2FA5A

The crystal structure of an unliganded multiple antibiotic-resistance repressor (marr) from xanthomonas campestris
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
139
Chain Sequence
HPVLLNLEQFLPYRLSVLSNRISGNIAKVYGDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAKDGLPRMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator marR/emrR family
publication title The crystal structure of XC1739: a putative multiple antibiotic-resistance repressor (MarR) from Xanthomonas campestris at 1.8 A resolution
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription
total genus 49
structure length 139
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fa5A00
5HOOA 1KU9A 4I7HA 2W24A 3G3ZA 4IRIA 3CUQB 2CGPA 3DV8A 2J5OA 3HRUA 5DDGA 2MLKA 3QU6A 4IRGA 1FWZA 5DEQA 2TDXA 4KA4A 3RJPA 2XV4S 2BYVE 3NRVA 3L2CA 1ZARA 5BOXA 4JK1X 1RNLA 3DPLC 3GFLA 4M74A 3GYHX 3ECHA 1G6NA 1LDKB 2HWVA 1FOKA 1TLHB 4Q47A 4HYEA 5E8GA 4HBLA 3IRQA 2ZXJA 4BXUA 2QBYB 3I64A 3M1EA 2EA4A 4BHCA 3I59B 1MGTA 2J5PA 3R0JA 4A5MA 1FPQA 3GXOA 1BI2A 4XLNF 4EM0B 3ZMUA 4LLGF 4AIHA 2DK8A 1KU7A 5LHHA 1Z7UA 3GFJA 2VBXA 4ENKA 2BBYA 3BPXA 2D2WA 3QRFF 2Z99A 1ZLKA 2LDUA 4OMZA 4KN4X 1P4XA 2F5EA 2V79A 4KMFA 1DPUA 1IUYA 4LFUA 3GX4X 1K7AA 2KKOA 2O03A 4KT5C 2Z9OA 2QWWA 4UV8A 1HW5A 4WXCA 2FQ3A 3MEXA 3R61A 4UVBA 5JI6A 5D6EA 3K0LA 3HSRA 1O57A 1B9MA 2LF8A 2EB7A 2HKXA 1ZGJA 1RI7A 1LNWA 4RB0A 2FEZA 4EJTA 1K78B 3WTXC 1KYZA 1TBXA 2D1VA 5A2QZ 4WX9A 3CTAA 3DFGA 2MD5A 5HDKA 1Z1DA 2Q0OA 2VBWA 3QOPA 2FU4A 5J8CA 2W57A 2V1UA 2XKPA 5FLXZ 3LAJA 5J8FA 3JSPA 2XAQA 3N97A 1Q1HA 2PQ8A 4MEYF 3KE2A 1BJAA 2EWNA 4EJOA 4RGUA 5D5UB 1K6OA 4LG0B 3LAPA 3LA7A 2VC1A 1H0MA 3MZHA 5CVUA 1OYYA 4L0ZB 3Q9SA 3GZ5A 3ZMSA 4CZZA 4Z2YA 5E18F 3J7AO 1UCRA 5JHUA 4MEXF 3J81Z 3ZMVA 4G9YA 3ZN1A 3TO7A 2PJPA 5D8KB 3HSEA 3KLNA 4YFXF 4KFCA 2IRFG 1RIOH 1RUNA 4XRFA 2COMA 5CJ9A 1MZBA 1L3LA 3F21A 4ENNA 4AD9A 2JSCA 1LQ1A 3JAMZ 1STZA 4KUMA 4P9FA 2X4HA 4M71A 3WGIA 1WSUA 2ZJ2A 1LDDA 4G7ZF 5HS8A 2XHKA 2QQ9A 2ISYA 1YFHA 3J80Z 4IJAA 5D6FA 4RS8A 2P8TA 5DYMA 1JE8A 2HOEA 2MC3A 4OIOF 1TQMA 5F1RA 4P5OA 3HRTA 5ICEA 3P9IA 2L54A 3SFZA 1XGOA 4HZFA 2UZKA 1CF7A 3ZMTA 4WK8F 4I0AA 2QENA 3ZN0A 3WGHA 4HDUA 1IW7F 4B8XA 3S2WA 1IZ1A 2RGVA 4UV9A 1ZG5A 3FMSA 1F1ZA 3W6JB 1HSTA 1V4RA 4EMSA 2DPUA 3R6SA 3C7JA 5K5RA 4L5IA 2LNBA 1FNNA 2XUBA 2VOOA 4HAMA 1T2KA 2XASA 4U88A 3RPQA 5E1ZB 3H3ZA 4ZYEA 1BOAA 1JGSA 4QWQA 2E7XA 5ILUA 5LGNA 2O3FA 3RDIA 4G7HF 5D8LB 1U8RA 3WTWC 5IT9K 2YR2A 4M73A 4HF1A 5TJJA 4LB6B 3KP7A 2P5LC 1F9NA 2QYOA 3VEPA 2UXXA 2ZBKA 4KIFA 5EEHA 4EGZA 2O6GE 3FM5A 1OYWA 3C3WA 2P4WA 2BEOA 1WQ2A 3RKXA 5HS7A 1FSEA 3KETA 2F5CA 4M9SA 3FWEA 3H92A 5ICCA 1W7PD 1EH6A 4LGWA 1WWXA 1XB4A 1ZAOA 3KP6A 1U5TA 2FF4A 1IRGA 1R22A 2XROA 3TOAA 1W7PA 1B1BA 5D5VB 1SD7A 2PN6A 3KP5A 2EJRA 2A61A 4PDKA 1R1UA 1AOYA 3E6MA 1G3TA 3FM3A 3RKYA 3CJNA 3GF2A 1YS6A 1HXDA 3TQNA 4XSZF 2Q2EA 3RIRA 3F8MA 1MJ9A 1RUOA 5ICFA 3I71A 4EVIA 2QUFA 3BP8A 1TQIA 3HHHA 5CYVA 2HYGD 4MGRA 3QPTA 2STTA 1TTYA 4OMYA 4CXFA 4WCGA 4FHTA 1I5ZA 2DAOA 2FBHA 2XKOA 1IXRC 5HLIA 1XSXA 2W85A 4MHGA 2W25A 2MH2A 5FFXA 5CVVA 3E6CC 3DXJF 4P9UA 4NB5A 3PFIA 2DO7A 5ICGA 4EV0A 5L3FA 2OAZA 1FYLA 3FHZA 2HQRA 1JXSA 2MA3A 4OIQF 5FGMA 2CWEA 2JTVA 5KVRA 3U9GA 1UFMA 4IHSA 1KGSA 2IT0A 1BIAA 1GHCA 2A07F 4A6DA 4FX0A 1O3RA 2WWYA 3F72A 4RGSA 3RYRA 2O61A 1JHHA 4PGGA 1S8NA 1ZG1A 1FYKA 1P92A 4UUVA 3EDPA 3FXQA 3KFWX 1UHWA 3GLXA 3U1DA 3BROA 2NRAC 2EFWA 3F8FA 1EH8A 2OZ6A 2GQQA 1USTA 5K1YA 2DFIA 4HA8A 1XD7A 3M8FA 2JRTA 1DP7P 1KU2A 3WU1B 5D4RA 3JTHA 3IWZA 3BPVA 3WODF 5HLHA 1PP7U 3CUQC 3GFMA 4IXAA 1ZHFA 5LEJA 4LB5A 3CO7C 2A3SA 2Y75A 1O3SA 3QPHA 1FSHA 3WTYC 5LBQA 4LLNA 2VODA 5F64A 2VN2A 3GVAA 3VFZA 3LA3A 4HQEA 1GXQA 2QM3A 1J7KA 1IXCA 2WTEA 3IKVA 2XGXA 1ULYA 4ETSA 2RVCA 3KCCA 3SZTA 2JPBA 1H9GA 2K86A 2JZYA 1ZREA 2V6CA 2KIFA 5IT3A 2CO5A 3GEZA 3BZ6A 5AIPA 2FBIA 3IRRA 3N4MA 4K2EA 1QPMA 3VODA 3ECOA 1Z6TA 2K7LA 2Z3YA 2ZMEA 4ENMA 1OYIA 3EYIA 1J75A 1CGPA 2ETHA 4HOBA 2KJCA 1O3QA 2DBBA 1Y0UA 4U7BA 2DQRA 5E20A 4Q5SF 2RV8A 2HZTA 1B4AA 1B59A 3F23A 3L9FA 2FMYA 5J6XA 2IA0A 4BNCA 1S6LA 1LB2A 1Z91A 1PUEE 2FA5A 1FP2A 2D1HA 1W5TA 3ZQ7A 4RAZA 1IAWA 3V7RA 3SHFA 2DI3A 2C6YA 1SD4A 2MH9A 3R60A 3V7SA 2VE8A 2GXGA 2QVOA 2DK5A 2DLLA 2DPDA 3KEQA 3RTRA 1TNTA 4DQ2A 4RGRA 4QLCU 4PCQA 2L4AA 2G7HA 2IJLA 2FSWA 2V9VA 3I4PA 4DNCA 1C0WA 1FT9A 2R3SA 5H20A 1CF7B 4O5VA 1YTYA 1IN7A 3T8TA 1TQPA 1DDNA 3MAJA 2CYYA 4M9XA 3TOBA 2VT3A 2HTSA 5DCFA 3BY6A 2PI0A 4AIJA 2K27A 4FX4A 3T1BA 1ZYRF 2P6TA 5DUKA 3RKWA 4HQMA 2M45A 2IA1A 3PQKA 2O8XA 5D5WB 5LEKA 2V1DA 2Z5UA 4ZZLA 4HF2A 1IN6A 1D3YA 1IXSB 1LEBA 2AS5F 3I0TA 4IRHA 3KZZA 3GW2A 3BJOA 2YPRA 4JBAA 2HQNA 4YIIA 2DW4A 3HSFA 2F5FA 4N0BA 1QO0D 1W4MA 1HW1A 2P5KA 2RKHA 4YFKF 1F5TA 2EA2A 4M6XA 2A68F 2K02A 1TW3A 4L9VA 1MDMB 3EUHA 5CVJA 1S3JA 1KQ8A 4KMUX 5K5OA 4XLPF 3IL2A 1ZRCA 2MLGA 3BOQA 1I1SA 2EFOA 1U5TC 1XGNA 3M9AA 4HF0A 3HUGA 3WTZA 5TRDA 1BBYA 1ZLJA 2ADUA 1SMTA 2LF7A 4A0XA 2HEOA 1U5TB 3DP7A 4D0PA 1W7PB 2RN7A 3EQLF 3RI4A 1MD0A 3WE3A 3BJ6A 2RDPA 3CDHA 1IN8A 1Z6RA 1SFUA 2L01A 1TNSA 1SD5A 4CICA 4R79A 1QBJA 1A04A 2OQRA 2RC4A 4A5NA 3NEUA 3ZMDA 2VE9A 4PZJA 2FNAA 2NYXA 1BI3A 3ROUA 1EH7A 2O0YA 1T6SA 3VOEA 1ZG3A 2GA2A 4AWXB 2F5DA 3CLOA 5ILSA 2A6HF 1MKMA 3V4GA 3MZYA 4S05A 2M1BA 5E8IA 4NQWA 1LJ9A 3TO9A 2ESHA 2V1XA 3HIFA 4LJZF 3FZVA 3VB2A 2HYFA 2KRFA 1U3EM 3ULQB 3E6BA 1W5SA 3CUOA 3DEUA 2Y48A 1VTNC 3WTSC 2BE5F 2GAUA 4UVCA 5L3EA 4CYDA 1WI9A 1XSVA 1SFEA 2XAHA 4L9NA 1MDMA 2CSOA 4MTDA 2OBPA 3MFKA 3IHUA 4BYYA 1HQCA 5L3CA 2D45A 5LHIA 4RB1A 3QP5A 1UHMA 4GO1A 1S29A 1FC3A 3T8RA 1OKRA 1G4DA 1BI0A 4OIRF 2FBKA 6PAXA 2A5YB 1V3FA 4KDPA 2YU3A 4G6DA 5FD6A 3M7GA 5BQTA 4HLYA 3Q9VA 1S7OA 2ZCWA 4RB2C 2H09A 4KNYA 4LMYA 1HW2A 1PDNC 1K79A 1XMKA 3FF5A 4WXDA 3SXYA 2EV6A 5CLSA 1OMIA 2M8EA 2HTJA 4S04A 1LVAA 3K1NA 1J5YA 2P5VA 1Z05A 3WG9A 3L09A 2M30A 4ZYHA 1QZZA 1HKQA 3B73A 2VC0A 5AONA 3QP6A 2PMHA 3K1PA 1G3WA 4HV5A 1HKSA 2VBYA 4EM2A 3D0SA 5LLQA 2E1CA 3WTTC 1L0OC 1KA8A 4UXNA 5K5QA 4P96A 1AWCA 2XAJA 2B0LA 4I01A 3BDDA 3C1DA 2PLYA 4IF4A 5A2QK 4PGHA 3F6OA 3EYYA 3OOPA 4YIFA 3I54A 5FO5A 1DPRA 4O3MA 3TDZC 4LD5A 4I2OA 5FLXK 1ZH5A 3E5XA 2CW0F 2DQLA 2PFBA 5DD4A 2EV0A 4G6QA 3ZP5A 2EFPA 3HYIA 3ABUA 4XSXF 3V8KA 4L5JA 2VONA 1ON1A 1U6GA 1XGMA 1G3YA 4HDVA 2ZMEB 1J9IA 1FP1D 2P7VB 4GGGA 2OU2A 3E6DA 2YX7A 3F22A 5FB2A 4MTEA 3T0YA 4M6YA 2ZNZA 1R1TA 2IW5A 2OA4A 2Z33A 3IC7A 2ISZA 3J81K 1SFXA 3KP4A 3W6KB 4LK0F 1ZRDA 5BPIA 2CG4A 3K1MA 1T98A 3Q5FA 1ZRFA 1ZN2A 3O6BB 1XCBA 3LFKA 4GYIA 2FMLA 2NAZA 1E17A 1FBSA 4MQVA 5ERIA 1E2XA 5E1WA 3TDUC 1BI1A 2UXNA 5BS6A 4HX4A 3MQ0A 3RPUA 3F6VA 3JAMK 3DKWA 1Z9CA 1R7JA 1J59A 3L00A 3P7NA 1YIOA 1YW9A 3GO5A 4KIGA 2X0LA 2K4BA 5LGTA 1R58A 2ELHA 4HX8A 2EFQA 3GUDA 1G3SA 1F4KA 3J80K 1YW7A 5DCMA 4WXHA 2XIGA 4G7OF 3KP3A 3KLOA 2GIVA 2UWMA 5E1XA 4P55A 3BWGA 5CVIA 2L3DA 2ZNYA 3BJAA 1B9NA 5IT9Z 4YFNF 4R8HA 2K4JA 4HW0A 3E5QA 2VXZA 2KJBA 1YQAA 2L02A 4IHTA 4OINF 2H6BA 4Y15A 1P4AA 3FMRA 4HLXA 2OZUA 2YX4A 5D5XB 1XDUA 3HRMA 2FE3A 3F3XA 4BHBA 1USSA 2LSOA 4N9IA 2L4MA 2ZFWA 3JTGA 1TW2A 1ON2A 1I1GA 1R36A 4EQQA 1O7LA 5F6FA 2NS0A 1R23A 5E17F 3CO6C 3O3KA 2JPCA 1QZYA 4ESFA 3F8CA 3KZYA 2BV6A 4UHTA 3HOSA 4U7DA 2H6CA 4WWCA 2HKOA 2GXBA 4I09A 4ZYDA 5JFRA 2HGCA 3P9CA 2XAFA 4GCVA 2RQPA 1XSDA 2VOPA 4CDGA 3I53A 1KYWA 2R7DA 2XRNA 1YS7A 3FXRA 2M87A 3GFIA 1XDSA 1YG2A 2HFHA 4CHUA 3SZPA 2OD5A 1T0FA 2F2EA 4NHJA 1XGSA 4BAYA 3MCZA 1ONVA 2EFNA 2P7CB 3F8NA 4I0BA 3CUQA 2OQGA 4MQ9F 2A6EF 3M8EA 4LLLA 4KN7X 1KQ9A 4ESJA 1XCVA 1PP8F 4L0YB 2BGCA 3E5UA 3HTUA 2R7FA 4A0ZA 1GVJA 2IA2A 4OU0A 4M9ZA 1ZGAA 2IP2A 3R4KA 1KU3A 1EV7A 2ESNA 1I6XA 1JHFA 2QBYA 1BC7C 2FRHA 3I59A 3JSOA 4CO8A 2ACJA 4G8XA 1YW8A 3HRSA 1D8JA 3HHGA 3I58A 2Q8KA 1B6AA 3R0AA 2EK5A 3IKTA 1BN5A 2DT5A 3AAFA 4MNUA 5LRRA 1QQIA 4OIPF 2AXLA 4N9HA 1FX7A 2FOKA 3K9TA 3O2PE 1P2FA 1WRJA 3K69A 5AIQA 2W84A 2ZKZA 4Q4ZF 4HX7A 2CFXA 4GXOA 5BMZA 1T38A 3NQOA 2RNJA 5KK1A 2XAGA 1T39A 4UVAA 3K2ZA 1HKTA 1OPCA 5H6QA 2IPQX 5DD8A 2HDCA 4UNOA 4TV7A 4ASNA 3TO6A 1XN7A 3SQNA 1R5GA 1S7AA 1U2WA 1I27A 1K78A 1DUXC 3WE2A 3ABTA 4BHPA 2EV5A 3QU3A 3WU0A 3KP2A 4A12A 3PQJA 4LK1F 1BC8C 5ED4A 5HDGA 5HVQC 4G94A 4IVNA 3OV8A 2IVMA 2E1NA 4LG0A 1U78A 2Y0MA 5FFZA 3LQQA 2LKPA 4A0YA 2H27A 2QQBA 4BH9A 2KIMA 2HR3A 3H3UA 3ML6A 2NNYA 3F8BA 5DV5A 4H0EA 1YYVA 3QAHA 3FXUA 4AIKA 3WTVC 1SD6A 4HV6A 3D5LA 3T5XA 4ESBA 1FY7A 2FXAA 5CVRA 5ILVA 3JW4A 3MWMA 2GWRA 4B09A 1R5HA 1O3TA 4EM1A 1IN5A 5DUIA 4GYGA 3FMQA 4L9JA 5LHGA 4EJUA 2VBZA 1D8KA 4OOIA 2QZ8A 4JQFA 5L3DA 1OR7A 1FZPB 2PG4A 3I5UA 3WTUC 2QQAA 3ZMZA 2STWA 1SAXA 2M5WA 2PEXA 3V8LA 1J2XA 3KEOA 3L7WA 5L3BA 5LGUA 1R1VA 3LWFA 4XBFA 2GZWA 2QLZA 3P9KA 1IN4A 3TKYA 4R1HA 1IRFA 2PBIA 4L9TA 1QNTA 2FNPA 2G7UA 4Y17A 1YLFA 2PMUA 1QGPA 2ZO4A 1SMYF 3HOTA 1R00A 1LDJA 1FLIA 2A69F 2WC2A 5JR3A 3LSTA 1J0RA 1XMAA 4RAYA 1FYMA 3DQVC 1P6RA 5D4SA 3GZ6A 4EGYA 3GWZA 4E70A 1LEAA 1KQ0A 4A6EA 4I98B 3G73A 3V8JA 3COAC 1HSJA 1X3UA 2P6SA 4RB3C 1IF1A 3E97A 2G9WA 5DCMB 1O7FA 1BM9A 4EJWA 4ZYGA 3IWFA 3V7CA 3E3VA 3WGGA 1ODDA 3RYPA 5L3GA 3U2RA 4I02A 4O6JA 1NHAA 4F7ZA 2WV0A 1WKMA 5FD5A 5JVTA 5H6RA 4BQAA 1YO5C 2H94A 5HLGA 4IPAA 4U0WA 3C18A 3LA2A 1RZ4A 5HS9A 4ZZDA 2XVCA 1REPC 3ZPLA 4YG2F 2GA1A 4KICA 3ISPA 1HBXG 1FBQA 1GXPA 2YSRA 4Y13A 4L18B 4ENJA 4EJVA 3LQRA 3B02A 4FT8A 5LRSA 1BIBA 2E7WA 4Q48A 4ON0A 1FBUA 2DU9A 3DPTA 5BPDA 3ERED 2HS5A 4ZH4F 3HTSB 2NNNA 4U0YA 4U0VA 4WF2A 4AVPA 4A2UA 2JT1A 4CGZA 4M72A 3EETA 5HDNA 3DF8A 3REOA 3FX3A 1D5VA 4KIBA 5EEGA 2CQKA 2DTRA 1H9TA 3TGNA 1UB9A 1MJBA 2MBFA 2KIUA 1MJAA 3ELKA 1P4WA 4KYWA 4RGXA 2VT2A
chains in the Genus database with same CATH superfamily
5HOOA 1KU9A 1VQMI 4I7HA 2GLOA 2W24A 3G3ZA 2QKLB 2QF7A 4IRIA 5GTHC 3CUQB 1GT0C 2LVSA 2CGPA 3O8HA 2B63J 3DV8A 2J5OA 3HRUA 5DDGA 2MLKA 3QU6A 4IRGA 1FWZA 3FXOA 5DEQA 2TDXA 3RSNA 4KA4A 3RJPA 5HNHA 4DYRA 2XV4S 1JTYA 2BYVE 4Y3OA 3NRVA 5J1RA 1HDDC 4GFBA 4BKXA 1HA8A 1MW7A 2E5ZA 3L2CA 4X6AJ 3K4JA 2XB0X 5K7FA 1ZARA 2YUSA 5BOXA 4JK1X 1RNLA 3DPLC 3GFLA 4XRSA 2LY9A 4M74A 3GYHX 3ECHA 1G6NA 2X6OA 1LDKB 2HWVA 1FOKA 1SVOA 1NG6A 1TLHB 3UNGC 1X2NA 4Q47A 2IS2A 2XPVA 4HYEA 5E8GA 4HBLA 3IRQA 2ZXJA 4BXUA 2QBYB 3I64A 3M1EA 2EA4A 4BHCA 3I59B 1MGTA 2J5PA 3VYSB 3FXKA 3DTIA 3R0JA 1GDTA 2H8WA 2MFZA 4A5MA 3ZQLA 2MGQA 3CLQA 4II3A 1FPQA 2A5WA 3CDLA 3GXOA 5IP9J 2JK3A 3C2GA 1BI2A 2JRMA 2E2HJ 3DTKA 4BDYA 2HXIA 4ZTJA 4XLNF 3ZQGA 5TISC 4EM0B 5EGOA 1Z21A 3DEWA 3FK6A 3ZMUA 1MMNA 3HGGA 4LLGF 1VZ0A 4AIHA 2DK8A 3OYAA 1KU7A 5LHHA 5K7HA 1Z7UA 1QHHD 3QODA 2DDBA 1G2HA 3BG5A 3GFJA 2VBXA 4ENKA 2QEXI 4KITB 4E6KG 2BBYA 2LMDA 3BPXA 2CUJA 4XOPA 2D2WA 2VKVA 3QRFF 2Z99A 1YITI 2VKEA 1ZLKA 2EZKA 4PJNA 2LDUA 1UJ8A 2HNHA 4OMZA 2KHMA 4KN4X 1NG7A 1P4XA 4A3DJ 2ELKA 2F5EA 2V79A 4KMFA 4CSWA 2OJED 1DPUA 1IUYA 4LFUA 3GX4X 3OIQA 1K7AA 1S7EA 2JA2A 2KKOA 4V2FA 2NVUB 2O03A 3OIOA 4KT5C 2Z9OA 2W82A 3DTEA 2QWWA 4YEJA 5IP7J 4UV8A 1HW5A 4WXCA 3OWTA 2FQ3A 3MEXA 3R61A 4UVBA 1SANA 5JI6A 3J7YJ 5D6EA 3HOUJ 3S1NJ 3K0LA 4E7JA 3PJRA 3HSRA 3ABMH 1O57A 1P9QC 1B9MA 2LF8A 4XKWA 3G6EI 1S9HA 1A5JA 2EB7A 3HEFA 2HKXA 4L5EA 1ZGJA 1RI7A 4DZJA 1LNWA 1EA3A 2F4IA 5EJCA 1MIJA 4RB0A 2FEZA 5F0FA 5J47A 2O9LA 4EJTA 1AHDP 1K78B 2KPMA 3WTXC 1E3HA 1KYZA 1TBXA 2D1VA 5A2QZ 4WX9A 1H88C 3U1KA 3CTAA 2KLOA 1Y8QB 3DFGA 3DLLF 3W2AA 4A3LJ 2MD5A 5LFAA 5HDKA 1Z1DA 2Q0OA 2VBWA 3QOPA 2FU4A 4FE7A 2W57A 5J8CA 2V1UA 2XKPA 2ZXIA 5F1JA 2VXDA 5H2FC 5FLXZ 3LAJA 1K4SA 5J8FA 3JSPA 2XAQA 4D7NA 3X2QH 3N97A 1Q1HA 2F4OB 2PQ8A 4MEYF 5FKKA 3KE2A 1BJAA 2EWNA 2KZVA 4RGUA 3DBHB 4EJOA 5D5UB 2V1NA 2BZTA 4RMNA 1K6OA 4NC6A 4LG0B 3HL2A 3Q0WA 4E7IA 2EIJH 3LAPA 4D9JA 1E0EA 3OYCA 1MMAA 2V9KA 4KISA 2ME6A 5GPCA 3H5RA 4JOMA 3LA7A 3JRCA 2VC1A 3ZGKA 4CUGA 1H0MA 1TWAJ 2E1MB 3MZHA 2M8GX 3GTGJ 1X1BA 5CVUA 1OYYA 2KISA 4L0ZB 3Q9SA 3GZ5A 3UR3C 3ZMSA 1Z77A 2L0KA 4Z2YA 4CZZA 3OYFA 4DYQA 1PUFA 5E18F 3J7AO 1UCRA 4ZJZA 3MD2A 5JHUA 3OL4A 5JVGF 4MEXF 3J81Z 3RZOJ 2HZDA 3ZMVA 4G9YA 4XICA 1CQTA 3ZN1A 3TO7A 1IUFA 3W2VA 3OSGA 3SEZA 3F0CA 1Z7LA 1DU0A 2PJPA 5D8KB 3PNTA 3Q0VA 3HSEA 1UAAA 5HODA 2FUG2 3KLNA 4HSRA 1OR7C 2W1OA 4YFXF 4V2GA 1GLNA 1ZQ3P 4KFCA 2X1DA 2LY2A 2IRFG 1RIOH 3SYTA 1RUNA 2X6WA 4BE1A 4XRFA 2COMA 3EUKL 1ZR4A 5CJ9A 1MZBA 1L3LA 3F21A 4BL0B 2LTPA 3H9GA 4ZDPA 1U9NA 4ENNA 4AD9A 3CCLI 3S16J 1XC5A 2JSCA 1YX3A 4X1EA 1LQ1A 3JAMZ 1STZA 2R7OA 4KUMA 3L2UA 2HDDA 4PSXA 2Y31A 2H1LA 2ECCA 4P9FA 4FETA 3J7AY 5M5XJ 2X4HA 1HOMA 1X1PA 4M71A 3WGIA 4M6VA 1WSUA 2ZJ2A 3OYIA 1LDDA 4G7ZF 4XLCA 4M3DA 5HS8A 2XHKA 3IAS2 2QQ9A 2ISYA 4DJAA 1YFHA 3CESA 3J80Z 3A02A 2IGMA 3K70C 4IJAA 5D6FA 3HGYA 4RS8A 1EKEA 2P8TA 1MBEA 5DYMA 1BA5A 1JE8A 2HOEA 2MC3A 4OIOF 4DYCA 1TQMA 4A3GJ 2P0WA 5F1RA 2QSFX 4P5OA 1QPIA 3HRTA 5KHDA 5ICEA 3P9IA 2CU7A 2L54A 4AIDA 2OTLI 1VQLI 3SFZA 1XGOA 2CV1A 4HZFA 1MBKA 2UZKA 1CF7A 3ZMTA 4WK8F 4M3EA 4I0AA 1X3ZB 1WI3A 2QENA 1G8XA 3M3YJ 3BG7A 2OTJI 3ZN0A 2Q2EB 3WGHA 4HDUA 1Z0XA 1IW7F 2XC7A 4B8XA 4UB6C 2K9NA 2WY8Q 3ZRGA 3S2WA 2DYRH 2OUMA 1IZ1A 2RGVA 4UV9A 1ZG5A 3FMSA 1F1ZA 3W6JB 1HSTA 1V4RA 4EMSA 1BW5A 4OWRB 2DPUA 4BY7J 2JVGA 3R6SA 3C7JA 2DOEA 5B3SH 3H0GJ 3OS0A 5K5RA 4L5IA 1YJWI 2LNBA 1FNNA 3FXMA 2XUBA 2VOOA 4HAMA 1T2KA 2KZGA 5GPAA 2XASA 2VJ4A 2CQXA 3VWBA 4U88A 3RPQA 2WB1N 5E1ZB 1OCPA 3FKJA 1W36C 3H3ZA 3OYNA 2VB6A 4ZYEA 2CW7A 4BS9A 1BOAA 5KAFC 1JGSA 2CQNA 1UELB 2CUFA 2X51A 4QWQA 4BU2A 3WG7H 2X48A 2E7XA 4DOZA 5ILUA 1E3OC 5LGNA 2O3FA 2OF7A 3RDIA 4G7HF 5D8LB 4GRIA 1U8RA 1V5GA 3WTWC 2JQ7A 4IOCF 1OQYA 4HPQA 5IT9K 2JWTA 2YR2A 3ASNH 2D5VA 1R4MB 1TT5B 1VQKI 1WJEA 3I4MJ 5HLTA 3S8PA 4M73A 4HF1A 2DFEA 2LREA 5TJJA 4D1QA 4LB6B 3KP7A 2P5LC 1D1CA 1F9NA 2QYOA 5CQGA 3VEPA 3TW6A 3RZDJ 2UXXA 2ZBKA 4KIFA 5EEHA 4EGZA 2R7RA 4AM3A 2O6GE 1YHQI 3FM5A 1OYWA 3C3WA 2P4WA 4B4CA 2IS6A 3A01A 2BEOA 4XOTA 1WQ2A 4FQGA 3RKXA 5HS7A 1FSEA 3KETA 4D7MA 2R7VA 4D5CA 3PUFA 2F5CA 4M9SA 3LSMA 1MBJA 3FWEA 3H92A 3V42A 5ICCA 1W7PD 4BGDA 1WJ5A 3OYJA 1EH6A 4LGWA 1WWXA 2L7FP 2DMQA 3DKXA 1XB4A 4A3EJ 3MN2A 1ZAOA 3KP6A 1U5TA 4II2A 2FF4A 3S3NA 1IRGA 1R22A 2XROA 3TOAA 1W7PA 3LSPA 2R5ZB 1X1CA 5M5WJ 1B1BA 2NOGA 2OPTA 4AVZA 5D5VB 1SD7A 2PN6A 3KP5A 2CQQA 3CP8A 3GMEA 2EJRA 5E3OA 2A61A 4PDKA 4LG3A 1R1UA 2LY1A 1ETVA 3GLLA 2IGKA 1AOYA 2R93J 3E6MA 3KZIC 4J00A 1G3TA 1WHUA 3FM3A 3RKYA 5FJ8J 1TC3C 1A6QA 3CJNA 3GF2A 3CCJI 2VQLA 1YS6A 1HXDA 1TWCJ 3TQNA 4XSZF 3E1SA 1IDZA 2Q2EA 2L7KA 2EIMH 4NBQA 3RIRA 3RQIA 1ETWA 3H9QA 4A3BJ 3F8MA 1MJ9A 4RAFA 1RUOA 2EILH 4IOAF 5ICFA 4DIQA 3B6AA 1AKHA 3I71A 2QUFA 4EVIA 2DDAA 3BP8A 1TQIA 3HHHA 3QYEA 3IH2A 4F55A 5CYVA 2HYGD 4BQNA 3C2HA 3QPTA 2VJ5A 4MGRA 1WJCA 2STTA 1TTYA 4OMYA 4I99C 4CXFA 4WCGA 4FHTA 5B1BH 3CCMI 4JX5A 1HF0A 2HQAA 1I5ZA 2X9DA 2DAOA 2FBHA 2XKOA 4E7LA 5FROA 1IXRC 3OYEA 5HLIA 1XSXA 1R9TJ 1VQOI 2KRCA 2EINH 2W85A 3QWLA 1QZEA 2BY1A 2QA4I 1Y56A 2WAQN 3CCQI 4MHGA 2W25A 2MH2A 5FFXA 1I39A 5CVVA 3E6CC 3DXJF 4P9UA 1LFPA 3ZXSA 1X4PA 4NB5A 3PFIA 2DO7A 1JKRC 5ICGA 3CC7I 4EV0A 2X85A 3Q3SA 5L3FA 1D0YA 2LG4A 2OAZA 1A6IA 1D0XA 1LFUP 3FHZA 1FYLA 4CH7A 1JKOC 2BVMA 3M4OJ 3OYMA 2HQRA 3ABKH 1JXSA 2XF6A 2MA3A 2FQ4A 4OIQF 2BXZA 4C30A 2VUMJ 3KYDB 5FGMA 2CWEA 2JTVA 4PFOA 5KVRA 4RLQA 3U9GA 1UFMA 1BR1A 2LLKA 3OYHA 4NUBA 2PX9A 4IHSA 1KGSA 2IT0A 2H8RA 1BIAA 2HOAA 5B1AH 2A07F 1GHCA 4A6DA 4FX0A 2K9SA 1O3RA 2WWYA 2M4GA 3F72A 4RGSA 3NARA 3JRDA 3RYRA 1POGA 5EGOB 2O61A 1JHHA 4PGGA 1S8NA 3HKZN 4A3FJ 2K3PA 1ZG1A 1FYKA 9ANTA 1P92A 3G4SI 3ZQQA 4UUVA 3EDPA 2DJIA 3MKZA 3FXQA 3KFWX 5FKOA 1FMVA 2LK2A 1S72I 1UHWA 3GLXA 4OAYA 3U1DA 2MSYA 2R7XA 3BROA 2NRAC 2EFWA 3F8FA 1YE9A 2FX0A 5DM6F 1EH8A 2OZ6A 2GQQA 1I6HJ 2MD0A 5EG0B 3S2DJ 1USTA 2YU9J 5K1YA 2HQ5A 4XIDA 1YIJI 1W0TA 1MH4A 2DFIA 4HA8A 1XD7A 5DM7F 3MVPA 4UUTA 3M8FA 2JRTA 1DP7P 1WJAA 1UHSA 2Y0SA 1F43A 2AHQA 1J09A 1KU2A 1DGWY 4NC7A 3WU1B 5D4RA 3FHNA 3JTHA 4JP0A 3OYKA 4XRSG 1LE8A 2LR8A 2VKDA 3ZOBA 3IWZA 3A1YA 3BPVA 1RRJA 3WODF 5HLHA 1PP7U 3CUQC 3BR0A 3GFMA 3GCMA 4M3GA 3KX2A 4AYBN 4IXAA 3TP3A 1ZHFA 5LEJA 1V55H 4E7KA 4YELA 4LB5A 2M4KA 3CO7C 2A3SA 4E4HA 3TL4X 2Y75A 1O3SA 5M5YJ 3S1MJ 3CMMA 3QPHA 2EPFA 1FSHA 3WTYC 3CJTB 1IGNA 5LBQA 4LLNA 1RR7A 2ID3A 2LYCA 3EUAA 2VODA 5F64A 3KYLA 2VN2A 2W4SA 3QYBA 2EBIA 3GVAA 3ONQA 1IO2A 3LA3A 4FISA 3VFZA 1VQNI 4HQEA 1GXQA 1WJBA 2QM3A 1J7KA 1IXCA 2WTEA 2JMWA 3IKVA 2XGXA 1T33A 3CJRB 1N75A 2W48A 2DA5A 2LKSA 1ULYA 4ETSA 1ZK8A 2KL4A 1HC8A 2RVCA 3KCCA 2WBMA 3PM1A 3SZTA 2JPBA 1H9GA 2K86A 2HVRA 1MNEA 2JZYA 4NNJA 1ZREA 2FJ1A 1KONA 2V6CA 2KIFA 5IT3A 2CO5A 2BY0A 3K4KA 3H5AA 1GVDA 3GEZA 3BZ6A 5AIPA 2FBIA 3CCEI 1WZ2A 3HOZJ 3IRRA 1QRYA 1QPMA 4K2EA 4E7HA 3N4MA 1JTXA 2L7MP 3VODA 3ECOA 5EZHA 1Z6TA 2AO9A 4HNUA 2K7LA 4IO9F 2Z3YA 2ZMEA 4CYCA 1PUFB 4ENMA 1OYIA 3EYIA 4A69C 1J75A 5LD2C 4HSTA 1CGPA 4QTRA 2ETHA 4IEJA 3CF5F 4HOBA 1APLC 3S32A 2KJCA 3LNQA 2PJRA 1O3QA 2BY3A 2DBBA 1Y0UA 4PK4A 3OIPA 4C2MJ 3CDIA 4U7BA 1MMSA 4CCKA 2DQRA 3TP0A 5EG0A 5E20A 1Y1VJ 5IPAA 2DA6A 4Q5SF 1A36A 2RV8A 3ZR8X 2FD5A 3MKLA 4IQ4A 1FTZA 1B72A 2HZTA 4BBSJ 1B4AA 1B59A 3F23A 3L2VA 3BTJA 3E0JB 3L9FA 3AKZA 1IJWC 2FMYA 5J6XA 2IA0A 4BNCA 4BQOA 3L2WA 1S6LA 1LB2A 1Z91A 1PUEE 2CS3A 2X6XA 4M3BA 1SEUA 2FA5A 1P7IA 3GTOJ 1FP2A 2D1HA 1W5TA 3ZQ7A 4RAZA 2L5QA 3V7RA 1IAWA 1VQ4I 3SHFA 3JCUC 3B6CA 2DI3A 2C6YA 1SD4A 1NH3A 2MH9A 1R49A 1MH3A 3CP2A 3R60A 1MBGA 3V7SA 2VE8A 2GXGA 2QVOA 1IRXA 4XR6A 2DK5A 2DLLA 2DPDA 4GDFA 4PUSA 4QPOA 3KEQA 3RTRA 1TNTA 1IG7A 3S93A 4DQ2A 4RGRA 4QLCU 2FOWA 2KMUA 2IBDA 3Q0UA 4PCQA 2L4AA 2G7HA 2L9NA 2IJLA 1Z67A 2FSWA 2GOXB 4XLHA 3HZJA 2LBFB 2V9VA 3I4PA 4DNCA 2DXIA 1C0WA 2Z2SB 1FT9A 3ESWB 5F0HA 2R3SA 5H20A 1CF7B 4O5VA 1YTYA 4AC0A 1IN7A 3VSKA 3DBLB 3T8TA 2CMPA 2DN0A 2VQCA 4IX7A 1TQPA 1DDNA 3MAJA 2CYYA 4M9XA 1Z3YA 3TOBA 2VT3A 2NVYJ 2Y30A 4B48A 2HTSA 2K3FA 2JSPA 5DCFA 2GM4A 3BY6A 4MFEA 2PI0A 1JKQC 4AIJA 2K27A 2HPMA 1VQ6I 3OR2C 4FX4A 2E1MC 3T1BA 1ZYRF 3OOUA 2AQEA 3BTCA 2P6TA 5DUKA 1JUMA 3RKWA 5KNLA 4HQMA 2M45A 4C3HJ 3FXJA 3GTQJ 2IA1A 3PQKA 4DZPA 4NQWB 2O8XA 3LOCA 2ZB9A 5FKLA 1TWGJ 3BCBA 2JVHA 2DMNA 5D5WB 5LEKA 2V1DA 2Z5UA 4ZZLA 4HF2A 1IN6A 4F52A 1D3YA 2M7BA 3TBIA 1IXSB 1LUJB 2WAEA 2QKMB 2AS5F 2E19A 1LEBA 3I0TA 4IRHA 2X1CA 3KZZA 3OSFA 2E1OA 2ZJPF 1Y1WJ 3CCYA 3GW2A 4YIRX 3BJOA 2YPRA 4JBAA 2HQNA 4YIIA 3ERMA 3FBNB 2DW4A 2IAIA 3HSFA 2R7WA 2F5FA 4N0BA 1I3AA 1QO0D 4CCOA 1X58A 3FKIJ 1W4MA 1HW1A 3PO3J 1OCOH 4C2UA 2P5KA 2RKHA 4YFKF 3DEEA 1F5TA 2EA2A 4M6XA 2A68F 1IV6A 1RESA 5FKMA 3CJQB 2O8KA 1VQPI 4U87A 3HG9A 1Y8RB 2K02A 2DA7A 3PIPF 2JUGA 1TW3A 4L9VA 1MDMB 1R6RA 1ZR2A 3EUHA 4CZCA 3JRBA 5CVJA 1U8BA 1S3JA 5J1YA 1K6YA 1X1DA 1KQ8A 5TGTA 4XLAA 4KMUX 3A01B 1GV5A 5K5OA 4XLPF 3IH3A 1H8AC 3IL2A 1ZRCA 3ZQFA 2TCTA 2MLGA 3BOQA 1I1SA 2V7FA 1NTCA 2EFOA 4HG2A 4UY8I 1U5TC 5E3NA 1RR8C 1XGNA 3M9AA 4HF0A 3HUGA 3WTZA 5TRDA 1BBYA 2VJJA 1ZLJA 2XF7A 2ADUA 1DGRM 1SMTA 2W00A 2LF7A 4A0XA 2HEOA 3IH4A 3CMYA 1R71A 1ETYA 1U5TB 3D5SC 2V26A 3DP7A 4D0PA 1W7PB 2RN7A 3S1QJ 3H35A 4ZDLA 2R7QA 2I10A 3EQLF 3RI4A 1MD0A 3BC8A 3WE3A 1SFOJ 1WJFA 1TT0A 3N05A 4RDUA 2LBFA 3BJ6A 2RDPA 3CDHA 1ZGWA 1IN8A 1JI8A 2L7ZA 1Z6RA 1SFUA 2XGDA 2L01A 1TNSA 1SD5A 4CICA 1OJLA 4R79A 2HOTA 1ERDA 1QBJA 1A04A 1R5ID 2PMZA 2OQRA 2RC4A 4XL9A 3OYGA 4A5NA 2M7AA 3NEUA 3ZMDA 3LL7A 2LRDA 3FIWA 2VE9A 2JJ7A 4PZJA 2FNAA 2NYXA 2QSGX 1BI3A 3ROUA 1EH7A 4DBRA 1OCZH 2O0YA 1T6SA 3VOEA 4HNVA 2LH9A 2K9LA 1YX5A 1ZG3A 1SC7A 2GA2A 4AWXB 1AKHB 2F5DA 3CLOA 5ILSA 2A6HF 3BZKA 1W0UA 1MKMA 3CQZJ 3V4GA 4CCLA 3MZYA 3HJEA 4IHYA 4S05A 4J01A 2DCEA 2CUZA 2M1BA 2UV1A 2XF5A 5E8IA 4NQWA 1LJ9A 1Y39A 2DA2A 3TO9A 2ESHA 2V1XA 3HIFA 2JA8J 3G2BA 3ZQHA 4LJZF 5F0CA 3FZVA 4AU7A 1FOYA 3VB2A 1O4XA 4XLFA 1WPKA 2HYFA 4FE4A 2KRFA 1U3EM 3PO2J 3ULQB 2R5YA 3CMAI 3E6BA 2MABA 1MSEC 1W5SA 3CUOA 2RQQA 1AA7A 3VDXA 4A3IJ 4N4OB 3DEUA 2Y48A 4C3IJ 1VTNC 2VASA 3WTSC 2BE5F 2GAUA 4UVCA 3JRIA 1KZHA 1I3QJ 5L3EA 3LSKA 2VL8A 4CYDA 3TMOA 3KPHA 3ZQIA 1WI9A 1ETXA 2A05A 1XSVA 1SFEA 2XAHA 4L9NA 1MDMA 4XLEA 4IZZA 3CZ6A 2CSOA 2E35A 4MTDA 2OBPA 3CCUI 4V19K 3MFKA 3IHUA 3DU6A 1PVEA 1QVTA 4BYYA 1HQCA 2KIQA 2XAUA 5J1UA 5L3CA 2D45A 5LHIA 3LSHA 4XK4A 1ENHA 4RB1A 3QP5A 3CC2I 3AG3H 4A93J 1UHMA 4GO1A 1S29A 3ZCOA 1FC3A 3T8RA 1OKRA 1G4DA 1BI0A 3SZGA 4OIRF 2FBKA 3GZNB 6PAXA 5GAHJ 5GADJ 2A5YB 1V3FA 2I5UA 1XPXA 4KDPA 3LSJA 4EEFG 2QGUA 2YU3A 3K2AA 2LD5A 1BR2A 4G6DA 3VSLA 2DYSH 5FD6A 3JREA 1NK2P 3HPHA 3M7GA 2R7TA 5BQTA 4KT6A 4HLYA 3Q9VA 1S7OA 2ZCWA 3HPGA 4RB2C 2H09A 1VNDA 4BXFA 4KNYA 2ZSHB 3S14J 4LMYA 1HW2A 1PDNC 5J4VA 5EDNA 1K79A 5HNFA 1XMKA 3FF5A 2IGNA 4WXDA 3SXYA 1B8IA 2EV6A 5CLSA 3OYDA 3I4NJ 4F93B 1MMGA 2CFOA 1RPWA 1OMIA 3BQYA 2M8EA 2QQ8A 2HTJA 4S04A 1LVAA 2E71A 2M2EA 3HOYJ 3K1NA 1PJRA 1DU6A 1J5YA 3I9V2 2P5VA 1Z3XA 1Z05A 1LE8B 4E7SA 1I50J 3WG9A 3L09A 2M30A 2UUZA 4ZYHA 1QZZA 1HKQA 3B73A 3CCVI 2VC0A 1BW6A 5AONA 1QU3A 3QP6A 2PMHA 3K1PA 1G3WA 3FXLA 4HRIA 2VLAA 2ICWG 4HV5A 1HKSA 1QVUA 5C44J 2VBYA 3FISA 2NXNB 4MLOA 4EM2A 3D0SA 5LLQA 2E1CA 1UMQA 2EZLA 1L0OC 3I3LA 1KA8A 3WTTC 1SVLA 3S15J 4UXNA 5K5QA 2RNGA 4BY1J 1X2MA 4P96A 4IHVA 1AWCA 2XAJA 1TWHJ 2B0LA 4I01A 2ELJA 3BDDA 3BR6A 4ITVA 3C1DA 4FTHA 2PLYA 5IYBJ 4IF4A 4Z6YA 5A2QK 2VQHA 4PGHA 3RQ4A 1Q1VA 3F6OA 2GOMA 2HOSA 2LC2A 2OCEA 3PNYA 3EYYA 4XKVA 4ZDOA 3OOPA 4YIFA 3I54A 5FO5A 1DPRA 4C2TA 1P7JA 4O3MA 3TDZC 4LD5A 3NAUA 4QIWN 3SEQA 3SDBA 5J3LA 3O8GA 4I2OA 4CA0A 5FLXK 1ZH5A 2BHZA 5M3FJ 3E5XA 2LOOA 5JLWA 4UUSA 2I8DA 2CW0F 2DQLA 2Z1DA 2PFBA 5DD4A 2IXSA 2EV0A 4G6QA 3ZP5A 2ZMEC 2EFPA 3HYIA 3HB9A 4DW6A 3ABUA 4XSXF 3V8KA 4FASD 1D1BA 4L5JA 4XONA 2VONA 1ON1A 1U6GA 1XGMA 2F48A 1G3YA 4HDVA 2DFFA 4XN3A 4XM3A 2ZMEB 1J9IA 1FP1D 2LP0A 1WH5A 2P7VB 4GGGA 1RKTA 4CYCB 1VFCA 2OU2A 3AG2H 3E6DA 4UB8C 2LKXA 2YX7A 3F22A 2DTZA 1D0ZA 2ZSIB 5FB2A 2ZFUA 2Z16A 4MTEA 1EF4A 3T0YA 3LFUA 3QOEA 4M6YA 1FTTA 1JUSA 3G1MA 2PJRB 2ZNZA 1R1TA 2X6YA 2IW5A 2OA4A 2Z33A 3UKGA 3IC7A 4BE2A 2ISZA 3J81K 1SFXA 2BVLA 3KP4A 3W6KB 1FIAA 4LK0F 1ZRDA 5BPIA 3OL3A 4QSHA 4XQFA 3AG1H 2CG4A 1B72B 3K1MA 2OV7A 1OCRH 3A2KA 1T98A 3FBIB 3Q5FA 1ZRFA 3CCRI 2BW3B 1ZN2A 4LOCA 3O6BB 5IOYA 2EIKH 1XCBA 3LFKA 1BOBA 2FMLA 4GYIA 1DP3A 4XRMA 2NAZA 3P5JA 1YRNA 4XNFA 3HXLA 1E17A 2XDVA 3EPZA 1K4TA 1X4OA 4BE0A 1FBSA 3C2BA 4MQVA 5ERIA 1YJNI 5KAIC 2L9RA 3RPUD 1E2XA 5E1WA 1G59A 3NWSA 1ACIA 2KDOA 3TDUC 1BI1A 2UXNA 3VYTB 4PJ0C 5BS6A 3HOXJ 3S2HJ 1OLTA 1ETQA 4HX4A 1QHGA 5C3EJ 3BR3A 3MQ0A 3RPUA 3F6VA 3JAMK 3DWLE 1FIPA 3DKWA 1Z9CA 1R7JA 1J59A 3GBGA 3L00A 2F4MB 3P7NA 1YIOA 1YW9A 3GO5A 2ECBA 4KIGA 1XG1A 2X0LA 3S3MA 3AL0C 2K40A 2K4BA 5LGTA 1R58A 2ELHA 1OCTC 4HX8A 3IV5A 2EFQA 3H0DA 3GUDA 1G3SA 1TL8A 3S1RJ 3J80K 1F4KA 1YW7A 3SDGA 1MMDA 5DCMA 5DTDA 1SAUA 1VQ8I 3AL0B 3QPLA 4WXHA 3D1NI 4B3XA 2XIGA 4J19A 4BQQA 2XRLA 3KP3A 4G7OF 1XMXA 3KLOA 4X0GA 2GIVA 2UWMA 5E1XA 4P55A 2V6EA 3BWGA 3A0BC 5CVIA 1ZKGA 2L3DA 4EATA 1WH7A 5GAEJ 2ZNYA 3BJAA 1B9NA 5IT9Z 2IEKA 2BY2A 2MC4A 4YFNF 4IHXA 5F08A 4HNTA 4P1WA 4R8HA 2K4JA 2EZIA 5GP9A 1X19A 2ID6A 1UG2A 4HW0A 1ETOA 2NVTJ 3E5QA 1NK3P 2VXZA 2KJBA 1TZLA 1YQAA 2OC6A 2L02A 4FCYA 3GTLJ 2H1KA 4YRVA 3SJMA 4IHTA 4OINF 4D5FA 3MKWB 3CD6I 3BG3A 3AG4H 1JJ8C 2H6BA 4Y15A 3GTKJ 2WAFA 1QA6A 2L2OA 1P4AA 3FMRA 4HLXA 2OZUA 2YX4A 4ZYAA 5D5XB 2Y0SN 2K9MA 1V5EA 1XDUA 3HRMA 1RETA 4PJMA 4BUPA 4Y4RA 3PNVA 3BR5A 3G1LA 1SFKA 1U0JA 2FE3A 2ZC2A 3ABLH 3AFHA 3F3XA 4BHBA 1USSA 2LSOA 4XKCA 5JHFA 4N9IA 2L4MA 2CV0A 3I55I 3A03A 5EEAA 2ZFWA 4ANJA 3JTGA 4KJZA 1TW2A 2ME0A 3EUHC 4C3JJ 4G6TB 1ON2A 1I1GA 3DU5A 1YOVB 1R36A 1A31A 3VYRB 4N4NB 4EQQA 1O7LA 5F6FA 1S5LC 3A0HC 2NS0A 1R23A 1ZELA 3JRGA 5E17F 1JGGA 3CO6C 3O3KA 2QCOA 2BW3A 2JPCA 1QZYA 1JKPC 2E2JJ 4PFPA 4ESFA 2ZJQF 3F8CA 3KZYA 2BV6A 2HVQA 4UHTA 4B1RA 2E36A 3HOSA 4U7DA 2H6CA 5B5EC 3G71I 3K4MA 3PSIA 2VPLA 1AU7A 4WWCA 1OISA 2HKOA 2GXBA 3OY9A 4I09A 4ZYDA 2M0CA 2HGCA 3P9CA 5JFRA 2XAFA 4GCVA 1XS9A 2DMUA 3HUGB 2RQPA 1XSDA 2VOPA 1MNDA 2KQRA 4C9YA 5EYRA 4CDGA 1JT0A 3I53A 3MKYB 1KYWA 2R7DA 2DJNA 2XRNA 3IUOA 3GTMJ 1YS7A 3FXRA 3BG9A 2M87A 1Y6IA 4IKFA 3GFIA 1HLVA 1XDSA 3G1OA 1YG2A 2HFHA 4CHUA 3F9KA 3SZPA 2OD5A 5E79C 3QYFA 3M07A 2RREA 2NS7A 2R7SA 1T0FA 1XX5A 3W6VA 1MBFA 3HDDA 3M1CA 2F2EA 5FLMJ 4NHJA 1D5YA 1XGSA 4BAYA 3MCZA 1ONVA 2EFNA 2P7CB 2IGOA 2CQ7A 3F8NA 4CCMA 4I0BA 3CUQA 2OQGA 4MQ9F 3L2QA 2AXTC 1IC8A 2A6EF 2DA1A 2VIXA 3M8EA 4LLLA 2W7NA 3RKQA 4KN7X 1KQ9A 4ESJA 1GUUA 3S3OA 1XCVA 3K10A 2JA7J 1PP8F 4L0YB 3KYCB 2BGCA 3E5UA 4H4KC 3OR1C 5JLXA 3HTUA 5IP6A 3BR1A 2B7EA 2R7FA 1VQ9I 5CQEA 1T95A 4A0ZA 1GVJA 2IA2A 2KFDA 4OU0A 5DS9A 4M9ZA 3MZ8A 1MSFC 1ZGAA 1XTAA 2IP2A 3R4KA 1KU3A 1EV7A 2O7OA 2ESNA 5J40A 1I6XA 3RCOA 1JHFA 2QBYA 1BC7C 1WFXA 2FRHA 4B43A 5IYCJ 2BOLA 3I59A 3JSOA 4CO8A 2ACJA 5F27A 4G8XA 1YW8A 3H5NA 3HRSA 5IY5H 5KCMA 1D8JA 2R5YB 2DOAA 2COBA 2NS8A 3HHGA 4JX4A 3I58A 3I56I 2Q8KA 2N8GA 4B3AA 5FKNA 4RA2A 1B6AA 3KEYA 3R0AA 4BDZA 3WHCA 2XGEA 1WVRA 2EK5A 3IKTA 1BN5A 2DT5A 2A6TA 3JRHA 3AAFA 4MNUA 5LRRA 3OYBA 2MW8A 1QQIA 4OIPF 1YJ9I 2XGCA 2AXLA 4N9HA 5K7ZA 1E3PA 2L9VA 1FX7A 2R4GA 2FOKA 4BXXJ 1MNMC 3K9TA 3O2PE 1P2FA 1WRJA 3K69A 2NVQJ 5AIQA 2DT7B 2ZXHA 2W84A 3BTIA 4RM3A 4RLFA 1A35A 2ZKZA 3GTJJ 5EF6A 4B47A 2M0MA 4Q4ZF 1TWFJ 3JRFA 3KIOA 4I6ZA 3NWTA 4NC8A 1BR4A 4HX7A 2MYSA 2CFXA 3BCAA 2DMPA 3QPSA 1LKXA 1IRZA 2WB1A 4GXOA 2MG4A 5BMZA 2E34A 1WJDA 4F92B 1T38A 4S0HB 3NQOA 2RNJA 5KK1A 3ZQCA 1BL0A 2XAGA 1T39A 4UVAA 3K2ZA 1HKTA 1OPCA 5H6QA 2IPQX 5DD8A 2HDCA 2DA4A 2M3AA 1FOWA 2KT0A 3K6GA 3FDYA 4RAGA 1ITYA 4UNOA 4TV7A 4BJ5C 4W97A 4ASNA 4Y7NJ 5B66C 2R92J 3TO6A 1XN7A 3SQNA 1R5GA 1S7AA 3DLAA 1U2WA 4JX6A 4A3CJ 1I27A 1K78A 1B8IB 4XORA 1EJ9A 1DUXC 3WE2A 3ABTA 2EH3A 3WHBA 4BHPA 2EV5A 3QU3A 3WU0A 3KP2A 3QQAA 4A12A 3PQJA 1D1AA 2DODA 4BJTA 4LK1F 2F6CA 4E7ZA 3BQZA 2XSJC 4LITA 1BC8C 5M3MJ 5ED4A 5HDGA 5HVQC 3ASOH 4G94A 2V4JC 3BZCA 2CJJA 4IVNA 5BNGA 3JRAA 3PSFA 3WU2C 2DT6A 3OV8A 3TW7A 2QSHX 2IVMA 2IS4A 2E1NA 3K7AJ 4LG0A 1U78A 2Y0MA 5FFZA 4XKBA 2HVSA 3IAM2 3LQQA 4A3JJ 4MIMA 2E2IJ 2LKPA 1HDPA 4LIVA 2QQBA 4A0YA 2EZHA 4BH9A 2H27A 1JT6A 1OFCX 2HR3A 2KIMA 3H3UA 3ML6A 2NNYA 3F8BA 2O5RA 5FRMA 5DV5A 4H0EA 1YYVA 3QAHA 3FXUA 4F91B 4NDLA 4AIKA 3WTVC 1VQ7I 3PUBA 1SD6A 4HV6A 3D5LA 1HCRA 2CH0A 2ZXWH 1X1AA 3T5XA 2BHYA 2WADA 4ESBA 1FY7A 2K5CA 1FOXA 5E3MA 2FXAA 5CVRA 5ILVA 2E5NA 3JW4A 2X1EA 4UUSB 3MWMA 4BEHB 1PYVA 1TP4A 2GWRA 1ORKA 2DA3A 2VPRA 4HEA2 4B09A 3CC4I 3H1CA 1R5HA 1O3TA 2JN6A 4EM1A 2E60A 4I76A 4CCJA 2PMZN 1IN5A 5DUIA 3DKYA 4GYGA 2M9HA 2CRGA 4B44A 5C4JJ 3FMQA 4L9JA 5LHGA 2P81A 4EJUA 2VBZA 3LSGA 1D8KA 4OOIA 1UG0A 2QZ8A 4JQFA 3MMYB 1LPQA 5L3DA 1OR7A 5IYDJ 1W1WE 4PSWA 1FZPB 3PFYA 2PG4A 3I5UA 3WTUC 3DCFA 2QQAA 3ZMZA 2STWA 1SAXA 3SFIA 2M5WA 2PEXA 2WA0A 3OS1A 3BT9A 2F5VA 3V8LA 2CUEA 1GV2A 2HDWA 1J2XA 3KEOA 2AQFA 2JUCA 3L7WA 3E7LA 5L3BA 5LGUA 2WAQA 1R1VA 3LWFA 4XBFA 3M8JA 2GZWA 1FMWA 2QLZA 2HXOA 3K70D 5FRNA 3P9KA 2XB5A 2HYJA 1IN4A 3TKYA 4R1HA 1IRFA 2PBIA 4L9TA 3LSRA 1QNTA 2FNPA 2VJIA 2G7UA 4Y17A 1YLFA 2PMUA 1QGPA 2ZO4A 4MFDA 1YRNB 1SMYF 4IQJA 2WV1A 3HOTA 5F04A 2BXYA 1R00A 1DQUA 1LDJA 1FLIA 2A69F 2L9SA 5GAGJ 4ZTFA 2WC2A 5JR3A 2KP6A 3LSIA 2G0EA 2VI6A 1J0RA 1XMAA 3LSTA 4PJLA 3CMEI 2K9QA 4RAYA 5IOZA 1FYMA 1R4NB 3H3VK 3DQVC 1P6RA 5D4SA 3GZ6A 4EGYA 2GIZA 4Y52J 1ZTRA 1LVKA 4ABZA 4IHWA 3BG6A 1T8IA 3GWZA 4E70A 4Y33A 3HC7A 4G12A 1LEAA 1KQ0A 4A6EA 3K4NA 4I98B 3G73A 2DOFA 5CPRB 2XPWA 1T56A 3V8JA 3HKZA 1HSJA 1X3UA 2P6SA 4RB3C 3COAC 4RM2A 1IF1A 3E97A 2R7ZJ 3H9JA 2G9WA 3H36A 1N25A 1YI2I 3VYUB 1JJ6C 2Q1ZB 2NOJB 5DCMB 4DGWB 1O7FA 1BM9A 2IS1A 1OCCH 3K4CA 1K61A 4EJWA 4ZYGA 4ZC3A 2KDZA 4BJ6C 3IWFA 3V7CA 1V5FA 3E3VA 3WGGA 3W3CA 1ODDA 3RYPA 5J4YA 2R0QC 5L3GA 3U2RA 4OAZA 3A4CA 1W36D 3OYLA 4I02A 1IV8A 3HOWJ 2R7UA 1Y0NA 2JA5J 4O6JA 4MO7A 1NHAA 2EQRA 4F7ZA 2WV0A 1WKMA 2Y9ZA 5FD5A 5JVTA 2GBYA 5H6RA 4BQAA 2OCCH 1YO5C 4IL6C 4BEHA 2VQGA 2H94A 3TEDA 2GXAA 5HLGA 4IPAA 1WGXA 4U0WA 3C18A 3LA2A 1RZ4A 5HS9A 3DBRB 4ZZDA 2XVCA 1REPC 1VQ5I 3ZPLA 4YG2F 2GA1A 4KICA 2B9SA 3ISPA 3K4LA 3J7ZI 1K83J 4XMYA 2HI3A 1HBXG 4CCNA 2NVXJ 3VPRA 2Y2ZA 4AYBA 1M1EB 1FBQA 2HU9A 1GXPA 4XN0A 2YSRA 1RC9A 1SVMA 4Y13A 3W2WA 2CW8A 2DFHA 4L18B 3IP4B 5C4XJ 4ENJA 1FJLA 4EJVA 1VI0A 1LFBA 2JA6J 2M34A 1V54H 3B02A 2VKHA 2Y69H 3BTLA 3D5RC 3LQRA 3S17J 4FT8A 1VF9A 1BIBA 2RAEA 5LRSA 4RBOA 1U9OA 1FEXA 3BLYA 3L2RA 4LIUA 2E7WA 2V9PA 2WY7Q 4Q48A 3FK7A 4PJJA 1F36A 1FBUA 2DU9A 3DPTA 4ON0A 1BJZA 2DMTA 2YS9A 5BPDA 3CF2A 3ERED 2R5ZA 2HS5A 4ZH4F 3HTSB 3DPUA 2NNNA 2HPIA 1IDYA 2K85A 4U0YA 4A3KJ 5FLVA 4JYKA 3OS2A 1W5CC 2XPUA 4U0VA 4WF2A 3HOVJ 3K4BA 4AVPA 4A3MJ 2ZJRF 2TRTA 2CV2A 4QPQA 3U21A 4A2UA 2JT1A 5CKTA 1MBHA 4CGZA 4M72A 3EETA 3CCSI 4AUXA 5E3LA 5HDNA 4F3QA 1T08B 3DF8A 3REOA 3FX3A 3OMYA 1RKWA 3L1PA 1UZCA 4KIBA 1D5VA 3HBLA 5EEGA 2CQKA 2DTRA 2Y9YA 1H89C 1T0FC 1H9TA 2LFBA 2KRHA 3TGNA 3PL8A 1UB9A 5EZGA 1MJBA 3GTPJ 1JUPA 1N78A 1WCMJ 4M3FA 3PIOF 1X3WB 2MBFA 4BBRJ 5GTIC 1N77A 3BR2A 3JR9A 3HM5A 2KIUA 4DBQA 1MJAA 3ELKA 1P4WA 4KYWA 4BACA 4RGXA 2VT2A 2XSDC 3LMMA 4W1UA 1ETKA
chains in the Genus database with same CATH topology
5HOOA 1KU9A 4I7HA 2W24A 3G3ZA 4IRIA 3CUQB 2CGPA 3DV8A 2J5OA 3HRUA 5DDGA 2MLKA 3QU6A 4IRGA 1FWZA 5DEQA 2TDXA 4KA4A 3RJPA 2XV4S 2BYVE 3NRVA 3L2CA 1ZARA 5BOXA 4JK1X 1RNLA 3DPLC 3GFLA 4M74A 3GYHX 3ECHA 1G6NA 1LDKB 2HWVA 1FOKA 1TLHB 4Q47A 4HYEA 5E8GA 4HBLA 3IRQA 2ZXJA 4BXUA 2QBYB 3I64A 3M1EA 2EA4A 4BHCA 3I59B 1MGTA 2J5PA 3R0JA 4A5MA 1FPQA 3GXOA 1BI2A 4XLNF 4EM0B 3ZMUA 4LLGF 4AIHA 2DK8A 1KU7A 5LHHA 1Z7UA 3GFJA 2VBXA 4ENKA 2BBYA 3BPXA 2D2WA 3QRFF 2Z99A 1ZLKA 2LDUA 4OMZA 4KN4X 1P4XA 2F5EA 2V79A 4KMFA 1DPUA 1IUYA 4LFUA 3GX4X 1K7AA 2KKOA 2O03A 4KT5C 2Z9OA 2QWWA 4UV8A 1HW5A 4WXCA 2FQ3A 3MEXA 3R61A 4UVBA 5JI6A 5D6EA 3K0LA 3HSRA 1O57A 1B9MA 2LF8A 2EB7A 2HKXA 1ZGJA 1RI7A 1LNWA 4RB0A 2FEZA 4EJTA 1K78B 3WTXC 1KYZA 1TBXA 2D1VA 5A2QZ 4WX9A 3CTAA 3DFGA 2MD5A 5HDKA 1Z1DA 2Q0OA 2VBWA 3QOPA 2FU4A 5J8CA 2W57A 2V1UA 2XKPA 5FLXZ 3LAJA 5J8FA 3JSPA 2XAQA 3N97A 1Q1HA 2PQ8A 4MEYF 3KE2A 1BJAA 2EWNA 4EJOA 4RGUA 5D5UB 1K6OA 4LG0B 3LAPA 3LA7A 2VC1A 1H0MA 3MZHA 5CVUA 1OYYA 4L0ZB 3Q9SA 3GZ5A 3ZMSA 4CZZA 4Z2YA 5E18F 3J7AO 1UCRA 5JHUA 4MEXF 3J81Z 3ZMVA 4G9YA 3ZN1A 3TO7A 2PJPA 5D8KB 3HSEA 3KLNA 4YFXF 4KFCA 2IRFG 1RIOH 1RUNA 4XRFA 2COMA 5CJ9A 1MZBA 1L3LA 3F21A 4ENNA 4AD9A 2JSCA 1LQ1A 3JAMZ 1STZA 4KUMA 4P9FA 2X4HA 4M71A 3WGIA 1WSUA 2ZJ2A 1LDDA 4G7ZF 5HS8A 2XHKA 2QQ9A 2ISYA 1YFHA 3J80Z 4IJAA 5D6FA 4RS8A 2P8TA 5DYMA 1JE8A 2HOEA 2MC3A 4OIOF 1TQMA 5F1RA 4P5OA 3HRTA 5ICEA 3P9IA 2L54A 3SFZA 1XGOA 4HZFA 2UZKA 1CF7A 3ZMTA 4WK8F 4I0AA 2QENA 3ZN0A 3WGHA 4HDUA 1IW7F 4B8XA 3S2WA 1IZ1A 2RGVA 4UV9A 1ZG5A 3FMSA 1F1ZA 3W6JB 1HSTA 1V4RA 4EMSA 2DPUA 3R6SA 3C7JA 5K5RA 4L5IA 2LNBA 1FNNA 2XUBA 2VOOA 4HAMA 1T2KA 2XASA 4U88A 3RPQA 5E1ZB 3H3ZA 4ZYEA 1BOAA 1JGSA 4QWQA 2E7XA 5ILUA 5LGNA 2O3FA 3RDIA 4G7HF 5D8LB 1U8RA 3WTWC 5IT9K 2YR2A 4M73A 4HF1A 5TJJA 4LB6B 3KP7A 2P5LC 1F9NA 2QYOA 3VEPA 2UXXA 2ZBKA 4KIFA 5EEHA 4EGZA 2O6GE 3FM5A 1OYWA 3C3WA 2P4WA 2BEOA 1WQ2A 3RKXA 5HS7A 1FSEA 3KETA 2F5CA 4M9SA 3FWEA 3H92A 5ICCA 1W7PD 1EH6A 4LGWA 1WWXA 1XB4A 1ZAOA 3KP6A 1U5TA 2FF4A 1IRGA 1R22A 2XROA 3TOAA 1W7PA 1B1BA 5D5VB 1SD7A 2PN6A 3KP5A 2EJRA 2A61A 4PDKA 1R1UA 1AOYA 3E6MA 1G3TA 3FM3A 3RKYA 3CJNA 3GF2A 1YS6A 1HXDA 3TQNA 4XSZF 2Q2EA 3RIRA 3F8MA 1MJ9A 1RUOA 5ICFA 3I71A 4EVIA 2QUFA 3BP8A 1TQIA 3HHHA 5CYVA 2HYGD 4MGRA 3QPTA 2STTA 1TTYA 4OMYA 4CXFA 4WCGA 4FHTA 1I5ZA 2DAOA 2FBHA 2XKOA 1IXRC 5HLIA 1XSXA 2W85A 4MHGA 2W25A 2MH2A 5FFXA 5CVVA 3E6CC 3DXJF 4P9UA 4NB5A 3PFIA 2DO7A 5ICGA 4EV0A 5L3FA 2OAZA 1FYLA 3FHZA 2HQRA 1JXSA 2MA3A 4OIQF 5FGMA 2CWEA 2JTVA 5KVRA 3U9GA 1UFMA 4IHSA 1KGSA 2IT0A 1BIAA 1GHCA 2A07F 4A6DA 4FX0A 1O3RA 2WWYA 3F72A 4RGSA 3RYRA 2O61A 1JHHA 4PGGA 1S8NA 1ZG1A 1FYKA 1P92A 4UUVA 3EDPA 3FXQA 3KFWX 1UHWA 3GLXA 3U1DA 3BROA 2NRAC 2EFWA 3F8FA 1EH8A 2OZ6A 2GQQA 1USTA 5K1YA 2DFIA 4HA8A 1XD7A 3M8FA 2JRTA 1DP7P 1KU2A 3WU1B 5D4RA 3JTHA 3IWZA 3BPVA 3WODF 5HLHA 1PP7U 3CUQC 3GFMA 4IXAA 1ZHFA 5LEJA 4LB5A 3CO7C 2A3SA 2Y75A 1O3SA 3QPHA 1FSHA 3WTYC 5LBQA 4LLNA 2VODA 5F64A 2VN2A 3GVAA 3VFZA 3LA3A 4HQEA 1GXQA 2QM3A 1J7KA 1IXCA 2WTEA 3IKVA 2XGXA 1ULYA 4ETSA 2RVCA 3KCCA 3SZTA 2JPBA 1H9GA 2K86A 2JZYA 1ZREA 2V6CA 2KIFA 5IT3A 2CO5A 3GEZA 3BZ6A 5AIPA 2FBIA 3IRRA 3N4MA 4K2EA 1QPMA 3VODA 3ECOA 1Z6TA 2K7LA 2Z3YA 2ZMEA 4ENMA 1OYIA 3EYIA 1J75A 1CGPA 2ETHA 4HOBA 2KJCA 1O3QA 2DBBA 1Y0UA 4U7BA 2DQRA 5E20A 4Q5SF 2RV8A 2HZTA 1B4AA 1B59A 3F23A 3L9FA 2FMYA 5J6XA 2IA0A 4BNCA 1S6LA 1LB2A 1Z91A 1PUEE 2FA5A 1FP2A 2D1HA 1W5TA 3ZQ7A 4RAZA 1IAWA 3V7RA 3SHFA 2DI3A 2C6YA 1SD4A 2MH9A 3R60A 3V7SA 2VE8A 2GXGA 2QVOA 2DK5A 2DLLA 2DPDA 3KEQA 3RTRA 1TNTA 4DQ2A 4RGRA 4QLCU 4PCQA 2L4AA 2G7HA 2IJLA 2FSWA 2V9VA 3I4PA 4DNCA 1C0WA 1FT9A 2R3SA 5H20A 1CF7B 4O5VA 1YTYA 1IN7A 3T8TA 1TQPA 1DDNA 3MAJA 2CYYA 4M9XA 3TOBA 2VT3A 2HTSA 5DCFA 3BY6A 2PI0A 4AIJA 2K27A 4FX4A 3T1BA 1ZYRF 2P6TA 5DUKA 3RKWA 4HQMA 2M45A 2IA1A 3PQKA 2O8XA 5D5WB 5LEKA 2V1DA 2Z5UA 4ZZLA 4HF2A 1IN6A 1D3YA 1IXSB 1LEBA 2AS5F 3I0TA 4IRHA 3KZZA 3GW2A 3BJOA 2YPRA 4JBAA 2HQNA 4YIIA 2DW4A 3HSFA 2F5FA 4N0BA 1QO0D 1W4MA 1HW1A 2P5KA 2RKHA 4YFKF 1F5TA 2EA2A 4M6XA 2A68F 2K02A 1TW3A 4L9VA 1MDMB 3EUHA 5CVJA 1S3JA 1KQ8A 4KMUX 5K5OA 4XLPF 3IL2A 1ZRCA 2MLGA 3BOQA 1I1SA 2EFOA 1U5TC 1XGNA 3M9AA 4HF0A 3HUGA 3WTZA 5TRDA 1BBYA 1ZLJA 2ADUA 1SMTA 2LF7A 4A0XA 2HEOA 1U5TB 3DP7A 4D0PA 1W7PB 2RN7A 3EQLF 3RI4A 1MD0A 3WE3A 3BJ6A 2RDPA 3CDHA 1IN8A 1Z6RA 1SFUA 2L01A 1TNSA 1SD5A 4CICA 4R79A 1QBJA 1A04A 2OQRA 2RC4A 4A5NA 3NEUA 3ZMDA 2VE9A 4PZJA 2FNAA 2NYXA 1BI3A 3ROUA 1EH7A 2O0YA 1T6SA 3VOEA 1ZG3A 2GA2A 4AWXB 2F5DA 3CLOA 5ILSA 2A6HF 1MKMA 3V4GA 3MZYA 4S05A 2M1BA 5E8IA 4NQWA 1LJ9A 3TO9A 2ESHA 2V1XA 3HIFA 4LJZF 3FZVA 3VB2A 2HYFA 2KRFA 1U3EM 3ULQB 3E6BA 1W5SA 3CUOA 3DEUA 2Y48A 1VTNC 3WTSC 2BE5F 2GAUA 4UVCA 5L3EA 4CYDA 1WI9A 1XSVA 1SFEA 2XAHA 4L9NA 1MDMA 2CSOA 4MTDA 2OBPA 3MFKA 3IHUA 4BYYA 1HQCA 5L3CA 2D45A 5LHIA 4RB1A 3QP5A 1UHMA 4GO1A 1S29A 1FC3A 3T8RA 1OKRA 1G4DA 1BI0A 4OIRF 2FBKA 6PAXA 2A5YB 1V3FA 4KDPA 2YU3A 4G6DA 5FD6A 3M7GA 5BQTA 4HLYA 3Q9VA 1S7OA 2ZCWA 4RB2C 2H09A 4KNYA 4LMYA 1HW2A 1PDNC 1K79A 1XMKA 3FF5A 4WXDA 3SXYA 2EV6A 5CLSA 1OMIA 2M8EA 2HTJA 4S04A 1LVAA 3K1NA 1J5YA 2P5VA 1Z05A 3WG9A 3L09A 2M30A 4ZYHA 1QZZA 1HKQA 3B73A 2VC0A 5AONA 3QP6A 2PMHA 3K1PA 1G3WA 4HV5A 1HKSA 2VBYA 4EM2A 3D0SA 5LLQA 2E1CA 3WTTC 1L0OC 1KA8A 4UXNA 5K5QA 4P96A 1AWCA 2XAJA 2B0LA 4I01A 3BDDA 3C1DA 2PLYA 4IF4A 5A2QK 4PGHA 3F6OA 3EYYA 3OOPA 4YIFA 3I54A 5FO5A 1DPRA 4O3MA 3TDZC 4LD5A 4I2OA 5FLXK 1ZH5A 3E5XA 2CW0F 2DQLA 2PFBA 5DD4A 2EV0A 4G6QA 3ZP5A 2EFPA 3HYIA 3ABUA 4XSXF 3V8KA 4L5JA 2VONA 1ON1A 1U6GA 1XGMA 1G3YA 4HDVA 2ZMEB 1J9IA 1FP1D 2P7VB 4GGGA 2OU2A 3E6DA 2YX7A 3F22A 5FB2A 4MTEA 3T0YA 4M6YA 2ZNZA 1R1TA 2IW5A 2OA4A 2Z33A 3IC7A 2ISZA 3J81K 1SFXA 3KP4A 3W6KB 4LK0F 1ZRDA 5BPIA 2CG4A 3K1MA 1T98A 3Q5FA 1ZRFA 1ZN2A 3O6BB 1XCBA 3LFKA 4GYIA 2FMLA 2NAZA 1E17A 1FBSA 4MQVA 5ERIA 1E2XA 5E1WA 3TDUC 1BI1A 2UXNA 5BS6A 4HX4A 3MQ0A 3RPUA 3F6VA 3JAMK 3DKWA 1Z9CA 1R7JA 1J59A 3L00A 3P7NA 1YIOA 1YW9A 3GO5A 4KIGA 2X0LA 2K4BA 5LGTA 1R58A 2ELHA 4HX8A 2EFQA 3GUDA 1G3SA 1F4KA 3J80K 1YW7A 5DCMA 4WXHA 2XIGA 4G7OF 3KP3A 3KLOA 2GIVA 2UWMA 5E1XA 4P55A 3BWGA 5CVIA 2L3DA 2ZNYA 3BJAA 1B9NA 5IT9Z 4YFNF 4R8HA 2K4JA 4HW0A 3E5QA 2VXZA 2KJBA 1YQAA 2L02A 4IHTA 4OINF 2H6BA 4Y15A 1P4AA 3FMRA 4HLXA 2OZUA 2YX4A 5D5XB 1XDUA 3HRMA 2FE3A 3F3XA 4BHBA 1USSA 2LSOA 4N9IA 2L4MA 2ZFWA 3JTGA 1TW2A 1ON2A 1I1GA 1R36A 4EQQA 1O7LA 5F6FA 2NS0A 1R23A 5E17F 3CO6C 3O3KA 2JPCA 1QZYA 4ESFA 3F8CA 3KZYA 2BV6A 4UHTA 3HOSA 4U7DA 2H6CA 4WWCA 2HKOA 2GXBA 4I09A 4ZYDA 5JFRA 2HGCA 3P9CA 2XAFA 4GCVA 2RQPA 1XSDA 2VOPA 4CDGA 3I53A 1KYWA 2R7DA 2XRNA 1YS7A 3FXRA 2M87A 3GFIA 1XDSA 1YG2A 2HFHA 4CHUA 3SZPA 2OD5A 1T0FA 2F2EA 4NHJA 1XGSA 4BAYA 3MCZA 1ONVA 2EFNA 2P7CB 3F8NA 4I0BA 3CUQA 2OQGA 4MQ9F 2A6EF 3M8EA 4LLLA 4KN7X 1KQ9A 4ESJA 1XCVA 1PP8F 4L0YB 2BGCA 3E5UA 3HTUA 2R7FA 4A0ZA 1GVJA 2IA2A 4OU0A 4M9ZA 1ZGAA 2IP2A 3R4KA 1KU3A 1EV7A 2ESNA 1I6XA 1JHFA 2QBYA 1BC7C 2FRHA 3I59A 3JSOA 4CO8A 2ACJA 4G8XA 1YW8A 3HRSA 1D8JA 3HHGA 3I58A 2Q8KA 1B6AA 3R0AA 2EK5A 3IKTA 1BN5A 2DT5A 3AAFA 4MNUA 5LRRA 1QQIA 4OIPF 2AXLA 4N9HA 1FX7A 2FOKA 3K9TA 3O2PE 1P2FA 1WRJA 3K69A 5AIQA 2W84A 2ZKZA 4Q4ZF 4HX7A 2CFXA 4GXOA 5BMZA 1T38A 3NQOA 2RNJA 5KK1A 2XAGA 1T39A 4UVAA 3K2ZA 1HKTA 1OPCA 5H6QA 2IPQX 5DD8A 2HDCA 4UNOA 4TV7A 4ASNA 3TO6A 1XN7A 3SQNA 1R5GA 1S7AA 1U2WA 1I27A 1K78A 1DUXC 3WE2A 3ABTA 4BHPA 2EV5A 3QU3A 3WU0A 3KP2A 4A12A 3PQJA 4LK1F 1BC8C 5ED4A 5HDGA 5HVQC 4G94A 4IVNA 3OV8A 2IVMA 2E1NA 4LG0A 1U78A 2Y0MA 5FFZA 3LQQA 2LKPA 4A0YA 2H27A 2QQBA 4BH9A 2KIMA 2HR3A 3H3UA 3ML6A 2NNYA 3F8BA 5DV5A 4H0EA 1YYVA 3QAHA 3FXUA 4AIKA 3WTVC 1SD6A 4HV6A 3D5LA 3T5XA 4ESBA 1FY7A 2FXAA 5CVRA 5ILVA 3JW4A 3MWMA 2GWRA 4B09A 1R5HA 1O3TA 4EM1A 1IN5A 5DUIA 4GYGA 3FMQA 4L9JA 5LHGA 4EJUA 2VBZA 1D8KA 4OOIA 2QZ8A 4JQFA 5L3DA 1OR7A 1FZPB 2PG4A 3I5UA 3WTUC 2QQAA 3ZMZA 2STWA 1SAXA 2M5WA 2PEXA 3V8LA 1J2XA 3KEOA 3L7WA 5L3BA 5LGUA 1R1VA 3LWFA 4XBFA 2GZWA 2QLZA 3P9KA 1IN4A 3TKYA 4R1HA 1IRFA 2PBIA 4L9TA 1QNTA 2FNPA 2G7UA 4Y17A 1YLFA 2PMUA 1QGPA 2ZO4A 1SMYF 3HOTA 1R00A 1LDJA 1FLIA 2A69F 2WC2A 5JR3A 3LSTA 1J0RA 1XMAA 4RAYA 1FYMA 3DQVC 1P6RA 5D4SA 3GZ6A 4EGYA 3GWZA 4E70A 1LEAA 1KQ0A 4A6EA 4I98B 3G73A 3V8JA 3COAC 1HSJA 1X3UA 2P6SA 4RB3C 1IF1A 3E97A 2G9WA 5DCMB 1O7FA 1BM9A 4EJWA 4ZYGA 3IWFA 3V7CA 3E3VA 3WGGA 1ODDA 3RYPA 5L3GA 3U2RA 4I02A 4O6JA 1NHAA 4F7ZA 2WV0A 1WKMA 5FD5A 5JVTA 5H6RA 4BQAA 1YO5C 2H94A 5HLGA 4IPAA 4U0WA 3C18A 3LA2A 1RZ4A 5HS9A 4ZZDA 2XVCA 1REPC 3ZPLA 4YG2F 2GA1A 4KICA 3ISPA 1HBXG 1FBQA 1GXPA 2YSRA 4Y13A 4L18B 4ENJA 4EJVA 3LQRA 3B02A 4FT8A 5LRSA 1BIBA 2E7WA 4Q48A 4ON0A 1FBUA 2DU9A 3DPTA 5BPDA 3ERED 2HS5A 4ZH4F 3HTSB 2NNNA 4U0YA 4U0VA 4WF2A 4AVPA 4A2UA 2JT1A 4CGZA 4M72A 3EETA 5HDNA 3DF8A 3REOA 3FX3A 1D5VA 4KIBA 5EEGA 2CQKA 2DTRA 1H9TA 3TGNA 1UB9A 1MJBA 2MBFA 2KIUA 1MJAA 3ELKA 1P4WA 4KYWA 4RGXA 2VT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOO A;  1KU9 A;  4I7H A;  2W24 A;  3G3Z A;  4IRI A;  3CUQ B;  2CGP A;  3DV8 A;  2J5O A;  3HRU A;  5DDG A;  2MLK A;  3QU6 A;  4IRG A;  1FWZ A;  5DEQ A;  2TDX A;  4KA4 A;  3RJP A;  2XV4 S;  2BYV E;  3NRV A;  3L2C A;  1ZAR A;  5BOX A;  4JK1 X;  1RNL A;  3DPL C;  3GFL A;  4M74 A;  3GYH X;  3ECH A;  1G6N A;  1LDK B;  2HWV A;  1FOK A;  1TLH B;  4Q47 A;  4HYE A;  5E8G A;  4HBL A;  3IRQ A;  2ZXJ A;  4BXU A;  2QBY B;  3I64 A;  3M1E A;  2EA4 A;  4BHC A;  3I59 B;  1MGT A;  2J5P A;  3R0J A;  4A5M A;  1FPQ A;  3GXO A;  1BI2 A;  4XLN F;  4EM0 B;  3ZMU A;  4LLG F;  4AIH A;  2DK8 A;  1KU7 A;  5LHH A;  1Z7U A;  3GFJ A;  2VBX A;  4ENK A;  2BBY A;  3BPX A;  2D2W A;  3QRF F;  2Z99 A;  1ZLK A;  2LDU A;  4OMZ A;  4KN4 X;  1P4X A;  2F5E A;  2V79 A;  4KMF A;  1DPU A;  1IUY A;  4LFU A;  3GX4 X;  1K7A A;  2KKO A;  2O03 A;  4KT5 C;  2Z9O A;  2QWW A;  4UV8 A;  1HW5 A;  4WXC A;  2FQ3 A;  3MEX A;  3R61 A;  4UVB A;  5JI6 A;  5D6E A;  3K0L A;  3HSR A;  1O57 A;  1B9M A;  2LF8 A;  2EB7 A;  2HKX A;  1ZGJ A;  1RI7 A;  1LNW A;  4RB0 A;  2FEZ A;  4EJT A;  1K78 B;  3WTX C;  1KYZ A;  1TBX A;  2D1V A;  5A2Q Z;  4WX9 A;  3CTA A;  3DFG A;  2MD5 A;  5HDK A;  1Z1D A;  2Q0O A;  2VBW A;  3QOP A;  2FU4 A;  5J8C A;  2W57 A;  2V1U A;  2XKP A;  5FLX Z;  3LAJ A;  5J8F A;  3JSP A;  2XAQ A;  3N97 A;  1Q1H A;  2PQ8 A;  4MEY F;  3KE2 A;  1BJA A;  2EWN A;  4EJO A;  4RGU A;  5D5U B;  1K6O A;  4LG0 B;  3LAP A;  3LA7 A;  2VC1 A;  1H0M A;  3MZH A;  5CVU A;  1OYY A;  4L0Z B;  3Q9S A;  3GZ5 A;  3ZMS A;  4CZZ A;  4Z2Y A;  5E18 F;  3J7A O;  1UCR A;  5JHU A;  4MEX F;  3J81 Z;  3ZMV A;  4G9Y A;  3ZN1 A;  3TO7 A;  2PJP A;  5D8K B;  3HSE A;  3KLN A;  4YFX F;  4KFC A;  2IRF G;  1RIO H;  1RUN A;  4XRF A;  2COM A;  5CJ9 A;  1MZB A;  1L3L A;  3F21 A;  4ENN A;  4AD9 A;  2JSC A;  1LQ1 A;  3JAM Z;  1STZ A;  4KUM A;  4P9F A;  2X4H A;  4M71 A;  3WGI A;  1WSU A;  2ZJ2 A;  1LDD A;  4G7Z F;  5HS8 A;  2XHK A;  2QQ9 A;  2ISY A;  1YFH A;  3J80 Z;  4IJA A;  5D6F A;  4RS8 A;  2P8T A;  5DYM A;  1JE8 A;  2HOE A;  2MC3 A;  4OIO F;  1TQM A;  5F1R A;  4P5O A;  3HRT A;  5ICE A;  3P9I A;  2L54 A;  3SFZ A;  1XGO A;  4HZF A;  2UZK A;  1CF7 A;  3ZMT A;  4WK8 F;  4I0A A;  2QEN A;  3ZN0 A;  3WGH A;  4HDU A;  1IW7 F;  4B8X A;  3S2W A;  1IZ1 A;  2RGV A;  4UV9 A;  1ZG5 A;  3FMS A;  1F1Z A;  3W6J B;  1HST A;  1V4R A;  4EMS A;  2DPU A;  3R6S A;  3C7J A;  5K5R A;  4L5I A;  2LNB A;  1FNN A;  2XUB A;  2VOO A;  4HAM A;  1T2K A;  2XAS A;  4U88 A;  3RPQ A;  5E1Z B;  3H3Z A;  4ZYE A;  1BOA A;  1JGS A;  4QWQ A;  2E7X A;  5ILU A;  5LGN A;  2O3F A;  3RDI A;  4G7H F;  5D8L B;  1U8R A;  3WTW C;  5IT9 K;  2YR2 A;  4M73 A;  4HF1 A;  5TJJ A;  4LB6 B;  3KP7 A;  2P5L C;  1F9N A;  2QYO A;  3VEP A;  2UXX A;  2ZBK A;  4KIF A;  5EEH A;  4EGZ A;  2O6G E;  3FM5 A;  1OYW A;  3C3W A;  2P4W A;  2BEO A;  1WQ2 A;  3RKX A;  5HS7 A;  1FSE A;  3KET A;  2F5C A;  4M9S A;  3FWE A;  3H92 A;  5ICC A;  1W7P D;  1EH6 A;  4LGW A;  1WWX A;  1XB4 A;  1ZAO A;  3KP6 A;  1U5T A;  2FF4 A;  1IRG A;  1R22 A;  2XRO A;  3TOA A;  1W7P A;  1B1B A;  5D5V B;  1SD7 A;  2PN6 A;  3KP5 A;  2EJR A;  2A61 A;  4PDK A;  1R1U A;  1AOY A;  3E6M A;  1G3T A;  3FM3 A;  3RKY A;  3CJN A;  3GF2 A;  1YS6 A;  1HXD A;  3TQN A;  4XSZ F;  2Q2E A;  3RIR A;  3F8M A;  1MJ9 A;  1RUO A;  5ICF A;  3I71 A;  4EVI A;  2QUF A;  3BP8 A;  1TQI A;  3HHH A;  5CYV A;  2HYG D;  4MGR A;  3QPT A;  2STT A;  1TTY A;  4OMY A;  4CXF A;  4WCG A;  4FHT A;  1I5Z A;  2DAO A;  2FBH A;  2XKO A;  1IXR C;  5HLI A;  1XSX A;  2W85 A;  4MHG A;  2W25 A;  2MH2 A;  5FFX A;  5CVV A;  3E6C C;  3DXJ F;  4P9U A;  4NB5 A;  3PFI A;  2DO7 A;  5ICG A;  4EV0 A;  5L3F A;  2OAZ A;  1FYL A;  3FHZ A;  2HQR A;  1JXS A;  2MA3 A;  4OIQ F;  5FGM A;  2CWE A;  2JTV A;  5KVR A;  3U9G A;  1UFM A;  4IHS A;  1KGS A;  2IT0 A;  1BIA A;  1GHC A;  2A07 F;  4A6D A;  4FX0 A;  1O3R A;  2WWY A;  3F72 A;  4RGS A;  3RYR A;  2O61 A;  1JHH A;  4PGG A;  1S8N A;  1ZG1 A;  1FYK A;  1P92 A;  4UUV A;  3EDP A;  3FXQ A;  3KFW X;  1UHW A;  3GLX A;  3U1D A;  3BRO A;  2NRA C;  2EFW A;  3F8F A;  1EH8 A;  2OZ6 A;  2GQQ A;  1UST A;  5K1Y A;  2DFI A;  4HA8 A;  1XD7 A;  3M8F A;  2JRT A;  1DP7 P;  1KU2 A;  3WU1 B;  5D4R A;  3JTH A;  3IWZ A;  3BPV A;  3WOD F;  5HLH A;  1PP7 U;  3CUQ C;  3GFM A;  4IXA A;  1ZHF A;  5LEJ A;  4LB5 A;  3CO7 C;  2A3S A;  2Y75 A;  1O3S A;  3QPH A;  1FSH A;  3WTY C;  5LBQ A;  4LLN A;  2VOD A;  5F64 A;  2VN2 A;  3GVA A;  3VFZ A;  3LA3 A;  4HQE A;  1GXQ A;  2QM3 A;  1J7K A;  1IXC A;  2WTE A;  3IKV A;  2XGX A;  1ULY A;  4ETS A;  2RVC A;  3KCC A;  3SZT A;  2JPB A;  1H9G A;  2K86 A;  2JZY A;  1ZRE A;  2V6C A;  2KIF A;  5IT3 A;  2CO5 A;  3GEZ A;  3BZ6 A;  5AIP A;  2FBI A;  3IRR A;  3N4M A;  4K2E A;  1QPM A;  3VOD A;  3ECO A;  1Z6T A;  2K7L A;  2Z3Y A;  2ZME A;  4ENM A;  1OYI A;  3EYI A;  1J75 A;  1CGP A;  2ETH A;  4HOB A;  2KJC A;  1O3Q A;  2DBB A;  1Y0U A;  4U7B A;  2DQR A;  5E20 A;  4Q5S F;  2RV8 A;  2HZT A;  1B4A A;  1B59 A;  3F23 A;  3L9F A;  2FMY A;  5J6X A;  2IA0 A;  4BNC A;  1S6L A;  1LB2 A;  1Z91 A;  1PUE E;  2FA5 A;  1FP2 A;  2D1H A;  1W5T A;  3ZQ7 A;  4RAZ A;  1IAW A;  3V7R A;  3SHF A;  2DI3 A;  2C6Y A;  1SD4 A;  2MH9 A;  3R60 A;  3V7S A;  2VE8 A;  2GXG A;  2QVO A;  2DK5 A;  2DLL A;  2DPD A;  3KEQ A;  3RTR A;  1TNT A;  4DQ2 A;  4RGR A;  4QLC U;  4PCQ A;  2L4A A;  2G7H A;  2IJL A;  2FSW A;  2V9V A;  3I4P A;  4DNC A;  1C0W A;  1FT9 A;  2R3S A;  5H20 A;  1CF7 B;  4O5V A;  1YTY A;  1IN7 A;  3T8T A;  1TQP A;  1DDN A;  3MAJ A;  2CYY A;  4M9X A;  3TOB A;  2VT3 A;  2HTS A;  5DCF A;  3BY6 A;  2PI0 A;  4AIJ A;  2K27 A;  4FX4 A;  3T1B A;  1ZYR F;  2P6T A;  5DUK A;  3RKW A;  4HQM A;  2M45 A;  2IA1 A;  3PQK A;  2O8X A;  5D5W B;  5LEK A;  2V1D A;  2Z5U A;  4ZZL A;  4HF2 A;  1IN6 A;  1D3Y A;  1IXS B;  1LEB A;  2AS5 F;  3I0T A;  4IRH A;  3KZZ A;  3GW2 A;  3BJO A;  2YPR A;  4JBA A;  2HQN A;  4YII A;  2DW4 A;  3HSF A;  2F5F A;  4N0B A;  1QO0 D;  1W4M A;  1HW1 A;  2P5K A;  2RKH A;  4YFK F;  1F5T A;  2EA2 A;  4M6X A;  2A68 F;  2K02 A;  1TW3 A;  4L9V A;  1MDM B;  3EUH A;  5CVJ A;  1S3J A;  1KQ8 A;  4KMU X;  5K5O A;  4XLP F;  3IL2 A;  1ZRC A;  2MLG A;  3BOQ A;  1I1S A;  2EFO A;  1U5T C;  1XGN A;  3M9A A;  4HF0 A;  3HUG A;  3WTZ A;  5TRD A;  1BBY A;  1ZLJ A;  2ADU A;  1SMT A;  2LF7 A;  4A0X A;  2HEO A;  1U5T B;  3DP7 A;  4D0P A;  1W7P B;  2RN7 A;  3EQL F;  3RI4 A;  1MD0 A;  3WE3 A;  3BJ6 A;  2RDP A;  3CDH A;  1IN8 A;  1Z6R A;  1SFU A;  2L01 A;  1TNS A;  1SD5 A;  4CIC A;  4R79 A;  1QBJ A;  1A04 A;  2OQR A;  2RC4 A;  4A5N A;  3NEU A;  3ZMD A;  2VE9 A;  4PZJ A;  2FNA A;  2NYX A;  1BI3 A;  3ROU A;  1EH7 A;  2O0Y A;  1T6S A;  3VOE A;  1ZG3 A;  2GA2 A;  4AWX B;  2F5D A;  3CLO A;  5ILS A;  2A6H F;  1MKM A;  3V4G A;  3MZY A;  4S05 A;  2M1B A;  5E8I A;  4NQW A;  1LJ9 A;  3TO9 A;  2ESH A;  2V1X A;  3HIF A;  4LJZ F;  3FZV A;  3VB2 A;  2HYF A;  2KRF A;  1U3E M;  3ULQ B;  3E6B A;  1W5S A;  3CUO A;  3DEU A;  2Y48 A;  1VTN C;  3WTS C;  2BE5 F;  2GAU A;  4UVC A;  5L3E A;  4CYD A;  1WI9 A;  1XSV A;  1SFE A;  2XAH A;  4L9N A;  1MDM A;  2CSO A;  4MTD A;  2OBP A;  3MFK A;  3IHU A;  4BYY A;  1HQC A;  5L3C A;  2D45 A;  5LHI A;  4RB1 A;  3QP5 A;  1UHM A;  4GO1 A;  1S29 A;  1FC3 A;  3T8R A;  1OKR A;  1G4D A;  1BI0 A;  4OIR F;  2FBK A;  6PAX A;  2A5Y B;  1V3F A;  4KDP A;  2YU3 A;  4G6D A;  5FD6 A;  3M7G A;  5BQT A;  4HLY A;  3Q9V A;  1S7O A;  2ZCW A;  4RB2 C;  2H09 A;  4KNY A;  4LMY A;  1HW2 A;  1PDN C;  1K79 A;  1XMK A;  3FF5 A;  4WXD A;  3SXY A;  2EV6 A;  5CLS A;  1OMI A;  2M8E A;  2HTJ A;  4S04 A;  1LVA A;  3K1N A;  1J5Y A;  2P5V A;  1Z05 A;  3WG9 A;  3L09 A;  2M30 A;  4ZYH A;  1QZZ A;  1HKQ A;  3B73 A;  2VC0 A;  5AON A;  3QP6 A;  2PMH A;  3K1P A;  1G3W A;  4HV5 A;  1HKS A;  2VBY A;  4EM2 A;  3D0S A;  5LLQ A;  2E1C A;  3WTT C;  1L0O C;  1KA8 A;  4UXN A;  5K5Q A;  4P96 A;  1AWC A;  2XAJ A;  2B0L A;  4I01 A;  3BDD A;  3C1D A;  2PLY A;  4IF4 A;  5A2Q K;  4PGH A;  3F6O A;  3EYY A;  3OOP A;  4YIF A;  3I54 A;  5FO5 A;  1DPR A;  4O3M A;  3TDZ C;  4LD5 A;  4I2O A;  5FLX K;  1ZH5 A;  3E5X A;  2CW0 F;  2DQL A;  2PFB A;  5DD4 A;  2EV0 A;  4G6Q A;  3ZP5 A;  2EFP A;  3HYI A;  3ABU A;  4XSX F;  3V8K A;  4L5J A;  2VON A;  1ON1 A;  1U6G A;  1XGM A;  1G3Y A;  4HDV A;  2ZME B;  1J9I A;  1FP1 D;  2P7V B;  4GGG A;  2OU2 A;  3E6D A;  2YX7 A;  3F22 A;  5FB2 A;  4MTE A;  3T0Y A;  4M6Y A;  2ZNZ A;  1R1T A;  2IW5 A;  2OA4 A;  2Z33 A;  3IC7 A;  2ISZ A;  3J81 K;  1SFX A;  3KP4 A;  3W6K B;  4LK0 F;  1ZRD A;  5BPI A;  2CG4 A;  3K1M A;  1T98 A;  3Q5F A;  1ZRF A;  1ZN2 A;  3O6B B;  1XCB A;  3LFK A;  4GYI A;  2FML A;  2NAZ A;  1E17 A;  1FBS A;  4MQV A;  5ERI A;  1E2X A;  5E1W A;  3TDU C;  1BI1 A;  2UXN A;  5BS6 A;  4HX4 A;  3MQ0 A;  3RPU A;  3F6V A;  3JAM K;  3DKW A;  1Z9C A;  1R7J A;  1J59 A;  3L00 A;  3P7N A;  1YIO A;  1YW9 A;  3GO5 A;  4KIG A;  2X0L A;  2K4B A;  5LGT A;  1R58 A;  2ELH A;  4HX8 A;  2EFQ A;  3GUD A;  1G3S A;  1F4K A;  3J80 K;  1YW7 A;  5DCM A;  4WXH A;  2XIG A;  4G7O F;  3KP3 A;  3KLO A;  2GIV A;  2UWM A;  5E1X A;  4P55 A;  3BWG A;  5CVI A;  2L3D A;  2ZNY A;  3BJA A;  1B9N A;  5IT9 Z;  4YFN F;  4R8H A;  2K4J A;  4HW0 A;  3E5Q A;  2VXZ A;  2KJB A;  1YQA A;  2L02 A;  4IHT A;  4OIN F;  2H6B A;  4Y15 A;  1P4A A;  3FMR A;  4HLX A;  2OZU A;  2YX4 A;  5D5X B;  1XDU A;  3HRM A;  2FE3 A;  3F3X A;  4BHB A;  1USS A;  2LSO A;  4N9I A;  2L4M A;  2ZFW A;  3JTG A;  1TW2 A;  1ON2 A;  1I1G A;  1R36 A;  4EQQ A;  1O7L A;  5F6F A;  2NS0 A;  1R23 A;  5E17 F;  3CO6 C;  3O3K A;  2JPC A;  1QZY A;  4ESF A;  3F8C A;  3KZY A;  2BV6 A;  4UHT A;  3HOS A;  4U7D A;  2H6C A;  4WWC A;  2HKO A;  2GXB A;  4I09 A;  4ZYD A;  5JFR A;  2HGC A;  3P9C A;  2XAF A;  4GCV A;  2RQP A;  1XSD A;  2VOP A;  4CDG A;  3I53 A;  1KYW A;  2R7D A;  2XRN A;  1YS7 A;  3FXR A;  2M87 A;  3GFI A;  1XDS A;  1YG2 A;  2HFH A;  4CHU A;  3SZP A;  2OD5 A;  1T0F A;  2F2E A;  4NHJ A;  1XGS A;  4BAY A;  3MCZ A;  1ONV A;  2EFN A;  2P7C B;  3F8N A;  4I0B A;  3CUQ A;  2OQG A;  4MQ9 F;  2A6E F;  3M8E A;  4LLL A;  4KN7 X;  1KQ9 A;  4ESJ A;  1XCV A;  1PP8 F;  4L0Y B;  2BGC A;  3E5U A;  3HTU A;  2R7F A;  4A0Z A;  1GVJ A;  2IA2 A;  4OU0 A;  4M9Z A;  1ZGA A;  2IP2 A;  3R4K A;  1KU3 A;  1EV7 A;  2ESN A;  1I6X A;  1JHF A;  2QBY A;  1BC7 C;  2FRH A;  3I59 A;  3JSO A;  4CO8 A;  2ACJ A;  4G8X A;  1YW8 A;  3HRS A;  1D8J A;  3HHG A;  3I58 A;  2Q8K A;  1B6A A;  3R0A A;  2EK5 A;  3IKT A;  1BN5 A;  2DT5 A;  3AAF A;  4MNU A;  5LRR A;  1QQI A;  4OIP F;  2AXL A;  4N9H A;  1FX7 A;  2FOK A;  3K9T A;  3O2P E;  1P2F A;  1WRJ A;  3K69 A;  5AIQ A;  2W84 A;  2ZKZ A;  4Q4Z F;  4HX7 A;  2CFX A;  4GXO A;  5BMZ A;  1T38 A;  3NQO A;  2RNJ A;  5KK1 A;  2XAG A;  1T39 A;  4UVA A;  3K2Z A;  1HKT A;  1OPC A;  5H6Q A;  2IPQ X;  5DD8 A;  2HDC A;  4UNO A;  4TV7 A;  4ASN A;  3TO6 A;  1XN7 A;  3SQN A;  1R5G A;  1S7A A;  1U2W A;  1I27 A;  1K78 A;  1DUX C;  3WE2 A;  3ABT A;  4BHP A;  2EV5 A;  3QU3 A;  3WU0 A;  3KP2 A;  4A12 A;  3PQJ A;  4LK1 F;  1BC8 C;  5ED4 A;  5HDG A;  5HVQ C;  4G94 A;  4IVN A;  3OV8 A;  2IVM A;  2E1N A;  4LG0 A;  1U78 A;  2Y0M A;  5FFZ A;  3LQQ A;  2LKP A;  4A0Y A;  2H27 A;  2QQB A;  4BH9 A;  2KIM A;  2HR3 A;  3H3U A;  3ML6 A;  2NNY A;  3F8B A;  5DV5 A;  4H0E A;  1YYV A;  3QAH A;  3FXU A;  4AIK A;  3WTV C;  1SD6 A;  4HV6 A;  3D5L A;  3T5X A;  4ESB A;  1FY7 A;  2FXA A;  5CVR A;  5ILV A;  3JW4 A;  3MWM A;  2GWR A;  4B09 A;  1R5H A;  1O3T A;  4EM1 A;  1IN5 A;  5DUI A;  4GYG A;  3FMQ A;  4L9J A;  5LHG A;  4EJU A;  2VBZ A;  1D8K A;  4OOI A;  2QZ8 A;  4JQF A;  5L3D A;  1OR7 A;  1FZP B;  2PG4 A;  3I5U A;  3WTU C;  2QQA A;  3ZMZ A;  2STW A;  1SAX A;  2M5W A;  2PEX A;  3V8L A;  1J2X A;  3KEO A;  3L7W A;  5L3B A;  5LGU A;  1R1V A;  3LWF A;  4XBF A;  2GZW A;  2QLZ A;  3P9K A;  1IN4 A;  3TKY A;  4R1H A;  1IRF A;  2PBI A;  4L9T A;  1QNT A;  2FNP A;  2G7U A;  4Y17 A;  1YLF A;  2PMU A;  1QGP A;  2ZO4 A;  1SMY F;  3HOT A;  1R00 A;  1LDJ A;  1FLI A;  2A69 F;  2WC2 A;  5JR3 A;  3LST A;  1J0R A;  1XMA A;  4RAY A;  1FYM A;  3DQV C;  1P6R A;  5D4S A;  3GZ6 A;  4EGY A;  3GWZ A;  4E70 A;  1LEA A;  1KQ0 A;  4A6E A;  4I98 B;  3G73 A;  3V8J A;  3COA C;  1HSJ A;  1X3U A;  2P6S A;  4RB3 C;  1IF1 A;  3E97 A;  2G9W A;  5DCM B;  1O7F A;  1BM9 A;  4EJW A;  4ZYG A;  3IWF A;  3V7C A;  3E3V A;  3WGG A;  1ODD A;  3RYP A;  5L3G A;  3U2R A;  4I02 A;  4O6J A;  1NHA A;  4F7Z A;  2WV0 A;  1WKM A;  5FD5 A;  5JVT A;  5H6R A;  4BQA A;  1YO5 C;  2H94 A;  5HLG A;  4IPA A;  4U0W A;  3C18 A;  3LA2 A;  1RZ4 A;  5HS9 A;  4ZZD A;  2XVC A;  1REP C;  3ZPL A;  4YG2 F;  2GA1 A;  4KIC A;  3ISP A;  1HBX G;  1FBQ A;  1GXP A;  2YSR A;  4Y13 A;  4L18 B;  4ENJ A;  4EJV A;  3LQR A;  3B02 A;  4FT8 A;  5LRS A;  1BIB A;  2E7W A;  4Q48 A;  4ON0 A;  1FBU A;  2DU9 A;  3DPT A;  5BPD A;  3ERE D;  2HS5 A;  4ZH4 F;  3HTS B;  2NNN A;  4U0Y A;  4U0V A;  4WF2 A;  4AVP A;  4A2U A;  2JT1 A;  4CGZ A;  4M72 A;  3EET A;  5HDN A;  3DF8 A;  3REO A;  3FX3 A;  1D5V A;  4KIB A;  5EEG A;  2CQK A;  2DTR A;  1H9T A;  3TGN A;  1UB9 A;  1MJB A;  2MBF A;  2KIU A;  1MJA A;  3ELK A;  1P4W A;  4KYW A;  4RGX A;  2VT2 A; 
#chains in the Genus database with same CATH topology
 5HOO A;  1KU9 A;  1VQM I;  4I7H A;  2GLO A;  2W24 A;  3G3Z A;  2QKL B;  2QF7 A;  4IRI A;  5GTH C;  3CUQ B;  1GT0 C;  2LVS A;  2CGP A;  3O8H A;  2B63 J;  3DV8 A;  2J5O A;  3HRU A;  5DDG A;  2MLK A;  3QU6 A;  4IRG A;  1FWZ A;  3FXO A;  5DEQ A;  2TDX A;  3RSN A;  4KA4 A;  3RJP A;  5HNH A;  4DYR A;  2XV4 S;  1JTY A;  2BYV E;  4Y3O A;  3NRV A;  5J1R A;  1HDD C;  4GFB A;  4BKX A;  1HA8 A;  1MW7 A;  2E5Z A;  3L2C A;  4X6A J;  3K4J A;  2XB0 X;  5K7F A;  1ZAR A;  2YUS A;  5BOX A;  4JK1 X;  1RNL A;  3DPL C;  3GFL A;  4XRS A;  2LY9 A;  4M74 A;  3GYH X;  3ECH A;  1G6N A;  2X6O A;  1LDK B;  2HWV A;  1FOK A;  1SVO A;  1NG6 A;  1TLH B;  3UNG C;  1X2N A;  4Q47 A;  2IS2 A;  2XPV A;  4HYE A;  5E8G A;  4HBL A;  3IRQ A;  2ZXJ A;  4BXU A;  2QBY B;  3I64 A;  3M1E A;  2EA4 A;  4BHC A;  3I59 B;  1MGT A;  2J5P A;  3VYS B;  3FXK A;  3DTI A;  3R0J A;  1GDT A;  2H8W A;  2MFZ A;  4A5M A;  3ZQL A;  2MGQ A;  3CLQ A;  4II3 A;  1FPQ A;  2A5W A;  3CDL A;  3GXO A;  5IP9 J;  2JK3 A;  3C2G A;  1BI2 A;  2JRM A;  2E2H J;  3DTK A;  4BDY A;  2HXI A;  4ZTJ A;  4XLN F;  3ZQG A;  5TIS C;  4EM0 B;  5EGO A;  1Z21 A;  3DEW A;  3FK6 A;  3ZMU A;  1MMN A;  3HGG A;  4LLG F;  1VZ0 A;  4AIH A;  2DK8 A;  3OYA A;  1KU7 A;  5LHH A;  5K7H A;  1Z7U A;  1QHH D;  3QOD A;  2DDB A;  1G2H A;  3BG5 A;  3GFJ A;  2VBX A;  4ENK A;  2QEX I;  4KIT B;  4E6K G;  2BBY A;  2LMD A;  3BPX A;  2CUJ A;  4XOP A;  2D2W A;  2VKV A;  3QRF F;  2Z99 A;  1YIT I;  2VKE A;  1ZLK A;  2EZK A;  4PJN A;  2LDU A;  1UJ8 A;  2HNH A;  4OMZ A;  2KHM A;  4KN4 X;  1NG7 A;  1P4X A;  4A3D J;  2ELK A;  2F5E A;  2V79 A;  4KMF A;  4CSW A;  2OJE D;  1DPU A;  1IUY A;  4LFU A;  3GX4 X;  3OIQ A;  1K7A A;  1S7E A;  2JA2 A;  2KKO A;  4V2F A;  2NVU B;  2O03 A;  3OIO A;  4KT5 C;  2Z9O A;  2W82 A;  3DTE A;  2QWW A;  4YEJ A;  5IP7 J;  4UV8 A;  1HW5 A;  4WXC A;  3OWT A;  2FQ3 A;  3MEX A;  3R61 A;  4UVB A;  1SAN A;  5JI6 A;  3J7Y J;  5D6E A;  3HOU J;  3S1N J;  3K0L A;  4E7J A;  3PJR A;  3HSR A;  3ABM H;  1O57 A;  1P9Q C;  1B9M A;  2LF8 A;  4XKW A;  3G6E I;  1S9H A;  1A5J A;  2EB7 A;  3HEF A;  2HKX A;  4L5E A;  1ZGJ A;  1RI7 A;  4DZJ A;  1LNW A;  1EA3 A;  2F4I A;  5EJC A;  1MIJ A;  4RB0 A;  2FEZ A;  5F0F A;  5J47 A;  2O9L A;  4EJT A;  1AHD P;  1K78 B;  2KPM A;  3WTX C;  1E3H A;  1KYZ A;  1TBX A;  2D1V A;  5A2Q Z;  4WX9 A;  1H88 C;  3U1K A;  3CTA A;  2KLO A;  1Y8Q B;  3DFG A;  3DLL F;  3W2A A;  4A3L J;  2MD5 A;  5LFA A;  5HDK A;  1Z1D A;  2Q0O A;  2VBW A;  3QOP A;  2FU4 A;  4FE7 A;  2W57 A;  5J8C A;  2V1U A;  2XKP A;  2ZXI A;  5F1J A;  2VXD A;  5H2F C;  5FLX Z;  3LAJ A;  1K4S A;  5J8F A;  3JSP A;  2XAQ A;  4D7N A;  3X2Q H;  3N97 A;  1Q1H A;  2F4O B;  2PQ8 A;  4MEY F;  5FKK A;  3KE2 A;  1BJA A;  2EWN A;  2KZV A;  4RGU A;  3DBH B;  4EJO A;  5D5U B;  2V1N A;  2BZT A;  4RMN A;  1K6O A;  4NC6 A;  4LG0 B;  3HL2 A;  3Q0W A;  4E7I A;  2EIJ H;  3LAP A;  4D9J A;  1E0E A;  3OYC A;  1MMA A;  2V9K A;  4KIS A;  2ME6 A;  5GPC A;  3H5R A;  4JOM A;  3LA7 A;  3JRC A;  2VC1 A;  3ZGK A;  4CUG A;  1H0M A;  1TWA J;  2E1M B;  3MZH A;  2M8G X;  3GTG J;  1X1B A;  5CVU A;  1OYY A;  2KIS A;  4L0Z B;  3Q9S A;  3GZ5 A;  3UR3 C;  3ZMS A;  1Z77 A;  2L0K A;  4Z2Y A;  4CZZ A;  3OYF A;  4DYQ A;  1PUF A;  5E18 F;  3J7A O;  1UCR A;  4ZJZ A;  3MD2 A;  5JHU A;  3OL4 A;  5JVG F;  4MEX F;  3J81 Z;  3RZO J;  2HZD A;  3ZMV A;  4G9Y A;  4XIC A;  1CQT A;  3ZN1 A;  3TO7 A;  1IUF A;  3W2V A;  3OSG A;  3SEZ A;  3F0C A;  1Z7L A;  1DU0 A;  2PJP A;  5D8K B;  3PNT A;  3Q0V A;  3HSE A;  1UAA A;  5HOD A;  2FUG 2;  3KLN A;  4HSR A;  1OR7 C;  2W1O A;  4YFX F;  4V2G A;  1GLN A;  1ZQ3 P;  4KFC A;  2X1D A;  2LY2 A;  2IRF G;  1RIO H;  3SYT A;  1RUN A;  2X6W A;  4BE1 A;  4XRF A;  2COM A;  3EUK L;  1ZR4 A;  5CJ9 A;  1MZB A;  1L3L A;  3F21 A;  4BL0 B;  2LTP A;  3H9G A;  4ZDP A;  1U9N A;  4ENN A;  4AD9 A;  3CCL I;  3S16 J;  1XC5 A;  2JSC A;  1YX3 A;  4X1E A;  1LQ1 A;  3JAM Z;  1STZ A;  2R7O A;  4KUM A;  3L2U A;  2HDD A;  4PSX A;  2Y31 A;  2H1L A;  2ECC A;  4P9F A;  4FET A;  3J7A Y;  5M5X J;  2X4H A;  1HOM A;  1X1P A;  4M71 A;  3WGI A;  4M6V A;  1WSU A;  2ZJ2 A;  3OYI A;  1LDD A;  4G7Z F;  4XLC A;  4M3D A;  5HS8 A;  2XHK A;  3IAS 2;  2QQ9 A;  2ISY A;  4DJA A;  1YFH A;  3CES A;  3J80 Z;  3A02 A;  2IGM A;  3K70 C;  4IJA A;  5D6F A;  3HGY A;  4RS8 A;  1EKE A;  2P8T A;  1MBE A;  5DYM A;  1BA5 A;  1JE8 A;  2HOE A;  2MC3 A;  4OIO F;  4DYC A;  1TQM A;  4A3G J;  2P0W A;  5F1R A;  2QSF X;  4P5O A;  1QPI A;  3HRT A;  5KHD A;  5ICE A;  3P9I A;  2CU7 A;  2L54 A;  4AID A;  2OTL I;  1VQL I;  3SFZ A;  1XGO A;  2CV1 A;  4HZF A;  1MBK A;  2UZK A;  1CF7 A;  3ZMT A;  4WK8 F;  4M3E A;  4I0A A;  1X3Z B;  1WI3 A;  2QEN A;  1G8X A;  3M3Y J;  3BG7 A;  2OTJ I;  3ZN0 A;  2Q2E B;  3WGH A;  4HDU A;  1Z0X A;  1IW7 F;  2XC7 A;  4B8X A;  4UB6 C;  2K9N A;  2WY8 Q;  3ZRG A;  3S2W A;  2DYR H;  2OUM A;  1IZ1 A;  2RGV A;  4UV9 A;  1ZG5 A;  3FMS A;  1F1Z A;  3W6J B;  1HST A;  1V4R A;  4EMS A;  1BW5 A;  4OWR B;  2DPU A;  4BY7 J;  2JVG A;  3R6S A;  3C7J A;  2DOE A;  5B3S H;  3H0G J;  3OS0 A;  5K5R A;  4L5I A;  1YJW I;  2LNB A;  1FNN A;  3FXM A;  2XUB A;  2VOO A;  4HAM A;  1T2K A;  2KZG A;  5GPA A;  2XAS A;  2VJ4 A;  2CQX A;  3VWB A;  4U88 A;  3RPQ A;  2WB1 N;  5E1Z B;  1OCP A;  3FKJ A;  1W36 C;  3H3Z A;  3OYN A;  2VB6 A;  4ZYE A;  2CW7 A;  4BS9 A;  1BOA A;  5KAF C;  1JGS A;  2CQN A;  1UEL B;  2CUF A;  2X51 A;  4QWQ A;  4BU2 A;  3WG7 H;  2X48 A;  2E7X A;  4DOZ A;  5ILU A;  1E3O C;  5LGN A;  2O3F A;  2OF7 A;  3RDI A;  4G7H F;  5D8L B;  4GRI A;  1U8R A;  1V5G A;  3WTW C;  2JQ7 A;  4IOC F;  1OQY A;  4HPQ A;  5IT9 K;  2JWT A;  2YR2 A;  3ASN H;  2D5V A;  1R4M B;  1TT5 B;  1VQK I;  1WJE A;  3I4M J;  5HLT A;  3S8P A;  4M73 A;  4HF1 A;  2DFE A;  2LRE A;  5TJJ A;  4D1Q A;  4LB6 B;  3KP7 A;  2P5L C;  1D1C A;  1F9N A;  2QYO A;  5CQG A;  3VEP A;  3TW6 A;  3RZD J;  2UXX A;  2ZBK A;  4KIF A;  5EEH A;  4EGZ A;  2R7R A;  4AM3 A;  2O6G E;  1YHQ I;  3FM5 A;  1OYW A;  3C3W A;  2P4W A;  4B4C A;  2IS6 A;  3A01 A;  2BEO A;  4XOT A;  1WQ2 A;  4FQG A;  3RKX A;  5HS7 A;  1FSE A;  3KET A;  4D7M A;  2R7V A;  4D5C A;  3PUF A;  2F5C A;  4M9S A;  3LSM A;  1MBJ A;  3FWE A;  3H92 A;  3V42 A;  5ICC A;  1W7P D;  4BGD A;  1WJ5 A;  3OYJ A;  1EH6 A;  4LGW A;  1WWX A;  2L7F P;  2DMQ A;  3DKX A;  1XB4 A;  4A3E J;  3MN2 A;  1ZAO A;  3KP6 A;  1U5T A;  4II2 A;  2FF4 A;  3S3N A;  1IRG A;  1R22 A;  2XRO A;  3TOA A;  1W7P A;  3LSP A;  2R5Z B;  1X1C A;  5M5W J;  1B1B A;  2NOG A;  2OPT A;  4AVZ A;  5D5V B;  1SD7 A;  2PN6 A;  3KP5 A;  2CQQ A;  3CP8 A;  3GME A;  2EJR A;  5E3O A;  2A61 A;  4PDK A;  4LG3 A;  1R1U A;  2LY1 A;  1ETV A;  3GLL A;  2IGK A;  1AOY A;  2R93 J;  3E6M A;  3KZI C;  4J00 A;  1G3T A;  1WHU A;  3FM3 A;  3RKY A;  5FJ8 J;  1TC3 C;  1A6Q A;  3CJN A;  3GF2 A;  3CCJ I;  2VQL A;  1YS6 A;  1HXD A;  1TWC J;  3TQN A;  4XSZ F;  3E1S A;  1IDZ A;  2Q2E A;  2L7K A;  2EIM H;  4NBQ A;  3RIR A;  3RQI A;  1ETW A;  3H9Q A;  4A3B J;  3F8M A;  1MJ9 A;  4RAF A;  1RUO A;  2EIL H;  4IOA F;  5ICF A;  4DIQ A;  3B6A A;  1AKH A;  3I71 A;  2QUF A;  4EVI A;  2DDA A;  3BP8 A;  1TQI A;  3HHH A;  3QYE A;  3IH2 A;  4F55 A;  5CYV A;  2HYG D;  4BQN A;  3C2H A;  3QPT A;  2VJ5 A;  4MGR A;  1WJC A;  2STT A;  1TTY A;  4OMY A;  4I99 C;  4CXF A;  4WCG A;  4FHT A;  5B1B H;  3CCM I;  4JX5 A;  1HF0 A;  2HQA A;  1I5Z A;  2X9D A;  2DAO A;  2FBH A;  2XKO A;  4E7L A;  5FRO A;  1IXR C;  3OYE A;  5HLI A;  1XSX A;  1R9T J;  1VQO I;  2KRC A;  2EIN H;  2W85 A;  3QWL A;  1QZE A;  2BY1 A;  2QA4 I;  1Y56 A;  2WAQ N;  3CCQ I;  4MHG A;  2W25 A;  2MH2 A;  5FFX A;  1I39 A;  5CVV A;  3E6C C;  3DXJ F;  4P9U A;  1LFP A;  3ZXS A;  1X4P A;  4NB5 A;  3PFI A;  2DO7 A;  1JKR C;  5ICG A;  3CC7 I;  4EV0 A;  2X85 A;  3Q3S A;  5L3F A;  1D0Y A;  2LG4 A;  2OAZ A;  1A6I A;  1D0X A;  1LFU P;  3FHZ A;  1FYL A;  4CH7 A;  1JKO C;  2BVM A;  3M4O J;  3OYM A;  2HQR A;  3ABK H;  1JXS A;  2XF6 A;  2MA3 A;  2FQ4 A;  4OIQ F;  2BXZ A;  4C30 A;  2VUM J;  3KYD B;  5FGM A;  2CWE A;  2JTV A;  4PFO A;  5KVR A;  4RLQ A;  3U9G A;  1UFM A;  1BR1 A;  2LLK A;  3OYH A;  4NUB A;  2PX9 A;  4IHS A;  1KGS A;  2IT0 A;  2H8R A;  1BIA A;  2HOA A;  5B1A H;  2A07 F;  1GHC A;  4A6D A;  4FX0 A;  2K9S A;  1O3R A;  2WWY A;  2M4G A;  3F72 A;  4RGS A;  3NAR A;  3JRD A;  3RYR A;  1POG A;  5EGO B;  2O61 A;  1JHH A;  4PGG A;  1S8N A;  3HKZ N;  4A3F J;  2K3P A;  1ZG1 A;  1FYK A;  9ANT A;  1P92 A;  3G4S I;  3ZQQ A;  4UUV A;  3EDP A;  2DJI A;  3MKZ A;  3FXQ A;  3KFW X;  5FKO A;  1FMV A;  2LK2 A;  1S72 I;  1UHW A;  3GLX A;  4OAY A;  3U1D A;  2MSY A;  2R7X A;  3BRO A;  2NRA C;  2EFW A;  3F8F A;  1YE9 A;  2FX0 A;  5DM6 F;  1EH8 A;  2OZ6 A;  2GQQ A;  1I6H J;  2MD0 A;  5EG0 B;  3S2D J;  1UST A;  2YU9 J;  5K1Y A;  2HQ5 A;  4XID A;  1YIJ I;  1W0T A;  1MH4 A;  2DFI A;  4HA8 A;  1XD7 A;  5DM7 F;  3MVP A;  4UUT A;  3M8F A;  2JRT A;  1DP7 P;  1WJA A;  1UHS A;  2Y0S A;  1F43 A;  2AHQ A;  1J09 A;  1KU2 A;  1DGW Y;  4NC7 A;  3WU1 B;  5D4R A;  3FHN A;  3JTH A;  4JP0 A;  3OYK A;  4XRS G;  1LE8 A;  2LR8 A;  2VKD A;  3ZOB A;  3IWZ A;  3A1Y A;  3BPV A;  1RRJ A;  3WOD F;  5HLH A;  1PP7 U;  3CUQ C;  3BR0 A;  3GFM A;  3GCM A;  4M3G A;  3KX2 A;  4AYB N;  4IXA A;  3TP3 A;  1ZHF A;  5LEJ A;  1V55 H;  4E7K A;  4YEL A;  4LB5 A;  2M4K A;  3CO7 C;  2A3S A;  4E4H A;  3TL4 X;  2Y75 A;  1O3S A;  5M5Y J;  3S1M J;  3CMM A;  3QPH A;  2EPF A;  1FSH A;  3WTY C;  3CJT B;  1IGN A;  5LBQ A;  4LLN A;  1RR7 A;  2ID3 A;  2LYC A;  3EUA A;  2VOD A;  5F64 A;  3KYL A;  2VN2 A;  2W4S A;  3QYB A;  2EBI A;  3GVA A;  3ONQ A;  1IO2 A;  3LA3 A;  4FIS A;  3VFZ A;  1VQN I;  4HQE A;  1GXQ A;  1WJB A;  2QM3 A;  1J7K A;  1IXC A;  2WTE A;  2JMW A;  3IKV A;  2XGX A;  1T33 A;  3CJR B;  1N75 A;  2W48 A;  2DA5 A;  2LKS A;  1ULY A;  4ETS A;  1ZK8 A;  2KL4 A;  1HC8 A;  2RVC A;  3KCC A;  2WBM A;  3PM1 A;  3SZT A;  2JPB A;  1H9G A;  2K86 A;  2HVR A;  1MNE A;  2JZY A;  4NNJ A;  1ZRE A;  2FJ1 A;  1KON A;  2V6C A;  2KIF A;  5IT3 A;  2CO5 A;  2BY0 A;  3K4K A;  3H5A A;  1GVD A;  3GEZ A;  3BZ6 A;  5AIP A;  2FBI A;  3CCE I;  1WZ2 A;  3HOZ J;  3IRR A;  1QRY A;  1QPM A;  4K2E A;  4E7H A;  3N4M A;  1JTX A;  2L7M P;  3VOD A;  3ECO A;  5EZH A;  1Z6T A;  2AO9 A;  4HNU A;  2K7L A;  4IO9 F;  2Z3Y A;  2ZME A;  4CYC A;  1PUF B;  4ENM A;  1OYI A;  3EYI A;  4A69 C;  1J75 A;  5LD2 C;  4HST A;  1CGP A;  4QTR A;  2ETH A;  4IEJ A;  3CF5 F;  4HOB A;  1APL C;  3S32 A;  2KJC A;  3LNQ A;  2PJR A;  1O3Q A;  2BY3 A;  2DBB A;  1Y0U A;  4PK4 A;  3OIP A;  4C2M J;  3CDI A;  4U7B A;  1MMS A;  4CCK A;  2DQR A;  3TP0 A;  5EG0 A;  5E20 A;  1Y1V J;  5IPA A;  2DA6 A;  4Q5S F;  1A36 A;  2RV8 A;  3ZR8 X;  2FD5 A;  3MKL A;  4IQ4 A;  1FTZ A;  1B72 A;  2HZT A;  4BBS J;  1B4A A;  1B59 A;  3F23 A;  3L2V A;  3BTJ A;  3E0J B;  3L9F A;  3AKZ A;  1IJW C;  2FMY A;  5J6X A;  2IA0 A;  4BNC A;  4BQO A;  3L2W A;  1S6L A;  1LB2 A;  1Z91 A;  1PUE E;  2CS3 A;  2X6X A;  4M3B A;  1SEU A;  2FA5 A;  1P7I A;  3GTO J;  1FP2 A;  2D1H A;  1W5T A;  3ZQ7 A;  4RAZ A;  2L5Q A;  3V7R A;  1IAW A;  1VQ4 I;  3SHF A;  3JCU C;  3B6C A;  2DI3 A;  2C6Y A;  1SD4 A;  1NH3 A;  2MH9 A;  1R49 A;  1MH3 A;  3CP2 A;  3R60 A;  1MBG A;  3V7S A;  2VE8 A;  2GXG A;  2QVO A;  1IRX A;  4XR6 A;  2DK5 A;  2DLL A;  2DPD A;  4GDF A;  4PUS A;  4QPO A;  3KEQ A;  3RTR A;  1TNT A;  1IG7 A;  3S93 A;  4DQ2 A;  4RGR A;  4QLC U;  2FOW A;  2KMU A;  2IBD A;  3Q0U A;  4PCQ A;  2L4A A;  2G7H A;  2L9N A;  2IJL A;  1Z67 A;  2FSW A;  2GOX B;  4XLH A;  3HZJ A;  2LBF B;  2V9V A;  3I4P A;  4DNC A;  2DXI A;  1C0W A;  2Z2S B;  1FT9 A;  3ESW B;  5F0H A;  2R3S A;  5H20 A;  1CF7 B;  4O5V A;  1YTY A;  4AC0 A;  1IN7 A;  3VSK A;  3DBL B;  3T8T A;  2CMP A;  2DN0 A;  2VQC A;  4IX7 A;  1TQP A;  1DDN A;  3MAJ A;  2CYY A;  4M9X A;  1Z3Y A;  3TOB A;  2VT3 A;  2NVY J;  2Y30 A;  4B48 A;  2HTS A;  2K3F A;  2JSP A;  5DCF A;  2GM4 A;  3BY6 A;  4MFE A;  2PI0 A;  1JKQ C;  4AIJ A;  2K27 A;  2HPM A;  1VQ6 I;  3OR2 C;  4FX4 A;  2E1M C;  3T1B A;  1ZYR F;  3OOU A;  2AQE A;  3BTC A;  2P6T A;  5DUK A;  1JUM A;  3RKW A;  5KNL A;  4HQM A;  2M45 A;  4C3H J;  3FXJ A;  3GTQ J;  2IA1 A;  3PQK A;  4DZP A;  4NQW B;  2O8X A;  3LOC A;  2ZB9 A;  5FKL A;  1TWG J;  3BCB A;  2JVH A;  2DMN A;  5D5W B;  5LEK A;  2V1D A;  2Z5U A;  4ZZL A;  4HF2 A;  1IN6 A;  4F52 A;  1D3Y A;  2M7B A;  3TBI A;  1IXS B;  1LUJ B;  2WAE A;  2QKM B;  2AS5 F;  2E19 A;  1LEB A;  3I0T A;  4IRH A;  2X1C A;  3KZZ A;  3OSF A;  2E1O A;  2ZJP F;  1Y1W J;  3CCY A;  3GW2 A;  4YIR X;  3BJO A;  2YPR A;  4JBA A;  2HQN A;  4YII A;  3ERM A;  3FBN B;  2DW4 A;  2IAI A;  3HSF A;  2R7W A;  2F5F A;  4N0B A;  1I3A A;  1QO0 D;  4CCO A;  1X58 A;  3FKI J;  1W4M A;  1HW1 A;  3PO3 J;  1OCO H;  4C2U A;  2P5K A;  2RKH A;  4YFK F;  3DEE A;  1F5T A;  2EA2 A;  4M6X A;  2A68 F;  1IV6 A;  1RES A;  5FKM A;  3CJQ B;  2O8K A;  1VQP I;  4U87 A;  3HG9 A;  1Y8R B;  2K02 A;  2DA7 A;  3PIP F;  2JUG A;  1TW3 A;  4L9V A;  1MDM B;  1R6R A;  1ZR2 A;  3EUH A;  4CZC A;  3JRB A;  5CVJ A;  1U8B A;  1S3J A;  5J1Y A;  1K6Y A;  1X1D A;  1KQ8 A;  5TGT A;  4XLA A;  4KMU X;  3A01 B;  1GV5 A;  5K5O A;  4XLP F;  3IH3 A;  1H8A C;  3IL2 A;  1ZRC A;  3ZQF A;  2TCT A;  2MLG A;  3BOQ A;  1I1S A;  2V7F A;  1NTC A;  2EFO A;  4HG2 A;  4UY8 I;  1U5T C;  5E3N A;  1RR8 C;  1XGN A;  3M9A A;  4HF0 A;  3HUG A;  3WTZ A;  5TRD A;  1BBY A;  2VJJ A;  1ZLJ A;  2XF7 A;  2ADU A;  1DGR M;  1SMT A;  2W00 A;  2LF7 A;  4A0X A;  2HEO A;  3IH4 A;  3CMY A;  1R71 A;  1ETY A;  1U5T B;  3D5S C;  2V26 A;  3DP7 A;  4D0P A;  1W7P B;  2RN7 A;  3S1Q J;  3H35 A;  4ZDL A;  2R7Q A;  2I10 A;  3EQL F;  3RI4 A;  1MD0 A;  3BC8 A;  3WE3 A;  1SFO J;  1WJF A;  1TT0 A;  3N05 A;  4RDU A;  2LBF A;  3BJ6 A;  2RDP A;  3CDH A;  1ZGW A;  1IN8 A;  1JI8 A;  2L7Z A;  1Z6R A;  1SFU A;  2XGD A;  2L01 A;  1TNS A;  1SD5 A;  4CIC A;  1OJL A;  4R79 A;  2HOT A;  1ERD A;  1QBJ A;  1A04 A;  1R5I D;  2PMZ A;  2OQR A;  2RC4 A;  4XL9 A;  3OYG A;  4A5N A;  2M7A A;  3NEU A;  3ZMD A;  3LL7 A;  2LRD A;  3FIW A;  2VE9 A;  2JJ7 A;  4PZJ A;  2FNA A;  2NYX A;  2QSG X;  1BI3 A;  3ROU A;  1EH7 A;  4DBR A;  1OCZ H;  2O0Y A;  1T6S A;  3VOE A;  4HNV A;  2LH9 A;  2K9L A;  1YX5 A;  1ZG3 A;  1SC7 A;  2GA2 A;  4AWX B;  1AKH B;  2F5D A;  3CLO A;  5ILS A;  2A6H F;  3BZK A;  1W0U A;  1MKM A;  3CQZ J;  3V4G A;  4CCL A;  3MZY A;  3HJE A;  4IHY A;  4S05 A;  4J01 A;  2DCE A;  2CUZ A;  2M1B A;  2UV1 A;  2XF5 A;  5E8I A;  4NQW A;  1LJ9 A;  1Y39 A;  2DA2 A;  3TO9 A;  2ESH A;  2V1X A;  3HIF A;  2JA8 J;  3G2B A;  3ZQH A;  4LJZ F;  5F0C A;  3FZV A;  4AU7 A;  1FOY A;  3VB2 A;  1O4X A;  4XLF A;  1WPK A;  2HYF A;  4FE4 A;  2KRF A;  1U3E M;  3PO2 J;  3ULQ B;  2R5Y A;  3CMA I;  3E6B A;  2MAB A;  1MSE C;  1W5S A;  3CUO A;  2RQQ A;  1AA7 A;  3VDX A;  4A3I J;  4N4O B;  3DEU A;  2Y48 A;  4C3I J;  1VTN C;  2VAS A;  3WTS C;  2BE5 F;  2GAU A;  4UVC A;  3JRI A;  1KZH A;  1I3Q J;  5L3E A;  3LSK A;  2VL8 A;  4CYD A;  3TMO A;  3KPH A;  3ZQI A;  1WI9 A;  1ETX A;  2A05 A;  1XSV A;  1SFE A;  2XAH A;  4L9N A;  1MDM A;  4XLE A;  4IZZ A;  3CZ6 A;  2CSO A;  2E35 A;  4MTD A;  2OBP A;  3CCU I;  4V19 K;  3MFK A;  3IHU A;  3DU6 A;  1PVE A;  1QVT A;  4BYY A;  1HQC A;  2KIQ A;  2XAU A;  5J1U A;  5L3C A;  2D45 A;  5LHI A;  3LSH A;  4XK4 A;  1ENH A;  4RB1 A;  3QP5 A;  3CC2 I;  3AG3 H;  4A93 J;  1UHM A;  4GO1 A;  1S29 A;  3ZCO A;  1FC3 A;  3T8R A;  1OKR A;  1G4D A;  1BI0 A;  3SZG A;  4OIR F;  2FBK A;  3GZN B;  6PAX A;  5GAH J;  5GAD J;  2A5Y B;  1V3F A;  2I5U A;  1XPX A;  4KDP A;  3LSJ A;  4EEF G;  2QGU A;  2YU3 A;  3K2A A;  2LD5 A;  1BR2 A;  4G6D A;  3VSL A;  2DYS H;  5FD6 A;  3JRE A;  1NK2 P;  3HPH A;  3M7G A;  2R7T A;  5BQT A;  4KT6 A;  4HLY A;  3Q9V A;  1S7O A;  2ZCW A;  3HPG A;  4RB2 C;  2H09 A;  1VND A;  4BXF A;  4KNY A;  2ZSH B;  3S14 J;  4LMY A;  1HW2 A;  1PDN C;  5J4V A;  5EDN A;  1K79 A;  5HNF A;  1XMK A;  3FF5 A;  2IGN A;  4WXD A;  3SXY A;  1B8I A;  2EV6 A;  5CLS A;  3OYD A;  3I4N J;  4F93 B;  1MMG A;  2CFO A;  1RPW A;  1OMI A;  3BQY A;  2M8E A;  2QQ8 A;  2HTJ A;  4S04 A;  1LVA A;  2E71 A;  2M2E A;  3HOY J;  3K1N A;  1PJR A;  1DU6 A;  1J5Y A;  3I9V 2;  2P5V A;  1Z3X A;  1Z05 A;  1LE8 B;  4E7S A;  1I50 J;  3WG9 A;  3L09 A;  2M30 A;  2UUZ A;  4ZYH A;  1QZZ A;  1HKQ A;  3B73 A;  3CCV I;  2VC0 A;  1BW6 A;  5AON A;  1QU3 A;  3QP6 A;  2PMH A;  3K1P A;  1G3W A;  3FXL A;  4HRI A;  2VLA A;  2ICW G;  4HV5 A;  1HKS A;  1QVU A;  5C44 J;  2VBY A;  3FIS A;  2NXN B;  4MLO A;  4EM2 A;  3D0S A;  5LLQ A;  2E1C A;  1UMQ A;  2EZL A;  1L0O C;  3I3L A;  1KA8 A;  3WTT C;  1SVL A;  3S15 J;  4UXN A;  5K5Q A;  2RNG A;  4BY1 J;  1X2M A;  4P96 A;  4IHV A;  1AWC A;  2XAJ A;  1TWH J;  2B0L A;  4I01 A;  2ELJ A;  3BDD A;  3BR6 A;  4ITV A;  3C1D A;  4FTH A;  2PLY A;  5IYB J;  4IF4 A;  4Z6Y A;  5A2Q K;  2VQH A;  4PGH A;  3RQ4 A;  1Q1V A;  3F6O A;  2GOM A;  2HOS A;  2LC2 A;  2OCE A;  3PNY A;  3EYY A;  4XKV A;  4ZDO A;  3OOP A;  4YIF A;  3I54 A;  5FO5 A;  1DPR A;  4C2T A;  1P7J A;  4O3M A;  3TDZ C;  4LD5 A;  3NAU A;  4QIW N;  3SEQ A;  3SDB A;  5J3L A;  3O8G A;  4I2O A;  4CA0 A;  5FLX K;  1ZH5 A;  2BHZ A;  5M3F J;  3E5X A;  2LOO A;  5JLW A;  4UUS A;  2I8D A;  2CW0 F;  2DQL A;  2Z1D A;  2PFB A;  5DD4 A;  2IXS A;  2EV0 A;  4G6Q A;  3ZP5 A;  2ZME C;  2EFP A;  3HYI A;  3HB9 A;  4DW6 A;  3ABU A;  4XSX F;  3V8K A;  4FAS D;  1D1B A;  4L5J A;  4XON A;  2VON A;  1ON1 A;  1U6G A;  1XGM A;  2F48 A;  1G3Y A;  4HDV A;  2DFF A;  4XN3 A;  4XM3 A;  2ZME B;  1J9I A;  1FP1 D;  2LP0 A;  1WH5 A;  2P7V B;  4GGG A;  1RKT A;  4CYC B;  1VFC A;  2OU2 A;  3AG2 H;  3E6D A;  4UB8 C;  2LKX A;  2YX7 A;  3F22 A;  2DTZ A;  1D0Z A;  2ZSI B;  5FB2 A;  2ZFU A;  2Z16 A;  4MTE A;  1EF4 A;  3T0Y A;  3LFU A;  3QOE A;  4M6Y A;  1FTT A;  1JUS A;  3G1M A;  2PJR B;  2ZNZ A;  1R1T A;  2X6Y A;  2IW5 A;  2OA4 A;  2Z33 A;  3UKG A;  3IC7 A;  4BE2 A;  2ISZ A;  3J81 K;  1SFX A;  2BVL A;  3KP4 A;  3W6K B;  1FIA A;  4LK0 F;  1ZRD A;  5BPI A;  3OL3 A;  4QSH A;  4XQF A;  3AG1 H;  2CG4 A;  1B72 B;  3K1M A;  2OV7 A;  1OCR H;  3A2K A;  1T98 A;  3FBI B;  3Q5F A;  1ZRF A;  3CCR I;  2BW3 B;  1ZN2 A;  4LOC A;  3O6B B;  5IOY A;  2EIK H;  1XCB A;  3LFK A;  1BOB A;  2FML A;  4GYI A;  1DP3 A;  4XRM A;  2NAZ A;  3P5J A;  1YRN A;  4XNF A;  3HXL A;  1E17 A;  2XDV A;  3EPZ A;  1K4T A;  1X4O A;  4BE0 A;  1FBS A;  3C2B A;  4MQV A;  5ERI A;  1YJN I;  5KAI C;  2L9R A;  3RPU D;  1E2X A;  5E1W A;  1G59 A;  3NWS A;  1ACI A;  2KDO A;  3TDU C;  1BI1 A;  2UXN A;  3VYT B;  4PJ0 C;  5BS6 A;  3HOX J;  3S2H J;  1OLT A;  1ETQ A;  4HX4 A;  1QHG A;  5C3E J;  3BR3 A;  3MQ0 A;  3RPU A;  3F6V A;  3JAM K;  3DWL E;  1FIP A;  3DKW A;  1Z9C A;  1R7J A;  1J59 A;  3GBG A;  3L00 A;  2F4M B;  3P7N A;  1YIO A;  1YW9 A;  3GO5 A;  2ECB A;  4KIG A;  1XG1 A;  2X0L A;  3S3M A;  3AL0 C;  2K40 A;  2K4B A;  5LGT A;  1R58 A;  2ELH A;  1OCT C;  4HX8 A;  3IV5 A;  2EFQ A;  3H0D A;  3GUD A;  1G3S A;  1TL8 A;  3S1R J;  3J80 K;  1F4K A;  1YW7 A;  3SDG A;  1MMD A;  5DCM A;  5DTD A;  1SAU A;  1VQ8 I;  3AL0 B;  3QPL A;  4WXH A;  3D1N I;  4B3X A;  2XIG A;  4J19 A;  4BQQ A;  2XRL A;  3KP3 A;  4G7O F;  1XMX A;  3KLO A;  4X0G A;  2GIV A;  2UWM A;  5E1X A;  4P55 A;  2V6E A;  3BWG A;  3A0B C;  5CVI A;  1ZKG A;  2L3D A;  4EAT A;  1WH7 A;  5GAE J;  2ZNY A;  3BJA A;  1B9N A;  5IT9 Z;  2IEK A;  2BY2 A;  2MC4 A;  4YFN F;  4IHX A;  5F08 A;  4HNT A;  4P1W A;  4R8H A;  2K4J A;  2EZI A;  5GP9 A;  1X19 A;  2ID6 A;  1UG2 A;  4HW0 A;  1ETO A;  2NVT J;  3E5Q A;  1NK3 P;  2VXZ A;  2KJB A;  1TZL A;  1YQA A;  2OC6 A;  2L02 A;  4FCY A;  3GTL J;  2H1K A;  4YRV A;  3SJM A;  4IHT A;  4OIN F;  4D5F A;  3MKW B;  3CD6 I;  3BG3 A;  3AG4 H;  1JJ8 C;  2H6B A;  4Y15 A;  3GTK J;  2WAF A;  1QA6 A;  2L2O A;  1P4A A;  3FMR A;  4HLX A;  2OZU A;  2YX4 A;  4ZYA A;  5D5X B;  2Y0S N;  2K9M A;  1V5E A;  1XDU A;  3HRM A;  1RET A;  4PJM A;  4BUP A;  4Y4R A;  3PNV A;  3BR5 A;  3G1L A;  1SFK A;  1U0J A;  2FE3 A;  2ZC2 A;  3ABL H;  3AFH A;  3F3X A;  4BHB A;  1USS A;  2LSO A;  4XKC A;  5JHF A;  4N9I A;  2L4M A;  2CV0 A;  3I55 I;  3A03 A;  5EEA A;  2ZFW A;  4ANJ A;  3JTG A;  4KJZ A;  1TW2 A;  2ME0 A;  3EUH C;  4C3J J;  4G6T B;  1ON2 A;  1I1G A;  3DU5 A;  1YOV B;  1R36 A;  1A31 A;  3VYR B;  4N4N B;  4EQQ A;  1O7L A;  5F6F A;  1S5L C;  3A0H C;  2NS0 A;  1R23 A;  1ZEL A;  3JRG A;  5E17 F;  1JGG A;  3CO6 C;  3O3K A;  2QCO A;  2BW3 A;  2JPC A;  1QZY A;  1JKP C;  2E2J J;  4PFP A;  4ESF A;  2ZJQ F;  3F8C A;  3KZY A;  2BV6 A;  2HVQ A;  4UHT A;  4B1R A;  2E36 A;  3HOS A;  4U7D A;  2H6C A;  5B5E C;  3G71 I;  3K4M A;  3PSI A;  2VPL A;  1AU7 A;  4WWC A;  1OIS A;  2HKO A;  2GXB A;  3OY9 A;  4I09 A;  4ZYD A;  2M0C A;  2HGC A;  3P9C A;  5JFR A;  2XAF A;  4GCV A;  1XS9 A;  2DMU A;  3HUG B;  2RQP A;  1XSD A;  2VOP A;  1MND A;  2KQR A;  4C9Y A;  5EYR A;  4CDG A;  1JT0 A;  3I53 A;  3MKY B;  1KYW A;  2R7D A;  2DJN A;  2XRN A;  3IUO A;  3GTM J;  1YS7 A;  3FXR A;  3BG9 A;  2M87 A;  1Y6I A;  4IKF A;  3GFI A;  1HLV A;  1XDS A;  3G1O A;  1YG2 A;  2HFH A;  4CHU A;  3F9K A;  3SZP A;  2OD5 A;  5E79 C;  3QYF A;  3M07 A;  2RRE A;  2NS7 A;  2R7S A;  1T0F A;  1XX5 A;  3W6V A;  1MBF A;  3HDD A;  3M1C A;  2F2E A;  5FLM J;  4NHJ A;  1D5Y A;  1XGS A;  4BAY A;  3MCZ A;  1ONV A;  2EFN A;  2P7C B;  2IGO A;  2CQ7 A;  3F8N A;  4CCM A;  4I0B A;  3CUQ A;  2OQG A;  4MQ9 F;  3L2Q A;  2AXT C;  1IC8 A;  2A6E F;  2DA1 A;  2VIX A;  3M8E A;  4LLL A;  2W7N A;  3RKQ A;  4KN7 X;  1KQ9 A;  4ESJ A;  1GUU A;  3S3O A;  1XCV A;  3K10 A;  2JA7 J;  1PP8 F;  4L0Y B;  3KYC B;  2BGC A;  3E5U A;  4H4K C;  3OR1 C;  5JLX A;  3HTU A;  5IP6 A;  3BR1 A;  2B7E A;  2R7F A;  1VQ9 I;  5CQE A;  1T95 A;  4A0Z A;  1GVJ A;  2IA2 A;  2KFD A;  4OU0 A;  5DS9 A;  4M9Z A;  3MZ8 A;  1MSF C;  1ZGA A;  1XTA A;  2IP2 A;  3R4K A;  1KU3 A;  1EV7 A;  2O7O A;  2ESN A;  5J40 A;  1I6X A;  3RCO A;  1JHF A;  2QBY A;  1BC7 C;  1WFX A;  2FRH A;  4B43 A;  5IYC J;  2BOL A;  3I59 A;  3JSO A;  4CO8 A;  2ACJ A;  5F27 A;  4G8X A;  1YW8 A;  3H5N A;  3HRS A;  5IY5 H;  5KCM A;  1D8J A;  2R5Y B;  2DOA A;  2COB A;  2NS8 A;  3HHG A;  4JX4 A;  3I58 A;  3I56 I;  2Q8K A;  2N8G A;  4B3A A;  5FKN A;  4RA2 A;  1B6A A;  3KEY A;  3R0A A;  4BDZ A;  3WHC A;  2XGE A;  1WVR A;  2EK5 A;  3IKT A;  1BN5 A;  2DT5 A;  2A6T A;  3JRH A;  3AAF A;  4MNU A;  5LRR A;  3OYB A;  2MW8 A;  1QQI A;  4OIP F;  1YJ9 I;  2XGC A;  2AXL A;  4N9H A;  5K7Z A;  1E3P A;  2L9V A;  1FX7 A;  2R4G A;  2FOK A;  4BXX J;  1MNM C;  3K9T A;  3O2P E;  1P2F A;  1WRJ A;  3K69 A;  2NVQ J;  5AIQ A;  2DT7 B;  2ZXH A;  2W84 A;  3BTI A;  4RM3 A;  4RLF A;  1A35 A;  2ZKZ A;  3GTJ J;  5EF6 A;  4B47 A;  2M0M A;  4Q4Z F;  1TWF J;  3JRF A;  3KIO A;  4I6Z A;  3NWT A;  4NC8 A;  1BR4 A;  4HX7 A;  2MYS A;  2CFX A;  3BCA A;  2DMP A;  3QPS A;  1LKX A;  1IRZ A;  2WB1 A;  4GXO A;  2MG4 A;  5BMZ A;  2E34 A;  1WJD A;  4F92 B;  1T38 A;  4S0H B;  3NQO A;  2RNJ A;  5KK1 A;  3ZQC A;  1BL0 A;  2XAG A;  1T39 A;  4UVA A;  3K2Z A;  1HKT A;  1OPC A;  5H6Q A;  2IPQ X;  5DD8 A;  2HDC A;  2DA4 A;  2M3A A;  1FOW A;  2KT0 A;  3K6G A;  3FDY A;  4RAG A;  1ITY A;  4UNO A;  4TV7 A;  4BJ5 C;  4W97 A;  4ASN A;  4Y7N J;  5B66 C;  2R92 J;  3TO6 A;  1XN7 A;  3SQN A;  1R5G A;  1S7A A;  3DLA A;  1U2W A;  4JX6 A;  4A3C J;  1I27 A;  1K78 A;  1B8I B;  4XOR A;  1EJ9 A;  1DUX C;  3WE2 A;  3ABT A;  2EH3 A;  3WHB A;  4BHP A;  2EV5 A;  3QU3 A;  3WU0 A;  3KP2 A;  3QQA A;  4A12 A;  3PQJ A;  1D1A A;  2DOD A;  4BJT A;  4LK1 F;  2F6C A;  4E7Z A;  3BQZ A;  2XSJ C;  4LIT A;  1BC8 C;  5M3M J;  5ED4 A;  5HDG A;  5HVQ C;  3ASO H;  4G94 A;  2V4J C;  3BZC A;  2CJJ A;  4IVN A;  5BNG A;  3JRA A;  3PSF A;  3WU2 C;  2DT6 A;  3OV8 A;  3TW7 A;  2QSH X;  2IVM A;  2IS4 A;  2E1N A;  3K7A J;  4LG0 A;  1U78 A;  2Y0M A;  5FFZ A;  4XKB A;  2HVS A;  3IAM 2;  3LQQ A;  4A3J J;  4MIM A;  2E2I J;  2LKP A;  1HDP A;  4LIV A;  2QQB A;  4A0Y A;  2EZH A;  4BH9 A;  2H27 A;  1JT6 A;  1OFC X;  2HR3 A;  2KIM A;  3H3U A;  3ML6 A;  2NNY A;  3F8B A;  2O5R A;  5FRM A;  5DV5 A;  4H0E A;  1YYV A;  3QAH A;  3FXU A;  4F91 B;  4NDL A;  4AIK A;  3WTV C;  1VQ7 I;  3PUB A;  1SD6 A;  4HV6 A;  3D5L A;  1HCR A;  2CH0 A;  2ZXW H;  1X1A A;  3T5X A;  2BHY A;  2WAD A;  4ESB A;  1FY7 A;  2K5C A;  1FOX A;  5E3M A;  2FXA A;  5CVR A;  5ILV A;  2E5N A;  3JW4 A;  2X1E A;  4UUS B;  3MWM A;  4BEH B;  1PYV A;  1TP4 A;  2GWR A;  1ORK A;  2DA3 A;  2VPR A;  4HEA 2;  4B09 A;  3CC4 I;  3H1C A;  1R5H A;  1O3T A;  2JN6 A;  4EM1 A;  2E60 A;  4I76 A;  4CCJ A;  2PMZ N;  1IN5 A;  5DUI A;  3DKY A;  4GYG A;  2M9H A;  2CRG A;  4B44 A;  5C4J J;  3FMQ A;  4L9J A;  5LHG A;  2P81 A;  4EJU A;  2VBZ A;  3LSG A;  1D8K A;  4OOI A;  1UG0 A;  2QZ8 A;  4JQF A;  3MMY B;  1LPQ A;  5L3D A;  1OR7 A;  5IYD J;  1W1W E;  4PSW A;  1FZP B;  3PFY A;  2PG4 A;  3I5U A;  3WTU C;  3DCF A;  2QQA A;  3ZMZ A;  2STW A;  1SAX A;  3SFI A;  2M5W A;  2PEX A;  2WA0 A;  3OS1 A;  3BT9 A;  2F5V A;  3V8L A;  2CUE A;  1GV2 A;  2HDW A;  1J2X A;  3KEO A;  2AQF A;  2JUC A;  3L7W A;  3E7L A;  5L3B A;  5LGU A;  2WAQ A;  1R1V A;  3LWF A;  4XBF A;  3M8J A;  2GZW A;  1FMW A;  2QLZ A;  2HXO A;  3K70 D;  5FRN A;  3P9K A;  2XB5 A;  2HYJ A;  1IN4 A;  3TKY A;  4R1H A;  1IRF A;  2PBI A;  4L9T A;  3LSR A;  1QNT A;  2FNP A;  2VJI A;  2G7U A;  4Y17 A;  1YLF A;  2PMU A;  1QGP A;  2ZO4 A;  4MFD A;  1YRN B;  1SMY F;  4IQJ A;  2WV1 A;  3HOT A;  5F04 A;  2BXY A;  1R00 A;  1DQU A;  1LDJ A;  1FLI A;  2A69 F;  2L9S A;  5GAG J;  4ZTF A;  2WC2 A;  5JR3 A;  2KP6 A;  3LSI A;  2G0E A;  2VI6 A;  1J0R A;  1XMA A;  3LST A;  4PJL A;  3CME I;  2K9Q A;  4RAY A;  5IOZ A;  1FYM A;  1R4N B;  3H3V K;  3DQV C;  1P6R A;  5D4S A;  3GZ6 A;  4EGY A;  2GIZ A;  4Y52 J;  1ZTR A;  1LVK A;  4ABZ A;  4IHW A;  3BG6 A;  1T8I A;  3GWZ A;  4E70 A;  4Y33 A;  3HC7 A;  4G12 A;  1LEA A;  1KQ0 A;  4A6E A;  3K4N A;  4I98 B;  3G73 A;  2DOF A;  5CPR B;  2XPW A;  1T56 A;  3V8J A;  3HKZ A;  1HSJ A;  1X3U A;  2P6S A;  4RB3 C;  3COA C;  4RM2 A;  1IF1 A;  3E97 A;  2R7Z J;  3H9J A;  2G9W A;  3H36 A;  1N25 A;  1YI2 I;  3VYU B;  1JJ6 C;  2Q1Z B;  2NOJ B;  5DCM B;  4DGW B;  1O7F A;  1BM9 A;  2IS1 A;  1OCC H;  3K4C A;  1K61 A;  4EJW A;  4ZYG A;  4ZC3 A;  2KDZ A;  4BJ6 C;  3IWF A;  3V7C A;  1V5F A;  3E3V A;  3WGG A;  3W3C A;  1ODD A;  3RYP A;  5J4Y A;  2R0Q C;  5L3G A;  3U2R A;  4OAZ A;  3A4C A;  1W36 D;  3OYL A;  4I02 A;  1IV8 A;  3HOW J;  2R7U A;  1Y0N A;  2JA5 J;  4O6J A;  4MO7 A;  1NHA A;  2EQR A;  4F7Z A;  2WV0 A;  1WKM A;  2Y9Z A;  5FD5 A;  5JVT A;  2GBY A;  5H6R A;  4BQA A;  2OCC H;  1YO5 C;  4IL6 C;  4BEH A;  2VQG A;  2H94 A;  3TED A;  2GXA A;  5HLG A;  4IPA A;  1WGX A;  4U0W A;  3C18 A;  3LA2 A;  1RZ4 A;  5HS9 A;  3DBR B;  4ZZD A;  2XVC A;  1REP C;  1VQ5 I;  3ZPL A;  4YG2 F;  2GA1 A;  4KIC A;  2B9S A;  3ISP A;  3K4L A;  3J7Z I;  1K83 J;  4XMY A;  2HI3 A;  1HBX G;  4CCN A;  2NVX J;  3VPR A;  2Y2Z A;  4AYB A;  1M1E B;  1FBQ A;  2HU9 A;  1GXP A;  4XN0 A;  2YSR A;  1RC9 A;  1SVM A;  4Y13 A;  3W2W A;  2CW8 A;  2DFH A;  4L18 B;  3IP4 B;  5C4X J;  4ENJ A;  1FJL A;  4EJV A;  1VI0 A;  1LFB A;  2JA6 J;  2M34 A;  1V54 H;  3B02 A;  2VKH A;  2Y69 H;  3BTL A;  3D5R C;  3LQR A;  3S17 J;  4FT8 A;  1VF9 A;  1BIB A;  2RAE A;  5LRS A;  4RBO A;  1U9O A;  1FEX A;  3BLY A;  3L2R A;  4LIU A;  2E7W A;  2V9P A;  2WY7 Q;  4Q48 A;  3FK7 A;  4PJJ A;  1F36 A;  1FBU A;  2DU9 A;  3DPT A;  4ON0 A;  1BJZ A;  2DMT A;  2YS9 A;  5BPD A;  3CF2 A;  3ERE D;  2R5Z A;  2HS5 A;  4ZH4 F;  3HTS B;  3DPU A;  2NNN A;  2HPI A;  1IDY A;  2K85 A;  4U0Y A;  4A3K J;  5FLV A;  4JYK A;  3OS2 A;  1W5C C;  2XPU A;  4U0V A;  4WF2 A;  3HOV J;  3K4B A;  4AVP A;  4A3M J;  2ZJR F;  2TRT A;  2CV2 A;  4QPQ A;  3U21 A;  4A2U A;  2JT1 A;  5CKT A;  1MBH A;  4CGZ A;  4M72 A;  3EET A;  3CCS I;  4AUX A;  5E3L A;  5HDN A;  4F3Q A;  1T08 B;  3DF8 A;  3REO A;  3FX3 A;  3OMY A;  1RKW A;  3L1P A;  1UZC A;  4KIB A;  1D5V A;  3HBL A;  5EEG A;  2CQK A;  2DTR A;  2Y9Y A;  1H89 C;  1T0F C;  1H9T A;  2LFB A;  2KRH A;  3TGN A;  3PL8 A;  1UB9 A;  5EZG A;  1MJB A;  3GTP J;  1JUP A;  1N78 A;  1WCM J;  4M3F A;  3PIO F;  1X3W B;  2MBF A;  4BBR J;  5GTI C;  1N77 A;  3BR2 A;  3JR9 A;  3HM5 A;  2KIU A;  4DBQ A;  1MJA A;  3ELK A;  1P4W A;  4KYW A;  4BAC A;  4RGX A;  2VT2 A;  2XSD C;  3LMM A;  4W1U A;  1ETK A; 
#chains in the Genus database with same CATH homology
 5HOO A;  1KU9 A;  4I7H A;  2W24 A;  3G3Z A;  4IRI A;  3CUQ B;  2CGP A;  3DV8 A;  2J5O A;  3HRU A;  5DDG A;  2MLK A;  3QU6 A;  4IRG A;  1FWZ A;  5DEQ A;  2TDX A;  4KA4 A;  3RJP A;  2XV4 S;  2BYV E;  3NRV A;  3L2C A;  1ZAR A;  5BOX A;  4JK1 X;  1RNL A;  3DPL C;  3GFL A;  4M74 A;  3GYH X;  3ECH A;  1G6N A;  1LDK B;  2HWV A;  1FOK A;  1TLH B;  4Q47 A;  4HYE A;  5E8G A;  4HBL A;  3IRQ A;  2ZXJ A;  4BXU A;  2QBY B;  3I64 A;  3M1E A;  2EA4 A;  4BHC A;  3I59 B;  1MGT A;  2J5P A;  3R0J A;  4A5M A;  1FPQ A;  3GXO A;  1BI2 A;  4XLN F;  4EM0 B;  3ZMU A;  4LLG F;  4AIH A;  2DK8 A;  1KU7 A;  5LHH A;  1Z7U A;  3GFJ A;  2VBX A;  4ENK A;  2BBY A;  3BPX A;  2D2W A;  3QRF F;  2Z99 A;  1ZLK A;  2LDU A;  4OMZ A;  4KN4 X;  1P4X A;  2F5E A;  2V79 A;  4KMF A;  1DPU A;  1IUY A;  4LFU A;  3GX4 X;  1K7A A;  2KKO A;  2O03 A;  4KT5 C;  2Z9O A;  2QWW A;  4UV8 A;  1HW5 A;  4WXC A;  2FQ3 A;  3MEX A;  3R61 A;  4UVB A;  5JI6 A;  5D6E A;  3K0L A;  3HSR A;  1O57 A;  1B9M A;  2LF8 A;  2EB7 A;  2HKX A;  1ZGJ A;  1RI7 A;  1LNW A;  4RB0 A;  2FEZ A;  4EJT A;  1K78 B;  3WTX C;  1KYZ A;  1TBX A;  2D1V A;  5A2Q Z;  4WX9 A;  3CTA A;  3DFG A;  2MD5 A;  5HDK A;  1Z1D A;  2Q0O A;  2VBW A;  3QOP A;  2FU4 A;  5J8C A;  2W57 A;  2V1U A;  2XKP A;  5FLX Z;  3LAJ A;  5J8F A;  3JSP A;  2XAQ A;  3N97 A;  1Q1H A;  2PQ8 A;  4MEY F;  3KE2 A;  1BJA A;  2EWN A;  4EJO A;  4RGU A;  5D5U B;  1K6O A;  4LG0 B;  3LAP A;  3LA7 A;  2VC1 A;  1H0M A;  3MZH A;  5CVU A;  1OYY A;  4L0Z B;  3Q9S A;  3GZ5 A;  3ZMS A;  4CZZ A;  4Z2Y A;  5E18 F;  3J7A O;  1UCR A;  5JHU A;  4MEX F;  3J81 Z;  3ZMV A;  4G9Y A;  3ZN1 A;  3TO7 A;  2PJP A;  5D8K B;  3HSE A;  3KLN A;  4YFX F;  4KFC A;  2IRF G;  1RIO H;  1RUN A;  4XRF A;  2COM A;  5CJ9 A;  1MZB A;  1L3L A;  3F21 A;  4ENN A;  4AD9 A;  2JSC A;  1LQ1 A;  3JAM Z;  1STZ A;  4KUM A;  4P9F A;  2X4H A;  4M71 A;  3WGI A;  1WSU A;  2ZJ2 A;  1LDD A;  4G7Z F;  5HS8 A;  2XHK A;  2QQ9 A;  2ISY A;  1YFH A;  3J80 Z;  4IJA A;  5D6F A;  4RS8 A;  2P8T A;  5DYM A;  1JE8 A;  2HOE A;  2MC3 A;  4OIO F;  1TQM A;  5F1R A;  4P5O A;  3HRT A;  5ICE A;  3P9I A;  2L54 A;  3SFZ A;  1XGO A;  4HZF A;  2UZK A;  1CF7 A;  3ZMT A;  4WK8 F;  4I0A A;  2QEN A;  3ZN0 A;  3WGH A;  4HDU A;  1IW7 F;  4B8X A;  3S2W A;  1IZ1 A;  2RGV A;  4UV9 A;  1ZG5 A;  3FMS A;  1F1Z A;  3W6J B;  1HST A;  1V4R A;  4EMS A;  2DPU A;  3R6S A;  3C7J A;  5K5R A;  4L5I A;  2LNB A;  1FNN A;  2XUB A;  2VOO A;  4HAM A;  1T2K A;  2XAS A;  4U88 A;  3RPQ A;  5E1Z B;  3H3Z A;  4ZYE A;  1BOA A;  1JGS A;  4QWQ A;  2E7X A;  5ILU A;  5LGN A;  2O3F A;  3RDI A;  4G7H F;  5D8L B;  1U8R A;  3WTW C;  5IT9 K;  2YR2 A;  4M73 A;  4HF1 A;  5TJJ A;  4LB6 B;  3KP7 A;  2P5L C;  1F9N A;  2QYO A;  3VEP A;  2UXX A;  2ZBK A;  4KIF A;  5EEH A;  4EGZ A;  2O6G E;  3FM5 A;  1OYW A;  3C3W A;  2P4W A;  2BEO A;  1WQ2 A;  3RKX A;  5HS7 A;  1FSE A;  3KET A;  2F5C A;  4M9S A;  3FWE A;  3H92 A;  5ICC A;  1W7P D;  1EH6 A;  4LGW A;  1WWX A;  1XB4 A;  1ZAO A;  3KP6 A;  1U5T A;  2FF4 A;  1IRG A;  1R22 A;  2XRO A;  3TOA A;  1W7P A;  1B1B A;  5D5V B;  1SD7 A;  2PN6 A;  3KP5 A;  2EJR A;  2A61 A;  4PDK A;  1R1U A;  1AOY A;  3E6M A;  1G3T A;  3FM3 A;  3RKY A;  3CJN A;  3GF2 A;  1YS6 A;  1HXD A;  3TQN A;  4XSZ F;  2Q2E A;  3RIR A;  3F8M A;  1MJ9 A;  1RUO A;  5ICF A;  3I71 A;  4EVI A;  2QUF A;  3BP8 A;  1TQI A;  3HHH A;  5CYV A;  2HYG D;  4MGR A;  3QPT A;  2STT A;  1TTY A;  4OMY A;  4CXF A;  4WCG A;  4FHT A;  1I5Z A;  2DAO A;  2FBH A;  2XKO A;  1IXR C;  5HLI A;  1XSX A;  2W85 A;  4MHG A;  2W25 A;  2MH2 A;  5FFX A;  5CVV A;  3E6C C;  3DXJ F;  4P9U A;  4NB5 A;  3PFI A;  2DO7 A;  5ICG A;  4EV0 A;  5L3F A;  2OAZ A;  1FYL A;  3FHZ A;  2HQR A;  1JXS A;  2MA3 A;  4OIQ F;  5FGM A;  2CWE A;  2JTV A;  5KVR A;  3U9G A;  1UFM A;  4IHS A;  1KGS A;  2IT0 A;  1BIA A;  1GHC A;  2A07 F;  4A6D A;  4FX0 A;  1O3R A;  2WWY A;  3F72 A;  4RGS A;  3RYR A;  2O61 A;  1JHH A;  4PGG A;  1S8N A;  1ZG1 A;  1FYK A;  1P92 A;  4UUV A;  3EDP A;  3FXQ A;  3KFW X;  1UHW A;  3GLX A;  3U1D A;  3BRO A;  2NRA C;  2EFW A;  3F8F A;  1EH8 A;  2OZ6 A;  2GQQ A;  1UST A;  5K1Y A;  2DFI A;  4HA8 A;  1XD7 A;  3M8F A;  2JRT A;  1DP7 P;  1KU2 A;  3WU1 B;  5D4R A;  3JTH A;  3IWZ A;  3BPV A;  3WOD F;  5HLH A;  1PP7 U;  3CUQ C;  3GFM A;  4IXA A;  1ZHF A;  5LEJ A;  4LB5 A;  3CO7 C;  2A3S A;  2Y75 A;  1O3S A;  3QPH A;  1FSH A;  3WTY C;  5LBQ A;  4LLN A;  2VOD A;  5F64 A;  2VN2 A;  3GVA A;  3VFZ A;  3LA3 A;  4HQE A;  1GXQ A;  2QM3 A;  1J7K A;  1IXC A;  2WTE A;  3IKV A;  2XGX A;  1ULY A;  4ETS A;  2RVC A;  3KCC A;  3SZT A;  2JPB A;  1H9G A;  2K86 A;  2JZY A;  1ZRE A;  2V6C A;  2KIF A;  5IT3 A;  2CO5 A;  3GEZ A;  3BZ6 A;  5AIP A;  2FBI A;  3IRR A;  3N4M A;  4K2E A;  1QPM A;  3VOD A;  3ECO A;  1Z6T A;  2K7L A;  2Z3Y A;  2ZME A;  4ENM A;  1OYI A;  3EYI A;  1J75 A;  1CGP A;  2ETH A;  4HOB A;  2KJC A;  1O3Q A;  2DBB A;  1Y0U A;  4U7B A;  2DQR A;  5E20 A;  4Q5S F;  2RV8 A;  2HZT A;  1B4A A;  1B59 A;  3F23 A;  3L9F A;  2FMY A;  5J6X A;  2IA0 A;  4BNC A;  1S6L A;  1LB2 A;  1Z91 A;  1PUE E;  2FA5 A;  1FP2 A;  2D1H A;  1W5T A;  3ZQ7 A;  4RAZ A;  1IAW A;  3V7R A;  3SHF A;  2DI3 A;  2C6Y A;  1SD4 A;  2MH9 A;  3R60 A;  3V7S A;  2VE8 A;  2GXG A;  2QVO A;  2DK5 A;  2DLL A;  2DPD A;  3KEQ A;  3RTR A;  1TNT A;  4DQ2 A;  4RGR A;  4QLC U;  4PCQ A;  2L4A A;  2G7H A;  2IJL A;  2FSW A;  2V9V A;  3I4P A;  4DNC A;  1C0W A;  1FT9 A;  2R3S A;  5H20 A;  1CF7 B;  4O5V A;  1YTY A;  1IN7 A;  3T8T A;  1TQP A;  1DDN A;  3MAJ A;  2CYY A;  4M9X A;  3TOB A;  2VT3 A;  2HTS A;  5DCF A;  3BY6 A;  2PI0 A;  4AIJ A;  2K27 A;  4FX4 A;  3T1B A;  1ZYR F;  2P6T A;  5DUK A;  3RKW A;  4HQM A;  2M45 A;  2IA1 A;  3PQK A;  2O8X A;  5D5W B;  5LEK A;  2V1D A;  2Z5U A;  4ZZL A;  4HF2 A;  1IN6 A;  1D3Y A;  1IXS B;  1LEB A;  2AS5 F;  3I0T A;  4IRH A;  3KZZ A;  3GW2 A;  3BJO A;  2YPR A;  4JBA A;  2HQN A;  4YII A;  2DW4 A;  3HSF A;  2F5F A;  4N0B A;  1QO0 D;  1W4M A;  1HW1 A;  2P5K A;  2RKH A;  4YFK F;  1F5T A;  2EA2 A;  4M6X A;  2A68 F;  2K02 A;  1TW3 A;  4L9V A;  1MDM B;  3EUH A;  5CVJ A;  1S3J A;  1KQ8 A;  4KMU X;  5K5O A;  4XLP F;  3IL2 A;  1ZRC A;  2MLG A;  3BOQ A;  1I1S A;  2EFO A;  1U5T C;  1XGN A;  3M9A A;  4HF0 A;  3HUG A;  3WTZ A;  5TRD A;  1BBY A;  1ZLJ A;  2ADU A;  1SMT A;  2LF7 A;  4A0X A;  2HEO A;  1U5T B;  3DP7 A;  4D0P A;  1W7P B;  2RN7 A;  3EQL F;  3RI4 A;  1MD0 A;  3WE3 A;  3BJ6 A;  2RDP A;  3CDH A;  1IN8 A;  1Z6R A;  1SFU A;  2L01 A;  1TNS A;  1SD5 A;  4CIC A;  4R79 A;  1QBJ A;  1A04 A;  2OQR A;  2RC4 A;  4A5N A;  3NEU A;  3ZMD A;  2VE9 A;  4PZJ A;  2FNA A;  2NYX A;  1BI3 A;  3ROU A;  1EH7 A;  2O0Y A;  1T6S A;  3VOE A;  1ZG3 A;  2GA2 A;  4AWX B;  2F5D A;  3CLO A;  5ILS A;  2A6H F;  1MKM A;  3V4G A;  3MZY A;  4S05 A;  2M1B A;  5E8I A;  4NQW A;  1LJ9 A;  3TO9 A;  2ESH A;  2V1X A;  3HIF A;  4LJZ F;  3FZV A;  3VB2 A;  2HYF A;  2KRF A;  1U3E M;  3ULQ B;  3E6B A;  1W5S A;  3CUO A;  3DEU A;  2Y48 A;  1VTN C;  3WTS C;  2BE5 F;  2GAU A;  4UVC A;  5L3E A;  4CYD A;  1WI9 A;  1XSV A;  1SFE A;  2XAH A;  4L9N A;  1MDM A;  2CSO A;  4MTD A;  2OBP A;  3MFK A;  3IHU A;  4BYY A;  1HQC A;  5L3C A;  2D45 A;  5LHI A;  4RB1 A;  3QP5 A;  1UHM A;  4GO1 A;  1S29 A;  1FC3 A;  3T8R A;  1OKR A;  1G4D A;  1BI0 A;  4OIR F;  2FBK A;  6PAX A;  2A5Y B;  1V3F A;  4KDP A;  2YU3 A;  4G6D A;  5FD6 A;  3M7G A;  5BQT A;  4HLY A;  3Q9V A;  1S7O A;  2ZCW A;  4RB2 C;  2H09 A;  4KNY A;  4LMY A;  1HW2 A;  1PDN C;  1K79 A;  1XMK A;  3FF5 A;  4WXD A;  3SXY A;  2EV6 A;  5CLS A;  1OMI A;  2M8E A;  2HTJ A;  4S04 A;  1LVA A;  3K1N A;  1J5Y A;  2P5V A;  1Z05 A;  3WG9 A;  3L09 A;  2M30 A;  4ZYH A;  1QZZ A;  1HKQ A;  3B73 A;  2VC0 A;  5AON A;  3QP6 A;  2PMH A;  3K1P A;  1G3W A;  4HV5 A;  1HKS A;  2VBY A;  4EM2 A;  3D0S A;  5LLQ A;  2E1C A;  3WTT C;  1L0O C;  1KA8 A;  4UXN A;  5K5Q A;  4P96 A;  1AWC A;  2XAJ A;  2B0L A;  4I01 A;  3BDD A;  3C1D A;  2PLY A;  4IF4 A;  5A2Q K;  4PGH A;  3F6O A;  3EYY A;  3OOP A;  4YIF A;  3I54 A;  5FO5 A;  1DPR A;  4O3M A;  3TDZ C;  4LD5 A;  4I2O A;  5FLX K;  1ZH5 A;  3E5X A;  2CW0 F;  2DQL A;  2PFB A;  5DD4 A;  2EV0 A;  4G6Q A;  3ZP5 A;  2EFP A;  3HYI A;  3ABU A;  4XSX F;  3V8K A;  4L5J A;  2VON A;  1ON1 A;  1U6G A;  1XGM A;  1G3Y A;  4HDV A;  2ZME B;  1J9I A;  1FP1 D;  2P7V B;  4GGG A;  2OU2 A;  3E6D A;  2YX7 A;  3F22 A;  5FB2 A;  4MTE A;  3T0Y A;  4M6Y A;  2ZNZ A;  1R1T A;  2IW5 A;  2OA4 A;  2Z33 A;  3IC7 A;  2ISZ A;  3J81 K;  1SFX A;  3KP4 A;  3W6K B;  4LK0 F;  1ZRD A;  5BPI A;  2CG4 A;  3K1M A;  1T98 A;  3Q5F A;  1ZRF A;  1ZN2 A;  3O6B B;  1XCB A;  3LFK A;  4GYI A;  2FML A;  2NAZ A;  1E17 A;  1FBS A;  4MQV A;  5ERI A;  1E2X A;  5E1W A;  3TDU C;  1BI1 A;  2UXN A;  5BS6 A;  4HX4 A;  3MQ0 A;  3RPU A;  3F6V A;  3JAM K;  3DKW A;  1Z9C A;  1R7J A;  1J59 A;  3L00 A;  3P7N A;  1YIO A;  1YW9 A;  3GO5 A;  4KIG A;  2X0L A;  2K4B A;  5LGT A;  1R58 A;  2ELH A;  4HX8 A;  2EFQ A;  3GUD A;  1G3S A;  1F4K A;  3J80 K;  1YW7 A;  5DCM A;  4WXH A;  2XIG A;  4G7O F;  3KP3 A;  3KLO A;  2GIV A;  2UWM A;  5E1X A;  4P55 A;  3BWG A;  5CVI A;  2L3D A;  2ZNY A;  3BJA A;  1B9N A;  5IT9 Z;  4YFN F;  4R8H A;  2K4J A;  4HW0 A;  3E5Q A;  2VXZ A;  2KJB A;  1YQA A;  2L02 A;  4IHT A;  4OIN F;  2H6B A;  4Y15 A;  1P4A A;  3FMR A;  4HLX A;  2OZU A;  2YX4 A;  5D5X B;  1XDU A;  3HRM A;  2FE3 A;  3F3X A;  4BHB A;  1USS A;  2LSO A;  4N9I A;  2L4M A;  2ZFW A;  3JTG A;  1TW2 A;  1ON2 A;  1I1G A;  1R36 A;  4EQQ A;  1O7L A;  5F6F A;  2NS0 A;  1R23 A;  5E17 F;  3CO6 C;  3O3K A;  2JPC A;  1QZY A;  4ESF A;  3F8C A;  3KZY A;  2BV6 A;  4UHT A;  3HOS A;  4U7D A;  2H6C A;  4WWC A;  2HKO A;  2GXB A;  4I09 A;  4ZYD A;  5JFR A;  2HGC A;  3P9C A;  2XAF A;  4GCV A;  2RQP A;  1XSD A;  2VOP A;  4CDG A;  3I53 A;  1KYW A;  2R7D A;  2XRN A;  1YS7 A;  3FXR A;  2M87 A;  3GFI A;  1XDS A;  1YG2 A;  2HFH A;  4CHU A;  3SZP A;  2OD5 A;  1T0F A;  2F2E A;  4NHJ A;  1XGS A;  4BAY A;  3MCZ A;  1ONV A;  2EFN A;  2P7C B;  3F8N A;  4I0B A;  3CUQ A;  2OQG A;  4MQ9 F;  2A6E F;  3M8E A;  4LLL A;  4KN7 X;  1KQ9 A;  4ESJ A;  1XCV A;  1PP8 F;  4L0Y B;  2BGC A;  3E5U A;  3HTU A;  2R7F A;  4A0Z A;  1GVJ A;  2IA2 A;  4OU0 A;  4M9Z A;  1ZGA A;  2IP2 A;  3R4K A;  1KU3 A;  1EV7 A;  2ESN A;  1I6X A;  1JHF A;  2QBY A;  1BC7 C;  2FRH A;  3I59 A;  3JSO A;  4CO8 A;  2ACJ A;  4G8X A;  1YW8 A;  3HRS A;  1D8J A;  3HHG A;  3I58 A;  2Q8K A;  1B6A A;  3R0A A;  2EK5 A;  3IKT A;  1BN5 A;  2DT5 A;  3AAF A;  4MNU A;  5LRR A;  1QQI A;  4OIP F;  2AXL A;  4N9H A;  1FX7 A;  2FOK A;  3K9T A;  3O2P E;  1P2F A;  1WRJ A;  3K69 A;  5AIQ A;  2W84 A;  2ZKZ A;  4Q4Z F;  4HX7 A;  2CFX A;  4GXO A;  5BMZ A;  1T38 A;  3NQO A;  2RNJ A;  5KK1 A;  2XAG A;  1T39 A;  4UVA A;  3K2Z A;  1HKT A;  1OPC A;  5H6Q A;  2IPQ X;  5DD8 A;  2HDC A;  4UNO A;  4TV7 A;  4ASN A;  3TO6 A;  1XN7 A;  3SQN A;  1R5G A;  1S7A A;  1U2W A;  1I27 A;  1K78 A;  1DUX C;  3WE2 A;  3ABT A;  4BHP A;  2EV5 A;  3QU3 A;  3WU0 A;  3KP2 A;  4A12 A;  3PQJ A;  4LK1 F;  1BC8 C;  5ED4 A;  5HDG A;  5HVQ C;  4G94 A;  4IVN A;  3OV8 A;  2IVM A;  2E1N A;  4LG0 A;  1U78 A;  2Y0M A;  5FFZ A;  3LQQ A;  2LKP A;  4A0Y A;  2H27 A;  2QQB A;  4BH9 A;  2KIM A;  2HR3 A;  3H3U A;  3ML6 A;  2NNY A;  3F8B A;  5DV5 A;  4H0E A;  1YYV A;  3QAH A;  3FXU A;  4AIK A;  3WTV C;  1SD6 A;  4HV6 A;  3D5L A;  3T5X A;  4ESB A;  1FY7 A;  2FXA A;  5CVR A;  5ILV A;  3JW4 A;  3MWM A;  2GWR A;  4B09 A;  1R5H A;  1O3T A;  4EM1 A;  1IN5 A;  5DUI A;  4GYG A;  3FMQ A;  4L9J A;  5LHG A;  4EJU A;  2VBZ A;  1D8K A;  4OOI A;  2QZ8 A;  4JQF A;  5L3D A;  1OR7 A;  1FZP B;  2PG4 A;  3I5U A;  3WTU C;  2QQA A;  3ZMZ A;  2STW A;  1SAX A;  2M5W A;  2PEX A;  3V8L A;  1J2X A;  3KEO A;  3L7W A;  5L3B A;  5LGU A;  1R1V A;  3LWF A;  4XBF A;  2GZW A;  2QLZ A;  3P9K A;  1IN4 A;  3TKY A;  4R1H A;  1IRF A;  2PBI A;  4L9T A;  1QNT A;  2FNP A;  2G7U A;  4Y17 A;  1YLF A;  2PMU A;  1QGP A;  2ZO4 A;  1SMY F;  3HOT A;  1R00 A;  1LDJ A;  1FLI A;  2A69 F;  2WC2 A;  5JR3 A;  3LST A;  1J0R A;  1XMA A;  4RAY A;  1FYM A;  3DQV C;  1P6R A;  5D4S A;  3GZ6 A;  4EGY A;  3GWZ A;  4E70 A;  1LEA A;  1KQ0 A;  4A6E A;  4I98 B;  3G73 A;  3V8J A;  3COA C;  1HSJ A;  1X3U A;  2P6S A;  4RB3 C;  1IF1 A;  3E97 A;  2G9W A;  5DCM B;  1O7F A;  1BM9 A;  4EJW A;  4ZYG A;  3IWF A;  3V7C A;  3E3V A;  3WGG A;  1ODD A;  3RYP A;  5L3G A;  3U2R A;  4I02 A;  4O6J A;  1NHA A;  4F7Z A;  2WV0 A;  1WKM A;  5FD5 A;  5JVT A;  5H6R A;  4BQA A;  1YO5 C;  2H94 A;  5HLG A;  4IPA A;  4U0W A;  3C18 A;  3LA2 A;  1RZ4 A;  5HS9 A;  4ZZD A;  2XVC A;  1REP C;  3ZPL A;  4YG2 F;  2GA1 A;  4KIC A;  3ISP A;  1HBX G;  1FBQ A;  1GXP A;  2YSR A;  4Y13 A;  4L18 B;  4ENJ A;  4EJV A;  3LQR A;  3B02 A;  4FT8 A;  5LRS A;  1BIB A;  2E7W A;  4Q48 A;  4ON0 A;  1FBU A;  2DU9 A;  3DPT A;  5BPD A;  3ERE D;  2HS5 A;  4ZH4 F;  3HTS B;  2NNN A;  4U0Y A;  4U0V A;  4WF2 A;  4AVP A;  4A2U A;  2JT1 A;  4CGZ A;  4M72 A;  3EET A;  5HDN A;  3DF8 A;  3REO A;  3FX3 A;  1D5V A;  4KIB A;  5EEG A;  2CQK A;  2DTR A;  1H9T A;  3TGN A;  1UB9 A;  1MJB A;  2MBF A;  2KIU A;  1MJA A;  3ELK A;  1P4W A;  4KYW A;  4RGX A;  2VT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...