1BA5A

Dna-binding domain of human telomeric protein, htrf1, nmr, 18 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
RKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding domain
molecule keywords HTRF1
publication title Solution structure of the DNA-binding domain of human telomeric protein, hTRF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1998-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ba5A00
3GTKJ 1ORKA 1ETQA 2E1OA 4GFBA 5IYCJ 2VUMJ 1GT0C 5J1YA 1GV5A 2DMTA 2EBIA 1WI3A 2M8GX 3LSJA 4M6VA 3LNQA 4B4CA 1RKWA 2R5ZA 1D5YA 2LK2A 3HOWJ 4FE7A 1NTCA 1MBKA 4DYRA 4DZPA 5C44J 5IP6A 3S15J 3ZQLA 2YS9A 1JJ8C 3S16J 4BY1J 1JUSA 2R0QC 2DJNA 1POGA 5FKNA 2VKVA 1Z0XA 1FIPA 3IH2A 4LOCA 1IDYA 1R9TJ 5IP9J 2EH3A 1ZK8A 5GP9A 3G1LA 3BG3A 5F0CA 1I3QJ 2DA4A 3HDDA 2L7FP 5J1UA 1ITYA 1O4XA 1F36A 4FISA 2RAEA 3BR1A 4ABZA 2M0CA 5FKLA 2LTPA 2ELKA 4XRSG 3F0CA 5F0FA 1QVTA 1WPKA 2WAQN 1U78A 1ZR4A 2IEKA 1G2HA 1MH4A 1BW5A 2IBDA 3ZQCA 5EZGA 2LVSA 1DU0A 1JTYA 2E2HJ 5DTDA 5M5XJ 2FD5A 4QIWN 1P7JA 2ID6A 2TRTA 2Y9ZA 2LD5A 1OCPA 1IGNA 2DMUA 2DMQA 4JX5A 5F08A 2GM4A 2IAIA 2X48A 4D7MA 3JRFA 2E2IJ 4XICA 5IOYA 3D1NI 2KDZA 1VF9A 4JX4A 1QPIA 2XRLA 1CQTA 1ZR2A 3BQZA 3CMYA 2EZHA 1IDZA 3S1NJ 1MBGA 2N8GA 5JLWA 4W97A 1APLC 4M3BA 1OJLA 3FK6A 5EYRA 2XPWA 3FKIJ 4Y52J 2L0KA 5F04A 3BQYA 2JA8J 1TWAJ 3TW7A 1RR7A 1RKTA 1TWFJ 1YRNB 3HOVJ 2QF7A 3BR2A 4MIMA 5IP7J 2YUSA 5BNGA 2G0EA 5IYDJ 1JT6A 2FX0A 1W0UA 1F43A 2ECCA 4Y7NJ 2WB1N 2JN6A 4A3EJ 4JP0A 1P7IA 1IV6A 3S1RJ 1U9OA 2L9RA 5IYBJ 2R92J 2EZIA 5M3MJ 1IRZA 3E7LA 4IHYA 4DYQA 1FJLA 3QQAA 5IOZA 2JA7J 4A3BJ 1HCRA 2ZB9A 1IC8A 4FE4A 4JYKA 3S2HJ 1H88C 1Z77A 3I4MJ 1WCMJ 2FQ4A 4G12A 4XRSA 3L1PA 2DMNA 3H0GJ 5C4JJ 4BBSJ 4MO7A 2XB5A 1ETYA 3CQZJ 3BTLA 3NARA 1ZTRA 1OFCX 3QPSA 5DS9A 5HODA 4A3MJ 3WHBA 3ZQIA 3BTCA 1AU7A 5EF6A 5M5YJ 3JRAA 3JRHA 1ETWA 1HDPA 4X6AJ 4IHXA 5EG0A 1JT0A 3HOUJ 5FKOA 1A6IA 3LOCA 5FJ8J 3S1QJ 2P81A 3OOUA 2EQRA 2E19A 1TWGJ 2DA5A 5EEAA 3A01B 3DCFA 5FKMA 2W48A 2DA1A 1B72B 2PMZN 1A5JA 2JA6J 4A3IJ 4X1EA 2ME0A 2Y31A 2LY9A 1IJWC 3OSFA 3DEWA 1K61A 1LFBA 1Y1WJ 1B8IB 1MH3A 3JRCA 4M3DA 3OSGA 4A93J 1HDDC 3TW6A 1WH5A 2XSDC 2LP0A 2M9HA 5E3NA 4MFDA 5F1JA 1MBHA 2NVXJ 3O8HA 1ETKA 3FISA 3O8GA 5GPCA 3Q3SA 3BTJA 4S0HB 4CYCB 1UG2A 1JKRC 2LFBA 5FKKA 2CQXA 4C3HJ 5C4XJ 2NVQJ 4A3LJ 2KT0A 2DA6A 1VI0A 5EZHA 3B6CA 5EG0B 1YRNA 1RESA 5J3LA 3BG9A 2Y30A 4BBRJ 3JRDA 3VPRA 3NAUA 2AO9A 3GTQJ 1BJZA 1JJ6C 3Q0WA 9ANTA 3BR0A 3OIOA 4C3IJ 4M3FA 3S17J 5K7FA 1JUPA 2HOTA 2K40A 2CU7A 3HOYJ 2EZKA 1ZGWA 2OPTA 1PUFB 3QPLA 1LFUP 4I76A 4C2MJ 4A3DJ 3BTIA 1GVDA 3HOXJ 3Q0VA 2XPUA 3SJMA 3HGGA 3RKQA 2CUEA 2DN0A 4XK4A 3GTJJ 2NVTJ 2HYJA 5IPAA 4AC0A 3HGYA 3ZOBA 1JGGA 1T33A 3HB9A 4XRMA 3JRBA 1ETXA 5JLXA 2DMPA 1SFOJ 1HOMA 2LR8A 4FCYA 4HNVA 1MBFA 3TP3A 2MW8A 2L7MP 1GUUA 3BR6A 4A3FJ 3A03A 3PO3J 3LSGA 2ID3A 2O7OA 3A01A 2K9NA 1BA5A 4MLOA 1B72A 2ME6A 1I50J 1JUMA 2HDDA 3HM5A 5M3FJ 1ETOA 3HKZN 1ZKGA 2DTZA 1B8IA 3UKGA 3RZOJ 1XG1A 2HI3A 1AKHB 2XB0X 2XPVA 3RZDJ 1MSEC 2HXIA 5M5WJ 1ZQ3P 2VPRA 3WHCA 4IEJA 2O8KA 4CYCA 3FIWA 4EEFG 1Y1VJ 3HOZJ 3GTLJ 1BW6A 1AHDP 4UUTA 4UUSA 3JREA 2CRGA 1JKPC 3JR9A 1W0TA 3IV5A 3IH3A 3MVPA 3Q0UA 2JJ7A 3TEDA 4L5EA 2HOAA 3JRGA 2R5YB 4A3KJ 4DW6A 1DU6A 5E3OA 1X58A 1OCTC 1EF4A 2CQQA 3W6VA 2HQ5A 2L7ZA 3HEFA 4NDLA 1MBEA 4A3GJ 2JA5J 2CJJA 2NS8A 1TWHJ 4DZJA 1Q1VA 2XGDA 3ZQFA 1PUFA 2DA3A 3IH4A 2X6OA 3G1OA 1H8AC 2DA2A 1I6HJ 2LLKA 3LSRA 4FTHA 3M4OJ 1XC5A 1RETA 1TC3C 3K7AJ 4J19A 4A3CJ 2YU9J 2VI6A 2Y9YA 4JX6A 1HLVA 4M3EA 4QSHA 1H89C 3K2AA 2XGEA 3S1MJ 1UHSA 4UUSB 4AUXA 2JMWA 3BG5A 3GTPJ 2NOGA 2JK3A 2EZLA 1FIAA 3BR3A 5EGOB 4M3GA 4RDUA 2I10A 2NS7A 4DYCA 1HF0A 3GTMJ 3A02A 1SANA 3JRIA 5F27A 2B63J 4RBOA 3M3YJ 1VFCA 2NVYJ 4BY7J 3H3VK 1FTTA 1GDTA 2X9DA 2R93J 2ECBA 1IUFA 4A3JJ 3C2BA 4V2GA 2R5ZB 4B1RA 2FJ1A 3MKLA 1JTXA 1MNMC 1ETVA 4A69C 3PM1A 5E3LA 3S14J 1AKHA 1FEXA 2R7ZJ 2K9SA 1MSFC 2Y0SN 1VNDA 2TCTA 2H8RA 3TP0A 4D7NA 1LE8A 2WV1A 5GPAA 3GBGA 1FTZA 3S2DJ 3G1MA 3LSPA 4B3AA 1E3OC 3CCYA 1JKOC 2VKEA 1TWCJ 1GV2A 1X2NA 4XIDA 1WGXA 1K83J 3B6AA 4W1UA 1QRYA 5K7ZA 2R5YA 1RPWA 2GBYA 4C3JJ 4MFEA 1U8BA 5FLVA 1BL0A 2XGCA 3BR5A 2MSYA 1UMQA 4QTRA 2Y2ZA 3GTGJ 3ZQHA 4AYBN 5F0HA 2D5VA 2JWTA 2K9QA 5E3MA 3I4NJ 2O9LA 1S7EA 1MBJA 2DA7A 2MGQA 2HXOA 4IHWA 2COBA 1T56A 5FLMJ 5EDNA 1JKQC 2M2EA 1U9NA 2HOSA 2QCOA 3BT9A 5C3EJ 2M34A 3ZQGA 4D5CA 1X2MA 5K7HA 1IG7A 4IHVA 3RQIA 2MG4A 2OF7A 1XS9A 1LE8B 1NK2P 5J1RA 1ENHA 2H1KA 3PO2J 2AHQA 2E2JJ 3SDGA 3SFIA 3GTOJ 3HBLA 4V2FA 1WH7A 4BXXJ 3CDLA 2CUFA 4BKXA 2GLOA 4I6ZA 3FK7A 5EGOA 2LKXA 3MN2A 1QVUA 1NK3P 4D5FA
chains in the Genus database with same CATH superfamily
5L3EA 1W7PB 3HSEA 2MD0A 2F5FA 3BOQA 1GT0C 1S29A 1DGRM 4HEA2 3VFZA 2MYSA 1IRFA 2B0LA 1WI3A 4CH7A 2R7UA 1N75A 5CVVA 1TP4A 2PBIA 1IRGA 4OAYA 1FX7A 5DUIA 2ZJRF 3BPXA 5FRNA 1KU2A 3WTYC 1BR4A 3AL0C 3DQVC 4RAFA 5C44J 3S15J 3EUAA 5HDKA 1U0JA 4XMYA 4GYGA 1D5VA 1QZZA 2EILH 3WU2C 1Z0XA 5H20A 5IT9Z 5GP9A 3TDZC 3OYAA 4PJ0C 1VQMI 1I3QJ 3FWEA 2ZFUA 4ZTJA 2L7FP 5HS7A 2P0WA 3DU5A 3EDPA 1CGPA 4IL6C 4HZFA 4C2UA 4CYDA 3BJ6A 2V6CA 2RAEA 1IUYA 3BR1A 2WV0A 4HW0A 3CJNA 1ZREA 1MDMA 1JXSA 4G7HF 4YIRX 2WAQN 5K5OA 3AL0B 2ISZA 1S7AA 3AG1H 1MH4A 3JSOA 1LUJB 2KIMA 2IBDA 2KJCA 2V1DA 2QQAA 1G59A 1DU0A 3BC8A 3ABUA 3GW2A 3R0JA 1KONA 4CDGA 1OQYA 3LSIA 2WADA 4QIWN 3SHFA 2CW0F 3J81K 4CCJA 4H4KC 3VOEA 3TKYA 2ADUA 3IP4B 2LD5A 1OCPA 3CUQC 1IGNA 1UB9A 2BHZA 2BHYA 5GTIC 2QVOA 3MQ0A 5KAIC 4L5JA 3JTGA 1QGPA 4IRGA 1YTYA 1AWCA 2X48A 4D7MA 2HVSA 1O57A 2L3DA 3B02A 4XICA 5IOYA 4JX4A 4B48A 5J4YA 2M7AA 2JSCA 4MGRA 3SQNA 4ZDPA 1CQTA 1ZR2A 2CQ7A 3R0AA 1X1AA 2DK8A 3QU6A 1DP3A 3FK6A 5EYRA 1Y8RB 2EV6A 4Y4RA 3R60A 4EQQA 2M0MA 4II2A 2OCEA 1KGSA 3TOAA 1RR7A 1RKTA 3VYSB 1J5YA 2QF7A 4EJVA 4EGZA 1BBYA 5IP7J 5BNGA 4UNOA 1JT6A 2FX0A 3CUQB 3ZP5A 2ECCA 2UUZA 2WB1N 2JN6A 2R7DA 1RZ4A 1P7IA 2QKLB 3TGNA 3DPLC 3MCZA 2F5DA 2OQRA 5LHGA 5IYBJ 4D0PA 1J09A 1Y6IA 2EZIA 5M3MJ 3KYLA 3E7LA 4IHYA 2IS2A 5IOZA 2ZB9A 2STTA 4JYKA 3S2HJ 1H88C 2V6EA 5DCMB 2EIKH 3FXMA 3C1DA 4ZYHA 1WJFA 4G12A 4XRSA 2E34A 1B4AA 3OMYA 4U0VA 2QENA 4MO7A 1FYLA 3CQZJ 3TOBA 2I8DA 3L2VA 1ZTRA 1OFCX 1UG0A 2GQQA 3BJOA 1I3AA 3OV8A 3BTCA 3DBHB 2W84A 3ROUA 4EM2A 4ESFA 3JRAA 2LG4A 3DKYA 3KP7A 3ECHA 1T08B 4UB8C 5LHIA 4CXFA 1B9NA 1EV7A 5EG0A 1JT0A 3HOUJ 4WXCA 5FKOA 2QSFX 4FX4A 1FYMA 1USTA 4OIQF 2WY8Q 3UNGC 3B73A 2DU9A 3OOUA 2BY1A 3HTSB 2OBPA 2GIZA 2O61A 1TNSA 1UHWA 2GOXB 2A61A 2VBXA 1B72B 2IGOA 3OSFA 3KZZA 5HVQC 1FMVA 1Y1WJ 1B8IB 3ABMH 3WE3A 3TW6A 1SMTA 1WH5A 4U0YA 4DOZA 2OZ6A 2XSDC 2M8EA 1Z21A 5D5UB 4ANJA 2XC7A 1O3TA 2ZXJA 1ETKA 2LSOA 3IWFA 5GPCA 3Q3SA 3R61A 2FSWA 3FXUA 1V3FA 2CQXA 5C4XJ 2NVQJ 4A3LJ 4BQOA 5EZHA 1VQKI 3ZCOA 1YRNA 3BG9A 3ZGKA 3CCJI 4EVIA 1QHHD 5K1YA 4IQJA 1R7JA 4KYWA 2ZO4A 4IHTA 1PVEA 3Q0WA 9ANTA 4C3IJ 4M3FA 2H6BA 3V4GA 5JI6A 5JFRA 1S7OA 3CCQI 3OYCA 2CU7A 1ZGWA 1FMWA 2OPTA 1PUFB 5H6RA 3L00A 3R6SA 4C2MJ 4RB1A 3L2RA 3BTIA 2IS1A 2CFOA 4HQMA 2VQHA 3H5NA 2O5RA 3NWTA 4A6DA 2XPUA 5HLIA 2V7FA 3RKQA 3CUOA 5H6QA 1YQAA 2Z3YA 3L2QA 2VE9A 2OZUA 2FBIA 2F5EA 4KICA 4BH9A 2EFWA 1O3SA 2HQRA 3D5RC 3K70C 5D6FA 1W36D 2KZGA 3HB9A 3NWSA 2Y0MA 3IKVA 2NOJB 3J7AY 3WTZA 2DPDA 4Y3OA 2XDVA 3DXJF 1WJ5A 5GADJ 3AKZA 1SD7A 3I59A 3RI4A 5DEQA 5E18F 1LVAA 5L3BA 2MW8A 2L7MP 1FOXA 2DLLA 1U5TA 4LGWA 2LF8A 2ID3A 2Q2EA 2VN2A 3W6JB 2OCCH 2Z1DA 3GUDA 4ITVA 2KRFA 4BXUA 1IW7F 4E7LA 1YYVA 4GCVA 1SMYF 1XMKA 4CGZA 3KEQA 1O7FA 2K5CA 4LLLA 4YFXF 1ETOA 1GXPA 1R5ID 5GTHC 2GA1A 4ENNA 3HKZN 3MKZA 3RYRA 2PX9A 3QPTA 3BROA 3RZOJ 3F8BA 5DM6F 2HI3A 3GWZA 2XPVA 4ZYEA 3HYIA 3W6KB 3FBNB 3LQQA 4HX4A 2VPRA 3IL2A 4BYYA 5FFZA 4XN3A 1RNLA 5DV5A 3QRFF 3GFIA 3HXLA 1EA3A 3HOZJ 1BW6A 1F5TA 1LEBA 4ZZDA 1PP8F 1TT0A 3V8LA 1JKPC 4NC6A 3I0TA 3G6EI 5F1RA 1XSDA 4HF1A 4M9XA 3ML6A 3IV5A 1ZG5A 2V9VA 2BVMA 2R5YB 2E7WA 1EF4A 2A69F 3CMMA 1UZCA 1Z3YA 2DI3A 2EV0A 1HC8A 1Q1VA 5EEHA 2F48A 4UVBA 3IH4A 2X6OA 3G1OA 4S04A 2DA2A 4EMSA 2QLZA 2W4SA 3ASNH 4A2UA 2BY3A 3GZNB 1MMAA 4CUGA 4L9JA 4GGGA 2EIJH 4U87A 2YU9J 4BDZA 4UUVA 2DTRA 2DODA 3S93A 3H92A 3BZ6A 1KU7A 3FM5A 2RGVA 4M3EA 2QM3A 5LEKA 4QSHA 2M87A 5D8KB 1O7LA 2HFHA 2NXNB 3PFIA 4IXAA 4JK1X 4ZDLA 1VQ6I 5L3FA 1DP7P 3BG5A 2JK3A 2ELJA 4GO1A 3DU6A 3T8TA 4BNCA 1WJEA 5ILVA 3A02A 1P4WA 4XN0A 2I5UA 2VT2A 1FC3A 4B09A 5CLSA 1VFCA 2JRTA 2NVYJ 3I71A 3ZN0A 4G6QA 3F8NA 1GDTA 3FHZA 2EJRA 2R5ZB 4V2GA 5B66C 1D8JA 2ICWG 2EA2A 2KIUA 3H5AA 3MKLA 5D5VB 1MNMC 1WJDA 2LBFA 4A69C 2VODA 3F8FA 3QYEA 3F72A 2AXTC 2JVGA 1NG7A 5E3LA 4U0WA 1FEXA 2H94A 3J80K 1AKHA 1IN5A 2R7ZJ 4E7KA 3CTAA 3HC7A 2KP6A 3GX4X 4LB6B 2E5NA 1VNDA 4HSTA 4UV8A 5D4RA 1A04A 1SVOA 4JBAA 2VQGA 3K1NA 2EIMH 5CVRA 4PZJA 2HDCA 1OR7A 3CJRB 4I98B 2NS0A 3E5QA 4YFNF 1FTZA 1X3ZB 3CD6I 3M1CA 5DD8A 1AA7A 4R8HA 5HDNA 3S2DJ 4DQ2A 2IS4A 4B3AA 1E3OC 2LF7A 1MGTA 4G7OF 1TWCJ 2BBYA 3HG9A 4XORA 3CMAI 3L09A 2YSRA 1QRYA 3GFJA 3K4NA 1QHGA 1WQ2A 1HKTA 2V1UA 4FHTA 5FLVA 3HUGB 4IKFA 1UMQA 2GOMA 4QTRA 2XROA 1L3LA 3M8FA 2Y2ZA 3ZQHA 1SD4A 2FXAA 3MZ8A 1P4XA 5ILUA 2RNJA 2MGQA 1TW3A 1ZLKA 3CLOA 5FLMJ 1JKQC 2M2EA 2XF6A 2X1CA 4GYIA 4HNTA 1Z7LA 4U7DA 2MG4A 1SFKA 3IC7A 1XDUA 2K9LA 2Q8KA 2HKOA 4YEJA 2F4MB 2ESNA 3ERED 5BMZA 4ENJA 4I09A 5L3DA 1Z6RA 3HBLA 2KRHA 1VQOI 3CCSI 3D5LA 2VASA 1QVUA 1IAWA 3CDIA 1ETQA 5E20A 2L4AA 1P9QC 2QBYA 3K10A 2D45A 1J2XA 1FOWA 1ZH5A 1BIBA 3EUHA 2O0YA 1XMAA 2A6TA 3C7JA 3H0DA 2B7EA 4BEHA 3H9QA 2UZKA 4YG2F 3C2GA 3L7WA 5K5QA 2EFOA 4DZPA 3OS1A 2BGCA 3ZQLA 1IF1A 5F6FA 3E5UA 1LVKA 4F3QA 2YS9A 1JJ8C 4PUSA 3MFKA 3S16J 5HS9A 3BLYA 2ZMEC 2HYGD 2ZC2A 1YS6A 3ZR8X 3NQOA 5FKNA 4LK0F 1ZARA 2EPFA 2KKOA 3PUFA 2K3FA 1IDYA 1Z67A 4HF0A 5IP9J 5JVTA 2EH3A 4NUBA 3G1LA 1WJBA 3LA7A 1O4XA 4IPAA 1TTYA 3ZMTA 4NC7A 5FKLA 3L2CA 3W2WA 1DUXC 2HPIA 3U9GA 2AQEA 4MEXF 1QO0D 3CP8A 1ZR4A 5J47A 2EV5A 1G2HA 3HL2A 3TQNA 1X19A 3TEDA 2P8TA 2E2HJ 3WG9A 4PK4A 5DTDA 2ZMEB 3DTIA 3HHGA 1RI7A 3DBRB 1HW1A 3M9AA 5AIQA 1P7JA 2ID6A 1BR1A 1HSTA 2TRTA 2OQGA 2LKPA 2O8XA 2Y9ZA 4WWCA 2FBKA 4L9NA 2DMUA 3MKWB 3FMQA 2D1HA 4JX5A 1T98A 4RGSA 5F08A 1T38A 3JRFA 2QZ8A 2KDZA 3CCUI 4AU7A 4RGXA 5DCMA 4Z6YA 3OYNA 3S3NA 1X4PA 3BQZA 3CMYA 1IDZA 4HX8A 1W5CC 3CCEI 3I4PA 3F3XA 1MBGA 1TW2A 2CQNA 5JLWA 1DDNA 4W97A 4M3BA 1IN7A 2EFQA 2MH2A 1R1UA 4F93B 1OJLA 4A0ZA 1S72I 2XPWA 3JW4A 2C6YA 4Y52J 2O6GE 2COMA 4PJJA 2EFNA 1OCZH 2VJ5A 3K70D 3EYYA 3DEUA 3HOVJ 5IT9K 4C9YA 4P9FA 2YUSA 3LWFA 2G0EA 2VKDA 5IYDJ 4KA4A 5JHFA 1W0UA 2IGNA 4AYBA 1YW8A 1T8IA 2YPRA 3EPZA 4A3EJ 2A6EF 4JP0A 1OYIA 3IUOA 1U9OA 4G6DA 3VYRB 1T6SA 1XGSA 4RS8A 3MAJA 2PI0A 1IRZA 2KHMA 2TDXA 2JA7J 1IC8A 5FD6A 3K6GA 1Z77A 3I4MJ 2UWMA 1WCMJ 1U3EM 3OYEA 1R5HA 3GFMA 1DQUA 2EA4A 2R7WA 1HSJA 2XASA 2FNPA 5C4JJ 2L9SA 2LYCA 3BTLA 5CPRB 4JQFA 3CDHA 2KQRA 3WTUC 5HODA 3CCRI 3GXOA 3N97A 3SZGA 3ZMZA 3JRHA 2HKXA 2X6WA 4IHXA 1E3PA 4F92B 1DPRA 2Z9OA 3LOCA 1LQ1A 5FJ8J 5K5RA 2P81A 1TQIA 1SFUA 3EETA 5HLTA 3H3ZA 3K4MA 3A01B 2QSGX 1Y8QB 3RJPA 2W48A 1MNDA 2PMZN 1O3QA 2ME0A 2O03A 2Y31A 3IAS2 4XLPF 2DT6A 3SEZA 3W2VA 1MH3A 2IVMA 4M3DA 4GRIA 4A93J 2XF7A 4E70A 6PAXA 5E3NA 4E7HA 2K4JA 3H35A 3MZYA 4F55A 2RN7A 2DDBA 2P5VA 3P7NA 3VSLA 1U8RA 1MBHA 2RQQA 2NVXJ 4CZCA 3FISA 4F91B 3BTJA 4IOAF 1MMDA 1X1PA 4KISA 2DA6A 1VI0A 2WBMA 2QKMB 3B6CA 3GVAA 3G4SI 2BVLA 4EGYA 2Y30A 4OINF 2HNHA 3VPRA 4A6EA 2AO9A 1YJ9I 2E1NA 2V1NA 3LSHA 2QBYB 2VQLA 2UXNA 3F6OA 5TISC 3GZ5A 3H5RA 3IHUA 3S17J 3EYIA 1K78A 1JUPA 3WE2A 3H3UA 3F9KA 3RQ4A 2HOTA 1YX5A 2O3FA 4G94A 1QBJA 1ON2A 4LIVA 2A6HF 1FPQA 3QPLA 1LFUP 4I76A 3OYKA 1IZ1A 4L18B 5GAEJ 1EH8A 2KISA 2KRCA 1HW5A 1FNNA 2E36A 4M72A 4H0EA 5KVRA 3WTWC 3SJMA 4CCNA 4B8XA 1YJNI 2DN0A 3D5SC 2X4HA 3JAMZ 5IPAA 4AC0A 4WX9A 3ZOBA 1UJ8A 2ELHA 1I1SA 2E71A 1T33A 2PJRB 4XRMA 3JRBA 2G7UA 2DO7A 1ETXA 2DMPA 3S32A 2RREA 3ISPA 4KN7X 3OOPA 2LR8A 2QUFA 1UELB 3DFGA 2FA5A 4HNVA 4UHTA 1MBFA 2LMDA 3RPQA 3G73A 2IPQX 4I7HA 3FXRA 1R4NB 3WTSC 3BR6A 5KHDA 3LSGA 2X51A 1S5LC 2O7OA 3K4BA 2NNYA 2DQLA 5FO5A 4OMZA 1GXQA 1JUMA 3DEEA 2PLYA 1S9HA 2HDDA 2P4WA 4EJTA 4RAYA 1YJWI 4E6KG 2DTZA 3UKGA 4M74A 2MABA 2NRAC 5BOXA 4PSXA 4ZH4F 4HV6A 5FGMA 2XB0X 1YO5C 3RZDJ 1BI3A 2MC3A 5FLXZ 4LFUA 3K4CA 5M5WJ 4LG0B 5IY5H 5FRMA 1E3HA 4E7SA 1V54H 5FD5A 4IEJA 2W00A 2QSHX 4CYCA 1UFMA 2LC2A 4EEFG 3DPTA 4CCMA 5HOOA 3A4CA 2E5ZA 2J5PA 4OIPF 1FSEA 3U2RA 4I99C 4PJMA 1FOYA 3DF8A 1OLTA 3WTXC 2E1CA 3JREA 3K2ZA 3M8EA 3DPUA 1FT9A 1W0TA 4OU0A 3RYPA 3MVPA 2EK5A 1TL8A 2VPLA 1LFPA 4RB3C 1B1BA 1W4MA 2FOWA 5D4SA 4ZDOA 3TL4X 3R4KA 3QU3A 3SXYA 3H9JA 2DW4A 3OY9A 3C18A 2L7ZA 1F1ZA 2H6CA 3GYHX 4R1HA 2CJJA 4MEYF 1TWHJ 1OYYA 4E4HA 1XTAA 2KPMA 2VLAA 3I58A 3OYDA 2W1OA 1H8AC 2L7KA 2VB6A 1I6HJ 2V26A 2LLKA 3SYTA 3M4OJ 1WKMA 1XC5A 1RUOA 1TC3C 5CJ9A 5HS8A 5D6EA 2LREA 2Y9YA 2RV8A 3I54A 4ASNA 3RSNA 1HLVA 2D2WA 4AIKA 4WXDA 3K2AA 5B1BH 4ZYGA 3MD2A 2XGEA 4HSRA 2NYXA 4PSWA 4UUSB 2H1LA 2JMWA 3WU0A 1I1GA 3FXOA 4L0ZB 3D0SA 2V9KA 5EGOB 1GVJA 4IO9F 3BY6A 1HBXG 4XSXF 2VBYA 1R5GA 1SANA 3ZMUA 4BACA 3OYGA 2FE3A 1XGNA 3TO7A 4KUMA 3A0HC 5LGNA 1IN4A 3M3YJ 3RKXA 3K9TA 3QYBA 4G7ZF 1FTTA 3HUGA 5E79C 2ECBA 4HX7A 1MNEA 1WZ2A 2KLOA 2V4JC 2Z2SB 4XL9A 4B1RA 2XHKA 2NNNA 2FJ1A 5LEJA 1RR8C 1KYWA 1J7KA 4QLCU 4ON0A 3AG3H 3HZJA 5CVJA 2LH9A 2OTLI 3LL7A 3KLNA 3KP2A 4ZTFA 1BI2A 1MSFC 4LIUA 1LDJA 4A12A 1YS7A 2HTSA 5AONA 2TCTA 2BW3B 4RGUA 2DPUA 5E8GA 3TP0A 5EJCA 2WV1A 1OMIA 5GPAA 2XGXA 1VQPI 4KNYA 1LEAA 4Q4ZF 3GLXA 3DTKA 4IZZA 4NB5A 3LFUA 2WC2A 3N05A 4Z2YA 1DPUA 1XCBA 4E7JA 1X2NA 1GV2A 2XAHA 3V7RA 4B44A 1K83J 3U1KA 2G7HA 3OYFA 5HNHA 1FLIA 1RPWA 2GWRA 3KYCB 4C3JJ 5TJJA 1U8BA 2MSYA 2ESHA 3EUKL 3BP8A 3WGGA 2LOOA 1QU3A 1JGSA 3ELKA 3CO6C 2LY1A 3S3OA 2K9QA 1QNTA 3I4NJ 4BQQA 1UHMA 3PJRA 1KZHA 4M6XA 3LAJA 2QCOA 2F4IA 3BT9A 2K3PA 2M34A 3SEQA 3OYBA 2AS5F 5K7HA 1IG7A 1WWXA 3RQIA 2OF7A 2NAZA 4IHVA 3VYUB 5J8FA 1XMXA 3LSMA 4HG2A 4YIIA 4AVZA 5GAGJ 3OS2A 1ZAOA 3KIOA 2M3AA 3I9V2 5LLQA 1HKSA 1T0FA 4ETSA 2YR2A 3GTOJ 1WH7A 3JTHA 4BKXA 4KT6A 3CO7C 4I6ZA 5H2FC 3DKWA 3FK7A 3GLLA 1NK3P 3UR3C 1Y56A 3GTKJ 4ZC3A 4GFBA 2VUMJ 5J1YA 1GV5A 2KMUA 4CSWA 2M8GX 4M9SA 3HSFA 4AWXB 4DJAA 3LSJA 4LLGF 3REOA 3LNQA 4B4CA 3KP3A 4II3A 1RKWA 2ZKZA 1D5YA 2LK2A 1ZRFA 5E1WA 1S6LA 1NTCA 4DYRA 2R3SA 1REPC 2V9PA 2OD5A 1SC7A 5DD4A 3CLQA 2FUG2 3FXKA 4RLFA 1JUSA 4KITB 3T1BA 1OCRH 1BI0A 1POGA 1XGOA 3P9KA 1J59A 1ZELA 1J0RA 1FIPA 3IH2A 5B3SH 1R9TJ 3V7SA 1ZK8A 2RDPA 5F0CA 3GZ6A 3HDDA 3M07A 4M6YA 1YLFA 3FX3A 4NNJA 3I5UA 5D5WB 5J1UA 3LA3A 4XKWA 2M4KA 3A0BC 3SZPA 4HAMA 5KK1A 2M0CA 4CCOA 4P1WA 2L02A 2LTPA 1H9GA 1Z91A 2ELKA 4XRSG 1WJAA 1TNTA 2BEOA 2IA0A 3F8CA 3BZKA 5F0FA 1R1VA 2ISYA 1WPKA 1X1BA 1VQ5I 1SD5A 1U78A 2CV0A 1SAXA 2IEKA 3G2BA 2R7FA 4ZYAA 4EM1A 1XX5A 4I0BA 1JTYA 2CWEA 3Q9VA 2XAGA 4G8XA 4DIQA 5GAHJ 1G3SA 3V7CA 3H36A 4XLAA 2W82A 3OYMA 2FU4A 5KAFC 4KFCA 3CCMI 2QA4I 1C0WA 2ETHA 1MIJA 3E6DA 4KMUX 3LQRA 1XSVA 4P9UA 1LJ9A 2DMQA 3F23A 2VBZA 2BE5F 2PQ8A 2GM4A 1MW7A 2EB7A 2MC4A 3D1NI 2IJLA 2IRFG 3X2QH 1VF9A 4BHCA 2JSPA 2RKHA 3KZIC 3QP5A 2EZHA 2HVRA 2N8GA 4BQNA 1D1BA 2A5YB 3RCOA 4N0BA 5EEGA 2XAUA 3U21A 4RAGA 3FKIJ 2QQ9A 4YFKF 1W7PA 2L0KA 5F04A 1G3TA 1L0OC 2CW7A 4NQWB 3SDBA 3GCMA 4HA8A 4OIOF 4S05A 2JA8J 1TWAJ 3TW7A 1FOKA 2PMUA 4Y13A 3OR2C 1YRNB 1SFXA 3BR2A 1Z3XA 4MTDA 2HOEA 4MIMA 1IV8A 5L3CA 1LB2A 3IRQA 3EQLF 3RPUD 1BOAA 4D1QA 3PFYA 2ZSIB 2FEZA 1MMSA 1BOBA 1P92A 5ICCA 1X3UA 3S1RJ 2H27A 4RGRA 2BXYA 2DOFA 4J01A 1WJCA 3ZN1A 3WTTC 1E17A 2ZJQF 1FJLA 1R1TA 1U5TC 5ICEA 2W24A 2KJBA 2K4BA 4FE4A 4IF4A 1OISA 2VOPA 1PDNC 4Y17A 4N9HA 2FQ4A 5TGTA 2MLKA 2IGKA 2VQCA 4PCQA 2DFEA 3BPVA 1D0XA 5CVUA 3HSRA 5KCMA 4OIRF 2H09A 2XB5A 4BBSJ 2FMLA 2XF5A 3NARA 2HWVA 3LA2A 1R49A 5DS9A 3AG2H 1SFEA 3WHBA 1BR2A 4XLEA 3ZQIA 1MMNA 1AU7A 4C2TA 4Q48A 4NC8A 2BV6A 5EF6A 5M5YJ 3MMYB 4X6AJ 1QA6A 2MH9A 2HYFA 2QWWA 4UVCA 3WGIA 4M73A 2MD5A 2L2OA 1A6IA 2DOEA 3KCCA 4HQEA 1ZYRF 4CZZA 1FP1D 2E1MC 4LK1F 3PSFA 3QYFA 2E19A 1TWGJ 2DA5A 4RM3A 2OJED 2EWNA 2VT3A 3DCFA 4LG3A 4YIFA 1ZLJA 2JA2A 1LDDA 2DA1A 2ZXIA 2QQ8A 3S2WA 2GXAA 1A5JA 1X1DA 4A3IJ 4X1EA 2JUCA 2LDUA 2PFBA 4YRVA 2LY9A 2CW8A 1K4TA 1HA8A 4RM2A 1ULYA 3F6VA 1K61A 4I2OA 2VJ4A 3JRCA 1MJAA 1ZHFA 1R36A 1HDDC 2BOLA 2LP0A 2M9HA 1FWZA 3FZVA 3A1YA 5JVGF 4O3MA 5HNFA 1K7AA 2A07F 4OWRB 5F1JA 2VONA 3C3WA 3CC2I 4S0HB 2DFFA 1UG2A 3J7ZI 4C3HJ 2E1MB 3P9CA 5CQEA 3LFKA 4BGDA 3KETA 3KFWX 3T8RA 3IWZA 3CUQA 3NAUA 3GTQJ 3J7YJ 3BDDA 1Z05A 3BR0A 2YX7A 3OIOA 1YX3A 5ICGA 5K7FA 2X85A 3E97A 1RRJA 2QGUA 4JOMA 3WTVC 2K40A 1E2XA 3HOYJ 2IW5A 1SVMA 2PJPA 3DTEA 2GA2A 2EZKA 2Y0SA 4PJLA 3Q5FA 4KMFA 4BL0B 4HV5A 2DAOA 3C2HA 2FRHA 3K4JA 4XKCA 1DGWY 3OL3A 4AIHA 1YI2I 4A3DJ 4N4OB 1GVDA 3RDIA 4BS9A 1Z9CA 3OYLA 3OS0A 1VQLI 3HOXJ 3Q0VA 3BWGA 3KP5A 2K86A 3HGGA 1KU9A 1PP7U 2ZBKA 2MBFA 1UCRA 2CUEA 1LNWA 3GTJJ 4L9TA 2HYJA 3OL4A 2PN6A 2NVTJ 1ZG3A 3HGYA 5J6XA 3RTRA 5ICFA 4IQ4A 3A2KA 3TO9A 1J9IA 3GFLA 2W25A 4B43A 3OYJA 4WCGA 5LGUA 2YX4A 1HOMA 2RQPA 3FF5A 2L54A 2M4GA 1T95A 4IRHA 3VEPA 3ZRGA 1OR7C 1I6XA 1EJ9A 3SFZA 3ESWB 5D5XB 5E8IA 1XSXA 2OTJI 2JT1A 1D0YA 2M1BA 3BJAA 2WAFA 3L2WA 5TRDA 4M9ZA 2K9NA 1YFHA 1BA5A 2YU3A 1ERDA 2OV7A 4MLOA 1B72A 3VWBA 2JRMA 4PFOA 1I50J 3E6MA 2J5OA 3I3LA 1V5GA 4HDVA 2XAFA 5HLHA 4HF2A 3RKYA 1B8IA 4BHBA 4WXHA 3QODA 2CG4A 1AKHB 5J4VA 3O3KA 2GXBA 2WTEA 3G3ZA 1HXDA 2F4OB 3MEXA 5J8CA 2R7XA 2BYVE 2VKHA 3WHCA 3ABTA 3SZTA 2CQKA 2K85A 2JZYA 3JSPA 2CV2A 3FIWA 2ZXHA 1Y1VJ 3E0JB 3MKYB 1TQPA 3BZCA 3GTLJ 1GLNA 1R71A 1Y0NA 4IVNA 1D8KA 2FOKA 4UUSA 3TDUC 3KLOA 3IRRA 1TQMA 2ZNYA 3Q0UA 2JJ7A 4L5EA 2HOAA 4DW6A 1RUNA 4PGGA 3JAMK 5E3OA 4RB0A 2IT0A 2CQQA 3W6VA 1SVLA 2R7VA 1I39A 4XRFA 4NDLA 4A3GJ 2JA5J 2NS8A 4QWQA 1MJ9A 2DT5A 1BC7C 2HTJA 3CESA 1PUFA 2DOAA 2Z16A 4Y15A 3I53A 1GHCA 1B59A 1XPXA 1A6QA 4XONA 4MHGA 1A36A 4I01A 5DCFA 1S3JA 2V79A 3EUHC 3IKTA 5BS6A 1QQIA 2XSJC 1RETA 1N78A 3VSKA 2EFPA 4J19A 1WSUA 1TZLA 3HRUA 4A3CJ 4WF2A 4FX0A 1FSHA 2VI6A 2X1EA 4L9VA 2JVHA 2BW3A 2WAEA 4CO8A 1YW9A 3KX2A 1D1CA 3PIOF 1K6YA 3S1MJ 4RLQA 4QPQA 1A35A 4BQAA 3F22A 2NOGA 1FYKA 4MNUA 2EZLA 1FIAA 2HU9A 3BR3A 4HLYA 1K79A 2R7TA 1USSA 5JHUA 4LD5A 2FF4A 1G3YA 3DKXA 3PQKA 5FLXK 1X4OA 3JRIA 2JPCA 2E7XA 3FM3A 5CYVA 2XAQA 4GXOA 2W57A 2CV1A 1FBUA 5E1XA 1CF7B 3ZMSA 1XD7A 1YITI 1VZ0A 1G8XA 3C2BA 1VTNC 4XKBA 3GEZA 4BEHB 2IS6A 2CMPA 3BCBA 3PNVA 3M8JA 1JTXA 5LRRA 2L4MA 2LKSA 1ETVA 4HBLA 2XIGA 3ERMA 3ULQB 2ZCWA 2K9SA 2GXGA 1YG2A 1YOVB 2M45A 5CVIA 4CCKA 4DBQA 2Y0SN 4EJUA 2H8RA 1KA8A 3BG6A 1ZRCA 4OOIA 3PNYA 4M71A 1STZA 3GBGA 4HDUA 3GO5A 2IA2A 2ZNZA 1G3WA 3L2UA 3QAHA 1FP2A 4KN4X 3LSPA 1MKMA 1BJAA 3HRSA 4UY8I 2VKEA 2W7NA 4F7ZA 1PUEE 3V8KA 1BM9A 1WGXA 5HLGA 2PEXA 2QEXI 2R5YA 2FMYA 2WA0A 2GBYA 1BL0A 2XGCA 4HLXA 2AXLA 3DWLE 2XVCA 4TV7A 1P4AA 4BU2A 3GTGJ 4P96A 4AYBN 2KZVA 4I02A 3U1DA 5E3MA 1ZN2A 4NBQA 2O9LA 1S7EA 2DA7A 3HKZA 2HXOA 4PGHA 2R7SA 2COBA 2Y69H 5EDNA 3FBIB 2HOSA 1TLHB 4XOPA 4A0XA 1X2MA 1T2KA 1HW2A 3CZ6A 1D1AA 1LE8B 1NK2P 1SAUA 4MQ9F 4BXFA 5J1RA 1VQ8I 3FXQA 3O2PE 4HNUA 4XBFA 4CA0A 2H1KA 3PO2J 1A31A 5J40A 2E2JJ 3SFIA 2D1VA 5KNLA 2GIVA 1Q1HA 1W1WE 2OA4A 4XLCA 2H8WA 3CCLI 3HRTA 4EM0B 4GDFA 1WVRA 3LMMA 2BY0A 1OYWA 4HOBA 2JQ7A 2LKXA 3MN2A 5LHHA 4DZJA 3J81Z 1ORKA 2DK5A 4LITA 2E1OA 1JHHA 1HKQA 2JPBA 5IYCJ 4EATA 2DMTA 2EBIA 3IAM2 2Z33A 4L0YB 4U88A 2DBBA 2A68F 4XQFA 2ZSHB 4M6VA 1T39A 4BE0A 2R5ZA 2F2EA 1K6OA 3HOWJ 2VL8A 4FE7A 1MBKA 1YW7A 1F4KA 5IP6A 1R23A 3QP6A 2XRNA 3QPHA 2VJIA 4HRIA 4BY1J 1PYVA 3GMEA 1OCCH 2R0QC 2AQFA 2DJNA 3E3VA 2WWYA 4FT8A 2VKVA 4LOCA 3KEYA 2IGMA 1XB4A 3M1EA 4E7IA 1LKXA 3FDYA 3BG3A 1B9MA 2DA4A 3F8MA 2NVUB 1ITYA 1O3RA 1F36A 1BC8C 4FISA 3CJTB 3K4LA 4ABZA 2BXZA 4KJZA 3T5XA 3F0CA 5CQGA 3HPGA 3K1MA 1QVTA 3GF2A 2GZWA 1S8NA 3CCVI 2CS3A 3LSTA 4NQWA 3ABKH 4FQGA 1BW5A 3ZQCA 5EZGA 2LVSA 2K7LA 4BJTA 5M5XJ 4KT5C 2HR3A 1XN7A 2Y75A 4BHPA 2FD5A 5AIPA 2L9VA 4BDYA 3F21A 2RNGA 5DYMA 5CKTA 2STWA 4C30A 3VDXA 1ZRDA 1IRXA 1MJBA 2JUGA 2QYOA 4KIFA 5D8LB 3I55I 1FZPB 2EINH 2X1DA 1YIJI 3KEOA 2IAIA 5FROA 2E2IJ 2F5VA 3E6BA 1SEUA 3CJQB 4DNCA 3VYTB 1QPIA 1VQ9I 3P9IA 1R22A 1KQ8A 2XRLA 4XLFA 3MZHA 1B6AA 2LY2A 3AAFA 4AIJA 1SD6A 2VJJA 3Q9SA 3PIPF 4UB6C 1ACIA 3S1NJ 1MDMB 1APLC 3HTUA 4ENKA 5F64A 2PMHA 5LFAA 3LAPA 3MWMA 2HVQA 3BQYA 3K4KA 2F6CA 1TWFJ 3O6BB 3E6CC 2P7VB 2XUBA 1H9TA 1F43A 4Y7NJ 3DLAA 1WRJA 4ESBA 1MMGA 3AFHA 3OYIA 3DLLF 1K78B 4IRIA 1IV6A 3HHHA 1RIOH 2L9RA 3KPHA 4B3XA 2P5LC 2R92J 1YHQI 2X0LA 1FBSA 4J00A 4DYQA 3QQAA 3K1PA 4F52A 1HCRA 4A3BJ 2KL4A 2KDOA 4PFPA 3PSIA 1OPCA 3NEUA 3WODF 3L1PA 2OUMA 2DMNA 1W7PD 4KDPA 3H0GJ 3I64A 4RMNA 1ETYA 5DUKA 4Q47A 2HQAA 2A05A 2DCEA 3QPSA 2M30A 4A3MJ 5ED4A 3TBIA 3DP7A 3G71I 1ETWA 1HDPA 2Z5UA 3BCAA 2BZTA 1FY7A 2DJIA 2Z99A 2X6XA 1JI8A 1BN5A 1KYZA 5FFXA 5LD2C 1M1EB 3BG7A 2ZMEA 3S1QJ 1XDSA 1OCOH 2EQRA 4BAYA 1XGMA 3CMEI 3K69A 5EEAA 1X3WB 1Y0UA 3QWLA 5FKMA 3WU1B 2BY2A 1ZG1A 4DBRA 2JA6J 1IN6A 4ESJA 1AOYA 1QZYA 2XKPA 4UXNA 3ZPLA 1IJWC 4KIGA 1KU3A 4LLNA 3DEWA 1LFBA 1NHAA 5BPDA 3OSGA 5LBQA 5HDGA 2L5QA 4QPOA 4XM3A 3FMSA 4ZYDA 1VQ7I 3W2AA 1G6NA 3OR1C 4OMYA 4MFDA 3HPHA 4BE2A 2MLGA 4EJWA 3S3MA 1BIAA 1ONVA 3O8HA 4ZJZA 3KP4A 1FBQA 3O8GA 2VOOA 2HZTA 4CYCB 2CUJA 1UAAA 1JKRC 2LFBA 5FKKA 1EH6A 2Q0OA 5BPIA 2E60A 2KT0A 2KFDA 1LDKB 5EG0B 2HS5A 1RESA 5J3LA 4ENMA 3OYHA 3ABLH 1R00A 4BBRJ 3JRDA 1BJZA 2L01A 3S8PA 2KIFA 1JJ6C 2X6YA 3DBLB 2V1XA 3KE2A 4RA2A 3OIQA 2OC6A 3E1SA 5ILSA 4DGWB 1LPQA 3PQJA 2DXIA 2MFZA 3CC7I 3FKJA 4HYEA 4O6JA 3KZYA 2LNBA 2R7OA 1I27A 4AVPA 3W3CA 1ODDA 2HZDA 1V5EA 3KYDB 1R58A 1TBXA 3I56I 4AIDA 2DFHA 2ACJA 5A2QK 3L9FA 1IXSB 4XK4A 2DDAA 4O5VA 4IX7A 4I0AA 1JGGA 4YELA 1N77A 2HEOA 4N4NB 2IXSA 2LRDA 5JLXA 4LMYA 4FETA 1SFOJ 2OAZA 5JR3A 2R7RA 3ONQA 1K4SA 2HPMA 1KQ9A 4D9JA 4FCYA 2E35A 3H1CA 3TP3A 1WHUA 1GUUA 3NRVA 1P6RA 5LGTA 4A3FJ 3A03A 3PO3J 1D0ZA 4OAZA 5ERIA 3A01A 2DYSH 4U7BA 2G9WA 4XSZF 2ME6A 4N9IA 2UV1A 3VB2A 2PG4A 3HM5A 5FB2A 4KIBA 3PUBA 5M3FJ 4ZZLA 4L5IA 1YIOA 4A5MA 2W85A 2P6SA 1ZKGA 2OU2A 1QZEA 3HIFA 3FHNA 3V42A 2R7QA 2ZXWH 1I5ZA 3P5JA 2F5CA 1XG1A 1Z6TA 2CH0A 1U2WA 4FASD 2WY7Q 1MSEC 3PL8A 2HXIA 1ZQ3P 1J75A 2IA1A 2P6TA 2ZJ2A 3RKWA 4XNFA 2O8KA 2P7CB 4R79A 5B1AH 2Y48A 2K9MA 4BE1A 1AHDP 3FXLA 2CSOA 3FMRA 1W5SA 3I59B 2VC1A 1ZGAA 3AG4H 2MA3A 4UUTA 2CRGA 3JR9A 3ZXSA 5E17F 2XKOA 1U5TB 3IH3A 3CF2A 3M7GA 3HJEA 3QOPA 2Q2EB 1T0FC 2FQ3A 4XKVA 4LJZF 3J80Z 3JRGA 4A3KJ 1DU6A 3WG7H 1X58A 3ZQ7A 3TMOA 1OCTC 2HQNA 5E1ZB 2HQ5A 3HEFA 1MBEA 2VXZA 1CF7A 2PMZA 1IXRC 2XGDA 3ZQFA 3E5XA 2FNAA 4G6TB 2DA3A 4X0GA 2HGCA 1H0MA 1G4DA 3KP6A 2VBWA 2M7BA 4BJ5C 3LSRA 4FTHA 4K2EA 4XLNF 3N4MA 1XCVA 3CP2A 3H9GA 3K7AJ 2ZJPF 3VODA 1F9NA 1HQCA 2ZFWA 2KIQA 4JX6A 1JE8A 2L9NA 5LRSA 5A2QZ 1H89C 1NH3A 4V19K 2PJRA 2VIXA 4MTEA 2CO5A 2JTVA 2WAQA 1YE9A 1UHSA 4AUXA 2CUZA 2VXDA 4IOCF 3GTPJ 1RC9A 1Z1DA 2IP2A 1V55H 4M3GA 4RDUA 2I10A 2NS7A 1MD0A 3ZQQA 4DYCA 1HF0A 1IXCA 2XV4S 3GTMJ 2K02A 2DYRH 5L3GA 2DFIA 2VC0A 1ZGJA 4UVAA 5F27A 2B63J 1R6RA 3LSKA 1X1CA 4RBOA 2HDWA 4BJ6C 4G9YA 4BY7J 3H3VK 1IO2A 1JHFA 2X9DA 4A5NA 5DDGA 2R93J 5B5EC 1IUFA 3ASOH 4XLHA 4A3JJ 5BQTA 1IN8A 1NG6A 1V4RA 3JCUC 3ZMDA 4P55A 1TT5B 3PM1A 3TO6A 4XOTA 2A3SA 1N25A 3HRMA 3S14J 1EH7A 1MZBA 2CFXA 1U6GA 3RPUA 1W36C 4LG0A 4PJNA 3HOSA 3ECOA 4AD9A 3QOEA 2P5KA 4D7NA 1LE8A 2DT7B 2XAJA 1KQ0A 2B9SA 4CHUA 1Y39A 4B47A 1PJRA 4EJOA 2VE8A 4RB2C 4P5OA 3J7AO 1R4MB 4E7ZA 3OWTA 3G1MA 4CICA 1WFXA 3CCYA 4A0YA 1JKOC 2RC4A 1Z7UA 4IHSA 2CGPA 3HOTA 3OIPA 1P2FA 2RVCA 2CYYA 2WB1A 4XIDA 2M5WA 3T0YA 2DQRA 2Q1ZB 3B6AA 3PNTA 4W1UA 3ZMVA 5DM7F 5K7ZA 1QPMA 2UXXA 3CC4I 2K27A 4UV9A 3FXJA 4MFEA 4BUPA 1VQNI 3BR5A 2FBHA 4XR6A 5IT3A 3DV8A 5F0HA 2D5VA 2R4GA 4PDKA 2JWTA 2A5WA 2QQBA 4RAZA 2LBFB 1ON1A 4MQVA 1MBJA 4IJAA 1EKEA 4Y33A 1BI1A 4IHWA 1T56A 1OKRA 1U9NA 4HPQA 3CF5F 4Q5SF 5C3EJ 3ZQGA 4D5CA 1V5FA 1XS9A 3K0LA 4CCLA 1ENHA 4AM3A 3COAC 3V8JA 2AHQA 3SDGA 3RIRA 4V2FA 3WGHA 4WK8F 4BXXJ 3CDLA 2CUFA 2GAUA 2GLOA 1D3YA 4LB5A 1W5TA 1WI9A 5EGOA 1VQ4I 4NHJA 1E0EA 4EV0A 4D5FA
chains in the Genus database with same CATH topology
3GTKJ 1ORKA 1ETQA 2E1OA 4GFBA 5IYCJ 2VUMJ 1GT0C 5J1YA 1GV5A 2DMTA 2EBIA 1WI3A 2M8GX 3LSJA 4M6VA 3LNQA 4B4CA 1RKWA 2R5ZA 1D5YA 2LK2A 3HOWJ 4FE7A 1NTCA 1MBKA 4DYRA 4DZPA 5C44J 5IP6A 3S15J 3ZQLA 2YS9A 1JJ8C 3S16J 4BY1J 1JUSA 2R0QC 2DJNA 1POGA 5FKNA 2VKVA 1Z0XA 1FIPA 3IH2A 4LOCA 1IDYA 1R9TJ 5IP9J 2EH3A 1ZK8A 5GP9A 3G1LA 3BG3A 5F0CA 1I3QJ 2DA4A 3HDDA 2L7FP 5J1UA 1ITYA 1O4XA 1F36A 4FISA 2RAEA 3BR1A 4ABZA 2M0CA 5FKLA 2LTPA 2ELKA 4XRSG 3F0CA 5F0FA 1QVTA 1WPKA 2WAQN 1U78A 1ZR4A 2IEKA 1G2HA 1MH4A 1BW5A 2IBDA 3ZQCA 5EZGA 2LVSA 1DU0A 1JTYA 2E2HJ 5DTDA 5M5XJ 2FD5A 4QIWN 1P7JA 2ID6A 2TRTA 2Y9ZA 2LD5A 1OCPA 1IGNA 2DMUA 2DMQA 4JX5A 5F08A 2GM4A 2IAIA 2X48A 4D7MA 3JRFA 2E2IJ 4XICA 5IOYA 3D1NI 2KDZA 1VF9A 4JX4A 1QPIA 2XRLA 1CQTA 1ZR2A 3BQZA 3CMYA 2EZHA 1IDZA 3S1NJ 1MBGA 2N8GA 5JLWA 4W97A 1APLC 4M3BA 1OJLA 3FK6A 5EYRA 2XPWA 3FKIJ 4Y52J 2L0KA 5F04A 3BQYA 2JA8J 1TWAJ 3TW7A 1RR7A 1RKTA 1TWFJ 1YRNB 3HOVJ 2QF7A 3BR2A 4MIMA 5IP7J 2YUSA 5BNGA 2G0EA 5IYDJ 1JT6A 2FX0A 1W0UA 1F43A 2ECCA 4Y7NJ 2WB1N 2JN6A 4A3EJ 4JP0A 1P7IA 1IV6A 3S1RJ 1U9OA 2L9RA 5IYBJ 2R92J 2EZIA 5M3MJ 1IRZA 3E7LA 4IHYA 4DYQA 1FJLA 3QQAA 5IOZA 2JA7J 4A3BJ 1HCRA 2ZB9A 1IC8A 4FE4A 4JYKA 3S2HJ 1H88C 1Z77A 3I4MJ 1WCMJ 2FQ4A 4G12A 4XRSA 3L1PA 2DMNA 3H0GJ 5C4JJ 4BBSJ 4MO7A 2XB5A 1ETYA 3CQZJ 3BTLA 3NARA 1ZTRA 1OFCX 3QPSA 5DS9A 5HODA 4A3MJ 3WHBA 3ZQIA 3BTCA 1AU7A 5EF6A 5M5YJ 3JRAA 3JRHA 1ETWA 1HDPA 4X6AJ 4IHXA 5EG0A 1JT0A 3HOUJ 5FKOA 1A6IA 3LOCA 5FJ8J 3S1QJ 2P81A 3OOUA 2EQRA 2E19A 1TWGJ 2DA5A 5EEAA 3A01B 3DCFA 5FKMA 2W48A 2DA1A 1B72B 2PMZN 1A5JA 2JA6J 4A3IJ 4X1EA 2ME0A 2Y31A 2LY9A 1IJWC 3OSFA 3DEWA 1K61A 1LFBA 1Y1WJ 1B8IB 1MH3A 3JRCA 4M3DA 3OSGA 4A93J 1HDDC 3TW6A 1WH5A 2XSDC 2LP0A 2M9HA 5E3NA 4MFDA 5F1JA 1MBHA 2NVXJ 3O8HA 1ETKA 3FISA 3O8GA 5GPCA 3Q3SA 3BTJA 4S0HB 4CYCB 1UG2A 1JKRC 2LFBA 5FKKA 2CQXA 4C3HJ 5C4XJ 2NVQJ 4A3LJ 2KT0A 2DA6A 1VI0A 5EZHA 3B6CA 5EG0B 1YRNA 1RESA 5J3LA 3BG9A 2Y30A 4BBRJ 3JRDA 3VPRA 3NAUA 2AO9A 3GTQJ 1BJZA 1JJ6C 3Q0WA 9ANTA 3BR0A 3OIOA 4C3IJ 4M3FA 3S17J 5K7FA 1JUPA 2HOTA 2K40A 2CU7A 3HOYJ 2EZKA 1ZGWA 2OPTA 1PUFB 3QPLA 1LFUP 4I76A 4C2MJ 4A3DJ 3BTIA 1GVDA 3HOXJ 3Q0VA 2XPUA 3SJMA 3HGGA 3RKQA 2CUEA 2DN0A 4XK4A 3GTJJ 2NVTJ 2HYJA 5IPAA 4AC0A 3HGYA 3ZOBA 1JGGA 1T33A 3HB9A 4XRMA 3JRBA 1ETXA 5JLXA 2DMPA 1SFOJ 1HOMA 2LR8A 4FCYA 4HNVA 1MBFA 3TP3A 2MW8A 2L7MP 1GUUA 3BR6A 4A3FJ 3A03A 3PO3J 3LSGA 2ID3A 2O7OA 3A01A 2K9NA 1BA5A 4MLOA 1B72A 2ME6A 1I50J 1JUMA 2HDDA 3HM5A 5M3FJ 1ETOA 3HKZN 1ZKGA 2DTZA 1B8IA 3UKGA 3RZOJ 1XG1A 2HI3A 1AKHB 2XB0X 2XPVA 3RZDJ 1MSEC 2HXIA 5M5WJ 1ZQ3P 2VPRA 3WHCA 4IEJA 2O8KA 4CYCA 3FIWA 4EEFG 1Y1VJ 3HOZJ 3GTLJ 1BW6A 1AHDP 4UUTA 4UUSA 3JREA 2CRGA 1JKPC 3JR9A 1W0TA 3IV5A 3IH3A 3MVPA 3Q0UA 2JJ7A 3TEDA 4L5EA 2HOAA 3JRGA 2R5YB 4A3KJ 4DW6A 1DU6A 5E3OA 1X58A 1OCTC 1EF4A 2CQQA 3W6VA 2HQ5A 2L7ZA 3HEFA 4NDLA 1MBEA 4A3GJ 2JA5J 2CJJA 2NS8A 1TWHJ 4DZJA 1Q1VA 2XGDA 3ZQFA 1PUFA 2DA3A 3IH4A 2X6OA 3G1OA 1H8AC 2DA2A 1I6HJ 2LLKA 3LSRA 4FTHA 3M4OJ 1XC5A 1RETA 1TC3C 3K7AJ 4J19A 4A3CJ 2YU9J 2VI6A 2Y9YA 4JX6A 1HLVA 4M3EA 4QSHA 1H89C 3K2AA 2XGEA 3S1MJ 1UHSA 4UUSB 4AUXA 2JMWA 3BG5A 3GTPJ 2NOGA 2JK3A 2EZLA 1FIAA 3BR3A 5EGOB 4M3GA 4RDUA 2I10A 2NS7A 4DYCA 1HF0A 3GTMJ 3A02A 1SANA 3JRIA 5F27A 2B63J 4RBOA 3M3YJ 1VFCA 2NVYJ 4BY7J 3H3VK 1FTTA 1GDTA 2X9DA 2R93J 2ECBA 1IUFA 4A3JJ 3C2BA 4V2GA 2R5ZB 4B1RA 2FJ1A 3MKLA 1JTXA 1MNMC 1ETVA 4A69C 3PM1A 5E3LA 3S14J 1AKHA 1FEXA 2R7ZJ 2K9SA 1MSFC 2Y0SN 1VNDA 2TCTA 2H8RA 3TP0A 4D7NA 1LE8A 2WV1A 5GPAA 3GBGA 1FTZA 3S2DJ 3G1MA 3LSPA 4B3AA 1E3OC 3CCYA 1JKOC 2VKEA 1TWCJ 1GV2A 1X2NA 4XIDA 1WGXA 1K83J 3B6AA 4W1UA 1QRYA 5K7ZA 2R5YA 1RPWA 2GBYA 4C3JJ 4MFEA 1U8BA 5FLVA 1BL0A 2XGCA 3BR5A 2MSYA 1UMQA 4QTRA 2Y2ZA 3GTGJ 3ZQHA 4AYBN 5F0HA 2D5VA 2JWTA 2K9QA 5E3MA 3I4NJ 2O9LA 1S7EA 1MBJA 2DA7A 2MGQA 2HXOA 4IHWA 2COBA 1T56A 5FLMJ 5EDNA 1JKQC 2M2EA 1U9NA 2HOSA 2QCOA 3BT9A 5C3EJ 2M34A 3ZQGA 4D5CA 1X2MA 5K7HA 1IG7A 4IHVA 3RQIA 2MG4A 2OF7A 1XS9A 1LE8B 1NK2P 5J1RA 1ENHA 2H1KA 3PO2J 2AHQA 2E2JJ 3SDGA 3SFIA 3GTOJ 3HBLA 4V2FA 1WH7A 4BXXJ 3CDLA 2CUFA 4BKXA 2GLOA 4I6ZA 3FK7A 5EGOA 2LKXA 3MN2A 1QVUA 1NK3P 4D5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK J;  1ORK A;  1ETQ A;  2E1O A;  4GFB A;  5IYC J;  2VUM J;  1GT0 C;  5J1Y A;  1GV5 A;  2DMT A;  2EBI A;  1WI3 A;  2M8G X;  3LSJ A;  4M6V A;  3LNQ A;  4B4C A;  1RKW A;  2R5Z A;  1D5Y A;  2LK2 A;  3HOW J;  4FE7 A;  1NTC A;  1MBK A;  4DYR A;  4DZP A;  5C44 J;  5IP6 A;  3S15 J;  3ZQL A;  2YS9 A;  1JJ8 C;  3S16 J;  4BY1 J;  1JUS A;  2R0Q C;  2DJN A;  1POG A;  5FKN A;  2VKV A;  1Z0X A;  1FIP A;  3IH2 A;  4LOC A;  1IDY A;  1R9T J;  5IP9 J;  2EH3 A;  1ZK8 A;  5GP9 A;  3G1L A;  3BG3 A;  5F0C A;  1I3Q J;  2DA4 A;  3HDD A;  2L7F P;  5J1U A;  1ITY A;  1O4X A;  1F36 A;  4FIS A;  2RAE A;  3BR1 A;  4ABZ A;  2M0C A;  5FKL A;  2LTP A;  2ELK A;  4XRS G;  3F0C A;  5F0F A;  1QVT A;  1WPK A;  2WAQ N;  1U78 A;  1ZR4 A;  2IEK A;  1G2H A;  1MH4 A;  1BW5 A;  2IBD A;  3ZQC A;  5EZG A;  2LVS A;  1DU0 A;  1JTY A;  2E2H J;  5DTD A;  5M5X J;  2FD5 A;  4QIW N;  1P7J A;  2ID6 A;  2TRT A;  2Y9Z A;  2LD5 A;  1OCP A;  1IGN A;  2DMU A;  2DMQ A;  4JX5 A;  5F08 A;  2GM4 A;  2IAI A;  2X48 A;  4D7M A;  3JRF A;  2E2I J;  4XIC A;  5IOY A;  3D1N I;  2KDZ A;  1VF9 A;  4JX4 A;  1QPI A;  2XRL A;  1CQT A;  1ZR2 A;  3BQZ A;  3CMY A;  2EZH A;  1IDZ A;  3S1N J;  1MBG A;  2N8G A;  5JLW A;  4W97 A;  1APL C;  4M3B A;  1OJL A;  3FK6 A;  5EYR A;  2XPW A;  3FKI J;  4Y52 J;  2L0K A;  5F04 A;  3BQY A;  2JA8 J;  1TWA J;  3TW7 A;  1RR7 A;  1RKT A;  1TWF J;  1YRN B;  3HOV J;  2QF7 A;  3BR2 A;  4MIM A;  5IP7 J;  2YUS A;  5BNG A;  2G0E A;  5IYD J;  1JT6 A;  2FX0 A;  1W0U A;  1F43 A;  2ECC A;  4Y7N J;  2WB1 N;  2JN6 A;  4A3E J;  4JP0 A;  1P7I A;  1IV6 A;  3S1R J;  1U9O A;  2L9R A;  5IYB J;  2R92 J;  2EZI A;  5M3M J;  1IRZ A;  3E7L A;  4IHY A;  4DYQ A;  1FJL A;  3QQA A;  5IOZ A;  2JA7 J;  4A3B J;  1HCR A;  2ZB9 A;  1IC8 A;  4FE4 A;  4JYK A;  3S2H J;  1H88 C;  1Z77 A;  3I4M J;  1WCM J;  2FQ4 A;  4G12 A;  4XRS A;  3L1P A;  2DMN A;  3H0G J;  5C4J J;  4BBS J;  4MO7 A;  2XB5 A;  1ETY A;  3CQZ J;  3BTL A;  3NAR A;  1ZTR A;  1OFC X;  3QPS A;  5DS9 A;  5HOD A;  4A3M J;  3WHB A;  3ZQI A;  3BTC A;  1AU7 A;  5EF6 A;  5M5Y J;  3JRA A;  3JRH A;  1ETW A;  1HDP A;  4X6A J;  4IHX A;  5EG0 A;  1JT0 A;  3HOU J;  5FKO A;  1A6I A;  3LOC A;  5FJ8 J;  3S1Q J;  2P81 A;  3OOU A;  2EQR A;  2E19 A;  1TWG J;  2DA5 A;  5EEA A;  3A01 B;  3DCF A;  5FKM A;  2W48 A;  2DA1 A;  1B72 B;  2PMZ N;  1A5J A;  2JA6 J;  4A3I J;  4X1E A;  2ME0 A;  2Y31 A;  2LY9 A;  1IJW C;  3OSF A;  3DEW A;  1K61 A;  1LFB A;  1Y1W J;  1B8I B;  1MH3 A;  3JRC A;  4M3D A;  3OSG A;  4A93 J;  1HDD C;  3TW6 A;  1WH5 A;  2XSD C;  2LP0 A;  2M9H A;  5E3N A;  4MFD A;  5F1J A;  1MBH A;  2NVX J;  3O8H A;  1ETK A;  3FIS A;  3O8G A;  5GPC A;  3Q3S A;  3BTJ A;  4S0H B;  4CYC B;  1UG2 A;  1JKR C;  2LFB A;  5FKK A;  2CQX A;  4C3H J;  5C4X J;  2NVQ J;  4A3L J;  2KT0 A;  2DA6 A;  1VI0 A;  5EZH A;  3B6C A;  5EG0 B;  1YRN A;  1RES A;  5J3L A;  3BG9 A;  2Y30 A;  4BBR J;  3JRD A;  3VPR A;  3NAU A;  2AO9 A;  3GTQ J;  1BJZ A;  1JJ6 C;  3Q0W A;  9ANT A;  3BR0 A;  3OIO A;  4C3I J;  4M3F A;  3S17 J;  5K7F A;  1JUP A;  2HOT A;  2K40 A;  2CU7 A;  3HOY J;  2EZK A;  1ZGW A;  2OPT A;  1PUF B;  3QPL A;  1LFU P;  4I76 A;  4C2M J;  4A3D J;  3BTI A;  1GVD A;  3HOX J;  3Q0V A;  2XPU A;  3SJM A;  3HGG A;  3RKQ A;  2CUE A;  2DN0 A;  4XK4 A;  3GTJ J;  2NVT J;  2HYJ A;  5IPA A;  4AC0 A;  3HGY A;  3ZOB A;  1JGG A;  1T33 A;  3HB9 A;  4XRM A;  3JRB A;  1ETX A;  5JLX A;  2DMP A;  1SFO J;  1HOM A;  2LR8 A;  4FCY A;  4HNV A;  1MBF A;  3TP3 A;  2MW8 A;  2L7M P;  1GUU A;  3BR6 A;  4A3F J;  3A03 A;  3PO3 J;  3LSG A;  2ID3 A;  2O7O A;  3A01 A;  2K9N A;  1BA5 A;  4MLO A;  1B72 A;  2ME6 A;  1I50 J;  1JUM A;  2HDD A;  3HM5 A;  5M3F J;  1ETO A;  3HKZ N;  1ZKG A;  2DTZ A;  1B8I A;  3UKG A;  3RZO J;  1XG1 A;  2HI3 A;  1AKH B;  2XB0 X;  2XPV A;  3RZD J;  1MSE C;  2HXI A;  5M5W J;  1ZQ3 P;  2VPR A;  3WHC A;  4IEJ A;  2O8K A;  4CYC A;  3FIW A;  4EEF G;  1Y1V J;  3HOZ J;  3GTL J;  1BW6 A;  1AHD P;  4UUT A;  4UUS A;  3JRE A;  2CRG A;  1JKP C;  3JR9 A;  1W0T A;  3IV5 A;  3IH3 A;  3MVP A;  3Q0U A;  2JJ7 A;  3TED A;  4L5E A;  2HOA A;  3JRG A;  2R5Y B;  4A3K J;  4DW6 A;  1DU6 A;  5E3O A;  1X58 A;  1OCT C;  1EF4 A;  2CQQ A;  3W6V A;  2HQ5 A;  2L7Z A;  3HEF A;  4NDL A;  1MBE A;  4A3G J;  2JA5 J;  2CJJ A;  2NS8 A;  1TWH J;  4DZJ A;  1Q1V A;  2XGD A;  3ZQF A;  1PUF A;  2DA3 A;  3IH4 A;  2X6O A;  3G1O A;  1H8A C;  2DA2 A;  1I6H J;  2LLK A;  3LSR A;  4FTH A;  3M4O J;  1XC5 A;  1RET A;  1TC3 C;  3K7A J;  4J19 A;  4A3C J;  2YU9 J;  2VI6 A;  2Y9Y A;  4JX6 A;  1HLV A;  4M3E A;  4QSH A;  1H89 C;  3K2A A;  2XGE A;  3S1M J;  1UHS A;  4UUS B;  4AUX A;  2JMW A;  3BG5 A;  3GTP J;  2NOG A;  2JK3 A;  2EZL A;  1FIA A;  3BR3 A;  5EGO B;  4M3G A;  4RDU A;  2I10 A;  2NS7 A;  4DYC A;  1HF0 A;  3GTM J;  3A02 A;  1SAN A;  3JRI A;  5F27 A;  2B63 J;  4RBO A;  3M3Y J;  1VFC A;  2NVY J;  4BY7 J;  3H3V K;  1FTT A;  1GDT A;  2X9D A;  2R93 J;  2ECB A;  1IUF A;  4A3J J;  3C2B A;  4V2G A;  2R5Z B;  4B1R A;  2FJ1 A;  3MKL A;  1JTX A;  1MNM C;  1ETV A;  4A69 C;  3PM1 A;  5E3L A;  3S14 J;  1AKH A;  1FEX A;  2R7Z J;  2K9S A;  1MSF C;  2Y0S N;  1VND A;  2TCT A;  2H8R A;  3TP0 A;  4D7N A;  1LE8 A;  2WV1 A;  5GPA A;  3GBG A;  1FTZ A;  3S2D J;  3G1M A;  3LSP A;  4B3A A;  1E3O C;  3CCY A;  1JKO C;  2VKE A;  1TWC J;  1GV2 A;  1X2N A;  4XID A;  1WGX A;  1K83 J;  3B6A A;  4W1U A;  1QRY A;  5K7Z A;  2R5Y A;  1RPW A;  2GBY A;  4C3J J;  4MFE A;  1U8B A;  5FLV A;  1BL0 A;  2XGC A;  3BR5 A;  2MSY A;  1UMQ A;  4QTR A;  2Y2Z A;  3GTG J;  3ZQH A;  4AYB N;  5F0H A;  2D5V A;  2JWT A;  2K9Q A;  5E3M A;  3I4N J;  2O9L A;  1S7E A;  1MBJ A;  2DA7 A;  2MGQ A;  2HXO A;  4IHW A;  2COB A;  1T56 A;  5FLM J;  5EDN A;  1JKQ C;  2M2E A;  1U9N A;  2HOS A;  2QCO A;  3BT9 A;  5C3E J;  2M34 A;  3ZQG A;  4D5C A;  1X2M A;  5K7H A;  1IG7 A;  4IHV A;  3RQI A;  2MG4 A;  2OF7 A;  1XS9 A;  1LE8 B;  1NK2 P;  5J1R A;  1ENH A;  2H1K A;  3PO2 J;  2AHQ A;  2E2J J;  3SDG A;  3SFI A;  3GTO J;  3HBL A;  4V2F A;  1WH7 A;  4BXX J;  3CDL A;  2CUF A;  4BKX A;  2GLO A;  4I6Z A;  3FK7 A;  5EGO A;  2LKX A;  3MN2 A;  1QVU A;  1NK3 P;  4D5F A; 
#chains in the Genus database with same CATH topology
 5L3E A;  1W7P B;  3HSE A;  2MD0 A;  2F5F A;  3BOQ A;  1GT0 C;  1S29 A;  1DGR M;  4HEA 2;  3VFZ A;  2MYS A;  1IRF A;  2B0L A;  1WI3 A;  4CH7 A;  2R7U A;  1N75 A;  5CVV A;  1TP4 A;  2PBI A;  1IRG A;  4OAY A;  1FX7 A;  5DUI A;  2ZJR F;  3BPX A;  5FRN A;  1KU2 A;  3WTY C;  1BR4 A;  3AL0 C;  3DQV C;  4RAF A;  5C44 J;  3S15 J;  3EUA A;  5HDK A;  1U0J A;  4XMY A;  4GYG A;  1D5V A;  1QZZ A;  2EIL H;  3WU2 C;  1Z0X A;  5H20 A;  5IT9 Z;  5GP9 A;  3TDZ C;  3OYA A;  4PJ0 C;  1VQM I;  1I3Q J;  3FWE A;  2ZFU A;  4ZTJ A;  2L7F P;  5HS7 A;  2P0W A;  3DU5 A;  3EDP A;  1CGP A;  4IL6 C;  4HZF A;  4C2U A;  4CYD A;  3BJ6 A;  2V6C A;  2RAE A;  1IUY A;  3BR1 A;  2WV0 A;  4HW0 A;  3CJN A;  1ZRE A;  1MDM A;  1JXS A;  4G7H F;  4YIR X;  2WAQ N;  5K5O A;  3AL0 B;  2ISZ A;  1S7A A;  3AG1 H;  1MH4 A;  3JSO A;  1LUJ B;  2KIM A;  2IBD A;  2KJC A;  2V1D A;  2QQA A;  1G59 A;  1DU0 A;  3BC8 A;  3ABU A;  3GW2 A;  3R0J A;  1KON A;  4CDG A;  1OQY A;  3LSI A;  2WAD A;  4QIW N;  3SHF A;  2CW0 F;  3J81 K;  4CCJ A;  4H4K C;  3VOE A;  3TKY A;  2ADU A;  3IP4 B;  2LD5 A;  1OCP A;  3CUQ C;  1IGN A;  1UB9 A;  2BHZ A;  2BHY A;  5GTI C;  2QVO A;  3MQ0 A;  5KAI C;  4L5J A;  3JTG A;  1QGP A;  4IRG A;  1YTY A;  1AWC A;  2X48 A;  4D7M A;  2HVS A;  1O57 A;  2L3D A;  3B02 A;  4XIC A;  5IOY A;  4JX4 A;  4B48 A;  5J4Y A;  2M7A A;  2JSC A;  4MGR A;  3SQN A;  4ZDP A;  1CQT A;  1ZR2 A;  2CQ7 A;  3R0A A;  1X1A A;  2DK8 A;  3QU6 A;  1DP3 A;  3FK6 A;  5EYR A;  1Y8R B;  2EV6 A;  4Y4R A;  3R60 A;  4EQQ A;  2M0M A;  4II2 A;  2OCE A;  1KGS A;  3TOA A;  1RR7 A;  1RKT A;  3VYS B;  1J5Y A;  2QF7 A;  4EJV A;  4EGZ A;  1BBY A;  5IP7 J;  5BNG A;  4UNO A;  1JT6 A;  2FX0 A;  3CUQ B;  3ZP5 A;  2ECC A;  2UUZ A;  2WB1 N;  2JN6 A;  2R7D A;  1RZ4 A;  1P7I A;  2QKL B;  3TGN A;  3DPL C;  3MCZ A;  2F5D A;  2OQR A;  5LHG A;  5IYB J;  4D0P A;  1J09 A;  1Y6I A;  2EZI A;  5M3M J;  3KYL A;  3E7L A;  4IHY A;  2IS2 A;  5IOZ A;  2ZB9 A;  2STT A;  4JYK A;  3S2H J;  1H88 C;  2V6E A;  5DCM B;  2EIK H;  3FXM A;  3C1D A;  4ZYH A;  1WJF A;  4G12 A;  4XRS A;  2E34 A;  1B4A A;  3OMY A;  4U0V A;  2QEN A;  4MO7 A;  1FYL A;  3CQZ J;  3TOB A;  2I8D A;  3L2V A;  1ZTR A;  1OFC X;  1UG0 A;  2GQQ A;  3BJO A;  1I3A A;  3OV8 A;  3BTC A;  3DBH B;  2W84 A;  3ROU A;  4EM2 A;  4ESF A;  3JRA A;  2LG4 A;  3DKY A;  3KP7 A;  3ECH A;  1T08 B;  4UB8 C;  5LHI A;  4CXF A;  1B9N A;  1EV7 A;  5EG0 A;  1JT0 A;  3HOU J;  4WXC A;  5FKO A;  2QSF X;  4FX4 A;  1FYM A;  1UST A;  4OIQ F;  2WY8 Q;  3UNG C;  3B73 A;  2DU9 A;  3OOU A;  2BY1 A;  3HTS B;  2OBP A;  2GIZ A;  2O61 A;  1TNS A;  1UHW A;  2GOX B;  2A61 A;  2VBX A;  1B72 B;  2IGO A;  3OSF A;  3KZZ A;  5HVQ C;  1FMV A;  1Y1W J;  1B8I B;  3ABM H;  3WE3 A;  3TW6 A;  1SMT A;  1WH5 A;  4U0Y A;  4DOZ A;  2OZ6 A;  2XSD C;  2M8E A;  1Z21 A;  5D5U B;  4ANJ A;  2XC7 A;  1O3T A;  2ZXJ A;  1ETK A;  2LSO A;  3IWF A;  5GPC A;  3Q3S A;  3R61 A;  2FSW A;  3FXU A;  1V3F A;  2CQX A;  5C4X J;  2NVQ J;  4A3L J;  4BQO A;  5EZH A;  1VQK I;  3ZCO A;  1YRN A;  3BG9 A;  3ZGK A;  3CCJ I;  4EVI A;  1QHH D;  5K1Y A;  4IQJ A;  1R7J A;  4KYW A;  2ZO4 A;  4IHT A;  1PVE A;  3Q0W A;  9ANT A;  4C3I J;  4M3F A;  2H6B A;  3V4G A;  5JI6 A;  5JFR A;  1S7O A;  3CCQ I;  3OYC A;  2CU7 A;  1ZGW A;  1FMW A;  2OPT A;  1PUF B;  5H6R A;  3L00 A;  3R6S A;  4C2M J;  4RB1 A;  3L2R A;  3BTI A;  2IS1 A;  2CFO A;  4HQM A;  2VQH A;  3H5N A;  2O5R A;  3NWT A;  4A6D A;  2XPU A;  5HLI A;  2V7F A;  3RKQ A;  3CUO A;  5H6Q A;  1YQA A;  2Z3Y A;  3L2Q A;  2VE9 A;  2OZU A;  2FBI A;  2F5E A;  4KIC A;  4BH9 A;  2EFW A;  1O3S A;  2HQR A;  3D5R C;  3K70 C;  5D6F A;  1W36 D;  2KZG A;  3HB9 A;  3NWS A;  2Y0M A;  3IKV A;  2NOJ B;  3J7A Y;  3WTZ A;  2DPD A;  4Y3O A;  2XDV A;  3DXJ F;  1WJ5 A;  5GAD J;  3AKZ A;  1SD7 A;  3I59 A;  3RI4 A;  5DEQ A;  5E18 F;  1LVA A;  5L3B A;  2MW8 A;  2L7M P;  1FOX A;  2DLL A;  1U5T A;  4LGW A;  2LF8 A;  2ID3 A;  2Q2E A;  2VN2 A;  3W6J B;  2OCC H;  2Z1D A;  3GUD A;  4ITV A;  2KRF A;  4BXU A;  1IW7 F;  4E7L A;  1YYV A;  4GCV A;  1SMY F;  1XMK A;  4CGZ A;  3KEQ A;  1O7F A;  2K5C A;  4LLL A;  4YFX F;  1ETO A;  1GXP A;  1R5I D;  5GTH C;  2GA1 A;  4ENN A;  3HKZ N;  3MKZ A;  3RYR A;  2PX9 A;  3QPT A;  3BRO A;  3RZO J;  3F8B A;  5DM6 F;  2HI3 A;  3GWZ A;  2XPV A;  4ZYE A;  3HYI A;  3W6K B;  3FBN B;  3LQQ A;  4HX4 A;  2VPR A;  3IL2 A;  4BYY A;  5FFZ A;  4XN3 A;  1RNL A;  5DV5 A;  3QRF F;  3GFI A;  3HXL A;  1EA3 A;  3HOZ J;  1BW6 A;  1F5T A;  1LEB A;  4ZZD A;  1PP8 F;  1TT0 A;  3V8L A;  1JKP C;  4NC6 A;  3I0T A;  3G6E I;  5F1R A;  1XSD A;  4HF1 A;  4M9X A;  3ML6 A;  3IV5 A;  1ZG5 A;  2V9V A;  2BVM A;  2R5Y B;  2E7W A;  1EF4 A;  2A69 F;  3CMM A;  1UZC A;  1Z3Y A;  2DI3 A;  2EV0 A;  1HC8 A;  1Q1V A;  5EEH A;  2F48 A;  4UVB A;  3IH4 A;  2X6O A;  3G1O A;  4S04 A;  2DA2 A;  4EMS A;  2QLZ A;  2W4S A;  3ASN H;  4A2U A;  2BY3 A;  3GZN B;  1MMA A;  4CUG A;  4L9J A;  4GGG A;  2EIJ H;  4U87 A;  2YU9 J;  4BDZ A;  4UUV A;  2DTR A;  2DOD A;  3S93 A;  3H92 A;  3BZ6 A;  1KU7 A;  3FM5 A;  2RGV A;  4M3E A;  2QM3 A;  5LEK A;  4QSH A;  2M87 A;  5D8K B;  1O7L A;  2HFH A;  2NXN B;  3PFI A;  4IXA A;  4JK1 X;  4ZDL A;  1VQ6 I;  5L3F A;  1DP7 P;  3BG5 A;  2JK3 A;  2ELJ A;  4GO1 A;  3DU6 A;  3T8T A;  4BNC A;  1WJE A;  5ILV A;  3A02 A;  1P4W A;  4XN0 A;  2I5U A;  2VT2 A;  1FC3 A;  4B09 A;  5CLS A;  1VFC A;  2JRT A;  2NVY J;  3I71 A;  3ZN0 A;  4G6Q A;  3F8N A;  1GDT A;  3FHZ A;  2EJR A;  2R5Z B;  4V2G A;  5B66 C;  1D8J A;  2ICW G;  2EA2 A;  2KIU A;  3H5A A;  3MKL A;  5D5V B;  1MNM C;  1WJD A;  2LBF A;  4A69 C;  2VOD A;  3F8F A;  3QYE A;  3F72 A;  2AXT C;  2JVG A;  1NG7 A;  5E3L A;  4U0W A;  1FEX A;  2H94 A;  3J80 K;  1AKH A;  1IN5 A;  2R7Z J;  4E7K A;  3CTA A;  3HC7 A;  2KP6 A;  3GX4 X;  4LB6 B;  2E5N A;  1VND A;  4HST A;  4UV8 A;  5D4R A;  1A04 A;  1SVO A;  4JBA A;  2VQG A;  3K1N A;  2EIM H;  5CVR A;  4PZJ A;  2HDC A;  1OR7 A;  3CJR B;  4I98 B;  2NS0 A;  3E5Q A;  4YFN F;  1FTZ A;  1X3Z B;  3CD6 I;  3M1C A;  5DD8 A;  1AA7 A;  4R8H A;  5HDN A;  3S2D J;  4DQ2 A;  2IS4 A;  4B3A A;  1E3O C;  2LF7 A;  1MGT A;  4G7O F;  1TWC J;  2BBY A;  3HG9 A;  4XOR A;  3CMA I;  3L09 A;  2YSR A;  1QRY A;  3GFJ A;  3K4N A;  1QHG A;  1WQ2 A;  1HKT A;  2V1U A;  4FHT A;  5FLV A;  3HUG B;  4IKF A;  1UMQ A;  2GOM A;  4QTR A;  2XRO A;  1L3L A;  3M8F A;  2Y2Z A;  3ZQH A;  1SD4 A;  2FXA A;  3MZ8 A;  1P4X A;  5ILU A;  2RNJ A;  2MGQ A;  1TW3 A;  1ZLK A;  3CLO A;  5FLM J;  1JKQ C;  2M2E A;  2XF6 A;  2X1C A;  4GYI A;  4HNT A;  1Z7L A;  4U7D A;  2MG4 A;  1SFK A;  3IC7 A;  1XDU A;  2K9L A;  2Q8K A;  2HKO A;  4YEJ A;  2F4M B;  2ESN A;  3ERE D;  5BMZ A;  4ENJ A;  4I09 A;  5L3D A;  1Z6R A;  3HBL A;  2KRH A;  1VQO I;  3CCS I;  3D5L A;  2VAS A;  1QVU A;  1IAW A;  3CDI A;  1ETQ A;  5E20 A;  2L4A A;  1P9Q C;  2QBY A;  3K10 A;  2D45 A;  1J2X A;  1FOW A;  1ZH5 A;  1BIB A;  3EUH A;  2O0Y A;  1XMA A;  2A6T A;  3C7J A;  3H0D A;  2B7E A;  4BEH A;  3H9Q A;  2UZK A;  4YG2 F;  3C2G A;  3L7W A;  5K5Q A;  2EFO A;  4DZP A;  3OS1 A;  2BGC A;  3ZQL A;  1IF1 A;  5F6F A;  3E5U A;  1LVK A;  4F3Q A;  2YS9 A;  1JJ8 C;  4PUS A;  3MFK A;  3S16 J;  5HS9 A;  3BLY A;  2ZME C;  2HYG D;  2ZC2 A;  1YS6 A;  3ZR8 X;  3NQO A;  5FKN A;  4LK0 F;  1ZAR A;  2EPF A;  2KKO A;  3PUF A;  2K3F A;  1IDY A;  1Z67 A;  4HF0 A;  5IP9 J;  5JVT A;  2EH3 A;  4NUB A;  3G1L A;  1WJB A;  3LA7 A;  1O4X A;  4IPA A;  1TTY A;  3ZMT A;  4NC7 A;  5FKL A;  3L2C A;  3W2W A;  1DUX C;  2HPI A;  3U9G A;  2AQE A;  4MEX F;  1QO0 D;  3CP8 A;  1ZR4 A;  5J47 A;  2EV5 A;  1G2H A;  3HL2 A;  3TQN A;  1X19 A;  3TED A;  2P8T A;  2E2H J;  3WG9 A;  4PK4 A;  5DTD A;  2ZME B;  3DTI A;  3HHG A;  1RI7 A;  3DBR B;  1HW1 A;  3M9A A;  5AIQ A;  1P7J A;  2ID6 A;  1BR1 A;  1HST A;  2TRT A;  2OQG A;  2LKP A;  2O8X A;  2Y9Z A;  4WWC A;  2FBK A;  4L9N A;  2DMU A;  3MKW B;  3FMQ A;  2D1H A;  4JX5 A;  1T98 A;  4RGS A;  5F08 A;  1T38 A;  3JRF A;  2QZ8 A;  2KDZ A;  3CCU I;  4AU7 A;  4RGX A;  5DCM A;  4Z6Y A;  3OYN A;  3S3N A;  1X4P A;  3BQZ A;  3CMY A;  1IDZ A;  4HX8 A;  1W5C C;  3CCE I;  3I4P A;  3F3X A;  1MBG A;  1TW2 A;  2CQN A;  5JLW A;  1DDN A;  4W97 A;  4M3B A;  1IN7 A;  2EFQ A;  2MH2 A;  1R1U A;  4F93 B;  1OJL A;  4A0Z A;  1S72 I;  2XPW A;  3JW4 A;  2C6Y A;  4Y52 J;  2O6G E;  2COM A;  4PJJ A;  2EFN A;  1OCZ H;  2VJ5 A;  3K70 D;  3EYY A;  3DEU A;  3HOV J;  5IT9 K;  4C9Y A;  4P9F A;  2YUS A;  3LWF A;  2G0E A;  2VKD A;  5IYD J;  4KA4 A;  5JHF A;  1W0U A;  2IGN A;  4AYB A;  1YW8 A;  1T8I A;  2YPR A;  3EPZ A;  4A3E J;  2A6E F;  4JP0 A;  1OYI A;  3IUO A;  1U9O A;  4G6D A;  3VYR B;  1T6S A;  1XGS A;  4RS8 A;  3MAJ A;  2PI0 A;  1IRZ A;  2KHM A;  2TDX A;  2JA7 J;  1IC8 A;  5FD6 A;  3K6G A;  1Z77 A;  3I4M J;  2UWM A;  1WCM J;  1U3E M;  3OYE A;  1R5H A;  3GFM A;  1DQU A;  2EA4 A;  2R7W A;  1HSJ A;  2XAS A;  2FNP A;  5C4J J;  2L9S A;  2LYC A;  3BTL A;  5CPR B;  4JQF A;  3CDH A;  2KQR A;  3WTU C;  5HOD A;  3CCR I;  3GXO A;  3N97 A;  3SZG A;  3ZMZ A;  3JRH A;  2HKX A;  2X6W A;  4IHX A;  1E3P A;  4F92 B;  1DPR A;  2Z9O A;  3LOC A;  1LQ1 A;  5FJ8 J;  5K5R A;  2P81 A;  1TQI A;  1SFU A;  3EET A;  5HLT A;  3H3Z A;  3K4M A;  3A01 B;  2QSG X;  1Y8Q B;  3RJP A;  2W48 A;  1MND A;  2PMZ N;  1O3Q A;  2ME0 A;  2O03 A;  2Y31 A;  3IAS 2;  4XLP F;  2DT6 A;  3SEZ A;  3W2V A;  1MH3 A;  2IVM A;  4M3D A;  4GRI A;  4A93 J;  2XF7 A;  4E70 A;  6PAX A;  5E3N A;  4E7H A;  2K4J A;  3H35 A;  3MZY A;  4F55 A;  2RN7 A;  2DDB A;  2P5V A;  3P7N A;  3VSL A;  1U8R A;  1MBH A;  2RQQ A;  2NVX J;  4CZC A;  3FIS A;  4F91 B;  3BTJ A;  4IOA F;  1MMD A;  1X1P A;  4KIS A;  2DA6 A;  1VI0 A;  2WBM A;  2QKM B;  3B6C A;  3GVA A;  3G4S I;  2BVL A;  4EGY A;  2Y30 A;  4OIN F;  2HNH A;  3VPR A;  4A6E A;  2AO9 A;  1YJ9 I;  2E1N A;  2V1N A;  3LSH A;  2QBY B;  2VQL A;  2UXN A;  3F6O A;  5TIS C;  3GZ5 A;  3H5R A;  3IHU A;  3S17 J;  3EYI A;  1K78 A;  1JUP A;  3WE2 A;  3H3U A;  3F9K A;  3RQ4 A;  2HOT A;  1YX5 A;  2O3F A;  4G94 A;  1QBJ A;  1ON2 A;  4LIV A;  2A6H F;  1FPQ A;  3QPL A;  1LFU P;  4I76 A;  3OYK A;  1IZ1 A;  4L18 B;  5GAE J;  1EH8 A;  2KIS A;  2KRC A;  1HW5 A;  1FNN A;  2E36 A;  4M72 A;  4H0E A;  5KVR A;  3WTW C;  3SJM A;  4CCN A;  4B8X A;  1YJN I;  2DN0 A;  3D5S C;  2X4H A;  3JAM Z;  5IPA A;  4AC0 A;  4WX9 A;  3ZOB A;  1UJ8 A;  2ELH A;  1I1S A;  2E71 A;  1T33 A;  2PJR B;  4XRM A;  3JRB A;  2G7U A;  2DO7 A;  1ETX A;  2DMP A;  3S32 A;  2RRE A;  3ISP A;  4KN7 X;  3OOP A;  2LR8 A;  2QUF A;  1UEL B;  3DFG A;  2FA5 A;  4HNV A;  4UHT A;  1MBF A;  2LMD A;  3RPQ A;  3G73 A;  2IPQ X;  4I7H A;  3FXR A;  1R4N B;  3WTS C;  3BR6 A;  5KHD A;  3LSG A;  2X51 A;  1S5L C;  2O7O A;  3K4B A;  2NNY A;  2DQL A;  5FO5 A;  4OMZ A;  1GXQ A;  1JUM A;  3DEE A;  2PLY A;  1S9H A;  2HDD A;  2P4W A;  4EJT A;  4RAY A;  1YJW I;  4E6K G;  2DTZ A;  3UKG A;  4M74 A;  2MAB A;  2NRA C;  5BOX A;  4PSX A;  4ZH4 F;  4HV6 A;  5FGM A;  2XB0 X;  1YO5 C;  3RZD J;  1BI3 A;  2MC3 A;  5FLX Z;  4LFU A;  3K4C A;  5M5W J;  4LG0 B;  5IY5 H;  5FRM A;  1E3H A;  4E7S A;  1V54 H;  5FD5 A;  4IEJ A;  2W00 A;  2QSH X;  4CYC A;  1UFM A;  2LC2 A;  4EEF G;  3DPT A;  4CCM A;  5HOO A;  3A4C A;  2E5Z A;  2J5P A;  4OIP F;  1FSE A;  3U2R A;  4I99 C;  4PJM A;  1FOY A;  3DF8 A;  1OLT A;  3WTX C;  2E1C A;  3JRE A;  3K2Z A;  3M8E A;  3DPU A;  1FT9 A;  1W0T A;  4OU0 A;  3RYP A;  3MVP A;  2EK5 A;  1TL8 A;  2VPL A;  1LFP A;  4RB3 C;  1B1B A;  1W4M A;  2FOW A;  5D4S A;  4ZDO A;  3TL4 X;  3R4K A;  3QU3 A;  3SXY A;  3H9J A;  2DW4 A;  3OY9 A;  3C18 A;  2L7Z A;  1F1Z A;  2H6C A;  3GYH X;  4R1H A;  2CJJ A;  4MEY F;  1TWH J;  1OYY A;  4E4H A;  1XTA A;  2KPM A;  2VLA A;  3I58 A;  3OYD A;  2W1O A;  1H8A C;  2L7K A;  2VB6 A;  1I6H J;  2V26 A;  2LLK A;  3SYT A;  3M4O J;  1WKM A;  1XC5 A;  1RUO A;  1TC3 C;  5CJ9 A;  5HS8 A;  5D6E A;  2LRE A;  2Y9Y A;  2RV8 A;  3I54 A;  4ASN A;  3RSN A;  1HLV A;  2D2W A;  4AIK A;  4WXD A;  3K2A A;  5B1B H;  4ZYG A;  3MD2 A;  2XGE A;  4HSR A;  2NYX A;  4PSW A;  4UUS B;  2H1L A;  2JMW A;  3WU0 A;  1I1G A;  3FXO A;  4L0Z B;  3D0S A;  2V9K A;  5EGO B;  1GVJ A;  4IO9 F;  3BY6 A;  1HBX G;  4XSX F;  2VBY A;  1R5G A;  1SAN A;  3ZMU A;  4BAC A;  3OYG A;  2FE3 A;  1XGN A;  3TO7 A;  4KUM A;  3A0H C;  5LGN A;  1IN4 A;  3M3Y J;  3RKX A;  3K9T A;  3QYB A;  4G7Z F;  1FTT A;  3HUG A;  5E79 C;  2ECB A;  4HX7 A;  1MNE A;  1WZ2 A;  2KLO A;  2V4J C;  2Z2S B;  4XL9 A;  4B1R A;  2XHK A;  2NNN A;  2FJ1 A;  5LEJ A;  1RR8 C;  1KYW A;  1J7K A;  4QLC U;  4ON0 A;  3AG3 H;  3HZJ A;  5CVJ A;  2LH9 A;  2OTL I;  3LL7 A;  3KLN A;  3KP2 A;  4ZTF A;  1BI2 A;  1MSF C;  4LIU A;  1LDJ A;  4A12 A;  1YS7 A;  2HTS A;  5AON A;  2TCT A;  2BW3 B;  4RGU A;  2DPU A;  5E8G A;  3TP0 A;  5EJC A;  2WV1 A;  1OMI A;  5GPA A;  2XGX A;  1VQP I;  4KNY A;  1LEA A;  4Q4Z F;  3GLX A;  3DTK A;  4IZZ A;  4NB5 A;  3LFU A;  2WC2 A;  3N05 A;  4Z2Y A;  1DPU A;  1XCB A;  4E7J A;  1X2N A;  1GV2 A;  2XAH A;  3V7R A;  4B44 A;  1K83 J;  3U1K A;  2G7H A;  3OYF A;  5HNH A;  1FLI A;  1RPW A;  2GWR A;  3KYC B;  4C3J J;  5TJJ A;  1U8B A;  2MSY A;  2ESH A;  3EUK L;  3BP8 A;  3WGG A;  2LOO A;  1QU3 A;  1JGS A;  3ELK A;  3CO6 C;  2LY1 A;  3S3O A;  2K9Q A;  1QNT A;  3I4N J;  4BQQ A;  1UHM A;  3PJR A;  1KZH A;  4M6X A;  3LAJ A;  2QCO A;  2F4I A;  3BT9 A;  2K3P A;  2M34 A;  3SEQ A;  3OYB A;  2AS5 F;  5K7H A;  1IG7 A;  1WWX A;  3RQI A;  2OF7 A;  2NAZ A;  4IHV A;  3VYU B;  5J8F A;  1XMX A;  3LSM A;  4HG2 A;  4YII A;  4AVZ A;  5GAG J;  3OS2 A;  1ZAO A;  3KIO A;  2M3A A;  3I9V 2;  5LLQ A;  1HKS A;  1T0F A;  4ETS A;  2YR2 A;  3GTO J;  1WH7 A;  3JTH A;  4BKX A;  4KT6 A;  3CO7 C;  4I6Z A;  5H2F C;  3DKW A;  3FK7 A;  3GLL A;  1NK3 P;  3UR3 C;  1Y56 A;  3GTK J;  4ZC3 A;  4GFB A;  2VUM J;  5J1Y A;  1GV5 A;  2KMU A;  4CSW A;  2M8G X;  4M9S A;  3HSF A;  4AWX B;  4DJA A;  3LSJ A;  4LLG F;  3REO A;  3LNQ A;  4B4C A;  3KP3 A;  4II3 A;  1RKW A;  2ZKZ A;  1D5Y A;  2LK2 A;  1ZRF A;  5E1W A;  1S6L A;  1NTC A;  4DYR A;  2R3S A;  1REP C;  2V9P A;  2OD5 A;  1SC7 A;  5DD4 A;  3CLQ A;  2FUG 2;  3FXK A;  4RLF A;  1JUS A;  4KIT B;  3T1B A;  1OCR H;  1BI0 A;  1POG A;  1XGO A;  3P9K A;  1J59 A;  1ZEL A;  1J0R A;  1FIP A;  3IH2 A;  5B3S H;  1R9T J;  3V7S A;  1ZK8 A;  2RDP A;  5F0C A;  3GZ6 A;  3HDD A;  3M07 A;  4M6Y A;  1YLF A;  3FX3 A;  4NNJ A;  3I5U A;  5D5W B;  5J1U A;  3LA3 A;  4XKW A;  2M4K A;  3A0B C;  3SZP A;  4HAM A;  5KK1 A;  2M0C A;  4CCO A;  4P1W A;  2L02 A;  2LTP A;  1H9G A;  1Z91 A;  2ELK A;  4XRS G;  1WJA A;  1TNT A;  2BEO A;  2IA0 A;  3F8C A;  3BZK A;  5F0F A;  1R1V A;  2ISY A;  1WPK A;  1X1B A;  1VQ5 I;  1SD5 A;  1U78 A;  2CV0 A;  1SAX A;  2IEK A;  3G2B A;  2R7F A;  4ZYA A;  4EM1 A;  1XX5 A;  4I0B A;  1JTY A;  2CWE A;  3Q9V A;  2XAG A;  4G8X A;  4DIQ A;  5GAH J;  1G3S A;  3V7C A;  3H36 A;  4XLA A;  2W82 A;  3OYM A;  2FU4 A;  5KAF C;  4KFC A;  3CCM I;  2QA4 I;  1C0W A;  2ETH A;  1MIJ A;  3E6D A;  4KMU X;  3LQR A;  1XSV A;  4P9U A;  1LJ9 A;  2DMQ A;  3F23 A;  2VBZ A;  2BE5 F;  2PQ8 A;  2GM4 A;  1MW7 A;  2EB7 A;  2MC4 A;  3D1N I;  2IJL A;  2IRF G;  3X2Q H;  1VF9 A;  4BHC A;  2JSP A;  2RKH A;  3KZI C;  3QP5 A;  2EZH A;  2HVR A;  2N8G A;  4BQN A;  1D1B A;  2A5Y B;  3RCO A;  4N0B A;  5EEG A;  2XAU A;  3U21 A;  4RAG A;  3FKI J;  2QQ9 A;  4YFK F;  1W7P A;  2L0K A;  5F04 A;  1G3T A;  1L0O C;  2CW7 A;  4NQW B;  3SDB A;  3GCM A;  4HA8 A;  4OIO F;  4S05 A;  2JA8 J;  1TWA J;  3TW7 A;  1FOK A;  2PMU A;  4Y13 A;  3OR2 C;  1YRN B;  1SFX A;  3BR2 A;  1Z3X A;  4MTD A;  2HOE A;  4MIM A;  1IV8 A;  5L3C A;  1LB2 A;  3IRQ A;  3EQL F;  3RPU D;  1BOA A;  4D1Q A;  3PFY A;  2ZSI B;  2FEZ A;  1MMS A;  1BOB A;  1P92 A;  5ICC A;  1X3U A;  3S1R J;  2H27 A;  4RGR A;  2BXY A;  2DOF A;  4J01 A;  1WJC A;  3ZN1 A;  3WTT C;  1E17 A;  2ZJQ F;  1FJL A;  1R1T A;  1U5T C;  5ICE A;  2W24 A;  2KJB A;  2K4B A;  4FE4 A;  4IF4 A;  1OIS A;  2VOP A;  1PDN C;  4Y17 A;  4N9H A;  2FQ4 A;  5TGT A;  2MLK A;  2IGK A;  2VQC A;  4PCQ A;  2DFE A;  3BPV A;  1D0X A;  5CVU A;  3HSR A;  5KCM A;  4OIR F;  2H09 A;  2XB5 A;  4BBS J;  2FML A;  2XF5 A;  3NAR A;  2HWV A;  3LA2 A;  1R49 A;  5DS9 A;  3AG2 H;  1SFE A;  3WHB A;  1BR2 A;  4XLE A;  3ZQI A;  1MMN A;  1AU7 A;  4C2T A;  4Q48 A;  4NC8 A;  2BV6 A;  5EF6 A;  5M5Y J;  3MMY B;  4X6A J;  1QA6 A;  2MH9 A;  2HYF A;  2QWW A;  4UVC A;  3WGI A;  4M73 A;  2MD5 A;  2L2O A;  1A6I A;  2DOE A;  3KCC A;  4HQE A;  1ZYR F;  4CZZ A;  1FP1 D;  2E1M C;  4LK1 F;  3PSF A;  3QYF A;  2E19 A;  1TWG J;  2DA5 A;  4RM3 A;  2OJE D;  2EWN A;  2VT3 A;  3DCF A;  4LG3 A;  4YIF A;  1ZLJ A;  2JA2 A;  1LDD A;  2DA1 A;  2ZXI A;  2QQ8 A;  3S2W A;  2GXA A;  1A5J A;  1X1D A;  4A3I J;  4X1E A;  2JUC A;  2LDU A;  2PFB A;  4YRV A;  2LY9 A;  2CW8 A;  1K4T A;  1HA8 A;  4RM2 A;  1ULY A;  3F6V A;  1K61 A;  4I2O A;  2VJ4 A;  3JRC A;  1MJA A;  1ZHF A;  1R36 A;  1HDD C;  2BOL A;  2LP0 A;  2M9H A;  1FWZ A;  3FZV A;  3A1Y A;  5JVG F;  4O3M A;  5HNF A;  1K7A A;  2A07 F;  4OWR B;  5F1J A;  2VON A;  3C3W A;  3CC2 I;  4S0H B;  2DFF A;  1UG2 A;  3J7Z I;  4C3H J;  2E1M B;  3P9C A;  5CQE A;  3LFK A;  4BGD A;  3KET A;  3KFW X;  3T8R A;  3IWZ A;  3CUQ A;  3NAU A;  3GTQ J;  3J7Y J;  3BDD A;  1Z05 A;  3BR0 A;  2YX7 A;  3OIO A;  1YX3 A;  5ICG A;  5K7F A;  2X85 A;  3E97 A;  1RRJ A;  2QGU A;  4JOM A;  3WTV C;  2K40 A;  1E2X A;  3HOY J;  2IW5 A;  1SVM A;  2PJP A;  3DTE A;  2GA2 A;  2EZK A;  2Y0S A;  4PJL A;  3Q5F A;  4KMF A;  4BL0 B;  4HV5 A;  2DAO A;  3C2H A;  2FRH A;  3K4J A;  4XKC A;  1DGW Y;  3OL3 A;  4AIH A;  1YI2 I;  4A3D J;  4N4O B;  1GVD A;  3RDI A;  4BS9 A;  1Z9C A;  3OYL A;  3OS0 A;  1VQL I;  3HOX J;  3Q0V A;  3BWG A;  3KP5 A;  2K86 A;  3HGG A;  1KU9 A;  1PP7 U;  2ZBK A;  2MBF A;  1UCR A;  2CUE A;  1LNW A;  3GTJ J;  4L9T A;  2HYJ A;  3OL4 A;  2PN6 A;  2NVT J;  1ZG3 A;  3HGY A;  5J6X A;  3RTR A;  5ICF A;  4IQ4 A;  3A2K A;  3TO9 A;  1J9I A;  3GFL A;  2W25 A;  4B43 A;  3OYJ A;  4WCG A;  5LGU A;  2YX4 A;  1HOM A;  2RQP A;  3FF5 A;  2L54 A;  2M4G A;  1T95 A;  4IRH A;  3VEP A;  3ZRG A;  1OR7 C;  1I6X A;  1EJ9 A;  3SFZ A;  3ESW B;  5D5X B;  5E8I A;  1XSX A;  2OTJ I;  2JT1 A;  1D0Y A;  2M1B A;  3BJA A;  2WAF A;  3L2W A;  5TRD A;  4M9Z A;  2K9N A;  1YFH A;  1BA5 A;  2YU3 A;  1ERD A;  2OV7 A;  4MLO A;  1B72 A;  3VWB A;  2JRM A;  4PFO A;  1I50 J;  3E6M A;  2J5O A;  3I3L A;  1V5G A;  4HDV A;  2XAF A;  5HLH A;  4HF2 A;  3RKY A;  1B8I A;  4BHB A;  4WXH A;  3QOD A;  2CG4 A;  1AKH B;  5J4V A;  3O3K A;  2GXB A;  2WTE A;  3G3Z A;  1HXD A;  2F4O B;  3MEX A;  5J8C A;  2R7X A;  2BYV E;  2VKH A;  3WHC A;  3ABT A;  3SZT A;  2CQK A;  2K85 A;  2JZY A;  3JSP A;  2CV2 A;  3FIW A;  2ZXH A;  1Y1V J;  3E0J B;  3MKY B;  1TQP A;  3BZC A;  3GTL J;  1GLN A;  1R71 A;  1Y0N A;  4IVN A;  1D8K A;  2FOK A;  4UUS A;  3TDU C;  3KLO A;  3IRR A;  1TQM A;  2ZNY A;  3Q0U A;  2JJ7 A;  4L5E A;  2HOA A;  4DW6 A;  1RUN A;  4PGG A;  3JAM K;  5E3O A;  4RB0 A;  2IT0 A;  2CQQ A;  3W6V A;  1SVL A;  2R7V A;  1I39 A;  4XRF A;  4NDL A;  4A3G J;  2JA5 J;  2NS8 A;  4QWQ A;  1MJ9 A;  2DT5 A;  1BC7 C;  2HTJ A;  3CES A;  1PUF A;  2DOA A;  2Z16 A;  4Y15 A;  3I53 A;  1GHC A;  1B59 A;  1XPX A;  1A6Q A;  4XON A;  4MHG A;  1A36 A;  4I01 A;  5DCF A;  1S3J A;  2V79 A;  3EUH C;  3IKT A;  5BS6 A;  1QQI A;  2XSJ C;  1RET A;  1N78 A;  3VSK A;  2EFP A;  4J19 A;  1WSU A;  1TZL A;  3HRU A;  4A3C J;  4WF2 A;  4FX0 A;  1FSH A;  2VI6 A;  2X1E A;  4L9V A;  2JVH A;  2BW3 A;  2WAE A;  4CO8 A;  1YW9 A;  3KX2 A;  1D1C A;  3PIO F;  1K6Y A;  3S1M J;  4RLQ A;  4QPQ A;  1A35 A;  4BQA A;  3F22 A;  2NOG A;  1FYK A;  4MNU A;  2EZL A;  1FIA A;  2HU9 A;  3BR3 A;  4HLY A;  1K79 A;  2R7T A;  1USS A;  5JHU A;  4LD5 A;  2FF4 A;  1G3Y A;  3DKX A;  3PQK A;  5FLX K;  1X4O A;  3JRI A;  2JPC A;  2E7X A;  3FM3 A;  5CYV A;  2XAQ A;  4GXO A;  2W57 A;  2CV1 A;  1FBU A;  5E1X A;  1CF7 B;  3ZMS A;  1XD7 A;  1YIT I;  1VZ0 A;  1G8X A;  3C2B A;  1VTN C;  4XKB A;  3GEZ A;  4BEH B;  2IS6 A;  2CMP A;  3BCB A;  3PNV A;  3M8J A;  1JTX A;  5LRR A;  2L4M A;  2LKS A;  1ETV A;  4HBL A;  2XIG A;  3ERM A;  3ULQ B;  2ZCW A;  2K9S A;  2GXG A;  1YG2 A;  1YOV B;  2M45 A;  5CVI A;  4CCK A;  4DBQ A;  2Y0S N;  4EJU A;  2H8R A;  1KA8 A;  3BG6 A;  1ZRC A;  4OOI A;  3PNY A;  4M71 A;  1STZ A;  3GBG A;  4HDU A;  3GO5 A;  2IA2 A;  2ZNZ A;  1G3W A;  3L2U A;  3QAH A;  1FP2 A;  4KN4 X;  3LSP A;  1MKM A;  1BJA A;  3HRS A;  4UY8 I;  2VKE A;  2W7N A;  4F7Z A;  1PUE E;  3V8K A;  1BM9 A;  1WGX A;  5HLG A;  2PEX A;  2QEX I;  2R5Y A;  2FMY A;  2WA0 A;  2GBY A;  1BL0 A;  2XGC A;  4HLX A;  2AXL A;  3DWL E;  2XVC A;  4TV7 A;  1P4A A;  4BU2 A;  3GTG J;  4P96 A;  4AYB N;  2KZV A;  4I02 A;  3U1D A;  5E3M A;  1ZN2 A;  4NBQ A;  2O9L A;  1S7E A;  2DA7 A;  3HKZ A;  2HXO A;  4PGH A;  2R7S A;  2COB A;  2Y69 H;  5EDN A;  3FBI B;  2HOS A;  1TLH B;  4XOP A;  4A0X A;  1X2M A;  1T2K A;  1HW2 A;  3CZ6 A;  1D1A A;  1LE8 B;  1NK2 P;  1SAU A;  4MQ9 F;  4BXF A;  5J1R A;  1VQ8 I;  3FXQ A;  3O2P E;  4HNU A;  4XBF A;  4CA0 A;  2H1K A;  3PO2 J;  1A31 A;  5J40 A;  2E2J J;  3SFI A;  2D1V A;  5KNL A;  2GIV A;  1Q1H A;  1W1W E;  2OA4 A;  4XLC A;  2H8W A;  3CCL I;  3HRT A;  4EM0 B;  4GDF A;  1WVR A;  3LMM A;  2BY0 A;  1OYW A;  4HOB A;  2JQ7 A;  2LKX A;  3MN2 A;  5LHH A;  4DZJ A;  3J81 Z;  1ORK A;  2DK5 A;  4LIT A;  2E1O A;  1JHH A;  1HKQ A;  2JPB A;  5IYC J;  4EAT A;  2DMT A;  2EBI A;  3IAM 2;  2Z33 A;  4L0Y B;  4U88 A;  2DBB A;  2A68 F;  4XQF A;  2ZSH B;  4M6V A;  1T39 A;  4BE0 A;  2R5Z A;  2F2E A;  1K6O A;  3HOW J;  2VL8 A;  4FE7 A;  1MBK A;  1YW7 A;  1F4K A;  5IP6 A;  1R23 A;  3QP6 A;  2XRN A;  3QPH A;  2VJI A;  4HRI A;  4BY1 J;  1PYV A;  3GME A;  1OCC H;  2R0Q C;  2AQF A;  2DJN A;  3E3V A;  2WWY A;  4FT8 A;  2VKV A;  4LOC A;  3KEY A;  2IGM A;  1XB4 A;  3M1E A;  4E7I A;  1LKX A;  3FDY A;  3BG3 A;  1B9M A;  2DA4 A;  3F8M A;  2NVU B;  1ITY A;  1O3R A;  1F36 A;  1BC8 C;  4FIS A;  3CJT B;  3K4L A;  4ABZ A;  2BXZ A;  4KJZ A;  3T5X A;  3F0C A;  5CQG A;  3HPG A;  3K1M A;  1QVT A;  3GF2 A;  2GZW A;  1S8N A;  3CCV I;  2CS3 A;  3LST A;  4NQW A;  3ABK H;  4FQG A;  1BW5 A;  3ZQC A;  5EZG A;  2LVS A;  2K7L A;  4BJT A;  5M5X J;  4KT5 C;  2HR3 A;  1XN7 A;  2Y75 A;  4BHP A;  2FD5 A;  5AIP A;  2L9V A;  4BDY A;  3F21 A;  2RNG A;  5DYM A;  5CKT A;  2STW A;  4C30 A;  3VDX A;  1ZRD A;  1IRX A;  1MJB A;  2JUG A;  2QYO A;  4KIF A;  5D8L B;  3I55 I;  1FZP B;  2EIN H;  2X1D A;  1YIJ I;  3KEO A;  2IAI A;  5FRO A;  2E2I J;  2F5V A;  3E6B A;  1SEU A;  3CJQ B;  4DNC A;  3VYT B;  1QPI A;  1VQ9 I;  3P9I A;  1R22 A;  1KQ8 A;  2XRL A;  4XLF A;  3MZH A;  1B6A A;  2LY2 A;  3AAF A;  4AIJ A;  1SD6 A;  2VJJ A;  3Q9S A;  3PIP F;  4UB6 C;  1ACI A;  3S1N J;  1MDM B;  1APL C;  3HTU A;  4ENK A;  5F64 A;  2PMH A;  5LFA A;  3LAP A;  3MWM A;  2HVQ A;  3BQY A;  3K4K A;  2F6C A;  1TWF J;  3O6B B;  3E6C C;  2P7V B;  2XUB A;  1H9T A;  1F43 A;  4Y7N J;  3DLA A;  1WRJ A;  4ESB A;  1MMG A;  3AFH A;  3OYI A;  3DLL F;  1K78 B;  4IRI A;  1IV6 A;  3HHH A;  1RIO H;  2L9R A;  3KPH A;  4B3X A;  2P5L C;  2R92 J;  1YHQ I;  2X0L A;  1FBS A;  4J00 A;  4DYQ A;  3QQA A;  3K1P A;  4F52 A;  1HCR A;  4A3B J;  2KL4 A;  2KDO A;  4PFP A;  3PSI A;  1OPC A;  3NEU A;  3WOD F;  3L1P A;  2OUM A;  2DMN A;  1W7P D;  4KDP A;  3H0G J;  3I64 A;  4RMN A;  1ETY A;  5DUK A;  4Q47 A;  2HQA A;  2A05 A;  2DCE A;  3QPS A;  2M30 A;  4A3M J;  5ED4 A;  3TBI A;  3DP7 A;  3G71 I;  1ETW A;  1HDP A;  2Z5U A;  3BCA A;  2BZT A;  1FY7 A;  2DJI A;  2Z99 A;  2X6X A;  1JI8 A;  1BN5 A;  1KYZ A;  5FFX A;  5LD2 C;  1M1E B;  3BG7 A;  2ZME A;  3S1Q J;  1XDS A;  1OCO H;  2EQR A;  4BAY A;  1XGM A;  3CME I;  3K69 A;  5EEA A;  1X3W B;  1Y0U A;  3QWL A;  5FKM A;  3WU1 B;  2BY2 A;  1ZG1 A;  4DBR A;  2JA6 J;  1IN6 A;  4ESJ A;  1AOY A;  1QZY A;  2XKP A;  4UXN A;  3ZPL A;  1IJW C;  4KIG A;  1KU3 A;  4LLN A;  3DEW A;  1LFB A;  1NHA A;  5BPD A;  3OSG A;  5LBQ A;  5HDG A;  2L5Q A;  4QPO A;  4XM3 A;  3FMS A;  4ZYD A;  1VQ7 I;  3W2A A;  1G6N A;  3OR1 C;  4OMY A;  4MFD A;  3HPH A;  4BE2 A;  2MLG A;  4EJW A;  3S3M A;  1BIA A;  1ONV A;  3O8H A;  4ZJZ A;  3KP4 A;  1FBQ A;  3O8G A;  2VOO A;  2HZT A;  4CYC B;  2CUJ A;  1UAA A;  1JKR C;  2LFB A;  5FKK A;  1EH6 A;  2Q0O A;  5BPI A;  2E60 A;  2KT0 A;  2KFD A;  1LDK B;  5EG0 B;  2HS5 A;  1RES A;  5J3L A;  4ENM A;  3OYH A;  3ABL H;  1R00 A;  4BBR J;  3JRD A;  1BJZ A;  2L01 A;  3S8P A;  2KIF A;  1JJ6 C;  2X6Y A;  3DBL B;  2V1X A;  3KE2 A;  4RA2 A;  3OIQ A;  2OC6 A;  3E1S A;  5ILS A;  4DGW B;  1LPQ A;  3PQJ A;  2DXI A;  2MFZ A;  3CC7 I;  3FKJ A;  4HYE A;  4O6J A;  3KZY A;  2LNB A;  2R7O A;  1I27 A;  4AVP A;  3W3C A;  1ODD A;  2HZD A;  1V5E A;  3KYD B;  1R58 A;  1TBX A;  3I56 I;  4AID A;  2DFH A;  2ACJ A;  5A2Q K;  3L9F A;  1IXS B;  4XK4 A;  2DDA A;  4O5V A;  4IX7 A;  4I0A A;  1JGG A;  4YEL A;  1N77 A;  2HEO A;  4N4N B;  2IXS A;  2LRD A;  5JLX A;  4LMY A;  4FET A;  1SFO J;  2OAZ A;  5JR3 A;  2R7R A;  3ONQ A;  1K4S A;  2HPM A;  1KQ9 A;  4D9J A;  4FCY A;  2E35 A;  3H1C A;  3TP3 A;  1WHU A;  1GUU A;  3NRV A;  1P6R A;  5LGT A;  4A3F J;  3A03 A;  3PO3 J;  1D0Z A;  4OAZ A;  5ERI A;  3A01 A;  2DYS H;  4U7B A;  2G9W A;  4XSZ F;  2ME6 A;  4N9I A;  2UV1 A;  3VB2 A;  2PG4 A;  3HM5 A;  5FB2 A;  4KIB A;  3PUB A;  5M3F J;  4ZZL A;  4L5I A;  1YIO A;  4A5M A;  2W85 A;  2P6S A;  1ZKG A;  2OU2 A;  1QZE A;  3HIF A;  3FHN A;  3V42 A;  2R7Q A;  2ZXW H;  1I5Z A;  3P5J A;  2F5C A;  1XG1 A;  1Z6T A;  2CH0 A;  1U2W A;  4FAS D;  2WY7 Q;  1MSE C;  3PL8 A;  2HXI A;  1ZQ3 P;  1J75 A;  2IA1 A;  2P6T A;  2ZJ2 A;  3RKW A;  4XNF A;  2O8K A;  2P7C B;  4R79 A;  5B1A H;  2Y48 A;  2K9M A;  4BE1 A;  1AHD P;  3FXL A;  2CSO A;  3FMR A;  1W5S A;  3I59 B;  2VC1 A;  1ZGA A;  3AG4 H;  2MA3 A;  4UUT A;  2CRG A;  3JR9 A;  3ZXS A;  5E17 F;  2XKO A;  1U5T B;  3IH3 A;  3CF2 A;  3M7G A;  3HJE A;  3QOP A;  2Q2E B;  1T0F C;  2FQ3 A;  4XKV A;  4LJZ F;  3J80 Z;  3JRG A;  4A3K J;  1DU6 A;  3WG7 H;  1X58 A;  3ZQ7 A;  3TMO A;  1OCT C;  2HQN A;  5E1Z B;  2HQ5 A;  3HEF A;  1MBE A;  2VXZ A;  1CF7 A;  2PMZ A;  1IXR C;  2XGD A;  3ZQF A;  3E5X A;  2FNA A;  4G6T B;  2DA3 A;  4X0G A;  2HGC A;  1H0M A;  1G4D A;  3KP6 A;  2VBW A;  2M7B A;  4BJ5 C;  3LSR A;  4FTH A;  4K2E A;  4XLN F;  3N4M A;  1XCV A;  3CP2 A;  3H9G A;  3K7A J;  2ZJP F;  3VOD A;  1F9N A;  1HQC A;  2ZFW A;  2KIQ A;  4JX6 A;  1JE8 A;  2L9N A;  5LRS A;  5A2Q Z;  1H89 C;  1NH3 A;  4V19 K;  2PJR A;  2VIX A;  4MTE A;  2CO5 A;  2JTV A;  2WAQ A;  1YE9 A;  1UHS A;  4AUX A;  2CUZ A;  2VXD A;  4IOC F;  3GTP J;  1RC9 A;  1Z1D A;  2IP2 A;  1V55 H;  4M3G A;  4RDU A;  2I10 A;  2NS7 A;  1MD0 A;  3ZQQ A;  4DYC A;  1HF0 A;  1IXC A;  2XV4 S;  3GTM J;  2K02 A;  2DYR H;  5L3G A;  2DFI A;  2VC0 A;  1ZGJ A;  4UVA A;  5F27 A;  2B63 J;  1R6R A;  3LSK A;  1X1C A;  4RBO A;  2HDW A;  4BJ6 C;  4G9Y A;  4BY7 J;  3H3V K;  1IO2 A;  1JHF A;  2X9D A;  4A5N A;  5DDG A;  2R93 J;  5B5E C;  1IUF A;  3ASO H;  4XLH A;  4A3J J;  5BQT A;  1IN8 A;  1NG6 A;  1V4R A;  3JCU C;  3ZMD A;  4P55 A;  1TT5 B;  3PM1 A;  3TO6 A;  4XOT A;  2A3S A;  1N25 A;  3HRM A;  3S14 J;  1EH7 A;  1MZB A;  2CFX A;  1U6G A;  3RPU A;  1W36 C;  4LG0 A;  4PJN A;  3HOS A;  3ECO A;  4AD9 A;  3QOE A;  2P5K A;  4D7N A;  1LE8 A;  2DT7 B;  2XAJ A;  1KQ0 A;  2B9S A;  4CHU A;  1Y39 A;  4B47 A;  1PJR A;  4EJO A;  2VE8 A;  4RB2 C;  4P5O A;  3J7A O;  1R4M B;  4E7Z A;  3OWT A;  3G1M A;  4CIC A;  1WFX A;  3CCY A;  4A0Y A;  1JKO C;  2RC4 A;  1Z7U A;  4IHS A;  2CGP A;  3HOT A;  3OIP A;  1P2F A;  2RVC A;  2CYY A;  2WB1 A;  4XID A;  2M5W A;  3T0Y A;  2DQR A;  2Q1Z B;  3B6A A;  3PNT A;  4W1U A;  3ZMV A;  5DM7 F;  5K7Z A;  1QPM A;  2UXX A;  3CC4 I;  2K27 A;  4UV9 A;  3FXJ A;  4MFE A;  4BUP A;  1VQN I;  3BR5 A;  2FBH A;  4XR6 A;  5IT3 A;  3DV8 A;  5F0H A;  2D5V A;  2R4G A;  4PDK A;  2JWT A;  2A5W A;  2QQB A;  4RAZ A;  2LBF B;  1ON1 A;  4MQV A;  1MBJ A;  4IJA A;  1EKE A;  4Y33 A;  1BI1 A;  4IHW A;  1T56 A;  1OKR A;  1U9N A;  4HPQ A;  3CF5 F;  4Q5S F;  5C3E J;  3ZQG A;  4D5C A;  1V5F A;  1XS9 A;  3K0L A;  4CCL A;  1ENH A;  4AM3 A;  3COA C;  3V8J A;  2AHQ A;  3SDG A;  3RIR A;  4V2F A;  3WGH A;  4WK8 F;  4BXX J;  3CDL A;  2CUF A;  2GAU A;  2GLO A;  1D3Y A;  4LB5 A;  1W5T A;  1WI9 A;  5EGO A;  1VQ4 I;  4NHJ A;  1E0E A;  4EV0 A;  4D5F A; 
#chains in the Genus database with same CATH homology
 3GTK J;  1ORK A;  1ETQ A;  2E1O A;  4GFB A;  5IYC J;  2VUM J;  1GT0 C;  5J1Y A;  1GV5 A;  2DMT A;  2EBI A;  1WI3 A;  2M8G X;  3LSJ A;  4M6V A;  3LNQ A;  4B4C A;  1RKW A;  2R5Z A;  1D5Y A;  2LK2 A;  3HOW J;  4FE7 A;  1NTC A;  1MBK A;  4DYR A;  4DZP A;  5C44 J;  5IP6 A;  3S15 J;  3ZQL A;  2YS9 A;  1JJ8 C;  3S16 J;  4BY1 J;  1JUS A;  2R0Q C;  2DJN A;  1POG A;  5FKN A;  2VKV A;  1Z0X A;  1FIP A;  3IH2 A;  4LOC A;  1IDY A;  1R9T J;  5IP9 J;  2EH3 A;  1ZK8 A;  5GP9 A;  3G1L A;  3BG3 A;  5F0C A;  1I3Q J;  2DA4 A;  3HDD A;  2L7F P;  5J1U A;  1ITY A;  1O4X A;  1F36 A;  4FIS A;  2RAE A;  3BR1 A;  4ABZ A;  2M0C A;  5FKL A;  2LTP A;  2ELK A;  4XRS G;  3F0C A;  5F0F A;  1QVT A;  1WPK A;  2WAQ N;  1U78 A;  1ZR4 A;  2IEK A;  1G2H A;  1MH4 A;  1BW5 A;  2IBD A;  3ZQC A;  5EZG A;  2LVS A;  1DU0 A;  1JTY A;  2E2H J;  5DTD A;  5M5X J;  2FD5 A;  4QIW N;  1P7J A;  2ID6 A;  2TRT A;  2Y9Z A;  2LD5 A;  1OCP A;  1IGN A;  2DMU A;  2DMQ A;  4JX5 A;  5F08 A;  2GM4 A;  2IAI A;  2X48 A;  4D7M A;  3JRF A;  2E2I J;  4XIC A;  5IOY A;  3D1N I;  2KDZ A;  1VF9 A;  4JX4 A;  1QPI A;  2XRL A;  1CQT A;  1ZR2 A;  3BQZ A;  3CMY A;  2EZH A;  1IDZ A;  3S1N J;  1MBG A;  2N8G A;  5JLW A;  4W97 A;  1APL C;  4M3B A;  1OJL A;  3FK6 A;  5EYR A;  2XPW A;  3FKI J;  4Y52 J;  2L0K A;  5F04 A;  3BQY A;  2JA8 J;  1TWA J;  3TW7 A;  1RR7 A;  1RKT A;  1TWF J;  1YRN B;  3HOV J;  2QF7 A;  3BR2 A;  4MIM A;  5IP7 J;  2YUS A;  5BNG A;  2G0E A;  5IYD J;  1JT6 A;  2FX0 A;  1W0U A;  1F43 A;  2ECC A;  4Y7N J;  2WB1 N;  2JN6 A;  4A3E J;  4JP0 A;  1P7I A;  1IV6 A;  3S1R J;  1U9O A;  2L9R A;  5IYB J;  2R92 J;  2EZI A;  5M3M J;  1IRZ A;  3E7L A;  4IHY A;  4DYQ A;  1FJL A;  3QQA A;  5IOZ A;  2JA7 J;  4A3B J;  1HCR A;  2ZB9 A;  1IC8 A;  4FE4 A;  4JYK A;  3S2H J;  1H88 C;  1Z77 A;  3I4M J;  1WCM J;  2FQ4 A;  4G12 A;  4XRS A;  3L1P A;  2DMN A;  3H0G J;  5C4J J;  4BBS J;  4MO7 A;  2XB5 A;  1ETY A;  3CQZ J;  3BTL A;  3NAR A;  1ZTR A;  1OFC X;  3QPS A;  5DS9 A;  5HOD A;  4A3M J;  3WHB A;  3ZQI A;  3BTC A;  1AU7 A;  5EF6 A;  5M5Y J;  3JRA A;  3JRH A;  1ETW A;  1HDP A;  4X6A J;  4IHX A;  5EG0 A;  1JT0 A;  3HOU J;  5FKO A;  1A6I A;  3LOC A;  5FJ8 J;  3S1Q J;  2P81 A;  3OOU A;  2EQR A;  2E19 A;  1TWG J;  2DA5 A;  5EEA A;  3A01 B;  3DCF A;  5FKM A;  2W48 A;  2DA1 A;  1B72 B;  2PMZ N;  1A5J A;  2JA6 J;  4A3I J;  4X1E A;  2ME0 A;  2Y31 A;  2LY9 A;  1IJW C;  3OSF A;  3DEW A;  1K61 A;  1LFB A;  1Y1W J;  1B8I B;  1MH3 A;  3JRC A;  4M3D A;  3OSG A;  4A93 J;  1HDD C;  3TW6 A;  1WH5 A;  2XSD C;  2LP0 A;  2M9H A;  5E3N A;  4MFD A;  5F1J A;  1MBH A;  2NVX J;  3O8H A;  1ETK A;  3FIS A;  3O8G A;  5GPC A;  3Q3S A;  3BTJ A;  4S0H B;  4CYC B;  1UG2 A;  1JKR C;  2LFB A;  5FKK A;  2CQX A;  4C3H J;  5C4X J;  2NVQ J;  4A3L J;  2KT0 A;  2DA6 A;  1VI0 A;  5EZH A;  3B6C A;  5EG0 B;  1YRN A;  1RES A;  5J3L A;  3BG9 A;  2Y30 A;  4BBR J;  3JRD A;  3VPR A;  3NAU A;  2AO9 A;  3GTQ J;  1BJZ A;  1JJ6 C;  3Q0W A;  9ANT A;  3BR0 A;  3OIO A;  4C3I J;  4M3F A;  3S17 J;  5K7F A;  1JUP A;  2HOT A;  2K40 A;  2CU7 A;  3HOY J;  2EZK A;  1ZGW A;  2OPT A;  1PUF B;  3QPL A;  1LFU P;  4I76 A;  4C2M J;  4A3D J;  3BTI A;  1GVD A;  3HOX J;  3Q0V A;  2XPU A;  3SJM A;  3HGG A;  3RKQ A;  2CUE A;  2DN0 A;  4XK4 A;  3GTJ J;  2NVT J;  2HYJ A;  5IPA A;  4AC0 A;  3HGY A;  3ZOB A;  1JGG A;  1T33 A;  3HB9 A;  4XRM A;  3JRB A;  1ETX A;  5JLX A;  2DMP A;  1SFO J;  1HOM A;  2LR8 A;  4FCY A;  4HNV A;  1MBF A;  3TP3 A;  2MW8 A;  2L7M P;  1GUU A;  3BR6 A;  4A3F J;  3A03 A;  3PO3 J;  3LSG A;  2ID3 A;  2O7O A;  3A01 A;  2K9N A;  1BA5 A;  4MLO A;  1B72 A;  2ME6 A;  1I50 J;  1JUM A;  2HDD A;  3HM5 A;  5M3F J;  1ETO A;  3HKZ N;  1ZKG A;  2DTZ A;  1B8I A;  3UKG A;  3RZO J;  1XG1 A;  2HI3 A;  1AKH B;  2XB0 X;  2XPV A;  3RZD J;  1MSE C;  2HXI A;  5M5W J;  1ZQ3 P;  2VPR A;  3WHC A;  4IEJ A;  2O8K A;  4CYC A;  3FIW A;  4EEF G;  1Y1V J;  3HOZ J;  3GTL J;  1BW6 A;  1AHD P;  4UUT A;  4UUS A;  3JRE A;  2CRG A;  1JKP C;  3JR9 A;  1W0T A;  3IV5 A;  3IH3 A;  3MVP A;  3Q0U A;  2JJ7 A;  3TED A;  4L5E A;  2HOA A;  3JRG A;  2R5Y B;  4A3K J;  4DW6 A;  1DU6 A;  5E3O A;  1X58 A;  1OCT C;  1EF4 A;  2CQQ A;  3W6V A;  2HQ5 A;  2L7Z A;  3HEF A;  4NDL A;  1MBE A;  4A3G J;  2JA5 J;  2CJJ A;  2NS8 A;  1TWH J;  4DZJ A;  1Q1V A;  2XGD A;  3ZQF A;  1PUF A;  2DA3 A;  3IH4 A;  2X6O A;  3G1O A;  1H8A C;  2DA2 A;  1I6H J;  2LLK A;  3LSR A;  4FTH A;  3M4O J;  1XC5 A;  1RET A;  1TC3 C;  3K7A J;  4J19 A;  4A3C J;  2YU9 J;  2VI6 A;  2Y9Y A;  4JX6 A;  1HLV A;  4M3E A;  4QSH A;  1H89 C;  3K2A A;  2XGE A;  3S1M J;  1UHS A;  4UUS B;  4AUX A;  2JMW A;  3BG5 A;  3GTP J;  2NOG A;  2JK3 A;  2EZL A;  1FIA A;  3BR3 A;  5EGO B;  4M3G A;  4RDU A;  2I10 A;  2NS7 A;  4DYC A;  1HF0 A;  3GTM J;  3A02 A;  1SAN A;  3JRI A;  5F27 A;  2B63 J;  4RBO A;  3M3Y J;  1VFC A;  2NVY J;  4BY7 J;  3H3V K;  1FTT A;  1GDT A;  2X9D A;  2R93 J;  2ECB A;  1IUF A;  4A3J J;  3C2B A;  4V2G A;  2R5Z B;  4B1R A;  2FJ1 A;  3MKL A;  1JTX A;  1MNM C;  1ETV A;  4A69 C;  3PM1 A;  5E3L A;  3S14 J;  1AKH A;  1FEX A;  2R7Z J;  2K9S A;  1MSF C;  2Y0S N;  1VND A;  2TCT A;  2H8R A;  3TP0 A;  4D7N A;  1LE8 A;  2WV1 A;  5GPA A;  3GBG A;  1FTZ A;  3S2D J;  3G1M A;  3LSP A;  4B3A A;  1E3O C;  3CCY A;  1JKO C;  2VKE A;  1TWC J;  1GV2 A;  1X2N A;  4XID A;  1WGX A;  1K83 J;  3B6A A;  4W1U A;  1QRY A;  5K7Z A;  2R5Y A;  1RPW A;  2GBY A;  4C3J J;  4MFE A;  1U8B A;  5FLV A;  1BL0 A;  2XGC A;  3BR5 A;  2MSY A;  1UMQ A;  4QTR A;  2Y2Z A;  3GTG J;  3ZQH A;  4AYB N;  5F0H A;  2D5V A;  2JWT A;  2K9Q A;  5E3M A;  3I4N J;  2O9L A;  1S7E A;  1MBJ A;  2DA7 A;  2MGQ A;  2HXO A;  4IHW A;  2COB A;  1T56 A;  5FLM J;  5EDN A;  1JKQ C;  2M2E A;  1U9N A;  2HOS A;  2QCO A;  3BT9 A;  5C3E J;  2M34 A;  3ZQG A;  4D5C A;  1X2M A;  5K7H A;  1IG7 A;  4IHV A;  3RQI A;  2MG4 A;  2OF7 A;  1XS9 A;  1LE8 B;  1NK2 P;  5J1R A;  1ENH A;  2H1K A;  3PO2 J;  2AHQ A;  2E2J J;  3SDG A;  3SFI A;  3GTO J;  3HBL A;  4V2F A;  1WH7 A;  4BXX J;  3CDL A;  2CUF A;  4BKX A;  2GLO A;  4I6Z A;  3FK7 A;  5EGO A;  2LKX A;  3MN2 A;  1QVU A;  1NK3 P;  4D5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...