5FGMA

Streptomyces coelicolor sigr region 4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
LPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ECF RNA polymerase sigma factor SigR
publication title In Streptomyces coelicolor SigR, methionine at the -35 element interacting region 4 confers the -31'-adenine base selectivity
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5fgmA00
1PP8F 2K7LA 3ZQ7A 5F6FA 4HBLA 3CUQC 4KN4X 2AXLA 2LKPA 4LK0F 2E1CA 2KIFA 2VBXA 4EGZA 4LLLA 4I09A 3I71A 5BS6A 2DU9A 4NQWA 3HSFA 3IKTA 1FBQA 3R6SA 1W5SA 3M8FA 2STWA 1QBJA 3RPQA 3KP6A 4HA8A 1G3SA 3LWFA 5E18F 2WV0A 2XASA 1B59A 2RC4A 2L4MA 4R79A 2GA1A 4M71A 1YFHA 3TKYA 1BI0A 2D1VA 5LRSA 1DP7P 2Q2EA 1HBXG 5HVQC 5ED4A 3JSPA 2ZFWA 4ENJA 3I64A 2FRHA 4UVBA 1W7PA 1REPC 3ZMTA 3F8CA 2IRFG 1T0FA 4YFKF 2DK8A 1IAWA 2E1NA 2W85A 2L02A 3HRTA 3G3ZA 4A0XA 1FYLA 4G7HF 4AIKA 3RDIA 3JTGA 4HV5A 3GO5A 2WTEA 2R7DA 1DDNA 2HYFA 2P8TA 1H0MA 3GFIA 1STZA 3B02A 2PEXA 2GWRA 3CLOA 2HFHA 1ZYRF 2ELHA 1HSJA 5DCMA 2QVOA 4CZZA 2VONA 4TV7A 2A61A 4EJUA 2ZKZA 3DFGA 1QPMA 2FBHA 4LK1F 4EGYA 3C3WA 4U0YA 2DAOA 2MLKA 4F7ZA 2HDCA 4A12A 3O2PE 3MEXA 4GCVA 5HLGA 1FSEA 2COMA 5K5RA 1B1BA 5DD8A 1ZRCA 2XAQA 3ZP5A 5CJ9A 3DPTA 4HDVA 2HKOA 4MGRA 2RNJA 4YIFA 3EYIA 1IN8A 1JE8A 3DV8A 2GZWA 3TO6A 4L0YB 3N4MA 1P4WA 4PGGA 2R3SA 4EJWA 2QQAA 4BYYA 3OOPA 2B0LA 2PLYA 4MQVA 5D8KB 5LEKA 3GFJA 4I02A 2CG4A 2RV8A 4G7ZF 4B09A 4OMYA 4RGXA 4O3MA 3V7RA 1KU2A 4YFXF 2BYVE 4GXOA 4EJVA 1G4DA 1J75A 3FXRA 2IA0A 4ETSA 3GZ6A 3KZZA 2W24A 3DKWA 4WK8F 1HSTA 4LD5A 2P7VB 4G6DA 2PG4A 2NRAC 4A6EA 5HS9A 2G7HA 5LGTA 4P9FA 2A5YB 2OZ6A 1HW5A 3F3XA 4ASNA 2ZNZA 3WTXC 4ZYGA 4AWXB 1R7JA 2ESHA 2IVMA 1O3TA 4B8XA 4H0EA 3ERED 2V1UA 1LJ9A 4L5IA 4U88A 2VT3A 2OQGA 3GEZA 4R1HA 1D8KA 4HF1A 4L5JA 5CVUA 3KP7A 5A2QZ 2IPQX 2VBWA 2XAGA 4M74A 1TQPA 2MBFA 4ZYEA 1R23A 4L0ZB 2PFBA 1BN5A 4QWQA 1J59A 2F2EA 4JQFA 2A69F 1PDNC 1QQIA 2IT0A 4JBAA 3F23A 4E70A 2VE9A 3GXOA 4IRGA 1SFUA 3BJAA 3FX3A 2DPUA 2ZNYA 3SZTA 1CGPA 5JFRA 1K78A 4HQMA 4OIPF 1FPQA 4FT8A 1KQ9A 4HF2A 2XGXA 4KMFA 4PCQA 3D5LA 5FO5A 1IW7F 2Z3YA 1SD5A 5E1WA 4Q5SF 4CXFA 4IRIA 2EA4A 2HS5A 4OIRF 3ABUA 3RIRA 1U6GA 3FM5A 3V8JA 3J80Z 1BI3A 1TBXA 3E97A 2YX4A 1R36A 3V7CA 2P6TA 3IRRA 3K9TA 4LB6B 1KQ8A 2HTSA 3F72A 1FBSA 2V1DA 5FB2A 1ZG1A 2M1BA 2CFXA 3J7AO 5L3FA 1SMTA 5AIQA 5BPDA 3R4KA 1CF7A 1S7OA 4MTDA 2FNPA 1T2KA 4PGHA 2O61A 1FNNA 1JHFA 1QO0D 2GAUA 1W7PD 1F4KA 1R5HA 2QUFA 5HDNA 5E1ZB 3QPTA 2BE5F 5ICCA 1HKSA 1XDSA 1F9NA 3R60A 2EJRA 4KT5C 4EV0A 1QZYA 2EB7A 2VODA 5ILSA 3MZHA 1TQMA 2M8EA 2LSOA 2EWNA 4CGZA 1LEAA 4HAMA 1G3WA 1H9GA 4AVPA 4P96A 2FMYA 1I1SA 2PMUA 2H6CA 5CLSA 3HSEA 4LMYA 3RPUA 1SFXA 1WRJA 4R8HA 2KIMA 1I6XA 2KRFA 2O3FA 1V3FA 1P4XA 3RI4A 1MDMA 2XKPA 3KLNA 1LVAA 2DQRA 3QRFF 2YSRA 2VC0A 5D5UB 4AIHA 3IC7A 1I27A 1QZZA 4KMUX 2RDPA 1IF1A 4ENKA 1K78B 4WWCA 1USSA 1DUXC 1KU3A 2CWEA 1WQ2A 3HUGA 3QU3A 4BHCA 2JPBA 2F5EA 2ADUA 3GLXA 3KZYA 2EV6A 1P2FA 5L3GA 2EFWA 3I5UA 1U5TA 2ZJ2A 4ZZLA 4I0BA 2QQBA 2F5CA 2DK5A 2HOEA 3IL2A 1EH7A 3T8RA 2DTRA 3BY6A 2VT2A 3QOPA 4UV8A 4ESBA 3EQLF 4GO1A 3VB2A 1GHCA 3NRVA 2BEOA 4N9IA 1CF7B 2JTVA 2V79A 4UXNA 3GF2A 1O3SA 2IP2A 1FP1D 4RAYA 1ODDA 2F5DA 2Q8KA 1HKQA 1X3UA 4GGGA 1SAXA 2K4JA 3GYHX 2K4BA 4L18B 2Z33A 4YIIA 3M7GA 3RKWA 2HTJA 2DFIA 1BBYA 1WSUA 5FD5A 4U7BA 1R22A 3IHUA 2BGCA 3DQVC 1L3LA 3WU1B 1HXDA 1Z7UA 1JXSA 2VN2A 1AWCA 3GWZA 4KICA 3VODA 3V8KA 2QBYA 4KDPA 3F6VA 2VBYA 2EFPA 2QQ9A 5CYVA 3K2ZA 4WCGA 1EV7A 4YFNF 1FT9A 4CICA 4AD9A 4Q48A 3E5XA 4EM2A 5D6EA 2DLLA 2OBPA 1MDMB 4OIOF 1RNLA 2K27A 3SHFA 4Q4ZF 5JR3A 4RS8A 3MFKA 1BOAA 3J81K 2VXZA 4EJOA 3RYPA 1FLIA 4ZH4F 5LBQA 4L9NA 3QAHA 1T38A 2QZ8A 1U5TB 4Z2YA 3HTSB 2V9VA 5K1YA 1J7KA 1GVJA 1ZLKA 4RB2C 2DPDA 1IRFA 1YS6A 3RJPA 1O3QA 3TDZC 1YQAA 3ZPLA 1W5TA 1IN6A 4GYGA 2PJPA 3PQKA 3FHZA 3F21A 4LG0A 1S3JA 1OMIA 1ULYA 3HRMA 5FD6A 1Z1DA 3W6KB 4ZYHA 1E17A 3C18A 2P5LC 3BZ6A 3VOEA 3WODF 1OYIA 2P5VA 3D0SA 3R0AA 3EETA 1F5TA 4HW0A 1TW2A 4HX8A 4BNCA 5CVRA 5D5VB 1R1TA 2W84A 5TJJA 2XUBA 3E6BA 1G3YA 1SD4A 2MLGA 5ICFA 2QBYB 3BJOA 1VTNC 2YX7A 4OU0A 3Q5FA 5K5QA 1U78A 4I0AA 3ZN0A 5E8IA 3BPVA 4IRHA 4EMSA 3DPLC 2OQRA 3IWZA 1Q1HA 2EFQA 3K1PA 3GUDA 2FA5A 2QLZA 3DP7A 3ECOA 3ZMVA 1BI1A 2Y0MA 5D4RA 2QWWA 2JZYA 1FC3A 3MAJA 5HOOA 3T0YA 4EQQA 4NB5A 3R61A 2ACJA 4ZYDA 4FX4A 2HWVA 2MA3A 3FXUA 4I01A 3F8MA 2RGVA 2NNYA 5FLXK 5J8CA 3KP3A 3FMSA 1HW2A 3T8TA 2UWMA 5CVVA 4ENNA 5AONA 4D0PA 2G9WA 1W7PB 1S8NA 3F22A 1R00A 2HQNA 2CSOA 3QPHA 5DV5A 3IKVA 4BHBA 4HOBA 2JPCA 1MD0A 3L9FA 3Q9VA 2HR3A 2RQPA 2EV0A 1R1UA 2K86A 1EH6A 3CUQA 3WE2A 4M9SA 1WWXA 1P6RA 1U2WA 2PQ8A 3F8NA 2RN7A 2O8XA 2O6GE 2Z5UA 2XVCA 5DCMB 4LLNA 4HQEA 3PFIA 3WTWC 2H27A 4HX4A 2FXAA 4RGSA 3F8FA 1MZBA 3MCZA 3E6DA 1U5TC 2M45A 3F6OA 1LQ1A 4N0BA 1FOKA 1J2XA 3EUHA 1XCBA 2STTA 4XSXF 3BROA 2CYYA 1RUOA 2FU4A 3IWFA 4LJZF 1FBUA 1MGTA 5AIPA 3JAMK 2W57A 3KP5A 5L3DA 3G73A 5F64A 2OD5A 1SMYF 1FWZA 5L3CA 3WG9A 2QENA 2ZXJA 4IHTA 1QGPA 3ZN1A 5LGNA 2X0LA 3VFZA 1LDKB 1SD7A 4KA4A 1ZHFA 1ZLJA 4RAZA 3MZYA 2H6BA 2XV4S 1XB4A 1IZ1A 4M9XA 2FBKA 4RB1A 1B6AA 3ZMUA 1J5YA 2DO7A 3TOAA 4WX9A 2GXBA 3EYYA 5H6RA 2E7WA 1IXCA 1I1GA 2XAHA 3E6CC 1ZAOA 1Z9CA 2ZMEA 3H92A 2KIUA 5D6FA 1J0RA 1XSVA 2P7CB 5BOXA 2X4HA 2NAZA 1LB2A 2A6HF 2KJBA 1R5GA 4CDGA 4EM0B 4HYEA 1YW8A 1UB9A 3U1DA 3CO6C 3DXJF 5H6QA 4I2OA 3ECHA 3GFLA 4N9HA 4L9JA 2P6SA 1XGNA 2GA2A 2VE8A 3CUQB 2R7FA 4HDUA 1TNSA 3CO7C 5ILUA 3TO9A 2KJCA 1O7FA 5BQTA 4OMZA 4OIQF 3F8BA 1SFEA 4FHTA 4WXDA 2XROA 3GFMA 5BMZA 3CJNA 3JW4A 4ZZDA 1ONVA 3LQRA 4P55A 2VOOA 5KVRA 3R0JA 3QP6A 3M1EA 1YIOA 2DQLA 3BWGA 3E3VA 2D2WA 3M8EA 3NQOA 4P5OA 1IN7A 1UHMA 3MQ0A 1TNTA 1KU9A 3L09A 5LEJA 1R1VA 4HF0A 3I0TA 4S04A 5DYMA 2W25A 3KP4A 1F1ZA 5BPIA 2H09A 3JTHA 3I59A 2L3DA 3WU0A 2YPRA 2F5FA 4L9VA 3O6BB 1I5ZA 3FZVA 1XGSA 2WC2A 1HW1A 2FSWA 3HRSA 1BJAA 4ENMA 1XGMA 1DPRA 2D45A 4HZFA 2DW4A 1TTYA 4OINF 2ZO4A 3ROUA 1ZREA 2FF4A 3WGHA 1XCVA 2EFNA 4M72A 2ZMEB 2K02A 5D5XB 2A68F 3BJ6A 4XBFA 4UV9A 4MEXF 4EM1A 4P9UA 4BH9A 1O57A 3HIFA 4A0YA 4A6DA 1T98A 3P9IA 1YW7A 4KN7X 3REOA 5E8GA 2OA4A 1BM9A 4U0WA 5FFZA 2UXXA 1J9IA 2XAFA 3ZMDA 1S29A 5ICGA 4IF4A 3HSRA 2PMHA 1BC8C 4M9ZA 4QLCU 4G8XA 1D3YA 4WF2A 2HQRA 1ON2A 2MC3A 3HOTA 2FBIA 5E17F 2P4WA 4JK1X 4O5VA 4XSZF 3WTTC 4ESJA 3KEQA 2DBBA 5IT9K 2TDXA 3KETA 2G7UA 1ZN2A 3J81Z 2NYXA 2XHKA 3Q9SA 5JVTA 1NHAA 3TO7A 1XMAA 3I53A 3M9AA 3ZMSA 2EV5A 4MHGA 3ULQB 4RB3C 5KK1A 5HS8A 1KQ0A 3HOSA 3CDHA 2FE3A 3I59B 1Z05A 2YU3A 4U0VA 2KKOA 3RTRA 4FX0A 3TDUC 1RUNA 3ML6A 3GZ5A 1R58A 3KLOA 1UHWA 1XSXA 2FQ3A 1OR7A 4LB5A 3L2CA 1BI2A 3LSTA 1IN5A 3WGIA 2P5KA 2IJLA 3HHHA 1ZH5A 5DDGA 2VC1A 5J6XA 2XIGA 2JT1A 4KYWA 5HDKA 1S6LA 3I54A 3E5QA 5D4SA 5FGMA 3WTYC 5LRRA 5DEQA 2YR2A 1Z6RA 4L9TA 2DT5A 4LFUA 3ELKA 3WE3A 5DUIA 4M6YA 5JI6A 4IHSA 4ESFA 3WTVC 2GXGA 1FSHA 4HV6A 3SQNA 2JRTA 5TRDA 3EDPA 3P7NA 3S2WA 1RIOH 1LDJA 2CQKA 2V1XA 4UVCA 1TLHB 4DNCA 4CYDA 5FFXA 2O0YA 1D5VA 3CTAA 1YG2A 4M6XA 3QP5A 3KE2A 4A5MA 3T1BA 4NHJA 3FMRA 1OPCA 2IA2A 3U2RA 3TOBA 1IRGA 3KP2A 4Y15A 3RKXA 5D5WB 3RKYA 4UNOA 2XKOA 5L3EA 4KIFA 2CO5A 2LNBA 2ESNA 1YLFA 2QM3A 5FLXZ 4UUVA 3LFKA 4IVNA 5IT3A 1U3EM 3WTZA 2D1HA 4WXHA 2CGPA 2L4AA 2E7XA 1TW3A 1ZRFA 2RKHA 2WWYA 2FOKA 2NNNA 5D8LB 3TQNA 5K5OA 4RGRA 2L54A 5CVJA 2M5WA 2LF8A 3E5UA 1FX7A 4CHUA 4MQ9F 3E6MA 4YG2F 2PBIA 2OU2A 1K7AA 2NS0A 3V8LA 1WKMA 1C0WA 1P4AA 1B9NA 1H9TA 1V4RA 3C1DA 4LLGF 1ZG5A 1G3TA 2OZUA 1KU7A 4XRFA 2LF7A 4KFCA 2AS5F 1ZGJA 2HKXA 5L3BA 1IUYA 3JSOA 1JHHA 3DEUA 4LGWA 1ZG3A 2A6EF 2ISZA 4LG0B 3LA3A 1GXPA 5DCFA 3SXYA 4MNUA 1USTA 4PDKA 4IXAA 4UHTA 3FF5A 3JAMZ 3V7SA 1A04A 3KEOA 1BC7C 1XMKA 1YTYA 1MJBA 3BOQA 4KIGA 5EEGA 2HYGD 1IXSB 2PN6A 3WTSC 1ZARA 1K79A 2FMLA 1L0OC 1TQIA 1OKRA 3FMQA 4OOIA 2EK5A 4BAYA 4XLPF 3C7JA 2JSCA 3K1MA 3GVAA 1G6NA 1HKTA 1MKMA 2DI3A 4I7HA 1LDDA 1S7AA 2Y48A 1XGOA 5LHHA 3KCCA 3U9GA 1OYYA 2GQQA 3SFZA 1BIAA 5HDGA 4G9YA 2OAZA 4O6JA 5A2QK 3LA7A 2Y75A 2ZCWA 3VEPA 1ZGAA 3CUOA 6PAXA 4A0ZA 5LLQA 2CW0F 2MH9A 4Y13A 5ICEA 3W6JB 1YS7A 4PZJA 1UFMA 1ZRDA 3HYIA 1IN4A 5E20A 1YYVA 3BPXA 2EFOA 3FXQA 3GW2A 3H3ZA 1FYKA 3OV8A 2XAJA 5EEHA 3WGGA 1XDUA 3PQJA 1W4MA 2UZKA 4KNYA 3RYRA 4AIJA 4Q47A 3ISPA 3P9CA 1LNWA 4A2UA 4A5NA 2O03A 5CVIA 3LQQA 4RGUA 2IW5A 4I98B 2M30A 1Z6TA 1O3RA 4M73A 4S05A 1AOYA 3P9KA 5ILVA 3J80K 3FM3A 2J5OA 2MH2A 5J8FA 1P92A 4BHPA 2GIVA 1FP2A 5H20A 1Y0UA 4HLXA 4WXCA 1DPUA 5JHUA 1KYZA 4UVAA 3FWEA 4HLYA 4G7OF 4EVIA 1HQCA 4U7DA 3LAPA 3BP8A 1KGSA 3COAC 1SD6A 2BBYA 3QU6A 1KA8A 4CO8A 2ETHA 1FY7A 5DUKA 4BQAA 3T5XA 4DQ2A 2UXNA 3LAJA 4HX7A 1JGSA 4Y17A 1XN7A 5LGUA 4KUMA 3I58A 1PP7U 1B4AA 1Z91A 2J5PA 3IRQA 2VBZA 3BDDA 4IPAA 3B73A 3DF8A 4KIBA 3V4GA 1PUEE 2V6CA 1MJ9A 2IA1A 4MTEA 2RVCA 4BXUA 3AAFA 3WTUC 2HGCA 1E2XA 2XRNA 1RI7A 3MWMA 4EJTA 2VOPA 2FEZA 4MEYF 3TGNA 3ZMZA 1GXQA 3I4PA 3HTUA 2Z9OA 1ON1A 4G6QA 2L01A 3GX4X 3K1NA 3N97A 3HHGA 4ON0A 5HLIA 2A07F 2HZTA 5LHIA 3H3UA 3HRUA 1UCRA 2QYOA 1YO5C 3O3KA 2Q0OA 2ZBKA 3K69A 1LEBA 2ISYA 3NEUA 1T39A 2MD5A 3KFWX 1O7LA 5HLHA 5HS7A 5F1RA 3K0LA 3LA2A 4K2EA 1B9MA 3L7WA 4GYIA 1YW9A 2BV6A 2Z99A 4XLNF 1T6SA 1OYWA 3SZPA 2EA2A 1FYMA 4IJAA 1XD7A 1EH8A 1WI9A 4RB0A 5IT9Z 1IXRC 5E1XA 2PI0A 5DD4A 1K6OA 2C6YA 5ERIA 1BIBA 2FNAA 2M87A 1MJAA 1U8RA 1XSDA 1D8JA 1RZ4A 5LHGA 2A3SA 4G94A 3L00A 1KYWA 2H94A 3ABTA 1FZPB 1QNTA 2HEOA 2LDUA
chains in the Genus database with same CATH superfamily
3I56I 1PP8F 2JSPA 1A6IA 4UUSA 2MW8A 3ZXSA 1BA5A 2Y0SA 2K7LA 3ZQ7A 5F6FA 2Q1ZB 4HBLA 2JVGA 1U9NA 5CQEA 3GLLA 3PFYA 3BG9A 3CUQC 4KN4X 2AXLA 1RPWA 2LKPA 3E7LA 4LK0F 2E1CA 2KIFA 2QEXI 2VBXA 3MKZA 1YRNA 2L7FP 4DBRA 3D1NI 3I4NJ 2QA4I 4EGZA 3FKIJ 4LLLA 3BR3A 1F43A 4I09A 2R92J 3I71A 2OV7A 1VQ8I 1UJ8A 4B47A 3DPUA 1ETQA 5BS6A 2QKLB 4ABZA 2XGCA 2DU9A 4AM3A 3SZGA 1MSEC 3O8GA 4NQWA 4XOPA 2LLKA 3HSFA 3IKTA 1FBQA 3R6SA 1W5SA 1R4MB 3M8FA 2STWA 2L7MP 3S1RJ 1QBJA 2XPUA 2ZB9A 1SANA 2V9PA 3RPQA 2NVQJ 3KP6A 5M5YJ 4HA8A 2VPLA 3DTKA 1G3SA 3CJTB 3LWFA 3G1LA 4QSHA 5E18F 2WV0A 2XASA 1K4SA 1Y8RB 1B59A 2RC4A 4LOCA 3K4JA 2KDZA 2L4MA 4R79A 1JT6A 3QYFA 2GA1A 4M71A 3H0DA 5K7ZA 1YFHA 3GBGA 2K9LA 3SDBA 3TKYA 1BI0A 3MKWB 2D1VA 5LRSA 3K4NA 1DP7P 2Q2EA 1HBXG 5HVQC 3CCEI 4BU2A 5ED4A 3JSPA 2ZFWA 4ENJA 1WJCA 3I64A 2I8DA 2FRHA 3JRHA 4BACA 4UVBA 1W7PA 2XB0X 1WJAA 2DOAA 2CQNA 1REPC 3ZMTA 3F8CA 4HSRA 2IRFG 3OWTA 3JRFA 1T0FA 1RKTA 1EKEA 3LSJA 5FKOA 4YFKF 4M3BA 2DK8A 2WAEA 1IAWA 2E1NA 4BY1J 4QPOA 2W85A 2VLAA 2L02A 3HRTA 3G3ZA 4A0XA 1FYLA 4G7HF 4AIKA 3W3CA 3RDIA 1YITI 3JTGA 3A1YA 1UMQA 3CCLI 2E19A 4HV5A 3GO5A 1YOVB 2DFFA 2WTEA 4C9YA 2E2HJ 2R7DA 1DDNA 2HYFA 2P8TA 1RR8C 3A01A 3GFIA 1H0MA 3K4CA 1STZA 3B02A 2PEXA 2GWRA 4GDFA 2F4OB 3CLOA 2HFHA 1ZYRF 3K70D 2CV1A 2ELHA 1UG2A 5FKLA 3BR1A 4JP0A 1HSJA 5DCMA 2QVOA 5LFAA 4ZC3A 4CZZA 4BGDA 3Q0VA 2PJRB 4XR6A 4BE0A 1TWGJ 2VONA 5EF6A 1UZCA 4TV7A 1X2MA 2A61A 2DMQA 4EJUA 2ZKZA 3SYTA 3BLYA 2KRHA 5JLWA 1WGXA 3DFGA 2MD0A 1QPMA 4M3FA 2FBHA 4LK1F 5M5XJ 4EGYA 3H9JA 2VJIA 3LSIA 2LMDA 3C3WA 4U0YA 1W5CC 1VQLI 2DAOA 2MLKA 1Z3XA 4F7ZA 2HDCA 4A12A 3O2PE 3MEXA 3OMYA 4GCVA 2UV1A 2Y30A 5HLGA 3OYMA 2CUZA 1XPXA 1FSEA 1MBJA 2EZHA 4E7SA 2COMA 3QWLA 3HOWJ 5K5RA 1B1BA 4XICA 5DD8A 1ZRCA 3NWTA 2XAQA 3ZP5A 5CJ9A 2M4KA 3M8JA 5F0HA 3DPTA 2ZJQF 2QSHX 5M3MJ 4HDVA 2ZJPF 2HKOA 4MGRA 2RNJA 4YIFA 4UY8I 3K4LA 3EYIA 3RPUD 2L7ZA 4XOTA 4XONA 1IN8A 3CCVI 1JE8A 1W36C 2EH3A 3DV8A 3KYCB 2GZWA 3TO6A 4JX4A 1YRNB 1UELB 4L0YB 3N4MA 4MIMA 3EUKL 3ZQFA 4D7NA 2V6EA 1HC8A 1P4WA 2DFEA 4PGGA 3O8HA 1NH3A 4DZPA 3HXLA 3FK6A 4KITB 3BR2A 4GRIA 3W2VA 2R3SA 4EJWA 2H8RA 3H9GA 1GLNA 2QQAA 4BYYA 3OOPA 3S17J 1WJFA 1Y56A 3HOYJ 4GFBA 3DTEA 4DYRA 4W97A 2B0LA 2PLYA 4NQWB 4MQVA 2KZGA 1LFPA 5D8KB 2L9VA 2DA5A 2Z1DA 5E3NA 5LEKA 3GFJA 4A69C 4I02A 1KONA 2CG4A 2RV8A 4G7ZF 2BY2A 2WAFA 4XM3A 3HG9A 4B09A 2VKVA 5JLXA 4OMYA 4RGXA 4BS9A 2GLOA 2JA6J 1TWHJ 4O3MA 3V7RA 3CC7I 1JKOC 3G6EI 2X6OA 3CCUI 1KU2A 4YFXF 5LD2C 2BYVE 4GXOA 4EJVA 1G4DA 3QPLA 1J75A 3FXRA 1ZGWA 1T8IA 2IA0A 4ETSA 3GZ6A 3KZZA 2L9RA 2Q2EB 2W24A 2WY7Q 4B3AA 3DKWA 2XSDC 4WK8F 1HSTA 4LD5A 3V42A 2P7VB 4G6DA 2PG4A 2D5VA 1TT0A 3LSKA 2K9NA 2NRAC 4A6EA 5HS9A 2G7HA 5LGTA 4P9FA 2A5YB 5IPAA 2OZ6A 1HW5A 3F3XA 4ASNA 2ZNZA 3WTXC 3OYDA 4ZYGA 1VQ6I 5F0CA 1BOBA 4IHWA 1D1AA 3ZQGA 4AWXB 2EIKH 1R7JA 2ESHA 2LK2A 3J7YJ 2IVMA 1OCZH 1U0JA 3H5AA 1O3TA 4B8XA 3ABKH 2HQAA 3L2RA 3A01B 1OFCX 3S16J 4H0EA 5FLVA 3ERED 3CCYA 2V1UA 1LJ9A 2JVHA 4RMNA 4L5IA 4G12A 2X51A 4U88A 2VT3A 2OQGA 3GEZA 4R1HA 4MO7A 2R7SA 4DW6A 1D8KA 4HF1A 3D5SC 4L5JA 5CVUA 4A3KJ 3KP7A 1ETVA 5A2QZ 1VQNI 4IHXA 2IPQX 2VBWA 2XAGA 3FKJA 4M74A 1TQPA 2MBFA 3VYTB 4C2MJ 1PJRA 4ZYEA 2XAUA 3BC8A 1R23A 4L0ZB 2PFBA 1BN5A 4QWQA 1J59A 1JKPC 3BTJA 2F2EA 4JQFA 1MBKA 2Y9ZA 2A69F 3M07A 3JCUC 2GIZA 1MMSA 2XSJC 4CCJA 1PDNC 3CP8A 4XRSG 2QCOA 2HOSA 3PJRA 1WZ2A 1QQIA 2IT0A 4JBAA 1QVUA 2ELKA 4NC8A 4E70A 3F23A 2VE9A 3GXOA 3Q0UA 1VZ0A 4IRGA 1V54H 3K4KA 2K9SA 1SFUA 3BJAA 1YIJI 1I50J 3RZOJ 2E2IJ 3FX3A 2VASA 2DPUA 2ZNYA 3SZTA 1CGPA 3BQYA 5JFRA 3H3VK 1JKQC 1K78A 4HQMA 4OIPF 1FPQA 4FT8A 4OAZA 1KQ9A 4HF2A 2M7BA 3MMYB 2XGXA 4KMFA 4PCQA 5IYBJ 3D5LA 4Y33A 1ETWA 3TEDA 5FO5A 1IW7F 2R7OA 2Z3YA 1SD5A 1LE8A 1W0UA 5E1WA 4Q5SF 4CXFA 5C3EJ 4IRIA 3S3OA 2EA4A 2HS5A 1VQ9I 2JWTA 4OIRF 3CDIA 4BY7J 3ABUA 3RIRA 1U6GA 3FM5A 3V8JA 2IS4A 5J47A 3J80Z 4CCOA 2E1OA 3HJEA 1BI3A 2ICWG 4D5CA 1TBXA 3E97A 4RLFA 1D0YA 4BJ5C 2LOOA 1FOWA 2NOJB 2YX4A 4LIVA 1R36A 3QYBA 2P6TA 4NUBA 4RAGA 3V7CA 3IRRA 1Y1WJ 3K9TA 4LB6B 1KQ8A 2HTSA 1M1EB 3F72A 5E79C 4AYBN 4E7HA 3ZCOA 1FBSA 2V1DA 1A35A 3UKGA 5FB2A 3FIWA 2DYRH 1ZG1A 1WI3A 2M1BA 2CFXA 3J7AO 5L3FA 1U8BA 1SMTA 3NARA 1IO2A 5AIQA 5BPDA 3R4KA 1CF7A 1S7OA 4MTDA 2FNPA 1T2KA 2HPIA 3BCAA 4PGHA 3JREA 2O61A 4M3DA 4DIQA 3OYJA 2VKDA 1FNNA 1H8AC 3LSMA 1JHFA 1QO0D 2W00A 3G1OA 4N4OB 3OS0A 2GAUA 3HPGA 1W7PD 1F4KA 1PVEA 1R5HA 3OIPA 2QUFA 1HCRA 3FXJA 2R7RA 1P9QC 2E2JJ 5HDNA 1S7EA 5E1ZB 3QPTA 2CV2A 1V5GA 2BE5F 2XDVA 5ICCA 1OR7C 4IQJA 1HKSA 3RZDJ 2OTJI 1XDSA 1F9NA 4IO9F 3R60A 4IHYA 2EJRA 4XKCA 4KT5C 4EV0A 1QZYA 4FISA 2EB7A 2VODA 5ILSA 3MZHA 3RQ4A 2DA3A 2DT7B 1TQMA 2M8EA 2LSOA 2EWNA 4CGZA 3PM1A 1LEAA 4HAMA 1G3WA 1YJ9I 1X1AA 5EYRA 1H9GA 4AVPA 4CH7A 2XF7A 2MGQA 2FMYA 1OQYA 4P96A 1I1SA 2PMUA 3BR5A 2H6CA 1D0XA 5CLSA 4DYCA 3HSEA 4LMYA 3RPUA 1SFXA 3GTLJ 5F04A 1WRJA 1GT0C 1T33A 4R8HA 2XF5A 2KIMA 1I6XA 2KRFA 2O3FA 2JA7J 4V2FA 1V3FA 5M3FJ 3P5JA 2DFHA 2NS7A 3MZ8A 2NOGA 1X58A 1P4XA 1Z77A 3AKZA 4JOMA 3LSRA 3KYLA 5IOZA 2EILH 3K7AJ 4BJTA 4AU7A 3RI4A 2V1NA 2EBIA 2XKPA 1MDMA 3KLNA 1LVAA 2E5ZA 2IGOA 3BQZA 1PUFB 2DQRA 3QRFF 2YSRA 2VC0A 3S2DJ 3DU6A 3JRDA 1EJ9A 4E6KG 5D5UB 3HEFA 2IGMA 3A0HC 3E1SA 4AIHA 3IC7A 1I27A 1QZZA 4KMUX 3S2HJ 2M2EA 2RDPA 4II3A 2HOAA 2R5YA 1IF1A 1KZHA 4C3HJ 4ENKA 1K78B 4WWCA 1USSA 1DUXC 1KU3A 3A4CA 2CWEA 1WQ2A 3HUGA 3PIPF 3WU2C 5C4JJ 3JRAA 1R6RA 3QU3A 4BHCA 2L0KA 2CQXA 2JPBA 3I4MJ 2F5EA 2ADUA 3GLXA 4OWRB 3KZYA 1OCPA 1YJNI 1NG7A 2EV6A 1B8IA 1P2FA 2JK3A 4A3MJ 2X1CA 5L3GA 2W7NA 2EFWA 3I5UA 1VQOI 4A3CJ 1U5TA 2ZJ2A 3ZGKA 4ZZLA 4LG3A 2CMPA 4RAFA 3OR1C 5F08A 4J00A 4I0BA 4XORA 2AHQA 2QQBA 2F5CA 2HXIA 2DK5A 2HOEA 3IL2A 1EH7A 3T8RA 2DTRA 5HNFA 2W1OA 3BY6A 2VT2A 1MNMC 4PFOA 1AA7A 2KPMA 3QOPA 4UV8A 2MABA 4ESBA 1N77A 1JJ6C 5EG0A 1AKHA 2ZXWH 4Y52J 3S3NA 1APLC 2X48A 2KIQA 5EJCA 5J1UA 5IY5H 3ZQIA 2XGDA 3EQLF 4GO1A 3VB2A 1GHCA 4IOCF 2AQEA 2OCCH 3NRVA 2HI3A 2BEOA 4N9IA 1QHHD 2JTVA 1ETOA 2V79A 3GF2A 4UXNA 5HODA 1SC7A 4PJMA 2W4SA 1O3SA 3GTQJ 2IP2A 1FP1D 3G1MA 4RAYA 1ODDA 2F5DA 4J19A 2Q8KA 3B6AA 1HKQA 1X3UA 4GGGA 1SAXA 2K4JA 1T08B 4XLAA 3GYHX 2K4BA 4L18B 2OF7A 2Z33A 3C2GA 4YIIA 3M7GA 3RKWA 1I6HJ 3DLAA 2HTJA 4F92B 3BG5A 2F4IA 2DFIA 1BBYA 3IH2A 4HNTA 5EGOB 1WSUA 5FD5A 4M3EA 3ZQQA 4U7BA 1R22A 1GV2A 3IHUA 3HDDA 3PL8A 2BGCA 2R7WA 3DQVC 1L3LA 3WU1B 3D5RC 4BBSJ 1HXDA 1Z7UA 3J7AY 1JXSA 3IUOA 2VN2A 5CPRB 5EZHA 2ZJRF 1AWCA 5GAHJ 4AIDA 1X1BA 1MMAA 4F93B 4YIRX 3GWZA 4PFPA 4KICA 4BL0B 3VODA 1SFKA 2KQRA 2IBDA 2TRTA 3BG7A 3IV5A 3V8KA 3SDGA 2NVYJ 2QBYA 2MC4A 4KDPA 3F6VA 2VBYA 2EFPA 4ZTJA 2QQ9A 1CQTA 5CYVA 3RQIA 5HLTA 4B48A 3K2ZA 4WCGA 1EV7A 4YFNF 1FT9A 4CICA 4AD9A 3PSFA 2M8GX 4I76A 1V55H 5KAIC 4Q48A 3E5XA 4EM2A 1JGGA 5D6EA 4X6AJ 1MNDA 3CMYA 1RC9A 2DLLA 2OBPA 1MDMB 4OIOF 1EF4A 1RNLA 5JVGF 5IP7J 2K27A 2QSFX 1MMGA 3SHFA 3CMAI 3S8PA 4Q4ZF 2CU7A 3ZQLA 4CCMA 3HL2A 1WH5A 2A6TA 2VQLA 5FRMA 4F3QA 2R5YB 5JR3A 3BTCA 3KZIC 4RS8A 3MFKA 5IP6A 1BOAA 3DEEA 3J81K 2VXZA 2JA8J 1I3QJ 3HUGB 4EJOA 3KPHA 3RYPA 1FLIA 4FCYA 4HSTA 4ZH4F 3JRIA 1A5JA 3HPHA 2GXAA 3DEWA 5LBQA 4L9NA 3CCJI 4AC0A 1R71A 3QAHA 5KCMA 1BW6A 1T38A 1Z7LA 2DMNA 2KHMA 2QZ8A 3F0CA 3FK7A 1U5TB 4Z2YA 3HTSB 1MBHA 2V9VA 4HG2A 5K1YA 1N25A 4IKFA 1J7KA 1GVJA 2ME0A 5GAGJ 1ZLKA 4RB2C 2DDAA 1WJDA 1IRFA 2DPDA 1YS6A 3FXKA 4Y3OA 3LFUA 2MFZA 4CA0A 3RJPA 1MIJA 2DA4A 1O3QA 4L5EA 2LP0A 1Q1VA 5EG0B 1AKHB 3TDZC 3QOEA 1YQAA 5KHDA 3ZPLA 1W5TA 3CESA 1MBFA 4BJ6C 1IN6A 1VQ7I 4GYGA 3EUAA 3GTPJ 3KYDB 4JYKA 2PJPA 2BZTA 3PQKA 2VQHA 1D1CA 3TW7A 3FHZA 2R7VA 1D1BA 3F21A 4JX6A 5GAEJ 2K3FA 4LG0A 1S3JA 1OMIA 1ULYA 3ABMH 3HRMA 5FD6A 1Z1DA 3VWBA 2X6XA 1DQUA 3W6KB 1E3OC 3PUFA 4ZYHA 1E17A 3C18A 2P5LC 3BZ6A 3VOEA 4NBQA 3WODF 2A5WA 4NC6A 3CP2A 1OYIA 4B44A 5DS9A 2P5VA 3D0SA 1E3PA 3R0AA 3EETA 1F5TA 1S72I 1H88C 4B43A 3HGYA 4HW0A 4F52A 1WJ5A 1X4OA 1TW2A 4HX8A 4BNCA 2DMTA 4BDZA 5CVRA 5D5VB 1R1TA 2W84A 1S5LC 2E1MC 5TJJA 2XUBA 3E6BA 5FROA 1V5FA 1G3YA 4C3JJ 2KMUA 2L2OA 2XRLA 3ESWB 3L2WA 2LC2A 3GTOJ 1SD4A 3CDLA 2MLGA 5ICFA 3ZRGA 2QBYB 3PNYA 5J1RA 2WA0A 3BJOA 5FRNA 1VTNC 4XNFA 2YX7A 1N78A 4UUSB 4OU0A 3Q5FA 5K5QA 2VL8A 4XN3A 3K70C 1U78A 4I0AA 2I5UA 3ZN0A 4XRSA 3AL0B 5E8IA 3BPVA 4IRHA 2EIJH 3GMEA 4IX7A 4EMSA 3SJMA 3DPLC 1H89C 2OQRA 3OS1A 3IWZA 1Q1HA 3DKYA 2EFQA 3VDXA 3K1PA 3GUDA 4PUSA 2FA5A 2QLZA 3UR3C 3DP7A 5E3OA 3I3LA 3ECOA 3NAUA 2GBYA 4BQQA 2XC7A 3ZMVA 3KIOA 1BI1A 2Y0MA 3DU5A 5D4RA 2QWWA 2ID3A 2JZYA 1IRZA 3HKZN 1FC3A 3MAJA 5HOOA 3T0YA 1K83J 2VKHA 2VJ5A 5GP9A 1ITYA 4EQQA 4NB5A 2DT6A 3R61A 1RRJA 2CUFA 2ACJA 2H1LA 4ZYDA 4FX4A 2HWVA 2MA3A 3FXUA 4I01A 1R9TJ 3CQZJ 2E34A 3F8MA 3HM5A 4C2TA 2X6YA 3A02A 2RGVA 2NS8A 2NNYA 5FLXK 5J8CA 3KP3A 3FMSA 2VJJA 1BR4A 1FOYA 2HYJA 1HW2A 3T8TA 5DTDA 2KP6A 1TWFJ 2UWMA 4RA2A 3HOZJ 5CVVA 3OYBA 4ENNA 5AONA 4BKXA 4D0PA 1P7JA 1VF9A 2K5CA 2G9WA 2K85A 1W7PB 1G2HA 3TMOA 1LFUP 1S8NA 3F22A 1R00A 5J4VA 2HQNA 2CSOA 4XKWA 3QPHA 5DV5A 3IKVA 4BHBA 5GTIC 4HOBA 1POGA 4CUGA 2JPCA 1MD0A 3L9FA 4YRVA 3H5RA 5FLMJ 3Q9VA 2HR3A 2RQPA 2VKEA 3BCBA 2EV0A 1R1UA 2K86A 4D1QA 1EH6A 3CUQA 1WJEA 4M9SA 3WE2A 1WWXA 2WAQN 4HNUA 1P6RA 1U2WA 2CRGA 1LVKA 2PQ8A 2ECBA 4IOAF 3F8NA 2RN7A 1XC5A 2ZFUA 2O8XA 2O6GE 2Z5UA 2XVCA 2DTZA 5DCMB 4LLNA 3W2WA 4HQEA 3HB9A 3PFIA 2BVLA 3PO2J 3WTWC 1AHDP 2H27A 4XK4A 4HX4A 4E7KA 2FXAA 4RGSA 1XG1A 3F8FA 4ZDLA 1MZBA 3MCZA 2R0QC 1X1CA 3E6DA 5J40A 1U5TC 2M45A 3F6OA 1LQ1A 1X19A 3H5NA 2VXDA 4N0BA 3VSLA 2X85A 1NG6A 4MFDA 1FOKA 1J2XA 1UAAA 3EUHA 2BHZA 1XCBA 4FE7A 2STTA 4XSXF 3BROA 2CYYA 1RUOA 2EZLA 4XL9A 4X0GA 2FU4A 3IWFA 1GDTA 2ME6A 4LJZF 1FBUA 1MGTA 5E3LA 1ERDA 3K10A 5AIPA 3JAMK 2W57A 3KP5A 4BDYA 5L3DA 3G73A 5F64A 1MH4A 4BQOA 2OD5A 3KX2A 1SMYF 3NWSA 1FWZA 3H35A 5L3CA 2XPVA 2R5ZA 3WG9A 3S15J 2QENA 1HA8A 2ZXJA 4IHTA 1QGPA 3JRCA 3ZN1A 5LGNA 2FQ4A 2X0LA 3LL7A 2WB1N 2CV0A 2HXOA 2KDOA 1ORKA 3VFZA 3OYKA 1OCRH 1LDKB 2I10A 3FBIB 1SD7A 3CC4I 3MN2A 3FXOA 2XB5A 1SVOA 4QPQA 4KA4A 1ZHFA 1ZLJA 4RAZA 3G4SI 3MZYA 2DA2A 1ZKGA 3OYNA 3FXMA 1IRXA 2K9MA 2H6BA 2XV4S 4FTHA 1XB4A 1IZ1A 4DBQA 1D5YA 4MLOA 3H36A 4M9XA 5C44J 2KFDA 1K4TA 2FBKA 5TGTA 4RB1A 1B6AA 3I9V2 1A6QA 1X1PA 3ZMUA 1J5YA 2DO7A 2H1KA 3TOAA 4WX9A 2GXBA 3EYYA 5H6RA 1LUJB 2DA7A 4UB6C 2E7WA 1IXCA 1I1GA 2XAHA 3E6CC 4CZCA 1ZAOA 1Z9CA 2KLOA 2VJ4A 2ZMEA 4CYCA 3H92A 1FTTA 2KIUA 1HDPA 5D6FA 2HDDA 1DU6A 1J0RA 1XSVA 2P7CB 5BOXA 1HDDC 2X4HA 3AL0C 2NAZA 4IQ4A 2WB1A 2OC6A 1LB2A 5K7FA 2A6HF 2X9DA 4XLEA 3L2QA 3DBHB 2KJBA 1R5GA 4CDGA 2O9LA 4EM0B 4HYEA 1TZLA 1YW8A 1UB9A 2JRMA 3U1DA 3CZ6A 3CO6C 2IEKA 3DXJF 5H6QA 1G8XA 4I2OA 3ECHA 3GFLA 4N9HA 4RLQA 4L9JA 2P6SA 4BXFA 1XGNA 5EZGA 2GA2A 2VE8A 4C30A 3CUQB 2R7FA 2JJ7A 4HDUA 1TNSA 3CO7C 3TL4X 3SEQA 5ILUA 4W1UA 3TO9A 3TW6A 2COBA 3B6CA 2KJCA 3W6VA 2LYCA 1O7FA 2FX0A 5BQTA 4OMZA 1B72A 4OIQF 3F8BA 2MYSA 3U1KA 1CF7B 1SFEA 2JA2A 4FHTA 4WXDA 4AYBA 2XROA 2M0MA 3GFMA 4YELA 5BMZA 3CJNA 3JW4A 4ZZDA 2O7OA 1MSFC 5CKTA 1ONVA 3LQRA 4P55A 4CCNA 4UB8C 2VOOA 5KVRA 2O5RA 2QKMB 5FKNA 2JA5J 3R0JA 3OYAA 3QP6A 3M1EA 1UHSA 1YIOA 2DQLA 3BWGA 3E3VA 2D2WA 3M8EA 3NQOA 4P5OA 4AVZA 3FISA 1IN7A 1GV5A 5DM7F 2DYSH 3ERMA 1ZELA 1UHMA 2DODA 1VQ4I 3MQ0A 2ZC2A 1T0FC 2CUEA 2IS2A 1TNTA 1KU9A 2CS3A 3HGGA 4BQNA 3L09A 1YX3A 5LEJA 1R1VA 2R4GA 4HF0A 3I0TA 3CJRB 2R5ZB 4S04A 2E5NA 5DYMA 2W25A 2F48A 3KP4A 4I99C 1F1ZA 5BPIA 1JTXA 2H09A 3IAS2 4F55A 3JTHA 3I59A 2L3DA 4S0HB 3WU0A 2YPRA 2F5FA 4L9VA 3VPRA 2BOLA 1I5ZA 3O6BB 4XKBA 1TL8A 1X4PA 2E60A 3FZVA 1XGSA 1SVMA 2WC2A 1HW1A 2FSWA 1PYVA 1LE8B 3HRSA 3U21A 2B63J 4AUXA 1ETKA 1BJAA 1F36A 4ENMA 1XGMA 1ETXA 2K40A 1DPRA 1FIPA 1GUUA 3DBLB 4KJZA 2D45A 4HZFA 1K61A 2DW4A 2GOXB 1TTYA 4OINF 2CQQA 1Z3YA 4IZZA 2ZO4A 3ROUA 3PUBA 1ZREA 3OR2C 2FF4A 3GCMA 3WGHA 2KISA 4HEA2 1XCVA 1FJLA 2EFNA 3CCMI 3BT9A 3CF5F 1MNEA 3ABLH 4M72A 2ZMEB 4CYCB 2K02A 3S32A 5D5XB 2A68F 2IAIA 2DN0A 3HOUJ 2CH0A 2IS6A 3BJ6A 4E4HA 3G2BA 1R49A 4XBFA 1Z21A 4UV9A 2V26A 3M1CA 2MG4A 3AG4H 3LOCA 4MEXF 4KT6A 4EM1A 1AU7A 2O8KA 3QQAA 4P9UA 1JTYA 4BH9A 3AG2H 1O57A 2ID6A 5BNGA 2CW7A 3OYHA 1BR2A 2AQFA 4BE2A 2B7EA 1IDZA 2QGUA 2RNGA 3HIFA 3K4BA 3C2HA 2BY0A 4A0YA 2Y0SN 4A6DA 4Y4RA 2DA1A 3DWLE 2LG4A 2V7FA 1T98A 3P9IA 4N4NB 5FJ8J 1YW7A 1IV6A 4KN7X 3REOA 5E8GA 2LBFA 2OA4A 3RKQA 1BM9A 4U0WA 2K9QA 1B72B 5FFZA 4ZDPA 2UXXA 1J9IA 1RESA 2XAFA 3ZMDA 1S29A 5ICGA 4IF4A 3HSRA 4HRIA 4II2A 4C3IJ 2PMHA 2BY1A 3FDYA 3X2QH 2RREA 3LMMA 3UNGC 5GPCA 2RQQA 1BC8C 4M9ZA 2FJ1A 4G8XA 4QLCU 5HNHA 1D3YA 3AG3H 4WF2A 4ZDOA 2HQRA 2E36A 1ON2A 3FHNA 2MC3A 2HPMA 3HOTA 2FBIA 5E17F 3BR0A 2P4WA 4JK1X 3SFIA 4O5VA 4XSZF 4A3GJ 5B3SH 3WTTC 4ESJA 2VPRA 2DBBA 3KEQA 2WV1A 3H0GJ 1NTCA 1Z67A 2EPFA 3CF2A 3VYRB 4DZJA 5IT9K 2TDXA 3KETA 2G7UA 3CD6I 2W48A 1ZN2A 2VIXA 3J81Z 2NYXA 4E7LA 4RM3A 2XHKA 3Q9SA 1NK2P 5JVTA 2CFOA 5CQGA 1NHAA 2M4GA 3TO7A 3VYSB 2P81A 2Z16A 1XMAA 3I53A 3M9AA 5E3MA 3ZMSA 4KISA 1FEXA 5GTHC 1Y0NA 2YU9J 1ZR2A 1RKWA 5C4XJ 3OL4A 1X3WB 2EV5A 4FASD 4XQFA 4MHGA 3ULQB 2BW3A 4RB3C 5KK1A 5HS8A 1KQ0A 3HOSA 3CDHA 2FE3A 3I59B 3JR9A 1Z05A 3OSFA 1E3HA 2YU3A 2KKOA 4U0VA 3RTRA 1DP3A 1P7IA 2NVTJ 2EIMH 4FX0A 3Q3SA 3TDUC 3RCOA 1MBEA 4XLHA 1RUNA 3ML6A 3GZ5A 2E35A 1R58A 3KLOA 1UHWA 1XSXA 2FQ3A 2R7TA 2X1DA 4PSXA 3S1NJ 1OR7A 4LB5A 1B8IB 1SAUA 4QTRA 3L2CA 3LSHA 2EZIA 5B5EC 1BI2A 4V2GA 3LSTA 1IN5A 2GOMA 3WGIA 2P5KA 2TCTA 3CJQB 2IJLA 1OCTC 3HZJA 3ZQCA 3HHHA 1ZH5A 2M7AA 5DDGA 3EUHC 1O4XA 3S1QJ 2BHYA 2VC1A 5J6XA 2XIGA 1R4NB 3S1MJ 1OISA 2JT1A 4KYWA 1HOMA 3F9KA 5HDKA 1JUPA 1S6LA 3I54A 3E5QA 1IC8A 3CCRI 4FQGA 5FKKA 5D4SA 5FGMA 1A31A 4F91B 3OYCA 3WTYC 1IDYA 2BY3A 3FBNB 5F1JA 5LRRA 5DEQA 4C2UA 1VQKI 2YR2A 3OYEA 2WADA 2VQGA 3M4OJ 4BE1A 4IHVA 1HLVA 3CLQA 1Z6RA 4DYQA 4L9TA 2DT5A 3QPSA 4LFUA 2AO9A 5J4YA 2VUMJ 3ELKA 4D7MA 3WE3A 5DUIA 3A0BC 4M6YA 1VQMI 3BTLA 5JI6A 4BBRJ 1S9HA 1HF0A 4D9JA 1FMWA 2YS9A 4ESFA 4IHSA 3WTVC 1QZEA 2GXGA 4PJNA 2GM4A 1FSHA 4HV6A 3SQNA 2JRTA 5TRDA 4CCLA 4DJAA 2ELJA 3EDPA 3P7NA 1XTAA 3S2WA 1JUMA 5GADJ 4ITVA 1RIOH 1LDJA 2CQKA 4XMYA 1IJWC 4A3BJ 1R5ID 2V1XA 4UVCA 1TLHB 4DNCA 3QODA 4CYDA 5FFXA 2LBFB 3CMMA 2O0YA 4IL6C 1W36D 1D5VA 3CTAA 1YG2A 2EZKA 4M6XA 3QP5A 3KE2A 1WH7A 2LY9A 4A5MA 2CQ7A 3T1BA 3GZNB 4NHJA 2BVMA 1D0ZA 1ETYA 1YX5A 3FMRA 1OPCA 2YUSA 4XN0A 2ZMEC 2IA2A 3U2RA 1G59A 3TOBA 2AXTC 1VQPI 2DA6A 3C2BA 1IRGA 4BUPA 3KP2A 4Y15A 3RKXA 2HZDA 4E7JA 5D5WB 3RKYA 4Z6YA 3MKYB 4UNOA 3G71I 2XKOA 5L3EA 1OCCH 1FMVA 2X6WA 4KIFA 2CO5A 1QPIA 4DGWB 3L1PA 5H2FC 2X1EA 2LNBA 3PO3J 2ESNA 1YLFA 2LFBA 3LSPA 2QM3A 5FLXZ 5KNLA 1J09A 4UUVA 2QSGX 2Y31A 2LREA 2DDBA 3LFKA 3K4MA 1SFOJ 4IVNA 5IT3A 4V19K 1TWCJ 1U3EM 3GTMJ 1JI8A 5KAFC 3WTZA 2D1HA 4WXHA 2CGPA 2BW3B 2L4AA 1LKXA 2PMZN 2ZSIB 1W1WE 2RAEA 2E7XA 3DBRB 1TW3A 1Y1VJ 2RKHA 1ZRFA 2WWYA 2FOKA 2NNNA 1BR1A 2BXZA 1YJWI 5D8LB 3IH3A 1DGWY 4E7IA 2V9KA 3TQNA 1VQ5I 4XIDA 5K5OA 2NXNB 4RGRA 3E0JB 2L54A 2DMUA 5CVJA 4ZTFA 3H9QA 2M5WA 2LF8A 1IGNA 3E5UA 1FX7A 5F0FA 4CHUA 3WG7H 4MQ9F 3ZR8X 1JUSA 3E6MA 4YG2F 1Y8QB 2PBIA 2OU2A 2LKSA 1K7AA 2CUJA 4BEHA 2NS0A 3V8LA 1WKMA 1LFBA 1EA3A 1C0WA 1P4AA 1B9NA 1H9TA 4HPQA 1BL0A 1V4RA 3C1DA 4LLGF 1ZG5A 4CSWA 2HVSA 5FKMA 3PIOF 1G3TA 1RETA 2G0EA 3MD2A 2LD5A 2OZUA 2WY8Q 3PNTA 4A3LJ 1QRYA 1QVTA 2M34A 1KU7A 4XRFA 4NC7A 4UUTA 2XGEA 2LF7A 2OCEA 3DCFA 3L2UA 2AS5F 1ZGJA 4KFCA 4A93J 3HKZA 2HKXA 2K3PA 5L3BA 4XKVA 2PMZA 1IUYA 4RM2A 1U9OA 3JSOA 1JHHA 1UG0A 1DU0A 3DEUA 4LGWA 1ZQ3P 1ZG3A 1YHQI 2A6EF 2ISZA 4LG0B 2DJIA 3LA3A 2R7XA 1GXPA 2OPTA 3J7ZI 5DCFA 3SXYA 2LRDA 4MNUA 3TBIA 1WCMJ 1USTA 4PDKA 4IXAA 3LNQA 4UHTA 3FF5A 3SEZA 3JAMZ 3V7SA 1A04A 3KEOA 1E0EA 1BC7C 1XMKA 1YTYA 1MJBA 2HNHA 3BOQA 4KIGA 5EEGA 2HYGD 1IXSB 2PN6A 3WTSC 4D5FA 3W2AA 3JRBA 1XMXA 1ZARA 3ZQHA 2FMLA 2HU9A 1K79A 1VNDA 1L0OC 1TWAJ 2WBMA 1RR7A 3KEYA 1TQIA 1OKRA 2M3AA 3FMQA 3DLLF 5B1BH 2JQ7A 2F5VA 4FETA 4OOIA 2EK5A 1XX5A 2OJED 4BAYA 2JMWA 4XLPF 2LY1A 3C7JA 2JSCA 2V4JC 1SEUA 3K1MA 5K7HA 4B1RA 3GVAA 1G6NA 1HKTA 4NDLA 1MKMA 2DI3A 1WJBA 4I7HA 1LDDA 1S7AA 2NVUB 2WAQA 2Y48A 1XGOA 5TISC 5LHHA 1YI2I 2DMPA 4PJLA 3RSNA 3KCCA 2DOEA 3U9GA 2NVXJ 1OYYA 3MVPA 4QIWN 1QHGA 1BW5A 3VSKA 2GQQA 2LKXA 1T95A 3SFZA 1BIAA 3QYEA 5HDGA 4MFEA 4G9YA 2OAZA 1IUFA 4O6JA 1N75A 5A2QK 1PUFA 5GPAA 3LA7A 2Y75A 2Y2ZA 2VQCA 3AFHA 1WFXA 2ZCWA 3OOUA 3VEPA 1ZGAA 1LPQA 3GTKJ 3FXLA 1V5EA 3CUOA 6PAXA 4A0ZA 5LLQA 2CW0F 5IYDJ 3HOXJ 3PSIA 2MH9A 1ZR4A 4Y13A 4M6VA 3ZOBA 1OLTA 4E7ZA 5ICEA 1Z0XA 3W6JB 1YS7A 4PZJA 1UFMA 1ZRDA 3HYIA 1IN4A 5E20A 1YYVA 3BPXA 2EFOA 4XLFA 2M0CA 2DCEA 1MH3A 3FXQA 3GW2A 3H3ZA 2PX9A 1FYKA 2BXYA 2XPWA 3OV8A 2JUGA 2XAJA 3OS2A 3OYIA 1GVDA 3CCQI 2R7QA 3OIQA 5EEHA 3WGGA 2KZVA 1XDUA 3PQJA 1W4MA 1MMNA 2EQRA 2UZKA 4PJ0C 1QU3A 4KNYA 3RYRA 1Y39A 2CW8A 2F6CA 4AIJA 4J01A 4Q47A 3ONQA 2Z2SB 3ISPA 4NNJA 3P9CA 1LNWA 2A05A 4A2UA 1A36A 2HOTA 4A5NA 2O03A 5CVIA 3LQQA 4RGUA 2IW5A 4I98B 4BEHB 1IG7A 3M3YJ 5IOYA 2M30A 3N05A 1VI0A 1Z6TA 1OCOH 1JKRC 1SVLA 1O3RA 4LITA 2LY2A 4M73A 4S05A 3BZKA 1AOYA 3S93A 2HQ5A 2KL4A 4X1EA 3P9KA 5ILVA 3J80K 5JHFA 3FM3A 2J5OA 3JRGA 3OY9A 2MH2A 2E71A 5J8FA 1P92A 1TP4A 4BHPA 2IS1A 3OSGA 1MW7A 2GIVA 4M3GA 1FP2A 5H20A 2R93J 2MSYA 2LR8A 3A03A 2QQ8A 1Y0UA 4HLXA 3DKXA 3K6GA 4WXCA 1DPUA 1OJLA 1K6YA 5JHUA 1KYZA 4UVAA 1T56A 5IYCJ 1X2NA 2IXSA 3FWEA 4PJJA 4HLYA 2LVSA 3GTJJ 4G7OF 2ZXHA 1HQCA 4EVIA 4U7DA 5EGOA 2OTLI 3LAPA 3BP8A 1KGSA 4PK4A 1SD6A 2BBYA 3QU6A 3BG3A 3COAC 4I6ZA 4XLCA 4LIUA 2N8GA 1KA8A 2OUMA 2ETHA 3IH4A 4CO8A 4ZYAA 3A2KA 1FY7A 5DUKA 4BQAA 3T5XA 4DQ2A 1ENHA 2IGKA 2JUCA 2UXNA 2B9SA 2HDWA 3LAJA 2ECCA 1JGSA 4HX7A 4B4CA 3MKLA 1FTZA 1W0TA 4Y17A 1XN7A 4H4KC 5LGUA 4KUMA 3I58A 1PP7U 2Y9YA 1B4AA 2L9SA 4OAYA 1Z91A 2J5PA 3WHBA 3IP4B 3CC2I 4A3JJ 3IRQA 1QA6A 1WPKA 2VBZA 2Y69H 5M5WJ 3HC7A 3OYGA 3BDDA 3ASNH 1ACIA 3S14J 2M9HA 4IPAA 3B73A 3BTIA 3DF8A 2HVRA 2H8WA 2JN6A 4KIBA 3V4GA 1PUEE 2V6CA 3EPZA 3OIOA 2CJJA 1YE9A 3L2VA 1MJ9A 2IA1A 2UUZA 4MTEA 2RVCA 4PSWA 4BXUA 2HGCA 1E2XA 2XRNA 3WTUC 1RI7A 3MWMA 3AAFA 2L7KA 1NK3P 2W82A 4EJTA 3Q0WA 2VOPA 2FEZA 4YEJA 4JX5A 2EINH 1TT5B 1DGRM 4MEYF 2FD5A 1I3AA 5B1AH 4A3EJ 3TGNA 3ZMZA 4CCKA 1GXQA 3BZCA 4FE4A 3I4PA 3HTUA 2Z9OA 1ON1A 4G6QA 2KRCA 5EDNA 2FUG2 3OL3A 2L01A 3GX4X 3BG6A 1TC3C 3K1NA 3N97A 4G6TB 2LH9A 5DM6F 4Y7NJ 3BR6A 3HHGA 4ON0A 5HLIA 2A07F 2HZTA 4P1WA 1IV8A 1ZK8A 2XF6A 5LHIA 1JT0A 3H3UA 4RBOA 3K2AA 2ZXIA 3HRUA 2P0WA 1UCRA 4U87A 3HOVJ 2QYOA 1BJZA 5EEAA 1YO5C 3O3KA 2E1MB 2Q0OA 2ZBKA 2FOWA 3K69A 1LEBA 2ISYA 3CMEI 3NEUA 1T39A 2MD5A 3KFWX 1O7LA 5HLHA 5HS7A 5F1RA 3LSGA 3K0LA 3LA2A 4IEJA 2QF7A 4K2EA 3OYFA 3ASOH 3TP0A 1B9MA 1X3ZB 1XS9A 3AG1H 3L7WA 4GYIA 2DJNA 1VFCA 1YW9A 1I39A 1X1DA 2DOFA 4BXXJ 1WVRA 2HVQA 1MMDA 2BV6A 2KT0A 1MBGA 3CCSI 2Z99A 4XLNF 4EATA 5IP9J 1T6SA 3S3MA 4ANJA 5J1YA 1OYWA 2ZSHB 1WHUA 3SZPA 2EA2A 3TP3A 3DTIA 3GTGJ 5B66C 1FYMA 4A3IJ 4XRMA 4IJAA 1FIAA 1XD7A 2R7UA 3H1CA 2DXIA 1EH8A 1WI9A 1ZTRA 4RB0A 5IT9Z 1IXRC 5E1XA 2PI0A 3IAM2 5DD4A 4A3FJ 2PJRA 1K6OA 1Y6IA 2C6YA 5ERIA 1BIBA 2L5QA 2FNAA 4DOZA 2M87A 1MJAA 2VI6A 4RDUA 1U8RA 3WHCA 1XSDA 3VYUB 2R7ZJ 1D8JA 1RZ4A 5J3LA 4A3DJ 4ZJZA 4EEFG 9ANTA 2L9NA 5LHGA 2A3SA 3OYLA 2VB6A 4G94A 3HBLA 3I55I 5F27A 3L00A 2F4MB 1KYWA 2LTPA 1FOXA 2H94A 3ABTA 2IGNA 1FZPB 1JJ8C 3PNVA 1QNTA 4HNVA 4B3XA 2HEOA 2LDUA
chains in the Genus database with same CATH topology
1PP8F 2K7LA 3ZQ7A 5F6FA 4HBLA 3CUQC 4KN4X 2AXLA 2LKPA 4LK0F 2E1CA 2KIFA 2VBXA 4EGZA 4LLLA 4I09A 3I71A 5BS6A 2DU9A 4NQWA 3HSFA 3IKTA 1FBQA 3R6SA 1W5SA 3M8FA 2STWA 1QBJA 3RPQA 3KP6A 4HA8A 1G3SA 3LWFA 5E18F 2WV0A 2XASA 1B59A 2RC4A 2L4MA 4R79A 2GA1A 4M71A 1YFHA 3TKYA 1BI0A 2D1VA 5LRSA 1DP7P 2Q2EA 1HBXG 5HVQC 5ED4A 3JSPA 2ZFWA 4ENJA 3I64A 2FRHA 4UVBA 1W7PA 1REPC 3ZMTA 3F8CA 2IRFG 1T0FA 4YFKF 2DK8A 1IAWA 2E1NA 2W85A 2L02A 3HRTA 3G3ZA 4A0XA 1FYLA 4G7HF 4AIKA 3RDIA 3JTGA 4HV5A 3GO5A 2WTEA 2R7DA 1DDNA 2HYFA 2P8TA 1H0MA 3GFIA 1STZA 3B02A 2PEXA 2GWRA 3CLOA 2HFHA 1ZYRF 2ELHA 1HSJA 5DCMA 2QVOA 4CZZA 2VONA 4TV7A 2A61A 4EJUA 2ZKZA 3DFGA 1QPMA 2FBHA 4LK1F 4EGYA 3C3WA 4U0YA 2DAOA 2MLKA 4F7ZA 2HDCA 4A12A 3O2PE 3MEXA 4GCVA 5HLGA 1FSEA 2COMA 5K5RA 1B1BA 5DD8A 1ZRCA 2XAQA 3ZP5A 5CJ9A 3DPTA 4HDVA 2HKOA 4MGRA 2RNJA 4YIFA 3EYIA 1IN8A 1JE8A 3DV8A 2GZWA 3TO6A 4L0YB 3N4MA 1P4WA 4PGGA 2R3SA 4EJWA 2QQAA 4BYYA 3OOPA 2B0LA 2PLYA 4MQVA 5D8KB 5LEKA 3GFJA 4I02A 2CG4A 2RV8A 4G7ZF 4B09A 4OMYA 4RGXA 4O3MA 3V7RA 1KU2A 4YFXF 2BYVE 4GXOA 4EJVA 1G4DA 1J75A 3FXRA 2IA0A 4ETSA 3GZ6A 3KZZA 2W24A 3DKWA 4WK8F 1HSTA 4LD5A 2P7VB 4G6DA 2PG4A 2NRAC 4A6EA 5HS9A 2G7HA 5LGTA 4P9FA 2A5YB 2OZ6A 1HW5A 3F3XA 4ASNA 2ZNZA 3WTXC 4ZYGA 4AWXB 1R7JA 2ESHA 2IVMA 1O3TA 4B8XA 4H0EA 3ERED 2V1UA 1LJ9A 4L5IA 4U88A 2VT3A 2OQGA 3GEZA 4R1HA 1D8KA 4HF1A 4L5JA 5CVUA 3KP7A 5A2QZ 2IPQX 2VBWA 2XAGA 4M74A 1TQPA 2MBFA 4ZYEA 1R23A 4L0ZB 2PFBA 1BN5A 4QWQA 1J59A 2F2EA 4JQFA 2A69F 1PDNC 1QQIA 2IT0A 4JBAA 3F23A 4E70A 2VE9A 3GXOA 4IRGA 1SFUA 3BJAA 3FX3A 2DPUA 2ZNYA 3SZTA 1CGPA 5JFRA 1K78A 4HQMA 4OIPF 1FPQA 4FT8A 1KQ9A 4HF2A 2XGXA 4KMFA 4PCQA 3D5LA 5FO5A 1IW7F 2Z3YA 1SD5A 5E1WA 4Q5SF 4CXFA 4IRIA 2EA4A 2HS5A 4OIRF 3ABUA 3RIRA 1U6GA 3FM5A 3V8JA 3J80Z 1BI3A 1TBXA 3E97A 2YX4A 1R36A 3V7CA 2P6TA 3IRRA 3K9TA 4LB6B 1KQ8A 2HTSA 3F72A 1FBSA 2V1DA 5FB2A 1ZG1A 2M1BA 2CFXA 3J7AO 5L3FA 1SMTA 5AIQA 5BPDA 3R4KA 1CF7A 1S7OA 4MTDA 2FNPA 1T2KA 4PGHA 2O61A 1FNNA 1JHFA 1QO0D 2GAUA 1W7PD 1F4KA 1R5HA 2QUFA 5HDNA 5E1ZB 3QPTA 2BE5F 5ICCA 1HKSA 1XDSA 1F9NA 3R60A 2EJRA 4KT5C 4EV0A 1QZYA 2EB7A 2VODA 5ILSA 3MZHA 1TQMA 2M8EA 2LSOA 2EWNA 4CGZA 1LEAA 4HAMA 1G3WA 1H9GA 4AVPA 4P96A 2FMYA 1I1SA 2PMUA 2H6CA 5CLSA 3HSEA 4LMYA 3RPUA 1SFXA 1WRJA 4R8HA 2KIMA 1I6XA 2KRFA 2O3FA 1V3FA 1P4XA 3RI4A 1MDMA 2XKPA 3KLNA 1LVAA 2DQRA 3QRFF 2YSRA 2VC0A 5D5UB 4AIHA 3IC7A 1I27A 1QZZA 4KMUX 2RDPA 1IF1A 4ENKA 1K78B 4WWCA 1USSA 1DUXC 1KU3A 2CWEA 1WQ2A 3HUGA 3QU3A 4BHCA 2JPBA 2F5EA 2ADUA 3GLXA 3KZYA 2EV6A 1P2FA 5L3GA 2EFWA 3I5UA 1U5TA 2ZJ2A 4ZZLA 4I0BA 2QQBA 2F5CA 2DK5A 2HOEA 3IL2A 1EH7A 3T8RA 2DTRA 3BY6A 2VT2A 3QOPA 4UV8A 4ESBA 3EQLF 4GO1A 3VB2A 1GHCA 3NRVA 2BEOA 4N9IA 1CF7B 2JTVA 2V79A 4UXNA 3GF2A 1O3SA 2IP2A 1FP1D 4RAYA 1ODDA 2F5DA 2Q8KA 1HKQA 1X3UA 4GGGA 1SAXA 2K4JA 3GYHX 2K4BA 4L18B 2Z33A 4YIIA 3M7GA 3RKWA 2HTJA 2DFIA 1BBYA 1WSUA 5FD5A 4U7BA 1R22A 3IHUA 2BGCA 3DQVC 1L3LA 3WU1B 1HXDA 1Z7UA 1JXSA 2VN2A 1AWCA 3GWZA 4KICA 3VODA 3V8KA 2QBYA 4KDPA 3F6VA 2VBYA 2EFPA 2QQ9A 5CYVA 3K2ZA 4WCGA 1EV7A 4YFNF 1FT9A 4CICA 4AD9A 4Q48A 3E5XA 4EM2A 5D6EA 2DLLA 2OBPA 1MDMB 4OIOF 1RNLA 2K27A 3SHFA 4Q4ZF 5JR3A 4RS8A 3MFKA 1BOAA 3J81K 2VXZA 4EJOA 3RYPA 1FLIA 4ZH4F 5LBQA 4L9NA 3QAHA 1T38A 2QZ8A 1U5TB 4Z2YA 3HTSB 2V9VA 5K1YA 1J7KA 1GVJA 1ZLKA 4RB2C 2DPDA 1IRFA 1YS6A 3RJPA 1O3QA 3TDZC 1YQAA 3ZPLA 1W5TA 1IN6A 4GYGA 2PJPA 3PQKA 3FHZA 3F21A 4LG0A 1S3JA 1OMIA 1ULYA 3HRMA 5FD6A 1Z1DA 3W6KB 4ZYHA 1E17A 3C18A 2P5LC 3BZ6A 3VOEA 3WODF 1OYIA 2P5VA 3D0SA 3R0AA 3EETA 1F5TA 4HW0A 1TW2A 4HX8A 4BNCA 5CVRA 5D5VB 1R1TA 2W84A 5TJJA 2XUBA 3E6BA 1G3YA 1SD4A 2MLGA 5ICFA 2QBYB 3BJOA 1VTNC 2YX7A 4OU0A 3Q5FA 5K5QA 1U78A 4I0AA 3ZN0A 5E8IA 3BPVA 4IRHA 4EMSA 3DPLC 2OQRA 3IWZA 1Q1HA 2EFQA 3K1PA 3GUDA 2FA5A 2QLZA 3DP7A 3ECOA 3ZMVA 1BI1A 2Y0MA 5D4RA 2QWWA 2JZYA 1FC3A 3MAJA 5HOOA 3T0YA 4EQQA 4NB5A 3R61A 2ACJA 4ZYDA 4FX4A 2HWVA 2MA3A 3FXUA 4I01A 3F8MA 2RGVA 2NNYA 5FLXK 5J8CA 3KP3A 3FMSA 1HW2A 3T8TA 2UWMA 5CVVA 4ENNA 5AONA 4D0PA 2G9WA 1W7PB 1S8NA 3F22A 1R00A 2HQNA 2CSOA 3QPHA 5DV5A 3IKVA 4BHBA 4HOBA 2JPCA 1MD0A 3L9FA 3Q9VA 2HR3A 2RQPA 2EV0A 1R1UA 2K86A 1EH6A 3CUQA 3WE2A 4M9SA 1WWXA 1P6RA 1U2WA 2PQ8A 3F8NA 2RN7A 2O8XA 2O6GE 2Z5UA 2XVCA 5DCMB 4LLNA 4HQEA 3PFIA 3WTWC 2H27A 4HX4A 2FXAA 4RGSA 3F8FA 1MZBA 3MCZA 3E6DA 1U5TC 2M45A 3F6OA 1LQ1A 4N0BA 1FOKA 1J2XA 3EUHA 1XCBA 2STTA 4XSXF 3BROA 2CYYA 1RUOA 2FU4A 3IWFA 4LJZF 1FBUA 1MGTA 5AIPA 3JAMK 2W57A 3KP5A 5L3DA 3G73A 5F64A 2OD5A 1SMYF 1FWZA 5L3CA 3WG9A 2QENA 2ZXJA 4IHTA 1QGPA 3ZN1A 5LGNA 2X0LA 3VFZA 1LDKB 1SD7A 4KA4A 1ZHFA 1ZLJA 4RAZA 3MZYA 2H6BA 2XV4S 1XB4A 1IZ1A 4M9XA 2FBKA 4RB1A 1B6AA 3ZMUA 1J5YA 2DO7A 3TOAA 4WX9A 2GXBA 3EYYA 5H6RA 2E7WA 1IXCA 1I1GA 2XAHA 3E6CC 1ZAOA 1Z9CA 2ZMEA 3H92A 2KIUA 5D6FA 1J0RA 1XSVA 2P7CB 5BOXA 2X4HA 2NAZA 1LB2A 2A6HF 2KJBA 1R5GA 4CDGA 4EM0B 4HYEA 1YW8A 1UB9A 3U1DA 3CO6C 3DXJF 5H6QA 4I2OA 3ECHA 3GFLA 4N9HA 4L9JA 2P6SA 1XGNA 2GA2A 2VE8A 3CUQB 2R7FA 4HDUA 1TNSA 3CO7C 5ILUA 3TO9A 2KJCA 1O7FA 5BQTA 4OMZA 4OIQF 3F8BA 1SFEA 4FHTA 4WXDA 2XROA 3GFMA 5BMZA 3CJNA 3JW4A 4ZZDA 1ONVA 3LQRA 4P55A 2VOOA 5KVRA 3R0JA 3QP6A 3M1EA 1YIOA 2DQLA 3BWGA 3E3VA 2D2WA 3M8EA 3NQOA 4P5OA 1IN7A 1UHMA 3MQ0A 1TNTA 1KU9A 3L09A 5LEJA 1R1VA 4HF0A 3I0TA 4S04A 5DYMA 2W25A 3KP4A 1F1ZA 5BPIA 2H09A 3JTHA 3I59A 2L3DA 3WU0A 2YPRA 2F5FA 4L9VA 3O6BB 1I5ZA 3FZVA 1XGSA 2WC2A 1HW1A 2FSWA 3HRSA 1BJAA 4ENMA 1XGMA 1DPRA 2D45A 4HZFA 2DW4A 1TTYA 4OINF 2ZO4A 3ROUA 1ZREA 2FF4A 3WGHA 1XCVA 2EFNA 4M72A 2ZMEB 2K02A 5D5XB 2A68F 3BJ6A 4XBFA 4UV9A 4MEXF 4EM1A 4P9UA 4BH9A 1O57A 3HIFA 4A0YA 4A6DA 1T98A 3P9IA 1YW7A 4KN7X 3REOA 5E8GA 2OA4A 1BM9A 4U0WA 5FFZA 2UXXA 1J9IA 2XAFA 3ZMDA 1S29A 5ICGA 4IF4A 3HSRA 2PMHA 1BC8C 4M9ZA 4QLCU 4G8XA 1D3YA 4WF2A 2HQRA 1ON2A 2MC3A 3HOTA 2FBIA 5E17F 2P4WA 4JK1X 4O5VA 4XSZF 3WTTC 4ESJA 3KEQA 2DBBA 5IT9K 2TDXA 3KETA 2G7UA 1ZN2A 3J81Z 2NYXA 2XHKA 3Q9SA 5JVTA 1NHAA 3TO7A 1XMAA 3I53A 3M9AA 3ZMSA 2EV5A 4MHGA 3ULQB 4RB3C 5KK1A 5HS8A 1KQ0A 3HOSA 3CDHA 2FE3A 3I59B 1Z05A 2YU3A 4U0VA 2KKOA 3RTRA 4FX0A 3TDUC 1RUNA 3ML6A 3GZ5A 1R58A 3KLOA 1UHWA 1XSXA 2FQ3A 1OR7A 4LB5A 3L2CA 1BI2A 3LSTA 1IN5A 3WGIA 2P5KA 2IJLA 3HHHA 1ZH5A 5DDGA 2VC1A 5J6XA 2XIGA 2JT1A 4KYWA 5HDKA 1S6LA 3I54A 3E5QA 5D4SA 5FGMA 3WTYC 5LRRA 5DEQA 2YR2A 1Z6RA 4L9TA 2DT5A 4LFUA 3ELKA 3WE3A 5DUIA 4M6YA 5JI6A 4IHSA 4ESFA 3WTVC 2GXGA 1FSHA 4HV6A 3SQNA 2JRTA 5TRDA 3EDPA 3P7NA 3S2WA 1RIOH 1LDJA 2CQKA 2V1XA 4UVCA 1TLHB 4DNCA 4CYDA 5FFXA 2O0YA 1D5VA 3CTAA 1YG2A 4M6XA 3QP5A 3KE2A 4A5MA 3T1BA 4NHJA 3FMRA 1OPCA 2IA2A 3U2RA 3TOBA 1IRGA 3KP2A 4Y15A 3RKXA 5D5WB 3RKYA 4UNOA 2XKOA 5L3EA 4KIFA 2CO5A 2LNBA 2ESNA 1YLFA 2QM3A 5FLXZ 4UUVA 3LFKA 4IVNA 5IT3A 1U3EM 3WTZA 2D1HA 4WXHA 2CGPA 2L4AA 2E7XA 1TW3A 1ZRFA 2RKHA 2WWYA 2FOKA 2NNNA 5D8LB 3TQNA 5K5OA 4RGRA 2L54A 5CVJA 2M5WA 2LF8A 3E5UA 1FX7A 4CHUA 4MQ9F 3E6MA 4YG2F 2PBIA 2OU2A 1K7AA 2NS0A 3V8LA 1WKMA 1C0WA 1P4AA 1B9NA 1H9TA 1V4RA 3C1DA 4LLGF 1ZG5A 1G3TA 2OZUA 1KU7A 4XRFA 2LF7A 4KFCA 2AS5F 1ZGJA 2HKXA 5L3BA 1IUYA 3JSOA 1JHHA 3DEUA 4LGWA 1ZG3A 2A6EF 2ISZA 4LG0B 3LA3A 1GXPA 5DCFA 3SXYA 4MNUA 1USTA 4PDKA 4IXAA 4UHTA 3FF5A 3JAMZ 3V7SA 1A04A 3KEOA 1BC7C 1XMKA 1YTYA 1MJBA 3BOQA 4KIGA 5EEGA 2HYGD 1IXSB 2PN6A 3WTSC 1ZARA 1K79A 2FMLA 1L0OC 1TQIA 1OKRA 3FMQA 4OOIA 2EK5A 4BAYA 4XLPF 3C7JA 2JSCA 3K1MA 3GVAA 1G6NA 1HKTA 1MKMA 2DI3A 4I7HA 1LDDA 1S7AA 2Y48A 1XGOA 5LHHA 3KCCA 3U9GA 1OYYA 2GQQA 3SFZA 1BIAA 5HDGA 4G9YA 2OAZA 4O6JA 5A2QK 3LA7A 2Y75A 2ZCWA 3VEPA 1ZGAA 3CUOA 6PAXA 4A0ZA 5LLQA 2CW0F 2MH9A 4Y13A 5ICEA 3W6JB 1YS7A 4PZJA 1UFMA 1ZRDA 3HYIA 1IN4A 5E20A 1YYVA 3BPXA 2EFOA 3FXQA 3GW2A 3H3ZA 1FYKA 3OV8A 2XAJA 5EEHA 3WGGA 1XDUA 3PQJA 1W4MA 2UZKA 4KNYA 3RYRA 4AIJA 4Q47A 3ISPA 3P9CA 1LNWA 4A2UA 4A5NA 2O03A 5CVIA 3LQQA 4RGUA 2IW5A 4I98B 2M30A 1Z6TA 1O3RA 4M73A 4S05A 1AOYA 3P9KA 5ILVA 3J80K 3FM3A 2J5OA 2MH2A 5J8FA 1P92A 4BHPA 2GIVA 1FP2A 5H20A 1Y0UA 4HLXA 4WXCA 1DPUA 5JHUA 1KYZA 4UVAA 3FWEA 4HLYA 4G7OF 4EVIA 1HQCA 4U7DA 3LAPA 3BP8A 1KGSA 3COAC 1SD6A 2BBYA 3QU6A 1KA8A 4CO8A 2ETHA 1FY7A 5DUKA 4BQAA 3T5XA 4DQ2A 2UXNA 3LAJA 4HX7A 1JGSA 4Y17A 1XN7A 5LGUA 4KUMA 3I58A 1PP7U 1B4AA 1Z91A 2J5PA 3IRQA 2VBZA 3BDDA 4IPAA 3B73A 3DF8A 4KIBA 3V4GA 1PUEE 2V6CA 1MJ9A 2IA1A 4MTEA 2RVCA 4BXUA 3AAFA 3WTUC 2HGCA 1E2XA 2XRNA 1RI7A 3MWMA 4EJTA 2VOPA 2FEZA 4MEYF 3TGNA 3ZMZA 1GXQA 3I4PA 3HTUA 2Z9OA 1ON1A 4G6QA 2L01A 3GX4X 3K1NA 3N97A 3HHGA 4ON0A 5HLIA 2A07F 2HZTA 5LHIA 3H3UA 3HRUA 1UCRA 2QYOA 1YO5C 3O3KA 2Q0OA 2ZBKA 3K69A 1LEBA 2ISYA 3NEUA 1T39A 2MD5A 3KFWX 1O7LA 5HLHA 5HS7A 5F1RA 3K0LA 3LA2A 4K2EA 1B9MA 3L7WA 4GYIA 1YW9A 2BV6A 2Z99A 4XLNF 1T6SA 1OYWA 3SZPA 2EA2A 1FYMA 4IJAA 1XD7A 1EH8A 1WI9A 4RB0A 5IT9Z 1IXRC 5E1XA 2PI0A 5DD4A 1K6OA 2C6YA 5ERIA 1BIBA 2FNAA 2M87A 1MJAA 1U8RA 1XSDA 1D8JA 1RZ4A 5LHGA 2A3SA 4G94A 3L00A 1KYWA 2H94A 3ABTA 1FZPB 1QNTA 2HEOA 2LDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP8 F;  2K7L A;  3ZQ7 A;  5F6F A;  4HBL A;  3CUQ C;  4KN4 X;  2AXL A;  2LKP A;  4LK0 F;  2E1C A;  2KIF A;  2VBX A;  4EGZ A;  4LLL A;  4I09 A;  3I71 A;  5BS6 A;  2DU9 A;  4NQW A;  3HSF A;  3IKT A;  1FBQ A;  3R6S A;  1W5S A;  3M8F A;  2STW A;  1QBJ A;  3RPQ A;  3KP6 A;  4HA8 A;  1G3S A;  3LWF A;  5E18 F;  2WV0 A;  2XAS A;  1B59 A;  2RC4 A;  2L4M A;  4R79 A;  2GA1 A;  4M71 A;  1YFH A;  3TKY A;  1BI0 A;  2D1V A;  5LRS A;  1DP7 P;  2Q2E A;  1HBX G;  5HVQ C;  5ED4 A;  3JSP A;  2ZFW A;  4ENJ A;  3I64 A;  2FRH A;  4UVB A;  1W7P A;  1REP C;  3ZMT A;  3F8C A;  2IRF G;  1T0F A;  4YFK F;  2DK8 A;  1IAW A;  2E1N A;  2W85 A;  2L02 A;  3HRT A;  3G3Z A;  4A0X A;  1FYL A;  4G7H F;  4AIK A;  3RDI A;  3JTG A;  4HV5 A;  3GO5 A;  2WTE A;  2R7D A;  1DDN A;  2HYF A;  2P8T A;  1H0M A;  3GFI A;  1STZ A;  3B02 A;  2PEX A;  2GWR A;  3CLO A;  2HFH A;  1ZYR F;  2ELH A;  1HSJ A;  5DCM A;  2QVO A;  4CZZ A;  2VON A;  4TV7 A;  2A61 A;  4EJU A;  2ZKZ A;  3DFG A;  1QPM A;  2FBH A;  4LK1 F;  4EGY A;  3C3W A;  4U0Y A;  2DAO A;  2MLK A;  4F7Z A;  2HDC A;  4A12 A;  3O2P E;  3MEX A;  4GCV A;  5HLG A;  1FSE A;  2COM A;  5K5R A;  1B1B A;  5DD8 A;  1ZRC A;  2XAQ A;  3ZP5 A;  5CJ9 A;  3DPT A;  4HDV A;  2HKO A;  4MGR A;  2RNJ A;  4YIF A;  3EYI A;  1IN8 A;  1JE8 A;  3DV8 A;  2GZW A;  3TO6 A;  4L0Y B;  3N4M A;  1P4W A;  4PGG A;  2R3S A;  4EJW A;  2QQA A;  4BYY A;  3OOP A;  2B0L A;  2PLY A;  4MQV A;  5D8K B;  5LEK A;  3GFJ A;  4I02 A;  2CG4 A;  2RV8 A;  4G7Z F;  4B09 A;  4OMY A;  4RGX A;  4O3M A;  3V7R A;  1KU2 A;  4YFX F;  2BYV E;  4GXO A;  4EJV A;  1G4D A;  1J75 A;  3FXR A;  2IA0 A;  4ETS A;  3GZ6 A;  3KZZ A;  2W24 A;  3DKW A;  4WK8 F;  1HST A;  4LD5 A;  2P7V B;  4G6D A;  2PG4 A;  2NRA C;  4A6E A;  5HS9 A;  2G7H A;  5LGT A;  4P9F A;  2A5Y B;  2OZ6 A;  1HW5 A;  3F3X A;  4ASN A;  2ZNZ A;  3WTX C;  4ZYG A;  4AWX B;  1R7J A;  2ESH A;  2IVM A;  1O3T A;  4B8X A;  4H0E A;  3ERE D;  2V1U A;  1LJ9 A;  4L5I A;  4U88 A;  2VT3 A;  2OQG A;  3GEZ A;  4R1H A;  1D8K A;  4HF1 A;  4L5J A;  5CVU A;  3KP7 A;  5A2Q Z;  2IPQ X;  2VBW A;  2XAG A;  4M74 A;  1TQP A;  2MBF A;  4ZYE A;  1R23 A;  4L0Z B;  2PFB A;  1BN5 A;  4QWQ A;  1J59 A;  2F2E A;  4JQF A;  2A69 F;  1PDN C;  1QQI A;  2IT0 A;  4JBA A;  3F23 A;  4E70 A;  2VE9 A;  3GXO A;  4IRG A;  1SFU A;  3BJA A;  3FX3 A;  2DPU A;  2ZNY A;  3SZT A;  1CGP A;  5JFR A;  1K78 A;  4HQM A;  4OIP F;  1FPQ A;  4FT8 A;  1KQ9 A;  4HF2 A;  2XGX A;  4KMF A;  4PCQ A;  3D5L A;  5FO5 A;  1IW7 F;  2Z3Y A;  1SD5 A;  5E1W A;  4Q5S F;  4CXF A;  4IRI A;  2EA4 A;  2HS5 A;  4OIR F;  3ABU A;  3RIR A;  1U6G A;  3FM5 A;  3V8J A;  3J80 Z;  1BI3 A;  1TBX A;  3E97 A;  2YX4 A;  1R36 A;  3V7C A;  2P6T A;  3IRR A;  3K9T A;  4LB6 B;  1KQ8 A;  2HTS A;  3F72 A;  1FBS A;  2V1D A;  5FB2 A;  1ZG1 A;  2M1B A;  2CFX A;  3J7A O;  5L3F A;  1SMT A;  5AIQ A;  5BPD A;  3R4K A;  1CF7 A;  1S7O A;  4MTD A;  2FNP A;  1T2K A;  4PGH A;  2O61 A;  1FNN A;  1JHF A;  1QO0 D;  2GAU A;  1W7P D;  1F4K A;  1R5H A;  2QUF A;  5HDN A;  5E1Z B;  3QPT A;  2BE5 F;  5ICC A;  1HKS A;  1XDS A;  1F9N A;  3R60 A;  2EJR A;  4KT5 C;  4EV0 A;  1QZY A;  2EB7 A;  2VOD A;  5ILS A;  3MZH A;  1TQM A;  2M8E A;  2LSO A;  2EWN A;  4CGZ A;  1LEA A;  4HAM A;  1G3W A;  1H9G A;  4AVP A;  4P96 A;  2FMY A;  1I1S A;  2PMU A;  2H6C A;  5CLS A;  3HSE A;  4LMY A;  3RPU A;  1SFX A;  1WRJ A;  4R8H A;  2KIM A;  1I6X A;  2KRF A;  2O3F A;  1V3F A;  1P4X A;  3RI4 A;  1MDM A;  2XKP A;  3KLN A;  1LVA A;  2DQR A;  3QRF F;  2YSR A;  2VC0 A;  5D5U B;  4AIH A;  3IC7 A;  1I27 A;  1QZZ A;  4KMU X;  2RDP A;  1IF1 A;  4ENK A;  1K78 B;  4WWC A;  1USS A;  1DUX C;  1KU3 A;  2CWE A;  1WQ2 A;  3HUG A;  3QU3 A;  4BHC A;  2JPB A;  2F5E A;  2ADU A;  3GLX A;  3KZY A;  2EV6 A;  1P2F A;  5L3G A;  2EFW A;  3I5U A;  1U5T A;  2ZJ2 A;  4ZZL A;  4I0B A;  2QQB A;  2F5C A;  2DK5 A;  2HOE A;  3IL2 A;  1EH7 A;  3T8R A;  2DTR A;  3BY6 A;  2VT2 A;  3QOP A;  4UV8 A;  4ESB A;  3EQL F;  4GO1 A;  3VB2 A;  1GHC A;  3NRV A;  2BEO A;  4N9I A;  1CF7 B;  2JTV A;  2V79 A;  4UXN A;  3GF2 A;  1O3S A;  2IP2 A;  1FP1 D;  4RAY A;  1ODD A;  2F5D A;  2Q8K A;  1HKQ A;  1X3U A;  4GGG A;  1SAX A;  2K4J A;  3GYH X;  2K4B A;  4L18 B;  2Z33 A;  4YII A;  3M7G A;  3RKW A;  2HTJ A;  2DFI A;  1BBY A;  1WSU A;  5FD5 A;  4U7B A;  1R22 A;  3IHU A;  2BGC A;  3DQV C;  1L3L A;  3WU1 B;  1HXD A;  1Z7U A;  1JXS A;  2VN2 A;  1AWC A;  3GWZ A;  4KIC A;  3VOD A;  3V8K A;  2QBY A;  4KDP A;  3F6V A;  2VBY A;  2EFP A;  2QQ9 A;  5CYV A;  3K2Z A;  4WCG A;  1EV7 A;  4YFN F;  1FT9 A;  4CIC A;  4AD9 A;  4Q48 A;  3E5X A;  4EM2 A;  5D6E A;  2DLL A;  2OBP A;  1MDM B;  4OIO F;  1RNL A;  2K27 A;  3SHF A;  4Q4Z F;  5JR3 A;  4RS8 A;  3MFK A;  1BOA A;  3J81 K;  2VXZ A;  4EJO A;  3RYP A;  1FLI A;  4ZH4 F;  5LBQ A;  4L9N A;  3QAH A;  1T38 A;  2QZ8 A;  1U5T B;  4Z2Y A;  3HTS B;  2V9V A;  5K1Y A;  1J7K A;  1GVJ A;  1ZLK A;  4RB2 C;  2DPD A;  1IRF A;  1YS6 A;  3RJP A;  1O3Q A;  3TDZ C;  1YQA A;  3ZPL A;  1W5T A;  1IN6 A;  4GYG A;  2PJP A;  3PQK A;  3FHZ A;  3F21 A;  4LG0 A;  1S3J A;  1OMI A;  1ULY A;  3HRM A;  5FD6 A;  1Z1D A;  3W6K B;  4ZYH A;  1E17 A;  3C18 A;  2P5L C;  3BZ6 A;  3VOE A;  3WOD F;  1OYI A;  2P5V A;  3D0S A;  3R0A A;  3EET A;  1F5T A;  4HW0 A;  1TW2 A;  4HX8 A;  4BNC A;  5CVR A;  5D5V B;  1R1T A;  2W84 A;  5TJJ A;  2XUB A;  3E6B A;  1G3Y A;  1SD4 A;  2MLG A;  5ICF A;  2QBY B;  3BJO A;  1VTN C;  2YX7 A;  4OU0 A;  3Q5F A;  5K5Q A;  1U78 A;  4I0A A;  3ZN0 A;  5E8I A;  3BPV A;  4IRH A;  4EMS A;  3DPL C;  2OQR A;  3IWZ A;  1Q1H A;  2EFQ A;  3K1P A;  3GUD A;  2FA5 A;  2QLZ A;  3DP7 A;  3ECO A;  3ZMV A;  1BI1 A;  2Y0M A;  5D4R A;  2QWW A;  2JZY A;  1FC3 A;  3MAJ A;  5HOO A;  3T0Y A;  4EQQ A;  4NB5 A;  3R61 A;  2ACJ A;  4ZYD A;  4FX4 A;  2HWV A;  2MA3 A;  3FXU A;  4I01 A;  3F8M A;  2RGV A;  2NNY A;  5FLX K;  5J8C A;  3KP3 A;  3FMS A;  1HW2 A;  3T8T A;  2UWM A;  5CVV A;  4ENN A;  5AON A;  4D0P A;  2G9W A;  1W7P B;  1S8N A;  3F22 A;  1R00 A;  2HQN A;  2CSO A;  3QPH A;  5DV5 A;  3IKV A;  4BHB A;  4HOB A;  2JPC A;  1MD0 A;  3L9F A;  3Q9V A;  2HR3 A;  2RQP A;  2EV0 A;  1R1U A;  2K86 A;  1EH6 A;  3CUQ A;  3WE2 A;  4M9S A;  1WWX A;  1P6R A;  1U2W A;  2PQ8 A;  3F8N A;  2RN7 A;  2O8X A;  2O6G E;  2Z5U A;  2XVC A;  5DCM B;  4LLN A;  4HQE A;  3PFI A;  3WTW C;  2H27 A;  4HX4 A;  2FXA A;  4RGS A;  3F8F A;  1MZB A;  3MCZ A;  3E6D A;  1U5T C;  2M45 A;  3F6O A;  1LQ1 A;  4N0B A;  1FOK A;  1J2X A;  3EUH A;  1XCB A;  2STT A;  4XSX F;  3BRO A;  2CYY A;  1RUO A;  2FU4 A;  3IWF A;  4LJZ F;  1FBU A;  1MGT A;  5AIP A;  3JAM K;  2W57 A;  3KP5 A;  5L3D A;  3G73 A;  5F64 A;  2OD5 A;  1SMY F;  1FWZ A;  5L3C A;  3WG9 A;  2QEN A;  2ZXJ A;  4IHT A;  1QGP A;  3ZN1 A;  5LGN A;  2X0L A;  3VFZ A;  1LDK B;  1SD7 A;  4KA4 A;  1ZHF A;  1ZLJ A;  4RAZ A;  3MZY A;  2H6B A;  2XV4 S;  1XB4 A;  1IZ1 A;  4M9X A;  2FBK A;  4RB1 A;  1B6A A;  3ZMU A;  1J5Y A;  2DO7 A;  3TOA A;  4WX9 A;  2GXB A;  3EYY A;  5H6R A;  2E7W A;  1IXC A;  1I1G A;  2XAH A;  3E6C C;  1ZAO A;  1Z9C A;  2ZME A;  3H92 A;  2KIU A;  5D6F A;  1J0R A;  1XSV A;  2P7C B;  5BOX A;  2X4H A;  2NAZ A;  1LB2 A;  2A6H F;  2KJB A;  1R5G A;  4CDG A;  4EM0 B;  4HYE A;  1YW8 A;  1UB9 A;  3U1D A;  3CO6 C;  3DXJ F;  5H6Q A;  4I2O A;  3ECH A;  3GFL A;  4N9H A;  4L9J A;  2P6S A;  1XGN A;  2GA2 A;  2VE8 A;  3CUQ B;  2R7F A;  4HDU A;  1TNS A;  3CO7 C;  5ILU A;  3TO9 A;  2KJC A;  1O7F A;  5BQT A;  4OMZ A;  4OIQ F;  3F8B A;  1SFE A;  4FHT A;  4WXD A;  2XRO A;  3GFM A;  5BMZ A;  3CJN A;  3JW4 A;  4ZZD A;  1ONV A;  3LQR A;  4P55 A;  2VOO A;  5KVR A;  3R0J A;  3QP6 A;  3M1E A;  1YIO A;  2DQL A;  3BWG A;  3E3V A;  2D2W A;  3M8E A;  3NQO A;  4P5O A;  1IN7 A;  1UHM A;  3MQ0 A;  1TNT A;  1KU9 A;  3L09 A;  5LEJ A;  1R1V A;  4HF0 A;  3I0T A;  4S04 A;  5DYM A;  2W25 A;  3KP4 A;  1F1Z A;  5BPI A;  2H09 A;  3JTH A;  3I59 A;  2L3D A;  3WU0 A;  2YPR A;  2F5F A;  4L9V A;  3O6B B;  1I5Z A;  3FZV A;  1XGS A;  2WC2 A;  1HW1 A;  2FSW A;  3HRS A;  1BJA A;  4ENM A;  1XGM A;  1DPR A;  2D45 A;  4HZF A;  2DW4 A;  1TTY A;  4OIN F;  2ZO4 A;  3ROU A;  1ZRE A;  2FF4 A;  3WGH A;  1XCV A;  2EFN A;  4M72 A;  2ZME B;  2K02 A;  5D5X B;  2A68 F;  3BJ6 A;  4XBF A;  4UV9 A;  4MEX F;  4EM1 A;  4P9U A;  4BH9 A;  1O57 A;  3HIF A;  4A0Y A;  4A6D A;  1T98 A;  3P9I A;  1YW7 A;  4KN7 X;  3REO A;  5E8G A;  2OA4 A;  1BM9 A;  4U0W A;  5FFZ A;  2UXX A;  1J9I A;  2XAF A;  3ZMD A;  1S29 A;  5ICG A;  4IF4 A;  3HSR A;  2PMH A;  1BC8 C;  4M9Z A;  4QLC U;  4G8X A;  1D3Y A;  4WF2 A;  2HQR A;  1ON2 A;  2MC3 A;  3HOT A;  2FBI A;  5E17 F;  2P4W A;  4JK1 X;  4O5V A;  4XSZ F;  3WTT C;  4ESJ A;  3KEQ A;  2DBB A;  5IT9 K;  2TDX A;  3KET A;  2G7U A;  1ZN2 A;  3J81 Z;  2NYX A;  2XHK A;  3Q9S A;  5JVT A;  1NHA A;  3TO7 A;  1XMA A;  3I53 A;  3M9A A;  3ZMS A;  2EV5 A;  4MHG A;  3ULQ B;  4RB3 C;  5KK1 A;  5HS8 A;  1KQ0 A;  3HOS A;  3CDH A;  2FE3 A;  3I59 B;  1Z05 A;  2YU3 A;  4U0V A;  2KKO A;  3RTR A;  4FX0 A;  3TDU C;  1RUN A;  3ML6 A;  3GZ5 A;  1R58 A;  3KLO A;  1UHW A;  1XSX A;  2FQ3 A;  1OR7 A;  4LB5 A;  3L2C A;  1BI2 A;  3LST A;  1IN5 A;  3WGI A;  2P5K A;  2IJL A;  3HHH A;  1ZH5 A;  5DDG A;  2VC1 A;  5J6X A;  2XIG A;  2JT1 A;  4KYW A;  5HDK A;  1S6L A;  3I54 A;  3E5Q A;  5D4S A;  5FGM A;  3WTY C;  5LRR A;  5DEQ A;  2YR2 A;  1Z6R A;  4L9T A;  2DT5 A;  4LFU A;  3ELK A;  3WE3 A;  5DUI A;  4M6Y A;  5JI6 A;  4IHS A;  4ESF A;  3WTV C;  2GXG A;  1FSH A;  4HV6 A;  3SQN A;  2JRT A;  5TRD A;  3EDP A;  3P7N A;  3S2W A;  1RIO H;  1LDJ A;  2CQK A;  2V1X A;  4UVC A;  1TLH B;  4DNC A;  4CYD A;  5FFX A;  2O0Y A;  1D5V A;  3CTA A;  1YG2 A;  4M6X A;  3QP5 A;  3KE2 A;  4A5M A;  3T1B A;  4NHJ A;  3FMR A;  1OPC A;  2IA2 A;  3U2R A;  3TOB A;  1IRG A;  3KP2 A;  4Y15 A;  3RKX A;  5D5W B;  3RKY A;  4UNO A;  2XKO A;  5L3E A;  4KIF A;  2CO5 A;  2LNB A;  2ESN A;  1YLF A;  2QM3 A;  5FLX Z;  4UUV A;  3LFK A;  4IVN A;  5IT3 A;  1U3E M;  3WTZ A;  2D1H A;  4WXH A;  2CGP A;  2L4A A;  2E7X A;  1TW3 A;  1ZRF A;  2RKH A;  2WWY A;  2FOK A;  2NNN A;  5D8L B;  3TQN A;  5K5O A;  4RGR A;  2L54 A;  5CVJ A;  2M5W A;  2LF8 A;  3E5U A;  1FX7 A;  4CHU A;  4MQ9 F;  3E6M A;  4YG2 F;  2PBI A;  2OU2 A;  1K7A A;  2NS0 A;  3V8L A;  1WKM A;  1C0W A;  1P4A A;  1B9N A;  1H9T A;  1V4R A;  3C1D A;  4LLG F;  1ZG5 A;  1G3T A;  2OZU A;  1KU7 A;  4XRF A;  2LF7 A;  4KFC A;  2AS5 F;  1ZGJ A;  2HKX A;  5L3B A;  1IUY A;  3JSO A;  1JHH A;  3DEU A;  4LGW A;  1ZG3 A;  2A6E F;  2ISZ A;  4LG0 B;  3LA3 A;  1GXP A;  5DCF A;  3SXY A;  4MNU A;  1UST A;  4PDK A;  4IXA A;  4UHT A;  3FF5 A;  3JAM Z;  3V7S A;  1A04 A;  3KEO A;  1BC7 C;  1XMK A;  1YTY A;  1MJB A;  3BOQ A;  4KIG A;  5EEG A;  2HYG D;  1IXS B;  2PN6 A;  3WTS C;  1ZAR A;  1K79 A;  2FML A;  1L0O C;  1TQI A;  1OKR A;  3FMQ A;  4OOI A;  2EK5 A;  4BAY A;  4XLP F;  3C7J A;  2JSC A;  3K1M A;  3GVA A;  1G6N A;  1HKT A;  1MKM A;  2DI3 A;  4I7H A;  1LDD A;  1S7A A;  2Y48 A;  1XGO A;  5LHH A;  3KCC A;  3U9G A;  1OYY A;  2GQQ A;  3SFZ A;  1BIA A;  5HDG A;  4G9Y A;  2OAZ A;  4O6J A;  5A2Q K;  3LA7 A;  2Y75 A;  2ZCW A;  3VEP A;  1ZGA A;  3CUO A;  6PAX A;  4A0Z A;  5LLQ A;  2CW0 F;  2MH9 A;  4Y13 A;  5ICE A;  3W6J B;  1YS7 A;  4PZJ A;  1UFM A;  1ZRD A;  3HYI A;  1IN4 A;  5E20 A;  1YYV A;  3BPX A;  2EFO A;  3FXQ A;  3GW2 A;  3H3Z A;  1FYK A;  3OV8 A;  2XAJ A;  5EEH A;  3WGG A;  1XDU A;  3PQJ A;  1W4M A;  2UZK A;  4KNY A;  3RYR A;  4AIJ A;  4Q47 A;  3ISP A;  3P9C A;  1LNW A;  4A2U A;  4A5N A;  2O03 A;  5CVI A;  3LQQ A;  4RGU A;  2IW5 A;  4I98 B;  2M30 A;  1Z6T A;  1O3R A;  4M73 A;  4S05 A;  1AOY A;  3P9K A;  5ILV A;  3J80 K;  3FM3 A;  2J5O A;  2MH2 A;  5J8F A;  1P92 A;  4BHP A;  2GIV A;  1FP2 A;  5H20 A;  1Y0U A;  4HLX A;  4WXC A;  1DPU A;  5JHU A;  1KYZ A;  4UVA A;  3FWE A;  4HLY A;  4G7O F;  4EVI A;  1HQC A;  4U7D A;  3LAP A;  3BP8 A;  1KGS A;  3COA C;  1SD6 A;  2BBY A;  3QU6 A;  1KA8 A;  4CO8 A;  2ETH A;  1FY7 A;  5DUK A;  4BQA A;  3T5X A;  4DQ2 A;  2UXN A;  3LAJ A;  4HX7 A;  1JGS A;  4Y17 A;  1XN7 A;  5LGU A;  4KUM A;  3I58 A;  1PP7 U;  1B4A A;  1Z91 A;  2J5P A;  3IRQ A;  2VBZ A;  3BDD A;  4IPA A;  3B73 A;  3DF8 A;  4KIB A;  3V4G A;  1PUE E;  2V6C A;  1MJ9 A;  2IA1 A;  4MTE A;  2RVC A;  4BXU A;  3AAF A;  3WTU C;  2HGC A;  1E2X A;  2XRN A;  1RI7 A;  3MWM A;  4EJT A;  2VOP A;  2FEZ A;  4MEY F;  3TGN A;  3ZMZ A;  1GXQ A;  3I4P A;  3HTU A;  2Z9O A;  1ON1 A;  4G6Q A;  2L01 A;  3GX4 X;  3K1N A;  3N97 A;  3HHG A;  4ON0 A;  5HLI A;  2A07 F;  2HZT A;  5LHI A;  3H3U A;  3HRU A;  1UCR A;  2QYO A;  1YO5 C;  3O3K A;  2Q0O A;  2ZBK A;  3K69 A;  1LEB A;  2ISY A;  3NEU A;  1T39 A;  2MD5 A;  3KFW X;  1O7L A;  5HLH A;  5HS7 A;  5F1R A;  3K0L A;  3LA2 A;  4K2E A;  1B9M A;  3L7W A;  4GYI A;  1YW9 A;  2BV6 A;  2Z99 A;  4XLN F;  1T6S A;  1OYW A;  3SZP A;  2EA2 A;  1FYM A;  4IJA A;  1XD7 A;  1EH8 A;  1WI9 A;  4RB0 A;  5IT9 Z;  1IXR C;  5E1X A;  2PI0 A;  5DD4 A;  1K6O A;  2C6Y A;  5ERI A;  1BIB A;  2FNA A;  2M87 A;  1MJA A;  1U8R A;  1XSD A;  1D8J A;  1RZ4 A;  5LHG A;  2A3S A;  4G94 A;  3L00 A;  1KYW A;  2H94 A;  3ABT A;  1FZP B;  1QNT A;  2HEO A;  2LDU A; 
#chains in the Genus database with same CATH topology
 3I56 I;  1PP8 F;  2JSP A;  1A6I A;  4UUS A;  2MW8 A;  3ZXS A;  1BA5 A;  2Y0S A;  2K7L A;  3ZQ7 A;  5F6F A;  2Q1Z B;  4HBL A;  2JVG A;  1U9N A;  5CQE A;  3GLL A;  3PFY A;  3BG9 A;  3CUQ C;  4KN4 X;  2AXL A;  1RPW A;  2LKP A;  3E7L A;  4LK0 F;  2E1C A;  2KIF A;  2QEX I;  2VBX A;  3MKZ A;  1YRN A;  2L7F P;  4DBR A;  3D1N I;  3I4N J;  2QA4 I;  4EGZ A;  3FKI J;  4LLL A;  3BR3 A;  1F43 A;  4I09 A;  2R92 J;  3I71 A;  2OV7 A;  1VQ8 I;  1UJ8 A;  4B47 A;  3DPU A;  1ETQ A;  5BS6 A;  2QKL B;  4ABZ A;  2XGC A;  2DU9 A;  4AM3 A;  3SZG A;  1MSE C;  3O8G A;  4NQW A;  4XOP A;  2LLK A;  3HSF A;  3IKT A;  1FBQ A;  3R6S A;  1W5S A;  1R4M B;  3M8F A;  2STW A;  2L7M P;  3S1R J;  1QBJ A;  2XPU A;  2ZB9 A;  1SAN A;  2V9P A;  3RPQ A;  2NVQ J;  3KP6 A;  5M5Y J;  4HA8 A;  2VPL A;  3DTK A;  1G3S A;  3CJT B;  3LWF A;  3G1L A;  4QSH A;  5E18 F;  2WV0 A;  2XAS A;  1K4S A;  1Y8R B;  1B59 A;  2RC4 A;  4LOC A;  3K4J A;  2KDZ A;  2L4M A;  4R79 A;  1JT6 A;  3QYF A;  2GA1 A;  4M71 A;  3H0D A;  5K7Z A;  1YFH A;  3GBG A;  2K9L A;  3SDB A;  3TKY A;  1BI0 A;  3MKW B;  2D1V A;  5LRS A;  3K4N A;  1DP7 P;  2Q2E A;  1HBX G;  5HVQ C;  3CCE I;  4BU2 A;  5ED4 A;  3JSP A;  2ZFW A;  4ENJ A;  1WJC A;  3I64 A;  2I8D A;  2FRH A;  3JRH A;  4BAC A;  4UVB A;  1W7P A;  2XB0 X;  1WJA A;  2DOA A;  2CQN A;  1REP C;  3ZMT A;  3F8C A;  4HSR A;  2IRF G;  3OWT A;  3JRF A;  1T0F A;  1RKT A;  1EKE A;  3LSJ A;  5FKO A;  4YFK F;  4M3B A;  2DK8 A;  2WAE A;  1IAW A;  2E1N A;  4BY1 J;  4QPO A;  2W85 A;  2VLA A;  2L02 A;  3HRT A;  3G3Z A;  4A0X A;  1FYL A;  4G7H F;  4AIK A;  3W3C A;  3RDI A;  1YIT I;  3JTG A;  3A1Y A;  1UMQ A;  3CCL I;  2E19 A;  4HV5 A;  3GO5 A;  1YOV B;  2DFF A;  2WTE A;  4C9Y A;  2E2H J;  2R7D A;  1DDN A;  2HYF A;  2P8T A;  1RR8 C;  3A01 A;  3GFI A;  1H0M A;  3K4C A;  1STZ A;  3B02 A;  2PEX A;  2GWR A;  4GDF A;  2F4O B;  3CLO A;  2HFH A;  1ZYR F;  3K70 D;  2CV1 A;  2ELH A;  1UG2 A;  5FKL A;  3BR1 A;  4JP0 A;  1HSJ A;  5DCM A;  2QVO A;  5LFA A;  4ZC3 A;  4CZZ A;  4BGD A;  3Q0V A;  2PJR B;  4XR6 A;  4BE0 A;  1TWG J;  2VON A;  5EF6 A;  1UZC A;  4TV7 A;  1X2M A;  2A61 A;  2DMQ A;  4EJU A;  2ZKZ A;  3SYT A;  3BLY A;  2KRH A;  5JLW A;  1WGX A;  3DFG A;  2MD0 A;  1QPM A;  4M3F A;  2FBH A;  4LK1 F;  5M5X J;  4EGY A;  3H9J A;  2VJI A;  3LSI A;  2LMD A;  3C3W A;  4U0Y A;  1W5C C;  1VQL I;  2DAO A;  2MLK A;  1Z3X A;  4F7Z A;  2HDC A;  4A12 A;  3O2P E;  3MEX A;  3OMY A;  4GCV A;  2UV1 A;  2Y30 A;  5HLG A;  3OYM A;  2CUZ A;  1XPX A;  1FSE A;  1MBJ A;  2EZH A;  4E7S A;  2COM A;  3QWL A;  3HOW J;  5K5R A;  1B1B A;  4XIC A;  5DD8 A;  1ZRC A;  3NWT A;  2XAQ A;  3ZP5 A;  5CJ9 A;  2M4K A;  3M8J A;  5F0H A;  3DPT A;  2ZJQ F;  2QSH X;  5M3M J;  4HDV A;  2ZJP F;  2HKO A;  4MGR A;  2RNJ A;  4YIF A;  4UY8 I;  3K4L A;  3EYI A;  3RPU D;  2L7Z A;  4XOT A;  4XON A;  1IN8 A;  3CCV I;  1JE8 A;  1W36 C;  2EH3 A;  3DV8 A;  3KYC B;  2GZW A;  3TO6 A;  4JX4 A;  1YRN B;  1UEL B;  4L0Y B;  3N4M A;  4MIM A;  3EUK L;  3ZQF A;  4D7N A;  2V6E A;  1HC8 A;  1P4W A;  2DFE A;  4PGG A;  3O8H A;  1NH3 A;  4DZP A;  3HXL A;  3FK6 A;  4KIT B;  3BR2 A;  4GRI A;  3W2V A;  2R3S A;  4EJW A;  2H8R A;  3H9G A;  1GLN A;  2QQA A;  4BYY A;  3OOP A;  3S17 J;  1WJF A;  1Y56 A;  3HOY J;  4GFB A;  3DTE A;  4DYR A;  4W97 A;  2B0L A;  2PLY A;  4NQW B;  4MQV A;  2KZG A;  1LFP A;  5D8K B;  2L9V A;  2DA5 A;  2Z1D A;  5E3N A;  5LEK A;  3GFJ A;  4A69 C;  4I02 A;  1KON A;  2CG4 A;  2RV8 A;  4G7Z F;  2BY2 A;  2WAF A;  4XM3 A;  3HG9 A;  4B09 A;  2VKV A;  5JLX A;  4OMY A;  4RGX A;  4BS9 A;  2GLO A;  2JA6 J;  1TWH J;  4O3M A;  3V7R A;  3CC7 I;  1JKO C;  3G6E I;  2X6O A;  3CCU I;  1KU2 A;  4YFX F;  5LD2 C;  2BYV E;  4GXO A;  4EJV A;  1G4D A;  3QPL A;  1J75 A;  3FXR A;  1ZGW A;  1T8I A;  2IA0 A;  4ETS A;  3GZ6 A;  3KZZ A;  2L9R A;  2Q2E B;  2W24 A;  2WY7 Q;  4B3A A;  3DKW A;  2XSD C;  4WK8 F;  1HST A;  4LD5 A;  3V42 A;  2P7V B;  4G6D A;  2PG4 A;  2D5V A;  1TT0 A;  3LSK A;  2K9N A;  2NRA C;  4A6E A;  5HS9 A;  2G7H A;  5LGT A;  4P9F A;  2A5Y B;  5IPA A;  2OZ6 A;  1HW5 A;  3F3X A;  4ASN A;  2ZNZ A;  3WTX C;  3OYD A;  4ZYG A;  1VQ6 I;  5F0C A;  1BOB A;  4IHW A;  1D1A A;  3ZQG A;  4AWX B;  2EIK H;  1R7J A;  2ESH A;  2LK2 A;  3J7Y J;  2IVM A;  1OCZ H;  1U0J A;  3H5A A;  1O3T A;  4B8X A;  3ABK H;  2HQA A;  3L2R A;  3A01 B;  1OFC X;  3S16 J;  4H0E A;  5FLV A;  3ERE D;  3CCY A;  2V1U A;  1LJ9 A;  2JVH A;  4RMN A;  4L5I A;  4G12 A;  2X51 A;  4U88 A;  2VT3 A;  2OQG A;  3GEZ A;  4R1H A;  4MO7 A;  2R7S A;  4DW6 A;  1D8K A;  4HF1 A;  3D5S C;  4L5J A;  5CVU A;  4A3K J;  3KP7 A;  1ETV A;  5A2Q Z;  1VQN I;  4IHX A;  2IPQ X;  2VBW A;  2XAG A;  3FKJ A;  4M74 A;  1TQP A;  2MBF A;  3VYT B;  4C2M J;  1PJR A;  4ZYE A;  2XAU A;  3BC8 A;  1R23 A;  4L0Z B;  2PFB A;  1BN5 A;  4QWQ A;  1J59 A;  1JKP C;  3BTJ A;  2F2E A;  4JQF A;  1MBK A;  2Y9Z A;  2A69 F;  3M07 A;  3JCU C;  2GIZ A;  1MMS A;  2XSJ C;  4CCJ A;  1PDN C;  3CP8 A;  4XRS G;  2QCO A;  2HOS A;  3PJR A;  1WZ2 A;  1QQI A;  2IT0 A;  4JBA A;  1QVU A;  2ELK A;  4NC8 A;  4E70 A;  3F23 A;  2VE9 A;  3GXO A;  3Q0U A;  1VZ0 A;  4IRG A;  1V54 H;  3K4K A;  2K9S A;  1SFU A;  3BJA A;  1YIJ I;  1I50 J;  3RZO J;  2E2I J;  3FX3 A;  2VAS A;  2DPU A;  2ZNY A;  3SZT A;  1CGP A;  3BQY A;  5JFR A;  3H3V K;  1JKQ C;  1K78 A;  4HQM A;  4OIP F;  1FPQ A;  4FT8 A;  4OAZ A;  1KQ9 A;  4HF2 A;  2M7B A;  3MMY B;  2XGX A;  4KMF A;  4PCQ A;  5IYB J;  3D5L A;  4Y33 A;  1ETW A;  3TED A;  5FO5 A;  1IW7 F;  2R7O A;  2Z3Y A;  1SD5 A;  1LE8 A;  1W0U A;  5E1W A;  4Q5S F;  4CXF A;  5C3E J;  4IRI A;  3S3O A;  2EA4 A;  2HS5 A;  1VQ9 I;  2JWT A;  4OIR F;  3CDI A;  4BY7 J;  3ABU A;  3RIR A;  1U6G A;  3FM5 A;  3V8J A;  2IS4 A;  5J47 A;  3J80 Z;  4CCO A;  2E1O A;  3HJE A;  1BI3 A;  2ICW G;  4D5C A;  1TBX A;  3E97 A;  4RLF A;  1D0Y A;  4BJ5 C;  2LOO A;  1FOW A;  2NOJ B;  2YX4 A;  4LIV A;  1R36 A;  3QYB A;  2P6T A;  4NUB A;  4RAG A;  3V7C A;  3IRR A;  1Y1W J;  3K9T A;  4LB6 B;  1KQ8 A;  2HTS A;  1M1E B;  3F72 A;  5E79 C;  4AYB N;  4E7H A;  3ZCO A;  1FBS A;  2V1D A;  1A35 A;  3UKG A;  5FB2 A;  3FIW A;  2DYR H;  1ZG1 A;  1WI3 A;  2M1B A;  2CFX A;  3J7A O;  5L3F A;  1U8B A;  1SMT A;  3NAR A;  1IO2 A;  5AIQ A;  5BPD A;  3R4K A;  1CF7 A;  1S7O A;  4MTD A;  2FNP A;  1T2K A;  2HPI A;  3BCA A;  4PGH A;  3JRE A;  2O61 A;  4M3D A;  4DIQ A;  3OYJ A;  2VKD A;  1FNN A;  1H8A C;  3LSM A;  1JHF A;  1QO0 D;  2W00 A;  3G1O A;  4N4O B;  3OS0 A;  2GAU A;  3HPG A;  1W7P D;  1F4K A;  1PVE A;  1R5H A;  3OIP A;  2QUF A;  1HCR A;  3FXJ A;  2R7R A;  1P9Q C;  2E2J J;  5HDN A;  1S7E A;  5E1Z B;  3QPT A;  2CV2 A;  1V5G A;  2BE5 F;  2XDV A;  5ICC A;  1OR7 C;  4IQJ A;  1HKS A;  3RZD J;  2OTJ I;  1XDS A;  1F9N A;  4IO9 F;  3R60 A;  4IHY A;  2EJR A;  4XKC A;  4KT5 C;  4EV0 A;  1QZY A;  4FIS A;  2EB7 A;  2VOD A;  5ILS A;  3MZH A;  3RQ4 A;  2DA3 A;  2DT7 B;  1TQM A;  2M8E A;  2LSO A;  2EWN A;  4CGZ A;  3PM1 A;  1LEA A;  4HAM A;  1G3W A;  1YJ9 I;  1X1A A;  5EYR A;  1H9G A;  4AVP A;  4CH7 A;  2XF7 A;  2MGQ A;  2FMY A;  1OQY A;  4P96 A;  1I1S A;  2PMU A;  3BR5 A;  2H6C A;  1D0X A;  5CLS A;  4DYC A;  3HSE A;  4LMY A;  3RPU A;  1SFX A;  3GTL J;  5F04 A;  1WRJ A;  1GT0 C;  1T33 A;  4R8H A;  2XF5 A;  2KIM A;  1I6X A;  2KRF A;  2O3F A;  2JA7 J;  4V2F A;  1V3F A;  5M3F J;  3P5J A;  2DFH A;  2NS7 A;  3MZ8 A;  2NOG A;  1X58 A;  1P4X A;  1Z77 A;  3AKZ A;  4JOM A;  3LSR A;  3KYL A;  5IOZ A;  2EIL H;  3K7A J;  4BJT A;  4AU7 A;  3RI4 A;  2V1N A;  2EBI A;  2XKP A;  1MDM A;  3KLN A;  1LVA A;  2E5Z A;  2IGO A;  3BQZ A;  1PUF B;  2DQR A;  3QRF F;  2YSR A;  2VC0 A;  3S2D J;  3DU6 A;  3JRD A;  1EJ9 A;  4E6K G;  5D5U B;  3HEF A;  2IGM A;  3A0H C;  3E1S A;  4AIH A;  3IC7 A;  1I27 A;  1QZZ A;  4KMU X;  3S2H J;  2M2E A;  2RDP A;  4II3 A;  2HOA A;  2R5Y A;  1IF1 A;  1KZH A;  4C3H J;  4ENK A;  1K78 B;  4WWC A;  1USS A;  1DUX C;  1KU3 A;  3A4C A;  2CWE A;  1WQ2 A;  3HUG A;  3PIP F;  3WU2 C;  5C4J J;  3JRA A;  1R6R A;  3QU3 A;  4BHC A;  2L0K A;  2CQX A;  2JPB A;  3I4M J;  2F5E A;  2ADU A;  3GLX A;  4OWR B;  3KZY A;  1OCP A;  1YJN I;  1NG7 A;  2EV6 A;  1B8I A;  1P2F A;  2JK3 A;  4A3M J;  2X1C A;  5L3G A;  2W7N A;  2EFW A;  3I5U A;  1VQO I;  4A3C J;  1U5T A;  2ZJ2 A;  3ZGK A;  4ZZL A;  4LG3 A;  2CMP A;  4RAF A;  3OR1 C;  5F08 A;  4J00 A;  4I0B A;  4XOR A;  2AHQ A;  2QQB A;  2F5C A;  2HXI A;  2DK5 A;  2HOE A;  3IL2 A;  1EH7 A;  3T8R A;  2DTR A;  5HNF A;  2W1O A;  3BY6 A;  2VT2 A;  1MNM C;  4PFO A;  1AA7 A;  2KPM A;  3QOP A;  4UV8 A;  2MAB A;  4ESB A;  1N77 A;  1JJ6 C;  5EG0 A;  1AKH A;  2ZXW H;  4Y52 J;  3S3N A;  1APL C;  2X48 A;  2KIQ A;  5EJC A;  5J1U A;  5IY5 H;  3ZQI A;  2XGD A;  3EQL F;  4GO1 A;  3VB2 A;  1GHC A;  4IOC F;  2AQE A;  2OCC H;  3NRV A;  2HI3 A;  2BEO A;  4N9I A;  1QHH D;  2JTV A;  1ETO A;  2V79 A;  3GF2 A;  4UXN A;  5HOD A;  1SC7 A;  4PJM A;  2W4S A;  1O3S A;  3GTQ J;  2IP2 A;  1FP1 D;  3G1M A;  4RAY A;  1ODD A;  2F5D A;  4J19 A;  2Q8K A;  3B6A A;  1HKQ A;  1X3U A;  4GGG A;  1SAX A;  2K4J A;  1T08 B;  4XLA A;  3GYH X;  2K4B A;  4L18 B;  2OF7 A;  2Z33 A;  3C2G A;  4YII A;  3M7G A;  3RKW A;  1I6H J;  3DLA A;  2HTJ A;  4F92 B;  3BG5 A;  2F4I A;  2DFI A;  1BBY A;  3IH2 A;  4HNT A;  5EGO B;  1WSU A;  5FD5 A;  4M3E A;  3ZQQ A;  4U7B A;  1R22 A;  1GV2 A;  3IHU A;  3HDD A;  3PL8 A;  2BGC A;  2R7W A;  3DQV C;  1L3L A;  3WU1 B;  3D5R C;  4BBS J;  1HXD A;  1Z7U A;  3J7A Y;  1JXS A;  3IUO A;  2VN2 A;  5CPR B;  5EZH A;  2ZJR F;  1AWC A;  5GAH J;  4AID A;  1X1B A;  1MMA A;  4F93 B;  4YIR X;  3GWZ A;  4PFP A;  4KIC A;  4BL0 B;  3VOD A;  1SFK A;  2KQR A;  2IBD A;  2TRT A;  3BG7 A;  3IV5 A;  3V8K A;  3SDG A;  2NVY J;  2QBY A;  2MC4 A;  4KDP A;  3F6V A;  2VBY A;  2EFP A;  4ZTJ A;  2QQ9 A;  1CQT A;  5CYV A;  3RQI A;  5HLT A;  4B48 A;  3K2Z A;  4WCG A;  1EV7 A;  4YFN F;  1FT9 A;  4CIC A;  4AD9 A;  3PSF A;  2M8G X;  4I76 A;  1V55 H;  5KAI C;  4Q48 A;  3E5X A;  4EM2 A;  1JGG A;  5D6E A;  4X6A J;  1MND A;  3CMY A;  1RC9 A;  2DLL A;  2OBP A;  1MDM B;  4OIO F;  1EF4 A;  1RNL A;  5JVG F;  5IP7 J;  2K27 A;  2QSF X;  1MMG A;  3SHF A;  3CMA I;  3S8P A;  4Q4Z F;  2CU7 A;  3ZQL A;  4CCM A;  3HL2 A;  1WH5 A;  2A6T A;  2VQL A;  5FRM A;  4F3Q A;  2R5Y B;  5JR3 A;  3BTC A;  3KZI C;  4RS8 A;  3MFK A;  5IP6 A;  1BOA A;  3DEE A;  3J81 K;  2VXZ A;  2JA8 J;  1I3Q J;  3HUG B;  4EJO A;  3KPH A;  3RYP A;  1FLI A;  4FCY A;  4HST A;  4ZH4 F;  3JRI A;  1A5J A;  3HPH A;  2GXA A;  3DEW A;  5LBQ A;  4L9N A;  3CCJ I;  4AC0 A;  1R71 A;  3QAH A;  5KCM A;  1BW6 A;  1T38 A;  1Z7L A;  2DMN A;  2KHM A;  2QZ8 A;  3F0C A;  3FK7 A;  1U5T B;  4Z2Y A;  3HTS B;  1MBH A;  2V9V A;  4HG2 A;  5K1Y A;  1N25 A;  4IKF A;  1J7K A;  1GVJ A;  2ME0 A;  5GAG J;  1ZLK A;  4RB2 C;  2DDA A;  1WJD A;  1IRF A;  2DPD A;  1YS6 A;  3FXK A;  4Y3O A;  3LFU A;  2MFZ A;  4CA0 A;  3RJP A;  1MIJ A;  2DA4 A;  1O3Q A;  4L5E A;  2LP0 A;  1Q1V A;  5EG0 B;  1AKH B;  3TDZ C;  3QOE A;  1YQA A;  5KHD A;  3ZPL A;  1W5T A;  3CES A;  1MBF A;  4BJ6 C;  1IN6 A;  1VQ7 I;  4GYG A;  3EUA A;  3GTP J;  3KYD B;  4JYK A;  2PJP A;  2BZT A;  3PQK A;  2VQH A;  1D1C A;  3TW7 A;  3FHZ A;  2R7V A;  1D1B A;  3F21 A;  4JX6 A;  5GAE J;  2K3F A;  4LG0 A;  1S3J A;  1OMI A;  1ULY A;  3ABM H;  3HRM A;  5FD6 A;  1Z1D A;  3VWB A;  2X6X A;  1DQU A;  3W6K B;  1E3O C;  3PUF A;  4ZYH A;  1E17 A;  3C18 A;  2P5L C;  3BZ6 A;  3VOE A;  4NBQ A;  3WOD F;  2A5W A;  4NC6 A;  3CP2 A;  1OYI A;  4B44 A;  5DS9 A;  2P5V A;  3D0S A;  1E3P A;  3R0A A;  3EET A;  1F5T A;  1S72 I;  1H88 C;  4B43 A;  3HGY A;  4HW0 A;  4F52 A;  1WJ5 A;  1X4O A;  1TW2 A;  4HX8 A;  4BNC A;  2DMT A;  4BDZ A;  5CVR A;  5D5V B;  1R1T A;  2W84 A;  1S5L C;  2E1M C;  5TJJ A;  2XUB A;  3E6B A;  5FRO A;  1V5F A;  1G3Y A;  4C3J J;  2KMU A;  2L2O A;  2XRL A;  3ESW B;  3L2W A;  2LC2 A;  3GTO J;  1SD4 A;  3CDL A;  2MLG A;  5ICF A;  3ZRG A;  2QBY B;  3PNY A;  5J1R A;  2WA0 A;  3BJO A;  5FRN A;  1VTN C;  4XNF A;  2YX7 A;  1N78 A;  4UUS B;  4OU0 A;  3Q5F A;  5K5Q A;  2VL8 A;  4XN3 A;  3K70 C;  1U78 A;  4I0A A;  2I5U A;  3ZN0 A;  4XRS A;  3AL0 B;  5E8I A;  3BPV A;  4IRH A;  2EIJ H;  3GME A;  4IX7 A;  4EMS A;  3SJM A;  3DPL C;  1H89 C;  2OQR A;  3OS1 A;  3IWZ A;  1Q1H A;  3DKY A;  2EFQ A;  3VDX A;  3K1P A;  3GUD A;  4PUS A;  2FA5 A;  2QLZ A;  3UR3 C;  3DP7 A;  5E3O A;  3I3L A;  3ECO A;  3NAU A;  2GBY A;  4BQQ A;  2XC7 A;  3ZMV A;  3KIO A;  1BI1 A;  2Y0M A;  3DU5 A;  5D4R A;  2QWW A;  2ID3 A;  2JZY A;  1IRZ A;  3HKZ N;  1FC3 A;  3MAJ A;  5HOO A;  3T0Y A;  1K83 J;  2VKH A;  2VJ5 A;  5GP9 A;  1ITY A;  4EQQ A;  4NB5 A;  2DT6 A;  3R61 A;  1RRJ A;  2CUF A;  2ACJ A;  2H1L A;  4ZYD A;  4FX4 A;  2HWV A;  2MA3 A;  3FXU A;  4I01 A;  1R9T J;  3CQZ J;  2E34 A;  3F8M A;  3HM5 A;  4C2T A;  2X6Y A;  3A02 A;  2RGV A;  2NS8 A;  2NNY A;  5FLX K;  5J8C A;  3KP3 A;  3FMS A;  2VJJ A;  1BR4 A;  1FOY A;  2HYJ A;  1HW2 A;  3T8T A;  5DTD A;  2KP6 A;  1TWF J;  2UWM A;  4RA2 A;  3HOZ J;  5CVV A;  3OYB A;  4ENN A;  5AON A;  4BKX A;  4D0P A;  1P7J A;  1VF9 A;  2K5C A;  2G9W A;  2K85 A;  1W7P B;  1G2H A;  3TMO A;  1LFU P;  1S8N A;  3F22 A;  1R00 A;  5J4V A;  2HQN A;  2CSO A;  4XKW A;  3QPH A;  5DV5 A;  3IKV A;  4BHB A;  5GTI C;  4HOB A;  1POG A;  4CUG A;  2JPC A;  1MD0 A;  3L9F A;  4YRV A;  3H5R A;  5FLM J;  3Q9V A;  2HR3 A;  2RQP A;  2VKE A;  3BCB A;  2EV0 A;  1R1U A;  2K86 A;  4D1Q A;  1EH6 A;  3CUQ A;  1WJE A;  4M9S A;  3WE2 A;  1WWX A;  2WAQ N;  4HNU A;  1P6R A;  1U2W A;  2CRG A;  1LVK A;  2PQ8 A;  2ECB A;  4IOA F;  3F8N A;  2RN7 A;  1XC5 A;  2ZFU A;  2O8X A;  2O6G E;  2Z5U A;  2XVC A;  2DTZ A;  5DCM B;  4LLN A;  3W2W A;  4HQE A;  3HB9 A;  3PFI A;  2BVL A;  3PO2 J;  3WTW C;  1AHD P;  2H27 A;  4XK4 A;  4HX4 A;  4E7K A;  2FXA A;  4RGS A;  1XG1 A;  3F8F A;  4ZDL A;  1MZB A;  3MCZ A;  2R0Q C;  1X1C A;  3E6D A;  5J40 A;  1U5T C;  2M45 A;  3F6O A;  1LQ1 A;  1X19 A;  3H5N A;  2VXD A;  4N0B A;  3VSL A;  2X85 A;  1NG6 A;  4MFD A;  1FOK A;  1J2X A;  1UAA A;  3EUH A;  2BHZ A;  1XCB A;  4FE7 A;  2STT A;  4XSX F;  3BRO A;  2CYY A;  1RUO A;  2EZL A;  4XL9 A;  4X0G A;  2FU4 A;  3IWF A;  1GDT A;  2ME6 A;  4LJZ F;  1FBU A;  1MGT A;  5E3L A;  1ERD A;  3K10 A;  5AIP A;  3JAM K;  2W57 A;  3KP5 A;  4BDY A;  5L3D A;  3G73 A;  5F64 A;  1MH4 A;  4BQO A;  2OD5 A;  3KX2 A;  1SMY F;  3NWS A;  1FWZ A;  3H35 A;  5L3C A;  2XPV A;  2R5Z A;  3WG9 A;  3S15 J;  2QEN A;  1HA8 A;  2ZXJ A;  4IHT A;  1QGP A;  3JRC A;  3ZN1 A;  5LGN A;  2FQ4 A;  2X0L A;  3LL7 A;  2WB1 N;  2CV0 A;  2HXO A;  2KDO A;  1ORK A;  3VFZ A;  3OYK A;  1OCR H;  1LDK B;  2I10 A;  3FBI B;  1SD7 A;  3CC4 I;  3MN2 A;  3FXO A;  2XB5 A;  1SVO A;  4QPQ A;  4KA4 A;  1ZHF A;  1ZLJ A;  4RAZ A;  3G4S I;  3MZY A;  2DA2 A;  1ZKG A;  3OYN A;  3FXM A;  1IRX A;  2K9M A;  2H6B A;  2XV4 S;  4FTH A;  1XB4 A;  1IZ1 A;  4DBQ A;  1D5Y A;  4MLO A;  3H36 A;  4M9X A;  5C44 J;  2KFD A;  1K4T A;  2FBK A;  5TGT A;  4RB1 A;  1B6A A;  3I9V 2;  1A6Q A;  1X1P A;  3ZMU A;  1J5Y A;  2DO7 A;  2H1K A;  3TOA A;  4WX9 A;  2GXB A;  3EYY A;  5H6R A;  1LUJ B;  2DA7 A;  4UB6 C;  2E7W A;  1IXC A;  1I1G A;  2XAH A;  3E6C C;  4CZC A;  1ZAO A;  1Z9C A;  2KLO A;  2VJ4 A;  2ZME A;  4CYC A;  3H92 A;  1FTT A;  2KIU A;  1HDP A;  5D6F A;  2HDD A;  1DU6 A;  1J0R A;  1XSV A;  2P7C B;  5BOX A;  1HDD C;  2X4H A;  3AL0 C;  2NAZ A;  4IQ4 A;  2WB1 A;  2OC6 A;  1LB2 A;  5K7F A;  2A6H F;  2X9D A;  4XLE A;  3L2Q A;  3DBH B;  2KJB A;  1R5G A;  4CDG A;  2O9L A;  4EM0 B;  4HYE A;  1TZL A;  1YW8 A;  1UB9 A;  2JRM A;  3U1D A;  3CZ6 A;  3CO6 C;  2IEK A;  3DXJ F;  5H6Q A;  1G8X A;  4I2O A;  3ECH A;  3GFL A;  4N9H A;  4RLQ A;  4L9J A;  2P6S A;  4BXF A;  1XGN A;  5EZG A;  2GA2 A;  2VE8 A;  4C30 A;  3CUQ B;  2R7F A;  2JJ7 A;  4HDU A;  1TNS A;  3CO7 C;  3TL4 X;  3SEQ A;  5ILU A;  4W1U A;  3TO9 A;  3TW6 A;  2COB A;  3B6C A;  2KJC A;  3W6V A;  2LYC A;  1O7F A;  2FX0 A;  5BQT A;  4OMZ A;  1B72 A;  4OIQ F;  3F8B A;  2MYS A;  3U1K A;  1CF7 B;  1SFE A;  2JA2 A;  4FHT A;  4WXD A;  4AYB A;  2XRO A;  2M0M A;  3GFM A;  4YEL A;  5BMZ A;  3CJN A;  3JW4 A;  4ZZD A;  2O7O A;  1MSF C;  5CKT A;  1ONV A;  3LQR A;  4P55 A;  4CCN A;  4UB8 C;  2VOO A;  5KVR A;  2O5R A;  2QKM B;  5FKN A;  2JA5 J;  3R0J A;  3OYA A;  3QP6 A;  3M1E A;  1UHS A;  1YIO A;  2DQL A;  3BWG A;  3E3V A;  2D2W A;  3M8E A;  3NQO A;  4P5O A;  4AVZ A;  3FIS A;  1IN7 A;  1GV5 A;  5DM7 F;  2DYS H;  3ERM A;  1ZEL A;  1UHM A;  2DOD A;  1VQ4 I;  3MQ0 A;  2ZC2 A;  1T0F C;  2CUE A;  2IS2 A;  1TNT A;  1KU9 A;  2CS3 A;  3HGG A;  4BQN A;  3L09 A;  1YX3 A;  5LEJ A;  1R1V A;  2R4G A;  4HF0 A;  3I0T A;  3CJR B;  2R5Z B;  4S04 A;  2E5N A;  5DYM A;  2W25 A;  2F48 A;  3KP4 A;  4I99 C;  1F1Z A;  5BPI A;  1JTX A;  2H09 A;  3IAS 2;  4F55 A;  3JTH A;  3I59 A;  2L3D A;  4S0H B;  3WU0 A;  2YPR A;  2F5F A;  4L9V A;  3VPR A;  2BOL A;  1I5Z A;  3O6B B;  4XKB A;  1TL8 A;  1X4P A;  2E60 A;  3FZV A;  1XGS A;  1SVM A;  2WC2 A;  1HW1 A;  2FSW A;  1PYV A;  1LE8 B;  3HRS A;  3U21 A;  2B63 J;  4AUX A;  1ETK A;  1BJA A;  1F36 A;  4ENM A;  1XGM A;  1ETX A;  2K40 A;  1DPR A;  1FIP A;  1GUU A;  3DBL B;  4KJZ A;  2D45 A;  4HZF A;  1K61 A;  2DW4 A;  2GOX B;  1TTY A;  4OIN F;  2CQQ A;  1Z3Y A;  4IZZ A;  2ZO4 A;  3ROU A;  3PUB A;  1ZRE A;  3OR2 C;  2FF4 A;  3GCM A;  3WGH A;  2KIS A;  4HEA 2;  1XCV A;  1FJL A;  2EFN A;  3CCM I;  3BT9 A;  3CF5 F;  1MNE A;  3ABL H;  4M72 A;  2ZME B;  4CYC B;  2K02 A;  3S32 A;  5D5X B;  2A68 F;  2IAI A;  2DN0 A;  3HOU J;  2CH0 A;  2IS6 A;  3BJ6 A;  4E4H A;  3G2B A;  1R49 A;  4XBF A;  1Z21 A;  4UV9 A;  2V26 A;  3M1C A;  2MG4 A;  3AG4 H;  3LOC A;  4MEX F;  4KT6 A;  4EM1 A;  1AU7 A;  2O8K A;  3QQA A;  4P9U A;  1JTY A;  4BH9 A;  3AG2 H;  1O57 A;  2ID6 A;  5BNG A;  2CW7 A;  3OYH A;  1BR2 A;  2AQF A;  4BE2 A;  2B7E A;  1IDZ A;  2QGU A;  2RNG A;  3HIF A;  3K4B A;  3C2H A;  2BY0 A;  4A0Y A;  2Y0S N;  4A6D A;  4Y4R A;  2DA1 A;  3DWL E;  2LG4 A;  2V7F A;  1T98 A;  3P9I A;  4N4N B;  5FJ8 J;  1YW7 A;  1IV6 A;  4KN7 X;  3REO A;  5E8G A;  2LBF A;  2OA4 A;  3RKQ A;  1BM9 A;  4U0W A;  2K9Q A;  1B72 B;  5FFZ A;  4ZDP A;  2UXX A;  1J9I A;  1RES A;  2XAF A;  3ZMD A;  1S29 A;  5ICG A;  4IF4 A;  3HSR A;  4HRI A;  4II2 A;  4C3I J;  2PMH A;  2BY1 A;  3FDY A;  3X2Q H;  2RRE A;  3LMM A;  3UNG C;  5GPC A;  2RQQ A;  1BC8 C;  4M9Z A;  2FJ1 A;  4G8X A;  4QLC U;  5HNH A;  1D3Y A;  3AG3 H;  4WF2 A;  4ZDO A;  2HQR A;  2E36 A;  1ON2 A;  3FHN A;  2MC3 A;  2HPM A;  3HOT A;  2FBI A;  5E17 F;  3BR0 A;  2P4W A;  4JK1 X;  3SFI A;  4O5V A;  4XSZ F;  4A3G J;  5B3S H;  3WTT C;  4ESJ A;  2VPR A;  2DBB A;  3KEQ A;  2WV1 A;  3H0G J;  1NTC A;  1Z67 A;  2EPF A;  3CF2 A;  3VYR B;  4DZJ A;  5IT9 K;  2TDX A;  3KET A;  2G7U A;  3CD6 I;  2W48 A;  1ZN2 A;  2VIX A;  3J81 Z;  2NYX A;  4E7L A;  4RM3 A;  2XHK A;  3Q9S A;  1NK2 P;  5JVT A;  2CFO A;  5CQG A;  1NHA A;  2M4G A;  3TO7 A;  3VYS B;  2P81 A;  2Z16 A;  1XMA A;  3I53 A;  3M9A A;  5E3M A;  3ZMS A;  4KIS A;  1FEX A;  5GTH C;  1Y0N A;  2YU9 J;  1ZR2 A;  1RKW A;  5C4X J;  3OL4 A;  1X3W B;  2EV5 A;  4FAS D;  4XQF A;  4MHG A;  3ULQ B;  2BW3 A;  4RB3 C;  5KK1 A;  5HS8 A;  1KQ0 A;  3HOS A;  3CDH A;  2FE3 A;  3I59 B;  3JR9 A;  1Z05 A;  3OSF A;  1E3H A;  2YU3 A;  2KKO A;  4U0V A;  3RTR A;  1DP3 A;  1P7I A;  2NVT J;  2EIM H;  4FX0 A;  3Q3S A;  3TDU C;  3RCO A;  1MBE A;  4XLH A;  1RUN A;  3ML6 A;  3GZ5 A;  2E35 A;  1R58 A;  3KLO A;  1UHW A;  1XSX A;  2FQ3 A;  2R7T A;  2X1D A;  4PSX A;  3S1N J;  1OR7 A;  4LB5 A;  1B8I B;  1SAU A;  4QTR A;  3L2C A;  3LSH A;  2EZI A;  5B5E C;  1BI2 A;  4V2G A;  3LST A;  1IN5 A;  2GOM A;  3WGI A;  2P5K A;  2TCT A;  3CJQ B;  2IJL A;  1OCT C;  3HZJ A;  3ZQC A;  3HHH A;  1ZH5 A;  2M7A A;  5DDG A;  3EUH C;  1O4X A;  3S1Q J;  2BHY A;  2VC1 A;  5J6X A;  2XIG A;  1R4N B;  3S1M J;  1OIS A;  2JT1 A;  4KYW A;  1HOM A;  3F9K A;  5HDK A;  1JUP A;  1S6L A;  3I54 A;  3E5Q A;  1IC8 A;  3CCR I;  4FQG A;  5FKK A;  5D4S A;  5FGM A;  1A31 A;  4F91 B;  3OYC A;  3WTY C;  1IDY A;  2BY3 A;  3FBN B;  5F1J A;  5LRR A;  5DEQ A;  4C2U A;  1VQK I;  2YR2 A;  3OYE A;  2WAD A;  2VQG A;  3M4O J;  4BE1 A;  4IHV A;  1HLV A;  3CLQ A;  1Z6R A;  4DYQ A;  4L9T A;  2DT5 A;  3QPS A;  4LFU A;  2AO9 A;  5J4Y A;  2VUM J;  3ELK A;  4D7M A;  3WE3 A;  5DUI A;  3A0B C;  4M6Y A;  1VQM I;  3BTL A;  5JI6 A;  4BBR J;  1S9H A;  1HF0 A;  4D9J A;  1FMW A;  2YS9 A;  4ESF A;  4IHS A;  3WTV C;  1QZE A;  2GXG A;  4PJN A;  2GM4 A;  1FSH A;  4HV6 A;  3SQN A;  2JRT A;  5TRD A;  4CCL A;  4DJA A;  2ELJ A;  3EDP A;  3P7N A;  1XTA A;  3S2W A;  1JUM A;  5GAD J;  4ITV A;  1RIO H;  1LDJ A;  2CQK A;  4XMY A;  1IJW C;  4A3B J;  1R5I D;  2V1X A;  4UVC A;  1TLH B;  4DNC A;  3QOD A;  4CYD A;  5FFX A;  2LBF B;  3CMM A;  2O0Y A;  4IL6 C;  1W36 D;  1D5V A;  3CTA A;  1YG2 A;  2EZK A;  4M6X A;  3QP5 A;  3KE2 A;  1WH7 A;  2LY9 A;  4A5M A;  2CQ7 A;  3T1B A;  3GZN B;  4NHJ A;  2BVM A;  1D0Z A;  1ETY A;  1YX5 A;  3FMR A;  1OPC A;  2YUS A;  4XN0 A;  2ZME C;  2IA2 A;  3U2R A;  1G59 A;  3TOB A;  2AXT C;  1VQP I;  2DA6 A;  3C2B A;  1IRG A;  4BUP A;  3KP2 A;  4Y15 A;  3RKX A;  2HZD A;  4E7J A;  5D5W B;  3RKY A;  4Z6Y A;  3MKY B;  4UNO A;  3G71 I;  2XKO A;  5L3E A;  1OCC H;  1FMV A;  2X6W A;  4KIF A;  2CO5 A;  1QPI A;  4DGW B;  3L1P A;  5H2F C;  2X1E A;  2LNB A;  3PO3 J;  2ESN A;  1YLF A;  2LFB A;  3LSP A;  2QM3 A;  5FLX Z;  5KNL A;  1J09 A;  4UUV A;  2QSG X;  2Y31 A;  2LRE A;  2DDB A;  3LFK A;  3K4M A;  1SFO J;  4IVN A;  5IT3 A;  4V19 K;  1TWC J;  1U3E M;  3GTM J;  1JI8 A;  5KAF C;  3WTZ A;  2D1H A;  4WXH A;  2CGP A;  2BW3 B;  2L4A A;  1LKX A;  2PMZ N;  2ZSI B;  1W1W E;  2RAE A;  2E7X A;  3DBR B;  1TW3 A;  1Y1V J;  2RKH A;  1ZRF A;  2WWY A;  2FOK A;  2NNN A;  1BR1 A;  2BXZ A;  1YJW I;  5D8L B;  3IH3 A;  1DGW Y;  4E7I A;  2V9K A;  3TQN A;  1VQ5 I;  4XID A;  5K5O A;  2NXN B;  4RGR A;  3E0J B;  2L54 A;  2DMU A;  5CVJ A;  4ZTF A;  3H9Q A;  2M5W A;  2LF8 A;  1IGN A;  3E5U A;  1FX7 A;  5F0F A;  4CHU A;  3WG7 H;  4MQ9 F;  3ZR8 X;  1JUS A;  3E6M A;  4YG2 F;  1Y8Q B;  2PBI A;  2OU2 A;  2LKS A;  1K7A A;  2CUJ A;  4BEH A;  2NS0 A;  3V8L A;  1WKM A;  1LFB A;  1EA3 A;  1C0W A;  1P4A A;  1B9N A;  1H9T A;  4HPQ A;  1BL0 A;  1V4R A;  3C1D A;  4LLG F;  1ZG5 A;  4CSW A;  2HVS A;  5FKM A;  3PIO F;  1G3T A;  1RET A;  2G0E A;  3MD2 A;  2LD5 A;  2OZU A;  2WY8 Q;  3PNT A;  4A3L J;  1QRY A;  1QVT A;  2M34 A;  1KU7 A;  4XRF A;  4NC7 A;  4UUT A;  2XGE A;  2LF7 A;  2OCE A;  3DCF A;  3L2U A;  2AS5 F;  1ZGJ A;  4KFC A;  4A93 J;  3HKZ A;  2HKX A;  2K3P A;  5L3B A;  4XKV A;  2PMZ A;  1IUY A;  4RM2 A;  1U9O A;  3JSO A;  1JHH A;  1UG0 A;  1DU0 A;  3DEU A;  4LGW A;  1ZQ3 P;  1ZG3 A;  1YHQ I;  2A6E F;  2ISZ A;  4LG0 B;  2DJI A;  3LA3 A;  2R7X A;  1GXP A;  2OPT A;  3J7Z I;  5DCF A;  3SXY A;  2LRD A;  4MNU A;  3TBI A;  1WCM J;  1UST A;  4PDK A;  4IXA A;  3LNQ A;  4UHT A;  3FF5 A;  3SEZ A;  3JAM Z;  3V7S A;  1A04 A;  3KEO A;  1E0E A;  1BC7 C;  1XMK A;  1YTY A;  1MJB A;  2HNH A;  3BOQ A;  4KIG A;  5EEG A;  2HYG D;  1IXS B;  2PN6 A;  3WTS C;  4D5F A;  3W2A A;  3JRB A;  1XMX A;  1ZAR A;  3ZQH A;  2FML A;  2HU9 A;  1K79 A;  1VND A;  1L0O C;  1TWA J;  2WBM A;  1RR7 A;  3KEY A;  1TQI A;  1OKR A;  2M3A A;  3FMQ A;  3DLL F;  5B1B H;  2JQ7 A;  2F5V A;  4FET A;  4OOI A;  2EK5 A;  1XX5 A;  2OJE D;  4BAY A;  2JMW A;  4XLP F;  2LY1 A;  3C7J A;  2JSC A;  2V4J C;  1SEU A;  3K1M A;  5K7H A;  4B1R A;  3GVA A;  1G6N A;  1HKT A;  4NDL A;  1MKM A;  2DI3 A;  1WJB A;  4I7H A;  1LDD A;  1S7A A;  2NVU B;  2WAQ A;  2Y48 A;  1XGO A;  5TIS C;  5LHH A;  1YI2 I;  2DMP A;  4PJL A;  3RSN A;  3KCC A;  2DOE A;  3U9G A;  2NVX J;  1OYY A;  3MVP A;  4QIW N;  1QHG A;  1BW5 A;  3VSK A;  2GQQ A;  2LKX A;  1T95 A;  3SFZ A;  1BIA A;  3QYE A;  5HDG A;  4MFE A;  4G9Y A;  2OAZ A;  1IUF A;  4O6J A;  1N75 A;  5A2Q K;  1PUF A;  5GPA A;  3LA7 A;  2Y75 A;  2Y2Z A;  2VQC A;  3AFH A;  1WFX A;  2ZCW A;  3OOU A;  3VEP A;  1ZGA A;  1LPQ A;  3GTK J;  3FXL A;  1V5E A;  3CUO A;  6PAX A;  4A0Z A;  5LLQ A;  2CW0 F;  5IYD J;  3HOX J;  3PSI A;  2MH9 A;  1ZR4 A;  4Y13 A;  4M6V A;  3ZOB A;  1OLT A;  4E7Z A;  5ICE A;  1Z0X A;  3W6J B;  1YS7 A;  4PZJ A;  1UFM A;  1ZRD A;  3HYI A;  1IN4 A;  5E20 A;  1YYV A;  3BPX A;  2EFO A;  4XLF A;  2M0C A;  2DCE A;  1MH3 A;  3FXQ A;  3GW2 A;  3H3Z A;  2PX9 A;  1FYK A;  2BXY A;  2XPW A;  3OV8 A;  2JUG A;  2XAJ A;  3OS2 A;  3OYI A;  1GVD A;  3CCQ I;  2R7Q A;  3OIQ A;  5EEH A;  3WGG A;  2KZV A;  1XDU A;  3PQJ A;  1W4M A;  1MMN A;  2EQR A;  2UZK A;  4PJ0 C;  1QU3 A;  4KNY A;  3RYR A;  1Y39 A;  2CW8 A;  2F6C A;  4AIJ A;  4J01 A;  4Q47 A;  3ONQ A;  2Z2S B;  3ISP A;  4NNJ A;  3P9C A;  1LNW A;  2A05 A;  4A2U A;  1A36 A;  2HOT A;  4A5N A;  2O03 A;  5CVI A;  3LQQ A;  4RGU A;  2IW5 A;  4I98 B;  4BEH B;  1IG7 A;  3M3Y J;  5IOY A;  2M30 A;  3N05 A;  1VI0 A;  1Z6T A;  1OCO H;  1JKR C;  1SVL A;  1O3R A;  4LIT A;  2LY2 A;  4M73 A;  4S05 A;  3BZK A;  1AOY A;  3S93 A;  2HQ5 A;  2KL4 A;  4X1E A;  3P9K A;  5ILV A;  3J80 K;  5JHF A;  3FM3 A;  2J5O A;  3JRG A;  3OY9 A;  2MH2 A;  2E71 A;  5J8F A;  1P92 A;  1TP4 A;  4BHP A;  2IS1 A;  3OSG A;  1MW7 A;  2GIV A;  4M3G A;  1FP2 A;  5H20 A;  2R93 J;  2MSY A;  2LR8 A;  3A03 A;  2QQ8 A;  1Y0U A;  4HLX A;  3DKX A;  3K6G A;  4WXC A;  1DPU A;  1OJL A;  1K6Y A;  5JHU A;  1KYZ A;  4UVA A;  1T56 A;  5IYC J;  1X2N A;  2IXS A;  3FWE A;  4PJJ A;  4HLY A;  2LVS A;  3GTJ J;  4G7O F;  2ZXH A;  1HQC A;  4EVI A;  4U7D A;  5EGO A;  2OTL I;  3LAP A;  3BP8 A;  1KGS A;  4PK4 A;  1SD6 A;  2BBY A;  3QU6 A;  3BG3 A;  3COA C;  4I6Z A;  4XLC A;  4LIU A;  2N8G A;  1KA8 A;  2OUM A;  2ETH A;  3IH4 A;  4CO8 A;  4ZYA A;  3A2K A;  1FY7 A;  5DUK A;  4BQA A;  3T5X A;  4DQ2 A;  1ENH A;  2IGK A;  2JUC A;  2UXN A;  2B9S A;  2HDW A;  3LAJ A;  2ECC A;  1JGS A;  4HX7 A;  4B4C A;  3MKL A;  1FTZ A;  1W0T A;  4Y17 A;  1XN7 A;  4H4K C;  5LGU A;  4KUM A;  3I58 A;  1PP7 U;  2Y9Y A;  1B4A A;  2L9S A;  4OAY A;  1Z91 A;  2J5P A;  3WHB A;  3IP4 B;  3CC2 I;  4A3J J;  3IRQ A;  1QA6 A;  1WPK A;  2VBZ A;  2Y69 H;  5M5W J;  3HC7 A;  3OYG A;  3BDD A;  3ASN H;  1ACI A;  3S14 J;  2M9H A;  4IPA A;  3B73 A;  3BTI A;  3DF8 A;  2HVR A;  2H8W A;  2JN6 A;  4KIB A;  3V4G A;  1PUE E;  2V6C A;  3EPZ A;  3OIO A;  2CJJ A;  1YE9 A;  3L2V A;  1MJ9 A;  2IA1 A;  2UUZ A;  4MTE A;  2RVC A;  4PSW A;  4BXU A;  2HGC A;  1E2X A;  2XRN A;  3WTU C;  1RI7 A;  3MWM A;  3AAF A;  2L7K A;  1NK3 P;  2W82 A;  4EJT A;  3Q0W A;  2VOP A;  2FEZ A;  4YEJ A;  4JX5 A;  2EIN H;  1TT5 B;  1DGR M;  4MEY F;  2FD5 A;  1I3A A;  5B1A H;  4A3E J;  3TGN A;  3ZMZ A;  4CCK A;  1GXQ A;  3BZC A;  4FE4 A;  3I4P A;  3HTU A;  2Z9O A;  1ON1 A;  4G6Q A;  2KRC A;  5EDN A;  2FUG 2;  3OL3 A;  2L01 A;  3GX4 X;  3BG6 A;  1TC3 C;  3K1N A;  3N97 A;  4G6T B;  2LH9 A;  5DM6 F;  4Y7N J;  3BR6 A;  3HHG A;  4ON0 A;  5HLI A;  2A07 F;  2HZT A;  4P1W A;  1IV8 A;  1ZK8 A;  2XF6 A;  5LHI A;  1JT0 A;  3H3U A;  4RBO A;  3K2A A;  2ZXI A;  3HRU A;  2P0W A;  1UCR A;  4U87 A;  3HOV J;  2QYO A;  1BJZ A;  5EEA A;  1YO5 C;  3O3K A;  2E1M B;  2Q0O A;  2ZBK A;  2FOW A;  3K69 A;  1LEB A;  2ISY A;  3CME I;  3NEU A;  1T39 A;  2MD5 A;  3KFW X;  1O7L A;  5HLH A;  5HS7 A;  5F1R A;  3LSG A;  3K0L A;  3LA2 A;  4IEJ A;  2QF7 A;  4K2E A;  3OYF A;  3ASO H;  3TP0 A;  1B9M A;  1X3Z B;  1XS9 A;  3AG1 H;  3L7W A;  4GYI A;  2DJN A;  1VFC A;  1YW9 A;  1I39 A;  1X1D A;  2DOF A;  4BXX J;  1WVR A;  2HVQ A;  1MMD A;  2BV6 A;  2KT0 A;  1MBG A;  3CCS I;  2Z99 A;  4XLN F;  4EAT A;  5IP9 J;  1T6S A;  3S3M A;  4ANJ A;  5J1Y A;  1OYW A;  2ZSH B;  1WHU A;  3SZP A;  2EA2 A;  3TP3 A;  3DTI A;  3GTG J;  5B66 C;  1FYM A;  4A3I J;  4XRM A;  4IJA A;  1FIA A;  1XD7 A;  2R7U A;  3H1C A;  2DXI A;  1EH8 A;  1WI9 A;  1ZTR A;  4RB0 A;  5IT9 Z;  1IXR C;  5E1X A;  2PI0 A;  3IAM 2;  5DD4 A;  4A3F J;  2PJR A;  1K6O A;  1Y6I A;  2C6Y A;  5ERI A;  1BIB A;  2L5Q A;  2FNA A;  4DOZ A;  2M87 A;  1MJA A;  2VI6 A;  4RDU A;  1U8R A;  3WHC A;  1XSD A;  3VYU B;  2R7Z J;  1D8J A;  1RZ4 A;  5J3L A;  4A3D J;  4ZJZ A;  4EEF G;  9ANT A;  2L9N A;  5LHG A;  2A3S A;  3OYL A;  2VB6 A;  4G94 A;  3HBL A;  3I55 I;  5F27 A;  3L00 A;  2F4M B;  1KYW A;  2LTP A;  1FOX A;  2H94 A;  3ABT A;  2IGN A;  1FZP B;  1JJ8 C;  3PNV A;  1QNT A;  4HNV A;  4B3X A;  2HEO A;  2LDU A; 
#chains in the Genus database with same CATH homology
 1PP8 F;  2K7L A;  3ZQ7 A;  5F6F A;  4HBL A;  3CUQ C;  4KN4 X;  2AXL A;  2LKP A;  4LK0 F;  2E1C A;  2KIF A;  2VBX A;  4EGZ A;  4LLL A;  4I09 A;  3I71 A;  5BS6 A;  2DU9 A;  4NQW A;  3HSF A;  3IKT A;  1FBQ A;  3R6S A;  1W5S A;  3M8F A;  2STW A;  1QBJ A;  3RPQ A;  3KP6 A;  4HA8 A;  1G3S A;  3LWF A;  5E18 F;  2WV0 A;  2XAS A;  1B59 A;  2RC4 A;  2L4M A;  4R79 A;  2GA1 A;  4M71 A;  1YFH A;  3TKY A;  1BI0 A;  2D1V A;  5LRS A;  1DP7 P;  2Q2E A;  1HBX G;  5HVQ C;  5ED4 A;  3JSP A;  2ZFW A;  4ENJ A;  3I64 A;  2FRH A;  4UVB A;  1W7P A;  1REP C;  3ZMT A;  3F8C A;  2IRF G;  1T0F A;  4YFK F;  2DK8 A;  1IAW A;  2E1N A;  2W85 A;  2L02 A;  3HRT A;  3G3Z A;  4A0X A;  1FYL A;  4G7H F;  4AIK A;  3RDI A;  3JTG A;  4HV5 A;  3GO5 A;  2WTE A;  2R7D A;  1DDN A;  2HYF A;  2P8T A;  1H0M A;  3GFI A;  1STZ A;  3B02 A;  2PEX A;  2GWR A;  3CLO A;  2HFH A;  1ZYR F;  2ELH A;  1HSJ A;  5DCM A;  2QVO A;  4CZZ A;  2VON A;  4TV7 A;  2A61 A;  4EJU A;  2ZKZ A;  3DFG A;  1QPM A;  2FBH A;  4LK1 F;  4EGY A;  3C3W A;  4U0Y A;  2DAO A;  2MLK A;  4F7Z A;  2HDC A;  4A12 A;  3O2P E;  3MEX A;  4GCV A;  5HLG A;  1FSE A;  2COM A;  5K5R A;  1B1B A;  5DD8 A;  1ZRC A;  2XAQ A;  3ZP5 A;  5CJ9 A;  3DPT A;  4HDV A;  2HKO A;  4MGR A;  2RNJ A;  4YIF A;  3EYI A;  1IN8 A;  1JE8 A;  3DV8 A;  2GZW A;  3TO6 A;  4L0Y B;  3N4M A;  1P4W A;  4PGG A;  2R3S A;  4EJW A;  2QQA A;  4BYY A;  3OOP A;  2B0L A;  2PLY A;  4MQV A;  5D8K B;  5LEK A;  3GFJ A;  4I02 A;  2CG4 A;  2RV8 A;  4G7Z F;  4B09 A;  4OMY A;  4RGX A;  4O3M A;  3V7R A;  1KU2 A;  4YFX F;  2BYV E;  4GXO A;  4EJV A;  1G4D A;  1J75 A;  3FXR A;  2IA0 A;  4ETS A;  3GZ6 A;  3KZZ A;  2W24 A;  3DKW A;  4WK8 F;  1HST A;  4LD5 A;  2P7V B;  4G6D A;  2PG4 A;  2NRA C;  4A6E A;  5HS9 A;  2G7H A;  5LGT A;  4P9F A;  2A5Y B;  2OZ6 A;  1HW5 A;  3F3X A;  4ASN A;  2ZNZ A;  3WTX C;  4ZYG A;  4AWX B;  1R7J A;  2ESH A;  2IVM A;  1O3T A;  4B8X A;  4H0E A;  3ERE D;  2V1U A;  1LJ9 A;  4L5I A;  4U88 A;  2VT3 A;  2OQG A;  3GEZ A;  4R1H A;  1D8K A;  4HF1 A;  4L5J A;  5CVU A;  3KP7 A;  5A2Q Z;  2IPQ X;  2VBW A;  2XAG A;  4M74 A;  1TQP A;  2MBF A;  4ZYE A;  1R23 A;  4L0Z B;  2PFB A;  1BN5 A;  4QWQ A;  1J59 A;  2F2E A;  4JQF A;  2A69 F;  1PDN C;  1QQI A;  2IT0 A;  4JBA A;  3F23 A;  4E70 A;  2VE9 A;  3GXO A;  4IRG A;  1SFU A;  3BJA A;  3FX3 A;  2DPU A;  2ZNY A;  3SZT A;  1CGP A;  5JFR A;  1K78 A;  4HQM A;  4OIP F;  1FPQ A;  4FT8 A;  1KQ9 A;  4HF2 A;  2XGX A;  4KMF A;  4PCQ A;  3D5L A;  5FO5 A;  1IW7 F;  2Z3Y A;  1SD5 A;  5E1W A;  4Q5S F;  4CXF A;  4IRI A;  2EA4 A;  2HS5 A;  4OIR F;  3ABU A;  3RIR A;  1U6G A;  3FM5 A;  3V8J A;  3J80 Z;  1BI3 A;  1TBX A;  3E97 A;  2YX4 A;  1R36 A;  3V7C A;  2P6T A;  3IRR A;  3K9T A;  4LB6 B;  1KQ8 A;  2HTS A;  3F72 A;  1FBS A;  2V1D A;  5FB2 A;  1ZG1 A;  2M1B A;  2CFX A;  3J7A O;  5L3F A;  1SMT A;  5AIQ A;  5BPD A;  3R4K A;  1CF7 A;  1S7O A;  4MTD A;  2FNP A;  1T2K A;  4PGH A;  2O61 A;  1FNN A;  1JHF A;  1QO0 D;  2GAU A;  1W7P D;  1F4K A;  1R5H A;  2QUF A;  5HDN A;  5E1Z B;  3QPT A;  2BE5 F;  5ICC A;  1HKS A;  1XDS A;  1F9N A;  3R60 A;  2EJR A;  4KT5 C;  4EV0 A;  1QZY A;  2EB7 A;  2VOD A;  5ILS A;  3MZH A;  1TQM A;  2M8E A;  2LSO A;  2EWN A;  4CGZ A;  1LEA A;  4HAM A;  1G3W A;  1H9G A;  4AVP A;  4P96 A;  2FMY A;  1I1S A;  2PMU A;  2H6C A;  5CLS A;  3HSE A;  4LMY A;  3RPU A;  1SFX A;  1WRJ A;  4R8H A;  2KIM A;  1I6X A;  2KRF A;  2O3F A;  1V3F A;  1P4X A;  3RI4 A;  1MDM A;  2XKP A;  3KLN A;  1LVA A;  2DQR A;  3QRF F;  2YSR A;  2VC0 A;  5D5U B;  4AIH A;  3IC7 A;  1I27 A;  1QZZ A;  4KMU X;  2RDP A;  1IF1 A;  4ENK A;  1K78 B;  4WWC A;  1USS A;  1DUX C;  1KU3 A;  2CWE A;  1WQ2 A;  3HUG A;  3QU3 A;  4BHC A;  2JPB A;  2F5E A;  2ADU A;  3GLX A;  3KZY A;  2EV6 A;  1P2F A;  5L3G A;  2EFW A;  3I5U A;  1U5T A;  2ZJ2 A;  4ZZL A;  4I0B A;  2QQB A;  2F5C A;  2DK5 A;  2HOE A;  3IL2 A;  1EH7 A;  3T8R A;  2DTR A;  3BY6 A;  2VT2 A;  3QOP A;  4UV8 A;  4ESB A;  3EQL F;  4GO1 A;  3VB2 A;  1GHC A;  3NRV A;  2BEO A;  4N9I A;  1CF7 B;  2JTV A;  2V79 A;  4UXN A;  3GF2 A;  1O3S A;  2IP2 A;  1FP1 D;  4RAY A;  1ODD A;  2F5D A;  2Q8K A;  1HKQ A;  1X3U A;  4GGG A;  1SAX A;  2K4J A;  3GYH X;  2K4B A;  4L18 B;  2Z33 A;  4YII A;  3M7G A;  3RKW A;  2HTJ A;  2DFI A;  1BBY A;  1WSU A;  5FD5 A;  4U7B A;  1R22 A;  3IHU A;  2BGC A;  3DQV C;  1L3L A;  3WU1 B;  1HXD A;  1Z7U A;  1JXS A;  2VN2 A;  1AWC A;  3GWZ A;  4KIC A;  3VOD A;  3V8K A;  2QBY A;  4KDP A;  3F6V A;  2VBY A;  2EFP A;  2QQ9 A;  5CYV A;  3K2Z A;  4WCG A;  1EV7 A;  4YFN F;  1FT9 A;  4CIC A;  4AD9 A;  4Q48 A;  3E5X A;  4EM2 A;  5D6E A;  2DLL A;  2OBP A;  1MDM B;  4OIO F;  1RNL A;  2K27 A;  3SHF A;  4Q4Z F;  5JR3 A;  4RS8 A;  3MFK A;  1BOA A;  3J81 K;  2VXZ A;  4EJO A;  3RYP A;  1FLI A;  4ZH4 F;  5LBQ A;  4L9N A;  3QAH A;  1T38 A;  2QZ8 A;  1U5T B;  4Z2Y A;  3HTS B;  2V9V A;  5K1Y A;  1J7K A;  1GVJ A;  1ZLK A;  4RB2 C;  2DPD A;  1IRF A;  1YS6 A;  3RJP A;  1O3Q A;  3TDZ C;  1YQA A;  3ZPL A;  1W5T A;  1IN6 A;  4GYG A;  2PJP A;  3PQK A;  3FHZ A;  3F21 A;  4LG0 A;  1S3J A;  1OMI A;  1ULY A;  3HRM A;  5FD6 A;  1Z1D A;  3W6K B;  4ZYH A;  1E17 A;  3C18 A;  2P5L C;  3BZ6 A;  3VOE A;  3WOD F;  1OYI A;  2P5V A;  3D0S A;  3R0A A;  3EET A;  1F5T A;  4HW0 A;  1TW2 A;  4HX8 A;  4BNC A;  5CVR A;  5D5V B;  1R1T A;  2W84 A;  5TJJ A;  2XUB A;  3E6B A;  1G3Y A;  1SD4 A;  2MLG A;  5ICF A;  2QBY B;  3BJO A;  1VTN C;  2YX7 A;  4OU0 A;  3Q5F A;  5K5Q A;  1U78 A;  4I0A A;  3ZN0 A;  5E8I A;  3BPV A;  4IRH A;  4EMS A;  3DPL C;  2OQR A;  3IWZ A;  1Q1H A;  2EFQ A;  3K1P A;  3GUD A;  2FA5 A;  2QLZ A;  3DP7 A;  3ECO A;  3ZMV A;  1BI1 A;  2Y0M A;  5D4R A;  2QWW A;  2JZY A;  1FC3 A;  3MAJ A;  5HOO A;  3T0Y A;  4EQQ A;  4NB5 A;  3R61 A;  2ACJ A;  4ZYD A;  4FX4 A;  2HWV A;  2MA3 A;  3FXU A;  4I01 A;  3F8M A;  2RGV A;  2NNY A;  5FLX K;  5J8C A;  3KP3 A;  3FMS A;  1HW2 A;  3T8T A;  2UWM A;  5CVV A;  4ENN A;  5AON A;  4D0P A;  2G9W A;  1W7P B;  1S8N A;  3F22 A;  1R00 A;  2HQN A;  2CSO A;  3QPH A;  5DV5 A;  3IKV A;  4BHB A;  4HOB A;  2JPC A;  1MD0 A;  3L9F A;  3Q9V A;  2HR3 A;  2RQP A;  2EV0 A;  1R1U A;  2K86 A;  1EH6 A;  3CUQ A;  3WE2 A;  4M9S A;  1WWX A;  1P6R A;  1U2W A;  2PQ8 A;  3F8N A;  2RN7 A;  2O8X A;  2O6G E;  2Z5U A;  2XVC A;  5DCM B;  4LLN A;  4HQE A;  3PFI A;  3WTW C;  2H27 A;  4HX4 A;  2FXA A;  4RGS A;  3F8F A;  1MZB A;  3MCZ A;  3E6D A;  1U5T C;  2M45 A;  3F6O A;  1LQ1 A;  4N0B A;  1FOK A;  1J2X A;  3EUH A;  1XCB A;  2STT A;  4XSX F;  3BRO A;  2CYY A;  1RUO A;  2FU4 A;  3IWF A;  4LJZ F;  1FBU A;  1MGT A;  5AIP A;  3JAM K;  2W57 A;  3KP5 A;  5L3D A;  3G73 A;  5F64 A;  2OD5 A;  1SMY F;  1FWZ A;  5L3C A;  3WG9 A;  2QEN A;  2ZXJ A;  4IHT A;  1QGP A;  3ZN1 A;  5LGN A;  2X0L A;  3VFZ A;  1LDK B;  1SD7 A;  4KA4 A;  1ZHF A;  1ZLJ A;  4RAZ A;  3MZY A;  2H6B A;  2XV4 S;  1XB4 A;  1IZ1 A;  4M9X A;  2FBK A;  4RB1 A;  1B6A A;  3ZMU A;  1J5Y A;  2DO7 A;  3TOA A;  4WX9 A;  2GXB A;  3EYY A;  5H6R A;  2E7W A;  1IXC A;  1I1G A;  2XAH A;  3E6C C;  1ZAO A;  1Z9C A;  2ZME A;  3H92 A;  2KIU A;  5D6F A;  1J0R A;  1XSV A;  2P7C B;  5BOX A;  2X4H A;  2NAZ A;  1LB2 A;  2A6H F;  2KJB A;  1R5G A;  4CDG A;  4EM0 B;  4HYE A;  1YW8 A;  1UB9 A;  3U1D A;  3CO6 C;  3DXJ F;  5H6Q A;  4I2O A;  3ECH A;  3GFL A;  4N9H A;  4L9J A;  2P6S A;  1XGN A;  2GA2 A;  2VE8 A;  3CUQ B;  2R7F A;  4HDU A;  1TNS A;  3CO7 C;  5ILU A;  3TO9 A;  2KJC A;  1O7F A;  5BQT A;  4OMZ A;  4OIQ F;  3F8B A;  1SFE A;  4FHT A;  4WXD A;  2XRO A;  3GFM A;  5BMZ A;  3CJN A;  3JW4 A;  4ZZD A;  1ONV A;  3LQR A;  4P55 A;  2VOO A;  5KVR A;  3R0J A;  3QP6 A;  3M1E A;  1YIO A;  2DQL A;  3BWG A;  3E3V A;  2D2W A;  3M8E A;  3NQO A;  4P5O A;  1IN7 A;  1UHM A;  3MQ0 A;  1TNT A;  1KU9 A;  3L09 A;  5LEJ A;  1R1V A;  4HF0 A;  3I0T A;  4S04 A;  5DYM A;  2W25 A;  3KP4 A;  1F1Z A;  5BPI A;  2H09 A;  3JTH A;  3I59 A;  2L3D A;  3WU0 A;  2YPR A;  2F5F A;  4L9V A;  3O6B B;  1I5Z A;  3FZV A;  1XGS A;  2WC2 A;  1HW1 A;  2FSW A;  3HRS A;  1BJA A;  4ENM A;  1XGM A;  1DPR A;  2D45 A;  4HZF A;  2DW4 A;  1TTY A;  4OIN F;  2ZO4 A;  3ROU A;  1ZRE A;  2FF4 A;  3WGH A;  1XCV A;  2EFN A;  4M72 A;  2ZME B;  2K02 A;  5D5X B;  2A68 F;  3BJ6 A;  4XBF A;  4UV9 A;  4MEX F;  4EM1 A;  4P9U A;  4BH9 A;  1O57 A;  3HIF A;  4A0Y A;  4A6D A;  1T98 A;  3P9I A;  1YW7 A;  4KN7 X;  3REO A;  5E8G A;  2OA4 A;  1BM9 A;  4U0W A;  5FFZ A;  2UXX A;  1J9I A;  2XAF A;  3ZMD A;  1S29 A;  5ICG A;  4IF4 A;  3HSR A;  2PMH A;  1BC8 C;  4M9Z A;  4QLC U;  4G8X A;  1D3Y A;  4WF2 A;  2HQR A;  1ON2 A;  2MC3 A;  3HOT A;  2FBI A;  5E17 F;  2P4W A;  4JK1 X;  4O5V A;  4XSZ F;  3WTT C;  4ESJ A;  3KEQ A;  2DBB A;  5IT9 K;  2TDX A;  3KET A;  2G7U A;  1ZN2 A;  3J81 Z;  2NYX A;  2XHK A;  3Q9S A;  5JVT A;  1NHA A;  3TO7 A;  1XMA A;  3I53 A;  3M9A A;  3ZMS A;  2EV5 A;  4MHG A;  3ULQ B;  4RB3 C;  5KK1 A;  5HS8 A;  1KQ0 A;  3HOS A;  3CDH A;  2FE3 A;  3I59 B;  1Z05 A;  2YU3 A;  4U0V A;  2KKO A;  3RTR A;  4FX0 A;  3TDU C;  1RUN A;  3ML6 A;  3GZ5 A;  1R58 A;  3KLO A;  1UHW A;  1XSX A;  2FQ3 A;  1OR7 A;  4LB5 A;  3L2C A;  1BI2 A;  3LST A;  1IN5 A;  3WGI A;  2P5K A;  2IJL A;  3HHH A;  1ZH5 A;  5DDG A;  2VC1 A;  5J6X A;  2XIG A;  2JT1 A;  4KYW A;  5HDK A;  1S6L A;  3I54 A;  3E5Q A;  5D4S A;  5FGM A;  3WTY C;  5LRR A;  5DEQ A;  2YR2 A;  1Z6R A;  4L9T A;  2DT5 A;  4LFU A;  3ELK A;  3WE3 A;  5DUI A;  4M6Y A;  5JI6 A;  4IHS A;  4ESF A;  3WTV C;  2GXG A;  1FSH A;  4HV6 A;  3SQN A;  2JRT A;  5TRD A;  3EDP A;  3P7N A;  3S2W A;  1RIO H;  1LDJ A;  2CQK A;  2V1X A;  4UVC A;  1TLH B;  4DNC A;  4CYD A;  5FFX A;  2O0Y A;  1D5V A;  3CTA A;  1YG2 A;  4M6X A;  3QP5 A;  3KE2 A;  4A5M A;  3T1B A;  4NHJ A;  3FMR A;  1OPC A;  2IA2 A;  3U2R A;  3TOB A;  1IRG A;  3KP2 A;  4Y15 A;  3RKX A;  5D5W B;  3RKY A;  4UNO A;  2XKO A;  5L3E A;  4KIF A;  2CO5 A;  2LNB A;  2ESN A;  1YLF A;  2QM3 A;  5FLX Z;  4UUV A;  3LFK A;  4IVN A;  5IT3 A;  1U3E M;  3WTZ A;  2D1H A;  4WXH A;  2CGP A;  2L4A A;  2E7X A;  1TW3 A;  1ZRF A;  2RKH A;  2WWY A;  2FOK A;  2NNN A;  5D8L B;  3TQN A;  5K5O A;  4RGR A;  2L54 A;  5CVJ A;  2M5W A;  2LF8 A;  3E5U A;  1FX7 A;  4CHU A;  4MQ9 F;  3E6M A;  4YG2 F;  2PBI A;  2OU2 A;  1K7A A;  2NS0 A;  3V8L A;  1WKM A;  1C0W A;  1P4A A;  1B9N A;  1H9T A;  1V4R A;  3C1D A;  4LLG F;  1ZG5 A;  1G3T A;  2OZU A;  1KU7 A;  4XRF A;  2LF7 A;  4KFC A;  2AS5 F;  1ZGJ A;  2HKX A;  5L3B A;  1IUY A;  3JSO A;  1JHH A;  3DEU A;  4LGW A;  1ZG3 A;  2A6E F;  2ISZ A;  4LG0 B;  3LA3 A;  1GXP A;  5DCF A;  3SXY A;  4MNU A;  1UST A;  4PDK A;  4IXA A;  4UHT A;  3FF5 A;  3JAM Z;  3V7S A;  1A04 A;  3KEO A;  1BC7 C;  1XMK A;  1YTY A;  1MJB A;  3BOQ A;  4KIG A;  5EEG A;  2HYG D;  1IXS B;  2PN6 A;  3WTS C;  1ZAR A;  1K79 A;  2FML A;  1L0O C;  1TQI A;  1OKR A;  3FMQ A;  4OOI A;  2EK5 A;  4BAY A;  4XLP F;  3C7J A;  2JSC A;  3K1M A;  3GVA A;  1G6N A;  1HKT A;  1MKM A;  2DI3 A;  4I7H A;  1LDD A;  1S7A A;  2Y48 A;  1XGO A;  5LHH A;  3KCC A;  3U9G A;  1OYY A;  2GQQ A;  3SFZ A;  1BIA A;  5HDG A;  4G9Y A;  2OAZ A;  4O6J A;  5A2Q K;  3LA7 A;  2Y75 A;  2ZCW A;  3VEP A;  1ZGA A;  3CUO A;  6PAX A;  4A0Z A;  5LLQ A;  2CW0 F;  2MH9 A;  4Y13 A;  5ICE A;  3W6J B;  1YS7 A;  4PZJ A;  1UFM A;  1ZRD A;  3HYI A;  1IN4 A;  5E20 A;  1YYV A;  3BPX A;  2EFO A;  3FXQ A;  3GW2 A;  3H3Z A;  1FYK A;  3OV8 A;  2XAJ A;  5EEH A;  3WGG A;  1XDU A;  3PQJ A;  1W4M A;  2UZK A;  4KNY A;  3RYR A;  4AIJ A;  4Q47 A;  3ISP A;  3P9C A;  1LNW A;  4A2U A;  4A5N A;  2O03 A;  5CVI A;  3LQQ A;  4RGU A;  2IW5 A;  4I98 B;  2M30 A;  1Z6T A;  1O3R A;  4M73 A;  4S05 A;  1AOY A;  3P9K A;  5ILV A;  3J80 K;  3FM3 A;  2J5O A;  2MH2 A;  5J8F A;  1P92 A;  4BHP A;  2GIV A;  1FP2 A;  5H20 A;  1Y0U A;  4HLX A;  4WXC A;  1DPU A;  5JHU A;  1KYZ A;  4UVA A;  3FWE A;  4HLY A;  4G7O F;  4EVI A;  1HQC A;  4U7D A;  3LAP A;  3BP8 A;  1KGS A;  3COA C;  1SD6 A;  2BBY A;  3QU6 A;  1KA8 A;  4CO8 A;  2ETH A;  1FY7 A;  5DUK A;  4BQA A;  3T5X A;  4DQ2 A;  2UXN A;  3LAJ A;  4HX7 A;  1JGS A;  4Y17 A;  1XN7 A;  5LGU A;  4KUM A;  3I58 A;  1PP7 U;  1B4A A;  1Z91 A;  2J5P A;  3IRQ A;  2VBZ A;  3BDD A;  4IPA A;  3B73 A;  3DF8 A;  4KIB A;  3V4G A;  1PUE E;  2V6C A;  1MJ9 A;  2IA1 A;  4MTE A;  2RVC A;  4BXU A;  3AAF A;  3WTU C;  2HGC A;  1E2X A;  2XRN A;  1RI7 A;  3MWM A;  4EJT A;  2VOP A;  2FEZ A;  4MEY F;  3TGN A;  3ZMZ A;  1GXQ A;  3I4P A;  3HTU A;  2Z9O A;  1ON1 A;  4G6Q A;  2L01 A;  3GX4 X;  3K1N A;  3N97 A;  3HHG A;  4ON0 A;  5HLI A;  2A07 F;  2HZT A;  5LHI A;  3H3U A;  3HRU A;  1UCR A;  2QYO A;  1YO5 C;  3O3K A;  2Q0O A;  2ZBK A;  3K69 A;  1LEB A;  2ISY A;  3NEU A;  1T39 A;  2MD5 A;  3KFW X;  1O7L A;  5HLH A;  5HS7 A;  5F1R A;  3K0L A;  3LA2 A;  4K2E A;  1B9M A;  3L7W A;  4GYI A;  1YW9 A;  2BV6 A;  2Z99 A;  4XLN F;  1T6S A;  1OYW A;  3SZP A;  2EA2 A;  1FYM A;  4IJA A;  1XD7 A;  1EH8 A;  1WI9 A;  4RB0 A;  5IT9 Z;  1IXR C;  5E1X A;  2PI0 A;  5DD4 A;  1K6O A;  2C6Y A;  5ERI A;  1BIB A;  2FNA A;  2M87 A;  1MJA A;  1U8R A;  1XSD A;  1D8J A;  1RZ4 A;  5LHG A;  2A3S A;  4G94 A;  3L00 A;  1KYW A;  2H94 A;  3ABT A;  1FZP B;  1QNT A;  2HEO A;  2LDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...