1XSDA

Crystal structure of the blai repressor in complex with dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*AP*CP*TP*AP*CP*AP*TP*AP*TP*GP*TP*AP*GP*TP*A)-3'
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsdA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1xsdA02
2GXGA 3I5UA 1R5HA 3ISPA 4G94A 3K1NA 4P96A 1FBUA 2FRHA 2Y0MA 2YX7A 3SQNA 1XGMA 4ESJA 1TW3A 4M9XA 4LFUA 1ZREA 2XAGA 1C0WA 3QU3A 4M6YA 1XB4A 1FT9A 1B9MA 1GXQA 3GFLA 1F5TA 2NRAC 4NHJA 1S3JA 3Q9VA 3DQVC 2VN2A 1J59A 1IN8A 2OA4A 1U3EM 1LEBA 1G3YA 2GAUA 4KUMA 1FSEA 3BOQA 3ZMVA 3M1EA 3MZHA 4U7DA 2LNBA 4Y17A 1B9NA 4IRGA 1TQPA 1H9GA 4CDGA 2V1DA 1FZPB 5KK1A 4BQAA 3GVAA 4LG0B 4WXCA 2FQ3A 2E7XA 2FXAA 2V1XA 2L4MA 3B02A 3SZPA 5H6RA 1XGSA 3R61A 4HA8A 1TLHB 2FBHA 5BS6A 1EH6A 5DD4A 2MBFA 5AONA 3BJOA 1O3SA 1K79A 5LEJA 3MZYA 2O6GE 4KICA 5HLGA 3VB2A 3I64A 3CTAA 2VODA 2KJBA 3AAFA 3WTUC 1GXPA 2P5LC 1XSDA 1ZRFA 4CYDA 3WTYC 2OU2A 1YIOA 2A6HF 2BGCA 2QBYB 1MKMA 2LF7A 5E1WA 4ENKA 3V7RA 5ILUA 1U78A 3R0JA 5ERIA 3E6BA 1HW2A 5EEGA 1UHWA 1BN5A 1QNTA 4K2EA 3QPTA 2V6CA 4BH9A 3EETA 4UVCA 5A2QZ 2STWA 2P7CB 2ZNZA 1JE8A 1W7PD 1SD7A 2RC4A 1R7JA 4P5OA 2FBKA 1YW8A 5L3FA 3NQOA 4L5JA 3KE2A 5L3BA 3FHZA 4ZYEA 5HLHA 5CJ9A 3W6KB 3I58A 1HSJA 4Q47A 3O2PE 3GO5A 2P4WA 1WWXA 3D0SA 2EK5A 1G6NA 5J8CA 3I54A 4EMSA 2XUBA 2NNYA 2C6YA 4AD9A 2HZTA 1XD7A 5E1XA 2VC1A 3C1DA 2Q0OA 4LK1F 1Z9CA 3DPTA 3IHUA 2GA1A 5E20A 3VODA 1KQ8A 3WU0A 3ERED 4AIHA 4F7ZA 3I0TA 3HSFA 4EJUA 3M8EA 2O61A 1E2XA 4ZYGA 2V79A 1X3UA 3ABTA 1YW7A 2QLZA 2EA4A 4HDUA 1SMTA 1H0MA 4RGRA 1RUOA 3K1MA 3PQJA 5IT9K 2W24A 3ZMUA 5D6EA 1LB2A 3ZPLA 1T39A 2QZ8A 2F5FA 1OYYA 2A61A 3U1DA 1H9TA 1S7OA 2UWMA 1ZRCA 4LLGF 2DTRA 4G7OF 4DQ2A 2H94A 1U8RA 1E17A 1G3TA 2HDCA 5E1ZB 4ENNA 3F23A 1XDSA 1ULYA 1FNNA 1V3FA 1DP7P 4UNOA 3R6SA 2DPDA 1ONVA 2GQQA 1GHCA 2IVMA 5HDNA 1QZZA 2EFPA 5DCFA 4HQMA 3V8LA 5JI6A 1LJ9A 1G3SA 5TRDA 5ICGA 1ZHFA 2J5OA 4HX7A 1U6GA 4U0WA 2F5EA 5FD5A 1USTA 2HTJA 1YLFA 2DQRA 3KCCA 1FYLA 5H6QA 1ZG5A 4EJVA 2IPQX 3Q9SA 1IXSB 1LDJA 3F8CA 1UFMA 1IRFA 2EV6A 4HOBA 4JK1X 4Y13A 4I2OA 4IF4A 3QOPA 3ELKA 4HAMA 2VXZA 2XASA 2HOEA 4Q48A 3WGGA 5L3GA 3TO9A 3WE3A 2PG4A 4LD5A 3MAJA 4EJWA 1TW2A 4JQFA 4HDVA 3T8TA 4R8HA 1YS7A 2A6EF 5AIPA 2UZKA 1KU9A 1IN7A 3Q5FA 3F8NA 3TDUC 2KRFA 2P7VB 4RAYA 3QRFF 1IZ1A 1RZ4A 2L02A 2WTEA 1J9IA 5AIQA 1Z7UA 1I1SA 2D45A 2H6BA 2FU4A 4G6QA 3WE2A 1W7PA 4G7HF 3FXUA 3RYPA 3RPUA 3H92A 3M7GA 2NAZA 5FFZA 4HV5A 3EYIA 4CHUA 5HDGA 1O7FA 5L3DA 5FFXA 5IT9Z 4L18B 1D8JA 2BYVE 3E5XA 2MLKA 1ZLKA 4AIKA 4BHBA 2QYOA 2Y48A 4KIBA 4UVBA 3K9TA 2FMYA 4GYIA 3WTVC 3NRVA 1MD0A 1IAWA 3QPHA 1OYIA 1Z6TA 3BP8A 2CQKA 5JR3A 2DU9A 4KYWA 1EH8A 3DKWA 1XCVA 1W5TA 4O6JA 2IRFG 2O0YA 2FSWA 2FEZA 1HSTA 2GWRA 4N9IA 2Q2EA 1RI7A 3U9GA 1FOKA 1J7KA 3SZTA 4YG2F 4U88A 3GYHX 2QUFA 3PFIA 1EV7A 4KT5C 2DK8A 5F1RA 2HTSA 1K78A 4B8XA 5L3CA 4HQEA 2OBPA 2HQNA 2F2EA 3L7WA 4WXDA 1IUYA 2PN6A 1I27A 4GGGA 3WG9A 4FHTA 2X0LA 4B09A 2Z99A 4WCGA 4OIPF 3T1BA 3WODF 2GXBA 3M8FA 1EH7A 2KIFA 5K5OA 2XHKA 4A12A 1GVJA 4IRHA 4U7BA 3ZN0A 5D5VB 3JSOA 4KFCA 4OU0A 1Z05A 1STZA 1R00A 4CZZA 1IXCA 2HGCA 2W57A 3V4GA 4YFKF 2D1VA 2XRNA 1BI2A 2OAZA 4KIGA 5D5XB 4ZYHA 4WX9A 3P9CA 3E97A 3RKYA 1FBSA 5ICFA 1FP1D 1W7PB 3FZVA 3CO6C 2ZKZA 3DXJF 4YFNF 4HLXA 2JSCA 2PBIA 2O3FA 3HRUA 1XMAA 2K4BA 5CVIA 2CWEA 1LDKB 3E5QA 4HLYA 4EQQA 1O3QA 4EVIA 3IL2A 3P9IA 4GXOA 2R7DA 3EDPA 2QQAA 4G9YA 4LJZF 1O7LA 4KNYA 4WF2A 3GEZA 4EM1A 2ZFWA 3KEOA 3NEUA 2LKPA 4FX4A 2L01A 5HS9A 4QWQA 1DPUA 1F1ZA 1P92A 1K78B 1TTYA 2HKOA 4RB0A 4DNCA 1IN4A 2MC3A 4BYYA 3HOTA 4MQVA 3C18A 3GWZA 2FBIA 3HUGA 2W85A 3HHHA 4A2UA 2LDUA 2JPBA 3FM5A 2AXLA 2NYXA 2XAHA 5DDGA 2ZJ2A 5LBQA 2HQRA 2X4HA 4L0YB 1QPMA 1T0FA 1SFEA 2RKHA 2FF4A 2DO7A 3C7JA 3BROA 2HYFA 3ROUA 1T38A 2KIMA 2RV8A 4ZZDA 4EM2A 4IVNA 1MZBA 2GZWA 2RNJA 4IJAA 3F3XA 1OR7A 1J0RA 4ZH4F 4XLNF 1O3TA 2QQ9A 3R0AA 2DBBA 3CJNA 2M1BA 1B4AA 3LAJA 2RVCA 1XSVA 4BAYA 2HEOA 5DYMA 3LA3A 5FD6A 1XGNA 3E6MA 3GFIA 2ZNYA 2IA0A 3DFGA 2M8EA 2YSRA 4L5IA 1R58A 3WTSC 1VTNC 5H20A 4PZJA 4IHTA 1FP2A 2CG4A 4RB2C 1QBJA 3E3VA 2Z3YA 4L9VA 2VT3A 2H6CA 3KLNA 1FYMA 2XAQA 3KZZA 2ZMEA 4UV9A 2MH9A 4HF2A 1D3YA 5JHUA 2BBYA 2G7HA 3QP5A 4YFXF 2DI3A 2CYYA 4CGZA 3VFZA 5ED4A 2FNPA 1S8NA 2B0LA 1BC8C 1W5SA 3BPVA 3O3KA 3K1PA 2FNAA 4ZZLA 3HYIA 1YQAA 5K5QA 4D0PA 2R3SA 3VEPA 3IRRA 3FWEA 3GUDA 4M73A 4KN7X 3F22A 2DK5A 5BPDA 3ZQ7A 2YPRA 3KP3A 2VC0A 1WKMA 2COMA 3HOSA 2VBYA 3DP7A 4L9JA 1SFUA 3FX3A 1KU2A 5J6XA 3ECOA 2O03A 1XN7A 4MEYF 1I5ZA 3CO7C 1HW5A 2ACJA 2A69F 3J80K 1BI0A 3D5LA 3RTRA 3ZMDA 2CSOA 5HOOA 3N97A 1MJAA 4HZFA 4BHPA 3BPXA 4OMZA 4XSZF 3KLOA 3FXRA 1NHAA 4GYGA 3F21A 1ZGAA 2ZCWA 1O3RA 2P5VA 1RUNA 4KA4A 3E5UA 2OD5A 5K1YA 2DW4A 4PGHA 2WV0A 3F8FA 2HYGD 1ZYRF 2Z5UA 2ETHA 4IHSA 1FC3A 2Z33A 3KP7A 4L9TA 2JPCA 2GA2A 2IA1A 3V8KA 4U0YA 2XKOA 1SD5A 4I01A 3CLOA 3F72A 4A0ZA 2STTA 4E70A 3TO7A 2HWVA 4OINF 4I0BA 4FT8A 1W4MA 3HRTA 4RGUA 1TNTA 4RB3C 1FBQA 3WTWC 2P8TA 5ILSA 2HFHA 1DDNA 1FY7A 3EUHA 1U5TC 3JSPA 2EJRA 1PUEE 2M87A 2VONA 1B1BA 3VOEA 3L09A 1AOYA 2P6SA 2P5KA 1P4XA 5DD8A 1YYVA 1BI1A 2KJCA 4KDPA 2TDXA 5LHHA 4LMYA 1TQIA 4LLNA 1HQCA 3HSRA 4MHGA 5DEQA 4EM0B 2K27A 4MGRA 2HR3A 3KEQA 4M71A 3EYYA 2EWNA 4UXNA 3U2RA 1PP7U 1KGSA 3KZYA 1PP8F 1F4KA 3SHFA 2EV0A 2XKPA 3GZ6A 3E6CC 5LHGA 2V9VA 5DUIA 1SAXA 1BC7C 3GF2A 3JW4A 4KMUX 1U2WA 3GXOA 4NQWA 1S29A 2VOOA 4MNUA 1HKTA 1ON2A 1ON1A 2ISYA 1D8KA 2XGXA 1MGTA 3I53A 5D8KB 5CVUA 4N0BA 2L4AA 1FPQA 1IXRC 3R4KA 3J80Z 3F8BA 2QENA 3LFKA 2IA2A 3GZ5A 1J2XA 3O6BB 4M74A 3CUQC 2JZYA 3G73A 3BY6A 1XCBA 5E8IA 4LK0F 2ZBKA 1DPRA 1SMYF 2FMLA 1OKRA 5LRSA 4UHTA 3L9FA 4OIOF 4BNCA 1SFXA 2VBWA 3JAMK 4UUVA 1V4RA 3FXQA 3SFZA 3I59A 4HF0A 3OOPA 4N9HA 1KQ9A 3TQNA 2VOPA 4WXHA 1D5VA 1ZLJA 1I1GA 4LB6B 1TBXA 4KIFA 3TDZC 2QWWA 4XSXF 5BMZA 4MTEA 4ENMA 5FLXK 2A3SA 1YTYA 1BIBA 1KYWA 2Y75A 3J7AO 5HVQC 5ILVA 3F6OA 1YG2A 3ULQB 1T6SA 2ESHA 2JRTA 4RGSA 1OPCA 4ESFA 1S7AA 5EEHA 2DQLA 3IWZA 3V7SA 2FE3A 4YIFA 5LHIA 1B59A 3H3UA 1BIAA 2UXNA 3JTGA 1P2FA 3IKVA 5E17F 1P4WA 4I09A 1XMKA 4RB1A 3I4PA 2E1NA 3WGHA 3B73A 4OMYA 4G7ZF 1QZYA 2OQRA 3WTTC 3L00A 4IPAA 3TKYA 5D6FA 2A5YB 3J81K 2A07F 3LQRA 1ZGJA 6PAXA 4LB5A 1LDDA 2H09A 4M6XA 4OOIA 1BM9A 2E1CA 4EGZA 5CVVA 2Z9OA 4M9SA 2CO5A 2EV5A 3MFKA 1BOAA 4I7HA 3GW2A 2MH2A 3V8JA 5FGMA 4Y15A 2K02A 2IT0A 2CFXA 1ZN2A 2ISZA 5CVRA 2RDPA 2JTVA 3FM3A 5TJJA 1MJ9A 4L9NA 1LNWA 1P6RA 2CGPA 1G3WA 4I02A 3C3WA 1MJBA 2WWYA 3LAPA 5D5UB 5BOXA 1IN6A 1WQ2A 2HKXA 5HDKA 5BPIA 1G4DA 2XVCA 1R36A 2CW0F 3E6DA 4TV7A 3S2WA 3I59B 3M9AA 3RIRA 3KFWX 1KYZA 3H3ZA 1Z91A 3RKWA 2A68F 1ZAOA 4Z2YA 4I98B 4O3MA 3FMRA 1BBYA 2K86A 4WWCA 3TOAA 2DPUA 1KU3A 3MWMA 2PI0A 1U5TA 4ASNA 3JAMZ 2R7FA 4OIQF 4S04A 4HX8A 1R1TA 2XAJA 3ZMTA 4S05A 1KA8A 2MA3A 3ZMSA 2DLLA 3BWGA 2DFIA 5FLXZ 1OMIA 4PDKA 4QLCU 3DEUA 4AVPA 1QGPA 2LSOA 1T2KA 1K7AA 4A0XA 2NS0A 1HBXG 2FA5A 2PMHA 4P9UA 1REPC 5F6FA 2P6TA 1IN5A 2RGVA 3GFMA 3MQ0A 2V1UA 2EFQA 3QU6A 4Q4ZF 1RNLA 3P7NA 2QM3A 1SD6A 1YW9A 4XRFA 3TOBA 5D4SA 5LGNA 1JHHA 2L3DA 3DV8A 1QQIA 2BV6A 3J81Z 5HLIA 4AWXB 3ML6A 3FMSA 3RI4A 3REOA 3WU1B 3COAC 5HS8A 2JT1A 2VBZA 3RYRA 2M45A 2W84A 1ZG1A 4PCQA 3CUQA 3WTXC 5DV5A 1YO5C 2EFNA 3RKXA 1LVAA 2PLYA 1USSA 1UCRA 4EV0A 2XIGA 5J8FA 5D4RA 1T98A 4P55A 1JGSA 1F9NA 4L0ZB 1WRJA 1XDUA 1Z6RA 4EJTA 4NB5A 4R1HA 5ICEA 2PJPA 1BI3A 4GCVA 3MEXA 5CYVA 2D1HA 5LGUA 2BE5F 3P9KA 1FYKA 2ZO4A 4AIJA 5D8LB 4A5NA 2RN7A 2ELHA 2YX4A 1L0OC 1QO0D 1U5TB 1XSXA 4HF1A 4UVAA 2PQ8A 3T5XA 3TGNA 4HW0A 2BEOA 2EB7A 2KIUA 2ZXJA 4U0VA 2ADUA 4A5MA 2WC2A 4JBAA 1R1VA 1KQ0A 3HIFA 4A6EA 1KU7A 1A04A 2OZ6A 3F6VA 5HS7A 4MEXF 2QVOA 3DPLC 3QAHA 3V7CA 1L3LA 1R22A 3IKTA 3TO6A 2EFWA 2VE8A 3PQKA 3RJPA 3FF5A 3LWFA 4Q5SF 4BHCA 1CF7A 3K2ZA 5CLSA 4RAZA 1Z1DA 5FB2A 2QQBA 2DAOA 3FMQA 5DCMA 1IF1A 2PEXA 1UB9A 1TNSA 5LLQA 4I0AA 2K4JA 5L3EA 4HYEA 1R23A 4M9ZA 2Q8KA 4G8XA 4EJOA 2PFBA 2ZMEB 1MDMA 2YR2A 4KN4X 3R60A 3HSEA 2G9WA 3IWFA 3WGIA 4UV8A 3GX4X 1R5GA 5LEKA 2J5PA 3GFJA 1Q1HA 4RS8A 1FWZA 2EA2A 2F5DA 3EQLF 2VBXA 3IC7A 2YU3A 3OV8A 1UHMA 5IT3A 4IRIA 4LGWA 4ZYDA 3CDHA 3CUQB 4PGGA 3KETA 1ZG3A 3W6JB 1Y0UA 5E8GA 2M5WA 1FX7A 2L54A 2RQPA 1ODDA 1BJAA 4O5VA 1JXSA 2VT2A 1FSHA 1HKSA 2EFOA 3QP6A 3BDDA 2XROA 4G6DA 2IJLA 1WSUA 1B6AA 1IRGA 1HW1A 2LF8A 4M72A 4A0YA 3CUOA 4LLLA 1ZH5A 2ESNA 2W25A 3K0LA 3ECHA 2GIVA 4CXFA 1TQMA 5LGTA 4ENJA 3K69A 4CICA 3HHGA 1J5YA 5BQTA 3RPQA 2PMUA 3LSTA 3MCZA 5FO5A 3WTZA 4MTDA 4A6DA 1RIOH 3G3ZA 3T0YA 3ZP5A 2VE9A 3BJAA 2MLGA 3ZN1A 4KMFA 3F8MA 4HBLA 2OZUA 4HV6A 2NNNA 1OYWA 1CF7B 3ABUA 1ZARA 1J75A 3HRSA 2XV4S 5DCMB 1YS6A 3SXYA 5KVRA 4HX4A 3LA7A 2K7LA 1HXDA 2G7UA 3LQQA 3KP5A 3KP4A 4GO1A 2MD5A 4XLPF 4MQ9F 4EGYA 1LEAA 2F5CA 2DT5A 4OIRF 4H0EA 5DUKA 1P4AA 2H27A 1MDMB 3HTSB 3LA2A 1LQ1A 2XAFA 5D5WB 4LG0A 2O8XA 2KKOA 2M30A 4ETSA 1I6XA 4FX0A 3I71A 4ON0A 4IXAA 4YIIA 2D2WA 1PDNC 3DF8A 1S6LA 5ICCA 1R1UA 2UXXA 3BJ6A 2E7WA 3T8RA 2FOKA 1YFHA 3KP6A 2AS5F 3L2CA 2OQGA 4P9FA 3JTHA 2IP2A 3N4MA 3BZ6A 1K6OA 5A2QK 1XGOA 3IRQA 4WK8F 1AWCA 5E18F 4R79A 3GLXA 1O57A 5F64A 1JHFA 2QBYA 1CGPA 1HKQA 4BXUA 3KP2A 5JFRA 4CO8A 5JVTA 5CVJA 3ZMZA 1IW7F 3HTUA 2HS5A 1SD4A 4XBFA 3RDIA 3HRMA 1ZRDA 2IW5A 4RGXA 1WI9A 4ESBA 1FLIA 1DUXC 5LRRA 5K5RA
chains in the Genus database with same CATH superfamily
2GXGA 3I5UA 1YX5A 1R5HA 3ISPA 4G94A 3K1NA 4P96A 1FBUA 2FRHA 2VUMJ 2XPWA 2Y0MA 2PMZA 2YX7A 3SQNA 1XGMA 4ESJA 2E2HJ 1FOYA 1TW3A 2L2OA 4M9XA 2Z1DA 3G4SI 2CUEA 4LFUA 1ZREA 3RSNA 4D1QA 1GV2A 2XAGA 1C0WA 2KRCA 2HVRA 1AA7A 3HOZJ 3QU3A 3RCOA 4M6YA 1XB4A 1FT9A 3DBHB 1B9MA 1GXQA 5F0HA 2WA0A 3GFLA 1F5TA 2VJIA 2WAQA 2NRAC 4NHJA 2VXDA 1S3JA 3Q9VA 3QWLA 2KZGA 4P1WA 3DQVC 2VN2A 2E71A 2LG4A 1J59A 1IN8A 1D1CA 2OA4A 2QSFX 1U3EM 1LEBA 4V2GA 4F55A 1G3YA 2DA3A 4IHVA 2GAUA 4KUMA 2OJED 4XRSG 1FSEA 3BOQA 2OTJI 5JHFA 3SEQA 3ZMVA 3M1EA 3MZHA 4U7DA 2LNBA 2PJRA 4Y17A 4MIMA 3AG4H 1B9NA 3KX2A 4IRGA 1TQPA 1H9GA 4CDGA 2B63J 2V1DA 1FZPB 5KK1A 1AU7A 4BQAA 3GVAA 1X4PA 1P9QC 2BOLA 2Y0SN 4LG0B 2V7FA 3VSKA 4WXCA 1LFPA 2FQ3A 2E7XA 2HQ5A 1D0XA 2FXAA 4ZYAA 1HA8A 2V1XA 5M5WJ 2L4MA 2QCOA 3B02A 1PJRA 2E36A 3SZPA 1E3OC 5H6RA 1XGSA 2W4SA 3R61A 4HA8A 2IAIA 1TLHB 3MMYB 2BHZA 2CMPA 2FBHA 4UB6C 3W2VA 5BS6A 1EH6A 1BOBA 5DD4A 2F48A 2MBFA 3BTIA 5AONA 3BJOA 1O3SA 4BBSJ 4I6ZA 5HNHA 1K79A 5LEJA 3MZYA 2O6GE 4KICA 1BR2A 3VB2A 3I64A 5HLGA 3CTAA 3RQIA 2VODA 2KJBA 2ME0A 3AAFA 3HPGA 3WTUC 1GXPA 2P5LC 1XSDA 3GCMA 1YIJI 1ZRFA 4CYDA 4UUSA 3WTYC 2OU2A 1YIOA 2A6HF 2CV0A 1D1AA 1WVRA 4N4NB 2BGCA 3HOYJ 3PSFA 2QBYB 1MKMA 2LF7A 2ZXIA 5E1WA 3VWBA 4ENKA 2AXTC 3V7RA 5ILUA 2QSGX 1KZHA 1AHDP 1U78A 3R0JA 5ERIA 3E6BA 3LSPA 1HW2A 5EEGA 1UHWA 1BN5A 4XM3A 1QNTA 1VNDA 3WHCA 4K2EA 2FQ4A 3OR1C 3QPTA 3SDGA 2V6CA 4S0HB 2P0WA 4BH9A 1TWHJ 3EETA 4UVCA 2H1LA 2XSDC 4BU2A 5A2QZ 5C44J 2STWA 3JRHA 2LBFA 2P7CB 2ZNZA 1VQLI 1T56A 2XGDA 4IKFA 1JE8A 1W7PD 1SD7A 2JA7J 2MABA 1U0JA 3G1LA 3LSKA 1MMDA 3FDYA 3RPUD 2RC4A 1R7JA 3HOUJ 4P5OA 2FBKA 5EGOB 3CC2I 1IRZA 3CCQI 5E3OA 5B5EC 1YW8A 5L3FA 3NQOA 3M07A 4L5JA 3KE2A 5KNLA 5L3BA 2UV1A 3DU6A 3FHZA 2XGCA 1VFCA 2F4MB 3HOWJ 4ZYEA 5HLHA 5CJ9A 1SVLA 3W6KB 3I58A 1QA6A 1HSJA 4Q47A 1IV6A 3O2PE 1BJZA 2E60A 3GO5A 2P4WA 1WWXA 1IDYA 2B7EA 3D0SA 5EF6A 3GTJJ 2EK5A 1FTTA 1G6NA 3OYMA 5J8CA 3I54A 3LSGA 1E0EA 1GVDA 2OC6A 4DJAA 4EMSA 2XUBA 2NNYA 2C6YA 4AD9A 2HZTA 4NNJA 1XD7A 2I10A 5E1XA 2VC1A 3C1DA 2Q0OA 3MZ8A 5C3EJ 5FKNA 2E1OA 4LK1F 1Z9CA 3DPTA 3IHUA 2O5RA 2GA1A 2TCTA 1X19A 3G1OA 5E20A 3VODA 2IS6A 2A6TA 3WU0A 3ERED 4AIHA 1KQ8A 4F7ZA 2VB6A 3I0TA 3HSFA 4EJUA 2KDOA 3M8EA 5J4YA 3I55I 1QPIA 2O61A 3BG9A 1WJCA 2PJRB 3H9QA 1E2XA 3ABTA 2V79A 1X3UA 2L9VA 4ZYGA 1YW7A 2DT6A 2QLZA 2EA4A 4HDUA 2OUMA 1SMTA 1H0MA 4RGRA 1RUOA 3K1MA 3PQJA 5IT9K 3GTPJ 2W24A 3ZMUA 5D6EA 2EILH 1LB2A 3ZPLA 1T39A 2R5YA 2V9KA 2QZ8A 1P7IA 1OLTA 2F5FA 1OYYA 2A61A 4M3DA 3S14J 3GTQJ 3S2DJ 4CCOA 4FE4A 3U1DA 2JA6J 3QPLA 1Y8RB 4DYQA 1H9TA 3SZGA 2OPTA 3PSIA 4XICA 3S8PA 1S7OA 3GBGA 5JVGF 2UWMA 1OCZH 1ZRCA 1JUPA 1X4OA 3Q0UA 2OV7A 3A0BC 2TRTA 4LLGF 2DTRA 1YHQI 4DQ2A 4G7OF 2H94A 1U8RA 1E17A 2XF5A 1G3TA 4BE2A 1UJ8A 5F0CA 1EJ9A 5E1ZB 2HDCA 3ZRGA 1ENHA 2JJ7A 3QOEA 3MKWB 2DJIA 2BY0A 3ZOBA 3F23A 4ENNA 1S9HA 5KAIC 1XDSA 2EPFA 1ULYA 1FNNA 1V3FA 2HOSA 1ETYA 3BR2A 2K40A 1DP7P 4UNOA 3R6SA 4F52A 2DPDA 1ONVA 2GQQA 5HODA 2ID3A 2IVMA 2R0QC 1T8IA 1GHCA 4XIDA 3DTIA 3OMYA 4LOCA 4X1EA 4J01A 1NK2P 1DP3A 4A3CJ 4GDFA 4A3IJ 1G8XA 5HDNA 1QZZA 2EFPA 5DCFA 4AU7A 4V19K 3CCYA 4HQMA 3V8LA 5JI6A 1LJ9A 1G3SA 2BVLA 5TRDA 3CCRI 2VPLA 5ICGA 4AC0A 2L7MP 1ZHFA 1ZGWA 3TP0A 2J5OA 3CJTB 4BQNA 1TZLA 1LKXA 4HX7A 1U6GA 4U0WA 2F5EA 1MIJA 5FD5A 1USTA 2HTJA 3LL7A 2GBYA 1YLFA 2M0MA 2DQRA 3M3YJ 1Y8QB 3DEEA 2O8KA 3KCCA 2LVSA 4XN0A 1FYLA 4XLHA 5H6QA 4PFPA 1ZG5A 4EJVA 2LBFB 2IPQX 2JA8J 5FKOA 3BR5A 3Q9SA 1IXSB 1R4NB 1LDJA 3F8CA 4AUXA 4IO9F 3OY9A 1UFMA 1IRFA 2I5UA 2EV6A 4HOBA 4BJ5C 1YE9A 2BY3A 5GAEJ 1N25A 4PJ0C 2HNHA 2W82A 1QU3A 1Y39A 2CQXA 3E7LA 2LY9A 4XLEA 2WAFA 4JK1X 5BNGA 4Y13A 3EUKL 1X1CA 4I2OA 5F08A 3JREA 4IF4A 3QOPA 2MD0A 1ITYA 4DW6A 1MH4A 3ELKA 4HAMA 2VXZA 4C2UA 2XASA 2JA5J 2HOEA 3FK6A 1JKPC 4M6VA 4Q48A 2EQRA 3WGGA 1SFKA 2RNGA 3IUOA 5L3GA 4M3BA 3LNQA 4L5EA 3TO9A 3WE3A 2PG4A 2DFFA 2E5ZA 2DYRH 4LD5A 2R7SA 3MAJA 1ORKA 2M9HA 5EZGA 3W3CA 4EJWA 1ETVA 1TW2A 2VL8A 1OISA 2R5ZA 2IGKA 1WH5A 4JQFA 4HRIA 4HDVA 3T8TA 4R8HA 3S15J 1JJ8C 1YS7A 2A6EF 5AIPA 3JRFA 2UZKA 2BHYA 1T0FC 1ETKA 1KU9A 2HOTA 3SFIA 2WY8Q 2LY2A 1IN7A 1ETOA 3Q5FA 3BTCA 3N05A 3F8NA 4NBQA 3RZDJ 3LSMA 3TDUC 3HEFA 2KRFA 2P7VB 4IEJA 2NS8A 2WB1A 4RAYA 2GLOA 2LRDA 2NVQJ 3QRFF 1IZ1A 2R5YB 2DA1A 1RZ4A 4D5CA 2KFDA 2RAEA 2L02A 2WTEA 2JK3A 1J9IA 5AIQA 2XC7A 1N78A 1Z7UA 2NXNB 1I1SA 2D45A 2H6BA 3H5NA 4XLAA 5CQGA 2FU4A 3DBLB 1OR7C 4G6QA 3WE2A 4YIRX 3LMMA 3BC8A 1GT0C 3CMYA 1W7PA 2X6WA 4HSRA 5J1YA 4G7HF 1HCRA 3FXUA 2K9NA 3RYPA 3DEWA 3RPUA 3H92A 3M7GA 3L2QA 2NAZA 2RQQA 4HV5A 5FFZA 3W6VA 3S1MJ 3EYIA 4FTHA 4CHUA 5HDGA 1O7FA 5L3DA 5FFXA 4EATA 1IJWC 5IT9Z 4L18B 1D8JA 2BYVE 3E5XA 2MLKA 2W1OA 1ZLKA 3CF2A 2EIJH 4AIKA 4BHBA 3FXOA 5EG0A 2QYOA 2Y48A 2ZSIB 4KIBA 4UVBA 3K9TA 2FMYA 4N4OB 4GYIA 1A6QA 1QRYA 3WTVC 1LFBA 2M7BA 5HLTA 1BW5A 3BT9A 5IYCJ 3NRVA 1MD0A 4BDYA 1IAWA 3QPHA 1MBFA 1OYIA 5F1JA 4A3LJ 1Z6TA 3BP8A 4A3DJ 2CQKA 5JR3A 2DU9A 2CQNA 5IPAA 4UUTA 4KYWA 1EH8A 4CH7A 1XCVA 1W5TA 3DKWA 2IGMA 1TT5B 1WPKA 3K4MA 4O6JA 2D5VA 1ZTRA 2IRFG 2O0YA 2FSWA 2FEZA 2DODA 3K10A 1HSTA 3HGGA 1RPWA 2F5VA 2GWRA 4N9IA 2Q2EA 1R5ID 2Z2SB 1DU6A 2XF7A 1RI7A 3U9GA 2ZMEC 1WJDA 3FXMA 4E7KA 4PK4A 3CP8A 1ZQ3P 1FOKA 3J7ZI 3OYAA 3C2GA 1J7KA 4A69C 3OYIA 4RAGA 3SZTA 4YG2F 4U88A 4FCYA 3PJRA 3GYHX 2QUFA 3PFIA 1WH7A 3OYNA 4B3XA 2ZJPF 1GLNA 1EV7A 4KT5C 3A01A 2XGEA 1MH3A 2DK8A 5F1RA 2HTSA 1K78A 4B8XA 3AG2H 5L3CA 4HQEA 2W7NA 1VZ0A 1PYVA 2OBPA 4B48A 4EEFG 1YJ9I 2G0EA 2HQNA 2F2EA 3L7WA 2P81A 2NVXJ 4WXDA 1IUYA 4E7HA 4PJLA 2R7OA 3HDDA 2R7QA 2PN6A 3HG9A 2N8GA 1I27A 5E3MA 2CUFA 4GGGA 3WG9A 4B47A 4FHTA 2X0LA 4B09A 3ZQCA 2MYSA 2JSPA 2Z99A 3A4CA 1GUUA 1Z67A 1TP4A 4WCGA 4OIPF 1IGNA 3T1BA 1NTCA 1OCRH 3WODF 2ECCA 2LR8A 3M8FA 2R5ZB 2GXBA 1EH7A 3L2UA 2KIFA 5K5OA 2DMQA 2XHKA 2FOWA 4A12A 1GVJA 4IRHA 4U7BA 1FOXA 3ZN0A 4IQJA 1WJ5A 2KQRA 2LYCA 5D5VB 3JSOA 2XSJC 2HPMA 4KFCA 1ACIA 4UB8C 1Y56A 4XQFA 4OU0A 1Z05A 1STZA 2EIKH 1R00A 9ANTA 4CZZA 1D0YA 3HJEA 1IXCA 4XKVA 3L1PA 2HGCA 2R4GA 2F4IA 3GZNB 2W57A 3DCFA 3V4GA 4ANJA 4YFKF 2JN6A 2D1VA 2XRNA 1BI2A 1ETWA 1ZR2A 1FJLA 1EF4A 3LSJA 2M4KA 2OAZA 5FROA 4DYRA 4KIGA 4IQ4A 5D5XB 4KJZA 4ZYHA 4WX9A 3P9CA 3E97A 3RKYA 3HPHA 4AIDA 1NG6A 2CW7A 5H2FC 4BE0A 2YU9J 1W0TA 1FBSA 2CUJA 4Y3OA 5F04A 1LUJB 3OR2C 1X1BA 5HNFA 5ICFA 1FP1D 1W7PB 3FZVA 3S3MA 3H1CA 3CO6C 3G1MA 2F6CA 3KPHA 3PUBA 1E3HA 2ZKZA 4BACA 1NH3A 3DXJF 2XPVA 2OCCH 5J1UA 4YFNF 5C4XJ 4HLXA 1XG1A 2JSCA 3AFHA 2PBIA 1LE8A 5TISC 2O3FA 3HRUA 1XMAA 1ETXA 5M5YJ 5EG0B 1XMXA 2K4BA 5CVIA 2CWEA 3I4MJ 5EJCA 2K9QA 3RKQA 2NVTJ 2BZTA 4E7IA 2CV1A 1LDKB 3PFYA 3E5QA 4HLYA 4EQQA 4RLQA 3PIOF 1NG7A 1O3QA 2LC2A 4EVIA 2QA4I 2LKXA 1OJLA 3IAS2 3IL2A 1FEXA 1I3AA 3P9IA 3OS1A 3BQYA 1V55H 1G2HA 4GXOA 2LKSA 2FX0A 2R7DA 3BLYA 1B8IA 3EDPA 1UHSA 2QQAA 3GLLA 4G9YA 3KYCB 4LJZF 2DMPA 4FETA 2QKLB 1OCCH 2K9LA 2OTLI 1O7LA 3BCBA 4DBRA 3DKYA 3MKZA 4KNYA 3ZQHA 2HPIA 4BUPA 3H3VK 2RREA 4WF2A 3GEZA 4EM1A 3DLAA 1VQKI 2LK2A 3AG3H 2CQ7A 2ZFWA 4OAZA 3MD2A 1K6YA 3KEOA 3NEUA 2DJNA 2R7WA 2LKPA 4FX4A 3EUHC 1W36C 1V5EA 3A01B 2CS3A 2AQEA 2L01A 5HS9A 5J3LA 4QWQA 1DPUA 1F1ZA 1P92A 3E1SA 1K78B 3KYLA 1TTYA 4XMYA 3S1NJ 2XDVA 3AKZA 1V54H 2HKOA 4RB0A 3ZR8X 4DNCA 2HDDA 1IN4A 3S1RJ 3CCEI 2MC3A 4LG3A 4BYYA 4RMNA 3BR3A 3LSIA 2PX9A 3HOTA 3J7AY 4MQVA 3S3OA 1PUFA 3C18A 3GWZA 2Y9ZA 2FBIA 2IS4A 3HUGA 2W85A 3BR1A 4ZDPA 2KL4A 2X1DA 3HHHA 1FOWA 3Q0WA 2LH9A 2EZKA 3LOCA 2LDUA 2HYJA 2JPBA 3FM5A 4XKCA 4A2UA 4LIUA 4RBOA 2AXLA 2NYXA 2XAHA 3D5SC 5DDGA 5B66C 2ZJ2A 5LBQA 2HQRA 2X4HA 2IEKA 4L0YB 2WY7Q 3CDIA 1QPMA 1T0FA 1SFEA 2RKHA 2WADA 2FF4A 2DO7A 1HDDC 2H8RA 1WFXA 2NVYJ 2DFEA 4CCMA 3C7JA 3BROA 4XRSA 2UUZA 4BS9A 4JX4A 3ONQA 2HYFA 3ROUA 2Y0SA 4B44A 2X51A 3VYTB 1OQYA 4M3EA 1MNDA 3ASNH 4A3EJ 1T38A 2HXOA 2KIMA 3H0DA 4PJMA 2RV8A 1KONA 3JRIA 4ZZDA 1W36D 4EM2A 4IVNA 4ZJZA 4IOAF 1MMAA 5K7ZA 2DFHA 1MZBA 2GZWA 2RNJA 4IJAA 3F3XA 4MFDA 3VSLA 2X85A 1OR7A 1J0RA 3I4NJ 3BQZA 4ZH4F 1TT0A 4XLNF 1O3TA 2IGNA 2QQ9A 3R0AA 2DBBA 3CJNA 2M1BA 1B4AA 4C3JJ 3LAJA 3Q3SA 2RVCA 1XSVA 2V4JC 1I50J 2VJJA 4JX5A 4BAYA 2JQ7A 4A3BJ 1LE8B 2HEOA 5DYMA 2X6XA 3JCUC 3LA3A 3IH4A 3PNVA 4AVZA 5FD6A 3I3LA 3UR3C 1XGNA 3E6MA 2L7ZA 2JMWA 4NC6A 3GFIA 2R93J 2ZNYA 2IA0A 3DFGA 3OIQA 2M8EA 2YSRA 4CUGA 2LLKA 4L5IA 1R58A 4LIVA 1Z0XA 3PM1A 2ZXHA 1V5GA 3K2AA 3FXLA 1O4XA 1QVUA 4J00A 3WTSC 1VTNC 3DTEA 4RDUA 5H20A 1Y1VJ 4PZJA 4A3MJ 4CA0A 4IHTA 1FP2A 2CG4A 2FD5A 4YRVA 2X9DA 4RB2C 1QBJA 3E3VA 4NUBA 2Z3YA 4L9VA 4H4KC 4BQOA 1R6RA 2VT3A 3FISA 2H6CA 1TWCJ 3VYSB 3KLNA 3CCSI 5DTDA 5J40A 1OFCX 2XAQA 1FYMA 3KZZA 2KP6A 2ZMEA 3JR9A 1Z3YA 3ZXSA 4GRIA 5DS9A 4UV9A 2MH9A 3PO2J 3ASOH 1A31A 4HF2A 2HXIA 1D3YA 3GTGJ 2JA2A 2R7TA 5JHUA 4DZPA 4IZZA 2BBYA 4BXXJ 3QODA 5E3NA 2G7HA 2E1MB 1WJBA 3QP5A 2VIXA 4YFXF 2DI3A 2R92J 3SDBA 2CYYA 3OSGA 4CGZA 3VFZA 4XNFA 4XKBA 5ED4A 4IL6C 3WU2C 2FNPA 1FTZA 1N77A 4KT6A 1S8NA 2B0LA 3J7YJ 1BC8C 3OYDA 1K83J 1T08B 2DA6A 3BPVA 1W5SA 3O3KA 3K1PA 1E3PA 4CCLA 2FNAA 3H0GJ 4ZZLA 1RESA 3HYIA 1YQAA 2QF7A 3CZ6A 5K5QA 1PUFB 4D0PA 1BW6A 2R3SA 3VEPA 3HC7A 3FWEA 3IRRA 3GUDA 4M73A 3HUGB 4BJ6C 4KN7X 3F22A 3CJQB 1MMNA 2DK5A 1UMQA 5BPDA 1I6HJ 2IS1A 3ZQ7A 2YPRA 3KP3A 2VC0A 1WKMA 5B3SH 2COMA 2V1NA 4RA2A 2Z16A 3HOSA 4BGDA 2VBYA 1FMVA 3BG6A 2VLAA 3DP7A 1WGXA 3KEYA 4L9JA 2MFZA 1SFUA 4FASD 1SVOA 3FX3A 1KU2A 1U8BA 4XORA 1JI8A 5J6XA 3ECOA 5FLVA 2O03A 1XN7A 3GTOJ 3K6GA 4MEYF 1I5ZA 2IGOA 3CO7C 4A3KJ 2CQQA 1HW5A 2VKDA 4PFOA 2ACJA 2KZVA 2A69F 2ZB9A 3W2WA 4UUSB 3J80K 2GXAA 2X6OA 1BI0A 2R7UA 3D5LA 3RTRA 3ZMDA 1JJ6C 4CCKA 2CSOA 5TGTA 5HOOA 3N97A 4XR6A 4G12A 2ELJA 1MJAA 2NOGA 4HZFA 3JRBA 4BHPA 4D5FA 3BPXA 3HM5A 4D9JA 4OMZA 4XSZF 1X2MA 3KLOA 1ZELA 3FXRA 4DZJA 3HKZN 1NHAA 4GYGA 1SC7A 2XAUA 1IG7A 3F21A 1ZGAA 2ZCWA 1O3RA 1VQ7I 2P5VA 1DGRM 3CP2A 1SVMA 4KA4A 1RUNA 3E5UA 2OD5A 4HNUA 5K1YA 1VF9A 2DW4A 3TP3A 1QZEA 4PGHA 4PSXA 2WV0A 2K3PA 3F8FA 4E7LA 1MSFC 2HYGD 1ZYRF 2ZJQF 2KHMA 3GTLJ 2Z5UA 4PUSA 2ETHA 4PSWA 2XPUA 4IHSA 4MO7A 1CQTA 3CCLI 1FC3A 2KLOA 2Z33A 3KP7A 4L9TA 2JPCA 2GA2A 5E3LA 2IA1A 3NWTA 3V8KA 4U0YA 3OL4A 2XKOA 1SD5A 3PNTA 4QPQA 4I01A 4JX6A 3CLOA 3F72A 1MBKA 4A0ZA 2STTA 4E70A 3SJMA 3TO7A 2HWVA 2B9SA 4OINF 3O8GA 1VQ4I 3BTLA 1JKOC 5DM7F 1JTXA 4I0BA 2MG4A 3FHNA 2K9MA 2HI3A 5IP9J 3S16J 3HKZA 3K4JA 3FXKA 5B1BH 4FT8A 1W4MA 3HRTA 4RGUA 1TNTA 2ID6A 1VI0A 3HB9A 3TW6A 3DBRB 2CW8A 4DGWB 4RB3C 1FBQA 4DOZA 2JRMA 2P8TA 3WTWC 5ILSA 4B43A 4AYBN 2HFHA 3H5AA 1JT6A 1HC8A 5CQEA 1DDNA 4HSTA 1FY7A 4Y7NJ 5GTHC 4A3JJ 3I56I 3EUHA 3CESA 3L2WA 1U5TC 2VKEA 3JSPA 3DU5A 2EJRA 3CCVI 1PUEE 2M87A 1R9TJ 1B1BA 2VONA 1RETA 1TWGJ 3QYBA 2HOAA 3AL0C 3VOEA 5E79C 2MGQA 3L09A 1AOYA 2M3AA 3FK7A 4CCNA 2P6SA 2P5KA 1P4XA 3H36A 1YYVA 1BI1A 5DD8A 2KJCA 2VQHA 3VPRA 4KDPA 2TDXA 2OCEA 1YX3A 5LHHA 4LMYA 1TQIA 4LLNA 1HQCA 4B4CA 2ZJRF 3HSRA 2DXIA 1Z7LA 4MHGA 5DEQA 3OYEA 4EM0B 2K27A 4MGRA 2HR3A 3KEQA 1X1DA 3DTKA 1HLVA 5IOZA 2EIMH 2DMUA 3U21A 3IH3A 4M71A 3EYYA 1SANA 1UG2A 2L9RA 2EWNA 4UXNA 3U2RA 1PP7U 1KGSA 3CDLA 4RM3A 1AKHA 4I76A 3PO3J 4CSWA 3KZYA 2IS2A 1PP8F 1F4KA 3SHFA 2EV0A 2XKPA 4F3QA 2X6YA 3M1CA 4PJNA 3GZ6A 3E6CC 5LHGA 3FXJA 2V9VA 5DUIA 1WJFA 1Z3XA 1SAXA 1BC7C 1D0ZA 1WI3A 3GF2A 3JW4A 1ZK8A 4KMUX 1U2WA 3GXOA 4NQWA 1S29A 1YRNA 2VOOA 4MNUA 1HKTA 2JWTA 1ON2A 3OYJA 2KIQA 1ON1A 2ISYA 2A5WA 1D8KA 1VQNI 2XGXA 3LFUA 1MGTA 3S93A 3I53A 5D8KB 3G71I 5CVUA 1BR1A 3GMEA 4N0BA 2L4AA 1FPQA 2HU9A 5FRMA 1IXRC 2LD5A 3R4KA 3K70C 3BR0A 3J80Z 2YUSA 1VQ9I 2DN0A 3F8BA 5CKTA 3JRAA 2QENA 2LFBA 3LFKA 2IA2A 2M4GA 3GZ5A 1J2XA 3O6BB 4M74A 3CUQC 2JZYA 2R7ZJ 3G73A 3BY6A 5EZHA 3KIOA 4W1UA 1XCBA 5GP9A 5E8IA 4LK0F 2BY2A 1A36A 4UY8I 3TBIA 2ZBKA 5IP7J 1DPRA 1SMYF 1BA5A 2HVQA 4BBRJ 3JRDA 2FMLA 3ZQQA 1OKRA 5F27A 5JLXA 5LRSA 4UHTA 4IHYA 2AQFA 3L9FA 2K9SA 4OIOF 4BNCA 4AM3A 1SFXA 2BW3A 2VBWA 3JAMK 4UUVA 1V4RA 3FXQA 4X6AJ 3SFZA 1W1WE 3SYTA 1DQUA 3I59A 4E7JA 4HF0A 3OOPA 2E2IJ 4N9HA 5JLWA 1KQ9A 3TQNA 2ZXWH 3OWTA 4WXHA 2CUZA 2DYSH 4ZC3A 2VOPA 1D5VA 1P7JA 1ZLJA 3ERMA 1I1GA 2BY1A 4LB6B 1TBXA 4KIFA 2L7KA 2QWWA 4XSXF 3TDZC 5BMZA 4MTEA 4ENMA 5FRNA 5FLXK 2NS7A 2A3SA 1YTYA 1BIBA 1KYWA 2Y75A 3J7AO 5HVQC 5ILVA 4U87A 3HL2A 3TMOA 3F6OA 2Q1ZB 1YG2A 1T6SA 3ULQB 1OCTC 3F9KA 2ESHA 2WV1A 2JRTA 3CMAI 4RGSA 1HOMA 1OPCA 4ESFA 1S7AA 5EEHA 2DQLA 1QHGA 3ABKH 3H9GA 3U1KA 3CC4I 1GDTA 3K70D 2Y2ZA 1I39A 2EH3A 3IWZA 1N75A 3CQZJ 3V7SA 3OYFA 3OS2A 2FE3A 4YIFA 5LHIA 1B59A 3H3UA 1BIAA 2UXNA 3JTGA 1P2FA 3IKVA 5E17F 4JOMA 5J4VA 1P4WA 4I09A 2W48A 1F43A 4HEA2 4JP0A 1VQ8I 1X1AA 1XMKA 4RB1A 2W00A 3I4PA 2E1NA 3WGHA 1YOVB 3B73A 4OMYA 3BCAA 4G7ZF 1QZYA 2PMZN 2OQRA 3WTTC 4OAYA 3A0HC 3L00A 3HOXJ 4IPAA 3V42A 3TKYA 1A5JA 1FIPA 1NK3P 2A05A 3H35A 3PUFA 5D6FA 3OYBA 2A5YB 3OL3A 3J81K 2A07F 4A3GJ 3LQRA 1AKHB 1H8AC 1ZGJA 6PAXA 4LB5A 1JT0A 1LDDA 2H09A 3GTMJ 2V26A 2H8WA 4M6XA 4OOIA 1X3ZB 1BM9A 2LP0A 3OIOA 4QSHA 1Y1WJ 4BY7J 4JYKA 1R49A 4NQWB 4YELA 2E1CA 1HF0A 1YRNB 5GAGJ 3W2AA 4EGZA 5CVVA 5M5XJ 3UKGA 2Z9OA 1Y0NA 1WHUA 3MN2A 4M9SA 2CO5A 4ZTFA 2Q2EB 3ZQIA 2EV5A 3MFKA 3CD6I 1BOAA 1X1PA 4I7HA 4Y33A 3GW2A 1IDZA 2MH2A 2HVSA 2ICWG 5GTIC 1D1BA 3MKYB 1BL0A 3V8JA 5FGMA 2MC4A 4Y15A 2L5QA 3ZGKA 2K02A 5GADJ 2IT0A 2JVHA 4IX7A 2CFXA 3K4CA 2VJ4A 1ZN2A 2CU7A 1MMGA 2ISZA 4E6KG 4C30A 5CVRA 2DOAA 2RDPA 4C2MJ 2KMUA 3FBIB 2JTVA 3FM3A 5TJJA 1MJ9A 4L9NA 1LNWA 5GPAA 1P6RA 5KAFC 1G3WA 2CGPA 3B6AA 4I02A 3C3WA 2Y9YA 1MJBA 5KHDA 2WWYA 2EBIA 3LAPA 1WZ2A 2QQ8A 5D5UB 4C3HJ 1IN6A 1WQ2A 5BOXA 2CRGA 2HKXA 5HDKA 1K4SA 5BPIA 1F36A 2DDAA 4CYCA 1G4DA 2XVCA 1R36A 2K85A 2CW0F 3E6DA 1TWFJ 1TC3C 3L2RA 2BW3B 1RR8C 3OS0A 4TV7A 3S2WA 3K4BA 3ABLH 1EKEA 3I59B 3M9AA 3RIRA 3IP4B 2DOFA 3KFWX 3CCJI 2M34A 3VYUB 1KYZA 3H3ZA 2VJ5A 1Z91A 3RKWA 1S5LC 3BG7A 2A68F 1ZAOA 4ZTJA 4Z2YA 2L0KA 2LY1A 4I98B 4BDZA 4O3MA 3FMRA 1BBYA 2K86A 4WWCA 1H88C 1XC5A 3S3NA 3BG5A 5LFAA 3TOAA 2DPUA 1KU3A 1HDPA 3CMEI 3MWMA 1K4TA 2PI0A 1IV8A 4OWRB 1U5TA 3S2HJ 4ASNA 3JAMZ 1UELB 1A6IA 2IBDA 2R7FA 4OIQF 4S04A 4HX8A 2LMDA 1Y6IA 1R1TA 2XAJA 4M3GA 4QIWN 2E35A 4HG2A 3ZMTA 4S05A 1KA8A 3LSRA 4XL9A 2MA3A 3L2VA 3ZMSA 1IRXA 2DLLA 4A93J 3BWGA 2DFIA 3NAUA 5CPRB 5FLXZ 1OMIA 4XK4A 5J1RA 1APLC 1ERDA 4PDKA 3ZQLA 2Y31A 3UNGC 4QLCU 3X2QH 3DEUA 4AVPA 1QGPA 4BEHA 2LSOA 5GPCA 1UG0A 1VQOI 2VQCA 1T2KA 3G2BA 2M7AA 3H9JA 1QHHD 1K7AA 4D7MA 3BZCA 3PL8A 1SEUA 3VYRB 4A0XA 2NS0A 1HBXG 3C2HA 1JTYA 3ABMH 2FA5A 2PMHA 4BKXA 4P9UA 1REPC 5F6FA 2P6TA 1IN5A 5IYDJ 2RGVA 3GFMA 2VPRA 3MQ0A 3M4OJ 2K5CA 2V1UA 5K7HA 3QPSA 2EFQA 3QU6A 3P5JA 1LPQA 4Q4ZF 4MLOA 2EZHA 3E0JB 3A03A 1JUSA 1RNLA 3P7NA 2QM3A 1SD6A 1YW9A 4XRFA 3HOVJ 5GAHJ 3OYHA 1W0UA 3CF5F 3TOBA 5D4SA 5LGNA 1X58A 1JHHA 1MW7A 2BXZA 2L3DA 4NDLA 3DV8A 1B8IB 2DA5A 1QQIA 5M3MJ 2XRLA 3CJRB 2AO9A 2BV6A 2Y69H 3JRCA 3J81Z 5FJ8J 4ZDLA 4CZCA 2VKVA 5HLIA 2AHQA 4F93B 4AWXB 2BXYA 4QPOA 3ML6A 2X1EA 3AG1H 3FMSA 3F0CA 3EUAA 2L9NA 3RI4A 3REOA 3H5RA 1MSEC 3WU1B 3COAC 5HS8A 2JT1A 4G6TB 2VBZA 3OSFA 1IUFA 3RYRA 4E7ZA 2M45A 2NOJB 2W84A 2QEXI 2O7OA 4LITA 1ZG1A 4PCQA 3CUQA 2E2JJ 2DOEA 3WTXC 4W97A 4M3FA 4II3A 3ZCOA 3K4KA 5DV5A 1YO5C 2EFNA 3RKXA 3A2KA 1LVAA 1T33A 2PLYA 1USSA 1UCRA 2F4OB 4F92B 1XX5A 2XIGA 2L9SA 4V2FA 3MVPA 4EV0A 5J8FA 5D4RA 3B6CA 4FISA 4RLFA 1T98A 4P55A 2DCEA 1JGSA 1F9NA 4CYCB 4L0ZB 1WRJA 1XDUA 1Z6RA 3BR6A 4EJTA 3MKLA 4NB5A 1RKTA 4R1HA 5ICEA 1JKRC 4KITB 3CLQA 2ZSHB 3ESWB 2KT0A 2PJPA 2DMTA 1BI3A 3OYLA 2DMNA 3IAM2 4GCVA 2GM4A 2QKMB 5KCMA 3MEXA 4B3AA 2R7RA 2X1CA 5FLMJ 5CYVA 2D1HA 3KYDB 5LGUA 2BE5F 3P9KA 1FYKA 2E34A 2MW8A 2ZO4A 3M8JA 4AIJA 1K61A 5D8LB 4A5NA 2RN7A 1MMSA 2ELHA 2WAEA 2YX4A 1L0OC 1QO0D 1U5TB 1WJEA 1XSXA 2JUGA 4HF1A 3K7AJ 4UVAA 2JVGA 2PQ8A 3T5XA 3TGNA 3PIPF 4HW0A 2BEOA 2X48A 2EB7A 3AL0B 2KIUA 2ZXJA 4U0VA 2ADUA 4A5MA 2WC2A 1SFOJ 3C2BA 4JBAA 1R1VA 2DA4A 1H89C 3NARA 1KQ0A 5J47A 3HIFA 4A6EA 3IV5A 1A04A 1KU7A 1VQPI 2OZ6A 1X2NA 3F6VA 5HS7A 4MEXF 1WJAA 2ZC2A 4HNVA 1MBGA 2K3FA 1B72A 2QVOA 3DPLC 3QAHA 3V7CA 3WHBA 5IOYA 4BEHB 1L3LA 1R22A 3IKTA 1TWAJ 2XF6A 3TO6A 3S17J 3NWSA 2EFWA 2VE8A 3K4NA 5EYRA 3PQKA 3Q0VA 1JKQC 3RJPA 3FF5A 1BR4A 3LWFA 2DA2A 3O8HA 2VQGA 4BHCA 1G59A 1CF7A 4Q5SF 3K2ZA 2EZIA 5CLSA 4RAZA 1IO2A 1Z1DA 3GTKJ 3S1QJ 4MFEA 5FB2A 1R4MB 1M1EB 2QQBA 2DAOA 3FMQA 5DCMA 4ABZA 3D1NI 1D5YA 1IF1A 2PEXA 1UB9A 1TNSA 4BXFA 1OCOH 4A3FJ 2H1KA 2LREA 5LLQA 4IHWA 4I0AA 1VQ6I 2E1MC 2E19A 1TL8A 2K4JA 1U9OA 4XLCA 5L3EA 4HYEA 1R23A 4XOTA 2QSHX 4M9ZA 2Q8KA 3HXLA 4G8XA 5C4JJ 4EJOA 5B1AH 2PFBA 4GFBA 2FJ1A 3OYKA 2ZMEB 1MDMA 2YR2A 4KN4X 3R60A 4DYCA 3HSEA 2G9WA 3IWFA 3WGIA 4UV8A 2QGUA 3GX4X 4XOPA 1YJWI 1R5GA 5LEKA 1W5CC 2J5PA 3GFJA 2WB1N 3HGYA 3HBLA 4XRMA 1Q1HA 4F91B 4RS8A 1FWZA 2EA2A 2F5DA 2LOOA 2VBXA 3EQLF 3IC7A 2YU3A 3OV8A 4PJJA 4X0GA 1UHMA 5IT3A 4IRIA 3OIPA 3A1YA 4LGWA 4E4HA 4ZYDA 2CH0A 3CDHA 1SAUA 3CUQB 4PGGA 1JGGA 3KETA 1LFUP 1ZG3A 1OCPA 1Y0UA 5E8GA 3W6JB 2I8DA 2M5WA 1FX7A 2L54A 4XONA 2R7XA 2RQPA 1VQMI 4C9YA 1ODDA 1BJAA 4O5VA 1JXSA 2VT2A 4BJTA 1FSHA 1XPXA 1HKSA 2EFOA 1Q1VA 2LTPA 1JUMA 2M0CA 3QP6A 3BDDA 2NVUB 2XROA 4G6DA 2WBMA 2IJLA 1WSUA 1B6AA 4BQQA 2JUCA 4CCJA 3ZQFA 1IRGA 2O9LA 1HW1A 5FKLA 3BZKA 2LF8A 4Y52J 3FBNB 1FMWA 2COBA 4AYBA 3VDXA 3G6EI 2M2EA 4M72A 5EEAA 4A0YA 4ITVA 5IP6A 4D7NA 3DLLF 1ZR4A 3CUOA 3WG7H 4LLLA 1ZH5A 2ESNA 1VQ5I 2W25A 3IH2A 4XLFA 3K0LA 3RQ4A 3ECHA 3JRGA 1EA3A 3CMMA 2GIVA 4CXFA 1TQMA 2KDZA 5LGTA 3QQAA 4ENJA 1X3WB 3K69A 1MNMC 1RRJA 1MBHA 4CICA 3HHGA 4FQGA 2FUG2 1J5YA 2ELKA 2YS9A 5BQTA 3RPQA 5LD2C 2PMUA 3LSTA 1MNEA 3CCUI 2EZLA 2VASA 3MCZA 5FO5A 1Z77A 2M8GX 4YEJA 3WTZA 4MTDA 1YJNI 2OF7A 4A6DA 1RIOH 3G3ZA 3T0YA 4BY1J 3ZP5A 1B72B 2VE9A 4C2TA 3BJAA 2MLGA 4NC8A 2CFOA 3ZN1A 1RR7A 3BG3A 4KMFA 2HDWA 4Y4RA 3F8MA 4NC7A 2E5NA 2OZUA 4HBLA 2NNNA 4HV6A 2L7FP 3ZQGA 1OYWA 3BTJA 1CF7B 3OYCA 1V5FA 3DPUA 1ZKGA 2GIZA 3ABUA 2EINH 2KISA 1ZARA 4I99C 4HNTA 3OYGA 1J75A 3HRSA 2XV4S 1YITI 4KISA 5DCMB 3KZIC 1UZCA 1YS6A 3SXYA 4DBQA 1FIAA 5KVRA 4HX4A 2MSYA 4B1RA 4FE7A 4E7SA 4QTRA 3LA7A 3S32A 3FIWA 4Z6YA 2XB5A 2K7LA 1HXDA 3D5RC 3FKIJ 2G7UA 3LQQA 3OOUA 3KP5A 3KP4A 4GO1A 1MBJA 2MD5A 2HQAA 4MQ9F 4XLPF 1POGA 2BVMA 4EGYA 1LEAA 1R71A 1J09A 3DKXA 2F5CA 2DT5A 4OIRF 4H0EA 5DUKA 1P4AA 1RC9A 2H27A 1MDMB 2CV2A 2XB0X 5DM6F 1XTAA 2CJJA 3HTSB 2R7VA 3LA2A 2IXSA 4II2A 2VKHA 1LQ1A 2XAFA 5D5WB 4LG0A 1XS9A 2O8XA 2DA7A 3I9V2 3EPZA 2KKOA 1DU0A 1T95A 2M30A 4ETSA 3TEDA 1I6XA 4FX0A 2VQLA 4BE1A 3A02A 3I71A 4ON0A 4IXAA 1Z21A 4YIIA 2D2WA 1PDNC 3DF8A 1S6LA 2ECBA 5ICCA 5EDNA 2KPMA 1PVEA 1A35A 1R1UA 5F0FA 2ZFUA 1RKWA 3SEZA 2UXXA 1LVKA 3TL4X 4BL0B 2VI6A 3BJ6A 4IOCF 2E7WA 3T8RA 3RZOJ 5IYBJ 2FOKA 1YFHA 1DGWY 3KP6A 3QYFA 1IC8A 4C3IJ 2AS5F 3L2CA 4XN3A 2OQGA 2ME6A 4P9FA 3JTHA 2IP2A 5K7FA 5M3FJ 1UAAA 3N4MA 4HPQA 1GV5A 3BZ6A 3CCMI 1K6OA 5A2QK 3QYEA 4RM2A 1XGOA 3IRQA 3CC7I 2DT7B 4WK8F 1AWCA 5E18F 5FKMA 5FKKA 2V6EA 4R79A 3GLXA 1O57A 5F64A 1JHFA 1S7EA 1I3QJ 2QBYA 3DWLE 1CGPA 1HKQA 1MBEA 4BXUA 1S72I 3K4LA 3KP2A 2KRHA 5JFRA 4CO8A 5JVTA 5CVJA 2V9PA 3TW7A 4DIQA 2HZDA 3ZMZA 1U9NA 1QVTA 4J19A 3HZJA 1IW7F 3FKJA 2DDBA 2HS5A 2DTZA 3HTUA 4RAFA 4XKWA 2WAQN 4IHXA 1YI2I 1SD4A 5IY5H 2GOXB 4XBFA 4ZDOA 3RDIA 3HRMA 1ZRDA 2GOMA 3LSHA 2IW5A 4RGXA 1WI9A 1ETQA 4ESBA 1FLIA 1DUXC 5LRRA 5K5RA 3PNYA 2Y30A 1WCMJ 5EGOA
chains in the Genus database with same CATH topology
2GXGA 3I5UA 1R5HA 3ISPA 4G94A 3K1NA 4P96A 1FBUA 2FRHA 2Y0MA 2YX7A 3SQNA 1XGMA 4ESJA 1TW3A 4M9XA 4LFUA 1ZREA 2XAGA 1C0WA 3QU3A 4M6YA 1XB4A 1FT9A 1B9MA 1GXQA 3GFLA 1F5TA 2NRAC 4NHJA 1S3JA 3Q9VA 3DQVC 2VN2A 1J59A 1IN8A 2OA4A 1U3EM 1LEBA 1G3YA 2GAUA 4KUMA 1FSEA 3BOQA 3ZMVA 3M1EA 3MZHA 4U7DA 2LNBA 4Y17A 1B9NA 4IRGA 1TQPA 1H9GA 4CDGA 2V1DA 1FZPB 5KK1A 4BQAA 3GVAA 4LG0B 4WXCA 2FQ3A 2E7XA 2FXAA 2V1XA 2L4MA 3B02A 3SZPA 5H6RA 1XGSA 3R61A 4HA8A 1TLHB 2FBHA 5BS6A 1EH6A 5DD4A 2MBFA 5AONA 3BJOA 1O3SA 1K79A 5LEJA 3MZYA 2O6GE 4KICA 5HLGA 3VB2A 3I64A 3CTAA 2VODA 2KJBA 3AAFA 3WTUC 1GXPA 2P5LC 1XSDA 1ZRFA 4CYDA 3WTYC 2OU2A 1YIOA 2A6HF 2BGCA 2QBYB 1MKMA 2LF7A 5E1WA 4ENKA 3V7RA 5ILUA 1U78A 3R0JA 5ERIA 3E6BA 1HW2A 5EEGA 1UHWA 1BN5A 1QNTA 4K2EA 3QPTA 2V6CA 4BH9A 3EETA 4UVCA 5A2QZ 2STWA 2P7CB 2ZNZA 1JE8A 1W7PD 1SD7A 2RC4A 1R7JA 4P5OA 2FBKA 1YW8A 5L3FA 3NQOA 4L5JA 3KE2A 5L3BA 3FHZA 4ZYEA 5HLHA 5CJ9A 3W6KB 3I58A 1HSJA 4Q47A 3O2PE 3GO5A 2P4WA 1WWXA 3D0SA 2EK5A 1G6NA 5J8CA 3I54A 4EMSA 2XUBA 2NNYA 2C6YA 4AD9A 2HZTA 1XD7A 5E1XA 2VC1A 3C1DA 2Q0OA 4LK1F 1Z9CA 3DPTA 3IHUA 2GA1A 5E20A 3VODA 1KQ8A 3WU0A 3ERED 4AIHA 4F7ZA 3I0TA 3HSFA 4EJUA 3M8EA 2O61A 1E2XA 4ZYGA 2V79A 1X3UA 3ABTA 1YW7A 2QLZA 2EA4A 4HDUA 1SMTA 1H0MA 4RGRA 1RUOA 3K1MA 3PQJA 5IT9K 2W24A 3ZMUA 5D6EA 1LB2A 3ZPLA 1T39A 2QZ8A 2F5FA 1OYYA 2A61A 3U1DA 1H9TA 1S7OA 2UWMA 1ZRCA 4LLGF 2DTRA 4G7OF 4DQ2A 2H94A 1U8RA 1E17A 1G3TA 2HDCA 5E1ZB 4ENNA 3F23A 1XDSA 1ULYA 1FNNA 1V3FA 1DP7P 4UNOA 3R6SA 2DPDA 1ONVA 2GQQA 1GHCA 2IVMA 5HDNA 1QZZA 2EFPA 5DCFA 4HQMA 3V8LA 5JI6A 1LJ9A 1G3SA 5TRDA 5ICGA 1ZHFA 2J5OA 4HX7A 1U6GA 4U0WA 2F5EA 5FD5A 1USTA 2HTJA 1YLFA 2DQRA 3KCCA 1FYLA 5H6QA 1ZG5A 4EJVA 2IPQX 3Q9SA 1IXSB 1LDJA 3F8CA 1UFMA 1IRFA 2EV6A 4HOBA 4JK1X 4Y13A 4I2OA 4IF4A 3QOPA 3ELKA 4HAMA 2VXZA 2XASA 2HOEA 4Q48A 3WGGA 5L3GA 3TO9A 3WE3A 2PG4A 4LD5A 3MAJA 4EJWA 1TW2A 4JQFA 4HDVA 3T8TA 4R8HA 1YS7A 2A6EF 5AIPA 2UZKA 1KU9A 1IN7A 3Q5FA 3F8NA 3TDUC 2KRFA 2P7VB 4RAYA 3QRFF 1IZ1A 1RZ4A 2L02A 2WTEA 1J9IA 5AIQA 1Z7UA 1I1SA 2D45A 2H6BA 2FU4A 4G6QA 3WE2A 1W7PA 4G7HF 3FXUA 3RYPA 3RPUA 3H92A 3M7GA 2NAZA 5FFZA 4HV5A 3EYIA 4CHUA 5HDGA 1O7FA 5L3DA 5FFXA 5IT9Z 4L18B 1D8JA 2BYVE 3E5XA 2MLKA 1ZLKA 4AIKA 4BHBA 2QYOA 2Y48A 4KIBA 4UVBA 3K9TA 2FMYA 4GYIA 3WTVC 3NRVA 1MD0A 1IAWA 3QPHA 1OYIA 1Z6TA 3BP8A 2CQKA 5JR3A 2DU9A 4KYWA 1EH8A 3DKWA 1XCVA 1W5TA 4O6JA 2IRFG 2O0YA 2FSWA 2FEZA 1HSTA 2GWRA 4N9IA 2Q2EA 1RI7A 3U9GA 1FOKA 1J7KA 3SZTA 4YG2F 4U88A 3GYHX 2QUFA 3PFIA 1EV7A 4KT5C 2DK8A 5F1RA 2HTSA 1K78A 4B8XA 5L3CA 4HQEA 2OBPA 2HQNA 2F2EA 3L7WA 4WXDA 1IUYA 2PN6A 1I27A 4GGGA 3WG9A 4FHTA 2X0LA 4B09A 2Z99A 4WCGA 4OIPF 3T1BA 3WODF 2GXBA 3M8FA 1EH7A 2KIFA 5K5OA 2XHKA 4A12A 1GVJA 4IRHA 4U7BA 3ZN0A 5D5VB 3JSOA 4KFCA 4OU0A 1Z05A 1STZA 1R00A 4CZZA 1IXCA 2HGCA 2W57A 3V4GA 4YFKF 2D1VA 2XRNA 1BI2A 2OAZA 4KIGA 5D5XB 4ZYHA 4WX9A 3P9CA 3E97A 3RKYA 1FBSA 5ICFA 1FP1D 1W7PB 3FZVA 3CO6C 2ZKZA 3DXJF 4YFNF 4HLXA 2JSCA 2PBIA 2O3FA 3HRUA 1XMAA 2K4BA 5CVIA 2CWEA 1LDKB 3E5QA 4HLYA 4EQQA 1O3QA 4EVIA 3IL2A 3P9IA 4GXOA 2R7DA 3EDPA 2QQAA 4G9YA 4LJZF 1O7LA 4KNYA 4WF2A 3GEZA 4EM1A 2ZFWA 3KEOA 3NEUA 2LKPA 4FX4A 2L01A 5HS9A 4QWQA 1DPUA 1F1ZA 1P92A 1K78B 1TTYA 2HKOA 4RB0A 4DNCA 1IN4A 2MC3A 4BYYA 3HOTA 4MQVA 3C18A 3GWZA 2FBIA 3HUGA 2W85A 3HHHA 4A2UA 2LDUA 2JPBA 3FM5A 2AXLA 2NYXA 2XAHA 5DDGA 2ZJ2A 5LBQA 2HQRA 2X4HA 4L0YB 1QPMA 1T0FA 1SFEA 2RKHA 2FF4A 2DO7A 3C7JA 3BROA 2HYFA 3ROUA 1T38A 2KIMA 2RV8A 4ZZDA 4EM2A 4IVNA 1MZBA 2GZWA 2RNJA 4IJAA 3F3XA 1OR7A 1J0RA 4ZH4F 4XLNF 1O3TA 2QQ9A 3R0AA 2DBBA 3CJNA 2M1BA 1B4AA 3LAJA 2RVCA 1XSVA 4BAYA 2HEOA 5DYMA 3LA3A 5FD6A 1XGNA 3E6MA 3GFIA 2ZNYA 2IA0A 3DFGA 2M8EA 2YSRA 4L5IA 1R58A 3WTSC 1VTNC 5H20A 4PZJA 4IHTA 1FP2A 2CG4A 4RB2C 1QBJA 3E3VA 2Z3YA 4L9VA 2VT3A 2H6CA 3KLNA 1FYMA 2XAQA 3KZZA 2ZMEA 4UV9A 2MH9A 4HF2A 1D3YA 5JHUA 2BBYA 2G7HA 3QP5A 4YFXF 2DI3A 2CYYA 4CGZA 3VFZA 5ED4A 2FNPA 1S8NA 2B0LA 1BC8C 1W5SA 3BPVA 3O3KA 3K1PA 2FNAA 4ZZLA 3HYIA 1YQAA 5K5QA 4D0PA 2R3SA 3VEPA 3IRRA 3FWEA 3GUDA 4M73A 4KN7X 3F22A 2DK5A 5BPDA 3ZQ7A 2YPRA 3KP3A 2VC0A 1WKMA 2COMA 3HOSA 2VBYA 3DP7A 4L9JA 1SFUA 3FX3A 1KU2A 5J6XA 3ECOA 2O03A 1XN7A 4MEYF 1I5ZA 3CO7C 1HW5A 2ACJA 2A69F 3J80K 1BI0A 3D5LA 3RTRA 3ZMDA 2CSOA 5HOOA 3N97A 1MJAA 4HZFA 4BHPA 3BPXA 4OMZA 4XSZF 3KLOA 3FXRA 1NHAA 4GYGA 3F21A 1ZGAA 2ZCWA 1O3RA 2P5VA 1RUNA 4KA4A 3E5UA 2OD5A 5K1YA 2DW4A 4PGHA 2WV0A 3F8FA 2HYGD 1ZYRF 2Z5UA 2ETHA 4IHSA 1FC3A 2Z33A 3KP7A 4L9TA 2JPCA 2GA2A 2IA1A 3V8KA 4U0YA 2XKOA 1SD5A 4I01A 3CLOA 3F72A 4A0ZA 2STTA 4E70A 3TO7A 2HWVA 4OINF 4I0BA 4FT8A 1W4MA 3HRTA 4RGUA 1TNTA 4RB3C 1FBQA 3WTWC 2P8TA 5ILSA 2HFHA 1DDNA 1FY7A 3EUHA 1U5TC 3JSPA 2EJRA 1PUEE 2M87A 2VONA 1B1BA 3VOEA 3L09A 1AOYA 2P6SA 2P5KA 1P4XA 5DD8A 1YYVA 1BI1A 2KJCA 4KDPA 2TDXA 5LHHA 4LMYA 1TQIA 4LLNA 1HQCA 3HSRA 4MHGA 5DEQA 4EM0B 2K27A 4MGRA 2HR3A 3KEQA 4M71A 3EYYA 2EWNA 4UXNA 3U2RA 1PP7U 1KGSA 3KZYA 1PP8F 1F4KA 3SHFA 2EV0A 2XKPA 3GZ6A 3E6CC 5LHGA 2V9VA 5DUIA 1SAXA 1BC7C 3GF2A 3JW4A 4KMUX 1U2WA 3GXOA 4NQWA 1S29A 2VOOA 4MNUA 1HKTA 1ON2A 1ON1A 2ISYA 1D8KA 2XGXA 1MGTA 3I53A 5D8KB 5CVUA 4N0BA 2L4AA 1FPQA 1IXRC 3R4KA 3J80Z 3F8BA 2QENA 3LFKA 2IA2A 3GZ5A 1J2XA 3O6BB 4M74A 3CUQC 2JZYA 3G73A 3BY6A 1XCBA 5E8IA 4LK0F 2ZBKA 1DPRA 1SMYF 2FMLA 1OKRA 5LRSA 4UHTA 3L9FA 4OIOF 4BNCA 1SFXA 2VBWA 3JAMK 4UUVA 1V4RA 3FXQA 3SFZA 3I59A 4HF0A 3OOPA 4N9HA 1KQ9A 3TQNA 2VOPA 4WXHA 1D5VA 1ZLJA 1I1GA 4LB6B 1TBXA 4KIFA 3TDZC 2QWWA 4XSXF 5BMZA 4MTEA 4ENMA 5FLXK 2A3SA 1YTYA 1BIBA 1KYWA 2Y75A 3J7AO 5HVQC 5ILVA 3F6OA 1YG2A 3ULQB 1T6SA 2ESHA 2JRTA 4RGSA 1OPCA 4ESFA 1S7AA 5EEHA 2DQLA 3IWZA 3V7SA 2FE3A 4YIFA 5LHIA 1B59A 3H3UA 1BIAA 2UXNA 3JTGA 1P2FA 3IKVA 5E17F 1P4WA 4I09A 1XMKA 4RB1A 3I4PA 2E1NA 3WGHA 3B73A 4OMYA 4G7ZF 1QZYA 2OQRA 3WTTC 3L00A 4IPAA 3TKYA 5D6FA 2A5YB 3J81K 2A07F 3LQRA 1ZGJA 6PAXA 4LB5A 1LDDA 2H09A 4M6XA 4OOIA 1BM9A 2E1CA 4EGZA 5CVVA 2Z9OA 4M9SA 2CO5A 2EV5A 3MFKA 1BOAA 4I7HA 3GW2A 2MH2A 3V8JA 5FGMA 4Y15A 2K02A 2IT0A 2CFXA 1ZN2A 2ISZA 5CVRA 2RDPA 2JTVA 3FM3A 5TJJA 1MJ9A 4L9NA 1LNWA 1P6RA 2CGPA 1G3WA 4I02A 3C3WA 1MJBA 2WWYA 3LAPA 5D5UB 5BOXA 1IN6A 1WQ2A 2HKXA 5HDKA 5BPIA 1G4DA 2XVCA 1R36A 2CW0F 3E6DA 4TV7A 3S2WA 3I59B 3M9AA 3RIRA 3KFWX 1KYZA 3H3ZA 1Z91A 3RKWA 2A68F 1ZAOA 4Z2YA 4I98B 4O3MA 3FMRA 1BBYA 2K86A 4WWCA 3TOAA 2DPUA 1KU3A 3MWMA 2PI0A 1U5TA 4ASNA 3JAMZ 2R7FA 4OIQF 4S04A 4HX8A 1R1TA 2XAJA 3ZMTA 4S05A 1KA8A 2MA3A 3ZMSA 2DLLA 3BWGA 2DFIA 5FLXZ 1OMIA 4PDKA 4QLCU 3DEUA 4AVPA 1QGPA 2LSOA 1T2KA 1K7AA 4A0XA 2NS0A 1HBXG 2FA5A 2PMHA 4P9UA 1REPC 5F6FA 2P6TA 1IN5A 2RGVA 3GFMA 3MQ0A 2V1UA 2EFQA 3QU6A 4Q4ZF 1RNLA 3P7NA 2QM3A 1SD6A 1YW9A 4XRFA 3TOBA 5D4SA 5LGNA 1JHHA 2L3DA 3DV8A 1QQIA 2BV6A 3J81Z 5HLIA 4AWXB 3ML6A 3FMSA 3RI4A 3REOA 3WU1B 3COAC 5HS8A 2JT1A 2VBZA 3RYRA 2M45A 2W84A 1ZG1A 4PCQA 3CUQA 3WTXC 5DV5A 1YO5C 2EFNA 3RKXA 1LVAA 2PLYA 1USSA 1UCRA 4EV0A 2XIGA 5J8FA 5D4RA 1T98A 4P55A 1JGSA 1F9NA 4L0ZB 1WRJA 1XDUA 1Z6RA 4EJTA 4NB5A 4R1HA 5ICEA 2PJPA 1BI3A 4GCVA 3MEXA 5CYVA 2D1HA 5LGUA 2BE5F 3P9KA 1FYKA 2ZO4A 4AIJA 5D8LB 4A5NA 2RN7A 2ELHA 2YX4A 1L0OC 1QO0D 1U5TB 1XSXA 4HF1A 4UVAA 2PQ8A 3T5XA 3TGNA 4HW0A 2BEOA 2EB7A 2KIUA 2ZXJA 4U0VA 2ADUA 4A5MA 2WC2A 4JBAA 1R1VA 1KQ0A 3HIFA 4A6EA 1KU7A 1A04A 2OZ6A 3F6VA 5HS7A 4MEXF 2QVOA 3DPLC 3QAHA 3V7CA 1L3LA 1R22A 3IKTA 3TO6A 2EFWA 2VE8A 3PQKA 3RJPA 3FF5A 3LWFA 4Q5SF 4BHCA 1CF7A 3K2ZA 5CLSA 4RAZA 1Z1DA 5FB2A 2QQBA 2DAOA 3FMQA 5DCMA 1IF1A 2PEXA 1UB9A 1TNSA 5LLQA 4I0AA 2K4JA 5L3EA 4HYEA 1R23A 4M9ZA 2Q8KA 4G8XA 4EJOA 2PFBA 2ZMEB 1MDMA 2YR2A 4KN4X 3R60A 3HSEA 2G9WA 3IWFA 3WGIA 4UV8A 3GX4X 1R5GA 5LEKA 2J5PA 3GFJA 1Q1HA 4RS8A 1FWZA 2EA2A 2F5DA 3EQLF 2VBXA 3IC7A 2YU3A 3OV8A 1UHMA 5IT3A 4IRIA 4LGWA 4ZYDA 3CDHA 3CUQB 4PGGA 3KETA 1ZG3A 3W6JB 1Y0UA 5E8GA 2M5WA 1FX7A 2L54A 2RQPA 1ODDA 1BJAA 4O5VA 1JXSA 2VT2A 1FSHA 1HKSA 2EFOA 3QP6A 3BDDA 2XROA 4G6DA 2IJLA 1WSUA 1B6AA 1IRGA 1HW1A 2LF8A 4M72A 4A0YA 3CUOA 4LLLA 1ZH5A 2ESNA 2W25A 3K0LA 3ECHA 2GIVA 4CXFA 1TQMA 5LGTA 4ENJA 3K69A 4CICA 3HHGA 1J5YA 5BQTA 3RPQA 2PMUA 3LSTA 3MCZA 5FO5A 3WTZA 4MTDA 4A6DA 1RIOH 3G3ZA 3T0YA 3ZP5A 2VE9A 3BJAA 2MLGA 3ZN1A 4KMFA 3F8MA 4HBLA 2OZUA 4HV6A 2NNNA 1OYWA 1CF7B 3ABUA 1ZARA 1J75A 3HRSA 2XV4S 5DCMB 1YS6A 3SXYA 5KVRA 4HX4A 3LA7A 2K7LA 1HXDA 2G7UA 3LQQA 3KP5A 3KP4A 4GO1A 2MD5A 4XLPF 4MQ9F 4EGYA 1LEAA 2F5CA 2DT5A 4OIRF 4H0EA 5DUKA 1P4AA 2H27A 1MDMB 3HTSB 3LA2A 1LQ1A 2XAFA 5D5WB 4LG0A 2O8XA 2KKOA 2M30A 4ETSA 1I6XA 4FX0A 3I71A 4ON0A 4IXAA 4YIIA 2D2WA 1PDNC 3DF8A 1S6LA 5ICCA 1R1UA 2UXXA 3BJ6A 2E7WA 3T8RA 2FOKA 1YFHA 3KP6A 2AS5F 3L2CA 2OQGA 4P9FA 3JTHA 2IP2A 3N4MA 3BZ6A 1K6OA 5A2QK 1XGOA 3IRQA 4WK8F 1AWCA 5E18F 4R79A 3GLXA 1O57A 5F64A 1JHFA 2QBYA 1CGPA 1HKQA 4BXUA 3KP2A 5JFRA 4CO8A 5JVTA 5CVJA 3ZMZA 1IW7F 3HTUA 2HS5A 1SD4A 4XBFA 3RDIA 3HRMA 1ZRDA 2IW5A 4RGXA 1WI9A 4ESBA 1FLIA 1DUXC 5LRRA 5K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GXG A;  3I5U A;  1R5H A;  3ISP A;  4G94 A;  3K1N A;  4P96 A;  1FBU A;  2FRH A;  2Y0M A;  2YX7 A;  3SQN A;  1XGM A;  4ESJ A;  1TW3 A;  4M9X A;  4LFU A;  1ZRE A;  2XAG A;  1C0W A;  3QU3 A;  4M6Y A;  1XB4 A;  1FT9 A;  1B9M A;  1GXQ A;  3GFL A;  1F5T A;  2NRA C;  4NHJ A;  1S3J A;  3Q9V A;  3DQV C;  2VN2 A;  1J59 A;  1IN8 A;  2OA4 A;  1U3E M;  1LEB A;  1G3Y A;  2GAU A;  4KUM A;  1FSE A;  3BOQ A;  3ZMV A;  3M1E A;  3MZH A;  4U7D A;  2LNB A;  4Y17 A;  1B9N A;  4IRG A;  1TQP A;  1H9G A;  4CDG A;  2V1D A;  1FZP B;  5KK1 A;  4BQA A;  3GVA A;  4LG0 B;  4WXC A;  2FQ3 A;  2E7X A;  2FXA A;  2V1X A;  2L4M A;  3B02 A;  3SZP A;  5H6R A;  1XGS A;  3R61 A;  4HA8 A;  1TLH B;  2FBH A;  5BS6 A;  1EH6 A;  5DD4 A;  2MBF A;  5AON A;  3BJO A;  1O3S A;  1K79 A;  5LEJ A;  3MZY A;  2O6G E;  4KIC A;  5HLG A;  3VB2 A;  3I64 A;  3CTA A;  2VOD A;  2KJB A;  3AAF A;  3WTU C;  1GXP A;  2P5L C;  1XSD A;  1ZRF A;  4CYD A;  3WTY C;  2OU2 A;  1YIO A;  2A6H F;  2BGC A;  2QBY B;  1MKM A;  2LF7 A;  5E1W A;  4ENK A;  3V7R A;  5ILU A;  1U78 A;  3R0J A;  5ERI A;  3E6B A;  1HW2 A;  5EEG A;  1UHW A;  1BN5 A;  1QNT A;  4K2E A;  3QPT A;  2V6C A;  4BH9 A;  3EET A;  4UVC A;  5A2Q Z;  2STW A;  2P7C B;  2ZNZ A;  1JE8 A;  1W7P D;  1SD7 A;  2RC4 A;  1R7J A;  4P5O A;  2FBK A;  1YW8 A;  5L3F A;  3NQO A;  4L5J A;  3KE2 A;  5L3B A;  3FHZ A;  4ZYE A;  5HLH A;  5CJ9 A;  3W6K B;  3I58 A;  1HSJ A;  4Q47 A;  3O2P E;  3GO5 A;  2P4W A;  1WWX A;  3D0S A;  2EK5 A;  1G6N A;  5J8C A;  3I54 A;  4EMS A;  2XUB A;  2NNY A;  2C6Y A;  4AD9 A;  2HZT A;  1XD7 A;  5E1X A;  2VC1 A;  3C1D A;  2Q0O A;  4LK1 F;  1Z9C A;  3DPT A;  3IHU A;  2GA1 A;  5E20 A;  3VOD A;  1KQ8 A;  3WU0 A;  3ERE D;  4AIH A;  4F7Z A;  3I0T A;  3HSF A;  4EJU A;  3M8E A;  2O61 A;  1E2X A;  4ZYG A;  2V79 A;  1X3U A;  3ABT A;  1YW7 A;  2QLZ A;  2EA4 A;  4HDU A;  1SMT A;  1H0M A;  4RGR A;  1RUO A;  3K1M A;  3PQJ A;  5IT9 K;  2W24 A;  3ZMU A;  5D6E A;  1LB2 A;  3ZPL A;  1T39 A;  2QZ8 A;  2F5F A;  1OYY A;  2A61 A;  3U1D A;  1H9T A;  1S7O A;  2UWM A;  1ZRC A;  4LLG F;  2DTR A;  4G7O F;  4DQ2 A;  2H94 A;  1U8R A;  1E17 A;  1G3T A;  2HDC A;  5E1Z B;  4ENN A;  3F23 A;  1XDS A;  1ULY A;  1FNN A;  1V3F A;  1DP7 P;  4UNO A;  3R6S A;  2DPD A;  1ONV A;  2GQQ A;  1GHC A;  2IVM A;  5HDN A;  1QZZ A;  2EFP A;  5DCF A;  4HQM A;  3V8L A;  5JI6 A;  1LJ9 A;  1G3S A;  5TRD A;  5ICG A;  1ZHF A;  2J5O A;  4HX7 A;  1U6G A;  4U0W A;  2F5E A;  5FD5 A;  1UST A;  2HTJ A;  1YLF A;  2DQR A;  3KCC A;  1FYL A;  5H6Q A;  1ZG5 A;  4EJV A;  2IPQ X;  3Q9S A;  1IXS B;  1LDJ A;  3F8C A;  1UFM A;  1IRF A;  2EV6 A;  4HOB A;  4JK1 X;  4Y13 A;  4I2O A;  4IF4 A;  3QOP A;  3ELK A;  4HAM A;  2VXZ A;  2XAS A;  2HOE A;  4Q48 A;  3WGG A;  5L3G A;  3TO9 A;  3WE3 A;  2PG4 A;  4LD5 A;  3MAJ A;  4EJW A;  1TW2 A;  4JQF A;  4HDV A;  3T8T A;  4R8H A;  1YS7 A;  2A6E F;  5AIP A;  2UZK A;  1KU9 A;  1IN7 A;  3Q5F A;  3F8N A;  3TDU C;  2KRF A;  2P7V B;  4RAY A;  3QRF F;  1IZ1 A;  1RZ4 A;  2L02 A;  2WTE A;  1J9I A;  5AIQ A;  1Z7U A;  1I1S A;  2D45 A;  2H6B A;  2FU4 A;  4G6Q A;  3WE2 A;  1W7P A;  4G7H F;  3FXU A;  3RYP A;  3RPU A;  3H92 A;  3M7G A;  2NAZ A;  5FFZ A;  4HV5 A;  3EYI A;  4CHU A;  5HDG A;  1O7F A;  5L3D A;  5FFX A;  5IT9 Z;  4L18 B;  1D8J A;  2BYV E;  3E5X A;  2MLK A;  1ZLK A;  4AIK A;  4BHB A;  2QYO A;  2Y48 A;  4KIB A;  4UVB A;  3K9T A;  2FMY A;  4GYI A;  3WTV C;  3NRV A;  1MD0 A;  1IAW A;  3QPH A;  1OYI A;  1Z6T A;  3BP8 A;  2CQK A;  5JR3 A;  2DU9 A;  4KYW A;  1EH8 A;  3DKW A;  1XCV A;  1W5T A;  4O6J A;  2IRF G;  2O0Y A;  2FSW A;  2FEZ A;  1HST A;  2GWR A;  4N9I A;  2Q2E A;  1RI7 A;  3U9G A;  1FOK A;  1J7K A;  3SZT A;  4YG2 F;  4U88 A;  3GYH X;  2QUF A;  3PFI A;  1EV7 A;  4KT5 C;  2DK8 A;  5F1R A;  2HTS A;  1K78 A;  4B8X A;  5L3C A;  4HQE A;  2OBP A;  2HQN A;  2F2E A;  3L7W A;  4WXD A;  1IUY A;  2PN6 A;  1I27 A;  4GGG A;  3WG9 A;  4FHT A;  2X0L A;  4B09 A;  2Z99 A;  4WCG A;  4OIP F;  3T1B A;  3WOD F;  2GXB A;  3M8F A;  1EH7 A;  2KIF A;  5K5O A;  2XHK A;  4A12 A;  1GVJ A;  4IRH A;  4U7B A;  3ZN0 A;  5D5V B;  3JSO A;  4KFC A;  4OU0 A;  1Z05 A;  1STZ A;  1R00 A;  4CZZ A;  1IXC A;  2HGC A;  2W57 A;  3V4G A;  4YFK F;  2D1V A;  2XRN A;  1BI2 A;  2OAZ A;  4KIG A;  5D5X B;  4ZYH A;  4WX9 A;  3P9C A;  3E97 A;  3RKY A;  1FBS A;  5ICF A;  1FP1 D;  1W7P B;  3FZV A;  3CO6 C;  2ZKZ A;  3DXJ F;  4YFN F;  4HLX A;  2JSC A;  2PBI A;  2O3F A;  3HRU A;  1XMA A;  2K4B A;  5CVI A;  2CWE A;  1LDK B;  3E5Q A;  4HLY A;  4EQQ A;  1O3Q A;  4EVI A;  3IL2 A;  3P9I A;  4GXO A;  2R7D A;  3EDP A;  2QQA A;  4G9Y A;  4LJZ F;  1O7L A;  4KNY A;  4WF2 A;  3GEZ A;  4EM1 A;  2ZFW A;  3KEO A;  3NEU A;  2LKP A;  4FX4 A;  2L01 A;  5HS9 A;  4QWQ A;  1DPU A;  1F1Z A;  1P92 A;  1K78 B;  1TTY A;  2HKO A;  4RB0 A;  4DNC A;  1IN4 A;  2MC3 A;  4BYY A;  3HOT A;  4MQV A;  3C18 A;  3GWZ A;  2FBI A;  3HUG A;  2W85 A;  3HHH A;  4A2U A;  2LDU A;  2JPB A;  3FM5 A;  2AXL A;  2NYX A;  2XAH A;  5DDG A;  2ZJ2 A;  5LBQ A;  2HQR A;  2X4H A;  4L0Y B;  1QPM A;  1T0F A;  1SFE A;  2RKH A;  2FF4 A;  2DO7 A;  3C7J A;  3BRO A;  2HYF A;  3ROU A;  1T38 A;  2KIM A;  2RV8 A;  4ZZD A;  4EM2 A;  4IVN A;  1MZB A;  2GZW A;  2RNJ A;  4IJA A;  3F3X A;  1OR7 A;  1J0R A;  4ZH4 F;  4XLN F;  1O3T A;  2QQ9 A;  3R0A A;  2DBB A;  3CJN A;  2M1B A;  1B4A A;  3LAJ A;  2RVC A;  1XSV A;  4BAY A;  2HEO A;  5DYM A;  3LA3 A;  5FD6 A;  1XGN A;  3E6M A;  3GFI A;  2ZNY A;  2IA0 A;  3DFG A;  2M8E A;  2YSR A;  4L5I A;  1R58 A;  3WTS C;  1VTN C;  5H20 A;  4PZJ A;  4IHT A;  1FP2 A;  2CG4 A;  4RB2 C;  1QBJ A;  3E3V A;  2Z3Y A;  4L9V A;  2VT3 A;  2H6C A;  3KLN A;  1FYM A;  2XAQ A;  3KZZ A;  2ZME A;  4UV9 A;  2MH9 A;  4HF2 A;  1D3Y A;  5JHU A;  2BBY A;  2G7H A;  3QP5 A;  4YFX F;  2DI3 A;  2CYY A;  4CGZ A;  3VFZ A;  5ED4 A;  2FNP A;  1S8N A;  2B0L A;  1BC8 C;  1W5S A;  3BPV A;  3O3K A;  3K1P A;  2FNA A;  4ZZL A;  3HYI A;  1YQA A;  5K5Q A;  4D0P A;  2R3S A;  3VEP A;  3IRR A;  3FWE A;  3GUD A;  4M73 A;  4KN7 X;  3F22 A;  2DK5 A;  5BPD A;  3ZQ7 A;  2YPR A;  3KP3 A;  2VC0 A;  1WKM A;  2COM A;  3HOS A;  2VBY A;  3DP7 A;  4L9J A;  1SFU A;  3FX3 A;  1KU2 A;  5J6X A;  3ECO A;  2O03 A;  1XN7 A;  4MEY F;  1I5Z A;  3CO7 C;  1HW5 A;  2ACJ A;  2A69 F;  3J80 K;  1BI0 A;  3D5L A;  3RTR A;  3ZMD A;  2CSO A;  5HOO A;  3N97 A;  1MJA A;  4HZF A;  4BHP A;  3BPX A;  4OMZ A;  4XSZ F;  3KLO A;  3FXR A;  1NHA A;  4GYG A;  3F21 A;  1ZGA A;  2ZCW A;  1O3R A;  2P5V A;  1RUN A;  4KA4 A;  3E5U A;  2OD5 A;  5K1Y A;  2DW4 A;  4PGH A;  2WV0 A;  3F8F A;  2HYG D;  1ZYR F;  2Z5U A;  2ETH A;  4IHS A;  1FC3 A;  2Z33 A;  3KP7 A;  4L9T A;  2JPC A;  2GA2 A;  2IA1 A;  3V8K A;  4U0Y A;  2XKO A;  1SD5 A;  4I01 A;  3CLO A;  3F72 A;  4A0Z A;  2STT A;  4E70 A;  3TO7 A;  2HWV A;  4OIN F;  4I0B A;  4FT8 A;  1W4M A;  3HRT A;  4RGU A;  1TNT A;  4RB3 C;  1FBQ A;  3WTW C;  2P8T A;  5ILS A;  2HFH A;  1DDN A;  1FY7 A;  3EUH A;  1U5T C;  3JSP A;  2EJR A;  1PUE E;  2M87 A;  2VON A;  1B1B A;  3VOE A;  3L09 A;  1AOY A;  2P6S A;  2P5K A;  1P4X A;  5DD8 A;  1YYV A;  1BI1 A;  2KJC A;  4KDP A;  2TDX A;  5LHH A;  4LMY A;  1TQI A;  4LLN A;  1HQC A;  3HSR A;  4MHG A;  5DEQ A;  4EM0 B;  2K27 A;  4MGR A;  2HR3 A;  3KEQ A;  4M71 A;  3EYY A;  2EWN A;  4UXN A;  3U2R A;  1PP7 U;  1KGS A;  3KZY A;  1PP8 F;  1F4K A;  3SHF A;  2EV0 A;  2XKP A;  3GZ6 A;  3E6C C;  5LHG A;  2V9V A;  5DUI A;  1SAX A;  1BC7 C;  3GF2 A;  3JW4 A;  4KMU X;  1U2W A;  3GXO A;  4NQW A;  1S29 A;  2VOO A;  4MNU A;  1HKT A;  1ON2 A;  1ON1 A;  2ISY A;  1D8K A;  2XGX A;  1MGT A;  3I53 A;  5D8K B;  5CVU A;  4N0B A;  2L4A A;  1FPQ A;  1IXR C;  3R4K A;  3J80 Z;  3F8B A;  2QEN A;  3LFK A;  2IA2 A;  3GZ5 A;  1J2X A;  3O6B B;  4M74 A;  3CUQ C;  2JZY A;  3G73 A;  3BY6 A;  1XCB A;  5E8I A;  4LK0 F;  2ZBK A;  1DPR A;  1SMY F;  2FML A;  1OKR A;  5LRS A;  4UHT A;  3L9F A;  4OIO F;  4BNC A;  1SFX A;  2VBW A;  3JAM K;  4UUV A;  1V4R A;  3FXQ A;  3SFZ A;  3I59 A;  4HF0 A;  3OOP A;  4N9H A;  1KQ9 A;  3TQN A;  2VOP A;  4WXH A;  1D5V A;  1ZLJ A;  1I1G A;  4LB6 B;  1TBX A;  4KIF A;  3TDZ C;  2QWW A;  4XSX F;  5BMZ A;  4MTE A;  4ENM A;  5FLX K;  2A3S A;  1YTY A;  1BIB A;  1KYW A;  2Y75 A;  3J7A O;  5HVQ C;  5ILV A;  3F6O A;  1YG2 A;  3ULQ B;  1T6S A;  2ESH A;  2JRT A;  4RGS A;  1OPC A;  4ESF A;  1S7A A;  5EEH A;  2DQL A;  3IWZ A;  3V7S A;  2FE3 A;  4YIF A;  5LHI A;  1B59 A;  3H3U A;  1BIA A;  2UXN A;  3JTG A;  1P2F A;  3IKV A;  5E17 F;  1P4W A;  4I09 A;  1XMK A;  4RB1 A;  3I4P A;  2E1N A;  3WGH A;  3B73 A;  4OMY A;  4G7Z F;  1QZY A;  2OQR A;  3WTT C;  3L00 A;  4IPA A;  3TKY A;  5D6F A;  2A5Y B;  3J81 K;  2A07 F;  3LQR A;  1ZGJ A;  6PAX A;  4LB5 A;  1LDD A;  2H09 A;  4M6X A;  4OOI A;  1BM9 A;  2E1C A;  4EGZ A;  5CVV A;  2Z9O A;  4M9S A;  2CO5 A;  2EV5 A;  3MFK A;  1BOA A;  4I7H A;  3GW2 A;  2MH2 A;  3V8J A;  5FGM A;  4Y15 A;  2K02 A;  2IT0 A;  2CFX A;  1ZN2 A;  2ISZ A;  5CVR A;  2RDP A;  2JTV A;  3FM3 A;  5TJJ A;  1MJ9 A;  4L9N A;  1LNW A;  1P6R A;  2CGP A;  1G3W A;  4I02 A;  3C3W A;  1MJB A;  2WWY A;  3LAP A;  5D5U B;  5BOX A;  1IN6 A;  1WQ2 A;  2HKX A;  5HDK A;  5BPI A;  1G4D A;  2XVC A;  1R36 A;  2CW0 F;  3E6D A;  4TV7 A;  3S2W A;  3I59 B;  3M9A A;  3RIR A;  3KFW X;  1KYZ A;  3H3Z A;  1Z91 A;  3RKW A;  2A68 F;  1ZAO A;  4Z2Y A;  4I98 B;  4O3M A;  3FMR A;  1BBY A;  2K86 A;  4WWC A;  3TOA A;  2DPU A;  1KU3 A;  3MWM A;  2PI0 A;  1U5T A;  4ASN A;  3JAM Z;  2R7F A;  4OIQ F;  4S04 A;  4HX8 A;  1R1T A;  2XAJ A;  3ZMT A;  4S05 A;  1KA8 A;  2MA3 A;  3ZMS A;  2DLL A;  3BWG A;  2DFI A;  5FLX Z;  1OMI A;  4PDK A;  4QLC U;  3DEU A;  4AVP A;  1QGP A;  2LSO A;  1T2K A;  1K7A A;  4A0X A;  2NS0 A;  1HBX G;  2FA5 A;  2PMH A;  4P9U A;  1REP C;  5F6F A;  2P6T A;  1IN5 A;  2RGV A;  3GFM A;  3MQ0 A;  2V1U A;  2EFQ A;  3QU6 A;  4Q4Z F;  1RNL A;  3P7N A;  2QM3 A;  1SD6 A;  1YW9 A;  4XRF A;  3TOB A;  5D4S A;  5LGN A;  1JHH A;  2L3D A;  3DV8 A;  1QQI A;  2BV6 A;  3J81 Z;  5HLI A;  4AWX B;  3ML6 A;  3FMS A;  3RI4 A;  3REO A;  3WU1 B;  3COA C;  5HS8 A;  2JT1 A;  2VBZ A;  3RYR A;  2M45 A;  2W84 A;  1ZG1 A;  4PCQ A;  3CUQ A;  3WTX C;  5DV5 A;  1YO5 C;  2EFN A;  3RKX A;  1LVA A;  2PLY A;  1USS A;  1UCR A;  4EV0 A;  2XIG A;  5J8F A;  5D4R A;  1T98 A;  4P55 A;  1JGS A;  1F9N A;  4L0Z B;  1WRJ A;  1XDU A;  1Z6R A;  4EJT A;  4NB5 A;  4R1H A;  5ICE A;  2PJP A;  1BI3 A;  4GCV A;  3MEX A;  5CYV A;  2D1H A;  5LGU A;  2BE5 F;  3P9K A;  1FYK A;  2ZO4 A;  4AIJ A;  5D8L B;  4A5N A;  2RN7 A;  2ELH A;  2YX4 A;  1L0O C;  1QO0 D;  1U5T B;  1XSX A;  4HF1 A;  4UVA A;  2PQ8 A;  3T5X A;  3TGN A;  4HW0 A;  2BEO A;  2EB7 A;  2KIU A;  2ZXJ A;  4U0V A;  2ADU A;  4A5M A;  2WC2 A;  4JBA A;  1R1V A;  1KQ0 A;  3HIF A;  4A6E A;  1KU7 A;  1A04 A;  2OZ6 A;  3F6V A;  5HS7 A;  4MEX F;  2QVO A;  3DPL C;  3QAH A;  3V7C A;  1L3L A;  1R22 A;  3IKT A;  3TO6 A;  2EFW A;  2VE8 A;  3PQK A;  3RJP A;  3FF5 A;  3LWF A;  4Q5S F;  4BHC A;  1CF7 A;  3K2Z A;  5CLS A;  4RAZ A;  1Z1D A;  5FB2 A;  2QQB A;  2DAO A;  3FMQ A;  5DCM A;  1IF1 A;  2PEX A;  1UB9 A;  1TNS A;  5LLQ A;  4I0A A;  2K4J A;  5L3E A;  4HYE A;  1R23 A;  4M9Z A;  2Q8K A;  4G8X A;  4EJO A;  2PFB A;  2ZME B;  1MDM A;  2YR2 A;  4KN4 X;  3R60 A;  3HSE A;  2G9W A;  3IWF A;  3WGI A;  4UV8 A;  3GX4 X;  1R5G A;  5LEK A;  2J5P A;  3GFJ A;  1Q1H A;  4RS8 A;  1FWZ A;  2EA2 A;  2F5D A;  3EQL F;  2VBX A;  3IC7 A;  2YU3 A;  3OV8 A;  1UHM A;  5IT3 A;  4IRI A;  4LGW A;  4ZYD A;  3CDH A;  3CUQ B;  4PGG A;  3KET A;  1ZG3 A;  3W6J B;  1Y0U A;  5E8G A;  2M5W A;  1FX7 A;  2L54 A;  2RQP A;  1ODD A;  1BJA A;  4O5V A;  1JXS A;  2VT2 A;  1FSH A;  1HKS A;  2EFO A;  3QP6 A;  3BDD A;  2XRO A;  4G6D A;  2IJL A;  1WSU A;  1B6A A;  1IRG A;  1HW1 A;  2LF8 A;  4M72 A;  4A0Y A;  3CUO A;  4LLL A;  1ZH5 A;  2ESN A;  2W25 A;  3K0L A;  3ECH A;  2GIV A;  4CXF A;  1TQM A;  5LGT A;  4ENJ A;  3K69 A;  4CIC A;  3HHG A;  1J5Y A;  5BQT A;  3RPQ A;  2PMU A;  3LST A;  3MCZ A;  5FO5 A;  3WTZ A;  4MTD A;  4A6D A;  1RIO H;  3G3Z A;  3T0Y A;  3ZP5 A;  2VE9 A;  3BJA A;  2MLG A;  3ZN1 A;  4KMF A;  3F8M A;  4HBL A;  2OZU A;  4HV6 A;  2NNN A;  1OYW A;  1CF7 B;  3ABU A;  1ZAR A;  1J75 A;  3HRS A;  2XV4 S;  5DCM B;  1YS6 A;  3SXY A;  5KVR A;  4HX4 A;  3LA7 A;  2K7L A;  1HXD A;  2G7U A;  3LQQ A;  3KP5 A;  3KP4 A;  4GO1 A;  2MD5 A;  4XLP F;  4MQ9 F;  4EGY A;  1LEA A;  2F5C A;  2DT5 A;  4OIR F;  4H0E A;  5DUK A;  1P4A A;  2H27 A;  1MDM B;  3HTS B;  3LA2 A;  1LQ1 A;  2XAF A;  5D5W B;  4LG0 A;  2O8X A;  2KKO A;  2M30 A;  4ETS A;  1I6X A;  4FX0 A;  3I71 A;  4ON0 A;  4IXA A;  4YII A;  2D2W A;  1PDN C;  3DF8 A;  1S6L A;  5ICC A;  1R1U A;  2UXX A;  3BJ6 A;  2E7W A;  3T8R A;  2FOK A;  1YFH A;  3KP6 A;  2AS5 F;  3L2C A;  2OQG A;  4P9F A;  3JTH A;  2IP2 A;  3N4M A;  3BZ6 A;  1K6O A;  5A2Q K;  1XGO A;  3IRQ A;  4WK8 F;  1AWC A;  5E18 F;  4R79 A;  3GLX A;  1O57 A;  5F64 A;  1JHF A;  2QBY A;  1CGP A;  1HKQ A;  4BXU A;  3KP2 A;  5JFR A;  4CO8 A;  5JVT A;  5CVJ A;  3ZMZ A;  1IW7 F;  3HTU A;  2HS5 A;  1SD4 A;  4XBF A;  3RDI A;  3HRM A;  1ZRD A;  2IW5 A;  4RGX A;  1WI9 A;  4ESB A;  1FLI A;  1DUX C;  5LRR A;  5K5R A; 
#chains in the Genus database with same CATH topology
 2GXG A;  3I5U A;  1YX5 A;  1R5H A;  3ISP A;  4G94 A;  3K1N A;  4P96 A;  1FBU A;  2FRH A;  2VUM J;  2XPW A;  2Y0M A;  2PMZ A;  2YX7 A;  3SQN A;  1XGM A;  4ESJ A;  2E2H J;  1FOY A;  1TW3 A;  2L2O A;  4M9X A;  2Z1D A;  3G4S I;  2CUE A;  4LFU A;  1ZRE A;  3RSN A;  4D1Q A;  1GV2 A;  2XAG A;  1C0W A;  2KRC A;  2HVR A;  1AA7 A;  3HOZ J;  3QU3 A;  3RCO A;  4M6Y A;  1XB4 A;  1FT9 A;  3DBH B;  1B9M A;  1GXQ A;  5F0H A;  2WA0 A;  3GFL A;  1F5T A;  2VJI A;  2WAQ A;  2NRA C;  4NHJ A;  2VXD A;  1S3J A;  3Q9V A;  3QWL A;  2KZG A;  4P1W A;  3DQV C;  2VN2 A;  2E71 A;  2LG4 A;  1J59 A;  1IN8 A;  1D1C A;  2OA4 A;  2QSF X;  1U3E M;  1LEB A;  4V2G A;  4F55 A;  1G3Y A;  2DA3 A;  4IHV A;  2GAU A;  4KUM A;  2OJE D;  4XRS G;  1FSE A;  3BOQ A;  2OTJ I;  5JHF A;  3SEQ A;  3ZMV A;  3M1E A;  3MZH A;  4U7D A;  2LNB A;  2PJR A;  4Y17 A;  4MIM A;  3AG4 H;  1B9N A;  3KX2 A;  4IRG A;  1TQP A;  1H9G A;  4CDG A;  2B63 J;  2V1D A;  1FZP B;  5KK1 A;  1AU7 A;  4BQA A;  3GVA A;  1X4P A;  1P9Q C;  2BOL A;  2Y0S N;  4LG0 B;  2V7F A;  3VSK A;  4WXC A;  1LFP A;  2FQ3 A;  2E7X A;  2HQ5 A;  1D0X A;  2FXA A;  4ZYA A;  1HA8 A;  2V1X A;  5M5W J;  2L4M A;  2QCO A;  3B02 A;  1PJR A;  2E36 A;  3SZP A;  1E3O C;  5H6R A;  1XGS A;  2W4S A;  3R61 A;  4HA8 A;  2IAI A;  1TLH B;  3MMY B;  2BHZ A;  2CMP A;  2FBH A;  4UB6 C;  3W2V A;  5BS6 A;  1EH6 A;  1BOB A;  5DD4 A;  2F48 A;  2MBF A;  3BTI A;  5AON A;  3BJO A;  1O3S A;  4BBS J;  4I6Z A;  5HNH A;  1K79 A;  5LEJ A;  3MZY A;  2O6G E;  4KIC A;  1BR2 A;  3VB2 A;  3I64 A;  5HLG A;  3CTA A;  3RQI A;  2VOD A;  2KJB A;  2ME0 A;  3AAF A;  3HPG A;  3WTU C;  1GXP A;  2P5L C;  1XSD A;  3GCM A;  1YIJ I;  1ZRF A;  4CYD A;  4UUS A;  3WTY C;  2OU2 A;  1YIO A;  2A6H F;  2CV0 A;  1D1A A;  1WVR A;  4N4N B;  2BGC A;  3HOY J;  3PSF A;  2QBY B;  1MKM A;  2LF7 A;  2ZXI A;  5E1W A;  3VWB A;  4ENK A;  2AXT C;  3V7R A;  5ILU A;  2QSG X;  1KZH A;  1AHD P;  1U78 A;  3R0J A;  5ERI A;  3E6B A;  3LSP A;  1HW2 A;  5EEG A;  1UHW A;  1BN5 A;  4XM3 A;  1QNT A;  1VND A;  3WHC A;  4K2E A;  2FQ4 A;  3OR1 C;  3QPT A;  3SDG A;  2V6C A;  4S0H B;  2P0W A;  4BH9 A;  1TWH J;  3EET A;  4UVC A;  2H1L A;  2XSD C;  4BU2 A;  5A2Q Z;  5C44 J;  2STW A;  3JRH A;  2LBF A;  2P7C B;  2ZNZ A;  1VQL I;  1T56 A;  2XGD A;  4IKF A;  1JE8 A;  1W7P D;  1SD7 A;  2JA7 J;  2MAB A;  1U0J A;  3G1L A;  3LSK A;  1MMD A;  3FDY A;  3RPU D;  2RC4 A;  1R7J A;  3HOU J;  4P5O A;  2FBK A;  5EGO B;  3CC2 I;  1IRZ A;  3CCQ I;  5E3O A;  5B5E C;  1YW8 A;  5L3F A;  3NQO A;  3M07 A;  4L5J A;  3KE2 A;  5KNL A;  5L3B A;  2UV1 A;  3DU6 A;  3FHZ A;  2XGC A;  1VFC A;  2F4M B;  3HOW J;  4ZYE A;  5HLH A;  5CJ9 A;  1SVL A;  3W6K B;  3I58 A;  1QA6 A;  1HSJ A;  4Q47 A;  1IV6 A;  3O2P E;  1BJZ A;  2E60 A;  3GO5 A;  2P4W A;  1WWX A;  1IDY A;  2B7E A;  3D0S A;  5EF6 A;  3GTJ J;  2EK5 A;  1FTT A;  1G6N A;  3OYM A;  5J8C A;  3I54 A;  3LSG A;  1E0E A;  1GVD A;  2OC6 A;  4DJA A;  4EMS A;  2XUB A;  2NNY A;  2C6Y A;  4AD9 A;  2HZT A;  4NNJ A;  1XD7 A;  2I10 A;  5E1X A;  2VC1 A;  3C1D A;  2Q0O A;  3MZ8 A;  5C3E J;  5FKN A;  2E1O A;  4LK1 F;  1Z9C A;  3DPT A;  3IHU A;  2O5R A;  2GA1 A;  2TCT A;  1X19 A;  3G1O A;  5E20 A;  3VOD A;  2IS6 A;  2A6T A;  3WU0 A;  3ERE D;  4AIH A;  1KQ8 A;  4F7Z A;  2VB6 A;  3I0T A;  3HSF A;  4EJU A;  2KDO A;  3M8E A;  5J4Y A;  3I55 I;  1QPI A;  2O61 A;  3BG9 A;  1WJC A;  2PJR B;  3H9Q A;  1E2X A;  3ABT A;  2V79 A;  1X3U A;  2L9V A;  4ZYG A;  1YW7 A;  2DT6 A;  2QLZ A;  2EA4 A;  4HDU A;  2OUM A;  1SMT A;  1H0M A;  4RGR A;  1RUO A;  3K1M A;  3PQJ A;  5IT9 K;  3GTP J;  2W24 A;  3ZMU A;  5D6E A;  2EIL H;  1LB2 A;  3ZPL A;  1T39 A;  2R5Y A;  2V9K A;  2QZ8 A;  1P7I A;  1OLT A;  2F5F A;  1OYY A;  2A61 A;  4M3D A;  3S14 J;  3GTQ J;  3S2D J;  4CCO A;  4FE4 A;  3U1D A;  2JA6 J;  3QPL A;  1Y8R B;  4DYQ A;  1H9T A;  3SZG A;  2OPT A;  3PSI A;  4XIC A;  3S8P A;  1S7O A;  3GBG A;  5JVG F;  2UWM A;  1OCZ H;  1ZRC A;  1JUP A;  1X4O A;  3Q0U A;  2OV7 A;  3A0B C;  2TRT A;  4LLG F;  2DTR A;  1YHQ I;  4DQ2 A;  4G7O F;  2H94 A;  1U8R A;  1E17 A;  2XF5 A;  1G3T A;  4BE2 A;  1UJ8 A;  5F0C A;  1EJ9 A;  5E1Z B;  2HDC A;  3ZRG A;  1ENH A;  2JJ7 A;  3QOE A;  3MKW B;  2DJI A;  2BY0 A;  3ZOB A;  3F23 A;  4ENN A;  1S9H A;  5KAI C;  1XDS A;  2EPF A;  1ULY A;  1FNN A;  1V3F A;  2HOS A;  1ETY A;  3BR2 A;  2K40 A;  1DP7 P;  4UNO A;  3R6S A;  4F52 A;  2DPD A;  1ONV A;  2GQQ A;  5HOD A;  2ID3 A;  2IVM A;  2R0Q C;  1T8I A;  1GHC A;  4XID A;  3DTI A;  3OMY A;  4LOC A;  4X1E A;  4J01 A;  1NK2 P;  1DP3 A;  4A3C J;  4GDF A;  4A3I J;  1G8X A;  5HDN A;  1QZZ A;  2EFP A;  5DCF A;  4AU7 A;  4V19 K;  3CCY A;  4HQM A;  3V8L A;  5JI6 A;  1LJ9 A;  1G3S A;  2BVL A;  5TRD A;  3CCR I;  2VPL A;  5ICG A;  4AC0 A;  2L7M P;  1ZHF A;  1ZGW A;  3TP0 A;  2J5O A;  3CJT B;  4BQN A;  1TZL A;  1LKX A;  4HX7 A;  1U6G A;  4U0W A;  2F5E A;  1MIJ A;  5FD5 A;  1UST A;  2HTJ A;  3LL7 A;  2GBY A;  1YLF A;  2M0M A;  2DQR A;  3M3Y J;  1Y8Q B;  3DEE A;  2O8K A;  3KCC A;  2LVS A;  4XN0 A;  1FYL A;  4XLH A;  5H6Q A;  4PFP A;  1ZG5 A;  4EJV A;  2LBF B;  2IPQ X;  2JA8 J;  5FKO A;  3BR5 A;  3Q9S A;  1IXS B;  1R4N B;  1LDJ A;  3F8C A;  4AUX A;  4IO9 F;  3OY9 A;  1UFM A;  1IRF A;  2I5U A;  2EV6 A;  4HOB A;  4BJ5 C;  1YE9 A;  2BY3 A;  5GAE J;  1N25 A;  4PJ0 C;  2HNH A;  2W82 A;  1QU3 A;  1Y39 A;  2CQX A;  3E7L A;  2LY9 A;  4XLE A;  2WAF A;  4JK1 X;  5BNG A;  4Y13 A;  3EUK L;  1X1C A;  4I2O A;  5F08 A;  3JRE A;  4IF4 A;  3QOP A;  2MD0 A;  1ITY A;  4DW6 A;  1MH4 A;  3ELK A;  4HAM A;  2VXZ A;  4C2U A;  2XAS A;  2JA5 J;  2HOE A;  3FK6 A;  1JKP C;  4M6V A;  4Q48 A;  2EQR A;  3WGG A;  1SFK A;  2RNG A;  3IUO A;  5L3G A;  4M3B A;  3LNQ A;  4L5E A;  3TO9 A;  3WE3 A;  2PG4 A;  2DFF A;  2E5Z A;  2DYR H;  4LD5 A;  2R7S A;  3MAJ A;  1ORK A;  2M9H A;  5EZG A;  3W3C A;  4EJW A;  1ETV A;  1TW2 A;  2VL8 A;  1OIS A;  2R5Z A;  2IGK A;  1WH5 A;  4JQF A;  4HRI A;  4HDV A;  3T8T A;  4R8H A;  3S15 J;  1JJ8 C;  1YS7 A;  2A6E F;  5AIP A;  3JRF A;  2UZK A;  2BHY A;  1T0F C;  1ETK A;  1KU9 A;  2HOT A;  3SFI A;  2WY8 Q;  2LY2 A;  1IN7 A;  1ETO A;  3Q5F A;  3BTC A;  3N05 A;  3F8N A;  4NBQ A;  3RZD J;  3LSM A;  3TDU C;  3HEF A;  2KRF A;  2P7V B;  4IEJ A;  2NS8 A;  2WB1 A;  4RAY A;  2GLO A;  2LRD A;  2NVQ J;  3QRF F;  1IZ1 A;  2R5Y B;  2DA1 A;  1RZ4 A;  4D5C A;  2KFD A;  2RAE A;  2L02 A;  2WTE A;  2JK3 A;  1J9I A;  5AIQ A;  2XC7 A;  1N78 A;  1Z7U A;  2NXN B;  1I1S A;  2D45 A;  2H6B A;  3H5N A;  4XLA A;  5CQG A;  2FU4 A;  3DBL B;  1OR7 C;  4G6Q A;  3WE2 A;  4YIR X;  3LMM A;  3BC8 A;  1GT0 C;  3CMY A;  1W7P A;  2X6W A;  4HSR A;  5J1Y A;  4G7H F;  1HCR A;  3FXU A;  2K9N A;  3RYP A;  3DEW A;  3RPU A;  3H92 A;  3M7G A;  3L2Q A;  2NAZ A;  2RQQ A;  4HV5 A;  5FFZ A;  3W6V A;  3S1M J;  3EYI A;  4FTH A;  4CHU A;  5HDG A;  1O7F A;  5L3D A;  5FFX A;  4EAT A;  1IJW C;  5IT9 Z;  4L18 B;  1D8J A;  2BYV E;  3E5X A;  2MLK A;  2W1O A;  1ZLK A;  3CF2 A;  2EIJ H;  4AIK A;  4BHB A;  3FXO A;  5EG0 A;  2QYO A;  2Y48 A;  2ZSI B;  4KIB A;  4UVB A;  3K9T A;  2FMY A;  4N4O B;  4GYI A;  1A6Q A;  1QRY A;  3WTV C;  1LFB A;  2M7B A;  5HLT A;  1BW5 A;  3BT9 A;  5IYC J;  3NRV A;  1MD0 A;  4BDY A;  1IAW A;  3QPH A;  1MBF A;  1OYI A;  5F1J A;  4A3L J;  1Z6T A;  3BP8 A;  4A3D J;  2CQK A;  5JR3 A;  2DU9 A;  2CQN A;  5IPA A;  4UUT A;  4KYW A;  1EH8 A;  4CH7 A;  1XCV A;  1W5T A;  3DKW A;  2IGM A;  1TT5 B;  1WPK A;  3K4M A;  4O6J A;  2D5V A;  1ZTR A;  2IRF G;  2O0Y A;  2FSW A;  2FEZ A;  2DOD A;  3K10 A;  1HST A;  3HGG A;  1RPW A;  2F5V A;  2GWR A;  4N9I A;  2Q2E A;  1R5I D;  2Z2S B;  1DU6 A;  2XF7 A;  1RI7 A;  3U9G A;  2ZME C;  1WJD A;  3FXM A;  4E7K A;  4PK4 A;  3CP8 A;  1ZQ3 P;  1FOK A;  3J7Z I;  3OYA A;  3C2G A;  1J7K A;  4A69 C;  3OYI A;  4RAG A;  3SZT A;  4YG2 F;  4U88 A;  4FCY A;  3PJR A;  3GYH X;  2QUF A;  3PFI A;  1WH7 A;  3OYN A;  4B3X A;  2ZJP F;  1GLN A;  1EV7 A;  4KT5 C;  3A01 A;  2XGE A;  1MH3 A;  2DK8 A;  5F1R A;  2HTS A;  1K78 A;  4B8X A;  3AG2 H;  5L3C A;  4HQE A;  2W7N A;  1VZ0 A;  1PYV A;  2OBP A;  4B48 A;  4EEF G;  1YJ9 I;  2G0E A;  2HQN A;  2F2E A;  3L7W A;  2P81 A;  2NVX J;  4WXD A;  1IUY A;  4E7H A;  4PJL A;  2R7O A;  3HDD A;  2R7Q A;  2PN6 A;  3HG9 A;  2N8G A;  1I27 A;  5E3M A;  2CUF A;  4GGG A;  3WG9 A;  4B47 A;  4FHT A;  2X0L A;  4B09 A;  3ZQC A;  2MYS A;  2JSP A;  2Z99 A;  3A4C A;  1GUU A;  1Z67 A;  1TP4 A;  4WCG A;  4OIP F;  1IGN A;  3T1B A;  1NTC A;  1OCR H;  3WOD F;  2ECC A;  2LR8 A;  3M8F A;  2R5Z B;  2GXB A;  1EH7 A;  3L2U A;  2KIF A;  5K5O A;  2DMQ A;  2XHK A;  2FOW A;  4A12 A;  1GVJ A;  4IRH A;  4U7B A;  1FOX A;  3ZN0 A;  4IQJ A;  1WJ5 A;  2KQR A;  2LYC A;  5D5V B;  3JSO A;  2XSJ C;  2HPM A;  4KFC A;  1ACI A;  4UB8 C;  1Y56 A;  4XQF A;  4OU0 A;  1Z05 A;  1STZ A;  2EIK H;  1R00 A;  9ANT A;  4CZZ A;  1D0Y A;  3HJE A;  1IXC A;  4XKV A;  3L1P A;  2HGC A;  2R4G A;  2F4I A;  3GZN B;  2W57 A;  3DCF A;  3V4G A;  4ANJ A;  4YFK F;  2JN6 A;  2D1V A;  2XRN A;  1BI2 A;  1ETW A;  1ZR2 A;  1FJL A;  1EF4 A;  3LSJ A;  2M4K A;  2OAZ A;  5FRO A;  4DYR A;  4KIG A;  4IQ4 A;  5D5X B;  4KJZ A;  4ZYH A;  4WX9 A;  3P9C A;  3E97 A;  3RKY A;  3HPH A;  4AID A;  1NG6 A;  2CW7 A;  5H2F C;  4BE0 A;  2YU9 J;  1W0T A;  1FBS A;  2CUJ A;  4Y3O A;  5F04 A;  1LUJ B;  3OR2 C;  1X1B A;  5HNF A;  5ICF A;  1FP1 D;  1W7P B;  3FZV A;  3S3M A;  3H1C A;  3CO6 C;  3G1M A;  2F6C A;  3KPH A;  3PUB A;  1E3H A;  2ZKZ A;  4BAC A;  1NH3 A;  3DXJ F;  2XPV A;  2OCC H;  5J1U A;  4YFN F;  5C4X J;  4HLX A;  1XG1 A;  2JSC A;  3AFH A;  2PBI A;  1LE8 A;  5TIS C;  2O3F A;  3HRU A;  1XMA A;  1ETX A;  5M5Y J;  5EG0 B;  1XMX A;  2K4B A;  5CVI A;  2CWE A;  3I4M J;  5EJC A;  2K9Q A;  3RKQ A;  2NVT J;  2BZT A;  4E7I A;  2CV1 A;  1LDK B;  3PFY A;  3E5Q A;  4HLY A;  4EQQ A;  4RLQ A;  3PIO F;  1NG7 A;  1O3Q A;  2LC2 A;  4EVI A;  2QA4 I;  2LKX A;  1OJL A;  3IAS 2;  3IL2 A;  1FEX A;  1I3A A;  3P9I A;  3OS1 A;  3BQY A;  1V55 H;  1G2H A;  4GXO A;  2LKS A;  2FX0 A;  2R7D A;  3BLY A;  1B8I A;  3EDP A;  1UHS A;  2QQA A;  3GLL A;  4G9Y A;  3KYC B;  4LJZ F;  2DMP A;  4FET A;  2QKL B;  1OCC H;  2K9L A;  2OTL I;  1O7L A;  3BCB A;  4DBR A;  3DKY A;  3MKZ A;  4KNY A;  3ZQH A;  2HPI A;  4BUP A;  3H3V K;  2RRE A;  4WF2 A;  3GEZ A;  4EM1 A;  3DLA A;  1VQK I;  2LK2 A;  3AG3 H;  2CQ7 A;  2ZFW A;  4OAZ A;  3MD2 A;  1K6Y A;  3KEO A;  3NEU A;  2DJN A;  2R7W A;  2LKP A;  4FX4 A;  3EUH C;  1W36 C;  1V5E A;  3A01 B;  2CS3 A;  2AQE A;  2L01 A;  5HS9 A;  5J3L A;  4QWQ A;  1DPU A;  1F1Z A;  1P92 A;  3E1S A;  1K78 B;  3KYL A;  1TTY A;  4XMY A;  3S1N J;  2XDV A;  3AKZ A;  1V54 H;  2HKO A;  4RB0 A;  3ZR8 X;  4DNC A;  2HDD A;  1IN4 A;  3S1R J;  3CCE I;  2MC3 A;  4LG3 A;  4BYY A;  4RMN A;  3BR3 A;  3LSI A;  2PX9 A;  3HOT A;  3J7A Y;  4MQV A;  3S3O A;  1PUF A;  3C18 A;  3GWZ A;  2Y9Z A;  2FBI A;  2IS4 A;  3HUG A;  2W85 A;  3BR1 A;  4ZDP A;  2KL4 A;  2X1D A;  3HHH A;  1FOW A;  3Q0W A;  2LH9 A;  2EZK A;  3LOC A;  2LDU A;  2HYJ A;  2JPB A;  3FM5 A;  4XKC A;  4A2U A;  4LIU A;  4RBO A;  2AXL A;  2NYX A;  2XAH A;  3D5S C;  5DDG A;  5B66 C;  2ZJ2 A;  5LBQ A;  2HQR A;  2X4H A;  2IEK A;  4L0Y B;  2WY7 Q;  3CDI A;  1QPM A;  1T0F A;  1SFE A;  2RKH A;  2WAD A;  2FF4 A;  2DO7 A;  1HDD C;  2H8R A;  1WFX A;  2NVY J;  2DFE A;  4CCM A;  3C7J A;  3BRO A;  4XRS A;  2UUZ A;  4BS9 A;  4JX4 A;  3ONQ A;  2HYF A;  3ROU A;  2Y0S A;  4B44 A;  2X51 A;  3VYT B;  1OQY A;  4M3E A;  1MND A;  3ASN H;  4A3E J;  1T38 A;  2HXO A;  2KIM A;  3H0D A;  4PJM A;  2RV8 A;  1KON A;  3JRI A;  4ZZD A;  1W36 D;  4EM2 A;  4IVN A;  4ZJZ A;  4IOA F;  1MMA A;  5K7Z A;  2DFH A;  1MZB A;  2GZW A;  2RNJ A;  4IJA A;  3F3X A;  4MFD A;  3VSL A;  2X85 A;  1OR7 A;  1J0R A;  3I4N J;  3BQZ A;  4ZH4 F;  1TT0 A;  4XLN F;  1O3T A;  2IGN A;  2QQ9 A;  3R0A A;  2DBB A;  3CJN A;  2M1B A;  1B4A A;  4C3J J;  3LAJ A;  3Q3S A;  2RVC A;  1XSV A;  2V4J C;  1I50 J;  2VJJ A;  4JX5 A;  4BAY A;  2JQ7 A;  4A3B J;  1LE8 B;  2HEO A;  5DYM A;  2X6X A;  3JCU C;  3LA3 A;  3IH4 A;  3PNV A;  4AVZ A;  5FD6 A;  3I3L A;  3UR3 C;  1XGN A;  3E6M A;  2L7Z A;  2JMW A;  4NC6 A;  3GFI A;  2R93 J;  2ZNY A;  2IA0 A;  3DFG A;  3OIQ A;  2M8E A;  2YSR A;  4CUG A;  2LLK A;  4L5I A;  1R58 A;  4LIV A;  1Z0X A;  3PM1 A;  2ZXH A;  1V5G A;  3K2A A;  3FXL A;  1O4X A;  1QVU A;  4J00 A;  3WTS C;  1VTN C;  3DTE A;  4RDU A;  5H20 A;  1Y1V J;  4PZJ A;  4A3M J;  4CA0 A;  4IHT A;  1FP2 A;  2CG4 A;  2FD5 A;  4YRV A;  2X9D A;  4RB2 C;  1QBJ A;  3E3V A;  4NUB A;  2Z3Y A;  4L9V A;  4H4K C;  4BQO A;  1R6R A;  2VT3 A;  3FIS A;  2H6C A;  1TWC J;  3VYS B;  3KLN A;  3CCS I;  5DTD A;  5J40 A;  1OFC X;  2XAQ A;  1FYM A;  3KZZ A;  2KP6 A;  2ZME A;  3JR9 A;  1Z3Y A;  3ZXS A;  4GRI A;  5DS9 A;  4UV9 A;  2MH9 A;  3PO2 J;  3ASO H;  1A31 A;  4HF2 A;  2HXI A;  1D3Y A;  3GTG J;  2JA2 A;  2R7T A;  5JHU A;  4DZP A;  4IZZ A;  2BBY A;  4BXX J;  3QOD A;  5E3N A;  2G7H A;  2E1M B;  1WJB A;  3QP5 A;  2VIX A;  4YFX F;  2DI3 A;  2R92 J;  3SDB A;  2CYY A;  3OSG A;  4CGZ A;  3VFZ A;  4XNF A;  4XKB A;  5ED4 A;  4IL6 C;  3WU2 C;  2FNP A;  1FTZ A;  1N77 A;  4KT6 A;  1S8N A;  2B0L A;  3J7Y J;  1BC8 C;  3OYD A;  1K83 J;  1T08 B;  2DA6 A;  3BPV A;  1W5S A;  3O3K A;  3K1P A;  1E3P A;  4CCL A;  2FNA A;  3H0G J;  4ZZL A;  1RES A;  3HYI A;  1YQA A;  2QF7 A;  3CZ6 A;  5K5Q A;  1PUF B;  4D0P A;  1BW6 A;  2R3S A;  3VEP A;  3HC7 A;  3FWE A;  3IRR A;  3GUD A;  4M73 A;  3HUG B;  4BJ6 C;  4KN7 X;  3F22 A;  3CJQ B;  1MMN A;  2DK5 A;  1UMQ A;  5BPD A;  1I6H J;  2IS1 A;  3ZQ7 A;  2YPR A;  3KP3 A;  2VC0 A;  1WKM A;  5B3S H;  2COM A;  2V1N A;  4RA2 A;  2Z16 A;  3HOS A;  4BGD A;  2VBY A;  1FMV A;  3BG6 A;  2VLA A;  3DP7 A;  1WGX A;  3KEY A;  4L9J A;  2MFZ A;  1SFU A;  4FAS D;  1SVO A;  3FX3 A;  1KU2 A;  1U8B A;  4XOR A;  1JI8 A;  5J6X A;  3ECO A;  5FLV A;  2O03 A;  1XN7 A;  3GTO J;  3K6G A;  4MEY F;  1I5Z A;  2IGO A;  3CO7 C;  4A3K J;  2CQQ A;  1HW5 A;  2VKD A;  4PFO A;  2ACJ A;  2KZV A;  2A69 F;  2ZB9 A;  3W2W A;  4UUS B;  3J80 K;  2GXA A;  2X6O A;  1BI0 A;  2R7U A;  3D5L A;  3RTR A;  3ZMD A;  1JJ6 C;  4CCK A;  2CSO A;  5TGT A;  5HOO A;  3N97 A;  4XR6 A;  4G12 A;  2ELJ A;  1MJA A;  2NOG A;  4HZF A;  3JRB A;  4BHP A;  4D5F A;  3BPX A;  3HM5 A;  4D9J A;  4OMZ A;  4XSZ F;  1X2M A;  3KLO A;  1ZEL A;  3FXR A;  4DZJ A;  3HKZ N;  1NHA A;  4GYG A;  1SC7 A;  2XAU A;  1IG7 A;  3F21 A;  1ZGA A;  2ZCW A;  1O3R A;  1VQ7 I;  2P5V A;  1DGR M;  3CP2 A;  1SVM A;  4KA4 A;  1RUN A;  3E5U A;  2OD5 A;  4HNU A;  5K1Y A;  1VF9 A;  2DW4 A;  3TP3 A;  1QZE A;  4PGH A;  4PSX A;  2WV0 A;  2K3P A;  3F8F A;  4E7L A;  1MSF C;  2HYG D;  1ZYR F;  2ZJQ F;  2KHM A;  3GTL J;  2Z5U A;  4PUS A;  2ETH A;  4PSW A;  2XPU A;  4IHS A;  4MO7 A;  1CQT A;  3CCL I;  1FC3 A;  2KLO A;  2Z33 A;  3KP7 A;  4L9T A;  2JPC A;  2GA2 A;  5E3L A;  2IA1 A;  3NWT A;  3V8K A;  4U0Y A;  3OL4 A;  2XKO A;  1SD5 A;  3PNT A;  4QPQ A;  4I01 A;  4JX6 A;  3CLO A;  3F72 A;  1MBK A;  4A0Z A;  2STT A;  4E70 A;  3SJM A;  3TO7 A;  2HWV A;  2B9S A;  4OIN F;  3O8G A;  1VQ4 I;  3BTL A;  1JKO C;  5DM7 F;  1JTX A;  4I0B A;  2MG4 A;  3FHN A;  2K9M A;  2HI3 A;  5IP9 J;  3S16 J;  3HKZ A;  3K4J A;  3FXK A;  5B1B H;  4FT8 A;  1W4M A;  3HRT A;  4RGU A;  1TNT A;  2ID6 A;  1VI0 A;  3HB9 A;  3TW6 A;  3DBR B;  2CW8 A;  4DGW B;  4RB3 C;  1FBQ A;  4DOZ A;  2JRM A;  2P8T A;  3WTW C;  5ILS A;  4B43 A;  4AYB N;  2HFH A;  3H5A A;  1JT6 A;  1HC8 A;  5CQE A;  1DDN A;  4HST A;  1FY7 A;  4Y7N J;  5GTH C;  4A3J J;  3I56 I;  3EUH A;  3CES A;  3L2W A;  1U5T C;  2VKE A;  3JSP A;  3DU5 A;  2EJR A;  3CCV I;  1PUE E;  2M87 A;  1R9T J;  1B1B A;  2VON A;  1RET A;  1TWG J;  3QYB A;  2HOA A;  3AL0 C;  3VOE A;  5E79 C;  2MGQ A;  3L09 A;  1AOY A;  2M3A A;  3FK7 A;  4CCN A;  2P6S A;  2P5K A;  1P4X A;  3H36 A;  1YYV A;  1BI1 A;  5DD8 A;  2KJC A;  2VQH A;  3VPR A;  4KDP A;  2TDX A;  2OCE A;  1YX3 A;  5LHH A;  4LMY A;  1TQI A;  4LLN A;  1HQC A;  4B4C A;  2ZJR F;  3HSR A;  2DXI A;  1Z7L A;  4MHG A;  5DEQ A;  3OYE A;  4EM0 B;  2K27 A;  4MGR A;  2HR3 A;  3KEQ A;  1X1D A;  3DTK A;  1HLV A;  5IOZ A;  2EIM H;  2DMU A;  3U21 A;  3IH3 A;  4M71 A;  3EYY A;  1SAN A;  1UG2 A;  2L9R A;  2EWN A;  4UXN A;  3U2R A;  1PP7 U;  1KGS A;  3CDL A;  4RM3 A;  1AKH A;  4I76 A;  3PO3 J;  4CSW A;  3KZY A;  2IS2 A;  1PP8 F;  1F4K A;  3SHF A;  2EV0 A;  2XKP A;  4F3Q A;  2X6Y A;  3M1C A;  4PJN A;  3GZ6 A;  3E6C C;  5LHG A;  3FXJ A;  2V9V A;  5DUI A;  1WJF A;  1Z3X A;  1SAX A;  1BC7 C;  1D0Z A;  1WI3 A;  3GF2 A;  3JW4 A;  1ZK8 A;  4KMU X;  1U2W A;  3GXO A;  4NQW A;  1S29 A;  1YRN A;  2VOO A;  4MNU A;  1HKT A;  2JWT A;  1ON2 A;  3OYJ A;  2KIQ A;  1ON1 A;  2ISY A;  2A5W A;  1D8K A;  1VQN I;  2XGX A;  3LFU A;  1MGT A;  3S93 A;  3I53 A;  5D8K B;  3G71 I;  5CVU A;  1BR1 A;  3GME A;  4N0B A;  2L4A A;  1FPQ A;  2HU9 A;  5FRM A;  1IXR C;  2LD5 A;  3R4K A;  3K70 C;  3BR0 A;  3J80 Z;  2YUS A;  1VQ9 I;  2DN0 A;  3F8B A;  5CKT A;  3JRA A;  2QEN A;  2LFB A;  3LFK A;  2IA2 A;  2M4G A;  3GZ5 A;  1J2X A;  3O6B B;  4M74 A;  3CUQ C;  2JZY A;  2R7Z J;  3G73 A;  3BY6 A;  5EZH A;  3KIO A;  4W1U A;  1XCB A;  5GP9 A;  5E8I A;  4LK0 F;  2BY2 A;  1A36 A;  4UY8 I;  3TBI A;  2ZBK A;  5IP7 J;  1DPR A;  1SMY F;  1BA5 A;  2HVQ A;  4BBR J;  3JRD A;  2FML A;  3ZQQ A;  1OKR A;  5F27 A;  5JLX A;  5LRS A;  4UHT A;  4IHY A;  2AQF A;  3L9F A;  2K9S A;  4OIO F;  4BNC A;  4AM3 A;  1SFX A;  2BW3 A;  2VBW A;  3JAM K;  4UUV A;  1V4R A;  3FXQ A;  4X6A J;  3SFZ A;  1W1W E;  3SYT A;  1DQU A;  3I59 A;  4E7J A;  4HF0 A;  3OOP A;  2E2I J;  4N9H A;  5JLW A;  1KQ9 A;  3TQN A;  2ZXW H;  3OWT A;  4WXH A;  2CUZ A;  2DYS H;  4ZC3 A;  2VOP A;  1D5V A;  1P7J A;  1ZLJ A;  3ERM A;  1I1G A;  2BY1 A;  4LB6 B;  1TBX A;  4KIF A;  2L7K A;  2QWW A;  4XSX F;  3TDZ C;  5BMZ A;  4MTE A;  4ENM A;  5FRN A;  5FLX K;  2NS7 A;  2A3S A;  1YTY A;  1BIB A;  1KYW A;  2Y75 A;  3J7A O;  5HVQ C;  5ILV A;  4U87 A;  3HL2 A;  3TMO A;  3F6O A;  2Q1Z B;  1YG2 A;  1T6S A;  3ULQ B;  1OCT C;  3F9K A;  2ESH A;  2WV1 A;  2JRT A;  3CMA I;  4RGS A;  1HOM A;  1OPC A;  4ESF A;  1S7A A;  5EEH A;  2DQL A;  1QHG A;  3ABK H;  3H9G A;  3U1K A;  3CC4 I;  1GDT A;  3K70 D;  2Y2Z A;  1I39 A;  2EH3 A;  3IWZ A;  1N75 A;  3CQZ J;  3V7S A;  3OYF A;  3OS2 A;  2FE3 A;  4YIF A;  5LHI A;  1B59 A;  3H3U A;  1BIA A;  2UXN A;  3JTG A;  1P2F A;  3IKV A;  5E17 F;  4JOM A;  5J4V A;  1P4W A;  4I09 A;  2W48 A;  1F43 A;  4HEA 2;  4JP0 A;  1VQ8 I;  1X1A A;  1XMK A;  4RB1 A;  2W00 A;  3I4P A;  2E1N A;  3WGH A;  1YOV B;  3B73 A;  4OMY A;  3BCA A;  4G7Z F;  1QZY A;  2PMZ N;  2OQR A;  3WTT C;  4OAY A;  3A0H C;  3L00 A;  3HOX J;  4IPA A;  3V42 A;  3TKY A;  1A5J A;  1FIP A;  1NK3 P;  2A05 A;  3H35 A;  3PUF A;  5D6F A;  3OYB A;  2A5Y B;  3OL3 A;  3J81 K;  2A07 F;  4A3G J;  3LQR A;  1AKH B;  1H8A C;  1ZGJ A;  6PAX A;  4LB5 A;  1JT0 A;  1LDD A;  2H09 A;  3GTM J;  2V26 A;  2H8W A;  4M6X A;  4OOI A;  1X3Z B;  1BM9 A;  2LP0 A;  3OIO A;  4QSH A;  1Y1W J;  4BY7 J;  4JYK A;  1R49 A;  4NQW B;  4YEL A;  2E1C A;  1HF0 A;  1YRN B;  5GAG J;  3W2A A;  4EGZ A;  5CVV A;  5M5X J;  3UKG A;  2Z9O A;  1Y0N A;  1WHU A;  3MN2 A;  4M9S A;  2CO5 A;  4ZTF A;  2Q2E B;  3ZQI A;  2EV5 A;  3MFK A;  3CD6 I;  1BOA A;  1X1P A;  4I7H A;  4Y33 A;  3GW2 A;  1IDZ A;  2MH2 A;  2HVS A;  2ICW G;  5GTI C;  1D1B A;  3MKY B;  1BL0 A;  3V8J A;  5FGM A;  2MC4 A;  4Y15 A;  2L5Q A;  3ZGK A;  2K02 A;  5GAD J;  2IT0 A;  2JVH A;  4IX7 A;  2CFX A;  3K4C A;  2VJ4 A;  1ZN2 A;  2CU7 A;  1MMG A;  2ISZ A;  4E6K G;  4C30 A;  5CVR A;  2DOA A;  2RDP A;  4C2M J;  2KMU A;  3FBI B;  2JTV A;  3FM3 A;  5TJJ A;  1MJ9 A;  4L9N A;  1LNW A;  5GPA A;  1P6R A;  5KAF C;  1G3W A;  2CGP A;  3B6A A;  4I02 A;  3C3W A;  2Y9Y A;  1MJB A;  5KHD A;  2WWY A;  2EBI A;  3LAP A;  1WZ2 A;  2QQ8 A;  5D5U B;  4C3H J;  1IN6 A;  1WQ2 A;  5BOX A;  2CRG A;  2HKX A;  5HDK A;  1K4S A;  5BPI A;  1F36 A;  2DDA A;  4CYC A;  1G4D A;  2XVC A;  1R36 A;  2K85 A;  2CW0 F;  3E6D A;  1TWF J;  1TC3 C;  3L2R A;  2BW3 B;  1RR8 C;  3OS0 A;  4TV7 A;  3S2W A;  3K4B A;  3ABL H;  1EKE A;  3I59 B;  3M9A A;  3RIR A;  3IP4 B;  2DOF A;  3KFW X;  3CCJ I;  2M34 A;  3VYU B;  1KYZ A;  3H3Z A;  2VJ5 A;  1Z91 A;  3RKW A;  1S5L C;  3BG7 A;  2A68 F;  1ZAO A;  4ZTJ A;  4Z2Y A;  2L0K A;  2LY1 A;  4I98 B;  4BDZ A;  4O3M A;  3FMR A;  1BBY A;  2K86 A;  4WWC A;  1H88 C;  1XC5 A;  3S3N A;  3BG5 A;  5LFA A;  3TOA A;  2DPU A;  1KU3 A;  1HDP A;  3CME I;  3MWM A;  1K4T A;  2PI0 A;  1IV8 A;  4OWR B;  1U5T A;  3S2H J;  4ASN A;  3JAM Z;  1UEL B;  1A6I A;  2IBD A;  2R7F A;  4OIQ F;  4S04 A;  4HX8 A;  2LMD A;  1Y6I A;  1R1T A;  2XAJ A;  4M3G A;  4QIW N;  2E35 A;  4HG2 A;  3ZMT A;  4S05 A;  1KA8 A;  3LSR A;  4XL9 A;  2MA3 A;  3L2V A;  3ZMS A;  1IRX A;  2DLL A;  4A93 J;  3BWG A;  2DFI A;  3NAU A;  5CPR B;  5FLX Z;  1OMI A;  4XK4 A;  5J1R A;  1APL C;  1ERD A;  4PDK A;  3ZQL A;  2Y31 A;  3UNG C;  4QLC U;  3X2Q H;  3DEU A;  4AVP A;  1QGP A;  4BEH A;  2LSO A;  5GPC A;  1UG0 A;  1VQO I;  2VQC A;  1T2K A;  3G2B A;  2M7A A;  3H9J A;  1QHH D;  1K7A A;  4D7M A;  3BZC A;  3PL8 A;  1SEU A;  3VYR B;  4A0X A;  2NS0 A;  1HBX G;  3C2H A;  1JTY A;  3ABM H;  2FA5 A;  2PMH A;  4BKX A;  4P9U A;  1REP C;  5F6F A;  2P6T A;  1IN5 A;  5IYD J;  2RGV A;  3GFM A;  2VPR A;  3MQ0 A;  3M4O J;  2K5C A;  2V1U A;  5K7H A;  3QPS A;  2EFQ A;  3QU6 A;  3P5J A;  1LPQ A;  4Q4Z F;  4MLO A;  2EZH A;  3E0J B;  3A03 A;  1JUS A;  1RNL A;  3P7N A;  2QM3 A;  1SD6 A;  1YW9 A;  4XRF A;  3HOV J;  5GAH J;  3OYH A;  1W0U A;  3CF5 F;  3TOB A;  5D4S A;  5LGN A;  1X58 A;  1JHH A;  1MW7 A;  2BXZ A;  2L3D A;  4NDL A;  3DV8 A;  1B8I B;  2DA5 A;  1QQI A;  5M3M J;  2XRL A;  3CJR B;  2AO9 A;  2BV6 A;  2Y69 H;  3JRC A;  3J81 Z;  5FJ8 J;  4ZDL A;  4CZC A;  2VKV A;  5HLI A;  2AHQ A;  4F93 B;  4AWX B;  2BXY A;  4QPO A;  3ML6 A;  2X1E A;  3AG1 H;  3FMS A;  3F0C A;  3EUA A;  2L9N A;  3RI4 A;  3REO A;  3H5R A;  1MSE C;  3WU1 B;  3COA C;  5HS8 A;  2JT1 A;  4G6T B;  2VBZ A;  3OSF A;  1IUF A;  3RYR A;  4E7Z A;  2M45 A;  2NOJ B;  2W84 A;  2QEX I;  2O7O A;  4LIT A;  1ZG1 A;  4PCQ A;  3CUQ A;  2E2J J;  2DOE A;  3WTX C;  4W97 A;  4M3F A;  4II3 A;  3ZCO A;  3K4K A;  5DV5 A;  1YO5 C;  2EFN A;  3RKX A;  3A2K A;  1LVA A;  1T33 A;  2PLY A;  1USS A;  1UCR A;  2F4O B;  4F92 B;  1XX5 A;  2XIG A;  2L9S A;  4V2F A;  3MVP A;  4EV0 A;  5J8F A;  5D4R A;  3B6C A;  4FIS A;  4RLF A;  1T98 A;  4P55 A;  2DCE A;  1JGS A;  1F9N A;  4CYC B;  4L0Z B;  1WRJ A;  1XDU A;  1Z6R A;  3BR6 A;  4EJT A;  3MKL A;  4NB5 A;  1RKT A;  4R1H A;  5ICE A;  1JKR C;  4KIT B;  3CLQ A;  2ZSH B;  3ESW B;  2KT0 A;  2PJP A;  2DMT A;  1BI3 A;  3OYL A;  2DMN A;  3IAM 2;  4GCV A;  2GM4 A;  2QKM B;  5KCM A;  3MEX A;  4B3A A;  2R7R A;  2X1C A;  5FLM J;  5CYV A;  2D1H A;  3KYD B;  5LGU A;  2BE5 F;  3P9K A;  1FYK A;  2E34 A;  2MW8 A;  2ZO4 A;  3M8J A;  4AIJ A;  1K61 A;  5D8L B;  4A5N A;  2RN7 A;  1MMS A;  2ELH A;  2WAE A;  2YX4 A;  1L0O C;  1QO0 D;  1U5T B;  1WJE A;  1XSX A;  2JUG A;  4HF1 A;  3K7A J;  4UVA A;  2JVG A;  2PQ8 A;  3T5X A;  3TGN A;  3PIP F;  4HW0 A;  2BEO A;  2X48 A;  2EB7 A;  3AL0 B;  2KIU A;  2ZXJ A;  4U0V A;  2ADU A;  4A5M A;  2WC2 A;  1SFO J;  3C2B A;  4JBA A;  1R1V A;  2DA4 A;  1H89 C;  3NAR A;  1KQ0 A;  5J47 A;  3HIF A;  4A6E A;  3IV5 A;  1A04 A;  1KU7 A;  1VQP I;  2OZ6 A;  1X2N A;  3F6V A;  5HS7 A;  4MEX F;  1WJA A;  2ZC2 A;  4HNV A;  1MBG A;  2K3F A;  1B72 A;  2QVO A;  3DPL C;  3QAH A;  3V7C A;  3WHB A;  5IOY A;  4BEH B;  1L3L A;  1R22 A;  3IKT A;  1TWA J;  2XF6 A;  3TO6 A;  3S17 J;  3NWS A;  2EFW A;  2VE8 A;  3K4N A;  5EYR A;  3PQK A;  3Q0V A;  1JKQ C;  3RJP A;  3FF5 A;  1BR4 A;  3LWF A;  2DA2 A;  3O8H A;  2VQG A;  4BHC A;  1G59 A;  1CF7 A;  4Q5S F;  3K2Z A;  2EZI A;  5CLS A;  4RAZ A;  1IO2 A;  1Z1D A;  3GTK J;  3S1Q J;  4MFE A;  5FB2 A;  1R4M B;  1M1E B;  2QQB A;  2DAO A;  3FMQ A;  5DCM A;  4ABZ A;  3D1N I;  1D5Y A;  1IF1 A;  2PEX A;  1UB9 A;  1TNS A;  4BXF A;  1OCO H;  4A3F J;  2H1K A;  2LRE A;  5LLQ A;  4IHW A;  4I0A A;  1VQ6 I;  2E1M C;  2E19 A;  1TL8 A;  2K4J A;  1U9O A;  4XLC A;  5L3E A;  4HYE A;  1R23 A;  4XOT A;  2QSH X;  4M9Z A;  2Q8K A;  3HXL A;  4G8X A;  5C4J J;  4EJO A;  5B1A H;  2PFB A;  4GFB A;  2FJ1 A;  3OYK A;  2ZME B;  1MDM A;  2YR2 A;  4KN4 X;  3R60 A;  4DYC A;  3HSE A;  2G9W A;  3IWF A;  3WGI A;  4UV8 A;  2QGU A;  3GX4 X;  4XOP A;  1YJW I;  1R5G A;  5LEK A;  1W5C C;  2J5P A;  3GFJ A;  2WB1 N;  3HGY A;  3HBL A;  4XRM A;  1Q1H A;  4F91 B;  4RS8 A;  1FWZ A;  2EA2 A;  2F5D A;  2LOO A;  2VBX A;  3EQL F;  3IC7 A;  2YU3 A;  3OV8 A;  4PJJ A;  4X0G A;  1UHM A;  5IT3 A;  4IRI A;  3OIP A;  3A1Y A;  4LGW A;  4E4H A;  4ZYD A;  2CH0 A;  3CDH A;  1SAU A;  3CUQ B;  4PGG A;  1JGG A;  3KET A;  1LFU P;  1ZG3 A;  1OCP A;  1Y0U A;  5E8G A;  3W6J B;  2I8D A;  2M5W A;  1FX7 A;  2L54 A;  4XON A;  2R7X A;  2RQP A;  1VQM I;  4C9Y A;  1ODD A;  1BJA A;  4O5V A;  1JXS A;  2VT2 A;  4BJT A;  1FSH A;  1XPX A;  1HKS A;  2EFO A;  1Q1V A;  2LTP A;  1JUM A;  2M0C A;  3QP6 A;  3BDD A;  2NVU B;  2XRO A;  4G6D A;  2WBM A;  2IJL A;  1WSU A;  1B6A A;  4BQQ A;  2JUC A;  4CCJ A;  3ZQF A;  1IRG A;  2O9L A;  1HW1 A;  5FKL A;  3BZK A;  2LF8 A;  4Y52 J;  3FBN B;  1FMW A;  2COB A;  4AYB A;  3VDX A;  3G6E I;  2M2E A;  4M72 A;  5EEA A;  4A0Y A;  4ITV A;  5IP6 A;  4D7N A;  3DLL F;  1ZR4 A;  3CUO A;  3WG7 H;  4LLL A;  1ZH5 A;  2ESN A;  1VQ5 I;  2W25 A;  3IH2 A;  4XLF A;  3K0L A;  3RQ4 A;  3ECH A;  3JRG A;  1EA3 A;  3CMM A;  2GIV A;  4CXF A;  1TQM A;  2KDZ A;  5LGT A;  3QQA A;  4ENJ A;  1X3W B;  3K69 A;  1MNM C;  1RRJ A;  1MBH A;  4CIC A;  3HHG A;  4FQG A;  2FUG 2;  1J5Y A;  2ELK A;  2YS9 A;  5BQT A;  3RPQ A;  5LD2 C;  2PMU A;  3LST A;  1MNE A;  3CCU I;  2EZL A;  2VAS A;  3MCZ A;  5FO5 A;  1Z77 A;  2M8G X;  4YEJ A;  3WTZ A;  4MTD A;  1YJN I;  2OF7 A;  4A6D A;  1RIO H;  3G3Z A;  3T0Y A;  4BY1 J;  3ZP5 A;  1B72 B;  2VE9 A;  4C2T A;  3BJA A;  2MLG A;  4NC8 A;  2CFO A;  3ZN1 A;  1RR7 A;  3BG3 A;  4KMF A;  2HDW A;  4Y4R A;  3F8M A;  4NC7 A;  2E5N A;  2OZU A;  4HBL A;  2NNN A;  4HV6 A;  2L7F P;  3ZQG A;  1OYW A;  3BTJ A;  1CF7 B;  3OYC A;  1V5F A;  3DPU A;  1ZKG A;  2GIZ A;  3ABU A;  2EIN H;  2KIS A;  1ZAR A;  4I99 C;  4HNT A;  3OYG A;  1J75 A;  3HRS A;  2XV4 S;  1YIT I;  4KIS A;  5DCM B;  3KZI C;  1UZC A;  1YS6 A;  3SXY A;  4DBQ A;  1FIA A;  5KVR A;  4HX4 A;  2MSY A;  4B1R A;  4FE7 A;  4E7S A;  4QTR A;  3LA7 A;  3S32 A;  3FIW A;  4Z6Y A;  2XB5 A;  2K7L A;  1HXD A;  3D5R C;  3FKI J;  2G7U A;  3LQQ A;  3OOU A;  3KP5 A;  3KP4 A;  4GO1 A;  1MBJ A;  2MD5 A;  2HQA A;  4MQ9 F;  4XLP F;  1POG A;  2BVM A;  4EGY A;  1LEA A;  1R71 A;  1J09 A;  3DKX A;  2F5C A;  2DT5 A;  4OIR F;  4H0E A;  5DUK A;  1P4A A;  1RC9 A;  2H27 A;  1MDM B;  2CV2 A;  2XB0 X;  5DM6 F;  1XTA A;  2CJJ A;  3HTS B;  2R7V A;  3LA2 A;  2IXS A;  4II2 A;  2VKH A;  1LQ1 A;  2XAF A;  5D5W B;  4LG0 A;  1XS9 A;  2O8X A;  2DA7 A;  3I9V 2;  3EPZ A;  2KKO A;  1DU0 A;  1T95 A;  2M30 A;  4ETS A;  3TED A;  1I6X A;  4FX0 A;  2VQL A;  4BE1 A;  3A02 A;  3I71 A;  4ON0 A;  4IXA A;  1Z21 A;  4YII A;  2D2W A;  1PDN C;  3DF8 A;  1S6L A;  2ECB A;  5ICC A;  5EDN A;  2KPM A;  1PVE A;  1A35 A;  1R1U A;  5F0F A;  2ZFU A;  1RKW A;  3SEZ A;  2UXX A;  1LVK A;  3TL4 X;  4BL0 B;  2VI6 A;  3BJ6 A;  4IOC F;  2E7W A;  3T8R A;  3RZO J;  5IYB J;  2FOK A;  1YFH A;  1DGW Y;  3KP6 A;  3QYF A;  1IC8 A;  4C3I J;  2AS5 F;  3L2C A;  4XN3 A;  2OQG A;  2ME6 A;  4P9F A;  3JTH A;  2IP2 A;  5K7F A;  5M3F J;  1UAA A;  3N4M A;  4HPQ A;  1GV5 A;  3BZ6 A;  3CCM I;  1K6O A;  5A2Q K;  3QYE A;  4RM2 A;  1XGO A;  3IRQ A;  3CC7 I;  2DT7 B;  4WK8 F;  1AWC A;  5E18 F;  5FKM A;  5FKK A;  2V6E A;  4R79 A;  3GLX A;  1O57 A;  5F64 A;  1JHF A;  1S7E A;  1I3Q J;  2QBY A;  3DWL E;  1CGP A;  1HKQ A;  1MBE A;  4BXU A;  1S72 I;  3K4L A;  3KP2 A;  2KRH A;  5JFR A;  4CO8 A;  5JVT A;  5CVJ A;  2V9P A;  3TW7 A;  4DIQ A;  2HZD A;  3ZMZ A;  1U9N A;  1QVT A;  4J19 A;  3HZJ A;  1IW7 F;  3FKJ A;  2DDB A;  2HS5 A;  2DTZ A;  3HTU A;  4RAF A;  4XKW A;  2WAQ N;  4IHX A;  1YI2 I;  1SD4 A;  5IY5 H;  2GOX B;  4XBF A;  4ZDO A;  3RDI A;  3HRM A;  1ZRD A;  2GOM A;  3LSH A;  2IW5 A;  4RGX A;  1WI9 A;  1ETQ A;  4ESB A;  1FLI A;  1DUX C;  5LRR A;  5K5R A;  3PNY A;  2Y30 A;  1WCM J;  5EGO A; 
#chains in the Genus database with same CATH homology
 2GXG A;  3I5U A;  1R5H A;  3ISP A;  4G94 A;  3K1N A;  4P96 A;  1FBU A;  2FRH A;  2Y0M A;  2YX7 A;  3SQN A;  1XGM A;  4ESJ A;  1TW3 A;  4M9X A;  4LFU A;  1ZRE A;  2XAG A;  1C0W A;  3QU3 A;  4M6Y A;  1XB4 A;  1FT9 A;  1B9M A;  1GXQ A;  3GFL A;  1F5T A;  2NRA C;  4NHJ A;  1S3J A;  3Q9V A;  3DQV C;  2VN2 A;  1J59 A;  1IN8 A;  2OA4 A;  1U3E M;  1LEB A;  1G3Y A;  2GAU A;  4KUM A;  1FSE A;  3BOQ A;  3ZMV A;  3M1E A;  3MZH A;  4U7D A;  2LNB A;  4Y17 A;  1B9N A;  4IRG A;  1TQP A;  1H9G A;  4CDG A;  2V1D A;  1FZP B;  5KK1 A;  4BQA A;  3GVA A;  4LG0 B;  4WXC A;  2FQ3 A;  2E7X A;  2FXA A;  2V1X A;  2L4M A;  3B02 A;  3SZP A;  5H6R A;  1XGS A;  3R61 A;  4HA8 A;  1TLH B;  2FBH A;  5BS6 A;  1EH6 A;  5DD4 A;  2MBF A;  5AON A;  3BJO A;  1O3S A;  1K79 A;  5LEJ A;  3MZY A;  2O6G E;  4KIC A;  5HLG A;  3VB2 A;  3I64 A;  3CTA A;  2VOD A;  2KJB A;  3AAF A;  3WTU C;  1GXP A;  2P5L C;  1XSD A;  1ZRF A;  4CYD A;  3WTY C;  2OU2 A;  1YIO A;  2A6H F;  2BGC A;  2QBY B;  1MKM A;  2LF7 A;  5E1W A;  4ENK A;  3V7R A;  5ILU A;  1U78 A;  3R0J A;  5ERI A;  3E6B A;  1HW2 A;  5EEG A;  1UHW A;  1BN5 A;  1QNT A;  4K2E A;  3QPT A;  2V6C A;  4BH9 A;  3EET A;  4UVC A;  5A2Q Z;  2STW A;  2P7C B;  2ZNZ A;  1JE8 A;  1W7P D;  1SD7 A;  2RC4 A;  1R7J A;  4P5O A;  2FBK A;  1YW8 A;  5L3F A;  3NQO A;  4L5J A;  3KE2 A;  5L3B A;  3FHZ A;  4ZYE A;  5HLH A;  5CJ9 A;  3W6K B;  3I58 A;  1HSJ A;  4Q47 A;  3O2P E;  3GO5 A;  2P4W A;  1WWX A;  3D0S A;  2EK5 A;  1G6N A;  5J8C A;  3I54 A;  4EMS A;  2XUB A;  2NNY A;  2C6Y A;  4AD9 A;  2HZT A;  1XD7 A;  5E1X A;  2VC1 A;  3C1D A;  2Q0O A;  4LK1 F;  1Z9C A;  3DPT A;  3IHU A;  2GA1 A;  5E20 A;  3VOD A;  1KQ8 A;  3WU0 A;  3ERE D;  4AIH A;  4F7Z A;  3I0T A;  3HSF A;  4EJU A;  3M8E A;  2O61 A;  1E2X A;  4ZYG A;  2V79 A;  1X3U A;  3ABT A;  1YW7 A;  2QLZ A;  2EA4 A;  4HDU A;  1SMT A;  1H0M A;  4RGR A;  1RUO A;  3K1M A;  3PQJ A;  5IT9 K;  2W24 A;  3ZMU A;  5D6E A;  1LB2 A;  3ZPL A;  1T39 A;  2QZ8 A;  2F5F A;  1OYY A;  2A61 A;  3U1D A;  1H9T A;  1S7O A;  2UWM A;  1ZRC A;  4LLG F;  2DTR A;  4G7O F;  4DQ2 A;  2H94 A;  1U8R A;  1E17 A;  1G3T A;  2HDC A;  5E1Z B;  4ENN A;  3F23 A;  1XDS A;  1ULY A;  1FNN A;  1V3F A;  1DP7 P;  4UNO A;  3R6S A;  2DPD A;  1ONV A;  2GQQ A;  1GHC A;  2IVM A;  5HDN A;  1QZZ A;  2EFP A;  5DCF A;  4HQM A;  3V8L A;  5JI6 A;  1LJ9 A;  1G3S A;  5TRD A;  5ICG A;  1ZHF A;  2J5O A;  4HX7 A;  1U6G A;  4U0W A;  2F5E A;  5FD5 A;  1UST A;  2HTJ A;  1YLF A;  2DQR A;  3KCC A;  1FYL A;  5H6Q A;  1ZG5 A;  4EJV A;  2IPQ X;  3Q9S A;  1IXS B;  1LDJ A;  3F8C A;  1UFM A;  1IRF A;  2EV6 A;  4HOB A;  4JK1 X;  4Y13 A;  4I2O A;  4IF4 A;  3QOP A;  3ELK A;  4HAM A;  2VXZ A;  2XAS A;  2HOE A;  4Q48 A;  3WGG A;  5L3G A;  3TO9 A;  3WE3 A;  2PG4 A;  4LD5 A;  3MAJ A;  4EJW A;  1TW2 A;  4JQF A;  4HDV A;  3T8T A;  4R8H A;  1YS7 A;  2A6E F;  5AIP A;  2UZK A;  1KU9 A;  1IN7 A;  3Q5F A;  3F8N A;  3TDU C;  2KRF A;  2P7V B;  4RAY A;  3QRF F;  1IZ1 A;  1RZ4 A;  2L02 A;  2WTE A;  1J9I A;  5AIQ A;  1Z7U A;  1I1S A;  2D45 A;  2H6B A;  2FU4 A;  4G6Q A;  3WE2 A;  1W7P A;  4G7H F;  3FXU A;  3RYP A;  3RPU A;  3H92 A;  3M7G A;  2NAZ A;  5FFZ A;  4HV5 A;  3EYI A;  4CHU A;  5HDG A;  1O7F A;  5L3D A;  5FFX A;  5IT9 Z;  4L18 B;  1D8J A;  2BYV E;  3E5X A;  2MLK A;  1ZLK A;  4AIK A;  4BHB A;  2QYO A;  2Y48 A;  4KIB A;  4UVB A;  3K9T A;  2FMY A;  4GYI A;  3WTV C;  3NRV A;  1MD0 A;  1IAW A;  3QPH A;  1OYI A;  1Z6T A;  3BP8 A;  2CQK A;  5JR3 A;  2DU9 A;  4KYW A;  1EH8 A;  3DKW A;  1XCV A;  1W5T A;  4O6J A;  2IRF G;  2O0Y A;  2FSW A;  2FEZ A;  1HST A;  2GWR A;  4N9I A;  2Q2E A;  1RI7 A;  3U9G A;  1FOK A;  1J7K A;  3SZT A;  4YG2 F;  4U88 A;  3GYH X;  2QUF A;  3PFI A;  1EV7 A;  4KT5 C;  2DK8 A;  5F1R A;  2HTS A;  1K78 A;  4B8X A;  5L3C A;  4HQE A;  2OBP A;  2HQN A;  2F2E A;  3L7W A;  4WXD A;  1IUY A;  2PN6 A;  1I27 A;  4GGG A;  3WG9 A;  4FHT A;  2X0L A;  4B09 A;  2Z99 A;  4WCG A;  4OIP F;  3T1B A;  3WOD F;  2GXB A;  3M8F A;  1EH7 A;  2KIF A;  5K5O A;  2XHK A;  4A12 A;  1GVJ A;  4IRH A;  4U7B A;  3ZN0 A;  5D5V B;  3JSO A;  4KFC A;  4OU0 A;  1Z05 A;  1STZ A;  1R00 A;  4CZZ A;  1IXC A;  2HGC A;  2W57 A;  3V4G A;  4YFK F;  2D1V A;  2XRN A;  1BI2 A;  2OAZ A;  4KIG A;  5D5X B;  4ZYH A;  4WX9 A;  3P9C A;  3E97 A;  3RKY A;  1FBS A;  5ICF A;  1FP1 D;  1W7P B;  3FZV A;  3CO6 C;  2ZKZ A;  3DXJ F;  4YFN F;  4HLX A;  2JSC A;  2PBI A;  2O3F A;  3HRU A;  1XMA A;  2K4B A;  5CVI A;  2CWE A;  1LDK B;  3E5Q A;  4HLY A;  4EQQ A;  1O3Q A;  4EVI A;  3IL2 A;  3P9I A;  4GXO A;  2R7D A;  3EDP A;  2QQA A;  4G9Y A;  4LJZ F;  1O7L A;  4KNY A;  4WF2 A;  3GEZ A;  4EM1 A;  2ZFW A;  3KEO A;  3NEU A;  2LKP A;  4FX4 A;  2L01 A;  5HS9 A;  4QWQ A;  1DPU A;  1F1Z A;  1P92 A;  1K78 B;  1TTY A;  2HKO A;  4RB0 A;  4DNC A;  1IN4 A;  2MC3 A;  4BYY A;  3HOT A;  4MQV A;  3C18 A;  3GWZ A;  2FBI A;  3HUG A;  2W85 A;  3HHH A;  4A2U A;  2LDU A;  2JPB A;  3FM5 A;  2AXL A;  2NYX A;  2XAH A;  5DDG A;  2ZJ2 A;  5LBQ A;  2HQR A;  2X4H A;  4L0Y B;  1QPM A;  1T0F A;  1SFE A;  2RKH A;  2FF4 A;  2DO7 A;  3C7J A;  3BRO A;  2HYF A;  3ROU A;  1T38 A;  2KIM A;  2RV8 A;  4ZZD A;  4EM2 A;  4IVN A;  1MZB A;  2GZW A;  2RNJ A;  4IJA A;  3F3X A;  1OR7 A;  1J0R A;  4ZH4 F;  4XLN F;  1O3T A;  2QQ9 A;  3R0A A;  2DBB A;  3CJN A;  2M1B A;  1B4A A;  3LAJ A;  2RVC A;  1XSV A;  4BAY A;  2HEO A;  5DYM A;  3LA3 A;  5FD6 A;  1XGN A;  3E6M A;  3GFI A;  2ZNY A;  2IA0 A;  3DFG A;  2M8E A;  2YSR A;  4L5I A;  1R58 A;  3WTS C;  1VTN C;  5H20 A;  4PZJ A;  4IHT A;  1FP2 A;  2CG4 A;  4RB2 C;  1QBJ A;  3E3V A;  2Z3Y A;  4L9V A;  2VT3 A;  2H6C A;  3KLN A;  1FYM A;  2XAQ A;  3KZZ A;  2ZME A;  4UV9 A;  2MH9 A;  4HF2 A;  1D3Y A;  5JHU A;  2BBY A;  2G7H A;  3QP5 A;  4YFX F;  2DI3 A;  2CYY A;  4CGZ A;  3VFZ A;  5ED4 A;  2FNP A;  1S8N A;  2B0L A;  1BC8 C;  1W5S A;  3BPV A;  3O3K A;  3K1P A;  2FNA A;  4ZZL A;  3HYI A;  1YQA A;  5K5Q A;  4D0P A;  2R3S A;  3VEP A;  3IRR A;  3FWE A;  3GUD A;  4M73 A;  4KN7 X;  3F22 A;  2DK5 A;  5BPD A;  3ZQ7 A;  2YPR A;  3KP3 A;  2VC0 A;  1WKM A;  2COM A;  3HOS A;  2VBY A;  3DP7 A;  4L9J A;  1SFU A;  3FX3 A;  1KU2 A;  5J6X A;  3ECO A;  2O03 A;  1XN7 A;  4MEY F;  1I5Z A;  3CO7 C;  1HW5 A;  2ACJ A;  2A69 F;  3J80 K;  1BI0 A;  3D5L A;  3RTR A;  3ZMD A;  2CSO A;  5HOO A;  3N97 A;  1MJA A;  4HZF A;  4BHP A;  3BPX A;  4OMZ A;  4XSZ F;  3KLO A;  3FXR A;  1NHA A;  4GYG A;  3F21 A;  1ZGA A;  2ZCW A;  1O3R A;  2P5V A;  1RUN A;  4KA4 A;  3E5U A;  2OD5 A;  5K1Y A;  2DW4 A;  4PGH A;  2WV0 A;  3F8F A;  2HYG D;  1ZYR F;  2Z5U A;  2ETH A;  4IHS A;  1FC3 A;  2Z33 A;  3KP7 A;  4L9T A;  2JPC A;  2GA2 A;  2IA1 A;  3V8K A;  4U0Y A;  2XKO A;  1SD5 A;  4I01 A;  3CLO A;  3F72 A;  4A0Z A;  2STT A;  4E70 A;  3TO7 A;  2HWV A;  4OIN F;  4I0B A;  4FT8 A;  1W4M A;  3HRT A;  4RGU A;  1TNT A;  4RB3 C;  1FBQ A;  3WTW C;  2P8T A;  5ILS A;  2HFH A;  1DDN A;  1FY7 A;  3EUH A;  1U5T C;  3JSP A;  2EJR A;  1PUE E;  2M87 A;  2VON A;  1B1B A;  3VOE A;  3L09 A;  1AOY A;  2P6S A;  2P5K A;  1P4X A;  5DD8 A;  1YYV A;  1BI1 A;  2KJC A;  4KDP A;  2TDX A;  5LHH A;  4LMY A;  1TQI A;  4LLN A;  1HQC A;  3HSR A;  4MHG A;  5DEQ A;  4EM0 B;  2K27 A;  4MGR A;  2HR3 A;  3KEQ A;  4M71 A;  3EYY A;  2EWN A;  4UXN A;  3U2R A;  1PP7 U;  1KGS A;  3KZY A;  1PP8 F;  1F4K A;  3SHF A;  2EV0 A;  2XKP A;  3GZ6 A;  3E6C C;  5LHG A;  2V9V A;  5DUI A;  1SAX A;  1BC7 C;  3GF2 A;  3JW4 A;  4KMU X;  1U2W A;  3GXO A;  4NQW A;  1S29 A;  2VOO A;  4MNU A;  1HKT A;  1ON2 A;  1ON1 A;  2ISY A;  1D8K A;  2XGX A;  1MGT A;  3I53 A;  5D8K B;  5CVU A;  4N0B A;  2L4A A;  1FPQ A;  1IXR C;  3R4K A;  3J80 Z;  3F8B A;  2QEN A;  3LFK A;  2IA2 A;  3GZ5 A;  1J2X A;  3O6B B;  4M74 A;  3CUQ C;  2JZY A;  3G73 A;  3BY6 A;  1XCB A;  5E8I A;  4LK0 F;  2ZBK A;  1DPR A;  1SMY F;  2FML A;  1OKR A;  5LRS A;  4UHT A;  3L9F A;  4OIO F;  4BNC A;  1SFX A;  2VBW A;  3JAM K;  4UUV A;  1V4R A;  3FXQ A;  3SFZ A;  3I59 A;  4HF0 A;  3OOP A;  4N9H A;  1KQ9 A;  3TQN A;  2VOP A;  4WXH A;  1D5V A;  1ZLJ A;  1I1G A;  4LB6 B;  1TBX A;  4KIF A;  3TDZ C;  2QWW A;  4XSX F;  5BMZ A;  4MTE A;  4ENM A;  5FLX K;  2A3S A;  1YTY A;  1BIB A;  1KYW A;  2Y75 A;  3J7A O;  5HVQ C;  5ILV A;  3F6O A;  1YG2 A;  3ULQ B;  1T6S A;  2ESH A;  2JRT A;  4RGS A;  1OPC A;  4ESF A;  1S7A A;  5EEH A;  2DQL A;  3IWZ A;  3V7S A;  2FE3 A;  4YIF A;  5LHI A;  1B59 A;  3H3U A;  1BIA A;  2UXN A;  3JTG A;  1P2F A;  3IKV A;  5E17 F;  1P4W A;  4I09 A;  1XMK A;  4RB1 A;  3I4P A;  2E1N A;  3WGH A;  3B73 A;  4OMY A;  4G7Z F;  1QZY A;  2OQR A;  3WTT C;  3L00 A;  4IPA A;  3TKY A;  5D6F A;  2A5Y B;  3J81 K;  2A07 F;  3LQR A;  1ZGJ A;  6PAX A;  4LB5 A;  1LDD A;  2H09 A;  4M6X A;  4OOI A;  1BM9 A;  2E1C A;  4EGZ A;  5CVV A;  2Z9O A;  4M9S A;  2CO5 A;  2EV5 A;  3MFK A;  1BOA A;  4I7H A;  3GW2 A;  2MH2 A;  3V8J A;  5FGM A;  4Y15 A;  2K02 A;  2IT0 A;  2CFX A;  1ZN2 A;  2ISZ A;  5CVR A;  2RDP A;  2JTV A;  3FM3 A;  5TJJ A;  1MJ9 A;  4L9N A;  1LNW A;  1P6R A;  2CGP A;  1G3W A;  4I02 A;  3C3W A;  1MJB A;  2WWY A;  3LAP A;  5D5U B;  5BOX A;  1IN6 A;  1WQ2 A;  2HKX A;  5HDK A;  5BPI A;  1G4D A;  2XVC A;  1R36 A;  2CW0 F;  3E6D A;  4TV7 A;  3S2W A;  3I59 B;  3M9A A;  3RIR A;  3KFW X;  1KYZ A;  3H3Z A;  1Z91 A;  3RKW A;  2A68 F;  1ZAO A;  4Z2Y A;  4I98 B;  4O3M A;  3FMR A;  1BBY A;  2K86 A;  4WWC A;  3TOA A;  2DPU A;  1KU3 A;  3MWM A;  2PI0 A;  1U5T A;  4ASN A;  3JAM Z;  2R7F A;  4OIQ F;  4S04 A;  4HX8 A;  1R1T A;  2XAJ A;  3ZMT A;  4S05 A;  1KA8 A;  2MA3 A;  3ZMS A;  2DLL A;  3BWG A;  2DFI A;  5FLX Z;  1OMI A;  4PDK A;  4QLC U;  3DEU A;  4AVP A;  1QGP A;  2LSO A;  1T2K A;  1K7A A;  4A0X A;  2NS0 A;  1HBX G;  2FA5 A;  2PMH A;  4P9U A;  1REP C;  5F6F A;  2P6T A;  1IN5 A;  2RGV A;  3GFM A;  3MQ0 A;  2V1U A;  2EFQ A;  3QU6 A;  4Q4Z F;  1RNL A;  3P7N A;  2QM3 A;  1SD6 A;  1YW9 A;  4XRF A;  3TOB A;  5D4S A;  5LGN A;  1JHH A;  2L3D A;  3DV8 A;  1QQI A;  2BV6 A;  3J81 Z;  5HLI A;  4AWX B;  3ML6 A;  3FMS A;  3RI4 A;  3REO A;  3WU1 B;  3COA C;  5HS8 A;  2JT1 A;  2VBZ A;  3RYR A;  2M45 A;  2W84 A;  1ZG1 A;  4PCQ A;  3CUQ A;  3WTX C;  5DV5 A;  1YO5 C;  2EFN A;  3RKX A;  1LVA A;  2PLY A;  1USS A;  1UCR A;  4EV0 A;  2XIG A;  5J8F A;  5D4R A;  1T98 A;  4P55 A;  1JGS A;  1F9N A;  4L0Z B;  1WRJ A;  1XDU A;  1Z6R A;  4EJT A;  4NB5 A;  4R1H A;  5ICE A;  2PJP A;  1BI3 A;  4GCV A;  3MEX A;  5CYV A;  2D1H A;  5LGU A;  2BE5 F;  3P9K A;  1FYK A;  2ZO4 A;  4AIJ A;  5D8L B;  4A5N A;  2RN7 A;  2ELH A;  2YX4 A;  1L0O C;  1QO0 D;  1U5T B;  1XSX A;  4HF1 A;  4UVA A;  2PQ8 A;  3T5X A;  3TGN A;  4HW0 A;  2BEO A;  2EB7 A;  2KIU A;  2ZXJ A;  4U0V A;  2ADU A;  4A5M A;  2WC2 A;  4JBA A;  1R1V A;  1KQ0 A;  3HIF A;  4A6E A;  1KU7 A;  1A04 A;  2OZ6 A;  3F6V A;  5HS7 A;  4MEX F;  2QVO A;  3DPL C;  3QAH A;  3V7C A;  1L3L A;  1R22 A;  3IKT A;  3TO6 A;  2EFW A;  2VE8 A;  3PQK A;  3RJP A;  3FF5 A;  3LWF A;  4Q5S F;  4BHC A;  1CF7 A;  3K2Z A;  5CLS A;  4RAZ A;  1Z1D A;  5FB2 A;  2QQB A;  2DAO A;  3FMQ A;  5DCM A;  1IF1 A;  2PEX A;  1UB9 A;  1TNS A;  5LLQ A;  4I0A A;  2K4J A;  5L3E A;  4HYE A;  1R23 A;  4M9Z A;  2Q8K A;  4G8X A;  4EJO A;  2PFB A;  2ZME B;  1MDM A;  2YR2 A;  4KN4 X;  3R60 A;  3HSE A;  2G9W A;  3IWF A;  3WGI A;  4UV8 A;  3GX4 X;  1R5G A;  5LEK A;  2J5P A;  3GFJ A;  1Q1H A;  4RS8 A;  1FWZ A;  2EA2 A;  2F5D A;  3EQL F;  2VBX A;  3IC7 A;  2YU3 A;  3OV8 A;  1UHM A;  5IT3 A;  4IRI A;  4LGW A;  4ZYD A;  3CDH A;  3CUQ B;  4PGG A;  3KET A;  1ZG3 A;  3W6J B;  1Y0U A;  5E8G A;  2M5W A;  1FX7 A;  2L54 A;  2RQP A;  1ODD A;  1BJA A;  4O5V A;  1JXS A;  2VT2 A;  1FSH A;  1HKS A;  2EFO A;  3QP6 A;  3BDD A;  2XRO A;  4G6D A;  2IJL A;  1WSU A;  1B6A A;  1IRG A;  1HW1 A;  2LF8 A;  4M72 A;  4A0Y A;  3CUO A;  4LLL A;  1ZH5 A;  2ESN A;  2W25 A;  3K0L A;  3ECH A;  2GIV A;  4CXF A;  1TQM A;  5LGT A;  4ENJ A;  3K69 A;  4CIC A;  3HHG A;  1J5Y A;  5BQT A;  3RPQ A;  2PMU A;  3LST A;  3MCZ A;  5FO5 A;  3WTZ A;  4MTD A;  4A6D A;  1RIO H;  3G3Z A;  3T0Y A;  3ZP5 A;  2VE9 A;  3BJA A;  2MLG A;  3ZN1 A;  4KMF A;  3F8M A;  4HBL A;  2OZU A;  4HV6 A;  2NNN A;  1OYW A;  1CF7 B;  3ABU A;  1ZAR A;  1J75 A;  3HRS A;  2XV4 S;  5DCM B;  1YS6 A;  3SXY A;  5KVR A;  4HX4 A;  3LA7 A;  2K7L A;  1HXD A;  2G7U A;  3LQQ A;  3KP5 A;  3KP4 A;  4GO1 A;  2MD5 A;  4XLP F;  4MQ9 F;  4EGY A;  1LEA A;  2F5C A;  2DT5 A;  4OIR F;  4H0E A;  5DUK A;  1P4A A;  2H27 A;  1MDM B;  3HTS B;  3LA2 A;  1LQ1 A;  2XAF A;  5D5W B;  4LG0 A;  2O8X A;  2KKO A;  2M30 A;  4ETS A;  1I6X A;  4FX0 A;  3I71 A;  4ON0 A;  4IXA A;  4YII A;  2D2W A;  1PDN C;  3DF8 A;  1S6L A;  5ICC A;  1R1U A;  2UXX A;  3BJ6 A;  2E7W A;  3T8R A;  2FOK A;  1YFH A;  3KP6 A;  2AS5 F;  3L2C A;  2OQG A;  4P9F A;  3JTH A;  2IP2 A;  3N4M A;  3BZ6 A;  1K6O A;  5A2Q K;  1XGO A;  3IRQ A;  4WK8 F;  1AWC A;  5E18 F;  4R79 A;  3GLX A;  1O57 A;  5F64 A;  1JHF A;  2QBY A;  1CGP A;  1HKQ A;  4BXU A;  3KP2 A;  5JFR A;  4CO8 A;  5JVT A;  5CVJ A;  3ZMZ A;  1IW7 F;  3HTU A;  2HS5 A;  1SD4 A;  4XBF A;  3RDI A;  3HRM A;  1ZRD A;  2IW5 A;  4RGX A;  1WI9 A;  4ESB A;  1FLI A;  1DUX C;  5LRR A;  5K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...