1X58A

Solution structures of the myb-like dna binding domain of 4930532d21rik protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
GSSGSSGRKDFTKEEVNYLFHGVKTMGNHWNSILWSFPFQKGRRAVDLAHKYHRLISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein 4930532D21Rik
publication title Solution structures of the myb-like DNA binding domain of 4930532D21Rik protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x58A01
2XGDA 4J19A 4V2GA 2FX0A 1HLVA 1D5YA 2Y9YA 3HKZN 1Z77A 1GT0C 4D5CA 5EDNA 2LKXA 3GTOJ 2JK3A 5FLMJ 1Q1VA 2DTZA 1JKQC 3Q0UA 1YRNB 3UKGA 2DA4A 2K9SA 5GPAA 1F36A 4JYKA 2E1OA 5JLXA 3HGYA 3BTCA 3FK7A 3JRFA 4C3JJ 1JJ6C 2AO9A 1MBHA 1FJLA 1U9OA 3E7LA 1ZR4A 2EZIA 2E19A 4DW6A 4FE4A 1GDTA 1IG7A 1I3QJ 3Q0VA 1RKWA 1HOMA 5IYCJ 3QPLA 1GV2A 1XG1A 5F08A 3S17J 4BXXJ 3M3YJ 5J1YA 2L0KA 4DYRA 3CCYA 5K7FA 3LNQA 3DCFA 2COBA 4FE7A 2JWTA 2OPTA 3OOUA 5IP9J 4A3JJ 1LE8A 4JX6A 2R7ZJ 1FIPA 3QPSA 4D7MA 4XK4A 1K61A 3FK6A 2E2IJ 5F0CA 1DU6A 1A6IA 1JKOC 3S1QJ 2VI6A 4AYBN 3JRGA 1IRZA 3CMYA 3GBGA 3SDGA 2HOSA 3ZQIA 1VFCA 1OFCX 4MLOA 1IUFA 2XB5A 1ETXA 2H8RA 2NVTJ 5K7HA 4DZPA 2LTPA 3QQAA 4AUXA 3WHBA 2M2EA 4A3DJ 1P7JA 5EG0A 1NK2P 2JA6J 2AHQA 5E3OA 1U78A 1UMQA 2X9DA 2XGEA 4M3EA 4FISA 3MVPA 5GP9A 3S2DJ 2DMQA 5FKMA 3S1RJ 2CUFA 1HF0A 2ID6A 4IEJA 2FD5A 2L7FP 1T33A 3CQZJ 4I6ZA 3BR0A 5DS9A 2E2HJ 1AKHB 4M3BA 2P81A 4EEFG 5IP6A 1O4XA 1AU7A 3TW7A 1MNMC 3I4NJ 1ENHA 5DTDA 5EZGA 5EF6A 2ZB9A 1JUPA 1SANA 5IYDJ 4M6VA 3OSGA 4C2MJ 2E2JJ 3FKIJ 3D1NI 1IDZA 3OIOA 3HOXJ 1MSEC 5EEAA 4A69C 5IOZA 4BY7J 2HOTA 2IEKA 2Y30A 5IPAA 1HDPA 2EQRA 2KDZA 4IHVA 1AHDP 3H0GJ 2TCTA 3GTKJ 5FKKA 2K9QA 2DMTA 1WI3A 2HI3A 1WPKA 3JRAA 3JRCA 1POGA 1OCPA 1ETWA 1U9NA 4UUTA 1OJLA 1U8BA 2ME0A 3A01A 1SFOJ 2XB0X 1E3OC 3NAUA 1VI0A 1ETQA 1I6HJ 1ITYA 3O8HA 5C44J 3ZQCA 5M5XJ 3F0CA 3LSRA 4A3MJ 1R9TJ 1W0UA 1W0TA 1HCRA 3RKQA 3HBLA 2HYJA 4X6AJ 3TP0A 1CQTA 5E3NA 2Y0SN 4XICA 2M8GX 5J1UA 1B72A 3BQYA 1VF9A 2R5YA 2QF7A 5FJ8J 1RESA 1JT0A 2XSDC 5F1JA 2DA3A 4XRMA 2LLKA 3BR3A 1H88C 3S1NJ 2JJ7A 1HDDC 3Q0WA 4A3GJ 4MO7A 2HXIA 2MSYA 3ZQLA 4V2FA 3A03A 5C4XJ 2K40A 1WCMJ 3RZOJ 3BG9A 3I4MJ 4IHWA 3ZQHA 5F27A 4QIWN 4B3AA 3HOZJ 4M3GA 5EGOA 3LSGA 3HOUJ 1ZQ3P 2DMNA 3FIWA 3GTQJ 1MBEA 1GV5A 3LOCA 5EYRA 3TW6A 4RDUA 4MFDA 3G1OA 2L7MP 2R93J 2EBIA 1BW5A 1LE8B 2GM4A 4IHYA 4A3LJ 2RAEA 2VUMJ 4Y7NJ 2JA8J 2FJ1A 1IGNA 3BTIA 2YUSA 2DA1A 4AC0A 1P7IA 1TWCJ 3CDLA 4BY1J 4MFEA 5F0HA 2VPRA 1RPWA 4XRSG 3IH2A 1T56A 3S16J 2O8KA 4A3CJ 2XRLA 4BKXA 4LOCA 1ETOA 5M5YJ 3W6VA 2R0QC 5EG0B 1QVTA 2XPVA 1PUFA 1IC8A 3S1MJ 4M3DA 1VNDA 2JMWA 1ORKA 2NVQJ 3HGGA 1MBKA 2HDDA 1LFBA 1X58A 9ANTA 1RETA 2XPUA 1GUUA 4A3IJ 2ECCA 1FTZA 4XRSA 4B4CA 2DJNA 4A3FJ 1JUSA 3PM1A 2W48A 4W1UA 4C3IJ 2CUEA 5E3MA 1H89C 3S2HJ 3MKLA 1WH7A 4DZJA 1ETYA 2NOGA 4CYCA 2GLOA 1JUMA 3RQIA 2N8GA 4S0HB 3JRHA 4GFBA 1EF4A 3DEWA 2I10A 1LFUP 1JJ8C 1Y1VJ 1X2NA 3BR5A 2R5ZA 4UUSA 2YU9J 3PO2J 4B1RA 5IOYA 1ZR2A 2HQ5A 1FTTA 5F0FA 3HM5A 3B6CA 3G1MA 1X2MA 3IH3A 3A01B 2IAIA 2ME6A 2Y31A 2DA2A 3BG3A 5J3LA 4DYCA 4L5EA 3HDDA 2DMUA 5M3FJ 1JTXA 4MIMA 2L9RA 5C3EJ 1IV6A 1ETVA 3C2BA 5M3MJ 1Y1WJ 1MH3A 5F04A 3BQZA 1MSFC 2B63J 3ZQFA 1JT6A 4HNVA 1JKRC 1B72B 1B8IA 3PO3J 4I76A 5FKNA 2NS7A 5M5WJ 2MW8A 2JA5J 3H3VK 2R5YB 4D5FA 3BG5A 2CRGA 2PMZN 4M3FA 1A5JA 4BBSJ 4QTRA 1S7EA 4JX4A 1YRNA 2R92J 2M34A 2FQ4A 2LY9A 3S14J 2ELKA 1UHSA 2X48A 3IV5A 5K7ZA 3GTLJ 2QCOA 3Q3SA 5EGOB 2IBDA 1BL0A 3GTJJ 2CU7A 2JA7J 3HOYJ 1WGXA 3JRIA 3HOWJ 2O9LA 1OCTC 2KT0A 2YS9A 2ID3A 3K7AJ 2HOAA 2LFBA 2MGQA 4FCYA 3ZOBA 3BT9A 3IH4A 2LVSA 2O7OA 5EZHA 4A3EJ 2H1KA 1IDYA 1H8AC 5GPCA 1BJZA 2NVYJ 3GTPJ 2EZHA 1FIAA 5IYBJ 4G12A 3M4OJ 3O8GA 2M9HA 1I50J 1NTCA 4A3KJ 1F43A 2DA5A 2EZLA 2M0CA 3GTGJ 1NK3P 1XC5A 3FISA 2CQXA 2DN0A 2WB1N 2ECBA 1QPIA 5IP7J 1FEXA 2DMPA 5HODA 1QRYA 3SFIA 1PUFB 2XPWA 3HB9A 3NARA 5JLWA 1BW6A 1QVUA 3BR1A 4X1EA 4IHXA 2LD5A 4Y52J 1IJWC 1JGGA 3G1LA 3RZDJ 3LSJA 4C3HJ 3SJMA 5FLVA 1TC3C 2G0EA 2EH3A 2NVXJ 1AKHA 4NDLA 3BR2A 1RKTA 1TWHJ 1UG2A 3BTJA 3L1PA 4FTHA 3JRDA 2DA6A 2TRTA 2LK2A 2MG4A 5C4JJ 2EZKA 3JRBA 4BBRJ 1BA5A 1TWFJ 3MN2A 2K9NA 1TWGJ 1MBJA 1K83J 1WH5A 4D7NA 3BR6A 4CYCB 4DYQA 2DA7A 5E3LA 4A93J 2JN6A 1ZKGA 3B6AA 4W97A 1Z0XA 2CQQA 5BNGA 1GVDA 1JTYA 1MH4A 3LSPA 2XGCA 3OSFA 1ZGWA 3JREA 1APLC 1MBGA 2R5ZB 1DU0A 4UUSB 2LR8A 3ZQGA 2GBYA 3TEDA 2VKEA 2L7ZA 2OF7A 4RBOA 3TP3A 4JX5A 1G2HA 5J1RA 4XIDA 2VKVA 2NS8A 2WV1A 1TWAJ 5FKLA 4QSHA 1ZTRA 3GTMJ 3BTLA 1XS9A 3VPRA 3HOVJ 2Y9ZA 2Y2ZA 4ABZA 1JKPC 2LP0A 3JR9A 5FKOA 3A02A 2WAQN 1ZK8A 1RR7A 2HXOA 2X6OA 2CJJA 3WHCA 2D5VA 1ETKA 3K2AA 1MBFA 3S15J 1B8IB 4A3BJ 3HEFA 4JP0A
chains in the Genus database with same CATH superfamily
2O0YA 3MEXA 1Z77A 1GT0C 4I7HA 3SYTA 3SZGA 2JK3A 2RQQA 2XAUA 3PUBA 5LRSA 3H9JA 1OCOH 2DQRA 5H6RA 3UKGA 2VJIA 2I5UA 5GPAA 1F36A 1SD5A 4JYKA 1T08B 3L2WA 3BDDA 3HGYA 1YW8A 3FK7A 2LKSA 1JJ6C 2FEZA 1FJLA 3AFHA 2GXGA 2HPMA 4LMYA 2XF7A 4CYDA 1I3QJ 1AOYA 1BI0A 2OU2A 2AQEA 1HQCA 1BJAA 4BXXJ 5F08A 2E1MB 2PX9A 5F6FA 2L0KA 4HZFA 4L9JA 5K7FA 2COBA 3OYHA 2JWTA 1RIOH 3M8EA 1IW7F 4MQVA 2DFIA 4OAZA 1YQAA 1LPQA 4XK4A 1S6LA 2VPLA 1K78B 3CMYA 3S3OA 3SXYA 4I0AA 1FBQA 1DDNA 3R4KA 4KIGA 2V1UA 2XKOA 3ZQIA 1VFCA 4MLOA 3GF2A 1IUFA 2DDBA 1ZLKA 5EEGA 3VWBA 2KZVA 2FF4A 4WXCA 3UR3C 2M2EA 3L7WA 3R0AA 1O7FA 5EG0A 3DKYA 2JA6J 3KE2A 4CA0A 5E3OA 4BQAA 1KU3A 2GZWA 3WGHA 2NOJB 5FD6A 1G3SA 5LEKA 4FISA 1AA7A 2HQRA 3LSMA 4XNFA 3ZRGA 3KZZA 1FYMA 2ID6A 2FD5A 5JHUA 2OA4A 1LNWA 2L7FP 1T33A 2X1DA 5KK1A 3BR0A 3WTWC 1W36D 1AKHB 2K5CA 1FBUA 4ZTFA 4U7BA 1TL8A 1LQ1A 2DI3A 4LG0B 3H5AA 1X4PA 4RS8A 1CGPA 4A0XA 3OS1A 4JOMA 3V7RA 1O4XA 3TW7A 4EM1A 1MNMC 2EFWA 1PUEE 5ERIA 3E5XA 4OIRF 1KZHA 1P4XA 2ZB9A 3A1YA 1X1AA 2EV6A 3R60A 4II2A 4HRIA 3FBNB 1XMXA 3DTIA 3FKIJ 1ZGAA 2F4IA 4E7JA 5DCMA 3PIOF 2IRFG 4BY7J 1G3YA 2MD0A 3F8CA 2HU9A 2VQLA 4TV7A 2JTVA 2XSJC 1CF7B 2EQRA 3I3LA 4L18B 2ZNZA 2TCTA 5H20A 3CUOA 2K9QA 1RUNA 2ZJ2A 3LQRA 2BZTA 1ZELA 2DMTA 2Q1ZB 2XDVA 2LNBA 1HSTA 4WWCA 4JK1X 4O5VA 2UUZA 1R6RA 5A2QZ 1OCPA 2O61A 3M8JA 4E6KG 1R00A 1Y0UA 4UUTA 2L9VA 2XASA 3DPUA 4HF1A 3HSRA 2Q2EB 4YIIA 1IUYA 5CJ9A 2DLLA 4FX4A 1VI0A 4D9JA 2DXIA 1ETQA 4XQFA 2XUBA 2ZNYA 4RM3A 3ZMSA 4UNOA 2GOMA 1W0TA 1X3UA 3RKQA 3AL0C 2HYJA 2FOWA 3QYFA 5ILVA 3DBRB 4WK8F 1E2XA 3IUOA 1CQTA 5HS7A 2A5WA 4BJ6C 1I1SA 1G6NA 1R36A 1SMTA 2CQNA 4F91B 2BEOA 3BQYA 1UJ8A 1YJNI 1IXSB 2HQNA 1PJRA 1IV8A 2QF7A 5CVRA 2PJPA 4AVPA 1Z9CA 2F2EA 4XRMA 3F23A 3CJRB 2EA4A 2NS0A 4RM2A 3WTZA 3S1NJ 2JSPA 4UV8A 2BGCA 1J59A 2M0MA 1ZAOA 1W36C 4P1WA 1N25A 2HXIA 1R1VA 4KN7X 4Z6YA 5C4XJ 1ONVA 3WE3A 4G7ZF 3RZOJ 3BG9A 3I4MJ 5F27A 4QIWN 4B3AA 3VEPA 4UVBA 2FUG2 3DPTA 4PK4A 2A68F 2QQBA 5BQTA 2X85A 4Q5SF 1GV5A 3A2KA 5LHIA 5EYRA 1E3PA 2HVQA 3QYBA 3TW6A 3DFGA 4RDUA 1XGSA 1FOYA 3G1OA 4AWXB 2R93J 2EBIA 3DTEA 1BW5A 4R1HA 1E17A 1HXDA 3OV8A 3CCJI 2RAEA 3ABLH 2FJ1A 1IGNA 4Q48A 5D8KB 4BL0B 5KVRA 3I9V2 2VJ5A 1X1BA 4PFOA 4A6EA 4O3MA 1OR7C 2R7FA 2VQHA 4N9HA 3WG7H 3DQVC 4LOCA 4XMYA 5EG0B 1IN5A 2YX7A 4GYIA 2XPVA 1PUFA 1IC8A 2IGKA 5F1RA 4M3DA 1VNDA 1U2WA 1X4OA 3FX3A 3OOPA 4EV0A 1VQ8I 1QA6A 3PUFA 2MA3A 4YIFA 4ZYAA 1LEBA 4XONA 4FASD 4ZC3A 3KP5A 5GAGJ 3KP7A 3U9GA 1EH7A 1IXCA 3GEZA 3F21A 3GLLA 4BQQA 1S7OA 2IGOA 2XPUA 4MEYF 1QU3A 2E71A 2MD5A 3DKXA 2NAZA 2W85A 4XRSA 4PJ0C 3PM1A 4ZDPA 2XROA 2W48A 4C3IJ 4FHTA 1BR1A 1O7LA 3DXJF 3DU5A 4RLFA 3UNGC 1H89C 2R4GA 3WU2C 4A0ZA 2MABA 2NOGA 3HXLA 1N78A 4EGYA 5DCMB 1JUMA 2KQRA 4AVZA 4XKCA 3T8TA 5D5WB 4DNCA 4EGZA 4S0HB 2F4MB 3GLXA 3S3NA 2CQKA 3D5SC 3LMMA 5FGMA 2GIVA 3F6OA 4YFNF 5IT9Z 2GXAA 2LKPA 3FBIB 3KFWX 1VQ9I 3LWFA 4YFXF 3AG3H 4B1RA 3K2ZA 2PQ8A 3OY9A 3HHGA 2W25A 3CCUI 4GXOA 3HUGA 2FXAA 1DUXC 2V1XA 2FU4A 1FP2A 1XGOA 3IH3A 5LD2C 2DO7A 2CMPA 2OQRA 3GWZA 3J81Z 1UG0A 4B8XA 2L9RA 1UB9A 4ZH4F 1TP4A 4XLAA 4L5JA 5M3MJ 3OYEA 3HOTA 1SAXA 3OYDA 1MSFC 4BYYA 3C2HA 2LY2A 3GCMA 2FE3A 2JUGA 1B8IA 1WJAA 4I76A 2A6TA 1EV7A 5BPDA 1A36A 4XRFA 3EETA 2JA5J 1GXQA 2DBBA 3H3VK 3KYDB 1B9NA 4KUMA 5DV5A 4D5FA 2CRGA 4HNUA 5DDGA 1J9IA 3K4JA 4JX4A 1RC9A 1J7KA 4DBRA 2KISA 2K4BA 5FROA 2FQ4A 5ICFA 2PJRA 3W2WA 2DPUA 2FNPA 4WX9A 4NHJA 5LLQA 4B3XA 3DU6A 2JPCA 1ZG5A 2QCOA 3Q3SA 2IBDA 3ESWB 1G8XA 3PL8A 3GTJJ 4ON0A 2KKOA 2V9KA 1SVOA 3JRIA 2GWRA 1VQ5I 4KIBA 2O9LA 2EFQA 3J80Z 1OCTC 2MLGA 2YS9A 4QPQA 3HRTA 3E0JB 1PDNC 1T6SA 1BR4A 3E1SA 2MGQA 1S8NA 3ZOBA 3BT9A 1ZG1A 2LVSA 2O7OA 2HR3A 2QYOA 5EZHA 4LGWA 1S9HA 3CJNA 3H36A 5B3SH 5GPCA 3K1PA 2OTLI 1FIAA 3WTVC 5AIPA 4E70A 1SFEA 1I50J 4A3KJ 1P4WA 2NNNA 1F43A 3U1DA 2OJED 3GTGJ 2VBWA 3FM3A 2HVRA 2KJCA 2BW3A 3X2QH 2FQ3A 2IS6A 2WB1N 2ECBA 2P7VB 3LA7A 2MBFA 5IP7J 1QPIA 4K2EA 3OMYA 3SFIA 1PUFB 3N4MA 2XPWA 4IZZA 2JVGA 3QPTA 4XLHA 1T39A 2BV6A 1RRJA 2A05A 2L54A 1R5GA 1U5TA 1ERDA 4C3HJ 1SVMA 1KGSA 1TQMA 3F8NA 3OWTA 4BEHA 3DKWA 3SJMA 4GO1A 3FM5A 1JI8A 5E8IA 1RKTA 1W5TA 3FXMA 3GYHX 2GXBA 5L3FA 4MQ9F 3L1PA 2OD5A 2CO5A 4CH7A 2VLAA 4FTHA 2BY0A 3JRDA 1KU7A 1LDJA 2KRFA 2HYFA 4UVAA 2KRCA 2E7WA 5IT3A 5K5RA 3RI4A 5GADJ 5ILSA 3CJTB 3ABMH 1OLTA 1WH5A 4FETA 3TO9A 1KU9A 3H1CA 1ZKGA 4BDZA 4W97A 3WE2A 1YITI 3BZ6A 1MH4A 3CP8A 3HYIA 3CUQA 4BU2A 1Z6TA 3C1DA 1BN5A 4AIKA 2R7VA 4DJAA 5LEJA 1XD7A 3P9IA 2L01A 2JPBA 1X1DA 1BR2A 3TDZC 4B44A 2ESHA 2ISZA 3RDIA 2VKVA 1BIBA 1ZTRA 3HOVJ 2VOPA 1JGSA 3G3ZA 2Y9ZA 2Y2ZA 4AIJA 3WODF 2PN6A 1JKPC 4R79A 3JAMK 2LP0A 3GZ5A 1R5ID 1IN7A 4FQGA 1SVLA 3N05A 2WAQN 3CTAA 2EIJH 2ZSIB 4AM3A 1RR7A 2X6OA 1YO5C 2CJJA 4RB2C 3ML6A 1P9QC 3VOEA 4UY8I 4A3BJ 1B8IB 1YIJI 3MCZA 1KA8A 1SC7A 3D0SA 3VODA 2STWA 4FX0A 2X6XA 2Y9YA 1D5YA 2Q0OA 2OV7A 2LKXA 4G7OF 2CH0A 2I8DA 3K9TA 1YJWI 2KIMA 3CC2I 3F8BA 2DA4A 2K9SA 3F8FA 2XGXA 5HOOA 1FSHA 5CPRB 2E1OA 2PJRB 1J5YA 4NC6A 5JLXA 2A69F 3HTUA 3JRFA 4BHCA 4C3JJ 4PGHA 4HBLA 3E7LA 2EZIA 2VKDA 1GDTA 1YOVB 1IG7A 4ZDLA 1TW2A 3VYUB 3WTSC 1X3WB 3QPLA 3S17J 5J4YA 4DYRA 1BIAA 5ILUA 3DCFA 1IRFA 3V7SA 2KL4A 2IPQX 2OPTA 3I56I 3HPGA 2QKLB 3IL2A 2EFOA 1FOXA 3QPSA 2QSFX 3OYAA 1YHQI 1K61A 4HYEA 4IL6C 3FK6A 1HW1A 2KJBA 1A6IA 1JKOC 4AYBN 4KT6A 3ABTA 3KLOA 2HOSA 2BW3B 1SD4A 2XB5A 2NVTJ 1WKMA 3TGNA 3P9CA 5K7HA 3TBIA 4XOTA 4DZPA 1SFKA 4PDKA 2JVHA 3WHBA 4ENJA 4A3DJ 2NVUB 2XF6A 2IP2A 5D8LB 3KZYA 2AHQA 2R7DA 1U78A 4AD9A 2X9DA 2M3AA 3JW4A 4DBQA 3I58A 1D1BA 1S29A 3LSHA 3MVPA 4MGRA 1DP3A 3ABKH 1A31A 3K1MA 3S1RJ 5TGTA 1HF0A 4IEJA 1OCZH 1U5TB 1ZYRF 4BEHB 1VZ0A 1R7JA 4S04A 1W7PA 3RKXA 3E6DA 2JZYA 3PQJA 3KETA 3HHHA 3E6CC 1UZCA 3ZMDA 4NC7A 4JBAA 4IHSA 2D1HA 2CW7A 1H0MA 4GCVA 1MGTA 2FBKA 1AU7A 4BE1A 2BVMA 5DTDA 5EZGA 5EF6A 4YEJA 1JUPA 1MJ9A 4RGRA 4ESJA 2W57A 4XM3A 4XKBA 4M6VA 3U21A 4HV5A 4CCNA 1IDZA 4UB8C 1YX3A 1TTYA 5IOZA 1CF7A 1UCRA 2WY7Q 3FXOA 2HOTA 2GQQA 2IEKA 1HDPA 2CG4A 3LA3A 1ZREA 3RCOA 1QZEA 3ONQA 1X1CA 2OCEA 2V6EA 4U88A 5FKKA 4EJVA 4GYGA 2VXDA 3MWMA 1WI3A 2HI3A 5IY5H 4P5OA 4ENKA 1DPRA 1WPKA 1J0RA 2Q2EA 3JRCA 1POGA 4E7ZA 2ELHA 2F5CA 4CZCA 1ETWA 3S2WA 3CMMA 2QVOA 4A2UA 3K4CA 3A01A 3DV8A 3NAUA 3BZKA 3IWFA 1LVAA 5CLSA 1YYVA 1I6HJ 1ITYA 4MTDA 2W7NA 3ZQCA 5M5XJ 1PP8F 2ESNA 3LSRA 2CV0A 1HCRA 3HRUA 2HVSA 3BOQA 4IPAA 2G7UA 2NYXA 2WBMA 1N75A 2KFDA 2Z9OA 3K0LA 4YELA 3H9QA 2A6HF 5J1UA 2IT0A 2CQ7A 4EM2A 1WVRA 1VF9A 1WI9A 3FMRA 5DD8A 2BY1A 1K4SA 4OIOF 2QWWA 3ZPLA 5FJ8J 2VL8A 4YRVA 2DA3A 4NNJA 5L3CA 1WRJA 4DQ2A 2YX4A 3GO5A 3RYRA 1H88C 3RSNA 2KRHA 4NBQA 2CWEA 4LJZF 1SAUA 4M72A 1ZG3A 3T5XA 3MD2A 2CFXA 3ZQLA 4V2FA 3A03A 3BY6A 3REOA 1ZRDA 2IS2A 4IRIA 3ZQHA 4EJUA 3E97A 3HOZJ 4XN0A 1UFMA 3JCUC 2VODA 2X51A 5EGOA 1D8KA 3HOUJ 1N77A 5H2FC 3TOAA 2DMNA 5HLTA 1QBJA 4RAGA 2Z3YA 5AIQA 4IO9F 4ANJA 4KICA 1WJFA 4XLEA 3GFIA 4G8XA 1OCCH 1YE9A 4FT8A 1NG6A 4OAYA 4MEXF 4HF2A 1XDUA 3LQQA 4BS9A 3DEEA 2JRMA 2DT5A 4A3LJ 4BJ5C 3OYFA 3BPVA 2YUSA 1VQNI 3IC7A 1P7IA 5LGTA 1TWCJ 1YG2A 1Y8QB 3KZIC 4MFEA 3SHFA 3WG9A 2ADUA 1YS6A 1EH8A 3EPZA 4XRSG 1HKTA 2MH9A 1T56A 2H09A 1D0ZA 2XRLA 5K5OA 3O2PE 1M1EB 2G7HA 1OR7A 2R0QC 1HKQA 3AG2H 1WFXA 3BROA 1TNTA 3S1MJ 2EIMH 2W24A 1MD0A 1ORKA 2NVQJ 2PI0A 5D5XB 2QQ8A 2AXTC 3ZP5A 2OBPA 2IA1A 3HGGA 3QODA 3J7YJ 2O03A 5EEHA 1W7PB 5FLXK 2KIUA 1LFBA 2HGCA 9ANTA 4ITVA 1LVKA 3WU1B 5HDNA 5DUKA 1GUUA 2JUCA 2ECCA 2KZGA 1XCVA 5HDGA 3I53A 4A3FJ 4ZZDA 1YI2I 2W1OA 4W1UA 2M5WA 1PYVA 4LB5A 1ZRFA 3GUDA 1IN4A 1FT9A 3MKLA 1ZH5A 1WH7A 2ZXIA 4DZJA 5AONA 3ZQQA 4RB3C 3PSIA 2XHKA 3CDHA 4HLXA 1Z91A 5CVVA 3BG7A 4YG2F 4XR6A 3JRHA 1ZGJA 2YU3A 4BXFA 4BGDA 3PJRA 4LIUA 2KIFA 1EF4A 1WHUA 4A12A 5J6XA 1Y1VJ 1FZPB 4OMYA 2P0WA 4HV6A 3FXRA 3I54A 3PO2J 4CGZA 1OPCA 3HC7A 1KONA 3LSTA 4LK0F 4Q47A 2H6BA 3F6VA 4Y3OA 3CO6C 2MC3A 3OR2C 3W6JB 3KEOA 1Y8RB 3B6CA 1X2MA 3O3KA 3A01B 3DP7A 1WQ2A 2Y31A 1A6QA 2V7FA 5J8FA 4DIQA 5C3EJ 3S93A 4LB6B 3L2QA 5LFAA 1IV6A 1ETVA 3C2BA 5E20A 5F04A 2HTJA 4XLFA 1ON2A 1GVJA 3SEQA 3BQZA 3J7AY 3ZQFA 2CYYA 3AL0B 1T0FC 2DT7B 1JKRC 1ACIA 5M5WJ 2MW8A 1ODDA 3DBLB 1VQPI 2OUMA 4LK1F 3FMQA 2VT2A 3DPLC 3BG5A 5HLHA 4Q4ZF 2PMZN 4M3FA 4M6YA 2HTSA 4QTRA 3BG6A 3ECHA 3ROUA 3FHNA 2RDPA 2E1CA 1YRNA 2B9SA 4C2TA 3K4BA 4MTEA 3W3CA 2LY9A 3S14J 3C2GA 2ELKA 4ZYEA 2H27A 4F52A 3OIPA 5EGOB 4PZJA 3FXKA 5JI6A 2ZJQF 2VXZA 2ZC2A 1S3JA 5BS6A 1KQ0A 3PIPF 5J47A 1G3TA 5K1YA 2ID3A 3H35A 1Y0NA 3ZN0A 3CF2A 4HPQA 2KMUA 4FCYA 2R7XA 1AWCA 1IDYA 3E5QA 2NVYJ 4M74A 3GTPJ 1R5HA 3HSEA 2Z5UA 2QQ9A 4AIHA 3M4OJ 2CUZA 3HG9A 5KHDA 3WGIA 4CUGA 2E60A 3M9AA 2DA5A 3S3MA 3FWEA 1NK3P 2RGVA 2ZXWH 4S05A 4NB5A 3DLAA 2UWMA 2R7WA 2DN0A 3LFUA 2FA5A 1FEXA 2QGUA 4IRHA 1OYYA 1QRYA 2VIXA 3CP2A 3P9KA 2M7AA 3NARA 3V7CA 3W6KB 2DFEA 2HKXA 3I71A 3RYPA 1MMSA 5DM7F 3RZDJ 1MMNA 1IRGA 3GVAA 1TC3C 1XPXA 1DP7P 2EH3A 4PJMA 1TWHJ 3O6BB 1LKXA 2DA6A 2LH9A 2TRTA 2IA0A 2EZKA 4HNTA 2XIGA 4HF0A 4BBRJ 1BA5A 1VQ7I 3ZMUA 4ZYGA 4BQNA 1HW5A 1RZ4A 3BR6A 1MNDA 4IJAA 4DYQA 1B9MA 2D1VA 2AS5F 2L02A 2CW0F 4E7LA 3KX2A 3PNTA 4BE0A 1GVDA 2BBYA 3LSPA 4OU0A 3OSFA 2DTRA 3H3UA 3C18A 3JREA 1APLC 1I6XA 5D6FA 1TW3A 1QPMA 2AXLA 4GGGA 3ERED 4B43A 2DT6A 4EQQA 2GBYA 1USSA 2IW5A 3TEDA 1FOWA 2VKEA 2OF7A 5FO5A 4RBOA 4JX5A 4BUPA 2FBHA 4L0YB 4I0BA 5B1BH 1TWAJ 5FKLA 3JSOA 3GTMJ 3BTLA 3VPRA 3KYCB 3OR1C 5JVTA 3A4CA 3DEUA 2V9VA 2VJ4A 3DF8A 2Y69H 4H0EA 3V8KA 5DEQA 1SD7A 3HRSA 1BBYA 3RKWA 1UAAA 5L3DA 1W1WE 1VQMI 2X6YA 3DLLF 4GRIA 5JFRA 2XAGA 1H9GA 5J8CA 3OYLA 1E0EA 5JVGF 3WHCA 5K5QA 4BAYA 4ZYDA 2R7UA 1MBFA 4LLNA 3RQ4A 3CC7I 3Q9SA 2RNGA 2XGDA 4J19A 6PAXA 4V2GA 3VYSB 2KPMA 4D0PA 1HLVA 4RGUA 3HKZN 3Q5FA 4BXUA 5HLGA 2FSWA 4D5CA 1RNLA 1S72I 3V42A 3GTOJ 4BHBA 1TQIA 3OYCA 1Q1VA 2ZXHA 3MKYB 1IAWA 2DODA 1Z05A 1JKQC 3Q0UA 4PGGA 3G71I 1YRNB 4ZYHA 2M8EA 4ZZLA 3QOPA 3BTCA 5FFZA 3HOSA 3P7NA 1U9OA 3GFLA 4IXAA 1ZR4A 4FE4A 1WSUA 4UUVA 1BC8C 3Q0VA 1RKWA 5D4SA 3IRQA 1HOMA 5CQEA 5IYCJ 1GV2A 1XG1A 1GHCA 5J1YA 2LY1A 4UXNA 2DOEA 3CCYA 4IQ4A 4EJTA 3C3WA 3RPQA 3LL7A 4FE7A 4KJZA 2XAHA 3HPHA 5IP9J 2R7ZJ 2LMDA 4Y13A 4E7HA 1LE8A 3TO7A 3L2RA 4G94A 4D7MA 4C30A 3QPHA 2E2IJ 4QPOA 5F0CA 1DU6A 1ZARA 3ASOH 3JRGA 2PEXA 1V5EA 1IRZA 3AG4H 4BQOA 3G4SI 1T8IA 2P5KA 2H8RA 2D45A 5JR3A 4CSWA 1FPQA 4AUXA 1P7JA 5E8GA 2AQFA 1NK2P 1D0XA 2DYRH 1JHHA 4L9TA 4PJNA 4QWQA 1UMQA 1PVEA 1YS7A 2WB1A 4M3EA 4RB0A 1A35A 3CJQB 3CF5F 5GP9A 3QU6A 2DMQA 2W4SA 3C7JA 2CUFA 4N0BA 3K4LA 5A2QK 4P9FA 5CYVA 1E3HA 4I6ZA 1MJAA 1OYIA 5J40A 3OYGA 3KPHA 4EM0B 3DTKA 4M3BA 3OYIA 2EA2A 4DOZA 5L3EA 4EEFG 5IP6A 1X1PA 3ZMTA 3MZYA 3I4NJ 1LDKB 2QSGX 5IYDJ 3RPUD 3DBHB 3EQLF 4C2MJ 2E2JJ 2L5QA 3OIOA 4B09A 2XAJA 1YW7A 3GMEA 3W2VA 3CCRI 4A69C 4E7KA 3QP5A 2X6WA 1R1UA 4XN3A 4CXFA 4Y15A 3KP3A 1NH3A 2FBIA 3FDYA 3KYLA 3MAJA 2J5OA 3L00A 1MW7A 2DK5A 2KDZA 2VBYA 2ZMEC 1F4KA 1AHDP 3MQ0A 3IHUA 3GTKJ 5FB2A 4M6XA 2W00A 4ETSA 2P5LC 1VQKI 3TOBA 3PNYA 1XGNA 2ZSHB 1IN6A 4RGSA 4XLPF 1OJLA 2JA2A 3EUHC 1SFOJ 2XB0X 4O6JA 2LREA 1E3OC 3CCEI 4PSWA 5C44J 2XRNA 4HAMA 3F0CA 3I5UA 1LJ9A 4A3MJ 3ABUA 3HBLA 4X6AJ 4ZTJA 1KQ9A 3WU0A 2CFOA 3QOEA 1HSJA 4XLCA 3TP0A 3GW2A 5E3NA 5LBQA 2ZCWA 2Y0SN 4XICA 2PBIA 2WAQA 2DJIA 3I64A 1XN7A 1B72A 1G4DA 2CS3A 3EDPA 1SD6A 3FKJA 2CGPA 4U7DA 4LLLA 2LBFA 2R5YA 4UVCA 4XOPA 1JT0A 5F1JA 5JHFA 5L3BA 4L0ZB 2LLKA 2GA2A 3BR3A 1HA8A 2L7KA 2WV0A 1I1GA 2JT1A 1W5SA 2FNAA 4A3GJ 5HNFA 2MSYA 3BJOA 1DQUA 2P4WA 3CCSI 2K40A 2L9NA 1OMIA 4G6TB 3ASNH 3VSLA 3S8PA 2EJRA 3BWGA 2J5PA 2Q8KA 2A61A 3LSGA 2LC2A 3MMYB 2QKMB 4CDGA 5GAHJ 1ZQ3P 4XORA 5E18F 1UHMA 3FIWA 4H4KC 3ZCOA 1O3SA 2HKOA 2OZ6A 3K1NA 1S5LC 3K4NA 3VB2A 3HRMA 1Z67A 4HSTA 2ZJPF 2LYCA 3L9FA 1OKRA 3SDBA 2KLOA 2X4HA 4XBFA 4EJOA 1LE8B 3SZTA 4Y7NJ 2BHYA 2WAFA 3FXUA 5D5UB 2VUMJ 1B1BA 2QZ8A 2X1CA 5HLIA 2HNHA 3F8MA 5F0HA 2VPRA 4KISA 2HZTA 4C2UA 3GZNB 4M73A 2LOOA 3PNVA 4NQWB 3S16J 4AYBA 2UXXA 4I09A 2VKHA 3G6EI 4D1QA 1YX5A 3OS0A 4BKXA 4RAYA 4CCKA 3M1CA 4KFCA 1QVTA 2HQAA 3BLYA 1ZHFA 3CCVI 4C9YA 5IT9K 1OCRH 2JMWA 5DM6F 1WJEA 4Y33A 2E7XA 2EILH 3T0YA 3U1KA 3K4KA 3BP8A 4NUBA 1EKEA 3HIFA 5B5EC 3OYBA 5F64A 4G7HF 1VQLI 4E7IA 2H1LA 5TRDA 2HDDA 4A5MA 2ZFWA 1XSDA 4B47A 4Y17A 1OISA 1X58A 2O3FA 3S32A 1RETA 3J81K 2HEOA 2RKHA 4F3QA 4A3IJ 1FTZA 3RIRA 2A5YB 2V9PA 2QUFA 3FXLA 1WWXA 1EH6A 4I02A 5E17F 2K86A 2F6CA 3S2HJ 2IGMA 3KIOA 2DYSH 2GLOA 1QZZA 1T98A 3EYIA 2IS1A 2HOEA 2N8GA 1K6YA 2LG4A 4EJWA 5TJJA 4GFBA 1FMVA 3DEWA 1A04A 1QNTA 1UELB 2I10A 3CUQC 4P55A 1LFUP 1X2NA 3BR5A 1O3RA 3K6GA 1SFUA 1V54H 2P8TA 2R5ZA 2YU9J 3CLOA 2HQ5A 1VQ4I 1VQ6I 2V1NA 5F0FA 3CCMI 4L5IA 3WTXC 2HZDA 1SMYF 1R71A 2GIZA 2WAEA 2ME6A 1D1AA 4XL9A 2DA2A 3QYEA 5J3LA 2BXZA 3HDDA 3J80K 2DMUA 5M3FJ 1JTXA 3R61A 4MIMA 3HL2A 4PFPA 2DDAA 1Y1WJ 1Z7UA 2V1DA 2WC2A 1MH3A 4CCOA 2XVCA 2LRDA 5FRNA 2VE8A 2RC4A 2BE5F 2DFHA 2OQGA 3H3ZA 1LB2A 3M8FA 2B63J 1MIJA 4HNVA 5LGUA 1B72B 1LEAA 3VSKA 2NS7A 1H9TA 3VYTB 4UB6C 2M1BA 2YSRA 3L2VA 2LBFB 1T0FA 3QAHA 2R5YB 1MNEA 2V6CA 3JSPA 4OWRB 5KAIC 4BBSJ 2DCEA 3I0TA 1S7EA 3E6MA 2K4JA 4KDPA 1U0JA 2MLKA 2M34A 3HSFA 1R4MB 3JTHA 3TDUC 1V3FA 1FY7A 1UHSA 1C0WA 2X48A 4HW0A 4U0YA 1D1CA 2E34A 3L2CA 4OIPF 2ZXJA 2E1MC 2CU7A 2K9MA 2Z16A 4J00A 3HOWJ 1MDMA 3GX4X 3LA2A 1D0YA 2PMUA 1Y39A 3F3XA 4BNCA 2DW4A 2EIKH 3K7AJ 3F22A 2LFBA 4XKWA 4RAFA 3IH4A 5BOXA 1O57A 1QHHD 4A3EJ 3A0HC 2VE9A 4E7SA 1TT5B 3I59A 1T2KA 4G12A 3O8GA 2M9HA 1NTCA 1S7AA 2IJLA 2TDXA 3SZPA 3J7ZI 3IKTA 2EZLA 3KLNA 1FLIA 5KCMA 4MHGA 2K9LA 4E4HA 1VQOI 3FISA 3L09A 2EV0A 1FP1D 2ELJA 1IXRC 2NXNB 1R49A 4IHYA 2OAZA 4WXHA 5JLWA 5FFXA 4YIRX 1QVUA 1BI2A 4X1EA 2PFBA 2LD5A 4Y52J 1JGGA 1TT0A 3FMSA 3H5NA 4BJTA 2BOLA 2VC1A 1U3EM 2WA0A 2NVXJ 4WF2A 4ENNA 1HKSA 3BR2A 1DGRM 4UHTA 1O3QA 1X19A 4YFKF 1UG2A 1YIOA 4HSRA 5ICEA 4DGWB 5ICCA 2H8WA 1P92A 2KDOA 4X0GA 2K3FA 3I55I 2E5ZA 4BH9A 2LK2A 2P7CB 2DOAA 2MG4A 4A6DA 5C4JJ 4XSXF 3FZVA 3ZMVA 5D6EA 2LF7A 1FX7A 2K9NA 2QM3A 5FD5A 2F5VA 4P96A 1TWGJ 1K83J 4D7NA 2PLYA 2L2OA 2Y48A 1DGWY 3I4PA 4F7ZA 5GTIC 2DA7A 1PP7U 4KMUX 4A93J 3EUKL 3T1BA 3B6AA 3F9KA 2LDUA 2FOKA 2CQQA 5D4RA 1JTYA 1BOAA 3N97A 2Y75A 1L3LA 1Z3YA 1TZLA 3F72A 1MBGA 4IOCF 2R5ZB 1DU0A 2VQGA 5CVIA 3B73A 1B6AA 2L7ZA 3MZ8A 4N9IA 2V26A 5B1AH 3JTGA 4F55A 1GXPA 4Y4RA 3R6SA 1Z3XA 3TP3A 4QLCU 2HDWA 5J1RA 2GOXB 1Z1DA 1KQ8A 2F5FA 2NS8A 1W4MA 2WV1A 1V5FA 3FF5A 4OMZA 3TQNA 1XS9A 3U2RA 4M9SA 2M7BA 2XAFA 4ABZA 2IA2A 2V4JC 4CZZA 5EJCA 2KHMA 2R7QA 5FKOA 5HVQC 5B66C 3A02A 4HDUA 2RQPA 2HDCA 1ZK8A 3TL4X 4ENMA 5TISC 3OYMA 2HXOA 1XGMA 2O5RA 3PQKA 3KEQA 3G73A 1NG7A 1XX5A 3S15J 4JP0A 1O3TA 3TKYA 2ZBKA 2FX0A 3QP6A 5DD4A 2YR2A 4HG2A 2W84A 5EDNA 1EA3A 3QRFF 2DFFA 5FLMJ 2KIQA 4KT5C 2DTZA 4HQEA 2L3DA 4UV9A 2NRAC 1TLHB 3A0BC 2PMZA 1QO0D 4PSXA 2UV1A 5D5VB 4A0YA 4LIVA 1SFXA 1QZYA 2DPDA 1V4RA 2AO9A 4M9ZA 1MBHA 1BI3A 4F92B 4DW6A 2E19A 2E36A 2YPRA 2EFPA 4LLGF 1MDMB 1JXSA 4G6QA 3JAMZ 4B48A 4KN4X 3M3YJ 5ED4A 2MC4A 2VASA 3LNQA 3H0DA 3MKWB 4HDVA 3OOUA 4A3JJ 4JX6A 1FIPA 4RA2A 3HZJA 1LUJB 3GXOA 1EJ9A 3I59B 1ULYA 4LD5A 5E1XA 3S1QJ 2VI6A 3OL3A 3ZN1A 2XF5A 1HBXG 3GBGA 3SDGA 3KP2A 1OFCX 2K85A 1ETXA 2GAUA 1MMDA 1QGPA 2LTPA 1VTNC 2XC7A 3QQAA 1FNNA 4M71A 1IZ1A 4CCJA 5GTHC 5CQGA 2XGEA 4RLQA 5CVUA 3ZGKA 3S2DJ 2IS4A 2VN2A 3VFZA 5FKMA 3ULQB 2XV4S 4KYWA 2P6TA 3BJ6A 3FXQA 5HS8A 2RVCA 3CQZJ 2BY3A 2HPIA 1ON1A 5CVJA 5DS9A 2E2HJ 3K10A 4RGXA 1RUOA 4R8HA 2LSOA 3OL4A 1D5VA 3VYRB 2P81A 3L2UA 4ZDOA 4NC8A 1V55H 3T8RA 2VOOA 4IOAF 1KYWA 2NNYA 2CW8A 1ENHA 1XDSA 1K6OA 2DOFA 1SANA 1REPC 5HS9A 2STTA 1QHGA 1W5CC 2K27A 2MFZA 5L3GA 4OIQF 3OSGA 3D1NI 4HEA2 3HOXJ 1MMGA 2F48A 2A07F 1MSEC 5EEAA 2F4OB 3FHZA 1K79A 4II3A 2O8XA 5LHHA 2VJJA 4OOIA 1FBSA 1G3WA 2Y30A 5IPAA 1IF1A 1D3YA 4CCLA 1RI7A 3SQNA 4IHVA 4N4NB 2VC0A 5BPIA 3H0GJ 2UXNA 2M45A 1LFPA 4L9NA 2COMA 4CCMA 2ZMEA 3BCBA 2F5EA 3CLQA 3JRAA 1MZBA 2WADA 5E1WA 2ZFUA 1WJCA 1IO2A 1R1TA 1U9NA 1U8BA 2ME0A 2DK8A 1I3AA 2D2WA 3O8HA 3IAM2 3EUHA 1R9TJ 1R23A 1W0UA 1WJBA 2PMHA 2IVMA 3NRVA 1GLNA 2EPFA 1R22A 2ACJA 4BHPA 3CCQI 4BACA 3V8LA 2A6EF 2M8GX 3NEUA 3ZXSA 2Z99A 5BMZA 1IN8A 2OTJI 4PJLA 1RESA 4PJJA 2XSDC 2R7RA 5LRRA 1TQPA 2BXYA 4XLNF 4HA8A 3HKZA 4LFUA 2JJ7A 2RREA 3Q0WA 4KA4A 1HDDC 2W82A 4MO7A 4M9XA 1BOBA 1K7AA 3SFZA 3IRRA 1V5GA 2M4GA 3K69A 2HWVA 1WCMJ 2QENA 4IKFA 4XKVA 4IHWA 3DWLE 2M87A 1F9NA 1FWZA 1Q1HA 4GDFA 3RTRA 4M3GA 4LG3A 4BE2A 2CV1A 1YW9A 1B59A 1D8JA 1BI1A 3D5RC 4U0VA 1BM9A 3AKZA 3GTQJ 1MBEA 3KCCA 2QLZA 2FMLA 3LOCA 4MFDA 2L7MP 3RPUA 3CMAI 2BHZA 3AG1H 3NQOA 2GM4A 2EB7A 4IRGA 5E1ZB 3IKVA 2JA8J 3CD6I 3BTIA 2BVLA 2DA1A 5E79C 2ISYA 4NQWA 4AC0A 3CDLA 4BY1J 5CKTA 1RPWA 1WZ2A 3IH2A 4JQFA 3QWLA 1FMWA 4RMNA 4U0WA 2E5NA 2Y0MA 4AIDA 2O8KA 1FC3A 5J4VA 1I27A 2LF8A 4A3CJ 1ETOA 5M5YJ 3W6VA 3ZR8X 3FXJA 3TMOA 3OYKA 1ZRCA 2FMYA 2ICWG 2X0LA 4G6DA 4CO8A 2WY8Q 1XMAA 3MZHA 1IRXA 2OC6A 3B02A 3LFKA 1J09A 1XB4A 1QQIA 3BZCA 3PFIA 2QA4I 4V19K 4EVIA 1MBKA 2QBYA 3K70D 1T95A 3TO6A 5KNLA 4LITA 1F1ZA 3BCAA 2WWYA 4U87A 2HFHA 4B4CA 1UHWA 4IHTA 2DJNA 2G9WA 2QQAA 4HX8A 3CMEI 1JUSA 2EWNA 3M07A 1YFHA 2ZKZA 3CC4I 3CO7C 2CUEA 1F5TA 2R7TA 5E3MA 2BY2A 2VONA 3PFYA 5HNHA 1ETYA 1P6RA 4EATA 4CYCA 4I2OA 3PSFA 2UZKA 3RQIA 3MFKA 3K4MA 1MKMA 2VQCA 3QU3A 3IWZA 2P6SA 1Y6IA 2A3SA 2IGNA 1FYKA 2K02A 1JJ8C 5ICGA 2E35A 4IF4A 4UUSA 3HJEA 5IOYA 1ZR2A 2Z33A 2GA1A 2ZMEB 4N4OB 4KMFA 1FTTA 4Z2YA 4KIFA 3CDIA 2V79A 2MH2A 3IP4B 3EYYA 3G1MA 3H5RA 1T38A 2IAIA 4RB1A 1XSXA 3BG3A 3GFMA 5FLXZ 3H92A 3HUGB 1XSVA 4L5EA 4DYCA 4ZJZA 4BDYA 1U8RA 4PUSA 3NWTA 1ZLJA 4MNUA 2O6GE 2X1EA 4EMSA 4I98B 2HS5A 2RN7A 1B4AA 1HC8A 1G59A 5HDKA 1FOKA 1KYZA 1JT6A 3H9GA 3V4GA 3E6BA 1YLFA 3PO3J 3ZMZA 2Z2SB 2JSCA 3MKZA 2F5DA 2Y0SA 5FKNA 4ESFA 2EINH 2IXSA 3J7AO 4IX7A 3KEYA 3E5UA 2M30A 4OINF 1A5JA 2VB6A 3ECOA 3BC8A 2R92J 3K70C 2L9SA 4IVNA 3Q9VA 4WXDA 4RAZA 3KP4A 3V8JA 1DPUA 1I39A 3IV5A 5K7ZA 3GTLJ 2R7SA 2XKPA 4WCGA 1BL0A 2CSOA 2K7LA 2DQLA 2M4KA 1OYWA 4I01A 2JA7J 1Z21A 3GZ6A 3HOYJ 1WGXA 1WJDA 4F93B 5LGNA 2KT0A 1J75A 3OYNA 2VBZA 1L0OC 4G9YA 4HLYA 2HOAA 1Z6RA 3COAC 4HX4A 1ZN2A 2VBXA 2P5VA 2H1KA 1H8AC 1BJZA 4PCQA 2EZHA 1BC7C 1HW2A 5IYBJ 1K78A 2E1NA 1Y56A 3RKYA 2L4AA 3LAJA 2M0CA 2B7EA 3ZQ7A 2WTEA 3WTYC 1XC5A 2R3SA 3SEZA 1J2XA 1FYLA 2CQXA 2R7OA 1KU2A 1STZA 2DMPA 4XSZF 3EUAA 2C6YA 1X3ZB 3D5LA 5HODA 1RR8C 2JQ7A 3HB9A 1U5TC 2Z1DA 3OIQA 4IQJA 2KP6A 1YJ9I 1BW6A 3BR1A 4IHXA 1IJWC 2MYSA 2ZJRF 3CCLI 3G1LA 3LSJA 3CZ6A 3BPXA 4ASNA 2RNJA 5FLVA 2EFNA 2G0EA 2QBYB 4HX7A 1AKHA 1FSEA 3BJAA 3M7GA 2K3PA 4NDLA 1YTYA 4LG0A 5LHGA 3BTJA 4CICA 4AU7A 3VDXA 1MJBA 2CUJA 2XAQA 1OQYA 1R58A 2H6CA 3JRBA 1USTA 2OZUA 3KP6A 4HOBA 1TWFJ 2HYGD 3MN2A 1Z7LA 5DUIA 2DU9A 2H94A 1MBJA 5DYMA 1U6GA 2DAOA 3ISPA 3LSKA 3P5JA 3R0JA 4CHUA 2VT3A 1XTAA 2QSHX 4CYCB 1JHFA 5E3LA 2OCCH 3ELKA 3AAFA 2JN6A 2QEXI 3WTUC 1I5ZA 1LDDA 4L9VA 1Z0XA 1SEUA 5BNGA 2JRTA 2PG4A 4KITB 2XGCA 5GAEJ 3M1EA 1ZGWA 1XCBA 2EV5A 3LAPA 3ERMA 4KNYA 2B0LA 4UUSB 2LR8A 3ZQGA 2L4MA 2EK5A 1TNSA 3CUQB 4J01A 3E3VA 2ZO4A 3IAS2 1P2FA 3CESA 3HTSB 3NWSA 3OYJA 1G2HA 4XIDA 3GFJA 4QSHA 4ESBA 1JE8A 5H6QA 3OS2A 2FRHA 3LSIA 4A5NA 2BYVE 1TBXA 3WTTC 1R4NB 3W2AA 3JR9A 1W7PD 5KAFC 5FRMA 1P4AA 1XMKA 5DCFA 3WGGA 2RV8A 4P9UA 2ETHA 1K4TA 3G2BA 1MMAA 2D5VA 1ETKA 1NHAA 3K2AA 4HQMA 1WJ5A 3HEFA 4I99C 3HM5A 2CV2A 3RJPA
chains in the Genus database with same CATH topology
2XGDA 4J19A 4V2GA 2FX0A 1HLVA 1D5YA 2Y9YA 3HKZN 1Z77A 1GT0C 4D5CA 5EDNA 2LKXA 3GTOJ 2JK3A 5FLMJ 1Q1VA 2DTZA 1JKQC 3Q0UA 1YRNB 3UKGA 2DA4A 2K9SA 5GPAA 1F36A 4JYKA 2E1OA 5JLXA 3HGYA 3BTCA 3FK7A 3JRFA 4C3JJ 1JJ6C 2AO9A 1MBHA 1FJLA 1U9OA 3E7LA 1ZR4A 2EZIA 2E19A 4DW6A 4FE4A 1GDTA 1IG7A 1I3QJ 3Q0VA 1RKWA 1HOMA 5IYCJ 3QPLA 1GV2A 1XG1A 5F08A 3S17J 4BXXJ 3M3YJ 5J1YA 2L0KA 4DYRA 3CCYA 5K7FA 3LNQA 3DCFA 2COBA 4FE7A 2JWTA 2OPTA 3OOUA 5IP9J 4A3JJ 1LE8A 4JX6A 2R7ZJ 1FIPA 3QPSA 4D7MA 4XK4A 1K61A 3FK6A 2E2IJ 5F0CA 1DU6A 1A6IA 1JKOC 3S1QJ 2VI6A 4AYBN 3JRGA 1IRZA 3CMYA 3GBGA 3SDGA 2HOSA 3ZQIA 1VFCA 1OFCX 4MLOA 1IUFA 2XB5A 1ETXA 2H8RA 2NVTJ 5K7HA 4DZPA 2LTPA 3QQAA 4AUXA 3WHBA 2M2EA 4A3DJ 1P7JA 5EG0A 1NK2P 2JA6J 2AHQA 5E3OA 1U78A 1UMQA 2X9DA 2XGEA 4M3EA 4FISA 3MVPA 5GP9A 3S2DJ 2DMQA 5FKMA 3S1RJ 2CUFA 1HF0A 2ID6A 4IEJA 2FD5A 2L7FP 1T33A 3CQZJ 4I6ZA 3BR0A 5DS9A 2E2HJ 1AKHB 4M3BA 2P81A 4EEFG 5IP6A 1O4XA 1AU7A 3TW7A 1MNMC 3I4NJ 1ENHA 5DTDA 5EZGA 5EF6A 2ZB9A 1JUPA 1SANA 5IYDJ 4M6VA 3OSGA 4C2MJ 2E2JJ 3FKIJ 3D1NI 1IDZA 3OIOA 3HOXJ 1MSEC 5EEAA 4A69C 5IOZA 4BY7J 2HOTA 2IEKA 2Y30A 5IPAA 1HDPA 2EQRA 2KDZA 4IHVA 1AHDP 3H0GJ 2TCTA 3GTKJ 5FKKA 2K9QA 2DMTA 1WI3A 2HI3A 1WPKA 3JRAA 3JRCA 1POGA 1OCPA 1ETWA 1U9NA 4UUTA 1OJLA 1U8BA 2ME0A 3A01A 1SFOJ 2XB0X 1E3OC 3NAUA 1VI0A 1ETQA 1I6HJ 1ITYA 3O8HA 5C44J 3ZQCA 5M5XJ 3F0CA 3LSRA 4A3MJ 1R9TJ 1W0UA 1W0TA 1HCRA 3RKQA 3HBLA 2HYJA 4X6AJ 3TP0A 1CQTA 5E3NA 2Y0SN 4XICA 2M8GX 5J1UA 1B72A 3BQYA 1VF9A 2R5YA 2QF7A 5FJ8J 1RESA 1JT0A 2XSDC 5F1JA 2DA3A 4XRMA 2LLKA 3BR3A 1H88C 3S1NJ 2JJ7A 1HDDC 3Q0WA 4A3GJ 4MO7A 2HXIA 2MSYA 3ZQLA 4V2FA 3A03A 5C4XJ 2K40A 1WCMJ 3RZOJ 3BG9A 3I4MJ 4IHWA 3ZQHA 5F27A 4QIWN 4B3AA 3HOZJ 4M3GA 5EGOA 3LSGA 3HOUJ 1ZQ3P 2DMNA 3FIWA 3GTQJ 1MBEA 1GV5A 3LOCA 5EYRA 3TW6A 4RDUA 4MFDA 3G1OA 2L7MP 2R93J 2EBIA 1BW5A 1LE8B 2GM4A 4IHYA 4A3LJ 2RAEA 2VUMJ 4Y7NJ 2JA8J 2FJ1A 1IGNA 3BTIA 2YUSA 2DA1A 4AC0A 1P7IA 1TWCJ 3CDLA 4BY1J 4MFEA 5F0HA 2VPRA 1RPWA 4XRSG 3IH2A 1T56A 3S16J 2O8KA 4A3CJ 2XRLA 4BKXA 4LOCA 1ETOA 5M5YJ 3W6VA 2R0QC 5EG0B 1QVTA 2XPVA 1PUFA 1IC8A 3S1MJ 4M3DA 1VNDA 2JMWA 1ORKA 2NVQJ 3HGGA 1MBKA 2HDDA 1LFBA 1X58A 9ANTA 1RETA 2XPUA 1GUUA 4A3IJ 2ECCA 1FTZA 4XRSA 4B4CA 2DJNA 4A3FJ 1JUSA 3PM1A 2W48A 4W1UA 4C3IJ 2CUEA 5E3MA 1H89C 3S2HJ 3MKLA 1WH7A 4DZJA 1ETYA 2NOGA 4CYCA 2GLOA 1JUMA 3RQIA 2N8GA 4S0HB 3JRHA 4GFBA 1EF4A 3DEWA 2I10A 1LFUP 1JJ8C 1Y1VJ 1X2NA 3BR5A 2R5ZA 4UUSA 2YU9J 3PO2J 4B1RA 5IOYA 1ZR2A 2HQ5A 1FTTA 5F0FA 3HM5A 3B6CA 3G1MA 1X2MA 3IH3A 3A01B 2IAIA 2ME6A 2Y31A 2DA2A 3BG3A 5J3LA 4DYCA 4L5EA 3HDDA 2DMUA 5M3FJ 1JTXA 4MIMA 2L9RA 5C3EJ 1IV6A 1ETVA 3C2BA 5M3MJ 1Y1WJ 1MH3A 5F04A 3BQZA 1MSFC 2B63J 3ZQFA 1JT6A 4HNVA 1JKRC 1B72B 1B8IA 3PO3J 4I76A 5FKNA 2NS7A 5M5WJ 2MW8A 2JA5J 3H3VK 2R5YB 4D5FA 3BG5A 2CRGA 2PMZN 4M3FA 1A5JA 4BBSJ 4QTRA 1S7EA 4JX4A 1YRNA 2R92J 2M34A 2FQ4A 2LY9A 3S14J 2ELKA 1UHSA 2X48A 3IV5A 5K7ZA 3GTLJ 2QCOA 3Q3SA 5EGOB 2IBDA 1BL0A 3GTJJ 2CU7A 2JA7J 3HOYJ 1WGXA 3JRIA 3HOWJ 2O9LA 1OCTC 2KT0A 2YS9A 2ID3A 3K7AJ 2HOAA 2LFBA 2MGQA 4FCYA 3ZOBA 3BT9A 3IH4A 2LVSA 2O7OA 5EZHA 4A3EJ 2H1KA 1IDYA 1H8AC 5GPCA 1BJZA 2NVYJ 3GTPJ 2EZHA 1FIAA 5IYBJ 4G12A 3M4OJ 3O8GA 2M9HA 1I50J 1NTCA 4A3KJ 1F43A 2DA5A 2EZLA 2M0CA 3GTGJ 1NK3P 1XC5A 3FISA 2CQXA 2DN0A 2WB1N 2ECBA 1QPIA 5IP7J 1FEXA 2DMPA 5HODA 1QRYA 3SFIA 1PUFB 2XPWA 3HB9A 3NARA 5JLWA 1BW6A 1QVUA 3BR1A 4X1EA 4IHXA 2LD5A 4Y52J 1IJWC 1JGGA 3G1LA 3RZDJ 3LSJA 4C3HJ 3SJMA 5FLVA 1TC3C 2G0EA 2EH3A 2NVXJ 1AKHA 4NDLA 3BR2A 1RKTA 1TWHJ 1UG2A 3BTJA 3L1PA 4FTHA 3JRDA 2DA6A 2TRTA 2LK2A 2MG4A 5C4JJ 2EZKA 3JRBA 4BBRJ 1BA5A 1TWFJ 3MN2A 2K9NA 1TWGJ 1MBJA 1K83J 1WH5A 4D7NA 3BR6A 4CYCB 4DYQA 2DA7A 5E3LA 4A93J 2JN6A 1ZKGA 3B6AA 4W97A 1Z0XA 2CQQA 5BNGA 1GVDA 1JTYA 1MH4A 3LSPA 2XGCA 3OSFA 1ZGWA 3JREA 1APLC 1MBGA 2R5ZB 1DU0A 4UUSB 2LR8A 3ZQGA 2GBYA 3TEDA 2VKEA 2L7ZA 2OF7A 4RBOA 3TP3A 4JX5A 1G2HA 5J1RA 4XIDA 2VKVA 2NS8A 2WV1A 1TWAJ 5FKLA 4QSHA 1ZTRA 3GTMJ 3BTLA 1XS9A 3VPRA 3HOVJ 2Y9ZA 2Y2ZA 4ABZA 1JKPC 2LP0A 3JR9A 5FKOA 3A02A 2WAQN 1ZK8A 1RR7A 2HXOA 2X6OA 2CJJA 3WHCA 2D5VA 1ETKA 3K2AA 1MBFA 3S15J 1B8IB 4A3BJ 3HEFA 4JP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGD A;  4J19 A;  4V2G A;  2FX0 A;  1HLV A;  1D5Y A;  2Y9Y A;  3HKZ N;  1Z77 A;  1GT0 C;  4D5C A;  5EDN A;  2LKX A;  3GTO J;  2JK3 A;  5FLM J;  1Q1V A;  2DTZ A;  1JKQ C;  3Q0U A;  1YRN B;  3UKG A;  2DA4 A;  2K9S A;  5GPA A;  1F36 A;  4JYK A;  2E1O A;  5JLX A;  3HGY A;  3BTC A;  3FK7 A;  3JRF A;  4C3J J;  1JJ6 C;  2AO9 A;  1MBH A;  1FJL A;  1U9O A;  3E7L A;  1ZR4 A;  2EZI A;  2E19 A;  4DW6 A;  4FE4 A;  1GDT A;  1IG7 A;  1I3Q J;  3Q0V A;  1RKW A;  1HOM A;  5IYC J;  3QPL A;  1GV2 A;  1XG1 A;  5F08 A;  3S17 J;  4BXX J;  3M3Y J;  5J1Y A;  2L0K A;  4DYR A;  3CCY A;  5K7F A;  3LNQ A;  3DCF A;  2COB A;  4FE7 A;  2JWT A;  2OPT A;  3OOU A;  5IP9 J;  4A3J J;  1LE8 A;  4JX6 A;  2R7Z J;  1FIP A;  3QPS A;  4D7M A;  4XK4 A;  1K61 A;  3FK6 A;  2E2I J;  5F0C A;  1DU6 A;  1A6I A;  1JKO C;  3S1Q J;  2VI6 A;  4AYB N;  3JRG A;  1IRZ A;  3CMY A;  3GBG A;  3SDG A;  2HOS A;  3ZQI A;  1VFC A;  1OFC X;  4MLO A;  1IUF A;  2XB5 A;  1ETX A;  2H8R A;  2NVT J;  5K7H A;  4DZP A;  2LTP A;  3QQA A;  4AUX A;  3WHB A;  2M2E A;  4A3D J;  1P7J A;  5EG0 A;  1NK2 P;  2JA6 J;  2AHQ A;  5E3O A;  1U78 A;  1UMQ A;  2X9D A;  2XGE A;  4M3E A;  4FIS A;  3MVP A;  5GP9 A;  3S2D J;  2DMQ A;  5FKM A;  3S1R J;  2CUF A;  1HF0 A;  2ID6 A;  4IEJ A;  2FD5 A;  2L7F P;  1T33 A;  3CQZ J;  4I6Z A;  3BR0 A;  5DS9 A;  2E2H J;  1AKH B;  4M3B A;  2P81 A;  4EEF G;  5IP6 A;  1O4X A;  1AU7 A;  3TW7 A;  1MNM C;  3I4N J;  1ENH A;  5DTD A;  5EZG A;  5EF6 A;  2ZB9 A;  1JUP A;  1SAN A;  5IYD J;  4M6V A;  3OSG A;  4C2M J;  2E2J J;  3FKI J;  3D1N I;  1IDZ A;  3OIO A;  3HOX J;  1MSE C;  5EEA A;  4A69 C;  5IOZ A;  4BY7 J;  2HOT A;  2IEK A;  2Y30 A;  5IPA A;  1HDP A;  2EQR A;  2KDZ A;  4IHV A;  1AHD P;  3H0G J;  2TCT A;  3GTK J;  5FKK A;  2K9Q A;  2DMT A;  1WI3 A;  2HI3 A;  1WPK A;  3JRA A;  3JRC A;  1POG A;  1OCP A;  1ETW A;  1U9N A;  4UUT A;  1OJL A;  1U8B A;  2ME0 A;  3A01 A;  1SFO J;  2XB0 X;  1E3O C;  3NAU A;  1VI0 A;  1ETQ A;  1I6H J;  1ITY A;  3O8H A;  5C44 J;  3ZQC A;  5M5X J;  3F0C A;  3LSR A;  4A3M J;  1R9T J;  1W0U A;  1W0T A;  1HCR A;  3RKQ A;  3HBL A;  2HYJ A;  4X6A J;  3TP0 A;  1CQT A;  5E3N A;  2Y0S N;  4XIC A;  2M8G X;  5J1U A;  1B72 A;  3BQY A;  1VF9 A;  2R5Y A;  2QF7 A;  5FJ8 J;  1RES A;  1JT0 A;  2XSD C;  5F1J A;  2DA3 A;  4XRM A;  2LLK A;  3BR3 A;  1H88 C;  3S1N J;  2JJ7 A;  1HDD C;  3Q0W A;  4A3G J;  4MO7 A;  2HXI A;  2MSY A;  3ZQL A;  4V2F A;  3A03 A;  5C4X J;  2K40 A;  1WCM J;  3RZO J;  3BG9 A;  3I4M J;  4IHW A;  3ZQH A;  5F27 A;  4QIW N;  4B3A A;  3HOZ J;  4M3G A;  5EGO A;  3LSG A;  3HOU J;  1ZQ3 P;  2DMN A;  3FIW A;  3GTQ J;  1MBE A;  1GV5 A;  3LOC A;  5EYR A;  3TW6 A;  4RDU A;  4MFD A;  3G1O A;  2L7M P;  2R93 J;  2EBI A;  1BW5 A;  1LE8 B;  2GM4 A;  4IHY A;  4A3L J;  2RAE A;  2VUM J;  4Y7N J;  2JA8 J;  2FJ1 A;  1IGN A;  3BTI A;  2YUS A;  2DA1 A;  4AC0 A;  1P7I A;  1TWC J;  3CDL A;  4BY1 J;  4MFE A;  5F0H A;  2VPR A;  1RPW A;  4XRS G;  3IH2 A;  1T56 A;  3S16 J;  2O8K A;  4A3C J;  2XRL A;  4BKX A;  4LOC A;  1ETO A;  5M5Y J;  3W6V A;  2R0Q C;  5EG0 B;  1QVT A;  2XPV A;  1PUF A;  1IC8 A;  3S1M J;  4M3D A;  1VND A;  2JMW A;  1ORK A;  2NVQ J;  3HGG A;  1MBK A;  2HDD A;  1LFB A;  1X58 A;  9ANT A;  1RET A;  2XPU A;  1GUU A;  4A3I J;  2ECC A;  1FTZ A;  4XRS A;  4B4C A;  2DJN A;  4A3F J;  1JUS A;  3PM1 A;  2W48 A;  4W1U A;  4C3I J;  2CUE A;  5E3M A;  1H89 C;  3S2H J;  3MKL A;  1WH7 A;  4DZJ A;  1ETY A;  2NOG A;  4CYC A;  2GLO A;  1JUM A;  3RQI A;  2N8G A;  4S0H B;  3JRH A;  4GFB A;  1EF4 A;  3DEW A;  2I10 A;  1LFU P;  1JJ8 C;  1Y1V J;  1X2N A;  3BR5 A;  2R5Z A;  4UUS A;  2YU9 J;  3PO2 J;  4B1R A;  5IOY A;  1ZR2 A;  2HQ5 A;  1FTT A;  5F0F A;  3HM5 A;  3B6C A;  3G1M A;  1X2M A;  3IH3 A;  3A01 B;  2IAI A;  2ME6 A;  2Y31 A;  2DA2 A;  3BG3 A;  5J3L A;  4DYC A;  4L5E A;  3HDD A;  2DMU A;  5M3F J;  1JTX A;  4MIM A;  2L9R A;  5C3E J;  1IV6 A;  1ETV A;  3C2B A;  5M3M J;  1Y1W J;  1MH3 A;  5F04 A;  3BQZ A;  1MSF C;  2B63 J;  3ZQF A;  1JT6 A;  4HNV A;  1JKR C;  1B72 B;  1B8I A;  3PO3 J;  4I76 A;  5FKN A;  2NS7 A;  5M5W J;  2MW8 A;  2JA5 J;  3H3V K;  2R5Y B;  4D5F A;  3BG5 A;  2CRG A;  2PMZ N;  4M3F A;  1A5J A;  4BBS J;  4QTR A;  1S7E A;  4JX4 A;  1YRN A;  2R92 J;  2M34 A;  2FQ4 A;  2LY9 A;  3S14 J;  2ELK A;  1UHS A;  2X48 A;  3IV5 A;  5K7Z A;  3GTL J;  2QCO A;  3Q3S A;  5EGO B;  2IBD A;  1BL0 A;  3GTJ J;  2CU7 A;  2JA7 J;  3HOY J;  1WGX A;  3JRI A;  3HOW J;  2O9L A;  1OCT C;  2KT0 A;  2YS9 A;  2ID3 A;  3K7A J;  2HOA A;  2LFB A;  2MGQ A;  4FCY A;  3ZOB A;  3BT9 A;  3IH4 A;  2LVS A;  2O7O A;  5EZH A;  4A3E J;  2H1K A;  1IDY A;  1H8A C;  5GPC A;  1BJZ A;  2NVY J;  3GTP J;  2EZH A;  1FIA A;  5IYB J;  4G12 A;  3M4O J;  3O8G A;  2M9H A;  1I50 J;  1NTC A;  4A3K J;  1F43 A;  2DA5 A;  2EZL A;  2M0C A;  3GTG J;  1NK3 P;  1XC5 A;  3FIS A;  2CQX A;  2DN0 A;  2WB1 N;  2ECB A;  1QPI A;  5IP7 J;  1FEX A;  2DMP A;  5HOD A;  1QRY A;  3SFI A;  1PUF B;  2XPW A;  3HB9 A;  3NAR A;  5JLW A;  1BW6 A;  1QVU A;  3BR1 A;  4X1E A;  4IHX A;  2LD5 A;  4Y52 J;  1IJW C;  1JGG A;  3G1L A;  3RZD J;  3LSJ A;  4C3H J;  3SJM A;  5FLV A;  1TC3 C;  2G0E A;  2EH3 A;  2NVX J;  1AKH A;  4NDL A;  3BR2 A;  1RKT A;  1TWH J;  1UG2 A;  3BTJ A;  3L1P A;  4FTH A;  3JRD A;  2DA6 A;  2TRT A;  2LK2 A;  2MG4 A;  5C4J J;  2EZK A;  3JRB A;  4BBR J;  1BA5 A;  1TWF J;  3MN2 A;  2K9N A;  1TWG J;  1MBJ A;  1K83 J;  1WH5 A;  4D7N A;  3BR6 A;  4CYC B;  4DYQ A;  2DA7 A;  5E3L A;  4A93 J;  2JN6 A;  1ZKG A;  3B6A A;  4W97 A;  1Z0X A;  2CQQ A;  5BNG A;  1GVD A;  1JTY A;  1MH4 A;  3LSP A;  2XGC A;  3OSF A;  1ZGW A;  3JRE A;  1APL C;  1MBG A;  2R5Z B;  1DU0 A;  4UUS B;  2LR8 A;  3ZQG A;  2GBY A;  3TED A;  2VKE A;  2L7Z A;  2OF7 A;  4RBO A;  3TP3 A;  4JX5 A;  1G2H A;  5J1R A;  4XID A;  2VKV A;  2NS8 A;  2WV1 A;  1TWA J;  5FKL A;  4QSH A;  1ZTR A;  3GTM J;  3BTL A;  1XS9 A;  3VPR A;  3HOV J;  2Y9Z A;  2Y2Z A;  4ABZ A;  1JKP C;  2LP0 A;  3JR9 A;  5FKO A;  3A02 A;  2WAQ N;  1ZK8 A;  1RR7 A;  2HXO A;  2X6O A;  2CJJ A;  3WHC A;  2D5V A;  1ETK A;  3K2A A;  1MBF A;  3S15 J;  1B8I B;  4A3B J;  3HEF A;  4JP0 A; 
#chains in the Genus database with same CATH topology
 2O0Y A;  3MEX A;  1Z77 A;  1GT0 C;  4I7H A;  3SYT A;  3SZG A;  2JK3 A;  2RQQ A;  2XAU A;  3PUB A;  5LRS A;  3H9J A;  1OCO H;  2DQR A;  5H6R A;  3UKG A;  2VJI A;  2I5U A;  5GPA A;  1F36 A;  1SD5 A;  4JYK A;  1T08 B;  3L2W A;  3BDD A;  3HGY A;  1YW8 A;  3FK7 A;  2LKS A;  1JJ6 C;  2FEZ A;  1FJL A;  3AFH A;  2GXG A;  2HPM A;  4LMY A;  2XF7 A;  4CYD A;  1I3Q J;  1AOY A;  1BI0 A;  2OU2 A;  2AQE A;  1HQC A;  1BJA A;  4BXX J;  5F08 A;  2E1M B;  2PX9 A;  5F6F A;  2L0K A;  4HZF A;  4L9J A;  5K7F A;  2COB A;  3OYH A;  2JWT A;  1RIO H;  3M8E A;  1IW7 F;  4MQV A;  2DFI A;  4OAZ A;  1YQA A;  1LPQ A;  4XK4 A;  1S6L A;  2VPL A;  1K78 B;  3CMY A;  3S3O A;  3SXY A;  4I0A A;  1FBQ A;  1DDN A;  3R4K A;  4KIG A;  2V1U A;  2XKO A;  3ZQI A;  1VFC A;  4MLO A;  3GF2 A;  1IUF A;  2DDB A;  1ZLK A;  5EEG A;  3VWB A;  2KZV A;  2FF4 A;  4WXC A;  3UR3 C;  2M2E A;  3L7W A;  3R0A A;  1O7F A;  5EG0 A;  3DKY A;  2JA6 J;  3KE2 A;  4CA0 A;  5E3O A;  4BQA A;  1KU3 A;  2GZW A;  3WGH A;  2NOJ B;  5FD6 A;  1G3S A;  5LEK A;  4FIS A;  1AA7 A;  2HQR A;  3LSM A;  4XNF A;  3ZRG A;  3KZZ A;  1FYM A;  2ID6 A;  2FD5 A;  5JHU A;  2OA4 A;  1LNW A;  2L7F P;  1T33 A;  2X1D A;  5KK1 A;  3BR0 A;  3WTW C;  1W36 D;  1AKH B;  2K5C A;  1FBU A;  4ZTF A;  4U7B A;  1TL8 A;  1LQ1 A;  2DI3 A;  4LG0 B;  3H5A A;  1X4P A;  4RS8 A;  1CGP A;  4A0X A;  3OS1 A;  4JOM A;  3V7R A;  1O4X A;  3TW7 A;  4EM1 A;  1MNM C;  2EFW A;  1PUE E;  5ERI A;  3E5X A;  4OIR F;  1KZH A;  1P4X A;  2ZB9 A;  3A1Y A;  1X1A A;  2EV6 A;  3R60 A;  4II2 A;  4HRI A;  3FBN B;  1XMX A;  3DTI A;  3FKI J;  1ZGA A;  2F4I A;  4E7J A;  5DCM A;  3PIO F;  2IRF G;  4BY7 J;  1G3Y A;  2MD0 A;  3F8C A;  2HU9 A;  2VQL A;  4TV7 A;  2JTV A;  2XSJ C;  1CF7 B;  2EQR A;  3I3L A;  4L18 B;  2ZNZ A;  2TCT A;  5H20 A;  3CUO A;  2K9Q A;  1RUN A;  2ZJ2 A;  3LQR A;  2BZT A;  1ZEL A;  2DMT A;  2Q1Z B;  2XDV A;  2LNB A;  1HST A;  4WWC A;  4JK1 X;  4O5V A;  2UUZ A;  1R6R A;  5A2Q Z;  1OCP A;  2O61 A;  3M8J A;  4E6K G;  1R00 A;  1Y0U A;  4UUT A;  2L9V A;  2XAS A;  3DPU A;  4HF1 A;  3HSR A;  2Q2E B;  4YII A;  1IUY A;  5CJ9 A;  2DLL A;  4FX4 A;  1VI0 A;  4D9J A;  2DXI A;  1ETQ A;  4XQF A;  2XUB A;  2ZNY A;  4RM3 A;  3ZMS A;  4UNO A;  2GOM A;  1W0T A;  1X3U A;  3RKQ A;  3AL0 C;  2HYJ A;  2FOW A;  3QYF A;  5ILV A;  3DBR B;  4WK8 F;  1E2X A;  3IUO A;  1CQT A;  5HS7 A;  2A5W A;  4BJ6 C;  1I1S A;  1G6N A;  1R36 A;  1SMT A;  2CQN A;  4F91 B;  2BEO A;  3BQY A;  1UJ8 A;  1YJN I;  1IXS B;  2HQN A;  1PJR A;  1IV8 A;  2QF7 A;  5CVR A;  2PJP A;  4AVP A;  1Z9C A;  2F2E A;  4XRM A;  3F23 A;  3CJR B;  2EA4 A;  2NS0 A;  4RM2 A;  3WTZ A;  3S1N J;  2JSP A;  4UV8 A;  2BGC A;  1J59 A;  2M0M A;  1ZAO A;  1W36 C;  4P1W A;  1N25 A;  2HXI A;  1R1V A;  4KN7 X;  4Z6Y A;  5C4X J;  1ONV A;  3WE3 A;  4G7Z F;  3RZO J;  3BG9 A;  3I4M J;  5F27 A;  4QIW N;  4B3A A;  3VEP A;  4UVB A;  2FUG 2;  3DPT A;  4PK4 A;  2A68 F;  2QQB A;  5BQT A;  2X85 A;  4Q5S F;  1GV5 A;  3A2K A;  5LHI A;  5EYR A;  1E3P A;  2HVQ A;  3QYB A;  3TW6 A;  3DFG A;  4RDU A;  1XGS A;  1FOY A;  3G1O A;  4AWX B;  2R93 J;  2EBI A;  3DTE A;  1BW5 A;  4R1H A;  1E17 A;  1HXD A;  3OV8 A;  3CCJ I;  2RAE A;  3ABL H;  2FJ1 A;  1IGN A;  4Q48 A;  5D8K B;  4BL0 B;  5KVR A;  3I9V 2;  2VJ5 A;  1X1B A;  4PFO A;  4A6E A;  4O3M A;  1OR7 C;  2R7F A;  2VQH A;  4N9H A;  3WG7 H;  3DQV C;  4LOC A;  4XMY A;  5EG0 B;  1IN5 A;  2YX7 A;  4GYI A;  2XPV A;  1PUF A;  1IC8 A;  2IGK A;  5F1R A;  4M3D A;  1VND A;  1U2W A;  1X4O A;  3FX3 A;  3OOP A;  4EV0 A;  1VQ8 I;  1QA6 A;  3PUF A;  2MA3 A;  4YIF A;  4ZYA A;  1LEB A;  4XON A;  4FAS D;  4ZC3 A;  3KP5 A;  5GAG J;  3KP7 A;  3U9G A;  1EH7 A;  1IXC A;  3GEZ A;  3F21 A;  3GLL A;  4BQQ A;  1S7O A;  2IGO A;  2XPU A;  4MEY F;  1QU3 A;  2E71 A;  2MD5 A;  3DKX A;  2NAZ A;  2W85 A;  4XRS A;  4PJ0 C;  3PM1 A;  4ZDP A;  2XRO A;  2W48 A;  4C3I J;  4FHT A;  1BR1 A;  1O7L A;  3DXJ F;  3DU5 A;  4RLF A;  3UNG C;  1H89 C;  2R4G A;  3WU2 C;  4A0Z A;  2MAB A;  2NOG A;  3HXL A;  1N78 A;  4EGY A;  5DCM B;  1JUM A;  2KQR A;  4AVZ A;  4XKC A;  3T8T A;  5D5W B;  4DNC A;  4EGZ A;  4S0H B;  2F4M B;  3GLX A;  3S3N A;  2CQK A;  3D5S C;  3LMM A;  5FGM A;  2GIV A;  3F6O A;  4YFN F;  5IT9 Z;  2GXA A;  2LKP A;  3FBI B;  3KFW X;  1VQ9 I;  3LWF A;  4YFX F;  3AG3 H;  4B1R A;  3K2Z A;  2PQ8 A;  3OY9 A;  3HHG A;  2W25 A;  3CCU I;  4GXO A;  3HUG A;  2FXA A;  1DUX C;  2V1X A;  2FU4 A;  1FP2 A;  1XGO A;  3IH3 A;  5LD2 C;  2DO7 A;  2CMP A;  2OQR A;  3GWZ A;  3J81 Z;  1UG0 A;  4B8X A;  2L9R A;  1UB9 A;  4ZH4 F;  1TP4 A;  4XLA A;  4L5J A;  5M3M J;  3OYE A;  3HOT A;  1SAX A;  3OYD A;  1MSF C;  4BYY A;  3C2H A;  2LY2 A;  3GCM A;  2FE3 A;  2JUG A;  1B8I A;  1WJA A;  4I76 A;  2A6T A;  1EV7 A;  5BPD A;  1A36 A;  4XRF A;  3EET A;  2JA5 J;  1GXQ A;  2DBB A;  3H3V K;  3KYD B;  1B9N A;  4KUM A;  5DV5 A;  4D5F A;  2CRG A;  4HNU A;  5DDG A;  1J9I A;  3K4J A;  4JX4 A;  1RC9 A;  1J7K A;  4DBR A;  2KIS A;  2K4B A;  5FRO A;  2FQ4 A;  5ICF A;  2PJR A;  3W2W A;  2DPU A;  2FNP A;  4WX9 A;  4NHJ A;  5LLQ A;  4B3X A;  3DU6 A;  2JPC A;  1ZG5 A;  2QCO A;  3Q3S A;  2IBD A;  3ESW B;  1G8X A;  3PL8 A;  3GTJ J;  4ON0 A;  2KKO A;  2V9K A;  1SVO A;  3JRI A;  2GWR A;  1VQ5 I;  4KIB A;  2O9L A;  2EFQ A;  3J80 Z;  1OCT C;  2MLG A;  2YS9 A;  4QPQ A;  3HRT A;  3E0J B;  1PDN C;  1T6S A;  1BR4 A;  3E1S A;  2MGQ A;  1S8N A;  3ZOB A;  3BT9 A;  1ZG1 A;  2LVS A;  2O7O A;  2HR3 A;  2QYO A;  5EZH A;  4LGW A;  1S9H A;  3CJN A;  3H36 A;  5B3S H;  5GPC A;  3K1P A;  2OTL I;  1FIA A;  3WTV C;  5AIP A;  4E70 A;  1SFE A;  1I50 J;  4A3K J;  1P4W A;  2NNN A;  1F43 A;  3U1D A;  2OJE D;  3GTG J;  2VBW A;  3FM3 A;  2HVR A;  2KJC A;  2BW3 A;  3X2Q H;  2FQ3 A;  2IS6 A;  2WB1 N;  2ECB A;  2P7V B;  3LA7 A;  2MBF A;  5IP7 J;  1QPI A;  4K2E A;  3OMY A;  3SFI A;  1PUF B;  3N4M A;  2XPW A;  4IZZ A;  2JVG A;  3QPT A;  4XLH A;  1T39 A;  2BV6 A;  1RRJ A;  2A05 A;  2L54 A;  1R5G A;  1U5T A;  1ERD A;  4C3H J;  1SVM A;  1KGS A;  1TQM A;  3F8N A;  3OWT A;  4BEH A;  3DKW A;  3SJM A;  4GO1 A;  3FM5 A;  1JI8 A;  5E8I A;  1RKT A;  1W5T A;  3FXM A;  3GYH X;  2GXB A;  5L3F A;  4MQ9 F;  3L1P A;  2OD5 A;  2CO5 A;  4CH7 A;  2VLA A;  4FTH A;  2BY0 A;  3JRD A;  1KU7 A;  1LDJ A;  2KRF A;  2HYF A;  4UVA A;  2KRC A;  2E7W A;  5IT3 A;  5K5R A;  3RI4 A;  5GAD J;  5ILS A;  3CJT B;  3ABM H;  1OLT A;  1WH5 A;  4FET A;  3TO9 A;  1KU9 A;  3H1C A;  1ZKG A;  4BDZ A;  4W97 A;  3WE2 A;  1YIT I;  3BZ6 A;  1MH4 A;  3CP8 A;  3HYI A;  3CUQ A;  4BU2 A;  1Z6T A;  3C1D A;  1BN5 A;  4AIK A;  2R7V A;  4DJA A;  5LEJ A;  1XD7 A;  3P9I A;  2L01 A;  2JPB A;  1X1D A;  1BR2 A;  3TDZ C;  4B44 A;  2ESH A;  2ISZ A;  3RDI A;  2VKV A;  1BIB A;  1ZTR A;  3HOV J;  2VOP A;  1JGS A;  3G3Z A;  2Y9Z A;  2Y2Z A;  4AIJ A;  3WOD F;  2PN6 A;  1JKP C;  4R79 A;  3JAM K;  2LP0 A;  3GZ5 A;  1R5I D;  1IN7 A;  4FQG A;  1SVL A;  3N05 A;  2WAQ N;  3CTA A;  2EIJ H;  2ZSI B;  4AM3 A;  1RR7 A;  2X6O A;  1YO5 C;  2CJJ A;  4RB2 C;  3ML6 A;  1P9Q C;  3VOE A;  4UY8 I;  4A3B J;  1B8I B;  1YIJ I;  3MCZ A;  1KA8 A;  1SC7 A;  3D0S A;  3VOD A;  2STW A;  4FX0 A;  2X6X A;  2Y9Y A;  1D5Y A;  2Q0O A;  2OV7 A;  2LKX A;  4G7O F;  2CH0 A;  2I8D A;  3K9T A;  1YJW I;  2KIM A;  3CC2 I;  3F8B A;  2DA4 A;  2K9S A;  3F8F A;  2XGX A;  5HOO A;  1FSH A;  5CPR B;  2E1O A;  2PJR B;  1J5Y A;  4NC6 A;  5JLX A;  2A69 F;  3HTU A;  3JRF A;  4BHC A;  4C3J J;  4PGH A;  4HBL A;  3E7L A;  2EZI A;  2VKD A;  1GDT A;  1YOV B;  1IG7 A;  4ZDL A;  1TW2 A;  3VYU B;  3WTS C;  1X3W B;  3QPL A;  3S17 J;  5J4Y A;  4DYR A;  1BIA A;  5ILU A;  3DCF A;  1IRF A;  3V7S A;  2KL4 A;  2IPQ X;  2OPT A;  3I56 I;  3HPG A;  2QKL B;  3IL2 A;  2EFO A;  1FOX A;  3QPS A;  2QSF X;  3OYA A;  1YHQ I;  1K61 A;  4HYE A;  4IL6 C;  3FK6 A;  1HW1 A;  2KJB A;  1A6I A;  1JKO C;  4AYB N;  4KT6 A;  3ABT A;  3KLO A;  2HOS A;  2BW3 B;  1SD4 A;  2XB5 A;  2NVT J;  1WKM A;  3TGN A;  3P9C A;  5K7H A;  3TBI A;  4XOT A;  4DZP A;  1SFK A;  4PDK A;  2JVH A;  3WHB A;  4ENJ A;  4A3D J;  2NVU B;  2XF6 A;  2IP2 A;  5D8L B;  3KZY A;  2AHQ A;  2R7D A;  1U78 A;  4AD9 A;  2X9D A;  2M3A A;  3JW4 A;  4DBQ A;  3I58 A;  1D1B A;  1S29 A;  3LSH A;  3MVP A;  4MGR A;  1DP3 A;  3ABK H;  1A31 A;  3K1M A;  3S1R J;  5TGT A;  1HF0 A;  4IEJ A;  1OCZ H;  1U5T B;  1ZYR F;  4BEH B;  1VZ0 A;  1R7J A;  4S04 A;  1W7P A;  3RKX A;  3E6D A;  2JZY A;  3PQJ A;  3KET A;  3HHH A;  3E6C C;  1UZC A;  3ZMD A;  4NC7 A;  4JBA A;  4IHS A;  2D1H A;  2CW7 A;  1H0M A;  4GCV A;  1MGT A;  2FBK A;  1AU7 A;  4BE1 A;  2BVM A;  5DTD A;  5EZG A;  5EF6 A;  4YEJ A;  1JUP A;  1MJ9 A;  4RGR A;  4ESJ A;  2W57 A;  4XM3 A;  4XKB A;  4M6V A;  3U21 A;  4HV5 A;  4CCN A;  1IDZ A;  4UB8 C;  1YX3 A;  1TTY A;  5IOZ A;  1CF7 A;  1UCR A;  2WY7 Q;  3FXO A;  2HOT A;  2GQQ A;  2IEK A;  1HDP A;  2CG4 A;  3LA3 A;  1ZRE A;  3RCO A;  1QZE A;  3ONQ A;  1X1C A;  2OCE A;  2V6E A;  4U88 A;  5FKK A;  4EJV A;  4GYG A;  2VXD A;  3MWM A;  1WI3 A;  2HI3 A;  5IY5 H;  4P5O A;  4ENK A;  1DPR A;  1WPK A;  1J0R A;  2Q2E A;  3JRC A;  1POG A;  4E7Z A;  2ELH A;  2F5C A;  4CZC A;  1ETW A;  3S2W A;  3CMM A;  2QVO A;  4A2U A;  3K4C A;  3A01 A;  3DV8 A;  3NAU A;  3BZK A;  3IWF A;  1LVA A;  5CLS A;  1YYV A;  1I6H J;  1ITY A;  4MTD A;  2W7N A;  3ZQC A;  5M5X J;  1PP8 F;  2ESN A;  3LSR A;  2CV0 A;  1HCR A;  3HRU A;  2HVS A;  3BOQ A;  4IPA A;  2G7U A;  2NYX A;  2WBM A;  1N75 A;  2KFD A;  2Z9O A;  3K0L A;  4YEL A;  3H9Q A;  2A6H F;  5J1U A;  2IT0 A;  2CQ7 A;  4EM2 A;  1WVR A;  1VF9 A;  1WI9 A;  3FMR A;  5DD8 A;  2BY1 A;  1K4S A;  4OIO F;  2QWW A;  3ZPL A;  5FJ8 J;  2VL8 A;  4YRV A;  2DA3 A;  4NNJ A;  5L3C A;  1WRJ A;  4DQ2 A;  2YX4 A;  3GO5 A;  3RYR A;  1H88 C;  3RSN A;  2KRH A;  4NBQ A;  2CWE A;  4LJZ F;  1SAU A;  4M72 A;  1ZG3 A;  3T5X A;  3MD2 A;  2CFX A;  3ZQL A;  4V2F A;  3A03 A;  3BY6 A;  3REO A;  1ZRD A;  2IS2 A;  4IRI A;  3ZQH A;  4EJU A;  3E97 A;  3HOZ J;  4XN0 A;  1UFM A;  3JCU C;  2VOD A;  2X51 A;  5EGO A;  1D8K A;  3HOU J;  1N77 A;  5H2F C;  3TOA A;  2DMN A;  5HLT A;  1QBJ A;  4RAG A;  2Z3Y A;  5AIQ A;  4IO9 F;  4ANJ A;  4KIC A;  1WJF A;  4XLE A;  3GFI A;  4G8X A;  1OCC H;  1YE9 A;  4FT8 A;  1NG6 A;  4OAY A;  4MEX F;  4HF2 A;  1XDU A;  3LQQ A;  4BS9 A;  3DEE A;  2JRM A;  2DT5 A;  4A3L J;  4BJ5 C;  3OYF A;  3BPV A;  2YUS A;  1VQN I;  3IC7 A;  1P7I A;  5LGT A;  1TWC J;  1YG2 A;  1Y8Q B;  3KZI C;  4MFE A;  3SHF A;  3WG9 A;  2ADU A;  1YS6 A;  1EH8 A;  3EPZ A;  4XRS G;  1HKT A;  2MH9 A;  1T56 A;  2H09 A;  1D0Z A;  2XRL A;  5K5O A;  3O2P E;  1M1E B;  2G7H A;  1OR7 A;  2R0Q C;  1HKQ A;  3AG2 H;  1WFX A;  3BRO A;  1TNT A;  3S1M J;  2EIM H;  2W24 A;  1MD0 A;  1ORK A;  2NVQ J;  2PI0 A;  5D5X B;  2QQ8 A;  2AXT C;  3ZP5 A;  2OBP A;  2IA1 A;  3HGG A;  3QOD A;  3J7Y J;  2O03 A;  5EEH A;  1W7P B;  5FLX K;  2KIU A;  1LFB A;  2HGC A;  9ANT A;  4ITV A;  1LVK A;  3WU1 B;  5HDN A;  5DUK A;  1GUU A;  2JUC A;  2ECC A;  2KZG A;  1XCV A;  5HDG A;  3I53 A;  4A3F J;  4ZZD A;  1YI2 I;  2W1O A;  4W1U A;  2M5W A;  1PYV A;  4LB5 A;  1ZRF A;  3GUD A;  1IN4 A;  1FT9 A;  3MKL A;  1ZH5 A;  1WH7 A;  2ZXI A;  4DZJ A;  5AON A;  3ZQQ A;  4RB3 C;  3PSI A;  2XHK A;  3CDH A;  4HLX A;  1Z91 A;  5CVV A;  3BG7 A;  4YG2 F;  4XR6 A;  3JRH A;  1ZGJ A;  2YU3 A;  4BXF A;  4BGD A;  3PJR A;  4LIU A;  2KIF A;  1EF4 A;  1WHU A;  4A12 A;  5J6X A;  1Y1V J;  1FZP B;  4OMY A;  2P0W A;  4HV6 A;  3FXR A;  3I54 A;  3PO2 J;  4CGZ A;  1OPC A;  3HC7 A;  1KON A;  3LST A;  4LK0 F;  4Q47 A;  2H6B A;  3F6V A;  4Y3O A;  3CO6 C;  2MC3 A;  3OR2 C;  3W6J B;  3KEO A;  1Y8R B;  3B6C A;  1X2M A;  3O3K A;  3A01 B;  3DP7 A;  1WQ2 A;  2Y31 A;  1A6Q A;  2V7F A;  5J8F A;  4DIQ A;  5C3E J;  3S93 A;  4LB6 B;  3L2Q A;  5LFA A;  1IV6 A;  1ETV A;  3C2B A;  5E20 A;  5F04 A;  2HTJ A;  4XLF A;  1ON2 A;  1GVJ A;  3SEQ A;  3BQZ A;  3J7A Y;  3ZQF A;  2CYY A;  3AL0 B;  1T0F C;  2DT7 B;  1JKR C;  1ACI A;  5M5W J;  2MW8 A;  1ODD A;  3DBL B;  1VQP I;  2OUM A;  4LK1 F;  3FMQ A;  2VT2 A;  3DPL C;  3BG5 A;  5HLH A;  4Q4Z F;  2PMZ N;  4M3F A;  4M6Y A;  2HTS A;  4QTR A;  3BG6 A;  3ECH A;  3ROU A;  3FHN A;  2RDP A;  2E1C A;  1YRN A;  2B9S A;  4C2T A;  3K4B A;  4MTE A;  3W3C A;  2LY9 A;  3S14 J;  3C2G A;  2ELK A;  4ZYE A;  2H27 A;  4F52 A;  3OIP A;  5EGO B;  4PZJ A;  3FXK A;  5JI6 A;  2ZJQ F;  2VXZ A;  2ZC2 A;  1S3J A;  5BS6 A;  1KQ0 A;  3PIP F;  5J47 A;  1G3T A;  5K1Y A;  2ID3 A;  3H35 A;  1Y0N A;  3ZN0 A;  3CF2 A;  4HPQ A;  2KMU A;  4FCY A;  2R7X A;  1AWC A;  1IDY A;  3E5Q A;  2NVY J;  4M74 A;  3GTP J;  1R5H A;  3HSE A;  2Z5U A;  2QQ9 A;  4AIH A;  3M4O J;  2CUZ A;  3HG9 A;  5KHD A;  3WGI A;  4CUG A;  2E60 A;  3M9A A;  2DA5 A;  3S3M A;  3FWE A;  1NK3 P;  2RGV A;  2ZXW H;  4S05 A;  4NB5 A;  3DLA A;  2UWM A;  2R7W A;  2DN0 A;  3LFU A;  2FA5 A;  1FEX A;  2QGU A;  4IRH A;  1OYY A;  1QRY A;  2VIX A;  3CP2 A;  3P9K A;  2M7A A;  3NAR A;  3V7C A;  3W6K B;  2DFE A;  2HKX A;  3I71 A;  3RYP A;  1MMS A;  5DM7 F;  3RZD J;  1MMN A;  1IRG A;  3GVA A;  1TC3 C;  1XPX A;  1DP7 P;  2EH3 A;  4PJM A;  1TWH J;  3O6B B;  1LKX A;  2DA6 A;  2LH9 A;  2TRT A;  2IA0 A;  2EZK A;  4HNT A;  2XIG A;  4HF0 A;  4BBR J;  1BA5 A;  1VQ7 I;  3ZMU A;  4ZYG A;  4BQN A;  1HW5 A;  1RZ4 A;  3BR6 A;  1MND A;  4IJA A;  4DYQ A;  1B9M A;  2D1V A;  2AS5 F;  2L02 A;  2CW0 F;  4E7L A;  3KX2 A;  3PNT A;  4BE0 A;  1GVD A;  2BBY A;  3LSP A;  4OU0 A;  3OSF A;  2DTR A;  3H3U A;  3C18 A;  3JRE A;  1APL C;  1I6X A;  5D6F A;  1TW3 A;  1QPM A;  2AXL A;  4GGG A;  3ERE D;  4B43 A;  2DT6 A;  4EQQ A;  2GBY A;  1USS A;  2IW5 A;  3TED A;  1FOW A;  2VKE A;  2OF7 A;  5FO5 A;  4RBO A;  4JX5 A;  4BUP A;  2FBH A;  4L0Y B;  4I0B A;  5B1B H;  1TWA J;  5FKL A;  3JSO A;  3GTM J;  3BTL A;  3VPR A;  3KYC B;  3OR1 C;  5JVT A;  3A4C A;  3DEU A;  2V9V A;  2VJ4 A;  3DF8 A;  2Y69 H;  4H0E A;  3V8K A;  5DEQ A;  1SD7 A;  3HRS A;  1BBY A;  3RKW A;  1UAA A;  5L3D A;  1W1W E;  1VQM I;  2X6Y A;  3DLL F;  4GRI A;  5JFR A;  2XAG A;  1H9G A;  5J8C A;  3OYL A;  1E0E A;  5JVG F;  3WHC A;  5K5Q A;  4BAY A;  4ZYD A;  2R7U A;  1MBF A;  4LLN A;  3RQ4 A;  3CC7 I;  3Q9S A;  2RNG A;  2XGD A;  4J19 A;  6PAX A;  4V2G A;  3VYS B;  2KPM A;  4D0P A;  1HLV A;  4RGU A;  3HKZ N;  3Q5F A;  4BXU A;  5HLG A;  2FSW A;  4D5C A;  1RNL A;  1S72 I;  3V42 A;  3GTO J;  4BHB A;  1TQI A;  3OYC A;  1Q1V A;  2ZXH A;  3MKY B;  1IAW A;  2DOD A;  1Z05 A;  1JKQ C;  3Q0U A;  4PGG A;  3G71 I;  1YRN B;  4ZYH A;  2M8E A;  4ZZL A;  3QOP A;  3BTC A;  5FFZ A;  3HOS A;  3P7N A;  1U9O A;  3GFL A;  4IXA A;  1ZR4 A;  4FE4 A;  1WSU A;  4UUV A;  1BC8 C;  3Q0V A;  1RKW A;  5D4S A;  3IRQ A;  1HOM A;  5CQE A;  5IYC J;  1GV2 A;  1XG1 A;  1GHC A;  5J1Y A;  2LY1 A;  4UXN A;  2DOE A;  3CCY A;  4IQ4 A;  4EJT A;  3C3W A;  3RPQ A;  3LL7 A;  4FE7 A;  4KJZ A;  2XAH A;  3HPH A;  5IP9 J;  2R7Z J;  2LMD A;  4Y13 A;  4E7H A;  1LE8 A;  3TO7 A;  3L2R A;  4G94 A;  4D7M A;  4C30 A;  3QPH A;  2E2I J;  4QPO A;  5F0C A;  1DU6 A;  1ZAR A;  3ASO H;  3JRG A;  2PEX A;  1V5E A;  1IRZ A;  3AG4 H;  4BQO A;  3G4S I;  1T8I A;  2P5K A;  2H8R A;  2D45 A;  5JR3 A;  4CSW A;  1FPQ A;  4AUX A;  1P7J A;  5E8G A;  2AQF A;  1NK2 P;  1D0X A;  2DYR H;  1JHH A;  4L9T A;  4PJN A;  4QWQ A;  1UMQ A;  1PVE A;  1YS7 A;  2WB1 A;  4M3E A;  4RB0 A;  1A35 A;  3CJQ B;  3CF5 F;  5GP9 A;  3QU6 A;  2DMQ A;  2W4S A;  3C7J A;  2CUF A;  4N0B A;  3K4L A;  5A2Q K;  4P9F A;  5CYV A;  1E3H A;  4I6Z A;  1MJA A;  1OYI A;  5J40 A;  3OYG A;  3KPH A;  4EM0 B;  3DTK A;  4M3B A;  3OYI A;  2EA2 A;  4DOZ A;  5L3E A;  4EEF G;  5IP6 A;  1X1P A;  3ZMT A;  3MZY A;  3I4N J;  1LDK B;  2QSG X;  5IYD J;  3RPU D;  3DBH B;  3EQL F;  4C2M J;  2E2J J;  2L5Q A;  3OIO A;  4B09 A;  2XAJ A;  1YW7 A;  3GME A;  3W2V A;  3CCR I;  4A69 C;  4E7K A;  3QP5 A;  2X6W A;  1R1U A;  4XN3 A;  4CXF A;  4Y15 A;  3KP3 A;  1NH3 A;  2FBI A;  3FDY A;  3KYL A;  3MAJ A;  2J5O A;  3L00 A;  1MW7 A;  2DK5 A;  2KDZ A;  2VBY A;  2ZME C;  1F4K A;  1AHD P;  3MQ0 A;  3IHU A;  3GTK J;  5FB2 A;  4M6X A;  2W00 A;  4ETS A;  2P5L C;  1VQK I;  3TOB A;  3PNY A;  1XGN A;  2ZSH B;  1IN6 A;  4RGS A;  4XLP F;  1OJL A;  2JA2 A;  3EUH C;  1SFO J;  2XB0 X;  4O6J A;  2LRE A;  1E3O C;  3CCE I;  4PSW A;  5C44 J;  2XRN A;  4HAM A;  3F0C A;  3I5U A;  1LJ9 A;  4A3M J;  3ABU A;  3HBL A;  4X6A J;  4ZTJ A;  1KQ9 A;  3WU0 A;  2CFO A;  3QOE A;  1HSJ A;  4XLC A;  3TP0 A;  3GW2 A;  5E3N A;  5LBQ A;  2ZCW A;  2Y0S N;  4XIC A;  2PBI A;  2WAQ A;  2DJI A;  3I64 A;  1XN7 A;  1B72 A;  1G4D A;  2CS3 A;  3EDP A;  1SD6 A;  3FKJ A;  2CGP A;  4U7D A;  4LLL A;  2LBF A;  2R5Y A;  4UVC A;  4XOP A;  1JT0 A;  5F1J A;  5JHF A;  5L3B A;  4L0Z B;  2LLK A;  2GA2 A;  3BR3 A;  1HA8 A;  2L7K A;  2WV0 A;  1I1G A;  2JT1 A;  1W5S A;  2FNA A;  4A3G J;  5HNF A;  2MSY A;  3BJO A;  1DQU A;  2P4W A;  3CCS I;  2K40 A;  2L9N A;  1OMI A;  4G6T B;  3ASN H;  3VSL A;  3S8P A;  2EJR A;  3BWG A;  2J5P A;  2Q8K A;  2A61 A;  3LSG A;  2LC2 A;  3MMY B;  2QKM B;  4CDG A;  5GAH J;  1ZQ3 P;  4XOR A;  5E18 F;  1UHM A;  3FIW A;  4H4K C;  3ZCO A;  1O3S A;  2HKO A;  2OZ6 A;  3K1N A;  1S5L C;  3K4N A;  3VB2 A;  3HRM A;  1Z67 A;  4HST A;  2ZJP F;  2LYC A;  3L9F A;  1OKR A;  3SDB A;  2KLO A;  2X4H A;  4XBF A;  4EJO A;  1LE8 B;  3SZT A;  4Y7N J;  2BHY A;  2WAF A;  3FXU A;  5D5U B;  2VUM J;  1B1B A;  2QZ8 A;  2X1C A;  5HLI A;  2HNH A;  3F8M A;  5F0H A;  2VPR A;  4KIS A;  2HZT A;  4C2U A;  3GZN B;  4M73 A;  2LOO A;  3PNV A;  4NQW B;  3S16 J;  4AYB A;  2UXX A;  4I09 A;  2VKH A;  3G6E I;  4D1Q A;  1YX5 A;  3OS0 A;  4BKX A;  4RAY A;  4CCK A;  3M1C A;  4KFC A;  1QVT A;  2HQA A;  3BLY A;  1ZHF A;  3CCV I;  4C9Y A;  5IT9 K;  1OCR H;  2JMW A;  5DM6 F;  1WJE A;  4Y33 A;  2E7X A;  2EIL H;  3T0Y A;  3U1K A;  3K4K A;  3BP8 A;  4NUB A;  1EKE A;  3HIF A;  5B5E C;  3OYB A;  5F64 A;  4G7H F;  1VQL I;  4E7I A;  2H1L A;  5TRD A;  2HDD A;  4A5M A;  2ZFW A;  1XSD A;  4B47 A;  4Y17 A;  1OIS A;  1X58 A;  2O3F A;  3S32 A;  1RET A;  3J81 K;  2HEO A;  2RKH A;  4F3Q A;  4A3I J;  1FTZ A;  3RIR A;  2A5Y B;  2V9P A;  2QUF A;  3FXL A;  1WWX A;  1EH6 A;  4I02 A;  5E17 F;  2K86 A;  2F6C A;  3S2H J;  2IGM A;  3KIO A;  2DYS H;  2GLO A;  1QZZ A;  1T98 A;  3EYI A;  2IS1 A;  2HOE A;  2N8G A;  1K6Y A;  2LG4 A;  4EJW A;  5TJJ A;  4GFB A;  1FMV A;  3DEW A;  1A04 A;  1QNT A;  1UEL B;  2I10 A;  3CUQ C;  4P55 A;  1LFU P;  1X2N A;  3BR5 A;  1O3R A;  3K6G A;  1SFU A;  1V54 H;  2P8T A;  2R5Z A;  2YU9 J;  3CLO A;  2HQ5 A;  1VQ4 I;  1VQ6 I;  2V1N A;  5F0F A;  3CCM I;  4L5I A;  3WTX C;  2HZD A;  1SMY F;  1R71 A;  2GIZ A;  2WAE A;  2ME6 A;  1D1A A;  4XL9 A;  2DA2 A;  3QYE A;  5J3L A;  2BXZ A;  3HDD A;  3J80 K;  2DMU A;  5M3F J;  1JTX A;  3R61 A;  4MIM A;  3HL2 A;  4PFP A;  2DDA A;  1Y1W J;  1Z7U A;  2V1D A;  2WC2 A;  1MH3 A;  4CCO A;  2XVC A;  2LRD A;  5FRN A;  2VE8 A;  2RC4 A;  2BE5 F;  2DFH A;  2OQG A;  3H3Z A;  1LB2 A;  3M8F A;  2B63 J;  1MIJ A;  4HNV A;  5LGU A;  1B72 B;  1LEA A;  3VSK A;  2NS7 A;  1H9T A;  3VYT B;  4UB6 C;  2M1B A;  2YSR A;  3L2V A;  2LBF B;  1T0F A;  3QAH A;  2R5Y B;  1MNE A;  2V6C A;  3JSP A;  4OWR B;  5KAI C;  4BBS J;  2DCE A;  3I0T A;  1S7E A;  3E6M A;  2K4J A;  4KDP A;  1U0J A;  2MLK A;  2M34 A;  3HSF A;  1R4M B;  3JTH A;  3TDU C;  1V3F A;  1FY7 A;  1UHS A;  1C0W A;  2X48 A;  4HW0 A;  4U0Y A;  1D1C A;  2E34 A;  3L2C A;  4OIP F;  2ZXJ A;  2E1M C;  2CU7 A;  2K9M A;  2Z16 A;  4J00 A;  3HOW J;  1MDM A;  3GX4 X;  3LA2 A;  1D0Y A;  2PMU A;  1Y39 A;  3F3X A;  4BNC A;  2DW4 A;  2EIK H;  3K7A J;  3F22 A;  2LFB A;  4XKW A;  4RAF A;  3IH4 A;  5BOX A;  1O57 A;  1QHH D;  4A3E J;  3A0H C;  2VE9 A;  4E7S A;  1TT5 B;  3I59 A;  1T2K A;  4G12 A;  3O8G A;  2M9H A;  1NTC A;  1S7A A;  2IJL A;  2TDX A;  3SZP A;  3J7Z I;  3IKT A;  2EZL A;  3KLN A;  1FLI A;  5KCM A;  4MHG A;  2K9L A;  4E4H A;  1VQO I;  3FIS A;  3L09 A;  2EV0 A;  1FP1 D;  2ELJ A;  1IXR C;  2NXN B;  1R49 A;  4IHY A;  2OAZ A;  4WXH A;  5JLW A;  5FFX A;  4YIR X;  1QVU A;  1BI2 A;  4X1E A;  2PFB A;  2LD5 A;  4Y52 J;  1JGG A;  1TT0 A;  3FMS A;  3H5N A;  4BJT A;  2BOL A;  2VC1 A;  1U3E M;  2WA0 A;  2NVX J;  4WF2 A;  4ENN A;  1HKS A;  3BR2 A;  1DGR M;  4UHT A;  1O3Q A;  1X19 A;  4YFK F;  1UG2 A;  1YIO A;  4HSR A;  5ICE A;  4DGW B;  5ICC A;  2H8W A;  1P92 A;  2KDO A;  4X0G A;  2K3F A;  3I55 I;  2E5Z A;  4BH9 A;  2LK2 A;  2P7C B;  2DOA A;  2MG4 A;  4A6D A;  5C4J J;  4XSX F;  3FZV A;  3ZMV A;  5D6E A;  2LF7 A;  1FX7 A;  2K9N A;  2QM3 A;  5FD5 A;  2F5V A;  4P96 A;  1TWG J;  1K83 J;  4D7N A;  2PLY A;  2L2O A;  2Y48 A;  1DGW Y;  3I4P A;  4F7Z A;  5GTI C;  2DA7 A;  1PP7 U;  4KMU X;  4A93 J;  3EUK L;  3T1B A;  3B6A A;  3F9K A;  2LDU A;  2FOK A;  2CQQ A;  5D4R A;  1JTY A;  1BOA A;  3N97 A;  2Y75 A;  1L3L A;  1Z3Y A;  1TZL A;  3F72 A;  1MBG A;  4IOC F;  2R5Z B;  1DU0 A;  2VQG A;  5CVI A;  3B73 A;  1B6A A;  2L7Z A;  3MZ8 A;  4N9I A;  2V26 A;  5B1A H;  3JTG A;  4F55 A;  1GXP A;  4Y4R A;  3R6S A;  1Z3X A;  3TP3 A;  4QLC U;  2HDW A;  5J1R A;  2GOX B;  1Z1D A;  1KQ8 A;  2F5F A;  2NS8 A;  1W4M A;  2WV1 A;  1V5F A;  3FF5 A;  4OMZ A;  3TQN A;  1XS9 A;  3U2R A;  4M9S A;  2M7B A;  2XAF A;  4ABZ A;  2IA2 A;  2V4J C;  4CZZ A;  5EJC A;  2KHM A;  2R7Q A;  5FKO A;  5HVQ C;  5B66 C;  3A02 A;  4HDU A;  2RQP A;  2HDC A;  1ZK8 A;  3TL4 X;  4ENM A;  5TIS C;  3OYM A;  2HXO A;  1XGM A;  2O5R A;  3PQK A;  3KEQ A;  3G73 A;  1NG7 A;  1XX5 A;  3S15 J;  4JP0 A;  1O3T A;  3TKY A;  2ZBK A;  2FX0 A;  3QP6 A;  5DD4 A;  2YR2 A;  4HG2 A;  2W84 A;  5EDN A;  1EA3 A;  3QRF F;  2DFF A;  5FLM J;  2KIQ A;  4KT5 C;  2DTZ A;  4HQE A;  2L3D A;  4UV9 A;  2NRA C;  1TLH B;  3A0B C;  2PMZ A;  1QO0 D;  4PSX A;  2UV1 A;  5D5V B;  4A0Y A;  4LIV A;  1SFX A;  1QZY A;  2DPD A;  1V4R A;  2AO9 A;  4M9Z A;  1MBH A;  1BI3 A;  4F92 B;  4DW6 A;  2E19 A;  2E36 A;  2YPR A;  2EFP A;  4LLG F;  1MDM B;  1JXS A;  4G6Q A;  3JAM Z;  4B48 A;  4KN4 X;  3M3Y J;  5ED4 A;  2MC4 A;  2VAS A;  3LNQ A;  3H0D A;  3MKW B;  4HDV A;  3OOU A;  4A3J J;  4JX6 A;  1FIP A;  4RA2 A;  3HZJ A;  1LUJ B;  3GXO A;  1EJ9 A;  3I59 B;  1ULY A;  4LD5 A;  5E1X A;  3S1Q J;  2VI6 A;  3OL3 A;  3ZN1 A;  2XF5 A;  1HBX G;  3GBG A;  3SDG A;  3KP2 A;  1OFC X;  2K85 A;  1ETX A;  2GAU A;  1MMD A;  1QGP A;  2LTP A;  1VTN C;  2XC7 A;  3QQA A;  1FNN A;  4M71 A;  1IZ1 A;  4CCJ A;  5GTH C;  5CQG A;  2XGE A;  4RLQ A;  5CVU A;  3ZGK A;  3S2D J;  2IS4 A;  2VN2 A;  3VFZ A;  5FKM A;  3ULQ B;  2XV4 S;  4KYW A;  2P6T A;  3BJ6 A;  3FXQ A;  5HS8 A;  2RVC A;  3CQZ J;  2BY3 A;  2HPI A;  1ON1 A;  5CVJ A;  5DS9 A;  2E2H J;  3K10 A;  4RGX A;  1RUO A;  4R8H A;  2LSO A;  3OL4 A;  1D5V A;  3VYR B;  2P81 A;  3L2U A;  4ZDO A;  4NC8 A;  1V55 H;  3T8R A;  2VOO A;  4IOA F;  1KYW A;  2NNY A;  2CW8 A;  1ENH A;  1XDS A;  1K6O A;  2DOF A;  1SAN A;  1REP C;  5HS9 A;  2STT A;  1QHG A;  1W5C C;  2K27 A;  2MFZ A;  5L3G A;  4OIQ F;  3OSG A;  3D1N I;  4HEA 2;  3HOX J;  1MMG A;  2F48 A;  2A07 F;  1MSE C;  5EEA A;  2F4O B;  3FHZ A;  1K79 A;  4II3 A;  2O8X A;  5LHH A;  2VJJ A;  4OOI A;  1FBS A;  1G3W A;  2Y30 A;  5IPA A;  1IF1 A;  1D3Y A;  4CCL A;  1RI7 A;  3SQN A;  4IHV A;  4N4N B;  2VC0 A;  5BPI A;  3H0G J;  2UXN A;  2M45 A;  1LFP A;  4L9N A;  2COM A;  4CCM A;  2ZME A;  3BCB A;  2F5E A;  3CLQ A;  3JRA A;  1MZB A;  2WAD A;  5E1W A;  2ZFU A;  1WJC A;  1IO2 A;  1R1T A;  1U9N A;  1U8B A;  2ME0 A;  2DK8 A;  1I3A A;  2D2W A;  3O8H A;  3IAM 2;  3EUH A;  1R9T J;  1R23 A;  1W0U A;  1WJB A;  2PMH A;  2IVM A;  3NRV A;  1GLN A;  2EPF A;  1R22 A;  2ACJ A;  4BHP A;  3CCQ I;  4BAC A;  3V8L A;  2A6E F;  2M8G X;  3NEU A;  3ZXS A;  2Z99 A;  5BMZ A;  1IN8 A;  2OTJ I;  4PJL A;  1RES A;  4PJJ A;  2XSD C;  2R7R A;  5LRR A;  1TQP A;  2BXY A;  4XLN F;  4HA8 A;  3HKZ A;  4LFU A;  2JJ7 A;  2RRE A;  3Q0W A;  4KA4 A;  1HDD C;  2W82 A;  4MO7 A;  4M9X A;  1BOB A;  1K7A A;  3SFZ A;  3IRR A;  1V5G A;  2M4G A;  3K69 A;  2HWV A;  1WCM J;  2QEN A;  4IKF A;  4XKV A;  4IHW A;  3DWL E;  2M87 A;  1F9N A;  1FWZ A;  1Q1H A;  4GDF A;  3RTR A;  4M3G A;  4LG3 A;  4BE2 A;  2CV1 A;  1YW9 A;  1B59 A;  1D8J A;  1BI1 A;  3D5R C;  4U0V A;  1BM9 A;  3AKZ A;  3GTQ J;  1MBE A;  3KCC A;  2QLZ A;  2FML A;  3LOC A;  4MFD A;  2L7M P;  3RPU A;  3CMA I;  2BHZ A;  3AG1 H;  3NQO A;  2GM4 A;  2EB7 A;  4IRG A;  5E1Z B;  3IKV A;  2JA8 J;  3CD6 I;  3BTI A;  2BVL A;  2DA1 A;  5E79 C;  2ISY A;  4NQW A;  4AC0 A;  3CDL A;  4BY1 J;  5CKT A;  1RPW A;  1WZ2 A;  3IH2 A;  4JQF A;  3QWL A;  1FMW A;  4RMN A;  4U0W A;  2E5N A;  2Y0M A;  4AID A;  2O8K A;  1FC3 A;  5J4V A;  1I27 A;  2LF8 A;  4A3C J;  1ETO A;  5M5Y J;  3W6V A;  3ZR8 X;  3FXJ A;  3TMO A;  3OYK A;  1ZRC A;  2FMY A;  2ICW G;  2X0L A;  4G6D A;  4CO8 A;  2WY8 Q;  1XMA A;  3MZH A;  1IRX A;  2OC6 A;  3B02 A;  3LFK A;  1J09 A;  1XB4 A;  1QQI A;  3BZC A;  3PFI A;  2QA4 I;  4V19 K;  4EVI A;  1MBK A;  2QBY A;  3K70 D;  1T95 A;  3TO6 A;  5KNL A;  4LIT A;  1F1Z A;  3BCA A;  2WWY A;  4U87 A;  2HFH A;  4B4C A;  1UHW A;  4IHT A;  2DJN A;  2G9W A;  2QQA A;  4HX8 A;  3CME I;  1JUS A;  2EWN A;  3M07 A;  1YFH A;  2ZKZ A;  3CC4 I;  3CO7 C;  2CUE A;  1F5T A;  2R7T A;  5E3M A;  2BY2 A;  2VON A;  3PFY A;  5HNH A;  1ETY A;  1P6R A;  4EAT A;  4CYC A;  4I2O A;  3PSF A;  2UZK A;  3RQI A;  3MFK A;  3K4M A;  1MKM A;  2VQC A;  3QU3 A;  3IWZ A;  2P6S A;  1Y6I A;  2A3S A;  2IGN A;  1FYK A;  2K02 A;  1JJ8 C;  5ICG A;  2E35 A;  4IF4 A;  4UUS A;  3HJE A;  5IOY A;  1ZR2 A;  2Z33 A;  2GA1 A;  2ZME B;  4N4O B;  4KMF A;  1FTT A;  4Z2Y A;  4KIF A;  3CDI A;  2V79 A;  2MH2 A;  3IP4 B;  3EYY A;  3G1M A;  3H5R A;  1T38 A;  2IAI A;  4RB1 A;  1XSX A;  3BG3 A;  3GFM A;  5FLX Z;  3H92 A;  3HUG B;  1XSV A;  4L5E A;  4DYC A;  4ZJZ A;  4BDY A;  1U8R A;  4PUS A;  3NWT A;  1ZLJ A;  4MNU A;  2O6G E;  2X1E A;  4EMS A;  4I98 B;  2HS5 A;  2RN7 A;  1B4A A;  1HC8 A;  1G59 A;  5HDK A;  1FOK A;  1KYZ A;  1JT6 A;  3H9G A;  3V4G A;  3E6B A;  1YLF A;  3PO3 J;  3ZMZ A;  2Z2S B;  2JSC A;  3MKZ A;  2F5D A;  2Y0S A;  5FKN A;  4ESF A;  2EIN H;  2IXS A;  3J7A O;  4IX7 A;  3KEY A;  3E5U A;  2M30 A;  4OIN F;  1A5J A;  2VB6 A;  3ECO A;  3BC8 A;  2R92 J;  3K70 C;  2L9S A;  4IVN A;  3Q9V A;  4WXD A;  4RAZ A;  3KP4 A;  3V8J A;  1DPU A;  1I39 A;  3IV5 A;  5K7Z A;  3GTL J;  2R7S A;  2XKP A;  4WCG A;  1BL0 A;  2CSO A;  2K7L A;  2DQL A;  2M4K A;  1OYW A;  4I01 A;  2JA7 J;  1Z21 A;  3GZ6 A;  3HOY J;  1WGX A;  1WJD A;  4F93 B;  5LGN A;  2KT0 A;  1J75 A;  3OYN A;  2VBZ A;  1L0O C;  4G9Y A;  4HLY A;  2HOA A;  1Z6R A;  3COA C;  4HX4 A;  1ZN2 A;  2VBX A;  2P5V A;  2H1K A;  1H8A C;  1BJZ A;  4PCQ A;  2EZH A;  1BC7 C;  1HW2 A;  5IYB J;  1K78 A;  2E1N A;  1Y56 A;  3RKY A;  2L4A A;  3LAJ A;  2M0C A;  2B7E A;  3ZQ7 A;  2WTE A;  3WTY C;  1XC5 A;  2R3S A;  3SEZ A;  1J2X A;  1FYL A;  2CQX A;  2R7O A;  1KU2 A;  1STZ A;  2DMP A;  4XSZ F;  3EUA A;  2C6Y A;  1X3Z B;  3D5L A;  5HOD A;  1RR8 C;  2JQ7 A;  3HB9 A;  1U5T C;  2Z1D A;  3OIQ A;  4IQJ A;  2KP6 A;  1YJ9 I;  1BW6 A;  3BR1 A;  4IHX A;  1IJW C;  2MYS A;  2ZJR F;  3CCL I;  3G1L A;  3LSJ A;  3CZ6 A;  3BPX A;  4ASN A;  2RNJ A;  5FLV A;  2EFN A;  2G0E A;  2QBY B;  4HX7 A;  1AKH A;  1FSE A;  3BJA A;  3M7G A;  2K3P A;  4NDL A;  1YTY A;  4LG0 A;  5LHG A;  3BTJ A;  4CIC A;  4AU7 A;  3VDX A;  1MJB A;  2CUJ A;  2XAQ A;  1OQY A;  1R58 A;  2H6C A;  3JRB A;  1UST A;  2OZU A;  3KP6 A;  4HOB A;  1TWF J;  2HYG D;  3MN2 A;  1Z7L A;  5DUI A;  2DU9 A;  2H94 A;  1MBJ A;  5DYM A;  1U6G A;  2DAO A;  3ISP A;  3LSK A;  3P5J A;  3R0J A;  4CHU A;  2VT3 A;  1XTA A;  2QSH X;  4CYC B;  1JHF A;  5E3L A;  2OCC H;  3ELK A;  3AAF A;  2JN6 A;  2QEX I;  3WTU C;  1I5Z A;  1LDD A;  4L9V A;  1Z0X A;  1SEU A;  5BNG A;  2JRT A;  2PG4 A;  4KIT B;  2XGC A;  5GAE J;  3M1E A;  1ZGW A;  1XCB A;  2EV5 A;  3LAP A;  3ERM A;  4KNY A;  2B0L A;  4UUS B;  2LR8 A;  3ZQG A;  2L4M A;  2EK5 A;  1TNS A;  3CUQ B;  4J01 A;  3E3V A;  2ZO4 A;  3IAS 2;  1P2F A;  3CES A;  3HTS B;  3NWS A;  3OYJ A;  1G2H A;  4XID A;  3GFJ A;  4QSH A;  4ESB A;  1JE8 A;  5H6Q A;  3OS2 A;  2FRH A;  3LSI A;  4A5N A;  2BYV E;  1TBX A;  3WTT C;  1R4N B;  3W2A A;  3JR9 A;  1W7P D;  5KAF C;  5FRM A;  1P4A A;  1XMK A;  5DCF A;  3WGG A;  2RV8 A;  4P9U A;  2ETH A;  1K4T A;  3G2B A;  1MMA A;  2D5V A;  1ETK A;  1NHA A;  3K2A A;  4HQM A;  1WJ5 A;  3HEF A;  4I99 C;  3HM5 A;  2CV2 A;  3RJP A; 
#chains in the Genus database with same CATH homology
 2XGD A;  4J19 A;  4V2G A;  2FX0 A;  1HLV A;  1D5Y A;  2Y9Y A;  3HKZ N;  1Z77 A;  1GT0 C;  4D5C A;  5EDN A;  2LKX A;  3GTO J;  2JK3 A;  5FLM J;  1Q1V A;  2DTZ A;  1JKQ C;  3Q0U A;  1YRN B;  3UKG A;  2DA4 A;  2K9S A;  5GPA A;  1F36 A;  4JYK A;  2E1O A;  5JLX A;  3HGY A;  3BTC A;  3FK7 A;  3JRF A;  4C3J J;  1JJ6 C;  2AO9 A;  1MBH A;  1FJL A;  1U9O A;  3E7L A;  1ZR4 A;  2EZI A;  2E19 A;  4DW6 A;  4FE4 A;  1GDT A;  1IG7 A;  1I3Q J;  3Q0V A;  1RKW A;  1HOM A;  5IYC J;  3QPL A;  1GV2 A;  1XG1 A;  5F08 A;  3S17 J;  4BXX J;  3M3Y J;  5J1Y A;  2L0K A;  4DYR A;  3CCY A;  5K7F A;  3LNQ A;  3DCF A;  2COB A;  4FE7 A;  2JWT A;  2OPT A;  3OOU A;  5IP9 J;  4A3J J;  1LE8 A;  4JX6 A;  2R7Z J;  1FIP A;  3QPS A;  4D7M A;  4XK4 A;  1K61 A;  3FK6 A;  2E2I J;  5F0C A;  1DU6 A;  1A6I A;  1JKO C;  3S1Q J;  2VI6 A;  4AYB N;  3JRG A;  1IRZ A;  3CMY A;  3GBG A;  3SDG A;  2HOS A;  3ZQI A;  1VFC A;  1OFC X;  4MLO A;  1IUF A;  2XB5 A;  1ETX A;  2H8R A;  2NVT J;  5K7H A;  4DZP A;  2LTP A;  3QQA A;  4AUX A;  3WHB A;  2M2E A;  4A3D J;  1P7J A;  5EG0 A;  1NK2 P;  2JA6 J;  2AHQ A;  5E3O A;  1U78 A;  1UMQ A;  2X9D A;  2XGE A;  4M3E A;  4FIS A;  3MVP A;  5GP9 A;  3S2D J;  2DMQ A;  5FKM A;  3S1R J;  2CUF A;  1HF0 A;  2ID6 A;  4IEJ A;  2FD5 A;  2L7F P;  1T33 A;  3CQZ J;  4I6Z A;  3BR0 A;  5DS9 A;  2E2H J;  1AKH B;  4M3B A;  2P81 A;  4EEF G;  5IP6 A;  1O4X A;  1AU7 A;  3TW7 A;  1MNM C;  3I4N J;  1ENH A;  5DTD A;  5EZG A;  5EF6 A;  2ZB9 A;  1JUP A;  1SAN A;  5IYD J;  4M6V A;  3OSG A;  4C2M J;  2E2J J;  3FKI J;  3D1N I;  1IDZ A;  3OIO A;  3HOX J;  1MSE C;  5EEA A;  4A69 C;  5IOZ A;  4BY7 J;  2HOT A;  2IEK A;  2Y30 A;  5IPA A;  1HDP A;  2EQR A;  2KDZ A;  4IHV A;  1AHD P;  3H0G J;  2TCT A;  3GTK J;  5FKK A;  2K9Q A;  2DMT A;  1WI3 A;  2HI3 A;  1WPK A;  3JRA A;  3JRC A;  1POG A;  1OCP A;  1ETW A;  1U9N A;  4UUT A;  1OJL A;  1U8B A;  2ME0 A;  3A01 A;  1SFO J;  2XB0 X;  1E3O C;  3NAU A;  1VI0 A;  1ETQ A;  1I6H J;  1ITY A;  3O8H A;  5C44 J;  3ZQC A;  5M5X J;  3F0C A;  3LSR A;  4A3M J;  1R9T J;  1W0U A;  1W0T A;  1HCR A;  3RKQ A;  3HBL A;  2HYJ A;  4X6A J;  3TP0 A;  1CQT A;  5E3N A;  2Y0S N;  4XIC A;  2M8G X;  5J1U A;  1B72 A;  3BQY A;  1VF9 A;  2R5Y A;  2QF7 A;  5FJ8 J;  1RES A;  1JT0 A;  2XSD C;  5F1J A;  2DA3 A;  4XRM A;  2LLK A;  3BR3 A;  1H88 C;  3S1N J;  2JJ7 A;  1HDD C;  3Q0W A;  4A3G J;  4MO7 A;  2HXI A;  2MSY A;  3ZQL A;  4V2F A;  3A03 A;  5C4X J;  2K40 A;  1WCM J;  3RZO J;  3BG9 A;  3I4M J;  4IHW A;  3ZQH A;  5F27 A;  4QIW N;  4B3A A;  3HOZ J;  4M3G A;  5EGO A;  3LSG A;  3HOU J;  1ZQ3 P;  2DMN A;  3FIW A;  3GTQ J;  1MBE A;  1GV5 A;  3LOC A;  5EYR A;  3TW6 A;  4RDU A;  4MFD A;  3G1O A;  2L7M P;  2R93 J;  2EBI A;  1BW5 A;  1LE8 B;  2GM4 A;  4IHY A;  4A3L J;  2RAE A;  2VUM J;  4Y7N J;  2JA8 J;  2FJ1 A;  1IGN A;  3BTI A;  2YUS A;  2DA1 A;  4AC0 A;  1P7I A;  1TWC J;  3CDL A;  4BY1 J;  4MFE A;  5F0H A;  2VPR A;  1RPW A;  4XRS G;  3IH2 A;  1T56 A;  3S16 J;  2O8K A;  4A3C J;  2XRL A;  4BKX A;  4LOC A;  1ETO A;  5M5Y J;  3W6V A;  2R0Q C;  5EG0 B;  1QVT A;  2XPV A;  1PUF A;  1IC8 A;  3S1M J;  4M3D A;  1VND A;  2JMW A;  1ORK A;  2NVQ J;  3HGG A;  1MBK A;  2HDD A;  1LFB A;  1X58 A;  9ANT A;  1RET A;  2XPU A;  1GUU A;  4A3I J;  2ECC A;  1FTZ A;  4XRS A;  4B4C A;  2DJN A;  4A3F J;  1JUS A;  3PM1 A;  2W48 A;  4W1U A;  4C3I J;  2CUE A;  5E3M A;  1H89 C;  3S2H J;  3MKL A;  1WH7 A;  4DZJ A;  1ETY A;  2NOG A;  4CYC A;  2GLO A;  1JUM A;  3RQI A;  2N8G A;  4S0H B;  3JRH A;  4GFB A;  1EF4 A;  3DEW A;  2I10 A;  1LFU P;  1JJ8 C;  1Y1V J;  1X2N A;  3BR5 A;  2R5Z A;  4UUS A;  2YU9 J;  3PO2 J;  4B1R A;  5IOY A;  1ZR2 A;  2HQ5 A;  1FTT A;  5F0F A;  3HM5 A;  3B6C A;  3G1M A;  1X2M A;  3IH3 A;  3A01 B;  2IAI A;  2ME6 A;  2Y31 A;  2DA2 A;  3BG3 A;  5J3L A;  4DYC A;  4L5E A;  3HDD A;  2DMU A;  5M3F J;  1JTX A;  4MIM A;  2L9R A;  5C3E J;  1IV6 A;  1ETV A;  3C2B A;  5M3M J;  1Y1W J;  1MH3 A;  5F04 A;  3BQZ A;  1MSF C;  2B63 J;  3ZQF A;  1JT6 A;  4HNV A;  1JKR C;  1B72 B;  1B8I A;  3PO3 J;  4I76 A;  5FKN A;  2NS7 A;  5M5W J;  2MW8 A;  2JA5 J;  3H3V K;  2R5Y B;  4D5F A;  3BG5 A;  2CRG A;  2PMZ N;  4M3F A;  1A5J A;  4BBS J;  4QTR A;  1S7E A;  4JX4 A;  1YRN A;  2R92 J;  2M34 A;  2FQ4 A;  2LY9 A;  3S14 J;  2ELK A;  1UHS A;  2X48 A;  3IV5 A;  5K7Z A;  3GTL J;  2QCO A;  3Q3S A;  5EGO B;  2IBD A;  1BL0 A;  3GTJ J;  2CU7 A;  2JA7 J;  3HOY J;  1WGX A;  3JRI A;  3HOW J;  2O9L A;  1OCT C;  2KT0 A;  2YS9 A;  2ID3 A;  3K7A J;  2HOA A;  2LFB A;  2MGQ A;  4FCY A;  3ZOB A;  3BT9 A;  3IH4 A;  2LVS A;  2O7O A;  5EZH A;  4A3E J;  2H1K A;  1IDY A;  1H8A C;  5GPC A;  1BJZ A;  2NVY J;  3GTP J;  2EZH A;  1FIA A;  5IYB J;  4G12 A;  3M4O J;  3O8G A;  2M9H A;  1I50 J;  1NTC A;  4A3K J;  1F43 A;  2DA5 A;  2EZL A;  2M0C A;  3GTG J;  1NK3 P;  1XC5 A;  3FIS A;  2CQX A;  2DN0 A;  2WB1 N;  2ECB A;  1QPI A;  5IP7 J;  1FEX A;  2DMP A;  5HOD A;  1QRY A;  3SFI A;  1PUF B;  2XPW A;  3HB9 A;  3NAR A;  5JLW A;  1BW6 A;  1QVU A;  3BR1 A;  4X1E A;  4IHX A;  2LD5 A;  4Y52 J;  1IJW C;  1JGG A;  3G1L A;  3RZD J;  3LSJ A;  4C3H J;  3SJM A;  5FLV A;  1TC3 C;  2G0E A;  2EH3 A;  2NVX J;  1AKH A;  4NDL A;  3BR2 A;  1RKT A;  1TWH J;  1UG2 A;  3BTJ A;  3L1P A;  4FTH A;  3JRD A;  2DA6 A;  2TRT A;  2LK2 A;  2MG4 A;  5C4J J;  2EZK A;  3JRB A;  4BBR J;  1BA5 A;  1TWF J;  3MN2 A;  2K9N A;  1TWG J;  1MBJ A;  1K83 J;  1WH5 A;  4D7N A;  3BR6 A;  4CYC B;  4DYQ A;  2DA7 A;  5E3L A;  4A93 J;  2JN6 A;  1ZKG A;  3B6A A;  4W97 A;  1Z0X A;  2CQQ A;  5BNG A;  1GVD A;  1JTY A;  1MH4 A;  3LSP A;  2XGC A;  3OSF A;  1ZGW A;  3JRE A;  1APL C;  1MBG A;  2R5Z B;  1DU0 A;  4UUS B;  2LR8 A;  3ZQG A;  2GBY A;  3TED A;  2VKE A;  2L7Z A;  2OF7 A;  4RBO A;  3TP3 A;  4JX5 A;  1G2H A;  5J1R A;  4XID A;  2VKV A;  2NS8 A;  2WV1 A;  1TWA J;  5FKL A;  4QSH A;  1ZTR A;  3GTM J;  3BTL A;  1XS9 A;  3VPR A;  3HOV J;  2Y9Z A;  2Y2Z A;  4ABZ A;  1JKP C;  2LP0 A;  3JR9 A;  5FKO A;  3A02 A;  2WAQ N;  1ZK8 A;  1RR7 A;  2HXO A;  2X6O A;  2CJJ A;  3WHC A;  2D5V A;  1ETK A;  3K2A A;  1MBF A;  3S15 J;  1B8I B;  4A3B J;  3HEF A;  4JP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...