1XSDA

Crystal structure of the blai repressor in complex with dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsdA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1xsdA02
3DXJF 5ILUA 4S05A 2JTVA 4LK0F 2CG4A 2OZ6A 4ZYHA 5DCFA 4L9JA 4DQ2A 2DT5A 1IUYA 1FP2A 4HQEA 4IPAA 4NHJA 3SQNA 3RYRA 3ML6A 4H0EA 2LF7A 4LLLA 1YG2A 2NS0A 1QBJA 5CVIA 3MFKA 1T6SA 3WTSC 1J5YA 2KIUA 4L5IA 2EV6A 4OMZA 3JW4A 2H6CA 4M72A 2MA3A 3P9CA 1Z6TA 2GZWA 4KN7X 5D5WB 5BPDA 3F8CA 4LK1F 2OBPA 2OA4A 3FXQA 3KP6A 3I0TA 2LDUA 1R00A 3GXOA 2JT1A 5D8KB 4G9YA 2AXLA 4M71A 3T1BA 1UCRA 2E7WA 4UV8A 3LA3A 4HF0A 2IA1A 3CLOA 2VT2A 2BGCA 2KKOA 3BROA 2V79A 2W24A 4JQFA 3E6CC 4LLNA 4IHTA 4I0BA 2FA5A 2IJLA 2D2WA 4WXDA 1S8NA 5E17F 5LRSA 3LQQA 2V1UA 1Z91A 1USTA 4EJVA 1PP7U 4EGZA 2VONA 1JHHA 2FRHA 3F8BA 3I59B 4RB0A 3BDDA 2P5KA 3KCCA 4KYWA 1MDMA 4FT8A 2QQ9A 1FYLA 5L3EA 5DUIA 1G3SA 1A04A 5HDKA 4WK8F 3CUQB 5LEJA 4MGRA 2QQBA 2YSRA 1IF1A 1F5TA 1S29A 1JXSA 3GFLA 1FNNA 1AOYA 2DQRA 3DQVC 2O0YA 4EQQA 2QYOA 4A5MA 2P5VA 5LGTA 2YX4A 4MQ9F 4ENJA 6PAXA 3MZHA 2HYFA 4N0BA 2C6YA 5FFXA 1WQ2A 4RGUA 4P9UA 2O6GE 2RKHA 1T0FA 2F2EA 3BJAA 3O6BB 5F1RA 1W4MA 2O8XA 3GWZA 4XSXF 1ULYA 2HR3A 3GO5A 1I27A 3DF8A 1D8KA 4WXCA 4AIJA 5K1YA 2ISZA 4U88A 2IP2A 5L3DA 2OQRA 2HKOA 4G7HF 3RKXA 2ZJ2A 4UUVA 4HA8A 1BIBA 4Z2YA 3N97A 4HZFA 3VOEA 3REOA 1OR7A 1W7PA 4HDVA 4FX4A 3LQRA 3ZMZA 4PGGA 2M45A 2M8EA 2JSCA 3E97A 3F22A 4XBFA 3ECOA 1ZLJA 1F1ZA 3FM3A 2HGCA 2J5OA 1XGOA 3M8FA 2MC3A 2A07F 2EFPA 5DV5A 3QRFF 1QQIA 4ZZDA 1BI1A 4OIRF 1ZH5A 4HF1A 3M8EA 3Q9VA 3SXYA 2IPQX 2PFBA 2EFNA 1ONVA 4Y15A 2IT0A 3Q5FA 5CLSA 5FLXZ 2PG4A 4OU0A 3H3UA 2L01A 1ZG5A 3J80K 4OOIA 3J81K 1ODDA 2H27A 4CXFA 1R5GA 1QZYA 2L4AA 1X3UA 2DI3A 1ZN2A 2QLZA 2E1CA 4CICA 4L0ZB 3GFIA 1G3TA 3C18A 2ELHA 3GZ6A 5AIQA 2GXGA 4HX8A 4TV7A 4UV9A 1XCVA 2ZCWA 2O3FA 2PEXA 4A2UA 4U7BA 5LGNA 2VE8A 2BE5F 4LJZF 4ZYDA 1I1GA 5BMZA 3BJ6A 4A0ZA 2PQ8A 5J8FA 1XCBA 2XKOA 3I54A 5J8CA 2WC2A 1U6GA 3VEPA 3FWEA 2FNPA 3QPHA 2OU2A 2DLLA 2XAQA 2XAFA 1ON1A 1KYZA 1TQIA 3WG9A 4GO1A 1LQ1A 2K4JA 1BIAA 2XGXA 3WTXC 1ON2A 3HSEA 1XSDA 1RZ4A 2EJRA 3CO7C 2DQLA 4RB1A 3JTGA 2P4WA 5CVJA 2FNAA 3RIRA 4HLXA 2RGVA 1FP1D 1XSVA 5EEHA 2O61A 3K1MA 3TGNA 3KP5A 1HSTA 3EETA 3V8LA 3SZPA 3AAFA 1FYMA 5JVTA 1YS7A 1P4XA 1XN7A 3K9TA 1GXPA 3LFKA 2QBYA 4ZYEA 2P6SA 5A2QZ 3R61A 5ED4A 1STZA 5E8IA 5LBQA 4L9NA 2CO5A 1J7KA 4EGYA 2Z33A 1L0OC 2EA2A 2A3SA 3JAMK 3L09A 4IHSA 4I09A 2EB7A 2CQKA 3LAJA 3B73A 3KP3A 3GUDA 5D5XB 1V4RA 4BHCA 4I2OA 2EA4A 5ICCA 2ETHA 5ICEA 4B8XA 4DNCA 4IRGA 2HQNA 1S3JA 3H92A 2IVMA 2ESNA 3KP4A 1O3QA 1IRGA 2AS5F 4HQMA 2PLYA 4RAZA 5HLGA 1SD4A 4XRFA 1HW1A 2DU9A 5FGMA 2O03A 3V7CA 2A68F 2F5CA 5LLQA 3L2CA 2EV0A 5K5OA 1TNSA 2JRTA 1DPRA 3CTAA 4UVCA 2XVCA 3D5LA 1K79A 1ZRCA 3TKYA 2RNJA 3R4KA 4G7ZF 2P7VB 2EFOA 1XMKA 5D6EA 5E18F 3I5UA 3NRVA 1XGMA 1YW7A 2KRFA 5H6RA 4LD5A 5IT9Z 1XDUA 1DP7P 5L3FA 4HOBA 4MHGA 4I7HA 4KMUX 5L3BA 1T98A 2Z9OA 2K27A 4BQAA 1XMAA 1IN6A 1BJAA 3WTYC 3GYHX 4YFNF 1MKMA 3HTSB 1IW7F 1OYYA 1OYWA 3HYIA 3E5UA 1IRFA 2FMYA 1HKTA 2CYYA 5A2QK 4UVBA 4BNCA 2EK5A 2L3DA 1ZYRF 1P92A 3ZMUA 3I64A 2DK5A 3E6DA 1B6AA 1TNTA 3FMRA 3PQJA 2XASA 4G7OF 3IWFA 1XDSA 4LB5A 2D45A 1XD7A 3FMQA 1H9GA 3ERED 3I59A 5TJJA 2HS5A 4A0YA 4A6DA 4M9XA 1HW2A 3ROUA 2D1HA 1W7PD 2RVCA 5HLHA 1FSHA 1FPQA 5TRDA 1JGSA 3F8NA 5IT3A 2RQPA 3I71A 2KIMA 1O57A 2UZKA 4LGWA 3ZMSA 5E1ZB 5EEGA 3CUQA 4L0YB 1Z9CA 4RGRA 1WI9A 1EH7A 2HEOA 2FBKA 3FXRA 4MQVA 2K4BA 3DP7A 5HS8A 3JTHA 1OKRA 2Y75A 4GYIA 4NQWA 3DPLC 4LLGF 3MAJA 1H9TA 1F4KA 3K69A 1PDNC 2TDXA 5HDNA 4I0AA 3IWZA 3GFMA 4L9VA 3JSOA 2EFWA 3QU3A 5HDGA 3LSTA 2HTSA 3C1DA 1FT9A 4IRIA 1OMIA 2BV6A 3BWGA 3DKWA 5IT9K 3GX4X 4Q5SF 3RTRA 4BHPA 2OZUA 3VODA 2R7FA 3KLNA 1JHFA 1B9MA 4Q47A 3EQLF 3LWFA 1KQ8A 1V3FA 1G4DA 2QUFA 3KLOA 4KIBA 4KIGA 3I4PA 4LFUA 4EJOA 2RDPA 1XB4A 4ESJA 1ZRFA 4GXOA 5LEKA 4R8HA 4EVIA 4AVPA 3KE2A 1BBYA 5L3GA 3NQOA 2XAGA 2H09A 4KN4X 3M7GA 4QWQA 1KU9A 3ELKA 2BEOA 1RIOH 3WTUC 1UB9A 3F72A 3WU0A 2ZO4A 4YIIA 5FD6A 2FU4A 1XGNA 1ZHFA 1ZARA 1SMYF 4KA4A 4MEXF 4AWXB 5K5RA 1G6NA 3M1EA 1GHCA 4EM1A 3E5XA 4PCQA 2CWEA 4ETSA 1REPC 5FB2A 3RKWA 2E7XA 1HQCA 4CO8A 5AIPA 1KGSA 3MZYA 1RUOA 3COAC 3N4MA 1WKMA 4KNYA 3R6SA 2DW4A 1NHAA 2Z3YA 3ZQ7A 5CJ9A 2P7CB 1UHMA 2DAOA 1O7LA 3C7JA 3L9FA 2Q0OA 3QOPA 3ZMVA 5E1XA 1R23A 2VC0A 1BC7C 3KP7A 4XSZF 1E2XA 2IW5A 1U78A 1E17A 1HBXG 2BBYA 2MH2A 2L02A 1Z1DA 5CVUA 3V4GA 4EJUA 3CUOA 1HW5A 2A6EF 4HX7A 1O3TA 2M87A 1MDMB 4CZZA 4LG0B 4OIPF 1ZGAA 1YS6A 1MZBA 3JSPA 3MWMA 5ILVA 2GQQA 2OD5A 4XLNF 1JE8A 4IVNA 1SFXA 3ZMDA 3GF2A 5FD5A 5J6XA 4Y17A 5D5VB 2NNYA 3HHGA 3E6BA 3O2PE 3KETA 4KFCA 4U0YA 1W5SA 3HRSA 3F3XA 2GWRA 1QO0D 3HSFA 1FOKA 3HOSA 1LDDA 2V6CA 4PZJA 1TQMA 1J9IA 2QM3A 5BPIA 4HF2A 2KJCA 1UHWA 3RYPA 3D0SA 2X4HA 2FE3A 2V9VA 1IN7A 2COMA 3NEUA 2GA2A 2ISYA 2STTA 2PBIA 2VOOA 4CDGA 3EUHA 1K78B 2IRFG 4IXAA 4I02A 3CJNA 3K0LA 4M6YA 1TLHB 1R5HA 4I01A 4MEYF 2P8TA 3O3KA 4P55A 2HQRA 1W7PB 1FBUA 4UHTA 1S6LA 2HWVA 3TO9A 1R1VA 3ABTA 4N9HA 4HLYA 1FZPB 3BPXA 3F8FA 2IA0A 5JFRA 1J75A 4FHTA 2HOEA 2F5EA 2NNNA 2OQGA 3EDPA 1WRJA 1U2WA 2XAHA 3ZP5A 1SD7A 4OINF 3TOBA 1CF7B 3T5XA 3IC7A 3FF5A 1D8JA 1R7JA 2VBXA 3VFZA 2STWA 1IN8A 1IZ1A 5CVVA 5E20A 1YLFA 1K6OA 4M73A 4OMYA 3I58A 4E70A 3ISPA 4N9IA 1PUEE 1C0WA 3FHZA 3QU6A 3QPTA 1QNTA 1LDJA 4M9ZA 1FWZA 3DFGA 2FBIA 3HRUA 3DEUA 3G73A 4EJWA 2FEZA 4P9FA 3WE3A 5FLXK 1USSA 4IF4A 1RNLA 4RGXA 1LEAA 1U8RA 3HRMA 2HYGD 1KU2A 5F6FA 1U5TA 1BI3A 2ZFWA 3BJOA 1LDKB 5LHGA 4PDKA 2M1BA 1O3SA 2XROA 3KEQA 4KICA 1ZLKA 1G3YA 3LAPA 1UFMA 4Y13A 4YFKF 1I1SA 5BOXA 4U7DA 1D5VA 1FLIA 4M9SA 2FQ3A 3FZVA 4Q48A 2H94A 1P4AA 4GCVA 4U0VA 1KYWA 1VTNC 2PMHA 2ADUA 2RC4A 3SFZA 3W6JB 3LA2A 1J59A 3FXUA 1MJ9A 3CDHA 5E8GA 5HOOA 5ICGA 4MNUA 2EWNA 2PI0A 3RDIA 1YTYA 4BHBA 3KP2A 3K1NA 2ESHA 3GEZA 4O6JA 1EH6A 2W84A 1KQ9A 2W85A 3QP5A 3IHUA 4ZH4F 3V8JA 1B4AA 4G6QA 1SFUA 2ZBKA 4WF2A 3RPQA 1TBXA 4KT5C 1HSJA 3T0YA 1RI7A 1PP8F 3P9KA 4WWCA 4GYGA 4JK1X 4ASNA 3WTTC 2YR2A 3HIFA 3U9GA 5JI6A 5ICFA 4EJTA 2VC1A 4EM0B 2YPRA 3ECHA 3S2WA 4I98B 3KZZA 4ON0A 2P6TA 1OYIA 1O3RA 2GIVA 5DCMB 2KJBA 3OV8A 2A6HF 1SD6A 5LGUA 2PN6A 1FYKA 1IN5A 1FC3A 4YIFA 1LJ9A 2CSOA 3PQKA 4ZZLA 1LB2A 3GW2A 1S7AA 2XRNA 2ZXJA 1B9NA 5E1WA 4AIHA 2FF4A 3GVAA 1KU7A 2GXBA 3K2ZA 1R36A 1KA8A 2HZTA 3RKYA 2VBYA 2ZMEB 5DDGA 2XIGA 1SFEA 5CYVA 3T8TA 3F8MA 1Y0UA 3RPUA 1BI2A 4M6XA 2Z5UA 2HFHA 1YW8A 4HX4A 4MTEA 1TW2A 3TOAA 1T39A 1QPMA 3ZN0A 1ZRDA 2VN2A 2FMLA 2GAUA 1MGTA 5JHUA 3RI4A 2ACJA 2HTJA 3SHFA 5LHIA 1K7AA 2ZKZA 5H20A 1D3YA 2R3SA 2JPBA 1FBQA 3DV8A 1KU3A 3KFWX 3WU1B 3R60A 3BZ6A 5DEQA 4UVAA 5LHHA 2G7UA 2W25A 4HBLA 1Z7UA 3WGIA 4G6DA 2IA2A 3TDUC 3R0JA 1I6XA 1W5TA 3W6KB 2WV0A 5DUKA 4HV6A 2K02A 4ENKA 1MD0A 2K86A 4LB6B 3MCZA 3M9AA 4A6EA 2HDCA 2UWMA 2V1DA 2DBBA 1T2KA 5LRRA 5D8LB 1ZG1A 1L3LA 3HSRA 3BP8A 4KDPA 4OIOF 4HV5A 3P7NA 4LG0A 2VBZA 1MJAA 1T38A 3EYYA 3MQ0A 5DYMA 4HDUA 5D4RA 3KZYA 2Q2EA 2MD5A 2Y48A 2P5LC 2A5YB 1U3EM 1ZREA 3L00A 3E3VA 4IJAA 2JPCA 5HLIA 3L7WA 4KMFA 1R1UA 1IAWA 4CHUA 3IRRA 3CO6C 3DPTA 4KUMA 3J80Z 3J81Z 1R1TA 2K7LA 1YFHA 5D4SA 2QVOA 4JBAA 2DTRA 4WCGA 3HUGA 4WX9A 2LSOA 2L54A 4S04A 2J5PA 2F5DA 1OPCA 2L4MA 4BXUA 1DPUA 2CW0F 1LNWA 3IKTA 1U5TC 3LA7A 3HOTA 5ILSA 2Y0MA 2RV8A 5KVRA 4M74A 5BS6A 3Q9SA 2MLGA 1BC8C 2FXAA 3QAHA 3WGHA 4RS8A 1IN4A 3ZMTA 5DD4A 1DUXC 3KEOA 2PMUA 1Q1HA 5BQTA 4YG2F 4XLPF 2FSWA 3GFJA 3EYIA 2A61A 3WODF 4A0XA 1K78A 2EV5A 1TW3A 1R58A 4ZYGA 2OAZA 4L18B 3PFIA 2V1XA 3U1DA 4CGZA 1YW9A 2MBFA 1LVAA 5D5UB 1G3WA 3B02A 4WXHA 1O7FA 4G94A 4D0PA 3K1PA 5JR3A 3J7AO 5AONA 2VE9A 4RGSA 1R22A 2KIFA 3IRQA 3P9IA 2A69F 4L9TA 4HAMA 1I5ZA 4P96A 2ZNZA 3R0AA 1GXQA 5HS9A 1CF7A 1BI0A 2Q8KA 3IL2A 3FX3A 1SD5A 2DPDA 4G8XA 1YQAA 1HKQA 4OIQF 4EMSA 3FM5A 1YO5C 2WTEA 1FBSA 4EM2A 4FX0A 3SZTA 1ZG3A 3TO6A 3HRTA 3RJPA 3F6VA 2XKPA 3TO7A 1ZAOA 1IXSB 2PJPA 3WGGA 4YFXF 2UXNA 2YX7A 3OOPA 3JAMZ 1WSUA 3WTZA 3E6MA 2CGPA 4O3MA 2JZYA 1FSEA 1DDNA 3T8RA 4BH9A 4UNOA 1BM9A 3F23A 1SAXA 4R1HA 2LKPA 2DK8A 3V8KA 1P2FA 5CVRA 1IXCA 2X0LA 2QWWA 2CFXA 4GGGA 1WWXA 4Q4ZF 3BOQA 2MLKA 3CUQC 3C3WA 2WWYA 3WTWC 2XAJA 1QZZA 1YYVA 2NRAC 2XV4S 2Z99A 3VB2A 3F21A 2FOKA 2LF8A 4ESBA 2QENA 1TTYA 2H6BA 5ERIA 1CGPA 2QQAA 4U0WA 2W57A 2R7DA 1QGPA 1KQ0A 3HHHA 2LNBA 1BOAA 4K2EA 1HXDA 4O5VA 1AWCA 5KK1A 2XHKA 5K5QA 4A12A 4UXNA 1FX7A 2VT3A 4A5NA 3IKVA 4BAYA 4QLCU 4R79A 4F7ZA 3GLXA 3ZN1A 5H6QA 1MJBA 2VXZA 2VOPA 4B09A 3G3ZA 2HKXA 3V7RA 2DFIA 1XSXA 4L5JA 1FY7A 2VODA 5HVQC 4IRHA 5FFZA 5F64A 1B1BA 4PGHA 2YU3A 2M30A 1SMTA 1ZGJA 3BY6A 2QZ8A 5DCMA 3ULQB 4HW0A 2NYXA 1TQPA 1B59A 5HS7A 3WTVC 4ESFA 1YIOA 3V7SA 4AD9A 4P5OA 4ENMA 1S7OA 1Z05A 3ZPLA 5L3CA 2XUBA 3FMSA 3MEXA 2G9WA 5D6FA 2MH9A 4RB3C 2F5FA 2DPUA 4RAYA 3U2RA 2BYVE 4NB5A 2UXXA 1RUNA 1XGSA 1Z6RA 2G7HA 4AIKA 4LMYA 2B0LA 2ZMEA 1EV7A 3H3ZA 2QBYB 4KIFA 5FO5A 3F6OA 2NAZA 1EH8A 1J0RA 4EV0A 4RB2C 3BPVA 3WE2A 4CYDA 4HYEA 1HKSA 3GZ5A 2FBHA 2D1VA 2M5WA 1J2XA 2ZNYA 1LEBA 3ABUA 1P6RA 3TDZC 3HTUA 2EFQA 3I53A 3E5QA 3TQNA 1U5TB 1P4WA 2E1NA 2DO7A 4MTDA 1IXRC 1GVJA 3QP6A 1H0MA 2GA1A 5DD8A 4BYYA 1BN5A 2RN7A 4ENNA 1F9NA 2VBWA
chains in the Genus database with same CATH superfamily
2K3FA 3DXJF 5ILUA 4HG2A 4V19K 4FTHA 5J4VA 4S05A 4E7SA 1U9OA 2JTVA 4LK0F 2CG4A 1N77A 2OZ6A 4ZYHA 5DCFA 4L9JA 2HZDA 4DQ2A 2DT5A 1IUYA 1FP2A 3D1NI 2BOLA 4IPAA 4HQEA 4NHJA 3SQNA 3RYRA 1M1EB 3ML6A 4H0EA 3OYIA 2O8KA 2LF7A 4LLLA 1YG2A 3FXOA 2NS0A 1QBJA 2XF7A 3HGGA 5CVIA 2E2HJ 4HEA2 3FXLA 3MFKA 1T6SA 2B7EA 4XORA 3DPUA 3WTSC 4XMYA 1J5YA 2KIUA 4L5IA 2EV6A 3LSHA 2CU7A 4XKVA 2ZB9A 4OMZA 2LC2A 1TWGJ 3JW4A 3CCEI 2H6CA 4C2MJ 4M72A 2MA3A 3P9CA 2LH9A 4X0GA 1Z6TA 2GZWA 3B6AA 4KN7X 3ZQQA 1MBEA 5D5WB 5BPDA 2Z2SB 4LG3A 3F8CA 4BE0A 4LK1F 1YRNA 2GM4A 2OBPA 2OA4A 3FXQA 1ETXA 1IGNA 3EUHC 2KRCA 5KNLA 3KP6A 3I0TA 3AL0C 1SANA 2LDUA 1R00A 3GXOA 2JT1A 2FOWA 5D8KB 2X51A 4G9YA 1HCRA 3OYMA 2AXLA 2OF7A 3GZNB 4M71A 3T1BA 3VSLA 1UCRA 2E7WA 4UV8A 3LA3A 2COBA 3HOXJ 4HF0A 2IA1A 3H5NA 5HNFA 3CLOA 2VT2A 3OSFA 3LSMA 5HODA 2BGCA 4C2UA 2KKOA 4NBQA 2M4GA 5FLMJ 1Z67A 1A6IA 2X9DA 3BROA 3HOYJ 4A3KJ 2V79A 2W24A 4JQFA 2HXOA 3E6CC 3BTIA 2L5QA 4LLNA 3I55I 3HOVJ 4IHTA 2RQQA 4I0BA 1UZCA 2FA5A 2IJLA 1AA7A 2D2WA 4WXDA 1S8NA 5E17F 1MBHA 3HL2A 5LRSA 3LQQA 2V1UA 1Z91A 3PSIA 1USTA 4EJVA 3KIOA 1PP7U 3K4JA 4A3GJ 4EGZA 2WAFA 2ZXWH 2VONA 4EATA 5EDNA 1JHHA 1PVEA 1T56A 3HGYA 4E7HA 1FOWA 1RR7A 4BQQA 2FRHA 3F8BA 3I59B 4RB0A 4ANJA 1JUMA 3PUBA 1MMNA 3BDDA 5FKKA 9ANTA 1ZGWA 1B72B 1AKHB 2NVQJ 2P5KA 2JJ7A 3GMEA 1ZR2A 3KCCA 2LP0A 2M0MA 4KYWA 1MDMA 1MSEC 1VQKI 2HDWA 4FT8A 3FXKA 2QQ9A 3LL7A 1FYLA 1P7JA 1F43A 3OL4A 2X48A 5L3EA 2XSDC 3BR1A 5DUIA 3FDYA 1G3SA 1A04A 5HDKA 4WK8F 2XGEA 3QQAA 1X3ZB 3CUQB 2RAEA 5LEJA 4MGRA 2QQBA 2YSRA 1ETYA 1IF1A 1F5TA 1S29A 4AYBA 1JXSA 3GFLA 3OYNA 2EZLA 3C2GA 4W1UA 1FNNA 1AOYA 5EG0A 2R7VA 1TT0A 2DQRA 3DQVC 2O0YA 3LSIA 4EQQA 3AG3H 3JRDA 2KDOA 4AVZA 2QYOA 4F3QA 5DM7F 4A5MA 2P5VA 1XX5A 2XGDA 3PFYA 3BR2A 2EIMH 4BDZA 1GUUA 5LGTA 2YX4A 1SC7A 4PSWA 3MD2A 4MQ9F 4IOAF 3BT9A 1BOBA 2EIKH 4GDFA 4ENJA 6PAXA 4BBSJ 1W5CC 3MZHA 2HYFA 4N0BA 2C6YA 3OYBA 2ZJRF 1JT0A 5FFXA 1WQ2A 2L9SA 4RGUA 4P9UA 2O6GE 3M4OJ 2KLOA 3Q3SA 2FX0A 5B66C 3L1PA 1JKQC 2RKHA 1QPIA 3FXJA 1T0FA 2F2EA 3BJAA 4N4NB 4J00A 3O6BB 5F1RA 2LD5A 2L7FP 3F0CA 1W4MA 2O8XA 3GWZA 4XSXF 1ULYA 1R71A 4UUTA 2HR3A 3GO5A 3FK6A 1UHSA 1I27A 2CUEA 1BJZA 4D5CA 1BR2A 3DF8A 1D8KA 4E4HA 2HPMA 4WXCA 4AIJA 5K1YA 2HVRA 2ISZA 2VQCA 4U88A 2IP2A 4CCJA 4M3GA 5L3DA 2OQRA 2HKOA 2WADA 1Y8RB 4G7HF 3RKXA 2ZJ2A 3JRIA 1B8IB 4HA8A 4UUVA 1BIBA 1ACIA 4Z2YA 1D1CA 1U9NA 3CD6I 3N97A 2DCEA 4HZFA 3VOEA 3REOA 1OR7A 1W7PA 4HDVA 4FX4A 2CFOA 3LQRA 2WAEA 4PFPA 2XPVA 1EJ9A 3ZMZA 1I6HJ 2AO9A 4PGGA 5JHFA 3EUKL 2M45A 2M8GX 2M8EA 2XPWA 3DU5A 5FKOA 2JSCA 3S16J 2WV1A 3E97A 2ID3A 4XBFA 3F22A 3ECOA 1W1WE 1ZLJA 3OR1C 1F1ZA 3FM3A 5GTIC 2HGCA 5GAHJ 2J5OA 1XGOA 3M8FA 2MC3A 3ZGKA 2EFPA 4IX7A 2A07F 3G2BA 5DV5A 4BE2A 3OS2A 3QRFF 2NS8A 3S32A 3OSGA 3RZDJ 1QQIA 4M3DA 4ZZDA 1BI1A 2HQAA 4FE7A 1IO2A 2G0EA 2IGOA 2RREA 2H8RA 5GPCA 4OIRF 3GTGJ 1ZH5A 2V7FA 4XOPA 2VQLA 3M8EA 4HF1A 3Q9VA 4XKBA 3SXYA 2IPQX 3GTKJ 2EPFA 2PFBA 2EFNA 1FIAA 1ONVA 4HSTA 2CV0A 4Y15A 2IT0A 3Q5FA 5CLSA 1KONA 3UR3C 4ZDOA 3CCJI 5FLXZ 5IP9J 1Y1VJ 2PG4A 4OU0A 3H3UA 3OS0A 5J40A 2L01A 1BR1A 3DCFA 3J80K 4OOIA 1ZG5A 3J81K 1OFCX 2YUSA 1ODDA 2H27A 4CXFA 2YU9J 1R5GA 2CMPA 5FRMA 1QZYA 4XK4A 5IYCJ 2L4AA 2LY1A 1X3UA 2DI3A 1ZN2A 2CS3A 2QLZA 2B63J 4BQNA 3MKLA 3CF2A 1MIJA 1VNDA 1WJAA 2E1CA 4CICA 1Y6IA 4L0ZB 3GFIA 2MSYA 1G3TA 3C18A 4LIVA 2ELHA 4CYCA 2XF5A 3GZ6A 2E35A 2VJIA 5AIQA 3I56I 4BXFA 2GXGA 3HEFA 2E5ZA 4HX8A 3HXLA 3QYBA 4TV7A 4UV9A 1YX5A 2DA3A 2V4JC 1XCVA 2ZCWA 3HC7A 2O3FA 3ZRGA 2PEXA 2E60A 3EPZA 1OCPA 2LY2A 4A2UA 4U7BA 1ZQ3P 5LGNA 3HOWJ 1JTYA 3BCAA 2VE8A 2BE5F 4LJZF 4ZYDA 1I1GA 3DBLB 4EEFG 3SEZA 3SZGA 2GXAA 5BMZA 3BJ6A 2JN6A 4A0ZA 4BS9A 4KJZA 2PQ8A 4BJTA 5J8FA 4IEJA 1XCBA 2XKOA 2EBIA 3I54A 5J8CA 4CUGA 2V26A 2WC2A 1RR8C 3G4SI 1T8IA 1U6GA 3VEPA 3FWEA 5C4XJ 2ID6A 4A3FJ 2FNPA 1TWAJ 1VQ9I 3QPHA 2OU2A 1S7EA 3DLAA 1WJFA 4QPQA 5CQGA 2DLLA 1ETOA 4DBQA 2XAQA 2XAFA 1ON1A 3H5AA 1KYZA 1TQIA 3WG9A 2VB6A 4GO1A 3BQZA 2JQ7A 1LQ1A 2K4JA 1BIAA 2XGXA 3K4NA 3W2AA 1TWHJ 1ON2A 3WTXC 3HSEA 4KISA 1K83J 1XSDA 1RZ4A 2EJRA 3WG7H 3CO7C 1IDZA 2DQLA 4RB1A 3CJQB 3JTGA 2P4WA 3CC4I 5CVJA 1GV5A 1RKWA 2FNAA 2DODA 3RIRA 2N8GA 2X1CA 4HLXA 2RGVA 1FP1D 1XSVA 5EEHA 2R7WA 1IDYA 2AHQA 2O61A 2VPRA 3K1MA 3W3CA 3TGNA 1UJ8A 3KP5A 1HSTA 3EETA 3AG1H 2EZIA 3JRHA 3M3YJ 3V8LA 3SZPA 3AAFA 2R5YA 2L9VA 1FYMA 5JVTA 1YS7A 3RPUD 3PM1A 2MYSA 1P4XA 1XN7A 5IP6A 3K9TA 2Y0SA 3MVPA 2DMNA 4II3A 1GXPA 3LFKA 2QBYA 4ZYEA 3S3NA 3AL0B 2P6SA 5LFAA 2KL4A 5A2QZ 2FUG2 5M5XJ 3R61A 5ED4A 1MMDA 3TW6A 1G59A 1STZA 5E8IA 5C44J 4AC0A 4B1RA 4XRSA 5LBQA 2HDDA 4L9NA 3GLLA 2WB1A 3HM5A 3OYKA 2CO5A 1J7KA 4EGYA 3TMOA 3H9GA 3DBHB 3AKZA 3ABKH 2X6XA 2Z33A 4E7JA 1L0OC 3K4BA 5DM6F 2EA2A 4A3BJ 2A3SA 3JAMK 3L09A 4IHSA 4I09A 2EB7A 2CQKA 1HOMA 2I10A 3LAJA 3B73A 3KP3A 1RRJA 1YJ9I 1LFUP 2W7NA 3GUDA 5D5XB 3CZ6A 1V4RA 4BHCA 2JA2A 4I2OA 4PJNA 4XN3A 2EA4A 3G1MA 5ICCA 2ETHA 5ICEA 4E7IA 4B8XA 4DNCA 4IRGA 2HQNA 1S3JA 2DJNA 4LIUA 3H92A 1MNEA 1X19A 2X6OA 2BHZA 3KPHA 3BG9A 2KPMA 1I50J 4S0HB 2IVMA 2ESNA 3KP4A 4DYRA 1O3QA 1IRGA 2AS5F 1K61A 3A0HC 5CPRB 5GAGJ 2DFHA 4HQMA 2PLYA 4RAZA 5HLGA 2K3PA 3CCLI 1BL0A 1SD4A 2DYRH 2KT0A 4XRFA 1HW1A 2DU9A 5FGMA 4E7KA 2O03A 3V7CA 4PFOA 2A68F 2F5CA 3S1NJ 2V9KA 5LLQA 3L2CA 2EV0A 5K5OA 2BXYA 1JTXA 1TNSA 1JUSA 3OOUA 2JRTA 1VQ5I 4NC6A 1DPRA 3CTAA 1R4MB 1D0XA 2XVCA 4UVCA 3D5LA 2NOGA 4CZCA 1K79A 1H88C 1NK2P 4A3DJ 1ZRCA 3TKYA 2RNJA 2QGUA 3NWSA 3R4KA 2MC4A 4PSXA 4G7ZF 2P7VB 4ZDPA 2EFOA 1XMKA 5IYBJ 1K4TA 4FETA 3SYTA 5D6EA 2DA7A 5E18F 4C9YA 4L5EA 3KX2A 1YJWI 2HVQA 3U21A 1YOVB 3I5UA 3NRVA 1IJWC 4C3IJ 1LUJB 4XKCA 1XGMA 4FCYA 1YW7A 2KRFA 5H6RA 4LD5A 2Y2ZA 1XDUA 4E7ZA 5IT9Z 1DP7P 3S1MJ 3O8HA 5L3FA 4ZC3A 2GOMA 4HOBA 4MHGA 4I7HA 4KMUX 5L3BA 2QF7A 1T98A 3G71I 1JT6A 2Z9OA 3BTLA 2K27A 2BXZA 1XMXA 4BQAA 2RNGA 3EUAA 5TISC 1XMAA 4G6TB 1IN6A 1BJAA 3WTYC 3WU2C 1OR7C 3N05A 2P81A 3GYHX 4YFNF 1MKMA 2FQ4A 5J1UA 3HTSB 1IW7F 1OYYA 1WPKA 1OYWA 4XRMA 3HYIA 1T95A 3DTEA 5JVGF 2K40A 3E5UA 1IRFA 2FMYA 1HKTA 2R7TA 2DOAA 2CYYA 3HPHA 3K4CA 2XGCA 5A2QK 4UVBA 4BNCA 1EF4A 2EK5A 2L3DA 1ZYRF 2L7MP 4RLQA 3PNTA 3PUFA 1P92A 3W6VA 1APLC 1BW6A 3ZQHA 3Q0UA 3ZMUA 3HKZA 1UG0A 3I64A 2X85A 2DK5A 3E6DA 1B6AA 2EZKA 2O7OA 3A03A 1TNTA 3H5RA 5GPAA 4ZYAA 5M3FJ 3FMRA 1W36C 3PQJA 2XASA 4G7OF 3IWFA 1XDSA 2ME0A 4LB5A 2D45A 1XD7A 1U8BA 3FMQA 3H35A 3HG9A 2K9LA 1PYVA 5KAFC 1H9GA 3LSRA 3ERED 3I59A 2R5ZB 3CP8A 1VF9A 5TJJA 1K6YA 3A02A 4FISA 2HS5A 1B72A 3G1OA 2HQ5A 2E1OA 4A0YA 4M9XA 4A6DA 1HW2A 3ROUA 2CH0A 1LVKA 3DTKA 2D1HA 3SEQA 1W7PD 2RVCA 5HLHA 1FSHA 1ETVA 2DT6A 2F4MB 1FPQA 3LSGA 5TRDA 4DJAA 1JGSA 3F8NA 3IAS2 4BGDA 5IT3A 3RQIA 2RQPA 3PIOF 1NG7A 2ME6A 2M2EA 2KZVA 3I71A 4B4CA 3DTIA 2KIMA 4I76A 1O57A 1DP3A 1V5FA 2UZKA 4LGWA 3ZMSA 5E1ZB 5EEGA 2PJRA 2HNHA 2AQEA 3CUQA 1V55H 4UB8C 4L0YB 1Z9CA 3HZJA 2H1LA 4RGRA 1WI9A 2R7ZJ 3BG5A 1EH7A 1XTAA 2HEOA 2Y30A 2ZXIA 3A1YA 1W36D 2FBKA 2CQ7A 2VJ4A 3FXRA 4MQVA 2K4BA 3DP7A 3CMEI 3S1QJ 5HS8A 2XSJC 1JKPC 3JTHA 1VQMI 5E3NA 3K70C 2ZSIB 1OKRA 2OTJI 2Y75A 4BE1A 2WAQA 4GYIA 1VZ0A 1YJNI 2DA5A 4NQWA 2IGKA 4NC7A 2VKVA 3DPLC 4LLGF 3MAJA 3MKYB 1H9TA 1F4KA 3ZQCA 3K69A 1PDNC 2XF6A 2Y31A 3GCMA 2TDXA 5HDNA 4I0AA 1HA8A 2L7ZA 2L9RA 3IWZA 3GFMA 4L9VA 2R7XA 3A0BC 3CDIA 3JSOA 2EFWA 3QU3A 5HDGA 3LSTA 5CKTA 2HTSA 2OUMA 2VQHA 3M1CA 3OY9A 1QVUA 3C1DA 1U0JA 1FT9A 4IRIA 1OMIA 4MFEA 5FKMA 3J7ZI 2BV6A 4CCOA 3BG3A 3BWGA 3DKWA 5IT9K 1IRXA 1VI0A 3GX4X 3BR3A 4Q5SF 3RTRA 4BHPA 3QYEA 3OYDA 2V6EA 2OZUA 3VODA 2R7FA 3A01B 1LKXA 3KLNA 2MD0A 1JHFA 3K70D 1B9MA 4Q47A 3EQLF 3LWFA 3DBRB 1KQ8A 1V3FA 1G4DA 5EF6A 2QUFA 3KLOA 4KIBA 4KIGA 2LRDA 4BKXA 1TWCJ 2QQ8A 3I4PA 4LFUA 2ELJA 4BJ6C 2RDPA 4EJOA 1XB4A 1Z0XA 4ESJA 4B47A 1ZRFA 4GXOA 1B8IA 1JUPA 5LEKA 2ZXHA 4R8HA 1A6QA 3CCRI 1XG1A 4EVIA 1FOYA 4AVPA 2V9PA 3KE2A 1BBYA 5L3GA 3NQOA 5K7ZA 4ABZA 2XAGA 2H09A 4KN4X 2E2JJ 3M7GA 4QWQA 1KU9A 2LVSA 3ELKA 2BEOA 1RIOH 3IUOA 1UB9A 3WTUC 3F72A 3PJRA 3WU0A 2ZO4A 2EINH 4YIIA 3GTMJ 5FD6A 2OPTA 3UKGA 2FU4A 2MGQA 2Z1DA 1XGNA 1JJ6C 1ZHFA 2LOOA 1ZARA 1SMYF 2QSHX 3IH3A 4KA4A 4MEXF 4AWXB 5K5RA 1WCMJ 3MMYB 1G6NA 2PMZA 2Y9YA 3M1EA 3A4CA 1GHCA 2B9SA 2R4GA 4EM1A 3E5XA 3JCUC 4PCQA 2CWEA 4ETSA 1REPC 4JYKA 5FB2A 2GBYA 3RKWA 4XKWA 1ETWA 2E7XA 1HQCA 4CO8A 1DU0A 5AIPA 1KGSA 3MZYA 4II2A 2ZJPF 1RUOA 3COAC 3N4MA 1WKMA 4KNYA 5GAEJ 3R6SA 2DW4A 1NHAA 2Z3YA 3ZR8X 1VFCA 3ZQ7A 4QSHA 2BY0A 3CC2I 2NVTJ 5CJ9A 5M5YJ 2P7CB 1UHMA 2DAOA 1GT0C 2UV1A 4HNUA 5KCMA 1O7LA 1I39A 3K4LA 1S9HA 3C7JA 2L9NA 3L9FA 2Q0OA 3QOPA 3ZMVA 5E1XA 1R23A 3CCSI 2HOAA 1FTZA 2F4OB 4LITA 3CC7I 3S93A 3BR0A 1GVDA 2VC0A 3LSKA 5DTDA 1BC7C 1Y56A 2LYCA 2R7RA 3BLYA 3SJMA 3KP7A 3OIQA 1MBJA 4XSZF 1E2XA 4J01A 2IW5A 1U78A 1E17A 3QOEA 1IUFA 1YX3A 1HBXG 5K7FA 1AHDP 3BTJA 4Z6YA 2BBYA 5EJCA 1W0TA 2MH2A 2L02A 4RAFA 4XL9A 2OTLI 1Z1DA 5CVUA 3FKJA 3V4GA 4EJUA 3CUOA 2FJ1A 4MLOA 1GV2A 3AFHA 2ZFUA 1HW5A 2A6EF 2VASA 3DWLE 3GBGA 4HRIA 1RPWA 4HX7A 1O3TA 2M87A 3S8PA 4B44A 1MDMB 1EKEA 4CCKA 2D5VA 4CZZA 3CMMA 2HI3A 4LG0B 4OIPF 1YIJI 3VYTB 1X1CA 4UUSB 1ZGAA 1YS6A 1MZBA 2CQQA 3JSPA 1R9TJ 3MWMA 4RMNA 2Q2EB 2DDBA 3WHCA 1A5JA 5ILVA 3JRBA 2GQQA 1G8XA 2OD5A 1VQNI 1X1AA 4XLNF 1JE8A 2ZMEC 4IL6C 4IVNA 5J4YA 1A36A 3MN2A 1Y1WJ 1SFXA 1Z77A 3ZMDA 3GF2A 5FD5A 5J6XA 3ABMH 4Y17A 5D5VB 2HVSA 2NNYA 3HHGA 1LE8B 3E6BA 3O2PE 3KETA 4KFCA 4U0YA 3H3VK 1W5SA 1I3AA 3HRSA 3F3XA 2GWRA 1QO0D 4PJMA 3HUGB 2IEKA 3HSFA 3QPSA 1FOKA 3HOSA 1SAUA 3L2RA 1LDDA 2E5NA 1WGXA 1ETKA 2V6CA 4PZJA 3K6GA 2BW3A 1XPXA 1TQMA 1J9IA 2JWTA 5EYRA 5TGTA 2YS9A 3C2BA 2W48A 1IC8A 2QM3A 1S5LC 4UY8I 5KHDA 5BPIA 5F0CA 4XICA 3TW7A 1QA6A 4HF2A 2KJCA 4NC8A 1XS9A 3VPRA 4NDLA 1UHWA 3S3MA 2F48A 2NOJB 3RYPA 1ORKA 3D0SA 3IAM2 4ITVA 3ZCOA 2X4HA 3LSJA 2CW7A 3CMAI 2M7AA 3HKZN 2JA6J 2FE3A 2V9VA 4NNJA 1IN7A 1RKTA 1X4PA 2COMA 5E3OA 3CJTB 4Y3OA 4XIDA 3NEUA 4M6VA 4BEHA 2GA2A 2ISYA 2LMDA 2STTA 2PBIA 2VOOA 4CDGA 3I4MJ 3EUHA 4MIMA 1K78B 2IRFG 4IXAA 1DGWY 4NUBA 2OV7A 3D5SC 4HPQA 3CJNA 3K0LA 4I02A 4M6YA 1BW5A 1TLHB 3HOUJ 4XQFA 2AQFA 1R5HA 4C3JJ 2WY8Q 1TT5B 3IH2A 4I01A 1SEUA 4MEYF 2P8TA 3O3KA 3L2QA 4BY1J 4P55A 3OYCA 2HQRA 1W7PB 2F5VA 2M4KA 1FBUA 2HYJA 2V1NA 4UHTA 1S6LA 2HWVA 3TO9A 1R1VA 3ABTA 1K4SA 3GTLJ 1ZKGA 3OYLA 4N9HA 4FQGA 2L7KA 2QKLB 4HLYA 4PUSA 3K4KA 1FZPB 4DW6A 1D5YA 3OR2C 1X1PA 3BPXA 2QSGX 2DMPA 3F8FA 1MNDA 1FIPA 1QZEA 2IA0A 3OL3A 5JFRA 3L2UA 1J75A 5B1AH 3IV5A 4A3IJ 3IP4B 4FHTA 2ICWG 3QYFA 4F93B 5F08A 2HOEA 2F5EA 4IKFA 3BZKA 1HDPA 2M0CA 1FMWA 2NNNA 2OQGA 2R7OA 3TL4X 2KQRA 3EDPA 1HC8A 1WRJA 4BACA 2WAQN 1Z3XA 1U2WA 1Y8QB 2E1MC 2XAHA 3ZP5A 1SD7A 4OINF 2L0KA 3TOBA 1CF7B 3T5XA 3H9JA 3IC7A 2IAIA 3FF5A 1D8JA 4C3HJ 1UAAA 3RKQA 1R7JA 2VBXA 5M5WJ 4MFDA 3TBIA 4GFBA 1WJDA 2Y9ZA 4YIRX 2M9HA 3VFZA 2DA6A 2STWA 1IN8A 2CUFA 1QHHD 1IZ1A 1SFKA 4B48A 5CVVA 5E20A 1OCTC 4BU2A 1FEXA 1YLFA 1WJ5A 1K6OA 4XLCA 4M73A 4OMYA 4W97A 3LSPA 2IBDA 3I58A 4E70A 3ISPA 1WJEA 4N9IA 1PUEE 1C0WA 3FHZA 3QU6A 3QPTA 2VQGA 1QNTA 1LDJA 4M9ZA 2X1EA 1FWZA 3DFGA 2FBIA 3HRUA 3DEUA 3G73A 3I9V2 4EJWA 2FEZA 4JX6A 4P9FA 3WE3A 5FLXK 3NAUA 4A93J 1USSA 2XC7A 1BR4A 4IF4A 2NVUB 1RNLA 2VI6A 4RGXA 1LEAA 3E7LA 3JREA 2HU9A 3ASNH 4CYCB 1V5EA 2DJIA 1U8RA 2KZGA 3HRMA 2GOXB 2O5RA 2HYGD 3RQ4A 1KU2A 2EH3A 4AYBN 2FD5A 5F6FA 1U5TA 5IY5H 2H1KA 1BI3A 2ZFWA 3AG4H 3BJOA 1WFXA 2BZTA 1LDKB 3BR6A 2K9MA 5LHGA 4PDKA 2IS2A 2K9NA 2M1BA 1O3SA 2XROA 3KEQA 4M3BA 4KICA 1ZLKA 3H0GJ 3B6CA 2PMZN 1G3YA 2XRLA 2LBFB 3LAPA 3J7AY 1UFMA 4Y13A 1TZLA 1PUFA 4XRSG 2F6CA 1WI3A 2JRMA 3P5JA 4A3CJ 4B3XA 2JA8J 3M07A 4YFKF 1I1SA 5BOXA 4U7DA 3OYGA 2IS6A 1D5VA 2BHYA 1FTTA 5GTHC 1SVMA 4GRIA 1FLIA 4J19A 4M9SA 2FQ3A 1XC5A 3FZVA 2K9QA 4Q48A 1E3HA 5IOZA 4IHVA 2ELKA 2R5ZA 5GADJ 2H94A 1P4AA 2IGNA 4GCVA 4U0VA 1W0UA 1KYWA 1VTNC 2PMHA 2LKXA 2CQXA 4V2GA 2ADUA 2K85A 2RC4A 3SFZA 4RAGA 3W6JB 1AU7A 1WJCA 3LA2A 3U1KA 4BDYA 1J59A 3FXUA 1MMAA 1MJ9A 3CDHA 5E8GA 2ECCA 5HOOA 1ZTRA 2XB5A 5H2FC 1T0FC 3FBIB 2DXIA 5ICGA 1MBFA 4BJ5C 4MNUA 2EWNA 2PI0A 3RDIA 1YTYA 4BHBA 3KP2A 3K1NA 1TL8A 2ESHA 3GEZA 4O6JA 2X1DA 3M8JA 4DIQA 1EH6A 2W84A 2XPUA 4A3JJ 1HLVA 4FE4A 1R6RA 1KQ9A 5B1BH 1T33A 1MNMC 2W85A 2BVMA 3QP5A 3IHUA 3K7AJ 4ZH4F 2R7QA 4F55A 3V8JA 5EEAA 1ITYA 1B4AA 4G6QA 5EGOB 2K5CA 2ZBKA 4WF2A 1SFUA 4DZPA 3RPQA 1TBXA 4KT5C 1HSJA 3T0YA 1N78A 2A6TA 4XONA 1RI7A 2CV1A 1PP8F 3P9KA 2DA2A 2VUMJ 3KZIC 1MH3A 2EZHA 4GYGA 4WWCA 3S2DJ 5J1YA 4JK1X 2W82A 1JGGA 4ASNA 3WTTC 3CF5F 2YR2A 1VQLI 4OAYA 3TEDA 2E71A 3PNYA 3JRFA 3HIFA 3CDLA 3KYLA 4BQOA 3U9GA 5JI6A 5ICFA 4EJTA 4CCLA 1D1AA 2VC1A 3H0DA 4EM0B 1SFOJ 2IS4A 2X6YA 2YPRA 2KISA 3ECHA 3S2WA 4JX4A 3S1RJ 4I98B 3KZZA 4ON0A 3X2QH 2Z16A 2P6TA 1OYIA 3ZQFA 1O3RA 3BTCA 3Q0VA 3A2KA 2GIVA 5DCMB 2KP6A 1JKRC 1H89C 2KJBA 4PJ0C 3OV8A 4YEJA 4CCMA 2A6HF 1SD6A 2VL8A 1MSFC 5LGUA 2PN6A 4DOZA 1FYKA 4AIDA 1IN5A 4RDUA 1FC3A 1D1BA 4YIFA 1DGRM 3QWLA 5E79C 1OISA 4N4OB 4OAZA 1LJ9A 1OCRH 5M3MJ 1AKHA 2E2IJ 4AM3A 3PSFA 1YHQI 2CSOA 3PQKA 4ZZLA 1LFPA 1LB2A 3GW2A 2Q1ZB 1ZELA 5E3LA 2F4IA 1DU6A 1NG6A 1S7AA 4F92B 2DFEA 3JRAA 2DMTA 2XRNA 2ZXJA 1B9NA 1YI2I 5E1WA 1V5GA 4AIHA 2FF4A 2M34A 2UUZA 1WH7A 3GVAA 1KU7A 2K9SA 3GTJJ 4YELA 4Y4RA 2GXBA 3K2ZA 1N25A 1R36A 1KA8A 2HZTA 1EA3A 3FK7A 3RKYA 4CCNA 2VBYA 3VSKA 4B3AA 5F0FA 2ZMEB 3ZQIA 4D7MA 5DDGA 2XIGA 2OJED 4HSRA 1SFEA 2R93J 5CYVA 3T8TA 2IXSA 4QTRA 5F1JA 5FLVA 3F8MA 1MW7A 2KFDA 2DA4A 1Y0UA 3RPUA 2QCOA 1BI2A 2VJ5A 2XB0X 4M6XA 2VPLA 2Z5UA 2HFHA 3DU6A 1YW8A 2IGMA 1T08B 4HX4A 4MTEA 1TW2A 4DYQA 4QPOA 2TRTA 3TOAA 1KZHA 1T39A 1QPMA 3ZN0A 3QPLA 1PJRA 1ZRDA 2VN2A 1Z21A 2FMLA 3OMYA 2GAUA 1MGTA 5JHUA 3RI4A 4Y33A 2ACJA 1ENHA 2DDAA 2DT7B 2HTJA 4RBOA 3OYFA 3SHFA 1HDDC 5J3LA 3K10A 5LHIA 3LOCA 3JRCA 1K7AA 1OCOH 2ZKZA 5H20A 1VQOI 1D3YA 4DGWB 4XOTA 2R3SA 3K4MA 2JPBA 1FBQA 1G2HA 4BBRJ 3CCUI 2Y69H 3DV8A 2QEXI 1KU3A 1VQ6I 3KFWX 4BL0B 4AU7A 3WU1B 2DMQA 2OC6A 5IP7J 2DFFA 3HPGA 4BY7J 3R60A 3BZ6A 3HDDA 1X3WB 5DEQA 4UVAA 5LHHA 2CV2A 2G7UA 2W25A 4IQ4A 4HBLA 3D5RC 1E0EA 1Z7UA 3WGIA 4G6DA 2IA2A 3TDUC 3R0JA 4LOCA 1I6XA 3S2HJ 3HBLA 3CCYA 3K2AA 3BCBA 1W5TA 3W6KB 4DZJA 1TWFJ 1I3QJ 2WV0A 3G6EI 2GIZA 5DUKA 5IOYA 4HV6A 1X1DA 2K02A 4ENKA 4I6ZA 1MD0A 2K86A 2JA7J 4LB6B 3CJRB 3MCZA 3M9AA 4A6EA 2H8WA 4BUPA 2HDCA 2UWMA 2V1DA 4XN0A 2DBBA 1T2KA 5LRRA 5EZHA 5D8LB 1ZG1A 1L3LA 3PO3J 3W2WA 3HSRA 3BP8A 4KDPA 2WA0A 4OIOF 4HV5A 3P7NA 4LG0A 2VBZA 3ZOBA 1MJAA 4A69C 3RCOA 4IHWA 4RLFA 2DOFA 2Y0SN 4UUSA 1T38A 2CW8A 3EYYA 3MQ0A 5CQEA 5DYMA 4HDUA 5D4RA 2E36A 2Q2EA 3KZYA 2MD5A 2Y48A 2PJRB 5K7HA 2P5LC 2A5YB 1U3EM 4ZTJA 1ZREA 1IRZA 2KRHA 3L00A 1X2NA 3E3VA 4IJAA 1YRNB 2JPCA 5HLIA 3L7WA 3PIPF 3PO2J 4KMFA 1R1UA 1IAWA 1MMGA 4CHUA 3IRRA 3CO6C 2WB1N 2E1MB 2DN0A 2TCTA 3DPTA 5FRNA 4KUMA 3BG7A 3J80Z 2LLKA 1UG2A 1R1TA 3J81Z 3OYJA 2K7LA 1YFHA 5D4SA 1LE8A 2LKSA 2QVOA 3KYCB 4JBAA 5F0HA 2DTRA 3OYAA 1MBGA 2QKMB 4NQWB 2LY9A 4WCGA 3HUGA 4WX9A 2LSOA 2L54A 2LR8A 2CRGA 4S04A 2J5PA 2F5DA 1OPCA 4JP0A 2L4MA 1A35A 4D9JA 5HNHA 4BXUA 4RM3A 3SFIA 1DPUA 2CW0F 1LNWA 2DYSH 3IKTA 1F36A 1U5TC 3CESA 3LA7A 3NARA 3ZQLA 3HOTA 3PL8A 1MH4A 5ILSA 2Y0MA 2L2OA 2RV8A 5KVRA 1NH3A 4M74A 5BS6A 3CCMI 3Q9SA 2MLGA 4A3MJ 2FXAA 1BC8C 2OCEA 5J47A 1Y39A 3QAHA 2DOEA 3Q0WA 3WGHA 4RS8A 3I4NJ 2KMUA 1IN4A 3ZMTA 5LD2C 5IPAA 4D5FA 5DD4A 1DUXC 3KEOA 2VLAA 2PMUA 3RZOJ 1Q1HA 4XR6A 4OWRB 5BQTA 4YG2F 4XLPF 1QRYA 2FSWA 3GFJA 3S17J 3EYIA 1OCCH 2A61A 3WODF 4Y52J 4A0XA 3RSNA 1JKOC 2NXNB 1K78A 2EV5A 1BA5A 2ECBA 1TW3A 1D0ZA 1IV6A 1R58A 1Q1VA 4ZYGA 3F9KA 4XLHA 4ZJZA 3CLQA 2OAZA 4L18B 3PFIA 2R7UA 3L2VA 2V1XA 3U1DA 3V42A 4CGZA 1YW9A 2I8DA 2MABA 2MBFA 4M3FA 1LVAA 2W1OA 1JJ8C 5D5UB 3GTOJ 1G3WA 2JVGA 2VJJA 2IS1A 2MG4A 3FXMA 3B02A 3DKXA 4WXHA 1O7FA 2VKHA 3IH4A 4G94A 2JSPA 4D7NA 1OJLA 2NS7A 3FBNB 4D0PA 3LNQA 3K1PA 5JR3A 3J7AO 5EG0B 1VQPI 5AONA 2MFZA 2VE9A 1RETA 3DEWA 4H4KC 1H8AC 3KYDB 4E6KG 2JUCA 1ERDA 1LFBA 2LTPA 4RGSA 1R22A 2KIFA 5KAIC 2LFBA 1X4OA 3JR9A 3IRQA 3HOZJ 3P9IA 4XM3A 1VQ4I 2A69F 4L9TA 4HAMA 1I5ZA 3CQZJ 4I99C 4P96A 3BZCA 2ZNZA 3R0AA 1GXQA 5HS9A 4FASD 1CF7A 1BI0A 2Q8KA 1CQTA 3IL2A 2CJJA 4JOMA 1X58A 4ZTFA 1X2MA 3FX3A 1FOXA 2EQRA 1SD5A 1TP4A 2DPDA 5FROA 4G8XA 2VXDA 1YQAA 1HKQA 4OIQF 2GLOA 2BY3A 2BY2A 4EMSA 3FM5A 3BQYA 4B43A 1YO5C 1OCZH 5DS9A 2WTEA 1FBSA 4EM2A 4FX0A 5FKNA 1WVRA 1WH5A 4KITB 2M3AA 3SZTA 1ZG3A 3CP2A 3TO6A 1UMQA 3HRTA 1J09A 2DA1A 3RJPA 2P0WA 3F6VA 2XKPA 3FKIJ 3S14J 2R7SA 1IG7A 3TO7A 1ZAOA 2E34A 3PNVA 1UELB 2O9LA 1IXSB 3BC8A 1R49A 2PJPA 2BVLA 4JX5A 1E3OC 4D1QA 3WGGA 4YFXF 2UXNA 2YX7A 3OOPA 3FISA 3JAMZ 1WSUA 3WTZA 3E6MA 2ZSHB 2CGPA 2HOSA 4O3MA 2JZYA 3VYRB 1FSEA 1DDNA 1OLTA 4V2FA 5F27A 3T8RA 4BH9A 4UNOA 1BM9A 3F23A 3DEEA 1SAXA 1Z3YA 2JA5J 4R1HA 3L2WA 5GP9A 3OIPA 2KHMA 2LKPA 2DK8A 4F52A 4RM2A 3V8KA 1P2FA 1SVOA 5CVRA 1IXCA 2X0LA 1O4XA 4X1EA 4CH7A 1HF0A 2QWWA 2CFXA 2JK3A 3GTPJ 4GGGA 5JLXA 1WWXA 4Q4ZF 3BOQA 2MLKA 3CUQC 3S15J 5HLTA 1MBKA 3C3WA 3FHNA 3SDBA 2WWYA 1GDTA 3WTWC 2XAJA 4KT6A 2CQNA 1QZZA 2LBFA 3QODA 1DQUA 1ZR4A 1YYVA 2DTZA 2NRAC 3S3OA 4AUXA 1MMSA 1N75A 3LMMA 2XV4S 2EIJH 2VKDA 1GLNA 1RC9A 4IO9F 2XAUA 2Z99A 3VDXA 3VB2A 3F21A 4A3LJ 2FOKA 2LF8A 4ESBA 2LK2A 2KIQA 2QENA 3I3LA 3NWTA 4DBRA 3CMYA 1TTYA 2H6BA 4IZZA 5ERIA 4F91B 1WZ2A 4BXXJ 1WHUA 1CGPA 2QQAA 4U0WA 2W57A 2R7DA 3G1LA 2BW3B 4IQJA 1P7IA 4YRVA 2PX9A 3HJEA 3CCQI 1QGPA 4ZDLA 3W2VA 1KQ0A 2CUZA 3HHHA 1VQ8I 2LNBA 2CUJA 2HXIA 1BOAA 2A5WA 5B5EC 4K2EA 1HXDA 5F04A 3VYSB 1R4NB 4O5VA 5C4JJ 5J1RA 1AWCA 5KK1A 2XHKA 3E0JB 2JMWA 2I5UA 1QVTA 5K5QA 1R5ID 2VIXA 4A12A 1SVLA 3FIWA 4M3EA 4BEHB 4UXNA 4DYCA 4E7LA 4IHYA 4X6AJ 3MZ8A 4C2TA 2ZC2A 1FX7A 2VT3A 4A5NA 3IKVA 4BAYA 5EGOA 4QLCU 3DLLF 2ZJQF 4R79A 3LFUA 3TP3A 4XLAA 4F7ZA 3GLXA 3ZN1A 5H6QA 4IHXA 4CA0A 1LPQA 1MJBA 2VXZA 2VOPA 4B09A 3ERMA 1Z7LA 2WBMA 3G3ZA 2HKXA 3H36A 3V7RA 2DFIA 3H1CA 2JUGA 1XSXA 4L5JA 1FY7A 2OCCH 2VODA 2BY1A 1ETQA 5HVQC 4IRHA 4XNFA 3GTQJ 2EILH 5FFZA 5F64A 1B1BA 1OQYA 4PGHA 3OYEA 3AG2H 2W4SA 2WY7Q 2AXTC 2YU3A 2M30A 1SMTA 1ZGJA 5EZGA 3BY6A 1FJLA 2VKEA 1IV8A 3OIOA 2QZ8A 3HB9A 5FJ8J 5DCMA 3ULQB 4HW0A 3H9QA 1A31A 2NYXA 5JLWA 4IOCF 1QHGA 1TQPA 1B59A 5HS7A 3WTVC 4ESFA 5E3MA 1YIOA 3OYHA 3V7SA 4AD9A 4P5OA 4ENMA 1S7OA 3UNGC 1Z05A 3ZPLA 4PK4A 2XUBA 5L3CA 3FMSA 4PJLA 3CCVI 4CSWA 3MEXA 2G9WA 5BNGA 4HNVA 5D6FA 2NVYJ 5FKLA 3ZXSA 2MH9A 1POGA 4RB3C 5IYDJ 2F5FA 1TC3C 2DPUA 1ZK8A 1P9QC 4RAYA 1VQ7I 3U2RA 2R5YB 2BYVE 2MW8A 4NB5A 1WJBA 2UXXA 1QU3A 1RUNA 1XGSA 1Z6RA 2G7HA 4Y7NJ 2QA4I 1NK3P 3BR5A 1YE9A 4AIKA 3ONQA 4LMYA 1NTCA 2B0LA 2ZMEA 2W00A 3ZQGA 1EV7A 3H3ZA 4XLEA 2X6WA 2QBYB 4KIFA 5FO5A 3ASOH 1FMVA 1V54H 2DMUA 3F6OA 2NAZA 3WHBA 4QIWN 1EH8A 1J0RA 3SDGA 3DKYA 3VYUB 4EV0A 2LG4A 4RB2C 3MKWB 2NVXJ 1JI8A 4A3EJ 3BPVA 3ESWB 3WE2A 4CYDA 2R92J 3OWTA 5B3SH 4HYEA 3TP0A 1HKSA 3GZ5A 2FBHA 2D1VA 2JVHA 2A05A 2XDVA 4HNTA 2M5WA 1X1BA 2R0QC 4XLFA 1S72I 1J2XA 3O8GA 2ZNYA 4PJJA 2HOTA 1LEBA 3ABUA 1P6RA 3TDZC 3ABLH 5C3EJ 3J7YJ 3HTUA 3OS1A 2HPIA 1E3PA 2EFQA 3I53A 3E5QA 4P1WA 3TQNA 1U5TB 1P4WA 1Y0NA 4U87A 2E1NA 2LREA 4RA2A 2DO7A 4MTDA 3E1SA 1RESA 1IXRC 3VWBA 2QSFX 1GVJA 4MO7A 3JRGA 2E19A 2M7BA 3MKZA 3KEYA 3QP6A 1H0MA 3C2HA 2GA1A 5DD8A 4BYYA 1D0YA 2KDZA 1BN5A 2RN7A 4UB6C 3A01A 4ENNA 1PUFB 3BG6A 1F9NA 4C30A 2VBWA 1YITI 4G12A
chains in the Genus database with same CATH topology
3DXJF 5ILUA 4S05A 2JTVA 4LK0F 2CG4A 2OZ6A 4ZYHA 5DCFA 4L9JA 4DQ2A 2DT5A 1IUYA 1FP2A 4HQEA 4IPAA 4NHJA 3SQNA 3RYRA 3ML6A 4H0EA 2LF7A 4LLLA 1YG2A 2NS0A 1QBJA 5CVIA 3MFKA 1T6SA 3WTSC 1J5YA 2KIUA 4L5IA 2EV6A 4OMZA 3JW4A 2H6CA 4M72A 2MA3A 3P9CA 1Z6TA 2GZWA 4KN7X 5D5WB 5BPDA 3F8CA 4LK1F 2OBPA 2OA4A 3FXQA 3KP6A 3I0TA 2LDUA 1R00A 3GXOA 2JT1A 5D8KB 4G9YA 2AXLA 4M71A 3T1BA 1UCRA 2E7WA 4UV8A 3LA3A 4HF0A 2IA1A 3CLOA 2VT2A 2BGCA 2KKOA 3BROA 2V79A 2W24A 4JQFA 3E6CC 4LLNA 4IHTA 4I0BA 2FA5A 2IJLA 2D2WA 4WXDA 1S8NA 5E17F 5LRSA 3LQQA 2V1UA 1Z91A 1USTA 4EJVA 1PP7U 4EGZA 2VONA 1JHHA 2FRHA 3F8BA 3I59B 4RB0A 3BDDA 2P5KA 3KCCA 4KYWA 1MDMA 4FT8A 2QQ9A 1FYLA 5L3EA 5DUIA 1G3SA 1A04A 5HDKA 4WK8F 3CUQB 5LEJA 4MGRA 2QQBA 2YSRA 1IF1A 1F5TA 1S29A 1JXSA 3GFLA 1FNNA 1AOYA 2DQRA 3DQVC 2O0YA 4EQQA 2QYOA 4A5MA 2P5VA 5LGTA 2YX4A 4MQ9F 4ENJA 6PAXA 3MZHA 2HYFA 4N0BA 2C6YA 5FFXA 1WQ2A 4RGUA 4P9UA 2O6GE 2RKHA 1T0FA 2F2EA 3BJAA 3O6BB 5F1RA 1W4MA 2O8XA 3GWZA 4XSXF 1ULYA 2HR3A 3GO5A 1I27A 3DF8A 1D8KA 4WXCA 4AIJA 5K1YA 2ISZA 4U88A 2IP2A 5L3DA 2OQRA 2HKOA 4G7HF 3RKXA 2ZJ2A 4UUVA 4HA8A 1BIBA 4Z2YA 3N97A 4HZFA 3VOEA 3REOA 1OR7A 1W7PA 4HDVA 4FX4A 3LQRA 3ZMZA 4PGGA 2M45A 2M8EA 2JSCA 3E97A 3F22A 4XBFA 3ECOA 1ZLJA 1F1ZA 3FM3A 2HGCA 2J5OA 1XGOA 3M8FA 2MC3A 2A07F 2EFPA 5DV5A 3QRFF 1QQIA 4ZZDA 1BI1A 4OIRF 1ZH5A 4HF1A 3M8EA 3Q9VA 3SXYA 2IPQX 2PFBA 2EFNA 1ONVA 4Y15A 2IT0A 3Q5FA 5CLSA 5FLXZ 2PG4A 4OU0A 3H3UA 2L01A 1ZG5A 3J80K 4OOIA 3J81K 1ODDA 2H27A 4CXFA 1R5GA 1QZYA 2L4AA 1X3UA 2DI3A 1ZN2A 2QLZA 2E1CA 4CICA 4L0ZB 3GFIA 1G3TA 3C18A 2ELHA 3GZ6A 5AIQA 2GXGA 4HX8A 4TV7A 4UV9A 1XCVA 2ZCWA 2O3FA 2PEXA 4A2UA 4U7BA 5LGNA 2VE8A 2BE5F 4LJZF 4ZYDA 1I1GA 5BMZA 3BJ6A 4A0ZA 2PQ8A 5J8FA 1XCBA 2XKOA 3I54A 5J8CA 2WC2A 1U6GA 3VEPA 3FWEA 2FNPA 3QPHA 2OU2A 2DLLA 2XAQA 2XAFA 1ON1A 1KYZA 1TQIA 3WG9A 4GO1A 1LQ1A 2K4JA 1BIAA 2XGXA 3WTXC 1ON2A 3HSEA 1XSDA 1RZ4A 2EJRA 3CO7C 2DQLA 4RB1A 3JTGA 2P4WA 5CVJA 2FNAA 3RIRA 4HLXA 2RGVA 1FP1D 1XSVA 5EEHA 2O61A 3K1MA 3TGNA 3KP5A 1HSTA 3EETA 3V8LA 3SZPA 3AAFA 1FYMA 5JVTA 1YS7A 1P4XA 1XN7A 3K9TA 1GXPA 3LFKA 2QBYA 4ZYEA 2P6SA 5A2QZ 3R61A 5ED4A 1STZA 5E8IA 5LBQA 4L9NA 2CO5A 1J7KA 4EGYA 2Z33A 1L0OC 2EA2A 2A3SA 3JAMK 3L09A 4IHSA 4I09A 2EB7A 2CQKA 3LAJA 3B73A 3KP3A 3GUDA 5D5XB 1V4RA 4BHCA 4I2OA 2EA4A 5ICCA 2ETHA 5ICEA 4B8XA 4DNCA 4IRGA 2HQNA 1S3JA 3H92A 2IVMA 2ESNA 3KP4A 1O3QA 1IRGA 2AS5F 4HQMA 2PLYA 4RAZA 5HLGA 1SD4A 4XRFA 1HW1A 2DU9A 5FGMA 2O03A 3V7CA 2A68F 2F5CA 5LLQA 3L2CA 2EV0A 5K5OA 1TNSA 2JRTA 1DPRA 3CTAA 4UVCA 2XVCA 3D5LA 1K79A 1ZRCA 3TKYA 2RNJA 3R4KA 4G7ZF 2P7VB 2EFOA 1XMKA 5D6EA 5E18F 3I5UA 3NRVA 1XGMA 1YW7A 2KRFA 5H6RA 4LD5A 5IT9Z 1XDUA 1DP7P 5L3FA 4HOBA 4MHGA 4I7HA 4KMUX 5L3BA 1T98A 2Z9OA 2K27A 4BQAA 1XMAA 1IN6A 1BJAA 3WTYC 3GYHX 4YFNF 1MKMA 3HTSB 1IW7F 1OYYA 1OYWA 3HYIA 3E5UA 1IRFA 2FMYA 1HKTA 2CYYA 5A2QK 4UVBA 4BNCA 2EK5A 2L3DA 1ZYRF 1P92A 3ZMUA 3I64A 2DK5A 3E6DA 1B6AA 1TNTA 3FMRA 3PQJA 2XASA 4G7OF 3IWFA 1XDSA 4LB5A 2D45A 1XD7A 3FMQA 1H9GA 3ERED 3I59A 5TJJA 2HS5A 4A0YA 4A6DA 4M9XA 1HW2A 3ROUA 2D1HA 1W7PD 2RVCA 5HLHA 1FSHA 1FPQA 5TRDA 1JGSA 3F8NA 5IT3A 2RQPA 3I71A 2KIMA 1O57A 2UZKA 4LGWA 3ZMSA 5E1ZB 5EEGA 3CUQA 4L0YB 1Z9CA 4RGRA 1WI9A 1EH7A 2HEOA 2FBKA 3FXRA 4MQVA 2K4BA 3DP7A 5HS8A 3JTHA 1OKRA 2Y75A 4GYIA 4NQWA 3DPLC 4LLGF 3MAJA 1H9TA 1F4KA 3K69A 1PDNC 2TDXA 5HDNA 4I0AA 3IWZA 3GFMA 4L9VA 3JSOA 2EFWA 3QU3A 5HDGA 3LSTA 2HTSA 3C1DA 1FT9A 4IRIA 1OMIA 2BV6A 3BWGA 3DKWA 5IT9K 3GX4X 4Q5SF 3RTRA 4BHPA 2OZUA 3VODA 2R7FA 3KLNA 1JHFA 1B9MA 4Q47A 3EQLF 3LWFA 1KQ8A 1V3FA 1G4DA 2QUFA 3KLOA 4KIBA 4KIGA 3I4PA 4LFUA 4EJOA 2RDPA 1XB4A 4ESJA 1ZRFA 4GXOA 5LEKA 4R8HA 4EVIA 4AVPA 3KE2A 1BBYA 5L3GA 3NQOA 2XAGA 2H09A 4KN4X 3M7GA 4QWQA 1KU9A 3ELKA 2BEOA 1RIOH 3WTUC 1UB9A 3F72A 3WU0A 2ZO4A 4YIIA 5FD6A 2FU4A 1XGNA 1ZHFA 1ZARA 1SMYF 4KA4A 4MEXF 4AWXB 5K5RA 1G6NA 3M1EA 1GHCA 4EM1A 3E5XA 4PCQA 2CWEA 4ETSA 1REPC 5FB2A 3RKWA 2E7XA 1HQCA 4CO8A 5AIPA 1KGSA 3MZYA 1RUOA 3COAC 3N4MA 1WKMA 4KNYA 3R6SA 2DW4A 1NHAA 2Z3YA 3ZQ7A 5CJ9A 2P7CB 1UHMA 2DAOA 1O7LA 3C7JA 3L9FA 2Q0OA 3QOPA 3ZMVA 5E1XA 1R23A 2VC0A 1BC7C 3KP7A 4XSZF 1E2XA 2IW5A 1U78A 1E17A 1HBXG 2BBYA 2MH2A 2L02A 1Z1DA 5CVUA 3V4GA 4EJUA 3CUOA 1HW5A 2A6EF 4HX7A 1O3TA 2M87A 1MDMB 4CZZA 4LG0B 4OIPF 1ZGAA 1YS6A 1MZBA 3JSPA 3MWMA 5ILVA 2GQQA 2OD5A 4XLNF 1JE8A 4IVNA 1SFXA 3ZMDA 3GF2A 5FD5A 5J6XA 4Y17A 5D5VB 2NNYA 3HHGA 3E6BA 3O2PE 3KETA 4KFCA 4U0YA 1W5SA 3HRSA 3F3XA 2GWRA 1QO0D 3HSFA 1FOKA 3HOSA 1LDDA 2V6CA 4PZJA 1TQMA 1J9IA 2QM3A 5BPIA 4HF2A 2KJCA 1UHWA 3RYPA 3D0SA 2X4HA 2FE3A 2V9VA 1IN7A 2COMA 3NEUA 2GA2A 2ISYA 2STTA 2PBIA 2VOOA 4CDGA 3EUHA 1K78B 2IRFG 4IXAA 4I02A 3CJNA 3K0LA 4M6YA 1TLHB 1R5HA 4I01A 4MEYF 2P8TA 3O3KA 4P55A 2HQRA 1W7PB 1FBUA 4UHTA 1S6LA 2HWVA 3TO9A 1R1VA 3ABTA 4N9HA 4HLYA 1FZPB 3BPXA 3F8FA 2IA0A 5JFRA 1J75A 4FHTA 2HOEA 2F5EA 2NNNA 2OQGA 3EDPA 1WRJA 1U2WA 2XAHA 3ZP5A 1SD7A 4OINF 3TOBA 1CF7B 3T5XA 3IC7A 3FF5A 1D8JA 1R7JA 2VBXA 3VFZA 2STWA 1IN8A 1IZ1A 5CVVA 5E20A 1YLFA 1K6OA 4M73A 4OMYA 3I58A 4E70A 3ISPA 4N9IA 1PUEE 1C0WA 3FHZA 3QU6A 3QPTA 1QNTA 1LDJA 4M9ZA 1FWZA 3DFGA 2FBIA 3HRUA 3DEUA 3G73A 4EJWA 2FEZA 4P9FA 3WE3A 5FLXK 1USSA 4IF4A 1RNLA 4RGXA 1LEAA 1U8RA 3HRMA 2HYGD 1KU2A 5F6FA 1U5TA 1BI3A 2ZFWA 3BJOA 1LDKB 5LHGA 4PDKA 2M1BA 1O3SA 2XROA 3KEQA 4KICA 1ZLKA 1G3YA 3LAPA 1UFMA 4Y13A 4YFKF 1I1SA 5BOXA 4U7DA 1D5VA 1FLIA 4M9SA 2FQ3A 3FZVA 4Q48A 2H94A 1P4AA 4GCVA 4U0VA 1KYWA 1VTNC 2PMHA 2ADUA 2RC4A 3SFZA 3W6JB 3LA2A 1J59A 3FXUA 1MJ9A 3CDHA 5E8GA 5HOOA 5ICGA 4MNUA 2EWNA 2PI0A 3RDIA 1YTYA 4BHBA 3KP2A 3K1NA 2ESHA 3GEZA 4O6JA 1EH6A 2W84A 1KQ9A 2W85A 3QP5A 3IHUA 4ZH4F 3V8JA 1B4AA 4G6QA 1SFUA 2ZBKA 4WF2A 3RPQA 1TBXA 4KT5C 1HSJA 3T0YA 1RI7A 1PP8F 3P9KA 4WWCA 4GYGA 4JK1X 4ASNA 3WTTC 2YR2A 3HIFA 3U9GA 5JI6A 5ICFA 4EJTA 2VC1A 4EM0B 2YPRA 3ECHA 3S2WA 4I98B 3KZZA 4ON0A 2P6TA 1OYIA 1O3RA 2GIVA 5DCMB 2KJBA 3OV8A 2A6HF 1SD6A 5LGUA 2PN6A 1FYKA 1IN5A 1FC3A 4YIFA 1LJ9A 2CSOA 3PQKA 4ZZLA 1LB2A 3GW2A 1S7AA 2XRNA 2ZXJA 1B9NA 5E1WA 4AIHA 2FF4A 3GVAA 1KU7A 2GXBA 3K2ZA 1R36A 1KA8A 2HZTA 3RKYA 2VBYA 2ZMEB 5DDGA 2XIGA 1SFEA 5CYVA 3T8TA 3F8MA 1Y0UA 3RPUA 1BI2A 4M6XA 2Z5UA 2HFHA 1YW8A 4HX4A 4MTEA 1TW2A 3TOAA 1T39A 1QPMA 3ZN0A 1ZRDA 2VN2A 2FMLA 2GAUA 1MGTA 5JHUA 3RI4A 2ACJA 2HTJA 3SHFA 5LHIA 1K7AA 2ZKZA 5H20A 1D3YA 2R3SA 2JPBA 1FBQA 3DV8A 1KU3A 3KFWX 3WU1B 3R60A 3BZ6A 5DEQA 4UVAA 5LHHA 2G7UA 2W25A 4HBLA 1Z7UA 3WGIA 4G6DA 2IA2A 3TDUC 3R0JA 1I6XA 1W5TA 3W6KB 2WV0A 5DUKA 4HV6A 2K02A 4ENKA 1MD0A 2K86A 4LB6B 3MCZA 3M9AA 4A6EA 2HDCA 2UWMA 2V1DA 2DBBA 1T2KA 5LRRA 5D8LB 1ZG1A 1L3LA 3HSRA 3BP8A 4KDPA 4OIOF 4HV5A 3P7NA 4LG0A 2VBZA 1MJAA 1T38A 3EYYA 3MQ0A 5DYMA 4HDUA 5D4RA 3KZYA 2Q2EA 2MD5A 2Y48A 2P5LC 2A5YB 1U3EM 1ZREA 3L00A 3E3VA 4IJAA 2JPCA 5HLIA 3L7WA 4KMFA 1R1UA 1IAWA 4CHUA 3IRRA 3CO6C 3DPTA 4KUMA 3J80Z 3J81Z 1R1TA 2K7LA 1YFHA 5D4SA 2QVOA 4JBAA 2DTRA 4WCGA 3HUGA 4WX9A 2LSOA 2L54A 4S04A 2J5PA 2F5DA 1OPCA 2L4MA 4BXUA 1DPUA 2CW0F 1LNWA 3IKTA 1U5TC 3LA7A 3HOTA 5ILSA 2Y0MA 2RV8A 5KVRA 4M74A 5BS6A 3Q9SA 2MLGA 1BC8C 2FXAA 3QAHA 3WGHA 4RS8A 1IN4A 3ZMTA 5DD4A 1DUXC 3KEOA 2PMUA 1Q1HA 5BQTA 4YG2F 4XLPF 2FSWA 3GFJA 3EYIA 2A61A 3WODF 4A0XA 1K78A 2EV5A 1TW3A 1R58A 4ZYGA 2OAZA 4L18B 3PFIA 2V1XA 3U1DA 4CGZA 1YW9A 2MBFA 1LVAA 5D5UB 1G3WA 3B02A 4WXHA 1O7FA 4G94A 4D0PA 3K1PA 5JR3A 3J7AO 5AONA 2VE9A 4RGSA 1R22A 2KIFA 3IRQA 3P9IA 2A69F 4L9TA 4HAMA 1I5ZA 4P96A 2ZNZA 3R0AA 1GXQA 5HS9A 1CF7A 1BI0A 2Q8KA 3IL2A 3FX3A 1SD5A 2DPDA 4G8XA 1YQAA 1HKQA 4OIQF 4EMSA 3FM5A 1YO5C 2WTEA 1FBSA 4EM2A 4FX0A 3SZTA 1ZG3A 3TO6A 3HRTA 3RJPA 3F6VA 2XKPA 3TO7A 1ZAOA 1IXSB 2PJPA 3WGGA 4YFXF 2UXNA 2YX7A 3OOPA 3JAMZ 1WSUA 3WTZA 3E6MA 2CGPA 4O3MA 2JZYA 1FSEA 1DDNA 3T8RA 4BH9A 4UNOA 1BM9A 3F23A 1SAXA 4R1HA 2LKPA 2DK8A 3V8KA 1P2FA 5CVRA 1IXCA 2X0LA 2QWWA 2CFXA 4GGGA 1WWXA 4Q4ZF 3BOQA 2MLKA 3CUQC 3C3WA 2WWYA 3WTWC 2XAJA 1QZZA 1YYVA 2NRAC 2XV4S 2Z99A 3VB2A 3F21A 2FOKA 2LF8A 4ESBA 2QENA 1TTYA 2H6BA 5ERIA 1CGPA 2QQAA 4U0WA 2W57A 2R7DA 1QGPA 1KQ0A 3HHHA 2LNBA 1BOAA 4K2EA 1HXDA 4O5VA 1AWCA 5KK1A 2XHKA 5K5QA 4A12A 4UXNA 1FX7A 2VT3A 4A5NA 3IKVA 4BAYA 4QLCU 4R79A 4F7ZA 3GLXA 3ZN1A 5H6QA 1MJBA 2VXZA 2VOPA 4B09A 3G3ZA 2HKXA 3V7RA 2DFIA 1XSXA 4L5JA 1FY7A 2VODA 5HVQC 4IRHA 5FFZA 5F64A 1B1BA 4PGHA 2YU3A 2M30A 1SMTA 1ZGJA 3BY6A 2QZ8A 5DCMA 3ULQB 4HW0A 2NYXA 1TQPA 1B59A 5HS7A 3WTVC 4ESFA 1YIOA 3V7SA 4AD9A 4P5OA 4ENMA 1S7OA 1Z05A 3ZPLA 5L3CA 2XUBA 3FMSA 3MEXA 2G9WA 5D6FA 2MH9A 4RB3C 2F5FA 2DPUA 4RAYA 3U2RA 2BYVE 4NB5A 2UXXA 1RUNA 1XGSA 1Z6RA 2G7HA 4AIKA 4LMYA 2B0LA 2ZMEA 1EV7A 3H3ZA 2QBYB 4KIFA 5FO5A 3F6OA 2NAZA 1EH8A 1J0RA 4EV0A 4RB2C 3BPVA 3WE2A 4CYDA 4HYEA 1HKSA 3GZ5A 2FBHA 2D1VA 2M5WA 1J2XA 2ZNYA 1LEBA 3ABUA 1P6RA 3TDZC 3HTUA 2EFQA 3I53A 3E5QA 3TQNA 1U5TB 1P4WA 2E1NA 2DO7A 4MTDA 1IXRC 1GVJA 3QP6A 1H0MA 2GA1A 5DD8A 4BYYA 1BN5A 2RN7A 4ENNA 1F9NA 2VBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ F;  5ILU A;  4S05 A;  2JTV A;  4LK0 F;  2CG4 A;  2OZ6 A;  4ZYH A;  5DCF A;  4L9J A;  4DQ2 A;  2DT5 A;  1IUY A;  1FP2 A;  4HQE A;  4IPA A;  4NHJ A;  3SQN A;  3RYR A;  3ML6 A;  4H0E A;  2LF7 A;  4LLL A;  1YG2 A;  2NS0 A;  1QBJ A;  5CVI A;  3MFK A;  1T6S A;  3WTS C;  1J5Y A;  2KIU A;  4L5I A;  2EV6 A;  4OMZ A;  3JW4 A;  2H6C A;  4M72 A;  2MA3 A;  3P9C A;  1Z6T A;  2GZW A;  4KN7 X;  5D5W B;  5BPD A;  3F8C A;  4LK1 F;  2OBP A;  2OA4 A;  3FXQ A;  3KP6 A;  3I0T A;  2LDU A;  1R00 A;  3GXO A;  2JT1 A;  5D8K B;  4G9Y A;  2AXL A;  4M71 A;  3T1B A;  1UCR A;  2E7W A;  4UV8 A;  3LA3 A;  4HF0 A;  2IA1 A;  3CLO A;  2VT2 A;  2BGC A;  2KKO A;  3BRO A;  2V79 A;  2W24 A;  4JQF A;  3E6C C;  4LLN A;  4IHT A;  4I0B A;  2FA5 A;  2IJL A;  2D2W A;  4WXD A;  1S8N A;  5E17 F;  5LRS A;  3LQQ A;  2V1U A;  1Z91 A;  1UST A;  4EJV A;  1PP7 U;  4EGZ A;  2VON A;  1JHH A;  2FRH A;  3F8B A;  3I59 B;  4RB0 A;  3BDD A;  2P5K A;  3KCC A;  4KYW A;  1MDM A;  4FT8 A;  2QQ9 A;  1FYL A;  5L3E A;  5DUI A;  1G3S A;  1A04 A;  5HDK A;  4WK8 F;  3CUQ B;  5LEJ A;  4MGR A;  2QQB A;  2YSR A;  1IF1 A;  1F5T A;  1S29 A;  1JXS A;  3GFL A;  1FNN A;  1AOY A;  2DQR A;  3DQV C;  2O0Y A;  4EQQ A;  2QYO A;  4A5M A;  2P5V A;  5LGT A;  2YX4 A;  4MQ9 F;  4ENJ A;  6PAX A;  3MZH A;  2HYF A;  4N0B A;  2C6Y A;  5FFX A;  1WQ2 A;  4RGU A;  4P9U A;  2O6G E;  2RKH A;  1T0F A;  2F2E A;  3BJA A;  3O6B B;  5F1R A;  1W4M A;  2O8X A;  3GWZ A;  4XSX F;  1ULY A;  2HR3 A;  3GO5 A;  1I27 A;  3DF8 A;  1D8K A;  4WXC A;  4AIJ A;  5K1Y A;  2ISZ A;  4U88 A;  2IP2 A;  5L3D A;  2OQR A;  2HKO A;  4G7H F;  3RKX A;  2ZJ2 A;  4UUV A;  4HA8 A;  1BIB A;  4Z2Y A;  3N97 A;  4HZF A;  3VOE A;  3REO A;  1OR7 A;  1W7P A;  4HDV A;  4FX4 A;  3LQR A;  3ZMZ A;  4PGG A;  2M45 A;  2M8E A;  2JSC A;  3E97 A;  3F22 A;  4XBF A;  3ECO A;  1ZLJ A;  1F1Z A;  3FM3 A;  2HGC A;  2J5O A;  1XGO A;  3M8F A;  2MC3 A;  2A07 F;  2EFP A;  5DV5 A;  3QRF F;  1QQI A;  4ZZD A;  1BI1 A;  4OIR F;  1ZH5 A;  4HF1 A;  3M8E A;  3Q9V A;  3SXY A;  2IPQ X;  2PFB A;  2EFN A;  1ONV A;  4Y15 A;  2IT0 A;  3Q5F A;  5CLS A;  5FLX Z;  2PG4 A;  4OU0 A;  3H3U A;  2L01 A;  1ZG5 A;  3J80 K;  4OOI A;  3J81 K;  1ODD A;  2H27 A;  4CXF A;  1R5G A;  1QZY A;  2L4A A;  1X3U A;  2DI3 A;  1ZN2 A;  2QLZ A;  2E1C A;  4CIC A;  4L0Z B;  3GFI A;  1G3T A;  3C18 A;  2ELH A;  3GZ6 A;  5AIQ A;  2GXG A;  4HX8 A;  4TV7 A;  4UV9 A;  1XCV A;  2ZCW A;  2O3F A;  2PEX A;  4A2U A;  4U7B A;  5LGN A;  2VE8 A;  2BE5 F;  4LJZ F;  4ZYD A;  1I1G A;  5BMZ A;  3BJ6 A;  4A0Z A;  2PQ8 A;  5J8F A;  1XCB A;  2XKO A;  3I54 A;  5J8C A;  2WC2 A;  1U6G A;  3VEP A;  3FWE A;  2FNP A;  3QPH A;  2OU2 A;  2DLL A;  2XAQ A;  2XAF A;  1ON1 A;  1KYZ A;  1TQI A;  3WG9 A;  4GO1 A;  1LQ1 A;  2K4J A;  1BIA A;  2XGX A;  3WTX C;  1ON2 A;  3HSE A;  1XSD A;  1RZ4 A;  2EJR A;  3CO7 C;  2DQL A;  4RB1 A;  3JTG A;  2P4W A;  5CVJ A;  2FNA A;  3RIR A;  4HLX A;  2RGV A;  1FP1 D;  1XSV A;  5EEH A;  2O61 A;  3K1M A;  3TGN A;  3KP5 A;  1HST A;  3EET A;  3V8L A;  3SZP A;  3AAF A;  1FYM A;  5JVT A;  1YS7 A;  1P4X A;  1XN7 A;  3K9T A;  1GXP A;  3LFK A;  2QBY A;  4ZYE A;  2P6S A;  5A2Q Z;  3R61 A;  5ED4 A;  1STZ A;  5E8I A;  5LBQ A;  4L9N A;  2CO5 A;  1J7K A;  4EGY A;  2Z33 A;  1L0O C;  2EA2 A;  2A3S A;  3JAM K;  3L09 A;  4IHS A;  4I09 A;  2EB7 A;  2CQK A;  3LAJ A;  3B73 A;  3KP3 A;  3GUD A;  5D5X B;  1V4R A;  4BHC A;  4I2O A;  2EA4 A;  5ICC A;  2ETH A;  5ICE A;  4B8X A;  4DNC A;  4IRG A;  2HQN A;  1S3J A;  3H92 A;  2IVM A;  2ESN A;  3KP4 A;  1O3Q A;  1IRG A;  2AS5 F;  4HQM A;  2PLY A;  4RAZ A;  5HLG A;  1SD4 A;  4XRF A;  1HW1 A;  2DU9 A;  5FGM A;  2O03 A;  3V7C A;  2A68 F;  2F5C A;  5LLQ A;  3L2C A;  2EV0 A;  5K5O A;  1TNS A;  2JRT A;  1DPR A;  3CTA A;  4UVC A;  2XVC A;  3D5L A;  1K79 A;  1ZRC A;  3TKY A;  2RNJ A;  3R4K A;  4G7Z F;  2P7V B;  2EFO A;  1XMK A;  5D6E A;  5E18 F;  3I5U A;  3NRV A;  1XGM A;  1YW7 A;  2KRF A;  5H6R A;  4LD5 A;  5IT9 Z;  1XDU A;  1DP7 P;  5L3F A;  4HOB A;  4MHG A;  4I7H A;  4KMU X;  5L3B A;  1T98 A;  2Z9O A;  2K27 A;  4BQA A;  1XMA A;  1IN6 A;  1BJA A;  3WTY C;  3GYH X;  4YFN F;  1MKM A;  3HTS B;  1IW7 F;  1OYY A;  1OYW A;  3HYI A;  3E5U A;  1IRF A;  2FMY A;  1HKT A;  2CYY A;  5A2Q K;  4UVB A;  4BNC A;  2EK5 A;  2L3D A;  1ZYR F;  1P92 A;  3ZMU A;  3I64 A;  2DK5 A;  3E6D A;  1B6A A;  1TNT A;  3FMR A;  3PQJ A;  2XAS A;  4G7O F;  3IWF A;  1XDS A;  4LB5 A;  2D45 A;  1XD7 A;  3FMQ A;  1H9G A;  3ERE D;  3I59 A;  5TJJ A;  2HS5 A;  4A0Y A;  4A6D A;  4M9X A;  1HW2 A;  3ROU A;  2D1H A;  1W7P D;  2RVC A;  5HLH A;  1FSH A;  1FPQ A;  5TRD A;  1JGS A;  3F8N A;  5IT3 A;  2RQP A;  3I71 A;  2KIM A;  1O57 A;  2UZK A;  4LGW A;  3ZMS A;  5E1Z B;  5EEG A;  3CUQ A;  4L0Y B;  1Z9C A;  4RGR A;  1WI9 A;  1EH7 A;  2HEO A;  2FBK A;  3FXR A;  4MQV A;  2K4B A;  3DP7 A;  5HS8 A;  3JTH A;  1OKR A;  2Y75 A;  4GYI A;  4NQW A;  3DPL C;  4LLG F;  3MAJ A;  1H9T A;  1F4K A;  3K69 A;  1PDN C;  2TDX A;  5HDN A;  4I0A A;  3IWZ A;  3GFM A;  4L9V A;  3JSO A;  2EFW A;  3QU3 A;  5HDG A;  3LST A;  2HTS A;  3C1D A;  1FT9 A;  4IRI A;  1OMI A;  2BV6 A;  3BWG A;  3DKW A;  5IT9 K;  3GX4 X;  4Q5S F;  3RTR A;  4BHP A;  2OZU A;  3VOD A;  2R7F A;  3KLN A;  1JHF A;  1B9M A;  4Q47 A;  3EQL F;  3LWF A;  1KQ8 A;  1V3F A;  1G4D A;  2QUF A;  3KLO A;  4KIB A;  4KIG A;  3I4P A;  4LFU A;  4EJO A;  2RDP A;  1XB4 A;  4ESJ A;  1ZRF A;  4GXO A;  5LEK A;  4R8H A;  4EVI A;  4AVP A;  3KE2 A;  1BBY A;  5L3G A;  3NQO A;  2XAG A;  2H09 A;  4KN4 X;  3M7G A;  4QWQ A;  1KU9 A;  3ELK A;  2BEO A;  1RIO H;  3WTU C;  1UB9 A;  3F72 A;  3WU0 A;  2ZO4 A;  4YII A;  5FD6 A;  2FU4 A;  1XGN A;  1ZHF A;  1ZAR A;  1SMY F;  4KA4 A;  4MEX F;  4AWX B;  5K5R A;  1G6N A;  3M1E A;  1GHC A;  4EM1 A;  3E5X A;  4PCQ A;  2CWE A;  4ETS A;  1REP C;  5FB2 A;  3RKW A;  2E7X A;  1HQC A;  4CO8 A;  5AIP A;  1KGS A;  3MZY A;  1RUO A;  3COA C;  3N4M A;  1WKM A;  4KNY A;  3R6S A;  2DW4 A;  1NHA A;  2Z3Y A;  3ZQ7 A;  5CJ9 A;  2P7C B;  1UHM A;  2DAO A;  1O7L A;  3C7J A;  3L9F A;  2Q0O A;  3QOP A;  3ZMV A;  5E1X A;  1R23 A;  2VC0 A;  1BC7 C;  3KP7 A;  4XSZ F;  1E2X A;  2IW5 A;  1U78 A;  1E17 A;  1HBX G;  2BBY A;  2MH2 A;  2L02 A;  1Z1D A;  5CVU A;  3V4G A;  4EJU A;  3CUO A;  1HW5 A;  2A6E F;  4HX7 A;  1O3T A;  2M87 A;  1MDM B;  4CZZ A;  4LG0 B;  4OIP F;  1ZGA A;  1YS6 A;  1MZB A;  3JSP A;  3MWM A;  5ILV A;  2GQQ A;  2OD5 A;  4XLN F;  1JE8 A;  4IVN A;  1SFX A;  3ZMD A;  3GF2 A;  5FD5 A;  5J6X A;  4Y17 A;  5D5V B;  2NNY A;  3HHG A;  3E6B A;  3O2P E;  3KET A;  4KFC A;  4U0Y A;  1W5S A;  3HRS A;  3F3X A;  2GWR A;  1QO0 D;  3HSF A;  1FOK A;  3HOS A;  1LDD A;  2V6C A;  4PZJ A;  1TQM A;  1J9I A;  2QM3 A;  5BPI A;  4HF2 A;  2KJC A;  1UHW A;  3RYP A;  3D0S A;  2X4H A;  2FE3 A;  2V9V A;  1IN7 A;  2COM A;  3NEU A;  2GA2 A;  2ISY A;  2STT A;  2PBI A;  2VOO A;  4CDG A;  3EUH A;  1K78 B;  2IRF G;  4IXA A;  4I02 A;  3CJN A;  3K0L A;  4M6Y A;  1TLH B;  1R5H A;  4I01 A;  4MEY F;  2P8T A;  3O3K A;  4P55 A;  2HQR A;  1W7P B;  1FBU A;  4UHT A;  1S6L A;  2HWV A;  3TO9 A;  1R1V A;  3ABT A;  4N9H A;  4HLY A;  1FZP B;  3BPX A;  3F8F A;  2IA0 A;  5JFR A;  1J75 A;  4FHT A;  2HOE A;  2F5E A;  2NNN A;  2OQG A;  3EDP A;  1WRJ A;  1U2W A;  2XAH A;  3ZP5 A;  1SD7 A;  4OIN F;  3TOB A;  1CF7 B;  3T5X A;  3IC7 A;  3FF5 A;  1D8J A;  1R7J A;  2VBX A;  3VFZ A;  2STW A;  1IN8 A;  1IZ1 A;  5CVV A;  5E20 A;  1YLF A;  1K6O A;  4M73 A;  4OMY A;  3I58 A;  4E70 A;  3ISP A;  4N9I A;  1PUE E;  1C0W A;  3FHZ A;  3QU6 A;  3QPT A;  1QNT A;  1LDJ A;  4M9Z A;  1FWZ A;  3DFG A;  2FBI A;  3HRU A;  3DEU A;  3G73 A;  4EJW A;  2FEZ A;  4P9F A;  3WE3 A;  5FLX K;  1USS A;  4IF4 A;  1RNL A;  4RGX A;  1LEA A;  1U8R A;  3HRM A;  2HYG D;  1KU2 A;  5F6F A;  1U5T A;  1BI3 A;  2ZFW A;  3BJO A;  1LDK B;  5LHG A;  4PDK A;  2M1B A;  1O3S A;  2XRO A;  3KEQ A;  4KIC A;  1ZLK A;  1G3Y A;  3LAP A;  1UFM A;  4Y13 A;  4YFK F;  1I1S A;  5BOX A;  4U7D A;  1D5V A;  1FLI A;  4M9S A;  2FQ3 A;  3FZV A;  4Q48 A;  2H94 A;  1P4A A;  4GCV A;  4U0V A;  1KYW A;  1VTN C;  2PMH A;  2ADU A;  2RC4 A;  3SFZ A;  3W6J B;  3LA2 A;  1J59 A;  3FXU A;  1MJ9 A;  3CDH A;  5E8G A;  5HOO A;  5ICG A;  4MNU A;  2EWN A;  2PI0 A;  3RDI A;  1YTY A;  4BHB A;  3KP2 A;  3K1N A;  2ESH A;  3GEZ A;  4O6J A;  1EH6 A;  2W84 A;  1KQ9 A;  2W85 A;  3QP5 A;  3IHU A;  4ZH4 F;  3V8J A;  1B4A A;  4G6Q A;  1SFU A;  2ZBK A;  4WF2 A;  3RPQ A;  1TBX A;  4KT5 C;  1HSJ A;  3T0Y A;  1RI7 A;  1PP8 F;  3P9K A;  4WWC A;  4GYG A;  4JK1 X;  4ASN A;  3WTT C;  2YR2 A;  3HIF A;  3U9G A;  5JI6 A;  5ICF A;  4EJT A;  2VC1 A;  4EM0 B;  2YPR A;  3ECH A;  3S2W A;  4I98 B;  3KZZ A;  4ON0 A;  2P6T A;  1OYI A;  1O3R A;  2GIV A;  5DCM B;  2KJB A;  3OV8 A;  2A6H F;  1SD6 A;  5LGU A;  2PN6 A;  1FYK A;  1IN5 A;  1FC3 A;  4YIF A;  1LJ9 A;  2CSO A;  3PQK A;  4ZZL A;  1LB2 A;  3GW2 A;  1S7A A;  2XRN A;  2ZXJ A;  1B9N A;  5E1W A;  4AIH A;  2FF4 A;  3GVA A;  1KU7 A;  2GXB A;  3K2Z A;  1R36 A;  1KA8 A;  2HZT A;  3RKY A;  2VBY A;  2ZME B;  5DDG A;  2XIG A;  1SFE A;  5CYV A;  3T8T A;  3F8M A;  1Y0U A;  3RPU A;  1BI2 A;  4M6X A;  2Z5U A;  2HFH A;  1YW8 A;  4HX4 A;  4MTE A;  1TW2 A;  3TOA A;  1T39 A;  1QPM A;  3ZN0 A;  1ZRD A;  2VN2 A;  2FML A;  2GAU A;  1MGT A;  5JHU A;  3RI4 A;  2ACJ A;  2HTJ A;  3SHF A;  5LHI A;  1K7A A;  2ZKZ A;  5H20 A;  1D3Y A;  2R3S A;  2JPB A;  1FBQ A;  3DV8 A;  1KU3 A;  3KFW X;  3WU1 B;  3R60 A;  3BZ6 A;  5DEQ A;  4UVA A;  5LHH A;  2G7U A;  2W25 A;  4HBL A;  1Z7U A;  3WGI A;  4G6D A;  2IA2 A;  3TDU C;  3R0J A;  1I6X A;  1W5T A;  3W6K B;  2WV0 A;  5DUK A;  4HV6 A;  2K02 A;  4ENK A;  1MD0 A;  2K86 A;  4LB6 B;  3MCZ A;  3M9A A;  4A6E A;  2HDC A;  2UWM A;  2V1D A;  2DBB A;  1T2K A;  5LRR A;  5D8L B;  1ZG1 A;  1L3L A;  3HSR A;  3BP8 A;  4KDP A;  4OIO F;  4HV5 A;  3P7N A;  4LG0 A;  2VBZ A;  1MJA A;  1T38 A;  3EYY A;  3MQ0 A;  5DYM A;  4HDU A;  5D4R A;  3KZY A;  2Q2E A;  2MD5 A;  2Y48 A;  2P5L C;  2A5Y B;  1U3E M;  1ZRE A;  3L00 A;  3E3V A;  4IJA A;  2JPC A;  5HLI A;  3L7W A;  4KMF A;  1R1U A;  1IAW A;  4CHU A;  3IRR A;  3CO6 C;  3DPT A;  4KUM A;  3J80 Z;  3J81 Z;  1R1T A;  2K7L A;  1YFH A;  5D4S A;  2QVO A;  4JBA A;  2DTR A;  4WCG A;  3HUG A;  4WX9 A;  2LSO A;  2L54 A;  4S04 A;  2J5P A;  2F5D A;  1OPC A;  2L4M A;  4BXU A;  1DPU A;  2CW0 F;  1LNW A;  3IKT A;  1U5T C;  3LA7 A;  3HOT A;  5ILS A;  2Y0M A;  2RV8 A;  5KVR A;  4M74 A;  5BS6 A;  3Q9S A;  2MLG A;  1BC8 C;  2FXA A;  3QAH A;  3WGH A;  4RS8 A;  1IN4 A;  3ZMT A;  5DD4 A;  1DUX C;  3KEO A;  2PMU A;  1Q1H A;  5BQT A;  4YG2 F;  4XLP F;  2FSW A;  3GFJ A;  3EYI A;  2A61 A;  3WOD F;  4A0X A;  1K78 A;  2EV5 A;  1TW3 A;  1R58 A;  4ZYG A;  2OAZ A;  4L18 B;  3PFI A;  2V1X A;  3U1D A;  4CGZ A;  1YW9 A;  2MBF A;  1LVA A;  5D5U B;  1G3W A;  3B02 A;  4WXH A;  1O7F A;  4G94 A;  4D0P A;  3K1P A;  5JR3 A;  3J7A O;  5AON A;  2VE9 A;  4RGS A;  1R22 A;  2KIF A;  3IRQ A;  3P9I A;  2A69 F;  4L9T A;  4HAM A;  1I5Z A;  4P96 A;  2ZNZ A;  3R0A A;  1GXQ A;  5HS9 A;  1CF7 A;  1BI0 A;  2Q8K A;  3IL2 A;  3FX3 A;  1SD5 A;  2DPD A;  4G8X A;  1YQA A;  1HKQ A;  4OIQ F;  4EMS A;  3FM5 A;  1YO5 C;  2WTE A;  1FBS A;  4EM2 A;  4FX0 A;  3SZT A;  1ZG3 A;  3TO6 A;  3HRT A;  3RJP A;  3F6V A;  2XKP A;  3TO7 A;  1ZAO A;  1IXS B;  2PJP A;  3WGG A;  4YFX F;  2UXN A;  2YX7 A;  3OOP A;  3JAM Z;  1WSU A;  3WTZ A;  3E6M A;  2CGP A;  4O3M A;  2JZY A;  1FSE A;  1DDN A;  3T8R A;  4BH9 A;  4UNO A;  1BM9 A;  3F23 A;  1SAX A;  4R1H A;  2LKP A;  2DK8 A;  3V8K A;  1P2F A;  5CVR A;  1IXC A;  2X0L A;  2QWW A;  2CFX A;  4GGG A;  1WWX A;  4Q4Z F;  3BOQ A;  2MLK A;  3CUQ C;  3C3W A;  2WWY A;  3WTW C;  2XAJ A;  1QZZ A;  1YYV A;  2NRA C;  2XV4 S;  2Z99 A;  3VB2 A;  3F21 A;  2FOK A;  2LF8 A;  4ESB A;  2QEN A;  1TTY A;  2H6B A;  5ERI A;  1CGP A;  2QQA A;  4U0W A;  2W57 A;  2R7D A;  1QGP A;  1KQ0 A;  3HHH A;  2LNB A;  1BOA A;  4K2E A;  1HXD A;  4O5V A;  1AWC A;  5KK1 A;  2XHK A;  5K5Q A;  4A12 A;  4UXN A;  1FX7 A;  2VT3 A;  4A5N A;  3IKV A;  4BAY A;  4QLC U;  4R79 A;  4F7Z A;  3GLX A;  3ZN1 A;  5H6Q A;  1MJB A;  2VXZ A;  2VOP A;  4B09 A;  3G3Z A;  2HKX A;  3V7R A;  2DFI A;  1XSX A;  4L5J A;  1FY7 A;  2VOD A;  5HVQ C;  4IRH A;  5FFZ A;  5F64 A;  1B1B A;  4PGH A;  2YU3 A;  2M30 A;  1SMT A;  1ZGJ A;  3BY6 A;  2QZ8 A;  5DCM A;  3ULQ B;  4HW0 A;  2NYX A;  1TQP A;  1B59 A;  5HS7 A;  3WTV C;  4ESF A;  1YIO A;  3V7S A;  4AD9 A;  4P5O A;  4ENM A;  1S7O A;  1Z05 A;  3ZPL A;  5L3C A;  2XUB A;  3FMS A;  3MEX A;  2G9W A;  5D6F A;  2MH9 A;  4RB3 C;  2F5F A;  2DPU A;  4RAY A;  3U2R A;  2BYV E;  4NB5 A;  2UXX A;  1RUN A;  1XGS A;  1Z6R A;  2G7H A;  4AIK A;  4LMY A;  2B0L A;  2ZME A;  1EV7 A;  3H3Z A;  2QBY B;  4KIF A;  5FO5 A;  3F6O A;  2NAZ A;  1EH8 A;  1J0R A;  4EV0 A;  4RB2 C;  3BPV A;  3WE2 A;  4CYD A;  4HYE A;  1HKS A;  3GZ5 A;  2FBH A;  2D1V A;  2M5W A;  1J2X A;  2ZNY A;  1LEB A;  3ABU A;  1P6R A;  3TDZ C;  3HTU A;  2EFQ A;  3I53 A;  3E5Q A;  3TQN A;  1U5T B;  1P4W A;  2E1N A;  2DO7 A;  4MTD A;  1IXR C;  1GVJ A;  3QP6 A;  1H0M A;  2GA1 A;  5DD8 A;  4BYY A;  1BN5 A;  2RN7 A;  4ENN A;  1F9N A;  2VBW A; 
#chains in the Genus database with same CATH topology
 2K3F A;  3DXJ F;  5ILU A;  4HG2 A;  4V19 K;  4FTH A;  5J4V A;  4S05 A;  4E7S A;  1U9O A;  2JTV A;  4LK0 F;  2CG4 A;  1N77 A;  2OZ6 A;  4ZYH A;  5DCF A;  4L9J A;  2HZD A;  4DQ2 A;  2DT5 A;  1IUY A;  1FP2 A;  3D1N I;  2BOL A;  4IPA A;  4HQE A;  4NHJ A;  3SQN A;  3RYR A;  1M1E B;  3ML6 A;  4H0E A;  3OYI A;  2O8K A;  2LF7 A;  4LLL A;  1YG2 A;  3FXO A;  2NS0 A;  1QBJ A;  2XF7 A;  3HGG A;  5CVI A;  2E2H J;  4HEA 2;  3FXL A;  3MFK A;  1T6S A;  2B7E A;  4XOR A;  3DPU A;  3WTS C;  4XMY A;  1J5Y A;  2KIU A;  4L5I A;  2EV6 A;  3LSH A;  2CU7 A;  4XKV A;  2ZB9 A;  4OMZ A;  2LC2 A;  1TWG J;  3JW4 A;  3CCE I;  2H6C A;  4C2M J;  4M72 A;  2MA3 A;  3P9C A;  2LH9 A;  4X0G A;  1Z6T A;  2GZW A;  3B6A A;  4KN7 X;  3ZQQ A;  1MBE A;  5D5W B;  5BPD A;  2Z2S B;  4LG3 A;  3F8C A;  4BE0 A;  4LK1 F;  1YRN A;  2GM4 A;  2OBP A;  2OA4 A;  3FXQ A;  1ETX A;  1IGN A;  3EUH C;  2KRC A;  5KNL A;  3KP6 A;  3I0T A;  3AL0 C;  1SAN A;  2LDU A;  1R00 A;  3GXO A;  2JT1 A;  2FOW A;  5D8K B;  2X51 A;  4G9Y A;  1HCR A;  3OYM A;  2AXL A;  2OF7 A;  3GZN B;  4M71 A;  3T1B A;  3VSL A;  1UCR A;  2E7W A;  4UV8 A;  3LA3 A;  2COB A;  3HOX J;  4HF0 A;  2IA1 A;  3H5N A;  5HNF A;  3CLO A;  2VT2 A;  3OSF A;  3LSM A;  5HOD A;  2BGC A;  4C2U A;  2KKO A;  4NBQ A;  2M4G A;  5FLM J;  1Z67 A;  1A6I A;  2X9D A;  3BRO A;  3HOY J;  4A3K J;  2V79 A;  2W24 A;  4JQF A;  2HXO A;  3E6C C;  3BTI A;  2L5Q A;  4LLN A;  3I55 I;  3HOV J;  4IHT A;  2RQQ A;  4I0B A;  1UZC A;  2FA5 A;  2IJL A;  1AA7 A;  2D2W A;  4WXD A;  1S8N A;  5E17 F;  1MBH A;  3HL2 A;  5LRS A;  3LQQ A;  2V1U A;  1Z91 A;  3PSI A;  1UST A;  4EJV A;  3KIO A;  1PP7 U;  3K4J A;  4A3G J;  4EGZ A;  2WAF A;  2ZXW H;  2VON A;  4EAT A;  5EDN A;  1JHH A;  1PVE A;  1T56 A;  3HGY A;  4E7H A;  1FOW A;  1RR7 A;  4BQQ A;  2FRH A;  3F8B A;  3I59 B;  4RB0 A;  4ANJ A;  1JUM A;  3PUB A;  1MMN A;  3BDD A;  5FKK A;  9ANT A;  1ZGW A;  1B72 B;  1AKH B;  2NVQ J;  2P5K A;  2JJ7 A;  3GME A;  1ZR2 A;  3KCC A;  2LP0 A;  2M0M A;  4KYW A;  1MDM A;  1MSE C;  1VQK I;  2HDW A;  4FT8 A;  3FXK A;  2QQ9 A;  3LL7 A;  1FYL A;  1P7J A;  1F43 A;  3OL4 A;  2X48 A;  5L3E A;  2XSD C;  3BR1 A;  5DUI A;  3FDY A;  1G3S A;  1A04 A;  5HDK A;  4WK8 F;  2XGE A;  3QQA A;  1X3Z B;  3CUQ B;  2RAE A;  5LEJ A;  4MGR A;  2QQB A;  2YSR A;  1ETY A;  1IF1 A;  1F5T A;  1S29 A;  4AYB A;  1JXS A;  3GFL A;  3OYN A;  2EZL A;  3C2G A;  4W1U A;  1FNN A;  1AOY A;  5EG0 A;  2R7V A;  1TT0 A;  2DQR A;  3DQV C;  2O0Y A;  3LSI A;  4EQQ A;  3AG3 H;  3JRD A;  2KDO A;  4AVZ A;  2QYO A;  4F3Q A;  5DM7 F;  4A5M A;  2P5V A;  1XX5 A;  2XGD A;  3PFY A;  3BR2 A;  2EIM H;  4BDZ A;  1GUU A;  5LGT A;  2YX4 A;  1SC7 A;  4PSW A;  3MD2 A;  4MQ9 F;  4IOA F;  3BT9 A;  1BOB A;  2EIK H;  4GDF A;  4ENJ A;  6PAX A;  4BBS J;  1W5C C;  3MZH A;  2HYF A;  4N0B A;  2C6Y A;  3OYB A;  2ZJR F;  1JT0 A;  5FFX A;  1WQ2 A;  2L9S A;  4RGU A;  4P9U A;  2O6G E;  3M4O J;  2KLO A;  3Q3S A;  2FX0 A;  5B66 C;  3L1P A;  1JKQ C;  2RKH A;  1QPI A;  3FXJ A;  1T0F A;  2F2E A;  3BJA A;  4N4N B;  4J00 A;  3O6B B;  5F1R A;  2LD5 A;  2L7F P;  3F0C A;  1W4M A;  2O8X A;  3GWZ A;  4XSX F;  1ULY A;  1R71 A;  4UUT A;  2HR3 A;  3GO5 A;  3FK6 A;  1UHS A;  1I27 A;  2CUE A;  1BJZ A;  4D5C A;  1BR2 A;  3DF8 A;  1D8K A;  4E4H A;  2HPM A;  4WXC A;  4AIJ A;  5K1Y A;  2HVR A;  2ISZ A;  2VQC A;  4U88 A;  2IP2 A;  4CCJ A;  4M3G A;  5L3D A;  2OQR A;  2HKO A;  2WAD A;  1Y8R B;  4G7H F;  3RKX A;  2ZJ2 A;  3JRI A;  1B8I B;  4HA8 A;  4UUV A;  1BIB A;  1ACI A;  4Z2Y A;  1D1C A;  1U9N A;  3CD6 I;  3N97 A;  2DCE A;  4HZF A;  3VOE A;  3REO A;  1OR7 A;  1W7P A;  4HDV A;  4FX4 A;  2CFO A;  3LQR A;  2WAE A;  4PFP A;  2XPV A;  1EJ9 A;  3ZMZ A;  1I6H J;  2AO9 A;  4PGG A;  5JHF A;  3EUK L;  2M45 A;  2M8G X;  2M8E A;  2XPW A;  3DU5 A;  5FKO A;  2JSC A;  3S16 J;  2WV1 A;  3E97 A;  2ID3 A;  4XBF A;  3F22 A;  3ECO A;  1W1W E;  1ZLJ A;  3OR1 C;  1F1Z A;  3FM3 A;  5GTI C;  2HGC A;  5GAH J;  2J5O A;  1XGO A;  3M8F A;  2MC3 A;  3ZGK A;  2EFP A;  4IX7 A;  2A07 F;  3G2B A;  5DV5 A;  4BE2 A;  3OS2 A;  3QRF F;  2NS8 A;  3S32 A;  3OSG A;  3RZD J;  1QQI A;  4M3D A;  4ZZD A;  1BI1 A;  2HQA A;  4FE7 A;  1IO2 A;  2G0E A;  2IGO A;  2RRE A;  2H8R A;  5GPC A;  4OIR F;  3GTG J;  1ZH5 A;  2V7F A;  4XOP A;  2VQL A;  3M8E A;  4HF1 A;  3Q9V A;  4XKB A;  3SXY A;  2IPQ X;  3GTK J;  2EPF A;  2PFB A;  2EFN A;  1FIA A;  1ONV A;  4HST A;  2CV0 A;  4Y15 A;  2IT0 A;  3Q5F A;  5CLS A;  1KON A;  3UR3 C;  4ZDO A;  3CCJ I;  5FLX Z;  5IP9 J;  1Y1V J;  2PG4 A;  4OU0 A;  3H3U A;  3OS0 A;  5J40 A;  2L01 A;  1BR1 A;  3DCF A;  3J80 K;  4OOI A;  1ZG5 A;  3J81 K;  1OFC X;  2YUS A;  1ODD A;  2H27 A;  4CXF A;  2YU9 J;  1R5G A;  2CMP A;  5FRM A;  1QZY A;  4XK4 A;  5IYC J;  2L4A A;  2LY1 A;  1X3U A;  2DI3 A;  1ZN2 A;  2CS3 A;  2QLZ A;  2B63 J;  4BQN A;  3MKL A;  3CF2 A;  1MIJ A;  1VND A;  1WJA A;  2E1C A;  4CIC A;  1Y6I A;  4L0Z B;  3GFI A;  2MSY A;  1G3T A;  3C18 A;  4LIV A;  2ELH A;  4CYC A;  2XF5 A;  3GZ6 A;  2E35 A;  2VJI A;  5AIQ A;  3I56 I;  4BXF A;  2GXG A;  3HEF A;  2E5Z A;  4HX8 A;  3HXL A;  3QYB A;  4TV7 A;  4UV9 A;  1YX5 A;  2DA3 A;  2V4J C;  1XCV A;  2ZCW A;  3HC7 A;  2O3F A;  3ZRG A;  2PEX A;  2E60 A;  3EPZ A;  1OCP A;  2LY2 A;  4A2U A;  4U7B A;  1ZQ3 P;  5LGN A;  3HOW J;  1JTY A;  3BCA A;  2VE8 A;  2BE5 F;  4LJZ F;  4ZYD A;  1I1G A;  3DBL B;  4EEF G;  3SEZ A;  3SZG A;  2GXA A;  5BMZ A;  3BJ6 A;  2JN6 A;  4A0Z A;  4BS9 A;  4KJZ A;  2PQ8 A;  4BJT A;  5J8F A;  4IEJ A;  1XCB A;  2XKO A;  2EBI A;  3I54 A;  5J8C A;  4CUG A;  2V26 A;  2WC2 A;  1RR8 C;  3G4S I;  1T8I A;  1U6G A;  3VEP A;  3FWE A;  5C4X J;  2ID6 A;  4A3F J;  2FNP A;  1TWA J;  1VQ9 I;  3QPH A;  2OU2 A;  1S7E A;  3DLA A;  1WJF A;  4QPQ A;  5CQG A;  2DLL A;  1ETO A;  4DBQ A;  2XAQ A;  2XAF A;  1ON1 A;  3H5A A;  1KYZ A;  1TQI A;  3WG9 A;  2VB6 A;  4GO1 A;  3BQZ A;  2JQ7 A;  1LQ1 A;  2K4J A;  1BIA A;  2XGX A;  3K4N A;  3W2A A;  1TWH J;  1ON2 A;  3WTX C;  3HSE A;  4KIS A;  1K83 J;  1XSD A;  1RZ4 A;  2EJR A;  3WG7 H;  3CO7 C;  1IDZ A;  2DQL A;  4RB1 A;  3CJQ B;  3JTG A;  2P4W A;  3CC4 I;  5CVJ A;  1GV5 A;  1RKW A;  2FNA A;  2DOD A;  3RIR A;  2N8G A;  2X1C A;  4HLX A;  2RGV A;  1FP1 D;  1XSV A;  5EEH A;  2R7W A;  1IDY A;  2AHQ A;  2O61 A;  2VPR A;  3K1M A;  3W3C A;  3TGN A;  1UJ8 A;  3KP5 A;  1HST A;  3EET A;  3AG1 H;  2EZI A;  3JRH A;  3M3Y J;  3V8L A;  3SZP A;  3AAF A;  2R5Y A;  2L9V A;  1FYM A;  5JVT A;  1YS7 A;  3RPU D;  3PM1 A;  2MYS A;  1P4X A;  1XN7 A;  5IP6 A;  3K9T A;  2Y0S A;  3MVP A;  2DMN A;  4II3 A;  1GXP A;  3LFK A;  2QBY A;  4ZYE A;  3S3N A;  3AL0 B;  2P6S A;  5LFA A;  2KL4 A;  5A2Q Z;  2FUG 2;  5M5X J;  3R61 A;  5ED4 A;  1MMD A;  3TW6 A;  1G59 A;  1STZ A;  5E8I A;  5C44 J;  4AC0 A;  4B1R A;  4XRS A;  5LBQ A;  2HDD A;  4L9N A;  3GLL A;  2WB1 A;  3HM5 A;  3OYK A;  2CO5 A;  1J7K A;  4EGY A;  3TMO A;  3H9G A;  3DBH B;  3AKZ A;  3ABK H;  2X6X A;  2Z33 A;  4E7J A;  1L0O C;  3K4B A;  5DM6 F;  2EA2 A;  4A3B J;  2A3S A;  3JAM K;  3L09 A;  4IHS A;  4I09 A;  2EB7 A;  2CQK A;  1HOM A;  2I10 A;  3LAJ A;  3B73 A;  3KP3 A;  1RRJ A;  1YJ9 I;  1LFU P;  2W7N A;  3GUD A;  5D5X B;  3CZ6 A;  1V4R A;  4BHC A;  2JA2 A;  4I2O A;  4PJN A;  4XN3 A;  2EA4 A;  3G1M A;  5ICC A;  2ETH A;  5ICE A;  4E7I A;  4B8X A;  4DNC A;  4IRG A;  2HQN A;  1S3J A;  2DJN A;  4LIU A;  3H92 A;  1MNE A;  1X19 A;  2X6O A;  2BHZ A;  3KPH A;  3BG9 A;  2KPM A;  1I50 J;  4S0H B;  2IVM A;  2ESN A;  3KP4 A;  4DYR A;  1O3Q A;  1IRG A;  2AS5 F;  1K61 A;  3A0H C;  5CPR B;  5GAG J;  2DFH A;  4HQM A;  2PLY A;  4RAZ A;  5HLG A;  2K3P A;  3CCL I;  1BL0 A;  1SD4 A;  2DYR H;  2KT0 A;  4XRF A;  1HW1 A;  2DU9 A;  5FGM A;  4E7K A;  2O03 A;  3V7C A;  4PFO A;  2A68 F;  2F5C A;  3S1N J;  2V9K A;  5LLQ A;  3L2C A;  2EV0 A;  5K5O A;  2BXY A;  1JTX A;  1TNS A;  1JUS A;  3OOU A;  2JRT A;  1VQ5 I;  4NC6 A;  1DPR A;  3CTA A;  1R4M B;  1D0X A;  2XVC A;  4UVC A;  3D5L A;  2NOG A;  4CZC A;  1K79 A;  1H88 C;  1NK2 P;  4A3D J;  1ZRC A;  3TKY A;  2RNJ A;  2QGU A;  3NWS A;  3R4K A;  2MC4 A;  4PSX A;  4G7Z F;  2P7V B;  4ZDP A;  2EFO A;  1XMK A;  5IYB J;  1K4T A;  4FET A;  3SYT A;  5D6E A;  2DA7 A;  5E18 F;  4C9Y A;  4L5E A;  3KX2 A;  1YJW I;  2HVQ A;  3U21 A;  1YOV B;  3I5U A;  3NRV A;  1IJW C;  4C3I J;  1LUJ B;  4XKC A;  1XGM A;  4FCY A;  1YW7 A;  2KRF A;  5H6R A;  4LD5 A;  2Y2Z A;  1XDU A;  4E7Z A;  5IT9 Z;  1DP7 P;  3S1M J;  3O8H A;  5L3F A;  4ZC3 A;  2GOM A;  4HOB A;  4MHG A;  4I7H A;  4KMU X;  5L3B A;  2QF7 A;  1T98 A;  3G71 I;  1JT6 A;  2Z9O A;  3BTL A;  2K27 A;  2BXZ A;  1XMX A;  4BQA A;  2RNG A;  3EUA A;  5TIS C;  1XMA A;  4G6T B;  1IN6 A;  1BJA A;  3WTY C;  3WU2 C;  1OR7 C;  3N05 A;  2P81 A;  3GYH X;  4YFN F;  1MKM A;  2FQ4 A;  5J1U A;  3HTS B;  1IW7 F;  1OYY A;  1WPK A;  1OYW A;  4XRM A;  3HYI A;  1T95 A;  3DTE A;  5JVG F;  2K40 A;  3E5U A;  1IRF A;  2FMY A;  1HKT A;  2R7T A;  2DOA A;  2CYY A;  3HPH A;  3K4C A;  2XGC A;  5A2Q K;  4UVB A;  4BNC A;  1EF4 A;  2EK5 A;  2L3D A;  1ZYR F;  2L7M P;  4RLQ A;  3PNT A;  3PUF A;  1P92 A;  3W6V A;  1APL C;  1BW6 A;  3ZQH A;  3Q0U A;  3ZMU A;  3HKZ A;  1UG0 A;  3I64 A;  2X85 A;  2DK5 A;  3E6D A;  1B6A A;  2EZK A;  2O7O A;  3A03 A;  1TNT A;  3H5R A;  5GPA A;  4ZYA A;  5M3F J;  3FMR A;  1W36 C;  3PQJ A;  2XAS A;  4G7O F;  3IWF A;  1XDS A;  2ME0 A;  4LB5 A;  2D45 A;  1XD7 A;  1U8B A;  3FMQ A;  3H35 A;  3HG9 A;  2K9L A;  1PYV A;  5KAF C;  1H9G A;  3LSR A;  3ERE D;  3I59 A;  2R5Z B;  3CP8 A;  1VF9 A;  5TJJ A;  1K6Y A;  3A02 A;  4FIS A;  2HS5 A;  1B72 A;  3G1O A;  2HQ5 A;  2E1O A;  4A0Y A;  4M9X A;  4A6D A;  1HW2 A;  3ROU A;  2CH0 A;  1LVK A;  3DTK A;  2D1H A;  3SEQ A;  1W7P D;  2RVC A;  5HLH A;  1FSH A;  1ETV A;  2DT6 A;  2F4M B;  1FPQ A;  3LSG A;  5TRD A;  4DJA A;  1JGS A;  3F8N A;  3IAS 2;  4BGD A;  5IT3 A;  3RQI A;  2RQP A;  3PIO F;  1NG7 A;  2ME6 A;  2M2E A;  2KZV A;  3I71 A;  4B4C A;  3DTI A;  2KIM A;  4I76 A;  1O57 A;  1DP3 A;  1V5F A;  2UZK A;  4LGW A;  3ZMS A;  5E1Z B;  5EEG A;  2PJR A;  2HNH A;  2AQE A;  3CUQ A;  1V55 H;  4UB8 C;  4L0Y B;  1Z9C A;  3HZJ A;  2H1L A;  4RGR A;  1WI9 A;  2R7Z J;  3BG5 A;  1EH7 A;  1XTA A;  2HEO A;  2Y30 A;  2ZXI A;  3A1Y A;  1W36 D;  2FBK A;  2CQ7 A;  2VJ4 A;  3FXR A;  4MQV A;  2K4B A;  3DP7 A;  3CME I;  3S1Q J;  5HS8 A;  2XSJ C;  1JKP C;  3JTH A;  1VQM I;  5E3N A;  3K70 C;  2ZSI B;  1OKR A;  2OTJ I;  2Y75 A;  4BE1 A;  2WAQ A;  4GYI A;  1VZ0 A;  1YJN I;  2DA5 A;  4NQW A;  2IGK A;  4NC7 A;  2VKV A;  3DPL C;  4LLG F;  3MAJ A;  3MKY B;  1H9T A;  1F4K A;  3ZQC A;  3K69 A;  1PDN C;  2XF6 A;  2Y31 A;  3GCM A;  2TDX A;  5HDN A;  4I0A A;  1HA8 A;  2L7Z A;  2L9R A;  3IWZ A;  3GFM A;  4L9V A;  2R7X A;  3A0B C;  3CDI A;  3JSO A;  2EFW A;  3QU3 A;  5HDG A;  3LST A;  5CKT A;  2HTS A;  2OUM A;  2VQH A;  3M1C A;  3OY9 A;  1QVU A;  3C1D A;  1U0J A;  1FT9 A;  4IRI A;  1OMI A;  4MFE A;  5FKM A;  3J7Z I;  2BV6 A;  4CCO A;  3BG3 A;  3BWG A;  3DKW A;  5IT9 K;  1IRX A;  1VI0 A;  3GX4 X;  3BR3 A;  4Q5S F;  3RTR A;  4BHP A;  3QYE A;  3OYD A;  2V6E A;  2OZU A;  3VOD A;  2R7F A;  3A01 B;  1LKX A;  3KLN A;  2MD0 A;  1JHF A;  3K70 D;  1B9M A;  4Q47 A;  3EQL F;  3LWF A;  3DBR B;  1KQ8 A;  1V3F A;  1G4D A;  5EF6 A;  2QUF A;  3KLO A;  4KIB A;  4KIG A;  2LRD A;  4BKX A;  1TWC J;  2QQ8 A;  3I4P A;  4LFU A;  2ELJ A;  4BJ6 C;  2RDP A;  4EJO A;  1XB4 A;  1Z0X A;  4ESJ A;  4B47 A;  1ZRF A;  4GXO A;  1B8I A;  1JUP A;  5LEK A;  2ZXH A;  4R8H A;  1A6Q A;  3CCR I;  1XG1 A;  4EVI A;  1FOY A;  4AVP A;  2V9P A;  3KE2 A;  1BBY A;  5L3G A;  3NQO A;  5K7Z A;  4ABZ A;  2XAG A;  2H09 A;  4KN4 X;  2E2J J;  3M7G A;  4QWQ A;  1KU9 A;  2LVS A;  3ELK A;  2BEO A;  1RIO H;  3IUO A;  1UB9 A;  3WTU C;  3F72 A;  3PJR A;  3WU0 A;  2ZO4 A;  2EIN H;  4YII A;  3GTM J;  5FD6 A;  2OPT A;  3UKG A;  2FU4 A;  2MGQ A;  2Z1D A;  1XGN A;  1JJ6 C;  1ZHF A;  2LOO A;  1ZAR A;  1SMY F;  2QSH X;  3IH3 A;  4KA4 A;  4MEX F;  4AWX B;  5K5R A;  1WCM J;  3MMY B;  1G6N A;  2PMZ A;  2Y9Y A;  3M1E A;  3A4C A;  1GHC A;  2B9S A;  2R4G A;  4EM1 A;  3E5X A;  3JCU C;  4PCQ A;  2CWE A;  4ETS A;  1REP C;  4JYK A;  5FB2 A;  2GBY A;  3RKW A;  4XKW A;  1ETW A;  2E7X A;  1HQC A;  4CO8 A;  1DU0 A;  5AIP A;  1KGS A;  3MZY A;  4II2 A;  2ZJP F;  1RUO A;  3COA C;  3N4M A;  1WKM A;  4KNY A;  5GAE J;  3R6S A;  2DW4 A;  1NHA A;  2Z3Y A;  3ZR8 X;  1VFC A;  3ZQ7 A;  4QSH A;  2BY0 A;  3CC2 I;  2NVT J;  5CJ9 A;  5M5Y J;  2P7C B;  1UHM A;  2DAO A;  1GT0 C;  2UV1 A;  4HNU A;  5KCM A;  1O7L A;  1I39 A;  3K4L A;  1S9H A;  3C7J A;  2L9N A;  3L9F A;  2Q0O A;  3QOP A;  3ZMV A;  5E1X A;  1R23 A;  3CCS I;  2HOA A;  1FTZ A;  2F4O B;  4LIT A;  3CC7 I;  3S93 A;  3BR0 A;  1GVD A;  2VC0 A;  3LSK A;  5DTD A;  1BC7 C;  1Y56 A;  2LYC A;  2R7R A;  3BLY A;  3SJM A;  3KP7 A;  3OIQ A;  1MBJ A;  4XSZ F;  1E2X A;  4J01 A;  2IW5 A;  1U78 A;  1E17 A;  3QOE A;  1IUF A;  1YX3 A;  1HBX G;  5K7F A;  1AHD P;  3BTJ A;  4Z6Y A;  2BBY A;  5EJC A;  1W0T A;  2MH2 A;  2L02 A;  4RAF A;  4XL9 A;  2OTL I;  1Z1D A;  5CVU A;  3FKJ A;  3V4G A;  4EJU A;  3CUO A;  2FJ1 A;  4MLO A;  1GV2 A;  3AFH A;  2ZFU A;  1HW5 A;  2A6E F;  2VAS A;  3DWL E;  3GBG A;  4HRI A;  1RPW A;  4HX7 A;  1O3T A;  2M87 A;  3S8P A;  4B44 A;  1MDM B;  1EKE A;  4CCK A;  2D5V A;  4CZZ A;  3CMM A;  2HI3 A;  4LG0 B;  4OIP F;  1YIJ I;  3VYT B;  1X1C A;  4UUS B;  1ZGA A;  1YS6 A;  1MZB A;  2CQQ A;  3JSP A;  1R9T J;  3MWM A;  4RMN A;  2Q2E B;  2DDB A;  3WHC A;  1A5J A;  5ILV A;  3JRB A;  2GQQ A;  1G8X A;  2OD5 A;  1VQN I;  1X1A A;  4XLN F;  1JE8 A;  2ZME C;  4IL6 C;  4IVN A;  5J4Y A;  1A36 A;  3MN2 A;  1Y1W J;  1SFX A;  1Z77 A;  3ZMD A;  3GF2 A;  5FD5 A;  5J6X A;  3ABM H;  4Y17 A;  5D5V B;  2HVS A;  2NNY A;  3HHG A;  1LE8 B;  3E6B A;  3O2P E;  3KET A;  4KFC A;  4U0Y A;  3H3V K;  1W5S A;  1I3A A;  3HRS A;  3F3X A;  2GWR A;  1QO0 D;  4PJM A;  3HUG B;  2IEK A;  3HSF A;  3QPS A;  1FOK A;  3HOS A;  1SAU A;  3L2R A;  1LDD A;  2E5N A;  1WGX A;  1ETK A;  2V6C A;  4PZJ A;  3K6G A;  2BW3 A;  1XPX A;  1TQM A;  1J9I A;  2JWT A;  5EYR A;  5TGT A;  2YS9 A;  3C2B A;  2W48 A;  1IC8 A;  2QM3 A;  1S5L C;  4UY8 I;  5KHD A;  5BPI A;  5F0C A;  4XIC A;  3TW7 A;  1QA6 A;  4HF2 A;  2KJC A;  4NC8 A;  1XS9 A;  3VPR A;  4NDL A;  1UHW A;  3S3M A;  2F48 A;  2NOJ B;  3RYP A;  1ORK A;  3D0S A;  3IAM 2;  4ITV A;  3ZCO A;  2X4H A;  3LSJ A;  2CW7 A;  3CMA I;  2M7A A;  3HKZ N;  2JA6 J;  2FE3 A;  2V9V A;  4NNJ A;  1IN7 A;  1RKT A;  1X4P A;  2COM A;  5E3O A;  3CJT B;  4Y3O A;  4XID A;  3NEU A;  4M6V A;  4BEH A;  2GA2 A;  2ISY A;  2LMD A;  2STT A;  2PBI A;  2VOO A;  4CDG A;  3I4M J;  3EUH A;  4MIM A;  1K78 B;  2IRF G;  4IXA A;  1DGW Y;  4NUB A;  2OV7 A;  3D5S C;  4HPQ A;  3CJN A;  3K0L A;  4I02 A;  4M6Y A;  1BW5 A;  1TLH B;  3HOU J;  4XQF A;  2AQF A;  1R5H A;  4C3J J;  2WY8 Q;  1TT5 B;  3IH2 A;  4I01 A;  1SEU A;  4MEY F;  2P8T A;  3O3K A;  3L2Q A;  4BY1 J;  4P55 A;  3OYC A;  2HQR A;  1W7P B;  2F5V A;  2M4K A;  1FBU A;  2HYJ A;  2V1N A;  4UHT A;  1S6L A;  2HWV A;  3TO9 A;  1R1V A;  3ABT A;  1K4S A;  3GTL J;  1ZKG A;  3OYL A;  4N9H A;  4FQG A;  2L7K A;  2QKL B;  4HLY A;  4PUS A;  3K4K A;  1FZP B;  4DW6 A;  1D5Y A;  3OR2 C;  1X1P A;  3BPX A;  2QSG X;  2DMP A;  3F8F A;  1MND A;  1FIP A;  1QZE A;  2IA0 A;  3OL3 A;  5JFR A;  3L2U A;  1J75 A;  5B1A H;  3IV5 A;  4A3I J;  3IP4 B;  4FHT A;  2ICW G;  3QYF A;  4F93 B;  5F08 A;  2HOE A;  2F5E A;  4IKF A;  3BZK A;  1HDP A;  2M0C A;  1FMW A;  2NNN A;  2OQG A;  2R7O A;  3TL4 X;  2KQR A;  3EDP A;  1HC8 A;  1WRJ A;  4BAC A;  2WAQ N;  1Z3X A;  1U2W A;  1Y8Q B;  2E1M C;  2XAH A;  3ZP5 A;  1SD7 A;  4OIN F;  2L0K A;  3TOB A;  1CF7 B;  3T5X A;  3H9J A;  3IC7 A;  2IAI A;  3FF5 A;  1D8J A;  4C3H J;  1UAA A;  3RKQ A;  1R7J A;  2VBX A;  5M5W J;  4MFD A;  3TBI A;  4GFB A;  1WJD A;  2Y9Z A;  4YIR X;  2M9H A;  3VFZ A;  2DA6 A;  2STW A;  1IN8 A;  2CUF A;  1QHH D;  1IZ1 A;  1SFK A;  4B48 A;  5CVV A;  5E20 A;  1OCT C;  4BU2 A;  1FEX A;  1YLF A;  1WJ5 A;  1K6O A;  4XLC A;  4M73 A;  4OMY A;  4W97 A;  3LSP A;  2IBD A;  3I58 A;  4E70 A;  3ISP A;  1WJE A;  4N9I A;  1PUE E;  1C0W A;  3FHZ A;  3QU6 A;  3QPT A;  2VQG A;  1QNT A;  1LDJ A;  4M9Z A;  2X1E A;  1FWZ A;  3DFG A;  2FBI A;  3HRU A;  3DEU A;  3G73 A;  3I9V 2;  4EJW A;  2FEZ A;  4JX6 A;  4P9F A;  3WE3 A;  5FLX K;  3NAU A;  4A93 J;  1USS A;  2XC7 A;  1BR4 A;  4IF4 A;  2NVU B;  1RNL A;  2VI6 A;  4RGX A;  1LEA A;  3E7L A;  3JRE A;  2HU9 A;  3ASN H;  4CYC B;  1V5E A;  2DJI A;  1U8R A;  2KZG A;  3HRM A;  2GOX B;  2O5R A;  2HYG D;  3RQ4 A;  1KU2 A;  2EH3 A;  4AYB N;  2FD5 A;  5F6F A;  1U5T A;  5IY5 H;  2H1K A;  1BI3 A;  2ZFW A;  3AG4 H;  3BJO A;  1WFX A;  2BZT A;  1LDK B;  3BR6 A;  2K9M A;  5LHG A;  4PDK A;  2IS2 A;  2K9N A;  2M1B A;  1O3S A;  2XRO A;  3KEQ A;  4M3B A;  4KIC A;  1ZLK A;  3H0G J;  3B6C A;  2PMZ N;  1G3Y A;  2XRL A;  2LBF B;  3LAP A;  3J7A Y;  1UFM A;  4Y13 A;  1TZL A;  1PUF A;  4XRS G;  2F6C A;  1WI3 A;  2JRM A;  3P5J A;  4A3C J;  4B3X A;  2JA8 J;  3M07 A;  4YFK F;  1I1S A;  5BOX A;  4U7D A;  3OYG A;  2IS6 A;  1D5V A;  2BHY A;  1FTT A;  5GTH C;  1SVM A;  4GRI A;  1FLI A;  4J19 A;  4M9S A;  2FQ3 A;  1XC5 A;  3FZV A;  2K9Q A;  4Q48 A;  1E3H A;  5IOZ A;  4IHV A;  2ELK A;  2R5Z A;  5GAD J;  2H94 A;  1P4A A;  2IGN A;  4GCV A;  4U0V A;  1W0U A;  1KYW A;  1VTN C;  2PMH A;  2LKX A;  2CQX A;  4V2G A;  2ADU A;  2K85 A;  2RC4 A;  3SFZ A;  4RAG A;  3W6J B;  1AU7 A;  1WJC A;  3LA2 A;  3U1K A;  4BDY A;  1J59 A;  3FXU A;  1MMA A;  1MJ9 A;  3CDH A;  5E8G A;  2ECC A;  5HOO A;  1ZTR A;  2XB5 A;  5H2F C;  1T0F C;  3FBI B;  2DXI A;  5ICG A;  1MBF A;  4BJ5 C;  4MNU A;  2EWN A;  2PI0 A;  3RDI A;  1YTY A;  4BHB A;  3KP2 A;  3K1N A;  1TL8 A;  2ESH A;  3GEZ A;  4O6J A;  2X1D A;  3M8J A;  4DIQ A;  1EH6 A;  2W84 A;  2XPU A;  4A3J J;  1HLV A;  4FE4 A;  1R6R A;  1KQ9 A;  5B1B H;  1T33 A;  1MNM C;  2W85 A;  2BVM A;  3QP5 A;  3IHU A;  3K7A J;  4ZH4 F;  2R7Q A;  4F55 A;  3V8J A;  5EEA A;  1ITY A;  1B4A A;  4G6Q A;  5EGO B;  2K5C A;  2ZBK A;  4WF2 A;  1SFU A;  4DZP A;  3RPQ A;  1TBX A;  4KT5 C;  1HSJ A;  3T0Y A;  1N78 A;  2A6T A;  4XON A;  1RI7 A;  2CV1 A;  1PP8 F;  3P9K A;  2DA2 A;  2VUM J;  3KZI C;  1MH3 A;  2EZH A;  4GYG A;  4WWC A;  3S2D J;  5J1Y A;  4JK1 X;  2W82 A;  1JGG A;  4ASN A;  3WTT C;  3CF5 F;  2YR2 A;  1VQL I;  4OAY A;  3TED A;  2E71 A;  3PNY A;  3JRF A;  3HIF A;  3CDL A;  3KYL A;  4BQO A;  3U9G A;  5JI6 A;  5ICF A;  4EJT A;  4CCL A;  1D1A A;  2VC1 A;  3H0D A;  4EM0 B;  1SFO J;  2IS4 A;  2X6Y A;  2YPR A;  2KIS A;  3ECH A;  3S2W A;  4JX4 A;  3S1R J;  4I98 B;  3KZZ A;  4ON0 A;  3X2Q H;  2Z16 A;  2P6T A;  1OYI A;  3ZQF A;  1O3R A;  3BTC A;  3Q0V A;  3A2K A;  2GIV A;  5DCM B;  2KP6 A;  1JKR C;  1H89 C;  2KJB A;  4PJ0 C;  3OV8 A;  4YEJ A;  4CCM A;  2A6H F;  1SD6 A;  2VL8 A;  1MSF C;  5LGU A;  2PN6 A;  4DOZ A;  1FYK A;  4AID A;  1IN5 A;  4RDU A;  1FC3 A;  1D1B A;  4YIF A;  1DGR M;  3QWL A;  5E79 C;  1OIS A;  4N4O B;  4OAZ A;  1LJ9 A;  1OCR H;  5M3M J;  1AKH A;  2E2I J;  4AM3 A;  3PSF A;  1YHQ I;  2CSO A;  3PQK A;  4ZZL A;  1LFP A;  1LB2 A;  3GW2 A;  2Q1Z B;  1ZEL A;  5E3L A;  2F4I A;  1DU6 A;  1NG6 A;  1S7A A;  4F92 B;  2DFE A;  3JRA A;  2DMT A;  2XRN A;  2ZXJ A;  1B9N A;  1YI2 I;  5E1W A;  1V5G A;  4AIH A;  2FF4 A;  2M34 A;  2UUZ A;  1WH7 A;  3GVA A;  1KU7 A;  2K9S A;  3GTJ J;  4YEL A;  4Y4R A;  2GXB A;  3K2Z A;  1N25 A;  1R36 A;  1KA8 A;  2HZT A;  1EA3 A;  3FK7 A;  3RKY A;  4CCN A;  2VBY A;  3VSK A;  4B3A A;  5F0F A;  2ZME B;  3ZQI A;  4D7M A;  5DDG A;  2XIG A;  2OJE D;  4HSR A;  1SFE A;  2R93 J;  5CYV A;  3T8T A;  2IXS A;  4QTR A;  5F1J A;  5FLV A;  3F8M A;  1MW7 A;  2KFD A;  2DA4 A;  1Y0U A;  3RPU A;  2QCO A;  1BI2 A;  2VJ5 A;  2XB0 X;  4M6X A;  2VPL A;  2Z5U A;  2HFH A;  3DU6 A;  1YW8 A;  2IGM A;  1T08 B;  4HX4 A;  4MTE A;  1TW2 A;  4DYQ A;  4QPO A;  2TRT A;  3TOA A;  1KZH A;  1T39 A;  1QPM A;  3ZN0 A;  3QPL A;  1PJR A;  1ZRD A;  2VN2 A;  1Z21 A;  2FML A;  3OMY A;  2GAU A;  1MGT A;  5JHU A;  3RI4 A;  4Y33 A;  2ACJ A;  1ENH A;  2DDA A;  2DT7 B;  2HTJ A;  4RBO A;  3OYF A;  3SHF A;  1HDD C;  5J3L A;  3K10 A;  5LHI A;  3LOC A;  3JRC A;  1K7A A;  1OCO H;  2ZKZ A;  5H20 A;  1VQO I;  1D3Y A;  4DGW B;  4XOT A;  2R3S A;  3K4M A;  2JPB A;  1FBQ A;  1G2H A;  4BBR J;  3CCU I;  2Y69 H;  3DV8 A;  2QEX I;  1KU3 A;  1VQ6 I;  3KFW X;  4BL0 B;  4AU7 A;  3WU1 B;  2DMQ A;  2OC6 A;  5IP7 J;  2DFF A;  3HPG A;  4BY7 J;  3R60 A;  3BZ6 A;  3HDD A;  1X3W B;  5DEQ A;  4UVA A;  5LHH A;  2CV2 A;  2G7U A;  2W25 A;  4IQ4 A;  4HBL A;  3D5R C;  1E0E A;  1Z7U A;  3WGI A;  4G6D A;  2IA2 A;  3TDU C;  3R0J A;  4LOC A;  1I6X A;  3S2H J;  3HBL A;  3CCY A;  3K2A A;  3BCB A;  1W5T A;  3W6K B;  4DZJ A;  1TWF J;  1I3Q J;  2WV0 A;  3G6E I;  2GIZ A;  5DUK A;  5IOY A;  4HV6 A;  1X1D A;  2K02 A;  4ENK A;  4I6Z A;  1MD0 A;  2K86 A;  2JA7 J;  4LB6 B;  3CJR B;  3MCZ A;  3M9A A;  4A6E A;  2H8W A;  4BUP A;  2HDC A;  2UWM A;  2V1D A;  4XN0 A;  2DBB A;  1T2K A;  5LRR A;  5EZH A;  5D8L B;  1ZG1 A;  1L3L A;  3PO3 J;  3W2W A;  3HSR A;  3BP8 A;  4KDP A;  2WA0 A;  4OIO F;  4HV5 A;  3P7N A;  4LG0 A;  2VBZ A;  3ZOB A;  1MJA A;  4A69 C;  3RCO A;  4IHW A;  4RLF A;  2DOF A;  2Y0S N;  4UUS A;  1T38 A;  2CW8 A;  3EYY A;  3MQ0 A;  5CQE A;  5DYM A;  4HDU A;  5D4R A;  2E36 A;  2Q2E A;  3KZY A;  2MD5 A;  2Y48 A;  2PJR B;  5K7H A;  2P5L C;  2A5Y B;  1U3E M;  4ZTJ A;  1ZRE A;  1IRZ A;  2KRH A;  3L00 A;  1X2N A;  3E3V A;  4IJA A;  1YRN B;  2JPC A;  5HLI A;  3L7W A;  3PIP F;  3PO2 J;  4KMF A;  1R1U A;  1IAW A;  1MMG A;  4CHU A;  3IRR A;  3CO6 C;  2WB1 N;  2E1M B;  2DN0 A;  2TCT A;  3DPT A;  5FRN A;  4KUM A;  3BG7 A;  3J80 Z;  2LLK A;  1UG2 A;  1R1T A;  3J81 Z;  3OYJ A;  2K7L A;  1YFH A;  5D4S A;  1LE8 A;  2LKS A;  2QVO A;  3KYC B;  4JBA A;  5F0H A;  2DTR A;  3OYA A;  1MBG A;  2QKM B;  4NQW B;  2LY9 A;  4WCG A;  3HUG A;  4WX9 A;  2LSO A;  2L54 A;  2LR8 A;  2CRG A;  4S04 A;  2J5P A;  2F5D A;  1OPC A;  4JP0 A;  2L4M A;  1A35 A;  4D9J A;  5HNH A;  4BXU A;  4RM3 A;  3SFI A;  1DPU A;  2CW0 F;  1LNW A;  2DYS H;  3IKT A;  1F36 A;  1U5T C;  3CES A;  3LA7 A;  3NAR A;  3ZQL A;  3HOT A;  3PL8 A;  1MH4 A;  5ILS A;  2Y0M A;  2L2O A;  2RV8 A;  5KVR A;  1NH3 A;  4M74 A;  5BS6 A;  3CCM I;  3Q9S A;  2MLG A;  4A3M J;  2FXA A;  1BC8 C;  2OCE A;  5J47 A;  1Y39 A;  3QAH A;  2DOE A;  3Q0W A;  3WGH A;  4RS8 A;  3I4N J;  2KMU A;  1IN4 A;  3ZMT A;  5LD2 C;  5IPA A;  4D5F A;  5DD4 A;  1DUX C;  3KEO A;  2VLA A;  2PMU A;  3RZO J;  1Q1H A;  4XR6 A;  4OWR B;  5BQT A;  4YG2 F;  4XLP F;  1QRY A;  2FSW A;  3GFJ A;  3S17 J;  3EYI A;  1OCC H;  2A61 A;  3WOD F;  4Y52 J;  4A0X A;  3RSN A;  1JKO C;  2NXN B;  1K78 A;  2EV5 A;  1BA5 A;  2ECB A;  1TW3 A;  1D0Z A;  1IV6 A;  1R58 A;  1Q1V A;  4ZYG A;  3F9K A;  4XLH A;  4ZJZ A;  3CLQ A;  2OAZ A;  4L18 B;  3PFI A;  2R7U A;  3L2V A;  2V1X A;  3U1D A;  3V42 A;  4CGZ A;  1YW9 A;  2I8D A;  2MAB A;  2MBF A;  4M3F A;  1LVA A;  2W1O A;  1JJ8 C;  5D5U B;  3GTO J;  1G3W A;  2JVG A;  2VJJ A;  2IS1 A;  2MG4 A;  3FXM A;  3B02 A;  3DKX A;  4WXH A;  1O7F A;  2VKH A;  3IH4 A;  4G94 A;  2JSP A;  4D7N A;  1OJL A;  2NS7 A;  3FBN B;  4D0P A;  3LNQ A;  3K1P A;  5JR3 A;  3J7A O;  5EG0 B;  1VQP I;  5AON A;  2MFZ A;  2VE9 A;  1RET A;  3DEW A;  4H4K C;  1H8A C;  3KYD B;  4E6K G;  2JUC A;  1ERD A;  1LFB A;  2LTP A;  4RGS A;  1R22 A;  2KIF A;  5KAI C;  2LFB A;  1X4O A;  3JR9 A;  3IRQ A;  3HOZ J;  3P9I A;  4XM3 A;  1VQ4 I;  2A69 F;  4L9T A;  4HAM A;  1I5Z A;  3CQZ J;  4I99 C;  4P96 A;  3BZC A;  2ZNZ A;  3R0A A;  1GXQ A;  5HS9 A;  4FAS D;  1CF7 A;  1BI0 A;  2Q8K A;  1CQT A;  3IL2 A;  2CJJ A;  4JOM A;  1X58 A;  4ZTF A;  1X2M A;  3FX3 A;  1FOX A;  2EQR A;  1SD5 A;  1TP4 A;  2DPD A;  5FRO A;  4G8X A;  2VXD A;  1YQA A;  1HKQ A;  4OIQ F;  2GLO A;  2BY3 A;  2BY2 A;  4EMS A;  3FM5 A;  3BQY A;  4B43 A;  1YO5 C;  1OCZ H;  5DS9 A;  2WTE A;  1FBS A;  4EM2 A;  4FX0 A;  5FKN A;  1WVR A;  1WH5 A;  4KIT B;  2M3A A;  3SZT A;  1ZG3 A;  3CP2 A;  3TO6 A;  1UMQ A;  3HRT A;  1J09 A;  2DA1 A;  3RJP A;  2P0W A;  3F6V A;  2XKP A;  3FKI J;  3S14 J;  2R7S A;  1IG7 A;  3TO7 A;  1ZAO A;  2E34 A;  3PNV A;  1UEL B;  2O9L A;  1IXS B;  3BC8 A;  1R49 A;  2PJP A;  2BVL A;  4JX5 A;  1E3O C;  4D1Q A;  3WGG A;  4YFX F;  2UXN A;  2YX7 A;  3OOP A;  3FIS A;  3JAM Z;  1WSU A;  3WTZ A;  3E6M A;  2ZSH B;  2CGP A;  2HOS A;  4O3M A;  2JZY A;  3VYR B;  1FSE A;  1DDN A;  1OLT A;  4V2F A;  5F27 A;  3T8R A;  4BH9 A;  4UNO A;  1BM9 A;  3F23 A;  3DEE A;  1SAX A;  1Z3Y A;  2JA5 J;  4R1H A;  3L2W A;  5GP9 A;  3OIP A;  2KHM A;  2LKP A;  2DK8 A;  4F52 A;  4RM2 A;  3V8K A;  1P2F A;  1SVO A;  5CVR A;  1IXC A;  2X0L A;  1O4X A;  4X1E A;  4CH7 A;  1HF0 A;  2QWW A;  2CFX A;  2JK3 A;  3GTP J;  4GGG A;  5JLX A;  1WWX A;  4Q4Z F;  3BOQ A;  2MLK A;  3CUQ C;  3S15 J;  5HLT A;  1MBK A;  3C3W A;  3FHN A;  3SDB A;  2WWY A;  1GDT A;  3WTW C;  2XAJ A;  4KT6 A;  2CQN A;  1QZZ A;  2LBF A;  3QOD A;  1DQU A;  1ZR4 A;  1YYV A;  2DTZ A;  2NRA C;  3S3O A;  4AUX A;  1MMS A;  1N75 A;  3LMM A;  2XV4 S;  2EIJ H;  2VKD A;  1GLN A;  1RC9 A;  4IO9 F;  2XAU A;  2Z99 A;  3VDX A;  3VB2 A;  3F21 A;  4A3L J;  2FOK A;  2LF8 A;  4ESB A;  2LK2 A;  2KIQ A;  2QEN A;  3I3L A;  3NWT A;  4DBR A;  3CMY A;  1TTY A;  2H6B A;  4IZZ A;  5ERI A;  4F91 B;  1WZ2 A;  4BXX J;  1WHU A;  1CGP A;  2QQA A;  4U0W A;  2W57 A;  2R7D A;  3G1L A;  2BW3 B;  4IQJ A;  1P7I A;  4YRV A;  2PX9 A;  3HJE A;  3CCQ I;  1QGP A;  4ZDL A;  3W2V A;  1KQ0 A;  2CUZ A;  3HHH A;  1VQ8 I;  2LNB A;  2CUJ A;  2HXI A;  1BOA A;  2A5W A;  5B5E C;  4K2E A;  1HXD A;  5F04 A;  3VYS B;  1R4N B;  4O5V A;  5C4J J;  5J1R A;  1AWC A;  5KK1 A;  2XHK A;  3E0J B;  2JMW A;  2I5U A;  1QVT A;  5K5Q A;  1R5I D;  2VIX A;  4A12 A;  1SVL A;  3FIW A;  4M3E A;  4BEH B;  4UXN A;  4DYC A;  4E7L A;  4IHY A;  4X6A J;  3MZ8 A;  4C2T A;  2ZC2 A;  1FX7 A;  2VT3 A;  4A5N A;  3IKV A;  4BAY A;  5EGO A;  4QLC U;  3DLL F;  2ZJQ F;  4R79 A;  3LFU A;  3TP3 A;  4XLA A;  4F7Z A;  3GLX A;  3ZN1 A;  5H6Q A;  4IHX A;  4CA0 A;  1LPQ A;  1MJB A;  2VXZ A;  2VOP A;  4B09 A;  3ERM A;  1Z7L A;  2WBM A;  3G3Z A;  2HKX A;  3H36 A;  3V7R A;  2DFI A;  3H1C A;  2JUG A;  1XSX A;  4L5J A;  1FY7 A;  2OCC H;  2VOD A;  2BY1 A;  1ETQ A;  5HVQ C;  4IRH A;  4XNF A;  3GTQ J;  2EIL H;  5FFZ A;  5F64 A;  1B1B A;  1OQY A;  4PGH A;  3OYE A;  3AG2 H;  2W4S A;  2WY7 Q;  2AXT C;  2YU3 A;  2M30 A;  1SMT A;  1ZGJ A;  5EZG A;  3BY6 A;  1FJL A;  2VKE A;  1IV8 A;  3OIO A;  2QZ8 A;  3HB9 A;  5FJ8 J;  5DCM A;  3ULQ B;  4HW0 A;  3H9Q A;  1A31 A;  2NYX A;  5JLW A;  4IOC F;  1QHG A;  1TQP A;  1B59 A;  5HS7 A;  3WTV C;  4ESF A;  5E3M A;  1YIO A;  3OYH A;  3V7S A;  4AD9 A;  4P5O A;  4ENM A;  1S7O A;  3UNG C;  1Z05 A;  3ZPL A;  4PK4 A;  2XUB A;  5L3C A;  3FMS A;  4PJL A;  3CCV I;  4CSW A;  3MEX A;  2G9W A;  5BNG A;  4HNV A;  5D6F A;  2NVY J;  5FKL A;  3ZXS A;  2MH9 A;  1POG A;  4RB3 C;  5IYD J;  2F5F A;  1TC3 C;  2DPU A;  1ZK8 A;  1P9Q C;  4RAY A;  1VQ7 I;  3U2R A;  2R5Y B;  2BYV E;  2MW8 A;  4NB5 A;  1WJB A;  2UXX A;  1QU3 A;  1RUN A;  1XGS A;  1Z6R A;  2G7H A;  4Y7N J;  2QA4 I;  1NK3 P;  3BR5 A;  1YE9 A;  4AIK A;  3ONQ A;  4LMY A;  1NTC A;  2B0L A;  2ZME A;  2W00 A;  3ZQG A;  1EV7 A;  3H3Z A;  4XLE A;  2X6W A;  2QBY B;  4KIF A;  5FO5 A;  3ASO H;  1FMV A;  1V54 H;  2DMU A;  3F6O A;  2NAZ A;  3WHB A;  4QIW N;  1EH8 A;  1J0R A;  3SDG A;  3DKY A;  3VYU B;  4EV0 A;  2LG4 A;  4RB2 C;  3MKW B;  2NVX J;  1JI8 A;  4A3E J;  3BPV A;  3ESW B;  3WE2 A;  4CYD A;  2R92 J;  3OWT A;  5B3S H;  4HYE A;  3TP0 A;  1HKS A;  3GZ5 A;  2FBH A;  2D1V A;  2JVH A;  2A05 A;  2XDV A;  4HNT A;  2M5W A;  1X1B A;  2R0Q C;  4XLF A;  1S72 I;  1J2X A;  3O8G A;  2ZNY A;  4PJJ A;  2HOT A;  1LEB A;  3ABU A;  1P6R A;  3TDZ C;  3ABL H;  5C3E J;  3J7Y J;  3HTU A;  3OS1 A;  2HPI A;  1E3P A;  2EFQ A;  3I53 A;  3E5Q A;  4P1W A;  3TQN A;  1U5T B;  1P4W A;  1Y0N A;  4U87 A;  2E1N A;  2LRE A;  4RA2 A;  2DO7 A;  4MTD A;  3E1S A;  1RES A;  1IXR C;  3VWB A;  2QSF X;  1GVJ A;  4MO7 A;  3JRG A;  2E19 A;  2M7B A;  3MKZ A;  3KEY A;  3QP6 A;  1H0M A;  3C2H A;  2GA1 A;  5DD8 A;  4BYY A;  1D0Y A;  2KDZ A;  1BN5 A;  2RN7 A;  4UB6 C;  3A01 A;  4ENN A;  1PUF B;  3BG6 A;  1F9N A;  4C30 A;  2VBW A;  1YIT I;  4G12 A; 
#chains in the Genus database with same CATH homology
 3DXJ F;  5ILU A;  4S05 A;  2JTV A;  4LK0 F;  2CG4 A;  2OZ6 A;  4ZYH A;  5DCF A;  4L9J A;  4DQ2 A;  2DT5 A;  1IUY A;  1FP2 A;  4HQE A;  4IPA A;  4NHJ A;  3SQN A;  3RYR A;  3ML6 A;  4H0E A;  2LF7 A;  4LLL A;  1YG2 A;  2NS0 A;  1QBJ A;  5CVI A;  3MFK A;  1T6S A;  3WTS C;  1J5Y A;  2KIU A;  4L5I A;  2EV6 A;  4OMZ A;  3JW4 A;  2H6C A;  4M72 A;  2MA3 A;  3P9C A;  1Z6T A;  2GZW A;  4KN7 X;  5D5W B;  5BPD A;  3F8C A;  4LK1 F;  2OBP A;  2OA4 A;  3FXQ A;  3KP6 A;  3I0T A;  2LDU A;  1R00 A;  3GXO A;  2JT1 A;  5D8K B;  4G9Y A;  2AXL A;  4M71 A;  3T1B A;  1UCR A;  2E7W A;  4UV8 A;  3LA3 A;  4HF0 A;  2IA1 A;  3CLO A;  2VT2 A;  2BGC A;  2KKO A;  3BRO A;  2V79 A;  2W24 A;  4JQF A;  3E6C C;  4LLN A;  4IHT A;  4I0B A;  2FA5 A;  2IJL A;  2D2W A;  4WXD A;  1S8N A;  5E17 F;  5LRS A;  3LQQ A;  2V1U A;  1Z91 A;  1UST A;  4EJV A;  1PP7 U;  4EGZ A;  2VON A;  1JHH A;  2FRH A;  3F8B A;  3I59 B;  4RB0 A;  3BDD A;  2P5K A;  3KCC A;  4KYW A;  1MDM A;  4FT8 A;  2QQ9 A;  1FYL A;  5L3E A;  5DUI A;  1G3S A;  1A04 A;  5HDK A;  4WK8 F;  3CUQ B;  5LEJ A;  4MGR A;  2QQB A;  2YSR A;  1IF1 A;  1F5T A;  1S29 A;  1JXS A;  3GFL A;  1FNN A;  1AOY A;  2DQR A;  3DQV C;  2O0Y A;  4EQQ A;  2QYO A;  4A5M A;  2P5V A;  5LGT A;  2YX4 A;  4MQ9 F;  4ENJ A;  6PAX A;  3MZH A;  2HYF A;  4N0B A;  2C6Y A;  5FFX A;  1WQ2 A;  4RGU A;  4P9U A;  2O6G E;  2RKH A;  1T0F A;  2F2E A;  3BJA A;  3O6B B;  5F1R A;  1W4M A;  2O8X A;  3GWZ A;  4XSX F;  1ULY A;  2HR3 A;  3GO5 A;  1I27 A;  3DF8 A;  1D8K A;  4WXC A;  4AIJ A;  5K1Y A;  2ISZ A;  4U88 A;  2IP2 A;  5L3D A;  2OQR A;  2HKO A;  4G7H F;  3RKX A;  2ZJ2 A;  4UUV A;  4HA8 A;  1BIB A;  4Z2Y A;  3N97 A;  4HZF A;  3VOE A;  3REO A;  1OR7 A;  1W7P A;  4HDV A;  4FX4 A;  3LQR A;  3ZMZ A;  4PGG A;  2M45 A;  2M8E A;  2JSC A;  3E97 A;  3F22 A;  4XBF A;  3ECO A;  1ZLJ A;  1F1Z A;  3FM3 A;  2HGC A;  2J5O A;  1XGO A;  3M8F A;  2MC3 A;  2A07 F;  2EFP A;  5DV5 A;  3QRF F;  1QQI A;  4ZZD A;  1BI1 A;  4OIR F;  1ZH5 A;  4HF1 A;  3M8E A;  3Q9V A;  3SXY A;  2IPQ X;  2PFB A;  2EFN A;  1ONV A;  4Y15 A;  2IT0 A;  3Q5F A;  5CLS A;  5FLX Z;  2PG4 A;  4OU0 A;  3H3U A;  2L01 A;  1ZG5 A;  3J80 K;  4OOI A;  3J81 K;  1ODD A;  2H27 A;  4CXF A;  1R5G A;  1QZY A;  2L4A A;  1X3U A;  2DI3 A;  1ZN2 A;  2QLZ A;  2E1C A;  4CIC A;  4L0Z B;  3GFI A;  1G3T A;  3C18 A;  2ELH A;  3GZ6 A;  5AIQ A;  2GXG A;  4HX8 A;  4TV7 A;  4UV9 A;  1XCV A;  2ZCW A;  2O3F A;  2PEX A;  4A2U A;  4U7B A;  5LGN A;  2VE8 A;  2BE5 F;  4LJZ F;  4ZYD A;  1I1G A;  5BMZ A;  3BJ6 A;  4A0Z A;  2PQ8 A;  5J8F A;  1XCB A;  2XKO A;  3I54 A;  5J8C A;  2WC2 A;  1U6G A;  3VEP A;  3FWE A;  2FNP A;  3QPH A;  2OU2 A;  2DLL A;  2XAQ A;  2XAF A;  1ON1 A;  1KYZ A;  1TQI A;  3WG9 A;  4GO1 A;  1LQ1 A;  2K4J A;  1BIA A;  2XGX A;  3WTX C;  1ON2 A;  3HSE A;  1XSD A;  1RZ4 A;  2EJR A;  3CO7 C;  2DQL A;  4RB1 A;  3JTG A;  2P4W A;  5CVJ A;  2FNA A;  3RIR A;  4HLX A;  2RGV A;  1FP1 D;  1XSV A;  5EEH A;  2O61 A;  3K1M A;  3TGN A;  3KP5 A;  1HST A;  3EET A;  3V8L A;  3SZP A;  3AAF A;  1FYM A;  5JVT A;  1YS7 A;  1P4X A;  1XN7 A;  3K9T A;  1GXP A;  3LFK A;  2QBY A;  4ZYE A;  2P6S A;  5A2Q Z;  3R61 A;  5ED4 A;  1STZ A;  5E8I A;  5LBQ A;  4L9N A;  2CO5 A;  1J7K A;  4EGY A;  2Z33 A;  1L0O C;  2EA2 A;  2A3S A;  3JAM K;  3L09 A;  4IHS A;  4I09 A;  2EB7 A;  2CQK A;  3LAJ A;  3B73 A;  3KP3 A;  3GUD A;  5D5X B;  1V4R A;  4BHC A;  4I2O A;  2EA4 A;  5ICC A;  2ETH A;  5ICE A;  4B8X A;  4DNC A;  4IRG A;  2HQN A;  1S3J A;  3H92 A;  2IVM A;  2ESN A;  3KP4 A;  1O3Q A;  1IRG A;  2AS5 F;  4HQM A;  2PLY A;  4RAZ A;  5HLG A;  1SD4 A;  4XRF A;  1HW1 A;  2DU9 A;  5FGM A;  2O03 A;  3V7C A;  2A68 F;  2F5C A;  5LLQ A;  3L2C A;  2EV0 A;  5K5O A;  1TNS A;  2JRT A;  1DPR A;  3CTA A;  4UVC A;  2XVC A;  3D5L A;  1K79 A;  1ZRC A;  3TKY A;  2RNJ A;  3R4K A;  4G7Z F;  2P7V B;  2EFO A;  1XMK A;  5D6E A;  5E18 F;  3I5U A;  3NRV A;  1XGM A;  1YW7 A;  2KRF A;  5H6R A;  4LD5 A;  5IT9 Z;  1XDU A;  1DP7 P;  5L3F A;  4HOB A;  4MHG A;  4I7H A;  4KMU X;  5L3B A;  1T98 A;  2Z9O A;  2K27 A;  4BQA A;  1XMA A;  1IN6 A;  1BJA A;  3WTY C;  3GYH X;  4YFN F;  1MKM A;  3HTS B;  1IW7 F;  1OYY A;  1OYW A;  3HYI A;  3E5U A;  1IRF A;  2FMY A;  1HKT A;  2CYY A;  5A2Q K;  4UVB A;  4BNC A;  2EK5 A;  2L3D A;  1ZYR F;  1P92 A;  3ZMU A;  3I64 A;  2DK5 A;  3E6D A;  1B6A A;  1TNT A;  3FMR A;  3PQJ A;  2XAS A;  4G7O F;  3IWF A;  1XDS A;  4LB5 A;  2D45 A;  1XD7 A;  3FMQ A;  1H9G A;  3ERE D;  3I59 A;  5TJJ A;  2HS5 A;  4A0Y A;  4A6D A;  4M9X A;  1HW2 A;  3ROU A;  2D1H A;  1W7P D;  2RVC A;  5HLH A;  1FSH A;  1FPQ A;  5TRD A;  1JGS A;  3F8N A;  5IT3 A;  2RQP A;  3I71 A;  2KIM A;  1O57 A;  2UZK A;  4LGW A;  3ZMS A;  5E1Z B;  5EEG A;  3CUQ A;  4L0Y B;  1Z9C A;  4RGR A;  1WI9 A;  1EH7 A;  2HEO A;  2FBK A;  3FXR A;  4MQV A;  2K4B A;  3DP7 A;  5HS8 A;  3JTH A;  1OKR A;  2Y75 A;  4GYI A;  4NQW A;  3DPL C;  4LLG F;  3MAJ A;  1H9T A;  1F4K A;  3K69 A;  1PDN C;  2TDX A;  5HDN A;  4I0A A;  3IWZ A;  3GFM A;  4L9V A;  3JSO A;  2EFW A;  3QU3 A;  5HDG A;  3LST A;  2HTS A;  3C1D A;  1FT9 A;  4IRI A;  1OMI A;  2BV6 A;  3BWG A;  3DKW A;  5IT9 K;  3GX4 X;  4Q5S F;  3RTR A;  4BHP A;  2OZU A;  3VOD A;  2R7F A;  3KLN A;  1JHF A;  1B9M A;  4Q47 A;  3EQL F;  3LWF A;  1KQ8 A;  1V3F A;  1G4D A;  2QUF A;  3KLO A;  4KIB A;  4KIG A;  3I4P A;  4LFU A;  4EJO A;  2RDP A;  1XB4 A;  4ESJ A;  1ZRF A;  4GXO A;  5LEK A;  4R8H A;  4EVI A;  4AVP A;  3KE2 A;  1BBY A;  5L3G A;  3NQO A;  2XAG A;  2H09 A;  4KN4 X;  3M7G A;  4QWQ A;  1KU9 A;  3ELK A;  2BEO A;  1RIO H;  3WTU C;  1UB9 A;  3F72 A;  3WU0 A;  2ZO4 A;  4YII A;  5FD6 A;  2FU4 A;  1XGN A;  1ZHF A;  1ZAR A;  1SMY F;  4KA4 A;  4MEX F;  4AWX B;  5K5R A;  1G6N A;  3M1E A;  1GHC A;  4EM1 A;  3E5X A;  4PCQ A;  2CWE A;  4ETS A;  1REP C;  5FB2 A;  3RKW A;  2E7X A;  1HQC A;  4CO8 A;  5AIP A;  1KGS A;  3MZY A;  1RUO A;  3COA C;  3N4M A;  1WKM A;  4KNY A;  3R6S A;  2DW4 A;  1NHA A;  2Z3Y A;  3ZQ7 A;  5CJ9 A;  2P7C B;  1UHM A;  2DAO A;  1O7L A;  3C7J A;  3L9F A;  2Q0O A;  3QOP A;  3ZMV A;  5E1X A;  1R23 A;  2VC0 A;  1BC7 C;  3KP7 A;  4XSZ F;  1E2X A;  2IW5 A;  1U78 A;  1E17 A;  1HBX G;  2BBY A;  2MH2 A;  2L02 A;  1Z1D A;  5CVU A;  3V4G A;  4EJU A;  3CUO A;  1HW5 A;  2A6E F;  4HX7 A;  1O3T A;  2M87 A;  1MDM B;  4CZZ A;  4LG0 B;  4OIP F;  1ZGA A;  1YS6 A;  1MZB A;  3JSP A;  3MWM A;  5ILV A;  2GQQ A;  2OD5 A;  4XLN F;  1JE8 A;  4IVN A;  1SFX A;  3ZMD A;  3GF2 A;  5FD5 A;  5J6X A;  4Y17 A;  5D5V B;  2NNY A;  3HHG A;  3E6B A;  3O2P E;  3KET A;  4KFC A;  4U0Y A;  1W5S A;  3HRS A;  3F3X A;  2GWR A;  1QO0 D;  3HSF A;  1FOK A;  3HOS A;  1LDD A;  2V6C A;  4PZJ A;  1TQM A;  1J9I A;  2QM3 A;  5BPI A;  4HF2 A;  2KJC A;  1UHW A;  3RYP A;  3D0S A;  2X4H A;  2FE3 A;  2V9V A;  1IN7 A;  2COM A;  3NEU A;  2GA2 A;  2ISY A;  2STT A;  2PBI A;  2VOO A;  4CDG A;  3EUH A;  1K78 B;  2IRF G;  4IXA A;  4I02 A;  3CJN A;  3K0L A;  4M6Y A;  1TLH B;  1R5H A;  4I01 A;  4MEY F;  2P8T A;  3O3K A;  4P55 A;  2HQR A;  1W7P B;  1FBU A;  4UHT A;  1S6L A;  2HWV A;  3TO9 A;  1R1V A;  3ABT A;  4N9H A;  4HLY A;  1FZP B;  3BPX A;  3F8F A;  2IA0 A;  5JFR A;  1J75 A;  4FHT A;  2HOE A;  2F5E A;  2NNN A;  2OQG A;  3EDP A;  1WRJ A;  1U2W A;  2XAH A;  3ZP5 A;  1SD7 A;  4OIN F;  3TOB A;  1CF7 B;  3T5X A;  3IC7 A;  3FF5 A;  1D8J A;  1R7J A;  2VBX A;  3VFZ A;  2STW A;  1IN8 A;  1IZ1 A;  5CVV A;  5E20 A;  1YLF A;  1K6O A;  4M73 A;  4OMY A;  3I58 A;  4E70 A;  3ISP A;  4N9I A;  1PUE E;  1C0W A;  3FHZ A;  3QU6 A;  3QPT A;  1QNT A;  1LDJ A;  4M9Z A;  1FWZ A;  3DFG A;  2FBI A;  3HRU A;  3DEU A;  3G73 A;  4EJW A;  2FEZ A;  4P9F A;  3WE3 A;  5FLX K;  1USS A;  4IF4 A;  1RNL A;  4RGX A;  1LEA A;  1U8R A;  3HRM A;  2HYG D;  1KU2 A;  5F6F A;  1U5T A;  1BI3 A;  2ZFW A;  3BJO A;  1LDK B;  5LHG A;  4PDK A;  2M1B A;  1O3S A;  2XRO A;  3KEQ A;  4KIC A;  1ZLK A;  1G3Y A;  3LAP A;  1UFM A;  4Y13 A;  4YFK F;  1I1S A;  5BOX A;  4U7D A;  1D5V A;  1FLI A;  4M9S A;  2FQ3 A;  3FZV A;  4Q48 A;  2H94 A;  1P4A A;  4GCV A;  4U0V A;  1KYW A;  1VTN C;  2PMH A;  2ADU A;  2RC4 A;  3SFZ A;  3W6J B;  3LA2 A;  1J59 A;  3FXU A;  1MJ9 A;  3CDH A;  5E8G A;  5HOO A;  5ICG A;  4MNU A;  2EWN A;  2PI0 A;  3RDI A;  1YTY A;  4BHB A;  3KP2 A;  3K1N A;  2ESH A;  3GEZ A;  4O6J A;  1EH6 A;  2W84 A;  1KQ9 A;  2W85 A;  3QP5 A;  3IHU A;  4ZH4 F;  3V8J A;  1B4A A;  4G6Q A;  1SFU A;  2ZBK A;  4WF2 A;  3RPQ A;  1TBX A;  4KT5 C;  1HSJ A;  3T0Y A;  1RI7 A;  1PP8 F;  3P9K A;  4WWC A;  4GYG A;  4JK1 X;  4ASN A;  3WTT C;  2YR2 A;  3HIF A;  3U9G A;  5JI6 A;  5ICF A;  4EJT A;  2VC1 A;  4EM0 B;  2YPR A;  3ECH A;  3S2W A;  4I98 B;  3KZZ A;  4ON0 A;  2P6T A;  1OYI A;  1O3R A;  2GIV A;  5DCM B;  2KJB A;  3OV8 A;  2A6H F;  1SD6 A;  5LGU A;  2PN6 A;  1FYK A;  1IN5 A;  1FC3 A;  4YIF A;  1LJ9 A;  2CSO A;  3PQK A;  4ZZL A;  1LB2 A;  3GW2 A;  1S7A A;  2XRN A;  2ZXJ A;  1B9N A;  5E1W A;  4AIH A;  2FF4 A;  3GVA A;  1KU7 A;  2GXB A;  3K2Z A;  1R36 A;  1KA8 A;  2HZT A;  3RKY A;  2VBY A;  2ZME B;  5DDG A;  2XIG A;  1SFE A;  5CYV A;  3T8T A;  3F8M A;  1Y0U A;  3RPU A;  1BI2 A;  4M6X A;  2Z5U A;  2HFH A;  1YW8 A;  4HX4 A;  4MTE A;  1TW2 A;  3TOA A;  1T39 A;  1QPM A;  3ZN0 A;  1ZRD A;  2VN2 A;  2FML A;  2GAU A;  1MGT A;  5JHU A;  3RI4 A;  2ACJ A;  2HTJ A;  3SHF A;  5LHI A;  1K7A A;  2ZKZ A;  5H20 A;  1D3Y A;  2R3S A;  2JPB A;  1FBQ A;  3DV8 A;  1KU3 A;  3KFW X;  3WU1 B;  3R60 A;  3BZ6 A;  5DEQ A;  4UVA A;  5LHH A;  2G7U A;  2W25 A;  4HBL A;  1Z7U A;  3WGI A;  4G6D A;  2IA2 A;  3TDU C;  3R0J A;  1I6X A;  1W5T A;  3W6K B;  2WV0 A;  5DUK A;  4HV6 A;  2K02 A;  4ENK A;  1MD0 A;  2K86 A;  4LB6 B;  3MCZ A;  3M9A A;  4A6E A;  2HDC A;  2UWM A;  2V1D A;  2DBB A;  1T2K A;  5LRR A;  5D8L B;  1ZG1 A;  1L3L A;  3HSR A;  3BP8 A;  4KDP A;  4OIO F;  4HV5 A;  3P7N A;  4LG0 A;  2VBZ A;  1MJA A;  1T38 A;  3EYY A;  3MQ0 A;  5DYM A;  4HDU A;  5D4R A;  3KZY A;  2Q2E A;  2MD5 A;  2Y48 A;  2P5L C;  2A5Y B;  1U3E M;  1ZRE A;  3L00 A;  3E3V A;  4IJA A;  2JPC A;  5HLI A;  3L7W A;  4KMF A;  1R1U A;  1IAW A;  4CHU A;  3IRR A;  3CO6 C;  3DPT A;  4KUM A;  3J80 Z;  3J81 Z;  1R1T A;  2K7L A;  1YFH A;  5D4S A;  2QVO A;  4JBA A;  2DTR A;  4WCG A;  3HUG A;  4WX9 A;  2LSO A;  2L54 A;  4S04 A;  2J5P A;  2F5D A;  1OPC A;  2L4M A;  4BXU A;  1DPU A;  2CW0 F;  1LNW A;  3IKT A;  1U5T C;  3LA7 A;  3HOT A;  5ILS A;  2Y0M A;  2RV8 A;  5KVR A;  4M74 A;  5BS6 A;  3Q9S A;  2MLG A;  1BC8 C;  2FXA A;  3QAH A;  3WGH A;  4RS8 A;  1IN4 A;  3ZMT A;  5DD4 A;  1DUX C;  3KEO A;  2PMU A;  1Q1H A;  5BQT A;  4YG2 F;  4XLP F;  2FSW A;  3GFJ A;  3EYI A;  2A61 A;  3WOD F;  4A0X A;  1K78 A;  2EV5 A;  1TW3 A;  1R58 A;  4ZYG A;  2OAZ A;  4L18 B;  3PFI A;  2V1X A;  3U1D A;  4CGZ A;  1YW9 A;  2MBF A;  1LVA A;  5D5U B;  1G3W A;  3B02 A;  4WXH A;  1O7F A;  4G94 A;  4D0P A;  3K1P A;  5JR3 A;  3J7A O;  5AON A;  2VE9 A;  4RGS A;  1R22 A;  2KIF A;  3IRQ A;  3P9I A;  2A69 F;  4L9T A;  4HAM A;  1I5Z A;  4P96 A;  2ZNZ A;  3R0A A;  1GXQ A;  5HS9 A;  1CF7 A;  1BI0 A;  2Q8K A;  3IL2 A;  3FX3 A;  1SD5 A;  2DPD A;  4G8X A;  1YQA A;  1HKQ A;  4OIQ F;  4EMS A;  3FM5 A;  1YO5 C;  2WTE A;  1FBS A;  4EM2 A;  4FX0 A;  3SZT A;  1ZG3 A;  3TO6 A;  3HRT A;  3RJP A;  3F6V A;  2XKP A;  3TO7 A;  1ZAO A;  1IXS B;  2PJP A;  3WGG A;  4YFX F;  2UXN A;  2YX7 A;  3OOP A;  3JAM Z;  1WSU A;  3WTZ A;  3E6M A;  2CGP A;  4O3M A;  2JZY A;  1FSE A;  1DDN A;  3T8R A;  4BH9 A;  4UNO A;  1BM9 A;  3F23 A;  1SAX A;  4R1H A;  2LKP A;  2DK8 A;  3V8K A;  1P2F A;  5CVR A;  1IXC A;  2X0L A;  2QWW A;  2CFX A;  4GGG A;  1WWX A;  4Q4Z F;  3BOQ A;  2MLK A;  3CUQ C;  3C3W A;  2WWY A;  3WTW C;  2XAJ A;  1QZZ A;  1YYV A;  2NRA C;  2XV4 S;  2Z99 A;  3VB2 A;  3F21 A;  2FOK A;  2LF8 A;  4ESB A;  2QEN A;  1TTY A;  2H6B A;  5ERI A;  1CGP A;  2QQA A;  4U0W A;  2W57 A;  2R7D A;  1QGP A;  1KQ0 A;  3HHH A;  2LNB A;  1BOA A;  4K2E A;  1HXD A;  4O5V A;  1AWC A;  5KK1 A;  2XHK A;  5K5Q A;  4A12 A;  4UXN A;  1FX7 A;  2VT3 A;  4A5N A;  3IKV A;  4BAY A;  4QLC U;  4R79 A;  4F7Z A;  3GLX A;  3ZN1 A;  5H6Q A;  1MJB A;  2VXZ A;  2VOP A;  4B09 A;  3G3Z A;  2HKX A;  3V7R A;  2DFI A;  1XSX A;  4L5J A;  1FY7 A;  2VOD A;  5HVQ C;  4IRH A;  5FFZ A;  5F64 A;  1B1B A;  4PGH A;  2YU3 A;  2M30 A;  1SMT A;  1ZGJ A;  3BY6 A;  2QZ8 A;  5DCM A;  3ULQ B;  4HW0 A;  2NYX A;  1TQP A;  1B59 A;  5HS7 A;  3WTV C;  4ESF A;  1YIO A;  3V7S A;  4AD9 A;  4P5O A;  4ENM A;  1S7O A;  1Z05 A;  3ZPL A;  5L3C A;  2XUB A;  3FMS A;  3MEX A;  2G9W A;  5D6F A;  2MH9 A;  4RB3 C;  2F5F A;  2DPU A;  4RAY A;  3U2R A;  2BYV E;  4NB5 A;  2UXX A;  1RUN A;  1XGS A;  1Z6R A;  2G7H A;  4AIK A;  4LMY A;  2B0L A;  2ZME A;  1EV7 A;  3H3Z A;  2QBY B;  4KIF A;  5FO5 A;  3F6O A;  2NAZ A;  1EH8 A;  1J0R A;  4EV0 A;  4RB2 C;  3BPV A;  3WE2 A;  4CYD A;  4HYE A;  1HKS A;  3GZ5 A;  2FBH A;  2D1V A;  2M5W A;  1J2X A;  2ZNY A;  1LEB A;  3ABU A;  1P6R A;  3TDZ C;  3HTU A;  2EFQ A;  3I53 A;  3E5Q A;  3TQN A;  1U5T B;  1P4W A;  2E1N A;  2DO7 A;  4MTD A;  1IXR C;  1GVJ A;  3QP6 A;  1H0M A;  2GA1 A;  5DD8 A;  4BYY A;  1BN5 A;  2RN7 A;  4ENN A;  1F9N A;  2VBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...