3AG4H

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag4H00
2EILH 1OCOH 2EIKH 3WG7H 5IY5H 5B1AH 2OCCH 1OCZH 3X2QH 2EINH 3ABMH 2Y69H 1OCRH 1V55H 1V54H 2DYSH 3AG3H 1OCCH 2DYRH 2ZXWH 3AG2H 3ABKH 3AG4H 5B1BH 2EIJH 5B3SH 3ASNH 3ASOH 2EIMH 3ABLH 3AG1H
chains in the Genus database with same CATH superfamily
4W97A 2ZO4A 2A6HF 2G7HA 2IGKA 1I50J 4UUSB 2BW3A 1VTNC 4DZJA 2L02A 4MO7A 4HQMA 2NXNB 5HOOA 2VLAA 5CQGA 4R8HA 3BLYA 1DP3A 3GCMA 3E7LA 4G9YA 1UZCA 3F3XA 4P9FA 2E71A 2ESNA 1ZG5A 4KICA 2MBFA 4F91B 4PSXA 1FPQA 3TP0A 3AL0B 5K5QA 1O3TA 2NS8A 4CICA 5GTHC 2LLKA 3U2RA 4M73A 3PQJA 3ASOH 4UY8I 3S2HJ 1A6IA 4M3BA 3GTJJ 4CZCA 3BG3A 4ON0A 2HYGD 4JBAA 4BL0B 2VC1A 3FKIJ 5F27A 5FB2A 2LR8A 2XGXA 2X85A 2MLKA 4LG0A 2JA7J 3HB9A 2QKLB 3C1DA 3EQLF 4XORA 4M3EA 2M87A 2XIGA 3EYYA 3K1PA 3TDZC 5JVTA 2QQ8A 1B1BA 5HVQC 2KRFA 4HV5A 5L3DA 2A61A 3FXUA 2YU3A 2GXBA 5L3EA 2XGEA 3BPVA 2DI3A 3I58A 4UVAA 2QSFX 3S14J 3DLLF 4LITA 5IYBJ 1STZA 2DN0A 4Q47A 3OYBA 3OS1A 1ETWA 2HWVA 3V7CA 4RLFA 4FISA 3NWSA 1YG2A 5F0CA 2M0MA 4HDUA 4WK8F 2KT0A 4Y7NJ 3A01A 5LGNA 2VODA 3AAFA 4KIGA 1AKHB 4UB6C 1QHHD 2H6CA 4U0VA 1FTTA 5EG0A 4I0BA 5J8CA 2UWMA 4C3JJ 2NVXJ 3GUDA 3PM1A 3OYIA 1NHAA 3LSIA 2DDBA 5K1YA 1NK2P 1SVMA 2K7LA 2HDWA 2WADA 2XROA 3H3VK 4XQFA 1CF7B 2GXAA 3BR2A 2VQLA 3I0TA 3F6VA 5J47A 2DW4A 2UXXA 1OR7C 1D8JA 1W1WE 3DBLB 5HDNA 1W7PB 3GTLJ 1SD7A 1O57A 3SQNA 5BNGA 1DU0A 2K40A 1XSVA 2QA4I 2JJ7A 2JUGA 2CG4A 2HZDA 2Y0MA 5LRSA 5K5RA 3F8CA 3FMQA 4KA4A 2FMYA 2QBYA 1VQ4I 1LFUP 3SEQA 3D5LA 3IH3A 2ETHA 3ZCOA 2MYSA 1UFMA 3K70D 2R7TA 1YS7A 4A3MJ 3C2HA 1DU6A 1JT6A 3GZ5A 3ZXSA 4FCYA 5E8IA 1S3JA 1YX3A 2XF5A 1J7KA 2LF8A 2QUFA 4G6QA 3RCOA 3HOYJ 5D6EA 1M1EB 2ZFUA 2FEZA 2GIVA 3O6BB 3PQKA 3ONQA 3KYDB 2WC2A 4M6VA 5K7FA 2WTEA 1S8NA 4RM3A 3WG9A 1Z1DA 2JN6A 2IA2A 4UUSA 1UHWA 1ZARA 2Q2EA 5K7HA 3CZ6A 1IAWA 1FC3A 2VUMJ 1YS6A 1T56A 1A35A 3JAMK 1S72I 2HGCA 1YOVB 3QP5A 4A12A 2IJLA 3RPUD 3CESA 1EKEA 2MG4A 3H92A 3HOSA 1LKXA 2M8EA 1BC8C 3BY6A 1LNWA 3ZQQA 1T2KA 2FQ3A 3JAMZ 1R58A 1I1GA 1RI7A 1FWZA 2EJRA 2L9SA 4XLPF 2CO5A 4EM2A 4D5FA 4CDGA 4AIDA 1TP4A 4JK1X 4TV7A 5TJJA 3CO6C 3KX2A 2ZC2A 2XASA 1G59A 1J59A 1VZ0A 1HC8A 1WJBA 3ELKA 1VQOI 1MZBA 3DCFA 1Y1WJ 4G7OF 4D5CA 4IL6C 2B7EA 5JHFA 3FKJA 5LGUA 5JLWA 5E1WA 3ZGKA 3P9CA 3OYGA 2AQFA 3E1SA 5F0FA 1JKRC 3JRAA 5D8LB 3L2CA 1AHDP 1HKTA 3HOXJ 1IRFA 3OSGA 4D1QA 3OYAA 1D1AA 1ZLJA 2DTRA 2JK3A 3LA3A 4A6DA 1VQ5I 3H5RA 3PSFA 2B9SA 1K6OA 1WJCA 3K6GA 1KONA 3KEYA 3N4MA 3KZZA 3F72A 2XC7A 5FRNA 2E5NA 2EA4A 5AIQA 1N75A 3RYPA 4XIDA 1H88C 2KQRA 1RC9A 2GOXB 3MZYA 1TW3A 4HSRA 4GDFA 2ID6A 3CUQA 1HDDC 2M3AA 3EPZA 4KJZA 3EUHA 5FO5A 3LSRA 1CF7A 3Q0VA 1RIOH 5JHUA 2AS5F 2LY1A 1W7PA 2XAGA 2Z5UA 3RI4A 3R0JA 4ZZDA 3L7WA 3V8LA 1W0UA 1JUMA 2AXLA 3P7NA 2E19A 1ULYA 4F7ZA 3EYIA 4KT6A 4BE2A 2JUCA 4I99C 4CXFA 2GIZA 4OAZA 1HW5A 4FX4A 2IT0A 2C6YA 1BN5A 3LQRA 2Q8KA 1Q1VA 2OC6A 1WI3A 3VOEA 1T8IA 1X1AA 2FBHA 1TBXA 3HKZN 5HODA 1ON2A 2ME6A 3VYSB 3WU1B 2JA6J 1WJEA 4HBLA 3DU6A 1ETYA 4N9HA 3VSLA 4B43A 3MWMA 1N25A 1NK3P 2DMQA 1SMTA 3JTHA 3SEZA 5B1BH 1MBEA 2GA1A 4RB0A 2CWEA 2XB0X 4B3AA 1R1VA 2L9NA 4MNUA 4E6KG 3HTUA 5CQEA 1ZG1A 1JJ6C 4K2EA 2RNJA 3GFLA 3IRRA 3IL2A 4XKWA 4ZYDA 4NQWB 2P81A 3ZRGA 2WV0A 4OMYA 1SMYF 2O0YA 2FE3A 2PJRB 4XK4A 2QM3A 2RN7A 5BOXA 2CYYA 4A3EJ 3AG2H 4PFPA 5ICGA 3OYKA 1H8AC 3NQOA 2E1CA 1JUSA 3ZQ7A 4ENNA 1FMWA 3CCJI 2VQHA 2V79A 1SD4A 1D5YA 1U8BA 3QU6A 1ZR4A 3HGYA 4ZC3A 1D0ZA 4XKVA 1MD0A 3TL4X 2R93J 5IPAA 1TQPA 3PNYA 1MMNA 2P7VB 3O3KA 5HS8A 4Y13A 1W5CC 4EJTA 1QQIA 3ABUA 2VOOA 3S2WA 4HNUA 1XGOA 5L3CA 1R1TA 4YEJA 1F4KA 4DNCA 1ZR2A 5LHGA 2M5WA 2M7BA 2HU9A 5DM6F 1WWXA 1GDTA 1L0OC 2KDOA 2IS6A 3CMEI 2YX4A 2X1DA 5K5OA 1IGNA 3HYIA 4NDLA 2LK2A 1FZPB 1NH3A 2LNBA 3BR1A 4BHBA 3TEDA 2A69F 2MD5A 2H6BA 2YS9A 1BJAA 3HRTA 4BY7J 1R5ID 1YTYA 5JVGF 5FLXK 1Z7UA 1TL8A 5KAIC 4HLXA 2A3SA 2K85A 2KJCA 1ZQ3P 2K3PA 3DF8A 1BIBA 2WA0A 4RM2A 4WF2A 1WCMJ 5HLHA 2N8GA 3ZN0A 3KETA 2PG4A 4HA8A 1MBGA 1FOKA 1S29A 1PYVA 1KGSA 3HGGA 4LIUA 2WAEA 3IH2A 4M72A 2EV0A 2WB1A 3K4NA 1FIPA 1KQ8A 4ZJZA 3JRIA 2HQ5A 5D4RA 2VN2A 3IAM2 5IOZA 2ZXWH 5IT9K 3RKWA 3OYMA 3L2UA 5JLXA 2XPUA 4ESBA 1S6LA 3OYHA 2L7FP 1V5GA 4RGSA 1GLNA 1SANA 2ZMEB 1PP7U 2XGDA 1H0MA 3WTSC 4XOTA 4M3GA 4OIRF 2X1CA 5KVRA 3AL0C 4IZZA 1W5TA 3IKVA 2M7AA 3HSFA 4UUTA 4ZYGA 4MEXF 3L00A 3LWFA 5LEKA 3I53A 4PZJA 3F6OA 1U2WA 2ECCA 4E7HA 1OCCH 5EGOB 3DTEA 1VQ6I 3S1QJ 1YIJI 4RAZA 2VBZA 3WTYC 2E1OA 1LE8B 4HZFA 3SFZA 2BVMA 1BI3A 2VBXA 5BMZA 1K7AA 2XVCA 3JTGA 2M4KA 3BZ6A 2P6TA 2IRFG 2E2HJ 1WJAA 4UNOA 2DA5A 2EIKH 3DU5A 3MKZA 3C3WA 4QPQA 4AIJA 3N97A 1GV2A 3E0JB 3J7ZI 1Z6TA 4L0YB 1XMKA 2YR2A 1WJFA 1SFUA 1X1PA 2CV2A 4LD5A 4YFNF 2E1MB 3PNVA 1SFXA 4DBRA 5FKKA 4M74A 3F8FA 1GXQA 4HPQA 1Y0UA 3JRHA 2O8XA 2JA5J 3S1NJ 3KLNA 3I56I 4L5EA 3Q9VA 4E4HA 3E6MA 4GGGA 4U87A 2V9PA 3CJQB 3ZMVA 5B1AH 1SAXA 3CUQC 5D4SA 1ZH5A 2JT1A 3TW6A 1ZG3A 3OL3A 2IEKA 3LSMA 1OYIA 2LDUA 3Q9SA 4WXHA 4A93J 2HQNA 3E5XA 3FXMA 3SZGA 3G1OA 3HM5A 3V4GA 2V1UA 2WV1A 3GTPJ 2OAZA 3GWZA 3G1LA 1PDNC 2HKOA 2QEXI 4CSWA 1FYMA 4F55A 3KP2A 3PFIA 5E79C 3HIFA 3QQAA 3K10A 5LGTA 2W84A 1G6NA 4PGHA 4C9YA 1N77A 3HHHA 3LSJA 1YO5C 1B8IA 4CHUA 2CQXA 2LREA 2PMZN 3BZKA 3GLXA 3NARA 1GXPA 1D1CA 1Z3XA 2R5ZA 2HEOA 3SDBA 1UCRA 3FHNA 1IN4A 1P9QC 3A03A 1MGTA 1MKMA 1UAAA 3MMYB 2I5UA 3OIPA 2JVHA 1QZYA 3EDPA 4J00A 4A3JJ 2EFPA 3OV8A 2DOAA 4P5OA 3ABLH 2FD5A 2R3SA 2IAIA 2R7VA 1J9IA 2VT3A 3T8RA 5F0HA 3FXKA 5F08A 3BTCA 3CMYA 2EZKA 3ABMH 4A3BJ 4AVPA 5CJ9A 2LTPA 3LSPA 4LK1F 1B9NA 3J7YJ 4QPOA 4R79A 4U0YA 1U9OA 2L9RA 2M30A 1S5LC 2RKHA 1B59A 1Y8QB 1WZ2A 2ADUA 3GFJA 3OYFA 1S9HA 2IGMA 3WTTC 2R5YB 1SAUA 4FASD 1R5GA 4ITVA 2OA4A 5F1JA 2LY9A 3JCUC 1LQ1A 2VQGA 3HOWJ 1XG1A 2V6CA 1IV6A 1E3OC 4L9TA 2IA0A 4UVCA 4HAMA 1RRJA 4EGYA 1MMDA 2MABA 4KMFA 3HUGB 1JHHA 3ZP5A 1LPQA 1Z77A 4B3XA 5M5XJ 4ZTFA 5F64A 2XHKA 1ZTRA 1Y1VJ 2EK5A 3VB2A 1VQ7I 5GP9A 3SXYA 3HOTA 3BZCA 1G3SA 2W85A 3K2AA 1U8RA 3EUKL 2JA2A 3FBIB 2Y48A 4LFUA 1YRNB 4LB6B 3GEZA 1YX5A 3L2VA 2DAOA 4A3LJ 1H9TA 3SJMA 3QOPA 5EEHA 4RAYA 2K9SA 4HV6A 5DCMB 3FK6A 4G94A 3BP8A 1WKMA 4A69C 3ERED 1G3TA 3BROA 5J40A 3BCAA 1MDMB 2HPMA 1IW7F 2PLYA 3ROUA 1LVAA 3HDDA 1JKOC 4DBQA 2WWYA 2DO7A 2LP0A 3MFKA 4HEA2 3IV5A 1JXSA 3OSFA 2ELJA 4WWCA 2VE9A 5J6XA 2Y9ZA 3BG7A 3P5JA 1ON1A 3A2KA 5B3SH 3G1MA 1JUPA 3K69A 4PDKA 2P4WA 3LA2A 1BC7C 1YJ9I 2EIMH 2HTJA 5ICEA 1V3FA 4JQFA 5CPRB 3I3LA 5FD6A 2BXZA 1KYWA 1X3UA 3VFZA 2QZ8A 1K61A 3IAS2 3S1RJ 3N05A 4DIQA 3E3VA 5FKLA 2W00A 1XX5A 2RQQA 4A3IJ 1Q1HA 2GXGA 5GADJ 3OYLA 2DA4A 4KISA 1C0WA 3LFUA 5EEAA 1OLTA 1TZLA 1IG7A 2CFXA 1Z3YA 3J81K 4IOCF 1SFKA 2QQAA 2FA5A 2LKSA 4RB2C 3WTUC 3VYTB 2AHQA 4S0HB 3GZ6A 3CCMI 3CCVI 1DUXC 1MNMC 1BI0A 1YYVA 4XLCA 1ZELA 4IRIA 4BYYA 3FM3A 2K4BA 3J81Z 2EZIA 4U7BA 3MKWB 2G9WA 2CS3A 2XRNA 4LGWA 3DTIA 2RDPA 2MA3A 2R5YA 4BNCA 4B48A 3TO9A 1T98A 4P96A 1WQ2A 1Z21A 3FK7A 1ZYRF 3CMAI 5LBQA 2O3FA 3QPSA 3GW2A 1SVOA 4L9NA 2OJED 1IXRC 4Z2YA 2LC2A 3SYTA 3K7AJ 1VQNI 1FOXA 2WBMA 2HOAA 4YFKF 1QPMA 1ENHA 2CRGA 2OUMA 4BAYA 1ZRDA 1TTYA 4L5IA 3LMMA 3S15J 1D8KA 2V1XA 2F5FA 2K27A 4EQQA 4H0EA 1TWFJ 4RAGA 1WJ5A 2DTZA 2BHZA 3WU2C 2CQQA 4AYBN 3GF2A 1IF1A 1QVUA 3I9V2 1YRNA 3F22A 1VQ9I 4BBRJ 4NHJA 2DFIA 2DT7B 5M5WJ 3K4LA 2V26A 3K9TA 3KE2A 1TT0A 2PBIA 1J09A 3AKZA 4KDPA 3CP8A 1IXSB 1G2HA 2O7OA 2E36A 2NRAC 1WI9A 2Y75A 3BR3A 4XSXF 1IUYA 5DCMA 3H3UA 3GZNB 3BG6A 1D0YA 3LNQA 3KYCB 4CUGA 3P9KA 2GBYA 4HDVA 4KITB 3PUFA 4A3KJ 3W6KB 2PQ8A 3OIQA 2VONA 4YIRX 3W6VA 2X1EA 3TOAA 2H8RA 1DPRA 1LDJA 1QBJA 1USSA 1TWAJ 1JTXA 2MGQA 3OS0A 2GAUA 3G71I 1X2MA 2ELKA 4MTEA 3OYEA 1I1SA 3M1EA 2V1DA 2VOPA 5KK1A 2W48A 1Z6RA 1OFCX 4HX7A 4F93B 3R4KA 2D5VA 3M3YJ 4G7ZF 2XUBA 4HW0A 4P9UA 1P7IA 2Y2ZA 5EYRA 5ILUA 2V1NA 4A0ZA 2K9NA 2ZMEC 2LBFB 3DPUA 2BV6A 2ZSHB 2COMA 2FF4A 4LMYA 2VKVA 3U21A 2QSGX 4WXDA 2L7MP 3ML6A 3UNGC 1KQ9A 3KFWX 1IDYA 1ZLKA 2FJ1A 3H3ZA 3SZPA 3A02A 1OCPA 3K4MA 3KEOA 4I76A 2IS4A 1OMIA 2ESHA 4NNJA 2AXTC 3VSKA 3AG1H 4EATA 5DDGA 3BR0A 4UB8C 1JE8A 1MSEC 1D5VA 4BHPA 4LJZF 4A5MA 5FJ8J 3V8JA 5HLGA 2W4SA 2EV5A 5DM7F 1G3YA 4A3GJ 2W25A 3GBGA 3BTLA 4X1EA 1ZREA 1UJ8A 2MW8A 4I6ZA 4HQEA 2JVGA 2R7OA 2EFOA 4FE7A 3D0SA 1YHQI 1A04A 4BDYA 2CUFA 2CJJA 4XM3A 2K86A 4QIWN 2E1MC 2XAFA 1HCRA 3OYCA 1R22A 5CVVA 3HRUA 2L4MA 4AVZA 2OQRA 4ABZA 2LRDA 2OD5A 3E6DA 3H0GJ 1MNEA 3K4JA 3OY9A 2DFEA 4RB1A 1WJDA 1W36C 3KZIC 2XF7A 2FQ4A 1L3LA 3P9IA 5EJCA 4II3A 1OYYA 4AU7A 4X0GA 4BJTA 1EH8A 2ZKZA 2DT5A 2NNNA 3H5NA 1AKHA 2WAQA 2VXDA 1Z7LA 5J1RA 1XTAA 2BOLA 2DU9A 5EEGA 4C3IJ 2XAUA 1JKPC 2CQNA 5HLTA 3DFGA 1Y8RB 2DCEA 4XLAA 4HG2A 5KCMA 1ONVA 5FLMJ 1RUOA 3MKLA 4RS8A 1K83J 4LG3A 4NC6A 2KJBA 3OYDA 1WH7A 3I59B 4IVNA 3G73A 2KHMA 1ZAOA 1T39A 1KYZA 1MIJA 4E7LA 2EFQA 3Q3SA 1Y0NA 5IP9J 4CA0A 2E34A 4L0ZB 2DFHA 3C2BA 2ISZA 3HHGA 1FP2A 2JA8J 2EV6A 1T38A 4Y17A 3RZDJ 1TW2A 3CCSI 1XGMA 1FIAA 2P6SA 3CMMA 1EH7A 3CC4I 5HDKA 2HOTA 3DEUA 1Y39A 2HKXA 2M1BA 4E7KA 1P6RA 3OWTA 1D1BA 2CQKA 5LHIA 4LK0F 2XF6A 4CYDA 2J5PA 1XGNA 4IRHA 5ILVA 2EILH 5DUKA 1LUJB 2QLZA 2XPVA 4PGGA 4WXCA 2PX9A 5J4VA 2LD5A 3G2BA 2BY2A 2M0CA 4MEYF 1TWCJ 2DOFA 3OR2C 4XRSG 2CW0F 3F23A 4HF1A 2FNPA 3H9QA 4HOBA 1J2XA 2KRHA 2XPWA 4MIMA 1MJBA 3VEPA 1XPXA 1W0TA 4S05A 3KP4A 4KN7X 4QSHA 3D1NI 4AIKA 4W1UA 1ETKA 2CSOA 2KL4A 3HC7A 4L18B 3I4NJ 3ESWB 3CCUI 4IF4A 4PFOA 5F04A 4IO9F 3ZQIA 4OU0A 2K9QA 3E5UA 5TISC 2RGVA 4E7IA 4NBQA 1PUFB 3B73A 1E3PA 2VKDA 2MD0A 1LFPA 1IUFA 3T1BA 3DBHB 5E3NA 3JRDA 1LFBA 2JSPA 1XB4A 1U5TB 4HSTA 5HDGA 3UR3C 4BEHB 1YJWI 5CVUA 2ACJA 4AM3A 2V4JC 2YUSA 1NTCA 3LSGA 2YX7A 3OYNA 5BQTA 3M07A 2RQPA 5JR3A 3JRCA 3ZOBA 3JSPA 2F48A 3OYJA 4KYWA 1WFXA 2XRLA 4XSZF 5CVJA 3DKYA 4ANJA 4AUXA 1WSUA 2HR3A 4C2MJ 1ETQA 3F8NA 1X19A 1R71A 1B9MA 1BJZA 3V42A 3O8HA 5E17F 4XL9A 1WH5A 1VFCA 4QTRA 3PJRA 2CQ7A 1OCRH 4ENJA 1GHCA 1MBHA 3J80K 1YIOA 2GZWA 1O7LA 2TRTA 2HFHA 3PUBA 2DA3A 3LSHA 2XSJC 4RLQA 4B8XA 3I4MJ 3KLOA 1HLVA 1FSEA 1HW2A 3J80Z 1EH6A 2JPCA 2OQGA 2VE8A 3I59A 1E3HA 5J1UA 2NS0A 2BY1A 3FZVA 5HNHA 5D5VB 2HQRA 1O7FA 1I6HJ 2A5YB 2R7RA 4DZPA 4AD9A 4BGDA 3U1DA 2NVYJ 4A2UA 4Y15A 4BBSJ 2KRCA 4NB5A 2MLGA 5FROA 1O3SA 2H09A 3MCZA 1OJLA 4XLEA 2K9MA 1EJ9A 2BEOA 2E35A 5D5UB 1VQKI 1BR1A 2KZVA 4NC8A 4GCVA 3PIPF 5J3LA 1FBUA 3ECHA 5E20A 2COBA 1VNDA 2F4MB 2QQBA 2JQ7A 5E8GA 2KPMA 3GFMA 2BYVE 1TT5B 4R1HA 2HPIA 2X9DA 2BXYA 4L9VA 4MQ9F 2NVTJ 3G3ZA 1BL0A 1S7EA 4X6AJ 4Q5SF 4BJ6C 3MAJA 2VKEA 1JGGA 1POGA 3GO5A 2LMDA 5LHHA 1F5TA 5TGTA 3BTIA 2BE5F 4J01A 2QVOA 1NG7A 2NVUB 2R7XA 4NQWA 1IRZA 4BU2A 2HOEA 2HYFA 2L01A 1V5EA 2DMTA 2FXAA 4I98B 4KMUX 3RYRA 3UKGA 3K2ZA 1ETVA 4Q48A 3LAJA 1R4NB 4C30A 3DEEA 3TP3A 2G0EA 2PJRA 2JPBA 4CYCB 2KIFA 1OCOH 3JRFA 3KP3A 1HOMA 1R6RA 2F5DA 1MJAA 3QYBA 4Y52J 1T08B 4G6DA 2D2WA 2O5RA 2DA1A 1KU9A 2IPQX 2HDCA 3NRVA 1VQ8I 4UHTA 3BTJA 4A3FJ 1IN5A 2H27A 3RKXA 2Z16A 1YE9A 1H89C 4EJVA 4NC7A 5F6FA 4BS9A 5ICCA 4I2OA 4BHCA 4U0WA 4O3MA 3RPQA 2PI0A 3E6CC 1QNTA 1Z67A 2DFFA 1I3AA 3CD6I 2FSWA 4XN3A 2H94A 4BY1J 1EF4A 2Y69H 4CH7A 2VL8A 5CVIA 4PK4A 1JT0A 3BR6A 3ECOA 1D3YA 3BR5A 2EWNA 2P5KA 3W2VA 1Z9CA 1UMQA 4XLHA 2LVSA 5GAHJ 2F5VA 5EF6A 2IVMA 2XAQA 2Z2SB 3CCRI 5ILSA 1FEXA 2IA1A 4IOAF 2STWA 3PSIA 3WE3A 1GVJA 3QPLA 4XOPA 2Y0SA 4XRFA 1IRGA 1U9NA 1QZEA 3ZPLA 1I6XA 2B0LA 2MC3A 2W24A 4V2GA 1UG2A 2O61A 3WTZA 1RR8C 2DODA 1CGPA 3JRBA 4A5NA 2FRHA 1TWHJ 2Y30A 5EZGA 3TO6A 2Z9OA 4A6EA 1Y6IA 2EPFA 2VB6A 3JREA 3HG9A 3ABTA 3F8MA 1E0EA 4H4KC 3DWLE 1D0XA 1MH4A 2E60A 3REOA 5KHDA 1XS9A 1TQIA 5L3FA 3E97A 4KT5C 2D1VA 3BOQA 1AWCA 3RPUA 3WTVC 3CTAA 3I64A 5HS9A 5EDNA 1XCBA 3HSRA 2VPRA 2OCCH 3BDDA 4C2TA 3R60A 2FUG2 2F5CA 2ZMEA 3S3MA 1MBKA 1OKRA 3FIWA 3COAC 4N9IA 2XKPA 2QF7A 1W7PD 2V6EA 2JRMA 3QYFA 3KYLA 2QWWA 1LDDA 2Q1ZB 2K5CA 3RDIA 1U3EM 1TQMA 2MH9A 4BKXA 2BW3B 1XGSA 1LJ9A 2L9VA 3CJRB 3LFKA 3ZMTA 3OIOA 2BHYA 4IEJA 5LRRA 4MHGA 1PJRA 5IT3A 1R7JA 2A6EF 5EGOA 2KFDA 2O9LA 3S93A 3OOPA 1LE8A 1P4XA 1YW7A 4XNFA 4KIFA 4D7NA 1XMAA 1HDPA 2K4JA 1T33A 1OQYA 3B02A 5EZHA 2LFBA 3X2QH 2ICWG 5C4XJ 4BH9A 1PP8F 1HKSA 1I3QJ 3H36A 4GYIA 3DKWA 1HXDA 5B66C 2M2EA 4Y33A 1FOWA 4LB5A 1YFHA 1IN7A 3NWTA 3M8FA 5IP6A 3HL2A 3MEXA 2O03A 2ZJQF 2L2OA 3ZQHA 4E70A 3BC8A 5L3GA 4UV9A 2CUEA 2UUZA 5GAEJ 3QPTA 3CDIA 4RA2A 3WGHA 2P7CB 1IDZA 1UG0A 4MFDA 3L09A 4XKCA 1DGRM 2DT6A 3SHFA 2DPDA 2GOMA 1YW9A 4JX4A 2KISA 2GWRA 3K4KA 4HF0A 4ESJA 3HBLA 1MSFC 3IP4B 1KZHA 5FLVA 3MZ8A 4YRVA 1TLHB 1XSXA 2DOEA 2Z1DA 2ZJPF 3RKYA 4CCJA 2WB1N 2F5EA 3A01B 2HQAA 3JRGA 2CV0A 2FU4A 5B5EC 2ZB9A 3PIOF 1FYKA 3HZJA 2DMUA 5K7ZA 4EJOA 1SFOJ 3F9KA 2PJPA 1MMSA 1RUNA 1UELB 4OINF 4LLNA 3TDUC 2CUZA 1XDSA 5E3OA 4UVBA 2GM4A 3VWBA 1MNDA 4Z6YA 3LL7A 3HRMA 3S16J 1FBQA 1ZK8A 4OIQF 2STTA 1FX7A 5IP7J 3CP2A 3F8BA 1W4MA 3S2DJ 2ZNYA 3K4BA 2X0LA 2DQLA 2HVSA 4M71A 3KZYA 1MJ9A 3I5UA 2ZXIA 4F92B 4BQNA 2UXNA 4WCGA 2QBYB 4RGXA 1Z91A 2OCEA 3FXJA 3WGIA 2LKXA 1SD6A 2ZSIB 4IQ4A 2MFZA 3A0BC 1IJWC 4BQAA 3RJPA 4IHSA 1X4OA 5DD8A 3IWFA 3L2RA 3TQNA 3ZMZA 1R5HA 4JOMA 1A31A 5L3BA 3V7SA 2X6XA 3AG4H 4BXXJ 2TCTA 3ZMUA 3ZQFA 4MTDA 2HZTA 1YITI 1REPC 1DGWY 4UXNA 1ZRCA 2CGPA 3HTSB 4IX7A 1JGSA 4G6TB 1RKWA 3MKYB 3HJEA 2RC4A 2WAFA 2R7ZJ 4S04A 5KAFC 1IZ1A 5F1RA 4PSWA 4KNYA 2Q2EB 2DPUA 3GTGJ 4II2A 1P2FA 3IWZA 2H1KA 2FMLA 2LSOA 2VI6A 1U6GA 2KDZA 2W1OA 1X1BA 3KCCA 1IO2A 5E3LA 5ICFA 2MH2A 4UUVA 3D5SC 2AQEA 1AA7A 1U5TC 2CMPA 3HKZA 2E7XA 3H35A 5JI6A 2DJIA 2FNAA 2OU2A 5BPDA 3DV8A 4B44A 2QQ9A 3HUGA 1TNSA 1SD5A 1YI2I 3BT9A 1V5FA 5FGMA 3Q5FA 4XICA 3PNTA 3K0LA 2MSYA 1W5SA 2OZUA 2NOJB 2VBYA 1I39A 3IH4A 1A5JA 2F4OB 3A0HC 2ELHA 4HLYA 3CDLA 2PEXA 4D7MA 4YG2F 2OTLI 4BACA 2Y0SN 5FD5A 3A4CA 4FQGA 2D45A 2RV8A 5C3EJ 2LKPA 3OR1C 1HQCA 3OS2A 3K70C 4BE1A 3F21A 1IXCA 4XRSA 1R23A 1UHMA 1ACIA 4ZDPA 3S1MJ 5A2QK 4Y3OA 3HXLA 2I10A 2X6OA 5CKTA 4P1WA 2BY0A 3M8JA 2K3FA 1DPUA 2P5VA 3FBNB 5HNFA 1RETA 3WU0A 2JZYA 3PL8A 2OBPA 4EM1A 4NUBA 5A2QZ 3JR9A 3KIOA 4HX8A 1MDMA 3QRFF 2DJNA 1K79A 2VBWA 1X58A 4ZYHA 3RIRA 1X2NA 1QGPA 3H9GA 3TW7A 2R7DA 1VQLI 3EUAA 1S7OA 3CUQB 5DV5A 2DLLA 2QSHX 3OOUA 3QWLA 3DTKA 3CLQA 1FLIA 2X51A 3R0AA 4XBFA 2R92J 3V8KA 4ENMA 3HPHA 1FBSA 2QENA 2R7QA 4HYEA 2NNYA 4E7JA 1K78B 2EQRA 2HI3A 2ISYA 3RZOJ 1G4DA 2Z99A 4FTHA 1T0FC 2BVLA 3EETA 1IN8A 1X3WB 1BR2A 3ERMA 4RAFA 1A36A 1XN7A 3W2AA 1RZ4A 3KP6A 3NEUA 1YW8A 3RTRA 1F1ZA 1RNLA 4FE4A 2VIXA 2CUJA 4CGZA 3GTKJ 3M4OJ 2D1HA 4DGWB 1XDUA 3CDHA 5IYCJ 3M1CA 4RBOA 1MMAA 4GYGA 5FFXA 4ZTJA 2FX0A 2L4AA 4F3QA 3KEQA 2R0QC 3BPXA 4FT8A 4XN0A 1OCZH 2HTSA 3RSNA 4DYCA 4DOZA 4CCMA 1FTZA 3C7JA 1WRJA 1BW5A 1IV8A 1QO0D 2LH9A 3SDGA 1IN6A 4RMNA 5LEJA 5D6FA 4ZYEA 2GLOA 2VJ5A 5FFZA 2L54A 1ORKA 2DK8A 4IXAA 2UV1A 4ASNA 1EV7A 2W7NA 4ENKA 2XSDC 3DP7A 2E1NA 3LOCA 3KP7A 2XKOA 3GFIA 5IOYA 1S7AA 4GO1A 2FBIA 3I54A 3MVPA 4OMZA 3T8TA 4IHTA 1FJLA 3H0DA 4FHTA 5H6QA 5HS7A 4E7ZA 3WE2A 5GPCA 5FKNA 4CCNA 3KP5A 3I71A 2CW8A 1P92A 3I4PA 4YIIA 3AFHA 4IJAA 4M3FA 3DEWA 4YELA 5KNLA 3L2WA 1AOYA 3HRSA 2VJIA 3QP6A 4HNVA 4AWXB 4U88A 3IUOA 1LVKA 2W82A 4A0YA 4AC0A 5GTIC 3CCLI 2KIMA 4OOIA 1R1UA 4DJAA 1F36A 1T6SA 3BQYA 1GV5A 4EJUA 2IS2A 3FXOA 3ULQB 2CH0A 3CQZJ 4L5JA 1SVLA 4M9XA 1BM9A 1WGXA 2ZXJA 1WVRA 3U9GA 4GXOA 3CC7I 3ZMDA 3DQVC 1V4RA 5JFRA 3FXRA 2A6TA 1U78A 9ANTA 1JTYA 5H2FC 4IKFA 2QYOA 2ECBA 2L3DA 4JX6A 1X1DA 1QPIA 1BIAA 2VQCA 4RGUA 1IRXA 4Y4RA 1KQ0A 1W36D 1DDNA 1OPCA 2A05A 2WY7Q 1K78A 4XR6A 4BUPA 1P7JA 3S3NA 1ODDA 5D5XB 1FMVA 2VXZA 1LEAA 4CO8A 3ABKH 1A6QA 5FRMA 2IGOA 3FXQA 2LBFA 2BZTA 2EZLA 4XKBA 4D0PA 3FX3A 4M9SA 4MQVA 1R49A 3FDYA 1VQPI 1TNTA 2M34A 1P4WA 1B72B 4IHWA 3TBIA 3H5AA 4BDZA 1G3WA 2L7KA 3IC7A 3VYUB 3JSOA 4HRIA 3CUOA 3ZMSA 5DD4A 1ETXA 4KIBA 5DS9A 4DW6A 3IHUA 2NVQJ 3E5QA 4ZDLA 1TWGJ 1ITYA 1X3ZB 3CCQI 2YU9J 3GMEA 4N4NB 5C44J 2HYJA 1O4XA 3FF5A 4LLGF 3L2QA 1HW1A 1UB9A 2PMZA 2QKMB 5IYDJ 3TOBA 3DPLC 2LG4A 2X48A 2V9VA 3F0CA 2OTJI 2B63J 2CU7A 2A68F 2A5WA 4PJLA 5D8KB 2IW5A 2EZHA 1QA6A 4IHYA 1WPKA 5CLSA 2CFOA 3M7GA 2ZJRF 4WX9A 3HPGA 4V2FA 1CQTA 4HNTA 4GFBA 5CVRA 1I27A 1FYLA 1ZHFA 1XC5A 3J7AY 5E3MA 1GVDA 2DYRH 4BJ5C 3GVAA 2GA2A 3W2WA 2XAHA 4BE0A 2DK5A 2FBKA 2E2IJ 2RREA 1FY7A 1YLFA 5E1XA 3PO2J 2NS7A 1KA8A 2KIQA 1BR4A 2AO9A 2CV1A 2A07F 2L5QA 2R7SA 5M3MJ 4CCKA 1ETOA 4OWRB 2PN6A 2IP2A 4KUMA 6PAXA 2KKOA 4CZZA 4BXFA 4OIOF 3BJAA 2WY8Q 5D5WB 1KU3A 2DDAA 3ZQCA 2JRTA 2UZKA 2KIUA 3CC2I 5DCFA 1KU2A 3FMRA 3U1KA 1R36A 4O6JA 1X4PA 5GAGJ 2E2JJ 3M9AA 2X6WA 2OV7A 4JX5A 1MMGA 2DBBA 3FM5A 4EJWA 2PFBA 4M6YA 3NAUA 2KP6A 5DTDA 1HBXG 2W57A 1WHUA 1HSTA 3HOVJ 3FMSA 4PJ0C 2ZBKA 3CCYA 1JJ8C 4OAYA 1OYWA 3WGGA 2K02A 1RKTA 3AG3H 3PFYA 4HF2A 4UV8A 3KPHA 2BBYA 3B6CA 3GYHX 1Z0XA 4G12A 3MQ0A 4YFXF 1B4AA 1B6AA 1B8IB 3WTXC 4MFEA 3H9JA 3QPHA 2R5ZB 4CCLA 2KLOA 2FOKA 1MH3A 4MLOA 1I5ZA 2EA2A 2HS5A 5FLXZ 4D9JA 4BXUA 5C4JJ 1J0RA 2E7WA 4XLFA 3G6EI 4C2UA 1PVEA 2ID3A 3DKXA 2KZGA 1JI8A 1BI1A 3CO7C 1G8XA 1ZN2A 2E5ZA 4PCQA 3A1YA 4A0XA 5M3FJ 1B72A 1XD7A 3CJNA 2H1LA 5FKOA 1P4AA 3J7AO 4AIHA 4DQ2A 1F9NA 2EH3A 3OMYA 4FX0A 3C2GA 4N4OB 3FHZA 1F43A 2NYXA 2XV4S 1TC3C 4B47A 5H6RA 1PUEE 5IT9Z 5LD2C 4IHVA 3TGNA 3K1NA 3WG7H 3H1CA 1E17A 1J5YA 2IGNA 1QHGA 1MBJA 2EINH 3E6BA 3SFIA 4I01A 4EEFG 2FOWA 5H20A 4XONA 2DXIA 3CLOA 2DMNA 2R4GA 2DQRA 2WAQN 4JYKA 1FNNA 2HNHA 2F6CA 2XB5A 4EM0B 1U0JA 1PUFA 2XGCA 4P55A 4BEHA 1N78A 1U5TA 1BOAA 3SZTA 1QVTA 1IC8A 5J8FA 2TDXA 3Q0WA 2JMWA 3ISPA 3QYEA 4HX4A 2F2EA 3BJ6A 1K6YA 3BG5A 1VF9A 5LLQA 4EMSA 2I8DA 2Y9YA 2VJJA 4B1RA 3FISA 2P8TA 4LIVA 4I02A 3R6SA 1QZZA 3IKTA 2G7UA 2X6YA 4F52A 3GXOA 1T95A 1BOBA 4OIPF 1BW6A 2V7FA 2DA7A 5DUIA 2P0WA 2BGCA 1APLC 3GX4X 5DYMA 1GUUA 3GTOJ 2LOOA 1KU7A 2ZXHA 1VI0A 2ZNZA 4PJMA 1HF0A 1SC7A 4L9JA 2KMUA 1ZGAA 2P5LC 3I55I 1ZGJA 3CF5F 4QWQA 4YIFA 2YPRA 3Q0UA 3EUHC 3D5RC 3R61A 1YJNI 1DP7P 1SFEA 3K4CA 3TO7A 1OISA 2IXSA 1O3RA 2DA2A 2VASA 3FWEA 1BA5A 3LSKA 3IRQA 3W6JB 4ZYAA 4FETA 4I09A 3CF2A 2HVRA 3ZQLA 1K4SA 3S8PA 3ZR8X 2QGUA 2HOSA 4MGRA 4AYBA 1RESA 4O5VA 4PJNA 4M3DA 4IHXA 1OR7A 3GTMJ 2EB7A 5GPAA 1O3QA 1YQAA 1JKQC 4RGRA 3BWGA 2CW7A 4ESFA 1T0FA 1ZGWA 3RQIA 3RQ4A 4U7DA 4I0AA 2OZ6A 3BG9A 2OPTA 3C18A 3VPRA 1V55H 1HA8A 1UHSA 1LDKB 1FSHA 2DYSH 4ZDOA 2R7FA 2Y31A 2HVQA 1ZKGA 2LY2A 4ZH4F 1Z05A 4Q4ZF 1MW7A 1MBFA 3ASNH 2DMPA 2RNGA 3MN2A 5ERIA 5TRDA 3O2PE 3WHCA 3BQZA 4RDUA 1GT0C 4A3DJ 3GLLA 2MC4A 2M45A 3DPTA 3TKYA 3LSTA 4XLNF 3VDXA 1AU7A 2J5OA 1E2XA 1OCTC 4G8XA 2F4IA 5ED4A 3HOZJ 1LEBA 3DBRB 4N0BA 4B4CA 4CYCA 2XAJA 1DQUA 1V54H 2HXOA 3TMOA 3DLAA 4ETSA 4XMYA 3HSEA 2IBDA 3L1PA 2R7UA 3M8EA 2PMHA 1XMXA 2LYCA 5CYVA 5LFAA 1HKQA 4LG0B 3G4SI 5E1ZB 2VT2A 3BCBA 4ZZLA 3GTQJ 4EVIA 3MZHA 3PO3J 1USTA 1FT9A 2RVCA 1SEUA 5BPIA 5FKMA 3ZN1A 1VQMI 3QU3A 3ZQGA 2BY3A 4LLLA 3W3CA 2M8GX 1LB2A 3K1MA 5M5YJ 1J75A 3S17J 1FP1D 2JWTA 4CCOA 3RKQA 2QCOA 1NG6A 4XRMA 5E18F 1QU3A 3V7RA 2ZJ2A 2EFWA 1H9GA 1R00A 3WODF 5DEQA 3T0YA 2O6GE 2NOGA 5AIPA 1XSDA 4KFCA 5J4YA 2VC0A 4EV0A 4KN4X 1Y56A 2L7ZA 2H8WA 2OF7A 2HXIA 1JHFA 1XCVA 2V9KA 4I7HA 3CJTB 4LOCA 2NAZA 4M9ZA 5EG0B 2Z33A 5AONA 3CCEI 2Q0OA 4JP0A 4DYQA 4G7HF 4IRGA 4C3HJ 1RPWA 3L9FA 3LA7A 2O8KA 2EFNA 4V19K 4PUSA 3S3OA 1EA3A 4BQOA 4B09A 2HDDA 3WTWC 1FOYA 2DA6A 3T5XA 4BQQA 3JW4A 5J1YA 2EBIA 3WHBA 2ME0A 4QLCU 2EIJH 3DXJF 1BBYA 1K4TA 1R4MB 2VPLA 2L0KA 3QODA 2GQQA 3B6AA 2PMUA 4J19A 2R7WA 3HOUJ 2LF7A 2Z3YA 2VKHA 5IY5H 3QAHA 1HSJA 2IS1A 3QOEA 4DYRA 4E7SA 1ERDA 2M4GA 4RB3C 2VJ4A 5BS6A 1QRYA 3VODA 3O8GA 2X4HA 1RR7A 2RAEA 1BI2A 2XDVA 3LQQA 4PJJA 3MD2A 2M9HA 2ZCWA 1R9TJ 4M6XA 2YSRA 3OL4A 2JTVA 3S32A 4GRIA 4A3CJ 3VYRB 1X1CA 2K9LA 3BJOA 4IPAA 2JSCA 4IQJA 3HEFA 1ZRFA 3FXLA 3LAPA 2ZFWA 4EGZA 5HLIA
chains in the Genus database with same CATH topology
2EILH 1OCOH 2EIKH 3WG7H 5IY5H 5B1AH 2OCCH 1OCZH 3X2QH 2EINH 3ABMH 2Y69H 1OCRH 1V55H 1V54H 2DYSH 3AG3H 1OCCH 2DYRH 2ZXWH 3AG2H 3ABKH 3AG4H 5B1BH 2EIJH 5B3SH 3ASNH 3ASOH 2EIMH 3ABLH 3AG1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL H;  1OCO H;  2EIK H;  3WG7 H;  5IY5 H;  5B1A H;  2OCC H;  1OCZ H;  3X2Q H;  2EIN H;  3ABM H;  2Y69 H;  1OCR H;  1V55 H;  1V54 H;  2DYS H;  3AG3 H;  1OCC H;  2DYR H;  2ZXW H;  3AG2 H;  3ABK H;  3AG4 H;  5B1B H;  2EIJ H;  5B3S H;  3ASN H;  3ASO H;  2EIM H;  3ABL H;  3AG1 H; 
#chains in the Genus database with same CATH topology
 4W97 A;  2ZO4 A;  2A6H F;  2G7H A;  2IGK A;  1I50 J;  4UUS B;  2BW3 A;  1VTN C;  4DZJ A;  2L02 A;  4MO7 A;  4HQM A;  2NXN B;  5HOO A;  2VLA A;  5CQG A;  4R8H A;  3BLY A;  1DP3 A;  3GCM A;  3E7L A;  4G9Y A;  1UZC A;  3F3X A;  4P9F A;  2E71 A;  2ESN A;  1ZG5 A;  4KIC A;  2MBF A;  4F91 B;  4PSX A;  1FPQ A;  3TP0 A;  3AL0 B;  5K5Q A;  1O3T A;  2NS8 A;  4CIC A;  5GTH C;  2LLK A;  3U2R A;  4M73 A;  3PQJ A;  3ASO H;  4UY8 I;  3S2H J;  1A6I A;  4M3B A;  3GTJ J;  4CZC A;  3BG3 A;  4ON0 A;  2HYG D;  4JBA A;  4BL0 B;  2VC1 A;  3FKI J;  5F27 A;  5FB2 A;  2LR8 A;  2XGX A;  2X85 A;  2MLK A;  4LG0 A;  2JA7 J;  3HB9 A;  2QKL B;  3C1D A;  3EQL F;  4XOR A;  4M3E A;  2M87 A;  2XIG A;  3EYY A;  3K1P A;  3TDZ C;  5JVT A;  2QQ8 A;  1B1B A;  5HVQ C;  2KRF A;  4HV5 A;  5L3D A;  2A61 A;  3FXU A;  2YU3 A;  2GXB A;  5L3E A;  2XGE A;  3BPV A;  2DI3 A;  3I58 A;  4UVA A;  2QSF X;  3S14 J;  3DLL F;  4LIT A;  5IYB J;  1STZ A;  2DN0 A;  4Q47 A;  3OYB A;  3OS1 A;  1ETW A;  2HWV A;  3V7C A;  4RLF A;  4FIS A;  3NWS A;  1YG2 A;  5F0C A;  2M0M A;  4HDU A;  4WK8 F;  2KT0 A;  4Y7N J;  3A01 A;  5LGN A;  2VOD A;  3AAF A;  4KIG A;  1AKH B;  4UB6 C;  1QHH D;  2H6C A;  4U0V A;  1FTT A;  5EG0 A;  4I0B A;  5J8C A;  2UWM A;  4C3J J;  2NVX J;  3GUD A;  3PM1 A;  3OYI A;  1NHA A;  3LSI A;  2DDB A;  5K1Y A;  1NK2 P;  1SVM A;  2K7L A;  2HDW A;  2WAD A;  2XRO A;  3H3V K;  4XQF A;  1CF7 B;  2GXA A;  3BR2 A;  2VQL A;  3I0T A;  3F6V A;  5J47 A;  2DW4 A;  2UXX A;  1OR7 C;  1D8J A;  1W1W E;  3DBL B;  5HDN A;  1W7P B;  3GTL J;  1SD7 A;  1O57 A;  3SQN A;  5BNG A;  1DU0 A;  2K40 A;  1XSV A;  2QA4 I;  2JJ7 A;  2JUG A;  2CG4 A;  2HZD A;  2Y0M A;  5LRS A;  5K5R A;  3F8C A;  3FMQ A;  4KA4 A;  2FMY A;  2QBY A;  1VQ4 I;  1LFU P;  3SEQ A;  3D5L A;  3IH3 A;  2ETH A;  3ZCO A;  2MYS A;  1UFM A;  3K70 D;  2R7T A;  1YS7 A;  4A3M J;  3C2H A;  1DU6 A;  1JT6 A;  3GZ5 A;  3ZXS A;  4FCY A;  5E8I A;  1S3J A;  1YX3 A;  2XF5 A;  1J7K A;  2LF8 A;  2QUF A;  4G6Q A;  3RCO A;  3HOY J;  5D6E A;  1M1E B;  2ZFU A;  2FEZ A;  2GIV A;  3O6B B;  3PQK A;  3ONQ A;  3KYD B;  2WC2 A;  4M6V A;  5K7F A;  2WTE A;  1S8N A;  4RM3 A;  3WG9 A;  1Z1D A;  2JN6 A;  2IA2 A;  4UUS A;  1UHW A;  1ZAR A;  2Q2E A;  5K7H A;  3CZ6 A;  1IAW A;  1FC3 A;  2VUM J;  1YS6 A;  1T56 A;  1A35 A;  3JAM K;  1S72 I;  2HGC A;  1YOV B;  3QP5 A;  4A12 A;  2IJL A;  3RPU D;  3CES A;  1EKE A;  2MG4 A;  3H92 A;  3HOS A;  1LKX A;  2M8E A;  1BC8 C;  3BY6 A;  1LNW A;  3ZQQ A;  1T2K A;  2FQ3 A;  3JAM Z;  1R58 A;  1I1G A;  1RI7 A;  1FWZ A;  2EJR A;  2L9S A;  4XLP F;  2CO5 A;  4EM2 A;  4D5F A;  4CDG A;  4AID A;  1TP4 A;  4JK1 X;  4TV7 A;  5TJJ A;  3CO6 C;  3KX2 A;  2ZC2 A;  2XAS A;  1G59 A;  1J59 A;  1VZ0 A;  1HC8 A;  1WJB A;  3ELK A;  1VQO I;  1MZB A;  3DCF A;  1Y1W J;  4G7O F;  4D5C A;  4IL6 C;  2B7E A;  5JHF A;  3FKJ A;  5LGU A;  5JLW A;  5E1W A;  3ZGK A;  3P9C A;  3OYG A;  2AQF A;  3E1S A;  5F0F A;  1JKR C;  3JRA A;  5D8L B;  3L2C A;  1AHD P;  1HKT A;  3HOX J;  1IRF A;  3OSG A;  4D1Q A;  3OYA A;  1D1A A;  1ZLJ A;  2DTR A;  2JK3 A;  3LA3 A;  4A6D A;  1VQ5 I;  3H5R A;  3PSF A;  2B9S A;  1K6O A;  1WJC A;  3K6G A;  1KON A;  3KEY A;  3N4M A;  3KZZ A;  3F72 A;  2XC7 A;  5FRN A;  2E5N A;  2EA4 A;  5AIQ A;  1N75 A;  3RYP A;  4XID A;  1H88 C;  2KQR A;  1RC9 A;  2GOX B;  3MZY A;  1TW3 A;  4HSR A;  4GDF A;  2ID6 A;  3CUQ A;  1HDD C;  2M3A A;  3EPZ A;  4KJZ A;  3EUH A;  5FO5 A;  3LSR A;  1CF7 A;  3Q0V A;  1RIO H;  5JHU A;  2AS5 F;  2LY1 A;  1W7P A;  2XAG A;  2Z5U A;  3RI4 A;  3R0J A;  4ZZD A;  3L7W A;  3V8L A;  1W0U A;  1JUM A;  2AXL A;  3P7N A;  2E19 A;  1ULY A;  4F7Z A;  3EYI A;  4KT6 A;  4BE2 A;  2JUC A;  4I99 C;  4CXF A;  2GIZ A;  4OAZ A;  1HW5 A;  4FX4 A;  2IT0 A;  2C6Y A;  1BN5 A;  3LQR A;  2Q8K A;  1Q1V A;  2OC6 A;  1WI3 A;  3VOE A;  1T8I A;  1X1A A;  2FBH A;  1TBX A;  3HKZ N;  5HOD A;  1ON2 A;  2ME6 A;  3VYS B;  3WU1 B;  2JA6 J;  1WJE A;  4HBL A;  3DU6 A;  1ETY A;  4N9H A;  3VSL A;  4B43 A;  3MWM A;  1N25 A;  1NK3 P;  2DMQ A;  1SMT A;  3JTH A;  3SEZ A;  5B1B H;  1MBE A;  2GA1 A;  4RB0 A;  2CWE A;  2XB0 X;  4B3A A;  1R1V A;  2L9N A;  4MNU A;  4E6K G;  3HTU A;  5CQE A;  1ZG1 A;  1JJ6 C;  4K2E A;  2RNJ A;  3GFL A;  3IRR A;  3IL2 A;  4XKW A;  4ZYD A;  4NQW B;  2P81 A;  3ZRG A;  2WV0 A;  4OMY A;  1SMY F;  2O0Y A;  2FE3 A;  2PJR B;  4XK4 A;  2QM3 A;  2RN7 A;  5BOX A;  2CYY A;  4A3E J;  3AG2 H;  4PFP A;  5ICG A;  3OYK A;  1H8A C;  3NQO A;  2E1C A;  1JUS A;  3ZQ7 A;  4ENN A;  1FMW A;  3CCJ I;  2VQH A;  2V79 A;  1SD4 A;  1D5Y A;  1U8B A;  3QU6 A;  1ZR4 A;  3HGY A;  4ZC3 A;  1D0Z A;  4XKV A;  1MD0 A;  3TL4 X;  2R93 J;  5IPA A;  1TQP A;  3PNY A;  1MMN A;  2P7V B;  3O3K A;  5HS8 A;  4Y13 A;  1W5C C;  4EJT A;  1QQI A;  3ABU A;  2VOO A;  3S2W A;  4HNU A;  1XGO A;  5L3C A;  1R1T A;  4YEJ A;  1F4K A;  4DNC A;  1ZR2 A;  5LHG A;  2M5W A;  2M7B A;  2HU9 A;  5DM6 F;  1WWX A;  1GDT A;  1L0O C;  2KDO A;  2IS6 A;  3CME I;  2YX4 A;  2X1D A;  5K5O A;  1IGN A;  3HYI A;  4NDL A;  2LK2 A;  1FZP B;  1NH3 A;  2LNB A;  3BR1 A;  4BHB A;  3TED A;  2A69 F;  2MD5 A;  2H6B A;  2YS9 A;  1BJA A;  3HRT A;  4BY7 J;  1R5I D;  1YTY A;  5JVG F;  5FLX K;  1Z7U A;  1TL8 A;  5KAI C;  4HLX A;  2A3S A;  2K85 A;  2KJC A;  1ZQ3 P;  2K3P A;  3DF8 A;  1BIB A;  2WA0 A;  4RM2 A;  4WF2 A;  1WCM J;  5HLH A;  2N8G A;  3ZN0 A;  3KET A;  2PG4 A;  4HA8 A;  1MBG A;  1FOK A;  1S29 A;  1PYV A;  1KGS A;  3HGG A;  4LIU A;  2WAE A;  3IH2 A;  4M72 A;  2EV0 A;  2WB1 A;  3K4N A;  1FIP A;  1KQ8 A;  4ZJZ A;  3JRI A;  2HQ5 A;  5D4R A;  2VN2 A;  3IAM 2;  5IOZ A;  2ZXW H;  5IT9 K;  3RKW A;  3OYM A;  3L2U A;  5JLX A;  2XPU A;  4ESB A;  1S6L A;  3OYH A;  2L7F P;  1V5G A;  4RGS A;  1GLN A;  1SAN A;  2ZME B;  1PP7 U;  2XGD A;  1H0M A;  3WTS C;  4XOT A;  4M3G A;  4OIR F;  2X1C A;  5KVR A;  3AL0 C;  4IZZ A;  1W5T A;  3IKV A;  2M7A A;  3HSF A;  4UUT A;  4ZYG A;  4MEX F;  3L00 A;  3LWF A;  5LEK A;  3I53 A;  4PZJ A;  3F6O A;  1U2W A;  2ECC A;  4E7H A;  1OCC H;  5EGO B;  3DTE A;  1VQ6 I;  3S1Q J;  1YIJ I;  4RAZ A;  2VBZ A;  3WTY C;  2E1O A;  1LE8 B;  4HZF A;  3SFZ A;  2BVM A;  1BI3 A;  2VBX A;  5BMZ A;  1K7A A;  2XVC A;  3JTG A;  2M4K A;  3BZ6 A;  2P6T A;  2IRF G;  2E2H J;  1WJA A;  4UNO A;  2DA5 A;  2EIK H;  3DU5 A;  3MKZ A;  3C3W A;  4QPQ A;  4AIJ A;  3N97 A;  1GV2 A;  3E0J B;  3J7Z I;  1Z6T A;  4L0Y B;  1XMK A;  2YR2 A;  1WJF A;  1SFU A;  1X1P A;  2CV2 A;  4LD5 A;  4YFN F;  2E1M B;  3PNV A;  1SFX A;  4DBR A;  5FKK A;  4M74 A;  3F8F A;  1GXQ A;  4HPQ A;  1Y0U A;  3JRH A;  2O8X A;  2JA5 J;  3S1N J;  3KLN A;  3I56 I;  4L5E A;  3Q9V A;  4E4H A;  3E6M A;  4GGG A;  4U87 A;  2V9P A;  3CJQ B;  3ZMV A;  5B1A H;  1SAX A;  3CUQ C;  5D4S A;  1ZH5 A;  2JT1 A;  3TW6 A;  1ZG3 A;  3OL3 A;  2IEK A;  3LSM A;  1OYI A;  2LDU A;  3Q9S A;  4WXH A;  4A93 J;  2HQN A;  3E5X A;  3FXM A;  3SZG A;  3G1O A;  3HM5 A;  3V4G A;  2V1U A;  2WV1 A;  3GTP J;  2OAZ A;  3GWZ A;  3G1L A;  1PDN C;  2HKO A;  2QEX I;  4CSW A;  1FYM A;  4F55 A;  3KP2 A;  3PFI A;  5E79 C;  3HIF A;  3QQA A;  3K10 A;  5LGT A;  2W84 A;  1G6N A;  4PGH A;  4C9Y A;  1N77 A;  3HHH A;  3LSJ A;  1YO5 C;  1B8I A;  4CHU A;  2CQX A;  2LRE A;  2PMZ N;  3BZK A;  3GLX A;  3NAR A;  1GXP A;  1D1C A;  1Z3X A;  2R5Z A;  2HEO A;  3SDB A;  1UCR A;  3FHN A;  1IN4 A;  1P9Q C;  3A03 A;  1MGT A;  1MKM A;  1UAA A;  3MMY B;  2I5U A;  3OIP A;  2JVH A;  1QZY A;  3EDP A;  4J00 A;  4A3J J;  2EFP A;  3OV8 A;  2DOA A;  4P5O A;  3ABL H;  2FD5 A;  2R3S A;  2IAI A;  2R7V A;  1J9I A;  2VT3 A;  3T8R A;  5F0H A;  3FXK A;  5F08 A;  3BTC A;  3CMY A;  2EZK A;  3ABM H;  4A3B J;  4AVP A;  5CJ9 A;  2LTP A;  3LSP A;  4LK1 F;  1B9N A;  3J7Y J;  4QPO A;  4R79 A;  4U0Y A;  1U9O A;  2L9R A;  2M30 A;  1S5L C;  2RKH A;  1B59 A;  1Y8Q B;  1WZ2 A;  2ADU A;  3GFJ A;  3OYF A;  1S9H A;  2IGM A;  3WTT C;  2R5Y B;  1SAU A;  4FAS D;  1R5G A;  4ITV A;  2OA4 A;  5F1J A;  2LY9 A;  3JCU C;  1LQ1 A;  2VQG A;  3HOW J;  1XG1 A;  2V6C A;  1IV6 A;  1E3O C;  4L9T A;  2IA0 A;  4UVC A;  4HAM A;  1RRJ A;  4EGY A;  1MMD A;  2MAB A;  4KMF A;  3HUG B;  1JHH A;  3ZP5 A;  1LPQ A;  1Z77 A;  4B3X A;  5M5X J;  4ZTF A;  5F64 A;  2XHK A;  1ZTR A;  1Y1V J;  2EK5 A;  3VB2 A;  1VQ7 I;  5GP9 A;  3SXY A;  3HOT A;  3BZC A;  1G3S A;  2W85 A;  3K2A A;  1U8R A;  3EUK L;  2JA2 A;  3FBI B;  2Y48 A;  4LFU A;  1YRN B;  4LB6 B;  3GEZ A;  1YX5 A;  3L2V A;  2DAO A;  4A3L J;  1H9T A;  3SJM A;  3QOP A;  5EEH A;  4RAY A;  2K9S A;  4HV6 A;  5DCM B;  3FK6 A;  4G94 A;  3BP8 A;  1WKM A;  4A69 C;  3ERE D;  1G3T A;  3BRO A;  5J40 A;  3BCA A;  1MDM B;  2HPM A;  1IW7 F;  2PLY A;  3ROU A;  1LVA A;  3HDD A;  1JKO C;  4DBQ A;  2WWY A;  2DO7 A;  2LP0 A;  3MFK A;  4HEA 2;  3IV5 A;  1JXS A;  3OSF A;  2ELJ A;  4WWC A;  2VE9 A;  5J6X A;  2Y9Z A;  3BG7 A;  3P5J A;  1ON1 A;  3A2K A;  5B3S H;  3G1M A;  1JUP A;  3K69 A;  4PDK A;  2P4W A;  3LA2 A;  1BC7 C;  1YJ9 I;  2EIM H;  2HTJ A;  5ICE A;  1V3F A;  4JQF A;  5CPR B;  3I3L A;  5FD6 A;  2BXZ A;  1KYW A;  1X3U A;  3VFZ A;  2QZ8 A;  1K61 A;  3IAS 2;  3S1R J;  3N05 A;  4DIQ A;  3E3V A;  5FKL A;  2W00 A;  1XX5 A;  2RQQ A;  4A3I J;  1Q1H A;  2GXG A;  5GAD J;  3OYL A;  2DA4 A;  4KIS A;  1C0W A;  3LFU A;  5EEA A;  1OLT A;  1TZL A;  1IG7 A;  2CFX A;  1Z3Y A;  3J81 K;  4IOC F;  1SFK A;  2QQA A;  2FA5 A;  2LKS A;  4RB2 C;  3WTU C;  3VYT B;  2AHQ A;  4S0H B;  3GZ6 A;  3CCM I;  3CCV I;  1DUX C;  1MNM C;  1BI0 A;  1YYV A;  4XLC A;  1ZEL A;  4IRI A;  4BYY A;  3FM3 A;  2K4B A;  3J81 Z;  2EZI A;  4U7B A;  3MKW B;  2G9W A;  2CS3 A;  2XRN A;  4LGW A;  3DTI A;  2RDP A;  2MA3 A;  2R5Y A;  4BNC A;  4B48 A;  3TO9 A;  1T98 A;  4P96 A;  1WQ2 A;  1Z21 A;  3FK7 A;  1ZYR F;  3CMA I;  5LBQ A;  2O3F A;  3QPS A;  3GW2 A;  1SVO A;  4L9N A;  2OJE D;  1IXR C;  4Z2Y A;  2LC2 A;  3SYT A;  3K7A J;  1VQN I;  1FOX A;  2WBM A;  2HOA A;  4YFK F;  1QPM A;  1ENH A;  2CRG A;  2OUM A;  4BAY A;  1ZRD A;  1TTY A;  4L5I A;  3LMM A;  3S15 J;  1D8K A;  2V1X A;  2F5F A;  2K27 A;  4EQQ A;  4H0E A;  1TWF J;  4RAG A;  1WJ5 A;  2DTZ A;  2BHZ A;  3WU2 C;  2CQQ A;  4AYB N;  3GF2 A;  1IF1 A;  1QVU A;  3I9V 2;  1YRN A;  3F22 A;  1VQ9 I;  4BBR J;  4NHJ A;  2DFI A;  2DT7 B;  5M5W J;  3K4L A;  2V26 A;  3K9T A;  3KE2 A;  1TT0 A;  2PBI A;  1J09 A;  3AKZ A;  4KDP A;  3CP8 A;  1IXS B;  1G2H A;  2O7O A;  2E36 A;  2NRA C;  1WI9 A;  2Y75 A;  3BR3 A;  4XSX F;  1IUY A;  5DCM A;  3H3U A;  3GZN B;  3BG6 A;  1D0Y A;  3LNQ A;  3KYC B;  4CUG A;  3P9K A;  2GBY A;  4HDV A;  4KIT B;  3PUF A;  4A3K J;  3W6K B;  2PQ8 A;  3OIQ A;  2VON A;  4YIR X;  3W6V A;  2X1E A;  3TOA A;  2H8R A;  1DPR A;  1LDJ A;  1QBJ A;  1USS A;  1TWA J;  1JTX A;  2MGQ A;  3OS0 A;  2GAU A;  3G71 I;  1X2M A;  2ELK A;  4MTE A;  3OYE A;  1I1S A;  3M1E A;  2V1D A;  2VOP A;  5KK1 A;  2W48 A;  1Z6R A;  1OFC X;  4HX7 A;  4F93 B;  3R4K A;  2D5V A;  3M3Y J;  4G7Z F;  2XUB A;  4HW0 A;  4P9U A;  1P7I A;  2Y2Z A;  5EYR A;  5ILU A;  2V1N A;  4A0Z A;  2K9N A;  2ZME C;  2LBF B;  3DPU A;  2BV6 A;  2ZSH B;  2COM A;  2FF4 A;  4LMY A;  2VKV A;  3U21 A;  2QSG X;  4WXD A;  2L7M P;  3ML6 A;  3UNG C;  1KQ9 A;  3KFW X;  1IDY A;  1ZLK A;  2FJ1 A;  3H3Z A;  3SZP A;  3A02 A;  1OCP A;  3K4M A;  3KEO A;  4I76 A;  2IS4 A;  1OMI A;  2ESH A;  4NNJ A;  2AXT C;  3VSK A;  3AG1 H;  4EAT A;  5DDG A;  3BR0 A;  4UB8 C;  1JE8 A;  1MSE C;  1D5V A;  4BHP A;  4LJZ F;  4A5M A;  5FJ8 J;  3V8J A;  5HLG A;  2W4S A;  2EV5 A;  5DM7 F;  1G3Y A;  4A3G J;  2W25 A;  3GBG A;  3BTL A;  4X1E A;  1ZRE A;  1UJ8 A;  2MW8 A;  4I6Z A;  4HQE A;  2JVG A;  2R7O A;  2EFO A;  4FE7 A;  3D0S A;  1YHQ I;  1A04 A;  4BDY A;  2CUF A;  2CJJ A;  4XM3 A;  2K86 A;  4QIW N;  2E1M C;  2XAF A;  1HCR A;  3OYC A;  1R22 A;  5CVV A;  3HRU A;  2L4M A;  4AVZ A;  2OQR A;  4ABZ A;  2LRD A;  2OD5 A;  3E6D A;  3H0G J;  1MNE A;  3K4J A;  3OY9 A;  2DFE A;  4RB1 A;  1WJD A;  1W36 C;  3KZI C;  2XF7 A;  2FQ4 A;  1L3L A;  3P9I A;  5EJC A;  4II3 A;  1OYY A;  4AU7 A;  4X0G A;  4BJT A;  1EH8 A;  2ZKZ A;  2DT5 A;  2NNN A;  3H5N A;  1AKH A;  2WAQ A;  2VXD A;  1Z7L A;  5J1R A;  1XTA A;  2BOL A;  2DU9 A;  5EEG A;  4C3I J;  2XAU A;  1JKP C;  2CQN A;  5HLT A;  3DFG A;  1Y8R B;  2DCE A;  4XLA A;  4HG2 A;  5KCM A;  1ONV A;  5FLM J;  1RUO A;  3MKL A;  4RS8 A;  1K83 J;  4LG3 A;  4NC6 A;  2KJB A;  3OYD A;  1WH7 A;  3I59 B;  4IVN A;  3G73 A;  2KHM A;  1ZAO A;  1T39 A;  1KYZ A;  1MIJ A;  4E7L A;  2EFQ A;  3Q3S A;  1Y0N A;  5IP9 J;  4CA0 A;  2E34 A;  4L0Z B;  2DFH A;  3C2B A;  2ISZ A;  3HHG A;  1FP2 A;  2JA8 J;  2EV6 A;  1T38 A;  4Y17 A;  3RZD J;  1TW2 A;  3CCS I;  1XGM A;  1FIA A;  2P6S A;  3CMM A;  1EH7 A;  3CC4 I;  5HDK A;  2HOT A;  3DEU A;  1Y39 A;  2HKX A;  2M1B A;  4E7K A;  1P6R A;  3OWT A;  1D1B A;  2CQK A;  5LHI A;  4LK0 F;  2XF6 A;  4CYD A;  2J5P A;  1XGN A;  4IRH A;  5ILV A;  2EIL H;  5DUK A;  1LUJ B;  2QLZ A;  2XPV A;  4PGG A;  4WXC A;  2PX9 A;  5J4V A;  2LD5 A;  3G2B A;  2BY2 A;  2M0C A;  4MEY F;  1TWC J;  2DOF A;  3OR2 C;  4XRS G;  2CW0 F;  3F23 A;  4HF1 A;  2FNP A;  3H9Q A;  4HOB A;  1J2X A;  2KRH A;  2XPW A;  4MIM A;  1MJB A;  3VEP A;  1XPX A;  1W0T A;  4S05 A;  3KP4 A;  4KN7 X;  4QSH A;  3D1N I;  4AIK A;  4W1U A;  1ETK A;  2CSO A;  2KL4 A;  3HC7 A;  4L18 B;  3I4N J;  3ESW B;  3CCU I;  4IF4 A;  4PFO A;  5F04 A;  4IO9 F;  3ZQI A;  4OU0 A;  2K9Q A;  3E5U A;  5TIS C;  2RGV A;  4E7I A;  4NBQ A;  1PUF B;  3B73 A;  1E3P A;  2VKD A;  2MD0 A;  1LFP A;  1IUF A;  3T1B A;  3DBH B;  5E3N A;  3JRD A;  1LFB A;  2JSP A;  1XB4 A;  1U5T B;  4HST A;  5HDG A;  3UR3 C;  4BEH B;  1YJW I;  5CVU A;  2ACJ A;  4AM3 A;  2V4J C;  2YUS A;  1NTC A;  3LSG A;  2YX7 A;  3OYN A;  5BQT A;  3M07 A;  2RQP A;  5JR3 A;  3JRC A;  3ZOB A;  3JSP A;  2F48 A;  3OYJ A;  4KYW A;  1WFX A;  2XRL A;  4XSZ F;  5CVJ A;  3DKY A;  4ANJ A;  4AUX A;  1WSU A;  2HR3 A;  4C2M J;  1ETQ A;  3F8N A;  1X19 A;  1R71 A;  1B9M A;  1BJZ A;  3V42 A;  3O8H A;  5E17 F;  4XL9 A;  1WH5 A;  1VFC A;  4QTR A;  3PJR A;  2CQ7 A;  1OCR H;  4ENJ A;  1GHC A;  1MBH A;  3J80 K;  1YIO A;  2GZW A;  1O7L A;  2TRT A;  2HFH A;  3PUB A;  2DA3 A;  3LSH A;  2XSJ C;  4RLQ A;  4B8X A;  3I4M J;  3KLO A;  1HLV A;  1FSE A;  1HW2 A;  3J80 Z;  1EH6 A;  2JPC A;  2OQG A;  2VE8 A;  3I59 A;  1E3H A;  5J1U A;  2NS0 A;  2BY1 A;  3FZV A;  5HNH A;  5D5V B;  2HQR A;  1O7F A;  1I6H J;  2A5Y B;  2R7R A;  4DZP A;  4AD9 A;  4BGD A;  3U1D A;  2NVY J;  4A2U A;  4Y15 A;  4BBS J;  2KRC A;  4NB5 A;  2MLG A;  5FRO A;  1O3S A;  2H09 A;  3MCZ A;  1OJL A;  4XLE A;  2K9M A;  1EJ9 A;  2BEO A;  2E35 A;  5D5U B;  1VQK I;  1BR1 A;  2KZV A;  4NC8 A;  4GCV A;  3PIP F;  5J3L A;  1FBU A;  3ECH A;  5E20 A;  2COB A;  1VND A;  2F4M B;  2QQB A;  2JQ7 A;  5E8G A;  2KPM A;  3GFM A;  2BYV E;  1TT5 B;  4R1H A;  2HPI A;  2X9D A;  2BXY A;  4L9V A;  4MQ9 F;  2NVT J;  3G3Z A;  1BL0 A;  1S7E A;  4X6A J;  4Q5S F;  4BJ6 C;  3MAJ A;  2VKE A;  1JGG A;  1POG A;  3GO5 A;  2LMD A;  5LHH A;  1F5T A;  5TGT A;  3BTI A;  2BE5 F;  4J01 A;  2QVO A;  1NG7 A;  2NVU B;  2R7X A;  4NQW A;  1IRZ A;  4BU2 A;  2HOE A;  2HYF A;  2L01 A;  1V5E A;  2DMT A;  2FXA A;  4I98 B;  4KMU X;  3RYR A;  3UKG A;  3K2Z A;  1ETV A;  4Q48 A;  3LAJ A;  1R4N B;  4C30 A;  3DEE A;  3TP3 A;  2G0E A;  2PJR A;  2JPB A;  4CYC B;  2KIF A;  1OCO H;  3JRF A;  3KP3 A;  1HOM A;  1R6R A;  2F5D A;  1MJA A;  3QYB A;  4Y52 J;  1T08 B;  4G6D A;  2D2W A;  2O5R A;  2DA1 A;  1KU9 A;  2IPQ X;  2HDC A;  3NRV A;  1VQ8 I;  4UHT A;  3BTJ A;  4A3F J;  1IN5 A;  2H27 A;  3RKX A;  2Z16 A;  1YE9 A;  1H89 C;  4EJV A;  4NC7 A;  5F6F A;  4BS9 A;  5ICC A;  4I2O A;  4BHC A;  4U0W A;  4O3M A;  3RPQ A;  2PI0 A;  3E6C C;  1QNT A;  1Z67 A;  2DFF A;  1I3A A;  3CD6 I;  2FSW A;  4XN3 A;  2H94 A;  4BY1 J;  1EF4 A;  2Y69 H;  4CH7 A;  2VL8 A;  5CVI A;  4PK4 A;  1JT0 A;  3BR6 A;  3ECO A;  1D3Y A;  3BR5 A;  2EWN A;  2P5K A;  3W2V A;  1Z9C A;  1UMQ A;  4XLH A;  2LVS A;  5GAH J;  2F5V A;  5EF6 A;  2IVM A;  2XAQ A;  2Z2S B;  3CCR I;  5ILS A;  1FEX A;  2IA1 A;  4IOA F;  2STW A;  3PSI A;  3WE3 A;  1GVJ A;  3QPL A;  4XOP A;  2Y0S A;  4XRF A;  1IRG A;  1U9N A;  1QZE A;  3ZPL A;  1I6X A;  2B0L A;  2MC3 A;  2W24 A;  4V2G A;  1UG2 A;  2O61 A;  3WTZ A;  1RR8 C;  2DOD A;  1CGP A;  3JRB A;  4A5N A;  2FRH A;  1TWH J;  2Y30 A;  5EZG A;  3TO6 A;  2Z9O A;  4A6E A;  1Y6I A;  2EPF A;  2VB6 A;  3JRE A;  3HG9 A;  3ABT A;  3F8M A;  1E0E A;  4H4K C;  3DWL E;  1D0X A;  1MH4 A;  2E60 A;  3REO A;  5KHD A;  1XS9 A;  1TQI A;  5L3F A;  3E97 A;  4KT5 C;  2D1V A;  3BOQ A;  1AWC A;  3RPU A;  3WTV C;  3CTA A;  3I64 A;  5HS9 A;  5EDN A;  1XCB A;  3HSR A;  2VPR A;  2OCC H;  3BDD A;  4C2T A;  3R60 A;  2FUG 2;  2F5C A;  2ZME A;  3S3M A;  1MBK A;  1OKR A;  3FIW A;  3COA C;  4N9I A;  2XKP A;  2QF7 A;  1W7P D;  2V6E A;  2JRM A;  3QYF A;  3KYL A;  2QWW A;  1LDD A;  2Q1Z B;  2K5C A;  3RDI A;  1U3E M;  1TQM A;  2MH9 A;  4BKX A;  2BW3 B;  1XGS A;  1LJ9 A;  2L9V A;  3CJR B;  3LFK A;  3ZMT A;  3OIO A;  2BHY A;  4IEJ A;  5LRR A;  4MHG A;  1PJR A;  5IT3 A;  1R7J A;  2A6E F;  5EGO A;  2KFD A;  2O9L A;  3S93 A;  3OOP A;  1LE8 A;  1P4X A;  1YW7 A;  4XNF A;  4KIF A;  4D7N A;  1XMA A;  1HDP A;  2K4J A;  1T33 A;  1OQY A;  3B02 A;  5EZH A;  2LFB A;  3X2Q H;  2ICW G;  5C4X J;  4BH9 A;  1PP8 F;  1HKS A;  1I3Q J;  3H36 A;  4GYI A;  3DKW A;  1HXD A;  5B66 C;  2M2E A;  4Y33 A;  1FOW A;  4LB5 A;  1YFH A;  1IN7 A;  3NWT A;  3M8F A;  5IP6 A;  3HL2 A;  3MEX A;  2O03 A;  2ZJQ F;  2L2O A;  3ZQH A;  4E70 A;  3BC8 A;  5L3G A;  4UV9 A;  2CUE A;  2UUZ A;  5GAE J;  3QPT A;  3CDI A;  4RA2 A;  3WGH A;  2P7C B;  1IDZ A;  1UG0 A;  4MFD A;  3L09 A;  4XKC A;  1DGR M;  2DT6 A;  3SHF A;  2DPD A;  2GOM A;  1YW9 A;  4JX4 A;  2KIS A;  2GWR A;  3K4K A;  4HF0 A;  4ESJ A;  3HBL A;  1MSF C;  3IP4 B;  1KZH A;  5FLV A;  3MZ8 A;  4YRV A;  1TLH B;  1XSX A;  2DOE A;  2Z1D A;  2ZJP F;  3RKY A;  4CCJ A;  2WB1 N;  2F5E A;  3A01 B;  2HQA A;  3JRG A;  2CV0 A;  2FU4 A;  5B5E C;  2ZB9 A;  3PIO F;  1FYK A;  3HZJ A;  2DMU A;  5K7Z A;  4EJO A;  1SFO J;  3F9K A;  2PJP A;  1MMS A;  1RUN A;  1UEL B;  4OIN F;  4LLN A;  3TDU C;  2CUZ A;  1XDS A;  5E3O A;  4UVB A;  2GM4 A;  3VWB A;  1MND A;  4Z6Y A;  3LL7 A;  3HRM A;  3S16 J;  1FBQ A;  1ZK8 A;  4OIQ F;  2STT A;  1FX7 A;  5IP7 J;  3CP2 A;  3F8B A;  1W4M A;  3S2D J;  2ZNY A;  3K4B A;  2X0L A;  2DQL A;  2HVS A;  4M71 A;  3KZY A;  1MJ9 A;  3I5U A;  2ZXI A;  4F92 B;  4BQN A;  2UXN A;  4WCG A;  2QBY B;  4RGX A;  1Z91 A;  2OCE A;  3FXJ A;  3WGI A;  2LKX A;  1SD6 A;  2ZSI B;  4IQ4 A;  2MFZ A;  3A0B C;  1IJW C;  4BQA A;  3RJP A;  4IHS A;  1X4O A;  5DD8 A;  3IWF A;  3L2R A;  3TQN A;  3ZMZ A;  1R5H A;  4JOM A;  1A31 A;  5L3B A;  3V7S A;  2X6X A;  3AG4 H;  4BXX J;  2TCT A;  3ZMU A;  3ZQF A;  4MTD A;  2HZT A;  1YIT I;  1REP C;  1DGW Y;  4UXN A;  1ZRC A;  2CGP A;  3HTS B;  4IX7 A;  1JGS A;  4G6T B;  1RKW A;  3MKY B;  3HJE A;  2RC4 A;  2WAF A;  2R7Z J;  4S04 A;  5KAF C;  1IZ1 A;  5F1R A;  4PSW A;  4KNY A;  2Q2E B;  2DPU A;  3GTG J;  4II2 A;  1P2F A;  3IWZ A;  2H1K A;  2FML A;  2LSO A;  2VI6 A;  1U6G A;  2KDZ A;  2W1O A;  1X1B A;  3KCC A;  1IO2 A;  5E3L A;  5ICF A;  2MH2 A;  4UUV A;  3D5S C;  2AQE A;  1AA7 A;  1U5T C;  2CMP A;  3HKZ A;  2E7X A;  3H35 A;  5JI6 A;  2DJI A;  2FNA A;  2OU2 A;  5BPD A;  3DV8 A;  4B44 A;  2QQ9 A;  3HUG A;  1TNS A;  1SD5 A;  1YI2 I;  3BT9 A;  1V5F A;  5FGM A;  3Q5F A;  4XIC A;  3PNT A;  3K0L A;  2MSY A;  1W5S A;  2OZU A;  2NOJ B;  2VBY A;  1I39 A;  3IH4 A;  1A5J A;  2F4O B;  3A0H C;  2ELH A;  4HLY A;  3CDL A;  2PEX A;  4D7M A;  4YG2 F;  2OTL I;  4BAC A;  2Y0S N;  5FD5 A;  3A4C A;  4FQG A;  2D45 A;  2RV8 A;  5C3E J;  2LKP A;  3OR1 C;  1HQC A;  3OS2 A;  3K70 C;  4BE1 A;  3F21 A;  1IXC A;  4XRS A;  1R23 A;  1UHM A;  1ACI A;  4ZDP A;  3S1M J;  5A2Q K;  4Y3O A;  3HXL A;  2I10 A;  2X6O A;  5CKT A;  4P1W A;  2BY0 A;  3M8J A;  2K3F A;  1DPU A;  2P5V A;  3FBN B;  5HNF A;  1RET A;  3WU0 A;  2JZY A;  3PL8 A;  2OBP A;  4EM1 A;  4NUB A;  5A2Q Z;  3JR9 A;  3KIO A;  4HX8 A;  1MDM A;  3QRF F;  2DJN A;  1K79 A;  2VBW A;  1X58 A;  4ZYH A;  3RIR A;  1X2N A;  1QGP A;  3H9G A;  3TW7 A;  2R7D A;  1VQL I;  3EUA A;  1S7O A;  3CUQ B;  5DV5 A;  2DLL A;  2QSH X;  3OOU A;  3QWL A;  3DTK A;  3CLQ A;  1FLI A;  2X51 A;  3R0A A;  4XBF A;  2R92 J;  3V8K A;  4ENM A;  3HPH A;  1FBS A;  2QEN A;  2R7Q A;  4HYE A;  2NNY A;  4E7J A;  1K78 B;  2EQR A;  2HI3 A;  2ISY A;  3RZO J;  1G4D A;  2Z99 A;  4FTH A;  1T0F C;  2BVL A;  3EET A;  1IN8 A;  1X3W B;  1BR2 A;  3ERM A;  4RAF A;  1A36 A;  1XN7 A;  3W2A A;  1RZ4 A;  3KP6 A;  3NEU A;  1YW8 A;  3RTR A;  1F1Z A;  1RNL A;  4FE4 A;  2VIX A;  2CUJ A;  4CGZ A;  3GTK J;  3M4O J;  2D1H A;  4DGW B;  1XDU A;  3CDH A;  5IYC J;  3M1C A;  4RBO A;  1MMA A;  4GYG A;  5FFX A;  4ZTJ A;  2FX0 A;  2L4A A;  4F3Q A;  3KEQ A;  2R0Q C;  3BPX A;  4FT8 A;  4XN0 A;  1OCZ H;  2HTS A;  3RSN A;  4DYC A;  4DOZ A;  4CCM A;  1FTZ A;  3C7J A;  1WRJ A;  1BW5 A;  1IV8 A;  1QO0 D;  2LH9 A;  3SDG A;  1IN6 A;  4RMN A;  5LEJ A;  5D6F A;  4ZYE A;  2GLO A;  2VJ5 A;  5FFZ A;  2L54 A;  1ORK A;  2DK8 A;  4IXA A;  2UV1 A;  4ASN A;  1EV7 A;  2W7N A;  4ENK A;  2XSD C;  3DP7 A;  2E1N A;  3LOC A;  3KP7 A;  2XKO A;  3GFI A;  5IOY A;  1S7A A;  4GO1 A;  2FBI A;  3I54 A;  3MVP A;  4OMZ A;  3T8T A;  4IHT A;  1FJL A;  3H0D A;  4FHT A;  5H6Q A;  5HS7 A;  4E7Z A;  3WE2 A;  5GPC A;  5FKN A;  4CCN A;  3KP5 A;  3I71 A;  2CW8 A;  1P92 A;  3I4P A;  4YII A;  3AFH A;  4IJA A;  4M3F A;  3DEW A;  4YEL A;  5KNL A;  3L2W A;  1AOY A;  3HRS A;  2VJI A;  3QP6 A;  4HNV A;  4AWX B;  4U88 A;  3IUO A;  1LVK A;  2W82 A;  4A0Y A;  4AC0 A;  5GTI C;  3CCL I;  2KIM A;  4OOI A;  1R1U A;  4DJA A;  1F36 A;  1T6S A;  3BQY A;  1GV5 A;  4EJU A;  2IS2 A;  3FXO A;  3ULQ B;  2CH0 A;  3CQZ J;  4L5J A;  1SVL A;  4M9X A;  1BM9 A;  1WGX A;  2ZXJ A;  1WVR A;  3U9G A;  4GXO A;  3CC7 I;  3ZMD A;  3DQV C;  1V4R A;  5JFR A;  3FXR A;  2A6T A;  1U78 A;  9ANT A;  1JTY A;  5H2F C;  4IKF A;  2QYO A;  2ECB A;  2L3D A;  4JX6 A;  1X1D A;  1QPI A;  1BIA A;  2VQC A;  4RGU A;  1IRX A;  4Y4R A;  1KQ0 A;  1W36 D;  1DDN A;  1OPC A;  2A05 A;  2WY7 Q;  1K78 A;  4XR6 A;  4BUP A;  1P7J A;  3S3N A;  1ODD A;  5D5X B;  1FMV A;  2VXZ A;  1LEA A;  4CO8 A;  3ABK H;  1A6Q A;  5FRM A;  2IGO A;  3FXQ A;  2LBF A;  2BZT A;  2EZL A;  4XKB A;  4D0P A;  3FX3 A;  4M9S A;  4MQV A;  1R49 A;  3FDY A;  1VQP I;  1TNT A;  2M34 A;  1P4W A;  1B72 B;  4IHW A;  3TBI A;  3H5A A;  4BDZ A;  1G3W A;  2L7K A;  3IC7 A;  3VYU B;  3JSO A;  4HRI A;  3CUO A;  3ZMS A;  5DD4 A;  1ETX A;  4KIB A;  5DS9 A;  4DW6 A;  3IHU A;  2NVQ J;  3E5Q A;  4ZDL A;  1TWG J;  1ITY A;  1X3Z B;  3CCQ I;  2YU9 J;  3GME A;  4N4N B;  5C44 J;  2HYJ A;  1O4X A;  3FF5 A;  4LLG F;  3L2Q A;  1HW1 A;  1UB9 A;  2PMZ A;  2QKM B;  5IYD J;  3TOB A;  3DPL C;  2LG4 A;  2X48 A;  2V9V A;  3F0C A;  2OTJ I;  2B63 J;  2CU7 A;  2A68 F;  2A5W A;  4PJL A;  5D8K B;  2IW5 A;  2EZH A;  1QA6 A;  4IHY A;  1WPK A;  5CLS A;  2CFO A;  3M7G A;  2ZJR F;  4WX9 A;  3HPG A;  4V2F A;  1CQT A;  4HNT A;  4GFB A;  5CVR A;  1I27 A;  1FYL A;  1ZHF A;  1XC5 A;  3J7A Y;  5E3M A;  1GVD A;  2DYR H;  4BJ5 C;  3GVA A;  2GA2 A;  3W2W A;  2XAH A;  4BE0 A;  2DK5 A;  2FBK A;  2E2I J;  2RRE A;  1FY7 A;  1YLF A;  5E1X A;  3PO2 J;  2NS7 A;  1KA8 A;  2KIQ A;  1BR4 A;  2AO9 A;  2CV1 A;  2A07 F;  2L5Q A;  2R7S A;  5M3M J;  4CCK A;  1ETO A;  4OWR B;  2PN6 A;  2IP2 A;  4KUM A;  6PAX A;  2KKO A;  4CZZ A;  4BXF A;  4OIO F;  3BJA A;  2WY8 Q;  5D5W B;  1KU3 A;  2DDA A;  3ZQC A;  2JRT A;  2UZK A;  2KIU A;  3CC2 I;  5DCF A;  1KU2 A;  3FMR A;  3U1K A;  1R36 A;  4O6J A;  1X4P A;  5GAG J;  2E2J J;  3M9A A;  2X6W A;  2OV7 A;  4JX5 A;  1MMG A;  2DBB A;  3FM5 A;  4EJW A;  2PFB A;  4M6Y A;  3NAU A;  2KP6 A;  5DTD A;  1HBX G;  2W57 A;  1WHU A;  1HST A;  3HOV J;  3FMS A;  4PJ0 C;  2ZBK A;  3CCY A;  1JJ8 C;  4OAY A;  1OYW A;  3WGG A;  2K02 A;  1RKT A;  3AG3 H;  3PFY A;  4HF2 A;  4UV8 A;  3KPH A;  2BBY A;  3B6C A;  3GYH X;  1Z0X A;  4G12 A;  3MQ0 A;  4YFX F;  1B4A A;  1B6A A;  1B8I B;  3WTX C;  4MFE A;  3H9J A;  3QPH A;  2R5Z B;  4CCL A;  2KLO A;  2FOK A;  1MH3 A;  4MLO A;  1I5Z A;  2EA2 A;  2HS5 A;  5FLX Z;  4D9J A;  4BXU A;  5C4J J;  1J0R A;  2E7W A;  4XLF A;  3G6E I;  4C2U A;  1PVE A;  2ID3 A;  3DKX A;  2KZG A;  1JI8 A;  1BI1 A;  3CO7 C;  1G8X A;  1ZN2 A;  2E5Z A;  4PCQ A;  3A1Y A;  4A0X A;  5M3F J;  1B72 A;  1XD7 A;  3CJN A;  2H1L A;  5FKO A;  1P4A A;  3J7A O;  4AIH A;  4DQ2 A;  1F9N A;  2EH3 A;  3OMY A;  4FX0 A;  3C2G A;  4N4O B;  3FHZ A;  1F43 A;  2NYX A;  2XV4 S;  1TC3 C;  4B47 A;  5H6R A;  1PUE E;  5IT9 Z;  5LD2 C;  4IHV A;  3TGN A;  3K1N A;  3WG7 H;  3H1C A;  1E17 A;  1J5Y A;  2IGN A;  1QHG A;  1MBJ A;  2EIN H;  3E6B A;  3SFI A;  4I01 A;  4EEF G;  2FOW A;  5H20 A;  4XON A;  2DXI A;  3CLO A;  2DMN A;  2R4G A;  2DQR A;  2WAQ N;  4JYK A;  1FNN A;  2HNH A;  2F6C A;  2XB5 A;  4EM0 B;  1U0J A;  1PUF A;  2XGC A;  4P55 A;  4BEH A;  1N78 A;  1U5T A;  1BOA A;  3SZT A;  1QVT A;  1IC8 A;  5J8F A;  2TDX A;  3Q0W A;  2JMW A;  3ISP A;  3QYE A;  4HX4 A;  2F2E A;  3BJ6 A;  1K6Y A;  3BG5 A;  1VF9 A;  5LLQ A;  4EMS A;  2I8D A;  2Y9Y A;  2VJJ A;  4B1R A;  3FIS A;  2P8T A;  4LIV A;  4I02 A;  3R6S A;  1QZZ A;  3IKT A;  2G7U A;  2X6Y A;  4F52 A;  3GXO A;  1T95 A;  1BOB A;  4OIP F;  1BW6 A;  2V7F A;  2DA7 A;  5DUI A;  2P0W A;  2BGC A;  1APL C;  3GX4 X;  5DYM A;  1GUU A;  3GTO J;  2LOO A;  1KU7 A;  2ZXH A;  1VI0 A;  2ZNZ A;  4PJM A;  1HF0 A;  1SC7 A;  4L9J A;  2KMU A;  1ZGA A;  2P5L C;  3I55 I;  1ZGJ A;  3CF5 F;  4QWQ A;  4YIF A;  2YPR A;  3Q0U A;  3EUH C;  3D5R C;  3R61 A;  1YJN I;  1DP7 P;  1SFE A;  3K4C A;  3TO7 A;  1OIS A;  2IXS A;  1O3R A;  2DA2 A;  2VAS A;  3FWE A;  1BA5 A;  3LSK A;  3IRQ A;  3W6J B;  4ZYA A;  4FET A;  4I09 A;  3CF2 A;  2HVR A;  3ZQL A;  1K4S A;  3S8P A;  3ZR8 X;  2QGU A;  2HOS A;  4MGR A;  4AYB A;  1RES A;  4O5V A;  4PJN A;  4M3D A;  4IHX A;  1OR7 A;  3GTM J;  2EB7 A;  5GPA A;  1O3Q A;  1YQA A;  1JKQ C;  4RGR A;  3BWG A;  2CW7 A;  4ESF A;  1T0F A;  1ZGW A;  3RQI A;  3RQ4 A;  4U7D A;  4I0A A;  2OZ6 A;  3BG9 A;  2OPT A;  3C18 A;  3VPR A;  1V55 H;  1HA8 A;  1UHS A;  1LDK B;  1FSH A;  2DYS H;  4ZDO A;  2R7F A;  2Y31 A;  2HVQ A;  1ZKG A;  2LY2 A;  4ZH4 F;  1Z05 A;  4Q4Z F;  1MW7 A;  1MBF A;  3ASN H;  2DMP A;  2RNG A;  3MN2 A;  5ERI A;  5TRD A;  3O2P E;  3WHC A;  3BQZ A;  4RDU A;  1GT0 C;  4A3D J;  3GLL A;  2MC4 A;  2M45 A;  3DPT A;  3TKY A;  3LST A;  4XLN F;  3VDX A;  1AU7 A;  2J5O A;  1E2X A;  1OCT C;  4G8X A;  2F4I A;  5ED4 A;  3HOZ J;  1LEB A;  3DBR B;  4N0B A;  4B4C A;  4CYC A;  2XAJ A;  1DQU A;  1V54 H;  2HXO A;  3TMO A;  3DLA A;  4ETS A;  4XMY A;  3HSE A;  2IBD A;  3L1P A;  2R7U A;  3M8E A;  2PMH A;  1XMX A;  2LYC A;  5CYV A;  5LFA A;  1HKQ A;  4LG0 B;  3G4S I;  5E1Z B;  2VT2 A;  3BCB A;  4ZZL A;  3GTQ J;  4EVI A;  3MZH A;  3PO3 J;  1UST A;  1FT9 A;  2RVC A;  1SEU A;  5BPI A;  5FKM A;  3ZN1 A;  1VQM I;  3QU3 A;  3ZQG A;  2BY3 A;  4LLL A;  3W3C A;  2M8G X;  1LB2 A;  3K1M A;  5M5Y J;  1J75 A;  3S17 J;  1FP1 D;  2JWT A;  4CCO A;  3RKQ A;  2QCO A;  1NG6 A;  4XRM A;  5E18 F;  1QU3 A;  3V7R A;  2ZJ2 A;  2EFW A;  1H9G A;  1R00 A;  3WOD F;  5DEQ A;  3T0Y A;  2O6G E;  2NOG A;  5AIP A;  1XSD A;  4KFC A;  5J4Y A;  2VC0 A;  4EV0 A;  4KN4 X;  1Y56 A;  2L7Z A;  2H8W A;  2OF7 A;  2HXI A;  1JHF A;  1XCV A;  2V9K A;  4I7H A;  3CJT B;  4LOC A;  2NAZ A;  4M9Z A;  5EG0 B;  2Z33 A;  5AON A;  3CCE I;  2Q0O A;  4JP0 A;  4DYQ A;  4G7H F;  4IRG A;  4C3H J;  1RPW A;  3L9F A;  3LA7 A;  2O8K A;  2EFN A;  4V19 K;  4PUS A;  3S3O A;  1EA3 A;  4BQO A;  4B09 A;  2HDD A;  3WTW C;  1FOY A;  2DA6 A;  3T5X A;  4BQQ A;  3JW4 A;  5J1Y A;  2EBI A;  3WHB A;  2ME0 A;  4QLC U;  2EIJ H;  3DXJ F;  1BBY A;  1K4T A;  1R4M B;  2VPL A;  2L0K A;  3QOD A;  2GQQ A;  3B6A A;  2PMU A;  4J19 A;  2R7W A;  3HOU J;  2LF7 A;  2Z3Y A;  2VKH A;  5IY5 H;  3QAH A;  1HSJ A;  2IS1 A;  3QOE A;  4DYR A;  4E7S A;  1ERD A;  2M4G A;  4RB3 C;  2VJ4 A;  5BS6 A;  1QRY A;  3VOD A;  3O8G A;  2X4H A;  1RR7 A;  2RAE A;  1BI2 A;  2XDV A;  3LQQ A;  4PJJ A;  3MD2 A;  2M9H A;  2ZCW A;  1R9T J;  4M6X A;  2YSR A;  3OL4 A;  2JTV A;  3S32 A;  4GRI A;  4A3C J;  3VYR B;  1X1C A;  2K9L A;  3BJO A;  4IPA A;  2JSC A;  4IQJ A;  3HEF A;  1ZRF A;  3FXL A;  3LAP A;  2ZFW A;  4EGZ A;  5HLI A; 
#chains in the Genus database with same CATH homology
 2EIL H;  1OCO H;  2EIK H;  3WG7 H;  5IY5 H;  5B1A H;  2OCC H;  1OCZ H;  3X2Q H;  2EIN H;  3ABM H;  2Y69 H;  1OCR H;  1V55 H;  1V54 H;  2DYS H;  3AG3 H;  1OCC H;  2DYR H;  2ZXW H;  3AG2 H;  3ABK H;  3AG4 H;  5B1B H;  2EIJ H;  5B3S H;  3ASN H;  3ASO H;  2EIM H;  3ABL H;  3AG1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...