1BA5A

Dna-binding domain of human telomeric protein, htrf1, nmr, 18 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
RKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA-binding domain of human telomeric protein, hTRF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna-binding domain
molecule keywords HTRF1
total genus 15
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1998-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ba5A00
2MGQA 4IEJA 2ID3A 2YS9A 4Y7NJ 1RKTA 2CUFA 4FTHA 1MBGA 3GTMJ 3VPRA 2B63J 3RZDJ 2D5VA 2HI3A 3JRFA 1ETYA 5C3EJ 1R9TJ 1FEXA 5E3LA 3BR5A 1FTTA 1GT0C 2DMUA 3WHBA 5F08A 1ZTRA 2ME6A 3OSFA 3GTPJ 4W1UA 4EEFG 3S1NJ 2ME0A 3HGGA 3BTLA 4L5EA 1BW5A 4AYBN 4Y52J 4MLOA 4UUSA 3BG3A 2LK2A 2E1OA 3HBLA 4A3KJ 3B6CA 4UUSB 4XIDA 2QCOA 1MH4A 3BTIA 2H8RA 2R5YB 2HYJA 5DS9A 1IUFA 4V2GA 1JTYA 1JKQC 1TWAJ 2TCTA 4JX4A 1X2NA 1W0UA 5F27A 2DA2A 1IG7A 2L7FP 3BT9A 3ZQIA 4M3FA 4IHVA 2Y9YA 3Q0WA 4QIWN 1JKPC 1B72B 5IOYA 3FIWA 1ZQ3P 3BTCA 1SFOJ 1QVTA 3GBGA 1FIAA 2LR8A 1GDTA 1RKWA 1Q1VA 1IRZA 3M4OJ 2CU7A 1ITYA 1B8IA 2O7OA 5E3MA 2NVTJ 5EYRA 5FKLA 2XB5A 2DA5A 1K61A 2MSYA 1WH7A 2GM4A 3ZQHA 1F36A 4C3HJ 3IH4A 2CJJA 1WCMJ 1Z0XA 2HQ5A 5M5XJ 1D5YA 1YRNB 2LFBA 1FJLA 5BNGA 1MH3A 2IAIA 1PUFA 2R5ZA 5GPCA 1FIPA 2E2IJ 3LSGA 3HGYA 2OPTA 2HOTA 4UUTA 2XRLA 2NVQJ 3FK6A 3BQZA 2CQXA 3LSPA 2E19A 5IP7J 1UG2A 1OCTC 5IP6A 3SJMA 2HOSA 2NVYJ 3BR1A 3MVPA 4AUXA 1CQTA 5GP9A 5E3NA 3RKQA 2MG4A 5IYDJ 2JMWA 5EGOA 1JJ6C 1G2HA 3NARA 2XPUA 3NAUA 3LSJA 4B4CA 2EQRA 5HODA 2XSDC 2LD5A 1AHDP 1U9OA 3QPLA 5E3OA 4A3CJ 4A3GJ 2DA4A 2L7MP 3ZQLA 2AO9A 4JP0A 1K83J 2XGDA 1BL0A 3F0CA 3D1NI 4M3EA 3A02A 1DU0A 2K9QA 2VUMJ 4I76A 4A3BJ 3S2HJ 3TEDA 1X58A 1NK2P 3BG5A 1E3OC 1EF4A 5FLMJ 2H1KA 3Q0UA 2Y2ZA 1VFCA 3OSGA 1JTXA 1H88C 2LY9A 2R0QC 1HF0A 2ELKA 3K7AJ 5J1UA 3K2AA 4M3BA 5IP9J 4C2MJ 1ZR4A 2HXOA 4BBRJ 1OFCX 3WHCA 4A3MJ 2L7ZA 2JA6J 3L1PA 3S15J 1MBJA 4S0HB 2O9LA 1TWFJ 1GUUA 2LVSA 1MBFA 2LKXA 1ETXA 3HOWJ 1WI3A 1ZGWA 4HNVA 2AHQA 4MIMA 3S16J 1QVUA 1ZKGA 2YU9J 1H8AC 1IDYA 1T56A 3OIOA 3HOUJ 1ZK8A 3A03A 1I3QJ 3BTJA 3A01A 5M3FJ 5EG0A 2RAEA 4AC0A 4FE4A 2QF7A 3GTLJ 4A3DJ 1AKHB 3BR2A 1U9NA 3OOUA 2X9DA 5C4XJ 3S2DJ 1GVDA 2HOAA 3JR9A 3HEFA 1AKHA 5M5WJ 3TP3A 4M3DA 1RR7A 4BKXA 3PO3J 1XS9A 1ETKA 1MBEA 1U78A 4RDUA 1ENHA 2O8KA 3TW6A 1VI0A 3CQZJ 4QSHA 3MKLA 1MBHA 3M3YJ 2K9NA 1PUFB 1I6HJ 1RETA 2DMPA 4FISA 2M2EA 2M9HA 2MW8A 3TW7A 1WH5A 1U8BA 4X6AJ 2HXIA 1Y1VJ 1B72A 3HOZJ 3DCFA 4JX5A 3B6AA 3S14J 4FCYA 1A6IA 5K7FA 5FKOA 3SDGA 5F0CA 4A3EJ 1HLVA 2DMQA 9ANTA 1LFBA 2OF7A 5EZHA 2VKVA 2VKEA 2EBIA 5FLVA 4D5FA 1TC3C 2EZLA 3HB9A 2GBYA 3RQIA 2P81A 1BA5A 2JA5J 3I4NJ 2KT0A 1QPIA 5GPAA 2HDDA 5FKMA 4BBSJ 2LTPA 2NVXJ 1HOMA 5JLWA 3IV5A 5IOZA 4DZPA 1ETWA 5M3MJ 1IDZA 4BY1J 2N8GA 3G1MA 1LE8B 3HOYJ 3JRDA 1FTZA 3JRHA 5K7ZA 2EZHA 2XPWA 3QPSA 2DTZA 4DYRA 3JRBA 3BG9A 2WAQN 5J1RA 4MFEA 1XC5A 1JUPA 1IGNA 2ID6A 4DZJA 1TWCJ 1JT0A 4MFDA 4DYQA 3GTKJ 1TWHJ 3LSRA 3E7LA 5EGOB 2TRTA 2YUSA 1OCPA 4GFBA 3RZOJ 1ETQA 1JUMA 1F43A 4D5CA 5F0FA 2G0EA 1JKOC 2XB0X 3BR0A 2R5YA 4M6VA 4LOCA 2NS8A 3HOVJ 3W6VA 1Z77A 4V2FA 4IHXA 5F04A 5EF6A 3GTOJ 3JRGA 1LE8A 5IYCJ 3O8HA 1QRYA 2KDZA 1YRNA 2R7ZJ 2DA6A 1DU6A 3LOCA 4CYCB 3BR3A 2X48A 1IJWC 2Y0SN 1WGXA 4XRMA 1UMQA 3CMYA 2GLOA 1P7JA 1HDPA 2IEKA 5C44J 3HOXJ 3LNQA 2E2JJ 2DA7A 2FQ4A 5FJ8J 4DYCA 2EH3A 4MO7A 4CYCA 2CQQA 4A3IJ 3GTQJ 4A3LJ 1SANA 3FISA 1JJ8C 1AU7A 4X1EA 3JRIA 4A3JJ 3ZQGA 2LP0A 2JA7J 1HDDC 2JJ7A 5J1YA 2ECBA 3IH3A 2EZIA 1X2MA 2EZKA 2VPRA 5F0HA 4IHYA 3I4MJ 3FK7A 2E2HJ 5IPAA 3TP0A 1JUSA 5FKKA 2JK3A 2DMNA 4XK4A 4D7MA 1B8IB 1VF9A 4NDLA 3BR6A 5EEAA 2K40A 1MNMC 2IBDA 3PM1A 2DN0A 2M34A 1XG1A 2DA3A 5M5YJ 4DW6A 3JRCA 3A01B 3FKIJ 5EZGA 3PO2J 1H89C 3C2BA 1MSEC 3GTGJ 3IH2A 2PMZN 4FE7A 1A5JA 4XRSA 3HKZN 3SFIA 2LLKA 2FD5A 4B1RA 1WPKA 3Q0VA 4JYKA 3HM5A 1ORKA 5FKNA 4I6ZA 2R92J 1IV6A 5C4JJ 3S1MJ 2DJNA 3UKGA 2CUEA 2WB1N 3CDLA 3HDDA 4BXXJ 4XRSG 1MBKA 1Y1WJ 2NS7A 1O4XA 1HCRA 2FJ1A 2ZB9A 4BY7J 1BW6A 1UHSA 2M8GX 2WV1A 2JN6A 5IYBJ 1ETOA 1VNDA 4A3FJ 4ABZA 2XGCA 1TWGJ 3O8GA 4W97A 5DTDA 1RPWA 1S7EA 3BQYA 1GV2A 4QTRA 2L9RA 2XGEA 2ECCA 1IC8A 4A69C 3G1OA 2M0CA 1NTCA 2XPVA 3ZQFA 2X6OA 1JT6A 3H3VK 1OJLA 2I10A 3QQAA 2COBA 1ETVA 1RESA 4RBOA 1MSFC 1POGA 4B3AA 2FX0A 5K7HA 1JKRC 2R93J 3JRAA 3DEWA 4G12A 5JLXA 3JREA 3S1QJ 4IHWA 3Q3SA 3H0GJ 2NOGA 5F1JA 2Y31A 2DA1A 5J3LA 3G1LA 5EDNA 1GV5A 2Y9ZA 2JWTA 2JA8J 2Y30A 4XICA 1NK3P 1JGGA 3S1RJ 1P7IA 2CRGA 2L0KA 3CCYA 1BJZA 3MN2A 3ZQCA 2DMTA 5EG0B 4M3GA 4D7NA 3S17J 4A93J 1T33A 1ZR2A 3GTJJ 4JX6A 4C3JJ 2R5ZB 1APLC 4J19A 4C3IJ 1W0TA 2VI6A 1I50J 2K9SA 1LFUP 2W48A 3ZOBA
chains in the Genus database with same CATH superfamily
4YFXF 2MGQA 2ID3A 4KISA 3BC8A 2RGVA 2KFDA 2CUFA 3C1DA 1Y0NA 3BPVA 4E7LA 1UG0A 1DPRA 3GTMJ 3VPRA 4AIDA 2D5VA 2IGMA 2HI3A 3CCJI 1O3SA 5E3LA 1QZYA 1YJWI 4XMYA 1A35A 1FTTA 4IO9F 5KAFC 3ZPLA 2DMUA 3RKXA 5F08A 4ENJA 3I58A 3K6GA 3AG2H 4A5NA 3S1NJ 2CV1A 3BTLA 5D8KB 1MNDA 1JHHA 1BW5A 4ZDLA 3ZRGA 4AYBN 4Y52J 2JRMA 2KHMA 4YFKF 3TKYA 3I71A 4CICA 4A3KJ 2G7UA 3DFGA 2A5WA 3I0TA 1T0FC 2Q2EA 2P5LC 4F92B 4LLLA 3I53A 3I56I 1S8NA 2R5YB 1B4AA 2HYJA 2FEZA 2GQQA 2HVQA 2OAZA 2HKOA 5DS9A 2CV2A 3RQ4A 2HNHA 4RB0A 2IXSA 4OAZA 1EH7A 3KFWX 2A6EF 2VKHA 4YG2F 2V7FA 1X2NA 5F27A 3E5QA 1BC7C 3F8CA 5LEJA 2HFHA 3L7WA 4B09A 1E17A 4M3FA 5JFRA 3I9V2 1JKPC 4ZYEA 2Z16A 3RYPA 3CUQC 5FGMA 3IKTA 1MGTA 1X19A 1QVTA 2IJLA 1FIAA 3ZQQA 1RKWA 3D0SA 3JW4A 2VL8A 1IRZA 3PFYA 4PZJA 4F52A 4Q4ZF 5E18F 1ITYA 5HDKA 1X3UA 2O7OA 4HSTA 4R1HA 4ZTFA 2PLYA 2KIMA 1R58A 2CWEA 5FKLA 2PBIA 1UHMA 2MSYA 5LGUA 2HGCA 3CLQA 4P5OA 4IQ4A 1FBQA 2CJJA 2BBYA 5JHUA 1MJAA 4NBQA 2BY3A 2XUBA 3KP6A 5HS8A 1FC3A 3TO6A 4KUMA 4LIUA 1YRNB 5B1AH 3WGIA 3L2UA 3HRTA 4KNYA 5BNGA 3SYTA 2H6BA 2FNPA 2L3DA 2E2IJ 4IOCF 2RQQA 3OYLA 4UY8I 2RNJA 1P9QC 3H35A 3HTUA 3FK6A 4HLYA 3MCZA 2CYYA 2E19A 5IP7J 4ENNA 4PK4A 4UB6C 2RVCA 3LSTA 3MVPA 4CSWA 5IY5H 1K6OA 5E3NA 3CZ6A 4XKWA 1W5CC 2EV0A 4Z6YA 3BPXA 3KEOA 3CCSI 2MG4A 3RKQA 4IQJA 3FBNB 3EDPA 5EGOA 1T2KA 2RREA 2XPUA 3NAUA 1SMYF 1LKXA 4XORA 3V8KA 2VC1A 4B4CA 4OIQF 4BH9A 1SD4A 2QM3A 2LD5A 1AHDP 2CV0A 1U9OA 5E3OA 4XLFA 3OS1A 3J7YJ 4HEA2 1K83J 4JBAA 4FX4A 1R23A 2JQ7A 1R1TA 3F8BA 1YW9A 4AD9A 2WAEA 5AONA 3F6OA 2PI0A 1E3OC 5J8CA 2LBFA 1GHCA 3IRRA 2H1KA 2L9VA 1LUJB 1XGOA 2KMUA 5HNFA 4IZZA 2OTLI 3KZZA 1R5HA 2OBPA 3ZMSA 1KU9A 1UHWA 5CVJA 2QQAA 1DP7P 2FE3A 2Z99A 4C2MJ 5KHDA 2DO7A 5K5QA 3MMYB 2RKHA 4EV0A 3WHCA 3V7CA 4BAYA 1H0MA 3J7AO 2XKPA 2YX4A 1ZG3A 3HG9A 2VOOA 2HWVA 4GRIA 3V4GA 3BG6A 5JR3A 2EILH 3WODF 3CLOA 1XMXA 2AHQA 2XF6A 3SEZA 1YYVA 2JVGA 2E5ZA 1ZKGA 2YU9J 1IDYA 3HHHA 1IRGA 1ZK8A 3A03A 1I3QJ 3P9KA 4Y15A 3VOEA 2DXIA 2JUCA 3GTLJ 1DDNA 1OR7C 1P6RA 1U9NA 2MA3A 3WU1B 4PJJA 1D0ZA 1GVDA 2HOAA 3S2DJ 2XAUA 1YFHA 5M5WJ 3TP3A 1W1WE 1N78A 4U87A 1MBEA 2A3SA 1A31A 1FOKA 4ESJA 4RDUA 2XROA 3ZCOA 3KYLA 1ZH5A 3TW6A 2L02A 3H5RA 1ZAOA 2DT7B 3IP4B 3CCVI 2CSOA 5FROA 2Q0OA 2EFWA 5DD4A 4Y17A 1FP2A 1MBHA 4Q48A 1LEAA 1RETA 4IHTA 2VJ5A 1W5TA 3GZ6A 2IS1A 3MZ8A 5CJ9A 2MD5A 1WH5A 3DLAA 2RN7A 2HXIA 2HVSA 2RNGA 4RM3A 2J5PA 3HOZJ 3K4BA 2XVCA 4CHUA 3B6AA 3MKZA 4FCYA 1OCCH 3ML6A 2V6EA 4AIJA 1A04A 2MLGA 1WFXA 2VIXA 3A2KA 3SDGA 4BJ5C 3K4KA 2ZBKA 1Z05A 1LFBA 4HF0A 2BY0A 2QBYB 3PUBA 2O6GE 2VKVA 4M9ZA 3WTYC 4HLXA 3UNGC 5FLVA 4LFUA 1ZREA 1YS6A 2KJBA 2Y48A 4CCLA 3HB9A 5LHGA 2L7KA 1J09A 4QWQA 4FASD 1YE9A 2BVMA 2QUFA 2JA5J 2KT0A 3GFJA 4XRFA 3JCUC 2LTPA 2PMZA 4CA0A 1S6LA 2WBMA 5L3CA 2BYVE 5M3MJ 3Q5FA 2DDAA 1FY7A 3K4JA 2PN6A 2KDOA 3BWGA 1D5VA 2HU9A 3JRHA 2VN2A 2EZHA 3QPSA 4KMUX 1SVOA 3C2GA 2EWNA 3OL4A 4MFEA 1XC5A 3ERMA 1WKMA 4KT5C 3VSKA 5DCMB 4DZJA 3QYEA 3PNYA 1LVKA 1T08B 4C2TA 1W5SA 2TRTA 5CVIA 3QRFF 1SC7A 1STZA 2YUSA 3TDUC 2W57A 4XN0A 1JUMA 2ISZA 4I0BA 3M8JA 3ABKH 4RAYA 1JKOC 4ENKA 4UHTA 1ZG5A 1YOVB 2R5YA 2PX9A 3HOVJ 3W6VA 1R5ID 1XMKA 2ZKZA 2E1NA 2LF8A 1BOBA 5F04A 5EF6A 1W7PA 1LE8A 4CUGA 1KONA 1TBXA 4O6JA 4HX8A 2P4WA 1MZBA 3FXLA 3F8FA 3DU5A 3EYIA 1DU6A 5ERIA 2PJRB 2Y69H 2IT0A 4XRMA 1UMQA 2CW8A 2NAZA 2ZXIA 2NNNA 3H5AA 1HDPA 2IEKA 2LBFB 1R71A 2L9NA 3LNQA 3IHUA 3KEYA 1YITI 3ECOA 2VBWA 4DYCA 4CYCA 3R60A 4A3IJ 1TLHB 2CQQA 2R7TA 2W7NA 2KKOA 2M4GA 3FMSA 4A3LJ 1JJ8C 2F5FA 1V4RA 4KDPA 2IGOA 4X1EA 4A3JJ 3EPZA 1UZCA 2MFZA 1HDDC 2HTJA 4EM0B 1QA6A 5IT9Z 2FNAA 2E36A 2BY2A 1XX5A 1X2MA 2EZIA 3B02A 4P96A 4IHYA 4AIHA 1YQAA 4FHTA 4BGDA 2DMNA 4NC7A 4D7MA 2QWWA 1KQ0A 2WAQA 4NDLA 1CF7A 2EPFA 3ZN0A 2D45A 3RPUD 3P7NA 5F1RA 5M5YJ 5KNLA 3A01B 2L4AA 3ABMH 3PQJA 4BUPA 1ZLJA 4WWCA 1RI7A 3IAS2 1LVAA 3C2BA 1H89C 1MSEC 4L0YB 2PMZN 4BEHB 3VWBA 4TV7A 4ESBA 2IS6A 2JA2A 3T1BA 2LRDA 1Y6IA 2K4JA 4UXNA 2CFXA 4HX4A 1J2XA 1QNTA 2HQNA 2VC0A 1ORKA 4I6ZA 1O3TA 2ISYA 5ED4A 3FX3A 5C4JJ 3UKGA 5FD5A 1G3TA 2DT6A 4PJ0C 1KYWA 3P9IA 5ILSA 2WB1N 3CDLA 3RSNA 2VE9A 5KAIC 4HV5A 4XRSG 1XPXA 1OPCA 1O4XA 2FJ1A 4G94A 1VQMI 2CQ7A 2PEXA 2R7SA 2LSOA 5D5VB 2M8GX 2OA4A 2WV1A 3I59A 3FHNA 4NQWB 2F5DA 4A3FJ 5FRNA 2DOFA 3O8GA 1ON2A 1IN5A 4OOIA 4W97A 3MZHA 1S7EA 3BQYA 4KJZA 4HRIA 1S7AA 5GTIC 3GMEA 1ZGJA 4UV8A 4ZJZA 4HPQA 4QTRA 1WZ2A 3CCQI 4NHJA 1TNTA 2XAQA 2F2EA 4NUBA 3VSLA 5HLTA 4C30A 2OU2A 1WSUA 1NH3A 2X6OA 2X6XA 3H3VK 1OJLA 4P1WA 2LDUA 5D4RA 2STTA 2COBA 1RESA 5L3FA 1D8JA 3WTUC 4RBOA 4ETSA 3CC2I 3PNTA 2GWRA 3F9KA 4ZYAA 5HDNA 5LRSA 2WAFA 4B3AA 4IKFA 1K78A 3OWTA 1VQ6I 4CCNA 1JKRC 1R22A 4I02A 5KVRA 5K5RA 2OJED 3DEWA 4G12A 5JLXA 1AOYA 1S7OA 3HL2A 1Y39A 3BOQA 4IHWA 3S1QJ 1XD7A 2ZXWH 5F1JA 3DBLB 2E1CA 4U88A 1FT9A 4EJWA 1SVLA 3G1LA 5FO5A 3I54A 1GV5A 2JWTA 1Y56A 4CO8A 3S1RJ 2CRGA 3KZYA 2BHYA 2EFPA 5EG0B 4OMZA 3QP5A 2CUJA 3SFZA 1W7PD 5EEHA 3HSRA 2IS2A 3OY9A 4A93J 2D1HA 1ZG1A 2JSPA 2R5ZB 4C3IJ 2K9SA 3ZOBA 1SVMA 3CMAI 1XB4A 2YS9A 1S9HA 4FQGA 4Y7NJ 2VQHA 4F93B 4J01A 1TW3A 2R4GA 3BG7A 2HZTA 3OYNA 3OYFA 2B63J 3RZDJ 3JRFA 2VE8A 1I27A 3ABLH 3BR5A 4MGRA 1NHAA 2GXGA 1J5YA 1RC9A 3ZXSA 1I5ZA 2Q1ZB 3WHBA 4NB5A 3PFIA 5ICCA 3L2VA 4EEFG 1VQ8I 2ME0A 3WE2A 1BR1A 3KP5A 4L5EA 2GIVA 5JVTA 1H9GA 2OQRA 1V54H 3B6CA 4B47A 3MZYA 3RTRA 4UUSB 4PJLA 4WX9A 1RIOH 1IN4A 1SAUA 2H8RA 1Z91A 3SZTA 1R4NB 2NS0A 4Y33A 5DD8A 2NVUB 4BYYA 2LC2A 1HKTA 1JTYA 3HUGA 4BXFA 1JKQC 4UVCA 2TCTA 1W0UA 1IG7A 2VT2A 4IHVA 3OYJA 2CH0A 3CCMI 3FIWA 1FOYA 3BTCA 1HBXG 2K85A 4CZCA 2GZWA 1GDTA 5A2QK 2Q8KA 2VBYA 3JSPA 5HOOA 4XSZF 1K79A 1P92A 3BCBA 4E7HA 2CU7A 3CD6I 2H27A 5J8FA 2BOLA 1IUYA 2R7OA 2NVTJ 2E60A 3MQ0A 1KQ9A 1P4XA 5EYRA 1WI9A 1H9TA 4KITB 3EUHA 1AWCA 3CCUI 3ECHA 4XL9A 4F91B 4G7HF 2GM4A 1QU3A 2OZ6A 3ZQHA 5BMZA 4XKCA 3S3NA 3QU3A 5HVQC 3D5RC 1Z0XA 4HX7A 5JVGF 5B5EC 1R00A 3FBIB 1D5YA 3KYDB 2A5YB 3S32A 2H09A 1MH3A 3AL0B 2R5ZA 2KZVA 1FIPA 2B0LA 5L3BA 2OPTA 1X1DA 4UUTA 4DQ2A 1N25A 2HQAA 3CP2A 4RAGA 4PJMA 3ROUA 2CQNA 4B48A 2QEXI 1DP3A 3GUDA 4II2A 4BE2A 3CJNA 2IW5A 4XLNF 5B3SH 2BW3B 1R1UA 3SJMA 3VYRB 3DBHB 2X51A 4AUXA 3CMEI 4AIKA 1CQTA 3LFUA 3GZ5A 4ITVA 5GP9A 2GA1A 2K7LA 5K5OA 1ZRCA 1G2HA 1ZN2A 3NARA 4P9FA 5AIQA 1LQ1A 2V9VA 3LSJA 4NC6A 2EQRA 5HODA 4I7HA 4P9UA 4YFNF 4ZDPA 4A3CJ 2CGPA 2DA4A 3ZQLA 2M5WA 3F0CA 5CLSA 1DU0A 4AWXB 3S2HJ 4NQWA 3KIOA 1NK2P 4WF2A 4OAYA 3BG5A 1D1BA 2EFNA 1IO2A 1K6YA 4U0YA 1IXSB 3CCLI 3OR1C 1YHQI 2BVLA 4N4OB 4N9HA 4PFPA 4U0VA 3Q0UA 1PP8F 2IA0A 3I55I 1D1AA 4A6EA 2R7WA 2F4IA 1VFCA 5CVUA 4Q47A 5ILUA 4E7IA 1J7KA 4B3XA 1H88C 5E79C 1X3WB 1SFKA 1PP7U 3K2AA 1CF7B 1PDNC 5IP9J 1ZR4A 5IT9K 3ONQA 2HXOA 4PJNA 3K10A 4BBRJ 3MKYB 2V26A 5GAGJ 4A3MJ 3RPQA 1QBJA 1K78B 1B6AA 2HPMA 2JSCA 2EJRA 2ZO4A 3GO5A 1C0WA 1EV7A 3DTEA 2KL4A 1K4TA 3TO9A 2LKXA 4L9VA 1MDMB 1QO0D 1WI3A 1K7AA 4HNUA 1MIJA 3T8RA 5LBQA 2L5QA 3RCOA 1FMWA 1I6XA 4IVNA 5TRDA 2JVHA 2QQ8A 1T56A 3HOUJ 2FA5A 5EG0A 1F5TA 1PVEA 4KT6A 4FE4A 2QF7A 1FOWA 3E0JB 1TQPA 4Y4RA 3JR9A 5LFAA 1LNWA 2WADA 1RR7A 3CC4I 1XS9A 2DODA 1V3FA 4GDFA 2DK5A 4MTEA 2KRHA 3U1KA 4GXOA 3ERED 4QSHA 4BU2A 2QQ9A 3GFIA 4YIRX 3L2CA 2QQBA 1I6HJ 4QPQA 4OMYA 1JGSA 1QGPA 1WJFA 4ESFA 2M2EA 3VFZA 3JTHA 5H2FC 2MW8A 3I3LA 4KFCA 1K4SA 4UUVA 2E7WA 1LDDA 2VBZA 3MFKA 4RGUA 2KQRA 3DCFA 3WTWC 3S14J 1HXDA 3M8EA 2DYSH 2F4OB 4E7ZA 2LNBA 2I8DA 5DCFA 4A3EJ 2Y0MA 4WCGA 2VPLA 1OYIA 2VXDA 2X1EA 3M1CA 3L2WA 3ABTA 2O8XA 2VKEA 2X85A 3BP8A 2ZFWA 4B43A 3WGHA 2GBYA 1V5FA 1YW7A 2HPIA 3J81Z 1ZLKA 2GXBA 3BCAA 4ZZDA 2F5CA 5LGTA 1QPIA 5GPAA 1P2FA 3EUAA 3KZIC 3WE3A 2NVXJ 3FWEA 2FRHA 1ETWA 2P7VB 4JK1X 4A2UA 3T5XA 2P5KA 2NYXA 1BI2A 1XGMA 1W7PB 3G1MA 4I0AA 3G73A 1LE8B 4A0YA 3JRDA 1FTZA 2XPWA 5BS6A 6PAXA 2DTZA 3BG9A 2WAQN 2W25A 1L0OC 4NC8A 3FXQA 4PUSA 1YG2A 4MFDA 2ZXJA 3CMMA 1O3QA 4DYQA 3BJAA 4B44A 3GTKJ 1Y8QB 5EGOB 5DV5A 2CW0F 2P8TA 2AQFA 5GAEJ 4A0ZA 5DCMA 3RZOJ 1ETQA 2GOXB 1USSA 4EGZA 1KZHA 5F0FA 3CF5F 2LOOA 3HJEA 2H94A 2F4MB 1QZEA 3DEEA 4M6VA 2EIJH 4DNCA 4LOCA 4C9YA 4XQFA 4N4NB 3JRGA 1WJ5A 3MKWB 1EH6A 3O8HA 4AYBA 3HTSB 3D5LA 5LLQA 2KDZA 1ODDA 1FP1D 3S8PA 2DA6A 4IJAA 2XIGA 3BR3A 3ZQ7A 4GCVA 1IJWC 1WWXA 1WGXA 3LFKA 4BQNA 3R61A 3HOXJ 4KIGA 3DKXA 1HSTA 2EH3A 4MO7A 1E0EA 1SD5A 3E6DA 4RAZA 3K0LA 2XAFA 4YIFA 4O5VA 2H6CA 3ZQGA 2R7RA 4A12A 4U0WA 5DEQA 1EH8A 2KZGA 1Z7UA 3HPHA 2ECBA 5FLXZ 3F72A 2EZKA 2VPRA 3HYIA 3IC7A 2IPQX 3TP0A 5FB2A 4XK4A 2C6YA 1UCRA 2M0MA 3BR6A 1G8XA 2EB7A 5EEAA 4LIVA 2K40A 4M73A 3OYAA 2MC3A 2L01A 3AAFA 3TOAA 4LB6B 3A4CA 2G7HA 4DW6A 4RB2C 2K5CA 4KN4X 3JRCA 1XDSA 3FKIJ 1T95A 3C18A 3HZJA 5EZGA 1DUXC 3PO2J 3IH2A 1I39A 2AXTC 2R7QA 3DPUA 3IAM2 5HNHA 3G6EI 1BI1A 1G3SA 1X1PA 2O03A 5E8IA 3HKZN 3GX4X 2X1CA 2LLKA 3RI4A 2FD5A 3WTSC 2RV8A 3KETA 3L9FA 3F8NA 4UB8C 2MC4A 3Q0VA 2X6WA 1PJRA 3F3XA 3ZMUA 1IV6A 2DLLA 3PIOF 2UV1A 1A36A 4IL6C 1W36C 2F5EA 3U9GA 3H9QA 3TL4X 1MBKA 3H36A 1R5GA 2NS7A 4S05A 1N77A 3L2QA 2ZB9A 2JPBA 5JHFA 2JT1A 2JN6A 3M1EA 4M74A 1JHFA 1F4KA 1ETOA 1VNDA 2BE5F 4PCQA 1XMAA 2XGCA 1QHGA 4BHBA 1SFUA 3K9TA 3ZN1A 4HDVA 4RS8A 1LFPA 2L4MA 4K2EA 1BBYA 1I1SA 3CP8A 2XGXA 2K9LA 1D0XA 2M0CA 4BQOA 1MMNA 1IXCA 2XPVA 1R49A 2AXLA 2R3SA 4X0GA 3IWZA 3E3VA 1S72I 1JE8A 2XDVA 4A6DA 2DW4A 3NRVA 3F22A 1POGA 3BLYA 4Y13A 4RB3C 4M72A 1GXQA 4UNOA 3N05A 3VYSB 2VOPA 3H3ZA 2FX0A 2QGUA 3KCCA 5K7HA 4RLFA 3JRAA 2KRFA 3CO6C 3JREA 4XOPA 2BV6A 3H0GJ 2EV5A 2M8EA 2Y31A 2A6TA 3OYHA 3COAC 3CTAA 3FM3A 2NOJB 4XICA 3OYEA 3FDYA 1P7IA 3ABUA 2FOWA 2L0KA 4GYIA 3CUQB 1EA3A 1MW7A 3FXKA 2DMTA 2AS5F 4ZYDA 4RM2A 4D7NA 2JRTA 3GZNB 4CH7A 1P4AA 3CDHA 3S17J 1LDJA 2QYOA 1Z7LA 4DGWB 3W6JB 1E3HA 5KCMA 1B9MA 4CDGA 4HA8A 3HKZA 2Z9OA 1APLC 4J19A 1W0TA 2I5UA 4DIQA 1IW7F 3K2ZA 1LFUP 1DGRM 3I5UA 4LMYA 4BHCA 3VDXA 4N0BA 3Q9VA 4MNUA 2ZJRF 2EFOA 1MBGA 3DPLC 1ULYA 3OS0A 2O0YA 1XGSA 3C2HA 3KX2A 4R8HA 1BN5A 2OZUA 2M45A 1ETYA 5C3EJ 1R9TJ 3REOA 5FD6A 5F64A 1GT0C 1IAWA 1I1GA 1ZTRA 3PSIA 4A0XA 3DU6A 3OYKA 4W1UA 2ZMEB 2EV6A 2MBFA 5D6FA 4UVAA 4ON0A 3VYUB 3AFHA 2DFEA 5EJCA 4MLOA 3L2RA 1YO5C 2YPRA 3BG3A 3DV8A 4L0ZB 3HBLA 3FXUA 3ZR8X 2LMDA 1IN8A 3HSFA 4RB1A 4GYGA 4XKVA 2QCOA 1MH4A 1OYWA 3ISPA 2QA4I 4G9YA 2FMYA 3P5JA 2H1LA 4UVBA 1SFEA 1IUFA 1U2WA 2OTJI 1MMAA 1TWAJ 5J4VA 2CO5A 3T0YA 3J80K 2Z3YA 3BT9A 4IPAA 3ZQIA 3GFMA 5HLHA 5HS9A 2Y9YA 3Q0WA 1BC8C 4QIWN 4G7ZF 2V1UA 2QZ8A 4KN7X 1SFOJ 3SQNA 4F3QA 2IGKA 2YSRA 1YI2I 4D9JA 3W2AA 3M4OJ 2D1VA 3CDIA 4M6XA 2OD5A 3H9GA 3LWFA 5E8GA 4EATA 5GADJ 5E3MA 3OR2C 3LSHA 2CW7A 4OWRB 5ILVA 3HOTA 4RGRA 4IF4A 1VQ7I 1WHUA 4L18B 1MMSA 2DA5A 1WH7A 3OIPA 2JPCA 5LRRA 1GLNA 4EQQA 2DOAA 2HOEA 1V55H 5M5XJ 3EETA 5IT3A 3G3ZA 2ELJA 2LFBA 3IKVA 3LA7A 4EGYA 1WRJA 1VQNI 5BQTA 4DJAA 2IAIA 5A2QZ 1REPC 2K3FA 5GPCA 2BW3A 3H1CA 2HOTA 1Z1DA 3KLOA 1R4MB 3R0JA 3O6BB 1MKMA 3E5XA 3BQZA 1XSDA 2CQXA 5CVVA 3LSPA 2DPDA 2RC4A 2JTVA 5H20A 5IP6A 2M1BA 3OYGA 2HOSA 2NVYJ 3BR1A 4OU0A 1MJ9A 2FSWA 2EK5A 2XAJA 3X2QH 1ON1A 2KLOA 3J80Z 5IYDJ 1JJ6C 1YW8A 1G3YA 4AVZA 4EJTA 3E5UA 2VQCA 1T8IA 4M9XA 2XSDC 1FLIA 1ACIA 4CGZA 3QPLA 4A3GJ 2L7MP 2KIFA 4HF1A 4JP0A 3KPHA 4L9TA 1BL0A 3OIQA 3QPTA 4M3EA 2L9SA 3A02A 4XBFA 2K9QA 2VUMJ 2CFOA 4A3BJ 1HC8A 2WWYA 3TEDA 1X58A 2P0WA 3LQQA 3LSIA 4L5IA 1WJBA 4IOAF 2XAHA 3DKWA 4QLCU 3WTTC 5K1YA 4UV9A 3SEQA 3R4KA 1VQOI 2OUMA 3CJRB 2IRFG 4GGGA 3HXLA 2CMPA 2LY9A 2R0QC 3LL7A 2ELKA 2VLAA 2LF7A 2E34A 1OFCX 2W24A 4H4KC 5FFZA 1G59A 4C2UA 4IRIA 3HRMA 2JA6J 1UAAA 3LQRA 1FYKA 2HTSA 2WC2A 3U1DA 3WGGA 3S15J 4YRVA 4S0HB 3S3MA 3OMYA 1GUUA 1T0FA 1AA7A 5HDGA 1MBFA 5LD2C 3HOWJ 4CCMA 4JOMA 4HNVA 3AG3H 3K1MA 3JSOA 1GXPA 4BACA 3HOSA 1QVUA 3S16J 2VT3A 1XSXA 2E1MB 4ZDOA 4BS9A 3BTJA 2X6YA 4BDZA 4AC0A 1LEBA 2V6CA 1W36D 4BQAA 3OOUA 2X9DA 3V8LA 2ESHA 1M1EB 3W2VA 2HYGD 4M3DA 1U5TA 1S5LC 1TNSA 1I3AA 5E17F 3TMOA 1U78A 1ENHA 1TTYA 1T6SA 2UXXA 2LY2A 3CQZJ 2ZC2A 3I4PA 3A1YA 4CCJA 1SEUA 1J9IA 3VB2A 3ASNH 2HR3A 1VQPI 2M4KA 2K9NA 1PUFB 2PQ8A 2R7DA 2CG4A 3DKYA 4FX0A 2VXZA 4HG2A 4RGXA 3K4MA 1FX7A 3C7JA 2M9HA 1B1BA 3RIRA 1TQIA 3TW7A 1U8BA 4PDKA 4JX5A 4D0PA 3S3OA 2ADUA 2ZMEA 3ULQB 5FKOA 3SZGA 2KP6A 5B1BH 2DMQA 9ANTA 3FMRA 2A05A 5EZHA 2BY1A 2EBIA 4D5FA 3J7ZI 2W85A 2QBYA 2BXYA 1X1BA 4CCKA 4OIOF 1VQ9I 3RQIA 2O61A 1YTYA 3K1PA 3DXJF 4BEHA 4DBRA 1YIJI 1JXSA 2HDDA 4G6QA 5J47A 3QODA 4R79A 4BBSJ 4LG0B 1SD7A 4AM3A 5AIPA 1OQYA 3QOEA 4MEYF 4XONA 3RKYA 3RPUA 2IA1A 1TW2A 3K4NA 3PUFA 4L9NA 3HOYJ 1XCVA 4QPOA 5E1XA 4DBQA 5K7ZA 3S93A 3LAPA 3LA2A 4DYRA 3JRBA 2O3FA 1LDKB 2Z33A 3EUHC 4EM2A 1JUPA 1JT0A 1TWCJ 4LK0F 1X4OA 2KIUA 3I59B 3IL2A 2KRCA 1G3WA 3WG9A 1LPQA 1OCPA 5L3EA 1OKRA 4PGHA 2G0EA 1S3JA 3G71I 4HSRA 5BPDA 1RR8C 3DLLF 2FUG2 4I09A 4LLGF 5D5XB 1Z77A 4NNJA 1XDUA 3GTOJ 3TOBA 1QRYA 1YRNA 2R7ZJ 3R0AA 4PSWA 4FT8A 4O3MA 3DP7A 5LHHA 3CC7I 2Y0SN 2BHZA 2UXNA 1HKSA 3CMYA 1P7JA 4G6TB 5C44J 1BIBA 2VB6A 2DA7A 2Z1DA 1WVRA 2FQ4A 1D1CA 2J5OA 3PIPF 3H9JA 3ELKA 5FFXA 2PMUA 3GTQJ 1HW5A 1SANA 3FISA 2YU3A 1AU7A 4KA4A 3JAMK 1ONVA 1IV8A 2MLKA 2JA7J 3FKJA 2JJ7A 3RDIA 5J1YA 2VQGA 3IH3A 1R7JA 1X1AA 2ZCWA 1O7LA 2OC6A 5F0HA 1UJ8A 3FK7A 3M07A 3I4MJ 3W2WA 5FKKA 5TJJA 1YJ9I 2K3PA 1BIAA 3ZMZA 3GVAA 5ICGA 1MDMA 2GIZA 3W3CA 1B8IB 1VF9A 4E7KA 1MJBA 2NXNB 3HRUA 2DI3A 2IBDA 1MNMC 2DN0A 2BXZA 2IVMA 4YIIA 1E3PA 2DA3A 1R6RA 5DYMA 3U21A 4LG3A 1RRJA 2A07F 1PUEE 5H6QA 3ESWB 3GTGJ 5CVRA 3CESA 4FE7A 2STWA 1YIOA 3K70C 4RGSA 4EJVA 2PG4A 3OL3A 4U7DA 3NEUA 3WTVC 3LA3A 3S2WA 3HM5A 3SXYA 4EJOA 3K70D 3CJTB 4N9IA 3E6MA 3HPGA 4LITA 3WTXC 4RA2A 1R36A 3GLXA 3V7RA 5GTHC 4KYWA 2DQRA 2ZFUA 4BXXJ 1Y1WJ 3J7AY 3F21A 1BW6A 1XN7A 2DT5A 3BJ6A 5IYBJ 4BDYA 5KK1A 1Y0UA 2CQKA 4BNCA 5CKTA 5ICFA 2BZTA 3KP3A 5DTDA 5HLGA 1Q1HA 2K02A 1R1VA 2W4SA 1RPWA 1O57A 3LSMA 2ZJPF 2L9RA 2NNYA 2XGEA 3K4CA 3QU6A 2ECCA 2X1DA 2BEOA 2PJPA 4A69C 4MQ9F 1NTCA 3PL8A 2QSHX 1JT6A 4OIRF 2I10A 1IN7A 1WJDA 2KISA 1UELB 2ZSHB 4P55A 2RQPA 2HYFA 4BJTA 4RLQA 5LEKA 2FXAA 2W84A 1OCZH 1OLTA 3CUOA 2A61A 4JQFA 3MAJA 3Q3SA 3GFLA 2NOGA 2DFFA 4PGGA 2DA1A 4HQMA 3BDDA 5J3LA 2X4HA 3QP6A 2JA8J 1TP4A 2Y30A 5LGNA 1NK3P 3FXRA 2IA2A 2GXAA 1SAXA 3CCYA 4AVPA 4HDUA 1QHHD 2PFBA 2V9PA 5L3GA 3M9AA 2JUGA 3KP4A 3Q9SA 3IRQA 2EIMH 3JTGA 1Z9CA 3KYCB 2WY8Q 3GTJJ 4JX6A 3UR3C 3BY6A 1DGWY 2VI6A 5HLIA 1FYMA 3V7SA 1J75A 2W48A 1ZELA 2QSFX 3OYIA 1IRFA 4KMFA 2M30A 4IEJA 2E5NA 2DDBA 2V79A 1RKTA 4FTHA 4CCOA 1QPMA 3KLNA 3M7GA 5J6XA 3GYHX 3LSKA 2GAUA 4I99C 1P4WA 3GEZA 3AL0C 1FEXA 3CCEI 4CXFA 2TDXA 4FETA 3GF2A 1ZHFA 2ME6A 3OSFA 3GTPJ 3WTZA 2VKDA 1RZ4A 3HGGA 2YR2A 4HZFA 2A69F 2DU9A 5DM6F 4IX7A 1WJAA 4UUSA 1VQ4I 2X0LA 2LK2A 2E1OA 2A6HF 1IXRC 3ZGKA 3OYCA 4M6YA 1WQ2A 4XIDA 1IF1A 2UUZA 4KICA 4PSXA 2DCEA 1GVJA 3BTIA 3PQKA 2ICWG 2LH9A 2WV0A 2DJIA 2H8WA 3BROA 3O3KA 1T39A 2O5RA 2FQ3A 1VZ0A 2VJJA 4V2GA 3GXOA 3KEQA 1TQMA 3QPHA 1DQUA 2P7CB 4JX4A 4YEJA 2YX7A 2V1DA 2DA2A 2L7FP 4XOTA 1WJEA 1BI3A 5EEGA 3H0DA 4LB5A 3A0HC 2V1XA 5IOYA 1B72B 1ZQ3P 1FSHA 4LLNA 4HBLA 5D5WB 3GBGA 4WK8F 2LR8A 4G7OF 3BZCA 2Y75A 1Q1VA 3JAMZ 1YJNI 2HKXA 4XM3A 2Z2SB 1B8IA 2FMLA 2MABA 4MEXF 1G4DA 3OS2A 4F55A 3I64A 1D8KA 3LAJA 1YX3A 1ZYRF 4Z2YA 2XB5A 1TL8A 1K61A 2ACJA 5DM7F 2QVOA 2DTRA 1JI8A 1F36A 1FZPB 4C3HJ 3IH4A 2FBHA 1WCMJ 4XNFA 3DEUA 5GAHJ 2MH9A 3EUKL 4WXCA 2HQ5A 4EM1A 3V8JA 1HSJA 3QYBA 3O2PE 3F6VA 1BOAA 1FJLA 2FOKA 1PUFA 4ZYGA 1KU3A 3GW2A 3LSGA 3HGYA 2CUZA 2OCCH 5BPIA 2XRLA 2FF4A 2NVQJ 4LJZF 1SD6A 3K69A 3C3WA 5D5UB 3OYBA 1FBSA 3N97A 1UG2A 1UFMA 1OCTC 1KYZA 1FMVA 4IRHA 5LHIA 1L3LA 2A68F 4DOZA 4M71A 1Z3XA 3IWFA 1U0JA 1J59A 3QYFA 3K1NA 4KIBA 2JMWA 1BR4A 1B9NA 4CYDA 4XKBA 3RKWA 5E20A 5FLXK 2W82A 3G2BA 2WTEA 2AO9A 5J40A 1VQLI 2XGDA 1YS7A 3D1NI 2Q2EB 3MD2A 4G6DA 2V1NA 1BI0A 2ZJQF 3NQOA 4I76A 3A0BC 4HNTA 5J4YA 3CO7C 1U3EM 4D1QA 5FRMA 5BOXA 3FXJA 1HW1A 3ZP5A 1U6GA 4A5MA 2FBKA 1EF4A 5FLMJ 3HC7A 2Y2ZA 1X1CA 3DWLE 2F5VA 4GO1A 4M9SA 3HRSA 3OSGA 2B7EA 2HEOA 1JTXA 3ZMTA 2HS5A 1OR7A 1G6NA 1HF0A 2ELHA 3FXOA 3K7AJ 4BL0B 5J1UA 2XC7A 4M3BA 2XRNA 3CJQB 4LGWA 2FU4A 2HDCA 4OIPF 2F48A 2E1MC 2L7ZA 2XKOA 3V42A 3L1PA 1KQ8A 2DFIA 1MBJA 4XLAA 3J81K 2O9LA 1TWFJ 1IZ1A 2E35A 2ZXHA 4YELA 2LVSA 3VEPA 4LK1F 2V9KA 3SZPA 1ETXA 1ZGWA 4LG0A 5B66C 1D0YA 2UWMA 2Y0SA 4MIMA 2D2WA 4F7ZA 5CQEA 2K4BA 2DOEA 2AQEA 4BQQA 2ZSIB 3P9CA 4OINF 1H8AC 3VODA 3OIOA 3GCMA 3A01A 5M3FJ 1VTNC 3DF8A 2RAEA 4A3DJ 4RMNA 3BJOA 3BR2A 3M8FA 3GWZA 1AKHB 2DPUA 2OCEA 5C4XJ 5H6RA 3HEFA 2XAGA 4IXAA 1AKHA 4I2OA 4EJUA 4KIFA 2RDPA 3FM5A 2L54A 4BKXA 3PO3J 1ETKA 1LJ9A 3TGNA 2L2OA 2O8KA 1VI0A 1O7FA 3DTIA 2B9SA 3HIFA 2MH2A 3E1SA 3IUOA 2V4JC 2K86A 2QKLB 1TT5B 3ZMDA 3MKLA 3M3YJ 2EINH 3E97A 1NG7A 3DTKA 2DMPA 1X4PA 2WA0A 4MHGA 4FISA 3HSEA 1B59A 2M3AA 4ASNA 2ESNA 3WG7H 1F9NA 2M87A 5TGTA 4X6AJ 2LKSA 2DK8A 1BM9A 1Y1VJ 1B72A 2R7UA 3EYYA 1NG6A 4ZYHA 5D8LB 1A6IA 1MNEA 1XCBA 2M7AA 5K7FA 3NWSA 5DDGA 3E6BA 1IRXA 1U5TB 5F0CA 1HLVA 2XF5A 1QQIA 1U5TC 4L5JA 2OF7A 2CS3A 4ENMA 1FSEA 1RUOA 2IP2A 1XGNA 1TC3C 3BZKA 2EZLA 5DUIA 4HOBA 2ZJ2A 2P81A 1BA5A 3I4NJ 4ZC3A 4E70A 3OV8A 5FKMA 1HOMA 3RYRA 5JLWA 2KJCA 3IV5A 5IOZA 4DZPA 3TBIA 1IDZA 4BY1J 2N8GA 3U2RA 4PFOA 3T8TA 2LYCA 1MMDA 2LG4A 2NRAC 1Z67A 3BZ6A 2QLZA 3EQLF 2DAOA 4HAMA 1KU7A 4WXHA 5J1RA 1ZRFA 3B73A 4S04A 4E6KG 3D5SC 1IGNA 2ID6A 5JI6A 4XLPF 1FBUA 1TWHJ 3LSRA 2R7XA 3E7LA 2JZYA 1V5EA 2XSJC 2VJIA 1HA8A 1ZGAA 4GFBA 1F43A 1MD0A 1BR2A 4D5CA 2LREA 4Y3OA 1VQ5I 1E2XA 2VASA 2XB0X 3BR0A 1V5GA 3ASOH 2XV4S 4E4HA 2NS8A 4CZZA 4V2FA 4IHXA 3ZMVA 5IYCJ 3AKZA 3NWTA 2K27A 2COMA 3WU2C 1MMGA 1FOXA 3QWLA 3LOCA 4WXDA 4CYCB 4ZTJA 2M7BA 2X48A 2R7VA 2G9WA 3TO7A 3DBRB 2W00A 1A6QA 1T38A 2GLOA 4HF2A 5ICEA 3KP7A 1DPUA 2E2JJ 1N75A 5FJ8J 2PJRA 2DBBA 1ZARA 4J00A 2R7FA 1FPQA 1VQKI 4RAFA 2FBIA 1KU2A 3JRIA 5E1ZB 1BJAA 2LP0A 3PSFA 1HW2A 2LY1A 4BXUA 2VONA 2QSGX 3L00A 2P6TA 3CUQA 2E2HJ 3H3UA 1X3ZB 3L09A 1F1ZA 1JUSA 5IPAA 2JK3A 3QAHA 1IN6A 4I01A 4XN3A 1QZZA 2EA2A 3MWMA 1OISA 1W4MA 5TISC 1J0RA 3PM1A 3PNVA 4Q5SF 3HHGA 3H92A 4XLCA 2M34A 1XG1A 2VJ4A 3AG1H 3W6KB 5D6EA 2IGNA 4XLHA 1OYYA 1A5JA 3LMMA 2HZDA 1OCOH 3KE2A 4XRSA 4IHSA 1EKEA 2WB1A 4II3A 3SFIA 2MD0A 3VYTB 1TT0A 4B1RA 1WPKA 1O3RA 4ZH4F 1WJCA 4JYKA 5FKNA 4HW0A 2R92J 1T98A 2DQLA 1XTAA 2ZNZA 2QKMB 1USTA 3S1MJ 2DJNA 1Z6TA 2CUEA 4EMSA 4E7JA 4H0EA 3GLLA 2MYSA 3F8MA 3HDDA 2P6SA 3WU0A 3SHFA 1KA8A 3FXMA 2QENA 2VODA 4V19K 1HCRA 4BY7J 1U8RA 1FNNA 1D3YA 1YX5A 5L3DA 3AG4H 5CPRB 2HDWA 1UHSA 3QOPA 2E7XA 2EFQA 1SMTA 3R6SA 1YLFA 4XR6A 2Z5UA 3OYDA 4ABZA 1TWGJ 3TDZC 4BE0A 2OV7A 4HYEA 1GV2A 4MQVA 2EA4A 2ZMEC 1Z6RA 1PYVA 3MEXA 2UZKA 2P5VA 2W1OA 3OOPA 4HV6A 2XASA 4ANJA 3E6CC 3N4MA 1IC8A 3PJRA 1UB9A 4BJ6C 5D4SA 1XSVA 3G1OA 1EJ9A 1TZLA 4IRGA 3FF5A 4LD5A 2E71A 3ZQFA 4G8XA 3CCRI 2GA2A 1ERDA 4MTDA 3DPTA 2ETHA 3QQAA 1ETVA 1RUNA 2WY7Q 2PMHA 3HUGB 4EVIA 3OYMA 1MSFC 2IS4A 3K4LA 2EIKH 4BE1A 5F6FA 3SDBA 3KP2A 5HS7A 2R93J 5CYVA 2HQRA 4HQEA 2ZNYA 4AU7A 3CF2A 3TQNA 2GOMA 2XF7A 1CGPA 2HVRA 2BGCA 1FYLA 2DYRH 3FMQA 3H5NA 4XLEA 5EDNA 2Y9ZA 3RJPA 2F6CA 5CQGA 3F23A 1JGGA 2KIQA 1HKQA 1OMIA 2VQLA 1Z21A 1BJZA 2KPMA 1RNLA 3MN2A 4XSXF 3ZQCA 4E7SA 3DQVC 1KGSA 1S29A 2DFHA 2LKPA 4M3GA 4BHPA 1Z3YA 2K9MA 1LB2A 1ZRDA 2XHKA 1T33A 1ZR2A 1Y8RB 4C3JJ 2VBXA 2OQGA 4L9JA 5DUKA 4B8XA 1FWZA 3FHZA 4ZZLA 5E1WA 4U7BA 1I50J 1OCRH 3G4SI 3FZVA 4I98B 1SFXA 1HQCA
chains in the Genus database with same CATH topology
2MGQA 4IEJA 2ID3A 2YS9A 4Y7NJ 1RKTA 2CUFA 4FTHA 1MBGA 3GTMJ 3VPRA 2B63J 3RZDJ 2D5VA 2HI3A 3JRFA 1ETYA 5C3EJ 1R9TJ 1FEXA 5E3LA 3BR5A 1FTTA 1GT0C 2DMUA 3WHBA 5F08A 1ZTRA 2ME6A 3OSFA 3GTPJ 4W1UA 4EEFG 3S1NJ 2ME0A 3HGGA 3BTLA 4L5EA 1BW5A 4AYBN 4Y52J 4MLOA 4UUSA 3BG3A 2LK2A 2E1OA 3HBLA 4A3KJ 3B6CA 4UUSB 4XIDA 2QCOA 1MH4A 3BTIA 2H8RA 2R5YB 2HYJA 5DS9A 1IUFA 4V2GA 1JTYA 1JKQC 1TWAJ 2TCTA 4JX4A 1X2NA 1W0UA 5F27A 2DA2A 1IG7A 2L7FP 3BT9A 3ZQIA 4M3FA 4IHVA 2Y9YA 3Q0WA 4QIWN 1JKPC 1B72B 5IOYA 3FIWA 1ZQ3P 3BTCA 1SFOJ 1QVTA 3GBGA 1FIAA 2LR8A 1GDTA 1RKWA 1Q1VA 1IRZA 3M4OJ 2CU7A 1ITYA 1B8IA 2O7OA 5E3MA 2NVTJ 5EYRA 5FKLA 2XB5A 2DA5A 1K61A 2MSYA 1WH7A 2GM4A 3ZQHA 1F36A 4C3HJ 3IH4A 2CJJA 1WCMJ 1Z0XA 2HQ5A 5M5XJ 1D5YA 1YRNB 2LFBA 1FJLA 5BNGA 1MH3A 2IAIA 1PUFA 2R5ZA 5GPCA 1FIPA 2E2IJ 3LSGA 3HGYA 2OPTA 2HOTA 4UUTA 2XRLA 2NVQJ 3FK6A 3BQZA 2CQXA 3LSPA 2E19A 5IP7J 1UG2A 1OCTC 5IP6A 3SJMA 2HOSA 2NVYJ 3BR1A 3MVPA 4AUXA 1CQTA 5GP9A 5E3NA 3RKQA 2MG4A 5IYDJ 2JMWA 5EGOA 1JJ6C 1G2HA 3NARA 2XPUA 3NAUA 3LSJA 4B4CA 2EQRA 5HODA 2XSDC 2LD5A 1AHDP 1U9OA 3QPLA 5E3OA 4A3CJ 4A3GJ 2DA4A 2L7MP 3ZQLA 2AO9A 4JP0A 1K83J 2XGDA 1BL0A 3F0CA 3D1NI 4M3EA 3A02A 1DU0A 2K9QA 2VUMJ 4I76A 4A3BJ 3S2HJ 3TEDA 1X58A 1NK2P 3BG5A 1E3OC 1EF4A 5FLMJ 2H1KA 3Q0UA 2Y2ZA 1VFCA 3OSGA 1JTXA 1H88C 2LY9A 2R0QC 1HF0A 2ELKA 3K7AJ 5J1UA 3K2AA 4M3BA 5IP9J 4C2MJ 1ZR4A 2HXOA 4BBRJ 1OFCX 3WHCA 4A3MJ 2L7ZA 2JA6J 3L1PA 3S15J 1MBJA 4S0HB 2O9LA 1TWFJ 1GUUA 2LVSA 1MBFA 2LKXA 1ETXA 3HOWJ 1WI3A 1ZGWA 4HNVA 2AHQA 4MIMA 3S16J 1QVUA 1ZKGA 2YU9J 1H8AC 1IDYA 1T56A 3OIOA 3HOUJ 1ZK8A 3A03A 1I3QJ 3BTJA 3A01A 5M3FJ 5EG0A 2RAEA 4AC0A 4FE4A 2QF7A 3GTLJ 4A3DJ 1AKHB 3BR2A 1U9NA 3OOUA 2X9DA 5C4XJ 3S2DJ 1GVDA 2HOAA 3JR9A 3HEFA 1AKHA 5M5WJ 3TP3A 4M3DA 1RR7A 4BKXA 3PO3J 1XS9A 1ETKA 1MBEA 1U78A 4RDUA 1ENHA 2O8KA 3TW6A 1VI0A 3CQZJ 4QSHA 3MKLA 1MBHA 3M3YJ 2K9NA 1PUFB 1I6HJ 1RETA 2DMPA 4FISA 2M2EA 2M9HA 2MW8A 3TW7A 1WH5A 1U8BA 4X6AJ 2HXIA 1Y1VJ 1B72A 3HOZJ 3DCFA 4JX5A 3B6AA 3S14J 4FCYA 1A6IA 5K7FA 5FKOA 3SDGA 5F0CA 4A3EJ 1HLVA 2DMQA 9ANTA 1LFBA 2OF7A 5EZHA 2VKVA 2VKEA 2EBIA 5FLVA 4D5FA 1TC3C 2EZLA 3HB9A 2GBYA 3RQIA 2P81A 1BA5A 2JA5J 3I4NJ 2KT0A 1QPIA 5GPAA 2HDDA 5FKMA 4BBSJ 2LTPA 2NVXJ 1HOMA 5JLWA 3IV5A 5IOZA 4DZPA 1ETWA 5M3MJ 1IDZA 4BY1J 2N8GA 3G1MA 1LE8B 3HOYJ 3JRDA 1FTZA 3JRHA 5K7ZA 2EZHA 2XPWA 3QPSA 2DTZA 4DYRA 3JRBA 3BG9A 2WAQN 5J1RA 4MFEA 1XC5A 1JUPA 1IGNA 2ID6A 4DZJA 1TWCJ 1JT0A 4MFDA 4DYQA 3GTKJ 1TWHJ 3LSRA 3E7LA 5EGOB 2TRTA 2YUSA 1OCPA 4GFBA 3RZOJ 1ETQA 1JUMA 1F43A 4D5CA 5F0FA 2G0EA 1JKOC 2XB0X 3BR0A 2R5YA 4M6VA 4LOCA 2NS8A 3HOVJ 3W6VA 1Z77A 4V2FA 4IHXA 5F04A 5EF6A 3GTOJ 3JRGA 1LE8A 5IYCJ 3O8HA 1QRYA 2KDZA 1YRNA 2R7ZJ 2DA6A 1DU6A 3LOCA 4CYCB 3BR3A 2X48A 1IJWC 2Y0SN 1WGXA 4XRMA 1UMQA 3CMYA 2GLOA 1P7JA 1HDPA 2IEKA 5C44J 3HOXJ 3LNQA 2E2JJ 2DA7A 2FQ4A 5FJ8J 4DYCA 2EH3A 4MO7A 4CYCA 2CQQA 4A3IJ 3GTQJ 4A3LJ 1SANA 3FISA 1JJ8C 1AU7A 4X1EA 3JRIA 4A3JJ 3ZQGA 2LP0A 2JA7J 1HDDC 2JJ7A 5J1YA 2ECBA 3IH3A 2EZIA 1X2MA 2EZKA 2VPRA 5F0HA 4IHYA 3I4MJ 3FK7A 2E2HJ 5IPAA 3TP0A 1JUSA 5FKKA 2JK3A 2DMNA 4XK4A 4D7MA 1B8IB 1VF9A 4NDLA 3BR6A 5EEAA 2K40A 1MNMC 2IBDA 3PM1A 2DN0A 2M34A 1XG1A 2DA3A 5M5YJ 4DW6A 3JRCA 3A01B 3FKIJ 5EZGA 3PO2J 1H89C 3C2BA 1MSEC 3GTGJ 3IH2A 2PMZN 4FE7A 1A5JA 4XRSA 3HKZN 3SFIA 2LLKA 2FD5A 4B1RA 1WPKA 3Q0VA 4JYKA 3HM5A 1ORKA 5FKNA 4I6ZA 2R92J 1IV6A 5C4JJ 3S1MJ 2DJNA 3UKGA 2CUEA 2WB1N 3CDLA 3HDDA 4BXXJ 4XRSG 1MBKA 1Y1WJ 2NS7A 1O4XA 1HCRA 2FJ1A 2ZB9A 4BY7J 1BW6A 1UHSA 2M8GX 2WV1A 2JN6A 5IYBJ 1ETOA 1VNDA 4A3FJ 4ABZA 2XGCA 1TWGJ 3O8GA 4W97A 5DTDA 1RPWA 1S7EA 3BQYA 1GV2A 4QTRA 2L9RA 2XGEA 2ECCA 1IC8A 4A69C 3G1OA 2M0CA 1NTCA 2XPVA 3ZQFA 2X6OA 1JT6A 3H3VK 1OJLA 2I10A 3QQAA 2COBA 1ETVA 1RESA 4RBOA 1MSFC 1POGA 4B3AA 2FX0A 5K7HA 1JKRC 2R93J 3JRAA 3DEWA 4G12A 5JLXA 3JREA 3S1QJ 4IHWA 3Q3SA 3H0GJ 2NOGA 5F1JA 2Y31A 2DA1A 5J3LA 3G1LA 5EDNA 1GV5A 2Y9ZA 2JWTA 2JA8J 2Y30A 4XICA 1NK3P 1JGGA 3S1RJ 1P7IA 2CRGA 2L0KA 3CCYA 1BJZA 3MN2A 3ZQCA 2DMTA 5EG0B 4M3GA 4D7NA 3S17J 4A93J 1T33A 1ZR2A 3GTJJ 4JX6A 4C3JJ 2R5ZB 1APLC 4J19A 4C3IJ 1W0TA 2VI6A 1I50J 2K9SA 1LFUP 2W48A 3ZOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGQ A;  4IEJ A;  2ID3 A;  2YS9 A;  4Y7N J;  1RKT A;  2CUF A;  4FTH A;  1MBG A;  3GTM J;  3VPR A;  2B63 J;  3RZD J;  2D5V A;  2HI3 A;  3JRF A;  1ETY A;  5C3E J;  1R9T J;  1FEX A;  5E3L A;  3BR5 A;  1FTT A;  1GT0 C;  2DMU A;  3WHB A;  5F08 A;  1ZTR A;  2ME6 A;  3OSF A;  3GTP J;  4W1U A;  4EEF G;  3S1N J;  2ME0 A;  3HGG A;  3BTL A;  4L5E A;  1BW5 A;  4AYB N;  4Y52 J;  4MLO A;  4UUS A;  3BG3 A;  2LK2 A;  2E1O A;  3HBL A;  4A3K J;  3B6C A;  4UUS B;  4XID A;  2QCO A;  1MH4 A;  3BTI A;  2H8R A;  2R5Y B;  2HYJ A;  5DS9 A;  1IUF A;  4V2G A;  1JTY A;  1JKQ C;  1TWA J;  2TCT A;  4JX4 A;  1X2N A;  1W0U A;  5F27 A;  2DA2 A;  1IG7 A;  2L7F P;  3BT9 A;  3ZQI A;  4M3F A;  4IHV A;  2Y9Y A;  3Q0W A;  4QIW N;  1JKP C;  1B72 B;  5IOY A;  3FIW A;  1ZQ3 P;  3BTC A;  1SFO J;  1QVT A;  3GBG A;  1FIA A;  2LR8 A;  1GDT A;  1RKW A;  1Q1V A;  1IRZ A;  3M4O J;  2CU7 A;  1ITY A;  1B8I A;  2O7O A;  5E3M A;  2NVT J;  5EYR A;  5FKL A;  2XB5 A;  2DA5 A;  1K61 A;  2MSY A;  1WH7 A;  2GM4 A;  3ZQH A;  1F36 A;  4C3H J;  3IH4 A;  2CJJ A;  1WCM J;  1Z0X A;  2HQ5 A;  5M5X J;  1D5Y A;  1YRN B;  2LFB A;  1FJL A;  5BNG A;  1MH3 A;  2IAI A;  1PUF A;  2R5Z A;  5GPC A;  1FIP A;  2E2I J;  3LSG A;  3HGY A;  2OPT A;  2HOT A;  4UUT A;  2XRL A;  2NVQ J;  3FK6 A;  3BQZ A;  2CQX A;  3LSP A;  2E19 A;  5IP7 J;  1UG2 A;  1OCT C;  5IP6 A;  3SJM A;  2HOS A;  2NVY J;  3BR1 A;  3MVP A;  4AUX A;  1CQT A;  5GP9 A;  5E3N A;  3RKQ A;  2MG4 A;  5IYD J;  2JMW A;  5EGO A;  1JJ6 C;  1G2H A;  3NAR A;  2XPU A;  3NAU A;  3LSJ A;  4B4C A;  2EQR A;  5HOD A;  2XSD C;  2LD5 A;  1AHD P;  1U9O A;  3QPL A;  5E3O A;  4A3C J;  4A3G J;  2DA4 A;  2L7M P;  3ZQL A;  2AO9 A;  4JP0 A;  1K83 J;  2XGD A;  1BL0 A;  3F0C A;  3D1N I;  4M3E A;  3A02 A;  1DU0 A;  2K9Q A;  2VUM J;  4I76 A;  4A3B J;  3S2H J;  3TED A;  1X58 A;  1NK2 P;  3BG5 A;  1E3O C;  1EF4 A;  5FLM J;  2H1K A;  3Q0U A;  2Y2Z A;  1VFC A;  3OSG A;  1JTX A;  1H88 C;  2LY9 A;  2R0Q C;  1HF0 A;  2ELK A;  3K7A J;  5J1U A;  3K2A A;  4M3B A;  5IP9 J;  4C2M J;  1ZR4 A;  2HXO A;  4BBR J;  1OFC X;  3WHC A;  4A3M J;  2L7Z A;  2JA6 J;  3L1P A;  3S15 J;  1MBJ A;  4S0H B;  2O9L A;  1TWF J;  1GUU A;  2LVS A;  1MBF A;  2LKX A;  1ETX A;  3HOW J;  1WI3 A;  1ZGW A;  4HNV A;  2AHQ A;  4MIM A;  3S16 J;  1QVU A;  1ZKG A;  2YU9 J;  1H8A C;  1IDY A;  1T56 A;  3OIO A;  3HOU J;  1ZK8 A;  3A03 A;  1I3Q J;  3BTJ A;  3A01 A;  5M3F J;  5EG0 A;  2RAE A;  4AC0 A;  4FE4 A;  2QF7 A;  3GTL J;  4A3D J;  1AKH B;  3BR2 A;  1U9N A;  3OOU A;  2X9D A;  5C4X J;  3S2D J;  1GVD A;  2HOA A;  3JR9 A;  3HEF A;  1AKH A;  5M5W J;  3TP3 A;  4M3D A;  1RR7 A;  4BKX A;  3PO3 J;  1XS9 A;  1ETK A;  1MBE A;  1U78 A;  4RDU A;  1ENH A;  2O8K A;  3TW6 A;  1VI0 A;  3CQZ J;  4QSH A;  3MKL A;  1MBH A;  3M3Y J;  2K9N A;  1PUF B;  1I6H J;  1RET A;  2DMP A;  4FIS A;  2M2E A;  2M9H A;  2MW8 A;  3TW7 A;  1WH5 A;  1U8B A;  4X6A J;  2HXI A;  1Y1V J;  1B72 A;  3HOZ J;  3DCF A;  4JX5 A;  3B6A A;  3S14 J;  4FCY A;  1A6I A;  5K7F A;  5FKO A;  3SDG A;  5F0C A;  4A3E J;  1HLV A;  2DMQ A;  9ANT A;  1LFB A;  2OF7 A;  5EZH A;  2VKV A;  2VKE A;  2EBI A;  5FLV A;  4D5F A;  1TC3 C;  2EZL A;  3HB9 A;  2GBY A;  3RQI A;  2P81 A;  1BA5 A;  2JA5 J;  3I4N J;  2KT0 A;  1QPI A;  5GPA A;  2HDD A;  5FKM A;  4BBS J;  2LTP A;  2NVX J;  1HOM A;  5JLW A;  3IV5 A;  5IOZ A;  4DZP A;  1ETW A;  5M3M J;  1IDZ A;  4BY1 J;  2N8G A;  3G1M A;  1LE8 B;  3HOY J;  3JRD A;  1FTZ A;  3JRH A;  5K7Z A;  2EZH A;  2XPW A;  3QPS A;  2DTZ A;  4DYR A;  3JRB A;  3BG9 A;  2WAQ N;  5J1R A;  4MFE A;  1XC5 A;  1JUP A;  1IGN A;  2ID6 A;  4DZJ A;  1TWC J;  1JT0 A;  4MFD A;  4DYQ A;  3GTK J;  1TWH J;  3LSR A;  3E7L A;  5EGO B;  2TRT A;  2YUS A;  1OCP A;  4GFB A;  3RZO J;  1ETQ A;  1JUM A;  1F43 A;  4D5C A;  5F0F A;  2G0E A;  1JKO C;  2XB0 X;  3BR0 A;  2R5Y A;  4M6V A;  4LOC A;  2NS8 A;  3HOV J;  3W6V A;  1Z77 A;  4V2F A;  4IHX A;  5F04 A;  5EF6 A;  3GTO J;  3JRG A;  1LE8 A;  5IYC J;  3O8H A;  1QRY A;  2KDZ A;  1YRN A;  2R7Z J;  2DA6 A;  1DU6 A;  3LOC A;  4CYC B;  3BR3 A;  2X48 A;  1IJW C;  2Y0S N;  1WGX A;  4XRM A;  1UMQ A;  3CMY A;  2GLO A;  1P7J A;  1HDP A;  2IEK A;  5C44 J;  3HOX J;  3LNQ A;  2E2J J;  2DA7 A;  2FQ4 A;  5FJ8 J;  4DYC A;  2EH3 A;  4MO7 A;  4CYC A;  2CQQ A;  4A3I J;  3GTQ J;  4A3L J;  1SAN A;  3FIS A;  1JJ8 C;  1AU7 A;  4X1E A;  3JRI A;  4A3J J;  3ZQG A;  2LP0 A;  2JA7 J;  1HDD C;  2JJ7 A;  5J1Y A;  2ECB A;  3IH3 A;  2EZI A;  1X2M A;  2EZK A;  2VPR A;  5F0H A;  4IHY A;  3I4M J;  3FK7 A;  2E2H J;  5IPA A;  3TP0 A;  1JUS A;  5FKK A;  2JK3 A;  2DMN A;  4XK4 A;  4D7M A;  1B8I B;  1VF9 A;  4NDL A;  3BR6 A;  5EEA A;  2K40 A;  1MNM C;  2IBD A;  3PM1 A;  2DN0 A;  2M34 A;  1XG1 A;  2DA3 A;  5M5Y J;  4DW6 A;  3JRC A;  3A01 B;  3FKI J;  5EZG A;  3PO2 J;  1H89 C;  3C2B A;  1MSE C;  3GTG J;  3IH2 A;  2PMZ N;  4FE7 A;  1A5J A;  4XRS A;  3HKZ N;  3SFI A;  2LLK A;  2FD5 A;  4B1R A;  1WPK A;  3Q0V A;  4JYK A;  3HM5 A;  1ORK A;  5FKN A;  4I6Z A;  2R92 J;  1IV6 A;  5C4J J;  3S1M J;  2DJN A;  3UKG A;  2CUE A;  2WB1 N;  3CDL A;  3HDD A;  4BXX J;  4XRS G;  1MBK A;  1Y1W J;  2NS7 A;  1O4X A;  1HCR A;  2FJ1 A;  2ZB9 A;  4BY7 J;  1BW6 A;  1UHS A;  2M8G X;  2WV1 A;  2JN6 A;  5IYB J;  1ETO A;  1VND A;  4A3F J;  4ABZ A;  2XGC A;  1TWG J;  3O8G A;  4W97 A;  5DTD A;  1RPW A;  1S7E A;  3BQY A;  1GV2 A;  4QTR A;  2L9R A;  2XGE A;  2ECC A;  1IC8 A;  4A69 C;  3G1O A;  2M0C A;  1NTC A;  2XPV A;  3ZQF A;  2X6O A;  1JT6 A;  3H3V K;  1OJL A;  2I10 A;  3QQA A;  2COB A;  1ETV A;  1RES A;  4RBO A;  1MSF C;  1POG A;  4B3A A;  2FX0 A;  5K7H A;  1JKR C;  2R93 J;  3JRA A;  3DEW A;  4G12 A;  5JLX A;  3JRE A;  3S1Q J;  4IHW A;  3Q3S A;  3H0G J;  2NOG A;  5F1J A;  2Y31 A;  2DA1 A;  5J3L A;  3G1L A;  5EDN A;  1GV5 A;  2Y9Z A;  2JWT A;  2JA8 J;  2Y30 A;  4XIC A;  1NK3 P;  1JGG A;  3S1R J;  1P7I A;  2CRG A;  2L0K A;  3CCY A;  1BJZ A;  3MN2 A;  3ZQC A;  2DMT A;  5EG0 B;  4M3G A;  4D7N A;  3S17 J;  4A93 J;  1T33 A;  1ZR2 A;  3GTJ J;  4JX6 A;  4C3J J;  2R5Z B;  1APL C;  4J19 A;  4C3I J;  1W0T A;  2VI6 A;  1I50 J;  2K9S A;  1LFU P;  2W48 A;  3ZOB A; 
#chains in the Genus database with same CATH topology
 4YFX F;  2MGQ A;  2ID3 A;  4KIS A;  3BC8 A;  2RGV A;  2KFD A;  2CUF A;  3C1D A;  1Y0N A;  3BPV A;  4E7L A;  1UG0 A;  1DPR A;  3GTM J;  3VPR A;  4AID A;  2D5V A;  2IGM A;  2HI3 A;  3CCJ I;  1O3S A;  5E3L A;  1QZY A;  1YJW I;  4XMY A;  1A35 A;  1FTT A;  4IO9 F;  5KAF C;  3ZPL A;  2DMU A;  3RKX A;  5F08 A;  4ENJ A;  3I58 A;  3K6G A;  3AG2 H;  4A5N A;  3S1N J;  2CV1 A;  3BTL A;  5D8K B;  1MND A;  1JHH A;  1BW5 A;  4ZDL A;  3ZRG A;  4AYB N;  4Y52 J;  2JRM A;  2KHM A;  4YFK F;  3TKY A;  3I71 A;  4CIC A;  4A3K J;  2G7U A;  3DFG A;  2A5W A;  3I0T A;  1T0F C;  2Q2E A;  2P5L C;  4F92 B;  4LLL A;  3I53 A;  3I56 I;  1S8N A;  2R5Y B;  1B4A A;  2HYJ A;  2FEZ A;  2GQQ A;  2HVQ A;  2OAZ A;  2HKO A;  5DS9 A;  2CV2 A;  3RQ4 A;  2HNH A;  4RB0 A;  2IXS A;  4OAZ A;  1EH7 A;  3KFW X;  2A6E F;  2VKH A;  4YG2 F;  2V7F A;  1X2N A;  5F27 A;  3E5Q A;  1BC7 C;  3F8C A;  5LEJ A;  2HFH A;  3L7W A;  4B09 A;  1E17 A;  4M3F A;  5JFR A;  3I9V 2;  1JKP C;  4ZYE A;  2Z16 A;  3RYP A;  3CUQ C;  5FGM A;  3IKT A;  1MGT A;  1X19 A;  1QVT A;  2IJL A;  1FIA A;  3ZQQ A;  1RKW A;  3D0S A;  3JW4 A;  2VL8 A;  1IRZ A;  3PFY A;  4PZJ A;  4F52 A;  4Q4Z F;  5E18 F;  1ITY A;  5HDK A;  1X3U A;  2O7O A;  4HST A;  4R1H A;  4ZTF A;  2PLY A;  2KIM A;  1R58 A;  2CWE A;  5FKL A;  2PBI A;  1UHM A;  2MSY A;  5LGU A;  2HGC A;  3CLQ A;  4P5O A;  4IQ4 A;  1FBQ A;  2CJJ A;  2BBY A;  5JHU A;  1MJA A;  4NBQ A;  2BY3 A;  2XUB A;  3KP6 A;  5HS8 A;  1FC3 A;  3TO6 A;  4KUM A;  4LIU A;  1YRN B;  5B1A H;  3WGI A;  3L2U A;  3HRT A;  4KNY A;  5BNG A;  3SYT A;  2H6B A;  2FNP A;  2L3D A;  2E2I J;  4IOC F;  2RQQ A;  3OYL A;  4UY8 I;  2RNJ A;  1P9Q C;  3H35 A;  3HTU A;  3FK6 A;  4HLY A;  3MCZ A;  2CYY A;  2E19 A;  5IP7 J;  4ENN A;  4PK4 A;  4UB6 C;  2RVC A;  3LST A;  3MVP A;  4CSW A;  5IY5 H;  1K6O A;  5E3N A;  3CZ6 A;  4XKW A;  1W5C C;  2EV0 A;  4Z6Y A;  3BPX A;  3KEO A;  3CCS I;  2MG4 A;  3RKQ A;  4IQJ A;  3FBN B;  3EDP A;  5EGO A;  1T2K A;  2RRE A;  2XPU A;  3NAU A;  1SMY F;  1LKX A;  4XOR A;  3V8K A;  2VC1 A;  4B4C A;  4OIQ F;  4BH9 A;  1SD4 A;  2QM3 A;  2LD5 A;  1AHD P;  2CV0 A;  1U9O A;  5E3O A;  4XLF A;  3OS1 A;  3J7Y J;  4HEA 2;  1K83 J;  4JBA A;  4FX4 A;  1R23 A;  2JQ7 A;  1R1T A;  3F8B A;  1YW9 A;  4AD9 A;  2WAE A;  5AON A;  3F6O A;  2PI0 A;  1E3O C;  5J8C A;  2LBF A;  1GHC A;  3IRR A;  2H1K A;  2L9V A;  1LUJ B;  1XGO A;  2KMU A;  5HNF A;  4IZZ A;  2OTL I;  3KZZ A;  1R5H A;  2OBP A;  3ZMS A;  1KU9 A;  1UHW A;  5CVJ A;  2QQA A;  1DP7 P;  2FE3 A;  2Z99 A;  4C2M J;  5KHD A;  2DO7 A;  5K5Q A;  3MMY B;  2RKH A;  4EV0 A;  3WHC A;  3V7C A;  4BAY A;  1H0M A;  3J7A O;  2XKP A;  2YX4 A;  1ZG3 A;  3HG9 A;  2VOO A;  2HWV A;  4GRI A;  3V4G A;  3BG6 A;  5JR3 A;  2EIL H;  3WOD F;  3CLO A;  1XMX A;  2AHQ A;  2XF6 A;  3SEZ A;  1YYV A;  2JVG A;  2E5Z A;  1ZKG A;  2YU9 J;  1IDY A;  3HHH A;  1IRG A;  1ZK8 A;  3A03 A;  1I3Q J;  3P9K A;  4Y15 A;  3VOE A;  2DXI A;  2JUC A;  3GTL J;  1DDN A;  1OR7 C;  1P6R A;  1U9N A;  2MA3 A;  3WU1 B;  4PJJ A;  1D0Z A;  1GVD A;  2HOA A;  3S2D J;  2XAU A;  1YFH A;  5M5W J;  3TP3 A;  1W1W E;  1N78 A;  4U87 A;  1MBE A;  2A3S A;  1A31 A;  1FOK A;  4ESJ A;  4RDU A;  2XRO A;  3ZCO A;  3KYL A;  1ZH5 A;  3TW6 A;  2L02 A;  3H5R A;  1ZAO A;  2DT7 B;  3IP4 B;  3CCV I;  2CSO A;  5FRO A;  2Q0O A;  2EFW A;  5DD4 A;  4Y17 A;  1FP2 A;  1MBH A;  4Q48 A;  1LEA A;  1RET A;  4IHT A;  2VJ5 A;  1W5T A;  3GZ6 A;  2IS1 A;  3MZ8 A;  5CJ9 A;  2MD5 A;  1WH5 A;  3DLA A;  2RN7 A;  2HXI A;  2HVS A;  2RNG A;  4RM3 A;  2J5P A;  3HOZ J;  3K4B A;  2XVC A;  4CHU A;  3B6A A;  3MKZ A;  4FCY A;  1OCC H;  3ML6 A;  2V6E A;  4AIJ A;  1A04 A;  2MLG A;  1WFX A;  2VIX A;  3A2K A;  3SDG A;  4BJ5 C;  3K4K A;  2ZBK A;  1Z05 A;  1LFB A;  4HF0 A;  2BY0 A;  2QBY B;  3PUB A;  2O6G E;  2VKV A;  4M9Z A;  3WTY C;  4HLX A;  3UNG C;  5FLV A;  4LFU A;  1ZRE A;  1YS6 A;  2KJB A;  2Y48 A;  4CCL A;  3HB9 A;  5LHG A;  2L7K A;  1J09 A;  4QWQ A;  4FAS D;  1YE9 A;  2BVM A;  2QUF A;  2JA5 J;  2KT0 A;  3GFJ A;  4XRF A;  3JCU C;  2LTP A;  2PMZ A;  4CA0 A;  1S6L A;  2WBM A;  5L3C A;  2BYV E;  5M3M J;  3Q5F A;  2DDA A;  1FY7 A;  3K4J A;  2PN6 A;  2KDO A;  3BWG A;  1D5V A;  2HU9 A;  3JRH A;  2VN2 A;  2EZH A;  3QPS A;  4KMU X;  1SVO A;  3C2G A;  2EWN A;  3OL4 A;  4MFE A;  1XC5 A;  3ERM A;  1WKM A;  4KT5 C;  3VSK A;  5DCM B;  4DZJ A;  3QYE A;  3PNY A;  1LVK A;  1T08 B;  4C2T A;  1W5S A;  2TRT A;  5CVI A;  3QRF F;  1SC7 A;  1STZ A;  2YUS A;  3TDU C;  2W57 A;  4XN0 A;  1JUM A;  2ISZ A;  4I0B A;  3M8J A;  3ABK H;  4RAY A;  1JKO C;  4ENK A;  4UHT A;  1ZG5 A;  1YOV B;  2R5Y A;  2PX9 A;  3HOV J;  3W6V A;  1R5I D;  1XMK A;  2ZKZ A;  2E1N A;  2LF8 A;  1BOB A;  5F04 A;  5EF6 A;  1W7P A;  1LE8 A;  4CUG A;  1KON A;  1TBX A;  4O6J A;  4HX8 A;  2P4W A;  1MZB A;  3FXL A;  3F8F A;  3DU5 A;  3EYI A;  1DU6 A;  5ERI A;  2PJR B;  2Y69 H;  2IT0 A;  4XRM A;  1UMQ A;  2CW8 A;  2NAZ A;  2ZXI A;  2NNN A;  3H5A A;  1HDP A;  2IEK A;  2LBF B;  1R71 A;  2L9N A;  3LNQ A;  3IHU A;  3KEY A;  1YIT I;  3ECO A;  2VBW A;  4DYC A;  4CYC A;  3R60 A;  4A3I J;  1TLH B;  2CQQ A;  2R7T A;  2W7N A;  2KKO A;  2M4G A;  3FMS A;  4A3L J;  1JJ8 C;  2F5F A;  1V4R A;  4KDP A;  2IGO A;  4X1E A;  4A3J J;  3EPZ A;  1UZC A;  2MFZ A;  1HDD C;  2HTJ A;  4EM0 B;  1QA6 A;  5IT9 Z;  2FNA A;  2E36 A;  2BY2 A;  1XX5 A;  1X2M A;  2EZI A;  3B02 A;  4P96 A;  4IHY A;  4AIH A;  1YQA A;  4FHT A;  4BGD A;  2DMN A;  4NC7 A;  4D7M A;  2QWW A;  1KQ0 A;  2WAQ A;  4NDL A;  1CF7 A;  2EPF A;  3ZN0 A;  2D45 A;  3RPU D;  3P7N A;  5F1R A;  5M5Y J;  5KNL A;  3A01 B;  2L4A A;  3ABM H;  3PQJ A;  4BUP A;  1ZLJ A;  4WWC A;  1RI7 A;  3IAS 2;  1LVA A;  3C2B A;  1H89 C;  1MSE C;  4L0Y B;  2PMZ N;  4BEH B;  3VWB A;  4TV7 A;  4ESB A;  2IS6 A;  2JA2 A;  3T1B A;  2LRD A;  1Y6I A;  2K4J A;  4UXN A;  2CFX A;  4HX4 A;  1J2X A;  1QNT A;  2HQN A;  2VC0 A;  1ORK A;  4I6Z A;  1O3T A;  2ISY A;  5ED4 A;  3FX3 A;  5C4J J;  3UKG A;  5FD5 A;  1G3T A;  2DT6 A;  4PJ0 C;  1KYW A;  3P9I A;  5ILS A;  2WB1 N;  3CDL A;  3RSN A;  2VE9 A;  5KAI C;  4HV5 A;  4XRS G;  1XPX A;  1OPC A;  1O4X A;  2FJ1 A;  4G94 A;  1VQM I;  2CQ7 A;  2PEX A;  2R7S A;  2LSO A;  5D5V B;  2M8G X;  2OA4 A;  2WV1 A;  3I59 A;  3FHN A;  4NQW B;  2F5D A;  4A3F J;  5FRN A;  2DOF A;  3O8G A;  1ON2 A;  1IN5 A;  4OOI A;  4W97 A;  3MZH A;  1S7E A;  3BQY A;  4KJZ A;  4HRI A;  1S7A A;  5GTI C;  3GME A;  1ZGJ A;  4UV8 A;  4ZJZ A;  4HPQ A;  4QTR A;  1WZ2 A;  3CCQ I;  4NHJ A;  1TNT A;  2XAQ A;  2F2E A;  4NUB A;  3VSL A;  5HLT A;  4C30 A;  2OU2 A;  1WSU A;  1NH3 A;  2X6O A;  2X6X A;  3H3V K;  1OJL A;  4P1W A;  2LDU A;  5D4R A;  2STT A;  2COB A;  1RES A;  5L3F A;  1D8J A;  3WTU C;  4RBO A;  4ETS A;  3CC2 I;  3PNT A;  2GWR A;  3F9K A;  4ZYA A;  5HDN A;  5LRS A;  2WAF A;  4B3A A;  4IKF A;  1K78 A;  3OWT A;  1VQ6 I;  4CCN A;  1JKR C;  1R22 A;  4I02 A;  5KVR A;  5K5R A;  2OJE D;  3DEW A;  4G12 A;  5JLX A;  1AOY A;  1S7O A;  3HL2 A;  1Y39 A;  3BOQ A;  4IHW A;  3S1Q J;  1XD7 A;  2ZXW H;  5F1J A;  3DBL B;  2E1C A;  4U88 A;  1FT9 A;  4EJW A;  1SVL A;  3G1L A;  5FO5 A;  3I54 A;  1GV5 A;  2JWT A;  1Y56 A;  4CO8 A;  3S1R J;  2CRG A;  3KZY A;  2BHY A;  2EFP A;  5EG0 B;  4OMZ A;  3QP5 A;  2CUJ A;  3SFZ A;  1W7P D;  5EEH A;  3HSR A;  2IS2 A;  3OY9 A;  4A93 J;  2D1H A;  1ZG1 A;  2JSP A;  2R5Z B;  4C3I J;  2K9S A;  3ZOB A;  1SVM A;  3CMA I;  1XB4 A;  2YS9 A;  1S9H A;  4FQG A;  4Y7N J;  2VQH A;  4F93 B;  4J01 A;  1TW3 A;  2R4G A;  3BG7 A;  2HZT A;  3OYN A;  3OYF A;  2B63 J;  3RZD J;  3JRF A;  2VE8 A;  1I27 A;  3ABL H;  3BR5 A;  4MGR A;  1NHA A;  2GXG A;  1J5Y A;  1RC9 A;  3ZXS A;  1I5Z A;  2Q1Z B;  3WHB A;  4NB5 A;  3PFI A;  5ICC A;  3L2V A;  4EEF G;  1VQ8 I;  2ME0 A;  3WE2 A;  1BR1 A;  3KP5 A;  4L5E A;  2GIV A;  5JVT A;  1H9G A;  2OQR A;  1V54 H;  3B6C A;  4B47 A;  3MZY A;  3RTR A;  4UUS B;  4PJL A;  4WX9 A;  1RIO H;  1IN4 A;  1SAU A;  2H8R A;  1Z91 A;  3SZT A;  1R4N B;  2NS0 A;  4Y33 A;  5DD8 A;  2NVU B;  4BYY A;  2LC2 A;  1HKT A;  1JTY A;  3HUG A;  4BXF A;  1JKQ C;  4UVC A;  2TCT A;  1W0U A;  1IG7 A;  2VT2 A;  4IHV A;  3OYJ A;  2CH0 A;  3CCM I;  3FIW A;  1FOY A;  3BTC A;  1HBX G;  2K85 A;  4CZC A;  2GZW A;  1GDT A;  5A2Q K;  2Q8K A;  2VBY A;  3JSP A;  5HOO A;  4XSZ F;  1K79 A;  1P92 A;  3BCB A;  4E7H A;  2CU7 A;  3CD6 I;  2H27 A;  5J8F A;  2BOL A;  1IUY A;  2R7O A;  2NVT J;  2E60 A;  3MQ0 A;  1KQ9 A;  1P4X A;  5EYR A;  1WI9 A;  1H9T A;  4KIT B;  3EUH A;  1AWC A;  3CCU I;  3ECH A;  4XL9 A;  4F91 B;  4G7H F;  2GM4 A;  1QU3 A;  2OZ6 A;  3ZQH A;  5BMZ A;  4XKC A;  3S3N A;  3QU3 A;  5HVQ C;  3D5R C;  1Z0X A;  4HX7 A;  5JVG F;  5B5E C;  1R00 A;  3FBI B;  1D5Y A;  3KYD B;  2A5Y B;  3S32 A;  2H09 A;  1MH3 A;  3AL0 B;  2R5Z A;  2KZV A;  1FIP A;  2B0L A;  5L3B A;  2OPT A;  1X1D A;  4UUT A;  4DQ2 A;  1N25 A;  2HQA A;  3CP2 A;  4RAG A;  4PJM A;  3ROU A;  2CQN A;  4B48 A;  2QEX I;  1DP3 A;  3GUD A;  4II2 A;  4BE2 A;  3CJN A;  2IW5 A;  4XLN F;  5B3S H;  2BW3 B;  1R1U A;  3SJM A;  3VYR B;  3DBH B;  2X51 A;  4AUX A;  3CME I;  4AIK A;  1CQT A;  3LFU A;  3GZ5 A;  4ITV A;  5GP9 A;  2GA1 A;  2K7L A;  5K5O A;  1ZRC A;  1G2H A;  1ZN2 A;  3NAR A;  4P9F A;  5AIQ A;  1LQ1 A;  2V9V A;  3LSJ A;  4NC6 A;  2EQR A;  5HOD A;  4I7H A;  4P9U A;  4YFN F;  4ZDP A;  4A3C J;  2CGP A;  2DA4 A;  3ZQL A;  2M5W A;  3F0C A;  5CLS A;  1DU0 A;  4AWX B;  3S2H J;  4NQW A;  3KIO A;  1NK2 P;  4WF2 A;  4OAY A;  3BG5 A;  1D1B A;  2EFN A;  1IO2 A;  1K6Y A;  4U0Y A;  1IXS B;  3CCL I;  3OR1 C;  1YHQ I;  2BVL A;  4N4O B;  4N9H A;  4PFP A;  4U0V A;  3Q0U A;  1PP8 F;  2IA0 A;  3I55 I;  1D1A A;  4A6E A;  2R7W A;  2F4I A;  1VFC A;  5CVU A;  4Q47 A;  5ILU A;  4E7I A;  1J7K A;  4B3X A;  1H88 C;  5E79 C;  1X3W B;  1SFK A;  1PP7 U;  3K2A A;  1CF7 B;  1PDN C;  5IP9 J;  1ZR4 A;  5IT9 K;  3ONQ A;  2HXO A;  4PJN A;  3K10 A;  4BBR J;  3MKY B;  2V26 A;  5GAG J;  4A3M J;  3RPQ A;  1QBJ A;  1K78 B;  1B6A A;  2HPM A;  2JSC A;  2EJR A;  2ZO4 A;  3GO5 A;  1C0W A;  1EV7 A;  3DTE A;  2KL4 A;  1K4T A;  3TO9 A;  2LKX A;  4L9V A;  1MDM B;  1QO0 D;  1WI3 A;  1K7A A;  4HNU A;  1MIJ A;  3T8R A;  5LBQ A;  2L5Q A;  3RCO A;  1FMW A;  1I6X A;  4IVN A;  5TRD A;  2JVH A;  2QQ8 A;  1T56 A;  3HOU J;  2FA5 A;  5EG0 A;  1F5T A;  1PVE A;  4KT6 A;  4FE4 A;  2QF7 A;  1FOW A;  3E0J B;  1TQP A;  4Y4R A;  3JR9 A;  5LFA A;  1LNW A;  2WAD A;  1RR7 A;  3CC4 I;  1XS9 A;  2DOD A;  1V3F A;  4GDF A;  2DK5 A;  4MTE A;  2KRH A;  3U1K A;  4GXO A;  3ERE D;  4QSH A;  4BU2 A;  2QQ9 A;  3GFI A;  4YIR X;  3L2C A;  2QQB A;  1I6H J;  4QPQ A;  4OMY A;  1JGS A;  1QGP A;  1WJF A;  4ESF A;  2M2E A;  3VFZ A;  3JTH A;  5H2F C;  2MW8 A;  3I3L A;  4KFC A;  1K4S A;  4UUV A;  2E7W A;  1LDD A;  2VBZ A;  3MFK A;  4RGU A;  2KQR A;  3DCF A;  3WTW C;  3S14 J;  1HXD A;  3M8E A;  2DYS H;  2F4O B;  4E7Z A;  2LNB A;  2I8D A;  5DCF A;  4A3E J;  2Y0M A;  4WCG A;  2VPL A;  1OYI A;  2VXD A;  2X1E A;  3M1C A;  3L2W A;  3ABT A;  2O8X A;  2VKE A;  2X85 A;  3BP8 A;  2ZFW A;  4B43 A;  3WGH A;  2GBY A;  1V5F A;  1YW7 A;  2HPI A;  3J81 Z;  1ZLK A;  2GXB A;  3BCA A;  4ZZD A;  2F5C A;  5LGT A;  1QPI A;  5GPA A;  1P2F A;  3EUA A;  3KZI C;  3WE3 A;  2NVX J;  3FWE A;  2FRH A;  1ETW A;  2P7V B;  4JK1 X;  4A2U A;  3T5X A;  2P5K A;  2NYX A;  1BI2 A;  1XGM A;  1W7P B;  3G1M A;  4I0A A;  3G73 A;  1LE8 B;  4A0Y A;  3JRD A;  1FTZ A;  2XPW A;  5BS6 A;  6PAX A;  2DTZ A;  3BG9 A;  2WAQ N;  2W25 A;  1L0O C;  4NC8 A;  3FXQ A;  4PUS A;  1YG2 A;  4MFD A;  2ZXJ A;  3CMM A;  1O3Q A;  4DYQ A;  3BJA A;  4B44 A;  3GTK J;  1Y8Q B;  5EGO B;  5DV5 A;  2CW0 F;  2P8T A;  2AQF A;  5GAE J;  4A0Z A;  5DCM A;  3RZO J;  1ETQ A;  2GOX B;  1USS A;  4EGZ A;  1KZH A;  5F0F A;  3CF5 F;  2LOO A;  3HJE A;  2H94 A;  2F4M B;  1QZE A;  3DEE A;  4M6V A;  2EIJ H;  4DNC A;  4LOC A;  4C9Y A;  4XQF A;  4N4N B;  3JRG A;  1WJ5 A;  3MKW B;  1EH6 A;  3O8H A;  4AYB A;  3HTS B;  3D5L A;  5LLQ A;  2KDZ A;  1ODD A;  1FP1 D;  3S8P A;  2DA6 A;  4IJA A;  2XIG A;  3BR3 A;  3ZQ7 A;  4GCV A;  1IJW C;  1WWX A;  1WGX A;  3LFK A;  4BQN A;  3R61 A;  3HOX J;  4KIG A;  3DKX A;  1HST A;  2EH3 A;  4MO7 A;  1E0E A;  1SD5 A;  3E6D A;  4RAZ A;  3K0L A;  2XAF A;  4YIF A;  4O5V A;  2H6C A;  3ZQG A;  2R7R A;  4A12 A;  4U0W A;  5DEQ A;  1EH8 A;  2KZG A;  1Z7U A;  3HPH A;  2ECB A;  5FLX Z;  3F72 A;  2EZK A;  2VPR A;  3HYI A;  3IC7 A;  2IPQ X;  3TP0 A;  5FB2 A;  4XK4 A;  2C6Y A;  1UCR A;  2M0M A;  3BR6 A;  1G8X A;  2EB7 A;  5EEA A;  4LIV A;  2K40 A;  4M73 A;  3OYA A;  2MC3 A;  2L01 A;  3AAF A;  3TOA A;  4LB6 B;  3A4C A;  2G7H A;  4DW6 A;  4RB2 C;  2K5C A;  4KN4 X;  3JRC A;  1XDS A;  3FKI J;  1T95 A;  3C18 A;  3HZJ A;  5EZG A;  1DUX C;  3PO2 J;  3IH2 A;  1I39 A;  2AXT C;  2R7Q A;  3DPU A;  3IAM 2;  5HNH A;  3G6E I;  1BI1 A;  1G3S A;  1X1P A;  2O03 A;  5E8I A;  3HKZ N;  3GX4 X;  2X1C A;  2LLK A;  3RI4 A;  2FD5 A;  3WTS C;  2RV8 A;  3KET A;  3L9F A;  3F8N A;  4UB8 C;  2MC4 A;  3Q0V A;  2X6W A;  1PJR A;  3F3X A;  3ZMU A;  1IV6 A;  2DLL A;  3PIO F;  2UV1 A;  1A36 A;  4IL6 C;  1W36 C;  2F5E A;  3U9G A;  3H9Q A;  3TL4 X;  1MBK A;  3H36 A;  1R5G A;  2NS7 A;  4S05 A;  1N77 A;  3L2Q A;  2ZB9 A;  2JPB A;  5JHF A;  2JT1 A;  2JN6 A;  3M1E A;  4M74 A;  1JHF A;  1F4K A;  1ETO A;  1VND A;  2BE5 F;  4PCQ A;  1XMA A;  2XGC A;  1QHG A;  4BHB A;  1SFU A;  3K9T A;  3ZN1 A;  4HDV A;  4RS8 A;  1LFP A;  2L4M A;  4K2E A;  1BBY A;  1I1S A;  3CP8 A;  2XGX A;  2K9L A;  1D0X A;  2M0C A;  4BQO A;  1MMN A;  1IXC A;  2XPV A;  1R49 A;  2AXL A;  2R3S A;  4X0G A;  3IWZ A;  3E3V A;  1S72 I;  1JE8 A;  2XDV A;  4A6D A;  2DW4 A;  3NRV A;  3F22 A;  1POG A;  3BLY A;  4Y13 A;  4RB3 C;  4M72 A;  1GXQ A;  4UNO A;  3N05 A;  3VYS B;  2VOP A;  3H3Z A;  2FX0 A;  2QGU A;  3KCC A;  5K7H A;  4RLF A;  3JRA A;  2KRF A;  3CO6 C;  3JRE A;  4XOP A;  2BV6 A;  3H0G J;  2EV5 A;  2M8E A;  2Y31 A;  2A6T A;  3OYH A;  3COA C;  3CTA A;  3FM3 A;  2NOJ B;  4XIC A;  3OYE A;  3FDY A;  1P7I A;  3ABU A;  2FOW A;  2L0K A;  4GYI A;  3CUQ B;  1EA3 A;  1MW7 A;  3FXK A;  2DMT A;  2AS5 F;  4ZYD A;  4RM2 A;  4D7N A;  2JRT A;  3GZN B;  4CH7 A;  1P4A A;  3CDH A;  3S17 J;  1LDJ A;  2QYO A;  1Z7L A;  4DGW B;  3W6J B;  1E3H A;  5KCM A;  1B9M A;  4CDG A;  4HA8 A;  3HKZ A;  2Z9O A;  1APL C;  4J19 A;  1W0T A;  2I5U A;  4DIQ A;  1IW7 F;  3K2Z A;  1LFU P;  1DGR M;  3I5U A;  4LMY A;  4BHC A;  3VDX A;  4N0B A;  3Q9V A;  4MNU A;  2ZJR F;  2EFO A;  1MBG A;  3DPL C;  1ULY A;  3OS0 A;  2O0Y A;  1XGS A;  3C2H A;  3KX2 A;  4R8H A;  1BN5 A;  2OZU A;  2M45 A;  1ETY A;  5C3E J;  1R9T J;  3REO A;  5FD6 A;  5F64 A;  1GT0 C;  1IAW A;  1I1G A;  1ZTR A;  3PSI A;  4A0X A;  3DU6 A;  3OYK A;  4W1U A;  2ZME B;  2EV6 A;  2MBF A;  5D6F A;  4UVA A;  4ON0 A;  3VYU B;  3AFH A;  2DFE A;  5EJC A;  4MLO A;  3L2R A;  1YO5 C;  2YPR A;  3BG3 A;  3DV8 A;  4L0Z B;  3HBL A;  3FXU A;  3ZR8 X;  2LMD A;  1IN8 A;  3HSF A;  4RB1 A;  4GYG A;  4XKV A;  2QCO A;  1MH4 A;  1OYW A;  3ISP A;  2QA4 I;  4G9Y A;  2FMY A;  3P5J A;  2H1L A;  4UVB A;  1SFE A;  1IUF A;  1U2W A;  2OTJ I;  1MMA A;  1TWA J;  5J4V A;  2CO5 A;  3T0Y A;  3J80 K;  2Z3Y A;  3BT9 A;  4IPA A;  3ZQI A;  3GFM A;  5HLH A;  5HS9 A;  2Y9Y A;  3Q0W A;  1BC8 C;  4QIW N;  4G7Z F;  2V1U A;  2QZ8 A;  4KN7 X;  1SFO J;  3SQN A;  4F3Q A;  2IGK A;  2YSR A;  1YI2 I;  4D9J A;  3W2A A;  3M4O J;  2D1V A;  3CDI A;  4M6X A;  2OD5 A;  3H9G A;  3LWF A;  5E8G A;  4EAT A;  5GAD J;  5E3M A;  3OR2 C;  3LSH A;  2CW7 A;  4OWR B;  5ILV A;  3HOT A;  4RGR A;  4IF4 A;  1VQ7 I;  1WHU A;  4L18 B;  1MMS A;  2DA5 A;  1WH7 A;  3OIP A;  2JPC A;  5LRR A;  1GLN A;  4EQQ A;  2DOA A;  2HOE A;  1V55 H;  5M5X J;  3EET A;  5IT3 A;  3G3Z A;  2ELJ A;  2LFB A;  3IKV A;  3LA7 A;  4EGY A;  1WRJ A;  1VQN I;  5BQT A;  4DJA A;  2IAI A;  5A2Q Z;  1REP C;  2K3F A;  5GPC A;  2BW3 A;  3H1C A;  2HOT A;  1Z1D A;  3KLO A;  1R4M B;  3R0J A;  3O6B B;  1MKM A;  3E5X A;  3BQZ A;  1XSD A;  2CQX A;  5CVV A;  3LSP A;  2DPD A;  2RC4 A;  2JTV A;  5H20 A;  5IP6 A;  2M1B A;  3OYG A;  2HOS A;  2NVY J;  3BR1 A;  4OU0 A;  1MJ9 A;  2FSW A;  2EK5 A;  2XAJ A;  3X2Q H;  1ON1 A;  2KLO A;  3J80 Z;  5IYD J;  1JJ6 C;  1YW8 A;  1G3Y A;  4AVZ A;  4EJT A;  3E5U A;  2VQC A;  1T8I A;  4M9X A;  2XSD C;  1FLI A;  1ACI A;  4CGZ A;  3QPL A;  4A3G J;  2L7M P;  2KIF A;  4HF1 A;  4JP0 A;  3KPH A;  4L9T A;  1BL0 A;  3OIQ A;  3QPT A;  4M3E A;  2L9S A;  3A02 A;  4XBF A;  2K9Q A;  2VUM J;  2CFO A;  4A3B J;  1HC8 A;  2WWY A;  3TED A;  1X58 A;  2P0W A;  3LQQ A;  3LSI A;  4L5I A;  1WJB A;  4IOA F;  2XAH A;  3DKW A;  4QLC U;  3WTT C;  5K1Y A;  4UV9 A;  3SEQ A;  3R4K A;  1VQO I;  2OUM A;  3CJR B;  2IRF G;  4GGG A;  3HXL A;  2CMP A;  2LY9 A;  2R0Q C;  3LL7 A;  2ELK A;  2VLA A;  2LF7 A;  2E34 A;  1OFC X;  2W24 A;  4H4K C;  5FFZ A;  1G59 A;  4C2U A;  4IRI A;  3HRM A;  2JA6 J;  1UAA A;  3LQR A;  1FYK A;  2HTS A;  2WC2 A;  3U1D A;  3WGG A;  3S15 J;  4YRV A;  4S0H B;  3S3M A;  3OMY A;  1GUU A;  1T0F A;  1AA7 A;  5HDG A;  1MBF A;  5LD2 C;  3HOW J;  4CCM A;  4JOM A;  4HNV A;  3AG3 H;  3K1M A;  3JSO A;  1GXP A;  4BAC A;  3HOS A;  1QVU A;  3S16 J;  2VT3 A;  1XSX A;  2E1M B;  4ZDO A;  4BS9 A;  3BTJ A;  2X6Y A;  4BDZ A;  4AC0 A;  1LEB A;  2V6C A;  1W36 D;  4BQA A;  3OOU A;  2X9D A;  3V8L A;  2ESH A;  1M1E B;  3W2V A;  2HYG D;  4M3D A;  1U5T A;  1S5L C;  1TNS A;  1I3A A;  5E17 F;  3TMO A;  1U78 A;  1ENH A;  1TTY A;  1T6S A;  2UXX A;  2LY2 A;  3CQZ J;  2ZC2 A;  3I4P A;  3A1Y A;  4CCJ A;  1SEU A;  1J9I A;  3VB2 A;  3ASN H;  2HR3 A;  1VQP I;  2M4K A;  2K9N A;  1PUF B;  2PQ8 A;  2R7D A;  2CG4 A;  3DKY A;  4FX0 A;  2VXZ A;  4HG2 A;  4RGX A;  3K4M A;  1FX7 A;  3C7J A;  2M9H A;  1B1B A;  3RIR A;  1TQI A;  3TW7 A;  1U8B A;  4PDK A;  4JX5 A;  4D0P A;  3S3O A;  2ADU A;  2ZME A;  3ULQ B;  5FKO A;  3SZG A;  2KP6 A;  5B1B H;  2DMQ A;  9ANT A;  3FMR A;  2A05 A;  5EZH A;  2BY1 A;  2EBI A;  4D5F A;  3J7Z I;  2W85 A;  2QBY A;  2BXY A;  1X1B A;  4CCK A;  4OIO F;  1VQ9 I;  3RQI A;  2O61 A;  1YTY A;  3K1P A;  3DXJ F;  4BEH A;  4DBR A;  1YIJ I;  1JXS A;  2HDD A;  4G6Q A;  5J47 A;  3QOD A;  4R79 A;  4BBS J;  4LG0 B;  1SD7 A;  4AM3 A;  5AIP A;  1OQY A;  3QOE A;  4MEY F;  4XON A;  3RKY A;  3RPU A;  2IA1 A;  1TW2 A;  3K4N A;  3PUF A;  4L9N A;  3HOY J;  1XCV A;  4QPO A;  5E1X A;  4DBQ A;  5K7Z A;  3S93 A;  3LAP A;  3LA2 A;  4DYR A;  3JRB A;  2O3F A;  1LDK B;  2Z33 A;  3EUH C;  4EM2 A;  1JUP A;  1JT0 A;  1TWC J;  4LK0 F;  1X4O A;  2KIU A;  3I59 B;  3IL2 A;  2KRC A;  1G3W A;  3WG9 A;  1LPQ A;  1OCP A;  5L3E A;  1OKR A;  4PGH A;  2G0E A;  1S3J A;  3G71 I;  4HSR A;  5BPD A;  1RR8 C;  3DLL F;  2FUG 2;  4I09 A;  4LLG F;  5D5X B;  1Z77 A;  4NNJ A;  1XDU A;  3GTO J;  3TOB A;  1QRY A;  1YRN A;  2R7Z J;  3R0A A;  4PSW A;  4FT8 A;  4O3M A;  3DP7 A;  5LHH A;  3CC7 I;  2Y0S N;  2BHZ A;  2UXN A;  1HKS A;  3CMY A;  1P7J A;  4G6T B;  5C44 J;  1BIB A;  2VB6 A;  2DA7 A;  2Z1D A;  1WVR A;  2FQ4 A;  1D1C A;  2J5O A;  3PIP F;  3H9J A;  3ELK A;  5FFX A;  2PMU A;  3GTQ J;  1HW5 A;  1SAN A;  3FIS A;  2YU3 A;  1AU7 A;  4KA4 A;  3JAM K;  1ONV A;  1IV8 A;  2MLK A;  2JA7 J;  3FKJ A;  2JJ7 A;  3RDI A;  5J1Y A;  2VQG A;  3IH3 A;  1R7J A;  1X1A A;  2ZCW A;  1O7L A;  2OC6 A;  5F0H A;  1UJ8 A;  3FK7 A;  3M07 A;  3I4M J;  3W2W A;  5FKK A;  5TJJ A;  1YJ9 I;  2K3P A;  1BIA A;  3ZMZ A;  3GVA A;  5ICG A;  1MDM A;  2GIZ A;  3W3C A;  1B8I B;  1VF9 A;  4E7K A;  1MJB A;  2NXN B;  3HRU A;  2DI3 A;  2IBD A;  1MNM C;  2DN0 A;  2BXZ A;  2IVM A;  4YII A;  1E3P A;  2DA3 A;  1R6R A;  5DYM A;  3U21 A;  4LG3 A;  1RRJ A;  2A07 F;  1PUE E;  5H6Q A;  3ESW B;  3GTG J;  5CVR A;  3CES A;  4FE7 A;  2STW A;  1YIO A;  3K70 C;  4RGS A;  4EJV A;  2PG4 A;  3OL3 A;  4U7D A;  3NEU A;  3WTV C;  3LA3 A;  3S2W A;  3HM5 A;  3SXY A;  4EJO A;  3K70 D;  3CJT B;  4N9I A;  3E6M A;  3HPG A;  4LIT A;  3WTX C;  4RA2 A;  1R36 A;  3GLX A;  3V7R A;  5GTH C;  4KYW A;  2DQR A;  2ZFU A;  4BXX J;  1Y1W J;  3J7A Y;  3F21 A;  1BW6 A;  1XN7 A;  2DT5 A;  3BJ6 A;  5IYB J;  4BDY A;  5KK1 A;  1Y0U A;  2CQK A;  4BNC A;  5CKT A;  5ICF A;  2BZT A;  3KP3 A;  5DTD A;  5HLG A;  1Q1H A;  2K02 A;  1R1V A;  2W4S A;  1RPW A;  1O57 A;  3LSM A;  2ZJP F;  2L9R A;  2NNY A;  2XGE A;  3K4C A;  3QU6 A;  2ECC A;  2X1D A;  2BEO A;  2PJP A;  4A69 C;  4MQ9 F;  1NTC A;  3PL8 A;  2QSH X;  1JT6 A;  4OIR F;  2I10 A;  1IN7 A;  1WJD A;  2KIS A;  1UEL B;  2ZSH B;  4P55 A;  2RQP A;  2HYF A;  4BJT A;  4RLQ A;  5LEK A;  2FXA A;  2W84 A;  1OCZ H;  1OLT A;  3CUO A;  2A61 A;  4JQF A;  3MAJ A;  3Q3S A;  3GFL A;  2NOG A;  2DFF A;  4PGG A;  2DA1 A;  4HQM A;  3BDD A;  5J3L A;  2X4H A;  3QP6 A;  2JA8 J;  1TP4 A;  2Y30 A;  5LGN A;  1NK3 P;  3FXR A;  2IA2 A;  2GXA A;  1SAX A;  3CCY A;  4AVP A;  4HDU A;  1QHH D;  2PFB A;  2V9P A;  5L3G A;  3M9A A;  2JUG A;  3KP4 A;  3Q9S A;  3IRQ A;  2EIM H;  3JTG A;  1Z9C A;  3KYC B;  2WY8 Q;  3GTJ J;  4JX6 A;  3UR3 C;  3BY6 A;  1DGW Y;  2VI6 A;  5HLI A;  1FYM A;  3V7S A;  1J75 A;  2W48 A;  1ZEL A;  2QSF X;  3OYI A;  1IRF A;  4KMF A;  2M30 A;  4IEJ A;  2E5N A;  2DDB A;  2V79 A;  1RKT A;  4FTH A;  4CCO A;  1QPM A;  3KLN A;  3M7G A;  5J6X A;  3GYH X;  3LSK A;  2GAU A;  4I99 C;  1P4W A;  3GEZ A;  3AL0 C;  1FEX A;  3CCE I;  4CXF A;  2TDX A;  4FET A;  3GF2 A;  1ZHF A;  2ME6 A;  3OSF A;  3GTP J;  3WTZ A;  2VKD A;  1RZ4 A;  3HGG A;  2YR2 A;  4HZF A;  2A69 F;  2DU9 A;  5DM6 F;  4IX7 A;  1WJA A;  4UUS A;  1VQ4 I;  2X0L A;  2LK2 A;  2E1O A;  2A6H F;  1IXR C;  3ZGK A;  3OYC A;  4M6Y A;  1WQ2 A;  4XID A;  1IF1 A;  2UUZ A;  4KIC A;  4PSX A;  2DCE A;  1GVJ A;  3BTI A;  3PQK A;  2ICW G;  2LH9 A;  2WV0 A;  2DJI A;  2H8W A;  3BRO A;  3O3K A;  1T39 A;  2O5R A;  2FQ3 A;  1VZ0 A;  2VJJ A;  4V2G A;  3GXO A;  3KEQ A;  1TQM A;  3QPH A;  1DQU A;  2P7C B;  4JX4 A;  4YEJ A;  2YX7 A;  2V1D A;  2DA2 A;  2L7F P;  4XOT A;  1WJE A;  1BI3 A;  5EEG A;  3H0D A;  4LB5 A;  3A0H C;  2V1X A;  5IOY A;  1B72 B;  1ZQ3 P;  1FSH A;  4LLN A;  4HBL A;  5D5W B;  3GBG A;  4WK8 F;  2LR8 A;  4G7O F;  3BZC A;  2Y75 A;  1Q1V A;  3JAM Z;  1YJN I;  2HKX A;  4XM3 A;  2Z2S B;  1B8I A;  2FML A;  2MAB A;  4MEX F;  1G4D A;  3OS2 A;  4F55 A;  3I64 A;  1D8K A;  3LAJ A;  1YX3 A;  1ZYR F;  4Z2Y A;  2XB5 A;  1TL8 A;  1K61 A;  2ACJ A;  5DM7 F;  2QVO A;  2DTR A;  1JI8 A;  1F36 A;  1FZP B;  4C3H J;  3IH4 A;  2FBH A;  1WCM J;  4XNF A;  3DEU A;  5GAH J;  2MH9 A;  3EUK L;  4WXC A;  2HQ5 A;  4EM1 A;  3V8J A;  1HSJ A;  3QYB A;  3O2P E;  3F6V A;  1BOA A;  1FJL A;  2FOK A;  1PUF A;  4ZYG A;  1KU3 A;  3GW2 A;  3LSG A;  3HGY A;  2CUZ A;  2OCC H;  5BPI A;  2XRL A;  2FF4 A;  2NVQ J;  4LJZ F;  1SD6 A;  3K69 A;  3C3W A;  5D5U B;  3OYB A;  1FBS A;  3N97 A;  1UG2 A;  1UFM A;  1OCT C;  1KYZ A;  1FMV A;  4IRH A;  5LHI A;  1L3L A;  2A68 F;  4DOZ A;  4M71 A;  1Z3X A;  3IWF A;  1U0J A;  1J59 A;  3QYF A;  3K1N A;  4KIB A;  2JMW A;  1BR4 A;  1B9N A;  4CYD A;  4XKB A;  3RKW A;  5E20 A;  5FLX K;  2W82 A;  3G2B A;  2WTE A;  2AO9 A;  5J40 A;  1VQL I;  2XGD A;  1YS7 A;  3D1N I;  2Q2E B;  3MD2 A;  4G6D A;  2V1N A;  1BI0 A;  2ZJQ F;  3NQO A;  4I76 A;  3A0B C;  4HNT A;  5J4Y A;  3CO7 C;  1U3E M;  4D1Q A;  5FRM A;  5BOX A;  3FXJ A;  1HW1 A;  3ZP5 A;  1U6G A;  4A5M A;  2FBK A;  1EF4 A;  5FLM J;  3HC7 A;  2Y2Z A;  1X1C A;  3DWL E;  2F5V A;  4GO1 A;  4M9S A;  3HRS A;  3OSG A;  2B7E A;  2HEO A;  1JTX A;  3ZMT A;  2HS5 A;  1OR7 A;  1G6N A;  1HF0 A;  2ELH A;  3FXO A;  3K7A J;  4BL0 B;  5J1U A;  2XC7 A;  4M3B A;  2XRN A;  3CJQ B;  4LGW A;  2FU4 A;  2HDC A;  4OIP F;  2F48 A;  2E1M C;  2L7Z A;  2XKO A;  3V42 A;  3L1P A;  1KQ8 A;  2DFI A;  1MBJ A;  4XLA A;  3J81 K;  2O9L A;  1TWF J;  1IZ1 A;  2E35 A;  2ZXH A;  4YEL A;  2LVS A;  3VEP A;  4LK1 F;  2V9K A;  3SZP A;  1ETX A;  1ZGW A;  4LG0 A;  5B66 C;  1D0Y A;  2UWM A;  2Y0S A;  4MIM A;  2D2W A;  4F7Z A;  5CQE A;  2K4B A;  2DOE A;  2AQE A;  4BQQ A;  2ZSI B;  3P9C A;  4OIN F;  1H8A C;  3VOD A;  3OIO A;  3GCM A;  3A01 A;  5M3F J;  1VTN C;  3DF8 A;  2RAE A;  4A3D J;  4RMN A;  3BJO A;  3BR2 A;  3M8F A;  3GWZ A;  1AKH B;  2DPU A;  2OCE A;  5C4X J;  5H6R A;  3HEF A;  2XAG A;  4IXA A;  1AKH A;  4I2O A;  4EJU A;  4KIF A;  2RDP A;  3FM5 A;  2L54 A;  4BKX A;  3PO3 J;  1ETK A;  1LJ9 A;  3TGN A;  2L2O A;  2O8K A;  1VI0 A;  1O7F A;  3DTI A;  2B9S A;  3HIF A;  2MH2 A;  3E1S A;  3IUO A;  2V4J C;  2K86 A;  2QKL B;  1TT5 B;  3ZMD A;  3MKL A;  3M3Y J;  2EIN H;  3E97 A;  1NG7 A;  3DTK A;  2DMP A;  1X4P A;  2WA0 A;  4MHG A;  4FIS A;  3HSE A;  1B59 A;  2M3A A;  4ASN A;  2ESN A;  3WG7 H;  1F9N A;  2M87 A;  5TGT A;  4X6A J;  2LKS A;  2DK8 A;  1BM9 A;  1Y1V J;  1B72 A;  2R7U A;  3EYY A;  1NG6 A;  4ZYH A;  5D8L B;  1A6I A;  1MNE A;  1XCB A;  2M7A A;  5K7F A;  3NWS A;  5DDG A;  3E6B A;  1IRX A;  1U5T B;  5F0C A;  1HLV A;  2XF5 A;  1QQI A;  1U5T C;  4L5J A;  2OF7 A;  2CS3 A;  4ENM A;  1FSE A;  1RUO A;  2IP2 A;  1XGN A;  1TC3 C;  3BZK A;  2EZL A;  5DUI A;  4HOB A;  2ZJ2 A;  2P81 A;  1BA5 A;  3I4N J;  4ZC3 A;  4E70 A;  3OV8 A;  5FKM A;  1HOM A;  3RYR A;  5JLW A;  2KJC A;  3IV5 A;  5IOZ A;  4DZP A;  3TBI A;  1IDZ A;  4BY1 J;  2N8G A;  3U2R A;  4PFO A;  3T8T A;  2LYC A;  1MMD A;  2LG4 A;  2NRA C;  1Z67 A;  3BZ6 A;  2QLZ A;  3EQL F;  2DAO A;  4HAM A;  1KU7 A;  4WXH A;  5J1R A;  1ZRF A;  3B73 A;  4S04 A;  4E6K G;  3D5S C;  1IGN A;  2ID6 A;  5JI6 A;  4XLP F;  1FBU A;  1TWH J;  3LSR A;  2R7X A;  3E7L A;  2JZY A;  1V5E A;  2XSJ C;  2VJI A;  1HA8 A;  1ZGA A;  4GFB A;  1F43 A;  1MD0 A;  1BR2 A;  4D5C A;  2LRE A;  4Y3O A;  1VQ5 I;  1E2X A;  2VAS A;  2XB0 X;  3BR0 A;  1V5G A;  3ASO H;  2XV4 S;  4E4H A;  2NS8 A;  4CZZ A;  4V2F A;  4IHX A;  3ZMV A;  5IYC J;  3AKZ A;  3NWT A;  2K27 A;  2COM A;  3WU2 C;  1MMG A;  1FOX A;  3QWL A;  3LOC A;  4WXD A;  4CYC B;  4ZTJ A;  2M7B A;  2X48 A;  2R7V A;  2G9W A;  3TO7 A;  3DBR B;  2W00 A;  1A6Q A;  1T38 A;  2GLO A;  4HF2 A;  5ICE A;  3KP7 A;  1DPU A;  2E2J J;  1N75 A;  5FJ8 J;  2PJR A;  2DBB A;  1ZAR A;  4J00 A;  2R7F A;  1FPQ A;  1VQK I;  4RAF A;  2FBI A;  1KU2 A;  3JRI A;  5E1Z B;  1BJA A;  2LP0 A;  3PSF A;  1HW2 A;  2LY1 A;  4BXU A;  2VON A;  2QSG X;  3L00 A;  2P6T A;  3CUQ A;  2E2H J;  3H3U A;  1X3Z B;  3L09 A;  1F1Z A;  1JUS A;  5IPA A;  2JK3 A;  3QAH A;  1IN6 A;  4I01 A;  4XN3 A;  1QZZ A;  2EA2 A;  3MWM A;  1OIS A;  1W4M A;  5TIS C;  1J0R A;  3PM1 A;  3PNV A;  4Q5S F;  3HHG A;  3H92 A;  4XLC A;  2M34 A;  1XG1 A;  2VJ4 A;  3AG1 H;  3W6K B;  5D6E A;  2IGN A;  4XLH A;  1OYY A;  1A5J A;  3LMM A;  2HZD A;  1OCO H;  3KE2 A;  4XRS A;  4IHS A;  1EKE A;  2WB1 A;  4II3 A;  3SFI A;  2MD0 A;  3VYT B;  1TT0 A;  4B1R A;  1WPK A;  1O3R A;  4ZH4 F;  1WJC A;  4JYK A;  5FKN A;  4HW0 A;  2R92 J;  1T98 A;  2DQL A;  1XTA A;  2ZNZ A;  2QKM B;  1UST A;  3S1M J;  2DJN A;  1Z6T A;  2CUE A;  4EMS A;  4E7J A;  4H0E A;  3GLL A;  2MYS A;  3F8M A;  3HDD A;  2P6S A;  3WU0 A;  3SHF A;  1KA8 A;  3FXM A;  2QEN A;  2VOD A;  4V19 K;  1HCR A;  4BY7 J;  1U8R A;  1FNN A;  1D3Y A;  1YX5 A;  5L3D A;  3AG4 H;  5CPR B;  2HDW A;  1UHS A;  3QOP A;  2E7X A;  2EFQ A;  1SMT A;  3R6S A;  1YLF A;  4XR6 A;  2Z5U A;  3OYD A;  4ABZ A;  1TWG J;  3TDZ C;  4BE0 A;  2OV7 A;  4HYE A;  1GV2 A;  4MQV A;  2EA4 A;  2ZME C;  1Z6R A;  1PYV A;  3MEX A;  2UZK A;  2P5V A;  2W1O A;  3OOP A;  4HV6 A;  2XAS A;  4ANJ A;  3E6C C;  3N4M A;  1IC8 A;  3PJR A;  1UB9 A;  4BJ6 C;  5D4S A;  1XSV A;  3G1O A;  1EJ9 A;  1TZL A;  4IRG A;  3FF5 A;  4LD5 A;  2E71 A;  3ZQF A;  4G8X A;  3CCR I;  2GA2 A;  1ERD A;  4MTD A;  3DPT A;  2ETH A;  3QQA A;  1ETV A;  1RUN A;  2WY7 Q;  2PMH A;  3HUG B;  4EVI A;  3OYM A;  1MSF C;  2IS4 A;  3K4L A;  2EIK H;  4BE1 A;  5F6F A;  3SDB A;  3KP2 A;  5HS7 A;  2R93 J;  5CYV A;  2HQR A;  4HQE A;  2ZNY A;  4AU7 A;  3CF2 A;  3TQN A;  2GOM A;  2XF7 A;  1CGP A;  2HVR A;  2BGC A;  1FYL A;  2DYR H;  3FMQ A;  3H5N A;  4XLE A;  5EDN A;  2Y9Z A;  3RJP A;  2F6C A;  5CQG A;  3F23 A;  1JGG A;  2KIQ A;  1HKQ A;  1OMI A;  2VQL A;  1Z21 A;  1BJZ A;  2KPM A;  1RNL A;  3MN2 A;  4XSX F;  3ZQC A;  4E7S A;  3DQV C;  1KGS A;  1S29 A;  2DFH A;  2LKP A;  4M3G A;  4BHP A;  1Z3Y A;  2K9M A;  1LB2 A;  1ZRD A;  2XHK A;  1T33 A;  1ZR2 A;  1Y8R B;  4C3J J;  2VBX A;  2OQG A;  4L9J A;  5DUK A;  4B8X A;  1FWZ A;  3FHZ A;  4ZZL A;  5E1W A;  4U7B A;  1I50 J;  1OCR H;  3G4S I;  3FZV A;  4I98 B;  1SFX A;  1HQC A; 
#chains in the Genus database with same CATH homology
 2MGQ A;  4IEJ A;  2ID3 A;  2YS9 A;  4Y7N J;  1RKT A;  2CUF A;  4FTH A;  1MBG A;  3GTM J;  3VPR A;  2B63 J;  3RZD J;  2D5V A;  2HI3 A;  3JRF A;  1ETY A;  5C3E J;  1R9T J;  1FEX A;  5E3L A;  3BR5 A;  1FTT A;  1GT0 C;  2DMU A;  3WHB A;  5F08 A;  1ZTR A;  2ME6 A;  3OSF A;  3GTP J;  4W1U A;  4EEF G;  3S1N J;  2ME0 A;  3HGG A;  3BTL A;  4L5E A;  1BW5 A;  4AYB N;  4Y52 J;  4MLO A;  4UUS A;  3BG3 A;  2LK2 A;  2E1O A;  3HBL A;  4A3K J;  3B6C A;  4UUS B;  4XID A;  2QCO A;  1MH4 A;  3BTI A;  2H8R A;  2R5Y B;  2HYJ A;  5DS9 A;  1IUF A;  4V2G A;  1JTY A;  1JKQ C;  1TWA J;  2TCT A;  4JX4 A;  1X2N A;  1W0U A;  5F27 A;  2DA2 A;  1IG7 A;  2L7F P;  3BT9 A;  3ZQI A;  4M3F A;  4IHV A;  2Y9Y A;  3Q0W A;  4QIW N;  1JKP C;  1B72 B;  5IOY A;  3FIW A;  1ZQ3 P;  3BTC A;  1SFO J;  1QVT A;  3GBG A;  1FIA A;  2LR8 A;  1GDT A;  1RKW A;  1Q1V A;  1IRZ A;  3M4O J;  2CU7 A;  1ITY A;  1B8I A;  2O7O A;  5E3M A;  2NVT J;  5EYR A;  5FKL A;  2XB5 A;  2DA5 A;  1K61 A;  2MSY A;  1WH7 A;  2GM4 A;  3ZQH A;  1F36 A;  4C3H J;  3IH4 A;  2CJJ A;  1WCM J;  1Z0X A;  2HQ5 A;  5M5X J;  1D5Y A;  1YRN B;  2LFB A;  1FJL A;  5BNG A;  1MH3 A;  2IAI A;  1PUF A;  2R5Z A;  5GPC A;  1FIP A;  2E2I J;  3LSG A;  3HGY A;  2OPT A;  2HOT A;  4UUT A;  2XRL A;  2NVQ J;  3FK6 A;  3BQZ A;  2CQX A;  3LSP A;  2E19 A;  5IP7 J;  1UG2 A;  1OCT C;  5IP6 A;  3SJM A;  2HOS A;  2NVY J;  3BR1 A;  3MVP A;  4AUX A;  1CQT A;  5GP9 A;  5E3N A;  3RKQ A;  2MG4 A;  5IYD J;  2JMW A;  5EGO A;  1JJ6 C;  1G2H A;  3NAR A;  2XPU A;  3NAU A;  3LSJ A;  4B4C A;  2EQR A;  5HOD A;  2XSD C;  2LD5 A;  1AHD P;  1U9O A;  3QPL A;  5E3O A;  4A3C J;  4A3G J;  2DA4 A;  2L7M P;  3ZQL A;  2AO9 A;  4JP0 A;  1K83 J;  2XGD A;  1BL0 A;  3F0C A;  3D1N I;  4M3E A;  3A02 A;  1DU0 A;  2K9Q A;  2VUM J;  4I76 A;  4A3B J;  3S2H J;  3TED A;  1X58 A;  1NK2 P;  3BG5 A;  1E3O C;  1EF4 A;  5FLM J;  2H1K A;  3Q0U A;  2Y2Z A;  1VFC A;  3OSG A;  1JTX A;  1H88 C;  2LY9 A;  2R0Q C;  1HF0 A;  2ELK A;  3K7A J;  5J1U A;  3K2A A;  4M3B A;  5IP9 J;  4C2M J;  1ZR4 A;  2HXO A;  4BBR J;  1OFC X;  3WHC A;  4A3M J;  2L7Z A;  2JA6 J;  3L1P A;  3S15 J;  1MBJ A;  4S0H B;  2O9L A;  1TWF J;  1GUU A;  2LVS A;  1MBF A;  2LKX A;  1ETX A;  3HOW J;  1WI3 A;  1ZGW A;  4HNV A;  2AHQ A;  4MIM A;  3S16 J;  1QVU A;  1ZKG A;  2YU9 J;  1H8A C;  1IDY A;  1T56 A;  3OIO A;  3HOU J;  1ZK8 A;  3A03 A;  1I3Q J;  3BTJ A;  3A01 A;  5M3F J;  5EG0 A;  2RAE A;  4AC0 A;  4FE4 A;  2QF7 A;  3GTL J;  4A3D J;  1AKH B;  3BR2 A;  1U9N A;  3OOU A;  2X9D A;  5C4X J;  3S2D J;  1GVD A;  2HOA A;  3JR9 A;  3HEF A;  1AKH A;  5M5W J;  3TP3 A;  4M3D A;  1RR7 A;  4BKX A;  3PO3 J;  1XS9 A;  1ETK A;  1MBE A;  1U78 A;  4RDU A;  1ENH A;  2O8K A;  3TW6 A;  1VI0 A;  3CQZ J;  4QSH A;  3MKL A;  1MBH A;  3M3Y J;  2K9N A;  1PUF B;  1I6H J;  1RET A;  2DMP A;  4FIS A;  2M2E A;  2M9H A;  2MW8 A;  3TW7 A;  1WH5 A;  1U8B A;  4X6A J;  2HXI A;  1Y1V J;  1B72 A;  3HOZ J;  3DCF A;  4JX5 A;  3B6A A;  3S14 J;  4FCY A;  1A6I A;  5K7F A;  5FKO A;  3SDG A;  5F0C A;  4A3E J;  1HLV A;  2DMQ A;  9ANT A;  1LFB A;  2OF7 A;  5EZH A;  2VKV A;  2VKE A;  2EBI A;  5FLV A;  4D5F A;  1TC3 C;  2EZL A;  3HB9 A;  2GBY A;  3RQI A;  2P81 A;  1BA5 A;  2JA5 J;  3I4N J;  2KT0 A;  1QPI A;  5GPA A;  2HDD A;  5FKM A;  4BBS J;  2LTP A;  2NVX J;  1HOM A;  5JLW A;  3IV5 A;  5IOZ A;  4DZP A;  1ETW A;  5M3M J;  1IDZ A;  4BY1 J;  2N8G A;  3G1M A;  1LE8 B;  3HOY J;  3JRD A;  1FTZ A;  3JRH A;  5K7Z A;  2EZH A;  2XPW A;  3QPS A;  2DTZ A;  4DYR A;  3JRB A;  3BG9 A;  2WAQ N;  5J1R A;  4MFE A;  1XC5 A;  1JUP A;  1IGN A;  2ID6 A;  4DZJ A;  1TWC J;  1JT0 A;  4MFD A;  4DYQ A;  3GTK J;  1TWH J;  3LSR A;  3E7L A;  5EGO B;  2TRT A;  2YUS A;  1OCP A;  4GFB A;  3RZO J;  1ETQ A;  1JUM A;  1F43 A;  4D5C A;  5F0F A;  2G0E A;  1JKO C;  2XB0 X;  3BR0 A;  2R5Y A;  4M6V A;  4LOC A;  2NS8 A;  3HOV J;  3W6V A;  1Z77 A;  4V2F A;  4IHX A;  5F04 A;  5EF6 A;  3GTO J;  3JRG A;  1LE8 A;  5IYC J;  3O8H A;  1QRY A;  2KDZ A;  1YRN A;  2R7Z J;  2DA6 A;  1DU6 A;  3LOC A;  4CYC B;  3BR3 A;  2X48 A;  1IJW C;  2Y0S N;  1WGX A;  4XRM A;  1UMQ A;  3CMY A;  2GLO A;  1P7J A;  1HDP A;  2IEK A;  5C44 J;  3HOX J;  3LNQ A;  2E2J J;  2DA7 A;  2FQ4 A;  5FJ8 J;  4DYC A;  2EH3 A;  4MO7 A;  4CYC A;  2CQQ A;  4A3I J;  3GTQ J;  4A3L J;  1SAN A;  3FIS A;  1JJ8 C;  1AU7 A;  4X1E A;  3JRI A;  4A3J J;  3ZQG A;  2LP0 A;  2JA7 J;  1HDD C;  2JJ7 A;  5J1Y A;  2ECB A;  3IH3 A;  2EZI A;  1X2M A;  2EZK A;  2VPR A;  5F0H A;  4IHY A;  3I4M J;  3FK7 A;  2E2H J;  5IPA A;  3TP0 A;  1JUS A;  5FKK A;  2JK3 A;  2DMN A;  4XK4 A;  4D7M A;  1B8I B;  1VF9 A;  4NDL A;  3BR6 A;  5EEA A;  2K40 A;  1MNM C;  2IBD A;  3PM1 A;  2DN0 A;  2M34 A;  1XG1 A;  2DA3 A;  5M5Y J;  4DW6 A;  3JRC A;  3A01 B;  3FKI J;  5EZG A;  3PO2 J;  1H89 C;  3C2B A;  1MSE C;  3GTG J;  3IH2 A;  2PMZ N;  4FE7 A;  1A5J A;  4XRS A;  3HKZ N;  3SFI A;  2LLK A;  2FD5 A;  4B1R A;  1WPK A;  3Q0V A;  4JYK A;  3HM5 A;  1ORK A;  5FKN A;  4I6Z A;  2R92 J;  1IV6 A;  5C4J J;  3S1M J;  2DJN A;  3UKG A;  2CUE A;  2WB1 N;  3CDL A;  3HDD A;  4BXX J;  4XRS G;  1MBK A;  1Y1W J;  2NS7 A;  1O4X A;  1HCR A;  2FJ1 A;  2ZB9 A;  4BY7 J;  1BW6 A;  1UHS A;  2M8G X;  2WV1 A;  2JN6 A;  5IYB J;  1ETO A;  1VND A;  4A3F J;  4ABZ A;  2XGC A;  1TWG J;  3O8G A;  4W97 A;  5DTD A;  1RPW A;  1S7E A;  3BQY A;  1GV2 A;  4QTR A;  2L9R A;  2XGE A;  2ECC A;  1IC8 A;  4A69 C;  3G1O A;  2M0C A;  1NTC A;  2XPV A;  3ZQF A;  2X6O A;  1JT6 A;  3H3V K;  1OJL A;  2I10 A;  3QQA A;  2COB A;  1ETV A;  1RES A;  4RBO A;  1MSF C;  1POG A;  4B3A A;  2FX0 A;  5K7H A;  1JKR C;  2R93 J;  3JRA A;  3DEW A;  4G12 A;  5JLX A;  3JRE A;  3S1Q J;  4IHW A;  3Q3S A;  3H0G J;  2NOG A;  5F1J A;  2Y31 A;  2DA1 A;  5J3L A;  3G1L A;  5EDN A;  1GV5 A;  2Y9Z A;  2JWT A;  2JA8 J;  2Y30 A;  4XIC A;  1NK3 P;  1JGG A;  3S1R J;  1P7I A;  2CRG A;  2L0K A;  3CCY A;  1BJZ A;  3MN2 A;  3ZQC A;  2DMT A;  5EG0 B;  4M3G A;  4D7N A;  3S17 J;  4A93 J;  1T33 A;  1ZR2 A;  3GTJ J;  4JX6 A;  4C3J J;  2R5Z B;  1APL C;  4J19 A;  4C3I J;  1W0T A;  2VI6 A;  1I50 J;  2K9S A;  1LFU P;  2W48 A;  3ZOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...