JA 1J0RA 2L7FP 3TL4X 1E17A 1R7JA 3F72A 4XSZF 1LDJA 4HBLA 2HOEA 1YJNI 2X51A 4BJ5C 2FQ3A 5DTDA 2IJLA 4LLGF 2F5EA 3QP5A 4PJMA 4ABZA 4LIUA 1QZZA 2WAQN 2HPIA 4OOIA 4XLCA 2EILH 5ICEA 3BG7A 3RPQA 4BHCA 2V79A 2DJIA 3HHHA 2GZWA 2L4AA 1POGA 1BN5A 3X2QH 5JVTA 4F93B 2UUZA 2FUG2 2FD5A 4WXDA 1R9TJ 1WCMJ 5B1AH 2FOKA 5E3MA 2BY2A 3LA7A 3QOPA 1AOYA 1ODDA 4BQOA 4EGYA 4KFCA 1Y0UA 1ON2A 1UHSA 1UELB 5E20A 1U8BA 1EH8A 2QLZA 2RDPA 4RA2A 3LSTA 4XRSG 3H9JA 4CH7A 2D5VA 5KCMA 1ZN2A 3AFHA 4EJVA 2Y31A 3K0LA 4M72A 2LBFA 3DFGA 1G6NA 2H6CA 2NS8A 2ZFWA 4M6XA 1HOMA 1MBEA 4YFXF 3V8LA 5GAEJ 3KIOA 1KZHA 3BR5A 1KU9A 2E5ZA 2DK8A 4JX4A 1H9TA 1DPRA 5FLVA 2R7SA 5C4XJ 5KK1A 5D5WB 3BY6A 4XRMA 4BL0B 4AM3A 2HVSA 5LGNA 2XAHA 1X4PA 2LVSA 2XGXA 1RC9A 3FMSA 3K7AJ 3RDIA 1IC8A 2IS6A 1B72A 4NQWA 4PFOA 3HOSA 1ZLKA 2L5QA 1HKSA 5J8CA 2HDDA 4JOMA 3JRDA 3PFIA 5CVRA 1WJFA 2JN6A 5KAIC 4LLLA 1HF0A 2K4JA 1R5ID 2CW7A 2QM3A 2VT3A 2XGDA 3HPHA 3JRBA 5BPIA 4EJWA 3U21A 2EK5A 3VYUB 1T0FC 2NNYA 2O8XA 4ZYHA 3VEPA 3KLNA 2ELKA 1HW1A 4BUPA 3L9FA 5M5WJ 2PMUA 3CESA 1MBJA 4XSXF 1AA7A 1FWZA 3SXYA 2EV6A 2ISZA 3BG3A 1IN5A 1U5TA 1Y6IA 2O3FA 3K1NA 3MKZA 2JMWA 2L9RA 3F22A 2GA1A 3IV5A 4W97A 3W2WA 3B6AA 1Y8QB 1IRFA 2LRDA 1XSVA 2CQKA 5LLQA 1IRZA 3DBHB 2IEKA 3CDLA 5HDKA 1YO5C 3M1CA 2HU9A 3QPHA 2KIMA 5JR3A 5DUIA 1ETOA 3W2AA 3QODA 2PMHA 3SHFA 1ZGWA 2EIJH 4QIWN 3GFJA 4AVZA 4HAMA 3CO6C 2GQQA 2UXXA 2OUMA 3JTHA 2V4JC 3FHNA 5LRSA 3KE2A 1BJAA 2PMZA 3N4MA 2R7TA 2HI3A 1JXSA 1IZ1A 5CVIA 1FMVA 1YW7A 4XLPF 2EFPA 3AL0C 4U87A 3VSKA 3HOVJ 4CZCA 1FIAA 5J4VA 2PLYA 1ZLJA 3FIWA 3NARA 3K70C 2BVLA 2XASA 5DYMA 2Z9OA 4MEYF 3JAMZ 1V5EA 2HTJA 3MEXA 4A2UA 4AIKA 2A6EF 1QA6A 1P9QC 3H35A 3LNQA 3KCCA 2LDUA 5K7FA 2STWA 2OQGA 3TDZC 1UG2A 2EWNA 2HTSA 2ZJQF 2KP6A 3ROUA 1B4AA 3RZDJ 3DEWA 2P4WA 1I1GA 1FLIA 3TP0A 3HHGA 1MNMC 4E7JA 4PUSA 3BG5A 3P9IA 4LB6B 2LY2A 3I0TA 4HLXA 4AIHA 3GTOJ 4IHSA 1FTTA 1ZKGA 4A3GJ 1Q1VA 4UV9A 2FJ1A 3WU2C 3Q0WA 2YPRA 1HKTA 5DCFA 5CYVA 4EM2A 2XGEA 2BEOA 2BVMA 4L9TA 2E19A 2KRHA 2Y9ZA 3GZ5A 1X3ZB 2Y0MA 2FBIA 2OZ6A 1YRNB 2HDWA 1YIJI 3RYPA 1LQ1A 4MTEA 1U5TC 3GLXA 1J2XA 3CUQB 3DTIA 1FP2A 3QAHA 2XPWA 3P5JA 4XICA 3S2HJ 2OD5A 2ZC2A 3BTLA 3CCRI 3KP4A 4BAYA 3CCUI 3FBIB 1VQ4I 1VQ6I 1G3YA 2OAZA 4S04A 3KYLA 2HZTA 4Z6YA 4M3EA 5BPDA 2O5RA 1XSDA 2DAOA 4OIRF 5E3OA 1R22A 2IGNA 2KDOA 3JRFA 4G7OF 2E7WA 5CVJA 4ZYDA 1RR7A 2RNGA 4LLNA 4FT8A 2X48A 4BQNA 1JKPC 2DMQA 3DP7A 2ZXJA 5JLWA 3HTSB 3FKIJ 3KEYA 1A35A 2ZMEB 2B63J 5FJ8J 2NVTJ 4IHXA 1X1PA 3IAS2 3I4NJ 2E71A 2MSYA 3D0SA 2E2JJ 5FKKA 4EATA 2ACJA 2KJCA 4HDVA 3OSGA 2ZNYA 2XHKA 1W0TA 2DLLA 2R7XA 2XPUA 5BS6A 4M9XA 4Y13A 1WH5A 2AQFA 1QO0D 4DYRA 4M9SA 2VT2A 5JVGF 3OYBA 1P4AA 1UJ8A 4LJZF 4GYGA 5FKOA 3ABLH 5FKNA 2R7DA 3NEUA 1BIBA 2V1NA 2HXIA 1TQPA 1XCBA 3Q0UA 3M3YJ 4HRIA 4II3A 3IKTA 2PFBA 1B6AA 3CCJI 2PX9A 2R7VA 3G6EI 3CDIA 1TNTA 2EZHA 4MFDA 4DBRA 4ON0A 2M8EA 4Q48A 1XDSA 2O0YA 2Q2EB 2HXOA 5K5RA 3OS0A 2V1UA 1ERDA 3HRUA 3D5LA 4PJNA 1H0MA 4IXAA 1TWFJ 4OINF 1FYLA 1MGTA 5M5YJ 1R1TA 1JT6A 3K70D 1MMNA 4ETSA 1W7PA 1OR7A 4PSXA 2DTRA 5AIPA 1H88C 1JE8A 2KIQA 4XMYA 1MMGA 5H6RA 3CTAA 4BXUA 2FA5A 2DFHA 4OU0A 1SFXA 2DPDA 2L3DA 1ZHFA 2P6SA 3TBIA 4ASNA 1ZRDA 3M1EA 4I6ZA 5DDGA 5J1YA 2CYYA 5DUKA 4KIBA 2EFNA 2OV7A 1PP7U 4X6AJ 2W00A 4NHJA 2PJPA 1JTYA 4Y7NJ 5D5VB 5C44J 4E7HA 4IPAA 4FETA 4KJZA 4D9JA 4BNCA 5E1XA 2H1LA 2VE8A 1N78A 3IRQA 1Y56A 2LF8A 3LA3A 1FBUA 1XX5A 3L2QA 2DFEA 1J59A 2HYGD 4P96A 4HYEA 1QHGA 5IYBJ 1Q1HA 1R5HA 3RPUD 2ECBA 2LKXA 5LBQA 1T33A 3ML6A 4BE1A 2LYCA 1XMAA 3MWMA 4PK4A 5D8KB 4BXXJ 1U8RA 3LA2A 5HNHA 2LKPA 2WAQA 4LITA 4FTHA 4L9NA 3G73A 2LD5A 1BC8C 5IT9K 3BTJA 3TO9A 1PVEA 3GW2A 1AKHB 4KYWA 3BCAA 1T2KA 5F27A 1YS7A 3DEUA 5HLIA 3PO3J 2CV1A 4MEXF 4J00A 5IOZA 4ZJZA 3BQYA 3CLOA 5LGTA 4E7LA 2NRAC 1J7KA 3CMEI 4ZDLA 2QKMB 1SVLA 4UUSB 4KISA 1G4DA 3HM5A 2DA4A 1K78B 5C3EJ 1G8XA 1LVAA 4XK4A 1O3SA 5D5UB 1MBFA 5LHGA 2P6TA 3DPLC 2P81A 4GXOA 4N0BA 4N4OB 2QEXI 3S32A 1KA8A 1FC3A 2ZFUA 4B3AA 2RN7A 2V7FA 3QPLA 1JI8A 4DZPA 2OF7A 3HL2A 2BY3A 2DMTA 3UR3C 2B9SA 4P1WA 3GXOA 4IEJA 1PP8F 1S29A 1PUEE 2OZUA 2RNJA 2VXDA 1D5YA 2XB5A 5DD4A 3BZ6A 1RZ4A 4BE0A 1QBJA 3GO5A 4IRGA 3IC7A 4M74A 5E8GA 2Z99A 3KZIC 2ZJPF 2L2OA 1GXQA 3HXLA 4YRVA 1WVRA 4NBQA 4MNUA 4XIDA 5EEAA 1B59A 1T6SA 3F6VA 1D1AA 2XKOA 3TDUC 2VJJA 3I59B 2IW5A 3RQIA 3PQJA 5H2FC 2L9VA 2EJRA 2HS5A 3DKWA 4I99C 4MO7A 3SZGA 1ZG5A 3J80Z 4QTRA 3TMOA 2Q0OA 2HQ5A 2Y0SA 4MFEA 4IVNA 2IA2A 4E6KG 3CCSI 1Z67A 2IBDA 2VQCA 4RB2C 5HS7A 2ME0A 3FXQA 1IXRC 1SANA 3K9TA 4NDLA 3CMYA 1LFBA 2XGCA 2LK2A 3HOWJ 4XN0A 4UY8I 2FSWA 2HNHA 1I39A 3OYHA 1D1CA 1FNNA 5FROA 1X3WB 5KNLA 1BA5A 1NG7A 5HDGA 5F1RA 2BHYA 1SMYF 1NHAA 4G9YA 2LSOA 2DQRA 2EZKA 1HW5A 4O5VA 1MIJA 5AIQA 3IP4B 2Z3YA 4ZYEA 1XPXA 2LNBA 1MZBA 3K2AA 5ICFA 4CICA 3C7JA 3H5NA 3KLOA 3E3VA 4O3MA 2KIFA 1QPMA 2YUSA 1VQNI 3LSMA 3OWTA 2P7CB 5F6FA 5J1UA 1S8NA 3QRFF 5LD2C 3AKZA 3DF8A 3O3KA 1IAWA 4X0GA 2M87A 3W6KB 3EYIA 5CJ9A 1D8JA 1DU6A 2M34A 1K4TA 2CG4A 4Y33A 3FXOA 1TWCJ 2IA0A 3HUGA 2VBXA 2CFXA 3OL4A 4MLOA 4BQQA 1FBSA 5IOYA 3WGIA 3IH4A 5GPCA 2QKLB 1V54H 4IZZA 1TTYA 3A02A 4F55A 1MJ9A 4HZFA 5J4YA 3TP3A 1WZ2A 2K9LA 1ZYRF 5J40A 2O7OA 4BEHA 2R5ZB 4LG0A 3I9V2 2O9LA 2BV6A 3H9QA 1G3SA 3S8PA 5DCMA 2A5WA 3E0JB 1HBXG 4A3IJ 1S7EA 3S3NA 2GM4A 4BDYA 2W84A 2ZO4A 2FXAA 2MD5A 1N25A 1P6RA 4LIVA 4XLFA 4AUXA 3W3CA 1OCPA 3DKYA 3RKXA 3QWLA 3JW4A 1KQ0A 2JK3A 3RCOA 2V9VA 4DNCA 4C2TA 4HF1A 3PIPF 3BJAA 3RTRA 1XD7A 2NAZA 2QVOA 3MN2A 3PFYA 1JKOC 3HB9A 3RI4A 2F5VA 3AG1H 3GFIA 1MW7A 4EMSA 2DU9A 5J1RA 2QBYA 1T95A 4S05A 4CDGA 4GO1A 2HVQA 5FD6A 3UKGA 3DPTA 4II2A 2PJRA 2FNAA 4RAGA 2X6OA 3IHUA 4XOPA 3LSKA 1TL8A 3ASOH 5DV5A 1L3LA 2IXSA 3ERMA 1AU7A 2XVCA 4C30A 3D1NI 2MA3A 2M45A 2JSCA 3AG4H 2IPQX 3HSEA 3V8JA 3ZGKA 1F43A 3JSPA 3MMYB 1LVKA 4OIQF 3Q5FA 5D4SA 2M4KA 3EDPA 4UV8A 1XSXA 2CJJA 3U9GA 3LAJA 3HOUJ 3BPVA 1TT5B 5E18F 2Z16A 2BY1A 4LD5A 5LHHA 3DBLB 3N05A 1SFOJ 1P2FA 1GXPA 1Z6TA 3CMMA 1WHUA 3CJRB 3OY9A 3K4JA 2OCCH 4B44A 2LBFB 2OBPA 2WWYA 4A69C 3ZN0A 3TW6A 3VDXA 2MYSA 2JPBA 4PGGA 2DXIA 4KIGA 1HXDA 4A5MA 4Q4ZF 1T0FA 1MNDA 1UZCA 2I10A 1GV2A 1R1VA 2W48A 2XAJA 2KL4A 3LSIA 2NNNA 1XG1A 4NQWB 1B72B 1MDMA 4BKXA 2Z5UA 5FLMJ 4XOTA 1T98A 2JVGA 4HNTA 2DA6A 3MZYA 5DD8A 3GZ6A 1LB2A 2MGQA 2IAIA 4F91B 3BG9A 1ZH5A 3H3VK 3M4OJ 4EJOA 3I71A 1FTZA 1A6QA 2CQXA 1MNEA 2QF7A 2FEZA 1S72I 3DBRB 4IF4A 1X4OA 2E1NA 2EQRA 4HG2A 2LC2A 3JTGA 3BT9A 2EIMH 2LTPA 2F6CA 3U1DA 5HOOA 3OYJA 4E7SA 4CHUA 2ZB9A 1YX3A 3HEFA 4KDPA 3C18A 2X6XA 3H1CA 2FRHA 2DDAA 4KT6A 1UMQA 2DOAA 3QOEA 5ILSA 4MTDA 5CQEA 1BM9A 1X3UA 1F1ZA 1TWHJ 4UVBA 5K5QA 4EGZA 2XV4S 1YYVA 4YIFA 1FJLA 4B43A 1IN6A 1OCTC 5FRMA 2D45A 3ASNH 2VONA 2FNPA 2YU9J 4LGWA 1W5TA 3AG2H 3FBNB 2E5NA 2G0EA 1IN4A 2JA8J 2DPUA 2DCEA 2KRCA 1GVJA 5CKTA 2LH9A 4ENKA 2JUCA 3E6MA 1LEBA 1ZELA 4XRSA 1XMKA 1ETVA 2AXLA 3K4CA 2Q8KA 2XC7A 1YOVB 4TV7A 5IP7J 2AO9A 3IRRA 2VN2A 4CCOA 2L7ZA 4AYBN 2CUEA 4XL9A 1ENHA 3J7AY 3NQOA 4DW6A 2K7LA 2Z1DA 4M3BA 4AIDA 1TQIA 4HNVA 3IWFA 3OS2A 2LFBA 1TWAJ 2RGVA 3R61A 2ID3A 5FFZA 4C3IJ 4HW0A 4PDKA 2DFFA 4FISA 2GOXB 2MH9A 3FXRA 2JQ7A 3MQ0A 1SD7A 4BDZA 2KPMA 3HZJA 1R00A 3BZKA 4LG3A 1Y1VJ 5AONA 2E1MB 4DIQA 1VQOI 4GFBA 4M3GA 2HYJA 1ONVA 2XAUA 1R36A 2R7FA 3CDHA 3ZQCA 3OR2C 4LFUA 3RKQA 2EBIA 2VASA 1OYWA 5GP9A 3QYBA 3I58A 4C2UA 2Y0SN 4N9IA 4RS8A 4QWQA 3OYAA 2IA1A 4CSWA 1KONA 5L3BA 1V3FA 3LSHA 3WTWC 3I55I 3FK6A 1TT0A 4HA8A 2GOMA 3WGHA 1UAAA 4HV6A 2W1OA 3RKWA 3L2VA 1XCVA 3QU6A 2HEOA 2DOEA 3JRHA 1JT0A 1IN8A 2CW0F 2H8WA 2M0CA 1BI0A 2O6GE 4Y15A 3GTJJ 2VJIA 3HKZN 3CC4I 1BBYA 4WF2A 4C3JJ 3T8TA 4FQGA 2VLAA 3VYRB 3OS1A 4AWXB 1RPWA 2R7QA 2XDVA 4D5FA 4HV5A 5HLHA 2NVYJ 2YS9A 1D0YA 2A07F 4JQFA 4UB6C 1IDZA 4ANJA 2IGOA 2W85A 2LY1A 1IG7A 5IY5H 3P7NA 2RQQA 1WJBA 2YR2A 4XNFA 2B7EA 3GYHX 1RESA 3LFKA 4X1EA 1Z7LA 4M71A 5TRDA 5LGUA 2ESHA 3BR0A 2EZLA 3V42A 3OYFA 3BCBA 2M4GA 2ZXHA 4ZH4F 2NVXJ 2R92J 2P8TA 3WHBA 5FGMA 2BYVE 2W82A 1S7OA 3DKXA 2K3FA 3SEQA 4G94A 1QRYA 2M8GX 1OKRA 1D1BA 4XM3A 2G7UA 2LP0A 1RR8C 3ECHA 2COBA 3BZCA 2CU7A 1O3RA 2CUFA 2FX0A 1QNTA 2V9PA 4V2GA 2QSHX 1JKRC 4XLNF 1EA3A 1I6HJ 1XB4A 2CQ7A 4KN7X 3OYKA 3GX4X 2BGCA 4F7ZA 4UXNA 4H0EA 5K7ZA 3Q9SA 2JPCA 2ZBKA 2XAQA 1H89C 2A6TA 2OTJI 1BI3A 4F92B 1RKTA 2E7XA 2EFQA 2FBKA 2ETHA 5FFXA 2VUMJ 2X6WA 1VQ7I 1PUFA 1NTCA 2IVMA 1P7IA 4U0VA 4L0YB 3ZQFA 3FM5A 3GTPJ 1YW8A 4BS9A 2NYXA 2P5VA 3E7LA 3QU3A 1XTAA 3F8BA 3OV8A 2KJBA 3MVPA 4BU2A 1QZEA 4M3DA 4FX0A 2ELJA 3SZTA 3JRGA 2QQBA 2Y2ZA 4ZZDA 2Y30A 1JUPA 3KFWX 3ULQB 2RAEA 1X58A 3RJPA 1VQ8I 4QSHA 4LK1F 4UVAA 5HVQC 3K1PA 4IL6C 3ZQIA 5KVRA 3H3ZA 4Y52J 1PYVA 1T56A 2JA6J 2FMLA 2VKEA 1O57A 4AD9A 4B4CA 4L9JA 5B3SH 2VQHA 1M1EB 1ORKA 1STZA 1W7PB 5EZGA 5EDNA 1REPC 2CV0A 2DFIA 3ZMDA 3RZOJ 1SFEA 2TRTA 1MBHA 3GWZA 4E70A 2K02A 2VOOA 5CVUA 2K85A 3ZR8X 1P4XA 2FE3A 1SAXA 4WWCA 4XKWA 1LNWA 3LOCA 1Y1WJ 1T8IA 3FWEA 4NC8A 4ESFA 5BMZA 4RB3C 1VQLI 4KA4A 1TW2A 4A3LJ 1FMWA 4PCQA 3PNYA 2MABA 1Y39A 3RQ4A 2E36A 2WB1N 4EM0B 3CQZJ 2XSJC 5HLTA 3WTXC 4XLEA 1XGNA 2BXZA 3V7SA 1GLNA 1S7AA 4HF0A 4PGHA 2JRMA 1XS9A 2CUZA 2WY7Q 4KICA 3WTUC 1XN7A 3L09A 3NWSA 5GTIC 2O03A 1SAUA 3VSLA 2L01A 1NK3P 1FYKA 2M7AA 1LFPA 3ISPA 1QZYA 3I3LA 4YEJA 2K9MA 3DXJF 3H0DA 3CCLI 5JLXA 1B9MA 3K1MA 4HF2A 4M73A 3A03A 4ESJA 1B8IA 2IGMA 2UWMA 1OQYA 1UG0A 2DI3A 2K5CA 5EJCA 2JJ7A 4HX4A 3TQNA 3F8FA 3LWFA 1L0OC 1UFMA 2IS1A 2H1KA 2EH3A 5LEJA 3JAMK 1VQ9I 3WGGA 3IH2A 1R23A 4I09A 5IYCJ 2XAFA 2HFHA 3HBLA 4BBSJ 4CYCA 4DJAA 1RRJA 3ONQA 1ETYA 1OLTA 4KUMA 3DLAA 2EA4A 3BC8A 5F0CA 4RB1A 3WTYC 4KMFA 1OPCA 1HKQA 1OFCX 1VF9A 5EEHA 2XKPA 2VL8A 1RETA 2JA5J 2ELHA 1NK2P 4N9HA 1A31A 4IQJA 1MH3A 1RKWA 4Y4RA 2D2WA 2R7ZJ 1QGPA 4ZZLA 4G7ZF 4FCYA 5GTHC 3S3MA 5D8LB 6PAXA 5CVVA 1YLFA 4HX8A 2LR8A 1KYZA 1R58A 3KETA 1K4SA 2LG4A 1K6YA 1XDUA 4PJ0C 1FOXA 3PSIA 1K83J 2HGCA 2NOGA 2QWWA 3ZXSA 3ZMZA 2STTA 4L9VA 4XKBA 2QUFA 5CPRB 4CCNA 5L3EA 3A2KA 1FT9A 2ISYA 1S5LC 1CF7A 4DZJA 1BJZA 3GTLJ 4A3CJ 4JP0A 3GZNB 1J09A 2DYSH 4ZTFA 3M9AA 5D4RA 1ZRCA 1ZG1A 2VB6A 3A0HC 2Z33A 2X1DA 3OOUA 3JRCA 1N77A 1I6XA 3W6JB 2W25A 4HSTA 2UXNA 3BR1A 2XUBA 1WGXA 2ZSIB 1S9HA 2BBYA 2HWVA 3OIOA 4DOZA 2JTVA 2N8GA 2W4SA 2HVRA 5HDNA 3LQRA 1I27A 1LDDA 3GF2A 1FSEA 3PJRA 3COAC 2ID6A 2MFZA 4P55A 4EEFG 4L0ZB 2BZTA 3PUBA 2HYFA 4OIPF 2JZYA 5DM7F 4FASD 4G8XA 3W2VA 3J81Z 3MAJA 1ETXA 1YE9A 3PNVA 1VTNC 3LSGA 3WTSC 3DQVC 5B66C 4M6YA 4A3DJ 1HDPA 4P9UA 3S17J 4I0AA 4ENJA 4A6DA 1TP4A 2PEXA 1O3TA 2F4IA 3JCUC 4ZC3A 3ZMVA 1DP7P 1MBKA 4AYBA 1BC7C 2KISA 2R5YA 3H5RA 1BI1A 3CZ6A 2GLOA 1SD4A 2B0LA 3ESWB 3HUGB 4UUTA 3S15J 3C2BA 4EVIA 2M2EA 1HQCA 4R8HA 1RNLA 3B73A 1B1BA 3ZN1A 3F21A 1ZGAA 5FKMA 2KZGA 2HOSA 1Z9CA 3O8GA 1G2HA 4P9FA 1I3QJ 1BOAA 1LJ9A 2L54A 5H6QA 1A36A 4CYDA
chains in the Genus database with same CATH topology
3CCRI 1VQ7I 2JQ7A 3CJTB 3CCUI 1VQ6I 1VQ4I 1YJWI 1VQPI 1VQOI 3J7ZI 1VQ5I 1VQNI 1VQ8I 1YJNI 3CD6I 3I55I 4IOCF 1FOXA 3CC2I 1YI2I 4V19K 2NXNB 3CMEI 1MMSA 2H8WA 3PIOF 1ACIA 3CC4I 5JVGF 3CCMI 3CC7I 1VQLI 2ZJRF 2E34A 3I56I 2QEXI 3J7YJ 1Y39A 3G71I 2E36A 3CCQI 1S72I 3CCJI 2E35A 3G6EI 3G4SI 5DM6F 1QA6A 1HC8A 4IO9F 5GADJ 2ZJQF 2ZJPF 5GAEJ 5DM7F 4IOAF 3CF5F 2K3FA 2QA4I 3PIPF 1YJ9I 3CCLI 1FOYA 3DLLF 3CMAI 3CCEI 1YHQI 3CCVI 5GAHJ 1VQKI 5GAGJ 3CCSI 1VQMI 2OTLI 1FOWA 2FOWA 1VQ9I 4UY8I 1YIJI 2OTJI 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR I;  1VQ7 I;  2JQ7 A;  3CJT B;  3CCU I;  1VQ6 I;  1VQ4 I;  1YJW I;  1VQP I;  1VQO I;  3J7Z I;  1VQ5 I;  1VQN I;  1VQ8 I;  1YJN I;  3CD6 I;  3I55 I;  4IOC F;  1FOX A;  3CC2 I;  1YI2 I;  4V19 K;  2NXN B;  3CME I;  1MMS A;  2H8W A;  3PIO F;  1ACI A;  3CC4 I;  5JVG F;  3CCM I;  3CC7 I;  1VQL I;  2ZJR F;  2E34 A;  3I56 I;  2QEX I;  3J7Y J;  1Y39 A;  3G71 I;  2E36 A;  3CCQ I;  1S72 I;  3CCJ I;  2E35 A;  3G6E I;  3G4S I;  5DM6 F;  1QA6 A;  1HC8 A;  4IO9 F;  5GAD J;  2ZJQ F;  2ZJP F;  5GAE J;  5DM7 F;  4IOA F;  3CF5 F;  2K3F A;  2QA4 I;  3PIP F;  1YJ9 I;  3CCL I;  1FOY A;  3DLL F;  3CMA I;  3CCE I;  1YHQ I;  3CCV I;  5GAH J;  1VQK I;  5GAG J;  3CCS I;  1VQM I;  2OTL I;  1FOW A;  2FOW A;  1VQ9 I;  4UY8 I;  1YIJ I;  2OTJ I;  1YIT I; 
#chains in the Genus database with same CATH topology
 2A5Y B;  1V4R A;  4WCG A;  1GVD A;  4KIT B;  2R7U A;  3CUQ C;  4RM3 A;  3MKL A;  3GFL A;  4BEH B;  1W5S A;  2CS3 A;  4G6D A;  3A4C A;  4XRF A;  3F3X A;  4LG0 B;  3M8E A;  3GVA A;  4E7K A;  1OCZ H;  4P5O A;  5DCM B;  3G1L A;  5ED4 A;  2M1B A;  1KU3 A;  5E8I A;  3ZMS A;  4CXF A;  1BR2 A;  5CLS A;  2DO7 A;  2DDB A;  4FE7 A;  3T1B A;  4G7H F;  5BQT A;  3JRI A;  1YW9 A;  3EQL F;  2WV1 A;  4XLA A;  2AS5 F;  3GFM A;  1O7F A;  2W24 A;  4FE4 A;  3ZP5 A;  2MH2 A;  3KP2 A;  4V19 K;  3HKZ A;  3GTG J;  3B6C A;  2DA1 A;  4I7H A;  4HEA 2;  2R93 J;  3KPH A;  2DA5 A;  2VE9 A;  3PIO F;  3IAM 2;  3KYD B;  4C9Y A;  2R7W A;  1O7L A;  2ZSH B;  4NUB A;  2QBY B;  2RQP A;  5HS8 A;  1VZ0 A;  2PJR B;  3HGY A;  1JKQ C;  3K4B A;  4F3Q A;  3OYI A;  1NH3 A;  1LE8 A;  4HDU A;  2K4B A;  1NG6 A;  2GXB A;  1G3W A;  3HTU A;  3TW7 A;  4HPQ A;  3S2W A;  3SDB A;  4MHG A;  3WG9 A;  4UUS A;  1CQT A;  3Q0V A;  2EFW A;  3DPU A;  4OAY A;  1VI0 A;  2M5W A;  2MD0 A;  3ZQ7 A;  4BJ6 C;  1IRG A;  4IO9 F;  3ZCO A;  2MG4 A;  2CRG A;  2TDX A;  3JSO A;  4OAZ A;  1JGS A;  3K4M A;  1D0X A;  5EGO A;  1FYM A;  2E60 A;  1IJW C;  1R5G A;  4BJT A;  1YQA A;  5A2Q Z;  5L3G A;  2Q1Z B;  4JX6 A;  5JHU A;  1T38 A;  3NAU A;  3C1D A;  2CO5 A;  3R0J A;  4RLQ A;  5EG0 A;  4LMY A;  4WXC A;  1A04 A;  1Z1D A;  2OCE A;  3G1O A;  3VFZ A;  3A01 A;  3ZQQ A;  2LOO A;  5D6E A;  2Z2S B;  3K4K A;  5KAF C;  2O8K A;  3CCY A;  3HSR A;  1SFU A;  2VKV A;  3TOA A;  2V6C A;  2YSR A;  3ZQH A;  1YTY A;  5F0F A;  1TW3 A;  4D1Q A;  3HSF A;  1WI9 A;  2X6Y A;  3BWG A;  4YFN F;  1MDM B;  1SMT A;  3V7R A;  4KNY A;  4CUG A;  2EV0 A;  1F5T A;  1MH4 A;  3VB2 A;  4U88 A;  4CCJ A;  3HYI A;  1ZTR A;  4G6T B;  5IP6 A;  1X1A A;  4XLH A;  3DEE A;  5IP9 J;  1J75 A;  2RRE A;  2NVQ J;  3KEQ A;  3CJT B;  3Q3S A;  4D7M A;  2GXA A;  2IRF G;  1GHC A;  5HS9 A;  1X19 A;  2DOF A;  3OL3 A;  4ZYG A;  2QQA A;  3DU5 A;  4ENN A;  2FF4 A;  3R60 A;  4A0X A;  1CGP A;  1U0J A;  1I3A A;  4A0Z A;  3BLY A;  2LKS A;  2CH0 A;  3PSF A;  1ZR2 A;  3J80 K;  4MQ9 F;  2JRT A;  1ON1 A;  1BIA A;  4KN4 X;  5E3N A;  1V5F A;  5EYR A;  4IOC F;  2MC3 A;  3BJO A;  1MMA A;  2WY8 Q;  4DGW B;  3DV8 A;  2PN6 A;  2FU4 A;  1IXC A;  3OR1 C;  1X1C A;  2NXN B;  1DP3 A;  1MJA A;  4M3F A;  2OA4 A;  5EEG A;  4U7B A;  4A3J J;  1KU7 A;  2VKD A;  5B5E C;  1V55 H;  3S3O A;  3O6B B;  1G59 A;  3ABM H;  3UNG C;  2WB1 A;  4RAZ A;  3SFI A;  2QSG X;  1R71 A;  2VPL A;  2M30 A;  1TZL A;  3CCM I;  4WXH A;  3CC7 I;  3AL0 B;  4RMN A;  1GV5 A;  5F0H A;  2COM A;  2ME6 A;  2YX7 A;  4XON A;  2IGK A;  3G71 I;  3IH3 A;  4ENM A;  2V6E A;  2DJN A;  1QHH D;  5JFR A;  1S3J A;  2K86 A;  5IYD J;  1JJ8 C;  4I2O A;  4GYI A;  3F23 A;  5ILV A;  1HDD C;  2YU3 A;  1XGO A;  2DMN A;  4JYK A;  2M0M A;  4CCL A;  3FZV A;  1TBX A;  2HOT A;  3HRM A;  1E0E A;  3R6S A;  1UB9 A;  5GAD J;  3L1P A;  4XR6 A;  4PSW A;  2M3A A;  1KGS A;  4L5E A;  2K9Q A;  2KQR A;  2Y48 A;  4BYY A;  1D3Y A;  4A6E A;  1ULY A;  2QSF X;  3TO6 A;  4CZZ A;  4RM2 A;  3LSP A;  1VFC A;  1WFX A;  4E4H A;  2P5L C;  3LMM A;  2RV8 A;  5ERI A;  3I53 A;  2G9W A;  1Z3Y A;  2OQR A;  5K5O A;  5FRN A;  2QCO A;  1V5G A;  4YII A;  5ILU A;  1IF1 A;  3ZPL A;  3SQN A;  1X2N A;  3CCE I;  1Z05 A;  2KLO A;  4L18 B;  2ZCW A;  2QZ8 A;  1DGR M;  1TQM A;  5GAG J;  4A3M J;  1H8A C;  3NRV A;  1UHW A;  1JGG A;  1I50 J;  2A05 A;  2DA7 A;  4EQQ A;  1U5T B;  4QLC U;  2DK5 A;  1IXS B;  3O2P E;  3MFK A;  1ZGJ A;  5EZH A;  4BBR J;  1JHF A;  3H36 A;  1U6G A;  4W1U A;  1JUM A;  3CF2 A;  2OC6 A;  3KYC B;  5FLX K;  3FMQ A;  1T08 B;  1R4M B;  4DYQ A;  3EUA A;  2K40 A;  1R6R A;  2EPF A;  3HOX J;  3ECO A;  4RAY A;  1B9N A;  2VXZ A;  2PBI A;  4AVP A;  1IUY A;  3MZ8 A;  3F8C A;  2FMY A;  2Y69 H;  3HDD A;  4RAF A;  4ZDO A;  3G2B A;  3OYN A;  2DW4 A;  3HRS A;  3S1R J;  2V1D A;  2ESN A;  3GTM J;  3F9K A;  1IRX A;  1F9N A;  3L7W A;  2BW3 A;  1SEU A;  2EZI A;  3I4M J;  2VQL A;  2VJ5 A;  4QPO A;  3CC2 I;  3LL7 A;  5FB2 A;  4XN3 A;  3VWB A;  2VBZ A;  4IRH A;  4CCK A;  2E1C A;  4Q5S F;  1GUU A;  1K7A A;  4EJT A;  2ICW G;  1SFK A;  2FQ4 A;  2LF7 A;  4K2E A;  3DTE A;  3IKV A;  3I54 A;  1ACI A;  4A3K J;  4BY7 J;  3WU0 A;  3RKY A;  2EFO A;  1OMI A;  1ZAO A;  4D5C A;  3J7A O;  1FP1 D;  1I5Z A;  1UHM A;  2DT7 B;  4B3X A;  3E6B A;  1Z77 A;  2A61 A;  2DBB A;  2L7M P;  1RI7 A;  2E35 A;  2GXG A;  4G12 A;  2P7V B;  2LMD A;  4A0Y A;  5LEK A;  1HC8 A;  3OIQ A;  1LKX A;  1OJL A;  1ZRE A;  1AWC A;  3SJM A;  2DT5 A;  2WA0 A;  3RPU A;  5E3L A;  1PUF B;  3BR3 A;  2F48 A;  3HRT A;  5HNF A;  3ZQL A;  1HLV A;  2VBW A;  1F36 A;  1OYI A;  2F5D A;  2ZKZ A;  2HDC A;  3TOB A;  2NS0 A;  2QQ8 A;  1Z3X A;  3TED A;  2WTE A;  2WAF A;  3A0B C;  3K2Z A;  3WG7 H;  4CGZ A;  4DBQ A;  3S1Q J;  2IS4 A;  2DA3 A;  5H20 A;  4IRI A;  3EPZ A;  3S93 A;  2HQR A;  4UB8 C;  2JA7 J;  2MBF A;  4KIF A;  3BR2 A;  3HJE A;  1YG2 A;  2KZV A;  1DU0 A;  3CJN A;  3MZH A;  2HKX A;  5IT3 A;  1IO2 A;  2VOD A;  3FXM A;  4UHT A;  1TNS A;  2JSP A;  1RIO H;  2XRL A;  5J6X A;  2FOW A;  3R0A A;  4RGU A;  3OYM A;  1FPQ A;  3HC7 A;  5D6F A;  2OTL I;  1FZP B;  4Y17 A;  2CQN A;  4DYC A;  3E6D A;  4A93 J;  2D1V A;  3EUK L;  3BRO A;  3PUF A;  3GCM A;  3VYT B;  2R7R A;  3L2U A;  3ABU A;  2E2I J;  2DTZ A;  3E5U A;  5EF6 A;  2ADU A;  2K9S A;  1YJW I;  1S6L A;  1U78 A;  1DDN A;  3HOY J;  2GBY A;  1I1S A;  2MLK A;  2CGP A;  3D5R C;  3LAP A;  1VQ5 I;  1P4W A;  1R4N B;  2JA2 A;  1G3T A;  2E2H J;  1W0U A;  1BW6 A;  5K7H A;  2OJE D;  3ZMU A;  1JTX A;  2EV5 A;  2KFD A;  4B47 A;  3QPT A;  2L4M A;  2X1E A;  3KX2 A;  3V4G A;  4I98 B;  1KQ9 A;  1MJB A;  1VND A;  2KT0 A;  3HPG A;  1D8K A;  4IJA A;  4PJJ A;  1KU2 A;  2TCT A;  4KT5 C;  2CV2 A;  1T39 A;  1B8I B;  5LRR A;  1LFU P;  3HG9 A;  2K3P A;  4LB5 A;  2LLK A;  2E1O A;  2R4G A;  3KZY A;  1EF4 A;  1BOB A;  2KMU A;  5J47 A;  4IHY A;  1J9I A;  2GIV A;  3FX3 A;  1ZAR A;  2ZJR F;  2E34 A;  3HIF A;  4DQ2 A;  2HKO A;  3FXU A;  2M7B A;  1WJD A;  1WH7 A;  1ETQ A;  1BR1 A;  3ERE D;  4UNO A;  2O61 A;  5E79 C;  2QQ9 A;  4AIJ A;  2IT0 A;  4HX7 A;  2KIU A;  4HNU A;  3OMY A;  4BH9 A;  4B09 A;  1DQU A;  2A68 F;  4CYC B;  2ZNZ A;  3LQQ A;  2X1C A;  3DU6 A;  4IQ4 A;  4C3H J;  2NVU B;  1FEX A;  4F52 A;  2CQQ A;  4RGX A;  3GLL A;  5GPA A;  4E7Z A;  2BHZ A;  3BTI A;  1XC5 A;  3G3Z A;  1QVU A;  3U1K A;  3TO7 A;  1SD5 A;  4N4N B;  3F6O A;  3T0Y A;  3OYE A;  3QYF A;  2AHQ A;  3P9C A;  1WJ5 A;  1W36 C;  2QA4 I;  3GME A;  2HPM A;  2LRE A;  4B48 A;  3FF5 A;  1E3O C;  3TGN A;  3K4N A;  3DLL F;  2AXT C;  4I01 A;  3LSJ A;  2JUG A;  3KP7 A;  2VQG A;  3V8K A;  3D5S C;  2RVC A;  1OCO H;  4MIM A;  3CMA I;  4BE2 A;  5IT9 Z;  3ZQG A;  3KEO A;  4XBF A;  1IDY A;  1U9N A;  1VQK I;  4JK1 X;  1FSH A;  1QPI A;  4PZJ A;  1LPQ A;  1MBG A;  5DEQ A;  2CW8 A;  1YIO A;  3FDY A;  3E5X A;  3E1S A;  3FIS A;  3WU1 B;  1K6O A;  1CF7 B;  2Y9Y A;  1Z91 A;  4C2M J;  2K27 A;  2HZD A;  2MLG A;  2FBH A;  1ZR4 A;  2QYO A;  1KYW A;  1ZQ3 P;  1ETK A;  1USS A;  1BI2 A;  2F2E A;  2ZJ2 A;  1WPK A;  2Y75 A;  1WWX A;  3SDG A;  3ABT A;  3BP8 A;  2HQA A;  5F08 A;  1ETW A;  1ZK8 A;  4RDU A;  5F1J A;  2XAG A;  2H27 A;  1XGM A;  2XRO A;  4CO8 A;  3J7Z I;  4IHW A;  1TC3 C;  1R49 A;  4YEL A;  3PNT A;  2E1M C;  1Z6R A;  5F64 A;  1BL0 A;  2K9N A;  2L0K A;  2VKH A;  3C3W A;  3CD6 I;  3FKJ A;  2DMP A;  3BOQ A;  1IUF A;  2H94 A;  2VPR A;  3I5U A;  4IHV A;  4J01 A;  3OIP A;  4BXF A;  4XKC A;  1A5J A;  4WK8 F;  2XIG A;  9ANT A;  3H9G A;  3ZRG A;  4RBO A;  1AHD P;  2VJ4 A;  3ABK H;  4UVC A;  2DMU A;  1A6I A;  2HQN A;  2GA2 A;  2H6B A;  5M3F J;  2BXY A;  3BPX A;  2JWT A;  1YRN A;  2R5Y B;  4FHT A;  4RGR A;  3CUQ A;  5HOD A;  2W57 A;  4B1R A;  1IV8 A;  2F5F A;  2D1H A;  3AG3 H;  3OSF A;  3JR9 A;  4WX9 A;  4GGG A;  3WE2 A;  2J5P A;  4YFK F;  2QEN A;  2WAD A;  3REO A;  3E6C C;  2KHM A;  1MD0 A;  2AQE A;  4M6V A;  3N97 A;  3OOP A;  1EH7 A;  2XF7 A;  3H0G J;  4IHT A;  4L5J A;  3CCQ I;  3R4K A;  3EET A;  1HST A;  3TKY A;  3K6G A;  1UST A;  1U2W A;  4J19 A;  4R79 A;  3BJ6 A;  1XMX A;  5BNG A;  1WJC A;  3PM1 A;  2VI6 A;  3PQK A;  2L9S A;  4U0W A;  4ZTJ A;  4IKF A;  1TLH B;  2PG4 A;  2DA2 A;  4AU7 A;  3CF5 F;  4A3B J;  2ZME A;  5E1Z B;  1QVT A;  2XPV A;  4BY1 J;  1X1B A;  5F04 A;  3LSR A;  2ZXI A;  3B02 A;  4B8X A;  5L3C A;  1ZRF A;  3S2D J;  1Z7U A;  4ESB A;  1QQI A;  2F5C A;  2YX4 A;  3GTQ J;  3GEZ A;  3PO2 J;  5J8F A;  3FMR A;  3ZOB A;  1Z21 A;  4MGR A;  5GAH J;  4XKV A;  3VPR A;  3QYE A;  3LFU A;  2HOA A;  1W36 D;  3EUH A;  2I8D A;  4U0Y A;  4E7I A;  4I76 A;  1VQM I;  3H3U A;  2J5O A;  1LUJ B;  1EKE A;  1H9G A;  3BTC A;  2V1X A;  3S1N J;  2A69 F;  4BGD A;  3CP2 A;  2CFO A;  2HR3 A;  3QP6 A;  1KQ8 A;  2KRF A;  4D0P A;  4CCM A;  2VOP A;  2ECC A;  2F4O B;  2NS7 A;  4RB0 A;  2CUJ A;  5KHD A;  2Q2E A;  1LE8 B;  1JJ6 C;  1O4X A;  3I4P A;  3PL8 A;  3G1M A;  4A12 A;  1BW5 A;  2H8R A;  1FBQ A;  4BHB A;  2UZK A;  3HOZ J;  2VIX A;  2R0Q C;  3ELK A;  1U9O A;  3QPS A;  4NC6 A;  1FIP A;  4U7D A;  2GIZ A;  2L02 A;  2P5K A;  3L00 A;  4XQF A;  1APL C;  3OYD A;  3F0C A;  5EGO B;  3KP6 A;  2EA2 A;  1D0Z A;  2R3S A;  1D5V A;  1E3P A;  4R1H A;  3GTK J;  5DS9 A;  3GBG A;  1HSJ A;  1MKM A;  4EJU A;  3MKW B;  4OIO F;  5EG0 B;  3A1Y A;  2ZXW H;  3RIR A;  2X9D A;  1MMS A;  3WTT C;  1LDK B;  1OIS A;  1OR7 C;  2DYR H;  1X2M A;  1WQ2 A;  1P7J A;  5C4J J;  3KP3 A;  2I5U A;  3A01 B;  3K10 A;  2P0W A;  1IW7 F;  2BE5 F;  1DGW Y;  4HSR A;  2UV1 A;  4M9Z A;  3I56 I;  3MD2 A;  1R1U A;  4Q47 A;  5E1W A;  5D5X B;  4EV0 A;  5B1B H;  1EH6 A;  3Q9V A;  4HLY A;  4G6Q A;  2PMZ N;  3RYR A;  3OYG A;  3G4S I;  3E5Q A;  2X4H A;  4RLF A;  4NB5 A;  3S14 J;  4YG2 F;  2ZME C;  1IGN A;  3GUD A;  2JVH A;  3V7C A;  5HLG A;  5M5X J;  1AKH A;  3S16 J;  3RSN A;  1PDN C;  4UUV A;  4H4K C;  2C6Y A;  3C2G A;  4IOA F;  2XB0 X;  4HQE A;  2EIN H;  1UCR A;  3QQA A;  2WAE A;  4AC0 A;  4RGS A;  3WOD F;  1MMD A;  1WI3 A;  3OYL A;  1YJ9 I;  1EJ9 A;  1FOY A;  3KP5 A;  2XF6 A;  3EUH C;  3C2H A;  1O3Q A;  2EB7 A;  3CUO A;  1MSE C;  1WRJ A;  4ZYA A;  2LY9 A;  3BDD A;  2X85 A;  4A3F J;  1K78 A;  2KKO A;  1YHQ I;  4NNJ A;  1C0W A;  2DOD A;  3CCV I;  4O6J A;  2A6H F;  3M8F A;  1N75 A;  4LOC A;  1QU3 A;  3EYY A;  2XRN A;  3VOE A;  3WTV C;  1OCR H;  2DQL A;  5TJJ A;  1F4K A;  5J3L A;  2IP2 A;  3SYT A;  4QPQ A;  3MCZ A;  1W1W E;  1DUX C;  1ITY A;  5ICC A;  1FOW A;  3DCF A;  3W6V A;  3SEZ A;  1FX7 A;  1JUS A;  2BY0 A;  4ZDP A;  1W4M A;  5ICG A;  2CMP A;  4EM1 A;  2CSO A;  2DT6 A;  4CA0 A;  1EV7 A;  2W7N A;  5BOX A;  2M9H A;  2VC0 A;  4GRI A;  3S1M J;  3WE3 A;  3M07 A;  4HQM A;  1JHH A;  4ITV A;  2PI0 A;  3J81 K;  5TGT A;  2BOL A;  1SVO A;  3L2R A;  5LHI A;  1X1D A;  1Y8R B;  1SD6 A;  1WKM A;  5JHF A;  3H5A A;  2PQ8 A;  1DPU A;  3I59 A;  1P92 A;  3WTZ A;  2GAU A;  1ZG3 A;  1LEA A;  2L7K A;  2OPT A;  3BR6 A;  3IL2 A;  3E97 A;  5TIS C;  3T8R A;  1OYY A;  2R7O A;  4Y3O A;  1U3E M;  2V9K A;  5M3M J;  3T5X A;  1YI2 I;  2DN0 A;  5FO5 A;  3VOD A;  4L5I A;  2X0L A;  4HOB A;  3CLQ A;  5FD5 A;  4D7N A;  4A3E J;  1J5Y A;  1GDT A;  1RUN A;  1RUO A;  1K61 A;  1XGS A;  2CWE A;  5FLX Z;  4MQV A;  1SC7 A;  3ZMT A;  5K1Y A;  3CO7 C;  4NC7 A;  2IS2 A;  3FM3 A;  1WJE A;  3KZZ A;  4JX5 A;  1SVM A;  3J7Y J;  1Z0X A;  3DWL E;  1W7P D;  5L3D A;  3JRE A;  5L3F A;  1WSU A;  1PJR A;  3HGG A;  3HOT A;  3CJQ B;  3H92 A;  4PJL A;  5CQG A;  3NWT A;  4A5N A;  4YIR X;  4OMZ A;  1HA8 A;  5DM6 F;  4BHP A;  3I64 A;  3U2R A;  3O8H A;  1FOK A;  4JBA A;  2F4M B;  1MSF C;  3F8M A;  3L2C A;  4I02 A;  3VYS B;  1YS6 A;  2H09 A;  2JT1 A;  1GT0 C;  2A3S A;  2GWR A;  2EIK H;  1E3H A;  1YX5 A;  3FK7 A;  1HCR A;  2XF5 A;  3M7G A;  5LFA A;  2OU2 A;  2G7H A;  4BAC A;  3K69 A;  3OYC A;  3DTK A;  3F8N A;  1YFH A;  1IV6 A;  4OMY A;  2KDZ A;  4OWR B;  3FXL A;  2NOJ B;  2MW8 A;  3IUO A;  4BQA A;  5IPA A;  1HW2 A;  1K79 A;  2VBY A;  3P9K A;  2BW3 B;  2WC2 A;  3K4L A;  2V26 A;  3L2W A;  5FKL A;  1W5C C;  2XSD C;  1IN7 A;  4V2F A;  3AAF A;  5JI6 A;  2RC4 A;  3JRA A;  1TWG J;  4XOR A;  3MKY B;  3BG6 A;  3SZP A;  5E17 F;  1FY7 A;  2R5Z A;  2WV0 A;  2VC1 A;  2L9N A;  3WHC A;  3CP8 A;  4PFP A;  1WJA A;  4LK0 F;  1YIT I;  3FHZ A;  3BQZ A;  4FX4 A;  2MC4 A;  4GDF A;  4S0H B;  5A2Q K;  1Y0N A;  2RKH A;  4I0B A;  2QGU A;  1OCC H;  3SFZ A;  4GCV A;  2WBM A;  3FXJ A;  1VQP I;  4Z2Y A;  1BR4 A;  3FXK A;  4KMU X;  1E2X A;  4IX7 A;  3IWZ A;  3M8J A;  1J0R A;  2L7F P;  3TL4 X;  1E17 A;  1R7J A;  3F72 A;  4XSZ F;  1LDJ A;  4HBL A;  2HOE A;  1YJN I;  2X51 A;  4BJ5 C;  2FQ3 A;  5DTD A;  2IJL A;  4LLG F;  2F5E A;  3QP5 A;  4PJM A;  4ABZ A;  4LIU A;  1QZZ A;  2WAQ N;  2HPI A;  4OOI A;  4XLC A;  2EIL H;  5ICE A;  3BG7 A;  3RPQ A;  4BHC A;  2V79 A;  2DJI A;  3HHH A;  2GZW A;  2L4A A;  1POG A;  1BN5 A;  3X2Q H;  5JVT A;  4F93 B;  2UUZ A;  2FUG 2;  2FD5 A;  4WXD A;  1R9T J;  1WCM J;  5B1A H;  2FOK A;  5E3M A;  2BY2 A;  3LA7 A;  3QOP A;  1AOY A;  1ODD A;  4BQO A;  4EGY A;  4KFC A;  1Y0U A;  1ON2 A;  1UHS A;  1UEL B;  5E20 A;  1U8B A;  1EH8 A;  2QLZ A;  2RDP A;  4RA2 A;  3LST A;  4XRS G;  3H9J A;  4CH7 A;  2D5V A;  5KCM A;  1ZN2 A;  3AFH A;  4EJV A;  2Y31 A;  3K0L A;  4M72 A;  2LBF A;  3DFG A;  1G6N A;  2H6C A;  2NS8 A;  2ZFW A;  4M6X A;  1HOM A;  1MBE A;  4YFX F;  3V8L A;  5GAE J;  3KIO A;  1KZH A;  3BR5 A;  1KU9 A;  2E5Z A;  2DK8 A;  4JX4 A;  1H9T A;  1DPR A;  5FLV A;  2R7S A;  5C4X J;  5KK1 A;  5D5W B;  3BY6 A;  4XRM A;  4BL0 B;  4AM3 A;  2HVS A;  5LGN A;  2XAH A;  1X4P A;  2LVS A;  2XGX A;  1RC9 A;  3FMS A;  3K7A J;  3RDI A;  1IC8 A;  2IS6 A;  1B72 A;  4NQW A;  4PFO A;  3HOS A;  1ZLK A;  2L5Q A;  1HKS A;  5J8C A;  2HDD A;  4JOM A;  3JRD A;  3PFI A;  5CVR A;  1WJF A;  2JN6 A;  5KAI C;  4LLL A;  1HF0 A;  2K4J A;  1R5I D;  2CW7 A;  2QM3 A;  2VT3 A;  2XGD A;  3HPH A;  3JRB A;  5BPI A;  4EJW A;  3U21 A;  2EK5 A;  3VYU B;  1T0F C;  2NNY A;  2O8X A;  4ZYH A;  3VEP A;  3KLN A;  2ELK A;  1HW1 A;  4BUP A;  3L9F A;  5M5W J;  2PMU A;  3CES A;  1MBJ A;  4XSX F;  1AA7 A;  1FWZ A;  3SXY A;  2EV6 A;  2ISZ A;  3BG3 A;  1IN5 A;  1U5T A;  1Y6I A;  2O3F A;  3K1N A;  3MKZ A;  2JMW A;  2L9R A;  3F22 A;  2GA1 A;  3IV5 A;  4W97 A;  3W2W A;  3B6A A;  1Y8Q B;  1IRF A;  2LRD A;  1XSV A;  2CQK A;  5LLQ A;  1IRZ A;  3DBH B;  2IEK A;  3CDL A;  5HDK A;  1YO5 C;  3M1C A;  2HU9 A;  3QPH A;  2KIM A;  5JR3 A;  5DUI A;  1ETO A;  3W2A A;  3QOD A;  2PMH A;  3SHF A;  1ZGW A;  2EIJ H;  4QIW N;  3GFJ A;  4AVZ A;  4HAM A;  3CO6 C;  2GQQ A;  2UXX A;  2OUM A;  3JTH A;  2V4J C;  3FHN A;  5LRS A;  3KE2 A;  1BJA A;  2PMZ A;  3N4M A;  2R7T A;  2HI3 A;  1JXS A;  1IZ1 A;  5CVI A;  1FMV A;  1YW7 A;  4XLP F;  2EFP A;  3AL0 C;  4U87 A;  3VSK A;  3HOV J;  4CZC A;  1FIA A;  5J4V A;  2PLY A;  1ZLJ A;  3FIW A;  3NAR A;  3K70 C;  2BVL A;  2XAS A;  5DYM A;  2Z9O A;  4MEY F;  3JAM Z;  1V5E A;  2HTJ A;  3MEX A;  4A2U A;  4AIK A;  2A6E F;  1QA6 A;  1P9Q C;  3H35 A;  3LNQ A;  3KCC A;  2LDU A;  5K7F A;  2STW A;  2OQG A;  3TDZ C;  1UG2 A;  2EWN A;  2HTS A;  2ZJQ F;  2KP6 A;  3ROU A;  1B4A A;  3RZD J;  3DEW A;  2P4W A;  1I1G A;  1FLI A;  3TP0 A;  3HHG A;  1MNM C;  4E7J A;  4PUS A;  3BG5 A;  3P9I A;  4LB6 B;  2LY2 A;  3I0T A;  4HLX A;  4AIH A;  3GTO J;  4IHS A;  1FTT A;  1ZKG A;  4A3G J;  1Q1V A;  4UV9 A;  2FJ1 A;  3WU2 C;  3Q0W A;  2YPR A;  1HKT A;  5DCF A;  5CYV A;  4EM2 A;  2XGE A;  2BEO A;  2BVM A;  4L9T A;  2E19 A;  2KRH A;  2Y9Z A;  3GZ5 A;  1X3Z B;  2Y0M A;  2FBI A;  2OZ6 A;  1YRN B;  2HDW A;  1YIJ I;  3RYP A;  1LQ1 A;  4MTE A;  1U5T C;  3GLX A;  1J2X A;  3CUQ B;  3DTI A;  1FP2 A;  3QAH A;  2XPW A;  3P5J A;  4XIC A;  3S2H J;  2OD5 A;  2ZC2 A;  3BTL A;  3CCR I;  3KP4 A;  4BAY A;  3CCU I;  3FBI B;  1VQ4 I;  1VQ6 I;  1G3Y A;  2OAZ A;  4S04 A;  3KYL A;  2HZT A;  4Z6Y A;  4M3E A;  5BPD A;  2O5R A;  1XSD A;  2DAO A;  4OIR F;  5E3O A;  1R22 A;  2IGN A;  2KDO A;  3JRF A;  4G7O F;  2E7W A;  5CVJ A;  4ZYD A;  1RR7 A;  2RNG A;  4LLN A;  4FT8 A;  2X48 A;  4BQN A;  1JKP C;  2DMQ A;  3DP7 A;  2ZXJ A;  5JLW A;  3HTS B;  3FKI J;  3KEY A;  1A35 A;  2ZME B;  2B63 J;  5FJ8 J;  2NVT J;  4IHX A;  1X1P A;  3IAS 2;  3I4N J;  2E71 A;  2MSY A;  3D0S A;  2E2J J;  5FKK A;  4EAT A;  2ACJ A;  2KJC A;  4HDV A;  3OSG A;  2ZNY A;  2XHK A;  1W0T A;  2DLL A;  2R7X A;  2XPU A;  5BS6 A;  4M9X A;  4Y13 A;  1WH5 A;  2AQF A;  1QO0 D;  4DYR A;  4M9S A;  2VT2 A;  5JVG F;  3OYB A;  1P4A A;  1UJ8 A;  4LJZ F;  4GYG A;  5FKO A;  3ABL H;  5FKN A;  2R7D A;  3NEU A;  1BIB A;  2V1N A;  2HXI A;  1TQP A;  1XCB A;  3Q0U A;  3M3Y J;  4HRI A;  4II3 A;  3IKT A;  2PFB A;  1B6A A;  3CCJ I;  2PX9 A;  2R7V A;  3G6E I;  3CDI A;  1TNT A;  2EZH A;  4MFD A;  4DBR A;  4ON0 A;  2M8E A;  4Q48 A;  1XDS A;  2O0Y A;  2Q2E B;  2HXO A;  5K5R A;  3OS0 A;  2V1U A;  1ERD A;  3HRU A;  3D5L A;  4PJN A;  1H0M A;  4IXA A;  1TWF J;  4OIN F;  1FYL A;  1MGT A;  5M5Y J;  1R1T A;  1JT6 A;  3K70 D;  1MMN A;  4ETS A;  1W7P A;  1OR7 A;  4PSX A;  2DTR A;  5AIP A;  1H88 C;  1JE8 A;  2KIQ A;  4XMY A;  1MMG A;  5H6R A;  3CTA A;  4BXU A;  2FA5 A;  2DFH A;  4OU0 A;  1SFX A;  2DPD A;  2L3D A;  1ZHF A;  2P6S A;  3TBI A;  4ASN A;  1ZRD A;  3M1E A;  4I6Z A;  5DDG A;  5J1Y A;  2CYY A;  5DUK A;  4KIB A;  2EFN A;  2OV7 A;  1PP7 U;  4X6A J;  2W00 A;  4NHJ A;  2PJP A;  1JTY A;  4Y7N J;  5D5V B;  5C44 J;  4E7H A;  4IPA A;  4FET A;  4KJZ A;  4D9J A;  4BNC A;  5E1X A;  2H1L A;  2VE8 A;  1N78 A;  3IRQ A;  1Y56 A;  2LF8 A;  3LA3 A;  1FBU A;  1XX5 A;  3L2Q A;  2DFE A;  1J59 A;  2HYG D;  4P96 A;  4HYE A;  1QHG A;  5IYB J;  1Q1H A;  1R5H A;  3RPU D;  2ECB A;  2LKX A;  5LBQ A;  1T33 A;  3ML6 A;  4BE1 A;  2LYC A;  1XMA A;  3MWM A;  4PK4 A;  5D8K B;  4BXX J;  1U8R A;  3LA2 A;  5HNH A;  2LKP A;  2WAQ A;  4LIT A;  4FTH A;  4L9N A;  3G73 A;  2LD5 A;  1BC8 C;  5IT9 K;  3BTJ A;  3TO9 A;  1PVE A;  3GW2 A;  1AKH B;  4KYW A;  3BCA A;  1T2K A;  5F27 A;  1YS7 A;  3DEU A;  5HLI A;  3PO3 J;  2CV1 A;  4MEX F;  4J00 A;  5IOZ A;  4ZJZ A;  3BQY A;  3CLO A;  5LGT A;  4E7L A;  2NRA C;  1J7K A;  3CME I;  4ZDL A;  2QKM B;  1SVL A;  4UUS B;  4KIS A;  1G4D A;  3HM5 A;  2DA4 A;  1K78 B;  5C3E J;  1G8X A;  1LVA A;  4XK4 A;  1O3S A;  5D5U B;  1MBF A;  5LHG A;  2P6T A;  3DPL C;  2P81 A;  4GXO A;  4N0B A;  4N4O B;  2QEX I;  3S32 A;  1KA8 A;  1FC3 A;  2ZFU A;  4B3A A;  2RN7 A;  2V7F A;  3QPL A;  1JI8 A;  4DZP A;  2OF7 A;  3HL2 A;  2BY3 A;  2DMT A;  3UR3 C;  2B9S A;  4P1W A;  3GXO A;  4IEJ A;  1PP8 F;  1S29 A;  1PUE E;  2OZU A;  2RNJ A;  2VXD A;  1D5Y A;  2XB5 A;  5DD4 A;  3BZ6 A;  1RZ4 A;  4BE0 A;  1QBJ A;  3GO5 A;  4IRG A;  3IC7 A;  4M74 A;  5E8G A;  2Z99 A;  3KZI C;  2ZJP F;  2L2O A;  1GXQ A;  3HXL A;  4YRV A;  1WVR A;  4NBQ A;  4MNU A;  4XID A;  5EEA A;  1B59 A;  1T6S A;  3F6V A;  1D1A A;  2XKO A;  3TDU C;  2VJJ A;  3I59 B;  2IW5 A;  3RQI A;  3PQJ A;  5H2F C;  2L9V A;  2EJR A;  2HS5 A;  3DKW A;  4I99 C;  4MO7 A;  3SZG A;  1ZG5 A;  3J80 Z;  4QTR A;  3TMO A;  2Q0O A;  2HQ5 A;  2Y0S A;  4MFE A;  4IVN A;  2IA2 A;  4E6K G;  3CCS I;  1Z67 A;  2IBD A;  2VQC A;  4RB2 C;  5HS7 A;  2ME0 A;  3FXQ A;  1IXR C;  1SAN A;  3K9T A;  4NDL A;  3CMY A;  1LFB A;  2XGC A;  2LK2 A;  3HOW J;  4XN0 A;  4UY8 I;  2FSW A;  2HNH A;  1I39 A;  3OYH A;  1D1C A;  1FNN A;  5FRO A;  1X3W B;  5KNL A;  1BA5 A;  1NG7 A;  5HDG A;  5F1R A;  2BHY A;  1SMY F;  1NHA A;  4G9Y A;  2LSO A;  2DQR A;  2EZK A;  1HW5 A;  4O5V A;  1MIJ A;  5AIQ A;  3IP4 B;  2Z3Y A;  4ZYE A;  1XPX A;  2LNB A;  1MZB A;  3K2A A;  5ICF A;  4CIC A;  3C7J A;  3H5N A;  3KLO A;  3E3V A;  4O3M A;  2KIF A;  1QPM A;  2YUS A;  1VQN I;  3LSM A;  3OWT A;  2P7C B;  5F6F A;  5J1U A;  1S8N A;  3QRF F;  5LD2 C;  3AKZ A;  3DF8 A;  3O3K A;  1IAW A;  4X0G A;  2M87 A;  3W6K B;  3EYI A;  5CJ9 A;  1D8J A;  1DU6 A;  2M34 A;  1K4T A;  2CG4 A;  4Y33 A;  3FXO A;  1TWC J;  2IA0 A;  3HUG A;  2VBX A;  2CFX A;  3OL4 A;  4MLO A;  4BQQ A;  1FBS A;  5IOY A;  3WGI A;  3IH4 A;  5GPC A;  2QKL B;  1V54 H;  4IZZ A;  1TTY A;  3A02 A;  4F55 A;  1MJ9 A;  4HZF A;  5J4Y A;  3TP3 A;  1WZ2 A;  2K9L A;  1ZYR F;  5J40 A;  2O7O A;  4BEH A;  2R5Z B;  4LG0 A;  3I9V 2;  2O9L A;  2BV6 A;  3H9Q A;  1G3S A;  3S8P A;  5DCM A;  2A5W A;  3E0J B;  1HBX G;  4A3I J;  1S7E A;  3S3N A;  2GM4 A;  4BDY A;  2W84 A;  2ZO4 A;  2FXA A;  2MD5 A;  1N25 A;  1P6R A;  4LIV A;  4XLF A;  4AUX A;  3W3C A;  1OCP A;  3DKY A;  3RKX A;  3QWL A;  3JW4 A;  1KQ0 A;  2JK3 A;  3RCO A;  2V9V A;  4DNC A;  4C2T A;  4HF1 A;  3PIP F;  3BJA A;  3RTR A;  1XD7 A;  2NAZ A;  2QVO A;  3MN2 A;  3PFY A;  1JKO C;  3HB9 A;  3RI4 A;  2F5V A;  3AG1 H;  3GFI A;  1MW7 A;  4EMS A;  2DU9 A;  5J1R A;  2QBY A;  1T95 A;  4S05 A;  4CDG A;  4GO1 A;  2HVQ A;  5FD6 A;  3UKG A;  3DPT A;  4II2 A;  2PJR A;  2FNA A;  4RAG A;  2X6O A;  3IHU A;  4XOP A;  3LSK A;  1TL8 A;  3ASO H;  5DV5 A;  1L3L A;  2IXS A;  3ERM A;  1AU7 A;  2XVC A;  4C30 A;  3D1N I;  2MA3 A;  2M45 A;  2JSC A;  3AG4 H;  2IPQ X;  3HSE A;  3V8J A;  3ZGK A;  1F43 A;  3JSP A;  3MMY B;  1LVK A;  4OIQ F;  3Q5F A;  5D4S A;  2M4K A;  3EDP A;  4UV8 A;  1XSX A;  2CJJ A;  3U9G A;  3LAJ A;  3HOU J;  3BPV A;  1TT5 B;  5E18 F;  2Z16 A;  2BY1 A;  4LD5 A;  5LHH A;  3DBL B;  3N05 A;  1SFO J;  1P2F A;  1GXP A;  1Z6T A;  3CMM A;  1WHU A;  3CJR B;  3OY9 A;  3K4J A;  2OCC H;  4B44 A;  2LBF B;  2OBP A;  2WWY A;  4A69 C;  3ZN0 A;  3TW6 A;  3VDX A;  2MYS A;  2JPB A;  4PGG A;  2DXI A;  4KIG A;  1HXD A;  4A5M A;  4Q4Z F;  1T0F A;  1MND A;  1UZC A;  2I10 A;  1GV2 A;  1R1V A;  2W48 A;  2XAJ A;  2KL4 A;  3LSI A;  2NNN A;  1XG1 A;  4NQW B;  1B72 B;  1MDM A;  4BKX A;  2Z5U A;  5FLM J;  4XOT A;  1T98 A;  2JVG A;  4HNT A;  2DA6 A;  3MZY A;  5DD8 A;  3GZ6 A;  1LB2 A;  2MGQ A;  2IAI A;  4F91 B;  3BG9 A;  1ZH5 A;  3H3V K;  3M4O J;  4EJO A;  3I71 A;  1FTZ A;  1A6Q A;  2CQX A;  1MNE A;  2QF7 A;  2FEZ A;  1S72 I;  3DBR B;  4IF4 A;  1X4O A;  2E1N A;  2EQR A;  4HG2 A;  2LC2 A;  3JTG A;  3BT9 A;  2EIM H;  2LTP A;  2F6C A;  3U1D A;  5HOO A;  3OYJ A;  4E7S A;  4CHU A;  2ZB9 A;  1YX3 A;  3HEF A;  4KDP A;  3C18 A;  2X6X A;  3H1C A;  2FRH A;  2DDA A;  4KT6 A;  1UMQ A;  2DOA A;  3QOE A;  5ILS A;  4MTD A;  5CQE A;  1BM9 A;  1X3U A;  1F1Z A;  1TWH J;  4UVB A;  5K5Q A;  4EGZ A;  2XV4 S;  1YYV A;  4YIF A;  1FJL A;  4B43 A;  1IN6 A;  1OCT C;  5FRM A;  2D45 A;  3ASN H;  2VON A;  2FNP A;  2YU9 J;  4LGW A;  1W5T A;  3AG2 H;  3FBN B;  2E5N A;  2G0E A;  1IN4 A;  2JA8 J;  2DPU A;  2DCE A;  2KRC A;  1GVJ A;  5CKT A;  2LH9 A;  4ENK A;  2JUC A;  3E6M A;  1LEB A;  1ZEL A;  4XRS A;  1XMK A;  1ETV A;  2AXL A;  3K4C A;  2Q8K A;  2XC7 A;  1YOV B;  4TV7 A;  5IP7 J;  2AO9 A;  3IRR A;  2VN2 A;  4CCO A;  2L7Z A;  4AYB N;  2CUE A;  4XL9 A;  1ENH A;  3J7A Y;  3NQO A;  4DW6 A;  2K7L A;  2Z1D A;  4M3B A;  4AID A;  1TQI A;  4HNV A;  3IWF A;  3OS2 A;  2LFB A;  1TWA J;  2RGV A;  3R61 A;  2ID3 A;  5FFZ A;  4C3I J;  4HW0 A;  4PDK A;  2DFF A;  4FIS A;  2GOX B;  2MH9 A;  3FXR A;  2JQ7 A;  3MQ0 A;  1SD7 A;  4BDZ A;  2KPM A;  3HZJ A;  1R00 A;  3BZK A;  4LG3 A;  1Y1V J;  5AON A;  2E1M B;  4DIQ A;  1VQO I;  4GFB A;  4M3G A;  2HYJ A;  1ONV A;  2XAU A;  1R36 A;  2R7F A;  3CDH A;  3ZQC A;  3OR2 C;  4LFU A;  3RKQ A;  2EBI A;  2VAS A;  1OYW A;  5GP9 A;  3QYB A;  3I58 A;  4C2U A;  2Y0S N;  4N9I A;  4RS8 A;  4QWQ A;  3OYA A;  2IA1 A;  4CSW A;  1KON A;  5L3B A;  1V3F A;  3LSH A;  3WTW C;  3I55 I;  3FK6 A;  1TT0 A;  4HA8 A;  2GOM A;  3WGH A;  1UAA A;  4HV6 A;  2W1O A;  3RKW A;  3L2V A;  1XCV A;  3QU6 A;  2HEO A;  2DOE A;  3JRH A;  1JT0 A;  1IN8 A;  2CW0 F;  2H8W A;  2M0C A;  1BI0 A;  2O6G E;  4Y15 A;  3GTJ J;  2VJI A;  3HKZ N;  3CC4 I;  1BBY A;  4WF2 A;  4C3J J;  3T8T A;  4FQG A;  2VLA A;  3VYR B;  3OS1 A;  4AWX B;  1RPW A;  2R7Q A;  2XDV A;  4D5F A;  4HV5 A;  5HLH A;  2NVY J;  2YS9 A;  1D0Y A;  2A07 F;  4JQF A;  4UB6 C;  1IDZ A;  4ANJ A;  2IGO A;  2W85 A;  2LY1 A;  1IG7 A;  5IY5 H;  3P7N A;  2RQQ A;  1WJB A;  2YR2 A;  4XNF A;  2B7E A;  3GYH X;  1RES A;  3LFK A;  4X1E A;  1Z7L A;  4M71 A;  5TRD A;  5LGU A;  2ESH A;  3BR0 A;  2EZL A;  3V42 A;  3OYF A;  3BCB A;  2M4G A;  2ZXH A;  4ZH4 F;  2NVX J;  2R92 J;  2P8T A;  3WHB A;  5FGM A;  2BYV E;  2W82 A;  1S7O A;  3DKX A;  2K3F A;  3SEQ A;  4G94 A;  1QRY A;  2M8G X;  1OKR A;  1D1B A;  4XM3 A;  2G7U A;  2LP0 A;  1RR8 C;  3ECH A;  2COB A;  3BZC A;  2CU7 A;  1O3R A;  2CUF A;  2FX0 A;  1QNT A;  2V9P A;  4V2G A;  2QSH X;  1JKR C;  4XLN F;  1EA3 A;  1I6H J;  1XB4 A;  2CQ7 A;  4KN7 X;  3OYK A;  3GX4 X;  2BGC A;  4F7Z A;  4UXN A;  4H0E A;  5K7Z A;  3Q9S A;  2JPC A;  2ZBK A;  2XAQ A;  1H89 C;  2A6T A;  2OTJ I;  1BI3 A;  4F92 B;  1RKT A;  2E7X A;  2EFQ A;  2FBK A;  2ETH A;  5FFX A;  2VUM J;  2X6W A;  1VQ7 I;  1PUF A;  1NTC A;  2IVM A;  1P7I A;  4U0V A;  4L0Y B;  3ZQF A;  3FM5 A;  3GTP J;  1YW8 A;  4BS9 A;  2NYX A;  2P5V A;  3E7L A;  3QU3 A;  1XTA A;  3F8B A;  3OV8 A;  2KJB A;  3MVP A;  4BU2 A;  1QZE A;  4M3D A;  4FX0 A;  2ELJ A;  3SZT A;  3JRG A;  2QQB A;  2Y2Z A;  4ZZD A;  2Y30 A;  1JUP A;  3KFW X;  3ULQ B;  2RAE A;  1X58 A;  3RJP A;  1VQ8 I;  4QSH A;  4LK1 F;  4UVA A;  5HVQ C;  3K1P A;  4IL6 C;  3ZQI A;  5KVR A;  3H3Z A;  4Y52 J;  1PYV A;  1T56 A;  2JA6 J;  2FML A;  2VKE A;  1O57 A;  4AD9 A;  4B4C A;  4L9J A;  5B3S H;  2VQH A;  1M1E B;  1ORK A;  1STZ A;  1W7P B;  5EZG A;  5EDN A;  1REP C;  2CV0 A;  2DFI A;  3ZMD A;  3RZO J;  1SFE A;  2TRT A;  1MBH A;  3GWZ A;  4E70 A;  2K02 A;  2VOO A;  5CVU A;  2K85 A;  3ZR8 X;  1P4X A;  2FE3 A;  1SAX A;  4WWC A;  4XKW A;  1LNW A;  3LOC A;  1Y1W J;  1T8I A;  3FWE A;  4NC8 A;  4ESF A;  5BMZ A;  4RB3 C;  1VQL I;  4KA4 A;  1TW2 A;  4A3L J;  1FMW A;  4PCQ A;  3PNY A;  2MAB A;  1Y39 A;  3RQ4 A;  2E36 A;  2WB1 N;  4EM0 B;  3CQZ J;  2XSJ C;  5HLT A;  3WTX C;  4XLE A;  1XGN A;  2BXZ A;  3V7S A;  1GLN A;  1S7A A;  4HF0 A;  4PGH A;  2JRM A;  1XS9 A;  2CUZ A;  2WY7 Q;  4KIC A;  3WTU C;  1XN7 A;  3L09 A;  3NWS A;  5GTI C;  2O03 A;  1SAU A;  3VSL A;  2L01 A;  1NK3 P;  1FYK A;  2M7A A;  1LFP A;  3ISP A;  1QZY A;  3I3L A;  4YEJ A;  2K9M A;  3DXJ F;  3H0D A;  3CCL I;  5JLX A;  1B9M A;  3K1M A;  4HF2 A;  4M73 A;  3A03 A;  4ESJ A;  1B8I A;  2IGM A;  2UWM A;  1OQY A;  1UG0 A;  2DI3 A;  2K5C A;  5EJC A;  2JJ7 A;  4HX4 A;  3TQN A;  3F8F A;  3LWF A;  1L0O C;  1UFM A;  2IS1 A;  2H1K A;  2EH3 A;  5LEJ A;  3JAM K;  1VQ9 I;  3WGG A;  3IH2 A;  1R23 A;  4I09 A;  5IYC J;  2XAF A;  2HFH A;  3HBL A;  4BBS J;  4CYC A;  4DJA A;  1RRJ A;  3ONQ A;  1ETY A;  1OLT A;  4KUM A;  3DLA A;  2EA4 A;  3BC8 A;  5F0C A;  4RB1 A;  3WTY C;  4KMF A;  1OPC A;  1HKQ A;  1OFC X;  1VF9 A;  5EEH A;  2XKP A;  2VL8 A;  1RET A;  2JA5 J;  2ELH A;  1NK2 P;  4N9H A;  1A31 A;  4IQJ A;  1MH3 A;  1RKW A;  4Y4R A;  2D2W A;  2R7Z J;  1QGP A;  4ZZL A;  4G7Z F;  4FCY A;  5GTH C;  3S3M A;  5D8L B;  6PAX A;  5CVV A;  1YLF A;  4HX8 A;  2LR8 A;  1KYZ A;  1R58 A;  3KET A;  1K4S A;  2LG4 A;  1K6Y A;  1XDU A;  4PJ0 C;  1FOX A;  3PSI A;  1K83 J;  2HGC A;  2NOG A;  2QWW A;  3ZXS A;  3ZMZ A;  2STT A;  4L9V A;  4XKB A;  2QUF A;  5CPR B;  4CCN A;  5L3E A;  3A2K A;  1FT9 A;  2ISY A;  1S5L C;  1CF7 A;  4DZJ A;  1BJZ A;  3GTL J;  4A3C J;  4JP0 A;  3GZN B;  1J09 A;  2DYS H;  4ZTF A;  3M9A A;  5D4R A;  1ZRC A;  1ZG1 A;  2VB6 A;  3A0H C;  2Z33 A;  2X1D A;  3OOU A;  3JRC A;  1N77 A;  1I6X A;  3W6J B;  2W25 A;  4HST A;  2UXN A;  3BR1 A;  2XUB A;  1WGX A;  2ZSI B;  1S9H A;  2BBY A;  2HWV A;  3OIO A;  4DOZ A;  2JTV A;  2N8G A;  2W4S A;  2HVR A;  5HDN A;  3LQR A;  1I27 A;  1LDD A;  3GF2 A;  1FSE A;  3PJR A;  3COA C;  2ID6 A;  2MFZ A;  4P55 A;  4EEF G;  4L0Z B;  2BZT A;  3PUB A;  2HYF A;  4OIP F;  2JZY A;  5DM7 F;  4FAS D;  4G8X A;  3W2V A;  3J81 Z;  3MAJ A;  1ETX A;  1YE9 A;  3PNV A;  1VTN C;  3LSG A;  3WTS C;  3DQV C;  5B66 C;  4M6Y A;  4A3D J;  1HDP A;  4P9U A;  3S17 J;  4I0A A;  4ENJ A;  4A6D A;  1TP4 A;  2PEX A;  1O3T A;  2F4I A;  3JCU C;  4ZC3 A;  3ZMV A;  1DP7 P;  1MBK A;  4AYB A;  1BC7 C;  2KIS A;  2R5Y A;  3H5R A;  1BI1 A;  3CZ6 A;  2GLO A;  1SD4 A;  2B0L A;  3ESW B;  3HUG B;  4UUT A;  3S15 J;  3C2B A;  4EVI A;  2M2E A;  1HQC A;  4R8H A;  1RNL A;  3B73 A;  1B1B A;  3ZN1 A;  3F21 A;  1ZGA A;  5FKM A;  2KZG A;  2HOS A;  1Z9C A;  3O8G A;  1G2H A;  4P9F A;  1I3Q J;  1BOA A;  1LJ9 A;  2L54 A;  5H6Q A;  1A36 A;  4CYD A; 
#chains in the Genus database with same CATH homology
 3CCR I;  1VQ7 I;  2JQ7 A;  3CJT B;  3CCU I;  1VQ6 I;  1VQ4 I;  1YJW I;  1VQP I;  1VQO I;  3J7Z I;  1VQ5 I;  1VQN I;  1VQ8 I;  1YJN I;  3CD6 I;  3I55 I;  4IOC F;  1FOX A;  3CC2 I;  1YI2 I;  4V19 K;  2NXN B;  3CME I;  1MMS A;  2H8W A;  3PIO F;  1ACI A;  3CC4 I;  5JVG F;  3CCM I;  3CC7 I;  1VQL I;  2ZJR F;  2E34 A;  3I56 I;  2QEX I;  3J7Y J;  1Y39 A;  3G71 I;  2E36 A;  3CCQ I;  1S72 I;  3CCJ I;  2E35 A;  3G6E I;  3G4S I;  5DM6 F;  1QA6 A;  1HC8 A;  4IO9 F;  5GAD J;  2ZJQ F;  2ZJP F;  5GAE J;  5DM7 F;  4IOA F;  3CF5 F;  2K3F A;  2QA4 I;  3PIP F;  1YJ9 I;  3CCL I;  1FOY A;  3DLL F;  3CMA I;  3CCE I;  1YHQ I;  3CCV I;  5GAH J;  1VQK I;  5GAG J;  3CCS I;  1VQM I;  2OTL I;  1FOW A;  2FOW A;  1VQ9 I;  4UY8 I;  1YIJ I;  2OTJ I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...