2OV7A

The first domain of the ribosomal protein l1 from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
GKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 27
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2ov7A01
2OV7A 2VPLA 2OUMA
chains in the Genus database with same CATH superfamily
2RNGA 3PO3J 1MMAA 1WH5A 1MJ9A 3M8JA 3WU0A 4DIQA 1D0ZA 2X6WA 2ZMEB 2K9SA 2VBWA 2MYSA 2BY1A 5LRRA 1TQPA 2YX7A 1W7PA 1RKWA 5DCMA 3CD6I 2QYOA 2FMYA 5CVVA 4ZJZA 1FBUA 4BXXJ 4BXFA 3L00A 3ML6A 1RETA 1Z21A 2R0QC 4W97A 3OMYA 1JT0A 5HLTA 2B63J 4W1UA 1LVAA 3CJRB 4BHCA 4D9JA 3QPHA 1XMAA 3WTSC 2BGCA 3I54A 4JYKA 4RAYA 2DN0A 2NVTJ 1SAXA 3O8HA 2X85A 1FJLA 4IL6C 2CMPA 3PIOF 1AKHB 3D5SC 2NOGA 5J3LA 4KFCA 2LY2A 3HSEA 2Z9OA 3HGYA 3ZN1A 2XHKA 2E1NA 5LGTA 1Y0NA 4E4HA 1BM9A 4G6QA 5L3GA 4UXNA 2A61A 1FOXA 2G7HA 2MC3A 3MZ8A 1BI1A 1Z91A 3CMMA 2ZJQF 4L0YB 3DXJF 2D45A 2DODA 1IN7A 3BZCA 2CQ7A 1SFEA 4A3KJ 1NK3P 3F8FA 3GMEA 4MLOA 3SZTA 1QHHD 5IT3A 2L9SA 3S2DJ 5LGUA 4IJAA 5LFAA 2CFXA 2Y0MA 2H8WA 3OOPA 1QU3A 1WI3A 1SVLA 1K83J 2G7UA 2XSDC 3WE3A 1H0MA 1FIPA 3FMQA 1WJDA 3GTMJ 2D5VA 1YS7A 2A6EF 2OV7A 2XGDA 3CJQB 3GZ5A 2BBYA 2LRDA 4Q4ZF 3MKYB 3GTKJ 2IS1A 1B4AA 4KN7X 2FUG2 1DQUA 2W1OA 3GX4X 5HS9A 3BR6A 1SVMA 1D1AA 3JAMZ 3A1YA 4E7IA 3ABMH 1JKQC 4A3JJ 3TDZC 4Y13A 1MNEA 4G7ZF 1ZR4A 2B9SA 1Z6TA 3F6OA 3KP4A 1HCRA 1ZREA 1LKXA 1S5LC 3HKZN 3IP4B 2JWTA 1S7OA 1X3WB 2FBIA 4A3BJ 3QQAA 4KDPA 5K5RA 4EQQA 2E2JJ 4S04A 4EEFG 3V7SA 3I4PA 4B4CA 3RPUA 3C2BA 3EQLF 1UG2A 2LNBA 3OYIA 2Y9ZA 5F1JA 5HNHA 4MGRA 3CCLI 4BDYA 4CYDA 3IKTA 3JAMK 1R7JA 1XGOA 3ZGKA 1WWXA 3OYNA 3KP3A 4BQNA 5GTHC 3K2AA 3PJRA 1YRNB 4IRGA 5H6RA 3ZQGA 3JCUC 2CV1A 2KDOA 4KUMA 5FLXK 3NARA 2O03A 1HW1A 3K7AJ 3LSHA 3LQRA 1UFMA 5DTDA 4AD9A 5EGOB 3EUKL 3LFUA 4M6YA 3PNTA 4ESFA 1T0FC 2VUMJ 2EIKH 4L18B 4U7DA 1D0XA 4E7SA 1ZGWA 1I1SA 2YU9J 1ORKA 1HC8A 3OYGA 2A05A 4QIWN 2MSYA 3VWBA 1KA8A 2BYVE 3JTGA 2E19A 1R00A 4E7LA 2BY0A 4DJAA 1IV6A 3K4CA 3QOPA 4RGUA 3E5QA 5FD5A 2OCEA 2FMLA 3B02A 3BOQA 3LOCA 2E1MB 5HOOA 5FRMA 4C9YA 1SFOJ 5HLGA 2XF6A 4XKCA 4NQWB 3HSFA 1IRZA 1H9GA 1ACIA 3HOTA 2Z2SB 1HKTA 3FDYA 1P4AA 1S29A 4OINF 1R58A 2VASA 2VJ4A 5LHIA 4LB5A 3FXRA 4IVNA 1D8KA 1IDZA 2LFBA 4JX6A 4RB0A 2KIQA 4AYBA 4KISA 5CVUA 2HXIA 5JLXA 3CLOA 1QNTA 5E3LA 3M1CA 3LSTA 4BL0B 4EJOA 4D5CA 2O8KA 3Q0WA 2I10A 3GBGA 2XB5A 2GM4A 3FXUA 2LF8A 4L5JA 3PUBA 2MD0A 4MFEA 1T0FA 2IBDA 1MNMC 4M9SA 3OYMA 1MBFA 1V5GA 3FMSA 4FE7A 1U6GA 1MDMA 2OQRA 5FO5A 4XLNF 3HIFA 4DYQA 2OTJI 2VN2A 4ABZA 1B9NA 4A6DA 1MMSA 3FF5A 2VPRA 1I3QJ 5KHDA 2L0KA 3KZZA 2ZXJA 5DV5A 2MLKA 4BJ6C 4KMUX 5F27A 2M9HA 2QZ8A 2G0EA 3ZPLA 2Y30A 3DWLE 2RQQA 4HF1A 2ZCWA 3HRMA 3WGHA 3BPVA 1BI0A 2GAUA 4M3FA 2P7CB 1SMYF 3LSKA 4CYCA 3S3NA 4GXOA 3FK7A 3L2UA 2MD5A 2KHMA 2F48A 3QYBA 1OMIA 3S8PA 5K5QA 5FLVA 3G1OA 3OR1C 2YPRA 4ZDPA 4OMYA 2QF7A 1MMDA 2R7OA 2OQGA 4RBOA 2KJBA 4DBQA 3K70D 3OSGA 3LQQA 1W7PB 3FK6A 2QCOA 3K6GA 3L2WA 4IHYA 1P4XA 4R8HA 1Z05A 2CRGA 2KZVA 3LA7A 5H2FC 4O6JA 1E3PA 4DOZA 3E0JB 1BIAA 3BT9A 2UWMA 2ME6A 3JRDA 3HYIA 2L01A 1X3UA 1YITI 5D8LB 4XSZF 2TDXA 1ON2A 1USTA 3KCCA 2IA0A 1TWGJ 3F8CA 1YIJI 4EJTA 5ICCA 3BTJA 4N0BA 4G6DA 2PJPA 3S1MJ 2HQRA 2EFNA 3ZQ7A 1J59A 1RUNA 1DGRM 2LOOA 2DK5A 1REPC 2DA3A 3I0TA 5DM6F 4WXHA 3KFWX 3R4KA 2ELJA 2WWYA 2BV6A 4A69C 3HOZJ 4EJUA 1WHUA 1ZAOA 1UMQA 3J7YJ 2F5VA 2VQLA 1LNWA 2UZKA 3ASNH 2YU3A 1JKOC 1ON1A 4QPQA 4ZYHA 1JUPA 2JRTA 2V6CA 3K0LA 3AAFA 4ESJA 2QEXI 4EM2A 2XPVA 3DPLC 1U5TB 5HDNA 1ULYA 2LD5A 2LK2A 2UXXA 4HV6A 1QZYA 1IXRC 3AG1H 3GVAA 3JREA 2XAUA 1T95A 2G9WA 1TLHB 3IAM2 3N05A 1YFHA 4Q5SF 1BI2A 5F1RA 2XSJC 4YEJA 5FKNA 1OKRA 3JRGA 2VC0A 2K3FA 5IOZA 4A93J 4A5NA 3TP3A 2R93J 2OF7A 4I09A 3GZNB 4XICA 3I4MJ 1S7EA 2LG4A 1IDYA 1EA3A 2OBPA 1R5HA 2DQLA 3HTUA 1JT6A 1FWZA 1EH8A 1XDSA 2A68F 3MZHA 3HTSB 2CQKA 1GUUA 1UHSA 3UR3C 4S05A 3BZKA 3ZXSA 3R0JA 3J81K 3OY9A 1TW3A 3I3LA 1HW5A 3M3YJ 3GCMA 3CJTB 4NDLA 1FY7A 2XB0X 3GTQJ 3WTXC 1UG0A 2GQQA 1XCVA 1VQPI 3HZJA 2COBA 3BG6A 3VOEA 3M9AA 4Y17A 3RDIA 1BC7C 2H1KA 5DD4A 1YTYA 1XX5A 3H3UA 3E6DA 1FYLA 2EPFA 3S2WA 4ENJA 2DO7A 4HSTA 2HOEA 2EB7A 2IT0A 1V5EA 2K9NA 1G3WA 1QO0D 2LY1A 4BEHA 4XOPA 1W36D 2Y31A 5JHFA 2R7TA 1U9OA 3E5UA 4U0YA 3SYTA 4OIOF 3U2RA 1JI8A 3FM5A 1S7AA 3RPUD 4ZC3A 3LAJA 3K69A 4A2UA 3ZQQA 2QLZA 3ABLH 1GHCA 2XRNA 3DU5A 2JSCA 1OCZH 4YIFA 2PJRA 3G71I 4O3MA 2PFBA 1A6IA 2ZJPF 1ZKGA 1WRJA 1GVJA 5FFXA 3GLLA 5KAIC 3KEOA 4XK4A 3I9V2 3K4MA 3JSPA 4DYRA 1Z77A 2A5WA 4E7ZA 4P5OA 2OC6A 2F4IA 1TQIA 2XAGA 4AIJA 1MBHA 4UNOA 1MMNA 3ISPA 2KMUA 4XKBA 2COMA 1Z9CA 2HOSA 3KZIC 2P81A 5IP6A 5FKKA 1WJCA 4YFKF 4Z6YA 4XM3A 2PMHA 1GXQA 2XUBA 2DXIA 3VB2A 4A3CJ 3FXMA 1T56A 4MO7A 5EDNA 1MDMB 2LREA 2LC2A 2XGXA 4XLEA 4XLPF 2ESHA 2FOKA 2KISA 1N25A 5CPRB 2VKEA 3FHNA 3I56I 3S1NJ 2AHQA 1LQ1A 2R7DA 1ZG3A 3KP7A 2D1VA 2FE3A 3W6JB 3IAS2 4RA2A 4MQVA 4FCYA 1TWHJ 4CYCB 3IH4A 1RPWA 4RGSA 3B73A 5FLMJ 1IUFA 3CC4I 1F5TA 3TQNA 4IOAF 5F08A 4RDUA 2Q8KA 1BR1A 2ZXWH 2H09A 3TO9A 1TNSA 3DPTA 2IW5A 3O2PE 2OD5A 5HNFA 2X48A 4ENKA 2XPWA 3WTYC 1SEUA 4PDKA 3I64A 3GTGJ 3TL4X 9ANTA 4AIHA 4IF4A 2HI3A 4LG0A 3F8BA 2EIJH 4DNCA 1TC3C 1T08B 3CQZJ 5FRNA 4FX0A 2EV6A 2KRHA 1YJ9I 3CCSI 4JQFA 2R5ZA 4ZDLA 3GTJJ 1KYWA 3FBNB 2E7XA 3HB9A 5KVRA 3G1LA 5D4RA 3J7AY 2O8XA 4RLQA 3ULQB 4OIRF 2XC7A 2VXZA 3NQOA 2L7MP 3LMMA 3QOEA 2RV8A 5B3SH 2V26A 3DKYA 2KL4A 1X2MA 3F8MA 4A3DJ 1JUMA 1IXCA 2L9VA 4ZYAA 4CZCA 3OL3A 4F92B 1Y56A 3OSFA 3GTPJ 1IXSB 2OZ6A 3MAJA 4I98B 2JMWA 4IHXA 2ID6A 3WTUC 4LLGF 4XLCA 2J5OA 1T6SA 1K79A 3FXOA 1YS6A 3MZYA 5BOXA 3BLYA 5LD2C 2FQ3A 4FE4A 2IGMA 3H5RA 2R7VA 5J40A 1XSVA 4JX5A 4I2OA 3DTKA 6PAXA 3QPLA 3HPHA 4FTHA 1JKRC 5AIPA 3BG7A 4BQQA 2FQ4A 1WGXA 1A36A 1RR8C 1BN5A 3FISA 3HGGA 1FLIA 1VQ5I 2KIFA 3K4NA 1IN4A 4QWQA 2GWRA 3BQZA 3OIOA 4CICA 1EH6A 5D5UB 2OPTA 2WB1A 4HAMA 3GXOA 1JHFA 3OYCA 1BA5A 4GO1A 5TGTA 1T8IA 1RC9A 1MBEA 3CO6C 1V5FA 1WSUA 2H27A 1XB4A 2HS5A 2WAQN 5EZGA 3DCFA 3J80Z 3K1PA 2M7BA 3IH2A 5JVTA 2BHYA 5DCFA 1GVDA 1QBJA 1MH4A 2HPIA 3BP8A 1FSEA 4M3DA 1U78A 3Q0VA 3BTIA 2CQNA 2EA2A 1TWCJ 1PUEE 3WTTC 4A5MA 2Z33A 2R7XA 2KLOA 3IL2A 1DU0A 4XRMA 1E3OC 1XS9A 2NVUB 2WAQA 2WA0A 2K4BA 3GLXA 5CVIA 4LK0F 2Q2EA 3K4KA 4BH9A 2HTJA 2RVCA 2BY2A 1Y0UA 1O4XA 3KYLA 4BXUA 3L9FA 1QGPA 1PJRA 4ZH4F 3J80K 5J4VA 3QP5A 4LLNA 2BXZA 3ZQHA 4EJWA 2NOJB 2FX0A 4BBRJ 2BEOA 2ESNA 1ERDA 3IKVA 2UUZA 3HSRA 1BR2A 5FGMA 2F5EA 4XNFA 1YJWI 4JP0A 5DS9A 3S3MA 4P96A 4BY1J 3SEQA 2EFPA 1OCOH 3HUGA 2NS0A 2IAIA 2DLLA 1PUFA 2V4JC 4RAGA 2TRTA 4LMYA 4C30A 1FBQA 1QZEA 2RNJA 3CP8A 4RGRA 3ZQIA 3J7ZI 3S32A 1DUXC 1ZELA 2K9QA 3T8TA 1NG6A 1K6OA 2JK3A 4D5FA 2HVSA 2O7OA 3LSRA 1F36A 1QPMA 3T0YA 3RI4A 4BEHB 2NXNB 1LPQA 1XN7A 2AO9A 2KJCA 1MBGA 5LHGA 1STZA 2DK8A 2OAZA 4IO9F 5E1ZB 2FNPA 4UUSA 4IHWA 2RQPA 4MNUA 3CJNA 4QSHA 2ZNYA 2CUJA 2IS6A 1A6QA 1N78A 1SANA 4IQ4A 3QWLA 3LFKA 4RLFA 2PJRB 1FYKA 3ZMVA 4HEA2 2R7SA 1ETWA 2Y75A 4M74A 3WE2A 5EYRA 4NC8A 2DFFA 5F04A 1OYWA 2WTEA 1R6RA 1TWFJ 3DEUA 3QYEA 4P9UA 3FZVA 4UUVA 2HYGD 2V6EA 2NYXA 3K4LA 2NAZA 4RB1A 2QUFA 4IPAA 2RAEA 1X1DA 2HQAA 1ZTRA 5HS7A 3RIRA 1XPXA 4CCMA 2VI6A 3IWFA 4OIPF 1AOYA 3ABTA 2JRMA 1D1BA 2V1XA 1YE9A 4F93B 4QTRA 3F9KA 3CDIA 4RAFA 2PEXA 3EUHC 3H0GJ 3I4NJ 3PM1A 1GXPA 3BTCA 1FOYA 4FISA 2M30A 2K40A 5IP7J 5D6EA 2GA2A 1VQ4I 4QLCU 5CQGA 4ZTFA 3WTWC 4XLAA 4HX4A 2JZYA 2W57A 2W85A 3FWEA 3E6CC 4IEJA 4Z2YA 4M3EA 1Y6IA 1YIOA 3CDHA 2VQGA 4M71A 4XRSA 4A12A 3BG5A 1R5ID 1IAWA 4V19K 3O8GA 2R3SA 2IGNA 3IRQA 1E17A 4M9ZA 1UAAA 3G4SI 1B59A 4A0ZA 5C4XJ 1SAUA 5FLXZ 4HW0A 3ZMSA 1VQMI 3ZOBA 1JKPC 1JTYA 2EINH 1SD5A 2CQQA 1WQ2A 3JR9A 3HOWJ 2ZSIB 1JHHA 2NNYA 3LSGA 5L3FA 4B44A 3BPXA 2HEOA 1JTXA 4MTDA 1A31A 1KU9A 2JA5J 4LG0B 4Y3OA 1RZ4A 4B3XA 2X0LA 3EUHA 3HKZA 2R5ZB 2LH9A 4WX9A 3DEWA 2MH2A 4BQAA 2HKXA 2XROA 4HF2A 4RS8A 5GP9A 2W84A 1F4KA 1WPKA 3DBRB 1B6AA 1IV8A 3FHZA 2EILH 2R7WA 4ZYEA 2ZFUA 5FD6A 4PJ0C 1RRJA 4ON0A 4U0VA 2Q0OA 2IGKA 3OYDA 1FC3A 3ZP5A 2M34A 3AG2H 1G8XA 1YW9A 1P7IA 3HRUA 2DMNA 2X6XA 2P5LC 2HFHA 3ABKH 4CH7A 4YG2F 2STWA 4XR6A 1XGSA 3G6EI 1PYVA 5DM7F 5KCMA 1QZZA 2HQ5A 2OJED 1GLNA 2VPLA 2LKPA 2W4SA 4KJZA 1W5TA 2VKDA 3CTAA 5DUIA 2R92J 4Y52J 2P7VB 3PNYA 4A3MJ 3GEZA 2KKOA 2HDCA 3ESWB 1C0WA 1G6NA 4MTEA 2O9LA 4ZZDA 2XASA 1X1AA 4WK8F 3MEXA 1M1EB 3DBHB 2HKOA 3T1BA 3TOBA 4YRVA 2CFOA 4GYIA 4V2GA 4C3JJ 1HBXG 1JE8A 3OYJA 2XAHA 2IEKA 2DA2A 1O3SA 3N4MA 2ADUA 2LP0A 4CCLA 4A3FJ 1KU3A 4L9VA 5E18F 2PMZN 2AS5F 3JRAA 3GZ6A 5D5VB 2L7ZA 2RGVA 2O6GE 3GYHX 1VNDA 1YI2I 2LY9A 1LFBA 3V7CA 2ZC2A 4E6KG 1HKSA 3S1RJ 2MA3A 2DU9A 4EM1A 2MH9A 1Q1VA 1V4RA 3OIPA 3L2QA 2QM3A 1IN5A 2ECBA 3S93A 4A0YA 5KNLA 2Q2EB 4KT5C 2LBFA 3IV5A 2K5CA 4NC6A 1IJWC 3B6AA 3P9CA 3E3VA 2VJ5A 5EJCA 5HS8A 1T2KA 1R71A 4PGHA 5CKTA 1DGWY 3KETA 3L2RA 4X1EA 4HLYA 2F5FA 3ZMUA 1VQ7I 3CMEI 2VBXA 2M0CA 1Y8RB 3R6SA 5CQEA 4CCNA 4KIBA 3E1SA 1S3JA 2FSWA 4CUGA 3I71A 3SXYA 1A35A 5F0CA 4JK1X 3D5RC 3NAUA 3BROA 2DA4A 3HUGB 1WJ5A 3FKIJ 3H9JA 2AQFA 3PUFA 4XORA 4WCGA 3DQVC 4EGZA 4CHUA 4WXCA 1PUFB 1RKTA 3OOUA 3JRBA 4LIVA 4KIFA 1Z3XA 3DU6A 4ESBA 2PI0A 4F55A 5B1BH 1W1WE 2ZJ2A 2BZTA 1MJBA 4UVBA 1K78A 5DCMB 1Y39A 3C7JA 4HQMA 2HVRA 3PIPF 4RGXA 2CWEA 3V4GA 2YUSA 1OFCX 4KITB 1FMWA 3VPRA 4UUSB 1IN6A 2PX9A 3ONQA 1B8IA 2HOAA 3FXQA 2CO5A 3KLOA 1XSXA 3LA3A 3RCOA 4E70A 1G59A 3MMYB 4GRIA 4BGDA 2QQ9A 2EZHA 4A3LJ 3JRIA 3I55I 1T98A 3FXJA 2BVMA 2OU2A 2FOWA 5J1RA 3O6BB 4HDUA 1MSEC 4I76A 2EV5A 3GW2A 3H0DA 2AXLA 1Y8QB 2EJRA 3TW7A 1LDJA 2HVQA 5DD8A 2NNNA 2NS8A 1N77A 2EA4A 1EJ9A 1D0YA 2Y48A 3BCBA 3EPZA 3OS2A 3OR2C 3BR1A 4LFUA 2QKMB 3HC7A 1W7PD 3WTZA 2EQRA 2QGUA 3H5NA 2CGPA 4CO8A 1ZG5A 5LGNA 4GCVA 3HM5A 2M45A 1ZGAA 2HXOA 4A3EJ 2LDUA 1FMVA 4EM0B 3F21A 1JXSA 2UXNA 2N8GA 2M7AA 1OCCH 2EK5A 3VODA 4NHJA 1QA6A 1AHDP 1HQCA 5K7ZA 3HHGA 3RPQA 4HNUA 5FB2A 1UELB 3BCAA 5L3DA 4RM3A 2KRCA 1KQ0A 1WFXA 2X51A 1OCTC 4ANJA 2LF7A 1ZRCA 3OYEA 5GPCA 3UKGA 2MW8A 1HOMA 1SMTA 2M0MA 4NNJA 3SQNA 3J81Z 2M3AA 3HEFA 3U1DA 2QQBA 2DMPA 3KE2A 4AIKA 2L9RA 4PGGA 4LGWA 3V8LA 1W0TA 4DGWB 2E5ZA 5DUKA 2FA5A 1ZK8A 3DKWA 4FQGA 2E2IJ 4MIMA 3QU6A 4WWCA 4CDGA 2ME0A 1G3SA 3HBLA 3OS1A 4UVCA 1IC8A 4DQ2A 5E3OA 5FJ8J 1DDNA 4G6TB 1LFUP 1IN8A 2F6CA 3HOXJ 2VC1A 4BNCA 4RMNA 3A01A 1TNTA 4LITA 4KT6A 3TKYA 2ELHA 2IVMA 2V1DA 3LWFA 1H9TA 2A6TA 1FT9A 2M4GA 4Y15A 5DYMA 2XAJA 2CSOA 2HDDA 3KP2A 2XDVA 1SVOA 3W3CA 4EATA 5E8GA 2HPMA 3DV8A 3CC7I 3PO2J 4RB2C 1FZPB 3RKYA 2JA2A 3GUDA 3Q3SA 1P6RA 3BDDA 4I99C 4PCQA 4AC0A 2ID3A 1ODDA 1F1ZA 3KEQA 3C3WA 3CESA 1X1PA 5C3EJ 1Z3YA 2E36A 4IXAA 2KZGA 1X58A 4IOCF 1XGMA 1FTTA 4KMFA 4AU7A 2K9LA 2VLAA 3VDXA 1R22A 3D5LA 3W2VA 5FKOA 1UHWA 4LJZF 4EMSA 2CW0F 2F4OB 2JTVA 2M2EA 2CH0A 2JVHA 4AM3A 1OISA 4D0PA 1K6YA 2IS4A 5LLQA 4S0HB 2E5NA 1RUOA 4V2FA 3I5UA 4CGZA 2A6HF 3DF8A 2DI3A 2AXTC 1VQ8I 1HA8A 3RKXA 1G2HA 4KICA 1DPRA 2MFZA 2H6CA 5EEGA 4DBRA 1OR7C 4LD5A 5ERIA 4HRIA 1R1TA 4CA0A 4E7KA 1CF7A 2LLKA 2LTPA 2P6TA 5JFRA 2HYFA 3H35A 3G3ZA 2VBYA 1D5YA 2XV4S 1U8RA 4LLLA 1LVKA 1DP7P 1X4PA 3M7GA 2XAQA 4BE2A 4RM2A 1USSA 4JOMA 2FF4A 3RYPA 2VJJA 2EFWA 3AFHA 4XQFA 1EKEA 1MZBA 3K4JA 3JW4A 2DTRA 1U8BA 2XKOA 3BY6A 3TMOA 2KIUA 3CF5F 4XKWA 4PUSA 4FHTA 4MEYF 2L9NA 4ENNA 2LBFB 3DKXA 1JUSA 3DPUA 2GIZA 1ZHFA 3CCRI 1AWCA 3S17J 1ZARA 4HNVA 1OPCA 4GDFA 1QVUA 1R1UA 5HDGA 4RB3C 1BW5A 3CMAI 3A0BC 2CU7A 4MQ9F 4U87A 4EGYA 2QQAA 3COAC 3D1NI 3QYFA 4M6XA 1ZLJA 1WJFA 4RAZA 5M5WJ 1I50J 4XOTA 3CCMI 3MCZA 3RQIA 1KYZA 3ERMA 4EVIA 5C4JJ 1QPIA 5L3CA 3IHUA 4BE0A 3LA2A 2VE8A 3HRTA 5E8IA 4GYGA 1OR7A 2KIMA 3BR3A 2QENA 5JR3A 2W25A 3R0AA 5ILVA 2LVSA 1J75A 4IHVA 4M73A 5L3BA 1QVTA 4M6VA 3M4OJ 2E71A 2STTA 2QKLB 4NBQA 2L5QA 1UZCA 2VQHA 1ZH5A 1K78B 1WZ2A 4LG3A 1MSFC 4M3BA 2H1LA 3P9IA 4HX8A 3NRVA 3RSNA 4PSWA 3WU2C 1FPQA 3CDLA 4XSXF 1UHMA 2JA7J 3WGIA 4Y7NJ 5GAEJ 1FEXA 3ZMDA 3ZMTA 3Q9SA 1POGA 1R1VA 1B8IB 4BUPA 2XKPA 1O57A 2EH3A 1ZYRF 4XL9A 5K5OA 1R36A 2NVYJ 1TP4A 3OV8A 2M8GX 2MLGA 3W2WA 2BOLA 1ZLKA 4ENMA 2JPCA 2DCEA 3KZYA 3T8RA 3S3OA 1LFPA 5J47A 1AA7A 2ECCA 5IT9K 1ETVA 5J1YA 2DDBA 3OYLA 2O5RA 2XIGA 2RKHA 3KP5A 2Y69H 3BWGA 4QPOA 2DFHA 1WKMA 1B1BA 1E2XA 3TGNA 1EF4A 4YFNF 3VYTB 2F2EA 2DPUA 1BW6A 3AKZA 2YSRA 1SFXA 3G1MA 3PNVA 4LOCA 3K70C 4CCOA 5B1AH 1Z6RA 2L02A 3WHCA 2DT5A 2EWNA 2GBYA 2FEZA 5H20A 3QAHA 3IWZA 4G8XA 3SJMA 4ZYDA 1TL8A 4AWXB 4B09A 4BJTA 2X1DA 3BZ6A 2OUMA 3CCVI 4I01A 3BR2A 2L54A 5IPAA 1Z1DA 3M07A 2ZBKA 2KT0A 3X2QH 3CUQC 1LE8A 1I1GA 3BJAA 2W82A 3HDDA 3FBIB 3TBIA 4OOIA 4N9IA 2XVCA 2V1UA 1Y1VJ 3H3VK 4PFOA 2L7KA 2IRFG 3ZN0A 3P7NA 1P9QC 3KP6A 3RKQA 1K4TA 2E35A 1IUYA 2VT2A 3ZMZA 2FNAA 3GFJA 4UV8A 2TCTA 2ISYA 3KX2A 1ZN2A 1W5SA 2X6OA 3U1KA 1JJ8C 3RTRA 3CCUI 1K61A 2EZIA 2DYRH 2NVQJ 2Z1DA 5D5XB 4HBLA 4HQEA 3EYIA 4NC7A 4N4NB 3A01B 1Y1WJ 2K7LA 2FRHA 3E6MA 1FTZA 1YX3A 1I27A 1FOWA 2E1CA 2QBYA 3BQYA 4B48A 2P5KA 3CUOA 4Q48A 2YX4A 4JX4A 2M8EA 2MGQA 1A5JA 3REOA 2R7ZJ 2NVXJ 3I58A 3K10A 1TT5B 1EH7A 1Z67A 2VE9A 4L9JA 2JN6A 3BC8A 5K7HA 2P8TA 2EBIA 2VQCA 2QSGX 5LRSA 4BS9A 1W5CC 3F22A 4BJ5C 4ZDOA 3CUQA 5HODA 2K9MA 3QPSA 5LBQA 3L1PA 2R7QA 2F5DA 2JVGA 4WXDA 1EV7A 3KEYA 4I0AA 3NEUA 2WV1A 1OCPA 1YHQI 1O3TA 1I5ZA 2DQRA 1LJ9A 2QQ8A 5DDGA 1HDDC 3MWMA 2KQRA 3BR5A 3ECOA 5ICFA 3J7AO 2O61A 3P9KA 1HW2A 1SFKA 3SFIA 4J00A 3ZR8X 1JGSA 4HDVA 3JRHA 4UB6C 1FSHA 3ZRGA 2W48A 5GPAA 1O3RA 2R7RA 2W7NA 3VFZA 4TV7A 1OCRH 1U5TC 3K4BA 1HSTA 2IPQX 1X1CA 4K2EA 1BJZA 2DBBA 2K85A 3W6KB 2E7WA 4AVPA 4IX7A 5F0HA 3R61A 1CF7B 1SFUA 1YX5A 3DP7A 1WJEA 2IS2A 3U9GA 1LDDA 2LMDA 3AL0C 2CW7A 5BQTA 3MKWB 3HG9A 5EEAA 2DA7A 2V9VA 3DFGA 5DEQA 4FETA 3UNGC 2HYJA 2DMQA 4U7BA 2HTSA 4J19A 2DJIA 3KYCB 2L4AA 2X1CA 2CS3A 1NH3A 1FOKA 2A07F 3D0SA 5CVRA 5F64A 2ZO4A 3I59A 4BDZA 1W36C 1O7LA 3CZ6A 3K1MA 3BJ6A 1U0JA 3M8EA 2UV1A 2V79A 2BY3A 1WJAA 4F91B 3S1QJ 2XRLA 2HWVA 1VQOI 5HLHA 3QPTA 1S6LA 2HZTA 4C3IJ 4R1HA 2GIVA 3Q5FA 3C1DA 3KIOA 4CZZA 2PLYA 4KA4A 2X6YA 3QU3A 4II3A 1GT0C 1MBJA 3H5AA 4C2TA 2A69F 5E1WA 3EUAA 2Z16A 2WC2A 4D1QA 1HF0A 2RN7A 4DZPA 1ENHA 5GTIC 1LEBA 2ACJA 1RIOH 5D6FA 1U5TA 3WG7H 5JVGF 1VQKI 4PJNA 1V3FA 4BAYA 3NWSA 4HOBA 1I3AA 2HR3A 1XMKA 2CW8A 4PK4A 4UV9A 4ASNA 1HXDA 1YW7A 1VQ6I 2PMUA 1MKMA 2VXDA 3FXLA 1R9TJ 1H89C 4MEXF 4HX7A 5F0FA 2L4MA 5LEJA 4NB5A 5GAHJ 3IRRA 1J5YA 1MGTA 1OLTA 1KQ8A 3DEEA 5H6QA 3SZGA 3TOAA 1VQ9I 4B1RA 1MD0A 3T5XA 2D1HA 2Y9YA 3BG9A 3OYKA 1CQTA 5J4YA 3E7LA 4LK1F 3CC2I 2CV2A 2E34A 3QP6A 1ZR2A 3RYRA 2CUFA 3H9QA 2Z99A 3KLNA 1WCMJ 4MFDA 4ETSA 2R5YA 4P55A 4C2MJ 2BHZA 1H88C 2PN6A 4UVAA 2EFQA 4KNYA 2P0WA 1D3YA 1GDTA 1P2FA 2DA1A 3VYRB 3QRFF 2PG4A 4FASD 1BBYA 1X1BA 3CCJI 5KAFC 3CCEI 1ZGJA 4FT8A 4GGGA 2ZNZA 1O3QA 4XIDA 3IUOA 5K1YA 4X0GA 2JSPA 1B72A 1RNLA 4L9TA 4PFPA 2DOFA 3H92A 1G3TA 1VI0A 5AONA 2RREA 4JBAA 5K7FA 4YELA 2WY8Q 5IY5H 4OAYA 1T39A 2ISZA 4U88A 1KGSA 5JLWA 3CP2A 1R49A 5J1UA 2KDZA 1S72I 2I5UA 2V7FA 1YO5C 2YR2A 4HPQA 1NG7A 5ILSA 4U0WA 1D5VA 1R23A 1XGNA 1LE8B 1OQYA 5J6XA 3ZCOA 5F6FA 3PFIA 3SZPA 2OTLI 2VBZA 2YS9A 3LAPA 3ASOH 4B3AA 2FD5A 1HDPA 2HQNA 1BL0A 2GLOA 1DP3A 3TW6A 2BW3A 1XSDA 4AIDA 5J8CA 1IGNA 4II2A 1E3HA 2XGEA 2M5WA 4AYBN 1S8NA 2X9DA 3DLLF 3CF2A 3EDPA 4KN4X 5IYBJ 5FKMA 1I39A 1MW7A 3RJPA 3R60A 3HOSA 4UY8I 2ZXIA 1TWAJ 3F0CA 5C44J 5M3FJ 2FXAA 3MVPA 1FYMA 1TTYA 2K3PA 2LR8A 2QA4I 2ZSHB 3IH3A 3CCYA 1LB2A 2KFDA 2PMZA 3PL8A 2O3FA 4HLXA 2H8RA 2P6SA 5FKLA 2EZKA 3E6BA 5BPDA 1IZ1A 2QBYB 4H4KC 3VSKA 5ILUA 2JJ7A 1YYVA 1RR7A 4PJLA 3V42A 3I53A 2R7UA 4Q47A 2F4MB 1WH7A 5CLSA 3LL7A 4N9HA 2CV0A 5HVQC 2DA5A 1TW2A 2R7FA 3ELKA 5EEHA 4I6ZA 4YFXF 1RI7A 2HGCA 3C2GA 5M3MJ 5D4SA 1WVRA 2WADA 1VTNC 2Z5UA 4L9NA 3SDBA 3GFLA 2IA1A 3CUQB 3LSIA 4Y33A 1N75A 1Q1HA 3RZOJ 1V55H 4C3HJ 2E60A 2NS7A 5CVJA 2ZB9A 2Q1ZB 3VYUB 2DMUA 2X1EA 4B43A 1PP7U 3OS0A 2OZUA 3SEZA 4DYCA 2KRFA 3L2CA 4HF0A 2NRAC 2IJLA 2ZFWA 3AG4H 3ZQCA 4IZZA 2E1OA 2WBMA 4IRHA 1ZG1A 1YW8A 2DDAA 3GF2A 2HDWA 2H6BA 4HG2A 3GWZA 5AIQA 2LYCA 3PSFA 4I0BA 1WJBA 4C2UA 2GXBA 5ICGA 3VYSB 4XN0A 4EV0A 1L3LA 3DTEA 2M1BA 5E17F 4HNTA 2MBFA 3RZDJ 1HLVA 3LSMA 1MBKA 1CGPA 2DOEA 3FIWA 1SD6A 1HKQA 1U2WA 2J5PA 4CCKA 2HNHA 4X6AJ 3A0HC 1QRYA 3WTVC 2BE5F 1Z7LA 1W4MA 5D8KB 3K1NA 1LUJB 4O5VA 3ZQLA 2CG4A 1VFCA 1AU7A 4PZJA 3F6VA 5A2QZ 4IKFA 1BR4A 4BHPA 5TJJA 1ZQ3P 4P9FA 5GAGJ 3G73A 3FKJA 2QSHX 3PSIA 2ZXHA 1YQAA 2X4HA 4A3GJ 3FMRA 5KK1A 3MKLA 5IOYA 1O7FA 2HZDA 4XLHA 3DLAA 4HZFA 4H0EA 3I59B 3OYAA 3HXLA 3HOUJ 3QODA 2JA6J 4I02A 3HHHA 2GXGA 3MN2A 1MIJA 2XPUA 5CJ9A 5JI6A 1TT0A 3P5JA 1R4MB 1PDNC 2DJNA 5HDKA 5J8FA 5EF6A 1KONA 3N97A 2LSOA 1FIAA 3A2KA 3TO6A 2DW4A 1KZHA 3MFKA 5E3MA 3L7WA 4UB8C 2K02A 5A2QK 2PBIA 1APLC 1SC7A 3H1CA 1FP2A 2VOOA 4BBSJ 1BOBA 5GADJ 4FX4A 3PQKA 4J01A 2DOAA 3CCQI 3OIQA 2IGOA 3AG3H 4ZZLA 4R79A 1J2XA 1OJLA 4ZYGA 1X3ZB 3L09A 1QHGA 4PJJA 2L2OA 2CUZA 3Q0UA 3JSOA 3F23A 2KPMA 2ZMEC 3OYBA 1JGGA 4ITVA 3AL0B 3S14J 2ETHA 1D8JA 4BKXA 1SD4A 3OWTA 1G3YA 1X4OA 1ZRFA 2RC4A 4LIUA 3IC7A 1MMGA 1L0OC 1QQIA 4WF2A 5EG0A 4F52A 4XRFA 4AVZA 2QVOA 4D7NA 2ELKA 3VEPA 2GOMA 3NWTA 1U3EM 3KYDB 1LEAA 1ITYA 2M4KA 2R5YB 3TP0A 4B47A 5D5WB 1IO2A 2VKHA 3KPHA 1NHAA 2EFOA 1SD7A 3FM3A 3S2HJ 2D2WA 1TBXA 4AUXA 3TEDA 2VKVA 1P7JA 1MNDA 4F7ZA 3JTHA 3SFZA 1B72B 1XG1A 2L3DA 3CMYA 3GTLJ 1BJAA 5B5EC 4PSXA 2R4GA 2XAFA 4M3GA 2OA4A 4DZJA 4GFBA 2VIXA 1ZRDA 3C18A 1LDKB 3DTIA 5FFZA 3BTLA 2QSFX 3SHFA 3V8JA 2EV0A 5E20A 4EJVA 1DU6A 4IRIA 4HA8A 2ZMEA 3BJOA 2XF5A 1DPUA 1D1CA 4OWRB 5E1XA 1UB9A 3EYYA 3GFMA 1W0UA 1ETQA 1U9NA 4OMZA 3WGGA 3CLQA 4OIQF 4P1WA 2MC4A 5IP9J 3U21A 1ONVA 1FX7A 2BW3B 1UJ8A 4E7JA 2W00A 2FBKA 1YLFA 5ICEA 2VB6A 2LKSA 1J09A 3F3XA 4M72A 3L2VA 3H9GA 2MG4A 1IG7A 2DMTA 2P5VA 1AKHA 1ETYA 3E97A 1MH3A 3H3ZA 4IHTA 2V1NA 1I6HJ 4B8XA 5EZHA 5IYDJ 2KP6A 2VT3A 2C6YA 3M1EA 1K7AA 4XONA 4A6EA 5B66C 4XKVA 2F5CA 3EETA 4BYYA 2DT7B 2Y0SN 5CYVA 5ED4A 2JPBA 1FBSA 4BU2A 1XCBA 1ETXA 1XD7A 4Y4RA 5M5YJ 1KU7A 2VODA 3MQ0A 1BOAA 2Y2ZA 5BMZA 5E79C 2JUCA 3OYFA 2CQXA 2WV0A 4BACA 1GV5A 1A04A 5LEKA 3C2HA 3WU1B 3ROUA 1NTCA 1TQMA 2MABA 4HYEA 3S15J 3M8FA 2Y0SA 4CSWA 4XBFA 1P4WA 4NUBA 4G7OF 4ZTJA 3G2BA 5IT9Z 5L3EA 3GO5A 2XGCA 2HOTA 2CYYA 4N4OB 3JRFA 4KYWA 2DT6A 2K27A 4L5EA 1BIBA 3F8NA 1VQNI 1VF9A 1Z0XA 2GZWA 2I8DA 3TDUC 2ZKZA 3W6VA 1Z7UA 3OL4A 3LNQA 1UCRA 4G9YA 4LB6B 2ICWG 2V9PA 2K86A 1XC5A 1J7KA 2QWWA 3S16J 4XN3A 1S9HA 4MHGA 3WHBA 5JHUA 2VONA 2JUGA 2WY7Q 2IA2A 3OYHA 2E1MC 1I6XA 3O3KA 2EZLA 3V7RA 5TISC 2H94A 4PJMA 2DA6A 1NK2P 1BC8C 1R5GA 1J0RA 1FP1D 2DYSH 2VJIA 3MD2A 1F9NA 1J9IA 1OYYA 4M9XA 1IRGA 1YJNI 4UUTA 2GOXB 1WI9A 4A3IJ 1FNNA 1YRNA 2WAEA 1XTAA 2B0LA 2DPDA 5M5XJ 2L7FP 2DTZA 3HPGA 2E2HJ 3RKWA 4XLFA 3CO7C 4IHSA 3HJEA 1OYIA 4BQOA 3ABUA 2M87A 1MJAA 3LSPA 3GFIA 1RESA 1PP8F 2GA1A 5EGOA 2JQ7A 5E3NA 1JJ6C 4BHBA 1IF1A 3JRCA 1P92A 2CUEA 4YIIA 5LHHA 2FU4A 2BXYA 2B7EA 3K2ZA 2XF7A 3HL2A 2DFIA 3A4CA 4L0ZB 4UHTA 1V54H 2O0YA 1TZLA 3VSLA 5HLIA 5BPIA 2WB1N 2OCCH 1ETOA 3BR0A 5IYCJ 1G4DA 2P4WA 2DAOA 2K4JA 1B9MA 3W2AA 4OAZA 2JT1A 2PQ8A 2FBHA 3FX3A 4HSRA 3HRSA 2VOPA 5TRDA 4E7HA 3TO7A 2IXSA 1F43A 4KIGA 4F3QA 2HU9A 3ERED 2VL8A 3RQ4A 4DW6A 4D7MA 1XDUA 3Q9VA 1VZ0A 3SDGA 2Z3YA 1R4NB 1T33A 4CXFA 1K4SA 2V9KA 4NQWA 3H36A 4G7HF 1IRFA 3BG3A 2W24A 1HSJA 4A0XA 4I7HA 3A03A 3FXKA 2IP2A 1E0EA 4BE1A 1KQ9A 5BS6A 2EIMH 2LKXA 3HOYJ 1IRXA 3PFYA 4XRSG 1BI3A 1PVEA 2WAFA 2ZJRF 2FJ1A 5EG0B 2A3SA 3F72A 4XMYA 3DBLB 2BVLA 3GTOJ 2RDPA 3ECHA 3ZQFA 2DFEA 1VQLI 1X2NA 3E5XA 4CCJA 3A02A 3MKZA 4L5IA 4YIRX 4IQJA 5BNGA 4BY7J 1T38A 4HV5A 3WG9A 1X19A 3PQJA 3WODF 2GXAA 1H8AC 2JA8J 3V8KA 1KU2A 3K9TA 4OU0A 1GV2A 5FROA 1YOVB 1YG2A 2CJJA 2AQEA 4G94A 1IW7F 1ETKA 3HOVJ 2A5YB 4G12A 1XMXA 3LSJA 3B6CA
chains in the Genus database with same CATH topology
2RNGA 2V7FA 4HNUA 3IAS2 1MMAA 1UELB 3BCAA 3M8JA 4HPQA 1NG7A 2KRCA 2X51A 1WFXA 4RM3A 4DIQA 4ANJA 1D0ZA 2X6WA 3OYEA 2M0MA 4NNJA 3ZCOA 2MYSA 2M3AA 1DP3A 2BW3A 4ZJZA 4BXFA 4DGWB 1BR1A 2E5ZA 4II2A 3DPTA 5HNFA 1Z21A 3CF2A 3OMYA 5HLTA 3TL4X 3CJRB 3OS1A 4D9JA 1MW7A 4G6TB 3HOSA 2ZXIA 5FRNA 2F6CA 2KRHA 4JQFA 2X85A 4ZDLA 3FBNB 2K3PA 2CMPA 4RMNA 4LITA 3J7AY 2ZSHB 3D5SC 4KT6A 4RLQA 2XC7A 2VXZA 2LY2A 2A6TA 3LMMA 3QOEA 2PMZA 2M4GA 2V26A 3PL8A 3DKYA 2KL4A 4E4HA 2XDVA 4ZYAA 3W3CA 4EATA 3OL3A 4CZCA 4F92B 1Y56A 2HPMA 4H4KC 3VSKA 2JA2A 4PJLA 3V42A 4XLCA 2R7UA 3CMMA 3CESA 3LL7A 3BLYA 5LD2C 2CV0A 1Z3YA 2IGMA 5HVQC 3H5RA 2R7VA 4AU7A 2K9LA 4MLOA 2VLAA 1QHHD 3VDXA 3C2GA 3DTKA 3D5LA 3W2VA 2L9SA 2WADA 3HPHA 3SDBA 3BG7A 4BQQA 2CH0A 2JVHA 5LFAA 3LSIA 4Y33A 1N75A 1QU3A 1K6YA 2E60A 3K4NA 2IS4A 1WJDA 2E5NA 2OV7A 3CJQB 3MKYB 2Q1ZB 2LRDA 3VYUB 2X1EA 4B43A 2WB1A 3OS0A 2IS1A 3SEZA 2FUG2 1HA8A 1DQUA 2W1OA 3OYCA 5TGTA 2MFZA 4DBRA 4IZZA 1D1AA 4E7IA 3A1YA 2WBMA 1OR7C 1V5FA 4HG2A 2HDWA 4HRIA 1MNEA 2LYCA 3PSFA 4CA0A 1WJBA 4E7KA 4C2UA 2M7BA 3VYSB 4XN0A 3DTEA 4HNTA 1LKXA 3H35A 3LSMA 3IP4B 2HPIA 4CCKA 2HNHA 1LVKA 1X4PA 1Z7LA 2R7XA 4BE2A 2KLOA 4RM2A 2WAQA 4JOMA 2WA0A 2VJJA 3OYIA 3AFHA 4XQFA 4IKFA 5HNHA 1BR4A 3K4KA 3K4JA 4BDYA 3FKJA 3PSIA 2ZXHA 3KYLA 3ZGKA 3TMOA 3OYNA 4BQNA 4XKWA 2HZDA 3PJRA 4PUSA 1PJRA 4XLHA 3DLAA 2L9NA 2LBFB 2CV1A 3DKXA 2KDOA 3OYAA 3DPUA 3HXLA 3QODA 2NOJB 1ERDA 3LSHA 2UUZA 1TT0A 1BR2A 4XNFA 3EUKL 3LFUA 3PNTA 3S3MA 1T0FC 1KONA 4U87A 3SEQA 3QYFA 1WJFA 3A2KA 4XOTA 1D0XA 2V4JC 4E7SA 4BE0A 4C30A 1BOBA 3OYGA 3CP8A 3S32A 1ZELA 4J01A 2DOAA 3VWBA 1NG6A 3OIQA 2IGOA 2HVSA 4R79A 4E7LA 4DJAA 4BEHB 2QKLB 3K4CA 2L5QA 2VQHA 1QHGA 4PJJA 2L2OA 2CUZA 4LG3A 2E1MB 2KPMA 3RSNA 4PSWA 5HOOA 5FRMA 3OYBA 2CUJA 4C9YA 2IS6A 4ITVA 3AL0B 1N78A 2XF6A 4IQ4A 4XKCA 3OWTA 4NQWB 1X4OA 4RLFA 2PJRB 3HOTA 2Z2SB 3FDYA 4HEA2 4LIUA 4BUPA 2R7SA 2VASA 2VJ4A 4NC8A 1MMGA 4XL9A 1R6RA 4AYBA 3W2WA 2BOLA 4F52A 3QYEA 4KISA 4AVZA 2DCEA 3S3OA 1LFPA 2V6EA 3K4LA 1AA7A 3M1CA 4BL0B 2GOMA 3NWTA 1X1DA 2HQAA 4CCMA 3GBGA 2M4KA 1D1BA 4B47A 3PUBA 1YE9A 4F93B 3OYLA 2MD0A 2O5RA 2VKHA 3F9KA 4QPOA 3OYMA 1V5GA 3EUHC 3VYTB 3AKZA 1MNDA 3K70C 3PNVA 5CQGA 4ZTFA 4CCOA 4XLAA 5KHDA 4PSXA 4BJ6C 2R4GA 1Y6IA 2X1DA 4BJTA 2VIXA 3DWLE 2OUMA 1LDKB 2RQQA 3DTIA 2VQGA 3LSKA 2XF5A 2IGNA 1D1CA 3S3NA 3L2UA 4OWRB 2W82A 2KHMA 3FBIB 3TBIA 3QYBA 3S8PA 3OR1C 4ZDPA 1UAAA 1MMDA 2R7OA 4P1WA 2L7KA 4PFOA 2MC4A 4DBQA 3K70D 1SAUA 1P9QC 3U21A 3K6GA 3L2WA 2BW3B 4E7JA 2W00A 2KZVA 3KX2A 2VB6A 3L2VA 1J09A 2ZSIB 3H9GA 4DOZA 3E0JB 2UWMA 3LSGA 3RTRA 4B44A 2Z1DA 4Y3OA 4B3XA 2V1NA 4NC7A 3HKZA 2LH9A 4N4NB 2KP6A 1YX3A 1DGRM 2LOOA 4XONA 4B48A 4XKVA 2DT7B 2R7WA 2ZFUA 3K10A 4BU2A 2ELJA 2IGKA 4Y4RA 3OYDA 1G8XA 3BC8A 2X6XA 3OYFA 2VQCA 4CH7A 4BS9A 4BACA 4BJ5C 4XR6A 2F5VA 2VQLA 4ZDOA 3C2HA 1PYVA 2K9MA 2MABA 4QPQA 2Y0SA 5KCMA 4CSWA 2R7QA 2JVGA 1GLNA 3KEYA 2VPLA 4NUBA 2W4SA 4ZTJA 3G2BA 4KJZA 3DPLC 2VKDA 3PNYA 4N4OB 2KQRA 2DT6A 1SFKA 2XAUA 1T95A 2I8DA 4J00A 3ZR8X 3OL4A 3ZRGA 3IAM2 1X1AA 3N05A 2R7RA 2W7NA 4YRVA 2CFOA 3K4BA 4XN3A 3OYJA 1X1CA 2XSJC 1S9HA 2JUGA 2WY7Q 4YEJA 4IX7A 3OYHA 2E1MC 4CCLA 1YX5A 1WJEA 4PJMA 2IS2A 3AL0C 2CW7A 3MKWB 2VJIA 3MD2A 3HG9A 2LG4A 4E6KG 4FETA 1EA3A 3UNGC 2GOXB 4U7BA 3OIPA 3L2QA 2DJIA 2X1CA 3S93A 5KNLA 2CS3A 2Q2EB 2WAEA 2LBFA 2K5CA 4BDZA 3HPGA 4XLFA 1W36C 3UR3C 3ZXSA 2VJ5A 3CZ6A 3OY9A 5CKTA 1DGWY 3I3LA 4BQOA 3L2RA 1U0JA 2UV1A 1WJAA 4F91B 5CQEA 4CCNA 1UG0A 3HL2A 3E1SA 2XF7A 3A4CA 3BG6A 4CUGA 1TZLA 3VSLA 3D5RC 2X6YA 4II3A 3HUGB 1WJ5A 3H9JA 2AQFA 4XORA 3W2AA 3H5AA 4OAZA 3DQVC 4C2TA 4HSTA 3EUAA 2Z16A 3OOUA 4HSRA 4LIVA 4D1QA 1Z3XA 3DU6A 4F55A 1V5EA 4E7HA 2LY1A 1W36D 2IXSA 4BEHA 4XOPA 5JHFA 2R7TA 4F3QA 2HU9A 4PJNA 2VL8A 3SYTA 3RQ4A 1JI8A 3NWSA 3RPUD 4ZC3A 1VZ0A 2HVRA 3ZQQA 4PK4A 2CW8A 3DU5A 2V9KA 4KITB 1FMWA 2PJRA 3ONQA 2VXDA 1OLTA 3RCOA 3DEEA 1G59A 3SZGA 3MMYB 4GRIA 4BGDA 3OYKA 2BVMA 1E0EA 4BE1A 3I9V2 3K4MA 2CV2A 1IRXA 3PFYA 2A5WA 4E7ZA 2WAFA 4P5OA 3H0DA 2OC6A 2F4IA 3H9QA 4XMYA 2HVQA 2BVLA 1MMNA 1N77A 2KMUA 4XKBA 1D0YA 3BCBA 3EPZA 3OS2A 2P0WA 1WJCA 4CCJA 3OR2C 3VYRB 2QKMB 4XM3A 3MKZA 4FASD 1X1BA 4IQJA 2DXIA 3HC7A 3H5NA 3IUOA 1X19A 2LREA 4X0GA 2LC2A 2JSPA 4XLEA 4PFPA 5CPRB 5FROA 1FMVA 3FHNA 2RREA 2AQEA 4YELA 2WY8Q 4OAYA 2M7AA 3CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OV7 A;  2VPL A;  2OUM A; 
#chains in the Genus database with same CATH topology
 2RNG A;  3PO3 J;  1MMA A;  1WH5 A;  1MJ9 A;  3M8J A;  3WU0 A;  4DIQ A;  1D0Z A;  2X6W A;  2ZME B;  2K9S A;  2VBW A;  2MYS A;  2BY1 A;  5LRR A;  1TQP A;  2YX7 A;  1W7P A;  1RKW A;  5DCM A;  3CD6 I;  2QYO A;  2FMY A;  5CVV A;  4ZJZ A;  1FBU A;  4BXX J;  4BXF A;  3L00 A;  3ML6 A;  1RET A;  1Z21 A;  2R0Q C;  4W97 A;  3OMY A;  1JT0 A;  5HLT A;  2B63 J;  4W1U A;  1LVA A;  3CJR B;  4BHC A;  4D9J A;  3QPH A;  1XMA A;  3WTS C;  2BGC A;  3I54 A;  4JYK A;  4RAY A;  2DN0 A;  2NVT J;  1SAX A;  3O8H A;  2X85 A;  1FJL A;  4IL6 C;  2CMP A;  3PIO F;  1AKH B;  3D5S C;  2NOG A;  5J3L A;  4KFC A;  2LY2 A;  3HSE A;  2Z9O A;  3HGY A;  3ZN1 A;  2XHK A;  2E1N A;  5LGT A;  1Y0N A;  4E4H A;  1BM9 A;  4G6Q A;  5L3G A;  4UXN A;  2A61 A;  1FOX A;  2G7H A;  2MC3 A;  3MZ8 A;  1BI1 A;  1Z91 A;  3CMM A;  2ZJQ F;  4L0Y B;  3DXJ F;  2D45 A;  2DOD A;  1IN7 A;  3BZC A;  2CQ7 A;  1SFE A;  4A3K J;  1NK3 P;  3F8F A;  3GME A;  4MLO A;  3SZT A;  1QHH D;  5IT3 A;  2L9S A;  3S2D J;  5LGU A;  4IJA A;  5LFA A;  2CFX A;  2Y0M A;  2H8W A;  3OOP A;  1QU3 A;  1WI3 A;  1SVL A;  1K83 J;  2G7U A;  2XSD C;  3WE3 A;  1H0M A;  1FIP A;  3FMQ A;  1WJD A;  3GTM J;  2D5V A;  1YS7 A;  2A6E F;  2OV7 A;  2XGD A;  3CJQ B;  3GZ5 A;  2BBY A;  2LRD A;  4Q4Z F;  3MKY B;  3GTK J;  2IS1 A;  1B4A A;  4KN7 X;  2FUG 2;  1DQU A;  2W1O A;  3GX4 X;  5HS9 A;  3BR6 A;  1SVM A;  1D1A A;  3JAM Z;  3A1Y A;  4E7I A;  3ABM H;  1JKQ C;  4A3J J;  3TDZ C;  4Y13 A;  1MNE A;  4G7Z F;  1ZR4 A;  2B9S A;  1Z6T A;  3F6O A;  3KP4 A;  1HCR A;  1ZRE A;  1LKX A;  1S5L C;  3HKZ N;  3IP4 B;  2JWT A;  1S7O A;  1X3W B;  2FBI A;  4A3B J;  3QQA A;  4KDP A;  5K5R A;  4EQQ A;  2E2J J;  4S04 A;  4EEF G;  3V7S A;  3I4P A;  4B4C A;  3RPU A;  3C2B A;  3EQL F;  1UG2 A;  2LNB A;  3OYI A;  2Y9Z A;  5F1J A;  5HNH A;  4MGR A;  3CCL I;  4BDY A;  4CYD A;  3IKT A;  3JAM K;  1R7J A;  1XGO A;  3ZGK A;  1WWX A;  3OYN A;  3KP3 A;  4BQN A;  5GTH C;  3K2A A;  3PJR A;  1YRN B;  4IRG A;  5H6R A;  3ZQG A;  3JCU C;  2CV1 A;  2KDO A;  4KUM A;  5FLX K;  3NAR A;  2O03 A;  1HW1 A;  3K7A J;  3LSH A;  3LQR A;  1UFM A;  5DTD A;  4AD9 A;  5EGO B;  3EUK L;  3LFU A;  4M6Y A;  3PNT A;  4ESF A;  1T0F C;  2VUM J;  2EIK H;  4L18 B;  4U7D A;  1D0X A;  4E7S A;  1ZGW A;  1I1S A;  2YU9 J;  1ORK A;  1HC8 A;  3OYG A;  2A05 A;  4QIW N;  2MSY A;  3VWB A;  1KA8 A;  2BYV E;  3JTG A;  2E19 A;  1R00 A;  4E7L A;  2BY0 A;  4DJA A;  1IV6 A;  3K4C A;  3QOP A;  4RGU A;  3E5Q A;  5FD5 A;  2OCE A;  2FML A;  3B02 A;  3BOQ A;  3LOC A;  2E1M B;  5HOO A;  5FRM A;  4C9Y A;  1SFO J;  5HLG A;  2XF6 A;  4XKC A;  4NQW B;  3HSF A;  1IRZ A;  1H9G A;  1ACI A;  3HOT A;  2Z2S B;  1HKT A;  3FDY A;  1P4A A;  1S29 A;  4OIN F;  1R58 A;  2VAS A;  2VJ4 A;  5LHI A;  4LB5 A;  3FXR A;  4IVN A;  1D8K A;  1IDZ A;  2LFB A;  4JX6 A;  4RB0 A;  2KIQ A;  4AYB A;  4KIS A;  5CVU A;  2HXI A;  5JLX A;  3CLO A;  1QNT A;  5E3L A;  3M1C A;  3LST A;  4BL0 B;  4EJO A;  4D5C A;  2O8K A;  3Q0W A;  2I10 A;  3GBG A;  2XB5 A;  2GM4 A;  3FXU A;  2LF8 A;  4L5J A;  3PUB A;  2MD0 A;  4MFE A;  1T0F A;  2IBD A;  1MNM C;  4M9S A;  3OYM A;  1MBF A;  1V5G A;  3FMS A;  4FE7 A;  1U6G A;  1MDM A;  2OQR A;  5FO5 A;  4XLN F;  3HIF A;  4DYQ A;  2OTJ I;  2VN2 A;  4ABZ A;  1B9N A;  4A6D A;  1MMS A;  3FF5 A;  2VPR A;  1I3Q J;  5KHD A;  2L0K A;  3KZZ A;  2ZXJ A;  5DV5 A;  2MLK A;  4BJ6 C;  4KMU X;  5F27 A;  2M9H A;  2QZ8 A;  2G0E A;  3ZPL A;  2Y30 A;  3DWL E;  2RQQ A;  4HF1 A;  2ZCW A;  3HRM A;  3WGH A;  3BPV A;  1BI0 A;  2GAU A;  4M3F A;  2P7C B;  1SMY F;  3LSK A;  4CYC A;  3S3N A;  4GXO A;  3FK7 A;  3L2U A;  2MD5 A;  2KHM A;  2F48 A;  3QYB A;  1OMI A;  3S8P A;  5K5Q A;  5FLV A;  3G1O A;  3OR1 C;  2YPR A;  4ZDP A;  4OMY A;  2QF7 A;  1MMD A;  2R7O A;  2OQG A;  4RBO A;  2KJB A;  4DBQ A;  3K70 D;  3OSG A;  3LQQ A;  1W7P B;  3FK6 A;  2QCO A;  3K6G A;  3L2W A;  4IHY A;  1P4X A;  4R8H A;  1Z05 A;  2CRG A;  2KZV A;  3LA7 A;  5H2F C;  4O6J A;  1E3P A;  4DOZ A;  3E0J B;  1BIA A;  3BT9 A;  2UWM A;  2ME6 A;  3JRD A;  3HYI A;  2L01 A;  1X3U A;  1YIT I;  5D8L B;  4XSZ F;  2TDX A;  1ON2 A;  1UST A;  3KCC A;  2IA0 A;  1TWG J;  3F8C A;  1YIJ I;  4EJT A;  5ICC A;  3BTJ A;  4N0B A;  4G6D A;  2PJP A;  3S1M J;  2HQR A;  2EFN A;  3ZQ7 A;  1J59 A;  1RUN A;  1DGR M;  2LOO A;  2DK5 A;  1REP C;  2DA3 A;  3I0T A;  5DM6 F;  4WXH A;  3KFW X;  3R4K A;  2ELJ A;  2WWY A;  2BV6 A;  4A69 C;  3HOZ J;  4EJU A;  1WHU A;  1ZAO A;  1UMQ A;  3J7Y J;  2F5V A;  2VQL A;  1LNW A;  2UZK A;  3ASN H;  2YU3 A;  1JKO C;  1ON1 A;  4QPQ A;  4ZYH A;  1JUP A;  2JRT A;  2V6C A;  3K0L A;  3AAF A;  4ESJ A;  2QEX I;  4EM2 A;  2XPV A;  3DPL C;  1U5T B;  5HDN A;  1ULY A;  2LD5 A;  2LK2 A;  2UXX A;  4HV6 A;  1QZY A;  1IXR C;  3AG1 H;  3GVA A;  3JRE A;  2XAU A;  1T95 A;  2G9W A;  1TLH B;  3IAM 2;  3N05 A;  1YFH A;  4Q5S F;  1BI2 A;  5F1R A;  2XSJ C;  4YEJ A;  5FKN A;  1OKR A;  3JRG A;  2VC0 A;  2K3F A;  5IOZ A;  4A93 J;  4A5N A;  3TP3 A;  2R93 J;  2OF7 A;  4I09 A;  3GZN B;  4XIC A;  3I4M J;  1S7E A;  2LG4 A;  1IDY A;  1EA3 A;  2OBP A;  1R5H A;  2DQL A;  3HTU A;  1JT6 A;  1FWZ A;  1EH8 A;  1XDS A;  2A68 F;  3MZH A;  3HTS B;  2CQK A;  1GUU A;  1UHS A;  3UR3 C;  4S05 A;  3BZK A;  3ZXS A;  3R0J A;  3J81 K;  3OY9 A;  1TW3 A;  3I3L A;  1HW5 A;  3M3Y J;  3GCM A;  3CJT B;  4NDL A;  1FY7 A;  2XB0 X;  3GTQ J;  3WTX C;  1UG0 A;  2GQQ A;  1XCV A;  1VQP I;  3HZJ A;  2COB A;  3BG6 A;  3VOE A;  3M9A A;  4Y17 A;  3RDI A;  1BC7 C;  2H1K A;  5DD4 A;  1YTY A;  1XX5 A;  3H3U A;  3E6D A;  1FYL A;  2EPF A;  3S2W A;  4ENJ A;  2DO7 A;  4HST A;  2HOE A;  2EB7 A;  2IT0 A;  1V5E A;  2K9N A;  1G3W A;  1QO0 D;  2LY1 A;  4BEH A;  4XOP A;  1W36 D;  2Y31 A;  5JHF A;  2R7T A;  1U9O A;  3E5U A;  4U0Y A;  3SYT A;  4OIO F;  3U2R A;  1JI8 A;  3FM5 A;  1S7A A;  3RPU D;  4ZC3 A;  3LAJ A;  3K69 A;  4A2U A;  3ZQQ A;  2QLZ A;  3ABL H;  1GHC A;  2XRN A;  3DU5 A;  2JSC A;  1OCZ H;  4YIF A;  2PJR A;  3G71 I;  4O3M A;  2PFB A;  1A6I A;  2ZJP F;  1ZKG A;  1WRJ A;  1GVJ A;  5FFX A;  3GLL A;  5KAI C;  3KEO A;  4XK4 A;  3I9V 2;  3K4M A;  3JSP A;  4DYR A;  1Z77 A;  2A5W A;  4E7Z A;  4P5O A;  2OC6 A;  2F4I A;  1TQI A;  2XAG A;  4AIJ A;  1MBH A;  4UNO A;  1MMN A;  3ISP A;  2KMU A;  4XKB A;  2COM A;  1Z9C A;  2HOS A;  3KZI C;  2P81 A;  5IP6 A;  5FKK A;  1WJC A;  4YFK F;  4Z6Y A;  4XM3 A;  2PMH A;  1GXQ A;  2XUB A;  2DXI A;  3VB2 A;  4A3C J;  3FXM A;  1T56 A;  4MO7 A;  5EDN A;  1MDM B;  2LRE A;  2LC2 A;  2XGX A;  4XLE A;  4XLP F;  2ESH A;  2FOK A;  2KIS A;  1N25 A;  5CPR B;  2VKE A;  3FHN A;  3I56 I;  3S1N J;  2AHQ A;  1LQ1 A;  2R7D A;  1ZG3 A;  3KP7 A;  2D1V A;  2FE3 A;  3W6J B;  3IAS 2;  4RA2 A;  4MQV A;  4FCY A;  1TWH J;  4CYC B;  3IH4 A;  1RPW A;  4RGS A;  3B73 A;  5FLM J;  1IUF A;  3CC4 I;  1F5T A;  3TQN A;  4IOA F;  5F08 A;  4RDU A;  2Q8K A;  1BR1 A;  2ZXW H;  2H09 A;  3TO9 A;  1TNS A;  3DPT A;  2IW5 A;  3O2P E;  2OD5 A;  5HNF A;  2X48 A;  4ENK A;  2XPW A;  3WTY C;  1SEU A;  4PDK A;  3I64 A;  3GTG J;  3TL4 X;  9ANT A;  4AIH A;  4IF4 A;  2HI3 A;  4LG0 A;  3F8B A;  2EIJ H;  4DNC A;  1TC3 C;  1T08 B;  3CQZ J;  5FRN A;  4FX0 A;  2EV6 A;  2KRH A;  1YJ9 I;  3CCS I;  4JQF A;  2R5Z A;  4ZDL A;  3GTJ J;  1KYW A;  3FBN B;  2E7X A;  3HB9 A;  5KVR A;  3G1L A;  5D4R A;  3J7A Y;  2O8X A;  4RLQ A;  3ULQ B;  4OIR F;  2XC7 A;  2VXZ A;  3NQO A;  2L7M P;  3LMM A;  3QOE A;  2RV8 A;  5B3S H;  2V26 A;  3DKY A;  2KL4 A;  1X2M A;  3F8M A;  4A3D J;  1JUM A;  1IXC A;  2L9V A;  4ZYA A;  4CZC A;  3OL3 A;  4F92 B;  1Y56 A;  3OSF A;  3GTP J;  1IXS B;  2OZ6 A;  3MAJ A;  4I98 B;  2JMW A;  4IHX A;  2ID6 A;  3WTU C;  4LLG F;  4XLC A;  2J5O A;  1T6S A;  1K79 A;  3FXO A;  1YS6 A;  3MZY A;  5BOX A;  3BLY A;  5LD2 C;  2FQ3 A;  4FE4 A;  2IGM A;  3H5R A;  2R7V A;  5J40 A;  1XSV A;  4JX5 A;  4I2O A;  3DTK A;  6PAX A;  3QPL A;  3HPH A;  4FTH A;  1JKR C;  5AIP A;  3BG7 A;  4BQQ A;  2FQ4 A;  1WGX A;  1A36 A;  1RR8 C;  1BN5 A;  3FIS A;  3HGG A;  1FLI A;  1VQ5 I;  2KIF A;  3K4N A;  1IN4 A;  4QWQ A;  2GWR A;  3BQZ A;  3OIO A;  4CIC A;  1EH6 A;  5D5U B;  2OPT A;  2WB1 A;  4HAM A;  3GXO A;  1JHF A;  3OYC A;  1BA5 A;  4GO1 A;  5TGT A;  1T8I A;  1RC9 A;  1MBE A;  3CO6 C;  1V5F A;  1WSU A;  2H27 A;  1XB4 A;  2HS5 A;  2WAQ N;  5EZG A;  3DCF A;  3J80 Z;  3K1P A;  2M7B A;  3IH2 A;  5JVT A;  2BHY A;  5DCF A;  1GVD A;  1QBJ A;  1MH4 A;  2HPI A;  3BP8 A;  1FSE A;  4M3D A;  1U78 A;  3Q0V A;  3BTI A;  2CQN A;  2EA2 A;  1TWC J;  1PUE E;  3WTT C;  4A5M A;  2Z33 A;  2R7X A;  2KLO A;  3IL2 A;  1DU0 A;  4XRM A;  1E3O C;  1XS9 A;  2NVU B;  2WAQ A;  2WA0 A;  2K4B A;  3GLX A;  5CVI A;  4LK0 F;  2Q2E A;  3K4K A;  4BH9 A;  2HTJ A;  2RVC A;  2BY2 A;  1Y0U A;  1O4X A;  3KYL A;  4BXU A;  3L9F A;  1QGP A;  1PJR A;  4ZH4 F;  3J80 K;  5J4V A;  3QP5 A;  4LLN A;  2BXZ A;  3ZQH A;  4EJW A;  2NOJ B;  2FX0 A;  4BBR J;  2BEO A;  2ESN A;  1ERD A;  3IKV A;  2UUZ A;  3HSR A;  1BR2 A;  5FGM A;  2F5E A;  4XNF A;  1YJW I;  4JP0 A;  5DS9 A;  3S3M A;  4P96 A;  4BY1 J;  3SEQ A;  2EFP A;  1OCO H;  3HUG A;  2NS0 A;  2IAI A;  2DLL A;  1PUF A;  2V4J C;  4RAG A;  2TRT A;  4LMY A;  4C30 A;  1FBQ A;  1QZE A;  2RNJ A;  3CP8 A;  4RGR A;  3ZQI A;  3J7Z I;  3S32 A;  1DUX C;  1ZEL A;  2K9Q A;  3T8T A;  1NG6 A;  1K6O A;  2JK3 A;  4D5F A;  2HVS A;  2O7O A;  3LSR A;  1F36 A;  1QPM A;  3T0Y A;  3RI4 A;  4BEH B;  2NXN B;  1LPQ A;  1XN7 A;  2AO9 A;  2KJC A;  1MBG A;  5LHG A;  1STZ A;  2DK8 A;  2OAZ A;  4IO9 F;  5E1Z B;  2FNP A;  4UUS A;  4IHW A;  2RQP A;  4MNU A;  3CJN A;  4QSH A;  2ZNY A;  2CUJ A;  2IS6 A;  1A6Q A;  1N78 A;  1SAN A;  4IQ4 A;  3QWL A;  3LFK A;  4RLF A;  2PJR B;  1FYK A;  3ZMV A;  4HEA 2;  2R7S A;  1ETW A;  2Y75 A;  4M74 A;  3WE2 A;  5EYR A;  4NC8 A;  2DFF A;  5F04 A;  1OYW A;  2WTE A;  1R6R A;  1TWF J;  3DEU A;  3QYE A;  4P9U A;  3FZV A;  4UUV A;  2HYG D;  2V6E A;  2NYX A;  3K4L A;  2NAZ A;  4RB1 A;  2QUF A;  4IPA A;  2RAE A;  1X1D A;  2HQA A;  1ZTR A;  5HS7 A;  3RIR A;  1XPX A;  4CCM A;  2VI6 A;  3IWF A;  4OIP F;  1AOY A;  3ABT A;  2JRM A;  1D1B A;  2V1X A;  1YE9 A;  4F93 B;  4QTR A;  3F9K A;  3CDI A;  4RAF A;  2PEX A;  3EUH C;  3H0G J;  3I4N J;  3PM1 A;  1GXP A;  3BTC A;  1FOY A;  4FIS A;  2M30 A;  2K40 A;  5IP7 J;  5D6E A;  2GA2 A;  1VQ4 I;  4QLC U;  5CQG A;  4ZTF A;  3WTW C;  4XLA A;  4HX4 A;  2JZY A;  2W57 A;  2W85 A;  3FWE A;  3E6C C;  4IEJ A;  4Z2Y A;  4M3E A;  1Y6I A;  1YIO A;  3CDH A;  2VQG A;  4M71 A;  4XRS A;  4A12 A;  3BG5 A;  1R5I D;  1IAW A;  4V19 K;  3O8G A;  2R3S A;  2IGN A;  3IRQ A;  1E17 A;  4M9Z A;  1UAA A;  3G4S I;  1B59 A;  4A0Z A;  5C4X J;  1SAU A;  5FLX Z;  4HW0 A;  3ZMS A;  1VQM I;  3ZOB A;  1JKP C;  1JTY A;  2EIN H;  1SD5 A;  2CQQ A;  1WQ2 A;  3JR9 A;  3HOW J;  2ZSI B;  1JHH A;  2NNY A;  3LSG A;  5L3F A;  4B44 A;  3BPX A;  2HEO A;  1JTX A;  4MTD A;  1A31 A;  1KU9 A;  2JA5 J;  4LG0 B;  4Y3O A;  1RZ4 A;  4B3X A;  2X0L A;  3EUH A;  3HKZ A;  2R5Z B;  2LH9 A;  4WX9 A;  3DEW A;  2MH2 A;  4BQA A;  2HKX A;  2XRO A;  4HF2 A;  4RS8 A;  5GP9 A;  2W84 A;  1F4K A;  1WPK A;  3DBR B;  1B6A A;  1IV8 A;  3FHZ A;  2EIL H;  2R7W A;  4ZYE A;  2ZFU A;  5FD6 A;  4PJ0 C;  1RRJ A;  4ON0 A;  4U0V A;  2Q0O A;  2IGK A;  3OYD A;  1FC3 A;  3ZP5 A;  2M34 A;  3AG2 H;  1G8X A;  1YW9 A;  1P7I A;  3HRU A;  2DMN A;  2X6X A;  2P5L C;  2HFH A;  3ABK H;  4CH7 A;  4YG2 F;  2STW A;  4XR6 A;  1XGS A;  3G6E I;  1PYV A;  5DM7 F;  5KCM A;  1QZZ A;  2HQ5 A;  2OJE D;  1GLN A;  2VPL A;  2LKP A;  2W4S A;  4KJZ A;  1W5T A;  2VKD A;  3CTA A;  5DUI A;  2R92 J;  4Y52 J;  2P7V B;  3PNY A;  4A3M J;  3GEZ A;  2KKO A;  2HDC A;  3ESW B;  1C0W A;  1G6N A;  4MTE A;  2O9L A;  4ZZD A;  2XAS A;  1X1A A;  4WK8 F;  3MEX A;  1M1E B;  3DBH B;  2HKO A;  3T1B A;  3TOB A;  4YRV A;  2CFO A;  4GYI A;  4V2G A;  4C3J J;  1HBX G;  1JE8 A;  3OYJ A;  2XAH A;  2IEK A;  2DA2 A;  1O3S A;  3N4M A;  2ADU A;  2LP0 A;  4CCL A;  4A3F J;  1KU3 A;  4L9V A;  5E18 F;  2PMZ N;  2AS5 F;  3JRA A;  3GZ6 A;  5D5V B;  2L7Z A;  2RGV A;  2O6G E;  3GYH X;  1VND A;  1YI2 I;  2LY9 A;  1LFB A;  3V7C A;  2ZC2 A;  4E6K G;  1HKS A;  3S1R J;  2MA3 A;  2DU9 A;  4EM1 A;  2MH9 A;  1Q1V A;  1V4R A;  3OIP A;  3L2Q A;  2QM3 A;  1IN5 A;  2ECB A;  3S93 A;  4A0Y A;  5KNL A;  2Q2E B;  4KT5 C;  2LBF A;  3IV5 A;  2K5C A;  4NC6 A;  1IJW C;  3B6A A;  3P9C A;  3E3V A;  2VJ5 A;  5EJC A;  5HS8 A;  1T2K A;  1R71 A;  4PGH A;  5CKT A;  1DGW Y;  3KET A;  3L2R A;  4X1E A;  4HLY A;  2F5F A;  3ZMU A;  1VQ7 I;  3CME I;  2VBX A;  2M0C A;  1Y8R B;  3R6S A;  5CQE A;  4CCN A;  4KIB A;  3E1S A;  1S3J A;  2FSW A;  4CUG A;  3I71 A;  3SXY A;  1A35 A;  5F0C A;  4JK1 X;  3D5R C;  3NAU A;  3BRO A;  2DA4 A;  3HUG B;  1WJ5 A;  3FKI J;  3H9J A;  2AQF A;  3PUF A;  4XOR A;  4WCG A;  3DQV C;  4EGZ A;  4CHU A;  4WXC A;  1PUF B;  1RKT A;  3OOU A;  3JRB A;  4LIV A;  4KIF A;  1Z3X A;  3DU6 A;  4ESB A;  2PI0 A;  4F55 A;  5B1B H;  1W1W E;  2ZJ2 A;  2BZT A;  1MJB A;  4UVB A;  1K78 A;  5DCM B;  1Y39 A;  3C7J A;  4HQM A;  2HVR A;  3PIP F;  4RGX A;  2CWE A;  3V4G A;  2YUS A;  1OFC X;  4KIT B;  1FMW A;  3VPR A;  4UUS B;  1IN6 A;  2PX9 A;  3ONQ A;  1B8I A;  2HOA A;  3FXQ A;  2CO5 A;  3KLO A;  1XSX A;  3LA3 A;  3RCO A;  4E70 A;  1G59 A;  3MMY B;  4GRI A;  4BGD A;  2QQ9 A;  2EZH A;  4A3L J;  3JRI A;  3I55 I;  1T98 A;  3FXJ A;  2BVM A;  2OU2 A;  2FOW A;  5J1R A;  3O6B B;  4HDU A;  1MSE C;  4I76 A;  2EV5 A;  3GW2 A;  3H0D A;  2AXL A;  1Y8Q B;  2EJR A;  3TW7 A;  1LDJ A;  2HVQ A;  5DD8 A;  2NNN A;  2NS8 A;  1N77 A;  2EA4 A;  1EJ9 A;  1D0Y A;  2Y48 A;  3BCB A;  3EPZ A;  3OS2 A;  3OR2 C;  3BR1 A;  4LFU A;  2QKM B;  3HC7 A;  1W7P D;  3WTZ A;  2EQR A;  2QGU A;  3H5N A;  2CGP A;  4CO8 A;  1ZG5 A;  5LGN A;  4GCV A;  3HM5 A;  2M45 A;  1ZGA A;  2HXO A;  4A3E J;  2LDU A;  1FMV A;  4EM0 B;  3F21 A;  1JXS A;  2UXN A;  2N8G A;  2M7A A;  1OCC H;  2EK5 A;  3VOD A;  4NHJ A;  1QA6 A;  1AHD P;  1HQC A;  5K7Z A;  3HHG A;  3RPQ A;  4HNU A;  5FB2 A;  1UEL B;  3BCA A;  5L3D A;  4RM3 A;  2KRC A;  1KQ0 A;  1WFX A;  2X51 A;  1OCT C;  4ANJ A;  2LF7 A;  1ZRC A;  3OYE A;  5GPC A;  3UKG A;  2MW8 A;  1HOM A;  1SMT A;  2M0M A;  4NNJ A;  3SQN A;  3J81 Z;  2M3A A;  3HEF A;  3U1D A;  2QQB A;  2DMP A;  3KE2 A;  4AIK A;  2L9R A;  4PGG A;  4LGW A;  3V8L A;  1W0T A;  4DGW B;  2E5Z A;  5DUK A;  2FA5 A;  1ZK8 A;  3DKW A;  4FQG A;  2E2I J;  4MIM A;  3QU6 A;  4WWC A;  4CDG A;  2ME0 A;  1G3S A;  3HBL A;  3OS1 A;  4UVC A;  1IC8 A;  4DQ2 A;  5E3O A;  5FJ8 J;  1DDN A;  4G6T B;  1LFU P;  1IN8 A;  2F6C A;  3HOX J;  2VC1 A;  4BNC A;  4RMN A;  3A01 A;  1TNT A;  4LIT A;  4KT6 A;  3TKY A;  2ELH A;  2IVM A;  2V1D A;  3LWF A;  1H9T A;  2A6T A;  1FT9 A;  2M4G A;  4Y15 A;  5DYM A;  2XAJ A;  2CSO A;  2HDD A;  3KP2 A;  2XDV A;  1SVO A;  3W3C A;  4EAT A;  5E8G A;  2HPM A;  3DV8 A;  3CC7 I;  3PO2 J;  4RB2 C;  1FZP B;  3RKY A;  2JA2 A;  3GUD A;  3Q3S A;  1P6R A;  3BDD A;  4I99 C;  4PCQ A;  4AC0 A;  2ID3 A;  1ODD A;  1F1Z A;  3KEQ A;  3C3W A;  3CES A;  1X1P A;  5C3E J;  1Z3Y A;  2E36 A;  4IXA A;  2KZG A;  1X58 A;  4IOC F;  1XGM A;  1FTT A;  4KMF A;  4AU7 A;  2K9L A;  2VLA A;  3VDX A;  1R22 A;  3D5L A;  3W2V A;  5FKO A;  1UHW A;  4LJZ F;  4EMS A;  2CW0 F;  2F4O B;  2JTV A;  2M2E A;  2CH0 A;  2JVH A;  4AM3 A;  1OIS A;  4D0P A;  1K6Y A;  2IS4 A;  5LLQ A;  4S0H B;  2E5N A;  1RUO A;  4V2F A;  3I5U A;  4CGZ A;  2A6H F;  3DF8 A;  2DI3 A;  2AXT C;  1VQ8 I;  1HA8 A;  3RKX A;  1G2H A;  4KIC A;  1DPR A;  2MFZ A;  2H6C A;  5EEG A;  4DBR A;  1OR7 C;  4LD5 A;  5ERI A;  4HRI A;  1R1T A;  4CA0 A;  4E7K A;  1CF7 A;  2LLK A;  2LTP A;  2P6T A;  5JFR A;  2HYF A;  3H35 A;  3G3Z A;  2VBY A;  1D5Y A;  2XV4 S;  1U8R A;  4LLL A;  1LVK A;  1DP7 P;  1X4P A;  3M7G A;  2XAQ A;  4BE2 A;  4RM2 A;  1USS A;  4JOM A;  2FF4 A;  3RYP A;  2VJJ A;  2EFW A;  3AFH A;  4XQF A;  1EKE A;  1MZB A;  3K4J A;  3JW4 A;  2DTR A;  1U8B A;  2XKO A;  3BY6 A;  3TMO A;  2KIU A;  3CF5 F;  4XKW A;  4PUS A;  4FHT A;  4MEY F;  2L9N A;  4ENN A;  2LBF B;  3DKX A;  1JUS A;  3DPU A;  2GIZ A;  1ZHF A;  3CCR I;  1AWC A;  3S17 J;  1ZAR A;  4HNV A;  1OPC A;  4GDF A;  1QVU A;  1R1U A;  5HDG A;  4RB3 C;  1BW5 A;  3CMA I;  3A0B C;  2CU7 A;  4MQ9 F;  4U87 A;  4EGY A;  2QQA A;  3COA C;  3D1N I;  3QYF A;  4M6X A;  1ZLJ A;  1WJF A;  4RAZ A;  5M5W J;  1I50 J;  4XOT A;  3CCM I;  3MCZ A;  3RQI A;  1KYZ A;  3ERM A;  4EVI A;  5C4J J;  1QPI A;  5L3C A;  3IHU A;  4BE0 A;  3LA2 A;  2VE8 A;  3HRT A;  5E8I A;  4GYG A;  1OR7 A;  2KIM A;  3BR3 A;  2QEN A;  5JR3 A;  2W25 A;  3R0A A;  5ILV A;  2LVS A;  1J75 A;  4IHV A;  4M73 A;  5L3B A;  1QVT A;  4M6V A;  3M4O J;  2E71 A;  2STT A;  2QKL B;  4NBQ A;  2L5Q A;  1UZC A;  2VQH A;  1ZH5 A;  1K78 B;  1WZ2 A;  4LG3 A;  1MSF C;  4M3B A;  2H1L A;  3P9I A;  4HX8 A;  3NRV A;  3RSN A;  4PSW A;  3WU2 C;  1FPQ A;  3CDL A;  4XSX F;  1UHM A;  2JA7 J;  3WGI A;  4Y7N J;  5GAE J;  1FEX A;  3ZMD A;  3ZMT A;  3Q9S A;  1POG A;  1R1V A;  1B8I B;  4BUP A;  2XKP A;  1O57 A;  2EH3 A;  1ZYR F;  4XL9 A;  5K5O A;  1R36 A;  2NVY J;  1TP4 A;  3OV8 A;  2M8G X;  2MLG A;  3W2W A;  2BOL A;  1ZLK A;  4ENM A;  2JPC A;  2DCE A;  3KZY A;  3T8R A;  3S3O A;  1LFP A;  5J47 A;  1AA7 A;  2ECC A;  5IT9 K;  1ETV A;  5J1Y A;  2DDB A;  3OYL A;  2O5R A;  2XIG A;  2RKH A;  3KP5 A;  2Y69 H;  3BWG A;  4QPO A;  2DFH A;  1WKM A;  1B1B A;  1E2X A;  3TGN A;  1EF4 A;  4YFN F;  3VYT B;  2F2E A;  2DPU A;  1BW6 A;  3AKZ A;  2YSR A;  1SFX A;  3G1M A;  3PNV A;  4LOC A;  3K70 C;  4CCO A;  5B1A H;  1Z6R A;  2L02 A;  3WHC A;  2DT5 A;  2EWN A;  2GBY A;  2FEZ A;  5H20 A;  3QAH A;  3IWZ A;  4G8X A;  3SJM A;  4ZYD A;  1TL8 A;  4AWX B;  4B09 A;  4BJT A;  2X1D A;  3BZ6 A;  2OUM A;  3CCV I;  4I01 A;  3BR2 A;  2L54 A;  5IPA A;  1Z1D A;  3M07 A;  2ZBK A;  2KT0 A;  3X2Q H;  3CUQ C;  1LE8 A;  1I1G A;  3BJA A;  2W82 A;  3HDD A;  3FBI B;  3TBI A;  4OOI A;  4N9I A;  2XVC A;  2V1U A;  1Y1V J;  3H3V K;  4PFO A;  2L7K A;  2IRF G;  3ZN0 A;  3P7N A;  1P9Q C;  3KP6 A;  3RKQ A;  1K4T A;  2E35 A;  1IUY A;  2VT2 A;  3ZMZ A;  2FNA A;  3GFJ A;  4UV8 A;  2TCT A;  2ISY A;  3KX2 A;  1ZN2 A;  1W5S A;  2X6O A;  3U1K A;  1JJ8 C;  3RTR A;  3CCU I;  1K61 A;  2EZI A;  2DYR H;  2NVQ J;  2Z1D A;  5D5X B;  4HBL A;  4HQE A;  3EYI A;  4NC7 A;  4N4N B;  3A01 B;  1Y1W J;  2K7L A;  2FRH A;  3E6M A;  1FTZ A;  1YX3 A;  1I27 A;  1FOW A;  2E1C A;  2QBY A;  3BQY A;  4B48 A;  2P5K A;  3CUO A;  4Q48 A;  2YX4 A;  4JX4 A;  2M8E A;  2MGQ A;  1A5J A;  3REO A;  2R7Z J;  2NVX J;  3I58 A;  3K10 A;  1TT5 B;  1EH7 A;  1Z67 A;  2VE9 A;  4L9J A;  2JN6 A;  3BC8 A;  5K7H A;  2P8T A;  2EBI A;  2VQC A;  2QSG X;  5LRS A;  4BS9 A;  1W5C C;  3F22 A;  4BJ5 C;  4ZDO A;  3CUQ A;  5HOD A;  2K9M A;  3QPS A;  5LBQ A;  3L1P A;  2R7Q A;  2F5D A;  2JVG A;  4WXD A;  1EV7 A;  3KEY A;  4I0A A;  3NEU A;  2WV1 A;  1OCP A;  1YHQ I;  1O3T A;  1I5Z A;  2DQR A;  1LJ9 A;  2QQ8 A;  5DDG A;  1HDD C;  3MWM A;  2KQR A;  3BR5 A;  3ECO A;  5ICF A;  3J7A O;  2O61 A;  3P9K A;  1HW2 A;  1SFK A;  3SFI A;  4J00 A;  3ZR8 X;  1JGS A;  4HDV A;  3JRH A;  4UB6 C;  1FSH A;  3ZRG A;  2W48 A;  5GPA A;  1O3R A;  2R7R A;  2W7N A;  3VFZ A;  4TV7 A;  1OCR H;  1U5T C;  3K4B A;  1HST A;  2IPQ X;  1X1C A;  4K2E A;  1BJZ A;  2DBB A;  2K85 A;  3W6K B;  2E7W A;  4AVP A;  4IX7 A;  5F0H A;  3R61 A;  1CF7 B;  1SFU A;  1YX5 A;  3DP7 A;  1WJE A;  2IS2 A;  3U9G A;  1LDD A;  2LMD A;  3AL0 C;  2CW7 A;  5BQT A;  3MKW B;  3HG9 A;  5EEA A;  2DA7 A;  2V9V A;  3DFG A;  5DEQ A;  4FET A;  3UNG C;  2HYJ A;  2DMQ A;  4U7B A;  2HTS A;  4J19 A;  2DJI A;  3KYC B;  2L4A A;  2X1C A;  2CS3 A;  1NH3 A;  1FOK A;  2A07 F;  3D0S A;  5CVR A;  5F64 A;  2ZO4 A;  3I59 A;  4BDZ A;  1W36 C;  1O7L A;  3CZ6 A;  3K1M A;  3BJ6 A;  1U0J A;  3M8E A;  2UV1 A;  2V79 A;  2BY3 A;  1WJA A;  4F91 B;  3S1Q J;  2XRL A;  2HWV A;  1VQO I;  5HLH A;  3QPT A;  1S6L A;  2HZT A;  4C3I J;  4R1H A;  2GIV A;  3Q5F A;  3C1D A;  3KIO A;  4CZZ A;  2PLY A;  4KA4 A;  2X6Y A;  3QU3 A;  4II3 A;  1GT0 C;  1MBJ A;  3H5A A;  4C2T A;  2A69 F;  5E1W A;  3EUA A;  2Z16 A;  2WC2 A;  4D1Q A;  1HF0 A;  2RN7 A;  4DZP A;  1ENH A;  5GTI C;  1LEB A;  2ACJ A;  1RIO H;  5D6F A;  1U5T A;  3WG7 H;  5JVG F;  1VQK I;  4PJN A;  1V3F A;  4BAY A;  3NWS A;  4HOB A;  1I3A A;  2HR3 A;  1XMK A;  2CW8 A;  4PK4 A;  4UV9 A;  4ASN A;  1HXD A;  1YW7 A;  1VQ6 I;  2PMU A;  1MKM A;  2VXD A;  3FXL A;  1R9T J;  1H89 C;  4MEX F;  4HX7 A;  5F0F A;  2L4M A;  5LEJ A;  4NB5 A;  5GAH J;  3IRR A;  1J5Y A;  1MGT A;  1OLT A;  1KQ8 A;  3DEE A;  5H6Q A;  3SZG A;  3TOA A;  1VQ9 I;  4B1R A;  1MD0 A;  3T5X A;  2D1H A;  2Y9Y A;  3BG9 A;  3OYK A;  1CQT A;  5J4Y A;  3E7L A;  4LK1 F;  3CC2 I;  2CV2 A;  2E34 A;  3QP6 A;  1ZR2 A;  3RYR A;  2CUF A;  3H9Q A;  2Z99 A;  3KLN A;  1WCM J;  4MFD A;  4ETS A;  2R5Y A;  4P55 A;  4C2M J;  2BHZ A;  1H88 C;  2PN6 A;  4UVA A;  2EFQ A;  4KNY A;  2P0W A;  1D3Y A;  1GDT A;  1P2F A;  2DA1 A;  3VYR B;  3QRF F;  2PG4 A;  4FAS D;  1BBY A;  1X1B A;  3CCJ I;  5KAF C;  3CCE I;  1ZGJ A;  4FT8 A;  4GGG A;  2ZNZ A;  1O3Q A;  4XID A;  3IUO A;  5K1Y A;  4X0G A;  2JSP A;  1B72 A;  1RNL A;  4L9T A;  4PFP A;  2DOF A;  3H92 A;  1G3T A;  1VI0 A;  5AON A;  2RRE A;  4JBA A;  5K7F A;  4YEL A;  2WY8 Q;  5IY5 H;  4OAY A;  1T39 A;  2ISZ A;  4U88 A;  1KGS A;  5JLW A;  3CP2 A;  1R49 A;  5J1U A;  2KDZ A;  1S72 I;  2I5U A;  2V7F A;  1YO5 C;  2YR2 A;  4HPQ A;  1NG7 A;  5ILS A;  4U0W A;  1D5V A;  1R23 A;  1XGN A;  1LE8 B;  1OQY A;  5J6X A;  3ZCO A;  5F6F A;  3PFI A;  3SZP A;  2OTL I;  2VBZ A;  2YS9 A;  3LAP A;  3ASO H;  4B3A A;  2FD5 A;  1HDP A;  2HQN A;  1BL0 A;  2GLO A;  1DP3 A;  3TW6 A;  2BW3 A;  1XSD A;  4AID A;  5J8C A;  1IGN A;  4II2 A;  1E3H A;  2XGE A;  2M5W A;  4AYB N;  1S8N A;  2X9D A;  3DLL F;  3CF2 A;  3EDP A;  4KN4 X;  5IYB J;  5FKM A;  1I39 A;  1MW7 A;  3RJP A;  3R60 A;  3HOS A;  4UY8 I;  2ZXI A;  1TWA J;  3F0C A;  5C44 J;  5M3F J;  2FXA A;  3MVP A;  1FYM A;  1TTY A;  2K3P A;  2LR8 A;  2QA4 I;  2ZSH B;  3IH3 A;  3CCY A;  1LB2 A;  2KFD A;  2PMZ A;  3PL8 A;  2O3F A;  4HLX A;  2H8R A;  2P6S A;  5FKL A;  2EZK A;  3E6B A;  5BPD A;  1IZ1 A;  2QBY B;  4H4K C;  3VSK A;  5ILU A;  2JJ7 A;  1YYV A;  1RR7 A;  4PJL A;  3V42 A;  3I53 A;  2R7U A;  4Q47 A;  2F4M B;  1WH7 A;  5CLS A;  3LL7 A;  4N9H A;  2CV0 A;  5HVQ C;  2DA5 A;  1TW2 A;  2R7F A;  3ELK A;  5EEH A;  4I6Z A;  4YFX F;  1RI7 A;  2HGC A;  3C2G A;  5M3M J;  5D4S A;  1WVR A;  2WAD A;  1VTN C;  2Z5U A;  4L9N A;  3SDB A;  3GFL A;  2IA1 A;  3CUQ B;  3LSI A;  4Y33 A;  1N75 A;  1Q1H A;  3RZO J;  1V55 H;  4C3H J;  2E60 A;  2NS7 A;  5CVJ A;  2ZB9 A;  2Q1Z B;  3VYU B;  2DMU A;  2X1E A;  4B43 A;  1PP7 U;  3OS0 A;  2OZU A;  3SEZ A;  4DYC A;  2KRF A;  3L2C A;  4HF0 A;  2NRA C;  2IJL A;  2ZFW A;  3AG4 H;  3ZQC A;  4IZZ A;  2E1O A;  2WBM A;  4IRH A;  1ZG1 A;  1YW8 A;  2DDA A;  3GF2 A;  2HDW A;  2H6B A;  4HG2 A;  3GWZ A;  5AIQ A;  2LYC A;  3PSF A;  4I0B A;  1WJB A;  4C2U A;  2GXB A;  5ICG A;  3VYS B;  4XN0 A;  4EV0 A;  1L3L A;  3DTE A;  2M1B A;  5E17 F;  4HNT A;  2MBF A;  3RZD J;  1HLV A;  3LSM A;  1MBK A;  1CGP A;  2DOE A;  3FIW A;  1SD6 A;  1HKQ A;  1U2W A;  2J5P A;  4CCK A;  2HNH A;  4X6A J;  3A0H C;  1QRY A;  3WTV C;  2BE5 F;  1Z7L A;  1W4M A;  5D8K B;  3K1N A;  1LUJ B;  4O5V A;  3ZQL A;  2CG4 A;  1VFC A;  1AU7 A;  4PZJ A;  3F6V A;  5A2Q Z;  4IKF A;  1BR4 A;  4BHP A;  5TJJ A;  1ZQ3 P;  4P9F A;  5GAG J;  3G73 A;  3FKJ A;  2QSH X;  3PSI A;  2ZXH A;  1YQA A;  2X4H A;  4A3G J;  3FMR A;  5KK1 A;  3MKL A;  5IOY A;  1O7F A;  2HZD A;  4XLH A;  3DLA A;  4HZF A;  4H0E A;  3I59 B;  3OYA A;  3HXL A;  3HOU J;  3QOD A;  2JA6 J;  4I02 A;  3HHH A;  2GXG A;  3MN2 A;  1MIJ A;  2XPU A;  5CJ9 A;  5JI6 A;  1TT0 A;  3P5J A;  1R4M B;  1PDN C;  2DJN A;  5HDK A;  5J8F A;  5EF6 A;  1KON A;  3N97 A;  2LSO A;  1FIA A;  3A2K A;  3TO6 A;  2DW4 A;  1KZH A;  3MFK A;  5E3M A;  3L7W A;  4UB8 C;  2K02 A;  5A2Q K;  2PBI A;  1APL C;  1SC7 A;  3H1C A;  1FP2 A;  2VOO A;  4BBS J;  1BOB A;  5GAD J;  4FX4 A;  3PQK A;  4J01 A;  2DOA A;  3CCQ I;  3OIQ A;  2IGO A;  3AG3 H;  4ZZL A;  4R79 A;  1J2X A;  1OJL A;  4ZYG A;  1X3Z B;  3L09 A;  1QHG A;  4PJJ A;  2L2O A;  2CUZ A;  3Q0U A;  3JSO A;  3F23 A;  2KPM A;  2ZME C;  3OYB A;  1JGG A;  4ITV A;  3AL0 B;  3S14 J;  2ETH A;  1D8J A;  4BKX A;  1SD4 A;  3OWT A;  1G3Y A;  1X4O A;  1ZRF A;  2RC4 A;  4LIU A;  3IC7 A;  1MMG A;  1L0O C;  1QQI A;  4WF2 A;  5EG0 A;  4F52 A;  4XRF A;  4AVZ A;  2QVO A;  4D7N A;  2ELK A;  3VEP A;  2GOM A;  3NWT A;  1U3E M;  3KYD B;  1LEA A;  1ITY A;  2M4K A;  2R5Y B;  3TP0 A;  4B47 A;  5D5W B;  1IO2 A;  2VKH A;  3KPH A;  1NHA A;  2EFO A;  1SD7 A;  3FM3 A;  3S2H J;  2D2W A;  1TBX A;  4AUX A;  3TED A;  2VKV A;  1P7J A;  1MND A;  4F7Z A;  3JTH A;  3SFZ A;  1B72 B;  1XG1 A;  2L3D A;  3CMY A;  3GTL J;  1BJA A;  5B5E C;  4PSX A;  2R4G A;  2XAF A;  4M3G A;  2OA4 A;  4DZJ A;  4GFB A;  2VIX A;  1ZRD A;  3C18 A;  1LDK B;  3DTI A;  5FFZ A;  3BTL A;  2QSF X;  3SHF A;  3V8J A;  2EV0 A;  5E20 A;  4EJV A;  1DU6 A;  4IRI A;  4HA8 A;  2ZME A;  3BJO A;  2XF5 A;  1DPU A;  1D1C A;  4OWR B;  5E1X A;  1UB9 A;  3EYY A;  3GFM A;  1W0U A;  1ETQ A;  1U9N A;  4OMZ A;  3WGG A;  3CLQ A;  4OIQ F;  4P1W A;  2MC4 A;  5IP9 J;  3U21 A;  1ONV A;  1FX7 A;  2BW3 B;  1UJ8 A;  4E7J A;  2W00 A;  2FBK A;  1YLF A;  5ICE A;  2VB6 A;  2LKS A;  1J09 A;  3F3X A;  4M72 A;  3L2V A;  3H9G A;  2MG4 A;  1IG7 A;  2DMT A;  2P5V A;  1AKH A;  1ETY A;  3E97 A;  1MH3 A;  3H3Z A;  4IHT A;  2V1N A;  1I6H J;  4B8X A;  5EZH A;  5IYD J;  2KP6 A;  2VT3 A;  2C6Y A;  3M1E A;  1K7A A;  4XON A;  4A6E A;  5B66 C;  4XKV A;  2F5C A;  3EET A;  4BYY A;  2DT7 B;  2Y0S N;  5CYV A;  5ED4 A;  2JPB A;  1FBS A;  4BU2 A;  1XCB A;  1ETX A;  1XD7 A;  4Y4R A;  5M5Y J;  1KU7 A;  2VOD A;  3MQ0 A;  1BOA A;  2Y2Z A;  5BMZ A;  5E79 C;  2JUC A;  3OYF A;  2CQX A;  2WV0 A;  4BAC A;  1GV5 A;  1A04 A;  5LEK A;  3C2H A;  3WU1 B;  3ROU A;  1NTC A;  1TQM A;  2MAB A;  4HYE A;  3S15 J;  3M8F A;  2Y0S A;  4CSW A;  4XBF A;  1P4W A;  4NUB A;  4G7O F;  4ZTJ A;  3G2B A;  5IT9 Z;  5L3E A;  3GO5 A;  2XGC A;  2HOT A;  2CYY A;  4N4O B;  3JRF A;  4KYW A;  2DT6 A;  2K27 A;  4L5E A;  1BIB A;  3F8N A;  1VQN I;  1VF9 A;  1Z0X A;  2GZW A;  2I8D A;  3TDU C;  2ZKZ A;  3W6V A;  1Z7U A;  3OL4 A;  3LNQ A;  1UCR A;  4G9Y A;  4LB6 B;  2ICW G;  2V9P A;  2K86 A;  1XC5 A;  1J7K A;  2QWW A;  3S16 J;  4XN3 A;  1S9H A;  4MHG A;  3WHB A;  5JHU A;  2VON A;  2JUG A;  2WY7 Q;  2IA2 A;  3OYH A;  2E1M C;  1I6X A;  3O3K A;  2EZL A;  3V7R A;  5TIS C;  2H94 A;  4PJM A;  2DA6 A;  1NK2 P;  1BC8 C;  1R5G A;  1J0R A;  1FP1 D;  2DYS H;  2VJI A;  3MD2 A;  1F9N A;  1J9I A;  1OYY A;  4M9X A;  1IRG A;  1YJN I;  4UUT A;  2GOX B;  1WI9 A;  4A3I J;  1FNN A;  1YRN A;  2WAE A;  1XTA A;  2B0L A;  2DPD A;  5M5X J;  2L7F P;  2DTZ A;  3HPG A;  2E2H J;  3RKW A;  4XLF A;  3CO7 C;  4IHS A;  3HJE A;  1OYI A;  4BQO A;  3ABU A;  2M87 A;  1MJA A;  3LSP A;  3GFI A;  1RES A;  1PP8 F;  2GA1 A;  5EGO A;  2JQ7 A;  5E3N A;  1JJ6 C;  4BHB A;  1IF1 A;  3JRC A;  1P92 A;  2CUE A;  4YII A;  5LHH A;  2FU4 A;  2BXY A;  2B7E A;  3K2Z A;  2XF7 A;  3HL2 A;  2DFI A;  3A4C A;  4L0Z B;  4UHT A;  1V54 H;  2O0Y A;  1TZL A;  3VSL A;  5HLI A;  5BPI A;  2WB1 N;  2OCC H;  1ETO A;  3BR0 A;  5IYC J;  1G4D A;  2P4W A;  2DAO A;  2K4J A;  1B9M A;  3W2A A;  4OAZ A;  2JT1 A;  2PQ8 A;  2FBH A;  3FX3 A;  4HSR A;  3HRS A;  2VOP A;  5TRD A;  4E7H A;  3TO7 A;  2IXS A;  1F43 A;  4KIG A;  4F3Q A;  2HU9 A;  3ERE D;  2VL8 A;  3RQ4 A;  4DW6 A;  4D7M A;  1XDU A;  3Q9V A;  1VZ0 A;  3SDG A;  2Z3Y A;  1R4N B;  1T33 A;  4CXF A;  1K4S A;  2V9K A;  4NQW A;  3H36 A;  4G7H F;  1IRF A;  3BG3 A;  2W24 A;  1HSJ A;  4A0X A;  4I7H A;  3A03 A;  3FXK A;  2IP2 A;  1E0E A;  4BE1 A;  1KQ9 A;  5BS6 A;  2EIM H;  2LKX A;  3HOY J;  1IRX A;  3PFY A;  4XRS G;  1BI3 A;  1PVE A;  2WAF A;  2ZJR F;  2FJ1 A;  5EG0 B;  2A3S A;  3F72 A;  4XMY A;  3DBL B;  2BVL A;  3GTO J;  2RDP A;  3ECH A;  3ZQF A;  2DFE A;  1VQL I;  1X2N A;  3E5X A;  4CCJ A;  3A02 A;  3MKZ A;  4L5I A;  4YIR X;  4IQJ A;  5BNG A;  4BY7 J;  1T38 A;  4HV5 A;  3WG9 A;  1X19 A;  3PQJ A;  3WOD F;  2GXA A;  1H8A C;  2JA8 J;  3V8K A;  1KU2 A;  3K9T A;  4OU0 A;  1GV2 A;  5FRO A;  1YOV B;  1YG2 A;  2CJJ A;  2AQE A;  4G94 A;  1IW7 F;  1ETK A;  3HOV J;  2A5Y B;  4G12 A;  1XMX A;  3LSJ A;  3B6C A; 
#chains in the Genus database with same CATH homology
 2RNG A;  2V7F A;  4HNU A;  3IAS 2;  1MMA A;  1UEL B;  3BCA A;  3M8J A;  4HPQ A;  1NG7 A;  2KRC A;  2X51 A;  1WFX A;  4RM3 A;  4DIQ A;  4ANJ A;  1D0Z A;  2X6W A;  3OYE A;  2M0M A;  4NNJ A;  3ZCO A;  2MYS A;  2M3A A;  1DP3 A;  2BW3 A;  4ZJZ A;  4BXF A;  4DGW B;  1BR1 A;  2E5Z A;  4II2 A;  3DPT A;  5HNF A;  1Z21 A;  3CF2 A;  3OMY A;  5HLT A;  3TL4 X;  3CJR B;  3OS1 A;  4D9J A;  1MW7 A;  4G6T B;  3HOS A;  2ZXI A;  5FRN A;  2F6C A;  2KRH A;  4JQF A;  2X85 A;  4ZDL A;  3FBN B;  2K3P A;  2CMP A;  4RMN A;  4LIT A;  3J7A Y;  2ZSH B;  3D5S C;  4KT6 A;  4RLQ A;  2XC7 A;  2VXZ A;  2LY2 A;  2A6T A;  3LMM A;  3QOE A;  2PMZ A;  2M4G A;  2V26 A;  3PL8 A;  3DKY A;  2KL4 A;  4E4H A;  2XDV A;  4ZYA A;  3W3C A;  4EAT A;  3OL3 A;  4CZC A;  4F92 B;  1Y56 A;  2HPM A;  4H4K C;  3VSK A;  2JA2 A;  4PJL A;  3V42 A;  4XLC A;  2R7U A;  3CMM A;  3CES A;  3LL7 A;  3BLY A;  5LD2 C;  2CV0 A;  1Z3Y A;  2IGM A;  5HVQ C;  3H5R A;  2R7V A;  4AU7 A;  2K9L A;  4MLO A;  2VLA A;  1QHH D;  3VDX A;  3C2G A;  3DTK A;  3D5L A;  3W2V A;  2L9S A;  2WAD A;  3HPH A;  3SDB A;  3BG7 A;  4BQQ A;  2CH0 A;  2JVH A;  5LFA A;  3LSI A;  4Y33 A;  1N75 A;  1QU3 A;  1K6Y A;  2E60 A;  3K4N A;  2IS4 A;  1WJD A;  2E5N A;  2OV7 A;  3CJQ B;  3MKY B;  2Q1Z B;  2LRD A;  3VYU B;  2X1E A;  4B43 A;  2WB1 A;  3OS0 A;  2IS1 A;  3SEZ A;  2FUG 2;  1HA8 A;  1DQU A;  2W1O A;  3OYC A;  5TGT A;  2MFZ A;  4DBR A;  4IZZ A;  1D1A A;  4E7I A;  3A1Y A;  2WBM A;  1OR7 C;  1V5F A;  4HG2 A;  2HDW A;  4HRI A;  1MNE A;  2LYC A;  3PSF A;  4CA0 A;  1WJB A;  4E7K A;  4C2U A;  2M7B A;  3VYS B;  4XN0 A;  3DTE A;  4HNT A;  1LKX A;  3H35 A;  3LSM A;  3IP4 B;  2HPI A;  4CCK A;  2HNH A;  1LVK A;  1X4P A;  1Z7L A;  2R7X A;  4BE2 A;  2KLO A;  4RM2 A;  2WAQ A;  4JOM A;  2WA0 A;  2VJJ A;  3OYI A;  3AFH A;  4XQF A;  4IKF A;  5HNH A;  1BR4 A;  3K4K A;  3K4J A;  4BDY A;  3FKJ A;  3PSI A;  2ZXH A;  3KYL A;  3ZGK A;  3TMO A;  3OYN A;  4BQN A;  4XKW A;  2HZD A;  3PJR A;  4PUS A;  1PJR A;  4XLH A;  3DLA A;  2L9N A;  2LBF B;  2CV1 A;  3DKX A;  2KDO A;  3OYA A;  3DPU A;  3HXL A;  3QOD A;  2NOJ B;  1ERD A;  3LSH A;  2UUZ A;  1TT0 A;  1BR2 A;  4XNF A;  3EUK L;  3LFU A;  3PNT A;  3S3M A;  1T0F C;  1KON A;  4U87 A;  3SEQ A;  3QYF A;  1WJF A;  3A2K A;  4XOT A;  1D0X A;  2V4J C;  4E7S A;  4BE0 A;  4C30 A;  1BOB A;  3OYG A;  3CP8 A;  3S32 A;  1ZEL A;  4J01 A;  2DOA A;  3VWB A;  1NG6 A;  3OIQ A;  2IGO A;  2HVS A;  4R79 A;  4E7L A;  4DJA A;  4BEH B;  2QKL B;  3K4C A;  2L5Q A;  2VQH A;  1QHG A;  4PJJ A;  2L2O A;  2CUZ A;  4LG3 A;  2E1M B;  2KPM A;  3RSN A;  4PSW A;  5HOO A;  5FRM A;  3OYB A;  2CUJ A;  4C9Y A;  2IS6 A;  4ITV A;  3AL0 B;  1N78 A;  2XF6 A;  4IQ4 A;  4XKC A;  3OWT A;  4NQW B;  1X4O A;  4RLF A;  2PJR B;  3HOT A;  2Z2S B;  3FDY A;  4HEA 2;  4LIU A;  4BUP A;  2R7S A;  2VAS A;  2VJ4 A;  4NC8 A;  1MMG A;  4XL9 A;  1R6R A;  4AYB A;  3W2W A;  2BOL A;  4F52 A;  3QYE A;  4KIS A;  4AVZ A;  2DCE A;  3S3O A;  1LFP A;  2V6E A;  3K4L A;  1AA7 A;  3M1C A;  4BL0 B;  2GOM A;  3NWT A;  1X1D A;  2HQA A;  4CCM A;  3GBG A;  2M4K A;  1D1B A;  4B47 A;  3PUB A;  1YE9 A;  4F93 B;  3OYL A;  2MD0 A;  2O5R A;  2VKH A;  3F9K A;  4QPO A;  3OYM A;  1V5G A;  3EUH C;  3VYT B;  3AKZ A;  1MND A;  3K70 C;  3PNV A;  5CQG A;  4ZTF A;  4CCO A;  4XLA A;  5KHD A;  4PSX A;  4BJ6 C;  2R4G A;  1Y6I A;  2X1D A;  4BJT A;  2VIX A;  3DWL E;  2OUM A;  1LDK B;  2RQQ A;  3DTI A;  2VQG A;  3LSK A;  2XF5 A;  2IGN A;  1D1C A;  3S3N A;  3L2U A;  4OWR B;  2W82 A;  2KHM A;  3FBI B;  3TBI A;  3QYB A;  3S8P A;  3OR1 C;  4ZDP A;  1UAA A;  1MMD A;  2R7O A;  4P1W A;  2L7K A;  4PFO A;  2MC4 A;  4DBQ A;  3K70 D;  1SAU A;  1P9Q C;  3U21 A;  3K6G A;  3L2W A;  2BW3 B;  4E7J A;  2W00 A;  2KZV A;  3KX2 A;  2VB6 A;  3L2V A;  1J09 A;  2ZSI B;  3H9G A;  4DOZ A;  3E0J B;  2UWM A;  3LSG A;  3RTR A;  4B44 A;  2Z1D A;  4Y3O A;  4B3X A;  2V1N A;  4NC7 A;  3HKZ A;  2LH9 A;  4N4N B;  2KP6 A;  1YX3 A;  1DGR M;  2LOO A;  4XON A;  4B48 A;  4XKV A;  2DT7 B;  2R7W A;  2ZFU A;  3K10 A;  4BU2 A;  2ELJ A;  2IGK A;  4Y4R A;  3OYD A;  1G8X A;  3BC8 A;  2X6X A;  3OYF A;  2VQC A;  4CH7 A;  4BS9 A;  4BAC A;  4BJ5 C;  4XR6 A;  2F5V A;  2VQL A;  4ZDO A;  3C2H A;  1PYV A;  2K9M A;  2MAB A;  4QPQ A;  2Y0S A;  5KCM A;  4CSW A;  2R7Q A;  2JVG A;  1GLN A;  3KEY A;  2VPL A;  4NUB A;  2W4S A;  4ZTJ A;  3G2B A;  4KJZ A;  3DPL C;  2VKD A;  3PNY A;  4N4O B;  2KQR A;  2DT6 A;  1SFK A;  2XAU A;  1T95 A;  2I8D A;  4J00 A;  3ZR8 X;  3OL4 A;  3ZRG A;  3IAM 2;  1X1A A;  3N05 A;  2R7R A;  2W7N A;  4YRV A;  2CFO A;  3K4B A;  4XN3 A;  3OYJ A;  1X1C A;  2XSJ C;  1S9H A;  2JUG A;  2WY7 Q;  4YEJ A;  4IX7 A;  3OYH A;  2E1M C;  4CCL A;  1YX5 A;  1WJE A;  4PJM A;  2IS2 A;  3AL0 C;  2CW7 A;  3MKW B;  2VJI A;  3MD2 A;  3HG9 A;  2LG4 A;  4E6K G;  4FET A;  1EA3 A;  3UNG C;  2GOX B;  4U7B A;  3OIP A;  3L2Q A;  2DJI A;  2X1C A;  3S93 A;  5KNL A;  2CS3 A;  2Q2E B;  2WAE A;  2LBF A;  2K5C A;  4BDZ A;  3HPG A;  4XLF A;  1W36 C;  3UR3 C;  3ZXS A;  2VJ5 A;  3CZ6 A;  3OY9 A;  5CKT A;  1DGW Y;  3I3L A;  4BQO A;  3L2R A;  1U0J A;  2UV1 A;  1WJA A;  4F91 B;  5CQE A;  4CCN A;  1UG0 A;  3HL2 A;  3E1S A;  2XF7 A;  3A4C A;  3BG6 A;  4CUG A;  1TZL A;  3VSL A;  3D5R C;  2X6Y A;  4II3 A;  3HUG B;  1WJ5 A;  3H9J A;  2AQF A;  4XOR A;  3W2A A;  3H5A A;  4OAZ A;  3DQV C;  4C2T A;  4HST A;  3EUA A;  2Z16 A;  3OOU A;  4HSR A;  4LIV A;  4D1Q A;  1Z3X A;  3DU6 A;  4F55 A;  1V5E A;  4E7H A;  2LY1 A;  1W36 D;  2IXS A;  4BEH A;  4XOP A;  5JHF A;  2R7T A;  4F3Q A;  2HU9 A;  4PJN A;  2VL8 A;  3SYT A;  3RQ4 A;  1JI8 A;  3NWS A;  3RPU D;  4ZC3 A;  1VZ0 A;  2HVR A;  3ZQQ A;  4PK4 A;  2CW8 A;  3DU5 A;  2V9K A;  4KIT B;  1FMW A;  2PJR A;  3ONQ A;  2VXD A;  1OLT A;  3RCO A;  3DEE A;  1G59 A;  3SZG A;  3MMY B;  4GRI A;  4BGD A;  3OYK A;  2BVM A;  1E0E A;  4BE1 A;  3I9V 2;  3K4M A;  2CV2 A;  1IRX A;  3PFY A;  2A5W A;  4E7Z A;  2WAF A;  4P5O A;  3H0D A;  2OC6 A;  2F4I A;  3H9Q A;  4XMY A;  2HVQ A;  2BVL A;  1MMN A;  1N77 A;  2KMU A;  4XKB A;  1D0Y A;  3BCB A;  3EPZ A;  3OS2 A;  2P0W A;  1WJC A;  4CCJ A;  3OR2 C;  3VYR B;  2QKM B;  4XM3 A;  3MKZ A;  4FAS D;  1X1B A;  4IQJ A;  2DXI A;  3HC7 A;  3H5N A;  3IUO A;  1X19 A;  2LRE A;  4X0G A;  2LC2 A;  2JSP A;  4XLE A;  4PFP A;  5CPR B;  5FRO A;  1FMV A;  3FHN A;  2RRE A;  2AQE A;  4YEL A;  2WY8 Q;  4OAY A;  2M7A A;  3CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...