1XSDA

Crystal structure of the blai repressor in complex with dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsdA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1xsdA02
4TV7A 4L5IA 5TJJA 3F3XA 1IW7F 3SXYA 1YFHA 1HSTA 4UV8A 3FWEA 4MHGA 1F5TA 3CUOA 1HW5A 1UCRA 1YG2A 3QPTA 1FWZA 1HXDA 4LLGF 1FSEA 2EB7A 3RPUA 4CXFA 2B0LA 2O0YA 4HDVA 3NQOA 4BYYA 4UUVA 1YS7A 3FMQA 4HX4A 2FA5A 2K7LA 4ESFA 5HLHA 3K1PA 5K5RA 4P55A 3DV8A 1U78A 1ZG5A 4MQ9F 5E8GA 2JPBA 3LQQA 1K6OA 1YYVA 4HX7A 4P9FA 2ACJA 3WTWC 3WGGA 3ZMTA 1S7OA 1XN7A 3BZ6A 3KP5A 5E1ZB 5BS6A 3U1DA 4UVCA 3O3KA 2KRFA 4EM0B 2YX4A 5E1XA 1R22A 2VBZA 4HV6A 1QGPA 5ICGA 2FNPA 3GYHX 3MQ0A 4LLLA 3R4KA 4BH9A 2EV6A 2FSWA 2HTJA 4LK0F 5HOOA 4BAYA 5ICCA 4Y15A 2K27A 1XDSA 4UNOA 3WTZA 3QP5A 2P4WA 1AWCA 4OIRF 2X4HA 4Z2YA 3RI4A 4NHJA 1LDDA 2FF4A 4BHCA 2OZUA 2R7FA 3P9IA 4JBAA 1R36A 1P6RA 5E17F 3FXUA 3V8JA 4EJVA 2HEOA 2IP2A 5JR3A 5FB2A 3IRRA 2STTA 2K86A 2C6YA 3R6SA 1YQAA 5D8LB 1J0RA 2PG4A 3KFWX 1L0OC 2DPUA 5LGNA 2A69F 3JW4A 2VE8A 2PMHA 4KIGA 3T1BA 2VBXA 2VC0A 4I7HA 2G9WA 1B1BA 4BHPA 3MFKA 2XUBA 4OIPF 4Q47A 1KQ9A 4A0ZA 1ZYRF 5L3FA 1TQMA 2VONA 4WXDA 4MQVA 4U88A 3ABUA 3HOTA 4I98B 4Q4ZF 4XRFA 3WTXC 3REOA 2CYYA 3JTGA 4B09A 3GEZA 2FXAA 4A12A 2MLGA 2ESHA 4L5JA 1SMYF 2CGPA 2V6CA 1ZG3A 3G73A 1HKQA 4LMYA 4U7DA 3MCZA 5FD6A 4DQ2A 3F8FA 2EFOA 2DLLA 1XGSA 3IWZA 2AS5F 3HTUA 4HV5A 2FMLA 4BXUA 3TKYA 4HF0A 2V1XA 1QBJA 2M1BA 2IVMA 1HSJA 2A07F 1EH8A 1O7LA 2VBYA 1JGSA 3MAJA 2V1UA 1W7PA 3ZMVA 4WK8F 2P6SA 2X0LA 1MD0A 1IN8A 1SMTA 3HIFA 4MEYF 4IHSA 1USSA 5DEQA 2IT0A 1XSVA 3I64A 3DKWA 4OMYA 2LKPA 3JSPA 2LDUA 3K69A 1R00A 2A68F 4ESJA 2M30A 2RC4A 2J5PA 1GVJA 4FX4A 2L4MA 4ZYDA 3E6CC 1WSUA 1R5HA 1E17A 1BI1A 3ERED 3BPVA 1RIOH 3ZMUA 3GFIA 1ZREA 4XLPF 4PCQA 2R3SA 2DO7A 1WKMA 3J80Z 1TW2A 2QWWA 4KT5C 4IRGA 4HF1A 2XASA 5BOXA 1IUYA 1I1GA 1SFUA 2DU9A 2A6HF 4G6QA 5LHGA 2XROA 2W57A 4RB1A 4GYIA 4EM2A 4G8XA 2MC3A 1YW9A 2QZ8A 3GF2A 1EH7A 3BY6A 4NQWA 3HYIA 4MTEA 2OZ6A 1G3YA 1IZ1A 1J5YA 1IF1A 1R1UA 4LB5A 4KIFA 1GXQA 3KP6A 3COAC 1ZGJA 1HQCA 4BHBA 2XAJA 4AIHA 2HFHA 1HBXG 1MDMA 1RUNA 3TO9A 3P9CA 1U5TA 1K79A 1V4RA 2EFNA 2OU2A 5DDGA 3PQKA 1I1SA 2BYVE 2L01A 2PLYA 4U0VA 4IRIA 1GXPA 1I5ZA 2BE5F 2GXBA 3CJNA 2D45A 2UZKA 4KN7X 4RGUA 1BBYA 3ZQ7A 5F1RA 1Z91A 5L3DA 2PEXA 3KE2A 3RYRA 3QU6A 3FXQA 1W7PB 2O8XA 2QQ9A 2FRHA 4ZYHA 3N4MA 1H9GA 5LEKA 5ICFA 3QRFF 4IVNA 2LF7A 1B59A 4RGXA 5J8FA 2EV5A 1MJBA 5D4SA 4EV0A 1BC7C 4MGRA 4KDPA 1OKRA 1P2FA 2EA4A 3SZTA 2IJLA 3KLOA 4HLXA 2VBWA 3RKYA 4M9ZA 3H3UA 2RV8A 1TTYA 1Z9CA 4ESBA 4RS8A 3ROUA 1ZRFA 3K9TA 4GXOA 2Z33A 4CDGA 2NNYA 2IA0A 1G6NA 3I54A 3ISPA 2XHKA 2DK8A 1FSHA 2LNBA 3WU1B 4ZZDA 3L00A 1SFXA 2H6CA 5JFRA 4WCGA 3PQJA 2K4BA 2YX7A 5LHHA 1D8JA 2RDPA 4PGGA 2VT2A 2XKPA 3RJPA 3V8LA 1O3SA 3LSTA 1XCBA 4CHUA 2BV6A 2HR3A 3HTSB 1R7JA 1B4AA 3TOBA 1K78A 1YS6A 1SFEA 3BOQA 4IRHA 1T2KA 4N9HA 1J9IA 3I0TA 4RGSA 4CYDA 2ESNA 4ASNA 4B8XA 1U5TB 2A6EF 3GVAA 1IN6A 4L9NA 1LDKB 1V3FA 2ADUA 4CZZA 2YSRA 1BN5A 2OD5A 1OYWA 1FY7A 2Z5UA 3L2CA 5AIPA 2E7WA 3D0SA 3K1NA 4YFKF 3JAMZ 3LA3A 3I71A 4ZH4F 2H94A 3GWZA 6PAXA 2O6GE 4LG0B 3KP7A 2O61A 1XGNA 2NS0A 4I02A 2QQBA 3F8MA 3WGHA 3C18A 3WODF 1CF7B 2Q8KA 2XAFA 3U9GA 5L3GA 4U7BA 2E7XA 3QAHA 3BDDA 1B9NA 1ZH5A 3ECHA 3KP3A 3E5QA 2H27A 2GXGA 4KICA 1MJAA 3E6DA 1ON1A 2ZMEA 1A04A 4IHTA 4LJZF 2ZCWA 1XSDA 3V4GA 2RGVA 2FNAA 4LGWA 4L0ZB 4CICA 2W24A 3TDUC 3ULQB 4K2EA 3RDIA 2CSOA 5HS7A 3KEQA 5K5QA 3V8KA 1KQ0A 4FX0A 3R61A 3ZPLA 3J81K 4QLCU 3IWFA 1YW7A 2ZNZA 1P4AA 2HQRA 4LD5A 1FBQA 4EMSA 3WTTC 1YTYA 5D5XB 1BJAA 3GX4X 2RNJA 2HQNA 4EVIA 1YW8A 2M87A 2RVCA 1HW2A 2FOKA 1HKTA 5CVIA 2D2WA 1P92A 1ZLKA 3SHFA 3ZMZA 2CO5A 5LGTA 3HRUA 3WE2A 2L54A 4IJAA 4HYEA 3JAMK 3IHUA 4ENKA 3DXJF 4G6DA 4HBLA 4M9XA 5CVRA 3HRMA 1TQIA 3EUHA 4PZJA 3IC7A 5D6FA 1RUOA 1XGOA 2BEOA 4GO1A 4I01A 3NRVA 4HAMA 4M6YA 5DUKA 5DD4A 3R60A 1G3WA 4YFXF 2NNNA 1FZPB 5H20A 1AOYA 1O3QA 5DCMB 3GFJA 1TQPA 4D0PA 2OQGA 3RTRA 2FEZA 2WC2A 5IT3A 1DP7P 2ZJ2A 1YO5C 1XDUA 1W5SA 2HYGD 1PP7U 1J7KA 1LJ9A 4LG0A 3U2RA 2HGCA 4G7HF 2HZTA 2KIUA 5ILSA 2QENA 2QUFA 3BJAA 4N0BA 2BBYA 5ERIA 1IN5A 2DPDA 2HWVA 2XAHA 3CUQB 4M73A 3E97A 5FGMA 3WGIA 1PP8F 3C7JA 5JVTA 4HF2A 1BM9A 3DPLC 1ZN2A 2DT5A 2ZMEB 3Q9VA 3IKVA 3I59B 4EJOA 5LHIA 4ZYGA 2ISYA 2NYXA 3SZPA 1KU2A 3KETA 1I6XA 5K5OA 2XAQA 5L3BA 3EETA 3MEXA 1U2WA 4LFUA 1KA8A 2XIGA 3P9KA 5CJ9A 5D8KB 4UV9A 2QBYA 4GGGA 4GYGA 4AIKA 1UB9A 4HQMA 2DFIA 5HS8A 2CFXA 1O57A 1S7AA 4KUMA 4WF2A 4M6XA 2KIMA 4OINF 1Z6TA 2HYFA 1IXCA 5ILUA 1NHAA 2MBFA 5E20A 4MTDA 1ZLJA 5E8IA 1ODDA 3WG9A 2ZKZA 3G3ZA 4P96A 5L3EA 2DAOA 3EQLF 5ILVA 1FOKA 2WTEA 3L9FA 2M5WA 5JI6A 2MH2A 1EH6A 2K4JA 2V9VA 2WWYA 2KJCA 4EGYA 4G7ZF 4ENMA 1WRJA 2ZBKA 5KVRA 2E1CA 1ULYA 2NAZA 3LAPA 4IXAA 2JSCA 2MA3A 4R8HA 1KU9A 3FHZA 3RKXA 3H92A 2F5EA 2P6TA 1XGMA 3L09A 1LVAA 1IN4A 1ONVA 3LA7A 3VODA 1W7PD 3CLOA 2QM3A 1REPC 4H0EA 3KEOA 2COMA 3LAJA 1UHWA 2P5VA 1KYWA 1O3RA 5HDNA 3BP8A 4RAYA 1IRGA 3VOEA 2ELHA 2E1NA 2M45A 2Z9OA 2FBHA 2YU3A 3NEUA 4L9VA 4UXNA 4DNCA 4KNYA 1MDMB 2DK5A 3F72A 2L4AA 2FBKA 4I0AA 1KU3A 1XB4A 2OAZA 2W84A 4XBFA 2FMYA 4S04A 2KJBA 1FYLA 5D5WB 5DCFA 3RPQA 4A5MA 2EFWA 3ZP5A 1FBSA 1TNSA 2PMUA 1O7FA 2F5FA 3R0AA 5AIQA 3M8EA 3M7GA 5A2QK 4IF4A 2FE3A 3C1DA 4WXHA 5LGUA 2GQQA 4BNCA 1U8RA 3Q9SA 4O5VA 2IW5A 2GIVA 4YIFA 3GXOA 3F22A 4I0BA 3ZMDA 4ZYEA 2XRNA 2JRTA 3VEPA 4HLYA 5E18F 4L9JA 2Y75A 3J7AO 3V7SA 3C3WA 3J81Z 4G7OF 3E6MA 5HLGA 1BOAA 1F1ZA 1TW3A 1XMAA 1K78B 4AIJA 1WI9A 4HW0A 1LEAA 3N97A 5FFXA 4HX8A 1D5VA 5E1WA 4EJUA 5HDKA 3F8BA 3QOPA 1FBUA 5TRDA 2GA2A 1OR7A 3ABTA 4EQQA 1S6LA 2GZWA 3FM5A 2HKXA 1T6SA 4P5OA 2EWNA 1IXRC 1JHFA 3RIRA 2RKHA 4I09A 1FLIA 1F9NA 2OBPA 5F64A 2JPCA 3HOSA 1YIOA 3E5UA 3KP2A 4AD9A 1BC8C 1KQ8A 1FX7A 4KA4A 3HHHA 1XD7A 2QLZA 2MLKA 3F23A 2LSOA 4A0XA 1SD5A 2WV0A 3WE3A 2W85A 1ZAOA 1P4XA 2MD5A 2DTRA 5J6XA 3P7NA 1ZARA 2O3FA 1J59A 1EV7A 1IXSB 1MZBA 5D6EA 3WTUC 1ZRCA 3R0JA 3ECOA 4EJTA 5LRSA 5FFZA 5HVQC 2CG4A 4EM1A 3TGNA 3M1EA 1IAWA 4L0YB 1TLHB 2EA2A 4A6EA 2F5CA 3SQNA 1WQ2A 2VE9A 1Z6RA 4FT8A 1O3TA 2A61A 2EJRA 1DDNA 3MZHA 2YR2A 2D1VA 5DV5A 1MGTA 3E5XA 4KYWA 2XGXA 1S29A 2VXZA 5A2QZ 1U6GA 2QYOA 2PQ8A 2PN6A 2D1HA 3IL2A 1SAXA 1G4DA 1LB2A 2UXXA 2OA4A 1LDJA 5K1YA 3TOAA 5LBQA 3O6BB 3SFZA 2Z3YA 3FF5A 3BJOA 4Q48A 4LK1F 1RI7A 1JE8A 1R58A 1T38A 4RB0A 2ZNYA 1PDNC 1LNWA 1BIAA 2EFQA 4QWQA 2DQLA 1MKMA 1H9TA 3F21A 4YG2F 3DFGA 5FD5A 3LWFA 1W5TA 2A3SA 1HW1A 1MJ9A 5JHUA 5BPIA 4ENNA 3QP6A 2M8EA 4G94A 2VN2A 1OPCA 4HQEA 1ZGAA 1FYMA 3HUGA 3K2ZA 2FU4A 4CGZA 2V1DA 2P5LC 2QBYB 1SD7A 2QQAA 3L7WA 4KN4X 3CO7C 3AAFA 1BI3A 3GFLA 2P8TA 2DI3A 5CVJA 1J75A 1TNTA 2P5KA 3DQVC 1XCVA 5L3CA 3O2PE 2ZFWA 4AWXB 2IA2A 4U0WA 3GLXA 3RYPA 4G9YA 5D4RA 1WWXA 3K0LA 1QQIA 2H6BA 2P7CB 1P4WA 4KFCA 2AXLA 2Z99A 3T5XA 1OMIA 3GZ5A 5EEGA 1C0WA 1SD4A 2W25A 1LQ1A 2A5YB 3EYYA 1Q1HA 4HOBA 5KK1A 2F5DA 3VFZA 3IKTA 3CUQC 3GFMA 2EV0A 3GZ6A 1DPUA 5BQTA 3JSOA 1OYIA 2VOPA 4N9IA 4BQAA 4A0YA 4HZFA 1JXSA 2VOOA 4M74A 5HLIA 5H6QA 1E2XA 4CO8A 1QZYA 3FM3A 2JTVA 4UVAA 1QNTA 4UVBA 3W6KB 2GWRA 1SD6A 5FO5A 1W4MA 3CO6C 1G3SA 2CWEA 3QU3A 3M9AA 1DPRA 4L18B 2K02A 2JT1A 3OV8A 3F6VA 1XMKA 2V79A 2STWA 2VT3A 4KIBA 1STZA 3TDZC 4PDKA 3HSFA 4JQFA 3KCCA 1G3TA 3ELKA 3CTAA 2HTSA 5CYVA 1X3UA 2J5OA 2IA1A 2ETHA 3ZN0A 4IPAA 3I59A 2IPQX 4LLNA 2UXNA 1FP2A 3V7CA 5LRRA 2EK5A 2QVOA 2GA1A 3D5LA 3B73A 4ON0A 1FNNA 3WU0A 1K7AA 2YPRA 1CF7A 1QO0D 1FP1D 3IRQA 1GHCA 4EGZA 1QZZA 5LLQA 1ZG1A 1FYKA 3KLNA 3HSEA 3I4PA 4LB6B 1BIBA 4EJWA 3DEUA 2Y0MA 3WTYC 4O6JA 3GUDA 2CW0F 2KKOA 4HDUA 4RAZA 2VODA 2O03A 2Q2EA 4A6DA 1D8KA 1ZHFA 1DUXC 3LQRA 1Z05A 4KMFA 1OYYA 5DCMA 1KU7A 3LFKA 3I5UA 3DF8A 5J8CA 3DPTA 4NB5A 4M71A 4Y17A 3TO7A 5LEJA 3K1MA 2ZO4A 5H6RA 1FT9A 1H0MA 4OIOF 3BJ6A 3ZN1A 1USTA 4MEXF 2R7DA 5IT9Z 3BPXA 3MZYA 4WXCA 3F8CA 3V7RA 4ENJA 1ON2A 1YLFA 1I27A 4XSXF 1R5GA 3KP4A 5DUIA 4I2OA 1FPQA 3TQNA 5CLSA 4U0YA 4ZZLA 3GO5A 4KMUX 2F2EA 3KZYA 3CUQA 4S05A 5D5UB 1UHMA 2ISZA 4ETSA 3MWMA 1F4KA 3E6BA 5ED4A 3I58A 4XSZF 4OOIA 4R79A 1J2XA 1PUEE 2FQ3A 5HDGA 2DBBA 3M8FA 4M72A 3J80K 4PGHA 3WTSC 1T98A 2L3DA 1T39A 4F7ZA 2HDCA 4JK1X 4OU0A 4M9SA 3HSRA 4RB3C 2NRAC 5DYMA 4YFNF 3BWGA 2G7UA 4XLNF 1RZ4A 1KYZA 3PFIA 5BMZA 3ZMSA 1JHHA 1CGPA 4Q5SF 2P7VB 3F8NA 4WWCA 5FLXZ 1ZRDA 1LEBA 1R1VA 3FX3A 2DQRA 2ZXJA 2XVCA 2BGCA 1Z1DA 2DW4A 3T8RA 2XV4S 2JZYA 4MNUA 1TBXA 3FMSA 2EFPA 3S2WA 4P9UA 4UHTA 1B9MA 2G7HA 5AONA 2RQPA 4FHTA 1VTNC 4RGRA 3FZVA 1D3YA 3CDHA 1IRFA 1R1TA 3F6OA 4A5NA 1U5TC 2PI0A 4O3MA 5FLXK 4Y13A 4R1HA 5HS9A 3RKWA 3TO6A 3GW2A 1U3EM 3FXRA 1BI2A 3T8TA 1S3JA 4HA8A 3WTVC 2GAUA 1Y0UA 3HRSA 4GCVA 3OOPA 3BROA 2Y48A 1T0FA 3B02A 3VB2A 2MH9A 1RNLA 2UWMA 4WX9A 4YIIA 2OQRA 5DD8A 3DP7A 3EDPA 2H09A 4A2UA 3HRTA 5IT9K 4OMZA 3H3ZA 1IN7A 5D5VB 1L3LA 2IRFG 2TDXA 5F6FA 3HHGA 4AVPA 1R23A 1S8NA 2KIFA 2XAGA 1B6AA 1FC3A 4L9TA 2HS5A 2PBIA 1XSXA 3FMRA 3Q5FA 5CVVA 3T0YA 2PJPA 3EYIA 5EEHA 1HKSA 1KGSA 1UFMA 4E70A 2HOEA 2Q0OA 1BI0A 2HKOA 2XKOA 3QPHA 4OIQF 2RN7A 5BPDA 3JTHA 3I53A 1Z7UA 2CQKA 2L02A 2LF8A 3W6JB 4RB2C 5ICEA 1QPMA 2PFBA 2FBIA 3KZZA 3E3VA 5CVUA 3LA2A 2VC1A 3ML6A
chains in the Genus database with same CATH superfamily
4TV7A 4L5IA 5B1AH 2R7XA 2HVRA 5TJJA 1UMQA 3F3XA 1IW7F 3SXYA 1YFHA 1HSTA 4PFPA 1SVMA 4UV8A 1X2MA 3FWEA 4MHGA 3CCUI 2R5YA 1F5TA 3CUOA 1HW5A 1VQ7I 2GLOA 4ZC3A 2KRHA 3HOUJ 1VFCA 3OSFA 1UCRA 3DTKA 2JRMA 1YG2A 3ZQQA 3QPTA 3TW6A 3OYKA 1LFPA 2ZXIA 1FWZA 1HXDA 4LLGF 1FSEA 3X2QH 2EB7A 3RPUA 4CXFA 2WY7Q 2B0LA 1KONA 1JTYA 2KDOA 2O0YA 4HDVA 3LSHA 3NQOA 4BYYA 4UUVA 3IH4A 1YS7A 4XRSG 2AQFA 3FMQA 3M8JA 4HX4A 3L2RA 1MNDA 2FA5A 2K7LA 3HGYA 4ESFA 5HLHA 2HQ5A 2W1OA 3K1PA 2R7RA 5K5RA 4P55A 3DV8A 3MN2A 1S7EA 1U78A 1ZG5A 4GDFA 2ECCA 4MQ9F 5E8GA 2JPBA 3JR9A 3LQQA 2FJ1A 4PJLA 2E5ZA 1K6OA 3L2QA 3HOVJ 2DJNA 2MW8A 1YYVA 2VUMJ 4NC8A 3SZGA 3TBIA 2V9KA 4HX7A 4P9FA 2ACJA 3WTWC 3GTKJ 3MKZA 3WGGA 3J7ZI 2WAEA 2A05A 2O7OA 4QTRA 3ZMTA 1S7OA 1XN7A 3FXOA 4F92B 4BACA 1FEXA 3BZ6A 2RNGA 3KP5A 5E1ZB 5BS6A 3U1DA 4UVCA 5GP9A 3O3KA 2KRFA 4NNJA 1IDZA 4ZYAA 4EM0B 2M0MA 2YX4A 2DFHA 2IGOA 5E1XA 4YELA 1JUPA 1R22A 2VBZA 4HV6A 5F08A 4ZDOA 2WAQN 1QGPA 5ICGA 2FNPA 5GAEJ 3GYHX 3MQ0A 1X1PA 1LFUP 4LLLA 2HOTA 3R4KA 1ERDA 4BH9A 4XIDA 1SEUA 4UUSB 5M3FJ 1MMDA 2VASA 3CQZJ 3BG5A 2EV6A 2E60A 2W82A 2FSWA 2HTJA 2NOGA 1N78A 4LK0F 2R93J 5HOOA 4BAYA 4CSWA 3ZQHA 5ICCA 4Y15A 2R7TA 2K27A 3GLLA 1WH5A 5M5XJ 1A6IA 3OYFA 3C2GA 1XDSA 4V2GA 4UNOA 3WTZA 4QPQA 3QP5A 3HDDA 2EQRA 2P4WA 4JYKA 2X1EA 1AWCA 2BZTA 4DW6A 3DU6A 2LC2A 4OIRF 3AFHA 1MBEA 2X4HA 4Z2YA 3RI4A 2VKVA 4NHJA 1ZKGA 1LDDA 1BA5A 2XF6A 2FF4A 4BHCA 3CF5F 4XORA 4HSTA 3SFIA 2OZUA 3DTIA 3I9V2 1Z0XA 2BY1A 2R7FA 1QHHD 1ETXA 3P9IA 2R5ZA 1RC9A 4JBAA 3A02A 1R36A 1P6RA 5E17F 3FXUA 3V8JA 4EJVA 1GDTA 2IP2A 2HEOA 5JR3A 5FB2A 3S8PA 1YOVB 3S32A 2HXIA 4IHWA 5JLXA 3LSJA 3IRRA 3ZRGA 2STTA 2K86A 2X1CA 1B72A 2BY3A 4JX5A 2JVHA 4XM3A 3F9KA 2C6YA 3R6SA 1YQAA 5D8LB 1UELB 1A31A 1J0RA 1TWCJ 2M4KA 2PG4A 3CCJI 2XGCA 3KFWX 3LSIA 3IH3A 1QU3A 2R7ZJ 1GUUA 4PJMA 1L0OC 2MYSA 2JA5J 2F6CA 1VQ5I 2NXNB 1WJEA 4J00A 2DPUA 4BEHA 5KNLA 5LGNA 2XRLA 5KAIC 2A69F 3JW4A 4XRMA 3HPGA 4IO9F 2K3PA 1MH3A 2VE8A 2PMHA 4KIGA 3H9JA 3T1BA 1YX5A 2QGUA 2VBXA 2VC0A 4I7HA 2K3FA 5F27A 1T95A 2LD5A 2G9WA 1B1BA 4BHPA 2HXOA 4JOMA 3U21A 4IHYA 3MFKA 2XUBA 2W00A 4OIPF 2L7KA 4Q47A 1KQ9A 4A0ZA 1YJ9I 1ZYRF 3MKYB 2V7FA 3DKXA 4UB6C 5L3FA 1TQMA 2VONA 4WXDA 3M1CA 4BQNA 4CCOA 1NTCA 4MQVA 3H9QA 4U88A 3CJQB 1FMWA 1BOBA 5IYDJ 1QVUA 3HG9A 3OYBA 3FHNA 1W0UA 4Y7NJ 3LL7A 3BLYA 4I76A 5FKNA 1IV6A 3ABUA 3B6CA 3HOTA 5KHDA 4BBRJ 4E7ZA 4I98B 4Q4ZF 4XRFA 3WTXC 3REOA 2LH9A 1ETWA 2CYYA 3JTGA 2LY9A 4CCMA 1B8IA 2HOSA 4B09A 3GEZA 1E3HA 2FXAA 4A12A 4F91B 2MLGA 2V4JC 4M3BA 4DYCA 1PUFB 4QPOA 2LVSA 2ESHA 4XN0A 2HZDA 4L5JA 1SMYF 2CGPA 2V6CA 1GVDA 4BUPA 4E7SA 4L5EA 5C4JJ 5IPAA 4J01A 1ZG3A 1SFOJ 1NG7A 3G73A 1HKQA 5FLMJ 4LMYA 4AC0A 4U7DA 3MCZA 2K9LA 3EUAA 5FD6A 3CMMA 4DQ2A 3F8FA 3AKZA 1A5JA 3S93A 2EFOA 3ZXSA 1MBGA 2DLLA 2BY2A 1XGSA 3IWZA 3H5RA 1BR1A 1X2NA 2N8GA 2AS5F 3HM5A 4X1EA 3ZCOA 3HTUA 3JRDA 4HV5A 2FMLA 4BXUA 3TKYA 4HF0A 2DOFA 2V1XA 1QBJA 2M1BA 2IVMA 3MKLA 4G6TB 4XLHA 1HSJA 3UR3C 2A07F 2NVXJ 1EH8A 1RR7A 4XR6A 3GTJJ 1O7LA 1YITI 2VBYA 1JGSA 1Z3XA 2ZFUA 3ABMH 1W7PA 3MAJA 3ONQA 3ZMVA 2V1UA 2QKMB 4WK8F 5BNGA 2O9LA 3QWLA 2P6SA 2X0LA 2DN0A 4IOAF 1MD0A 2EILH 1IN8A 5J47A 1SMTA 3FIWA 3HIFA 1N75A 4MEYF 4IHSA 1OCPA 1USSA 2KL4A 4Y3OA 5DEQA 2IT0A 1XSVA 2DJIA 3I64A 1W36C 3DKWA 1D5YA 4OMYA 1TZLA 3CJTB 3DEEA 2LKPA 3JSPA 3BG7A 1ETKA 1JT6A 2LDUA 4N4NB 1A35A 4KISA 3I4NJ 3W6VA 2PJRA 1MIJA 2M7BA 3K69A 1R00A 2A68F 1YJNI 2Y31A 1WZ2A 1D0YA 4ESJA 2M30A 2RC4A 2J5PA 1GVJA 3K10A 3NWTA 4H4KC 2Y0SN 2DMTA 4FX4A 2L4MA 4ZYDA 3E6CC 1WSUA 1R4MB 4BU2A 3CMAI 1R5HA 1XS9A 5B5EC 3G1MA 1V5GA 3CESA 3OY9A 1WJAA 1E17A 1BI1A 3ERED 1I3QJ 3BPVA 1RIOH 2VQCA 3ZMUA 5GTIC 5F04A 3GFIA 1NK3P 1ZREA 4XLPF 1X3ZB 4PCQA 2R3SA 5C3EJ 2DO7A 1WKMA 3J80Z 2YU9J 5J40A 1FOXA 1TW2A 1XMXA 2QWWA 4KT5C 2AXTC 4IRGA 5EYRA 4HF1A 4D9JA 3VYUB 2LFBA 4RAFA 2XASA 5BOXA 2M7AA 5IY5H 1IUYA 1I1GA 4E7KA 1SFUA 2DU9A 2A6HF 4G6QA 5LHGA 2XROA 4BDZA 2W57A 2E2HJ 2WAQA 2I8DA 2FUG2 4RB1A 2LBFA 4GYIA 4EM2A 2RREA 4G8XA 3M07A 2CV1A 2MC3A 1YW9A 2QZ8A 4OAZA 4DZPA 5B3SH 2JUGA 1BW5A 1DU0A 3B6AA 3GF2A 1EH7A 3BY6A 4NQWA 3HYIA 4B3AA 2NVQJ 4MTEA 2OZ6A 1G3YA 1IZ1A 1J5YA 1IF1A 1R1UA 4LB5A 4KIFA 1GXQA 3KP6A 1V5FA 3COAC 1ZGJA 1HQCA 1LKXA 2XB5A 3BG3A 3JRAA 2HOAA 4BHBA 5FKLA 2XAJA 4AIHA 4BXFA 2BY0A 2XC7A 3BTLA 1W0TA 1DU6A 1DP3A 1W36D 2R5YB 2Q1ZB 2WY8Q 1ZR2A 4HEA2 4DBRA 1YJWI 2HFHA 2KZVA 3BZKA 3PNYA 3HZJA 3WG7H 1HBXG 1MDMA 2DA3A 2Y69H 2KRCA 2DCEA 1RUNA 3TO9A 2DT7B 4EEFG 4BQOA 1WCMJ 3P9CA 1P7JA 1U5TA 1K79A 2ZXWH 1V4RA 2EFNA 2OU2A 3UKGA 1K83J 1X1CA 3H1CA 5DDGA 3PQKA 5EJCA 1I1SA 1OCCH 2BYVE 2L01A 2PLYA 2BVMA 2KMUA 4U0VA 1UHSA 4IRIA 1GXPA 1I5ZA 2BE5F 2GXBA 2KZGA 3PNVA 4ZTFA 1QZEA 3S16J 5EG0B 1GT0C 3CJNA 3EUHC 4QSHA 3K70C 1P9QC 4G12A 2D45A 4LG3A 3H5AA 2E1MC 3QOEA 1WJFA 2UZKA 4ITVA 4KN7X 4RGUA 3K4BA 1BBYA 3H9GA 1ZR4A 3ZQ7A 2NS7A 1Z91A 5F1RA 5L3DA 9ANTA 2PEXA 1XG1A 5IP9J 2XGDA 4CZCA 3KE2A 2HU9A 3RYRA 1FIAA 3QU6A 2IS6A 3FXQA 1W7PB 5EZHA 2O8XA 2AQEA 2QQ9A 2FRHA 2HI3A 3S17J 3HOXJ 4M6VA 1SANA 4ZYHA 3N4MA 4BY1J 1H9GA 5LEKA 5ICFA 2CFOA 4AIDA 3QRFF 4IVNA 4XOPA 2ZJRF 2LF7A 1B59A 4RGXA 2CUFA 1JKOC 5J8FA 2EV5A 1MJBA 5D4SA 4EV0A 3S2DJ 3OL3A 1D1BA 3CZ6A 1BC7C 4MGRA 4KDPA 1OKRA 1P2FA 2EZIA 2EA4A 3SZTA 2IJLA 1G2HA 3KLOA 4HLXA 5GPAA 5EEAA 2VBWA 3RKYA 5EDNA 4M9ZA 3CC2I 2IGMA 3H3UA 2RV8A 3H36A 1TTYA 2XPWA 1Z9CA 1ENHA 5FKMA 4ESBA 3TP3A 4RS8A 3ROUA 1VQPI 1ZRFA 3K9TA 3ASNH 4GXOA 2Z33A 4CDGA 2NNYA 3RQ4A 2IA0A 1G6NA 2LY1A 3RZDJ 2X51A 2MG4A 3I54A 3ISPA 1ETVA 3IV5A 4CCKA 4A3GJ 2XHKA 2DK8A 2R7SA 1FSHA 1IGNA 1RRJA 2LNBA 5K7FA 3WU1B 1UAAA 4ZZDA 3L00A 1SFXA 2DA7A 4DYRA 2E5NA 1W1WE 3VYRB 2H6CA 2LTPA 2LP0A 2Y9YA 1POGA 3Q0WA 5JFRA 4WCGA 3G4SI 2E35A 3PQJA 2LK2A 2AO9A 2K4BA 2YX7A 5LHHA 1D8JA 4D5CA 2VXDA 2RDPA 2WAFA 4PGGA 1B8IB 1VQ8I 1HA8A 2VT2A 1K4TA 1V5EA 4XICA 3ZQCA 1HDDC 2XKPA 3RJPA 2B7EA 1BJZA 2CQ7A 3V8LA 1O3SA 1R49A 1HOMA 4W1UA 3I3LA 4GRIA 3LSTA 5E3MA 1MMSA 1XCBA 3HKZA 1TL8A 4CHUA 1IDYA 2BV6A 4C2MJ 2DT6A 2HVSA 1LUJB 2HR3A 1WVRA 4XL9A 3HTSB 1R7JA 1HF0A 1B4AA 1SVOA 3A2KA 4PJJA 3TOBA 1YS6A 2DOAA 1K78A 1SFEA 3BOQA 5DM7F 4BEHB 4IHXA 1QPIA 4IRHA 1T2KA 2VLAA 1CQTA 4N9HA 4BDYA 1J9IA 1ETYA 1OCOH 3I0TA 3BR2A 4RGSA 4XLFA 4HRIA 1EJ9A 3G1LA 2LLKA 3KEYA 4CYDA 2ESNA 4UUSA 4FTHA 2NVUB 4ASNA 2EZHA 4B8XA 1MBKA 1U5TB 2A6EF 3GVAA 1IN6A 4L9NA 2QCOA 1LDKB 1V3FA 2ADUA 4CZZA 5FLVA 2YSRA 1BN5A 2E1MB 3IAM2 2OD5A 3OYLA 1OYWA 1FY7A 2Z5UA 3L2CA 5AIPA 4PUSA 2E7WA 2DDAA 4A3DJ 3D0SA 3PSIA 2ECBA 3K1NA 2R7UA 4YFKF 5DS9A 3JAMZ 3BC8A 2BOLA 3LA3A 2KFDA 3JRIA 3I71A 4ZH4F 2H94A 2XGEA 3GTOJ 3GWZA 6PAXA 2O6GE 4LG0B 3KP7A 3S3MA 2O61A 1XGNA 2H8WA 2NS0A 3S15J 3H0DA 4I02A 2R5ZB 1TWAJ 1XTAA 4AUXA 4E4HA 2QQBA 3F8MA 3WGHA 3C18A 3WODF 1T8IA 1OISA 1CF7B 2Q8KA 2XAFA 3U9GA 2DA6A 5L3GA 4U7BA 2E7XA 1U9OA 3QAHA 3BDDA 2YUSA 3LSMA 1B9NA 2MGQA 1ZH5A 3ECHA 2ZJPF 2EIJH 2E19A 1RKWA 3KP3A 3FK6A 3E5QA 3F0CA 3S1RJ 2H27A 2GXGA 4BE2A 4KICA 1MJAA 3E6DA 1ON1A 5K7ZA 2F48A 2ZMEA 4PJ0C 1LE8B 3M4OJ 2DYSH 4D1QA 1A04A 2L5QA 4IHTA 1EKEA 1Z21A 4LJZF 1X4OA 2ZCWA 3A03A 1XSDA 3V4GA 2RGVA 2OUMA 2FNAA 3BTIA 4LGWA 2F4IA 2LR8A 5CQGA 2Q2EB 4L0ZB 4CICA 1MBHA 3TW7A 1OCRH 2W24A 3TDUC 3ULQB 2LRDA 4EATA 4K2EA 3RDIA 2CSOA 1FTZA 5HS7A 3KEQA 2OPTA 5K5QA 2OCCH 2M4GA 2QF7A 3V8KA 1KQ0A 4FX0A 3R61A 2ZSIB 1R9TJ 2FX0A 3ZPLA 5FROA 4QLCU 3V42A 3J81K 3IWFA 1YW7A 3AG2H 2ZNZA 2D5VA 2ZB9A 5IYCJ 2LOOA 2AHQA 3OYIA 1P4AA 2HQRA 4LD5A 1FBQA 4EMSA 5HNFA 3WTTC 1YTYA 1LPQA 3MZ8A 1IO2A 5D5XB 1Z77A 4F52A 3PIOF 1BJAA 3GX4X 2RNJA 3TMOA 2HQNA 1X1BA 4OAYA 1YW8A 4XKBA 2RVCA 2M87A 4EVIA 2NS8A 1HW2A 4BKXA 2FOKA 1HKTA 5CVIA 2WB1N 2D2WA 1RETA 2NOJB 2PMZN 1P92A 3G71I 1ZLKA 3OIOA 2XPVA 3SHFA 3ZMZA 2CO5A 3OWTA 5LGTA 4IX7A 1IV8A 3HRUA 1NG6A 3WE2A 2L54A 4IJAA 4PJNA 4HYEA 3JAMK 2X6OA 3IHUA 4ENKA 3DXJF 4C2TA 1D0XA 1JTXA 2X6YA 4G6DA 4HBLA 4M9XA 5CVRA 3WHCA 5J4VA 1X3WB 3HRMA 1TQIA 2DYRH 3JREA 3EUHA 4XRSA 4PZJA 4BS9A 3IC7A 5D6FA 1RUOA 1K61A 1UZCA 1XGOA 2BEOA 4GO1A 4CA0A 5HNHA 3K70D 2JA2A 4I01A 3NRVA 2CUJA 4HAMA 4M6YA 5DUKA 5DD4A 4IL6C 3R60A 4RA2A 1G3WA 2QSFX 3Q0VA 4YFXF 2NNNA 4AYBN 4CUGA 1VQMI 1FZPB 5H20A 1AOYA 1V54H 1O3QA 5DCMB 3GFJA 1VNDA 5F0CA 1TQPA 4NQWB 3OSGA 1X19A 4RMNA 3ZQFA 2Z16A 4D0PA 4B47A 5FKKA 2OQGA 3QYFA 3S2HJ 1AHDP 3KYCB 1FMVA 3RTRA 2FEZA 4KJZA 2I5UA 2WBMA 2K9SA 3GTGJ 1Q1VA 3SYTA 2WC2A 5IT3A 3K7AJ 2Y0SA 3ZQGA 2ME0A 1DP7P 2ZJ2A 1YO5C 4DGWB 5F1JA 1XDUA 4E7HA 1W5SA 3CCVI 3JRGA 2HYGD 2KIQA 1X58A 1PP7U 1J7KA 1LJ9A 2A5WA 4LG0A 2M2EA 3U2RA 2HGCA 4G7HF 1IRZA 1WJDA 4IQ4A 2HZTA 2X85A 4JX6A 1VQ6I 1YRNA 2CQQA 1JUSA 3JRCA 1IRXA 4D7NA 2KIUA 5ILSA 1FIPA 2QENA 2QUFA 3BJAA 1OCTC 1DQUA 3S1NJ 4N0BA 5HLTA 2BBYA 3HJEA 5ERIA 1IN5A 4RLQA 2HWVA 2DPDA 2XAHA 4BY7J 3CUQB 3MVPA 3NAUA 4FE4A 2CMPA 3E97A 4M73A 5FGMA 4A3EJ 3WGIA 3CJRB 1PP8F 3C7JA 5JVTA 5K7HA 4HF2A 5GAHJ 1MH4A 1BM9A 2L9SA 3DPLC 1P7IA 2B63J 3D5RC 1ZN2A 2DT5A 2ZMEB 3E0JB 3Q9VA 3IKVA 1LE8A 3I59B 3DEWA 4EJOA 3LSGA 5LHIA 2X6WA 3WHBA 3OS2A 1RKTA 4ZYGA 2ISYA 2NYXA 1K4SA 3SZPA 2O8KA 2EH3A 1KU2A 1MNEA 2BW3A 3KETA 2XF5A 1JKRC 1I6XA 1XC5A 5K5OA 3G2BA 1WJ5A 2XAQA 5L3BA 2QSGX 1A36A 3EETA 3MEXA 4XLCA 1U2WA 2DA1A 2K9NA 4LFUA 2L9RA 4CYCB 3KPHA 4C3IJ 1KA8A 2OV7A 1PYVA 2XIGA 3P9KA 5CJ9A 5D8KB 2ELJA 3BCBA 4DYQA 3BQYA 4UV9A 2QBYA 4GGGA 4GYGA 3E1SA 2ZMEC 4HQMA 2DFIA 1UB9A 3FXLA 4AIKA 5HS8A 2CFXA 1O57A 1R5ID 1S7AA 1WPKA 4KUMA 4FCYA 3S1MJ 4WF2A 4M6XA 2KIMA 2EZKA 4OINF 5IYBJ 1Z6TA 2HYFA 1IXCA 1ETOA 4BJ5C 1FOWA 2H8RA 4HNVA 1NHAA 2MBFA 5E20A 5ILUA 4MTDA 1ZLJA 1Y39A 2HQAA 3TP0A 5E8IA 1U8BA 4ABZA 5E3NA 3GBGA 4I6ZA 1ODDA 3WG9A 3U1KA 1YI2I 2ZKZA 3G3ZA 4P96A 5L3EA 2DAOA 3EQLF 2FQ4A 1I50J 3CP2A 3FXKA 4X6AJ 1E3OC 5ILVA 1D1CA 1VQOI 3I56I 4RM3A 1FOKA 2WTEA 3L9FA 2M5WA 5JI6A 1LVKA 1OJLA 2MH2A 5B1BH 1EH6A 2K4JA 1UJ8A 2V9VA 2WWYA 2JQ7A 1TP4A 2RQQA 1APLC 2VJ5A 1MMNA 1HLVA 2KJCA 4EGYA 4G7ZF 4ENMA 1WRJA 2ZBKA 5KVRA 2XSDC 5IP6A 1JKPC 2E1CA 1ULYA 2NAZA 3LAPA 4C3JJ 1VF9A 2GXAA 4IXAA 3FKJA 2TRTA 2FD5A 2QSHX 3L1PA 2CH0A 2JSCA 3FK7A 3W2WA 2MA3A 1ZQ3P 4R8HA 1KU9A 2OJED 4UB8C 3RKXA 3FHZA 1PUFA 3S1QJ 3H92A 2R7VA 2F5EA 2P6TA 1XGMA 3L09A 1U9NA 4IZZA 2X6XA 1LVAA 1WH7A 1IN4A 1B72B 1ONVA 3LA7A 3VODA 2DODA 1W7PD 3CLOA 1ACIA 3K4MA 2QM3A 1REPC 4II3A 4H0EA 4NUBA 3BT9A 3MD2A 3KEOA 5F0FA 2COMA 5FJ8J 2MFZA 3LAJA 3BCAA 5KCMA 1UHWA 2P5VA 1KYWA 4FE7A 1O3RA 4RLFA 1RESA 1E3PA 5HDNA 3GTQJ 4RDUA 3BP8A 4RAYA 1IRGA 3VOEA 3K4JA 2QEXI 2ELHA 2E1NA 3O8HA 2M45A 2X48A 2Z9OA 2FBHA 2YU3A 3NEUA 4L9VA 4UXNA 4DNCA 4KNYA 1MDMB 2DK5A 3F72A 2L4AA 3VSLA 2FBKA 4B3XA 4I0AA 1OR7C 1KU3A 1XB4A 2OAZA 2W84A 4CCJA 3CC7I 4XBFA 2FMYA 4S04A 5C4XJ 2KJBA 1FYLA 5D5WB 3PO2J 1X1DA 4HNTA 5DCFA 3RPQA 1Y56A 2CU7A 2X9DA 4A5MA 2XAUA 2EFWA 2R4GA 4A69C 2L7MP 3JRFA 3ZP5A 5TGTA 1FBSA 1TNSA 2ZJQF 1D1AA 2PMUA 1O7FA 2W48A 3RSNA 2BVLA 2F5FA 3R0AA 1I3AA 5AIQA 3M8EA 3M7GA 5A2QK 1HDPA 2MSYA 4IF4A 1H8AC 3CF2A 5B66C 4C3HJ 1WJCA 2FE3A 3C1DA 4WXHA 5LGUA 2R0QC 2GQQA 3FBIB 1WHUA 4IOCF 4BNCA 1U8RA 3Q9SA 2VQHA 4O5VA 2JA6J 3CCLI 2IW5A 4XKWA 1Y1WJ 1QRYA 3OYHA 2GIVA 4A3BJ 4YIFA 3GXOA 1RPWA 1VQ9I 3F22A 4I0BA 3ZMDA 4N4OB 4HNUA 4ZYEA 2COBA 2XRNA 4FQGA 4XOTA 2JRTA 1MBFA 3VEPA 4HLYA 2PX9A 5E18F 4D5FA 1AKHB 3G1OA 4L9JA 2VQGA 1W5CC 3QODA 4HPQA 1AA7A 2Y75A 3ZGKA 3CD6I 3J7AO 4E7JA 3A1YA 3V7SA 4XLEA 3H35A 3C3WA 3LSKA 4LIUA 3J81Z 1YX3A 4D7MA 3CC4I 3D1NI 4G7OF 3CMEI 4A3FJ 3E6MA 5HLGA 3DTEA 1BOAA 1F1ZA 1TW3A 1XMAA 5TISC 1K78B 2P81A 2OCEA 4AIJA 1WI9A 4HW0A 1LEAA 3N97A 2VB6A 2M3AA 5FFXA 2EIMH 4HX8A 1D5VA 5E1WA 3CCQI 4EJUA 4A3CJ 4A3IJ 5HDKA 1VQNI 2Z2SB 3DWLE 3F8BA 3QOPA 1FBUA 5TRDA 3QPLA 3OL4A 2GA2A 1OR7A 1M1EB 1MMAA 4YEJA 3ABTA 3HOYJ 2DOEA 4EQQA 4NC6A 1Z67A 5M3MJ 1S6LA 2GZWA 3AG3H 2GOXB 3MMYB 2IGKA 3FM5A 2HKXA 1T6SA 4P5OA 3TEDA 2EWNA 1IXRC 1GLNA 3FKIJ 4A3KJ 1JHFA 3RIRA 1TWFJ 2RKHA 2KDZA 4I09A 1FLIA 1F9NA 2OBPA 5F64A 2JPCA 3HOSA 1WI3A 1YIOA 4BXXJ 2PJRB 3E5UA 3KP2A 5HODA 4AD9A 1BC8C 1KQ8A 3IP4B 1FX7A 3OYNA 4KA4A 3HHHA 5CPRB 2DFFA 1XD7A 2QLZA 4PK4A 3OIPA 5DM6F 2MLKA 3HOZJ 3PO3J 3F23A 4C2UA 2LSOA 3EUKL 4C30A 3FDYA 1Y1VJ 4BE0A 4A0XA 1SD5A 4CH7A 2WV0A 3WE3A 4M3DA 4CCNA 2W85A 3J7YJ 3JCUC 2CUZA 4XLAA 1ZAOA 2A6TA 4ZDLA 5JLWA 1AKHA 4MLOA 1P4XA 2MD5A 4A3MJ 2DTRA 2L7ZA 2VL8A 5J6XA 3P7NA 3QQAA 2HPMA 3DLAA 3VYSB 1ZARA 4F93B 1OCZH 4IQJA 1NH3A 1VI0A 2VKDA 2O3FA 3DBHB 1OFCX 2E36A 2GIZA 1J59A 5IOYA 1EV7A 1Y8QB 1IXSB 5DTDA 4J19A 1MZBA 5D6EA 3WTUC 1ZRCA 3R0JA 3ECOA 4EJTA 5LRSA 2VJJA 5FFZA 2R7QA 5HVQC 2QA4I 2CG4A 4EM1A 3ASOH 3TGNA 5EGOB 3M1EA 1IAWA 4OWRB 4L0YB 1TLHB 4CYCA 3AG4H 2EA2A 4A6EA 3LMMA 1XX5A 2F5CA 3OYJA 3SQNA 4B44A 1N77A 4XN3A 1WQ2A 2VE9A 1Z6RA 4FT8A 2E2JJ 1O3TA 1O4XA 2A61A 2DMUA 4E6KG 2EJRA 4XONA 2L9NA 2KLOA 1R71A 1DDNA 2IAIA 3MZHA 2YR2A 2D1VA 4W97A 2OF7A 5DV5A 1MGTA 1EF4A 2OTJI 3E5XA 5FKOA 4KYWA 2XGXA 4XKVA 1S29A 4V2FA 2CJJA 3DBLB 2VXZA 1I39A 1YRNB 1BW6A 5A2QZ 2DMPA 1U6GA 2M0CA 2QYOA 2TCTA 2PQ8A 2DXIA 4XNFA 2E2IJ 2PN6A 2D1HA 3IL2A 2M8GX 1SAXA 3BR0A 1G4DA 4FASD 3FXJA 2BXZA 1LB2A 1ZTRA 2UXXA 2OA4A 5FRMA 1LDJA 5K1YA 1MNMC 4F55A 2OC6A 3TOAA 3VYTB 2ZC2A 3O6BB 2Z3YA 3SFZA 5LBQA 2JJ7A 3S3NA 3FF5A 3BJOA 4Q48A 2XPUA 2KPMA 3NWSA 3CP8A 4LK1F 1RI7A 1JE8A 1R58A 3CCEI 1T38A 4RB0A 1G59A 4B4CA 4CCLA 2ZNYA 1PDNC 2ICWG 2VQLA 1LNWA 5M5WJ 1BIAA 2EFQA 2OTLI 5EG0A 4JP0A 2DA5A 4QWQA 3S3OA 2NVTJ 3ABKH 2DQLA 1MKMA 2W7NA 3NARA 1TWHJ 1H9TA 3S14J 3F21A 4YG2F 3DFGA 3I55I 1HC8A 3OYAA 5FD5A 3LWFA 1W5TA 2A3SA 2W4SA 1Y0NA 1HW1A 1MJ9A 3P5JA 5JHUA 3ZQIA 4ENNA 4XMYA 3QP6A 1SVLA 2M8EA 4G94A 5BPIA 3Q3SA 2VN2A 5EGOA 1OPCA 4HQEA 1ZGAA 4MFEA 1FYMA 3K4LA 3HUGA 3MKWB 3K2ZA 2FU4A 1I6HJ 3GTLJ 2V1DA 4CGZA 2P5LC 1SD7A 2QBYB 1X4PA 2L0KA 2Y2ZA 2QQAA 2V26A 3L7WA 1FJLA 1QA6A 4KN4X 3CO7C 3AAFA 1BI3A 5JHFA 3KZIC 3OYEA 3VSKA 3GFLA 4RBOA 2P8TA 2DI3A 1JKQC 2M9HA 5CVJA 4S0HB 1J75A 1TNTA 5J4YA 2P5KA 3DQVC 2DTZA 2JK3A 2IS1A 1XCVA 2I10A 1GV5A 5L3CA 3O2PE 2KHMA 2P0WA 2ZFWA 4AWXB 2LYCA 2IA2A 4U0WA 3AL0B 1JJ8C 3GLXA 4PSWA 3RYPA 3OYGA 2ID6A 4G9YA 5D4RA 1WWXA 1U0JA 3K0LA 1QQIA 2H6BA 2P7CB 1P4WA 4KFCA 3PSFA 2AXLA 3A01B 3HEFA 1JI8A 4I99C 4UY8I 2Z99A 1OLTA 5E3LA 1Z7LA 5IP7J 3T5XA 3BR1A 2WADA 3QPSA 1OMIA 3GZ5A 5EEGA 1C0WA 2IXSA 1OQYA 1SD4A 3PUBA 5GTHC 1R6RA 1JJ6C 2R7WA 1D0ZA 3LSPA 4MIMA 2W25A 3BR5A 1ITYA 1LQ1A 2A5YB 2GOMA 2IBDA 2XF7A 5H2FC 3RPUD 3AG1H 3EYYA 1Q1HA 2EZLA 4P1WA 4HOBA 5KK1A 2F5DA 3IH2A 3M3YJ 3VFZA 3IKTA 2XSJC 4PFOA 3CUQC 5E3OA 3GFMA 1WGXA 1SAUA 2KT0A 4F3QA 2BW3B 2EV0A 2KISA 3PUFA 4KT6A 4IEJA 3GZ6A 2ELKA 1DPUA 5BQTA 3JSOA 3BQZA 1OYIA 2V1NA 2WB1A 2VOPA 4N9IA 4BQAA 4A0YA 3SDGA 3GMEA 4HZFA 1JXSA 2VOOA 2JWTA 4M74A 5HLIA 2LREA 2MD0A 5H6QA 1E2XA 2ME6A 1T0FC 4CO8A 2EIKH 1QZYA 2WA0A 2DA4A 3FM3A 4MO7A 3D5SC 4Y4RA 2JTVA 4UVAA 1QNTA 3RQIA 4UVBA 4B48A 3OR2C 3SEZA 3W6KB 2GWRA 3KYLA 4U87A 2UV1A 1SD6A 5C44J 2M34A 5FO5A 1W4MA 3CO6C 2BHYA 2K9QA 1K6YA 4NBQA 1G3SA 2CWEA 3HBLA 2JN6A 2CQNA 1VQLI 3QU3A 3M9AA 1DPRA 4AU7A 4L18B 4DBQA 2K02A 2JT1A 3OV8A 1Z3YA 3F6VA 1XMKA 2V79A 2STWA 2VT3A 3JRHA 2K5CA 4KIBA 1STZA 3FBNB 2VPRA 3TDZC 4PDKA 4DZJA 3OYCA 2WV1A 4A3JJ 2FOWA 3BR6A 3HSFA 3CDIA 4JQFA 3KCCA 3SJMA 4Z6YA 3L2UA 2ID3A 2PMZA 3EPZA 1S72I 3UNGC 3KIOA 2JA8J 1G3TA 3ELKA 3CTAA 2HTSA 5CYVA 2V9PA 1X3UA 2J5OA 3HPHA 3OYMA 1TT0A 2IA1A 3A0BC 2ETHA 2VKHA 3ZN0A 2JMWA 4IPAA 3I59A 2IPQX 4LIVA 4LLNA 2UXNA 1FP2A 4BQQA 1G8XA 2QQ8A 4Y33A 3I4MJ 3V7CA 3VDXA 5LRRA 2EK5A 5J1RA 2QVOA 2GA1A 3DU5A 2LG4A 3D5LA 3B73A 4FISA 2IGNA 4ON0A 1BR2A 1ETQA 3E7LA 1FNNA 3VPRA 1IC8A 5CKTA 3WU0A 1K7AA 2YPRA 3A4CA 2CW7A 1CF7A 1GV2A 1T33A 5IOZA 1JT0A 1QO0D 3HKZN 3OYDA 1FP1D 3IRQA 3N05A 3Q0UA 1GHCA 4EGZA 2CS3A 3L2WA 3PIPF 1QZZA 5LLQA 2F5VA 1ZG1A 1FYKA 3KLNA 3HSEA 3I4PA 4LB6B 3OS1A 1X1AA 2JUCA 1BIBA 4EJWA 3JRBA 3DEUA 3FISA 4DJAA 4HSRA 2GM4A 2Y0MA 2F4OB 3WTYC 4O6JA 1BR4A 1UG0A 3GUDA 2CW0F 3PL8A 2H1KA 2KKOA 4HDUA 1WFXA 4RAZA 2CV0A 2VODA 2O03A 1VZ0A 2Q2EA 4LOCA 4A6DA 4M3GA 1D8KA 1ZHFA 1DUXC 4M3EA 3LQRA 1Z05A 4RM2A 2H1LA 3OMYA 4KMFA 2E71A 1OYYA 5DCMA 1KU7A 3LFKA 4BJTA 3I5UA 5GPCA 3DF8A 5J8CA 1IUFA 3DPTA 4NB5A 4M71A 2K85A 2KQRA 4Y17A 3TO7A 5LEJA 3K1MA 3HL2A 2ZO4A 5H6RA 1FT9A 3PFYA 1H0MA 4OIOF 3BJ6A 3CCYA 2K40A 1DGWY 3ZN1A 1USTA 4GFBA 4MEXF 3HOWJ 2L2OA 3BTJA 2R7DA 4Y52J 5IT9Z 5EF6A 3BPXA 1WJBA 1ZELA 3WU2C 3A0HC 3MZYA 3W3CA 3DBRB 4WXCA 1VQ4I 1FTTA 3OIQA 4BE1A 2IEKA 2V6EA 3F8CA 2VKEA 3VWBA 3V7RA 4ENJA 1MMGA 1UG2A 1PVEA 3C2HA 5J3LA 1ON2A 1YLFA 3W2VA 1I27A 5F0HA 4XSXF 1TWGJ 1R5GA 3KP4A 5DUIA 2L7FP 4II2A 4I2OA 4FETA 3SDBA 2G0EA 2IS2A 3TL4X 4E7LA 1FPQA 5CQEA 3TQNA 5CLSA 5J1YA 3K2AA 3AL0C 2F4MB 4U0YA 2CV2A 4ZZLA 4BBSJ 3GO5A 3ZQLA 3LSRA 2DMQA 4KMUX 2F2EA 1N25A 4XK4A 5KAFC 5LFAA 3KZYA 3CUQA 4S05A 2LKXA 5D5UB 1UHMA 3LNQA 2ISZA 1E0EA 4ETSA 3MWMA 2ZSHB 3RKQA 3E6BA 1F4KA 5ED4A 3I58A 1QHGA 4XSZF 3IAS2 4OOIA 3OS0A 4IHVA 3CCRI 3CCSI 4R79A 1J2XA 2VI6A 1PUEE 3RCOA 5EZGA 4AVZA 4PSXA 2FQ3A 2EPFA 3HGGA 1VQKI 3HB9A 5HDGA 1YIJI 2DBBA 3M8FA 1EA3A 2DMNA 4M72A 3J80K 4PGHA 3WTSC 1T98A 2L3DA 4B1RA 1T39A 5M5YJ 4F7ZA 2HDCA 1XPXA 4LITA 4JK1X 4OU0A 4IKFA 4M9SA 3HSRA 4RB3C 5LD2C 2GBYA 3H3VK 2R7OA 3CLQA 4DIQA 3DLLF 2LKSA 2NRAC 3OOUA 5DYMA 3DPUA 4X0GA 2CW8A 4YFNF 3BWGA 1MSFC 2G7UA 3PJRA 1SFKA 1RZ4A 2VJ4A 1KYZA 4XLNF 4BGDA 3PFIA 4AYBA 2O5RA 4A3LJ 5BMZA 3ZMSA 1JHHA 3CCMI 1CGPA 2P7VB 4Q5SF 3F8NA 3H0GJ 4WWCA 1F43A 3OR1C 2DA2A 5FLXZ 3ZR8X 1ZRDA 3IUOA 1R4NB 4E7IA 1ZK8A 1LEBA 1R1VA 3FX3A 2DQRA 2ZXJA 2XVCA 2BGCA 1Z1DA 2JVGA 2BXYA 2DW4A 2EBIA 2KP6A 3T8RA 2XV4S 4BL0B 2JZYA 4MNUA 2JSPA 4V19K 1TBXA 2E1OA 3K4CA 3FMSA 2EFPA 3S2WA 4P9UA 4M3FA 4ZDPA 1S5LC 2B9SA 4UHTA 1B9MA 2G7HA 5AONA 2RQPA 3K4KA 4FHTA 2XDVA 3A01A 1VTNC 1H88C 1AU7A 4AM3A 4RGRA 3FZVA 1D3YA 3CDHA 1FOYA 1IRFA 2Y30A 1R1TA 3F6OA 2CUEA 2LMDA 4A5NA 3DKYA 4DOZA 4MFDA 1HCRA 1Y6IA 2HNHA 5GADJ 2QKLB 3BTCA 3KX2A 1MW7A 1U5TC 2UUZA 2PI0A 1SC7A 3K4NA 4NC7A 4O3MA 5FLXK 4Y13A 3ABLH 1RR8C 3DCFA 2YS9A 4R1HA 5HS9A 3RKWA 1TC3C 2E34A 3TO6A 3KYDB 2EINH 3GW2A 2L9VA 1U3EM 3ERMA 3BR3A 3FXRA 4RAGA 4QIWN 3RZOJ 2DDBA 2ZXHA 1BI2A 3T8TA 3C2BA 1S3JA 4HA8A 3WTVC 2IS4A 1V55H 3HUGB 2GAUA 3HRSA 1Y0UA 4GCVA 3OOPA 5FRNA 3BROA 2HDWA 2K9MA 2X1DA 2Y48A 1T0FA 1T56A 2HYJA 1ZGWA 1YHQI 2VPLA 3B02A 3FXMA 2Z1DA 3QYEA 3VB2A 4ANJA 3CMYA 2MH9A 3ZOBA 1RNLA 2UWMA 4WX9A 4YIIA 2MC4A 2Y9ZA 4NDLA 3W2AA 4ZTJA 2OQRA 4YRVA 5DD8A 1T08B 3BG9A 3DP7A 5J1UA 2JA7J 3EDPA 2H09A 4A2UA 2CQXA 1JUMA 3HRTA 2DFEA 4A93J 1KZHA 5IT9K 4OMZA 1IJWC 3H3ZA 1IN7A 3GZNB 5D5VB 4C9YA 1L3LA 1MSEC 1JGGA 2IRFG 1YE9A 1NK2P 3SEQA 4BJ6C 2TDXA 5F6FA 1F36A 1A6QA 3BZCA 3HHGA 4AVPA 1R23A 1S8NA 2KIFA 2XAGA 1J09A 1B6AA 4XQFA 1Y8RB 1FC3A 3LFUA 5JVGF 4L9TA 2RAEA 2HS5A 1TT5B 2PBIA 1XSXA 2R92J 1MBJA 3CDLA 3K6GA 3FMRA 3Q5FA 3J7AY 5CVVA 2NVYJ 3T0YA 2MABA 4ZJZA 3GTPJ 2PJPA 3EYIA 5EEHA 1PJRA 1HKSA 1KGSA 2CRGA 3HXLA 1UFMA 5GAGJ 4E70A 2HOEA 2HVQA 2VJIA 5E79C 4B43A 3BG6A 2Q0OA 1BI0A 3QYBA 2HKOA 3PNTA 4KITB 2XKOA 3PM1A 4HG2A 3QPHA 4OIQF 2RN7A 5BPDA 1IG7A 1DGRM 2XB0X 1ORKA 3JTHA 1S9HA 3I53A 2LBFB 1Z7UA 1LFBA 1BL0A 2HDDA 2CQKA 2L02A 3GCMA 2LY2A 2LF8A 2VIXA 1QVTA 3H5NA 3W6JB 3HC7A 4RB2C 4JX4A 3LOCA 5ICEA 1QPMA 2PFBA 3GTMJ 2FBIA 1H89C 3KZZA 3G6EI 3ESWB 3E3VA 3L2VA 2BHZA 5CVUA 3LA2A 4YIRX 2VC1A 4XKCA 2HPIA 3ML6A 4UUTA 3O8GA
chains in the Genus database with same CATH topology
4TV7A 4L5IA 5TJJA 3F3XA 1IW7F 3SXYA 1YFHA 1HSTA 4UV8A 3FWEA 4MHGA 1F5TA 3CUOA 1HW5A 1UCRA 1YG2A 3QPTA 1FWZA 1HXDA 4LLGF 1FSEA 2EB7A 3RPUA 4CXFA 2B0LA 2O0YA 4HDVA 3NQOA 4BYYA 4UUVA 1YS7A 3FMQA 4HX4A 2FA5A 2K7LA 4ESFA 5HLHA 3K1PA 5K5RA 4P55A 3DV8A 1U78A 1ZG5A 4MQ9F 5E8GA 2JPBA 3LQQA 1K6OA 1YYVA 4HX7A 4P9FA 2ACJA 3WTWC 3WGGA 3ZMTA 1S7OA 1XN7A 3BZ6A 3KP5A 5E1ZB 5BS6A 3U1DA 4UVCA 3O3KA 2KRFA 4EM0B 2YX4A 5E1XA 1R22A 2VBZA 4HV6A 1QGPA 5ICGA 2FNPA 3GYHX 3MQ0A 4LLLA 3R4KA 4BH9A 2EV6A 2FSWA 2HTJA 4LK0F 5HOOA 4BAYA 5ICCA 4Y15A 2K27A 1XDSA 4UNOA 3WTZA 3QP5A 2P4WA 1AWCA 4OIRF 2X4HA 4Z2YA 3RI4A 4NHJA 1LDDA 2FF4A 4BHCA 2OZUA 2R7FA 3P9IA 4JBAA 1R36A 1P6RA 5E17F 3FXUA 3V8JA 4EJVA 2HEOA 2IP2A 5JR3A 5FB2A 3IRRA 2STTA 2K86A 2C6YA 3R6SA 1YQAA 5D8LB 1J0RA 2PG4A 3KFWX 1L0OC 2DPUA 5LGNA 2A69F 3JW4A 2VE8A 2PMHA 4KIGA 3T1BA 2VBXA 2VC0A 4I7HA 2G9WA 1B1BA 4BHPA 3MFKA 2XUBA 4OIPF 4Q47A 1KQ9A 4A0ZA 1ZYRF 5L3FA 1TQMA 2VONA 4WXDA 4MQVA 4U88A 3ABUA 3HOTA 4I98B 4Q4ZF 4XRFA 3WTXC 3REOA 2CYYA 3JTGA 4B09A 3GEZA 2FXAA 4A12A 2MLGA 2ESHA 4L5JA 1SMYF 2CGPA 2V6CA 1ZG3A 3G73A 1HKQA 4LMYA 4U7DA 3MCZA 5FD6A 4DQ2A 3F8FA 2EFOA 2DLLA 1XGSA 3IWZA 2AS5F 3HTUA 4HV5A 2FMLA 4BXUA 3TKYA 4HF0A 2V1XA 1QBJA 2M1BA 2IVMA 1HSJA 2A07F 1EH8A 1O7LA 2VBYA 1JGSA 3MAJA 2V1UA 1W7PA 3ZMVA 4WK8F 2P6SA 2X0LA 1MD0A 1IN8A 1SMTA 3HIFA 4MEYF 4IHSA 1USSA 5DEQA 2IT0A 1XSVA 3I64A 3DKWA 4OMYA 2LKPA 3JSPA 2LDUA 3K69A 1R00A 2A68F 4ESJA 2M30A 2RC4A 2J5PA 1GVJA 4FX4A 2L4MA 4ZYDA 3E6CC 1WSUA 1R5HA 1E17A 1BI1A 3ERED 3BPVA 1RIOH 3ZMUA 3GFIA 1ZREA 4XLPF 4PCQA 2R3SA 2DO7A 1WKMA 3J80Z 1TW2A 2QWWA 4KT5C 4IRGA 4HF1A 2XASA 5BOXA 1IUYA 1I1GA 1SFUA 2DU9A 2A6HF 4G6QA 5LHGA 2XROA 2W57A 4RB1A 4GYIA 4EM2A 4G8XA 2MC3A 1YW9A 2QZ8A 3GF2A 1EH7A 3BY6A 4NQWA 3HYIA 4MTEA 2OZ6A 1G3YA 1IZ1A 1J5YA 1IF1A 1R1UA 4LB5A 4KIFA 1GXQA 3KP6A 3COAC 1ZGJA 1HQCA 4BHBA 2XAJA 4AIHA 2HFHA 1HBXG 1MDMA 1RUNA 3TO9A 3P9CA 1U5TA 1K79A 1V4RA 2EFNA 2OU2A 5DDGA 3PQKA 1I1SA 2BYVE 2L01A 2PLYA 4U0VA 4IRIA 1GXPA 1I5ZA 2BE5F 2GXBA 3CJNA 2D45A 2UZKA 4KN7X 4RGUA 1BBYA 3ZQ7A 5F1RA 1Z91A 5L3DA 2PEXA 3KE2A 3RYRA 3QU6A 3FXQA 1W7PB 2O8XA 2QQ9A 2FRHA 4ZYHA 3N4MA 1H9GA 5LEKA 5ICFA 3QRFF 4IVNA 2LF7A 1B59A 4RGXA 5J8FA 2EV5A 1MJBA 5D4SA 4EV0A 1BC7C 4MGRA 4KDPA 1OKRA 1P2FA 2EA4A 3SZTA 2IJLA 3KLOA 4HLXA 2VBWA 3RKYA 4M9ZA 3H3UA 2RV8A 1TTYA 1Z9CA 4ESBA 4RS8A 3ROUA 1ZRFA 3K9TA 4GXOA 2Z33A 4CDGA 2NNYA 2IA0A 1G6NA 3I54A 3ISPA 2XHKA 2DK8A 1FSHA 2LNBA 3WU1B 4ZZDA 3L00A 1SFXA 2H6CA 5JFRA 4WCGA 3PQJA 2K4BA 2YX7A 5LHHA 1D8JA 2RDPA 4PGGA 2VT2A 2XKPA 3RJPA 3V8LA 1O3SA 3LSTA 1XCBA 4CHUA 2BV6A 2HR3A 3HTSB 1R7JA 1B4AA 3TOBA 1K78A 1YS6A 1SFEA 3BOQA 4IRHA 1T2KA 4N9HA 1J9IA 3I0TA 4RGSA 4CYDA 2ESNA 4ASNA 4B8XA 1U5TB 2A6EF 3GVAA 1IN6A 4L9NA 1LDKB 1V3FA 2ADUA 4CZZA 2YSRA 1BN5A 2OD5A 1OYWA 1FY7A 2Z5UA 3L2CA 5AIPA 2E7WA 3D0SA 3K1NA 4YFKF 3JAMZ 3LA3A 3I71A 4ZH4F 2H94A 3GWZA 6PAXA 2O6GE 4LG0B 3KP7A 2O61A 1XGNA 2NS0A 4I02A 2QQBA 3F8MA 3WGHA 3C18A 3WODF 1CF7B 2Q8KA 2XAFA 3U9GA 5L3GA 4U7BA 2E7XA 3QAHA 3BDDA 1B9NA 1ZH5A 3ECHA 3KP3A 3E5QA 2H27A 2GXGA 4KICA 1MJAA 3E6DA 1ON1A 2ZMEA 1A04A 4IHTA 4LJZF 2ZCWA 1XSDA 3V4GA 2RGVA 2FNAA 4LGWA 4L0ZB 4CICA 2W24A 3TDUC 3ULQB 4K2EA 3RDIA 2CSOA 5HS7A 3KEQA 5K5QA 3V8KA 1KQ0A 4FX0A 3R61A 3ZPLA 3J81K 4QLCU 3IWFA 1YW7A 2ZNZA 1P4AA 2HQRA 4LD5A 1FBQA 4EMSA 3WTTC 1YTYA 5D5XB 1BJAA 3GX4X 2RNJA 2HQNA 4EVIA 1YW8A 2M87A 2RVCA 1HW2A 2FOKA 1HKTA 5CVIA 2D2WA 1P92A 1ZLKA 3SHFA 3ZMZA 2CO5A 5LGTA 3HRUA 3WE2A 2L54A 4IJAA 4HYEA 3JAMK 3IHUA 4ENKA 3DXJF 4G6DA 4HBLA 4M9XA 5CVRA 3HRMA 1TQIA 3EUHA 4PZJA 3IC7A 5D6FA 1RUOA 1XGOA 2BEOA 4GO1A 4I01A 3NRVA 4HAMA 4M6YA 5DUKA 5DD4A 3R60A 1G3WA 4YFXF 2NNNA 1FZPB 5H20A 1AOYA 1O3QA 5DCMB 3GFJA 1TQPA 4D0PA 2OQGA 3RTRA 2FEZA 2WC2A 5IT3A 1DP7P 2ZJ2A 1YO5C 1XDUA 1W5SA 2HYGD 1PP7U 1J7KA 1LJ9A 4LG0A 3U2RA 2HGCA 4G7HF 2HZTA 2KIUA 5ILSA 2QENA 2QUFA 3BJAA 4N0BA 2BBYA 5ERIA 1IN5A 2DPDA 2HWVA 2XAHA 3CUQB 4M73A 3E97A 5FGMA 3WGIA 1PP8F 3C7JA 5JVTA 4HF2A 1BM9A 3DPLC 1ZN2A 2DT5A 2ZMEB 3Q9VA 3IKVA 3I59B 4EJOA 5LHIA 4ZYGA 2ISYA 2NYXA 3SZPA 1KU2A 3KETA 1I6XA 5K5OA 2XAQA 5L3BA 3EETA 3MEXA 1U2WA 4LFUA 1KA8A 2XIGA 3P9KA 5CJ9A 5D8KB 4UV9A 2QBYA 4GGGA 4GYGA 4AIKA 1UB9A 4HQMA 2DFIA 5HS8A 2CFXA 1O57A 1S7AA 4KUMA 4WF2A 4M6XA 2KIMA 4OINF 1Z6TA 2HYFA 1IXCA 5ILUA 1NHAA 2MBFA 5E20A 4MTDA 1ZLJA 5E8IA 1ODDA 3WG9A 2ZKZA 3G3ZA 4P96A 5L3EA 2DAOA 3EQLF 5ILVA 1FOKA 2WTEA 3L9FA 2M5WA 5JI6A 2MH2A 1EH6A 2K4JA 2V9VA 2WWYA 2KJCA 4EGYA 4G7ZF 4ENMA 1WRJA 2ZBKA 5KVRA 2E1CA 1ULYA 2NAZA 3LAPA 4IXAA 2JSCA 2MA3A 4R8HA 1KU9A 3FHZA 3RKXA 3H92A 2F5EA 2P6TA 1XGMA 3L09A 1LVAA 1IN4A 1ONVA 3LA7A 3VODA 1W7PD 3CLOA 2QM3A 1REPC 4H0EA 3KEOA 2COMA 3LAJA 1UHWA 2P5VA 1KYWA 1O3RA 5HDNA 3BP8A 4RAYA 1IRGA 3VOEA 2ELHA 2E1NA 2M45A 2Z9OA 2FBHA 2YU3A 3NEUA 4L9VA 4UXNA 4DNCA 4KNYA 1MDMB 2DK5A 3F72A 2L4AA 2FBKA 4I0AA 1KU3A 1XB4A 2OAZA 2W84A 4XBFA 2FMYA 4S04A 2KJBA 1FYLA 5D5WB 5DCFA 3RPQA 4A5MA 2EFWA 3ZP5A 1FBSA 1TNSA 2PMUA 1O7FA 2F5FA 3R0AA 5AIQA 3M8EA 3M7GA 5A2QK 4IF4A 2FE3A 3C1DA 4WXHA 5LGUA 2GQQA 4BNCA 1U8RA 3Q9SA 4O5VA 2IW5A 2GIVA 4YIFA 3GXOA 3F22A 4I0BA 3ZMDA 4ZYEA 2XRNA 2JRTA 3VEPA 4HLYA 5E18F 4L9JA 2Y75A 3J7AO 3V7SA 3C3WA 3J81Z 4G7OF 3E6MA 5HLGA 1BOAA 1F1ZA 1TW3A 1XMAA 1K78B 4AIJA 1WI9A 4HW0A 1LEAA 3N97A 5FFXA 4HX8A 1D5VA 5E1WA 4EJUA 5HDKA 3F8BA 3QOPA 1FBUA 5TRDA 2GA2A 1OR7A 3ABTA 4EQQA 1S6LA 2GZWA 3FM5A 2HKXA 1T6SA 4P5OA 2EWNA 1IXRC 1JHFA 3RIRA 2RKHA 4I09A 1FLIA 1F9NA 2OBPA 5F64A 2JPCA 3HOSA 1YIOA 3E5UA 3KP2A 4AD9A 1BC8C 1KQ8A 1FX7A 4KA4A 3HHHA 1XD7A 2QLZA 2MLKA 3F23A 2LSOA 4A0XA 1SD5A 2WV0A 3WE3A 2W85A 1ZAOA 1P4XA 2MD5A 2DTRA 5J6XA 3P7NA 1ZARA 2O3FA 1J59A 1EV7A 1IXSB 1MZBA 5D6EA 3WTUC 1ZRCA 3R0JA 3ECOA 4EJTA 5LRSA 5FFZA 5HVQC 2CG4A 4EM1A 3TGNA 3M1EA 1IAWA 4L0YB 1TLHB 2EA2A 4A6EA 2F5CA 3SQNA 1WQ2A 2VE9A 1Z6RA 4FT8A 1O3TA 2A61A 2EJRA 1DDNA 3MZHA 2YR2A 2D1VA 5DV5A 1MGTA 3E5XA 4KYWA 2XGXA 1S29A 2VXZA 5A2QZ 1U6GA 2QYOA 2PQ8A 2PN6A 2D1HA 3IL2A 1SAXA 1G4DA 1LB2A 2UXXA 2OA4A 1LDJA 5K1YA 3TOAA 5LBQA 3O6BB 3SFZA 2Z3YA 3FF5A 3BJOA 4Q48A 4LK1F 1RI7A 1JE8A 1R58A 1T38A 4RB0A 2ZNYA 1PDNC 1LNWA 1BIAA 2EFQA 4QWQA 2DQLA 1MKMA 1H9TA 3F21A 4YG2F 3DFGA 5FD5A 3LWFA 1W5TA 2A3SA 1HW1A 1MJ9A 5JHUA 5BPIA 4ENNA 3QP6A 2M8EA 4G94A 2VN2A 1OPCA 4HQEA 1ZGAA 1FYMA 3HUGA 3K2ZA 2FU4A 4CGZA 2V1DA 2P5LC 2QBYB 1SD7A 2QQAA 3L7WA 4KN4X 3CO7C 3AAFA 1BI3A 3GFLA 2P8TA 2DI3A 5CVJA 1J75A 1TNTA 2P5KA 3DQVC 1XCVA 5L3CA 3O2PE 2ZFWA 4AWXB 2IA2A 4U0WA 3GLXA 3RYPA 4G9YA 5D4RA 1WWXA 3K0LA 1QQIA 2H6BA 2P7CB 1P4WA 4KFCA 2AXLA 2Z99A 3T5XA 1OMIA 3GZ5A 5EEGA 1C0WA 1SD4A 2W25A 1LQ1A 2A5YB 3EYYA 1Q1HA 4HOBA 5KK1A 2F5DA 3VFZA 3IKTA 3CUQC 3GFMA 2EV0A 3GZ6A 1DPUA 5BQTA 3JSOA 1OYIA 2VOPA 4N9IA 4BQAA 4A0YA 4HZFA 1JXSA 2VOOA 4M74A 5HLIA 5H6QA 1E2XA 4CO8A 1QZYA 3FM3A 2JTVA 4UVAA 1QNTA 4UVBA 3W6KB 2GWRA 1SD6A 5FO5A 1W4MA 3CO6C 1G3SA 2CWEA 3QU3A 3M9AA 1DPRA 4L18B 2K02A 2JT1A 3OV8A 3F6VA 1XMKA 2V79A 2STWA 2VT3A 4KIBA 1STZA 3TDZC 4PDKA 3HSFA 4JQFA 3KCCA 1G3TA 3ELKA 3CTAA 2HTSA 5CYVA 1X3UA 2J5OA 2IA1A 2ETHA 3ZN0A 4IPAA 3I59A 2IPQX 4LLNA 2UXNA 1FP2A 3V7CA 5LRRA 2EK5A 2QVOA 2GA1A 3D5LA 3B73A 4ON0A 1FNNA 3WU0A 1K7AA 2YPRA 1CF7A 1QO0D 1FP1D 3IRQA 1GHCA 4EGZA 1QZZA 5LLQA 1ZG1A 1FYKA 3KLNA 3HSEA 3I4PA 4LB6B 1BIBA 4EJWA 3DEUA 2Y0MA 3WTYC 4O6JA 3GUDA 2CW0F 2KKOA 4HDUA 4RAZA 2VODA 2O03A 2Q2EA 4A6DA 1D8KA 1ZHFA 1DUXC 3LQRA 1Z05A 4KMFA 1OYYA 5DCMA 1KU7A 3LFKA 3I5UA 3DF8A 5J8CA 3DPTA 4NB5A 4M71A 4Y17A 3TO7A 5LEJA 3K1MA 2ZO4A 5H6RA 1FT9A 1H0MA 4OIOF 3BJ6A 3ZN1A 1USTA 4MEXF 2R7DA 5IT9Z 3BPXA 3MZYA 4WXCA 3F8CA 3V7RA 4ENJA 1ON2A 1YLFA 1I27A 4XSXF 1R5GA 3KP4A 5DUIA 4I2OA 1FPQA 3TQNA 5CLSA 4U0YA 4ZZLA 3GO5A 4KMUX 2F2EA 3KZYA 3CUQA 4S05A 5D5UB 1UHMA 2ISZA 4ETSA 3MWMA 1F4KA 3E6BA 5ED4A 3I58A 4XSZF 4OOIA 4R79A 1J2XA 1PUEE 2FQ3A 5HDGA 2DBBA 3M8FA 4M72A 3J80K 4PGHA 3WTSC 1T98A 2L3DA 1T39A 4F7ZA 2HDCA 4JK1X 4OU0A 4M9SA 3HSRA 4RB3C 2NRAC 5DYMA 4YFNF 3BWGA 2G7UA 4XLNF 1RZ4A 1KYZA 3PFIA 5BMZA 3ZMSA 1JHHA 1CGPA 4Q5SF 2P7VB 3F8NA 4WWCA 5FLXZ 1ZRDA 1LEBA 1R1VA 3FX3A 2DQRA 2ZXJA 2XVCA 2BGCA 1Z1DA 2DW4A 3T8RA 2XV4S 2JZYA 4MNUA 1TBXA 3FMSA 2EFPA 3S2WA 4P9UA 4UHTA 1B9MA 2G7HA 5AONA 2RQPA 4FHTA 1VTNC 4RGRA 3FZVA 1D3YA 3CDHA 1IRFA 1R1TA 3F6OA 4A5NA 1U5TC 2PI0A 4O3MA 5FLXK 4Y13A 4R1HA 5HS9A 3RKWA 3TO6A 3GW2A 1U3EM 3FXRA 1BI2A 3T8TA 1S3JA 4HA8A 3WTVC 2GAUA 1Y0UA 3HRSA 4GCVA 3OOPA 3BROA 2Y48A 1T0FA 3B02A 3VB2A 2MH9A 1RNLA 2UWMA 4WX9A 4YIIA 2OQRA 5DD8A 3DP7A 3EDPA 2H09A 4A2UA 3HRTA 5IT9K 4OMZA 3H3ZA 1IN7A 5D5VB 1L3LA 2IRFG 2TDXA 5F6FA 3HHGA 4AVPA 1R23A 1S8NA 2KIFA 2XAGA 1B6AA 1FC3A 4L9TA 2HS5A 2PBIA 1XSXA 3FMRA 3Q5FA 5CVVA 3T0YA 2PJPA 3EYIA 5EEHA 1HKSA 1KGSA 1UFMA 4E70A 2HOEA 2Q0OA 1BI0A 2HKOA 2XKOA 3QPHA 4OIQF 2RN7A 5BPDA 3JTHA 3I53A 1Z7UA 2CQKA 2L02A 2LF8A 3W6JB 4RB2C 5ICEA 1QPMA 2PFBA 2FBIA 3KZZA 3E3VA 5CVUA 3LA2A 2VC1A 3ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TV7 A;  4L5I A;  5TJJ A;  3F3X A;  1IW7 F;  3SXY A;  1YFH A;  1HST A;  4UV8 A;  3FWE A;  4MHG A;  1F5T A;  3CUO A;  1HW5 A;  1UCR A;  1YG2 A;  3QPT A;  1FWZ A;  1HXD A;  4LLG F;  1FSE A;  2EB7 A;  3RPU A;  4CXF A;  2B0L A;  2O0Y A;  4HDV A;  3NQO A;  4BYY A;  4UUV A;  1YS7 A;  3FMQ A;  4HX4 A;  2FA5 A;  2K7L A;  4ESF A;  5HLH A;  3K1P A;  5K5R A;  4P55 A;  3DV8 A;  1U78 A;  1ZG5 A;  4MQ9 F;  5E8G A;  2JPB A;  3LQQ A;  1K6O A;  1YYV A;  4HX7 A;  4P9F A;  2ACJ A;  3WTW C;  3WGG A;  3ZMT A;  1S7O A;  1XN7 A;  3BZ6 A;  3KP5 A;  5E1Z B;  5BS6 A;  3U1D A;  4UVC A;  3O3K A;  2KRF A;  4EM0 B;  2YX4 A;  5E1X A;  1R22 A;  2VBZ A;  4HV6 A;  1QGP A;  5ICG A;  2FNP A;  3GYH X;  3MQ0 A;  4LLL A;  3R4K A;  4BH9 A;  2EV6 A;  2FSW A;  2HTJ A;  4LK0 F;  5HOO A;  4BAY A;  5ICC A;  4Y15 A;  2K27 A;  1XDS A;  4UNO A;  3WTZ A;  3QP5 A;  2P4W A;  1AWC A;  4OIR F;  2X4H A;  4Z2Y A;  3RI4 A;  4NHJ A;  1LDD A;  2FF4 A;  4BHC A;  2OZU A;  2R7F A;  3P9I A;  4JBA A;  1R36 A;  1P6R A;  5E17 F;  3FXU A;  3V8J A;  4EJV A;  2HEO A;  2IP2 A;  5JR3 A;  5FB2 A;  3IRR A;  2STT A;  2K86 A;  2C6Y A;  3R6S A;  1YQA A;  5D8L B;  1J0R A;  2PG4 A;  3KFW X;  1L0O C;  2DPU A;  5LGN A;  2A69 F;  3JW4 A;  2VE8 A;  2PMH A;  4KIG A;  3T1B A;  2VBX A;  2VC0 A;  4I7H A;  2G9W A;  1B1B A;  4BHP A;  3MFK A;  2XUB A;  4OIP F;  4Q47 A;  1KQ9 A;  4A0Z A;  1ZYR F;  5L3F A;  1TQM A;  2VON A;  4WXD A;  4MQV A;  4U88 A;  3ABU A;  3HOT A;  4I98 B;  4Q4Z F;  4XRF A;  3WTX C;  3REO A;  2CYY A;  3JTG A;  4B09 A;  3GEZ A;  2FXA A;  4A12 A;  2MLG A;  2ESH A;  4L5J A;  1SMY F;  2CGP A;  2V6C A;  1ZG3 A;  3G73 A;  1HKQ A;  4LMY A;  4U7D A;  3MCZ A;  5FD6 A;  4DQ2 A;  3F8F A;  2EFO A;  2DLL A;  1XGS A;  3IWZ A;  2AS5 F;  3HTU A;  4HV5 A;  2FML A;  4BXU A;  3TKY A;  4HF0 A;  2V1X A;  1QBJ A;  2M1B A;  2IVM A;  1HSJ A;  2A07 F;  1EH8 A;  1O7L A;  2VBY A;  1JGS A;  3MAJ A;  2V1U A;  1W7P A;  3ZMV A;  4WK8 F;  2P6S A;  2X0L A;  1MD0 A;  1IN8 A;  1SMT A;  3HIF A;  4MEY F;  4IHS A;  1USS A;  5DEQ A;  2IT0 A;  1XSV A;  3I64 A;  3DKW A;  4OMY A;  2LKP A;  3JSP A;  2LDU A;  3K69 A;  1R00 A;  2A68 F;  4ESJ A;  2M30 A;  2RC4 A;  2J5P A;  1GVJ A;  4FX4 A;  2L4M A;  4ZYD A;  3E6C C;  1WSU A;  1R5H A;  1E17 A;  1BI1 A;  3ERE D;  3BPV A;  1RIO H;  3ZMU A;  3GFI A;  1ZRE A;  4XLP F;  4PCQ A;  2R3S A;  2DO7 A;  1WKM A;  3J80 Z;  1TW2 A;  2QWW A;  4KT5 C;  4IRG A;  4HF1 A;  2XAS A;  5BOX A;  1IUY A;  1I1G A;  1SFU A;  2DU9 A;  2A6H F;  4G6Q A;  5LHG A;  2XRO A;  2W57 A;  4RB1 A;  4GYI A;  4EM2 A;  4G8X A;  2MC3 A;  1YW9 A;  2QZ8 A;  3GF2 A;  1EH7 A;  3BY6 A;  4NQW A;  3HYI A;  4MTE A;  2OZ6 A;  1G3Y A;  1IZ1 A;  1J5Y A;  1IF1 A;  1R1U A;  4LB5 A;  4KIF A;  1GXQ A;  3KP6 A;  3COA C;  1ZGJ A;  1HQC A;  4BHB A;  2XAJ A;  4AIH A;  2HFH A;  1HBX G;  1MDM A;  1RUN A;  3TO9 A;  3P9C A;  1U5T A;  1K79 A;  1V4R A;  2EFN A;  2OU2 A;  5DDG A;  3PQK A;  1I1S A;  2BYV E;  2L01 A;  2PLY A;  4U0V A;  4IRI A;  1GXP A;  1I5Z A;  2BE5 F;  2GXB A;  3CJN A;  2D45 A;  2UZK A;  4KN7 X;  4RGU A;  1BBY A;  3ZQ7 A;  5F1R A;  1Z91 A;  5L3D A;  2PEX A;  3KE2 A;  3RYR A;  3QU6 A;  3FXQ A;  1W7P B;  2O8X A;  2QQ9 A;  2FRH A;  4ZYH A;  3N4M A;  1H9G A;  5LEK A;  5ICF A;  3QRF F;  4IVN A;  2LF7 A;  1B59 A;  4RGX A;  5J8F A;  2EV5 A;  1MJB A;  5D4S A;  4EV0 A;  1BC7 C;  4MGR A;  4KDP A;  1OKR A;  1P2F A;  2EA4 A;  3SZT A;  2IJL A;  3KLO A;  4HLX A;  2VBW A;  3RKY A;  4M9Z A;  3H3U A;  2RV8 A;  1TTY A;  1Z9C A;  4ESB A;  4RS8 A;  3ROU A;  1ZRF A;  3K9T A;  4GXO A;  2Z33 A;  4CDG A;  2NNY A;  2IA0 A;  1G6N A;  3I54 A;  3ISP A;  2XHK A;  2DK8 A;  1FSH A;  2LNB A;  3WU1 B;  4ZZD A;  3L00 A;  1SFX A;  2H6C A;  5JFR A;  4WCG A;  3PQJ A;  2K4B A;  2YX7 A;  5LHH A;  1D8J A;  2RDP A;  4PGG A;  2VT2 A;  2XKP A;  3RJP A;  3V8L A;  1O3S A;  3LST A;  1XCB A;  4CHU A;  2BV6 A;  2HR3 A;  3HTS B;  1R7J A;  1B4A A;  3TOB A;  1K78 A;  1YS6 A;  1SFE A;  3BOQ A;  4IRH A;  1T2K A;  4N9H A;  1J9I A;  3I0T A;  4RGS A;  4CYD A;  2ESN A;  4ASN A;  4B8X A;  1U5T B;  2A6E F;  3GVA A;  1IN6 A;  4L9N A;  1LDK B;  1V3F A;  2ADU A;  4CZZ A;  2YSR A;  1BN5 A;  2OD5 A;  1OYW A;  1FY7 A;  2Z5U A;  3L2C A;  5AIP A;  2E7W A;  3D0S A;  3K1N A;  4YFK F;  3JAM Z;  3LA3 A;  3I71 A;  4ZH4 F;  2H94 A;  3GWZ A;  6PAX A;  2O6G E;  4LG0 B;  3KP7 A;  2O61 A;  1XGN A;  2NS0 A;  4I02 A;  2QQB A;  3F8M A;  3WGH A;  3C18 A;  3WOD F;  1CF7 B;  2Q8K A;  2XAF A;  3U9G A;  5L3G A;  4U7B A;  2E7X A;  3QAH A;  3BDD A;  1B9N A;  1ZH5 A;  3ECH A;  3KP3 A;  3E5Q A;  2H27 A;  2GXG A;  4KIC A;  1MJA A;  3E6D A;  1ON1 A;  2ZME A;  1A04 A;  4IHT A;  4LJZ F;  2ZCW A;  1XSD A;  3V4G A;  2RGV A;  2FNA A;  4LGW A;  4L0Z B;  4CIC A;  2W24 A;  3TDU C;  3ULQ B;  4K2E A;  3RDI A;  2CSO A;  5HS7 A;  3KEQ A;  5K5Q A;  3V8K A;  1KQ0 A;  4FX0 A;  3R61 A;  3ZPL A;  3J81 K;  4QLC U;  3IWF A;  1YW7 A;  2ZNZ A;  1P4A A;  2HQR A;  4LD5 A;  1FBQ A;  4EMS A;  3WTT C;  1YTY A;  5D5X B;  1BJA A;  3GX4 X;  2RNJ A;  2HQN A;  4EVI A;  1YW8 A;  2M87 A;  2RVC A;  1HW2 A;  2FOK A;  1HKT A;  5CVI A;  2D2W A;  1P92 A;  1ZLK A;  3SHF A;  3ZMZ A;  2CO5 A;  5LGT A;  3HRU A;  3WE2 A;  2L54 A;  4IJA A;  4HYE A;  3JAM K;  3IHU A;  4ENK A;  3DXJ F;  4G6D A;  4HBL A;  4M9X A;  5CVR A;  3HRM A;  1TQI A;  3EUH A;  4PZJ A;  3IC7 A;  5D6F A;  1RUO A;  1XGO A;  2BEO A;  4GO1 A;  4I01 A;  3NRV A;  4HAM A;  4M6Y A;  5DUK A;  5DD4 A;  3R60 A;  1G3W A;  4YFX F;  2NNN A;  1FZP B;  5H20 A;  1AOY A;  1O3Q A;  5DCM B;  3GFJ A;  1TQP A;  4D0P A;  2OQG A;  3RTR A;  2FEZ A;  2WC2 A;  5IT3 A;  1DP7 P;  2ZJ2 A;  1YO5 C;  1XDU A;  1W5S A;  2HYG D;  1PP7 U;  1J7K A;  1LJ9 A;  4LG0 A;  3U2R A;  2HGC A;  4G7H F;  2HZT A;  2KIU A;  5ILS A;  2QEN A;  2QUF A;  3BJA A;  4N0B A;  2BBY A;  5ERI A;  1IN5 A;  2DPD A;  2HWV A;  2XAH A;  3CUQ B;  4M73 A;  3E97 A;  5FGM A;  3WGI A;  1PP8 F;  3C7J A;  5JVT A;  4HF2 A;  1BM9 A;  3DPL C;  1ZN2 A;  2DT5 A;  2ZME B;  3Q9V A;  3IKV A;  3I59 B;  4EJO A;  5LHI A;  4ZYG A;  2ISY A;  2NYX A;  3SZP A;  1KU2 A;  3KET A;  1I6X A;  5K5O A;  2XAQ A;  5L3B A;  3EET A;  3MEX A;  1U2W A;  4LFU A;  1KA8 A;  2XIG A;  3P9K A;  5CJ9 A;  5D8K B;  4UV9 A;  2QBY A;  4GGG A;  4GYG A;  4AIK A;  1UB9 A;  4HQM A;  2DFI A;  5HS8 A;  2CFX A;  1O57 A;  1S7A A;  4KUM A;  4WF2 A;  4M6X A;  2KIM A;  4OIN F;  1Z6T A;  2HYF A;  1IXC A;  5ILU A;  1NHA A;  2MBF A;  5E20 A;  4MTD A;  1ZLJ A;  5E8I A;  1ODD A;  3WG9 A;  2ZKZ A;  3G3Z A;  4P96 A;  5L3E A;  2DAO A;  3EQL F;  5ILV A;  1FOK A;  2WTE A;  3L9F A;  2M5W A;  5JI6 A;  2MH2 A;  1EH6 A;  2K4J A;  2V9V A;  2WWY A;  2KJC A;  4EGY A;  4G7Z F;  4ENM A;  1WRJ A;  2ZBK A;  5KVR A;  2E1C A;  1ULY A;  2NAZ A;  3LAP A;  4IXA A;  2JSC A;  2MA3 A;  4R8H A;  1KU9 A;  3FHZ A;  3RKX A;  3H92 A;  2F5E A;  2P6T A;  1XGM A;  3L09 A;  1LVA A;  1IN4 A;  1ONV A;  3LA7 A;  3VOD A;  1W7P D;  3CLO A;  2QM3 A;  1REP C;  4H0E A;  3KEO A;  2COM A;  3LAJ A;  1UHW A;  2P5V A;  1KYW A;  1O3R A;  5HDN A;  3BP8 A;  4RAY A;  1IRG A;  3VOE A;  2ELH A;  2E1N A;  2M45 A;  2Z9O A;  2FBH A;  2YU3 A;  3NEU A;  4L9V A;  4UXN A;  4DNC A;  4KNY A;  1MDM B;  2DK5 A;  3F72 A;  2L4A A;  2FBK A;  4I0A A;  1KU3 A;  1XB4 A;  2OAZ A;  2W84 A;  4XBF A;  2FMY A;  4S04 A;  2KJB A;  1FYL A;  5D5W B;  5DCF A;  3RPQ A;  4A5M A;  2EFW A;  3ZP5 A;  1FBS A;  1TNS A;  2PMU A;  1O7F A;  2F5F A;  3R0A A;  5AIQ A;  3M8E A;  3M7G A;  5A2Q K;  4IF4 A;  2FE3 A;  3C1D A;  4WXH A;  5LGU A;  2GQQ A;  4BNC A;  1U8R A;  3Q9S A;  4O5V A;  2IW5 A;  2GIV A;  4YIF A;  3GXO A;  3F22 A;  4I0B A;  3ZMD A;  4ZYE A;  2XRN A;  2JRT A;  3VEP A;  4HLY A;  5E18 F;  4L9J A;  2Y75 A;  3J7A O;  3V7S A;  3C3W A;  3J81 Z;  4G7O F;  3E6M A;  5HLG A;  1BOA A;  1F1Z A;  1TW3 A;  1XMA A;  1K78 B;  4AIJ A;  1WI9 A;  4HW0 A;  1LEA A;  3N97 A;  5FFX A;  4HX8 A;  1D5V A;  5E1W A;  4EJU A;  5HDK A;  3F8B A;  3QOP A;  1FBU A;  5TRD A;  2GA2 A;  1OR7 A;  3ABT A;  4EQQ A;  1S6L A;  2GZW A;  3FM5 A;  2HKX A;  1T6S A;  4P5O A;  2EWN A;  1IXR C;  1JHF A;  3RIR A;  2RKH A;  4I09 A;  1FLI A;  1F9N A;  2OBP A;  5F64 A;  2JPC A;  3HOS A;  1YIO A;  3E5U A;  3KP2 A;  4AD9 A;  1BC8 C;  1KQ8 A;  1FX7 A;  4KA4 A;  3HHH A;  1XD7 A;  2QLZ A;  2MLK A;  3F23 A;  2LSO A;  4A0X A;  1SD5 A;  2WV0 A;  3WE3 A;  2W85 A;  1ZAO A;  1P4X A;  2MD5 A;  2DTR A;  5J6X A;  3P7N A;  1ZAR A;  2O3F A;  1J59 A;  1EV7 A;  1IXS B;  1MZB A;  5D6E A;  3WTU C;  1ZRC A;  3R0J A;  3ECO A;  4EJT A;  5LRS A;  5FFZ A;  5HVQ C;  2CG4 A;  4EM1 A;  3TGN A;  3M1E A;  1IAW A;  4L0Y B;  1TLH B;  2EA2 A;  4A6E A;  2F5C A;  3SQN A;  1WQ2 A;  2VE9 A;  1Z6R A;  4FT8 A;  1O3T A;  2A61 A;  2EJR A;  1DDN A;  3MZH A;  2YR2 A;  2D1V A;  5DV5 A;  1MGT A;  3E5X A;  4KYW A;  2XGX A;  1S29 A;  2VXZ A;  5A2Q Z;  1U6G A;  2QYO A;  2PQ8 A;  2PN6 A;  2D1H A;  3IL2 A;  1SAX A;  1G4D A;  1LB2 A;  2UXX A;  2OA4 A;  1LDJ A;  5K1Y A;  3TOA A;  5LBQ A;  3O6B B;  3SFZ A;  2Z3Y A;  3FF5 A;  3BJO A;  4Q48 A;  4LK1 F;  1RI7 A;  1JE8 A;  1R58 A;  1T38 A;  4RB0 A;  2ZNY A;  1PDN C;  1LNW A;  1BIA A;  2EFQ A;  4QWQ A;  2DQL A;  1MKM A;  1H9T A;  3F21 A;  4YG2 F;  3DFG A;  5FD5 A;  3LWF A;  1W5T A;  2A3S A;  1HW1 A;  1MJ9 A;  5JHU A;  5BPI A;  4ENN A;  3QP6 A;  2M8E A;  4G94 A;  2VN2 A;  1OPC A;  4HQE A;  1ZGA A;  1FYM A;  3HUG A;  3K2Z A;  2FU4 A;  4CGZ A;  2V1D A;  2P5L C;  2QBY B;  1SD7 A;  2QQA A;  3L7W A;  4KN4 X;  3CO7 C;  3AAF A;  1BI3 A;  3GFL A;  2P8T A;  2DI3 A;  5CVJ A;  1J75 A;  1TNT A;  2P5K A;  3DQV C;  1XCV A;  5L3C A;  3O2P E;  2ZFW A;  4AWX B;  2IA2 A;  4U0W A;  3GLX A;  3RYP A;  4G9Y A;  5D4R A;  1WWX A;  3K0L A;  1QQI A;  2H6B A;  2P7C B;  1P4W A;  4KFC A;  2AXL A;  2Z99 A;  3T5X A;  1OMI A;  3GZ5 A;  5EEG A;  1C0W A;  1SD4 A;  2W25 A;  1LQ1 A;  2A5Y B;  3EYY A;  1Q1H A;  4HOB A;  5KK1 A;  2F5D A;  3VFZ A;  3IKT A;  3CUQ C;  3GFM A;  2EV0 A;  3GZ6 A;  1DPU A;  5BQT A;  3JSO A;  1OYI A;  2VOP A;  4N9I A;  4BQA A;  4A0Y A;  4HZF A;  1JXS A;  2VOO A;  4M74 A;  5HLI A;  5H6Q A;  1E2X A;  4CO8 A;  1QZY A;  3FM3 A;  2JTV A;  4UVA A;  1QNT A;  4UVB A;  3W6K B;  2GWR A;  1SD6 A;  5FO5 A;  1W4M A;  3CO6 C;  1G3S A;  2CWE A;  3QU3 A;  3M9A A;  1DPR A;  4L18 B;  2K02 A;  2JT1 A;  3OV8 A;  3F6V A;  1XMK A;  2V79 A;  2STW A;  2VT3 A;  4KIB A;  1STZ A;  3TDZ C;  4PDK A;  3HSF A;  4JQF A;  3KCC A;  1G3T A;  3ELK A;  3CTA A;  2HTS A;  5CYV A;  1X3U A;  2J5O A;  2IA1 A;  2ETH A;  3ZN0 A;  4IPA A;  3I59 A;  2IPQ X;  4LLN A;  2UXN A;  1FP2 A;  3V7C A;  5LRR A;  2EK5 A;  2QVO A;  2GA1 A;  3D5L A;  3B73 A;  4ON0 A;  1FNN A;  3WU0 A;  1K7A A;  2YPR A;  1CF7 A;  1QO0 D;  1FP1 D;  3IRQ A;  1GHC A;  4EGZ A;  1QZZ A;  5LLQ A;  1ZG1 A;  1FYK A;  3KLN A;  3HSE A;  3I4P A;  4LB6 B;  1BIB A;  4EJW A;  3DEU A;  2Y0M A;  3WTY C;  4O6J A;  3GUD A;  2CW0 F;  2KKO A;  4HDU A;  4RAZ A;  2VOD A;  2O03 A;  2Q2E A;  4A6D A;  1D8K A;  1ZHF A;  1DUX C;  3LQR A;  1Z05 A;  4KMF A;  1OYY A;  5DCM A;  1KU7 A;  3LFK A;  3I5U A;  3DF8 A;  5J8C A;  3DPT A;  4NB5 A;  4M71 A;  4Y17 A;  3TO7 A;  5LEJ A;  3K1M A;  2ZO4 A;  5H6R A;  1FT9 A;  1H0M A;  4OIO F;  3BJ6 A;  3ZN1 A;  1UST A;  4MEX F;  2R7D A;  5IT9 Z;  3BPX A;  3MZY A;  4WXC A;  3F8C A;  3V7R A;  4ENJ A;  1ON2 A;  1YLF A;  1I27 A;  4XSX F;  1R5G A;  3KP4 A;  5DUI A;  4I2O A;  1FPQ A;  3TQN A;  5CLS A;  4U0Y A;  4ZZL A;  3GO5 A;  4KMU X;  2F2E A;  3KZY A;  3CUQ A;  4S05 A;  5D5U B;  1UHM A;  2ISZ A;  4ETS A;  3MWM A;  1F4K A;  3E6B A;  5ED4 A;  3I58 A;  4XSZ F;  4OOI A;  4R79 A;  1J2X A;  1PUE E;  2FQ3 A;  5HDG A;  2DBB A;  3M8F A;  4M72 A;  3J80 K;  4PGH A;  3WTS C;  1T98 A;  2L3D A;  1T39 A;  4F7Z A;  2HDC A;  4JK1 X;  4OU0 A;  4M9S A;  3HSR A;  4RB3 C;  2NRA C;  5DYM A;  4YFN F;  3BWG A;  2G7U A;  4XLN F;  1RZ4 A;  1KYZ A;  3PFI A;  5BMZ A;  3ZMS A;  1JHH A;  1CGP A;  4Q5S F;  2P7V B;  3F8N A;  4WWC A;  5FLX Z;  1ZRD A;  1LEB A;  1R1V A;  3FX3 A;  2DQR A;  2ZXJ A;  2XVC A;  2BGC A;  1Z1D A;  2DW4 A;  3T8R A;  2XV4 S;  2JZY A;  4MNU A;  1TBX A;  3FMS A;  2EFP A;  3S2W A;  4P9U A;  4UHT A;  1B9M A;  2G7H A;  5AON A;  2RQP A;  4FHT A;  1VTN C;  4RGR A;  3FZV A;  1D3Y A;  3CDH A;  1IRF A;  1R1T A;  3F6O A;  4A5N A;  1U5T C;  2PI0 A;  4O3M A;  5FLX K;  4Y13 A;  4R1H A;  5HS9 A;  3RKW A;  3TO6 A;  3GW2 A;  1U3E M;  3FXR A;  1BI2 A;  3T8T A;  1S3J A;  4HA8 A;  3WTV C;  2GAU A;  1Y0U A;  3HRS A;  4GCV A;  3OOP A;  3BRO A;  2Y48 A;  1T0F A;  3B02 A;  3VB2 A;  2MH9 A;  1RNL A;  2UWM A;  4WX9 A;  4YII A;  2OQR A;  5DD8 A;  3DP7 A;  3EDP A;  2H09 A;  4A2U A;  3HRT A;  5IT9 K;  4OMZ A;  3H3Z A;  1IN7 A;  5D5V B;  1L3L A;  2IRF G;  2TDX A;  5F6F A;  3HHG A;  4AVP A;  1R23 A;  1S8N A;  2KIF A;  2XAG A;  1B6A A;  1FC3 A;  4L9T A;  2HS5 A;  2PBI A;  1XSX A;  3FMR A;  3Q5F A;  5CVV A;  3T0Y A;  2PJP A;  3EYI A;  5EEH A;  1HKS A;  1KGS A;  1UFM A;  4E70 A;  2HOE A;  2Q0O A;  1BI0 A;  2HKO A;  2XKO A;  3QPH A;  4OIQ F;  2RN7 A;  5BPD A;  3JTH A;  3I53 A;  1Z7U A;  2CQK A;  2L02 A;  2LF8 A;  3W6J B;  4RB2 C;  5ICE A;  1QPM A;  2PFB A;  2FBI A;  3KZZ A;  3E3V A;  5CVU A;  3LA2 A;  2VC1 A;  3ML6 A; 
#chains in the Genus database with same CATH topology
 4TV7 A;  4L5I A;  5B1A H;  2R7X A;  2HVR A;  5TJJ A;  1UMQ A;  3F3X A;  1IW7 F;  3SXY A;  1YFH A;  1HST A;  4PFP A;  1SVM A;  4UV8 A;  1X2M A;  3FWE A;  4MHG A;  3CCU I;  2R5Y A;  1F5T A;  3CUO A;  1HW5 A;  1VQ7 I;  2GLO A;  4ZC3 A;  2KRH A;  3HOU J;  1VFC A;  3OSF A;  1UCR A;  3DTK A;  2JRM A;  1YG2 A;  3ZQQ A;  3QPT A;  3TW6 A;  3OYK A;  1LFP A;  2ZXI A;  1FWZ A;  1HXD A;  4LLG F;  1FSE A;  3X2Q H;  2EB7 A;  3RPU A;  4CXF A;  2WY7 Q;  2B0L A;  1KON A;  1JTY A;  2KDO A;  2O0Y A;  4HDV A;  3LSH A;  3NQO A;  4BYY A;  4UUV A;  3IH4 A;  1YS7 A;  4XRS G;  2AQF A;  3FMQ A;  3M8J A;  4HX4 A;  3L2R A;  1MND A;  2FA5 A;  2K7L A;  3HGY A;  4ESF A;  5HLH A;  2HQ5 A;  2W1O A;  3K1P A;  2R7R A;  5K5R A;  4P55 A;  3DV8 A;  3MN2 A;  1S7E A;  1U78 A;  1ZG5 A;  4GDF A;  2ECC A;  4MQ9 F;  5E8G A;  2JPB A;  3JR9 A;  3LQQ A;  2FJ1 A;  4PJL A;  2E5Z A;  1K6O A;  3L2Q A;  3HOV J;  2DJN A;  2MW8 A;  1YYV A;  2VUM J;  4NC8 A;  3SZG A;  3TBI A;  2V9K A;  4HX7 A;  4P9F A;  2ACJ A;  3WTW C;  3GTK J;  3MKZ A;  3WGG A;  3J7Z I;  2WAE A;  2A05 A;  2O7O A;  4QTR A;  3ZMT A;  1S7O A;  1XN7 A;  3FXO A;  4F92 B;  4BAC A;  1FEX A;  3BZ6 A;  2RNG A;  3KP5 A;  5E1Z B;  5BS6 A;  3U1D A;  4UVC A;  5GP9 A;  3O3K A;  2KRF A;  4NNJ A;  1IDZ A;  4ZYA A;  4EM0 B;  2M0M A;  2YX4 A;  2DFH A;  2IGO A;  5E1X A;  4YEL A;  1JUP A;  1R22 A;  2VBZ A;  4HV6 A;  5F08 A;  4ZDO A;  2WAQ N;  1QGP A;  5ICG A;  2FNP A;  5GAE J;  3GYH X;  3MQ0 A;  1X1P A;  1LFU P;  4LLL A;  2HOT A;  3R4K A;  1ERD A;  4BH9 A;  4XID A;  1SEU A;  4UUS B;  5M3F J;  1MMD A;  2VAS A;  3CQZ J;  3BG5 A;  2EV6 A;  2E60 A;  2W82 A;  2FSW A;  2HTJ A;  2NOG A;  1N78 A;  4LK0 F;  2R93 J;  5HOO A;  4BAY A;  4CSW A;  3ZQH A;  5ICC A;  4Y15 A;  2R7T A;  2K27 A;  3GLL A;  1WH5 A;  5M5X J;  1A6I A;  3OYF A;  3C2G A;  1XDS A;  4V2G A;  4UNO A;  3WTZ A;  4QPQ A;  3QP5 A;  3HDD A;  2EQR A;  2P4W A;  4JYK A;  2X1E A;  1AWC A;  2BZT A;  4DW6 A;  3DU6 A;  2LC2 A;  4OIR F;  3AFH A;  1MBE A;  2X4H A;  4Z2Y A;  3RI4 A;  2VKV A;  4NHJ A;  1ZKG A;  1LDD A;  1BA5 A;  2XF6 A;  2FF4 A;  4BHC A;  3CF5 F;  4XOR A;  4HST A;  3SFI A;  2OZU A;  3DTI A;  3I9V 2;  1Z0X A;  2BY1 A;  2R7F A;  1QHH D;  1ETX A;  3P9I A;  2R5Z A;  1RC9 A;  4JBA A;  3A02 A;  1R36 A;  1P6R A;  5E17 F;  3FXU A;  3V8J A;  4EJV A;  1GDT A;  2IP2 A;  2HEO A;  5JR3 A;  5FB2 A;  3S8P A;  1YOV B;  3S32 A;  2HXI A;  4IHW A;  5JLX A;  3LSJ A;  3IRR A;  3ZRG A;  2STT A;  2K86 A;  2X1C A;  1B72 A;  2BY3 A;  4JX5 A;  2JVH A;  4XM3 A;  3F9K A;  2C6Y A;  3R6S A;  1YQA A;  5D8L B;  1UEL B;  1A31 A;  1J0R A;  1TWC J;  2M4K A;  2PG4 A;  3CCJ I;  2XGC A;  3KFW X;  3LSI A;  3IH3 A;  1QU3 A;  2R7Z J;  1GUU A;  4PJM A;  1L0O C;  2MYS A;  2JA5 J;  2F6C A;  1VQ5 I;  2NXN B;  1WJE A;  4J00 A;  2DPU A;  4BEH A;  5KNL A;  5LGN A;  2XRL A;  5KAI C;  2A69 F;  3JW4 A;  4XRM A;  3HPG A;  4IO9 F;  2K3P A;  1MH3 A;  2VE8 A;  2PMH A;  4KIG A;  3H9J A;  3T1B A;  1YX5 A;  2QGU A;  2VBX A;  2VC0 A;  4I7H A;  2K3F A;  5F27 A;  1T95 A;  2LD5 A;  2G9W A;  1B1B A;  4BHP A;  2HXO A;  4JOM A;  3U21 A;  4IHY A;  3MFK A;  2XUB A;  2W00 A;  4OIP F;  2L7K A;  4Q47 A;  1KQ9 A;  4A0Z A;  1YJ9 I;  1ZYR F;  3MKY B;  2V7F A;  3DKX A;  4UB6 C;  5L3F A;  1TQM A;  2VON A;  4WXD A;  3M1C A;  4BQN A;  4CCO A;  1NTC A;  4MQV A;  3H9Q A;  4U88 A;  3CJQ B;  1FMW A;  1BOB A;  5IYD J;  1QVU A;  3HG9 A;  3OYB A;  3FHN A;  1W0U A;  4Y7N J;  3LL7 A;  3BLY A;  4I76 A;  5FKN A;  1IV6 A;  3ABU A;  3B6C A;  3HOT A;  5KHD A;  4BBR J;  4E7Z A;  4I98 B;  4Q4Z F;  4XRF A;  3WTX C;  3REO A;  2LH9 A;  1ETW A;  2CYY A;  3JTG A;  2LY9 A;  4CCM A;  1B8I A;  2HOS A;  4B09 A;  3GEZ A;  1E3H A;  2FXA A;  4A12 A;  4F91 B;  2MLG A;  2V4J C;  4M3B A;  4DYC A;  1PUF B;  4QPO A;  2LVS A;  2ESH A;  4XN0 A;  2HZD A;  4L5J A;  1SMY F;  2CGP A;  2V6C A;  1GVD A;  4BUP A;  4E7S A;  4L5E A;  5C4J J;  5IPA A;  4J01 A;  1ZG3 A;  1SFO J;  1NG7 A;  3G73 A;  1HKQ A;  5FLM J;  4LMY A;  4AC0 A;  4U7D A;  3MCZ A;  2K9L A;  3EUA A;  5FD6 A;  3CMM A;  4DQ2 A;  3F8F A;  3AKZ A;  1A5J A;  3S93 A;  2EFO A;  3ZXS A;  1MBG A;  2DLL A;  2BY2 A;  1XGS A;  3IWZ A;  3H5R A;  1BR1 A;  1X2N A;  2N8G A;  2AS5 F;  3HM5 A;  4X1E A;  3ZCO A;  3HTU A;  3JRD A;  4HV5 A;  2FML A;  4BXU A;  3TKY A;  4HF0 A;  2DOF A;  2V1X A;  1QBJ A;  2M1B A;  2IVM A;  3MKL A;  4G6T B;  4XLH A;  1HSJ A;  3UR3 C;  2A07 F;  2NVX J;  1EH8 A;  1RR7 A;  4XR6 A;  3GTJ J;  1O7L A;  1YIT I;  2VBY A;  1JGS A;  1Z3X A;  2ZFU A;  3ABM H;  1W7P A;  3MAJ A;  3ONQ A;  3ZMV A;  2V1U A;  2QKM B;  4WK8 F;  5BNG A;  2O9L A;  3QWL A;  2P6S A;  2X0L A;  2DN0 A;  4IOA F;  1MD0 A;  2EIL H;  1IN8 A;  5J47 A;  1SMT A;  3FIW A;  3HIF A;  1N75 A;  4MEY F;  4IHS A;  1OCP A;  1USS A;  2KL4 A;  4Y3O A;  5DEQ A;  2IT0 A;  1XSV A;  2DJI A;  3I64 A;  1W36 C;  3DKW A;  1D5Y A;  4OMY A;  1TZL A;  3CJT B;  3DEE A;  2LKP A;  3JSP A;  3BG7 A;  1ETK A;  1JT6 A;  2LDU A;  4N4N B;  1A35 A;  4KIS A;  3I4N J;  3W6V A;  2PJR A;  1MIJ A;  2M7B A;  3K69 A;  1R00 A;  2A68 F;  1YJN I;  2Y31 A;  1WZ2 A;  1D0Y A;  4ESJ A;  2M30 A;  2RC4 A;  2J5P A;  1GVJ A;  3K10 A;  3NWT A;  4H4K C;  2Y0S N;  2DMT A;  4FX4 A;  2L4M A;  4ZYD A;  3E6C C;  1WSU A;  1R4M B;  4BU2 A;  3CMA I;  1R5H A;  1XS9 A;  5B5E C;  3G1M A;  1V5G A;  3CES A;  3OY9 A;  1WJA A;  1E17 A;  1BI1 A;  3ERE D;  1I3Q J;  3BPV A;  1RIO H;  2VQC A;  3ZMU A;  5GTI C;  5F04 A;  3GFI A;  1NK3 P;  1ZRE A;  4XLP F;  1X3Z B;  4PCQ A;  2R3S A;  5C3E J;  2DO7 A;  1WKM A;  3J80 Z;  2YU9 J;  5J40 A;  1FOX A;  1TW2 A;  1XMX A;  2QWW A;  4KT5 C;  2AXT C;  4IRG A;  5EYR A;  4HF1 A;  4D9J A;  3VYU B;  2LFB A;  4RAF A;  2XAS A;  5BOX A;  2M7A A;  5IY5 H;  1IUY A;  1I1G A;  4E7K A;  1SFU A;  2DU9 A;  2A6H F;  4G6Q A;  5LHG A;  2XRO A;  4BDZ A;  2W57 A;  2E2H J;  2WAQ A;  2I8D A;  2FUG 2;  4RB1 A;  2LBF A;  4GYI A;  4EM2 A;  2RRE A;  4G8X A;  3M07 A;  2CV1 A;  2MC3 A;  1YW9 A;  2QZ8 A;  4OAZ A;  4DZP A;  5B3S H;  2JUG A;  1BW5 A;  1DU0 A;  3B6A A;  3GF2 A;  1EH7 A;  3BY6 A;  4NQW A;  3HYI A;  4B3A A;  2NVQ J;  4MTE A;  2OZ6 A;  1G3Y A;  1IZ1 A;  1J5Y A;  1IF1 A;  1R1U A;  4LB5 A;  4KIF A;  1GXQ A;  3KP6 A;  1V5F A;  3COA C;  1ZGJ A;  1HQC A;  1LKX A;  2XB5 A;  3BG3 A;  3JRA A;  2HOA A;  4BHB A;  5FKL A;  2XAJ A;  4AIH A;  4BXF A;  2BY0 A;  2XC7 A;  3BTL A;  1W0T A;  1DU6 A;  1DP3 A;  1W36 D;  2R5Y B;  2Q1Z B;  2WY8 Q;  1ZR2 A;  4HEA 2;  4DBR A;  1YJW I;  2HFH A;  2KZV A;  3BZK A;  3PNY A;  3HZJ A;  3WG7 H;  1HBX G;  1MDM A;  2DA3 A;  2Y69 H;  2KRC A;  2DCE A;  1RUN A;  3TO9 A;  2DT7 B;  4EEF G;  4BQO A;  1WCM J;  3P9C A;  1P7J A;  1U5T A;  1K79 A;  2ZXW H;  1V4R A;  2EFN A;  2OU2 A;  3UKG A;  1K83 J;  1X1C A;  3H1C A;  5DDG A;  3PQK A;  5EJC A;  1I1S A;  1OCC H;  2BYV E;  2L01 A;  2PLY A;  2BVM A;  2KMU A;  4U0V A;  1UHS A;  4IRI A;  1GXP A;  1I5Z A;  2BE5 F;  2GXB A;  2KZG A;  3PNV A;  4ZTF A;  1QZE A;  3S16 J;  5EG0 B;  1GT0 C;  3CJN A;  3EUH C;  4QSH A;  3K70 C;  1P9Q C;  4G12 A;  2D45 A;  4LG3 A;  3H5A A;  2E1M C;  3QOE A;  1WJF A;  2UZK A;  4ITV A;  4KN7 X;  4RGU A;  3K4B A;  1BBY A;  3H9G A;  1ZR4 A;  3ZQ7 A;  2NS7 A;  1Z91 A;  5F1R A;  5L3D A;  9ANT A;  2PEX A;  1XG1 A;  5IP9 J;  2XGD A;  4CZC A;  3KE2 A;  2HU9 A;  3RYR A;  1FIA A;  3QU6 A;  2IS6 A;  3FXQ A;  1W7P B;  5EZH A;  2O8X A;  2AQE A;  2QQ9 A;  2FRH A;  2HI3 A;  3S17 J;  3HOX J;  4M6V A;  1SAN A;  4ZYH A;  3N4M A;  4BY1 J;  1H9G A;  5LEK A;  5ICF A;  2CFO A;  4AID A;  3QRF F;  4IVN A;  4XOP A;  2ZJR F;  2LF7 A;  1B59 A;  4RGX A;  2CUF A;  1JKO C;  5J8F A;  2EV5 A;  1MJB A;  5D4S A;  4EV0 A;  3S2D J;  3OL3 A;  1D1B A;  3CZ6 A;  1BC7 C;  4MGR A;  4KDP A;  1OKR A;  1P2F A;  2EZI A;  2EA4 A;  3SZT A;  2IJL A;  1G2H A;  3KLO A;  4HLX A;  5GPA A;  5EEA A;  2VBW A;  3RKY A;  5EDN A;  4M9Z A;  3CC2 I;  2IGM A;  3H3U A;  2RV8 A;  3H36 A;  1TTY A;  2XPW A;  1Z9C A;  1ENH A;  5FKM A;  4ESB A;  3TP3 A;  4RS8 A;  3ROU A;  1VQP I;  1ZRF A;  3K9T A;  3ASN H;  4GXO A;  2Z33 A;  4CDG A;  2NNY A;  3RQ4 A;  2IA0 A;  1G6N A;  2LY1 A;  3RZD J;  2X51 A;  2MG4 A;  3I54 A;  3ISP A;  1ETV A;  3IV5 A;  4CCK A;  4A3G J;  2XHK A;  2DK8 A;  2R7S A;  1FSH A;  1IGN A;  1RRJ A;  2LNB A;  5K7F A;  3WU1 B;  1UAA A;  4ZZD A;  3L00 A;  1SFX A;  2DA7 A;  4DYR A;  2E5N A;  1W1W E;  3VYR B;  2H6C A;  2LTP A;  2LP0 A;  2Y9Y A;  1POG A;  3Q0W A;  5JFR A;  4WCG A;  3G4S I;  2E35 A;  3PQJ A;  2LK2 A;  2AO9 A;  2K4B A;  2YX7 A;  5LHH A;  1D8J A;  4D5C A;  2VXD A;  2RDP A;  2WAF A;  4PGG A;  1B8I B;  1VQ8 I;  1HA8 A;  2VT2 A;  1K4T A;  1V5E A;  4XIC A;  3ZQC A;  1HDD C;  2XKP A;  3RJP A;  2B7E A;  1BJZ A;  2CQ7 A;  3V8L A;  1O3S A;  1R49 A;  1HOM A;  4W1U A;  3I3L A;  4GRI A;  3LST A;  5E3M A;  1MMS A;  1XCB A;  3HKZ A;  1TL8 A;  4CHU A;  1IDY A;  2BV6 A;  4C2M J;  2DT6 A;  2HVS A;  1LUJ B;  2HR3 A;  1WVR A;  4XL9 A;  3HTS B;  1R7J A;  1HF0 A;  1B4A A;  1SVO A;  3A2K A;  4PJJ A;  3TOB A;  1YS6 A;  2DOA A;  1K78 A;  1SFE A;  3BOQ A;  5DM7 F;  4BEH B;  4IHX A;  1QPI A;  4IRH A;  1T2K A;  2VLA A;  1CQT A;  4N9H A;  4BDY A;  1J9I A;  1ETY A;  1OCO H;  3I0T A;  3BR2 A;  4RGS A;  4XLF A;  4HRI A;  1EJ9 A;  3G1L A;  2LLK A;  3KEY A;  4CYD A;  2ESN A;  4UUS A;  4FTH A;  2NVU B;  4ASN A;  2EZH A;  4B8X A;  1MBK A;  1U5T B;  2A6E F;  3GVA A;  1IN6 A;  4L9N A;  2QCO A;  1LDK B;  1V3F A;  2ADU A;  4CZZ A;  5FLV A;  2YSR A;  1BN5 A;  2E1M B;  3IAM 2;  2OD5 A;  3OYL A;  1OYW A;  1FY7 A;  2Z5U A;  3L2C A;  5AIP A;  4PUS A;  2E7W A;  2DDA A;  4A3D J;  3D0S A;  3PSI A;  2ECB A;  3K1N A;  2R7U A;  4YFK F;  5DS9 A;  3JAM Z;  3BC8 A;  2BOL A;  3LA3 A;  2KFD A;  3JRI A;  3I71 A;  4ZH4 F;  2H94 A;  2XGE A;  3GTO J;  3GWZ A;  6PAX A;  2O6G E;  4LG0 B;  3KP7 A;  3S3M A;  2O61 A;  1XGN A;  2H8W A;  2NS0 A;  3S15 J;  3H0D A;  4I02 A;  2R5Z B;  1TWA J;  1XTA A;  4AUX A;  4E4H A;  2QQB A;  3F8M A;  3WGH A;  3C18 A;  3WOD F;  1T8I A;  1OIS A;  1CF7 B;  2Q8K A;  2XAF A;  3U9G A;  2DA6 A;  5L3G A;  4U7B A;  2E7X A;  1U9O A;  3QAH A;  3BDD A;  2YUS A;  3LSM A;  1B9N A;  2MGQ A;  1ZH5 A;  3ECH A;  2ZJP F;  2EIJ H;  2E19 A;  1RKW A;  3KP3 A;  3FK6 A;  3E5Q A;  3F0C A;  3S1R J;  2H27 A;  2GXG A;  4BE2 A;  4KIC A;  1MJA A;  3E6D A;  1ON1 A;  5K7Z A;  2F48 A;  2ZME A;  4PJ0 C;  1LE8 B;  3M4O J;  2DYS H;  4D1Q A;  1A04 A;  2L5Q A;  4IHT A;  1EKE A;  1Z21 A;  4LJZ F;  1X4O A;  2ZCW A;  3A03 A;  1XSD A;  3V4G A;  2RGV A;  2OUM A;  2FNA A;  3BTI A;  4LGW A;  2F4I A;  2LR8 A;  5CQG A;  2Q2E B;  4L0Z B;  4CIC A;  1MBH A;  3TW7 A;  1OCR H;  2W24 A;  3TDU C;  3ULQ B;  2LRD A;  4EAT A;  4K2E A;  3RDI A;  2CSO A;  1FTZ A;  5HS7 A;  3KEQ A;  2OPT A;  5K5Q A;  2OCC H;  2M4G A;  2QF7 A;  3V8K A;  1KQ0 A;  4FX0 A;  3R61 A;  2ZSI B;  1R9T J;  2FX0 A;  3ZPL A;  5FRO A;  4QLC U;  3V42 A;  3J81 K;  3IWF A;  1YW7 A;  3AG2 H;  2ZNZ A;  2D5V A;  2ZB9 A;  5IYC J;  2LOO A;  2AHQ A;  3OYI A;  1P4A A;  2HQR A;  4LD5 A;  1FBQ A;  4EMS A;  5HNF A;  3WTT C;  1YTY A;  1LPQ A;  3MZ8 A;  1IO2 A;  5D5X B;  1Z77 A;  4F52 A;  3PIO F;  1BJA A;  3GX4 X;  2RNJ A;  3TMO A;  2HQN A;  1X1B A;  4OAY A;  1YW8 A;  4XKB A;  2RVC A;  2M87 A;  4EVI A;  2NS8 A;  1HW2 A;  4BKX A;  2FOK A;  1HKT A;  5CVI A;  2WB1 N;  2D2W A;  1RET A;  2NOJ B;  2PMZ N;  1P92 A;  3G71 I;  1ZLK A;  3OIO A;  2XPV A;  3SHF A;  3ZMZ A;  2CO5 A;  3OWT A;  5LGT A;  4IX7 A;  1IV8 A;  3HRU A;  1NG6 A;  3WE2 A;  2L54 A;  4IJA A;  4PJN A;  4HYE A;  3JAM K;  2X6O A;  3IHU A;  4ENK A;  3DXJ F;  4C2T A;  1D0X A;  1JTX A;  2X6Y A;  4G6D A;  4HBL A;  4M9X A;  5CVR A;  3WHC A;  5J4V A;  1X3W B;  3HRM A;  1TQI A;  2DYR H;  3JRE A;  3EUH A;  4XRS A;  4PZJ A;  4BS9 A;  3IC7 A;  5D6F A;  1RUO A;  1K61 A;  1UZC A;  1XGO A;  2BEO A;  4GO1 A;  4CA0 A;  5HNH A;  3K70 D;  2JA2 A;  4I01 A;  3NRV A;  2CUJ A;  4HAM A;  4M6Y A;  5DUK A;  5DD4 A;  4IL6 C;  3R60 A;  4RA2 A;  1G3W A;  2QSF X;  3Q0V A;  4YFX F;  2NNN A;  4AYB N;  4CUG A;  1VQM I;  1FZP B;  5H20 A;  1AOY A;  1V54 H;  1O3Q A;  5DCM B;  3GFJ A;  1VND A;  5F0C A;  1TQP A;  4NQW B;  3OSG A;  1X19 A;  4RMN A;  3ZQF A;  2Z16 A;  4D0P A;  4B47 A;  5FKK A;  2OQG A;  3QYF A;  3S2H J;  1AHD P;  3KYC B;  1FMV A;  3RTR A;  2FEZ A;  4KJZ A;  2I5U A;  2WBM A;  2K9S A;  3GTG J;  1Q1V A;  3SYT A;  2WC2 A;  5IT3 A;  3K7A J;  2Y0S A;  3ZQG A;  2ME0 A;  1DP7 P;  2ZJ2 A;  1YO5 C;  4DGW B;  5F1J A;  1XDU A;  4E7H A;  1W5S A;  3CCV I;  3JRG A;  2HYG D;  2KIQ A;  1X58 A;  1PP7 U;  1J7K A;  1LJ9 A;  2A5W A;  4LG0 A;  2M2E A;  3U2R A;  2HGC A;  4G7H F;  1IRZ A;  1WJD A;  4IQ4 A;  2HZT A;  2X85 A;  4JX6 A;  1VQ6 I;  1YRN A;  2CQQ A;  1JUS A;  3JRC A;  1IRX A;  4D7N A;  2KIU A;  5ILS A;  1FIP A;  2QEN A;  2QUF A;  3BJA A;  1OCT C;  1DQU A;  3S1N J;  4N0B A;  5HLT A;  2BBY A;  3HJE A;  5ERI A;  1IN5 A;  4RLQ A;  2HWV A;  2DPD A;  2XAH A;  4BY7 J;  3CUQ B;  3MVP A;  3NAU A;  4FE4 A;  2CMP A;  3E97 A;  4M73 A;  5FGM A;  4A3E J;  3WGI A;  3CJR B;  1PP8 F;  3C7J A;  5JVT A;  5K7H A;  4HF2 A;  5GAH J;  1MH4 A;  1BM9 A;  2L9S A;  3DPL C;  1P7I A;  2B63 J;  3D5R C;  1ZN2 A;  2DT5 A;  2ZME B;  3E0J B;  3Q9V A;  3IKV A;  1LE8 A;  3I59 B;  3DEW A;  4EJO A;  3LSG A;  5LHI A;  2X6W A;  3WHB A;  3OS2 A;  1RKT A;  4ZYG A;  2ISY A;  2NYX A;  1K4S A;  3SZP A;  2O8K A;  2EH3 A;  1KU2 A;  1MNE A;  2BW3 A;  3KET A;  2XF5 A;  1JKR C;  1I6X A;  1XC5 A;  5K5O A;  3G2B A;  1WJ5 A;  2XAQ A;  5L3B A;  2QSG X;  1A36 A;  3EET A;  3MEX A;  4XLC A;  1U2W A;  2DA1 A;  2K9N A;  4LFU A;  2L9R A;  4CYC B;  3KPH A;  4C3I J;  1KA8 A;  2OV7 A;  1PYV A;  2XIG A;  3P9K A;  5CJ9 A;  5D8K B;  2ELJ A;  3BCB A;  4DYQ A;  3BQY A;  4UV9 A;  2QBY A;  4GGG A;  4GYG A;  3E1S A;  2ZME C;  4HQM A;  2DFI A;  1UB9 A;  3FXL A;  4AIK A;  5HS8 A;  2CFX A;  1O57 A;  1R5I D;  1S7A A;  1WPK A;  4KUM A;  4FCY A;  3S1M J;  4WF2 A;  4M6X A;  2KIM A;  2EZK A;  4OIN F;  5IYB J;  1Z6T A;  2HYF A;  1IXC A;  1ETO A;  4BJ5 C;  1FOW A;  2H8R A;  4HNV A;  1NHA A;  2MBF A;  5E20 A;  5ILU A;  4MTD A;  1ZLJ A;  1Y39 A;  2HQA A;  3TP0 A;  5E8I A;  1U8B A;  4ABZ A;  5E3N A;  3GBG A;  4I6Z A;  1ODD A;  3WG9 A;  3U1K A;  1YI2 I;  2ZKZ A;  3G3Z A;  4P96 A;  5L3E A;  2DAO A;  3EQL F;  2FQ4 A;  1I50 J;  3CP2 A;  3FXK A;  4X6A J;  1E3O C;  5ILV A;  1D1C A;  1VQO I;  3I56 I;  4RM3 A;  1FOK A;  2WTE A;  3L9F A;  2M5W A;  5JI6 A;  1LVK A;  1OJL A;  2MH2 A;  5B1B H;  1EH6 A;  2K4J A;  1UJ8 A;  2V9V A;  2WWY A;  2JQ7 A;  1TP4 A;  2RQQ A;  1APL C;  2VJ5 A;  1MMN A;  1HLV A;  2KJC A;  4EGY A;  4G7Z F;  4ENM A;  1WRJ A;  2ZBK A;  5KVR A;  2XSD C;  5IP6 A;  1JKP C;  2E1C A;  1ULY A;  2NAZ A;  3LAP A;  4C3J J;  1VF9 A;  2GXA A;  4IXA A;  3FKJ A;  2TRT A;  2FD5 A;  2QSH X;  3L1P A;  2CH0 A;  2JSC A;  3FK7 A;  3W2W A;  2MA3 A;  1ZQ3 P;  4R8H A;  1KU9 A;  2OJE D;  4UB8 C;  3RKX A;  3FHZ A;  1PUF A;  3S1Q J;  3H92 A;  2R7V A;  2F5E A;  2P6T A;  1XGM A;  3L09 A;  1U9N A;  4IZZ A;  2X6X A;  1LVA A;  1WH7 A;  1IN4 A;  1B72 B;  1ONV A;  3LA7 A;  3VOD A;  2DOD A;  1W7P D;  3CLO A;  1ACI A;  3K4M A;  2QM3 A;  1REP C;  4II3 A;  4H0E A;  4NUB A;  3BT9 A;  3MD2 A;  3KEO A;  5F0F A;  2COM A;  5FJ8 J;  2MFZ A;  3LAJ A;  3BCA A;  5KCM A;  1UHW A;  2P5V A;  1KYW A;  4FE7 A;  1O3R A;  4RLF A;  1RES A;  1E3P A;  5HDN A;  3GTQ J;  4RDU A;  3BP8 A;  4RAY A;  1IRG A;  3VOE A;  3K4J A;  2QEX I;  2ELH A;  2E1N A;  3O8H A;  2M45 A;  2X48 A;  2Z9O A;  2FBH A;  2YU3 A;  3NEU A;  4L9V A;  4UXN A;  4DNC A;  4KNY A;  1MDM B;  2DK5 A;  3F72 A;  2L4A A;  3VSL A;  2FBK A;  4B3X A;  4I0A A;  1OR7 C;  1KU3 A;  1XB4 A;  2OAZ A;  2W84 A;  4CCJ A;  3CC7 I;  4XBF A;  2FMY A;  4S04 A;  5C4X J;  2KJB A;  1FYL A;  5D5W B;  3PO2 J;  1X1D A;  4HNT A;  5DCF A;  3RPQ A;  1Y56 A;  2CU7 A;  2X9D A;  4A5M A;  2XAU A;  2EFW A;  2R4G A;  4A69 C;  2L7M P;  3JRF A;  3ZP5 A;  5TGT A;  1FBS A;  1TNS A;  2ZJQ F;  1D1A A;  2PMU A;  1O7F A;  2W48 A;  3RSN A;  2BVL A;  2F5F A;  3R0A A;  1I3A A;  5AIQ A;  3M8E A;  3M7G A;  5A2Q K;  1HDP A;  2MSY A;  4IF4 A;  1H8A C;  3CF2 A;  5B66 C;  4C3H J;  1WJC A;  2FE3 A;  3C1D A;  4WXH A;  5LGU A;  2R0Q C;  2GQQ A;  3FBI B;  1WHU A;  4IOC F;  4BNC A;  1U8R A;  3Q9S A;  2VQH A;  4O5V A;  2JA6 J;  3CCL I;  2IW5 A;  4XKW A;  1Y1W J;  1QRY A;  3OYH A;  2GIV A;  4A3B J;  4YIF A;  3GXO A;  1RPW A;  1VQ9 I;  3F22 A;  4I0B A;  3ZMD A;  4N4O B;  4HNU A;  4ZYE A;  2COB A;  2XRN A;  4FQG A;  4XOT A;  2JRT A;  1MBF A;  3VEP A;  4HLY A;  2PX9 A;  5E18 F;  4D5F A;  1AKH B;  3G1O A;  4L9J A;  2VQG A;  1W5C C;  3QOD A;  4HPQ A;  1AA7 A;  2Y75 A;  3ZGK A;  3CD6 I;  3J7A O;  4E7J A;  3A1Y A;  3V7S A;  4XLE A;  3H35 A;  3C3W A;  3LSK A;  4LIU A;  3J81 Z;  1YX3 A;  4D7M A;  3CC4 I;  3D1N I;  4G7O F;  3CME I;  4A3F J;  3E6M A;  5HLG A;  3DTE A;  1BOA A;  1F1Z A;  1TW3 A;  1XMA A;  5TIS C;  1K78 B;  2P81 A;  2OCE A;  4AIJ A;  1WI9 A;  4HW0 A;  1LEA A;  3N97 A;  2VB6 A;  2M3A A;  5FFX A;  2EIM H;  4HX8 A;  1D5V A;  5E1W A;  3CCQ I;  4EJU A;  4A3C J;  4A3I J;  5HDK A;  1VQN I;  2Z2S B;  3DWL E;  3F8B A;  3QOP A;  1FBU A;  5TRD A;  3QPL A;  3OL4 A;  2GA2 A;  1OR7 A;  1M1E B;  1MMA A;  4YEJ A;  3ABT A;  3HOY J;  2DOE A;  4EQQ A;  4NC6 A;  1Z67 A;  5M3M J;  1S6L A;  2GZW A;  3AG3 H;  2GOX B;  3MMY B;  2IGK A;  3FM5 A;  2HKX A;  1T6S A;  4P5O A;  3TED A;  2EWN A;  1IXR C;  1GLN A;  3FKI J;  4A3K J;  1JHF A;  3RIR A;  1TWF J;  2RKH A;  2KDZ A;  4I09 A;  1FLI A;  1F9N A;  2OBP A;  5F64 A;  2JPC A;  3HOS A;  1WI3 A;  1YIO A;  4BXX J;  2PJR B;  3E5U A;  3KP2 A;  5HOD A;  4AD9 A;  1BC8 C;  1KQ8 A;  3IP4 B;  1FX7 A;  3OYN A;  4KA4 A;  3HHH A;  5CPR B;  2DFF A;  1XD7 A;  2QLZ A;  4PK4 A;  3OIP A;  5DM6 F;  2MLK A;  3HOZ J;  3PO3 J;  3F23 A;  4C2U A;  2LSO A;  3EUK L;  4C30 A;  3FDY A;  1Y1V J;  4BE0 A;  4A0X A;  1SD5 A;  4CH7 A;  2WV0 A;  3WE3 A;  4M3D A;  4CCN A;  2W85 A;  3J7Y J;  3JCU C;  2CUZ A;  4XLA A;  1ZAO A;  2A6T A;  4ZDL A;  5JLW A;  1AKH A;  4MLO A;  1P4X A;  2MD5 A;  4A3M J;  2DTR A;  2L7Z A;  2VL8 A;  5J6X A;  3P7N A;  3QQA A;  2HPM A;  3DLA A;  3VYS B;  1ZAR A;  4F93 B;  1OCZ H;  4IQJ A;  1NH3 A;  1VI0 A;  2VKD A;  2O3F A;  3DBH B;  1OFC X;  2E36 A;  2GIZ A;  1J59 A;  5IOY A;  1EV7 A;  1Y8Q B;  1IXS B;  5DTD A;  4J19 A;  1MZB A;  5D6E A;  3WTU C;  1ZRC A;  3R0J A;  3ECO A;  4EJT A;  5LRS A;  2VJJ A;  5FFZ A;  2R7Q A;  5HVQ C;  2QA4 I;  2CG4 A;  4EM1 A;  3ASO H;  3TGN A;  5EGO B;  3M1E A;  1IAW A;  4OWR B;  4L0Y B;  1TLH B;  4CYC A;  3AG4 H;  2EA2 A;  4A6E A;  3LMM A;  1XX5 A;  2F5C A;  3OYJ A;  3SQN A;  4B44 A;  1N77 A;  4XN3 A;  1WQ2 A;  2VE9 A;  1Z6R A;  4FT8 A;  2E2J J;  1O3T A;  1O4X A;  2A61 A;  2DMU A;  4E6K G;  2EJR A;  4XON A;  2L9N A;  2KLO A;  1R71 A;  1DDN A;  2IAI A;  3MZH A;  2YR2 A;  2D1V A;  4W97 A;  2OF7 A;  5DV5 A;  1MGT A;  1EF4 A;  2OTJ I;  3E5X A;  5FKO A;  4KYW A;  2XGX A;  4XKV A;  1S29 A;  4V2F A;  2CJJ A;  3DBL B;  2VXZ A;  1I39 A;  1YRN B;  1BW6 A;  5A2Q Z;  2DMP A;  1U6G A;  2M0C A;  2QYO A;  2TCT A;  2PQ8 A;  2DXI A;  4XNF A;  2E2I J;  2PN6 A;  2D1H A;  3IL2 A;  2M8G X;  1SAX A;  3BR0 A;  1G4D A;  4FAS D;  3FXJ A;  2BXZ A;  1LB2 A;  1ZTR A;  2UXX A;  2OA4 A;  5FRM A;  1LDJ A;  5K1Y A;  1MNM C;  4F55 A;  2OC6 A;  3TOA A;  3VYT B;  2ZC2 A;  3O6B B;  2Z3Y A;  3SFZ A;  5LBQ A;  2JJ7 A;  3S3N A;  3FF5 A;  3BJO A;  4Q48 A;  2XPU A;  2KPM A;  3NWS A;  3CP8 A;  4LK1 F;  1RI7 A;  1JE8 A;  1R58 A;  3CCE I;  1T38 A;  4RB0 A;  1G59 A;  4B4C A;  4CCL A;  2ZNY A;  1PDN C;  2ICW G;  2VQL A;  1LNW A;  5M5W J;  1BIA A;  2EFQ A;  2OTL I;  5EG0 A;  4JP0 A;  2DA5 A;  4QWQ A;  3S3O A;  2NVT J;  3ABK H;  2DQL A;  1MKM A;  2W7N A;  3NAR A;  1TWH J;  1H9T A;  3S14 J;  3F21 A;  4YG2 F;  3DFG A;  3I55 I;  1HC8 A;  3OYA A;  5FD5 A;  3LWF A;  1W5T A;  2A3S A;  2W4S A;  1Y0N A;  1HW1 A;  1MJ9 A;  3P5J A;  5JHU A;  3ZQI A;  4ENN A;  4XMY A;  3QP6 A;  1SVL A;  2M8E A;  4G94 A;  5BPI A;  3Q3S A;  2VN2 A;  5EGO A;  1OPC A;  4HQE A;  1ZGA A;  4MFE A;  1FYM A;  3K4L A;  3HUG A;  3MKW B;  3K2Z A;  2FU4 A;  1I6H J;  3GTL J;  2V1D A;  4CGZ A;  2P5L C;  1SD7 A;  2QBY B;  1X4P A;  2L0K A;  2Y2Z A;  2QQA A;  2V26 A;  3L7W A;  1FJL A;  1QA6 A;  4KN4 X;  3CO7 C;  3AAF A;  1BI3 A;  5JHF A;  3KZI C;  3OYE A;  3VSK A;  3GFL A;  4RBO A;  2P8T A;  2DI3 A;  1JKQ C;  2M9H A;  5CVJ A;  4S0H B;  1J75 A;  1TNT A;  5J4Y A;  2P5K A;  3DQV C;  2DTZ A;  2JK3 A;  2IS1 A;  1XCV A;  2I10 A;  1GV5 A;  5L3C A;  3O2P E;  2KHM A;  2P0W A;  2ZFW A;  4AWX B;  2LYC A;  2IA2 A;  4U0W A;  3AL0 B;  1JJ8 C;  3GLX A;  4PSW A;  3RYP A;  3OYG A;  2ID6 A;  4G9Y A;  5D4R A;  1WWX A;  1U0J A;  3K0L A;  1QQI A;  2H6B A;  2P7C B;  1P4W A;  4KFC A;  3PSF A;  2AXL A;  3A01 B;  3HEF A;  1JI8 A;  4I99 C;  4UY8 I;  2Z99 A;  1OLT A;  5E3L A;  1Z7L A;  5IP7 J;  3T5X A;  3BR1 A;  2WAD A;  3QPS A;  1OMI A;  3GZ5 A;  5EEG A;  1C0W A;  2IXS A;  1OQY A;  1SD4 A;  3PUB A;  5GTH C;  1R6R A;  1JJ6 C;  2R7W A;  1D0Z A;  3LSP A;  4MIM A;  2W25 A;  3BR5 A;  1ITY A;  1LQ1 A;  2A5Y B;  2GOM A;  2IBD A;  2XF7 A;  5H2F C;  3RPU D;  3AG1 H;  3EYY A;  1Q1H A;  2EZL A;  4P1W A;  4HOB A;  5KK1 A;  2F5D A;  3IH2 A;  3M3Y J;  3VFZ A;  3IKT A;  2XSJ C;  4PFO A;  3CUQ C;  5E3O A;  3GFM A;  1WGX A;  1SAU A;  2KT0 A;  4F3Q A;  2BW3 B;  2EV0 A;  2KIS A;  3PUF A;  4KT6 A;  4IEJ A;  3GZ6 A;  2ELK A;  1DPU A;  5BQT A;  3JSO A;  3BQZ A;  1OYI A;  2V1N A;  2WB1 A;  2VOP A;  4N9I A;  4BQA A;  4A0Y A;  3SDG A;  3GME A;  4HZF A;  1JXS A;  2VOO A;  2JWT A;  4M74 A;  5HLI A;  2LRE A;  2MD0 A;  5H6Q A;  1E2X A;  2ME6 A;  1T0F C;  4CO8 A;  2EIK H;  1QZY A;  2WA0 A;  2DA4 A;  3FM3 A;  4MO7 A;  3D5S C;  4Y4R A;  2JTV A;  4UVA A;  1QNT A;  3RQI A;  4UVB A;  4B48 A;  3OR2 C;  3SEZ A;  3W6K B;  2GWR A;  3KYL A;  4U87 A;  2UV1 A;  1SD6 A;  5C44 J;  2M34 A;  5FO5 A;  1W4M A;  3CO6 C;  2BHY A;  2K9Q A;  1K6Y A;  4NBQ A;  1G3S A;  2CWE A;  3HBL A;  2JN6 A;  2CQN A;  1VQL I;  3QU3 A;  3M9A A;  1DPR A;  4AU7 A;  4L18 B;  4DBQ A;  2K02 A;  2JT1 A;  3OV8 A;  1Z3Y A;  3F6V A;  1XMK A;  2V79 A;  2STW A;  2VT3 A;  3JRH A;  2K5C A;  4KIB A;  1STZ A;  3FBN B;  2VPR A;  3TDZ C;  4PDK A;  4DZJ A;  3OYC A;  2WV1 A;  4A3J J;  2FOW A;  3BR6 A;  3HSF A;  3CDI A;  4JQF A;  3KCC A;  3SJM A;  4Z6Y A;  3L2U A;  2ID3 A;  2PMZ A;  3EPZ A;  1S72 I;  3UNG C;  3KIO A;  2JA8 J;  1G3T A;  3ELK A;  3CTA A;  2HTS A;  5CYV A;  2V9P A;  1X3U A;  2J5O A;  3HPH A;  3OYM A;  1TT0 A;  2IA1 A;  3A0B C;  2ETH A;  2VKH A;  3ZN0 A;  2JMW A;  4IPA A;  3I59 A;  2IPQ X;  4LIV A;  4LLN A;  2UXN A;  1FP2 A;  4BQQ A;  1G8X A;  2QQ8 A;  4Y33 A;  3I4M J;  3V7C A;  3VDX A;  5LRR A;  2EK5 A;  5J1R A;  2QVO A;  2GA1 A;  3DU5 A;  2LG4 A;  3D5L A;  3B73 A;  4FIS A;  2IGN A;  4ON0 A;  1BR2 A;  1ETQ A;  3E7L A;  1FNN A;  3VPR A;  1IC8 A;  5CKT A;  3WU0 A;  1K7A A;  2YPR A;  3A4C A;  2CW7 A;  1CF7 A;  1GV2 A;  1T33 A;  5IOZ A;  1JT0 A;  1QO0 D;  3HKZ N;  3OYD A;  1FP1 D;  3IRQ A;  3N05 A;  3Q0U A;  1GHC A;  4EGZ A;  2CS3 A;  3L2W A;  3PIP F;  1QZZ A;  5LLQ A;  2F5V A;  1ZG1 A;  1FYK A;  3KLN A;  3HSE A;  3I4P A;  4LB6 B;  3OS1 A;  1X1A A;  2JUC A;  1BIB A;  4EJW A;  3JRB A;  3DEU A;  3FIS A;  4DJA A;  4HSR A;  2GM4 A;  2Y0M A;  2F4O B;  3WTY C;  4O6J A;  1BR4 A;  1UG0 A;  3GUD A;  2CW0 F;  3PL8 A;  2H1K A;  2KKO A;  4HDU A;  1WFX A;  4RAZ A;  2CV0 A;  2VOD A;  2O03 A;  1VZ0 A;  2Q2E A;  4LOC A;  4A6D A;  4M3G A;  1D8K A;  1ZHF A;  1DUX C;  4M3E A;  3LQR A;  1Z05 A;  4RM2 A;  2H1L A;  3OMY A;  4KMF A;  2E71 A;  1OYY A;  5DCM A;  1KU7 A;  3LFK A;  4BJT A;  3I5U A;  5GPC A;  3DF8 A;  5J8C A;  1IUF A;  3DPT A;  4NB5 A;  4M71 A;  2K85 A;  2KQR A;  4Y17 A;  3TO7 A;  5LEJ A;  3K1M A;  3HL2 A;  2ZO4 A;  5H6R A;  1FT9 A;  3PFY A;  1H0M A;  4OIO F;  3BJ6 A;  3CCY A;  2K40 A;  1DGW Y;  3ZN1 A;  1UST A;  4GFB A;  4MEX F;  3HOW J;  2L2O A;  3BTJ A;  2R7D A;  4Y52 J;  5IT9 Z;  5EF6 A;  3BPX A;  1WJB A;  1ZEL A;  3WU2 C;  3A0H C;  3MZY A;  3W3C A;  3DBR B;  4WXC A;  1VQ4 I;  1FTT A;  3OIQ A;  4BE1 A;  2IEK A;  2V6E A;  3F8C A;  2VKE A;  3VWB A;  3V7R A;  4ENJ A;  1MMG A;  1UG2 A;  1PVE A;  3C2H A;  5J3L A;  1ON2 A;  1YLF A;  3W2V A;  1I27 A;  5F0H A;  4XSX F;  1TWG J;  1R5G A;  3KP4 A;  5DUI A;  2L7F P;  4II2 A;  4I2O A;  4FET A;  3SDB A;  2G0E A;  2IS2 A;  3TL4 X;  4E7L A;  1FPQ A;  5CQE A;  3TQN A;  5CLS A;  5J1Y A;  3K2A A;  3AL0 C;  2F4M B;  4U0Y A;  2CV2 A;  4ZZL A;  4BBS J;  3GO5 A;  3ZQL A;  3LSR A;  2DMQ A;  4KMU X;  2F2E A;  1N25 A;  4XK4 A;  5KAF C;  5LFA A;  3KZY A;  3CUQ A;  4S05 A;  2LKX A;  5D5U B;  1UHM A;  3LNQ A;  2ISZ A;  1E0E A;  4ETS A;  3MWM A;  2ZSH B;  3RKQ A;  3E6B A;  1F4K A;  5ED4 A;  3I58 A;  1QHG A;  4XSZ F;  3IAS 2;  4OOI A;  3OS0 A;  4IHV A;  3CCR I;  3CCS I;  4R79 A;  1J2X A;  2VI6 A;  1PUE E;  3RCO A;  5EZG A;  4AVZ A;  4PSX A;  2FQ3 A;  2EPF A;  3HGG A;  1VQK I;  3HB9 A;  5HDG A;  1YIJ I;  2DBB A;  3M8F A;  1EA3 A;  2DMN A;  4M72 A;  3J80 K;  4PGH A;  3WTS C;  1T98 A;  2L3D A;  4B1R A;  1T39 A;  5M5Y J;  4F7Z A;  2HDC A;  1XPX A;  4LIT A;  4JK1 X;  4OU0 A;  4IKF A;  4M9S A;  3HSR A;  4RB3 C;  5LD2 C;  2GBY A;  3H3V K;  2R7O A;  3CLQ A;  4DIQ A;  3DLL F;  2LKS A;  2NRA C;  3OOU A;  5DYM A;  3DPU A;  4X0G A;  2CW8 A;  4YFN F;  3BWG A;  1MSF C;  2G7U A;  3PJR A;  1SFK A;  1RZ4 A;  2VJ4 A;  1KYZ A;  4XLN F;  4BGD A;  3PFI A;  4AYB A;  2O5R A;  4A3L J;  5BMZ A;  3ZMS A;  1JHH A;  3CCM I;  1CGP A;  2P7V B;  4Q5S F;  3F8N A;  3H0G J;  4WWC A;  1F43 A;  3OR1 C;  2DA2 A;  5FLX Z;  3ZR8 X;  1ZRD A;  3IUO A;  1R4N B;  4E7I A;  1ZK8 A;  1LEB A;  1R1V A;  3FX3 A;  2DQR A;  2ZXJ A;  2XVC A;  2BGC A;  1Z1D A;  2JVG A;  2BXY A;  2DW4 A;  2EBI A;  2KP6 A;  3T8R A;  2XV4 S;  4BL0 B;  2JZY A;  4MNU A;  2JSP A;  4V19 K;  1TBX A;  2E1O A;  3K4C A;  3FMS A;  2EFP A;  3S2W A;  4P9U A;  4M3F A;  4ZDP A;  1S5L C;  2B9S A;  4UHT A;  1B9M A;  2G7H A;  5AON A;  2RQP A;  3K4K A;  4FHT A;  2XDV A;  3A01 A;  1VTN C;  1H88 C;  1AU7 A;  4AM3 A;  4RGR A;  3FZV A;  1D3Y A;  3CDH A;  1FOY A;  1IRF A;  2Y30 A;  1R1T A;  3F6O A;  2CUE A;  2LMD A;  4A5N A;  3DKY A;  4DOZ A;  4MFD A;  1HCR A;  1Y6I A;  2HNH A;  5GAD J;  2QKL B;  3BTC A;  3KX2 A;  1MW7 A;  1U5T C;  2UUZ A;  2PI0 A;  1SC7 A;  3K4N A;  4NC7 A;  4O3M A;  5FLX K;  4Y13 A;  3ABL H;  1RR8 C;  3DCF A;  2YS9 A;  4R1H A;  5HS9 A;  3RKW A;  1TC3 C;  2E34 A;  3TO6 A;  3KYD B;  2EIN H;  3GW2 A;  2L9V A;  1U3E M;  3ERM A;  3BR3 A;  3FXR A;  4RAG A;  4QIW N;  3RZO J;  2DDB A;  2ZXH A;  1BI2 A;  3T8T A;  3C2B A;  1S3J A;  4HA8 A;  3WTV C;  2IS4 A;  1V55 H;  3HUG B;  2GAU A;  3HRS A;  1Y0U A;  4GCV A;  3OOP A;  5FRN A;  3BRO A;  2HDW A;  2K9M A;  2X1D A;  2Y48 A;  1T0F A;  1T56 A;  2HYJ A;  1ZGW A;  1YHQ I;  2VPL A;  3B02 A;  3FXM A;  2Z1D A;  3QYE A;  3VB2 A;  4ANJ A;  3CMY A;  2MH9 A;  3ZOB A;  1RNL A;  2UWM A;  4WX9 A;  4YII A;  2MC4 A;  2Y9Z A;  4NDL A;  3W2A A;  4ZTJ A;  2OQR A;  4YRV A;  5DD8 A;  1T08 B;  3BG9 A;  3DP7 A;  5J1U A;  2JA7 J;  3EDP A;  2H09 A;  4A2U A;  2CQX A;  1JUM A;  3HRT A;  2DFE A;  4A93 J;  1KZH A;  5IT9 K;  4OMZ A;  1IJW C;  3H3Z A;  1IN7 A;  3GZN B;  5D5V B;  4C9Y A;  1L3L A;  1MSE C;  1JGG A;  2IRF G;  1YE9 A;  1NK2 P;  3SEQ A;  4BJ6 C;  2TDX A;  5F6F A;  1F36 A;  1A6Q A;  3BZC A;  3HHG A;  4AVP A;  1R23 A;  1S8N A;  2KIF A;  2XAG A;  1J09 A;  1B6A A;  4XQF A;  1Y8R B;  1FC3 A;  3LFU A;  5JVG F;  4L9T A;  2RAE A;  2HS5 A;  1TT5 B;  2PBI A;  1XSX A;  2R92 J;  1MBJ A;  3CDL A;  3K6G A;  3FMR A;  3Q5F A;  3J7A Y;  5CVV A;  2NVY J;  3T0Y A;  2MAB A;  4ZJZ A;  3GTP J;  2PJP A;  3EYI A;  5EEH A;  1PJR A;  1HKS A;  1KGS A;  2CRG A;  3HXL A;  1UFM A;  5GAG J;  4E70 A;  2HOE A;  2HVQ A;  2VJI A;  5E79 C;  4B43 A;  3BG6 A;  2Q0O A;  1BI0 A;  3QYB A;  2HKO A;  3PNT A;  4KIT B;  2XKO A;  3PM1 A;  4HG2 A;  3QPH A;  4OIQ F;  2RN7 A;  5BPD A;  1IG7 A;  1DGR M;  2XB0 X;  1ORK A;  3JTH A;  1S9H A;  3I53 A;  2LBF B;  1Z7U A;  1LFB A;  1BL0 A;  2HDD A;  2CQK A;  2L02 A;  3GCM A;  2LY2 A;  2LF8 A;  2VIX A;  1QVT A;  3H5N A;  3W6J B;  3HC7 A;  4RB2 C;  4JX4 A;  3LOC A;  5ICE A;  1QPM A;  2PFB A;  3GTM J;  2FBI A;  1H89 C;  3KZZ A;  3G6E I;  3ESW B;  3E3V A;  3L2V A;  2BHZ A;  5CVU A;  3LA2 A;  4YIR X;  2VC1 A;  4XKC A;  2HPI A;  3ML6 A;  4UUT A;  3O8G A; 
#chains in the Genus database with same CATH homology
 4TV7 A;  4L5I A;  5TJJ A;  3F3X A;  1IW7 F;  3SXY A;  1YFH A;  1HST A;  4UV8 A;  3FWE A;  4MHG A;  1F5T A;  3CUO A;  1HW5 A;  1UCR A;  1YG2 A;  3QPT A;  1FWZ A;  1HXD A;  4LLG F;  1FSE A;  2EB7 A;  3RPU A;  4CXF A;  2B0L A;  2O0Y A;  4HDV A;  3NQO A;  4BYY A;  4UUV A;  1YS7 A;  3FMQ A;  4HX4 A;  2FA5 A;  2K7L A;  4ESF A;  5HLH A;  3K1P A;  5K5R A;  4P55 A;  3DV8 A;  1U78 A;  1ZG5 A;  4MQ9 F;  5E8G A;  2JPB A;  3LQQ A;  1K6O A;  1YYV A;  4HX7 A;  4P9F A;  2ACJ A;  3WTW C;  3WGG A;  3ZMT A;  1S7O A;  1XN7 A;  3BZ6 A;  3KP5 A;  5E1Z B;  5BS6 A;  3U1D A;  4UVC A;  3O3K A;  2KRF A;  4EM0 B;  2YX4 A;  5E1X A;  1R22 A;  2VBZ A;  4HV6 A;  1QGP A;  5ICG A;  2FNP A;  3GYH X;  3MQ0 A;  4LLL A;  3R4K A;  4BH9 A;  2EV6 A;  2FSW A;  2HTJ A;  4LK0 F;  5HOO A;  4BAY A;  5ICC A;  4Y15 A;  2K27 A;  1XDS A;  4UNO A;  3WTZ A;  3QP5 A;  2P4W A;  1AWC A;  4OIR F;  2X4H A;  4Z2Y A;  3RI4 A;  4NHJ A;  1LDD A;  2FF4 A;  4BHC A;  2OZU A;  2R7F A;  3P9I A;  4JBA A;  1R36 A;  1P6R A;  5E17 F;  3FXU A;  3V8J A;  4EJV A;  2HEO A;  2IP2 A;  5JR3 A;  5FB2 A;  3IRR A;  2STT A;  2K86 A;  2C6Y A;  3R6S A;  1YQA A;  5D8L B;  1J0R A;  2PG4 A;  3KFW X;  1L0O C;  2DPU A;  5LGN A;  2A69 F;  3JW4 A;  2VE8 A;  2PMH A;  4KIG A;  3T1B A;  2VBX A;  2VC0 A;  4I7H A;  2G9W A;  1B1B A;  4BHP A;  3MFK A;  2XUB A;  4OIP F;  4Q47 A;  1KQ9 A;  4A0Z A;  1ZYR F;  5L3F A;  1TQM A;  2VON A;  4WXD A;  4MQV A;  4U88 A;  3ABU A;  3HOT A;  4I98 B;  4Q4Z F;  4XRF A;  3WTX C;  3REO A;  2CYY A;  3JTG A;  4B09 A;  3GEZ A;  2FXA A;  4A12 A;  2MLG A;  2ESH A;  4L5J A;  1SMY F;  2CGP A;  2V6C A;  1ZG3 A;  3G73 A;  1HKQ A;  4LMY A;  4U7D A;  3MCZ A;  5FD6 A;  4DQ2 A;  3F8F A;  2EFO A;  2DLL A;  1XGS A;  3IWZ A;  2AS5 F;  3HTU A;  4HV5 A;  2FML A;  4BXU A;  3TKY A;  4HF0 A;  2V1X A;  1QBJ A;  2M1B A;  2IVM A;  1HSJ A;  2A07 F;  1EH8 A;  1O7L A;  2VBY A;  1JGS A;  3MAJ A;  2V1U A;  1W7P A;  3ZMV A;  4WK8 F;  2P6S A;  2X0L A;  1MD0 A;  1IN8 A;  1SMT A;  3HIF A;  4MEY F;  4IHS A;  1USS A;  5DEQ A;  2IT0 A;  1XSV A;  3I64 A;  3DKW A;  4OMY A;  2LKP A;  3JSP A;  2LDU A;  3K69 A;  1R00 A;  2A68 F;  4ESJ A;  2M30 A;  2RC4 A;  2J5P A;  1GVJ A;  4FX4 A;  2L4M A;  4ZYD A;  3E6C C;  1WSU A;  1R5H A;  1E17 A;  1BI1 A;  3ERE D;  3BPV A;  1RIO H;  3ZMU A;  3GFI A;  1ZRE A;  4XLP F;  4PCQ A;  2R3S A;  2DO7 A;  1WKM A;  3J80 Z;  1TW2 A;  2QWW A;  4KT5 C;  4IRG A;  4HF1 A;  2XAS A;  5BOX A;  1IUY A;  1I1G A;  1SFU A;  2DU9 A;  2A6H F;  4G6Q A;  5LHG A;  2XRO A;  2W57 A;  4RB1 A;  4GYI A;  4EM2 A;  4G8X A;  2MC3 A;  1YW9 A;  2QZ8 A;  3GF2 A;  1EH7 A;  3BY6 A;  4NQW A;  3HYI A;  4MTE A;  2OZ6 A;  1G3Y A;  1IZ1 A;  1J5Y A;  1IF1 A;  1R1U A;  4LB5 A;  4KIF A;  1GXQ A;  3KP6 A;  3COA C;  1ZGJ A;  1HQC A;  4BHB A;  2XAJ A;  4AIH A;  2HFH A;  1HBX G;  1MDM A;  1RUN A;  3TO9 A;  3P9C A;  1U5T A;  1K79 A;  1V4R A;  2EFN A;  2OU2 A;  5DDG A;  3PQK A;  1I1S A;  2BYV E;  2L01 A;  2PLY A;  4U0V A;  4IRI A;  1GXP A;  1I5Z A;  2BE5 F;  2GXB A;  3CJN A;  2D45 A;  2UZK A;  4KN7 X;  4RGU A;  1BBY A;  3ZQ7 A;  5F1R A;  1Z91 A;  5L3D A;  2PEX A;  3KE2 A;  3RYR A;  3QU6 A;  3FXQ A;  1W7P B;  2O8X A;  2QQ9 A;  2FRH A;  4ZYH A;  3N4M A;  1H9G A;  5LEK A;  5ICF A;  3QRF F;  4IVN A;  2LF7 A;  1B59 A;  4RGX A;  5J8F A;  2EV5 A;  1MJB A;  5D4S A;  4EV0 A;  1BC7 C;  4MGR A;  4KDP A;  1OKR A;  1P2F A;  2EA4 A;  3SZT A;  2IJL A;  3KLO A;  4HLX A;  2VBW A;  3RKY A;  4M9Z A;  3H3U A;  2RV8 A;  1TTY A;  1Z9C A;  4ESB A;  4RS8 A;  3ROU A;  1ZRF A;  3K9T A;  4GXO A;  2Z33 A;  4CDG A;  2NNY A;  2IA0 A;  1G6N A;  3I54 A;  3ISP A;  2XHK A;  2DK8 A;  1FSH A;  2LNB A;  3WU1 B;  4ZZD A;  3L00 A;  1SFX A;  2H6C A;  5JFR A;  4WCG A;  3PQJ A;  2K4B A;  2YX7 A;  5LHH A;  1D8J A;  2RDP A;  4PGG A;  2VT2 A;  2XKP A;  3RJP A;  3V8L A;  1O3S A;  3LST A;  1XCB A;  4CHU A;  2BV6 A;  2HR3 A;  3HTS B;  1R7J A;  1B4A A;  3TOB A;  1K78 A;  1YS6 A;  1SFE A;  3BOQ A;  4IRH A;  1T2K A;  4N9H A;  1J9I A;  3I0T A;  4RGS A;  4CYD A;  2ESN A;  4ASN A;  4B8X A;  1U5T B;  2A6E F;  3GVA A;  1IN6 A;  4L9N A;  1LDK B;  1V3F A;  2ADU A;  4CZZ A;  2YSR A;  1BN5 A;  2OD5 A;  1OYW A;  1FY7 A;  2Z5U A;  3L2C A;  5AIP A;  2E7W A;  3D0S A;  3K1N A;  4YFK F;  3JAM Z;  3LA3 A;  3I71 A;  4ZH4 F;  2H94 A;  3GWZ A;  6PAX A;  2O6G E;  4LG0 B;  3KP7 A;  2O61 A;  1XGN A;  2NS0 A;  4I02 A;  2QQB A;  3F8M A;  3WGH A;  3C18 A;  3WOD F;  1CF7 B;  2Q8K A;  2XAF A;  3U9G A;  5L3G A;  4U7B A;  2E7X A;  3QAH A;  3BDD A;  1B9N A;  1ZH5 A;  3ECH A;  3KP3 A;  3E5Q A;  2H27 A;  2GXG A;  4KIC A;  1MJA A;  3E6D A;  1ON1 A;  2ZME A;  1A04 A;  4IHT A;  4LJZ F;  2ZCW A;  1XSD A;  3V4G A;  2RGV A;  2FNA A;  4LGW A;  4L0Z B;  4CIC A;  2W24 A;  3TDU C;  3ULQ B;  4K2E A;  3RDI A;  2CSO A;  5HS7 A;  3KEQ A;  5K5Q A;  3V8K A;  1KQ0 A;  4FX0 A;  3R61 A;  3ZPL A;  3J81 K;  4QLC U;  3IWF A;  1YW7 A;  2ZNZ A;  1P4A A;  2HQR A;  4LD5 A;  1FBQ A;  4EMS A;  3WTT C;  1YTY A;  5D5X B;  1BJA A;  3GX4 X;  2RNJ A;  2HQN A;  4EVI A;  1YW8 A;  2M87 A;  2RVC A;  1HW2 A;  2FOK A;  1HKT A;  5CVI A;  2D2W A;  1P92 A;  1ZLK A;  3SHF A;  3ZMZ A;  2CO5 A;  5LGT A;  3HRU A;  3WE2 A;  2L54 A;  4IJA A;  4HYE A;  3JAM K;  3IHU A;  4ENK A;  3DXJ F;  4G6D A;  4HBL A;  4M9X A;  5CVR A;  3HRM A;  1TQI A;  3EUH A;  4PZJ A;  3IC7 A;  5D6F A;  1RUO A;  1XGO A;  2BEO A;  4GO1 A;  4I01 A;  3NRV A;  4HAM A;  4M6Y A;  5DUK A;  5DD4 A;  3R60 A;  1G3W A;  4YFX F;  2NNN A;  1FZP B;  5H20 A;  1AOY A;  1O3Q A;  5DCM B;  3GFJ A;  1TQP A;  4D0P A;  2OQG A;  3RTR A;  2FEZ A;  2WC2 A;  5IT3 A;  1DP7 P;  2ZJ2 A;  1YO5 C;  1XDU A;  1W5S A;  2HYG D;  1PP7 U;  1J7K A;  1LJ9 A;  4LG0 A;  3U2R A;  2HGC A;  4G7H F;  2HZT A;  2KIU A;  5ILS A;  2QEN A;  2QUF A;  3BJA A;  4N0B A;  2BBY A;  5ERI A;  1IN5 A;  2DPD A;  2HWV A;  2XAH A;  3CUQ B;  4M73 A;  3E97 A;  5FGM A;  3WGI A;  1PP8 F;  3C7J A;  5JVT A;  4HF2 A;  1BM9 A;  3DPL C;  1ZN2 A;  2DT5 A;  2ZME B;  3Q9V A;  3IKV A;  3I59 B;  4EJO A;  5LHI A;  4ZYG A;  2ISY A;  2NYX A;  3SZP A;  1KU2 A;  3KET A;  1I6X A;  5K5O A;  2XAQ A;  5L3B A;  3EET A;  3MEX A;  1U2W A;  4LFU A;  1KA8 A;  2XIG A;  3P9K A;  5CJ9 A;  5D8K B;  4UV9 A;  2QBY A;  4GGG A;  4GYG A;  4AIK A;  1UB9 A;  4HQM A;  2DFI A;  5HS8 A;  2CFX A;  1O57 A;  1S7A A;  4KUM A;  4WF2 A;  4M6X A;  2KIM A;  4OIN F;  1Z6T A;  2HYF A;  1IXC A;  5ILU A;  1NHA A;  2MBF A;  5E20 A;  4MTD A;  1ZLJ A;  5E8I A;  1ODD A;  3WG9 A;  2ZKZ A;  3G3Z A;  4P96 A;  5L3E A;  2DAO A;  3EQL F;  5ILV A;  1FOK A;  2WTE A;  3L9F A;  2M5W A;  5JI6 A;  2MH2 A;  1EH6 A;  2K4J A;  2V9V A;  2WWY A;  2KJC A;  4EGY A;  4G7Z F;  4ENM A;  1WRJ A;  2ZBK A;  5KVR A;  2E1C A;  1ULY A;  2NAZ A;  3LAP A;  4IXA A;  2JSC A;  2MA3 A;  4R8H A;  1KU9 A;  3FHZ A;  3RKX A;  3H92 A;  2F5E A;  2P6T A;  1XGM A;  3L09 A;  1LVA A;  1IN4 A;  1ONV A;  3LA7 A;  3VOD A;  1W7P D;  3CLO A;  2QM3 A;  1REP C;  4H0E A;  3KEO A;  2COM A;  3LAJ A;  1UHW A;  2P5V A;  1KYW A;  1O3R A;  5HDN A;  3BP8 A;  4RAY A;  1IRG A;  3VOE A;  2ELH A;  2E1N A;  2M45 A;  2Z9O A;  2FBH A;  2YU3 A;  3NEU A;  4L9V A;  4UXN A;  4DNC A;  4KNY A;  1MDM B;  2DK5 A;  3F72 A;  2L4A A;  2FBK A;  4I0A A;  1KU3 A;  1XB4 A;  2OAZ A;  2W84 A;  4XBF A;  2FMY A;  4S04 A;  2KJB A;  1FYL A;  5D5W B;  5DCF A;  3RPQ A;  4A5M A;  2EFW A;  3ZP5 A;  1FBS A;  1TNS A;  2PMU A;  1O7F A;  2F5F A;  3R0A A;  5AIQ A;  3M8E A;  3M7G A;  5A2Q K;  4IF4 A;  2FE3 A;  3C1D A;  4WXH A;  5LGU A;  2GQQ A;  4BNC A;  1U8R A;  3Q9S A;  4O5V A;  2IW5 A;  2GIV A;  4YIF A;  3GXO A;  3F22 A;  4I0B A;  3ZMD A;  4ZYE A;  2XRN A;  2JRT A;  3VEP A;  4HLY A;  5E18 F;  4L9J A;  2Y75 A;  3J7A O;  3V7S A;  3C3W A;  3J81 Z;  4G7O F;  3E6M A;  5HLG A;  1BOA A;  1F1Z A;  1TW3 A;  1XMA A;  1K78 B;  4AIJ A;  1WI9 A;  4HW0 A;  1LEA A;  3N97 A;  5FFX A;  4HX8 A;  1D5V A;  5E1W A;  4EJU A;  5HDK A;  3F8B A;  3QOP A;  1FBU A;  5TRD A;  2GA2 A;  1OR7 A;  3ABT A;  4EQQ A;  1S6L A;  2GZW A;  3FM5 A;  2HKX A;  1T6S A;  4P5O A;  2EWN A;  1IXR C;  1JHF A;  3RIR A;  2RKH A;  4I09 A;  1FLI A;  1F9N A;  2OBP A;  5F64 A;  2JPC A;  3HOS A;  1YIO A;  3E5U A;  3KP2 A;  4AD9 A;  1BC8 C;  1KQ8 A;  1FX7 A;  4KA4 A;  3HHH A;  1XD7 A;  2QLZ A;  2MLK A;  3F23 A;  2LSO A;  4A0X A;  1SD5 A;  2WV0 A;  3WE3 A;  2W85 A;  1ZAO A;  1P4X A;  2MD5 A;  2DTR A;  5J6X A;  3P7N A;  1ZAR A;  2O3F A;  1J59 A;  1EV7 A;  1IXS B;  1MZB A;  5D6E A;  3WTU C;  1ZRC A;  3R0J A;  3ECO A;  4EJT A;  5LRS A;  5FFZ A;  5HVQ C;  2CG4 A;  4EM1 A;  3TGN A;  3M1E A;  1IAW A;  4L0Y B;  1TLH B;  2EA2 A;  4A6E A;  2F5C A;  3SQN A;  1WQ2 A;  2VE9 A;  1Z6R A;  4FT8 A;  1O3T A;  2A61 A;  2EJR A;  1DDN A;  3MZH A;  2YR2 A;  2D1V A;  5DV5 A;  1MGT A;  3E5X A;  4KYW A;  2XGX A;  1S29 A;  2VXZ A;  5A2Q Z;  1U6G A;  2QYO A;  2PQ8 A;  2PN6 A;  2D1H A;  3IL2 A;  1SAX A;  1G4D A;  1LB2 A;  2UXX A;  2OA4 A;  1LDJ A;  5K1Y A;  3TOA A;  5LBQ A;  3O6B B;  3SFZ A;  2Z3Y A;  3FF5 A;  3BJO A;  4Q48 A;  4LK1 F;  1RI7 A;  1JE8 A;  1R58 A;  1T38 A;  4RB0 A;  2ZNY A;  1PDN C;  1LNW A;  1BIA A;  2EFQ A;  4QWQ A;  2DQL A;  1MKM A;  1H9T A;  3F21 A;  4YG2 F;  3DFG A;  5FD5 A;  3LWF A;  1W5T A;  2A3S A;  1HW1 A;  1MJ9 A;  5JHU A;  5BPI A;  4ENN A;  3QP6 A;  2M8E A;  4G94 A;  2VN2 A;  1OPC A;  4HQE A;  1ZGA A;  1FYM A;  3HUG A;  3K2Z A;  2FU4 A;  4CGZ A;  2V1D A;  2P5L C;  2QBY B;  1SD7 A;  2QQA A;  3L7W A;  4KN4 X;  3CO7 C;  3AAF A;  1BI3 A;  3GFL A;  2P8T A;  2DI3 A;  5CVJ A;  1J75 A;  1TNT A;  2P5K A;  3DQV C;  1XCV A;  5L3C A;  3O2P E;  2ZFW A;  4AWX B;  2IA2 A;  4U0W A;  3GLX A;  3RYP A;  4G9Y A;  5D4R A;  1WWX A;  3K0L A;  1QQI A;  2H6B A;  2P7C B;  1P4W A;  4KFC A;  2AXL A;  2Z99 A;  3T5X A;  1OMI A;  3GZ5 A;  5EEG A;  1C0W A;  1SD4 A;  2W25 A;  1LQ1 A;  2A5Y B;  3EYY A;  1Q1H A;  4HOB A;  5KK1 A;  2F5D A;  3VFZ A;  3IKT A;  3CUQ C;  3GFM A;  2EV0 A;  3GZ6 A;  1DPU A;  5BQT A;  3JSO A;  1OYI A;  2VOP A;  4N9I A;  4BQA A;  4A0Y A;  4HZF A;  1JXS A;  2VOO A;  4M74 A;  5HLI A;  5H6Q A;  1E2X A;  4CO8 A;  1QZY A;  3FM3 A;  2JTV A;  4UVA A;  1QNT A;  4UVB A;  3W6K B;  2GWR A;  1SD6 A;  5FO5 A;  1W4M A;  3CO6 C;  1G3S A;  2CWE A;  3QU3 A;  3M9A A;  1DPR A;  4L18 B;  2K02 A;  2JT1 A;  3OV8 A;  3F6V A;  1XMK A;  2V79 A;  2STW A;  2VT3 A;  4KIB A;  1STZ A;  3TDZ C;  4PDK A;  3HSF A;  4JQF A;  3KCC A;  1G3T A;  3ELK A;  3CTA A;  2HTS A;  5CYV A;  1X3U A;  2J5O A;  2IA1 A;  2ETH A;  3ZN0 A;  4IPA A;  3I59 A;  2IPQ X;  4LLN A;  2UXN A;  1FP2 A;  3V7C A;  5LRR A;  2EK5 A;  2QVO A;  2GA1 A;  3D5L A;  3B73 A;  4ON0 A;  1FNN A;  3WU0 A;  1K7A A;  2YPR A;  1CF7 A;  1QO0 D;  1FP1 D;  3IRQ A;  1GHC A;  4EGZ A;  1QZZ A;  5LLQ A;  1ZG1 A;  1FYK A;  3KLN A;  3HSE A;  3I4P A;  4LB6 B;  1BIB A;  4EJW A;  3DEU A;  2Y0M A;  3WTY C;  4O6J A;  3GUD A;  2CW0 F;  2KKO A;  4HDU A;  4RAZ A;  2VOD A;  2O03 A;  2Q2E A;  4A6D A;  1D8K A;  1ZHF A;  1DUX C;  3LQR A;  1Z05 A;  4KMF A;  1OYY A;  5DCM A;  1KU7 A;  3LFK A;  3I5U A;  3DF8 A;  5J8C A;  3DPT A;  4NB5 A;  4M71 A;  4Y17 A;  3TO7 A;  5LEJ A;  3K1M A;  2ZO4 A;  5H6R A;  1FT9 A;  1H0M A;  4OIO F;  3BJ6 A;  3ZN1 A;  1UST A;  4MEX F;  2R7D A;  5IT9 Z;  3BPX A;  3MZY A;  4WXC A;  3F8C A;  3V7R A;  4ENJ A;  1ON2 A;  1YLF A;  1I27 A;  4XSX F;  1R5G A;  3KP4 A;  5DUI A;  4I2O A;  1FPQ A;  3TQN A;  5CLS A;  4U0Y A;  4ZZL A;  3GO5 A;  4KMU X;  2F2E A;  3KZY A;  3CUQ A;  4S05 A;  5D5U B;  1UHM A;  2ISZ A;  4ETS A;  3MWM A;  1F4K A;  3E6B A;  5ED4 A;  3I58 A;  4XSZ F;  4OOI A;  4R79 A;  1J2X A;  1PUE E;  2FQ3 A;  5HDG A;  2DBB A;  3M8F A;  4M72 A;  3J80 K;  4PGH A;  3WTS C;  1T98 A;  2L3D A;  1T39 A;  4F7Z A;  2HDC A;  4JK1 X;  4OU0 A;  4M9S A;  3HSR A;  4RB3 C;  2NRA C;  5DYM A;  4YFN F;  3BWG A;  2G7U A;  4XLN F;  1RZ4 A;  1KYZ A;  3PFI A;  5BMZ A;  3ZMS A;  1JHH A;  1CGP A;  4Q5S F;  2P7V B;  3F8N A;  4WWC A;  5FLX Z;  1ZRD A;  1LEB A;  1R1V A;  3FX3 A;  2DQR A;  2ZXJ A;  2XVC A;  2BGC A;  1Z1D A;  2DW4 A;  3T8R A;  2XV4 S;  2JZY A;  4MNU A;  1TBX A;  3FMS A;  2EFP A;  3S2W A;  4P9U A;  4UHT A;  1B9M A;  2G7H A;  5AON A;  2RQP A;  4FHT A;  1VTN C;  4RGR A;  3FZV A;  1D3Y A;  3CDH A;  1IRF A;  1R1T A;  3F6O A;  4A5N A;  1U5T C;  2PI0 A;  4O3M A;  5FLX K;  4Y13 A;  4R1H A;  5HS9 A;  3RKW A;  3TO6 A;  3GW2 A;  1U3E M;  3FXR A;  1BI2 A;  3T8T A;  1S3J A;  4HA8 A;  3WTV C;  2GAU A;  1Y0U A;  3HRS A;  4GCV A;  3OOP A;  3BRO A;  2Y48 A;  1T0F A;  3B02 A;  3VB2 A;  2MH9 A;  1RNL A;  2UWM A;  4WX9 A;  4YII A;  2OQR A;  5DD8 A;  3DP7 A;  3EDP A;  2H09 A;  4A2U A;  3HRT A;  5IT9 K;  4OMZ A;  3H3Z A;  1IN7 A;  5D5V B;  1L3L A;  2IRF G;  2TDX A;  5F6F A;  3HHG A;  4AVP A;  1R23 A;  1S8N A;  2KIF A;  2XAG A;  1B6A A;  1FC3 A;  4L9T A;  2HS5 A;  2PBI A;  1XSX A;  3FMR A;  3Q5F A;  5CVV A;  3T0Y A;  2PJP A;  3EYI A;  5EEH A;  1HKS A;  1KGS A;  1UFM A;  4E70 A;  2HOE A;  2Q0O A;  1BI0 A;  2HKO A;  2XKO A;  3QPH A;  4OIQ F;  2RN7 A;  5BPD A;  3JTH A;  3I53 A;  1Z7U A;  2CQK A;  2L02 A;  2LF8 A;  3W6J B;  4RB2 C;  5ICE A;  1QPM A;  2PFB A;  2FBI A;  3KZZ A;  3E3V A;  5CVU A;  3LA2 A;  2VC1 A;  3ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...