3AG4H

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag4H00
1V54H 2EILH 5B1BH 5B1AH 3ABMH 5IY5H 2DYSH 2ZXWH 1OCCH 2EIKH 3ASOH 3AG4H 3AG2H 3AG3H 3AG1H 3X2QH 2EIJH 1OCRH 1OCZH 2EINH 5B3SH 2Y69H 3ABLH 2OCCH 3WG7H 2DYRH 1V55H 2EIMH 3ASNH 1OCOH 3ABKH
chains in the Genus database with same CATH superfamily
4RGSA 1B6AA 4ENJA 2K9MA 4PSXA 3F8MA 4A3DJ 5FKKA 5EZGA 1H8AC 2IXSA 4V2FA 5BPIA 3L9FA 4XKCA 3U21A 5K7FA 4E7ZA 1QQIA 4OIPF 3HHGA 1BOAA 4Q4ZF 4Y17A 1HKQA 1HDPA 3F0CA 2O03A 2MC3A 5GPAA 4F52A 1FLIA 3PM1A 2JZYA 2QM3A 2VL8A 3CDIA 3F9KA 1ETKA 3CJTB 2V4JC 3G4SI 4H4KC 1UZCA 2K9NA 3J80K 1FBUA 2JA7J 2BEOA 3QP6A 2P5VA 4HF2A 2A5YB 1XD7A 2IGOA 5DD8A 2OUMA 4XOPA 3KYLA 2DQLA 4DZJA 5ICCA 1RC9A 5EJCA 4P9UA 2RQQA 5E3OA 5J40A 2VOOA 1PP7U 3CCUI 1ENHA 2BVMA 5EZHA 5K7ZA 3M8JA 3ABUA 2WWYA 3NAUA 4ZDLA 3V8JA 3L2WA 1WCMJ 2MLGA 4QLCU 3ZOBA 4X6AJ 2JA6J 3HIFA 4L0YB 4HLYA 2OTLI 3DTKA 2OJED 1WJDA 3KEQA 3CMAI 1P7JA 3HSFA 2AHQA 2M0MA 3TP3A 2GQQA 2EZIA 4KMUX 2R92J 4AIHA 4KA4A 5FRNA 4ZJZA 3LSKA 3UKGA 3L2QA 1GLNA 3K6GA 5GAHJ 3ONQA 1C0WA 5ILVA 4A3CJ 2DA5A 1DDNA 3ZN1A 4GYGA 2X1EA 2IA1A 4IHVA 3ULQB 3LSPA 1M1EB 1SMTA 3JRGA 4IO9F 1MDMA 3HSEA 3PNYA 1MH3A 2E1MC 2HOAA 1BJAA 3I54A 4FISA 2P7VB 4XRSA 4BJ5C 4Q5SF 2CH0A 2DMTA 2Z1DA 4I01A 4BBRJ 5TRDA 1B59A 5FKLA 2KJBA 3AG1H 1G6NA 2K5CA 4RDUA 2ESHA 2CV0A 3SYTA 2GXBA 3BT9A 4KNYA 1BN5A 1XGOA 1RKTA 4R1HA 4CCMA 4E7SA 3QODA 2R7SA 2BXYA 1MNEA 4W1UA 5E18F 4LG3A 4NQWA 3S93A 1VI0A 3HKZA 2ZXWH 4ZYHA 1CF7A 3S3OA 1B9MA 2CGPA 1Y6IA 2Q2EB 3CQZJ 3FX3A 1DUXC 1WFXA 4XM3A 3K4BA 3ZQHA 2CO5A 5FKNA 4CYDA 1GV2A 1I50J 2BOLA 3DKYA 3T8RA 1YX3A 4FASD 3BROA 2PX9A 3KLNA 2WBMA 4X1EA 3BG9A 3WU1B 3GTGJ 4YEJA 3CCVI 3HOUJ 4IHTA 2XB5A 3MWMA 2KIFA 3PSIA 2L0KA 2ZXJA 1KZHA 1JTYA 1JKQC 1O57A 1LEBA 1VQ5I 2LY9A 3GVAA 3WTWC 4G6TB 1Z7LA 1WI9A 1XDSA 4M9XA 3T5XA 2VN2A 4PSWA 3KZIC 3BQYA 1NK3P 2PJPA 4UV8A 3CCJI 3HTSB 2V9PA 2P6TA 3MQ0A 4D9JA 4UB8C 2JWTA 3I4PA 2E60A 4XKVA 5FKMA 2DW4A 3M1CA 3QAHA 2VC1A 2KZVA 5AONA 4A12A 4R79A 3GTQJ 2FOKA 1OISA 2BHZA 1AU7A 4EEFG 3HRMA 1SVMA 2G7HA 4IOAF 4JBAA 1T56A 3IH4A 5CYVA 3K1PA 3E7LA 1UG2A 1FMWA 1TWHJ 3A02A 2V6CA 2KDZA 2YSRA 4OWRB 1FSHA 1MJAA 4L0ZB 2HQAA 5FJ8J 2ZXIA 4CUGA 1RESA 5JFRA 1YTYA 1EH8A 1TTYA 3FM5A 5KCMA 2QF7A 1ERDA 1R4MB 1E3PA 3CP2A 1HDDC 3CC7I 3BY6A 3EUHC 4XLPF 4AUXA 1DPUA 4GO1A 2L4AA 3Q0VA 3TQNA 2KT0A 1TQMA 3JW4A 1B9NA 4BEHA 4HQEA 2EIMH 3CDHA 4PJLA 5EF6A 2OA4A 1QPIA 1UMQA 2OC6A 4I76A 3IH2A 3FZVA 3OR1C 2CRGA 2K86A 3U9GA 3G2BA 4MTEA 1FPQA 1ETQA 3F8BA 2GOXB 3BWGA 1IW7F 4V2GA 4M3DA 2F5CA 4NDLA 5ILSA 2UZKA 5LFAA 2VQLA 5DTDA 1VNDA 3TOAA 1UAAA 1KGSA 2LKSA 1MBHA 2M4KA 2XF5A 4MEXF 4BS9A 3SEQA 1I3AA 2O7OA 2P8TA 4XICA 1JKOC 5KVRA 3H9GA 4CHUA 2J5PA 4I0BA 2JTVA 2R5ZA 1O7FA 2IS1A 3E5XA 3MEXA 1ZGJA 3L00A 1G2HA 2LMDA 4AIKA 5HNHA 1VQLI 2LOOA 2M87A 4PGHA 1ZYRF 2IAIA 4EJUA 4C3JJ 2DFIA 3E5QA 5BMZA 2HOEA 4HF1A 1R1VA 1R36A 2Z3YA 2EV6A 2EPFA 1EKEA 5IPAA 4MFDA 1MD0A 3GTKJ 1FSEA 3RKYA 3LOCA 2E2IJ 3HUGB 2KHMA 2BW3B 2XPVA 4S0HB 5E20A 3PFYA 4PJ0C 1YITI 4F91B 1YJ9I 5K5RA 2DOFA 1QVTA 3P9CA 2OZUA 2P4WA 2NNYA 3LSJA 3KP7A 1Y56A 3H36A 4EJVA 2XAQA 3DV8A 1ZGWA 4EGZA 1F4KA 2VQCA 3GXOA 4BYYA 2R7RA 2D1HA 3VEPA 2KQRA 3KFWX 2K85A 3QU3A 3D5LA 3H0GJ 4BQQA 2D1VA 5HDGA 2F48A 3ZR8X 2DA6A 1U9OA 4BXXJ 4LMYA 1U3EM 1W1WE 3M4OJ 5H20A 3IH3A 2PEXA 5GPCA 3SZPA 2ELKA 4MQVA 2MD0A 1WJ5A 1IV8A 4HQMA 3WU0A 3GTPJ 4JX6A 5F0CA 1QHHD 5E1WA 4LB6B 5JLWA 1FZPB 2V7FA 4UY8I 1IDZA 5KNLA 3I9V2 1UHSA 2AQFA 2NAZA 1ETOA 4I09A 4CA0A 4F7ZA 2XROA 1TT0A 3HXLA 3M1EA 1OYIA 5H2FC 2CUEA 2R5YB 1T39A 1RR8C 2F5EA 5JR3A 3GW2A 3M8FA 2NS0A 4U7BA 2HS5A 3ZPLA 2O9LA 1WZ2A 3GFJA 2YX4A 3OYBA 2ZSIB 2PG4A 2FMYA 2Y48A 3JRBA 2H1LA 5CJ9A 3OYGA 3WTZA 4OMYA 2H1KA 3I64A 4BE1A 2AXTC 1BM9A 1LDDA 3O8GA 4RGXA 3V8KA 1RIOH 4YIIA 4CO8A 1ETWA 3VFZA 2RC4A 2M2EA 4Q47A 4RAZA 4RGUA 1J2XA 5LGNA 3COAC 3CMMA 1T08B 1UB9A 3ZGKA 4A5NA 2X1DA 2R5ZB 3EETA 4A5MA 1SC7A 2CUFA 2Y0SN 3WGIA 1L3LA 4NUBA 3G71I 1FBQA 4XLEA 1LJ9A 3OIOA 1ZHFA 5J8FA 2BY1A 3LA7A 2E35A 2VJIA 5L3CA 2LLKA 5KK1A 4HLXA 1X3UA 5B66C 2L7MP 1SVOA 3HG9A 4NQWB 1WQ2A 2VB6A 2K4JA 4II3A 2VQGA 1VQPI 2DN0A 4IEJA 3K0LA 4G7OF 1FTTA 4DYCA 5J8CA 2CMPA 5HS8A 3D5RC 1IN4A 2KDOA 1X2MA 2F6CA 1JT6A 1MKMA 3F22A 3HB9A 3BC8A 4A3EJ 4LG0A 3Q0WA 3ABKH 1XC5A 5EDNA 3HSRA 1EH7A 2BXZA 2IJLA 3JRFA 3EDPA 1T0FC 3PNVA 4AU7A 3C2BA 2OPTA 2QEXI 2GXAA 3BPVA 2KP6A 3H3VK 2E2HJ 1UELB 2XHKA 5K5OA 2Y75A 3M3YJ 3BJAA 1HSJA 4CZCA 2KIQA 1LUJB 2JSPA 1LFUP 3CLOA 4RLQA 2JRMA 2G9WA 2WTEA 1MH4A 3MKLA 4GDFA 1J7KA 2ACJA 1QU3A 3QYBA 3JSOA 2XV4S 4WXDA 1X3ZB 2DYSH 2H6CA 5AIQA 4ZYGA 5KHDA 1U8RA 3LSHA 4U88A 2PBIA 5E1XA 5LEJA 3W2VA 2FBKA 3O6BB 1FIPA 3H35A 2HPIA 4B44A 2M8GX 4Q48A 2E5NA 2CG4A 1FX7A 3SDGA 2FA5A 1MMSA 5IT9K 2VBXA 1TWAJ 3IKVA 4WK8F 3FK6A 3ZQ7A 1HBXG 2Y2ZA 2YUSA 1ON1A 3IP4B 2DA4A 1LB2A 2HQNA 2D2WA 3DEUA 3NQOA 2UV1A 4HG2A 4M3GA 3SJMA 4BY7J 3AG4H 2JRTA 1J0RA 2JA5J 2HTJA 3TW6A 4XRMA 4B09A 4N4NB 1TQIA 1YW9A 5BNGA 5HLHA 1IZ1A 4P5OA 4WF2A 4LD5A 1R9TJ 5LRRA 3ZXSA 2V6EA 4A69C 1CGPA 4L9JA 2K4BA 3VB2A 4IRGA 3ZMDA 3LSRA 1FOXA 3CUQA 1E2XA 1VF9A 1D3YA 5FRMA 4I02A 2QQ9A 1ONVA 2O8XA 1WH7A 4BY1J 3L2CA 1OCOH 5FLVA 3J81K 3U2RA 2VUMJ 2E36A 5E1ZB 4ZTJA 4Y7NJ 1E17A 4BHPA 4M6XA 2ZB9A 3QP5A 4ON0A 2XKOA 2FE3A 4D1QA 1WRJA 3FXKA 1SD7A 2Q8KA 2XSJC 2FX0A 2V79A 2K40A 1SFOJ 3WGGA 3WTVC 2K7LA 4OMZA 2ZC2A 4AIDA 3HOZJ 1HKTA 2GOMA 1HLVA 4XR6A 3HGYA 3J7YJ 1VQMI 4Y52J 4QTRA 1VQ9I 5M5XJ 2R0QC 3FBNB 4HW0A 3G6EI 2MC4A 3RKXA 5LHGA 1A5JA 4U0YA 3GLLA 1BI2A 1ON2A 2HXIA 4HA8A 5KAIC 3DBHB 1MW7A 1V4RA 3CCEI 2VLAA 2HXOA 2XRNA 1W4MA 3QPHA 5K7HA 2M45A 3MKYB 5D6EA 2VJ4A 2FOWA 2IW5A 4XLFA 2QGUA 1R5GA 4MNUA 2RKHA 4BE2A 4A0XA 2O5RA 1SD6A 1QZZA 3IC7A 5CQEA 4M71A 1V5GA 1VZ0A 3OYNA 4PDKA 4BUPA 4YIRX 1OPCA 1OJLA 3EPZA 3GLXA 3V7SA 2LYCA 1YRNA 2DDBA 2K3FA 2M7AA 1RI7A 3E6CC 2RGVA 1SFUA 2XPUA 3VYRB 3LNQA 4ETSA 1X19A 1R6RA 1E3HA 3ZQQA 2NOJB 3KP2A 2K27A 3DKXA 4ASNA 3PIPF 3WG7H 1JGGA 4J00A 2STTA 1IRXA 1QHGA 2L7ZA 3N05A 1DGRM 1W0UA 1ETXA 5F1RA 1S7OA 2DT5A 2XC7A 2BY2A 3OYEA 1D1BA 5IYDJ 3S8PA 3JAMZ 1WGXA 3ERED 1KU9A 4JX4A 2A07F 5HLIA 2ELJA 1S7EA 2FRHA 2KIMA 2P5LC 1MNMC 3OMYA 3CC2I 3BR2A 1FOKA 4PJNA 5HS9A 2D45A 2BE5F 2JVHA 1XPXA 3F6OA 4N9IA 3MKZA 5E8IA 1GXPA 2FJ1A 2GAUA 2OQRA 4MIMA 5D8KB 4ABZA 4IJAA 5D4SA 4BJTA 1F5TA 3DBLB 3RIRA 3CZ6A 4WXHA 3T0YA 1HXDA 1JUMA 3S32A 3BR6A 1USTA 4A3LJ 1S7AA 2FSWA 2IS4A 5D8LB 3I71A 4OIQF 4UVAA 2DOEA 2WAFA 4BXFA 3I3LA 3LFKA 3R0JA 4M6YA 3U1KA 3ASNH 3J80Z 5DCFA 5IOYA 3BZ6A 4F3QA 2COBA 2IT0A 3H3UA 3B6AA 1F43A 4M72A 4U0WA 4UVCA 2H94A 3PJRA 2E1OA 3QPLA 4QPOA 3F8CA 5HLGA 1I6XA 2R7FA 5DDGA 4IHXA 4M3FA 2V1UA 3OOPA 3JRCA 5AIPA 5DYMA 1B4AA 3IV5A 2W57A 1MSFC 4B48A 4ZZDA 2PQ8A 3G73A 4KT6A 2M0CA 3ZMTA 5LBQA 3OSFA 1FOWA 2EZHA 3S17J 3S1QJ 5BS6A 3K1NA 4AD9A 4UUVA 2BBYA 2KFDA 2ECCA 3DWLE 4C9YA 4M3EA 2A3SA 2XB0X 2LREA 3GMEA 2H09A 5HDKA 2BGCA 4E7HA 1XDUA 4MEYF 3LQQA 1XX5A 1I27A 3DLAA 1BBYA 3OV8A 3PFIA 1IV6A 1DU0A 2NRAC 1X1CA 2O3FA 2JPBA 3K9TA 4WCGA 5IP9J 1SMYF 4ZYDA 3MMYB 2IRFG 2F4OB 1ZLKA 4J19A 4XLHA 3K4JA 2L54A 3ELKA 1BIBA 3AG2H 4JQFA 1Z6RA 3BZKA 1J59A 4P55A 4B8XA 4OAZA 1OCRH 5JI6A 4B47A 1FY7A 5IT3A 3F3XA 4FHTA 5GAEJ 2MG4A 3LA2A 3HOYJ 1X4OA 2IGNA 2L9SA 2MABA 1TBXA 2ETHA 3KETA 3FHZA 2IA2A 1YW7A 5CPRB 1IN5A 4NNJA 4LLLA 1FP2A 2VQHA 4GCVA 1MBFA 4A3FJ 3IRQA 3QOEA 3HBLA 1OR7C 2DPDA 1W36C 4AM3A 2CQXA 2ISZA 1MBGA 2A05A 3GEZA 1D1AA 3BZCA 4ENMA 5EEHA 2WB1N 3W6JB 4AYBN 1IXSB 2P6SA 2CQ7A 4NHJA 3DTEA 3GWZA 1TWGJ 4PZJA 5F64A 4XBFA 2XSDC 4X0GA 1WJCA 1ZG3A 4ZDPA 3IRRA 2W84A 4OU0A 4B43A 2X48A 2XVCA 2L7KA 1Y39A 2HYGD 3FISA 4HDUA 4MTDA 3I4MJ 4Y13A 3W3CA 2UXXA 4XQFA 1I6HJ 3MCZA 5CKTA 3HUGA 3KP3A 4CCNA 4NC6A 4Y15A 2LF8A 2HDDA 2W85A 2LNBA 3FIWA 2WA0A 4BH9A 1XGSA 4KN4X 4D5CA 2ME0A 2KKOA 1REPC 1TT5B 3FKJA 2OQGA 5TISC 3E97A 3CTAA 3DPUA 1F1ZA 2LH9A 1MZBA 4BAYA 1TW2A 1FIAA 4EM2A 3TMOA 2YX7A 4I0AA 2Y69H 4D5FA 3G1MA 2ZJPF 1XTAA 2DO7A 3CUQB 4UUTA 1K78B 1XSXA 1DPRA 2OTJI 4EJWA 3L7WA 2WAEA 1HOMA 2PJRA 3HOSA 2ISYA 3SZTA 3CMYA 1APLC 1LVAA 2Y0MA 5D4RA 1W7PB 2X85A 4Z2YA 3ZQIA 4U7DA 1DQUA 1K61A 2EIJH 3BDDA 1YLFA 2DMNA 2JK3A 1AWCA 2JQ7A 3EYIA 1G3YA 1LDKB 3C1DA 3RSNA 2OZ6A 4HAMA 3TDUC 3TOBA 4IHYA 1QVUA 2YPRA 1U2WA 4BNCA 3WHBA 1IUYA 5L3GA 3C7JA 2GIVA 5DUKA 3C3WA 5GAGJ 2ZMEB 1G59A 4ZDOA 1RR7A 2VONA 1W36D 2VOPA 4XRFA 5LEKA 1N78A 5LD2C 2A68F 3EUHA 5FROA 3BR1A 3PSFA 3F21A 1D1CA 4RS8A 2DDAA 1YI2I 1D5YA 3RZDJ 2A6HF 1X1BA 5M3FJ 3J7AY 2STWA 5TGTA 5ED4A 1RUNA 2I8DA 2V9VA 3LFUA 3BCBA 4ZH4F 2CJJA 3FXUA 3HTUA 3IWZA 2VJ5A 4XIDA 1MBEA 4NC8A 1K83J 3FMQA 1VQ8I 3BR5A 3ISPA 4PK4A 3BG7A 4P1WA 5B1AH 3RDIA 2BZTA 3LSIA 1WI3A 2AS5F 4B1RA 3QWLA 2DA2A 2DODA 2WADA 3OYLA 2Z2SB 5C44J 3OYJA 1WJAA 2DTRA 1EH6A 3I4NJ 2CFXA 1R49A 5F1JA 1GXQA 3H1CA 2F4IA 3DKWA 1G3TA 2DJNA 2OU2A 3H5RA 3BTJA 4FQGA 3AFHA 4ZTFA 1G3SA 2NS7A 1XG1A 2DBBA 2JA2A 1BC8C 3QQAA 2LSOA 1DP3A 3HKZN 2R4GA 3EYYA 1WSUA 2HVRA 2LTPA 4BQNA 2DMUA 1K4SA 1P6RA 2F5DA 3SFZA 1WPKA 1H9GA 3Q0UA 4Y3OA 4YFXF 4FE4A 3WU2C 1Y1VJ 4BHBA 2Y9YA 4YRVA 1H0MA 2GIZA 3A01B 4PFOA 4UV9A 2XUBA 2QA4I 4KIGA 1XS9A 2KRFA 1GVJA 4G8XA 2OV7A 3JSPA 3FWEA 3BCAA 3D0SA 4I6ZA 3P9KA 4MLOA 4CSWA 3CCMI 2VBYA 5HLTA 2DQRA 5H6RA 3L2VA 3HRUA 4XKWA 1USSA 2Z99A 5FD5A 1GT0C 3FBIB 2NNNA 2E34A 2RREA 4G9YA 1TNSA 4E4HA 1JJ6C 3GFIA 5BPDA 3DPLC 1ORKA 2IA0A 3IUOA 2LBFA 5HODA 1VQOI 3DEWA 3R6SA 3CLQA 1ITYA 3FXLA 2CQNA 3TBIA 1YJNI 4BHCA 1AA7A 5J4YA 1TP4A 2EA2A 3HGGA 3L1PA 4RMNA 3OS0A 1QZEA 3DU6A 2QENA 3RJPA 3H9JA 4GYIA 2IS6A 3HPGA 1X4PA 5F04A 3JREA 4RGRA 3TEDA 2JUGA 2KZGA 1AOYA 1Z67A 1MMGA 4DIQA 3ERMA 1KYWA 2E7WA 3EUKL 2LFBA 3ZCOA 1XMKA 4QSHA 1O3TA 3JR9A 1T2KA 4LK1F 4KT5C 3RQ4A 3S2HJ 4HRIA 1PYVA 4KYWA 9ANTA 2Y0SA 1BL0A 1ZRDA 1D0YA 1ZREA 4A3MJ 4XNFA 3PUFA 1MBJA 1OQYA 1V54H 1MMDA 2CW7A 1H9TA 3BG3A 2H8WA 3ABMH 4L5IA 4Z6YA 1J9IA 5CVUA 1R5HA 1BR4A 3O2PE 4BL0B 1SFEA 1Z91A 4IQJA 3OIQA 1JKRC 4PUSA 2BY0A 3BLYA 2IEKA 3FM3A 3RYRA 1LE8B 1WJEA 2DCEA 1OYWA 1JHFA 1MDMB 1L0OC 1MIJA 1V5FA 1X1DA 4KIFA 4JOMA 3KP5A 4CCJA 3SEZA 4BGDA 3ZP5A 5BOXA 2KRCA 2QQ8A 5HDNA 4ESBA 5HOOA 2I5UA 2KL4A 2QSFX 2A61A 5FLXK 2ZFWA 1B8IA 5ERIA 2EV5A 2FNPA 4BKXA 2J5OA 5J1UA 3F8FA 3HOTA 3OWTA 2DMPA 1JGSA 3CJRB 2KIUA 1K79A 3F72A 1WVRA 2QVOA 2X6OA 1ZARA 2OF7A 1PVEA 3DFGA 2AO9A 2XGXA 1PUEE 4EMSA 2NYXA 4RM3A 2VE8A 4J01A 1ZTRA 1DP7P 3BTLA 4LOCA 4BQAA 2V1XA 1FJLA 3A0BC 5DEQA 4EVIA 3ROUA 3ZQGA 4KICA 4L9TA 5HS7A 1WKMA 1I1SA 1ETVA 4CCKA 2E1NA 1IXCA 2CV1A 3LA3A 4DYQA 2WY7Q 1NG7A 1A35A 3QYEA 3G3ZA 2DPUA 3PQJA 4A2UA 1H89C 1EA3A 3PO2J 4LGWA 2XAJA 1U5TC 2QUFA 3TO9A 1FEXA 4YFKF 5DCMA 3W2WA 3CUOA 4Y33A 2F2EA 2F4MB 2KPMA 3HM5A 3GTOJ 1UG0A 3MN2A 2QSHX 3CD6I 3E6DA 2NXNB 3I0TA 2TRTA 2AQEA 3PNTA 2NVQJ 2IPQX 5ICEA 4AVZA 1OCCH 4DZPA 5BQTA 3A2KA 3RTRA 4CCLA 2E19A 3OY9A 2RQPA 1LFPA 4IF4A 5IP7J 4FCYA 2Y31A 1WH5A 4DNCA 1Z3YA 1JUSA 1X2NA 1X1PA 4EV0A 4F93B 3GF2A 3VSLA 3AL0C 1TWFJ 2LVSA 3GFMA 2MSYA 3V8LA 1IRZA 2B7EA 2C6YA 3QU6A 3SDBA 5IP6A 1W5TA 3VDXA 1YO5C 1ZRCA 3M7GA 1FYLA 3OS1A 1WWXA 1ZK8A 3K4LA 4FTHA 4DJAA 1D0XA 2F5FA 4RBOA 3W6VA 1K4TA 1HF0A 3F8NA 1OCPA 2DFEA 2QLZA 1YIJI 2M7BA 4HF0A 4KDPA 3HJEA 3DF8A 4RLFA 2WY8Q 2BV6A 3CCLI 4BEHB 4AYBA 4ZYAA 1PUFA 3AL0B 3JRDA 5EG0B 1U5TA 1BR2A 2DI3A 4LFUA 5CLSA 2K3PA 5E3MA 3N4MA 2EA4A 2VKHA 1U8BA 5E17F 1KU2A 5A2QK 1O3SA 4KFCA 2GA2A 3ZN0A 3OYIA 5LRSA 2DU9A 1ZR4A 2ZMEA 4L5JA 4FE7A 4AIJA 2QQBA 3L2UA 2K02A 1HW2A 4BU2A 2DA1A 2IGKA 1E0EA 5DV5A 4A3JJ 4EJTA 2VKDA 4HX8A 2QCOA 2ICWG 1OCZH 3GZ5A 1AKHA 1SAXA 1T98A 3PUBA 2KRHA 1IN6A 1FWZA 1BR1A 2UUZA 4RA2A 2LRDA 3B02A 4DGWB 1W7PD 1KU3A 1OLTA 1Z3XA 2ZXHA 1IUFA 4HOBA 4C30A 2LKXA 3A01A 4YFNF 1SANA 3HOWJ 2L02A 2X6WA 2L5QA 4U87A 4RM2A 1XMAA 2GBYA 5F27A 3CP8A 2EFNA 1YHQI 1IXRC 3HOXJ 2FMLA 2YS9A 3ABTA 4B3AA 4DOZA 2CQQA 4EQQA 5EGOB 4CCOA 4HNUA 3S1MJ 3CMEI 3I59A 4O6JA 4H0EA 3W2AA 1MNDA 3RQIA 3FXJA 5JVGF 1P9QC 1TL8A 2DOAA 3CJNA 2DT6A 4FX0A 2CUJA 2ZJRF 2L4MA 2FBHA 4MGRA 2W24A 3I5UA 2WV0A 1R1TA 2DFHA 2H27A 2V26A 3FF5A 3RCOA 4IX7A 3EUAA 2IGMA 2M4GA 3JCUC 3RZOJ 2BHYA 1VQ4I 5M3MJ 2W25A 2VI6A 3GTLJ 4A93J 3DXJF 2VASA 2X0LA 3E5UA 1QZYA 3ZMSA 2H6BA 1YS7A 3AKZA 5F0FA 2K9QA 1QGPA 1QRYA 1SFKA 1Z21A 2VXDA 3R60A 3VYSB 3K70C 2HDCA 4XSZF 1B1BA 3C2HA 3A03A 5EEAA 3VYTB 3HC7A 1BC7C 2LG4A 1HCRA 2R7ZJ 2HQRA 1W5SA 2EILH 1FP1D 2W4SA 4KIBA 1S72I 4UUSB 3PO3J 1VQNI 1R5ID 4IRHA 3AAFA 5F6FA 3S14J 4L9NA 3HZJA 3IL2A 1O3RA 1TQPA 5H6QA 3JRIA 4EM0B 2E2JJ 4L18B 2A6EF 2RN7A 2XPWA 2DAOA 2HZTA 4UHTA 2XGDA 5C4JJ 2HDWA 1U78A 2FF4A 4FT8A 2HPMA 1A6IA 4UB6C 1FNNA 3IHUA 1XN7A 2DTZA 4M9SA 2EBIA 4ENKA 2Y9ZA 3E6BA 2VXZA 2QKMB 2HFHA 3PQKA 1IGNA 2ZMEC 3JRHA 2ELHA 2GWRA 2HNHA 2E1CA 5DD4A 3BP8A 3H0DA 2WAQN 4EJOA 1JE8A 2VC0A 2XGCA 1IRGA 2E71A 3TO7A 2QYOA 2DK5A 1Z6TA 5J6XA 1N77A 1R1UA 1P2FA 1BA5A 4HZFA 4C3HJ 4DQ2A 1QO0D 3VWBA 1SFXA 1JI8A 3CO7C 2LBFB 4LK0F 3TDZC 3S3MA 3KIOA 1K6YA 1QNTA 1FOYA 2JPCA 2X51A 1JXSA 2YR2A 4DYRA 1K78A 2HI3A 2W7NA 2R7TA 4XLCA 4O3MA 4MHGA 1BJZA 4KN7X 1BOBA 5CQGA 2HKXA 4IHSA 3WTSC 2I10A 4HV6A 3I55I 5B5EC 2R7XA 1IJWC 1P4AA 4AVPA 1MJBA 3CCYA 3OYHA 3K70D 2CW0F 4MO7A 2MGQA 1YJWI 4LIVA 4JYKA 1LEAA 2YU3A 2L9NA 2RNGA 2W1OA 4HX7A 3GYHX 2XIGA 1R4NB 2HOTA 1OKRA 3LSTA 5LGUA 3RI4A 2F5VA 3S15J 2MW8A 2ID3A 3IWFA 3J81Z 1S5LC 3GTMJ 1PJRA 3VYUB 1RZ4A 3EQLF 1QA6A 1HC8A 1A6QA 3DQVC 3Q3SA 1GDTA 2P5KA 3DLLF 1A31A 1IF1A 5J47A 4HSRA 4B4CA 4BJ6C 4A3IJ 3A1YA 3KE2A 3WTYC 3KYCB 4A3KJ 5D5WB 1A04A 4KJZA 3FDYA 1ZAOA 4O5VA 2L9VA 1V55H 4LJZF 4PCQA 1YFHA 3DP7A 3HRSA 2LK2A 3HPHA 2PFBA 1TLHB 4ITVA 4DW6A 1IAWA 4XN3A 4JP0A 1J09A 4IZZA 2XKPA 1LNWA 1U9NA 3NWSA 5M5WJ 2O6GE 1LPQA 3WHCA 3ZQCA 4CXFA 3HDDA 2EINH 2WC2A 4R8HA 4P9FA 1D8KA 1KQ0A 1HW5A 5JHUA 1OMIA 4HBLA 2O0YA 4AC0A 3QOPA 4XKBA 1JTXA 2KMUA 4G6DA 5FGMA 4ZZLA 3MZHA 3VOEA 4M73A 5EG0A 4ENNA 3S1RJ 5KAFC 2W00A 2R7WA 2NVTJ 2EFOA 3B73A 3FXRA 4OAYA 4BQOA 2JUCA 2DLLA 3M9AA 1GHCA 1UJ8A 2A6TA 2IBDA 4I2OA 3NARA 4G12A 3KP4A 2ZNZA 1KQ8A 2JVGA 2HZDA 4RB3C 3PL8A 3NWTA 2MBFA 4U0VA 1ZQ3P 4LLGF 1Z77A 1BW5A 3GCMA 1SVLA 3SXYA 3ML6A 4HYEA 1ZG5A 3MAJA 5F08A 2MD5A 4GFBA 1YX5A 3MD2A 4WX9A 2DA7A 2VT2A 4NBQA 3CO6C 2EZKA 4A0YA 2HWVA 1LFBA 4C2TA 3WTXC 3LWFA 1VQKI 1LKXA 1KU7A 4BBSJ 1D8JA 3S1NJ 1R58A 3BJOA 2EFWA 1F9NA 2QZ8A 2R3SA 2ZKZA 2CS3A 3QYFA 3OS2A 2GXGA 2RDPA 2XF7A 1OR7A 2PMUA 1KONA 1Y8RB 4YG2F 4IOCF 1W0TA 5L3BA 5FB2A 3JAMK 2Q1ZB 2BYVE 2EFQA 2H8RA 5IOZA 2XAUA 4FX4A 3W6KB 4D0PA 3B6CA 5ICGA 1CQTA 3ZRGA 4PGGA 1STZA 2XF6A 1DU6A 2ADUA 1UHWA 3K10A 1VFCA 2R7OA 1JKPC 1R23A 2EV0A 3E6MA 4CGZA 1ZKGA 2BY3A 2X4HA 1JT0A 1FBSA 3ECHA 4MFEA 3KPHA 3SHFA 2LC2A 3MZYA 2L7FP 5J4VA 3T8TA 1MMAA 2CSOA 2ID6A 1B72B 4AWXB 2HQ5A 2HOSA 1LQ1A 4LLNA 1SD4A 1ZLJA 4MQ9F 3BTCA 1RKWA 2HKOA 3ZQFA 3HL2A 2XAFA 2PLYA 1XCBA 1YE9A 3I59B 3L2RA 5ICFA 4S04A 3BQZA 2GZWA 1Z7UA 4ESFA 4HDVA 4E70A 1IDYA 1FT9A 3HHHA 3RKQA 2Q0OA 1BW6A 1VQ6I 5B1BH 2FQ3A 2Z16A 5E79C 2VT3A 5D5VB 1XSDA 2XDVA 2L2OA 5L3FA 2K9LA 2X1CA 2XAHA 1K7AA 4N4OB 3LSMA 1KA8A 3Q9SA 3LAPA 4V19K 5JLXA 1YS6A 1HW1A 1S9HA 1WJBA 2G7UA 2KLOA 3TP0A 3CESA 4CYCA 3DEEA 3K4NA 4IPAA 4OINF 3DPTA 3HRTA 4GGGA 4ZYEA 1IO2A 1R7JA 3OR2C 5EEGA 3K4MA 2DMQA 1T8IA 4XLNF 1UCRA 2DXIA 3QPTA 3RYPA 3K4KA 3P9IA 2IS2A 3BR3A 3F6VA 3JTHA 1J5YA 4E6KG 1TZLA 1R71A 3VODA 1RPWA 1S3JA 2CQKA 1B8IB 3GFLA 4E7IA 2VBWA 3FKIJ 1T0FA 5E8GA 2RNJA 1YOVB 2HYJA 2WV1A 2B0LA 4F92B 1NTCA 2E1MB 1XMXA 1P4XA 5LLQA 3K69A 2UXNA 2P7CB 2MFZA 3DCFA 1ZH5A 2V9KA 3K2AA 3QRFF 4CZZA 2X6XA 5IT9Z 2MH2A 3VPRA 4XMYA 4A3BJ 2JN6A 3OYMA 2LDUA 2RVCA 1Z05A 4HNTA 2YU9J 3KP6A 3ZMUA 4N0BA 2FQ4A 2HYFA 5D5UB 3FMSA 2TCTA 3I56I 3O8HA 2WAQA 5L3EA 3A4CA 2LY1A 1P7IA 1XB4A 3S2WA 1UFMA 1BI1A 1IN8A 2EJRA 3C18A 1GUUA 2L01A 1W5CC 2V1NA 5B3SH 3N97A 1GVDA 1V5EA 2PN6A 3K7AJ 2LR8A 1B72A 4N9HA 2VKVA 5ILUA 2XGEA 4OOIA 5HNFA 5DM6F 2QWWA 1FYMA 1NHAA 1JJ8C 3HOVJ 4B3XA 3MVPA 5TJJA 3WE3A 1WJFA 3RPUA 1CF7B 4CDGA 3OYKA 3TW7A 1T6SA 3GUDA 3ECOA 2R5YA 1O3QA 3H9QA 2FD5A 1P4WA 1T38A 3ZMVA 3GO5A 4IQ4A 2A69F 4S05A 3PIOF 3DBRB 3BR0A 2NVUB 4XLAA 5JHFA 2DFFA 5IYCJ 2LD5A 2FUG2 1SD5A 2ZCWA 2K9SA 2IP2A 2L9RA 3CJQB 3SFIA 3ABLH 3CCRI 3UR3C 2KJCA 3BPXA 3CC4I 1IC8A 5M5YJ 2OD5A 1U5TB 4F55A 3BOQA 2Z9OA 3HEFA 3I53A 5GTIC 3WODF 3CCSI 2Z33A 4XL9A 2UWMA 2HTSA 3MFKA 4YELA 2E5ZA 4PFPA 4RAYA 4IVNA 1JUPA 4QWQA 2VIXA 2FEZA 2EH3A 2JT1A 1ZELA 2E7XA 2VBZA 3LSGA 2M30A 3H92A 4RB1A 2L3DA 2TDXA 4NB5A 3MZ8A 4E7JA 2FBIA 2XRLA 3FK7A 4ZC3A 2O61A 2B9SA 5EYRA 1GV5A 2R7QA 3KEOA 1KYZA 3K2ZA 2EK5A 3TKYA 4A6EA 1R00A 1AKHB 1IRFA 1WHUA 2B63J 1Y1WJ 1QPMA 2ZO4A 2VPRA 3RPUD 3BG5A 2ESNA 3V4GA 4I99C 2GA1A 1SAUA 2LP0A 4XONA 3RPQA 5J1YA 1IG7A 1Q1VA 1ZGAA 5CVVA 5D6FA 4QPQA 2PMZA 2ZJ2A 5EGOA 2ECBA 1XGMA 4UXNA 2LKPA 1I39A 3RKWA 4BDYA 2JA8J 1Z1DA 1X1AA 2OBPA 5FO5A 2NVXJ 5DS9A 3OYFA 4LG0B 1ZRFA 3L09A 3KYDB 3WGHA 3M8EA 2FXAA 3V7CA 3IAS2 1ZG1A 5FFZA 3FXQA 4RAFA 3WG9A 1YIOA 5GTHC 3VSKA 2EIKH 5GP9A 2OCEA 2DJIA 2EB7A 4EM1A 3KZYA 1SEUA 4WWCA 1UHMA 2A5WA 2R7DA 1Z0XA 1N25A 3CUQC 3GZNB 3KLOA 1G4DA 1F36A 2Y30A 1U6GA 4GRIA 2PI0A 5J3LA 4UNOA 2M1BA 2R93J 1PP8F 2R7UA 2JMWA 4LIUA 4W97A 4JX5A 4GXOA 2DT7B 4BDZA 4D7MA 3MKWB 4M9ZA 4G6QA 2ZFUA 4FETA 2M5WA 3K1MA 4IL6C 1G3WA 4Y4RA 4M3BA 3ASOH 4KMFA 4KITB 3K4CA 5FLMJ 3AG3H 4XOTA 2XASA 2QQAA 2VJJA 3S2DJ 2HGCA 1S8NA 3T1BA 2RAEA 4RB0A 2QBYA 1ETYA 3E1SA 1MGTA 1FMVA 2ZNYA 2CW8A 2ZBKA 5DCMB 2FNAA 2MYSA 3I58A 2EQRA 5K5QA 3SQNA 3KEYA 3KX2A 1OCTC 2HU9A 2MH9A 1POGA 3OSGA 4C2UA 4E7LA 3TL4X 4E7KA 1PDNC 5J1RA 3H5NA 2HVQA 1D0ZA 1T95A 4G7ZF 2M3AA 1Y8QB 4PJMA 4BACA 4PJJA 5L3DA 2GM4A 4C3IJ 2LF7A 2JSCA 5E3NA 1BIAA 1QBJA 1RNLA 2AXLA 2CV2A 3S16J 4WXCA 3LQRA 2W48A 1FC3A 3OL3A 1JHHA 2NVYJ 3BJ6A 3SZGA 3J7ZI 1YG2A 4BE0A 2CYYA 1YW8A 4ANJA 3JTGA 3QPSA 1YYVA 2EWNA 2M9HA 3TGNA 5LHHA 4D7NA 4CH7A 4HNVA 4IHWA 4CYCB 2X6YA 1V3FA 2VKEA 4HX4A 1I1GA 5LGTA 5C4XJ 4XSXF 1O7LA 2Q2EA 3D5SC 2CFOA 2Z5UA 5E3LA 3GZ6A 3G1OA 1VQ7I 3OIPA 2N8GA 3X2QH 3E0JB 2G0EA 4M74A 3Q5FA 5GADJ 3FMRA 4NC7A 3GX4X 4HEA2 1E3OC 3NRVA 1T33A 1ULYA 2EFPA 3GTJJ 1VTNC 2MLKA 3M07A 1HQCA 1P92A 4DBQA 2QBYB 3P7NA 2RV8A 4IXAA 2PMHA 5DM7F 2MA3A 2P0WA 3D1NI 2VODA 2FU4A 1EF4A 3CF5F 2D5VA 3NEUA 4P96A 4TV7A 3WE2A 1I3QJ 1XCVA 2KISA 3GBGA 2EZLA 4IRIA 5CVRA 3C2GA 4HSTA 2IVMA 5LHIA 3H3ZA 1ZR2A 1A36A 2ME6A 2M34A 1PUFB 3FXMA 1ODDA 3DTIA 5FFXA 1X3WB 5D5XB 1EJ9A 4QIWN 3R0AA 2XAGA 1K6OA 2NS8A 6PAXA 4LB5A 3CDLA 2VE9A 3JRAA 5IY5H 4K2EA 2R7VA 5CVIA 2NOGA 1MMNA 1HA8A 1YRNB 1OYYA 3CCQI 2PJRB 4CICA 2W82A 4LITA 2DK8A 3UNGC 1D5VA 1MJ9A 3ZMZA 1W7PA 3IKTA 1KQ9A 2HVSA 1HSTA 1IN7A 4EATA 5DUIA 1R22A 3BTIA 2DYRH 2ZSHB 1I5ZA 4L9VA 3FXOA 1OFCX 5FD6A 4HPQA 4I98B 3LAJA 1LDJA 4OIRF 1TW3A 2M8EA 1BI0A 3REOA 2COMA 5F0HA 4XK4A 4XRSG 4JK1X 1Y0UA 1NG6A 1Z9CA 1TC3C 3G1LA 3E3VA 4G94A 1U0JA 4I7HA 1BI3A 3CF2A 5FKOA 4DBRA 3WTTC 2OAZA 1NH3A 1YQAA 4KUMA 4XN0A 3ZQLA 1H88C 1DGWY 3P5JA 2ZJQF 1TWCJ 3H5AA 3HYIA 4RB2C 2LY2A 3FHNA 3WTUC 3U1DA 3OYCA 2PMZN 3TO6A 4A6DA 2V1DA 5A2QZ 1NK2P 2QSGX 3LMMA 2HEOA 5FLXZ 1FTZA 3OYAA 1O4XA 1LE8A 3BG6A 4A3GJ 3OOUA 1LVKA 3A0HC 5C3EJ 4ESJA 2CU7A 3O3KA 5IYBJ 1Q1HA 3IAM2 4BXUA 2GLOA 4IKFA 1X58A 4G7HF 1RETA 1J75A 4UUSA 1AHDP 4L5EA 1Y0NA 3DU5A 5JVTA 2BVLA 4M6VA 1MSEC 3ESWB 2CUZA 3KZZA 3J7AO 1S29A 3Q9VA 2JJ7A 2OCCH 3KCCA 4C2MJ 3R4KA 2QKLB 1RRJA 3V42A 1FYKA 2VPLA 4KISA 3R61A 4A0ZA 1N75A 3S3NA 1TNTA 4YIFA 2BW3A 4OIOF 1HKSA 5K1YA 1MBKA 3OL4A 3LL7A 5HVQC 3V7RA 2O8KA 4RAGA 4EGYA 2WB1A 1S6LA 2DA3A 1ACIA 1XSVA 1ZN2A 2CWEA 4XORA 3OYDA 1EV7A 4II2A 1XGNA 5CVJA 3F23A 2HR3A 2X9DA 1G8XA 4HV5A 1RUOA 2P81A 4UVBA
chains in the Genus database with same CATH topology
1V54H 2EILH 5B1BH 5B1AH 3ABMH 5IY5H 2DYSH 2ZXWH 1OCCH 2EIKH 3ASOH 3AG4H 3AG2H 3AG3H 3AG1H 3X2QH 2EIJH 1OCRH 1OCZH 2EINH 5B3SH 2Y69H 3ABLH 2OCCH 3WG7H 2DYRH 1V55H 2EIMH 3ASNH 1OCOH 3ABKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  2EIL H;  5B1B H;  5B1A H;  3ABM H;  5IY5 H;  2DYS H;  2ZXW H;  1OCC H;  2EIK H;  3ASO H;  3AG4 H;  3AG2 H;  3AG3 H;  3AG1 H;  3X2Q H;  2EIJ H;  1OCR H;  1OCZ H;  2EIN H;  5B3S H;  2Y69 H;  3ABL H;  2OCC H;  3WG7 H;  2DYR H;  1V55 H;  2EIM H;  3ASN H;  1OCO H;  3ABK H; 
#chains in the Genus database with same CATH topology
 4RGS A;  1B6A A;  4ENJ A;  2K9M A;  4PSX A;  3F8M A;  4A3D J;  5FKK A;  5EZG A;  1H8A C;  2IXS A;  4V2F A;  5BPI A;  3L9F A;  4XKC A;  3U21 A;  5K7F A;  4E7Z A;  1QQI A;  4OIP F;  3HHG A;  1BOA A;  4Q4Z F;  4Y17 A;  1HKQ A;  1HDP A;  3F0C A;  2O03 A;  2MC3 A;  5GPA A;  4F52 A;  1FLI A;  3PM1 A;  2JZY A;  2QM3 A;  2VL8 A;  3CDI A;  3F9K A;  1ETK A;  3CJT B;  2V4J C;  3G4S I;  4H4K C;  1UZC A;  2K9N A;  3J80 K;  1FBU A;  2JA7 J;  2BEO A;  3QP6 A;  2P5V A;  4HF2 A;  2A5Y B;  1XD7 A;  2IGO A;  5DD8 A;  2OUM A;  4XOP A;  3KYL A;  2DQL A;  4DZJ A;  5ICC A;  1RC9 A;  5EJC A;  4P9U A;  2RQQ A;  5E3O A;  5J40 A;  2VOO A;  1PP7 U;  3CCU I;  1ENH A;  2BVM A;  5EZH A;  5K7Z A;  3M8J A;  3ABU A;  2WWY A;  3NAU A;  4ZDL A;  3V8J A;  3L2W A;  1WCM J;  2MLG A;  4QLC U;  3ZOB A;  4X6A J;  2JA6 J;  3HIF A;  4L0Y B;  4HLY A;  2OTL I;  3DTK A;  2OJE D;  1WJD A;  3KEQ A;  3CMA I;  1P7J A;  3HSF A;  2AHQ A;  2M0M A;  3TP3 A;  2GQQ A;  2EZI A;  4KMU X;  2R92 J;  4AIH A;  4KA4 A;  5FRN A;  4ZJZ A;  3LSK A;  3UKG A;  3L2Q A;  1GLN A;  3K6G A;  5GAH J;  3ONQ A;  1C0W A;  5ILV A;  4A3C J;  2DA5 A;  1DDN A;  3ZN1 A;  4GYG A;  2X1E A;  2IA1 A;  4IHV A;  3ULQ B;  3LSP A;  1M1E B;  1SMT A;  3JRG A;  4IO9 F;  1MDM A;  3HSE A;  3PNY A;  1MH3 A;  2E1M C;  2HOA A;  1BJA A;  3I54 A;  4FIS A;  2P7V B;  4XRS A;  4BJ5 C;  4Q5S F;  2CH0 A;  2DMT A;  2Z1D A;  4I01 A;  4BBR J;  5TRD A;  1B59 A;  5FKL A;  2KJB A;  3AG1 H;  1G6N A;  2K5C A;  4RDU A;  2ESH A;  2CV0 A;  3SYT A;  2GXB A;  3BT9 A;  4KNY A;  1BN5 A;  1XGO A;  1RKT A;  4R1H A;  4CCM A;  4E7S A;  3QOD A;  2R7S A;  2BXY A;  1MNE A;  4W1U A;  5E18 F;  4LG3 A;  4NQW A;  3S93 A;  1VI0 A;  3HKZ A;  2ZXW H;  4ZYH A;  1CF7 A;  3S3O A;  1B9M A;  2CGP A;  1Y6I A;  2Q2E B;  3CQZ J;  3FX3 A;  1DUX C;  1WFX A;  4XM3 A;  3K4B A;  3ZQH A;  2CO5 A;  5FKN A;  4CYD A;  1GV2 A;  1I50 J;  2BOL A;  3DKY A;  3T8R A;  1YX3 A;  4FAS D;  3BRO A;  2PX9 A;  3KLN A;  2WBM A;  4X1E A;  3BG9 A;  3WU1 B;  3GTG J;  4YEJ A;  3CCV I;  3HOU J;  4IHT A;  2XB5 A;  3MWM A;  2KIF A;  3PSI A;  2L0K A;  2ZXJ A;  1KZH A;  1JTY A;  1JKQ C;  1O57 A;  1LEB A;  1VQ5 I;  2LY9 A;  3GVA A;  3WTW C;  4G6T B;  1Z7L A;  1WI9 A;  1XDS A;  4M9X A;  3T5X A;  2VN2 A;  4PSW A;  3KZI C;  3BQY A;  1NK3 P;  2PJP A;  4UV8 A;  3CCJ I;  3HTS B;  2V9P A;  2P6T A;  3MQ0 A;  4D9J A;  4UB8 C;  2JWT A;  3I4P A;  2E60 A;  4XKV A;  5FKM A;  2DW4 A;  3M1C A;  3QAH A;  2VC1 A;  2KZV A;  5AON A;  4A12 A;  4R79 A;  3GTQ J;  2FOK A;  1OIS A;  2BHZ A;  1AU7 A;  4EEF G;  3HRM A;  1SVM A;  2G7H A;  4IOA F;  4JBA A;  1T56 A;  3IH4 A;  5CYV A;  3K1P A;  3E7L A;  1UG2 A;  1FMW A;  1TWH J;  3A02 A;  2V6C A;  2KDZ A;  2YSR A;  4OWR B;  1FSH A;  1MJA A;  4L0Z B;  2HQA A;  5FJ8 J;  2ZXI A;  4CUG A;  1RES A;  5JFR A;  1YTY A;  1EH8 A;  1TTY A;  3FM5 A;  5KCM A;  2QF7 A;  1ERD A;  1R4M B;  1E3P A;  3CP2 A;  1HDD C;  3CC7 I;  3BY6 A;  3EUH C;  4XLP F;  4AUX A;  1DPU A;  4GO1 A;  2L4A A;  3Q0V A;  3TQN A;  2KT0 A;  1TQM A;  3JW4 A;  1B9N A;  4BEH A;  4HQE A;  2EIM H;  3CDH A;  4PJL A;  5EF6 A;  2OA4 A;  1QPI A;  1UMQ A;  2OC6 A;  4I76 A;  3IH2 A;  3FZV A;  3OR1 C;  2CRG A;  2K86 A;  3U9G A;  3G2B A;  4MTE A;  1FPQ A;  1ETQ A;  3F8B A;  2GOX B;  3BWG A;  1IW7 F;  4V2G A;  4M3D A;  2F5C A;  4NDL A;  5ILS A;  2UZK A;  5LFA A;  2VQL A;  5DTD A;  1VND A;  3TOA A;  1UAA A;  1KGS A;  2LKS A;  1MBH A;  2M4K A;  2XF5 A;  4MEX F;  4BS9 A;  3SEQ A;  1I3A A;  2O7O A;  2P8T A;  4XIC A;  1JKO C;  5KVR A;  3H9G A;  4CHU A;  2J5P A;  4I0B A;  2JTV A;  2R5Z A;  1O7F A;  2IS1 A;  3E5X A;  3MEX A;  1ZGJ A;  3L00 A;  1G2H A;  2LMD A;  4AIK A;  5HNH A;  1VQL I;  2LOO A;  2M87 A;  4PGH A;  1ZYR F;  2IAI A;  4EJU A;  4C3J J;  2DFI A;  3E5Q A;  5BMZ A;  2HOE A;  4HF1 A;  1R1V A;  1R36 A;  2Z3Y A;  2EV6 A;  2EPF A;  1EKE A;  5IPA A;  4MFD A;  1MD0 A;  3GTK J;  1FSE A;  3RKY A;  3LOC A;  2E2I J;  3HUG B;  2KHM A;  2BW3 B;  2XPV A;  4S0H B;  5E20 A;  3PFY A;  4PJ0 C;  1YIT I;  4F91 B;  1YJ9 I;  5K5R A;  2DOF A;  1QVT A;  3P9C A;  2OZU A;  2P4W A;  2NNY A;  3LSJ A;  3KP7 A;  1Y56 A;  3H36 A;  4EJV A;  2XAQ A;  3DV8 A;  1ZGW A;  4EGZ A;  1F4K A;  2VQC A;  3GXO A;  4BYY A;  2R7R A;  2D1H A;  3VEP A;  2KQR A;  3KFW X;  2K85 A;  3QU3 A;  3D5L A;  3H0G J;  4BQQ A;  2D1V A;  5HDG A;  2F48 A;  3ZR8 X;  2DA6 A;  1U9O A;  4BXX J;  4LMY A;  1U3E M;  1W1W E;  3M4O J;  5H20 A;  3IH3 A;  2PEX A;  5GPC A;  3SZP A;  2ELK A;  4MQV A;  2MD0 A;  1WJ5 A;  1IV8 A;  4HQM A;  3WU0 A;  3GTP J;  4JX6 A;  5F0C A;  1QHH D;  5E1W A;  4LB6 B;  5JLW A;  1FZP B;  2V7F A;  4UY8 I;  1IDZ A;  5KNL A;  3I9V 2;  1UHS A;  2AQF A;  2NAZ A;  1ETO A;  4I09 A;  4CA0 A;  4F7Z A;  2XRO A;  1TT0 A;  3HXL A;  3M1E A;  1OYI A;  5H2F C;  2CUE A;  2R5Y B;  1T39 A;  1RR8 C;  2F5E A;  5JR3 A;  3GW2 A;  3M8F A;  2NS0 A;  4U7B A;  2HS5 A;  3ZPL A;  2O9L A;  1WZ2 A;  3GFJ A;  2YX4 A;  3OYB A;  2ZSI B;  2PG4 A;  2FMY A;  2Y48 A;  3JRB A;  2H1L A;  5CJ9 A;  3OYG A;  3WTZ A;  4OMY A;  2H1K A;  3I64 A;  4BE1 A;  2AXT C;  1BM9 A;  1LDD A;  3O8G A;  4RGX A;  3V8K A;  1RIO H;  4YII A;  4CO8 A;  1ETW A;  3VFZ A;  2RC4 A;  2M2E A;  4Q47 A;  4RAZ A;  4RGU A;  1J2X A;  5LGN A;  3COA C;  3CMM A;  1T08 B;  1UB9 A;  3ZGK A;  4A5N A;  2X1D A;  2R5Z B;  3EET A;  4A5M A;  1SC7 A;  2CUF A;  2Y0S N;  3WGI A;  1L3L A;  4NUB A;  3G71 I;  1FBQ A;  4XLE A;  1LJ9 A;  3OIO A;  1ZHF A;  5J8F A;  2BY1 A;  3LA7 A;  2E35 A;  2VJI A;  5L3C A;  2LLK A;  5KK1 A;  4HLX A;  1X3U A;  5B66 C;  2L7M P;  1SVO A;  3HG9 A;  4NQW B;  1WQ2 A;  2VB6 A;  2K4J A;  4II3 A;  2VQG A;  1VQP I;  2DN0 A;  4IEJ A;  3K0L A;  4G7O F;  1FTT A;  4DYC A;  5J8C A;  2CMP A;  5HS8 A;  3D5R C;  1IN4 A;  2KDO A;  1X2M A;  2F6C A;  1JT6 A;  1MKM A;  3F22 A;  3HB9 A;  3BC8 A;  4A3E J;  4LG0 A;  3Q0W A;  3ABK H;  1XC5 A;  5EDN A;  3HSR A;  1EH7 A;  2BXZ A;  2IJL A;  3JRF A;  3EDP A;  1T0F C;  3PNV A;  4AU7 A;  3C2B A;  2OPT A;  2QEX I;  2GXA A;  3BPV A;  2KP6 A;  3H3V K;  2E2H J;  1UEL B;  2XHK A;  5K5O A;  2Y75 A;  3M3Y J;  3BJA A;  1HSJ A;  4CZC A;  2KIQ A;  1LUJ B;  2JSP A;  1LFU P;  3CLO A;  4RLQ A;  2JRM A;  2G9W A;  2WTE A;  1MH4 A;  3MKL A;  4GDF A;  1J7K A;  2ACJ A;  1QU3 A;  3QYB A;  3JSO A;  2XV4 S;  4WXD A;  1X3Z B;  2DYS H;  2H6C A;  5AIQ A;  4ZYG A;  5KHD A;  1U8R A;  3LSH A;  4U88 A;  2PBI A;  5E1X A;  5LEJ A;  3W2V A;  2FBK A;  3O6B B;  1FIP A;  3H35 A;  2HPI A;  4B44 A;  2M8G X;  4Q48 A;  2E5N A;  2CG4 A;  1FX7 A;  3SDG A;  2FA5 A;  1MMS A;  5IT9 K;  2VBX A;  1TWA J;  3IKV A;  4WK8 F;  3FK6 A;  3ZQ7 A;  1HBX G;  2Y2Z A;  2YUS A;  1ON1 A;  3IP4 B;  2DA4 A;  1LB2 A;  2HQN A;  2D2W A;  3DEU A;  3NQO A;  2UV1 A;  4HG2 A;  4M3G A;  3SJM A;  4BY7 J;  3AG4 H;  2JRT A;  1J0R A;  2JA5 J;  2HTJ A;  3TW6 A;  4XRM A;  4B09 A;  4N4N B;  1TQI A;  1YW9 A;  5BNG A;  5HLH A;  1IZ1 A;  4P5O A;  4WF2 A;  4LD5 A;  1R9T J;  5LRR A;  3ZXS A;  2V6E A;  4A69 C;  1CGP A;  4L9J A;  2K4B A;  3VB2 A;  4IRG A;  3ZMD A;  3LSR A;  1FOX A;  3CUQ A;  1E2X A;  1VF9 A;  1D3Y A;  5FRM A;  4I02 A;  2QQ9 A;  1ONV A;  2O8X A;  1WH7 A;  4BY1 J;  3L2C A;  1OCO H;  5FLV A;  3J81 K;  3U2R A;  2VUM J;  2E36 A;  5E1Z B;  4ZTJ A;  4Y7N J;  1E17 A;  4BHP A;  4M6X A;  2ZB9 A;  3QP5 A;  4ON0 A;  2XKO A;  2FE3 A;  4D1Q A;  1WRJ A;  3FXK A;  1SD7 A;  2Q8K A;  2XSJ C;  2FX0 A;  2V79 A;  2K40 A;  1SFO J;  3WGG A;  3WTV C;  2K7L A;  4OMZ A;  2ZC2 A;  4AID A;  3HOZ J;  1HKT A;  2GOM A;  1HLV A;  4XR6 A;  3HGY A;  3J7Y J;  1VQM I;  4Y52 J;  4QTR A;  1VQ9 I;  5M5X J;  2R0Q C;  3FBN B;  4HW0 A;  3G6E I;  2MC4 A;  3RKX A;  5LHG A;  1A5J A;  4U0Y A;  3GLL A;  1BI2 A;  1ON2 A;  2HXI A;  4HA8 A;  5KAI C;  3DBH B;  1MW7 A;  1V4R A;  3CCE I;  2VLA A;  2HXO A;  2XRN A;  1W4M A;  3QPH A;  5K7H A;  2M45 A;  3MKY B;  5D6E A;  2VJ4 A;  2FOW A;  2IW5 A;  4XLF A;  2QGU A;  1R5G A;  4MNU A;  2RKH A;  4BE2 A;  4A0X A;  2O5R A;  1SD6 A;  1QZZ A;  3IC7 A;  5CQE A;  4M71 A;  1V5G A;  1VZ0 A;  3OYN A;  4PDK A;  4BUP A;  4YIR X;  1OPC A;  1OJL A;  3EPZ A;  3GLX A;  3V7S A;  2LYC A;  1YRN A;  2DDB A;  2K3F A;  2M7A A;  1RI7 A;  3E6C C;  2RGV A;  1SFU A;  2XPU A;  3VYR B;  3LNQ A;  4ETS A;  1X19 A;  1R6R A;  1E3H A;  3ZQQ A;  2NOJ B;  3KP2 A;  2K27 A;  3DKX A;  4ASN A;  3PIP F;  3WG7 H;  1JGG A;  4J00 A;  2STT A;  1IRX A;  1QHG A;  2L7Z A;  3N05 A;  1DGR M;  1W0U A;  1ETX A;  5F1R A;  1S7O A;  2DT5 A;  2XC7 A;  2BY2 A;  3OYE A;  1D1B A;  5IYD J;  3S8P A;  3JAM Z;  1WGX A;  3ERE D;  1KU9 A;  4JX4 A;  2A07 F;  5HLI A;  2ELJ A;  1S7E A;  2FRH A;  2KIM A;  2P5L C;  1MNM C;  3OMY A;  3CC2 I;  3BR2 A;  1FOK A;  4PJN A;  5HS9 A;  2D45 A;  2BE5 F;  2JVH A;  1XPX A;  3F6O A;  4N9I A;  3MKZ A;  5E8I A;  1GXP A;  2FJ1 A;  2GAU A;  2OQR A;  4MIM A;  5D8K B;  4ABZ A;  4IJA A;  5D4S A;  4BJT A;  1F5T A;  3DBL B;  3RIR A;  3CZ6 A;  4WXH A;  3T0Y A;  1HXD A;  1JUM A;  3S32 A;  3BR6 A;  1UST A;  4A3L J;  1S7A A;  2FSW A;  2IS4 A;  5D8L B;  3I71 A;  4OIQ F;  4UVA A;  2DOE A;  2WAF A;  4BXF A;  3I3L A;  3LFK A;  3R0J A;  4M6Y A;  3U1K A;  3ASN H;  3J80 Z;  5DCF A;  5IOY A;  3BZ6 A;  4F3Q A;  2COB A;  2IT0 A;  3H3U A;  3B6A A;  1F43 A;  4M72 A;  4U0W A;  4UVC A;  2H94 A;  3PJR A;  2E1O A;  3QPL A;  4QPO A;  3F8C A;  5HLG A;  1I6X A;  2R7F A;  5DDG A;  4IHX A;  4M3F A;  2V1U A;  3OOP A;  3JRC A;  5AIP A;  5DYM A;  1B4A A;  3IV5 A;  2W57 A;  1MSF C;  4B48 A;  4ZZD A;  2PQ8 A;  3G73 A;  4KT6 A;  2M0C A;  3ZMT A;  5LBQ A;  3OSF A;  1FOW A;  2EZH A;  3S17 J;  3S1Q J;  5BS6 A;  3K1N A;  4AD9 A;  4UUV A;  2BBY A;  2KFD A;  2ECC A;  3DWL E;  4C9Y A;  4M3E A;  2A3S A;  2XB0 X;  2LRE A;  3GME A;  2H09 A;  5HDK A;  2BGC A;  4E7H A;  1XDU A;  4MEY F;  3LQQ A;  1XX5 A;  1I27 A;  3DLA A;  1BBY A;  3OV8 A;  3PFI A;  1IV6 A;  1DU0 A;  2NRA C;  1X1C A;  2O3F A;  2JPB A;  3K9T A;  4WCG A;  5IP9 J;  1SMY F;  4ZYD A;  3MMY B;  2IRF G;  2F4O B;  1ZLK A;  4J19 A;  4XLH A;  3K4J A;  2L54 A;  3ELK A;  1BIB A;  3AG2 H;  4JQF A;  1Z6R A;  3BZK A;  1J59 A;  4P55 A;  4B8X A;  4OAZ A;  1OCR H;  5JI6 A;  4B47 A;  1FY7 A;  5IT3 A;  3F3X A;  4FHT A;  5GAE J;  2MG4 A;  3LA2 A;  3HOY J;  1X4O A;  2IGN A;  2L9S A;  2MAB A;  1TBX A;  2ETH A;  3KET A;  3FHZ A;  2IA2 A;  1YW7 A;  5CPR B;  1IN5 A;  4NNJ A;  4LLL A;  1FP2 A;  2VQH A;  4GCV A;  1MBF A;  4A3F J;  3IRQ A;  3QOE A;  3HBL A;  1OR7 C;  2DPD A;  1W36 C;  4AM3 A;  2CQX A;  2ISZ A;  1MBG A;  2A05 A;  3GEZ A;  1D1A A;  3BZC A;  4ENM A;  5EEH A;  2WB1 N;  3W6J B;  4AYB N;  1IXS B;  2P6S A;  2CQ7 A;  4NHJ A;  3DTE A;  3GWZ A;  1TWG J;  4PZJ A;  5F64 A;  4XBF A;  2XSD C;  4X0G A;  1WJC A;  1ZG3 A;  4ZDP A;  3IRR A;  2W84 A;  4OU0 A;  4B43 A;  2X48 A;  2XVC A;  2L7K A;  1Y39 A;  2HYG D;  3FIS A;  4HDU A;  4MTD A;  3I4M J;  4Y13 A;  3W3C A;  2UXX A;  4XQF A;  1I6H J;  3MCZ A;  5CKT A;  3HUG A;  3KP3 A;  4CCN A;  4NC6 A;  4Y15 A;  2LF8 A;  2HDD A;  2W85 A;  2LNB A;  3FIW A;  2WA0 A;  4BH9 A;  1XGS A;  4KN4 X;  4D5C A;  2ME0 A;  2KKO A;  1REP C;  1TT5 B;  3FKJ A;  2OQG A;  5TIS C;  3E97 A;  3CTA A;  3DPU A;  1F1Z A;  2LH9 A;  1MZB A;  4BAY A;  1TW2 A;  1FIA A;  4EM2 A;  3TMO A;  2YX7 A;  4I0A A;  2Y69 H;  4D5F A;  3G1M A;  2ZJP F;  1XTA A;  2DO7 A;  3CUQ B;  4UUT A;  1K78 B;  1XSX A;  1DPR A;  2OTJ I;  4EJW A;  3L7W A;  2WAE A;  1HOM A;  2PJR A;  3HOS A;  2ISY A;  3SZT A;  3CMY A;  1APL C;  1LVA A;  2Y0M A;  5D4R A;  1W7P B;  2X85 A;  4Z2Y A;  3ZQI A;  4U7D A;  1DQU A;  1K61 A;  2EIJ H;  3BDD A;  1YLF A;  2DMN A;  2JK3 A;  1AWC A;  2JQ7 A;  3EYI A;  1G3Y A;  1LDK B;  3C1D A;  3RSN A;  2OZ6 A;  4HAM A;  3TDU C;  3TOB A;  4IHY A;  1QVU A;  2YPR A;  1U2W A;  4BNC A;  3WHB A;  1IUY A;  5L3G A;  3C7J A;  2GIV A;  5DUK A;  3C3W A;  5GAG J;  2ZME B;  1G59 A;  4ZDO A;  1RR7 A;  2VON A;  1W36 D;  2VOP A;  4XRF A;  5LEK A;  1N78 A;  5LD2 C;  2A68 F;  3EUH A;  5FRO A;  3BR1 A;  3PSF A;  3F21 A;  1D1C A;  4RS8 A;  2DDA A;  1YI2 I;  1D5Y A;  3RZD J;  2A6H F;  1X1B A;  5M3F J;  3J7A Y;  2STW A;  5TGT A;  5ED4 A;  1RUN A;  2I8D A;  2V9V A;  3LFU A;  3BCB A;  4ZH4 F;  2CJJ A;  3FXU A;  3HTU A;  3IWZ A;  2VJ5 A;  4XID A;  1MBE A;  4NC8 A;  1K83 J;  3FMQ A;  1VQ8 I;  3BR5 A;  3ISP A;  4PK4 A;  3BG7 A;  4P1W A;  5B1A H;  3RDI A;  2BZT A;  3LSI A;  1WI3 A;  2AS5 F;  4B1R A;  3QWL A;  2DA2 A;  2DOD A;  2WAD A;  3OYL A;  2Z2S B;  5C44 J;  3OYJ A;  1WJA A;  2DTR A;  1EH6 A;  3I4N J;  2CFX A;  1R49 A;  5F1J A;  1GXQ A;  3H1C A;  2F4I A;  3DKW A;  1G3T A;  2DJN A;  2OU2 A;  3H5R A;  3BTJ A;  4FQG A;  3AFH A;  4ZTF A;  1G3S A;  2NS7 A;  1XG1 A;  2DBB A;  2JA2 A;  1BC8 C;  3QQA A;  2LSO A;  1DP3 A;  3HKZ N;  2R4G A;  3EYY A;  1WSU A;  2HVR A;  2LTP A;  4BQN A;  2DMU A;  1K4S A;  1P6R A;  2F5D A;  3SFZ A;  1WPK A;  1H9G A;  3Q0U A;  4Y3O A;  4YFX F;  4FE4 A;  3WU2 C;  1Y1V J;  4BHB A;  2Y9Y A;  4YRV A;  1H0M A;  2GIZ A;  3A01 B;  4PFO A;  4UV9 A;  2XUB A;  2QA4 I;  4KIG A;  1XS9 A;  2KRF A;  1GVJ A;  4G8X A;  2OV7 A;  3JSP A;  3FWE A;  3BCA A;  3D0S A;  4I6Z A;  3P9K A;  4MLO A;  4CSW A;  3CCM I;  2VBY A;  5HLT A;  2DQR A;  5H6R A;  3L2V A;  3HRU A;  4XKW A;  1USS A;  2Z99 A;  5FD5 A;  1GT0 C;  3FBI B;  2NNN A;  2E34 A;  2RRE A;  4G9Y A;  1TNS A;  4E4H A;  1JJ6 C;  3GFI A;  5BPD A;  3DPL C;  1ORK A;  2IA0 A;  3IUO A;  2LBF A;  5HOD A;  1VQO I;  3DEW A;  3R6S A;  3CLQ A;  1ITY A;  3FXL A;  2CQN A;  3TBI A;  1YJN I;  4BHC A;  1AA7 A;  5J4Y A;  1TP4 A;  2EA2 A;  3HGG A;  3L1P A;  4RMN A;  3OS0 A;  1QZE A;  3DU6 A;  2QEN A;  3RJP A;  3H9J A;  4GYI A;  2IS6 A;  3HPG A;  1X4P A;  5F04 A;  3JRE A;  4RGR A;  3TED A;  2JUG A;  2KZG A;  1AOY A;  1Z67 A;  1MMG A;  4DIQ A;  3ERM A;  1KYW A;  2E7W A;  3EUK L;  2LFB A;  3ZCO A;  1XMK A;  4QSH A;  1O3T A;  3JR9 A;  1T2K A;  4LK1 F;  4KT5 C;  3RQ4 A;  3S2H J;  4HRI A;  1PYV A;  4KYW A;  9ANT A;  2Y0S A;  1BL0 A;  1ZRD A;  1D0Y A;  1ZRE A;  4A3M J;  4XNF A;  3PUF A;  1MBJ A;  1OQY A;  1V54 H;  1MMD A;  2CW7 A;  1H9T A;  3BG3 A;  2H8W A;  3ABM H;  4L5I A;  4Z6Y A;  1J9I A;  5CVU A;  1R5H A;  1BR4 A;  3O2P E;  4BL0 B;  1SFE A;  1Z91 A;  4IQJ A;  3OIQ A;  1JKR C;  4PUS A;  2BY0 A;  3BLY A;  2IEK A;  3FM3 A;  3RYR A;  1LE8 B;  1WJE A;  2DCE A;  1OYW A;  1JHF A;  1MDM B;  1L0O C;  1MIJ A;  1V5F A;  1X1D A;  4KIF A;  4JOM A;  3KP5 A;  4CCJ A;  3SEZ A;  4BGD A;  3ZP5 A;  5BOX A;  2KRC A;  2QQ8 A;  5HDN A;  4ESB A;  5HOO A;  2I5U A;  2KL4 A;  2QSF X;  2A61 A;  5FLX K;  2ZFW A;  1B8I A;  5ERI A;  2EV5 A;  2FNP A;  4BKX A;  2J5O A;  5J1U A;  3F8F A;  3HOT A;  3OWT A;  2DMP A;  1JGS A;  3CJR B;  2KIU A;  1K79 A;  3F72 A;  1WVR A;  2QVO A;  2X6O A;  1ZAR A;  2OF7 A;  1PVE A;  3DFG A;  2AO9 A;  2XGX A;  1PUE E;  4EMS A;  2NYX A;  4RM3 A;  2VE8 A;  4J01 A;  1ZTR A;  1DP7 P;  3BTL A;  4LOC A;  4BQA A;  2V1X A;  1FJL A;  3A0B C;  5DEQ A;  4EVI A;  3ROU A;  3ZQG A;  4KIC A;  4L9T A;  5HS7 A;  1WKM A;  1I1S A;  1ETV A;  4CCK A;  2E1N A;  1IXC A;  2CV1 A;  3LA3 A;  4DYQ A;  2WY7 Q;  1NG7 A;  1A35 A;  3QYE A;  3G3Z A;  2DPU A;  3PQJ A;  4A2U A;  1H89 C;  1EA3 A;  3PO2 J;  4LGW A;  2XAJ A;  1U5T C;  2QUF A;  3TO9 A;  1FEX A;  4YFK F;  5DCM A;  3W2W A;  3CUO A;  4Y33 A;  2F2E A;  2F4M B;  2KPM A;  3HM5 A;  3GTO J;  1UG0 A;  3MN2 A;  2QSH X;  3CD6 I;  3E6D A;  2NXN B;  3I0T A;  2TRT A;  2AQE A;  3PNT A;  2NVQ J;  2IPQ X;  5ICE A;  4AVZ A;  1OCC H;  4DZP A;  5BQT A;  3A2K A;  3RTR A;  4CCL A;  2E19 A;  3OY9 A;  2RQP A;  1LFP A;  4IF4 A;  5IP7 J;  4FCY A;  2Y31 A;  1WH5 A;  4DNC A;  1Z3Y A;  1JUS A;  1X2N A;  1X1P A;  4EV0 A;  4F93 B;  3GF2 A;  3VSL A;  3AL0 C;  1TWF J;  2LVS A;  3GFM A;  2MSY A;  3V8L A;  1IRZ A;  2B7E A;  2C6Y A;  3QU6 A;  3SDB A;  5IP6 A;  1W5T A;  3VDX A;  1YO5 C;  1ZRC A;  3M7G A;  1FYL A;  3OS1 A;  1WWX A;  1ZK8 A;  3K4L A;  4FTH A;  4DJA A;  1D0X A;  2F5F A;  4RBO A;  3W6V A;  1K4T A;  1HF0 A;  3F8N A;  1OCP A;  2DFE A;  2QLZ A;  1YIJ I;  2M7B A;  4HF0 A;  4KDP A;  3HJE A;  3DF8 A;  4RLF A;  2WY8 Q;  2BV6 A;  3CCL I;  4BEH B;  4AYB A;  4ZYA A;  1PUF A;  3AL0 B;  3JRD A;  5EG0 B;  1U5T A;  1BR2 A;  2DI3 A;  4LFU A;  5CLS A;  2K3P A;  5E3M A;  3N4M A;  2EA4 A;  2VKH A;  1U8B A;  5E17 F;  1KU2 A;  5A2Q K;  1O3S A;  4KFC A;  2GA2 A;  3ZN0 A;  3OYI A;  5LRS A;  2DU9 A;  1ZR4 A;  2ZME A;  4L5J A;  4FE7 A;  4AIJ A;  2QQB A;  3L2U A;  2K02 A;  1HW2 A;  4BU2 A;  2DA1 A;  2IGK A;  1E0E A;  5DV5 A;  4A3J J;  4EJT A;  2VKD A;  4HX8 A;  2QCO A;  2ICW G;  1OCZ H;  3GZ5 A;  1AKH A;  1SAX A;  1T98 A;  3PUB A;  2KRH A;  1IN6 A;  1FWZ A;  1BR1 A;  2UUZ A;  4RA2 A;  2LRD A;  3B02 A;  4DGW B;  1W7P D;  1KU3 A;  1OLT A;  1Z3X A;  2ZXH A;  1IUF A;  4HOB A;  4C30 A;  2LKX A;  3A01 A;  4YFN F;  1SAN A;  3HOW J;  2L02 A;  2X6W A;  2L5Q A;  4U87 A;  4RM2 A;  1XMA A;  2GBY A;  5F27 A;  3CP8 A;  2EFN A;  1YHQ I;  1IXR C;  3HOX J;  2FML A;  2YS9 A;  3ABT A;  4B3A A;  4DOZ A;  2CQQ A;  4EQQ A;  5EGO B;  4CCO A;  4HNU A;  3S1M J;  3CME I;  3I59 A;  4O6J A;  4H0E A;  3W2A A;  1MND A;  3RQI A;  3FXJ A;  5JVG F;  1P9Q C;  1TL8 A;  2DOA A;  3CJN A;  2DT6 A;  4FX0 A;  2CUJ A;  2ZJR F;  2L4M A;  2FBH A;  4MGR A;  2W24 A;  3I5U A;  2WV0 A;  1R1T A;  2DFH A;  2H27 A;  2V26 A;  3FF5 A;  3RCO A;  4IX7 A;  3EUA A;  2IGM A;  2M4G A;  3JCU C;  3RZO J;  2BHY A;  1VQ4 I;  5M3M J;  2W25 A;  2VI6 A;  3GTL J;  4A93 J;  3DXJ F;  2VAS A;  2X0L A;  3E5U A;  1QZY A;  3ZMS A;  2H6B A;  1YS7 A;  3AKZ A;  5F0F A;  2K9Q A;  1QGP A;  1QRY A;  1SFK A;  1Z21 A;  2VXD A;  3R60 A;  3VYS B;  3K70 C;  2HDC A;  4XSZ F;  1B1B A;  3C2H A;  3A03 A;  5EEA A;  3VYT B;  3HC7 A;  1BC7 C;  2LG4 A;  1HCR A;  2R7Z J;  2HQR A;  1W5S A;  2EIL H;  1FP1 D;  2W4S A;  4KIB A;  1S72 I;  4UUS B;  3PO3 J;  1VQN I;  1R5I D;  4IRH A;  3AAF A;  5F6F A;  3S14 J;  4L9N A;  3HZJ A;  3IL2 A;  1O3R A;  1TQP A;  5H6Q A;  3JRI A;  4EM0 B;  2E2J J;  4L18 B;  2A6E F;  2RN7 A;  2XPW A;  2DAO A;  2HZT A;  4UHT A;  2XGD A;  5C4J J;  2HDW A;  1U78 A;  2FF4 A;  4FT8 A;  2HPM A;  1A6I A;  4UB6 C;  1FNN A;  3IHU A;  1XN7 A;  2DTZ A;  4M9S A;  2EBI A;  4ENK A;  2Y9Z A;  3E6B A;  2VXZ A;  2QKM B;  2HFH A;  3PQK A;  1IGN A;  2ZME C;  3JRH A;  2ELH A;  2GWR A;  2HNH A;  2E1C A;  5DD4 A;  3BP8 A;  3H0D A;  2WAQ N;  4EJO A;  1JE8 A;  2VC0 A;  2XGC A;  1IRG A;  2E71 A;  3TO7 A;  2QYO A;  2DK5 A;  1Z6T A;  5J6X A;  1N77 A;  1R1U A;  1P2F A;  1BA5 A;  4HZF A;  4C3H J;  4DQ2 A;  1QO0 D;  3VWB A;  1SFX A;  1JI8 A;  3CO7 C;  2LBF B;  4LK0 F;  3TDZ C;  3S3M A;  3KIO A;  1K6Y A;  1QNT A;  1FOY A;  2JPC A;  2X51 A;  1JXS A;  2YR2 A;  4DYR A;  1K78 A;  2HI3 A;  2W7N A;  2R7T A;  4XLC A;  4O3M A;  4MHG A;  1BJZ A;  4KN7 X;  1BOB A;  5CQG A;  2HKX A;  4IHS A;  3WTS C;  2I10 A;  4HV6 A;  3I55 I;  5B5E C;  2R7X A;  1IJW C;  1P4A A;  4AVP A;  1MJB A;  3CCY A;  3OYH A;  3K70 D;  2CW0 F;  4MO7 A;  2MGQ A;  1YJW I;  4LIV A;  4JYK A;  1LEA A;  2YU3 A;  2L9N A;  2RNG A;  2W1O A;  4HX7 A;  3GYH X;  2XIG A;  1R4N B;  2HOT A;  1OKR A;  3LST A;  5LGU A;  3RI4 A;  2F5V A;  3S15 J;  2MW8 A;  2ID3 A;  3IWF A;  3J81 Z;  1S5L C;  3GTM J;  1PJR A;  3VYU B;  1RZ4 A;  3EQL F;  1QA6 A;  1HC8 A;  1A6Q A;  3DQV C;  3Q3S A;  1GDT A;  2P5K A;  3DLL F;  1A31 A;  1IF1 A;  5J47 A;  4HSR A;  4B4C A;  4BJ6 C;  4A3I J;  3A1Y A;  3KE2 A;  3WTY C;  3KYC B;  4A3K J;  5D5W B;  1A04 A;  4KJZ A;  3FDY A;  1ZAO A;  4O5V A;  2L9V A;  1V55 H;  4LJZ F;  4PCQ A;  1YFH A;  3DP7 A;  3HRS A;  2LK2 A;  3HPH A;  2PFB A;  1TLH B;  4ITV A;  4DW6 A;  1IAW A;  4XN3 A;  4JP0 A;  1J09 A;  4IZZ A;  2XKP A;  1LNW A;  1U9N A;  3NWS A;  5M5W J;  2O6G E;  1LPQ A;  3WHC A;  3ZQC A;  4CXF A;  3HDD A;  2EIN H;  2WC2 A;  4R8H A;  4P9F A;  1D8K A;  1KQ0 A;  1HW5 A;  5JHU A;  1OMI A;  4HBL A;  2O0Y A;  4AC0 A;  3QOP A;  4XKB A;  1JTX A;  2KMU A;  4G6D A;  5FGM A;  4ZZL A;  3MZH A;  3VOE A;  4M73 A;  5EG0 A;  4ENN A;  3S1R J;  5KAF C;  2W00 A;  2R7W A;  2NVT J;  2EFO A;  3B73 A;  3FXR A;  4OAY A;  4BQO A;  2JUC A;  2DLL A;  3M9A A;  1GHC A;  1UJ8 A;  2A6T A;  2IBD A;  4I2O A;  3NAR A;  4G12 A;  3KP4 A;  2ZNZ A;  1KQ8 A;  2JVG A;  2HZD A;  4RB3 C;  3PL8 A;  3NWT A;  2MBF A;  4U0V A;  1ZQ3 P;  4LLG F;  1Z77 A;  1BW5 A;  3GCM A;  1SVL A;  3SXY A;  3ML6 A;  4HYE A;  1ZG5 A;  3MAJ A;  5F08 A;  2MD5 A;  4GFB A;  1YX5 A;  3MD2 A;  4WX9 A;  2DA7 A;  2VT2 A;  4NBQ A;  3CO6 C;  2EZK A;  4A0Y A;  2HWV A;  1LFB A;  4C2T A;  3WTX C;  3LWF A;  1VQK I;  1LKX A;  1KU7 A;  4BBS J;  1D8J A;  3S1N J;  1R58 A;  3BJO A;  2EFW A;  1F9N A;  2QZ8 A;  2R3S A;  2ZKZ A;  2CS3 A;  3QYF A;  3OS2 A;  2GXG A;  2RDP A;  2XF7 A;  1OR7 A;  2PMU A;  1KON A;  1Y8R B;  4YG2 F;  4IOC F;  1W0T A;  5L3B A;  5FB2 A;  3JAM K;  2Q1Z B;  2BYV E;  2EFQ A;  2H8R A;  5IOZ A;  2XAU A;  4FX4 A;  3W6K B;  4D0P A;  3B6C A;  5ICG A;  1CQT A;  3ZRG A;  4PGG A;  1STZ A;  2XF6 A;  1DU6 A;  2ADU A;  1UHW A;  3K10 A;  1VFC A;  2R7O A;  1JKP C;  1R23 A;  2EV0 A;  3E6M A;  4CGZ A;  1ZKG A;  2BY3 A;  2X4H A;  1JT0 A;  1FBS A;  3ECH A;  4MFE A;  3KPH A;  3SHF A;  2LC2 A;  3MZY A;  2L7F P;  5J4V A;  3T8T A;  1MMA A;  2CSO A;  2ID6 A;  1B72 B;  4AWX B;  2HQ5 A;  2HOS A;  1LQ1 A;  4LLN A;  1SD4 A;  1ZLJ A;  4MQ9 F;  3BTC A;  1RKW A;  2HKO A;  3ZQF A;  3HL2 A;  2XAF A;  2PLY A;  1XCB A;  1YE9 A;  3I59 B;  3L2R A;  5ICF A;  4S04 A;  3BQZ A;  2GZW A;  1Z7U A;  4ESF A;  4HDV A;  4E70 A;  1IDY A;  1FT9 A;  3HHH A;  3RKQ A;  2Q0O A;  1BW6 A;  1VQ6 I;  5B1B H;  2FQ3 A;  2Z16 A;  5E79 C;  2VT3 A;  5D5V B;  1XSD A;  2XDV A;  2L2O A;  5L3F A;  2K9L A;  2X1C A;  2XAH A;  1K7A A;  4N4O B;  3LSM A;  1KA8 A;  3Q9S A;  3LAP A;  4V19 K;  5JLX A;  1YS6 A;  1HW1 A;  1S9H A;  1WJB A;  2G7U A;  2KLO A;  3TP0 A;  3CES A;  4CYC A;  3DEE A;  3K4N A;  4IPA A;  4OIN F;  3DPT A;  3HRT A;  4GGG A;  4ZYE A;  1IO2 A;  1R7J A;  3OR2 C;  5EEG A;  3K4M A;  2DMQ A;  1T8I A;  4XLN F;  1UCR A;  2DXI A;  3QPT A;  3RYP A;  3K4K A;  3P9I A;  2IS2 A;  3BR3 A;  3F6V A;  3JTH A;  1J5Y A;  4E6K G;  1TZL A;  1R71 A;  3VOD A;  1RPW A;  1S3J A;  2CQK A;  1B8I B;  3GFL A;  4E7I A;  2VBW A;  3FKI J;  1T0F A;  5E8G A;  2RNJ A;  1YOV B;  2HYJ A;  2WV1 A;  2B0L A;  4F92 B;  1NTC A;  2E1M B;  1XMX A;  1P4X A;  5LLQ A;  3K69 A;  2UXN A;  2P7C B;  2MFZ A;  3DCF A;  1ZH5 A;  2V9K A;  3K2A A;  3QRF F;  4CZZ A;  2X6X A;  5IT9 Z;  2MH2 A;  3VPR A;  4XMY A;  4A3B J;  2JN6 A;  3OYM A;  2LDU A;  2RVC A;  1Z05 A;  4HNT A;  2YU9 J;  3KP6 A;  3ZMU A;  4N0B A;  2FQ4 A;  2HYF A;  5D5U B;  3FMS A;  2TCT A;  3I56 I;  3O8H A;  2WAQ A;  5L3E A;  3A4C A;  2LY1 A;  1P7I A;  1XB4 A;  3S2W A;  1UFM A;  1BI1 A;  1IN8 A;  2EJR A;  3C18 A;  1GUU A;  2L01 A;  1W5C C;  2V1N A;  5B3S H;  3N97 A;  1GVD A;  1V5E A;  2PN6 A;  3K7A J;  2LR8 A;  1B72 A;  4N9H A;  2VKV A;  5ILU A;  2XGE A;  4OOI A;  5HNF A;  5DM6 F;  2QWW A;  1FYM A;  1NHA A;  1JJ8 C;  3HOV J;  4B3X A;  3MVP A;  5TJJ A;  3WE3 A;  1WJF A;  3RPU A;  1CF7 B;  4CDG A;  3OYK A;  3TW7 A;  1T6S A;  3GUD A;  3ECO A;  2R5Y A;  1O3Q A;  3H9Q A;  2FD5 A;  1P4W A;  1T38 A;  3ZMV A;  3GO5 A;  4IQ4 A;  2A69 F;  4S05 A;  3PIO F;  3DBR B;  3BR0 A;  2NVU B;  4XLA A;  5JHF A;  2DFF A;  5IYC J;  2LD5 A;  2FUG 2;  1SD5 A;  2ZCW A;  2K9S A;  2IP2 A;  2L9R A;  3CJQ B;  3SFI A;  3ABL H;  3CCR I;  3UR3 C;  2KJC A;  3BPX A;  3CC4 I;  1IC8 A;  5M5Y J;  2OD5 A;  1U5T B;  4F55 A;  3BOQ A;  2Z9O A;  3HEF A;  3I53 A;  5GTI C;  3WOD F;  3CCS I;  2Z33 A;  4XL9 A;  2UWM A;  2HTS A;  3MFK A;  4YEL A;  2E5Z A;  4PFP A;  4RAY A;  4IVN A;  1JUP A;  4QWQ A;  2VIX A;  2FEZ A;  2EH3 A;  2JT1 A;  1ZEL A;  2E7X A;  2VBZ A;  3LSG A;  2M30 A;  3H92 A;  4RB1 A;  2L3D A;  2TDX A;  4NB5 A;  3MZ8 A;  4E7J A;  2FBI A;  2XRL A;  3FK7 A;  4ZC3 A;  2O61 A;  2B9S A;  5EYR A;  1GV5 A;  2R7Q A;  3KEO A;  1KYZ A;  3K2Z A;  2EK5 A;  3TKY A;  4A6E A;  1R00 A;  1AKH B;  1IRF A;  1WHU A;  2B63 J;  1Y1W J;  1QPM A;  2ZO4 A;  2VPR A;  3RPU D;  3BG5 A;  2ESN A;  3V4G A;  4I99 C;  2GA1 A;  1SAU A;  2LP0 A;  4XON A;  3RPQ A;  5J1Y A;  1IG7 A;  1Q1V A;  1ZGA A;  5CVV A;  5D6F A;  4QPQ A;  2PMZ A;  2ZJ2 A;  5EGO A;  2ECB A;  1XGM A;  4UXN A;  2LKP A;  1I39 A;  3RKW A;  4BDY A;  2JA8 J;  1Z1D A;  1X1A A;  2OBP A;  5FO5 A;  2NVX J;  5DS9 A;  3OYF A;  4LG0 B;  1ZRF A;  3L09 A;  3KYD B;  3WGH A;  3M8E A;  2FXA A;  3V7C A;  3IAS 2;  1ZG1 A;  5FFZ A;  3FXQ A;  4RAF A;  3WG9 A;  1YIO A;  5GTH C;  3VSK A;  2EIK H;  5GP9 A;  2OCE A;  2DJI A;  2EB7 A;  4EM1 A;  3KZY A;  1SEU A;  4WWC A;  1UHM A;  2A5W A;  2R7D A;  1Z0X A;  1N25 A;  3CUQ C;  3GZN B;  3KLO A;  1G4D A;  1F36 A;  2Y30 A;  1U6G A;  4GRI A;  2PI0 A;  5J3L A;  4UNO A;  2M1B A;  2R93 J;  1PP8 F;  2R7U A;  2JMW A;  4LIU A;  4W97 A;  4JX5 A;  4GXO A;  2DT7 B;  4BDZ A;  4D7M A;  3MKW B;  4M9Z A;  4G6Q A;  2ZFU A;  4FET A;  2M5W A;  3K1M A;  4IL6 C;  1G3W A;  4Y4R A;  4M3B A;  3ASO H;  4KMF A;  4KIT B;  3K4C A;  5FLM J;  3AG3 H;  4XOT A;  2XAS A;  2QQA A;  2VJJ A;  3S2D J;  2HGC A;  1S8N A;  3T1B A;  2RAE A;  4RB0 A;  2QBY A;  1ETY A;  3E1S A;  1MGT A;  1FMV A;  2ZNY A;  2CW8 A;  2ZBK A;  5DCM B;  2FNA A;  2MYS A;  3I58 A;  2EQR A;  5K5Q A;  3SQN A;  3KEY A;  3KX2 A;  1OCT C;  2HU9 A;  2MH9 A;  1POG A;  3OSG A;  4C2U A;  4E7L A;  3TL4 X;  4E7K A;  1PDN C;  5J1R A;  3H5N A;  2HVQ A;  1D0Z A;  1T95 A;  4G7Z F;  2M3A A;  1Y8Q B;  4PJM A;  4BAC A;  4PJJ A;  5L3D A;  2GM4 A;  4C3I J;  2LF7 A;  2JSC A;  5E3N A;  1BIA A;  1QBJ A;  1RNL A;  2AXL A;  2CV2 A;  3S16 J;  4WXC A;  3LQR A;  2W48 A;  1FC3 A;  3OL3 A;  1JHH A;  2NVY J;  3BJ6 A;  3SZG A;  3J7Z I;  1YG2 A;  4BE0 A;  2CYY A;  1YW8 A;  4ANJ A;  3JTG A;  3QPS A;  1YYV A;  2EWN A;  2M9H A;  3TGN A;  5LHH A;  4D7N A;  4CH7 A;  4HNV A;  4IHW A;  4CYC B;  2X6Y A;  1V3F A;  2VKE A;  4HX4 A;  1I1G A;  5LGT A;  5C4X J;  4XSX F;  1O7L A;  2Q2E A;  3D5S C;  2CFO A;  2Z5U A;  5E3L A;  3GZ6 A;  3G1O A;  1VQ7 I;  3OIP A;  2N8G A;  3X2Q H;  3E0J B;  2G0E A;  4M74 A;  3Q5F A;  5GAD J;  3FMR A;  4NC7 A;  3GX4 X;  4HEA 2;  1E3O C;  3NRV A;  1T33 A;  1ULY A;  2EFP A;  3GTJ J;  1VTN C;  2MLK A;  3M07 A;  1HQC A;  1P92 A;  4DBQ A;  2QBY B;  3P7N A;  2RV8 A;  4IXA A;  2PMH A;  5DM7 F;  2MA3 A;  2P0W A;  3D1N I;  2VOD A;  2FU4 A;  1EF4 A;  3CF5 F;  2D5V A;  3NEU A;  4P96 A;  4TV7 A;  3WE2 A;  1I3Q J;  1XCV A;  2KIS A;  3GBG A;  2EZL A;  4IRI A;  5CVR A;  3C2G A;  4HST A;  2IVM A;  5LHI A;  3H3Z A;  1ZR2 A;  1A36 A;  2ME6 A;  2M34 A;  1PUF B;  3FXM A;  1ODD A;  3DTI A;  5FFX A;  1X3W B;  5D5X B;  1EJ9 A;  4QIW N;  3R0A A;  2XAG A;  1K6O A;  2NS8 A;  6PAX A;  4LB5 A;  3CDL A;  2VE9 A;  3JRA A;  5IY5 H;  4K2E A;  2R7V A;  5CVI A;  2NOG A;  1MMN A;  1HA8 A;  1YRN B;  1OYY A;  3CCQ I;  2PJR B;  4CIC A;  2W82 A;  4LIT A;  2DK8 A;  3UNG C;  1D5V A;  1MJ9 A;  3ZMZ A;  1W7P A;  3IKT A;  1KQ9 A;  2HVS A;  1HST A;  1IN7 A;  4EAT A;  5DUI A;  1R22 A;  3BTI A;  2DYR H;  2ZSH B;  1I5Z A;  4L9V A;  3FXO A;  1OFC X;  5FD6 A;  4HPQ A;  4I98 B;  3LAJ A;  1LDJ A;  4OIR F;  1TW3 A;  2M8E A;  1BI0 A;  3REO A;  2COM A;  5F0H A;  4XK4 A;  4XRS G;  4JK1 X;  1Y0U A;  1NG6 A;  1Z9C A;  1TC3 C;  3G1L A;  3E3V A;  4G94 A;  1U0J A;  4I7H A;  1BI3 A;  3CF2 A;  5FKO A;  4DBR A;  3WTT C;  2OAZ A;  1NH3 A;  1YQA A;  4KUM A;  4XN0 A;  3ZQL A;  1H88 C;  1DGW Y;  3P5J A;  2ZJQ F;  1TWC J;  3H5A A;  3HYI A;  4RB2 C;  2LY2 A;  3FHN A;  3WTU C;  3U1D A;  3OYC A;  2PMZ N;  3TO6 A;  4A6D A;  2V1D A;  5A2Q Z;  1NK2 P;  2QSG X;  3LMM A;  2HEO A;  5FLX Z;  1FTZ A;  3OYA A;  1O4X A;  1LE8 A;  3BG6 A;  4A3G J;  3OOU A;  1LVK A;  3A0H C;  5C3E J;  4ESJ A;  2CU7 A;  3O3K A;  5IYB J;  1Q1H A;  3IAM 2;  4BXU A;  2GLO A;  4IKF A;  1X58 A;  4G7H F;  1RET A;  1J75 A;  4UUS A;  1AHD P;  4L5E A;  1Y0N A;  3DU5 A;  5JVT A;  2BVL A;  4M6V A;  1MSE C;  3ESW B;  2CUZ A;  3KZZ A;  3J7A O;  1S29 A;  3Q9V A;  2JJ7 A;  2OCC H;  3KCC A;  4C2M J;  3R4K A;  2QKL B;  1RRJ A;  3V42 A;  1FYK A;  2VPL A;  4KIS A;  3R61 A;  4A0Z A;  1N75 A;  3S3N A;  1TNT A;  4YIF A;  2BW3 A;  4OIO F;  1HKS A;  5K1Y A;  1MBK A;  3OL4 A;  3LL7 A;  5HVQ C;  3V7R A;  2O8K A;  4RAG A;  4EGY A;  2WB1 A;  1S6L A;  2DA3 A;  1ACI A;  1XSV A;  1ZN2 A;  2CWE A;  4XOR A;  3OYD A;  1EV7 A;  4II2 A;  1XGN A;  5CVJ A;  3F23 A;  2HR3 A;  2X9D A;  1G8X A;  4HV5 A;  1RUO A;  2P81 A;  4UVB A; 
#chains in the Genus database with same CATH homology
 1V54 H;  2EIL H;  5B1B H;  5B1A H;  3ABM H;  5IY5 H;  2DYS H;  2ZXW H;  1OCC H;  2EIK H;  3ASO H;  3AG4 H;  3AG2 H;  3AG3 H;  3AG1 H;  3X2Q H;  2EIJ H;  1OCR H;  1OCZ H;  2EIN H;  5B3S H;  2Y69 H;  3ABL H;  2OCC H;  3WG7 H;  2DYR H;  1V55 H;  2EIM H;  3ASN H;  1OCO H;  3ABK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...