4EM2A

Seleno-methionine staphylococcus aureus marr in complex with salicylate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
total genus 58
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em2A00
1BI2A 4S05A 4RB0A 4ZYGA 3D0SA 4ESJA 1BM9A 4B8XA 2K4BA 4HF2A 5JFRA 5LBQA 4G7OF 1FNNA 5LLQA 3ZMUA 1Z6TA 1UHWA 2L4AA 4KIGA 3WTUC 1O3QA 4FT8A 4AD9A 1QNTA 4P96A 2H6BA 1BI0A 3LQQA 1HQCA 5FD6A 3EETA 4RB1A 5LEJA 2IRFG 1IN8A 3FHZA 3KP6A 3U1DA 1R58A 2ZO4A 2DU9A 2DAOA 2V6CA 4HLYA 3F8MA 2PEXA 3ELKA 3FZVA 1P4AA 3RTRA 2XKOA 4BH9A 4IHTA 1Y0UA 3QRFF 3E3VA 4I0BA 2W25A 3RPQA 1TQPA 3M8FA 1J0RA 2DFIA 3WTYC 1L0OC 4M9SA 1XDUA 4I01A 4K2EA 4ENMA 3FXQA 4MTDA 2JZYA 2L3DA 4AIHA 2MD5A 3LA3A 2GA1A 1R1TA 1YYVA 2XUBA 4Y15A 5BS6A 4U0VA 2D1VA 3DFGA 4KN7X 2HOEA 2P5KA 1EV7A 1XN7A 4CO8A 1T98A 2DK8A 2PN6A 1T2KA 3JTHA 3T0YA 3Q9SA 1UHMA 4LLGF 5EEGA 3ZMSA 2Z9OA 2XAFA 5CVIA 5KVRA 4LD5A 4Y13A 2FBIA 4GYGA 3REOA 4S04A 4YFKF 4HBLA 1FYMA 2V1DA 1B6AA 5F64A 3SFZA 1P92A 3H3ZA 5ED4A 1TNSA 5L3DA 1B59A 1BI1A 3WGHA 2BBYA 3KP5A 4FX4A 1R00A 2L01A 1GHCA 4M71A 1U5TB 4ASNA 3IWFA 2HTJA 3DEUA 3MQ0A 1FSEA 3C18A 5K5QA 3I4PA 4IRGA 3KP2A 4A6EA 4HQEA 4I98B 2FEZA 2FNAA 3EUHA 3F8NA 3IKVA 4OIQF 3I71A 4LG0A 4IF4A 4G6DA 5DCMB 2FMLA 3I59B 3J81K 2DK5A 2IW5A 4ZYDA 1ZRDA 2A5YB 5H20A 2DLLA 2P6SA 2HQRA 1MD0A 2YPRA 4P9UA 3GZ5A 1O7FA 5L3CA 1BIAA 4RGXA 3KP4A 1IN4A 1KQ0A 3RKYA 2NS0A 2LF7A 2WWYA 4JBAA 4BHPA 4IRHA 4L9TA 3R4KA 1RNLA 3V8JA 2D1HA 3F3XA 1IN5A 2R7DA 2PJPA 1YTYA 1R7JA 3FM5A 1O3SA 2XRNA 4RB2C 2M45A 1OR7A 3F8FA 3JW4A 1YQAA 2EA4A 3ZMTA 2EJRA 4OMZA 4MNUA 3HOSA 3B02A 4HF0A 3BOQA 3N97A 3EYIA 4G6QA 5ERIA 4I0AA 4YIIA 4IJAA 2O61A 3F6OA 2ESHA 2A3SA 4M73A 2M5WA 3DPLC 2Z5UA 1B1BA 1O3TA 1HKSA 4OMYA 2Y48A 2DPUA 1T38A 2KJCA 1HBXG 3QOPA 4ESFA 1LDJA 1RUOA 4KMFA 5E8GA 2DQLA 2EV0A 5E1ZB 1P4XA 3F21A 3GFMA 2A6EF 1SD5A 4LLLA 3QU3A 2JTVA 3VFZA 5D4SA 3EQLF 3PFIA 4KUMA 2H27A 4P55A 3FMSA 2OD5A 3IC7A 5ICEA 1FZPB 3CUQB 2FXAA 3Q9VA 3JAMK 1QBJA 3E5QA 1B4AA 1K6OA 3E6MA 2PMUA 1YW7A 4M9XA 1MJAA 1FYKA 1ULYA 2A61A 2QVOA 3R0JA 2XV4S 4CXFA 2M30A 4FHTA 2E1CA 2MLGA 1U2WA 1H9GA 2XAHA 3RKWA 1UFMA 4EVIA 1QZYA 3LSTA 2JRTA 2IA1A 3HYIA 4O5VA 1SD6A 2JPCA 2HR3A 2UZKA 4EJOA 1OYYA 5FFXA 2LF8A 4HV5A 1KU7A 5JR3A 3Q5FA 3VOEA 3ZN0A 4UVCA 4QLCU 5CVVA 4XRFA 2CYYA 2F5CA 3TOAA 2FNPA 2EWNA 3BDDA 3HRTA 4O6JA 3PQJA 4OU0A 3HRSA 4RB3C 5E20A 1O7LA 1D3YA 1XDSA 2VONA 4N9IA 1LEAA 3NQOA 5DD4A 1W7PD 2QM3A 2OZUA 1XSDA 1R23A 3IKTA 1T39A 4M74A 1AOYA 3JTGA 5D6EA 4IRIA 1TBXA 2STTA 1NHAA 1HKTA 3OOPA 5AONA 5J8FA 1I27A 1W7PA 3L9FA 3M8EA 4WWCA 2G7UA 1WI9A 4LB5A 1GXQA 1ZARA 4KT5C 1IXSB 3MEXA 3P9CA 5CJ9A 4XLPF 1P2FA 5CLSA 5HS7A 1Z7UA 4QWQA 2J5OA 5CYVA 4M72A 2H6CA 1S6LA 2DO7A 3D5LA 3O2PE 4F7ZA 3FXUA 4UVAA 1RIOH 4LFUA 4HA8A 4ENKA 1ONVA 3CJNA 2FBKA 3JSPA 3MCZA 4CGZA 3FM3A 3KEOA 4BHCA 3DPTA 4OOIA 3KEQA 2K4JA 2YX4A 1JE8A 4HX7A 2QLZA 3WTSC 1XGSA 3HHHA 1R1VA 3BJOA 1PP7U 5LRRA 2E7WA 3FF5A 4PCQA 3WTWC 2K86A 4RGRA 1XGOA 4CZZA 1C0WA 4U7DA 2CG4A 2WTEA 3ZQ7A 4LMYA 3EDPA 1KYZA 2JT1A 2FOKA 2XAQA 1T0FA 1SD4A 3GLXA 5LHHA 4AIJA 1OYWA 2OAZA 3F72A 1ZGJA 2EFOA 1JHFA 4L18B 2HEOA 2KIUA 2QWWA 2HKOA 5L3FA 3QU6A 3ISPA 2VBXA 3TO7A 4D0PA 4U7BA 1REPC 2V9VA 3ZPLA 1TNTA 4EM0B 2VBWA 1F5TA 2IT0A 2B0LA 3GFJA 2Y0MA 4JQFA 1PDNC 2HS5A 5DEQA 5J6XA 4N9HA 2EK5A 2XVCA 1U6GA 2ZCWA 3CTAA 5F6FA 1RI7A 4M6YA 2F5DA 5TRDA 1B9NA 5BPIA 3OV8A 1XGMA 3HUGA 1TTYA 3BP8A 3GX4X 2K27A 3JAMZ 2PBIA 3RIRA 4OIOF 1IN6A 4OIRF 3L2CA 3WE3A 1JGSA 2NRAC 3ULQB 3FMRA 4KIFA 2DW4A 2VT3A 3C1DA 4HX4A 2FBHA 2F2EA 1U78A 1G3YA 1XD7A 2LSOA 1SFXA 4BHBA 2VBZA 2QBYA 3TGNA 2ADUA 1HW5A 2BE5F 3S2WA 4ZZLA 2Z33A 3MWMA 1KU9A 4GO1A 3K69A 5JVTA 1DUXC 1BJAA 4KDPA 5DYMA 3P9KA 1W4MA 5D5VB 3HIFA 5ILSA 4FX0A 2STWA 1CF7A 2ZMEA 1ZHFA 2J5PA 2XROA 1V3FA 4A0XA 3M7GA 1OYIA 2L4MA 2E7XA 1QO0D 4H0EA 2EFNA 3ROUA 1XSVA 5IT9K 2L02A 3SZPA 1BBYA 3G3ZA 4ETSA 1FOKA 1UCRA 2DI3A 3KCCA 1BN5A 2XAGA 4EJVA 4PDKA 5HDKA 1MGTA 2MC3A 2ELHA 4RAYA 2DTRA 1K7AA 4RGUA 3WG9A 5BOXA 1DPRA 1QZZA 3NRVA 4MGRA 4KYWA 4I2OA 2RC4A 2X0LA 4IHSA 4Q48A 4HDUA 4A12A 2MH2A 3V4GA 1A04A 1XGNA 2VC0A 4U88A 1KGSA 2LKPA 3GZ6A 1AWCA 1MDMB 1J75A 1I1SA 3C3WA 5E1XA 1D5VA 1U8RA 1WRJA 3KE2A 3LA2A 2HZTA 1IF1A 4WF2A 5JI6A 1KQ8A 5CVJA 1OMIA 2RQPA 3DP7A 3HHGA 4U0YA 3GFIA 4BQAA 2HKXA 1G4DA 2VN2A 4BNCA 1IXRC 2QQAA 3HSFA 2DQRA 2HYGD 4BXUA 3KZYA 3ZMDA 2ESNA 2E1NA 1K78B 3ECOA 5AIQA 5DUIA 2RNJA 3E6BA 3VB2A 1T6SA 3HTUA 1SAXA 5HLIA 1YW8A 2ISYA 3P9IA 2IP2A 4RS8A 5L3GA 2GXBA 3F6VA 1HSTA 4DNCA 1FP2A 4G7ZF 1J5YA 1Z91A 1V4RA 1I5ZA 1MZBA 3WTVC 4U0WA 5D4RA 3HSEA 4MEXF 4NHJA 1TLHB 1PP8F 2F5EA 1EH6A 3DQVC 3K1MA 4WX9A 3GFLA 3TKYA 3KFWX 2EFPA 1KU3A 5LGTA 2BYVE 2H94A 1YG2A 3G73A 2P5LC 1ZRCA 2EFQA 2FRHA 4AWXB 2A68F 3JSOA 2ZBKA 3WTXC 2HDCA 2HTSA 2V1UA 5DD8A 4YIFA 3C7JA 3L7WA 4CHUA 2HWVA 3TOBA 1ZN2A 3GVAA 3LA7A 4LK1F 2RVCA 3I5UA 3HTSB 4Y17A 3QPHA 1ON2A 3VEPA 3V7RA 3GW2A 4LK0F 5J8CA 3I58A 3WU0A 2KJBA 2D2WA 2KIMA 5LGNA 2BGCA 2XGXA 2HYFA 1MJ9A 4PGGA 2FU4A 3WU1B 4ON0A 3LAPA 1YIOA 2FA5A 5DCFA 3QAHA 3F22A 1XCBA 3FMQA 4YG2F 5FFZA 3ZMZA 2VODA 3TDUC 4L9NA 4PGHA 1FP1D 3CO6C 1F1ZA 3BJ6A 2P6TA 5D5XB 5D5UB 5E8IA 3F8BA 5L3BA 1B9MA 2HQNA 1ZG5A 1IZ1A 1VTNC 4NQWA 3V7CA 2UWMA 2ZNYA 1J59A 3M1EA 1KU2A 3N4MA 1KYWA 3T1BA 5IT9Z 4KA4A 1HW2A 5DCMA 3GEZA 1TW3A 3E5XA 3I59A 1SMYF 2NNNA 2RV8A 3MZYA 4HQMA 2MLKA 1YO5C 3GO5A 2FSWA 3R60A 5JHUA 1SMTA 4EM2A 2P7CB 2CSOA 5BQTA 4ENJA 2QENA 2P5VA 4KNYA 2OBPA 1E2XA 4A2UA 1WKMA 2AS5F 3QP6A 3BROA 3QP5A 4HOBA 4WXDA 2IVMA 1DDNA 2A6HF 1IW7F 3ERED 4Q47A 2KIFA 2CWEA 2ZJ2A 2Z99A 4ENNA 4ESBA 3F8CA 1XB4A 2L54A 4EQQA 2V79A 1I6XA 2R3SA 2ZKZA 2ZMEB 2BV6A 1XMAA 3MFKA 3B73A 1L3LA 2QUFA 3ZP5A 4GYIA 2UXNA 4E70A 3CUQC 3T8TA 2O3FA 1FT9A 4KFCA 4OINF 2AXLA 2GWRA 1BIBA 2FQ3A 2QQBA 5D8KB 3RYPA 1ZG3A 4G7HF 5LHIA 2IPQX 4L9VA 4B09A 4LGWA 5EEHA 3SHFA 3I53A 1ZGAA 2A69F 1JXSA 1USSA 1IUYA 3CUQA 3WODF 3RJPA 1TW2A 3RYRA 1EH8A 4Q4ZF 1S7OA 3O3KA 5FLXZ 2PFBA 3H92A 2XKPA 4L5IA 5K1YA 2VOPA 1TQMA 3BJAA 1FC3A 3LQRA 1DPUA 3EYYA 2YSRA 2VT2A 1IRGA 1TQIA 1RUNA 4LG0B 4UV9A 4WXHA 3R6SA 3K1NA 4A0ZA 3L09A 4HW0A 4WK8F 1R1UA 1O57A 4MQVA 3E97A 3IL2A 4EV0A 2GXGA 1R22A 1PUEE 5TJJA 1JHHA 3IRQA 2QQ9A 4LB6B 2Q0OA 4GGGA 3K0LA 3KLNA 3PQKA 4YFNF 4CDGA 1BC8C 4KMUX 1FBUA 1Z9CA 3RKXA 2VC1A 2ISZA 2RGVA 2VBYA 5E1WA 4DQ2A 1S3JA 1ODDA 1SD7A 4M9ZA 2XAJA 4XLNF 5FB2A 3CO7C 4WXCA 1LDDA 1XMKA 5HS9A 1BI3A 4HLXA 1LEBA 5CVUA 5HLGA 3H3UA 4A6DA 5CVRA 1KQ9A 4HV6A 3TDZC 3P7NA 5LGUA 4PZJA 4N0BA 4LLNA 3VODA 1IRFA 3GXOA 2WV0A 2MH9A 1YS6A 5HVQC 3BPVA 5LHGA 2IJLA 3NEUA 2RN7A 3I0TA 2KRFA 4HAMA 3GWZA 2ACJA 2QYOA 3BY6A 3K9TA 4UV8A 5KK1A 3HRMA 3LWFA 2EB7A 3U2RA 3HOTA 4EJUA 4XSZF 6PAXA 4GXOA 3MAJA 1U3EM 3U9GA 2MBFA 4HZFA 3E6DA 2ETHA 2M1BA 4CYDA 4EJTA 2WC2A 4A5NA 4R8HA 2OQRA 5AIPA 5DUKA 2O03A 2EV6A 2CFXA 4HDVA 5LEKA 1S7AA 2W84A 4Z2YA 2XIGA 3W6JB 3QPTA 4JK1X 2P7VB 5D6FA 4R79A 5F1RA 4HYEA 3FX3A 3DF8A 1IXCA 3L00A 4IXAA 2GAUA 3SZTA 3BPXA 3J80Z 4KIBA 4KICA 4A5MA 5DDGA 4G94A 1BC7C 1ZG1A 1OKRA 2H09A 4UNOA 1UB9A 1HXDA 1Q1HA 1O3RA 5D8LB 1ZAOA 1WQ2A 4RAZA 1HW1A 2C6YA 1R5HA 4ZYHA 1YW9A 1YS7A 2RKHA 1ZLKA 2GIVA 1FYLA 1K79A 5HOOA 4WCGA 3F23A 4UUVA 3RDIA 2OQGA 5E17F 1J9IA 3TQNA 1ZREA 2W24A 2XHKA 2Q8KA 4L0ZB 3R61A 3WGGA 2YX7A 2OU2A 4AVPA 1FSHA 2PQ8A 4UXNA 1X3UA 3V7SA 3ZN1A 3SXYA 4KN4X 5HDGA 5A2QK 3T5XA 2QZ8A 1SFEA 3KP3A 4ZH4F 2DPDA 1Z6RA 2W85A 2ZXJA 1WSUA 1QQIA 1J2XA 3I54A 5K5OA 1P6RA 2PLYA 3HRUA 1W7PB 2CO5A 5FLXK 5IT3A 1Z1DA 2Y75A 4G9YA 2XASA 2IA0A 2K02A 3CLOA 3DXJF 4L5JA 3LFKA 1E17A 2K7LA 1J7KA 2M87A 3FXRA 1ZH5A 4UHTA 3I64A 3RI4A 1FY7A 1SFUA 2FF4A 2Q2EA 3MZHA 2RDPA 2NNYA 3GF2A 4M6XA 4L0YB 2O0YA 4YFXF 4HX8A 3TO9A 2EA2A 1D8JA 1MKMA 4G8XA 2A07F 3WGIA 4I02A 1F4KA 5BMZA 3R0AA 2VXZA 1ZRFA 4EMSA 2VOOA 1W5SA 2V1XA 1STZA 2PI0A 3IHUA 4EJWA 2CQKA 1CGPA 1U5TC 3DV8A 3M9AA 3IWZA 5H6QA 5ICCA 4XBFA 2IA2A 5FD5A 4BAYA 2PG4A 5D5WB 1YFHA 5H6RA 3TO6A 3COAC 3KLOA 1S8NA 1MJBA 4EGZA 2ZFWA 4GCVA 1H0MA 1LDKB 1ZYRF 1U5TA 4EM1A 2X4HA 1RZ4A 1G6NA 3BWGA 4R1HA 5ILUA 1F9NA 4OIPF 1FX7A 2JPBA 2NAZA 4A0YA 5HS8A 2D45A 3E6CC 1MDMA 2CGPA 2YU3A 2NYXA 2VE9A 1S29A 1FPQA 5ICFA 1D8KA 2P8TA 3WE2A 4I09A 1GXPA 3CUOA 5FGMA 2F5FA 1LB2A 2LDUA 3KETA 4LJZF 4ZZDA 2FMYA 1HSJA 2PMHA 3K2ZA 3KP7A 2R7FA 1EH7A 4EGYA 3ABTA 2VE8A 3HSRA 1QGPA 4UVBA 4TV7A 2DBBA 4MQ9F 1R5GA 1FBSA 1K78A 1G3WA 2GQQA 1IAWA 2G9WA 4MHGA 4IVNA 1G3SA 4P9FA 2QBYB 4P5OA 2OA4A 1LNWA 5L3EA 4O3MA 4XSXF 2YR2A 3AAFA 4MTEA 3J80K 1QPMA 3SQNA 1DP7P 1LQ1A 3T8RA 1IN7A 2JSCA 1LJ9A 3ECHA 2MA3A 3J7AO 2HGCA 3K1PA 1ZLJA 1YLFA 1CF7B 2TDXA 5FO5A 1G3TA 3IRRA 2BEOA 2EFWA 3WTZA 3W6KB 3BZ6A 5HLHA 5HDNA 2GA2A 3GYHX 2CW0F 2OZ6A 5BPDA 3LAJA 2Z3YA 3FWEA 5ILVA 3KZZA 1OPCA 1FBQA 1R36A 3J81Z 5ICGA 1ON1A 1W5TA 2O6GE 1Z05A 2M8EA 4RGSA 2GZWA 2UXXA 4BYYA 3V8KA 3RPUA 4L9JA 3ZMVA 4AIKA 2W57A 2COMA 4IPAA 3GUDA 5K5RA 5A2QZ 3V8LA 1FWZA 1LVAA 1FLIA 2ZNZA 4Q5SF 2FE3A 4CICA 5DV5A 3ML6A 1XSXA 4HF1A 3DKWA 3O6BB 2HFHA 2P4WA 3WTTC 1P4WA 2KKOA 1BOAA 4NB5A 2LNBA 4MEYF 5E18F 4I7HA 2EV5A 5LRSA 3E5UA 2DT5A 1KA8A 1I1GA 4ZYEA 2G7HA 1HKQA 1H9TA 3CDHA 3ABUA 1WWXA 1XCVA 2O8XA 1GVJA 1USTA
chains in the Genus database with same CATH superfamily
4CCMA 3DTKA 3OYMA 1BI2A 1YE9A 4S05A 4RB0A 4KJZA 2Y0SA 4DW6A 3M8JA 1G8XA 4ZYGA 3D0SA 4ESJA 1BM9A 3OYJA 4B8XA 2K4BA 3C2HA 4HF2A 5JFRA 5LBQA 2HOTA 2XPUA 1N77A 4G7OF 1QVTA 1FNNA 5LLQA 3ZQIA 5M3FJ 5C4JJ 1UHSA 1P7JA 1MNDA 4FCYA 2E1MB 2HPIA 4JX5A 3ZMUA 1Z6TA 5IOYA 1FOYA 1UHWA 3ZGKA 2L4AA 4D7NA 4KIGA 3WTUC 4BACA 1O3QA 1BR4A 1TT0A 4FT8A 4AD9A 1QNTA 3G1OA 4P96A 2H6BA 1BI0A 3Q0VA 3FKIJ 1RC9A 4DZJA 4EEFG 3LSRA 2COBA 3LQQA 1HQCA 1ORKA 5FD6A 3M4OJ 3EETA 3ESWB 5LEJA 4RB1A 2IRFG 1IN8A 3FHZA 3KP6A 3H5AA 2BY3A 3CD6I 4C30A 3RSNA 2ZB9A 3U1DA 2L9NA 1R58A 2X48A 5DM6F 1RR8C 2ZO4A 2XPVA 4QIWN 1K4TA 2DU9A 2DAOA 2DODA 2V6CA 4HLYA 3F8MA 4UUTA 2PEXA 3ELKA 3FZVA 2E5NA 2TCTA 1P4AA 3RTRA 3BG7A 3ABLH 2XKOA 3DLAA 3Q0WA 3K4BA 1JKQC 3JRDA 4BH9A 3W2WA 4IHTA 1Y0UA 4AUXA 4X1EA 3QRFF 3E3VA 4A3DJ 4I0BA 2W25A 3RPQA 1TQPA 3M8FA 3OR1C 1J0RA 2DFIA 1I3QJ 3WTYC 2ICWG 1L0OC 4M9SA 1XDUA 4I01A 4K2EA 5F0FA 3W3CA 3JCUC 3FXQA 2VLAA 2R5ZB 4MTDA 4ENMA 3GTLJ 1OQYA 2JZYA 2L3DA 4ZC3A 4AIHA 2MD5A 3LA3A 4HSRA 2DXIA 3G6EI 2GA1A 3LOCA 1BW5A 1R1TA 5IP9J 1YYVA 4S0HB 2XUBA 4Y15A 5BS6A 3IAM2 2RAEA 1V5EA 4U0VA 2D1VA 3DFGA 4KN7X 1JUPA 2VJ4A 2HOEA 2P5KA 3S2DJ 1EV7A 4XKWA 1XN7A 3FDYA 4CO8A 1T98A 2DK8A 2XGEA 2PN6A 1YI2I 1T2KA 1UG0A 3JTHA 3HOWJ 2XGDA 3T0YA 5FJ8J 3Q9SA 2LTPA 2V4JC 1UHMA 4LLGF 5EEGA 1ZR4A 3ZMSA 2Z9OA 2XAFA 5CVIA 5KVRA 2JA5J 4IHVA 3CJRB 2A6TA 1FEXA 4LD5A 4Y13A 2FBIA 4GYGA 3REOA 1NK3P 4S04A 2HQAA 3SEZA 3MN2A 1ZKGA 2QA4I 3CJTB 3CMMA 2MGQA 1LFPA 2DDAA 4BJ5C 3OYNA 4YFKF 4HBLA 2MABA 1FYMA 2V1DA 1B6AA 4NC6A 1U8BA 1MBFA 2NVTJ 5F64A 3SFZA 1ETXA 1P92A 1V5FA 4E7JA 3H3ZA 5ED4A 2MFZA 2CJJA 1TNSA 2K9SA 4A3EJ 2E35A 3EUHC 5L3DA 4CSWA 1B59A 2LVSA 1BI1A 3WGHA 3K6GA 4M3BA 2BBYA 2P0WA 3HOXJ 3DTEA 3JRBA 3OWTA 3KP5A 4JYKA 2CQXA 4FX4A 1R00A 2L01A 2AXTC 1S72I 1GHCA 4M71A 2Y9YA 3DU5A 1GT0C 4A3KJ 1U5TB 4ASNA 3IWFA 2HTJA 3JRCA 3DEUA 4XRMA 3MQ0A 2GLOA 1FSEA 3GMEA 4MIMA 3RQIA 1WJBA 3C18A 5K5QA 1ERDA 4PJNA 1Y0NA 1QPIA 1PYVA 2KIQA 3I4PA 4IRGA 3KP2A 4A6EA 4CCJA 4HQEA 4I98B 1ZQ3P 2FEZA 4HPQA 4PK4A 2VJJA 2FNAA 3EUHA 2CUFA 3F8NA 3IKVA 5J1RA 1MMAA 1WCMJ 5HLTA 2I5UA 2ZJPF 4OIQF 3I71A 4LG0A 1VQ9I 2OTLI 4IF4A 3OSFA 1JUMA 1IO2A 4G6DA 5DCMB 4BL0B 1X2MA 4DYQA 2FMLA 2E2HJ 2L7MP 3I59B 3J81K 1UG2A 2DK5A 2IW5A 4ZYDA 4C2MJ 1ZRDA 2A5YB 5H20A 2DLLA 1DU6A 2P6SA 4RBOA 2HQRA 1MD0A 2YPRA 4P9UA 3GZ5A 1O7FA 1OR7C 3GTMJ 1N75A 2IS4A 5L3CA 1BIAA 4ZTJA 3GCMA 4RGXA 4BE1A 3KP4A 1IN4A 1KQ0A 2CQ7A 3RKYA 1I6HJ 3OYCA 3HOZJ 1F43A 2NS0A 4ANJA 1WJ5A 2LF7A 2WWYA 4JBAA 2QSFX 4BHPA 1IV8A 4IRHA 4NUBA 3W2AA 4L9TA 3R4KA 3S1NJ 4DOZA 1RNLA 3V8JA 2D1HA 4EATA 3F3XA 1FOXA 1Z3YA 1IN5A 2F4IA 2R7DA 4RAFA 2R5YB 4J00A 2PJPA 4ITVA 1YTYA 1R7JA 3E1SA 1GDTA 3FM5A 2F4OB 3W6VA 5GAEJ 2PJRB 1O3SA 2XRNA 4RB2C 2M45A 1OR7A 1IRZA 5LFAA 3F8FA 3JW4A 1YQAA 2EA4A 3ZMTA 3K2AA 2EJRA 3V42A 2MYSA 2JJ7A 3BLYA 4OMZA 4MNUA 3HOUJ 1TZLA 3HOSA 3B02A 4HF0A 3BOQA 4FE4A 3N97A 3EYIA 4G6QA 2ME6A 5ERIA 4I0AA 4YIIA 2W4SA 3WG7H 1IG7A 5FKNA 1SAUA 2OCCH 3H36A 2VQHA 4IJAA 3HKZN 2LBFA 3OYGA 2O61A 4XNFA 1NH3A 3HPGA 3F6OA 2ESHA 4M3EA 3HB9A 1SC7A 2A3SA 4M73A 3S1QJ 1WHUA 4P1WA 3LSMA 2M5WA 3DPLC 3HG9A 2XB5A 2Z5UA 1B1BA 4E4HA 2JWTA 5FRNA 3L2QA 1O3TA 1HKSA 3DKYA 2HNHA 2MSYA 3PFYA 3Q3SA 2Y48A 3VDXA 4OMYA 2DPUA 1T38A 5K7HA 2KJCA 2X9DA 2JA8J 1HBXG 2BHYA 1T08B 3QOPA 1M1EB 4BXXJ 4ESFA 3TP0A 4DBRA 4HRIA 2M9HA 1LDJA 1RUOA 4KMFA 1H88C 4XR6A 5E8GA 4DIQA 5FLVA 2DQLA 2EV0A 5E1ZB 3BG5A 4V2GA 1P4XA 2DFEA 3F21A 3GFMA 2A6EF 1SD5A 4LLLA 1R6RA 3QU3A 1PUFB 1QU3A 2JTVA 2Y31A 1QVUA 2R7VA 3AG4H 4GFBA 3VFZA 5D4SA 3CC7I 3EQLF 3PFIA 4KUMA 2H27A 4P55A 1UJ8A 3J7YJ 3FMSA 1I50J 2OD5A 1ACIA 2LY1A 3IC7A 2L9RA 5ICEA 2VASA 1FZPB 3CUQB 3Q0UA 2FXAA 3OIPA 3H0DA 1Q1VA 1SVMA 4GRIA 3S3OA 3Q9VA 1GVDA 3K4MA 3JAMK 2ZJQF 1QBJA 3E5QA 2KFDA 2WY8Q 4FASD 1B4AA 2LYCA 3RKQA 3FBNB 2R7OA 5E79C 1K6OA 3E6MA 3TL4X 2PMUA 1YW7A 3BR5A 4M9XA 1MJAA 1MBKA 2IEKA 1N25A 1FYKA 1ULYA 2A61A 2QVOA 1Z0XA 3A01A 4CCOA 3H35A 3KX2A 3R0JA 2YU9J 3OR2C 1FOWA 2XV4S 3HKZA 3O8GA 4W97A 1VQMI 4CXFA 2V9KA 2M30A 4FHTA 2E1CA 1Y39A 2MLGA 2YUSA 1U2WA 3KIOA 4DBQA 1H9GA 2XAHA 3RKWA 1UFMA 4EVIA 1QZYA 3LSTA 4F92B 2JRTA 4IHXA 2IA1A 3HYIA 4O5VA 1LE8B 1JT0A 1SD6A 3CF5F 2JPCA 4B4CA 2HR3A 4FQGA 2AQEA 2UZKA 4EJOA 1OYYA 2QCOA 1HCRA 5FFXA 4II3A 3LSIA 2WAQN 2LF8A 4HV5A 5F0HA 2OF7A 4XN0A 1KU7A 5JR3A 4YIRX 3VOEA 3Q5FA 3ZN0A 1WH7A 4UVCA 5DTDA 3QWLA 1OCZH 4F55A 1WJCA 4QLCU 5CVVA 1JJ6C 3HPHA 1OCPA 2NVXJ 1E0EA 5IPAA 4XRFA 4NDLA 2CYYA 2MW8A 2CW7A 4BJTA 2F5CA 3TOAA 2FNPA 3BDDA 1XC5A 2EWNA 3HRTA 2K85A 4O6JA 2D5VA 3PQJA 4E7HA 4OU0A 2JUCA 2EIKH 3HRSA 4RB3C 5E20A 5J1YA 4Y4RA 5JLXA 1CQTA 1O7LA 1D3YA 1XDSA 4PJMA 2VONA 3GTPJ 1ETYA 4N9IA 1LEAA 3K4NA 3CCYA 4MLOA 3NQOA 3OIQA 5CQEA 5DD4A 3P5JA 1XPXA 5EYRA 1WFXA 1W7PD 2E36A 2LC2A 2CUEA 1LKXA 3OIOA 3VSLA 2QM3A 2OZUA 1U9OA 1XSDA 1R23A 3IKTA 3CC4I 1T39A 2LG4A 3I56I 1WI3A 5GPCA 4M74A 1AOYA 3JTGA 1WJEA 5D6EA 2WAEA 4IRIA 1TBXA 2STTA 2HQ5A 1NHAA 2ZSHB 5EZHA 4RLQA 1HKTA 3OOPA 5AONA 2CW8A 2H8RA 5J8FA 1I27A 2LRDA 1W7PA 5GAGJ 4X0GA 1QZEA 3L9FA 3M8EA 5GADJ 4WWCA 3CCEI 2G7UA 2WA0A 4F3QA 2XF6A 1WI9A 4LB5A 4XICA 1GXQA 1Z67A 2H8WA 1ZARA 2Y0SN 4KT5C 1IXSB 5B5EC 3MEXA 5J40A 3P9CA 1QHHD 5CJ9A 5GTIC 1E3PA 2WAQA 5F1JA 4XOTA 4XLPF 2IXSA 1P2FA 2X6WA 1MBEA 5CLSA 5HS7A 2DA1A 1Z7UA 1MH4A 4QWQA 1MSFC 2J5OA 3EPZA 1T8IA 5CYVA 4M72A 4I76A 1BL0A 2H6CA 1S6LA 4C9YA 1XTAA 2DO7A 2MD0A 3D5LA 3O2PE 4F7ZA 3FXUA 4UVAA 1XMXA 1RIOH 1VQ8I 4LFUA 3ZQQA 4HA8A 4ENKA 2GXAA 2OV7A 1ONVA 3A4CA 3CJNA 2FBKA 1G2HA 3JSPA 2F6CA 1IV6A 3MCZA 4CGZA 3FK7A 5C3EJ 1XS9A 3FM3A 3KEOA 3DPTA 4OOIA 4BHCA 1IGNA 3KEQA 1I3AA 2WADA 3IUOA 2K4JA 2YX4A 1HLVA 1JE8A 1Z7LA 4IEJA 5FKMA 3OYDA 2CH0A 4HX7A 3IP4B 1SEUA 2QLZA 1GV5A 3WTSC 3RCOA 1XGSA 3HHHA 1R1VA 3BJOA 3CCSI 1PP7U 5LRRA 3K7AJ 1EA3A 3U1KA 2E7WA 4BDYA 1T0FC 2Z16A 2ME0A 4C2UA 2LY9A 1VI0A 3PM1A 2KP6A 3FF5A 4PCQA 3WTWC 2HOSA 2K86A 4RGRA 1XGOA 4CZZA 2CRGA 2HVQA 1C0WA 3PUBA 4U7DA 2CG4A 2WTEA 1VQNI 3LFUA 3ZQ7A 1MNEA 4LMYA 3F9KA 3EDPA 3BR3A 1KYZA 2JT1A 2VKDA 3I55I 3KYLA 3K10A 4QSHA 4A93J 4BBRJ 4NNJA 3UKGA 2FOKA 2VPRA 3OSGA 3BQZA 2Z1DA 2XAQA 2BY0A 4DZPA 3FKJA 1T0FA 1FMWA 4BQOA 1SD4A 3OS0A 3GLXA 5LHHA 4AIJA 1JJ8C 1OYWA 2OAZA 4LOCA 3F72A 2QSHX 1R4MB 1ZGJA 2EFOA 1JHFA 5IP7J 2R93J 2K5CA 4L18B 2HEOA 2KIUA 1B72B 2QWWA 2Z2SB 2HKOA 1RPWA 2M3AA 3M07A 5L3FA 2IS1A 3QU6A 3ISPA 2DN0A 2VBXA 3TO7A 2KISA 4D0PA 4U7BA 3OYKA 1MBJA 1REPC 2V9VA 3ZPLA 1TNTA 2FQ4A 4EM0B 3ZR8X 5B66C 2VBWA 1F5TA 1FTTA 3ERMA 2KL4A 2IT0A 2B0LA 3GFJA 3C2BA 2EIMH 2Y0MA 4HNUA 2L7KA 5EG0A 4JQFA 4C3IJ 2OCEA 1PDNC 1MBGA 4IHWA 5FKLA 2HS5A 2IGKA 1Y8QB 2NVQJ 1R5ID 5DEQA 4BY7J 5J6XA 1YJ9I 4N9HA 3PO3J 3HL2A 2EK5A 3SDGA 1DU0A 3CTAA 2WAFA 1U6GA 2XVCA 2ZCWA 3LSJA 4G12A 5F6FA 1RI7A 3EUAA 4M6YA 2KDOA 2F5DA 2M0MA 4XMYA 5TRDA 1B9NA 2VQCA 5BPIA 3OV8A 1XGMA 2ELKA 3HUGA 1TTYA 3BP8A 3GX4X 2K27A 3JAMZ 2PBIA 3RIRA 1ZELA 4XN3A 3ZQGA 1IN6A 4OIOF 4OIRF 3L2CA 1MMNA 3WE3A 1JGSA 2NRAC 2F48A 3ULQB 3FMRA 3HGYA 4CYCA 3PIPF 1DQUA 4KIFA 2DW4A 3GTJJ 2VT3A 3C1DA 4HX4A 3BT9A 1ZTRA 2FBHA 4LG3A 2F2EA 4PUSA 4RLFA 1WJDA 3KYDB 1U78A 1FMVA 1OCOH 4H4KC 1G3YA 1XD7A 4AVZA 2LSOA 1SFXA 4BHBA 2XC7A 2VBZA 2QBYA 2XSDC 4AC0A 1XG1A 2ZMEC 2LBFB 3TGNA 2O7OA 3CMEI 2ADUA 4XRSA 2NS8A 1HW5A 2BE5F 5F04A 3S2WA 4ZZLA 2Z33A 2M34A 3MWMA 3I4NJ 1KU9A 4GO1A 1MH3A 3K69A 5GAHJ 3PNYA 5JVTA 3LSGA 4IKFA 4E7IA 1DUXC 1TWHJ 1BJAA 2DA2A 1PJRA 5DYMA 4KDPA 4HG2A 3P9KA 3ZCOA 2HVSA 1W4MA 2BVMA 5D5VB 3HIFA 5ILSA 2Q2EB 3BTIA 3OMYA 2XF7A 1H89C 5CKTA 1K83J 4FX0A 2STWA 1V5GA 1CF7A 4BEHA 2ZMEA 1ZHFA 2J5PA 1D5YA 2XROA 1V3FA 2W48A 4A0XA 1EJ9A 2X1EA 1VFCA 3VWBA 4J19A 3CZ6A 3GBGA 2LKSA 3M7GA 1OYIA 2L4MA 2E7XA 3PNTA 2LKXA 1BA5A 1QO0D 4XIDA 5EGOA 3CMYA 4H0EA 1X1AA 2JVGA 2EFNA 3ROUA 1XSVA 5IT9K 2L02A 1R49A 3SZPA 3F0CA 4BY1J 5M5XJ 1BBYA 2W7NA 3G3ZA 4ETSA 1FOKA 1UCRA 5J1UA 1WH5A 2DI3A 3KCCA 4A3LJ 1BN5A 1VQLI 2XAGA 2Y30A 2CQQA 4EJVA 2K9QA 4PDKA 5HDKA 1MGTA 2MC3A 2ELHA 4RAYA 3QYFA 2DTRA 1K7AA 2JMWA 4RGUA 3GTOJ 5GTHC 3WG9A 5BOXA 1DPRA 1QZZA 3NRVA 4V19K 4MGRA 4KYWA 4I2OA 2RC4A 1Z21A 2X0LA 4Q48A 4IHSA 4HDUA 1GUUA 3CLQA 4A3GJ 2HXIA 4A12A 1S7EA 4UB8C 2MH2A 3J7AY 3JRAA 2EILH 4Y52J 2HYJA 3V4GA 1JTYA 4JX4A 2XB0X 3BTJA 4D7MA 1A04A 3OL4A 1XGNA 2VC0A 4U88A 5B1BH 3QOEA 4I6ZA 1KGSA 2LKPA 4A3IJ 3GZ6A 4UUSA 1AWCA 1MDMB 4CA0A 4HSTA 1J75A 3CF2A 3HJEA 1I1SA 2L2OA 2EZLA 3C3WA 5E1XA 4PFOA 2JQ7A 1D5VA 2E1MC 5JVGF 5EZGA 1OCTC 1U8RA 1WRJA 3PIOF 3S32A 2O9LA 4A3MJ 3KE2A 4A3JJ 3LA2A 2QQ8A 2HZTA 3VYRB 4M3GA 4CZCA 1IF1A 2M2EA 2KZVA 4WF2A 5JI6A 1YRNA 1KQ8A 5CVJA 1OMIA 2RQPA 2LD5A 3DP7A 3HHGA 2DCEA 4U0YA 1BR1A 2E2JJ 1A36A 3GFIA 4BQAA 2HKXA 3L2UA 2VN2A 1G4DA 4BNCA 1IXRC 2QQAA 3HSFA 1AKHB 2RQQA 4RM2A 3CCJI 2HPMA 4M6VA 5KNLA 2XAUA 2DMNA 2DQRA 4E7KA 4HNVA 3L2RA 2HYGD 4XLEA 3PJRA 4BXUA 3KZYA 1D0ZA 1APLC 2LR8A 3ZMDA 2ESNA 2E1NA 1K78B 3ECOA 2M7BA 5AIQA 5DUIA 1YITI 2H1KA 2RNJA 3E6BA 3VB2A 1T6SA 5IOZA 1MMGA 3H0GJ 3HTUA 1SAXA 4ABZA 5HLIA 2IBDA 4LITA 1YW8A 2ISYA 2WV1A 1DGWY 3X2QH 3D5RC 3HOVJ 4E6KG 3MVPA 2DTZA 3K4LA 1VQ7I 1U0JA 4FISA 3H9JA 3P9IA 3TMOA 2IP2A 4C3HJ 1HDPA 3HC7A 4RS8A 4B1RA 5L3GA 2DFFA 4XLFA 2B63J 4BJ6C 3IH4A 2GXBA 3F6VA 1HSTA 2TRTA 4DNCA 3ZQCA 1FP2A 1NK2P 4G7ZF 1J5YA 2FX0A 1T33A 2CQNA 4LIVA 4N4OB 1Z91A 1V4RA 2BZTA 1I5ZA 1MZBA 3WTVC 3LNQA 1R9TJ 1RKWA 2O8KA 2EZIA 1R4NB 4U0WA 4XKVA 5D4RA 3HSEA 1SANA 3AL0B 3CCVI 3HBLA 5E3OA 4MEXF 1ZK8A 1JGGA 4NHJA 1TLHB 3A2KA 4CCNA 5M5YJ 1RRJA 1PP8F 1MMDA 1LPQA 2W82A 2F5EA 1EH6A 5C44J 3DQVC 2KHMA 1FTZA 1HDDC 2FUG2 3K1MA 4BGDA 4WX9A 1Y8RB 2A05A 3GFLA 3TKYA 3KFWX 2EFPA 1KU3A 4DJAA 5LGTA 2BYVE 2H94A 1YG2A 3OYHA 3I4MJ 3AG3H 4RM3A 3H5NA 3ZXSA 2R5ZA 3BCBA 1TWGJ 3A0BC 4OWRB 3G73A 2P5LC 1ZRCA 2EFQA 2FRHA 4M3DA 2A68F 4AWXB 2ZBKA 3WTXC 3JSOA 2HDCA 1NG6A 4KITB 2HTSA 4BE0A 2DYSH 2DMUA 2V1UA 5DD8A 3DBRB 1ETQA 4YIFA 3C7JA 3L7WA 5IY5H 2HWVA 3A03A 1ZN2A 3TOBA 3GVAA 4CHUA 3LA7A 4LK1F 2RVCA 1IC8A 3I5UA 3HTSB 4Y17A 2K40A 3QPHA 3SJMA 1LUJB 1ON2A 2CFOA 3VEPA 3HOYJ 1X4PA 3ASNH 4D9JA 2DMPA 3V7RA 4B44A 3GW2A 2VUMJ 1SVLA 4LK0F 2Y2ZA 5J8CA 3CC2I 3I58A 4W1UA 1WZ2A 4A69C 3HM5A 2HXOA 1X1PA 3WU0A 2KJBA 2D2WA 2KIMA 5LGNA 2BGCA 5JHFA 3BR2A 2VPLA 4C2TA 2XGXA 2ZXWH 4B3XA 3BC8A 3H1CA 2HYFA 5E3MA 1EKEA 1RKTA 1MJ9A 4J01A 4A3BJ 4PGGA 3OS1A 2F4MB 2FU4A 3WU1B 2V9PA 4ON0A 3LAPA 1B8IB 1YIOA 2FA5A 2QGUA 2IS2A 4PJLA 1JKRC 5HNFA 5DCFA 3QAHA 3F22A 2R92J 1XCBA 3S3NA 3FMQA 1YOVB 3S2HJ 3HEFA 4YG2F 2PMZN 5FFZA 4IQJA 3HXLA 5KHDA 3ZMZA 2VODA 3TDUC 4L9NA 4IQ4A 4PGHA 5J3LA 1FP1D 3CO6C 1F1ZA 3BJ6A 4IOCF 2DMTA 2P6TA 2DT6A 1TWCJ 5D5XB 5D5UB 5BNGA 5E8IA 3F8BA 5L3BA 4XONA 3BTLA 1VF9A 1B9MA 2HQNA 4CCLA 1ZG5A 2ZXHA 3SEQA 2HDDA 1IZ1A 4JX6A 1VTNC 1TT5B 1WJFA 5EJCA 4NQWA 2DJIA 3V7CA 2UWMA 2ZNYA 4UY8I 3CQZJ 3BTCA 3LSPA 1J59A 3WU2C 3M1EA 4YELA 3VPRA 1KU2A 3N4MA 1KYWA 1U9NA 3T1BA 5IT9Z 3CDLA 3LSKA 1MSEC 3MZ8A 4KA4A 2R7SA 1V54H 3ABKH 1HW2A 5DCMA 3S8PA 3GEZA 1TW3A 3E5XA 5HODA 3I59A 4I99C 1SMYF 2EH3A 4BS9A 2NNNA 2RV8A 1RR7A 3MZYA 3ONQA 2DOEA 2ZSIB 2OPTA 1BOBA 4HQMA 2MLKA 1YO5C 3GO5A 4PJ0C 2JSPA 2KLOA 2FSWA 3R60A 3BG3A 5JHUA 4MFEA 4Y3OA 1SMTA 4EM2A 3CCUI 3CP2A 1QA6A 2P7CB 2CSOA 5BQTA 4ENJA 1LFUP 2BXZA 2QENA 1Y1WJ 5IYCJ 2P5VA 4KNYA 3H9GA 2OBPA 3DLLF 1E2XA 4A2UA 3FXLA 2R5YA 1WKMA 2M4KA 3OYAA 2AS5F 2PMZA 3QP6A 1ETVA 2PJRA 3BROA 3QP5A 3DWLE 4HOBA 4WXDA 2IVMA 5B3SH 1DDNA 2A6HF 1IW7F 4PSWA 3ERED 4Q47A 1X1CA 1OCRH 2KIFA 2CWEA 2AQFA 2ZJ2A 1VQ5I 2Z99A 4ENNA 2B7EA 3DEEA 3F8CA 4ESBA 2VKVA 1XB4A 4IL6C 2B9SA 2L54A 2JA6J 3OS2A 1BW6A 4EQQA 2BVLA 2V79A 1I6XA 2QKMB 2V7FA 1TL8A 4UB6C 5J4YA 3GLLA 4B43A 2L9SA 2R3SA 1W0UA 3OY9A 2M8GX 2ZKZA 2ZMEB 5CPRB 2BV6A 2M4GA 1XMAA 3MFKA 3B73A 1L3LA 2K3PA 2QUFA 3L2VA 2EIJH 3ZP5A 4GYIA 2UXNA 2LY2A 2L0KA 4FE7A 4E70A 2G0EA 4CCKA 5EGOB 3QODA 5FLMJ 3CCLI 3CUQC 2VJIA 4Y7NJ 3OYFA 3T8TA 3IH3A 4A3CJ 1FIAA 4BKXA 2O3FA 1FT9A 4KFCA 4OINF 3S1RJ 2AXLA 4QPOA 1QRYA 2GWRA 3K70C 2JVHA 3CESA 1BIBA 3K70D 2FQ3A 2QQBA 5D8KB 3RYPA 1ZG3A 4F91B 2KRHA 5LHIA 4G7HF 2IPQX 1DGRM 4L9VA 1PUFA 3AKZA 4B09A 2O5RA 3BR0A 4LGWA 3FISA 4IO9F 3QYBA 2VXDA 5EEHA 3SHFA 3I53A 3DBLB 4OAYA 1ZGAA 2A69F 3VYUB 1JXSA 3W2VA 5E3NA 1USSA 3BCAA 1IUYA 3CUQA 2R7WA 1QHGA 2FOWA 3WODF 3RJPA 4XKCA 1TW2A 3RYRA 1EH8A 2KPMA 2VL8A 3M1CA 3KZIC 3GZNB 2R4GA 3FIWA 2VKEA 4Q4ZF 1OISA 3ZQHA 4XK4A 1S7OA 3FXMA 3O3KA 4F93B 1J09A 1RESA 3TEDA 3KYCB 3OYBA 5FLXZ 2PFBA 3JR9A 2VQGA 2K9LA 3DCFA 1VQKI 2K3FA 1D1AA 4BQQA 2V6EA 3H92A 2XKPA 4L5EA 4LIUA 1GLNA 3BZCA 4L5IA 5K1YA 3CMAI 2VOPA 1TQMA 1TP4A 2BW3A 4B47A 2NOGA 2JK3A 3BJAA 1FC3A 2EZHA 3BG9A 2KT0A 3LQRA 1DPUA 2HU9A 3EYYA 2YSRA 2VT2A 5TGTA 1YIJI 1IRGA 1TQIA 1UELB 2VIXA 4XKBA 1RUNA 4LG0B 4UV9A 1POGA 4IHYA 4WXHA 2NVUB 3R6SA 3K1NA 4A0ZA 3L09A 4HW0A 4WK8F 1R1UA 1O57A 2E71A 4MQVA 3E97A 4XM3A 3IL2A 3ASOH 1A31A 3S1MJ 1LE8A 1YRNB 3PSIA 2DOFA 3AG2H 4EV0A 2GXGA 1R22A 2X6OA 3PO2J 4OAZA 1GV2A 4BBSJ 1TWAJ 1PUEE 5TJJA 2HI3A 3CCMI 3HDDA 1JHHA 3IRQA 3E7LA 2QQ9A 3BG6A 4LB6B 3CCQI 2Q0OA 3PL8A 4GGGA 3K0LA 3KLNA 3NWTA 3PQKA 3OYEA 4YFNF 4CDGA 1BC8C 1X2NA 1X1BA 2HZDA 3ZQLA 4KMUX 3G71I 3AFHA 1FBUA 4KT6A 2VC1A 1MW7A 3RKXA 2RGVA 1Z9CA 2ISZA 2VBYA 1X1DA 5E1WA 4NBQA 4DQ2A 1S3JA 3D1NI 4KISA 2VI6A 2XSJC 4FTHA 1ODDA 1P9QC 2ECBA 2EPFA 1PVEA 1SD7A 4XLAA 4ZYAA 4M9ZA 2GBYA 2XAJA 4XLNF 1VNDA 5FB2A 3CO7C 4WXCA 1LDDA 2DA5A 3O8HA 3IV5A 1XMKA 1A6IA 5HS9A 1BI3A 4X6AJ 2I8DA 4HLXA 1LEBA 1OJLA 1W36C 5CVUA 2CUZA 5HLGA 3H3UA 2IAIA 3QYEA 4A6DA 3CJQB 3JRGA 5CVRA 1W36D 1KQ9A 2I10A 1X3WB 2NXNB 4HV6A 3TDZC 2R7XA 2QSGX 3P7NA 5KCMA 2M0CA 5M5WJ 5LGUA 2IGMA 3KEYA 3UR3C 4PZJA 4N0BA 2DA7A 2CS3A 4LLNA 3VODA 4XRSG 1UZCA 4ZJZA 4A3FJ 1IRFA 3GXOA 2JA2A 2WV0A 2MH9A 1YS6A 4II2A 5HVQC 1DP3A 3BPVA 3N05A 1K6YA 2E5ZA 5LHGA 3ZQFA 2DJNA 3K4CA 2IJLA 1SVOA 3GTKJ 3NEUA 4XL9A 4DYCA 2RN7A 2KZGA 3I0TA 2L5QA 1D1BA 1IRXA 1IJWC 2KRFA 4HAMA 3GWZA 2ACJA 2QYOA 5M3MJ 5GP9A 4FETA 3SFIA 4G6TB 3A0HC 4B48A 3BY6A 2HDWA 3K9TA 1NTCA 4UV8A 2GIZA 3MD2A 2E1OA 3C2GA 3PSFA 5KK1A 5J4VA 3K4KA 4ZDPA 3TBIA 2XRLA 3HRMA 3LWFA 5J47A 2EB7A 4QTRA 3U2RA 3HOTA 3S15J 4EJUA 4XSZF 6PAXA 4GXOA 2M7AA 3CDIA 3MAJA 1U3EM 4MO7A 2DA3A 4BU2A 2A5WA 3U9GA 2MBFA 2F5VA 4HZFA 4MFDA 9ANTA 3E6DA 2ETHA 2M1BA 5FROA 4CH7A 3UNGC 4CYDA 4EJTA 2WC2A 4A5NA 1D1CA 2KDZA 3VSKA 3S14J 4R8HA 4D5CA 4F52A 2OQRA 2XF5A 5AIPA 4AU7A 3E0JB 5DUKA 2O03A 2EV6A 4GDFA 2CFXA 5F08A 2CV2A 4HDVA 4M3FA 2N8GA 3H5RA 5LEKA 1S7AA 2W84A 1WPKA 2JRMA 3TW7A 5H2FC 4Z2YA 5EEAA 3BR6A 2BY1A 1I39A 2XIGA 3QPTA 1Y1VJ 4JK1X 2P7VB 3W6JB 5D6FA 2XPWA 2IS6A 1W5CC 2BHZA 2ID6A 3FBIB 4NC8A 4R79A 2R7TA 3H9QA 2L9VA 3A01B 3TP3A 1A6QA 2V1NA 5F1RA 1AHDP 1YX3A 4ZDOA 4HYEA 3FX3A 3DF8A 4PFPA 3S17J 1IXCA 3MMYB 1JKPC 3RZDJ 1AU7A 3IAS2 1VQ4I 2LK2A 3L00A 4IXAA 2GAUA 3SZTA 3BPXA 3J80Z 4KIBA 3L1PA 2GM4A 4KICA 4A5MA 4PJJA 5F0CA 3I9V2 3EUKL 4BUPA 5DDGA 4G94A 1BC7C 1ZG1A 1OKRA 2H09A 1S9HA 4UNOA 1UB9A 2VQLA 3ABMH 4B3AA 1HXDA 1LVKA 2WBMA 2EQRA 1Q1HA 1O3RA 1KZHA 5D8LB 1ZAOA 1WQ2A 4RAZA 1HW1A 3WHCA 1G59A 3BQYA 1JUSA 2C6YA 4NQWB 1R5HA 3ZRGA 4ZYHA 2VKHA 5GPAA 5HNHA 2OTJI 1YW9A 1YS7A 2DA4A 2RKHA 1ZLKA 2IGNA 2GIVA 1FYLA 3ZOBA 1K79A 3A1YA 1B72A 2BY2A 3B6AA 5HOOA 4WCGA 2H1LA 3F23A 1UAAA 4UUVA 1D0XA 4RAGA 4BXFA 2K9NA 1Y56A 3RDIA 4RDUA 1D0YA 3DU6A 2OQGA 1O4XA 5E17F 2X85A 1J9IA 1IDZA 2R7ZJ 3TQNA 1S5LC 1VQOI 1ZREA 2W24A 2XHKA 3I3LA 3LSHA 2Q8KA 3MKZA 4L0ZB 3R61A 4QPQA 3WGGA 3NAUA 3LL7A 2RNGA 2YX7A 3DBHB 1FJLA 2OU2A 4AVPA 2X1CA 4NC7A 1FSHA 2PQ8A 5B1AH 1BJZA 4UXNA 1X3UA 1A35A 3V7SA 3ZN1A 3A02A 3G1MA 3SXYA 4JP0A 4KN4X 5HDGA 2GOMA 2CU7A 3FXJA 2NOJB 5A2QK 3T5XA 2QZ8A 1SFEA 3KP3A 4ZH4F 2DPDA 1AA7A 1Z6RA 3KPHA 2QKLB 3PNVA 2W85A 5FKKA 4PSXA 2DA6A 2OJED 2ZJRF 1ETOA 2ZXJA 2OC6A 1WSUA 1QQIA 1J2XA 1WGXA 3I54A 2E60A 5K5OA 1P6RA 2LREA 3NARA 2W00A 2PLYA 4Z6YA 2HOAA 1SFKA 3GTQJ 3HRUA 1W7PB 1ITYA 2CO5A 3OOUA 4AYBN 2X6XA 5FLXK 2LLKA 2DDBA 5IT3A 2UV1A 1Z1DA 2Y75A 4G9YA 1X3ZB 2XASA 1OCCH 1YHQI 4XORA 1MBHA 4BQNA 4XQFA 3TW6A 3FXOA 4BE2A 2IA0A 2K02A 3CLOA 3S3MA 3VYTB 1YJNI 3DXJF 1X58A 5CQGA 1MMSA 4L5JA 1ZR2A 1E3HA 3LFKA 3CP8A 3QPLA 1E17A 2K7LA 5E3LA 1J7KA 2M87A 2ZC2A 3FXRA 2L7FP 2R0QC 1ZH5A 4UHTA 3DKXA 1T56A 3J7ZI 3I64A 5K7ZA 3RI4A 4AM3A 3U21A 1P7IA 3JRFA 1YX5A 2CMPA 1IUFA 2NS7A 1FY7A 1V55H 1SFUA 2EZKA 2CUJA 2FF4A 2Q2EA 2V26A 3MZHA 2RDPA 2NNYA 3GF2A 4M6XA 4L0YB 4BDZA 3JRIA 2O0YA 4YFXF 4HX8A 2Y9ZA 1OLTA 4XLHA 3TO9A 2EA2A 1D8JA 1MKMA 2FJ1A 4G8XA 2A07F 2JUGA 3WGIA 2K9MA 4I02A 1Z3XA 3AG1H 1F4KA 5BMZA 3R0AA 2VXZA 1K4SA 1ZRFA 1XX5A 1VQ6I 4EMSA 2VOOA 1W5SA 2DMQA 1STZA 2V1XA 2PI0A 3IHUA 2VJ5A 4EJWA 2CQKA 2ZFUA 1U5TC 5FKOA 1CGPA 3DV8A 3S93A 1WVRA 3M9AA 4YEJA 1T95A 3IWZA 3JRHA 1X19A 2KRCA 5H6QA 3BZKA 5ICCA 4IX7A 4XBFA 2IA2A 5FD5A 4BAYA 2PG4A 1Y6IA 3OL3A 4D5FA 5D5WB 1YFHA 5H6RA 1HF0A 2E34A 3TO6A 3KLOA 1S8NA 3COAC 5TISC 4AYBA 5JLWA 2IGOA 3MKYB 1NG7A 1MJBA 3IH2A 2AHQA 2QF7A 3RQ4A 2KMUA 5KAIC 4EGZA 2BW3B 2MC4A 2ZFWA 4E7SA 2LMDA 4E7ZA 4GCVA 1MIJA 1H0MA 1LDKB 3QQAA 1ZYRF 5EF6A 2E19A 1Z77A 2X51A 4HNTA 1U5TA 4EM1A 2GOXB 2W1OA 4DYRA 2X4HA 1HOMA 1RZ4A 3HGGA 1G6NA 3VYSB 3BWGA 2JA7J 2WY7Q 2DFHA 1ETWA 1W1WE 2EINH 4R1HA 4RMNA 5ILUA 2L7ZA 2LP0A 1F9NA 4JOMA 2YS9A 4OIPF 1K61A 1E3OC 1FX7A 2JPBA 2NAZA 2ECCA 4A0YA 5HS8A 3CCRI 3HZJA 3E6CC 2D45A 1MDMA 3QPSA 2ELJA 5EG0B 1UMQA 4HEA2 2VB6A 3G1LA 1A5JA 2CGPA 2YU3A 2AO9A 1F36A 3PUFA 2NYXA 1ENHA 2VE9A 1HC8A 1S29A 2MG4A 5FRMA 1FPQA 3SYTA 5ICFA 1D8KA 3DPUA 5EDNA 4E7LA 2P8TA 2R7UA 3WE2A 1LFBA 3HUGB 2XDVA 4I09A 1GXPA 1IDYA 2Q1ZB 3CUOA 2ZXIA 5FGMA 2F5FA 1LB2A 2LDUA 3KETA 4LJZF 4ZZDA 2FMYA 1HSJA 2PMHA 4XLCA 3K2ZA 2PX9A 3OYLA 2CV1A 3KP7A 2JN6A 3FXKA 1JKOC 2R7FA 4IZZA 4U87A 2DOAA 2EBIA 1AKHA 1EH7A 4CYCB 4DGWB 4EGYA 3ABTA 1YJWI 2VE8A 3K4JA 5IYBJ 2WB1N 3HSRA 1VQPI 1QGPA 4UVBA 4TV7A 2DBBA 4MQ9F 1JI8A 1R5GA 1FBSA 1K78A 5C4XJ 1WJAA 1G3WA 2GQQA 1IAWA 3WHBA 2G9WA 2KQRA 1FIPA 3MKLA 4MHGA 4IVNA 1G3SA 3SDBA 2OUMA 3OYIA 3RZOJ 3FK6A 4P9FA 3AL0C 2QBYB 4P5OA 3LMMA 1H8AC 1ETKA 2OA4A 1LNWA 2QEXI 3DTIA 4D1QA 1X4OA 5L3EA 4O3MA 4XSXF 2YR2A 3AAFA 4MTEA 3SZGA 2LH9A 3G4SI 3J80K 3MKWB 2Y69H 1TC3C 4C3JJ 1QPMA 3SQNA 1DP7P 2UUZA 1LQ1A 3T8RA 1IN7A 2JSCA 3M3YJ 1LJ9A 3ECHA 3G2BA 1OFCX 2LOOA 2MA3A 2DT7B 3J7AO 2HGCA 2HVRA 1MNMC 3K1PA 1ZLJA 3NWSA 3RPUD 1YLFA 1CF7B 2TDXA 4BEHB 4ZTFA 1N78A 5FO5A 1G3TA 3IRRA 2BEOA 2EFWA 3WTZA 4AIDA 3W6KB 3BZ6A 5HLHA 4IOAF 5HDNA 2R7QA 2GA2A 3D5SC 5K7FA 3GYHX 2CW0F 2OZ6A 5BPDA 2CV0A 3LAJA 2Z3YA 3FWEA 5ILVA 3KZZA 1OPCA 1JT6A 1FBQA 1R36A 4YRVA 3J81Z 5IP6A 5ICGA 1R71A 1ON1A 1W5TA 2O6GE 1Z05A 2M8EA 2DYRH 1JTXA 1KONA 4RGSA 4ZDLA 1HA8A 2GZWA 2UXXA 4BYYA 3DEWA 3RPUA 2P81A 4L9JA 3V8KA 3ZMVA 4CUGA 1SFOJ 4AIKA 2R7RA 5IYDJ 2W57A 2COMA 2LFBA 4IPAA 2FD5A 3GUDA 5K5RA 5A2QZ 3V8LA 2ID3A 2WB1A 2XGCA 1FWZA 3B6CA 5KAFC 5DS9A 5F27A 1LVAA 1FLIA 2ZNZA 3JREA 4Q5SF 2FE3A 4CICA 5DV5A 4XOPA 1RETA 3ML6A 1XSXA 2X1DA 4HF1A 3DKWA 5DM7F 2X6YA 3H3VK 3O6BB 2HFHA 3BR1A 2P4WA 3S16J 3WTTC 1VZ0A 4Y33A 1P4WA 2KKOA 1BOAA 4NB5A 2LNBA 4MEYF 2NVYJ 5E18F 2RREA 4I7HA 2EV5A 5LRSA 1EF4A 3E5UA 2DT5A 1B8IA 1KA8A 1I1GA 4ZYEA 3GTGJ 1ZGWA 2G7HA 1BR2A 4UUSB 1HKQA 4V2FA 1H9TA 3CDHA 1W0TA 3ABUA 1WWXA 4RA2A 2BXYA 5LD2C 3FHNA 1XCVA 3L2WA 2O8XA 1GVJA 1TWFJ 1USTA 2E2IJ 4N4NB 2BOLA
chains in the Genus database with same CATH topology
1BI2A 4S05A 4RB0A 4ZYGA 3D0SA 4ESJA 1BM9A 4B8XA 2K4BA 4HF2A 5JFRA 5LBQA 4G7OF 1FNNA 5LLQA 3ZMUA 1Z6TA 1UHWA 2L4AA 4KIGA 3WTUC 1O3QA 4FT8A 4AD9A 1QNTA 4P96A 2H6BA 1BI0A 3LQQA 1HQCA 5FD6A 3EETA 4RB1A 5LEJA 2IRFG 1IN8A 3FHZA 3KP6A 3U1DA 1R58A 2ZO4A 2DU9A 2DAOA 2V6CA 4HLYA 3F8MA 2PEXA 3ELKA 3FZVA 1P4AA 3RTRA 2XKOA 4BH9A 4IHTA 1Y0UA 3QRFF 3E3VA 4I0BA 2W25A 3RPQA 1TQPA 3M8FA 1J0RA 2DFIA 3WTYC 1L0OC 4M9SA 1XDUA 4I01A 4K2EA 4ENMA 3FXQA 4MTDA 2JZYA 2L3DA 4AIHA 2MD5A 3LA3A 2GA1A 1R1TA 1YYVA 2XUBA 4Y15A 5BS6A 4U0VA 2D1VA 3DFGA 4KN7X 2HOEA 2P5KA 1EV7A 1XN7A 4CO8A 1T98A 2DK8A 2PN6A 1T2KA 3JTHA 3T0YA 3Q9SA 1UHMA 4LLGF 5EEGA 3ZMSA 2Z9OA 2XAFA 5CVIA 5KVRA 4LD5A 4Y13A 2FBIA 4GYGA 3REOA 4S04A 4YFKF 4HBLA 1FYMA 2V1DA 1B6AA 5F64A 3SFZA 1P92A 3H3ZA 5ED4A 1TNSA 5L3DA 1B59A 1BI1A 3WGHA 2BBYA 3KP5A 4FX4A 1R00A 2L01A 1GHCA 4M71A 1U5TB 4ASNA 3IWFA 2HTJA 3DEUA 3MQ0A 1FSEA 3C18A 5K5QA 3I4PA 4IRGA 3KP2A 4A6EA 4HQEA 4I98B 2FEZA 2FNAA 3EUHA 3F8NA 3IKVA 4OIQF 3I71A 4LG0A 4IF4A 4G6DA 5DCMB 2FMLA 3I59B 3J81K 2DK5A 2IW5A 4ZYDA 1ZRDA 2A5YB 5H20A 2DLLA 2P6SA 2HQRA 1MD0A 2YPRA 4P9UA 3GZ5A 1O7FA 5L3CA 1BIAA 4RGXA 3KP4A 1IN4A 1KQ0A 3RKYA 2NS0A 2LF7A 2WWYA 4JBAA 4BHPA 4IRHA 4L9TA 3R4KA 1RNLA 3V8JA 2D1HA 3F3XA 1IN5A 2R7DA 2PJPA 1YTYA 1R7JA 3FM5A 1O3SA 2XRNA 4RB2C 2M45A 1OR7A 3F8FA 3JW4A 1YQAA 2EA4A 3ZMTA 2EJRA 4OMZA 4MNUA 3HOSA 3B02A 4HF0A 3BOQA 3N97A 3EYIA 4G6QA 5ERIA 4I0AA 4YIIA 4IJAA 2O61A 3F6OA 2ESHA 2A3SA 4M73A 2M5WA 3DPLC 2Z5UA 1B1BA 1O3TA 1HKSA 4OMYA 2Y48A 2DPUA 1T38A 2KJCA 1HBXG 3QOPA 4ESFA 1LDJA 1RUOA 4KMFA 5E8GA 2DQLA 2EV0A 5E1ZB 1P4XA 3F21A 3GFMA 2A6EF 1SD5A 4LLLA 3QU3A 2JTVA 3VFZA 5D4SA 3EQLF 3PFIA 4KUMA 2H27A 4P55A 3FMSA 2OD5A 3IC7A 5ICEA 1FZPB 3CUQB 2FXAA 3Q9VA 3JAMK 1QBJA 3E5QA 1B4AA 1K6OA 3E6MA 2PMUA 1YW7A 4M9XA 1MJAA 1FYKA 1ULYA 2A61A 2QVOA 3R0JA 2XV4S 4CXFA 2M30A 4FHTA 2E1CA 2MLGA 1U2WA 1H9GA 2XAHA 3RKWA 1UFMA 4EVIA 1QZYA 3LSTA 2JRTA 2IA1A 3HYIA 4O5VA 1SD6A 2JPCA 2HR3A 2UZKA 4EJOA 1OYYA 5FFXA 2LF8A 4HV5A 1KU7A 5JR3A 3Q5FA 3VOEA 3ZN0A 4UVCA 4QLCU 5CVVA 4XRFA 2CYYA 2F5CA 3TOAA 2FNPA 2EWNA 3BDDA 3HRTA 4O6JA 3PQJA 4OU0A 3HRSA 4RB3C 5E20A 1O7LA 1D3YA 1XDSA 2VONA 4N9IA 1LEAA 3NQOA 5DD4A 1W7PD 2QM3A 2OZUA 1XSDA 1R23A 3IKTA 1T39A 4M74A 1AOYA 3JTGA 5D6EA 4IRIA 1TBXA 2STTA 1NHAA 1HKTA 3OOPA 5AONA 5J8FA 1I27A 1W7PA 3L9FA 3M8EA 4WWCA 2G7UA 1WI9A 4LB5A 1GXQA 1ZARA 4KT5C 1IXSB 3MEXA 3P9CA 5CJ9A 4XLPF 1P2FA 5CLSA 5HS7A 1Z7UA 4QWQA 2J5OA 5CYVA 4M72A 2H6CA 1S6LA 2DO7A 3D5LA 3O2PE 4F7ZA 3FXUA 4UVAA 1RIOH 4LFUA 4HA8A 4ENKA 1ONVA 3CJNA 2FBKA 3JSPA 3MCZA 4CGZA 3FM3A 3KEOA 4BHCA 3DPTA 4OOIA 3KEQA 2K4JA 2YX4A 1JE8A 4HX7A 2QLZA 3WTSC 1XGSA 3HHHA 1R1VA 3BJOA 1PP7U 5LRRA 2E7WA 3FF5A 4PCQA 3WTWC 2K86A 4RGRA 1XGOA 4CZZA 1C0WA 4U7DA 2CG4A 2WTEA 3ZQ7A 4LMYA 3EDPA 1KYZA 2JT1A 2FOKA 2XAQA 1T0FA 1SD4A 3GLXA 5LHHA 4AIJA 1OYWA 2OAZA 3F72A 1ZGJA 2EFOA 1JHFA 4L18B 2HEOA 2KIUA 2QWWA 2HKOA 5L3FA 3QU6A 3ISPA 2VBXA 3TO7A 4D0PA 4U7BA 1REPC 2V9VA 3ZPLA 1TNTA 4EM0B 2VBWA 1F5TA 2IT0A 2B0LA 3GFJA 2Y0MA 4JQFA 1PDNC 2HS5A 5DEQA 5J6XA 4N9HA 2EK5A 2XVCA 1U6GA 2ZCWA 3CTAA 5F6FA 1RI7A 4M6YA 2F5DA 5TRDA 1B9NA 5BPIA 3OV8A 1XGMA 3HUGA 1TTYA 3BP8A 3GX4X 2K27A 3JAMZ 2PBIA 3RIRA 4OIOF 1IN6A 4OIRF 3L2CA 3WE3A 1JGSA 2NRAC 3ULQB 3FMRA 4KIFA 2DW4A 2VT3A 3C1DA 4HX4A 2FBHA 2F2EA 1U78A 1G3YA 1XD7A 2LSOA 1SFXA 4BHBA 2VBZA 2QBYA 3TGNA 2ADUA 1HW5A 2BE5F 3S2WA 4ZZLA 2Z33A 3MWMA 1KU9A 4GO1A 3K69A 5JVTA 1DUXC 1BJAA 4KDPA 5DYMA 3P9KA 1W4MA 5D5VB 3HIFA 5ILSA 4FX0A 2STWA 1CF7A 2ZMEA 1ZHFA 2J5PA 2XROA 1V3FA 4A0XA 3M7GA 1OYIA 2L4MA 2E7XA 1QO0D 4H0EA 2EFNA 3ROUA 1XSVA 5IT9K 2L02A 3SZPA 1BBYA 3G3ZA 4ETSA 1FOKA 1UCRA 2DI3A 3KCCA 1BN5A 2XAGA 4EJVA 4PDKA 5HDKA 1MGTA 2MC3A 2ELHA 4RAYA 2DTRA 1K7AA 4RGUA 3WG9A 5BOXA 1DPRA 1QZZA 3NRVA 4MGRA 4KYWA 4I2OA 2RC4A 2X0LA 4IHSA 4Q48A 4HDUA 4A12A 2MH2A 3V4GA 1A04A 1XGNA 2VC0A 4U88A 1KGSA 2LKPA 3GZ6A 1AWCA 1MDMB 1J75A 1I1SA 3C3WA 5E1XA 1D5VA 1U8RA 1WRJA 3KE2A 3LA2A 2HZTA 1IF1A 4WF2A 5JI6A 1KQ8A 5CVJA 1OMIA 2RQPA 3DP7A 3HHGA 4U0YA 3GFIA 4BQAA 2HKXA 1G4DA 2VN2A 4BNCA 1IXRC 2QQAA 3HSFA 2DQRA 2HYGD 4BXUA 3KZYA 3ZMDA 2ESNA 2E1NA 1K78B 3ECOA 5AIQA 5DUIA 2RNJA 3E6BA 3VB2A 1T6SA 3HTUA 1SAXA 5HLIA 1YW8A 2ISYA 3P9IA 2IP2A 4RS8A 5L3GA 2GXBA 3F6VA 1HSTA 4DNCA 1FP2A 4G7ZF 1J5YA 1Z91A 1V4RA 1I5ZA 1MZBA 3WTVC 4U0WA 5D4RA 3HSEA 4MEXF 4NHJA 1TLHB 1PP8F 2F5EA 1EH6A 3DQVC 3K1MA 4WX9A 3GFLA 3TKYA 3KFWX 2EFPA 1KU3A 5LGTA 2BYVE 2H94A 1YG2A 3G73A 2P5LC 1ZRCA 2EFQA 2FRHA 4AWXB 2A68F 3JSOA 2ZBKA 3WTXC 2HDCA 2HTSA 2V1UA 5DD8A 4YIFA 3C7JA 3L7WA 4CHUA 2HWVA 3TOBA 1ZN2A 3GVAA 3LA7A 4LK1F 2RVCA 3I5UA 3HTSB 4Y17A 3QPHA 1ON2A 3VEPA 3V7RA 3GW2A 4LK0F 5J8CA 3I58A 3WU0A 2KJBA 2D2WA 2KIMA 5LGNA 2BGCA 2XGXA 2HYFA 1MJ9A 4PGGA 2FU4A 3WU1B 4ON0A 3LAPA 1YIOA 2FA5A 5DCFA 3QAHA 3F22A 1XCBA 3FMQA 4YG2F 5FFZA 3ZMZA 2VODA 3TDUC 4L9NA 4PGHA 1FP1D 3CO6C 1F1ZA 3BJ6A 2P6TA 5D5XB 5D5UB 5E8IA 3F8BA 5L3BA 1B9MA 2HQNA 1ZG5A 1IZ1A 1VTNC 4NQWA 3V7CA 2UWMA 2ZNYA 1J59A 3M1EA 1KU2A 3N4MA 1KYWA 3T1BA 5IT9Z 4KA4A 1HW2A 5DCMA 3GEZA 1TW3A 3E5XA 3I59A 1SMYF 2NNNA 2RV8A 3MZYA 4HQMA 2MLKA 1YO5C 3GO5A 2FSWA 3R60A 5JHUA 1SMTA 4EM2A 2P7CB 2CSOA 5BQTA 4ENJA 2QENA 2P5VA 4KNYA 2OBPA 1E2XA 4A2UA 1WKMA 2AS5F 3QP6A 3BROA 3QP5A 4HOBA 4WXDA 2IVMA 1DDNA 2A6HF 1IW7F 3ERED 4Q47A 2KIFA 2CWEA 2ZJ2A 2Z99A 4ENNA 4ESBA 3F8CA 1XB4A 2L54A 4EQQA 2V79A 1I6XA 2R3SA 2ZKZA 2ZMEB 2BV6A 1XMAA 3MFKA 3B73A 1L3LA 2QUFA 3ZP5A 4GYIA 2UXNA 4E70A 3CUQC 3T8TA 2O3FA 1FT9A 4KFCA 4OINF 2AXLA 2GWRA 1BIBA 2FQ3A 2QQBA 5D8KB 3RYPA 1ZG3A 4G7HF 5LHIA 2IPQX 4L9VA 4B09A 4LGWA 5EEHA 3SHFA 3I53A 1ZGAA 2A69F 1JXSA 1USSA 1IUYA 3CUQA 3WODF 3RJPA 1TW2A 3RYRA 1EH8A 4Q4ZF 1S7OA 3O3KA 5FLXZ 2PFBA 3H92A 2XKPA 4L5IA 5K1YA 2VOPA 1TQMA 3BJAA 1FC3A 3LQRA 1DPUA 3EYYA 2YSRA 2VT2A 1IRGA 1TQIA 1RUNA 4LG0B 4UV9A 4WXHA 3R6SA 3K1NA 4A0ZA 3L09A 4HW0A 4WK8F 1R1UA 1O57A 4MQVA 3E97A 3IL2A 4EV0A 2GXGA 1R22A 1PUEE 5TJJA 1JHHA 3IRQA 2QQ9A 4LB6B 2Q0OA 4GGGA 3K0LA 3KLNA 3PQKA 4YFNF 4CDGA 1BC8C 4KMUX 1FBUA 1Z9CA 3RKXA 2VC1A 2ISZA 2RGVA 2VBYA 5E1WA 4DQ2A 1S3JA 1ODDA 1SD7A 4M9ZA 2XAJA 4XLNF 5FB2A 3CO7C 4WXCA 1LDDA 1XMKA 5HS9A 1BI3A 4HLXA 1LEBA 5CVUA 5HLGA 3H3UA 4A6DA 5CVRA 1KQ9A 4HV6A 3TDZC 3P7NA 5LGUA 4PZJA 4N0BA 4LLNA 3VODA 1IRFA 3GXOA 2WV0A 2MH9A 1YS6A 5HVQC 3BPVA 5LHGA 2IJLA 3NEUA 2RN7A 3I0TA 2KRFA 4HAMA 3GWZA 2ACJA 2QYOA 3BY6A 3K9TA 4UV8A 5KK1A 3HRMA 3LWFA 2EB7A 3U2RA 3HOTA 4EJUA 4XSZF 6PAXA 4GXOA 3MAJA 1U3EM 3U9GA 2MBFA 4HZFA 3E6DA 2ETHA 2M1BA 4CYDA 4EJTA 2WC2A 4A5NA 4R8HA 2OQRA 5AIPA 5DUKA 2O03A 2EV6A 2CFXA 4HDVA 5LEKA 1S7AA 2W84A 4Z2YA 2XIGA 3W6JB 3QPTA 4JK1X 2P7VB 5D6FA 4R79A 5F1RA 4HYEA 3FX3A 3DF8A 1IXCA 3L00A 4IXAA 2GAUA 3SZTA 3BPXA 3J80Z 4KIBA 4KICA 4A5MA 5DDGA 4G94A 1BC7C 1ZG1A 1OKRA 2H09A 4UNOA 1UB9A 1HXDA 1Q1HA 1O3RA 5D8LB 1ZAOA 1WQ2A 4RAZA 1HW1A 2C6YA 1R5HA 4ZYHA 1YW9A 1YS7A 2RKHA 1ZLKA 2GIVA 1FYLA 1K79A 5HOOA 4WCGA 3F23A 4UUVA 3RDIA 2OQGA 5E17F 1J9IA 3TQNA 1ZREA 2W24A 2XHKA 2Q8KA 4L0ZB 3R61A 3WGGA 2YX7A 2OU2A 4AVPA 1FSHA 2PQ8A 4UXNA 1X3UA 3V7SA 3ZN1A 3SXYA 4KN4X 5HDGA 5A2QK 3T5XA 2QZ8A 1SFEA 3KP3A 4ZH4F 2DPDA 1Z6RA 2W85A 2ZXJA 1WSUA 1QQIA 1J2XA 3I54A 5K5OA 1P6RA 2PLYA 3HRUA 1W7PB 2CO5A 5FLXK 5IT3A 1Z1DA 2Y75A 4G9YA 2XASA 2IA0A 2K02A 3CLOA 3DXJF 4L5JA 3LFKA 1E17A 2K7LA 1J7KA 2M87A 3FXRA 1ZH5A 4UHTA 3I64A 3RI4A 1FY7A 1SFUA 2FF4A 2Q2EA 3MZHA 2RDPA 2NNYA 3GF2A 4M6XA 4L0YB 2O0YA 4YFXF 4HX8A 3TO9A 2EA2A 1D8JA 1MKMA 4G8XA 2A07F 3WGIA 4I02A 1F4KA 5BMZA 3R0AA 2VXZA 1ZRFA 4EMSA 2VOOA 1W5SA 2V1XA 1STZA 2PI0A 3IHUA 4EJWA 2CQKA 1CGPA 1U5TC 3DV8A 3M9AA 3IWZA 5H6QA 5ICCA 4XBFA 2IA2A 5FD5A 4BAYA 2PG4A 5D5WB 1YFHA 5H6RA 3TO6A 3COAC 3KLOA 1S8NA 1MJBA 4EGZA 2ZFWA 4GCVA 1H0MA 1LDKB 1ZYRF 1U5TA 4EM1A 2X4HA 1RZ4A 1G6NA 3BWGA 4R1HA 5ILUA 1F9NA 4OIPF 1FX7A 2JPBA 2NAZA 4A0YA 5HS8A 2D45A 3E6CC 1MDMA 2CGPA 2YU3A 2NYXA 2VE9A 1S29A 1FPQA 5ICFA 1D8KA 2P8TA 3WE2A 4I09A 1GXPA 3CUOA 5FGMA 2F5FA 1LB2A 2LDUA 3KETA 4LJZF 4ZZDA 2FMYA 1HSJA 2PMHA 3K2ZA 3KP7A 2R7FA 1EH7A 4EGYA 3ABTA 2VE8A 3HSRA 1QGPA 4UVBA 4TV7A 2DBBA 4MQ9F 1R5GA 1FBSA 1K78A 1G3WA 2GQQA 1IAWA 2G9WA 4MHGA 4IVNA 1G3SA 4P9FA 2QBYB 4P5OA 2OA4A 1LNWA 5L3EA 4O3MA 4XSXF 2YR2A 3AAFA 4MTEA 3J80K 1QPMA 3SQNA 1DP7P 1LQ1A 3T8RA 1IN7A 2JSCA 1LJ9A 3ECHA 2MA3A 3J7AO 2HGCA 3K1PA 1ZLJA 1YLFA 1CF7B 2TDXA 5FO5A 1G3TA 3IRRA 2BEOA 2EFWA 3WTZA 3W6KB 3BZ6A 5HLHA 5HDNA 2GA2A 3GYHX 2CW0F 2OZ6A 5BPDA 3LAJA 2Z3YA 3FWEA 5ILVA 3KZZA 1OPCA 1FBQA 1R36A 3J81Z 5ICGA 1ON1A 1W5TA 2O6GE 1Z05A 2M8EA 4RGSA 2GZWA 2UXXA 4BYYA 3V8KA 3RPUA 4L9JA 3ZMVA 4AIKA 2W57A 2COMA 4IPAA 3GUDA 5K5RA 5A2QZ 3V8LA 1FWZA 1LVAA 1FLIA 2ZNZA 4Q5SF 2FE3A 4CICA 5DV5A 3ML6A 1XSXA 4HF1A 3DKWA 3O6BB 2HFHA 2P4WA 3WTTC 1P4WA 2KKOA 1BOAA 4NB5A 2LNBA 4MEYF 5E18F 4I7HA 2EV5A 5LRSA 3E5UA 2DT5A 1KA8A 1I1GA 4ZYEA 2G7HA 1HKQA 1H9TA 3CDHA 3ABUA 1WWXA 1XCVA 2O8XA 1GVJA 1USTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI2 A;  4S05 A;  4RB0 A;  4ZYG A;  3D0S A;  4ESJ A;  1BM9 A;  4B8X A;  2K4B A;  4HF2 A;  5JFR A;  5LBQ A;  4G7O F;  1FNN A;  5LLQ A;  3ZMU A;  1Z6T A;  1UHW A;  2L4A A;  4KIG A;  3WTU C;  1O3Q A;  4FT8 A;  4AD9 A;  1QNT A;  4P96 A;  2H6B A;  1BI0 A;  3LQQ A;  1HQC A;  5FD6 A;  3EET A;  4RB1 A;  5LEJ A;  2IRF G;  1IN8 A;  3FHZ A;  3KP6 A;  3U1D A;  1R58 A;  2ZO4 A;  2DU9 A;  2DAO A;  2V6C A;  4HLY A;  3F8M A;  2PEX A;  3ELK A;  3FZV A;  1P4A A;  3RTR A;  2XKO A;  4BH9 A;  4IHT A;  1Y0U A;  3QRF F;  3E3V A;  4I0B A;  2W25 A;  3RPQ A;  1TQP A;  3M8F A;  1J0R A;  2DFI A;  3WTY C;  1L0O C;  4M9S A;  1XDU A;  4I01 A;  4K2E A;  4ENM A;  3FXQ A;  4MTD A;  2JZY A;  2L3D A;  4AIH A;  2MD5 A;  3LA3 A;  2GA1 A;  1R1T A;  1YYV A;  2XUB A;  4Y15 A;  5BS6 A;  4U0V A;  2D1V A;  3DFG A;  4KN7 X;  2HOE A;  2P5K A;  1EV7 A;  1XN7 A;  4CO8 A;  1T98 A;  2DK8 A;  2PN6 A;  1T2K A;  3JTH A;  3T0Y A;  3Q9S A;  1UHM A;  4LLG F;  5EEG A;  3ZMS A;  2Z9O A;  2XAF A;  5CVI A;  5KVR A;  4LD5 A;  4Y13 A;  2FBI A;  4GYG A;  3REO A;  4S04 A;  4YFK F;  4HBL A;  1FYM A;  2V1D A;  1B6A A;  5F64 A;  3SFZ A;  1P92 A;  3H3Z A;  5ED4 A;  1TNS A;  5L3D A;  1B59 A;  1BI1 A;  3WGH A;  2BBY A;  3KP5 A;  4FX4 A;  1R00 A;  2L01 A;  1GHC A;  4M71 A;  1U5T B;  4ASN A;  3IWF A;  2HTJ A;  3DEU A;  3MQ0 A;  1FSE A;  3C18 A;  5K5Q A;  3I4P A;  4IRG A;  3KP2 A;  4A6E A;  4HQE A;  4I98 B;  2FEZ A;  2FNA A;  3EUH A;  3F8N A;  3IKV A;  4OIQ F;  3I71 A;  4LG0 A;  4IF4 A;  4G6D A;  5DCM B;  2FML A;  3I59 B;  3J81 K;  2DK5 A;  2IW5 A;  4ZYD A;  1ZRD A;  2A5Y B;  5H20 A;  2DLL A;  2P6S A;  2HQR A;  1MD0 A;  2YPR A;  4P9U A;  3GZ5 A;  1O7F A;  5L3C A;  1BIA A;  4RGX A;  3KP4 A;  1IN4 A;  1KQ0 A;  3RKY A;  2NS0 A;  2LF7 A;  2WWY A;  4JBA A;  4BHP A;  4IRH A;  4L9T A;  3R4K A;  1RNL A;  3V8J A;  2D1H A;  3F3X A;  1IN5 A;  2R7D A;  2PJP A;  1YTY A;  1R7J A;  3FM5 A;  1O3S A;  2XRN A;  4RB2 C;  2M45 A;  1OR7 A;  3F8F A;  3JW4 A;  1YQA A;  2EA4 A;  3ZMT A;  2EJR A;  4OMZ A;  4MNU A;  3HOS A;  3B02 A;  4HF0 A;  3BOQ A;  3N97 A;  3EYI A;  4G6Q A;  5ERI A;  4I0A A;  4YII A;  4IJA A;  2O61 A;  3F6O A;  2ESH A;  2A3S A;  4M73 A;  2M5W A;  3DPL C;  2Z5U A;  1B1B A;  1O3T A;  1HKS A;  4OMY A;  2Y48 A;  2DPU A;  1T38 A;  2KJC A;  1HBX G;  3QOP A;  4ESF A;  1LDJ A;  1RUO A;  4KMF A;  5E8G A;  2DQL A;  2EV0 A;  5E1Z B;  1P4X A;  3F21 A;  3GFM A;  2A6E F;  1SD5 A;  4LLL A;  3QU3 A;  2JTV A;  3VFZ A;  5D4S A;  3EQL F;  3PFI A;  4KUM A;  2H27 A;  4P55 A;  3FMS A;  2OD5 A;  3IC7 A;  5ICE A;  1FZP B;  3CUQ B;  2FXA A;  3Q9V A;  3JAM K;  1QBJ A;  3E5Q A;  1B4A A;  1K6O A;  3E6M A;  2PMU A;  1YW7 A;  4M9X A;  1MJA A;  1FYK A;  1ULY A;  2A61 A;  2QVO A;  3R0J A;  2XV4 S;  4CXF A;  2M30 A;  4FHT A;  2E1C A;  2MLG A;  1U2W A;  1H9G A;  2XAH A;  3RKW A;  1UFM A;  4EVI A;  1QZY A;  3LST A;  2JRT A;  2IA1 A;  3HYI A;  4O5V A;  1SD6 A;  2JPC A;  2HR3 A;  2UZK A;  4EJO A;  1OYY A;  5FFX A;  2LF8 A;  4HV5 A;  1KU7 A;  5JR3 A;  3Q5F A;  3VOE A;  3ZN0 A;  4UVC A;  4QLC U;  5CVV A;  4XRF A;  2CYY A;  2F5C A;  3TOA A;  2FNP A;  2EWN A;  3BDD A;  3HRT A;  4O6J A;  3PQJ A;  4OU0 A;  3HRS A;  4RB3 C;  5E20 A;  1O7L A;  1D3Y A;  1XDS A;  2VON A;  4N9I A;  1LEA A;  3NQO A;  5DD4 A;  1W7P D;  2QM3 A;  2OZU A;  1XSD A;  1R23 A;  3IKT A;  1T39 A;  4M74 A;  1AOY A;  3JTG A;  5D6E A;  4IRI A;  1TBX A;  2STT A;  1NHA A;  1HKT A;  3OOP A;  5AON A;  5J8F A;  1I27 A;  1W7P A;  3L9F A;  3M8E A;  4WWC A;  2G7U A;  1WI9 A;  4LB5 A;  1GXQ A;  1ZAR A;  4KT5 C;  1IXS B;  3MEX A;  3P9C A;  5CJ9 A;  4XLP F;  1P2F A;  5CLS A;  5HS7 A;  1Z7U A;  4QWQ A;  2J5O A;  5CYV A;  4M72 A;  2H6C A;  1S6L A;  2DO7 A;  3D5L A;  3O2P E;  4F7Z A;  3FXU A;  4UVA A;  1RIO H;  4LFU A;  4HA8 A;  4ENK A;  1ONV A;  3CJN A;  2FBK A;  3JSP A;  3MCZ A;  4CGZ A;  3FM3 A;  3KEO A;  4BHC A;  3DPT A;  4OOI A;  3KEQ A;  2K4J A;  2YX4 A;  1JE8 A;  4HX7 A;  2QLZ A;  3WTS C;  1XGS A;  3HHH A;  1R1V A;  3BJO A;  1PP7 U;  5LRR A;  2E7W A;  3FF5 A;  4PCQ A;  3WTW C;  2K86 A;  4RGR A;  1XGO A;  4CZZ A;  1C0W A;  4U7D A;  2CG4 A;  2WTE A;  3ZQ7 A;  4LMY A;  3EDP A;  1KYZ A;  2JT1 A;  2FOK A;  2XAQ A;  1T0F A;  1SD4 A;  3GLX A;  5LHH A;  4AIJ A;  1OYW A;  2OAZ A;  3F72 A;  1ZGJ A;  2EFO A;  1JHF A;  4L18 B;  2HEO A;  2KIU A;  2QWW A;  2HKO A;  5L3F A;  3QU6 A;  3ISP A;  2VBX A;  3TO7 A;  4D0P A;  4U7B A;  1REP C;  2V9V A;  3ZPL A;  1TNT A;  4EM0 B;  2VBW A;  1F5T A;  2IT0 A;  2B0L A;  3GFJ A;  2Y0M A;  4JQF A;  1PDN C;  2HS5 A;  5DEQ A;  5J6X A;  4N9H A;  2EK5 A;  2XVC A;  1U6G A;  2ZCW A;  3CTA A;  5F6F A;  1RI7 A;  4M6Y A;  2F5D A;  5TRD A;  1B9N A;  5BPI A;  3OV8 A;  1XGM A;  3HUG A;  1TTY A;  3BP8 A;  3GX4 X;  2K27 A;  3JAM Z;  2PBI A;  3RIR A;  4OIO F;  1IN6 A;  4OIR F;  3L2C A;  3WE3 A;  1JGS A;  2NRA C;  3ULQ B;  3FMR A;  4KIF A;  2DW4 A;  2VT3 A;  3C1D A;  4HX4 A;  2FBH A;  2F2E A;  1U78 A;  1G3Y A;  1XD7 A;  2LSO A;  1SFX A;  4BHB A;  2VBZ A;  2QBY A;  3TGN A;  2ADU A;  1HW5 A;  2BE5 F;  3S2W A;  4ZZL A;  2Z33 A;  3MWM A;  1KU9 A;  4GO1 A;  3K69 A;  5JVT A;  1DUX C;  1BJA A;  4KDP A;  5DYM A;  3P9K A;  1W4M A;  5D5V B;  3HIF A;  5ILS A;  4FX0 A;  2STW A;  1CF7 A;  2ZME A;  1ZHF A;  2J5P A;  2XRO A;  1V3F A;  4A0X A;  3M7G A;  1OYI A;  2L4M A;  2E7X A;  1QO0 D;  4H0E A;  2EFN A;  3ROU A;  1XSV A;  5IT9 K;  2L02 A;  3SZP A;  1BBY A;  3G3Z A;  4ETS A;  1FOK A;  1UCR A;  2DI3 A;  3KCC A;  1BN5 A;  2XAG A;  4EJV A;  4PDK A;  5HDK A;  1MGT A;  2MC3 A;  2ELH A;  4RAY A;  2DTR A;  1K7A A;  4RGU A;  3WG9 A;  5BOX A;  1DPR A;  1QZZ A;  3NRV A;  4MGR A;  4KYW A;  4I2O A;  2RC4 A;  2X0L A;  4IHS A;  4Q48 A;  4HDU A;  4A12 A;  2MH2 A;  3V4G A;  1A04 A;  1XGN A;  2VC0 A;  4U88 A;  1KGS A;  2LKP A;  3GZ6 A;  1AWC A;  1MDM B;  1J75 A;  1I1S A;  3C3W A;  5E1X A;  1D5V A;  1U8R A;  1WRJ A;  3KE2 A;  3LA2 A;  2HZT A;  1IF1 A;  4WF2 A;  5JI6 A;  1KQ8 A;  5CVJ A;  1OMI A;  2RQP A;  3DP7 A;  3HHG A;  4U0Y A;  3GFI A;  4BQA A;  2HKX A;  1G4D A;  2VN2 A;  4BNC A;  1IXR C;  2QQA A;  3HSF A;  2DQR A;  2HYG D;  4BXU A;  3KZY A;  3ZMD A;  2ESN A;  2E1N A;  1K78 B;  3ECO A;  5AIQ A;  5DUI A;  2RNJ A;  3E6B A;  3VB2 A;  1T6S A;  3HTU A;  1SAX A;  5HLI A;  1YW8 A;  2ISY A;  3P9I A;  2IP2 A;  4RS8 A;  5L3G A;  2GXB A;  3F6V A;  1HST A;  4DNC A;  1FP2 A;  4G7Z F;  1J5Y A;  1Z91 A;  1V4R A;  1I5Z A;  1MZB A;  3WTV C;  4U0W A;  5D4R A;  3HSE A;  4MEX F;  4NHJ A;  1TLH B;  1PP8 F;  2F5E A;  1EH6 A;  3DQV C;  3K1M A;  4WX9 A;  3GFL A;  3TKY A;  3KFW X;  2EFP A;  1KU3 A;  5LGT A;  2BYV E;  2H94 A;  1YG2 A;  3G73 A;  2P5L C;  1ZRC A;  2EFQ A;  2FRH A;  4AWX B;  2A68 F;  3JSO A;  2ZBK A;  3WTX C;  2HDC A;  2HTS A;  2V1U A;  5DD8 A;  4YIF A;  3C7J A;  3L7W A;  4CHU A;  2HWV A;  3TOB A;  1ZN2 A;  3GVA A;  3LA7 A;  4LK1 F;  2RVC A;  3I5U A;  3HTS B;  4Y17 A;  3QPH A;  1ON2 A;  3VEP A;  3V7R A;  3GW2 A;  4LK0 F;  5J8C A;  3I58 A;  3WU0 A;  2KJB A;  2D2W A;  2KIM A;  5LGN A;  2BGC A;  2XGX A;  2HYF A;  1MJ9 A;  4PGG A;  2FU4 A;  3WU1 B;  4ON0 A;  3LAP A;  1YIO A;  2FA5 A;  5DCF A;  3QAH A;  3F22 A;  1XCB A;  3FMQ A;  4YG2 F;  5FFZ A;  3ZMZ A;  2VOD A;  3TDU C;  4L9N A;  4PGH A;  1FP1 D;  3CO6 C;  1F1Z A;  3BJ6 A;  2P6T A;  5D5X B;  5D5U B;  5E8I A;  3F8B A;  5L3B A;  1B9M A;  2HQN A;  1ZG5 A;  1IZ1 A;  1VTN C;  4NQW A;  3V7C A;  2UWM A;  2ZNY A;  1J59 A;  3M1E A;  1KU2 A;  3N4M A;  1KYW A;  3T1B A;  5IT9 Z;  4KA4 A;  1HW2 A;  5DCM A;  3GEZ A;  1TW3 A;  3E5X A;  3I59 A;  1SMY F;  2NNN A;  2RV8 A;  3MZY A;  4HQM A;  2MLK A;  1YO5 C;  3GO5 A;  2FSW A;  3R60 A;  5JHU A;  1SMT A;  4EM2 A;  2P7C B;  2CSO A;  5BQT A;  4ENJ A;  2QEN A;  2P5V A;  4KNY A;  2OBP A;  1E2X A;  4A2U A;  1WKM A;  2AS5 F;  3QP6 A;  3BRO A;  3QP5 A;  4HOB A;  4WXD A;  2IVM A;  1DDN A;  2A6H F;  1IW7 F;  3ERE D;  4Q47 A;  2KIF A;  2CWE A;  2ZJ2 A;  2Z99 A;  4ENN A;  4ESB A;  3F8C A;  1XB4 A;  2L54 A;  4EQQ A;  2V79 A;  1I6X A;  2R3S A;  2ZKZ A;  2ZME B;  2BV6 A;  1XMA A;  3MFK A;  3B73 A;  1L3L A;  2QUF A;  3ZP5 A;  4GYI A;  2UXN A;  4E70 A;  3CUQ C;  3T8T A;  2O3F A;  1FT9 A;  4KFC A;  4OIN F;  2AXL A;  2GWR A;  1BIB A;  2FQ3 A;  2QQB A;  5D8K B;  3RYP A;  1ZG3 A;  4G7H F;  5LHI A;  2IPQ X;  4L9V A;  4B09 A;  4LGW A;  5EEH A;  3SHF A;  3I53 A;  1ZGA A;  2A69 F;  1JXS A;  1USS A;  1IUY A;  3CUQ A;  3WOD F;  3RJP A;  1TW2 A;  3RYR A;  1EH8 A;  4Q4Z F;  1S7O A;  3O3K A;  5FLX Z;  2PFB A;  3H92 A;  2XKP A;  4L5I A;  5K1Y A;  2VOP A;  1TQM A;  3BJA A;  1FC3 A;  3LQR A;  1DPU A;  3EYY A;  2YSR A;  2VT2 A;  1IRG A;  1TQI A;  1RUN A;  4LG0 B;  4UV9 A;  4WXH A;  3R6S A;  3K1N A;  4A0Z A;  3L09 A;  4HW0 A;  4WK8 F;  1R1U A;  1O57 A;  4MQV A;  3E97 A;  3IL2 A;  4EV0 A;  2GXG A;  1R22 A;  1PUE E;  5TJJ A;  1JHH A;  3IRQ A;  2QQ9 A;  4LB6 B;  2Q0O A;  4GGG A;  3K0L A;  3KLN A;  3PQK A;  4YFN F;  4CDG A;  1BC8 C;  4KMU X;  1FBU A;  1Z9C A;  3RKX A;  2VC1 A;  2ISZ A;  2RGV A;  2VBY A;  5E1W A;  4DQ2 A;  1S3J A;  1ODD A;  1SD7 A;  4M9Z A;  2XAJ A;  4XLN F;  5FB2 A;  3CO7 C;  4WXC A;  1LDD A;  1XMK A;  5HS9 A;  1BI3 A;  4HLX A;  1LEB A;  5CVU A;  5HLG A;  3H3U A;  4A6D A;  5CVR A;  1KQ9 A;  4HV6 A;  3TDZ C;  3P7N A;  5LGU A;  4PZJ A;  4N0B A;  4LLN A;  3VOD A;  1IRF A;  3GXO A;  2WV0 A;  2MH9 A;  1YS6 A;  5HVQ C;  3BPV A;  5LHG A;  2IJL A;  3NEU A;  2RN7 A;  3I0T A;  2KRF A;  4HAM A;  3GWZ A;  2ACJ A;  2QYO A;  3BY6 A;  3K9T A;  4UV8 A;  5KK1 A;  3HRM A;  3LWF A;  2EB7 A;  3U2R A;  3HOT A;  4EJU A;  4XSZ F;  6PAX A;  4GXO A;  3MAJ A;  1U3E M;  3U9G A;  2MBF A;  4HZF A;  3E6D A;  2ETH A;  2M1B A;  4CYD A;  4EJT A;  2WC2 A;  4A5N A;  4R8H A;  2OQR A;  5AIP A;  5DUK A;  2O03 A;  2EV6 A;  2CFX A;  4HDV A;  5LEK A;  1S7A A;  2W84 A;  4Z2Y A;  2XIG A;  3W6J B;  3QPT A;  4JK1 X;  2P7V B;  5D6F A;  4R79 A;  5F1R A;  4HYE A;  3FX3 A;  3DF8 A;  1IXC A;  3L00 A;  4IXA A;  2GAU A;  3SZT A;  3BPX A;  3J80 Z;  4KIB A;  4KIC A;  4A5M A;  5DDG A;  4G94 A;  1BC7 C;  1ZG1 A;  1OKR A;  2H09 A;  4UNO A;  1UB9 A;  1HXD A;  1Q1H A;  1O3R A;  5D8L B;  1ZAO A;  1WQ2 A;  4RAZ A;  1HW1 A;  2C6Y A;  1R5H A;  4ZYH A;  1YW9 A;  1YS7 A;  2RKH A;  1ZLK A;  2GIV A;  1FYL A;  1K79 A;  5HOO A;  4WCG A;  3F23 A;  4UUV A;  3RDI A;  2OQG A;  5E17 F;  1J9I A;  3TQN A;  1ZRE A;  2W24 A;  2XHK A;  2Q8K A;  4L0Z B;  3R61 A;  3WGG A;  2YX7 A;  2OU2 A;  4AVP A;  1FSH A;  2PQ8 A;  4UXN A;  1X3U A;  3V7S A;  3ZN1 A;  3SXY A;  4KN4 X;  5HDG A;  5A2Q K;  3T5X A;  2QZ8 A;  1SFE A;  3KP3 A;  4ZH4 F;  2DPD A;  1Z6R A;  2W85 A;  2ZXJ A;  1WSU A;  1QQI A;  1J2X A;  3I54 A;  5K5O A;  1P6R A;  2PLY A;  3HRU A;  1W7P B;  2CO5 A;  5FLX K;  5IT3 A;  1Z1D A;  2Y75 A;  4G9Y A;  2XAS A;  2IA0 A;  2K02 A;  3CLO A;  3DXJ F;  4L5J A;  3LFK A;  1E17 A;  2K7L A;  1J7K A;  2M87 A;  3FXR A;  1ZH5 A;  4UHT A;  3I64 A;  3RI4 A;  1FY7 A;  1SFU A;  2FF4 A;  2Q2E A;  3MZH A;  2RDP A;  2NNY A;  3GF2 A;  4M6X A;  4L0Y B;  2O0Y A;  4YFX F;  4HX8 A;  3TO9 A;  2EA2 A;  1D8J A;  1MKM A;  4G8X A;  2A07 F;  3WGI A;  4I02 A;  1F4K A;  5BMZ A;  3R0A A;  2VXZ A;  1ZRF A;  4EMS A;  2VOO A;  1W5S A;  2V1X A;  1STZ A;  2PI0 A;  3IHU A;  4EJW A;  2CQK A;  1CGP A;  1U5T C;  3DV8 A;  3M9A A;  3IWZ A;  5H6Q A;  5ICC A;  4XBF A;  2IA2 A;  5FD5 A;  4BAY A;  2PG4 A;  5D5W B;  1YFH A;  5H6R A;  3TO6 A;  3COA C;  3KLO A;  1S8N A;  1MJB A;  4EGZ A;  2ZFW A;  4GCV A;  1H0M A;  1LDK B;  1ZYR F;  1U5T A;  4EM1 A;  2X4H A;  1RZ4 A;  1G6N A;  3BWG A;  4R1H A;  5ILU A;  1F9N A;  4OIP F;  1FX7 A;  2JPB A;  2NAZ A;  4A0Y A;  5HS8 A;  2D45 A;  3E6C C;  1MDM A;  2CGP A;  2YU3 A;  2NYX A;  2VE9 A;  1S29 A;  1FPQ A;  5ICF A;  1D8K A;  2P8T A;  3WE2 A;  4I09 A;  1GXP A;  3CUO A;  5FGM A;  2F5F A;  1LB2 A;  2LDU A;  3KET A;  4LJZ F;  4ZZD A;  2FMY A;  1HSJ A;  2PMH A;  3K2Z A;  3KP7 A;  2R7F A;  1EH7 A;  4EGY A;  3ABT A;  2VE8 A;  3HSR A;  1QGP A;  4UVB A;  4TV7 A;  2DBB A;  4MQ9 F;  1R5G A;  1FBS A;  1K78 A;  1G3W A;  2GQQ A;  1IAW A;  2G9W A;  4MHG A;  4IVN A;  1G3S A;  4P9F A;  2QBY B;  4P5O A;  2OA4 A;  1LNW A;  5L3E A;  4O3M A;  4XSX F;  2YR2 A;  3AAF A;  4MTE A;  3J80 K;  1QPM A;  3SQN A;  1DP7 P;  1LQ1 A;  3T8R A;  1IN7 A;  2JSC A;  1LJ9 A;  3ECH A;  2MA3 A;  3J7A O;  2HGC A;  3K1P A;  1ZLJ A;  1YLF A;  1CF7 B;  2TDX A;  5FO5 A;  1G3T A;  3IRR A;  2BEO A;  2EFW A;  3WTZ A;  3W6K B;  3BZ6 A;  5HLH A;  5HDN A;  2GA2 A;  3GYH X;  2CW0 F;  2OZ6 A;  5BPD A;  3LAJ A;  2Z3Y A;  3FWE A;  5ILV A;  3KZZ A;  1OPC A;  1FBQ A;  1R36 A;  3J81 Z;  5ICG A;  1ON1 A;  1W5T A;  2O6G E;  1Z05 A;  2M8E A;  4RGS A;  2GZW A;  2UXX A;  4BYY A;  3V8K A;  3RPU A;  4L9J A;  3ZMV A;  4AIK A;  2W57 A;  2COM A;  4IPA A;  3GUD A;  5K5R A;  5A2Q Z;  3V8L A;  1FWZ A;  1LVA A;  1FLI A;  2ZNZ A;  4Q5S F;  2FE3 A;  4CIC A;  5DV5 A;  3ML6 A;  1XSX A;  4HF1 A;  3DKW A;  3O6B B;  2HFH A;  2P4W A;  3WTT C;  1P4W A;  2KKO A;  1BOA A;  4NB5 A;  2LNB A;  4MEY F;  5E18 F;  4I7H A;  2EV5 A;  5LRS A;  3E5U A;  2DT5 A;  1KA8 A;  1I1G A;  4ZYE A;  2G7H A;  1HKQ A;  1H9T A;  3CDH A;  3ABU A;  1WWX A;  1XCV A;  2O8X A;  1GVJ A;  1UST A; 
#chains in the Genus database with same CATH topology
 4CCM A;  3DTK A;  3OYM A;  1BI2 A;  1YE9 A;  4S05 A;  4RB0 A;  4KJZ A;  2Y0S A;  4DW6 A;  3M8J A;  1G8X A;  4ZYG A;  3D0S A;  4ESJ A;  1BM9 A;  3OYJ A;  4B8X A;  2K4B A;  3C2H A;  4HF2 A;  5JFR A;  5LBQ A;  2HOT A;  2XPU A;  1N77 A;  4G7O F;  1QVT A;  1FNN A;  5LLQ A;  3ZQI A;  5M3F J;  5C4J J;  1UHS A;  1P7J A;  1MND A;  4FCY A;  2E1M B;  2HPI A;  4JX5 A;  3ZMU A;  1Z6T A;  5IOY A;  1FOY A;  1UHW A;  3ZGK A;  2L4A A;  4D7N A;  4KIG A;  3WTU C;  4BAC A;  1O3Q A;  1BR4 A;  1TT0 A;  4FT8 A;  4AD9 A;  1QNT A;  3G1O A;  4P96 A;  2H6B A;  1BI0 A;  3Q0V A;  3FKI J;  1RC9 A;  4DZJ A;  4EEF G;  3LSR A;  2COB A;  3LQQ A;  1HQC A;  1ORK A;  5FD6 A;  3M4O J;  3EET A;  3ESW B;  5LEJ A;  4RB1 A;  2IRF G;  1IN8 A;  3FHZ A;  3KP6 A;  3H5A A;  2BY3 A;  3CD6 I;  4C30 A;  3RSN A;  2ZB9 A;  3U1D A;  2L9N A;  1R58 A;  2X48 A;  5DM6 F;  1RR8 C;  2ZO4 A;  2XPV A;  4QIW N;  1K4T A;  2DU9 A;  2DAO A;  2DOD A;  2V6C A;  4HLY A;  3F8M A;  4UUT A;  2PEX A;  3ELK A;  3FZV A;  2E5N A;  2TCT A;  1P4A A;  3RTR A;  3BG7 A;  3ABL H;  2XKO A;  3DLA A;  3Q0W A;  3K4B A;  1JKQ C;  3JRD A;  4BH9 A;  3W2W A;  4IHT A;  1Y0U A;  4AUX A;  4X1E A;  3QRF F;  3E3V A;  4A3D J;  4I0B A;  2W25 A;  3RPQ A;  1TQP A;  3M8F A;  3OR1 C;  1J0R A;  2DFI A;  1I3Q J;  3WTY C;  2ICW G;  1L0O C;  4M9S A;  1XDU A;  4I01 A;  4K2E A;  5F0F A;  3W3C A;  3JCU C;  3FXQ A;  2VLA A;  2R5Z B;  4MTD A;  4ENM A;  3GTL J;  1OQY A;  2JZY A;  2L3D A;  4ZC3 A;  4AIH A;  2MD5 A;  3LA3 A;  4HSR A;  2DXI A;  3G6E I;  2GA1 A;  3LOC A;  1BW5 A;  1R1T A;  5IP9 J;  1YYV A;  4S0H B;  2XUB A;  4Y15 A;  5BS6 A;  3IAM 2;  2RAE A;  1V5E A;  4U0V A;  2D1V A;  3DFG A;  4KN7 X;  1JUP A;  2VJ4 A;  2HOE A;  2P5K A;  3S2D J;  1EV7 A;  4XKW A;  1XN7 A;  3FDY A;  4CO8 A;  1T98 A;  2DK8 A;  2XGE A;  2PN6 A;  1YI2 I;  1T2K A;  1UG0 A;  3JTH A;  3HOW J;  2XGD A;  3T0Y A;  5FJ8 J;  3Q9S A;  2LTP A;  2V4J C;  1UHM A;  4LLG F;  5EEG A;  1ZR4 A;  3ZMS A;  2Z9O A;  2XAF A;  5CVI A;  5KVR A;  2JA5 J;  4IHV A;  3CJR B;  2A6T A;  1FEX A;  4LD5 A;  4Y13 A;  2FBI A;  4GYG A;  3REO A;  1NK3 P;  4S04 A;  2HQA A;  3SEZ A;  3MN2 A;  1ZKG A;  2QA4 I;  3CJT B;  3CMM A;  2MGQ A;  1LFP A;  2DDA A;  4BJ5 C;  3OYN A;  4YFK F;  4HBL A;  2MAB A;  1FYM A;  2V1D A;  1B6A A;  4NC6 A;  1U8B A;  1MBF A;  2NVT J;  5F64 A;  3SFZ A;  1ETX A;  1P92 A;  1V5F A;  4E7J A;  3H3Z A;  5ED4 A;  2MFZ A;  2CJJ A;  1TNS A;  2K9S A;  4A3E J;  2E35 A;  3EUH C;  5L3D A;  4CSW A;  1B59 A;  2LVS A;  1BI1 A;  3WGH A;  3K6G A;  4M3B A;  2BBY A;  2P0W A;  3HOX J;  3DTE A;  3JRB A;  3OWT A;  3KP5 A;  4JYK A;  2CQX A;  4FX4 A;  1R00 A;  2L01 A;  2AXT C;  1S72 I;  1GHC A;  4M71 A;  2Y9Y A;  3DU5 A;  1GT0 C;  4A3K J;  1U5T B;  4ASN A;  3IWF A;  2HTJ A;  3JRC A;  3DEU A;  4XRM A;  3MQ0 A;  2GLO A;  1FSE A;  3GME A;  4MIM A;  3RQI A;  1WJB A;  3C18 A;  5K5Q A;  1ERD A;  4PJN A;  1Y0N A;  1QPI A;  1PYV A;  2KIQ A;  3I4P A;  4IRG A;  3KP2 A;  4A6E A;  4CCJ A;  4HQE A;  4I98 B;  1ZQ3 P;  2FEZ A;  4HPQ A;  4PK4 A;  2VJJ A;  2FNA A;  3EUH A;  2CUF A;  3F8N A;  3IKV A;  5J1R A;  1MMA A;  1WCM J;  5HLT A;  2I5U A;  2ZJP F;  4OIQ F;  3I71 A;  4LG0 A;  1VQ9 I;  2OTL I;  4IF4 A;  3OSF A;  1JUM A;  1IO2 A;  4G6D A;  5DCM B;  4BL0 B;  1X2M A;  4DYQ A;  2FML A;  2E2H J;  2L7M P;  3I59 B;  3J81 K;  1UG2 A;  2DK5 A;  2IW5 A;  4ZYD A;  4C2M J;  1ZRD A;  2A5Y B;  5H20 A;  2DLL A;  1DU6 A;  2P6S A;  4RBO A;  2HQR A;  1MD0 A;  2YPR A;  4P9U A;  3GZ5 A;  1O7F A;  1OR7 C;  3GTM J;  1N75 A;  2IS4 A;  5L3C A;  1BIA A;  4ZTJ A;  3GCM A;  4RGX A;  4BE1 A;  3KP4 A;  1IN4 A;  1KQ0 A;  2CQ7 A;  3RKY A;  1I6H J;  3OYC A;  3HOZ J;  1F43 A;  2NS0 A;  4ANJ A;  1WJ5 A;  2LF7 A;  2WWY A;  4JBA A;  2QSF X;  4BHP A;  1IV8 A;  4IRH A;  4NUB A;  3W2A A;  4L9T A;  3R4K A;  3S1N J;  4DOZ A;  1RNL A;  3V8J A;  2D1H A;  4EAT A;  3F3X A;  1FOX A;  1Z3Y A;  1IN5 A;  2F4I A;  2R7D A;  4RAF A;  2R5Y B;  4J00 A;  2PJP A;  4ITV A;  1YTY A;  1R7J A;  3E1S A;  1GDT A;  3FM5 A;  2F4O B;  3W6V A;  5GAE J;  2PJR B;  1O3S A;  2XRN A;  4RB2 C;  2M45 A;  1OR7 A;  1IRZ A;  5LFA A;  3F8F A;  3JW4 A;  1YQA A;  2EA4 A;  3ZMT A;  3K2A A;  2EJR A;  3V42 A;  2MYS A;  2JJ7 A;  3BLY A;  4OMZ A;  4MNU A;  3HOU J;  1TZL A;  3HOS A;  3B02 A;  4HF0 A;  3BOQ A;  4FE4 A;  3N97 A;  3EYI A;  4G6Q A;  2ME6 A;  5ERI A;  4I0A A;  4YII A;  2W4S A;  3WG7 H;  1IG7 A;  5FKN A;  1SAU A;  2OCC H;  3H36 A;  2VQH A;  4IJA A;  3HKZ N;  2LBF A;  3OYG A;  2O61 A;  4XNF A;  1NH3 A;  3HPG A;  3F6O A;  2ESH A;  4M3E A;  3HB9 A;  1SC7 A;  2A3S A;  4M73 A;  3S1Q J;  1WHU A;  4P1W A;  3LSM A;  2M5W A;  3DPL C;  3HG9 A;  2XB5 A;  2Z5U A;  1B1B A;  4E4H A;  2JWT A;  5FRN A;  3L2Q A;  1O3T A;  1HKS A;  3DKY A;  2HNH A;  2MSY A;  3PFY A;  3Q3S A;  2Y48 A;  3VDX A;  4OMY A;  2DPU A;  1T38 A;  5K7H A;  2KJC A;  2X9D A;  2JA8 J;  1HBX G;  2BHY A;  1T08 B;  3QOP A;  1M1E B;  4BXX J;  4ESF A;  3TP0 A;  4DBR A;  4HRI A;  2M9H A;  1LDJ A;  1RUO A;  4KMF A;  1H88 C;  4XR6 A;  5E8G A;  4DIQ A;  5FLV A;  2DQL A;  2EV0 A;  5E1Z B;  3BG5 A;  4V2G A;  1P4X A;  2DFE A;  3F21 A;  3GFM A;  2A6E F;  1SD5 A;  4LLL A;  1R6R A;  3QU3 A;  1PUF B;  1QU3 A;  2JTV A;  2Y31 A;  1QVU A;  2R7V A;  3AG4 H;  4GFB A;  3VFZ A;  5D4S A;  3CC7 I;  3EQL F;  3PFI A;  4KUM A;  2H27 A;  4P55 A;  1UJ8 A;  3J7Y J;  3FMS A;  1I50 J;  2OD5 A;  1ACI A;  2LY1 A;  3IC7 A;  2L9R A;  5ICE A;  2VAS A;  1FZP B;  3CUQ B;  3Q0U A;  2FXA A;  3OIP A;  3H0D A;  1Q1V A;  1SVM A;  4GRI A;  3S3O A;  3Q9V A;  1GVD A;  3K4M A;  3JAM K;  2ZJQ F;  1QBJ A;  3E5Q A;  2KFD A;  2WY8 Q;  4FAS D;  1B4A A;  2LYC A;  3RKQ A;  3FBN B;  2R7O A;  5E79 C;  1K6O A;  3E6M A;  3TL4 X;  2PMU A;  1YW7 A;  3BR5 A;  4M9X A;  1MJA A;  1MBK A;  2IEK A;  1N25 A;  1FYK A;  1ULY A;  2A61 A;  2QVO A;  1Z0X A;  3A01 A;  4CCO A;  3H35 A;  3KX2 A;  3R0J A;  2YU9 J;  3OR2 C;  1FOW A;  2XV4 S;  3HKZ A;  3O8G A;  4W97 A;  1VQM I;  4CXF A;  2V9K A;  2M30 A;  4FHT A;  2E1C A;  1Y39 A;  2MLG A;  2YUS A;  1U2W A;  3KIO A;  4DBQ A;  1H9G A;  2XAH A;  3RKW A;  1UFM A;  4EVI A;  1QZY A;  3LST A;  4F92 B;  2JRT A;  4IHX A;  2IA1 A;  3HYI A;  4O5V A;  1LE8 B;  1JT0 A;  1SD6 A;  3CF5 F;  2JPC A;  4B4C A;  2HR3 A;  4FQG A;  2AQE A;  2UZK A;  4EJO A;  1OYY A;  2QCO A;  1HCR A;  5FFX A;  4II3 A;  3LSI A;  2WAQ N;  2LF8 A;  4HV5 A;  5F0H A;  2OF7 A;  4XN0 A;  1KU7 A;  5JR3 A;  4YIR X;  3VOE A;  3Q5F A;  3ZN0 A;  1WH7 A;  4UVC A;  5DTD A;  3QWL A;  1OCZ H;  4F55 A;  1WJC A;  4QLC U;  5CVV A;  1JJ6 C;  3HPH A;  1OCP A;  2NVX J;  1E0E A;  5IPA A;  4XRF A;  4NDL A;  2CYY A;  2MW8 A;  2CW7 A;  4BJT A;  2F5C A;  3TOA A;  2FNP A;  3BDD A;  1XC5 A;  2EWN A;  3HRT A;  2K85 A;  4O6J A;  2D5V A;  3PQJ A;  4E7H A;  4OU0 A;  2JUC A;  2EIK H;  3HRS A;  4RB3 C;  5E20 A;  5J1Y A;  4Y4R A;  5JLX A;  1CQT A;  1O7L A;  1D3Y A;  1XDS A;  4PJM A;  2VON A;  3GTP J;  1ETY A;  4N9I A;  1LEA A;  3K4N A;  3CCY A;  4MLO A;  3NQO A;  3OIQ A;  5CQE A;  5DD4 A;  3P5J A;  1XPX A;  5EYR A;  1WFX A;  1W7P D;  2E36 A;  2LC2 A;  2CUE A;  1LKX A;  3OIO A;  3VSL A;  2QM3 A;  2OZU A;  1U9O A;  1XSD A;  1R23 A;  3IKT A;  3CC4 I;  1T39 A;  2LG4 A;  3I56 I;  1WI3 A;  5GPC A;  4M74 A;  1AOY A;  3JTG A;  1WJE A;  5D6E A;  2WAE A;  4IRI A;  1TBX A;  2STT A;  2HQ5 A;  1NHA A;  2ZSH B;  5EZH A;  4RLQ A;  1HKT A;  3OOP A;  5AON A;  2CW8 A;  2H8R A;  5J8F A;  1I27 A;  2LRD A;  1W7P A;  5GAG J;  4X0G A;  1QZE A;  3L9F A;  3M8E A;  5GAD J;  4WWC A;  3CCE I;  2G7U A;  2WA0 A;  4F3Q A;  2XF6 A;  1WI9 A;  4LB5 A;  4XIC A;  1GXQ A;  1Z67 A;  2H8W A;  1ZAR A;  2Y0S N;  4KT5 C;  1IXS B;  5B5E C;  3MEX A;  5J40 A;  3P9C A;  1QHH D;  5CJ9 A;  5GTI C;  1E3P A;  2WAQ A;  5F1J A;  4XOT A;  4XLP F;  2IXS A;  1P2F A;  2X6W A;  1MBE A;  5CLS A;  5HS7 A;  2DA1 A;  1Z7U A;  1MH4 A;  4QWQ A;  1MSF C;  2J5O A;  3EPZ A;  1T8I A;  5CYV A;  4M72 A;  4I76 A;  1BL0 A;  2H6C A;  1S6L A;  4C9Y A;  1XTA A;  2DO7 A;  2MD0 A;  3D5L A;  3O2P E;  4F7Z A;  3FXU A;  4UVA A;  1XMX A;  1RIO H;  1VQ8 I;  4LFU A;  3ZQQ A;  4HA8 A;  4ENK A;  2GXA A;  2OV7 A;  1ONV A;  3A4C A;  3CJN A;  2FBK A;  1G2H A;  3JSP A;  2F6C A;  1IV6 A;  3MCZ A;  4CGZ A;  3FK7 A;  5C3E J;  1XS9 A;  3FM3 A;  3KEO A;  3DPT A;  4OOI A;  4BHC A;  1IGN A;  3KEQ A;  1I3A A;  2WAD A;  3IUO A;  2K4J A;  2YX4 A;  1HLV A;  1JE8 A;  1Z7L A;  4IEJ A;  5FKM A;  3OYD A;  2CH0 A;  4HX7 A;  3IP4 B;  1SEU A;  2QLZ A;  1GV5 A;  3WTS C;  3RCO A;  1XGS A;  3HHH A;  1R1V A;  3BJO A;  3CCS I;  1PP7 U;  5LRR A;  3K7A J;  1EA3 A;  3U1K A;  2E7W A;  4BDY A;  1T0F C;  2Z16 A;  2ME0 A;  4C2U A;  2LY9 A;  1VI0 A;  3PM1 A;  2KP6 A;  3FF5 A;  4PCQ A;  3WTW C;  2HOS A;  2K86 A;  4RGR A;  1XGO A;  4CZZ A;  2CRG A;  2HVQ A;  1C0W A;  3PUB A;  4U7D A;  2CG4 A;  2WTE A;  1VQN I;  3LFU A;  3ZQ7 A;  1MNE A;  4LMY A;  3F9K A;  3EDP A;  3BR3 A;  1KYZ A;  2JT1 A;  2VKD A;  3I55 I;  3KYL A;  3K10 A;  4QSH A;  4A93 J;  4BBR J;  4NNJ A;  3UKG A;  2FOK A;  2VPR A;  3OSG A;  3BQZ A;  2Z1D A;  2XAQ A;  2BY0 A;  4DZP A;  3FKJ A;  1T0F A;  1FMW A;  4BQO A;  1SD4 A;  3OS0 A;  3GLX A;  5LHH A;  4AIJ A;  1JJ8 C;  1OYW A;  2OAZ A;  4LOC A;  3F72 A;  2QSH X;  1R4M B;  1ZGJ A;  2EFO A;  1JHF A;  5IP7 J;  2R93 J;  2K5C A;  4L18 B;  2HEO A;  2KIU A;  1B72 B;  2QWW A;  2Z2S B;  2HKO A;  1RPW A;  2M3A A;  3M07 A;  5L3F A;  2IS1 A;  3QU6 A;  3ISP A;  2DN0 A;  2VBX A;  3TO7 A;  2KIS A;  4D0P A;  4U7B A;  3OYK A;  1MBJ A;  1REP C;  2V9V A;  3ZPL A;  1TNT A;  2FQ4 A;  4EM0 B;  3ZR8 X;  5B66 C;  2VBW A;  1F5T A;  1FTT A;  3ERM A;  2KL4 A;  2IT0 A;  2B0L A;  3GFJ A;  3C2B A;  2EIM H;  2Y0M A;  4HNU A;  2L7K A;  5EG0 A;  4JQF A;  4C3I J;  2OCE A;  1PDN C;  1MBG A;  4IHW A;  5FKL A;  2HS5 A;  2IGK A;  1Y8Q B;  2NVQ J;  1R5I D;  5DEQ A;  4BY7 J;  5J6X A;  1YJ9 I;  4N9H A;  3PO3 J;  3HL2 A;  2EK5 A;  3SDG A;  1DU0 A;  3CTA A;  2WAF A;  1U6G A;  2XVC A;  2ZCW A;  3LSJ A;  4G12 A;  5F6F A;  1RI7 A;  3EUA A;  4M6Y A;  2KDO A;  2F5D A;  2M0M A;  4XMY A;  5TRD A;  1B9N A;  2VQC A;  5BPI A;  3OV8 A;  1XGM A;  2ELK A;  3HUG A;  1TTY A;  3BP8 A;  3GX4 X;  2K27 A;  3JAM Z;  2PBI A;  3RIR A;  1ZEL A;  4XN3 A;  3ZQG A;  1IN6 A;  4OIO F;  4OIR F;  3L2C A;  1MMN A;  3WE3 A;  1JGS A;  2NRA C;  2F48 A;  3ULQ B;  3FMR A;  3HGY A;  4CYC A;  3PIP F;  1DQU A;  4KIF A;  2DW4 A;  3GTJ J;  2VT3 A;  3C1D A;  4HX4 A;  3BT9 A;  1ZTR A;  2FBH A;  4LG3 A;  2F2E A;  4PUS A;  4RLF A;  1WJD A;  3KYD B;  1U78 A;  1FMV A;  1OCO H;  4H4K C;  1G3Y A;  1XD7 A;  4AVZ A;  2LSO A;  1SFX A;  4BHB A;  2XC7 A;  2VBZ A;  2QBY A;  2XSD C;  4AC0 A;  1XG1 A;  2ZME C;  2LBF B;  3TGN A;  2O7O A;  3CME I;  2ADU A;  4XRS A;  2NS8 A;  1HW5 A;  2BE5 F;  5F04 A;  3S2W A;  4ZZL A;  2Z33 A;  2M34 A;  3MWM A;  3I4N J;  1KU9 A;  4GO1 A;  1MH3 A;  3K69 A;  5GAH J;  3PNY A;  5JVT A;  3LSG A;  4IKF A;  4E7I A;  1DUX C;  1TWH J;  1BJA A;  2DA2 A;  1PJR A;  5DYM A;  4KDP A;  4HG2 A;  3P9K A;  3ZCO A;  2HVS A;  1W4M A;  2BVM A;  5D5V B;  3HIF A;  5ILS A;  2Q2E B;  3BTI A;  3OMY A;  2XF7 A;  1H89 C;  5CKT A;  1K83 J;  4FX0 A;  2STW A;  1V5G A;  1CF7 A;  4BEH A;  2ZME A;  1ZHF A;  2J5P A;  1D5Y A;  2XRO A;  1V3F A;  2W48 A;  4A0X A;  1EJ9 A;  2X1E A;  1VFC A;  3VWB A;  4J19 A;  3CZ6 A;  3GBG A;  2LKS A;  3M7G A;  1OYI A;  2L4M A;  2E7X A;  3PNT A;  2LKX A;  1BA5 A;  1QO0 D;  4XID A;  5EGO A;  3CMY A;  4H0E A;  1X1A A;  2JVG A;  2EFN A;  3ROU A;  1XSV A;  5IT9 K;  2L02 A;  1R49 A;  3SZP A;  3F0C A;  4BY1 J;  5M5X J;  1BBY A;  2W7N A;  3G3Z A;  4ETS A;  1FOK A;  1UCR A;  5J1U A;  1WH5 A;  2DI3 A;  3KCC A;  4A3L J;  1BN5 A;  1VQL I;  2XAG A;  2Y30 A;  2CQQ A;  4EJV A;  2K9Q A;  4PDK A;  5HDK A;  1MGT A;  2MC3 A;  2ELH A;  4RAY A;  3QYF A;  2DTR A;  1K7A A;  2JMW A;  4RGU A;  3GTO J;  5GTH C;  3WG9 A;  5BOX A;  1DPR A;  1QZZ A;  3NRV A;  4V19 K;  4MGR A;  4KYW A;  4I2O A;  2RC4 A;  1Z21 A;  2X0L A;  4Q48 A;  4IHS A;  4HDU A;  1GUU A;  3CLQ A;  4A3G J;  2HXI A;  4A12 A;  1S7E A;  4UB8 C;  2MH2 A;  3J7A Y;  3JRA A;  2EIL H;  4Y52 J;  2HYJ A;  3V4G A;  1JTY A;  4JX4 A;  2XB0 X;  3BTJ A;  4D7M A;  1A04 A;  3OL4 A;  1XGN A;  2VC0 A;  4U88 A;  5B1B H;  3QOE A;  4I6Z A;  1KGS A;  2LKP A;  4A3I J;  3GZ6 A;  4UUS A;  1AWC A;  1MDM B;  4CA0 A;  4HST A;  1J75 A;  3CF2 A;  3HJE A;  1I1S A;  2L2O A;  2EZL A;  3C3W A;  5E1X A;  4PFO A;  2JQ7 A;  1D5V A;  2E1M C;  5JVG F;  5EZG A;  1OCT C;  1U8R A;  1WRJ A;  3PIO F;  3S32 A;  2O9L A;  4A3M J;  3KE2 A;  4A3J J;  3LA2 A;  2QQ8 A;  2HZT A;  3VYR B;  4M3G A;  4CZC A;  1IF1 A;  2M2E A;  2KZV A;  4WF2 A;  5JI6 A;  1YRN A;  1KQ8 A;  5CVJ A;  1OMI A;  2RQP A;  2LD5 A;  3DP7 A;  3HHG A;  2DCE A;  4U0Y A;  1BR1 A;  2E2J J;  1A36 A;  3GFI A;  4BQA A;  2HKX A;  3L2U A;  2VN2 A;  1G4D A;  4BNC A;  1IXR C;  2QQA A;  3HSF A;  1AKH B;  2RQQ A;  4RM2 A;  3CCJ I;  2HPM A;  4M6V A;  5KNL A;  2XAU A;  2DMN A;  2DQR A;  4E7K A;  4HNV A;  3L2R A;  2HYG D;  4XLE A;  3PJR A;  4BXU A;  3KZY A;  1D0Z A;  1APL C;  2LR8 A;  3ZMD A;  2ESN A;  2E1N A;  1K78 B;  3ECO A;  2M7B A;  5AIQ A;  5DUI A;  1YIT I;  2H1K A;  2RNJ A;  3E6B A;  3VB2 A;  1T6S A;  5IOZ A;  1MMG A;  3H0G J;  3HTU A;  1SAX A;  4ABZ A;  5HLI A;  2IBD A;  4LIT A;  1YW8 A;  2ISY A;  2WV1 A;  1DGW Y;  3X2Q H;  3D5R C;  3HOV J;  4E6K G;  3MVP A;  2DTZ A;  3K4L A;  1VQ7 I;  1U0J A;  4FIS A;  3H9J A;  3P9I A;  3TMO A;  2IP2 A;  4C3H J;  1HDP A;  3HC7 A;  4RS8 A;  4B1R A;  5L3G A;  2DFF A;  4XLF A;  2B63 J;  4BJ6 C;  3IH4 A;  2GXB A;  3F6V A;  1HST A;  2TRT A;  4DNC A;  3ZQC A;  1FP2 A;  1NK2 P;  4G7Z F;  1J5Y A;  2FX0 A;  1T33 A;  2CQN A;  4LIV A;  4N4O B;  1Z91 A;  1V4R A;  2BZT A;  1I5Z A;  1MZB A;  3WTV C;  3LNQ A;  1R9T J;  1RKW A;  2O8K A;  2EZI A;  1R4N B;  4U0W A;  4XKV A;  5D4R A;  3HSE A;  1SAN A;  3AL0 B;  3CCV I;  3HBL A;  5E3O A;  4MEX F;  1ZK8 A;  1JGG A;  4NHJ A;  1TLH B;  3A2K A;  4CCN A;  5M5Y J;  1RRJ A;  1PP8 F;  1MMD A;  1LPQ A;  2W82 A;  2F5E A;  1EH6 A;  5C44 J;  3DQV C;  2KHM A;  1FTZ A;  1HDD C;  2FUG 2;  3K1M A;  4BGD A;  4WX9 A;  1Y8R B;  2A05 A;  3GFL A;  3TKY A;  3KFW X;  2EFP A;  1KU3 A;  4DJA A;  5LGT A;  2BYV E;  2H94 A;  1YG2 A;  3OYH A;  3I4M J;  3AG3 H;  4RM3 A;  3H5N A;  3ZXS A;  2R5Z A;  3BCB A;  1TWG J;  3A0B C;  4OWR B;  3G73 A;  2P5L C;  1ZRC A;  2EFQ A;  2FRH A;  4M3D A;  2A68 F;  4AWX B;  2ZBK A;  3WTX C;  3JSO A;  2HDC A;  1NG6 A;  4KIT B;  2HTS A;  4BE0 A;  2DYS H;  2DMU A;  2V1U A;  5DD8 A;  3DBR B;  1ETQ A;  4YIF A;  3C7J A;  3L7W A;  5IY5 H;  2HWV A;  3A03 A;  1ZN2 A;  3TOB A;  3GVA A;  4CHU A;  3LA7 A;  4LK1 F;  2RVC A;  1IC8 A;  3I5U A;  3HTS B;  4Y17 A;  2K40 A;  3QPH A;  3SJM A;  1LUJ B;  1ON2 A;  2CFO A;  3VEP A;  3HOY J;  1X4P A;  3ASN H;  4D9J A;  2DMP A;  3V7R A;  4B44 A;  3GW2 A;  2VUM J;  1SVL A;  4LK0 F;  2Y2Z A;  5J8C A;  3CC2 I;  3I58 A;  4W1U A;  1WZ2 A;  4A69 C;  3HM5 A;  2HXO A;  1X1P A;  3WU0 A;  2KJB A;  2D2W A;  2KIM A;  5LGN A;  2BGC A;  5JHF A;  3BR2 A;  2VPL A;  4C2T A;  2XGX A;  2ZXW H;  4B3X A;  3BC8 A;  3H1C A;  2HYF A;  5E3M A;  1EKE A;  1RKT A;  1MJ9 A;  4J01 A;  4A3B J;  4PGG A;  3OS1 A;  2F4M B;  2FU4 A;  3WU1 B;  2V9P A;  4ON0 A;  3LAP A;  1B8I B;  1YIO A;  2FA5 A;  2QGU A;  2IS2 A;  4PJL A;  1JKR C;  5HNF A;  5DCF A;  3QAH A;  3F22 A;  2R92 J;  1XCB A;  3S3N A;  3FMQ A;  1YOV B;  3S2H J;  3HEF A;  4YG2 F;  2PMZ N;  5FFZ A;  4IQJ A;  3HXL A;  5KHD A;  3ZMZ A;  2VOD A;  3TDU C;  4L9N A;  4IQ4 A;  4PGH A;  5J3L A;  1FP1 D;  3CO6 C;  1F1Z A;  3BJ6 A;  4IOC F;  2DMT A;  2P6T A;  2DT6 A;  1TWC J;  5D5X B;  5D5U B;  5BNG A;  5E8I A;  3F8B A;  5L3B A;  4XON A;  3BTL A;  1VF9 A;  1B9M A;  2HQN A;  4CCL A;  1ZG5 A;  2ZXH A;  3SEQ A;  2HDD A;  1IZ1 A;  4JX6 A;  1VTN C;  1TT5 B;  1WJF A;  5EJC A;  4NQW A;  2DJI A;  3V7C A;  2UWM A;  2ZNY A;  4UY8 I;  3CQZ J;  3BTC A;  3LSP A;  1J59 A;  3WU2 C;  3M1E A;  4YEL A;  3VPR A;  1KU2 A;  3N4M A;  1KYW A;  1U9N A;  3T1B A;  5IT9 Z;  3CDL A;  3LSK A;  1MSE C;  3MZ8 A;  4KA4 A;  2R7S A;  1V54 H;  3ABK H;  1HW2 A;  5DCM A;  3S8P A;  3GEZ A;  1TW3 A;  3E5X A;  5HOD A;  3I59 A;  4I99 C;  1SMY F;  2EH3 A;  4BS9 A;  2NNN A;  2RV8 A;  1RR7 A;  3MZY A;  3ONQ A;  2DOE A;  2ZSI B;  2OPT A;  1BOB A;  4HQM A;  2MLK A;  1YO5 C;  3GO5 A;  4PJ0 C;  2JSP A;  2KLO A;  2FSW A;  3R60 A;  3BG3 A;  5JHU A;  4MFE A;  4Y3O A;  1SMT A;  4EM2 A;  3CCU I;  3CP2 A;  1QA6 A;  2P7C B;  2CSO A;  5BQT A;  4ENJ A;  1LFU P;  2BXZ A;  2QEN A;  1Y1W J;  5IYC J;  2P5V A;  4KNY A;  3H9G A;  2OBP A;  3DLL F;  1E2X A;  4A2U A;  3FXL A;  2R5Y A;  1WKM A;  2M4K A;  3OYA A;  2AS5 F;  2PMZ A;  3QP6 A;  1ETV A;  2PJR A;  3BRO A;  3QP5 A;  3DWL E;  4HOB A;  4WXD A;  2IVM A;  5B3S H;  1DDN A;  2A6H F;  1IW7 F;  4PSW A;  3ERE D;  4Q47 A;  1X1C A;  1OCR H;  2KIF A;  2CWE A;  2AQF A;  2ZJ2 A;  1VQ5 I;  2Z99 A;  4ENN A;  2B7E A;  3DEE A;  3F8C A;  4ESB A;  2VKV A;  1XB4 A;  4IL6 C;  2B9S A;  2L54 A;  2JA6 J;  3OS2 A;  1BW6 A;  4EQQ A;  2BVL A;  2V79 A;  1I6X A;  2QKM B;  2V7F A;  1TL8 A;  4UB6 C;  5J4Y A;  3GLL A;  4B43 A;  2L9S A;  2R3S A;  1W0U A;  3OY9 A;  2M8G X;  2ZKZ A;  2ZME B;  5CPR B;  2BV6 A;  2M4G A;  1XMA A;  3MFK A;  3B73 A;  1L3L A;  2K3P A;  2QUF A;  3L2V A;  2EIJ H;  3ZP5 A;  4GYI A;  2UXN A;  2LY2 A;  2L0K A;  4FE7 A;  4E70 A;  2G0E A;  4CCK A;  5EGO B;  3QOD A;  5FLM J;  3CCL I;  3CUQ C;  2VJI A;  4Y7N J;  3OYF A;  3T8T A;  3IH3 A;  4A3C J;  1FIA A;  4BKX A;  2O3F A;  1FT9 A;  4KFC A;  4OIN F;  3S1R J;  2AXL A;  4QPO A;  1QRY A;  2GWR A;  3K70 C;  2JVH A;  3CES A;  1BIB A;  3K70 D;  2FQ3 A;  2QQB A;  5D8K B;  3RYP A;  1ZG3 A;  4F91 B;  2KRH A;  5LHI A;  4G7H F;  2IPQ X;  1DGR M;  4L9V A;  1PUF A;  3AKZ A;  4B09 A;  2O5R A;  3BR0 A;  4LGW A;  3FIS A;  4IO9 F;  3QYB A;  2VXD A;  5EEH A;  3SHF A;  3I53 A;  3DBL B;  4OAY A;  1ZGA A;  2A69 F;  3VYU B;  1JXS A;  3W2V A;  5E3N A;  1USS A;  3BCA A;  1IUY A;  3CUQ A;  2R7W A;  1QHG A;  2FOW A;  3WOD F;  3RJP A;  4XKC A;  1TW2 A;  3RYR A;  1EH8 A;  2KPM A;  2VL8 A;  3M1C A;  3KZI C;  3GZN B;  2R4G A;  3FIW A;  2VKE A;  4Q4Z F;  1OIS A;  3ZQH A;  4XK4 A;  1S7O A;  3FXM A;  3O3K A;  4F93 B;  1J09 A;  1RES A;  3TED A;  3KYC B;  3OYB A;  5FLX Z;  2PFB A;  3JR9 A;  2VQG A;  2K9L A;  3DCF A;  1VQK I;  2K3F A;  1D1A A;  4BQQ A;  2V6E A;  3H92 A;  2XKP A;  4L5E A;  4LIU A;  1GLN A;  3BZC A;  4L5I A;  5K1Y A;  3CMA I;  2VOP A;  1TQM A;  1TP4 A;  2BW3 A;  4B47 A;  2NOG A;  2JK3 A;  3BJA A;  1FC3 A;  2EZH A;  3BG9 A;  2KT0 A;  3LQR A;  1DPU A;  2HU9 A;  3EYY A;  2YSR A;  2VT2 A;  5TGT A;  1YIJ I;  1IRG A;  1TQI A;  1UEL B;  2VIX A;  4XKB A;  1RUN A;  4LG0 B;  4UV9 A;  1POG A;  4IHY A;  4WXH A;  2NVU B;  3R6S A;  3K1N A;  4A0Z A;  3L09 A;  4HW0 A;  4WK8 F;  1R1U A;  1O57 A;  2E71 A;  4MQV A;  3E97 A;  4XM3 A;  3IL2 A;  3ASO H;  1A31 A;  3S1M J;  1LE8 A;  1YRN B;  3PSI A;  2DOF A;  3AG2 H;  4EV0 A;  2GXG A;  1R22 A;  2X6O A;  3PO2 J;  4OAZ A;  1GV2 A;  4BBS J;  1TWA J;  1PUE E;  5TJJ A;  2HI3 A;  3CCM I;  3HDD A;  1JHH A;  3IRQ A;  3E7L A;  2QQ9 A;  3BG6 A;  4LB6 B;  3CCQ I;  2Q0O A;  3PL8 A;  4GGG A;  3K0L A;  3KLN A;  3NWT A;  3PQK A;  3OYE A;  4YFN F;  4CDG A;  1BC8 C;  1X2N A;  1X1B A;  2HZD A;  3ZQL A;  4KMU X;  3G71 I;  3AFH A;  1FBU A;  4KT6 A;  2VC1 A;  1MW7 A;  3RKX A;  2RGV A;  1Z9C A;  2ISZ A;  2VBY A;  1X1D A;  5E1W A;  4NBQ A;  4DQ2 A;  1S3J A;  3D1N I;  4KIS A;  2VI6 A;  2XSJ C;  4FTH A;  1ODD A;  1P9Q C;  2ECB A;  2EPF A;  1PVE A;  1SD7 A;  4XLA A;  4ZYA A;  4M9Z A;  2GBY A;  2XAJ A;  4XLN F;  1VND A;  5FB2 A;  3CO7 C;  4WXC A;  1LDD A;  2DA5 A;  3O8H A;  3IV5 A;  1XMK A;  1A6I A;  5HS9 A;  1BI3 A;  4X6A J;  2I8D A;  4HLX A;  1LEB A;  1OJL A;  1W36 C;  5CVU A;  2CUZ A;  5HLG A;  3H3U A;  2IAI A;  3QYE A;  4A6D A;  3CJQ B;  3JRG A;  5CVR A;  1W36 D;  1KQ9 A;  2I10 A;  1X3W B;  2NXN B;  4HV6 A;  3TDZ C;  2R7X A;  2QSG X;  3P7N A;  5KCM A;  2M0C A;  5M5W J;  5LGU A;  2IGM A;  3KEY A;  3UR3 C;  4PZJ A;  4N0B A;  2DA7 A;  2CS3 A;  4LLN A;  3VOD A;  4XRS G;  1UZC A;  4ZJZ A;  4A3F J;  1IRF A;  3GXO A;  2JA2 A;  2WV0 A;  2MH9 A;  1YS6 A;  4II2 A;  5HVQ C;  1DP3 A;  3BPV A;  3N05 A;  1K6Y A;  2E5Z A;  5LHG A;  3ZQF A;  2DJN A;  3K4C A;  2IJL A;  1SVO A;  3GTK J;  3NEU A;  4XL9 A;  4DYC A;  2RN7 A;  2KZG A;  3I0T A;  2L5Q A;  1D1B A;  1IRX A;  1IJW C;  2KRF A;  4HAM A;  3GWZ A;  2ACJ A;  2QYO A;  5M3M J;  5GP9 A;  4FET A;  3SFI A;  4G6T B;  3A0H C;  4B48 A;  3BY6 A;  2HDW A;  3K9T A;  1NTC A;  4UV8 A;  2GIZ A;  3MD2 A;  2E1O A;  3C2G A;  3PSF A;  5KK1 A;  5J4V A;  3K4K A;  4ZDP A;  3TBI A;  2XRL A;  3HRM A;  3LWF A;  5J47 A;  2EB7 A;  4QTR A;  3U2R A;  3HOT A;  3S15 J;  4EJU A;  4XSZ F;  6PAX A;  4GXO A;  2M7A A;  3CDI A;  3MAJ A;  1U3E M;  4MO7 A;  2DA3 A;  4BU2 A;  2A5W A;  3U9G A;  2MBF A;  2F5V A;  4HZF A;  4MFD A;  9ANT A;  3E6D A;  2ETH A;  2M1B A;  5FRO A;  4CH7 A;  3UNG C;  4CYD A;  4EJT A;  2WC2 A;  4A5N A;  1D1C A;  2KDZ A;  3VSK A;  3S14 J;  4R8H A;  4D5C A;  4F52 A;  2OQR A;  2XF5 A;  5AIP A;  4AU7 A;  3E0J B;  5DUK A;  2O03 A;  2EV6 A;  4GDF A;  2CFX A;  5F08 A;  2CV2 A;  4HDV A;  4M3F A;  2N8G A;  3H5R A;  5LEK A;  1S7A A;  2W84 A;  1WPK A;  2JRM A;  3TW7 A;  5H2F C;  4Z2Y A;  5EEA A;  3BR6 A;  2BY1 A;  1I39 A;  2XIG A;  3QPT A;  1Y1V J;  4JK1 X;  2P7V B;  3W6J B;  5D6F A;  2XPW A;  2IS6 A;  1W5C C;  2BHZ A;  2ID6 A;  3FBI B;  4NC8 A;  4R79 A;  2R7T A;  3H9Q A;  2L9V A;  3A01 B;  3TP3 A;  1A6Q A;  2V1N A;  5F1R A;  1AHD P;  1YX3 A;  4ZDO A;  4HYE A;  3FX3 A;  3DF8 A;  4PFP A;  3S17 J;  1IXC A;  3MMY B;  1JKP C;  3RZD J;  1AU7 A;  3IAS 2;  1VQ4 I;  2LK2 A;  3L00 A;  4IXA A;  2GAU A;  3SZT A;  3BPX A;  3J80 Z;  4KIB A;  3L1P A;  2GM4 A;  4KIC A;  4A5M A;  4PJJ A;  5F0C A;  3I9V 2;  3EUK L;  4BUP A;  5DDG A;  4G94 A;  1BC7 C;  1ZG1 A;  1OKR A;  2H09 A;  1S9H A;  4UNO A;  1UB9 A;  2VQL A;  3ABM H;  4B3A A;  1HXD A;  1LVK A;  2WBM A;  2EQR A;  1Q1H A;  1O3R A;  1KZH A;  5D8L B;  1ZAO A;  1WQ2 A;  4RAZ A;  1HW1 A;  3WHC A;  1G59 A;  3BQY A;  1JUS A;  2C6Y A;  4NQW B;  1R5H A;  3ZRG A;  4ZYH A;  2VKH A;  5GPA A;  5HNH A;  2OTJ I;  1YW9 A;  1YS7 A;  2DA4 A;  2RKH A;  1ZLK A;  2IGN A;  2GIV A;  1FYL A;  3ZOB A;  1K79 A;  3A1Y A;  1B72 A;  2BY2 A;  3B6A A;  5HOO A;  4WCG A;  2H1L A;  3F23 A;  1UAA A;  4UUV A;  1D0X A;  4RAG A;  4BXF A;  2K9N A;  1Y56 A;  3RDI A;  4RDU A;  1D0Y A;  3DU6 A;  2OQG A;  1O4X A;  5E17 F;  2X85 A;  1J9I A;  1IDZ A;  2R7Z J;  3TQN A;  1S5L C;  1VQO I;  1ZRE A;  2W24 A;  2XHK A;  3I3L A;  3LSH A;  2Q8K A;  3MKZ A;  4L0Z B;  3R61 A;  4QPQ A;  3WGG A;  3NAU A;  3LL7 A;  2RNG A;  2YX7 A;  3DBH B;  1FJL A;  2OU2 A;  4AVP A;  2X1C A;  4NC7 A;  1FSH A;  2PQ8 A;  5B1A H;  1BJZ A;  4UXN A;  1X3U A;  1A35 A;  3V7S A;  3ZN1 A;  3A02 A;  3G1M A;  3SXY A;  4JP0 A;  4KN4 X;  5HDG A;  2GOM A;  2CU7 A;  3FXJ A;  2NOJ B;  5A2Q K;  3T5X A;  2QZ8 A;  1SFE A;  3KP3 A;  4ZH4 F;  2DPD A;  1AA7 A;  1Z6R A;  3KPH A;  2QKL B;  3PNV A;  2W85 A;  5FKK A;  4PSX A;  2DA6 A;  2OJE D;  2ZJR F;  1ETO A;  2ZXJ A;  2OC6 A;  1WSU A;  1QQI A;  1J2X A;  1WGX A;  3I54 A;  2E60 A;  5K5O A;  1P6R A;  2LRE A;  3NAR A;  2W00 A;  2PLY A;  4Z6Y A;  2HOA A;  1SFK A;  3GTQ J;  3HRU A;  1W7P B;  1ITY A;  2CO5 A;  3OOU A;  4AYB N;  2X6X A;  5FLX K;  2LLK A;  2DDB A;  5IT3 A;  2UV1 A;  1Z1D A;  2Y75 A;  4G9Y A;  1X3Z B;  2XAS A;  1OCC H;  1YHQ I;  4XOR A;  1MBH A;  4BQN A;  4XQF A;  3TW6 A;  3FXO A;  4BE2 A;  2IA0 A;  2K02 A;  3CLO A;  3S3M A;  3VYT B;  1YJN I;  3DXJ F;  1X58 A;  5CQG A;  1MMS A;  4L5J A;  1ZR2 A;  1E3H A;  3LFK A;  3CP8 A;  3QPL A;  1E17 A;  2K7L A;  5E3L A;  1J7K A;  2M87 A;  2ZC2 A;  3FXR A;  2L7F P;  2R0Q C;  1ZH5 A;  4UHT A;  3DKX A;  1T56 A;  3J7Z I;  3I64 A;  5K7Z A;  3RI4 A;  4AM3 A;  3U21 A;  1P7I A;  3JRF A;  1YX5 A;  2CMP A;  1IUF A;  2NS7 A;  1FY7 A;  1V55 H;  1SFU A;  2EZK A;  2CUJ A;  2FF4 A;  2Q2E A;  2V26 A;  3MZH A;  2RDP A;  2NNY A;  3GF2 A;  4M6X A;  4L0Y B;  4BDZ A;  3JRI A;  2O0Y A;  4YFX F;  4HX8 A;  2Y9Z A;  1OLT A;  4XLH A;  3TO9 A;  2EA2 A;  1D8J A;  1MKM A;  2FJ1 A;  4G8X A;  2A07 F;  2JUG A;  3WGI A;  2K9M A;  4I02 A;  1Z3X A;  3AG1 H;  1F4K A;  5BMZ A;  3R0A A;  2VXZ A;  1K4S A;  1ZRF A;  1XX5 A;  1VQ6 I;  4EMS A;  2VOO A;  1W5S A;  2DMQ A;  1STZ A;  2V1X A;  2PI0 A;  3IHU A;  2VJ5 A;  4EJW A;  2CQK A;  2ZFU A;  1U5T C;  5FKO A;  1CGP A;  3DV8 A;  3S93 A;  1WVR A;  3M9A A;  4YEJ A;  1T95 A;  3IWZ A;  3JRH A;  1X19 A;  2KRC A;  5H6Q A;  3BZK A;  5ICC A;  4IX7 A;  4XBF A;  2IA2 A;  5FD5 A;  4BAY A;  2PG4 A;  1Y6I A;  3OL3 A;  4D5F A;  5D5W B;  1YFH A;  5H6R A;  1HF0 A;  2E34 A;  3TO6 A;  3KLO A;  1S8N A;  3COA C;  5TIS C;  4AYB A;  5JLW A;  2IGO A;  3MKY B;  1NG7 A;  1MJB A;  3IH2 A;  2AHQ A;  2QF7 A;  3RQ4 A;  2KMU A;  5KAI C;  4EGZ A;  2BW3 B;  2MC4 A;  2ZFW A;  4E7S A;  2LMD A;  4E7Z A;  4GCV A;  1MIJ A;  1H0M A;  1LDK B;  3QQA A;  1ZYR F;  5EF6 A;  2E19 A;  1Z77 A;  2X51 A;  4HNT A;  1U5T A;  4EM1 A;  2GOX B;  2W1O A;  4DYR A;  2X4H A;  1HOM A;  1RZ4 A;  3HGG A;  1G6N A;  3VYS B;  3BWG A;  2JA7 J;  2WY7 Q;  2DFH A;  1ETW A;  1W1W E;  2EIN H;  4R1H A;  4RMN A;  5ILU A;  2L7Z A;  2LP0 A;  1F9N A;  4JOM A;  2YS9 A;  4OIP F;  1K61 A;  1E3O C;  1FX7 A;  2JPB A;  2NAZ A;  2ECC A;  4A0Y A;  5HS8 A;  3CCR I;  3HZJ A;  3E6C C;  2D45 A;  1MDM A;  3QPS A;  2ELJ A;  5EG0 B;  1UMQ A;  4HEA 2;  2VB6 A;  3G1L A;  1A5J A;  2CGP A;  2YU3 A;  2AO9 A;  1F36 A;  3PUF A;  2NYX A;  1ENH A;  2VE9 A;  1HC8 A;  1S29 A;  2MG4 A;  5FRM A;  1FPQ A;  3SYT A;  5ICF A;  1D8K A;  3DPU A;  5EDN A;  4E7L A;  2P8T A;  2R7U A;  3WE2 A;  1LFB A;  3HUG B;  2XDV A;  4I09 A;  1GXP A;  1IDY A;  2Q1Z B;  3CUO A;  2ZXI A;  5FGM A;  2F5F A;  1LB2 A;  2LDU A;  3KET A;  4LJZ F;  4ZZD A;  2FMY A;  1HSJ A;  2PMH A;  4XLC A;  3K2Z A;  2PX9 A;  3OYL A;  2CV1 A;  3KP7 A;  2JN6 A;  3FXK A;  1JKO C;  2R7F A;  4IZZ A;  4U87 A;  2DOA A;  2EBI A;  1AKH A;  1EH7 A;  4CYC B;  4DGW B;  4EGY A;  3ABT A;  1YJW I;  2VE8 A;  3K4J A;  5IYB J;  2WB1 N;  3HSR A;  1VQP I;  1QGP A;  4UVB A;  4TV7 A;  2DBB A;  4MQ9 F;  1JI8 A;  1R5G A;  1FBS A;  1K78 A;  5C4X J;  1WJA A;  1G3W A;  2GQQ A;  1IAW A;  3WHB A;  2G9W A;  2KQR A;  1FIP A;  3MKL A;  4MHG A;  4IVN A;  1G3S A;  3SDB A;  2OUM A;  3OYI A;  3RZO J;  3FK6 A;  4P9F A;  3AL0 C;  2QBY B;  4P5O A;  3LMM A;  1H8A C;  1ETK A;  2OA4 A;  1LNW A;  2QEX I;  3DTI A;  4D1Q A;  1X4O A;  5L3E A;  4O3M A;  4XSX F;  2YR2 A;  3AAF A;  4MTE A;  3SZG A;  2LH9 A;  3G4S I;  3J80 K;  3MKW B;  2Y69 H;  1TC3 C;  4C3J J;  1QPM A;  3SQN A;  1DP7 P;  2UUZ A;  1LQ1 A;  3T8R A;  1IN7 A;  2JSC A;  3M3Y J;  1LJ9 A;  3ECH A;  3G2B A;  1OFC X;  2LOO A;  2MA3 A;  2DT7 B;  3J7A O;  2HGC A;  2HVR A;  1MNM C;  3K1P A;  1ZLJ A;  3NWS A;  3RPU D;  1YLF A;  1CF7 B;  2TDX A;  4BEH B;  4ZTF A;  1N78 A;  5FO5 A;  1G3T A;  3IRR A;  2BEO A;  2EFW A;  3WTZ A;  4AID A;  3W6K B;  3BZ6 A;  5HLH A;  4IOA F;  5HDN A;  2R7Q A;  2GA2 A;  3D5S C;  5K7F A;  3GYH X;  2CW0 F;  2OZ6 A;  5BPD A;  2CV0 A;  3LAJ A;  2Z3Y A;  3FWE A;  5ILV A;  3KZZ A;  1OPC A;  1JT6 A;  1FBQ A;  1R36 A;  4YRV A;  3J81 Z;  5IP6 A;  5ICG A;  1R71 A;  1ON1 A;  1W5T A;  2O6G E;  1Z05 A;  2M8E A;  2DYR H;  1JTX A;  1KON A;  4RGS A;  4ZDL A;  1HA8 A;  2GZW A;  2UXX A;  4BYY A;  3DEW A;  3RPU A;  2P81 A;  4L9J A;  3V8K A;  3ZMV A;  4CUG A;  1SFO J;  4AIK A;  2R7R A;  5IYD J;  2W57 A;  2COM A;  2LFB A;  4IPA A;  2FD5 A;  3GUD A;  5K5R A;  5A2Q Z;  3V8L A;  2ID3 A;  2WB1 A;  2XGC A;  1FWZ A;  3B6C A;  5KAF C;  5DS9 A;  5F27 A;  1LVA A;  1FLI A;  2ZNZ A;  3JRE A;  4Q5S F;  2FE3 A;  4CIC A;  5DV5 A;  4XOP A;  1RET A;  3ML6 A;  1XSX A;  2X1D A;  4HF1 A;  3DKW A;  5DM7 F;  2X6Y A;  3H3V K;  3O6B B;  2HFH A;  3BR1 A;  2P4W A;  3S16 J;  3WTT C;  1VZ0 A;  4Y33 A;  1P4W A;  2KKO A;  1BOA A;  4NB5 A;  2LNB A;  4MEY F;  2NVY J;  5E18 F;  2RRE A;  4I7H A;  2EV5 A;  5LRS A;  1EF4 A;  3E5U A;  2DT5 A;  1B8I A;  1KA8 A;  1I1G A;  4ZYE A;  3GTG J;  1ZGW A;  2G7H A;  1BR2 A;  4UUS B;  1HKQ A;  4V2F A;  1H9T A;  3CDH A;  1W0T A;  3ABU A;  1WWX A;  4RA2 A;  2BXY A;  5LD2 C;  3FHN A;  1XCV A;  3L2W A;  2O8X A;  1GVJ A;  1TWF J;  1UST A;  2E2I J;  4N4N B;  2BOL A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  4S05 A;  4RB0 A;  4ZYG A;  3D0S A;  4ESJ A;  1BM9 A;  4B8X A;  2K4B A;  4HF2 A;  5JFR A;  5LBQ A;  4G7O F;  1FNN A;  5LLQ A;  3ZMU A;  1Z6T A;  1UHW A;  2L4A A;  4KIG A;  3WTU C;  1O3Q A;  4FT8 A;  4AD9 A;  1QNT A;  4P96 A;  2H6B A;  1BI0 A;  3LQQ A;  1HQC A;  5FD6 A;  3EET A;  4RB1 A;  5LEJ A;  2IRF G;  1IN8 A;  3FHZ A;  3KP6 A;  3U1D A;  1R58 A;  2ZO4 A;  2DU9 A;  2DAO A;  2V6C A;  4HLY A;  3F8M A;  2PEX A;  3ELK A;  3FZV A;  1P4A A;  3RTR A;  2XKO A;  4BH9 A;  4IHT A;  1Y0U A;  3QRF F;  3E3V A;  4I0B A;  2W25 A;  3RPQ A;  1TQP A;  3M8F A;  1J0R A;  2DFI A;  3WTY C;  1L0O C;  4M9S A;  1XDU A;  4I01 A;  4K2E A;  4ENM A;  3FXQ A;  4MTD A;  2JZY A;  2L3D A;  4AIH A;  2MD5 A;  3LA3 A;  2GA1 A;  1R1T A;  1YYV A;  2XUB A;  4Y15 A;  5BS6 A;  4U0V A;  2D1V A;  3DFG A;  4KN7 X;  2HOE A;  2P5K A;  1EV7 A;  1XN7 A;  4CO8 A;  1T98 A;  2DK8 A;  2PN6 A;  1T2K A;  3JTH A;  3T0Y A;  3Q9S A;  1UHM A;  4LLG F;  5EEG A;  3ZMS A;  2Z9O A;  2XAF A;  5CVI A;  5KVR A;  4LD5 A;  4Y13 A;  2FBI A;  4GYG A;  3REO A;  4S04 A;  4YFK F;  4HBL A;  1FYM A;  2V1D A;  1B6A A;  5F64 A;  3SFZ A;  1P92 A;  3H3Z A;  5ED4 A;  1TNS A;  5L3D A;  1B59 A;  1BI1 A;  3WGH A;  2BBY A;  3KP5 A;  4FX4 A;  1R00 A;  2L01 A;  1GHC A;  4M71 A;  1U5T B;  4ASN A;  3IWF A;  2HTJ A;  3DEU A;  3MQ0 A;  1FSE A;  3C18 A;  5K5Q A;  3I4P A;  4IRG A;  3KP2 A;  4A6E A;  4HQE A;  4I98 B;  2FEZ A;  2FNA A;  3EUH A;  3F8N A;  3IKV A;  4OIQ F;  3I71 A;  4LG0 A;  4IF4 A;  4G6D A;  5DCM B;  2FML A;  3I59 B;  3J81 K;  2DK5 A;  2IW5 A;  4ZYD A;  1ZRD A;  2A5Y B;  5H20 A;  2DLL A;  2P6S A;  2HQR A;  1MD0 A;  2YPR A;  4P9U A;  3GZ5 A;  1O7F A;  5L3C A;  1BIA A;  4RGX A;  3KP4 A;  1IN4 A;  1KQ0 A;  3RKY A;  2NS0 A;  2LF7 A;  2WWY A;  4JBA A;  4BHP A;  4IRH A;  4L9T A;  3R4K A;  1RNL A;  3V8J A;  2D1H A;  3F3X A;  1IN5 A;  2R7D A;  2PJP A;  1YTY A;  1R7J A;  3FM5 A;  1O3S A;  2XRN A;  4RB2 C;  2M45 A;  1OR7 A;  3F8F A;  3JW4 A;  1YQA A;  2EA4 A;  3ZMT A;  2EJR A;  4OMZ A;  4MNU A;  3HOS A;  3B02 A;  4HF0 A;  3BOQ A;  3N97 A;  3EYI A;  4G6Q A;  5ERI A;  4I0A A;  4YII A;  4IJA A;  2O61 A;  3F6O A;  2ESH A;  2A3S A;  4M73 A;  2M5W A;  3DPL C;  2Z5U A;  1B1B A;  1O3T A;  1HKS A;  4OMY A;  2Y48 A;  2DPU A;  1T38 A;  2KJC A;  1HBX G;  3QOP A;  4ESF A;  1LDJ A;  1RUO A;  4KMF A;  5E8G A;  2DQL A;  2EV0 A;  5E1Z B;  1P4X A;  3F21 A;  3GFM A;  2A6E F;  1SD5 A;  4LLL A;  3QU3 A;  2JTV A;  3VFZ A;  5D4S A;  3EQL F;  3PFI A;  4KUM A;  2H27 A;  4P55 A;  3FMS A;  2OD5 A;  3IC7 A;  5ICE A;  1FZP B;  3CUQ B;  2FXA A;  3Q9V A;  3JAM K;  1QBJ A;  3E5Q A;  1B4A A;  1K6O A;  3E6M A;  2PMU A;  1YW7 A;  4M9X A;  1MJA A;  1FYK A;  1ULY A;  2A61 A;  2QVO A;  3R0J A;  2XV4 S;  4CXF A;  2M30 A;  4FHT A;  2E1C A;  2MLG A;  1U2W A;  1H9G A;  2XAH A;  3RKW A;  1UFM A;  4EVI A;  1QZY A;  3LST A;  2JRT A;  2IA1 A;  3HYI A;  4O5V A;  1SD6 A;  2JPC A;  2HR3 A;  2UZK A;  4EJO A;  1OYY A;  5FFX A;  2LF8 A;  4HV5 A;  1KU7 A;  5JR3 A;  3Q5F A;  3VOE A;  3ZN0 A;  4UVC A;  4QLC U;  5CVV A;  4XRF A;  2CYY A;  2F5C A;  3TOA A;  2FNP A;  2EWN A;  3BDD A;  3HRT A;  4O6J A;  3PQJ A;  4OU0 A;  3HRS A;  4RB3 C;  5E20 A;  1O7L A;  1D3Y A;  1XDS A;  2VON A;  4N9I A;  1LEA A;  3NQO A;  5DD4 A;  1W7P D;  2QM3 A;  2OZU A;  1XSD A;  1R23 A;  3IKT A;  1T39 A;  4M74 A;  1AOY A;  3JTG A;  5D6E A;  4IRI A;  1TBX A;  2STT A;  1NHA A;  1HKT A;  3OOP A;  5AON A;  5J8F A;  1I27 A;  1W7P A;  3L9F A;  3M8E A;  4WWC A;  2G7U A;  1WI9 A;  4LB5 A;  1GXQ A;  1ZAR A;  4KT5 C;  1IXS B;  3MEX A;  3P9C A;  5CJ9 A;  4XLP F;  1P2F A;  5CLS A;  5HS7 A;  1Z7U A;  4QWQ A;  2J5O A;  5CYV A;  4M72 A;  2H6C A;  1S6L A;  2DO7 A;  3D5L A;  3O2P E;  4F7Z A;  3FXU A;  4UVA A;  1RIO H;  4LFU A;  4HA8 A;  4ENK A;  1ONV A;  3CJN A;  2FBK A;  3JSP A;  3MCZ A;  4CGZ A;  3FM3 A;  3KEO A;  4BHC A;  3DPT A;  4OOI A;  3KEQ A;  2K4J A;  2YX4 A;  1JE8 A;  4HX7 A;  2QLZ A;  3WTS C;  1XGS A;  3HHH A;  1R1V A;  3BJO A;  1PP7 U;  5LRR A;  2E7W A;  3FF5 A;  4PCQ A;  3WTW C;  2K86 A;  4RGR A;  1XGO A;  4CZZ A;  1C0W A;  4U7D A;  2CG4 A;  2WTE A;  3ZQ7 A;  4LMY A;  3EDP A;  1KYZ A;  2JT1 A;  2FOK A;  2XAQ A;  1T0F A;  1SD4 A;  3GLX A;  5LHH A;  4AIJ A;  1OYW A;  2OAZ A;  3F72 A;  1ZGJ A;  2EFO A;  1JHF A;  4L18 B;  2HEO A;  2KIU A;  2QWW A;  2HKO A;  5L3F A;  3QU6 A;  3ISP A;  2VBX A;  3TO7 A;  4D0P A;  4U7B A;  1REP C;  2V9V A;  3ZPL A;  1TNT A;  4EM0 B;  2VBW A;  1F5T A;  2IT0 A;  2B0L A;  3GFJ A;  2Y0M A;  4JQF A;  1PDN C;  2HS5 A;  5DEQ A;  5J6X A;  4N9H A;  2EK5 A;  2XVC A;  1U6G A;  2ZCW A;  3CTA A;  5F6F A;  1RI7 A;  4M6Y A;  2F5D A;  5TRD A;  1B9N A;  5BPI A;  3OV8 A;  1XGM A;  3HUG A;  1TTY A;  3BP8 A;  3GX4 X;  2K27 A;  3JAM Z;  2PBI A;  3RIR A;  4OIO F;  1IN6 A;  4OIR F;  3L2C A;  3WE3 A;  1JGS A;  2NRA C;  3ULQ B;  3FMR A;  4KIF A;  2DW4 A;  2VT3 A;  3C1D A;  4HX4 A;  2FBH A;  2F2E A;  1U78 A;  1G3Y A;  1XD7 A;  2LSO A;  1SFX A;  4BHB A;  2VBZ A;  2QBY A;  3TGN A;  2ADU A;  1HW5 A;  2BE5 F;  3S2W A;  4ZZL A;  2Z33 A;  3MWM A;  1KU9 A;  4GO1 A;  3K69 A;  5JVT A;  1DUX C;  1BJA A;  4KDP A;  5DYM A;  3P9K A;  1W4M A;  5D5V B;  3HIF A;  5ILS A;  4FX0 A;  2STW A;  1CF7 A;  2ZME A;  1ZHF A;  2J5P A;  2XRO A;  1V3F A;  4A0X A;  3M7G A;  1OYI A;  2L4M A;  2E7X A;  1QO0 D;  4H0E A;  2EFN A;  3ROU A;  1XSV A;  5IT9 K;  2L02 A;  3SZP A;  1BBY A;  3G3Z A;  4ETS A;  1FOK A;  1UCR A;  2DI3 A;  3KCC A;  1BN5 A;  2XAG A;  4EJV A;  4PDK A;  5HDK A;  1MGT A;  2MC3 A;  2ELH A;  4RAY A;  2DTR A;  1K7A A;  4RGU A;  3WG9 A;  5BOX A;  1DPR A;  1QZZ A;  3NRV A;  4MGR A;  4KYW A;  4I2O A;  2RC4 A;  2X0L A;  4IHS A;  4Q48 A;  4HDU A;  4A12 A;  2MH2 A;  3V4G A;  1A04 A;  1XGN A;  2VC0 A;  4U88 A;  1KGS A;  2LKP A;  3GZ6 A;  1AWC A;  1MDM B;  1J75 A;  1I1S A;  3C3W A;  5E1X A;  1D5V A;  1U8R A;  1WRJ A;  3KE2 A;  3LA2 A;  2HZT A;  1IF1 A;  4WF2 A;  5JI6 A;  1KQ8 A;  5CVJ A;  1OMI A;  2RQP A;  3DP7 A;  3HHG A;  4U0Y A;  3GFI A;  4BQA A;  2HKX A;  1G4D A;  2VN2 A;  4BNC A;  1IXR C;  2QQA A;  3HSF A;  2DQR A;  2HYG D;  4BXU A;  3KZY A;  3ZMD A;  2ESN A;  2E1N A;  1K78 B;  3ECO A;  5AIQ A;  5DUI A;  2RNJ A;  3E6B A;  3VB2 A;  1T6S A;  3HTU A;  1SAX A;  5HLI A;  1YW8 A;  2ISY A;  3P9I A;  2IP2 A;  4RS8 A;  5L3G A;  2GXB A;  3F6V A;  1HST A;  4DNC A;  1FP2 A;  4G7Z F;  1J5Y A;  1Z91 A;  1V4R A;  1I5Z A;  1MZB A;  3WTV C;  4U0W A;  5D4R A;  3HSE A;  4MEX F;  4NHJ A;  1TLH B;  1PP8 F;  2F5E A;  1EH6 A;  3DQV C;  3K1M A;  4WX9 A;  3GFL A;  3TKY A;  3KFW X;  2EFP A;  1KU3 A;  5LGT A;  2BYV E;  2H94 A;  1YG2 A;  3G73 A;  2P5L C;  1ZRC A;  2EFQ A;  2FRH A;  4AWX B;  2A68 F;  3JSO A;  2ZBK A;  3WTX C;  2HDC A;  2HTS A;  2V1U A;  5DD8 A;  4YIF A;  3C7J A;  3L7W A;  4CHU A;  2HWV A;  3TOB A;  1ZN2 A;  3GVA A;  3LA7 A;  4LK1 F;  2RVC A;  3I5U A;  3HTS B;  4Y17 A;  3QPH A;  1ON2 A;  3VEP A;  3V7R A;  3GW2 A;  4LK0 F;  5J8C A;  3I58 A;  3WU0 A;  2KJB A;  2D2W A;  2KIM A;  5LGN A;  2BGC A;  2XGX A;  2HYF A;  1MJ9 A;  4PGG A;  2FU4 A;  3WU1 B;  4ON0 A;  3LAP A;  1YIO A;  2FA5 A;  5DCF A;  3QAH A;  3F22 A;  1XCB A;  3FMQ A;  4YG2 F;  5FFZ A;  3ZMZ A;  2VOD A;  3TDU C;  4L9N A;  4PGH A;  1FP1 D;  3CO6 C;  1F1Z A;  3BJ6 A;  2P6T A;  5D5X B;  5D5U B;  5E8I A;  3F8B A;  5L3B A;  1B9M A;  2HQN A;  1ZG5 A;  1IZ1 A;  1VTN C;  4NQW A;  3V7C A;  2UWM A;  2ZNY A;  1J59 A;  3M1E A;  1KU2 A;  3N4M A;  1KYW A;  3T1B A;  5IT9 Z;  4KA4 A;  1HW2 A;  5DCM A;  3GEZ A;  1TW3 A;  3E5X A;  3I59 A;  1SMY F;  2NNN A;  2RV8 A;  3MZY A;  4HQM A;  2MLK A;  1YO5 C;  3GO5 A;  2FSW A;  3R60 A;  5JHU A;  1SMT A;  4EM2 A;  2P7C B;  2CSO A;  5BQT A;  4ENJ A;  2QEN A;  2P5V A;  4KNY A;  2OBP A;  1E2X A;  4A2U A;  1WKM A;  2AS5 F;  3QP6 A;  3BRO A;  3QP5 A;  4HOB A;  4WXD A;  2IVM A;  1DDN A;  2A6H F;  1IW7 F;  3ERE D;  4Q47 A;  2KIF A;  2CWE A;  2ZJ2 A;  2Z99 A;  4ENN A;  4ESB A;  3F8C A;  1XB4 A;  2L54 A;  4EQQ A;  2V79 A;  1I6X A;  2R3S A;  2ZKZ A;  2ZME B;  2BV6 A;  1XMA A;  3MFK A;  3B73 A;  1L3L A;  2QUF A;  3ZP5 A;  4GYI A;  2UXN A;  4E70 A;  3CUQ C;  3T8T A;  2O3F A;  1FT9 A;  4KFC A;  4OIN F;  2AXL A;  2GWR A;  1BIB A;  2FQ3 A;  2QQB A;  5D8K B;  3RYP A;  1ZG3 A;  4G7H F;  5LHI A;  2IPQ X;  4L9V A;  4B09 A;  4LGW A;  5EEH A;  3SHF A;  3I53 A;  1ZGA A;  2A69 F;  1JXS A;  1USS A;  1IUY A;  3CUQ A;  3WOD F;  3RJP A;  1TW2 A;  3RYR A;  1EH8 A;  4Q4Z F;  1S7O A;  3O3K A;  5FLX Z;  2PFB A;  3H92 A;  2XKP A;  4L5I A;  5K1Y A;  2VOP A;  1TQM A;  3BJA A;  1FC3 A;  3LQR A;  1DPU A;  3EYY A;  2YSR A;  2VT2 A;  1IRG A;  1TQI A;  1RUN A;  4LG0 B;  4UV9 A;  4WXH A;  3R6S A;  3K1N A;  4A0Z A;  3L09 A;  4HW0 A;  4WK8 F;  1R1U A;  1O57 A;  4MQV A;  3E97 A;  3IL2 A;  4EV0 A;  2GXG A;  1R22 A;  1PUE E;  5TJJ A;  1JHH A;  3IRQ A;  2QQ9 A;  4LB6 B;  2Q0O A;  4GGG A;  3K0L A;  3KLN A;  3PQK A;  4YFN F;  4CDG A;  1BC8 C;  4KMU X;  1FBU A;  1Z9C A;  3RKX A;  2VC1 A;  2ISZ A;  2RGV A;  2VBY A;  5E1W A;  4DQ2 A;  1S3J A;  1ODD A;  1SD7 A;  4M9Z A;  2XAJ A;  4XLN F;  5FB2 A;  3CO7 C;  4WXC A;  1LDD A;  1XMK A;  5HS9 A;  1BI3 A;  4HLX A;  1LEB A;  5CVU A;  5HLG A;  3H3U A;  4A6D A;  5CVR A;  1KQ9 A;  4HV6 A;  3TDZ C;  3P7N A;  5LGU A;  4PZJ A;  4N0B A;  4LLN A;  3VOD A;  1IRF A;  3GXO A;  2WV0 A;  2MH9 A;  1YS6 A;  5HVQ C;  3BPV A;  5LHG A;  2IJL A;  3NEU A;  2RN7 A;  3I0T A;  2KRF A;  4HAM A;  3GWZ A;  2ACJ A;  2QYO A;  3BY6 A;  3K9T A;  4UV8 A;  5KK1 A;  3HRM A;  3LWF A;  2EB7 A;  3U2R A;  3HOT A;  4EJU A;  4XSZ F;  6PAX A;  4GXO A;  3MAJ A;  1U3E M;  3U9G A;  2MBF A;  4HZF A;  3E6D A;  2ETH A;  2M1B A;  4CYD A;  4EJT A;  2WC2 A;  4A5N A;  4R8H A;  2OQR A;  5AIP A;  5DUK A;  2O03 A;  2EV6 A;  2CFX A;  4HDV A;  5LEK A;  1S7A A;  2W84 A;  4Z2Y A;  2XIG A;  3W6J B;  3QPT A;  4JK1 X;  2P7V B;  5D6F A;  4R79 A;  5F1R A;  4HYE A;  3FX3 A;  3DF8 A;  1IXC A;  3L00 A;  4IXA A;  2GAU A;  3SZT A;  3BPX A;  3J80 Z;  4KIB A;  4KIC A;  4A5M A;  5DDG A;  4G94 A;  1BC7 C;  1ZG1 A;  1OKR A;  2H09 A;  4UNO A;  1UB9 A;  1HXD A;  1Q1H A;  1O3R A;  5D8L B;  1ZAO A;  1WQ2 A;  4RAZ A;  1HW1 A;  2C6Y A;  1R5H A;  4ZYH A;  1YW9 A;  1YS7 A;  2RKH A;  1ZLK A;  2GIV A;  1FYL A;  1K79 A;  5HOO A;  4WCG A;  3F23 A;  4UUV A;  3RDI A;  2OQG A;  5E17 F;  1J9I A;  3TQN A;  1ZRE A;  2W24 A;  2XHK A;  2Q8K A;  4L0Z B;  3R61 A;  3WGG A;  2YX7 A;  2OU2 A;  4AVP A;  1FSH A;  2PQ8 A;  4UXN A;  1X3U A;  3V7S A;  3ZN1 A;  3SXY A;  4KN4 X;  5HDG A;  5A2Q K;  3T5X A;  2QZ8 A;  1SFE A;  3KP3 A;  4ZH4 F;  2DPD A;  1Z6R A;  2W85 A;  2ZXJ A;  1WSU A;  1QQI A;  1J2X A;  3I54 A;  5K5O A;  1P6R A;  2PLY A;  3HRU A;  1W7P B;  2CO5 A;  5FLX K;  5IT3 A;  1Z1D A;  2Y75 A;  4G9Y A;  2XAS A;  2IA0 A;  2K02 A;  3CLO A;  3DXJ F;  4L5J A;  3LFK A;  1E17 A;  2K7L A;  1J7K A;  2M87 A;  3FXR A;  1ZH5 A;  4UHT A;  3I64 A;  3RI4 A;  1FY7 A;  1SFU A;  2FF4 A;  2Q2E A;  3MZH A;  2RDP A;  2NNY A;  3GF2 A;  4M6X A;  4L0Y B;  2O0Y A;  4YFX F;  4HX8 A;  3TO9 A;  2EA2 A;  1D8J A;  1MKM A;  4G8X A;  2A07 F;  3WGI A;  4I02 A;  1F4K A;  5BMZ A;  3R0A A;  2VXZ A;  1ZRF A;  4EMS A;  2VOO A;  1W5S A;  2V1X A;  1STZ A;  2PI0 A;  3IHU A;  4EJW A;  2CQK A;  1CGP A;  1U5T C;  3DV8 A;  3M9A A;  3IWZ A;  5H6Q A;  5ICC A;  4XBF A;  2IA2 A;  5FD5 A;  4BAY A;  2PG4 A;  5D5W B;  1YFH A;  5H6R A;  3TO6 A;  3COA C;  3KLO A;  1S8N A;  1MJB A;  4EGZ A;  2ZFW A;  4GCV A;  1H0M A;  1LDK B;  1ZYR F;  1U5T A;  4EM1 A;  2X4H A;  1RZ4 A;  1G6N A;  3BWG A;  4R1H A;  5ILU A;  1F9N A;  4OIP F;  1FX7 A;  2JPB A;  2NAZ A;  4A0Y A;  5HS8 A;  2D45 A;  3E6C C;  1MDM A;  2CGP A;  2YU3 A;  2NYX A;  2VE9 A;  1S29 A;  1FPQ A;  5ICF A;  1D8K A;  2P8T A;  3WE2 A;  4I09 A;  1GXP A;  3CUO A;  5FGM A;  2F5F A;  1LB2 A;  2LDU A;  3KET A;  4LJZ F;  4ZZD A;  2FMY A;  1HSJ A;  2PMH A;  3K2Z A;  3KP7 A;  2R7F A;  1EH7 A;  4EGY A;  3ABT A;  2VE8 A;  3HSR A;  1QGP A;  4UVB A;  4TV7 A;  2DBB A;  4MQ9 F;  1R5G A;  1FBS A;  1K78 A;  1G3W A;  2GQQ A;  1IAW A;  2G9W A;  4MHG A;  4IVN A;  1G3S A;  4P9F A;  2QBY B;  4P5O A;  2OA4 A;  1LNW A;  5L3E A;  4O3M A;  4XSX F;  2YR2 A;  3AAF A;  4MTE A;  3J80 K;  1QPM A;  3SQN A;  1DP7 P;  1LQ1 A;  3T8R A;  1IN7 A;  2JSC A;  1LJ9 A;  3ECH A;  2MA3 A;  3J7A O;  2HGC A;  3K1P A;  1ZLJ A;  1YLF A;  1CF7 B;  2TDX A;  5FO5 A;  1G3T A;  3IRR A;  2BEO A;  2EFW A;  3WTZ A;  3W6K B;  3BZ6 A;  5HLH A;  5HDN A;  2GA2 A;  3GYH X;  2CW0 F;  2OZ6 A;  5BPD A;  3LAJ A;  2Z3Y A;  3FWE A;  5ILV A;  3KZZ A;  1OPC A;  1FBQ A;  1R36 A;  3J81 Z;  5ICG A;  1ON1 A;  1W5T A;  2O6G E;  1Z05 A;  2M8E A;  4RGS A;  2GZW A;  2UXX A;  4BYY A;  3V8K A;  3RPU A;  4L9J A;  3ZMV A;  4AIK A;  2W57 A;  2COM A;  4IPA A;  3GUD A;  5K5R A;  5A2Q Z;  3V8L A;  1FWZ A;  1LVA A;  1FLI A;  2ZNZ A;  4Q5S F;  2FE3 A;  4CIC A;  5DV5 A;  3ML6 A;  1XSX A;  4HF1 A;  3DKW A;  3O6B B;  2HFH A;  2P4W A;  3WTT C;  1P4W A;  2KKO A;  1BOA A;  4NB5 A;  2LNB A;  4MEY F;  5E18 F;  4I7H A;  2EV5 A;  5LRS A;  3E5U A;  2DT5 A;  1KA8 A;  1I1G A;  4ZYE A;  2G7H A;  1HKQ A;  1H9T A;  3CDH A;  3ABU A;  1WWX A;  1XCV A;  2O8X A;  1GVJ A;  1UST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...