2OV7A

The first domain of the ribosomal protein l1 from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
GKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
publication title Domain I of ribosomal protein L1 is sufficient for specific RNA binding.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 27
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2ov7A01
2VPLA 2OV7A 2OUMA
chains in the Genus database with same CATH superfamily
3ZQGA 1PJRA 3DBLB 2BEOA 1SD5A 2BY3A 1FBSA 3KP6A 4G12A 2MSYA 1BIBA 2E19A 1F4KA 1XSXA 3LL7A 3ZMDA 3HSRA 4M3EA 2RNJA 5DDGA 2XKPA 3CC2I 1K61A 2PBIA 2ZSHB 2R92J 5F0FA 4II2A 3TO6A 3OYJA 1LFPA 3K4CA 2VE8A 1OCZH 1XS9A 1E2XA 5EEHA 4B3XA 4ZJZA 5JVGF 1U6GA 4D5CA 2RNGA 4RAGA 3I71A 2X6WA 4MTEA 1WI3A 4LK0F 3I55I 2CUFA 1J09A 5EG0A 3J7AO 2L7KA 4U7BA 1R1UA 4Y15A 2JZYA 4BH9A 4RGUA 1D1AA 4AYBA 2KIUA 3E6DA 2ZMEB 3WG9A 5JVTA 3SDBA 3P7NA 1UMQA 2W25A 2MYSA 2ZNYA 3BDDA 4F92B 2H1KA 2KJCA 4ENJA 3G1MA 4JQFA 4QWQA 4P96A 4AVZA 2CMPA 5A2QK 3TGNA 1VQKI 3BY6A 5J47A 5DM6F 3G1LA 2R5YA 1SD6A 4JP0A 4ZYAA 3WHCA 4I0AA 1QZEA 4CXFA 2DI3A 1UHMA 1YW9A 3BR2A 3AFHA 3DPUA 2M8GX 3EUKL 1ETQA 4U0WA 2DFEA 2OQGA 3H3ZA 3E3VA 3HG9A 1ON1A 3TW7A 5CJ9A 1BW5A 4RDUA 2DDAA 2PMZN 4CH7A 3L2CA 5K5RA 3S1RJ 1BM9A 1MBEA 1I3AA 1D8KA 2KJBA 2K7LA 2CW7A 1UZCA 3LMMA 3WTWC 1IN8A 2OCCH 3WTYC 4E6KG 3MKLA 2DA3A 1MJ9A 3VEPA 1I6HJ 3PIPF 4XORA 4E7LA 3IAM2 4KYWA 1FX7A 2FX0A 1OKRA 4I02A 2FNPA 4NB5A 1KYWA 1MZBA 5M3MJ 3BTIA 1R58A 2XGXA 2HWVA 4TV7A 1YIOA 2Y0SA 2YS9A 1JGGA 1SFXA 1JKOC 4BXXJ 5E1ZB 1R23A 3RYPA 1CF7B 3KEQA 3VFZA 5FROA 2X48A 2VE9A 2R7RA 2GZWA 3CJNA 3AG4H 2V1NA 1HCRA 1S5LC 1RESA 5EGOB 1WKMA 4WF2A 2H6CA 1LUJB 4XOTA 1AKHB 4GXOA 3ZXSA 2MA3A 3F8FA 1FSEA 4OU0A 4UB8C 3FK6A 1OQYA 2HOEA 2QKLB 4XLHA 4A3MJ 2FBKA 3PIOF 2RKHA 4YRVA 1BI2A 2W00A 1FLIA 1JTYA 2CQXA 1T2KA 2F5CA 1H8AC 1EH7A 1ZK8A 4B3AA 4UUSB 4K2EA 5F08A 1JGSA 2Z33A 3CDIA 1W0TA 6PAXA 3I64A 1XCVA 1XC5A 1VQ7I 1YYVA 2ZKZA 3LSHA 1USSA 2R4GA 3HBLA 2M5WA 2W4SA 4I09A 4F52A 4BQAA 4HX8A 2P7CB 1ETWA 1NH3A 3QYFA 2Q0OA 3LFKA 2XC7A 3TEDA 2NVTJ 5JLXA 2WBMA 4HSRA 1LFBA 2Z5UA 1HQCA 2GOMA 2LLKA 5H6QA 3U2RA 2GA1A 2X6YA 2XF7A 2XAFA 4A6EA 3CF2A 1H9GA 1VQNI 3DBHB 2E1MB 3J81K 4BL0B 4LB6B 2PX9A 1A04A 4G6QA 5BS6A 3T8RA 1D1BA 4WXHA 4RM2A 1ZKGA 2RC4A 4MNUA 4OIQF 2FE3A 2RQQA 2R7OA 2QUFA 1CGPA 1IN4A 3HOZJ 5D8LB 3QAHA 1MJAA 3DEEA 4OOIA 5E3LA 2JRTA 2VIXA 3FZVA 4PK4A 3VYTB 3JRHA 2J5OA 1K78B 3C1DA 1MJBA 3BR6A 2A3SA 5EEAA 5D5VB 5EYRA 5ICGA 4DZPA 3M7GA 3HOYJ 1ZYRF 3J7ZI 4BKXA 3KP5A 3BR0A 3KP2A 2M0MA 1WI9A 2XHKA 4KICA 2W85A 1FEXA 2UZKA 1PDNC 5FRNA 2G9WA 2LYCA 2W7NA 3S3OA 2VOOA 3KP3A 5EGOA 2NRAC 1P92A 3G1OA 3X2QH 3QYBA 1MMGA 1IRZA 5K5QA 1FTTA 4A69C 4AD9A 1Z21A 4ZH4F 3EDPA 4EGYA 2QENA 1D0XA 3MZ8A 2HNHA 1QA6A 3W3CA 2L4MA 4QTRA 1Y0NA 4XLAA 4M6VA 2ZJ2A 4IHSA 4CCLA 4HG2A 4XSXF 1D8JA 3DP7A 4F3QA 2FMYA 1JHHA 2KIMA 4HBLA 4IQ4A 2B7EA 1BJZA 3BWGA 3BTLA 3ZMZA 1MD0A 2P5KA 3RQ4A 3HRUA 1C0WA 1NK2P 1P9QC 5J4YA 1XGSA 5KHDA 1K4SA 2LFBA 1YLFA 2RV8A 1K79A 3JRGA 1RKWA 1MH4A 1O3QA 5FRMA 5L3GA 3GCMA 1S6LA 3GBGA 4OAZA 2VOPA 3CF5F 5LRRA 3SDGA 2Q2EA 3PNVA 3VOEA 4AIKA 1KU3A 1T98A 4E7SA 1TWCJ 1QBJA 3DEUA 3WU0A 2EB7A 4M9XA 3S2WA 3RZOJ 2LKSA 2L7FP 2GOXB 2P6TA 2LBFA 4UXNA 1E3PA 2XUBA 4P9FA 3IRRA 4CZZA 1SFEA 3PSFA 3BPVA 5GAHJ 4M9ZA 2E35A 1YG2A 5BQTA 1JKPC 4GYIA 1JJ8C 2G0EA 3BZ6A 4LIUA 4FX4A 4N4NB 5F1JA 1B4AA 1IO2A 4CYCA 2DA4A 1P4WA 3R0AA 2FEZA 4MEXF 1TWGJ 5TJJA 2JRMA 1VQ5I 3E6MA 1KONA 4NC6A 1BOAA 1XCBA 4MEYF 2BE5F 1WHUA 2KPMA 2CG4A 3CJQB 4M3GA 4BDZA 3KPHA 2BW3A 2GIVA 2QVOA 2CUZA 2HKXA 2EFNA 2QQ9A 1X1AA 2ACJA 1B9MA 1Z05A 1SANA 3HOWJ 4LG3A 2DK5A 2ECCA 3QPSA 4O3MA 2CYYA 2V1DA 3IRQA 1X1BA 5DD4A 2WV0A 1K4TA 5HS8A 3M1CA 2V6CA 2F5FA 3K4MA 4DW6A 2K86A 3ISPA 5KAIC 2DPUA 2VBXA 4X0GA 1I6XA 1QPMA 2XGEA 3S2HJ 2FNAA 2J5PA 3GZ6A 4YFNF 1A6IA 2W1OA 1OR7C 3GWZA 5L3BA 4UVAA 2Z16A 2Y69H 1QGPA 4IRHA 2P4WA 4L9TA 1LPQA 4CCKA 4CYDA 4PFPA 2D5VA 4OMZA 2K4BA 4CHUA 4XLCA 1MBKA 3KZYA 2A69F 3I0TA 3LSKA 1X1CA 1JHFA 3L2QA 2ZJQF 2GWRA 3HSFA 4BQNA 1RPWA 4C3JJ 3IKTA 3H3VK 2VKDA 2UWMA 1B1BA 2ICWG 1X3ZB 2NS0A 5BOXA 4FX0A 3S32A 1R5HA 1ZELA 1IUFA 1ETVA 2X51A 3GTQJ 1BR4A 2O6GE 4L0YB 1ONVA 1IUYA 1HLVA 3P9IA 3ZQ7A 3OYCA 2FF4A 2M3AA 2WTEA 1SFUA 4CCMA 4L9VA 3MQ0A 2TDXA 3OYDA 1KQ9A 3HL2A 1P2FA 1SAXA 5D6FA 5D5XB 1TNSA 5TRDA 1WQ2A 3DPLC 3ZPLA 2LH9A 4ENNA 2E34A 1XSVA 2Q1ZB 3KYCB 4UNOA 2QA4I 3H3UA 2H09A 2MFZA 3S93A 1GT0C 4KFCA 1VQ4I 2E1OA 3IWZA 4HW0A 1V3FA 2IGMA 2BOLA 4GGGA 3BTJA 4XKCA 3B6CA 4W1UA 1ORKA 3L2RA 2ZO4A 3GLLA 4EGZA 5B1BH 1ZGAA 5IT9K 3G71I 1S7AA 3K4BA 2BYVE 1LVKA 1H0MA 2LMDA 3KP4A 5FGMA 4D7NA 4KN4X 2DODA 4EQQA 3REOA 4V19K 2K85A 1NG7A 3HKZN 4CZCA 2OZUA 1HKTA 2XAUA 2NNYA 1W7PA 1S29A 2DT7B 1EA3A 2DQLA 3A1YA 4BBSJ 1SVMA 4UV9A 4FCYA 3CTAA 1F36A 4PJLA 1QVTA 3CQZJ 5LEJA 5FFXA 2BZTA 3BJ6A 4EM0B 3SHFA 1W5TA 4I0BA 3RPUD 4XICA 1XSDA 4XONA 1XMKA 3DFGA 3M1EA 2ZCWA 2HDWA 2FSWA 1U5TC 1I1GA 4U87A 2AXLA 5E1XA 1HKSA 1FP2A 3HUGA 2OC6A 1LFUP 1G6NA 4QPOA 2R5ZB 1G4DA 1YS7A 3CMEI 1DU6A 2PJRA 4KN7X 1F1ZA 5E18F 1YTYA 1ZG3A 2WC2A 1VF9A 2NS7A 1GV5A 1TBXA 2CUEA 3AKZA 1HBXG 3HKZA 2F5VA 3H5RA 2X85A 1VTNC 1OMIA 4PUSA 2NXNB 2MD5A 3EUHA 3RJPA 1N25A 3F23A 2R7VA 1MBFA 1QHHD 3MVPA 4IOCF 2IS2A 1DP3A 2KHMA 5FD5A 2JVHA 1TW2A 1ZH5A 1HW2A 2JA8J 3PL8A 2LD5A 2ID3A 3DKWA 3ZR8X 2V26A 1DP7P 5FFZA 1TC3C 1TQIA 2M9HA 3ASOH 1EJ9A 3HTSB 4AWXB 4ZDPA 1YJWI 4J01A 2V4JC 4QLCU 3CMYA 2XAQA 3CUQC 3PFYA 4EJWA 2KRHA 2HQRA 2EILH 4NNJA 4YEJA 5DCMA 1MDMB 2V9PA 4LLNA 2KLOA 1MH3A 1UJ8A 2JPCA 4RB0A 1Z7UA 2QYOA 1YJNI 2HTSA 2RGVA 2A61A 3ZMVA 2CV2A 4KIGA 1J9IA 5D8KB 3M9AA 5K7ZA 4XRMA 2YSRA 2M2EA 3BQZA 2IA2A 2XGCA 4MLOA 5EJCA 3N05A 5LHHA 3ML6A 3JSPA 1XB4A 5FJ8J 1T95A 1YO5C 2XPWA 3KLOA 1UHSA 5K5OA 3OSFA 2EBIA 1PUFA 4OINF 1A35A 3VYUB 4LJZF 3CC4I 2MLKA 2RDPA 5HS9A 4BU2A 2EFOA 3CO7C 5ILSA 3NRVA 2X9DA 4A0ZA 5FLXZ 4ZYEA 4BDYA 2RVCA 1FMWA 2OF7A 2Y75A 2PJPA 2LKPA 4B48A 2M34A 2L9NA 4KIBA 3KEOA 5CVIA 4FISA 1RR7A 2HFHA 2X1DA 4BEHB 2LOOA 3L00A 3KIOA 3WTZA 2WB1A 3H0DA 2IGOA 2V9KA 3RKXA 4C3IJ 5FLVA 2TCTA 2XPUA 2VODA 2FOWA 4MO7A 1E0EA 5K7HA 2XSDC 4IOAF 4RA2A 5GAEJ 2R5ZA 3ASNH 2QQ8A 1YRNA 3CDLA 2G7HA 3AG3H 4D9JA 2A6EF 4IO9F 1SAUA 4HX4A 3GZNB 2KMUA 3H92A 3GTKJ 2STWA 2MC4A 2OA4A 1I27A 2M7BA 1W0UA 5C44J 1TL8A 3KE2A 4AC0A 1PYVA 1GUUA 2XB5A 4UUTA 1MIJA 3WE3A 1BIAA 1SVLA 2MG4A 1FOXA 2QGUA 3L2WA 1D0YA 1Z7LA 3FMQA 1PP7U 1EH6A 4XQFA 1IV6A 3CC7I 3CZ6A 2VQGA 2XASA 3H35A 2GBYA 3ABTA 4HLYA 2K9LA 4BACA 4BGDA 4IX7A 3BG9A 1VQMI 1MDMA 4BHBA 1DPUA 2Y31A 4U0VA 3E0JB 4LG0A 3FKIJ 4KIFA 2BHYA 3HTUA 1S72I 1O3TA 5L3DA 3U1DA 4XIDA 3F21A 2HPMA 1LNWA 2CU7A 3DWLE 4ZDLA 2IRFG 2EZKA 1VI0A 4S05A 4ANJA 1HA8A 5J8CA 4ZTJA 3J80K 5B5EC 2LF7A 3DU6A 1ZG1A 4P1WA 2NVUB 1I1SA 1WJCA 1AOYA 1U78A 3UR3C 2HOAA 4BHPA 1NG6A 1HW5A 2JUGA 3OR1C 4AYBN 3G73A 1YI2I 2O5RA 1IJWC 3GTMJ 2V79A 3ZQCA 2PN6A 1F43A 3CMAI 2E2JJ 2UXXA 2L7ZA 3BG5A 4V2GA 3VB2A 3I5UA 1OISA 2DA6A 2YX4A 2EQRA 3MZYA 3QOPA 3T5XA 5HOOA 2IS6A 3I4MJ 1YHQI 2WY7Q 1A5JA 2COBA 2ETHA 2L02A 5DD8A 3PQJA 3ZP5A 3FDYA 3IH4A 2EV0A 2LSOA 1KYZA 2BXYA 3HIFA 3TP3A 5DS9A 4MTDA 1VQ6I 4J19A 4B47A 4IHXA 2KQRA 4A93J 3SZGA 1DU0A 3T1BA 5LGUA 1F9NA 3FHZA 2FA5A 4RGXA 3RQIA 5J1RA 1QHGA 1XGNA 1HF0A 4RLFA 3JRDA 1GXQA 2ZMEC 4MIMA 2CQ7A 4RGSA 5DCFA 3B02A 4U0YA 3FK7A 4MFDA 2K4JA 1RZ4A 2HXOA 2IT0A 2Y0SN 2O61A 1X3WB 1YE9A 2G7UA 4FHTA 3BQYA 4A6DA 1ETOA 4XKBA 2DMPA 3D5SC 4KUMA 3MEXA 1RC9A 1PP8F 5B1AH 1N77A 2HVSA 5LLQA 1X4OA 2HDCA 4EJVA 3KCCA 3FM5A 1WH7A 1Y56A 4HX7A 2VONA 1J0RA 2XRLA 3NQOA 2EH3A 1HDPA 3LA3A 4BY7J 3QPTA 4CCOA 4FT8A 2NAZA 3EYIA 2JPBA 3PFIA 1B72A 1OPCA 5JLWA 4IJAA 5ICEA 2QLZA 1YIJI 4N9IA 1RUOA 3DTKA 3BZKA 2B0LA 2OQRA 4HLXA 3GTPJ 4YFXF 2V9VA 1IGNA 3FKJA 5M5WJ 4HEA2 3PUBA 2CFXA 1YS6A 3BCBA 3BJOA 2CRGA 2MW8A 4LITA 4HPQA 4I76A 2OZ6A 1G2HA 3CCLI 4U7DA 2MABA 3OYBA 3K70C 2QEXI 1X2MA 3CLOA 3BG3A 3QU3A 2ZC2A 4XM3A 4WCGA 4JX4A 2IVMA 2XAJA 2VJ5A 3R0JA 1NHAA 4ZYHA 3R4KA 3OYNA 1S9HA 2E60A 3ERMA 1JUPA 4A3JJ 1GXPA 3FM3A 5L3CA 3WGIA 3GUDA 4OIPF 4LLGF 4BYYA 2DQRA 3A02A 3JAMK 3JREA 2VUMJ 1ZN2A 2M87A 5D5UB 2IGKA 2ISYA 3IWFA 4A3CJ 3TO9A 1R5ID 3IL2A 4CCNA 5JFRA 1UG0A 4WXCA 1SEUA 2E7WA 1NK3P 1HXDA 2FXAA 2QSFX 3FXLA 5HNFA 3A03A 5FD6A 5LRSA 3F72A 3OYLA 5J4VA 5EZGA 3FXJA 3OYFA 3BOQA 4DYRA 2Q2EB 2F2EA 2Y9YA 3HRTA 4NC7A 2ECBA 2VBWA 5D6EA 1R1VA 2VJ4A 1XTAA 1KQ8A 2JJ7A 2EWNA 3OIPA 3I4NJ 2V7FA 4WWCA 4CICA 2WA0A 2V6EA 4CO8A 3OYMA 2H8RA 2MH2A 3MKYB 2IXSA 2LBFB 3RZDJ 5ILUA 1JXSA 5E1WA 2ZFUA 2KIFA 2RREA 3LSPA 3FXRA 3U1KA 5ICFA 2QBYA 5J1YA 1IC8A 4IRGA 1ZHFA 5E79C 1MW7A 1O7FA 3BR3A 4Z2YA 4CYCB 1IDZA 3K70D 1O7LA 1BBYA 3S14J 2EV5A 4L5EA 4PSXA 5IYBJ 4GYGA 1MMNA 3A2KA 2VI6A 2CGPA 1MNEA 3NWTA 5D4RA 3DTIA 4B8XA 4I01A 3F8BA 1WWXA 1OFCX 2FQ4A 3CUOA 2E2IJ 2Y48A 1TQMA 2BW3B 1T6SA 3OIQA 3JW4A 3CCSI 4XKWA 2GLOA 1EH8A 3CJRB 4E70A 3MMYB 4A3FJ 4FE7A 4BUPA 1TTYA 1YJ9I 3GX4X 3LSRA 4NC8A 1QU3A 3E1SA 3DLLF 5KNLA 1S3JA 4Z6YA 2LNBA 2FBHA 1RUNA 2K02A 4RB3C 3V7SA 3UKGA 2DPDA 4BJ5C 4YIRX 1ZQ3P 4KA4A 5CVJA 3FHNA 1RRJA 3PO2J 1YX5A 3H9QA 1VQ9I 2VPLA 3QWLA 2DTZA 4HOBA 1ODDA 2FQ3A 1EKEA 9ANTA 2BVLA 3FX3A 2CV0A 4XBFA 4UUVA 4M3FA 3HHGA 1MBGA 1JUMA 2E1NA 3RTRA 4FTHA 3ONQA 3OS2A 1LE8A 4CCJA 1XMXA 2R7ZJ 2O3FA 1JUSA 2LC2A 3GZ5A 1SVOA 3HOXJ 3MZHA 3E5XA 2NOJB 4E7IA 1R36A 3K1PA 5FKLA 1ITYA 2M1BA 2VBZA 4JX5A 3D5LA 1AHDP 4C2TA 2UUZA 1BN5A 4IEJA 1H88C 1N78A 5CQGA 2QSGX 1I50J 2P8TA 1U3EM 3K69A 1HDDC 5HDKA 4B44A 3HJEA 1VQLI 4XMYA 3BZCA 5EDNA 2ZBKA 1IG7A 5H6RA 4P5OA 4RAZA 3HXLA 3QOEA 4PSWA 3H0GJ 3R60A 1T08B 3HGGA 2CW8A 1VFCA 2CV1A 2DO7A 4ON0A 1FT9A 5J1UA 3LA2A 1BR1A 2DXIA 3CCJI 1FNNA 4EEFG 3L2VA 4PZJA 1QNTA 3TBIA 1TT5B 3C2GA 4PGHA 4RB2C 5LGTA 2ZXJA 3W6JB 2JK3A 1IN7A 1Y6IA 2DBBA 2HYGD 2KIQA 3CCMI 3G6EI 1Z77A 3AL0B 1IXCA 4HZFA 1UAAA 4S0HB 1YFHA 2H1LA 2JA2A 4C3HJ 2ZFWA 3HSEA 5CVUA 5AIPA 4IHTA 1UFMA 2FMLA 1ZLJA 2AS5F 5A2QZ 3CESA 3A0BC 4DIQA 1W5SA 2D2WA 3GYHX 1WJFA 1JKRC 3F6VA 5D4SA 1W7PB 4XSZF 1Z0XA 1RR8C 1X2NA 1G3SA 3CCRI 3E6CC 1KA8A 4BE0A 1IV8A 3G4SI 1ZR2A 1GDTA 2EPFA 4DBQA 3HYIA 2ELJA 3OV8A 4IHVA 1ON2A 2ZXHA 3Q0VA 3TKYA 2DA1A 3P5JA 1MGTA 1WJAA 1KU2A 1FWZA 2L54A 3G3ZA 2Y9ZA 3RSNA 5HDNA 1RNLA 4EJTA 2OTLI 4D1QA 2PEXA 4Y33A 2OUMA 3K1NA 5FO5A 2DA5A 3LA7A 3ROUA 1TZLA 3C3WA 2GAUA 2OV7A 4EV0A 5GTHC 3HUGB 3Q0UA 1U9OA 1FBQA 1S7OA 4Q47A 2QM3A 2EIJH 3EETA 3SFZA 1V5FA 5IP9J 2B9SA 3F6OA 4BJTA 3ABUA 2PJRB 3PO3J 2L5QA 4Q4ZF 1Z91A 1YW7A 3PSIA 1BC7C 2IBDA 3SZTA 5FKOA 4JBAA 2VL8A 5HLGA 5J8FA 5DUIA 1T0FC 1U8RA 3WU1B 5IY5H 1K6OA 1ZG5A 1GLNA 3LQRA 1TQPA 5HLIA 1V55H 2DA2A 4IXAA 2VBYA 2Z1DA 3JRIA 3K9TA 2VASA 2XVCA 3IV5A 4A3KJ 3C18A 2DW4A 3WODF 5J40A 1G8XA 2EV6A 2E5NA 2D45A 3QU6A 2XGDA 5DCMB 3OMYA 2JT1A 1OCRH 2VLAA 4M73A 2E71A 1MBJA 2HQAA 2FD5A 4RAYA 3GW2A 2P5LC 4G8XA 3PNYA 3BG6A 4XNFA 4LLLA 3WTUC 4L5IA 1P7IA 3S15J 3DKYA 3LOCA 3TOAA 3BR5A 2HZDA 2V1XA 1LEAA 4RM3A 3IP4B 1WRJA 2HVRA 1PUFB 1LDJA 2KDOA 4B43A 3ELKA 4E4HA 4HYEA 4BJ6C 3J81Z 3R6SA 3BJAA 4KMFA 2K9NA 1V5GA 2L3DA 3M07A 1Z3YA 2F4OB 2R0QC 2EZLA 2WADA 2H27A 1MMDA 1AU7A 5DV5A 1TNTA 1P4AA 5LD2C 1D3YA 1FOYA 4JYKA 4AIHA 1A31A 2STTA 2H8WA 1A36A 2FU4A 1WJDA 3GTLJ 1RI7A 3FWEA 2L9VA 1EF4A 2O7OA 3MD2A 2GM4A 4B1RA 1IXRC 2VN2A 3MN2A 3SQNA 3W2VA 3HOUJ 2QF7A 1PUEE 2HTJA 4DZJA 2DFIA 2IAIA 3QPHA 1HC8A 4X6AJ 1B59A 5E3NA 3Q9VA 1D5YA 2HQ5A 3QQAA 5FKMA 1R22A 4NHJA 2O9LA 1UHWA 1OR7A 1RKTA 5CQEA 4UB6C 2HYFA 4YELA 1L3LA 1YRNB 1FPQA 3GFMA 4G7ZF 3MFKA 3E5UA 2R7UA 3EUAA 3SZPA 3OYAA 3RI4A 1ENHA 2LK2A 1WVRA 2PLYA 3GTJJ 5F0HA 3TMOA 2EFWA 4A5NA 1R7JA 2IGNA 5JI6A 3L2UA 5F64A 1Q1VA 3RPUA 1JI8A 1HSTA 3TW6A 2K5CA 1T33A 2KFDA 2WAEA 2QSHX 2CQQA 3D5RC 3FXQA 2H6BA 2WB1N 5F04A 4F7ZA 4GO1A 3H5NA 5CVVA 5HS7A 3EPZA 3EQLF 4B4CA 2IA1A 1LJ9A 4IRIA 4LG0B 2PQ8A 4CA0A 1N75A 3I4PA 2GXAA 1XDSA 2VB6A 1P7JA 2VT3A 4BE2A 4S04A 4IZZA 4ZTFA 2ZXWH 5IOZA 4DGWB 1GVDA 2M45A 3GMEA 2LDUA 1LDKB 3W6VA 2KRFA 1FIAA 1WGXA 1RIOH 3CUQB 2QQBA 3ZGKA 4ZDOA 2DJNA 1XX5A 2F5EA 4O5VA 3HPHA 5FLMJ 3ECHA 2ME0A 1R1TA 2DT6A 2KKOA 1D0ZA 1G3TA 3P9CA 2LG4A 2L7MP 2BY2A 3KZIC 4ESBA 1XGMA 2VT2A 1HKQA 4LOCA 4ZYDA 4KITB 2L2OA 2ADUA 2GXGA 4NQWA 1OLTA 3BLYA 1Y1WJ 2VKEA 2NVXJ 3VWBA 3E7LA 2DAOA 5H20A 3VSKA 3G2BA 1ULYA 1WFXA 4I98B 4WX9A 1O3SA 1ZRFA 3PJRA 2YU9J 2JQ7A 2QQAA 1VQPI 4CDGA 2L4AA 1Y39A 1B8IB 3IH3A 3CCEI 1HSJA 2BHZA 2OJED 2IPQX 3CP8A 2K9QA 4N4OB 2DN0A 2KL4A 2LVSA 1R9TJ 1LEBA 1HOMA 1U9NA 2BVMA 2EFPA 1DUXC 1J7KA 2DYSH 2R3SA 1MBHA 4FETA 1X3UA 4HDUA 1T39A 2VXZA 1AWCA 3KYDB 1X1DA 1FP1D 4Y4RA 4EM2A 3COAC 2PMHA 5M5YJ 2KZGA 4M9SA 2DA7A 2FOKA 1BI3A 3K7AJ 1VZ0A 2W57A 2ZSIB 1KZHA 2K27A 2P81A 3OOUA 3DXJF 5TISC 2EA2A 5BNGA 3L1PA 3PUFA 4IF4A 5E8GA 4G7HF 3CCQI 2FBIA 2OD5A 2BXZA 3HM5A 2L0KA 3U9GA 4FE4A 4JX6A 5B3SH 5IOYA 4UHTA 3CCVI 1ZRCA 4G6DA 1I5ZA 1ZARA 1KGSA 3GVAA 2LR8A 4M74A 3RKWA 4Y3OA 2KZVA 3DU5A 3MCZA 1B72B 2Q8KA 2DOEA 5CPRB 4LMYA 3VPRA 1ZGJA 3P9KA 4DQ2A 2CO5A 3AG2H 4A3GJ 3CUQA 3V4GA 2XIGA 1T38A 3ZMSA 1X58A 3IHUA 3I56I 2FRHA 2E1CA 3TO7A 4KDPA 2O03A 2R7SA 1H9TA 2FJ1A 1XD7A 1WJBA 5HNHA 1I39A 5J3LA 2DOFA 3KETA 3LSTA 2COMA 3FBIB 3CCUI 4M6XA 3JSOA 4LGWA 3JTHA 5FB2A 4L9JA 5CVRA 1CQTA 1FZPB 2R93J 4EJOA 4DYQA 3ERED 4XL9A 5DM7F 2Z99A 3M8EA 3RIRA 5ERIA 3ECOA 3V8LA 2W82A 3OYIA 2OTJI 1B8IA 2PMUA 1HW1A 3WU2C 1I3QJ 2NOGA 4GFBA 2I8DA 2M7AA 1XGOA 3IUOA 1KU7A 1UCRA 5IT9Z 1GV2A 4II3A 5H2FC 3S3MA 2CSOA 2QWWA 5F27A 2EIMH 4D7MA 1B9NA 3W2AA 1WH5A 2ME6A 3ZN1A 2JVGA 4AIDA 3CJTB 4N9HA 1ZRDA 2HOTA 4QPQA 1JE8A 3BG7A 4MFEA 4A0XA 3ULQB 3A01B 3K6GA 3JTGA 5IYCJ 5ILVA 4HV5A 3ZQFA 3DKXA 3O8GA 3L09A 2P7VB 4M3DA 4L18B 3BT9A 1QO0D 2PG4A 3S17J 2MH9A 4F55A 5J6XA 4L9NA 2ELKA 1MSEC 5L3FA 1IN6A 1TT0A 1MMAA 5KCMA 3Q5FA 4G7OF 3DQVC 1KQ0A 5AONA 3LQQA 4OWRB 2CWEA 4RLQA 1VQ8I 4A0YA 3ZQIA 5IP6A 1GHCA 3O6BB 4O6JA 2VJIA 2Y2ZA 2HVQA 4X1EA 3H36A 2OBPA 2F6CA 3K2ZA 4DYCA 5GPAA 4PJ0C 3QODA 1FYLA 3RKQA 4BQOA 2ESHA 1D1CA 1J75A 5F1RA 2QBYB 2NNNA 1LB2A 3SEZA 2OCEA 2HYJA 3K4JA 5L3EA 3U21A 3K0LA 4LFUA 3CMMA 3VYRB 4IKFA 2X1CA 3FISA 3FIWA 3OYEA 4YG2F 3HPGA 1OCTC 3LWFA 3GF2A 2MD0A 2LF8A 5HVQC 4F91B 1TW3A 3K4NA 1V5EA 3ESWB 3F8CA 4RAFA 4ZZDA 5GP9A 1JJ6C 3S8PA 2M8EA 3FBNB 4PGGA 5AIQA 3I53A 4M71A 1Y1VJ 5HODA 1FTZA 1Y8QB 1JT0A 4G6TB 3H9JA 3PQKA 2BV6A 2JSCA 2VQHA 3O3KA 4U88A 1Z6RA 1RETA 3OWTA 2NYXA 2P6SA 2X6OA 1Y0UA 2JWTA 2JTVA 5LFAA 1FOKA 2YX7A 4Y52J 3DCFA 2W24A 2PMZA 1XDUA 4RGRA 3HC7A 3HDDA 3A01A 2K9MA 3KFWX 2ZB9A 2R7XA 3S2DJ 1LE8B 4ESJA 3IC7A 2QKMB 1R71A 3BP8A 1OCOH 1G3YA 1BC8C 2OAZA 2E1MC 2B63J 3RYRA 4MQ9F 5C3EJ 1LQ1A 1E3HA 3DLAA 5ED4A 2VKHA 2HQNA 1V4RA 1R4NB 2MBFA 3VSLA 1K6YA 1G3WA 2ZMEA 2UXNA 2LKXA 3V8KA 3OYKA 2YU3A 5BPIA 1PVEA 2EFQA 3S1QJ 2IP2A 1AA7A 5M3FJ 2LRDA 4E7KA 4C2UA 4OMYA 4BXUA 1O4XA 4V2FA 3TDZC 3TOBA 2BY1A 2HGCA 1J59A 4AUXA 4I99C 4M3BA 4B09A 2CS3A 4EJUA 4KT6A 2HR3A 3C2BA 3V7CA 3ZRGA 4ESFA 3LSGA 3KYLA 4HNTA 2LY9A 4HAMA 4XRFA 1VQOI 1SMTA 3D1NI 5GAGJ 2VXDA 2N8GA 4I7HA 2GA2A 1WSUA 3OYGA 1ETXA 1YITI 1U2WA 2CQKA 4ITVA 3PM1A 1W36C 2WAFA 1FC3A 2DMTA 2F4IA 3GXOA 2D1HA 3D0SA 2WAQN 2K3FA 3F3XA 2L9RA 2HPIA 3OL4A 2WWYA 1BR2A 1OYIA 1K83J 3F9KA 3WTVC 4C2MJ 4PFOA 1BL0A 3QP5A 2R7WA 2OU2A 4Q5SF 4XN0A 5TGTA 2A68F 1X19A 1CF7A 5F6FA 2IEKA 1MSFC 2DCEA 2E7XA 3HOSA 4Y17A 2E2HJ 1U0JA 2JN6A 3JRCA 2CUJA 1APLC 3TQNA 3TP0A 1FY7A 4BBRJ 1ZAOA 3FXKA 2W48A 1DPRA 2X0LA 1S8NA 2AQFA 2C6YA 2IS4A 1AKHA 2BY0A 4XN3A 2ESNA 3H9GA 1TP4A 2Z2SB 3O2PE 5KVRA 3E97A 4CGZA 3J80Z 3IKVA 3GLXA 4I6ZA 3L9FA 3Q9SA 1OCPA 3OR2C 4RB1A 3HZJA 1QQIA 4UUSA 4N0BA 4IL6C 2X6XA 4R1HA 2F4MB 2WV1A 3L7WA 4IVNA 5EF6A 5DUKA 4ABZA 3JR9A 1FMVA 2WAQA 1OYYA 2HU9A 1SFKA 4ZZLA 4LD5A 4GCVA 4DJAA 2R7TA 2H94A 2KISA 4ZYGA 3CP2A 1LVAA 1FYMA 2L01A 4MGRA 1ZREA 2JUCA 4XR6A 5LHIA 3HOVJ 2K40A 5F0CA 2EJRA 2LREA 2W84A 3CLQA 3HOTA 1IZ1A 4XOPA 1DGRM 3WGHA 3E6BA 3UNGC 3RCOA 1F5TA 5JHUA 1ZGWA 2VC1A 4E7ZA 5KK1A 3ZOBA 5FLXK 1W36D 3IH2A 4A2UA 4YIIA 5LBQA 3AL0C 4WXDA 4IHWA 2EK5A 4HDVA 3VODA 1FSHA 1O3RA 4J00A 2DTRA 2UV1A 4A12A 3NWSA 4LB5A 2A07F 4XK4A 3ZQLA 4IQJA 1G59A 1UG2A 5C4XJ 3BC8A 3BROA 4Y13A 2CFOA 1K78A 1IAWA 2AO9A 2KDZA 1L0OC 3FMRA 2VJJA 4OIOF 3QPLA 2XB0X 3MKWB 3GFLA 2MC3A 2DMUA 3JRBA 4HF1A 3K1MA 4LK1F 4XKVA 3SFIA 2KT0A 3ZMUA 2RQPA 3BPXA 4MQVA 2R7DA 4HRIA 2JA6J 1Y8RB 2DDBA 2KRCA 2WY8Q 4UVCA 3RDIA 5IT3A 3BTCA 4WK8F 2XV4S 3WTXC 2M4GA 2A05A 3OS0A 3DF8A 5IPAA 2XF5A 3HRSA 2HKOA 3F0CA 2A6TA 5E20A 5JHFA 2XAGA 3V7RA 3LSMA 1JTXA 2VQLA 3Q3SA 5IP7J 2X4HA 4A3DJ 2Z3YA 5D5WB 1Z6TA 2GIZA 1LKXA 4XRSG 1XG1A 1IW7F 1OYWA 4D5FA 1DGWY 1W4MA 2P5VA 1JT6A 4AU7A 4FQGA 2OPTA 3CO6C 4H0EA 1FJLA 4L0ZB 1GVJA 3EUHC 4QSHA 1QZYA 1TLHB 3I9V2 3F8MA 5K7FA 4BAYA 1VNDA 1IF1A 4C30A 2AQEA 1SD4A 2HI3A 2DMNA 2IW5A 1XPXA 1REPC 1YQAA 3SYTA 1BOBA 2CH0A 3GO5A 2JA5J 1X1PA 4KT5C 4XLFA 1QZZA 1ACIA 3WTTC 3WHBA 1T8IA 3K2AA 2HDDA 3S3NA 1LDDA 3KEYA 3MKZA 2M30A 2AHQA 2D1VA 3RPQA 3M8FA 3ABMH 3ZQQA 3JAMZ 2GXBA 2YUSA 2E5ZA 1W7PD 4E7JA 4OIRF 2ZXIA 5LEKA 4R8HA 4FASD 4UY8I 2YPRA 4M72A 3DEWA 4D0PA 3HGYA 3BR1A 1BA5A 1ERDA 3OIOA 3LAPA 1Z67A 1S7EA 5HDGA 1J5YA 1IDYA 1USTA 3FMSA 2ID6A 4Q48A 4MHGA 3R61A 3CDHA 4HV6A 1POGA 1YX3A 4HF0A 4ASNA 4HF2A 1STZA 3H1CA 4NUBA 2EINH 3WTSC 3AAFA 2X1EA 3OY9A 2NVYJ 2P0WA 3HB9A 4P9UA 4PJMA 4E7HA 4BY1J 4HQMA 4JOMA 2O8KA 2DT5A 5E17F 2K9SA 1IXSB 1DQUA 4UV8A 5EZHA 3WE2A 1R49A 1IRGA 3DTEA 4XRSA 5LHGA 2NVQJ 2L9SA 3KLNA 4CSWA 3M8JA 5K1YA 1Q1HA 1ETKA 2O8XA 5CYVA 2HOSA 3J7AY 4PDKA 1MMSA 5M5XJ 2LTPA 5E3MA 3QRFF 4NQWB 2R7FA 3MWMA 2HS5A 5CLSA 3TL4X 4HNVA 5FKNA 2VPRA 2PFBA 4LIVA 1TWHJ 1Z3XA 4BQQA 5GADJ 1WZ2A 4PCQA 2EZIA 1XN7A 3GEZA 3K10A 5DEQA 1BW6A 3VYSB 4BXFA 1SD7A 4F93B 1YOVB 3A0HC 4YFKF 4XLNF 3T8TA 1ZTRA 1R5GA 2BGCA 3OS1A 2DLLA 2DFHA 4RBOA 3CD6I 3HRMA 4A3LJ 1A6QA 3O8HA 2XRNA 3DV8A 3C2HA 2F5DA 2VQCA 1R00A 1U5TB 3I58A 3IAS2 4EVIA 1Z9CA 3WG7H 4QIWN 3LNQA 2K3PA 4BS9A 1M1EB 3SJMA 1BI0A 1E3OC 2RAEA 2VC0A 4DBRA 1BJAA 4GRIA 4H4KC 1E17A 1WPKA 2ISZA 4A3EJ 1EV7A 3ZN0A 1QRYA 2VKVA 1T0FA 2DJIA 4JK1X 3SXYA 1ZR4A 3K4KA 3J7YJ 1QPIA 4P55A 3S1NJ 5FKKA 1XMAA 4ZC3A 3PNTA 2A5YB 3GTOJ 3W2WA 1K7AA 3HEFA 2Y30A 2DMQA 5C4JJ 1B6AA 3AG1H 2ELHA 4R79A 2DU9A 1O57A 3TDUC 3FXUA 1T56A 4BE1A 2HXIA 3MAJA 1ZLKA 2IA0A 5GPCA 1MKMA 3V8JA 1W1WE 4BNCA 4M6YA 2M0CA 1QVUA 3VDXA 4A3BJ 2MLGA 3B73A 4XLEA 1P6RA 3SEQA 3ZQHA 3LAJA 2DOAA 3Q0WA 3GFIA 2V1UA 1UB9A 5GTIC 3NARA 3N97A 3FF5A 2IS1A 4PJJA 4EATA 3LFUA 3M4OJ 4AIJA 3QP6A 3V42A 3F22A 1SFOJ 3EYYA 2EZHA 3S1MJ 2XPVA 5BMZA 2GQQA 1JKQC 1IRFA 3ZCOA 3I59B 4C9YA 3FXOA 3JRFA 5BPDA 4ENKA 4L5JA 1ETYA 3F8NA 3OYHA 1J2XA 2I10A 2PI0A 1WCMJ 2BBYA 4NBQA 1IRXA 4HNUA 4PJNA 1R6RA 1TWFJ 5E3OA 3ZMTA 4GDFA 1D5VA 4IPAA 2HZTA 4EM1A 4KNYA 1DDNA 1Z1DA 2XKOA 2CJJA 2EIKH 3H5AA 4G94A 1U8BA 5IYDJ 2A5WA 2A6HF 3I3LA 3W6KB 2JA7J 2AXTC 2FUG2 1X4PA 2NS8A 3RKYA 2CW0F 4NDLA 4DNCA 1H89C 1WJEA 1OJLA 1FYKA 2I5UA 1U5TA 2JMWA 2DK8A 1FIPA 4AVPA 2R7QA 3DPTA 4DOZA 1W5CC 2HEOA 1IN5A 1FOWA 4AM3A 3DBRB 5CKTA 4XLPF 4UVBA 2KP6A 1FBUA 2ZNZA 2E36A 1TWAJ 2QZ8A 3ABKH 3KX2A 4Y7NJ 5E8IA 1MNDA 2ZJPF 1WJ5A 3QYEA 5EG0B 5DTDA 1SMYF 2DFFA 2XAHA 2QCOA 4IHYA 2TRTA 1R4MB 1P4XA 4CUGA 4OAYA 3JRAA 2LP0A 1V54H 2Z9OA 5JR3A 1MNMC 2F48A 4A3IJ 4W97A 2CQNA 3NEUA 3ABLH 5DYMA 2ZJRF 1YW8A 2R5YB 3LSJA 4G9YA 2YR2A 3K4LA 1OCCH 1SC7A 5HLTA 3OSGA 5B66C 3NAUA 2LY2A 3OOPA 4KMUX 4HA8A 5KAFC 4EMSA 1NTCA 3KP7A 4HSTA 2RN7A 3LSIA 2XF6A 2M4KA 3B6AA 4ENMA 5HLHA 4I2OA 2XDVA 4RMNA 4YIFA 3KZZA 3FXMA 3A4CA 3I59A 3JCUC 3OL3A 2Y0MA 4BHCA 4KISA 3GFJA 2O0YA 3C7JA 4ETSA 3CCYA 5ICCA 2XROA 4RS8A 3M3YJ 3N4MA 3BCAA 4A5MA 5EEGA 1UELB 2IJLA 3I54A 2EA4A 2XSJC 3GTGJ 3T0YA 4HQEA 4BEHA 2JSPA 3HHHA 3WGGA 3S16J 2MGQA 4KJZA 1KU9A 3E5QA 1BI1A 2LY1A 5LGNA 2DYRH
chains in the Genus database with same CATH topology
1WJAA 3PFYA 2KRHA 4NNJA 4YEJA 1PJRA 2CS3A 4KT6A 3RSNA 2KLOA 4D1QA 4Y33A 3LL7A 2OUMA 2CV2A 3ZRGA 3KYLA 1TZLA 3LSGA 4HNTA 2OV7A 2ZSHB 3HUGB 4MLOA 4II2A 3OYJA 3N05A 1LFPA 2VXDA 3K4CA 1T95A 1V5FA 3OYGA 4BJTA 4B3XA 4ZJZA 2PJRB 2RNGA 2L5QA 4ITVA 2X6WA 1W36C 2WAFA 2F4IA 1J09A 3PSIA 2L7KA 3VYUB 4U7BA 2VL8A 2HPIA 1T0FC 3OL4A 1BR2A 3F9KA 1GLNA 4BU2A 1D1AA 4PFOA 4AYBA 2R7WA 3SDBA 4XN0A 2Z1DA 2MYSA 5TGTA 4BDYA 1X19A 1FMWA 2VASA 4B48A 2DCEA 4F92B 3HOSA 1U0JA 4JQFA 2L9NA 2CUJA 4AVZA 2CMPA 2X1DA 4BEHB 2LOOA 4ZYAA 2AQFA 2WB1A 2IS4A 1G8XA 2IGOA 2E5NA 2V9KA 4XN3A 3H0DA 3AFHA 3DPUA 3EUKL 3H9GA 2Z2SB 1E0EA 3HG9A 1DP3A 3OMYA 2VLAA 4CH7A 2HQAA 3OR2C 3PNYA 2CW7A 3BG6A 4XNFA 3LMMA 2X6XA 4E6KG 4D9JA 3DKYA 1SAUA 2KMUA 4XORA 1FMVA 2HZDA 2WAQA 3IAM2 4E7LA 2MC4A 2HU9A 4RM3A 1SFKA 3IP4B 2HVRA 2M7BA 2KDOA 4B43A 4DJAA 2R7TA 4E4HA 4BJ6C 1PYVA 3CP2A 1V5GA 2Y0SA 1Z3YA 4XR6A 2WADA 3L2WA 1MMDA 1D0YA 1Z7LA 5LD2C 2LREA 4XQFA 3HOTA 5FROA 3CZ6A 4XOPA 2R7RA 1DGRM 2VQGA 3H35A 1WJDA 3UNGC 2V1NA 2K9LA 3RCOA 4BACA 4BGDA 3MD2A 4IX7A 4XOTA 3W2VA 4E7ZA 3ZXSA 3E0JB 1W36D 3AL0C 2QKLB 4XLHA 4YRVA 2W00A 2HPMA 4J00A 3DWLE 2UV1A 3NWSA 4ZDLA 4IQJA 5CQEA 4ANJA 4YELA 1G59A 1HA8A 3BC8A 2CFOA 4ZTJA 2R7UA 3EUAA 3DU6A 3LSHA 4P1WA 3OYAA 2R4GA 2VJJA 2W4SA 1WJCA 3MKWB 4F52A 3TMOA 3UR3C 3QYFA 1NG6A 2JUGA 3OR1C 2IGNA 4XKVA 2O5RA 3L2UA 2XC7A 2WBMA 4HRIA 4HSRA 1JI8A 2KRCA 2WY8Q 2M4GA 2GOMA 3OS0A 2K5CA 2X6YA 2XF7A 2XF5A 3CF2A 2WAEA 2E1MB 3D5RC 4BL0B 2A6TA 5JHFA 5HOOA 3H5NA 2IS6A 3EPZA 2WY7Q 1D1BA 3LSMA 4RM2A 2VQLA 4CA0A 2RQQA 3FDYA 2R7OA 1N75A 1LKXA 2VB6A 3DEEA 1DGWY 4BE2A 2VIXA 4IZZA 4ZTFA 4PK4A 4AU7A 4B47A 2KQRA 3VYTB 3SZGA 4DGWB 1LDKB 1QHGA 3EUHC 3ZGKA 4RLFA 4ZDOA 3I9V2 4C30A 2AQEA 2M0MA 3HPHA 2DT6A 1YE9A 1D0ZA 2LG4A 4XKBA 1BOBA 3D5SC 3SYTA 4KITB 5FRNA 2L2OA 2CH0A 2LYCA 2W7NA 1N77A 4XLFA 3S3OA 2HVSA 1X4OA 3S3NA 1OLTA 3BLYA 3QYBA 1MMGA 3KEYA 3MKZA 3VWBA 1Y56A 3ZQQA 1Z21A 3VSKA 3G2BA 1WFXA 2E5ZA 4E7JA 1D0XA 3PJRA 2HNHA 4CCOA 2ZXIA 3W3CA 4FASD 4XLAA 4CCLA 4HG2A 3CP8A 4N4OB 2KL4A 1ERDA 4F3QA 2BVMA 4IQ4A 3DTKA 4FETA 2VXZA 3RQ4A 1X1DA 4Y4RA 1YX3A 1P9QC 5KHDA 4NUBA 3FKJA 2X1EA 4HEA2 1VZ0A 3OY9A 2ZSIB 2P0WA 3PUBA 3BCBA 3OOUA 4PJMA 4E7HA 5FRMA 4JOMA 4LITA 1DQUA 4HPQA 3DTEA 3GBGA 4OAZA 2L9SA 3PNVA 2MABA 3OYBA 3K70C 4E7SA 4CSWA 3M8JA 3J7AY 4XM3A 4NQWB 3TL4X 2VJ5A 2GOXB 2LBFA 4LIVA 1Z3XA 4BQQA 3OYNA 1S9HA 2E60A 4Y3OA 3PSFA 2KZVA 3DU5A 3K10A 3VYSB 4BXFA 5CPRB 4LIUA 4F93B 4N4NB 3OS1A 1KONA 2IGKA 2KPMA 3C2HA 2VQCA 2R7SA 3IAS2 1WJBA 4CCNA 5HNHA 3CJQB 1UG0A 2K3PA 4BDZA 4BS9A 2BW3A 2CUZA 4DBRA 5HNFA 3FBIB 1X1AA 4GRIA 4H4KC 3OYLA 3OYFA 4LG3A 2Q2EB 4NC7A 2VJ4A 1X1BA 4XL9A 3M1CA 3OIPA 2DJIA 2V7FA 3K4KA 3K4MA 2WA0A 2V6EA 2W82A 3OYMA 3OYIA 3MKYB 2IXSA 2LBFB 4X0GA 4ZC3A 3PNTA 2ZFUA 3W2WA 2I8DA 2M7AA 2W1OA 1OR7C 2RREA 3IUOA 2Z16A 4R79A 4II3A 3S3MA 1MW7A 4CCKA 4BE1A 4PFPA 3W2AA 3K70D 4PSXA 2JVGA 1MMNA 3A2KA 4XLCA 1MNEA 3NWTA 4QPQA 3DTIA 3BG7A 3VDXA 3LSKA 1X1CA 4XLEA 3SEQA 3L2QA 2DOAA 3K6GA 2IS1A 4PJJA 4BQNA 3DKXA 4EATA 3LFUA 2BW3B 3OIQA 3V42A 2VKDA 2UWMA 4XKWA 3CJRB 4F55A 3MMYB 3ZCOA 3S32A 1TT0A 4C9YA 1MMAA 1ZELA 5KCMA 4BUPA 2X51A 3DQVC 4OWRB 1BR4A 1QU3A 4NC8A 4RLQA 3E1SA 3OYHA 3OYCA 2VJIA 5KNLA 2HVQA 2M3AA 1IRXA 4HNUA 4CCMA 4PJNA 2F6CA 1R6RA 3OYDA 3HL2A 3QODA 4BJ5C 3DPLC 4BQOA 1D1CA 2LH9A 3FHNA 1YX5A 3H5AA 2Q1ZB 2A5WA 3H9QA 3I3LA 3SEZA 3K4JA 2MFZA 3S93A 3U21A 2VPLA 2FUG2 1X4PA 3CMMA 3VYRB 1WJEA 2IGMA 2X1CA 4IKFA 2BOLA 2BVLA 2CV0A 4XKCA 3RTRA 3OYEA 2R7QA 3DPTA 4DOZA 3ONQA 3OS2A 3L2RA 4CCJA 3HPGA 5CKTA 3K4BA 2LC2A 1LVKA 2MD0A 5HVQC 4F91B 2KP6A 2NOJB 4E7IA 3K4NA 1V5EA 3KX2A 3D5LA 4C2TA 1NG7A 2UUZA 4CZCA 1N78A 1MNDA 5CQGA 1WJ5A 2XAUA 3QYEA 3S8PA 3FBNB 4B44A 4XMYA 4CUGA 2DT7B 4OAYA 1EA3A 3A1YA 4P5OA 4G6TB 4PJLA 3HXLA 3QOEA 3H9JA 4PSWA 2VQHA 2CW8A 2CV1A 1BR1A 3OWTA 2DXIA 3RPUD 4XONA 3L2VA 5LFAA 3TBIA 2HDWA 3C2GA 3K4LA 5HLTA 2PMZA 1Y6IA 2LY2A 4U87A 3HC7A 3AL0B 2OC6A 4HSTA 2K9MA 3LSIA 4QPOA 2R7XA 2XF6A 2QKMB 2M4KA 1UAAA 2PJRA 2JA2A 2XDVA 4RMNA 2E1MC 3AKZA 3A4CA 3HKZA 2F5VA 3H5RA 3OL3A 4KISA 2X85A 3CESA 3DLAA 4DIQA 4PUSA 2VKHA 1WJFA 3VSLA 1K6YA 2R7VA 1QHHD 3OYKA 2IS2A 3BCAA 2KHMA 2JVHA 1AA7A 1UELB 3PL8A 4BE0A 2LRDA 4E7KA 4C2UA 3ZR8X 2V26A 2XSJC 4DBQA 2ELJA 4BEHA 2JSPA 2ZXHA 4KJZA 4ZDPA 2LY1A 4J01A 2V4JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPL A;  2OV7 A;  2OUM A; 
#chains in the Genus database with same CATH topology
 3ZQG A;  1PJR A;  3DBL B;  2BEO A;  1SD5 A;  2BY3 A;  1FBS A;  3KP6 A;  4G12 A;  2MSY A;  1BIB A;  2E19 A;  1F4K A;  1XSX A;  3LL7 A;  3ZMD A;  3HSR A;  4M3E A;  2RNJ A;  5DDG A;  2XKP A;  3CC2 I;  1K61 A;  2PBI A;  2ZSH B;  2R92 J;  5F0F A;  4II2 A;  3TO6 A;  3OYJ A;  1LFP A;  3K4C A;  2VE8 A;  1OCZ H;  1XS9 A;  1E2X A;  5EEH A;  4B3X A;  4ZJZ A;  5JVG F;  1U6G A;  4D5C A;  2RNG A;  4RAG A;  3I71 A;  2X6W A;  4MTE A;  1WI3 A;  4LK0 F;  3I55 I;  2CUF A;  1J09 A;  5EG0 A;  3J7A O;  2L7K A;  4U7B A;  1R1U A;  4Y15 A;  2JZY A;  4BH9 A;  4RGU A;  1D1A A;  4AYB A;  2KIU A;  3E6D A;  2ZME B;  3WG9 A;  5JVT A;  3SDB A;  3P7N A;  1UMQ A;  2W25 A;  2MYS A;  2ZNY A;  3BDD A;  4F92 B;  2H1K A;  2KJC A;  4ENJ A;  3G1M A;  4JQF A;  4QWQ A;  4P96 A;  4AVZ A;  2CMP A;  5A2Q K;  3TGN A;  1VQK I;  3BY6 A;  5J47 A;  5DM6 F;  3G1L A;  2R5Y A;  1SD6 A;  4JP0 A;  4ZYA A;  3WHC A;  4I0A A;  1QZE A;  4CXF A;  2DI3 A;  1UHM A;  1YW9 A;  3BR2 A;  3AFH A;  3DPU A;  2M8G X;  3EUK L;  1ETQ A;  4U0W A;  2DFE A;  2OQG A;  3H3Z A;  3E3V A;  3HG9 A;  1ON1 A;  3TW7 A;  5CJ9 A;  1BW5 A;  4RDU A;  2DDA A;  2PMZ N;  4CH7 A;  3L2C A;  5K5R A;  3S1R J;  1BM9 A;  1MBE A;  1I3A A;  1D8K A;  2KJB A;  2K7L A;  2CW7 A;  1UZC A;  3LMM A;  3WTW C;  1IN8 A;  2OCC H;  3WTY C;  4E6K G;  3MKL A;  2DA3 A;  1MJ9 A;  3VEP A;  1I6H J;  3PIP F;  4XOR A;  4E7L A;  3IAM 2;  4KYW A;  1FX7 A;  2FX0 A;  1OKR A;  4I02 A;  2FNP A;  4NB5 A;  1KYW A;  1MZB A;  5M3M J;  3BTI A;  1R58 A;  2XGX A;  2HWV A;  4TV7 A;  1YIO A;  2Y0S A;  2YS9 A;  1JGG A;  1SFX A;  1JKO C;  4BXX J;  5E1Z B;  1R23 A;  3RYP A;  1CF7 B;  3KEQ A;  3VFZ A;  5FRO A;  2X48 A;  2VE9 A;  2R7R A;  2GZW A;  3CJN A;  3AG4 H;  2V1N A;  1HCR A;  1S5L C;  1RES A;  5EGO B;  1WKM A;  4WF2 A;  2H6C A;  1LUJ B;  4XOT A;  1AKH B;  4GXO A;  3ZXS A;  2MA3 A;  3F8F A;  1FSE A;  4OU0 A;  4UB8 C;  3FK6 A;  1OQY A;  2HOE A;  2QKL B;  4XLH A;  4A3M J;  2FBK A;  3PIO F;  2RKH A;  4YRV A;  1BI2 A;  2W00 A;  1FLI A;  1JTY A;  2CQX A;  1T2K A;  2F5C A;  1H8A C;  1EH7 A;  1ZK8 A;  4B3A A;  4UUS B;  4K2E A;  5F08 A;  1JGS A;  2Z33 A;  3CDI A;  1W0T A;  6PAX A;  3I64 A;  1XCV A;  1XC5 A;  1VQ7 I;  1YYV A;  2ZKZ A;  3LSH A;  1USS A;  2R4G A;  3HBL A;  2M5W A;  2W4S A;  4I09 A;  4F52 A;  4BQA A;  4HX8 A;  2P7C B;  1ETW A;  1NH3 A;  3QYF A;  2Q0O A;  3LFK A;  2XC7 A;  3TED A;  2NVT J;  5JLX A;  2WBM A;  4HSR A;  1LFB A;  2Z5U A;  1HQC A;  2GOM A;  2LLK A;  5H6Q A;  3U2R A;  2GA1 A;  2X6Y A;  2XF7 A;  2XAF A;  4A6E A;  3CF2 A;  1H9G A;  1VQN I;  3DBH B;  2E1M B;  3J81 K;  4BL0 B;  4LB6 B;  2PX9 A;  1A04 A;  4G6Q A;  5BS6 A;  3T8R A;  1D1B A;  4WXH A;  4RM2 A;  1ZKG A;  2RC4 A;  4MNU A;  4OIQ F;  2FE3 A;  2RQQ A;  2R7O A;  2QUF A;  1CGP A;  1IN4 A;  3HOZ J;  5D8L B;  3QAH A;  1MJA A;  3DEE A;  4OOI A;  5E3L A;  2JRT A;  2VIX A;  3FZV A;  4PK4 A;  3VYT B;  3JRH A;  2J5O A;  1K78 B;  3C1D A;  1MJB A;  3BR6 A;  2A3S A;  5EEA A;  5D5V B;  5EYR A;  5ICG A;  4DZP A;  3M7G A;  3HOY J;  1ZYR F;  3J7Z I;  4BKX A;  3KP5 A;  3BR0 A;  3KP2 A;  2M0M A;  1WI9 A;  2XHK A;  4KIC A;  2W85 A;  1FEX A;  2UZK A;  1PDN C;  5FRN A;  2G9W A;  2LYC A;  2W7N A;  3S3O A;  2VOO A;  3KP3 A;  5EGO A;  2NRA C;  1P92 A;  3G1O A;  3X2Q H;  3QYB A;  1MMG A;  1IRZ A;  5K5Q A;  1FTT A;  4A69 C;  4AD9 A;  1Z21 A;  4ZH4 F;  3EDP A;  4EGY A;  2QEN A;  1D0X A;  3MZ8 A;  2HNH A;  1QA6 A;  3W3C A;  2L4M A;  4QTR A;  1Y0N A;  4XLA A;  4M6V A;  2ZJ2 A;  4IHS A;  4CCL A;  4HG2 A;  4XSX F;  1D8J A;  3DP7 A;  4F3Q A;  2FMY A;  1JHH A;  2KIM A;  4HBL A;  4IQ4 A;  2B7E A;  1BJZ A;  3BWG A;  3BTL A;  3ZMZ A;  1MD0 A;  2P5K A;  3RQ4 A;  3HRU A;  1C0W A;  1NK2 P;  1P9Q C;  5J4Y A;  1XGS A;  5KHD A;  1K4S A;  2LFB A;  1YLF A;  2RV8 A;  1K79 A;  3JRG A;  1RKW A;  1MH4 A;  1O3Q A;  5FRM A;  5L3G A;  3GCM A;  1S6L A;  3GBG A;  4OAZ A;  2VOP A;  3CF5 F;  5LRR A;  3SDG A;  2Q2E A;  3PNV A;  3VOE A;  4AIK A;  1KU3 A;  1T98 A;  4E7S A;  1TWC J;  1QBJ A;  3DEU A;  3WU0 A;  2EB7 A;  4M9X A;  3S2W A;  3RZO J;  2LKS A;  2L7F P;  2GOX B;  2P6T A;  2LBF A;  4UXN A;  1E3P A;  2XUB A;  4P9F A;  3IRR A;  4CZZ A;  1SFE A;  3PSF A;  3BPV A;  5GAH J;  4M9Z A;  2E35 A;  1YG2 A;  5BQT A;  1JKP C;  4GYI A;  1JJ8 C;  2G0E A;  3BZ6 A;  4LIU A;  4FX4 A;  4N4N B;  5F1J A;  1B4A A;  1IO2 A;  4CYC A;  2DA4 A;  1P4W A;  3R0A A;  2FEZ A;  4MEX F;  1TWG J;  5TJJ A;  2JRM A;  1VQ5 I;  3E6M A;  1KON A;  4NC6 A;  1BOA A;  1XCB A;  4MEY F;  2BE5 F;  1WHU A;  2KPM A;  2CG4 A;  3CJQ B;  4M3G A;  4BDZ A;  3KPH A;  2BW3 A;  2GIV A;  2QVO A;  2CUZ A;  2HKX A;  2EFN A;  2QQ9 A;  1X1A A;  2ACJ A;  1B9M A;  1Z05 A;  1SAN A;  3HOW J;  4LG3 A;  2DK5 A;  2ECC A;  3QPS A;  4O3M A;  2CYY A;  2V1D A;  3IRQ A;  1X1B A;  5DD4 A;  2WV0 A;  1K4T A;  5HS8 A;  3M1C A;  2V6C A;  2F5F A;  3K4M A;  4DW6 A;  2K86 A;  3ISP A;  5KAI C;  2DPU A;  2VBX A;  4X0G A;  1I6X A;  1QPM A;  2XGE A;  3S2H J;  2FNA A;  2J5P A;  3GZ6 A;  4YFN F;  1A6I A;  2W1O A;  1OR7 C;  3GWZ A;  5L3B A;  4UVA A;  2Z16 A;  2Y69 H;  1QGP A;  4IRH A;  2P4W A;  4L9T A;  1LPQ A;  4CCK A;  4CYD A;  4PFP A;  2D5V A;  4OMZ A;  2K4B A;  4CHU A;  4XLC A;  1MBK A;  3KZY A;  2A69 F;  3I0T A;  3LSK A;  1X1C A;  1JHF A;  3L2Q A;  2ZJQ F;  2GWR A;  3HSF A;  4BQN A;  1RPW A;  4C3J J;  3IKT A;  3H3V K;  2VKD A;  2UWM A;  1B1B A;  2ICW G;  1X3Z B;  2NS0 A;  5BOX A;  4FX0 A;  3S32 A;  1R5H A;  1ZEL A;  1IUF A;  1ETV A;  2X51 A;  3GTQ J;  1BR4 A;  2O6G E;  4L0Y B;  1ONV A;  1IUY A;  1HLV A;  3P9I A;  3ZQ7 A;  3OYC A;  2FF4 A;  2M3A A;  2WTE A;  1SFU A;  4CCM A;  4L9V A;  3MQ0 A;  2TDX A;  3OYD A;  1KQ9 A;  3HL2 A;  1P2F A;  1SAX A;  5D6F A;  5D5X B;  1TNS A;  5TRD A;  1WQ2 A;  3DPL C;  3ZPL A;  2LH9 A;  4ENN A;  2E34 A;  1XSV A;  2Q1Z B;  3KYC B;  4UNO A;  2QA4 I;  3H3U A;  2H09 A;  2MFZ A;  3S93 A;  1GT0 C;  4KFC A;  1VQ4 I;  2E1O A;  3IWZ A;  4HW0 A;  1V3F A;  2IGM A;  2BOL A;  4GGG A;  3BTJ A;  4XKC A;  3B6C A;  4W1U A;  1ORK A;  3L2R A;  2ZO4 A;  3GLL A;  4EGZ A;  5B1B H;  1ZGA A;  5IT9 K;  3G71 I;  1S7A A;  3K4B A;  2BYV E;  1LVK A;  1H0M A;  2LMD A;  3KP4 A;  5FGM A;  4D7N A;  4KN4 X;  2DOD A;  4EQQ A;  3REO A;  4V19 K;  2K85 A;  1NG7 A;  3HKZ N;  4CZC A;  2OZU A;  1HKT A;  2XAU A;  2NNY A;  1W7P A;  1S29 A;  2DT7 B;  1EA3 A;  2DQL A;  3A1Y A;  4BBS J;  1SVM A;  4UV9 A;  4FCY A;  3CTA A;  1F36 A;  4PJL A;  1QVT A;  3CQZ J;  5LEJ A;  5FFX A;  2BZT A;  3BJ6 A;  4EM0 B;  3SHF A;  1W5T A;  4I0B A;  3RPU D;  4XIC A;  1XSD A;  4XON A;  1XMK A;  3DFG A;  3M1E A;  2ZCW A;  2HDW A;  2FSW A;  1U5T C;  1I1G A;  4U87 A;  2AXL A;  5E1X A;  1HKS A;  1FP2 A;  3HUG A;  2OC6 A;  1LFU P;  1G6N A;  4QPO A;  2R5Z B;  1G4D A;  1YS7 A;  3CME I;  1DU6 A;  2PJR A;  4KN7 X;  1F1Z A;  5E18 F;  1YTY A;  1ZG3 A;  2WC2 A;  1VF9 A;  2NS7 A;  1GV5 A;  1TBX A;  2CUE A;  3AKZ A;  1HBX G;  3HKZ A;  2F5V A;  3H5R A;  2X85 A;  1VTN C;  1OMI A;  4PUS A;  2NXN B;  2MD5 A;  3EUH A;  3RJP A;  1N25 A;  3F23 A;  2R7V A;  1MBF A;  1QHH D;  3MVP A;  4IOC F;  2IS2 A;  1DP3 A;  2KHM A;  5FD5 A;  2JVH A;  1TW2 A;  1ZH5 A;  1HW2 A;  2JA8 J;  3PL8 A;  2LD5 A;  2ID3 A;  3DKW A;  3ZR8 X;  2V26 A;  1DP7 P;  5FFZ A;  1TC3 C;  1TQI A;  2M9H A;  3ASO H;  1EJ9 A;  3HTS B;  4AWX B;  4ZDP A;  1YJW I;  4J01 A;  2V4J C;  4QLC U;  3CMY A;  2XAQ A;  3CUQ C;  3PFY A;  4EJW A;  2KRH A;  2HQR A;  2EIL H;  4NNJ A;  4YEJ A;  5DCM A;  1MDM B;  2V9P A;  4LLN A;  2KLO A;  1MH3 A;  1UJ8 A;  2JPC A;  4RB0 A;  1Z7U A;  2QYO A;  1YJN I;  2HTS A;  2RGV A;  2A61 A;  3ZMV A;  2CV2 A;  4KIG A;  1J9I A;  5D8K B;  3M9A A;  5K7Z A;  4XRM A;  2YSR A;  2M2E A;  3BQZ A;  2IA2 A;  2XGC A;  4MLO A;  5EJC A;  3N05 A;  5LHH A;  3ML6 A;  3JSP A;  1XB4 A;  5FJ8 J;  1T95 A;  1YO5 C;  2XPW A;  3KLO A;  1UHS A;  5K5O A;  3OSF A;  2EBI A;  1PUF A;  4OIN F;  1A35 A;  3VYU B;  4LJZ F;  3CC4 I;  2MLK A;  2RDP A;  5HS9 A;  4BU2 A;  2EFO A;  3CO7 C;  5ILS A;  3NRV A;  2X9D A;  4A0Z A;  5FLX Z;  4ZYE A;  4BDY A;  2RVC A;  1FMW A;  2OF7 A;  2Y75 A;  2PJP A;  2LKP A;  4B48 A;  2M34 A;  2L9N A;  4KIB A;  3KEO A;  5CVI A;  4FIS A;  1RR7 A;  2HFH A;  2X1D A;  4BEH B;  2LOO A;  3L00 A;  3KIO A;  3WTZ A;  2WB1 A;  3H0D A;  2IGO A;  2V9K A;  3RKX A;  4C3I J;  5FLV A;  2TCT A;  2XPU A;  2VOD A;  2FOW A;  4MO7 A;  1E0E A;  5K7H A;  2XSD C;  4IOA F;  4RA2 A;  5GAE J;  2R5Z A;  3ASN H;  2QQ8 A;  1YRN A;  3CDL A;  2G7H A;  3AG3 H;  4D9J A;  2A6E F;  4IO9 F;  1SAU A;  4HX4 A;  3GZN B;  2KMU A;  3H92 A;  3GTK J;  2STW A;  2MC4 A;  2OA4 A;  1I27 A;  2M7B A;  1W0U A;  5C44 J;  1TL8 A;  3KE2 A;  4AC0 A;  1PYV A;  1GUU A;  2XB5 A;  4UUT A;  1MIJ A;  3WE3 A;  1BIA A;  1SVL A;  2MG4 A;  1FOX A;  2QGU A;  3L2W A;  1D0Y A;  1Z7L A;  3FMQ A;  1PP7 U;  1EH6 A;  4XQF A;  1IV6 A;  3CC7 I;  3CZ6 A;  2VQG A;  2XAS A;  3H35 A;  2GBY A;  3ABT A;  4HLY A;  2K9L A;  4BAC A;  4BGD A;  4IX7 A;  3BG9 A;  1VQM I;  1MDM A;  4BHB A;  1DPU A;  2Y31 A;  4U0V A;  3E0J B;  4LG0 A;  3FKI J;  4KIF A;  2BHY A;  3HTU A;  1S72 I;  1O3T A;  5L3D A;  3U1D A;  4XID A;  3F21 A;  2HPM A;  1LNW A;  2CU7 A;  3DWL E;  4ZDL A;  2IRF G;  2EZK A;  1VI0 A;  4S05 A;  4ANJ A;  1HA8 A;  5J8C A;  4ZTJ A;  3J80 K;  5B5E C;  2LF7 A;  3DU6 A;  1ZG1 A;  4P1W A;  2NVU B;  1I1S A;  1WJC A;  1AOY A;  1U78 A;  3UR3 C;  2HOA A;  4BHP A;  1NG6 A;  1HW5 A;  2JUG A;  3OR1 C;  4AYB N;  3G73 A;  1YI2 I;  2O5R A;  1IJW C;  3GTM J;  2V79 A;  3ZQC A;  2PN6 A;  1F43 A;  3CMA I;  2E2J J;  2UXX A;  2L7Z A;  3BG5 A;  4V2G A;  3VB2 A;  3I5U A;  1OIS A;  2DA6 A;  2YX4 A;  2EQR A;  3MZY A;  3QOP A;  3T5X A;  5HOO A;  2IS6 A;  3I4M J;  1YHQ I;  2WY7 Q;  1A5J A;  2COB A;  2ETH A;  2L02 A;  5DD8 A;  3PQJ A;  3ZP5 A;  3FDY A;  3IH4 A;  2EV0 A;  2LSO A;  1KYZ A;  2BXY A;  3HIF A;  3TP3 A;  5DS9 A;  4MTD A;  1VQ6 I;  4J19 A;  4B47 A;  4IHX A;  2KQR A;  4A93 J;  3SZG A;  1DU0 A;  3T1B A;  5LGU A;  1F9N A;  3FHZ A;  2FA5 A;  4RGX A;  3RQI A;  5J1R A;  1QHG A;  1XGN A;  1HF0 A;  4RLF A;  3JRD A;  1GXQ A;  2ZME C;  4MIM A;  2CQ7 A;  4RGS A;  5DCF A;  3B02 A;  4U0Y A;  3FK7 A;  4MFD A;  2K4J A;  1RZ4 A;  2HXO A;  2IT0 A;  2Y0S N;  2O61 A;  1X3W B;  1YE9 A;  2G7U A;  4FHT A;  3BQY A;  4A6D A;  1ETO A;  4XKB A;  2DMP A;  3D5S C;  4KUM A;  3MEX A;  1RC9 A;  1PP8 F;  5B1A H;  1N77 A;  2HVS A;  5LLQ A;  1X4O A;  2HDC A;  4EJV A;  3KCC A;  3FM5 A;  1WH7 A;  1Y56 A;  4HX7 A;  2VON A;  1J0R A;  2XRL A;  3NQO A;  2EH3 A;  1HDP A;  3LA3 A;  4BY7 J;  3QPT A;  4CCO A;  4FT8 A;  2NAZ A;  3EYI A;  2JPB A;  3PFI A;  1B72 A;  1OPC A;  5JLW A;  4IJA A;  5ICE A;  2QLZ A;  1YIJ I;  4N9I A;  1RUO A;  3DTK A;  3BZK A;  2B0L A;  2OQR A;  4HLX A;  3GTP J;  4YFX F;  2V9V A;  1IGN A;  3FKJ A;  5M5W J;  4HEA 2;  3PUB A;  2CFX A;  1YS6 A;  3BCB A;  3BJO A;  2CRG A;  2MW8 A;  4LIT A;  4HPQ A;  4I76 A;  2OZ6 A;  1G2H A;  3CCL I;  4U7D A;  2MAB A;  3OYB A;  3K70 C;  2QEX I;  1X2M A;  3CLO A;  3BG3 A;  3QU3 A;  2ZC2 A;  4XM3 A;  4WCG A;  4JX4 A;  2IVM A;  2XAJ A;  2VJ5 A;  3R0J A;  1NHA A;  4ZYH A;  3R4K A;  3OYN A;  1S9H A;  2E60 A;  3ERM A;  1JUP A;  4A3J J;  1GXP A;  3FM3 A;  5L3C A;  3WGI A;  3GUD A;  4OIP F;  4LLG F;  4BYY A;  2DQR A;  3A02 A;  3JAM K;  3JRE A;  2VUM J;  1ZN2 A;  2M87 A;  5D5U B;  2IGK A;  2ISY A;  3IWF A;  4A3C J;  3TO9 A;  1R5I D;  3IL2 A;  4CCN A;  5JFR A;  1UG0 A;  4WXC A;  1SEU A;  2E7W A;  1NK3 P;  1HXD A;  2FXA A;  2QSF X;  3FXL A;  5HNF A;  3A03 A;  5FD6 A;  5LRS A;  3F72 A;  3OYL A;  5J4V A;  5EZG A;  3FXJ A;  3OYF A;  3BOQ A;  4DYR A;  2Q2E B;  2F2E A;  2Y9Y A;  3HRT A;  4NC7 A;  2ECB A;  2VBW A;  5D6E A;  1R1V A;  2VJ4 A;  1XTA A;  1KQ8 A;  2JJ7 A;  2EWN A;  3OIP A;  3I4N J;  2V7F A;  4WWC A;  4CIC A;  2WA0 A;  2V6E A;  4CO8 A;  3OYM A;  2H8R A;  2MH2 A;  3MKY B;  2IXS A;  2LBF B;  3RZD J;  5ILU A;  1JXS A;  5E1W A;  2ZFU A;  2KIF A;  2RRE A;  3LSP A;  3FXR A;  3U1K A;  5ICF A;  2QBY A;  5J1Y A;  1IC8 A;  4IRG A;  1ZHF A;  5E79 C;  1MW7 A;  1O7F A;  3BR3 A;  4Z2Y A;  4CYC B;  1IDZ A;  3K70 D;  1O7L A;  1BBY A;  3S14 J;  2EV5 A;  4L5E A;  4PSX A;  5IYB J;  4GYG A;  1MMN A;  3A2K A;  2VI6 A;  2CGP A;  1MNE A;  3NWT A;  5D4R A;  3DTI A;  4B8X A;  4I01 A;  3F8B A;  1WWX A;  1OFC X;  2FQ4 A;  3CUO A;  2E2I J;  2Y48 A;  1TQM A;  2BW3 B;  1T6S A;  3OIQ A;  3JW4 A;  3CCS I;  4XKW A;  2GLO A;  1EH8 A;  3CJR B;  4E70 A;  3MMY B;  4A3F J;  4FE7 A;  4BUP A;  1TTY A;  1YJ9 I;  3GX4 X;  3LSR A;  4NC8 A;  1QU3 A;  3E1S A;  3DLL F;  5KNL A;  1S3J A;  4Z6Y A;  2LNB A;  2FBH A;  1RUN A;  2K02 A;  4RB3 C;  3V7S A;  3UKG A;  2DPD A;  4BJ5 C;  4YIR X;  1ZQ3 P;  4KA4 A;  5CVJ A;  3FHN A;  1RRJ A;  3PO2 J;  1YX5 A;  3H9Q A;  1VQ9 I;  2VPL A;  3QWL A;  2DTZ A;  4HOB A;  1ODD A;  2FQ3 A;  1EKE A;  9ANT A;  2BVL A;  3FX3 A;  2CV0 A;  4XBF A;  4UUV A;  4M3F A;  3HHG A;  1MBG A;  1JUM A;  2E1N A;  3RTR A;  4FTH A;  3ONQ A;  3OS2 A;  1LE8 A;  4CCJ A;  1XMX A;  2R7Z J;  2O3F A;  1JUS A;  2LC2 A;  3GZ5 A;  1SVO A;  3HOX J;  3MZH A;  3E5X A;  2NOJ B;  4E7I A;  1R36 A;  3K1P A;  5FKL A;  1ITY A;  2M1B A;  2VBZ A;  4JX5 A;  3D5L A;  1AHD P;  4C2T A;  2UUZ A;  1BN5 A;  4IEJ A;  1H88 C;  1N78 A;  5CQG A;  2QSG X;  1I50 J;  2P8T A;  1U3E M;  3K69 A;  1HDD C;  5HDK A;  4B44 A;  3HJE A;  1VQL I;  4XMY A;  3BZC A;  5EDN A;  2ZBK A;  1IG7 A;  5H6R A;  4P5O A;  4RAZ A;  3HXL A;  3QOE A;  4PSW A;  3H0G J;  3R60 A;  1T08 B;  3HGG A;  2CW8 A;  1VFC A;  2CV1 A;  2DO7 A;  4ON0 A;  1FT9 A;  5J1U A;  3LA2 A;  1BR1 A;  2DXI A;  3CCJ I;  1FNN A;  4EEF G;  3L2V A;  4PZJ A;  1QNT A;  3TBI A;  1TT5 B;  3C2G A;  4PGH A;  4RB2 C;  5LGT A;  2ZXJ A;  3W6J B;  2JK3 A;  1IN7 A;  1Y6I A;  2DBB A;  2HYG D;  2KIQ A;  3CCM I;  3G6E I;  1Z77 A;  3AL0 B;  1IXC A;  4HZF A;  1UAA A;  4S0H B;  1YFH A;  2H1L A;  2JA2 A;  4C3H J;  2ZFW A;  3HSE A;  5CVU A;  5AIP A;  4IHT A;  1UFM A;  2FML A;  1ZLJ A;  2AS5 F;  5A2Q Z;  3CES A;  3A0B C;  4DIQ A;  1W5S A;  2D2W A;  3GYH X;  1WJF A;  1JKR C;  3F6V A;  5D4S A;  1W7P B;  4XSZ F;  1Z0X A;  1RR8 C;  1X2N A;  1G3S A;  3CCR I;  3E6C C;  1KA8 A;  4BE0 A;  1IV8 A;  3G4S I;  1ZR2 A;  1GDT A;  2EPF A;  4DBQ A;  3HYI A;  2ELJ A;  3OV8 A;  4IHV A;  1ON2 A;  2ZXH A;  3Q0V A;  3TKY A;  2DA1 A;  3P5J A;  1MGT A;  1WJA A;  1KU2 A;  1FWZ A;  2L54 A;  3G3Z A;  2Y9Z A;  3RSN A;  5HDN A;  1RNL A;  4EJT A;  2OTL I;  4D1Q A;  2PEX A;  4Y33 A;  2OUM A;  3K1N A;  5FO5 A;  2DA5 A;  3LA7 A;  3ROU A;  1TZL A;  3C3W A;  2GAU A;  2OV7 A;  4EV0 A;  5GTH C;  3HUG B;  3Q0U A;  1U9O A;  1FBQ A;  1S7O A;  4Q47 A;  2QM3 A;  2EIJ H;  3EET A;  3SFZ A;  1V5F A;  5IP9 J;  2B9S A;  3F6O A;  4BJT A;  3ABU A;  2PJR B;  3PO3 J;  2L5Q A;  4Q4Z F;  1Z91 A;  1YW7 A;  3PSI A;  1BC7 C;  2IBD A;  3SZT A;  5FKO A;  4JBA A;  2VL8 A;  5HLG A;  5J8F A;  5DUI A;  1T0F C;  1U8R A;  3WU1 B;  5IY5 H;  1K6O A;  1ZG5 A;  1GLN A;  3LQR A;  1TQP A;  5HLI A;  1V55 H;  2DA2 A;  4IXA A;  2VBY A;  2Z1D A;  3JRI A;  3K9T A;  2VAS A;  2XVC A;  3IV5 A;  4A3K J;  3C18 A;  2DW4 A;  3WOD F;  5J40 A;  1G8X A;  2EV6 A;  2E5N A;  2D45 A;  3QU6 A;  2XGD A;  5DCM B;  3OMY A;  2JT1 A;  1OCR H;  2VLA A;  4M73 A;  2E71 A;  1MBJ A;  2HQA A;  2FD5 A;  4RAY A;  3GW2 A;  2P5L C;  4G8X A;  3PNY A;  3BG6 A;  4XNF A;  4LLL A;  3WTU C;  4L5I A;  1P7I A;  3S15 J;  3DKY A;  3LOC A;  3TOA A;  3BR5 A;  2HZD A;  2V1X A;  1LEA A;  4RM3 A;  3IP4 B;  1WRJ A;  2HVR A;  1PUF B;  1LDJ A;  2KDO A;  4B43 A;  3ELK A;  4E4H A;  4HYE A;  4BJ6 C;  3J81 Z;  3R6S A;  3BJA A;  4KMF A;  2K9N A;  1V5G A;  2L3D A;  3M07 A;  1Z3Y A;  2F4O B;  2R0Q C;  2EZL A;  2WAD A;  2H27 A;  1MMD A;  1AU7 A;  5DV5 A;  1TNT A;  1P4A A;  5LD2 C;  1D3Y A;  1FOY A;  4JYK A;  4AIH A;  1A31 A;  2STT A;  2H8W A;  1A36 A;  2FU4 A;  1WJD A;  3GTL J;  1RI7 A;  3FWE A;  2L9V A;  1EF4 A;  2O7O A;  3MD2 A;  2GM4 A;  4B1R A;  1IXR C;  2VN2 A;  3MN2 A;  3SQN A;  3W2V A;  3HOU J;  2QF7 A;  1PUE E;  2HTJ A;  4DZJ A;  2DFI A;  2IAI A;  3QPH A;  1HC8 A;  4X6A J;  1B59 A;  5E3N A;  3Q9V A;  1D5Y A;  2HQ5 A;  3QQA A;  5FKM A;  1R22 A;  4NHJ A;  2O9L A;  1UHW A;  1OR7 A;  1RKT A;  5CQE A;  4UB6 C;  2HYF A;  4YEL A;  1L3L A;  1YRN B;  1FPQ A;  3GFM A;  4G7Z F;  3MFK A;  3E5U A;  2R7U A;  3EUA A;  3SZP A;  3OYA A;  3RI4 A;  1ENH A;  2LK2 A;  1WVR A;  2PLY A;  3GTJ J;  5F0H A;  3TMO A;  2EFW A;  4A5N A;  1R7J A;  2IGN A;  5JI6 A;  3L2U A;  5F64 A;  1Q1V A;  3RPU A;  1JI8 A;  1HST A;  3TW6 A;  2K5C A;  1T33 A;  2KFD A;  2WAE A;  2QSH X;  2CQQ A;  3D5R C;  3FXQ A;  2H6B A;  2WB1 N;  5F04 A;  4F7Z A;  4GO1 A;  3H5N A;  5CVV A;  5HS7 A;  3EPZ A;  3EQL F;  4B4C A;  2IA1 A;  1LJ9 A;  4IRI A;  4LG0 B;  2PQ8 A;  4CA0 A;  1N75 A;  3I4P A;  2GXA A;  1XDS A;  2VB6 A;  1P7J A;  2VT3 A;  4BE2 A;  4S04 A;  4IZZ A;  4ZTF A;  2ZXW H;  5IOZ A;  4DGW B;  1GVD A;  2M45 A;  3GME A;  2LDU A;  1LDK B;  3W6V A;  2KRF A;  1FIA A;  1WGX A;  1RIO H;  3CUQ B;  2QQB A;  3ZGK A;  4ZDO A;  2DJN A;  1XX5 A;  2F5E A;  4O5V A;  3HPH A;  5FLM J;  3ECH A;  2ME0 A;  1R1T A;  2DT6 A;  2KKO A;  1D0Z A;  1G3T A;  3P9C A;  2LG4 A;  2L7M P;  2BY2 A;  3KZI C;  4ESB A;  1XGM A;  2VT2 A;  1HKQ A;  4LOC A;  4ZYD A;  4KIT B;  2L2O A;  2ADU A;  2GXG A;  4NQW A;  1OLT A;  3BLY A;  1Y1W J;  2VKE A;  2NVX J;  3VWB A;  3E7L A;  2DAO A;  5H20 A;  3VSK A;  3G2B A;  1ULY A;  1WFX A;  4I98 B;  4WX9 A;  1O3S A;  1ZRF A;  3PJR A;  2YU9 J;  2JQ7 A;  2QQA A;  1VQP I;  4CDG A;  2L4A A;  1Y39 A;  1B8I B;  3IH3 A;  3CCE I;  1HSJ A;  2BHZ A;  2OJE D;  2IPQ X;  3CP8 A;  2K9Q A;  4N4O B;  2DN0 A;  2KL4 A;  2LVS A;  1R9T J;  1LEB A;  1HOM A;  1U9N A;  2BVM A;  2EFP A;  1DUX C;  1J7K A;  2DYS H;  2R3S A;  1MBH A;  4FET A;  1X3U A;  4HDU A;  1T39 A;  2VXZ A;  1AWC A;  3KYD B;  1X1D A;  1FP1 D;  4Y4R A;  4EM2 A;  3COA C;  2PMH A;  5M5Y J;  2KZG A;  4M9S A;  2DA7 A;  2FOK A;  1BI3 A;  3K7A J;  1VZ0 A;  2W57 A;  2ZSI B;  1KZH A;  2K27 A;  2P81 A;  3OOU A;  3DXJ F;  5TIS C;  2EA2 A;  5BNG A;  3L1P A;  3PUF A;  4IF4 A;  5E8G A;  4G7H F;  3CCQ I;  2FBI A;  2OD5 A;  2BXZ A;  3HM5 A;  2L0K A;  3U9G A;  4FE4 A;  4JX6 A;  5B3S H;  5IOY A;  4UHT A;  3CCV I;  1ZRC A;  4G6D A;  1I5Z A;  1ZAR A;  1KGS A;  3GVA A;  2LR8 A;  4M74 A;  3RKW A;  4Y3O A;  2KZV A;  3DU5 A;  3MCZ A;  1B72 B;  2Q8K A;  2DOE A;  5CPR B;  4LMY A;  3VPR A;  1ZGJ A;  3P9K A;  4DQ2 A;  2CO5 A;  3AG2 H;  4A3G J;  3CUQ A;  3V4G A;  2XIG A;  1T38 A;  3ZMS A;  1X58 A;  3IHU A;  3I56 I;  2FRH A;  2E1C A;  3TO7 A;  4KDP A;  2O03 A;  2R7S A;  1H9T A;  2FJ1 A;  1XD7 A;  1WJB A;  5HNH A;  1I39 A;  5J3L A;  2DOF A;  3KET A;  3LST A;  2COM A;  3FBI B;  3CCU I;  4M6X A;  3JSO A;  4LGW A;  3JTH A;  5FB2 A;  4L9J A;  5CVR A;  1CQT A;  1FZP B;  2R93 J;  4EJO A;  4DYQ A;  3ERE D;  4XL9 A;  5DM7 F;  2Z99 A;  3M8E A;  3RIR A;  5ERI A;  3ECO A;  3V8L A;  2W82 A;  3OYI A;  2OTJ I;  1B8I A;  2PMU A;  1HW1 A;  3WU2 C;  1I3Q J;  2NOG A;  4GFB A;  2I8D A;  2M7A A;  1XGO A;  3IUO A;  1KU7 A;  1UCR A;  5IT9 Z;  1GV2 A;  4II3 A;  5H2F C;  3S3M A;  2CSO A;  2QWW A;  5F27 A;  2EIM H;  4D7M A;  1B9N A;  3W2A A;  1WH5 A;  2ME6 A;  3ZN1 A;  2JVG A;  4AID A;  3CJT B;  4N9H A;  1ZRD A;  2HOT A;  4QPQ A;  1JE8 A;  3BG7 A;  4MFE A;  4A0X A;  3ULQ B;  3A01 B;  3K6G A;  3JTG A;  5IYC J;  5ILV A;  4HV5 A;  3ZQF A;  3DKX A;  3O8G A;  3L09 A;  2P7V B;  4M3D A;  4L18 B;  3BT9 A;  1QO0 D;  2PG4 A;  3S17 J;  2MH9 A;  4F55 A;  5J6X A;  4L9N A;  2ELK A;  1MSE C;  5L3F A;  1IN6 A;  1TT0 A;  1MMA A;  5KCM A;  3Q5F A;  4G7O F;  3DQV C;  1KQ0 A;  5AON A;  3LQQ A;  4OWR B;  2CWE A;  4RLQ A;  1VQ8 I;  4A0Y A;  3ZQI A;  5IP6 A;  1GHC A;  3O6B B;  4O6J A;  2VJI A;  2Y2Z A;  2HVQ A;  4X1E A;  3H36 A;  2OBP A;  2F6C A;  3K2Z A;  4DYC A;  5GPA A;  4PJ0 C;  3QOD A;  1FYL A;  3RKQ A;  4BQO A;  2ESH A;  1D1C A;  1J75 A;  5F1R A;  2QBY B;  2NNN A;  1LB2 A;  3SEZ A;  2OCE A;  2HYJ A;  3K4J A;  5L3E A;  3U21 A;  3K0L A;  4LFU A;  3CMM A;  3VYR B;  4IKF A;  2X1C A;  3FIS A;  3FIW A;  3OYE A;  4YG2 F;  3HPG A;  1OCT C;  3LWF A;  3GF2 A;  2MD0 A;  2LF8 A;  5HVQ C;  4F91 B;  1TW3 A;  3K4N A;  1V5E A;  3ESW B;  3F8C A;  4RAF A;  4ZZD A;  5GP9 A;  1JJ6 C;  3S8P A;  2M8E A;  3FBN B;  4PGG A;  5AIQ A;  3I53 A;  4M71 A;  1Y1V J;  5HOD A;  1FTZ A;  1Y8Q B;  1JT0 A;  4G6T B;  3H9J A;  3PQK A;  2BV6 A;  2JSC A;  2VQH A;  3O3K A;  4U88 A;  1Z6R A;  1RET A;  3OWT A;  2NYX A;  2P6S A;  2X6O A;  1Y0U A;  2JWT A;  2JTV A;  5LFA A;  1FOK A;  2YX7 A;  4Y52 J;  3DCF A;  2W24 A;  2PMZ A;  1XDU A;  4RGR A;  3HC7 A;  3HDD A;  3A01 A;  2K9M A;  3KFW X;  2ZB9 A;  2R7X A;  3S2D J;  1LE8 B;  4ESJ A;  3IC7 A;  2QKM B;  1R71 A;  3BP8 A;  1OCO H;  1G3Y A;  1BC8 C;  2OAZ A;  2E1M C;  2B63 J;  3RYR A;  4MQ9 F;  5C3E J;  1LQ1 A;  1E3H A;  3DLA A;  5ED4 A;  2VKH A;  2HQN A;  1V4R A;  1R4N B;  2MBF A;  3VSL A;  1K6Y A;  1G3W A;  2ZME A;  2UXN A;  2LKX A;  3V8K A;  3OYK A;  2YU3 A;  5BPI A;  1PVE A;  2EFQ A;  3S1Q J;  2IP2 A;  1AA7 A;  5M3F J;  2LRD A;  4E7K A;  4C2U A;  4OMY A;  4BXU A;  1O4X A;  4V2F A;  3TDZ C;  3TOB A;  2BY1 A;  2HGC A;  1J59 A;  4AUX A;  4I99 C;  4M3B A;  4B09 A;  2CS3 A;  4EJU A;  4KT6 A;  2HR3 A;  3C2B A;  3V7C A;  3ZRG A;  4ESF A;  3LSG A;  3KYL A;  4HNT A;  2LY9 A;  4HAM A;  4XRF A;  1VQO I;  1SMT A;  3D1N I;  5GAG J;  2VXD A;  2N8G A;  4I7H A;  2GA2 A;  1WSU A;  3OYG A;  1ETX A;  1YIT I;  1U2W A;  2CQK A;  4ITV A;  3PM1 A;  1W36 C;  2WAF A;  1FC3 A;  2DMT A;  2F4I A;  3GXO A;  2D1H A;  3D0S A;  2WAQ N;  2K3F A;  3F3X A;  2L9R A;  2HPI A;  3OL4 A;  2WWY A;  1BR2 A;  1OYI A;  1K83 J;  3F9K A;  3WTV C;  4C2M J;  4PFO A;  1BL0 A;  3QP5 A;  2R7W A;  2OU2 A;  4Q5S F;  4XN0 A;  5TGT A;  2A68 F;  1X19 A;  1CF7 A;  5F6F A;  2IEK A;  1MSF C;  2DCE A;  2E7X A;  3HOS A;  4Y17 A;  2E2H J;  1U0J A;  2JN6 A;  3JRC A;  2CUJ A;  1APL C;  3TQN A;  3TP0 A;  1FY7 A;  4BBR J;  1ZAO A;  3FXK A;  2W48 A;  1DPR A;  2X0L A;  1S8N A;  2AQF A;  2C6Y A;  2IS4 A;  1AKH A;  2BY0 A;  4XN3 A;  2ESN A;  3H9G A;  1TP4 A;  2Z2S B;  3O2P E;  5KVR A;  3E97 A;  4CGZ A;  3J80 Z;  3IKV A;  3GLX A;  4I6Z A;  3L9F A;  3Q9S A;  1OCP A;  3OR2 C;  4RB1 A;  3HZJ A;  1QQI A;  4UUS A;  4N0B A;  4IL6 C;  2X6X A;  4R1H A;  2F4M B;  2WV1 A;  3L7W A;  4IVN A;  5EF6 A;  5DUK A;  4ABZ A;  3JR9 A;  1FMV A;  2WAQ A;  1OYY A;  2HU9 A;  1SFK A;  4ZZL A;  4LD5 A;  4GCV A;  4DJA A;  2R7T A;  2H94 A;  2KIS A;  4ZYG A;  3CP2 A;  1LVA A;  1FYM A;  2L01 A;  4MGR A;  1ZRE A;  2JUC A;  4XR6 A;  5LHI A;  3HOV J;  2K40 A;  5F0C A;  2EJR A;  2LRE A;  2W84 A;  3CLQ A;  3HOT A;  1IZ1 A;  4XOP A;  1DGR M;  3WGH A;  3E6B A;  3UNG C;  3RCO A;  1F5T A;  5JHU A;  1ZGW A;  2VC1 A;  4E7Z A;  5KK1 A;  3ZOB A;  5FLX K;  1W36 D;  3IH2 A;  4A2U A;  4YII A;  5LBQ A;  3AL0 C;  4WXD A;  4IHW A;  2EK5 A;  4HDV A;  3VOD A;  1FSH A;  1O3R A;  4J00 A;  2DTR A;  2UV1 A;  4A12 A;  3NWS A;  4LB5 A;  2A07 F;  4XK4 A;  3ZQL A;  4IQJ A;  1G59 A;  1UG2 A;  5C4X J;  3BC8 A;  3BRO A;  4Y13 A;  2CFO A;  1K78 A;  1IAW A;  2AO9 A;  2KDZ A;  1L0O C;  3FMR A;  2VJJ A;  4OIO F;  3QPL A;  2XB0 X;  3MKW B;  3GFL A;  2MC3 A;  2DMU A;  3JRB A;  4HF1 A;  3K1M A;  4LK1 F;  4XKV A;  3SFI A;  2KT0 A;  3ZMU A;  2RQP A;  3BPX A;  4MQV A;  2R7D A;  4HRI A;  2JA6 J;  1Y8R B;  2DDB A;  2KRC A;  2WY8 Q;  4UVC A;  3RDI A;  5IT3 A;  3BTC A;  4WK8 F;  2XV4 S;  3WTX C;  2M4G A;  2A05 A;  3OS0 A;  3DF8 A;  5IPA A;  2XF5 A;  3HRS A;  2HKO A;  3F0C A;  2A6T A;  5E20 A;  5JHF A;  2XAG A;  3V7R A;  3LSM A;  1JTX A;  2VQL A;  3Q3S A;  5IP7 J;  2X4H A;  4A3D J;  2Z3Y A;  5D5W B;  1Z6T A;  2GIZ A;  1LKX A;  4XRS G;  1XG1 A;  1IW7 F;  1OYW A;  4D5F A;  1DGW Y;  1W4M A;  2P5V A;  1JT6 A;  4AU7 A;  4FQG A;  2OPT A;  3CO6 C;  4H0E A;  1FJL A;  4L0Z B;  1GVJ A;  3EUH C;  4QSH A;  1QZY A;  1TLH B;  3I9V 2;  3F8M A;  5K7F A;  4BAY A;  1VND A;  1IF1 A;  4C30 A;  2AQE A;  1SD4 A;  2HI3 A;  2DMN A;  2IW5 A;  1XPX A;  1REP C;  1YQA A;  3SYT A;  1BOB A;  2CH0 A;  3GO5 A;  2JA5 J;  1X1P A;  4KT5 C;  4XLF A;  1QZZ A;  1ACI A;  3WTT C;  3WHB A;  1T8I A;  3K2A A;  2HDD A;  3S3N A;  1LDD A;  3KEY A;  3MKZ A;  2M30 A;  2AHQ A;  2D1V A;  3RPQ A;  3M8F A;  3ABM H;  3ZQQ A;  3JAM Z;  2GXB A;  2YUS A;  2E5Z A;  1W7P D;  4E7J A;  4OIR F;  2ZXI A;  5LEK A;  4R8H A;  4FAS D;  4UY8 I;  2YPR A;  4M72 A;  3DEW A;  4D0P A;  3HGY A;  3BR1 A;  1BA5 A;  1ERD A;  3OIO A;  3LAP A;  1Z67 A;  1S7E A;  5HDG A;  1J5Y A;  1IDY A;  1UST A;  3FMS A;  2ID6 A;  4Q48 A;  4MHG A;  3R61 A;  3CDH A;  4HV6 A;  1POG A;  1YX3 A;  4HF0 A;  4ASN A;  4HF2 A;  1STZ A;  3H1C A;  4NUB A;  2EIN H;  3WTS C;  3AAF A;  2X1E A;  3OY9 A;  2NVY J;  2P0W A;  3HB9 A;  4P9U A;  4PJM A;  4E7H A;  4BY1 J;  4HQM A;  4JOM A;  2O8K A;  2DT5 A;  5E17 F;  2K9S A;  1IXS B;  1DQU A;  4UV8 A;  5EZH A;  3WE2 A;  1R49 A;  1IRG A;  3DTE A;  4XRS A;  5LHG A;  2NVQ J;  2L9S A;  3KLN A;  4CSW A;  3M8J A;  5K1Y A;  1Q1H A;  1ETK A;  2O8X A;  5CYV A;  2HOS A;  3J7A Y;  4PDK A;  1MMS A;  5M5X J;  2LTP A;  5E3M A;  3QRF F;  4NQW B;  2R7F A;  3MWM A;  2HS5 A;  5CLS A;  3TL4 X;  4HNV A;  5FKN A;  2VPR A;  2PFB A;  4LIV A;  1TWH J;  1Z3X A;  4BQQ A;  5GAD J;  1WZ2 A;  4PCQ A;  2EZI A;  1XN7 A;  3GEZ A;  3K10 A;  5DEQ A;  1BW6 A;  3VYS B;  4BXF A;  1SD7 A;  4F93 B;  1YOV B;  3A0H C;  4YFK F;  4XLN F;  3T8T A;  1ZTR A;  1R5G A;  2BGC A;  3OS1 A;  2DLL A;  2DFH A;  4RBO A;  3CD6 I;  3HRM A;  4A3L J;  1A6Q A;  3O8H A;  2XRN A;  3DV8 A;  3C2H A;  2F5D A;  2VQC A;  1R00 A;  1U5T B;  3I58 A;  3IAS 2;  4EVI A;  1Z9C A;  3WG7 H;  4QIW N;  3LNQ A;  2K3P A;  4BS9 A;  1M1E B;  3SJM A;  1BI0 A;  1E3O C;  2RAE A;  2VC0 A;  4DBR A;  1BJA A;  4GRI A;  4H4K C;  1E17 A;  1WPK A;  2ISZ A;  4A3E J;  1EV7 A;  3ZN0 A;  1QRY A;  2VKV A;  1T0F A;  2DJI A;  4JK1 X;  3SXY A;  1ZR4 A;  3K4K A;  3J7Y J;  1QPI A;  4P55 A;  3S1N J;  5FKK A;  1XMA A;  4ZC3 A;  3PNT A;  2A5Y B;  3GTO J;  3W2W A;  1K7A A;  3HEF A;  2Y30 A;  2DMQ A;  5C4J J;  1B6A A;  3AG1 H;  2ELH A;  4R79 A;  2DU9 A;  1O57 A;  3TDU C;  3FXU A;  1T56 A;  4BE1 A;  2HXI A;  3MAJ A;  1ZLK A;  2IA0 A;  5GPC A;  1MKM A;  3V8J A;  1W1W E;  4BNC A;  4M6Y A;  2M0C A;  1QVU A;  3VDX A;  4A3B J;  2MLG A;  3B73 A;  4XLE A;  1P6R A;  3SEQ A;  3ZQH A;  3LAJ A;  2DOA A;  3Q0W A;  3GFI A;  2V1U A;  1UB9 A;  5GTI C;  3NAR A;  3N97 A;  3FF5 A;  2IS1 A;  4PJJ A;  4EAT A;  3LFU A;  3M4O J;  4AIJ A;  3QP6 A;  3V42 A;  3F22 A;  1SFO J;  3EYY A;  2EZH A;  3S1M J;  2XPV A;  5BMZ A;  2GQQ A;  1JKQ C;  1IRF A;  3ZCO A;  3I59 B;  4C9Y A;  3FXO A;  3JRF A;  5BPD A;  4ENK A;  4L5J A;  1ETY A;  3F8N A;  3OYH A;  1J2X A;  2I10 A;  2PI0 A;  1WCM J;  2BBY A;  4NBQ A;  1IRX A;  4HNU A;  4PJN A;  1R6R A;  1TWF J;  5E3O A;  3ZMT A;  4GDF A;  1D5V A;  4IPA A;  2HZT A;  4EM1 A;  4KNY A;  1DDN A;  1Z1D A;  2XKO A;  2CJJ A;  2EIK H;  3H5A A;  4G94 A;  1U8B A;  5IYD J;  2A5W A;  2A6H F;  3I3L A;  3W6K B;  2JA7 J;  2AXT C;  2FUG 2;  1X4P A;  2NS8 A;  3RKY A;  2CW0 F;  4NDL A;  4DNC A;  1H89 C;  1WJE A;  1OJL A;  1FYK A;  2I5U A;  1U5T A;  2JMW A;  2DK8 A;  1FIP A;  4AVP A;  2R7Q A;  3DPT A;  4DOZ A;  1W5C C;  2HEO A;  1IN5 A;  1FOW A;  4AM3 A;  3DBR B;  5CKT A;  4XLP F;  4UVB A;  2KP6 A;  1FBU A;  2ZNZ A;  2E36 A;  1TWA J;  2QZ8 A;  3ABK H;  3KX2 A;  4Y7N J;  5E8I A;  1MND A;  2ZJP F;  1WJ5 A;  3QYE A;  5EG0 B;  5DTD A;  1SMY F;  2DFF A;  2XAH A;  2QCO A;  4IHY A;  2TRT A;  1R4M B;  1P4X A;  4CUG A;  4OAY A;  3JRA A;  2LP0 A;  1V54 H;  2Z9O A;  5JR3 A;  1MNM C;  2F48 A;  4A3I J;  4W97 A;  2CQN A;  3NEU A;  3ABL H;  5DYM A;  2ZJR F;  1YW8 A;  2R5Y B;  3LSJ A;  4G9Y A;  2YR2 A;  3K4L A;  1OCC H;  1SC7 A;  5HLT A;  3OSG A;  5B66 C;  3NAU A;  2LY2 A;  3OOP A;  4KMU X;  4HA8 A;  5KAF C;  4EMS A;  1NTC A;  3KP7 A;  4HST A;  2RN7 A;  3LSI A;  2XF6 A;  2M4K A;  3B6A A;  4ENM A;  5HLH A;  4I2O A;  2XDV A;  4RMN A;  4YIF A;  3KZZ A;  3FXM A;  3A4C A;  3I59 A;  3JCU C;  3OL3 A;  2Y0M A;  4BHC A;  4KIS A;  3GFJ A;  2O0Y A;  3C7J A;  4ETS A;  3CCY A;  5ICC A;  2XRO A;  4RS8 A;  3M3Y J;  3N4M A;  3BCA A;  4A5M A;  5EEG A;  1UEL B;  2IJL A;  3I54 A;  2EA4 A;  2XSJ C;  3GTG J;  3T0Y A;  4HQE A;  4BEH A;  2JSP A;  3HHH A;  3WGG A;  3S16 J;  2MGQ A;  4KJZ A;  1KU9 A;  3E5Q A;  1BI1 A;  2LY1 A;  5LGN A;  2DYR H; 
#chains in the Genus database with same CATH homology
 1WJA A;  3PFY A;  2KRH A;  4NNJ A;  4YEJ A;  1PJR A;  2CS3 A;  4KT6 A;  3RSN A;  2KLO A;  4D1Q A;  4Y33 A;  3LL7 A;  2OUM A;  2CV2 A;  3ZRG A;  3KYL A;  1TZL A;  3LSG A;  4HNT A;  2OV7 A;  2ZSH B;  3HUG B;  4MLO A;  4II2 A;  3OYJ A;  3N05 A;  1LFP A;  2VXD A;  3K4C A;  1T95 A;  1V5F A;  3OYG A;  4BJT A;  4B3X A;  4ZJZ A;  2PJR B;  2RNG A;  2L5Q A;  4ITV A;  2X6W A;  1W36 C;  2WAF A;  2F4I A;  1J09 A;  3PSI A;  2L7K A;  3VYU B;  4U7B A;  2VL8 A;  2HPI A;  1T0F C;  3OL4 A;  1BR2 A;  3F9K A;  1GLN A;  4BU2 A;  1D1A A;  4PFO A;  4AYB A;  2R7W A;  3SDB A;  4XN0 A;  2Z1D A;  2MYS A;  5TGT A;  4BDY A;  1X19 A;  1FMW A;  2VAS A;  4B48 A;  2DCE A;  4F92 B;  3HOS A;  1U0J A;  4JQF A;  2L9N A;  2CUJ A;  4AVZ A;  2CMP A;  2X1D A;  4BEH B;  2LOO A;  4ZYA A;  2AQF A;  2WB1 A;  2IS4 A;  1G8X A;  2IGO A;  2E5N A;  2V9K A;  4XN3 A;  3H0D A;  3AFH A;  3DPU A;  3EUK L;  3H9G A;  2Z2S B;  1E0E A;  3HG9 A;  1DP3 A;  3OMY A;  2VLA A;  4CH7 A;  2HQA A;  3OR2 C;  3PNY A;  2CW7 A;  3BG6 A;  4XNF A;  3LMM A;  2X6X A;  4E6K G;  4D9J A;  3DKY A;  1SAU A;  2KMU A;  4XOR A;  1FMV A;  2HZD A;  2WAQ A;  3IAM 2;  4E7L A;  2MC4 A;  2HU9 A;  4RM3 A;  1SFK A;  3IP4 B;  2HVR A;  2M7B A;  2KDO A;  4B43 A;  4DJA A;  2R7T A;  4E4H A;  4BJ6 C;  1PYV A;  3CP2 A;  1V5G A;  2Y0S A;  1Z3Y A;  4XR6 A;  2WAD A;  3L2W A;  1MMD A;  1D0Y A;  1Z7L A;  5LD2 C;  2LRE A;  4XQF A;  3HOT A;  5FRO A;  3CZ6 A;  4XOP A;  2R7R A;  1DGR M;  2VQG A;  3H35 A;  1WJD A;  3UNG C;  2V1N A;  2K9L A;  3RCO A;  4BAC A;  4BGD A;  3MD2 A;  4IX7 A;  4XOT A;  3W2V A;  4E7Z A;  3ZXS A;  3E0J B;  1W36 D;  3AL0 C;  2QKL B;  4XLH A;  4YRV A;  2W00 A;  2HPM A;  4J00 A;  3DWL E;  2UV1 A;  3NWS A;  4ZDL A;  4IQJ A;  5CQE A;  4ANJ A;  4YEL A;  1G59 A;  1HA8 A;  3BC8 A;  2CFO A;  4ZTJ A;  2R7U A;  3EUA A;  3DU6 A;  3LSH A;  4P1W A;  3OYA A;  2R4G A;  2VJJ A;  2W4S A;  1WJC A;  3MKW B;  4F52 A;  3TMO A;  3UR3 C;  3QYF A;  1NG6 A;  2JUG A;  3OR1 C;  2IGN A;  4XKV A;  2O5R A;  3L2U A;  2XC7 A;  2WBM A;  4HRI A;  4HSR A;  1JI8 A;  2KRC A;  2WY8 Q;  2M4G A;  2GOM A;  3OS0 A;  2K5C A;  2X6Y A;  2XF7 A;  2XF5 A;  3CF2 A;  2WAE A;  2E1M B;  3D5R C;  4BL0 B;  2A6T A;  5JHF A;  5HOO A;  3H5N A;  2IS6 A;  3EPZ A;  2WY7 Q;  1D1B A;  3LSM A;  4RM2 A;  2VQL A;  4CA0 A;  2RQQ A;  3FDY A;  2R7O A;  1N75 A;  1LKX A;  2VB6 A;  3DEE A;  1DGW Y;  4BE2 A;  2VIX A;  4IZZ A;  4ZTF A;  4PK4 A;  4AU7 A;  4B47 A;  2KQR A;  3VYT B;  3SZG A;  4DGW B;  1LDK B;  1QHG A;  3EUH C;  3ZGK A;  4RLF A;  4ZDO A;  3I9V 2;  4C30 A;  2AQE A;  2M0M A;  3HPH A;  2DT6 A;  1YE9 A;  1D0Z A;  2LG4 A;  4XKB A;  1BOB A;  3D5S C;  3SYT A;  4KIT B;  5FRN A;  2L2O A;  2CH0 A;  2LYC A;  2W7N A;  1N77 A;  4XLF A;  3S3O A;  2HVS A;  1X4O A;  3S3N A;  1OLT A;  3BLY A;  3QYB A;  1MMG A;  3KEY A;  3MKZ A;  3VWB A;  1Y56 A;  3ZQQ A;  1Z21 A;  3VSK A;  3G2B A;  1WFX A;  2E5Z A;  4E7J A;  1D0X A;  3PJR A;  2HNH A;  4CCO A;  2ZXI A;  3W3C A;  4FAS D;  4XLA A;  4CCL A;  4HG2 A;  3CP8 A;  4N4O B;  2KL4 A;  1ERD A;  4F3Q A;  2BVM A;  4IQ4 A;  3DTK A;  4FET A;  2VXZ A;  3RQ4 A;  1X1D A;  4Y4R A;  1YX3 A;  1P9Q C;  5KHD A;  4NUB A;  3FKJ A;  2X1E A;  4HEA 2;  1VZ0 A;  3OY9 A;  2ZSI B;  2P0W A;  3PUB A;  3BCB A;  3OOU A;  4PJM A;  4E7H A;  5FRM A;  4JOM A;  4LIT A;  1DQU A;  4HPQ A;  3DTE A;  3GBG A;  4OAZ A;  2L9S A;  3PNV A;  2MAB A;  3OYB A;  3K70 C;  4E7S A;  4CSW A;  3M8J A;  3J7A Y;  4XM3 A;  4NQW B;  3TL4 X;  2VJ5 A;  2GOX B;  2LBF A;  4LIV A;  1Z3X A;  4BQQ A;  3OYN A;  1S9H A;  2E60 A;  4Y3O A;  3PSF A;  2KZV A;  3DU5 A;  3K10 A;  3VYS B;  4BXF A;  5CPR B;  4LIU A;  4F93 B;  4N4N B;  3OS1 A;  1KON A;  2IGK A;  2KPM A;  3C2H A;  2VQC A;  2R7S A;  3IAS 2;  1WJB A;  4CCN A;  5HNH A;  3CJQ B;  1UG0 A;  2K3P A;  4BDZ A;  4BS9 A;  2BW3 A;  2CUZ A;  4DBR A;  5HNF A;  3FBI B;  1X1A A;  4GRI A;  4H4K C;  3OYL A;  3OYF A;  4LG3 A;  2Q2E B;  4NC7 A;  2VJ4 A;  1X1B A;  4XL9 A;  3M1C A;  3OIP A;  2DJI A;  2V7F A;  3K4K A;  3K4M A;  2WA0 A;  2V6E A;  2W82 A;  3OYM A;  3OYI A;  3MKY B;  2IXS A;  2LBF B;  4X0G A;  4ZC3 A;  3PNT A;  2ZFU A;  3W2W A;  2I8D A;  2M7A A;  2W1O A;  1OR7 C;  2RRE A;  3IUO A;  2Z16 A;  4R79 A;  4II3 A;  3S3M A;  1MW7 A;  4CCK A;  4BE1 A;  4PFP A;  3W2A A;  3K70 D;  4PSX A;  2JVG A;  1MMN A;  3A2K A;  4XLC A;  1MNE A;  3NWT A;  4QPQ A;  3DTI A;  3BG7 A;  3VDX A;  3LSK A;  1X1C A;  4XLE A;  3SEQ A;  3L2Q A;  2DOA A;  3K6G A;  2IS1 A;  4PJJ A;  4BQN A;  3DKX A;  4EAT A;  3LFU A;  2BW3 B;  3OIQ A;  3V42 A;  2VKD A;  2UWM A;  4XKW A;  3CJR B;  4F55 A;  3MMY B;  3ZCO A;  3S32 A;  1TT0 A;  4C9Y A;  1MMA A;  1ZEL A;  5KCM A;  4BUP A;  2X51 A;  3DQV C;  4OWR B;  1BR4 A;  1QU3 A;  4NC8 A;  4RLQ A;  3E1S A;  3OYH A;  3OYC A;  2VJI A;  5KNL A;  2HVQ A;  2M3A A;  1IRX A;  4HNU A;  4CCM A;  4PJN A;  2F6C A;  1R6R A;  3OYD A;  3HL2 A;  3QOD A;  4BJ5 C;  3DPL C;  4BQO A;  1D1C A;  2LH9 A;  3FHN A;  1YX5 A;  3H5A A;  2Q1Z B;  2A5W A;  3H9Q A;  3I3L A;  3SEZ A;  3K4J A;  2MFZ A;  3S93 A;  3U21 A;  2VPL A;  2FUG 2;  1X4P A;  3CMM A;  3VYR B;  1WJE A;  2IGM A;  2X1C A;  4IKF A;  2BOL A;  2BVL A;  2CV0 A;  4XKC A;  3RTR A;  3OYE A;  2R7Q A;  3DPT A;  4DOZ A;  3ONQ A;  3OS2 A;  3L2R A;  4CCJ A;  3HPG A;  5CKT A;  3K4B A;  2LC2 A;  1LVK A;  2MD0 A;  5HVQ C;  4F91 B;  2KP6 A;  2NOJ B;  4E7I A;  3K4N A;  1V5E A;  3KX2 A;  3D5L A;  4C2T A;  1NG7 A;  2UUZ A;  4CZC A;  1N78 A;  1MND A;  5CQG A;  1WJ5 A;  2XAU A;  3QYE A;  3S8P A;  3FBN B;  4B44 A;  4XMY A;  4CUG A;  2DT7 B;  4OAY A;  1EA3 A;  3A1Y A;  4P5O A;  4G6T B;  4PJL A;  3HXL A;  3QOE A;  3H9J A;  4PSW A;  2VQH A;  2CW8 A;  2CV1 A;  1BR1 A;  3OWT A;  2DXI A;  3RPU D;  4XON A;  3L2V A;  5LFA A;  3TBI A;  2HDW A;  3C2G A;  3K4L A;  5HLT A;  2PMZ A;  1Y6I A;  2LY2 A;  4U87 A;  3HC7 A;  3AL0 B;  2OC6 A;  4HST A;  2K9M A;  3LSI A;  4QPO A;  2R7X A;  2XF6 A;  2QKM B;  2M4K A;  1UAA A;  2PJR A;  2JA2 A;  2XDV A;  4RMN A;  2E1M C;  3AKZ A;  3A4C A;  3HKZ A;  2F5V A;  3H5R A;  3OL3 A;  4KIS A;  2X85 A;  3CES A;  3DLA A;  4DIQ A;  4PUS A;  2VKH A;  1WJF A;  3VSL A;  1K6Y A;  2R7V A;  1QHH D;  3OYK A;  2IS2 A;  3BCA A;  2KHM A;  2JVH A;  1AA7 A;  1UEL B;  3PL8 A;  4BE0 A;  2LRD A;  4E7K A;  4C2U A;  3ZR8 X;  2V26 A;  2XSJ C;  4DBQ A;  2ELJ A;  4BEH A;  2JSP A;  2ZXH A;  4KJZ A;  4ZDP A;  2LY1 A;  4J01 A;  2V4J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...