1X58A

Solution structures of the myb-like dna binding domain of 4930532d21rik protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
GSSGSSGRKDFTKEEVNYLFHGVKTMGNHWNSILWSFPFQKGRRAVDLAHKYHRLISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein 4930532D21Rik
publication title Solution structures of the myb-like DNA binding domain of 4930532D21Rik protein
rcsb
source organism Mus musculus
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x58A01
4FCYA 1XG1A 1TWAJ 5IP7J 2XB5A 1K61A 1H8AC 1IC8A 2YU9J 2LFBA 2R93J 9ANTA 2JA5J 4C3HJ 1WH5A 3WHBA 2E2HJ 1U8BA 2Y9YA 2KT0A 2HOTA 2G0EA 2E2IJ 1ETYA 1MBGA 2VKVA 2QCOA 1P7JA 3S17J 2DTZA 2GBYA 2HXOA 4X6AJ 1H89C 1A5JA 5K7ZA 2LK2A 3GTPJ 5JLWA 1HLVA 2OPTA 2B63J 4FISA 1HF0A 1AKHA 3S14J 4A93J 2JK3A 3QPSA 2JA8J 3S16J 3RKQA 2W48A 1MBHA 1BJZA 1JKOC 1OJLA 1IV6A 2EZLA 1NTCA 1Y1WJ 2OF7A 3VPRA 3JRGA 3FIWA 1GT0C 3D1NI 3Q0VA 5IYDJ 1MSFC 3JR9A 1RESA 1PUFB 2NVYJ 3JREA 4A3LJ 4ABZA 1VI0A 1YRNA 2R92J 3BR1A 1JUSA 2CU7A 4HNVA 3W6VA 5F0FA 1SFOJ 3FK6A 4DYQA 2XB0X 3L1PA 2NVQJ 3HBLA 1P7IA 4A3EJ 5IYBJ 2JA7J 1EF4A 2L0KA 3DEWA 4A3IJ 3BG3A 3HM5A 3S1QJ 2WV1A 5M5YJ 2HI3A 5FKKA 2CRGA 3K7AJ 1IRZA 3HGGA 1ZQ3P 3FK7A 1IJWC 3ZQFA 2VUMJ 1ZR4A 3LSRA 5J1YA 2RAEA 3G1OA 2ELKA 4GFBA 4W1UA 4RDUA 4C3JJ 1O4XA 1WCMJ 5IOZA 3CQZJ 3UKGA 1Y1VJ 1FIAA 5EF6A 5EDNA 5C3EJ 3HDDA 1X2MA 3M4OJ 1B8IA 4D5FA 2Y30A 1GV2A 2ECCA 3BR3A 1B72A 1IDYA 2HOAA 1QRYA 1LFBA 2FJ1A 3S2HJ 2DA6A 2FQ4A 4M6VA 2L7ZA 1JKPC 1VNDA 2M9HA 3HOUJ 4Y7NJ 3BT9A 3GTKJ 1LE8A 3ZQIA 2GLOA 5EEAA 3JRCA 4AYBN 5F27A 3CCYA 1QVUA 4S0HB 2XGCA 4RBOA 1WH7A 5F08A 2WB1N 3JRAA 1K83J 5IP6A 3I4MJ 3GTGJ 2DMPA 3OSFA 4UUSA 2XGEA 3LSPA 3A01B 3HOWJ 1DU6A 3QQAA 4W97A 5FKNA 3O8GA 1RR7A 1Z0XA 4D7MA 5E3NA 4BKXA 2ME6A 4QTRA 1OCTC 3H0GJ 3S1MJ 3HOZJ 2DN0A 2M34A 1Z77A 2CQQA 2NVXJ 4A69C 3LSGA 2EQRA 2WAQN 3FISA 3B6AA 1RPWA 3HEFA 2Y0SN 2VI6A 2H1KA 5EGOA 5JLXA 2COBA 5FLMJ 4IHXA 5M5XJ 2Y2ZA 1XC5A 2R5ZA 2DMNA 5GP9A 4XIDA 5FJ8J 3LSJA 3DCFA 3H3VK 2I10A 1ETWA 1QVTA 3SFIA 2E1OA 3GBGA 2FX0A 1WPKA 4CYCA 1T33A 2JJ7A 5DS9A 1AHDP 1ITYA 1JKQC 5J1UA 5IP9J 3K2AA 2XPWA 3TP0A 4BBSJ 1RKTA 3MN2A 4A3FJ 3GTJJ 1U9NA 1F36A 2CQXA 2EH3A 2VKEA 2CJJA 4XRSA 2CUEA 5IYCJ 1NK3P 1U9OA 4JX6A 2M8GX 4G12A 5F1JA 3HOYJ 5M3FJ 4C3IJ 2XPUA 4X1EA 3CMYA 1GV5A 1IGNA 2ID3A 1NK2P 2ID6A 5C44J 3HKZN 4B3AA 1GUUA 5FLVA 4MFEA 2JMWA 1TC3C 2L7FP 2GM4A 1BW5A 1JTXA 5FKMA 1E3OC 3BQZA 3OSGA 1JTYA 2QF7A 4JP0A 2PMZN 3RZDJ 1MSEC 3JRBA 2LR8A 4AC0A 1HDPA 2ME0A 2LTPA 2JN6A 5IOYA 3GTOJ 4D7NA 5EYRA 2DA4A 3SDGA 3ZQGA 1IUFA 1JKRC 4A3MJ 2XRLA 5C4JJ 3NARA 1I6HJ 3LOCA 3F0CA 3BTIA 1MH4A 1YRNB 3HOVJ 1ZGWA 2NS7A 2NOGA 1W0UA 4A3GJ 3Q3SA 2TRTA 1TWFJ 3BR2A 2Y31A 5M5WJ 1IG7A 1HCRA 1TWHJ 1ZKGA 2DA7A 5GPAA 1APLC 2HOSA 3Q0WA 1TWCJ 3TW7A 4M3BA 1BL0A 2HQ5A 3JRIA 5J3LA 1VFCA 1ETVA 1RETA 3OIOA 1G2HA 2L7MP 3LNQA 1JUMA 1QPIA 2X9DA 4MIMA 1RKWA 4BXXJ 1W0TA 3JRFA 3ZQHA 1D5YA 1LFUP 2X48A 1OCPA 1ETKA 2R5YA 3SJMA 5F0CA 5EG0A 1UMQA 4V2FA 2JWTA 3JRHA 3FKIJ 3GTQJ 1B8IB 1FIPA 2YS9A 4D5CA 1B72B 2ECBA 2LVSA 1JUPA 3WHCA 3HGYA 4I76A 1ZR2A 3RQIA 3MKLA 2MG4A 4QIWN 4JX4A 1X2NA 3S1RJ 1MBJA 4DYRA 1BA5A 3BR5A 1VF9A 3ZQCA 4XICA 3PO2J 3PM1A 2P81A 1LE8B 3G1MA 3A03A 3S1NJ 2O7OA 2XGDA 2H8RA 1WGXA 2NVTJ 4B1RA 2DJNA 1GDTA 4M3DA 3I4NJ 2HDDA 4UUSB 4MO7A 3O8HA 5E3LA 3BR6A 5FKLA 1OFCX 1AU7A 4C2MJ 4XRSG 3BTCA 2TCTA 4L5EA 1DU0A 3BQYA 1MBFA 4IEJA 2K40A 3NAUA 1MBKA 1JT0A 2MSYA 4A3JJ 2E19A 1ETXA 3E7LA 1UG2A 4BBRJ 2AO9A 5BNGA 5E3MA 2EZKA 4DYCA 1MNMC 1R9TJ 2HYJA 1POGA 3S15J 2DMQA 1JT6A 1I50J 5K7HA 1H88C 2EZIA 4NDLA 2M2EA 5EGOB 4A3KJ 4Y52J 2LY9A 3C2BA 5F04A 3HOXJ 3PO3J 3HB9A 4BY7J 3B6CA 3GTLJ 5GPCA 2R5ZB 1I3QJ 3ZQLA 2DA3A 2XSDC 1JJ6C 4MLOA 4CYCB 4A3BJ 4BY1J 2O9LA 3ZOBA 4M3EA 4UUTA 1ORKA 2YUSA 1AKHB 3G1LA 1PUFA 1MBEA 3TW6A 3MVPA 3IV5A 4LOCA 1BW6A 5C4XJ 4JX5A 1A6IA 2NS8A 2D5VA 1HOMA 1FTZA 2IBDA 3BTLA 4AUXA 5IPAA 3QPLA 2DMUA 5HODA 4A3CJ 2IEKA 2L9RA 3JRDA 1ENHA 5EZGA 4M3GA 2E2JJ 2LKXA 3A02A 2CUFA 4DZJA 3BTJA 4B4CA 5FKOA 1T56A 2LP0A 4XRMA 1ZK8A 2LD5A 4EEFG 2IAIA 1TWGJ 4IHYA 2HXIA 2EBIA 1FJLA 1FEXA 2MW8A 2M0CA 4DW6A 2JA6J 3Q0UA 4V2GA 5DTDA 1UHSA 3TEDA 2R0QC 2K9QA 3IH4A 5E3OA 2MGQA 1S7EA 1XS9A 2K9NA 1F43A 5EZHA 2N8GA 4FE4A 1ZTRA 1FTTA 2DA2A 2DMTA 1JGGA 4I6ZA 3RZOJ 2AHQA 1ETOA 2KDZA 3IH2A 2R7ZJ 1CQTA 2DA1A 2K9SA 2VPRA 4IHWA 4XK4A 3BR0A 3BG9A 3A01A 3GTMJ 2XPVA 5M3MJ 1MH3A 3BG5A 4QSHA 2R5YB 3S2DJ 1ETQA 1IDZA 1U78A 5K7FA 5EG0B 1SANA 1HDDC 4DZPA 5J1RA 1JJ8C 4IHVA 2DA5A 3TP3A 3CDLA 1X58A 2EZHA 3M3YJ 2Y9ZA 1WI3A 4FTHA 1Q1VA 4FE7A 4MFDA 4J19A 4M3FA 4JYKA 3IH3A 5F0HA 2LLKA 4A3DJ 2X6OA 2O8KA 3OOUA 2FD5A 1GVDA 2ZB9A
chains in the Genus database with same CATH superfamily
3BLYA 4IRHA 4HQMA 1XG1A 4HDVA 2DOFA 4BQAA 2W57A 3F8CA 1ULYA 4ZYAA 3KYLA 2CW7A 1H8AC 4EJOA 4U88A 3OYAA 4F52A 2E2HJ 1GHCA 1R1UA 1UCRA 1DPUA 1FMWA 1ETYA 1MBGA 1MMSA 3R61A 3J7AY 1SVMA 3C2GA 4XN3A 4BJ6C 3RTRA 2LF8A 3RYRA 2A6TA 1G3YA 2DTZA 2EV5A 2M30A 2DXIA 2UWMA 1HKSA 2EB7A 4X6AJ 1LPQA 4CHUA 5D5WB 2OPTA 2GZWA 2XAQA 1JHFA 1XSDA 1AKHA 3MAJA 3TGNA 3RQ4A 2JA8J 1G3WA 3G4SI 1XCBA 4KN4X 3B02A 2E71A 1OJLA 4LFUA 5DEQA 3A0HC 3MMYB 1DGWY 2E1MC 2OF7A 3VPRA 3JRGA 4NBQA 3FIWA 5LFAA 1GT0C 3D1NI 3Q0VA 2PMUA 2KKOA 1C0WA 1D0XA 4PK4A 1F9NA 3CCLI 1WJBA 4ABZA 3VODA 1YRNA 1S6LA 2R92J 2ISZA 1Z7UA 1FSEA 2KMUA 2XAFA 1XDSA 1R6RA 2K4BA 2HVSA 2CU7A 3DBRB 4HF0A 2CMPA 4PDKA 5KAFC 2PMHA 1RZ4A 2VASA 1ODDA 1SFOJ 3GEZA 1SD4A 1YE9A 3F8NA 2XB0X 3WTUC 3VSKA 3TO9A 3WGGA 1TQIA 1FY7A 4A3EJ 1OCRH 3L09A 2GAUA 5FKKA 4II3A 4XR6A 1LDDA 1IRZA 1S7OA 3HGGA 1ZQ3P 3L2VA 1LJ9A 1D1CA 1IJWC 3EYIA 2EFPA 1ZR4A 3LSRA 1ACIA 3CLOA 3HPGA 2RAEA 4BL0B 1OR7C 2PLYA 4GGGA 5L3GA 3CDHA 5F1RA 2STWA 2OQGA 2Z9OA 5D6EA 1USSA 1FIAA 5EDNA 5C3EJ 4M73A 1AWCA 2HYFA 5KHDA 2R7VA 2ECCA 3BR3A 3KP2A 2MC4A 2HOAA 3PL8A 1QRYA 1OCCH 1BI0A 4BDZA 2G7HA 3WTSC 3RJPA 4M6VA 3SFZA 2L9SA 4Q4ZF 2L7ZA 1IZ1A 2GA2A 3ZXSA 3E6MA 5FLXK 2KISA 2XVCA 5F27A 4PUSA 4MTEA 3PUFA 1T95A 4P1WA 5FO5A 2VBZA 2XGCA 4YRVA 1K6OA 2XAGA 4RBOA 1V5GA 5F08A 2PN6A 4BNCA 1U5TA 2PG4A 3I4MJ 2DMPA 1VQNI 2M7AA 4LB6B 3TOBA 3T5XA 5JFRA 4ZC3A 1FX7A 4C30A 1O57A 1BM9A 1WI9A 2MABA 5HNFA 4UVBA 2HQNA 4QTRA 4IQJA 2EPFA 4ITVA 1YX3A 3S1MJ 2M34A 2HNHA 3QYBA 2CQQA 4IOAF 2NAZA 4E7JA 1W36D 4DBRA 3W2AA 1V3FA 4LLLA 3R0AA 5ICFA 4KJZA 2VI6A 2H1KA 5E1XA 5EGOA 2KIFA 2L02A 5JLXA 1HA8A 1R5HA 1WWXA 3FF5A 3T1BA 1H9TA 1K6YA 1KU3A 1WRJA 2VL8A 1R1VA 2LBFB 2R5ZA 1BC7C 1TNSA 3FXJA 2P7VB 3LSJA 5J40A 5HOOA 3SFIA 4AIKA 1XGSA 1J09A 1ITYA 3LSKA 2J5OA 5J1UA 1Q1HA 5IP9J 3TP0A 4BBSJ 4HQEA 3OYNA 5L3FA 1RC9A 3GTJJ 1TT5B 5D8KB 2VKEA 2V9KA 2KRHA 1XGOA 2Z2SB 4BJTA 5IYCJ 4EMSA 2R7FA 3OYHA 4B3XA 2Q0OA 4C3IJ 3CMYA 4X1EA 4I09A 3O3KA 4B48A 1KGSA 2P4WA 1IN4A 3IKVA 5HS9A 4B3AA 1GUUA 3BCBA 3C18A 3CUQA 5D6FA 2R4GA 4IVNA 1TC3C 2P6SA 2GM4A 5E20A 3GCMA 4DOZA 3BQZA 1W36C 1JTYA 2QF7A 1MMAA 2DBBA 1ZRDA 1UHMA 1MSEC 3JRBA 1SAXA 4YIIA 2ME0A 1VQ6I 4BHPA 1FWZA 3GTOJ 1I39A 1JKRC 5C4JJ 1PYVA 2QKLB 3LOCA 2JT1A 3CMAI 5FLXZ 4KITB 1YRNB 3HOVJ 2MH9A 4FQGA 3BDDA 2GIZA 2Y0MA 3DPLC 3WTWC 4A3GJ 3AG3H 3TL4X 1TWFJ 3ABUA 3BR2A 4XLEA 3VYRB 4CA0A 5DDGA 1IG7A 1HCRA 1TWHJ 2DA7A 3SHFA 2V6CA 1E17A 4M9ZA 3ZMVA 2E36A 5L3BA 4XOPA 2AS5F 5FFZA 3G6EI 1A31A 4XLPF 1YG2A 2HTSA 4BXFA 3LNQA 5E18F 3OS0A 1QQIA 3S93A 3UNGC 1K7AA 1MGTA 5FD5A 4Z6YA 3A0BC 2BV6A 2ESNA 3ZQHA 3JRFA 1KA8A 3LWFA 3HSEA 2X48A 4YFXF 1OCPA 2XKPA 3SJMA 2VE8A 1BOAA 1U0JA 2DQLA 2CSOA 4ZTJA 3FKIJ 4D5CA 2LVSA 1QGPA 1JUPA 4ZDOA 3HGYA 3L7WA 2GIVA 3KEYA 4I76A 3E6CC 2XGXA 1W1WE 1T08B 3HJEA 1TTYA 2UZKA 4U87A 4QIWN 3BR5A 3ZPLA 2FMLA 2WWYA 3I9V2 4ZYDA 1YYVA 2P81A 4ESFA 1BN5A 1G4DA 3S1NJ 2CFOA 2ADUA 1U3EM 4A12A 3SQNA 2XGDA 2EIMH 3L2CA 1WJFA 3BY6A 4C2UA 4OIRF 3ZN0A 2RKHA 4U0YA 1U5TB 4LJZF 2KPMA 5J4VA 4MO7A 3CMEI 2FEZA 3FXRA 3HSRA 3KP4A 2KIMA 2WC2A 3CLQA 4CCOA 4HDUA 1OFCX 1IXRC 4XRSG 2NXNB 1DU0A 3BQYA 3I4PA 1XTAA 2BVMA 4IEJA 3I59A 4BQOA 3CJNA 2E19A 1SMTA 4HOBA 4DBQA 1LUJB 1R4MB 1ZRCA 3CCVI 1IN5A 1GVJA 5E3MA 1ZG5A 4PZJA 3KFWX 1D8JA 1X4OA 3IWFA 3MZ8A 1R23A 1JT6A 2C6YA 2EZIA 2UV1A 4NDLA 5EGOB 4BDYA 4FETA 2LY9A 3SXYA 5LEJA 3PO3J 3GTLJ 1IN6A 3B6CA 1Y0NA 2A68F 4GRIA 5GPCA 4ZTFA 2R5ZB 3OYMA 2E7WA 1OKRA 4QPOA 2CQ7A 3HRTA 2XSDC 4R1HA 3K0LA 2J5PA 3WGHA 2FU4A 1EH6A 2K02A 4M3EA 2ZFWA 3FXUA 4EVIA 2YU3A 2YUSA 3JW4A 1PUFA 4IRIA 2KL4A 4Q48A 4L9JA 1XGMA 4LOCA 1JHHA 3DPUA 2K86A 2CUZA 1Z91A 1MMNA 2VQGA 5C4XJ 4JX5A 4KUMA 2NS8A 1NG6A 2DTRA 2DT5A 2RQQA 3I53A 1RUNA 3QOEA 2R3SA 3PIOF 1FTZA 2IBDA 5IPAA 2DMUA 1IN8A 2IEKA 4EM2A 2OTLI 4YFNF 4BYYA 3LSIA 3U21A 2XF7A 3TBIA 2F2EA 1REPC 1WJDA 3CUQB 5EEGA 5B3SH 1DP3A 4EJWA 3A4CA 1T56A 3OYDA 2DYRH 1A04A 4CDGA 1KZHA 1ZK8A 5EJCA 4Q47A 4A0XA 1ZREA 5TJJA 2PFBA 1T39A 1MMGA 3I0TA 4IHYA 4NC6A 4DIQA 5E79C 4WX9A 3VDXA 3FXLA 3N4MA 1WKMA 3GZ5A 3H3ZA 2VXZA 1HXDA 2WAFA 1UFMA 4RB0A 3KP6A 1PUEE 3HIFA 3IL2A 1DDNA 4B47A 4G94A 3BZCA 3K4MA 1F5TA 4MEXF 2EK5A 2MGQA 4HSRA 2E1CA 5JVGF 1XDUA 3KLOA 4XL9A 2EWNA 1ZTRA 2WY7Q 1T8IA 1FTTA 1JGGA 1U5TC 4KIFA 3S2WA 4Y17A 1CGPA 3M8EA 2KDZA 1TQMA 1GLNA 4XLCA 4MHGA 4U7DA 3HC7A 1ZG1A 2VPRA 4IHWA 1X3WB 5EEHA 4ENKA 2IA2A 2ETHA 4MNUA 4G7HF 1O3TA 3BR0A 3A01A 3GTMJ 1J9IA 2A5YB 3L9FA 3AFHA 2RNGA 1FMVA 5CQEA 1U78A 5K7FA 2K27A 4GYIA 3AL0B 2QSFX 1QA6A 3FDYA 4JBAA 4R79A 2LKSA 2XAHA 5J1RA 2OJED 1IRGA 3TQNA 3K70D 2IS6A 2X0LA 3GYHX 2VPLA 3KP3A 3WODF 1LDKB 1T2KA 3DLAA 4G7ZF 2EZHA 3QP6A 4EM0B 5GAGJ 1WJEA 3M3YJ 2V4JC 1KU7A 1FOYA 2OA4A 2L9VA 1J5YA 3K4KA 3QU6A 4J19A 2DLLA 4V19K 4BHBA 4HX7A 2O8KA 1RR8C 1GVDA 5HDNA 3WGIA 4HEA2 5H6QA 4LD5A 3CCQI 3E1SA 1K78A 2GQQA 2VBWA 4KN7X 5IP7J 4IZZA 2XB5A 2ESHA 4M9SA 2LFBA 3F3XA 9ANTA 2LNBA 2IA1A 2KT0A 2NYXA 2HOTA 3MCZA 2M8EA 5K5RA 4M74A 2G0EA 1XMXA 1HSJA 1ZELA 2BHYA 3I59B 3Q5FA 1U8RA 4RAGA 3VSLA 4NC8A 4BUPA 1TBXA 1ZGJA 4RAFA 5DD8A 2GBYA 1N75A 5A2QK 2XKOA 4IQ4A 1F4KA 2LK2A 2MH2A 1NHAA 3BZKA 5JR3A 3R0JA 5JLWA 1HLVA 3BWGA 4E7ZA 3K70C 1HKQA 4A93J 2DDBA 3BJ6A 2IS2A 2OZUA 5DM7F 2VODA 1MBHA 3D5LA 1SEUA 2EZLA 1KQ8A 1NTCA 1MJ9A 4N0BA 3ZMTA 1DPRA 2E5ZA 3JR9A 1OCOH 5BQTA 1PUFB 1RRJA 3BR1A 4E6KG 3CMMA 5IY5H 4H4KC 3OR2C 3W6VA 4AVZA 3E0JB 3FK6A 4DYQA 5DUIA 2XUBA 1ERDA 1P7IA 3EUKL 3DEEA 3KEOA 5BPDA 3RKWA 3CDIA 2QYOA 2L0KA 4CXFA 1ZLKA 3BJOA 2VIXA 3S3OA 2MA3A 3FKJA 3HM5A 4HG2A 2HI3A 4NNJA 2CRGA 5DCMA 3J81K 3HOSA 3K69A 1K4SA 5KK1A 2V1DA 4ON0A 1HW1A 3AL0C 3BZ6A 4BU2A 1R22A 1Z1DA 3DV8A 2I8DA 1N77A 4C3JJ 2E5NA 2BZTA 2EINH 1MJBA 3HDDA 1X2MA 2XSJC 4RM3A 3I55I 1B8IA 3M4OJ 1BOBA 1B72A 5L3CA 1SFUA 3PFYA 1LFBA 3SYTA 4N9IA 3N05A 2X1DA 3KZIC 3IC7A 1JKPC 2X51A 2XF5A 3HOUJ 4HV6A 2JUGA 4UNOA 3ZQIA 3FZVA 4ZDPA 3JRCA 2FA5A 2A6EF 1S3JA 3KYDB 1FLIA 1QVUA 4S0HB 1LEAA 1WH7A 1FC3A 1IXCA 2LY2A 1QO0D 5IP6A 1YOVB 3EQLF 3LSPA 2XGEA 4HBLA 3A01B 3HOWJ 2VC0A 1SVOA 2DT7B 1KQ0A 4GDFA 2E35A 3CJQB 4KYWA 1EKEA 4D7MA 5E3NA 4BKXA 2QQ9A 3GW2A 3ZRGA 3H0GJ 1O3SA 1ZRFA 2VE9A 4OMYA 5BS6A 2QQ8A 3O6BB 4EM1A 3ZQQA 1LVAA 4BEHA 3LSGA 4A6EA 2M87A 5JVTA 3FISA 3RPQA 1HW5A 2XASA 2CW0F 3KZYA 3HEFA 3V7SA 2VBXA 2Q2EA 2LG4A 4PGHA 3L2QA 5FLMJ 2IGKA 4JQFA 1BC8C 2BYVE 3TKYA 1K78B 5GP9A 3OMYA 4PJJA 2VJ4A 4MQVA 3ZP5A 3H3VK 3ABKH 3S32A 4XNFA 3GFJA 2KJCA 2FX0A 1WPKA 3KP7A 1T33A 2JJ7A 3HYIA 2M4GA 3K4CA 1DQUA 3IAM2 5HDKA 3SZTA 1YIJI 3UR3C 5ILUA 1IO2A 2V26A 3PUBA 1F36A 4D9JA 3A2KA 2M5WA 2CJJA 2GXGA 1MKMA 2VOOA 3GMEA 2HKXA 4E7LA 3WU1B 1X3UA 4IO9F 3ZQ7A 4PGGA 3HOYJ 2CW8A 1NK2P 1IGNA 1S9HA 4DGWB 4C2TA 3I58A 3CCEI 5IT9K 3HKZN 1B9MA 5LBQA 1FYKA 1MNEA 3ASOH 5GADJ 2WY8Q 1JTXA 2LC2A 4ENNA 2JSPA 2VONA 4JP0A 2PMZN 4L5IA 2JA2A 2LR8A 2MBFA 4AIJA 1XMKA 1Z7LA 2P0WA 4BE2A 5J6XA 2BY0A 2JN6A 5IOYA 4XORA 4AYBA 2QZ8A 3BPXA 4D7NA 5D8LB 3BPVA 4A3MJ 2XRLA 1I6HJ 4RGRA 4LGWA 1HQCA 1W5TA 2WB1A 4P9FA 2W7NA 5ICEA 2YR2A 3LMMA 3S3MA 2NS7A 2QUFA 3QODA 1YJNI 2M1BA 2G9WA 2EIJH 4OIOF 5H6RA 3FXMA 5GPAA 1ZKGA 5D5UB 4ENMA 2HOSA 3NRVA 4U0VA 2HOEA 3ZMSA 1TWCJ 2ZCWA 3CO6C 2HQ5A 5AONA 4WXDA 2W1OA 5J3LA 1VFCA 1I5ZA 3RKYA 4LLNA 4OOIA 1ETVA 1RETA 2MLGA 4IKFA 5DCMB 4AD9A 2X9DA 1BIAA 4MIMA 3VWBA 3PIPF 1I3AA 4E70A 1W0TA 1O3RA 4XMYA 1X1DA 2WAQA 2ZMEA 1LFUP 2EV0A 2R5YA 2Y0SA 2A07F 1IXSB 4K2EA 2HU9A 4Z2YA 2FBHA 4V2FA 3HRUA 4Y15A 2O03A 1B8IB 3F72A 4RMNA 2DAOA 1B72B 2ECBA 5IT3A 1P4WA 4DQ2A 2KHMA 2QQAA 3RQIA 3MWMA 3MKLA 1LFPA 4EATA 2QSHX 2DU9A 2K5CA 5F64A 5J4YA 3S1RJ 1MBJA 4DYRA 1BA5A 1VF9A 4HLYA 4XICA 3PO2J 5DD4A 1BJAA 1Z05A 3EETA 3K4BA 2XF6A 1QU3A 2A61A 1FBSA 2HWVA 2NVTJ 5JHFA 3N97A 4B1RA 4X0GA 1GDTA 3VOEA 3K1MA 2HDWA 2K9MA 3G2BA 2HDDA 1ZLJA 3HOTA 3E5UA 3WU2C 5DV5A 4HRIA 3FHNA 5E3LA 4HYEA 3BR6A 3KIOA 3IRRA 2D2WA 1G3SA 4B09A 2ISYA 2V1NA 4EGZA 4C2MJ 1AU7A 5L3EA 1D5VA 1MBFA 4H0EA 4UVCA 5AIQA 1MBKA 3DXJF 3M07A 5CPRB 1JT0A 5IT9Z 5HLIA 3H36A 3F8FA 4BEHB 1VQLI 4AM3A 3BC8A 3ECOA 1FYLA 4UHTA 2AQFA 1Z6TA 4E7IA 1R9TJ 5B5EC 3LAJA 3S15J 1I50J 1QHHD 2AXTC 5K7HA 3RCOA 4A3KJ 4LIUA 4Y52J 2Q2EB 1HSTA 5F04A 1KYZA 3K9TA 3CF5F 4BXUA 1BR2A 3G73A 1R5GA 4UB8C 5HLGA 1VZ0A 4PSXA 5FGMA 5FB2A 4M71A 1I3QJ 1O7FA 3V8JA 1NH3A 4BH9A 1T0FC 3ABLH 1XCVA 4JK1X 3F23A 4G6QA 2O9LA 2L2OA 3ZOBA 1NG7A 4F92B 3EUHA 1AKHB 3G1LA 1P4XA 3F22A 1S5LC 3IV5A 2ZC2A 3HXLA 3M1CA 4J01A 2GOMA 1SD6A 1BW6A 2EIKH 4LK1F 2X1CA 4LG3A 3GWZA 2P8TA 3V4GA 1XX5A 2R7RA 2D5VA 3V7CA 4A3CJ 4KIGA 4EV0A 2L9RA 2JVHA 1JXSA 5EZGA 4M3GA 2COMA 3ELKA 3WG9A 3A02A 3QP5A 3DWLE 3KYCB 4S05A 4DZJA 3LA2A 4I0BA 2KQRA 2LP0A 4HA8A 2BBYA 2KP6A 4XKBA 3LAPA 2CFXA 3HRSA 3O2PE 3J7ZI 1GXPA 1AOYA 2HXIA 3WU0A 2DFFA 4L0YB 4KDPA 1ZH5A 2VOPA 1A35A 1XB4A 3IUOA 5TISC 2M0CA 4G8XA 4V2GA 1D1AA 4OMZA 3ZMDA 5LRRA 1UHSA 1QNTA 3FXKA 1H9GA 1WQ2A 2ZXHA 3IH4A 3I54A 2R7DA 2IGOA 2JZYA 4PFPA 3CF2A 1K4TA 1F43A 5EZHA 3L2WA 2N8GA 5K5OA 2A69F 4CICA 3TO7A 1V54H 3BJAA 2AHQA 4A2UA 1ZAOA 5K1YA 4RB1A 2QEXI 2B7EA 1JE8A 1XSXA 2DA1A 2NRAC 4I7HA 2K9SA 1A36A 1FOXA 2M0MA 4AU7A 3DP7A 4XK4A 3GF2A 5KAIC 5TRDA 1WJCA 2ZMEB 3KPHA 3PNTA 5HLHA 1KYWA 1SFXA 5FROA 4QSHA 2R5YB 1O3QA 3S2DJ 1ETQA 1IDZA 2XAUA 3S3NA 4HLXA 4U7BA 2R7UA 1HDDC 2JTVA 2QKMB 5JHUA 1M1EB 2MC3A 4DZPA 3Q9SA 2EA4A 1TT0A 2DA5A 2K3PA 3CDLA 1Y56A 3EYYA 2QENA 1ZGAA 3PFIA 2Y9ZA 2ZJ2A 2QGUA 2JRTA 5L3DA 1Q1VA 4BS9A 1P92A 4MFDA 1HW2A 5LHHA 1VQ5I 4NB5A 2A5WA 3QPHA 1OCZH 2XDVA 2TDXA 2HPIA 4NQWA 6PAXA 4XKCA 3Q9VA 3LQRA 4PJNA 2A05A 2BEOA 4FCYA 2HGCA 5ILSA 2DOEA 4L9TA 3OR1C 4ESJA 3MZHA 1R71A 3FMSA 2X6XA 2XV4S 2JPBA 4C3HJ 2JA5J 3WHBA 2Y9YA 2P5KA 2RREA 4CGZA 2VQLA 1E3PA 3QYEA 2VC1A 2QCOA 1I1SA 4LMYA 2DQRA 3C3WA 4KT6A 3S17J 3ABMH 4D0PA 4L0ZB 2PX9A 3OIQA 1YJWI 4FHTA 1H89C 4IL6C 4YEJA 4XLNF 4ASNA 4N4NB 3GTPJ 1HF0A 1KU2A 2VN2A 3S14J 2JK3A 4A5NA 2Z1DA 4RB3C 3S16J 3RKQA 2F4IA 2W48A 3H5RA 3VYTB 2YPRA 1SD5A 4CCMA 1PP7U 3CCRI 2BY3A 1Y1WJ 2OD5A 5LHGA 1UELB 1WVRA 4QPQA 4YIFA 4EQQA 2W00A 4LLGF 2W24A 5B1BH 1RESA 2GXBA 5GAHJ 2F48A 3JREA 4A3LJ 1E3HA 3FX3A 3W6JB 1WJ5A 2O3FA 1ZARA 3FM3A 2H6BA 4M72A 2DPUA 5F0FA 3GZ6A 2F5EA 1PP8F 2W4SA 3HBLA 4QLCU 3ISPA 1G59A 3F6VA 2ZO4A 2YX4A 2RV8A 2JA7J 3RPUA 1BI3A 3K1PA 1X1AA 5CYVA 2ZMEC 5J8CA 3V42A 1MDMA 4A0YA 4WCGA 3PSFA 1JI8A 3ZQFA 2H6CA 2ZXJA 2VUMJ 5J1YA 1G3TA 3G1OA 2R7TA 3M8FA 3JCUC 2IS1A 5IOZA 2FSWA 3H9GA 5EF6A 4ENJA 4NC7A 4F93B 2ZSHB 2QBYA 2JUCA 3BCAA 4HZFA 2Y30A 1GV2A 3H3UA 4UVAA 1IDYA 2QQBA 3CC7I 4J00A 3SEZA 2FJ1A 2VJ5A 3LSMA 1HKTA 3ZGKA 3P9IA 2DA6A 2M3AA 5F6FA 3PQJA 1YTYA 4PJ0C 2FUG2 1DGRM 2DW4A 3F6OA 2LOOA 1O7LA 4Y7NJ 3BT9A 3OYBA 1OLTA 3OYKA 4OAYA 5EEAA 3GFLA 3JTGA 1KQ9A 4U0WA 2GWRA 3DTKA 4XM3A 1V5EA 5ICCA 2O6GE 3LFKA 1YS7A 2M7BA 3JRAA 2RVCA 3LQQA 3OYGA 2QA4I 2E34A 3ML6A 2XIGA 3OSFA 4UUSA 3MKYB 1XGNA 2P5VA 3QQAA 4W97A 4FT8A 5FKNA 3EUAA 3CP8A 3O8GA 1RR7A 4HPQA 4HSTA 4WK8F 3E6BA 1PDNC 5LGUA 2K4JA 2ME6A 3IAS2 2H8WA 5D5VB 4GYGA 2V1XA 4RA2A 1FPQA 4G6DA 1J75A 1YITI 4G9YA 1FT9A 3P9KA 5CVJA 4MQ9F 3RSNA 2FE3A 3DBLB 4KT5C 2BGCA 2XAJA 4OWRB 2STTA 3MKWB 1A6QA 5GAEJ 1T6SA 2CUJA 4CCJA 2KRFA 1YLFA 5J8FA 3OYFA 1J2XA 3HKZA 3F8MA 2IPQX 1Y8QB 4NQWB 4IHXA 4HX4A 2RQPA 2Y2ZA 2QVOA 3SEQA 1QBJA 3HTSB 1X1PA 3MEXA 4XIDA 3D5SC 5TGTA 4CH7A 2X4HA 1ETWA 1QVTA 4F3QA 2E1OA 3JAMK 3GBGA 1AHDP 2F5FA 3CUQC 2WAEA 1D0ZA 2XPWA 5BOXA 2ZSIB 2Z5UA 3S8PA 2E7XA 1RKTA 2IA0A 5HDGA 2H94A 5J47A 2EH3A 2L9NA 1SC7A 3PNYA 4OIQF 4XRSA 2CUEA 1B59A 3NEUA 4GXOA 1X1BA 4JX6A 4G12A 3TDUC 5F1JA 3E3VA 3WE2A 1DP7P 3I56I 1F1ZA 2ID6A 5C44J 3CD6I 4XBFA 5LRSA 1B9NA 2GXAA 3P9CA 1OYYA 4NHJA 3GXOA 5FLVA 1S72I 4LIVA 1RNLA 4UB6C 4A0ZA 4IOCF 4RAYA 2OUMA 4HV5A 3OYCA 5FKMA 5LD2C 5BPIA 3OSGA 1IF1A 3C2HA 3HUGA 3RZDJ 3FM5A 1S29A 2IGNA 3T8TA 4AC0A 4HNUA 2Q8KA 5E1ZB 3COAC 4O5VA 5EYRA 4A5MA 3SDGA 3ZMUA 1IUFA 5FD6A 1XSVA 1MH4A 2V6EA 1ZGWA 3FWEA 2RC4A 1R1TA 2PJRA 5HNHA 3L2UA 2DDAA 1FSHA 3M7GA 2KZVA 1BI2A 3Q3SA 2TRTA 2ZJQF 4LG0A 5D4SA 2Y31A 2FNPA 5M5WJ 3K4NA 2MD0A 1VQMI 4ESBA 2R7WA 2KIUA 5DM6F 3C7JA 1BL0A 2JVGA 1R7JA 2R7XA 1OYIA 2UXNA 3OIOA 4UY8I 2L7MP 4KMUX 2K9LA 1G2HA 1OPCA 2R7QA 1Z3YA 1MDMB 1RKWA 4BXXJ 1SFEA 4F55A 1D5YA 2Z3YA 3H9JA 5HLTA 1UMQA 2DOAA 3I71A 3KP5A 4ZJZA 2QWWA 4FX4A 2QBYB 2PJPA 3IHUA 1OYWA 2YS9A 4IHTA 1Y8RB 2CGPA 3JTHA 4KA4A 1HBXG 1ZR2A 2MG4A 4B8XA 4JX4A 1X2NA 3E97A 3WG7H 2HKOA 2HVQA 4Y13A 4I0AA 2F5VA 2ZJRF 5K5QA 3PM1A 4F7ZA 4I02A 3MQ0A 1IW7F 2VXDA 3JAMZ 1Z6RA 2K7LA 2O7OA 2EFOA 2H8RA 1WGXA 4RGXA 4TV7A 5A2QZ 3GUDA 3B73A 1TP4A 3CCJI 1YIOA 2DJNA 2V7FA 3R6SA 3DPTA 4II2A 3BG7A 3WTYC 4DJAA 5GTIC 1V4RA 3LFUA 4UUSB 2Y48A 2H09A 2M4KA 1J59A 3O8HA 3IRQA 2V1UA 4HF2A 2CS3A 3L00A 3V8LA 2NNYA 4L5EA 4IXAA 2ZKZA 4P5OA 2MSYA 4A3JJ 1XMAA 2HZTA 3E7LA 2CV2A 2FMYA 2RDPA 3LSHA 1S7AA 3QRFF 5KNLA 4BBRJ 2AO9A 2W85A 5BNGA 4DYCA 4L5JA 1MNMC 2JRMA 2HYJA 1POGA 1UAAA 4DNCA 5LHIA 5LGTA 2DMQA 2XC7A 2OC6A 4A6DA 2BVLA 2IP2A 3C2BA 3GO5A 4I99C 3HB9A 5CJ9A 3OV8A 3DEUA 3GVAA 3ULQB 1YW7A 2L5QA 4O3MA 4L9NA 4E7KA 4KNYA 4EGYA 1YW8A 2DA3A 5E8IA 4ZZDA 3J81Z 3KCCA 3GLXA 4E7HA 4A3BJ 4YIRX 2UXXA 3J7YJ 1VQ9I 3MZYA 3OYEA 2BOLA 2IGMA 3DBHB 1YQAA 2LMDA 3HTUA 3LA3A 4BQQA 1QZEA 3BROA 2DT6A 1MIJA 3MVPA 2FBIA 3AG4H 4XONA 3VFZA 4MTDA 3LA7A 1KU9A 4FASD 2BW3A 3PJRA 1A6IA 1Y39A 1USTA 2CWEA 4HF1A 1VQ8I 5CLSA 4AUXA 3QPLA 3M8JA 3OS1A 3U1KA 3VYUB 4O6JA 2BXYA 3OYIA 3L2RA 2FBKA 2E2JJ 1UHWA 3IWZA 1AA7A 3VB2A 2VKHA 5DCFA 2DYSH 3C1DA 3BTJA 1B1BA 4B4CA 3JSPA 5HS7A 3WTVC 2LD5A 3HUGB 1WZ2A 2ZJPF 2KIQA 2VT2A 1VQKI 4ZDLA 4RLQA 1FBQA 2AXLA 1FEXA 2CH0A 4DW6A 4LB5A 3G3ZA 2UUZA 2FXAA 2HFHA 1EV7A 3PNVA 2PJRB 2V9PA 4LK0F 5DTDA 2ELJA 3TEDA 4P96A 3SZPA 2HS5A 4C9YA 2KDOA 3DU6A 5E3OA 2NS0A 1XS9A 4LG0B 3KZZA 2GA1A 2FOWA 5FRNA 4FE4A 2OCEA 2DA2A 3EDPA 1BR1A 4YFKF 2HR3A 3CJTB 1ON1A 1TZLA 4WWCA 1FYMA 2R7ZJ 1CQTA 2VQCA 4HW0A 1UB9A 3TMOA 3DTIA 3BG9A 2XPVA 1S8NA 3BG5A 3PQKA 2V9VA 2O5RA 1SANA 3CC2I 4LITA 1TLHB 3I3LA 4XQFA 5JI6A 4IRGA 1JJ8C 3V8KA 4IHVA 3DF8A 1X1CA 2DK5A 2WV0A 4MEYF 1CF7A 3RIRA 3R4KA 2LKPA 3I5UA 2F6CA 4FTHA 1Y0UA 2FNAA 4CYDA 2JQ7A 4HNTA 4BHCA 1LEBA 2D1VA 4M3FA 1R5ID 3WTTC 3ROUA 3TOAA 2LLKA 4B44A 2X6OA 1MMDA 3EPZA 1Z3XA 3OOUA 5H2FC 1R49A 4G7OF 2ZB9A 2Z33A 3QOPA 1WSUA 1BR4A 1BIBA 1TWAJ 1K61A 2HVRA 1D1BA 3OL4A 5CKTA 1IC8A 1IAWA 2HEOA 3DTEA 2YU9J 1P2FA 1WH5A 2R93J 2DPDA 1U2WA 1U8BA 3QWLA 4ETSA 3ASNH 1W7PA 1YW9A 1LQ1A 3CP2A 2E2IJ 1T98A 2VKVA 1FOKA 1R4NB 1P7JA 2YX7A 3BG6A 3D5RC 2BE5F 3G71I 2MYSA 2MD5A 3HZJA 2PEXA 4KMFA 1I6XA 2HXOA 4WXHA 3ABTA 5E17F 5K7ZA 1A5JA 2Y75A 3H1CA 1FNNA 2X85A 1T38A 2B63J 2VKDA 4FISA 1TW3A 2ZXWH 4RB2C 1PJRA 3WTZA 4AVPA 3RI4A 3QPSA 1D0YA 2ICWG 3K1NA 2AQEA 3FXOA 4G6TB 1BJZA 3QAHA 2ZBKA 4RGUA 1JKOC 1IV6A 2P6TA 2HYGD 2EA2A 2VT3A 4CZCA 3MFKA 1ONVA 5LLQA 4AWXB 4RM2A 2BY1A 1WFXA 5IYDJ 1MSFC 1P4AA 3HHGA 2NVYJ 2PBIA 3K4JA 1VI0A 2OU2A 4IJAA 4BAYA 1YX5A 1JUSA 3KE2A 1YFHA 2CV0A 4HNVA 2L4MA 3HHHA 4CUGA 2E60A 4UUVA 2BW3B 2LYCA 4OIPF 2KFDA 2OZ6A 3L1PA 2NVQJ 2HPMA 1IRFA 1RIOH 2ZNYA 1RI7A 2E1NA 5IYBJ 5ERIA 2GOXB 1EF4A 3DEWA 4M9XA 4Y33A 4A3IJ 1EJ9A 3BG3A 3ERMA 5ILVA 3DLLF 1L3LA 5ICGA 3S1QJ 2WV1A 4RAZA 2FOKA 5M5YJ 5CVVA 3K7AJ 2K3FA 3FK7A 1ZN2A 4WXCA 1QZYA 2D45A 1LNWA 2VB6A 1U6GA 4IF4A 4NUBA 4WF2A 2ELKA 3FXQA 4GFBA 5CVUA 2FQ3A 1BI1A 3DKWA 3GLLA 4W1UA 4RDUA 3ECHA 3ZCOA 1IV8A 1O4XA 1WCMJ 5LEKA 3CQZJ 4XLHA 3UKGA 1Y1VJ 2CV1A 1FBUA 2LY1A 2X6YA 2ZNZA 3H5NA 2OV7A 2ACJA 3NQOA 4D5FA 4E7SA 2WBMA 3OYJA 2LSOA 2P7CB 3H0DA 2IJLA 3WTXC 2R7SA 1EA3A 3ZR8X 4PCQA 1BBYA 3J80K 2IVMA 1DUXC 3S2HJ 1X19A 2FQ4A 2F5DA 3CC4I 2LF7A 2L4AA 2KJBA 1VNDA 2M9HA 4HX8A 3M9AA 2H1LA 3GTKJ 1TQPA 1JGSA 2DFHA 3OOPA 1LE8A 1Z21A 4XSXF 2GLOA 1UZCA 4AYBN 4XLAA 1L0OC 1SMYF 3CCYA 3OS2A 4L9VA 4ZZLA 2F4MB 2WB1N 1VTNC 1K83J 3GTGJ 2HDCA 2WA0A 1SVLA 5HVQC 1DU6A 3OIPA 3T8RA 1WJAA 4BE0A 1W5CC 4D1QA 4B43A 1G6NA 3W2VA 1Z0XA 4BE1A 1J0RA 2F5CA 2MFZA 4XN0A 1OCTC 1VQ7I 3HOZJ 2DN0A 3GZNB 4EJUA 1W4MA 2R7OA 3CJRB 3REOA 1Z77A 2OAZA 2DK8A 5CQGA 2L54A 2NVXJ 4A69C 2EQRA 1CF7B 2QM3A 1B4AA 1FZPB 2WAQN 3B6AA 1RPWA 2Y0SN 2KRCA 5DUKA 2VQHA 2COBA 5LGNA 3MKZA 1YJ9I 2G7UA 4KICA 4OINF 5M5XJ 1XC5A 4Y3OA 3CCUI 2DMNA 3VEPA 5FJ8J 5ED4A 3DCFA 3P5JA 5FRMA 2I10A 1SAUA 4OAZA 3F21A 1K79A 1I27A 4HAMA 4CYCA 2CQNA 5DS9A 4Q5SF 1P9QC 4CO8A 5KVRA 1JKQC 3K2AA 2F4OB 4S04A 2ZFUA 1W5SA 3GFMA 1FP1D 2W82A 3MN2A 4PFOA 4RS8A 2IT0A 4A3FJ 1U9NA 1W7PB 2CQXA 3LL7A 3AG1H 1YHQI 2XROA 4M6XA 3ZN1A 2VLAA 1YS6A 2VJJA 1XPXA 2CYYA 1NK3P 4UXNA 1U9OA 2M8GX 1LDJA 5M3FJ 2KZGA 2JSCA 2XPUA 1GV5A 2ID3A 3H35A 3QU3A 1MJAA 2CO5A 4UV8A 2L3DA 4XKWA 4MFEA 2JMWA 3BP8A 3MD2A 2OCCH 2BXZA 3W2WA 3I64A 5AIPA 2L7FP 3D0SA 1BW5A 1E3OC 3FBNB 3A1YA 2LDUA 2LH9A 4P9UA 2QLZA 1V5FA 4ZYGA 1HDPA 3J80Z 2LTPA 1ZHFA 1VQPI 2EFWA 2DA4A 3ZQGA 3IP4B 3NARA 1TL8A 3F0CA 3BTIA 4UV9A 3K10A 3PSIA 4BJ5C 2NOGA 5CVIA 5H20A 3K4LA 4P55A 1W0UA 2NNNA 3GFIA 4ZYEA 4PJMA 3HPHA 3FBIB 1H0MA 2KLOA 2EILH 4IX7A 1APLC 1VQ4I 1YI2I 1MNDA 3Q0WA 3SDBA 1W7PD 3TW7A 4M3BA 2XHKA 3CCMI 1TW2A 3JRIA 4RLFA 1JUMA 2NVUB 5BMZA 1E0EA 1QPIA 1QHGA 3JSOA 1R58A 2HQAA 3H5AA 3J7AO 4CCNA 4AIDA 2FF4A 1GXQA 3ESWB 4M6YA 3AAFA 2Y69H 5B1AH 3HL2A 4BGDA 1LB2A 3BOQA 4KISA 1ETKA 2ELHA 5GTHC 1P6RA 5E8GA 2WADA 1ZG3A 5F0CA 4BACA 3DKYA 5EG0A 1D3YA 1LKXA 1OR7A 2JWTA 3JRHA 4L18B 3GTQJ 1FIPA 1I1GA 2DFIA 4Y4RA 3WHCA 1MW7A 3DKXA 5DYMA 2DI3A 4XRFA 4XLFA 3CUOA 1UJ8A 2DJIA 2HQRA 1MD0A 2Z99A 1R36A 4I01A 4EJVA 3ZQCA 1IRXA 2EJRA 3NWSA 3SZGA 3G1MA 3A03A 1LE8B 2IW5A 5D5XB 3K2ZA 1IN7A 5E1WA 2B0LA 3KEQA 3HSFA 4CSWA 3DQVC 4EJTA 2M45A 4M3DA 3H92A 3I4NJ 2OTJI 1TNTA 4GCVA 5FFXA 1QPMA 3V7RA 2IXSA 2DCEA 5FKLA 2LREA 4R8HA 3CZ6A 2HTJA 1LVKA 3BTCA 3F9KA 1IUYA 2TCTA 1OQYA 4CCKA 3QYFA 2K40A 3NAUA 4IPAA 4KIBA 1FOWA 1ETXA 2EFNA 2HZDA 2PMZA 1D8KA 3E5XA 3EUHC 2XRNA 1UG2A 2A3SA 4MGRA 2EFQA 2EZKA 1OISA 3KX2A 3U1DA 2P5LC 1ON2A 5CVRA 2MLKA 4I2OA 4N9HA 1H88C 3E5QA 2EV6A 1YO5C 2M2EA 3HOXJ 3WE3A 4OU0A 2X1EA 3ZMZA 4BQNA 3HRMA 3F8BA 4BY7J 2O61A 3OY9A 4F91B 5KCMA 4CCLA 3CO7C 3ZQLA 1JJ6C 3OL3A 4MLOA 4ZH4F 4CYCB 4BY1J 3R60A 2DO7A 3CCSI 3DFGA 4UUTA 1ORKA 1N78A 3DU5A 1OMIA 4XKVA 3ERED 1FP2A 1MBEA 2O0YA 3TW6A 2Q1ZB 2L7KA 4ZYHA 2IS4A 2RN7A 4KFCA 1UG0A 2VBYA 2PI0A 4IHSA 1STZA 1HOMA 4N4OB 3BTLA 5HODA 2B9SA 3W6KB 1RUOA 3GX4X 3FHZA 2VJIA 3JRDA 1ENHA 2CQKA 2K85A 3OYLA 4YG2F 2LKXA 1T0FA 1MZBA 4AIHA 2CUFA 2YSRA 1ZYRF 3RYPA 1SFKA 1XD7A 4PJLA 5FKOA 2BHZA 4XRMA 3X2QH 4JOMA 2L01A 2ZXIA 4EEFG 3FMQA 2IAIA 2OBPA 2X6WA 3CTAA 1TWGJ 5B66C 2RGVA 2OQRA 2EBIA 2FRHA 3FMRA 3RKXA 2V79A 1FJLA 3E6DA 2MW8A 2RNJA 2E1MB 4PSWA 3HG9A 1EH7A 4ANJA 3KLNA 2JA6J 3Q0UA 1WHUA 1SD7A 1R00A 3IKTA 3LSTA 1G8XA 3RDIA 2R0QC 1PVEA 3TO6A 4FX0A 5HS8A 2D1HA 2K9QA 3H9QA 1X3ZB 4I98B 1S7EA 1VQOI 4QWQA 2K9NA 3NWTA 2W84A 1XN7A 3P7NA 2DODA 2DMTA 2H27A 2QSGX 4I6ZA 3RZOJ 1ETOA 3ONQA 1Z67A 3IH2A 4GO1A 3AG2H 1KONA 4XSZF 4CZZA 3M1EA 1Y6IA 3W3CA 1Z9CA 3AKZA 2A6HF 1B6AA 2IRFG 1N25A 3TDZC 5M3MJ 1MH3A 2W25A 2JPCA 1J7KA 2Z16A 5EG0B 4E4HA 5D4RA 3K6GA 3QPTA 3T0YA 3CESA 4RGSA 1X4PA 3U2RA 3OWTA 2NOJB 2DFEA 3TP3A 2CG4A 3KETA 1X58A 3RPUD 3U9GA 2O8XA 1WI3A 1E2XA 2WTEA 2I5UA 4YELA 4FE7A 2LRDA 4JYKA 4XOTA 1QZZA 3IH3A 5F0HA 4A3DJ 2FD5A 2LBFA 1EH8A 3VYSB 1V55H 2BY2A 2PQ8A 1HC8A
chains in the Genus database with same CATH topology
4FCYA 1XG1A 1TWAJ 5IP7J 2XB5A 1K61A 1H8AC 1IC8A 2YU9J 2LFBA 2R93J 9ANTA 2JA5J 4C3HJ 1WH5A 3WHBA 2E2HJ 1U8BA 2Y9YA 2KT0A 2HOTA 2G0EA 2E2IJ 1ETYA 1MBGA 2VKVA 2QCOA 1P7JA 3S17J 2DTZA 2GBYA 2HXOA 4X6AJ 1H89C 1A5JA 5K7ZA 2LK2A 3GTPJ 5JLWA 1HLVA 2OPTA 2B63J 4FISA 1HF0A 1AKHA 3S14J 4A93J 2JK3A 3QPSA 2JA8J 3S16J 3RKQA 2W48A 1MBHA 1BJZA 1JKOC 1OJLA 1IV6A 2EZLA 1NTCA 1Y1WJ 2OF7A 3VPRA 3JRGA 3FIWA 1GT0C 3D1NI 3Q0VA 5IYDJ 1MSFC 3JR9A 1RESA 1PUFB 2NVYJ 3JREA 4A3LJ 4ABZA 1VI0A 1YRNA 2R92J 3BR1A 1JUSA 2CU7A 4HNVA 3W6VA 5F0FA 1SFOJ 3FK6A 4DYQA 2XB0X 3L1PA 2NVQJ 3HBLA 1P7IA 4A3EJ 5IYBJ 2JA7J 1EF4A 2L0KA 3DEWA 4A3IJ 3BG3A 3HM5A 3S1QJ 2WV1A 5M5YJ 2HI3A 5FKKA 2CRGA 3K7AJ 1IRZA 3HGGA 1ZQ3P 3FK7A 1IJWC 3ZQFA 2VUMJ 1ZR4A 3LSRA 5J1YA 2RAEA 3G1OA 2ELKA 4GFBA 4W1UA 4RDUA 4C3JJ 1O4XA 1WCMJ 5IOZA 3CQZJ 3UKGA 1Y1VJ 1FIAA 5EF6A 5EDNA 5C3EJ 3HDDA 1X2MA 3M4OJ 1B8IA 4D5FA 2Y30A 1GV2A 2ECCA 3BR3A 1B72A 1IDYA 2HOAA 1QRYA 1LFBA 2FJ1A 3S2HJ 2DA6A 2FQ4A 4M6VA 2L7ZA 1JKPC 1VNDA 2M9HA 3HOUJ 4Y7NJ 3BT9A 3GTKJ 1LE8A 3ZQIA 2GLOA 5EEAA 3JRCA 4AYBN 5F27A 3CCYA 1QVUA 4S0HB 2XGCA 4RBOA 1WH7A 5F08A 2WB1N 3JRAA 1K83J 5IP6A 3I4MJ 3GTGJ 2DMPA 3OSFA 4UUSA 2XGEA 3LSPA 3A01B 3HOWJ 1DU6A 3QQAA 4W97A 5FKNA 3O8GA 1RR7A 1Z0XA 4D7MA 5E3NA 4BKXA 2ME6A 4QTRA 1OCTC 3H0GJ 3S1MJ 3HOZJ 2DN0A 2M34A 1Z77A 2CQQA 2NVXJ 4A69C 3LSGA 2EQRA 2WAQN 3FISA 3B6AA 1RPWA 3HEFA 2Y0SN 2VI6A 2H1KA 5EGOA 5JLXA 2COBA 5FLMJ 4IHXA 5M5XJ 2Y2ZA 1XC5A 2R5ZA 2DMNA 5GP9A 4XIDA 5FJ8J 3LSJA 3DCFA 3H3VK 2I10A 1ETWA 1QVTA 3SFIA 2E1OA 3GBGA 2FX0A 1WPKA 4CYCA 1T33A 2JJ7A 5DS9A 1AHDP 1ITYA 1JKQC 5J1UA 5IP9J 3K2AA 2XPWA 3TP0A 4BBSJ 1RKTA 3MN2A 4A3FJ 3GTJJ 1U9NA 1F36A 2CQXA 2EH3A 2VKEA 2CJJA 4XRSA 2CUEA 5IYCJ 1NK3P 1U9OA 4JX6A 2M8GX 4G12A 5F1JA 3HOYJ 5M3FJ 4C3IJ 2XPUA 4X1EA 3CMYA 1GV5A 1IGNA 2ID3A 1NK2P 2ID6A 5C44J 3HKZN 4B3AA 1GUUA 5FLVA 4MFEA 2JMWA 1TC3C 2L7FP 2GM4A 1BW5A 1JTXA 5FKMA 1E3OC 3BQZA 3OSGA 1JTYA 2QF7A 4JP0A 2PMZN 3RZDJ 1MSEC 3JRBA 2LR8A 4AC0A 1HDPA 2ME0A 2LTPA 2JN6A 5IOYA 3GTOJ 4D7NA 5EYRA 2DA4A 3SDGA 3ZQGA 1IUFA 1JKRC 4A3MJ 2XRLA 5C4JJ 3NARA 1I6HJ 3LOCA 3F0CA 3BTIA 1MH4A 1YRNB 3HOVJ 1ZGWA 2NS7A 2NOGA 1W0UA 4A3GJ 3Q3SA 2TRTA 1TWFJ 3BR2A 2Y31A 5M5WJ 1IG7A 1HCRA 1TWHJ 1ZKGA 2DA7A 5GPAA 1APLC 2HOSA 3Q0WA 1TWCJ 3TW7A 4M3BA 1BL0A 2HQ5A 3JRIA 5J3LA 1VFCA 1ETVA 1RETA 3OIOA 1G2HA 2L7MP 3LNQA 1JUMA 1QPIA 2X9DA 4MIMA 1RKWA 4BXXJ 1W0TA 3JRFA 3ZQHA 1D5YA 1LFUP 2X48A 1OCPA 1ETKA 2R5YA 3SJMA 5F0CA 5EG0A 1UMQA 4V2FA 2JWTA 3JRHA 3FKIJ 3GTQJ 1B8IB 1FIPA 2YS9A 4D5CA 1B72B 2ECBA 2LVSA 1JUPA 3WHCA 3HGYA 4I76A 1ZR2A 3RQIA 3MKLA 2MG4A 4QIWN 4JX4A 1X2NA 3S1RJ 1MBJA 4DYRA 1BA5A 3BR5A 1VF9A 3ZQCA 4XICA 3PO2J 3PM1A 2P81A 1LE8B 3G1MA 3A03A 3S1NJ 2O7OA 2XGDA 2H8RA 1WGXA 2NVTJ 4B1RA 2DJNA 1GDTA 4M3DA 3I4NJ 2HDDA 4UUSB 4MO7A 3O8HA 5E3LA 3BR6A 5FKLA 1OFCX 1AU7A 4C2MJ 4XRSG 3BTCA 2TCTA 4L5EA 1DU0A 3BQYA 1MBFA 4IEJA 2K40A 3NAUA 1MBKA 1JT0A 2MSYA 4A3JJ 2E19A 1ETXA 3E7LA 1UG2A 4BBRJ 2AO9A 5BNGA 5E3MA 2EZKA 4DYCA 1MNMC 1R9TJ 2HYJA 1POGA 3S15J 2DMQA 1JT6A 1I50J 5K7HA 1H88C 2EZIA 4NDLA 2M2EA 5EGOB 4A3KJ 4Y52J 2LY9A 3C2BA 5F04A 3HOXJ 3PO3J 3HB9A 4BY7J 3B6CA 3GTLJ 5GPCA 2R5ZB 1I3QJ 3ZQLA 2DA3A 2XSDC 1JJ6C 4MLOA 4CYCB 4A3BJ 4BY1J 2O9LA 3ZOBA 4M3EA 4UUTA 1ORKA 2YUSA 1AKHB 3G1LA 1PUFA 1MBEA 3TW6A 3MVPA 3IV5A 4LOCA 1BW6A 5C4XJ 4JX5A 1A6IA 2NS8A 2D5VA 1HOMA 1FTZA 2IBDA 3BTLA 4AUXA 5IPAA 3QPLA 2DMUA 5HODA 4A3CJ 2IEKA 2L9RA 3JRDA 1ENHA 5EZGA 4M3GA 2E2JJ 2LKXA 3A02A 2CUFA 4DZJA 3BTJA 4B4CA 5FKOA 1T56A 2LP0A 4XRMA 1ZK8A 2LD5A 4EEFG 2IAIA 1TWGJ 4IHYA 2HXIA 2EBIA 1FJLA 1FEXA 2MW8A 2M0CA 4DW6A 2JA6J 3Q0UA 4V2GA 5DTDA 1UHSA 3TEDA 2R0QC 2K9QA 3IH4A 5E3OA 2MGQA 1S7EA 1XS9A 2K9NA 1F43A 5EZHA 2N8GA 4FE4A 1ZTRA 1FTTA 2DA2A 2DMTA 1JGGA 4I6ZA 3RZOJ 2AHQA 1ETOA 2KDZA 3IH2A 2R7ZJ 1CQTA 2DA1A 2K9SA 2VPRA 4IHWA 4XK4A 3BR0A 3BG9A 3A01A 3GTMJ 2XPVA 5M3MJ 1MH3A 3BG5A 4QSHA 2R5YB 3S2DJ 1ETQA 1IDZA 1U78A 5K7FA 5EG0B 1SANA 1HDDC 4DZPA 5J1RA 1JJ8C 4IHVA 2DA5A 3TP3A 3CDLA 1X58A 2EZHA 3M3YJ 2Y9ZA 1WI3A 4FTHA 1Q1VA 4FE7A 4MFDA 4J19A 4M3FA 4JYKA 3IH3A 5F0HA 2LLKA 4A3DJ 2X6OA 2O8KA 3OOUA 2FD5A 1GVDA 2ZB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCY A;  1XG1 A;  1TWA J;  5IP7 J;  2XB5 A;  1K61 A;  1H8A C;  1IC8 A;  2YU9 J;  2LFB A;  2R93 J;  9ANT A;  2JA5 J;  4C3H J;  1WH5 A;  3WHB A;  2E2H J;  1U8B A;  2Y9Y A;  2KT0 A;  2HOT A;  2G0E A;  2E2I J;  1ETY A;  1MBG A;  2VKV A;  2QCO A;  1P7J A;  3S17 J;  2DTZ A;  2GBY A;  2HXO A;  4X6A J;  1H89 C;  1A5J A;  5K7Z A;  2LK2 A;  3GTP J;  5JLW A;  1HLV A;  2OPT A;  2B63 J;  4FIS A;  1HF0 A;  1AKH A;  3S14 J;  4A93 J;  2JK3 A;  3QPS A;  2JA8 J;  3S16 J;  3RKQ A;  2W48 A;  1MBH A;  1BJZ A;  1JKO C;  1OJL A;  1IV6 A;  2EZL A;  1NTC A;  1Y1W J;  2OF7 A;  3VPR A;  3JRG A;  3FIW A;  1GT0 C;  3D1N I;  3Q0V A;  5IYD J;  1MSF C;  3JR9 A;  1RES A;  1PUF B;  2NVY J;  3JRE A;  4A3L J;  4ABZ A;  1VI0 A;  1YRN A;  2R92 J;  3BR1 A;  1JUS A;  2CU7 A;  4HNV A;  3W6V A;  5F0F A;  1SFO J;  3FK6 A;  4DYQ A;  2XB0 X;  3L1P A;  2NVQ J;  3HBL A;  1P7I A;  4A3E J;  5IYB J;  2JA7 J;  1EF4 A;  2L0K A;  3DEW A;  4A3I J;  3BG3 A;  3HM5 A;  3S1Q J;  2WV1 A;  5M5Y J;  2HI3 A;  5FKK A;  2CRG A;  3K7A J;  1IRZ A;  3HGG A;  1ZQ3 P;  3FK7 A;  1IJW C;  3ZQF A;  2VUM J;  1ZR4 A;  3LSR A;  5J1Y A;  2RAE A;  3G1O A;  2ELK A;  4GFB A;  4W1U A;  4RDU A;  4C3J J;  1O4X A;  1WCM J;  5IOZ A;  3CQZ J;  3UKG A;  1Y1V J;  1FIA A;  5EF6 A;  5EDN A;  5C3E J;  3HDD A;  1X2M A;  3M4O J;  1B8I A;  4D5F A;  2Y30 A;  1GV2 A;  2ECC A;  3BR3 A;  1B72 A;  1IDY A;  2HOA A;  1QRY A;  1LFB A;  2FJ1 A;  3S2H J;  2DA6 A;  2FQ4 A;  4M6V A;  2L7Z A;  1JKP C;  1VND A;  2M9H A;  3HOU J;  4Y7N J;  3BT9 A;  3GTK J;  1LE8 A;  3ZQI A;  2GLO A;  5EEA A;  3JRC A;  4AYB N;  5F27 A;  3CCY A;  1QVU A;  4S0H B;  2XGC A;  4RBO A;  1WH7 A;  5F08 A;  2WB1 N;  3JRA A;  1K83 J;  5IP6 A;  3I4M J;  3GTG J;  2DMP A;  3OSF A;  4UUS A;  2XGE A;  3LSP A;  3A01 B;  3HOW J;  1DU6 A;  3QQA A;  4W97 A;  5FKN A;  3O8G A;  1RR7 A;  1Z0X A;  4D7M A;  5E3N A;  4BKX A;  2ME6 A;  4QTR A;  1OCT C;  3H0G J;  3S1M J;  3HOZ J;  2DN0 A;  2M34 A;  1Z77 A;  2CQQ A;  2NVX J;  4A69 C;  3LSG A;  2EQR A;  2WAQ N;  3FIS A;  3B6A A;  1RPW A;  3HEF A;  2Y0S N;  2VI6 A;  2H1K A;  5EGO A;  5JLX A;  2COB A;  5FLM J;  4IHX A;  5M5X J;  2Y2Z A;  1XC5 A;  2R5Z A;  2DMN A;  5GP9 A;  4XID A;  5FJ8 J;  3LSJ A;  3DCF A;  3H3V K;  2I10 A;  1ETW A;  1QVT A;  3SFI A;  2E1O A;  3GBG A;  2FX0 A;  1WPK A;  4CYC A;  1T33 A;  2JJ7 A;  5DS9 A;  1AHD P;  1ITY A;  1JKQ C;  5J1U A;  5IP9 J;  3K2A A;  2XPW A;  3TP0 A;  4BBS J;  1RKT A;  3MN2 A;  4A3F J;  3GTJ J;  1U9N A;  1F36 A;  2CQX A;  2EH3 A;  2VKE A;  2CJJ A;  4XRS A;  2CUE A;  5IYC J;  1NK3 P;  1U9O A;  4JX6 A;  2M8G X;  4G12 A;  5F1J A;  3HOY J;  5M3F J;  4C3I J;  2XPU A;  4X1E A;  3CMY A;  1GV5 A;  1IGN A;  2ID3 A;  1NK2 P;  2ID6 A;  5C44 J;  3HKZ N;  4B3A A;  1GUU A;  5FLV A;  4MFE A;  2JMW A;  1TC3 C;  2L7F P;  2GM4 A;  1BW5 A;  1JTX A;  5FKM A;  1E3O C;  3BQZ A;  3OSG A;  1JTY A;  2QF7 A;  4JP0 A;  2PMZ N;  3RZD J;  1MSE C;  3JRB A;  2LR8 A;  4AC0 A;  1HDP A;  2ME0 A;  2LTP A;  2JN6 A;  5IOY A;  3GTO J;  4D7N A;  5EYR A;  2DA4 A;  3SDG A;  3ZQG A;  1IUF A;  1JKR C;  4A3M J;  2XRL A;  5C4J J;  3NAR A;  1I6H J;  3LOC A;  3F0C A;  3BTI A;  1MH4 A;  1YRN B;  3HOV J;  1ZGW A;  2NS7 A;  2NOG A;  1W0U A;  4A3G J;  3Q3S A;  2TRT A;  1TWF J;  3BR2 A;  2Y31 A;  5M5W J;  1IG7 A;  1HCR A;  1TWH J;  1ZKG A;  2DA7 A;  5GPA A;  1APL C;  2HOS A;  3Q0W A;  1TWC J;  3TW7 A;  4M3B A;  1BL0 A;  2HQ5 A;  3JRI A;  5J3L A;  1VFC A;  1ETV A;  1RET A;  3OIO A;  1G2H A;  2L7M P;  3LNQ A;  1JUM A;  1QPI A;  2X9D A;  4MIM A;  1RKW A;  4BXX J;  1W0T A;  3JRF A;  3ZQH A;  1D5Y A;  1LFU P;  2X48 A;  1OCP A;  1ETK A;  2R5Y A;  3SJM A;  5F0C A;  5EG0 A;  1UMQ A;  4V2F A;  2JWT A;  3JRH A;  3FKI J;  3GTQ J;  1B8I B;  1FIP A;  2YS9 A;  4D5C A;  1B72 B;  2ECB A;  2LVS A;  1JUP A;  3WHC A;  3HGY A;  4I76 A;  1ZR2 A;  3RQI A;  3MKL A;  2MG4 A;  4QIW N;  4JX4 A;  1X2N A;  3S1R J;  1MBJ A;  4DYR A;  1BA5 A;  3BR5 A;  1VF9 A;  3ZQC A;  4XIC A;  3PO2 J;  3PM1 A;  2P81 A;  1LE8 B;  3G1M A;  3A03 A;  3S1N J;  2O7O A;  2XGD A;  2H8R A;  1WGX A;  2NVT J;  4B1R A;  2DJN A;  1GDT A;  4M3D A;  3I4N J;  2HDD A;  4UUS B;  4MO7 A;  3O8H A;  5E3L A;  3BR6 A;  5FKL A;  1OFC X;  1AU7 A;  4C2M J;  4XRS G;  3BTC A;  2TCT A;  4L5E A;  1DU0 A;  3BQY A;  1MBF A;  4IEJ A;  2K40 A;  3NAU A;  1MBK A;  1JT0 A;  2MSY A;  4A3J J;  2E19 A;  1ETX A;  3E7L A;  1UG2 A;  4BBR J;  2AO9 A;  5BNG A;  5E3M A;  2EZK A;  4DYC A;  1MNM C;  1R9T J;  2HYJ A;  1POG A;  3S15 J;  2DMQ A;  1JT6 A;  1I50 J;  5K7H A;  1H88 C;  2EZI A;  4NDL A;  2M2E A;  5EGO B;  4A3K J;  4Y52 J;  2LY9 A;  3C2B A;  5F04 A;  3HOX J;  3PO3 J;  3HB9 A;  4BY7 J;  3B6C A;  3GTL J;  5GPC A;  2R5Z B;  1I3Q J;  3ZQL A;  2DA3 A;  2XSD C;  1JJ6 C;  4MLO A;  4CYC B;  4A3B J;  4BY1 J;  2O9L A;  3ZOB A;  4M3E A;  4UUT A;  1ORK A;  2YUS A;  1AKH B;  3G1L A;  1PUF A;  1MBE A;  3TW6 A;  3MVP A;  3IV5 A;  4LOC A;  1BW6 A;  5C4X J;  4JX5 A;  1A6I A;  2NS8 A;  2D5V A;  1HOM A;  1FTZ A;  2IBD A;  3BTL A;  4AUX A;  5IPA A;  3QPL A;  2DMU A;  5HOD A;  4A3C J;  2IEK A;  2L9R A;  3JRD A;  1ENH A;  5EZG A;  4M3G A;  2E2J J;  2LKX A;  3A02 A;  2CUF A;  4DZJ A;  3BTJ A;  4B4C A;  5FKO A;  1T56 A;  2LP0 A;  4XRM A;  1ZK8 A;  2LD5 A;  4EEF G;  2IAI A;  1TWG J;  4IHY A;  2HXI A;  2EBI A;  1FJL A;  1FEX A;  2MW8 A;  2M0C A;  4DW6 A;  2JA6 J;  3Q0U A;  4V2G A;  5DTD A;  1UHS A;  3TED A;  2R0Q C;  2K9Q A;  3IH4 A;  5E3O A;  2MGQ A;  1S7E A;  1XS9 A;  2K9N A;  1F43 A;  5EZH A;  2N8G A;  4FE4 A;  1ZTR A;  1FTT A;  2DA2 A;  2DMT A;  1JGG A;  4I6Z A;  3RZO J;  2AHQ A;  1ETO A;  2KDZ A;  3IH2 A;  2R7Z J;  1CQT A;  2DA1 A;  2K9S A;  2VPR A;  4IHW A;  4XK4 A;  3BR0 A;  3BG9 A;  3A01 A;  3GTM J;  2XPV A;  5M3M J;  1MH3 A;  3BG5 A;  4QSH A;  2R5Y B;  3S2D J;  1ETQ A;  1IDZ A;  1U78 A;  5K7F A;  5EG0 B;  1SAN A;  1HDD C;  4DZP A;  5J1R A;  1JJ8 C;  4IHV A;  2DA5 A;  3TP3 A;  3CDL A;  1X58 A;  2EZH A;  3M3Y J;  2Y9Z A;  1WI3 A;  4FTH A;  1Q1V A;  4FE7 A;  4MFD A;  4J19 A;  4M3F A;  4JYK A;  3IH3 A;  5F0H A;  2LLK A;  4A3D J;  2X6O A;  2O8K A;  3OOU A;  2FD5 A;  1GVD A;  2ZB9 A; 
#chains in the Genus database with same CATH topology
 3BLY A;  4IRH A;  4HQM A;  1XG1 A;  4HDV A;  2DOF A;  4BQA A;  2W57 A;  3F8C A;  1ULY A;  4ZYA A;  3KYL A;  2CW7 A;  1H8A C;  4EJO A;  4U88 A;  3OYA A;  4F52 A;  2E2H J;  1GHC A;  1R1U A;  1UCR A;  1DPU A;  1FMW A;  1ETY A;  1MBG A;  1MMS A;  3R61 A;  3J7A Y;  1SVM A;  3C2G A;  4XN3 A;  4BJ6 C;  3RTR A;  2LF8 A;  3RYR A;  2A6T A;  1G3Y A;  2DTZ A;  2EV5 A;  2M30 A;  2DXI A;  2UWM A;  1HKS A;  2EB7 A;  4X6A J;  1LPQ A;  4CHU A;  5D5W B;  2OPT A;  2GZW A;  2XAQ A;  1JHF A;  1XSD A;  1AKH A;  3MAJ A;  3TGN A;  3RQ4 A;  2JA8 J;  1G3W A;  3G4S I;  1XCB A;  4KN4 X;  3B02 A;  2E71 A;  1OJL A;  4LFU A;  5DEQ A;  3A0H C;  3MMY B;  1DGW Y;  2E1M C;  2OF7 A;  3VPR A;  3JRG A;  4NBQ A;  3FIW A;  5LFA A;  1GT0 C;  3D1N I;  3Q0V A;  2PMU A;  2KKO A;  1C0W A;  1D0X A;  4PK4 A;  1F9N A;  3CCL I;  1WJB A;  4ABZ A;  3VOD A;  1YRN A;  1S6L A;  2R92 J;  2ISZ A;  1Z7U A;  1FSE A;  2KMU A;  2XAF A;  1XDS A;  1R6R A;  2K4B A;  2HVS A;  2CU7 A;  3DBR B;  4HF0 A;  2CMP A;  4PDK A;  5KAF C;  2PMH A;  1RZ4 A;  2VAS A;  1ODD A;  1SFO J;  3GEZ A;  1SD4 A;  1YE9 A;  3F8N A;  2XB0 X;  3WTU C;  3VSK A;  3TO9 A;  3WGG A;  1TQI A;  1FY7 A;  4A3E J;  1OCR H;  3L09 A;  2GAU A;  5FKK A;  4II3 A;  4XR6 A;  1LDD A;  1IRZ A;  1S7O A;  3HGG A;  1ZQ3 P;  3L2V A;  1LJ9 A;  1D1C A;  1IJW C;  3EYI A;  2EFP A;  1ZR4 A;  3LSR A;  1ACI A;  3CLO A;  3HPG A;  2RAE A;  4BL0 B;  1OR7 C;  2PLY A;  4GGG A;  5L3G A;  3CDH A;  5F1R A;  2STW A;  2OQG A;  2Z9O A;  5D6E A;  1USS A;  1FIA A;  5EDN A;  5C3E J;  4M73 A;  1AWC A;  2HYF A;  5KHD A;  2R7V A;  2ECC A;  3BR3 A;  3KP2 A;  2MC4 A;  2HOA A;  3PL8 A;  1QRY A;  1OCC H;  1BI0 A;  4BDZ A;  2G7H A;  3WTS C;  3RJP A;  4M6V A;  3SFZ A;  2L9S A;  4Q4Z F;  2L7Z A;  1IZ1 A;  2GA2 A;  3ZXS A;  3E6M A;  5FLX K;  2KIS A;  2XVC A;  5F27 A;  4PUS A;  4MTE A;  3PUF A;  1T95 A;  4P1W A;  5FO5 A;  2VBZ A;  2XGC A;  4YRV A;  1K6O A;  2XAG A;  4RBO A;  1V5G A;  5F08 A;  2PN6 A;  4BNC A;  1U5T A;  2PG4 A;  3I4M J;  2DMP A;  1VQN I;  2M7A A;  4LB6 B;  3TOB A;  3T5X A;  5JFR A;  4ZC3 A;  1FX7 A;  4C30 A;  1O57 A;  1BM9 A;  1WI9 A;  2MAB A;  5HNF A;  4UVB A;  2HQN A;  4QTR A;  4IQJ A;  2EPF A;  4ITV A;  1YX3 A;  3S1M J;  2M34 A;  2HNH A;  3QYB A;  2CQQ A;  4IOA F;  2NAZ A;  4E7J A;  1W36 D;  4DBR A;  3W2A A;  1V3F A;  4LLL A;  3R0A A;  5ICF A;  4KJZ A;  2VI6 A;  2H1K A;  5E1X A;  5EGO A;  2KIF A;  2L02 A;  5JLX A;  1HA8 A;  1R5H A;  1WWX A;  3FF5 A;  3T1B A;  1H9T A;  1K6Y A;  1KU3 A;  1WRJ A;  2VL8 A;  1R1V A;  2LBF B;  2R5Z A;  1BC7 C;  1TNS A;  3FXJ A;  2P7V B;  3LSJ A;  5J40 A;  5HOO A;  3SFI A;  4AIK A;  1XGS A;  1J09 A;  1ITY A;  3LSK A;  2J5O A;  5J1U A;  1Q1H A;  5IP9 J;  3TP0 A;  4BBS J;  4HQE A;  3OYN A;  5L3F A;  1RC9 A;  3GTJ J;  1TT5 B;  5D8K B;  2VKE A;  2V9K A;  2KRH A;  1XGO A;  2Z2S B;  4BJT A;  5IYC J;  4EMS A;  2R7F A;  3OYH A;  4B3X A;  2Q0O A;  4C3I J;  3CMY A;  4X1E A;  4I09 A;  3O3K A;  4B48 A;  1KGS A;  2P4W A;  1IN4 A;  3IKV A;  5HS9 A;  4B3A A;  1GUU A;  3BCB A;  3C18 A;  3CUQ A;  5D6F A;  2R4G A;  4IVN A;  1TC3 C;  2P6S A;  2GM4 A;  5E20 A;  3GCM A;  4DOZ A;  3BQZ A;  1W36 C;  1JTY A;  2QF7 A;  1MMA A;  2DBB A;  1ZRD A;  1UHM A;  1MSE C;  3JRB A;  1SAX A;  4YII A;  2ME0 A;  1VQ6 I;  4BHP A;  1FWZ A;  3GTO J;  1I39 A;  1JKR C;  5C4J J;  1PYV A;  2QKL B;  3LOC A;  2JT1 A;  3CMA I;  5FLX Z;  4KIT B;  1YRN B;  3HOV J;  2MH9 A;  4FQG A;  3BDD A;  2GIZ A;  2Y0M A;  3DPL C;  3WTW C;  4A3G J;  3AG3 H;  3TL4 X;  1TWF J;  3ABU A;  3BR2 A;  4XLE A;  3VYR B;  4CA0 A;  5DDG A;  1IG7 A;  1HCR A;  1TWH J;  2DA7 A;  3SHF A;  2V6C A;  1E17 A;  4M9Z A;  3ZMV A;  2E36 A;  5L3B A;  4XOP A;  2AS5 F;  5FFZ A;  3G6E I;  1A31 A;  4XLP F;  1YG2 A;  2HTS A;  4BXF A;  3LNQ A;  5E18 F;  3OS0 A;  1QQI A;  3S93 A;  3UNG C;  1K7A A;  1MGT A;  5FD5 A;  4Z6Y A;  3A0B C;  2BV6 A;  2ESN A;  3ZQH A;  3JRF A;  1KA8 A;  3LWF A;  3HSE A;  2X48 A;  4YFX F;  1OCP A;  2XKP A;  3SJM A;  2VE8 A;  1BOA A;  1U0J A;  2DQL A;  2CSO A;  4ZTJ A;  3FKI J;  4D5C A;  2LVS A;  1QGP A;  1JUP A;  4ZDO A;  3HGY A;  3L7W A;  2GIV A;  3KEY A;  4I76 A;  3E6C C;  2XGX A;  1W1W E;  1T08 B;  3HJE A;  1TTY A;  2UZK A;  4U87 A;  4QIW N;  3BR5 A;  3ZPL A;  2FML A;  2WWY A;  3I9V 2;  4ZYD A;  1YYV A;  2P81 A;  4ESF A;  1BN5 A;  1G4D A;  3S1N J;  2CFO A;  2ADU A;  1U3E M;  4A12 A;  3SQN A;  2XGD A;  2EIM H;  3L2C A;  1WJF A;  3BY6 A;  4C2U A;  4OIR F;  3ZN0 A;  2RKH A;  4U0Y A;  1U5T B;  4LJZ F;  2KPM A;  5J4V A;  4MO7 A;  3CME I;  2FEZ A;  3FXR A;  3HSR A;  3KP4 A;  2KIM A;  2WC2 A;  3CLQ A;  4CCO A;  4HDU A;  1OFC X;  1IXR C;  4XRS G;  2NXN B;  1DU0 A;  3BQY A;  3I4P A;  1XTA A;  2BVM A;  4IEJ A;  3I59 A;  4BQO A;  3CJN A;  2E19 A;  1SMT A;  4HOB A;  4DBQ A;  1LUJ B;  1R4M B;  1ZRC A;  3CCV I;  1IN5 A;  1GVJ A;  5E3M A;  1ZG5 A;  4PZJ A;  3KFW X;  1D8J A;  1X4O A;  3IWF A;  3MZ8 A;  1R23 A;  1JT6 A;  2C6Y A;  2EZI A;  2UV1 A;  4NDL A;  5EGO B;  4BDY A;  4FET A;  2LY9 A;  3SXY A;  5LEJ A;  3PO3 J;  3GTL J;  1IN6 A;  3B6C A;  1Y0N A;  2A68 F;  4GRI A;  5GPC A;  4ZTF A;  2R5Z B;  3OYM A;  2E7W A;  1OKR A;  4QPO A;  2CQ7 A;  3HRT A;  2XSD C;  4R1H A;  3K0L A;  2J5P A;  3WGH A;  2FU4 A;  1EH6 A;  2K02 A;  4M3E A;  2ZFW A;  3FXU A;  4EVI A;  2YU3 A;  2YUS A;  3JW4 A;  1PUF A;  4IRI A;  2KL4 A;  4Q48 A;  4L9J A;  1XGM A;  4LOC A;  1JHH A;  3DPU A;  2K86 A;  2CUZ A;  1Z91 A;  1MMN A;  2VQG A;  5C4X J;  4JX5 A;  4KUM A;  2NS8 A;  1NG6 A;  2DTR A;  2DT5 A;  2RQQ A;  3I53 A;  1RUN A;  3QOE A;  2R3S A;  3PIO F;  1FTZ A;  2IBD A;  5IPA A;  2DMU A;  1IN8 A;  2IEK A;  4EM2 A;  2OTL I;  4YFN F;  4BYY A;  3LSI A;  3U21 A;  2XF7 A;  3TBI A;  2F2E A;  1REP C;  1WJD A;  3CUQ B;  5EEG A;  5B3S H;  1DP3 A;  4EJW A;  3A4C A;  1T56 A;  3OYD A;  2DYR H;  1A04 A;  4CDG A;  1KZH A;  1ZK8 A;  5EJC A;  4Q47 A;  4A0X A;  1ZRE A;  5TJJ A;  2PFB A;  1T39 A;  1MMG A;  3I0T A;  4IHY A;  4NC6 A;  4DIQ A;  5E79 C;  4WX9 A;  3VDX A;  3FXL A;  3N4M A;  1WKM A;  3GZ5 A;  3H3Z A;  2VXZ A;  1HXD A;  2WAF A;  1UFM A;  4RB0 A;  3KP6 A;  1PUE E;  3HIF A;  3IL2 A;  1DDN A;  4B47 A;  4G94 A;  3BZC A;  3K4M A;  1F5T A;  4MEX F;  2EK5 A;  2MGQ A;  4HSR A;  2E1C A;  5JVG F;  1XDU A;  3KLO A;  4XL9 A;  2EWN A;  1ZTR A;  2WY7 Q;  1T8I A;  1FTT A;  1JGG A;  1U5T C;  4KIF A;  3S2W A;  4Y17 A;  1CGP A;  3M8E A;  2KDZ A;  1TQM A;  1GLN A;  4XLC A;  4MHG A;  4U7D A;  3HC7 A;  1ZG1 A;  2VPR A;  4IHW A;  1X3W B;  5EEH A;  4ENK A;  2IA2 A;  2ETH A;  4MNU A;  4G7H F;  1O3T A;  3BR0 A;  3A01 A;  3GTM J;  1J9I A;  2A5Y B;  3L9F A;  3AFH A;  2RNG A;  1FMV A;  5CQE A;  1U78 A;  5K7F A;  2K27 A;  4GYI A;  3AL0 B;  2QSF X;  1QA6 A;  3FDY A;  4JBA A;  4R79 A;  2LKS A;  2XAH A;  5J1R A;  2OJE D;  1IRG A;  3TQN A;  3K70 D;  2IS6 A;  2X0L A;  3GYH X;  2VPL A;  3KP3 A;  3WOD F;  1LDK B;  1T2K A;  3DLA A;  4G7Z F;  2EZH A;  3QP6 A;  4EM0 B;  5GAG J;  1WJE A;  3M3Y J;  2V4J C;  1KU7 A;  1FOY A;  2OA4 A;  2L9V A;  1J5Y A;  3K4K A;  3QU6 A;  4J19 A;  2DLL A;  4V19 K;  4BHB A;  4HX7 A;  2O8K A;  1RR8 C;  1GVD A;  5HDN A;  3WGI A;  4HEA 2;  5H6Q A;  4LD5 A;  3CCQ I;  3E1S A;  1K78 A;  2GQQ A;  2VBW A;  4KN7 X;  5IP7 J;  4IZZ A;  2XB5 A;  2ESH A;  4M9S A;  2LFB A;  3F3X A;  9ANT A;  2LNB A;  2IA1 A;  2KT0 A;  2NYX A;  2HOT A;  3MCZ A;  2M8E A;  5K5R A;  4M74 A;  2G0E A;  1XMX A;  1HSJ A;  1ZEL A;  2BHY A;  3I59 B;  3Q5F A;  1U8R A;  4RAG A;  3VSL A;  4NC8 A;  4BUP A;  1TBX A;  1ZGJ A;  4RAF A;  5DD8 A;  2GBY A;  1N75 A;  5A2Q K;  2XKO A;  4IQ4 A;  1F4K A;  2LK2 A;  2MH2 A;  1NHA A;  3BZK A;  5JR3 A;  3R0J A;  5JLW A;  1HLV A;  3BWG A;  4E7Z A;  3K70 C;  1HKQ A;  4A93 J;  2DDB A;  3BJ6 A;  2IS2 A;  2OZU A;  5DM7 F;  2VOD A;  1MBH A;  3D5L A;  1SEU A;  2EZL A;  1KQ8 A;  1NTC A;  1MJ9 A;  4N0B A;  3ZMT A;  1DPR A;  2E5Z A;  3JR9 A;  1OCO H;  5BQT A;  1PUF B;  1RRJ A;  3BR1 A;  4E6K G;  3CMM A;  5IY5 H;  4H4K C;  3OR2 C;  3W6V A;  4AVZ A;  3E0J B;  3FK6 A;  4DYQ A;  5DUI A;  2XUB A;  1ERD A;  1P7I A;  3EUK L;  3DEE A;  3KEO A;  5BPD A;  3RKW A;  3CDI A;  2QYO A;  2L0K A;  4CXF A;  1ZLK A;  3BJO A;  2VIX A;  3S3O A;  2MA3 A;  3FKJ A;  3HM5 A;  4HG2 A;  2HI3 A;  4NNJ A;  2CRG A;  5DCM A;  3J81 K;  3HOS A;  3K69 A;  1K4S A;  5KK1 A;  2V1D A;  4ON0 A;  1HW1 A;  3AL0 C;  3BZ6 A;  4BU2 A;  1R22 A;  1Z1D A;  3DV8 A;  2I8D A;  1N77 A;  4C3J J;  2E5N A;  2BZT A;  2EIN H;  1MJB A;  3HDD A;  1X2M A;  2XSJ C;  4RM3 A;  3I55 I;  1B8I A;  3M4O J;  1BOB A;  1B72 A;  5L3C A;  1SFU A;  3PFY A;  1LFB A;  3SYT A;  4N9I A;  3N05 A;  2X1D A;  3KZI C;  3IC7 A;  1JKP C;  2X51 A;  2XF5 A;  3HOU J;  4HV6 A;  2JUG A;  4UNO A;  3ZQI A;  3FZV A;  4ZDP A;  3JRC A;  2FA5 A;  2A6E F;  1S3J A;  3KYD B;  1FLI A;  1QVU A;  4S0H B;  1LEA A;  1WH7 A;  1FC3 A;  1IXC A;  2LY2 A;  1QO0 D;  5IP6 A;  1YOV B;  3EQL F;  3LSP A;  2XGE A;  4HBL A;  3A01 B;  3HOW J;  2VC0 A;  1SVO A;  2DT7 B;  1KQ0 A;  4GDF A;  2E35 A;  3CJQ B;  4KYW A;  1EKE A;  4D7M A;  5E3N A;  4BKX A;  2QQ9 A;  3GW2 A;  3ZRG A;  3H0G J;  1O3S A;  1ZRF A;  2VE9 A;  4OMY A;  5BS6 A;  2QQ8 A;  3O6B B;  4EM1 A;  3ZQQ A;  1LVA A;  4BEH A;  3LSG A;  4A6E A;  2M87 A;  5JVT A;  3FIS A;  3RPQ A;  1HW5 A;  2XAS A;  2CW0 F;  3KZY A;  3HEF A;  3V7S A;  2VBX A;  2Q2E A;  2LG4 A;  4PGH A;  3L2Q A;  5FLM J;  2IGK A;  4JQF A;  1BC8 C;  2BYV E;  3TKY A;  1K78 B;  5GP9 A;  3OMY A;  4PJJ A;  2VJ4 A;  4MQV A;  3ZP5 A;  3H3V K;  3ABK H;  3S32 A;  4XNF A;  3GFJ A;  2KJC A;  2FX0 A;  1WPK A;  3KP7 A;  1T33 A;  2JJ7 A;  3HYI A;  2M4G A;  3K4C A;  1DQU A;  3IAM 2;  5HDK A;  3SZT A;  1YIJ I;  3UR3 C;  5ILU A;  1IO2 A;  2V26 A;  3PUB A;  1F36 A;  4D9J A;  3A2K A;  2M5W A;  2CJJ A;  2GXG A;  1MKM A;  2VOO A;  3GME A;  2HKX A;  4E7L A;  3WU1 B;  1X3U A;  4IO9 F;  3ZQ7 A;  4PGG A;  3HOY J;  2CW8 A;  1NK2 P;  1IGN A;  1S9H A;  4DGW B;  4C2T A;  3I58 A;  3CCE I;  5IT9 K;  3HKZ N;  1B9M A;  5LBQ A;  1FYK A;  1MNE A;  3ASO H;  5GAD J;  2WY8 Q;  1JTX A;  2LC2 A;  4ENN A;  2JSP A;  2VON A;  4JP0 A;  2PMZ N;  4L5I A;  2JA2 A;  2LR8 A;  2MBF A;  4AIJ A;  1XMK A;  1Z7L A;  2P0W A;  4BE2 A;  5J6X A;  2BY0 A;  2JN6 A;  5IOY A;  4XOR A;  4AYB A;  2QZ8 A;  3BPX A;  4D7N A;  5D8L B;  3BPV A;  4A3M J;  2XRL A;  1I6H J;  4RGR A;  4LGW A;  1HQC A;  1W5T A;  2WB1 A;  4P9F A;  2W7N A;  5ICE A;  2YR2 A;  3LMM A;  3S3M A;  2NS7 A;  2QUF A;  3QOD A;  1YJN I;  2M1B A;  2G9W A;  2EIJ H;  4OIO F;  5H6R A;  3FXM A;  5GPA A;  1ZKG A;  5D5U B;  4ENM A;  2HOS A;  3NRV A;  4U0V A;  2HOE A;  3ZMS A;  1TWC J;  2ZCW A;  3CO6 C;  2HQ5 A;  5AON A;  4WXD A;  2W1O A;  5J3L A;  1VFC A;  1I5Z A;  3RKY A;  4LLN A;  4OOI A;  1ETV A;  1RET A;  2MLG A;  4IKF A;  5DCM B;  4AD9 A;  2X9D A;  1BIA A;  4MIM A;  3VWB A;  3PIP F;  1I3A A;  4E70 A;  1W0T A;  1O3R A;  4XMY A;  1X1D A;  2WAQ A;  2ZME A;  1LFU P;  2EV0 A;  2R5Y A;  2Y0S A;  2A07 F;  1IXS B;  4K2E A;  2HU9 A;  4Z2Y A;  2FBH A;  4V2F A;  3HRU A;  4Y15 A;  2O03 A;  1B8I B;  3F72 A;  4RMN A;  2DAO A;  1B72 B;  2ECB A;  5IT3 A;  1P4W A;  4DQ2 A;  2KHM A;  2QQA A;  3RQI A;  3MWM A;  3MKL A;  1LFP A;  4EAT A;  2QSH X;  2DU9 A;  2K5C A;  5F64 A;  5J4Y A;  3S1R J;  1MBJ A;  4DYR A;  1BA5 A;  1VF9 A;  4HLY A;  4XIC A;  3PO2 J;  5DD4 A;  1BJA A;  1Z05 A;  3EET A;  3K4B A;  2XF6 A;  1QU3 A;  2A61 A;  1FBS A;  2HWV A;  2NVT J;  5JHF A;  3N97 A;  4B1R A;  4X0G A;  1GDT A;  3VOE A;  3K1M A;  2HDW A;  2K9M A;  3G2B A;  2HDD A;  1ZLJ A;  3HOT A;  3E5U A;  3WU2 C;  5DV5 A;  4HRI A;  3FHN A;  5E3L A;  4HYE A;  3BR6 A;  3KIO A;  3IRR A;  2D2W A;  1G3S A;  4B09 A;  2ISY A;  2V1N A;  4EGZ A;  4C2M J;  1AU7 A;  5L3E A;  1D5V A;  1MBF A;  4H0E A;  4UVC A;  5AIQ A;  1MBK A;  3DXJ F;  3M07 A;  5CPR B;  1JT0 A;  5IT9 Z;  5HLI A;  3H36 A;  3F8F A;  4BEH B;  1VQL I;  4AM3 A;  3BC8 A;  3ECO A;  1FYL A;  4UHT A;  2AQF A;  1Z6T A;  4E7I A;  1R9T J;  5B5E C;  3LAJ A;  3S15 J;  1I50 J;  1QHH D;  2AXT C;  5K7H A;  3RCO A;  4A3K J;  4LIU A;  4Y52 J;  2Q2E B;  1HST A;  5F04 A;  1KYZ A;  3K9T A;  3CF5 F;  4BXU A;  1BR2 A;  3G73 A;  1R5G A;  4UB8 C;  5HLG A;  1VZ0 A;  4PSX A;  5FGM A;  5FB2 A;  4M71 A;  1I3Q J;  1O7F A;  3V8J A;  1NH3 A;  4BH9 A;  1T0F C;  3ABL H;  1XCV A;  4JK1 X;  3F23 A;  4G6Q A;  2O9L A;  2L2O A;  3ZOB A;  1NG7 A;  4F92 B;  3EUH A;  1AKH B;  3G1L A;  1P4X A;  3F22 A;  1S5L C;  3IV5 A;  2ZC2 A;  3HXL A;  3M1C A;  4J01 A;  2GOM A;  1SD6 A;  1BW6 A;  2EIK H;  4LK1 F;  2X1C A;  4LG3 A;  3GWZ A;  2P8T A;  3V4G A;  1XX5 A;  2R7R A;  2D5V A;  3V7C A;  4A3C J;  4KIG A;  4EV0 A;  2L9R A;  2JVH A;  1JXS A;  5EZG A;  4M3G A;  2COM A;  3ELK A;  3WG9 A;  3A02 A;  3QP5 A;  3DWL E;  3KYC B;  4S05 A;  4DZJ A;  3LA2 A;  4I0B A;  2KQR A;  2LP0 A;  4HA8 A;  2BBY A;  2KP6 A;  4XKB A;  3LAP A;  2CFX A;  3HRS A;  3O2P E;  3J7Z I;  1GXP A;  1AOY A;  2HXI A;  3WU0 A;  2DFF A;  4L0Y B;  4KDP A;  1ZH5 A;  2VOP A;  1A35 A;  1XB4 A;  3IUO A;  5TIS C;  2M0C A;  4G8X A;  4V2G A;  1D1A A;  4OMZ A;  3ZMD A;  5LRR A;  1UHS A;  1QNT A;  3FXK A;  1H9G A;  1WQ2 A;  2ZXH A;  3IH4 A;  3I54 A;  2R7D A;  2IGO A;  2JZY A;  4PFP A;  3CF2 A;  1K4T A;  1F43 A;  5EZH A;  3L2W A;  2N8G A;  5K5O A;  2A69 F;  4CIC A;  3TO7 A;  1V54 H;  3BJA A;  2AHQ A;  4A2U A;  1ZAO A;  5K1Y A;  4RB1 A;  2QEX I;  2B7E A;  1JE8 A;  1XSX A;  2DA1 A;  2NRA C;  4I7H A;  2K9S A;  1A36 A;  1FOX A;  2M0M A;  4AU7 A;  3DP7 A;  4XK4 A;  3GF2 A;  5KAI C;  5TRD A;  1WJC A;  2ZME B;  3KPH A;  3PNT A;  5HLH A;  1KYW A;  1SFX A;  5FRO A;  4QSH A;  2R5Y B;  1O3Q A;  3S2D J;  1ETQ A;  1IDZ A;  2XAU A;  3S3N A;  4HLX A;  4U7B A;  2R7U A;  1HDD C;  2JTV A;  2QKM B;  5JHU A;  1M1E B;  2MC3 A;  4DZP A;  3Q9S A;  2EA4 A;  1TT0 A;  2DA5 A;  2K3P A;  3CDL A;  1Y56 A;  3EYY A;  2QEN A;  1ZGA A;  3PFI A;  2Y9Z A;  2ZJ2 A;  2QGU A;  2JRT A;  5L3D A;  1Q1V A;  4BS9 A;  1P92 A;  4MFD A;  1HW2 A;  5LHH A;  1VQ5 I;  4NB5 A;  2A5W A;  3QPH A;  1OCZ H;  2XDV A;  2TDX A;  2HPI A;  4NQW A;  6PAX A;  4XKC A;  3Q9V A;  3LQR A;  4PJN A;  2A05 A;  2BEO A;  4FCY A;  2HGC A;  5ILS A;  2DOE A;  4L9T A;  3OR1 C;  4ESJ A;  3MZH A;  1R71 A;  3FMS A;  2X6X A;  2XV4 S;  2JPB A;  4C3H J;  2JA5 J;  3WHB A;  2Y9Y A;  2P5K A;  2RRE A;  4CGZ A;  2VQL A;  1E3P A;  3QYE A;  2VC1 A;  2QCO A;  1I1S A;  4LMY A;  2DQR A;  3C3W A;  4KT6 A;  3S17 J;  3ABM H;  4D0P A;  4L0Z B;  2PX9 A;  3OIQ A;  1YJW I;  4FHT A;  1H89 C;  4IL6 C;  4YEJ A;  4XLN F;  4ASN A;  4N4N B;  3GTP J;  1HF0 A;  1KU2 A;  2VN2 A;  3S14 J;  2JK3 A;  4A5N A;  2Z1D A;  4RB3 C;  3S16 J;  3RKQ A;  2F4I A;  2W48 A;  3H5R A;  3VYT B;  2YPR A;  1SD5 A;  4CCM A;  1PP7 U;  3CCR I;  2BY3 A;  1Y1W J;  2OD5 A;  5LHG A;  1UEL B;  1WVR A;  4QPQ A;  4YIF A;  4EQQ A;  2W00 A;  4LLG F;  2W24 A;  5B1B H;  1RES A;  2GXB A;  5GAH J;  2F48 A;  3JRE A;  4A3L J;  1E3H A;  3FX3 A;  3W6J B;  1WJ5 A;  2O3F A;  1ZAR A;  3FM3 A;  2H6B A;  4M72 A;  2DPU A;  5F0F A;  3GZ6 A;  2F5E A;  1PP8 F;  2W4S A;  3HBL A;  4QLC U;  3ISP A;  1G59 A;  3F6V A;  2ZO4 A;  2YX4 A;  2RV8 A;  2JA7 J;  3RPU A;  1BI3 A;  3K1P A;  1X1A A;  5CYV A;  2ZME C;  5J8C A;  3V42 A;  1MDM A;  4A0Y A;  4WCG A;  3PSF A;  1JI8 A;  3ZQF A;  2H6C A;  2ZXJ A;  2VUM J;  5J1Y A;  1G3T A;  3G1O A;  2R7T A;  3M8F A;  3JCU C;  2IS1 A;  5IOZ A;  2FSW A;  3H9G A;  5EF6 A;  4ENJ A;  4NC7 A;  4F93 B;  2ZSH B;  2QBY A;  2JUC A;  3BCA A;  4HZF A;  2Y30 A;  1GV2 A;  3H3U A;  4UVA A;  1IDY A;  2QQB A;  3CC7 I;  4J00 A;  3SEZ A;  2FJ1 A;  2VJ5 A;  3LSM A;  1HKT A;  3ZGK A;  3P9I A;  2DA6 A;  2M3A A;  5F6F A;  3PQJ A;  1YTY A;  4PJ0 C;  2FUG 2;  1DGR M;  2DW4 A;  3F6O A;  2LOO A;  1O7L A;  4Y7N J;  3BT9 A;  3OYB A;  1OLT A;  3OYK A;  4OAY A;  5EEA A;  3GFL A;  3JTG A;  1KQ9 A;  4U0W A;  2GWR A;  3DTK A;  4XM3 A;  1V5E A;  5ICC A;  2O6G E;  3LFK A;  1YS7 A;  2M7B A;  3JRA A;  2RVC A;  3LQQ A;  3OYG A;  2QA4 I;  2E34 A;  3ML6 A;  2XIG A;  3OSF A;  4UUS A;  3MKY B;  1XGN A;  2P5V A;  3QQA A;  4W97 A;  4FT8 A;  5FKN A;  3EUA A;  3CP8 A;  3O8G A;  1RR7 A;  4HPQ A;  4HST A;  4WK8 F;  3E6B A;  1PDN C;  5LGU A;  2K4J A;  2ME6 A;  3IAS 2;  2H8W A;  5D5V B;  4GYG A;  2V1X A;  4RA2 A;  1FPQ A;  4G6D A;  1J75 A;  1YIT I;  4G9Y A;  1FT9 A;  3P9K A;  5CVJ A;  4MQ9 F;  3RSN A;  2FE3 A;  3DBL B;  4KT5 C;  2BGC A;  2XAJ A;  4OWR B;  2STT A;  3MKW B;  1A6Q A;  5GAE J;  1T6S A;  2CUJ A;  4CCJ A;  2KRF A;  1YLF A;  5J8F A;  3OYF A;  1J2X A;  3HKZ A;  3F8M A;  2IPQ X;  1Y8Q B;  4NQW B;  4IHX A;  4HX4 A;  2RQP A;  2Y2Z A;  2QVO A;  3SEQ A;  1QBJ A;  3HTS B;  1X1P A;  3MEX A;  4XID A;  3D5S C;  5TGT A;  4CH7 A;  2X4H A;  1ETW A;  1QVT A;  4F3Q A;  2E1O A;  3JAM K;  3GBG A;  1AHD P;  2F5F A;  3CUQ C;  2WAE A;  1D0Z A;  2XPW A;  5BOX A;  2ZSI B;  2Z5U A;  3S8P A;  2E7X A;  1RKT A;  2IA0 A;  5HDG A;  2H94 A;  5J47 A;  2EH3 A;  2L9N A;  1SC7 A;  3PNY A;  4OIQ F;  4XRS A;  2CUE A;  1B59 A;  3NEU A;  4GXO A;  1X1B A;  4JX6 A;  4G12 A;  3TDU C;  5F1J A;  3E3V A;  3WE2 A;  1DP7 P;  3I56 I;  1F1Z A;  2ID6 A;  5C44 J;  3CD6 I;  4XBF A;  5LRS A;  1B9N A;  2GXA A;  3P9C A;  1OYY A;  4NHJ A;  3GXO A;  5FLV A;  1S72 I;  4LIV A;  1RNL A;  4UB6 C;  4A0Z A;  4IOC F;  4RAY A;  2OUM A;  4HV5 A;  3OYC A;  5FKM A;  5LD2 C;  5BPI A;  3OSG A;  1IF1 A;  3C2H A;  3HUG A;  3RZD J;  3FM5 A;  1S29 A;  2IGN A;  3T8T A;  4AC0 A;  4HNU A;  2Q8K A;  5E1Z B;  3COA C;  4O5V A;  5EYR A;  4A5M A;  3SDG A;  3ZMU A;  1IUF A;  5FD6 A;  1XSV A;  1MH4 A;  2V6E A;  1ZGW A;  3FWE A;  2RC4 A;  1R1T A;  2PJR A;  5HNH A;  3L2U A;  2DDA A;  1FSH A;  3M7G A;  2KZV A;  1BI2 A;  3Q3S A;  2TRT A;  2ZJQ F;  4LG0 A;  5D4S A;  2Y31 A;  2FNP A;  5M5W J;  3K4N A;  2MD0 A;  1VQM I;  4ESB A;  2R7W A;  2KIU A;  5DM6 F;  3C7J A;  1BL0 A;  2JVG A;  1R7J A;  2R7X A;  1OYI A;  2UXN A;  3OIO A;  4UY8 I;  2L7M P;  4KMU X;  2K9L A;  1G2H A;  1OPC A;  2R7Q A;  1Z3Y A;  1MDM B;  1RKW A;  4BXX J;  1SFE A;  4F55 A;  1D5Y A;  2Z3Y A;  3H9J A;  5HLT A;  1UMQ A;  2DOA A;  3I71 A;  3KP5 A;  4ZJZ A;  2QWW A;  4FX4 A;  2QBY B;  2PJP A;  3IHU A;  1OYW A;  2YS9 A;  4IHT A;  1Y8R B;  2CGP A;  3JTH A;  4KA4 A;  1HBX G;  1ZR2 A;  2MG4 A;  4B8X A;  4JX4 A;  1X2N A;  3E97 A;  3WG7 H;  2HKO A;  2HVQ A;  4Y13 A;  4I0A A;  2F5V A;  2ZJR F;  5K5Q A;  3PM1 A;  4F7Z A;  4I02 A;  3MQ0 A;  1IW7 F;  2VXD A;  3JAM Z;  1Z6R A;  2K7L A;  2O7O A;  2EFO A;  2H8R A;  1WGX A;  4RGX A;  4TV7 A;  5A2Q Z;  3GUD A;  3B73 A;  1TP4 A;  3CCJ I;  1YIO A;  2DJN A;  2V7F A;  3R6S A;  3DPT A;  4II2 A;  3BG7 A;  3WTY C;  4DJA A;  5GTI C;  1V4R A;  3LFU A;  4UUS B;  2Y48 A;  2H09 A;  2M4K A;  1J59 A;  3O8H A;  3IRQ A;  2V1U A;  4HF2 A;  2CS3 A;  3L00 A;  3V8L A;  2NNY A;  4L5E A;  4IXA A;  2ZKZ A;  4P5O A;  2MSY A;  4A3J J;  1XMA A;  2HZT A;  3E7L A;  2CV2 A;  2FMY A;  2RDP A;  3LSH A;  1S7A A;  3QRF F;  5KNL A;  4BBR J;  2AO9 A;  2W85 A;  5BNG A;  4DYC A;  4L5J A;  1MNM C;  2JRM A;  2HYJ A;  1POG A;  1UAA A;  4DNC A;  5LHI A;  5LGT A;  2DMQ A;  2XC7 A;  2OC6 A;  4A6D A;  2BVL A;  2IP2 A;  3C2B A;  3GO5 A;  4I99 C;  3HB9 A;  5CJ9 A;  3OV8 A;  3DEU A;  3GVA A;  3ULQ B;  1YW7 A;  2L5Q A;  4O3M A;  4L9N A;  4E7K A;  4KNY A;  4EGY A;  1YW8 A;  2DA3 A;  5E8I A;  4ZZD A;  3J81 Z;  3KCC A;  3GLX A;  4E7H A;  4A3B J;  4YIR X;  2UXX A;  3J7Y J;  1VQ9 I;  3MZY A;  3OYE A;  2BOL A;  2IGM A;  3DBH B;  1YQA A;  2LMD A;  3HTU A;  3LA3 A;  4BQQ A;  1QZE A;  3BRO A;  2DT6 A;  1MIJ A;  3MVP A;  2FBI A;  3AG4 H;  4XON A;  3VFZ A;  4MTD A;  3LA7 A;  1KU9 A;  4FAS D;  2BW3 A;  3PJR A;  1A6I A;  1Y39 A;  1UST A;  2CWE A;  4HF1 A;  1VQ8 I;  5CLS A;  4AUX A;  3QPL A;  3M8J A;  3OS1 A;  3U1K A;  3VYU B;  4O6J A;  2BXY A;  3OYI A;  3L2R A;  2FBK A;  2E2J J;  1UHW A;  3IWZ A;  1AA7 A;  3VB2 A;  2VKH A;  5DCF A;  2DYS H;  3C1D A;  3BTJ A;  1B1B A;  4B4C A;  3JSP A;  5HS7 A;  3WTV C;  2LD5 A;  3HUG B;  1WZ2 A;  2ZJP F;  2KIQ A;  2VT2 A;  1VQK I;  4ZDL A;  4RLQ A;  1FBQ A;  2AXL A;  1FEX A;  2CH0 A;  4DW6 A;  4LB5 A;  3G3Z A;  2UUZ A;  2FXA A;  2HFH A;  1EV7 A;  3PNV A;  2PJR B;  2V9P A;  4LK0 F;  5DTD A;  2ELJ A;  3TED A;  4P96 A;  3SZP A;  2HS5 A;  4C9Y A;  2KDO A;  3DU6 A;  5E3O A;  2NS0 A;  1XS9 A;  4LG0 B;  3KZZ A;  2GA1 A;  2FOW A;  5FRN A;  4FE4 A;  2OCE A;  2DA2 A;  3EDP A;  1BR1 A;  4YFK F;  2HR3 A;  3CJT B;  1ON1 A;  1TZL A;  4WWC A;  1FYM A;  2R7Z J;  1CQT A;  2VQC A;  4HW0 A;  1UB9 A;  3TMO A;  3DTI A;  3BG9 A;  2XPV A;  1S8N A;  3BG5 A;  3PQK A;  2V9V A;  2O5R A;  1SAN A;  3CC2 I;  4LIT A;  1TLH B;  3I3L A;  4XQF A;  5JI6 A;  4IRG A;  1JJ8 C;  3V8K A;  4IHV A;  3DF8 A;  1X1C A;  2DK5 A;  2WV0 A;  4MEY F;  1CF7 A;  3RIR A;  3R4K A;  2LKP A;  3I5U A;  2F6C A;  4FTH A;  1Y0U A;  2FNA A;  4CYD A;  2JQ7 A;  4HNT A;  4BHC A;  1LEB A;  2D1V A;  4M3F A;  1R5I D;  3WTT C;  3ROU A;  3TOA A;  2LLK A;  4B44 A;  2X6O A;  1MMD A;  3EPZ A;  1Z3X A;  3OOU A;  5H2F C;  1R49 A;  4G7O F;  2ZB9 A;  2Z33 A;  3QOP A;  1WSU A;  1BR4 A;  1BIB A;  1TWA J;  1K61 A;  2HVR A;  1D1B A;  3OL4 A;  5CKT A;  1IC8 A;  1IAW A;  2HEO A;  3DTE A;  2YU9 J;  1P2F A;  1WH5 A;  2R93 J;  2DPD A;  1U2W A;  1U8B A;  3QWL A;  4ETS A;  3ASN H;  1W7P A;  1YW9 A;  1LQ1 A;  3CP2 A;  2E2I J;  1T98 A;  2VKV A;  1FOK A;  1R4N B;  1P7J A;  2YX7 A;  3BG6 A;  3D5R C;  2BE5 F;  3G71 I;  2MYS A;  2MD5 A;  3HZJ A;  2PEX A;  4KMF A;  1I6X A;  2HXO A;  4WXH A;  3ABT A;  5E17 F;  5K7Z A;  1A5J A;  2Y75 A;  3H1C A;  1FNN A;  2X85 A;  1T38 A;  2B63 J;  2VKD A;  4FIS A;  1TW3 A;  2ZXW H;  4RB2 C;  1PJR A;  3WTZ A;  4AVP A;  3RI4 A;  3QPS A;  1D0Y A;  2ICW G;  3K1N A;  2AQE A;  3FXO A;  4G6T B;  1BJZ A;  3QAH A;  2ZBK A;  4RGU A;  1JKO C;  1IV6 A;  2P6T A;  2HYG D;  2EA2 A;  2VT3 A;  4CZC A;  3MFK A;  1ONV A;  5LLQ A;  4AWX B;  4RM2 A;  2BY1 A;  1WFX A;  5IYD J;  1MSF C;  1P4A A;  3HHG A;  2NVY J;  2PBI A;  3K4J A;  1VI0 A;  2OU2 A;  4IJA A;  4BAY A;  1YX5 A;  1JUS A;  3KE2 A;  1YFH A;  2CV0 A;  4HNV A;  2L4M A;  3HHH A;  4CUG A;  2E60 A;  4UUV A;  2BW3 B;  2LYC A;  4OIP F;  2KFD A;  2OZ6 A;  3L1P A;  2NVQ J;  2HPM A;  1IRF A;  1RIO H;  2ZNY A;  1RI7 A;  2E1N A;  5IYB J;  5ERI A;  2GOX B;  1EF4 A;  3DEW A;  4M9X A;  4Y33 A;  4A3I J;  1EJ9 A;  3BG3 A;  3ERM A;  5ILV A;  3DLL F;  1L3L A;  5ICG A;  3S1Q J;  2WV1 A;  4RAZ A;  2FOK A;  5M5Y J;  5CVV A;  3K7A J;  2K3F A;  3FK7 A;  1ZN2 A;  4WXC A;  1QZY A;  2D45 A;  1LNW A;  2VB6 A;  1U6G A;  4IF4 A;  4NUB A;  4WF2 A;  2ELK A;  3FXQ A;  4GFB A;  5CVU A;  2FQ3 A;  1BI1 A;  3DKW A;  3GLL A;  4W1U A;  4RDU A;  3ECH A;  3ZCO A;  1IV8 A;  1O4X A;  1WCM J;  5LEK A;  3CQZ J;  4XLH A;  3UKG A;  1Y1V J;  2CV1 A;  1FBU A;  2LY1 A;  2X6Y A;  2ZNZ A;  3H5N A;  2OV7 A;  2ACJ A;  3NQO A;  4D5F A;  4E7S A;  2WBM A;  3OYJ A;  2LSO A;  2P7C B;  3H0D A;  2IJL A;  3WTX C;  2R7S A;  1EA3 A;  3ZR8 X;  4PCQ A;  1BBY A;  3J80 K;  2IVM A;  1DUX C;  3S2H J;  1X19 A;  2FQ4 A;  2F5D A;  3CC4 I;  2LF7 A;  2L4A A;  2KJB A;  1VND A;  2M9H A;  4HX8 A;  3M9A A;  2H1L A;  3GTK J;  1TQP A;  1JGS A;  2DFH A;  3OOP A;  1LE8 A;  1Z21 A;  4XSX F;  2GLO A;  1UZC A;  4AYB N;  4XLA A;  1L0O C;  1SMY F;  3CCY A;  3OS2 A;  4L9V A;  4ZZL A;  2F4M B;  2WB1 N;  1VTN C;  1K83 J;  3GTG J;  2HDC A;  2WA0 A;  1SVL A;  5HVQ C;  1DU6 A;  3OIP A;  3T8R A;  1WJA A;  4BE0 A;  1W5C C;  4D1Q A;  4B43 A;  1G6N A;  3W2V A;  1Z0X A;  4BE1 A;  1J0R A;  2F5C A;  2MFZ A;  4XN0 A;  1OCT C;  1VQ7 I;  3HOZ J;  2DN0 A;  3GZN B;  4EJU A;  1W4M A;  2R7O A;  3CJR B;  3REO A;  1Z77 A;  2OAZ A;  2DK8 A;  5CQG A;  2L54 A;  2NVX J;  4A69 C;  2EQR A;  1CF7 B;  2QM3 A;  1B4A A;  1FZP B;  2WAQ N;  3B6A A;  1RPW A;  2Y0S N;  2KRC A;  5DUK A;  2VQH A;  2COB A;  5LGN A;  3MKZ A;  1YJ9 I;  2G7U A;  4KIC A;  4OIN F;  5M5X J;  1XC5 A;  4Y3O A;  3CCU I;  2DMN A;  3VEP A;  5FJ8 J;  5ED4 A;  3DCF A;  3P5J A;  5FRM A;  2I10 A;  1SAU A;  4OAZ A;  3F21 A;  1K79 A;  1I27 A;  4HAM A;  4CYC A;  2CQN A;  5DS9 A;  4Q5S F;  1P9Q C;  4CO8 A;  5KVR A;  1JKQ C;  3K2A A;  2F4O B;  4S04 A;  2ZFU A;  1W5S A;  3GFM A;  1FP1 D;  2W82 A;  3MN2 A;  4PFO A;  4RS8 A;  2IT0 A;  4A3F J;  1U9N A;  1W7P B;  2CQX A;  3LL7 A;  3AG1 H;  1YHQ I;  2XRO A;  4M6X A;  3ZN1 A;  2VLA A;  1YS6 A;  2VJJ A;  1XPX A;  2CYY A;  1NK3 P;  4UXN A;  1U9O A;  2M8G X;  1LDJ A;  5M3F J;  2KZG A;  2JSC A;  2XPU A;  1GV5 A;  2ID3 A;  3H35 A;  3QU3 A;  1MJA A;  2CO5 A;  4UV8 A;  2L3D A;  4XKW A;  4MFE A;  2JMW A;  3BP8 A;  3MD2 A;  2OCC H;  2BXZ A;  3W2W A;  3I64 A;  5AIP A;  2L7F P;  3D0S A;  1BW5 A;  1E3O C;  3FBN B;  3A1Y A;  2LDU A;  2LH9 A;  4P9U A;  2QLZ A;  1V5F A;  4ZYG A;  1HDP A;  3J80 Z;  2LTP A;  1ZHF A;  1VQP I;  2EFW A;  2DA4 A;  3ZQG A;  3IP4 B;  3NAR A;  1TL8 A;  3F0C A;  3BTI A;  4UV9 A;  3K10 A;  3PSI A;  4BJ5 C;  2NOG A;  5CVI A;  5H20 A;  3K4L A;  4P55 A;  1W0U A;  2NNN A;  3GFI A;  4ZYE A;  4PJM A;  3HPH A;  3FBI B;  1H0M A;  2KLO A;  2EIL H;  4IX7 A;  1APL C;  1VQ4 I;  1YI2 I;  1MND A;  3Q0W A;  3SDB A;  1W7P D;  3TW7 A;  4M3B A;  2XHK A;  3CCM I;  1TW2 A;  3JRI A;  4RLF A;  1JUM A;  2NVU B;  5BMZ A;  1E0E A;  1QPI A;  1QHG A;  3JSO A;  1R58 A;  2HQA A;  3H5A A;  3J7A O;  4CCN A;  4AID A;  2FF4 A;  1GXQ A;  3ESW B;  4M6Y A;  3AAF A;  2Y69 H;  5B1A H;  3HL2 A;  4BGD A;  1LB2 A;  3BOQ A;  4KIS A;  1ETK A;  2ELH A;  5GTH C;  1P6R A;  5E8G A;  2WAD A;  1ZG3 A;  5F0C A;  4BAC A;  3DKY A;  5EG0 A;  1D3Y A;  1LKX A;  1OR7 A;  2JWT A;  3JRH A;  4L18 B;  3GTQ J;  1FIP A;  1I1G A;  2DFI A;  4Y4R A;  3WHC A;  1MW7 A;  3DKX A;  5DYM A;  2DI3 A;  4XRF A;  4XLF A;  3CUO A;  1UJ8 A;  2DJI A;  2HQR A;  1MD0 A;  2Z99 A;  1R36 A;  4I01 A;  4EJV A;  3ZQC A;  1IRX A;  2EJR A;  3NWS A;  3SZG A;  3G1M A;  3A03 A;  1LE8 B;  2IW5 A;  5D5X B;  3K2Z A;  1IN7 A;  5E1W A;  2B0L A;  3KEQ A;  3HSF A;  4CSW A;  3DQV C;  4EJT A;  2M45 A;  4M3D A;  3H92 A;  3I4N J;  2OTJ I;  1TNT A;  4GCV A;  5FFX A;  1QPM A;  3V7R A;  2IXS A;  2DCE A;  5FKL A;  2LRE A;  4R8H A;  3CZ6 A;  2HTJ A;  1LVK A;  3BTC A;  3F9K A;  1IUY A;  2TCT A;  1OQY A;  4CCK A;  3QYF A;  2K40 A;  3NAU A;  4IPA A;  4KIB A;  1FOW A;  1ETX A;  2EFN A;  2HZD A;  2PMZ A;  1D8K A;  3E5X A;  3EUH C;  2XRN A;  1UG2 A;  2A3S A;  4MGR A;  2EFQ A;  2EZK A;  1OIS A;  3KX2 A;  3U1D A;  2P5L C;  1ON2 A;  5CVR A;  2MLK A;  4I2O A;  4N9H A;  1H88 C;  3E5Q A;  2EV6 A;  1YO5 C;  2M2E A;  3HOX J;  3WE3 A;  4OU0 A;  2X1E A;  3ZMZ A;  4BQN A;  3HRM A;  3F8B A;  4BY7 J;  2O61 A;  3OY9 A;  4F91 B;  5KCM A;  4CCL A;  3CO7 C;  3ZQL A;  1JJ6 C;  3OL3 A;  4MLO A;  4ZH4 F;  4CYC B;  4BY1 J;  3R60 A;  2DO7 A;  3CCS I;  3DFG A;  4UUT A;  1ORK A;  1N78 A;  3DU5 A;  1OMI A;  4XKV A;  3ERE D;  1FP2 A;  1MBE A;  2O0Y A;  3TW6 A;  2Q1Z B;  2L7K A;  4ZYH A;  2IS4 A;  2RN7 A;  4KFC A;  1UG0 A;  2VBY A;  2PI0 A;  4IHS A;  1STZ A;  1HOM A;  4N4O B;  3BTL A;  5HOD A;  2B9S A;  3W6K B;  1RUO A;  3GX4 X;  3FHZ A;  2VJI A;  3JRD A;  1ENH A;  2CQK A;  2K85 A;  3OYL A;  4YG2 F;  2LKX A;  1T0F A;  1MZB A;  4AIH A;  2CUF A;  2YSR A;  1ZYR F;  3RYP A;  1SFK A;  1XD7 A;  4PJL A;  5FKO A;  2BHZ A;  4XRM A;  3X2Q H;  4JOM A;  2L01 A;  2ZXI A;  4EEF G;  3FMQ A;  2IAI A;  2OBP A;  2X6W A;  3CTA A;  1TWG J;  5B66 C;  2RGV A;  2OQR A;  2EBI A;  2FRH A;  3FMR A;  3RKX A;  2V79 A;  1FJL A;  3E6D A;  2MW8 A;  2RNJ A;  2E1M B;  4PSW A;  3HG9 A;  1EH7 A;  4ANJ A;  3KLN A;  2JA6 J;  3Q0U A;  1WHU A;  1SD7 A;  1R00 A;  3IKT A;  3LST A;  1G8X A;  3RDI A;  2R0Q C;  1PVE A;  3TO6 A;  4FX0 A;  5HS8 A;  2D1H A;  2K9Q A;  3H9Q A;  1X3Z B;  4I98 B;  1S7E A;  1VQO I;  4QWQ A;  2K9N A;  3NWT A;  2W84 A;  1XN7 A;  3P7N A;  2DOD A;  2DMT A;  2H27 A;  2QSG X;  4I6Z A;  3RZO J;  1ETO A;  3ONQ A;  1Z67 A;  3IH2 A;  4GO1 A;  3AG2 H;  1KON A;  4XSZ F;  4CZZ A;  3M1E A;  1Y6I A;  3W3C A;  1Z9C A;  3AKZ A;  2A6H F;  1B6A A;  2IRF G;  1N25 A;  3TDZ C;  5M3M J;  1MH3 A;  2W25 A;  2JPC A;  1J7K A;  2Z16 A;  5EG0 B;  4E4H A;  5D4R A;  3K6G A;  3QPT A;  3T0Y A;  3CES A;  4RGS A;  1X4P A;  3U2R A;  3OWT A;  2NOJ B;  2DFE A;  3TP3 A;  2CG4 A;  3KET A;  1X58 A;  3RPU D;  3U9G A;  2O8X A;  1WI3 A;  1E2X A;  2WTE A;  2I5U A;  4YEL A;  4FE7 A;  2LRD A;  4JYK A;  4XOT A;  1QZZ A;  3IH3 A;  5F0H A;  4A3D J;  2FD5 A;  2LBF A;  1EH8 A;  3VYS B;  1V55 H;  2BY2 A;  2PQ8 A;  1HC8 A; 
#chains in the Genus database with same CATH homology
 4FCY A;  1XG1 A;  1TWA J;  5IP7 J;  2XB5 A;  1K61 A;  1H8A C;  1IC8 A;  2YU9 J;  2LFB A;  2R93 J;  9ANT A;  2JA5 J;  4C3H J;  1WH5 A;  3WHB A;  2E2H J;  1U8B A;  2Y9Y A;  2KT0 A;  2HOT A;  2G0E A;  2E2I J;  1ETY A;  1MBG A;  2VKV A;  2QCO A;  1P7J A;  3S17 J;  2DTZ A;  2GBY A;  2HXO A;  4X6A J;  1H89 C;  1A5J A;  5K7Z A;  2LK2 A;  3GTP J;  5JLW A;  1HLV A;  2OPT A;  2B63 J;  4FIS A;  1HF0 A;  1AKH A;  3S14 J;  4A93 J;  2JK3 A;  3QPS A;  2JA8 J;  3S16 J;  3RKQ A;  2W48 A;  1MBH A;  1BJZ A;  1JKO C;  1OJL A;  1IV6 A;  2EZL A;  1NTC A;  1Y1W J;  2OF7 A;  3VPR A;  3JRG A;  3FIW A;  1GT0 C;  3D1N I;  3Q0V A;  5IYD J;  1MSF C;  3JR9 A;  1RES A;  1PUF B;  2NVY J;  3JRE A;  4A3L J;  4ABZ A;  1VI0 A;  1YRN A;  2R92 J;  3BR1 A;  1JUS A;  2CU7 A;  4HNV A;  3W6V A;  5F0F A;  1SFO J;  3FK6 A;  4DYQ A;  2XB0 X;  3L1P A;  2NVQ J;  3HBL A;  1P7I A;  4A3E J;  5IYB J;  2JA7 J;  1EF4 A;  2L0K A;  3DEW A;  4A3I J;  3BG3 A;  3HM5 A;  3S1Q J;  2WV1 A;  5M5Y J;  2HI3 A;  5FKK A;  2CRG A;  3K7A J;  1IRZ A;  3HGG A;  1ZQ3 P;  3FK7 A;  1IJW C;  3ZQF A;  2VUM J;  1ZR4 A;  3LSR A;  5J1Y A;  2RAE A;  3G1O A;  2ELK A;  4GFB A;  4W1U A;  4RDU A;  4C3J J;  1O4X A;  1WCM J;  5IOZ A;  3CQZ J;  3UKG A;  1Y1V J;  1FIA A;  5EF6 A;  5EDN A;  5C3E J;  3HDD A;  1X2M A;  3M4O J;  1B8I A;  4D5F A;  2Y30 A;  1GV2 A;  2ECC A;  3BR3 A;  1B72 A;  1IDY A;  2HOA A;  1QRY A;  1LFB A;  2FJ1 A;  3S2H J;  2DA6 A;  2FQ4 A;  4M6V A;  2L7Z A;  1JKP C;  1VND A;  2M9H A;  3HOU J;  4Y7N J;  3BT9 A;  3GTK J;  1LE8 A;  3ZQI A;  2GLO A;  5EEA A;  3JRC A;  4AYB N;  5F27 A;  3CCY A;  1QVU A;  4S0H B;  2XGC A;  4RBO A;  1WH7 A;  5F08 A;  2WB1 N;  3JRA A;  1K83 J;  5IP6 A;  3I4M J;  3GTG J;  2DMP A;  3OSF A;  4UUS A;  2XGE A;  3LSP A;  3A01 B;  3HOW J;  1DU6 A;  3QQA A;  4W97 A;  5FKN A;  3O8G A;  1RR7 A;  1Z0X A;  4D7M A;  5E3N A;  4BKX A;  2ME6 A;  4QTR A;  1OCT C;  3H0G J;  3S1M J;  3HOZ J;  2DN0 A;  2M34 A;  1Z77 A;  2CQQ A;  2NVX J;  4A69 C;  3LSG A;  2EQR A;  2WAQ N;  3FIS A;  3B6A A;  1RPW A;  3HEF A;  2Y0S N;  2VI6 A;  2H1K A;  5EGO A;  5JLX A;  2COB A;  5FLM J;  4IHX A;  5M5X J;  2Y2Z A;  1XC5 A;  2R5Z A;  2DMN A;  5GP9 A;  4XID A;  5FJ8 J;  3LSJ A;  3DCF A;  3H3V K;  2I10 A;  1ETW A;  1QVT A;  3SFI A;  2E1O A;  3GBG A;  2FX0 A;  1WPK A;  4CYC A;  1T33 A;  2JJ7 A;  5DS9 A;  1AHD P;  1ITY A;  1JKQ C;  5J1U A;  5IP9 J;  3K2A A;  2XPW A;  3TP0 A;  4BBS J;  1RKT A;  3MN2 A;  4A3F J;  3GTJ J;  1U9N A;  1F36 A;  2CQX A;  2EH3 A;  2VKE A;  2CJJ A;  4XRS A;  2CUE A;  5IYC J;  1NK3 P;  1U9O A;  4JX6 A;  2M8G X;  4G12 A;  5F1J A;  3HOY J;  5M3F J;  4C3I J;  2XPU A;  4X1E A;  3CMY A;  1GV5 A;  1IGN A;  2ID3 A;  1NK2 P;  2ID6 A;  5C44 J;  3HKZ N;  4B3A A;  1GUU A;  5FLV A;  4MFE A;  2JMW A;  1TC3 C;  2L7F P;  2GM4 A;  1BW5 A;  1JTX A;  5FKM A;  1E3O C;  3BQZ A;  3OSG A;  1JTY A;  2QF7 A;  4JP0 A;  2PMZ N;  3RZD J;  1MSE C;  3JRB A;  2LR8 A;  4AC0 A;  1HDP A;  2ME0 A;  2LTP A;  2JN6 A;  5IOY A;  3GTO J;  4D7N A;  5EYR A;  2DA4 A;  3SDG A;  3ZQG A;  1IUF A;  1JKR C;  4A3M J;  2XRL A;  5C4J J;  3NAR A;  1I6H J;  3LOC A;  3F0C A;  3BTI A;  1MH4 A;  1YRN B;  3HOV J;  1ZGW A;  2NS7 A;  2NOG A;  1W0U A;  4A3G J;  3Q3S A;  2TRT A;  1TWF J;  3BR2 A;  2Y31 A;  5M5W J;  1IG7 A;  1HCR A;  1TWH J;  1ZKG A;  2DA7 A;  5GPA A;  1APL C;  2HOS A;  3Q0W A;  1TWC J;  3TW7 A;  4M3B A;  1BL0 A;  2HQ5 A;  3JRI A;  5J3L A;  1VFC A;  1ETV A;  1RET A;  3OIO A;  1G2H A;  2L7M P;  3LNQ A;  1JUM A;  1QPI A;  2X9D A;  4MIM A;  1RKW A;  4BXX J;  1W0T A;  3JRF A;  3ZQH A;  1D5Y A;  1LFU P;  2X48 A;  1OCP A;  1ETK A;  2R5Y A;  3SJM A;  5F0C A;  5EG0 A;  1UMQ A;  4V2F A;  2JWT A;  3JRH A;  3FKI J;  3GTQ J;  1B8I B;  1FIP A;  2YS9 A;  4D5C A;  1B72 B;  2ECB A;  2LVS A;  1JUP A;  3WHC A;  3HGY A;  4I76 A;  1ZR2 A;  3RQI A;  3MKL A;  2MG4 A;  4QIW N;  4JX4 A;  1X2N A;  3S1R J;  1MBJ A;  4DYR A;  1BA5 A;  3BR5 A;  1VF9 A;  3ZQC A;  4XIC A;  3PO2 J;  3PM1 A;  2P81 A;  1LE8 B;  3G1M A;  3A03 A;  3S1N J;  2O7O A;  2XGD A;  2H8R A;  1WGX A;  2NVT J;  4B1R A;  2DJN A;  1GDT A;  4M3D A;  3I4N J;  2HDD A;  4UUS B;  4MO7 A;  3O8H A;  5E3L A;  3BR6 A;  5FKL A;  1OFC X;  1AU7 A;  4C2M J;  4XRS G;  3BTC A;  2TCT A;  4L5E A;  1DU0 A;  3BQY A;  1MBF A;  4IEJ A;  2K40 A;  3NAU A;  1MBK A;  1JT0 A;  2MSY A;  4A3J J;  2E19 A;  1ETX A;  3E7L A;  1UG2 A;  4BBR J;  2AO9 A;  5BNG A;  5E3M A;  2EZK A;  4DYC A;  1MNM C;  1R9T J;  2HYJ A;  1POG A;  3S15 J;  2DMQ A;  1JT6 A;  1I50 J;  5K7H A;  1H88 C;  2EZI A;  4NDL A;  2M2E A;  5EGO B;  4A3K J;  4Y52 J;  2LY9 A;  3C2B A;  5F04 A;  3HOX J;  3PO3 J;  3HB9 A;  4BY7 J;  3B6C A;  3GTL J;  5GPC A;  2R5Z B;  1I3Q J;  3ZQL A;  2DA3 A;  2XSD C;  1JJ6 C;  4MLO A;  4CYC B;  4A3B J;  4BY1 J;  2O9L A;  3ZOB A;  4M3E A;  4UUT A;  1ORK A;  2YUS A;  1AKH B;  3G1L A;  1PUF A;  1MBE A;  3TW6 A;  3MVP A;  3IV5 A;  4LOC A;  1BW6 A;  5C4X J;  4JX5 A;  1A6I A;  2NS8 A;  2D5V A;  1HOM A;  1FTZ A;  2IBD A;  3BTL A;  4AUX A;  5IPA A;  3QPL A;  2DMU A;  5HOD A;  4A3C J;  2IEK A;  2L9R A;  3JRD A;  1ENH A;  5EZG A;  4M3G A;  2E2J J;  2LKX A;  3A02 A;  2CUF A;  4DZJ A;  3BTJ A;  4B4C A;  5FKO A;  1T56 A;  2LP0 A;  4XRM A;  1ZK8 A;  2LD5 A;  4EEF G;  2IAI A;  1TWG J;  4IHY A;  2HXI A;  2EBI A;  1FJL A;  1FEX A;  2MW8 A;  2M0C A;  4DW6 A;  2JA6 J;  3Q0U A;  4V2G A;  5DTD A;  1UHS A;  3TED A;  2R0Q C;  2K9Q A;  3IH4 A;  5E3O A;  2MGQ A;  1S7E A;  1XS9 A;  2K9N A;  1F43 A;  5EZH A;  2N8G A;  4FE4 A;  1ZTR A;  1FTT A;  2DA2 A;  2DMT A;  1JGG A;  4I6Z A;  3RZO J;  2AHQ A;  1ETO A;  2KDZ A;  3IH2 A;  2R7Z J;  1CQT A;  2DA1 A;  2K9S A;  2VPR A;  4IHW A;  4XK4 A;  3BR0 A;  3BG9 A;  3A01 A;  3GTM J;  2XPV A;  5M3M J;  1MH3 A;  3BG5 A;  4QSH A;  2R5Y B;  3S2D J;  1ETQ A;  1IDZ A;  1U78 A;  5K7F A;  5EG0 B;  1SAN A;  1HDD C;  4DZP A;  5J1R A;  1JJ8 C;  4IHV A;  2DA5 A;  3TP3 A;  3CDL A;  1X58 A;  2EZH A;  3M3Y J;  2Y9Z A;  1WI3 A;  4FTH A;  1Q1V A;  4FE7 A;  4MFD A;  4J19 A;  4M3F A;  4JYK A;  3IH3 A;  5F0H A;  2LLK A;  4A3D J;  2X6O A;  2O8K A;  3OOU A;  2FD5 A;  1GVD A;  2ZB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...