3AG4H

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag4H00
1V55H 3AG2H 2EIMH 3ABKH 1OCCH 3AG1H 2Y69H 2EIKH 3ASNH 1OCOH 5B3SH 2DYRH 3AG3H 3X2QH 3ABMH 2EIJH 1OCZH 3AG4H 1V54H 2OCCH 5IY5H 2EINH 2ZXWH 2EILH 3ASOH 1OCRH 2DYSH 5B1BH 5B1AH 3WG7H 3ABLH
chains in the Genus database with same CATH superfamily
2K3PA 3JSOA 1HDDC 2K27A 3LSGA 5HLGA 3D5LA 3PNYA 3WTXC 4QTRA 4LLNA 1TWHJ 4XN0A 3SEQA 1FIAA 2L9VA 4O6JA 3K10A 3CF5F 1IN8A 3DQVC 1Q1HA 2CH0A 1IV8A 1B9MA 1KONA 4OAZA 1OLTA 4IOCF 3AL0B 1TC3C 1IN7A 1CF7A 3LQRA 2KZGA 3UNGC 3AL0C 2AQEA 4U0VA 2IXSA 2EFPA 2K4JA 1IJWC 3E6CC 2YU3A 4EVIA 3KEQA 2XF7A 4D9JA 1VTNC 3C3WA 2DXIA 2M1BA 3FXRA 1J0RA 1FMVA 4PK4A 1V5EA 5TGTA 2R7UA 2DK8A 3SZGA 1KU9A 4GCVA 4C9YA 3MWMA 2BW3B 2RKHA 4A3FJ 4IXAA 2O03A 3BTIA 3CLQA 2L7KA 2OCCH 5EGOA 3R60A 3BJOA 3G2BA 1MMGA 3CLOA 1U9NA 2JRTA 2R7FA 2P6SA 4HX4A 3CCMI 2FU4A 2ZJPF 2H8RA 2CFOA 1B72A 4E7KA 1R23A 1RZ4A 1RRJA 4CH7A 5HS7A 1RNLA 3DFGA 1AA7A 3E5XA 2ETHA 3ZP5A 2IA2A 3TO6A 3FZVA 3K1PA 5HS9A 1IXCA 5H20A 5M3FJ 2Z3YA 2K86A 4G94A 4C2MJ 3CCQI 1LDKB 4XONA 1ZLJA 3H36A 4QSHA 2VONA 4JX4A 2XRNA 1LVKA 2E1MC 1HOMA 1BR1A 1R5GA 4DZPA 2CU7A 4HDVA 2R7VA 4G6TB 6PAXA 3MVPA 1R71A 3GZ5A 3TOAA 3J81Z 4KNYA 4F55A 1R9TJ 3K2ZA 3OL4A 1OR7A 2ZKZA 2LBFB 2CUZA 2FX0A 4XICA 1MH3A 1AHDP 2DI3A 4A5MA 4UXNA 4BS9A 3P9IA 5JVGF 3WHBA 3BT9A 3HPHA 1B8IB 1TQPA 2UXXA 4FISA 1OQYA 2H1LA 3N4MA 3C18A 2KIMA 1J59A 2CUFA 2JA2A 4XRSA 3G4SI 1FYMA 1XX5A 4ZZDA 3K69A 5FKKA 4CYCB 3BJ6A 4PJJA 2R7DA 2RGVA 4FETA 3PSIA 5FLXK 2M4KA 4H0EA 3HOWJ 4A3GJ 2DMUA 1Y8RB 3ABUA 1SFEA 1Z05A 1VFCA 3LMMA 1VQLI 3DKXA 2OD5A 3FHNA 2HVRA 1HKQA 4P55A 4ETSA 2JMWA 4HZFA 3DKYA 2ELHA 2OQRA 3R4KA 3FKJA 1JKRC 3JSPA 4GGGA 4HOBA 2FMYA 2EZLA 3OYHA 1FPQA 3RYPA 5KVRA 2X85A 2A68F 3IV5A 4L0ZB 4KT5C 3LSIA 3OYJA 1WJAA 2COMA 1X58A 2P7CB 2LKSA 2R7XA 1OCOH 4ZTJA 2VC1A 2L7FP 1OISA 2LP0A 1UMQA 1KYWA 1Z7LA 3A01A 1T0FA 3HC7A 1AOYA 4RBOA 3GMEA 4P5OA 2LFBA 1FLIA 3OYDA 2WTEA 4U7DA 2TDXA 5EDNA 1QU3A 1DP3A 5ILUA 4I99C 5J6XA 3FHZA 1PUFB 3WGIA 2ESHA 2MH9A 3EUKL 3ECOA 3CMEI 4WXHA 3KEYA 2PEXA 2WV1A 2CWEA 3LSMA 4AWXB 5DDGA 3AG1H 4XKCA 4GXOA 5BMZA 2VJ4A 4GRIA 2R5YB 2VKDA 1YJ9I 2GWRA 4ZYGA 2K3FA 2MD5A 1UHMA 5M3MJ 1OCTC 3BPXA 1VQNI 2DFEA 4L5JA 4OAYA 4BE1A 1R36A 4XLPF 1QA6A 4I0BA 3JRBA 3H9JA 3GFJA 2ADUA 3BOQA 4CCKA 2MABA 1P4WA 2QKLB 3BTCA 1XG1A 3GX4X 1ZELA 1VQPI 2DA2A 1O57A 4HEA2 4XSZF 3QRFF 3ERMA 1FJLA 1YJWI 3HL2A 1FP1D 2D1HA 4DNCA 2DA7A 2VUMJ 3MN2A 1YX3A 4FT8A 3T8RA 4C2TA 4KIFA 4LFUA 2XF6A 4JBAA 3E3VA 3P7NA 3OR1C 4P1WA 2DA3A 5B66C 4B3XA 3BP8A 3Q3SA 5ILVA 3FXQA 4KMUX 3KZIC 1I3AA 1MSEC 2F4IA 2VQCA 1Y6IA 4AVZA 1TNTA 2HOAA 2X4HA 2RQQA 1NK2P 1B6AA 1TLHB 5CVRA 5H6QA 4CSWA 2YU9J 5LBQA 4UB6C 4UUSB 1YG2A 9ANTA 2L54A 4A5NA 3CC2I 2RQPA 1BJAA 4EJUA 3TMOA 1E0EA 4KN7X 4WK8F 4O3MA 2BV6A 4HQEA 1H9GA 4E7HA 2P5KA 2ZNYA 1XSDA 1X3UA 1XSXA 2L5QA 2AO9A 3KE2A 4FASD 1L0OC 5CYVA 4I98B 1JUPA 5CJ9A 4LB5A 3M7GA 2W00A 2GIZA 3CQZJ 1Z6TA 5GADJ 4L0YB 3HGGA 2R7SA 4MLOA 2DAOA 1QZYA 3QU3A 3ROUA 4IZZA 2OBPA 1YE9A 2AXTC 3FXMA 4LIUA 4PSWA 2DLLA 3DBRB 2PJRB 4EEFG 1Z3XA 3GXOA 2P4WA 5K7ZA 3LOCA 3BR5A 3RCOA 4A0XA 4AVPA 1J7KA 5ERIA 4KN4X 4XK4A 2QSGX 5KCMA 3H5RA 1EKEA 4EJTA 3DV8A 5BOXA 3LWFA 2DQLA 2V7FA 4I76A 5IYDJ 3MMYB 3HPGA 3TP0A 4YEJA 3MKYB 3ASNH 3TL4X 2FQ4A 4CICA 2KL4A 1X1PA 2FA5A 4RB3C 1YHQI 4XLAA 4XN3A 4EJOA 1UB9A 2MSYA 5ED4A 1J75A 2HWVA 3L2QA 4YG2F 1S7EA 4G7ZF 3WU0A 1Y0UA 4UUVA 3EQLF 4NUBA 4MGRA 2F48A 4JOMA 2IS1A 4Y13A 1WCMJ 2QVOA 4X6AJ 4UNOA 2FOWA 5FFXA 1DU0A 2ID6A 5E3MA 4GFBA 2LRDA 3BJAA 3A1YA 1XC5A 2LD5A 3ZQHA 3FKIJ 3RKQA 5HLIA 4FX4A 3KPHA 3OYMA 3K6GA 2Z1DA 4DZJA 4B44A 4ESJA 4A3IJ 4A3DJ 1A04A 4IF4A 2BYVE 4RM2A 5DM6F 2LNBA 5FKLA 1IV6A 4A3MJ 2BHZA 1MDMB 1OCPA 3OYLA 1Y0NA 2KIFA 3E97A 4YFXF 2H6CA 1PP7U 1ZRDA 1YRNB 2LH9A 5K5OA 1LFPA 3PO3J 1FP2A 2X6OA 1HW1A 2K9SA 2HXOA 3F72A 1R1UA 3HXLA 3FK7A 2XSDC 2M3AA 2JA8J 2PLYA 2EFQA 1XS9A 1A31A 4A3BJ 3PNVA 3ZQQA 2NVXJ 3NRVA 3VODA 3BY6A 1K6YA 3IC7A 4EM2A 3J81K 1G3SA 5FROA 2UXNA 5K5QA 1TWCJ 4HDUA 5C44J 2OC6A 2VIXA 3H5NA 1J09A 1GLNA 1R00A 3EDPA 3F21A 4X1EA 2O6GE 4KDPA 1S7OA 2WY8Q 1EJ9A 4XLNF 3ZRGA 4XKBA 1QO0D 4KMFA 3CDHA 2F4MB 3M8FA 2ZO4A 2HU9A 2HYJA 2ME6A 1N75A 1RKWA 1WWXA 5EJCA 4YIRX 1XDSA 1K61A 1MBGA 5DTDA 4YFNF 2QBYB 2OF7A 2M45A 1HCRA 1C0WA 5LFAA 3S1RJ 2Z9OA 2DW4A 1UAAA 1W4MA 4RGSA 2M4GA 3OYEA 3RZOJ 4A3JJ 3T1BA 4OIOF 1QVUA 2BGCA 3BZ6A 3K4BA 1FOKA 4XL9A 2FBKA 2V1NA 3F6VA 1ZG3A 1WJBA 1YS7A 2M30A 1R5ID 2XKPA 4ITVA 3KYCB 4BY7J 2VXZA 1S5LC 5A2QZ 1VQOI 1K83J 1R7JA 2BW3A 2IPQX 3WTTC 3G6EI 1SEUA 1V5GA 2OZ6A 1I39A 2QENA 2WC2A 1AKHB 1Y8QB 2HQNA 2VQGA 2JPCA 4BACA 4PZJA 4ZTFA 1NTCA 2EBIA 2DDBA 2FEZA 3I0TA 4N4NB 4HNUA 2GQQA 3V42A 2XDVA 1RR7A 1ZHFA 1JJ8C 1V3FA 1RKTA 2H94A 2WB1A 5ILSA 3WTWC 2F4OB 3HG9A 2FE3A 3CO6C 1M1EB 3GTOJ 5D8KB 1IN5A 2E60A 2V9PA 2MYSA 4HX7A 3REOA 1IUYA 2M87A 2MA3A 2L7MP 3QPHA 2CSOA 4ANJA 3RJPA 2RVCA 2MBFA 3V4GA 3JAMK 3J80K 5EEAA 2HDWA 1X1BA 2E71A 2TRTA 1MNDA 3G1OA 3GEZA 1ZN2A 3CUQB 3O6BB 1W36D 4F93B 5BNGA 3B6CA 3HSEA 3MEXA 2YR2A 2CQ7A 2E19A 2FJ1A 2DOFA 1PVEA 4FQGA 3TBIA 2IRFG 1FZPB 4MFDA 3VYRB 2LBFA 1YOVB 1Z6RA 3E0JB 1BM9A 2KZVA 2XPVA 3QOEA 2GM4A 3CO7C 3CCSI 3GTMJ 5DD8A 5J1RA 1SFKA 2WADA 2W24A 1E3OC 2CQQA 3DPUA 2HOEA 3S3NA 4M9SA 4IHWA 3KFWX 4A69C 2Y30A 4ZC3A 1W5CC 3A02A 2G9WA 4BHBA 2M7BA 1GXQA 1OCRH 4CYCA 1UZCA 3UR3C 2FNAA 2J5OA 2LKXA 3J7ZI 2H6BA 1ORKA 1VI0A 3EETA 2LVSA 3DEEA 2LREA 3S32A 5HOOA 1VZ0A 2E34A 2GIVA 4I01A 2VE8A 2DBBA 3OIPA 2BHYA 5D5UB 4QIWN 5KHDA 2RDPA 3QPLA 4IHTA 2MD0A 3NQOA 1IN6A 3SQNA 1MSFC 2ECCA 3RKYA 2OJED 4NBQA 4J00A 4RB2C 2VASA 3M1CA 3GZ6A 3MZYA 3FMRA 5EEGA 5IPAA 3H9QA 1ETXA 1SVMA 2DU9A 4UVBA 4BEHA 3BR6A 4G6QA 1D5YA 2KRHA 1GDTA 1FY7A 5FKMA 5ICCA 2M2EA 4YRVA 1G8XA 2ESNA 3TW6A 3U1DA 1H88C 4P9UA 2KDOA 3N97A 5JLXA 1JGSA 2G0EA 1FBSA 2E36A 5J1YA 1Z67A 3L9FA 3F0CA 1PUFA 3LFKA 2PFBA 1TNSA 2VJIA 2Z16A 3FMSA 4R8HA 4I0AA 1TT0A 1YYVA 5K1YA 2MGQA 2W57A 4XQFA 4UVAA 1MMSA 2XGEA 3AG2H 3GUDA 2R5YA 2GXGA 2EIKH 3I53A 4J19A 1CGPA 4C2UA 2GAUA 2PJPA 2ICWG 2Q0OA 3O3KA 4XLFA 1F5TA 3OL3A 2VBZA 3IP4B 2IAIA 4D5CA 2XB5A 2QYOA 1T2KA 4L9NA 3U21A 3EUHA 2A5YB 1PJRA 2LLKA 3PQJA 5LHHA 1MGTA 4U0WA 4HA8A 4XRMA 2CUJA 5JHFA 1X1AA 1ZARA 4BJ5C 1BC7C 1EH7A 5FO5A 4N9HA 5EG0B 3GFIA 2JRMA 5LLQA 4HNTA 2X0LA 1ENHA 1DQUA 1Z1DA 4KIGA 3VEPA 3F8NA 3VOEA 1VQKI 1E2XA 2CW7A 3IH3A 1R6RA 2R3SA 5CPRB 4MTEA 3PIOF 1JTXA 1R4MB 3LAJA 1VQ4I 3BPVA 2JA5J 3CD6I 3AAFA 4U87A 1GT0C 3CCJI 4BDZA 1UHWA 5DCMB 1ETOA 1P9QC 4DYRA 2MC3A 3BROA 3HJEA 4PGHA 1LUJB 2MW8A 4M6VA 4II2A 4PCQA 2EK5A 1VQ5I 3HOVJ 3B73A 4XOPA 1U9OA 2JT1A 3QOPA 4UUSA 2VLAA 1HW2A 3ZR8X 4DW6A 3ZQGA 3DPLC 4D7NA 1B59A 3QQAA 5K5RA 2P5LC 3AG3H 3RYRA 5E8GA 4B1RA 3BWGA 2BY2A 2M0CA 3VDXA 1E3HA 3KLOA 4GDFA 1R4NB 3OS0A 1ETWA 1ODDA 1BI3A 4EM0B 2LTPA 3CDIA 3HUGB 3I71A 4EM1A 2CGPA 4WCGA 4E7JA 1V5FA 2RNGA 4BUPA 2D1VA 2B9SA 1MBKA 3PQKA 2CV1A 1QGPA 3Q0UA 4Q5SF 1UG0A 2HZDA 5L3BA 2DPUA 2BXYA 4PJNA 1SANA 3OIQA 4G7OF 4AIJA 5BQTA 3ZOBA 1QBJA 3JRHA 3QYFA 1LEBA 3OYBA 1GUUA 5E1XA 4WXCA 2Z33A 3ZXSA 5JLWA 3G3ZA 4J01A 1HSJA 3MQ0A 1X2MA 2PJRA 2CO5A 3HOZJ 3DLAA 1V4RA 2LSOA 1TT5B 1HXDA 3ZMDA 3RQIA 3HKZA 1RI7A 2P8TA 2STTA 1WH7A 2ZXHA 4A3LJ 3L2CA 3HOXJ 3U2RA 2FBIA 1P7IA 4DIQA 5LEJA 2VN2A 3HKZN 4LIVA 3WTYC 3MFKA 1I6XA 2ZXIA 4MFEA 1W36C 4D0PA 4DYQA 4XLHA 2LY1A 4GO1A 1A6QA 3CCVI 3VPRA 1N25A 2DK5A 2EIJH 1ZQ3P 3S1NJ 2IS4A 2NS0A 2LY2A 3F23A 1IW7F 2VXDA 2FSWA 2IEKA 2Q1ZB 3ABTA 4M3DA 3P9KA 4EJVA 2B7EA 5A2QK 2Y48A 1HDPA 4XKVA 1LDJA 2GOMA 5EF6A 4BQQA 1U8BA 2QLZA 4BXUA 1YJNI 3KP6A 1QQIA 2OAZA 2A3SA 3WHCA 3BLYA 2EV5A 2DT7B 4IKFA 3LA7A 2Y0MA 3ERED 1K79A 1ZRFA 2FNPA 1P92A 5IT9Z 4EGYA 3LA2A 1NG6A 3KEOA 2X6XA 1P4AA 3QYEA 1BIAA 4JQFA 4BE0A 1MDMA 2HTSA 2O7OA 1B4AA 3S8PA 3DWLE 1YRNA 4M3EA 2ZJQF 3WTVC 2VI6A 3L00A 3S1MJ 1LQ1A 4Z2YA 2DA4A 4M3GA 4Y15A 3SFZA 2EA4A 1TP4A 1ZLKA 4C3JJ 4XOTA 2VPRA 3BCAA 1WGXA 4V19K 3S15J 3I54A 4NC7A 1EV7A 2O0YA 4ZDPA 4BJTA 3ZMUA 3DLLF 1D0YA 4Z6YA 1Z7UA 1NG7A 3OR2C 4RB1A 4HPQA 4RS8A 5J3LA 3F8BA 3ZMZA 3CJNA 3LL7A 3SEZA 2I8DA 3V8JA 2BVLA 2DTZA 4BBSJ 3BQZA 5AIPA 4OIRF 2W4SA 5LD2C 1REPC 4FCYA 1D8JA 3WG7H 2XROA 3RTRA 1GVDA 3NWTA 1BI1A 2EFNA 2OZUA 3CP2A 3ZN0A 3C2HA 5J8FA 3RKWA 1LPQA 1ACIA 4LLGF 2QBYA 1IRZA 1QNTA 1Y1VJ 1DGWY 2HQ5A 4S04A 3U1KA 1JE8A 3ML6A 4Y17A 2MH2A 2EWNA 4AUXA 2VOOA 2LC2A 1FOWA 3PL8A 3F8MA 3IHUA 1DGRM 2XGXA 1JHHA 2W1OA 2UWMA 1T56A 4ESBA 4KYWA 2PX9A 5DUKA 1T98A 4UY8I 3ULQB 1HBXG 1XD7A 2O61A 2V6EA 2IBDA 3S93A 3K4CA 3VFZA 4B48A 1DPRA 2O9LA 4XSXF 4CCMA 1RPWA 4G7HF 2J5PA 2XPUA 2Y69H 4JYKA 4M9XA 1S72I 3DU5A 1AKHA 1R1TA 5FLMJ 1FBUA 2XAJA 1YW8A 5CVJA 2YX4A 4FE7A 4LGWA 2M5WA 2V1XA 4BHPA 2L2OA 2ZJ2A 4BY1J 5IP9J 4ESFA 1USTA 3ZMVA 3EUHC 4V2GA 1OPCA 3N05A 2COBA 2JSPA 4XRFA 4V2FA 3M07A 3LSKA 2GA1A 4UUTA 1U5TB 1RUOA 4S05A 2E7XA 4QLCU 2X1EA 1XGOA 3SDBA 4IQ4A 2VBYA 3DTIA 3CUQA 3X2QH 1DP7P 4NHJA 2ISYA 3A0BC 4A3CJ 2P5VA 4RAZA 2R7QA 1MKMA 1QPMA 1VF9A 5LHIA 4I7HA 1JKQC 1X3ZB 4DYCA 1D1AA 2CMPA 2Z99A 4MQVA 2DO7A 3RSNA 2F5VA 4ABZA 3L2UA 1YIOA 2XPWA 1LE8B 2IS6A 2DFHA 2IA1A 3OOPA 4IRHA 2HYGD 2V26A 3HRUA 2FUG2 1JXSA 1IUFA 3DTEA 1MMAA 3HBLA 3LA3A 1ZKGA 3O2PE 3R61A 2K9MA 2ZB9A 4HV6A 2L7ZA 1IC8A 2JVHA 3I9V2 4ENJA 1SFOJ 5GAEJ 5D6FA 5HLTA 2JWTA 1OYIA 1W1WE 3E5UA 2BE5F 3I5UA 4KUMA 5EZGA 3TDUC 1OMIA 2KQRA 2FMLA 3C1DA 3H3ZA 1FIPA 4D7MA 2HYFA 1LB2A 5B1BH 1QRYA 2JA6J 1JHFA 1WJEA 4HW0A 3KP3A 1OKRA 5F0HA 3BQYA 3PM1A 1U8RA 2VKVA 3L2VA 2PBIA 5DUIA 1OFCX 1VQ9I 4IL6C 3JREA 4FX0A 1KZHA 4A12A 3OYKA 3ZMTA 1GV5A 2YX7A 2V79A 2DMQA 2E2JJ 4LB6B 2VT3A 4X0GA 1XN7A 2EA2A 3S2HJ 2LMDA 1VQ6I 5IP7J 4XLCA 2M8EA 5BPDA 2QQ8A 1N77A 1FMWA 2VT2A 2Y0SA 3B6AA 2DMPA 4KISA 3P9CA 1IRGA 1SFXA 4QWQA 1BJZA 4UV9A 2IW5A 4G6DA 2Y0SN 1D0ZA 1ON1A 2A6EF 4F92B 4CUGA 1JUMA 3OV8A 4EATA 3BG3A 1G6NA 2KDZA 1QVTA 3CC4I 2XB0X 2NVYJ 4ZYEA 4HYEA 2IGKA 2HXIA 2ZSIB 3ZQ7A 4CYDA 1IXRC 2XAGA 5L3CA 2NVUB 4EMSA 4IOAF 5FGMA 3L2WA 2F2EA 2FQ3A 2LKPA 2BXZA 2OPTA 3EPZA 2HTJA 4BE2A 1TWAJ 4M3BA 3OWTA 2R7RA 1LFUP 2WAEA 4HV5A 5H6RA 3GBGA 1QZZA 4E4HA 5J8CA 3PIPF 2DFIA 3T8TA 4W97A 2VJ5A 5DV5A 4PFOA 3RQ4A 2A05A 2G7UA 3OMYA 3D5RC 3DBHB 3KZYA 5TISC 3A2KA 3H0DA 4A93J 5DCFA 1SMTA 4IQJA 2H09A 2Y9ZA 1ZG5A 2L3DA 3OIOA 2QQ9A 4M6YA 1D3YA 2HGCA 4MHGA 2EZKA 1OYWA 3FWEA 2VPLA 3W2WA 5EG0A 2H1KA 3BG5A 1OYYA 2O3FA 1SD5A 2DQRA 3GF2A 2EFOA 4ZYAA 3QP6A 3I3LA 2VJJA 5JI6A 1W0UA 2HPMA 5IOYA 5HDGA 4DJAA 4IHVA 1S3JA 2Z5UA 3S2WA 3L7WA 2WWYA 3RKXA 5DCMA 2VB6A 2X6YA 3ZQLA 2ZMEB 1J5YA 3V7CA 5HS8A 2ZCWA 2M7AA 2ZMEC 2ZXWH 4EQQA 3VSKA 5KNLA 2A07F 2STWA 1APLC 4L9TA 1Z3YA 2CYYA 2XHKA 2HEOA 1ZR4A 5IT9K 3EUAA 3TKYA 1RUNA 2PN6A 4WWCA 4AU7A 3OYCA 5FD5A 3DXJF 5LRRA 3RPQA 2E1NA 4ZDOA 3OYGA 4LG0B 2QM3A 4XORA 4L5EA 1MBHA 2Y2ZA 3QODA 2ZJRF 2IGMA 1BIBA 2F5EA 4LITA 1RIOH 4BQAA 2JUGA 4LK0F 4HLXA 3T5XA 3TEDA 1BW6A 4F3QA 5GTIC 1HF0A 1FC3A 4BDYA 2E7WA 3HUGA 2UV1A 5DYMA 4ZYHA 3FXKA 3SHFA 3FXJA 3HSRA 4AYBA 4K2EA 3HDDA 4CO8A 4FE4A 5FKNA 1SMYF 2V9VA 4CCOA 3J7AO 2WAQA 3PSFA 2E35A 4II3A 4YIIA 3LSJA 5ICEA 2K02A 3MCZA 4AYBN 1KQ0A 2CQKA 1GHCA 1FX7A 2VKEA 3HZJA 2D2WA 3HIFA 4NC8A 1I3QJ 4IRGA 3G1LA 3PFIA 5FB2A 2MLGA 1KGSA 3K4NA 2L4MA 2VL8A 4YELA 1UFMA 5LGNA 4RLFA 5EYRA 1TQMA 3HM5A 3HSFA 4HSTA 3NARA 2CJJA 3GTQJ 3J7AY 4IHXA 3ELKA 3OSFA 3KLNA 4OWRB 4B8XA 1S9HA 4AC0A 5K7FA 2ACJA 1KU7A 4IRIA 2QUFA 2VODA 3GZNB 1FTTA 3OS2A 3H35A 2UZKA 1XCVA 4RM3A 1G2HA 1F4KA 2RREA 4NQWB 3GTGJ 2N8GA 2WB1N 3BR0A 5JR3A 2GOXB 5IP6A 4AIKA 4XBFA 2DYRH 1Z77A 3ABMH 1LFBA 3I64A 4DQ2A 2QEXI 4OINF 3CMYA 1USSA 2XF5A 1FSHA 3V8KA 3CUQC 3CMMA 4DBRA 3W6KB 2Q8KA 4YFKF 4ZJZA 2EV0A 3F6OA 5CQGA 2P81A 1U2WA 1PDNC 2CS3A 3HRTA 3FMQA 3ONQA 4JX5A 5BPIA 1T38A 3ZCOA 1I1SA 4O5VA 3RPUA 3L2RA 2G7HA 1WH5A 4YIFA 1YW9A 5F0CA 5M5WJ 3E5QA 3FDYA 4M73A 2AHQA 5D8LB 4EV0A 3J7YJ 5FLXZ 3L09A 1B8IA 1I27A 3VYUB 3KZZA 4XLEA 2PMZA 1XSVA 1O3QA 3CC7I 1IF1A 1W7PD 3K2AA 3RPUD 3NAUA 2FF4A 1XMXA 1ULYA 4HF1A 2QKMB 5LGTA 3HOYJ 3AFHA 1TW2A 5AIQA 4E7LA 2ID3A 2XAHA 2V6CA 3CZ6A 2NNNA 1UG2A 2PI0A 2RC4A 1PUEE 4E7SA 3FX3A 1FYLA 1UHSA 1LJ9A 5E3LA 5HNFA 2KT0A 1FYKA 1XCBA 3H1CA 4E7IA 3GLLA 1WI9A 2PQ8A 1MIJA 1ZK8A 3GTPJ 1ON2A 1KYZA 4OIPF 1WSUA 1YW7A 4KICA 1U6GA 1Q1VA 1ITYA 2H27A 3TDZC 3IKVA 5HDNA 5E20A 2KIUA 5LRSA 1K78B 2HI3A 2F5DA 1DUXC 2VOPA 1SD4A 1IZ1A 3WU2C 1HLVA 4BAYA 3V8LA 4PGGA 1ZAOA 2XUBA 1MZBA 5L3GA 3RZDJ 2IS2A 1IRXA 2LY9A 3W6VA 3CESA 2Q2EB 2DCEA 1K6OA 5EEHA 4AIHA 1ZGAA 1JGGA 3PFYA 2NOGA 3MKLA 3ESWB 1XDUA 3ZN1A 3SJMA 2XGCA 3PNTA 4LMYA 5FJ8J 5D5VB 2DT6A 4LJZF 3DP7A 3FM3A 3WTUC 1TWFJ 3MKZA 1PYVA 1Z0XA 2PG4A 2HPIA 2LDUA 1V55H 3FXLA 3CCLI 1SAUA 4MQ9F 5F6FA 1S8NA 2A69F 2LF7A 4F52A 3G73A 1P4XA 1BBYA 3PO2J 2W85A 4Y7NJ 5M5YJ 1K7AA 4PJMA 2HKXA 3WU1B 3DEUA 3JTGA 3VYSB 3GTJJ 2EINH 4G12A 1KU3A 3E6MA 3ASOH 1BR2A 3D0SA 2L01A 1Z9CA 3NWSA 4U88A 4LD5A 2YSRA 4RB0A 2QQBA 1U5TA 2WBMA 4KA4A 3ZQCA 5IOZA 1PP8F 1BN5A 5IYBJ 3F22A 2XGDA 3UKGA 2CQNA 4R79A 2JK3A 2IJLA 2XAQA 4HG2A 1T33A 2VE9A 4LLLA 1A35A 2NAZA 3KX2A 4BQNA 1ZREA 3QP5A 3L1PA 1D1BA 1O7FA 2E2IJ 4LK1F 1MJAA 4JK1X 4MNUA 2LG4A 1MMNA 1FOYA 2EPFA 3Q0WA 1K4TA 4HSRA 1ZGJA 3JRGA 1WJCA 4Y3OA 5FFZA 1LE8A 4MEXF 4MEYF 3F8FA 4M9ZA 1FNNA 1SVLA 1TL8A 2FXAA 3EYYA 2CW8A 5E79C 2K40A 1IDYA 2BVMA 4PSXA 5CKTA 3V7RA 1I6HJ 2QSFX 1H0MA 3DF8A 5F0FA 2W84A 4XMYA 3ZPLA 3Q9VA 4RGXA 1WPKA 5AONA 4G8XA 4UV8A 2ZBKA 4WXDA 4ZDLA 2YS9A 2M9HA 2C6YA 2CG4A 4F7ZA 3H3VK 5E1WA 3R0AA 2DOAA 2DYSH 5HVQC 1I1GA 2YUSA 4S0HB 1JT6A 3GLXA 3K4MA 1FTZA 2JUCA 3KP5A 2ZFUA 4BL0B 2CV2A 4A3EJ 5H2FC 2B0LA 4Q47A 1T8IA 2HVQA 3MZ8A 4R1HA 3F9KA 2JSCA 3DKWA 1UJ8A 1MW7A 2R92J 3KP4A 1B1BA 4Y4RA 4E7ZA 2R7WA 1P2FA 4HQMA 1TQIA 2OTLI 3I55I 2RV8A 3OYNA 1HSTA 3M9AA 1OJLA 4ENMA 2OTJI 1XPXA 2I5UA 3DU6A 4RAYA 1ETQA 5E3OA 2NNYA 4XRSG 1JKOC 2HQRA 4OMYA 5C4JJ 3BCBA 2KJCA 2A6HF 1EF4A 1OCCH 2O8KA 1UELB 2DA6A 1Y1WJ 1W5SA 4NDLA 5M5XJ 3TOBA 3S17J 3R6SA 1KQ8A 3I4MJ 1ERDA 4CDGA 2DPDA 3KYDB 1A6IA 3GFLA 3GWZA 3QPSA 2E5NA 1VNDA 1F36A 2DFFA 2X51A 1BW5A 3BTLA 1WFXA 5TJJA 1BOAA 3HTUA 4P96A 4OMZA 4UVCA 2GBYA 2QQAA 3CP8A 1YX5A 3CDLA 2M0MA 4BJ6C 2JVGA 1ZG1A 1W7PB 4IO9F 2VBXA 3FBIB 1TWGJ 2L9RA 2MFZA 4BXXJ 4A6EA 1JT0A 1U0JA 4BGDA 1ZYRF 1FSEA 1FT9A 4IJAA 2E1MB 3OOUA 4XKWA 3GTKJ 1L3LA 3K4KA 2AS5F 5J40A 1E17A 3K7AJ 3LSHA 2BY3A 2XAFA 2YPRA 2AQFA 4RMNA 1STZA 2KRCA 1S6LA 2OV7A 3I56I 2LK2A 2ZFWA 4N4OB 2KKOA 5B3SH 1DPUA 1GVJA 2CFXA 1VQ7I 3OYAA 2DMNA 2ZMEA 3K1NA 3A03A 1WZ2A 2NS7A 4I09A 4GYIA 1IRFA 2VQLA 5D4SA 2Y75A 1HC8A 3CJRB 3QAHA 2R7OA 2KJBA 2GLOA 3QU6A 4ZYDA 1JJ6C 4I2OA 5IYCJ 1JTYA 2K5CA 4LG0A 1G3WA 5K7HA 1BI0A 2DMTA 2X1DA 1K4SA 1T08B 3A4CA 3ZQIA 4BU2A 2W82A 4RDUA 5JHUA 1MMDA 1FOXA 4XM3A 1R49A 4EJWA 2RNJA 3ISPA 1A36A 1U3EM 1ZH5A 1H8AC 4KJZA 3Q5FA 1POGA 3IAS2 1ETVA 4UHTA 3SXYA 4DOZA 2RAEA 2L4AA 1U78A 4RA2A 3HB9A 3SFIA 4G9YA 4BQOA 5B1AH 1Z21A 1HKSA 3FBNB 4BEHB 3W3CA 4DBQA 2HR3A 3ZGKA 3HOTA 2L0KA 4KFCA 3K70D 1IAWA 4Q4ZF 2XSJC 3H92A 2CV0A 2KHMA 2RN7A 5CVUA 4E6KG 3JRIA 5D5XB 2O5RA 1YS6A 1YI2I 3W2VA 4CCNA 2QGUA 2MG4A 4HNVA 2DOEA 1MBEA 4BBRJ 3JAMZ 3J80Z 3TQNA 2Y31A 3GTLJ 3K4JA 1RC9A 3HRSA 5E3NA 1X4PA 4W1UA 4NQWA 4BNCA 1NHAA 3I59B 2B63J 2L9SA 3T0YA 2V1DA 3F8CA 1U5TC 4L18B 1KU2A 3BC8A 4BH9A 3WTZA 5KAFC 2QZ8A 3AKZA 4RAGA 3MKWB 1J2XA 3PUFA 4QPQA 2UUZA 3DBLB 1QZEA 1W5TA 3IRQA 5DM7F 5BS6A 2R7ZJ 1IGNA 4CXFA 2GXBA 4WF2A 3V7SA 1O3SA 5GAGJ 3OSGA 5C3EJ 4IVNA 2W48A 5TRDA 3K4LA 3BZKA 3BG7A 3HHGA 4CCLA 2ELKA 4HF2A 1T95A 5F27A 3RI4A 2P6TA 3COAC 2VC0A 1R22A 5DD4A 2BBYA 3A0HC 3K1MA 3FF5A 1N78A 2HZTA 3GVAA 1S29A 3B02A 4M72A 4N9IA 1JI8A 5FD6A 2VQHA 2HKOA 2P7VB 4F91B 1YITI 3CCEI 3SZPA 2NOJB 4PUSA 2FBHA 1X1CA 3I4NJ 2R5ZB 1RESA 4C30A 3FISA 5FRMA 4XNFA 1X19A 4RGUA 4ZZLA 2A61A 4ASNA 3TW7A 2EB7A 1SC7A 3CCUI 4WX9A 4RAFA 2JA7J 2R4GA 2F6CA 3MAJA 1EH6A 5J4VA 3IRRA 2OUMA 5E17F 2EQRA 2NVQJ 1IXSB 5DEQA 3LNQA 4KIBA 3GCMA 2DA5A 1FWZA 1ONVA 3WGGA 3AG4H 3JTHA 5F08A 4HAMA 1YFHA 4A2UA 3W2AA 2DN0A 3QYBA 1CF7B 4B4CA 1K78A 4LOCA 4B3AA 2K4BA 3FXOA 1ZRCA 1H9TA 4CHUA 2EZIA 2CRGA 2BEOA 2KFDA 3FXUA 3F3XA 2K9NA 2BY1A 4A0ZA 1MD0A 3PUBA 1IO2A 4RLQA 2Q2EA 3ECHA 2CUEA 2XRLA 1BOBA 1WHUA 1OCZH 2XAUA 4KT6A 1YLFA 2E1CA 2IGNA 3C2BA 1ZGWA 5EGOB 1MH4A 4IHSA 5GPAA 4OU0A 1WJFA 4A3KJ 5F1RA 1SFUA 4PFPA 3IAM2 4BKXA 4GYGA 2VBWA 1YTYA 2CW0F 2E5ZA 2KMUA 3IWFA 3O8GA 1B72B 1MNMC 2W25A 4Q48A 3W6JB 3BR3A 3JW4A 4RGRA 1R5HA 3OYFA 3GFMA 4CCJA 4B09A 1FEXA 3FK6A 1TTYA 2FD5A 3E6DA 1X2NA 2NS8A 2M34A 5F1JA 5GAHJ 2F5FA 3E7LA 1GV2A 3HRMA 3CMAI 4I6ZA 3WODF 1MJ9A 2P0WA 3FIWA 5J1UA 3KIOA 1DDNA 3VWBA 3KP2A 1HQCA 3LFUA 2DDAA 5L3FA 3I58A 2HQAA 1I5ZA 1G59A 2JTVA 1HA8A 1OR7C 1D1CA 3GW2A 4TV7A 4NNJA 3HOUJ 2NVTJ 2XC7A 2MLKA 3QPTA 1YQAA 3ZQFA 4BYYA 3R0JA 2IGOA 1NH3A 3OYIA 2IT0A 2EILH 2Y9YA 5L3EA 2K85A 2K7LA 2JPBA 4FTHA 5FRNA 5C4XJ 1BA5A 2XV4S 4JX6A 1RR8C 1AU7A 3H3UA 5KAIC 1IG7A 2E2HJ 2M8GX 2OA4A 3IL2A 1IN4A 1H89C 5L3DA 2QSHX 2ZNZA 3ZMSA 2AXLA 2EV6A 3I4PA 2FRHA 1WQ2A 2HVSA 3CF2A 4PJ0C 3G71I 3BTJA 4IHYA 2CQXA 3SDGA 4D5FA 3BR1A 4M6XA 1XGMA 2QCOA 2A5WA 2VKHA 4HF0A 1LNWA 3H9GA 4Y52J 4L5IA 2GXAA 1B9NA 1FBQA 1TBXA 3KP7A 2XIGA 2X48A 1TW3A 3JCUC 1CQTA 3S2DJ 2BZTA 1I50J 4NB5A 2WV0A 3OY9A 3IWZA 3K0LA 3K70C 2LOOA 3O8HA 1JKPC 2DODA 1MNEA 5D6EA 2KPMA 1BR4A 2V4JC 5E1ZB 4IX7A 5FLVA 3M8JA 3LQQA 1YO5C 1SD7A 1XMKA 3SYTA 1VQ8I 2R0QC 1O3TA 2WAQN 1S7AA 4M71A 4XR6A 2ZXJA 2HDCA 1WRJA 3JR9A 2HOTA 3HHHA 1V54H 1WVRA 2O8XA 1XGNA 3H5AA 4AIDA 3A01B 2XKOA 1WKMA 3P5JA 3M4OJ 1T0FC 1D8KA 3IUOA 4B47A 3VSLA 1WI3A 1BI2A 2JJ7A 2DT5A 3M8EA 2NRAC 3TGNA 5B5EC 4L9JA 4IPAA 3S3MA 1BC8C 1Y39A 4MO7A 3CUOA 4KITB 2ECBA 2F5CA 5LHGA 3S14J 1HKTA 2ZC2A 2HFHA 4A0YA 1SAXA 2A6TA 3VB2A 5E8IA 1KQ9A 3CJTB 1GXPA 1G3TA 1Y56A 3JRFA 4NC6A 1TZLA 3CTAA 4M3FA 3TO7A 5KK1A 4CGZA 3BG6A 3E1SA 4BXFA 3WE2A 1P6RA 4HRIA 1VQMI 4C3HJ 4CA0A 2R7TA 3G1MA 4ENNA 4OOIA 4JP0A 4ON0A 4LG3A 4OIQF 3HEFA 3RIRA 1ZR2A 1W7PA 2WAFA 1EH8A 2L02A 3MD2A 3OS1A 3ABKH 4E70A 3D1NI 3LAPA 1YIJI 1XTAA 5HNHA 4AM3A 2HS5A 1XMAA 3Q0VA 1WJ5A 3E6BA 2WA0A 5IT3A 5D4RA 2ZSHB 4CZCA 3S3OA 3BDDA 2L9NA 3CCRI 2LYCA 4DGWB 1MBJA 1ETYA 5LEKA 2DTRA 1F9NA 3BZCA 1F43A 4QPOA 2D45A 5GPCA 3KETA 2V9KA 2PMZN 5DS9A 3BR2A 2LF8A 4C3IJ 1T6SA 5E18F 3IH2A 4H4KC 3GYHX 4L9VA 3WG9A 4EGZA 5CVVA 1O7LA 1AWCA 5ICFA 3RDIA 4U0YA 5JFRA 2QWWA 3C7JA 3M1EA 3QWLA 2IVMA 1QHHD 4PJLA 3LSPA 2D5VA 1J9IA 3WTSC 2BY0A 3LSTA 3NEUA 5GTHC 2QA4I 3WGHA 2X6WA 2NYXA 2X1CA 5CQEA 3WE3A 1RETA 1F1ZA 3H0GJ 3ABLH 1G4DA 4U7BA 1IDZA 2OU2A 1WJDA 2NXNB 2EJRA 5HLHA 2KISA 1LEAA 4HLYA 2JZYA 1NK3P 1E3PA 1JUSA 3PJRA 1QHGA 5CLSA 3BG9A 3JRAA 3S16J 2KP6A 4BHCA 5HDKA 1Z91A 1X4OA 2JQ7A 5JVTA 3K9TA 3IKTA 1SVOA 4FHTA 2ME0A 5D5WB 2EZHA 5FKOA 2HOSA 2K9QA 2XASA 2OCEA 5GP9A 2HNHA 3C2GA 2EIMH 3KYLA 2K9LA 2XVCA 2FOKA 1LDDA 5F04A 1UCRA 2QF7A 1SD6A 2DJIA 1LVAA 5F64A 4B43A 2V1UA 3DTKA 2DA1A 4UB8C 1D0XA 5J47A 3EYIA 2IA0A 3M3YJ 3LSRA 4IEJA 1EA3A 2WY7Q 2EH3A 2GA2A 3VYTB 2I10A 1O4XA 3S1QJ 3CCYA 5ICGA 3HOSA 2X9DA 1W0TA 3I59A 4ZH4F 3TP3A 4MTDA 5HODA 2KIQA 2OQGA 4AD9A 1MBFA 1XB4A 3DEWA 2R93J 1A5JA 3GO5A 3DCFA 4MIMA 3JRCA 1O3RA 3HTSB 2DJNA 4D1QA 1HW5A 1X3WB 1QPIA 2BOLA 1MJBA 3D5SC 3MZHA 3TO9A 4P9FA 4N0BA 1T39A 1BL0A 1X1DA 1ETKA 2ELJA 3FM5A 1P7JA 4M74A 2Z2SB 1R58A 3Q9SA 2KRFA 2PMHA 2HDDA 5EZHA 5CVIA 3IH4A 2GZWA 3CJQB 4I02A 3SZTA 2TCTA 1KA8A 2LR8A 5J4YA 1D5VA 4Y33A 1G3YA 2W7NA 2H8WA 1R1VA 1ZTRA 3HYIA 3U9GA 2KLOA 4A6DA 4ENKA 4CZZA 3JRDA 2ISZA 5LGUA 5IY5H 2IP2A 2E1OA 3DPTA 2R5ZA 3KCCA 1DU6A 1XGSA 4HBLA 1LKXA 4XIDA 2EFWA 3HGYA 2PMUA 4HX8A 4PDKA 2MC4A 2JN6A
chains in the Genus database with same CATH topology
1V55H 3AG2H 2EIMH 3ABKH 1OCCH 3AG1H 2Y69H 2EIKH 3ASNH 1OCOH 5B3SH 2DYRH 3AG3H 3X2QH 3ABMH 2EIJH 1OCZH 3AG4H 1V54H 2OCCH 5IY5H 2EINH 2ZXWH 2EILH 3ASOH 1OCRH 2DYSH 5B1BH 5B1AH 3WG7H 3ABLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 H;  3AG2 H;  2EIM H;  3ABK H;  1OCC H;  3AG1 H;  2Y69 H;  2EIK H;  3ASN H;  1OCO H;  5B3S H;  2DYR H;  3AG3 H;  3X2Q H;  3ABM H;  2EIJ H;  1OCZ H;  3AG4 H;  1V54 H;  2OCC H;  5IY5 H;  2EIN H;  2ZXW H;  2EIL H;  3ASO H;  1OCR H;  2DYS H;  5B1B H;  5B1A H;  3WG7 H;  3ABL H; 
#chains in the Genus database with same CATH topology
 2K3P A;  3JSO A;  1HDD C;  2K27 A;  3LSG A;  5HLG A;  3D5L A;  3PNY A;  3WTX C;  4QTR A;  4LLN A;  1TWH J;  4XN0 A;  3SEQ A;  1FIA A;  2L9V A;  4O6J A;  3K10 A;  3CF5 F;  1IN8 A;  3DQV C;  1Q1H A;  2CH0 A;  1IV8 A;  1B9M A;  1KON A;  4OAZ A;  1OLT A;  4IOC F;  3AL0 B;  1TC3 C;  1IN7 A;  1CF7 A;  3LQR A;  2KZG A;  3UNG C;  3AL0 C;  2AQE A;  4U0V A;  2IXS A;  2EFP A;  2K4J A;  1IJW C;  3E6C C;  2YU3 A;  4EVI A;  3KEQ A;  2XF7 A;  4D9J A;  1VTN C;  3C3W A;  2DXI A;  2M1B A;  3FXR A;  1J0R A;  1FMV A;  4PK4 A;  1V5E A;  5TGT A;  2R7U A;  2DK8 A;  3SZG A;  1KU9 A;  4GCV A;  4C9Y A;  3MWM A;  2BW3 B;  2RKH A;  4A3F J;  4IXA A;  2O03 A;  3BTI A;  3CLQ A;  2L7K A;  2OCC H;  5EGO A;  3R60 A;  3BJO A;  3G2B A;  1MMG A;  3CLO A;  1U9N A;  2JRT A;  2R7F A;  2P6S A;  4HX4 A;  3CCM I;  2FU4 A;  2ZJP F;  2H8R A;  2CFO A;  1B72 A;  4E7K A;  1R23 A;  1RZ4 A;  1RRJ A;  4CH7 A;  5HS7 A;  1RNL A;  3DFG A;  1AA7 A;  3E5X A;  2ETH A;  3ZP5 A;  2IA2 A;  3TO6 A;  3FZV A;  3K1P A;  5HS9 A;  1IXC A;  5H20 A;  5M3F J;  2Z3Y A;  2K86 A;  4G94 A;  4C2M J;  3CCQ I;  1LDK B;  4XON A;  1ZLJ A;  3H36 A;  4QSH A;  2VON A;  4JX4 A;  2XRN A;  1LVK A;  2E1M C;  1HOM A;  1BR1 A;  1R5G A;  4DZP A;  2CU7 A;  4HDV A;  2R7V A;  4G6T B;  6PAX A;  3MVP A;  1R71 A;  3GZ5 A;  3TOA A;  3J81 Z;  4KNY A;  4F55 A;  1R9T J;  3K2Z A;  3OL4 A;  1OR7 A;  2ZKZ A;  2LBF B;  2CUZ A;  2FX0 A;  4XIC A;  1MH3 A;  1AHD P;  2DI3 A;  4A5M A;  4UXN A;  4BS9 A;  3P9I A;  5JVG F;  3WHB A;  3BT9 A;  3HPH A;  1B8I B;  1TQP A;  2UXX A;  4FIS A;  1OQY A;  2H1L A;  3N4M A;  3C18 A;  2KIM A;  1J59 A;  2CUF A;  2JA2 A;  4XRS A;  3G4S I;  1FYM A;  1XX5 A;  4ZZD A;  3K69 A;  5FKK A;  4CYC B;  3BJ6 A;  4PJJ A;  2R7D A;  2RGV A;  4FET A;  3PSI A;  5FLX K;  2M4K A;  4H0E A;  3HOW J;  4A3G J;  2DMU A;  1Y8R B;  3ABU A;  1SFE A;  1Z05 A;  1VFC A;  3LMM A;  1VQL I;  3DKX A;  2OD5 A;  3FHN A;  2HVR A;  1HKQ A;  4P55 A;  4ETS A;  2JMW A;  4HZF A;  3DKY A;  2ELH A;  2OQR A;  3R4K A;  3FKJ A;  1JKR C;  3JSP A;  4GGG A;  4HOB A;  2FMY A;  2EZL A;  3OYH A;  1FPQ A;  3RYP A;  5KVR A;  2X85 A;  2A68 F;  3IV5 A;  4L0Z B;  4KT5 C;  3LSI A;  3OYJ A;  1WJA A;  2COM A;  1X58 A;  2P7C B;  2LKS A;  2R7X A;  1OCO H;  4ZTJ A;  2VC1 A;  2L7F P;  1OIS A;  2LP0 A;  1UMQ A;  1KYW A;  1Z7L A;  3A01 A;  1T0F A;  3HC7 A;  1AOY A;  4RBO A;  3GME A;  4P5O A;  2LFB A;  1FLI A;  3OYD A;  2WTE A;  4U7D A;  2TDX A;  5EDN A;  1QU3 A;  1DP3 A;  5ILU A;  4I99 C;  5J6X A;  3FHZ A;  1PUF B;  3WGI A;  2ESH A;  2MH9 A;  3EUK L;  3ECO A;  3CME I;  4WXH A;  3KEY A;  2PEX A;  2WV1 A;  2CWE A;  3LSM A;  4AWX B;  5DDG A;  3AG1 H;  4XKC A;  4GXO A;  5BMZ A;  2VJ4 A;  4GRI A;  2R5Y B;  2VKD A;  1YJ9 I;  2GWR A;  4ZYG A;  2K3F A;  2MD5 A;  1UHM A;  5M3M J;  1OCT C;  3BPX A;  1VQN I;  2DFE A;  4L5J A;  4OAY A;  4BE1 A;  1R36 A;  4XLP F;  1QA6 A;  4I0B A;  3JRB A;  3H9J A;  3GFJ A;  2ADU A;  3BOQ A;  4CCK A;  2MAB A;  1P4W A;  2QKL B;  3BTC A;  1XG1 A;  3GX4 X;  1ZEL A;  1VQP I;  2DA2 A;  1O57 A;  4HEA 2;  4XSZ F;  3QRF F;  3ERM A;  1FJL A;  1YJW I;  3HL2 A;  1FP1 D;  2D1H A;  4DNC A;  2DA7 A;  2VUM J;  3MN2 A;  1YX3 A;  4FT8 A;  3T8R A;  4C2T A;  4KIF A;  4LFU A;  2XF6 A;  4JBA A;  3E3V A;  3P7N A;  3OR1 C;  4P1W A;  2DA3 A;  5B66 C;  4B3X A;  3BP8 A;  3Q3S A;  5ILV A;  3FXQ A;  4KMU X;  3KZI C;  1I3A A;  1MSE C;  2F4I A;  2VQC A;  1Y6I A;  4AVZ A;  1TNT A;  2HOA A;  2X4H A;  2RQQ A;  1NK2 P;  1B6A A;  1TLH B;  5CVR A;  5H6Q A;  4CSW A;  2YU9 J;  5LBQ A;  4UB6 C;  4UUS B;  1YG2 A;  9ANT A;  2L54 A;  4A5N A;  3CC2 I;  2RQP A;  1BJA A;  4EJU A;  3TMO A;  1E0E A;  4KN7 X;  4WK8 F;  4O3M A;  2BV6 A;  4HQE A;  1H9G A;  4E7H A;  2P5K A;  2ZNY A;  1XSD A;  1X3U A;  1XSX A;  2L5Q A;  2AO9 A;  3KE2 A;  4FAS D;  1L0O C;  5CYV A;  4I98 B;  1JUP A;  5CJ9 A;  4LB5 A;  3M7G A;  2W00 A;  2GIZ A;  3CQZ J;  1Z6T A;  5GAD J;  4L0Y B;  3HGG A;  2R7S A;  4MLO A;  2DAO A;  1QZY A;  3QU3 A;  3ROU A;  4IZZ A;  2OBP A;  1YE9 A;  2AXT C;  3FXM A;  4LIU A;  4PSW A;  2DLL A;  3DBR B;  2PJR B;  4EEF G;  1Z3X A;  3GXO A;  2P4W A;  5K7Z A;  3LOC A;  3BR5 A;  3RCO A;  4A0X A;  4AVP A;  1J7K A;  5ERI A;  4KN4 X;  4XK4 A;  2QSG X;  5KCM A;  3H5R A;  1EKE A;  4EJT A;  3DV8 A;  5BOX A;  3LWF A;  2DQL A;  2V7F A;  4I76 A;  5IYD J;  3MMY B;  3HPG A;  3TP0 A;  4YEJ A;  3MKY B;  3ASN H;  3TL4 X;  2FQ4 A;  4CIC A;  2KL4 A;  1X1P A;  2FA5 A;  4RB3 C;  1YHQ I;  4XLA A;  4XN3 A;  4EJO A;  1UB9 A;  2MSY A;  5ED4 A;  1J75 A;  2HWV A;  3L2Q A;  4YG2 F;  1S7E A;  4G7Z F;  3WU0 A;  1Y0U A;  4UUV A;  3EQL F;  4NUB A;  4MGR A;  2F48 A;  4JOM A;  2IS1 A;  4Y13 A;  1WCM J;  2QVO A;  4X6A J;  4UNO A;  2FOW A;  5FFX A;  1DU0 A;  2ID6 A;  5E3M A;  4GFB A;  2LRD A;  3BJA A;  3A1Y A;  1XC5 A;  2LD5 A;  3ZQH A;  3FKI J;  3RKQ A;  5HLI A;  4FX4 A;  3KPH A;  3OYM A;  3K6G A;  2Z1D A;  4DZJ A;  4B44 A;  4ESJ A;  4A3I J;  4A3D J;  1A04 A;  4IF4 A;  2BYV E;  4RM2 A;  5DM6 F;  2LNB A;  5FKL A;  1IV6 A;  4A3M J;  2BHZ A;  1MDM B;  1OCP A;  3OYL A;  1Y0N A;  2KIF A;  3E97 A;  4YFX F;  2H6C A;  1PP7 U;  1ZRD A;  1YRN B;  2LH9 A;  5K5O A;  1LFP A;  3PO3 J;  1FP2 A;  2X6O A;  1HW1 A;  2K9S A;  2HXO A;  3F72 A;  1R1U A;  3HXL A;  3FK7 A;  2XSD C;  2M3A A;  2JA8 J;  2PLY A;  2EFQ A;  1XS9 A;  1A31 A;  4A3B J;  3PNV A;  3ZQQ A;  2NVX J;  3NRV A;  3VOD A;  3BY6 A;  1K6Y A;  3IC7 A;  4EM2 A;  3J81 K;  1G3S A;  5FRO A;  2UXN A;  5K5Q A;  1TWC J;  4HDU A;  5C44 J;  2OC6 A;  2VIX A;  3H5N A;  1J09 A;  1GLN A;  1R00 A;  3EDP A;  3F21 A;  4X1E A;  2O6G E;  4KDP A;  1S7O A;  2WY8 Q;  1EJ9 A;  4XLN F;  3ZRG A;  4XKB A;  1QO0 D;  4KMF A;  3CDH A;  2F4M B;  3M8F A;  2ZO4 A;  2HU9 A;  2HYJ A;  2ME6 A;  1N75 A;  1RKW A;  1WWX A;  5EJC A;  4YIR X;  1XDS A;  1K61 A;  1MBG A;  5DTD A;  4YFN F;  2QBY B;  2OF7 A;  2M45 A;  1HCR A;  1C0W A;  5LFA A;  3S1R J;  2Z9O A;  2DW4 A;  1UAA A;  1W4M A;  4RGS A;  2M4G A;  3OYE A;  3RZO J;  4A3J J;  3T1B A;  4OIO F;  1QVU A;  2BGC A;  3BZ6 A;  3K4B A;  1FOK A;  4XL9 A;  2FBK A;  2V1N A;  3F6V A;  1ZG3 A;  1WJB A;  1YS7 A;  2M30 A;  1R5I D;  2XKP A;  4ITV A;  3KYC B;  4BY7 J;  2VXZ A;  1S5L C;  5A2Q Z;  1VQO I;  1K83 J;  1R7J A;  2BW3 A;  2IPQ X;  3WTT C;  3G6E I;  1SEU A;  1V5G A;  2OZ6 A;  1I39 A;  2QEN A;  2WC2 A;  1AKH B;  1Y8Q B;  2HQN A;  2VQG A;  2JPC A;  4BAC A;  4PZJ A;  4ZTF A;  1NTC A;  2EBI A;  2DDB A;  2FEZ A;  3I0T A;  4N4N B;  4HNU A;  2GQQ A;  3V42 A;  2XDV A;  1RR7 A;  1ZHF A;  1JJ8 C;  1V3F A;  1RKT A;  2H94 A;  2WB1 A;  5ILS A;  3WTW C;  2F4O B;  3HG9 A;  2FE3 A;  3CO6 C;  1M1E B;  3GTO J;  5D8K B;  1IN5 A;  2E60 A;  2V9P A;  2MYS A;  4HX7 A;  3REO A;  1IUY A;  2M87 A;  2MA3 A;  2L7M P;  3QPH A;  2CSO A;  4ANJ A;  3RJP A;  2RVC A;  2MBF A;  3V4G A;  3JAM K;  3J80 K;  5EEA A;  2HDW A;  1X1B A;  2E71 A;  2TRT A;  1MND A;  3G1O A;  3GEZ A;  1ZN2 A;  3CUQ B;  3O6B B;  1W36 D;  4F93 B;  5BNG A;  3B6C A;  3HSE A;  3MEX A;  2YR2 A;  2CQ7 A;  2E19 A;  2FJ1 A;  2DOF A;  1PVE A;  4FQG A;  3TBI A;  2IRF G;  1FZP B;  4MFD A;  3VYR B;  2LBF A;  1YOV B;  1Z6R A;  3E0J B;  1BM9 A;  2KZV A;  2XPV A;  3QOE A;  2GM4 A;  3CO7 C;  3CCS I;  3GTM J;  5DD8 A;  5J1R A;  1SFK A;  2WAD A;  2W24 A;  1E3O C;  2CQQ A;  3DPU A;  2HOE A;  3S3N A;  4M9S A;  4IHW A;  3KFW X;  4A69 C;  2Y30 A;  4ZC3 A;  1W5C C;  3A02 A;  2G9W A;  4BHB A;  2M7B A;  1GXQ A;  1OCR H;  4CYC A;  1UZC A;  3UR3 C;  2FNA A;  2J5O A;  2LKX A;  3J7Z I;  2H6B A;  1ORK A;  1VI0 A;  3EET A;  2LVS A;  3DEE A;  2LRE A;  3S32 A;  5HOO A;  1VZ0 A;  2E34 A;  2GIV A;  4I01 A;  2VE8 A;  2DBB A;  3OIP A;  2BHY A;  5D5U B;  4QIW N;  5KHD A;  2RDP A;  3QPL A;  4IHT A;  2MD0 A;  3NQO A;  1IN6 A;  3SQN A;  1MSF C;  2ECC A;  3RKY A;  2OJE D;  4NBQ A;  4J00 A;  4RB2 C;  2VAS A;  3M1C A;  3GZ6 A;  3MZY A;  3FMR A;  5EEG A;  5IPA A;  3H9Q A;  1ETX A;  1SVM A;  2DU9 A;  4UVB A;  4BEH A;  3BR6 A;  4G6Q A;  1D5Y A;  2KRH A;  1GDT A;  1FY7 A;  5FKM A;  5ICC A;  2M2E A;  4YRV A;  1G8X A;  2ESN A;  3TW6 A;  3U1D A;  1H88 C;  4P9U A;  2KDO A;  3N97 A;  5JLX A;  1JGS A;  2G0E A;  1FBS A;  2E36 A;  5J1Y A;  1Z67 A;  3L9F A;  3F0C A;  1PUF A;  3LFK A;  2PFB A;  1TNS A;  2VJI A;  2Z16 A;  3FMS A;  4R8H A;  4I0A A;  1TT0 A;  1YYV A;  5K1Y A;  2MGQ A;  2W57 A;  4XQF A;  4UVA A;  1MMS A;  2XGE A;  3AG2 H;  3GUD A;  2R5Y A;  2GXG A;  2EIK H;  3I53 A;  4J19 A;  1CGP A;  4C2U A;  2GAU A;  2PJP A;  2ICW G;  2Q0O A;  3O3K A;  4XLF A;  1F5T A;  3OL3 A;  2VBZ A;  3IP4 B;  2IAI A;  4D5C A;  2XB5 A;  2QYO A;  1T2K A;  4L9N A;  3U21 A;  3EUH A;  2A5Y B;  1PJR A;  2LLK A;  3PQJ A;  5LHH A;  1MGT A;  4U0W A;  4HA8 A;  4XRM A;  2CUJ A;  5JHF A;  1X1A A;  1ZAR A;  4BJ5 C;  1BC7 C;  1EH7 A;  5FO5 A;  4N9H A;  5EG0 B;  3GFI A;  2JRM A;  5LLQ A;  4HNT A;  2X0L A;  1ENH A;  1DQU A;  1Z1D A;  4KIG A;  3VEP A;  3F8N A;  3VOE A;  1VQK I;  1E2X A;  2CW7 A;  3IH3 A;  1R6R A;  2R3S A;  5CPR B;  4MTE A;  3PIO F;  1JTX A;  1R4M B;  3LAJ A;  1VQ4 I;  3BPV A;  2JA5 J;  3CD6 I;  3AAF A;  4U87 A;  1GT0 C;  3CCJ I;  4BDZ A;  1UHW A;  5DCM B;  1ETO A;  1P9Q C;  4DYR A;  2MC3 A;  3BRO A;  3HJE A;  4PGH A;  1LUJ B;  2MW8 A;  4M6V A;  4II2 A;  4PCQ A;  2EK5 A;  1VQ5 I;  3HOV J;  3B73 A;  4XOP A;  1U9O A;  2JT1 A;  3QOP A;  4UUS A;  2VLA A;  1HW2 A;  3ZR8 X;  4DW6 A;  3ZQG A;  3DPL C;  4D7N A;  1B59 A;  3QQA A;  5K5R A;  2P5L C;  3AG3 H;  3RYR A;  5E8G A;  4B1R A;  3BWG A;  2BY2 A;  2M0C A;  3VDX A;  1E3H A;  3KLO A;  4GDF A;  1R4N B;  3OS0 A;  1ETW A;  1ODD A;  1BI3 A;  4EM0 B;  2LTP A;  3CDI A;  3HUG B;  3I71 A;  4EM1 A;  2CGP A;  4WCG A;  4E7J A;  1V5F A;  2RNG A;  4BUP A;  2D1V A;  2B9S A;  1MBK A;  3PQK A;  2CV1 A;  1QGP A;  3Q0U A;  4Q5S F;  1UG0 A;  2HZD A;  5L3B A;  2DPU A;  2BXY A;  4PJN A;  1SAN A;  3OIQ A;  4G7O F;  4AIJ A;  5BQT A;  3ZOB A;  1QBJ A;  3JRH A;  3QYF A;  1LEB A;  3OYB A;  1GUU A;  5E1X A;  4WXC A;  2Z33 A;  3ZXS A;  5JLW A;  3G3Z A;  4J01 A;  1HSJ A;  3MQ0 A;  1X2M A;  2PJR A;  2CO5 A;  3HOZ J;  3DLA A;  1V4R A;  2LSO A;  1TT5 B;  1HXD A;  3ZMD A;  3RQI A;  3HKZ A;  1RI7 A;  2P8T A;  2STT A;  1WH7 A;  2ZXH A;  4A3L J;  3L2C A;  3HOX J;  3U2R A;  2FBI A;  1P7I A;  4DIQ A;  5LEJ A;  2VN2 A;  3HKZ N;  4LIV A;  3WTY C;  3MFK A;  1I6X A;  2ZXI A;  4MFE A;  1W36 C;  4D0P A;  4DYQ A;  4XLH A;  2LY1 A;  4GO1 A;  1A6Q A;  3CCV I;  3VPR A;  1N25 A;  2DK5 A;  2EIJ H;  1ZQ3 P;  3S1N J;  2IS4 A;  2NS0 A;  2LY2 A;  3F23 A;  1IW7 F;  2VXD A;  2FSW A;  2IEK A;  2Q1Z B;  3ABT A;  4M3D A;  3P9K A;  4EJV A;  2B7E A;  5A2Q K;  2Y48 A;  1HDP A;  4XKV A;  1LDJ A;  2GOM A;  5EF6 A;  4BQQ A;  1U8B A;  2QLZ A;  4BXU A;  1YJN I;  3KP6 A;  1QQI A;  2OAZ A;  2A3S A;  3WHC A;  3BLY A;  2EV5 A;  2DT7 B;  4IKF A;  3LA7 A;  2Y0M A;  3ERE D;  1K79 A;  1ZRF A;  2FNP A;  1P92 A;  5IT9 Z;  4EGY A;  3LA2 A;  1NG6 A;  3KEO A;  2X6X A;  1P4A A;  3QYE A;  1BIA A;  4JQF A;  4BE0 A;  1MDM A;  2HTS A;  2O7O A;  1B4A A;  3S8P A;  3DWL E;  1YRN A;  4M3E A;  2ZJQ F;  3WTV C;  2VI6 A;  3L00 A;  3S1M J;  1LQ1 A;  4Z2Y A;  2DA4 A;  4M3G A;  4Y15 A;  3SFZ A;  2EA4 A;  1TP4 A;  1ZLK A;  4C3J J;  4XOT A;  2VPR A;  3BCA A;  1WGX A;  4V19 K;  3S15 J;  3I54 A;  4NC7 A;  1EV7 A;  2O0Y A;  4ZDP A;  4BJT A;  3ZMU A;  3DLL F;  1D0Y A;  4Z6Y A;  1Z7U A;  1NG7 A;  3OR2 C;  4RB1 A;  4HPQ A;  4RS8 A;  5J3L A;  3F8B A;  3ZMZ A;  3CJN A;  3LL7 A;  3SEZ A;  2I8D A;  3V8J A;  2BVL A;  2DTZ A;  4BBS J;  3BQZ A;  5AIP A;  4OIR F;  2W4S A;  5LD2 C;  1REP C;  4FCY A;  1D8J A;  3WG7 H;  2XRO A;  3RTR A;  1GVD A;  3NWT A;  1BI1 A;  2EFN A;  2OZU A;  3CP2 A;  3ZN0 A;  3C2H A;  5J8F A;  3RKW A;  1LPQ A;  1ACI A;  4LLG F;  2QBY A;  1IRZ A;  1QNT A;  1Y1V J;  1DGW Y;  2HQ5 A;  4S04 A;  3U1K A;  1JE8 A;  3ML6 A;  4Y17 A;  2MH2 A;  2EWN A;  4AUX A;  2VOO A;  2LC2 A;  1FOW A;  3PL8 A;  3F8M A;  3IHU A;  1DGR M;  2XGX A;  1JHH A;  2W1O A;  2UWM A;  1T56 A;  4ESB A;  4KYW A;  2PX9 A;  5DUK A;  1T98 A;  4UY8 I;  3ULQ B;  1HBX G;  1XD7 A;  2O61 A;  2V6E A;  2IBD A;  3S93 A;  3K4C A;  3VFZ A;  4B48 A;  1DPR A;  2O9L A;  4XSX F;  4CCM A;  1RPW A;  4G7H F;  2J5P A;  2XPU A;  2Y69 H;  4JYK A;  4M9X A;  1S72 I;  3DU5 A;  1AKH A;  1R1T A;  5FLM J;  1FBU A;  2XAJ A;  1YW8 A;  5CVJ A;  2YX4 A;  4FE7 A;  4LGW A;  2M5W A;  2V1X A;  4BHP A;  2L2O A;  2ZJ2 A;  4BY1 J;  5IP9 J;  4ESF A;  1UST A;  3ZMV A;  3EUH C;  4V2G A;  1OPC A;  3N05 A;  2COB A;  2JSP A;  4XRF A;  4V2F A;  3M07 A;  3LSK A;  2GA1 A;  4UUT A;  1U5T B;  1RUO A;  4S05 A;  2E7X A;  4QLC U;  2X1E A;  1XGO A;  3SDB A;  4IQ4 A;  2VBY A;  3DTI A;  3CUQ A;  3X2Q H;  1DP7 P;  4NHJ A;  2ISY A;  3A0B C;  4A3C J;  2P5V A;  4RAZ A;  2R7Q A;  1MKM A;  1QPM A;  1VF9 A;  5LHI A;  4I7H A;  1JKQ C;  1X3Z B;  4DYC A;  1D1A A;  2CMP A;  2Z99 A;  4MQV A;  2DO7 A;  3RSN A;  2F5V A;  4ABZ A;  3L2U A;  1YIO A;  2XPW A;  1LE8 B;  2IS6 A;  2DFH A;  2IA1 A;  3OOP A;  4IRH A;  2HYG D;  2V26 A;  3HRU A;  2FUG 2;  1JXS A;  1IUF A;  3DTE A;  1MMA A;  3HBL A;  3LA3 A;  1ZKG A;  3O2P E;  3R61 A;  2K9M A;  2ZB9 A;  4HV6 A;  2L7Z A;  1IC8 A;  2JVH A;  3I9V 2;  4ENJ A;  1SFO J;  5GAE J;  5D6F A;  5HLT A;  2JWT A;  1OYI A;  1W1W E;  3E5U A;  2BE5 F;  3I5U A;  4KUM A;  5EZG A;  3TDU C;  1OMI A;  2KQR A;  2FML A;  3C1D A;  3H3Z A;  1FIP A;  4D7M A;  2HYF A;  1LB2 A;  5B1B H;  1QRY A;  2JA6 J;  1JHF A;  1WJE A;  4HW0 A;  3KP3 A;  1OKR A;  5F0H A;  3BQY A;  3PM1 A;  1U8R A;  2VKV A;  3L2V A;  2PBI A;  5DUI A;  1OFC X;  1VQ9 I;  4IL6 C;  3JRE A;  4FX0 A;  1KZH A;  4A12 A;  3OYK A;  3ZMT A;  1GV5 A;  2YX7 A;  2V79 A;  2DMQ A;  2E2J J;  4LB6 B;  2VT3 A;  4X0G A;  1XN7 A;  2EA2 A;  3S2H J;  2LMD A;  1VQ6 I;  5IP7 J;  4XLC A;  2M8E A;  5BPD A;  2QQ8 A;  1N77 A;  1FMW A;  2VT2 A;  2Y0S A;  3B6A A;  2DMP A;  4KIS A;  3P9C A;  1IRG A;  1SFX A;  4QWQ A;  1BJZ A;  4UV9 A;  2IW5 A;  4G6D A;  2Y0S N;  1D0Z A;  1ON1 A;  2A6E F;  4F92 B;  4CUG A;  1JUM A;  3OV8 A;  4EAT A;  3BG3 A;  1G6N A;  2KDZ A;  1QVT A;  3CC4 I;  2XB0 X;  2NVY J;  4ZYE A;  4HYE A;  2IGK A;  2HXI A;  2ZSI B;  3ZQ7 A;  4CYD A;  1IXR C;  2XAG A;  5L3C A;  2NVU B;  4EMS A;  4IOA F;  5FGM A;  3L2W A;  2F2E A;  2FQ3 A;  2LKP A;  2BXZ A;  2OPT A;  3EPZ A;  2HTJ A;  4BE2 A;  1TWA J;  4M3B A;  3OWT A;  2R7R A;  1LFU P;  2WAE A;  4HV5 A;  5H6R A;  3GBG A;  1QZZ A;  4E4H A;  5J8C A;  3PIP F;  2DFI A;  3T8T A;  4W97 A;  2VJ5 A;  5DV5 A;  4PFO A;  3RQ4 A;  2A05 A;  2G7U A;  3OMY A;  3D5R C;  3DBH B;  3KZY A;  5TIS C;  3A2K A;  3H0D A;  4A93 J;  5DCF A;  1SMT A;  4IQJ A;  2H09 A;  2Y9Z A;  1ZG5 A;  2L3D A;  3OIO A;  2QQ9 A;  4M6Y A;  1D3Y A;  2HGC A;  4MHG A;  2EZK A;  1OYW A;  3FWE A;  2VPL A;  3W2W A;  5EG0 A;  2H1K A;  3BG5 A;  1OYY A;  2O3F A;  1SD5 A;  2DQR A;  3GF2 A;  2EFO A;  4ZYA A;  3QP6 A;  3I3L A;  2VJJ A;  5JI6 A;  1W0U A;  2HPM A;  5IOY A;  5HDG A;  4DJA A;  4IHV A;  1S3J A;  2Z5U A;  3S2W A;  3L7W A;  2WWY A;  3RKX A;  5DCM A;  2VB6 A;  2X6Y A;  3ZQL A;  2ZME B;  1J5Y A;  3V7C A;  5HS8 A;  2ZCW A;  2M7A A;  2ZME C;  2ZXW H;  4EQQ A;  3VSK A;  5KNL A;  2A07 F;  2STW A;  1APL C;  4L9T A;  1Z3Y A;  2CYY A;  2XHK A;  2HEO A;  1ZR4 A;  5IT9 K;  3EUA A;  3TKY A;  1RUN A;  2PN6 A;  4WWC A;  4AU7 A;  3OYC A;  5FD5 A;  3DXJ F;  5LRR A;  3RPQ A;  2E1N A;  4ZDO A;  3OYG A;  4LG0 B;  2QM3 A;  4XOR A;  4L5E A;  1MBH A;  2Y2Z A;  3QOD A;  2ZJR F;  2IGM A;  1BIB A;  2F5E A;  4LIT A;  1RIO H;  4BQA A;  2JUG A;  4LK0 F;  4HLX A;  3T5X A;  3TED A;  1BW6 A;  4F3Q A;  5GTI C;  1HF0 A;  1FC3 A;  4BDY A;  2E7W A;  3HUG A;  2UV1 A;  5DYM A;  4ZYH A;  3FXK A;  3SHF A;  3FXJ A;  3HSR A;  4AYB A;  4K2E A;  3HDD A;  4CO8 A;  4FE4 A;  5FKN A;  1SMY F;  2V9V A;  4CCO A;  3J7A O;  2WAQ A;  3PSF A;  2E35 A;  4II3 A;  4YII A;  3LSJ A;  5ICE A;  2K02 A;  3MCZ A;  4AYB N;  1KQ0 A;  2CQK A;  1GHC A;  1FX7 A;  2VKE A;  3HZJ A;  2D2W A;  3HIF A;  4NC8 A;  1I3Q J;  4IRG A;  3G1L A;  3PFI A;  5FB2 A;  2MLG A;  1KGS A;  3K4N A;  2L4M A;  2VL8 A;  4YEL A;  1UFM A;  5LGN A;  4RLF A;  5EYR A;  1TQM A;  3HM5 A;  3HSF A;  4HST A;  3NAR A;  2CJJ A;  3GTQ J;  3J7A Y;  4IHX A;  3ELK A;  3OSF A;  3KLN A;  4OWR B;  4B8X A;  1S9H A;  4AC0 A;  5K7F A;  2ACJ A;  1KU7 A;  4IRI A;  2QUF A;  2VOD A;  3GZN B;  1FTT A;  3OS2 A;  3H35 A;  2UZK A;  1XCV A;  4RM3 A;  1G2H A;  1F4K A;  2RRE A;  4NQW B;  3GTG J;  2N8G A;  2WB1 N;  3BR0 A;  5JR3 A;  2GOX B;  5IP6 A;  4AIK A;  4XBF A;  2DYR H;  1Z77 A;  3ABM H;  1LFB A;  3I64 A;  4DQ2 A;  2QEX I;  4OIN F;  3CMY A;  1USS A;  2XF5 A;  1FSH A;  3V8K A;  3CUQ C;  3CMM A;  4DBR A;  3W6K B;  2Q8K A;  4YFK F;  4ZJZ A;  2EV0 A;  3F6O A;  5CQG A;  2P81 A;  1U2W A;  1PDN C;  2CS3 A;  3HRT A;  3FMQ A;  3ONQ A;  4JX5 A;  5BPI A;  1T38 A;  3ZCO A;  1I1S A;  4O5V A;  3RPU A;  3L2R A;  2G7H A;  1WH5 A;  4YIF A;  1YW9 A;  5F0C A;  5M5W J;  3E5Q A;  3FDY A;  4M73 A;  2AHQ A;  5D8L B;  4EV0 A;  3J7Y J;  5FLX Z;  3L09 A;  1B8I A;  1I27 A;  3VYU B;  3KZZ A;  4XLE A;  2PMZ A;  1XSV A;  1O3Q A;  3CC7 I;  1IF1 A;  1W7P D;  3K2A A;  3RPU D;  3NAU A;  2FF4 A;  1XMX A;  1ULY A;  4HF1 A;  2QKM B;  5LGT A;  3HOY J;  3AFH A;  1TW2 A;  5AIQ A;  4E7L A;  2ID3 A;  2XAH A;  2V6C A;  3CZ6 A;  2NNN A;  1UG2 A;  2PI0 A;  2RC4 A;  1PUE E;  4E7S A;  3FX3 A;  1FYL A;  1UHS A;  1LJ9 A;  5E3L A;  5HNF A;  2KT0 A;  1FYK A;  1XCB A;  3H1C A;  4E7I A;  3GLL A;  1WI9 A;  2PQ8 A;  1MIJ A;  1ZK8 A;  3GTP J;  1ON2 A;  1KYZ A;  4OIP F;  1WSU A;  1YW7 A;  4KIC A;  1U6G A;  1Q1V A;  1ITY A;  2H27 A;  3TDZ C;  3IKV A;  5HDN A;  5E20 A;  2KIU A;  5LRS A;  1K78 B;  2HI3 A;  2F5D A;  1DUX C;  2VOP A;  1SD4 A;  1IZ1 A;  3WU2 C;  1HLV A;  4BAY A;  3V8L A;  4PGG A;  1ZAO A;  2XUB A;  1MZB A;  5L3G A;  3RZD J;  2IS2 A;  1IRX A;  2LY9 A;  3W6V A;  3CES A;  2Q2E B;  2DCE A;  1K6O A;  5EEH A;  4AIH A;  1ZGA A;  1JGG A;  3PFY A;  2NOG A;  3MKL A;  3ESW B;  1XDU A;  3ZN1 A;  3SJM A;  2XGC A;  3PNT A;  4LMY A;  5FJ8 J;  5D5V B;  2DT6 A;  4LJZ F;  3DP7 A;  3FM3 A;  3WTU C;  1TWF J;  3MKZ A;  1PYV A;  1Z0X A;  2PG4 A;  2HPI A;  2LDU A;  1V55 H;  3FXL A;  3CCL I;  1SAU A;  4MQ9 F;  5F6F A;  1S8N A;  2A69 F;  2LF7 A;  4F52 A;  3G73 A;  1P4X A;  1BBY A;  3PO2 J;  2W85 A;  4Y7N J;  5M5Y J;  1K7A A;  4PJM A;  2HKX A;  3WU1 B;  3DEU A;  3JTG A;  3VYS B;  3GTJ J;  2EIN H;  4G12 A;  1KU3 A;  3E6M A;  3ASO H;  1BR2 A;  3D0S A;  2L01 A;  1Z9C A;  3NWS A;  4U88 A;  4LD5 A;  2YSR A;  4RB0 A;  2QQB A;  1U5T A;  2WBM A;  4KA4 A;  3ZQC A;  5IOZ A;  1PP8 F;  1BN5 A;  5IYB J;  3F22 A;  2XGD A;  3UKG A;  2CQN A;  4R79 A;  2JK3 A;  2IJL A;  2XAQ A;  4HG2 A;  1T33 A;  2VE9 A;  4LLL A;  1A35 A;  2NAZ A;  3KX2 A;  4BQN A;  1ZRE A;  3QP5 A;  3L1P A;  1D1B A;  1O7F A;  2E2I J;  4LK1 F;  1MJA A;  4JK1 X;  4MNU A;  2LG4 A;  1MMN A;  1FOY A;  2EPF A;  3Q0W A;  1K4T A;  4HSR A;  1ZGJ A;  3JRG A;  1WJC A;  4Y3O A;  5FFZ A;  1LE8 A;  4MEX F;  4MEY F;  3F8F A;  4M9Z A;  1FNN A;  1SVL A;  1TL8 A;  2FXA A;  3EYY A;  2CW8 A;  5E79 C;  2K40 A;  1IDY A;  2BVM A;  4PSX A;  5CKT A;  3V7R A;  1I6H J;  2QSF X;  1H0M A;  3DF8 A;  5F0F A;  2W84 A;  4XMY A;  3ZPL A;  3Q9V A;  4RGX A;  1WPK A;  5AON A;  4G8X A;  4UV8 A;  2ZBK A;  4WXD A;  4ZDL A;  2YS9 A;  2M9H A;  2C6Y A;  2CG4 A;  4F7Z A;  3H3V K;  5E1W A;  3R0A A;  2DOA A;  2DYS H;  5HVQ C;  1I1G A;  2YUS A;  4S0H B;  1JT6 A;  3GLX A;  3K4M A;  1FTZ A;  2JUC A;  3KP5 A;  2ZFU A;  4BL0 B;  2CV2 A;  4A3E J;  5H2F C;  2B0L A;  4Q47 A;  1T8I A;  2HVQ A;  3MZ8 A;  4R1H A;  3F9K A;  2JSC A;  3DKW A;  1UJ8 A;  1MW7 A;  2R92 J;  3KP4 A;  1B1B A;  4Y4R A;  4E7Z A;  2R7W A;  1P2F A;  4HQM A;  1TQI A;  2OTL I;  3I55 I;  2RV8 A;  3OYN A;  1HST A;  3M9A A;  1OJL A;  4ENM A;  2OTJ I;  1XPX A;  2I5U A;  3DU6 A;  4RAY A;  1ETQ A;  5E3O A;  2NNY A;  4XRS G;  1JKO C;  2HQR A;  4OMY A;  5C4J J;  3BCB A;  2KJC A;  2A6H F;  1EF4 A;  1OCC H;  2O8K A;  1UEL B;  2DA6 A;  1Y1W J;  1W5S A;  4NDL A;  5M5X J;  3TOB A;  3S17 J;  3R6S A;  1KQ8 A;  3I4M J;  1ERD A;  4CDG A;  2DPD A;  3KYD B;  1A6I A;  3GFL A;  3GWZ A;  3QPS A;  2E5N A;  1VND A;  1F36 A;  2DFF A;  2X51 A;  1BW5 A;  3BTL A;  1WFX A;  5TJJ A;  1BOA A;  3HTU A;  4P96 A;  4OMZ A;  4UVC A;  2GBY A;  2QQA A;  3CP8 A;  1YX5 A;  3CDL A;  2M0M A;  4BJ6 C;  2JVG A;  1ZG1 A;  1W7P B;  4IO9 F;  2VBX A;  3FBI B;  1TWG J;  2L9R A;  2MFZ A;  4BXX J;  4A6E A;  1JT0 A;  1U0J A;  4BGD A;  1ZYR F;  1FSE A;  1FT9 A;  4IJA A;  2E1M B;  3OOU A;  4XKW A;  3GTK J;  1L3L A;  3K4K A;  2AS5 F;  5J40 A;  1E17 A;  3K7A J;  3LSH A;  2BY3 A;  2XAF A;  2YPR A;  2AQF A;  4RMN A;  1STZ A;  2KRC A;  1S6L A;  2OV7 A;  3I56 I;  2LK2 A;  2ZFW A;  4N4O B;  2KKO A;  5B3S H;  1DPU A;  1GVJ A;  2CFX A;  1VQ7 I;  3OYA A;  2DMN A;  2ZME A;  3K1N A;  3A03 A;  1WZ2 A;  2NS7 A;  4I09 A;  4GYI A;  1IRF A;  2VQL A;  5D4S A;  2Y75 A;  1HC8 A;  3CJR B;  3QAH A;  2R7O A;  2KJB A;  2GLO A;  3QU6 A;  4ZYD A;  1JJ6 C;  4I2O A;  5IYC J;  1JTY A;  2K5C A;  4LG0 A;  1G3W A;  5K7H A;  1BI0 A;  2DMT A;  2X1D A;  1K4S A;  1T08 B;  3A4C A;  3ZQI A;  4BU2 A;  2W82 A;  4RDU A;  5JHU A;  1MMD A;  1FOX A;  4XM3 A;  1R49 A;  4EJW A;  2RNJ A;  3ISP A;  1A36 A;  1U3E M;  1ZH5 A;  1H8A C;  4KJZ A;  3Q5F A;  1POG A;  3IAS 2;  1ETV A;  4UHT A;  3SXY A;  4DOZ A;  2RAE A;  2L4A A;  1U78 A;  4RA2 A;  3HB9 A;  3SFI A;  4G9Y A;  4BQO A;  5B1A H;  1Z21 A;  1HKS A;  3FBN B;  4BEH B;  3W3C A;  4DBQ A;  2HR3 A;  3ZGK A;  3HOT A;  2L0K A;  4KFC A;  3K70 D;  1IAW A;  4Q4Z F;  2XSJ C;  3H92 A;  2CV0 A;  2KHM A;  2RN7 A;  5CVU A;  4E6K G;  3JRI A;  5D5X B;  2O5R A;  1YS6 A;  1YI2 I;  3W2V A;  4CCN A;  2QGU A;  2MG4 A;  4HNV A;  2DOE A;  1MBE A;  4BBR J;  3JAM Z;  3J80 Z;  3TQN A;  2Y31 A;  3GTL J;  3K4J A;  1RC9 A;  3HRS A;  5E3N A;  1X4P A;  4W1U A;  4NQW A;  4BNC A;  1NHA A;  3I59 B;  2B63 J;  2L9S A;  3T0Y A;  2V1D A;  3F8C A;  1U5T C;  4L18 B;  1KU2 A;  3BC8 A;  4BH9 A;  3WTZ A;  5KAF C;  2QZ8 A;  3AKZ A;  4RAG A;  3MKW B;  1J2X A;  3PUF A;  4QPQ A;  2UUZ A;  3DBL B;  1QZE A;  1W5T A;  3IRQ A;  5DM7 F;  5BS6 A;  2R7Z J;  1IGN A;  4CXF A;  2GXB A;  4WF2 A;  3V7S A;  1O3S A;  5GAG J;  3OSG A;  5C3E J;  4IVN A;  2W48 A;  5TRD A;  3K4L A;  3BZK A;  3BG7 A;  3HHG A;  4CCL A;  2ELK A;  4HF2 A;  1T95 A;  5F27 A;  3RI4 A;  2P6T A;  3COA C;  2VC0 A;  1R22 A;  5DD4 A;  2BBY A;  3A0H C;  3K1M A;  3FF5 A;  1N78 A;  2HZT A;  3GVA A;  1S29 A;  3B02 A;  4M72 A;  4N9I A;  1JI8 A;  5FD6 A;  2VQH A;  2HKO A;  2P7V B;  4F91 B;  1YIT I;  3CCE I;  3SZP A;  2NOJ B;  4PUS A;  2FBH A;  1X1C A;  3I4N J;  2R5Z B;  1RES A;  4C30 A;  3FIS A;  5FRM A;  4XNF A;  1X19 A;  4RGU A;  4ZZL A;  2A61 A;  4ASN A;  3TW7 A;  2EB7 A;  1SC7 A;  3CCU I;  4WX9 A;  4RAF A;  2JA7 J;  2R4G A;  2F6C A;  3MAJ A;  1EH6 A;  5J4V A;  3IRR A;  2OUM A;  5E17 F;  2EQR A;  2NVQ J;  1IXS B;  5DEQ A;  3LNQ A;  4KIB A;  3GCM A;  2DA5 A;  1FWZ A;  1ONV A;  3WGG A;  3AG4 H;  3JTH A;  5F08 A;  4HAM A;  1YFH A;  4A2U A;  3W2A A;  2DN0 A;  3QYB A;  1CF7 B;  4B4C A;  1K78 A;  4LOC A;  4B3A A;  2K4B A;  3FXO A;  1ZRC A;  1H9T A;  4CHU A;  2EZI A;  2CRG A;  2BEO A;  2KFD A;  3FXU A;  3F3X A;  2K9N A;  2BY1 A;  4A0Z A;  1MD0 A;  3PUB A;  1IO2 A;  4RLQ A;  2Q2E A;  3ECH A;  2CUE A;  2XRL A;  1BOB A;  1WHU A;  1OCZ H;  2XAU A;  4KT6 A;  1YLF A;  2E1C A;  2IGN A;  3C2B A;  1ZGW A;  5EGO B;  1MH4 A;  4IHS A;  5GPA A;  4OU0 A;  1WJF A;  4A3K J;  5F1R A;  1SFU A;  4PFP A;  3IAM 2;  4BKX A;  4GYG A;  2VBW A;  1YTY A;  2CW0 F;  2E5Z A;  2KMU A;  3IWF A;  3O8G A;  1B72 B;  1MNM C;  2W25 A;  4Q48 A;  3W6J B;  3BR3 A;  3JW4 A;  4RGR A;  1R5H A;  3OYF A;  3GFM A;  4CCJ A;  4B09 A;  1FEX A;  3FK6 A;  1TTY A;  2FD5 A;  3E6D A;  1X2N A;  2NS8 A;  2M34 A;  5F1J A;  5GAH J;  2F5F A;  3E7L A;  1GV2 A;  3HRM A;  3CMA I;  4I6Z A;  3WOD F;  1MJ9 A;  2P0W A;  3FIW A;  5J1U A;  3KIO A;  1DDN A;  3VWB A;  3KP2 A;  1HQC A;  3LFU A;  2DDA A;  5L3F A;  3I58 A;  2HQA A;  1I5Z A;  1G59 A;  2JTV A;  1HA8 A;  1OR7 C;  1D1C A;  3GW2 A;  4TV7 A;  4NNJ A;  3HOU J;  2NVT J;  2XC7 A;  2MLK A;  3QPT A;  1YQA A;  3ZQF A;  4BYY A;  3R0J A;  2IGO A;  1NH3 A;  3OYI A;  2IT0 A;  2EIL H;  2Y9Y A;  5L3E A;  2K85 A;  2K7L A;  2JPB A;  4FTH A;  5FRN A;  5C4X J;  1BA5 A;  2XV4 S;  4JX6 A;  1RR8 C;  1AU7 A;  3H3U A;  5KAI C;  1IG7 A;  2E2H J;  2M8G X;  2OA4 A;  3IL2 A;  1IN4 A;  1H89 C;  5L3D A;  2QSH X;  2ZNZ A;  3ZMS A;  2AXL A;  2EV6 A;  3I4P A;  2FRH A;  1WQ2 A;  2HVS A;  3CF2 A;  4PJ0 C;  3G71 I;  3BTJ A;  4IHY A;  2CQX A;  3SDG A;  4D5F A;  3BR1 A;  4M6X A;  1XGM A;  2QCO A;  2A5W A;  2VKH A;  4HF0 A;  1LNW A;  3H9G A;  4Y52 J;  4L5I A;  2GXA A;  1B9N A;  1FBQ A;  1TBX A;  3KP7 A;  2XIG A;  2X48 A;  1TW3 A;  3JCU C;  1CQT A;  3S2D J;  2BZT A;  1I50 J;  4NB5 A;  2WV0 A;  3OY9 A;  3IWZ A;  3K0L A;  3K70 C;  2LOO A;  3O8H A;  1JKP C;  2DOD A;  1MNE A;  5D6E A;  2KPM A;  1BR4 A;  2V4J C;  5E1Z B;  4IX7 A;  5FLV A;  3M8J A;  3LQQ A;  1YO5 C;  1SD7 A;  1XMK A;  3SYT A;  1VQ8 I;  2R0Q C;  1O3T A;  2WAQ N;  1S7A A;  4M71 A;  4XR6 A;  2ZXJ A;  2HDC A;  1WRJ A;  3JR9 A;  2HOT A;  3HHH A;  1V54 H;  1WVR A;  2O8X A;  1XGN A;  3H5A A;  4AID A;  3A01 B;  2XKO A;  1WKM A;  3P5J A;  3M4O J;  1T0F C;  1D8K A;  3IUO A;  4B47 A;  3VSL A;  1WI3 A;  1BI2 A;  2JJ7 A;  2DT5 A;  3M8E A;  2NRA C;  3TGN A;  5B5E C;  4L9J A;  4IPA A;  3S3M A;  1BC8 C;  1Y39 A;  4MO7 A;  3CUO A;  4KIT B;  2ECB A;  2F5C A;  5LHG A;  3S14 J;  1HKT A;  2ZC2 A;  2HFH A;  4A0Y A;  1SAX A;  2A6T A;  3VB2 A;  5E8I A;  1KQ9 A;  3CJT B;  1GXP A;  1G3T A;  1Y56 A;  3JRF A;  4NC6 A;  1TZL A;  3CTA A;  4M3F A;  3TO7 A;  5KK1 A;  4CGZ A;  3BG6 A;  3E1S A;  4BXF A;  3WE2 A;  1P6R A;  4HRI A;  1VQM I;  4C3H J;  4CA0 A;  2R7T A;  3G1M A;  4ENN A;  4OOI A;  4JP0 A;  4ON0 A;  4LG3 A;  4OIQ F;  3HEF A;  3RIR A;  1ZR2 A;  1W7P A;  2WAF A;  1EH8 A;  2L02 A;  3MD2 A;  3OS1 A;  3ABK H;  4E70 A;  3D1N I;  3LAP A;  1YIJ I;  1XTA A;  5HNH A;  4AM3 A;  2HS5 A;  1XMA A;  3Q0V A;  1WJ5 A;  3E6B A;  2WA0 A;  5IT3 A;  5D4R A;  2ZSH B;  4CZC A;  3S3O A;  3BDD A;  2L9N A;  3CCR I;  2LYC A;  4DGW B;  1MBJ A;  1ETY A;  5LEK A;  2DTR A;  1F9N A;  3BZC A;  1F43 A;  4QPO A;  2D45 A;  5GPC A;  3KET A;  2V9K A;  2PMZ N;  5DS9 A;  3BR2 A;  2LF8 A;  4C3I J;  1T6S A;  5E18 F;  3IH2 A;  4H4K C;  3GYH X;  4L9V A;  3WG9 A;  4EGZ A;  5CVV A;  1O7L A;  1AWC A;  5ICF A;  3RDI A;  4U0Y A;  5JFR A;  2QWW A;  3C7J A;  3M1E A;  3QWL A;  2IVM A;  1QHH D;  4PJL A;  3LSP A;  2D5V A;  1J9I A;  3WTS C;  2BY0 A;  3LST A;  3NEU A;  5GTH C;  2QA4 I;  3WGH A;  2X6W A;  2NYX A;  2X1C A;  5CQE A;  3WE3 A;  1RET A;  1F1Z A;  3H0G J;  3ABL H;  1G4D A;  4U7B A;  1IDZ A;  2OU2 A;  1WJD A;  2NXN B;  2EJR A;  5HLH A;  2KIS A;  1LEA A;  4HLY A;  2JZY A;  1NK3 P;  1E3P A;  1JUS A;  3PJR A;  1QHG A;  5CLS A;  3BG9 A;  3JRA A;  3S16 J;  2KP6 A;  4BHC A;  5HDK A;  1Z91 A;  1X4O A;  2JQ7 A;  5JVT A;  3K9T A;  3IKT A;  1SVO A;  4FHT A;  2ME0 A;  5D5W B;  2EZH A;  5FKO A;  2HOS A;  2K9Q A;  2XAS A;  2OCE A;  5GP9 A;  2HNH A;  3C2G A;  2EIM H;  3KYL A;  2K9L A;  2XVC A;  2FOK A;  1LDD A;  5F04 A;  1UCR A;  2QF7 A;  1SD6 A;  2DJI A;  1LVA A;  5F64 A;  4B43 A;  2V1U A;  3DTK A;  2DA1 A;  4UB8 C;  1D0X A;  5J47 A;  3EYI A;  2IA0 A;  3M3Y J;  3LSR A;  4IEJ A;  1EA3 A;  2WY7 Q;  2EH3 A;  2GA2 A;  3VYT B;  2I10 A;  1O4X A;  3S1Q J;  3CCY A;  5ICG A;  3HOS A;  2X9D A;  1W0T A;  3I59 A;  4ZH4 F;  3TP3 A;  4MTD A;  5HOD A;  2KIQ A;  2OQG A;  4AD9 A;  1MBF A;  1XB4 A;  3DEW A;  2R93 J;  1A5J A;  3GO5 A;  3DCF A;  4MIM A;  3JRC A;  1O3R A;  3HTS B;  2DJN A;  4D1Q A;  1HW5 A;  1X3W B;  1QPI A;  2BOL A;  1MJB A;  3D5S C;  3MZH A;  3TO9 A;  4P9F A;  4N0B A;  1T39 A;  1BL0 A;  1X1D A;  1ETK A;  2ELJ A;  3FM5 A;  1P7J A;  4M74 A;  2Z2S B;  1R58 A;  3Q9S A;  2KRF A;  2PMH A;  2HDD A;  5EZH A;  5CVI A;  3IH4 A;  2GZW A;  3CJQ B;  4I02 A;  3SZT A;  2TCT A;  1KA8 A;  2LR8 A;  5J4Y A;  1D5V A;  4Y33 A;  1G3Y A;  2W7N A;  2H8W A;  1R1V A;  1ZTR A;  3HYI A;  3U9G A;  2KLO A;  4A6D A;  4ENK A;  4CZZ A;  3JRD A;  2ISZ A;  5LGU A;  5IY5 H;  2IP2 A;  2E1O A;  3DPT A;  2R5Z A;  3KCC A;  1DU6 A;  1XGS A;  4HBL A;  1LKX A;  4XID A;  2EFW A;  3HGY A;  2PMU A;  4HX8 A;  4PDK A;  2MC4 A;  2JN6 A; 
#chains in the Genus database with same CATH homology
 1V55 H;  3AG2 H;  2EIM H;  3ABK H;  1OCC H;  3AG1 H;  2Y69 H;  2EIK H;  3ASN H;  1OCO H;  5B3S H;  2DYR H;  3AG3 H;  3X2Q H;  3ABM H;  2EIJ H;  1OCZ H;  3AG4 H;  1V54 H;  2OCC H;  5IY5 H;  2EIN H;  2ZXW H;  2EIL H;  3ASO H;  1OCR H;  2DYS H;  5B1B H;  5B1A H;  3WG7 H;  3ABL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...