5FGMA

Streptomyces coelicolor sigr region 4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
LPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Streptomyces coelicolor SigR, methionine at the -35 element interacting region 4 confers the -31'-adenine base selectivity
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords ECF RNA polymerase sigma factor SigR
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5fgmA00
2CSOA 4YFKF 3LA2A 4IRGA 3PQKA 4RS8A 5LHGA 2LNBA 2W25A 4Y13A 2GA1A 1BI1A 4EGZA 1XN7A 1S8NA 2EFPA 4U7DA 4ZZDA 1I1GA 2FA5A 4GO1A 1IW7F 1TW3A 3H92A 3FHZA 1IRFA 4RAYA 3ZMDA 1E17A 4P9UA 5A2QK 3HHHA 2O03A 1O3SA 4M73A 4UUVA 2HQNA 4O6JA 5CJ9A 3EQLF 3P9CA 1NHAA 2RC4A 4U0VA 3WU0A 2DLLA 2VBXA 5LEJA 3NQOA 3RI4A 2P5KA 2XKPA 5IT9Z 4B09A 1BBYA 1QZYA 4HX4A 4ZYHA 1H9TA 4EQQA 1BN5A 2QUFA 2VT2A 3ZMTA 1FBUA 3CUQA 4ON0A 3L2CA 4YIFA 5E1XA 2DTRA 1T2KA 2EB7A 1W7PB 3DKWA 4KIGA 3I59A 2ZCWA 2AXLA 4U0WA 3WTTC 1X3UA 3QAHA 1TQMA 1YO5C 4I7HA 2OD5A 4YFXF 2KJCA 3IRQA 1ULYA 4PGGA 2ESNA 3BY6A 4ENNA 2HFHA 2QENA 1FYKA 3KP3A 1MJAA 4UVCA 1LDDA 3ULQB 4HA8A 4OIPF 2RGVA 2OU2A 3BJ6A 5ILSA 1RUOA 3VB2A 3SZPA 1G6NA 1IAWA 1BC7C 2EFOA 2P4WA 1ON2A 2K27A 1R1VA 5BMZA 4UV8A 1REPC 4HZFA 1MJ9A 4DNCA 1TTYA 4ZYGA 3E6DA 1IXRC 3WG9A 4HDUA 4ESJA 2ZBKA 5FD5A 4ZYDA 4A6EA 5FLXZ 1KU9A 1BC8C 3J80Z 5DDGA 1Y0UA 2XV4S 2A3SA 3T8TA 2CQKA 1I6XA 5LHHA 2A6EF 5FB2A 1XD7A 2IW5A 5ICGA 1FSEA 4JK1X 1G3WA 3ECOA 2GXBA 4UNOA 2OAZA 2Z9OA 4KIBA 1UCRA 1W5SA 4P9FA 2DU9A 2JZYA 2VN2A 3QU6A 1OPCA 2M30A 3GF2A 1FZPB 1BI2A 3FX3A 1K78A 2RDPA 1XGNA 3ABUA 1GXQA 4HF2A 1FNNA 4M9SA 5LGUA 5CVVA 1HQCA 3OV8A 1LVAA 5CYVA 4UV9A 3K1MA 3JSPA 3QP6A 1OMIA 2K4JA 4RB2C 1SD6A 2NAZA 5F64A 1KQ8A 3KZZA 3I4PA 2DPUA 1W4MA 3DPTA 4N0BA 1ONVA 5HOOA 2VXZA 3QU3A 4AVPA 2XVCA 4EMSA 5E20A 1F4KA 1XDSA 4OOIA 4Y15A 3E5XA 4LB6B 3GLXA 1HXDA 2ACJA 2HYFA 3RPUA 5ICFA 2VOPA 1U5TB 1J7KA 2LSOA 3BJOA 4S05A 2GAUA 3TKYA 4IHTA 1XMKA 2XAJA 3WGGA 1P6RA 4M74A 5HLGA 2Z3YA 1HSTA 2PN6A 3WTVC 1OKRA 3SHFA 1SFEA 4CHUA 4LJZF 1PP8F 3REOA 4EM0B 4EJUA 1B9MA 5LBQA 2A61A 5CVRA 2M1BA 1U3EM 3GYHX 4Q47A 4I98B 1IRGA 4P55A 2QBYB 3GEZA 2VC1A 2OBPA 1ZN2A 4CZZA 3HOSA 1Z1DA 5D5XB 2YSRA 4ENJA 1IN8A 2MBFA 1K79A 4MTEA 5AIPA 1RUNA 2JT1A 3W6JB 2BV6A 4BYYA 2PBIA 3M7GA 4G7HF 2P6SA 2W85A 4XRFA 1XGMA 4RB1A 4KA4A 3H3ZA 1ZRFA 3V8KA 4PGHA 4EV0A 3PFIA 3U9GA 1HW5A 5HDGA 2JTVA 2YX7A 3WTWC 3CO7C 1YW9A 2L3DA 1J59A 1OYYA 3ZQ7A 2QQAA 1FWZA 4TV7A 1TNTA 2KIFA 3COAC 4IRHA 5HDNA 1ZGAA 1Q1HA 1QPMA 1EH6A 1VTNC 4LG0B 5BOXA 2VE9A 2QZ8A 1XDUA 3S2WA 1LEAA 3GFLA 2RV8A 2CG4A 2IP2A 1J5YA 4L18B 2Q0OA 1KA8A 4OMZA 1CF7A 1QQIA 2VE8A 3LAPA 4YFNF 2YR2A 5DD4A 2RQPA 3FM3A 2OQGA 4WXHA 1D8KA 2FNAA 2MC3A 2PI0A 4OMYA 1KYWA 2JRTA 4UXNA 3LAJA 1WRJA 3JSOA 3MZHA 4LB5A 1YYVA 4KFCA 5D8KB 1O7LA 4LLLA 1S29A 4Y17A 2NYXA 4A0XA 2BGCA 4EJWA 1T39A 2QWWA 4MQ9F 4ZH4F 3T5XA 3C1DA 1UFMA 4RAZA 5D4RA 5HS7A 4D0PA 3GFJA 1R7JA 2ISZA 3P9IA 4M6XA 1MDMB 2WWYA 1G4DA 2MH9A 1P4WA 1MD0A 2GA2A 3JTHA 1AOYA 3J81K 4U88A 4HV6A 4UHTA 4M9ZA 5ICCA 4CXFA 4A6DA 4M71A 1CF7B 3HSEA 2OZ6A 3FZVA 2O6GE 1SFXA 2BBYA 5HLIA 1KU2A 4ZYEA 3CDHA 1DUXC 2HTSA 4HAMA 3F6OA 1TQPA 1R36A 3MEXA 1XSVA 4KNYA 5JFRA 5D5WB 3F72A 1SD5A 2DBBA 4U0YA 5AONA 4IRIA 2CO5A 5K5QA 2VONA 4ESFA 3KP2A 2ELHA 2W57A 4WF2A 2P8TA 2ZO4A 1Z91A 4A2UA 5L3BA 3ELKA 1G3TA 3WGIA 2IA1A 2WV0A 5H20A 1EH7A 3DF8A 3K0LA 3JW4A 2FNPA 1YFHA 2YU3A 3SFZA 3K1NA 5E8GA 2CGPA 2PFBA 4G6DA 5DCMB 3V7SA 3ERED 5E18F 4N9HA 1IN6A 5CVIA 1LDKB 3T0YA 2CYYA 1TQIA 2QQ9A 2P5LC 4B8XA 4S04A 3I5UA 2V1UA 1XSDA 3I59B 4EGYA 5L3CA 3LQRA 2GQQA 2EFNA 3KE2A 3ROUA 1HBXG 5FLXK 2G9WA 1YTYA 1G3SA 5ED4A 2EWNA 2IVMA 4O5VA 4WWCA 5DCFA 3Q9SA 1D8JA 2XGXA 1JHFA 3WTXC 3K9TA 1L0OC 5D4SA 1BJAA 2UZKA 1YS7A 1K78B 1Z6RA 5DEQA 3LA7A 2O0YA 5J8FA 4L0YB 2P7CB 4I02A 1IUYA 1R5GA 2QQBA 4RGXA 1ON1A 4E70A 4BNCA 3C3WA 5H6QA 5L3GA 4XSXF 4GCVA 2G7UA 5BQTA 2PQ8A 4HLYA 5LEKA 1DPUA 1RNLA 4WXDA 1IN7A 1OYWA 3KEQA 5KK1A 2EFQA 2EV5A 2NS0A 2ZJ2A 1SMYF 1R1UA 5TJJA 3DQVC 3NEUA 3C7JA 3V7CA 3GFMA 1RZ4A 2DFIA 1W5TA 4HOBA 4A5MA 4AIJA 4OIOF 1KU7A 4WXCA 1Z05A 3HIFA 1XMAA 1DPRA 3P7NA 3FMSA 4R8HA 1R1TA 4ZZLA 4L0ZB 1H0MA 5JVTA 4GYGA 2VOOA 1A04A 3IRRA 1P92A 1E2XA 3M1EA 2FOKA 4NQWA 5HVQC 2K86A 2HS5A 4IF4A 2R7FA 1SMTA 3WGHA 5BPDA 3GO5A 4BH9A 3DPLC 2QVOA 1CGPA 2ZNZA 3KFWX 2HDCA 3IWFA 4HX8A 5KVRA 1UB9A 1EH8A 1LDJA 3J81Z 1QO0D 1YG2A 1WQ2A 3V8JA 1W7PA 5LRSA 1RI7A 5BPIA 3GXOA 1FP1D 1P4XA 3VOEA 3EYYA 1JXSA 1BI3A 2RVCA 3ECHA 5DCMA 3KZYA 2A68F 4Q4ZF 2V1DA 3I58A 5F1RA 4G8XA 2HZTA 4U7BA 3P9KA 3LSTA 4BXUA 1ZH5A 1U2WA 2MLGA 2H94A 3HRTA 2HOEA 4KN7X 5EEHA 4DQ2A 4HLXA 2L02A 1O3TA 2F5CA 3FMQA 1FBSA 1LB2A 3TDUC 1QBJA 3WE3A 1IN5A 1XCBA 5CVUA 3GZ6A 1PDNC 4RB0A 4I0BA 2LF7A 5L3DA 4UVBA 2DPDA 2DO7A 3SZTA 4A0YA 5D6EA 3L09A 3E5QA 3DP7A 1FC3A 3FXUA 4WCGA 4ETSA 4LD5A 2STWA 4BQAA 2IPQX 3R0AA 3F3XA 1AWCA 2PMUA 2FBHA 4G6QA 2L4AA 1QZZA 5JI6A 2X0LA 2F5FA 3R4KA 3VFZA 2IT0A 3DFGA 1T0FA 4XLNF 5LLQA 1XSXA 4KT5C 2HWVA 4GXOA 3ZN0A 2EJRA 3E5UA 2KRFA 4G94A 1JE8A 3M8EA 3F22A 2Y75A 3HRMA 1B59A 1U6GA 2FSWA 1BIBA 3WTZA 2EFWA 1YS6A 2HGCA 3ISPA 2EA2A 2COMA 2PLYA 3TDZC 2RKHA 4CYDA 3BZ6A 3FF5A 2XIGA 5DD8A 2A5YB 4IXAA 1TW2A 4EJVA 3GUDA 4BHCA 3F23A 3HSRA 2VBYA 2LKPA 2P6TA 1U5TC 3E3VA 4HF1A 3RKYA 3Q5FA 4LG0A 4MGRA 2E1CA 1MDMA 1ZGJA 1HKSA 5LGTA 3E6BA 3GWZA 1FYLA 1ZARA 3R61A 3ZMSA 3M8FA 1HKQA 5A2QZ 2PMHA 3QP5A 2RN7A 3C18A 2VODA 3L9FA 2OQRA 2BEOA 1I27A 4LGWA 2ESHA 1USSA 4FX4A 4HF0A 4H0EA 1HW2A 4QLCU 1IF1A 2V1XA 4XLPF 1Z9CA 2TDXA 5ILUA 1KGSA 2FXAA 1O7FA 4KN4X 4I0AA 3TGNA 2M45A 2E7XA 2WTEA 2ZMEB 3WE2A 4MQVA 1D5VA 4KDPA 3ZN1A 3MCZA 1PP7U 2Z99A 2DK8A 3BROA 3VEPA 4L9JA 3RJPA 2ETHA 4MNUA 2FMLA 1OYIA 2X4HA 4IHSA 2Q2EA 5D5UB 2JPBA 3DEUA 2LDUA 2K7LA 3IL2A 4EJTA 3RTRA 4HQEA 3RYPA 1WWXA 3RIRA 4G7OF 2F2EA 4Z2YA 3K1PA 1YQAA 1GVJA 1WKMA 3V8LA 3KP4A 1UHWA 3BJAA 4G7ZF 4MEYF 3KETA 3BDDA 5E8IA 2M5WA 1HW1A 3KEOA 2DW4A 3D0SA 3LFKA 2XROA 2B0LA 5H6RA 2YPRA 2G7HA 2V6CA 2ZKZA 2LF8A 4LMYA 3JTGA 2DQRA 1ZLJA 4A0ZA 4LLNA 4L9TA 1FSHA 3HYIA 5JHUA 1ZG5A 1T98A 2DT5A 2Y48A 5ILVA 1C0WA 2L01A 4M72A 3JAMZ 1K7AA 3LQQA 3M9AA 3R60A 4P96A 3TO7A 2VC0A 1F5TA 2HQRA 3AAFA 4FHTA 3D5LA 2XRNA 3QRFF 1B6AA 5LHIA 2STTA 2V79A 3CLOA 2Q8KA 1S7AA 2L4MA 2VT3A 5HDKA 2W24A 4XSZF 2XAQA 2W84A 2Y0MA 1IXCA 3HUGA 1FP2A 3TO6A 2O61A 1P4AA 2RNJA 1O3RA 2EV6A 1SFUA 3JAMK 3V7RA 1JGSA 2D1VA 2ZFWA 2JSCA 5FGMA 1ZRCA 2KIUA 3HOTA 2M8EA 5CVJA 4M6YA 2IA0A 2Z5UA 4CO8A 4L9VA 1XB4A 2HKXA 3CO6C 2H6BA 1JHHA 2FE3A 3R0JA 5AIQA 4AWXB 2ZXJA 2OZUA 4CDGA 2QLZA 3SXYA 1QNTA 3F8BA 1J0RA 3R6SA 1KU3A 4OIRF 4MTDA 4WK8F 1BM9A 3IHUA 4A12A 5FFXA 1MKMA 2XAGA 3DXJF 4L5IA 5FO5A 3T1BA 1O57A 3GW2A 2JPCA 3HRSA 2J5OA 1U8RA 1YW8A 2L54A 1J75A 3EETA 3GVAA 4YG2F 1MJBA 3F21A 5J8CA 3DV8A 3RKXA 2FF4A 1U78A 1FT9A 3F8MA 1XCVA 2FRHA 3HSFA 1TLHB 4GYIA 2FEZA 2UXNA 2H27A 2M87A 3ZMUA 1FX7A 1Z6TA 2HEOA 1FPQA 1I5ZA 3QPTA 3TQNA 2IRFG 5D6FA 3F8NA 3Q9VA 1ZHFA 2FU4A 3EDPA 3BOQA 4OINF 1I1SA 2O3FA 4PDKA 1MGTA 4NB5A 3BPVA 1LEBA 1KQ0A 1YW7A 1ZAOA 3CJNA 3TO9A 3T8RA 3K69A 1DDNA 1S7OA 2A07F 2EV0A 2DAOA 1T6SA 1GHCA 4F7ZA 1S6LA 4PCQA 2KKOA 3FM5A 4AD9A 4LK1F 1OR7A 1B1BA 2EA4A 5HLHA 3FWEA 4HYEA 4O3MA 5IT9K 4IJAA 2XAHA 5DYMA 1F9NA 3W6KB 4KMFA 2QBYA 3GX4X 1B9NA 2OA4A 2PG4A 3J7AO 1ZRDA 1IXSB 3F8CA 3SQNA 4IVNA 1FOKA 3MZYA 1ZG1A 3CUQB 5FD6A 4FT8A 3IC7A 3G73A 1KQ9A 3IKVA 2J5PA 3QPHA 1XGSA 4CICA 4CGZA 3CUQC 2E1NA 2C6YA 4HDVA 1YIOA 5E1WA 4BHBA 4BHPA 2ISYA 1FLIA 4EM2A 4KYWA 5CLSA 1R22A 2MD5A 3KP6A 2GXGA 4RGSA 1HKTA 5FFZA 2FBIA 1DP7P 4KUMA 3E6CC 3BP8A 2AS5F 2F5DA 4LK0F 3U2RA 4EVIA 3ZP5A 5F6FA 4AIHA 2MH2A 2ZNYA 3ABTA 1STZA 3E97A 3ZMVA 1QGPA 2VBZA 1ODDA 4JBAA 1GXPA 4UVAA 3HTUA 3N97A 3LWFA 1IZ1A 4G9YA 4P5OA 1W7PD 3IKTA 1R5HA 1SD4A 1SAXA 3WTSC 3OOPA 1BOAA 4ENMA 3MQ0A 4MHGA 4KMUX 3F8FA 1D3YA 5IT3A 3K2ZA 1L3LA 1RIOH 4HBLA 5HS8A 1TNSA 4HV5A 4OU0A 2IA2A 3I53A 2XKOA 1EV7A 5ERIA 3O3KA 2H6CA 4M9XA 4LLGF 3RDIA 4JQFA 1V4RA 3EYIA 4I2OA 4HQMA 3GZ5A 1USTA 2BE5F 2MA3A 4ESBA 3I64A 3L7WA 3ML6A 4RGRA 2QYOA 2DI3A 3MAJA 2XAFA 3J80K 3WU1B 5TRDA 3MWMA 2D2WA 3TOBA 2GZWA 3NRVA 3FXQA 5HS9A 4KICA 1Z7UA 2ADUA 1P2FA 3PQJA 1MZBA 1WSUA 3BWGA 3WTYC 4Q5SF 1BIAA 2DQLA 5LGNA 3U1DA 1B4AA 2P7VB 4FX0A 5E17F 1K6OA 2EK5A 2E7WA 5L3EA 3N4MA 2HYGD 2XASA 4YIIA 5K5RA 3F6VA 3I71A 2CW0F 4R79A 1LQ1A 1FYMA 3TOAA 6PAXA 1S3JA 2KIMA 4QWQA 2NNYA 2A6HF 2NNNA 1F1ZA 3EUHA 2MLKA 4ASNA 3WTUC 3RPQA 4AIKA 3LA3A 3ZPLA 2Z33A 2UWMA 3O2PE 2R7DA 2DK5A 3BPXA 4KIFA 2XHKA 4I09A 4HW0A 4K2EA 4N9IA 4R1HA 2FBKA 4A5NA 2D1HA 1R00A 2F5EA 1IN4A 2R3SA 2BYVE 3VODA 1TBXA 3I0TA 1SD7A 2VBWA 1J2XA 4I01A 3KP5A 3E6MA 4RB3C 3WODF 5JR3A 4ENKA 3FMRA 4L5JA 2NRAC 2WC2A 2CFXA 4LFUA 4PZJA 1J9IA 2IJLA 3IWZA 2CWEA 3HRUA 3HTSB 3MFKA 4RGUA 2H09A 2GIVA 3CUOA 1BI0A 1FBQA 1U5TA 3ZMZA 4Q48A 2K02A 5BS6A 1FY7A 4OIQF 1R58A 2KJBA 4BAYA 2V9VA 1ZLKA 2FMYA 3RKWA 1G3YA 3QOPA 2GWRA 2PEXA 3G3ZA 5LRRA 1ZREA 4EM1A 2O8XA 3KP7A 2ZMEA 1O3QA 3HHGA 1PUEE 5J6XA 5DV5A 5ICEA 5L3FA 1R23A 4MEXF 3L00A 1ZYRF 5D5VB 2HTJA 1KYZA 1YLFA 4GGGA 4NHJA 1UHMA 1LJ9A 1ZG3A 4XBFA 1HSJA 1XGOA 5D8LB 5DUIA 3CTAA 5K5OA 2YX4A 4IPAA 1T38A 3B73A 3FXRA 4WX9A 4EJOA 1LNWA 2PJPA 2A69F 2K4BA 2UXXA 5EEGA 2HR3A 4L9NA 2HKOA 3H3UA 1WI9A 5K1YA 3V4GA 2D45A 1H9GA 3B02A 3KCCA 2FQ3A 4HX7A 2QM3A 3KLNA 3O6BB 2P5VA 3GFIA 5E1ZB 3I54A 3RYRA 2XUBA 3KLOA 5DUKA 1V3FA
chains in the Genus database with same CATH superfamily
5FLMJ 2CSOA 3BG3A 1UELB 3LA2A 4YFKF 4IRGA 2GLOA 3HB9A 2CQQA 2DJNA 4ZDOA 2E1MB 4DBRA 2R7QA 5DS9A 3PQKA 4RS8A 2LNBA 2W25A 4BU2A 4Y13A 5LHGA 2P81A 2GA1A 4M3GA 2R92J 1MSFC 1BI1A 2L0KA 4EGZA 1XN7A 1S8NA 4RAFA 2EFPA 4U7DA 4ZZDA 1I1GA 2FA5A 5F08A 1VQMI 4GO1A 1IW7F 2IGNA 2GOMA 1TW3A 3H92A 3FHZA 1IRFA 4RAYA 2VLAA 2OF7A 3ZMDA 2R7OA 2VKDA 1E17A 4P9UA 5A2QK 3HHHA 2O03A 4UUSA 5EYRA 1O3SA 1B72A 4M73A 4UUVA 1QU3A 1IDYA 2HQNA 4O6JA 5TGTA 3RPUD 3M3YJ 5CJ9A 3EQLF 2JK3A 2ZFUA 3SEQA 2HQ5A 1Y1WJ 3P9CA 3BG5A 3F9KA 3JRCA 1NHAA 2R5ZA 2B7EA 2RC4A 4U0VA 3WU0A 2DLLA 2VBXA 2VB6A 5LEJA 3NQOA 3RI4A 3IH2A 3TL4X 2DJIA 2P5KA 3OYLA 2FOWA 1EKEA 2XKPA 5IT9Z 2IBDA 1MMAA 5EJCA 4B09A 1BBYA 1QZYA 4HX4A 4PFOA 4FCYA 3JCUC 4ZYHA 1H9TA 4EQQA 3IH3A 5F04A 3E1SA 1BN5A 3HZJA 5LFAA 2QUFA 2VT2A 3ZMTA 1FBUA 2QSGX 3CUQA 2ZJPF 3EPZA 3AG1H 4ON0A 2XGDA 3L2CA 2MYSA 1D0ZA 4YIFA 1OCPA 5E1XA 2JVGA 4M3DA 2DTRA 1T2KA 3DU6A 3J7ZI 1FMWA 2EB7A 3AKZA 2DFHA 4ZTFA 1W7PB 2E1MC 1ETKA 2DA6A 3DKWA 4KIGA 5BNGA 3DBHB 3I59A 1RKTA 2LC2A 2ZCWA 3OR2C 2JRMA 2AXLA 4U0WA 3WTTC 1X3UA 2MG4A 3QAHA 1TQMA 4Y33A 1YO5C 1FOXA 4I7HA 1K4TA 2OD5A 4YFXF 1NH3A 2KJCA 2OUMA 3IRQA 1ULYA 2BY3A 4PGGA 2EBIA 2ESNA 3TBIA 3BY6A 3GTLJ 4ENNA 2HFHA 3PNTA 1VF9A 4XKBA 4XORA 2IGOA 2QENA 4PJMA 1FYKA 3KP3A 1MJAA 3HPGA 3RZDJ 4UVCA 5FKOA 1LDDA 4H4KC 3D5SC 1ERDA 3ULQB 4HA8A 1V5FA 2ZSHB 4OIPF 3ASOH 2RGVA 1AA7A 4E7LA 2OU2A 3BJ6A 3OWTA 5ILSA 1RUOA 1BJZA 4IHWA 3VB2A 3SZPA 3JRBA 4HSTA 3HOWJ 1G6NA 1LE8B 1YOVB 1IAWA 1BC7C 3K4MA 1MSEC 1GVDA 2EFOA 3KIOA 3EUAA 2P4WA 1Q1VA 2MD0A 5FROA 2M0CA 3A0BC 1ON2A 2COBA 2K27A 2X1DA 5IOZA 1R1VA 1SVLA 3FBNB 5BMZA 3BQZA 4UV8A 1REPC 4HZFA 1MJ9A 4DNCA 2PMZN 1TTYA 4XICA 4ZYGA 1XMXA 1TT0A 3E6DA 3WHBA 3I4MJ 1IXRC 1M1EB 3WG9A 4HDUA 4ESJA 2R7TA 2ZBKA 5FD5A 2PJRB 4ZYDA 4A6EA 1YITI 5FLXZ 1KU9A 1AKHA 2K9MA 1BC8C 1P9QC 5F1JA 3J80Z 2QSHX 4E6KG 5DDGA 1Y0UA 2XV4S 3HJEA 2A3SA 1UG0A 3T8TA 2VASA 1SANA 2CQKA 2LP0A 1I6XA 3RSNA 5J3LA 5C4JJ 4CYCA 5LHHA 2A6EF 3DBRB 5FB2A 3BG7A 2ZC2A 3CCRI 1XD7A 4HNUA 2XPUA 3TP0A 1OCZH 2L5QA 3G1LA 3MKYB 1FIPA 2IW5A 5JHFA 3AL0C 5ICGA 1FSEA 4JK1X 1G3WA 3ECOA 2GXBA 3GTGJ 4UNOA 3OYIA 2HVSA 2OAZA 2VQCA 2Z9OA 4KIBA 1UCRA 3OYJA 1W5SA 4P9FA 2JJ7A 4KISA 2F4MB 2IEKA 2DU9A 4ZTJA 2JZYA 5IPAA 2LVSA 2VN2A 2DA3A 3QU6A 1OPCA 2L9VA 5KAIC 2M30A 1HCRA 3GF2A 2ID3A 1FZPB 1QPIA 1BI2A 3FX3A 9ANTA 2IGKA 1K78A 2RDPA 3ESWB 1TL8A 1XGNA 3ABUA 1GXQA 4IX7A 1UMQA 4HF2A 2E2HJ 5DTDA 1UAAA 3GTJJ 1FNNA 4M9SA 5LGUA 5CVVA 1HQCA 5EF6A 3OV8A 1LVAA 5CYVA 4UV9A 3DU5A 3K1MA 1AU7A 3BTLA 4XR6A 3JSPA 4RLQA 4F92B 3QP6A 5J40A 1OMIA 2K4JA 4D5FA 4RB2C 1SD6A 2NAZA 3OYAA 5F64A 1KQ8A 3KZZA 3I4PA 1D1CA 4AC0A 4BGDA 1I3AA 2MABA 4BACA 2DPUA 1W4MA 3S8PA 1GDTA 3CC7I 1BW6A 3DPTA 1AHDP 4N0BA 3SDBA 3CJRB 2KISA 1ONVA 2DA7A 5HOOA 1RR8C 1DP3A 1D0YA 2VXZA 3QU3A 4AVPA 4F55A 3A4CA 3C2BA 1VQNI 3S93A 3S3MA 2XVCA 4EMSA 3QPLA 5E20A 4XKWA 1F4KA 1XDSA 2K3FA 4OOIA 1IUFA 4Y15A 3E5XA 4RM3A 1ETXA 4LB6B 4XN0A 3GLXA 4V2FA 4LG3A 4BQNA 4ZJZA 1HXDA 2ACJA 2HYFA 3RPUA 4UUTA 2NOGA 2V7FA 3H9QA 1MH3A 5ICFA 2VOPA 1U5TB 1J7KA 2AQFA 2LSOA 4QPQA 3BJOA 4S05A 2GAUA 3TKYA 4IHTA 1XMKA 2XAJA 3U1KA 2HZDA 3WGGA 1P6RA 2W7NA 4M74A 5HLGA 2Z3YA 2DTZA 1HSTA 2HPIA 5F0CA 1D1AA 2PN6A 2DA1A 3WTVC 1N75A 1OKRA 2Y0SN 3PUFA 1A36A 3SHFA 1SFEA 1SEUA 4CHUA 4LJZF 1PP8F 3REOA 4EM0B 3I9V2 4EJUA 1B9MA 1YRNB 3ZQFA 5LBQA 2A61A 5CVRA 4NC6A 1Y39A 4F91B 2M1BA 2WAQA 1U3EM 3GYHX 4Q47A 4I98B 1IRGA 4P55A 1U8BA 1FOWA 4C3HJ 2QBYB 2WAQN 3GEZA 2RQQA 3H0GJ 1MNDA 2VC1A 3L2RA 3S17J 4NC8A 2OBPA 4FISA 1ZN2A 1LFBA 1W5CC 1MBKA 1Z67A 2VL8A 3AG4H 5K7ZA 4CZZA 3HOSA 1OJLA 1Z1DA 1GV2A 5D5XB 2YSRA 5HLTA 2LREA 1TWCJ 4ENJA 2PMZA 3LFUA 1IN8A 2MBFA 3CP2A 1K79A 3ABMH 4BJ6C 4MTEA 5AIPA 3O8GA 1RUNA 3ZRGA 2L7FP 4A93J 3K10A 2JT1A 2R4GA 4PUSA 4B47A 2VIXA 2EIJH 3QPSA 1IV8A 2JVHA 3K7AJ 3H3VK 3W6JB 4XNFA 2HVQA 3CMYA 1LFUP 3DCFA 3L1PA 4GRIA 4IHVA 2BV6A 5E79C 4BYYA 2PBIA 4OAYA 3M7GA 4G7HF 2P6SA 2W85A 4XRFA 1XGMA 5IP9J 2HQAA 4RB1A 1BR2A 4KA4A 2DDBA 3H3ZA 1ZRFA 2ID6A 1B8IA 3V8KA 4PGHA 4EV0A 3Q0VA 5K7HA 3OSFA 1BR1A 3PFIA 3U9GA 4C3IJ 1HW5A 1NK2P 5HDGA 1RETA 2JTVA 4D9JA 2YX7A 3WTWC 3CO7C 2V26A 1YW9A 5F0FA 2L3DA 1J59A 1OYYA 3ZQ7A 2K9NA 3ZQHA 1UJ8A 2QQAA 1FWZA 1ETOA 2TRTA 4TV7A 1TNTA 3CCQI 2BVMA 3VSKA 2LH9A 2KIFA 3COAC 1VQOI 4IRHA 1RKWA 2KIQA 2GOXB 4HSRA 5HDNA 2JUCA 4BEHB 1ZGAA 1Q1HA 3JRIA 3BG6A 1QPMA 5M5XJ 1EH6A 3DKYA 1VTNC 4LG0B 2DMUA 2VE9A 5BOXA 3W3CA 2QZ8A 1XDUA 3S2WA 2HI3A 1LEAA 3GFLA 2RV8A 3M8JA 2CG4A 2IP2A 1J5YA 4XM3A 2CW8A 3HOZJ 2XPWA 4L18B 1Z21A 1R71A 2Q0OA 1ETYA 1KA8A 4OMZA 1QQIA 5IYCJ 1CF7A 3HGGA 2VE8A 1MNMC 2ZXHA 3BR3A 4FASD 1W1WE 3LAPA 4YFNF 3GLLA 4S0HB 3JR9A 3BR0A 1TZLA 2YR2A 5DD4A 2RQPA 3FM3A 3P5JA 2OQGA 4WXHA 1TT5B 1D8KA 2FNAA 3H0DA 4QIWN 2MC3A 2PI0A 1RRJA 1X1BA 2E1OA 4OMYA 1KYWA 2YS9A 2JRTA 4UXNA 3LAJA 1V55H 1WRJA 3S32A 3JSOA 4RA2A 3MZHA 4LB5A 4XOTA 1X3ZB 2R7RA 3C2HA 1YJWI 1YYVA 1N78A 4KFCA 2L7MP 1FOYA 5D8KB 3SYTA 1O7LA 4LLLA 4D5CA 4E7SA 1S29A 4Y17A 2NYXA 4A0XA 3S15J 2BGCA 1WH7A 4EJWA 1T39A 2V4JC 2ELKA 1Y6IA 2QWWA 4MQ9F 1VQLI 4ZH4F 3T5XA 3C1DA 1UFMA 1R4MB 2DYRH 1JJ8C 2K5CA 4RAZA 5D4RA 5HS7A 4D0PA 3GFJA 2HDDA 4KITB 1R7JA 2ISZA 3CCUI 3P9IA 4M6XA 1MDMB 1PVEA 2WWYA 3Q3SA 2MH9A 1G4DA 1P4WA 4PJ0C 1MD0A 1WH5A 2GA2A 3JTHA 1AOYA 5GPCA 3J81K 1Z77A 4U88A 3S2HJ 4DJAA 4HV6A 4UHTA 3CCEI 4M9ZA 5ICCA 3QQAA 4CXFA 4RM2A 1JKPC 4A3JJ 3DTEA 4A6DA 5FRNA 4M71A 3W6VA 1CF7B 4V2GA 3HSEA 2OZ6A 3FZVA 1X4OA 1K6YA 4IKFA 1BW5A 1LVKA 1JKRC 5CPRB 2O6GE 1X58A 1SFXA 1KZHA 3GBGA 2BBYA 5B1AH 5GTIC 4M3EA 5HLIA 1CQTA 5EZGA 3E0JB 1KU2A 2Z1DA 4ZYEA 3CDHA 2CUFA 1DUXC 2L7ZA 3QODA 2HTSA 1AKHB 2KQRA 4HAMA 3F6OA 4ABZA 1TQPA 2O8KA 3GTMJ 1R36A 4A3GJ 3MEXA 1XSVA 4KNYA 1YJ9I 5JFRA 5D5WB 3WG7H 3L2UA 3F72A 1SD5A 2DBBA 2K9SA 3WHCA 4XLEA 4U0YA 5AONA 4IRIA 3V42A 2CO5A 5K5QA 2VONA 4ESFA 3VYRB 2M7AA 3FKIJ 2VQLA 3KP2A 3Q0UA 2DOAA 2ELHA 2W57A 4WF2A 2L9SA 4AVZA 3ONQA 2P8TA 2VKEA 5CKTA 5J1YA 2ME6A 2ZO4A 3F0CA 3IP4B 3PFYA 1Z91A 3CDLA 4A2UA 5L3BA 3ELKA 1G3TA 3WGIA 2IA1A 1NTCA 2NVUB 2XC7A 2WV0A 3B6CA 5H20A 3MZ8A 1EH7A 3DF8A 3K0LA 4BE1A 1X1PA 1MW7A 3JW4A 2FNPA 1YFHA 4II2A 4CCKA 2YU3A 3RCOA 3I55I 3I56I 2Q2EB 3SFZA 3K1NA 5E8GA 4A3KJ 3BG9A 4C2UA 2CGPA 2W1OA 3PM1A 2PFBA 2LKSA 4G6DA 5DCMB 3V7SA 1VQ6I 2EZHA 3ERED 5E18F 4N9HA 1IN6A 5CVIA 1LDKB 5M3MJ 3G2BA 4HG2A 3T0YA 4RMNA 2CYYA 3S1NJ 1TQIA 2QQ9A 2P5LC 2OTLI 4B8XA 1V54H 5J4VA 4IL6C 4S04A 3I5UA 2R93J 5C4XJ 5H2FC 2V1UA 3A1YA 2JUGA 1XSDA 3I59B 3OIQA 4EGYA 3PSIA 5L3CA 1VQKI 3LQRA 1SC7A 1VFCA 1WJFA 2GQQA 2M4KA 2EH3A 2EFNA 3KE2A 1D5YA 3ROUA 1MIJA 3KYLA 3J7AY 2JA8J 4XLHA 4XOPA 1WJCA 1HBXG 5FLXK 2KLOA 2G9WA 3CMEI 1VQPI 1U0JA 1YTYA 1G3SA 5ED4A 1WHUA 2EWNA 2IVMA 3H1CA 4Y52J 4DGWB 4UB6C 1LE8A 4O5VA 2RAEA 4WWCA 5DCFA 2ZXIA 3Q9SA 1D8JA 2XGXA 1JHFA 3WTXC 1VI0A 3K9TA 1L0OC 3OIPA 2ELJA 5D4SA 2EIMH 1BJAA 3L2WA 2UZKA 2QEXI 3ABKH 1YS7A 2M3AA 3HKZN 1Z6RA 1K78B 1IRXA 4EEFG 1D1BA 5DEQA 3LA7A 2O0YA 3CDIA 5J8FA 4L0YB 2P7CB 2V9PA 2XF5A 2QKMB 4F93B 1TWHJ 4I02A 4J19A 2M4GA 1Z0XA 4A3FJ 1GLNA 3H9GA 1WGXA 1IUYA 1R5GA 2QQBA 4RGXA 3KZIC 1ON1A 2LR8A 3TP3A 4E70A 2BHYA 4BNCA 3C3WA 2IS1A 1S5LC 2WA0A 5H6QA 5M3FJ 1HA8A 4A69C 5L3GA 1PJRA 4B3AA 4DYCA 2CFOA 4XSXF 4GCVA 2G7UA 2QF7A 2PQ8A 5BQTA 3PO3J 4HLYA 5LEKA 4YEJA 3ASNH 3HL2A 1DPUA 1RNLA 4WXDA 1IN7A 3IAM2 1OYWA 3SFIA 1ITYA 3KEQA 3FKJA 5KK1A 3PL8A 2AXTC 3S1QJ 3M1CA 2OCCH 5EZHA 2EFQA 1R6RA 4IEJA 2EV5A 5E3OA 4D1QA 3OYKA 2NS0A 2ZJ2A 1SMYF 3OSGA 1R1UA 4J00A 5GPAA 5TJJA 2XAUA 3DQVC 3NEUA 4LITA 2V9KA 3C7JA 4ZC3A 2R0QC 2B9SA 3ZQQA 3V7CA 3CCJI 3GFMA 3LOCA 1RZ4A 4PFPA 1FTZA 5IOYA 2DFIA 3ZGKA 1W5TA 4HOBA 4A5MA 4AIJA 2NS7A 4OIOF 3RQ4A 1KU7A 4WXCA 3L2QA 1Z7LA 4QTRA 5FLVA 4BXXJ 3LSRA 1Z05A 3HIFA 2DODA 3DPUA 1X2NA 1XG1A 1DPRA 1XMAA 3P7NA 4D7MA 2DCEA 3FMSA 1X4PA 4R8HA 5DM7F 4I99C 3JRAA 1R1TA 4ZZLA 4L0ZB 3BCAA 1H0MA 5JVTA 4GYGA 3BTCA 2VOOA 1A04A 1XX5A 4C9YA 2M0MA 3IRRA 2D5VA 1P92A 1E2XA 3DKXA 3M1EA 2NOJB 5CQGA 4C3JJ 2FOKA 4NQWA 5HVQC 2K86A 2HS5A 1R4NB 4IF4A 5FKKA 2R7FA 1SMTA 3WGHA 2DT7B 2IS4A 1FTTA 5BPDA 4CSWA 1F43A 4XRSA 2DOEA 3UR3C 3CP8A 1FIAA 2QGUA 4A3LJ 3GO5A 2Y2ZA 1YIJI 4BE0A 4BH9A 3DPLC 1MBFA 3QYBA 2FD5A 2QVOA 1CGPA 2EZLA 2IAIA 2ZNZA 3KFWX 2HDCA 3IWFA 4XRMA 2CQ7A 2HXOA 2KRHA 1UB9A 4HX8A 3E7LA 5KVRA 2F4IA 4LIVA 1EH8A 2VJ4A 1LDJA 2KDOA 1QO0D 3J81Z 1ZGWA 1YG2A 3DTIA 4F52A 4W1UA 1WQ2A 3V8JA 1W7PA 3QOEA 3A03A 2L7KA 2CS3A 5LRSA 1RI7A 3ZQGA 5BPIA 4C30A 1R9TJ 1OCOH 3CCYA 3OL4A 4BY7J 4D7NA 3GXOA 4MLOA 1FP1D 3VSLA 1P4XA 4OWRB 1JKQC 3VOEA 3ZQIA 3MKZA 3EYYA 1JXSA 2VKVA 3H5RA 1BI3A 1T95A 2RVCA 3BCBA 3LSHA 4E4HA 1DGRM 3ECHA 2XGCA 5DCMA 2H8WA 3KZYA 2A68F 2QKLB 4Q4ZF 2V1DA 5EGOA 3I58A 2XB5A 4P1WA 5F1RA 4II3A 4G8XA 3BLYA 2HZTA 2XPVA 4U7BA 1MMDA 3P9KA 3LSTA 2E34A 4BXUA 1WJBA 3IUOA 4DW6A 1ZH5A 1U2WA 4HRIA 4C2TA 1R5ID 2LG4A 4BKXA 1F36A 2H94A 2MLGA 3HRTA 2HOEA 4CCOA 2Z16A 2NVYJ 4KN7X 3J7YJ 5EEHA 3TMOA 4YIRX 1JJ6C 1NG6A 1MBJA 4A3BJ 3QYFA 4DQ2A 4IQJA 4HLXA 1NK3P 2LLKA 2LFBA 4XLAA 1U9NA 2L02A 3DLAA 1O3TA 2JA7J 2F5CA 3FMQA 1FBSA 1LB2A 2EZIA 3TDUC 3FXOA 1QBJA 3FXJA 2HYJA 2HDWA 1ZTRA 3S16J 2KP6A 3WE3A 1IN5A 1XCBA 3MKLA 2F5VA 1QHHD 2DMPA 5CVUA 5EG0B 3GZ6A 2XGEA 1PDNC 2DOFA 4RB0A 4I0BA 2LF7A 5L3DA 1X1DA 2L9NA 4XLCA 4UVBA 1K83J 1VQ7I 1E3OC 5EG0A 2M2EA 4MFDA 2CMPA 4N4OB 1DGWY 3OYNA 2DPDA 1OISA 2DO7A 2YUSA 3HKZA 4A3IJ 1A35A 3SZTA 3PNVA 4JX4A 4A0YA 2G0EA 2K9LA 5D6EA 2HNHA 2ZJQF 3L09A 3E5QA 3DP7A 2P0WA 2Y30A 1FC3A 3FXUA 3KPHA 3K70C 3PJRA 4WCGA 4ETSA 4X6AJ 5FKMA 3O8HA 2E60A 1S7EA 2QSFX 2Y9ZA 3QYEA 4LD5A 2STWA 2X6WA 2EIKH 4BQAA 3CESA 5FRMA 2R5ZB 2IPQX 3R0AA 3F3XA 1WFXA 2Q1ZB 1AWCA 2PMUA 1FMVA 2FBHA 4G6QA 2L4AA 2DXIA 1QZZA 1ETWA 5JI6A 2X0LA 2F5FA 3R4KA 3VFZA 1V5EA 1X1CA 2CH0A 3DFGA 2IT0A 2ZB9A 5HNFA 3AFHA 1T0FA 1X2MA 1ENHA 4XLNF 1P7JA 5LLQA 3IV5A 1JUMA 1XSXA 4KT5C 2HWVA 4GXOA 3OYCA 1OCTC 3ZN0A 2EJRA 3E5UA 2KRFA 4G94A 4XLFA 1JE8A 3M8EA 3F22A 2DA5A 1JTXA 1W36C 2UV1A 2Y75A 3HRMA 1B59A 1IV6A 5KAFC 1U6GA 2FSWA 2X9DA 1BIBA 3WTZA 2EFWA 2VPRA 4KT6A 1JUSA 1YS6A 4MO7A 2HGCA 3ISPA 2DDAA 1I3QJ 2EA2A 2COMA 5FJ8J 4Y3OA 4IO9F 3GZNB 3GTKJ 2QQ8A 2PLYA 2ECBA 2RKHA 3TDZC 4CYDA 1W36D 1H89C 3D1NI 1X1AA 3BZ6A 5GAGJ 3FF5A 3CQZJ 2BOLA 2XIGA 5DD8A 3BQYA 2A5YB 4IXAA 5B5EC 3EUHC 1TW2A 4EJVA 2X48A 3GUDA 4BHCA 3F23A 2E19A 3HSRA 2IXSA 2VBYA 2LKPA 2R7UA 1YX5A 2P6TA 2JQ7A 1U5TC 4RLFA 3E3VA 3ZCOA 4HF1A 2ICWG 3RKYA 2KFDA 1ZR2A 2O5RA 3OYDA 3Q5FA 4LG0A 2CU7A 3A01A 4MGRA 2E1CA 1MDMA 1ZGJA 5K7FA 1HKSA 2HU9A 4MIMA 1ETVA 5LGTA 3E6BA 1YI2I 3ERMA 5KHDA 2BVLA 1YE9A 4BQOA 3GWZA 3OYFA 1FYLA 3SZGA 2HOSA 1ZARA 1MMSA 3R61A 4BBSJ 3ZMSA 3M8FA 1K4SA 1IGNA 4Y4RA 1HKQA 5A2QZ 3NWTA 2PMHA 3QP5A 2RN7A 3C18A 2WADA 2VODA 3ZQCA 5CQEA 1QVUA 3L9FA 1I50J 2OQRA 2BEOA 1I27A 3VYSB 4A3MJ 3QWLA 4FE4A 4LGWA 2ESHA 5B3SH 2CRGA 1USSA 4FX4A 4HF0A 2GBYA 4H0EA 4IHXA 1HW2A 3K4NA 4QLCU 1IF1A 2M9HA 1UZCA 2V1XA 4XLPF 1Z9CA 2TDXA 4NC7A 4ITVA 1RC9A 3U21A 3OL3A 5ILUA 1KGSA 2FXAA 1O7FA 4KN4X 4E7JA 4I0AA 1OFCX 3TGNA 2WB1N 1JT0A 2JWTA 2M45A 2E7XA 1XPXA 3CC4I 2WTEA 2ZMEB 3WE2A 4MQVA 3NWSA 3SDGA 1D5VA 3VYUB 4KDPA 3AG2H 4AUXA 3ZN1A 3MCZA 4QPOA 3FHNA 1PP7U 4LOCA 2VQHA 2Z99A 1Y0NA 2DK8A 3BROA 3NAUA 4B4CA 1FJLA 3VEPA 1T0FC 4L9JA 3RJPA 2W82A 2ETHA 4MNUA 2FMLA 4L5EA 1OYIA 3GCMA 2X4HA 3BC8A 3HUGB 1QVTA 3SJMA 4IHSA 3FXKA 3M4OJ 1IDZA 4UB8C 3FBIB 2Q2EA 5D5UB 2JPBA 3DEUA 2DMNA 2LDUA 3DBLB 2K7LA 3MKWB 3IL2A 4EJTA 3RTRA 2DA2A 4HQEA 4B3XA 2HXIA 3RYPA 4CZCA 1W0TA 1WWXA 3CF5F 1JI8A 3OYBA 1H88C 2KZVA 3RIRA 4G7OF 2F2EA 1YRNA 1EF4A 4Z2YA 3K1PA 1ZELA 1MMNA 1SFKA 1YQAA 4E7ZA 3OYHA 2EQRA 1GVJA 1WKMA 3V8LA 3KP4A 1UHWA 2LRDA 2EINH 3GTPJ 3BJAA 3OYEA 4GFBA 3KEYA 4G7ZF 5J47A 4MEYF 1HC8A 3KETA 3I3LA 1T08B 3BDDA 5E8IA 2M5WA 1HW1A 3K4KA 3GTQJ 3KEOA 1S72I 2DW4A 3D0SA 1GT0C 3LFKA 2XROA 2B0LA 2KDZA 5H6RA 2YPRA 2JMWA 3S3OA 5M5WJ 2G7HA 4AM3A 1I6HJ 2V6CA 2WAFA 4E7IA 3L2VA 2ZKZA 2PX9A 2LF8A 4LMYA 3JTGA 2DQRA 1ZLJA 4A0ZA 4LLNA 2VJJA 3PIPF 4L9TA 1FSHA 2LMDA 1MMGA 4BY1J 3HYIA 5JHUA 3HG9A 4NDLA 1YJNI 1ZG5A 1T98A 2DT5A 2Y48A 5ILVA 1C0WA 1S9HA 2L01A 4M72A 4KJZA 2H1KA 4DIQA 3JAMZ 2XSDC 2BZTA 1K7AA 1ACIA 1D0XA 1G2HA 5C44J 2O7OA 3GTOJ 1G8XA 3JRGA 3LQQA 3CD6I 3M9AA 3R60A 4P96A 3LSIA 3TO7A 3IH4A 2VC0A 1ZKGA 2LBFB 2HQRA 1F5TA 1TWFJ 3DLLF 2W48A 3AAFA 4FHTA 3D5LA 2XRNA 2L2OA 4RBOA 1XS9A 3QRFF 2M7BA 1VZ0A 3OS1A 2JN6A 5M5YJ 1B6AA 5LHIA 2STTA 2R7SA 2FQ4A 4HEA2 2V79A 4UUSB 1B8IB 3CLOA 2Q8KA 1RR7A 5IP7J 1VQ8I 1KONA 1S7AA 2NVXJ 2L4MA 2VT3A 5HDKA 3VDXA 2W24A 5FKLA 4XSZF 2DA4A 3HXLA 2XAQA 3HDDA 2W84A 2Y0MA 4M6VA 2BW3B 4GDFA 4HNVA 1Z3XA 1IXCA 2WAEA 3HUGA 1FP2A 1ORKA 3TO6A 2O61A 1T56A 4G12A 3LSJA 1P4AA 2RNJA 2RREA 1Y8RB 5EGOB 1O3RA 2VJ5A 2EV6A 1SFUA 3JAMK 3V7RA 3ZOBA 1JGSA 2D1VA 2ZFWA 4IQ4A 4XL9A 3HOVJ 1QA6A 1TWGJ 2JSCA 5FGMA 1ZRCA 4BL0B 3K4BA 2KIUA 3HOTA 2M8EA 4M6YA 5CVJA 5KCMA 2IA0A 2Z5UA 4CO8A 3N05A 4L9VA 3G4SI 1WJAA 5TISC 1XB4A 3X2QH 4DYRA 2HKXA 2BY1A 2Z2SB 3CO6C 2H6BA 2KZGA 1JHHA 2E5NA 2FE3A 3R0JA 5AIQA 4AWXB 3K4CA 3MN2A 3BZCA 4PJNA 5IYBJ 3ZQLA 2ZXJA 5B1BH 2OZUA 3AL0B 3MD2A 4CDGA 2QLZA 3SXYA 2GIZA 1QNTA 1RPWA 2PJRA 3F8BA 2LY9A 3G1OA 1J0RA 3R6SA 1KU3A 1DU6A 3LNQA 4OIRF 4MTDA 4WK8F 1BM9A 3H36A 2DFFA 2XB0X 3TW7A 2KL4A 1W0UA 1K61A 2R5YB 3JRFA 2VXDA 5GAEJ 2WBMA 4AYBN 3IHUA 4A12A 5FFXA 4M3FA 1MKMA 2XAGA 3DXJF 4XQFA 4L5IA 5FO5A 2A05A 4YELA 2K3PA 1E3HA 3T1BA 1O57A 3AG3H 3K4LA 2B63J 5IYDJ 3GW2A 2IGMA 2JPCA 3HRSA 3S3NA 2J5OA 3KYDB 1U8RA 4YRVA 1YW8A 2I5UA 4ANJA 5J1UA 3A01B 1TP4A 2L54A 3MMYB 3CCLI 3K4JA 1J75A 2OCEA 1IO2A 3EETA 3GVAA 4YG2F 1MJBA 3F21A 1MBHA 1LUJB 4U87A 5GTHC 5J8CA 4BDZA 2W00A 3DV8A 3RKXA 5B66C 2FF4A 1U78A 2Y69H 1FT9A 3UNGC 3F8MA 2AQEA 1XCVA 4JP0A 3TEDA 3MVPA 1X3WB 5GADJ 2FRHA 3HSFA 3OS0A 1TLHB 4GYIA 2FEZA 2CQNA 2UXNA 4AYBA 1Z3YA 2RNGA 2O9LA 2H27A 3I4NJ 2M87A 3JRHA 3RQIA 4RDUA 2LYCA 3ZMUA 3SEZA 4CCJA 1FX7A 2CW7A 3DEEA 1Z6TA 2HEOA 3FXMA 2OC6A 3A2KA 1FPQA 1I5ZA 3QPTA 4NNJA 3TQNA 1GUUA 5D6FA 2IRFG 3F8NA 2CV0A 3Q9VA 1ZHFA 3OYMA 2FU4A 3EDPA 2WV1A 1T8IA 3BOQA 1JUPA 4OINF 1POGA 2CQXA 1I1SA 3PO2J 3FXLA 2O3FA 4PDKA 1MGTA 4NB5A 3BPVA 1LEBA 1KQ0A 1YW7A 4J01A 2IS2A 1DU0A 1U9OA 1ZAOA 1A6IA 3JRDA 2XDVA 3CJNA 2CUZA 2BHZA 3TO9A 3T8RA 3K69A 1DDNA 4IOCF 1S7OA 2A07F 4XKCA 2EV0A 5C3EJ 2DAOA 2LK2A 1T6SA 1GHCA 1OCRH 4F7ZA 1S6LA 4PCQA 5GAHJ 1JGGA 2KKOA 3BT9A 3CMAI 3ABLH 1HDDC 2CJJA 3FM5A 4AD9A 1OR7A 4LK1F 1B1BA 2EA4A 2OTJI 5HLHA 2KT0A 3CCMI 1E0EA 4NBQA 1G59A 3FWEA 4HPQA 4HYEA 4O3MA 2LTPA 1LPQA 5IT9K 2MC4A 3KX2A 4IJAA 4X0GA 3K2AA 3PUBA 4OAZA 2XAHA 5DYMA 1F9NA 2JSPA 3W6KB 2Y9YA 2QBYA 4KMFA 3GX4X 1B9NA 2X6YA 1WPKA 2OA4A 2PG4A 3DEWA 1T33A 3J7AO 1ZRDA 1IXSB 2E71A 3FK6A 3BR6A 3F8CA 3SQNA 4DYQA 1JTYA 3K6GA 4IVNA 3OIOA 3CMMA 5HODA 1V5GA 1FOKA 3MZYA 1JKOC 1ZG1A 3CUQB 5FD6A 4FT8A 1BL0A 3IC7A 3PNYA 4UY8I 3VWBA 3G71I 2F48A 3G73A 1KQ9A 3IKVA 2J5PA 3LSKA 3QPHA 1XGSA 4FQGA 1J09A 4XN3A 4CICA 3OY9A 3BTJA 3CUQC 4CGZA 2E1NA 2KHMA 2C6YA 1PUFB 4HDVA 1OQYA 2I10A 2QCOA 4CUGA 1QHGA 1YIOA 1WZ2A 5E1WA 4BHBA 3CLQA 4BHPA 5IP6A 2ISYA 1FLIA 2VUMJ 2NVQJ 4EM2A 4KYWA 4B48A 5CLSA 1R22A 2MD5A 3KP6A 4XRSG 2GXGA 4RGSA 5F0HA 2EPFA 2DMQA 5IY5H 2WB1A 4F3QA 1A31A 1SFOJ 1HKTA 1WJ5A 4PSWA 5FFZA 2FBIA 1DP7P 4KUMA 3E6CC 1B72B 2X6XA 3BP8A 2KMUA 2AS5F 2F5DA 1MNEA 4LK0F 3U2RA 4XMYA 4EVIA 3ZP5A 5F6FA 5LD2C 4AIHA 3A02A 2MH2A 1ZR4A 4BJ5C 5E3MA 1R49A 1TWAJ 2NXNB 4FE7A 4DBQA 2ZNYA 3OOUA 3ABTA 1STZA 2OPTA 3CCSI 2Y0SA 3E97A 3ZMVA 1QGPA 2VBZA 1IC8A 1ODDA 1SVOA 4JBAA 1GXPA 4UVAA 4XK4A 1EJ9A 2LY1A 3HTUA 3N97A 3LWFA 1IZ1A 4G9YA 3OS2A 3W2VA 1Y8QB 4P5OA 4CCNA 3C2GA 1W7PD 3IKTA 1R5HA 2M8GX 2QA4I 1N77A 2CV1A 1SD4A 3HBLA 2X6OA 1SAXA 2V1NA 3WTSC 3CJQB 1BOAA 2DYSH 3OOPA 4B1RA 4ENMA 3MQ0A 2VKHA 2M34A 1SAUA 4IZZA 4MHGA 4KMUX 4I76A 3F8FA 1D3YA 3OYGA 3BR5A 5IT3A 3K2ZA 2FUG2 1L3LA 5FKNA 3HGYA 3BZKA 1RIOH 4HBLA 2K9QA 5HS8A 2VJIA 4Y7NJ 1TNSA 4HV5A 4NQWB 1VQ9I 2MSYA 4LIUA 4OU0A 1BA5A 3HEFA 2FX0A 3LSMA 2BXYA 2IA2A 3I53A 4Z6YA 1WCMJ 2HOAA 2LKXA 2WY8Q 1IG7A 2XKOA 1EV7A 5ERIA 1E3PA 3O3KA 5F27A 2H8RA 2H6CA 2BW3A 3HPHA 4M9XA 4FTHA 4LLGF 3RDIA 4JQFA 1V4RA 3EYIA 4I2OA 2R7XA 4G6TB 1H8AC 2DMTA 4HQMA 3GZ5A 1USTA 4XIDA 2BE5F 2MA3A 3CCVI 1N25A 4ESBA 3I64A 1XC5A 1BOBA 3L7WA 1QZEA 3ML6A 4RGRA 3CF2A 2KPMA 5E3LA 1HF0A 2QYOA 1WJEA 2DI3A 4AU7A 5EEAA 4BBRJ 3KYCB 3OMYA 3MAJA 3TW6A 4DZJA 2HPMA 3G1MA 1SVMA 2XAFA 3J80K 3WU1B 4BQQA 1IJWC 2OJED 4ZYAA 1FEXA 1WI3A 4EATA 4PK4A 5TRDA 3MWMA 2D2WA 4PSXA 2GZWA 3NRVA 3FXQA 3TOBA 5HS9A 2LOOA 4M3BA 4JYKA 4KICA 1Z7UA 3VYTB 1Y1VJ 2ADUA 1P2FA 4V19K 3PQJA 4ZDLA 1MZBA 1WSUA 3BWGA 3WTYC 2X1EA 4QSHA 2XSJC 4Q5SF 1BIAA 2DQLA 2MGQA 2ZMEC 5LGNA 1A5JA 3U1DA 1B4AA 2P7VB 4FX0A 3K70D 5E17F 1HOMA 1K6OA 3HM5A 2ME0A 2BXZA 3M07A 3S1RJ 4RAGA 2LD5A 2HVRA 2EK5A 1VQ4I 3B6AA 2IS6A 4JX6A 2ZJRF 2E7WA 5L3EA 2A6TA 3N4MA 2VQGA 2F6CA 2CUJA 2E36A 2HYGD 2XASA 4YIIA 5K5RA 3F6VA 5J1RA 3I71A 2R5YA 2CW0F 2XRLA 4R79A 4B44A 1LQ1A 2DT6A 1FYMA 3TOAA 6PAXA 4C2MJ 1S3JA 2KIMA 2A5WA 3FDYA 4QWQA 4W97A 1OR7C 2NNYA 1QRYA 1ETQA 1WVRA 2A6HF 2E35A 1I39A 3W2WA 2NNNA 3LSPA 2GXAA 4A3CJ 1F1ZA 2LBFA 2X85A 3S14J 3EUHA 2UUZA 2MLKA 3S2DJ 1VQ5I 4ASNA 3WTUC 3RPQA 1OCCH 3FK7A 4AIKA 3LA3A 3FIWA 3ZPLA 2Z33A 2K40A 1HLVA 2UWMA 3CZ6A 3JREA 4BUPA 2AO9A 3O2PE 1PUFA 2R7DA 2DK5A 1LFPA 3BPXA 4KIFA 2AHQA 2XHKA 4I09A 4HW0A 2Y31A 4K2EA 1APLC 1ZQ3P 4N9IA 1YX3A 4R1HA 3RZOJ 4JOMA 2FBKA 4A5NA 1OLTA 2D1HA 3RKQA 4PJJA 1R00A 2MFZA 2F5EA 1IN4A 5KNLA 2TCTA 2R3SA 3BR1A 3PSFA 2BYVE 2CV2A 3ZR8X 3VODA 3UKGA 1TBXA 3I0TA 1SD7A 1X19A 2VBWA 1J2XA 2WY7Q 4PJLA 4I01A 4XKVA 4XONA 2JA5J 3KP5A 3E6MA 2I8DA 4RB3C 4I6ZA 3WODF 2BY0A 2L9RA 3W2AA 4IOAF 3H35A 5J4YA 3OR1C 5JR3A 3FMRA 4ENKA 4L5JA 2JA6J 2NRAC 1BR4A 2WC2A 2CFXA 4LFUA 4PZJA 2XF7A 1J9IA 2IJLA 3IWZA 3D5RC 2CWEA 2W4SA 2E2JJ 2E2IJ 1TC3C 3HRUA 2LY2A 3HTSB 3MFKA 1P7IA 4RGUA 2MW8A 2GIVA 2H09A 1MH4A 4E7KA 3CUOA 1HDPA 2DFEA 3LSGA 1PYVA 2OV7A 4JX5A 5DM6F 2E5ZA 1BI0A 1FBQA 1A6QA 1U5TA 3A0HC 3ZMZA 2GM4A 5GP9A 1LKXA 4Q48A 2R7ZJ 2K02A 1XTAA 5BS6A 3FISA 1FY7A 1VNDA 4OIQF 3Q0WA 1R58A 2KJBA 2NS8A 4A3DJ 4BAYA 2V9VA 2FMYA 3RKWA 1ZLKA 1G3YA 3QOPA 1NG7A 2GWRA 2KRCA 3GMEA 3HOYJ 2PEXA 3HOXJ 3EUKL 3G3ZA 5LRRA 3VPRA 2FJ1A 4BDYA 1ZREA 4EM1A 2K85A 2O8XA 3KP7A 5JLWA 2ZMEA 1MBGA 1O3QA 5E3NA 3HHGA 1PUEE 5J6XA 1ZK8A 5DV5A 5ICEA 3CJTB 5L3FA 4B43A 5JVGF 1R23A 4MEXF 2BY2A 2ZXWH 3L00A 4DOZA 2EILH 1ZYRF 1YHQI 1DQUA 5D5VB 2HTJA 3LMMA 3BTIA 1RESA 4ZDPA 1KYZA 3IAS2 2CUEA 1IRZA 1YLFA 2R7WA 4CCLA 4BE2A 3BR2A 4GGGA 4FETA 1UHMA 1LJ9A 1ZG3A 4X1EA 4XBFA 4NHJA 1WJDA 1HSJA 4BEHA 4IHYA 1XGOA 3H9JA 2DN0A 2V6EA 1UG2A 1Y56A 5D8LB 3HC7A 4CA0A 5DUIA 3CTAA 5EDNA 5K5OA 2YX4A 4IPAA 1T38A 1MBEA 3B73A 3FXRA 3H5NA 4EJOA 5JLXA 4WX9A 1LNWA 4HNTA 2PJPA 2A69F 2F4OB 2YU9J 2K4BA 2UXXA 4NUBA 5EEGA 2HR3A 5HNHA 1GV5A 3LL7A 4L9NA 2NVTJ 2HKOA 3DTKA 3H3UA 1WI9A 4A3EJ 4MFEA 4CH7A 4BXFA 1JT6A 2JA2A 5K1YA 1O4XA 2N8GA 4N4NB 3V4GA 2D45A 3H5AA 2XF6A 2H1LA 3HOUJ 1H9GA 3S1MJ 4DZPA 3B02A 3KCCA 2FQ3A 3WU2C 4HX7A 2QM3A 3KLNA 4BS9A 3ZXSA 2X51A 4AIDA 2EZKA 4CCMA 3O6BB 1EA3A 2P5VA 3GFIA 2VPLA 2ECCA 2ZSIB 3NARA 2HOTA 2X1CA 2R7VA 5E1ZB 4BJTA 3I54A 3RYRA 4CYCB 2XUBA 3G6EI 3KLOA 1UHSA 5DUKA 4E7HA 1V3FA 3CC2I 3PIOF 3DWLE 2VI6A
chains in the Genus database with same CATH topology
2CSOA 4YFKF 3LA2A 4IRGA 3PQKA 4RS8A 5LHGA 2LNBA 2W25A 4Y13A 2GA1A 1BI1A 4EGZA 1XN7A 1S8NA 2EFPA 4U7DA 4ZZDA 1I1GA 2FA5A 4GO1A 1IW7F 1TW3A 3H92A 3FHZA 1IRFA 4RAYA 3ZMDA 1E17A 4P9UA 5A2QK 3HHHA 2O03A 1O3SA 4M73A 4UUVA 2HQNA 4O6JA 5CJ9A 3EQLF 3P9CA 1NHAA 2RC4A 4U0VA 3WU0A 2DLLA 2VBXA 5LEJA 3NQOA 3RI4A 2P5KA 2XKPA 5IT9Z 4B09A 1BBYA 1QZYA 4HX4A 4ZYHA 1H9TA 4EQQA 1BN5A 2QUFA 2VT2A 3ZMTA 1FBUA 3CUQA 4ON0A 3L2CA 4YIFA 5E1XA 2DTRA 1T2KA 2EB7A 1W7PB 3DKWA 4KIGA 3I59A 2ZCWA 2AXLA 4U0WA 3WTTC 1X3UA 3QAHA 1TQMA 1YO5C 4I7HA 2OD5A 4YFXF 2KJCA 3IRQA 1ULYA 4PGGA 2ESNA 3BY6A 4ENNA 2HFHA 2QENA 1FYKA 3KP3A 1MJAA 4UVCA 1LDDA 3ULQB 4HA8A 4OIPF 2RGVA 2OU2A 3BJ6A 5ILSA 1RUOA 3VB2A 3SZPA 1G6NA 1IAWA 1BC7C 2EFOA 2P4WA 1ON2A 2K27A 1R1VA 5BMZA 4UV8A 1REPC 4HZFA 1MJ9A 4DNCA 1TTYA 4ZYGA 3E6DA 1IXRC 3WG9A 4HDUA 4ESJA 2ZBKA 5FD5A 4ZYDA 4A6EA 5FLXZ 1KU9A 1BC8C 3J80Z 5DDGA 1Y0UA 2XV4S 2A3SA 3T8TA 2CQKA 1I6XA 5LHHA 2A6EF 5FB2A 1XD7A 2IW5A 5ICGA 1FSEA 4JK1X 1G3WA 3ECOA 2GXBA 4UNOA 2OAZA 2Z9OA 4KIBA 1UCRA 1W5SA 4P9FA 2DU9A 2JZYA 2VN2A 3QU6A 1OPCA 2M30A 3GF2A 1FZPB 1BI2A 3FX3A 1K78A 2RDPA 1XGNA 3ABUA 1GXQA 4HF2A 1FNNA 4M9SA 5LGUA 5CVVA 1HQCA 3OV8A 1LVAA 5CYVA 4UV9A 3K1MA 3JSPA 3QP6A 1OMIA 2K4JA 4RB2C 1SD6A 2NAZA 5F64A 1KQ8A 3KZZA 3I4PA 2DPUA 1W4MA 3DPTA 4N0BA 1ONVA 5HOOA 2VXZA 3QU3A 4AVPA 2XVCA 4EMSA 5E20A 1F4KA 1XDSA 4OOIA 4Y15A 3E5XA 4LB6B 3GLXA 1HXDA 2ACJA 2HYFA 3RPUA 5ICFA 2VOPA 1U5TB 1J7KA 2LSOA 3BJOA 4S05A 2GAUA 3TKYA 4IHTA 1XMKA 2XAJA 3WGGA 1P6RA 4M74A 5HLGA 2Z3YA 1HSTA 2PN6A 3WTVC 1OKRA 3SHFA 1SFEA 4CHUA 4LJZF 1PP8F 3REOA 4EM0B 4EJUA 1B9MA 5LBQA 2A61A 5CVRA 2M1BA 1U3EM 3GYHX 4Q47A 4I98B 1IRGA 4P55A 2QBYB 3GEZA 2VC1A 2OBPA 1ZN2A 4CZZA 3HOSA 1Z1DA 5D5XB 2YSRA 4ENJA 1IN8A 2MBFA 1K79A 4MTEA 5AIPA 1RUNA 2JT1A 3W6JB 2BV6A 4BYYA 2PBIA 3M7GA 4G7HF 2P6SA 2W85A 4XRFA 1XGMA 4RB1A 4KA4A 3H3ZA 1ZRFA 3V8KA 4PGHA 4EV0A 3PFIA 3U9GA 1HW5A 5HDGA 2JTVA 2YX7A 3WTWC 3CO7C 1YW9A 2L3DA 1J59A 1OYYA 3ZQ7A 2QQAA 1FWZA 4TV7A 1TNTA 2KIFA 3COAC 4IRHA 5HDNA 1ZGAA 1Q1HA 1QPMA 1EH6A 1VTNC 4LG0B 5BOXA 2VE9A 2QZ8A 1XDUA 3S2WA 1LEAA 3GFLA 2RV8A 2CG4A 2IP2A 1J5YA 4L18B 2Q0OA 1KA8A 4OMZA 1CF7A 1QQIA 2VE8A 3LAPA 4YFNF 2YR2A 5DD4A 2RQPA 3FM3A 2OQGA 4WXHA 1D8KA 2FNAA 2MC3A 2PI0A 4OMYA 1KYWA 2JRTA 4UXNA 3LAJA 1WRJA 3JSOA 3MZHA 4LB5A 1YYVA 4KFCA 5D8KB 1O7LA 4LLLA 1S29A 4Y17A 2NYXA 4A0XA 2BGCA 4EJWA 1T39A 2QWWA 4MQ9F 4ZH4F 3T5XA 3C1DA 1UFMA 4RAZA 5D4RA 5HS7A 4D0PA 3GFJA 1R7JA 2ISZA 3P9IA 4M6XA 1MDMB 2WWYA 1G4DA 2MH9A 1P4WA 1MD0A 2GA2A 3JTHA 1AOYA 3J81K 4U88A 4HV6A 4UHTA 4M9ZA 5ICCA 4CXFA 4A6DA 4M71A 1CF7B 3HSEA 2OZ6A 3FZVA 2O6GE 1SFXA 2BBYA 5HLIA 1KU2A 4ZYEA 3CDHA 1DUXC 2HTSA 4HAMA 3F6OA 1TQPA 1R36A 3MEXA 1XSVA 4KNYA 5JFRA 5D5WB 3F72A 1SD5A 2DBBA 4U0YA 5AONA 4IRIA 2CO5A 5K5QA 2VONA 4ESFA 3KP2A 2ELHA 2W57A 4WF2A 2P8TA 2ZO4A 1Z91A 4A2UA 5L3BA 3ELKA 1G3TA 3WGIA 2IA1A 2WV0A 5H20A 1EH7A 3DF8A 3K0LA 3JW4A 2FNPA 1YFHA 2YU3A 3SFZA 3K1NA 5E8GA 2CGPA 2PFBA 4G6DA 5DCMB 3V7SA 3ERED 5E18F 4N9HA 1IN6A 5CVIA 1LDKB 3T0YA 2CYYA 1TQIA 2QQ9A 2P5LC 4B8XA 4S04A 3I5UA 2V1UA 1XSDA 3I59B 4EGYA 5L3CA 3LQRA 2GQQA 2EFNA 3KE2A 3ROUA 1HBXG 5FLXK 2G9WA 1YTYA 1G3SA 5ED4A 2EWNA 2IVMA 4O5VA 4WWCA 5DCFA 3Q9SA 1D8JA 2XGXA 1JHFA 3WTXC 3K9TA 1L0OC 5D4SA 1BJAA 2UZKA 1YS7A 1K78B 1Z6RA 5DEQA 3LA7A 2O0YA 5J8FA 4L0YB 2P7CB 4I02A 1IUYA 1R5GA 2QQBA 4RGXA 1ON1A 4E70A 4BNCA 3C3WA 5H6QA 5L3GA 4XSXF 4GCVA 2G7UA 5BQTA 2PQ8A 4HLYA 5LEKA 1DPUA 1RNLA 4WXDA 1IN7A 1OYWA 3KEQA 5KK1A 2EFQA 2EV5A 2NS0A 2ZJ2A 1SMYF 1R1UA 5TJJA 3DQVC 3NEUA 3C7JA 3V7CA 3GFMA 1RZ4A 2DFIA 1W5TA 4HOBA 4A5MA 4AIJA 4OIOF 1KU7A 4WXCA 1Z05A 3HIFA 1XMAA 1DPRA 3P7NA 3FMSA 4R8HA 1R1TA 4ZZLA 4L0ZB 1H0MA 5JVTA 4GYGA 2VOOA 1A04A 3IRRA 1P92A 1E2XA 3M1EA 2FOKA 4NQWA 5HVQC 2K86A 2HS5A 4IF4A 2R7FA 1SMTA 3WGHA 5BPDA 3GO5A 4BH9A 3DPLC 2QVOA 1CGPA 2ZNZA 3KFWX 2HDCA 3IWFA 4HX8A 5KVRA 1UB9A 1EH8A 1LDJA 3J81Z 1QO0D 1YG2A 1WQ2A 3V8JA 1W7PA 5LRSA 1RI7A 5BPIA 3GXOA 1FP1D 1P4XA 3VOEA 3EYYA 1JXSA 1BI3A 2RVCA 3ECHA 5DCMA 3KZYA 2A68F 4Q4ZF 2V1DA 3I58A 5F1RA 4G8XA 2HZTA 4U7BA 3P9KA 3LSTA 4BXUA 1ZH5A 1U2WA 2MLGA 2H94A 3HRTA 2HOEA 4KN7X 5EEHA 4DQ2A 4HLXA 2L02A 1O3TA 2F5CA 3FMQA 1FBSA 1LB2A 3TDUC 1QBJA 3WE3A 1IN5A 1XCBA 5CVUA 3GZ6A 1PDNC 4RB0A 4I0BA 2LF7A 5L3DA 4UVBA 2DPDA 2DO7A 3SZTA 4A0YA 5D6EA 3L09A 3E5QA 3DP7A 1FC3A 3FXUA 4WCGA 4ETSA 4LD5A 2STWA 4BQAA 2IPQX 3R0AA 3F3XA 1AWCA 2PMUA 2FBHA 4G6QA 2L4AA 1QZZA 5JI6A 2X0LA 2F5FA 3R4KA 3VFZA 2IT0A 3DFGA 1T0FA 4XLNF 5LLQA 1XSXA 4KT5C 2HWVA 4GXOA 3ZN0A 2EJRA 3E5UA 2KRFA 4G94A 1JE8A 3M8EA 3F22A 2Y75A 3HRMA 1B59A 1U6GA 2FSWA 1BIBA 3WTZA 2EFWA 1YS6A 2HGCA 3ISPA 2EA2A 2COMA 2PLYA 3TDZC 2RKHA 4CYDA 3BZ6A 3FF5A 2XIGA 5DD8A 2A5YB 4IXAA 1TW2A 4EJVA 3GUDA 4BHCA 3F23A 3HSRA 2VBYA 2LKPA 2P6TA 1U5TC 3E3VA 4HF1A 3RKYA 3Q5FA 4LG0A 4MGRA 2E1CA 1MDMA 1ZGJA 1HKSA 5LGTA 3E6BA 3GWZA 1FYLA 1ZARA 3R61A 3ZMSA 3M8FA 1HKQA 5A2QZ 2PMHA 3QP5A 2RN7A 3C18A 2VODA 3L9FA 2OQRA 2BEOA 1I27A 4LGWA 2ESHA 1USSA 4FX4A 4HF0A 4H0EA 1HW2A 4QLCU 1IF1A 2V1XA 4XLPF 1Z9CA 2TDXA 5ILUA 1KGSA 2FXAA 1O7FA 4KN4X 4I0AA 3TGNA 2M45A 2E7XA 2WTEA 2ZMEB 3WE2A 4MQVA 1D5VA 4KDPA 3ZN1A 3MCZA 1PP7U 2Z99A 2DK8A 3BROA 3VEPA 4L9JA 3RJPA 2ETHA 4MNUA 2FMLA 1OYIA 2X4HA 4IHSA 2Q2EA 5D5UB 2JPBA 3DEUA 2LDUA 2K7LA 3IL2A 4EJTA 3RTRA 4HQEA 3RYPA 1WWXA 3RIRA 4G7OF 2F2EA 4Z2YA 3K1PA 1YQAA 1GVJA 1WKMA 3V8LA 3KP4A 1UHWA 3BJAA 4G7ZF 4MEYF 3KETA 3BDDA 5E8IA 2M5WA 1HW1A 3KEOA 2DW4A 3D0SA 3LFKA 2XROA 2B0LA 5H6RA 2YPRA 2G7HA 2V6CA 2ZKZA 2LF8A 4LMYA 3JTGA 2DQRA 1ZLJA 4A0ZA 4LLNA 4L9TA 1FSHA 3HYIA 5JHUA 1ZG5A 1T98A 2DT5A 2Y48A 5ILVA 1C0WA 2L01A 4M72A 3JAMZ 1K7AA 3LQQA 3M9AA 3R60A 4P96A 3TO7A 2VC0A 1F5TA 2HQRA 3AAFA 4FHTA 3D5LA 2XRNA 3QRFF 1B6AA 5LHIA 2STTA 2V79A 3CLOA 2Q8KA 1S7AA 2L4MA 2VT3A 5HDKA 2W24A 4XSZF 2XAQA 2W84A 2Y0MA 1IXCA 3HUGA 1FP2A 3TO6A 2O61A 1P4AA 2RNJA 1O3RA 2EV6A 1SFUA 3JAMK 3V7RA 1JGSA 2D1VA 2ZFWA 2JSCA 5FGMA 1ZRCA 2KIUA 3HOTA 2M8EA 5CVJA 4M6YA 2IA0A 2Z5UA 4CO8A 4L9VA 1XB4A 2HKXA 3CO6C 2H6BA 1JHHA 2FE3A 3R0JA 5AIQA 4AWXB 2ZXJA 2OZUA 4CDGA 2QLZA 3SXYA 1QNTA 3F8BA 1J0RA 3R6SA 1KU3A 4OIRF 4MTDA 4WK8F 1BM9A 3IHUA 4A12A 5FFXA 1MKMA 2XAGA 3DXJF 4L5IA 5FO5A 3T1BA 1O57A 3GW2A 2JPCA 3HRSA 2J5OA 1U8RA 1YW8A 2L54A 1J75A 3EETA 3GVAA 4YG2F 1MJBA 3F21A 5J8CA 3DV8A 3RKXA 2FF4A 1U78A 1FT9A 3F8MA 1XCVA 2FRHA 3HSFA 1TLHB 4GYIA 2FEZA 2UXNA 2H27A 2M87A 3ZMUA 1FX7A 1Z6TA 2HEOA 1FPQA 1I5ZA 3QPTA 3TQNA 2IRFG 5D6FA 3F8NA 3Q9VA 1ZHFA 2FU4A 3EDPA 3BOQA 4OINF 1I1SA 2O3FA 4PDKA 1MGTA 4NB5A 3BPVA 1LEBA 1KQ0A 1YW7A 1ZAOA 3CJNA 3TO9A 3T8RA 3K69A 1DDNA 1S7OA 2A07F 2EV0A 2DAOA 1T6SA 1GHCA 4F7ZA 1S6LA 4PCQA 2KKOA 3FM5A 4AD9A 4LK1F 1OR7A 1B1BA 2EA4A 5HLHA 3FWEA 4HYEA 4O3MA 5IT9K 4IJAA 2XAHA 5DYMA 1F9NA 3W6KB 4KMFA 2QBYA 3GX4X 1B9NA 2OA4A 2PG4A 3J7AO 1ZRDA 1IXSB 3F8CA 3SQNA 4IVNA 1FOKA 3MZYA 1ZG1A 3CUQB 5FD6A 4FT8A 3IC7A 3G73A 1KQ9A 3IKVA 2J5PA 3QPHA 1XGSA 4CICA 4CGZA 3CUQC 2E1NA 2C6YA 4HDVA 1YIOA 5E1WA 4BHBA 4BHPA 2ISYA 1FLIA 4EM2A 4KYWA 5CLSA 1R22A 2MD5A 3KP6A 2GXGA 4RGSA 1HKTA 5FFZA 2FBIA 1DP7P 4KUMA 3E6CC 3BP8A 2AS5F 2F5DA 4LK0F 3U2RA 4EVIA 3ZP5A 5F6FA 4AIHA 2MH2A 2ZNYA 3ABTA 1STZA 3E97A 3ZMVA 1QGPA 2VBZA 1ODDA 4JBAA 1GXPA 4UVAA 3HTUA 3N97A 3LWFA 1IZ1A 4G9YA 4P5OA 1W7PD 3IKTA 1R5HA 1SD4A 1SAXA 3WTSC 3OOPA 1BOAA 4ENMA 3MQ0A 4MHGA 4KMUX 3F8FA 1D3YA 5IT3A 3K2ZA 1L3LA 1RIOH 4HBLA 5HS8A 1TNSA 4HV5A 4OU0A 2IA2A 3I53A 2XKOA 1EV7A 5ERIA 3O3KA 2H6CA 4M9XA 4LLGF 3RDIA 4JQFA 1V4RA 3EYIA 4I2OA 4HQMA 3GZ5A 1USTA 2BE5F 2MA3A 4ESBA 3I64A 3L7WA 3ML6A 4RGRA 2QYOA 2DI3A 3MAJA 2XAFA 3J80K 3WU1B 5TRDA 3MWMA 2D2WA 3TOBA 2GZWA 3NRVA 3FXQA 5HS9A 4KICA 1Z7UA 2ADUA 1P2FA 3PQJA 1MZBA 1WSUA 3BWGA 3WTYC 4Q5SF 1BIAA 2DQLA 5LGNA 3U1DA 1B4AA 2P7VB 4FX0A 5E17F 1K6OA 2EK5A 2E7WA 5L3EA 3N4MA 2HYGD 2XASA 4YIIA 5K5RA 3F6VA 3I71A 2CW0F 4R79A 1LQ1A 1FYMA 3TOAA 6PAXA 1S3JA 2KIMA 4QWQA 2NNYA 2A6HF 2NNNA 1F1ZA 3EUHA 2MLKA 4ASNA 3WTUC 3RPQA 4AIKA 3LA3A 3ZPLA 2Z33A 2UWMA 3O2PE 2R7DA 2DK5A 3BPXA 4KIFA 2XHKA 4I09A 4HW0A 4K2EA 4N9IA 4R1HA 2FBKA 4A5NA 2D1HA 1R00A 2F5EA 1IN4A 2R3SA 2BYVE 3VODA 1TBXA 3I0TA 1SD7A 2VBWA 1J2XA 4I01A 3KP5A 3E6MA 4RB3C 3WODF 5JR3A 4ENKA 3FMRA 4L5JA 2NRAC 2WC2A 2CFXA 4LFUA 4PZJA 1J9IA 2IJLA 3IWZA 2CWEA 3HRUA 3HTSB 3MFKA 4RGUA 2H09A 2GIVA 3CUOA 1BI0A 1FBQA 1U5TA 3ZMZA 4Q48A 2K02A 5BS6A 1FY7A 4OIQF 1R58A 2KJBA 4BAYA 2V9VA 1ZLKA 2FMYA 3RKWA 1G3YA 3QOPA 2GWRA 2PEXA 3G3ZA 5LRRA 1ZREA 4EM1A 2O8XA 3KP7A 2ZMEA 1O3QA 3HHGA 1PUEE 5J6XA 5DV5A 5ICEA 5L3FA 1R23A 4MEXF 3L00A 1ZYRF 5D5VB 2HTJA 1KYZA 1YLFA 4GGGA 4NHJA 1UHMA 1LJ9A 1ZG3A 4XBFA 1HSJA 1XGOA 5D8LB 5DUIA 3CTAA 5K5OA 2YX4A 4IPAA 1T38A 3B73A 3FXRA 4WX9A 4EJOA 1LNWA 2PJPA 2A69F 2K4BA 2UXXA 5EEGA 2HR3A 4L9NA 2HKOA 3H3UA 1WI9A 5K1YA 3V4GA 2D45A 1H9GA 3B02A 3KCCA 2FQ3A 4HX7A 2QM3A 3KLNA 3O6BB 2P5VA 3GFIA 5E1ZB 3I54A 3RYRA 2XUBA 3KLOA 5DUKA 1V3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSO A;  4YFK F;  3LA2 A;  4IRG A;  3PQK A;  4RS8 A;  5LHG A;  2LNB A;  2W25 A;  4Y13 A;  2GA1 A;  1BI1 A;  4EGZ A;  1XN7 A;  1S8N A;  2EFP A;  4U7D A;  4ZZD A;  1I1G A;  2FA5 A;  4GO1 A;  1IW7 F;  1TW3 A;  3H92 A;  3FHZ A;  1IRF A;  4RAY A;  3ZMD A;  1E17 A;  4P9U A;  5A2Q K;  3HHH A;  2O03 A;  1O3S A;  4M73 A;  4UUV A;  2HQN A;  4O6J A;  5CJ9 A;  3EQL F;  3P9C A;  1NHA A;  2RC4 A;  4U0V A;  3WU0 A;  2DLL A;  2VBX A;  5LEJ A;  3NQO A;  3RI4 A;  2P5K A;  2XKP A;  5IT9 Z;  4B09 A;  1BBY A;  1QZY A;  4HX4 A;  4ZYH A;  1H9T A;  4EQQ A;  1BN5 A;  2QUF A;  2VT2 A;  3ZMT A;  1FBU A;  3CUQ A;  4ON0 A;  3L2C A;  4YIF A;  5E1X A;  2DTR A;  1T2K A;  2EB7 A;  1W7P B;  3DKW A;  4KIG A;  3I59 A;  2ZCW A;  2AXL A;  4U0W A;  3WTT C;  1X3U A;  3QAH A;  1TQM A;  1YO5 C;  4I7H A;  2OD5 A;  4YFX F;  2KJC A;  3IRQ A;  1ULY A;  4PGG A;  2ESN A;  3BY6 A;  4ENN A;  2HFH A;  2QEN A;  1FYK A;  3KP3 A;  1MJA A;  4UVC A;  1LDD A;  3ULQ B;  4HA8 A;  4OIP F;  2RGV A;  2OU2 A;  3BJ6 A;  5ILS A;  1RUO A;  3VB2 A;  3SZP A;  1G6N A;  1IAW A;  1BC7 C;  2EFO A;  2P4W A;  1ON2 A;  2K27 A;  1R1V A;  5BMZ A;  4UV8 A;  1REP C;  4HZF A;  1MJ9 A;  4DNC A;  1TTY A;  4ZYG A;  3E6D A;  1IXR C;  3WG9 A;  4HDU A;  4ESJ A;  2ZBK A;  5FD5 A;  4ZYD A;  4A6E A;  5FLX Z;  1KU9 A;  1BC8 C;  3J80 Z;  5DDG A;  1Y0U A;  2XV4 S;  2A3S A;  3T8T A;  2CQK A;  1I6X A;  5LHH A;  2A6E F;  5FB2 A;  1XD7 A;  2IW5 A;  5ICG A;  1FSE A;  4JK1 X;  1G3W A;  3ECO A;  2GXB A;  4UNO A;  2OAZ A;  2Z9O A;  4KIB A;  1UCR A;  1W5S A;  4P9F A;  2DU9 A;  2JZY A;  2VN2 A;  3QU6 A;  1OPC A;  2M30 A;  3GF2 A;  1FZP B;  1BI2 A;  3FX3 A;  1K78 A;  2RDP A;  1XGN A;  3ABU A;  1GXQ A;  4HF2 A;  1FNN A;  4M9S A;  5LGU A;  5CVV A;  1HQC A;  3OV8 A;  1LVA A;  5CYV A;  4UV9 A;  3K1M A;  3JSP A;  3QP6 A;  1OMI A;  2K4J A;  4RB2 C;  1SD6 A;  2NAZ A;  5F64 A;  1KQ8 A;  3KZZ A;  3I4P A;  2DPU A;  1W4M A;  3DPT A;  4N0B A;  1ONV A;  5HOO A;  2VXZ A;  3QU3 A;  4AVP A;  2XVC A;  4EMS A;  5E20 A;  1F4K A;  1XDS A;  4OOI A;  4Y15 A;  3E5X A;  4LB6 B;  3GLX A;  1HXD A;  2ACJ A;  2HYF A;  3RPU A;  5ICF A;  2VOP A;  1U5T B;  1J7K A;  2LSO A;  3BJO A;  4S05 A;  2GAU A;  3TKY A;  4IHT A;  1XMK A;  2XAJ A;  3WGG A;  1P6R A;  4M74 A;  5HLG A;  2Z3Y A;  1HST A;  2PN6 A;  3WTV C;  1OKR A;  3SHF A;  1SFE A;  4CHU A;  4LJZ F;  1PP8 F;  3REO A;  4EM0 B;  4EJU A;  1B9M A;  5LBQ A;  2A61 A;  5CVR A;  2M1B A;  1U3E M;  3GYH X;  4Q47 A;  4I98 B;  1IRG A;  4P55 A;  2QBY B;  3GEZ A;  2VC1 A;  2OBP A;  1ZN2 A;  4CZZ A;  3HOS A;  1Z1D A;  5D5X B;  2YSR A;  4ENJ A;  1IN8 A;  2MBF A;  1K79 A;  4MTE A;  5AIP A;  1RUN A;  2JT1 A;  3W6J B;  2BV6 A;  4BYY A;  2PBI A;  3M7G A;  4G7H F;  2P6S A;  2W85 A;  4XRF A;  1XGM A;  4RB1 A;  4KA4 A;  3H3Z A;  1ZRF A;  3V8K A;  4PGH A;  4EV0 A;  3PFI A;  3U9G A;  1HW5 A;  5HDG A;  2JTV A;  2YX7 A;  3WTW C;  3CO7 C;  1YW9 A;  2L3D A;  1J59 A;  1OYY A;  3ZQ7 A;  2QQA A;  1FWZ A;  4TV7 A;  1TNT A;  2KIF A;  3COA C;  4IRH A;  5HDN A;  1ZGA A;  1Q1H A;  1QPM A;  1EH6 A;  1VTN C;  4LG0 B;  5BOX A;  2VE9 A;  2QZ8 A;  1XDU A;  3S2W A;  1LEA A;  3GFL A;  2RV8 A;  2CG4 A;  2IP2 A;  1J5Y A;  4L18 B;  2Q0O A;  1KA8 A;  4OMZ A;  1CF7 A;  1QQI A;  2VE8 A;  3LAP A;  4YFN F;  2YR2 A;  5DD4 A;  2RQP A;  3FM3 A;  2OQG A;  4WXH A;  1D8K A;  2FNA A;  2MC3 A;  2PI0 A;  4OMY A;  1KYW A;  2JRT A;  4UXN A;  3LAJ A;  1WRJ A;  3JSO A;  3MZH A;  4LB5 A;  1YYV A;  4KFC A;  5D8K B;  1O7L A;  4LLL A;  1S29 A;  4Y17 A;  2NYX A;  4A0X A;  2BGC A;  4EJW A;  1T39 A;  2QWW A;  4MQ9 F;  4ZH4 F;  3T5X A;  3C1D A;  1UFM A;  4RAZ A;  5D4R A;  5HS7 A;  4D0P A;  3GFJ A;  1R7J A;  2ISZ A;  3P9I A;  4M6X A;  1MDM B;  2WWY A;  1G4D A;  2MH9 A;  1P4W A;  1MD0 A;  2GA2 A;  3JTH A;  1AOY A;  3J81 K;  4U88 A;  4HV6 A;  4UHT A;  4M9Z A;  5ICC A;  4CXF A;  4A6D A;  4M71 A;  1CF7 B;  3HSE A;  2OZ6 A;  3FZV A;  2O6G E;  1SFX A;  2BBY A;  5HLI A;  1KU2 A;  4ZYE A;  3CDH A;  1DUX C;  2HTS A;  4HAM A;  3F6O A;  1TQP A;  1R36 A;  3MEX A;  1XSV A;  4KNY A;  5JFR A;  5D5W B;  3F72 A;  1SD5 A;  2DBB A;  4U0Y A;  5AON A;  4IRI A;  2CO5 A;  5K5Q A;  2VON A;  4ESF A;  3KP2 A;  2ELH A;  2W57 A;  4WF2 A;  2P8T A;  2ZO4 A;  1Z91 A;  4A2U A;  5L3B A;  3ELK A;  1G3T A;  3WGI A;  2IA1 A;  2WV0 A;  5H20 A;  1EH7 A;  3DF8 A;  3K0L A;  3JW4 A;  2FNP A;  1YFH A;  2YU3 A;  3SFZ A;  3K1N A;  5E8G A;  2CGP A;  2PFB A;  4G6D A;  5DCM B;  3V7S A;  3ERE D;  5E18 F;  4N9H A;  1IN6 A;  5CVI A;  1LDK B;  3T0Y A;  2CYY A;  1TQI A;  2QQ9 A;  2P5L C;  4B8X A;  4S04 A;  3I5U A;  2V1U A;  1XSD A;  3I59 B;  4EGY A;  5L3C A;  3LQR A;  2GQQ A;  2EFN A;  3KE2 A;  3ROU A;  1HBX G;  5FLX K;  2G9W A;  1YTY A;  1G3S A;  5ED4 A;  2EWN A;  2IVM A;  4O5V A;  4WWC A;  5DCF A;  3Q9S A;  1D8J A;  2XGX A;  1JHF A;  3WTX C;  3K9T A;  1L0O C;  5D4S A;  1BJA A;  2UZK A;  1YS7 A;  1K78 B;  1Z6R A;  5DEQ A;  3LA7 A;  2O0Y A;  5J8F A;  4L0Y B;  2P7C B;  4I02 A;  1IUY A;  1R5G A;  2QQB A;  4RGX A;  1ON1 A;  4E70 A;  4BNC A;  3C3W A;  5H6Q A;  5L3G A;  4XSX F;  4GCV A;  2G7U A;  5BQT A;  2PQ8 A;  4HLY A;  5LEK A;  1DPU A;  1RNL A;  4WXD A;  1IN7 A;  1OYW A;  3KEQ A;  5KK1 A;  2EFQ A;  2EV5 A;  2NS0 A;  2ZJ2 A;  1SMY F;  1R1U A;  5TJJ A;  3DQV C;  3NEU A;  3C7J A;  3V7C A;  3GFM A;  1RZ4 A;  2DFI A;  1W5T A;  4HOB A;  4A5M A;  4AIJ A;  4OIO F;  1KU7 A;  4WXC A;  1Z05 A;  3HIF A;  1XMA A;  1DPR A;  3P7N A;  3FMS A;  4R8H A;  1R1T A;  4ZZL A;  4L0Z B;  1H0M A;  5JVT A;  4GYG A;  2VOO A;  1A04 A;  3IRR A;  1P92 A;  1E2X A;  3M1E A;  2FOK A;  4NQW A;  5HVQ C;  2K86 A;  2HS5 A;  4IF4 A;  2R7F A;  1SMT A;  3WGH A;  5BPD A;  3GO5 A;  4BH9 A;  3DPL C;  2QVO A;  1CGP A;  2ZNZ A;  3KFW X;  2HDC A;  3IWF A;  4HX8 A;  5KVR A;  1UB9 A;  1EH8 A;  1LDJ A;  3J81 Z;  1QO0 D;  1YG2 A;  1WQ2 A;  3V8J A;  1W7P A;  5LRS A;  1RI7 A;  5BPI A;  3GXO A;  1FP1 D;  1P4X A;  3VOE A;  3EYY A;  1JXS A;  1BI3 A;  2RVC A;  3ECH A;  5DCM A;  3KZY A;  2A68 F;  4Q4Z F;  2V1D A;  3I58 A;  5F1R A;  4G8X A;  2HZT A;  4U7B A;  3P9K A;  3LST A;  4BXU A;  1ZH5 A;  1U2W A;  2MLG A;  2H94 A;  3HRT A;  2HOE A;  4KN7 X;  5EEH A;  4DQ2 A;  4HLX A;  2L02 A;  1O3T A;  2F5C A;  3FMQ A;  1FBS A;  1LB2 A;  3TDU C;  1QBJ A;  3WE3 A;  1IN5 A;  1XCB A;  5CVU A;  3GZ6 A;  1PDN C;  4RB0 A;  4I0B A;  2LF7 A;  5L3D A;  4UVB A;  2DPD A;  2DO7 A;  3SZT A;  4A0Y A;  5D6E A;  3L09 A;  3E5Q A;  3DP7 A;  1FC3 A;  3FXU A;  4WCG A;  4ETS A;  4LD5 A;  2STW A;  4BQA A;  2IPQ X;  3R0A A;  3F3X A;  1AWC A;  2PMU A;  2FBH A;  4G6Q A;  2L4A A;  1QZZ A;  5JI6 A;  2X0L A;  2F5F A;  3R4K A;  3VFZ A;  2IT0 A;  3DFG A;  1T0F A;  4XLN F;  5LLQ A;  1XSX A;  4KT5 C;  2HWV A;  4GXO A;  3ZN0 A;  2EJR A;  3E5U A;  2KRF A;  4G94 A;  1JE8 A;  3M8E A;  3F22 A;  2Y75 A;  3HRM A;  1B59 A;  1U6G A;  2FSW A;  1BIB A;  3WTZ A;  2EFW A;  1YS6 A;  2HGC A;  3ISP A;  2EA2 A;  2COM A;  2PLY A;  3TDZ C;  2RKH A;  4CYD A;  3BZ6 A;  3FF5 A;  2XIG A;  5DD8 A;  2A5Y B;  4IXA A;  1TW2 A;  4EJV A;  3GUD A;  4BHC A;  3F23 A;  3HSR A;  2VBY A;  2LKP A;  2P6T A;  1U5T C;  3E3V A;  4HF1 A;  3RKY A;  3Q5F A;  4LG0 A;  4MGR A;  2E1C A;  1MDM A;  1ZGJ A;  1HKS A;  5LGT A;  3E6B A;  3GWZ A;  1FYL A;  1ZAR A;  3R61 A;  3ZMS A;  3M8F A;  1HKQ A;  5A2Q Z;  2PMH A;  3QP5 A;  2RN7 A;  3C18 A;  2VOD A;  3L9F A;  2OQR A;  2BEO A;  1I27 A;  4LGW A;  2ESH A;  1USS A;  4FX4 A;  4HF0 A;  4H0E A;  1HW2 A;  4QLC U;  1IF1 A;  2V1X A;  4XLP F;  1Z9C A;  2TDX A;  5ILU A;  1KGS A;  2FXA A;  1O7F A;  4KN4 X;  4I0A A;  3TGN A;  2M45 A;  2E7X A;  2WTE A;  2ZME B;  3WE2 A;  4MQV A;  1D5V A;  4KDP A;  3ZN1 A;  3MCZ A;  1PP7 U;  2Z99 A;  2DK8 A;  3BRO A;  3VEP A;  4L9J A;  3RJP A;  2ETH A;  4MNU A;  2FML A;  1OYI A;  2X4H A;  4IHS A;  2Q2E A;  5D5U B;  2JPB A;  3DEU A;  2LDU A;  2K7L A;  3IL2 A;  4EJT A;  3RTR A;  4HQE A;  3RYP A;  1WWX A;  3RIR A;  4G7O F;  2F2E A;  4Z2Y A;  3K1P A;  1YQA A;  1GVJ A;  1WKM A;  3V8L A;  3KP4 A;  1UHW A;  3BJA A;  4G7Z F;  4MEY F;  3KET A;  3BDD A;  5E8I A;  2M5W A;  1HW1 A;  3KEO A;  2DW4 A;  3D0S A;  3LFK A;  2XRO A;  2B0L A;  5H6R A;  2YPR A;  2G7H A;  2V6C A;  2ZKZ A;  2LF8 A;  4LMY A;  3JTG A;  2DQR A;  1ZLJ A;  4A0Z A;  4LLN A;  4L9T A;  1FSH A;  3HYI A;  5JHU A;  1ZG5 A;  1T98 A;  2DT5 A;  2Y48 A;  5ILV A;  1C0W A;  2L01 A;  4M72 A;  3JAM Z;  1K7A A;  3LQQ A;  3M9A A;  3R60 A;  4P96 A;  3TO7 A;  2VC0 A;  1F5T A;  2HQR A;  3AAF A;  4FHT A;  3D5L A;  2XRN A;  3QRF F;  1B6A A;  5LHI A;  2STT A;  2V79 A;  3CLO A;  2Q8K A;  1S7A A;  2L4M A;  2VT3 A;  5HDK A;  2W24 A;  4XSZ F;  2XAQ A;  2W84 A;  2Y0M A;  1IXC A;  3HUG A;  1FP2 A;  3TO6 A;  2O61 A;  1P4A A;  2RNJ A;  1O3R A;  2EV6 A;  1SFU A;  3JAM K;  3V7R A;  1JGS A;  2D1V A;  2ZFW A;  2JSC A;  5FGM A;  1ZRC A;  2KIU A;  3HOT A;  2M8E A;  5CVJ A;  4M6Y A;  2IA0 A;  2Z5U A;  4CO8 A;  4L9V A;  1XB4 A;  2HKX A;  3CO6 C;  2H6B A;  1JHH A;  2FE3 A;  3R0J A;  5AIQ A;  4AWX B;  2ZXJ A;  2OZU A;  4CDG A;  2QLZ A;  3SXY A;  1QNT A;  3F8B A;  1J0R A;  3R6S A;  1KU3 A;  4OIR F;  4MTD A;  4WK8 F;  1BM9 A;  3IHU A;  4A12 A;  5FFX A;  1MKM A;  2XAG A;  3DXJ F;  4L5I A;  5FO5 A;  3T1B A;  1O57 A;  3GW2 A;  2JPC A;  3HRS A;  2J5O A;  1U8R A;  1YW8 A;  2L54 A;  1J75 A;  3EET A;  3GVA A;  4YG2 F;  1MJB A;  3F21 A;  5J8C A;  3DV8 A;  3RKX A;  2FF4 A;  1U78 A;  1FT9 A;  3F8M A;  1XCV A;  2FRH A;  3HSF A;  1TLH B;  4GYI A;  2FEZ A;  2UXN A;  2H27 A;  2M87 A;  3ZMU A;  1FX7 A;  1Z6T A;  2HEO A;  1FPQ A;  1I5Z A;  3QPT A;  3TQN A;  2IRF G;  5D6F A;  3F8N A;  3Q9V A;  1ZHF A;  2FU4 A;  3EDP A;  3BOQ A;  4OIN F;  1I1S A;  2O3F A;  4PDK A;  1MGT A;  4NB5 A;  3BPV A;  1LEB A;  1KQ0 A;  1YW7 A;  1ZAO A;  3CJN A;  3TO9 A;  3T8R A;  3K69 A;  1DDN A;  1S7O A;  2A07 F;  2EV0 A;  2DAO A;  1T6S A;  1GHC A;  4F7Z A;  1S6L A;  4PCQ A;  2KKO A;  3FM5 A;  4AD9 A;  4LK1 F;  1OR7 A;  1B1B A;  2EA4 A;  5HLH A;  3FWE A;  4HYE A;  4O3M A;  5IT9 K;  4IJA A;  2XAH A;  5DYM A;  1F9N A;  3W6K B;  4KMF A;  2QBY A;  3GX4 X;  1B9N A;  2OA4 A;  2PG4 A;  3J7A O;  1ZRD A;  1IXS B;  3F8C A;  3SQN A;  4IVN A;  1FOK A;  3MZY A;  1ZG1 A;  3CUQ B;  5FD6 A;  4FT8 A;  3IC7 A;  3G73 A;  1KQ9 A;  3IKV A;  2J5P A;  3QPH A;  1XGS A;  4CIC A;  4CGZ A;  3CUQ C;  2E1N A;  2C6Y A;  4HDV A;  1YIO A;  5E1W A;  4BHB A;  4BHP A;  2ISY A;  1FLI A;  4EM2 A;  4KYW A;  5CLS A;  1R22 A;  2MD5 A;  3KP6 A;  2GXG A;  4RGS A;  1HKT A;  5FFZ A;  2FBI A;  1DP7 P;  4KUM A;  3E6C C;  3BP8 A;  2AS5 F;  2F5D A;  4LK0 F;  3U2R A;  4EVI A;  3ZP5 A;  5F6F A;  4AIH A;  2MH2 A;  2ZNY A;  3ABT A;  1STZ A;  3E97 A;  3ZMV A;  1QGP A;  2VBZ A;  1ODD A;  4JBA A;  1GXP A;  4UVA A;  3HTU A;  3N97 A;  3LWF A;  1IZ1 A;  4G9Y A;  4P5O A;  1W7P D;  3IKT A;  1R5H A;  1SD4 A;  1SAX A;  3WTS C;  3OOP A;  1BOA A;  4ENM A;  3MQ0 A;  4MHG A;  4KMU X;  3F8F A;  1D3Y A;  5IT3 A;  3K2Z A;  1L3L A;  1RIO H;  4HBL A;  5HS8 A;  1TNS A;  4HV5 A;  4OU0 A;  2IA2 A;  3I53 A;  2XKO A;  1EV7 A;  5ERI A;  3O3K A;  2H6C A;  4M9X A;  4LLG F;  3RDI A;  4JQF A;  1V4R A;  3EYI A;  4I2O A;  4HQM A;  3GZ5 A;  1UST A;  2BE5 F;  2MA3 A;  4ESB A;  3I64 A;  3L7W A;  3ML6 A;  4RGR A;  2QYO A;  2DI3 A;  3MAJ A;  2XAF A;  3J80 K;  3WU1 B;  5TRD A;  3MWM A;  2D2W A;  3TOB A;  2GZW A;  3NRV A;  3FXQ A;  5HS9 A;  4KIC A;  1Z7U A;  2ADU A;  1P2F A;  3PQJ A;  1MZB A;  1WSU A;  3BWG A;  3WTY C;  4Q5S F;  1BIA A;  2DQL A;  5LGN A;  3U1D A;  1B4A A;  2P7V B;  4FX0 A;  5E17 F;  1K6O A;  2EK5 A;  2E7W A;  5L3E A;  3N4M A;  2HYG D;  2XAS A;  4YII A;  5K5R A;  3F6V A;  3I71 A;  2CW0 F;  4R79 A;  1LQ1 A;  1FYM A;  3TOA A;  6PAX A;  1S3J A;  2KIM A;  4QWQ A;  2NNY A;  2A6H F;  2NNN A;  1F1Z A;  3EUH A;  2MLK A;  4ASN A;  3WTU C;  3RPQ A;  4AIK A;  3LA3 A;  3ZPL A;  2Z33 A;  2UWM A;  3O2P E;  2R7D A;  2DK5 A;  3BPX A;  4KIF A;  2XHK A;  4I09 A;  4HW0 A;  4K2E A;  4N9I A;  4R1H A;  2FBK A;  4A5N A;  2D1H A;  1R00 A;  2F5E A;  1IN4 A;  2R3S A;  2BYV E;  3VOD A;  1TBX A;  3I0T A;  1SD7 A;  2VBW A;  1J2X A;  4I01 A;  3KP5 A;  3E6M A;  4RB3 C;  3WOD F;  5JR3 A;  4ENK A;  3FMR A;  4L5J A;  2NRA C;  2WC2 A;  2CFX A;  4LFU A;  4PZJ A;  1J9I A;  2IJL A;  3IWZ A;  2CWE A;  3HRU A;  3HTS B;  3MFK A;  4RGU A;  2H09 A;  2GIV A;  3CUO A;  1BI0 A;  1FBQ A;  1U5T A;  3ZMZ A;  4Q48 A;  2K02 A;  5BS6 A;  1FY7 A;  4OIQ F;  1R58 A;  2KJB A;  4BAY A;  2V9V A;  1ZLK A;  2FMY A;  3RKW A;  1G3Y A;  3QOP A;  2GWR A;  2PEX A;  3G3Z A;  5LRR A;  1ZRE A;  4EM1 A;  2O8X A;  3KP7 A;  2ZME A;  1O3Q A;  3HHG A;  1PUE E;  5J6X A;  5DV5 A;  5ICE A;  5L3F A;  1R23 A;  4MEX F;  3L00 A;  1ZYR F;  5D5V B;  2HTJ A;  1KYZ A;  1YLF A;  4GGG A;  4NHJ A;  1UHM A;  1LJ9 A;  1ZG3 A;  4XBF A;  1HSJ A;  1XGO A;  5D8L B;  5DUI A;  3CTA A;  5K5O A;  2YX4 A;  4IPA A;  1T38 A;  3B73 A;  3FXR A;  4WX9 A;  4EJO A;  1LNW A;  2PJP A;  2A69 F;  2K4B A;  2UXX A;  5EEG A;  2HR3 A;  4L9N A;  2HKO A;  3H3U A;  1WI9 A;  5K1Y A;  3V4G A;  2D45 A;  1H9G A;  3B02 A;  3KCC A;  2FQ3 A;  4HX7 A;  2QM3 A;  3KLN A;  3O6B B;  2P5V A;  3GFI A;  5E1Z B;  3I54 A;  3RYR A;  2XUB A;  3KLO A;  5DUK A;  1V3F A; 
#chains in the Genus database with same CATH topology
 5FLM J;  2CSO A;  3BG3 A;  1UEL B;  3LA2 A;  4YFK F;  4IRG A;  2GLO A;  3HB9 A;  2CQQ A;  2DJN A;  4ZDO A;  2E1M B;  4DBR A;  2R7Q A;  5DS9 A;  3PQK A;  4RS8 A;  2LNB A;  2W25 A;  4BU2 A;  4Y13 A;  5LHG A;  2P81 A;  2GA1 A;  4M3G A;  2R92 J;  1MSF C;  1BI1 A;  2L0K A;  4EGZ A;  1XN7 A;  1S8N A;  4RAF A;  2EFP A;  4U7D A;  4ZZD A;  1I1G A;  2FA5 A;  5F08 A;  1VQM I;  4GO1 A;  1IW7 F;  2IGN A;  2GOM A;  1TW3 A;  3H92 A;  3FHZ A;  1IRF A;  4RAY A;  2VLA A;  2OF7 A;  3ZMD A;  2R7O A;  2VKD A;  1E17 A;  4P9U A;  5A2Q K;  3HHH A;  2O03 A;  4UUS A;  5EYR A;  1O3S A;  1B72 A;  4M73 A;  4UUV A;  1QU3 A;  1IDY A;  2HQN A;  4O6J A;  5TGT A;  3RPU D;  3M3Y J;  5CJ9 A;  3EQL F;  2JK3 A;  2ZFU A;  3SEQ A;  2HQ5 A;  1Y1W J;  3P9C A;  3BG5 A;  3F9K A;  3JRC A;  1NHA A;  2R5Z A;  2B7E A;  2RC4 A;  4U0V A;  3WU0 A;  2DLL A;  2VBX A;  2VB6 A;  5LEJ A;  3NQO A;  3RI4 A;  3IH2 A;  3TL4 X;  2DJI A;  2P5K A;  3OYL A;  2FOW A;  1EKE A;  2XKP A;  5IT9 Z;  2IBD A;  1MMA A;  5EJC A;  4B09 A;  1BBY A;  1QZY A;  4HX4 A;  4PFO A;  4FCY A;  3JCU C;  4ZYH A;  1H9T A;  4EQQ A;  3IH3 A;  5F04 A;  3E1S A;  1BN5 A;  3HZJ A;  5LFA A;  2QUF A;  2VT2 A;  3ZMT A;  1FBU A;  2QSG X;  3CUQ A;  2ZJP F;  3EPZ A;  3AG1 H;  4ON0 A;  2XGD A;  3L2C A;  2MYS A;  1D0Z A;  4YIF A;  1OCP A;  5E1X A;  2JVG A;  4M3D A;  2DTR A;  1T2K A;  3DU6 A;  3J7Z I;  1FMW A;  2EB7 A;  3AKZ A;  2DFH A;  4ZTF A;  1W7P B;  2E1M C;  1ETK A;  2DA6 A;  3DKW A;  4KIG A;  5BNG A;  3DBH B;  3I59 A;  1RKT A;  2LC2 A;  2ZCW A;  3OR2 C;  2JRM A;  2AXL A;  4U0W A;  3WTT C;  1X3U A;  2MG4 A;  3QAH A;  1TQM A;  4Y33 A;  1YO5 C;  1FOX A;  4I7H A;  1K4T A;  2OD5 A;  4YFX F;  1NH3 A;  2KJC A;  2OUM A;  3IRQ A;  1ULY A;  2BY3 A;  4PGG A;  2EBI A;  2ESN A;  3TBI A;  3BY6 A;  3GTL J;  4ENN A;  2HFH A;  3PNT A;  1VF9 A;  4XKB A;  4XOR A;  2IGO A;  2QEN A;  4PJM A;  1FYK A;  3KP3 A;  1MJA A;  3HPG A;  3RZD J;  4UVC A;  5FKO A;  1LDD A;  4H4K C;  3D5S C;  1ERD A;  3ULQ B;  4HA8 A;  1V5F A;  2ZSH B;  4OIP F;  3ASO H;  2RGV A;  1AA7 A;  4E7L A;  2OU2 A;  3BJ6 A;  3OWT A;  5ILS A;  1RUO A;  1BJZ A;  4IHW A;  3VB2 A;  3SZP A;  3JRB A;  4HST A;  3HOW J;  1G6N A;  1LE8 B;  1YOV B;  1IAW A;  1BC7 C;  3K4M A;  1MSE C;  1GVD A;  2EFO A;  3KIO A;  3EUA A;  2P4W A;  1Q1V A;  2MD0 A;  5FRO A;  2M0C A;  3A0B C;  1ON2 A;  2COB A;  2K27 A;  2X1D A;  5IOZ A;  1R1V A;  1SVL A;  3FBN B;  5BMZ A;  3BQZ A;  4UV8 A;  1REP C;  4HZF A;  1MJ9 A;  4DNC A;  2PMZ N;  1TTY A;  4XIC A;  4ZYG A;  1XMX A;  1TT0 A;  3E6D A;  3WHB A;  3I4M J;  1IXR C;  1M1E B;  3WG9 A;  4HDU A;  4ESJ A;  2R7T A;  2ZBK A;  5FD5 A;  2PJR B;  4ZYD A;  4A6E A;  1YIT I;  5FLX Z;  1KU9 A;  1AKH A;  2K9M A;  1BC8 C;  1P9Q C;  5F1J A;  3J80 Z;  2QSH X;  4E6K G;  5DDG A;  1Y0U A;  2XV4 S;  3HJE A;  2A3S A;  1UG0 A;  3T8T A;  2VAS A;  1SAN A;  2CQK A;  2LP0 A;  1I6X A;  3RSN A;  5J3L A;  5C4J J;  4CYC A;  5LHH A;  2A6E F;  3DBR B;  5FB2 A;  3BG7 A;  2ZC2 A;  3CCR I;  1XD7 A;  4HNU A;  2XPU A;  3TP0 A;  1OCZ H;  2L5Q A;  3G1L A;  3MKY B;  1FIP A;  2IW5 A;  5JHF A;  3AL0 C;  5ICG A;  1FSE A;  4JK1 X;  1G3W A;  3ECO A;  2GXB A;  3GTG J;  4UNO A;  3OYI A;  2HVS A;  2OAZ A;  2VQC A;  2Z9O A;  4KIB A;  1UCR A;  3OYJ A;  1W5S A;  4P9F A;  2JJ7 A;  4KIS A;  2F4M B;  2IEK A;  2DU9 A;  4ZTJ A;  2JZY A;  5IPA A;  2LVS A;  2VN2 A;  2DA3 A;  3QU6 A;  1OPC A;  2L9V A;  5KAI C;  2M30 A;  1HCR A;  3GF2 A;  2ID3 A;  1FZP B;  1QPI A;  1BI2 A;  3FX3 A;  9ANT A;  2IGK A;  1K78 A;  2RDP A;  3ESW B;  1TL8 A;  1XGN A;  3ABU A;  1GXQ A;  4IX7 A;  1UMQ A;  4HF2 A;  2E2H J;  5DTD A;  1UAA A;  3GTJ J;  1FNN A;  4M9S A;  5LGU A;  5CVV A;  1HQC A;  5EF6 A;  3OV8 A;  1LVA A;  5CYV A;  4UV9 A;  3DU5 A;  3K1M A;  1AU7 A;  3BTL A;  4XR6 A;  3JSP A;  4RLQ A;  4F92 B;  3QP6 A;  5J40 A;  1OMI A;  2K4J A;  4D5F A;  4RB2 C;  1SD6 A;  2NAZ A;  3OYA A;  5F64 A;  1KQ8 A;  3KZZ A;  3I4P A;  1D1C A;  4AC0 A;  4BGD A;  1I3A A;  2MAB A;  4BAC A;  2DPU A;  1W4M A;  3S8P A;  1GDT A;  3CC7 I;  1BW6 A;  3DPT A;  1AHD P;  4N0B A;  3SDB A;  3CJR B;  2KIS A;  1ONV A;  2DA7 A;  5HOO A;  1RR8 C;  1DP3 A;  1D0Y A;  2VXZ A;  3QU3 A;  4AVP A;  4F55 A;  3A4C A;  3C2B A;  1VQN I;  3S93 A;  3S3M A;  2XVC A;  4EMS A;  3QPL A;  5E20 A;  4XKW A;  1F4K A;  1XDS A;  2K3F A;  4OOI A;  1IUF A;  4Y15 A;  3E5X A;  4RM3 A;  1ETX A;  4LB6 B;  4XN0 A;  3GLX A;  4V2F A;  4LG3 A;  4BQN A;  4ZJZ A;  1HXD A;  2ACJ A;  2HYF A;  3RPU A;  4UUT A;  2NOG A;  2V7F A;  3H9Q A;  1MH3 A;  5ICF A;  2VOP A;  1U5T B;  1J7K A;  2AQF A;  2LSO A;  4QPQ A;  3BJO A;  4S05 A;  2GAU A;  3TKY A;  4IHT A;  1XMK A;  2XAJ A;  3U1K A;  2HZD A;  3WGG A;  1P6R A;  2W7N A;  4M74 A;  5HLG A;  2Z3Y A;  2DTZ A;  1HST A;  2HPI A;  5F0C A;  1D1A A;  2PN6 A;  2DA1 A;  3WTV C;  1N75 A;  1OKR A;  2Y0S N;  3PUF A;  1A36 A;  3SHF A;  1SFE A;  1SEU A;  4CHU A;  4LJZ F;  1PP8 F;  3REO A;  4EM0 B;  3I9V 2;  4EJU A;  1B9M A;  1YRN B;  3ZQF A;  5LBQ A;  2A61 A;  5CVR A;  4NC6 A;  1Y39 A;  4F91 B;  2M1B A;  2WAQ A;  1U3E M;  3GYH X;  4Q47 A;  4I98 B;  1IRG A;  4P55 A;  1U8B A;  1FOW A;  4C3H J;  2QBY B;  2WAQ N;  3GEZ A;  2RQQ A;  3H0G J;  1MND A;  2VC1 A;  3L2R A;  3S17 J;  4NC8 A;  2OBP A;  4FIS A;  1ZN2 A;  1LFB A;  1W5C C;  1MBK A;  1Z67 A;  2VL8 A;  3AG4 H;  5K7Z A;  4CZZ A;  3HOS A;  1OJL A;  1Z1D A;  1GV2 A;  5D5X B;  2YSR A;  5HLT A;  2LRE A;  1TWC J;  4ENJ A;  2PMZ A;  3LFU A;  1IN8 A;  2MBF A;  3CP2 A;  1K79 A;  3ABM H;  4BJ6 C;  4MTE A;  5AIP A;  3O8G A;  1RUN A;  3ZRG A;  2L7F P;  4A93 J;  3K10 A;  2JT1 A;  2R4G A;  4PUS A;  4B47 A;  2VIX A;  2EIJ H;  3QPS A;  1IV8 A;  2JVH A;  3K7A J;  3H3V K;  3W6J B;  4XNF A;  2HVQ A;  3CMY A;  1LFU P;  3DCF A;  3L1P A;  4GRI A;  4IHV A;  2BV6 A;  5E79 C;  4BYY A;  2PBI A;  4OAY A;  3M7G A;  4G7H F;  2P6S A;  2W85 A;  4XRF A;  1XGM A;  5IP9 J;  2HQA A;  4RB1 A;  1BR2 A;  4KA4 A;  2DDB A;  3H3Z A;  1ZRF A;  2ID6 A;  1B8I A;  3V8K A;  4PGH A;  4EV0 A;  3Q0V A;  5K7H A;  3OSF A;  1BR1 A;  3PFI A;  3U9G A;  4C3I J;  1HW5 A;  1NK2 P;  5HDG A;  1RET A;  2JTV A;  4D9J A;  2YX7 A;  3WTW C;  3CO7 C;  2V26 A;  1YW9 A;  5F0F A;  2L3D A;  1J59 A;  1OYY A;  3ZQ7 A;  2K9N A;  3ZQH A;  1UJ8 A;  2QQA A;  1FWZ A;  1ETO A;  2TRT A;  4TV7 A;  1TNT A;  3CCQ I;  2BVM A;  3VSK A;  2LH9 A;  2KIF A;  3COA C;  1VQO I;  4IRH A;  1RKW A;  2KIQ A;  2GOX B;  4HSR A;  5HDN A;  2JUC A;  4BEH B;  1ZGA A;  1Q1H A;  3JRI A;  3BG6 A;  1QPM A;  5M5X J;  1EH6 A;  3DKY A;  1VTN C;  4LG0 B;  2DMU A;  2VE9 A;  5BOX A;  3W3C A;  2QZ8 A;  1XDU A;  3S2W A;  2HI3 A;  1LEA A;  3GFL A;  2RV8 A;  3M8J A;  2CG4 A;  2IP2 A;  1J5Y A;  4XM3 A;  2CW8 A;  3HOZ J;  2XPW A;  4L18 B;  1Z21 A;  1R71 A;  2Q0O A;  1ETY A;  1KA8 A;  4OMZ A;  1QQI A;  5IYC J;  1CF7 A;  3HGG A;  2VE8 A;  1MNM C;  2ZXH A;  3BR3 A;  4FAS D;  1W1W E;  3LAP A;  4YFN F;  3GLL A;  4S0H B;  3JR9 A;  3BR0 A;  1TZL A;  2YR2 A;  5DD4 A;  2RQP A;  3FM3 A;  3P5J A;  2OQG A;  4WXH A;  1TT5 B;  1D8K A;  2FNA A;  3H0D A;  4QIW N;  2MC3 A;  2PI0 A;  1RRJ A;  1X1B A;  2E1O A;  4OMY A;  1KYW A;  2YS9 A;  2JRT A;  4UXN A;  3LAJ A;  1V55 H;  1WRJ A;  3S32 A;  3JSO A;  4RA2 A;  3MZH A;  4LB5 A;  4XOT A;  1X3Z B;  2R7R A;  3C2H A;  1YJW I;  1YYV A;  1N78 A;  4KFC A;  2L7M P;  1FOY A;  5D8K B;  3SYT A;  1O7L A;  4LLL A;  4D5C A;  4E7S A;  1S29 A;  4Y17 A;  2NYX A;  4A0X A;  3S15 J;  2BGC A;  1WH7 A;  4EJW A;  1T39 A;  2V4J C;  2ELK A;  1Y6I A;  2QWW A;  4MQ9 F;  1VQL I;  4ZH4 F;  3T5X A;  3C1D A;  1UFM A;  1R4M B;  2DYR H;  1JJ8 C;  2K5C A;  4RAZ A;  5D4R A;  5HS7 A;  4D0P A;  3GFJ A;  2HDD A;  4KIT B;  1R7J A;  2ISZ A;  3CCU I;  3P9I A;  4M6X A;  1MDM B;  1PVE A;  2WWY A;  3Q3S A;  2MH9 A;  1G4D A;  1P4W A;  4PJ0 C;  1MD0 A;  1WH5 A;  2GA2 A;  3JTH A;  1AOY A;  5GPC A;  3J81 K;  1Z77 A;  4U88 A;  3S2H J;  4DJA A;  4HV6 A;  4UHT A;  3CCE I;  4M9Z A;  5ICC A;  3QQA A;  4CXF A;  4RM2 A;  1JKP C;  4A3J J;  3DTE A;  4A6D A;  5FRN A;  4M71 A;  3W6V A;  1CF7 B;  4V2G A;  3HSE A;  2OZ6 A;  3FZV A;  1X4O A;  1K6Y A;  4IKF A;  1BW5 A;  1LVK A;  1JKR C;  5CPR B;  2O6G E;  1X58 A;  1SFX A;  1KZH A;  3GBG A;  2BBY A;  5B1A H;  5GTI C;  4M3E A;  5HLI A;  1CQT A;  5EZG A;  3E0J B;  1KU2 A;  2Z1D A;  4ZYE A;  3CDH A;  2CUF A;  1DUX C;  2L7Z A;  3QOD A;  2HTS A;  1AKH B;  2KQR A;  4HAM A;  3F6O A;  4ABZ A;  1TQP A;  2O8K A;  3GTM J;  1R36 A;  4A3G J;  3MEX A;  1XSV A;  4KNY A;  1YJ9 I;  5JFR A;  5D5W B;  3WG7 H;  3L2U A;  3F72 A;  1SD5 A;  2DBB A;  2K9S A;  3WHC A;  4XLE A;  4U0Y A;  5AON A;  4IRI A;  3V42 A;  2CO5 A;  5K5Q A;  2VON A;  4ESF A;  3VYR B;  2M7A A;  3FKI J;  2VQL A;  3KP2 A;  3Q0U A;  2DOA A;  2ELH A;  2W57 A;  4WF2 A;  2L9S A;  4AVZ A;  3ONQ A;  2P8T A;  2VKE A;  5CKT A;  5J1Y A;  2ME6 A;  2ZO4 A;  3F0C A;  3IP4 B;  3PFY A;  1Z91 A;  3CDL A;  4A2U A;  5L3B A;  3ELK A;  1G3T A;  3WGI A;  2IA1 A;  1NTC A;  2NVU B;  2XC7 A;  2WV0 A;  3B6C A;  5H20 A;  3MZ8 A;  1EH7 A;  3DF8 A;  3K0L A;  4BE1 A;  1X1P A;  1MW7 A;  3JW4 A;  2FNP A;  1YFH A;  4II2 A;  4CCK A;  2YU3 A;  3RCO A;  3I55 I;  3I56 I;  2Q2E B;  3SFZ A;  3K1N A;  5E8G A;  4A3K J;  3BG9 A;  4C2U A;  2CGP A;  2W1O A;  3PM1 A;  2PFB A;  2LKS A;  4G6D A;  5DCM B;  3V7S A;  1VQ6 I;  2EZH A;  3ERE D;  5E18 F;  4N9H A;  1IN6 A;  5CVI A;  1LDK B;  5M3M J;  3G2B A;  4HG2 A;  3T0Y A;  4RMN A;  2CYY A;  3S1N J;  1TQI A;  2QQ9 A;  2P5L C;  2OTL I;  4B8X A;  1V54 H;  5J4V A;  4IL6 C;  4S04 A;  3I5U A;  2R93 J;  5C4X J;  5H2F C;  2V1U A;  3A1Y A;  2JUG A;  1XSD A;  3I59 B;  3OIQ A;  4EGY A;  3PSI A;  5L3C A;  1VQK I;  3LQR A;  1SC7 A;  1VFC A;  1WJF A;  2GQQ A;  2M4K A;  2EH3 A;  2EFN A;  3KE2 A;  1D5Y A;  3ROU A;  1MIJ A;  3KYL A;  3J7A Y;  2JA8 J;  4XLH A;  4XOP A;  1WJC A;  1HBX G;  5FLX K;  2KLO A;  2G9W A;  3CME I;  1VQP I;  1U0J A;  1YTY A;  1G3S A;  5ED4 A;  1WHU A;  2EWN A;  2IVM A;  3H1C A;  4Y52 J;  4DGW B;  4UB6 C;  1LE8 A;  4O5V A;  2RAE A;  4WWC A;  5DCF A;  2ZXI A;  3Q9S A;  1D8J A;  2XGX A;  1JHF A;  3WTX C;  1VI0 A;  3K9T A;  1L0O C;  3OIP A;  2ELJ A;  5D4S A;  2EIM H;  1BJA A;  3L2W A;  2UZK A;  2QEX I;  3ABK H;  1YS7 A;  2M3A A;  3HKZ N;  1Z6R A;  1K78 B;  1IRX A;  4EEF G;  1D1B A;  5DEQ A;  3LA7 A;  2O0Y A;  3CDI A;  5J8F A;  4L0Y B;  2P7C B;  2V9P A;  2XF5 A;  2QKM B;  4F93 B;  1TWH J;  4I02 A;  4J19 A;  2M4G A;  1Z0X A;  4A3F J;  1GLN A;  3H9G A;  1WGX A;  1IUY A;  1R5G A;  2QQB A;  4RGX A;  3KZI C;  1ON1 A;  2LR8 A;  3TP3 A;  4E70 A;  2BHY A;  4BNC A;  3C3W A;  2IS1 A;  1S5L C;  2WA0 A;  5H6Q A;  5M3F J;  1HA8 A;  4A69 C;  5L3G A;  1PJR A;  4B3A A;  4DYC A;  2CFO A;  4XSX F;  4GCV A;  2G7U A;  2QF7 A;  2PQ8 A;  5BQT A;  3PO3 J;  4HLY A;  5LEK A;  4YEJ A;  3ASN H;  3HL2 A;  1DPU A;  1RNL A;  4WXD A;  1IN7 A;  3IAM 2;  1OYW A;  3SFI A;  1ITY A;  3KEQ A;  3FKJ A;  5KK1 A;  3PL8 A;  2AXT C;  3S1Q J;  3M1C A;  2OCC H;  5EZH A;  2EFQ A;  1R6R A;  4IEJ A;  2EV5 A;  5E3O A;  4D1Q A;  3OYK A;  2NS0 A;  2ZJ2 A;  1SMY F;  3OSG A;  1R1U A;  4J00 A;  5GPA A;  5TJJ A;  2XAU A;  3DQV C;  3NEU A;  4LIT A;  2V9K A;  3C7J A;  4ZC3 A;  2R0Q C;  2B9S A;  3ZQQ A;  3V7C A;  3CCJ I;  3GFM A;  3LOC A;  1RZ4 A;  4PFP A;  1FTZ A;  5IOY A;  2DFI A;  3ZGK A;  1W5T A;  4HOB A;  4A5M A;  4AIJ A;  2NS7 A;  4OIO F;  3RQ4 A;  1KU7 A;  4WXC A;  3L2Q A;  1Z7L A;  4QTR A;  5FLV A;  4BXX J;  3LSR A;  1Z05 A;  3HIF A;  2DOD A;  3DPU A;  1X2N A;  1XG1 A;  1DPR A;  1XMA A;  3P7N A;  4D7M A;  2DCE A;  3FMS A;  1X4P A;  4R8H A;  5DM7 F;  4I99 C;  3JRA A;  1R1T A;  4ZZL A;  4L0Z B;  3BCA A;  1H0M A;  5JVT A;  4GYG A;  3BTC A;  2VOO A;  1A04 A;  1XX5 A;  4C9Y A;  2M0M A;  3IRR A;  2D5V A;  1P92 A;  1E2X A;  3DKX A;  3M1E A;  2NOJ B;  5CQG A;  4C3J J;  2FOK A;  4NQW A;  5HVQ C;  2K86 A;  2HS5 A;  1R4N B;  4IF4 A;  5FKK A;  2R7F A;  1SMT A;  3WGH A;  2DT7 B;  2IS4 A;  1FTT A;  5BPD A;  4CSW A;  1F43 A;  4XRS A;  2DOE A;  3UR3 C;  3CP8 A;  1FIA A;  2QGU A;  4A3L J;  3GO5 A;  2Y2Z A;  1YIJ I;  4BE0 A;  4BH9 A;  3DPL C;  1MBF A;  3QYB A;  2FD5 A;  2QVO A;  1CGP A;  2EZL A;  2IAI A;  2ZNZ A;  3KFW X;  2HDC A;  3IWF A;  4XRM A;  2CQ7 A;  2HXO A;  2KRH A;  1UB9 A;  4HX8 A;  3E7L A;  5KVR A;  2F4I A;  4LIV A;  1EH8 A;  2VJ4 A;  1LDJ A;  2KDO A;  1QO0 D;  3J81 Z;  1ZGW A;  1YG2 A;  3DTI A;  4F52 A;  4W1U A;  1WQ2 A;  3V8J A;  1W7P A;  3QOE A;  3A03 A;  2L7K A;  2CS3 A;  5LRS A;  1RI7 A;  3ZQG A;  5BPI A;  4C30 A;  1R9T J;  1OCO H;  3CCY A;  3OL4 A;  4BY7 J;  4D7N A;  3GXO A;  4MLO A;  1FP1 D;  3VSL A;  1P4X A;  4OWR B;  1JKQ C;  3VOE A;  3ZQI A;  3MKZ A;  3EYY A;  1JXS A;  2VKV A;  3H5R A;  1BI3 A;  1T95 A;  2RVC A;  3BCB A;  3LSH A;  4E4H A;  1DGR M;  3ECH A;  2XGC A;  5DCM A;  2H8W A;  3KZY A;  2A68 F;  2QKL B;  4Q4Z F;  2V1D A;  5EGO A;  3I58 A;  2XB5 A;  4P1W A;  5F1R A;  4II3 A;  4G8X A;  3BLY A;  2HZT A;  2XPV A;  4U7B A;  1MMD A;  3P9K A;  3LST A;  2E34 A;  4BXU A;  1WJB A;  3IUO A;  4DW6 A;  1ZH5 A;  1U2W A;  4HRI A;  4C2T A;  1R5I D;  2LG4 A;  4BKX A;  1F36 A;  2H94 A;  2MLG A;  3HRT A;  2HOE A;  4CCO A;  2Z16 A;  2NVY J;  4KN7 X;  3J7Y J;  5EEH A;  3TMO A;  4YIR X;  1JJ6 C;  1NG6 A;  1MBJ A;  4A3B J;  3QYF A;  4DQ2 A;  4IQJ A;  4HLX A;  1NK3 P;  2LLK A;  2LFB A;  4XLA A;  1U9N A;  2L02 A;  3DLA A;  1O3T A;  2JA7 J;  2F5C A;  3FMQ A;  1FBS A;  1LB2 A;  2EZI A;  3TDU C;  3FXO A;  1QBJ A;  3FXJ A;  2HYJ A;  2HDW A;  1ZTR A;  3S16 J;  2KP6 A;  3WE3 A;  1IN5 A;  1XCB A;  3MKL A;  2F5V A;  1QHH D;  2DMP A;  5CVU A;  5EG0 B;  3GZ6 A;  2XGE A;  1PDN C;  2DOF A;  4RB0 A;  4I0B A;  2LF7 A;  5L3D A;  1X1D A;  2L9N A;  4XLC A;  4UVB A;  1K83 J;  1VQ7 I;  1E3O C;  5EG0 A;  2M2E A;  4MFD A;  2CMP A;  4N4O B;  1DGW Y;  3OYN A;  2DPD A;  1OIS A;  2DO7 A;  2YUS A;  3HKZ A;  4A3I J;  1A35 A;  3SZT A;  3PNV A;  4JX4 A;  4A0Y A;  2G0E A;  2K9L A;  5D6E A;  2HNH A;  2ZJQ F;  3L09 A;  3E5Q A;  3DP7 A;  2P0W A;  2Y30 A;  1FC3 A;  3FXU A;  3KPH A;  3K70 C;  3PJR A;  4WCG A;  4ETS A;  4X6A J;  5FKM A;  3O8H A;  2E60 A;  1S7E A;  2QSF X;  2Y9Z A;  3QYE A;  4LD5 A;  2STW A;  2X6W A;  2EIK H;  4BQA A;  3CES A;  5FRM A;  2R5Z B;  2IPQ X;  3R0A A;  3F3X A;  1WFX A;  2Q1Z B;  1AWC A;  2PMU A;  1FMV A;  2FBH A;  4G6Q A;  2L4A A;  2DXI A;  1QZZ A;  1ETW A;  5JI6 A;  2X0L A;  2F5F A;  3R4K A;  3VFZ A;  1V5E A;  1X1C A;  2CH0 A;  3DFG A;  2IT0 A;  2ZB9 A;  5HNF A;  3AFH A;  1T0F A;  1X2M A;  1ENH A;  4XLN F;  1P7J A;  5LLQ A;  3IV5 A;  1JUM A;  1XSX A;  4KT5 C;  2HWV A;  4GXO A;  3OYC A;  1OCT C;  3ZN0 A;  2EJR A;  3E5U A;  2KRF A;  4G94 A;  4XLF A;  1JE8 A;  3M8E A;  3F22 A;  2DA5 A;  1JTX A;  1W36 C;  2UV1 A;  2Y75 A;  3HRM A;  1B59 A;  1IV6 A;  5KAF C;  1U6G A;  2FSW A;  2X9D A;  1BIB A;  3WTZ A;  2EFW A;  2VPR A;  4KT6 A;  1JUS A;  1YS6 A;  4MO7 A;  2HGC A;  3ISP A;  2DDA A;  1I3Q J;  2EA2 A;  2COM A;  5FJ8 J;  4Y3O A;  4IO9 F;  3GZN B;  3GTK J;  2QQ8 A;  2PLY A;  2ECB A;  2RKH A;  3TDZ C;  4CYD A;  1W36 D;  1H89 C;  3D1N I;  1X1A A;  3BZ6 A;  5GAG J;  3FF5 A;  3CQZ J;  2BOL A;  2XIG A;  5DD8 A;  3BQY A;  2A5Y B;  4IXA A;  5B5E C;  3EUH C;  1TW2 A;  4EJV A;  2X48 A;  3GUD A;  4BHC A;  3F23 A;  2E19 A;  3HSR A;  2IXS A;  2VBY A;  2LKP A;  2R7U A;  1YX5 A;  2P6T A;  2JQ7 A;  1U5T C;  4RLF A;  3E3V A;  3ZCO A;  4HF1 A;  2ICW G;  3RKY A;  2KFD A;  1ZR2 A;  2O5R A;  3OYD A;  3Q5F A;  4LG0 A;  2CU7 A;  3A01 A;  4MGR A;  2E1C A;  1MDM A;  1ZGJ A;  5K7F A;  1HKS A;  2HU9 A;  4MIM A;  1ETV A;  5LGT A;  3E6B A;  1YI2 I;  3ERM A;  5KHD A;  2BVL A;  1YE9 A;  4BQO A;  3GWZ A;  3OYF A;  1FYL A;  3SZG A;  2HOS A;  1ZAR A;  1MMS A;  3R61 A;  4BBS J;  3ZMS A;  3M8F A;  1K4S A;  1IGN A;  4Y4R A;  1HKQ A;  5A2Q Z;  3NWT A;  2PMH A;  3QP5 A;  2RN7 A;  3C18 A;  2WAD A;  2VOD A;  3ZQC A;  5CQE A;  1QVU A;  3L9F A;  1I50 J;  2OQR A;  2BEO A;  1I27 A;  3VYS B;  4A3M J;  3QWL A;  4FE4 A;  4LGW A;  2ESH A;  5B3S H;  2CRG A;  1USS A;  4FX4 A;  4HF0 A;  2GBY A;  4H0E A;  4IHX A;  1HW2 A;  3K4N A;  4QLC U;  1IF1 A;  2M9H A;  1UZC A;  2V1X A;  4XLP F;  1Z9C A;  2TDX A;  4NC7 A;  4ITV A;  1RC9 A;  3U21 A;  3OL3 A;  5ILU A;  1KGS A;  2FXA A;  1O7F A;  4KN4 X;  4E7J A;  4I0A A;  1OFC X;  3TGN A;  2WB1 N;  1JT0 A;  2JWT A;  2M45 A;  2E7X A;  1XPX A;  3CC4 I;  2WTE A;  2ZME B;  3WE2 A;  4MQV A;  3NWS A;  3SDG A;  1D5V A;  3VYU B;  4KDP A;  3AG2 H;  4AUX A;  3ZN1 A;  3MCZ A;  4QPO A;  3FHN A;  1PP7 U;  4LOC A;  2VQH A;  2Z99 A;  1Y0N A;  2DK8 A;  3BRO A;  3NAU A;  4B4C A;  1FJL A;  3VEP A;  1T0F C;  4L9J A;  3RJP A;  2W82 A;  2ETH A;  4MNU A;  2FML A;  4L5E A;  1OYI A;  3GCM A;  2X4H A;  3BC8 A;  3HUG B;  1QVT A;  3SJM A;  4IHS A;  3FXK A;  3M4O J;  1IDZ A;  4UB8 C;  3FBI B;  2Q2E A;  5D5U B;  2JPB A;  3DEU A;  2DMN A;  2LDU A;  3DBL B;  2K7L A;  3MKW B;  3IL2 A;  4EJT A;  3RTR A;  2DA2 A;  4HQE A;  4B3X A;  2HXI A;  3RYP A;  4CZC A;  1W0T A;  1WWX A;  3CF5 F;  1JI8 A;  3OYB A;  1H88 C;  2KZV A;  3RIR A;  4G7O F;  2F2E A;  1YRN A;  1EF4 A;  4Z2Y A;  3K1P A;  1ZEL A;  1MMN A;  1SFK A;  1YQA A;  4E7Z A;  3OYH A;  2EQR A;  1GVJ A;  1WKM A;  3V8L A;  3KP4 A;  1UHW A;  2LRD A;  2EIN H;  3GTP J;  3BJA A;  3OYE A;  4GFB A;  3KEY A;  4G7Z F;  5J47 A;  4MEY F;  1HC8 A;  3KET A;  3I3L A;  1T08 B;  3BDD A;  5E8I A;  2M5W A;  1HW1 A;  3K4K A;  3GTQ J;  3KEO A;  1S72 I;  2DW4 A;  3D0S A;  1GT0 C;  3LFK A;  2XRO A;  2B0L A;  2KDZ A;  5H6R A;  2YPR A;  2JMW A;  3S3O A;  5M5W J;  2G7H A;  4AM3 A;  1I6H J;  2V6C A;  2WAF A;  4E7I A;  3L2V A;  2ZKZ A;  2PX9 A;  2LF8 A;  4LMY A;  3JTG A;  2DQR A;  1ZLJ A;  4A0Z A;  4LLN A;  2VJJ A;  3PIP F;  4L9T A;  1FSH A;  2LMD A;  1MMG A;  4BY1 J;  3HYI A;  5JHU A;  3HG9 A;  4NDL A;  1YJN I;  1ZG5 A;  1T98 A;  2DT5 A;  2Y48 A;  5ILV A;  1C0W A;  1S9H A;  2L01 A;  4M72 A;  4KJZ A;  2H1K A;  4DIQ A;  3JAM Z;  2XSD C;  2BZT A;  1K7A A;  1ACI A;  1D0X A;  1G2H A;  5C44 J;  2O7O A;  3GTO J;  1G8X A;  3JRG A;  3LQQ A;  3CD6 I;  3M9A A;  3R60 A;  4P96 A;  3LSI A;  3TO7 A;  3IH4 A;  2VC0 A;  1ZKG A;  2LBF B;  2HQR A;  1F5T A;  1TWF J;  3DLL F;  2W48 A;  3AAF A;  4FHT A;  3D5L A;  2XRN A;  2L2O A;  4RBO A;  1XS9 A;  3QRF F;  2M7B A;  1VZ0 A;  3OS1 A;  2JN6 A;  5M5Y J;  1B6A A;  5LHI A;  2STT A;  2R7S A;  2FQ4 A;  4HEA 2;  2V79 A;  4UUS B;  1B8I B;  3CLO A;  2Q8K A;  1RR7 A;  5IP7 J;  1VQ8 I;  1KON A;  1S7A A;  2NVX J;  2L4M A;  2VT3 A;  5HDK A;  3VDX A;  2W24 A;  5FKL A;  4XSZ F;  2DA4 A;  3HXL A;  2XAQ A;  3HDD A;  2W84 A;  2Y0M A;  4M6V A;  2BW3 B;  4GDF A;  4HNV A;  1Z3X A;  1IXC A;  2WAE A;  3HUG A;  1FP2 A;  1ORK A;  3TO6 A;  2O61 A;  1T56 A;  4G12 A;  3LSJ A;  1P4A A;  2RNJ A;  2RRE A;  1Y8R B;  5EGO B;  1O3R A;  2VJ5 A;  2EV6 A;  1SFU A;  3JAM K;  3V7R A;  3ZOB A;  1JGS A;  2D1V A;  2ZFW A;  4IQ4 A;  4XL9 A;  3HOV J;  1QA6 A;  1TWG J;  2JSC A;  5FGM A;  1ZRC A;  4BL0 B;  3K4B A;  2KIU A;  3HOT A;  2M8E A;  4M6Y A;  5CVJ A;  5KCM A;  2IA0 A;  2Z5U A;  4CO8 A;  3N05 A;  4L9V A;  3G4S I;  1WJA A;  5TIS C;  1XB4 A;  3X2Q H;  4DYR A;  2HKX A;  2BY1 A;  2Z2S B;  3CO6 C;  2H6B A;  2KZG A;  1JHH A;  2E5N A;  2FE3 A;  3R0J A;  5AIQ A;  4AWX B;  3K4C A;  3MN2 A;  3BZC A;  4PJN A;  5IYB J;  3ZQL A;  2ZXJ A;  5B1B H;  2OZU A;  3AL0 B;  3MD2 A;  4CDG A;  2QLZ A;  3SXY A;  2GIZ A;  1QNT A;  1RPW A;  2PJR A;  3F8B A;  2LY9 A;  3G1O A;  1J0R A;  3R6S A;  1KU3 A;  1DU6 A;  3LNQ A;  4OIR F;  4MTD A;  4WK8 F;  1BM9 A;  3H36 A;  2DFF A;  2XB0 X;  3TW7 A;  2KL4 A;  1W0U A;  1K61 A;  2R5Y B;  3JRF A;  2VXD A;  5GAE J;  2WBM A;  4AYB N;  3IHU A;  4A12 A;  5FFX A;  4M3F A;  1MKM A;  2XAG A;  3DXJ F;  4XQF A;  4L5I A;  5FO5 A;  2A05 A;  4YEL A;  2K3P A;  1E3H A;  3T1B A;  1O57 A;  3AG3 H;  3K4L A;  2B63 J;  5IYD J;  3GW2 A;  2IGM A;  2JPC A;  3HRS A;  3S3N A;  2J5O A;  3KYD B;  1U8R A;  4YRV A;  1YW8 A;  2I5U A;  4ANJ A;  5J1U A;  3A01 B;  1TP4 A;  2L54 A;  3MMY B;  3CCL I;  3K4J A;  1J75 A;  2OCE A;  1IO2 A;  3EET A;  3GVA A;  4YG2 F;  1MJB A;  3F21 A;  1MBH A;  1LUJ B;  4U87 A;  5GTH C;  5J8C A;  4BDZ A;  2W00 A;  3DV8 A;  3RKX A;  5B66 C;  2FF4 A;  1U78 A;  2Y69 H;  1FT9 A;  3UNG C;  3F8M A;  2AQE A;  1XCV A;  4JP0 A;  3TED A;  3MVP A;  1X3W B;  5GAD J;  2FRH A;  3HSF A;  3OS0 A;  1TLH B;  4GYI A;  2FEZ A;  2CQN A;  2UXN A;  4AYB A;  1Z3Y A;  2RNG A;  2O9L A;  2H27 A;  3I4N J;  2M87 A;  3JRH A;  3RQI A;  4RDU A;  2LYC A;  3ZMU A;  3SEZ A;  4CCJ A;  1FX7 A;  2CW7 A;  3DEE A;  1Z6T A;  2HEO A;  3FXM A;  2OC6 A;  3A2K A;  1FPQ A;  1I5Z A;  3QPT A;  4NNJ A;  3TQN A;  1GUU A;  5D6F A;  2IRF G;  3F8N A;  2CV0 A;  3Q9V A;  1ZHF A;  3OYM A;  2FU4 A;  3EDP A;  2WV1 A;  1T8I A;  3BOQ A;  1JUP A;  4OIN F;  1POG A;  2CQX A;  1I1S A;  3PO2 J;  3FXL A;  2O3F A;  4PDK A;  1MGT A;  4NB5 A;  3BPV A;  1LEB A;  1KQ0 A;  1YW7 A;  4J01 A;  2IS2 A;  1DU0 A;  1U9O A;  1ZAO A;  1A6I A;  3JRD A;  2XDV A;  3CJN A;  2CUZ A;  2BHZ A;  3TO9 A;  3T8R A;  3K69 A;  1DDN A;  4IOC F;  1S7O A;  2A07 F;  4XKC A;  2EV0 A;  5C3E J;  2DAO A;  2LK2 A;  1T6S A;  1GHC A;  1OCR H;  4F7Z A;  1S6L A;  4PCQ A;  5GAH J;  1JGG A;  2KKO A;  3BT9 A;  3CMA I;  3ABL H;  1HDD C;  2CJJ A;  3FM5 A;  4AD9 A;  1OR7 A;  4LK1 F;  1B1B A;  2EA4 A;  2OTJ I;  5HLH A;  2KT0 A;  3CCM I;  1E0E A;  4NBQ A;  1G59 A;  3FWE A;  4HPQ A;  4HYE A;  4O3M A;  2LTP A;  1LPQ A;  5IT9 K;  2MC4 A;  3KX2 A;  4IJA A;  4X0G A;  3K2A A;  3PUB A;  4OAZ A;  2XAH A;  5DYM A;  1F9N A;  2JSP A;  3W6K B;  2Y9Y A;  2QBY A;  4KMF A;  3GX4 X;  1B9N A;  2X6Y A;  1WPK A;  2OA4 A;  2PG4 A;  3DEW A;  1T33 A;  3J7A O;  1ZRD A;  1IXS B;  2E71 A;  3FK6 A;  3BR6 A;  3F8C A;  3SQN A;  4DYQ A;  1JTY A;  3K6G A;  4IVN A;  3OIO A;  3CMM A;  5HOD A;  1V5G A;  1FOK A;  3MZY A;  1JKO C;  1ZG1 A;  3CUQ B;  5FD6 A;  4FT8 A;  1BL0 A;  3IC7 A;  3PNY A;  4UY8 I;  3VWB A;  3G71 I;  2F48 A;  3G73 A;  1KQ9 A;  3IKV A;  2J5P A;  3LSK A;  3QPH A;  1XGS A;  4FQG A;  1J09 A;  4XN3 A;  4CIC A;  3OY9 A;  3BTJ A;  3CUQ C;  4CGZ A;  2E1N A;  2KHM A;  2C6Y A;  1PUF B;  4HDV A;  1OQY A;  2I10 A;  2QCO A;  4CUG A;  1QHG A;  1YIO A;  1WZ2 A;  5E1W A;  4BHB A;  3CLQ A;  4BHP A;  5IP6 A;  2ISY A;  1FLI A;  2VUM J;  2NVQ J;  4EM2 A;  4KYW A;  4B48 A;  5CLS A;  1R22 A;  2MD5 A;  3KP6 A;  4XRS G;  2GXG A;  4RGS A;  5F0H A;  2EPF A;  2DMQ A;  5IY5 H;  2WB1 A;  4F3Q A;  1A31 A;  1SFO J;  1HKT A;  1WJ5 A;  4PSW A;  5FFZ A;  2FBI A;  1DP7 P;  4KUM A;  3E6C C;  1B72 B;  2X6X A;  3BP8 A;  2KMU A;  2AS5 F;  2F5D A;  1MNE A;  4LK0 F;  3U2R A;  4XMY A;  4EVI A;  3ZP5 A;  5F6F A;  5LD2 C;  4AIH A;  3A02 A;  2MH2 A;  1ZR4 A;  4BJ5 C;  5E3M A;  1R49 A;  1TWA J;  2NXN B;  4FE7 A;  4DBQ A;  2ZNY A;  3OOU A;  3ABT A;  1STZ A;  2OPT A;  3CCS I;  2Y0S A;  3E97 A;  3ZMV A;  1QGP A;  2VBZ A;  1IC8 A;  1ODD A;  1SVO A;  4JBA A;  1GXP A;  4UVA A;  4XK4 A;  1EJ9 A;  2LY1 A;  3HTU A;  3N97 A;  3LWF A;  1IZ1 A;  4G9Y A;  3OS2 A;  3W2V A;  1Y8Q B;  4P5O A;  4CCN A;  3C2G A;  1W7P D;  3IKT A;  1R5H A;  2M8G X;  2QA4 I;  1N77 A;  2CV1 A;  1SD4 A;  3HBL A;  2X6O A;  1SAX A;  2V1N A;  3WTS C;  3CJQ B;  1BOA A;  2DYS H;  3OOP A;  4B1R A;  4ENM A;  3MQ0 A;  2VKH A;  2M34 A;  1SAU A;  4IZZ A;  4MHG A;  4KMU X;  4I76 A;  3F8F A;  1D3Y A;  3OYG A;  3BR5 A;  5IT3 A;  3K2Z A;  2FUG 2;  1L3L A;  5FKN A;  3HGY A;  3BZK A;  1RIO H;  4HBL A;  2K9Q A;  5HS8 A;  2VJI A;  4Y7N J;  1TNS A;  4HV5 A;  4NQW B;  1VQ9 I;  2MSY A;  4LIU A;  4OU0 A;  1BA5 A;  3HEF A;  2FX0 A;  3LSM A;  2BXY A;  2IA2 A;  3I53 A;  4Z6Y A;  1WCM J;  2HOA A;  2LKX A;  2WY8 Q;  1IG7 A;  2XKO A;  1EV7 A;  5ERI A;  1E3P A;  3O3K A;  5F27 A;  2H8R A;  2H6C A;  2BW3 A;  3HPH A;  4M9X A;  4FTH A;  4LLG F;  3RDI A;  4JQF A;  1V4R A;  3EYI A;  4I2O A;  2R7X A;  4G6T B;  1H8A C;  2DMT A;  4HQM A;  3GZ5 A;  1UST A;  4XID A;  2BE5 F;  2MA3 A;  3CCV I;  1N25 A;  4ESB A;  3I64 A;  1XC5 A;  1BOB A;  3L7W A;  1QZE A;  3ML6 A;  4RGR A;  3CF2 A;  2KPM A;  5E3L A;  1HF0 A;  2QYO A;  1WJE A;  2DI3 A;  4AU7 A;  5EEA A;  4BBR J;  3KYC B;  3OMY A;  3MAJ A;  3TW6 A;  4DZJ A;  2HPM A;  3G1M A;  1SVM A;  2XAF A;  3J80 K;  3WU1 B;  4BQQ A;  1IJW C;  2OJE D;  4ZYA A;  1FEX A;  1WI3 A;  4EAT A;  4PK4 A;  5TRD A;  3MWM A;  2D2W A;  4PSX A;  2GZW A;  3NRV A;  3FXQ A;  3TOB A;  5HS9 A;  2LOO A;  4M3B A;  4JYK A;  4KIC A;  1Z7U A;  3VYT B;  1Y1V J;  2ADU A;  1P2F A;  4V19 K;  3PQJ A;  4ZDL A;  1MZB A;  1WSU A;  3BWG A;  3WTY C;  2X1E A;  4QSH A;  2XSJ C;  4Q5S F;  1BIA A;  2DQL A;  2MGQ A;  2ZME C;  5LGN A;  1A5J A;  3U1D A;  1B4A A;  2P7V B;  4FX0 A;  3K70 D;  5E17 F;  1HOM A;  1K6O A;  3HM5 A;  2ME0 A;  2BXZ A;  3M07 A;  3S1R J;  4RAG A;  2LD5 A;  2HVR A;  2EK5 A;  1VQ4 I;  3B6A A;  2IS6 A;  4JX6 A;  2ZJR F;  2E7W A;  5L3E A;  2A6T A;  3N4M A;  2VQG A;  2F6C A;  2CUJ A;  2E36 A;  2HYG D;  2XAS A;  4YII A;  5K5R A;  3F6V A;  5J1R A;  3I71 A;  2R5Y A;  2CW0 F;  2XRL A;  4R79 A;  4B44 A;  1LQ1 A;  2DT6 A;  1FYM A;  3TOA A;  6PAX A;  4C2M J;  1S3J A;  2KIM A;  2A5W A;  3FDY A;  4QWQ A;  4W97 A;  1OR7 C;  2NNY A;  1QRY A;  1ETQ A;  1WVR A;  2A6H F;  2E35 A;  1I39 A;  3W2W A;  2NNN A;  3LSP A;  2GXA A;  4A3C J;  1F1Z A;  2LBF A;  2X85 A;  3S14 J;  3EUH A;  2UUZ A;  2MLK A;  3S2D J;  1VQ5 I;  4ASN A;  3WTU C;  3RPQ A;  1OCC H;  3FK7 A;  4AIK A;  3LA3 A;  3FIW A;  3ZPL A;  2Z33 A;  2K40 A;  1HLV A;  2UWM A;  3CZ6 A;  3JRE A;  4BUP A;  2AO9 A;  3O2P E;  1PUF A;  2R7D A;  2DK5 A;  1LFP A;  3BPX A;  4KIF A;  2AHQ A;  2XHK A;  4I09 A;  4HW0 A;  2Y31 A;  4K2E A;  1APL C;  1ZQ3 P;  4N9I A;  1YX3 A;  4R1H A;  3RZO J;  4JOM A;  2FBK A;  4A5N A;  1OLT A;  2D1H A;  3RKQ A;  4PJJ A;  1R00 A;  2MFZ A;  2F5E A;  1IN4 A;  5KNL A;  2TCT A;  2R3S A;  3BR1 A;  3PSF A;  2BYV E;  2CV2 A;  3ZR8 X;  3VOD A;  3UKG A;  1TBX A;  3I0T A;  1SD7 A;  1X19 A;  2VBW A;  1J2X A;  2WY7 Q;  4PJL A;  4I01 A;  4XKV A;  4XON A;  2JA5 J;  3KP5 A;  3E6M A;  2I8D A;  4RB3 C;  4I6Z A;  3WOD F;  2BY0 A;  2L9R A;  3W2A A;  4IOA F;  3H35 A;  5J4Y A;  3OR1 C;  5JR3 A;  3FMR A;  4ENK A;  4L5J A;  2JA6 J;  2NRA C;  1BR4 A;  2WC2 A;  2CFX A;  4LFU A;  4PZJ A;  2XF7 A;  1J9I A;  2IJL A;  3IWZ A;  3D5R C;  2CWE A;  2W4S A;  2E2J J;  2E2I J;  1TC3 C;  3HRU A;  2LY2 A;  3HTS B;  3MFK A;  1P7I A;  4RGU A;  2MW8 A;  2GIV A;  2H09 A;  1MH4 A;  4E7K A;  3CUO A;  1HDP A;  2DFE A;  3LSG A;  1PYV A;  2OV7 A;  4JX5 A;  5DM6 F;  2E5Z A;  1BI0 A;  1FBQ A;  1A6Q A;  1U5T A;  3A0H C;  3ZMZ A;  2GM4 A;  5GP9 A;  1LKX A;  4Q48 A;  2R7Z J;  2K02 A;  1XTA A;  5BS6 A;  3FIS A;  1FY7 A;  1VND A;  4OIQ F;  3Q0W A;  1R58 A;  2KJB A;  2NS8 A;  4A3D J;  4BAY A;  2V9V A;  2FMY A;  3RKW A;  1ZLK A;  1G3Y A;  3QOP A;  1NG7 A;  2GWR A;  2KRC A;  3GME A;  3HOY J;  2PEX A;  3HOX J;  3EUK L;  3G3Z A;  5LRR A;  3VPR A;  2FJ1 A;  4BDY A;  1ZRE A;  4EM1 A;  2K85 A;  2O8X A;  3KP7 A;  5JLW A;  2ZME A;  1MBG A;  1O3Q A;  5E3N A;  3HHG A;  1PUE E;  5J6X A;  1ZK8 A;  5DV5 A;  5ICE A;  3CJT B;  5L3F A;  4B43 A;  5JVG F;  1R23 A;  4MEX F;  2BY2 A;  2ZXW H;  3L00 A;  4DOZ A;  2EIL H;  1ZYR F;  1YHQ I;  1DQU A;  5D5V B;  2HTJ A;  3LMM A;  3BTI A;  1RES A;  4ZDP A;  1KYZ A;  3IAS 2;  2CUE A;  1IRZ A;  1YLF A;  2R7W A;  4CCL A;  4BE2 A;  3BR2 A;  4GGG A;  4FET A;  1UHM A;  1LJ9 A;  1ZG3 A;  4X1E A;  4XBF A;  4NHJ A;  1WJD A;  1HSJ A;  4BEH A;  4IHY A;  1XGO A;  3H9J A;  2DN0 A;  2V6E A;  1UG2 A;  1Y56 A;  5D8L B;  3HC7 A;  4CA0 A;  5DUI A;  3CTA A;  5EDN A;  5K5O A;  2YX4 A;  4IPA A;  1T38 A;  1MBE A;  3B73 A;  3FXR A;  3H5N A;  4EJO A;  5JLX A;  4WX9 A;  1LNW A;  4HNT A;  2PJP A;  2A69 F;  2F4O B;  2YU9 J;  2K4B A;  2UXX A;  4NUB A;  5EEG A;  2HR3 A;  5HNH A;  1GV5 A;  3LL7 A;  4L9N A;  2NVT J;  2HKO A;  3DTK A;  3H3U A;  1WI9 A;  4A3E J;  4MFE A;  4CH7 A;  4BXF A;  1JT6 A;  2JA2 A;  5K1Y A;  1O4X A;  2N8G A;  4N4N B;  3V4G A;  2D45 A;  3H5A A;  2XF6 A;  2H1L A;  3HOU J;  1H9G A;  3S1M J;  4DZP A;  3B02 A;  3KCC A;  2FQ3 A;  3WU2 C;  4HX7 A;  2QM3 A;  3KLN A;  4BS9 A;  3ZXS A;  2X51 A;  4AID A;  2EZK A;  4CCM A;  3O6B B;  1EA3 A;  2P5V A;  3GFI A;  2VPL A;  2ECC A;  2ZSI B;  3NAR A;  2HOT A;  2X1C A;  2R7V A;  5E1Z B;  4BJT A;  3I54 A;  3RYR A;  4CYC B;  2XUB A;  3G6E I;  3KLO A;  1UHS A;  5DUK A;  4E7H A;  1V3F A;  3CC2 I;  3PIO F;  3DWL E;  2VI6 A; 
#chains in the Genus database with same CATH homology
 2CSO A;  4YFK F;  3LA2 A;  4IRG A;  3PQK A;  4RS8 A;  5LHG A;  2LNB A;  2W25 A;  4Y13 A;  2GA1 A;  1BI1 A;  4EGZ A;  1XN7 A;  1S8N A;  2EFP A;  4U7D A;  4ZZD A;  1I1G A;  2FA5 A;  4GO1 A;  1IW7 F;  1TW3 A;  3H92 A;  3FHZ A;  1IRF A;  4RAY A;  3ZMD A;  1E17 A;  4P9U A;  5A2Q K;  3HHH A;  2O03 A;  1O3S A;  4M73 A;  4UUV A;  2HQN A;  4O6J A;  5CJ9 A;  3EQL F;  3P9C A;  1NHA A;  2RC4 A;  4U0V A;  3WU0 A;  2DLL A;  2VBX A;  5LEJ A;  3NQO A;  3RI4 A;  2P5K A;  2XKP A;  5IT9 Z;  4B09 A;  1BBY A;  1QZY A;  4HX4 A;  4ZYH A;  1H9T A;  4EQQ A;  1BN5 A;  2QUF A;  2VT2 A;  3ZMT A;  1FBU A;  3CUQ A;  4ON0 A;  3L2C A;  4YIF A;  5E1X A;  2DTR A;  1T2K A;  2EB7 A;  1W7P B;  3DKW A;  4KIG A;  3I59 A;  2ZCW A;  2AXL A;  4U0W A;  3WTT C;  1X3U A;  3QAH A;  1TQM A;  1YO5 C;  4I7H A;  2OD5 A;  4YFX F;  2KJC A;  3IRQ A;  1ULY A;  4PGG A;  2ESN A;  3BY6 A;  4ENN A;  2HFH A;  2QEN A;  1FYK A;  3KP3 A;  1MJA A;  4UVC A;  1LDD A;  3ULQ B;  4HA8 A;  4OIP F;  2RGV A;  2OU2 A;  3BJ6 A;  5ILS A;  1RUO A;  3VB2 A;  3SZP A;  1G6N A;  1IAW A;  1BC7 C;  2EFO A;  2P4W A;  1ON2 A;  2K27 A;  1R1V A;  5BMZ A;  4UV8 A;  1REP C;  4HZF A;  1MJ9 A;  4DNC A;  1TTY A;  4ZYG A;  3E6D A;  1IXR C;  3WG9 A;  4HDU A;  4ESJ A;  2ZBK A;  5FD5 A;  4ZYD A;  4A6E A;  5FLX Z;  1KU9 A;  1BC8 C;  3J80 Z;  5DDG A;  1Y0U A;  2XV4 S;  2A3S A;  3T8T A;  2CQK A;  1I6X A;  5LHH A;  2A6E F;  5FB2 A;  1XD7 A;  2IW5 A;  5ICG A;  1FSE A;  4JK1 X;  1G3W A;  3ECO A;  2GXB A;  4UNO A;  2OAZ A;  2Z9O A;  4KIB A;  1UCR A;  1W5S A;  4P9F A;  2DU9 A;  2JZY A;  2VN2 A;  3QU6 A;  1OPC A;  2M30 A;  3GF2 A;  1FZP B;  1BI2 A;  3FX3 A;  1K78 A;  2RDP A;  1XGN A;  3ABU A;  1GXQ A;  4HF2 A;  1FNN A;  4M9S A;  5LGU A;  5CVV A;  1HQC A;  3OV8 A;  1LVA A;  5CYV A;  4UV9 A;  3K1M A;  3JSP A;  3QP6 A;  1OMI A;  2K4J A;  4RB2 C;  1SD6 A;  2NAZ A;  5F64 A;  1KQ8 A;  3KZZ A;  3I4P A;  2DPU A;  1W4M A;  3DPT A;  4N0B A;  1ONV A;  5HOO A;  2VXZ A;  3QU3 A;  4AVP A;  2XVC A;  4EMS A;  5E20 A;  1F4K A;  1XDS A;  4OOI A;  4Y15 A;  3E5X A;  4LB6 B;  3GLX A;  1HXD A;  2ACJ A;  2HYF A;  3RPU A;  5ICF A;  2VOP A;  1U5T B;  1J7K A;  2LSO A;  3BJO A;  4S05 A;  2GAU A;  3TKY A;  4IHT A;  1XMK A;  2XAJ A;  3WGG A;  1P6R A;  4M74 A;  5HLG A;  2Z3Y A;  1HST A;  2PN6 A;  3WTV C;  1OKR A;  3SHF A;  1SFE A;  4CHU A;  4LJZ F;  1PP8 F;  3REO A;  4EM0 B;  4EJU A;  1B9M A;  5LBQ A;  2A61 A;  5CVR A;  2M1B A;  1U3E M;  3GYH X;  4Q47 A;  4I98 B;  1IRG A;  4P55 A;  2QBY B;  3GEZ A;  2VC1 A;  2OBP A;  1ZN2 A;  4CZZ A;  3HOS A;  1Z1D A;  5D5X B;  2YSR A;  4ENJ A;  1IN8 A;  2MBF A;  1K79 A;  4MTE A;  5AIP A;  1RUN A;  2JT1 A;  3W6J B;  2BV6 A;  4BYY A;  2PBI A;  3M7G A;  4G7H F;  2P6S A;  2W85 A;  4XRF A;  1XGM A;  4RB1 A;  4KA4 A;  3H3Z A;  1ZRF A;  3V8K A;  4PGH A;  4EV0 A;  3PFI A;  3U9G A;  1HW5 A;  5HDG A;  2JTV A;  2YX7 A;  3WTW C;  3CO7 C;  1YW9 A;  2L3D A;  1J59 A;  1OYY A;  3ZQ7 A;  2QQA A;  1FWZ A;  4TV7 A;  1TNT A;  2KIF A;  3COA C;  4IRH A;  5HDN A;  1ZGA A;  1Q1H A;  1QPM A;  1EH6 A;  1VTN C;  4LG0 B;  5BOX A;  2VE9 A;  2QZ8 A;  1XDU A;  3S2W A;  1LEA A;  3GFL A;  2RV8 A;  2CG4 A;  2IP2 A;  1J5Y A;  4L18 B;  2Q0O A;  1KA8 A;  4OMZ A;  1CF7 A;  1QQI A;  2VE8 A;  3LAP A;  4YFN F;  2YR2 A;  5DD4 A;  2RQP A;  3FM3 A;  2OQG A;  4WXH A;  1D8K A;  2FNA A;  2MC3 A;  2PI0 A;  4OMY A;  1KYW A;  2JRT A;  4UXN A;  3LAJ A;  1WRJ A;  3JSO A;  3MZH A;  4LB5 A;  1YYV A;  4KFC A;  5D8K B;  1O7L A;  4LLL A;  1S29 A;  4Y17 A;  2NYX A;  4A0X A;  2BGC A;  4EJW A;  1T39 A;  2QWW A;  4MQ9 F;  4ZH4 F;  3T5X A;  3C1D A;  1UFM A;  4RAZ A;  5D4R A;  5HS7 A;  4D0P A;  3GFJ A;  1R7J A;  2ISZ A;  3P9I A;  4M6X A;  1MDM B;  2WWY A;  1G4D A;  2MH9 A;  1P4W A;  1MD0 A;  2GA2 A;  3JTH A;  1AOY A;  3J81 K;  4U88 A;  4HV6 A;  4UHT A;  4M9Z A;  5ICC A;  4CXF A;  4A6D A;  4M71 A;  1CF7 B;  3HSE A;  2OZ6 A;  3FZV A;  2O6G E;  1SFX A;  2BBY A;  5HLI A;  1KU2 A;  4ZYE A;  3CDH A;  1DUX C;  2HTS A;  4HAM A;  3F6O A;  1TQP A;  1R36 A;  3MEX A;  1XSV A;  4KNY A;  5JFR A;  5D5W B;  3F72 A;  1SD5 A;  2DBB A;  4U0Y A;  5AON A;  4IRI A;  2CO5 A;  5K5Q A;  2VON A;  4ESF A;  3KP2 A;  2ELH A;  2W57 A;  4WF2 A;  2P8T A;  2ZO4 A;  1Z91 A;  4A2U A;  5L3B A;  3ELK A;  1G3T A;  3WGI A;  2IA1 A;  2WV0 A;  5H20 A;  1EH7 A;  3DF8 A;  3K0L A;  3JW4 A;  2FNP A;  1YFH A;  2YU3 A;  3SFZ A;  3K1N A;  5E8G A;  2CGP A;  2PFB A;  4G6D A;  5DCM B;  3V7S A;  3ERE D;  5E18 F;  4N9H A;  1IN6 A;  5CVI A;  1LDK B;  3T0Y A;  2CYY A;  1TQI A;  2QQ9 A;  2P5L C;  4B8X A;  4S04 A;  3I5U A;  2V1U A;  1XSD A;  3I59 B;  4EGY A;  5L3C A;  3LQR A;  2GQQ A;  2EFN A;  3KE2 A;  3ROU A;  1HBX G;  5FLX K;  2G9W A;  1YTY A;  1G3S A;  5ED4 A;  2EWN A;  2IVM A;  4O5V A;  4WWC A;  5DCF A;  3Q9S A;  1D8J A;  2XGX A;  1JHF A;  3WTX C;  3K9T A;  1L0O C;  5D4S A;  1BJA A;  2UZK A;  1YS7 A;  1K78 B;  1Z6R A;  5DEQ A;  3LA7 A;  2O0Y A;  5J8F A;  4L0Y B;  2P7C B;  4I02 A;  1IUY A;  1R5G A;  2QQB A;  4RGX A;  1ON1 A;  4E70 A;  4BNC A;  3C3W A;  5H6Q A;  5L3G A;  4XSX F;  4GCV A;  2G7U A;  5BQT A;  2PQ8 A;  4HLY A;  5LEK A;  1DPU A;  1RNL A;  4WXD A;  1IN7 A;  1OYW A;  3KEQ A;  5KK1 A;  2EFQ A;  2EV5 A;  2NS0 A;  2ZJ2 A;  1SMY F;  1R1U A;  5TJJ A;  3DQV C;  3NEU A;  3C7J A;  3V7C A;  3GFM A;  1RZ4 A;  2DFI A;  1W5T A;  4HOB A;  4A5M A;  4AIJ A;  4OIO F;  1KU7 A;  4WXC A;  1Z05 A;  3HIF A;  1XMA A;  1DPR A;  3P7N A;  3FMS A;  4R8H A;  1R1T A;  4ZZL A;  4L0Z B;  1H0M A;  5JVT A;  4GYG A;  2VOO A;  1A04 A;  3IRR A;  1P92 A;  1E2X A;  3M1E A;  2FOK A;  4NQW A;  5HVQ C;  2K86 A;  2HS5 A;  4IF4 A;  2R7F A;  1SMT A;  3WGH A;  5BPD A;  3GO5 A;  4BH9 A;  3DPL C;  2QVO A;  1CGP A;  2ZNZ A;  3KFW X;  2HDC A;  3IWF A;  4HX8 A;  5KVR A;  1UB9 A;  1EH8 A;  1LDJ A;  3J81 Z;  1QO0 D;  1YG2 A;  1WQ2 A;  3V8J A;  1W7P A;  5LRS A;  1RI7 A;  5BPI A;  3GXO A;  1FP1 D;  1P4X A;  3VOE A;  3EYY A;  1JXS A;  1BI3 A;  2RVC A;  3ECH A;  5DCM A;  3KZY A;  2A68 F;  4Q4Z F;  2V1D A;  3I58 A;  5F1R A;  4G8X A;  2HZT A;  4U7B A;  3P9K A;  3LST A;  4BXU A;  1ZH5 A;  1U2W A;  2MLG A;  2H94 A;  3HRT A;  2HOE A;  4KN7 X;  5EEH A;  4DQ2 A;  4HLX A;  2L02 A;  1O3T A;  2F5C A;  3FMQ A;  1FBS A;  1LB2 A;  3TDU C;  1QBJ A;  3WE3 A;  1IN5 A;  1XCB A;  5CVU A;  3GZ6 A;  1PDN C;  4RB0 A;  4I0B A;  2LF7 A;  5L3D A;  4UVB A;  2DPD A;  2DO7 A;  3SZT A;  4A0Y A;  5D6E A;  3L09 A;  3E5Q A;  3DP7 A;  1FC3 A;  3FXU A;  4WCG A;  4ETS A;  4LD5 A;  2STW A;  4BQA A;  2IPQ X;  3R0A A;  3F3X A;  1AWC A;  2PMU A;  2FBH A;  4G6Q A;  2L4A A;  1QZZ A;  5JI6 A;  2X0L A;  2F5F A;  3R4K A;  3VFZ A;  2IT0 A;  3DFG A;  1T0F A;  4XLN F;  5LLQ A;  1XSX A;  4KT5 C;  2HWV A;  4GXO A;  3ZN0 A;  2EJR A;  3E5U A;  2KRF A;  4G94 A;  1JE8 A;  3M8E A;  3F22 A;  2Y75 A;  3HRM A;  1B59 A;  1U6G A;  2FSW A;  1BIB A;  3WTZ A;  2EFW A;  1YS6 A;  2HGC A;  3ISP A;  2EA2 A;  2COM A;  2PLY A;  3TDZ C;  2RKH A;  4CYD A;  3BZ6 A;  3FF5 A;  2XIG A;  5DD8 A;  2A5Y B;  4IXA A;  1TW2 A;  4EJV A;  3GUD A;  4BHC A;  3F23 A;  3HSR A;  2VBY A;  2LKP A;  2P6T A;  1U5T C;  3E3V A;  4HF1 A;  3RKY A;  3Q5F A;  4LG0 A;  4MGR A;  2E1C A;  1MDM A;  1ZGJ A;  1HKS A;  5LGT A;  3E6B A;  3GWZ A;  1FYL A;  1ZAR A;  3R61 A;  3ZMS A;  3M8F A;  1HKQ A;  5A2Q Z;  2PMH A;  3QP5 A;  2RN7 A;  3C18 A;  2VOD A;  3L9F A;  2OQR A;  2BEO A;  1I27 A;  4LGW A;  2ESH A;  1USS A;  4FX4 A;  4HF0 A;  4H0E A;  1HW2 A;  4QLC U;  1IF1 A;  2V1X A;  4XLP F;  1Z9C A;  2TDX A;  5ILU A;  1KGS A;  2FXA A;  1O7F A;  4KN4 X;  4I0A A;  3TGN A;  2M45 A;  2E7X A;  2WTE A;  2ZME B;  3WE2 A;  4MQV A;  1D5V A;  4KDP A;  3ZN1 A;  3MCZ A;  1PP7 U;  2Z99 A;  2DK8 A;  3BRO A;  3VEP A;  4L9J A;  3RJP A;  2ETH A;  4MNU A;  2FML A;  1OYI A;  2X4H A;  4IHS A;  2Q2E A;  5D5U B;  2JPB A;  3DEU A;  2LDU A;  2K7L A;  3IL2 A;  4EJT A;  3RTR A;  4HQE A;  3RYP A;  1WWX A;  3RIR A;  4G7O F;  2F2E A;  4Z2Y A;  3K1P A;  1YQA A;  1GVJ A;  1WKM A;  3V8L A;  3KP4 A;  1UHW A;  3BJA A;  4G7Z F;  4MEY F;  3KET A;  3BDD A;  5E8I A;  2M5W A;  1HW1 A;  3KEO A;  2DW4 A;  3D0S A;  3LFK A;  2XRO A;  2B0L A;  5H6R A;  2YPR A;  2G7H A;  2V6C A;  2ZKZ A;  2LF8 A;  4LMY A;  3JTG A;  2DQR A;  1ZLJ A;  4A0Z A;  4LLN A;  4L9T A;  1FSH A;  3HYI A;  5JHU A;  1ZG5 A;  1T98 A;  2DT5 A;  2Y48 A;  5ILV A;  1C0W A;  2L01 A;  4M72 A;  3JAM Z;  1K7A A;  3LQQ A;  3M9A A;  3R60 A;  4P96 A;  3TO7 A;  2VC0 A;  1F5T A;  2HQR A;  3AAF A;  4FHT A;  3D5L A;  2XRN A;  3QRF F;  1B6A A;  5LHI A;  2STT A;  2V79 A;  3CLO A;  2Q8K A;  1S7A A;  2L4M A;  2VT3 A;  5HDK A;  2W24 A;  4XSZ F;  2XAQ A;  2W84 A;  2Y0M A;  1IXC A;  3HUG A;  1FP2 A;  3TO6 A;  2O61 A;  1P4A A;  2RNJ A;  1O3R A;  2EV6 A;  1SFU A;  3JAM K;  3V7R A;  1JGS A;  2D1V A;  2ZFW A;  2JSC A;  5FGM A;  1ZRC A;  2KIU A;  3HOT A;  2M8E A;  5CVJ A;  4M6Y A;  2IA0 A;  2Z5U A;  4CO8 A;  4L9V A;  1XB4 A;  2HKX A;  3CO6 C;  2H6B A;  1JHH A;  2FE3 A;  3R0J A;  5AIQ A;  4AWX B;  2ZXJ A;  2OZU A;  4CDG A;  2QLZ A;  3SXY A;  1QNT A;  3F8B A;  1J0R A;  3R6S A;  1KU3 A;  4OIR F;  4MTD A;  4WK8 F;  1BM9 A;  3IHU A;  4A12 A;  5FFX A;  1MKM A;  2XAG A;  3DXJ F;  4L5I A;  5FO5 A;  3T1B A;  1O57 A;  3GW2 A;  2JPC A;  3HRS A;  2J5O A;  1U8R A;  1YW8 A;  2L54 A;  1J75 A;  3EET A;  3GVA A;  4YG2 F;  1MJB A;  3F21 A;  5J8C A;  3DV8 A;  3RKX A;  2FF4 A;  1U78 A;  1FT9 A;  3F8M A;  1XCV A;  2FRH A;  3HSF A;  1TLH B;  4GYI A;  2FEZ A;  2UXN A;  2H27 A;  2M87 A;  3ZMU A;  1FX7 A;  1Z6T A;  2HEO A;  1FPQ A;  1I5Z A;  3QPT A;  3TQN A;  2IRF G;  5D6F A;  3F8N A;  3Q9V A;  1ZHF A;  2FU4 A;  3EDP A;  3BOQ A;  4OIN F;  1I1S A;  2O3F A;  4PDK A;  1MGT A;  4NB5 A;  3BPV A;  1LEB A;  1KQ0 A;  1YW7 A;  1ZAO A;  3CJN A;  3TO9 A;  3T8R A;  3K69 A;  1DDN A;  1S7O A;  2A07 F;  2EV0 A;  2DAO A;  1T6S A;  1GHC A;  4F7Z A;  1S6L A;  4PCQ A;  2KKO A;  3FM5 A;  4AD9 A;  4LK1 F;  1OR7 A;  1B1B A;  2EA4 A;  5HLH A;  3FWE A;  4HYE A;  4O3M A;  5IT9 K;  4IJA A;  2XAH A;  5DYM A;  1F9N A;  3W6K B;  4KMF A;  2QBY A;  3GX4 X;  1B9N A;  2OA4 A;  2PG4 A;  3J7A O;  1ZRD A;  1IXS B;  3F8C A;  3SQN A;  4IVN A;  1FOK A;  3MZY A;  1ZG1 A;  3CUQ B;  5FD6 A;  4FT8 A;  3IC7 A;  3G73 A;  1KQ9 A;  3IKV A;  2J5P A;  3QPH A;  1XGS A;  4CIC A;  4CGZ A;  3CUQ C;  2E1N A;  2C6Y A;  4HDV A;  1YIO A;  5E1W A;  4BHB A;  4BHP A;  2ISY A;  1FLI A;  4EM2 A;  4KYW A;  5CLS A;  1R22 A;  2MD5 A;  3KP6 A;  2GXG A;  4RGS A;  1HKT A;  5FFZ A;  2FBI A;  1DP7 P;  4KUM A;  3E6C C;  3BP8 A;  2AS5 F;  2F5D A;  4LK0 F;  3U2R A;  4EVI A;  3ZP5 A;  5F6F A;  4AIH A;  2MH2 A;  2ZNY A;  3ABT A;  1STZ A;  3E97 A;  3ZMV A;  1QGP A;  2VBZ A;  1ODD A;  4JBA A;  1GXP A;  4UVA A;  3HTU A;  3N97 A;  3LWF A;  1IZ1 A;  4G9Y A;  4P5O A;  1W7P D;  3IKT A;  1R5H A;  1SD4 A;  1SAX A;  3WTS C;  3OOP A;  1BOA A;  4ENM A;  3MQ0 A;  4MHG A;  4KMU X;  3F8F A;  1D3Y A;  5IT3 A;  3K2Z A;  1L3L A;  1RIO H;  4HBL A;  5HS8 A;  1TNS A;  4HV5 A;  4OU0 A;  2IA2 A;  3I53 A;  2XKO A;  1EV7 A;  5ERI A;  3O3K A;  2H6C A;  4M9X A;  4LLG F;  3RDI A;  4JQF A;  1V4R A;  3EYI A;  4I2O A;  4HQM A;  3GZ5 A;  1UST A;  2BE5 F;  2MA3 A;  4ESB A;  3I64 A;  3L7W A;  3ML6 A;  4RGR A;  2QYO A;  2DI3 A;  3MAJ A;  2XAF A;  3J80 K;  3WU1 B;  5TRD A;  3MWM A;  2D2W A;  3TOB A;  2GZW A;  3NRV A;  3FXQ A;  5HS9 A;  4KIC A;  1Z7U A;  2ADU A;  1P2F A;  3PQJ A;  1MZB A;  1WSU A;  3BWG A;  3WTY C;  4Q5S F;  1BIA A;  2DQL A;  5LGN A;  3U1D A;  1B4A A;  2P7V B;  4FX0 A;  5E17 F;  1K6O A;  2EK5 A;  2E7W A;  5L3E A;  3N4M A;  2HYG D;  2XAS A;  4YII A;  5K5R A;  3F6V A;  3I71 A;  2CW0 F;  4R79 A;  1LQ1 A;  1FYM A;  3TOA A;  6PAX A;  1S3J A;  2KIM A;  4QWQ A;  2NNY A;  2A6H F;  2NNN A;  1F1Z A;  3EUH A;  2MLK A;  4ASN A;  3WTU C;  3RPQ A;  4AIK A;  3LA3 A;  3ZPL A;  2Z33 A;  2UWM A;  3O2P E;  2R7D A;  2DK5 A;  3BPX A;  4KIF A;  2XHK A;  4I09 A;  4HW0 A;  4K2E A;  4N9I A;  4R1H A;  2FBK A;  4A5N A;  2D1H A;  1R00 A;  2F5E A;  1IN4 A;  2R3S A;  2BYV E;  3VOD A;  1TBX A;  3I0T A;  1SD7 A;  2VBW A;  1J2X A;  4I01 A;  3KP5 A;  3E6M A;  4RB3 C;  3WOD F;  5JR3 A;  4ENK A;  3FMR A;  4L5J A;  2NRA C;  2WC2 A;  2CFX A;  4LFU A;  4PZJ A;  1J9I A;  2IJL A;  3IWZ A;  2CWE A;  3HRU A;  3HTS B;  3MFK A;  4RGU A;  2H09 A;  2GIV A;  3CUO A;  1BI0 A;  1FBQ A;  1U5T A;  3ZMZ A;  4Q48 A;  2K02 A;  5BS6 A;  1FY7 A;  4OIQ F;  1R58 A;  2KJB A;  4BAY A;  2V9V A;  1ZLK A;  2FMY A;  3RKW A;  1G3Y A;  3QOP A;  2GWR A;  2PEX A;  3G3Z A;  5LRR A;  1ZRE A;  4EM1 A;  2O8X A;  3KP7 A;  2ZME A;  1O3Q A;  3HHG A;  1PUE E;  5J6X A;  5DV5 A;  5ICE A;  5L3F A;  1R23 A;  4MEX F;  3L00 A;  1ZYR F;  5D5V B;  2HTJ A;  1KYZ A;  1YLF A;  4GGG A;  4NHJ A;  1UHM A;  1LJ9 A;  1ZG3 A;  4XBF A;  1HSJ A;  1XGO A;  5D8L B;  5DUI A;  3CTA A;  5K5O A;  2YX4 A;  4IPA A;  1T38 A;  3B73 A;  3FXR A;  4WX9 A;  4EJO A;  1LNW A;  2PJP A;  2A69 F;  2K4B A;  2UXX A;  5EEG A;  2HR3 A;  4L9N A;  2HKO A;  3H3U A;  1WI9 A;  5K1Y A;  3V4G A;  2D45 A;  1H9G A;  3B02 A;  3KCC A;  2FQ3 A;  4HX7 A;  2QM3 A;  3KLN A;  3O6B B;  2P5V A;  3GFI A;  5E1Z B;  3I54 A;  3RYR A;  2XUB A;  3KLO A;  5DUK A;  1V3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...