4EM2A

Seleno-methionine staphylococcus aureus marr in complex with salicylate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
total genus 58
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em2A00
4BXUA 2WTEA 4OIRF 1XB4A 3WE3A 4BH9A 1XGMA 1DPRA 2PN6A 3H3ZA 1ZAOA 1P4WA 1R1VA 2P6SA 4KIBA 1VTNC 1DPUA 1KU3A 1FZPB 2F5DA 1ZLKA 3JAMZ 3N97A 3HSFA 5DCFA 4U0VA 1F4KA 1OR7A 2XGXA 3L09A 4K2EA 1XMAA 2KIUA 5TJJA 4HW0A 3WGHA 1Y0UA 2VOPA 5FLXZ 4A6EA 3QAHA 1TBXA 2V1XA 4LG0A 2ETHA 2XAHA 5FFZA 3MEXA 3GFMA 2QYOA 2D1VA 3OV8A 4MNUA 4WWCA 2FMYA 2DPDA 3GUDA 2XHKA 3WTWC 1T6SA 3TDZC 2DLLA 4ESBA 2A07F 2LSOA 4RGRA 1K6OA 1X3UA 4IRGA 4H0EA 4HBLA 4OMZA 2DT5A 2DAOA 1J2XA 3WTZA 4M72A 2IVMA 1I1GA 3EUHA 2DK8A 1ZRCA 2LF7A 1SFXA 1U8RA 1YQAA 3F22A 2P7CB 2VOOA 1KQ0A 2PEXA 1BN5A 5K5OA 1WWXA 1R00A 3RKYA 4A5MA 2A68F 4S05A 2PQ8A 2W85A 1UFMA 2XAQA 3DPLC 3BPVA 1W5SA 3I71A 1WQ2A 5D5UB 1GXPA 3BY6A 4NHJA 1XMKA 4YFXF 4M6YA 1YFHA 4FX0A 4LK0F 2G7UA 3CUQB 1O3RA 2ZXJA 2CW0F 3F23A 2XVCA 4MGRA 1W7PB 5IT9Z 3EQLF 4TV7A 2FF4A 1LNWA 2DI3A 1ZARA 3WGGA 5F1RA 4XSZF 1ZREA 4ENMA 1QZYA 2NYXA 2Y75A 5D8KB 1FT9A 1JXSA 4O3MA 1D3YA 3E5UA 4RB0A 3JTGA 2F5CA 2UXNA 5HDGA 2MBFA 1B9MA 5CVRA 3L7WA 3RPQA 4GXOA 1GHCA 2H6CA 1LEBA 1KYZA 4I7HA 4I0BA 4ZYEA 1FYKA 3RJPA 2H27A 5K5QA 1DUXC 3I59A 3RI4A 5FGMA 4BYYA 4BHCA 4EM2A 5JR3A 1D5VA 2PG4A 2JZYA 4HDVA 4UVCA 4OMYA 2RV8A 1NHAA 1MJBA 1SD6A 2ZKZA 2XKOA 3HRMA 1REPC 4A2UA 5D4RA 2EFNA 5LBQA 3R6SA 1RIOH 1U3EM 2VBYA 2LKPA 2VT2A 3ABUA 3GZ6A 4UNOA 2RGVA 2HR3A 3E3VA 2IPQX 3W6KB 1IW7F 3FX3A 3HIFA 3WU0A 4UHTA 2Z99A 2RDPA 2IP2A 2K02A 3VOEA 1H9TA 4IVNA 1HKQA 1OYYA 4HZFA 3EYYA 1D8KA 1HW1A 4KIGA 4CDGA 2RVCA 3HRSA 1LJ9A 4G7ZF 2WV0A 3M8EA 2M8EA 1DP7P 1KU9A 1U2WA 4OIOF 5LGUA 3GZ5A 3EYIA 1XD7A 1BC7C 3FM3A 2OAZA 1H9GA 1ZGAA 2K4JA 4ENJA 3BJOA 4KMUX 2GIVA 2HWVA 4G7HF 3K0LA 2H6BA 2GWRA 1G4DA 1XGSA 3JSPA 4EV0A 1TNTA 2QLZA 2OZUA 2ADUA 1T38A 2ISZA 1QPMA 4Z2YA 3FHZA 2KRFA 2QWWA 1W5TA 1CF7B 3GYHX 4AVPA 5CVUA 1STZA 4CYDA 1JHHA 3HSRA 5FD6A 3ECOA 1QGPA 4L9VA 2EB7A 2Y48A 3IKVA 1KGSA 5L3DA 4LLGF 2W25A 3B73A 4IJAA 2ZCWA 1ZRDA 2GZWA 1HBXG 1IRGA 1G6NA 1B59A 2VBXA 5E1XA 2K27A 1I5ZA 1R7JA 2VC1A 3K1NA 4O5VA 2ESHA 3ZMSA 3TOAA 5LLQA 3HYIA 3RPUA 3IWZA 3RIRA 3GF2A 2CQKA 1HKTA 4EJWA 2OA4A 4L9NA 2KIFA 2E1CA 3CUQC 5J8FA 3F8NA 3FXQA 2FBKA 5E20A 2XROA 1OYWA 1ZG3A 1B6AA 2P4WA 5JI6A 2M5WA 3G3ZA 3HUGA 3FMSA 4O6JA 2A61A 4BHPA 2EFQA 5FO5A 2ESNA 3E5QA 3I59B 4BAYA 3KP3A 1JE8A 5ILVA 3MAJA 1IN8A 4OINF 5HS9A 1R23A 1MZBA 3R60A 5TRDA 5LHIA 2O61A 5EEHA 4NQWA 3GO5A 4I02A 1FBUA 4DNCA 3L9FA 3RDIA 1W4MA 1QZZA 4IRHA 3M8FA 1HXDA 1SMYF 4Y13A 1D8JA 3CO7C 4KDPA 3MWMA 2A3SA 3SZTA 2D1HA 4ZYHA 5FLXK 3IL2A 1ODDA 2DQLA 1S8NA 4HA8A 2CG4A 3K1PA 2C6YA 3F21A 2RQPA 4R79A 1S29A 4B8XA 4XLPF 1RNLA 4RS8A 3KFWX 2NS0A 3QOPA 4M9ZA 4ESFA 5JFRA 4A0YA 1LQ1A 2QENA 1QO0D 2OQGA 4EJTA 3WTYC 4CICA 1AOYA 1L0OC 2EA2A 2XAGA 4JBAA 1B9NA 2VE9A 4L5IA 5A2QZ 3HOSA 1R1UA 1V4RA 3ULQB 1J9IA 1Z1DA 3ZQ7A 4WCGA 5DYMA 2HOEA 5LGNA 4ZYGA 2FSWA 1FPQA 4M74A 2EV6A 3LA2A 1KQ9A 2BGCA 3VEPA 1KYWA 3TO6A 1PUEE 4U7BA 1TQIA 4FX4A 5CVJA 2UZKA 1U5TA 5JHUA 2CGPA 4PGHA 3J7AO 3KP5A 3ML6A 2V1DA 5BS6A 5HDKA 2DU9A 1XGOA 4GYIA 4ENNA 5D5WB 4EJUA 4I0AA 1I1SA 1R58A 2P6TA 3HSEA 2COMA 2ZNZA 3QU3A 3KZZA 6PAXA 2PFBA 2QBYB 1YW8A 2VXZA 4I01A 4UVAA 1FBSA 1TNSA 4MQVA 2R7DA 2V1UA 5HLIA 2FBHA 4LG0B 4P9FA 2Z5UA 2KJCA 1MJAA 2FA5A 3FXUA 1YLFA 1A04A 4PZJA 1HSTA 4UXNA 5KK1A 3TOBA 2P7VB 2YU3A 2QUFA 1LEAA 4A0ZA 1XSXA 2OU2A 3P9IA 5ICFA 4WF2A 2MH9A 1O57A 3SHFA 4OU0A 3V4GA 4L9JA 3ELKA 2NNYA 2L01A 1XGNA 1FYLA 4XRFA 1IN7A 2DK5A 3IWFA 3Q5FA 1MDMA 3EDPA 1XCBA 1SAXA 4IF4A 3F6OA 4HX8A 3V7RA 2HEOA 2UWMA 4YFNF 4HQEA 1ZN2A 1ZHFA 3TQNA 5H6QA 3M1EA 3GXOA 1C0WA 1BOAA 1R1TA 3F8BA 5K5RA 5LRSA 1P4AA 2LF8A 4AIHA 2EV0A 3CLOA 1SD7A 3AAFA 3DPTA 5ICCA 4KNYA 5E1WA 1SMTA 5L3EA 3FXRA 1SFUA 4Y15A 4LK1F 5HVQC 2DTRA 5FD5A 4Y17A 2Q0OA 3FF5A 3COAC 3Q9VA 3VFZA 3QPTA 4HDUA 2OBPA 2NNNA 3DKWA 4GO1A 2XUBA 5ICGA 2DFIA 4KFCA 1U5TC 4RGXA 3M9AA 3U1DA 1OMIA 2CSOA 4XSXF 4ESJA 4WX9A 1GXQA 1UB9A 2YX7A 3ZMTA 2HQNA 4S04A 1RZ4A 4Q47A 3KP7A 2IW5A 1WKMA 4PCQA 1CF7A 3F8MA 3T8RA 2VODA 1FBQA 3FWEA 2JTVA 4CXFA 5ED4A 1KU7A 3BJAA 1K79A 5IT9K 3S2WA 1YS7A 2ZFWA 2ZJ2A 1F5TA 4CHUA 2EFPA 1FSHA 2Q8KA 2HFHA 5BPIA 1SD4A 5DDGA 3GEZA 2F2EA 5ICEA 2IA1A 3ABTA 1F1ZA 5FFXA 3WODF 5HOOA 5ILUA 2CWEA 4RGUA 2FBIA 1FSEA 3RTRA 1BM9A 5DCMA 4G8XA 2EFWA 1MGTA 2P5VA 4WK8F 5HS7A 3ZN0A 2Z33A 1IN4A 1EV7A 4P5OA 5CVVA 2UXXA 3FZVA 5F64A 3HRTA 5E1ZB 3DP7A 4HQMA 4HF0A 2P5KA 2VE8A 3LQQA 1T98A 4EQQA 1QBJA 2PMHA 5KVRA 4G6DA 3ZMZA 2HDCA 3ZMUA 2WWYA 4R1HA 4WXHA 3G73A 3V8LA 1S6LA 3HTSB 3NEUA 3HHHA 1V3FA 2HYGD 1QNTA 2HTSA 2LNBA 3IC7A 1BBYA 4RAYA 3BROA 2EFOA 3T0YA 4KN7X 3QP6A 2FNAA 5E17F 3E6MA 4UUVA 2FMLA 3RKXA 4Q4ZF 4L18B 4P55A 5BMZA 1USTA 1B4AA 2RC4A 1YG2A 5J6XA 2GA2A 1O3QA 2GA1A 1FC3A 4BQAA 2RN7A 4M9XA 3BWGA 1O3TA 4UV8A 2PLYA 3Q9SA 3KEOA 4ENKA 4G9YA 1SD5A 4HV6A 2R3SA 3RKWA 4EJOA 4PDKA 2BE5F 5H20A 3GWZA 5LEJA 2HTJA 1Q1HA 3PFIA 2EK5A 5D6EA 2D2WA 2F5EA 1PDNC 2LDUA 2BYVE 2RNJA 3RYPA 2OQRA 2O03A 4LB5A 3MFKA 2K86A 2XAJA 1S7AA 1K78A 4HYEA 1XSVA 4YG2F 3GFIA 5BQTA 3I53A 2K4BA 2H94A 1EH6A 4EMSA 3F3XA 1G3TA 1HSJA 1FYMA 1ONVA 2XASA 3E6CC 3T8TA 4ON0A 4A12A 4G6QA 3KZYA 1FP2A 1OPCA 2QQAA 5HLHA 3WE2A 5DV5A 4A0XA 1FY7A 1E2XA 1U5TB 1UCRA 1WI9A 2AS5F 1WSUA 2QM3A 3DEUA 4GGGA 3TKYA 1J7KA 4YIFA 2EV5A 1MJ9A 3WU1B 1T0FA 3L00A 1BIBA 4MHGA 4ZZLA 3I64A 3GLXA 3GW2A 3GFJA 4BHBA 3LFKA 2M1BA 4ASNA 3BOQA 3LAJA 1IXSB 4CZZA 2QQBA 2Q2EA 1OKRA 4CO8A 1ZLJA 1USSA 3V7CA 2YSRA 3WTVC 1P6RA 1SFEA 1RUOA 2MC3A 4P96A 1LDJA 2B0LA 2D45A 4JQFA 4YFKF 2ZMEA 2O3FA 3P9KA 1BIAA 2HKXA 5IT3A 1Z05A 3LWFA 2EWNA 2FNPA 3TO9A 4YIIA 5FB2A 1Z9CA 3FM5A 3JAMK 3SZPA 2A6EF 4KA4A 3J80Z 1U78A 3HHGA 1I6XA 5LGTA 2ZBKA 1IN6A 2M87A 4RB2C 3GVAA 4IXAA 2ISYA 4HLXA 3U2RA 1UHWA 3DFGA 3I0TA 2O6GE 3T5XA 5CLSA 4L0YB 1TW2A 4GYGA 3I54A 3D0SA 3WG9A 4IRIA 4AIJA 5HDNA 3HRUA 1IRFA 2JRTA 1ZH5A 4KN4X 4LMYA 3KE2A 1GVJA 1T39A 1G3YA 5LHGA 2KIMA 1BJAA 2P5LC 3WTTC 4Q5SF 4B09A 1O7LA 2O0YA 4RGSA 4MTDA 1EH8A 2VT3A 3KP2A 3TGNA 1FX7A 1R5GA 2A69F 3BPXA 4HF1A 3QPHA 2ZMEB 4FT8A 1P4XA 5D5XB 1R36A 2L3DA 2TDXA 5LHHA 4LLLA 5DUIA 4CGZA 4M71A 4OIPF 3WTSC 2QZ8A 3BZ6A 3LQRA 3ECHA 1LDDA 4I09A 2G7HA 3KETA 5L3CA 2ZNYA 2DQRA 1YS6A 3T1BA 2FXAA 3KP4A 1IUYA 1L3LA 1K78B 2QQ9A 5E8GA 5LRRA 3NQOA 1J5YA 2ACJA 4UV9A 1MKMA 3ZMVA 1G3WA 3E6DA 3GX4X 4BNCA 1HW5A 2V9VA 2PMUA 1PP8F 3F6VA 1ZG5A 2CO5A 2P8TA 1BC8C 3K69A 3LSTA 3I58A 3R4KA 3HOTA 3V7SA 1R5HA 3LA7A 2DO7A 1YW7A 4LFUA 5BPDA 3F8FA 1IXCA 3LAPA 3CJNA 1IZ1A 4EGZA 5ERIA 5DCMB 1BI1A 3QU6A 3ZN1A 2RKHA 4LD5A 1XCVA 2QVOA 2DPUA 2ZO4A 4MQ9F 4IHSA 1S7OA 5HLGA 2MD5A 4M9SA 2G9WA 1G3SA 2V79A 1DDNA 4OIQF 2FU4A 3DXJF 3MQ0A 2L54A 4KICA 3F8CA 2MH2A 2KKOA 1TQMA 3DV8A 4ZZDA 4P9UA 2KJBA 1FOKA 1J0RA 2OD5A 1OYIA 3C18A 1BI0A 2K7LA 3KCCA 1J59A 5L3BA 2E7WA 3DF8A 1ZG1A 3C1DA 1MD0A 4U88A 4M73A 1MDMB 2GAUA 3QRFF 2FEZA 1LDKB 4EM1A 2WC2A 4R8HA 3BDDA 4L5JA 1ON2A 5AIPA 2CYYA 2FRHA 4ZH4F 2NRAC 2A5YB 2MA3A 5AONA 4DQ2A 4N0BA 2AXLA 2Z3YA 2PJPA 2E1NA 4U0YA 1LB2A 4OOIA 5CVIA 3SQNA 3WTUC 2NAZA 1EH7A 3PQKA 3N4MA 1BI3A 3R0AA 3IRQA 1QQIA 1W7PA 4XBFA 4HOBA 3ZP5A 1TLHB 5L3GA 2OZ6A 2VC0A 1XN7A 1PP7U 2FQ3A 1KU2A 2MLKA 3CUOA 1O7FA 4KUMA 2IA2A 4D0PA 2JPBA 1IN5A 2XAFA 1B1BA 2X0LA 2HKOA 1TTYA 2M45A 3SFZA 4EGYA 2DBBA 2EA4A 1IF1A 3RYRA 4ZYDA 5E8IA 2YPRA 1BI2A 3KLOA 2FE3A 3D5LA 2J5PA 3OOPA 2STTA 3B02A 3ERED 1HW2A 2FOKA 1ZGJA 3IKTA 1F9NA 4U7DA 3FMQA 5DEQA 2L4AA 3KLNA 1YW9A 3HTUA 3TDUC 3JW4A 3KP6A 1KQ8A 4EVIA 3NRVA 1YYVA 3O6BB 3VB2A 2E7XA 2L02A 4KT5C 2VBWA 2H09A 3JTHA 4N9IA 4UVBA 3P7NA 4FHTA 5K1YA 5BOXA 2XIGA 3JSOA 3W6JB 2EJRA 1XDSA 3H92A 1S3JA 5H6RA 3PQJA 2M30A 2STWA 2JPCA 2F5FA 5D8LB 3F72A 3J81K 3CTAA 1P92A 1RUNA 2W57A 4A5NA 4MEYF 1Z6RA 3R61A 1KA8A 3V8JA 2YX4A 3ZPLA 4KYWA 3VODA 4N9HA 2Y0MA 4EM0B 3QP5A 4KIFA 2HZTA 3BP8A 3K1MA 2Z9OA 1K7AA 4HX4A 3J80K 2X4HA 1R22A 3ZMDA 4I2OA 2GXBA 2PBIA 2W24A 4HF2A 4HAMA 4KMFA 5ILSA 1LVAA 1XDUA 3L2CA 3LA3A 3WGIA 2JSCA 1YO5C 4L0ZB 2ELHA 2IA0A 4MEXF 1TQPA 4LJZF 4RB3C 1ZRFA 3O3KA 5E18F 1IAWA 4HLYA 1CGPA 3E6BA 2V6CA 2O8XA 3ROUA 1HKSA 1H0MA 3SXYA 4LLNA 4MTEA 1AWCA 2R7FA 3J81Z 2IT0A 1WRJA 3BJ6A 1Z7UA 3MZHA 3GFLA 3M7GA 2IJLA 3REOA 3WTXC 3ISPA 2XV4S 2PI0A 2IRFG 1U6GA 5DD4A 4IHTA 1FLIA 2HS5A 3I4PA 4EJVA 4LGWA 3CUQA 2DW4A 1RI7A 4XLNF 4RAZA 4GCVA 3IHUA 4G7OF 5LEKA 2GXGA 4F7ZA 4AIKA 4M6XA 3K9TA 3IRRA 3C3WA 3E5XA 4HX7A 2JT1A 5L3FA 1O3SA 3CDHA 5D6FA 3I5UA 2BBYA 1IXRC 5JVTA 1ON1A 5EEGA 2HQRA 4AWXB 5CJ9A 2BEOA 1XSDA 4IPAA 2J5OA 1FWZA 5DD8A 1J75A 2YR2A 1T2KA 3TO7A 1FP1D 2W84A 2BV6A 2L4MA 2XKPA 3P9CA 1Z6TA 4NB5A 3EETA 4WXCA 4LB6B 1TW3A 3R0JA 3MZYA 4RB1A 5HS8A 1I27A 1YIOA 4A6DA 4ETSA 5A2QK 1HQCA 1E17A 2MLGA 4QLCU 3CO6C 4AD9A 4JK1X 4U0WA 1ULYA 3H3UA 1Z91A 3KEQA 5AIQA 4E70A 2A6HF 3MCZA 4G94A 4PGGA 4Q48A 1P2FA 5DUKA 3E97A 2VN2A 2HYFA 1JHFA 2HGCA 1YTYA 5D4SA 2GQQA 2QBYA 3V8KA 5CYVA 2VONA 1UHMA 1FNNA 4I98B 1JGSA 5F6FA 5D5VB 3FMRA 3O2PE 2VBZA 4HV5A 4WXDA 2CFXA 3C7JA 5J8CA 3DQVC 4L9TA 3K2ZA 4QWQA 1ZYRF 3U9GA 1W7PD 2XRNA
chains in the Genus database with same CATH superfamily
4BXUA 2AXTC 1ZR4A 2WTEA 1X4OA 4OIRF 1XB4A 4F92B 3WE3A 4BH9A 1XGMA 3MMYB 2R5ZA 1DPRA 3PIPF 2PN6A 3H3ZA 1ZAOA 1WJDA 4PSWA 4IO9F 1P4WA 1QA6A 1R1VA 2HU9A 2P6SA 4KIBA 3OS0A 1VTNC 1OJLA 4C9YA 1DPUA 4UUSB 3NWTA 1KU3A 4DBRA 1FZPB 1VQLI 3H5RA 1QPIA 2F5DA 1ZLKA 4XKWA 2DT7B 2V6EA 3SYTA 4D9JA 3K70D 2BOLA 3JAMZ 4XRSG 3N97A 3HSFA 5DCFA 5B5EC 4U0VA 5GP9A 4BDYA 1F4KA 1OR7A 4J00A 2XGXA 3CMYA 3AG2H 2JRMA 1S72I 1JJ8C 3L09A 2W48A 2GOXB 4K2EA 1XMAA 1R4NB 2ID3A 3LSRA 2FUG2 3RZDJ 2KIUA 1VI0A 4PUSA 5TJJA 4HW0A 3RKQA 4NDLA 3WGHA 2ELKA 1Y1VJ 4XQFA 1Y0UA 4A3IJ 4JP0A 4A3BJ 2VOPA 2W00A 5FLXZ 4A6EA 3QAHA 1TBXA 2V1XA 1BJZA 2W4SA 4LG0A 2ETHA 2XAHA 5FFZA 3MEXA 3PM1A 3GFMA 2V4JC 1IRZA 2QYOA 2D1VA 4BACA 3PSIA 3ONQA 3OV8A 4MNUA 4WWCA 1IV6A 3VSLA 2FMYA 2DPDA 3HBLA 1A6IA 3GUDA 3PIOF 2XHKA 3ZR8X 3WTWC 2WAFA 3WHCA 4YELA 1T6SA 3TDZC 2IGOA 2M9HA 4IQ4A 2DOFA 2DLLA 2ZFUA 3BG7A 2ID6A 4ESBA 5K7FA 4N4OB 2A07F 2LSOA 4RGRA 1K6OA 3NWSA 1X3UA 4IRGA 1AKHA 3CD6I 4H0EA 4HBLA 4OMZA 2DT5A 2DAOA 1GT0C 3FHNA 1RETA 1J2XA 3WTZA 3OYEA 4M72A 2IVMA 1I1GA 2AHQA 3EUHA 2DK8A 1ZRCA 1DGRM 1UMQA 1ETVA 4PJMA 1T95A 3M8JA 1QHHD 2JVHA 2LF7A 1SC7A 1XTAA 2MW8A 1SFXA 3L2QA 1U8RA 1AHDP 1YQAA 3BZCA 5FLMJ 2VLAA 2Y9ZA 3F22A 4B44A 2YS9A 2P7CB 2VOOA 1KQ0A 1GUUA 3OYFA 5EJCA 2PEXA 1BN5A 5IYBJ 2X85A 5K5OA 1WWXA 1JTYA 1K83J 1R00A 1Y8RB 3RKYA 5C4JJ 4A5MA 3GTLJ 2VIXA 3QPLA 4XKBA 3ZQLA 2A68F 4S05A 3FK6A 2PQ8A 2W85A 2ZXWH 5GAHJ 1UFMA 2XAQA 1U9OA 2DODA 3QYEA 2VQGA 2ZXHA 3DPLC 2Y2ZA 2LY1A 1VNDA 3BPVA 4I76A 3WHBA 1GLNA 1W5SA 3I71A 1WQ2A 4XICA 5D5UB 4DW6A 1RR7A 1GXPA 4CCJA 2TRTA 1EKEA 3BY6A 3DEWA 2JA8J 4NHJA 1XMKA 2F48A 1ZKGA 4YFXF 4M6YA 4OWRB 4Y52J 1YFHA 3J7ZI 5J1RA 3OSGA 3OYNA 1PJRA 4FX0A 1IRXA 3AKZA 3OYKA 4XORA 1GVDA 2JUCA 4M6VA 1ZTRA 2QSFX 1RPWA 5H2FC 1LFUP 4LK0F 1X58A 3DPUA 2G7UA 3CUQB 5DS9A 2ZXJA 1O3RA 2CW0F 3F23A 1ZK8A 2XVCA 1T0FC 4MGRA 5EZHA 1W7PB 5IT9Z 3EQLF 4TV7A 2FF4A 1LNWA 4FCYA 1WJCA 2DI3A 1ZARA 3BZKA 3WGGA 2PMZN 3BQYA 3VYUB 4XSZF 4B48A 5F1RA 2PJRB 2E36A 4HEA2 4ENMA 2EH3A 1ZREA 1QZYA 2NYXA 4XLCA 2LH9A 2LY2A 3JRCA 2Y75A 5D8KB 1FT9A 2JN6A 1JXSA 4DGWB 4ITVA 3OWTA 1V5FA 4O3MA 1D3YA 3E5UA 3S93A 4RB0A 2JQ7A 2VB6A 1VFCA 3H3VK 3BC8A 3JTGA 1JGGA 3CCJI 2F5CA 2UXNA 4CSWA 3NAUA 5HDGA 2MBFA 1LUJB 1B9MA 5CVRA 3D5SC 2ZB9A 2EPFA 1HOMA 3L7WA 3RPQA 1P7JA 4GXOA 3M07A 1GHCA 2H6CA 1LEBA 4FE4A 1KYZA 4AYBA 4I7HA 3JRFA 3NARA 2LREA 2PMZA 4I0BA 4ZYEA 3RJPA 1FYKA 2H27A 5K5QA 1DUXC 3CP8A 3I59A 2ZMEC 3RI4A 5EGOA 5FGMA 4BYYA 2OTLI 3ZQQA 2LK2A 3GTMJ 4BHCA 4IOAF 4EM2A 5JR3A 3CJRB 1D5VA 2PG4A 4CCKA 2JZYA 4HDVA 4A3GJ 1W1WE 4UVCA 4OMYA 4PJLA 2RV8A 4RAFA 2NVXJ 1IJWC 4G12A 1NHAA 1MJBA 1SD6A 2ZKZA 4LITA 4XNFA 2XKOA 3HRMA 1REPC 4A2UA 5D4RA 1VF9A 3RCOA 2EFNA 3LSGA 3PJRA 2K9QA 4ZDLA 2H8WA 2DOEA 3DBRB 1VQ7I 5LBQA 3F9KA 5GAEJ 3R6SA 2JK3A 1RIOH 2V26A 1U3EM 3IH2A 3GMEA 1JKPC 2O5RA 3OYHA 2VBYA 2L7FP 2LKPA 3HOXJ 4CYCB 2VT2A 3ABUA 3TMOA 3GZ6A 2DMPA 4UNOA 2RGVA 1MSEC 2HR3A 3E3VA 3DTEA 2IPQX 3W6KB 1VQMI 1IW7F 2M34A 3FX3A 3HIFA 3WU0A 5FJ8J 4UHTA 2Z99A 3S3OA 2RDPA 3CCMI 2IP2A 5FROA 1NTCA 2K02A 3VOEA 3CC7I 3S17J 2HVRA 1H9TA 4IVNA 1HKQA 1OYYA 3HXLA 2CFOA 4CA0A 2M4KA 4HZFA 3EYYA 1D8KA 1VQ9I 4XOPA 1MMGA 2KP6A 1HW1A 4KIGA 4CDGA 2RVCA 3HRSA 2LY9A 1LJ9A 2XF5A 2JMWA 4ZC3A 4G7ZF 2WV0A 3I3LA 3M8EA 4RLFA 2M8EA 1DP7P 1KU9A 5E79C 4HNVA 3DCFA 1U2WA 2K5CA 4OIOF 3PFYA 4UUTA 3PUFA 2CV2A 3DBLB 5LGUA 3GZ5A 2M7AA 3EYIA 1XD7A 1HCRA 1BC7C 3FM3A 2OAZA 2LD5A 1H9GA 1ZGAA 2K4JA 4E6KG 4ENJA 3BJOA 2BY0A 1JT6A 3LNQA 4KMUX 2M2EA 2R7XA 2GIVA 2HWVA 5EGOB 1AKHB 4G7HF 3K0LA 2H6BA 4N4NB 1F43A 1WCMJ 2IGMA 2GWRA 3WU2C 4BJ6C 1G4DA 1XGSA 4LG3A 3K2AA 4IHYA 3JSPA 2RNGA 4EV0A 1TNTA 1Z7LA 1N77A 2QLZA 2M4GA 2OZUA 2ME6A 2ADUA 2R7UA 1T38A 3A0BC 1YE9A 3S2DJ 1X1PA 2ISZA 1QPMA 3EUKL 4Z2YA 3FHZA 2KRFA 2QWWA 1W5TA 2CJJA 1CF7B 2VASA 4B1RA 3QWLA 3PO2J 4AVPA 3GYHX 2I8DA 5CVUA 1VQ4I 1STZA 4CYDA 1JHHA 3HSRA 1QRYA 2DA3A 3IP4B 5FD6A 1N75A 1Y39A 4IHWA 2WAQN 3ECOA 1QGPA 3S16J 3X2QH 3GLLA 1POGA 2KISA 4L9VA 2EB7A 2Y48A 3IKVA 1AA7A 2E2JJ 2EZLA 1KGSA 2JWTA 5L3DA 4LLGF 2W25A 3B73A 4IJAA 1WJAA 4IQJA 2LMDA 1XC5A 4ANJA 3FXJA 2DA7A 2ZCWA 1ZRDA 1UHSA 5B1AH 2EBIA 2GZWA 4XL9A 1HBXG 2LKSA 2BW3A 1G6NA 1IRGA 3AG1H 2VJJA 1B59A 4NQWB 2LP0A 3DLLF 1P9QC 2E1OA 1D5YA 2XGEA 4A3LJ 1FOWA 2WB1N 2VBXA 5E1XA 4BDZA 2K27A 3H35A 3OOUA 4DBQA 4RM3A 1I5ZA 3FISA 1R7JA 5C3EJ 2VC1A 3K1NA 4F55A 3S1MJ 2KPMA 4O5VA 2ESHA 1MNEA 3ZMSA 3CC2I 3TOAA 5LLQA 1LE8A 3S1RJ 2O7OA 4XIDA 2CU7A 3UNGC 3HYIA 2LTPA 4A69C 3KEYA 3RPUA 3IWZA 3AL0C 3S1NJ 3RIRA 4X0GA 2X6XA 3GF2A 4XOTA 1HDDC 2CQKA 1HKTA 4EJWA 2OA4A 4L9NA 2KIFA 4QPOA 2E1CA 3CUQC 1AU7A 1B8IB 3EUAA 5J8FA 4BBRJ 3HGGA 3HEFA 4RM2A 5IOYA 2R92J 3F8NA 3FXQA 2FBKA 5E20A 3CCQI 2DXIA 2F4MB 2XROA 1OYWA 1ZG3A 3N05A 4CCNA 3EPZA 1B6AA 2R7OA 2P4WA 5JI6A 2M5WA 3RZOJ 4FTHA 4NBQA 4XLHA 2R5ZB 3DTIA 3G3ZA 3IH3A 1Y0NA 3A01A 3HUGA 3LFUA 3FMSA 2L9RA 5J47A 4O6JA 2A61A 4BHPA 1IC8A 2EFQA 4XLAA 4JOMA 5FO5A 1KZHA 4H4KC 3BR5A 2ESNA 1RR8C 3E5QA 3I59B 3ZCOA 4BAYA 3DKXA 3G1LA 3KP3A 1JE8A 2HOAA 4I99C 2CH0A 5ILVA 3MAJA 3H0DA 1IN8A 4OINF 3JCUC 1E0EA 5HS9A 3LOCA 1R23A 1MZBA 4AM3A 3R60A 3CCYA 5TRDA 5LHIA 2O61A 4II2A 3S14J 2CV1A 5EEHA 4NQWA 2Q2EB 2ECCA 3GO5A 2HZDA 1FBUA 4I02A 2I5UA 4DNCA 3OYDA 3L9FA 3RDIA 3ZOBA 2FD5A 1W4MA 3PL8A 2M8GX 1MW7A 1QZZA 2MSYA 4IRHA 3M8FA 1HXDA 1SMYF 4Y13A 4GDFA 2MG4A 1D8JA 3CO7C 4KDPA 3MWMA 2A3SA 3B6CA 2XSDC 3SZTA 2OUMA 2D1HA 3Q0WA 4ZYHA 4M3EA 2CQNA 5FLXK 2UV1A 2L7MP 3IL2A 1ODDA 2DQLA 3GTQJ 2HXOA 5KAIC 1S8NA 4HA8A 5DM7F 1LPQA 2CG4A 3DEEA 3K1PA 3MKLA 1YI2I 2C6YA 2CQXA 3A03A 3F21A 4BE2A 2RQPA 3ZQCA 4R79A 1S29A 4B8XA 4XLPF 1RNLA 4M3BA 1K4SA 4RS8A 4BE1A 4BXXJ 3KFWX 5E3MA 2NS0A 3QOPA 4YRVA 4ABZA 3CCUI 4M9ZA 4ESFA 5JFRA 2K9NA 4A0YA 1LQ1A 5F0CA 5EYRA 2VQHA 1LFBA 1T56A 2QENA 1M1EB 1QO0D 2OQGA 3JRBA 2A6TA 2KHMA 4EJTA 3ERMA 3WTYC 4CICA 3AG4H 2NXNB 4C3HJ 1AOYA 1L0OC 2EA2A 2X1EA 2XAGA 3IV5A 2JSPA 2QF7A 4JBAA 1X3WB 4A3MJ 1ZR2A 1JT0A 1B9NA 3SDGA 2VE9A 4L5IA 4DYCA 5A2QZ 2R4GA 4HPQA 3HOSA 1R1UA 1V4RA 3ULQB 1J9IA 1D0YA 1Z1DA 3ZQ7A 3LSPA 4S0HB 4IZZA 4WCGA 5DYMA 2HOEA 2MABA 5LGNA 4ZYGA 2FSWA 1FPQA 2DFFA 4M74A 4PK4A 2EV6A 4HSRA 3LA2A 2WY8Q 4A3EJ 1TC3C 2R93J 1KQ9A 4BEHA 2BGCA 1JI8A 2R7QA 3VEPA 3S3NA 1KYWA 3ASNH 3TO6A 3BR6A 1PUEE 5HNFA 4U7BA 1TL8A 3GTPJ 1TQIA 3DKYA 4PJ0C 4EATA 3CCRI 2KL4A 1SAUA 4FX4A 1D1AA 4A3CJ 1U9NA 5CVJA 2UZKA 3S15J 1U5TA 5JHUA 2CGPA 1EF4A 1IGNA 4PGHA 3J7AO 3KP5A 3ML6A 4MFEA 4XMYA 2V1DA 5BS6A 2YU9J 5HDKA 1FMWA 1TT5B 2DU9A 3SDBA 4XRMA 3IUOA 1W5CC 2EINH 4W1UA 2CUJA 1S7EA 4I6ZA 3HOUJ 1XGOA 1TWGJ 4GYIA 4ENNA 2XPWA 1IV8A 5D5WB 2OCCH 4I0AA 4EJUA 1I1SA 1R58A 2P6TA 1ETOA 3HSEA 2COMA 2ZNZA 5FRMA 3QU3A 3KZZA 2B7EA 1HF0A 4E7HA 1YRNB 4NC6A 1JKRC 4D1QA 5TISC 1OR7C 4L5EA 6PAXA 4CCLA 2PFBA 3IAS2 2QBYB 1YW8A 2VXZA 4I01A 4UVAA 1FBSA 4AIDA 5FRNA 1TNSA 4MQVA 3LSKA 4RAGA 2QKMB 2R7DA 3HZJA 1CQTA 2V1UA 5HLIA 4BS9A 2FBHA 3OL4A 2QCOA 4DYQA 4LG0B 3BTCA 2RAEA 3CC4I 1MMDA 4HNTA 4P9FA 4F91B 3H5AA 2Z5UA 2KJCA 1MJAA 2FA5A 3FXUA 1YLFA 1A04A 4PZJA 1HSTA 3HOYJ 2WY7Q 2H1LA 2LG4A 2X6YA 4UXNA 5KK1A 3TOBA 2P7VB 2YU3A 2QUFA 1LEAA 4M3DA 5E3OA 1UG0A 4A0ZA 1XSXA 2OU2A 3P9IA 5ICFA 1VZ0A 1MBJA 3JRDA 2VQLA 3TL4X 4WF2A 2M0CA 3Q0VA 1ACIA 4E7JA 1MH3A 2MH9A 1O57A 3MKWB 3SHFA 4OU0A 2NVYJ 1IUFA 2BZTA 2X51A 3OY9A 3BG3A 2IS1A 5EG0A 3V4GA 4L9JA 3ELKA 3BR1A 2L01A 2NNYA 2W7NA 1XGNA 3CDLA 1FYLA 1SANA 2F4IA 1Z0XA 1WH5A 4XRFA 5KHDA 1IN7A 1BOBA 2DK5A 3IWFA 3Q3SA 4QIWN 3Q5FA 2CW8A 2ZC2A 3C2GA 1MDMA 3PSFA 3Q0UA 3EDPA 1XCBA 1SAXA 4IF4A 5F0HA 3F6OA 2IGKA 1MBFA 4HX8A 3DBHB 4KJZA 3V7RA 4JYKA 2DDAA 2R7RA 2HEOA 2VKDA 2KQRA 1P7IA 1GV2A 2UWMA 4YFNF 3CQZJ 4HQEA 2E2IJ 2BXZA 1ZN2A 1BW6A 3KZIC 1ZHFA 2HOTA 5F27A 3PO3J 3TQNA 3I56I 5H6QA 3M1EA 3GXOA 1C0WA 2IS4A 1BOAA 1R1TA 3F8BA 5M3MJ 5K5RA 1DGWY 3J7YJ 2DCEA 1K6YA 4FETA 2CV0A 5LRSA 1NK2P 2CQ7A 1P4AA 2LF8A 4AIHA 1VQNI 4FQGA 2EV0A 3CLOA 4DJAA 1SD7A 3AAFA 2VKVA 3DPTA 3CCLI 5ICCA 4KNYA 4UY8I 5E1WA 1SMTA 2Z2SB 3FXRA 5L3EA 1IDZA 1JUSA 2MC4A 4CCOA 1SFUA 3HPGA 4Y15A 4LK1F 2AQEA 2DTRA 5HVQC 2XRLA 4II3A 5FD5A 1WFXA 3CESA 4Y17A 1R49A 2IXSA 2Q0OA 3FF5A 3COAC 1BR2A 3B6AA 3Q9VA 4Y7NJ 3VFZA 3QPTA 2EIJH 1K61A 1FTZA 4HDUA 2OBPA 3OIOA 1MNMC 2O8KA 2NNNA 3DKWA 1W0TA 2OCEA 2IBDA 3HKZN 4GO1A 4RA2A 2XUBA 5ICGA 3CZ6A 2DFIA 4KFCA 1U5TC 5CQGA 4RGXA 3M9AA 3U1DA 3ABLH 1OMIA 2CSOA 4GRIA 4XSXF 4BJ5C 5EDNA 2GIZA 3VSKA 1ORKA 4RLQA 3TEDA 4A3KJ 1ZELA 3CLQA 4ESJA 2B63J 4XLEA 3LSIA 4WX9A 2NS7A 1GXQA 1UB9A 2YX7A 3ZMTA 2HQNA 4S04A 1RZ4A 4Q47A 3BG5A 3KP7A 3HL2A 1YOVB 2IW5A 1TWFJ 1WKMA 1ETQA 4PCQA 1CF7A 3F8MA 4C3IJ 2QA4I 5CPRB 3T8RA 2VODA 1FBQA 2HDDA 4QPQA 3FWEA 2JTVA 3LSJA 2NOGA 4CXFA 5ED4A 1VQPI 1KU7A 3BJAA 3VYSB 1K79A 5IT9K 3S2WA 1YS7A 2ZFWA 2ZJ2A 3TP3A 1F5TA 4CHUA 5M5WJ 1WGXA 2EFPA 2HDWA 2Q8KA 1FSHA 2R7ZJ 2HFHA 5BPIA 2WA0A 1LKXA 1SD4A 3OYMA 3L2RA 5DDGA 3GEZA 2F2EA 3L2VA 5JHFA 2KRHA 1H8AC 5ICEA 2IA1A 3ABTA 5GPAA 1F1ZA 5FFXA 2MD0A 3WODF 5HOOA 5ILUA 3AL0B 3SEZA 1Y6IA 2CWEA 2ECBA 1QZEA 4RGUA 1OFCX 2VUMJ 4AYBN 4IL6C 3LSMA 2FBIA 1EA3A 1FSEA 2IGNA 4C30A 1DU0A 3RTRA 1BM9A 5DCMA 4G8XA 4AVZA 2KT0A 3DLAA 3FIWA 1OCZH 2EFWA 3LSHA 1MGTA 2P5VA 4BY7J 1FOYA 4WK8F 3FXMA 5HS7A 2BW3B 3ZN0A 2ZJRF 1APLC 2Z33A 2ZSHB 1IN4A 1EV7A 5HNHA 3ABMH 1MMAA 2BHYA 1H89C 1QHGA 2NS8A 4P5OA 1R71A 3VWBA 1Q1VA 2DT6A 2UXXA 5CVVA 4AC0A 1FOXA 1ETXA 3FZVA 5F64A 1FIPA 2R7VA 3E0JB 9ANTA 3HRTA 1PYVA 5E1ZB 3DP7A 4HQMA 4HF0A 2P5KA 1YX3A 3BTLA 2VE8A 3PUBA 3LQQA 1T98A 3ZXSA 4EQQA 1QBJA 1G8XA 1WJEA 3S8PA 1V54H 2PMHA 4RBOA 5KVRA 2JA6J 4G6DA 3HPHA 2WV1A 3K70C 3ZMZA 4XONA 2HDCA 1BL0A 4MLOA 3ZMUA 2WWYA 2LLKA 1RC9A 4R1HA 2AQFA 1WHUA 5FKKA 4NUBA 4WXHA 3G73A 2HPIA 1FMVA 3CMAI 3V8LA 1S6LA 3HTSB 3NEUA 3BTIA 3HHHA 1PUFB 3HOZJ 3I9V2 1V3FA 2HYGD 1QNTA 2K85A 2KFDA 2HTSA 2LNBA 2ZJPF 1Z77A 3IC7A 1BBYA 4YIRX 2CW7A 3G4SI 2AO9A 2XPVA 1OISA 3BROA 4RAYA 1MSFC 1UELB 2EFOA 4BUPA 3T0YA 4KN7X 3QP6A 2FNAA 5E17F 2DDBA 3E6MA 4UUVA 2FMLA 2Z16A 2VKEA 3RKXA 4Q4ZF 1YJWI 1QVUA 2V1NA 2LYCA 4L18B 3BT9A 4P55A 4IEJA 4F93B 3LMMA 5EF6A 5BMZA 1USTA 1B4AA 2RC4A 2HQAA 1GV5A 1YG2A 5J6XA 1IG7A 2GA2A 4IKFA 1O3QA 2GA1A 3OMYA 1FC3A 1ETKA 2ICWG 1W36D 4BQAA 2RN7A 2QSGX 3HJEA 4M9XA 4LIVA 1BA5A 2E34A 2ZXIA 1VQ8I 3BWGA 1O3TA 1YRNA 4BY1J 3IH4A 3FBNB 4UV8A 2PLYA 5IYCJ 3FKJA 3Q9SA 2H1KA 1WPKA 3KEOA 2L7ZA 2K3PA 4PJJA 3HG9A 4G9YA 3GCMA 4ENKA 4E7LA 1SD5A 2KLOA 2KRCA 2R3SA 4HV6A 3RKWA 4EJOA 4PDKA 2BE5F 2M0MA 5H20A 3GWZA 5LEJA 1NH3A 2HTJA 3OSFA 1Q1HA 3OYAA 3G1MA 2H8RA 3AFHA 3PFIA 4D7MA 2EK5A 3M1CA 5D6EA 3VDXA 2O9LA 1LVKA 2D2WA 1RKTA 2VXDA 3H36A 2F5EA 1PDNC 2LDUA 1S9HA 1SEUA 1I50J 1XMXA 2BYVE 4PFPA 3KYCB 5IY5H 2QSHX 3F0CA 2RNJA 1LFPA 2XB0X 2OQRA 5F08A 2O03A 3RYPA 5K7HA 4LB5A 3MFKA 2E35A 2K86A 2XAJA 4QTRA 4E7KA 1S7AA 4W97A 1K78A 2GLOA 1DQUA 4HYEA 2LBFA 4A93J 1XSVA 4HSTA 1OCCH 5IP7J 4YG2F 4RMNA 3GFIA 3AG3H 5BQTA 3I53A 2K4BA 3O8HA 1WI3A 2WAQA 2H94A 1EH6A 4EMSA 3F3XA 1G3TA 1HSJA 3RSNA 1ONVA 2XASA 1FYMA 3E6CC 3KPHA 3T8TA 4ON0A 4A12A 4ZTFA 4G6QA 1V5GA 4C2UA 1MH4A 3PNVA 3KZYA 3W2WA 1FP2A 5F0FA 3W2VA 1BR1A 4A3FJ 1OPCA 3GTKJ 2QQAA 3CP2A 5HLHA 4XRSA 1WJFA 3WE2A 2NVQJ 5DV5A 4ZYAA 2X1DA 4A0XA 4EEFG 1FY7A 2P0WA 1E2XA 1U5TB 1UCRA 1WI9A 2AS5F 2BY3A 1WSUA 3OYLA 3FK7A 1A36A 5JLXA 2QM3A 3DEUA 4GGGA 3S2HJ 3OYGA 3QPSA 2FJ1A 3TKYA 1E3OC 1J7KA 4YIFA 2EV5A 4BEHB 2XPUA 1MJ9A 2GOMA 4HNUA 4FISA 3WU1B 1T0FA 1VQKI 3L00A 1BIBA 2FX0A 4MHGA 4ZZLA 3I64A 3GLXA 3GW2A 3GFJA 4P1WA 4BHBA 3LFKA 3A4CA 2M1BA 4ASNA 3BOQA 3LAJA 1WZ2A 1IXSB 3BCAA 3ZQGA 4CZZA 1UZCA 2QQBA 4FE7A 4BGDA 2Q2EA 1OKRA 2IAIA 3H5NA 1ZLJA 1USSA 4CO8A 5C4XJ 3KYDB 2DA2A 3V7CA 2YSRA 2YUSA 3QYBA 5IP9J 3WTVC 1P6RA 1SFEA 1RUOA 4IHVA 2MC3A 4P96A 1LDJA 2B0LA 1R5ID 2PX9A 3RQ4A 2D45A 4JQFA 2L2OA 2VJIA 4C3JJ 4YFKF 2XC7A 3A2KA 2JA2A 2ZMEA 2DMNA 2O3FA 3ZQHA 1T08B 3P9KA 1BIAA 1H88C 1Z67A 2HKXA 5IT3A 1Z05A 3LWFA 3GZNB 2EWNA 1SFOJ 2FNPA 3TO9A 4YIIA 5FB2A 1Z9CA 3FM5A 3JAMK 3SZPA 4BXFA 2A6EF 4KA4A 3J80Z 2DA6A 1U78A 3HHGA 4J19A 4MFDA 1I6XA 4XR6A 2XF7A 3D5RC 3HUGB 5LGTA 4A3JJ 2UUZA 1HA8A 5LD2C 2ZBKA 1IN6A 2M87A 2ELJA 3KYLA 3QYFA 2E5NA 4RB2C 3GVAA 2R0QC 2W1OA 4IXAA 3GTOJ 1O4XA 2N8GA 2ISYA 4HLXA 4XKCA 3U2RA 1UHWA 5DTDA 3DFGA 3I0TA 2O6GE 1V55H 2ZJQF 3T5XA 5CLSA 4L0YB 1TW2A 4GYGA 3I54A 3D0SA 5DM6F 2BVMA 3WG9A 1RRJA 4IRIA 3JRIA 1HLVA 4AIJA 2BXYA 3IAM2 4ZDOA 5HDNA 2L5QA 3FXLA 2VI6A 4XN0A 2JA5J 3HRUA 1IRFA 2JRTA 2DFHA 5GTHC 1ZH5A 4C2MJ 4KN4X 4Y4RA 4LMYA 3FXKA 4CCMA 2KZVA 3KE2A 1GVJA 2DOAA 1T39A 1R4MB 2NOJB 1SFKA 1G3YA 5LHGA 3JRAA 2KIMA 3OYCA 1BJAA 2P5LC 1B72B 1PVEA 3WTTC 4Q5SF 2X1CA 2R5YA 2Y31A 2K9SA 4BE0A 4B09A 1O7LA 1J09A 2O0YA 2KMUA 4RGSA 3H1CA 4MTDA 1EH8A 2VPLA 3GTGJ 3DTKA 2WADA 3DU6A 3K6GA 2VT3A 3BG9A 1JKOC 1MBKA 3KP2A 3TGNA 3MKZA 2HVSA 1U8BA 4DZJA 1FX7A 1R5GA 4Y33A 2A69F 3BPXA 3HM5A 4HF1A 1XS9A 4NC8A 3QPHA 2NVUB 5B3SH 2ZMEB 3CJTB 2LOOA 4FT8A 4CH7A 1P4XA 5D5XB 1R36A 2L3DA 2TDXA 2MFZA 4LLLA 5LHHA 5DUIA 1I3QJ 3KX2A 3I4MJ 1UAAA 3E7LA 3ABKH 4CGZA 1OLTA 3TW6A 4M71A 4OIPF 3OL3A 3WTSC 2QZ8A 3CDIA 2HXIA 4E7IA 4B3XA 3BZ6A 3LQRA 1UG2A 3ECHA 1LDDA 4I09A 1SVOA 2EZHA 5HODA 1I6HJ 2CS3A 2Y0SA 2G7HA 2HYJA 3VYRB 3KETA 5L3CA 2ZNYA 1TWCJ 2WBMA 2DQRA 1W0UA 5M5YJ 1VQ6I 1YS6A 2K9LA 3T1BA 2OTJI 2IS2A 2FXAA 3KP4A 1IUYA 1L3LA 1U0JA 1N78A 2E5ZA 2E19A 2MYSA 2QQ9A 5E8GA 5LRRA 2M3AA 3NQOA 4AUXA 1K78B 1J5YA 2IEKA 2ACJA 4UV9A 1MKMA 3GBGA 3ZMVA 4D5FA 2EQRA 1G3WA 3E6DA 2E60A 3H9GA 3GX4X 4BNCA 1HW5A 2QGUA 2V9VA 4YEJA 2PMUA 3FBIB 3FXOA 1YJNI 2JA7J 1PP8F 1NG6A 1A31A 3F6VA 1ZG5A 2LC2A 2CO5A 3G71I 3A01B 3JR9A 2P8TA 1BC8C 4DIQA 3K69A 3LSTA 2KDOA 5FKOA 3I58A 3R4KA 3HOTA 3V7SA 2HVQA 4D5CA 5J4YA 2ZSIB 1R5HA 3LA7A 5GTIC 2OF7A 1OCTC 3DU5A 2DO7A 1VQOI 1YW7A 5E3NA 4F52A 4LFUA 5BPDA 3F8FA 5E3LA 4LIUA 4HG2A 1IXCA 3H9QA 3LAPA 3CJNA 1IZ1A 3C2HA 5IOZA 4EGZA 5ERIA 1T8IA 3VPRA 4OAYA 3G6EI 4PJNA 5DCMB 1BI1A 2COBA 2OC6A 3QU6A 4PFOA 2EIKH 3ZN1A 2RKHA 4LD5A 3CJQB 1S5LC 3K4KA 1X1BA 3M4OJ 2M7BA 4XM3A 1XCVA 2DFEA 2QVOA 3HC7A 1XG1A 3HB9A 2DPUA 2ZO4A 3K4CA 4MQ9F 4IHSA 1S7OA 5HLGA 2VL8A 1A5JA 2CRGA 2MD5A 2E2HJ 4M9SA 1G3SA 2G9WA 5M3FJ 3HKZA 2V79A 1DDNA 4OAZA 4OIQF 3K4JA 2FU4A 3DXJF 3MQ0A 2L54A 1WJ5A 4NC7A 4KICA 3ZQFA 3OYJA 3F8CA 2MH2A 2XSJC 2KKOA 4X1EA 1TQMA 3DV8A 4ZZDA 4B3AA 4P9UA 2R7WA 2KJBA 1J0RA 1FOKA 2IS6A 2OD5A 1OYIA 4E7ZA 3C18A 4BU2A 4BBSJ 1MBGA 1BI0A 2K7LA 3H9JA 1D0XA 3KCCA 1X1DA 1J59A 3JREA 5L3BA 3OS2A 2E7WA 3DF8A 4V2GA 1NK3P 4MO7A 1ZG1A 4FASD 2Y9YA 5EG0B 4XKVA 3C1DA 1MD0A 2BY1A 3MN2A 2KZGA 1RKWA 4U88A 3BTJA 2V9KA 4IOCF 5J4VA 2HQ5A 5JLWA 3G1OA 4M73A 1MDMB 4E7SA 2GAUA 3QRFF 3J7AY 5M5XJ 2Y0SN 4UUSA 2FEZA 4B43A 1LDKB 2K3FA 4KT6A 2WC2A 4EM1A 3GTJJ 3CF5F 4R8HA 1JUMA 3BDDA 1G2HA 4L5JA 3CCEI 1E3PA 1ON2A 2JUGA 5AIPA 2CYYA 1JJ6C 2FRHA 4ZH4F 2NRAC 2A5YB 3PNYA 2MA3A 5AONA 2GXAA 4DQ2A 4N0BA 4A3DJ 2AXLA 2Z3YA 2PJPA 2E1NA 4U0YA 1LB2A 4OOIA 4XK4A 1QU3A 1MMNA 3RQIA 3A1YA 5CVIA 3SQNA 3WTUC 4C2TA 3TBIA 3OYBA 2HOSA 3CMMA 2NAZA 5B1BH 1EH7A 3SZGA 3PQKA 3N4MA 1BI3A 4M3GA 3R0AA 1TZLA 2Y30A 1I3AA 3VYTB 3IRQA 1QQIA 2XB5A 1MNDA 2BVLA 1MMSA 1W7PA 4XBFA 4HOBA 3ZP5A 1TLHB 5L3GA 2X6OA 2OZ6A 4KITB 5IYDJ 2VC0A 3C2BA 1XN7A 4J01A 1V5EA 1G59A 1PP7U 3U1KA 1VQ5I 1OQYA 2FQ3A 2GM4A 1KU2A 2MLKA 3CUOA 1O7FA 2EZKA 2OJED 4KUMA 3SJMA 2NVTJ 3FKIJ 5BNGA 2IA2A 4D0PA 3LL7A 3M3YJ 2JPBA 1IN5A 2OPTA 3K4BA 5F04A 1FEXA 2XAFA 1B1BA 1IDYA 3U21A 2X0LA 2HKOA 1TTYA 2M45A 5JVGF 3SFZA 4EGYA 1X1CA 2DBBA 1X3ZB 2EA4A 1IF1A 3RYRA 4ZYDA 5E8IA 2QQ8A 4GFBA 2YPRA 1BI2A 4HRIA 3KLOA 2FE3A 3D5LA 2J5PA 3OOPA 2STTA 2RQQA 3B02A 3ERED 1HW2A 2FOKA 1ZGJA 2E1MB 4UB6C 2MGQA 3FDYA 5KNLA 3IKTA 2VJ4A 1F9NA 4U7DA 3FMQA 3QQAA 2KDZA 2RREA 5DEQA 1MIJA 5CQEA 2L4AA 1A6QA 3KLNA 3CF2A 1FIAA 1YW9A 1PUFA 2BY2A 2QKLB 2D5VA 1A35A 1HDPA 1ETWA 3HTUA 4BKXA 1SVLA 3A0HC 1OCOH 4LOCA 2L0KA 2LRDA 3TDUC 3HOVJ 4BQOA 3JW4A 2BHZA 1XX5A 3KP6A 3K10A 1KQ8A 1WJBA 5EEAA 1TT0A 1WH7A 4EVIA 1X1AA 2K9MA 3NRVA 1YYVA 1ENHA 3O6BB 3VB2A 1ZQ3P 2E7XA 2L02A 1MBEA 2E71A 1X2NA 4KT5C 3L1PA 2VBWA 2H09A 3JTHA 5J3LA 1UJ8A 4N9IA 4UVBA 1DP3A 3L2WA 2FQ4A 3P7NA 4FHTA 5K1YA 1D1BA 5BOXA 3H0GJ 3O8GA 3W3CA 4CUGA 3KIOA 3S32A 2XIGA 3JSOA 3W6JB 2EJRA 4PSXA 2HI3A 2L9NA 1XDSA 2DYRH 3L2UA 3W6VA 2Q1ZB 3H92A 1S3JA 1WVRA 3TW7A 2LVSA 5H6RA 3PQJA 2M30A 5B66C 2JPCA 2L7KA 5LFAA 2F5FA 4AU7A 2STWA 1Z3YA 4V2FA 3F72A 5D8LB 2I10A 3J81K 3CTAA 1P92A 2KIQA 5GPCA 3OR1C 2W57A 1RUNA 2G0EA 4A5NA 4MEYF 1JUPA 3UKGA 2F6CA 1Z6RA 1QVTA 3R61A 3I4NJ 2F4OB 3BR2A 3MD2A 4ZTJA 2XGCA 1KA8A 3V8JA 2R7TA 5TGTA 2YX4A 3ZPLA 4KYWA 3VODA 1LE8B 1R6RA 4N9HA 2PJRA 2Y0MA 4E4HA 4KISA 2P81A 5J1UA 4EM0B 1I39A 2ME0A 3QP5A 1BR4A 3ASOH 4KIFA 3MKYB 3CMEI 2EIMH 2F5VA 2HZTA 3BP8A 3K1MA 3JRHA 2DTZA 2WB1A 1ZGWA 2Z9OA 4MIMA 2JJ7A 5C44J 1K7AA 4HX4A 3J80K 3K7AJ 2X4HA 1B8IA 1R22A 3ZMDA 4BL0B 4I2OA 2PBIA 2W24A 3V42A 4HF2A 2GXBA 4HAMA 2DN0A 3SFIA 4KMFA 1W36C 1Y8QB 5ILSA 3BQZA 1LVAA 1XDUA 2X9DA 1Z3XA 3L2CA 3LA3A 3WGIA 2JSCA 1YO5C 4L0ZB 2K40A 2A05A 2ELHA 2IA0A 3OIPA 4MEXF 3MVPA 2EZIA 3A02A 4U87A 2CQQA 1TQPA 4LJZF 4JX6A 1B72A 1Y1WJ 3OR2C 3S1QJ 4RB3C 1ZRFA 3O3KA 1GDTA 5E18F 3OYIA 1IAWA 2A5WA 4HLYA 1CGPA 3E6BA 2V6CA 4QSHA 2O8XA 3DWLE 2LR8A 3ROUA 1E3HA 1HKSA 1H0MA 3SXYA 1XPXA 3HDDA 4LLNA 2TCTA 1NG7A 4MTEA 1AWCA 5FKNA 3PNTA 2R7FA 4NNJA 4B47A 1FJLA 3J81Z 2VKHA 1WRJA 3BJ6A 2QEXI 2IT0A 1TP4A 4UB8C 1X2MA 2DJNA 1Z7UA 1Z21A 1N25A 3MZHA 3GFLA 5IPAA 1SVMA 4DZPA 2XF6A 4CYCA 3M7GA 4IHXA 2IJLA 3REOA 3WTXC 3BR0A 3ISPA 2XV4S 2PI0A 3BR3A 2IRFG 1U6GA 5DD4A 3HOWJ 2XAUA 4IHTA 1FLIA 2HS5A 3I4PA 4EJVA 3UR3C 4LGWA 2X6WA 4DOZA 3CUQA 2DW4A 4DYRA 5EZGA 3D1NI 2V7FA 5GAGJ 1RI7A 1K4TA 1YX5A 5J40A 4XLNF 4RAZA 3MZ8A 4GCVA 3IHUA 4G7OF 2LBFB 5LEKA 5K7ZA 1TWAJ 4Y3OA 2GXGA 4F7ZA 3OS1A 3EUHC 3JRGA 4AIKA 4M6XA 3K9TA 3IRRA 2XGDA 3C3WA 3E5XA 5J1YA 2LKXA 4V19K 4HX7A 2JT1A 2VJ5A 4ZJZA 2XDVA 2V9PA 5L3FA 1KONA 1O3SA 3CDHA 5D6FA 2DMUA 4Z6YA 2CUEA 2L9VA 4JX5A 3I5UA 2BBYA 3K4LA 3BLYA 3WG7H 1IXRC 5JVTA 1ON1A 5EEGA 3ZRGA 2HQRA 1YIJI 1YJ9I 2Y69H 4AWXB 5CJ9A 5HLTA 2BEOA 1XSDA 3TP0A 5FLVA 2L9SA 4IPAA 1F36A 3HGYA 4F3QA 2HPMA 2WAEA 4JX4A 5IP6A 2J5OA 1FWZA 2GBYA 5DD8A 2VPRA 1J75A 2YR2A 1T2KA 3G2BA 1DU6A 4IX7A 3TO7A 2R7SA 1FP1D 2VQCA 2W84A 4BQQA 2BV6A 2L4MA 2XKPA 3K4MA 3RPUD 1HC8A 3CCVI 5F1JA 3P9CA 1Z6TA 4NB5A 3EETA 1T33A 1R9TJ 4WXCA 4LB6B 1TW3A 3R0JA 2DYSH 4CZCA 3MZYA 3I55I 4M3FA 3ZGKA 4RB1A 4RDUA 5FKMA 5HS8A 4X6AJ 2DA4A 1I27A 2DMQA 1JTXA 1YIOA 2CMPA 2DJIA 1ITYA 2CUFA 4ZDPA 3ZQIA 4A6DA 4ETSA 1D0ZA 4XLFA 2B9SA 3BCBA 5A2QK 1HQCA 1E17A 2R5YB 1Y56A 1MBHA 2MLGA 4QLCU 3CO6C 4AD9A 4D7NA 1X19A 4BJTA 4JK1X 2DMTA 4U0WA 1ULYA 4BQNA 1OCRH 1RESA 1TWHJ 2DA1A 3H3UA 1YHQI 1Z91A 3KEQA 3QOEA 2OV7A 5CKTA 3K4NA 1D1CA 2A6HF 5AIQA 4E70A 3MCZA 4G94A 4PGGA 4Q48A 2LFBA 1P2FA 2DA5A 4G6TB 2Z1DA 5DUKA 3E97A 2FOWA 2VN2A 3S3MA 1FTTA 2HYFA 3CCSI 1X4PA 3E1SA 1JHFA 2E1MC 2HGCA 5KAFC 1YTYA 5D4SA 1OCPA 2GQQA 2QBYA 2CUZA 1IO2A 1JKQC 3V8KA 5CYVA 2VONA 1UHMA 1FNNA 2X48A 1EJ9A 4I98B 1BW5A 2W82A 1JGSA 3P5JA 2JVGA 5F6FA 5KCMA 1ERDA 5D5VB 3OIQA 3FMRA 1YITI 2EILH 3O2PE 2VBZA 5GADJ 3QODA 5FKLA 4HV5A 4WXDA 3BG6A 2CFXA 3C7JA 3W2AA 1ETYA 5J8CA 3DQVC 4L9TA 3K2ZA 4QWQA 4B4CA 1ZYRF 3ESWB 2HNHA 3SEQA 3U9GA 1W7PD 2XRNA 4XN3A
chains in the Genus database with same CATH topology
4BXUA 2WTEA 4OIRF 1XB4A 3WE3A 4BH9A 1XGMA 1DPRA 2PN6A 3H3ZA 1ZAOA 1P4WA 1R1VA 2P6SA 4KIBA 1VTNC 1DPUA 1KU3A 1FZPB 2F5DA 1ZLKA 3JAMZ 3N97A 3HSFA 5DCFA 4U0VA 1F4KA 1OR7A 2XGXA 3L09A 4K2EA 1XMAA 2KIUA 5TJJA 4HW0A 3WGHA 1Y0UA 2VOPA 5FLXZ 4A6EA 3QAHA 1TBXA 2V1XA 4LG0A 2ETHA 2XAHA 5FFZA 3MEXA 3GFMA 2QYOA 2D1VA 3OV8A 4MNUA 4WWCA 2FMYA 2DPDA 3GUDA 2XHKA 3WTWC 1T6SA 3TDZC 2DLLA 4ESBA 2A07F 2LSOA 4RGRA 1K6OA 1X3UA 4IRGA 4H0EA 4HBLA 4OMZA 2DT5A 2DAOA 1J2XA 3WTZA 4M72A 2IVMA 1I1GA 3EUHA 2DK8A 1ZRCA 2LF7A 1SFXA 1U8RA 1YQAA 3F22A 2P7CB 2VOOA 1KQ0A 2PEXA 1BN5A 5K5OA 1WWXA 1R00A 3RKYA 4A5MA 2A68F 4S05A 2PQ8A 2W85A 1UFMA 2XAQA 3DPLC 3BPVA 1W5SA 3I71A 1WQ2A 5D5UB 1GXPA 3BY6A 4NHJA 1XMKA 4YFXF 4M6YA 1YFHA 4FX0A 4LK0F 2G7UA 3CUQB 1O3RA 2ZXJA 2CW0F 3F23A 2XVCA 4MGRA 1W7PB 5IT9Z 3EQLF 4TV7A 2FF4A 1LNWA 2DI3A 1ZARA 3WGGA 5F1RA 4XSZF 1ZREA 4ENMA 1QZYA 2NYXA 2Y75A 5D8KB 1FT9A 1JXSA 4O3MA 1D3YA 3E5UA 4RB0A 3JTGA 2F5CA 2UXNA 5HDGA 2MBFA 1B9MA 5CVRA 3L7WA 3RPQA 4GXOA 1GHCA 2H6CA 1LEBA 1KYZA 4I7HA 4I0BA 4ZYEA 1FYKA 3RJPA 2H27A 5K5QA 1DUXC 3I59A 3RI4A 5FGMA 4BYYA 4BHCA 4EM2A 5JR3A 1D5VA 2PG4A 2JZYA 4HDVA 4UVCA 4OMYA 2RV8A 1NHAA 1MJBA 1SD6A 2ZKZA 2XKOA 3HRMA 1REPC 4A2UA 5D4RA 2EFNA 5LBQA 3R6SA 1RIOH 1U3EM 2VBYA 2LKPA 2VT2A 3ABUA 3GZ6A 4UNOA 2RGVA 2HR3A 3E3VA 2IPQX 3W6KB 1IW7F 3FX3A 3HIFA 3WU0A 4UHTA 2Z99A 2RDPA 2IP2A 2K02A 3VOEA 1H9TA 4IVNA 1HKQA 1OYYA 4HZFA 3EYYA 1D8KA 1HW1A 4KIGA 4CDGA 2RVCA 3HRSA 1LJ9A 4G7ZF 2WV0A 3M8EA 2M8EA 1DP7P 1KU9A 1U2WA 4OIOF 5LGUA 3GZ5A 3EYIA 1XD7A 1BC7C 3FM3A 2OAZA 1H9GA 1ZGAA 2K4JA 4ENJA 3BJOA 4KMUX 2GIVA 2HWVA 4G7HF 3K0LA 2H6BA 2GWRA 1G4DA 1XGSA 3JSPA 4EV0A 1TNTA 2QLZA 2OZUA 2ADUA 1T38A 2ISZA 1QPMA 4Z2YA 3FHZA 2KRFA 2QWWA 1W5TA 1CF7B 3GYHX 4AVPA 5CVUA 1STZA 4CYDA 1JHHA 3HSRA 5FD6A 3ECOA 1QGPA 4L9VA 2EB7A 2Y48A 3IKVA 1KGSA 5L3DA 4LLGF 2W25A 3B73A 4IJAA 2ZCWA 1ZRDA 2GZWA 1HBXG 1IRGA 1G6NA 1B59A 2VBXA 5E1XA 2K27A 1I5ZA 1R7JA 2VC1A 3K1NA 4O5VA 2ESHA 3ZMSA 3TOAA 5LLQA 3HYIA 3RPUA 3IWZA 3RIRA 3GF2A 2CQKA 1HKTA 4EJWA 2OA4A 4L9NA 2KIFA 2E1CA 3CUQC 5J8FA 3F8NA 3FXQA 2FBKA 5E20A 2XROA 1OYWA 1ZG3A 1B6AA 2P4WA 5JI6A 2M5WA 3G3ZA 3HUGA 3FMSA 4O6JA 2A61A 4BHPA 2EFQA 5FO5A 2ESNA 3E5QA 3I59B 4BAYA 3KP3A 1JE8A 5ILVA 3MAJA 1IN8A 4OINF 5HS9A 1R23A 1MZBA 3R60A 5TRDA 5LHIA 2O61A 5EEHA 4NQWA 3GO5A 4I02A 1FBUA 4DNCA 3L9FA 3RDIA 1W4MA 1QZZA 4IRHA 3M8FA 1HXDA 1SMYF 4Y13A 1D8JA 3CO7C 4KDPA 3MWMA 2A3SA 3SZTA 2D1HA 4ZYHA 5FLXK 3IL2A 1ODDA 2DQLA 1S8NA 4HA8A 2CG4A 3K1PA 2C6YA 3F21A 2RQPA 4R79A 1S29A 4B8XA 4XLPF 1RNLA 4RS8A 3KFWX 2NS0A 3QOPA 4M9ZA 4ESFA 5JFRA 4A0YA 1LQ1A 2QENA 1QO0D 2OQGA 4EJTA 3WTYC 4CICA 1AOYA 1L0OC 2EA2A 2XAGA 4JBAA 1B9NA 2VE9A 4L5IA 5A2QZ 3HOSA 1R1UA 1V4RA 3ULQB 1J9IA 1Z1DA 3ZQ7A 4WCGA 5DYMA 2HOEA 5LGNA 4ZYGA 2FSWA 1FPQA 4M74A 2EV6A 3LA2A 1KQ9A 2BGCA 3VEPA 1KYWA 3TO6A 1PUEE 4U7BA 1TQIA 4FX4A 5CVJA 2UZKA 1U5TA 5JHUA 2CGPA 4PGHA 3J7AO 3KP5A 3ML6A 2V1DA 5BS6A 5HDKA 2DU9A 1XGOA 4GYIA 4ENNA 5D5WB 4EJUA 4I0AA 1I1SA 1R58A 2P6TA 3HSEA 2COMA 2ZNZA 3QU3A 3KZZA 6PAXA 2PFBA 2QBYB 1YW8A 2VXZA 4I01A 4UVAA 1FBSA 1TNSA 4MQVA 2R7DA 2V1UA 5HLIA 2FBHA 4LG0B 4P9FA 2Z5UA 2KJCA 1MJAA 2FA5A 3FXUA 1YLFA 1A04A 4PZJA 1HSTA 4UXNA 5KK1A 3TOBA 2P7VB 2YU3A 2QUFA 1LEAA 4A0ZA 1XSXA 2OU2A 3P9IA 5ICFA 4WF2A 2MH9A 1O57A 3SHFA 4OU0A 3V4GA 4L9JA 3ELKA 2NNYA 2L01A 1XGNA 1FYLA 4XRFA 1IN7A 2DK5A 3IWFA 3Q5FA 1MDMA 3EDPA 1XCBA 1SAXA 4IF4A 3F6OA 4HX8A 3V7RA 2HEOA 2UWMA 4YFNF 4HQEA 1ZN2A 1ZHFA 3TQNA 5H6QA 3M1EA 3GXOA 1C0WA 1BOAA 1R1TA 3F8BA 5K5RA 5LRSA 1P4AA 2LF8A 4AIHA 2EV0A 3CLOA 1SD7A 3AAFA 3DPTA 5ICCA 4KNYA 5E1WA 1SMTA 5L3EA 3FXRA 1SFUA 4Y15A 4LK1F 5HVQC 2DTRA 5FD5A 4Y17A 2Q0OA 3FF5A 3COAC 3Q9VA 3VFZA 3QPTA 4HDUA 2OBPA 2NNNA 3DKWA 4GO1A 2XUBA 5ICGA 2DFIA 4KFCA 1U5TC 4RGXA 3M9AA 3U1DA 1OMIA 2CSOA 4XSXF 4ESJA 4WX9A 1GXQA 1UB9A 2YX7A 3ZMTA 2HQNA 4S04A 1RZ4A 4Q47A 3KP7A 2IW5A 1WKMA 4PCQA 1CF7A 3F8MA 3T8RA 2VODA 1FBQA 3FWEA 2JTVA 4CXFA 5ED4A 1KU7A 3BJAA 1K79A 5IT9K 3S2WA 1YS7A 2ZFWA 2ZJ2A 1F5TA 4CHUA 2EFPA 1FSHA 2Q8KA 2HFHA 5BPIA 1SD4A 5DDGA 3GEZA 2F2EA 5ICEA 2IA1A 3ABTA 1F1ZA 5FFXA 3WODF 5HOOA 5ILUA 2CWEA 4RGUA 2FBIA 1FSEA 3RTRA 1BM9A 5DCMA 4G8XA 2EFWA 1MGTA 2P5VA 4WK8F 5HS7A 3ZN0A 2Z33A 1IN4A 1EV7A 4P5OA 5CVVA 2UXXA 3FZVA 5F64A 3HRTA 5E1ZB 3DP7A 4HQMA 4HF0A 2P5KA 2VE8A 3LQQA 1T98A 4EQQA 1QBJA 2PMHA 5KVRA 4G6DA 3ZMZA 2HDCA 3ZMUA 2WWYA 4R1HA 4WXHA 3G73A 3V8LA 1S6LA 3HTSB 3NEUA 3HHHA 1V3FA 2HYGD 1QNTA 2HTSA 2LNBA 3IC7A 1BBYA 4RAYA 3BROA 2EFOA 3T0YA 4KN7X 3QP6A 2FNAA 5E17F 3E6MA 4UUVA 2FMLA 3RKXA 4Q4ZF 4L18B 4P55A 5BMZA 1USTA 1B4AA 2RC4A 1YG2A 5J6XA 2GA2A 1O3QA 2GA1A 1FC3A 4BQAA 2RN7A 4M9XA 3BWGA 1O3TA 4UV8A 2PLYA 3Q9SA 3KEOA 4ENKA 4G9YA 1SD5A 4HV6A 2R3SA 3RKWA 4EJOA 4PDKA 2BE5F 5H20A 3GWZA 5LEJA 2HTJA 1Q1HA 3PFIA 2EK5A 5D6EA 2D2WA 2F5EA 1PDNC 2LDUA 2BYVE 2RNJA 3RYPA 2OQRA 2O03A 4LB5A 3MFKA 2K86A 2XAJA 1S7AA 1K78A 4HYEA 1XSVA 4YG2F 3GFIA 5BQTA 3I53A 2K4BA 2H94A 1EH6A 4EMSA 3F3XA 1G3TA 1HSJA 1FYMA 1ONVA 2XASA 3E6CC 3T8TA 4ON0A 4A12A 4G6QA 3KZYA 1FP2A 1OPCA 2QQAA 5HLHA 3WE2A 5DV5A 4A0XA 1FY7A 1E2XA 1U5TB 1UCRA 1WI9A 2AS5F 1WSUA 2QM3A 3DEUA 4GGGA 3TKYA 1J7KA 4YIFA 2EV5A 1MJ9A 3WU1B 1T0FA 3L00A 1BIBA 4MHGA 4ZZLA 3I64A 3GLXA 3GW2A 3GFJA 4BHBA 3LFKA 2M1BA 4ASNA 3BOQA 3LAJA 1IXSB 4CZZA 2QQBA 2Q2EA 1OKRA 4CO8A 1ZLJA 1USSA 3V7CA 2YSRA 3WTVC 1P6RA 1SFEA 1RUOA 2MC3A 4P96A 1LDJA 2B0LA 2D45A 4JQFA 4YFKF 2ZMEA 2O3FA 3P9KA 1BIAA 2HKXA 5IT3A 1Z05A 3LWFA 2EWNA 2FNPA 3TO9A 4YIIA 5FB2A 1Z9CA 3FM5A 3JAMK 3SZPA 2A6EF 4KA4A 3J80Z 1U78A 3HHGA 1I6XA 5LGTA 2ZBKA 1IN6A 2M87A 4RB2C 3GVAA 4IXAA 2ISYA 4HLXA 3U2RA 1UHWA 3DFGA 3I0TA 2O6GE 3T5XA 5CLSA 4L0YB 1TW2A 4GYGA 3I54A 3D0SA 3WG9A 4IRIA 4AIJA 5HDNA 3HRUA 1IRFA 2JRTA 1ZH5A 4KN4X 4LMYA 3KE2A 1GVJA 1T39A 1G3YA 5LHGA 2KIMA 1BJAA 2P5LC 3WTTC 4Q5SF 4B09A 1O7LA 2O0YA 4RGSA 4MTDA 1EH8A 2VT3A 3KP2A 3TGNA 1FX7A 1R5GA 2A69F 3BPXA 4HF1A 3QPHA 2ZMEB 4FT8A 1P4XA 5D5XB 1R36A 2L3DA 2TDXA 5LHHA 4LLLA 5DUIA 4CGZA 4M71A 4OIPF 3WTSC 2QZ8A 3BZ6A 3LQRA 3ECHA 1LDDA 4I09A 2G7HA 3KETA 5L3CA 2ZNYA 2DQRA 1YS6A 3T1BA 2FXAA 3KP4A 1IUYA 1L3LA 1K78B 2QQ9A 5E8GA 5LRRA 3NQOA 1J5YA 2ACJA 4UV9A 1MKMA 3ZMVA 1G3WA 3E6DA 3GX4X 4BNCA 1HW5A 2V9VA 2PMUA 1PP8F 3F6VA 1ZG5A 2CO5A 2P8TA 1BC8C 3K69A 3LSTA 3I58A 3R4KA 3HOTA 3V7SA 1R5HA 3LA7A 2DO7A 1YW7A 4LFUA 5BPDA 3F8FA 1IXCA 3LAPA 3CJNA 1IZ1A 4EGZA 5ERIA 5DCMB 1BI1A 3QU6A 3ZN1A 2RKHA 4LD5A 1XCVA 2QVOA 2DPUA 2ZO4A 4MQ9F 4IHSA 1S7OA 5HLGA 2MD5A 4M9SA 2G9WA 1G3SA 2V79A 1DDNA 4OIQF 2FU4A 3DXJF 3MQ0A 2L54A 4KICA 3F8CA 2MH2A 2KKOA 1TQMA 3DV8A 4ZZDA 4P9UA 2KJBA 1FOKA 1J0RA 2OD5A 1OYIA 3C18A 1BI0A 2K7LA 3KCCA 1J59A 5L3BA 2E7WA 3DF8A 1ZG1A 3C1DA 1MD0A 4U88A 4M73A 1MDMB 2GAUA 3QRFF 2FEZA 1LDKB 4EM1A 2WC2A 4R8HA 3BDDA 4L5JA 1ON2A 5AIPA 2CYYA 2FRHA 4ZH4F 2NRAC 2A5YB 2MA3A 5AONA 4DQ2A 4N0BA 2AXLA 2Z3YA 2PJPA 2E1NA 4U0YA 1LB2A 4OOIA 5CVIA 3SQNA 3WTUC 2NAZA 1EH7A 3PQKA 3N4MA 1BI3A 3R0AA 3IRQA 1QQIA 1W7PA 4XBFA 4HOBA 3ZP5A 1TLHB 5L3GA 2OZ6A 2VC0A 1XN7A 1PP7U 2FQ3A 1KU2A 2MLKA 3CUOA 1O7FA 4KUMA 2IA2A 4D0PA 2JPBA 1IN5A 2XAFA 1B1BA 2X0LA 2HKOA 1TTYA 2M45A 3SFZA 4EGYA 2DBBA 2EA4A 1IF1A 3RYRA 4ZYDA 5E8IA 2YPRA 1BI2A 3KLOA 2FE3A 3D5LA 2J5PA 3OOPA 2STTA 3B02A 3ERED 1HW2A 2FOKA 1ZGJA 3IKTA 1F9NA 4U7DA 3FMQA 5DEQA 2L4AA 3KLNA 1YW9A 3HTUA 3TDUC 3JW4A 3KP6A 1KQ8A 4EVIA 3NRVA 1YYVA 3O6BB 3VB2A 2E7XA 2L02A 4KT5C 2VBWA 2H09A 3JTHA 4N9IA 4UVBA 3P7NA 4FHTA 5K1YA 5BOXA 2XIGA 3JSOA 3W6JB 2EJRA 1XDSA 3H92A 1S3JA 5H6RA 3PQJA 2M30A 2STWA 2JPCA 2F5FA 5D8LB 3F72A 3J81K 3CTAA 1P92A 1RUNA 2W57A 4A5NA 4MEYF 1Z6RA 3R61A 1KA8A 3V8JA 2YX4A 3ZPLA 4KYWA 3VODA 4N9HA 2Y0MA 4EM0B 3QP5A 4KIFA 2HZTA 3BP8A 3K1MA 2Z9OA 1K7AA 4HX4A 3J80K 2X4HA 1R22A 3ZMDA 4I2OA 2GXBA 2PBIA 2W24A 4HF2A 4HAMA 4KMFA 5ILSA 1LVAA 1XDUA 3L2CA 3LA3A 3WGIA 2JSCA 1YO5C 4L0ZB 2ELHA 2IA0A 4MEXF 1TQPA 4LJZF 4RB3C 1ZRFA 3O3KA 5E18F 1IAWA 4HLYA 1CGPA 3E6BA 2V6CA 2O8XA 3ROUA 1HKSA 1H0MA 3SXYA 4LLNA 4MTEA 1AWCA 2R7FA 3J81Z 2IT0A 1WRJA 3BJ6A 1Z7UA 3MZHA 3GFLA 3M7GA 2IJLA 3REOA 3WTXC 3ISPA 2XV4S 2PI0A 2IRFG 1U6GA 5DD4A 4IHTA 1FLIA 2HS5A 3I4PA 4EJVA 4LGWA 3CUQA 2DW4A 1RI7A 4XLNF 4RAZA 4GCVA 3IHUA 4G7OF 5LEKA 2GXGA 4F7ZA 4AIKA 4M6XA 3K9TA 3IRRA 3C3WA 3E5XA 4HX7A 2JT1A 5L3FA 1O3SA 3CDHA 5D6FA 3I5UA 2BBYA 1IXRC 5JVTA 1ON1A 5EEGA 2HQRA 4AWXB 5CJ9A 2BEOA 1XSDA 4IPAA 2J5OA 1FWZA 5DD8A 1J75A 2YR2A 1T2KA 3TO7A 1FP1D 2W84A 2BV6A 2L4MA 2XKPA 3P9CA 1Z6TA 4NB5A 3EETA 4WXCA 4LB6B 1TW3A 3R0JA 3MZYA 4RB1A 5HS8A 1I27A 1YIOA 4A6DA 4ETSA 5A2QK 1HQCA 1E17A 2MLGA 4QLCU 3CO6C 4AD9A 4JK1X 4U0WA 1ULYA 3H3UA 1Z91A 3KEQA 5AIQA 4E70A 2A6HF 3MCZA 4G94A 4PGGA 4Q48A 1P2FA 5DUKA 3E97A 2VN2A 2HYFA 1JHFA 2HGCA 1YTYA 5D4SA 2GQQA 2QBYA 3V8KA 5CYVA 2VONA 1UHMA 1FNNA 4I98B 1JGSA 5F6FA 5D5VB 3FMRA 3O2PE 2VBZA 4HV5A 4WXDA 2CFXA 3C7JA 5J8CA 3DQVC 4L9TA 3K2ZA 4QWQA 1ZYRF 3U9GA 1W7PD 2XRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXU A;  2WTE A;  4OIR F;  1XB4 A;  3WE3 A;  4BH9 A;  1XGM A;  1DPR A;  2PN6 A;  3H3Z A;  1ZAO A;  1P4W A;  1R1V A;  2P6S A;  4KIB A;  1VTN C;  1DPU A;  1KU3 A;  1FZP B;  2F5D A;  1ZLK A;  3JAM Z;  3N97 A;  3HSF A;  5DCF A;  4U0V A;  1F4K A;  1OR7 A;  2XGX A;  3L09 A;  4K2E A;  1XMA A;  2KIU A;  5TJJ A;  4HW0 A;  3WGH A;  1Y0U A;  2VOP A;  5FLX Z;  4A6E A;  3QAH A;  1TBX A;  2V1X A;  4LG0 A;  2ETH A;  2XAH A;  5FFZ A;  3MEX A;  3GFM A;  2QYO A;  2D1V A;  3OV8 A;  4MNU A;  4WWC A;  2FMY A;  2DPD A;  3GUD A;  2XHK A;  3WTW C;  1T6S A;  3TDZ C;  2DLL A;  4ESB A;  2A07 F;  2LSO A;  4RGR A;  1K6O A;  1X3U A;  4IRG A;  4H0E A;  4HBL A;  4OMZ A;  2DT5 A;  2DAO A;  1J2X A;  3WTZ A;  4M72 A;  2IVM A;  1I1G A;  3EUH A;  2DK8 A;  1ZRC A;  2LF7 A;  1SFX A;  1U8R A;  1YQA A;  3F22 A;  2P7C B;  2VOO A;  1KQ0 A;  2PEX A;  1BN5 A;  5K5O A;  1WWX A;  1R00 A;  3RKY A;  4A5M A;  2A68 F;  4S05 A;  2PQ8 A;  2W85 A;  1UFM A;  2XAQ A;  3DPL C;  3BPV A;  1W5S A;  3I71 A;  1WQ2 A;  5D5U B;  1GXP A;  3BY6 A;  4NHJ A;  1XMK A;  4YFX F;  4M6Y A;  1YFH A;  4FX0 A;  4LK0 F;  2G7U A;  3CUQ B;  1O3R A;  2ZXJ A;  2CW0 F;  3F23 A;  2XVC A;  4MGR A;  1W7P B;  5IT9 Z;  3EQL F;  4TV7 A;  2FF4 A;  1LNW A;  2DI3 A;  1ZAR A;  3WGG A;  5F1R A;  4XSZ F;  1ZRE A;  4ENM A;  1QZY A;  2NYX A;  2Y75 A;  5D8K B;  1FT9 A;  1JXS A;  4O3M A;  1D3Y A;  3E5U A;  4RB0 A;  3JTG A;  2F5C A;  2UXN A;  5HDG A;  2MBF A;  1B9M A;  5CVR A;  3L7W A;  3RPQ A;  4GXO A;  1GHC A;  2H6C A;  1LEB A;  1KYZ A;  4I7H A;  4I0B A;  4ZYE A;  1FYK A;  3RJP A;  2H27 A;  5K5Q A;  1DUX C;  3I59 A;  3RI4 A;  5FGM A;  4BYY A;  4BHC A;  4EM2 A;  5JR3 A;  1D5V A;  2PG4 A;  2JZY A;  4HDV A;  4UVC A;  4OMY A;  2RV8 A;  1NHA A;  1MJB A;  1SD6 A;  2ZKZ A;  2XKO A;  3HRM A;  1REP C;  4A2U A;  5D4R A;  2EFN A;  5LBQ A;  3R6S A;  1RIO H;  1U3E M;  2VBY A;  2LKP A;  2VT2 A;  3ABU A;  3GZ6 A;  4UNO A;  2RGV A;  2HR3 A;  3E3V A;  2IPQ X;  3W6K B;  1IW7 F;  3FX3 A;  3HIF A;  3WU0 A;  4UHT A;  2Z99 A;  2RDP A;  2IP2 A;  2K02 A;  3VOE A;  1H9T A;  4IVN A;  1HKQ A;  1OYY A;  4HZF A;  3EYY A;  1D8K A;  1HW1 A;  4KIG A;  4CDG A;  2RVC A;  3HRS A;  1LJ9 A;  4G7Z F;  2WV0 A;  3M8E A;  2M8E A;  1DP7 P;  1KU9 A;  1U2W A;  4OIO F;  5LGU A;  3GZ5 A;  3EYI A;  1XD7 A;  1BC7 C;  3FM3 A;  2OAZ A;  1H9G A;  1ZGA A;  2K4J A;  4ENJ A;  3BJO A;  4KMU X;  2GIV A;  2HWV A;  4G7H F;  3K0L A;  2H6B A;  2GWR A;  1G4D A;  1XGS A;  3JSP A;  4EV0 A;  1TNT A;  2QLZ A;  2OZU A;  2ADU A;  1T38 A;  2ISZ A;  1QPM A;  4Z2Y A;  3FHZ A;  2KRF A;  2QWW A;  1W5T A;  1CF7 B;  3GYH X;  4AVP A;  5CVU A;  1STZ A;  4CYD A;  1JHH A;  3HSR A;  5FD6 A;  3ECO A;  1QGP A;  4L9V A;  2EB7 A;  2Y48 A;  3IKV A;  1KGS A;  5L3D A;  4LLG F;  2W25 A;  3B73 A;  4IJA A;  2ZCW A;  1ZRD A;  2GZW A;  1HBX G;  1IRG A;  1G6N A;  1B59 A;  2VBX A;  5E1X A;  2K27 A;  1I5Z A;  1R7J A;  2VC1 A;  3K1N A;  4O5V A;  2ESH A;  3ZMS A;  3TOA A;  5LLQ A;  3HYI A;  3RPU A;  3IWZ A;  3RIR A;  3GF2 A;  2CQK A;  1HKT A;  4EJW A;  2OA4 A;  4L9N A;  2KIF A;  2E1C A;  3CUQ C;  5J8F A;  3F8N A;  3FXQ A;  2FBK A;  5E20 A;  2XRO A;  1OYW A;  1ZG3 A;  1B6A A;  2P4W A;  5JI6 A;  2M5W A;  3G3Z A;  3HUG A;  3FMS A;  4O6J A;  2A61 A;  4BHP A;  2EFQ A;  5FO5 A;  2ESN A;  3E5Q A;  3I59 B;  4BAY A;  3KP3 A;  1JE8 A;  5ILV A;  3MAJ A;  1IN8 A;  4OIN F;  5HS9 A;  1R23 A;  1MZB A;  3R60 A;  5TRD A;  5LHI A;  2O61 A;  5EEH A;  4NQW A;  3GO5 A;  4I02 A;  1FBU A;  4DNC A;  3L9F A;  3RDI A;  1W4M A;  1QZZ A;  4IRH A;  3M8F A;  1HXD A;  1SMY F;  4Y13 A;  1D8J A;  3CO7 C;  4KDP A;  3MWM A;  2A3S A;  3SZT A;  2D1H A;  4ZYH A;  5FLX K;  3IL2 A;  1ODD A;  2DQL A;  1S8N A;  4HA8 A;  2CG4 A;  3K1P A;  2C6Y A;  3F21 A;  2RQP A;  4R79 A;  1S29 A;  4B8X A;  4XLP F;  1RNL A;  4RS8 A;  3KFW X;  2NS0 A;  3QOP A;  4M9Z A;  4ESF A;  5JFR A;  4A0Y A;  1LQ1 A;  2QEN A;  1QO0 D;  2OQG A;  4EJT A;  3WTY C;  4CIC A;  1AOY A;  1L0O C;  2EA2 A;  2XAG A;  4JBA A;  1B9N A;  2VE9 A;  4L5I A;  5A2Q Z;  3HOS A;  1R1U A;  1V4R A;  3ULQ B;  1J9I A;  1Z1D A;  3ZQ7 A;  4WCG A;  5DYM A;  2HOE A;  5LGN A;  4ZYG A;  2FSW A;  1FPQ A;  4M74 A;  2EV6 A;  3LA2 A;  1KQ9 A;  2BGC A;  3VEP A;  1KYW A;  3TO6 A;  1PUE E;  4U7B A;  1TQI A;  4FX4 A;  5CVJ A;  2UZK A;  1U5T A;  5JHU A;  2CGP A;  4PGH A;  3J7A O;  3KP5 A;  3ML6 A;  2V1D A;  5BS6 A;  5HDK A;  2DU9 A;  1XGO A;  4GYI A;  4ENN A;  5D5W B;  4EJU A;  4I0A A;  1I1S A;  1R58 A;  2P6T A;  3HSE A;  2COM A;  2ZNZ A;  3QU3 A;  3KZZ A;  6PAX A;  2PFB A;  2QBY B;  1YW8 A;  2VXZ A;  4I01 A;  4UVA A;  1FBS A;  1TNS A;  4MQV A;  2R7D A;  2V1U A;  5HLI A;  2FBH A;  4LG0 B;  4P9F A;  2Z5U A;  2KJC A;  1MJA A;  2FA5 A;  3FXU A;  1YLF A;  1A04 A;  4PZJ A;  1HST A;  4UXN A;  5KK1 A;  3TOB A;  2P7V B;  2YU3 A;  2QUF A;  1LEA A;  4A0Z A;  1XSX A;  2OU2 A;  3P9I A;  5ICF A;  4WF2 A;  2MH9 A;  1O57 A;  3SHF A;  4OU0 A;  3V4G A;  4L9J A;  3ELK A;  2NNY A;  2L01 A;  1XGN A;  1FYL A;  4XRF A;  1IN7 A;  2DK5 A;  3IWF A;  3Q5F A;  1MDM A;  3EDP A;  1XCB A;  1SAX A;  4IF4 A;  3F6O A;  4HX8 A;  3V7R A;  2HEO A;  2UWM A;  4YFN F;  4HQE A;  1ZN2 A;  1ZHF A;  3TQN A;  5H6Q A;  3M1E A;  3GXO A;  1C0W A;  1BOA A;  1R1T A;  3F8B A;  5K5R A;  5LRS A;  1P4A A;  2LF8 A;  4AIH A;  2EV0 A;  3CLO A;  1SD7 A;  3AAF A;  3DPT A;  5ICC A;  4KNY A;  5E1W A;  1SMT A;  5L3E A;  3FXR A;  1SFU A;  4Y15 A;  4LK1 F;  5HVQ C;  2DTR A;  5FD5 A;  4Y17 A;  2Q0O A;  3FF5 A;  3COA C;  3Q9V A;  3VFZ A;  3QPT A;  4HDU A;  2OBP A;  2NNN A;  3DKW A;  4GO1 A;  2XUB A;  5ICG A;  2DFI A;  4KFC A;  1U5T C;  4RGX A;  3M9A A;  3U1D A;  1OMI A;  2CSO A;  4XSX F;  4ESJ A;  4WX9 A;  1GXQ A;  1UB9 A;  2YX7 A;  3ZMT A;  2HQN A;  4S04 A;  1RZ4 A;  4Q47 A;  3KP7 A;  2IW5 A;  1WKM A;  4PCQ A;  1CF7 A;  3F8M A;  3T8R A;  2VOD A;  1FBQ A;  3FWE A;  2JTV A;  4CXF A;  5ED4 A;  1KU7 A;  3BJA A;  1K79 A;  5IT9 K;  3S2W A;  1YS7 A;  2ZFW A;  2ZJ2 A;  1F5T A;  4CHU A;  2EFP A;  1FSH A;  2Q8K A;  2HFH A;  5BPI A;  1SD4 A;  5DDG A;  3GEZ A;  2F2E A;  5ICE A;  2IA1 A;  3ABT A;  1F1Z A;  5FFX A;  3WOD F;  5HOO A;  5ILU A;  2CWE A;  4RGU A;  2FBI A;  1FSE A;  3RTR A;  1BM9 A;  5DCM A;  4G8X A;  2EFW A;  1MGT A;  2P5V A;  4WK8 F;  5HS7 A;  3ZN0 A;  2Z33 A;  1IN4 A;  1EV7 A;  4P5O A;  5CVV A;  2UXX A;  3FZV A;  5F64 A;  3HRT A;  5E1Z B;  3DP7 A;  4HQM A;  4HF0 A;  2P5K A;  2VE8 A;  3LQQ A;  1T98 A;  4EQQ A;  1QBJ A;  2PMH A;  5KVR A;  4G6D A;  3ZMZ A;  2HDC A;  3ZMU A;  2WWY A;  4R1H A;  4WXH A;  3G73 A;  3V8L A;  1S6L A;  3HTS B;  3NEU A;  3HHH A;  1V3F A;  2HYG D;  1QNT A;  2HTS A;  2LNB A;  3IC7 A;  1BBY A;  4RAY A;  3BRO A;  2EFO A;  3T0Y A;  4KN7 X;  3QP6 A;  2FNA A;  5E17 F;  3E6M A;  4UUV A;  2FML A;  3RKX A;  4Q4Z F;  4L18 B;  4P55 A;  5BMZ A;  1UST A;  1B4A A;  2RC4 A;  1YG2 A;  5J6X A;  2GA2 A;  1O3Q A;  2GA1 A;  1FC3 A;  4BQA A;  2RN7 A;  4M9X A;  3BWG A;  1O3T A;  4UV8 A;  2PLY A;  3Q9S A;  3KEO A;  4ENK A;  4G9Y A;  1SD5 A;  4HV6 A;  2R3S A;  3RKW A;  4EJO A;  4PDK A;  2BE5 F;  5H20 A;  3GWZ A;  5LEJ A;  2HTJ A;  1Q1H A;  3PFI A;  2EK5 A;  5D6E A;  2D2W A;  2F5E A;  1PDN C;  2LDU A;  2BYV E;  2RNJ A;  3RYP A;  2OQR A;  2O03 A;  4LB5 A;  3MFK A;  2K86 A;  2XAJ A;  1S7A A;  1K78 A;  4HYE A;  1XSV A;  4YG2 F;  3GFI A;  5BQT A;  3I53 A;  2K4B A;  2H94 A;  1EH6 A;  4EMS A;  3F3X A;  1G3T A;  1HSJ A;  1FYM A;  1ONV A;  2XAS A;  3E6C C;  3T8T A;  4ON0 A;  4A12 A;  4G6Q A;  3KZY A;  1FP2 A;  1OPC A;  2QQA A;  5HLH A;  3WE2 A;  5DV5 A;  4A0X A;  1FY7 A;  1E2X A;  1U5T B;  1UCR A;  1WI9 A;  2AS5 F;  1WSU A;  2QM3 A;  3DEU A;  4GGG A;  3TKY A;  1J7K A;  4YIF A;  2EV5 A;  1MJ9 A;  3WU1 B;  1T0F A;  3L00 A;  1BIB A;  4MHG A;  4ZZL A;  3I64 A;  3GLX A;  3GW2 A;  3GFJ A;  4BHB A;  3LFK A;  2M1B A;  4ASN A;  3BOQ A;  3LAJ A;  1IXS B;  4CZZ A;  2QQB A;  2Q2E A;  1OKR A;  4CO8 A;  1ZLJ A;  1USS A;  3V7C A;  2YSR A;  3WTV C;  1P6R A;  1SFE A;  1RUO A;  2MC3 A;  4P96 A;  1LDJ A;  2B0L A;  2D45 A;  4JQF A;  4YFK F;  2ZME A;  2O3F A;  3P9K A;  1BIA A;  2HKX A;  5IT3 A;  1Z05 A;  3LWF A;  2EWN A;  2FNP A;  3TO9 A;  4YII A;  5FB2 A;  1Z9C A;  3FM5 A;  3JAM K;  3SZP A;  2A6E F;  4KA4 A;  3J80 Z;  1U78 A;  3HHG A;  1I6X A;  5LGT A;  2ZBK A;  1IN6 A;  2M87 A;  4RB2 C;  3GVA A;  4IXA A;  2ISY A;  4HLX A;  3U2R A;  1UHW A;  3DFG A;  3I0T A;  2O6G E;  3T5X A;  5CLS A;  4L0Y B;  1TW2 A;  4GYG A;  3I54 A;  3D0S A;  3WG9 A;  4IRI A;  4AIJ A;  5HDN A;  3HRU A;  1IRF A;  2JRT A;  1ZH5 A;  4KN4 X;  4LMY A;  3KE2 A;  1GVJ A;  1T39 A;  1G3Y A;  5LHG A;  2KIM A;  1BJA A;  2P5L C;  3WTT C;  4Q5S F;  4B09 A;  1O7L A;  2O0Y A;  4RGS A;  4MTD A;  1EH8 A;  2VT3 A;  3KP2 A;  3TGN A;  1FX7 A;  1R5G A;  2A69 F;  3BPX A;  4HF1 A;  3QPH A;  2ZME B;  4FT8 A;  1P4X A;  5D5X B;  1R36 A;  2L3D A;  2TDX A;  5LHH A;  4LLL A;  5DUI A;  4CGZ A;  4M71 A;  4OIP F;  3WTS C;  2QZ8 A;  3BZ6 A;  3LQR A;  3ECH A;  1LDD A;  4I09 A;  2G7H A;  3KET A;  5L3C A;  2ZNY A;  2DQR A;  1YS6 A;  3T1B A;  2FXA A;  3KP4 A;  1IUY A;  1L3L A;  1K78 B;  2QQ9 A;  5E8G A;  5LRR A;  3NQO A;  1J5Y A;  2ACJ A;  4UV9 A;  1MKM A;  3ZMV A;  1G3W A;  3E6D A;  3GX4 X;  4BNC A;  1HW5 A;  2V9V A;  2PMU A;  1PP8 F;  3F6V A;  1ZG5 A;  2CO5 A;  2P8T A;  1BC8 C;  3K69 A;  3LST A;  3I58 A;  3R4K A;  3HOT A;  3V7S A;  1R5H A;  3LA7 A;  2DO7 A;  1YW7 A;  4LFU A;  5BPD A;  3F8F A;  1IXC A;  3LAP A;  3CJN A;  1IZ1 A;  4EGZ A;  5ERI A;  5DCM B;  1BI1 A;  3QU6 A;  3ZN1 A;  2RKH A;  4LD5 A;  1XCV A;  2QVO A;  2DPU A;  2ZO4 A;  4MQ9 F;  4IHS A;  1S7O A;  5HLG A;  2MD5 A;  4M9S A;  2G9W A;  1G3S A;  2V79 A;  1DDN A;  4OIQ F;  2FU4 A;  3DXJ F;  3MQ0 A;  2L54 A;  4KIC A;  3F8C A;  2MH2 A;  2KKO A;  1TQM A;  3DV8 A;  4ZZD A;  4P9U A;  2KJB A;  1FOK A;  1J0R A;  2OD5 A;  1OYI A;  3C18 A;  1BI0 A;  2K7L A;  3KCC A;  1J59 A;  5L3B A;  2E7W A;  3DF8 A;  1ZG1 A;  3C1D A;  1MD0 A;  4U88 A;  4M73 A;  1MDM B;  2GAU A;  3QRF F;  2FEZ A;  1LDK B;  4EM1 A;  2WC2 A;  4R8H A;  3BDD A;  4L5J A;  1ON2 A;  5AIP A;  2CYY A;  2FRH A;  4ZH4 F;  2NRA C;  2A5Y B;  2MA3 A;  5AON A;  4DQ2 A;  4N0B A;  2AXL A;  2Z3Y A;  2PJP A;  2E1N A;  4U0Y A;  1LB2 A;  4OOI A;  5CVI A;  3SQN A;  3WTU C;  2NAZ A;  1EH7 A;  3PQK A;  3N4M A;  1BI3 A;  3R0A A;  3IRQ A;  1QQI A;  1W7P A;  4XBF A;  4HOB A;  3ZP5 A;  1TLH B;  5L3G A;  2OZ6 A;  2VC0 A;  1XN7 A;  1PP7 U;  2FQ3 A;  1KU2 A;  2MLK A;  3CUO A;  1O7F A;  4KUM A;  2IA2 A;  4D0P A;  2JPB A;  1IN5 A;  2XAF A;  1B1B A;  2X0L A;  2HKO A;  1TTY A;  2M45 A;  3SFZ A;  4EGY A;  2DBB A;  2EA4 A;  1IF1 A;  3RYR A;  4ZYD A;  5E8I A;  2YPR A;  1BI2 A;  3KLO A;  2FE3 A;  3D5L A;  2J5P A;  3OOP A;  2STT A;  3B02 A;  3ERE D;  1HW2 A;  2FOK A;  1ZGJ A;  3IKT A;  1F9N A;  4U7D A;  3FMQ A;  5DEQ A;  2L4A A;  3KLN A;  1YW9 A;  3HTU A;  3TDU C;  3JW4 A;  3KP6 A;  1KQ8 A;  4EVI A;  3NRV A;  1YYV A;  3O6B B;  3VB2 A;  2E7X A;  2L02 A;  4KT5 C;  2VBW A;  2H09 A;  3JTH A;  4N9I A;  4UVB A;  3P7N A;  4FHT A;  5K1Y A;  5BOX A;  2XIG A;  3JSO A;  3W6J B;  2EJR A;  1XDS A;  3H92 A;  1S3J A;  5H6R A;  3PQJ A;  2M30 A;  2STW A;  2JPC A;  2F5F A;  5D8L B;  3F72 A;  3J81 K;  3CTA A;  1P92 A;  1RUN A;  2W57 A;  4A5N A;  4MEY F;  1Z6R A;  3R61 A;  1KA8 A;  3V8J A;  2YX4 A;  3ZPL A;  4KYW A;  3VOD A;  4N9H A;  2Y0M A;  4EM0 B;  3QP5 A;  4KIF A;  2HZT A;  3BP8 A;  3K1M A;  2Z9O A;  1K7A A;  4HX4 A;  3J80 K;  2X4H A;  1R22 A;  3ZMD A;  4I2O A;  2GXB A;  2PBI A;  2W24 A;  4HF2 A;  4HAM A;  4KMF A;  5ILS A;  1LVA A;  1XDU A;  3L2C A;  3LA3 A;  3WGI A;  2JSC A;  1YO5 C;  4L0Z B;  2ELH A;  2IA0 A;  4MEX F;  1TQP A;  4LJZ F;  4RB3 C;  1ZRF A;  3O3K A;  5E18 F;  1IAW A;  4HLY A;  1CGP A;  3E6B A;  2V6C A;  2O8X A;  3ROU A;  1HKS A;  1H0M A;  3SXY A;  4LLN A;  4MTE A;  1AWC A;  2R7F A;  3J81 Z;  2IT0 A;  1WRJ A;  3BJ6 A;  1Z7U A;  3MZH A;  3GFL A;  3M7G A;  2IJL A;  3REO A;  3WTX C;  3ISP A;  2XV4 S;  2PI0 A;  2IRF G;  1U6G A;  5DD4 A;  4IHT A;  1FLI A;  2HS5 A;  3I4P A;  4EJV A;  4LGW A;  3CUQ A;  2DW4 A;  1RI7 A;  4XLN F;  4RAZ A;  4GCV A;  3IHU A;  4G7O F;  5LEK A;  2GXG A;  4F7Z A;  4AIK A;  4M6X A;  3K9T A;  3IRR A;  3C3W A;  3E5X A;  4HX7 A;  2JT1 A;  5L3F A;  1O3S A;  3CDH A;  5D6F A;  3I5U A;  2BBY A;  1IXR C;  5JVT A;  1ON1 A;  5EEG A;  2HQR A;  4AWX B;  5CJ9 A;  2BEO A;  1XSD A;  4IPA A;  2J5O A;  1FWZ A;  5DD8 A;  1J75 A;  2YR2 A;  1T2K A;  3TO7 A;  1FP1 D;  2W84 A;  2BV6 A;  2L4M A;  2XKP A;  3P9C A;  1Z6T A;  4NB5 A;  3EET A;  4WXC A;  4LB6 B;  1TW3 A;  3R0J A;  3MZY A;  4RB1 A;  5HS8 A;  1I27 A;  1YIO A;  4A6D A;  4ETS A;  5A2Q K;  1HQC A;  1E17 A;  2MLG A;  4QLC U;  3CO6 C;  4AD9 A;  4JK1 X;  4U0W A;  1ULY A;  3H3U A;  1Z91 A;  3KEQ A;  5AIQ A;  4E70 A;  2A6H F;  3MCZ A;  4G94 A;  4PGG A;  4Q48 A;  1P2F A;  5DUK A;  3E97 A;  2VN2 A;  2HYF A;  1JHF A;  2HGC A;  1YTY A;  5D4S A;  2GQQ A;  2QBY A;  3V8K A;  5CYV A;  2VON A;  1UHM A;  1FNN A;  4I98 B;  1JGS A;  5F6F A;  5D5V B;  3FMR A;  3O2P E;  2VBZ A;  4HV5 A;  4WXD A;  2CFX A;  3C7J A;  5J8C A;  3DQV C;  4L9T A;  3K2Z A;  4QWQ A;  1ZYR F;  3U9G A;  1W7P D;  2XRN A; 
#chains in the Genus database with same CATH topology
 4BXU A;  2AXT C;  1ZR4 A;  2WTE A;  1X4O A;  4OIR F;  1XB4 A;  4F92 B;  3WE3 A;  4BH9 A;  1XGM A;  3MMY B;  2R5Z A;  1DPR A;  3PIP F;  2PN6 A;  3H3Z A;  1ZAO A;  1WJD A;  4PSW A;  4IO9 F;  1P4W A;  1QA6 A;  1R1V A;  2HU9 A;  2P6S A;  4KIB A;  3OS0 A;  1VTN C;  1OJL A;  4C9Y A;  1DPU A;  4UUS B;  3NWT A;  1KU3 A;  4DBR A;  1FZP B;  1VQL I;  3H5R A;  1QPI A;  2F5D A;  1ZLK A;  4XKW A;  2DT7 B;  2V6E A;  3SYT A;  4D9J A;  3K70 D;  2BOL A;  3JAM Z;  4XRS G;  3N97 A;  3HSF A;  5DCF A;  5B5E C;  4U0V A;  5GP9 A;  4BDY A;  1F4K A;  1OR7 A;  4J00 A;  2XGX A;  3CMY A;  3AG2 H;  2JRM A;  1S72 I;  1JJ8 C;  3L09 A;  2W48 A;  2GOX B;  4K2E A;  1XMA A;  1R4N B;  2ID3 A;  3LSR A;  2FUG 2;  3RZD J;  2KIU A;  1VI0 A;  4PUS A;  5TJJ A;  4HW0 A;  3RKQ A;  4NDL A;  3WGH A;  2ELK A;  1Y1V J;  4XQF A;  1Y0U A;  4A3I J;  4JP0 A;  4A3B J;  2VOP A;  2W00 A;  5FLX Z;  4A6E A;  3QAH A;  1TBX A;  2V1X A;  1BJZ A;  2W4S A;  4LG0 A;  2ETH A;  2XAH A;  5FFZ A;  3MEX A;  3PM1 A;  3GFM A;  2V4J C;  1IRZ A;  2QYO A;  2D1V A;  4BAC A;  3PSI A;  3ONQ A;  3OV8 A;  4MNU A;  4WWC A;  1IV6 A;  3VSL A;  2FMY A;  2DPD A;  3HBL A;  1A6I A;  3GUD A;  3PIO F;  2XHK A;  3ZR8 X;  3WTW C;  2WAF A;  3WHC A;  4YEL A;  1T6S A;  3TDZ C;  2IGO A;  2M9H A;  4IQ4 A;  2DOF A;  2DLL A;  2ZFU A;  3BG7 A;  2ID6 A;  4ESB A;  5K7F A;  4N4O B;  2A07 F;  2LSO A;  4RGR A;  1K6O A;  3NWS A;  1X3U A;  4IRG A;  1AKH A;  3CD6 I;  4H0E A;  4HBL A;  4OMZ A;  2DT5 A;  2DAO A;  1GT0 C;  3FHN A;  1RET A;  1J2X A;  3WTZ A;  3OYE A;  4M72 A;  2IVM A;  1I1G A;  2AHQ A;  3EUH A;  2DK8 A;  1ZRC A;  1DGR M;  1UMQ A;  1ETV A;  4PJM A;  1T95 A;  3M8J A;  1QHH D;  2JVH A;  2LF7 A;  1SC7 A;  1XTA A;  2MW8 A;  1SFX A;  3L2Q A;  1U8R A;  1AHD P;  1YQA A;  3BZC A;  5FLM J;  2VLA A;  2Y9Z A;  3F22 A;  4B44 A;  2YS9 A;  2P7C B;  2VOO A;  1KQ0 A;  1GUU A;  3OYF A;  5EJC A;  2PEX A;  1BN5 A;  5IYB J;  2X85 A;  5K5O A;  1WWX A;  1JTY A;  1K83 J;  1R00 A;  1Y8R B;  3RKY A;  5C4J J;  4A5M A;  3GTL J;  2VIX A;  3QPL A;  4XKB A;  3ZQL A;  2A68 F;  4S05 A;  3FK6 A;  2PQ8 A;  2W85 A;  2ZXW H;  5GAH J;  1UFM A;  2XAQ A;  1U9O A;  2DOD A;  3QYE A;  2VQG A;  2ZXH A;  3DPL C;  2Y2Z A;  2LY1 A;  1VND A;  3BPV A;  4I76 A;  3WHB A;  1GLN A;  1W5S A;  3I71 A;  1WQ2 A;  4XIC A;  5D5U B;  4DW6 A;  1RR7 A;  1GXP A;  4CCJ A;  2TRT A;  1EKE A;  3BY6 A;  3DEW A;  2JA8 J;  4NHJ A;  1XMK A;  2F48 A;  1ZKG A;  4YFX F;  4M6Y A;  4OWR B;  4Y52 J;  1YFH A;  3J7Z I;  5J1R A;  3OSG A;  3OYN A;  1PJR A;  4FX0 A;  1IRX A;  3AKZ A;  3OYK A;  4XOR A;  1GVD A;  2JUC A;  4M6V A;  1ZTR A;  2QSF X;  1RPW A;  5H2F C;  1LFU P;  4LK0 F;  1X58 A;  3DPU A;  2G7U A;  3CUQ B;  5DS9 A;  2ZXJ A;  1O3R A;  2CW0 F;  3F23 A;  1ZK8 A;  2XVC A;  1T0F C;  4MGR A;  5EZH A;  1W7P B;  5IT9 Z;  3EQL F;  4TV7 A;  2FF4 A;  1LNW A;  4FCY A;  1WJC A;  2DI3 A;  1ZAR A;  3BZK A;  3WGG A;  2PMZ N;  3BQY A;  3VYU B;  4XSZ F;  4B48 A;  5F1R A;  2PJR B;  2E36 A;  4HEA 2;  4ENM A;  2EH3 A;  1ZRE A;  1QZY A;  2NYX A;  4XLC A;  2LH9 A;  2LY2 A;  3JRC A;  2Y75 A;  5D8K B;  1FT9 A;  2JN6 A;  1JXS A;  4DGW B;  4ITV A;  3OWT A;  1V5F A;  4O3M A;  1D3Y A;  3E5U A;  3S93 A;  4RB0 A;  2JQ7 A;  2VB6 A;  1VFC A;  3H3V K;  3BC8 A;  3JTG A;  1JGG A;  3CCJ I;  2F5C A;  2UXN A;  4CSW A;  3NAU A;  5HDG A;  2MBF A;  1LUJ B;  1B9M A;  5CVR A;  3D5S C;  2ZB9 A;  2EPF A;  1HOM A;  3L7W A;  3RPQ A;  1P7J A;  4GXO A;  3M07 A;  1GHC A;  2H6C A;  1LEB A;  4FE4 A;  1KYZ A;  4AYB A;  4I7H A;  3JRF A;  3NAR A;  2LRE A;  2PMZ A;  4I0B A;  4ZYE A;  3RJP A;  1FYK A;  2H27 A;  5K5Q A;  1DUX C;  3CP8 A;  3I59 A;  2ZME C;  3RI4 A;  5EGO A;  5FGM A;  4BYY A;  2OTL I;  3ZQQ A;  2LK2 A;  3GTM J;  4BHC A;  4IOA F;  4EM2 A;  5JR3 A;  3CJR B;  1D5V A;  2PG4 A;  4CCK A;  2JZY A;  4HDV A;  4A3G J;  1W1W E;  4UVC A;  4OMY A;  4PJL A;  2RV8 A;  4RAF A;  2NVX J;  1IJW C;  4G12 A;  1NHA A;  1MJB A;  1SD6 A;  2ZKZ A;  4LIT A;  4XNF A;  2XKO A;  3HRM A;  1REP C;  4A2U A;  5D4R A;  1VF9 A;  3RCO A;  2EFN A;  3LSG A;  3PJR A;  2K9Q A;  4ZDL A;  2H8W A;  2DOE A;  3DBR B;  1VQ7 I;  5LBQ A;  3F9K A;  5GAE J;  3R6S A;  2JK3 A;  1RIO H;  2V26 A;  1U3E M;  3IH2 A;  3GME A;  1JKP C;  2O5R A;  3OYH A;  2VBY A;  2L7F P;  2LKP A;  3HOX J;  4CYC B;  2VT2 A;  3ABU A;  3TMO A;  3GZ6 A;  2DMP A;  4UNO A;  2RGV A;  1MSE C;  2HR3 A;  3E3V A;  3DTE A;  2IPQ X;  3W6K B;  1VQM I;  1IW7 F;  2M34 A;  3FX3 A;  3HIF A;  3WU0 A;  5FJ8 J;  4UHT A;  2Z99 A;  3S3O A;  2RDP A;  3CCM I;  2IP2 A;  5FRO A;  1NTC A;  2K02 A;  3VOE A;  3CC7 I;  3S17 J;  2HVR A;  1H9T A;  4IVN A;  1HKQ A;  1OYY A;  3HXL A;  2CFO A;  4CA0 A;  2M4K A;  4HZF A;  3EYY A;  1D8K A;  1VQ9 I;  4XOP A;  1MMG A;  2KP6 A;  1HW1 A;  4KIG A;  4CDG A;  2RVC A;  3HRS A;  2LY9 A;  1LJ9 A;  2XF5 A;  2JMW A;  4ZC3 A;  4G7Z F;  2WV0 A;  3I3L A;  3M8E A;  4RLF A;  2M8E A;  1DP7 P;  1KU9 A;  5E79 C;  4HNV A;  3DCF A;  1U2W A;  2K5C A;  4OIO F;  3PFY A;  4UUT A;  3PUF A;  2CV2 A;  3DBL B;  5LGU A;  3GZ5 A;  2M7A A;  3EYI A;  1XD7 A;  1HCR A;  1BC7 C;  3FM3 A;  2OAZ A;  2LD5 A;  1H9G A;  1ZGA A;  2K4J A;  4E6K G;  4ENJ A;  3BJO A;  2BY0 A;  1JT6 A;  3LNQ A;  4KMU X;  2M2E A;  2R7X A;  2GIV A;  2HWV A;  5EGO B;  1AKH B;  4G7H F;  3K0L A;  2H6B A;  4N4N B;  1F43 A;  1WCM J;  2IGM A;  2GWR A;  3WU2 C;  4BJ6 C;  1G4D A;  1XGS A;  4LG3 A;  3K2A A;  4IHY A;  3JSP A;  2RNG A;  4EV0 A;  1TNT A;  1Z7L A;  1N77 A;  2QLZ A;  2M4G A;  2OZU A;  2ME6 A;  2ADU A;  2R7U A;  1T38 A;  3A0B C;  1YE9 A;  3S2D J;  1X1P A;  2ISZ A;  1QPM A;  3EUK L;  4Z2Y A;  3FHZ A;  2KRF A;  2QWW A;  1W5T A;  2CJJ A;  1CF7 B;  2VAS A;  4B1R A;  3QWL A;  3PO2 J;  4AVP A;  3GYH X;  2I8D A;  5CVU A;  1VQ4 I;  1STZ A;  4CYD A;  1JHH A;  3HSR A;  1QRY A;  2DA3 A;  3IP4 B;  5FD6 A;  1N75 A;  1Y39 A;  4IHW A;  2WAQ N;  3ECO A;  1QGP A;  3S16 J;  3X2Q H;  3GLL A;  1POG A;  2KIS A;  4L9V A;  2EB7 A;  2Y48 A;  3IKV A;  1AA7 A;  2E2J J;  2EZL A;  1KGS A;  2JWT A;  5L3D A;  4LLG F;  2W25 A;  3B73 A;  4IJA A;  1WJA A;  4IQJ A;  2LMD A;  1XC5 A;  4ANJ A;  3FXJ A;  2DA7 A;  2ZCW A;  1ZRD A;  1UHS A;  5B1A H;  2EBI A;  2GZW A;  4XL9 A;  1HBX G;  2LKS A;  2BW3 A;  1G6N A;  1IRG A;  3AG1 H;  2VJJ A;  1B59 A;  4NQW B;  2LP0 A;  3DLL F;  1P9Q C;  2E1O A;  1D5Y A;  2XGE A;  4A3L J;  1FOW A;  2WB1 N;  2VBX A;  5E1X A;  4BDZ A;  2K27 A;  3H35 A;  3OOU A;  4DBQ A;  4RM3 A;  1I5Z A;  3FIS A;  1R7J A;  5C3E J;  2VC1 A;  3K1N A;  4F55 A;  3S1M J;  2KPM A;  4O5V A;  2ESH A;  1MNE A;  3ZMS A;  3CC2 I;  3TOA A;  5LLQ A;  1LE8 A;  3S1R J;  2O7O A;  4XID A;  2CU7 A;  3UNG C;  3HYI A;  2LTP A;  4A69 C;  3KEY A;  3RPU A;  3IWZ A;  3AL0 C;  3S1N J;  3RIR A;  4X0G A;  2X6X A;  3GF2 A;  4XOT A;  1HDD C;  2CQK A;  1HKT A;  4EJW A;  2OA4 A;  4L9N A;  2KIF A;  4QPO A;  2E1C A;  3CUQ C;  1AU7 A;  1B8I B;  3EUA A;  5J8F A;  4BBR J;  3HGG A;  3HEF A;  4RM2 A;  5IOY A;  2R92 J;  3F8N A;  3FXQ A;  2FBK A;  5E20 A;  3CCQ I;  2DXI A;  2F4M B;  2XRO A;  1OYW A;  1ZG3 A;  3N05 A;  4CCN A;  3EPZ A;  1B6A A;  2R7O A;  2P4W A;  5JI6 A;  2M5W A;  3RZO J;  4FTH A;  4NBQ A;  4XLH A;  2R5Z B;  3DTI A;  3G3Z A;  3IH3 A;  1Y0N A;  3A01 A;  3HUG A;  3LFU A;  3FMS A;  2L9R A;  5J47 A;  4O6J A;  2A61 A;  4BHP A;  1IC8 A;  2EFQ A;  4XLA A;  4JOM A;  5FO5 A;  1KZH A;  4H4K C;  3BR5 A;  2ESN A;  1RR8 C;  3E5Q A;  3I59 B;  3ZCO A;  4BAY A;  3DKX A;  3G1L A;  3KP3 A;  1JE8 A;  2HOA A;  4I99 C;  2CH0 A;  5ILV A;  3MAJ A;  3H0D A;  1IN8 A;  4OIN F;  3JCU C;  1E0E A;  5HS9 A;  3LOC A;  1R23 A;  1MZB A;  4AM3 A;  3R60 A;  3CCY A;  5TRD A;  5LHI A;  2O61 A;  4II2 A;  3S14 J;  2CV1 A;  5EEH A;  4NQW A;  2Q2E B;  2ECC A;  3GO5 A;  2HZD A;  1FBU A;  4I02 A;  2I5U A;  4DNC A;  3OYD A;  3L9F A;  3RDI A;  3ZOB A;  2FD5 A;  1W4M A;  3PL8 A;  2M8G X;  1MW7 A;  1QZZ A;  2MSY A;  4IRH A;  3M8F A;  1HXD A;  1SMY F;  4Y13 A;  4GDF A;  2MG4 A;  1D8J A;  3CO7 C;  4KDP A;  3MWM A;  2A3S A;  3B6C A;  2XSD C;  3SZT A;  2OUM A;  2D1H A;  3Q0W A;  4ZYH A;  4M3E A;  2CQN A;  5FLX K;  2UV1 A;  2L7M P;  3IL2 A;  1ODD A;  2DQL A;  3GTQ J;  2HXO A;  5KAI C;  1S8N A;  4HA8 A;  5DM7 F;  1LPQ A;  2CG4 A;  3DEE A;  3K1P A;  3MKL A;  1YI2 I;  2C6Y A;  2CQX A;  3A03 A;  3F21 A;  4BE2 A;  2RQP A;  3ZQC A;  4R79 A;  1S29 A;  4B8X A;  4XLP F;  1RNL A;  4M3B A;  1K4S A;  4RS8 A;  4BE1 A;  4BXX J;  3KFW X;  5E3M A;  2NS0 A;  3QOP A;  4YRV A;  4ABZ A;  3CCU I;  4M9Z A;  4ESF A;  5JFR A;  2K9N A;  4A0Y A;  1LQ1 A;  5F0C A;  5EYR A;  2VQH A;  1LFB A;  1T56 A;  2QEN A;  1M1E B;  1QO0 D;  2OQG A;  3JRB A;  2A6T A;  2KHM A;  4EJT A;  3ERM A;  3WTY C;  4CIC A;  3AG4 H;  2NXN B;  4C3H J;  1AOY A;  1L0O C;  2EA2 A;  2X1E A;  2XAG A;  3IV5 A;  2JSP A;  2QF7 A;  4JBA A;  1X3W B;  4A3M J;  1ZR2 A;  1JT0 A;  1B9N A;  3SDG A;  2VE9 A;  4L5I A;  4DYC A;  5A2Q Z;  2R4G A;  4HPQ A;  3HOS A;  1R1U A;  1V4R A;  3ULQ B;  1J9I A;  1D0Y A;  1Z1D A;  3ZQ7 A;  3LSP A;  4S0H B;  4IZZ A;  4WCG A;  5DYM A;  2HOE A;  2MAB A;  5LGN A;  4ZYG A;  2FSW A;  1FPQ A;  2DFF A;  4M74 A;  4PK4 A;  2EV6 A;  4HSR A;  3LA2 A;  2WY8 Q;  4A3E J;  1TC3 C;  2R93 J;  1KQ9 A;  4BEH A;  2BGC A;  1JI8 A;  2R7Q A;  3VEP A;  3S3N A;  1KYW A;  3ASN H;  3TO6 A;  3BR6 A;  1PUE E;  5HNF A;  4U7B A;  1TL8 A;  3GTP J;  1TQI A;  3DKY A;  4PJ0 C;  4EAT A;  3CCR I;  2KL4 A;  1SAU A;  4FX4 A;  1D1A A;  4A3C J;  1U9N A;  5CVJ A;  2UZK A;  3S15 J;  1U5T A;  5JHU A;  2CGP A;  1EF4 A;  1IGN A;  4PGH A;  3J7A O;  3KP5 A;  3ML6 A;  4MFE A;  4XMY A;  2V1D A;  5BS6 A;  2YU9 J;  5HDK A;  1FMW A;  1TT5 B;  2DU9 A;  3SDB A;  4XRM A;  3IUO A;  1W5C C;  2EIN H;  4W1U A;  2CUJ A;  1S7E A;  4I6Z A;  3HOU J;  1XGO A;  1TWG J;  4GYI A;  4ENN A;  2XPW A;  1IV8 A;  5D5W B;  2OCC H;  4I0A A;  4EJU A;  1I1S A;  1R58 A;  2P6T A;  1ETO A;  3HSE A;  2COM A;  2ZNZ A;  5FRM A;  3QU3 A;  3KZZ A;  2B7E A;  1HF0 A;  4E7H A;  1YRN B;  4NC6 A;  1JKR C;  4D1Q A;  5TIS C;  1OR7 C;  4L5E A;  6PAX A;  4CCL A;  2PFB A;  3IAS 2;  2QBY B;  1YW8 A;  2VXZ A;  4I01 A;  4UVA A;  1FBS A;  4AID A;  5FRN A;  1TNS A;  4MQV A;  3LSK A;  4RAG A;  2QKM B;  2R7D A;  3HZJ A;  1CQT A;  2V1U A;  5HLI A;  4BS9 A;  2FBH A;  3OL4 A;  2QCO A;  4DYQ A;  4LG0 B;  3BTC A;  2RAE A;  3CC4 I;  1MMD A;  4HNT A;  4P9F A;  4F91 B;  3H5A A;  2Z5U A;  2KJC A;  1MJA A;  2FA5 A;  3FXU A;  1YLF A;  1A04 A;  4PZJ A;  1HST A;  3HOY J;  2WY7 Q;  2H1L A;  2LG4 A;  2X6Y A;  4UXN A;  5KK1 A;  3TOB A;  2P7V B;  2YU3 A;  2QUF A;  1LEA A;  4M3D A;  5E3O A;  1UG0 A;  4A0Z A;  1XSX A;  2OU2 A;  3P9I A;  5ICF A;  1VZ0 A;  1MBJ A;  3JRD A;  2VQL A;  3TL4 X;  4WF2 A;  2M0C A;  3Q0V A;  1ACI A;  4E7J A;  1MH3 A;  2MH9 A;  1O57 A;  3MKW B;  3SHF A;  4OU0 A;  2NVY J;  1IUF A;  2BZT A;  2X51 A;  3OY9 A;  3BG3 A;  2IS1 A;  5EG0 A;  3V4G A;  4L9J A;  3ELK A;  3BR1 A;  2L01 A;  2NNY A;  2W7N A;  1XGN A;  3CDL A;  1FYL A;  1SAN A;  2F4I A;  1Z0X A;  1WH5 A;  4XRF A;  5KHD A;  1IN7 A;  1BOB A;  2DK5 A;  3IWF A;  3Q3S A;  4QIW N;  3Q5F A;  2CW8 A;  2ZC2 A;  3C2G A;  1MDM A;  3PSF A;  3Q0U A;  3EDP A;  1XCB A;  1SAX A;  4IF4 A;  5F0H A;  3F6O A;  2IGK A;  1MBF A;  4HX8 A;  3DBH B;  4KJZ A;  3V7R A;  4JYK A;  2DDA A;  2R7R A;  2HEO A;  2VKD A;  2KQR A;  1P7I A;  1GV2 A;  2UWM A;  4YFN F;  3CQZ J;  4HQE A;  2E2I J;  2BXZ A;  1ZN2 A;  1BW6 A;  3KZI C;  1ZHF A;  2HOT A;  5F27 A;  3PO3 J;  3TQN A;  3I56 I;  5H6Q A;  3M1E A;  3GXO A;  1C0W A;  2IS4 A;  1BOA A;  1R1T A;  3F8B A;  5M3M J;  5K5R A;  1DGW Y;  3J7Y J;  2DCE A;  1K6Y A;  4FET A;  2CV0 A;  5LRS A;  1NK2 P;  2CQ7 A;  1P4A A;  2LF8 A;  4AIH A;  1VQN I;  4FQG A;  2EV0 A;  3CLO A;  4DJA A;  1SD7 A;  3AAF A;  2VKV A;  3DPT A;  3CCL I;  5ICC A;  4KNY A;  4UY8 I;  5E1W A;  1SMT A;  2Z2S B;  3FXR A;  5L3E A;  1IDZ A;  1JUS A;  2MC4 A;  4CCO A;  1SFU A;  3HPG A;  4Y15 A;  4LK1 F;  2AQE A;  2DTR A;  5HVQ C;  2XRL A;  4II3 A;  5FD5 A;  1WFX A;  3CES A;  4Y17 A;  1R49 A;  2IXS A;  2Q0O A;  3FF5 A;  3COA C;  1BR2 A;  3B6A A;  3Q9V A;  4Y7N J;  3VFZ A;  3QPT A;  2EIJ H;  1K61 A;  1FTZ A;  4HDU A;  2OBP A;  3OIO A;  1MNM C;  2O8K A;  2NNN A;  3DKW A;  1W0T A;  2OCE A;  2IBD A;  3HKZ N;  4GO1 A;  4RA2 A;  2XUB A;  5ICG A;  3CZ6 A;  2DFI A;  4KFC A;  1U5T C;  5CQG A;  4RGX A;  3M9A A;  3U1D A;  3ABL H;  1OMI A;  2CSO A;  4GRI A;  4XSX F;  4BJ5 C;  5EDN A;  2GIZ A;  3VSK A;  1ORK A;  4RLQ A;  3TED A;  4A3K J;  1ZEL A;  3CLQ A;  4ESJ A;  2B63 J;  4XLE A;  3LSI A;  4WX9 A;  2NS7 A;  1GXQ A;  1UB9 A;  2YX7 A;  3ZMT A;  2HQN A;  4S04 A;  1RZ4 A;  4Q47 A;  3BG5 A;  3KP7 A;  3HL2 A;  1YOV B;  2IW5 A;  1TWF J;  1WKM A;  1ETQ A;  4PCQ A;  1CF7 A;  3F8M A;  4C3I J;  2QA4 I;  5CPR B;  3T8R A;  2VOD A;  1FBQ A;  2HDD A;  4QPQ A;  3FWE A;  2JTV A;  3LSJ A;  2NOG A;  4CXF A;  5ED4 A;  1VQP I;  1KU7 A;  3BJA A;  3VYS B;  1K79 A;  5IT9 K;  3S2W A;  1YS7 A;  2ZFW A;  2ZJ2 A;  3TP3 A;  1F5T A;  4CHU A;  5M5W J;  1WGX A;  2EFP A;  2HDW A;  2Q8K A;  1FSH A;  2R7Z J;  2HFH A;  5BPI A;  2WA0 A;  1LKX A;  1SD4 A;  3OYM A;  3L2R A;  5DDG A;  3GEZ A;  2F2E A;  3L2V A;  5JHF A;  2KRH A;  1H8A C;  5ICE A;  2IA1 A;  3ABT A;  5GPA A;  1F1Z A;  5FFX A;  2MD0 A;  3WOD F;  5HOO A;  5ILU A;  3AL0 B;  3SEZ A;  1Y6I A;  2CWE A;  2ECB A;  1QZE A;  4RGU A;  1OFC X;  2VUM J;  4AYB N;  4IL6 C;  3LSM A;  2FBI A;  1EA3 A;  1FSE A;  2IGN A;  4C30 A;  1DU0 A;  3RTR A;  1BM9 A;  5DCM A;  4G8X A;  4AVZ A;  2KT0 A;  3DLA A;  3FIW A;  1OCZ H;  2EFW A;  3LSH A;  1MGT A;  2P5V A;  4BY7 J;  1FOY A;  4WK8 F;  3FXM A;  5HS7 A;  2BW3 B;  3ZN0 A;  2ZJR F;  1APL C;  2Z33 A;  2ZSH B;  1IN4 A;  1EV7 A;  5HNH A;  3ABM H;  1MMA A;  2BHY A;  1H89 C;  1QHG A;  2NS8 A;  4P5O A;  1R71 A;  3VWB A;  1Q1V A;  2DT6 A;  2UXX A;  5CVV A;  4AC0 A;  1FOX A;  1ETX A;  3FZV A;  5F64 A;  1FIP A;  2R7V A;  3E0J B;  9ANT A;  3HRT A;  1PYV A;  5E1Z B;  3DP7 A;  4HQM A;  4HF0 A;  2P5K A;  1YX3 A;  3BTL A;  2VE8 A;  3PUB A;  3LQQ A;  1T98 A;  3ZXS A;  4EQQ A;  1QBJ A;  1G8X A;  1WJE A;  3S8P A;  1V54 H;  2PMH A;  4RBO A;  5KVR A;  2JA6 J;  4G6D A;  3HPH A;  2WV1 A;  3K70 C;  3ZMZ A;  4XON A;  2HDC A;  1BL0 A;  4MLO A;  3ZMU A;  2WWY A;  2LLK A;  1RC9 A;  4R1H A;  2AQF A;  1WHU A;  5FKK A;  4NUB A;  4WXH A;  3G73 A;  2HPI A;  1FMV A;  3CMA I;  3V8L A;  1S6L A;  3HTS B;  3NEU A;  3BTI A;  3HHH A;  1PUF B;  3HOZ J;  3I9V 2;  1V3F A;  2HYG D;  1QNT A;  2K85 A;  2KFD A;  2HTS A;  2LNB A;  2ZJP F;  1Z77 A;  3IC7 A;  1BBY A;  4YIR X;  2CW7 A;  3G4S I;  2AO9 A;  2XPV A;  1OIS A;  3BRO A;  4RAY A;  1MSF C;  1UEL B;  2EFO A;  4BUP A;  3T0Y A;  4KN7 X;  3QP6 A;  2FNA A;  5E17 F;  2DDB A;  3E6M A;  4UUV A;  2FML A;  2Z16 A;  2VKE A;  3RKX A;  4Q4Z F;  1YJW I;  1QVU A;  2V1N A;  2LYC A;  4L18 B;  3BT9 A;  4P55 A;  4IEJ A;  4F93 B;  3LMM A;  5EF6 A;  5BMZ A;  1UST A;  1B4A A;  2RC4 A;  2HQA A;  1GV5 A;  1YG2 A;  5J6X A;  1IG7 A;  2GA2 A;  4IKF A;  1O3Q A;  2GA1 A;  3OMY A;  1FC3 A;  1ETK A;  2ICW G;  1W36 D;  4BQA A;  2RN7 A;  2QSG X;  3HJE A;  4M9X A;  4LIV A;  1BA5 A;  2E34 A;  2ZXI A;  1VQ8 I;  3BWG A;  1O3T A;  1YRN A;  4BY1 J;  3IH4 A;  3FBN B;  4UV8 A;  2PLY A;  5IYC J;  3FKJ A;  3Q9S A;  2H1K A;  1WPK A;  3KEO A;  2L7Z A;  2K3P A;  4PJJ A;  3HG9 A;  4G9Y A;  3GCM A;  4ENK A;  4E7L A;  1SD5 A;  2KLO A;  2KRC A;  2R3S A;  4HV6 A;  3RKW A;  4EJO A;  4PDK A;  2BE5 F;  2M0M A;  5H20 A;  3GWZ A;  5LEJ A;  1NH3 A;  2HTJ A;  3OSF A;  1Q1H A;  3OYA A;  3G1M A;  2H8R A;  3AFH A;  3PFI A;  4D7M A;  2EK5 A;  3M1C A;  5D6E A;  3VDX A;  2O9L A;  1LVK A;  2D2W A;  1RKT A;  2VXD A;  3H36 A;  2F5E A;  1PDN C;  2LDU A;  1S9H A;  1SEU A;  1I50 J;  1XMX A;  2BYV E;  4PFP A;  3KYC B;  5IY5 H;  2QSH X;  3F0C A;  2RNJ A;  1LFP A;  2XB0 X;  2OQR A;  5F08 A;  2O03 A;  3RYP A;  5K7H A;  4LB5 A;  3MFK A;  2E35 A;  2K86 A;  2XAJ A;  4QTR A;  4E7K A;  1S7A A;  4W97 A;  1K78 A;  2GLO A;  1DQU A;  4HYE A;  2LBF A;  4A93 J;  1XSV A;  4HST A;  1OCC H;  5IP7 J;  4YG2 F;  4RMN A;  3GFI A;  3AG3 H;  5BQT A;  3I53 A;  2K4B A;  3O8H A;  1WI3 A;  2WAQ A;  2H94 A;  1EH6 A;  4EMS A;  3F3X A;  1G3T A;  1HSJ A;  3RSN A;  1ONV A;  2XAS A;  1FYM A;  3E6C C;  3KPH A;  3T8T A;  4ON0 A;  4A12 A;  4ZTF A;  4G6Q A;  1V5G A;  4C2U A;  1MH4 A;  3PNV A;  3KZY A;  3W2W A;  1FP2 A;  5F0F A;  3W2V A;  1BR1 A;  4A3F J;  1OPC A;  3GTK J;  2QQA A;  3CP2 A;  5HLH A;  4XRS A;  1WJF A;  3WE2 A;  2NVQ J;  5DV5 A;  4ZYA A;  2X1D A;  4A0X A;  4EEF G;  1FY7 A;  2P0W A;  1E2X A;  1U5T B;  1UCR A;  1WI9 A;  2AS5 F;  2BY3 A;  1WSU A;  3OYL A;  3FK7 A;  1A36 A;  5JLX A;  2QM3 A;  3DEU A;  4GGG A;  3S2H J;  3OYG A;  3QPS A;  2FJ1 A;  3TKY A;  1E3O C;  1J7K A;  4YIF A;  2EV5 A;  4BEH B;  2XPU A;  1MJ9 A;  2GOM A;  4HNU A;  4FIS A;  3WU1 B;  1T0F A;  1VQK I;  3L00 A;  1BIB A;  2FX0 A;  4MHG A;  4ZZL A;  3I64 A;  3GLX A;  3GW2 A;  3GFJ A;  4P1W A;  4BHB A;  3LFK A;  3A4C A;  2M1B A;  4ASN A;  3BOQ A;  3LAJ A;  1WZ2 A;  1IXS B;  3BCA A;  3ZQG A;  4CZZ A;  1UZC A;  2QQB A;  4FE7 A;  4BGD A;  2Q2E A;  1OKR A;  2IAI A;  3H5N A;  1ZLJ A;  1USS A;  4CO8 A;  5C4X J;  3KYD B;  2DA2 A;  3V7C A;  2YSR A;  2YUS A;  3QYB A;  5IP9 J;  3WTV C;  1P6R A;  1SFE A;  1RUO A;  4IHV A;  2MC3 A;  4P96 A;  1LDJ A;  2B0L A;  1R5I D;  2PX9 A;  3RQ4 A;  2D45 A;  4JQF A;  2L2O A;  2VJI A;  4C3J J;  4YFK F;  2XC7 A;  3A2K A;  2JA2 A;  2ZME A;  2DMN A;  2O3F A;  3ZQH A;  1T08 B;  3P9K A;  1BIA A;  1H88 C;  1Z67 A;  2HKX A;  5IT3 A;  1Z05 A;  3LWF A;  3GZN B;  2EWN A;  1SFO J;  2FNP A;  3TO9 A;  4YII A;  5FB2 A;  1Z9C A;  3FM5 A;  3JAM K;  3SZP A;  4BXF A;  2A6E F;  4KA4 A;  3J80 Z;  2DA6 A;  1U78 A;  3HHG A;  4J19 A;  4MFD A;  1I6X A;  4XR6 A;  2XF7 A;  3D5R C;  3HUG B;  5LGT A;  4A3J J;  2UUZ A;  1HA8 A;  5LD2 C;  2ZBK A;  1IN6 A;  2M87 A;  2ELJ A;  3KYL A;  3QYF A;  2E5N A;  4RB2 C;  3GVA A;  2R0Q C;  2W1O A;  4IXA A;  3GTO J;  1O4X A;  2N8G A;  2ISY A;  4HLX A;  4XKC A;  3U2R A;  1UHW A;  5DTD A;  3DFG A;  3I0T A;  2O6G E;  1V55 H;  2ZJQ F;  3T5X A;  5CLS A;  4L0Y B;  1TW2 A;  4GYG A;  3I54 A;  3D0S A;  5DM6 F;  2BVM A;  3WG9 A;  1RRJ A;  4IRI A;  3JRI A;  1HLV A;  4AIJ A;  2BXY A;  3IAM 2;  4ZDO A;  5HDN A;  2L5Q A;  3FXL A;  2VI6 A;  4XN0 A;  2JA5 J;  3HRU A;  1IRF A;  2JRT A;  2DFH A;  5GTH C;  1ZH5 A;  4C2M J;  4KN4 X;  4Y4R A;  4LMY A;  3FXK A;  4CCM A;  2KZV A;  3KE2 A;  1GVJ A;  2DOA A;  1T39 A;  1R4M B;  2NOJ B;  1SFK A;  1G3Y A;  5LHG A;  3JRA A;  2KIM A;  3OYC A;  1BJA A;  2P5L C;  1B72 B;  1PVE A;  3WTT C;  4Q5S F;  2X1C A;  2R5Y A;  2Y31 A;  2K9S A;  4BE0 A;  4B09 A;  1O7L A;  1J09 A;  2O0Y A;  2KMU A;  4RGS A;  3H1C A;  4MTD A;  1EH8 A;  2VPL A;  3GTG J;  3DTK A;  2WAD A;  3DU6 A;  3K6G A;  2VT3 A;  3BG9 A;  1JKO C;  1MBK A;  3KP2 A;  3TGN A;  3MKZ A;  2HVS A;  1U8B A;  4DZJ A;  1FX7 A;  1R5G A;  4Y33 A;  2A69 F;  3BPX A;  3HM5 A;  4HF1 A;  1XS9 A;  4NC8 A;  3QPH A;  2NVU B;  5B3S H;  2ZME B;  3CJT B;  2LOO A;  4FT8 A;  4CH7 A;  1P4X A;  5D5X B;  1R36 A;  2L3D A;  2TDX A;  2MFZ A;  4LLL A;  5LHH A;  5DUI A;  1I3Q J;  3KX2 A;  3I4M J;  1UAA A;  3E7L A;  3ABK H;  4CGZ A;  1OLT A;  3TW6 A;  4M71 A;  4OIP F;  3OL3 A;  3WTS C;  2QZ8 A;  3CDI A;  2HXI A;  4E7I A;  4B3X A;  3BZ6 A;  3LQR A;  1UG2 A;  3ECH A;  1LDD A;  4I09 A;  1SVO A;  2EZH A;  5HOD A;  1I6H J;  2CS3 A;  2Y0S A;  2G7H A;  2HYJ A;  3VYR B;  3KET A;  5L3C A;  2ZNY A;  1TWC J;  2WBM A;  2DQR A;  1W0U A;  5M5Y J;  1VQ6 I;  1YS6 A;  2K9L A;  3T1B A;  2OTJ I;  2IS2 A;  2FXA A;  3KP4 A;  1IUY A;  1L3L A;  1U0J A;  1N78 A;  2E5Z A;  2E19 A;  2MYS A;  2QQ9 A;  5E8G A;  5LRR A;  2M3A A;  3NQO A;  4AUX A;  1K78 B;  1J5Y A;  2IEK A;  2ACJ A;  4UV9 A;  1MKM A;  3GBG A;  3ZMV A;  4D5F A;  2EQR A;  1G3W A;  3E6D A;  2E60 A;  3H9G A;  3GX4 X;  4BNC A;  1HW5 A;  2QGU A;  2V9V A;  4YEJ A;  2PMU A;  3FBI B;  3FXO A;  1YJN I;  2JA7 J;  1PP8 F;  1NG6 A;  1A31 A;  3F6V A;  1ZG5 A;  2LC2 A;  2CO5 A;  3G71 I;  3A01 B;  3JR9 A;  2P8T A;  1BC8 C;  4DIQ A;  3K69 A;  3LST A;  2KDO A;  5FKO A;  3I58 A;  3R4K A;  3HOT A;  3V7S A;  2HVQ A;  4D5C A;  5J4Y A;  2ZSI B;  1R5H A;  3LA7 A;  5GTI C;  2OF7 A;  1OCT C;  3DU5 A;  2DO7 A;  1VQO I;  1YW7 A;  5E3N A;  4F52 A;  4LFU A;  5BPD A;  3F8F A;  5E3L A;  4LIU A;  4HG2 A;  1IXC A;  3H9Q A;  3LAP A;  3CJN A;  1IZ1 A;  3C2H A;  5IOZ A;  4EGZ A;  5ERI A;  1T8I A;  3VPR A;  4OAY A;  3G6E I;  4PJN A;  5DCM B;  1BI1 A;  2COB A;  2OC6 A;  3QU6 A;  4PFO A;  2EIK H;  3ZN1 A;  2RKH A;  4LD5 A;  3CJQ B;  1S5L C;  3K4K A;  1X1B A;  3M4O J;  2M7B A;  4XM3 A;  1XCV A;  2DFE A;  2QVO A;  3HC7 A;  1XG1 A;  3HB9 A;  2DPU A;  2ZO4 A;  3K4C A;  4MQ9 F;  4IHS A;  1S7O A;  5HLG A;  2VL8 A;  1A5J A;  2CRG A;  2MD5 A;  2E2H J;  4M9S A;  1G3S A;  2G9W A;  5M3F J;  3HKZ A;  2V79 A;  1DDN A;  4OAZ A;  4OIQ F;  3K4J A;  2FU4 A;  3DXJ F;  3MQ0 A;  2L54 A;  1WJ5 A;  4NC7 A;  4KIC A;  3ZQF A;  3OYJ A;  3F8C A;  2MH2 A;  2XSJ C;  2KKO A;  4X1E A;  1TQM A;  3DV8 A;  4ZZD A;  4B3A A;  4P9U A;  2R7W A;  2KJB A;  1J0R A;  1FOK A;  2IS6 A;  2OD5 A;  1OYI A;  4E7Z A;  3C18 A;  4BU2 A;  4BBS J;  1MBG A;  1BI0 A;  2K7L A;  3H9J A;  1D0X A;  3KCC A;  1X1D A;  1J59 A;  3JRE A;  5L3B A;  3OS2 A;  2E7W A;  3DF8 A;  4V2G A;  1NK3 P;  4MO7 A;  1ZG1 A;  4FAS D;  2Y9Y A;  5EG0 B;  4XKV A;  3C1D A;  1MD0 A;  2BY1 A;  3MN2 A;  2KZG A;  1RKW A;  4U88 A;  3BTJ A;  2V9K A;  4IOC F;  5J4V A;  2HQ5 A;  5JLW A;  3G1O A;  4M73 A;  1MDM B;  4E7S A;  2GAU A;  3QRF F;  3J7A Y;  5M5X J;  2Y0S N;  4UUS A;  2FEZ A;  4B43 A;  1LDK B;  2K3F A;  4KT6 A;  2WC2 A;  4EM1 A;  3GTJ J;  3CF5 F;  4R8H A;  1JUM A;  3BDD A;  1G2H A;  4L5J A;  3CCE I;  1E3P A;  1ON2 A;  2JUG A;  5AIP A;  2CYY A;  1JJ6 C;  2FRH A;  4ZH4 F;  2NRA C;  2A5Y B;  3PNY A;  2MA3 A;  5AON A;  2GXA A;  4DQ2 A;  4N0B A;  4A3D J;  2AXL A;  2Z3Y A;  2PJP A;  2E1N A;  4U0Y A;  1LB2 A;  4OOI A;  4XK4 A;  1QU3 A;  1MMN A;  3RQI A;  3A1Y A;  5CVI A;  3SQN A;  3WTU C;  4C2T A;  3TBI A;  3OYB A;  2HOS A;  3CMM A;  2NAZ A;  5B1B H;  1EH7 A;  3SZG A;  3PQK A;  3N4M A;  1BI3 A;  4M3G A;  3R0A A;  1TZL A;  2Y30 A;  1I3A A;  3VYT B;  3IRQ A;  1QQI A;  2XB5 A;  1MND A;  2BVL A;  1MMS A;  1W7P A;  4XBF A;  4HOB A;  3ZP5 A;  1TLH B;  5L3G A;  2X6O A;  2OZ6 A;  4KIT B;  5IYD J;  2VC0 A;  3C2B A;  1XN7 A;  4J01 A;  1V5E A;  1G59 A;  1PP7 U;  3U1K A;  1VQ5 I;  1OQY A;  2FQ3 A;  2GM4 A;  1KU2 A;  2MLK A;  3CUO A;  1O7F A;  2EZK A;  2OJE D;  4KUM A;  3SJM A;  2NVT J;  3FKI J;  5BNG A;  2IA2 A;  4D0P A;  3LL7 A;  3M3Y J;  2JPB A;  1IN5 A;  2OPT A;  3K4B A;  5F04 A;  1FEX A;  2XAF A;  1B1B A;  1IDY A;  3U21 A;  2X0L A;  2HKO A;  1TTY A;  2M45 A;  5JVG F;  3SFZ A;  4EGY A;  1X1C A;  2DBB A;  1X3Z B;  2EA4 A;  1IF1 A;  3RYR A;  4ZYD A;  5E8I A;  2QQ8 A;  4GFB A;  2YPR A;  1BI2 A;  4HRI A;  3KLO A;  2FE3 A;  3D5L A;  2J5P A;  3OOP A;  2STT A;  2RQQ A;  3B02 A;  3ERE D;  1HW2 A;  2FOK A;  1ZGJ A;  2E1M B;  4UB6 C;  2MGQ A;  3FDY A;  5KNL A;  3IKT A;  2VJ4 A;  1F9N A;  4U7D A;  3FMQ A;  3QQA A;  2KDZ A;  2RRE A;  5DEQ A;  1MIJ A;  5CQE A;  2L4A A;  1A6Q A;  3KLN A;  3CF2 A;  1FIA A;  1YW9 A;  1PUF A;  2BY2 A;  2QKL B;  2D5V A;  1A35 A;  1HDP A;  1ETW A;  3HTU A;  4BKX A;  1SVL A;  3A0H C;  1OCO H;  4LOC A;  2L0K A;  2LRD A;  3TDU C;  3HOV J;  4BQO A;  3JW4 A;  2BHZ A;  1XX5 A;  3KP6 A;  3K10 A;  1KQ8 A;  1WJB A;  5EEA A;  1TT0 A;  1WH7 A;  4EVI A;  1X1A A;  2K9M A;  3NRV A;  1YYV A;  1ENH A;  3O6B B;  3VB2 A;  1ZQ3 P;  2E7X A;  2L02 A;  1MBE A;  2E71 A;  1X2N A;  4KT5 C;  3L1P A;  2VBW A;  2H09 A;  3JTH A;  5J3L A;  1UJ8 A;  4N9I A;  4UVB A;  1DP3 A;  3L2W A;  2FQ4 A;  3P7N A;  4FHT A;  5K1Y A;  1D1B A;  5BOX A;  3H0G J;  3O8G A;  3W3C A;  4CUG A;  3KIO A;  3S32 A;  2XIG A;  3JSO A;  3W6J B;  2EJR A;  4PSX A;  2HI3 A;  2L9N A;  1XDS A;  2DYR H;  3L2U A;  3W6V A;  2Q1Z B;  3H92 A;  1S3J A;  1WVR A;  3TW7 A;  2LVS A;  5H6R A;  3PQJ A;  2M30 A;  5B66 C;  2JPC A;  2L7K A;  5LFA A;  2F5F A;  4AU7 A;  2STW A;  1Z3Y A;  4V2F A;  3F72 A;  5D8L B;  2I10 A;  3J81 K;  3CTA A;  1P92 A;  2KIQ A;  5GPC A;  3OR1 C;  2W57 A;  1RUN A;  2G0E A;  4A5N A;  4MEY F;  1JUP A;  3UKG A;  2F6C A;  1Z6R A;  1QVT A;  3R61 A;  3I4N J;  2F4O B;  3BR2 A;  3MD2 A;  4ZTJ A;  2XGC A;  1KA8 A;  3V8J A;  2R7T A;  5TGT A;  2YX4 A;  3ZPL A;  4KYW A;  3VOD A;  1LE8 B;  1R6R A;  4N9H A;  2PJR A;  2Y0M A;  4E4H A;  4KIS A;  2P81 A;  5J1U A;  4EM0 B;  1I39 A;  2ME0 A;  3QP5 A;  1BR4 A;  3ASO H;  4KIF A;  3MKY B;  3CME I;  2EIM H;  2F5V A;  2HZT A;  3BP8 A;  3K1M A;  3JRH A;  2DTZ A;  2WB1 A;  1ZGW A;  2Z9O A;  4MIM A;  2JJ7 A;  5C44 J;  1K7A A;  4HX4 A;  3J80 K;  3K7A J;  2X4H A;  1B8I A;  1R22 A;  3ZMD A;  4BL0 B;  4I2O A;  2PBI A;  2W24 A;  3V42 A;  4HF2 A;  2GXB A;  4HAM A;  2DN0 A;  3SFI A;  4KMF A;  1W36 C;  1Y8Q B;  5ILS A;  3BQZ A;  1LVA A;  1XDU A;  2X9D A;  1Z3X A;  3L2C A;  3LA3 A;  3WGI A;  2JSC A;  1YO5 C;  4L0Z B;  2K40 A;  2A05 A;  2ELH A;  2IA0 A;  3OIP A;  4MEX F;  3MVP A;  2EZI A;  3A02 A;  4U87 A;  2CQQ A;  1TQP A;  4LJZ F;  4JX6 A;  1B72 A;  1Y1W J;  3OR2 C;  3S1Q J;  4RB3 C;  1ZRF A;  3O3K A;  1GDT A;  5E18 F;  3OYI A;  1IAW A;  2A5W A;  4HLY A;  1CGP A;  3E6B A;  2V6C A;  4QSH A;  2O8X A;  3DWL E;  2LR8 A;  3ROU A;  1E3H A;  1HKS A;  1H0M A;  3SXY A;  1XPX A;  3HDD A;  4LLN A;  2TCT A;  1NG7 A;  4MTE A;  1AWC A;  5FKN A;  3PNT A;  2R7F A;  4NNJ A;  4B47 A;  1FJL A;  3J81 Z;  2VKH A;  1WRJ A;  3BJ6 A;  2QEX I;  2IT0 A;  1TP4 A;  4UB8 C;  1X2M A;  2DJN A;  1Z7U A;  1Z21 A;  1N25 A;  3MZH A;  3GFL A;  5IPA A;  1SVM A;  4DZP A;  2XF6 A;  4CYC A;  3M7G A;  4IHX A;  2IJL A;  3REO A;  3WTX C;  3BR0 A;  3ISP A;  2XV4 S;  2PI0 A;  3BR3 A;  2IRF G;  1U6G A;  5DD4 A;  3HOW J;  2XAU A;  4IHT A;  1FLI A;  2HS5 A;  3I4P A;  4EJV A;  3UR3 C;  4LGW A;  2X6W A;  4DOZ A;  3CUQ A;  2DW4 A;  4DYR A;  5EZG A;  3D1N I;  2V7F A;  5GAG J;  1RI7 A;  1K4T A;  1YX5 A;  5J40 A;  4XLN F;  4RAZ A;  3MZ8 A;  4GCV A;  3IHU A;  4G7O F;  2LBF B;  5LEK A;  5K7Z A;  1TWA J;  4Y3O A;  2GXG A;  4F7Z A;  3OS1 A;  3EUH C;  3JRG A;  4AIK A;  4M6X A;  3K9T A;  3IRR A;  2XGD A;  3C3W A;  3E5X A;  5J1Y A;  2LKX A;  4V19 K;  4HX7 A;  2JT1 A;  2VJ5 A;  4ZJZ A;  2XDV A;  2V9P A;  5L3F A;  1KON A;  1O3S A;  3CDH A;  5D6F A;  2DMU A;  4Z6Y A;  2CUE A;  2L9V A;  4JX5 A;  3I5U A;  2BBY A;  3K4L A;  3BLY A;  3WG7 H;  1IXR C;  5JVT A;  1ON1 A;  5EEG A;  3ZRG A;  2HQR A;  1YIJ I;  1YJ9 I;  2Y69 H;  4AWX B;  5CJ9 A;  5HLT A;  2BEO A;  1XSD A;  3TP0 A;  5FLV A;  2L9S A;  4IPA A;  1F36 A;  3HGY A;  4F3Q A;  2HPM A;  2WAE A;  4JX4 A;  5IP6 A;  2J5O A;  1FWZ A;  2GBY A;  5DD8 A;  2VPR A;  1J75 A;  2YR2 A;  1T2K A;  3G2B A;  1DU6 A;  4IX7 A;  3TO7 A;  2R7S A;  1FP1 D;  2VQC A;  2W84 A;  4BQQ A;  2BV6 A;  2L4M A;  2XKP A;  3K4M A;  3RPU D;  1HC8 A;  3CCV I;  5F1J A;  3P9C A;  1Z6T A;  4NB5 A;  3EET A;  1T33 A;  1R9T J;  4WXC A;  4LB6 B;  1TW3 A;  3R0J A;  2DYS H;  4CZC A;  3MZY A;  3I55 I;  4M3F A;  3ZGK A;  4RB1 A;  4RDU A;  5FKM A;  5HS8 A;  4X6A J;  2DA4 A;  1I27 A;  2DMQ A;  1JTX A;  1YIO A;  2CMP A;  2DJI A;  1ITY A;  2CUF A;  4ZDP A;  3ZQI A;  4A6D A;  4ETS A;  1D0Z A;  4XLF A;  2B9S A;  3BCB A;  5A2Q K;  1HQC A;  1E17 A;  2R5Y B;  1Y56 A;  1MBH A;  2MLG A;  4QLC U;  3CO6 C;  4AD9 A;  4D7N A;  1X19 A;  4BJT A;  4JK1 X;  2DMT A;  4U0W A;  1ULY A;  4BQN A;  1OCR H;  1RES A;  1TWH J;  2DA1 A;  3H3U A;  1YHQ I;  1Z91 A;  3KEQ A;  3QOE A;  2OV7 A;  5CKT A;  3K4N A;  1D1C A;  2A6H F;  5AIQ A;  4E70 A;  3MCZ A;  4G94 A;  4PGG A;  4Q48 A;  2LFB A;  1P2F A;  2DA5 A;  4G6T B;  2Z1D A;  5DUK A;  3E97 A;  2FOW A;  2VN2 A;  3S3M A;  1FTT A;  2HYF A;  3CCS I;  1X4P A;  3E1S A;  1JHF A;  2E1M C;  2HGC A;  5KAF C;  1YTY A;  5D4S A;  1OCP A;  2GQQ A;  2QBY A;  2CUZ A;  1IO2 A;  1JKQ C;  3V8K A;  5CYV A;  2VON A;  1UHM A;  1FNN A;  2X48 A;  1EJ9 A;  4I98 B;  1BW5 A;  2W82 A;  1JGS A;  3P5J A;  2JVG A;  5F6F A;  5KCM A;  1ERD A;  5D5V B;  3OIQ A;  3FMR A;  1YIT I;  2EIL H;  3O2P E;  2VBZ A;  5GAD J;  3QOD A;  5FKL A;  4HV5 A;  4WXD A;  3BG6 A;  2CFX A;  3C7J A;  3W2A A;  1ETY A;  5J8C A;  3DQV C;  4L9T A;  3K2Z A;  4QWQ A;  4B4C A;  1ZYR F;  3ESW B;  2HNH A;  3SEQ A;  3U9G A;  1W7P D;  2XRN A;  4XN3 A; 
#chains in the Genus database with same CATH homology
 4BXU A;  2WTE A;  4OIR F;  1XB4 A;  3WE3 A;  4BH9 A;  1XGM A;  1DPR A;  2PN6 A;  3H3Z A;  1ZAO A;  1P4W A;  1R1V A;  2P6S A;  4KIB A;  1VTN C;  1DPU A;  1KU3 A;  1FZP B;  2F5D A;  1ZLK A;  3JAM Z;  3N97 A;  3HSF A;  5DCF A;  4U0V A;  1F4K A;  1OR7 A;  2XGX A;  3L09 A;  4K2E A;  1XMA A;  2KIU A;  5TJJ A;  4HW0 A;  3WGH A;  1Y0U A;  2VOP A;  5FLX Z;  4A6E A;  3QAH A;  1TBX A;  2V1X A;  4LG0 A;  2ETH A;  2XAH A;  5FFZ A;  3MEX A;  3GFM A;  2QYO A;  2D1V A;  3OV8 A;  4MNU A;  4WWC A;  2FMY A;  2DPD A;  3GUD A;  2XHK A;  3WTW C;  1T6S A;  3TDZ C;  2DLL A;  4ESB A;  2A07 F;  2LSO A;  4RGR A;  1K6O A;  1X3U A;  4IRG A;  4H0E A;  4HBL A;  4OMZ A;  2DT5 A;  2DAO A;  1J2X A;  3WTZ A;  4M72 A;  2IVM A;  1I1G A;  3EUH A;  2DK8 A;  1ZRC A;  2LF7 A;  1SFX A;  1U8R A;  1YQA A;  3F22 A;  2P7C B;  2VOO A;  1KQ0 A;  2PEX A;  1BN5 A;  5K5O A;  1WWX A;  1R00 A;  3RKY A;  4A5M A;  2A68 F;  4S05 A;  2PQ8 A;  2W85 A;  1UFM A;  2XAQ A;  3DPL C;  3BPV A;  1W5S A;  3I71 A;  1WQ2 A;  5D5U B;  1GXP A;  3BY6 A;  4NHJ A;  1XMK A;  4YFX F;  4M6Y A;  1YFH A;  4FX0 A;  4LK0 F;  2G7U A;  3CUQ B;  1O3R A;  2ZXJ A;  2CW0 F;  3F23 A;  2XVC A;  4MGR A;  1W7P B;  5IT9 Z;  3EQL F;  4TV7 A;  2FF4 A;  1LNW A;  2DI3 A;  1ZAR A;  3WGG A;  5F1R A;  4XSZ F;  1ZRE A;  4ENM A;  1QZY A;  2NYX A;  2Y75 A;  5D8K B;  1FT9 A;  1JXS A;  4O3M A;  1D3Y A;  3E5U A;  4RB0 A;  3JTG A;  2F5C A;  2UXN A;  5HDG A;  2MBF A;  1B9M A;  5CVR A;  3L7W A;  3RPQ A;  4GXO A;  1GHC A;  2H6C A;  1LEB A;  1KYZ A;  4I7H A;  4I0B A;  4ZYE A;  1FYK A;  3RJP A;  2H27 A;  5K5Q A;  1DUX C;  3I59 A;  3RI4 A;  5FGM A;  4BYY A;  4BHC A;  4EM2 A;  5JR3 A;  1D5V A;  2PG4 A;  2JZY A;  4HDV A;  4UVC A;  4OMY A;  2RV8 A;  1NHA A;  1MJB A;  1SD6 A;  2ZKZ A;  2XKO A;  3HRM A;  1REP C;  4A2U A;  5D4R A;  2EFN A;  5LBQ A;  3R6S A;  1RIO H;  1U3E M;  2VBY A;  2LKP A;  2VT2 A;  3ABU A;  3GZ6 A;  4UNO A;  2RGV A;  2HR3 A;  3E3V A;  2IPQ X;  3W6K B;  1IW7 F;  3FX3 A;  3HIF A;  3WU0 A;  4UHT A;  2Z99 A;  2RDP A;  2IP2 A;  2K02 A;  3VOE A;  1H9T A;  4IVN A;  1HKQ A;  1OYY A;  4HZF A;  3EYY A;  1D8K A;  1HW1 A;  4KIG A;  4CDG A;  2RVC A;  3HRS A;  1LJ9 A;  4G7Z F;  2WV0 A;  3M8E A;  2M8E A;  1DP7 P;  1KU9 A;  1U2W A;  4OIO F;  5LGU A;  3GZ5 A;  3EYI A;  1XD7 A;  1BC7 C;  3FM3 A;  2OAZ A;  1H9G A;  1ZGA A;  2K4J A;  4ENJ A;  3BJO A;  4KMU X;  2GIV A;  2HWV A;  4G7H F;  3K0L A;  2H6B A;  2GWR A;  1G4D A;  1XGS A;  3JSP A;  4EV0 A;  1TNT A;  2QLZ A;  2OZU A;  2ADU A;  1T38 A;  2ISZ A;  1QPM A;  4Z2Y A;  3FHZ A;  2KRF A;  2QWW A;  1W5T A;  1CF7 B;  3GYH X;  4AVP A;  5CVU A;  1STZ A;  4CYD A;  1JHH A;  3HSR A;  5FD6 A;  3ECO A;  1QGP A;  4L9V A;  2EB7 A;  2Y48 A;  3IKV A;  1KGS A;  5L3D A;  4LLG F;  2W25 A;  3B73 A;  4IJA A;  2ZCW A;  1ZRD A;  2GZW A;  1HBX G;  1IRG A;  1G6N A;  1B59 A;  2VBX A;  5E1X A;  2K27 A;  1I5Z A;  1R7J A;  2VC1 A;  3K1N A;  4O5V A;  2ESH A;  3ZMS A;  3TOA A;  5LLQ A;  3HYI A;  3RPU A;  3IWZ A;  3RIR A;  3GF2 A;  2CQK A;  1HKT A;  4EJW A;  2OA4 A;  4L9N A;  2KIF A;  2E1C A;  3CUQ C;  5J8F A;  3F8N A;  3FXQ A;  2FBK A;  5E20 A;  2XRO A;  1OYW A;  1ZG3 A;  1B6A A;  2P4W A;  5JI6 A;  2M5W A;  3G3Z A;  3HUG A;  3FMS A;  4O6J A;  2A61 A;  4BHP A;  2EFQ A;  5FO5 A;  2ESN A;  3E5Q A;  3I59 B;  4BAY A;  3KP3 A;  1JE8 A;  5ILV A;  3MAJ A;  1IN8 A;  4OIN F;  5HS9 A;  1R23 A;  1MZB A;  3R60 A;  5TRD A;  5LHI A;  2O61 A;  5EEH A;  4NQW A;  3GO5 A;  4I02 A;  1FBU A;  4DNC A;  3L9F A;  3RDI A;  1W4M A;  1QZZ A;  4IRH A;  3M8F A;  1HXD A;  1SMY F;  4Y13 A;  1D8J A;  3CO7 C;  4KDP A;  3MWM A;  2A3S A;  3SZT A;  2D1H A;  4ZYH A;  5FLX K;  3IL2 A;  1ODD A;  2DQL A;  1S8N A;  4HA8 A;  2CG4 A;  3K1P A;  2C6Y A;  3F21 A;  2RQP A;  4R79 A;  1S29 A;  4B8X A;  4XLP F;  1RNL A;  4RS8 A;  3KFW X;  2NS0 A;  3QOP A;  4M9Z A;  4ESF A;  5JFR A;  4A0Y A;  1LQ1 A;  2QEN A;  1QO0 D;  2OQG A;  4EJT A;  3WTY C;  4CIC A;  1AOY A;  1L0O C;  2EA2 A;  2XAG A;  4JBA A;  1B9N A;  2VE9 A;  4L5I A;  5A2Q Z;  3HOS A;  1R1U A;  1V4R A;  3ULQ B;  1J9I A;  1Z1D A;  3ZQ7 A;  4WCG A;  5DYM A;  2HOE A;  5LGN A;  4ZYG A;  2FSW A;  1FPQ A;  4M74 A;  2EV6 A;  3LA2 A;  1KQ9 A;  2BGC A;  3VEP A;  1KYW A;  3TO6 A;  1PUE E;  4U7B A;  1TQI A;  4FX4 A;  5CVJ A;  2UZK A;  1U5T A;  5JHU A;  2CGP A;  4PGH A;  3J7A O;  3KP5 A;  3ML6 A;  2V1D A;  5BS6 A;  5HDK A;  2DU9 A;  1XGO A;  4GYI A;  4ENN A;  5D5W B;  4EJU A;  4I0A A;  1I1S A;  1R58 A;  2P6T A;  3HSE A;  2COM A;  2ZNZ A;  3QU3 A;  3KZZ A;  6PAX A;  2PFB A;  2QBY B;  1YW8 A;  2VXZ A;  4I01 A;  4UVA A;  1FBS A;  1TNS A;  4MQV A;  2R7D A;  2V1U A;  5HLI A;  2FBH A;  4LG0 B;  4P9F A;  2Z5U A;  2KJC A;  1MJA A;  2FA5 A;  3FXU A;  1YLF A;  1A04 A;  4PZJ A;  1HST A;  4UXN A;  5KK1 A;  3TOB A;  2P7V B;  2YU3 A;  2QUF A;  1LEA A;  4A0Z A;  1XSX A;  2OU2 A;  3P9I A;  5ICF A;  4WF2 A;  2MH9 A;  1O57 A;  3SHF A;  4OU0 A;  3V4G A;  4L9J A;  3ELK A;  2NNY A;  2L01 A;  1XGN A;  1FYL A;  4XRF A;  1IN7 A;  2DK5 A;  3IWF A;  3Q5F A;  1MDM A;  3EDP A;  1XCB A;  1SAX A;  4IF4 A;  3F6O A;  4HX8 A;  3V7R A;  2HEO A;  2UWM A;  4YFN F;  4HQE A;  1ZN2 A;  1ZHF A;  3TQN A;  5H6Q A;  3M1E A;  3GXO A;  1C0W A;  1BOA A;  1R1T A;  3F8B A;  5K5R A;  5LRS A;  1P4A A;  2LF8 A;  4AIH A;  2EV0 A;  3CLO A;  1SD7 A;  3AAF A;  3DPT A;  5ICC A;  4KNY A;  5E1W A;  1SMT A;  5L3E A;  3FXR A;  1SFU A;  4Y15 A;  4LK1 F;  5HVQ C;  2DTR A;  5FD5 A;  4Y17 A;  2Q0O A;  3FF5 A;  3COA C;  3Q9V A;  3VFZ A;  3QPT A;  4HDU A;  2OBP A;  2NNN A;  3DKW A;  4GO1 A;  2XUB A;  5ICG A;  2DFI A;  4KFC A;  1U5T C;  4RGX A;  3M9A A;  3U1D A;  1OMI A;  2CSO A;  4XSX F;  4ESJ A;  4WX9 A;  1GXQ A;  1UB9 A;  2YX7 A;  3ZMT A;  2HQN A;  4S04 A;  1RZ4 A;  4Q47 A;  3KP7 A;  2IW5 A;  1WKM A;  4PCQ A;  1CF7 A;  3F8M A;  3T8R A;  2VOD A;  1FBQ A;  3FWE A;  2JTV A;  4CXF A;  5ED4 A;  1KU7 A;  3BJA A;  1K79 A;  5IT9 K;  3S2W A;  1YS7 A;  2ZFW A;  2ZJ2 A;  1F5T A;  4CHU A;  2EFP A;  1FSH A;  2Q8K A;  2HFH A;  5BPI A;  1SD4 A;  5DDG A;  3GEZ A;  2F2E A;  5ICE A;  2IA1 A;  3ABT A;  1F1Z A;  5FFX A;  3WOD F;  5HOO A;  5ILU A;  2CWE A;  4RGU A;  2FBI A;  1FSE A;  3RTR A;  1BM9 A;  5DCM A;  4G8X A;  2EFW A;  1MGT A;  2P5V A;  4WK8 F;  5HS7 A;  3ZN0 A;  2Z33 A;  1IN4 A;  1EV7 A;  4P5O A;  5CVV A;  2UXX A;  3FZV A;  5F64 A;  3HRT A;  5E1Z B;  3DP7 A;  4HQM A;  4HF0 A;  2P5K A;  2VE8 A;  3LQQ A;  1T98 A;  4EQQ A;  1QBJ A;  2PMH A;  5KVR A;  4G6D A;  3ZMZ A;  2HDC A;  3ZMU A;  2WWY A;  4R1H A;  4WXH A;  3G73 A;  3V8L A;  1S6L A;  3HTS B;  3NEU A;  3HHH A;  1V3F A;  2HYG D;  1QNT A;  2HTS A;  2LNB A;  3IC7 A;  1BBY A;  4RAY A;  3BRO A;  2EFO A;  3T0Y A;  4KN7 X;  3QP6 A;  2FNA A;  5E17 F;  3E6M A;  4UUV A;  2FML A;  3RKX A;  4Q4Z F;  4L18 B;  4P55 A;  5BMZ A;  1UST A;  1B4A A;  2RC4 A;  1YG2 A;  5J6X A;  2GA2 A;  1O3Q A;  2GA1 A;  1FC3 A;  4BQA A;  2RN7 A;  4M9X A;  3BWG A;  1O3T A;  4UV8 A;  2PLY A;  3Q9S A;  3KEO A;  4ENK A;  4G9Y A;  1SD5 A;  4HV6 A;  2R3S A;  3RKW A;  4EJO A;  4PDK A;  2BE5 F;  5H20 A;  3GWZ A;  5LEJ A;  2HTJ A;  1Q1H A;  3PFI A;  2EK5 A;  5D6E A;  2D2W A;  2F5E A;  1PDN C;  2LDU A;  2BYV E;  2RNJ A;  3RYP A;  2OQR A;  2O03 A;  4LB5 A;  3MFK A;  2K86 A;  2XAJ A;  1S7A A;  1K78 A;  4HYE A;  1XSV A;  4YG2 F;  3GFI A;  5BQT A;  3I53 A;  2K4B A;  2H94 A;  1EH6 A;  4EMS A;  3F3X A;  1G3T A;  1HSJ A;  1FYM A;  1ONV A;  2XAS A;  3E6C C;  3T8T A;  4ON0 A;  4A12 A;  4G6Q A;  3KZY A;  1FP2 A;  1OPC A;  2QQA A;  5HLH A;  3WE2 A;  5DV5 A;  4A0X A;  1FY7 A;  1E2X A;  1U5T B;  1UCR A;  1WI9 A;  2AS5 F;  1WSU A;  2QM3 A;  3DEU A;  4GGG A;  3TKY A;  1J7K A;  4YIF A;  2EV5 A;  1MJ9 A;  3WU1 B;  1T0F A;  3L00 A;  1BIB A;  4MHG A;  4ZZL A;  3I64 A;  3GLX A;  3GW2 A;  3GFJ A;  4BHB A;  3LFK A;  2M1B A;  4ASN A;  3BOQ A;  3LAJ A;  1IXS B;  4CZZ A;  2QQB A;  2Q2E A;  1OKR A;  4CO8 A;  1ZLJ A;  1USS A;  3V7C A;  2YSR A;  3WTV C;  1P6R A;  1SFE A;  1RUO A;  2MC3 A;  4P96 A;  1LDJ A;  2B0L A;  2D45 A;  4JQF A;  4YFK F;  2ZME A;  2O3F A;  3P9K A;  1BIA A;  2HKX A;  5IT3 A;  1Z05 A;  3LWF A;  2EWN A;  2FNP A;  3TO9 A;  4YII A;  5FB2 A;  1Z9C A;  3FM5 A;  3JAM K;  3SZP A;  2A6E F;  4KA4 A;  3J80 Z;  1U78 A;  3HHG A;  1I6X A;  5LGT A;  2ZBK A;  1IN6 A;  2M87 A;  4RB2 C;  3GVA A;  4IXA A;  2ISY A;  4HLX A;  3U2R A;  1UHW A;  3DFG A;  3I0T A;  2O6G E;  3T5X A;  5CLS A;  4L0Y B;  1TW2 A;  4GYG A;  3I54 A;  3D0S A;  3WG9 A;  4IRI A;  4AIJ A;  5HDN A;  3HRU A;  1IRF A;  2JRT A;  1ZH5 A;  4KN4 X;  4LMY A;  3KE2 A;  1GVJ A;  1T39 A;  1G3Y A;  5LHG A;  2KIM A;  1BJA A;  2P5L C;  3WTT C;  4Q5S F;  4B09 A;  1O7L A;  2O0Y A;  4RGS A;  4MTD A;  1EH8 A;  2VT3 A;  3KP2 A;  3TGN A;  1FX7 A;  1R5G A;  2A69 F;  3BPX A;  4HF1 A;  3QPH A;  2ZME B;  4FT8 A;  1P4X A;  5D5X B;  1R36 A;  2L3D A;  2TDX A;  5LHH A;  4LLL A;  5DUI A;  4CGZ A;  4M71 A;  4OIP F;  3WTS C;  2QZ8 A;  3BZ6 A;  3LQR A;  3ECH A;  1LDD A;  4I09 A;  2G7H A;  3KET A;  5L3C A;  2ZNY A;  2DQR A;  1YS6 A;  3T1B A;  2FXA A;  3KP4 A;  1IUY A;  1L3L A;  1K78 B;  2QQ9 A;  5E8G A;  5LRR A;  3NQO A;  1J5Y A;  2ACJ A;  4UV9 A;  1MKM A;  3ZMV A;  1G3W A;  3E6D A;  3GX4 X;  4BNC A;  1HW5 A;  2V9V A;  2PMU A;  1PP8 F;  3F6V A;  1ZG5 A;  2CO5 A;  2P8T A;  1BC8 C;  3K69 A;  3LST A;  3I58 A;  3R4K A;  3HOT A;  3V7S A;  1R5H A;  3LA7 A;  2DO7 A;  1YW7 A;  4LFU A;  5BPD A;  3F8F A;  1IXC A;  3LAP A;  3CJN A;  1IZ1 A;  4EGZ A;  5ERI A;  5DCM B;  1BI1 A;  3QU6 A;  3ZN1 A;  2RKH A;  4LD5 A;  1XCV A;  2QVO A;  2DPU A;  2ZO4 A;  4MQ9 F;  4IHS A;  1S7O A;  5HLG A;  2MD5 A;  4M9S A;  2G9W A;  1G3S A;  2V79 A;  1DDN A;  4OIQ F;  2FU4 A;  3DXJ F;  3MQ0 A;  2L54 A;  4KIC A;  3F8C A;  2MH2 A;  2KKO A;  1TQM A;  3DV8 A;  4ZZD A;  4P9U A;  2KJB A;  1FOK A;  1J0R A;  2OD5 A;  1OYI A;  3C18 A;  1BI0 A;  2K7L A;  3KCC A;  1J59 A;  5L3B A;  2E7W A;  3DF8 A;  1ZG1 A;  3C1D A;  1MD0 A;  4U88 A;  4M73 A;  1MDM B;  2GAU A;  3QRF F;  2FEZ A;  1LDK B;  4EM1 A;  2WC2 A;  4R8H A;  3BDD A;  4L5J A;  1ON2 A;  5AIP A;  2CYY A;  2FRH A;  4ZH4 F;  2NRA C;  2A5Y B;  2MA3 A;  5AON A;  4DQ2 A;  4N0B A;  2AXL A;  2Z3Y A;  2PJP A;  2E1N A;  4U0Y A;  1LB2 A;  4OOI A;  5CVI A;  3SQN A;  3WTU C;  2NAZ A;  1EH7 A;  3PQK A;  3N4M A;  1BI3 A;  3R0A A;  3IRQ A;  1QQI A;  1W7P A;  4XBF A;  4HOB A;  3ZP5 A;  1TLH B;  5L3G A;  2OZ6 A;  2VC0 A;  1XN7 A;  1PP7 U;  2FQ3 A;  1KU2 A;  2MLK A;  3CUO A;  1O7F A;  4KUM A;  2IA2 A;  4D0P A;  2JPB A;  1IN5 A;  2XAF A;  1B1B A;  2X0L A;  2HKO A;  1TTY A;  2M45 A;  3SFZ A;  4EGY A;  2DBB A;  2EA4 A;  1IF1 A;  3RYR A;  4ZYD A;  5E8I A;  2YPR A;  1BI2 A;  3KLO A;  2FE3 A;  3D5L A;  2J5P A;  3OOP A;  2STT A;  3B02 A;  3ERE D;  1HW2 A;  2FOK A;  1ZGJ A;  3IKT A;  1F9N A;  4U7D A;  3FMQ A;  5DEQ A;  2L4A A;  3KLN A;  1YW9 A;  3HTU A;  3TDU C;  3JW4 A;  3KP6 A;  1KQ8 A;  4EVI A;  3NRV A;  1YYV A;  3O6B B;  3VB2 A;  2E7X A;  2L02 A;  4KT5 C;  2VBW A;  2H09 A;  3JTH A;  4N9I A;  4UVB A;  3P7N A;  4FHT A;  5K1Y A;  5BOX A;  2XIG A;  3JSO A;  3W6J B;  2EJR A;  1XDS A;  3H92 A;  1S3J A;  5H6R A;  3PQJ A;  2M30 A;  2STW A;  2JPC A;  2F5F A;  5D8L B;  3F72 A;  3J81 K;  3CTA A;  1P92 A;  1RUN A;  2W57 A;  4A5N A;  4MEY F;  1Z6R A;  3R61 A;  1KA8 A;  3V8J A;  2YX4 A;  3ZPL A;  4KYW A;  3VOD A;  4N9H A;  2Y0M A;  4EM0 B;  3QP5 A;  4KIF A;  2HZT A;  3BP8 A;  3K1M A;  2Z9O A;  1K7A A;  4HX4 A;  3J80 K;  2X4H A;  1R22 A;  3ZMD A;  4I2O A;  2GXB A;  2PBI A;  2W24 A;  4HF2 A;  4HAM A;  4KMF A;  5ILS A;  1LVA A;  1XDU A;  3L2C A;  3LA3 A;  3WGI A;  2JSC A;  1YO5 C;  4L0Z B;  2ELH A;  2IA0 A;  4MEX F;  1TQP A;  4LJZ F;  4RB3 C;  1ZRF A;  3O3K A;  5E18 F;  1IAW A;  4HLY A;  1CGP A;  3E6B A;  2V6C A;  2O8X A;  3ROU A;  1HKS A;  1H0M A;  3SXY A;  4LLN A;  4MTE A;  1AWC A;  2R7F A;  3J81 Z;  2IT0 A;  1WRJ A;  3BJ6 A;  1Z7U A;  3MZH A;  3GFL A;  3M7G A;  2IJL A;  3REO A;  3WTX C;  3ISP A;  2XV4 S;  2PI0 A;  2IRF G;  1U6G A;  5DD4 A;  4IHT A;  1FLI A;  2HS5 A;  3I4P A;  4EJV A;  4LGW A;  3CUQ A;  2DW4 A;  1RI7 A;  4XLN F;  4RAZ A;  4GCV A;  3IHU A;  4G7O F;  5LEK A;  2GXG A;  4F7Z A;  4AIK A;  4M6X A;  3K9T A;  3IRR A;  3C3W A;  3E5X A;  4HX7 A;  2JT1 A;  5L3F A;  1O3S A;  3CDH A;  5D6F A;  3I5U A;  2BBY A;  1IXR C;  5JVT A;  1ON1 A;  5EEG A;  2HQR A;  4AWX B;  5CJ9 A;  2BEO A;  1XSD A;  4IPA A;  2J5O A;  1FWZ A;  5DD8 A;  1J75 A;  2YR2 A;  1T2K A;  3TO7 A;  1FP1 D;  2W84 A;  2BV6 A;  2L4M A;  2XKP A;  3P9C A;  1Z6T A;  4NB5 A;  3EET A;  4WXC A;  4LB6 B;  1TW3 A;  3R0J A;  3MZY A;  4RB1 A;  5HS8 A;  1I27 A;  1YIO A;  4A6D A;  4ETS A;  5A2Q K;  1HQC A;  1E17 A;  2MLG A;  4QLC U;  3CO6 C;  4AD9 A;  4JK1 X;  4U0W A;  1ULY A;  3H3U A;  1Z91 A;  3KEQ A;  5AIQ A;  4E70 A;  2A6H F;  3MCZ A;  4G94 A;  4PGG A;  4Q48 A;  1P2F A;  5DUK A;  3E97 A;  2VN2 A;  2HYF A;  1JHF A;  2HGC A;  1YTY A;  5D4S A;  2GQQ A;  2QBY A;  3V8K A;  5CYV A;  2VON A;  1UHM A;  1FNN A;  4I98 B;  1JGS A;  5F6F A;  5D5V B;  3FMR A;  3O2P E;  2VBZ A;  4HV5 A;  4WXD A;  2CFX A;  3C7J A;  5J8C A;  3DQV C;  4L9T A;  3K2Z A;  4QWQ A;  1ZYR F;  3U9G A;  1W7P D;  2XRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...