4EM2A

Seleno-methionine staphylococcus aureus marr in complex with salicylate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
total genus 58
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em2A00
3NEUA 1O7FA 4S05A 2ZBKA 3SHFA 1YYVA 2NAZA 3I0TA 5DCMB 4KICA 1HW2A 2DLLA 3G73A 2P7VB 3GZ6A 1PUEE 3GUDA 1TTYA 5FD6A 5D5VB 2VOOA 4BHCA 4R8HA 3J81Z 2EV6A 2HYFA 5IT9K 1G3YA 5K1YA 4UV8A 4ENMA 2RNJA 3LA3A 3GX4X 5JFRA 2CGPA 1SD6A 1HKQA 2H6CA 1DPRA 1ON1A 2HKXA 4A0XA 3GO5A 3K1PA 3BJAA 1RI7A 5E8IA 1P2FA 3JAMZ 2VONA 1F1ZA 4YG2F 5J8CA 4UVAA 2MC3A 3E6CC 1S8NA 1ONVA 4WXDA 1R58A 3V7CA 1H9TA 4IRIA 2PMHA 2QBYA 3M9AA 3N4MA 2BV6A 3PQKA 3GZ5A 2ESNA 1R7JA 3EQLF 4BHBA 1FBUA 1P4XA 4Y17A 3EETA 1R1VA 4UNOA 3CUQA 3MZHA 3L2CA 2V79A 1YO5C 1KYWA 1B4AA 5BPDA 1B9NA 4O3MA 2QWWA 2A6HF 1TQPA 2XHKA 1QZZA 2HTJA 4QLCU 2DT5A 1Z7UA 2IRFG 2STWA 2R3SA 3KP7A 1EH7A 1XMAA 1ODDA 3OOPA 1XGMA 4R79A 4Q4ZF 4KNYA 3BP8A 1FX7A 1U2WA 1S3JA 2K27A 3F8BA 1UHWA 2VOPA 1G4DA 2DBBA 1MJAA 3VFZA 2MLGA 2DK8A 2MA3A 4RGUA 2VXZA 3C3WA 3WTTC 4EJVA 1HXDA 1HW5A 1IRGA 1KQ8A 3T1BA 3WTWC 5JR3A 2XRNA 3H3UA 4L9TA 1TW3A 1Z6RA 4CYDA 1KU2A 1QZYA 1B59A 1R5GA 2LF8A 4N9IA 5J8FA 1YFHA 3ZMTA 2CW0F 1D3YA 5JVTA 3VOEA 4GXOA 2RQPA 4P5OA 5CYVA 4OOIA 4I7HA 1FSEA 2PMUA 4WXHA 3GFIA 1UCRA 3DPTA 3E5UA 1W7PD 2A69F 4ESJA 4YIIA 1O3SA 2P6TA 4GYGA 1A04A 2VODA 2E1NA 4EM2A 2HEOA 2GXGA 3QOPA 3BPXA 2EA4A 2K7LA 3SFZA 3Q5FA 1K79A 5DCMA 5K5OA 3BOQA 4MHGA 2L4AA 2EFWA 4HDVA 4LG0A 2HQRA 4GO1A 4L9JA 5F64A 1I5ZA 4IF4A 1E17A 2Z33A 4BHPA 3J80Z 5LBQA 1JHHA 3R0AA 1MD0A 4Q5SF 3F23A 4BH9A 4Q47A 2HWVA 5D8LB 2K4BA 3IHUA 3BJ6A 5D5XB 3LWFA 4L5IA 2FU4A 4EJTA 2CQKA 3RYPA 1FYKA 2XKPA 3IWFA 2RKHA 5D4SA 3DEUA 2XAQA 5L3FA 4EVIA 1WRJA 2ZXJA 5BS6A 1ON2A 1RUNA 4PGGA 1MGTA 1Z6TA 4WK8F 3CUOA 4R1HA 3M8EA 2D2WA 5A2QK 4HF2A 1O3QA 4PGHA 3AAFA 2VBXA 4ZYHA 1EV7A 1L3LA 1HKSA 2OZ6A 3V8KA 3L7WA 3NQOA 1QGPA 1B6AA 3E5XA 4U88A 1Z05A 1QBJA 2J5PA 3RKYA 2UXNA 3FXUA 1SD7A 4LMYA 3WODF 4E70A 3HRTA 3L00A 5DEQA 1BI0A 2H6BA 3CUQB 1MDMA 5DD8A 5ERIA 4RB0A 5HDKA 1YIOA 1TLHB 1MJBA 2ISZA 1P92A 3ERED 3F8NA 3E6DA 2A68F 2VBYA 4GYIA 4OIRF 1LEBA 5E1WA 1D5VA 5HVQC 3WTSC 4HDUA 3KEOA 2ZO4A 2PI0A 2WWYA 3SXYA 1F4KA 2EFPA 2O6GE 3V8LA 3IRQA 3T8TA 4Y13A 1FNNA 2QM3A 1TQMA 5L3EA 1IUYA 3EDPA 1WQ2A 1P4WA 3T0YA 2H94A 2Q0OA 3VODA 2KJCA 1FBSA 2FNPA 3TO9A 4UV9A 4GGGA 2Z99A 2QLZA 2J5OA 4PZJA 3V4GA 2KIFA 2RVCA 3HRUA 5HS9A 1IN5A 2VN2A 2XAGA 4RAYA 4AIKA 2PFBA 4LG0B 1QO0D 2LNBA 4FHTA 2HQNA 1REPC 2FBKA 4L0ZB 3I4PA 2CFXA 4FX0A 1RZ4A 2FMYA 4WXCA 3I54A 1XDUA 5LGTA 2DQLA 5HDNA 4G7ZF 3K1MA 4UUVA 1XGSA 2A3SA 1I27A 1T38A 3GYHX 4LLNA 3LFKA 4M6YA 4A12A 1J9IA 4HA8A 1ULYA 3DPLC 1IXRC 2ZMEB 4ZYEA 1OYYA 1BI1A 1OYWA 4YFXF 3ZMVA 1FY7A 4IJAA 1FYLA 1XCVA 4B8XA 1FLIA 4LK1F 2D1VA 2HKOA 3ULQB 2P5VA 3J80K 1ZAOA 2H09A 4JBAA 1R5HA 1BC7C 1ZHFA 3WTUC 4UXNA 1PDNC 1J0RA 1UB9A 5IT3A 3E5QA 1Q1HA 5L3BA 3TO6A 1BI2A 4AWXB 3KETA 3CUQC 1GVJA 4CXFA 4U7DA 2ZMEA 1Z1DA 2FF4A 2VC1A 3HTSB 5DYMA 2YR2A 1XCBA 3BJOA 1OR7A 3WGGA 2P5KA 4A6EA 5ILSA 4M9XA 2F5EA 4HLXA 3ROUA 4CZZA 3KP2A 4A5MA 1B9MA 1O3RA 3GFLA 1XGNA 4U0WA 3LA7A 4PDKA 3F3XA 4IRGA 4HV5A 3ELKA 3IRRA 3RDIA 5DV5A 4G7HF 2K4JA 1SAXA 3CTAA 4L5JA 1DPUA 4N9HA 5FLXZ 2ACJA 5DUIA 4HBLA 4EGZA 3LQQA 4XLPF 1R00A 2KIMA 5CVIA 4JK1X 4LFUA 3MFKA 3B02A 1PP8F 4KN4X 3FZVA 3RKWA 1QPMA 4O5VA 3ZMUA 1ZLJA 2V1UA 1UFMA 1V4RA 1FPQA 4RS8A 4ZH4F 2JPBA 4KUMA 2ZNYA 4KDPA 1SMYF 4EJUA 5KK1A 3FMQA 4G6QA 5LHIA 3E6MA 3R61A 5CLSA 1XGOA 5HS7A 1USSA 2ZKZA 4MQVA 4RB1A 2XAJA 1BIAA 4MTDA 2NRAC 1U5TA 3NRVA 5ILVA 2CG4A 4CDGA 1IN7A 1W4MA 4G6DA 1LDKB 4F7ZA 4I0BA 2F2EA 2IW5A 2VT3A 3F72A 4RAZA 3PQJA 5J6XA 5K5QA 6PAXA 3KP3A 2RGVA 1XSXA 2GZWA 1BC8C 2P4WA 2RC4A 1ZREA 3ZN0A 3WE3A 2CYYA 3ZP5A 3QP5A 2DQRA 2M30A 1YS7A 2QQ9A 3F21A 3H92A 4LGWA 3RPUA 3R0JA 2P7CB 2FQ3A 4P9FA 4HAMA 1SD4A 3QPTA 2E7XA 4LJZF 1SFXA 1BI3A 3J81K 3WGIA 1ZLKA 2VE8A 1OYIA 3ZMDA 2KKOA 2PG4A 4CO8A 1ZRFA 4HOBA 5ED4A 2KIUA 4M72A 3F22A 1IN4A 1X3UA 4M71A 4EV0A 3HHHA 1U6GA 3O2PE 5TRDA 2G7HA 2RDPA 3I58A 4JQFA 1O3TA 4RGRA 2HGCA 2Y0MA 4EQQA 3RPQA 3FMSA 5FO5A 4KA4A 2EJRA 1XSDA 2RN7A 5CVRA 1CF7B 1BBYA 1ZGAA 1S29A 2WV0A 3T5XA 3JW4A 3WE2A 5H20A 4MGRA 4L9VA 2VE9A 1FYMA 1WSUA 3SQNA 5L3DA 2A61A 5AONA 3FXQA 1O7LA 4HQMA 4M73A 3EUHA 4NB5A 1FZPB 1JHFA 2XROA 1R23A 4HF1A 4A2UA 2OAZA 3RJPA 4UHTA 4S04A 2JZYA 5L3GA 3F8FA 4ON0A 4LK0F 1ZRCA 4EM0B 2GA1A 1K7AA 5DDGA 2P5LC 1YW7A 1D8KA 1TNSA 1NHAA 2W85A 2QVOA 4FX4A 2STTA 1Y0UA 2FE3A 3BWGA 2JT1A 4KYWA 2XUBA 2MLKA 3HRMA 3HYIA 3FHZA 1MDMB 1YW8A 5LGUA 2F5CA 4AVPA 3MWMA 3TOAA 2QENA 2OA4A 2WC2A 4RGSA 5F1RA 4G8XA 4OIPF 4ESFA 4ENJA 2QQBA 3VEPA 2BBYA 5HLHA 2WTEA 5JI6A 3M7GA 1W7PA 2X4HA 4RB2C 3COAC 1KGSA 3IKTA 3TDUC 3HOTA 3K69A 1R1UA 5E1XA 3EYIA 2JPCA 2ZNZA 1LJ9A 3QAHA 3OV8A 1AOYA 5BMZA 3GEZA 2IP2A 1TQIA 1V3FA 3GFJA 4BXUA 2NYXA 2HTSA 4HLYA 3L9FA 2GXBA 5E18F 1U5TC 1SMTA 1IRFA 4IXAA 3CO7C 3MQ0A 3HSEA 1ZG5A 3CO6C 4G9YA 4P55A 4I98B 1F9NA 5DD4A 1O57A 1T0FA 2Y75A 4L18B 2ZFWA 2QBYB 2CO5A 1YTYA 3RIRA 5E8GA 3T8RA 4ZYDA 4OMYA 5FGMA 2O03A 4A5NA 3GF2A 5HS8A 2VBWA 2IPQX 2FBIA 1P4AA 4WX9A 4MEYF 1IW7F 4YFNF 3GW2A 4KMFA 4IHTA 2O0YA 4OIQF 5D4RA 1T2KA 2Y48A 2LSOA 1J59A 2C6YA 3P7NA 2BE5F 2PBIA 4ZYGA 3ZQ7A 1BM9A 2Z5UA 1T39A 3KFWX 2K86A 5LHGA 2O3FA 5FB2A 4I09A 4LD5A 2DO7A 2F5FA 3I64A 5ICFA 2PJPA 1T98A 1XB4A 1W5SA 3F6VA 3RYRA 3GVAA 1XDSA 3F8CA 4MQ9F 4P9UA 2HFHA 2M1BA 2XGXA 3V7SA 5LHHA 3D5LA 2EV0A 5F6FA 1LDJA 3I59B 2JSCA 3ZN1A 2IA1A 2PEXA 3HUGA 2HYGD 3IKVA 4HX7A 4L9NA 1VTNC 3ZMSA 1LB2A 2EK5A 2ESHA 1TW2A 2AS5F 3L09A 2IA2A 1ZRDA 1MZBA 1G3SA 4HF0A 1TBXA 2Z3YA 3HOSA 2TDXA 2A6EF 3TGNA 2V6CA 3REOA 1R22A 2G7UA 3EYYA 3DF8A 2Q8KA 1WKMA 2R7DA 4G7OF 1U78A 1OPCA 1IN6A 4YIFA 5FLXK 2VT2A 1FBQA 3M1EA 3TO7A 1BIBA 3TKYA 1RIOH 4P96A 2P6SA 2GIVA 3FF5A 4D0PA 1F5TA 5LGNA 1OKRA 5K5RA 2OU2A 3HSFA 1AWCA 1YS6A 3QU3A 1U5TB 1CGPA 2QYOA 4PCQA 4BNCA 1XMKA 5FFZA 4K2EA 4NQWA 2BEOA 5D8KB 1HQCA 2ZCWA 4ESBA 2FOKA 4IPAA 1LNWA 2W24A 2DAOA 3M8FA 4KT5C 4LLGF 2XAHA 4ZZDA 3G3ZA 3FWEA 1RUOA 3LAPA 1BOAA 2YPRA 1HW1A 2L54A 2L3DA 2L4MA 2O61A 3KEQA 5ICEA 3P9IA 2YX4A 1JGSA 1FT9A 4WCGA 4QWQA 4BAYA 1GXPA 4LB5A 2DI3A 4ASNA 2FNAA 3ECHA 5E20A 2D45A 2L02A 4EGYA 4IVNA 3I53A 2JTVA 1K78B 2EA2A 4TV7A 3DV8A 1BN5A 3RTRA 3BY6A 3WTVC 2IA0A 3QPHA 1XSVA 4WF2A 2FEZA 1K78A 2W57A 1G3WA 2W84A 3BPVA 3WTYC 3DKWA 1S6LA 2DPUA 3ISPA 2GQQA 5D5UB 1FSHA 2EFOA 2PQ8A 4KN7X 4I01A 4U0YA 5E1ZB 1YLFA 4UVBA 4EM1A 2FMLA 4RB3C 2BYVE 2A5YB 3H3ZA 3HTUA 2E7WA 1B1BA 3V7RA 5H6RA 2FSWA 5CVUA 3K1NA 3CJNA 2LKPA 2EFNA 2M87A 3IL2A 2IJLA 4KIFA 4EJOA 1IZ1A 2XKOA 4G94A 3LSTA 2HR3A 1LQ1A 2YSRA 4KIBA 2DFIA 2QZ8A 3FM5A 5LRRA 4WWCA 4YFKF 4N0BA 3KP4A 2UWMA 5TJJA 3LQRA 2K02A 4XSXF 3JSPA 4AIJA 2GWRA 5FFXA 1J2XA 4DQ2A 1FC3A 3U9GA 2ELHA 1QNTA 4M74A 3C18A 4M9SA 2A07F 2LF7A 2L01A 3KCCA 1CF7A 3E6BA 1OMIA 3B73A 5EEGA 3D0SA 3J7AO 3P9CA 1R36A 1SFEA 4O6JA 1S7AA 3SZTA 4LLLA 4ZZLA 3ML6A 4EJWA 4MTEA 3C7JA 2RV8A 2GA2A 3MCZA 1W7PB 2IVMA 5A2QZ 1P6RA 3SZPA 4AD9A 3TDZC 5ICCA 4NHJA 2O8XA 3F6OA 5AIPA 1HSTA 3CLOA 1UHMA 1FP2A 2V9VA 3MAJA 4DNCA 1H0MA 4HYEA 1STZA 3U2RA 4HX4A 3KE2A 3Q9SA 2XIGA 1I1SA 3KLOA 2DW4A 1BJAA 1MKMA 4HW0A 3FXRA 1FP1D 5CJ9A 2FA5A 3E97A 3KP6A 2ETHA 2EWNA 1U8RA 3N97A 2COMA 5ICGA 1KU7A 2HZTA 5HDGA 2BGCA 2NNYA 2KJBA 1WI9A 3K0LA 3F8MA 4ENNA 2W25A 4HZFA 1YG2A 1ZN2A 2LDUA 2HS5A 2HDCA 4XBFA 3HHGA 5DCFA 1KQ9A 4IRHA 4Z2YA 1L0OC 3FM3A 3MEXA 2X0LA 1ZYRF 1HKTA 1ZARA 2PLYA 2NS0A 5ILUA 3U1DA 2FRHA 1FOKA 3PFIA 2PN6A 1GXQA 1TNTA 5EEHA 1ZG1A 2DPDA 3V8JA 3TOBA 2YU3A 3GWZA 3GXOA 1IF1A 1KYZA 4M6XA 1J75A 1H9GA 2OD5A 5BOXA 4U0VA 1SD5A 1Z91A 2D1HA 1C0WA 1JXSA 4LB6B 2G9WA 4ENKA 5HOOA 4HQEA 2EB7A 2Z9OA 2R7FA 4A0ZA 3JTGA 3IC7A 3R4KA 2OQGA 1XN7A 1MJ9A 3FX3A 5D6EA 2EV5A 5KVRA 4XRFA 1R1TA 2DTRA 1T6SA 3DP7A 3GFMA 4KMUX 1EH8A 5LRSA 2YX7A 2XASA 5CVJA 3ZMZA 3K2ZA 4OU0A 3WTZA 3MZYA 5BPIA 3IWZA 3ECOA 1IAWA 3O3KA 3BZ6A 4BQAA 1KA8A 3DXJF 1EH6A 4XLNF 2DK5A 4HX8A 3I5UA 3QP6A 5FD5A 2ISYA 3HIFA 4OINF 3RKXA 2OQRA 3I59A 5LEJA 1J5YA 2V1DA 3ZPLA 3WU1B 1YW9A 4U7BA 1GHCA 2AXLA 2XV4S 3JTHA 4ETSA 1LDDA 5LLQA 3JAMK 4BYYA 1PP7U 1ZG3A 1I1GA 1K6OA 4I0AA 3DQVC 1G6NA 1QQIA 1IN8A 2KRFA 4I2OA 3E3VA 1IXCA 4GCVA 5HLIA 1LEAA 5H6QA 3KZZA 5IT9Z 3LA2A 5D5WB 1D8JA 5DUKA 3WTXC 3I71A 1HBXG 3VB2A 4I02A 3KP5A 2CSOA 1ZGJA 1KU3A 1YQAA 1E2XA 3S2WA 4EMSA 2ADUA 1KU9A 2EFQA 2GAUA 2M45A 3ABUA 2OBPA 4UVCA 4A0YA 2FXAA 2DU9A 3GLXA 3O6BB 4MEXF 4Q48A 4CGZA 1Z9CA 4HV6A 4H0EA 2CWEA 3WU0A 5D6FA 4KFCA 4MNUA 5BQTA 3FMRA 1USTA 4IHSA 3BDDA 1RNLA 5L3CA 1J7KA 2QUFA 3RI4A 4CICA 1KQ0A 2E1CA 3QRFF 1U3EM 1JE8A 5JHUA 3TQNA 2XVCA 2Q2EA 3P9KA 2IT0A 3W6KB 2XAFA 1W5TA 2MBFA 1DDNA 5LEKA 2NNNA 2OZUA 2QQAA 2M5WA 2VBZA 4OMZA 1HSJA 3HRSA 2VC0A 2FBHA 4Y15A 2H27A 3WG9A 4L0YB 2V1XA 4A6DA 2MH2A 3Q9VA 3LAJA 1XD7A 1DUXC 1I6XA 3WGHA 4RGXA 3KLNA 4XSZF 3C1DA 4M9ZA 3W6JB 2MD5A 3K9TA 5HLGA 5AIQA 1IXSB 3ABTA 1DP7P 3BROA 3QU6A 4FT8A 2UXXA 4KIGA 5CVVA 2JRTA 1LVAA 5E17F 4AIHA 4B09A 2ZJ2A 2MH9A 3JSOA 3CDHA 1SFUA 1WWXA 1S7OA 3KZYA 2B0LA 3R6SA 4OIOF 4CHUA 1G3TA 1FWZA 1ZH5A 2HOEA 2UZKA 2M8EA 2P8TA 2F5DA 3R60A 3HSRA 3DFGA
chains in the Genus database with same CATH superfamily
3NEUA 2HVSA 4ZDOA 4CUGA 3U21A 2B63J 1O7FA 4S05A 3WU2C 2OPTA 2ZBKA 3S14J 1SAUA 2GBYA 3SHFA 3VYSB 2N8GA 2AHQA 2DTZA 3QQAA 2X85A 1YYVA 2NAZA 1FIAA 4MFEA 1E3PA 1ETKA 3I0TA 5DCMB 1BR4A 2VLAA 4KICA 1OCPA 1HW2A 1V55H 2DLLA 2H1LA 3TL4X 1TWHJ 5EG0A 3G73A 3RPUD 2P7VB 2XSDC 2LP0A 3SEQA 3GZ6A 1PUEE 1ZQ3P 3GUDA 2ELJA 2R7WA 4BDYA 2AQFA 5BNGA 1TTYA 5FD6A 5D5VB 5J3LA 2VOOA 4BHCA 2H8WA 3OWTA 4R8HA 3OYJA 2DA4A 3J81Z 1JJ6C 4HSTA 2EV6A 1X58A 4DZPA 2HYFA 5IT9K 1G3YA 5K1YA 9ANTA 4UV8A 2E2HJ 4ENMA 2RNJA 5FLMJ 3LA3A 3GTGJ 3SDGA 1N75A 3F9KA 3GX4X 4AM3A 4AIDA 2JVGA 5JFRA 2LK2A 2CGPA 1MH4A 1SD6A 1HKQA 2H6CA 1DPRA 1ON1A 2HKXA 2Z2SB 4A0XA 3GO5A 1W0UA 4KISA 2JUCA 3H9QA 2K9SA 3K1PA 2X6XA 3BJAA 1RI7A 4ZDLA 1NTCA 2CU7A 5E8IA 3NWTA 5IY5H 1HCRA 1P2FA 2DFFA 2IAIA 3JAMZ 1S7EA 3JRGA 3W2WA 3OIPA 2VONA 2BVLA 1FOYA 1F1ZA 5EZHA 4IOCF 1RPWA 2VJ4A 4XN0A 4YG2F 5J8CA 1Y1WJ 4UVAA 2MC3A 3E6CC 1DP3A 1S8NA 1ONVA 4WXDA 3HKZN 3BG7A 3BR1A 1R58A 3V7CA 1H9TA 2JA6J 3OS0A 3OL4A 5IYBJ 4IRIA 2PMHA 2ZXIA 2QBYA 4I99C 1HF0A 3M9AA 3E7LA 2Y0SN 2EQRA 3N4MA 2BV6A 3PQKA 3GZ5A 3D1NI 2ESNA 1R7JA 3EQLF 4BHBA 1VNDA 1FBUA 1P4XA 3D5RC 3EETA 1R1VA 1TT5B 4V2FA 4Y17A 2JQ7A 2XF5A 4UNOA 3RQ4A 1VQNI 3HXLA 3CUQA 3MZHA 3L2CA 2NS7A 2V79A 1A6IA 1YO5C 1KYWA 4BJ5C 1B4AA 2CW8A 1DGWY 5BPDA 1B9NA 4O3MA 2QWWA 2A6HF 1TQPA 4DYQA 5M5YJ 2XHKA 2JA5J 1LFPA 1ZELA 4AU7A 1QZZA 2HTJA 4QLCU 2DT5A 1Z7UA 2IRFG 2M34A 4RAFA 1ZGWA 2XPWA 2STWA 2R3SA 4XLCA 2HI3A 3KP7A 2JJ7A 4A3GJ 1EH7A 1W5CC 3E1SA 1XMAA 1ODDA 4U87A 3OOPA 1FMVA 1XGMA 4R79A 4Q4ZF 4KNYA 3ZRGA 3DWLE 2LY1A 3BP8A 1FX7A 1U2WA 5J1RA 4DIQA 1FOWA 1S3JA 5E3LA 4IOAF 2K27A 3F8BA 1UHWA 3TW7A 1HLVA 2VOPA 4GDFA 1G4DA 2DBBA 1VQLI 1MJAA 3VFZA 2DT7B 3JRAA 2DT6A 2EH3A 2MLGA 2DK8A 2MA3A 4RGUA 2VXZA 2GLOA 3HKZA 3C3WA 3WTTC 3BG9A 4EJVA 1TWGJ 2EBIA 2P0WA 5IYCJ 1HXDA 2JRMA 2V1NA 2DYSH 4YIRX 2NVUB 3KIOA 3OYNA 3FHNA 1HW5A 1IRGA 2IGNA 1KQ8A 3S8PA 3T1BA 3WTWC 5JR3A 1LE8A 2QA4I 1ZKGA 3I3LA 5F0FA 4XRMA 2XRNA 3K4CA 3H3UA 4L9TA 1TW3A 3B6AA 1EF4A 4RBOA 3U1KA 1Z6RA 4XKWA 4CYDA 1KU2A 2W00A 1QZYA 3DEEA 1BA5A 1LUJB 2L2OA 4DOZA 1B59A 3K6GA 4GFBA 1R5GA 3G4SI 2LF8A 4N9IA 3NARA 2VI6A 5J8FA 1YFHA 2KIQA 3WHBA 3ZMTA 4DGWB 3BR6A 2CW0F 1D3YA 2IS6A 5JVTA 2JVHA 3VOEA 2E5ZA 2FD5A 2MGQA 2TCTA 2RQPA 4GXOA 4LIUA 4P5OA 5CYVA 4OOIA 4A3LJ 1QVUA 4I7HA 1FSEA 4XK4A 2PMUA 1FTZA 4WXHA 1YX5A 3GFIA 3Q0WA 1UCRA 1ITYA 2KL4A 3E5UA 3DPTA 2PMZA 1W7PD 1IGNA 4MIMA 4JX5A 2A69F 2ZB9A 4XQFA 4ESJA 4YIIA 1U0JA 2P6TA 1O3SA 2HPIA 4GYGA 1A04A 4C9YA 4JYKA 3FK7A 3BC8A 3IH4A 2VODA 1Y0NA 2E1NA 4EM2A 2WAQN 3MKYB 2HEOA 1Z7LA 2BVMA 2NVQJ 3QYFA 1S9HA 2G0EA 2GXGA 5FRNA 4MLOA 3LMMA 1KZHA 3P5JA 3QOPA 2A6TA 3BPXA 2EA4A 2K7LA 4MO7A 3SFZA 2R7VA 3Q5FA 4XLEA 1K79A 5DCMA 1B72A 5K5OA 4BY7J 3BOQA 4MHGA 2L4AA 2EFWA 4HDVA 4IO9F 2KZGA 4C3JJ 4ZC3A 4LG0A 5FLVA 2HQRA 4GO1A 3BR3A 4L9JA 3PFYA 5F64A 1IDZA 4IHVA 1I5ZA 2DYRH 2XGEA 4IF4A 1E17A 2Z33A 4BHPA 4YRVA 3J80Z 5LBQA 4XRSG 1JHHA 3CCSI 3R0AA 1MD0A 4Q5SF 2IXSA 3F23A 1JI8A 4BH9A 4Q47A 2HWVA 5D8LB 2K4BA 3IHUA 3L1PA 3BJ6A 5D5XB 3JRHA 3LWFA 3QPLA 1UAAA 4L5IA 2L5QA 1K61A 2FU4A 4EJTA 2CQKA 2WBMA 2M8GX 3O8GA 3RYPA 4PFPA 1DU0A 1FYKA 2OV7A 1MMNA 2L7KA 1B72B 4NBQA 2XKPA 4Y3OA 3IWFA 1R4NB 2KMUA 2RKHA 2I10A 2ZJPF 2ZSIB 3DU6A 5D4SA 3DEUA 2XAQA 5L3FA 4EVIA 1WRJA 1QA6A 2L9RA 3TP0A 2ZXJA 3A0BC 3D5SC 3K70C 1NH3A 1RR7A 1TWCJ 5BS6A 1ON2A 2FX0A 1RUNA 3QOEA 4PGGA 1MGTA 4A3IJ 1Z6TA 2XB5A 3A4CA 2BXYA 1JTXA 4CCMA 3IP4B 4WK8F 1ETXA 1Y6IA 3CUOA 1P7JA 3M8EA 2D2WA 1XX5A 4R1HA 3FXMA 5A2QK 4HF2A 1O3QA 4PGHA 4B43A 3SYTA 5DS9A 2VQLA 3AAFA 2DMTA 2VBXA 4ZYHA 5C4JJ 1EV7A 1L3LA 1HKSA 2OZ6A 3V8KA 2HOTA 1ERDA 3L7WA 3NQOA 4I76A 3DEWA 1QGPA 3S2HJ 3CCRI 1B6AA 3E5XA 1JUSA 1S5LC 4U88A 2CUEA 1Z05A 5B1AH 2L9VA 1QBJA 4RLFA 2J5PA 3RKYA 2UXNA 3FXUA 1SD7A 2LLKA 1IC8A 5B66C 1ORKA 2VQHA 4LMYA 2QGUA 3WODF 1IV6A 1HA8A 4E70A 3HRTA 3L00A 5DEQA 1BI0A 2H6BA 3CUQB 4N4OB 4KITB 3EUAA 4HG2A 4J01A 1MDMA 5B5EC 5DD8A 5ERIA 1IJWC 1BJZA 4RB0A 3VDXA 5HDKA 1YIOA 5FKNA 1TLHB 1MJBA 2ISZA 4ZTJA 1P92A 3S32A 2RQQA 3ERED 2VB6A 3KYDB 5EDNA 3F8NA 1VZ0A 2R5YB 3E6DA 2A68F 2VBYA 1T08B 4GYIA 1MH3A 1E3HA 3OIOA 4OIRF 4CCLA 1LEBA 1V5FA 4UB8C 1VQ5I 5FKOA 5E1WA 2R93J 1OCCH 1D5VA 3OMYA 3PJRA 2WY8Q 3IH3A 5IOYA 5HVQC 1Q1VA 4XLHA 3WTSC 2CUFA 4HDUA 3KEOA 2ZO4A 2PI0A 4CSWA 2WWYA 3SXYA 4II2A 1F4KA 2EFPA 2IBDA 3FISA 2O6GE 3PSFA 3V8LA 4E7JA 1OQYA 1U9NA 4A3EJ 3S1RJ 5DM7F 3IRQA 3T8TA 3S1QJ 2VXDA 4Y13A 1FNNA 2QM3A 1TQMA 2KRCA 2E1MC 5L3EA 1UJ8A 1IUYA 3EDPA 1WQ2A 4AYBA 1P4WA 3T0YA 1W1WE 1IO2A 1F43A 2DA7A 1FTTA 2H94A 3OYAA 2L9NA 2Q0OA 2DMNA 3SDBA 1IRXA 2ZFUA 3VODA 2KJCA 2VKEA 4D5CA 3HJEA 1FBSA 2FNPA 3TO9A 4UV9A 3CMMA 2WADA 4QPOA 3CD6I 4GGGA 3L2WA 2Z99A 2A05A 2QLZA 2DOEA 2J5OA 3S3OA 4QTRA 3Q0UA 3OR1C 3CMEI 2MYSA 5IPAA 4PZJA 3V4GA 1YRNA 1T8IA 2KIFA 2RVCA 3HRUA 4G6TB 4Y7NJ 1RC9A 5HS9A 1IN5A 2VN2A 2XAGA 1WJ5A 4RAYA 4DYCA 4AIKA 1VQPI 2LR8A 2JWTA 2PFBA 4LG0B 1QO0D 2LNBA 4A69C 2LVSA 4FHTA 2HQNA 1FJLA 1Y1VJ 2CS3A 3G6EI 1REPC 3H0GJ 2FBKA 3HEFA 2VPLA 1TC3C 4L0ZB 3I4PA 2CFXA 4FX0A 1RZ4A 1T33A 5K7HA 2CQQA 5GAGJ 2LMDA 2X51A 5KAFC 1R9TJ 2FMYA 4WXCA 3ZOBA 4IQ4A 4BQQA 3S16J 3I54A 1XDUA 5LGTA 2DQLA 5HDNA 4G7ZF 2E1MB 3K1MA 3BR0A 1W36D 4UUVA 1XGSA 2R5YA 2A3SA 1D5YA 3H5RA 1I27A 1T38A 3GYHX 4B1RA 2X1CA 4LLNA 3RZDJ 1PUFB 3LFKA 3CCVI 1JKQC 3IUOA 4M6YA 1WJCA 4A12A 1JKRC 1J9IA 4HA8A 1ULYA 2MW8A 3DPLC 1IXRC 4DJAA 2ZMEB 2E1OA 4ZYEA 1OYYA 1BI1A 3JREA 2HYJA 1OYWA 4YFXF 2B7EA 4XICA 3ZMVA 1N78A 1FY7A 2HQ5A 4IJAA 1FYLA 1XCVA 4B8XA 1FLIA 1A35A 4LK1F 2D1VA 2HKOA 2EINH 3ULQB 2P5VA 1OISA 3BR2A 3J80K 2KDZA 1ZAOA 4HSRA 5FKKA 2H09A 4JBAA 1R5HA 2EZHA 1BC7C 3A1YA 1ZHFA 3WTUC 3HC7A 3CESA 1YJNI 3C2HA 2M3AA 3WHCA 3CLQA 4UXNA 1CQTA 1PDNC 1J0RA 1UB9A 5IT3A 1Z21A 3E5QA 3LSKA 1OCRH 1Q1HA 2LREA 5L3BA 1W36C 2E5NA 3TO6A 1BI2A 1NG7A 3Q3SA 4AWXB 3KETA 2DDBA 3CUQC 3A01A 1GVJA 2HU9A 3F0CA 3E0JB 4CXFA 5GAHJ 2CW7A 4U7DA 1H8AC 3W2VA 2ZMEA 3VYUB 1Z1DA 4CCKA 2VKDA 1D1BA 2FF4A 2VC1A 4F55A 3HTSB 3ABLH 5DYMA 2YR2A 4HNUA 4IL6C 1XCBA 3S1MJ 3BJOA 3OYFA 1OR7A 3WGGA 2JA2A 5GADJ 2P5KA 3HB9A 5IP9J 4BL0B 4A6EA 1X1CA 1SANA 4XKCA 1X3WB 5EGOA 2HPMA 4UB6C 4M9XA 2F5EA 4UUTA 5ILSA 3FXJA 4HLXA 2KDOA 3ROUA 3FXLA 3UNGC 2B9SA 4BQOA 3KP2A 1XTAA 4D9JA 4A5MA 4CZZA 1B9MA 3H36A 4G12A 1O3RA 3GFLA 4A3CJ 1XGNA 4U0WA 3LA7A 1NK3P 4PDKA 2CFOA 2CUJA 3F3XA 4IRGA 4HV5A 3ELKA 4DZJA 2VPRA 3IRRA 3DCFA 3RDIA 4DW6A 1O4XA 4CCJA 2DA3A 4NUBA 1AKHB 3A0HC 5DV5A 4XKVA 4G7HF 1YJ9I 3RZOJ 2Y69H 2HDWA 2PJRA 1XMXA 3DBHB 4E7LA 3BTLA 4RM3A 2ECCA 2K4JA 2L7FP 1SAXA 3CTAA 4L5JA 2VASA 1DPUA 4N9HA 3ZQQA 5FLXZ 2ACJA 5EYRA 2DJNA 5DUIA 5M3FJ 1I3QJ 2R7RA 4HBLA 4QSHA 4EGZA 4A3KJ 3OIQA 3LQQA 2DMQA 2VQGA 1D0ZA 4XLPF 1R00A 2KIMA 5CVIA 4JK1X 3LSJA 4W1UA 4B44A 3V42A 4LFUA 3CF5F 3CCLI 3MFKA 3B02A 1PP8F 4P1WA 1B8IB 1T0FC 4KN4X 3FZVA 5M5XJ 3RKWA 1QPMA 4O5VA 3ZMUA 4LG3A 2DA5A 1ZLJA 2DDAA 2V1UA 1UFMA 2X6OA 3ONQA 1V4RA 2M4GA 2XF6A 1FPQA 4II3A 4RS8A 2Y31A 4ZH4F 5CQEA 2JPBA 4KUMA 2ZNYA 4KDPA 1SMYF 4EEFG 3H9GA 4EJUA 5KK1A 2LBFA 3FMQA 4G6QA 3PO3J 5LHIA 3E6MA 3R61A 5CLSA 1XGOA 3PUBA 1USSA 2JMWA 5HS7A 2ZKZA 3KEYA 3G1OA 1OCZH 4ZJZA 4RDUA 3UR3C 2R7TA 4MQVA 3DBLB 4E7IA 4RB1A 2XAJA 2KT0A 1NG6A 1BIAA 4MTDA 2NRAC 1U5TA 3NRVA 4EATA 1X19A 2CG4A 4CDGA 2W48A 5ILVA 1IG7A 1IN7A 1WFXA 1W4MA 2K85A 2BHZA 4PFOA 4G6DA 1LDKB 2LG4A 3BG6A 4IQJA 4F7ZA 4I0BA 2F2EA 2IW5A 3UKGA 2VT3A 3F72A 2KISA 3PQJA 4RAZA 4BBSJ 3W3CA 3H0DA 4A93J 2BOLA 2WAFA 5J6XA 5K5QA 2M7AA 1PUFA 2MG4A 3BZCA 6PAXA 3KP3A 2RGVA 1XSXA 2GXAA 2GZWA 1BC8C 2P4WA 4RLQA 5M5WJ 3FKJA 2L9SA 5J4YA 2MABA 2RC4A 4HNTA 1ZREA 3ZN0A 1AKHA 3WE3A 5C3EJ 1A5JA 2CYYA 2BHYA 1I6HJ 3I4NJ 3ZP5A 4B47A 3QP5A 2CJJA 4ZTFA 2DQRA 3EUHC 1X4PA 2M30A 3OYLA 3EUKL 4PJMA 3CCQI 3NAUA 1VQMI 1YS7A 2QQ9A 1DU6A 3F21A 3H92A 2ZXHA 4LGWA 3RPUA 3R0JA 5J4VA 2KP6A 2P7CB 2FQ3A 4P9FA 4IHYA 4HAMA 1SD4A 2QCOA 3QPTA 2E7XA 1MBKA 3BLYA 3OYIA 3K70D 4LJZF 4IHXA 1SFXA 2Y2ZA 2GM4A 1BI3A 2W1OA 1VQ6I 3J81K 2VKVA 3MKLA 2NVYJ 3WGIA 2QF7A 4BE2A 1ZLKA 4BE0A 2VE8A 1OYIA 2HZDA 2FJ1A 2M9HA 5KCMA 3ZMDA 5HODA 2KKOA 1IV8A 2H1KA 2PG4A 4IHWA 3MKWB 1K83J 4D7NA 2H8RA 4CO8A 2ME6A 1ZRFA 4HOBA 5ED4A 2W4SA 3OYMA 3K4JA 2KIUA 3JR9A 3OYHA 1T95A 4M72A 2F48A 4M3EA 3F22A 4W97A 1IN4A 1X3UA 3PO2J 4M71A 4AYBN 1ZK8A 4EV0A 3HHHA 4PJNA 4OWRB 1V5EA 4BACA 1U6GA 3O2PE 5TRDA 1QPIA 4AUXA 2G7HA 1N77A 2RDPA 3I58A 4JQFA 1O3TA 4RGRA 1JUMA 3HPGA 2HGCA 3TP3A 2BW3B 2Y0MA 4B3AA 5E3NA 4V19K 4EQQA 3MZ8A 1D1CA 2ID3A 4H4KC 3RPQA 5J40A 3FMSA 2KHMA 5FO5A 4KA4A 2W7NA 2EJRA 3CC4I 2DFEA 1XSDA 2RN7A 5CVRA 1CF7B 1BBYA 1ZGAA 1S29A 3J7YJ 2WV0A 3T5XA 1R5ID 3JW4A 3WE2A 5H20A 3M3YJ 4MGRA 2IS4A 3I9V2 4L9VA 2VE9A 1FYMA 1WSUA 3SQNA 2EZIA 5L3DA 2A61A 3SEZA 2FOWA 3CCEI 3S3NA 5AONA 1Y56A 1P7IA 1O7LA 3FXQA 4HQMA 4M73A 1PJRA 5F0HA 1TL8A 3EUHA 4NB5A 1FZPB 1JHFA 2R5ZA 2WV1A 2XROA 1R23A 1ZR2A 4HF1A 4A2UA 3AG4H 2OAZA 3RJPA 4UHTA 4S04A 3AG2H 2JZYA 1QZEA 4B48A 4M3GA 5L3GA 3F8FA 1RESA 4ON0A 1R6RA 2FUG2 2HXOA 4LK0F 1ZRCA 4EM0B 2GA1A 1K7AA 2IEKA 5DDGA 1ZR4A 3IAM2 2P5LC 1YW7A 5EZGA 1D8KA 3HDDA 3RCOA 1TNSA 1W0TA 3MMYB 1NHAA 2W85A 2QVOA 3GZNB 1PVEA 4IZZA 4FX4A 2STTA 1Y0UA 2Q1ZB 2FE3A 4F92B 2LH9A 3BWGA 2JT1A 1WJAA 4KYWA 4A3BJ 3CC2I 3MN2A 1FMWA 3JCUC 2XUBA 3CCUI 2MLKA 3FKIJ 1X1DA 1GVDA 2E71A 4A3FJ 3HRMA 3HYIA 1RRJA 2WB1N 3FHZA 1MDMB 3HOYJ 1MBEA 2XB0X 3K10A 1YW8A 3M8JA 2LKXA 5LGUA 2DN0A 2F5CA 4AVPA 3GTMJ 4IEJA 4F3QA 3MWMA 3A02A 2HVRA 3TOAA 4CYCB 2QENA 2XGDA 1JUPA 2OA4A 2BXZA 4BS9A 2WC2A 3GLLA 2V9KA 1VQOI 2LYCA 4RGSA 3HL2A 5B3SH 3ZGKA 4G8XA 5F1RA 4OIPF 4ESFA 2I8DA 2KQRA 2QQBA 3VEPA 4ENJA 2BBYA 2VUMJ 1ETYA 3CJTB 3L2UA 2QEXI 5HLHA 4E7KA 2WTEA 5GAEJ 1MBJA 4XIDA 2UV1A 4F91B 2VL8A 5JI6A 1M1EB 4C3IJ 2BY2A 3FXOA 2DA2A 4DBQA 1UMQA 3M7GA 1G8XA 1W7PA 1Y8QB 2X4HA 2EIMH 3CZ6A 3TEDA 4RB2C 1UHSA 3COAC 1KGSA 3IKTA 3TDUC 3HOTA 2M4KA 3K69A 4BJTA 1R1UA 1JT0A 5E1XA 4UUSA 3EYIA 2ZNZA 2JPCA 1LJ9A 1JT6A 1YX3A 3QAHA 2OTLI 3OV8A 1AOYA 5BMZA 2F4IA 3GEZA 1ENHA 2IP2A 1TQIA 2NS8A 1V3FA 3GFJA 4BXUA 2NYXA 2OF7A 5GTIC 2HTSA 4BXFA 1SEUA 4HLYA 3L9FA 2GXBA 3ZQLA 2MC4A 5E18F 3FK6A 1U5TC 1SMTA 2ECBA 1IRFA 4IXAA 3CO7C 3MQ0A 3HSEA 1ZG5A 3CCMI 1QVTA 1R71A 3CO6C 4G9YA 2F4OB 4LIVA 4P55A 3BCBA 5J1UA 2YU9J 3DPUA 4I98B 1F9NA 5DD4A 3S93A 1O57A 4E6KG 1T0FA 4ZDPA 2Y75A 3QPSA 4L18B 3CJRB 2ZFWA 4QIWN 2QBYB 2CO5A 5CQGA 1YTYA 3RIRA 5E8GA 4HEA2 3T8RA 4ZYDA 4OMYA 3GTQJ 3CMYA 3C2GA 1IUFA 5FGMA 2O03A 3PM1A 2Y9ZA 4A5NA 1SFKA 2R7ZJ 3GF2A 4M6VA 4B3XA 2VBWA 4NDLA 1Z77A 5HS8A 4J00A 1GT0C 3AG1H 2IPQX 3A2KA 1MBHA 2FBIA 1P4AA 5FRMA 4WX9A 2LFBA 4MEYF 3PSIA 1IW7F 4YFNF 3GW2A 4XOTA 4KMFA 2O5RA 3PL8A 4IHTA 2O0YA 4OIQF 3BR5A 5D4RA 1T2KA 2Y48A 2WAEA 2LSOA 3EPZA 1MSFC 1J59A 2C6YA 3P7NA 2BE5F 4C2UA 1MW7A 2PBIA 3OY9A 4X6AJ 4ZYGA 3ZQ7A 1BM9A 2Z5UA 3S3MA 1T39A 3KFWX 1J09A 2K86A 4RA2A 2O3FA 2PX9A 4E7SA 5LHGA 4OAYA 2NVTJ 5FB2A 4I09A 4LD5A 1YRNB 2MFZA 2DO7A 2XC7A 1SFOJ 2F5FA 3I64A 2EZKA 5ICFA 3ZQCA 2PJPA 4JX4A 1AA7A 1T98A 1XB4A 1F36A 2EIKH 1W5SA 1AU7A 2FQ4A 3F6VA 1I39A 1XC5A 3VSLA 3JRBA 3LSHA 1BR2A 3RYRA 4RM2A 3GVAA 5LFAA 2CUZA 1RETA 2XGCA 1MBFA 1XDSA 2LY9A 1X1PA 3F8CA 4MQ9F 3ASOH 4P9UA 5C4XJ 3L2RA 2HFHA 3TMOA 3Q0VA 2KRHA 3AL0B 2M1BA 2XGXA 1IRZA 2K9MA 1RKWA 3V7SA 3DLLF 2R7SA 5LHHA 2BZTA 2EV0A 3D5LA 5F6FA 1LDJA 3MKZA 5JLWA 3PUFA 3I59B 2JSCA 3ZN1A 2IA1A 2KFDA 2PEXA 3K4KA 1QU3A 3HUGA 2HYGD 1WI3A 3C2BA 3IKVA 5EGOB 3M07A 4HX7A 1HC8A 1OR7C 3ZQHA 3W6VA 4L9NA 4CCNA 1VTNC 3ZMSA 1LB2A 2EK5A 2ESHA 4F93B 1TW2A 4PJJA 3CCJI 2AS5F 3L09A 2IA2A 1ZRDA 1MZBA 2VQCA 4B4CA 2XRLA 1GLNA 4FCYA 4FTHA 1G3SA 4HF0A 1TBXA 2Z3YA 3DTIA 3HOSA 2OTJI 1ZTRA 4JOMA 2TDXA 2A6EF 3TGNA 5C44J 2V6CA 2QSGX 3REOA 1R22A 2G7UA 4XRSA 3EYYA 3DF8A 4KJZA 2Q8KA 1WKMA 2R4GA 1B8IA 1Z67A 2R7DA 3M1CA 4HNVA 3ZR8X 2M2EA 4ABZA 2R7QA 1U78A 1LPQA 4G7OF 1OPCA 3HOXJ 1IN6A 4YIFA 3VWBA 5FLXK 2VT2A 1FBQA 2PMZN 3M1EA 3TO7A 1S72I 2BY3A 2ZJRF 1BIBA 3TKYA 1PYVA 1RIOH 4P96A 3RQIA 2XSJC 2P6SA 3HG9A 2GIVA 4XLFA 3FF5A 4A3DJ 4D0PA 5DM6F 1DGRM 5K7ZA 1F5TA 2ZC2A 1Z0XA 1WVRA 5LGNA 1OKRA 5K5RA 2OU2A 3W2AA 2RREA 3HSFA 3OOUA 1VFCA 1BW5A 1MIJA 1AWCA 1YS6A 3QU3A 1U5TB 1CGPA 1TP4A 2QYOA 4PCQA 2NXNB 4BNCA 1XMKA 5FFZA 3ZQGA 4K2EA 4NQWA 4FASD 2BEOA 3MD2A 4XONA 5D8KB 4PSXA 3FXKA 4BXXJ 1MMAA 1HQCA 3O8HA 5E3OA 2ZCWA 1POGA 4ESBA 2FOKA 4IPAA 1LNWA 2W24A 3GTLJ 2CV2A 3QWLA 3DU5A 2DAOA 4V2GA 3M8FA 4KT5C 1Y39A 4LLGF 2XAHA 4FE7A 4ZZDA 5KHDA 2KZVA 2CH0A 3G3ZA 1OCTC 2QQ8A 4M3DA 3FWEA 1RUOA 3BQYA 4NQWB 3LAPA 2BY1A 4LOCA 1BOAA 1WZ2A 2YPRA 1HW1A 2L54A 2R7OA 1FEXA 2L3DA 2L4MA 2O61A 3KEQA 2KLOA 3H1CA 2CQ7A 1JTYA 3G2BA 2X9DA 5ICEA 2ZSHB 3P9IA 1OCOH 2YX4A 2ICWG 1JGSA 1FT9A 3DTEA 3H35A 2UUZA 2JUGA 4WCGA 4QWQA 2CQNA 4BAYA 3CJQB 1GXPA 4LB5A 2DI3A 2BW3A 1A6QA 1LVKA 4ASNA 4UY8I 3I55I 1LE8B 5DTDA 4XLAA 2FNAA 2Z16A 3ECHA 5E20A 2D45A 2L02A 4EGYA 5K7FA 2COBA 4L5EA 4IVNA 1QHHD 2DODA 3I53A 4A3JJ 2JTVA 4J19A 3SZGA 1K78B 2EA2A 1SVLA 1WPKA 4XL9A 1I50J 3LSMA 4TV7A 2GOXB 3DV8A 1BN5A 2BY0A 3RTRA 3HM5A 5FROA 3BY6A 3WTVC 2IA0A 3QPHA 1H88C 1XSVA 4WF2A 4M3FA 1U9OA 5FKMA 1H89C 3ZQIA 2M7BA 1JKOC 4BU2A 2FEZA 4X0GA 3J7ZI 1K78A 2W57A 1ETVA 1G3WA 2W84A 2WB1A 5M3MJ 1WJDA 2K9QA 3DTKA 4YELA 3BPVA 1TT0A 2E36A 5JLXA 3WTYC 3CDIA 3DKWA 1S6LA 2DPUA 3ISPA 2E35A 2GQQA 5D5UB 1FSHA 2EFOA 3K4BA 2PQ8A 3GMEA 4KN7X 3BTIA 4I01A 4U0YA 5E1ZB 1YLFA 2JA7J 3PIPF 1ETWA 4UVBA 2E2JJ 4EM1A 2FMLA 4RB3C 1SVMA 1OJLA 2A5YB 2BYVE 3PIOF 2P81A 3H3ZA 3HTUA 1YJWI 2E7WA 1B1BA 3V7RA 3OYDA 3HBLA 2NOGA 5H6RA 2V9PA 2FSWA 5CVUA 3AKZA 3K1NA 3S17J 2IS2A 3LSIA 3CJNA 1APLC 2LKPA 3OYKA 2EFNA 2M87A 3H5AA 3IL2A 2IJLA 4KIFA 3DKXA 1TWFJ 4EJOA 4X1EA 1IZ1A 2XKOA 4G94A 3GTOJ 3HOWJ 1EJ9A 2WAQA 5KNLA 3LSTA 2V26A 3JRIA 2LC2A 2HR3A 1LQ1A 2HXIA 3QODA 2R92J 1R4MB 2YSRA 1E0EA 4KIBA 2AXTC 2DFIA 2QZ8A 3FM5A 5LRRA 2X6YA 1JKPC 2D5VA 3ERMA 4WWCA 1TZLA 4YFKF 1P9QC 4CH7A 1YIJI 2M0CA 4N0BA 2DA6A 3KP4A 1YITI 1VQ8I 5TJJA 2UWMA 3LQRA 2K02A 4XSXF 3JSPA 3PNYA 1MMSA 4CYCA 3IAS2 4AIJA 2GIZA 2GWRA 5FFXA 1J2XA 3K4NA 4DQ2A 3SFIA 4AVZA 2ID6A 3S2DJ 3ZQFA 1FC3A 3U9GA 3LOCA 2ELHA 1QNTA 4M74A 4RAGA 3FIWA 3C18A 4M9SA 2AO9A 2A07F 1LFBA 4BGDA 4XMYA 2XF7A 2LF7A 2L7ZA 2PJRB 1T56A 2L01A 3KCCA 3RKQA 1CF7A 3E6BA 5EEAA 1OMIA 3HOUJ 3B73A 5EEGA 3K4MA 3D0SA 3IV5A 3J7AO 3OS2A 3P9CA 4IKFA 1R36A 2CQXA 4UUSB 1SFEA 4O6JA 1S7AA 3SZTA 5HNHA 2YS9A 2NOJB 1UELB 2MSYA 1YOVB 4LLLA 3J7AY 4ZZLA 3GTPJ 3OS1A 3ML6A 3BCAA 4EJWA 4C3HJ 5CKTA 4MTEA 3OYCA 3C7JA 2ELKA 3OYGA 2RV8A 5HNFA 2GA2A 3TBIA 3MCZA 1EKEA 1SVOA 3JRDA 1W7PB 5FJ8J 3DLAA 1MNMC 2IVMA 5A2QZ 3GTKJ 1P6RA 2K9NA 2R7UA 2TRTA 3SZPA 2E19A 5TGTA 4AD9A 3TDZC 2F6CA 2HDDA 5ICCA 2E34A 2K5CA 4FE4A 4IX7A 4NHJA 2O8XA 3F6OA 4CZCA 5AIPA 1HSTA 2EIJH 3CLOA 3B6CA 4BY1J 1UHMA 5F04A 1FP2A 2V9VA 4D7MA 3MAJA 4DNCA 1H0MA 1UZCA 4HYEA 1STZA 3ESWB 3U2RA 1MMDA 1Z3YA 2Y0SA 4HX4A 3KE2A 4CCOA 1MMGA 2V4JC 3G1LA 3Q9SA 2XIGA 1UG0A 2MD0A 2QKMB 3PNTA 1I1SA 2IGOA 2DOAA 3KLOA 2HOAA 3BG5A 2DW4A 1BJAA 1MKMA 4HW0A 3SJMA 3LNQA 3FXRA 2GOMA 1FP1D 3L2QA 5CJ9A 2FA5A 3KPHA 4DYRA 3E97A 2DXIA 3KP6A 2ETHA 1I3AA 2EWNA 1U8RA 3N97A 3BG3A 2A5WA 4PK4A 2COMA 3G1MA 3K2AA 3KZIC 4BEHB 3HOVJ 1LKXA 5ICGA 1KU7A 2HZTA 5HDGA 4BUPA 3I56I 2BGCA 2NNYA 3WG7H 2VIXA 2X48A 2KJBA 4PJ0C 1WH7A 1WI9A 3K0LA 3F8MA 4ENNA 2LY2A 2W25A 3BZKA 1G59A 4HZFA 3OL3A 1YG2A 4PSWA 2L7MP 1ZN2A 2LDUA 3VYRB 2HS5A 2CV1A 2HDCA 5LD2C 4XBFA 2R0QC 3HHGA 5DCFA 1BR1A 2XAUA 1KQ9A 4IRHA 4Z2YA 1L0OC 3FM3A 2XPVA 3K7AJ 3MEXA 3M4OJ 2X0LA 1YI2I 1ZYRF 1HKTA 3GBGA 1ZARA 2PLYA 3I4MJ 2NS0A 5ILUA 2JA8J 3ABMH 3U1DA 2QKLB 2LKSA 3A01B 2FRHA 2ZXWH 5TISC 1VQ4I 1FOKA 2DOFA 3PFIA 2PN6A 1GXQA 4BEHA 1TNTA 5EEHA 3HUGB 1ZG1A 4XOPA 1V5GA 3V8JA 2DPDA 3TOBA 2YU3A 3GWZA 3GXOA 1IF1A 1KYZA 4M6XA 4ANJA 5B1BH 5CPRB 1J75A 3ZCOA 1H9GA 2OD5A 5BOXA 4U0VA 1SD5A 3LSRA 1Z91A 2D1HA 1C0WA 1JXSA 4LB6B 1K4TA 2G9WA 4ZYAA 2LTPA 2M0MA 2CRGA 3AFHA 4ENKA 3AG3H 5HOOA 3GTJJ 3VSKA 4HQEA 3LSGA 1V54H 2EB7A 3HZJA 1YHQI 2Z9OA 2R7FA 2HVQA 3TW6A 1MNEA 2VJ5A 1BOBA 5EJCA 2DFHA 4A0ZA 3JTGA 3IC7A 3R4KA 1UG2A 2OQGA 4YEJA 1XN7A 1MJ9A 2K9LA 3FX3A 5D6EA 2EV5A 2Y9YA 5KVRA 4XRFA 5IP7J 1R1TA 2HNHA 2CV0A 1X4OA 1WCMJ 2DTRA 4XM3A 1T6SA 2F4MB 3DP7A 3GFMA 3H5NA 2XDVA 1A36A 2EILH 4KMUX 4PJLA 2LD5A 2R7XA 1EH8A 1YE9A 5LRSA 1Y8RB 3OSFA 1FIPA 2YX7A 2XASA 5CVJA 3ZMZA 5GPCA 1WJFA 2CMPA 3K2ZA 4OU0A 3AL0C 1G2HA 2OJED 3A03A 3WTZA 3MZYA 5BPIA 3IWZA 3ECOA 1IAWA 3O3KA 3BZ6A 2JK3A 1K4SA 1X2MA 3QYBA 4BQAA 1KA8A 4HRIA 1FOXA 1VI0A 2Z1DA 4NNJA 3DXJF 5EG0B 2WY7Q 4FQGA 1EH6A 3G71I 4XLNF 2DK5A 3S15J 4HX8A 3I5UA 3QP6A 5FD5A 2DA1A 2ISYA 4PUSA 1OFCX 3HIFA 1GV2A 4OINF 3RKXA 2F5VA 2V7FA 1D0XA 2OQRA 1U8BA 3I59A 5LEJA 1J5YA 1GV5A 1IDYA 5IYDJ 1HOMA 3KX2A 2V1DA 4CA0A 3OSGA 1ETOA 3ZPLA 3DBRB 3FBIB 3WU1B 1YW9A 3CQZJ 3HOZJ 3KYCB 4U7BA 3LSPA 4ITVA 1GHCA 3KYLA 2OCCH 2AXLA 2XV4S 3JTHA 1QRYA 2VJIA 4ETSA 5EF6A 1LDDA 1QHGA 5LLQA 3JAMK 4BYYA 1X1BA 5HLTA 1VQ7I 1WGXA 1PP7U 1WJEA 1KONA 4JX6A 1ZG3A 1I1GA 2EZLA 1EA3A 1X1AA 3PNVA 1Z3XA 4I0AA 2HQAA 3DQVC 1K6OA 2R5ZB 1G6NA 5E3MA 3BQZA 3BTCA 4LITA 2LBFB 4FETA 1BW6A 1K6YA 4E7ZA 1QQIA 2QSHX 3CC7I 1IN8A 2KRFA 3VYTB 4I2OA 1WJBA 4E7HA 3E3VA 1IXCA 4GCVA 5HLIA 1LEAA 1JJ8C 5H6QA 3KZZA 1XG1A 2VJJA 5F1JA 5IT9Z 3LA2A 2DCEA 3GCMA 1R49A 5D5WB 2O9LA 3H3VK 4JP0A 5DUKA 1D8JA 4C2MJ 3MVPA 3K4LA 4XKBA 5GP9A 4QPQA 3WTXC 2DJIA 2X1DA 3I71A 1LFUP 1HBXG 3BTJA 3VB2A 4I02A 3KP5A 2CSOA 2X1EA 1ZGJA 2DMUA 3H9JA 5F0CA 3VPRA 1KU3A 1YQAA 2VKHA 1E2XA 3S2WA 3CF2A 4BE1A 4EMSA 2IS1A 2ADUA 1KU9A 3HGYA 4F52A 2EFQA 3ABKH 2LRDA 3X2QH 2GAUA 5JVGF 3BT9A 2YUSA 2M45A 3ABUA 2JSPA 2OBPA 4UVCA 4A0YA 5J47A 2DU9A 1WH5A 2FXAA 3GLXA 3O6BB 4BQNA 4MEXF 4Q48A 4CGZA 3CP2A 2ZMEC 1Z9CA 4HV6A 1GDTA 4S0HB 4BDZA 3CP8A 4H0EA 3ZXSA 4XR6A 2CWEA 3ASNH 2Y30A 3JRFA 3WU0A 1DQUA 5D6FA 4KFCA 4NC6A 2O8KA 2K3PA 4MNUA 3FBNB 4A3MJ 1RKTA 5BQTA 4NC7A 4RMNA 2KPMA 3FDYA 1MBGA 5H2FC 3FMRA 1TWAJ 2DMPA 1USTA 4IHSA 4Y52J 3BDDA 1RNLA 5L3CA 1J7KA 1OLTA 2QUFA 2WA0A 4BJ6C 3S1NJ 1XPXA 1D1AA 3RI4A 5J1YA 4BKXA 4KT6A 3JRCA 3NWSA 1SC7A 3CDLA 4FISA 4Y33A 3N05A 4CICA 4XORA 1KQ0A 2E1CA 3QRFF 1U3EM 1JE8A 5JHUA 4GRIA 4OAZA 4MFDA 3TQNA 2XVCA 2Q2EA 3P9KA 2HOSA 2IT0A 3W6KB 5FKLA 2XAFA 1W5TA 2MBFA 1DDNA 5LEKA 3CMAI 2NNNA 3LL7A 2XPUA 2OZUA 2QQAA 2M5WA 4D5FA 2VBZA 1ETQA 1VQ9I 2ME0A 4OMZA 1HSJA 3HRSA 2OCEA 1HDDC 1RR8C 1JGGA 2VC0A 4BBRJ 5KAIC 1XS9A 2FBHA 2AQEA 5F08A 2E2IJ 3DKYA 4Y15A 1MNDA 2H27A 3HGGA 3WG9A 3L2VA 1E3OC 4L0YB 2V1XA 4A6DA 1N25A 2MH2A 2IGMA 3Q9VA 5JHFA 3LAJA 4E4HA 1XD7A 4I6ZA 1GUUA 2W82A 1DUXC 1I6XA 1WHUA 3WGHA 4RGXA 3HPHA 3KLNA 4XSZF 2Q2EB 3C1DA 2ZJQF 4M9ZA 2E60A 3RSNA 3W6JB 2MD5A 4C2TA 3K9TA 5HLGA 5GTHC 4DBRA 1AHDP 5IOZA 2OC6A 2EPFA 4M3BA 5AIQA 2I5UA 4D1QA 1IXSB 2RAEA 3OR2C 3OYBA 3ABTA 4XN3A 1DP7P 3BROA 1A31A 1X2NA 3LFUA 3QU6A 2O7OA 4FT8A 2QSFX 3CCYA 2UXXA 4KIGA 5CVVA 1BL0A 2JRTA 1LVAA 4XNFA 1MSEC 5E17F 1X3ZB 2JN6A 4AIHA 4B09A 2L0KA 2ZJ2A 2MH9A 3QYEA 4Y4RA 3JSOA 3CDHA 1SFUA 2V6EA 1WWXA 2X6WA 1S7OA 2K40A 2B0LA 3KZYA 3R6SA 4AC0A 4OIOF 1VF9A 4CHUA 4N4NB 1ACIA 4HPQA 1G3TA 1FWZA 3OYEA 1VQKI 2OUMA 1ZH5A 2HOEA 2LOOA 3IH2A 2M8EA 5F27A 2UZKA 2P8TA 1HDPA 2F5DA 3R60A 3HSRA 5IP6A 2K3FA 3DFGA 2IGKA 5GPAA 4Z6YA 4NC8A 4C30A 2RNGA 1D0YA 5E79C 1NK2P 2NVXJ
chains in the Genus database with same CATH topology
3NEUA 1O7FA 4S05A 2ZBKA 3SHFA 1YYVA 2NAZA 3I0TA 5DCMB 4KICA 1HW2A 2DLLA 3G73A 2P7VB 3GZ6A 1PUEE 3GUDA 1TTYA 5FD6A 5D5VB 2VOOA 4BHCA 4R8HA 3J81Z 2EV6A 2HYFA 5IT9K 1G3YA 5K1YA 4UV8A 4ENMA 2RNJA 3LA3A 3GX4X 5JFRA 2CGPA 1SD6A 1HKQA 2H6CA 1DPRA 1ON1A 2HKXA 4A0XA 3GO5A 3K1PA 3BJAA 1RI7A 5E8IA 1P2FA 3JAMZ 2VONA 1F1ZA 4YG2F 5J8CA 4UVAA 2MC3A 3E6CC 1S8NA 1ONVA 4WXDA 1R58A 3V7CA 1H9TA 4IRIA 2PMHA 2QBYA 3M9AA 3N4MA 2BV6A 3PQKA 3GZ5A 2ESNA 1R7JA 3EQLF 4BHBA 1FBUA 1P4XA 4Y17A 3EETA 1R1VA 4UNOA 3CUQA 3MZHA 3L2CA 2V79A 1YO5C 1KYWA 1B4AA 5BPDA 1B9NA 4O3MA 2QWWA 2A6HF 1TQPA 2XHKA 1QZZA 2HTJA 4QLCU 2DT5A 1Z7UA 2IRFG 2STWA 2R3SA 3KP7A 1EH7A 1XMAA 1ODDA 3OOPA 1XGMA 4R79A 4Q4ZF 4KNYA 3BP8A 1FX7A 1U2WA 1S3JA 2K27A 3F8BA 1UHWA 2VOPA 1G4DA 2DBBA 1MJAA 3VFZA 2MLGA 2DK8A 2MA3A 4RGUA 2VXZA 3C3WA 3WTTC 4EJVA 1HXDA 1HW5A 1IRGA 1KQ8A 3T1BA 3WTWC 5JR3A 2XRNA 3H3UA 4L9TA 1TW3A 1Z6RA 4CYDA 1KU2A 1QZYA 1B59A 1R5GA 2LF8A 4N9IA 5J8FA 1YFHA 3ZMTA 2CW0F 1D3YA 5JVTA 3VOEA 4GXOA 2RQPA 4P5OA 5CYVA 4OOIA 4I7HA 1FSEA 2PMUA 4WXHA 3GFIA 1UCRA 3DPTA 3E5UA 1W7PD 2A69F 4ESJA 4YIIA 1O3SA 2P6TA 4GYGA 1A04A 2VODA 2E1NA 4EM2A 2HEOA 2GXGA 3QOPA 3BPXA 2EA4A 2K7LA 3SFZA 3Q5FA 1K79A 5DCMA 5K5OA 3BOQA 4MHGA 2L4AA 2EFWA 4HDVA 4LG0A 2HQRA 4GO1A 4L9JA 5F64A 1I5ZA 4IF4A 1E17A 2Z33A 4BHPA 3J80Z 5LBQA 1JHHA 3R0AA 1MD0A 4Q5SF 3F23A 4BH9A 4Q47A 2HWVA 5D8LB 2K4BA 3IHUA 3BJ6A 5D5XB 3LWFA 4L5IA 2FU4A 4EJTA 2CQKA 3RYPA 1FYKA 2XKPA 3IWFA 2RKHA 5D4SA 3DEUA 2XAQA 5L3FA 4EVIA 1WRJA 2ZXJA 5BS6A 1ON2A 1RUNA 4PGGA 1MGTA 1Z6TA 4WK8F 3CUOA 4R1HA 3M8EA 2D2WA 5A2QK 4HF2A 1O3QA 4PGHA 3AAFA 2VBXA 4ZYHA 1EV7A 1L3LA 1HKSA 2OZ6A 3V8KA 3L7WA 3NQOA 1QGPA 1B6AA 3E5XA 4U88A 1Z05A 1QBJA 2J5PA 3RKYA 2UXNA 3FXUA 1SD7A 4LMYA 3WODF 4E70A 3HRTA 3L00A 5DEQA 1BI0A 2H6BA 3CUQB 1MDMA 5DD8A 5ERIA 4RB0A 5HDKA 1YIOA 1TLHB 1MJBA 2ISZA 1P92A 3ERED 3F8NA 3E6DA 2A68F 2VBYA 4GYIA 4OIRF 1LEBA 5E1WA 1D5VA 5HVQC 3WTSC 4HDUA 3KEOA 2ZO4A 2PI0A 2WWYA 3SXYA 1F4KA 2EFPA 2O6GE 3V8LA 3IRQA 3T8TA 4Y13A 1FNNA 2QM3A 1TQMA 5L3EA 1IUYA 3EDPA 1WQ2A 1P4WA 3T0YA 2H94A 2Q0OA 3VODA 2KJCA 1FBSA 2FNPA 3TO9A 4UV9A 4GGGA 2Z99A 2QLZA 2J5OA 4PZJA 3V4GA 2KIFA 2RVCA 3HRUA 5HS9A 1IN5A 2VN2A 2XAGA 4RAYA 4AIKA 2PFBA 4LG0B 1QO0D 2LNBA 4FHTA 2HQNA 1REPC 2FBKA 4L0ZB 3I4PA 2CFXA 4FX0A 1RZ4A 2FMYA 4WXCA 3I54A 1XDUA 5LGTA 2DQLA 5HDNA 4G7ZF 3K1MA 4UUVA 1XGSA 2A3SA 1I27A 1T38A 3GYHX 4LLNA 3LFKA 4M6YA 4A12A 1J9IA 4HA8A 1ULYA 3DPLC 1IXRC 2ZMEB 4ZYEA 1OYYA 1BI1A 1OYWA 4YFXF 3ZMVA 1FY7A 4IJAA 1FYLA 1XCVA 4B8XA 1FLIA 4LK1F 2D1VA 2HKOA 3ULQB 2P5VA 3J80K 1ZAOA 2H09A 4JBAA 1R5HA 1BC7C 1ZHFA 3WTUC 4UXNA 1PDNC 1J0RA 1UB9A 5IT3A 3E5QA 1Q1HA 5L3BA 3TO6A 1BI2A 4AWXB 3KETA 3CUQC 1GVJA 4CXFA 4U7DA 2ZMEA 1Z1DA 2FF4A 2VC1A 3HTSB 5DYMA 2YR2A 1XCBA 3BJOA 1OR7A 3WGGA 2P5KA 4A6EA 5ILSA 4M9XA 2F5EA 4HLXA 3ROUA 4CZZA 3KP2A 4A5MA 1B9MA 1O3RA 3GFLA 1XGNA 4U0WA 3LA7A 4PDKA 3F3XA 4IRGA 4HV5A 3ELKA 3IRRA 3RDIA 5DV5A 4G7HF 2K4JA 1SAXA 3CTAA 4L5JA 1DPUA 4N9HA 5FLXZ 2ACJA 5DUIA 4HBLA 4EGZA 3LQQA 4XLPF 1R00A 2KIMA 5CVIA 4JK1X 4LFUA 3MFKA 3B02A 1PP8F 4KN4X 3FZVA 3RKWA 1QPMA 4O5VA 3ZMUA 1ZLJA 2V1UA 1UFMA 1V4RA 1FPQA 4RS8A 4ZH4F 2JPBA 4KUMA 2ZNYA 4KDPA 1SMYF 4EJUA 5KK1A 3FMQA 4G6QA 5LHIA 3E6MA 3R61A 5CLSA 1XGOA 5HS7A 1USSA 2ZKZA 4MQVA 4RB1A 2XAJA 1BIAA 4MTDA 2NRAC 1U5TA 3NRVA 5ILVA 2CG4A 4CDGA 1IN7A 1W4MA 4G6DA 1LDKB 4F7ZA 4I0BA 2F2EA 2IW5A 2VT3A 3F72A 4RAZA 3PQJA 5J6XA 5K5QA 6PAXA 3KP3A 2RGVA 1XSXA 2GZWA 1BC8C 2P4WA 2RC4A 1ZREA 3ZN0A 3WE3A 2CYYA 3ZP5A 3QP5A 2DQRA 2M30A 1YS7A 2QQ9A 3F21A 3H92A 4LGWA 3RPUA 3R0JA 2P7CB 2FQ3A 4P9FA 4HAMA 1SD4A 3QPTA 2E7XA 4LJZF 1SFXA 1BI3A 3J81K 3WGIA 1ZLKA 2VE8A 1OYIA 3ZMDA 2KKOA 2PG4A 4CO8A 1ZRFA 4HOBA 5ED4A 2KIUA 4M72A 3F22A 1IN4A 1X3UA 4M71A 4EV0A 3HHHA 1U6GA 3O2PE 5TRDA 2G7HA 2RDPA 3I58A 4JQFA 1O3TA 4RGRA 2HGCA 2Y0MA 4EQQA 3RPQA 3FMSA 5FO5A 4KA4A 2EJRA 1XSDA 2RN7A 5CVRA 1CF7B 1BBYA 1ZGAA 1S29A 2WV0A 3T5XA 3JW4A 3WE2A 5H20A 4MGRA 4L9VA 2VE9A 1FYMA 1WSUA 3SQNA 5L3DA 2A61A 5AONA 3FXQA 1O7LA 4HQMA 4M73A 3EUHA 4NB5A 1FZPB 1JHFA 2XROA 1R23A 4HF1A 4A2UA 2OAZA 3RJPA 4UHTA 4S04A 2JZYA 5L3GA 3F8FA 4ON0A 4LK0F 1ZRCA 4EM0B 2GA1A 1K7AA 5DDGA 2P5LC 1YW7A 1D8KA 1TNSA 1NHAA 2W85A 2QVOA 4FX4A 2STTA 1Y0UA 2FE3A 3BWGA 2JT1A 4KYWA 2XUBA 2MLKA 3HRMA 3HYIA 3FHZA 1MDMB 1YW8A 5LGUA 2F5CA 4AVPA 3MWMA 3TOAA 2QENA 2OA4A 2WC2A 4RGSA 5F1RA 4G8XA 4OIPF 4ESFA 4ENJA 2QQBA 3VEPA 2BBYA 5HLHA 2WTEA 5JI6A 3M7GA 1W7PA 2X4HA 4RB2C 3COAC 1KGSA 3IKTA 3TDUC 3HOTA 3K69A 1R1UA 5E1XA 3EYIA 2JPCA 2ZNZA 1LJ9A 3QAHA 3OV8A 1AOYA 5BMZA 3GEZA 2IP2A 1TQIA 1V3FA 3GFJA 4BXUA 2NYXA 2HTSA 4HLYA 3L9FA 2GXBA 5E18F 1U5TC 1SMTA 1IRFA 4IXAA 3CO7C 3MQ0A 3HSEA 1ZG5A 3CO6C 4G9YA 4P55A 4I98B 1F9NA 5DD4A 1O57A 1T0FA 2Y75A 4L18B 2ZFWA 2QBYB 2CO5A 1YTYA 3RIRA 5E8GA 3T8RA 4ZYDA 4OMYA 5FGMA 2O03A 4A5NA 3GF2A 5HS8A 2VBWA 2IPQX 2FBIA 1P4AA 4WX9A 4MEYF 1IW7F 4YFNF 3GW2A 4KMFA 4IHTA 2O0YA 4OIQF 5D4RA 1T2KA 2Y48A 2LSOA 1J59A 2C6YA 3P7NA 2BE5F 2PBIA 4ZYGA 3ZQ7A 1BM9A 2Z5UA 1T39A 3KFWX 2K86A 5LHGA 2O3FA 5FB2A 4I09A 4LD5A 2DO7A 2F5FA 3I64A 5ICFA 2PJPA 1T98A 1XB4A 1W5SA 3F6VA 3RYRA 3GVAA 1XDSA 3F8CA 4MQ9F 4P9UA 2HFHA 2M1BA 2XGXA 3V7SA 5LHHA 3D5LA 2EV0A 5F6FA 1LDJA 3I59B 2JSCA 3ZN1A 2IA1A 2PEXA 3HUGA 2HYGD 3IKVA 4HX7A 4L9NA 1VTNC 3ZMSA 1LB2A 2EK5A 2ESHA 1TW2A 2AS5F 3L09A 2IA2A 1ZRDA 1MZBA 1G3SA 4HF0A 1TBXA 2Z3YA 3HOSA 2TDXA 2A6EF 3TGNA 2V6CA 3REOA 1R22A 2G7UA 3EYYA 3DF8A 2Q8KA 1WKMA 2R7DA 4G7OF 1U78A 1OPCA 1IN6A 4YIFA 5FLXK 2VT2A 1FBQA 3M1EA 3TO7A 1BIBA 3TKYA 1RIOH 4P96A 2P6SA 2GIVA 3FF5A 4D0PA 1F5TA 5LGNA 1OKRA 5K5RA 2OU2A 3HSFA 1AWCA 1YS6A 3QU3A 1U5TB 1CGPA 2QYOA 4PCQA 4BNCA 1XMKA 5FFZA 4K2EA 4NQWA 2BEOA 5D8KB 1HQCA 2ZCWA 4ESBA 2FOKA 4IPAA 1LNWA 2W24A 2DAOA 3M8FA 4KT5C 4LLGF 2XAHA 4ZZDA 3G3ZA 3FWEA 1RUOA 3LAPA 1BOAA 2YPRA 1HW1A 2L54A 2L3DA 2L4MA 2O61A 3KEQA 5ICEA 3P9IA 2YX4A 1JGSA 1FT9A 4WCGA 4QWQA 4BAYA 1GXPA 4LB5A 2DI3A 4ASNA 2FNAA 3ECHA 5E20A 2D45A 2L02A 4EGYA 4IVNA 3I53A 2JTVA 1K78B 2EA2A 4TV7A 3DV8A 1BN5A 3RTRA 3BY6A 3WTVC 2IA0A 3QPHA 1XSVA 4WF2A 2FEZA 1K78A 2W57A 1G3WA 2W84A 3BPVA 3WTYC 3DKWA 1S6LA 2DPUA 3ISPA 2GQQA 5D5UB 1FSHA 2EFOA 2PQ8A 4KN7X 4I01A 4U0YA 5E1ZB 1YLFA 4UVBA 4EM1A 2FMLA 4RB3C 2BYVE 2A5YB 3H3ZA 3HTUA 2E7WA 1B1BA 3V7RA 5H6RA 2FSWA 5CVUA 3K1NA 3CJNA 2LKPA 2EFNA 2M87A 3IL2A 2IJLA 4KIFA 4EJOA 1IZ1A 2XKOA 4G94A 3LSTA 2HR3A 1LQ1A 2YSRA 4KIBA 2DFIA 2QZ8A 3FM5A 5LRRA 4WWCA 4YFKF 4N0BA 3KP4A 2UWMA 5TJJA 3LQRA 2K02A 4XSXF 3JSPA 4AIJA 2GWRA 5FFXA 1J2XA 4DQ2A 1FC3A 3U9GA 2ELHA 1QNTA 4M74A 3C18A 4M9SA 2A07F 2LF7A 2L01A 3KCCA 1CF7A 3E6BA 1OMIA 3B73A 5EEGA 3D0SA 3J7AO 3P9CA 1R36A 1SFEA 4O6JA 1S7AA 3SZTA 4LLLA 4ZZLA 3ML6A 4EJWA 4MTEA 3C7JA 2RV8A 2GA2A 3MCZA 1W7PB 2IVMA 5A2QZ 1P6RA 3SZPA 4AD9A 3TDZC 5ICCA 4NHJA 2O8XA 3F6OA 5AIPA 1HSTA 3CLOA 1UHMA 1FP2A 2V9VA 3MAJA 4DNCA 1H0MA 4HYEA 1STZA 3U2RA 4HX4A 3KE2A 3Q9SA 2XIGA 1I1SA 3KLOA 2DW4A 1BJAA 1MKMA 4HW0A 3FXRA 1FP1D 5CJ9A 2FA5A 3E97A 3KP6A 2ETHA 2EWNA 1U8RA 3N97A 2COMA 5ICGA 1KU7A 2HZTA 5HDGA 2BGCA 2NNYA 2KJBA 1WI9A 3K0LA 3F8MA 4ENNA 2W25A 4HZFA 1YG2A 1ZN2A 2LDUA 2HS5A 2HDCA 4XBFA 3HHGA 5DCFA 1KQ9A 4IRHA 4Z2YA 1L0OC 3FM3A 3MEXA 2X0LA 1ZYRF 1HKTA 1ZARA 2PLYA 2NS0A 5ILUA 3U1DA 2FRHA 1FOKA 3PFIA 2PN6A 1GXQA 1TNTA 5EEHA 1ZG1A 2DPDA 3V8JA 3TOBA 2YU3A 3GWZA 3GXOA 1IF1A 1KYZA 4M6XA 1J75A 1H9GA 2OD5A 5BOXA 4U0VA 1SD5A 1Z91A 2D1HA 1C0WA 1JXSA 4LB6B 2G9WA 4ENKA 5HOOA 4HQEA 2EB7A 2Z9OA 2R7FA 4A0ZA 3JTGA 3IC7A 3R4KA 2OQGA 1XN7A 1MJ9A 3FX3A 5D6EA 2EV5A 5KVRA 4XRFA 1R1TA 2DTRA 1T6SA 3DP7A 3GFMA 4KMUX 1EH8A 5LRSA 2YX7A 2XASA 5CVJA 3ZMZA 3K2ZA 4OU0A 3WTZA 3MZYA 5BPIA 3IWZA 3ECOA 1IAWA 3O3KA 3BZ6A 4BQAA 1KA8A 3DXJF 1EH6A 4XLNF 2DK5A 4HX8A 3I5UA 3QP6A 5FD5A 2ISYA 3HIFA 4OINF 3RKXA 2OQRA 3I59A 5LEJA 1J5YA 2V1DA 3ZPLA 3WU1B 1YW9A 4U7BA 1GHCA 2AXLA 2XV4S 3JTHA 4ETSA 1LDDA 5LLQA 3JAMK 4BYYA 1PP7U 1ZG3A 1I1GA 1K6OA 4I0AA 3DQVC 1G6NA 1QQIA 1IN8A 2KRFA 4I2OA 3E3VA 1IXCA 4GCVA 5HLIA 1LEAA 5H6QA 3KZZA 5IT9Z 3LA2A 5D5WB 1D8JA 5DUKA 3WTXC 3I71A 1HBXG 3VB2A 4I02A 3KP5A 2CSOA 1ZGJA 1KU3A 1YQAA 1E2XA 3S2WA 4EMSA 2ADUA 1KU9A 2EFQA 2GAUA 2M45A 3ABUA 2OBPA 4UVCA 4A0YA 2FXAA 2DU9A 3GLXA 3O6BB 4MEXF 4Q48A 4CGZA 1Z9CA 4HV6A 4H0EA 2CWEA 3WU0A 5D6FA 4KFCA 4MNUA 5BQTA 3FMRA 1USTA 4IHSA 3BDDA 1RNLA 5L3CA 1J7KA 2QUFA 3RI4A 4CICA 1KQ0A 2E1CA 3QRFF 1U3EM 1JE8A 5JHUA 3TQNA 2XVCA 2Q2EA 3P9KA 2IT0A 3W6KB 2XAFA 1W5TA 2MBFA 1DDNA 5LEKA 2NNNA 2OZUA 2QQAA 2M5WA 2VBZA 4OMZA 1HSJA 3HRSA 2VC0A 2FBHA 4Y15A 2H27A 3WG9A 4L0YB 2V1XA 4A6DA 2MH2A 3Q9VA 3LAJA 1XD7A 1DUXC 1I6XA 3WGHA 4RGXA 3KLNA 4XSZF 3C1DA 4M9ZA 3W6JB 2MD5A 3K9TA 5HLGA 5AIQA 1IXSB 3ABTA 1DP7P 3BROA 3QU6A 4FT8A 2UXXA 4KIGA 5CVVA 2JRTA 1LVAA 5E17F 4AIHA 4B09A 2ZJ2A 2MH9A 3JSOA 3CDHA 1SFUA 1WWXA 1S7OA 3KZYA 2B0LA 3R6SA 4OIOF 4CHUA 1G3TA 1FWZA 1ZH5A 2HOEA 2UZKA 2M8EA 2P8TA 2F5DA 3R60A 3HSRA 3DFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEU A;  1O7F A;  4S05 A;  2ZBK A;  3SHF A;  1YYV A;  2NAZ A;  3I0T A;  5DCM B;  4KIC A;  1HW2 A;  2DLL A;  3G73 A;  2P7V B;  3GZ6 A;  1PUE E;  3GUD A;  1TTY A;  5FD6 A;  5D5V B;  2VOO A;  4BHC A;  4R8H A;  3J81 Z;  2EV6 A;  2HYF A;  5IT9 K;  1G3Y A;  5K1Y A;  4UV8 A;  4ENM A;  2RNJ A;  3LA3 A;  3GX4 X;  5JFR A;  2CGP A;  1SD6 A;  1HKQ A;  2H6C A;  1DPR A;  1ON1 A;  2HKX A;  4A0X A;  3GO5 A;  3K1P A;  3BJA A;  1RI7 A;  5E8I A;  1P2F A;  3JAM Z;  2VON A;  1F1Z A;  4YG2 F;  5J8C A;  4UVA A;  2MC3 A;  3E6C C;  1S8N A;  1ONV A;  4WXD A;  1R58 A;  3V7C A;  1H9T A;  4IRI A;  2PMH A;  2QBY A;  3M9A A;  3N4M A;  2BV6 A;  3PQK A;  3GZ5 A;  2ESN A;  1R7J A;  3EQL F;  4BHB A;  1FBU A;  1P4X A;  4Y17 A;  3EET A;  1R1V A;  4UNO A;  3CUQ A;  3MZH A;  3L2C A;  2V79 A;  1YO5 C;  1KYW A;  1B4A A;  5BPD A;  1B9N A;  4O3M A;  2QWW A;  2A6H F;  1TQP A;  2XHK A;  1QZZ A;  2HTJ A;  4QLC U;  2DT5 A;  1Z7U A;  2IRF G;  2STW A;  2R3S A;  3KP7 A;  1EH7 A;  1XMA A;  1ODD A;  3OOP A;  1XGM A;  4R79 A;  4Q4Z F;  4KNY A;  3BP8 A;  1FX7 A;  1U2W A;  1S3J A;  2K27 A;  3F8B A;  1UHW A;  2VOP A;  1G4D A;  2DBB A;  1MJA A;  3VFZ A;  2MLG A;  2DK8 A;  2MA3 A;  4RGU A;  2VXZ A;  3C3W A;  3WTT C;  4EJV A;  1HXD A;  1HW5 A;  1IRG A;  1KQ8 A;  3T1B A;  3WTW C;  5JR3 A;  2XRN A;  3H3U A;  4L9T A;  1TW3 A;  1Z6R A;  4CYD A;  1KU2 A;  1QZY A;  1B59 A;  1R5G A;  2LF8 A;  4N9I A;  5J8F A;  1YFH A;  3ZMT A;  2CW0 F;  1D3Y A;  5JVT A;  3VOE A;  4GXO A;  2RQP A;  4P5O A;  5CYV A;  4OOI A;  4I7H A;  1FSE A;  2PMU A;  4WXH A;  3GFI A;  1UCR A;  3DPT A;  3E5U A;  1W7P D;  2A69 F;  4ESJ A;  4YII A;  1O3S A;  2P6T A;  4GYG A;  1A04 A;  2VOD A;  2E1N A;  4EM2 A;  2HEO A;  2GXG A;  3QOP A;  3BPX A;  2EA4 A;  2K7L A;  3SFZ A;  3Q5F A;  1K79 A;  5DCM A;  5K5O A;  3BOQ A;  4MHG A;  2L4A A;  2EFW A;  4HDV A;  4LG0 A;  2HQR A;  4GO1 A;  4L9J A;  5F64 A;  1I5Z A;  4IF4 A;  1E17 A;  2Z33 A;  4BHP A;  3J80 Z;  5LBQ A;  1JHH A;  3R0A A;  1MD0 A;  4Q5S F;  3F23 A;  4BH9 A;  4Q47 A;  2HWV A;  5D8L B;  2K4B A;  3IHU A;  3BJ6 A;  5D5X B;  3LWF A;  4L5I A;  2FU4 A;  4EJT A;  2CQK A;  3RYP A;  1FYK A;  2XKP A;  3IWF A;  2RKH A;  5D4S A;  3DEU A;  2XAQ A;  5L3F A;  4EVI A;  1WRJ A;  2ZXJ A;  5BS6 A;  1ON2 A;  1RUN A;  4PGG A;  1MGT A;  1Z6T A;  4WK8 F;  3CUO A;  4R1H A;  3M8E A;  2D2W A;  5A2Q K;  4HF2 A;  1O3Q A;  4PGH A;  3AAF A;  2VBX A;  4ZYH A;  1EV7 A;  1L3L A;  1HKS A;  2OZ6 A;  3V8K A;  3L7W A;  3NQO A;  1QGP A;  1B6A A;  3E5X A;  4U88 A;  1Z05 A;  1QBJ A;  2J5P A;  3RKY A;  2UXN A;  3FXU A;  1SD7 A;  4LMY A;  3WOD F;  4E70 A;  3HRT A;  3L00 A;  5DEQ A;  1BI0 A;  2H6B A;  3CUQ B;  1MDM A;  5DD8 A;  5ERI A;  4RB0 A;  5HDK A;  1YIO A;  1TLH B;  1MJB A;  2ISZ A;  1P92 A;  3ERE D;  3F8N A;  3E6D A;  2A68 F;  2VBY A;  4GYI A;  4OIR F;  1LEB A;  5E1W A;  1D5V A;  5HVQ C;  3WTS C;  4HDU A;  3KEO A;  2ZO4 A;  2PI0 A;  2WWY A;  3SXY A;  1F4K A;  2EFP A;  2O6G E;  3V8L A;  3IRQ A;  3T8T A;  4Y13 A;  1FNN A;  2QM3 A;  1TQM A;  5L3E A;  1IUY A;  3EDP A;  1WQ2 A;  1P4W A;  3T0Y A;  2H94 A;  2Q0O A;  3VOD A;  2KJC A;  1FBS A;  2FNP A;  3TO9 A;  4UV9 A;  4GGG A;  2Z99 A;  2QLZ A;  2J5O A;  4PZJ A;  3V4G A;  2KIF A;  2RVC A;  3HRU A;  5HS9 A;  1IN5 A;  2VN2 A;  2XAG A;  4RAY A;  4AIK A;  2PFB A;  4LG0 B;  1QO0 D;  2LNB A;  4FHT A;  2HQN A;  1REP C;  2FBK A;  4L0Z B;  3I4P A;  2CFX A;  4FX0 A;  1RZ4 A;  2FMY A;  4WXC A;  3I54 A;  1XDU A;  5LGT A;  2DQL A;  5HDN A;  4G7Z F;  3K1M A;  4UUV A;  1XGS A;  2A3S A;  1I27 A;  1T38 A;  3GYH X;  4LLN A;  3LFK A;  4M6Y A;  4A12 A;  1J9I A;  4HA8 A;  1ULY A;  3DPL C;  1IXR C;  2ZME B;  4ZYE A;  1OYY A;  1BI1 A;  1OYW A;  4YFX F;  3ZMV A;  1FY7 A;  4IJA A;  1FYL A;  1XCV A;  4B8X A;  1FLI A;  4LK1 F;  2D1V A;  2HKO A;  3ULQ B;  2P5V A;  3J80 K;  1ZAO A;  2H09 A;  4JBA A;  1R5H A;  1BC7 C;  1ZHF A;  3WTU C;  4UXN A;  1PDN C;  1J0R A;  1UB9 A;  5IT3 A;  3E5Q A;  1Q1H A;  5L3B A;  3TO6 A;  1BI2 A;  4AWX B;  3KET A;  3CUQ C;  1GVJ A;  4CXF A;  4U7D A;  2ZME A;  1Z1D A;  2FF4 A;  2VC1 A;  3HTS B;  5DYM A;  2YR2 A;  1XCB A;  3BJO A;  1OR7 A;  3WGG A;  2P5K A;  4A6E A;  5ILS A;  4M9X A;  2F5E A;  4HLX A;  3ROU A;  4CZZ A;  3KP2 A;  4A5M A;  1B9M A;  1O3R A;  3GFL A;  1XGN A;  4U0W A;  3LA7 A;  4PDK A;  3F3X A;  4IRG A;  4HV5 A;  3ELK A;  3IRR A;  3RDI A;  5DV5 A;  4G7H F;  2K4J A;  1SAX A;  3CTA A;  4L5J A;  1DPU A;  4N9H A;  5FLX Z;  2ACJ A;  5DUI A;  4HBL A;  4EGZ A;  3LQQ A;  4XLP F;  1R00 A;  2KIM A;  5CVI A;  4JK1 X;  4LFU A;  3MFK A;  3B02 A;  1PP8 F;  4KN4 X;  3FZV A;  3RKW A;  1QPM A;  4O5V A;  3ZMU A;  1ZLJ A;  2V1U A;  1UFM A;  1V4R A;  1FPQ A;  4RS8 A;  4ZH4 F;  2JPB A;  4KUM A;  2ZNY A;  4KDP A;  1SMY F;  4EJU A;  5KK1 A;  3FMQ A;  4G6Q A;  5LHI A;  3E6M A;  3R61 A;  5CLS A;  1XGO A;  5HS7 A;  1USS A;  2ZKZ A;  4MQV A;  4RB1 A;  2XAJ A;  1BIA A;  4MTD A;  2NRA C;  1U5T A;  3NRV A;  5ILV A;  2CG4 A;  4CDG A;  1IN7 A;  1W4M A;  4G6D A;  1LDK B;  4F7Z A;  4I0B A;  2F2E A;  2IW5 A;  2VT3 A;  3F72 A;  4RAZ A;  3PQJ A;  5J6X A;  5K5Q A;  6PAX A;  3KP3 A;  2RGV A;  1XSX A;  2GZW A;  1BC8 C;  2P4W A;  2RC4 A;  1ZRE A;  3ZN0 A;  3WE3 A;  2CYY A;  3ZP5 A;  3QP5 A;  2DQR A;  2M30 A;  1YS7 A;  2QQ9 A;  3F21 A;  3H92 A;  4LGW A;  3RPU A;  3R0J A;  2P7C B;  2FQ3 A;  4P9F A;  4HAM A;  1SD4 A;  3QPT A;  2E7X A;  4LJZ F;  1SFX A;  1BI3 A;  3J81 K;  3WGI A;  1ZLK A;  2VE8 A;  1OYI A;  3ZMD A;  2KKO A;  2PG4 A;  4CO8 A;  1ZRF A;  4HOB A;  5ED4 A;  2KIU A;  4M72 A;  3F22 A;  1IN4 A;  1X3U A;  4M71 A;  4EV0 A;  3HHH A;  1U6G A;  3O2P E;  5TRD A;  2G7H A;  2RDP A;  3I58 A;  4JQF A;  1O3T A;  4RGR A;  2HGC A;  2Y0M A;  4EQQ A;  3RPQ A;  3FMS A;  5FO5 A;  4KA4 A;  2EJR A;  1XSD A;  2RN7 A;  5CVR A;  1CF7 B;  1BBY A;  1ZGA A;  1S29 A;  2WV0 A;  3T5X A;  3JW4 A;  3WE2 A;  5H20 A;  4MGR A;  4L9V A;  2VE9 A;  1FYM A;  1WSU A;  3SQN A;  5L3D A;  2A61 A;  5AON A;  3FXQ A;  1O7L A;  4HQM A;  4M73 A;  3EUH A;  4NB5 A;  1FZP B;  1JHF A;  2XRO A;  1R23 A;  4HF1 A;  4A2U A;  2OAZ A;  3RJP A;  4UHT A;  4S04 A;  2JZY A;  5L3G A;  3F8F A;  4ON0 A;  4LK0 F;  1ZRC A;  4EM0 B;  2GA1 A;  1K7A A;  5DDG A;  2P5L C;  1YW7 A;  1D8K A;  1TNS A;  1NHA A;  2W85 A;  2QVO A;  4FX4 A;  2STT A;  1Y0U A;  2FE3 A;  3BWG A;  2JT1 A;  4KYW A;  2XUB A;  2MLK A;  3HRM A;  3HYI A;  3FHZ A;  1MDM B;  1YW8 A;  5LGU A;  2F5C A;  4AVP A;  3MWM A;  3TOA A;  2QEN A;  2OA4 A;  2WC2 A;  4RGS A;  5F1R A;  4G8X A;  4OIP F;  4ESF A;  4ENJ A;  2QQB A;  3VEP A;  2BBY A;  5HLH A;  2WTE A;  5JI6 A;  3M7G A;  1W7P A;  2X4H A;  4RB2 C;  3COA C;  1KGS A;  3IKT A;  3TDU C;  3HOT A;  3K69 A;  1R1U A;  5E1X A;  3EYI A;  2JPC A;  2ZNZ A;  1LJ9 A;  3QAH A;  3OV8 A;  1AOY A;  5BMZ A;  3GEZ A;  2IP2 A;  1TQI A;  1V3F A;  3GFJ A;  4BXU A;  2NYX A;  2HTS A;  4HLY A;  3L9F A;  2GXB A;  5E18 F;  1U5T C;  1SMT A;  1IRF A;  4IXA A;  3CO7 C;  3MQ0 A;  3HSE A;  1ZG5 A;  3CO6 C;  4G9Y A;  4P55 A;  4I98 B;  1F9N A;  5DD4 A;  1O57 A;  1T0F A;  2Y75 A;  4L18 B;  2ZFW A;  2QBY B;  2CO5 A;  1YTY A;  3RIR A;  5E8G A;  3T8R A;  4ZYD A;  4OMY A;  5FGM A;  2O03 A;  4A5N A;  3GF2 A;  5HS8 A;  2VBW A;  2IPQ X;  2FBI A;  1P4A A;  4WX9 A;  4MEY F;  1IW7 F;  4YFN F;  3GW2 A;  4KMF A;  4IHT A;  2O0Y A;  4OIQ F;  5D4R A;  1T2K A;  2Y48 A;  2LSO A;  1J59 A;  2C6Y A;  3P7N A;  2BE5 F;  2PBI A;  4ZYG A;  3ZQ7 A;  1BM9 A;  2Z5U A;  1T39 A;  3KFW X;  2K86 A;  5LHG A;  2O3F A;  5FB2 A;  4I09 A;  4LD5 A;  2DO7 A;  2F5F A;  3I64 A;  5ICF A;  2PJP A;  1T98 A;  1XB4 A;  1W5S A;  3F6V A;  3RYR A;  3GVA A;  1XDS A;  3F8C A;  4MQ9 F;  4P9U A;  2HFH A;  2M1B A;  2XGX A;  3V7S A;  5LHH A;  3D5L A;  2EV0 A;  5F6F A;  1LDJ A;  3I59 B;  2JSC A;  3ZN1 A;  2IA1 A;  2PEX A;  3HUG A;  2HYG D;  3IKV A;  4HX7 A;  4L9N A;  1VTN C;  3ZMS A;  1LB2 A;  2EK5 A;  2ESH A;  1TW2 A;  2AS5 F;  3L09 A;  2IA2 A;  1ZRD A;  1MZB A;  1G3S A;  4HF0 A;  1TBX A;  2Z3Y A;  3HOS A;  2TDX A;  2A6E F;  3TGN A;  2V6C A;  3REO A;  1R22 A;  2G7U A;  3EYY A;  3DF8 A;  2Q8K A;  1WKM A;  2R7D A;  4G7O F;  1U78 A;  1OPC A;  1IN6 A;  4YIF A;  5FLX K;  2VT2 A;  1FBQ A;  3M1E A;  3TO7 A;  1BIB A;  3TKY A;  1RIO H;  4P96 A;  2P6S A;  2GIV A;  3FF5 A;  4D0P A;  1F5T A;  5LGN A;  1OKR A;  5K5R A;  2OU2 A;  3HSF A;  1AWC A;  1YS6 A;  3QU3 A;  1U5T B;  1CGP A;  2QYO A;  4PCQ A;  4BNC A;  1XMK A;  5FFZ A;  4K2E A;  4NQW A;  2BEO A;  5D8K B;  1HQC A;  2ZCW A;  4ESB A;  2FOK A;  4IPA A;  1LNW A;  2W24 A;  2DAO A;  3M8F A;  4KT5 C;  4LLG F;  2XAH A;  4ZZD A;  3G3Z A;  3FWE A;  1RUO A;  3LAP A;  1BOA A;  2YPR A;  1HW1 A;  2L54 A;  2L3D A;  2L4M A;  2O61 A;  3KEQ A;  5ICE A;  3P9I A;  2YX4 A;  1JGS A;  1FT9 A;  4WCG A;  4QWQ A;  4BAY A;  1GXP A;  4LB5 A;  2DI3 A;  4ASN A;  2FNA A;  3ECH A;  5E20 A;  2D45 A;  2L02 A;  4EGY A;  4IVN A;  3I53 A;  2JTV A;  1K78 B;  2EA2 A;  4TV7 A;  3DV8 A;  1BN5 A;  3RTR A;  3BY6 A;  3WTV C;  2IA0 A;  3QPH A;  1XSV A;  4WF2 A;  2FEZ A;  1K78 A;  2W57 A;  1G3W A;  2W84 A;  3BPV A;  3WTY C;  3DKW A;  1S6L A;  2DPU A;  3ISP A;  2GQQ A;  5D5U B;  1FSH A;  2EFO A;  2PQ8 A;  4KN7 X;  4I01 A;  4U0Y A;  5E1Z B;  1YLF A;  4UVB A;  4EM1 A;  2FML A;  4RB3 C;  2BYV E;  2A5Y B;  3H3Z A;  3HTU A;  2E7W A;  1B1B A;  3V7R A;  5H6R A;  2FSW A;  5CVU A;  3K1N A;  3CJN A;  2LKP A;  2EFN A;  2M87 A;  3IL2 A;  2IJL A;  4KIF A;  4EJO A;  1IZ1 A;  2XKO A;  4G94 A;  3LST A;  2HR3 A;  1LQ1 A;  2YSR A;  4KIB A;  2DFI A;  2QZ8 A;  3FM5 A;  5LRR A;  4WWC A;  4YFK F;  4N0B A;  3KP4 A;  2UWM A;  5TJJ A;  3LQR A;  2K02 A;  4XSX F;  3JSP A;  4AIJ A;  2GWR A;  5FFX A;  1J2X A;  4DQ2 A;  1FC3 A;  3U9G A;  2ELH A;  1QNT A;  4M74 A;  3C18 A;  4M9S A;  2A07 F;  2LF7 A;  2L01 A;  3KCC A;  1CF7 A;  3E6B A;  1OMI A;  3B73 A;  5EEG A;  3D0S A;  3J7A O;  3P9C A;  1R36 A;  1SFE A;  4O6J A;  1S7A A;  3SZT A;  4LLL A;  4ZZL A;  3ML6 A;  4EJW A;  4MTE A;  3C7J A;  2RV8 A;  2GA2 A;  3MCZ A;  1W7P B;  2IVM A;  5A2Q Z;  1P6R A;  3SZP A;  4AD9 A;  3TDZ C;  5ICC A;  4NHJ A;  2O8X A;  3F6O A;  5AIP A;  1HST A;  3CLO A;  1UHM A;  1FP2 A;  2V9V A;  3MAJ A;  4DNC A;  1H0M A;  4HYE A;  1STZ A;  3U2R A;  4HX4 A;  3KE2 A;  3Q9S A;  2XIG A;  1I1S A;  3KLO A;  2DW4 A;  1BJA A;  1MKM A;  4HW0 A;  3FXR A;  1FP1 D;  5CJ9 A;  2FA5 A;  3E97 A;  3KP6 A;  2ETH A;  2EWN A;  1U8R A;  3N97 A;  2COM A;  5ICG A;  1KU7 A;  2HZT A;  5HDG A;  2BGC A;  2NNY A;  2KJB A;  1WI9 A;  3K0L A;  3F8M A;  4ENN A;  2W25 A;  4HZF A;  1YG2 A;  1ZN2 A;  2LDU A;  2HS5 A;  2HDC A;  4XBF A;  3HHG A;  5DCF A;  1KQ9 A;  4IRH A;  4Z2Y A;  1L0O C;  3FM3 A;  3MEX A;  2X0L A;  1ZYR F;  1HKT A;  1ZAR A;  2PLY A;  2NS0 A;  5ILU A;  3U1D A;  2FRH A;  1FOK A;  3PFI A;  2PN6 A;  1GXQ A;  1TNT A;  5EEH A;  1ZG1 A;  2DPD A;  3V8J A;  3TOB A;  2YU3 A;  3GWZ A;  3GXO A;  1IF1 A;  1KYZ A;  4M6X A;  1J75 A;  1H9G A;  2OD5 A;  5BOX A;  4U0V A;  1SD5 A;  1Z91 A;  2D1H A;  1C0W A;  1JXS A;  4LB6 B;  2G9W A;  4ENK A;  5HOO A;  4HQE A;  2EB7 A;  2Z9O A;  2R7F A;  4A0Z A;  3JTG A;  3IC7 A;  3R4K A;  2OQG A;  1XN7 A;  1MJ9 A;  3FX3 A;  5D6E A;  2EV5 A;  5KVR A;  4XRF A;  1R1T A;  2DTR A;  1T6S A;  3DP7 A;  3GFM A;  4KMU X;  1EH8 A;  5LRS A;  2YX7 A;  2XAS A;  5CVJ A;  3ZMZ A;  3K2Z A;  4OU0 A;  3WTZ A;  3MZY A;  5BPI A;  3IWZ A;  3ECO A;  1IAW A;  3O3K A;  3BZ6 A;  4BQA A;  1KA8 A;  3DXJ F;  1EH6 A;  4XLN F;  2DK5 A;  4HX8 A;  3I5U A;  3QP6 A;  5FD5 A;  2ISY A;  3HIF A;  4OIN F;  3RKX A;  2OQR A;  3I59 A;  5LEJ A;  1J5Y A;  2V1D A;  3ZPL A;  3WU1 B;  1YW9 A;  4U7B A;  1GHC A;  2AXL A;  2XV4 S;  3JTH A;  4ETS A;  1LDD A;  5LLQ A;  3JAM K;  4BYY A;  1PP7 U;  1ZG3 A;  1I1G A;  1K6O A;  4I0A A;  3DQV C;  1G6N A;  1QQI A;  1IN8 A;  2KRF A;  4I2O A;  3E3V A;  1IXC A;  4GCV A;  5HLI A;  1LEA A;  5H6Q A;  3KZZ A;  5IT9 Z;  3LA2 A;  5D5W B;  1D8J A;  5DUK A;  3WTX C;  3I71 A;  1HBX G;  3VB2 A;  4I02 A;  3KP5 A;  2CSO A;  1ZGJ A;  1KU3 A;  1YQA A;  1E2X A;  3S2W A;  4EMS A;  2ADU A;  1KU9 A;  2EFQ A;  2GAU A;  2M45 A;  3ABU A;  2OBP A;  4UVC A;  4A0Y A;  2FXA A;  2DU9 A;  3GLX A;  3O6B B;  4MEX F;  4Q48 A;  4CGZ A;  1Z9C A;  4HV6 A;  4H0E A;  2CWE A;  3WU0 A;  5D6F A;  4KFC A;  4MNU A;  5BQT A;  3FMR A;  1UST A;  4IHS A;  3BDD A;  1RNL A;  5L3C A;  1J7K A;  2QUF A;  3RI4 A;  4CIC A;  1KQ0 A;  2E1C A;  3QRF F;  1U3E M;  1JE8 A;  5JHU A;  3TQN A;  2XVC A;  2Q2E A;  3P9K A;  2IT0 A;  3W6K B;  2XAF A;  1W5T A;  2MBF A;  1DDN A;  5LEK A;  2NNN A;  2OZU A;  2QQA A;  2M5W A;  2VBZ A;  4OMZ A;  1HSJ A;  3HRS A;  2VC0 A;  2FBH A;  4Y15 A;  2H27 A;  3WG9 A;  4L0Y B;  2V1X A;  4A6D A;  2MH2 A;  3Q9V A;  3LAJ A;  1XD7 A;  1DUX C;  1I6X A;  3WGH A;  4RGX A;  3KLN A;  4XSZ F;  3C1D A;  4M9Z A;  3W6J B;  2MD5 A;  3K9T A;  5HLG A;  5AIQ A;  1IXS B;  3ABT A;  1DP7 P;  3BRO A;  3QU6 A;  4FT8 A;  2UXX A;  4KIG A;  5CVV A;  2JRT A;  1LVA A;  5E17 F;  4AIH A;  4B09 A;  2ZJ2 A;  2MH9 A;  3JSO A;  3CDH A;  1SFU A;  1WWX A;  1S7O A;  3KZY A;  2B0L A;  3R6S A;  4OIO F;  4CHU A;  1G3T A;  1FWZ A;  1ZH5 A;  2HOE A;  2UZK A;  2M8E A;  2P8T A;  2F5D A;  3R60 A;  3HSR A;  3DFG A; 
#chains in the Genus database with same CATH topology
 3NEU A;  2HVS A;  4ZDO A;  4CUG A;  3U21 A;  2B63 J;  1O7F A;  4S05 A;  3WU2 C;  2OPT A;  2ZBK A;  3S14 J;  1SAU A;  2GBY A;  3SHF A;  3VYS B;  2N8G A;  2AHQ A;  2DTZ A;  3QQA A;  2X85 A;  1YYV A;  2NAZ A;  1FIA A;  4MFE A;  1E3P A;  1ETK A;  3I0T A;  5DCM B;  1BR4 A;  2VLA A;  4KIC A;  1OCP A;  1HW2 A;  1V55 H;  2DLL A;  2H1L A;  3TL4 X;  1TWH J;  5EG0 A;  3G73 A;  3RPU D;  2P7V B;  2XSD C;  2LP0 A;  3SEQ A;  3GZ6 A;  1PUE E;  1ZQ3 P;  3GUD A;  2ELJ A;  2R7W A;  4BDY A;  2AQF A;  5BNG A;  1TTY A;  5FD6 A;  5D5V B;  5J3L A;  2VOO A;  4BHC A;  2H8W A;  3OWT A;  4R8H A;  3OYJ A;  2DA4 A;  3J81 Z;  1JJ6 C;  4HST A;  2EV6 A;  1X58 A;  4DZP A;  2HYF A;  5IT9 K;  1G3Y A;  5K1Y A;  9ANT A;  4UV8 A;  2E2H J;  4ENM A;  2RNJ A;  5FLM J;  3LA3 A;  3GTG J;  3SDG A;  1N75 A;  3F9K A;  3GX4 X;  4AM3 A;  4AID A;  2JVG A;  5JFR A;  2LK2 A;  2CGP A;  1MH4 A;  1SD6 A;  1HKQ A;  2H6C A;  1DPR A;  1ON1 A;  2HKX A;  2Z2S B;  4A0X A;  3GO5 A;  1W0U A;  4KIS A;  2JUC A;  3H9Q A;  2K9S A;  3K1P A;  2X6X A;  3BJA A;  1RI7 A;  4ZDL A;  1NTC A;  2CU7 A;  5E8I A;  3NWT A;  5IY5 H;  1HCR A;  1P2F A;  2DFF A;  2IAI A;  3JAM Z;  1S7E A;  3JRG A;  3W2W A;  3OIP A;  2VON A;  2BVL A;  1FOY A;  1F1Z A;  5EZH A;  4IOC F;  1RPW A;  2VJ4 A;  4XN0 A;  4YG2 F;  5J8C A;  1Y1W J;  4UVA A;  2MC3 A;  3E6C C;  1DP3 A;  1S8N A;  1ONV A;  4WXD A;  3HKZ N;  3BG7 A;  3BR1 A;  1R58 A;  3V7C A;  1H9T A;  2JA6 J;  3OS0 A;  3OL4 A;  5IYB J;  4IRI A;  2PMH A;  2ZXI A;  2QBY A;  4I99 C;  1HF0 A;  3M9A A;  3E7L A;  2Y0S N;  2EQR A;  3N4M A;  2BV6 A;  3PQK A;  3GZ5 A;  3D1N I;  2ESN A;  1R7J A;  3EQL F;  4BHB A;  1VND A;  1FBU A;  1P4X A;  3D5R C;  3EET A;  1R1V A;  1TT5 B;  4V2F A;  4Y17 A;  2JQ7 A;  2XF5 A;  4UNO A;  3RQ4 A;  1VQN I;  3HXL A;  3CUQ A;  3MZH A;  3L2C A;  2NS7 A;  2V79 A;  1A6I A;  1YO5 C;  1KYW A;  4BJ5 C;  1B4A A;  2CW8 A;  1DGW Y;  5BPD A;  1B9N A;  4O3M A;  2QWW A;  2A6H F;  1TQP A;  4DYQ A;  5M5Y J;  2XHK A;  2JA5 J;  1LFP A;  1ZEL A;  4AU7 A;  1QZZ A;  2HTJ A;  4QLC U;  2DT5 A;  1Z7U A;  2IRF G;  2M34 A;  4RAF A;  1ZGW A;  2XPW A;  2STW A;  2R3S A;  4XLC A;  2HI3 A;  3KP7 A;  2JJ7 A;  4A3G J;  1EH7 A;  1W5C C;  3E1S A;  1XMA A;  1ODD A;  4U87 A;  3OOP A;  1FMV A;  1XGM A;  4R79 A;  4Q4Z F;  4KNY A;  3ZRG A;  3DWL E;  2LY1 A;  3BP8 A;  1FX7 A;  1U2W A;  5J1R A;  4DIQ A;  1FOW A;  1S3J A;  5E3L A;  4IOA F;  2K27 A;  3F8B A;  1UHW A;  3TW7 A;  1HLV A;  2VOP A;  4GDF A;  1G4D A;  2DBB A;  1VQL I;  1MJA A;  3VFZ A;  2DT7 B;  3JRA A;  2DT6 A;  2EH3 A;  2MLG A;  2DK8 A;  2MA3 A;  4RGU A;  2VXZ A;  2GLO A;  3HKZ A;  3C3W A;  3WTT C;  3BG9 A;  4EJV A;  1TWG J;  2EBI A;  2P0W A;  5IYC J;  1HXD A;  2JRM A;  2V1N A;  2DYS H;  4YIR X;  2NVU B;  3KIO A;  3OYN A;  3FHN A;  1HW5 A;  1IRG A;  2IGN A;  1KQ8 A;  3S8P A;  3T1B A;  3WTW C;  5JR3 A;  1LE8 A;  2QA4 I;  1ZKG A;  3I3L A;  5F0F A;  4XRM A;  2XRN A;  3K4C A;  3H3U A;  4L9T A;  1TW3 A;  3B6A A;  1EF4 A;  4RBO A;  3U1K A;  1Z6R A;  4XKW A;  4CYD A;  1KU2 A;  2W00 A;  1QZY A;  3DEE A;  1BA5 A;  1LUJ B;  2L2O A;  4DOZ A;  1B59 A;  3K6G A;  4GFB A;  1R5G A;  3G4S I;  2LF8 A;  4N9I A;  3NAR A;  2VI6 A;  5J8F A;  1YFH A;  2KIQ A;  3WHB A;  3ZMT A;  4DGW B;  3BR6 A;  2CW0 F;  1D3Y A;  2IS6 A;  5JVT A;  2JVH A;  3VOE A;  2E5Z A;  2FD5 A;  2MGQ A;  2TCT A;  2RQP A;  4GXO A;  4LIU A;  4P5O A;  5CYV A;  4OOI A;  4A3L J;  1QVU A;  4I7H A;  1FSE A;  4XK4 A;  2PMU A;  1FTZ A;  4WXH A;  1YX5 A;  3GFI A;  3Q0W A;  1UCR A;  1ITY A;  2KL4 A;  3E5U A;  3DPT A;  2PMZ A;  1W7P D;  1IGN A;  4MIM A;  4JX5 A;  2A69 F;  2ZB9 A;  4XQF A;  4ESJ A;  4YII A;  1U0J A;  2P6T A;  1O3S A;  2HPI A;  4GYG A;  1A04 A;  4C9Y A;  4JYK A;  3FK7 A;  3BC8 A;  3IH4 A;  2VOD A;  1Y0N A;  2E1N A;  4EM2 A;  2WAQ N;  3MKY B;  2HEO A;  1Z7L A;  2BVM A;  2NVQ J;  3QYF A;  1S9H A;  2G0E A;  2GXG A;  5FRN A;  4MLO A;  3LMM A;  1KZH A;  3P5J A;  3QOP A;  2A6T A;  3BPX A;  2EA4 A;  2K7L A;  4MO7 A;  3SFZ A;  2R7V A;  3Q5F A;  4XLE A;  1K79 A;  5DCM A;  1B72 A;  5K5O A;  4BY7 J;  3BOQ A;  4MHG A;  2L4A A;  2EFW A;  4HDV A;  4IO9 F;  2KZG A;  4C3J J;  4ZC3 A;  4LG0 A;  5FLV A;  2HQR A;  4GO1 A;  3BR3 A;  4L9J A;  3PFY A;  5F64 A;  1IDZ A;  4IHV A;  1I5Z A;  2DYR H;  2XGE A;  4IF4 A;  1E17 A;  2Z33 A;  4BHP A;  4YRV A;  3J80 Z;  5LBQ A;  4XRS G;  1JHH A;  3CCS I;  3R0A A;  1MD0 A;  4Q5S F;  2IXS A;  3F23 A;  1JI8 A;  4BH9 A;  4Q47 A;  2HWV A;  5D8L B;  2K4B A;  3IHU A;  3L1P A;  3BJ6 A;  5D5X B;  3JRH A;  3LWF A;  3QPL A;  1UAA A;  4L5I A;  2L5Q A;  1K61 A;  2FU4 A;  4EJT A;  2CQK A;  2WBM A;  2M8G X;  3O8G A;  3RYP A;  4PFP A;  1DU0 A;  1FYK A;  2OV7 A;  1MMN A;  2L7K A;  1B72 B;  4NBQ A;  2XKP A;  4Y3O A;  3IWF A;  1R4N B;  2KMU A;  2RKH A;  2I10 A;  2ZJP F;  2ZSI B;  3DU6 A;  5D4S A;  3DEU A;  2XAQ A;  5L3F A;  4EVI A;  1WRJ A;  1QA6 A;  2L9R A;  3TP0 A;  2ZXJ A;  3A0B C;  3D5S C;  3K70 C;  1NH3 A;  1RR7 A;  1TWC J;  5BS6 A;  1ON2 A;  2FX0 A;  1RUN A;  3QOE A;  4PGG A;  1MGT A;  4A3I J;  1Z6T A;  2XB5 A;  3A4C A;  2BXY A;  1JTX A;  4CCM A;  3IP4 B;  4WK8 F;  1ETX A;  1Y6I A;  3CUO A;  1P7J A;  3M8E A;  2D2W A;  1XX5 A;  4R1H A;  3FXM A;  5A2Q K;  4HF2 A;  1O3Q A;  4PGH A;  4B43 A;  3SYT A;  5DS9 A;  2VQL A;  3AAF A;  2DMT A;  2VBX A;  4ZYH A;  5C4J J;  1EV7 A;  1L3L A;  1HKS A;  2OZ6 A;  3V8K A;  2HOT A;  1ERD A;  3L7W A;  3NQO A;  4I76 A;  3DEW A;  1QGP A;  3S2H J;  3CCR I;  1B6A A;  3E5X A;  1JUS A;  1S5L C;  4U88 A;  2CUE A;  1Z05 A;  5B1A H;  2L9V A;  1QBJ A;  4RLF A;  2J5P A;  3RKY A;  2UXN A;  3FXU A;  1SD7 A;  2LLK A;  1IC8 A;  5B66 C;  1ORK A;  2VQH A;  4LMY A;  2QGU A;  3WOD F;  1IV6 A;  1HA8 A;  4E70 A;  3HRT A;  3L00 A;  5DEQ A;  1BI0 A;  2H6B A;  3CUQ B;  4N4O B;  4KIT B;  3EUA A;  4HG2 A;  4J01 A;  1MDM A;  5B5E C;  5DD8 A;  5ERI A;  1IJW C;  1BJZ A;  4RB0 A;  3VDX A;  5HDK A;  1YIO A;  5FKN A;  1TLH B;  1MJB A;  2ISZ A;  4ZTJ A;  1P92 A;  3S32 A;  2RQQ A;  3ERE D;  2VB6 A;  3KYD B;  5EDN A;  3F8N A;  1VZ0 A;  2R5Y B;  3E6D A;  2A68 F;  2VBY A;  1T08 B;  4GYI A;  1MH3 A;  1E3H A;  3OIO A;  4OIR F;  4CCL A;  1LEB A;  1V5F A;  4UB8 C;  1VQ5 I;  5FKO A;  5E1W A;  2R93 J;  1OCC H;  1D5V A;  3OMY A;  3PJR A;  2WY8 Q;  3IH3 A;  5IOY A;  5HVQ C;  1Q1V A;  4XLH A;  3WTS C;  2CUF A;  4HDU A;  3KEO A;  2ZO4 A;  2PI0 A;  4CSW A;  2WWY A;  3SXY A;  4II2 A;  1F4K A;  2EFP A;  2IBD A;  3FIS A;  2O6G E;  3PSF A;  3V8L A;  4E7J A;  1OQY A;  1U9N A;  4A3E J;  3S1R J;  5DM7 F;  3IRQ A;  3T8T A;  3S1Q J;  2VXD A;  4Y13 A;  1FNN A;  2QM3 A;  1TQM A;  2KRC A;  2E1M C;  5L3E A;  1UJ8 A;  1IUY A;  3EDP A;  1WQ2 A;  4AYB A;  1P4W A;  3T0Y A;  1W1W E;  1IO2 A;  1F43 A;  2DA7 A;  1FTT A;  2H94 A;  3OYA A;  2L9N A;  2Q0O A;  2DMN A;  3SDB A;  1IRX A;  2ZFU A;  3VOD A;  2KJC A;  2VKE A;  4D5C A;  3HJE A;  1FBS A;  2FNP A;  3TO9 A;  4UV9 A;  3CMM A;  2WAD A;  4QPO A;  3CD6 I;  4GGG A;  3L2W A;  2Z99 A;  2A05 A;  2QLZ A;  2DOE A;  2J5O A;  3S3O A;  4QTR A;  3Q0U A;  3OR1 C;  3CME I;  2MYS A;  5IPA A;  4PZJ A;  3V4G A;  1YRN A;  1T8I A;  2KIF A;  2RVC A;  3HRU A;  4G6T B;  4Y7N J;  1RC9 A;  5HS9 A;  1IN5 A;  2VN2 A;  2XAG A;  1WJ5 A;  4RAY A;  4DYC A;  4AIK A;  1VQP I;  2LR8 A;  2JWT A;  2PFB A;  4LG0 B;  1QO0 D;  2LNB A;  4A69 C;  2LVS A;  4FHT A;  2HQN A;  1FJL A;  1Y1V J;  2CS3 A;  3G6E I;  1REP C;  3H0G J;  2FBK A;  3HEF A;  2VPL A;  1TC3 C;  4L0Z B;  3I4P A;  2CFX A;  4FX0 A;  1RZ4 A;  1T33 A;  5K7H A;  2CQQ A;  5GAG J;  2LMD A;  2X51 A;  5KAF C;  1R9T J;  2FMY A;  4WXC A;  3ZOB A;  4IQ4 A;  4BQQ A;  3S16 J;  3I54 A;  1XDU A;  5LGT A;  2DQL A;  5HDN A;  4G7Z F;  2E1M B;  3K1M A;  3BR0 A;  1W36 D;  4UUV A;  1XGS A;  2R5Y A;  2A3S A;  1D5Y A;  3H5R A;  1I27 A;  1T38 A;  3GYH X;  4B1R A;  2X1C A;  4LLN A;  3RZD J;  1PUF B;  3LFK A;  3CCV I;  1JKQ C;  3IUO A;  4M6Y A;  1WJC A;  4A12 A;  1JKR C;  1J9I A;  4HA8 A;  1ULY A;  2MW8 A;  3DPL C;  1IXR C;  4DJA A;  2ZME B;  2E1O A;  4ZYE A;  1OYY A;  1BI1 A;  3JRE A;  2HYJ A;  1OYW A;  4YFX F;  2B7E A;  4XIC A;  3ZMV A;  1N78 A;  1FY7 A;  2HQ5 A;  4IJA A;  1FYL A;  1XCV A;  4B8X A;  1FLI A;  1A35 A;  4LK1 F;  2D1V A;  2HKO A;  2EIN H;  3ULQ B;  2P5V A;  1OIS A;  3BR2 A;  3J80 K;  2KDZ A;  1ZAO A;  4HSR A;  5FKK A;  2H09 A;  4JBA A;  1R5H A;  2EZH A;  1BC7 C;  3A1Y A;  1ZHF A;  3WTU C;  3HC7 A;  3CES A;  1YJN I;  3C2H A;  2M3A A;  3WHC A;  3CLQ A;  4UXN A;  1CQT A;  1PDN C;  1J0R A;  1UB9 A;  5IT3 A;  1Z21 A;  3E5Q A;  3LSK A;  1OCR H;  1Q1H A;  2LRE A;  5L3B A;  1W36 C;  2E5N A;  3TO6 A;  1BI2 A;  1NG7 A;  3Q3S A;  4AWX B;  3KET A;  2DDB A;  3CUQ C;  3A01 A;  1GVJ A;  2HU9 A;  3F0C A;  3E0J B;  4CXF A;  5GAH J;  2CW7 A;  4U7D A;  1H8A C;  3W2V A;  2ZME A;  3VYU B;  1Z1D A;  4CCK A;  2VKD A;  1D1B A;  2FF4 A;  2VC1 A;  4F55 A;  3HTS B;  3ABL H;  5DYM A;  2YR2 A;  4HNU A;  4IL6 C;  1XCB A;  3S1M J;  3BJO A;  3OYF A;  1OR7 A;  3WGG A;  2JA2 A;  5GAD J;  2P5K A;  3HB9 A;  5IP9 J;  4BL0 B;  4A6E A;  1X1C A;  1SAN A;  4XKC A;  1X3W B;  5EGO A;  2HPM A;  4UB6 C;  4M9X A;  2F5E A;  4UUT A;  5ILS A;  3FXJ A;  4HLX A;  2KDO A;  3ROU A;  3FXL A;  3UNG C;  2B9S A;  4BQO A;  3KP2 A;  1XTA A;  4D9J A;  4A5M A;  4CZZ A;  1B9M A;  3H36 A;  4G12 A;  1O3R A;  3GFL A;  4A3C J;  1XGN A;  4U0W A;  3LA7 A;  1NK3 P;  4PDK A;  2CFO A;  2CUJ A;  3F3X A;  4IRG A;  4HV5 A;  3ELK A;  4DZJ A;  2VPR A;  3IRR A;  3DCF A;  3RDI A;  4DW6 A;  1O4X A;  4CCJ A;  2DA3 A;  4NUB A;  1AKH B;  3A0H C;  5DV5 A;  4XKV A;  4G7H F;  1YJ9 I;  3RZO J;  2Y69 H;  2HDW A;  2PJR A;  1XMX A;  3DBH B;  4E7L A;  3BTL A;  4RM3 A;  2ECC A;  2K4J A;  2L7F P;  1SAX A;  3CTA A;  4L5J A;  2VAS A;  1DPU A;  4N9H A;  3ZQQ A;  5FLX Z;  2ACJ A;  5EYR A;  2DJN A;  5DUI A;  5M3F J;  1I3Q J;  2R7R A;  4HBL A;  4QSH A;  4EGZ A;  4A3K J;  3OIQ A;  3LQQ A;  2DMQ A;  2VQG A;  1D0Z A;  4XLP F;  1R00 A;  2KIM A;  5CVI A;  4JK1 X;  3LSJ A;  4W1U A;  4B44 A;  3V42 A;  4LFU A;  3CF5 F;  3CCL I;  3MFK A;  3B02 A;  1PP8 F;  4P1W A;  1B8I B;  1T0F C;  4KN4 X;  3FZV A;  5M5X J;  3RKW A;  1QPM A;  4O5V A;  3ZMU A;  4LG3 A;  2DA5 A;  1ZLJ A;  2DDA A;  2V1U A;  1UFM A;  2X6O A;  3ONQ A;  1V4R A;  2M4G A;  2XF6 A;  1FPQ A;  4II3 A;  4RS8 A;  2Y31 A;  4ZH4 F;  5CQE A;  2JPB A;  4KUM A;  2ZNY A;  4KDP A;  1SMY F;  4EEF G;  3H9G A;  4EJU A;  5KK1 A;  2LBF A;  3FMQ A;  4G6Q A;  3PO3 J;  5LHI A;  3E6M A;  3R61 A;  5CLS A;  1XGO A;  3PUB A;  1USS A;  2JMW A;  5HS7 A;  2ZKZ A;  3KEY A;  3G1O A;  1OCZ H;  4ZJZ A;  4RDU A;  3UR3 C;  2R7T A;  4MQV A;  3DBL B;  4E7I A;  4RB1 A;  2XAJ A;  2KT0 A;  1NG6 A;  1BIA A;  4MTD A;  2NRA C;  1U5T A;  3NRV A;  4EAT A;  1X19 A;  2CG4 A;  4CDG A;  2W48 A;  5ILV A;  1IG7 A;  1IN7 A;  1WFX A;  1W4M A;  2K85 A;  2BHZ A;  4PFO A;  4G6D A;  1LDK B;  2LG4 A;  3BG6 A;  4IQJ A;  4F7Z A;  4I0B A;  2F2E A;  2IW5 A;  3UKG A;  2VT3 A;  3F72 A;  2KIS A;  3PQJ A;  4RAZ A;  4BBS J;  3W3C A;  3H0D A;  4A93 J;  2BOL A;  2WAF A;  5J6X A;  5K5Q A;  2M7A A;  1PUF A;  2MG4 A;  3BZC A;  6PAX A;  3KP3 A;  2RGV A;  1XSX A;  2GXA A;  2GZW A;  1BC8 C;  2P4W A;  4RLQ A;  5M5W J;  3FKJ A;  2L9S A;  5J4Y A;  2MAB A;  2RC4 A;  4HNT A;  1ZRE A;  3ZN0 A;  1AKH A;  3WE3 A;  5C3E J;  1A5J A;  2CYY A;  2BHY A;  1I6H J;  3I4N J;  3ZP5 A;  4B47 A;  3QP5 A;  2CJJ A;  4ZTF A;  2DQR A;  3EUH C;  1X4P A;  2M30 A;  3OYL A;  3EUK L;  4PJM A;  3CCQ I;  3NAU A;  1VQM I;  1YS7 A;  2QQ9 A;  1DU6 A;  3F21 A;  3H92 A;  2ZXH A;  4LGW A;  3RPU A;  3R0J A;  5J4V A;  2KP6 A;  2P7C B;  2FQ3 A;  4P9F A;  4IHY A;  4HAM A;  1SD4 A;  2QCO A;  3QPT A;  2E7X A;  1MBK A;  3BLY A;  3OYI A;  3K70 D;  4LJZ F;  4IHX A;  1SFX A;  2Y2Z A;  2GM4 A;  1BI3 A;  2W1O A;  1VQ6 I;  3J81 K;  2VKV A;  3MKL A;  2NVY J;  3WGI A;  2QF7 A;  4BE2 A;  1ZLK A;  4BE0 A;  2VE8 A;  1OYI A;  2HZD A;  2FJ1 A;  2M9H A;  5KCM A;  3ZMD A;  5HOD A;  2KKO A;  1IV8 A;  2H1K A;  2PG4 A;  4IHW A;  3MKW B;  1K83 J;  4D7N A;  2H8R A;  4CO8 A;  2ME6 A;  1ZRF A;  4HOB A;  5ED4 A;  2W4S A;  3OYM A;  3K4J A;  2KIU A;  3JR9 A;  3OYH A;  1T95 A;  4M72 A;  2F48 A;  4M3E A;  3F22 A;  4W97 A;  1IN4 A;  1X3U A;  3PO2 J;  4M71 A;  4AYB N;  1ZK8 A;  4EV0 A;  3HHH A;  4PJN A;  4OWR B;  1V5E A;  4BAC A;  1U6G A;  3O2P E;  5TRD A;  1QPI A;  4AUX A;  2G7H A;  1N77 A;  2RDP A;  3I58 A;  4JQF A;  1O3T A;  4RGR A;  1JUM A;  3HPG A;  2HGC A;  3TP3 A;  2BW3 B;  2Y0M A;  4B3A A;  5E3N A;  4V19 K;  4EQQ A;  3MZ8 A;  1D1C A;  2ID3 A;  4H4K C;  3RPQ A;  5J40 A;  3FMS A;  2KHM A;  5FO5 A;  4KA4 A;  2W7N A;  2EJR A;  3CC4 I;  2DFE A;  1XSD A;  2RN7 A;  5CVR A;  1CF7 B;  1BBY A;  1ZGA A;  1S29 A;  3J7Y J;  2WV0 A;  3T5X A;  1R5I D;  3JW4 A;  3WE2 A;  5H20 A;  3M3Y J;  4MGR A;  2IS4 A;  3I9V 2;  4L9V A;  2VE9 A;  1FYM A;  1WSU A;  3SQN A;  2EZI A;  5L3D A;  2A61 A;  3SEZ A;  2FOW A;  3CCE I;  3S3N A;  5AON A;  1Y56 A;  1P7I A;  1O7L A;  3FXQ A;  4HQM A;  4M73 A;  1PJR A;  5F0H A;  1TL8 A;  3EUH A;  4NB5 A;  1FZP B;  1JHF A;  2R5Z A;  2WV1 A;  2XRO A;  1R23 A;  1ZR2 A;  4HF1 A;  4A2U A;  3AG4 H;  2OAZ A;  3RJP A;  4UHT A;  4S04 A;  3AG2 H;  2JZY A;  1QZE A;  4B48 A;  4M3G A;  5L3G A;  3F8F A;  1RES A;  4ON0 A;  1R6R A;  2FUG 2;  2HXO A;  4LK0 F;  1ZRC A;  4EM0 B;  2GA1 A;  1K7A A;  2IEK A;  5DDG A;  1ZR4 A;  3IAM 2;  2P5L C;  1YW7 A;  5EZG A;  1D8K A;  3HDD A;  3RCO A;  1TNS A;  1W0T A;  3MMY B;  1NHA A;  2W85 A;  2QVO A;  3GZN B;  1PVE A;  4IZZ A;  4FX4 A;  2STT A;  1Y0U A;  2Q1Z B;  2FE3 A;  4F92 B;  2LH9 A;  3BWG A;  2JT1 A;  1WJA A;  4KYW A;  4A3B J;  3CC2 I;  3MN2 A;  1FMW A;  3JCU C;  2XUB A;  3CCU I;  2MLK A;  3FKI J;  1X1D A;  1GVD A;  2E71 A;  4A3F J;  3HRM A;  3HYI A;  1RRJ A;  2WB1 N;  3FHZ A;  1MDM B;  3HOY J;  1MBE A;  2XB0 X;  3K10 A;  1YW8 A;  3M8J A;  2LKX A;  5LGU A;  2DN0 A;  2F5C A;  4AVP A;  3GTM J;  4IEJ A;  4F3Q A;  3MWM A;  3A02 A;  2HVR A;  3TOA A;  4CYC B;  2QEN A;  2XGD A;  1JUP A;  2OA4 A;  2BXZ A;  4BS9 A;  2WC2 A;  3GLL A;  2V9K A;  1VQO I;  2LYC A;  4RGS A;  3HL2 A;  5B3S H;  3ZGK A;  4G8X A;  5F1R A;  4OIP F;  4ESF A;  2I8D A;  2KQR A;  2QQB A;  3VEP A;  4ENJ A;  2BBY A;  2VUM J;  1ETY A;  3CJT B;  3L2U A;  2QEX I;  5HLH A;  4E7K A;  2WTE A;  5GAE J;  1MBJ A;  4XID A;  2UV1 A;  4F91 B;  2VL8 A;  5JI6 A;  1M1E B;  4C3I J;  2BY2 A;  3FXO A;  2DA2 A;  4DBQ A;  1UMQ A;  3M7G A;  1G8X A;  1W7P A;  1Y8Q B;  2X4H A;  2EIM H;  3CZ6 A;  3TED A;  4RB2 C;  1UHS A;  3COA C;  1KGS A;  3IKT A;  3TDU C;  3HOT A;  2M4K A;  3K69 A;  4BJT A;  1R1U A;  1JT0 A;  5E1X A;  4UUS A;  3EYI A;  2ZNZ A;  2JPC A;  1LJ9 A;  1JT6 A;  1YX3 A;  3QAH A;  2OTL I;  3OV8 A;  1AOY A;  5BMZ A;  2F4I A;  3GEZ A;  1ENH A;  2IP2 A;  1TQI A;  2NS8 A;  1V3F A;  3GFJ A;  4BXU A;  2NYX A;  2OF7 A;  5GTI C;  2HTS A;  4BXF A;  1SEU A;  4HLY A;  3L9F A;  2GXB A;  3ZQL A;  2MC4 A;  5E18 F;  3FK6 A;  1U5T C;  1SMT A;  2ECB A;  1IRF A;  4IXA A;  3CO7 C;  3MQ0 A;  3HSE A;  1ZG5 A;  3CCM I;  1QVT A;  1R71 A;  3CO6 C;  4G9Y A;  2F4O B;  4LIV A;  4P55 A;  3BCB A;  5J1U A;  2YU9 J;  3DPU A;  4I98 B;  1F9N A;  5DD4 A;  3S93 A;  1O57 A;  4E6K G;  1T0F A;  4ZDP A;  2Y75 A;  3QPS A;  4L18 B;  3CJR B;  2ZFW A;  4QIW N;  2QBY B;  2CO5 A;  5CQG A;  1YTY A;  3RIR A;  5E8G A;  4HEA 2;  3T8R A;  4ZYD A;  4OMY A;  3GTQ J;  3CMY A;  3C2G A;  1IUF A;  5FGM A;  2O03 A;  3PM1 A;  2Y9Z A;  4A5N A;  1SFK A;  2R7Z J;  3GF2 A;  4M6V A;  4B3X A;  2VBW A;  4NDL A;  1Z77 A;  5HS8 A;  4J00 A;  1GT0 C;  3AG1 H;  2IPQ X;  3A2K A;  1MBH A;  2FBI A;  1P4A A;  5FRM A;  4WX9 A;  2LFB A;  4MEY F;  3PSI A;  1IW7 F;  4YFN F;  3GW2 A;  4XOT A;  4KMF A;  2O5R A;  3PL8 A;  4IHT A;  2O0Y A;  4OIQ F;  3BR5 A;  5D4R A;  1T2K A;  2Y48 A;  2WAE A;  2LSO A;  3EPZ A;  1MSF C;  1J59 A;  2C6Y A;  3P7N A;  2BE5 F;  4C2U A;  1MW7 A;  2PBI A;  3OY9 A;  4X6A J;  4ZYG A;  3ZQ7 A;  1BM9 A;  2Z5U A;  3S3M A;  1T39 A;  3KFW X;  1J09 A;  2K86 A;  4RA2 A;  2O3F A;  2PX9 A;  4E7S A;  5LHG A;  4OAY A;  2NVT J;  5FB2 A;  4I09 A;  4LD5 A;  1YRN B;  2MFZ A;  2DO7 A;  2XC7 A;  1SFO J;  2F5F A;  3I64 A;  2EZK A;  5ICF A;  3ZQC A;  2PJP A;  4JX4 A;  1AA7 A;  1T98 A;  1XB4 A;  1F36 A;  2EIK H;  1W5S A;  1AU7 A;  2FQ4 A;  3F6V A;  1I39 A;  1XC5 A;  3VSL A;  3JRB A;  3LSH A;  1BR2 A;  3RYR A;  4RM2 A;  3GVA A;  5LFA A;  2CUZ A;  1RET A;  2XGC A;  1MBF A;  1XDS A;  2LY9 A;  1X1P A;  3F8C A;  4MQ9 F;  3ASO H;  4P9U A;  5C4X J;  3L2R A;  2HFH A;  3TMO A;  3Q0V A;  2KRH A;  3AL0 B;  2M1B A;  2XGX A;  1IRZ A;  2K9M A;  1RKW A;  3V7S A;  3DLL F;  2R7S A;  5LHH A;  2BZT A;  2EV0 A;  3D5L A;  5F6F A;  1LDJ A;  3MKZ A;  5JLW A;  3PUF A;  3I59 B;  2JSC A;  3ZN1 A;  2IA1 A;  2KFD A;  2PEX A;  3K4K A;  1QU3 A;  3HUG A;  2HYG D;  1WI3 A;  3C2B A;  3IKV A;  5EGO B;  3M07 A;  4HX7 A;  1HC8 A;  1OR7 C;  3ZQH A;  3W6V A;  4L9N A;  4CCN A;  1VTN C;  3ZMS A;  1LB2 A;  2EK5 A;  2ESH A;  4F93 B;  1TW2 A;  4PJJ A;  3CCJ I;  2AS5 F;  3L09 A;  2IA2 A;  1ZRD A;  1MZB A;  2VQC A;  4B4C A;  2XRL A;  1GLN A;  4FCY A;  4FTH A;  1G3S A;  4HF0 A;  1TBX A;  2Z3Y A;  3DTI A;  3HOS A;  2OTJ I;  1ZTR A;  4JOM A;  2TDX A;  2A6E F;  3TGN A;  5C44 J;  2V6C A;  2QSG X;  3REO A;  1R22 A;  2G7U A;  4XRS A;  3EYY A;  3DF8 A;  4KJZ A;  2Q8K A;  1WKM A;  2R4G A;  1B8I A;  1Z67 A;  2R7D A;  3M1C A;  4HNV A;  3ZR8 X;  2M2E A;  4ABZ A;  2R7Q A;  1U78 A;  1LPQ A;  4G7O F;  1OPC A;  3HOX J;  1IN6 A;  4YIF A;  3VWB A;  5FLX K;  2VT2 A;  1FBQ A;  2PMZ N;  3M1E A;  3TO7 A;  1S72 I;  2BY3 A;  2ZJR F;  1BIB A;  3TKY A;  1PYV A;  1RIO H;  4P96 A;  3RQI A;  2XSJ C;  2P6S A;  3HG9 A;  2GIV A;  4XLF A;  3FF5 A;  4A3D J;  4D0P A;  5DM6 F;  1DGR M;  5K7Z A;  1F5T A;  2ZC2 A;  1Z0X A;  1WVR A;  5LGN A;  1OKR A;  5K5R A;  2OU2 A;  3W2A A;  2RRE A;  3HSF A;  3OOU A;  1VFC A;  1BW5 A;  1MIJ A;  1AWC A;  1YS6 A;  3QU3 A;  1U5T B;  1CGP A;  1TP4 A;  2QYO A;  4PCQ A;  2NXN B;  4BNC A;  1XMK A;  5FFZ A;  3ZQG A;  4K2E A;  4NQW A;  4FAS D;  2BEO A;  3MD2 A;  4XON A;  5D8K B;  4PSX A;  3FXK A;  4BXX J;  1MMA A;  1HQC A;  3O8H A;  5E3O A;  2ZCW A;  1POG A;  4ESB A;  2FOK A;  4IPA A;  1LNW A;  2W24 A;  3GTL J;  2CV2 A;  3QWL A;  3DU5 A;  2DAO A;  4V2G A;  3M8F A;  4KT5 C;  1Y39 A;  4LLG F;  2XAH A;  4FE7 A;  4ZZD A;  5KHD A;  2KZV A;  2CH0 A;  3G3Z A;  1OCT C;  2QQ8 A;  4M3D A;  3FWE A;  1RUO A;  3BQY A;  4NQW B;  3LAP A;  2BY1 A;  4LOC A;  1BOA A;  1WZ2 A;  2YPR A;  1HW1 A;  2L54 A;  2R7O A;  1FEX A;  2L3D A;  2L4M A;  2O61 A;  3KEQ A;  2KLO A;  3H1C A;  2CQ7 A;  1JTY A;  3G2B A;  2X9D A;  5ICE A;  2ZSH B;  3P9I A;  1OCO H;  2YX4 A;  2ICW G;  1JGS A;  1FT9 A;  3DTE A;  3H35 A;  2UUZ A;  2JUG A;  4WCG A;  4QWQ A;  2CQN A;  4BAY A;  3CJQ B;  1GXP A;  4LB5 A;  2DI3 A;  2BW3 A;  1A6Q A;  1LVK A;  4ASN A;  4UY8 I;  3I55 I;  1LE8 B;  5DTD A;  4XLA A;  2FNA A;  2Z16 A;  3ECH A;  5E20 A;  2D45 A;  2L02 A;  4EGY A;  5K7F A;  2COB A;  4L5E A;  4IVN A;  1QHH D;  2DOD A;  3I53 A;  4A3J J;  2JTV A;  4J19 A;  3SZG A;  1K78 B;  2EA2 A;  1SVL A;  1WPK A;  4XL9 A;  1I50 J;  3LSM A;  4TV7 A;  2GOX B;  3DV8 A;  1BN5 A;  2BY0 A;  3RTR A;  3HM5 A;  5FRO A;  3BY6 A;  3WTV C;  2IA0 A;  3QPH A;  1H88 C;  1XSV A;  4WF2 A;  4M3F A;  1U9O A;  5FKM A;  1H89 C;  3ZQI A;  2M7B A;  1JKO C;  4BU2 A;  2FEZ A;  4X0G A;  3J7Z I;  1K78 A;  2W57 A;  1ETV A;  1G3W A;  2W84 A;  2WB1 A;  5M3M J;  1WJD A;  2K9Q A;  3DTK A;  4YEL A;  3BPV A;  1TT0 A;  2E36 A;  5JLX A;  3WTY C;  3CDI A;  3DKW A;  1S6L A;  2DPU A;  3ISP A;  2E35 A;  2GQQ A;  5D5U B;  1FSH A;  2EFO A;  3K4B A;  2PQ8 A;  3GME A;  4KN7 X;  3BTI A;  4I01 A;  4U0Y A;  5E1Z B;  1YLF A;  2JA7 J;  3PIP F;  1ETW A;  4UVB A;  2E2J J;  4EM1 A;  2FML A;  4RB3 C;  1SVM A;  1OJL A;  2A5Y B;  2BYV E;  3PIO F;  2P81 A;  3H3Z A;  3HTU A;  1YJW I;  2E7W A;  1B1B A;  3V7R A;  3OYD A;  3HBL A;  2NOG A;  5H6R A;  2V9P A;  2FSW A;  5CVU A;  3AKZ A;  3K1N A;  3S17 J;  2IS2 A;  3LSI A;  3CJN A;  1APL C;  2LKP A;  3OYK A;  2EFN A;  2M87 A;  3H5A A;  3IL2 A;  2IJL A;  4KIF A;  3DKX A;  1TWF J;  4EJO A;  4X1E A;  1IZ1 A;  2XKO A;  4G94 A;  3GTO J;  3HOW J;  1EJ9 A;  2WAQ A;  5KNL A;  3LST A;  2V26 A;  3JRI A;  2LC2 A;  2HR3 A;  1LQ1 A;  2HXI A;  3QOD A;  2R92 J;  1R4M B;  2YSR A;  1E0E A;  4KIB A;  2AXT C;  2DFI A;  2QZ8 A;  3FM5 A;  5LRR A;  2X6Y A;  1JKP C;  2D5V A;  3ERM A;  4WWC A;  1TZL A;  4YFK F;  1P9Q C;  4CH7 A;  1YIJ I;  2M0C A;  4N0B A;  2DA6 A;  3KP4 A;  1YIT I;  1VQ8 I;  5TJJ A;  2UWM A;  3LQR A;  2K02 A;  4XSX F;  3JSP A;  3PNY A;  1MMS A;  4CYC A;  3IAS 2;  4AIJ A;  2GIZ A;  2GWR A;  5FFX A;  1J2X A;  3K4N A;  4DQ2 A;  3SFI A;  4AVZ A;  2ID6 A;  3S2D J;  3ZQF A;  1FC3 A;  3U9G A;  3LOC A;  2ELH A;  1QNT A;  4M74 A;  4RAG A;  3FIW A;  3C18 A;  4M9S A;  2AO9 A;  2A07 F;  1LFB A;  4BGD A;  4XMY A;  2XF7 A;  2LF7 A;  2L7Z A;  2PJR B;  1T56 A;  2L01 A;  3KCC A;  3RKQ A;  1CF7 A;  3E6B A;  5EEA A;  1OMI A;  3HOU J;  3B73 A;  5EEG A;  3K4M A;  3D0S A;  3IV5 A;  3J7A O;  3OS2 A;  3P9C A;  4IKF A;  1R36 A;  2CQX A;  4UUS B;  1SFE A;  4O6J A;  1S7A A;  3SZT A;  5HNH A;  2YS9 A;  2NOJ B;  1UEL B;  2MSY A;  1YOV B;  4LLL A;  3J7A Y;  4ZZL A;  3GTP J;  3OS1 A;  3ML6 A;  3BCA A;  4EJW A;  4C3H J;  5CKT A;  4MTE A;  3OYC A;  3C7J A;  2ELK A;  3OYG A;  2RV8 A;  5HNF A;  2GA2 A;  3TBI A;  3MCZ A;  1EKE A;  1SVO A;  3JRD A;  1W7P B;  5FJ8 J;  3DLA A;  1MNM C;  2IVM A;  5A2Q Z;  3GTK J;  1P6R A;  2K9N A;  2R7U A;  2TRT A;  3SZP A;  2E19 A;  5TGT A;  4AD9 A;  3TDZ C;  2F6C A;  2HDD A;  5ICC A;  2E34 A;  2K5C A;  4FE4 A;  4IX7 A;  4NHJ A;  2O8X A;  3F6O A;  4CZC A;  5AIP A;  1HST A;  2EIJ H;  3CLO A;  3B6C A;  4BY1 J;  1UHM A;  5F04 A;  1FP2 A;  2V9V A;  4D7M A;  3MAJ A;  4DNC A;  1H0M A;  1UZC A;  4HYE A;  1STZ A;  3ESW B;  3U2R A;  1MMD A;  1Z3Y A;  2Y0S A;  4HX4 A;  3KE2 A;  4CCO A;  1MMG A;  2V4J C;  3G1L A;  3Q9S A;  2XIG A;  1UG0 A;  2MD0 A;  2QKM B;  3PNT A;  1I1S A;  2IGO A;  2DOA A;  3KLO A;  2HOA A;  3BG5 A;  2DW4 A;  1BJA A;  1MKM A;  4HW0 A;  3SJM A;  3LNQ A;  3FXR A;  2GOM A;  1FP1 D;  3L2Q A;  5CJ9 A;  2FA5 A;  3KPH A;  4DYR A;  3E97 A;  2DXI A;  3KP6 A;  2ETH A;  1I3A A;  2EWN A;  1U8R A;  3N97 A;  3BG3 A;  2A5W A;  4PK4 A;  2COM A;  3G1M A;  3K2A A;  3KZI C;  4BEH B;  3HOV J;  1LKX A;  5ICG A;  1KU7 A;  2HZT A;  5HDG A;  4BUP A;  3I56 I;  2BGC A;  2NNY A;  3WG7 H;  2VIX A;  2X48 A;  2KJB A;  4PJ0 C;  1WH7 A;  1WI9 A;  3K0L A;  3F8M A;  4ENN A;  2LY2 A;  2W25 A;  3BZK A;  1G59 A;  4HZF A;  3OL3 A;  1YG2 A;  4PSW A;  2L7M P;  1ZN2 A;  2LDU A;  3VYR B;  2HS5 A;  2CV1 A;  2HDC A;  5LD2 C;  4XBF A;  2R0Q C;  3HHG A;  5DCF A;  1BR1 A;  2XAU A;  1KQ9 A;  4IRH A;  4Z2Y A;  1L0O C;  3FM3 A;  2XPV A;  3K7A J;  3MEX A;  3M4O J;  2X0L A;  1YI2 I;  1ZYR F;  1HKT A;  3GBG A;  1ZAR A;  2PLY A;  3I4M J;  2NS0 A;  5ILU A;  2JA8 J;  3ABM H;  3U1D A;  2QKL B;  2LKS A;  3A01 B;  2FRH A;  2ZXW H;  5TIS C;  1VQ4 I;  1FOK A;  2DOF A;  3PFI A;  2PN6 A;  1GXQ A;  4BEH A;  1TNT A;  5EEH A;  3HUG B;  1ZG1 A;  4XOP A;  1V5G A;  3V8J A;  2DPD A;  3TOB A;  2YU3 A;  3GWZ A;  3GXO A;  1IF1 A;  1KYZ A;  4M6X A;  4ANJ A;  5B1B H;  5CPR B;  1J75 A;  3ZCO A;  1H9G A;  2OD5 A;  5BOX A;  4U0V A;  1SD5 A;  3LSR A;  1Z91 A;  2D1H A;  1C0W A;  1JXS A;  4LB6 B;  1K4T A;  2G9W A;  4ZYA A;  2LTP A;  2M0M A;  2CRG A;  3AFH A;  4ENK A;  3AG3 H;  5HOO A;  3GTJ J;  3VSK A;  4HQE A;  3LSG A;  1V54 H;  2EB7 A;  3HZJ A;  1YHQ I;  2Z9O A;  2R7F A;  2HVQ A;  3TW6 A;  1MNE A;  2VJ5 A;  1BOB A;  5EJC A;  2DFH A;  4A0Z A;  3JTG A;  3IC7 A;  3R4K A;  1UG2 A;  2OQG A;  4YEJ A;  1XN7 A;  1MJ9 A;  2K9L A;  3FX3 A;  5D6E A;  2EV5 A;  2Y9Y A;  5KVR A;  4XRF A;  5IP7 J;  1R1T A;  2HNH A;  2CV0 A;  1X4O A;  1WCM J;  2DTR A;  4XM3 A;  1T6S A;  2F4M B;  3DP7 A;  3GFM A;  3H5N A;  2XDV A;  1A36 A;  2EIL H;  4KMU X;  4PJL A;  2LD5 A;  2R7X A;  1EH8 A;  1YE9 A;  5LRS A;  1Y8R B;  3OSF A;  1FIP A;  2YX7 A;  2XAS A;  5CVJ A;  3ZMZ A;  5GPC A;  1WJF A;  2CMP A;  3K2Z A;  4OU0 A;  3AL0 C;  1G2H A;  2OJE D;  3A03 A;  3WTZ A;  3MZY A;  5BPI A;  3IWZ A;  3ECO A;  1IAW A;  3O3K A;  3BZ6 A;  2JK3 A;  1K4S A;  1X2M A;  3QYB A;  4BQA A;  1KA8 A;  4HRI A;  1FOX A;  1VI0 A;  2Z1D A;  4NNJ A;  3DXJ F;  5EG0 B;  2WY7 Q;  4FQG A;  1EH6 A;  3G71 I;  4XLN F;  2DK5 A;  3S15 J;  4HX8 A;  3I5U A;  3QP6 A;  5FD5 A;  2DA1 A;  2ISY A;  4PUS A;  1OFC X;  3HIF A;  1GV2 A;  4OIN F;  3RKX A;  2F5V A;  2V7F A;  1D0X A;  2OQR A;  1U8B A;  3I59 A;  5LEJ A;  1J5Y A;  1GV5 A;  1IDY A;  5IYD J;  1HOM A;  3KX2 A;  2V1D A;  4CA0 A;  3OSG A;  1ETO A;  3ZPL A;  3DBR B;  3FBI B;  3WU1 B;  1YW9 A;  3CQZ J;  3HOZ J;  3KYC B;  4U7B A;  3LSP A;  4ITV A;  1GHC A;  3KYL A;  2OCC H;  2AXL A;  2XV4 S;  3JTH A;  1QRY A;  2VJI A;  4ETS A;  5EF6 A;  1LDD A;  1QHG A;  5LLQ A;  3JAM K;  4BYY A;  1X1B A;  5HLT A;  1VQ7 I;  1WGX A;  1PP7 U;  1WJE A;  1KON A;  4JX6 A;  1ZG3 A;  1I1G A;  2EZL A;  1EA3 A;  1X1A A;  3PNV A;  1Z3X A;  4I0A A;  2HQA A;  3DQV C;  1K6O A;  2R5Z B;  1G6N A;  5E3M A;  3BQZ A;  3BTC A;  4LIT A;  2LBF B;  4FET A;  1BW6 A;  1K6Y A;  4E7Z A;  1QQI A;  2QSH X;  3CC7 I;  1IN8 A;  2KRF A;  3VYT B;  4I2O A;  1WJB A;  4E7H A;  3E3V A;  1IXC A;  4GCV A;  5HLI A;  1LEA A;  1JJ8 C;  5H6Q A;  3KZZ A;  1XG1 A;  2VJJ A;  5F1J A;  5IT9 Z;  3LA2 A;  2DCE A;  3GCM A;  1R49 A;  5D5W B;  2O9L A;  3H3V K;  4JP0 A;  5DUK A;  1D8J A;  4C2M J;  3MVP A;  3K4L A;  4XKB A;  5GP9 A;  4QPQ A;  3WTX C;  2DJI A;  2X1D A;  3I71 A;  1LFU P;  1HBX G;  3BTJ A;  3VB2 A;  4I02 A;  3KP5 A;  2CSO A;  2X1E A;  1ZGJ A;  2DMU A;  3H9J A;  5F0C A;  3VPR A;  1KU3 A;  1YQA A;  2VKH A;  1E2X A;  3S2W A;  3CF2 A;  4BE1 A;  4EMS A;  2IS1 A;  2ADU A;  1KU9 A;  3HGY A;  4F52 A;  2EFQ A;  3ABK H;  2LRD A;  3X2Q H;  2GAU A;  5JVG F;  3BT9 A;  2YUS A;  2M45 A;  3ABU A;  2JSP A;  2OBP A;  4UVC A;  4A0Y A;  5J47 A;  2DU9 A;  1WH5 A;  2FXA A;  3GLX A;  3O6B B;  4BQN A;  4MEX F;  4Q48 A;  4CGZ A;  3CP2 A;  2ZME C;  1Z9C A;  4HV6 A;  1GDT A;  4S0H B;  4BDZ A;  3CP8 A;  4H0E A;  3ZXS A;  4XR6 A;  2CWE A;  3ASN H;  2Y30 A;  3JRF A;  3WU0 A;  1DQU A;  5D6F A;  4KFC A;  4NC6 A;  2O8K A;  2K3P A;  4MNU A;  3FBN B;  4A3M J;  1RKT A;  5BQT A;  4NC7 A;  4RMN A;  2KPM A;  3FDY A;  1MBG A;  5H2F C;  3FMR A;  1TWA J;  2DMP A;  1UST A;  4IHS A;  4Y52 J;  3BDD A;  1RNL A;  5L3C A;  1J7K A;  1OLT A;  2QUF A;  2WA0 A;  4BJ6 C;  3S1N J;  1XPX A;  1D1A A;  3RI4 A;  5J1Y A;  4BKX A;  4KT6 A;  3JRC A;  3NWS A;  1SC7 A;  3CDL A;  4FIS A;  4Y33 A;  3N05 A;  4CIC A;  4XOR A;  1KQ0 A;  2E1C A;  3QRF F;  1U3E M;  1JE8 A;  5JHU A;  4GRI A;  4OAZ A;  4MFD A;  3TQN A;  2XVC A;  2Q2E A;  3P9K A;  2HOS A;  2IT0 A;  3W6K B;  5FKL A;  2XAF A;  1W5T A;  2MBF A;  1DDN A;  5LEK A;  3CMA I;  2NNN A;  3LL7 A;  2XPU A;  2OZU A;  2QQA A;  2M5W A;  4D5F A;  2VBZ A;  1ETQ A;  1VQ9 I;  2ME0 A;  4OMZ A;  1HSJ A;  3HRS A;  2OCE A;  1HDD C;  1RR8 C;  1JGG A;  2VC0 A;  4BBR J;  5KAI C;  1XS9 A;  2FBH A;  2AQE A;  5F08 A;  2E2I J;  3DKY A;  4Y15 A;  1MND A;  2H27 A;  3HGG A;  3WG9 A;  3L2V A;  1E3O C;  4L0Y B;  2V1X A;  4A6D A;  1N25 A;  2MH2 A;  2IGM A;  3Q9V A;  5JHF A;  3LAJ A;  4E4H A;  1XD7 A;  4I6Z A;  1GUU A;  2W82 A;  1DUX C;  1I6X A;  1WHU A;  3WGH A;  4RGX A;  3HPH A;  3KLN A;  4XSZ F;  2Q2E B;  3C1D A;  2ZJQ F;  4M9Z A;  2E60 A;  3RSN A;  3W6J B;  2MD5 A;  4C2T A;  3K9T A;  5HLG A;  5GTH C;  4DBR A;  1AHD P;  5IOZ A;  2OC6 A;  2EPF A;  4M3B A;  5AIQ A;  2I5U A;  4D1Q A;  1IXS B;  2RAE A;  3OR2 C;  3OYB A;  3ABT A;  4XN3 A;  1DP7 P;  3BRO A;  1A31 A;  1X2N A;  3LFU A;  3QU6 A;  2O7O A;  4FT8 A;  2QSF X;  3CCY A;  2UXX A;  4KIG A;  5CVV A;  1BL0 A;  2JRT A;  1LVA A;  4XNF A;  1MSE C;  5E17 F;  1X3Z B;  2JN6 A;  4AIH A;  4B09 A;  2L0K A;  2ZJ2 A;  2MH9 A;  3QYE A;  4Y4R A;  3JSO A;  3CDH A;  1SFU A;  2V6E A;  1WWX A;  2X6W A;  1S7O A;  2K40 A;  2B0L A;  3KZY A;  3R6S A;  4AC0 A;  4OIO F;  1VF9 A;  4CHU A;  4N4N B;  1ACI A;  4HPQ A;  1G3T A;  1FWZ A;  3OYE A;  1VQK I;  2OUM A;  1ZH5 A;  2HOE A;  2LOO A;  3IH2 A;  2M8E A;  5F27 A;  2UZK A;  2P8T A;  1HDP A;  2F5D A;  3R60 A;  3HSR A;  5IP6 A;  2K3F A;  3DFG A;  2IGK A;  5GPA A;  4Z6Y A;  4NC8 A;  4C30 A;  2RNG A;  1D0Y A;  5E79 C;  1NK2 P;  2NVX J; 
#chains in the Genus database with same CATH homology
 3NEU A;  1O7F A;  4S05 A;  2ZBK A;  3SHF A;  1YYV A;  2NAZ A;  3I0T A;  5DCM B;  4KIC A;  1HW2 A;  2DLL A;  3G73 A;  2P7V B;  3GZ6 A;  1PUE E;  3GUD A;  1TTY A;  5FD6 A;  5D5V B;  2VOO A;  4BHC A;  4R8H A;  3J81 Z;  2EV6 A;  2HYF A;  5IT9 K;  1G3Y A;  5K1Y A;  4UV8 A;  4ENM A;  2RNJ A;  3LA3 A;  3GX4 X;  5JFR A;  2CGP A;  1SD6 A;  1HKQ A;  2H6C A;  1DPR A;  1ON1 A;  2HKX A;  4A0X A;  3GO5 A;  3K1P A;  3BJA A;  1RI7 A;  5E8I A;  1P2F A;  3JAM Z;  2VON A;  1F1Z A;  4YG2 F;  5J8C A;  4UVA A;  2MC3 A;  3E6C C;  1S8N A;  1ONV A;  4WXD A;  1R58 A;  3V7C A;  1H9T A;  4IRI A;  2PMH A;  2QBY A;  3M9A A;  3N4M A;  2BV6 A;  3PQK A;  3GZ5 A;  2ESN A;  1R7J A;  3EQL F;  4BHB A;  1FBU A;  1P4X A;  4Y17 A;  3EET A;  1R1V A;  4UNO A;  3CUQ A;  3MZH A;  3L2C A;  2V79 A;  1YO5 C;  1KYW A;  1B4A A;  5BPD A;  1B9N A;  4O3M A;  2QWW A;  2A6H F;  1TQP A;  2XHK A;  1QZZ A;  2HTJ A;  4QLC U;  2DT5 A;  1Z7U A;  2IRF G;  2STW A;  2R3S A;  3KP7 A;  1EH7 A;  1XMA A;  1ODD A;  3OOP A;  1XGM A;  4R79 A;  4Q4Z F;  4KNY A;  3BP8 A;  1FX7 A;  1U2W A;  1S3J A;  2K27 A;  3F8B A;  1UHW A;  2VOP A;  1G4D A;  2DBB A;  1MJA A;  3VFZ A;  2MLG A;  2DK8 A;  2MA3 A;  4RGU A;  2VXZ A;  3C3W A;  3WTT C;  4EJV A;  1HXD A;  1HW5 A;  1IRG A;  1KQ8 A;  3T1B A;  3WTW C;  5JR3 A;  2XRN A;  3H3U A;  4L9T A;  1TW3 A;  1Z6R A;  4CYD A;  1KU2 A;  1QZY A;  1B59 A;  1R5G A;  2LF8 A;  4N9I A;  5J8F A;  1YFH A;  3ZMT A;  2CW0 F;  1D3Y A;  5JVT A;  3VOE A;  4GXO A;  2RQP A;  4P5O A;  5CYV A;  4OOI A;  4I7H A;  1FSE A;  2PMU A;  4WXH A;  3GFI A;  1UCR A;  3DPT A;  3E5U A;  1W7P D;  2A69 F;  4ESJ A;  4YII A;  1O3S A;  2P6T A;  4GYG A;  1A04 A;  2VOD A;  2E1N A;  4EM2 A;  2HEO A;  2GXG A;  3QOP A;  3BPX A;  2EA4 A;  2K7L A;  3SFZ A;  3Q5F A;  1K79 A;  5DCM A;  5K5O A;  3BOQ A;  4MHG A;  2L4A A;  2EFW A;  4HDV A;  4LG0 A;  2HQR A;  4GO1 A;  4L9J A;  5F64 A;  1I5Z A;  4IF4 A;  1E17 A;  2Z33 A;  4BHP A;  3J80 Z;  5LBQ A;  1JHH A;  3R0A A;  1MD0 A;  4Q5S F;  3F23 A;  4BH9 A;  4Q47 A;  2HWV A;  5D8L B;  2K4B A;  3IHU A;  3BJ6 A;  5D5X B;  3LWF A;  4L5I A;  2FU4 A;  4EJT A;  2CQK A;  3RYP A;  1FYK A;  2XKP A;  3IWF A;  2RKH A;  5D4S A;  3DEU A;  2XAQ A;  5L3F A;  4EVI A;  1WRJ A;  2ZXJ A;  5BS6 A;  1ON2 A;  1RUN A;  4PGG A;  1MGT A;  1Z6T A;  4WK8 F;  3CUO A;  4R1H A;  3M8E A;  2D2W A;  5A2Q K;  4HF2 A;  1O3Q A;  4PGH A;  3AAF A;  2VBX A;  4ZYH A;  1EV7 A;  1L3L A;  1HKS A;  2OZ6 A;  3V8K A;  3L7W A;  3NQO A;  1QGP A;  1B6A A;  3E5X A;  4U88 A;  1Z05 A;  1QBJ A;  2J5P A;  3RKY A;  2UXN A;  3FXU A;  1SD7 A;  4LMY A;  3WOD F;  4E70 A;  3HRT A;  3L00 A;  5DEQ A;  1BI0 A;  2H6B A;  3CUQ B;  1MDM A;  5DD8 A;  5ERI A;  4RB0 A;  5HDK A;  1YIO A;  1TLH B;  1MJB A;  2ISZ A;  1P92 A;  3ERE D;  3F8N A;  3E6D A;  2A68 F;  2VBY A;  4GYI A;  4OIR F;  1LEB A;  5E1W A;  1D5V A;  5HVQ C;  3WTS C;  4HDU A;  3KEO A;  2ZO4 A;  2PI0 A;  2WWY A;  3SXY A;  1F4K A;  2EFP A;  2O6G E;  3V8L A;  3IRQ A;  3T8T A;  4Y13 A;  1FNN A;  2QM3 A;  1TQM A;  5L3E A;  1IUY A;  3EDP A;  1WQ2 A;  1P4W A;  3T0Y A;  2H94 A;  2Q0O A;  3VOD A;  2KJC A;  1FBS A;  2FNP A;  3TO9 A;  4UV9 A;  4GGG A;  2Z99 A;  2QLZ A;  2J5O A;  4PZJ A;  3V4G A;  2KIF A;  2RVC A;  3HRU A;  5HS9 A;  1IN5 A;  2VN2 A;  2XAG A;  4RAY A;  4AIK A;  2PFB A;  4LG0 B;  1QO0 D;  2LNB A;  4FHT A;  2HQN A;  1REP C;  2FBK A;  4L0Z B;  3I4P A;  2CFX A;  4FX0 A;  1RZ4 A;  2FMY A;  4WXC A;  3I54 A;  1XDU A;  5LGT A;  2DQL A;  5HDN A;  4G7Z F;  3K1M A;  4UUV A;  1XGS A;  2A3S A;  1I27 A;  1T38 A;  3GYH X;  4LLN A;  3LFK A;  4M6Y A;  4A12 A;  1J9I A;  4HA8 A;  1ULY A;  3DPL C;  1IXR C;  2ZME B;  4ZYE A;  1OYY A;  1BI1 A;  1OYW A;  4YFX F;  3ZMV A;  1FY7 A;  4IJA A;  1FYL A;  1XCV A;  4B8X A;  1FLI A;  4LK1 F;  2D1V A;  2HKO A;  3ULQ B;  2P5V A;  3J80 K;  1ZAO A;  2H09 A;  4JBA A;  1R5H A;  1BC7 C;  1ZHF A;  3WTU C;  4UXN A;  1PDN C;  1J0R A;  1UB9 A;  5IT3 A;  3E5Q A;  1Q1H A;  5L3B A;  3TO6 A;  1BI2 A;  4AWX B;  3KET A;  3CUQ C;  1GVJ A;  4CXF A;  4U7D A;  2ZME A;  1Z1D A;  2FF4 A;  2VC1 A;  3HTS B;  5DYM A;  2YR2 A;  1XCB A;  3BJO A;  1OR7 A;  3WGG A;  2P5K A;  4A6E A;  5ILS A;  4M9X A;  2F5E A;  4HLX A;  3ROU A;  4CZZ A;  3KP2 A;  4A5M A;  1B9M A;  1O3R A;  3GFL A;  1XGN A;  4U0W A;  3LA7 A;  4PDK A;  3F3X A;  4IRG A;  4HV5 A;  3ELK A;  3IRR A;  3RDI A;  5DV5 A;  4G7H F;  2K4J A;  1SAX A;  3CTA A;  4L5J A;  1DPU A;  4N9H A;  5FLX Z;  2ACJ A;  5DUI A;  4HBL A;  4EGZ A;  3LQQ A;  4XLP F;  1R00 A;  2KIM A;  5CVI A;  4JK1 X;  4LFU A;  3MFK A;  3B02 A;  1PP8 F;  4KN4 X;  3FZV A;  3RKW A;  1QPM A;  4O5V A;  3ZMU A;  1ZLJ A;  2V1U A;  1UFM A;  1V4R A;  1FPQ A;  4RS8 A;  4ZH4 F;  2JPB A;  4KUM A;  2ZNY A;  4KDP A;  1SMY F;  4EJU A;  5KK1 A;  3FMQ A;  4G6Q A;  5LHI A;  3E6M A;  3R61 A;  5CLS A;  1XGO A;  5HS7 A;  1USS A;  2ZKZ A;  4MQV A;  4RB1 A;  2XAJ A;  1BIA A;  4MTD A;  2NRA C;  1U5T A;  3NRV A;  5ILV A;  2CG4 A;  4CDG A;  1IN7 A;  1W4M A;  4G6D A;  1LDK B;  4F7Z A;  4I0B A;  2F2E A;  2IW5 A;  2VT3 A;  3F72 A;  4RAZ A;  3PQJ A;  5J6X A;  5K5Q A;  6PAX A;  3KP3 A;  2RGV A;  1XSX A;  2GZW A;  1BC8 C;  2P4W A;  2RC4 A;  1ZRE A;  3ZN0 A;  3WE3 A;  2CYY A;  3ZP5 A;  3QP5 A;  2DQR A;  2M30 A;  1YS7 A;  2QQ9 A;  3F21 A;  3H92 A;  4LGW A;  3RPU A;  3R0J A;  2P7C B;  2FQ3 A;  4P9F A;  4HAM A;  1SD4 A;  3QPT A;  2E7X A;  4LJZ F;  1SFX A;  1BI3 A;  3J81 K;  3WGI A;  1ZLK A;  2VE8 A;  1OYI A;  3ZMD A;  2KKO A;  2PG4 A;  4CO8 A;  1ZRF A;  4HOB A;  5ED4 A;  2KIU A;  4M72 A;  3F22 A;  1IN4 A;  1X3U A;  4M71 A;  4EV0 A;  3HHH A;  1U6G A;  3O2P E;  5TRD A;  2G7H A;  2RDP A;  3I58 A;  4JQF A;  1O3T A;  4RGR A;  2HGC A;  2Y0M A;  4EQQ A;  3RPQ A;  3FMS A;  5FO5 A;  4KA4 A;  2EJR A;  1XSD A;  2RN7 A;  5CVR A;  1CF7 B;  1BBY A;  1ZGA A;  1S29 A;  2WV0 A;  3T5X A;  3JW4 A;  3WE2 A;  5H20 A;  4MGR A;  4L9V A;  2VE9 A;  1FYM A;  1WSU A;  3SQN A;  5L3D A;  2A61 A;  5AON A;  3FXQ A;  1O7L A;  4HQM A;  4M73 A;  3EUH A;  4NB5 A;  1FZP B;  1JHF A;  2XRO A;  1R23 A;  4HF1 A;  4A2U A;  2OAZ A;  3RJP A;  4UHT A;  4S04 A;  2JZY A;  5L3G A;  3F8F A;  4ON0 A;  4LK0 F;  1ZRC A;  4EM0 B;  2GA1 A;  1K7A A;  5DDG A;  2P5L C;  1YW7 A;  1D8K A;  1TNS A;  1NHA A;  2W85 A;  2QVO A;  4FX4 A;  2STT A;  1Y0U A;  2FE3 A;  3BWG A;  2JT1 A;  4KYW A;  2XUB A;  2MLK A;  3HRM A;  3HYI A;  3FHZ A;  1MDM B;  1YW8 A;  5LGU A;  2F5C A;  4AVP A;  3MWM A;  3TOA A;  2QEN A;  2OA4 A;  2WC2 A;  4RGS A;  5F1R A;  4G8X A;  4OIP F;  4ESF A;  4ENJ A;  2QQB A;  3VEP A;  2BBY A;  5HLH A;  2WTE A;  5JI6 A;  3M7G A;  1W7P A;  2X4H A;  4RB2 C;  3COA C;  1KGS A;  3IKT A;  3TDU C;  3HOT A;  3K69 A;  1R1U A;  5E1X A;  3EYI A;  2JPC A;  2ZNZ A;  1LJ9 A;  3QAH A;  3OV8 A;  1AOY A;  5BMZ A;  3GEZ A;  2IP2 A;  1TQI A;  1V3F A;  3GFJ A;  4BXU A;  2NYX A;  2HTS A;  4HLY A;  3L9F A;  2GXB A;  5E18 F;  1U5T C;  1SMT A;  1IRF A;  4IXA A;  3CO7 C;  3MQ0 A;  3HSE A;  1ZG5 A;  3CO6 C;  4G9Y A;  4P55 A;  4I98 B;  1F9N A;  5DD4 A;  1O57 A;  1T0F A;  2Y75 A;  4L18 B;  2ZFW A;  2QBY B;  2CO5 A;  1YTY A;  3RIR A;  5E8G A;  3T8R A;  4ZYD A;  4OMY A;  5FGM A;  2O03 A;  4A5N A;  3GF2 A;  5HS8 A;  2VBW A;  2IPQ X;  2FBI A;  1P4A A;  4WX9 A;  4MEY F;  1IW7 F;  4YFN F;  3GW2 A;  4KMF A;  4IHT A;  2O0Y A;  4OIQ F;  5D4R A;  1T2K A;  2Y48 A;  2LSO A;  1J59 A;  2C6Y A;  3P7N A;  2BE5 F;  2PBI A;  4ZYG A;  3ZQ7 A;  1BM9 A;  2Z5U A;  1T39 A;  3KFW X;  2K86 A;  5LHG A;  2O3F A;  5FB2 A;  4I09 A;  4LD5 A;  2DO7 A;  2F5F A;  3I64 A;  5ICF A;  2PJP A;  1T98 A;  1XB4 A;  1W5S A;  3F6V A;  3RYR A;  3GVA A;  1XDS A;  3F8C A;  4MQ9 F;  4P9U A;  2HFH A;  2M1B A;  2XGX A;  3V7S A;  5LHH A;  3D5L A;  2EV0 A;  5F6F A;  1LDJ A;  3I59 B;  2JSC A;  3ZN1 A;  2IA1 A;  2PEX A;  3HUG A;  2HYG D;  3IKV A;  4HX7 A;  4L9N A;  1VTN C;  3ZMS A;  1LB2 A;  2EK5 A;  2ESH A;  1TW2 A;  2AS5 F;  3L09 A;  2IA2 A;  1ZRD A;  1MZB A;  1G3S A;  4HF0 A;  1TBX A;  2Z3Y A;  3HOS A;  2TDX A;  2A6E F;  3TGN A;  2V6C A;  3REO A;  1R22 A;  2G7U A;  3EYY A;  3DF8 A;  2Q8K A;  1WKM A;  2R7D A;  4G7O F;  1U78 A;  1OPC A;  1IN6 A;  4YIF A;  5FLX K;  2VT2 A;  1FBQ A;  3M1E A;  3TO7 A;  1BIB A;  3TKY A;  1RIO H;  4P96 A;  2P6S A;  2GIV A;  3FF5 A;  4D0P A;  1F5T A;  5LGN A;  1OKR A;  5K5R A;  2OU2 A;  3HSF A;  1AWC A;  1YS6 A;  3QU3 A;  1U5T B;  1CGP A;  2QYO A;  4PCQ A;  4BNC A;  1XMK A;  5FFZ A;  4K2E A;  4NQW A;  2BEO A;  5D8K B;  1HQC A;  2ZCW A;  4ESB A;  2FOK A;  4IPA A;  1LNW A;  2W24 A;  2DAO A;  3M8F A;  4KT5 C;  4LLG F;  2XAH A;  4ZZD A;  3G3Z A;  3FWE A;  1RUO A;  3LAP A;  1BOA A;  2YPR A;  1HW1 A;  2L54 A;  2L3D A;  2L4M A;  2O61 A;  3KEQ A;  5ICE A;  3P9I A;  2YX4 A;  1JGS A;  1FT9 A;  4WCG A;  4QWQ A;  4BAY A;  1GXP A;  4LB5 A;  2DI3 A;  4ASN A;  2FNA A;  3ECH A;  5E20 A;  2D45 A;  2L02 A;  4EGY A;  4IVN A;  3I53 A;  2JTV A;  1K78 B;  2EA2 A;  4TV7 A;  3DV8 A;  1BN5 A;  3RTR A;  3BY6 A;  3WTV C;  2IA0 A;  3QPH A;  1XSV A;  4WF2 A;  2FEZ A;  1K78 A;  2W57 A;  1G3W A;  2W84 A;  3BPV A;  3WTY C;  3DKW A;  1S6L A;  2DPU A;  3ISP A;  2GQQ A;  5D5U B;  1FSH A;  2EFO A;  2PQ8 A;  4KN7 X;  4I01 A;  4U0Y A;  5E1Z B;  1YLF A;  4UVB A;  4EM1 A;  2FML A;  4RB3 C;  2BYV E;  2A5Y B;  3H3Z A;  3HTU A;  2E7W A;  1B1B A;  3V7R A;  5H6R A;  2FSW A;  5CVU A;  3K1N A;  3CJN A;  2LKP A;  2EFN A;  2M87 A;  3IL2 A;  2IJL A;  4KIF A;  4EJO A;  1IZ1 A;  2XKO A;  4G94 A;  3LST A;  2HR3 A;  1LQ1 A;  2YSR A;  4KIB A;  2DFI A;  2QZ8 A;  3FM5 A;  5LRR A;  4WWC A;  4YFK F;  4N0B A;  3KP4 A;  2UWM A;  5TJJ A;  3LQR A;  2K02 A;  4XSX F;  3JSP A;  4AIJ A;  2GWR A;  5FFX A;  1J2X A;  4DQ2 A;  1FC3 A;  3U9G A;  2ELH A;  1QNT A;  4M74 A;  3C18 A;  4M9S A;  2A07 F;  2LF7 A;  2L01 A;  3KCC A;  1CF7 A;  3E6B A;  1OMI A;  3B73 A;  5EEG A;  3D0S A;  3J7A O;  3P9C A;  1R36 A;  1SFE A;  4O6J A;  1S7A A;  3SZT A;  4LLL A;  4ZZL A;  3ML6 A;  4EJW A;  4MTE A;  3C7J A;  2RV8 A;  2GA2 A;  3MCZ A;  1W7P B;  2IVM A;  5A2Q Z;  1P6R A;  3SZP A;  4AD9 A;  3TDZ C;  5ICC A;  4NHJ A;  2O8X A;  3F6O A;  5AIP A;  1HST A;  3CLO A;  1UHM A;  1FP2 A;  2V9V A;  3MAJ A;  4DNC A;  1H0M A;  4HYE A;  1STZ A;  3U2R A;  4HX4 A;  3KE2 A;  3Q9S A;  2XIG A;  1I1S A;  3KLO A;  2DW4 A;  1BJA A;  1MKM A;  4HW0 A;  3FXR A;  1FP1 D;  5CJ9 A;  2FA5 A;  3E97 A;  3KP6 A;  2ETH A;  2EWN A;  1U8R A;  3N97 A;  2COM A;  5ICG A;  1KU7 A;  2HZT A;  5HDG A;  2BGC A;  2NNY A;  2KJB A;  1WI9 A;  3K0L A;  3F8M A;  4ENN A;  2W25 A;  4HZF A;  1YG2 A;  1ZN2 A;  2LDU A;  2HS5 A;  2HDC A;  4XBF A;  3HHG A;  5DCF A;  1KQ9 A;  4IRH A;  4Z2Y A;  1L0O C;  3FM3 A;  3MEX A;  2X0L A;  1ZYR F;  1HKT A;  1ZAR A;  2PLY A;  2NS0 A;  5ILU A;  3U1D A;  2FRH A;  1FOK A;  3PFI A;  2PN6 A;  1GXQ A;  1TNT A;  5EEH A;  1ZG1 A;  2DPD A;  3V8J A;  3TOB A;  2YU3 A;  3GWZ A;  3GXO A;  1IF1 A;  1KYZ A;  4M6X A;  1J75 A;  1H9G A;  2OD5 A;  5BOX A;  4U0V A;  1SD5 A;  1Z91 A;  2D1H A;  1C0W A;  1JXS A;  4LB6 B;  2G9W A;  4ENK A;  5HOO A;  4HQE A;  2EB7 A;  2Z9O A;  2R7F A;  4A0Z A;  3JTG A;  3IC7 A;  3R4K A;  2OQG A;  1XN7 A;  1MJ9 A;  3FX3 A;  5D6E A;  2EV5 A;  5KVR A;  4XRF A;  1R1T A;  2DTR A;  1T6S A;  3DP7 A;  3GFM A;  4KMU X;  1EH8 A;  5LRS A;  2YX7 A;  2XAS A;  5CVJ A;  3ZMZ A;  3K2Z A;  4OU0 A;  3WTZ A;  3MZY A;  5BPI A;  3IWZ A;  3ECO A;  1IAW A;  3O3K A;  3BZ6 A;  4BQA A;  1KA8 A;  3DXJ F;  1EH6 A;  4XLN F;  2DK5 A;  4HX8 A;  3I5U A;  3QP6 A;  5FD5 A;  2ISY A;  3HIF A;  4OIN F;  3RKX A;  2OQR A;  3I59 A;  5LEJ A;  1J5Y A;  2V1D A;  3ZPL A;  3WU1 B;  1YW9 A;  4U7B A;  1GHC A;  2AXL A;  2XV4 S;  3JTH A;  4ETS A;  1LDD A;  5LLQ A;  3JAM K;  4BYY A;  1PP7 U;  1ZG3 A;  1I1G A;  1K6O A;  4I0A A;  3DQV C;  1G6N A;  1QQI A;  1IN8 A;  2KRF A;  4I2O A;  3E3V A;  1IXC A;  4GCV A;  5HLI A;  1LEA A;  5H6Q A;  3KZZ A;  5IT9 Z;  3LA2 A;  5D5W B;  1D8J A;  5DUK A;  3WTX C;  3I71 A;  1HBX G;  3VB2 A;  4I02 A;  3KP5 A;  2CSO A;  1ZGJ A;  1KU3 A;  1YQA A;  1E2X A;  3S2W A;  4EMS A;  2ADU A;  1KU9 A;  2EFQ A;  2GAU A;  2M45 A;  3ABU A;  2OBP A;  4UVC A;  4A0Y A;  2FXA A;  2DU9 A;  3GLX A;  3O6B B;  4MEX F;  4Q48 A;  4CGZ A;  1Z9C A;  4HV6 A;  4H0E A;  2CWE A;  3WU0 A;  5D6F A;  4KFC A;  4MNU A;  5BQT A;  3FMR A;  1UST A;  4IHS A;  3BDD A;  1RNL A;  5L3C A;  1J7K A;  2QUF A;  3RI4 A;  4CIC A;  1KQ0 A;  2E1C A;  3QRF F;  1U3E M;  1JE8 A;  5JHU A;  3TQN A;  2XVC A;  2Q2E A;  3P9K A;  2IT0 A;  3W6K B;  2XAF A;  1W5T A;  2MBF A;  1DDN A;  5LEK A;  2NNN A;  2OZU A;  2QQA A;  2M5W A;  2VBZ A;  4OMZ A;  1HSJ A;  3HRS A;  2VC0 A;  2FBH A;  4Y15 A;  2H27 A;  3WG9 A;  4L0Y B;  2V1X A;  4A6D A;  2MH2 A;  3Q9V A;  3LAJ A;  1XD7 A;  1DUX C;  1I6X A;  3WGH A;  4RGX A;  3KLN A;  4XSZ F;  3C1D A;  4M9Z A;  3W6J B;  2MD5 A;  3K9T A;  5HLG A;  5AIQ A;  1IXS B;  3ABT A;  1DP7 P;  3BRO A;  3QU6 A;  4FT8 A;  2UXX A;  4KIG A;  5CVV A;  2JRT A;  1LVA A;  5E17 F;  4AIH A;  4B09 A;  2ZJ2 A;  2MH9 A;  3JSO A;  3CDH A;  1SFU A;  1WWX A;  1S7O A;  3KZY A;  2B0L A;  3R6S A;  4OIO F;  4CHU A;  1G3T A;  1FWZ A;  1ZH5 A;  2HOE A;  2UZK A;  2M8E A;  2P8T A;  2F5D A;  3R60 A;  3HSR A;  3DFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...