2FA5A

The crystal structure of an unliganded multiple antibiotic-resistance repressor (marr) from xanthomonas campestris
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
148
structure length
139
Chain Sequence
HPVLLNLEQFLPYRLSVLSNRISGNIAKVYGDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAKDGLPRMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator marR/emrR family
publication title The crystal structure of XC1739: a putative multiple antibiotic-resistance repressor (MarR) from Xanthomonas campestris at 1.8 A resolution
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transcription
total genus 49
structure length 139
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fa5A00
2RN7A 3KETA 1ON1A 3NQOA 4UV8A 4LJZF 4GGGA 2IPQX 3LSTA 1Y0UA 1MZBA 3HRUA 1USSA 2EA2A 4KICA 3WTYC 1IN5A 3LAJA 1K78B 3SFZA 1O3SA 5IT3A 3K2ZA 1P4XA 1T6SA 2EFPA 3V8KA 1HKTA 1SD5A 1G6NA 2DT5A 2JT1A 4B8XA 5ILVA 3GWZA 3PQJA 4DQ2A 2KIUA 4TV7A 1MKMA 2OAZA 2XAFA 4M73A 2FEZA 2CFXA 1ON2A 2JSCA 2QVOA 1FYMA 2OBPA 4M9SA 5HLGA 4IVNA 4KDPA 1R22A 2Z3YA 1T39A 4UV9A 4OU0A 4M9ZA 2Q2EA 1RNLA 3WU0A 4JK1X 2ETHA 2Y75A 4P9FA 1SD7A 1K6OA 3MCZA 1HQCA 3R4KA 4OIPF 1BN5A 3KZYA 5H6QA 1W5TA 5DEQA 1BBYA 1IRFA 5L3EA 1DDNA 2QQAA 2J5OA 4NHJA 4KIBA 1R5GA 3H3ZA 3GO5A 2XKPA 4L5JA 3BP8A 2VBWA 5BS6A 1GVJA 4RB1A 2CGPA 1FPQA 4BAYA 4G6DA 4YG2F 5TJJA 4ZYDA 2EFNA 3J81Z 2W57A 1FSEA 3T8RA 2OU2A 2HYGD 1BI1A 3COAC 1YS6A 1XB4A 2JRTA 1A04A 1IXSB 4OINF 3GFLA 1XGNA 1TTYA 3ZMTA 3QPTA 4DNCA 2VXZA 1FT9A 2FBKA 5J6XA 3H3UA 3BPXA 3I59B 5AIPA 1EH8A 2GZWA 3WTWC 1P4WA 4Q4ZF 5D8LB 2V1DA 1T2KA 5JHUA 3BDDA 5H20A 1YQAA 2DK8A 3D5LA 3KLOA 2GXBA 1UFMA 3RKXA 1XGSA 4A5MA 1BI2A 1G3WA 2KJCA 4CO8A 3F21A 2MH9A 3Q5FA 3KP5A 3WGGA 2V1UA 5ILUA 4HW0A 2ELHA 3HOSA 3QP5A 1KU2A 1VTNC 3MFKA 3L00A 2QQBA 2HDCA 4LMYA 1L0OC 2ACJA 2RDPA 2VOOA 3K1PA 4GO1A 4HF0A 2JPBA 1U5TC 4LG0B 3HHGA 2GAUA 4P5OA 1KYWA 5ERIA 1GHCA 4WXHA 2A6HF 2PI0A 3N4MA 3GW2A 4YFNF 4ZYEA 2ZNZA 2BBYA 5BPDA 1U8RA 4L9TA 3PFIA 3WTVC 3I54A 3L9FA 3E5XA 3JTHA 1SAXA 4L9VA 4L9JA 2HYFA 2M5WA 2L01A 3ZQ7A 5DD8A 3U9GA 5DV5A 1ZARA 4OMYA 2OZUA 2QBYB 2FMLA 2MBFA 3DKWA 3IRRA 2NNYA 1JGSA 4IPAA 2A6EF 3KEQA 2XROA 3K1NA 3F23A 2CYYA 1MD0A 1OKRA 3C3WA 3C7JA 4LLLA 4ENNA 4CDGA 4RGRA 1W7PD 4KMUX 3R0AA 2HGCA 2CO5A 4I09A 3AAFA 1QZYA 4M6XA 1OYIA 4U88A 4U7DA 3WTSC 2A69F 5L3FA 1H9GA 2L4AA 4KYWA 3HUGA 2NAZA 2P6SA 1D3YA 2P4WA 1REPC 2KRFA 3HSRA 5FLXK 3EYYA 1KU7A 3F8MA 1C0WA 1J59A 2OQGA 3GVAA 3RI4A 2FA5A 1SD4A 3KP6A 3QU6A 4LGWA 4PGHA 2K4BA 2IA2A 2P7VB 2A5YB 3I71A 2M87A 4L18B 3I58A 2VOPA 1WWXA 2H94A 4OIRF 4R1HA 3E6BA 1SMTA 4HF2A 1U78A 3DPLC 4G7ZF 3R60A 4OOIA 2PQ8A 1STZA 2HFHA 3HRMA 2RVCA 4XBFA 5L3BA 3F22A 4YFXF 3K0LA 3ECOA 4BQAA 5CJ9A 2BV6A 4KN7X 3HYIA 3S2WA 3FXUA 4KA4A 4BHBA 4ESFA 1J0RA 3CTAA 1FNNA 1XD7A 1MDMB 2PN6A 1B4AA 3I4PA 3C18A 1J75A 2ZO4A 3RTRA 4Z2YA 1U5TB 2KIFA 3RYRA 2OA4A 1RZ4A 2GA1A 3GF2A 5D5UB 5CVJA 3HIFA 3K69A 4RGSA 4LFUA 4EM1A 4G8XA 1EH6A 1WI9A 2HTJA 4P96A 3ZN0A 3GXOA 3V4GA 3KCCA 3V8LA 3VB2A 1IN6A 1TNSA 2FNPA 2XAGA 4PZJA 2JPCA 1R1TA 2ISYA 4PDKA 1FBSA 3U2RA 1FWZA 2EV6A 3L09A 1IXRC 1DPRA 4RAYA 4EGYA 1I5ZA 1KQ8A 2FF4A 2PFBA 2K86A 3FX3A 4I98B 2DI3A 2CSOA 1Z91A 4IRHA 2CQKA 4Y17A 4A5NA 2YX4A 5FGMA 2UXXA 3MAJA 3LAPA 2D1VA 1BI0A 3ML6A 4HV5A 4BXUA 1RUNA 2VN2A 2VBYA 2ZJ2A 3RJPA 1ZYRF 4QWQA 2FMYA 2VE8A 3CDHA 4MGRA 3LA7A 3CUOA 2ESNA 3IRQA 4NB5A 3R61A 1D5VA 4Q48A 2J5PA 1HKQA 4I01A 1YW8A 2PJPA 1TLHB 5E20A 3CJNA 5F6FA 1B59A 2PLYA 3FMQA 3W6JB 1XCVA 1KQ9A 2M45A 4UXNA 3MZHA 3WTZA 4G7HF 3DEUA 3QPHA 2R7DA 3OV8A 3FF5A 1FC3A 1P2FA 5HDKA 1I1GA 3H92A 5FO5A 5LRRA 2W84A 1R36A 2HQNA 1KA8A 4R79A 1ZGJA 2FXAA 1X3UA 3PQKA 1K7AA 4HX4A 4BH9A 3ROUA 2RKHA 1LQ1A 5FD6A 1LDDA 2EV5A 3V7CA 3F8CA 2YU3A 2MD5A 1S7AA 4IHTA 1IXCA 3CO6C 2FSWA 3IWZA 3WTXC 4EMSA 4WCGA 1F4KA 4M72A 1IZ1A 2XUBA 4LLGF 5JI6A 2DK5A 2Q0OA 5HDNA 4CHUA 2O0YA 4IXAA 1FYKA 4MQVA 5E1ZB 3DXJF 2HTSA 1FP2A 3M9AA 2EFOA 2XVCA 3KLNA 1WQ2A 2X4HA 4U0VA 1AWCA 2RNJA 2O3FA 3QP6A 4WX9A 2P8TA 4HF1A 3JW4A 3ERED 1ZG3A 4EGZA 1JE8A 1XSVA 4IRGA 2VBXA 5A2QZ 3GEZA 4MHGA 3F72A 3R0JA 5LRSA 3MQ0A 5CVUA 1BC8C 1CF7A 3CUQA 2VE9A 3ULQB 5F64A 1Z9CA 1FOKA 4MEYF 1LEAA 1ZRDA 2YR2A 1MGTA 3E6DA 4Q5SF 2CW0F 1IN8A 2V6CA 4GCVA 3T0YA 2IA0A 2P5VA 2XAHA 4F7ZA 2WWYA 1HSJA 2GXGA 1BC7C 3SQNA 1QPMA 4AVPA 1DPUA 5DCMA 2DQLA 2QLZA 5A2QK 4HQEA 4XLPF 1R1VA 3DV8A 3TOBA 3ELKA 4YIFA 5LBQA 2P7CB 3WTUC 3P7NA 3E6MA 2ADUA 3M1EA 3QOPA 2VT3A 3JAMZ 4G94A 1JXSA 2VC1A 5FD5A 4CYDA 2HWVA 1FBQA 2NYXA 1HSTA 2JTVA 3LQRA 5LGTA 1QGPA 1I6XA 3BJAA 5L3CA 4ZZLA 2JZYA 2IT0A 3TO9A 4HDVA 2Y0MA 6PAXA 5LGNA 1IUYA 2MLGA 1E2XA 1TBXA 4ESBA 3GLXA 2GQQA 4LLNA 4ON0A 3Q9SA 4L9NA 2TDXA 1QQIA 5FB2A 5LHGA 1P92A 3KFWX 1K79A 2E7XA 5L3GA 3GYHX 3VFZA 1ZLJA 4AWXB 1R00A 3SXYA 4I02A 3JAMK 1WKMA 2VT2A 4UNOA 2FBHA 4CGZA 3LQQA 4ASNA 4XSXF 2K27A 4MTDA 4CXFA 2EV0A 4Y13A 5K5RA 3CLOA 4ZYHA 1B6AA 3ECHA 3IKTA 1O3TA 4NQWA 5F1RA 1DUXC 3RIRA 3KP4A 5BQTA 3CUQC 3RDIA 2Q8KA 3E5QA 3P9CA 1SMYF 3WU1B 4EM0B 2MH2A 3BJOA 1S8NA 4EJOA 2FOKA 2DW4A 3OOPA 2LNBA 5DDGA 3BY6A 4OIOF 2QQ9A 1W7PA 2F5EA 2RGVA 5J8CA 1T98A 1HKSA 5K5QA 5FLXZ 3LA2A 4RS8A 4D0PA 2FNAA 3KP7A 2BE5F 5J8FA 3IWFA 2V9VA 4RGXA 2QYOA 5D5VB 4QLCU 2E1CA 3SZTA 4L5IA 4FX0A 3REOA 2XASA 2UXNA 2XGXA 5BOXA 5CYVA 4HDUA 3TOAA 2B0LA 4MNUA 4WK8F 3ZP5A 1FSHA 4U0YA 2RV8A 1TQPA 3QAHA 4L0ZB 4KT5C 2V1XA 1I1SA 3FZVA 3GX4X 4WWCA 3W6KB 2IW5A 1XSDA 1Q1HA 3IHUA 4I2OA 2A68F 4M6YA 4EV0A 1SFXA 4XRFA 2QUFA 4OMZA 2A3SA 3GFMA 2EFWA 1B9MA 1YG2A 4JBAA 4B09A 4A0ZA 5CVVA 4AIKA 3BJ6A 5HS9A 3HHHA 3P9IA 2WTEA 2ZXJA 4LK0F 1S6LA 5HS8A 1U6GA 2IA1A 4UVAA 2GIVA 5E8GA 1V4RA 4HLXA 1R1UA 4GYIA 3M8EA 5ICEA 2STWA 3FHZA 4YIIA 1SFEA 1D8JA 3FMRA 3U1DA 3F8FA 1TQMA 2LF8A 3VEPA 2IVMA 1OR7A 3EYIA 3HRTA 2HEOA 4P55A 3ZMZA 3F3XA 3WGHA 2QZ8A 3TDUC 2YPRA 1O7LA 3DP7A 4R8HA 5EEHA 4IJAA 2KIMA 1R5HA 4PCQA 1MJ9A 3F8BA 2WV0A 2F5FA 2M8EA 5L3DA 3WODF 2ZMEA 2BYVE 3TQNA 2IP2A 5CLSA 3HSFA 1MJAA 2W25A 4H0EA 3HTSB 1HW1A 2RQPA 1EH7A 1HW2A 4WF2A 3BOQA 1LDKB 3SHFA 3MZYA 2DTRA 3BPVA 1FYLA 1NHAA 3B73A 5DUKA 1CF7B 3CUQB 1FLIA 2G7HA 2IJLA 3ZMVA 4LK1F 4ENMA 2O03A 1YO5C 4HAMA 4ENKA 3FXQA 1ONVA 2FU4A 5JFRA 5DD4A 4RB3C 1XDSA 4KNYA 4L0YB 1QO0D 2AXLA 4ETSA 3K9TA 2EB7A 5IT9K 2H09A 5D5WB 4UUVA 4LB5A 1ZG1A 4RAZA 3P9KA 1BM9A 5AIQA 3CO7C 1B1BA 5DCMB 1XMKA 4IRIA 4KIFA 2OD5A 2QM3A 5BMZA 5BPIA 4ENJA 3RKWA 5JVTA 3RPQA 4RB2C 2L4MA 3MEXA 3EQLF 4HQMA 3TKYA 1B9NA 4O3MA 1FP1D 3O3KA 4LD5A 1JHHA 1ZAOA 2LF7A 4BHCA 2K7LA 2LKPA 1PUEE 3T1BA 1FZPB 1Z6RA 1RUOA 1HBXG 1H0MA 2Z9OA 1T38A 1FBUA 3HTUA 2Z99A 3FMSA 2HS5A 3BWGA 1UHWA 2MLKA 2HQRA 3FXRA 3KE2A 1LNWA 1QNTA 3DFGA 1P4AA 4P9UA 3V7RA 1WRJA 5E17F 1FX7A 3EDPA 2AS5F 1ZGAA 4HYEA 3J7AO 3RYPA 2ZKZA 3B02A 4GYGA 2A61A 5D6EA 1IAWA 1PDNC 4RB0A 1OYWA 1RIOH 1BIBA 1KU9A 3I0TA 5LGUA 2E7WA 2HR3A 4WXCA 4HX7A 3JTGA 2K02A 1UHMA 3GFIA 5ICCA 3F6OA 1ZREA 3KEOA 1F5TA 1LB2A 1YYVA 1XMAA 4AD9A 1W7PB 2DLLA 5D4SA 4KMFA 3E97A 2NS0A 4ZYGA 2DPUA 3I64A 4HOBA 3IL2A 4FX4A 1MJBA 4WXDA 3J80K 2VBZA 2EA4A 3TO6A 3IKVA 2CG4A 2D1HA 5LLQA 5HDGA 1BI3A 1T0FA 4M9XA 3GZ5A 3KZZA 1DP7P 3GFJA 4MTEA 2NNNA 3F6VA 5D5XB 2DO7A 1ZG5A 2MA3A 3E3VA 5D4RA 4O6JA 3RPUA 1MDMA 5DYMA 1U5TA 4OIQF 2O6GE 4MEXF 2PG4A 2Z33A 4G7OF 1ZRFA 2F5CA 1U3EM 4LB6B 5LHHA 3ZPLA 3WG9A 1KYZA 3DQVC 4O5VA 4EJWA 1G3SA 4KFCA 3ZMUA 1R58A 3NRVA 2DAOA 1XN7A 2OQRA 3ABTA 5CVIA 3KP2A 4UVCA 1IF1A 5EEGA 2C6YA 2FRHA 4IF4A 2XIGA 5DCFA 5E1XA 3T5XA 3WTTC 3L2CA 4KN4X 3KP3A 1XCBA 4A0XA 2RC4A 4CZZA 2OZ6A 1J5YA 1O7FA 2PMUA 4A6DA 1YTYA 4EJUA 3EETA 2L02A 2P5KA 1YIOA 4IHSA 2P6TA 1P6RA 1IW7F 2ZFWA 5TRDA 5DUIA 1IN4A 2PBIA 2EFQA 4EJTA 1D8KA 2UWMA 5FFXA 2E1NA 2ZMEB 2XKOA 5K5OA 3J81K 2G9WA 4N0BA 2V79A 1IRGA 3R6SA 1Z7UA 2YSRA 3C1DA 1U2WA 3G3ZA 5HS7A 2STTA 1H9TA 5E1WA 2F5DA 5ED4A 4BHPA 2D2WA 3ZMSA 1KU3A 3E5UA 4ESJA 1PP8F 2H6BA 2CWEA 2VC0A 1ZHFA 3V8JA 3RKYA 2Y48A 2COMA 2EJRA 1LVAA 5D8KB 3LWFA 1O3RA 2QWWA 3QRFF 2ZNYA 1XSXA 5FFZA 1K78A 3IC7A 4PGGA 3DF8A 4HBLA 4XLNF 1W5SA 5E18F 5E8IA 1I27A 2DFIA 1HW5A 3FM5A 1OMIA 3L7WA 1LDJA 2VODA 2H27A 2GWRA 1UCRA 1AOYA 4HA8A 5ICGA 4K2EA 1TW3A 3TGNA 1S29A 3FM3A 4G6QA 2G7UA 4KUMA 4A0YA 2A07F 4HV6A 2HZTA 1XDUA 1HXDA 1JHFA 3I5UA 4UHTA 4BNCA 5LEKA 1EV7A 2LSOA 2IRFG 2XHKA 5LHIA 1TQIA 2BGCA 3E6CC 1L3LA 5KK1A 1GXPA 1QZZA 4N9IA 2O61A 2FE3A 4KIGA 5HLHA 1W4MA 3Q9VA 1YLFA 5HOOA 1ZN2A 1J7KA 3M7GA 2R3SA 5ILSA 4S04A 2BEOA 1S7OA 3DPTA 1ODDA 4EQQA 1BIAA 1OYYA 4FT8A 3FWEA 2XAQA 3N97A 4I7HA 1G4DA 3HRSA 4HX8A 3JSOA 3EUHA 3WGIA 2PMHA 4BYYA 4CICA 4AIJA 1Z6TA 4I0BA 1F1ZA 4U7BA 3D0SA 1SFUA 2FBIA 1SD6A 1WSUA 2DBBA 3M8FA 2ISZA 3MWMA 1LJ9A 2HKOA 1FY7A 3ZMDA 3I59A 1CGPA 4AIHA 1USTA 2DQRA 1BJAA 1R23A 1V3FA 4EVIA 4MQ9F 3GUDA 2KKOA 3I53A 1XGMA 3GZ6A 1J9IA 2D45A 1YW7A 2O8XA 3JSPA 1GXQA 2ZCWA 2GA2A 2M30A 1IN7A 3G73A 3TO7A 3WE2A 1KGSA 2KJBA 5IT9Z 4RGUA 4UVBA 2P5LC 4A2UA 4M71A 3HSEA 1Z1DA 2XV4S 2FQ3A 3VODA 3HOTA 2WC2A 2L54A 4M74A 4HZFA 4EJVA 2M1BA 5D6FA 1ZLKA 2X0LA 1XGOA 1LEBA 1ULYA 2H6CA 1G3TA 3BROA 5KVRA 4G9YA 4I0AA 1R7JA 2EWNA 5JR3A 1O57A 4LG0A 3SZPA 2ZBKA 1F9NA 1ZRCA 1E17A 2EK5A 1J2XA 2HOEA 4S05A 4U0WA 3TDZC 3F8NA 1TNTA 3O6BB 4Y15A 1BOAA 4A12A 1YS7A 3K1MA 4N9HA 3V7SA 1G3YA 4Q47A 1KQ0A 5H6RA 3WE3A 5HVQC 1PP7U 4XSZF 2NRAC 4GXOA 2QBYA 1YFHA 3VOEA 4HLYA 4ZH4F 2MC3A 3BZ6A 2F2EA 1S3JA 2DPDA 2PEXA 2QENA 3NEUA 3O2PE 4JQFA 2VONA 5HLIA 5AONA 4A6EA 2XRNA 2YX7A 1OPCA 1RI7A 5ICFA 4FHTA 4YFKF 3ISPA 1UB9A 3T8TA 4EM2A 3ABUA 2K4JA 5LEJA 2XAJA 1TW2A 1QBJA 5CVRA 3LFKA 2Z5UA 1O3QA 3QU3A 2DU9A 2LDUA 3ZN1A 3LA3A 4E70A 1YW9A 4ZZDA 5K1YA 2L3DA 2ESHA 1ZH5A 2HKXA 2W24A 2R7FA 2W85A 2UZKA 3J80Z 1Z05A
chains in the Genus database with same CATH superfamily
2RN7A 4UB8C 2VJIA 3KETA 3A01B 2FX0A 1ON1A 1D0XA 2QGUA 3NQOA 4UV8A 4LJZF 2EIMH 1SVOA 2KZVA 1X1BA 4GGGA 2IPQX 3LSTA 1Y0UA 1MZBA 3HRUA 1USSA 2EA2A 4KICA 3WTYC 1IN5A 3LAJA 1K78B 5IYBJ 1YITI 3SFZA 4II3A 4XRMA 1O3SA 5IT3A 4XLCA 1ZR2A 1WVRA 3K2ZA 1P4XA 1OCCH 1G59A 1T6SA 1NK2P 2EFPA 3V8KA 1HKTA 1SD5A 4XONA 1G6NA 2DT5A 2JT1A 4PJ0C 4B8XA 5ILVA 3GWZA 3PQJA 5JVGF 3DWLE 4DQ2A 3BR3A 2M7BA 2KIUA 4TV7A 4A69C 4EATA 3H9JA 1MKMA 5KAIC 2OAZA 2XAFA 2VJJA 2FEZA 4M73A 3RCOA 2OTJI 4A3BJ 1ETYA 2HI3A 2KMUA 2CFXA 4XN3A 3BZCA 4XORA 4IOCF 1ON2A 2JSCA 2QVOA 3S8PA 1FYMA 2OBPA 4M9SA 5HLGA 3OMYA 1PYVA 2DOFA 4IVNA 3CJRB 4KDPA 1Z21A 1VFCA 1R22A 3G6EI 2Z3YA 1T39A 1DGRM 1SAUA 4UV9A 2K3FA 4B48A 1I3AA 2R7ZJ 4OU0A 2LBFA 3S1NJ 4M9ZA 2OUMA 2Q2EA 1RNLA 3H0GJ 4CCMA 3WU0A 1GVDA 2UUZA 1BW5A 4JK1X 3JRCA 2ETHA 2CFOA 2Y75A 2DFFA 2BY0A 2ZSHB 4P9FA 3OYHA 1SD7A 1K6OA 2AO9A 3LOCA 3MCZA 2R7WA 1HQCA 2HVRA 3R4KA 1AA7A 4BE0A 5F27A 2IBDA 2W1OA 4OIPF 3CCMI 1BN5A 2DYRH 1K4SA 2DFHA 2H8WA 2NXNB 3KZYA 5H6QA 3S93A 1W5TA 5DEQA 1AHDP 3HC7A 2EZIA 1XTAA 1BBYA 1IRFA 4BEHB 5L3EA 1DDNA 2QQAA 3K4NA 2J5OA 2W4SA 3JRIA 9ANTA 4NHJA 2NVTJ 4KIBA 5HODA 1R5GA 4ZTFA 3H3ZA 2NVXJ 3GO5A 3DU5A 2XKPA 4L5JA 3BP8A 2VBWA 5DM6F 1IGNA 3LSJA 5BS6A 1GVJA 4RB1A 3GTJJ 2CGPA 1FPQA 3QOEA 3IV5A 3HOXJ 2CUEA 4RLFA 4BAYA 1ETXA 2PX9A 4YIRX 4G6DA 4YG2F 5FKLA 3WG7H 2WBMA 5TJJA 4ZYDA 2EFNA 3J81Z 2W57A 3H9QA 1FSEA 4B4CA 3T8RA 2KIQA 2OU2A 2HYGD 2BVLA 4CCLA 1BA5A 1BI1A 2M8GX 1BW6A 3COAC 3GTKJ 2KDZA 1YS6A 4B47A 4M3BA 1XB4A 2JRTA 1A04A 1IXSB 3QPLA 2CUJA 1LKXA 1LVKA 2W82A 1ETWA 4OINF 3GFLA 1XGNA 3Q0UA 1TTYA 3MKLA 1LUJB 3ZMTA 3QPTA 2HPMA 2ME6A 4N4OB 1TT0A 4BJ6C 3SYTA 2OPTA 2OC6A 1YE9A 4DNCA 2VXZA 5M3MJ 1FT9A 2DODA 2FBKA 2Y2ZA 5J6XA 5EZGA 4II2A 3B6AA 3ZQQA 3JRGA 3H3UA 3QYBA 3BPXA 2TRTA 2WA0A 3K6GA 2QA4I 3I59B 3Q3SA 2EINH 1R71A 1JTXA 4DBRA 3OS0A 5AIPA 3AKZA 2XC7A 3RQ4A 3O8HA 1EH8A 1MBJA 2GZWA 3WTWC 1P4WA 3BG6A 4Q4ZF 5D8LB 1V55H 1LFBA 2LVSA 2V1DA 1T2KA 5JHUA 5CQGA 1PUFA 3BDDA 2G0EA 2V9PA 1H8AC 3DTKA 3O8GA 1ERDA 5F0HA 5H20A 1YQAA 4BXFA 2VKHA 1A35A 2DK8A 2JRMA 4QSHA 3A2KA 3PIPF 5C4XJ 2MD0A 1Q1VA 3D5LA 4HG2A 3KLOA 2GXBA 1LE8A 1UFMA 2JA7J 3RKXA 3LSIA 4BXXJ 1XGSA 3A03A 4A5MA 1TC3C 1IRZA 1Y56A 2D5VA 1BI2A 1G3WA 4AIDA 2KJCA 3U1KA 4CO8A 3F21A 3MKZA 4AYBA 2MH9A 3LMMA 3CQZJ 3Q5FA 4AM3A 4G12A 4PK4A 1WHUA 2VJ4A 2BVMA 3KP5A 2WV1A 3WGGA 2V1UA 5ILUA 1FOWA 2R7OA 4XQFA 4HW0A 2ELHA 3HOSA 3QP5A 3OR1C 3HKZA 1KU2A 1QA6A 2KL4A 1VTNC 1X19A 1MNDA 3DPUA 3MFKA 3L00A 2QQBA 3CESA 2HDCA 4LMYA 4LG3A 2CH0A 2H8RA 4ZDPA 3BG9A 4C3IJ 1FMVA 1L0OC 4L5EA 2ACJA 3OYJA 2DDAA 2RDPA 2VOOA 3K1PA 4GO1A 4HF0A 2JPBA 1U5TC 3FISA 1T95A 3IAS2 4LG0B 3HHGA 2GAUA 4P5OA 1KYWA 2K9MA 5ERIA 5EZHA 3M8JA 1GHCA 5FRMA 2WAQN 2O8KA 1A36A 4WXHA 3ASNH 2XB0X 2A6HF 3TW6A 3FXMA 2PI0A 3LSHA 1OJLA 2IGOA 2P0WA 2YS9A 1VQ5I 3N4MA 3GW2A 4YFNF 3JRBA 4ZYEA 1DU6A 3ZQFA 1SEUA 2ZNZA 2BBYA 5BPDA 2I8DA 3CCUI 1U8RA 4ZTJA 4L9TA 3PFIA 2ZC2A 3BTJA 2DJIA 3I54A 3WTVC 3L9FA 3CP8A 3E5XA 3JTHA 4BQQA 1SAXA 4L9VA 1EJ9A 4BDYA 3OL3A 4L9JA 5GTIC 2HYFA 2M5WA 3CJTB 1PJRA 3EUKL 2L01A 3ZQ7A 3AFHA 1IJWC 1GDTA 1OCPA 2LK2A 5DD8A 3U9GA 2PMZA 1UG2A 2EH3A 1RPWA 5DV5A 1ZARA 1XMXA 4OMYA 2OZUA 2QBYB 2R7UA 4JOMA 2FMLA 2BHYA 1YJWI 2MBFA 1E3PA 3DKWA 3IRRA 2Z16A 2NNYA 1JGSA 4IPAA 2R93J 3CF2A 3BT9A 2HVSA 1TWAJ 2BZTA 2A6EF 3KEQA 1OCRH 3HOYJ 4X6AJ 3PUFA 2XROA 1X1CA 2JA2A 3K1NA 4N4NB 3OYAA 4GRIA 3F23A 1Z7LA 5LD2C 3S1QJ 2CYYA 2E19A 1MD0A 2LKXA 1OKRA 1GLNA 2MSYA 4XLFA 4A3IJ 2DOEA 3E0JB 5FKOA 4IHXA 3C3WA 1MSFC 1VQNI 3C7JA 4XK4A 3DBRB 3CLQA 4LLLA 2VB6A 3ZQGA 4ENNA 3PFYA 4CDGA 1U9NA 4RGRA 2DFEA 4A3DJ 1W7PD 4KMUX 3TW7A 3R0AA 2HGCA 4ABZA 2R4GA 2KPMA 2CO5A 4I09A 4DZJA 3S14J 1W36C 1LFUP 2X51A 1B72A 2L9VA 3AAFA 1QZYA 3OY9A 4CCKA 5IP9J 3ZQIA 1TWFJ 4M6XA 1WH7A 1VQ9I 2HOSA 1OYIA 4U88A 2QQ8A 3CZ6A 4U7DA 3L2QA 4FE4A 3OL4A 3WTSC 2JVHA 2A69F 3TL4X 5L3FA 1H9GA 2L4AA 4KYWA 3HUGA 3CP2A 2NAZA 1R49A 2IS1A 2P6SA 2Y9ZA 1D3YA 2P4WA 1REPC 2KRFA 3LNQA 4BE1A 3I3LA 2WAEA 3HSRA 4I76A 3DBLB 2M3AA 5FLXK 3EYYA 1KU7A 3F8MA 1C0WA 3CCYA 2R7QA 1J59A 2OQGA 3GVAA 3RI4A 4E7KA 2F4OB 2FA5A 1SD4A 3KP6A 4QPQA 4DYQA 4OAYA 3QU6A 4DBQA 1APLC 4LGWA 4PGHA 5EDNA 2K4BA 2F5VA 2IA2A 2HNHA 2P7VB 4PFPA 2A5YB 2K9LA 5DTDA 3I71A 2JA6J 1WJCA 2M87A 3A0BC 4L18B 3I58A 4C2MJ 2VOPA 1MW7A 1WWXA 2NOJB 3CDIA 2H94A 3FBNB 4OIRF 2UV1A 3L2WA 4R1HA 3E6BA 1DP3A 1SMTA 4MFDA 4HF2A 1U78A 1HDPA 3DPLC 3K70D 4G7ZF 3R60A 4OOIA 2LBFB 3BTIA 2OCCH 2E36A 4A93J 2PQ8A 2Q2EB 1STZA 3WHCA 2HFHA 3BR5A 3HRMA 1TWHJ 1B8IB 2RVCA 4XBFA 5L3BA 3F22A 4YFXF 3K0LA 3S15J 2VQGA 3ECOA 4BQAA 1JJ6C 4CCJA 2CQ7A 2I10A 5CJ9A 2BV6A 3WHBA 4KN7X 3HYIA 2V4JC 3S2WA 1VQ4I 3FXUA 2XDVA 3OYIA 4KA4A 5J1UA 2LD5A 4BHBA 1MMDA 4ESFA 2WB1A 1J0RA 3VPRA 3CTAA 1FNNA 1XD7A 4MFEA 3S3NA 3KPHA 1MDMB 2PN6A 4BDZA 1B4AA 3HGGA 3C18A 3I4PA 2ZO4A 1J75A 3GCMA 3RTRA 5C4JJ 5GTHC 5IOZA 4Z2YA 2R7SA 1U5TB 2KIFA 3RYRA 2V1NA 5JHFA 2OA4A 4DGWB 1O4XA 1RZ4A 2XSJC 5J3LA 2GA1A 3GF2A 5D5UB 5CVJA 2VQCA 3HIFA 5FRNA 3K69A 4RGSA 1NTCA 4LFUA 4EM1A 4G8XA 1EH6A 1WI9A 2VI6A 2HTJA 1VI0A 4DYRA 2DDBA 4ZJZA 4P96A 3CMEI 3ZN0A 3GXOA 3V4GA 2I5UA 3KCCA 3V8LA 3VB2A 4BGDA 5J1RA 1NG6A 4BY7J 3HKZN 3E1SA 4C9YA 1IN6A 3HJEA 3X2QH 4MIMA 2DYSH 1UZCA 1TNSA 2FNPA 2XAGA 4PZJA 1Y39A 2X1DA 3UNGC 2JPCA 5JLWA 3FXOA 1HF0A 1R1TA 4ITVA 1QZEA 2CUZA 2ISYA 4PDKA 1ZR4A 3I9V2 1FBSA 4V19K 3U2RA 1HDDC 1FWZA 2EV6A 3L09A 3E7LA 1IXRC 4E4HA 5CQEA 1Y1VJ 3G1OA 1A5JA 1MNMC 1VQPI 1DPRA 4RAYA 3RSNA 4KT6A 4EGYA 5F0CA 2KLOA 4ZC3A 1I5ZA 1KQ8A 2FF4A 2PFBA 2K86A 5F08A 3FX3A 4I98B 3J7AY 2DI3A 2CSOA 1BL0A 1Z91A 4IRHA 2YUSA 4BUPA 2CQKA 1AU7A 1D1CA 3OYCA 4Y17A 4A5NA 2YX4A 3SJMA 2ZXHA 3N05A 5FGMA 2UXXA 3MAJA 3LAPA 1PUFB 1RKTA 2D1VA 4E7LA 3CC4I 2O5RA 4CA0A 1S9HA 3GTMJ 1BI0A 3ML6A 4HV5A 2DA3A 2PMZN 2MABA 4BXUA 2R7VA 4OWRB 2JSPA 4RM2A 1RUNA 2VN2A 1LE8B 4H4KC 4F3QA 2KQRA 3H3VK 2VBYA 2ZJ2A 1I39A 3FIWA 3RJPA 1ZYRF 4QWQA 2FMYA 1ZK8A 2VE8A 3CDHA 4MGRA 1M1EB 4IHYA 4RMNA 3LA7A 3S2HJ 3CUOA 4HSTA 2GIZA 3NAUA 4KISA 2NVUB 2ESNA 3BG7A 3IRQA 1LFPA 4NB5A 2V26A 4XM3A 3R61A 2ICWG 3K4BA 4M3FA 1D5VA 4Q48A 2J5PA 1HKQA 1WJBA 4I01A 3PIOF 5F1JA 1YW8A 3MMYB 3ZOBA 2PJPA 1TLHB 3FKIJ 5E20A 2B7EA 2V6EA 4CH7A 3CJNA 3A4CA 4M3EA 5F6FA 1B59A 1RESA 2PLYA 2JA8J 3FMQA 2EIKH 3W6JB 3PUBA 4XRSG 1V5GA 4Y7NJ 2DXIA 1XCVA 1KQ9A 3VYRB 2M45A 4UXNA 4PJJA 3MZHA 2ZJQF 1IUFA 2VKDA 3WTZA 4G7HF 3S3OA 3DEUA 3QPHA 2X1EA 2F4IA 2OV7A 2R7DA 1FJLA 3OV8A 3FF5A 1MBGA 4XNFA 1FC3A 1Z67A 3OIQA 2A5WA 1P2FA 4UB6C 5HDKA 1I1GA 3H92A 5FO5A 3K4JA 1JKQC 1ZGWA 5LRRA 2W84A 1R36A 2HQNA 1KA8A 4R79A 4CCOA 1ZGJA 2FXAA 2LLKA 3W2VA 2M0MA 3ZR8X 1X3UA 3PQKA 1YI2I 3ERMA 1K7AA 5TISC 4HX4A 4BH9A 3CCQI 3ROUA 2RKHA 2W48A 1LQ1A 2B63J 5FD6A 1LDDA 2EV5A 2MYSA 3V7CA 3F8CA 3PNYA 2YU3A 2MD5A 3OYDA 1S7AA 2QF7A 4IHTA 1IXCA 3CO6C 2FSWA 3IWZA 3WTXC 2JVGA 4EMSA 4WCGA 1F4KA 2BXYA 3ZQLA 4M72A 2XUBA 1IZ1A 1S7EA 2JJ7A 4LLGF 5JI6A 4M3DA 1XC5A 4D9JA 4ZDOA 2DK5A 2Q0OA 5HDNA 4BE2A 4CHUA 2HOAA 4E6KG 1I6HJ 1R6RA 2O0YA 4IXAA 4MQVA 1FYKA 2K5CA 1RETA 4QTRA 3RZOJ 5E1ZB 3DXJF 2HTSA 1FP2A 3DKYA 3FK7A 3M9AA 1K6YA 2EFOA 2XVCA 4FETA 3GTPJ 3HOVJ 3KLNA 1WQ2A 3PM1A 3Q0WA 1BJZA 1U8BA 5EJCA 2TCTA 2X4HA 2LH9A 3LSGA 4U0VA 1AWCA 4FE7A 2BY1A 4DZPA 2RNJA 1D5YA 2O3FA 3QP6A 4WX9A 2P8TA 1MIJA 4HF1A 3JW4A 1B72B 3ERED 2X48A 2X1CA 1ZG3A 3TP3A 4EGZA 3U21A 3WU2C 1JE8A 1XSVA 4IRGA 3G2BA 4S0HB 2VBXA 2Y0SN 3G1LA 5A2QZ 3GEZA 3AG1H 4MHGA 3CDLA 2LYCA 3F72A 5EG0A 3HUGB 2LOOA 3R0JA 5LRSA 2ZJRF 3MQ0A 2WY7Q 3FDYA 5CVUA 4YEJA 1BC8C 1TT5B 2ELKA 3IH4A 2ECCA 1MBFA 1TWGJ 3CUQA 4E7IA 1CF7A 2VE9A 2IGNA 3KYCB 5KHDA 3ULQB 5F64A 3RPUD 3AG2H 1Z9CA 3G71I 1FOKA 3OYLA 4MEYF 2LMDA 2RREA 1A6QA 3GBGA 2XPWA 2Y30A 2AXTC 1LEAA 1ZRDA 1VZ0A 2YR2A 3C2BA 1Y8RB 1MGTA 3E6DA 3M1CA 4Q5SF 2CW0F 1IN8A 3OYGA 2V6CA 4GCVA 3T0YA 2IA0A 2P5VA 3OYNA 2XAHA 3QODA 1VQOI 4G6TB 1D0YA 4F7ZA 2WWYA 1HSJA 2GXGA 1BC7C 2PJRA 3DLAA 1R4MB 1OCOH 1QPMA 3SQNA 4AVPA 4IHWA 4RAFA 4C3HJ 1DPUA 2L7KA 5DCMA 3JRAA 2DQLA 5E3OA 4CYCA 1S5LC 2QLZA 1RR8C 2LRDA 5A2QK 4HQEA 1Z0XA 4FCYA 4XLPF 1R1VA 1ORKA 3DV8A 3TOBA 3ELKA 3LSMA 4ANJA 4YIFA 5LBQA 2P7CB 3WTUC 1E0EA 3P7NA 2F6CA 3E6MA 2DA6A 2ADUA 3M1EA 3QOPA 2VT3A 3JAMZ 4G94A 3LSKA 1JXSA 2Q1ZB 2IGMA 5E3LA 2VC1A 5FD5A 4CYDA 4DIQA 2HWVA 3BQYA 4B44A 1VQ6I 1FBQA 2IEKA 2NYXA 1HSTA 4PUSA 4F93B 3HGYA 1RR7A 2JTVA 3LQRA 5LGTA 2L7MP 1QGPA 1I6XA 3BJAA 3TP0A 5L3CA 3CCSI 3DEEA 1D1BA 3CCLI 2GM4A 3SEQA 2JZYA 4ZZLA 2IT0A 1WPKA 3NWSA 1OFCX 1VQ7I 3TO9A 4IKFA 1T33A 4HDVA 2Y0MA 1ZTRA 6PAXA 3S16J 5LGNA 1IUYA 2MLGA 3DTEA 1E2XA 1TBXA 4ESBA 3GLXA 2GQQA 4XOPA 2VXDA 4LLNA 2HOTA 4ON0A 2XPVA 1X3WB 3Q9SA 3LSRA 4L9NA 2NVQJ 2TDXA 1FMWA 3GTGJ 2N8GA 1GV5A 4A3EJ 1MH4A 1QQIA 2HQAA 3KEYA 5FB2A 5LHGA 1P92A 3KFWX 1K79A 3G1MA 3OIPA 2E7XA 3BR2A 1R9TJ 1QVTA 5L3GA 3GYHX 3G4SI 3VFZA 1ZLJA 3J7YJ 4AWXB 4RBOA 1R00A 2CRGA 3SXYA 4I02A 1KZHA 4F91B 3JAMK 1WKMA 2O7OA 2VT2A 3HPHA 4RAGA 4UNOA 2FBHA 2M2EA 4CGZA 1AKHA 3LQQA 4ASNA 4XSXF 2K27A 4MTDA 4CXFA 5KAFC 1Z77A 2EV0A 3H35A 4LOCA 4Y13A 5K5RA 1WJFA 3CLOA 4GDFA 4NC7A 4ZYHA 2OCEA 1B6AA 3ECHA 3IKTA 3UR3C 3I56I 1O3TA 3W2WA 1HCRA 4PSWA 1OISA 1BR4A 4J00A 4NQWA 2L9SA 5FKKA 5F1RA 1LPQA 3BR6A 1DUXC 1T8IA 5DS9A 2ZXWH 3RIRA 3KP4A 5BQTA 3CUQC 3RDIA 2Q8KA 3E5QA 1UHSA 3P9CA 4XKBA 3OR2C 1IG7A 1SMYF 3WU1B 4OAZA 2MH2A 4EM0B 5IP7J 2IGKA 3BJOA 1S8NA 3QYFA 4EJOA 2FOKA 2DW4A 2VKEA 1MMNA 3OOPA 2LNBA 1UAAA 5DDGA 2E60A 3BY6A 2XAUA 4OIOF 2WAFA 2QQ9A 2DOAA 2E71A 2X6WA 1N77A 1W7PA 2F5EA 2RGVA 1T98A 3F9KA 5J8CA 1K4TA 1EA3A 1HKSA 5K5QA 2DMNA 1DU0A 2QSGX 3AG3H 5FLXZ 3LA2A 4RS8A 4D0PA 3QYEA 2FNAA 3KP7A 4F52A 1T08B 3NARA 3L2RA 2BE5F 4CUGA 2JN6A 5J8FA 1DQUA 3IWFA 1DGWY 3K2AA 2CW7A 2E5ZA 2VASA 1Y8QB 2V9VA 4BL0B 4EEFG 4RGXA 3IH3A 2HXOA 2QYOA 5K7HA 5D5VB 1EKEA 4QLCU 2E1CA 1OCTC 2AHQA 3SZTA 4L5IA 3BTCA 4FX0A 5TGTA 3REOA 2VQLA 2XASA 2UXNA 2XGXA 4E7HA 5BOXA 5CYVA 4HDUA 1Y6IA 3HL2A 3TOAA 2B0LA 3IP4B 1S72I 4UUTA 2LP0A 4MNUA 4FQGA 4WK8F 3ZP5A 3BCAA 4RA2A 1FSHA 1Z3XA 4U0YA 2HDWA 4XLHA 2RV8A 1TQPA 3QAHA 4L0ZB 4XMYA 4KT5C 2KP6A 2ZJPF 4KJZA 2CUFA 2V1XA 3D5RC 5FKNA 3FZVA 1I1SA 3GX4X 2LKSA 3W6KB 2IW5A 2ZB9A 4WWCA 1XSDA 1Q1HA 1YX3A 3CCEI 3IHUA 1A6IA 3TEDA 4I2OA 2A68F 1WI3A 2DT6A 3BTLA 2KISA 4M6YA 4EV0A 1SFXA 4XRFA 2BXZA 2VQHA 2QUFA 2VL8A 4OMZA 2A3SA 2OJED 3GFMA 2EFWA 1R5ID 1B9MA 1YG2A 4JBAA 2DA1A 4A0ZA 2F4MB 4B09A 1P9QC 5CVVA 4AIKA 3S2DJ 3BJ6A 2ME0A 2XGDA 3S32A 5IPAA 5HS9A 3HHHA 3P9IA 2WTEA 1MSEC 2JQ7A 2ZXJA 4LK0F 1BOBA 1S6LA 2W00A 4Y33A 4HSRA 5HS8A 3HG9A 1U6GA 4MO7A 2R7RA 1V5FA 5IOYA 2IA1A 4UVAA 4FASD 2GIVA 2E2IJ 4IOAF 5E8GA 1V4RA 3PNVA 4YRVA 1IO2A 3OOUA 4HLXA 3NWTA 1R1UA 3VYSB 2ID6A 1HLVA 2E1MC 3HM5A 3M8EA 4GYIA 3KZIC 3KIOA 2WY8Q 4M6VA 5ICEA 5LFAA 3OYMA 1JI8A 2STWA 3JRFA 3FHZA 4YIIA 1SFEA 5E3MA 3FMRA 1D8JA 3U1DA 1N75A 3F8FA 3D1NI 4AC0A 1TQMA 2LF8A 3VEPA 2IVMA 1OR7A 3JRDA 2LG4A 3EYIA 3HRTA 4HPQA 4BQNA 2HEOA 2M9HA 3GTQJ 4P55A 3ZMZA 4BY1J 4Z6YA 3AG4H 3F3XA 1UG0A 3M07A 3WGHA 2QZ8A 2XGEA 3TDUC 2YPRA 1O7LA 1G2HA 3DP7A 2BY3A 4R8HA 3L2VA 5EEHA 3JR9A 4IJAA 2KIMA 1R5HA 4PCQA 1MJ9A 5BNGA 4QPOA 3F8BA 2WV0A 2F5FA 2M8EA 2WADA 5L3DA 5IYCJ 3WODF 1FOYA 2ZMEA 2BYVE 2EBIA 3TQNA 2IP2A 3MZ8A 4HEA2 2JK3A 2K9QA 5CLSA 1MBKA 3SEZA 4IQ4A 1WGXA 3HSFA 4Y3OA 1MJAA 3H5NA 2W25A 4H0EA 1P7IA 3HTSB 1HW1A 3DEWA 1HC8A 3SDBA 2RQPA 1EH7A 1VF9A 4AYBN 4WF2A 2Z2SB 1HW2A 2CQXA 3BOQA 2L9NA 5IP6A 2AQFA 2Y31A 1LDKB 4XOTA 3SHFA 2LR8A 3MZYA 2DTRA 5EG0B 3PL8A 3BPVA 1FYLA 4BS9A 1X1DA 1NHAA 3B73A 5DUKA 1X2MA 4ZDLA 3RQIA 1CF7B 3CUQB 1FLIA 1QVUA 2ZFUA 2G7HA 5GAEJ 2IJLA 3ZMVA 2RQQA 4UY8I 5EGOA 4LK1F 4ENMA 3MD2A 2O03A 1YO5C 4UUSA 4HAMA 4ENKA 3K4CA 5M5WJ 3FXQA 3W6VA 1ONVA 2FU4A 5JFRA 4BJTA 5DD4A 3VYTB 4F55A 4RB3C 3FXJA 1XDSA 4KNYA 5K7FA 4L0YB 1QO0D 2AXLA 2K40A 2LFBA 2HZDA 4ETSA 1XX5A 2BW3A 2EB7A 3K9TA 2H09A 5D5WB 1XS9A 4UUVA 2ZXIA 4LB5A 5IT9K 3L1PA 2LREA 3IUOA 3CMMA 1ZG1A 4RAZA 3HOWJ 3P9KA 1BM9A 5AIQA 1ACIA 3CO7C 1B1BA 3K70C 1YRNA 2R7TA 1UMQA 5DCMB 1BR1A 1XMKA 4IRIA 1F36A 4KIFA 5KNLA 2R0QC 2OD5A 4HNVA 4B43A 3JCUC 2QM3A 4NC6A 5BMZA 5BPIA 5GPAA 1NH3A 4ENJA 3RKWA 1Y0NA 3IH2A 5JVTA 2CQQA 3RPQA 4BBSJ 4X1EA 2L7FP 3SFIA 4RB2C 1QHGA 1MBEA 3CMYA 3S1MJ 2P81A 1SC7A 2L4MA 3TMOA 3MEXA 3EQLF 4HQMA 3TKYA 1F43A 2QCOA 4C30A 1JKRC 1B9NA 4O3MA 1OR7C 3BCBA 4E7JA 1FP1D 3O3KA 4LD5A 1JHHA 4P1WA 2DA2A 1ZAOA 2LF7A 2KDOA 4BHCA 2K7LA 2LKPA 4BU2A 1OQYA 3FXKA 1PUEE 3T1BA 4W97A 1FZPB 1Z6RA 1RUOA 3ESWB 1HBXG 1MBHA 2LY2A 1WJEA 1H0MA 2Z9OA 1WH5A 1T38A 3CCVI 1FBUA 3HTUA 2Z99A 5B5EC 3FMSA 2HS5A 3BWGA 1MH3A 1UHWA 2MLKA 2XPUA 2HQRA 2VIXA 2ZMEC 5B3SH 1Z3YA 3FXRA 3KE2A 1SFOJ 1LNWA 1QNTA 3BLYA 3DFGA 1P4AA 1ETQA 3V7RA 4P9UA 1H89C 4PFOA 3DKXA 1WRJA 3FBIB 2GLOA 5E17F 1WCMJ 2DMPA 1FX7A 1X4PA 3H9GA 3VSKA 3EDPA 2R5YA 2E1MB 3D5SC 2AS5F 1AKHB 1X1AA 3C2GA 1ZGAA 5M5XJ 3H5AA 4HYEA 4B3AA 3J7AO 1MMSA 3RYPA 2ZKZA 2RNGA 3B02A 4GYGA 4AVZA 2A61A 5D6EA 2L2OA 5EEAA 3RKQA 4XICA 3OSGA 5GAHJ 1SVLA 4PJMA 1IAWA 2L5QA 2M7AA 1PDNC 4NQWB 4D5FA 4RB0A 1OYWA 1RIOH 1BIBA 3GLLA 1KU9A 3I0TA 5LGUA 3DLLF 3A0HC 2E7WA 2HR3A 4WXCA 3HPGA 2IXSA 4HX7A 1NK3P 3FK6A 2A05A 3JTGA 2K02A 1QRYA 1UHMA 2EIJH 2HXIA 3GMEA 3GFIA 1E3HA 5ICCA 1W0UA 2A6TA 3F6OA 1ZREA 1JTYA 4XIDA 3KEOA 1F5TA 1LB2A 1YYVA 1VQ8I 3ZXSA 1XMAA 4AD9A 1W7PB 4NBQA 4BACA 1VQMI 2DLLA 5D4SA 4KMFA 4RDUA 3E97A 2NS0A 4ZYGA 2DPUA 3I64A 4HOBA 2DCEA 3IL2A 4GFBA 1EF4A 4FX4A 3OYEA 3PO2J 1MJBA 4WXDA 3J80K 2VBZA 1FEXA 2EA4A 4IO9F 3TO6A 1SVMA 3IKVA 2CG4A 2D1HA 5LLQA 5HDGA 1BI3A 1T0FA 1B8IA 2M34A 2DMUA 4M9XA 1TZLA 3GZ5A 3KZZA 5GADJ 1DP7P 2HU9A 3GFJA 4MTEA 3ZGKA 2NNNA 4I6ZA 1NG7A 3F6VA 5D5XB 2DO7A 2NVYJ 1ZG5A 3OIOA 2MA3A 3E3VA 5D4RA 4IEJA 4O6JA 1FTZA 2WB1N 1ZKGA 3RPUA 1MDMA 1PVEA 3H1CA 5J4YA 2V7FA 3CF5F 1ETOA 2DN0A 3ABLH 4MLOA 5DYMA 1U5TA 3CCJI 4OIQF 2O6GE 4MEXF 2PG4A 2Z33A 3M4OJ 3H36A 2HYJA 4J01A 4G7OF 2H1LA 3OYKA 3PO3J 1ZRFA 4V2GA 1V54H 4HNUA 1D0ZA 1FTTA 2KZGA 2ELJA 2R92J 3CD6I 2F5CA 1U3EM 5K7ZA 1Y1WJ 1IRXA 4PJNA 4LB6B 5LHHA 1WJDA 2DA5A 3BR0A 5EYRA 2X6YA 3ZPLA 2JMWA 3WG9A 2X6OA 4PJLA 4KITB 1TP4A 2BOLA 1KYZA 3MKYB 2E2HJ 3OYFA 2GOMA 5J1YA 2Z1DA 3DQVC 4O5VA 4EJWA 1G3SA 4KFCA 3ZMUA 2B9SA 5CPRB 1R58A 3NRVA 2DAOA 1XN7A 2OQRA 1W0TA 1K83J 3ABTA 3IAM2 3KP2A 5CVIA 4UVCA 1XPXA 5EEGA 1IF1A 2FRHA 2AQEA 2VLAA 4IF4A 2C6YA 2XIGA 5DCFA 5E1XA 3T5XA 3ZCOA 2FUG2 2K3PA 3WTTC 3L2CA 4A3FJ 4C2UA 2DTZA 4KN4X 3A1YA 3KP3A 1XCBA 3HB9A 2KFDA 1U9OA 1YIJI 4A0XA 2RC4A 4CZZA 2OZ6A 1J5YA 3M3YJ 1O7FA 2PMUA 4A6DA 1YTYA 2OF7A 4EJUA 3EETA 2L02A 3PSFA 2P5KA 3PJRA 1YIOA 4IHSA 2P6TA 2FQ4A 4XRSA 3SDGA 1P6RA 1IW7F 5J40A 4JX4A 2ZFWA 3TBIA 5TRDA 5DUIA 1JT6A 1IN4A 1JKPC 3CC2I 1RRJA 4IHVA 2PBIA 4IL6C 2EFQA 3OS2A 2EZLA 1X58A 2E1OA 1X3ZB 4LITA 3KYLA 4AUXA 4EJTA 1D8KA 2UWMA 2R5ZA 5FFXA 1H88C 1WZ2A 2E1NA 2ZMEB 3H5RA 2XKOA 4XKCA 5K5OA 2G9WA 3EUAA 4N0BA 3BZKA 3J81K 2V79A 1IRGA 1IDZA 3R6SA 1Z7UA 2VUMJ 1E3OC 2YSRA 3DBHB 3C1DA 4LIUA 1U2WA 4ZYAA 3G3ZA 2XF5A 4BKXA 5HS7A 1WFXA 3JRHA 5FROA 2STTA 1H9TA 5E1WA 1P7JA 4PSXA 2DA7A 4A3LJ 2L0KA 2F5DA 1OCZH 4F92B 1T0FC 5ED4A 2JA5J 4BHPA 1VQKI 2D2WA 4HRIA 3ZMSA 2ID3A 2MC4A 1KU3A 3E5UA 1UJ8A 2CW8A 3A02A 4ESJA 1R4NB 1PP8F 2H6BA 2CWEA 3BQZA 3S3MA 1W36D 1ETKA 2QKMB 2VC0A 1ZHFA 4XLAA 3FKJA 2X9DA 3V8JA 3RKYA 3I4NJ 2VKVA 2JUGA 2Y48A 2COMA 3A01A 2EJRA 1LVAA 2CU7A 5CKTA 3LWFA 5D8KB 1O3RA 2QWWA 5HNFA 3QRFF 2IS2A 5IYDJ 5EGOB 2XSDC 2IS6A 1N78A 2ZNYA 1XSXA 5FFZA 4NUBA 4UUSB 1K78A 4A3CJ 3IC7A 2GXAA 1JUPA 4PGGA 4W1UA 5FKMA 2E35A 3HOUJ 3DF8A 4A3MJ 3EPZA 4HBLA 4XLNF 1W5SA 2LY1A 5E8IA 5E18F 5C3EJ 2RAEA 1I27A 2BW3B 3ASOH 2E34A 2NS7A 2DFIA 1HW5A 2DA4A 2MGQA 1RC9A 2K9NA 3FM5A 3RZDJ 1YRNB 2EZHA 2FJ1A 1OMIA 2XRLA 1X2NA 3I4MJ 3L7WA 3OYBA 1LDJA 1SFKA 4E7ZA 3JREA 5F0FA 2HVQA 3AL0C 2VODA 2H27A 2DJNA 1X4OA 2GWRA 1X1PA 1SANA 1D1AA 3KYDB 2XF7A 3CCRI 2LY9A 3LSPA 1UCRA 2XF6A 3LL7A 2QSFX 2E2JJ 1AOYA 4QIWN 4X0GA 3BR1A 4HA8A 4M3GA 2CV0A 3GTOJ 5ICGA 4K2EA 1TW3A 3K4LA 2IS4A 3TGNA 1A31A 1S29A 4V2FA 3FM3A 4G6QA 2G7UA 2JUCA 4AU7A 5FLVA 4KUMA 3GTLJ 4A0YA 4D5CA 5JLXA 2A07F 4HV6A 5FLMJ 2HZTA 1XDUA 3MKWB 1HXDA 1JHFA 4IX7A 3P5JA 3I5UA 4UHTA 5M5YJ 2K85A 4BNCA 3L2UA 5LEKA 2EPFA 1EV7A 2LSOA 4CSWA 3SZGA 2IRFG 4A3GJ 2XHKA 5F04A 2QEXI 2BY2A 4LIVA 5LHIA 4BEHA 1TQIA 2BGCA 3E6CC 1L3LA 5KK1A 1GUUA 5FJ8J 1GXPA 3F0CA 1QZZA 2X85A 3HZJA 4N9IA 1ENHA 4C3JJ 2O61A 1IV6A 2FE3A 2FOWA 4KIGA 4XR6A 5HLHA 1W4MA 3Q9VA 1POGA 4JX6A 4A3KJ 4D7NA 1JUMA 1YLFA 5HOOA 4B3XA 1ZN2A 1GV2A 4A3JJ 1J7KA 3M7GA 2R3SA 5ILSA 4S04A 2HQ5A 3OWTA 3PNTA 2BEOA 1S7OA 3DPTA 1ODDA 2R5YB 4EQQA 1BIAA 3ZQCA 2CV2A 1OYYA 4FT8A 1I50J 3CJQB 3FWEA 5IY5H 5KCMA 2W7NA 2XAQA 4D1QA 3N97A 2QSHX 4I7HA 3W3CA 1G4DA 3HRSA 4HX8A 3JSOA 4XLEA 3EUHA 4BJ5C 3WGIA 2PMHA 1BR2A 4BYYA 4NNJA 2IAIA 4CICA 4FTHA 4AIJA 2E5NA 1Z6TA 4DOZA 4JX5A 2BHZA 1V5EA 4I0BA 2CS3A 4NC8A 2M4GA 1F1ZA 4U7BA 3MN2A 3ZRGA 4JYKA 1JJ8C 3D0SA 2M0CA 2VPRA 1SFUA 3VYUB 2VPLA 2EILH 1QU3A 2R7XA 2FBIA 1SD6A 4B1RA 1WSUA 4C2TA 1JUSA 4IZZA 2NS8A 1MNEA 4J19A 3S17J 3B6CA 2DBBA 3M8FA 2ISZA 3MWMA 4XN0A 1LJ9A 2HKOA 2X6XA 1FY7A 5EF6A 3BC8A 3ZMDA 3I59A 1CGPA 4AIHA 1USTA 4BBRJ 3FHNA 2DQRA 1ZELA 1BJAA 1R23A 1FOXA 3ABMH 3W2AA 1V3FA 2DMQA 4MQ9F 4EVIA 4XKVA 3GUDA 1WJAA 2KT0A 4XL9A 2KKOA 4IQJA 3I53A 1XGMA 1QHHD 3GZ6A 1CQTA 1J9IA 2D45A 1KONA 1YW7A 2VJ5A 2O8XA 4FISA 3JSPA 1GXQA 2ZCWA 3QQAA 5M3FJ 1ITYA 2GA2A 4Y4RA 2M30A 4NDLA 3K7AJ 1MMAA 1IN7A 3QPSA 2KRHA 3TO7A 3G73A 3WE2A 1KGSA 1J09A 2KJBA 5IT9Z 4D7MA 4RGUA 2MW8A 2ZSIB 1GT0C 4UVBA 2LC2A 4XKWA 2P5LC 1G8XA 5E3NA 2DT7B 4E7SA 4A2UA 1ETVA 4M71A 3HSEA 3PSIA 1Z1DA 2XV4S 2FQ3A 3ONQA 1U0JA 2Y0SA 3VODA 3HOTA 5B1AH 2WC2A 2KHMA 2L54A 1YX5A 4HZFA 4M74A 4EJVA 2M1BA 5D6FA 1ZLKA 2K9SA 2X0LA 1XGOA 3HBLA 1VQLI 1LEBA 1ULYA 3OSFA 3DU6A 3C2HA 2JWTA 5B66C 2H6CA 1G3TA 3BROA 1WJ5A 1OLTA 5KVRA 3H0DA 1IC8A 5GAGJ 4G9YA 3S1RJ 3GZNB 1W5CC 4I99C 4I0AA 2YU9J 2O9LA 1R7JA 5HNHA 2EWNA 1JT0A 4U87A 5JR3A 3I55I 1O57A 3K4MA 1YOVB 1YJ9I 3BG5A 4LG0A 3SZPA 2ZBKA 3BG3A 1F9NA 1N25A 2MG4A 1ZRCA 1E17A 2EK5A 5GP9A 2XB5A 2ECBA 1J2XA 3AL0B 3CMAI 1JGGA 2KRCA 2HOEA 3MVPA 5J47A 2L9RA 1QPIA 1FIAA 4S05A 4U0WA 2COBA 1IV8A 3TDZC 3F8NA 2HDDA 3J7ZI 2DMTA 4RM3A 3VDXA 1TNTA 3O6BB 4HNTA 2PJRB 2FD5A 4Y15A 1BOAA 1UELB 2QKLB 2MFZA 5DM7F 4A12A 1YS7A 3K1MA 2LTPA 1RKWA 4N9HA 3LFUA 3QWLA 3V7SA 3EUHC 2NOGA 4DJAA 4CYCB 1G3YA 4Q47A 4JP0A 5E79C 4BQOA 1KQ0A 5H6RA 3WE3A 5C44J 2CV1A 3ABKH 2F48A 5J4VA 2CQNA 5HVQC 1ZQ3P 3K4KA 1JKOC 1PP7U 1VNDA 4XSZF 3VWBA 2EZKA 2Y9YA 2NRAC 1HOMA 4GXOA 2L7ZA 1TWCJ 3VSLA 3UKGA 2QBYA 3DCFA 1T56A 3OS1A 1YJNI 4CZCA 1YFHA 3VOEA 4HLYA 5B1BH 4ZH4F 2M4KA 3ZQHA 2MC3A 3BZ6A 1YHQI 1HA8A 2F2EA 1MMGA 3HDDA 1S3JA 2DPDA 2PEXA 5H2FC 2R5ZB 2QENA 2HPIA 1XG1A 2EQRA 3CC7I 3NEUA 3O2PE 4JQFA 1FIPA 2VONA 2CMPA 5HLIA 5AONA 3HEFA 3HXLA 4A6EA 2XRNA 2YX7A 1OPCA 1RI7A 5ICFA 1W1WE 4FHTA 3HOZJ 4YFKF 3ISPA 4Y52J 2V9KA 1K61A 5HLTA 2XGCA 1UB9A 3KX2A 3T8TA 4EM2A 3ABUA 2K4JA 2GOXB 2XAJA 1TW2A 5LEJA 1QBJA 2H1KA 5CVRA 3FXLA 3LFKA 4RLQA 2Z5UA 1O3QA 3QU3A 3V42A 2DU9A 1TL8A 2LDUA 2Y69H 4YELA 1I3QJ 2CJJA 5GPCA 4CCNA 3ZN1A 3LA3A 4E70A 1YW9A 4ZZDA 2OTLI 5K1YA 2WAQA 2L3DA 3Q0VA 3DTIA 2ESHA 3K10A 1ZH5A 2HKXA 2W24A 4DYCA 2R7FA 2W85A 1IDYA 2UZKA 3J80Z 4DW6A 2GBYA 1Z05A
chains in the Genus database with same CATH topology
2RN7A 3KETA 1ON1A 3NQOA 4UV8A 4LJZF 4GGGA 2IPQX 3LSTA 1Y0UA 1MZBA 3HRUA 1USSA 2EA2A 4KICA 3WTYC 1IN5A 3LAJA 1K78B 3SFZA 1O3SA 5IT3A 3K2ZA 1P4XA 1T6SA 2EFPA 3V8KA 1HKTA 1SD5A 1G6NA 2DT5A 2JT1A 4B8XA 5ILVA 3GWZA 3PQJA 4DQ2A 2KIUA 4TV7A 1MKMA 2OAZA 2XAFA 4M73A 2FEZA 2CFXA 1ON2A 2JSCA 2QVOA 1FYMA 2OBPA 4M9SA 5HLGA 4IVNA 4KDPA 1R22A 2Z3YA 1T39A 4UV9A 4OU0A 4M9ZA 2Q2EA 1RNLA 3WU0A 4JK1X 2ETHA 2Y75A 4P9FA 1SD7A 1K6OA 3MCZA 1HQCA 3R4KA 4OIPF 1BN5A 3KZYA 5H6QA 1W5TA 5DEQA 1BBYA 1IRFA 5L3EA 1DDNA 2QQAA 2J5OA 4NHJA 4KIBA 1R5GA 3H3ZA 3GO5A 2XKPA 4L5JA 3BP8A 2VBWA 5BS6A 1GVJA 4RB1A 2CGPA 1FPQA 4BAYA 4G6DA 4YG2F 5TJJA 4ZYDA 2EFNA 3J81Z 2W57A 1FSEA 3T8RA 2OU2A 2HYGD 1BI1A 3COAC 1YS6A 1XB4A 2JRTA 1A04A 1IXSB 4OINF 3GFLA 1XGNA 1TTYA 3ZMTA 3QPTA 4DNCA 2VXZA 1FT9A 2FBKA 5J6XA 3H3UA 3BPXA 3I59B 5AIPA 1EH8A 2GZWA 3WTWC 1P4WA 4Q4ZF 5D8LB 2V1DA 1T2KA 5JHUA 3BDDA 5H20A 1YQAA 2DK8A 3D5LA 3KLOA 2GXBA 1UFMA 3RKXA 1XGSA 4A5MA 1BI2A 1G3WA 2KJCA 4CO8A 3F21A 2MH9A 3Q5FA 3KP5A 3WGGA 2V1UA 5ILUA 4HW0A 2ELHA 3HOSA 3QP5A 1KU2A 1VTNC 3MFKA 3L00A 2QQBA 2HDCA 4LMYA 1L0OC 2ACJA 2RDPA 2VOOA 3K1PA 4GO1A 4HF0A 2JPBA 1U5TC 4LG0B 3HHGA 2GAUA 4P5OA 1KYWA 5ERIA 1GHCA 4WXHA 2A6HF 2PI0A 3N4MA 3GW2A 4YFNF 4ZYEA 2ZNZA 2BBYA 5BPDA 1U8RA 4L9TA 3PFIA 3WTVC 3I54A 3L9FA 3E5XA 3JTHA 1SAXA 4L9VA 4L9JA 2HYFA 2M5WA 2L01A 3ZQ7A 5DD8A 3U9GA 5DV5A 1ZARA 4OMYA 2OZUA 2QBYB 2FMLA 2MBFA 3DKWA 3IRRA 2NNYA 1JGSA 4IPAA 2A6EF 3KEQA 2XROA 3K1NA 3F23A 2CYYA 1MD0A 1OKRA 3C3WA 3C7JA 4LLLA 4ENNA 4CDGA 4RGRA 1W7PD 4KMUX 3R0AA 2HGCA 2CO5A 4I09A 3AAFA 1QZYA 4M6XA 1OYIA 4U88A 4U7DA 3WTSC 2A69F 5L3FA 1H9GA 2L4AA 4KYWA 3HUGA 2NAZA 2P6SA 1D3YA 2P4WA 1REPC 2KRFA 3HSRA 5FLXK 3EYYA 1KU7A 3F8MA 1C0WA 1J59A 2OQGA 3GVAA 3RI4A 2FA5A 1SD4A 3KP6A 3QU6A 4LGWA 4PGHA 2K4BA 2IA2A 2P7VB 2A5YB 3I71A 2M87A 4L18B 3I58A 2VOPA 1WWXA 2H94A 4OIRF 4R1HA 3E6BA 1SMTA 4HF2A 1U78A 3DPLC 4G7ZF 3R60A 4OOIA 2PQ8A 1STZA 2HFHA 3HRMA 2RVCA 4XBFA 5L3BA 3F22A 4YFXF 3K0LA 3ECOA 4BQAA 5CJ9A 2BV6A 4KN7X 3HYIA 3S2WA 3FXUA 4KA4A 4BHBA 4ESFA 1J0RA 3CTAA 1FNNA 1XD7A 1MDMB 2PN6A 1B4AA 3I4PA 3C18A 1J75A 2ZO4A 3RTRA 4Z2YA 1U5TB 2KIFA 3RYRA 2OA4A 1RZ4A 2GA1A 3GF2A 5D5UB 5CVJA 3HIFA 3K69A 4RGSA 4LFUA 4EM1A 4G8XA 1EH6A 1WI9A 2HTJA 4P96A 3ZN0A 3GXOA 3V4GA 3KCCA 3V8LA 3VB2A 1IN6A 1TNSA 2FNPA 2XAGA 4PZJA 2JPCA 1R1TA 2ISYA 4PDKA 1FBSA 3U2RA 1FWZA 2EV6A 3L09A 1IXRC 1DPRA 4RAYA 4EGYA 1I5ZA 1KQ8A 2FF4A 2PFBA 2K86A 3FX3A 4I98B 2DI3A 2CSOA 1Z91A 4IRHA 2CQKA 4Y17A 4A5NA 2YX4A 5FGMA 2UXXA 3MAJA 3LAPA 2D1VA 1BI0A 3ML6A 4HV5A 4BXUA 1RUNA 2VN2A 2VBYA 2ZJ2A 3RJPA 1ZYRF 4QWQA 2FMYA 2VE8A 3CDHA 4MGRA 3LA7A 3CUOA 2ESNA 3IRQA 4NB5A 3R61A 1D5VA 4Q48A 2J5PA 1HKQA 4I01A 1YW8A 2PJPA 1TLHB 5E20A 3CJNA 5F6FA 1B59A 2PLYA 3FMQA 3W6JB 1XCVA 1KQ9A 2M45A 4UXNA 3MZHA 3WTZA 4G7HF 3DEUA 3QPHA 2R7DA 3OV8A 3FF5A 1FC3A 1P2FA 5HDKA 1I1GA 3H92A 5FO5A 5LRRA 2W84A 1R36A 2HQNA 1KA8A 4R79A 1ZGJA 2FXAA 1X3UA 3PQKA 1K7AA 4HX4A 4BH9A 3ROUA 2RKHA 1LQ1A 5FD6A 1LDDA 2EV5A 3V7CA 3F8CA 2YU3A 2MD5A 1S7AA 4IHTA 1IXCA 3CO6C 2FSWA 3IWZA 3WTXC 4EMSA 4WCGA 1F4KA 4M72A 1IZ1A 2XUBA 4LLGF 5JI6A 2DK5A 2Q0OA 5HDNA 4CHUA 2O0YA 4IXAA 1FYKA 4MQVA 5E1ZB 3DXJF 2HTSA 1FP2A 3M9AA 2EFOA 2XVCA 3KLNA 1WQ2A 2X4HA 4U0VA 1AWCA 2RNJA 2O3FA 3QP6A 4WX9A 2P8TA 4HF1A 3JW4A 3ERED 1ZG3A 4EGZA 1JE8A 1XSVA 4IRGA 2VBXA 5A2QZ 3GEZA 4MHGA 3F72A 3R0JA 5LRSA 3MQ0A 5CVUA 1BC8C 1CF7A 3CUQA 2VE9A 3ULQB 5F64A 1Z9CA 1FOKA 4MEYF 1LEAA 1ZRDA 2YR2A 1MGTA 3E6DA 4Q5SF 2CW0F 1IN8A 2V6CA 4GCVA 3T0YA 2IA0A 2P5VA 2XAHA 4F7ZA 2WWYA 1HSJA 2GXGA 1BC7C 3SQNA 1QPMA 4AVPA 1DPUA 5DCMA 2DQLA 2QLZA 5A2QK 4HQEA 4XLPF 1R1VA 3DV8A 3TOBA 3ELKA 4YIFA 5LBQA 2P7CB 3WTUC 3P7NA 3E6MA 2ADUA 3M1EA 3QOPA 2VT3A 3JAMZ 4G94A 1JXSA 2VC1A 5FD5A 4CYDA 2HWVA 1FBQA 2NYXA 1HSTA 2JTVA 3LQRA 5LGTA 1QGPA 1I6XA 3BJAA 5L3CA 4ZZLA 2JZYA 2IT0A 3TO9A 4HDVA 2Y0MA 6PAXA 5LGNA 1IUYA 2MLGA 1E2XA 1TBXA 4ESBA 3GLXA 2GQQA 4LLNA 4ON0A 3Q9SA 4L9NA 2TDXA 1QQIA 5FB2A 5LHGA 1P92A 3KFWX 1K79A 2E7XA 5L3GA 3GYHX 3VFZA 1ZLJA 4AWXB 1R00A 3SXYA 4I02A 3JAMK 1WKMA 2VT2A 4UNOA 2FBHA 4CGZA 3LQQA 4ASNA 4XSXF 2K27A 4MTDA 4CXFA 2EV0A 4Y13A 5K5RA 3CLOA 4ZYHA 1B6AA 3ECHA 3IKTA 1O3TA 4NQWA 5F1RA 1DUXC 3RIRA 3KP4A 5BQTA 3CUQC 3RDIA 2Q8KA 3E5QA 3P9CA 1SMYF 3WU1B 4EM0B 2MH2A 3BJOA 1S8NA 4EJOA 2FOKA 2DW4A 3OOPA 2LNBA 5DDGA 3BY6A 4OIOF 2QQ9A 1W7PA 2F5EA 2RGVA 5J8CA 1T98A 1HKSA 5K5QA 5FLXZ 3LA2A 4RS8A 4D0PA 2FNAA 3KP7A 2BE5F 5J8FA 3IWFA 2V9VA 4RGXA 2QYOA 5D5VB 4QLCU 2E1CA 3SZTA 4L5IA 4FX0A 3REOA 2XASA 2UXNA 2XGXA 5BOXA 5CYVA 4HDUA 3TOAA 2B0LA 4MNUA 4WK8F 3ZP5A 1FSHA 4U0YA 2RV8A 1TQPA 3QAHA 4L0ZB 4KT5C 2V1XA 1I1SA 3FZVA 3GX4X 4WWCA 3W6KB 2IW5A 1XSDA 1Q1HA 3IHUA 4I2OA 2A68F 4M6YA 4EV0A 1SFXA 4XRFA 2QUFA 4OMZA 2A3SA 3GFMA 2EFWA 1B9MA 1YG2A 4JBAA 4B09A 4A0ZA 5CVVA 4AIKA 3BJ6A 5HS9A 3HHHA 3P9IA 2WTEA 2ZXJA 4LK0F 1S6LA 5HS8A 1U6GA 2IA1A 4UVAA 2GIVA 5E8GA 1V4RA 4HLXA 1R1UA 4GYIA 3M8EA 5ICEA 2STWA 3FHZA 4YIIA 1SFEA 1D8JA 3FMRA 3U1DA 3F8FA 1TQMA 2LF8A 3VEPA 2IVMA 1OR7A 3EYIA 3HRTA 2HEOA 4P55A 3ZMZA 3F3XA 3WGHA 2QZ8A 3TDUC 2YPRA 1O7LA 3DP7A 4R8HA 5EEHA 4IJAA 2KIMA 1R5HA 4PCQA 1MJ9A 3F8BA 2WV0A 2F5FA 2M8EA 5L3DA 3WODF 2ZMEA 2BYVE 3TQNA 2IP2A 5CLSA 3HSFA 1MJAA 2W25A 4H0EA 3HTSB 1HW1A 2RQPA 1EH7A 1HW2A 4WF2A 3BOQA 1LDKB 3SHFA 3MZYA 2DTRA 3BPVA 1FYLA 1NHAA 3B73A 5DUKA 1CF7B 3CUQB 1FLIA 2G7HA 2IJLA 3ZMVA 4LK1F 4ENMA 2O03A 1YO5C 4HAMA 4ENKA 3FXQA 1ONVA 2FU4A 5JFRA 5DD4A 4RB3C 1XDSA 4KNYA 4L0YB 1QO0D 2AXLA 4ETSA 3K9TA 2EB7A 5IT9K 2H09A 5D5WB 4UUVA 4LB5A 1ZG1A 4RAZA 3P9KA 1BM9A 5AIQA 3CO7C 1B1BA 5DCMB 1XMKA 4IRIA 4KIFA 2OD5A 2QM3A 5BMZA 5BPIA 4ENJA 3RKWA 5JVTA 3RPQA 4RB2C 2L4MA 3MEXA 3EQLF 4HQMA 3TKYA 1B9NA 4O3MA 1FP1D 3O3KA 4LD5A 1JHHA 1ZAOA 2LF7A 4BHCA 2K7LA 2LKPA 1PUEE 3T1BA 1FZPB 1Z6RA 1RUOA 1HBXG 1H0MA 2Z9OA 1T38A 1FBUA 3HTUA 2Z99A 3FMSA 2HS5A 3BWGA 1UHWA 2MLKA 2HQRA 3FXRA 3KE2A 1LNWA 1QNTA 3DFGA 1P4AA 4P9UA 3V7RA 1WRJA 5E17F 1FX7A 3EDPA 2AS5F 1ZGAA 4HYEA 3J7AO 3RYPA 2ZKZA 3B02A 4GYGA 2A61A 5D6EA 1IAWA 1PDNC 4RB0A 1OYWA 1RIOH 1BIBA 1KU9A 3I0TA 5LGUA 2E7WA 2HR3A 4WXCA 4HX7A 3JTGA 2K02A 1UHMA 3GFIA 5ICCA 3F6OA 1ZREA 3KEOA 1F5TA 1LB2A 1YYVA 1XMAA 4AD9A 1W7PB 2DLLA 5D4SA 4KMFA 3E97A 2NS0A 4ZYGA 2DPUA 3I64A 4HOBA 3IL2A 4FX4A 1MJBA 4WXDA 3J80K 2VBZA 2EA4A 3TO6A 3IKVA 2CG4A 2D1HA 5LLQA 5HDGA 1BI3A 1T0FA 4M9XA 3GZ5A 3KZZA 1DP7P 3GFJA 4MTEA 2NNNA 3F6VA 5D5XB 2DO7A 1ZG5A 2MA3A 3E3VA 5D4RA 4O6JA 3RPUA 1MDMA 5DYMA 1U5TA 4OIQF 2O6GE 4MEXF 2PG4A 2Z33A 4G7OF 1ZRFA 2F5CA 1U3EM 4LB6B 5LHHA 3ZPLA 3WG9A 1KYZA 3DQVC 4O5VA 4EJWA 1G3SA 4KFCA 3ZMUA 1R58A 3NRVA 2DAOA 1XN7A 2OQRA 3ABTA 5CVIA 3KP2A 4UVCA 1IF1A 5EEGA 2C6YA 2FRHA 4IF4A 2XIGA 5DCFA 5E1XA 3T5XA 3WTTC 3L2CA 4KN4X 3KP3A 1XCBA 4A0XA 2RC4A 4CZZA 2OZ6A 1J5YA 1O7FA 2PMUA 4A6DA 1YTYA 4EJUA 3EETA 2L02A 2P5KA 1YIOA 4IHSA 2P6TA 1P6RA 1IW7F 2ZFWA 5TRDA 5DUIA 1IN4A 2PBIA 2EFQA 4EJTA 1D8KA 2UWMA 5FFXA 2E1NA 2ZMEB 2XKOA 5K5OA 3J81K 2G9WA 4N0BA 2V79A 1IRGA 3R6SA 1Z7UA 2YSRA 3C1DA 1U2WA 3G3ZA 5HS7A 2STTA 1H9TA 5E1WA 2F5DA 5ED4A 4BHPA 2D2WA 3ZMSA 1KU3A 3E5UA 4ESJA 1PP8F 2H6BA 2CWEA 2VC0A 1ZHFA 3V8JA 3RKYA 2Y48A 2COMA 2EJRA 1LVAA 5D8KB 3LWFA 1O3RA 2QWWA 3QRFF 2ZNYA 1XSXA 5FFZA 1K78A 3IC7A 4PGGA 3DF8A 4HBLA 4XLNF 1W5SA 5E18F 5E8IA 1I27A 2DFIA 1HW5A 3FM5A 1OMIA 3L7WA 1LDJA 2VODA 2H27A 2GWRA 1UCRA 1AOYA 4HA8A 5ICGA 4K2EA 1TW3A 3TGNA 1S29A 3FM3A 4G6QA 2G7UA 4KUMA 4A0YA 2A07F 4HV6A 2HZTA 1XDUA 1HXDA 1JHFA 3I5UA 4UHTA 4BNCA 5LEKA 1EV7A 2LSOA 2IRFG 2XHKA 5LHIA 1TQIA 2BGCA 3E6CC 1L3LA 5KK1A 1GXPA 1QZZA 4N9IA 2O61A 2FE3A 4KIGA 5HLHA 1W4MA 3Q9VA 1YLFA 5HOOA 1ZN2A 1J7KA 3M7GA 2R3SA 5ILSA 4S04A 2BEOA 1S7OA 3DPTA 1ODDA 4EQQA 1BIAA 1OYYA 4FT8A 3FWEA 2XAQA 3N97A 4I7HA 1G4DA 3HRSA 4HX8A 3JSOA 3EUHA 3WGIA 2PMHA 4BYYA 4CICA 4AIJA 1Z6TA 4I0BA 1F1ZA 4U7BA 3D0SA 1SFUA 2FBIA 1SD6A 1WSUA 2DBBA 3M8FA 2ISZA 3MWMA 1LJ9A 2HKOA 1FY7A 3ZMDA 3I59A 1CGPA 4AIHA 1USTA 2DQRA 1BJAA 1R23A 1V3FA 4EVIA 4MQ9F 3GUDA 2KKOA 3I53A 1XGMA 3GZ6A 1J9IA 2D45A 1YW7A 2O8XA 3JSPA 1GXQA 2ZCWA 2GA2A 2M30A 1IN7A 3G73A 3TO7A 3WE2A 1KGSA 2KJBA 5IT9Z 4RGUA 4UVBA 2P5LC 4A2UA 4M71A 3HSEA 1Z1DA 2XV4S 2FQ3A 3VODA 3HOTA 2WC2A 2L54A 4M74A 4HZFA 4EJVA 2M1BA 5D6FA 1ZLKA 2X0LA 1XGOA 1LEBA 1ULYA 2H6CA 1G3TA 3BROA 5KVRA 4G9YA 4I0AA 1R7JA 2EWNA 5JR3A 1O57A 4LG0A 3SZPA 2ZBKA 1F9NA 1ZRCA 1E17A 2EK5A 1J2XA 2HOEA 4S05A 4U0WA 3TDZC 3F8NA 1TNTA 3O6BB 4Y15A 1BOAA 4A12A 1YS7A 3K1MA 4N9HA 3V7SA 1G3YA 4Q47A 1KQ0A 5H6RA 3WE3A 5HVQC 1PP7U 4XSZF 2NRAC 4GXOA 2QBYA 1YFHA 3VOEA 4HLYA 4ZH4F 2MC3A 3BZ6A 2F2EA 1S3JA 2DPDA 2PEXA 2QENA 3NEUA 3O2PE 4JQFA 2VONA 5HLIA 5AONA 4A6EA 2XRNA 2YX7A 1OPCA 1RI7A 5ICFA 4FHTA 4YFKF 3ISPA 1UB9A 3T8TA 4EM2A 3ABUA 2K4JA 5LEJA 2XAJA 1TW2A 1QBJA 5CVRA 3LFKA 2Z5UA 1O3QA 3QU3A 2DU9A 2LDUA 3ZN1A 3LA3A 4E70A 1YW9A 4ZZDA 5K1YA 2L3DA 2ESHA 1ZH5A 2HKXA 2W24A 2R7FA 2W85A 2UZKA 3J80Z 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN7 A;  3KET A;  1ON1 A;  3NQO A;  4UV8 A;  4LJZ F;  4GGG A;  2IPQ X;  3LST A;  1Y0U A;  1MZB A;  3HRU A;  1USS A;  2EA2 A;  4KIC A;  3WTY C;  1IN5 A;  3LAJ A;  1K78 B;  3SFZ A;  1O3S A;  5IT3 A;  3K2Z A;  1P4X A;  1T6S A;  2EFP A;  3V8K A;  1HKT A;  1SD5 A;  1G6N A;  2DT5 A;  2JT1 A;  4B8X A;  5ILV A;  3GWZ A;  3PQJ A;  4DQ2 A;  2KIU A;  4TV7 A;  1MKM A;  2OAZ A;  2XAF A;  4M73 A;  2FEZ A;  2CFX A;  1ON2 A;  2JSC A;  2QVO A;  1FYM A;  2OBP A;  4M9S A;  5HLG A;  4IVN A;  4KDP A;  1R22 A;  2Z3Y A;  1T39 A;  4UV9 A;  4OU0 A;  4M9Z A;  2Q2E A;  1RNL A;  3WU0 A;  4JK1 X;  2ETH A;  2Y75 A;  4P9F A;  1SD7 A;  1K6O A;  3MCZ A;  1HQC A;  3R4K A;  4OIP F;  1BN5 A;  3KZY A;  5H6Q A;  1W5T A;  5DEQ A;  1BBY A;  1IRF A;  5L3E A;  1DDN A;  2QQA A;  2J5O A;  4NHJ A;  4KIB A;  1R5G A;  3H3Z A;  3GO5 A;  2XKP A;  4L5J A;  3BP8 A;  2VBW A;  5BS6 A;  1GVJ A;  4RB1 A;  2CGP A;  1FPQ A;  4BAY A;  4G6D A;  4YG2 F;  5TJJ A;  4ZYD A;  2EFN A;  3J81 Z;  2W57 A;  1FSE A;  3T8R A;  2OU2 A;  2HYG D;  1BI1 A;  3COA C;  1YS6 A;  1XB4 A;  2JRT A;  1A04 A;  1IXS B;  4OIN F;  3GFL A;  1XGN A;  1TTY A;  3ZMT A;  3QPT A;  4DNC A;  2VXZ A;  1FT9 A;  2FBK A;  5J6X A;  3H3U A;  3BPX A;  3I59 B;  5AIP A;  1EH8 A;  2GZW A;  3WTW C;  1P4W A;  4Q4Z F;  5D8L B;  2V1D A;  1T2K A;  5JHU A;  3BDD A;  5H20 A;  1YQA A;  2DK8 A;  3D5L A;  3KLO A;  2GXB A;  1UFM A;  3RKX A;  1XGS A;  4A5M A;  1BI2 A;  1G3W A;  2KJC A;  4CO8 A;  3F21 A;  2MH9 A;  3Q5F A;  3KP5 A;  3WGG A;  2V1U A;  5ILU A;  4HW0 A;  2ELH A;  3HOS A;  3QP5 A;  1KU2 A;  1VTN C;  3MFK A;  3L00 A;  2QQB A;  2HDC A;  4LMY A;  1L0O C;  2ACJ A;  2RDP A;  2VOO A;  3K1P A;  4GO1 A;  4HF0 A;  2JPB A;  1U5T C;  4LG0 B;  3HHG A;  2GAU A;  4P5O A;  1KYW A;  5ERI A;  1GHC A;  4WXH A;  2A6H F;  2PI0 A;  3N4M A;  3GW2 A;  4YFN F;  4ZYE A;  2ZNZ A;  2BBY A;  5BPD A;  1U8R A;  4L9T A;  3PFI A;  3WTV C;  3I54 A;  3L9F A;  3E5X A;  3JTH A;  1SAX A;  4L9V A;  4L9J A;  2HYF A;  2M5W A;  2L01 A;  3ZQ7 A;  5DD8 A;  3U9G A;  5DV5 A;  1ZAR A;  4OMY A;  2OZU A;  2QBY B;  2FML A;  2MBF A;  3DKW A;  3IRR A;  2NNY A;  1JGS A;  4IPA A;  2A6E F;  3KEQ A;  2XRO A;  3K1N A;  3F23 A;  2CYY A;  1MD0 A;  1OKR A;  3C3W A;  3C7J A;  4LLL A;  4ENN A;  4CDG A;  4RGR A;  1W7P D;  4KMU X;  3R0A A;  2HGC A;  2CO5 A;  4I09 A;  3AAF A;  1QZY A;  4M6X A;  1OYI A;  4U88 A;  4U7D A;  3WTS C;  2A69 F;  5L3F A;  1H9G A;  2L4A A;  4KYW A;  3HUG A;  2NAZ A;  2P6S A;  1D3Y A;  2P4W A;  1REP C;  2KRF A;  3HSR A;  5FLX K;  3EYY A;  1KU7 A;  3F8M A;  1C0W A;  1J59 A;  2OQG A;  3GVA A;  3RI4 A;  2FA5 A;  1SD4 A;  3KP6 A;  3QU6 A;  4LGW A;  4PGH A;  2K4B A;  2IA2 A;  2P7V B;  2A5Y B;  3I71 A;  2M87 A;  4L18 B;  3I58 A;  2VOP A;  1WWX A;  2H94 A;  4OIR F;  4R1H A;  3E6B A;  1SMT A;  4HF2 A;  1U78 A;  3DPL C;  4G7Z F;  3R60 A;  4OOI A;  2PQ8 A;  1STZ A;  2HFH A;  3HRM A;  2RVC A;  4XBF A;  5L3B A;  3F22 A;  4YFX F;  3K0L A;  3ECO A;  4BQA A;  5CJ9 A;  2BV6 A;  4KN7 X;  3HYI A;  3S2W A;  3FXU A;  4KA4 A;  4BHB A;  4ESF A;  1J0R A;  3CTA A;  1FNN A;  1XD7 A;  1MDM B;  2PN6 A;  1B4A A;  3I4P A;  3C18 A;  1J75 A;  2ZO4 A;  3RTR A;  4Z2Y A;  1U5T B;  2KIF A;  3RYR A;  2OA4 A;  1RZ4 A;  2GA1 A;  3GF2 A;  5D5U B;  5CVJ A;  3HIF A;  3K69 A;  4RGS A;  4LFU A;  4EM1 A;  4G8X A;  1EH6 A;  1WI9 A;  2HTJ A;  4P96 A;  3ZN0 A;  3GXO A;  3V4G A;  3KCC A;  3V8L A;  3VB2 A;  1IN6 A;  1TNS A;  2FNP A;  2XAG A;  4PZJ A;  2JPC A;  1R1T A;  2ISY A;  4PDK A;  1FBS A;  3U2R A;  1FWZ A;  2EV6 A;  3L09 A;  1IXR C;  1DPR A;  4RAY A;  4EGY A;  1I5Z A;  1KQ8 A;  2FF4 A;  2PFB A;  2K86 A;  3FX3 A;  4I98 B;  2DI3 A;  2CSO A;  1Z91 A;  4IRH A;  2CQK A;  4Y17 A;  4A5N A;  2YX4 A;  5FGM A;  2UXX A;  3MAJ A;  3LAP A;  2D1V A;  1BI0 A;  3ML6 A;  4HV5 A;  4BXU A;  1RUN A;  2VN2 A;  2VBY A;  2ZJ2 A;  3RJP A;  1ZYR F;  4QWQ A;  2FMY A;  2VE8 A;  3CDH A;  4MGR A;  3LA7 A;  3CUO A;  2ESN A;  3IRQ A;  4NB5 A;  3R61 A;  1D5V A;  4Q48 A;  2J5P A;  1HKQ A;  4I01 A;  1YW8 A;  2PJP A;  1TLH B;  5E20 A;  3CJN A;  5F6F A;  1B59 A;  2PLY A;  3FMQ A;  3W6J B;  1XCV A;  1KQ9 A;  2M45 A;  4UXN A;  3MZH A;  3WTZ A;  4G7H F;  3DEU A;  3QPH A;  2R7D A;  3OV8 A;  3FF5 A;  1FC3 A;  1P2F A;  5HDK A;  1I1G A;  3H92 A;  5FO5 A;  5LRR A;  2W84 A;  1R36 A;  2HQN A;  1KA8 A;  4R79 A;  1ZGJ A;  2FXA A;  1X3U A;  3PQK A;  1K7A A;  4HX4 A;  4BH9 A;  3ROU A;  2RKH A;  1LQ1 A;  5FD6 A;  1LDD A;  2EV5 A;  3V7C A;  3F8C A;  2YU3 A;  2MD5 A;  1S7A A;  4IHT A;  1IXC A;  3CO6 C;  2FSW A;  3IWZ A;  3WTX C;  4EMS A;  4WCG A;  1F4K A;  4M72 A;  1IZ1 A;  2XUB A;  4LLG F;  5JI6 A;  2DK5 A;  2Q0O A;  5HDN A;  4CHU A;  2O0Y A;  4IXA A;  1FYK A;  4MQV A;  5E1Z B;  3DXJ F;  2HTS A;  1FP2 A;  3M9A A;  2EFO A;  2XVC A;  3KLN A;  1WQ2 A;  2X4H A;  4U0V A;  1AWC A;  2RNJ A;  2O3F A;  3QP6 A;  4WX9 A;  2P8T A;  4HF1 A;  3JW4 A;  3ERE D;  1ZG3 A;  4EGZ A;  1JE8 A;  1XSV A;  4IRG A;  2VBX A;  5A2Q Z;  3GEZ A;  4MHG A;  3F72 A;  3R0J A;  5LRS A;  3MQ0 A;  5CVU A;  1BC8 C;  1CF7 A;  3CUQ A;  2VE9 A;  3ULQ B;  5F64 A;  1Z9C A;  1FOK A;  4MEY F;  1LEA A;  1ZRD A;  2YR2 A;  1MGT A;  3E6D A;  4Q5S F;  2CW0 F;  1IN8 A;  2V6C A;  4GCV A;  3T0Y A;  2IA0 A;  2P5V A;  2XAH A;  4F7Z A;  2WWY A;  1HSJ A;  2GXG A;  1BC7 C;  3SQN A;  1QPM A;  4AVP A;  1DPU A;  5DCM A;  2DQL A;  2QLZ A;  5A2Q K;  4HQE A;  4XLP F;  1R1V A;  3DV8 A;  3TOB A;  3ELK A;  4YIF A;  5LBQ A;  2P7C B;  3WTU C;  3P7N A;  3E6M A;  2ADU A;  3M1E A;  3QOP A;  2VT3 A;  3JAM Z;  4G94 A;  1JXS A;  2VC1 A;  5FD5 A;  4CYD A;  2HWV A;  1FBQ A;  2NYX A;  1HST A;  2JTV A;  3LQR A;  5LGT A;  1QGP A;  1I6X A;  3BJA A;  5L3C A;  4ZZL A;  2JZY A;  2IT0 A;  3TO9 A;  4HDV A;  2Y0M A;  6PAX A;  5LGN A;  1IUY A;  2MLG A;  1E2X A;  1TBX A;  4ESB A;  3GLX A;  2GQQ A;  4LLN A;  4ON0 A;  3Q9S A;  4L9N A;  2TDX A;  1QQI A;  5FB2 A;  5LHG A;  1P92 A;  3KFW X;  1K79 A;  2E7X A;  5L3G A;  3GYH X;  3VFZ A;  1ZLJ A;  4AWX B;  1R00 A;  3SXY A;  4I02 A;  3JAM K;  1WKM A;  2VT2 A;  4UNO A;  2FBH A;  4CGZ A;  3LQQ A;  4ASN A;  4XSX F;  2K27 A;  4MTD A;  4CXF A;  2EV0 A;  4Y13 A;  5K5R A;  3CLO A;  4ZYH A;  1B6A A;  3ECH A;  3IKT A;  1O3T A;  4NQW A;  5F1R A;  1DUX C;  3RIR A;  3KP4 A;  5BQT A;  3CUQ C;  3RDI A;  2Q8K A;  3E5Q A;  3P9C A;  1SMY F;  3WU1 B;  4EM0 B;  2MH2 A;  3BJO A;  1S8N A;  4EJO A;  2FOK A;  2DW4 A;  3OOP A;  2LNB A;  5DDG A;  3BY6 A;  4OIO F;  2QQ9 A;  1W7P A;  2F5E A;  2RGV A;  5J8C A;  1T98 A;  1HKS A;  5K5Q A;  5FLX Z;  3LA2 A;  4RS8 A;  4D0P A;  2FNA A;  3KP7 A;  2BE5 F;  5J8F A;  3IWF A;  2V9V A;  4RGX A;  2QYO A;  5D5V B;  4QLC U;  2E1C A;  3SZT A;  4L5I A;  4FX0 A;  3REO A;  2XAS A;  2UXN A;  2XGX A;  5BOX A;  5CYV A;  4HDU A;  3TOA A;  2B0L A;  4MNU A;  4WK8 F;  3ZP5 A;  1FSH A;  4U0Y A;  2RV8 A;  1TQP A;  3QAH A;  4L0Z B;  4KT5 C;  2V1X A;  1I1S A;  3FZV A;  3GX4 X;  4WWC A;  3W6K B;  2IW5 A;  1XSD A;  1Q1H A;  3IHU A;  4I2O A;  2A68 F;  4M6Y A;  4EV0 A;  1SFX A;  4XRF A;  2QUF A;  4OMZ A;  2A3S A;  3GFM A;  2EFW A;  1B9M A;  1YG2 A;  4JBA A;  4B09 A;  4A0Z A;  5CVV A;  4AIK A;  3BJ6 A;  5HS9 A;  3HHH A;  3P9I A;  2WTE A;  2ZXJ A;  4LK0 F;  1S6L A;  5HS8 A;  1U6G A;  2IA1 A;  4UVA A;  2GIV A;  5E8G A;  1V4R A;  4HLX A;  1R1U A;  4GYI A;  3M8E A;  5ICE A;  2STW A;  3FHZ A;  4YII A;  1SFE A;  1D8J A;  3FMR A;  3U1D A;  3F8F A;  1TQM A;  2LF8 A;  3VEP A;  2IVM A;  1OR7 A;  3EYI A;  3HRT A;  2HEO A;  4P55 A;  3ZMZ A;  3F3X A;  3WGH A;  2QZ8 A;  3TDU C;  2YPR A;  1O7L A;  3DP7 A;  4R8H A;  5EEH A;  4IJA A;  2KIM A;  1R5H A;  4PCQ A;  1MJ9 A;  3F8B A;  2WV0 A;  2F5F A;  2M8E A;  5L3D A;  3WOD F;  2ZME A;  2BYV E;  3TQN A;  2IP2 A;  5CLS A;  3HSF A;  1MJA A;  2W25 A;  4H0E A;  3HTS B;  1HW1 A;  2RQP A;  1EH7 A;  1HW2 A;  4WF2 A;  3BOQ A;  1LDK B;  3SHF A;  3MZY A;  2DTR A;  3BPV A;  1FYL A;  1NHA A;  3B73 A;  5DUK A;  1CF7 B;  3CUQ B;  1FLI A;  2G7H A;  2IJL A;  3ZMV A;  4LK1 F;  4ENM A;  2O03 A;  1YO5 C;  4HAM A;  4ENK A;  3FXQ A;  1ONV A;  2FU4 A;  5JFR A;  5DD4 A;  4RB3 C;  1XDS A;  4KNY A;  4L0Y B;  1QO0 D;  2AXL A;  4ETS A;  3K9T A;  2EB7 A;  5IT9 K;  2H09 A;  5D5W B;  4UUV A;  4LB5 A;  1ZG1 A;  4RAZ A;  3P9K A;  1BM9 A;  5AIQ A;  3CO7 C;  1B1B A;  5DCM B;  1XMK A;  4IRI A;  4KIF A;  2OD5 A;  2QM3 A;  5BMZ A;  5BPI A;  4ENJ A;  3RKW A;  5JVT A;  3RPQ A;  4RB2 C;  2L4M A;  3MEX A;  3EQL F;  4HQM A;  3TKY A;  1B9N A;  4O3M A;  1FP1 D;  3O3K A;  4LD5 A;  1JHH A;  1ZAO A;  2LF7 A;  4BHC A;  2K7L A;  2LKP A;  1PUE E;  3T1B A;  1FZP B;  1Z6R A;  1RUO A;  1HBX G;  1H0M A;  2Z9O A;  1T38 A;  1FBU A;  3HTU A;  2Z99 A;  3FMS A;  2HS5 A;  3BWG A;  1UHW A;  2MLK A;  2HQR A;  3FXR A;  3KE2 A;  1LNW A;  1QNT A;  3DFG A;  1P4A A;  4P9U A;  3V7R A;  1WRJ A;  5E17 F;  1FX7 A;  3EDP A;  2AS5 F;  1ZGA A;  4HYE A;  3J7A O;  3RYP A;  2ZKZ A;  3B02 A;  4GYG A;  2A61 A;  5D6E A;  1IAW A;  1PDN C;  4RB0 A;  1OYW A;  1RIO H;  1BIB A;  1KU9 A;  3I0T A;  5LGU A;  2E7W A;  2HR3 A;  4WXC A;  4HX7 A;  3JTG A;  2K02 A;  1UHM A;  3GFI A;  5ICC A;  3F6O A;  1ZRE A;  3KEO A;  1F5T A;  1LB2 A;  1YYV A;  1XMA A;  4AD9 A;  1W7P B;  2DLL A;  5D4S A;  4KMF A;  3E97 A;  2NS0 A;  4ZYG A;  2DPU A;  3I64 A;  4HOB A;  3IL2 A;  4FX4 A;  1MJB A;  4WXD A;  3J80 K;  2VBZ A;  2EA4 A;  3TO6 A;  3IKV A;  2CG4 A;  2D1H A;  5LLQ A;  5HDG A;  1BI3 A;  1T0F A;  4M9X A;  3GZ5 A;  3KZZ A;  1DP7 P;  3GFJ A;  4MTE A;  2NNN A;  3F6V A;  5D5X B;  2DO7 A;  1ZG5 A;  2MA3 A;  3E3V A;  5D4R A;  4O6J A;  3RPU A;  1MDM A;  5DYM A;  1U5T A;  4OIQ F;  2O6G E;  4MEX F;  2PG4 A;  2Z33 A;  4G7O F;  1ZRF A;  2F5C A;  1U3E M;  4LB6 B;  5LHH A;  3ZPL A;  3WG9 A;  1KYZ A;  3DQV C;  4O5V A;  4EJW A;  1G3S A;  4KFC A;  3ZMU A;  1R58 A;  3NRV A;  2DAO A;  1XN7 A;  2OQR A;  3ABT A;  5CVI A;  3KP2 A;  4UVC A;  1IF1 A;  5EEG A;  2C6Y A;  2FRH A;  4IF4 A;  2XIG A;  5DCF A;  5E1X A;  3T5X A;  3WTT C;  3L2C A;  4KN4 X;  3KP3 A;  1XCB A;  4A0X A;  2RC4 A;  4CZZ A;  2OZ6 A;  1J5Y A;  1O7F A;  2PMU A;  4A6D A;  1YTY A;  4EJU A;  3EET A;  2L02 A;  2P5K A;  1YIO A;  4IHS A;  2P6T A;  1P6R A;  1IW7 F;  2ZFW A;  5TRD A;  5DUI A;  1IN4 A;  2PBI A;  2EFQ A;  4EJT A;  1D8K A;  2UWM A;  5FFX A;  2E1N A;  2ZME B;  2XKO A;  5K5O A;  3J81 K;  2G9W A;  4N0B A;  2V79 A;  1IRG A;  3R6S A;  1Z7U A;  2YSR A;  3C1D A;  1U2W A;  3G3Z A;  5HS7 A;  2STT A;  1H9T A;  5E1W A;  2F5D A;  5ED4 A;  4BHP A;  2D2W A;  3ZMS A;  1KU3 A;  3E5U A;  4ESJ A;  1PP8 F;  2H6B A;  2CWE A;  2VC0 A;  1ZHF A;  3V8J A;  3RKY A;  2Y48 A;  2COM A;  2EJR A;  1LVA A;  5D8K B;  3LWF A;  1O3R A;  2QWW A;  3QRF F;  2ZNY A;  1XSX A;  5FFZ A;  1K78 A;  3IC7 A;  4PGG A;  3DF8 A;  4HBL A;  4XLN F;  1W5S A;  5E18 F;  5E8I A;  1I27 A;  2DFI A;  1HW5 A;  3FM5 A;  1OMI A;  3L7W A;  1LDJ A;  2VOD A;  2H27 A;  2GWR A;  1UCR A;  1AOY A;  4HA8 A;  5ICG A;  4K2E A;  1TW3 A;  3TGN A;  1S29 A;  3FM3 A;  4G6Q A;  2G7U A;  4KUM A;  4A0Y A;  2A07 F;  4HV6 A;  2HZT A;  1XDU A;  1HXD A;  1JHF A;  3I5U A;  4UHT A;  4BNC A;  5LEK A;  1EV7 A;  2LSO A;  2IRF G;  2XHK A;  5LHI A;  1TQI A;  2BGC A;  3E6C C;  1L3L A;  5KK1 A;  1GXP A;  1QZZ A;  4N9I A;  2O61 A;  2FE3 A;  4KIG A;  5HLH A;  1W4M A;  3Q9V A;  1YLF A;  5HOO A;  1ZN2 A;  1J7K A;  3M7G A;  2R3S A;  5ILS A;  4S04 A;  2BEO A;  1S7O A;  3DPT A;  1ODD A;  4EQQ A;  1BIA A;  1OYY A;  4FT8 A;  3FWE A;  2XAQ A;  3N97 A;  4I7H A;  1G4D A;  3HRS A;  4HX8 A;  3JSO A;  3EUH A;  3WGI A;  2PMH A;  4BYY A;  4CIC A;  4AIJ A;  1Z6T A;  4I0B A;  1F1Z A;  4U7B A;  3D0S A;  1SFU A;  2FBI A;  1SD6 A;  1WSU A;  2DBB A;  3M8F A;  2ISZ A;  3MWM A;  1LJ9 A;  2HKO A;  1FY7 A;  3ZMD A;  3I59 A;  1CGP A;  4AIH A;  1UST A;  2DQR A;  1BJA A;  1R23 A;  1V3F A;  4EVI A;  4MQ9 F;  3GUD A;  2KKO A;  3I53 A;  1XGM A;  3GZ6 A;  1J9I A;  2D45 A;  1YW7 A;  2O8X A;  3JSP A;  1GXQ A;  2ZCW A;  2GA2 A;  2M30 A;  1IN7 A;  3G73 A;  3TO7 A;  3WE2 A;  1KGS A;  2KJB A;  5IT9 Z;  4RGU A;  4UVB A;  2P5L C;  4A2U A;  4M71 A;  3HSE A;  1Z1D A;  2XV4 S;  2FQ3 A;  3VOD A;  3HOT A;  2WC2 A;  2L54 A;  4M74 A;  4HZF A;  4EJV A;  2M1B A;  5D6F A;  1ZLK A;  2X0L A;  1XGO A;  1LEB A;  1ULY A;  2H6C A;  1G3T A;  3BRO A;  5KVR A;  4G9Y A;  4I0A A;  1R7J A;  2EWN A;  5JR3 A;  1O57 A;  4LG0 A;  3SZP A;  2ZBK A;  1F9N A;  1ZRC A;  1E17 A;  2EK5 A;  1J2X A;  2HOE A;  4S05 A;  4U0W A;  3TDZ C;  3F8N A;  1TNT A;  3O6B B;  4Y15 A;  1BOA A;  4A12 A;  1YS7 A;  3K1M A;  4N9H A;  3V7S A;  1G3Y A;  4Q47 A;  1KQ0 A;  5H6R A;  3WE3 A;  5HVQ C;  1PP7 U;  4XSZ F;  2NRA C;  4GXO A;  2QBY A;  1YFH A;  3VOE A;  4HLY A;  4ZH4 F;  2MC3 A;  3BZ6 A;  2F2E A;  1S3J A;  2DPD A;  2PEX A;  2QEN A;  3NEU A;  3O2P E;  4JQF A;  2VON A;  5HLI A;  5AON A;  4A6E A;  2XRN A;  2YX7 A;  1OPC A;  1RI7 A;  5ICF A;  4FHT A;  4YFK F;  3ISP A;  1UB9 A;  3T8T A;  4EM2 A;  3ABU A;  2K4J A;  5LEJ A;  2XAJ A;  1TW2 A;  1QBJ A;  5CVR A;  3LFK A;  2Z5U A;  1O3Q A;  3QU3 A;  2DU9 A;  2LDU A;  3ZN1 A;  3LA3 A;  4E70 A;  1YW9 A;  4ZZD A;  5K1Y A;  2L3D A;  2ESH A;  1ZH5 A;  2HKX A;  2W24 A;  2R7F A;  2W85 A;  2UZK A;  3J80 Z;  1Z05 A; 
#chains in the Genus database with same CATH topology
 2RN7 A;  4UB8 C;  2VJI A;  3KET A;  3A01 B;  2FX0 A;  1ON1 A;  1D0X A;  2QGU A;  3NQO A;  4UV8 A;  4LJZ F;  2EIM H;  1SVO A;  2KZV A;  1X1B A;  4GGG A;  2IPQ X;  3LST A;  1Y0U A;  1MZB A;  3HRU A;  1USS A;  2EA2 A;  4KIC A;  3WTY C;  1IN5 A;  3LAJ A;  1K78 B;  5IYB J;  1YIT I;  3SFZ A;  4II3 A;  4XRM A;  1O3S A;  5IT3 A;  4XLC A;  1ZR2 A;  1WVR A;  3K2Z A;  1P4X A;  1OCC H;  1G59 A;  1T6S A;  1NK2 P;  2EFP A;  3V8K A;  1HKT A;  1SD5 A;  4XON A;  1G6N A;  2DT5 A;  2JT1 A;  4PJ0 C;  4B8X A;  5ILV A;  3GWZ A;  3PQJ A;  5JVG F;  3DWL E;  4DQ2 A;  3BR3 A;  2M7B A;  2KIU A;  4TV7 A;  4A69 C;  4EAT A;  3H9J A;  1MKM A;  5KAI C;  2OAZ A;  2XAF A;  2VJJ A;  2FEZ A;  4M73 A;  3RCO A;  2OTJ I;  4A3B J;  1ETY A;  2HI3 A;  2KMU A;  2CFX A;  4XN3 A;  3BZC A;  4XOR A;  4IOC F;  1ON2 A;  2JSC A;  2QVO A;  3S8P A;  1FYM A;  2OBP A;  4M9S A;  5HLG A;  3OMY A;  1PYV A;  2DOF A;  4IVN A;  3CJR B;  4KDP A;  1Z21 A;  1VFC A;  1R22 A;  3G6E I;  2Z3Y A;  1T39 A;  1DGR M;  1SAU A;  4UV9 A;  2K3F A;  4B48 A;  1I3A A;  2R7Z J;  4OU0 A;  2LBF A;  3S1N J;  4M9Z A;  2OUM A;  2Q2E A;  1RNL A;  3H0G J;  4CCM A;  3WU0 A;  1GVD A;  2UUZ A;  1BW5 A;  4JK1 X;  3JRC A;  2ETH A;  2CFO A;  2Y75 A;  2DFF A;  2BY0 A;  2ZSH B;  4P9F A;  3OYH A;  1SD7 A;  1K6O A;  2AO9 A;  3LOC A;  3MCZ A;  2R7W A;  1HQC A;  2HVR A;  3R4K A;  1AA7 A;  4BE0 A;  5F27 A;  2IBD A;  2W1O A;  4OIP F;  3CCM I;  1BN5 A;  2DYR H;  1K4S A;  2DFH A;  2H8W A;  2NXN B;  3KZY A;  5H6Q A;  3S93 A;  1W5T A;  5DEQ A;  1AHD P;  3HC7 A;  2EZI A;  1XTA A;  1BBY A;  1IRF A;  4BEH B;  5L3E A;  1DDN A;  2QQA A;  3K4N A;  2J5O A;  2W4S A;  3JRI A;  9ANT A;  4NHJ A;  2NVT J;  4KIB A;  5HOD A;  1R5G A;  4ZTF A;  3H3Z A;  2NVX J;  3GO5 A;  3DU5 A;  2XKP A;  4L5J A;  3BP8 A;  2VBW A;  5DM6 F;  1IGN A;  3LSJ A;  5BS6 A;  1GVJ A;  4RB1 A;  3GTJ J;  2CGP A;  1FPQ A;  3QOE A;  3IV5 A;  3HOX J;  2CUE A;  4RLF A;  4BAY A;  1ETX A;  2PX9 A;  4YIR X;  4G6D A;  4YG2 F;  5FKL A;  3WG7 H;  2WBM A;  5TJJ A;  4ZYD A;  2EFN A;  3J81 Z;  2W57 A;  3H9Q A;  1FSE A;  4B4C A;  3T8R A;  2KIQ A;  2OU2 A;  2HYG D;  2BVL A;  4CCL A;  1BA5 A;  1BI1 A;  2M8G X;  1BW6 A;  3COA C;  3GTK J;  2KDZ A;  1YS6 A;  4B47 A;  4M3B A;  1XB4 A;  2JRT A;  1A04 A;  1IXS B;  3QPL A;  2CUJ A;  1LKX A;  1LVK A;  2W82 A;  1ETW A;  4OIN F;  3GFL A;  1XGN A;  3Q0U A;  1TTY A;  3MKL A;  1LUJ B;  3ZMT A;  3QPT A;  2HPM A;  2ME6 A;  4N4O B;  1TT0 A;  4BJ6 C;  3SYT A;  2OPT A;  2OC6 A;  1YE9 A;  4DNC A;  2VXZ A;  5M3M J;  1FT9 A;  2DOD A;  2FBK A;  2Y2Z A;  5J6X A;  5EZG A;  4II2 A;  3B6A A;  3ZQQ A;  3JRG A;  3H3U A;  3QYB A;  3BPX A;  2TRT A;  2WA0 A;  3K6G A;  2QA4 I;  3I59 B;  3Q3S A;  2EIN H;  1R71 A;  1JTX A;  4DBR A;  3OS0 A;  5AIP A;  3AKZ A;  2XC7 A;  3RQ4 A;  3O8H A;  1EH8 A;  1MBJ A;  2GZW A;  3WTW C;  1P4W A;  3BG6 A;  4Q4Z F;  5D8L B;  1V55 H;  1LFB A;  2LVS A;  2V1D A;  1T2K A;  5JHU A;  5CQG A;  1PUF A;  3BDD A;  2G0E A;  2V9P A;  1H8A C;  3DTK A;  3O8G A;  1ERD A;  5F0H A;  5H20 A;  1YQA A;  4BXF A;  2VKH A;  1A35 A;  2DK8 A;  2JRM A;  4QSH A;  3A2K A;  3PIP F;  5C4X J;  2MD0 A;  1Q1V A;  3D5L A;  4HG2 A;  3KLO A;  2GXB A;  1LE8 A;  1UFM A;  2JA7 J;  3RKX A;  3LSI A;  4BXX J;  1XGS A;  3A03 A;  4A5M A;  1TC3 C;  1IRZ A;  1Y56 A;  2D5V A;  1BI2 A;  1G3W A;  4AID A;  2KJC A;  3U1K A;  4CO8 A;  3F21 A;  3MKZ A;  4AYB A;  2MH9 A;  3LMM A;  3CQZ J;  3Q5F A;  4AM3 A;  4G12 A;  4PK4 A;  1WHU A;  2VJ4 A;  2BVM A;  3KP5 A;  2WV1 A;  3WGG A;  2V1U A;  5ILU A;  1FOW A;  2R7O A;  4XQF A;  4HW0 A;  2ELH A;  3HOS A;  3QP5 A;  3OR1 C;  3HKZ A;  1KU2 A;  1QA6 A;  2KL4 A;  1VTN C;  1X19 A;  1MND A;  3DPU A;  3MFK A;  3L00 A;  2QQB A;  3CES A;  2HDC A;  4LMY A;  4LG3 A;  2CH0 A;  2H8R A;  4ZDP A;  3BG9 A;  4C3I J;  1FMV A;  1L0O C;  4L5E A;  2ACJ A;  3OYJ A;  2DDA A;  2RDP A;  2VOO A;  3K1P A;  4GO1 A;  4HF0 A;  2JPB A;  1U5T C;  3FIS A;  1T95 A;  3IAS 2;  4LG0 B;  3HHG A;  2GAU A;  4P5O A;  1KYW A;  2K9M A;  5ERI A;  5EZH A;  3M8J A;  1GHC A;  5FRM A;  2WAQ N;  2O8K A;  1A36 A;  4WXH A;  3ASN H;  2XB0 X;  2A6H F;  3TW6 A;  3FXM A;  2PI0 A;  3LSH A;  1OJL A;  2IGO A;  2P0W A;  2YS9 A;  1VQ5 I;  3N4M A;  3GW2 A;  4YFN F;  3JRB A;  4ZYE A;  1DU6 A;  3ZQF A;  1SEU A;  2ZNZ A;  2BBY A;  5BPD A;  2I8D A;  3CCU I;  1U8R A;  4ZTJ A;  4L9T A;  3PFI A;  2ZC2 A;  3BTJ A;  2DJI A;  3I54 A;  3WTV C;  3L9F A;  3CP8 A;  3E5X A;  3JTH A;  4BQQ A;  1SAX A;  4L9V A;  1EJ9 A;  4BDY A;  3OL3 A;  4L9J A;  5GTI C;  2HYF A;  2M5W A;  3CJT B;  1PJR A;  3EUK L;  2L01 A;  3ZQ7 A;  3AFH A;  1IJW C;  1GDT A;  1OCP A;  2LK2 A;  5DD8 A;  3U9G A;  2PMZ A;  1UG2 A;  2EH3 A;  1RPW A;  5DV5 A;  1ZAR A;  1XMX A;  4OMY A;  2OZU A;  2QBY B;  2R7U A;  4JOM A;  2FML A;  2BHY A;  1YJW I;  2MBF A;  1E3P A;  3DKW A;  3IRR A;  2Z16 A;  2NNY A;  1JGS A;  4IPA A;  2R93 J;  3CF2 A;  3BT9 A;  2HVS A;  1TWA J;  2BZT A;  2A6E F;  3KEQ A;  1OCR H;  3HOY J;  4X6A J;  3PUF A;  2XRO A;  1X1C A;  2JA2 A;  3K1N A;  4N4N B;  3OYA A;  4GRI A;  3F23 A;  1Z7L A;  5LD2 C;  3S1Q J;  2CYY A;  2E19 A;  1MD0 A;  2LKX A;  1OKR A;  1GLN A;  2MSY A;  4XLF A;  4A3I J;  2DOE A;  3E0J B;  5FKO A;  4IHX A;  3C3W A;  1MSF C;  1VQN I;  3C7J A;  4XK4 A;  3DBR B;  3CLQ A;  4LLL A;  2VB6 A;  3ZQG A;  4ENN A;  3PFY A;  4CDG A;  1U9N A;  4RGR A;  2DFE A;  4A3D J;  1W7P D;  4KMU X;  3TW7 A;  3R0A A;  2HGC A;  4ABZ A;  2R4G A;  2KPM A;  2CO5 A;  4I09 A;  4DZJ A;  3S14 J;  1W36 C;  1LFU P;  2X51 A;  1B72 A;  2L9V A;  3AAF A;  1QZY A;  3OY9 A;  4CCK A;  5IP9 J;  3ZQI A;  1TWF J;  4M6X A;  1WH7 A;  1VQ9 I;  2HOS A;  1OYI A;  4U88 A;  2QQ8 A;  3CZ6 A;  4U7D A;  3L2Q A;  4FE4 A;  3OL4 A;  3WTS C;  2JVH A;  2A69 F;  3TL4 X;  5L3F A;  1H9G A;  2L4A A;  4KYW A;  3HUG A;  3CP2 A;  2NAZ A;  1R49 A;  2IS1 A;  2P6S A;  2Y9Z A;  1D3Y A;  2P4W A;  1REP C;  2KRF A;  3LNQ A;  4BE1 A;  3I3L A;  2WAE A;  3HSR A;  4I76 A;  3DBL B;  2M3A A;  5FLX K;  3EYY A;  1KU7 A;  3F8M A;  1C0W A;  3CCY A;  2R7Q A;  1J59 A;  2OQG A;  3GVA A;  3RI4 A;  4E7K A;  2F4O B;  2FA5 A;  1SD4 A;  3KP6 A;  4QPQ A;  4DYQ A;  4OAY A;  3QU6 A;  4DBQ A;  1APL C;  4LGW A;  4PGH A;  5EDN A;  2K4B A;  2F5V A;  2IA2 A;  2HNH A;  2P7V B;  4PFP A;  2A5Y B;  2K9L A;  5DTD A;  3I71 A;  2JA6 J;  1WJC A;  2M87 A;  3A0B C;  4L18 B;  3I58 A;  4C2M J;  2VOP A;  1MW7 A;  1WWX A;  2NOJ B;  3CDI A;  2H94 A;  3FBN B;  4OIR F;  2UV1 A;  3L2W A;  4R1H A;  3E6B A;  1DP3 A;  1SMT A;  4MFD A;  4HF2 A;  1U78 A;  1HDP A;  3DPL C;  3K70 D;  4G7Z F;  3R60 A;  4OOI A;  2LBF B;  3BTI A;  2OCC H;  2E36 A;  4A93 J;  2PQ8 A;  2Q2E B;  1STZ A;  3WHC A;  2HFH A;  3BR5 A;  3HRM A;  1TWH J;  1B8I B;  2RVC A;  4XBF A;  5L3B A;  3F22 A;  4YFX F;  3K0L A;  3S15 J;  2VQG A;  3ECO A;  4BQA A;  1JJ6 C;  4CCJ A;  2CQ7 A;  2I10 A;  5CJ9 A;  2BV6 A;  3WHB A;  4KN7 X;  3HYI A;  2V4J C;  3S2W A;  1VQ4 I;  3FXU A;  2XDV A;  3OYI A;  4KA4 A;  5J1U A;  2LD5 A;  4BHB A;  1MMD A;  4ESF A;  2WB1 A;  1J0R A;  3VPR A;  3CTA A;  1FNN A;  1XD7 A;  4MFE A;  3S3N A;  3KPH A;  1MDM B;  2PN6 A;  4BDZ A;  1B4A A;  3HGG A;  3C18 A;  3I4P A;  2ZO4 A;  1J75 A;  3GCM A;  3RTR A;  5C4J J;  5GTH C;  5IOZ A;  4Z2Y A;  2R7S A;  1U5T B;  2KIF A;  3RYR A;  2V1N A;  5JHF A;  2OA4 A;  4DGW B;  1O4X A;  1RZ4 A;  2XSJ C;  5J3L A;  2GA1 A;  3GF2 A;  5D5U B;  5CVJ A;  2VQC A;  3HIF A;  5FRN A;  3K69 A;  4RGS A;  1NTC A;  4LFU A;  4EM1 A;  4G8X A;  1EH6 A;  1WI9 A;  2VI6 A;  2HTJ A;  1VI0 A;  4DYR A;  2DDB A;  4ZJZ A;  4P96 A;  3CME I;  3ZN0 A;  3GXO A;  3V4G A;  2I5U A;  3KCC A;  3V8L A;  3VB2 A;  4BGD A;  5J1R A;  1NG6 A;  4BY7 J;  3HKZ N;  3E1S A;  4C9Y A;  1IN6 A;  3HJE A;  3X2Q H;  4MIM A;  2DYS H;  1UZC A;  1TNS A;  2FNP A;  2XAG A;  4PZJ A;  1Y39 A;  2X1D A;  3UNG C;  2JPC A;  5JLW A;  3FXO A;  1HF0 A;  1R1T A;  4ITV A;  1QZE A;  2CUZ A;  2ISY A;  4PDK A;  1ZR4 A;  3I9V 2;  1FBS A;  4V19 K;  3U2R A;  1HDD C;  1FWZ A;  2EV6 A;  3L09 A;  3E7L A;  1IXR C;  4E4H A;  5CQE A;  1Y1V J;  3G1O A;  1A5J A;  1MNM C;  1VQP I;  1DPR A;  4RAY A;  3RSN A;  4KT6 A;  4EGY A;  5F0C A;  2KLO A;  4ZC3 A;  1I5Z A;  1KQ8 A;  2FF4 A;  2PFB A;  2K86 A;  5F08 A;  3FX3 A;  4I98 B;  3J7A Y;  2DI3 A;  2CSO A;  1BL0 A;  1Z91 A;  4IRH A;  2YUS A;  4BUP A;  2CQK A;  1AU7 A;  1D1C A;  3OYC A;  4Y17 A;  4A5N A;  2YX4 A;  3SJM A;  2ZXH A;  3N05 A;  5FGM A;  2UXX A;  3MAJ A;  3LAP A;  1PUF B;  1RKT A;  2D1V A;  4E7L A;  3CC4 I;  2O5R A;  4CA0 A;  1S9H A;  3GTM J;  1BI0 A;  3ML6 A;  4HV5 A;  2DA3 A;  2PMZ N;  2MAB A;  4BXU A;  2R7V A;  4OWR B;  2JSP A;  4RM2 A;  1RUN A;  2VN2 A;  1LE8 B;  4H4K C;  4F3Q A;  2KQR A;  3H3V K;  2VBY A;  2ZJ2 A;  1I39 A;  3FIW A;  3RJP A;  1ZYR F;  4QWQ A;  2FMY A;  1ZK8 A;  2VE8 A;  3CDH A;  4MGR A;  1M1E B;  4IHY A;  4RMN A;  3LA7 A;  3S2H J;  3CUO A;  4HST A;  2GIZ A;  3NAU A;  4KIS A;  2NVU B;  2ESN A;  3BG7 A;  3IRQ A;  1LFP A;  4NB5 A;  2V26 A;  4XM3 A;  3R61 A;  2ICW G;  3K4B A;  4M3F A;  1D5V A;  4Q48 A;  2J5P A;  1HKQ A;  1WJB A;  4I01 A;  3PIO F;  5F1J A;  1YW8 A;  3MMY B;  3ZOB A;  2PJP A;  1TLH B;  3FKI J;  5E20 A;  2B7E A;  2V6E A;  4CH7 A;  3CJN A;  3A4C A;  4M3E A;  5F6F A;  1B59 A;  1RES A;  2PLY A;  2JA8 J;  3FMQ A;  2EIK H;  3W6J B;  3PUB A;  4XRS G;  1V5G A;  4Y7N J;  2DXI A;  1XCV A;  1KQ9 A;  3VYR B;  2M45 A;  4UXN A;  4PJJ A;  3MZH A;  2ZJQ F;  1IUF A;  2VKD A;  3WTZ A;  4G7H F;  3S3O A;  3DEU A;  3QPH A;  2X1E A;  2F4I A;  2OV7 A;  2R7D A;  1FJL A;  3OV8 A;  3FF5 A;  1MBG A;  4XNF A;  1FC3 A;  1Z67 A;  3OIQ A;  2A5W A;  1P2F A;  4UB6 C;  5HDK A;  1I1G A;  3H92 A;  5FO5 A;  3K4J A;  1JKQ C;  1ZGW A;  5LRR A;  2W84 A;  1R36 A;  2HQN A;  1KA8 A;  4R79 A;  4CCO A;  1ZGJ A;  2FXA A;  2LLK A;  3W2V A;  2M0M A;  3ZR8 X;  1X3U A;  3PQK A;  1YI2 I;  3ERM A;  1K7A A;  5TIS C;  4HX4 A;  4BH9 A;  3CCQ I;  3ROU A;  2RKH A;  2W48 A;  1LQ1 A;  2B63 J;  5FD6 A;  1LDD A;  2EV5 A;  2MYS A;  3V7C A;  3F8C A;  3PNY A;  2YU3 A;  2MD5 A;  3OYD A;  1S7A A;  2QF7 A;  4IHT A;  1IXC A;  3CO6 C;  2FSW A;  3IWZ A;  3WTX C;  2JVG A;  4EMS A;  4WCG A;  1F4K A;  2BXY A;  3ZQL A;  4M72 A;  2XUB A;  1IZ1 A;  1S7E A;  2JJ7 A;  4LLG F;  5JI6 A;  4M3D A;  1XC5 A;  4D9J A;  4ZDO A;  2DK5 A;  2Q0O A;  5HDN A;  4BE2 A;  4CHU A;  2HOA A;  4E6K G;  1I6H J;  1R6R A;  2O0Y A;  4IXA A;  4MQV A;  1FYK A;  2K5C A;  1RET A;  4QTR A;  3RZO J;  5E1Z B;  3DXJ F;  2HTS A;  1FP2 A;  3DKY A;  3FK7 A;  3M9A A;  1K6Y A;  2EFO A;  2XVC A;  4FET A;  3GTP J;  3HOV J;  3KLN A;  1WQ2 A;  3PM1 A;  3Q0W A;  1BJZ A;  1U8B A;  5EJC A;  2TCT A;  2X4H A;  2LH9 A;  3LSG A;  4U0V A;  1AWC A;  4FE7 A;  2BY1 A;  4DZP A;  2RNJ A;  1D5Y A;  2O3F A;  3QP6 A;  4WX9 A;  2P8T A;  1MIJ A;  4HF1 A;  3JW4 A;  1B72 B;  3ERE D;  2X48 A;  2X1C A;  1ZG3 A;  3TP3 A;  4EGZ A;  3U21 A;  3WU2 C;  1JE8 A;  1XSV A;  4IRG A;  3G2B A;  4S0H B;  2VBX A;  2Y0S N;  3G1L A;  5A2Q Z;  3GEZ A;  3AG1 H;  4MHG A;  3CDL A;  2LYC A;  3F72 A;  5EG0 A;  3HUG B;  2LOO A;  3R0J A;  5LRS A;  2ZJR F;  3MQ0 A;  2WY7 Q;  3FDY A;  5CVU A;  4YEJ A;  1BC8 C;  1TT5 B;  2ELK A;  3IH4 A;  2ECC A;  1MBF A;  1TWG J;  3CUQ A;  4E7I A;  1CF7 A;  2VE9 A;  2IGN A;  3KYC B;  5KHD A;  3ULQ B;  5F64 A;  3RPU D;  3AG2 H;  1Z9C A;  3G71 I;  1FOK A;  3OYL A;  4MEY F;  2LMD A;  2RRE A;  1A6Q A;  3GBG A;  2XPW A;  2Y30 A;  2AXT C;  1LEA A;  1ZRD A;  1VZ0 A;  2YR2 A;  3C2B A;  1Y8R B;  1MGT A;  3E6D A;  3M1C A;  4Q5S F;  2CW0 F;  1IN8 A;  3OYG A;  2V6C A;  4GCV A;  3T0Y A;  2IA0 A;  2P5V A;  3OYN A;  2XAH A;  3QOD A;  1VQO I;  4G6T B;  1D0Y A;  4F7Z A;  2WWY A;  1HSJ A;  2GXG A;  1BC7 C;  2PJR A;  3DLA A;  1R4M B;  1OCO H;  1QPM A;  3SQN A;  4AVP A;  4IHW A;  4RAF A;  4C3H J;  1DPU A;  2L7K A;  5DCM A;  3JRA A;  2DQL A;  5E3O A;  4CYC A;  1S5L C;  2QLZ A;  1RR8 C;  2LRD A;  5A2Q K;  4HQE A;  1Z0X A;  4FCY A;  4XLP F;  1R1V A;  1ORK A;  3DV8 A;  3TOB A;  3ELK A;  3LSM A;  4ANJ A;  4YIF A;  5LBQ A;  2P7C B;  3WTU C;  1E0E A;  3P7N A;  2F6C A;  3E6M A;  2DA6 A;  2ADU A;  3M1E A;  3QOP A;  2VT3 A;  3JAM Z;  4G94 A;  3LSK A;  1JXS A;  2Q1Z B;  2IGM A;  5E3L A;  2VC1 A;  5FD5 A;  4CYD A;  4DIQ A;  2HWV A;  3BQY A;  4B44 A;  1VQ6 I;  1FBQ A;  2IEK A;  2NYX A;  1HST A;  4PUS A;  4F93 B;  3HGY A;  1RR7 A;  2JTV A;  3LQR A;  5LGT A;  2L7M P;  1QGP A;  1I6X A;  3BJA A;  3TP0 A;  5L3C A;  3CCS I;  3DEE A;  1D1B A;  3CCL I;  2GM4 A;  3SEQ A;  2JZY A;  4ZZL A;  2IT0 A;  1WPK A;  3NWS A;  1OFC X;  1VQ7 I;  3TO9 A;  4IKF A;  1T33 A;  4HDV A;  2Y0M A;  1ZTR A;  6PAX A;  3S16 J;  5LGN A;  1IUY A;  2MLG A;  3DTE A;  1E2X A;  1TBX A;  4ESB A;  3GLX A;  2GQQ A;  4XOP A;  2VXD A;  4LLN A;  2HOT A;  4ON0 A;  2XPV A;  1X3W B;  3Q9S A;  3LSR A;  4L9N A;  2NVQ J;  2TDX A;  1FMW A;  3GTG J;  2N8G A;  1GV5 A;  4A3E J;  1MH4 A;  1QQI A;  2HQA A;  3KEY A;  5FB2 A;  5LHG A;  1P92 A;  3KFW X;  1K79 A;  3G1M A;  3OIP A;  2E7X A;  3BR2 A;  1R9T J;  1QVT A;  5L3G A;  3GYH X;  3G4S I;  3VFZ A;  1ZLJ A;  3J7Y J;  4AWX B;  4RBO A;  1R00 A;  2CRG A;  3SXY A;  4I02 A;  1KZH A;  4F91 B;  3JAM K;  1WKM A;  2O7O A;  2VT2 A;  3HPH A;  4RAG A;  4UNO A;  2FBH A;  2M2E A;  4CGZ A;  1AKH A;  3LQQ A;  4ASN A;  4XSX F;  2K27 A;  4MTD A;  4CXF A;  5KAF C;  1Z77 A;  2EV0 A;  3H35 A;  4LOC A;  4Y13 A;  5K5R A;  1WJF A;  3CLO A;  4GDF A;  4NC7 A;  4ZYH A;  2OCE A;  1B6A A;  3ECH A;  3IKT A;  3UR3 C;  3I56 I;  1O3T A;  3W2W A;  1HCR A;  4PSW A;  1OIS A;  1BR4 A;  4J00 A;  4NQW A;  2L9S A;  5FKK A;  5F1R A;  1LPQ A;  3BR6 A;  1DUX C;  1T8I A;  5DS9 A;  2ZXW H;  3RIR A;  3KP4 A;  5BQT A;  3CUQ C;  3RDI A;  2Q8K A;  3E5Q A;  1UHS A;  3P9C A;  4XKB A;  3OR2 C;  1IG7 A;  1SMY F;  3WU1 B;  4OAZ A;  2MH2 A;  4EM0 B;  5IP7 J;  2IGK A;  3BJO A;  1S8N A;  3QYF A;  4EJO A;  2FOK A;  2DW4 A;  2VKE A;  1MMN A;  3OOP A;  2LNB A;  1UAA A;  5DDG A;  2E60 A;  3BY6 A;  2XAU A;  4OIO F;  2WAF A;  2QQ9 A;  2DOA A;  2E71 A;  2X6W A;  1N77 A;  1W7P A;  2F5E A;  2RGV A;  1T98 A;  3F9K A;  5J8C A;  1K4T A;  1EA3 A;  1HKS A;  5K5Q A;  2DMN A;  1DU0 A;  2QSG X;  3AG3 H;  5FLX Z;  3LA2 A;  4RS8 A;  4D0P A;  3QYE A;  2FNA A;  3KP7 A;  4F52 A;  1T08 B;  3NAR A;  3L2R A;  2BE5 F;  4CUG A;  2JN6 A;  5J8F A;  1DQU A;  3IWF A;  1DGW Y;  3K2A A;  2CW7 A;  2E5Z A;  2VAS A;  1Y8Q B;  2V9V A;  4BL0 B;  4EEF G;  4RGX A;  3IH3 A;  2HXO A;  2QYO A;  5K7H A;  5D5V B;  1EKE A;  4QLC U;  2E1C A;  1OCT C;  2AHQ A;  3SZT A;  4L5I A;  3BTC A;  4FX0 A;  5TGT A;  3REO A;  2VQL A;  2XAS A;  2UXN A;  2XGX A;  4E7H A;  5BOX A;  5CYV A;  4HDU A;  1Y6I A;  3HL2 A;  3TOA A;  2B0L A;  3IP4 B;  1S72 I;  4UUT A;  2LP0 A;  4MNU A;  4FQG A;  4WK8 F;  3ZP5 A;  3BCA A;  4RA2 A;  1FSH A;  1Z3X A;  4U0Y A;  2HDW A;  4XLH A;  2RV8 A;  1TQP A;  3QAH A;  4L0Z B;  4XMY A;  4KT5 C;  2KP6 A;  2ZJP F;  4KJZ A;  2CUF A;  2V1X A;  3D5R C;  5FKN A;  3FZV A;  1I1S A;  3GX4 X;  2LKS A;  3W6K B;  2IW5 A;  2ZB9 A;  4WWC A;  1XSD A;  1Q1H A;  1YX3 A;  3CCE I;  3IHU A;  1A6I A;  3TED A;  4I2O A;  2A68 F;  1WI3 A;  2DT6 A;  3BTL A;  2KIS A;  4M6Y A;  4EV0 A;  1SFX A;  4XRF A;  2BXZ A;  2VQH A;  2QUF A;  2VL8 A;  4OMZ A;  2A3S A;  2OJE D;  3GFM A;  2EFW A;  1R5I D;  1B9M A;  1YG2 A;  4JBA A;  2DA1 A;  4A0Z A;  2F4M B;  4B09 A;  1P9Q C;  5CVV A;  4AIK A;  3S2D J;  3BJ6 A;  2ME0 A;  2XGD A;  3S32 A;  5IPA A;  5HS9 A;  3HHH A;  3P9I A;  2WTE A;  1MSE C;  2JQ7 A;  2ZXJ A;  4LK0 F;  1BOB A;  1S6L A;  2W00 A;  4Y33 A;  4HSR A;  5HS8 A;  3HG9 A;  1U6G A;  4MO7 A;  2R7R A;  1V5F A;  5IOY A;  2IA1 A;  4UVA A;  4FAS D;  2GIV A;  2E2I J;  4IOA F;  5E8G A;  1V4R A;  3PNV A;  4YRV A;  1IO2 A;  3OOU A;  4HLX A;  3NWT A;  1R1U A;  3VYS B;  2ID6 A;  1HLV A;  2E1M C;  3HM5 A;  3M8E A;  4GYI A;  3KZI C;  3KIO A;  2WY8 Q;  4M6V A;  5ICE A;  5LFA A;  3OYM A;  1JI8 A;  2STW A;  3JRF A;  3FHZ A;  4YII A;  1SFE A;  5E3M A;  3FMR A;  1D8J A;  3U1D A;  1N75 A;  3F8F A;  3D1N I;  4AC0 A;  1TQM A;  2LF8 A;  3VEP A;  2IVM A;  1OR7 A;  3JRD A;  2LG4 A;  3EYI A;  3HRT A;  4HPQ A;  4BQN A;  2HEO A;  2M9H A;  3GTQ J;  4P55 A;  3ZMZ A;  4BY1 J;  4Z6Y A;  3AG4 H;  3F3X A;  1UG0 A;  3M07 A;  3WGH A;  2QZ8 A;  2XGE A;  3TDU C;  2YPR A;  1O7L A;  1G2H A;  3DP7 A;  2BY3 A;  4R8H A;  3L2V A;  5EEH A;  3JR9 A;  4IJA A;  2KIM A;  1R5H A;  4PCQ A;  1MJ9 A;  5BNG A;  4QPO A;  3F8B A;  2WV0 A;  2F5F A;  2M8E A;  2WAD A;  5L3D A;  5IYC J;  3WOD F;  1FOY A;  2ZME A;  2BYV E;  2EBI A;  3TQN A;  2IP2 A;  3MZ8 A;  4HEA 2;  2JK3 A;  2K9Q A;  5CLS A;  1MBK A;  3SEZ A;  4IQ4 A;  1WGX A;  3HSF A;  4Y3O A;  1MJA A;  3H5N A;  2W25 A;  4H0E A;  1P7I A;  3HTS B;  1HW1 A;  3DEW A;  1HC8 A;  3SDB A;  2RQP A;  1EH7 A;  1VF9 A;  4AYB N;  4WF2 A;  2Z2S B;  1HW2 A;  2CQX A;  3BOQ A;  2L9N A;  5IP6 A;  2AQF A;  2Y31 A;  1LDK B;  4XOT A;  3SHF A;  2LR8 A;  3MZY A;  2DTR A;  5EG0 B;  3PL8 A;  3BPV A;  1FYL A;  4BS9 A;  1X1D A;  1NHA A;  3B73 A;  5DUK A;  1X2M A;  4ZDL A;  3RQI A;  1CF7 B;  3CUQ B;  1FLI A;  1QVU A;  2ZFU A;  2G7H A;  5GAE J;  2IJL A;  3ZMV A;  2RQQ A;  4UY8 I;  5EGO A;  4LK1 F;  4ENM A;  3MD2 A;  2O03 A;  1YO5 C;  4UUS A;  4HAM A;  4ENK A;  3K4C A;  5M5W J;  3FXQ A;  3W6V A;  1ONV A;  2FU4 A;  5JFR A;  4BJT A;  5DD4 A;  3VYT B;  4F55 A;  4RB3 C;  3FXJ A;  1XDS A;  4KNY A;  5K7F A;  4L0Y B;  1QO0 D;  2AXL A;  2K40 A;  2LFB A;  2HZD A;  4ETS A;  1XX5 A;  2BW3 A;  2EB7 A;  3K9T A;  2H09 A;  5D5W B;  1XS9 A;  4UUV A;  2ZXI A;  4LB5 A;  5IT9 K;  3L1P A;  2LRE A;  3IUO A;  3CMM A;  1ZG1 A;  4RAZ A;  3HOW J;  3P9K A;  1BM9 A;  5AIQ A;  1ACI A;  3CO7 C;  1B1B A;  3K70 C;  1YRN A;  2R7T A;  1UMQ A;  5DCM B;  1BR1 A;  1XMK A;  4IRI A;  1F36 A;  4KIF A;  5KNL A;  2R0Q C;  2OD5 A;  4HNV A;  4B43 A;  3JCU C;  2QM3 A;  4NC6 A;  5BMZ A;  5BPI A;  5GPA A;  1NH3 A;  4ENJ A;  3RKW A;  1Y0N A;  3IH2 A;  5JVT A;  2CQQ A;  3RPQ A;  4BBS J;  4X1E A;  2L7F P;  3SFI A;  4RB2 C;  1QHG A;  1MBE A;  3CMY A;  3S1M J;  2P81 A;  1SC7 A;  2L4M A;  3TMO A;  3MEX A;  3EQL F;  4HQM A;  3TKY A;  1F43 A;  2QCO A;  4C30 A;  1JKR C;  1B9N A;  4O3M A;  1OR7 C;  3BCB A;  4E7J A;  1FP1 D;  3O3K A;  4LD5 A;  1JHH A;  4P1W A;  2DA2 A;  1ZAO A;  2LF7 A;  2KDO A;  4BHC A;  2K7L A;  2LKP A;  4BU2 A;  1OQY A;  3FXK A;  1PUE E;  3T1B A;  4W97 A;  1FZP B;  1Z6R A;  1RUO A;  3ESW B;  1HBX G;  1MBH A;  2LY2 A;  1WJE A;  1H0M A;  2Z9O A;  1WH5 A;  1T38 A;  3CCV I;  1FBU A;  3HTU A;  2Z99 A;  5B5E C;  3FMS A;  2HS5 A;  3BWG A;  1MH3 A;  1UHW A;  2MLK A;  2XPU A;  2HQR A;  2VIX A;  2ZME C;  5B3S H;  1Z3Y A;  3FXR A;  3KE2 A;  1SFO J;  1LNW A;  1QNT A;  3BLY A;  3DFG A;  1P4A A;  1ETQ A;  3V7R A;  4P9U A;  1H89 C;  4PFO A;  3DKX A;  1WRJ A;  3FBI B;  2GLO A;  5E17 F;  1WCM J;  2DMP A;  1FX7 A;  1X4P A;  3H9G A;  3VSK A;  3EDP A;  2R5Y A;  2E1M B;  3D5S C;  2AS5 F;  1AKH B;  1X1A A;  3C2G A;  1ZGA A;  5M5X J;  3H5A A;  4HYE A;  4B3A A;  3J7A O;  1MMS A;  3RYP A;  2ZKZ A;  2RNG A;  3B02 A;  4GYG A;  4AVZ A;  2A61 A;  5D6E A;  2L2O A;  5EEA A;  3RKQ A;  4XIC A;  3OSG A;  5GAH J;  1SVL A;  4PJM A;  1IAW A;  2L5Q A;  2M7A A;  1PDN C;  4NQW B;  4D5F A;  4RB0 A;  1OYW A;  1RIO H;  1BIB A;  3GLL A;  1KU9 A;  3I0T A;  5LGU A;  3DLL F;  3A0H C;  2E7W A;  2HR3 A;  4WXC A;  3HPG A;  2IXS A;  4HX7 A;  1NK3 P;  3FK6 A;  2A05 A;  3JTG A;  2K02 A;  1QRY A;  1UHM A;  2EIJ H;  2HXI A;  3GME A;  3GFI A;  1E3H A;  5ICC A;  1W0U A;  2A6T A;  3F6O A;  1ZRE A;  1JTY A;  4XID A;  3KEO A;  1F5T A;  1LB2 A;  1YYV A;  1VQ8 I;  3ZXS A;  1XMA A;  4AD9 A;  1W7P B;  4NBQ A;  4BAC A;  1VQM I;  2DLL A;  5D4S A;  4KMF A;  4RDU A;  3E97 A;  2NS0 A;  4ZYG A;  2DPU A;  3I64 A;  4HOB A;  2DCE A;  3IL2 A;  4GFB A;  1EF4 A;  4FX4 A;  3OYE A;  3PO2 J;  1MJB A;  4WXD A;  3J80 K;  2VBZ A;  1FEX A;  2EA4 A;  4IO9 F;  3TO6 A;  1SVM A;  3IKV A;  2CG4 A;  2D1H A;  5LLQ A;  5HDG A;  1BI3 A;  1T0F A;  1B8I A;  2M34 A;  2DMU A;  4M9X A;  1TZL A;  3GZ5 A;  3KZZ A;  5GAD J;  1DP7 P;  2HU9 A;  3GFJ A;  4MTE A;  3ZGK A;  2NNN A;  4I6Z A;  1NG7 A;  3F6V A;  5D5X B;  2DO7 A;  2NVY J;  1ZG5 A;  3OIO A;  2MA3 A;  3E3V A;  5D4R A;  4IEJ A;  4O6J A;  1FTZ A;  2WB1 N;  1ZKG A;  3RPU A;  1MDM A;  1PVE A;  3H1C A;  5J4Y A;  2V7F A;  3CF5 F;  1ETO A;  2DN0 A;  3ABL H;  4MLO A;  5DYM A;  1U5T A;  3CCJ I;  4OIQ F;  2O6G E;  4MEX F;  2PG4 A;  2Z33 A;  3M4O J;  3H36 A;  2HYJ A;  4J01 A;  4G7O F;  2H1L A;  3OYK A;  3PO3 J;  1ZRF A;  4V2G A;  1V54 H;  4HNU A;  1D0Z A;  1FTT A;  2KZG A;  2ELJ A;  2R92 J;  3CD6 I;  2F5C A;  1U3E M;  5K7Z A;  1Y1W J;  1IRX A;  4PJN A;  4LB6 B;  5LHH A;  1WJD A;  2DA5 A;  3BR0 A;  5EYR A;  2X6Y A;  3ZPL A;  2JMW A;  3WG9 A;  2X6O A;  4PJL A;  4KIT B;  1TP4 A;  2BOL A;  1KYZ A;  3MKY B;  2E2H J;  3OYF A;  2GOM A;  5J1Y A;  2Z1D A;  3DQV C;  4O5V A;  4EJW A;  1G3S A;  4KFC A;  3ZMU A;  2B9S A;  5CPR B;  1R58 A;  3NRV A;  2DAO A;  1XN7 A;  2OQR A;  1W0T A;  1K83 J;  3ABT A;  3IAM 2;  3KP2 A;  5CVI A;  4UVC A;  1XPX A;  5EEG A;  1IF1 A;  2FRH A;  2AQE A;  2VLA A;  4IF4 A;  2C6Y A;  2XIG A;  5DCF A;  5E1X A;  3T5X A;  3ZCO A;  2FUG 2;  2K3P A;  3WTT C;  3L2C A;  4A3F J;  4C2U A;  2DTZ A;  4KN4 X;  3A1Y A;  3KP3 A;  1XCB A;  3HB9 A;  2KFD A;  1U9O A;  1YIJ I;  4A0X A;  2RC4 A;  4CZZ A;  2OZ6 A;  1J5Y A;  3M3Y J;  1O7F A;  2PMU A;  4A6D A;  1YTY A;  2OF7 A;  4EJU A;  3EET A;  2L02 A;  3PSF A;  2P5K A;  3PJR A;  1YIO A;  4IHS A;  2P6T A;  2FQ4 A;  4XRS A;  3SDG A;  1P6R A;  1IW7 F;  5J40 A;  4JX4 A;  2ZFW A;  3TBI A;  5TRD A;  5DUI A;  1JT6 A;  1IN4 A;  1JKP C;  3CC2 I;  1RRJ A;  4IHV A;  2PBI A;  4IL6 C;  2EFQ A;  3OS2 A;  2EZL A;  1X58 A;  2E1O A;  1X3Z B;  4LIT A;  3KYL A;  4AUX A;  4EJT A;  1D8K A;  2UWM A;  2R5Z A;  5FFX A;  1H88 C;  1WZ2 A;  2E1N A;  2ZME B;  3H5R A;  2XKO A;  4XKC A;  5K5O A;  2G9W A;  3EUA A;  4N0B A;  3BZK A;  3J81 K;  2V79 A;  1IRG A;  1IDZ A;  3R6S A;  1Z7U A;  2VUM J;  1E3O C;  2YSR A;  3DBH B;  3C1D A;  4LIU A;  1U2W A;  4ZYA A;  3G3Z A;  2XF5 A;  4BKX A;  5HS7 A;  1WFX A;  3JRH A;  5FRO A;  2STT A;  1H9T A;  5E1W A;  1P7J A;  4PSX A;  2DA7 A;  4A3L J;  2L0K A;  2F5D A;  1OCZ H;  4F92 B;  1T0F C;  5ED4 A;  2JA5 J;  4BHP A;  1VQK I;  2D2W A;  4HRI A;  3ZMS A;  2ID3 A;  2MC4 A;  1KU3 A;  3E5U A;  1UJ8 A;  2CW8 A;  3A02 A;  4ESJ A;  1R4N B;  1PP8 F;  2H6B A;  2CWE A;  3BQZ A;  3S3M A;  1W36 D;  1ETK A;  2QKM B;  2VC0 A;  1ZHF A;  4XLA A;  3FKJ A;  2X9D A;  3V8J A;  3RKY A;  3I4N J;  2VKV A;  2JUG A;  2Y48 A;  2COM A;  3A01 A;  2EJR A;  1LVA A;  2CU7 A;  5CKT A;  3LWF A;  5D8K B;  1O3R A;  2QWW A;  5HNF A;  3QRF F;  2IS2 A;  5IYD J;  5EGO B;  2XSD C;  2IS6 A;  1N78 A;  2ZNY A;  1XSX A;  5FFZ A;  4NUB A;  4UUS B;  1K78 A;  4A3C J;  3IC7 A;  2GXA A;  1JUP A;  4PGG A;  4W1U A;  5FKM A;  2E35 A;  3HOU J;  3DF8 A;  4A3M J;  3EPZ A;  4HBL A;  4XLN F;  1W5S A;  2LY1 A;  5E8I A;  5E18 F;  5C3E J;  2RAE A;  1I27 A;  2BW3 B;  3ASO H;  2E34 A;  2NS7 A;  2DFI A;  1HW5 A;  2DA4 A;  2MGQ A;  1RC9 A;  2K9N A;  3FM5 A;  3RZD J;  1YRN B;  2EZH A;  2FJ1 A;  1OMI A;  2XRL A;  1X2N A;  3I4M J;  3L7W A;  3OYB A;  1LDJ A;  1SFK A;  4E7Z A;  3JRE A;  5F0F A;  2HVQ A;  3AL0 C;  2VOD A;  2H27 A;  2DJN A;  1X4O A;  2GWR A;  1X1P A;  1SAN A;  1D1A A;  3KYD B;  2XF7 A;  3CCR I;  2LY9 A;  3LSP A;  1UCR A;  2XF6 A;  3LL7 A;  2QSF X;  2E2J J;  1AOY A;  4QIW N;  4X0G A;  3BR1 A;  4HA8 A;  4M3G A;  2CV0 A;  3GTO J;  5ICG A;  4K2E A;  1TW3 A;  3K4L A;  2IS4 A;  3TGN A;  1A31 A;  1S29 A;  4V2F A;  3FM3 A;  4G6Q A;  2G7U A;  2JUC A;  4AU7 A;  5FLV A;  4KUM A;  3GTL J;  4A0Y A;  4D5C A;  5JLX A;  2A07 F;  4HV6 A;  5FLM J;  2HZT A;  1XDU A;  3MKW B;  1HXD A;  1JHF A;  4IX7 A;  3P5J A;  3I5U A;  4UHT A;  5M5Y J;  2K85 A;  4BNC A;  3L2U A;  5LEK A;  2EPF A;  1EV7 A;  2LSO A;  4CSW A;  3SZG A;  2IRF G;  4A3G J;  2XHK A;  5F04 A;  2QEX I;  2BY2 A;  4LIV A;  5LHI A;  4BEH A;  1TQI A;  2BGC A;  3E6C C;  1L3L A;  5KK1 A;  1GUU A;  5FJ8 J;  1GXP A;  3F0C A;  1QZZ A;  2X85 A;  3HZJ A;  4N9I A;  1ENH A;  4C3J J;  2O61 A;  1IV6 A;  2FE3 A;  2FOW A;  4KIG A;  4XR6 A;  5HLH A;  1W4M A;  3Q9V A;  1POG A;  4JX6 A;  4A3K J;  4D7N A;  1JUM A;  1YLF A;  5HOO A;  4B3X A;  1ZN2 A;  1GV2 A;  4A3J J;  1J7K A;  3M7G A;  2R3S A;  5ILS A;  4S04 A;  2HQ5 A;  3OWT A;  3PNT A;  2BEO A;  1S7O A;  3DPT A;  1ODD A;  2R5Y B;  4EQQ A;  1BIA A;  3ZQC A;  2CV2 A;  1OYY A;  4FT8 A;  1I50 J;  3CJQ B;  3FWE A;  5IY5 H;  5KCM A;  2W7N A;  2XAQ A;  4D1Q A;  3N97 A;  2QSH X;  4I7H A;  3W3C A;  1G4D A;  3HRS A;  4HX8 A;  3JSO A;  4XLE A;  3EUH A;  4BJ5 C;  3WGI A;  2PMH A;  1BR2 A;  4BYY A;  4NNJ A;  2IAI A;  4CIC A;  4FTH A;  4AIJ A;  2E5N A;  1Z6T A;  4DOZ A;  4JX5 A;  2BHZ A;  1V5E A;  4I0B A;  2CS3 A;  4NC8 A;  2M4G A;  1F1Z A;  4U7B A;  3MN2 A;  3ZRG A;  4JYK A;  1JJ8 C;  3D0S A;  2M0C A;  2VPR A;  1SFU A;  3VYU B;  2VPL A;  2EIL H;  1QU3 A;  2R7X A;  2FBI A;  1SD6 A;  4B1R A;  1WSU A;  4C2T A;  1JUS A;  4IZZ A;  2NS8 A;  1MNE A;  4J19 A;  3S17 J;  3B6C A;  2DBB A;  3M8F A;  2ISZ A;  3MWM A;  4XN0 A;  1LJ9 A;  2HKO A;  2X6X A;  1FY7 A;  5EF6 A;  3BC8 A;  3ZMD A;  3I59 A;  1CGP A;  4AIH A;  1UST A;  4BBR J;  3FHN A;  2DQR A;  1ZEL A;  1BJA A;  1R23 A;  1FOX A;  3ABM H;  3W2A A;  1V3F A;  2DMQ A;  4MQ9 F;  4EVI A;  4XKV A;  3GUD A;  1WJA A;  2KT0 A;  4XL9 A;  2KKO A;  4IQJ A;  3I53 A;  1XGM A;  1QHH D;  3GZ6 A;  1CQT A;  1J9I A;  2D45 A;  1KON A;  1YW7 A;  2VJ5 A;  2O8X A;  4FIS A;  3JSP A;  1GXQ A;  2ZCW A;  3QQA A;  5M3F J;  1ITY A;  2GA2 A;  4Y4R A;  2M30 A;  4NDL A;  3K7A J;  1MMA A;  1IN7 A;  3QPS A;  2KRH A;  3TO7 A;  3G73 A;  3WE2 A;  1KGS A;  1J09 A;  2KJB A;  5IT9 Z;  4D7M A;  4RGU A;  2MW8 A;  2ZSI B;  1GT0 C;  4UVB A;  2LC2 A;  4XKW A;  2P5L C;  1G8X A;  5E3N A;  2DT7 B;  4E7S A;  4A2U A;  1ETV A;  4M71 A;  3HSE A;  3PSI A;  1Z1D A;  2XV4 S;  2FQ3 A;  3ONQ A;  1U0J A;  2Y0S A;  3VOD A;  3HOT A;  5B1A H;  2WC2 A;  2KHM A;  2L54 A;  1YX5 A;  4HZF A;  4M74 A;  4EJV A;  2M1B A;  5D6F A;  1ZLK A;  2K9S A;  2X0L A;  1XGO A;  3HBL A;  1VQL I;  1LEB A;  1ULY A;  3OSF A;  3DU6 A;  3C2H A;  2JWT A;  5B66 C;  2H6C A;  1G3T A;  3BRO A;  1WJ5 A;  1OLT A;  5KVR A;  3H0D A;  1IC8 A;  5GAG J;  4G9Y A;  3S1R J;  3GZN B;  1W5C C;  4I99 C;  4I0A A;  2YU9 J;  2O9L A;  1R7J A;  5HNH A;  2EWN A;  1JT0 A;  4U87 A;  5JR3 A;  3I55 I;  1O57 A;  3K4M A;  1YOV B;  1YJ9 I;  3BG5 A;  4LG0 A;  3SZP A;  2ZBK A;  3BG3 A;  1F9N A;  1N25 A;  2MG4 A;  1ZRC A;  1E17 A;  2EK5 A;  5GP9 A;  2XB5 A;  2ECB A;  1J2X A;  3AL0 B;  3CMA I;  1JGG A;  2KRC A;  2HOE A;  3MVP A;  5J47 A;  2L9R A;  1QPI A;  1FIA A;  4S05 A;  4U0W A;  2COB A;  1IV8 A;  3TDZ C;  3F8N A;  2HDD A;  3J7Z I;  2DMT A;  4RM3 A;  3VDX A;  1TNT A;  3O6B B;  4HNT A;  2PJR B;  2FD5 A;  4Y15 A;  1BOA A;  1UEL B;  2QKL B;  2MFZ A;  5DM7 F;  4A12 A;  1YS7 A;  3K1M A;  2LTP A;  1RKW A;  4N9H A;  3LFU A;  3QWL A;  3V7S A;  3EUH C;  2NOG A;  4DJA A;  4CYC B;  1G3Y A;  4Q47 A;  4JP0 A;  5E79 C;  4BQO A;  1KQ0 A;  5H6R A;  3WE3 A;  5C44 J;  2CV1 A;  3ABK H;  2F48 A;  5J4V A;  2CQN A;  5HVQ C;  1ZQ3 P;  3K4K A;  1JKO C;  1PP7 U;  1VND A;  4XSZ F;  3VWB A;  2EZK A;  2Y9Y A;  2NRA C;  1HOM A;  4GXO A;  2L7Z A;  1TWC J;  3VSL A;  3UKG A;  2QBY A;  3DCF A;  1T56 A;  3OS1 A;  1YJN I;  4CZC A;  1YFH A;  3VOE A;  4HLY A;  5B1B H;  4ZH4 F;  2M4K A;  3ZQH A;  2MC3 A;  3BZ6 A;  1YHQ I;  1HA8 A;  2F2E A;  1MMG A;  3HDD A;  1S3J A;  2DPD A;  2PEX A;  5H2F C;  2R5Z B;  2QEN A;  2HPI A;  1XG1 A;  2EQR A;  3CC7 I;  3NEU A;  3O2P E;  4JQF A;  1FIP A;  2VON A;  2CMP A;  5HLI A;  5AON A;  3HEF A;  3HXL A;  4A6E A;  2XRN A;  2YX7 A;  1OPC A;  1RI7 A;  5ICF A;  1W1W E;  4FHT A;  3HOZ J;  4YFK F;  3ISP A;  4Y52 J;  2V9K A;  1K61 A;  5HLT A;  2XGC A;  1UB9 A;  3KX2 A;  3T8T A;  4EM2 A;  3ABU A;  2K4J A;  2GOX B;  2XAJ A;  1TW2 A;  5LEJ A;  1QBJ A;  2H1K A;  5CVR A;  3FXL A;  3LFK A;  4RLQ A;  2Z5U A;  1O3Q A;  3QU3 A;  3V42 A;  2DU9 A;  1TL8 A;  2LDU A;  2Y69 H;  4YEL A;  1I3Q J;  2CJJ A;  5GPC A;  4CCN A;  3ZN1 A;  3LA3 A;  4E70 A;  1YW9 A;  4ZZD A;  2OTL I;  5K1Y A;  2WAQ A;  2L3D A;  3Q0V A;  3DTI A;  2ESH A;  3K10 A;  1ZH5 A;  2HKX A;  2W24 A;  4DYC A;  2R7F A;  2W85 A;  1IDY A;  2UZK A;  3J80 Z;  4DW6 A;  2GBY A;  1Z05 A; 
#chains in the Genus database with same CATH homology
 2RN7 A;  3KET A;  1ON1 A;  3NQO A;  4UV8 A;  4LJZ F;  4GGG A;  2IPQ X;  3LST A;  1Y0U A;  1MZB A;  3HRU A;  1USS A;  2EA2 A;  4KIC A;  3WTY C;  1IN5 A;  3LAJ A;  1K78 B;  3SFZ A;  1O3S A;  5IT3 A;  3K2Z A;  1P4X A;  1T6S A;  2EFP A;  3V8K A;  1HKT A;  1SD5 A;  1G6N A;  2DT5 A;  2JT1 A;  4B8X A;  5ILV A;  3GWZ A;  3PQJ A;  4DQ2 A;  2KIU A;  4TV7 A;  1MKM A;  2OAZ A;  2XAF A;  4M73 A;  2FEZ A;  2CFX A;  1ON2 A;  2JSC A;  2QVO A;  1FYM A;  2OBP A;  4M9S A;  5HLG A;  4IVN A;  4KDP A;  1R22 A;  2Z3Y A;  1T39 A;  4UV9 A;  4OU0 A;  4M9Z A;  2Q2E A;  1RNL A;  3WU0 A;  4JK1 X;  2ETH A;  2Y75 A;  4P9F A;  1SD7 A;  1K6O A;  3MCZ A;  1HQC A;  3R4K A;  4OIP F;  1BN5 A;  3KZY A;  5H6Q A;  1W5T A;  5DEQ A;  1BBY A;  1IRF A;  5L3E A;  1DDN A;  2QQA A;  2J5O A;  4NHJ A;  4KIB A;  1R5G A;  3H3Z A;  3GO5 A;  2XKP A;  4L5J A;  3BP8 A;  2VBW A;  5BS6 A;  1GVJ A;  4RB1 A;  2CGP A;  1FPQ A;  4BAY A;  4G6D A;  4YG2 F;  5TJJ A;  4ZYD A;  2EFN A;  3J81 Z;  2W57 A;  1FSE A;  3T8R A;  2OU2 A;  2HYG D;  1BI1 A;  3COA C;  1YS6 A;  1XB4 A;  2JRT A;  1A04 A;  1IXS B;  4OIN F;  3GFL A;  1XGN A;  1TTY A;  3ZMT A;  3QPT A;  4DNC A;  2VXZ A;  1FT9 A;  2FBK A;  5J6X A;  3H3U A;  3BPX A;  3I59 B;  5AIP A;  1EH8 A;  2GZW A;  3WTW C;  1P4W A;  4Q4Z F;  5D8L B;  2V1D A;  1T2K A;  5JHU A;  3BDD A;  5H20 A;  1YQA A;  2DK8 A;  3D5L A;  3KLO A;  2GXB A;  1UFM A;  3RKX A;  1XGS A;  4A5M A;  1BI2 A;  1G3W A;  2KJC A;  4CO8 A;  3F21 A;  2MH9 A;  3Q5F A;  3KP5 A;  3WGG A;  2V1U A;  5ILU A;  4HW0 A;  2ELH A;  3HOS A;  3QP5 A;  1KU2 A;  1VTN C;  3MFK A;  3L00 A;  2QQB A;  2HDC A;  4LMY A;  1L0O C;  2ACJ A;  2RDP A;  2VOO A;  3K1P A;  4GO1 A;  4HF0 A;  2JPB A;  1U5T C;  4LG0 B;  3HHG A;  2GAU A;  4P5O A;  1KYW A;  5ERI A;  1GHC A;  4WXH A;  2A6H F;  2PI0 A;  3N4M A;  3GW2 A;  4YFN F;  4ZYE A;  2ZNZ A;  2BBY A;  5BPD A;  1U8R A;  4L9T A;  3PFI A;  3WTV C;  3I54 A;  3L9F A;  3E5X A;  3JTH A;  1SAX A;  4L9V A;  4L9J A;  2HYF A;  2M5W A;  2L01 A;  3ZQ7 A;  5DD8 A;  3U9G A;  5DV5 A;  1ZAR A;  4OMY A;  2OZU A;  2QBY B;  2FML A;  2MBF A;  3DKW A;  3IRR A;  2NNY A;  1JGS A;  4IPA A;  2A6E F;  3KEQ A;  2XRO A;  3K1N A;  3F23 A;  2CYY A;  1MD0 A;  1OKR A;  3C3W A;  3C7J A;  4LLL A;  4ENN A;  4CDG A;  4RGR A;  1W7P D;  4KMU X;  3R0A A;  2HGC A;  2CO5 A;  4I09 A;  3AAF A;  1QZY A;  4M6X A;  1OYI A;  4U88 A;  4U7D A;  3WTS C;  2A69 F;  5L3F A;  1H9G A;  2L4A A;  4KYW A;  3HUG A;  2NAZ A;  2P6S A;  1D3Y A;  2P4W A;  1REP C;  2KRF A;  3HSR A;  5FLX K;  3EYY A;  1KU7 A;  3F8M A;  1C0W A;  1J59 A;  2OQG A;  3GVA A;  3RI4 A;  2FA5 A;  1SD4 A;  3KP6 A;  3QU6 A;  4LGW A;  4PGH A;  2K4B A;  2IA2 A;  2P7V B;  2A5Y B;  3I71 A;  2M87 A;  4L18 B;  3I58 A;  2VOP A;  1WWX A;  2H94 A;  4OIR F;  4R1H A;  3E6B A;  1SMT A;  4HF2 A;  1U78 A;  3DPL C;  4G7Z F;  3R60 A;  4OOI A;  2PQ8 A;  1STZ A;  2HFH A;  3HRM A;  2RVC A;  4XBF A;  5L3B A;  3F22 A;  4YFX F;  3K0L A;  3ECO A;  4BQA A;  5CJ9 A;  2BV6 A;  4KN7 X;  3HYI A;  3S2W A;  3FXU A;  4KA4 A;  4BHB A;  4ESF A;  1J0R A;  3CTA A;  1FNN A;  1XD7 A;  1MDM B;  2PN6 A;  1B4A A;  3I4P A;  3C18 A;  1J75 A;  2ZO4 A;  3RTR A;  4Z2Y A;  1U5T B;  2KIF A;  3RYR A;  2OA4 A;  1RZ4 A;  2GA1 A;  3GF2 A;  5D5U B;  5CVJ A;  3HIF A;  3K69 A;  4RGS A;  4LFU A;  4EM1 A;  4G8X A;  1EH6 A;  1WI9 A;  2HTJ A;  4P96 A;  3ZN0 A;  3GXO A;  3V4G A;  3KCC A;  3V8L A;  3VB2 A;  1IN6 A;  1TNS A;  2FNP A;  2XAG A;  4PZJ A;  2JPC A;  1R1T A;  2ISY A;  4PDK A;  1FBS A;  3U2R A;  1FWZ A;  2EV6 A;  3L09 A;  1IXR C;  1DPR A;  4RAY A;  4EGY A;  1I5Z A;  1KQ8 A;  2FF4 A;  2PFB A;  2K86 A;  3FX3 A;  4I98 B;  2DI3 A;  2CSO A;  1Z91 A;  4IRH A;  2CQK A;  4Y17 A;  4A5N A;  2YX4 A;  5FGM A;  2UXX A;  3MAJ A;  3LAP A;  2D1V A;  1BI0 A;  3ML6 A;  4HV5 A;  4BXU A;  1RUN A;  2VN2 A;  2VBY A;  2ZJ2 A;  3RJP A;  1ZYR F;  4QWQ A;  2FMY A;  2VE8 A;  3CDH A;  4MGR A;  3LA7 A;  3CUO A;  2ESN A;  3IRQ A;  4NB5 A;  3R61 A;  1D5V A;  4Q48 A;  2J5P A;  1HKQ A;  4I01 A;  1YW8 A;  2PJP A;  1TLH B;  5E20 A;  3CJN A;  5F6F A;  1B59 A;  2PLY A;  3FMQ A;  3W6J B;  1XCV A;  1KQ9 A;  2M45 A;  4UXN A;  3MZH A;  3WTZ A;  4G7H F;  3DEU A;  3QPH A;  2R7D A;  3OV8 A;  3FF5 A;  1FC3 A;  1P2F A;  5HDK A;  1I1G A;  3H92 A;  5FO5 A;  5LRR A;  2W84 A;  1R36 A;  2HQN A;  1KA8 A;  4R79 A;  1ZGJ A;  2FXA A;  1X3U A;  3PQK A;  1K7A A;  4HX4 A;  4BH9 A;  3ROU A;  2RKH A;  1LQ1 A;  5FD6 A;  1LDD A;  2EV5 A;  3V7C A;  3F8C A;  2YU3 A;  2MD5 A;  1S7A A;  4IHT A;  1IXC A;  3CO6 C;  2FSW A;  3IWZ A;  3WTX C;  4EMS A;  4WCG A;  1F4K A;  4M72 A;  1IZ1 A;  2XUB A;  4LLG F;  5JI6 A;  2DK5 A;  2Q0O A;  5HDN A;  4CHU A;  2O0Y A;  4IXA A;  1FYK A;  4MQV A;  5E1Z B;  3DXJ F;  2HTS A;  1FP2 A;  3M9A A;  2EFO A;  2XVC A;  3KLN A;  1WQ2 A;  2X4H A;  4U0V A;  1AWC A;  2RNJ A;  2O3F A;  3QP6 A;  4WX9 A;  2P8T A;  4HF1 A;  3JW4 A;  3ERE D;  1ZG3 A;  4EGZ A;  1JE8 A;  1XSV A;  4IRG A;  2VBX A;  5A2Q Z;  3GEZ A;  4MHG A;  3F72 A;  3R0J A;  5LRS A;  3MQ0 A;  5CVU A;  1BC8 C;  1CF7 A;  3CUQ A;  2VE9 A;  3ULQ B;  5F64 A;  1Z9C A;  1FOK A;  4MEY F;  1LEA A;  1ZRD A;  2YR2 A;  1MGT A;  3E6D A;  4Q5S F;  2CW0 F;  1IN8 A;  2V6C A;  4GCV A;  3T0Y A;  2IA0 A;  2P5V A;  2XAH A;  4F7Z A;  2WWY A;  1HSJ A;  2GXG A;  1BC7 C;  3SQN A;  1QPM A;  4AVP A;  1DPU A;  5DCM A;  2DQL A;  2QLZ A;  5A2Q K;  4HQE A;  4XLP F;  1R1V A;  3DV8 A;  3TOB A;  3ELK A;  4YIF A;  5LBQ A;  2P7C B;  3WTU C;  3P7N A;  3E6M A;  2ADU A;  3M1E A;  3QOP A;  2VT3 A;  3JAM Z;  4G94 A;  1JXS A;  2VC1 A;  5FD5 A;  4CYD A;  2HWV A;  1FBQ A;  2NYX A;  1HST A;  2JTV A;  3LQR A;  5LGT A;  1QGP A;  1I6X A;  3BJA A;  5L3C A;  4ZZL A;  2JZY A;  2IT0 A;  3TO9 A;  4HDV A;  2Y0M A;  6PAX A;  5LGN A;  1IUY A;  2MLG A;  1E2X A;  1TBX A;  4ESB A;  3GLX A;  2GQQ A;  4LLN A;  4ON0 A;  3Q9S A;  4L9N A;  2TDX A;  1QQI A;  5FB2 A;  5LHG A;  1P92 A;  3KFW X;  1K79 A;  2E7X A;  5L3G A;  3GYH X;  3VFZ A;  1ZLJ A;  4AWX B;  1R00 A;  3SXY A;  4I02 A;  3JAM K;  1WKM A;  2VT2 A;  4UNO A;  2FBH A;  4CGZ A;  3LQQ A;  4ASN A;  4XSX F;  2K27 A;  4MTD A;  4CXF A;  2EV0 A;  4Y13 A;  5K5R A;  3CLO A;  4ZYH A;  1B6A A;  3ECH A;  3IKT A;  1O3T A;  4NQW A;  5F1R A;  1DUX C;  3RIR A;  3KP4 A;  5BQT A;  3CUQ C;  3RDI A;  2Q8K A;  3E5Q A;  3P9C A;  1SMY F;  3WU1 B;  4EM0 B;  2MH2 A;  3BJO A;  1S8N A;  4EJO A;  2FOK A;  2DW4 A;  3OOP A;  2LNB A;  5DDG A;  3BY6 A;  4OIO F;  2QQ9 A;  1W7P A;  2F5E A;  2RGV A;  5J8C A;  1T98 A;  1HKS A;  5K5Q A;  5FLX Z;  3LA2 A;  4RS8 A;  4D0P A;  2FNA A;  3KP7 A;  2BE5 F;  5J8F A;  3IWF A;  2V9V A;  4RGX A;  2QYO A;  5D5V B;  4QLC U;  2E1C A;  3SZT A;  4L5I A;  4FX0 A;  3REO A;  2XAS A;  2UXN A;  2XGX A;  5BOX A;  5CYV A;  4HDU A;  3TOA A;  2B0L A;  4MNU A;  4WK8 F;  3ZP5 A;  1FSH A;  4U0Y A;  2RV8 A;  1TQP A;  3QAH A;  4L0Z B;  4KT5 C;  2V1X A;  1I1S A;  3FZV A;  3GX4 X;  4WWC A;  3W6K B;  2IW5 A;  1XSD A;  1Q1H A;  3IHU A;  4I2O A;  2A68 F;  4M6Y A;  4EV0 A;  1SFX A;  4XRF A;  2QUF A;  4OMZ A;  2A3S A;  3GFM A;  2EFW A;  1B9M A;  1YG2 A;  4JBA A;  4B09 A;  4A0Z A;  5CVV A;  4AIK A;  3BJ6 A;  5HS9 A;  3HHH A;  3P9I A;  2WTE A;  2ZXJ A;  4LK0 F;  1S6L A;  5HS8 A;  1U6G A;  2IA1 A;  4UVA A;  2GIV A;  5E8G A;  1V4R A;  4HLX A;  1R1U A;  4GYI A;  3M8E A;  5ICE A;  2STW A;  3FHZ A;  4YII A;  1SFE A;  1D8J A;  3FMR A;  3U1D A;  3F8F A;  1TQM A;  2LF8 A;  3VEP A;  2IVM A;  1OR7 A;  3EYI A;  3HRT A;  2HEO A;  4P55 A;  3ZMZ A;  3F3X A;  3WGH A;  2QZ8 A;  3TDU C;  2YPR A;  1O7L A;  3DP7 A;  4R8H A;  5EEH A;  4IJA A;  2KIM A;  1R5H A;  4PCQ A;  1MJ9 A;  3F8B A;  2WV0 A;  2F5F A;  2M8E A;  5L3D A;  3WOD F;  2ZME A;  2BYV E;  3TQN A;  2IP2 A;  5CLS A;  3HSF A;  1MJA A;  2W25 A;  4H0E A;  3HTS B;  1HW1 A;  2RQP A;  1EH7 A;  1HW2 A;  4WF2 A;  3BOQ A;  1LDK B;  3SHF A;  3MZY A;  2DTR A;  3BPV A;  1FYL A;  1NHA A;  3B73 A;  5DUK A;  1CF7 B;  3CUQ B;  1FLI A;  2G7H A;  2IJL A;  3ZMV A;  4LK1 F;  4ENM A;  2O03 A;  1YO5 C;  4HAM A;  4ENK A;  3FXQ A;  1ONV A;  2FU4 A;  5JFR A;  5DD4 A;  4RB3 C;  1XDS A;  4KNY A;  4L0Y B;  1QO0 D;  2AXL A;  4ETS A;  3K9T A;  2EB7 A;  5IT9 K;  2H09 A;  5D5W B;  4UUV A;  4LB5 A;  1ZG1 A;  4RAZ A;  3P9K A;  1BM9 A;  5AIQ A;  3CO7 C;  1B1B A;  5DCM B;  1XMK A;  4IRI A;  4KIF A;  2OD5 A;  2QM3 A;  5BMZ A;  5BPI A;  4ENJ A;  3RKW A;  5JVT A;  3RPQ A;  4RB2 C;  2L4M A;  3MEX A;  3EQL F;  4HQM A;  3TKY A;  1B9N A;  4O3M A;  1FP1 D;  3O3K A;  4LD5 A;  1JHH A;  1ZAO A;  2LF7 A;  4BHC A;  2K7L A;  2LKP A;  1PUE E;  3T1B A;  1FZP B;  1Z6R A;  1RUO A;  1HBX G;  1H0M A;  2Z9O A;  1T38 A;  1FBU A;  3HTU A;  2Z99 A;  3FMS A;  2HS5 A;  3BWG A;  1UHW A;  2MLK A;  2HQR A;  3FXR A;  3KE2 A;  1LNW A;  1QNT A;  3DFG A;  1P4A A;  4P9U A;  3V7R A;  1WRJ A;  5E17 F;  1FX7 A;  3EDP A;  2AS5 F;  1ZGA A;  4HYE A;  3J7A O;  3RYP A;  2ZKZ A;  3B02 A;  4GYG A;  2A61 A;  5D6E A;  1IAW A;  1PDN C;  4RB0 A;  1OYW A;  1RIO H;  1BIB A;  1KU9 A;  3I0T A;  5LGU A;  2E7W A;  2HR3 A;  4WXC A;  4HX7 A;  3JTG A;  2K02 A;  1UHM A;  3GFI A;  5ICC A;  3F6O A;  1ZRE A;  3KEO A;  1F5T A;  1LB2 A;  1YYV A;  1XMA A;  4AD9 A;  1W7P B;  2DLL A;  5D4S A;  4KMF A;  3E97 A;  2NS0 A;  4ZYG A;  2DPU A;  3I64 A;  4HOB A;  3IL2 A;  4FX4 A;  1MJB A;  4WXD A;  3J80 K;  2VBZ A;  2EA4 A;  3TO6 A;  3IKV A;  2CG4 A;  2D1H A;  5LLQ A;  5HDG A;  1BI3 A;  1T0F A;  4M9X A;  3GZ5 A;  3KZZ A;  1DP7 P;  3GFJ A;  4MTE A;  2NNN A;  3F6V A;  5D5X B;  2DO7 A;  1ZG5 A;  2MA3 A;  3E3V A;  5D4R A;  4O6J A;  3RPU A;  1MDM A;  5DYM A;  1U5T A;  4OIQ F;  2O6G E;  4MEX F;  2PG4 A;  2Z33 A;  4G7O F;  1ZRF A;  2F5C A;  1U3E M;  4LB6 B;  5LHH A;  3ZPL A;  3WG9 A;  1KYZ A;  3DQV C;  4O5V A;  4EJW A;  1G3S A;  4KFC A;  3ZMU A;  1R58 A;  3NRV A;  2DAO A;  1XN7 A;  2OQR A;  3ABT A;  5CVI A;  3KP2 A;  4UVC A;  1IF1 A;  5EEG A;  2C6Y A;  2FRH A;  4IF4 A;  2XIG A;  5DCF A;  5E1X A;  3T5X A;  3WTT C;  3L2C A;  4KN4 X;  3KP3 A;  1XCB A;  4A0X A;  2RC4 A;  4CZZ A;  2OZ6 A;  1J5Y A;  1O7F A;  2PMU A;  4A6D A;  1YTY A;  4EJU A;  3EET A;  2L02 A;  2P5K A;  1YIO A;  4IHS A;  2P6T A;  1P6R A;  1IW7 F;  2ZFW A;  5TRD A;  5DUI A;  1IN4 A;  2PBI A;  2EFQ A;  4EJT A;  1D8K A;  2UWM A;  5FFX A;  2E1N A;  2ZME B;  2XKO A;  5K5O A;  3J81 K;  2G9W A;  4N0B A;  2V79 A;  1IRG A;  3R6S A;  1Z7U A;  2YSR A;  3C1D A;  1U2W A;  3G3Z A;  5HS7 A;  2STT A;  1H9T A;  5E1W A;  2F5D A;  5ED4 A;  4BHP A;  2D2W A;  3ZMS A;  1KU3 A;  3E5U A;  4ESJ A;  1PP8 F;  2H6B A;  2CWE A;  2VC0 A;  1ZHF A;  3V8J A;  3RKY A;  2Y48 A;  2COM A;  2EJR A;  1LVA A;  5D8K B;  3LWF A;  1O3R A;  2QWW A;  3QRF F;  2ZNY A;  1XSX A;  5FFZ A;  1K78 A;  3IC7 A;  4PGG A;  3DF8 A;  4HBL A;  4XLN F;  1W5S A;  5E18 F;  5E8I A;  1I27 A;  2DFI A;  1HW5 A;  3FM5 A;  1OMI A;  3L7W A;  1LDJ A;  2VOD A;  2H27 A;  2GWR A;  1UCR A;  1AOY A;  4HA8 A;  5ICG A;  4K2E A;  1TW3 A;  3TGN A;  1S29 A;  3FM3 A;  4G6Q A;  2G7U A;  4KUM A;  4A0Y A;  2A07 F;  4HV6 A;  2HZT A;  1XDU A;  1HXD A;  1JHF A;  3I5U A;  4UHT A;  4BNC A;  5LEK A;  1EV7 A;  2LSO A;  2IRF G;  2XHK A;  5LHI A;  1TQI A;  2BGC A;  3E6C C;  1L3L A;  5KK1 A;  1GXP A;  1QZZ A;  4N9I A;  2O61 A;  2FE3 A;  4KIG A;  5HLH A;  1W4M A;  3Q9V A;  1YLF A;  5HOO A;  1ZN2 A;  1J7K A;  3M7G A;  2R3S A;  5ILS A;  4S04 A;  2BEO A;  1S7O A;  3DPT A;  1ODD A;  4EQQ A;  1BIA A;  1OYY A;  4FT8 A;  3FWE A;  2XAQ A;  3N97 A;  4I7H A;  1G4D A;  3HRS A;  4HX8 A;  3JSO A;  3EUH A;  3WGI A;  2PMH A;  4BYY A;  4CIC A;  4AIJ A;  1Z6T A;  4I0B A;  1F1Z A;  4U7B A;  3D0S A;  1SFU A;  2FBI A;  1SD6 A;  1WSU A;  2DBB A;  3M8F A;  2ISZ A;  3MWM A;  1LJ9 A;  2HKO A;  1FY7 A;  3ZMD A;  3I59 A;  1CGP A;  4AIH A;  1UST A;  2DQR A;  1BJA A;  1R23 A;  1V3F A;  4EVI A;  4MQ9 F;  3GUD A;  2KKO A;  3I53 A;  1XGM A;  3GZ6 A;  1J9I A;  2D45 A;  1YW7 A;  2O8X A;  3JSP A;  1GXQ A;  2ZCW A;  2GA2 A;  2M30 A;  1IN7 A;  3G73 A;  3TO7 A;  3WE2 A;  1KGS A;  2KJB A;  5IT9 Z;  4RGU A;  4UVB A;  2P5L C;  4A2U A;  4M71 A;  3HSE A;  1Z1D A;  2XV4 S;  2FQ3 A;  3VOD A;  3HOT A;  2WC2 A;  2L54 A;  4M74 A;  4HZF A;  4EJV A;  2M1B A;  5D6F A;  1ZLK A;  2X0L A;  1XGO A;  1LEB A;  1ULY A;  2H6C A;  1G3T A;  3BRO A;  5KVR A;  4G9Y A;  4I0A A;  1R7J A;  2EWN A;  5JR3 A;  1O57 A;  4LG0 A;  3SZP A;  2ZBK A;  1F9N A;  1ZRC A;  1E17 A;  2EK5 A;  1J2X A;  2HOE A;  4S05 A;  4U0W A;  3TDZ C;  3F8N A;  1TNT A;  3O6B B;  4Y15 A;  1BOA A;  4A12 A;  1YS7 A;  3K1M A;  4N9H A;  3V7S A;  1G3Y A;  4Q47 A;  1KQ0 A;  5H6R A;  3WE3 A;  5HVQ C;  1PP7 U;  4XSZ F;  2NRA C;  4GXO A;  2QBY A;  1YFH A;  3VOE A;  4HLY A;  4ZH4 F;  2MC3 A;  3BZ6 A;  2F2E A;  1S3J A;  2DPD A;  2PEX A;  2QEN A;  3NEU A;  3O2P E;  4JQF A;  2VON A;  5HLI A;  5AON A;  4A6E A;  2XRN A;  2YX7 A;  1OPC A;  1RI7 A;  5ICF A;  4FHT A;  4YFK F;  3ISP A;  1UB9 A;  3T8T A;  4EM2 A;  3ABU A;  2K4J A;  5LEJ A;  2XAJ A;  1TW2 A;  1QBJ A;  5CVR A;  3LFK A;  2Z5U A;  1O3Q A;  3QU3 A;  2DU9 A;  2LDU A;  3ZN1 A;  3LA3 A;  4E70 A;  1YW9 A;  4ZZD A;  5K1Y A;  2L3D A;  2ESH A;  1ZH5 A;  2HKX A;  2W24 A;  2R7F A;  2W85 A;  2UZK A;  3J80 Z;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...