4EM2A

Seleno-methionine staphylococcus aureus marr in complex with salicylate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 58
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em2A00
4BHBA 5J6XA 4XRFA 2HWVA 2RC4A 5IT9K 1I1SA 5DUIA 1IXSB 2Z33A 1R23A 2O61A 1BI1A 3RKXA 3HRTA 4KYWA 1XSXA 3BZ6A 3NEUA 5LHHA 1IN6A 3T8RA 3CTAA 4M6XA 2DAOA 4YFNF 1LEAA 2IJLA 5HDNA 2GZWA 1P4AA 3WE3A 4O3MA 5D5WB 3ZQ7A 4YG2F 1HKSA 4I0BA 4L0ZB 3FZVA 4A5NA 1S3JA 4IHTA 1I5ZA 3TDUC 3BDDA 2W84A 2PN6A 4R79A 2FE3A 1XCBA 4UVBA 1QBJA 3F6VA 3K2ZA 1LDJA 2AXLA 1PP8F 4YIIA 3DEUA 4WCGA 2LNBA 3BPXA 1X3UA 1XCVA 3T1BA 4BHPA 4KMUX 2VC1A 3U2RA 6PAXA 4EJVA 2HQNA 2X0LA 2HYFA 1W5TA 1HKTA 3J81Z 1Z91A 3LA3A 3DQVC 5HLHA 1S7OA 2PI0A 4M6YA 3BP8A 4L5JA 4A0YA 1OPCA 1RNLA 3IC7A 3GF2A 5H6QA 3ABTA 2YX4A 3HOSA 1G3TA 3MZYA 2V79A 2A07F 5LEKA 5JR3A 3I58A 3TOAA 1Z05A 3QP6A 1KQ9A 1SD6A 3F22A 3WU1B 1FY7A 3WTTC 3P7NA 1U5TA 3M8FA 2BYVE 4OIOF 2VN2A 1YTYA 1K6OA 4ENNA 3QPHA 3F8BA 2EFNA 2XRNA 1ZH5A 1DDNA 4MEYF 3WU0A 1K78A 3JTHA 4RAYA 3ROUA 3ERED 3CUQC 2MH9A 3E5XA 4RS8A 4WWCA 1FBUA 3CUQA 5E18F 2EB7A 1REPC 2E1CA 2A61A 4R8HA 1I6XA 1J5YA 2P5LC 1CF7A 4UXNA 5F1RA 4I02A 5ILUA 5DDGA 4CYDA 3HUGA 3EDPA 4UUVA 1HQCA 5HDKA 1MD0A 5CLSA 2EK5A 3F72A 5HVQC 1T2KA 3IKVA 4ZYDA 5D6FA 4B09A 3P9IA 3V7SA 3F8FA 4HW0A 5D8LB 4OIRF 2JPCA 5ICEA 2OD5A 4EQQA 4LLGF 3EQLF 2NYXA 2A5YB 2P5KA 3KZZA 5DCFA 4A12A 1FZPB 3GO5A 3D5LA 5D5VB 3R61A 1L0OC 2UWMA 4HZFA 4I98B 1ZG5A 4HLXA 4N0BA 2AS5F 4Q47A 4MHGA 1VTNC 4CXFA 4L9TA 2ETHA 2QM3A 2RDPA 4YIFA 5IT3A 3ZMVA 4P5OA 4FT8A 2P6SA 3ZMTA 3E6DA 3EYYA 2RVCA 1QNTA 4IRIA 4YFKF 3ML6A 3BY6A 4UVCA 1DP7P 1XGMA 4NB5A 2W24A 4AWXB 2HGCA 4ESJA 1U78A 3MWMA 4RB2C 3I54A 2OQGA 4L9JA 5EEHA 1MKMA 2GIVA 2UXNA 3T0YA 1DPUA 5LRRA 1YFHA 3KLOA 4BNCA 2VBWA 4HV6A 5HS8A 5L3CA 5LGTA 3CDHA 3RI4A 4G7OF 1DUXC 2BEOA 2EV5A 3RJPA 4MTDA 2PG4A 2ZNYA 1XGNA 1P4XA 1UHWA 2P5VA 1SFUA 3K1PA 3CUQB 3E6CC 2ZNZA 5FFXA 4WXCA 4HLYA 2XIGA 4GYGA 2M45A 4LB6B 1R36A 5TJJA 3HOTA 3J81K 2BBYA 4L9VA 4KDPA 1ZLJA 3KP4A 2K86A 4HQMA 2W85A 4CDGA 3I53A 2ZFWA 3HRMA 3FWEA 1Z9CA 3COAC 4U0WA 1ZGJA 2IP2A 4EGZA 3M8EA 1Q1HA 1FC3A 5JHUA 4KUMA 5K5RA 2HTJA 1BC8C 5E20A 4JK1X 4EM1A 2EWNA 3GEZA 3VFZA 5F64A 1J0RA 5ICCA 2QBYA 3U9GA 1KU9A 2A6HF 4G6QA 3WTXC 4BAYA 4HX8A 2QQ9A 4ESFA 4OIPF 3JSOA 2ISYA 5ILVA 2XUBA 2ESHA 1T98A 1B9NA 4RGUA 5E1WA 1J7KA 3KLNA 2BE5F 2LSOA 2E7XA 2QLZA 5HLGA 2DPDA 3HHHA 4Q48A 3TQNA 4MQVA 1O3TA 1A04A 2XAGA 3MEXA 2R7DA 1ZARA 3SFZA 3MFKA 1KU2A 1SFXA 3W6KB 5L3EA 1TNSA 3E6MA 3C18A 1SD7A 4A5MA 1Z7UA 4KMFA 2C6YA 2CSOA 1ZN2A 4LK1F 2X4HA 3V7CA 2L4AA 4EV0A 5BMZA 1YO5C 4D0PA 5LHIA 2EFWA 3ZPLA 2VBXA 1TW3A 5HOOA 2DK5A 4KN7X 2NRAC 1R00A 1BC7C 3IWZA 4HDUA 5LGUA 1R7JA 4LD5A 3FMRA 5LGNA 1HW1A 5DD8A 1MJBA 3HYIA 3RDIA 3LA2A 1IN8A 2QWWA 5DD4A 4IPAA 2KJCA 2P8TA 5CVIA 5FB2A 2VOOA 3RPQA 4HA8A 3DFGA 1IF1A 4L18B 1KGSA 3E6BA 1HSTA 4ESBA 2PQ8A 1ZAOA 2XV4S 1PP7U 2OBPA 1O3SA 4QLCU 5E8IA 3I5UA 3QU6A 3HHGA 2K4JA 2DU9A 2GXBA 2G9WA 1TQMA 5JFRA 1EV7A 3IRQA 2XVCA 1WI9A 1BN5A 3GUDA 4Y17A 2HTSA 1IUYA 3FXRA 1EH8A 3LAJA 3FXUA 3FM3A 3V4GA 2EJRA 2Y48A 4E70A 1WSUA 5D5UB 4UHTA 2DW4A 3N4MA 5JVTA 1R1TA 4A0XA 4NHJA 1YW8A 5L3GA 1E17A 4AIKA 2ADUA 4Z2YA 4OOIA 2QQAA 3RPUA 4MEXF 1RI7A 4KICA 1G3WA 2M8EA 4EVIA 2XKPA 2W57A 1F9NA 2YSRA 4WXHA 2DQRA 4LLNA 2VODA 2LF8A 5ICGA 4N9IA 2HZTA 2IA2A 3I64A 4XSZF 3PQKA 1FX7A 3W6JB 3ULQB 2FA5A 2NAZA 4QWQA 1G3YA 1J9IA 5K5OA 2FMYA 1XDSA 1KU7A 2VXZA 4FX4A 3JTGA 2VT3A 1UFMA 2DI3A 4GGGA 4O6JA 3V8JA 2IT0A 3JW4A 3I4PA 5E8GA 3ABUA 1JE8A 2NS0A 1FOKA 1HKQA 2OQRA 4EGYA 1FP1D 1WKMA 4M71A 2ZJ2A 3F21A 2ZCWA 3I0TA 2CYYA 1JXSA 2XAJA 4EJOA 4EJWA 2Q2EA 1DPRA 4EMSA 2L4MA 4G7HF 1T39A 2EFPA 2P7VB 4ON0A 5CVUA 4G7ZF 3V8KA 4YFXF 4RB0A 2Z99A 4AIJA 3WGHA 2VT2A 5AIPA 4IVNA 3V7RA 1HXDA 4KT5C 3F8CA 3IKTA 1G3SA 4P9FA 2DK8A 3R0JA 3ECHA 5D8KB 2JSCA 4GCVA 3SXYA 1LNWA 3ZN0A 1G6NA 2Q8KA 4A0ZA 1ZRDA 5FLXZ 1L3LA 4DQ2A 5FFZA 1BBYA 3HSRA 2HDCA 1XSVA 1XMAA 5K5QA 4I0AA 1LJ9A 1RUOA 1ZHFA 4KIGA 2LF7A 2RGVA 2EFOA 4EM0B 1D8JA 3L9FA 2MLGA 2PJPA 4KFCA 1B1BA 4ZZLA 4RGSA 2IW5A 3ZN1A 1RIOH 2M1BA 5LHGA 3GZ5A 1TW2A 3JAMZ 1JHHA 4AVPA 1QQIA 2O6GE 3QOPA 5DCMB 1O7FA 4N9HA 2GA1A 2HEOA 1O3RA 4AIHA 3HSFA 1P4WA 1T38A 3WE2A 3SQNA 1F5TA 2D45A 1KQ0A 2FOKA 4A6DA 2OZUA 1YIOA 1FWZA 3Q9SA 1ZRFA 3F23A 4ENMA 1U6GA 3ZMDA 3ELKA 5DYMA 1BI3A 3N97A 1IAWA 3H3UA 1JHFA 2H94A 3LQRA 2DQLA 3O6BB 2XAQA 4IXAA 5L3BA 1IZ1A 3TKYA 4ZH4F 2M30A 3K9TA 3Q5FA 3Q9VA 2DBBA 5HDGA 3D0SA 1FYMA 3RYPA 2CFXA 2V1DA 4CO8A 2LDUA 2CO5A 3HRUA 1K7AA 2BV6A 1YYVA 2DLLA 3DP7A 5CVRA 4BXUA 3FMSA 5FD6A 5L3DA 3L09A 4TV7A 2IA0A 2JPBA 4WK8F 3BJAA 4M73A 1O7LA 1H9TA 1T6SA 2XROA 2WWYA 1LB2A 1J2XA 4RAZA 4WX9A 3U1DA 3CO6C 4I01A 3KP7A 1NHAA 3E5QA 3H3ZA 1FBSA 3HRSA 1D3YA 3SHFA 1I1GA 5F6FA 1O57A 1RZ4A 3VEPA 3RTRA 5BQTA 3WG9A 1TQIA 4GO1A 2GXGA 3CLOA 3CUOA 4PDKA 3GXOA 3H92A 4MNUA 2M87A 2KJBA 3SZPA 2ZMEA 2O03A 4KN4X 4XBFA 1FPQA 1P92A 5A2QZ 3C7JA 3WTUC 5J8CA 4P96A 4PGHA 2JTVA 2EV6A 2L54A 2J5OA 1ZYRF 4L9NA 3REOA 3KEOA 1UHMA 2Y75A 5KK1A 2L3DA 4I7HA 2YX7A 1R1UA 4K2EA 5H20A 1ZLKA 2FXAA 4G9YA 4KIFA 1STZA 2K7LA 2FQ3A 5FLXK 1YW7A 3M7GA 3WTYC 3G3ZA 2FBKA 1H0MA 2GQQA 3I59B 5BPDA 2L01A 2FSWA 3B73A 2RKHA 3KCCA 1FYLA 3DPTA 5D4SA 3LWFA 4ZZDA 2F5DA 3QP5A 1XB4A 1IXCA 1ON2A 1ZG3A 1KYZA 3ZMSA 1B6AA 1MJ9A 4HX7A 2ISZA 3DV8A 4WXDA 2COMA 1KU3A 1TTYA 2Z5UA 2Z9OA 3J80Z 5LLQA 2MD5A 3IRRA 2FBIA 4HAMA 4ETSA 3O3KA 1FYKA 3EETA 4MTEA 4BHCA 3BPVA 1ULYA 3EYIA 5LRSA 2MH2A 3JAMK 3KP2A 4L5IA 2KKOA 5J8FA 1R22A 4OMYA 4OINF 2B0LA 5LBQA 1IW7F 1FBQA 5K1YA 4S05A 4G8XA 2G7UA 5JI6A 4OMZA 5ICFA 1FLIA 1C0WA 4GXOA 2HKOA 2VBZA 2H6CA 2QZ8A 3BJ6A 3LAPA 4G6DA 1LDKB 4HQEA 2ZMEB 4FX0A 3M9AA 1R58A 4M9SA 2XASA 1YLFA 1IRFA 2PLYA 3ZMZA 1OYYA 5DUKA 2V9VA 3WGIA 2F5CA 4EJUA 4DNCA 1IN4A 1LEBA 2VC0A 3HSEA 3R4KA 1D5VA 4BYYA 4LK0F 3WTWC 2IRFG 3P9CA 3GYHX 2MBFA 4BH9A 2F2EA 5AONA 3F6OA 1IXRC 3BOQA 3WODF 3L7WA 2VBYA 2DO7A 3TO9A 1SD4A 1O3QA 4I09A 2HKXA 4OIQF 3E5UA 2HR3A 3VOEA 3ISPA 2F5FA 4EJTA 1B9MA 5E1ZB 5EEGA 5CJ9A 2FBHA 3F3XA 3CJNA 4ENKA 3DKWA 1R5GA 1BOAA 2FEZA 1LDDA 2XKOA 1GHCA 3KP5A 4F7ZA 2K4BA 2OU2A 3PQJA 1W7PA 5FD5A 1TQPA 3M1EA 3B02A 1UB9A 2OA4A 3BWGA 4PGGA 1U8RA 1LQ1A 4U88A 2HYGD 5TRDA 4MQ9F 3NRVA 3GLXA 1XMKA 4Q5SF 2IA1A 2Q0OA 1H9GA 5ERIA 3RKWA 3E3VA 2JZYA 1PDNC 2MA3A 1I27A 4HYEA 5LEJA 4IRHA 2FRHA 2R3SA 3GFJA 5A2QK 4R1HA 4I2OA 2KRFA 5FGMA 2QQBA 3KZYA 1OMIA 3SZTA 1ZG1A 4LMYA 3P9KA 3TO7A 1V3FA 1JGSA 4U0YA 4S04A 2K02A 4L0YB 5DCMA 2IPQX 2PEXA 2DFIA 2IVMA 1F4KA 4G94A 2ACJA 1W7PD 3O2PE 3MAJA 3GVAA 1ODDA 4H0EA 4IJAA 2H27A 2H6BA 1QPMA 4WF2A 1F1ZA 1W4MA 1BI0A 1OKRA 1KQ8A 2UZKA 3C3WA 1SAXA 3QPTA 1TLHB 4ZYGA 4IF4A 3GZ6A 1P2FA 1R5HA 3T8TA 2YU3A 2CQKA 2PBIA 1Y0UA 2GAUA 3WTZA 2NNNA 3NQOA 2UXXA 1FNNA 3S2WA 3J80K 2GA2A 2KIFA 2D1VA 4HDVA 4RGXA 3KP6A 1PUEE 3L00A 1D8KA 4Y13A 5HS9A 4BQAA 5FO5A 3FXQA 5HLIA 2BGCA 2VOPA 1R1VA 4HX4A 1YW9A 1U5TC 1W7PB 4NQWA 4XLNF 4ASNA 1S7AA 1YQAA 5DV5A 1XGOA 2TDXA 1USTA 2STWA 4RB1A 1USSA 1MDMA 3LQQA 1QGPA 2WV0A 4M9XA 2EFQA 3K1NA 1GVJA 2HS5A 4B8XA 4HV5A 3V8LA 1Z6TA 1HW5A 2XGXA 4IHSA 5KVRA 1ONVA 4A6EA 1BJAA 2MLKA 3QU3A 4PCQA 4FHTA 3C1DA 1FT9A 1AOYA 1YG2A 4JBAA 1OYWA 5E1XA 3BJOA 2FU4A 2HQRA 4CICA 2V1XA 1E2XA 2E7WA 1MGTA 2QYOA 2CGPA 2WTEA 2DT5A 1B4AA 2J5PA 1ZREA 2E1NA 1XD7A 3PFIA 5L3FA 1BI2A 1U2WA 1T0FA 1G4DA 3QAHA 2L02A 3LFKA 2VE8A 1YS7A 2RQPA 1BM9A 1K79A 2EV0A 2WC2A 2XAFA 1IN5A 2PMUA 4OU0A 1V4RA 1MZBA 3FX3A 1J59A 2P7CB 5HS7A 2A6EF 3MCZA 1XSDA 2D1HA 4CHUA 2MC3A 3RYRA 4UVAA 3ZMUA 3DXJF 4GYIA 3I59A 1S6LA 2GWRA 3KP3A 2LKPA 3ZP5A 4U7BA 2VONA 3KFWX 3MZHA 2O0YA 3GX4X 4UV8A 3QRFF 3K69A 4P9UA 1FSEA 3FMQA 3GWZA 4LB5A 3OOPA 4UNOA 3FF5A 2HOEA 2O3FA 3GFLA 3R60A 1P6RA 2CW0F 4PZJA 5D6EA 1AWCA 5BOXA 3DPLC 1OYIA 4Q4ZF 4U7DA 3BROA 4XSXF 1U5TB 1MDMB 2YPRA 2NNYA 3FHZA 2VE9A 4LG0A 3R0AA 5AIQA 1BIAA 1Z1DA 2QENA 3G73A 1KA8A 1FSHA 3T5XA 4KIBA 2P4WA 1BIBA 3JSPA 5IT9Z 1K78B 5ED4A 4CGZA 2V6CA 5H6RA 1UCRA 2R7FA 1SFEA 2H09A 5DEQA 2FMLA 1YS6A 2DTRA 1S29A 2ESNA 3TOBA 1HW2A 2XAHA 3F8MA 1TNTA 1MJAA 1W5SA 4U0VA 1J75A 4RGRA 2YR2A 2PFBA 3TGNA 3AAFA 1CF7B 1QO0D 4ENJA 1SMTA 1ON1A 1QZZA 3K1MA 4O5VA 3E97A 2Z3YA 3EUHA 2PMHA 2A3SA 3GFMA 4HBLA 3ECOA 4M74A 3IL2A 2CG4A 2A68F 2Y0MA 4A2UA 5E17F 3VODA 3TDZC 4HF0A 3GFIA 4UV9A 1QZYA 3HTSB 2RN7A 2KIMA 3FM5A 1WRJA 2K27A 2FF4A 3CO7C 1FP2A 3WTSC 4ZYEA 3LSTA 2EA4A 4P55A 1XN7A 2ZBKA 4HF1A 5D5XB 2O8XA 4HOBA 4LFUA 1EH7A 3WGGA 2ZO4A 2XHKA 2HFHA 4KA4A 3RKYA 2ELHA 2W25A 2FNAA 2M5WA 4M9ZA 3HIFA 3I71A 3IHUA 3VB2A 1LVAA 4LG0B 1U3EM 3K0LA 1SMYF 5BPIA 3GW2A 1IRGA 2A69F 1ZGAA 1CGPA 4ZYHA 4XLPF 4AD9A 2G7HA 2ZXJA 3L2CA 1EH6A 1KYWA 4M72A 3R6SA 3OV8A 5BS6A 1WWXA 1HBXG 3J7AO 3RIRA 4EM2A 1TBXA 3WTVC 3IWFA 2QUFA 1RUNA 2STTA 1GXPA 4KNYA 2KIUA 4MGRA 1SD5A 2EA2A 1B59A 3TO6A 3KEQA 4JQFA 2D2WA 2F5EA 2FNPA 1IN7A 3MQ0A 3F8NA 2ZKZA 4CZZA 2OAZA 2JT1A 4LJZF 1S8NA 2V1UA 1HSJA 1GXQA 4LLLA 1OR7A 2RV8A 2JRTA 2P6TA 1XDUA 2CWEA 1XGSA 3DF8A 5CYVA 3KETA 4LGWA 1Z6RA 3KE2A 5D4RA 2QBYB 1WQ2A 4IRGA 2RNJA 2OZ6A 1ZRCA 3LA7A 4RB3C 2DPUA 5CVJA 5ILSA 3HTUA 4Y15A 5CVVA 4HF2A 2QVOA
chains in the Genus database with same CATH superfamily
4BHBA 5J6XA 4CYCB 4XRFA 1OQYA 2HWVA 2RC4A 4IX7A 5IT9K 1I1SA 1LUJB 5DUIA 4FETA 1IXSB 2Z33A 1ETKA 3HGYA 1R23A 2JRMA 3HOUJ 2O61A 1VF9A 1BI1A 3HJEA 5B66C 4Y4RA 3RKXA 3HRTA 3VPRA 4KYWA 1XSXA 3BZ6A 3HKZN 4IKFA 3A2KA 3NEUA 1HC8A 5LHHA 1IN6A 3T8RA 2FOWA 4Y3OA 3CD6I 5J40A 2HXIA 3CTAA 1SVOA 4M6XA 2DAOA 2QQ8A 3N05A 4YFNF 5M5WJ 1LEAA 2IJLA 5HDNA 1IRZA 3HPHA 2GZWA 1ETVA 1P4AA 2K9SA 3OL3A 3WE3A 1OCOH 4O3MA 5D5WB 5FKMA 3ZQ7A 4YG2F 3GTMJ 3LSRA 4A3DJ 1HKSA 3NWSA 2L0KA 3ZQGA 4I0BA 4L0ZB 3FZVA 3CCSI 4A5NA 1BR4A 2GLOA 4IHVA 1S3JA 2L9RA 2OV7A 4IHTA 2E5ZA 1I5ZA 3TDUC 5DM6F 3BDDA 2W84A 1MBFA 2PN6A 2BY0A 4R79A 2O9LA 3JRIA 2FE3A 1WVRA 2EQRA 5F04A 4J00A 1XCBA 2VKVA 3ASNH 4UVBA 1ZR4A 3OYDA 2LBFA 1U8BA 2JUCA 2KL4A 1QBJA 3F6VA 5KAIC 5F0HA 2CFOA 3AG2H 2EBIA 1VQLI 4RMNA 3K2ZA 1LDJA 2AXLA 1PP8F 1XTAA 4YIIA 5C3EJ 1YX3A 2LD5A 3W2VA 3DEUA 4WCGA 1QZEA 2ZJPF 2LNBA 2W82A 1X3UA 3BPXA 1XCVA 2E71A 3T1BA 4BHPA 4GFBA 3OS1A 4KMUX 3HOYJ 2VIXA 2VC1A 2DTZA 5FLVA 1VQ5I 3U2RA 6PAXA 4I6ZA 4EJVA 1WI3A 1WPKA 4X0GA 2HQNA 2X0LA 2IS1A 3GTJJ 3Q0VA 1Y8QB 1W5TA 2HYFA 4ZDPA 2CV2A 3J81Z 1HKTA 3CCUI 1Z91A 3L2VA 1IGNA 3GMEA 3M4OJ 5IP6A 3LA3A 3DQVC 1TZLA 5HLHA 1S7OA 1ZR2A 2PI0A 4FE7A 3BP8A 4M6YA 1WJFA 4PJLA 4L5JA 3CLQA 1A35A 4A0YA 3TP0A 1OPCA 1RNLA 1LPQA 4BL0B 3IC7A 4BUPA 3GF2A 3A0HC 5H6QA 3ABTA 4X1EA 2YX4A 3L2UA 3HOSA 5EEAA 1G3TA 3MZYA 2V79A 2VL8A 2A07F 3BG5A 4M3GA 5LEKA 5JR3A 3I58A 1OFCX 3TOAA 1Z05A 1BJZA 3QP6A 4J01A 1KQ9A 5IYCJ 1SD6A 2JA6J 3F22A 2EIMH 2OJED 3WU1B 1FY7A 1WH7A 2VJ5A 2F5VA 3WTTC 3P7NA 1U5TA 3M8FA 2BYVE 4RLQA 4OIOF 2VN2A 1YTYA 1U9NA 1K6OA 1ERDA 2K40A 4ENNA 1RRJA 3QPHA 5J3LA 3DTIA 3F8BA 5HNFA 5IOZA 2E5NA 2EFNA 2F4OB 2XRNA 3QOEA 3FKIJ 4HNUA 1ZH5A 1DDNA 4MEYF 1POGA 3WU0A 1D0YA 1K78A 3JTHA 4RAYA 3ROUA 4E7HA 4D5FA 4A3LJ 3ERED 3CUQC 2CUJA 2MH9A 2UV1A 3B6AA 3E5XA 4HNVA 4RM2A 3HM5A 1GV2A 1JKOC 4Y52J 1LFUP 4RS8A 4ZJZA 4WWCA 4AM3A 1I6HJ 1NH3A 1FBUA 1Q1VA 3CUQA 5E18F 2RNGA 2EB7A 1REPC 2E1CA 5B1AH 2A61A 2V9PA 4PJMA 4R8HA 1I6XA 1J5YA 2YUSA 1JGGA 3FXMA 4CUGA 2P5LC 1CF7A 2DFHA 2LBFB 4UXNA 2I10A 5F1RA 2DA6A 4I02A 5ILUA 5DDGA 4CYDA 2Y69H 3LOCA 3HUGA 2R7VA 1P9QC 3EDPA 3K4NA 4AYBN 2M2EA 4UUVA 2XSDC 1HQCA 4XN3A 5HDKA 1JTYA 4IZZA 3D1NI 1MD0A 2LH9A 2BXZA 5CLSA 2WAFA 2EK5A 2VJ4A 3F72A 5HVQC 1T2KA 2IS2A 3IKVA 4ZYDA 3GTLJ 1W5CC 5D6FA 4B09A 3P9IA 3V7SA 3F8FA 4HW0A 5D8LB 4OIRF 2JPCA 5ICEA 2HOSA 2CQNA 2OD5A 2X6OA 3C2HA 3G1LA 4LLGF 4A69C 4EQQA 3HGGA 3EQLF 1S5LC 2NYXA 3IH3A 2A5YB 2P5KA 3KZZA 5DCFA 5J1RA 3DTEA 4A12A 4BE2A 1FZPB 3GO5A 3D5LA 2Q2EB 4XLFA 5D5VB 2MC4A 2DOAA 3R61A 1L0OC 1LKXA 4W97A 5TGTA 1RKWA 4HF2A 2UWMA 3ONQA 4HZFA 5C4XJ 4JX5A 4C3IJ 4I98B 3LSJA 3PNVA 4HLXA 1ZG5A 4N0BA 2AS5F 4Q47A 4MHGA 1ETOA 1VTNC 3WHCA 3OMYA 4CXFA 2W1OA 4L9TA 5KNLA 1PJRA 2ETHA 3C2GA 2IXSA 2E36A 3ZR8X 1ZGWA 2QM3A 1MBHA 2RDPA 4YIFA 5IT3A 4JP0A 3ZMVA 4P5OA 5JLXA 2MD0A 4FT8A 1H8AC 2P6SA 4A3EJ 2ELKA 2IS4A 5M3FJ 3ZMTA 3E6DA 4LOCA 2RVCA 1QNTA 3EYYA 2DT7B 3OYFA 4IRIA 4YFKF 3ABKH 2BW3A 1FOXA 1R9TJ 2HVSA 2K9NA 2JK3A 2KFDA 3ML6A 3BY6A 1E3HA 4UVCA 1HF0A 1IRXA 4JOMA 2P81A 4L5EA 1DP7P 4C2TA 1IUFA 1XGMA 4RBOA 3BQZA 4NB5A 3DU6A 2W24A 4AWXB 2HGCA 1EKEA 4ESJA 2GXAA 4ABZA 1U78A 3K4MA 3MWMA 4RB2C 1T8IA 2NVQJ 3OIOA 3I54A 3ZQQA 1ITYA 2ZB9A 3FKJA 1QPIA 2OQGA 4L9JA 5EEHA 1VI0A 1MKMA 3MKWB 2GIVA 2UXNA 3T0YA 1DPUA 5LRRA 2W00A 1YFHA 3KLOA 3G1OA 4BNCA 2LG4A 3M07A 3VYSB 3K7AJ 2CUEA 2VBWA 4HV6A 1Y39A 5HS8A 5L3CA 5LGTA 1O4XA 3CDHA 3RI4A 4G7OF 2XB0X 1G59A 3DBRB 2VUMJ 1DUXC 2VQGA 2BEOA 2EV5A 4XLAA 3RJPA 1FIPA 4MTDA 1V55H 5EG0B 2V6EA 2PG4A 2P0WA 1DU6A 1JTXA 2ZNYA 2L2OA 4W1UA 1XGNA 3LSPA 3G6EI 1P4XA 1UHWA 2P5VA 1SFUA 3K1PA 3CUQB 3E6CC 1IV8A 2ZNZA 1SFOJ 5FFXA 4WXCA 1PVEA 4HLYA 2XIGA 4GYGA 1GUUA 2M45A 4LB6B 5IYBJ 1R36A 4UUSA 3DU5A 4M3DA 5GP9A 5TJJA 3HOTA 3AG3H 3J81K 3KYCB 1FMVA 2BBYA 2WBMA 4L9VA 3HUGB 3OOUA 1ZLJA 3KP4A 4KDPA 2K86A 4X6AJ 1BOBA 1UMQA 4HQMA 4DYQA 2W85A 4CDGA 3S1NJ 1W0TA 2EIKH 3I53A 3UNGC 3Q3SA 2ZFWA 2ME6A 1EJ9A 1MH4A 3O8GA 3HRMA 4F91B 3M3YJ 3FWEA 3J7ZI 1Z9CA 3COAC 4Z6YA 2MG4A 4XLEA 3C2BA 3GTOJ 2PX9A 4ZTFA 4BQQA 2V7FA 2ZXIA 1R4NB 1TWGJ 1ZGJA 2IP2A 4U0WA 2DJNA 5HLTA 4EGZA 3M8EA 1MBJA 2DMTA 1Q1HA 1FC3A 5JHUA 4KUMA 4ZC3A 5K5RA 3BTCA 3OYAA 2HTJA 2ZSHB 4RAGA 1BC8C 2R7ZJ 5E20A 4JK1X 1X4OA 4EM1A 2EWNA 4CCMA 3JR9A 5JVGF 3OSGA 3H35A 4NDLA 3GEZA 4QPQA 3SEQA 2LY9A 1KZHA 5C4JJ 3VFZA 5F64A 4ITVA 1J0RA 2NVUB 5ICCA 2QBYA 2CRGA 3U9GA 1KU9A 2A6HF 4G6QA 4NC8A 3VYTB 2XGEA 4BAYA 3WTXC 4HX8A 1HOMA 2QQ9A 3K4JA 3TL4X 3OYIA 3CP2A 4ESFA 3PNYA 5E3OA 4OIPF 4RLFA 2H8RA 3JSOA 3CDLA 2ISYA 1BR2A 1OCRH 5ILVA 2XUBA 2ESHA 1T98A 2LRDA 1B9NA 4RGUA 2O5RA 5E1WA 4E7SA 3S15J 1J7KA 1ORKA 3KLNA 2BE5F 2LSOA 2E7XA 2QLZA 3RCOA 2CV1A 1VQKI 1K61A 5HLGA 2DPDA 3HHHA 4F52A 2BW3B 2COBA 3CMYA 4HRIA 1JUPA 4HSTA 5DTDA 1F43A 4BE0A 4Q48A 3TQNA 4H4KC 4MQVA 1IDYA 1A04A 1O3TA 2B7EA 2XAGA 2LC2A 3MEXA 2R7DA 2NVXJ 2IGMA 2BXYA 3HOVJ 1ZARA 3SFZA 5JHFA 2CV0A 3MFKA 2H1LA 1MNMC 2BVMA 1ETQA 1JUSA 2E34A 3JRDA 1KU2A 1SFXA 3W6KB 3CCMI 4PFPA 5L3EA 1TNSA 1F36A 3E6MA 2H1KA 4BJ5C 3C18A 1SD7A 4A5MA 2EIJH 1Z7UA 2R93J 1ZKGA 4KMFA 2C6YA 2CSOA 1ZN2A 4LK1F 2X4HA 4D9JA 3V7CA 3ABMH 2L4AA 1X1AA 4EV0A 5BMZA 1YO5C 2O8KA 4D0PA 5LHIA 3S14J 2EFWA 3ZPLA 1QVTA 2VBXA 1PUFA 1TW3A 4LG3A 1GT0C 5HOOA 3KIOA 2ZXHA 2DK5A 5CPRB 4GDFA 4KN7X 2NRAC 2QA4I 3FK6A 2CS3A 5F27A 1UELB 1D1AA 2HNHA 4OWRB 1R00A 1BC7C 1JI8A 3IWZA 4HDUA 5LGUA 1R7JA 1YJNI 3VSKA 2AHQA 2B9SA 4LD5A 3FMRA 2HOTA 3M1CA 5LGNA 4AU7A 1HW1A 3B6CA 4PFOA 5DD8A 4B3AA 1MJBA 2MYSA 3HYIA 3RDIA 3K70C 4IOCF 1T56A 3LA2A 1IN8A 2HU9A 2QWWA 1E3OC 1VQPI 5DD4A 3KZIC 4IPAA 2YU9J 2KJCA 1HDDC 3K4LA 2P8TA 2KLOA 2JVGA 5CVIA 4KITB 5FB2A 3CC2I 3RPQA 2VOOA 2XF5A 1U0JA 2LREA 2QGUA 3DFGA 4HA8A 4DW6A 1IF1A 4L18B 4OAZA 1KGSA 3E6BA 3DKXA 1HSTA 4ESBA 2LLKA 5IY5H 1WCMJ 3JRFA 1JJ8C 2PQ8A 3DEEA 1ZAOA 2XV4S 1PP7U 5EZGA 2OBPA 3D5RC 1O3SA 2M8GX 4QLCU 4BQNA 1SAUA 2M7BA 3S93A 5E8IA 2G0EA 3I5UA 2LY1A 3QU6A 3QPSA 2E35A 3HHGA 4XLHA 5GAHJ 2BY1A 2K4JA 2DU9A 2GXBA 2G9WA 1TQMA 4A3CJ 9ANTA 1E0EA 5JFRA 5IYDJ 5CQEA 3DLLF 1EV7A 1VQ8I 2FX0A 1YJWI 4BY1J 2NVTJ 2V4JC 2BHYA 3TP3A 2AO9A 3IRQA 1RKTA 2XVCA 1WI9A 1JKPC 1BN5A 3GUDA 4Y17A 3OR2C 5M5YJ 1MMNA 2Y30A 2HTSA 3CDIA 3PIOF 1VQ6I 3S16J 1A6QA 1IUYA 1N75A 1YRNB 3VWBA 3FXRA 1EH8A 5FRMA 1J09A 2MW8A 3LAJA 2BZTA 2KISA 3FXUA 3FM3A 3V4GA 2EJRA 2WAQN 2Y48A 5FROA 4E70A 5D5UB 1WSUA 1RETA 2DA3A 4C2MJ 3WG7H 4UHTA 2DW4A 3N4MA 2YS9A 1R1TA 4UUTA 5JVTA 2RREA 4A0XA 4NHJA 1YW8A 5L3GA 1E17A 4AIKA 2ADUA 3DWLE 1ETWA 4IEJA 4KJZA 1IDZA 4Z2YA 4OOIA 3ZQCA 2X1EA 2QQAA 3RPUA 4RAFA 3F0CA 4MEXF 2DT6A 1RI7A 4KICA 1G3WA 2VKEA 4V2FA 2M8EA 3K70D 4EVIA 2XKPA 2W57A 1SEUA 1F9NA 2YSRA 2Q1ZB 4WXHA 4QSHA 5K7ZA 4IHXA 2DQRA 5IOYA 1XPXA 5B1BH 1PUFB 4LLNA 2VODA 2LMDA 2LF8A 3A03A 3H0GJ 3S3MA 3CJQB 3ZRGA 2HVRA 3NWTA 5ICGA 4F92B 4YRVA 4N9IA 1LFPA 2HZTA 1ZK8A 2IA2A 3I64A 4XSZF 3PQKA 1FX7A 3W6JB 3ULQB 2EPFA 2FA5A 1W36C 3RKQA 4DYRA 4D7MA 2E2JJ 1ZTRA 3OS2A 2NAZA 4QWQA 1G3YA 5C44J 1J9IA 3U21A 3BR2A 3CP8A 2X6WA 3EUKL 2NXNB 5K5OA 2FMYA 1XDSA 1KU7A 2VXZA 2X85A 3A01B 4FX4A 3FISA 3JTGA 4S0HB 4EATA 1NG7A 5IP7J 4QIWN 2VT3A 1UFMA 2DI3A 4GGGA 4O6JA 3V8JA 3OYNA 2IT0A 3JW4A 3I4PA 5E8GA 4AVZA 3ABUA 3O8HA 4XKWA 1JE8A 3VYUB 2NS0A 3MMYB 3HL2A 2N8GA 5GPAA 1FOKA 1HKQA 3BCBA 2VKDA 2OQRA 4A3JJ 2JQ7A 3LSHA 1ACIA 4EGYA 1MW7A 2FD5A 2XPUA 1FP1D 1WKMA 3Q0WA 4M71A 1QA6A 2ZJ2A 3F21A 5CKTA 2ZCWA 1VQMI 5EZHA 2Y9YA 4QPOA 4IL6C 2ID6A 2M34A 3I0TA 1Z7LA 2R7RA 2CYYA 2VI6A 3RPUD 1JXSA 4XN0A 3OWTA 2XAJA 1YX5A 4EJOA 2R92J 1MSEC 4EJWA 2Q2EA 3OS0A 1DPRA 4EMSA 3HPGA 1WJBA 4CH7A 2XDVA 4IOAF 2L4MA 4G7HF 1T39A 2EFPA 2P7VB 4ON0A 4A3IJ 5CVUA 4G7ZF 2L7KA 3V8KA 4YFXF 2KRHA 4RB0A 4BS9A 2Z99A 4AIJA 3WGHA 4BY7J 2VT2A 5AIPA 4E7LA 4IVNA 3KX2A 4AC0A 3V7RA 1HXDA 1TL8A 4KT5C 5E3NA 3F8CA 4BXFA 3IKTA 1G3SA 2DA1A 2E1MC 1PYVA 2PJRA 4P9FA 2DK8A 3R0JA 3H9GA 3QYFA 2FQ4A 3ECHA 5D8KB 2JSCA 4GCVA 3SXYA 1LNWA 3ZN0A 1G6NA 3TBIA 1Y8RB 3MD2A 2BVLA 2LYCA 2OTJI 4Y33A 3BLYA 5CQGA 2IEKA 3VSLA 2Q8KA 4A0ZA 1ZRDA 3OYGA 2K9MA 3BC8A 5FLXZ 1L3LA 1AHDP 5F0FA 4UY8I 3CESA 4DQ2A 3IH2A 5FFZA 1WJCA 2XF6A 1BBYA 2V9KA 2GOMA 3QPLA 3BCAA 3HSRA 2HDCA 1XSVA 4NC6A 2QF7A 3ERMA 1XMAA 5K5QA 4E7JA 4I0AA 2H8WA 4M3BA 1LJ9A 1RUOA 2LK2A 3SDGA 1ZHFA 2DMUA 4KIGA 2F6CA 3JRCA 4MO7A 2LF7A 2WADA 1P7IA 2RGVA 3RSNA 4XOTA 3GTKJ 5GAEJ 2EFOA 4DOZA 1OLTA 4EM0B 3FXJA 5EG0A 2HXOA 5GPCA 2W4SA 1K4SA 4Y7NJ 3H9QA 3DCFA 1D8JA 1WJDA 1VQOI 1I3QJ 3L9FA 2MLGA 1VQ9I 3W2AA 2PJPA 4PK4A 1N77A 4KFCA 1B1BA 2KIQA 4ZZLA 4RGSA 2ICWG 4EEFG 4DIQA 2K85A 2LKSA 1K6YA 2IW5A 3ZN1A 4B47A 1RIOH 2M1BA 1XS9A 4JYKA 5LHGA 3F9KA 2NOGA 2VASA 2QEXI 1X2MA 4XRSA 1HCRA 4XKVA 3CF2A 1LE8A 3GZ5A 1TW2A 3JAMZ 3BG3A 1JHHA 4AVPA 1N25A 3A02A 1QQIA 2O6GE 2A5WA 3PSFA 3OY9A 3QOPA 5DCMB 1O7FA 3MKYB 2EZLA 3IAM2 1WH5A 4N9HA 2GA1A 1ETYA 3IH4A 1B72B 2HEOA 1O3RA 2NS8A 3MVPA 2Z1DA 3HSFA 1P4WA 4AIHA 4BDYA 1T38A 2B63J 3WE2A 1WJAA 3SQNA 1F5TA 2CU7A 2D45A 4XL9A 2DYRH 3LSMA 1KQ0A 3G2BA 4HSRA 1D0ZA 2FOKA 1BW6A 2HYJA 4A6DA 1FJLA 3S2HJ 2OZUA 3PO2J 2L9SA 1YIOA 1FWZA 4XKBA 1RR8C 3Q9SA 1ZRFA 3F23A 3OR1C 2D5VA 3J7YJ 3FXKA 3NAUA 4E4HA 4ENMA 1U6GA 2QKLB 2L7ZA 4ANJA 3ZMDA 4FCYA 1TP4A 3ELKA 5DYMA 1TC3C 1BI3A 2CH0A 5DS9A 5M5XJ 4RDUA 2EH3A 3N97A 1IAWA 3H3UA 1T95A 1JHFA 1Y0NA 2EILH 1H88C 2H94A 3LQRA 3PNTA 3OYLA 3JRGA 3CJRB 2DQLA 2PJRB 3O6BB 2XAQA 2DA7A 1IV6A 4IXAA 5L3BA 1X1CA 1IZ1A 2HDWA 3TKYA 4ZH4F 4XMYA 1WFXA 2M30A 3GLLA 2RAEA 1A6IA 1S7EA 3K9TA 2BHZA 2DA4A 3Q5FA 3Q9VA 2DBBA 5HDGA 3BG6A 3D0SA 1D1CA 1FYMA 3VDXA 3I4MJ 3HZJA 5EF6A 3RYPA 4XRSG 3BG7A 2CFXA 2V1DA 4A93J 1FMWA 2LDUA 2CO5A 4CO8A 3HRUA 1ENHA 1HDPA 5F1JA 2WV1A 1K7AA 2BV6A 1YYVA 2DLLA 5IP9J 3DP7A 5CVRA 1T08B 4BXUA 3FMSA 5FD6A 5L3DA 3L09A 4B48A 3K4BA 4TV7A 2HOAA 2IA0A 2JPBA 4WK8F 3BJAA 4D5CA 4M73A 4B44A 1O7LA 4XOPA 2O7OA 1H9TA 1T6SA 2VKHA 5FKLA 4BDZA 2XROA 2WWYA 4XICA 1LB2A 1J2XA 4RAZA 4WX9A 4JX4A 1ZQ3P 1QHHD 2R5ZB 1YJ9I 3U1DA 3CO6C 2CQQA 4I01A 1GV5A 3KP7A 3IUOA 1NHAA 1WGXA 3E5QA 3H3ZA 1FBSA 3HRSA 3BT9A 1D3YA 3SHFA 3H5NA 1I1GA 4NNJA 5F6FA 1O57A 1RZ4A 3VEPA 2ZMEC 4ZDLA 4IO9F 4XONA 3RTRA 5BQTA 2R7TA 3WG9A 3BTJA 3HOZJ 1TQIA 1Z3XA 2VXDA 4GO1A 4BACA 2GXGA 2HPMA 3CLOA 1Z77A 2CW8A 3CUOA 4PDKA 1LE8B 3GXOA 3LNQA 1MSFC 2IGKA 3H92A 3IV5A 1MMSA 1OCZH 2XPVA 4MNUA 2JJ7A 2KJBA 2M87A 2WAEA 3SZPA 2ZMEA 2O03A 4KN4X 1D0XA 1UG0A 4XBFA 4DZPA 5M3MJ 1APLC 2UUZA 2A6TA 3SEZA 1FPQA 3SFIA 1P92A 3PFYA 5A2QZ 2E2IJ 3C7JA 3WTUC 5J8CA 4P96A 1VQNI 4PGHA 2ECCA 1X58A 1M1EB 2EV6A 2A05A 2JTVA 3AG1H 2L9VA 2ZC2A 2L54A 4AIDA 2J5OA 4II2A 1ZYRF 4L9NA 1FOWA 3REOA 1Y56A 1UHMA 2Y75A 2ECBA 2L7MP 3KEOA 1HLVA 3W3CA 3CC4I 3W2WA 3X2QH 3CCRI 2NOJB 5KK1A 4MLOA 3S3OA 2L3DA 2JSPA 4I7HA 3CZ6A 2YX7A 1R1UA 4K2EA 2OTLI 3DTKA 1UAAA 3OYHA 5H20A 1ZLKA 1WZ2A 2FXAA 4C30A 5E3MA 3G1MA 2OUMA 4G9YA 4KIFA 1STZA 2K7LA 2FQ3A 5FLXK 1YW7A 3M7GA 4GRIA 3WTYC 5J1YA 4OAYA 4IQ4A 4I99C 3G3ZA 2FBKA 1H0MA 1BL0A 2WY7Q 2K3FA 1R49A 2GQQA 3I59B 3LSGA 5BPDA 1NG6A 2L01A 2FSWA 3B73A 1NK3P 2RKHA 3KCCA 2JN6A 1FYLA 3DPTA 2VPRA 3H1CA 2AQEA 5D4SA 3LWFA 3BR6A 4ZZDA 1SVLA 1YRNA 2F5DA 2R5YA 3QP5A 3BR0A 1G2HA 1XB4A 1GVDA 1IXCA 1V54H 4HNTA 1ON2A 3WHBA 3K10A 1ZG3A 4PSWA 1YOVB 4DBQA 1UJ8A 1KYZA 3ZMSA 1B6AA 1MJ9A 2KMUA 1JJ6C 1N78A 2CUZA 4HX7A 1MBKA 2ISZA 3A1YA 2OCCH 3DV8A 3AL0C 3I3LA 4WXDA 2OC6A 5K7HA 4U87A 5KCMA 2COMA 1KU3A 2JA5J 1TTYA 2Z5UA 2Z9OA 1LFBA 3J80Z 5LLQA 4XORA 3BQYA 2MD5A 3JCUC 3IRRA 1WHUA 2FBIA 3K2AA 3HOWJ 5DM7F 4HAMA 4ETSA 2M9HA 4BJTA 2DA2A 3TEDA 3O3KA 2ZXWH 1FYKA 3EETA 4IQJA 3ZQLA 4MTEA 1RESA 1R71A 1BR1A 4BHCA 2GOXB 3BPVA 1ULYA 3EYIA 3IAS2 5LRSA 2MH2A 3JAMK 2M0CA 2K9LA 3KP2A 4V19K 2X1CA 4YELA 3KPHA 4BJ6C 2LVSA 4L5IA 2KKOA 5J1UA 5J8FA 2DMQA 1R22A 4OMYA 4OINF 1Y1WJ 3TMOA 2B0LA 4C3JJ 4XKCA 2LY2A 5LBQA 1IW7F 1FBQA 5K1YA 3BZCA 4S05A 3A01A 1YI2I 1AU7A 3OYMA 4G8XA 2JUGA 2G7UA 3BTIA 3E0JB 5JI6A 2VQCA 1S72I 4OMZA 5ICFA 1FLIA 4V2GA 1C0WA 4GXOA 3HEFA 2HKOA 2VBZA 4A3FJ 2H6CA 2QZ8A 5EGOA 2E60A 3SYTA 5J47A 1VFCA 3BJ6A 1MH3A 3LAPA 3LMMA 4G6DA 1LDKB 4HQEA 2ZMEB 3QYEA 1LVKA 4FX0A 4JX6A 3G4SI 2CUFA 3M9AA 1MIJA 1R58A 2M7AA 4M9SA 3SDBA 2VQHA 2XASA 2DCEA 1FEXA 1YLFA 1IRFA 2PLYA 4BGDA 2VQLA 2DJIA 3ZMZA 2DFEA 4BQOA 1OYYA 5DUKA 2V9VA 3WGIA 2F5CA 4EJUA 4DNCA 5H2FC 3OL4A 1IN4A 1OISA 1LEBA 1K83J 2VC0A 4CCJA 3KYDB 2IGNA 5EDNA 3HSEA 3R4KA 1D5VA 3S17J 4BYYA 3ZOBA 4D1QA 2CQ7A 4LK0F 3WTWC 3OIQA 2IRFG 3P9CA 3GYHX 2MBFA 4BH9A 3MKZA 2F2EA 5AONA 3F6OA 1W1WE 1IXRC 3NARA 4A3BJ 3BOQA 3WODF 4CSWA 1UZCA 2VJJA 3L7WA 2VBYA 2DO7A 3TO9A 1SD4A 1X3ZB 1V5EA 2LR8A 1IJWC 4MFDA 3UKGA 1O3QA 2ID3A 4I09A 2DXIA 2HKXA 4OIQF 3E5UA 2HR3A 3VOEA 3ISPA 2VJIA 2TCTA 2F5FA 4EJTA 1B9MA 5E1ZB 5EEGA 5CJ9A 2FBHA 1IO2A 3F3XA 3CJNA 4ENKA 4XM3A 4A3GJ 3DKWA 1OCPA 1R5GA 2R5YB 5B3SH 3ZXSA 1BOAA 4CA0A 3LSIA 2FEZA 1NK2P 4RA2A 5HODA 1LDDA 5J4YA 4IHYA 2XKOA 3QQAA 1GHCA 2KZVA 3KP5A 4F7ZA 2K4BA 2MABA 2OU2A 3PQJA 2LKXA 1DU0A 2XAUA 4M6VA 1MNEA 1W7PA 5FD5A 1TQPA 3OYEA 3HBLA 3M1EA 3B02A 1UB9A 1RC9A 3H3VK 2X6YA 2ZJRF 2OA4A 1YHQI 2DA5A 3BWGA 4PGGA 2KDZA 3CMMA 5J4VA 4G6TB 1U8RA 2L5QA 1LQ1A 4CCLA 4U88A 2HYGD 3QODA 1FIAA 3EPZA 5TRDA 1Z67A 4MQ9F 1E3PA 3NRVA 3MKLA 3GLXA 2R0QC 3JREA 1P7JA 4E6KG 1XMKA 4CCNA 4XRMA 3AL0B 3HOXJ 4Q5SF 2KT0A 1SVMA 2IA1A 3PO3J 2X9DA 2Q0OA 1H9GA 1MMGA 5ERIA 3RKWA 5GADJ 3E3VA 2JZYA 1PDNC 3AFHA 2MA3A 3VYRB 2R7WA 1I27A 4HYEA 3AG4H 3OIPA 5LEJA 4IRHA 2BY3A 2L9NA 3CCLI 2EZKA 2FRHA 2R3SA 2HI3A 2ZJQF 3ZQFA 3GFJA 5A2QK 1D1BA 4R1HA 3ASOH 4I2OA 2KRFA 1I3AA 5FGMA 2FUG2 2QQBA 3KZYA 1EA3A 3I56I 1OMIA 3SZTA 1ZG1A 1VZ0A 4LMYA 4LIVA 2R7UA 2Y9ZA 3P9KA 4A3KJ 5EGOB 3TO7A 2DODA 1V3FA 1JGSA 2LTPA 1S9HA 1MNDA 5F0CA 2DFFA 4U0YA 4S04A 2K02A 3L1PA 2DDBA 4L0YB 5DCMA 2IPQX 5FJ8J 2PEXA 2DFIA 2TRTA 2HVQA 2IVMA 1OCCH 4PJ0C 3HXLA 2VLAA 1F4KA 1B72A 1JT6A 2K5CA 4G94A 2ACJA 1W7PD 2EINH 3O2PE 3MAJA 3GCMA 3GVAA 3M8JA 1ODDA 2HQAA 4H0EA 4NC7A 3D5SC 4IJAA 2H27A 2JA7J 2H6BA 2HZDA 2OCEA 2Y2ZA 2DOFA 5GAGJ 1X1BA 2WB1A 1QPMA 4WF2A 1F1ZA 2Z16A 1W4MA 1BI0A 1OKRA 1KQ8A 2KPMA 4B1RA 2W7NA 2UZKA 3C3WA 2XRLA 3DBLB 2KZGA 1SAXA 3ZQIA 3QPTA 1TLHB 4ZYGA 2QSHX 2LFBA 4IF4A 3GZ6A 1P2FA 1R5HA 2VB6A 2R7QA 3T8TA 2YU3A 3E7LA 3L2RA 2XC7A 2CQKA 2PBIA 1Y0UA 2GAUA 1OJLA 1BA5A 3WTZA 1TWAJ 5KHDA 2NNNA 3OYJA 2JA2A 3NQOA 2MGQA 4M3FA 2UXXA 1FNNA 3BG9A 3S2WA 3J80K 2EZHA 2GA2A 2KIFA 2D1VA 4PUSA 3CQZJ 4HDVA 4RGXA 3KP6A 1PUEE 2HDDA 1WJ5A 3L00A 1D8KA 2DN0A 2DOEA 2GBYA 2ZFUA 1W36D 2V1NA 3CCQI 2DMPA 2CMPA 1Y6IA 5HS9A 4Y13A 1AKHB 3FK7A 4BQAA 5FO5A 3FXQA 5HLIA 2BGCA 2QCOA 2VOPA 1X3WB 2NVYJ 1R1VA 4HX4A 1YW9A 1U5TC 1W7PB 4NQWA 1SANA 4XLNF 1MMAA 1I39A 4ASNA 1S7AA 1YQAA 5DV5A 2X6XA 2KRCA 4KISA 1XGOA 2TDXA 3BR3A 1USTA 3PUBA 4RB1A 2STWA 2GM4A 1USSA 4N4NB 1MDMA 3LQQA 1QGPA 4NUBA 2WV0A 4M9XA 2EFQA 3K1NA 1GVJA 2HS5A 4B8XA 1FTZA 4HV5A 3V8LA 5F08A 4E7KA 1Z6TA 3DKYA 1TT5B 4F55A 1HW5A 2XGXA 1X1DA 4IHSA 5KVRA 1ONVA 4A6EA 1BJAA 2LOOA 3QYBA 1FOYA 2MLKA 3QU3A 2JVHA 1RPWA 1UG2A 4PCQA 3HG9A 4FHTA 3C1DA 1FT9A 1U9OA 1JKQC 4N4OB 1AOYA 1YG2A 4XR6A 2R5ZA 4LITA 4JBAA 2MFZA 1OYWA 5E1XA 2DYSH 2Y0SA 3BJOA 3CF5F 2FU4A 2HQRA 4CICA 2V1XA 1E2XA 2QKMB 2OF7A 2E7WA 3HC7A 4F3QA 1MGTA 2QYOA 2CGPA 2WTEA 1VQ7I 2DT5A 1BW5A 2XGDA 1B4AA 2J5PA 4E7IA 3RZOJ 4FQGA 1T33A 4MIMA 1ZREA 3FBNB 4YEJA 1T0FC 2E1NA 1XD7A 1X19A 1R4MB 2KP6A 2HQ5A 3H36A 2ME0A 3PFIA 1MBEA 2VPLA 1SFKA 3HDDA 5L3FA 2WY8Q 1BI2A 2EZIA 1U2WA 1T0FA 1G4DA 3QAHA 2L02A 4HG2A 1K4TA 3H5RA 3LFKA 1UHSA 1YE9A 2M4KA 2VE8A 1YS7A 2RQPA 1BM9A 1K79A 3FBIB 2EV0A 3OYCA 3FDYA 2WC2A 1NTCA 2XAFA 5K7FA 1IN5A 2PMUA 4OU0A 2F4IA 2I8DA 4UB8C 3S2DJ 1V4RA 1MZBA 1HA8A 3FXOA 3FX3A 1QU3A 3J7AY 3JRBA 4BEHA 1J59A 1B8IA 1IG7A 2P7CB 5HS7A 2A6EF 1AA7A 3MCZA 1XSDA 2D1HA 4CHUA 2MC3A 3RYRA 2R7XA 1A36A 4UVAA 3ZMUA 3DXJF 4XIDA 4QTRA 4GYIA 3I59A 1S6LA 5E3LA 3Q0UA 2GWRA 3KP3A 2X1DA 2LKPA 2KQRA 3ZP5A 3WU2C 4U7BA 4YIRX 2VONA 3KFWX 3MZHA 2O0YA 1DQUA 4UV8A 2ELJA 3GX4X 3LL7A 3QRFF 4G12A 3K69A 2FJ1A 4BU2A 4P9UA 3SJMA 1A31A 2RQQA 4II3A 1FSEA 3PJRA 3FMQA 3GWZA 4LB5A 3OOPA 4UNOA 3FF5A 2HOEA 2E1MB 4NQWB 4ZYAA 1GLNA 1DGWY 5FKNA 2O3FA 1CQTA 2WA0A 5KAFC 3IP4B 3GFLA 5FRNA 3FHNA 4AUXA 3A0BC 3R60A 1P6RA 4I76A 2CW0F 2PMZA 4PZJA 5D6EA 2DMNA 1AWCA 5BOXA 3DPLC 1OYIA 4B4CA 4Q4ZF 5TISC 3BROA 4XSXF 1U5TB 2AQFA 4PJNA 4U7DA 3CCJI 1MDMB 2YPRA 2R4GA 2NNYA 1VQ4I 4IHWA 3FHZA 2VE9A 4FASD 2XGCA 3RQIA 4ZDOA 3I55I 3LSKA 3LFUA 3R0AA 4LG0A 4C9YA 5AIQA 1BIAA 3K6GA 1Z1DA 3ABLH 4DJAA 2QENA 3G73A 1KA8A 3RZDJ 2R7OA 1R6RA 2WAQA 4CCKA 4D7NA 3FXLA 1FSHA 1XG1A 3T5XA 1WJEA 2X51A 4KIBA 2P4WA 1BIBA 3JSPA 1A5JA 4XLCA 5IT9Z 1K78B 5ED4A 4CGZA 3HKZA 4KT6A 3S1QJ 2V6CA 2HPIA 5H6RA 1UCRA 2R7FA 3MZ8A 1GDTA 1SFEA 2F48A 2H09A 5DEQA 2FMLA 1YS6A 2DTRA 1YIJI 3DLAA 1FTTA 4B43A 3H5AA 1S29A 2ESNA 3TOBA 1HW2A 2XAHA 2KHMA 4DBRA 3S32A 3GZNB 1MBGA 3F8MA 3GBGA 3OYBA 1TNTA 1MJAA 1W5SA 3BZKA 1JUMA 3EUHC 4U0VA 1JKRC 1J75A 4RGRA 4FISA 2YR2A 2PFBA 3TGNA 3AAFA 4BXXJ 1CF7B 2XF7A 5FKOA 1QO0D 4DGWB 4ENJA 1XMXA 2WB1N 1SMTA 1ON1A 1QZZA 3K1MA 4O5VA 2Z2SB 3E97A 2Z3YA 3EUHA 4HEA2 2PMHA 3K4KA 2QSGX 4BBSJ 5EYRA 2A3SA 3GFMA 4HBLA 2LP0A 3ECOA 4M74A 3IL2A 3I4NJ 2CG4A 2A68F 4F93B 2W48A 2AXTC 2Y0MA 2Y31A 2MSYA 4A2UA 2I5UA 5E17F 3DBHB 2XSJC 3PUFA 3VODA 3S1RJ 3CCVI 1XX5A 3TDZC 2M3AA 3CC7I 4HF0A 3GFIA 4BEHB 4UV9A 1B8IB 1QZYA 3PIPF 1Z21A 2L7FP 3P5JA 3HTSB 2RN7A 2KIMA 2E1OA 1Z3YA 3FM5A 1X2NA 2JMWA 5HNHA 4C2UA 1WRJA 2K27A 2FF4A 1KONA 3CO7C 1FP2A 2KDOA 5IPAA 3ESWB 3WTSC 3PM1A 3LSTA 4ZYEA 2EA4A 4P55A 3AKZA 1XN7A 2ZBKA 3V42A 4HF1A 5D5XB 3JRHA 2IGOA 2O8XA 3L2QA 3GTGJ 2JA8J 3RQ4A 4HOBA 1I50J 2M4GA 1D5YA 4LFUA 2GIZA 3BTLA 1EH7A 3WGGA 1ETXA 4DZJA 5E79C 2ZO4A 2XHKA 2HFHA 3KEYA 4KA4A 3RKYA 2ELHA 1QHGA 2W25A 4CYCA 2NS7A 4XNFA 1Y1VJ 4J19A 3GTPJ 2FNAA 2M5WA 4M9ZA 4XK4A 3E1SA 3I9V2 3HIFA 3DPUA 1TWFJ 3TW6A 3ZCOA 2IBDA 3BR1A 3I71A 3IHUA 4B3XA 3VB2A 1DGRM 4HPQA 5FLMJ 1LVAA 1G8XA 1TT0A 2XPWA 4LG0B 1U3EM 2CJJA 4E7ZA 3JRAA 5LD2C 1IC8A 4CZCA 3ZGKA 3K0LA 1SMYF 5BPIA 3A4CA 3GW2A 4A3MJ 1IRGA 1MMDA 5EJCA 1QVUA 2A69F 2Y0SN 1ZGAA 1CGPA 4ZYHA 4XLPF 4AD9A 3GTQJ 4MFEA 2K3PA 1OCTC 2G7HA 2ZXJA 2BOLA 3L2CA 1V5FA 1EH6A 1KYWA 4M3EA 4CCOA 4DYCA 1YITI 4M72A 3R6SA 3OV8A 1ZELA 3S1MJ 5BS6A 1WWXA 1HBXG 3J7AO 3RIRA 2M0MA 4EM2A 3BR5A 3G71I 3PL8A 1TBXA 1H89C 3WTVC 2E2HJ 1TWCJ 3PSIA 3IWFA 2QUFA 3EUAA 1RUNA 1GXPA 2STTA 4FE4A 3U1KA 5B5EC 2KIUA 4KNYA 5GTIC 4MGRA 1SD5A 2EA2A 4PJJA 1B59A 1W0UA 2F4MB 3TO6A 3W6VA 3KEQA 4C3HJ 2QSFX 4FTHA 3CCYA 4UUSB 3MN2A 2R7SA 3S3NA 1XC5A 3CMAI 5LFAA 3L2WA 4JQFA 2CW7A 2D2WA 2X48A 3UR3C 3TW7A 2IS6A 2F5EA 3CJTB 4BE1A 2FNPA 2OPTA 3H9JA 1IN7A 2V26A 3MQ0A 5FKKA 1OR7C 3F8NA 4XQFA 5GTHC 2ZKZA 4CZZA 2OAZA 5JLWA 2JT1A 4AYBA 2K9QA 1EF4A 4LJZF 1S8NA 3QWLA 4BKXA 4BBRJ 2V1UA 1HSJA 1GXQA 4LLLA 1VNDA 4UB6C 2E19A 3DEWA 1OR7A 1Z0XA 4LIUA 2RV8A 4PSXA 1X1PA 2JRTA 2P6TA 5BNGA 1XDUA 2CWEA 3HB9A 1XGSA 3DF8A 5CYVA 3S8PA 3KETA 3OYKA 4LGWA 1Z6RA 3KE2A 5D4RA 3OSFA 2QBYB 3CMEI 2CQXA 1WQ2A 4IRGA 2JWTA 2XB5A 1TWHJ 2DDAA 2RNJA 1X4PA 1V5GA 3KYLA 2OZ6A 4ZTJA 1ZRCA 3LA7A 3SZGA 4RB3C 3K4CA 3H0DA 1RR7A 2ZSIB 3FIWA 2BY2A 1DP3A 2IAIA 1QRYA 3CCEI 2PMZN 4RM3A 1AKHA 2DPUA 5CVJA 4NBQA 1R5ID 1SC7A 5ILSA 3HTUA 4Y15A 5CVVA 3ZQHA 4P1WA 2QVOA 1JT0A
chains in the Genus database with same CATH topology
4BHBA 5J6XA 4XRFA 2HWVA 2RC4A 5IT9K 1I1SA 5DUIA 1IXSB 2Z33A 1R23A 2O61A 1BI1A 3RKXA 3HRTA 4KYWA 1XSXA 3BZ6A 3NEUA 5LHHA 1IN6A 3T8RA 3CTAA 4M6XA 2DAOA 4YFNF 1LEAA 2IJLA 5HDNA 2GZWA 1P4AA 3WE3A 4O3MA 5D5WB 3ZQ7A 4YG2F 1HKSA 4I0BA 4L0ZB 3FZVA 4A5NA 1S3JA 4IHTA 1I5ZA 3TDUC 3BDDA 2W84A 2PN6A 4R79A 2FE3A 1XCBA 4UVBA 1QBJA 3F6VA 3K2ZA 1LDJA 2AXLA 1PP8F 4YIIA 3DEUA 4WCGA 2LNBA 3BPXA 1X3UA 1XCVA 3T1BA 4BHPA 4KMUX 2VC1A 3U2RA 6PAXA 4EJVA 2HQNA 2X0LA 2HYFA 1W5TA 1HKTA 3J81Z 1Z91A 3LA3A 3DQVC 5HLHA 1S7OA 2PI0A 4M6YA 3BP8A 4L5JA 4A0YA 1OPCA 1RNLA 3IC7A 3GF2A 5H6QA 3ABTA 2YX4A 3HOSA 1G3TA 3MZYA 2V79A 2A07F 5LEKA 5JR3A 3I58A 3TOAA 1Z05A 3QP6A 1KQ9A 1SD6A 3F22A 3WU1B 1FY7A 3WTTC 3P7NA 1U5TA 3M8FA 2BYVE 4OIOF 2VN2A 1YTYA 1K6OA 4ENNA 3QPHA 3F8BA 2EFNA 2XRNA 1ZH5A 1DDNA 4MEYF 3WU0A 1K78A 3JTHA 4RAYA 3ROUA 3ERED 3CUQC 2MH9A 3E5XA 4RS8A 4WWCA 1FBUA 3CUQA 5E18F 2EB7A 1REPC 2E1CA 2A61A 4R8HA 1I6XA 1J5YA 2P5LC 1CF7A 4UXNA 5F1RA 4I02A 5ILUA 5DDGA 4CYDA 3HUGA 3EDPA 4UUVA 1HQCA 5HDKA 1MD0A 5CLSA 2EK5A 3F72A 5HVQC 1T2KA 3IKVA 4ZYDA 5D6FA 4B09A 3P9IA 3V7SA 3F8FA 4HW0A 5D8LB 4OIRF 2JPCA 5ICEA 2OD5A 4EQQA 4LLGF 3EQLF 2NYXA 2A5YB 2P5KA 3KZZA 5DCFA 4A12A 1FZPB 3GO5A 3D5LA 5D5VB 3R61A 1L0OC 2UWMA 4HZFA 4I98B 1ZG5A 4HLXA 4N0BA 2AS5F 4Q47A 4MHGA 1VTNC 4CXFA 4L9TA 2ETHA 2QM3A 2RDPA 4YIFA 5IT3A 3ZMVA 4P5OA 4FT8A 2P6SA 3ZMTA 3E6DA 3EYYA 2RVCA 1QNTA 4IRIA 4YFKF 3ML6A 3BY6A 4UVCA 1DP7P 1XGMA 4NB5A 2W24A 4AWXB 2HGCA 4ESJA 1U78A 3MWMA 4RB2C 3I54A 2OQGA 4L9JA 5EEHA 1MKMA 2GIVA 2UXNA 3T0YA 1DPUA 5LRRA 1YFHA 3KLOA 4BNCA 2VBWA 4HV6A 5HS8A 5L3CA 5LGTA 3CDHA 3RI4A 4G7OF 1DUXC 2BEOA 2EV5A 3RJPA 4MTDA 2PG4A 2ZNYA 1XGNA 1P4XA 1UHWA 2P5VA 1SFUA 3K1PA 3CUQB 3E6CC 2ZNZA 5FFXA 4WXCA 4HLYA 2XIGA 4GYGA 2M45A 4LB6B 1R36A 5TJJA 3HOTA 3J81K 2BBYA 4L9VA 4KDPA 1ZLJA 3KP4A 2K86A 4HQMA 2W85A 4CDGA 3I53A 2ZFWA 3HRMA 3FWEA 1Z9CA 3COAC 4U0WA 1ZGJA 2IP2A 4EGZA 3M8EA 1Q1HA 1FC3A 5JHUA 4KUMA 5K5RA 2HTJA 1BC8C 5E20A 4JK1X 4EM1A 2EWNA 3GEZA 3VFZA 5F64A 1J0RA 5ICCA 2QBYA 3U9GA 1KU9A 2A6HF 4G6QA 3WTXC 4BAYA 4HX8A 2QQ9A 4ESFA 4OIPF 3JSOA 2ISYA 5ILVA 2XUBA 2ESHA 1T98A 1B9NA 4RGUA 5E1WA 1J7KA 3KLNA 2BE5F 2LSOA 2E7XA 2QLZA 5HLGA 2DPDA 3HHHA 4Q48A 3TQNA 4MQVA 1O3TA 1A04A 2XAGA 3MEXA 2R7DA 1ZARA 3SFZA 3MFKA 1KU2A 1SFXA 3W6KB 5L3EA 1TNSA 3E6MA 3C18A 1SD7A 4A5MA 1Z7UA 4KMFA 2C6YA 2CSOA 1ZN2A 4LK1F 2X4HA 3V7CA 2L4AA 4EV0A 5BMZA 1YO5C 4D0PA 5LHIA 2EFWA 3ZPLA 2VBXA 1TW3A 5HOOA 2DK5A 4KN7X 2NRAC 1R00A 1BC7C 3IWZA 4HDUA 5LGUA 1R7JA 4LD5A 3FMRA 5LGNA 1HW1A 5DD8A 1MJBA 3HYIA 3RDIA 3LA2A 1IN8A 2QWWA 5DD4A 4IPAA 2KJCA 2P8TA 5CVIA 5FB2A 2VOOA 3RPQA 4HA8A 3DFGA 1IF1A 4L18B 1KGSA 3E6BA 1HSTA 4ESBA 2PQ8A 1ZAOA 2XV4S 1PP7U 2OBPA 1O3SA 4QLCU 5E8IA 3I5UA 3QU6A 3HHGA 2K4JA 2DU9A 2GXBA 2G9WA 1TQMA 5JFRA 1EV7A 3IRQA 2XVCA 1WI9A 1BN5A 3GUDA 4Y17A 2HTSA 1IUYA 3FXRA 1EH8A 3LAJA 3FXUA 3FM3A 3V4GA 2EJRA 2Y48A 4E70A 1WSUA 5D5UB 4UHTA 2DW4A 3N4MA 5JVTA 1R1TA 4A0XA 4NHJA 1YW8A 5L3GA 1E17A 4AIKA 2ADUA 4Z2YA 4OOIA 2QQAA 3RPUA 4MEXF 1RI7A 4KICA 1G3WA 2M8EA 4EVIA 2XKPA 2W57A 1F9NA 2YSRA 4WXHA 2DQRA 4LLNA 2VODA 2LF8A 5ICGA 4N9IA 2HZTA 2IA2A 3I64A 4XSZF 3PQKA 1FX7A 3W6JB 3ULQB 2FA5A 2NAZA 4QWQA 1G3YA 1J9IA 5K5OA 2FMYA 1XDSA 1KU7A 2VXZA 4FX4A 3JTGA 2VT3A 1UFMA 2DI3A 4GGGA 4O6JA 3V8JA 2IT0A 3JW4A 3I4PA 5E8GA 3ABUA 1JE8A 2NS0A 1FOKA 1HKQA 2OQRA 4EGYA 1FP1D 1WKMA 4M71A 2ZJ2A 3F21A 2ZCWA 3I0TA 2CYYA 1JXSA 2XAJA 4EJOA 4EJWA 2Q2EA 1DPRA 4EMSA 2L4MA 4G7HF 1T39A 2EFPA 2P7VB 4ON0A 5CVUA 4G7ZF 3V8KA 4YFXF 4RB0A 2Z99A 4AIJA 3WGHA 2VT2A 5AIPA 4IVNA 3V7RA 1HXDA 4KT5C 3F8CA 3IKTA 1G3SA 4P9FA 2DK8A 3R0JA 3ECHA 5D8KB 2JSCA 4GCVA 3SXYA 1LNWA 3ZN0A 1G6NA 2Q8KA 4A0ZA 1ZRDA 5FLXZ 1L3LA 4DQ2A 5FFZA 1BBYA 3HSRA 2HDCA 1XSVA 1XMAA 5K5QA 4I0AA 1LJ9A 1RUOA 1ZHFA 4KIGA 2LF7A 2RGVA 2EFOA 4EM0B 1D8JA 3L9FA 2MLGA 2PJPA 4KFCA 1B1BA 4ZZLA 4RGSA 2IW5A 3ZN1A 1RIOH 2M1BA 5LHGA 3GZ5A 1TW2A 3JAMZ 1JHHA 4AVPA 1QQIA 2O6GE 3QOPA 5DCMB 1O7FA 4N9HA 2GA1A 2HEOA 1O3RA 4AIHA 3HSFA 1P4WA 1T38A 3WE2A 3SQNA 1F5TA 2D45A 1KQ0A 2FOKA 4A6DA 2OZUA 1YIOA 1FWZA 3Q9SA 1ZRFA 3F23A 4ENMA 1U6GA 3ZMDA 3ELKA 5DYMA 1BI3A 3N97A 1IAWA 3H3UA 1JHFA 2H94A 3LQRA 2DQLA 3O6BB 2XAQA 4IXAA 5L3BA 1IZ1A 3TKYA 4ZH4F 2M30A 3K9TA 3Q5FA 3Q9VA 2DBBA 5HDGA 3D0SA 1FYMA 3RYPA 2CFXA 2V1DA 4CO8A 2LDUA 2CO5A 3HRUA 1K7AA 2BV6A 1YYVA 2DLLA 3DP7A 5CVRA 4BXUA 3FMSA 5FD6A 5L3DA 3L09A 4TV7A 2IA0A 2JPBA 4WK8F 3BJAA 4M73A 1O7LA 1H9TA 1T6SA 2XROA 2WWYA 1LB2A 1J2XA 4RAZA 4WX9A 3U1DA 3CO6C 4I01A 3KP7A 1NHAA 3E5QA 3H3ZA 1FBSA 3HRSA 1D3YA 3SHFA 1I1GA 5F6FA 1O57A 1RZ4A 3VEPA 3RTRA 5BQTA 3WG9A 1TQIA 4GO1A 2GXGA 3CLOA 3CUOA 4PDKA 3GXOA 3H92A 4MNUA 2M87A 2KJBA 3SZPA 2ZMEA 2O03A 4KN4X 4XBFA 1FPQA 1P92A 5A2QZ 3C7JA 3WTUC 5J8CA 4P96A 4PGHA 2JTVA 2EV6A 2L54A 2J5OA 1ZYRF 4L9NA 3REOA 3KEOA 1UHMA 2Y75A 5KK1A 2L3DA 4I7HA 2YX7A 1R1UA 4K2EA 5H20A 1ZLKA 2FXAA 4G9YA 4KIFA 1STZA 2K7LA 2FQ3A 5FLXK 1YW7A 3M7GA 3WTYC 3G3ZA 2FBKA 1H0MA 2GQQA 3I59B 5BPDA 2L01A 2FSWA 3B73A 2RKHA 3KCCA 1FYLA 3DPTA 5D4SA 3LWFA 4ZZDA 2F5DA 3QP5A 1XB4A 1IXCA 1ON2A 1ZG3A 1KYZA 3ZMSA 1B6AA 1MJ9A 4HX7A 2ISZA 3DV8A 4WXDA 2COMA 1KU3A 1TTYA 2Z5UA 2Z9OA 3J80Z 5LLQA 2MD5A 3IRRA 2FBIA 4HAMA 4ETSA 3O3KA 1FYKA 3EETA 4MTEA 4BHCA 3BPVA 1ULYA 3EYIA 5LRSA 2MH2A 3JAMK 3KP2A 4L5IA 2KKOA 5J8FA 1R22A 4OMYA 4OINF 2B0LA 5LBQA 1IW7F 1FBQA 5K1YA 4S05A 4G8XA 2G7UA 5JI6A 4OMZA 5ICFA 1FLIA 1C0WA 4GXOA 2HKOA 2VBZA 2H6CA 2QZ8A 3BJ6A 3LAPA 4G6DA 1LDKB 4HQEA 2ZMEB 4FX0A 3M9AA 1R58A 4M9SA 2XASA 1YLFA 1IRFA 2PLYA 3ZMZA 1OYYA 5DUKA 2V9VA 3WGIA 2F5CA 4EJUA 4DNCA 1IN4A 1LEBA 2VC0A 3HSEA 3R4KA 1D5VA 4BYYA 4LK0F 3WTWC 2IRFG 3P9CA 3GYHX 2MBFA 4BH9A 2F2EA 5AONA 3F6OA 1IXRC 3BOQA 3WODF 3L7WA 2VBYA 2DO7A 3TO9A 1SD4A 1O3QA 4I09A 2HKXA 4OIQF 3E5UA 2HR3A 3VOEA 3ISPA 2F5FA 4EJTA 1B9MA 5E1ZB 5EEGA 5CJ9A 2FBHA 3F3XA 3CJNA 4ENKA 3DKWA 1R5GA 1BOAA 2FEZA 1LDDA 2XKOA 1GHCA 3KP5A 4F7ZA 2K4BA 2OU2A 3PQJA 1W7PA 5FD5A 1TQPA 3M1EA 3B02A 1UB9A 2OA4A 3BWGA 4PGGA 1U8RA 1LQ1A 4U88A 2HYGD 5TRDA 4MQ9F 3NRVA 3GLXA 1XMKA 4Q5SF 2IA1A 2Q0OA 1H9GA 5ERIA 3RKWA 3E3VA 2JZYA 1PDNC 2MA3A 1I27A 4HYEA 5LEJA 4IRHA 2FRHA 2R3SA 3GFJA 5A2QK 4R1HA 4I2OA 2KRFA 5FGMA 2QQBA 3KZYA 1OMIA 3SZTA 1ZG1A 4LMYA 3P9KA 3TO7A 1V3FA 1JGSA 4U0YA 4S04A 2K02A 4L0YB 5DCMA 2IPQX 2PEXA 2DFIA 2IVMA 1F4KA 4G94A 2ACJA 1W7PD 3O2PE 3MAJA 3GVAA 1ODDA 4H0EA 4IJAA 2H27A 2H6BA 1QPMA 4WF2A 1F1ZA 1W4MA 1BI0A 1OKRA 1KQ8A 2UZKA 3C3WA 1SAXA 3QPTA 1TLHB 4ZYGA 4IF4A 3GZ6A 1P2FA 1R5HA 3T8TA 2YU3A 2CQKA 2PBIA 1Y0UA 2GAUA 3WTZA 2NNNA 3NQOA 2UXXA 1FNNA 3S2WA 3J80K 2GA2A 2KIFA 2D1VA 4HDVA 4RGXA 3KP6A 1PUEE 3L00A 1D8KA 4Y13A 5HS9A 4BQAA 5FO5A 3FXQA 5HLIA 2BGCA 2VOPA 1R1VA 4HX4A 1YW9A 1U5TC 1W7PB 4NQWA 4XLNF 4ASNA 1S7AA 1YQAA 5DV5A 1XGOA 2TDXA 1USTA 2STWA 4RB1A 1USSA 1MDMA 3LQQA 1QGPA 2WV0A 4M9XA 2EFQA 3K1NA 1GVJA 2HS5A 4B8XA 4HV5A 3V8LA 1Z6TA 1HW5A 2XGXA 4IHSA 5KVRA 1ONVA 4A6EA 1BJAA 2MLKA 3QU3A 4PCQA 4FHTA 3C1DA 1FT9A 1AOYA 1YG2A 4JBAA 1OYWA 5E1XA 3BJOA 2FU4A 2HQRA 4CICA 2V1XA 1E2XA 2E7WA 1MGTA 2QYOA 2CGPA 2WTEA 2DT5A 1B4AA 2J5PA 1ZREA 2E1NA 1XD7A 3PFIA 5L3FA 1BI2A 1U2WA 1T0FA 1G4DA 3QAHA 2L02A 3LFKA 2VE8A 1YS7A 2RQPA 1BM9A 1K79A 2EV0A 2WC2A 2XAFA 1IN5A 2PMUA 4OU0A 1V4RA 1MZBA 3FX3A 1J59A 2P7CB 5HS7A 2A6EF 3MCZA 1XSDA 2D1HA 4CHUA 2MC3A 3RYRA 4UVAA 3ZMUA 3DXJF 4GYIA 3I59A 1S6LA 2GWRA 3KP3A 2LKPA 3ZP5A 4U7BA 2VONA 3KFWX 3MZHA 2O0YA 3GX4X 4UV8A 3QRFF 3K69A 4P9UA 1FSEA 3FMQA 3GWZA 4LB5A 3OOPA 4UNOA 3FF5A 2HOEA 2O3FA 3GFLA 3R60A 1P6RA 2CW0F 4PZJA 5D6EA 1AWCA 5BOXA 3DPLC 1OYIA 4Q4ZF 4U7DA 3BROA 4XSXF 1U5TB 1MDMB 2YPRA 2NNYA 3FHZA 2VE9A 4LG0A 3R0AA 5AIQA 1BIAA 1Z1DA 2QENA 3G73A 1KA8A 1FSHA 3T5XA 4KIBA 2P4WA 1BIBA 3JSPA 5IT9Z 1K78B 5ED4A 4CGZA 2V6CA 5H6RA 1UCRA 2R7FA 1SFEA 2H09A 5DEQA 2FMLA 1YS6A 2DTRA 1S29A 2ESNA 3TOBA 1HW2A 2XAHA 3F8MA 1TNTA 1MJAA 1W5SA 4U0VA 1J75A 4RGRA 2YR2A 2PFBA 3TGNA 3AAFA 1CF7B 1QO0D 4ENJA 1SMTA 1ON1A 1QZZA 3K1MA 4O5VA 3E97A 2Z3YA 3EUHA 2PMHA 2A3SA 3GFMA 4HBLA 3ECOA 4M74A 3IL2A 2CG4A 2A68F 2Y0MA 4A2UA 5E17F 3VODA 3TDZC 4HF0A 3GFIA 4UV9A 1QZYA 3HTSB 2RN7A 2KIMA 3FM5A 1WRJA 2K27A 2FF4A 3CO7C 1FP2A 3WTSC 4ZYEA 3LSTA 2EA4A 4P55A 1XN7A 2ZBKA 4HF1A 5D5XB 2O8XA 4HOBA 4LFUA 1EH7A 3WGGA 2ZO4A 2XHKA 2HFHA 4KA4A 3RKYA 2ELHA 2W25A 2FNAA 2M5WA 4M9ZA 3HIFA 3I71A 3IHUA 3VB2A 1LVAA 4LG0B 1U3EM 3K0LA 1SMYF 5BPIA 3GW2A 1IRGA 2A69F 1ZGAA 1CGPA 4ZYHA 4XLPF 4AD9A 2G7HA 2ZXJA 3L2CA 1EH6A 1KYWA 4M72A 3R6SA 3OV8A 5BS6A 1WWXA 1HBXG 3J7AO 3RIRA 4EM2A 1TBXA 3WTVC 3IWFA 2QUFA 1RUNA 2STTA 1GXPA 4KNYA 2KIUA 4MGRA 1SD5A 2EA2A 1B59A 3TO6A 3KEQA 4JQFA 2D2WA 2F5EA 2FNPA 1IN7A 3MQ0A 3F8NA 2ZKZA 4CZZA 2OAZA 2JT1A 4LJZF 1S8NA 2V1UA 1HSJA 1GXQA 4LLLA 1OR7A 2RV8A 2JRTA 2P6TA 1XDUA 2CWEA 1XGSA 3DF8A 5CYVA 3KETA 4LGWA 1Z6RA 3KE2A 5D4RA 2QBYB 1WQ2A 4IRGA 2RNJA 2OZ6A 1ZRCA 3LA7A 4RB3C 2DPUA 5CVJA 5ILSA 3HTUA 4Y15A 5CVVA 4HF2A 2QVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHB A;  5J6X A;  4XRF A;  2HWV A;  2RC4 A;  5IT9 K;  1I1S A;  5DUI A;  1IXS B;  2Z33 A;  1R23 A;  2O61 A;  1BI1 A;  3RKX A;  3HRT A;  4KYW A;  1XSX A;  3BZ6 A;  3NEU A;  5LHH A;  1IN6 A;  3T8R A;  3CTA A;  4M6X A;  2DAO A;  4YFN F;  1LEA A;  2IJL A;  5HDN A;  2GZW A;  1P4A A;  3WE3 A;  4O3M A;  5D5W B;  3ZQ7 A;  4YG2 F;  1HKS A;  4I0B A;  4L0Z B;  3FZV A;  4A5N A;  1S3J A;  4IHT A;  1I5Z A;  3TDU C;  3BDD A;  2W84 A;  2PN6 A;  4R79 A;  2FE3 A;  1XCB A;  4UVB A;  1QBJ A;  3F6V A;  3K2Z A;  1LDJ A;  2AXL A;  1PP8 F;  4YII A;  3DEU A;  4WCG A;  2LNB A;  3BPX A;  1X3U A;  1XCV A;  3T1B A;  4BHP A;  4KMU X;  2VC1 A;  3U2R A;  6PAX A;  4EJV A;  2HQN A;  2X0L A;  2HYF A;  1W5T A;  1HKT A;  3J81 Z;  1Z91 A;  3LA3 A;  3DQV C;  5HLH A;  1S7O A;  2PI0 A;  4M6Y A;  3BP8 A;  4L5J A;  4A0Y A;  1OPC A;  1RNL A;  3IC7 A;  3GF2 A;  5H6Q A;  3ABT A;  2YX4 A;  3HOS A;  1G3T A;  3MZY A;  2V79 A;  2A07 F;  5LEK A;  5JR3 A;  3I58 A;  3TOA A;  1Z05 A;  3QP6 A;  1KQ9 A;  1SD6 A;  3F22 A;  3WU1 B;  1FY7 A;  3WTT C;  3P7N A;  1U5T A;  3M8F A;  2BYV E;  4OIO F;  2VN2 A;  1YTY A;  1K6O A;  4ENN A;  3QPH A;  3F8B A;  2EFN A;  2XRN A;  1ZH5 A;  1DDN A;  4MEY F;  3WU0 A;  1K78 A;  3JTH A;  4RAY A;  3ROU A;  3ERE D;  3CUQ C;  2MH9 A;  3E5X A;  4RS8 A;  4WWC A;  1FBU A;  3CUQ A;  5E18 F;  2EB7 A;  1REP C;  2E1C A;  2A61 A;  4R8H A;  1I6X A;  1J5Y A;  2P5L C;  1CF7 A;  4UXN A;  5F1R A;  4I02 A;  5ILU A;  5DDG A;  4CYD A;  3HUG A;  3EDP A;  4UUV A;  1HQC A;  5HDK A;  1MD0 A;  5CLS A;  2EK5 A;  3F72 A;  5HVQ C;  1T2K A;  3IKV A;  4ZYD A;  5D6F A;  4B09 A;  3P9I A;  3V7S A;  3F8F A;  4HW0 A;  5D8L B;  4OIR F;  2JPC A;  5ICE A;  2OD5 A;  4EQQ A;  4LLG F;  3EQL F;  2NYX A;  2A5Y B;  2P5K A;  3KZZ A;  5DCF A;  4A12 A;  1FZP B;  3GO5 A;  3D5L A;  5D5V B;  3R61 A;  1L0O C;  2UWM A;  4HZF A;  4I98 B;  1ZG5 A;  4HLX A;  4N0B A;  2AS5 F;  4Q47 A;  4MHG A;  1VTN C;  4CXF A;  4L9T A;  2ETH A;  2QM3 A;  2RDP A;  4YIF A;  5IT3 A;  3ZMV A;  4P5O A;  4FT8 A;  2P6S A;  3ZMT A;  3E6D A;  3EYY A;  2RVC A;  1QNT A;  4IRI A;  4YFK F;  3ML6 A;  3BY6 A;  4UVC A;  1DP7 P;  1XGM A;  4NB5 A;  2W24 A;  4AWX B;  2HGC A;  4ESJ A;  1U78 A;  3MWM A;  4RB2 C;  3I54 A;  2OQG A;  4L9J A;  5EEH A;  1MKM A;  2GIV A;  2UXN A;  3T0Y A;  1DPU A;  5LRR A;  1YFH A;  3KLO A;  4BNC A;  2VBW A;  4HV6 A;  5HS8 A;  5L3C A;  5LGT A;  3CDH A;  3RI4 A;  4G7O F;  1DUX C;  2BEO A;  2EV5 A;  3RJP A;  4MTD A;  2PG4 A;  2ZNY A;  1XGN A;  1P4X A;  1UHW A;  2P5V A;  1SFU A;  3K1P A;  3CUQ B;  3E6C C;  2ZNZ A;  5FFX A;  4WXC A;  4HLY A;  2XIG A;  4GYG A;  2M45 A;  4LB6 B;  1R36 A;  5TJJ A;  3HOT A;  3J81 K;  2BBY A;  4L9V A;  4KDP A;  1ZLJ A;  3KP4 A;  2K86 A;  4HQM A;  2W85 A;  4CDG A;  3I53 A;  2ZFW A;  3HRM A;  3FWE A;  1Z9C A;  3COA C;  4U0W A;  1ZGJ A;  2IP2 A;  4EGZ A;  3M8E A;  1Q1H A;  1FC3 A;  5JHU A;  4KUM A;  5K5R A;  2HTJ A;  1BC8 C;  5E20 A;  4JK1 X;  4EM1 A;  2EWN A;  3GEZ A;  3VFZ A;  5F64 A;  1J0R A;  5ICC A;  2QBY A;  3U9G A;  1KU9 A;  2A6H F;  4G6Q A;  3WTX C;  4BAY A;  4HX8 A;  2QQ9 A;  4ESF A;  4OIP F;  3JSO A;  2ISY A;  5ILV A;  2XUB A;  2ESH A;  1T98 A;  1B9N A;  4RGU A;  5E1W A;  1J7K A;  3KLN A;  2BE5 F;  2LSO A;  2E7X A;  2QLZ A;  5HLG A;  2DPD A;  3HHH A;  4Q48 A;  3TQN A;  4MQV A;  1O3T A;  1A04 A;  2XAG A;  3MEX A;  2R7D A;  1ZAR A;  3SFZ A;  3MFK A;  1KU2 A;  1SFX A;  3W6K B;  5L3E A;  1TNS A;  3E6M A;  3C18 A;  1SD7 A;  4A5M A;  1Z7U A;  4KMF A;  2C6Y A;  2CSO A;  1ZN2 A;  4LK1 F;  2X4H A;  3V7C A;  2L4A A;  4EV0 A;  5BMZ A;  1YO5 C;  4D0P A;  5LHI A;  2EFW A;  3ZPL A;  2VBX A;  1TW3 A;  5HOO A;  2DK5 A;  4KN7 X;  2NRA C;  1R00 A;  1BC7 C;  3IWZ A;  4HDU A;  5LGU A;  1R7J A;  4LD5 A;  3FMR A;  5LGN A;  1HW1 A;  5DD8 A;  1MJB A;  3HYI A;  3RDI A;  3LA2 A;  1IN8 A;  2QWW A;  5DD4 A;  4IPA A;  2KJC A;  2P8T A;  5CVI A;  5FB2 A;  2VOO A;  3RPQ A;  4HA8 A;  3DFG A;  1IF1 A;  4L18 B;  1KGS A;  3E6B A;  1HST A;  4ESB A;  2PQ8 A;  1ZAO A;  2XV4 S;  1PP7 U;  2OBP A;  1O3S A;  4QLC U;  5E8I A;  3I5U A;  3QU6 A;  3HHG A;  2K4J A;  2DU9 A;  2GXB A;  2G9W A;  1TQM A;  5JFR A;  1EV7 A;  3IRQ A;  2XVC A;  1WI9 A;  1BN5 A;  3GUD A;  4Y17 A;  2HTS A;  1IUY A;  3FXR A;  1EH8 A;  3LAJ A;  3FXU A;  3FM3 A;  3V4G A;  2EJR A;  2Y48 A;  4E70 A;  1WSU A;  5D5U B;  4UHT A;  2DW4 A;  3N4M A;  5JVT A;  1R1T A;  4A0X A;  4NHJ A;  1YW8 A;  5L3G A;  1E17 A;  4AIK A;  2ADU A;  4Z2Y A;  4OOI A;  2QQA A;  3RPU A;  4MEX F;  1RI7 A;  4KIC A;  1G3W A;  2M8E A;  4EVI A;  2XKP A;  2W57 A;  1F9N A;  2YSR A;  4WXH A;  2DQR A;  4LLN A;  2VOD A;  2LF8 A;  5ICG A;  4N9I A;  2HZT A;  2IA2 A;  3I64 A;  4XSZ F;  3PQK A;  1FX7 A;  3W6J B;  3ULQ B;  2FA5 A;  2NAZ A;  4QWQ A;  1G3Y A;  1J9I A;  5K5O A;  2FMY A;  1XDS A;  1KU7 A;  2VXZ A;  4FX4 A;  3JTG A;  2VT3 A;  1UFM A;  2DI3 A;  4GGG A;  4O6J A;  3V8J A;  2IT0 A;  3JW4 A;  3I4P A;  5E8G A;  3ABU A;  1JE8 A;  2NS0 A;  1FOK A;  1HKQ A;  2OQR A;  4EGY A;  1FP1 D;  1WKM A;  4M71 A;  2ZJ2 A;  3F21 A;  2ZCW A;  3I0T A;  2CYY A;  1JXS A;  2XAJ A;  4EJO A;  4EJW A;  2Q2E A;  1DPR A;  4EMS A;  2L4M A;  4G7H F;  1T39 A;  2EFP A;  2P7V B;  4ON0 A;  5CVU A;  4G7Z F;  3V8K A;  4YFX F;  4RB0 A;  2Z99 A;  4AIJ A;  3WGH A;  2VT2 A;  5AIP A;  4IVN A;  3V7R A;  1HXD A;  4KT5 C;  3F8C A;  3IKT A;  1G3S A;  4P9F A;  2DK8 A;  3R0J A;  3ECH A;  5D8K B;  2JSC A;  4GCV A;  3SXY A;  1LNW A;  3ZN0 A;  1G6N A;  2Q8K A;  4A0Z A;  1ZRD A;  5FLX Z;  1L3L A;  4DQ2 A;  5FFZ A;  1BBY A;  3HSR A;  2HDC A;  1XSV A;  1XMA A;  5K5Q A;  4I0A A;  1LJ9 A;  1RUO A;  1ZHF A;  4KIG A;  2LF7 A;  2RGV A;  2EFO A;  4EM0 B;  1D8J A;  3L9F A;  2MLG A;  2PJP A;  4KFC A;  1B1B A;  4ZZL A;  4RGS A;  2IW5 A;  3ZN1 A;  1RIO H;  2M1B A;  5LHG A;  3GZ5 A;  1TW2 A;  3JAM Z;  1JHH A;  4AVP A;  1QQI A;  2O6G E;  3QOP A;  5DCM B;  1O7F A;  4N9H A;  2GA1 A;  2HEO A;  1O3R A;  4AIH A;  3HSF A;  1P4W A;  1T38 A;  3WE2 A;  3SQN A;  1F5T A;  2D45 A;  1KQ0 A;  2FOK A;  4A6D A;  2OZU A;  1YIO A;  1FWZ A;  3Q9S A;  1ZRF A;  3F23 A;  4ENM A;  1U6G A;  3ZMD A;  3ELK A;  5DYM A;  1BI3 A;  3N97 A;  1IAW A;  3H3U A;  1JHF A;  2H94 A;  3LQR A;  2DQL A;  3O6B B;  2XAQ A;  4IXA A;  5L3B A;  1IZ1 A;  3TKY A;  4ZH4 F;  2M30 A;  3K9T A;  3Q5F A;  3Q9V A;  2DBB A;  5HDG A;  3D0S A;  1FYM A;  3RYP A;  2CFX A;  2V1D A;  4CO8 A;  2LDU A;  2CO5 A;  3HRU A;  1K7A A;  2BV6 A;  1YYV A;  2DLL A;  3DP7 A;  5CVR A;  4BXU A;  3FMS A;  5FD6 A;  5L3D A;  3L09 A;  4TV7 A;  2IA0 A;  2JPB A;  4WK8 F;  3BJA A;  4M73 A;  1O7L A;  1H9T A;  1T6S A;  2XRO A;  2WWY A;  1LB2 A;  1J2X A;  4RAZ A;  4WX9 A;  3U1D A;  3CO6 C;  4I01 A;  3KP7 A;  1NHA A;  3E5Q A;  3H3Z A;  1FBS A;  3HRS A;  1D3Y A;  3SHF A;  1I1G A;  5F6F A;  1O57 A;  1RZ4 A;  3VEP A;  3RTR A;  5BQT A;  3WG9 A;  1TQI A;  4GO1 A;  2GXG A;  3CLO A;  3CUO A;  4PDK A;  3GXO A;  3H92 A;  4MNU A;  2M87 A;  2KJB A;  3SZP A;  2ZME A;  2O03 A;  4KN4 X;  4XBF A;  1FPQ A;  1P92 A;  5A2Q Z;  3C7J A;  3WTU C;  5J8C A;  4P96 A;  4PGH A;  2JTV A;  2EV6 A;  2L54 A;  2J5O A;  1ZYR F;  4L9N A;  3REO A;  3KEO A;  1UHM A;  2Y75 A;  5KK1 A;  2L3D A;  4I7H A;  2YX7 A;  1R1U A;  4K2E A;  5H20 A;  1ZLK A;  2FXA A;  4G9Y A;  4KIF A;  1STZ A;  2K7L A;  2FQ3 A;  5FLX K;  1YW7 A;  3M7G A;  3WTY C;  3G3Z A;  2FBK A;  1H0M A;  2GQQ A;  3I59 B;  5BPD A;  2L01 A;  2FSW A;  3B73 A;  2RKH A;  3KCC A;  1FYL A;  3DPT A;  5D4S A;  3LWF A;  4ZZD A;  2F5D A;  3QP5 A;  1XB4 A;  1IXC A;  1ON2 A;  1ZG3 A;  1KYZ A;  3ZMS A;  1B6A A;  1MJ9 A;  4HX7 A;  2ISZ A;  3DV8 A;  4WXD A;  2COM A;  1KU3 A;  1TTY A;  2Z5U A;  2Z9O A;  3J80 Z;  5LLQ A;  2MD5 A;  3IRR A;  2FBI A;  4HAM A;  4ETS A;  3O3K A;  1FYK A;  3EET A;  4MTE A;  4BHC A;  3BPV A;  1ULY A;  3EYI A;  5LRS A;  2MH2 A;  3JAM K;  3KP2 A;  4L5I A;  2KKO A;  5J8F A;  1R22 A;  4OMY A;  4OIN F;  2B0L A;  5LBQ A;  1IW7 F;  1FBQ A;  5K1Y A;  4S05 A;  4G8X A;  2G7U A;  5JI6 A;  4OMZ A;  5ICF A;  1FLI A;  1C0W A;  4GXO A;  2HKO A;  2VBZ A;  2H6C A;  2QZ8 A;  3BJ6 A;  3LAP A;  4G6D A;  1LDK B;  4HQE A;  2ZME B;  4FX0 A;  3M9A A;  1R58 A;  4M9S A;  2XAS A;  1YLF A;  1IRF A;  2PLY A;  3ZMZ A;  1OYY A;  5DUK A;  2V9V A;  3WGI A;  2F5C A;  4EJU A;  4DNC A;  1IN4 A;  1LEB A;  2VC0 A;  3HSE A;  3R4K A;  1D5V A;  4BYY A;  4LK0 F;  3WTW C;  2IRF G;  3P9C A;  3GYH X;  2MBF A;  4BH9 A;  2F2E A;  5AON A;  3F6O A;  1IXR C;  3BOQ A;  3WOD F;  3L7W A;  2VBY A;  2DO7 A;  3TO9 A;  1SD4 A;  1O3Q A;  4I09 A;  2HKX A;  4OIQ F;  3E5U A;  2HR3 A;  3VOE A;  3ISP A;  2F5F A;  4EJT A;  1B9M A;  5E1Z B;  5EEG A;  5CJ9 A;  2FBH A;  3F3X A;  3CJN A;  4ENK A;  3DKW A;  1R5G A;  1BOA A;  2FEZ A;  1LDD A;  2XKO A;  1GHC A;  3KP5 A;  4F7Z A;  2K4B A;  2OU2 A;  3PQJ A;  1W7P A;  5FD5 A;  1TQP A;  3M1E A;  3B02 A;  1UB9 A;  2OA4 A;  3BWG A;  4PGG A;  1U8R A;  1LQ1 A;  4U88 A;  2HYG D;  5TRD A;  4MQ9 F;  3NRV A;  3GLX A;  1XMK A;  4Q5S F;  2IA1 A;  2Q0O A;  1H9G A;  5ERI A;  3RKW A;  3E3V A;  2JZY A;  1PDN C;  2MA3 A;  1I27 A;  4HYE A;  5LEJ A;  4IRH A;  2FRH A;  2R3S A;  3GFJ A;  5A2Q K;  4R1H A;  4I2O A;  2KRF A;  5FGM A;  2QQB A;  3KZY A;  1OMI A;  3SZT A;  1ZG1 A;  4LMY A;  3P9K A;  3TO7 A;  1V3F A;  1JGS A;  4U0Y A;  4S04 A;  2K02 A;  4L0Y B;  5DCM A;  2IPQ X;  2PEX A;  2DFI A;  2IVM A;  1F4K A;  4G94 A;  2ACJ A;  1W7P D;  3O2P E;  3MAJ A;  3GVA A;  1ODD A;  4H0E A;  4IJA A;  2H27 A;  2H6B A;  1QPM A;  4WF2 A;  1F1Z A;  1W4M A;  1BI0 A;  1OKR A;  1KQ8 A;  2UZK A;  3C3W A;  1SAX A;  3QPT A;  1TLH B;  4ZYG A;  4IF4 A;  3GZ6 A;  1P2F A;  1R5H A;  3T8T A;  2YU3 A;  2CQK A;  2PBI A;  1Y0U A;  2GAU A;  3WTZ A;  2NNN A;  3NQO A;  2UXX A;  1FNN A;  3S2W A;  3J80 K;  2GA2 A;  2KIF A;  2D1V A;  4HDV A;  4RGX A;  3KP6 A;  1PUE E;  3L00 A;  1D8K A;  4Y13 A;  5HS9 A;  4BQA A;  5FO5 A;  3FXQ A;  5HLI A;  2BGC A;  2VOP A;  1R1V A;  4HX4 A;  1YW9 A;  1U5T C;  1W7P B;  4NQW A;  4XLN F;  4ASN A;  1S7A A;  1YQA A;  5DV5 A;  1XGO A;  2TDX A;  1UST A;  2STW A;  4RB1 A;  1USS A;  1MDM A;  3LQQ A;  1QGP A;  2WV0 A;  4M9X A;  2EFQ A;  3K1N A;  1GVJ A;  2HS5 A;  4B8X A;  4HV5 A;  3V8L A;  1Z6T A;  1HW5 A;  2XGX A;  4IHS A;  5KVR A;  1ONV A;  4A6E A;  1BJA A;  2MLK A;  3QU3 A;  4PCQ A;  4FHT A;  3C1D A;  1FT9 A;  1AOY A;  1YG2 A;  4JBA A;  1OYW A;  5E1X A;  3BJO A;  2FU4 A;  2HQR A;  4CIC A;  2V1X A;  1E2X A;  2E7W A;  1MGT A;  2QYO A;  2CGP A;  2WTE A;  2DT5 A;  1B4A A;  2J5P A;  1ZRE A;  2E1N A;  1XD7 A;  3PFI A;  5L3F A;  1BI2 A;  1U2W A;  1T0F A;  1G4D A;  3QAH A;  2L02 A;  3LFK A;  2VE8 A;  1YS7 A;  2RQP A;  1BM9 A;  1K79 A;  2EV0 A;  2WC2 A;  2XAF A;  1IN5 A;  2PMU A;  4OU0 A;  1V4R A;  1MZB A;  3FX3 A;  1J59 A;  2P7C B;  5HS7 A;  2A6E F;  3MCZ A;  1XSD A;  2D1H A;  4CHU A;  2MC3 A;  3RYR A;  4UVA A;  3ZMU A;  3DXJ F;  4GYI A;  3I59 A;  1S6L A;  2GWR A;  3KP3 A;  2LKP A;  3ZP5 A;  4U7B A;  2VON A;  3KFW X;  3MZH A;  2O0Y A;  3GX4 X;  4UV8 A;  3QRF F;  3K69 A;  4P9U A;  1FSE A;  3FMQ A;  3GWZ A;  4LB5 A;  3OOP A;  4UNO A;  3FF5 A;  2HOE A;  2O3F A;  3GFL A;  3R60 A;  1P6R A;  2CW0 F;  4PZJ A;  5D6E A;  1AWC A;  5BOX A;  3DPL C;  1OYI A;  4Q4Z F;  4U7D A;  3BRO A;  4XSX F;  1U5T B;  1MDM B;  2YPR A;  2NNY A;  3FHZ A;  2VE9 A;  4LG0 A;  3R0A A;  5AIQ A;  1BIA A;  1Z1D A;  2QEN A;  3G73 A;  1KA8 A;  1FSH A;  3T5X A;  4KIB A;  2P4W A;  1BIB A;  3JSP A;  5IT9 Z;  1K78 B;  5ED4 A;  4CGZ A;  2V6C A;  5H6R A;  1UCR A;  2R7F A;  1SFE A;  2H09 A;  5DEQ A;  2FML A;  1YS6 A;  2DTR A;  1S29 A;  2ESN A;  3TOB A;  1HW2 A;  2XAH A;  3F8M A;  1TNT A;  1MJA A;  1W5S A;  4U0V A;  1J75 A;  4RGR A;  2YR2 A;  2PFB A;  3TGN A;  3AAF A;  1CF7 B;  1QO0 D;  4ENJ A;  1SMT A;  1ON1 A;  1QZZ A;  3K1M A;  4O5V A;  3E97 A;  2Z3Y A;  3EUH A;  2PMH A;  2A3S A;  3GFM A;  4HBL A;  3ECO A;  4M74 A;  3IL2 A;  2CG4 A;  2A68 F;  2Y0M A;  4A2U A;  5E17 F;  3VOD A;  3TDZ C;  4HF0 A;  3GFI A;  4UV9 A;  1QZY A;  3HTS B;  2RN7 A;  2KIM A;  3FM5 A;  1WRJ A;  2K27 A;  2FF4 A;  3CO7 C;  1FP2 A;  3WTS C;  4ZYE A;  3LST A;  2EA4 A;  4P55 A;  1XN7 A;  2ZBK A;  4HF1 A;  5D5X B;  2O8X A;  4HOB A;  4LFU A;  1EH7 A;  3WGG A;  2ZO4 A;  2XHK A;  2HFH A;  4KA4 A;  3RKY A;  2ELH A;  2W25 A;  2FNA A;  2M5W A;  4M9Z A;  3HIF A;  3I71 A;  3IHU A;  3VB2 A;  1LVA A;  4LG0 B;  1U3E M;  3K0L A;  1SMY F;  5BPI A;  3GW2 A;  1IRG A;  2A69 F;  1ZGA A;  1CGP A;  4ZYH A;  4XLP F;  4AD9 A;  2G7H A;  2ZXJ A;  3L2C A;  1EH6 A;  1KYW A;  4M72 A;  3R6S A;  3OV8 A;  5BS6 A;  1WWX A;  1HBX G;  3J7A O;  3RIR A;  4EM2 A;  1TBX A;  3WTV C;  3IWF A;  2QUF A;  1RUN A;  2STT A;  1GXP A;  4KNY A;  2KIU A;  4MGR A;  1SD5 A;  2EA2 A;  1B59 A;  3TO6 A;  3KEQ A;  4JQF A;  2D2W A;  2F5E A;  2FNP A;  1IN7 A;  3MQ0 A;  3F8N A;  2ZKZ A;  4CZZ A;  2OAZ A;  2JT1 A;  4LJZ F;  1S8N A;  2V1U A;  1HSJ A;  1GXQ A;  4LLL A;  1OR7 A;  2RV8 A;  2JRT A;  2P6T A;  1XDU A;  2CWE A;  1XGS A;  3DF8 A;  5CYV A;  3KET A;  4LGW A;  1Z6R A;  3KE2 A;  5D4R A;  2QBY B;  1WQ2 A;  4IRG A;  2RNJ A;  2OZ6 A;  1ZRC A;  3LA7 A;  4RB3 C;  2DPU A;  5CVJ A;  5ILS A;  3HTU A;  4Y15 A;  5CVV A;  4HF2 A;  2QVO A; 
#chains in the Genus database with same CATH topology
 4BHB A;  5J6X A;  4CYC B;  4XRF A;  1OQY A;  2HWV A;  2RC4 A;  4IX7 A;  5IT9 K;  1I1S A;  1LUJ B;  5DUI A;  4FET A;  1IXS B;  2Z33 A;  1ETK A;  3HGY A;  1R23 A;  2JRM A;  3HOU J;  2O61 A;  1VF9 A;  1BI1 A;  3HJE A;  5B66 C;  4Y4R A;  3RKX A;  3HRT A;  3VPR A;  4KYW A;  1XSX A;  3BZ6 A;  3HKZ N;  4IKF A;  3A2K A;  3NEU A;  1HC8 A;  5LHH A;  1IN6 A;  3T8R A;  2FOW A;  4Y3O A;  3CD6 I;  5J40 A;  2HXI A;  3CTA A;  1SVO A;  4M6X A;  2DAO A;  2QQ8 A;  3N05 A;  4YFN F;  5M5W J;  1LEA A;  2IJL A;  5HDN A;  1IRZ A;  3HPH A;  2GZW A;  1ETV A;  1P4A A;  2K9S A;  3OL3 A;  3WE3 A;  1OCO H;  4O3M A;  5D5W B;  5FKM A;  3ZQ7 A;  4YG2 F;  3GTM J;  3LSR A;  4A3D J;  1HKS A;  3NWS A;  2L0K A;  3ZQG A;  4I0B A;  4L0Z B;  3FZV A;  3CCS I;  4A5N A;  1BR4 A;  2GLO A;  4IHV A;  1S3J A;  2L9R A;  2OV7 A;  4IHT A;  2E5Z A;  1I5Z A;  3TDU C;  5DM6 F;  3BDD A;  2W84 A;  1MBF A;  2PN6 A;  2BY0 A;  4R79 A;  2O9L A;  3JRI A;  2FE3 A;  1WVR A;  2EQR A;  5F04 A;  4J00 A;  1XCB A;  2VKV A;  3ASN H;  4UVB A;  1ZR4 A;  3OYD A;  2LBF A;  1U8B A;  2JUC A;  2KL4 A;  1QBJ A;  3F6V A;  5KAI C;  5F0H A;  2CFO A;  3AG2 H;  2EBI A;  1VQL I;  4RMN A;  3K2Z A;  1LDJ A;  2AXL A;  1PP8 F;  1XTA A;  4YII A;  5C3E J;  1YX3 A;  2LD5 A;  3W2V A;  3DEU A;  4WCG A;  1QZE A;  2ZJP F;  2LNB A;  2W82 A;  1X3U A;  3BPX A;  1XCV A;  2E71 A;  3T1B A;  4BHP A;  4GFB A;  3OS1 A;  4KMU X;  3HOY J;  2VIX A;  2VC1 A;  2DTZ A;  5FLV A;  1VQ5 I;  3U2R A;  6PAX A;  4I6Z A;  4EJV A;  1WI3 A;  1WPK A;  4X0G A;  2HQN A;  2X0L A;  2IS1 A;  3GTJ J;  3Q0V A;  1Y8Q B;  1W5T A;  2HYF A;  4ZDP A;  2CV2 A;  3J81 Z;  1HKT A;  3CCU I;  1Z91 A;  3L2V A;  1IGN A;  3GME A;  3M4O J;  5IP6 A;  3LA3 A;  3DQV C;  1TZL A;  5HLH A;  1S7O A;  1ZR2 A;  2PI0 A;  4FE7 A;  3BP8 A;  4M6Y A;  1WJF A;  4PJL A;  4L5J A;  3CLQ A;  1A35 A;  4A0Y A;  3TP0 A;  1OPC A;  1RNL A;  1LPQ A;  4BL0 B;  3IC7 A;  4BUP A;  3GF2 A;  3A0H C;  5H6Q A;  3ABT A;  4X1E A;  2YX4 A;  3L2U A;  3HOS A;  5EEA A;  1G3T A;  3MZY A;  2V79 A;  2VL8 A;  2A07 F;  3BG5 A;  4M3G A;  5LEK A;  5JR3 A;  3I58 A;  1OFC X;  3TOA A;  1Z05 A;  1BJZ A;  3QP6 A;  4J01 A;  1KQ9 A;  5IYC J;  1SD6 A;  2JA6 J;  3F22 A;  2EIM H;  2OJE D;  3WU1 B;  1FY7 A;  1WH7 A;  2VJ5 A;  2F5V A;  3WTT C;  3P7N A;  1U5T A;  3M8F A;  2BYV E;  4RLQ A;  4OIO F;  2VN2 A;  1YTY A;  1U9N A;  1K6O A;  1ERD A;  2K40 A;  4ENN A;  1RRJ A;  3QPH A;  5J3L A;  3DTI A;  3F8B A;  5HNF A;  5IOZ A;  2E5N A;  2EFN A;  2F4O B;  2XRN A;  3QOE A;  3FKI J;  4HNU A;  1ZH5 A;  1DDN A;  4MEY F;  1POG A;  3WU0 A;  1D0Y A;  1K78 A;  3JTH A;  4RAY A;  3ROU A;  4E7H A;  4D5F A;  4A3L J;  3ERE D;  3CUQ C;  2CUJ A;  2MH9 A;  2UV1 A;  3B6A A;  3E5X A;  4HNV A;  4RM2 A;  3HM5 A;  1GV2 A;  1JKO C;  4Y52 J;  1LFU P;  4RS8 A;  4ZJZ A;  4WWC A;  4AM3 A;  1I6H J;  1NH3 A;  1FBU A;  1Q1V A;  3CUQ A;  5E18 F;  2RNG A;  2EB7 A;  1REP C;  2E1C A;  5B1A H;  2A61 A;  2V9P A;  4PJM A;  4R8H A;  1I6X A;  1J5Y A;  2YUS A;  1JGG A;  3FXM A;  4CUG A;  2P5L C;  1CF7 A;  2DFH A;  2LBF B;  4UXN A;  2I10 A;  5F1R A;  2DA6 A;  4I02 A;  5ILU A;  5DDG A;  4CYD A;  2Y69 H;  3LOC A;  3HUG A;  2R7V A;  1P9Q C;  3EDP A;  3K4N A;  4AYB N;  2M2E A;  4UUV A;  2XSD C;  1HQC A;  4XN3 A;  5HDK A;  1JTY A;  4IZZ A;  3D1N I;  1MD0 A;  2LH9 A;  2BXZ A;  5CLS A;  2WAF A;  2EK5 A;  2VJ4 A;  3F72 A;  5HVQ C;  1T2K A;  2IS2 A;  3IKV A;  4ZYD A;  3GTL J;  1W5C C;  5D6F A;  4B09 A;  3P9I A;  3V7S A;  3F8F A;  4HW0 A;  5D8L B;  4OIR F;  2JPC A;  5ICE A;  2HOS A;  2CQN A;  2OD5 A;  2X6O A;  3C2H A;  3G1L A;  4LLG F;  4A69 C;  4EQQ A;  3HGG A;  3EQL F;  1S5L C;  2NYX A;  3IH3 A;  2A5Y B;  2P5K A;  3KZZ A;  5DCF A;  5J1R A;  3DTE A;  4A12 A;  4BE2 A;  1FZP B;  3GO5 A;  3D5L A;  2Q2E B;  4XLF A;  5D5V B;  2MC4 A;  2DOA A;  3R61 A;  1L0O C;  1LKX A;  4W97 A;  5TGT A;  1RKW A;  4HF2 A;  2UWM A;  3ONQ A;  4HZF A;  5C4X J;  4JX5 A;  4C3I J;  4I98 B;  3LSJ A;  3PNV A;  4HLX A;  1ZG5 A;  4N0B A;  2AS5 F;  4Q47 A;  4MHG A;  1ETO A;  1VTN C;  3WHC A;  3OMY A;  4CXF A;  2W1O A;  4L9T A;  5KNL A;  1PJR A;  2ETH A;  3C2G A;  2IXS A;  2E36 A;  3ZR8 X;  1ZGW A;  2QM3 A;  1MBH A;  2RDP A;  4YIF A;  5IT3 A;  4JP0 A;  3ZMV A;  4P5O A;  5JLX A;  2MD0 A;  4FT8 A;  1H8A C;  2P6S A;  4A3E J;  2ELK A;  2IS4 A;  5M3F J;  3ZMT A;  3E6D A;  4LOC A;  2RVC A;  1QNT A;  3EYY A;  2DT7 B;  3OYF A;  4IRI A;  4YFK F;  3ABK H;  2BW3 A;  1FOX A;  1R9T J;  2HVS A;  2K9N A;  2JK3 A;  2KFD A;  3ML6 A;  3BY6 A;  1E3H A;  4UVC A;  1HF0 A;  1IRX A;  4JOM A;  2P81 A;  4L5E A;  1DP7 P;  4C2T A;  1IUF A;  1XGM A;  4RBO A;  3BQZ A;  4NB5 A;  3DU6 A;  2W24 A;  4AWX B;  2HGC A;  1EKE A;  4ESJ A;  2GXA A;  4ABZ A;  1U78 A;  3K4M A;  3MWM A;  4RB2 C;  1T8I A;  2NVQ J;  3OIO A;  3I54 A;  3ZQQ A;  1ITY A;  2ZB9 A;  3FKJ A;  1QPI A;  2OQG A;  4L9J A;  5EEH A;  1VI0 A;  1MKM A;  3MKW B;  2GIV A;  2UXN A;  3T0Y A;  1DPU A;  5LRR A;  2W00 A;  1YFH A;  3KLO A;  3G1O A;  4BNC A;  2LG4 A;  3M07 A;  3VYS B;  3K7A J;  2CUE A;  2VBW A;  4HV6 A;  1Y39 A;  5HS8 A;  5L3C A;  5LGT A;  1O4X A;  3CDH A;  3RI4 A;  4G7O F;  2XB0 X;  1G59 A;  3DBR B;  2VUM J;  1DUX C;  2VQG A;  2BEO A;  2EV5 A;  4XLA A;  3RJP A;  1FIP A;  4MTD A;  1V55 H;  5EG0 B;  2V6E A;  2PG4 A;  2P0W A;  1DU6 A;  1JTX A;  2ZNY A;  2L2O A;  4W1U A;  1XGN A;  3LSP A;  3G6E I;  1P4X A;  1UHW A;  2P5V A;  1SFU A;  3K1P A;  3CUQ B;  3E6C C;  1IV8 A;  2ZNZ A;  1SFO J;  5FFX A;  4WXC A;  1PVE A;  4HLY A;  2XIG A;  4GYG A;  1GUU A;  2M45 A;  4LB6 B;  5IYB J;  1R36 A;  4UUS A;  3DU5 A;  4M3D A;  5GP9 A;  5TJJ A;  3HOT A;  3AG3 H;  3J81 K;  3KYC B;  1FMV A;  2BBY A;  2WBM A;  4L9V A;  3HUG B;  3OOU A;  1ZLJ A;  3KP4 A;  4KDP A;  2K86 A;  4X6A J;  1BOB A;  1UMQ A;  4HQM A;  4DYQ A;  2W85 A;  4CDG A;  3S1N J;  1W0T A;  2EIK H;  3I53 A;  3UNG C;  3Q3S A;  2ZFW A;  2ME6 A;  1EJ9 A;  1MH4 A;  3O8G A;  3HRM A;  4F91 B;  3M3Y J;  3FWE A;  3J7Z I;  1Z9C A;  3COA C;  4Z6Y A;  2MG4 A;  4XLE A;  3C2B A;  3GTO J;  2PX9 A;  4ZTF A;  4BQQ A;  2V7F A;  2ZXI A;  1R4N B;  1TWG J;  1ZGJ A;  2IP2 A;  4U0W A;  2DJN A;  5HLT A;  4EGZ A;  3M8E A;  1MBJ A;  2DMT A;  1Q1H A;  1FC3 A;  5JHU A;  4KUM A;  4ZC3 A;  5K5R A;  3BTC A;  3OYA A;  2HTJ A;  2ZSH B;  4RAG A;  1BC8 C;  2R7Z J;  5E20 A;  4JK1 X;  1X4O A;  4EM1 A;  2EWN A;  4CCM A;  3JR9 A;  5JVG F;  3OSG A;  3H35 A;  4NDL A;  3GEZ A;  4QPQ A;  3SEQ A;  2LY9 A;  1KZH A;  5C4J J;  3VFZ A;  5F64 A;  4ITV A;  1J0R A;  2NVU B;  5ICC A;  2QBY A;  2CRG A;  3U9G A;  1KU9 A;  2A6H F;  4G6Q A;  4NC8 A;  3VYT B;  2XGE A;  4BAY A;  3WTX C;  4HX8 A;  1HOM A;  2QQ9 A;  3K4J A;  3TL4 X;  3OYI A;  3CP2 A;  4ESF A;  3PNY A;  5E3O A;  4OIP F;  4RLF A;  2H8R A;  3JSO A;  3CDL A;  2ISY A;  1BR2 A;  1OCR H;  5ILV A;  2XUB A;  2ESH A;  1T98 A;  2LRD A;  1B9N A;  4RGU A;  2O5R A;  5E1W A;  4E7S A;  3S15 J;  1J7K A;  1ORK A;  3KLN A;  2BE5 F;  2LSO A;  2E7X A;  2QLZ A;  3RCO A;  2CV1 A;  1VQK I;  1K61 A;  5HLG A;  2DPD A;  3HHH A;  4F52 A;  2BW3 B;  2COB A;  3CMY A;  4HRI A;  1JUP A;  4HST A;  5DTD A;  1F43 A;  4BE0 A;  4Q48 A;  3TQN A;  4H4K C;  4MQV A;  1IDY A;  1A04 A;  1O3T A;  2B7E A;  2XAG A;  2LC2 A;  3MEX A;  2R7D A;  2NVX J;  2IGM A;  2BXY A;  3HOV J;  1ZAR A;  3SFZ A;  5JHF A;  2CV0 A;  3MFK A;  2H1L A;  1MNM C;  2BVM A;  1ETQ A;  1JUS A;  2E34 A;  3JRD A;  1KU2 A;  1SFX A;  3W6K B;  3CCM I;  4PFP A;  5L3E A;  1TNS A;  1F36 A;  3E6M A;  2H1K A;  4BJ5 C;  3C18 A;  1SD7 A;  4A5M A;  2EIJ H;  1Z7U A;  2R93 J;  1ZKG A;  4KMF A;  2C6Y A;  2CSO A;  1ZN2 A;  4LK1 F;  2X4H A;  4D9J A;  3V7C A;  3ABM H;  2L4A A;  1X1A A;  4EV0 A;  5BMZ A;  1YO5 C;  2O8K A;  4D0P A;  5LHI A;  3S14 J;  2EFW A;  3ZPL A;  1QVT A;  2VBX A;  1PUF A;  1TW3 A;  4LG3 A;  1GT0 C;  5HOO A;  3KIO A;  2ZXH A;  2DK5 A;  5CPR B;  4GDF A;  4KN7 X;  2NRA C;  2QA4 I;  3FK6 A;  2CS3 A;  5F27 A;  1UEL B;  1D1A A;  2HNH A;  4OWR B;  1R00 A;  1BC7 C;  1JI8 A;  3IWZ A;  4HDU A;  5LGU A;  1R7J A;  1YJN I;  3VSK A;  2AHQ A;  2B9S A;  4LD5 A;  3FMR A;  2HOT A;  3M1C A;  5LGN A;  4AU7 A;  1HW1 A;  3B6C A;  4PFO A;  5DD8 A;  4B3A A;  1MJB A;  2MYS A;  3HYI A;  3RDI A;  3K70 C;  4IOC F;  1T56 A;  3LA2 A;  1IN8 A;  2HU9 A;  2QWW A;  1E3O C;  1VQP I;  5DD4 A;  3KZI C;  4IPA A;  2YU9 J;  2KJC A;  1HDD C;  3K4L A;  2P8T A;  2KLO A;  2JVG A;  5CVI A;  4KIT B;  5FB2 A;  3CC2 I;  3RPQ A;  2VOO A;  2XF5 A;  1U0J A;  2LRE A;  2QGU A;  3DFG A;  4HA8 A;  4DW6 A;  1IF1 A;  4L18 B;  4OAZ A;  1KGS A;  3E6B A;  3DKX A;  1HST A;  4ESB A;  2LLK A;  5IY5 H;  1WCM J;  3JRF A;  1JJ8 C;  2PQ8 A;  3DEE A;  1ZAO A;  2XV4 S;  1PP7 U;  5EZG A;  2OBP A;  3D5R C;  1O3S A;  2M8G X;  4QLC U;  4BQN A;  1SAU A;  2M7B A;  3S93 A;  5E8I A;  2G0E A;  3I5U A;  2LY1 A;  3QU6 A;  3QPS A;  2E35 A;  3HHG A;  4XLH A;  5GAH J;  2BY1 A;  2K4J A;  2DU9 A;  2GXB A;  2G9W A;  1TQM A;  4A3C J;  9ANT A;  1E0E A;  5JFR A;  5IYD J;  5CQE A;  3DLL F;  1EV7 A;  1VQ8 I;  2FX0 A;  1YJW I;  4BY1 J;  2NVT J;  2V4J C;  2BHY A;  3TP3 A;  2AO9 A;  3IRQ A;  1RKT A;  2XVC A;  1WI9 A;  1JKP C;  1BN5 A;  3GUD A;  4Y17 A;  3OR2 C;  5M5Y J;  1MMN A;  2Y30 A;  2HTS A;  3CDI A;  3PIO F;  1VQ6 I;  3S16 J;  1A6Q A;  1IUY A;  1N75 A;  1YRN B;  3VWB A;  3FXR A;  1EH8 A;  5FRM A;  1J09 A;  2MW8 A;  3LAJ A;  2BZT A;  2KIS A;  3FXU A;  3FM3 A;  3V4G A;  2EJR A;  2WAQ N;  2Y48 A;  5FRO A;  4E70 A;  5D5U B;  1WSU A;  1RET A;  2DA3 A;  4C2M J;  3WG7 H;  4UHT A;  2DW4 A;  3N4M A;  2YS9 A;  1R1T A;  4UUT A;  5JVT A;  2RRE A;  4A0X A;  4NHJ A;  1YW8 A;  5L3G A;  1E17 A;  4AIK A;  2ADU A;  3DWL E;  1ETW A;  4IEJ A;  4KJZ A;  1IDZ A;  4Z2Y A;  4OOI A;  3ZQC A;  2X1E A;  2QQA A;  3RPU A;  4RAF A;  3F0C A;  4MEX F;  2DT6 A;  1RI7 A;  4KIC A;  1G3W A;  2VKE A;  4V2F A;  2M8E A;  3K70 D;  4EVI A;  2XKP A;  2W57 A;  1SEU A;  1F9N A;  2YSR A;  2Q1Z B;  4WXH A;  4QSH A;  5K7Z A;  4IHX A;  2DQR A;  5IOY A;  1XPX A;  5B1B H;  1PUF B;  4LLN A;  2VOD A;  2LMD A;  2LF8 A;  3A03 A;  3H0G J;  3S3M A;  3CJQ B;  3ZRG A;  2HVR A;  3NWT A;  5ICG A;  4F92 B;  4YRV A;  4N9I A;  1LFP A;  2HZT A;  1ZK8 A;  2IA2 A;  3I64 A;  4XSZ F;  3PQK A;  1FX7 A;  3W6J B;  3ULQ B;  2EPF A;  2FA5 A;  1W36 C;  3RKQ A;  4DYR A;  4D7M A;  2E2J J;  1ZTR A;  3OS2 A;  2NAZ A;  4QWQ A;  1G3Y A;  5C44 J;  1J9I A;  3U21 A;  3BR2 A;  3CP8 A;  2X6W A;  3EUK L;  2NXN B;  5K5O A;  2FMY A;  1XDS A;  1KU7 A;  2VXZ A;  2X85 A;  3A01 B;  4FX4 A;  3FIS A;  3JTG A;  4S0H B;  4EAT A;  1NG7 A;  5IP7 J;  4QIW N;  2VT3 A;  1UFM A;  2DI3 A;  4GGG A;  4O6J A;  3V8J A;  3OYN A;  2IT0 A;  3JW4 A;  3I4P A;  5E8G A;  4AVZ A;  3ABU A;  3O8H A;  4XKW A;  1JE8 A;  3VYU B;  2NS0 A;  3MMY B;  3HL2 A;  2N8G A;  5GPA A;  1FOK A;  1HKQ A;  3BCB A;  2VKD A;  2OQR A;  4A3J J;  2JQ7 A;  3LSH A;  1ACI A;  4EGY A;  1MW7 A;  2FD5 A;  2XPU A;  1FP1 D;  1WKM A;  3Q0W A;  4M71 A;  1QA6 A;  2ZJ2 A;  3F21 A;  5CKT A;  2ZCW A;  1VQM I;  5EZH A;  2Y9Y A;  4QPO A;  4IL6 C;  2ID6 A;  2M34 A;  3I0T A;  1Z7L A;  2R7R A;  2CYY A;  2VI6 A;  3RPU D;  1JXS A;  4XN0 A;  3OWT A;  2XAJ A;  1YX5 A;  4EJO A;  2R92 J;  1MSE C;  4EJW A;  2Q2E A;  3OS0 A;  1DPR A;  4EMS A;  3HPG A;  1WJB A;  4CH7 A;  2XDV A;  4IOA F;  2L4M A;  4G7H F;  1T39 A;  2EFP A;  2P7V B;  4ON0 A;  4A3I J;  5CVU A;  4G7Z F;  2L7K A;  3V8K A;  4YFX F;  2KRH A;  4RB0 A;  4BS9 A;  2Z99 A;  4AIJ A;  3WGH A;  4BY7 J;  2VT2 A;  5AIP A;  4E7L A;  4IVN A;  3KX2 A;  4AC0 A;  3V7R A;  1HXD A;  1TL8 A;  4KT5 C;  5E3N A;  3F8C A;  4BXF A;  3IKT A;  1G3S A;  2DA1 A;  2E1M C;  1PYV A;  2PJR A;  4P9F A;  2DK8 A;  3R0J A;  3H9G A;  3QYF A;  2FQ4 A;  3ECH A;  5D8K B;  2JSC A;  4GCV A;  3SXY A;  1LNW A;  3ZN0 A;  1G6N A;  3TBI A;  1Y8R B;  3MD2 A;  2BVL A;  2LYC A;  2OTJ I;  4Y33 A;  3BLY A;  5CQG A;  2IEK A;  3VSL A;  2Q8K A;  4A0Z A;  1ZRD A;  3OYG A;  2K9M A;  3BC8 A;  5FLX Z;  1L3L A;  1AHD P;  5F0F A;  4UY8 I;  3CES A;  4DQ2 A;  3IH2 A;  5FFZ A;  1WJC A;  2XF6 A;  1BBY A;  2V9K A;  2GOM A;  3QPL A;  3BCA A;  3HSR A;  2HDC A;  1XSV A;  4NC6 A;  2QF7 A;  3ERM A;  1XMA A;  5K5Q A;  4E7J A;  4I0A A;  2H8W A;  4M3B A;  1LJ9 A;  1RUO A;  2LK2 A;  3SDG A;  1ZHF A;  2DMU A;  4KIG A;  2F6C A;  3JRC A;  4MO7 A;  2LF7 A;  2WAD A;  1P7I A;  2RGV A;  3RSN A;  4XOT A;  3GTK J;  5GAE J;  2EFO A;  4DOZ A;  1OLT A;  4EM0 B;  3FXJ A;  5EG0 A;  2HXO A;  5GPC A;  2W4S A;  1K4S A;  4Y7N J;  3H9Q A;  3DCF A;  1D8J A;  1WJD A;  1VQO I;  1I3Q J;  3L9F A;  2MLG A;  1VQ9 I;  3W2A A;  2PJP A;  4PK4 A;  1N77 A;  4KFC A;  1B1B A;  2KIQ A;  4ZZL A;  4RGS A;  2ICW G;  4EEF G;  4DIQ A;  2K85 A;  2LKS A;  1K6Y A;  2IW5 A;  3ZN1 A;  4B47 A;  1RIO H;  2M1B A;  1XS9 A;  4JYK A;  5LHG A;  3F9K A;  2NOG A;  2VAS A;  2QEX I;  1X2M A;  4XRS A;  1HCR A;  4XKV A;  3CF2 A;  1LE8 A;  3GZ5 A;  1TW2 A;  3JAM Z;  3BG3 A;  1JHH A;  4AVP A;  1N25 A;  3A02 A;  1QQI A;  2O6G E;  2A5W A;  3PSF A;  3OY9 A;  3QOP A;  5DCM B;  1O7F A;  3MKY B;  2EZL A;  3IAM 2;  1WH5 A;  4N9H A;  2GA1 A;  1ETY A;  3IH4 A;  1B72 B;  2HEO A;  1O3R A;  2NS8 A;  3MVP A;  2Z1D A;  3HSF A;  1P4W A;  4AIH A;  4BDY A;  1T38 A;  2B63 J;  3WE2 A;  1WJA A;  3SQN A;  1F5T A;  2CU7 A;  2D45 A;  4XL9 A;  2DYR H;  3LSM A;  1KQ0 A;  3G2B A;  4HSR A;  1D0Z A;  2FOK A;  1BW6 A;  2HYJ A;  4A6D A;  1FJL A;  3S2H J;  2OZU A;  3PO2 J;  2L9S A;  1YIO A;  1FWZ A;  4XKB A;  1RR8 C;  3Q9S A;  1ZRF A;  3F23 A;  3OR1 C;  2D5V A;  3J7Y J;  3FXK A;  3NAU A;  4E4H A;  4ENM A;  1U6G A;  2QKL B;  2L7Z A;  4ANJ A;  3ZMD A;  4FCY A;  1TP4 A;  3ELK A;  5DYM A;  1TC3 C;  1BI3 A;  2CH0 A;  5DS9 A;  5M5X J;  4RDU A;  2EH3 A;  3N97 A;  1IAW A;  3H3U A;  1T95 A;  1JHF A;  1Y0N A;  2EIL H;  1H88 C;  2H94 A;  3LQR A;  3PNT A;  3OYL A;  3JRG A;  3CJR B;  2DQL A;  2PJR B;  3O6B B;  2XAQ A;  2DA7 A;  1IV6 A;  4IXA A;  5L3B A;  1X1C A;  1IZ1 A;  2HDW A;  3TKY A;  4ZH4 F;  4XMY A;  1WFX A;  2M30 A;  3GLL A;  2RAE A;  1A6I A;  1S7E A;  3K9T A;  2BHZ A;  2DA4 A;  3Q5F A;  3Q9V A;  2DBB A;  5HDG A;  3BG6 A;  3D0S A;  1D1C A;  1FYM A;  3VDX A;  3I4M J;  3HZJ A;  5EF6 A;  3RYP A;  4XRS G;  3BG7 A;  2CFX A;  2V1D A;  4A93 J;  1FMW A;  2LDU A;  2CO5 A;  4CO8 A;  3HRU A;  1ENH A;  1HDP A;  5F1J A;  2WV1 A;  1K7A A;  2BV6 A;  1YYV A;  2DLL A;  5IP9 J;  3DP7 A;  5CVR A;  1T08 B;  4BXU A;  3FMS A;  5FD6 A;  5L3D A;  3L09 A;  4B48 A;  3K4B A;  4TV7 A;  2HOA A;  2IA0 A;  2JPB A;  4WK8 F;  3BJA A;  4D5C A;  4M73 A;  4B44 A;  1O7L A;  4XOP A;  2O7O A;  1H9T A;  1T6S A;  2VKH A;  5FKL A;  4BDZ A;  2XRO A;  2WWY A;  4XIC A;  1LB2 A;  1J2X A;  4RAZ A;  4WX9 A;  4JX4 A;  1ZQ3 P;  1QHH D;  2R5Z B;  1YJ9 I;  3U1D A;  3CO6 C;  2CQQ A;  4I01 A;  1GV5 A;  3KP7 A;  3IUO A;  1NHA A;  1WGX A;  3E5Q A;  3H3Z A;  1FBS A;  3HRS A;  3BT9 A;  1D3Y A;  3SHF A;  3H5N A;  1I1G A;  4NNJ A;  5F6F A;  1O57 A;  1RZ4 A;  3VEP A;  2ZME C;  4ZDL A;  4IO9 F;  4XON A;  3RTR A;  5BQT A;  2R7T A;  3WG9 A;  3BTJ A;  3HOZ J;  1TQI A;  1Z3X A;  2VXD A;  4GO1 A;  4BAC A;  2GXG A;  2HPM A;  3CLO A;  1Z77 A;  2CW8 A;  3CUO A;  4PDK A;  1LE8 B;  3GXO A;  3LNQ A;  1MSF C;  2IGK A;  3H92 A;  3IV5 A;  1MMS A;  1OCZ H;  2XPV A;  4MNU A;  2JJ7 A;  2KJB A;  2M87 A;  2WAE A;  3SZP A;  2ZME A;  2O03 A;  4KN4 X;  1D0X A;  1UG0 A;  4XBF A;  4DZP A;  5M3M J;  1APL C;  2UUZ A;  2A6T A;  3SEZ A;  1FPQ A;  3SFI A;  1P92 A;  3PFY A;  5A2Q Z;  2E2I J;  3C7J A;  3WTU C;  5J8C A;  4P96 A;  1VQN I;  4PGH A;  2ECC A;  1X58 A;  1M1E B;  2EV6 A;  2A05 A;  2JTV A;  3AG1 H;  2L9V A;  2ZC2 A;  2L54 A;  4AID A;  2J5O A;  4II2 A;  1ZYR F;  4L9N A;  1FOW A;  3REO A;  1Y56 A;  1UHM A;  2Y75 A;  2ECB A;  2L7M P;  3KEO A;  1HLV A;  3W3C A;  3CC4 I;  3W2W A;  3X2Q H;  3CCR I;  2NOJ B;  5KK1 A;  4MLO A;  3S3O A;  2L3D A;  2JSP A;  4I7H A;  3CZ6 A;  2YX7 A;  1R1U A;  4K2E A;  2OTL I;  3DTK A;  1UAA A;  3OYH A;  5H20 A;  1ZLK A;  1WZ2 A;  2FXA A;  4C30 A;  5E3M A;  3G1M A;  2OUM A;  4G9Y A;  4KIF A;  1STZ A;  2K7L A;  2FQ3 A;  5FLX K;  1YW7 A;  3M7G A;  4GRI A;  3WTY C;  5J1Y A;  4OAY A;  4IQ4 A;  4I99 C;  3G3Z A;  2FBK A;  1H0M A;  1BL0 A;  2WY7 Q;  2K3F A;  1R49 A;  2GQQ A;  3I59 B;  3LSG A;  5BPD A;  1NG6 A;  2L01 A;  2FSW A;  3B73 A;  1NK3 P;  2RKH A;  3KCC A;  2JN6 A;  1FYL A;  3DPT A;  2VPR A;  3H1C A;  2AQE A;  5D4S A;  3LWF A;  3BR6 A;  4ZZD A;  1SVL A;  1YRN A;  2F5D A;  2R5Y A;  3QP5 A;  3BR0 A;  1G2H A;  1XB4 A;  1GVD A;  1IXC A;  1V54 H;  4HNT A;  1ON2 A;  3WHB A;  3K10 A;  1ZG3 A;  4PSW A;  1YOV B;  4DBQ A;  1UJ8 A;  1KYZ A;  3ZMS A;  1B6A A;  1MJ9 A;  2KMU A;  1JJ6 C;  1N78 A;  2CUZ A;  4HX7 A;  1MBK A;  2ISZ A;  3A1Y A;  2OCC H;  3DV8 A;  3AL0 C;  3I3L A;  4WXD A;  2OC6 A;  5K7H A;  4U87 A;  5KCM A;  2COM A;  1KU3 A;  2JA5 J;  1TTY A;  2Z5U A;  2Z9O A;  1LFB A;  3J80 Z;  5LLQ A;  4XOR A;  3BQY A;  2MD5 A;  3JCU C;  3IRR A;  1WHU A;  2FBI A;  3K2A A;  3HOW J;  5DM7 F;  4HAM A;  4ETS A;  2M9H A;  4BJT A;  2DA2 A;  3TED A;  3O3K A;  2ZXW H;  1FYK A;  3EET A;  4IQJ A;  3ZQL A;  4MTE A;  1RES A;  1R71 A;  1BR1 A;  4BHC A;  2GOX B;  3BPV A;  1ULY A;  3EYI A;  3IAS 2;  5LRS A;  2MH2 A;  3JAM K;  2M0C A;  2K9L A;  3KP2 A;  4V19 K;  2X1C A;  4YEL A;  3KPH A;  4BJ6 C;  2LVS A;  4L5I A;  2KKO A;  5J1U A;  5J8F A;  2DMQ A;  1R22 A;  4OMY A;  4OIN F;  1Y1W J;  3TMO A;  2B0L A;  4C3J J;  4XKC A;  2LY2 A;  5LBQ A;  1IW7 F;  1FBQ A;  5K1Y A;  3BZC A;  4S05 A;  3A01 A;  1YI2 I;  1AU7 A;  3OYM A;  4G8X A;  2JUG A;  2G7U A;  3BTI A;  3E0J B;  5JI6 A;  2VQC A;  1S72 I;  4OMZ A;  5ICF A;  1FLI A;  4V2G A;  1C0W A;  4GXO A;  3HEF A;  2HKO A;  2VBZ A;  4A3F J;  2H6C A;  2QZ8 A;  5EGO A;  2E60 A;  3SYT A;  5J47 A;  1VFC A;  3BJ6 A;  1MH3 A;  3LAP A;  3LMM A;  4G6D A;  1LDK B;  4HQE A;  2ZME B;  3QYE A;  1LVK A;  4FX0 A;  4JX6 A;  3G4S I;  2CUF A;  3M9A A;  1MIJ A;  1R58 A;  2M7A A;  4M9S A;  3SDB A;  2VQH A;  2XAS A;  2DCE A;  1FEX A;  1YLF A;  1IRF A;  2PLY A;  4BGD A;  2VQL A;  2DJI A;  3ZMZ A;  2DFE A;  4BQO A;  1OYY A;  5DUK A;  2V9V A;  3WGI A;  2F5C A;  4EJU A;  4DNC A;  5H2F C;  3OL4 A;  1IN4 A;  1OIS A;  1LEB A;  1K83 J;  2VC0 A;  4CCJ A;  3KYD B;  2IGN A;  5EDN A;  3HSE A;  3R4K A;  1D5V A;  3S17 J;  4BYY A;  3ZOB A;  4D1Q A;  2CQ7 A;  4LK0 F;  3WTW C;  3OIQ A;  2IRF G;  3P9C A;  3GYH X;  2MBF A;  4BH9 A;  3MKZ A;  2F2E A;  5AON A;  3F6O A;  1W1W E;  1IXR C;  3NAR A;  4A3B J;  3BOQ A;  3WOD F;  4CSW A;  1UZC A;  2VJJ A;  3L7W A;  2VBY A;  2DO7 A;  3TO9 A;  1SD4 A;  1X3Z B;  1V5E A;  2LR8 A;  1IJW C;  4MFD A;  3UKG A;  1O3Q A;  2ID3 A;  4I09 A;  2DXI A;  2HKX A;  4OIQ F;  3E5U A;  2HR3 A;  3VOE A;  3ISP A;  2VJI A;  2TCT A;  2F5F A;  4EJT A;  1B9M A;  5E1Z B;  5EEG A;  5CJ9 A;  2FBH A;  1IO2 A;  3F3X A;  3CJN A;  4ENK A;  4XM3 A;  4A3G J;  3DKW A;  1OCP A;  1R5G A;  2R5Y B;  5B3S H;  3ZXS A;  1BOA A;  4CA0 A;  3LSI A;  2FEZ A;  1NK2 P;  4RA2 A;  5HOD A;  1LDD A;  5J4Y A;  4IHY A;  2XKO A;  3QQA A;  1GHC A;  2KZV A;  3KP5 A;  4F7Z A;  2K4B A;  2MAB A;  2OU2 A;  3PQJ A;  2LKX A;  1DU0 A;  2XAU A;  4M6V A;  1MNE A;  1W7P A;  5FD5 A;  1TQP A;  3OYE A;  3HBL A;  3M1E A;  3B02 A;  1UB9 A;  1RC9 A;  3H3V K;  2X6Y A;  2ZJR F;  2OA4 A;  1YHQ I;  2DA5 A;  3BWG A;  4PGG A;  2KDZ A;  3CMM A;  5J4V A;  4G6T B;  1U8R A;  2L5Q A;  1LQ1 A;  4CCL A;  4U88 A;  2HYG D;  3QOD A;  1FIA A;  3EPZ A;  5TRD A;  1Z67 A;  4MQ9 F;  1E3P A;  3NRV A;  3MKL A;  3GLX A;  2R0Q C;  3JRE A;  1P7J A;  4E6K G;  1XMK A;  4CCN A;  4XRM A;  3AL0 B;  3HOX J;  4Q5S F;  2KT0 A;  1SVM A;  2IA1 A;  3PO3 J;  2X9D A;  2Q0O A;  1H9G A;  1MMG A;  5ERI A;  3RKW A;  5GAD J;  3E3V A;  2JZY A;  1PDN C;  3AFH A;  2MA3 A;  3VYR B;  2R7W A;  1I27 A;  4HYE A;  3AG4 H;  3OIP A;  5LEJ A;  4IRH A;  2BY3 A;  2L9N A;  3CCL I;  2EZK A;  2FRH A;  2R3S A;  2HI3 A;  2ZJQ F;  3ZQF A;  3GFJ A;  5A2Q K;  1D1B A;  4R1H A;  3ASO H;  4I2O A;  2KRF A;  1I3A A;  5FGM A;  2FUG 2;  2QQB A;  3KZY A;  1EA3 A;  3I56 I;  1OMI A;  3SZT A;  1ZG1 A;  1VZ0 A;  4LMY A;  4LIV A;  2R7U A;  2Y9Z A;  3P9K A;  4A3K J;  5EGO B;  3TO7 A;  2DOD A;  1V3F A;  1JGS A;  2LTP A;  1S9H A;  1MND A;  5F0C A;  2DFF A;  4U0Y A;  4S04 A;  2K02 A;  3L1P A;  2DDB A;  4L0Y B;  5DCM A;  2IPQ X;  5FJ8 J;  2PEX A;  2DFI A;  2TRT A;  2HVQ A;  2IVM A;  1OCC H;  4PJ0 C;  3HXL A;  2VLA A;  1F4K A;  1B72 A;  1JT6 A;  2K5C A;  4G94 A;  2ACJ A;  1W7P D;  2EIN H;  3O2P E;  3MAJ A;  3GCM A;  3GVA A;  3M8J A;  1ODD A;  2HQA A;  4H0E A;  4NC7 A;  3D5S C;  4IJA A;  2H27 A;  2JA7 J;  2H6B A;  2HZD A;  2OCE A;  2Y2Z A;  2DOF A;  5GAG J;  1X1B A;  2WB1 A;  1QPM A;  4WF2 A;  1F1Z A;  2Z16 A;  1W4M A;  1BI0 A;  1OKR A;  1KQ8 A;  2KPM A;  4B1R A;  2W7N A;  2UZK A;  3C3W A;  2XRL A;  3DBL B;  2KZG A;  1SAX A;  3ZQI A;  3QPT A;  1TLH B;  4ZYG A;  2QSH X;  2LFB A;  4IF4 A;  3GZ6 A;  1P2F A;  1R5H A;  2VB6 A;  2R7Q A;  3T8T A;  2YU3 A;  3E7L A;  3L2R A;  2XC7 A;  2CQK A;  2PBI A;  1Y0U A;  2GAU A;  1OJL A;  1BA5 A;  3WTZ A;  1TWA J;  5KHD A;  2NNN A;  3OYJ A;  2JA2 A;  3NQO A;  2MGQ A;  4M3F A;  2UXX A;  1FNN A;  3BG9 A;  3S2W A;  3J80 K;  2EZH A;  2GA2 A;  2KIF A;  2D1V A;  4PUS A;  3CQZ J;  4HDV A;  4RGX A;  3KP6 A;  1PUE E;  2HDD A;  1WJ5 A;  3L00 A;  1D8K A;  2DN0 A;  2DOE A;  2GBY A;  2ZFU A;  1W36 D;  2V1N A;  3CCQ I;  2DMP A;  2CMP A;  1Y6I A;  5HS9 A;  4Y13 A;  1AKH B;  3FK7 A;  4BQA A;  5FO5 A;  3FXQ A;  5HLI A;  2BGC A;  2QCO A;  2VOP A;  1X3W B;  2NVY J;  1R1V A;  4HX4 A;  1YW9 A;  1U5T C;  1W7P B;  4NQW A;  1SAN A;  4XLN F;  1MMA A;  1I39 A;  4ASN A;  1S7A A;  1YQA A;  5DV5 A;  2X6X A;  2KRC A;  4KIS A;  1XGO A;  2TDX A;  3BR3 A;  1UST A;  3PUB A;  4RB1 A;  2STW A;  2GM4 A;  1USS A;  4N4N B;  1MDM A;  3LQQ A;  1QGP A;  4NUB A;  2WV0 A;  4M9X A;  2EFQ A;  3K1N A;  1GVJ A;  2HS5 A;  4B8X A;  1FTZ A;  4HV5 A;  3V8L A;  5F08 A;  4E7K A;  1Z6T A;  3DKY A;  1TT5 B;  4F55 A;  1HW5 A;  2XGX A;  1X1D A;  4IHS A;  5KVR A;  1ONV A;  4A6E A;  1BJA A;  2LOO A;  3QYB A;  1FOY A;  2MLK A;  3QU3 A;  2JVH A;  1RPW A;  1UG2 A;  4PCQ A;  3HG9 A;  4FHT A;  3C1D A;  1FT9 A;  1U9O A;  1JKQ C;  4N4O B;  1AOY A;  1YG2 A;  4XR6 A;  2R5Z A;  4LIT A;  4JBA A;  2MFZ A;  1OYW A;  5E1X A;  2DYS H;  2Y0S A;  3BJO A;  3CF5 F;  2FU4 A;  2HQR A;  4CIC A;  2V1X A;  1E2X A;  2QKM B;  2OF7 A;  2E7W A;  3HC7 A;  4F3Q A;  1MGT A;  2QYO A;  2CGP A;  2WTE A;  1VQ7 I;  2DT5 A;  1BW5 A;  2XGD A;  1B4A A;  2J5P A;  4E7I A;  3RZO J;  4FQG A;  1T33 A;  4MIM A;  1ZRE A;  3FBN B;  4YEJ A;  1T0F C;  2E1N A;  1XD7 A;  1X19 A;  1R4M B;  2KP6 A;  2HQ5 A;  3H36 A;  2ME0 A;  3PFI A;  1MBE A;  2VPL A;  1SFK A;  3HDD A;  5L3F A;  2WY8 Q;  1BI2 A;  2EZI A;  1U2W A;  1T0F A;  1G4D A;  3QAH A;  2L02 A;  4HG2 A;  1K4T A;  3H5R A;  3LFK A;  1UHS A;  1YE9 A;  2M4K A;  2VE8 A;  1YS7 A;  2RQP A;  1BM9 A;  1K79 A;  3FBI B;  2EV0 A;  3OYC A;  3FDY A;  2WC2 A;  1NTC A;  2XAF A;  5K7F A;  1IN5 A;  2PMU A;  4OU0 A;  2F4I A;  2I8D A;  4UB8 C;  3S2D J;  1V4R A;  1MZB A;  1HA8 A;  3FXO A;  3FX3 A;  1QU3 A;  3J7A Y;  3JRB A;  4BEH A;  1J59 A;  1B8I A;  1IG7 A;  2P7C B;  5HS7 A;  2A6E F;  1AA7 A;  3MCZ A;  1XSD A;  2D1H A;  4CHU A;  2MC3 A;  3RYR A;  2R7X A;  1A36 A;  4UVA A;  3ZMU A;  3DXJ F;  4XID A;  4QTR A;  4GYI A;  3I59 A;  1S6L A;  5E3L A;  3Q0U A;  2GWR A;  3KP3 A;  2X1D A;  2LKP A;  2KQR A;  3ZP5 A;  3WU2 C;  4U7B A;  4YIR X;  2VON A;  3KFW X;  3MZH A;  2O0Y A;  1DQU A;  4UV8 A;  2ELJ A;  3GX4 X;  3LL7 A;  3QRF F;  4G12 A;  3K69 A;  2FJ1 A;  4BU2 A;  4P9U A;  3SJM A;  1A31 A;  2RQQ A;  4II3 A;  1FSE A;  3PJR A;  3FMQ A;  3GWZ A;  4LB5 A;  3OOP A;  4UNO A;  3FF5 A;  2HOE A;  2E1M B;  4NQW B;  4ZYA A;  1GLN A;  1DGW Y;  5FKN A;  2O3F A;  1CQT A;  2WA0 A;  5KAF C;  3IP4 B;  3GFL A;  5FRN A;  3FHN A;  4AUX A;  3A0B C;  3R60 A;  1P6R A;  4I76 A;  2CW0 F;  2PMZ A;  4PZJ A;  5D6E A;  2DMN A;  1AWC A;  5BOX A;  3DPL C;  1OYI A;  4B4C A;  4Q4Z F;  5TIS C;  3BRO A;  4XSX F;  1U5T B;  2AQF A;  4PJN A;  4U7D A;  3CCJ I;  1MDM B;  2YPR A;  2R4G A;  2NNY A;  1VQ4 I;  4IHW A;  3FHZ A;  2VE9 A;  4FAS D;  2XGC A;  3RQI A;  4ZDO A;  3I55 I;  3LSK A;  3LFU A;  3R0A A;  4LG0 A;  4C9Y A;  5AIQ A;  1BIA A;  3K6G A;  1Z1D A;  3ABL H;  4DJA A;  2QEN A;  3G73 A;  1KA8 A;  3RZD J;  2R7O A;  1R6R A;  2WAQ A;  4CCK A;  4D7N A;  3FXL A;  1FSH A;  1XG1 A;  3T5X A;  1WJE A;  2X51 A;  4KIB A;  2P4W A;  1BIB A;  3JSP A;  1A5J A;  4XLC A;  5IT9 Z;  1K78 B;  5ED4 A;  4CGZ A;  3HKZ A;  4KT6 A;  3S1Q J;  2V6C A;  2HPI A;  5H6R A;  1UCR A;  2R7F A;  3MZ8 A;  1GDT A;  1SFE A;  2F48 A;  2H09 A;  5DEQ A;  2FML A;  1YS6 A;  2DTR A;  1YIJ I;  3DLA A;  1FTT A;  4B43 A;  3H5A A;  1S29 A;  2ESN A;  3TOB A;  1HW2 A;  2XAH A;  2KHM A;  4DBR A;  3S32 A;  3GZN B;  1MBG A;  3F8M A;  3GBG A;  3OYB A;  1TNT A;  1MJA A;  1W5S A;  3BZK A;  1JUM A;  3EUH C;  4U0V A;  1JKR C;  1J75 A;  4RGR A;  4FIS A;  2YR2 A;  2PFB A;  3TGN A;  3AAF A;  4BXX J;  1CF7 B;  2XF7 A;  5FKO A;  1QO0 D;  4DGW B;  4ENJ A;  1XMX A;  2WB1 N;  1SMT A;  1ON1 A;  1QZZ A;  3K1M A;  4O5V A;  2Z2S B;  3E97 A;  2Z3Y A;  3EUH A;  4HEA 2;  2PMH A;  3K4K A;  2QSG X;  4BBS J;  5EYR A;  2A3S A;  3GFM A;  4HBL A;  2LP0 A;  3ECO A;  4M74 A;  3IL2 A;  3I4N J;  2CG4 A;  2A68 F;  4F93 B;  2W48 A;  2AXT C;  2Y0M A;  2Y31 A;  2MSY A;  4A2U A;  2I5U A;  5E17 F;  3DBH B;  2XSJ C;  3PUF A;  3VOD A;  3S1R J;  3CCV I;  1XX5 A;  3TDZ C;  2M3A A;  3CC7 I;  4HF0 A;  3GFI A;  4BEH B;  4UV9 A;  1B8I B;  1QZY A;  3PIP F;  1Z21 A;  2L7F P;  3P5J A;  3HTS B;  2RN7 A;  2KIM A;  2E1O A;  1Z3Y A;  3FM5 A;  1X2N A;  2JMW A;  5HNH A;  4C2U A;  1WRJ A;  2K27 A;  2FF4 A;  1KON A;  3CO7 C;  1FP2 A;  2KDO A;  5IPA A;  3ESW B;  3WTS C;  3PM1 A;  3LST A;  4ZYE A;  2EA4 A;  4P55 A;  3AKZ A;  1XN7 A;  2ZBK A;  3V42 A;  4HF1 A;  5D5X B;  3JRH A;  2IGO A;  2O8X A;  3L2Q A;  3GTG J;  2JA8 J;  3RQ4 A;  4HOB A;  1I50 J;  2M4G A;  1D5Y A;  4LFU A;  2GIZ A;  3BTL A;  1EH7 A;  3WGG A;  1ETX A;  4DZJ A;  5E79 C;  2ZO4 A;  2XHK A;  2HFH A;  3KEY A;  4KA4 A;  3RKY A;  2ELH A;  1QHG A;  2W25 A;  4CYC A;  2NS7 A;  4XNF A;  1Y1V J;  4J19 A;  3GTP J;  2FNA A;  2M5W A;  4M9Z A;  4XK4 A;  3E1S A;  3I9V 2;  3HIF A;  3DPU A;  1TWF J;  3TW6 A;  3ZCO A;  2IBD A;  3BR1 A;  3I71 A;  3IHU A;  4B3X A;  3VB2 A;  1DGR M;  4HPQ A;  5FLM J;  1LVA A;  1G8X A;  1TT0 A;  2XPW A;  4LG0 B;  1U3E M;  2CJJ A;  4E7Z A;  3JRA A;  5LD2 C;  1IC8 A;  4CZC A;  3ZGK A;  3K0L A;  1SMY F;  5BPI A;  3A4C A;  3GW2 A;  4A3M J;  1IRG A;  1MMD A;  5EJC A;  1QVU A;  2A69 F;  2Y0S N;  1ZGA A;  1CGP A;  4ZYH A;  4XLP F;  4AD9 A;  3GTQ J;  4MFE A;  2K3P A;  1OCT C;  2G7H A;  2ZXJ A;  2BOL A;  3L2C A;  1V5F A;  1EH6 A;  1KYW A;  4M3E A;  4CCO A;  4DYC A;  1YIT I;  4M72 A;  3R6S A;  3OV8 A;  1ZEL A;  3S1M J;  5BS6 A;  1WWX A;  1HBX G;  3J7A O;  3RIR A;  2M0M A;  4EM2 A;  3BR5 A;  3G71 I;  3PL8 A;  1TBX A;  1H89 C;  3WTV C;  2E2H J;  1TWC J;  3PSI A;  3IWF A;  2QUF A;  3EUA A;  1RUN A;  1GXP A;  2STT A;  4FE4 A;  3U1K A;  5B5E C;  2KIU A;  4KNY A;  5GTI C;  4MGR A;  1SD5 A;  2EA2 A;  4PJJ A;  1B59 A;  1W0U A;  2F4M B;  3TO6 A;  3W6V A;  3KEQ A;  4C3H J;  2QSF X;  4FTH A;  3CCY A;  4UUS B;  3MN2 A;  2R7S A;  3S3N A;  1XC5 A;  3CMA I;  5LFA A;  3L2W A;  4JQF A;  2CW7 A;  2D2W A;  2X48 A;  3UR3 C;  3TW7 A;  2IS6 A;  2F5E A;  3CJT B;  4BE1 A;  2FNP A;  2OPT A;  3H9J A;  1IN7 A;  2V26 A;  3MQ0 A;  5FKK A;  1OR7 C;  3F8N A;  4XQF A;  5GTH C;  2ZKZ A;  4CZZ A;  2OAZ A;  5JLW A;  2JT1 A;  4AYB A;  2K9Q A;  1EF4 A;  4LJZ F;  1S8N A;  3QWL A;  4BKX A;  4BBR J;  2V1U A;  1HSJ A;  1GXQ A;  4LLL A;  1VND A;  4UB6 C;  2E19 A;  3DEW A;  1OR7 A;  1Z0X A;  4LIU A;  2RV8 A;  4PSX A;  1X1P A;  2JRT A;  2P6T A;  5BNG A;  1XDU A;  2CWE A;  3HB9 A;  1XGS A;  3DF8 A;  5CYV A;  3S8P A;  3KET A;  3OYK A;  4LGW A;  1Z6R A;  3KE2 A;  5D4R A;  3OSF A;  2QBY B;  3CME I;  2CQX A;  1WQ2 A;  4IRG A;  2JWT A;  2XB5 A;  1TWH J;  2DDA A;  2RNJ A;  1X4P A;  1V5G A;  3KYL A;  2OZ6 A;  4ZTJ A;  1ZRC A;  3LA7 A;  3SZG A;  4RB3 C;  3K4C A;  3H0D A;  1RR7 A;  2ZSI B;  3FIW A;  2BY2 A;  1DP3 A;  2IAI A;  1QRY A;  3CCE I;  2PMZ N;  4RM3 A;  1AKH A;  2DPU A;  5CVJ A;  4NBQ A;  1R5I D;  1SC7 A;  5ILS A;  3HTU A;  4Y15 A;  5CVV A;  3ZQH A;  4P1W A;  2QVO A;  1JT0 A; 
#chains in the Genus database with same CATH homology
 4BHB A;  5J6X A;  4XRF A;  2HWV A;  2RC4 A;  5IT9 K;  1I1S A;  5DUI A;  1IXS B;  2Z33 A;  1R23 A;  2O61 A;  1BI1 A;  3RKX A;  3HRT A;  4KYW A;  1XSX A;  3BZ6 A;  3NEU A;  5LHH A;  1IN6 A;  3T8R A;  3CTA A;  4M6X A;  2DAO A;  4YFN F;  1LEA A;  2IJL A;  5HDN A;  2GZW A;  1P4A A;  3WE3 A;  4O3M A;  5D5W B;  3ZQ7 A;  4YG2 F;  1HKS A;  4I0B A;  4L0Z B;  3FZV A;  4A5N A;  1S3J A;  4IHT A;  1I5Z A;  3TDU C;  3BDD A;  2W84 A;  2PN6 A;  4R79 A;  2FE3 A;  1XCB A;  4UVB A;  1QBJ A;  3F6V A;  3K2Z A;  1LDJ A;  2AXL A;  1PP8 F;  4YII A;  3DEU A;  4WCG A;  2LNB A;  3BPX A;  1X3U A;  1XCV A;  3T1B A;  4BHP A;  4KMU X;  2VC1 A;  3U2R A;  6PAX A;  4EJV A;  2HQN A;  2X0L A;  2HYF A;  1W5T A;  1HKT A;  3J81 Z;  1Z91 A;  3LA3 A;  3DQV C;  5HLH A;  1S7O A;  2PI0 A;  4M6Y A;  3BP8 A;  4L5J A;  4A0Y A;  1OPC A;  1RNL A;  3IC7 A;  3GF2 A;  5H6Q A;  3ABT A;  2YX4 A;  3HOS A;  1G3T A;  3MZY A;  2V79 A;  2A07 F;  5LEK A;  5JR3 A;  3I58 A;  3TOA A;  1Z05 A;  3QP6 A;  1KQ9 A;  1SD6 A;  3F22 A;  3WU1 B;  1FY7 A;  3WTT C;  3P7N A;  1U5T A;  3M8F A;  2BYV E;  4OIO F;  2VN2 A;  1YTY A;  1K6O A;  4ENN A;  3QPH A;  3F8B A;  2EFN A;  2XRN A;  1ZH5 A;  1DDN A;  4MEY F;  3WU0 A;  1K78 A;  3JTH A;  4RAY A;  3ROU A;  3ERE D;  3CUQ C;  2MH9 A;  3E5X A;  4RS8 A;  4WWC A;  1FBU A;  3CUQ A;  5E18 F;  2EB7 A;  1REP C;  2E1C A;  2A61 A;  4R8H A;  1I6X A;  1J5Y A;  2P5L C;  1CF7 A;  4UXN A;  5F1R A;  4I02 A;  5ILU A;  5DDG A;  4CYD A;  3HUG A;  3EDP A;  4UUV A;  1HQC A;  5HDK A;  1MD0 A;  5CLS A;  2EK5 A;  3F72 A;  5HVQ C;  1T2K A;  3IKV A;  4ZYD A;  5D6F A;  4B09 A;  3P9I A;  3V7S A;  3F8F A;  4HW0 A;  5D8L B;  4OIR F;  2JPC A;  5ICE A;  2OD5 A;  4EQQ A;  4LLG F;  3EQL F;  2NYX A;  2A5Y B;  2P5K A;  3KZZ A;  5DCF A;  4A12 A;  1FZP B;  3GO5 A;  3D5L A;  5D5V B;  3R61 A;  1L0O C;  2UWM A;  4HZF A;  4I98 B;  1ZG5 A;  4HLX A;  4N0B A;  2AS5 F;  4Q47 A;  4MHG A;  1VTN C;  4CXF A;  4L9T A;  2ETH A;  2QM3 A;  2RDP A;  4YIF A;  5IT3 A;  3ZMV A;  4P5O A;  4FT8 A;  2P6S A;  3ZMT A;  3E6D A;  3EYY A;  2RVC A;  1QNT A;  4IRI A;  4YFK F;  3ML6 A;  3BY6 A;  4UVC A;  1DP7 P;  1XGM A;  4NB5 A;  2W24 A;  4AWX B;  2HGC A;  4ESJ A;  1U78 A;  3MWM A;  4RB2 C;  3I54 A;  2OQG A;  4L9J A;  5EEH A;  1MKM A;  2GIV A;  2UXN A;  3T0Y A;  1DPU A;  5LRR A;  1YFH A;  3KLO A;  4BNC A;  2VBW A;  4HV6 A;  5HS8 A;  5L3C A;  5LGT A;  3CDH A;  3RI4 A;  4G7O F;  1DUX C;  2BEO A;  2EV5 A;  3RJP A;  4MTD A;  2PG4 A;  2ZNY A;  1XGN A;  1P4X A;  1UHW A;  2P5V A;  1SFU A;  3K1P A;  3CUQ B;  3E6C C;  2ZNZ A;  5FFX A;  4WXC A;  4HLY A;  2XIG A;  4GYG A;  2M45 A;  4LB6 B;  1R36 A;  5TJJ A;  3HOT A;  3J81 K;  2BBY A;  4L9V A;  4KDP A;  1ZLJ A;  3KP4 A;  2K86 A;  4HQM A;  2W85 A;  4CDG A;  3I53 A;  2ZFW A;  3HRM A;  3FWE A;  1Z9C A;  3COA C;  4U0W A;  1ZGJ A;  2IP2 A;  4EGZ A;  3M8E A;  1Q1H A;  1FC3 A;  5JHU A;  4KUM A;  5K5R A;  2HTJ A;  1BC8 C;  5E20 A;  4JK1 X;  4EM1 A;  2EWN A;  3GEZ A;  3VFZ A;  5F64 A;  1J0R A;  5ICC A;  2QBY A;  3U9G A;  1KU9 A;  2A6H F;  4G6Q A;  3WTX C;  4BAY A;  4HX8 A;  2QQ9 A;  4ESF A;  4OIP F;  3JSO A;  2ISY A;  5ILV A;  2XUB A;  2ESH A;  1T98 A;  1B9N A;  4RGU A;  5E1W A;  1J7K A;  3KLN A;  2BE5 F;  2LSO A;  2E7X A;  2QLZ A;  5HLG A;  2DPD A;  3HHH A;  4Q48 A;  3TQN A;  4MQV A;  1O3T A;  1A04 A;  2XAG A;  3MEX A;  2R7D A;  1ZAR A;  3SFZ A;  3MFK A;  1KU2 A;  1SFX A;  3W6K B;  5L3E A;  1TNS A;  3E6M A;  3C18 A;  1SD7 A;  4A5M A;  1Z7U A;  4KMF A;  2C6Y A;  2CSO A;  1ZN2 A;  4LK1 F;  2X4H A;  3V7C A;  2L4A A;  4EV0 A;  5BMZ A;  1YO5 C;  4D0P A;  5LHI A;  2EFW A;  3ZPL A;  2VBX A;  1TW3 A;  5HOO A;  2DK5 A;  4KN7 X;  2NRA C;  1R00 A;  1BC7 C;  3IWZ A;  4HDU A;  5LGU A;  1R7J A;  4LD5 A;  3FMR A;  5LGN A;  1HW1 A;  5DD8 A;  1MJB A;  3HYI A;  3RDI A;  3LA2 A;  1IN8 A;  2QWW A;  5DD4 A;  4IPA A;  2KJC A;  2P8T A;  5CVI A;  5FB2 A;  2VOO A;  3RPQ A;  4HA8 A;  3DFG A;  1IF1 A;  4L18 B;  1KGS A;  3E6B A;  1HST A;  4ESB A;  2PQ8 A;  1ZAO A;  2XV4 S;  1PP7 U;  2OBP A;  1O3S A;  4QLC U;  5E8I A;  3I5U A;  3QU6 A;  3HHG A;  2K4J A;  2DU9 A;  2GXB A;  2G9W A;  1TQM A;  5JFR A;  1EV7 A;  3IRQ A;  2XVC A;  1WI9 A;  1BN5 A;  3GUD A;  4Y17 A;  2HTS A;  1IUY A;  3FXR A;  1EH8 A;  3LAJ A;  3FXU A;  3FM3 A;  3V4G A;  2EJR A;  2Y48 A;  4E70 A;  1WSU A;  5D5U B;  4UHT A;  2DW4 A;  3N4M A;  5JVT A;  1R1T A;  4A0X A;  4NHJ A;  1YW8 A;  5L3G A;  1E17 A;  4AIK A;  2ADU A;  4Z2Y A;  4OOI A;  2QQA A;  3RPU A;  4MEX F;  1RI7 A;  4KIC A;  1G3W A;  2M8E A;  4EVI A;  2XKP A;  2W57 A;  1F9N A;  2YSR A;  4WXH A;  2DQR A;  4LLN A;  2VOD A;  2LF8 A;  5ICG A;  4N9I A;  2HZT A;  2IA2 A;  3I64 A;  4XSZ F;  3PQK A;  1FX7 A;  3W6J B;  3ULQ B;  2FA5 A;  2NAZ A;  4QWQ A;  1G3Y A;  1J9I A;  5K5O A;  2FMY A;  1XDS A;  1KU7 A;  2VXZ A;  4FX4 A;  3JTG A;  2VT3 A;  1UFM A;  2DI3 A;  4GGG A;  4O6J A;  3V8J A;  2IT0 A;  3JW4 A;  3I4P A;  5E8G A;  3ABU A;  1JE8 A;  2NS0 A;  1FOK A;  1HKQ A;  2OQR A;  4EGY A;  1FP1 D;  1WKM A;  4M71 A;  2ZJ2 A;  3F21 A;  2ZCW A;  3I0T A;  2CYY A;  1JXS A;  2XAJ A;  4EJO A;  4EJW A;  2Q2E A;  1DPR A;  4EMS A;  2L4M A;  4G7H F;  1T39 A;  2EFP A;  2P7V B;  4ON0 A;  5CVU A;  4G7Z F;  3V8K A;  4YFX F;  4RB0 A;  2Z99 A;  4AIJ A;  3WGH A;  2VT2 A;  5AIP A;  4IVN A;  3V7R A;  1HXD A;  4KT5 C;  3F8C A;  3IKT A;  1G3S A;  4P9F A;  2DK8 A;  3R0J A;  3ECH A;  5D8K B;  2JSC A;  4GCV A;  3SXY A;  1LNW A;  3ZN0 A;  1G6N A;  2Q8K A;  4A0Z A;  1ZRD A;  5FLX Z;  1L3L A;  4DQ2 A;  5FFZ A;  1BBY A;  3HSR A;  2HDC A;  1XSV A;  1XMA A;  5K5Q A;  4I0A A;  1LJ9 A;  1RUO A;  1ZHF A;  4KIG A;  2LF7 A;  2RGV A;  2EFO A;  4EM0 B;  1D8J A;  3L9F A;  2MLG A;  2PJP A;  4KFC A;  1B1B A;  4ZZL A;  4RGS A;  2IW5 A;  3ZN1 A;  1RIO H;  2M1B A;  5LHG A;  3GZ5 A;  1TW2 A;  3JAM Z;  1JHH A;  4AVP A;  1QQI A;  2O6G E;  3QOP A;  5DCM B;  1O7F A;  4N9H A;  2GA1 A;  2HEO A;  1O3R A;  4AIH A;  3HSF A;  1P4W A;  1T38 A;  3WE2 A;  3SQN A;  1F5T A;  2D45 A;  1KQ0 A;  2FOK A;  4A6D A;  2OZU A;  1YIO A;  1FWZ A;  3Q9S A;  1ZRF A;  3F23 A;  4ENM A;  1U6G A;  3ZMD A;  3ELK A;  5DYM A;  1BI3 A;  3N97 A;  1IAW A;  3H3U A;  1JHF A;  2H94 A;  3LQR A;  2DQL A;  3O6B B;  2XAQ A;  4IXA A;  5L3B A;  1IZ1 A;  3TKY A;  4ZH4 F;  2M30 A;  3K9T A;  3Q5F A;  3Q9V A;  2DBB A;  5HDG A;  3D0S A;  1FYM A;  3RYP A;  2CFX A;  2V1D A;  4CO8 A;  2LDU A;  2CO5 A;  3HRU A;  1K7A A;  2BV6 A;  1YYV A;  2DLL A;  3DP7 A;  5CVR A;  4BXU A;  3FMS A;  5FD6 A;  5L3D A;  3L09 A;  4TV7 A;  2IA0 A;  2JPB A;  4WK8 F;  3BJA A;  4M73 A;  1O7L A;  1H9T A;  1T6S A;  2XRO A;  2WWY A;  1LB2 A;  1J2X A;  4RAZ A;  4WX9 A;  3U1D A;  3CO6 C;  4I01 A;  3KP7 A;  1NHA A;  3E5Q A;  3H3Z A;  1FBS A;  3HRS A;  1D3Y A;  3SHF A;  1I1G A;  5F6F A;  1O57 A;  1RZ4 A;  3VEP A;  3RTR A;  5BQT A;  3WG9 A;  1TQI A;  4GO1 A;  2GXG A;  3CLO A;  3CUO A;  4PDK A;  3GXO A;  3H92 A;  4MNU A;  2M87 A;  2KJB A;  3SZP A;  2ZME A;  2O03 A;  4KN4 X;  4XBF A;  1FPQ A;  1P92 A;  5A2Q Z;  3C7J A;  3WTU C;  5J8C A;  4P96 A;  4PGH A;  2JTV A;  2EV6 A;  2L54 A;  2J5O A;  1ZYR F;  4L9N A;  3REO A;  3KEO A;  1UHM A;  2Y75 A;  5KK1 A;  2L3D A;  4I7H A;  2YX7 A;  1R1U A;  4K2E A;  5H20 A;  1ZLK A;  2FXA A;  4G9Y A;  4KIF A;  1STZ A;  2K7L A;  2FQ3 A;  5FLX K;  1YW7 A;  3M7G A;  3WTY C;  3G3Z A;  2FBK A;  1H0M A;  2GQQ A;  3I59 B;  5BPD A;  2L01 A;  2FSW A;  3B73 A;  2RKH A;  3KCC A;  1FYL A;  3DPT A;  5D4S A;  3LWF A;  4ZZD A;  2F5D A;  3QP5 A;  1XB4 A;  1IXC A;  1ON2 A;  1ZG3 A;  1KYZ A;  3ZMS A;  1B6A A;  1MJ9 A;  4HX7 A;  2ISZ A;  3DV8 A;  4WXD A;  2COM A;  1KU3 A;  1TTY A;  2Z5U A;  2Z9O A;  3J80 Z;  5LLQ A;  2MD5 A;  3IRR A;  2FBI A;  4HAM A;  4ETS A;  3O3K A;  1FYK A;  3EET A;  4MTE A;  4BHC A;  3BPV A;  1ULY A;  3EYI A;  5LRS A;  2MH2 A;  3JAM K;  3KP2 A;  4L5I A;  2KKO A;  5J8F A;  1R22 A;  4OMY A;  4OIN F;  2B0L A;  5LBQ A;  1IW7 F;  1FBQ A;  5K1Y A;  4S05 A;  4G8X A;  2G7U A;  5JI6 A;  4OMZ A;  5ICF A;  1FLI A;  1C0W A;  4GXO A;  2HKO A;  2VBZ A;  2H6C A;  2QZ8 A;  3BJ6 A;  3LAP A;  4G6D A;  1LDK B;  4HQE A;  2ZME B;  4FX0 A;  3M9A A;  1R58 A;  4M9S A;  2XAS A;  1YLF A;  1IRF A;  2PLY A;  3ZMZ A;  1OYY A;  5DUK A;  2V9V A;  3WGI A;  2F5C A;  4EJU A;  4DNC A;  1IN4 A;  1LEB A;  2VC0 A;  3HSE A;  3R4K A;  1D5V A;  4BYY A;  4LK0 F;  3WTW C;  2IRF G;  3P9C A;  3GYH X;  2MBF A;  4BH9 A;  2F2E A;  5AON A;  3F6O A;  1IXR C;  3BOQ A;  3WOD F;  3L7W A;  2VBY A;  2DO7 A;  3TO9 A;  1SD4 A;  1O3Q A;  4I09 A;  2HKX A;  4OIQ F;  3E5U A;  2HR3 A;  3VOE A;  3ISP A;  2F5F A;  4EJT A;  1B9M A;  5E1Z B;  5EEG A;  5CJ9 A;  2FBH A;  3F3X A;  3CJN A;  4ENK A;  3DKW A;  1R5G A;  1BOA A;  2FEZ A;  1LDD A;  2XKO A;  1GHC A;  3KP5 A;  4F7Z A;  2K4B A;  2OU2 A;  3PQJ A;  1W7P A;  5FD5 A;  1TQP A;  3M1E A;  3B02 A;  1UB9 A;  2OA4 A;  3BWG A;  4PGG A;  1U8R A;  1LQ1 A;  4U88 A;  2HYG D;  5TRD A;  4MQ9 F;  3NRV A;  3GLX A;  1XMK A;  4Q5S F;  2IA1 A;  2Q0O A;  1H9G A;  5ERI A;  3RKW A;  3E3V A;  2JZY A;  1PDN C;  2MA3 A;  1I27 A;  4HYE A;  5LEJ A;  4IRH A;  2FRH A;  2R3S A;  3GFJ A;  5A2Q K;  4R1H A;  4I2O A;  2KRF A;  5FGM A;  2QQB A;  3KZY A;  1OMI A;  3SZT A;  1ZG1 A;  4LMY A;  3P9K A;  3TO7 A;  1V3F A;  1JGS A;  4U0Y A;  4S04 A;  2K02 A;  4L0Y B;  5DCM A;  2IPQ X;  2PEX A;  2DFI A;  2IVM A;  1F4K A;  4G94 A;  2ACJ A;  1W7P D;  3O2P E;  3MAJ A;  3GVA A;  1ODD A;  4H0E A;  4IJA A;  2H27 A;  2H6B A;  1QPM A;  4WF2 A;  1F1Z A;  1W4M A;  1BI0 A;  1OKR A;  1KQ8 A;  2UZK A;  3C3W A;  1SAX A;  3QPT A;  1TLH B;  4ZYG A;  4IF4 A;  3GZ6 A;  1P2F A;  1R5H A;  3T8T A;  2YU3 A;  2CQK A;  2PBI A;  1Y0U A;  2GAU A;  3WTZ A;  2NNN A;  3NQO A;  2UXX A;  1FNN A;  3S2W A;  3J80 K;  2GA2 A;  2KIF A;  2D1V A;  4HDV A;  4RGX A;  3KP6 A;  1PUE E;  3L00 A;  1D8K A;  4Y13 A;  5HS9 A;  4BQA A;  5FO5 A;  3FXQ A;  5HLI A;  2BGC A;  2VOP A;  1R1V A;  4HX4 A;  1YW9 A;  1U5T C;  1W7P B;  4NQW A;  4XLN F;  4ASN A;  1S7A A;  1YQA A;  5DV5 A;  1XGO A;  2TDX A;  1UST A;  2STW A;  4RB1 A;  1USS A;  1MDM A;  3LQQ A;  1QGP A;  2WV0 A;  4M9X A;  2EFQ A;  3K1N A;  1GVJ A;  2HS5 A;  4B8X A;  4HV5 A;  3V8L A;  1Z6T A;  1HW5 A;  2XGX A;  4IHS A;  5KVR A;  1ONV A;  4A6E A;  1BJA A;  2MLK A;  3QU3 A;  4PCQ A;  4FHT A;  3C1D A;  1FT9 A;  1AOY A;  1YG2 A;  4JBA A;  1OYW A;  5E1X A;  3BJO A;  2FU4 A;  2HQR A;  4CIC A;  2V1X A;  1E2X A;  2E7W A;  1MGT A;  2QYO A;  2CGP A;  2WTE A;  2DT5 A;  1B4A A;  2J5P A;  1ZRE A;  2E1N A;  1XD7 A;  3PFI A;  5L3F A;  1BI2 A;  1U2W A;  1T0F A;  1G4D A;  3QAH A;  2L02 A;  3LFK A;  2VE8 A;  1YS7 A;  2RQP A;  1BM9 A;  1K79 A;  2EV0 A;  2WC2 A;  2XAF A;  1IN5 A;  2PMU A;  4OU0 A;  1V4R A;  1MZB A;  3FX3 A;  1J59 A;  2P7C B;  5HS7 A;  2A6E F;  3MCZ A;  1XSD A;  2D1H A;  4CHU A;  2MC3 A;  3RYR A;  4UVA A;  3ZMU A;  3DXJ F;  4GYI A;  3I59 A;  1S6L A;  2GWR A;  3KP3 A;  2LKP A;  3ZP5 A;  4U7B A;  2VON A;  3KFW X;  3MZH A;  2O0Y A;  3GX4 X;  4UV8 A;  3QRF F;  3K69 A;  4P9U A;  1FSE A;  3FMQ A;  3GWZ A;  4LB5 A;  3OOP A;  4UNO A;  3FF5 A;  2HOE A;  2O3F A;  3GFL A;  3R60 A;  1P6R A;  2CW0 F;  4PZJ A;  5D6E A;  1AWC A;  5BOX A;  3DPL C;  1OYI A;  4Q4Z F;  4U7D A;  3BRO A;  4XSX F;  1U5T B;  1MDM B;  2YPR A;  2NNY A;  3FHZ A;  2VE9 A;  4LG0 A;  3R0A A;  5AIQ A;  1BIA A;  1Z1D A;  2QEN A;  3G73 A;  1KA8 A;  1FSH A;  3T5X A;  4KIB A;  2P4W A;  1BIB A;  3JSP A;  5IT9 Z;  1K78 B;  5ED4 A;  4CGZ A;  2V6C A;  5H6R A;  1UCR A;  2R7F A;  1SFE A;  2H09 A;  5DEQ A;  2FML A;  1YS6 A;  2DTR A;  1S29 A;  2ESN A;  3TOB A;  1HW2 A;  2XAH A;  3F8M A;  1TNT A;  1MJA A;  1W5S A;  4U0V A;  1J75 A;  4RGR A;  2YR2 A;  2PFB A;  3TGN A;  3AAF A;  1CF7 B;  1QO0 D;  4ENJ A;  1SMT A;  1ON1 A;  1QZZ A;  3K1M A;  4O5V A;  3E97 A;  2Z3Y A;  3EUH A;  2PMH A;  2A3S A;  3GFM A;  4HBL A;  3ECO A;  4M74 A;  3IL2 A;  2CG4 A;  2A68 F;  2Y0M A;  4A2U A;  5E17 F;  3VOD A;  3TDZ C;  4HF0 A;  3GFI A;  4UV9 A;  1QZY A;  3HTS B;  2RN7 A;  2KIM A;  3FM5 A;  1WRJ A;  2K27 A;  2FF4 A;  3CO7 C;  1FP2 A;  3WTS C;  4ZYE A;  3LST A;  2EA4 A;  4P55 A;  1XN7 A;  2ZBK A;  4HF1 A;  5D5X B;  2O8X A;  4HOB A;  4LFU A;  1EH7 A;  3WGG A;  2ZO4 A;  2XHK A;  2HFH A;  4KA4 A;  3RKY A;  2ELH A;  2W25 A;  2FNA A;  2M5W A;  4M9Z A;  3HIF A;  3I71 A;  3IHU A;  3VB2 A;  1LVA A;  4LG0 B;  1U3E M;  3K0L A;  1SMY F;  5BPI A;  3GW2 A;  1IRG A;  2A69 F;  1ZGA A;  1CGP A;  4ZYH A;  4XLP F;  4AD9 A;  2G7H A;  2ZXJ A;  3L2C A;  1EH6 A;  1KYW A;  4M72 A;  3R6S A;  3OV8 A;  5BS6 A;  1WWX A;  1HBX G;  3J7A O;  3RIR A;  4EM2 A;  1TBX A;  3WTV C;  3IWF A;  2QUF A;  1RUN A;  2STT A;  1GXP A;  4KNY A;  2KIU A;  4MGR A;  1SD5 A;  2EA2 A;  1B59 A;  3TO6 A;  3KEQ A;  4JQF A;  2D2W A;  2F5E A;  2FNP A;  1IN7 A;  3MQ0 A;  3F8N A;  2ZKZ A;  4CZZ A;  2OAZ A;  2JT1 A;  4LJZ F;  1S8N A;  2V1U A;  1HSJ A;  1GXQ A;  4LLL A;  1OR7 A;  2RV8 A;  2JRT A;  2P6T A;  1XDU A;  2CWE A;  1XGS A;  3DF8 A;  5CYV A;  3KET A;  4LGW A;  1Z6R A;  3KE2 A;  5D4R A;  2QBY B;  1WQ2 A;  4IRG A;  2RNJ A;  2OZ6 A;  1ZRC A;  3LA7 A;  4RB3 C;  2DPU A;  5CVJ A;  5ILS A;  3HTU A;  4Y15 A;  5CVV A;  4HF2 A;  2QVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...