5FGMA

Streptomyces coelicolor sigr region 4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
LPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ECF RNA polymerase sigma factor SigR
publication title In Streptomyces coelicolor SigR, methionine at the -35 element interacting region 4 confers the -31'-adenine base selectivity
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5fgmA00
5LEKA 1ZG1A 1T2KA 1ODDA 3GFIA 1T0FA 2KRFA 3JTHA 2IP2A 2ZJ2A 1O3TA 2VT2A 3ZMTA 5DYMA 1K78B 5CYVA 2PMHA 4ENKA 2FEZA 1QPMA 2HYFA 1L0OC 5D8KB 4GO1A 4CXFA 3Q5FA 4WCGA 1I5ZA 3FF5A 1J59A 3ZPLA 5IT9K 1O57A 3IC7A 2A5YB 3BROA 2ISZA 1GXPA 4MGRA 3KEQA 1CF7A 2PBIA 1YQAA 2O0YA 5HDKA 3GLXA 3EQLF 3DFGA 1RUOA 2D1HA 3J7AO 3SHFA 1S7OA 2EA2A 1HKTA 4U0WA 4CHUA 1G3SA 3T8TA 2F5DA 2X0LA 1MDMA 2QLZA 3RTRA 3HUGA 4KT5C 1PP8F 3KP7A 2XGXA 4IRIA 4AIKA 2RV8A 2GIVA 2D45A 4RAZA 1XB4A 3WTZA 1IRGA 4RGSA 4L9NA 5AONA 2P6SA 1HW1A 1LJ9A 1O7FA 5L3BA 3T5XA 1YFHA 2VBWA 1G3TA 3ZP5A 1HW5A 2CGPA 3RKXA 3QPHA 1ZRDA 5ED4A 1ZYRF 4IPAA 2OU2A 5DCFA 1T6SA 3LA3A 2QVOA 1YO5C 1HBXG 1R1VA 3NEUA 2VN2A 3COAC 6PAXA 1YTYA 1HSTA 1WWXA 2FBIA 1BC7C 2M30A 3K1MA 4RGRA 5FO5A 2JRTA 4KN4X 2GAUA 1KYZA 1KGSA 3HYIA 3LAPA 1IN8A 3QU3A 2DLLA 3ECHA 5K1YA 1OKRA 1MD0A 1FBUA 3FXRA 3I0TA 3O6BB 4P9FA 1SAXA 2RVCA 1YS7A 1G4DA 4Y15A 2B0LA 1D3YA 2Y48A 1FT9A 3L00A 1FBSA 3K1NA 5DD8A 2ZO4A 4MHGA 1B9NA 2FA5A 5HLHA 1JHFA 2FRHA 1XN7A 3BZ6A 1KU9A 5LLQA 2EFWA 2HQRA 5TJJA 2P8TA 2IA0A 4YIIA 1KU2A 4AIHA 5ILVA 3R61A 4OOIA 3REOA 3WTWC 3RJPA 1P4XA 5DUIA 1HW2A 4HYEA 2Z9OA 2RN7A 3N4MA 3MFKA 5FD6A 3EYYA 3BP8A 2VBYA 2MA3A 2XHKA 4ENNA 2OD5A 2F2EA 3GEZA 3DPLC 5CVVA 1IXSB 3J80Z 2MH2A 1QNTA 1SFEA 4Q4ZF 3CUOA 3ML6A 2PEXA 4F7ZA 2PMUA 1BBYA 2HTJA 3ERED 2BE5F 1FYKA 4EGZA 3V7SA 3MEXA 3LQRA 1BI1A 4BXUA 1O3SA 3LSTA 5FFXA 5HOOA 5FFZA 2V9VA 2ISYA 1B4AA 3SZTA 2PN6A 2LSOA 1Y0UA 3HTUA 2P7CB 3G3ZA 4ESFA 1MJBA 4YFKF 4E70A 4ZH4F 3JSPA 1ZAOA 4RB0A 5FB2A 2FNAA 4EJWA 5FLXK 2JSCA 5LEJA 1P6RA 2DAOA 5EEGA 1PUEE 1R58A 2M8EA 2R3SA 2EA4A 3PFIA 2EV0A 2XKOA 4L9VA 3F8NA 1EH7A 2G7HA 1KA8A 3J81Z 3BDDA 1FNNA 4A6DA 3FWEA 3HOTA 2MH9A 1ULYA 1V4RA 4UVAA 5FGMA 2IPQX 3BPVA 4A5MA 1Z7UA 5HS9A 2VONA 1D8KA 2DU9A 2PG4A 3FXQA 1YLFA 4EVIA 2BYVE 4HA8A 3BOQA 2L3DA 2QQ9A 5J6XA 1DDNA 2VC1A 1DP7P 3V7RA 1TW2A 5DDGA 3VFZA 5H6QA 1CGPA 2RQPA 1MZBA 4DQ2A 3CDHA 2XAJA 2P4WA 4WXCA 1ON2A 2V1UA 1A04A 3ECOA 3OV8A 3U1DA 4A0XA 1YYVA 1HKSA 1W4MA 1V3FA 1SMYF 2M1BA 2DO7A 4IJAA 5A2QZ 2EV6A 3BJAA 2C6YA 1U5TA 4A0YA 1LEBA 4S04A 2EFQA 2HKOA 5E20A 1F5TA 2XKPA 4EJUA 1XD7A 1R23A 4R8HA 4PZJA 3Q9VA 1LNWA 3I53A 4HF1A 1IN5A 5LHIA 1IXRC 3DP7A 5H6RA 5K5OA 5ILUA 3JW4A 1MJAA 1IN7A 4XSZF 1Z6RA 4M72A 4IHTA 4KUMA 4BQAA 1ZLJA 1YS6A 4AD9A 1WKMA 2WC2A 1OYIA 1SD4A 2F5EA 3M8FA 4NHJA 1KQ8A 4M9ZA 1J5YA 2FQ3A 5CVIA 3LFKA 4MEXF 2MLGA 2QBYB 4KN7X 4WF2A 4HQMA 3HRSA 4AVPA 1Q1HA 3QAHA 5E18F 5HLGA 1TQMA 5L3DA 2EFOA 1Z9CA 4MTDA 4XRFA 1T38A 2KIMA 3C18A 5LRRA 2QQBA 2EV5A 4EJOA 5AIQA 2R7DA 1X3UA 1TLHB 1XMKA 2H94A 1R36A 4I0BA 2ZNYA 4HW0A 3AAFA 2QUFA 2QM3A 3JTGA 2EJRA 5DCMA 1WQ2A 4EMSA 1IF1A 3LAJA 4M74A 2A6EF 2IW5A 2O3FA 3E97A 4EM2A 2QYOA 3HRUA 2VBXA 4M9SA 2FE3A 1W7PB 3D0SA 2PLYA 5JVTA 3DXJF 4FT8A 3ABTA 3GX4X 3WODF 4L0YB 1Z91A 2ESNA 4EM1A 1QZZA 3PQJA 4UVBA 1U2WA 4Q48A 3WTTC 4HOBA 4N0BA 1P4AA 2Y0MA 4BHPA 4ZYEA 1R5GA 1TW3A 1CF7B 4LGWA 4H0EA 2DBBA 4R79A 4P55A 4UXNA 1I1SA 2CWEA 1MGTA 4KIBA 4B8XA 1FSEA 5E1XA 5CVJA 3F72A 1FPQA 1MDMB 2MBFA 4OIRF 2WV0A 2XIGA 3O2PE 4Z2YA 3K9TA 1LB2A 3VOEA 2YR2A 4EV0A 3E5UA 4LMYA 1TNSA 2BV6A 3QU6A 5K5QA 3TOBA 5JHUA 1R1TA 2FNPA 3JSOA 3CO7C 2PQ8A 1TQPA 1QZYA 3GFLA 1AWCA 4GCVA 1KU7A 1SD5A 2K4BA 4OMZA 2H6CA 2AS5F 3LQQA 2RDPA 3M1EA 3QPTA 2ELHA 5D8LB 1JGSA 3R0AA 2RKHA 1YW7A 1KQ0A 4G7ZF 3RKWA 2M45A 1XMAA 2COMA 5F64A 2A61A 2ESHA 4PGGA 3RYPA 1EH8A 3L2CA 1R5HA 3F23A 2WWYA 5HVQC 5L3FA 2DT5A 2L02A 3F8FA 4HV6A 3L7WA 2O6GE 4M9XA 3HHHA 1G3WA 5CJ9A 3MZHA 4EM0B 3KE2A 3GO5A 2UWMA 4HQEA 2NNNA 4IRHA 3KP3A 1C0WA 5D5VB 1BI2A 1K6OA 4LG0A 4ZYGA 1TNTA 2J5OA 1QO0D 3WG9A 1GVJA 1E17A 2LF8A 1RUNA 1Z1DA 5L3EA 5BPIA 2HYGD 2EB7A 4ZYDA 3TKYA 1BIBA 3BY6A 2OA4A 3S2WA 1OYWA 5ICFA 2MD5A 1F9NA 2AXLA 1IN4A 3SFZA 4XLNF 4ZYHA 1T39A 3RYRA 3KFWX 4HBLA 3VODA 1WRJA 5F6FA 2QZ8A 5H20A 4A6EA 1YIOA 1DPUA 3EETA 3IWFA 4EQQA 3NRVA 3I71A 1LQ1A 4G7HF 1E2XA 1OPCA 1FOKA 2ZFWA 4Q47A 3IHUA 1T98A 4TV7A 3C1DA 4OIPF 5ERIA 5LHGA 4A0ZA 3K69A 4M73A 4U0VA 1ZREA 1RIOH 5J8FA 1BIAA 3T8RA 2NYXA 4LLNA 1R7JA 2VOOA 5ICEA 3TO6A 2VODA 1BI0A 3C3WA 2HZTA 3M9AA 3O3KA 3R60A 2NNYA 3WGHA 4GYGA 2A6HF 2GA1A 2XASA 3HOSA 3D5LA 2CO5A 4LLLA 2DTRA 3TDZC 2OAZA 4EJTA 1J9IA 5D6FA 3FMSA 5LHHA 1S8NA 2XAGA 2A3SA 5L3GA 1TQIA 2DK8A 2XVCA 1ON1A 1R00A 3HSEA 4K2EA 2XAFA 4I02A 2EFPA 3CUQA 1FLIA 3HSRA 2ZNZA 4MEYF 1USSA 3KZZA 2YX7A 1P4WA 3W6KB 3GZ6A 2VE9A 1LDDA 2P5LC 5D5WB 5K5RA 4GYIA 2HTSA 3IKVA 1JE8A 1FYMA 1KQ9A 2HOEA 1DPRA 4BYYA 3GUDA 4LFUA 4LJZF 5DV5A 2XRNA 4ETSA 1HQCA 3IKTA 3ZMDA 1GXQA 3K0LA 3TDUC 1IW7F 2LF7A 2Y75A 3GW2A 2HS5A 4U0YA 1J0RA 3SQNA 3J80K 1U5TB 4BAYA 1SD7A 3JAMZ 1XGMA 2CYYA 4XSXF 3HTSB 4P9UA 4HV5A 4HF0A 3CO6C 1LDJA 2J5PA 3Q9SA 1PP7U 4RB1A 4CICA 1XCBA 3E6BA 3FZVA 2A68F 3E5QA 1ZG3A 2RGVA 2VT3A 1H9GA 4ENJA 2EFNA 3EYIA 1XCVA 1ZH5A 3QRFF 2FU4A 2ADUA 1U78A 2ZCWA 4P96A 4HAMA 4UVCA 4KNYA 1F4KA 2L4MA 2XAHA 2E1NA 3TO7A 3LA7A 3QP5A 2HEOA 2IVMA 5D6EA 2JPBA 4JQFA 2ETHA 5LGUA 1FP1D 2IA1A 1SFXA 1RNLA 1BOAA 5F1RA 3OOPA 1I6XA 3QP6A 2NAZA 3CLOA 5LRSA 1G6NA 3HRMA 1Z6TA 5DCMB 3HIFA 1YG2A 3ABUA 3HRTA 1XDSA 4WK8F 2K27A 4WWCA 1JHHA 1FYLA 4MQ9F 2W84A 3F22A 4YIFA 2DPDA 5FD5A 2QWWA 2DW4A 4HX7A 1Z05A 3VEPA 1K7AA 3WGGA 5BS6A 3H3ZA 2LDUA 4WX9A 3KCCA 1FZPB 2K86A 2ZMEB 3WTXC 4JBAA 4O5VA 3GZ5A 5D5UB 1SMTA 4CZZA 5A2QK 2IT0A 5LGNA 4OU0A 1FBQA 4IRGA 1U8RA 2H27A 3EUHA 1FWZA 4G9YA 4ENMA 5E8IA 3IL2A 3ZN1A 2YPRA 4L18B 1LDKB 4A5NA 4OINF 5IT3A 4KDPA 2IJLA 3RPUA 2Z5UA 3ZN0A 2DK5A 3K2ZA 2W85A 3DKWA 5JI6A 4OMYA 5EEHA 2XV4S 2F5FA 5HS7A 3GF2A 3KETA 4BH9A 3KEOA 4D0PA 2Q2EA 3M7GA 2V79A 3R0JA 4L5IA 1ZHFA 2F5CA 4BHBA 4LB5A 4I01A 2HGCA 2E7WA 1LEAA 4CYDA 1L3LA 4HZFA 2QENA 2IA2A 1AOYA 4RAYA 4XBFA 4ON0A 2YU3A 1UB9A 2Z99A 3L9FA 3I54A 4OIOF 2H09A 1WI9A 3K1PA 2P7VB 5L3CA 1WSUA 3ZQ7A 4UV9A 2P5VA 5IT9Z 1UHMA 4LG0B 4UHTA 3I59A 1FP2A 3ROUA 4WXHA 2ZBKA 1XDUA 2FF4A 3KLOA 3M8EA 2RNJA 4PCQA 2FMYA 2HKXA 2W57A 4Y13A 4U7BA 1FC3A 2GXGA 2K4JA 4HDVA 5JR3A 2TDXA 1P2FA 2FSWA 2OBPA 2Z33A 4HLYA 1O3QA 4LB6B 1IN6A 5JFRA 4Q5SF 3BJOA 1KYWA 1W7PA 2DI3A 1ZRCA 5D5XB 4O3MA 1FX7A 4L0ZB 4M6YA 1I27A 1S3JA 2CFXA 2K7LA 4U7DA 3DV8A 4I2OA 3LWFA 3V8JA 2FMLA 3IRQA 4L9JA 5E1ZB 4ESJA 3VB2A 4BNCA 1S7AA 3PQKA 3V7CA 1NHAA 2ZKZA 2QQAA 4YFNF 3MAJA 5E17F 5J8CA 3MCZA 5DUKA 1J75A 2DPUA 2UZKA 3V8LA 2OQRA 3TO9A 4U88A 3KP5A 3WTYC 1H0MA 1R1UA 3IWZA 1YW8A 3WU1B 3FMQA 3I5UA 5LBQA 4RGXA 4B09A 2BGCA 1K78A 1IAWA 3DPTA 2E1CA 3FM5A 3T0YA 1BN5A 2VC0A 5BQTA 3P9CA 4S05A 3H3UA 3ZMSA 1IRFA 4L9TA 2JZYA 4IF4A 3WE2A 3R4KA 3P7NA 4A2UA 3NQOA 1W5TA 3RDIA 2PJPA 2HQNA 5E8GA 1KU3A 3DEUA 4QWQA 2HWVA 4LD5A 3IRRA 3B02A 4BHCA 1BC8C 5AIPA 3C7JA 2RC4A 4G8XA 2G9WA 1DUXC 2HDCA 2DQRA 1VTNC 1D5VA 2MLKA 2FXAA 4RS8A 3GWZA 3RKYA 1J2XA 4UUVA 1S29A 3CUQB 5ICCA 2JPCA 2OZ6A 3V4GA 4YFXF 1U3EM 4L5JA 2LNBA 4Y17A 1JXSA 4LK0F 2LKPA 2EK5A 3CTAA 2E7XA 2L4AA 4HX8A 2K02A 2L54A 1TTYA 4HX4A 5ICGA 1H9TA 3BWGA 2JT1A 4KICA 4ZZLA 3WTVC 3CUQC 3FHZA 2KKOA 2BBYA 1YW9A 2L01A 3WTUC 4QLCU 1BI3A 2M5WA 4KIFA 1XSDA 2O8XA 1ZARA 2HFHA 2VXZA 4OIQF 1XGOA 2XUBA 5HDNA 2WTEA 3R6SA 5E1WA 4YG2F 2FOKA 1IUYA 1W5SA 5FLXZ 2P5KA 3RIRA 2YSRA 3HHGA 1QGPA 2M87A 3QOPA 5HLIA 1OR7A 3DQVC 1PDNC 2PFBA 3ZMVA 4P5OA 3GVAA 4MQVA 4IVNA 4KFCA 2DFIA 3E6CC 3F21A 5DD4A 3ULQB 1J7KA 4IXAA 4EJVA 1GHCA 3SZPA 3U9GA 1XSVA 2KIFA 2V1DA 1ZG5A 5HDGA 2OQGA 1HSJA 2UXNA 4R1HA 2FBHA 2GZWA 2ZXJA 3KLNA 3DF8A 1BM9A 3F3XA 1QBJA 3E5XA 2A69F 1S6LA 1P92A 3LA2A 4ASNA 4NB5A 5TRDA 3GFMA 4I0AA 2BEOA 1SFUA 4RB3C 3F8BA 2IRFG 3KP2A 5DEQA 1I1GA 3ZMZA 2NS0A 2CQKA 3E6DA 3FX3A 1ZGJA 1B9MA 4LK1F 3GYHX 1U5TC 2GXBA 3ZMUA 2CW0F 2D1VA 2R7FA 1EV7A 4KMFA 1U6GA 3ELKA 2EWNA 2O61A 5D4SA 4KIGA 2MC3A 4G94A 3V8KA 1REPC 3F8CA 4HLXA 3GFJA 1BJAA 3I4PA 4M71A 3J81K 4G6DA 2GA2A 3JAMK 3WTSC 4N9IA 4KA4A 3KP4A 4G6QA 3W6JB 5D4RA 1B1BA 3EDPA 2CSOA 2V6CA 2Z3YA 3BPXA 4DNCA 5CVUA 2H6BA 4O6JA 4I98B 2ACJA 4A12A 1UFMA 4XLPF 3N97A 5KK1A 3HSFA 1HXDA 1TBXA 2KJCA 1HKQA 2STTA 3F6OA 2V1XA 3CJNA 2KIUA 3T1BA 3H92A 3U2RA 2A07F 3WE3A 1IZ1A 4EGYA 4RGUA 4JK1X 3KZYA 3I58A 4AIJA 4FX4A 4GXOA 1ZGAA 3L09A 4CGZA 1O7LA 2XAQA 4KMUX 3MWMA 1SD6A 4PGHA 4RB2C 5BMZA 2Q0OA 3TGNA 5CLSA 4M6XA 4PDKA 5BPDA 3G73A 1OYYA 2W24A 1LVAA 3P9IA 4CO8A 1MJ9A 2OZUA 3RPQA 1RI7A 4KYWA 4I7HA 2O03A 4WXDA 1UHWA 1XSXA 1B6AA 3RI4A 3I59B 4G7OF 1OMIA 2D2WA 1XGSA 4AWXB 1G3YA 1ZN2A 2NRAC 4ZZDA 1ZRFA 3BJ6A 1XGNA 5KVRA 1FY7A 3FXUA 2X4HA 5HS8A 4N9HA 4FX0A 2STWA 3E3VA 2CG4A 3P9KA 5CVRA 5BOXA 1MKMA 2VE8A 1B59A 2PI0A 1ONVA 1STZA 1D8JA 1R22A 3WGIA 2HR3A 1RZ4A 5LGTA 4UV8A 1USTA 1UCRA 4GGGA 1ZLKA 4LLGF 4MNUA 4MTEA 1QQIA 3GXOA 1FSHA 3E6MA 4IHSA 1EH6A 2W25A 4CDGA 4HF2A 2FBKA 4I09A 2QBYA 3KP6A 3B73A 2ZMEA 2VBZA 3FM3A 3I64A 2DQLA 3SXYA 4FHTA 3TOAA 3MQ0A 1F1ZA 2KJBA 2XROA 2YX4A 2JTVA 3F8MA 1K79A 2Q8KA 4NQWA 3ISPA 4UNOA 2P6TA 1IXCA 2UXXA 2GQQA 1W7PD 4HDUA 2GWRA 2VOPA 2G7UA 3WU0A 1O3RA 3FMRA 5ILSA 4ESBA 3MZYA 3F6VA 3TQNA
chains in the Genus database with same CATH superfamily
3BR5A 1NG6A 5LEKA 2WAFA 2WB1N 1ZG1A 1T2KA 1ODDA 3GFIA 1A35A 1T0FA 1VQPI 2KRFA 5M3FJ 3JTHA 2BY1A 5JHFA 2IP2A 2MG4A 2ZJ2A 1TZLA 2HXIA 1O3TA 3QWLA 2VT2A 1UAAA 1FOXA 3ZMTA 5DYMA 1K78B 5CYVA 2PMHA 3JR9A 4ENKA 2FEZA 1QPMA 1JKRC 2HYFA 2ME0A 1L0OC 5D8KB 2EINH 4GO1A 2M8GX 3ASOH 3PO2J 3JRCA 3FK7A 4CXFA 3Q5FA 4WCGA 1I5ZA 3FF5A 1J59A 3ZPLA 5IT9K 1O57A 4IX7A 3IC7A 2A5YB 3BROA 2ISZA 1GXPA 4MGRA 1RRJA 1VQ7I 3KEQA 3M07A 2PBIA 1CF7A 1YQAA 2O0YA 4HPQA 1SEUA 5HDKA 3GLXA 3EQLF 3DFGA 1D1AA 2D1HA 1RUOA 3J7AO 1JT6A 3SHFA 3CESA 2CJJA 4XLAA 1S7OA 2E34A 2EA2A 1HKTA 4U0WA 1MBFA 4CHUA 1G3SA 2JN6A 4L5EA 3U1KA 3T8TA 4AU7A 3IAM2 2F5DA 2X0LA 2PX9A 2R4GA 3HKZA 1MDMA 2QLZA 3RTRA 4DJAA 3HUGA 2GIZA 3Q0UA 2ID6A 2KQRA 4KT5C 1PP8F 3KP7A 4FE7A 1JTYA 1HF0A 1ENHA 2JVGA 2XGEA 2XGXA 4IRIA 2MABA 4BY1J 4AIKA 4XOPA 2RV8A 2GIVA 2D45A 4RAZA 4F93B 1XB4A 3WTZA 3DKYA 1JJ8C 1IRGA 2AXTC 1BL0A 4RGSA 4L9NA 5AONA 3CCLI 2P6SA 1HW1A 1LJ9A 3LSJA 1P7JA 2EZLA 1O7FA 5L3BA 3T5XA 3WHBA 1YFHA 2VBWA 1G3TA 1Z67A 3ZP5A 4II3A 1HW5A 2CGPA 1K6YA 3RKXA 3QPHA 1ZRDA 5ED4A 1ZYRF 4CCOA 1WI3A 4IPAA 3JRGA 3DLAA 2OU2A 1ORKA 5DCFA 1IUFA 2JA8J 1T6SA 3BG5A 1UG2A 3OYNA 2K40A 3LA3A 2QVOA 1YO5C 1SC7A 1F36A 1ZKGA 2AQFA 4XKBA 1HBXG 1D0XA 1R1VA 3CCMI 3NEUA 5IOZA 2VN2A 1ZR2A 3K4NA 2BVMA 3H9GA 3COAC 1A6QA 2XRLA 1YTYA 6PAXA 1HSTA 1ETWA 5FRMA 1WWXA 2BY3A 4D9JA 2FBIA 1BC7C 2M30A 3K1MA 1TWHJ 4FASD 3QPLA 3K10A 4RGRA 1WH7A 3X2QH 1A36A 5FO5A 4E7KA 2R92J 2JRTA 4KN4X 2GAUA 2R7TA 1U9OA 1KYZA 3HPGA 1KGSA 3HYIA 3LAPA 1IN8A 4FISA 3IAS2 4HRIA 3QU3A 2JA2A 1K4TA 2DLLA 3ECHA 1R9TJ 3HJEA 3ZCOA 5K1YA 1OKRA 3GLLA 1MD0A 4GDFA 2ME6A 5EF6A 1ACIA 1FBUA 3FXRA 3I0TA 3OS0A 3O6BB 1G59A 4P9FA 4HSRA 2DMPA 1SAXA 2RVCA 1YS7A 1S5LC 1G4DA 4Y15A 3H36A 2B0LA 5LD2C 1D3YA 3VSLA 5EYRA 3K70D 2Y48A 3VYUB 1FT9A 3HKZN 3D5RC 3L00A 5IP7J 4S0HB 1JUPA 1VI0A 1FBSA 3LMMA 3OYEA 1RETA 1JTXA 1XMXA 3K1NA 5DD8A 5J4YA 2ZO4A 3BG6A 4MHGA 1B9NA 2BVLA 2FA5A 3GTJJ 3MKLA 2L7MP 5HLHA 1BR2A 1JHFA 2BW3A 2HDDA 4IQ4A 2FRHA 1XN7A 3I4MJ 1K4SA 1VQ4I 5K7ZA 3BZ6A 5J47A 3QODA 2YU9J 4RLQA 2BHYA 1KU9A 2XGCA 4OAYA 5LLQA 1W36C 2EFWA 2HQRA 3DTIA 2X48A 5TJJA 2E1MB 1OR7C 2P8TA 5EG0A 3FIWA 2M0CA 3ZQIA 2IA0A 2LMDA 1Q1VA 3OIOA 4PSXA 1YJ9I 4YIIA 3HZJA 4LITA 3HB9A 1NTCA 1HCRA 5EDNA 1KU2A 2I10A 2VKVA 4AIHA 5ILVA 4E4HA 3R61A 5GAHJ 3H9QA 4OOIA 3REOA 1VQ9I 3LNQA 3WTWC 3RJPA 1P4XA 5DUIA 1HW2A 4HYEA 2PJRB 2Z9OA 4RDUA 2NVTJ 2RN7A 3N4MA 2X9DA 3MFKA 4ITVA 4A3GJ 5FD6A 3EYYA 3BTIA 3BP8A 2VBYA 2MA3A 4A3MJ 3S17J 2XHKA 4ENNA 3A2KA 2WY7Q 2OD5A 2W4SA 2E1MC 2F2EA 2H1KA 3GEZA 4BU2A 3DPLC 5CVVA 1IXSB 3J80Z 4IQJA 3OYBA 1AA7A 2MH2A 1TWFJ 3IP4B 4BDYA 2QSGX 1QNTA 1SFEA 2FJ1A 4Q4ZF 4UY8I 3CUOA 1RKWA 3K2AA 4M3DA 3VPRA 1JKOC 3ML6A 2PEXA 4F7ZA 1JUSA 4P1WA 2PMUA 1BBYA 2HTJA 3ERED 2HI3A 5H2FC 2BE5F 1FYKA 2WA0A 4EGZA 3V7SA 3MEXA 2WADA 3LQRA 1BI1A 1OQYA 3A0HC 3FKJA 4BXUA 1APLC 4M3EA 1O3SA 3LSTA 5FFXA 2NVYJ 5HOOA 3OYGA 5FFZA 3BTJA 4B48A 3QYEA 3H3VK 5E3LA 2V9VA 2ISYA 1B4AA 3HC7A 3SZTA 2PN6A 2EZIA 4CCNA 2LSOA 3EPZA 2L2OA 1QPIA 1Y0UA 3HTUA 2P7CB 4QPOA 3G3ZA 3LOCA 3G4SI 4ESFA 1MJBA 4YFKF 4E70A 4ZH4F 3JSPA 4KISA 2GOXB 4BQQA 4V2GA 1ZAOA 3ESWB 4RB0A 5FB2A 1Y8RB 2XF5A 2FNAA 1Y0NA 4EJWA 5FLXK 1X1BA 3A01B 2JSCA 5LEJA 1P6RA 1B72A 2DAOA 3HBLA 5EEGA 1PUEE 1R58A 1SANA 2NOGA 3HOXJ 5F27A 2M8EA 2R3SA 2EA4A 3N05A 3PFIA 4BE1A 2EV0A 2KRHA 2ZJQF 2XKOA 3NARA 2QF7A 4L9VA 2QSHX 3F8NA 5GPCA 3G6EI 2R5YA 3H5NA 1EH7A 2G7HA 1KA8A 3DBRB 3J81Z 3BDDA 1FNNA 4A6DA 3FWEA 4CA0A 1OFCX 2CQXA 3HOTA 3S14J 2MH9A 1ULYA 2F4MB 1V4RA 4UVAA 1BW6A 5FGMA 4KITB 3KIOA 2ZC2A 1VQ8I 2LH9A 4PSWA 4BQNA 2IPQX 3VYSB 3P5JA 3BPVA 3S3OA 4A5MA 1Z7UA 5IYCJ 5HS9A 2VONA 1D8KA 1BR1A 3PL8A 2DU9A 2ID3A 2PG4A 3FXQA 1YLFA 1Z3XA 2QGUA 4EVIA 2XGDA 2BYVE 4HA8A 1DQUA 3BOQA 2L3DA 4C3IJ 2QQ9A 2BOLA 5J6XA 2BZTA 3DWLE 3BR1A 1DDNA 2VC1A 1Y6IA 1DP7P 3V7RA 1TW2A 2HVQA 5FKNA 5DDGA 5GPAA 3VFZA 3PUFA 3C2GA 3LSHA 1IO2A 5H6QA 1CGPA 2RQPA 2XB5A 1MZBA 4DQ2A 2DXIA 3VWBA 3CDHA 3K4LA 4IHXA 2XAJA 2P4WA 4WXCA 1ON2A 4A3BJ 1U8BA 2V1UA 2H8RA 3TP3A 5B1BH 1A04A 3ECOA 1T33A 3OV8A 2M9HA 3SYTA 3U1DA 1YYVA 4A0XA 1G8XA 1LE8A 1HKSA 2KPMA 3PSFA 1W4MA 1V3FA 2QA4I 1U9NA 1UHSA 1D1CA 1SMYF 4MO7A 3OYHA 3RKQA 2M1BA 2DO7A 4IJAA 4XR6A 3CCSI 2GM4A 5A2QZ 2EV6A 3VDXA 2DA7A 3OYLA 3BJAA 5J3LA 3RZOJ 2C6YA 1U5TA 3EUHC 3ZOBA 4PJ0C 2DA4A 3DPUA 4B1RA 4X6AJ 4A0YA 3A1YA 1LEBA 4S04A 3FXJA 2EFQA 2HKOA 3MKWB 2Q2EB 5E20A 3F0CA 1F5TA 4RBOA 2XKPA 1VFCA 3SZGA 1XD7A 4EJUA 1R23A 4R8HA 4PZJA 5EZHA 3Q9VA 1LNWA 4E6KG 3FK6A 3I53A 4HF1A 1IN5A 5LHIA 5F0CA 1IXRC 3DP7A 3CCVI 3PNVA 1TT5B 5H6RA 5K5OA 1IG7A 5ILUA 4RAFA 3JW4A 1MJAA 2IGKA 3CCRI 1MMSA 1IN7A 3CCJI 1Z6RA 4XSZF 4M72A 3ZGKA 5K7HA 2VIXA 4IHTA 4KUMA 4BQAA 1ZLJA 1YS6A 2RREA 3BQYA 3BTLA 4Y52J 3RSNA 4AD9A 3VYRB 2QEXI 1WKMA 4XN0A 2WC2A 4RLFA 3CJTB 1YIJI 1OYIA 1SD4A 4UUSA 4B43A 2F5EA 2X6XA 3M8FA 4NHJA 1KQ8A 4DBRA 3CD6I 4M9ZA 2WV1A 4M3FA 1J5YA 2LRDA 2FQ3A 2VQCA 4NC7A 5CVIA 2VQHA 3LFKA 4MEXF 2MLGA 2QBYB 4KN7X 4NC6A 4F91B 4WF2A 4HQMA 3HRSA 4AVPA 1Q1HA 4XKCA 3QAHA 5E18F 4F3QA 5HLGA 1TQMA 3OIQA 4V19K 1I39A 5L3DA 4CUGA 3I4NJ 2EFOA 3S2DJ 1Z9CA 2KFDA 4MTDA 4M6VA 2DA5A 4XRFA 2K9NA 2HVRA 1T38A 2KIMA 3C18A 5LRRA 2Y9ZA 2QQBA 2EV5A 5FKLA 4EJOA 3S2HJ 4UB8C 3IH4A 4NQWB 2LKXA 5AIQA 4E7JA 4MIMA 2R7DA 1X3UA 3K6GA 3CCEI 1TLHB 1XMKA 2H94A 1R36A 1LFPA 4A3FJ 4I0BA 2ZNYA 1BR4A 2Y9YA 4HW0A 3AAFA 2W48A 2QUFA 1BOBA 1J09A 1TWAJ 2LTPA 2M7BA 2QM3A 3JTGA 2EJRA 2FUG2 5DCMA 3AL0C 3GBGA 3PNYA 2HQAA 1B8IB 3IH3A 1WQ2A 4EMSA 4J19A 3BG3A 2M3AA 3LAJA 1IF1A 2MGQA 4M74A 2A6EF 5EGOB 2IW5A 1I3QJ 2O3FA 3FXOA 5LFAA 4JYKA 3E97A 4EM2A 3PM1A 2QYOA 4M3BA 3TMOA 3M4OJ 3HRUA 3CCQI 2VBXA 2DFEA 2FE3A 4M9SA 1W7PB 4XICA 3D0SA 1YI2I 2PLYA 5JVTA 3DXJF 4FT8A 2M2EA 3ABTA 3L2VA 3GX4X 3WODF 4L0YB 1Z91A 2ESNA 4EM1A 5TGTA 1QZZA 2M7AA 3E1SA 3PQJA 4UVBA 1U2WA 2H1LA 5CQEA 4Q48A 3WTTC 5B1AH 4HOBA 3W2AA 2D5VA 4N0BA 2DT6A 1WJCA 1P4AA 2Y0MA 3LL7A 1H88C 3SFIA 1ITYA 1XC5A 4XLEA 4BHPA 4ZYEA 3LSRA 1R5GA 1TW3A 3H5RA 5GP9A 4XLFA 1CF7B 4LGWA 3K4CA 4H0EA 3WG7H 3B6AA 2DBBA 4R79A 4CZCA 4P55A 4UXNA 4PJLA 1I1SA 4XQFA 1N75A 2CWEA 3C2BA 1MGTA 1LPQA 1D0ZA 4KIBA 1ETQA 4B8XA 1OISA 3VSKA 3HOVJ 1EF4A 3DEEA 1FSEA 2BXYA 3FXLA 4XONA 5CVJA 2EBIA 5E1XA 3U21A 3PIOF 4FQGA 3F72A 1VQNI 3BTCA 1FPQA 1CQTA 1MDMB 2MBFA 1ZTRA 3HUGB 4OIRF 2WV0A 2XIGA 3O2PE 4Z2YA 2NS7A 1DP3A 4BJTA 1Y56A 3K9TA 1LB2A 1E3HA 3VOEA 4BGDA 2YR2A 4EV0A 1OCPA 3E5UA 4LMYA 1TNSA 2WY8Q 2UV1A 2ZXIA 3LSMA 1MMDA 2BV6A 3QU6A 2R7OA 2LOOA 5K5QA 3TOBA 5JHUA 1R1TA 2JA6J 4B3AA 2FNPA 3JSOA 3CO7C 2PQ8A 2WAQA 3OYIA 1TQPA 1QZYA 3GFLA 3OR1C 1AWCA 4GCVA 5B5EC 1KU7A 1SD5A 4B3XA 2R7QA 2LLKA 3OIPA 3BZKA 2K4BA 4OMZA 2L7KA 2H6CA 3DKXA 2AS5F 2JQ7A 1SVMA 3LQQA 2RDPA 3M1EA 2CQNA 3QPTA 2ELHA 3SDBA 5D8LB 1JGSA 3R0AA 2AQEA 2DA6A 3ABMH 4BUPA 3CMEI 1MNEA 2RKHA 3ABLH 1YW7A 1KQ0A 2FQ4A 2H8WA 1FMVA 4G7ZF 3RKWA 2CUJA 2M45A 1XMAA 1Z3YA 2COMA 5F64A 1MBKA 2A61A 3VYTB 2ESHA 4PGGA 2DFHA 1IDYA 2W1OA 3CJRB 4QPQA 3RYPA 1EH8A 3L2CA 1R5HA 3F23A 4HSTA 3ONQA 2WWYA 5HVQC 1AHDP 3QQAA 3ZQQA 5L3FA 2DT5A 2L02A 1TWGJ 3F8FA 3L7WA 4HV6A 4M9XA 2O6GE 3HHHA 3K4JA 1G3WA 4A3IJ 5CJ9A 3MZHA 2QQ8A 4EM0B 3KE2A 3RQIA 3GO5A 3ZQFA 2UWMA 2JK3A 2O7OA 2IS1A 4HQEA 2NNNA 2LREA 4PJMA 4QSHA 3GTLJ 4IRHA 3EUKL 3KP3A 1C0WA 1WJAA 2DA1A 5D5VB 4IHWA 1W0TA 3ERMA 3BT9A 1BI2A 1KZHA 1K6OA 4LG0A 4ZYGA 1X1CA 1TNTA 3S1QJ 2JA5J 1E3OC 2CU7A 2J5OA 4NNJA 1QO0D 3WG9A 1GVJA 4CCMA 1JT0A 1E17A 3DLLF 2LF8A 2BW3B 3GTOJ 1V54H 1MW7A 5BNGA 1RUNA 1Z1DA 5L3EA 5BPIA 4IO9F 2HYGD 3AG2H 4C2MJ 2EB7A 4ZYDA 5M5YJ 3I3LA 4ABZA 5EZGA 5DM7F 3TKYA 1SVOA 5GAEJ 3BY6A 1BIBA 2LVSA 1UJ8A 5EG0B 2OA4A 2EH3A 4HEA2 3K7AJ 3S2WA 1OYWA 2IXSA 2CW8A 4CH7A 3OYDA 5ICFA 2MD5A 3H1CA 1R49A 3DBLB 3GZNB 4XN3A 1F9NA 1VZ0A 2XPVA 2VASA 1WPKA 2IAIA 2V9PA 2AXLA 1IN4A 3SFZA 4XLNF 4ZYHA 2R0QC 3FBNB 1T39A 3RYRA 2NVQJ 3KFWX 1FMWA 2OF7A 3S1NJ 4HBLA 1MIJA 3VODA 4A3DJ 5FROA 1HDPA 1WRJA 2ELKA 4A3KJ 5F6FA 5C4XJ 4BDZA 2QZ8A 3PJRA 1ETOA 3A02A 3BZCA 2GBYA 2V9KA 3AG1H 5H20A 5C3EJ 4A6EA 1YIOA 1DPUA 3K70C 3CDIA 2DMTA 3CJQB 3EETA 2R7XA 3CMMA 1X1PA 1K83J 1LKXA 3IWFA 2HOTA 4EQQA 3NRVA 1WJBA 3I71A 4DGWB 4G7HF 1LQ1A 1RKTA 1E2XA 1GV5A 4HG2A 4PK4A 1OPCA 1XPXA 1FOKA 2ZFWA 3K4MA 4Q47A 1VQOI 3IHUA 1FEXA 3WU2C 1E0EA 1T98A 4TV7A 3C1DA 2QKMB 4OIPF 2X51A 3HOYJ 2XSDC 2DTZA 4BXXJ 4C9YA 5ERIA 5LHGA 4A0ZA 3K69A 4M73A 4U0VA 1ZREA 3ASNH 1RIOH 3DU5A 5J8FA 1IJWC 1BIAA 2Z1DA 1X4OA 3T8RA 1WJFA 3OR2C 2NYXA 1VQ5I 2ZSIB 4LLNA 1R7JA 2VOOA 5ICEA 3TO6A 2VODA 1BI0A 3C3WA 4XRSG 2HZTA 3M9AA 3KX2A 3O3KA 1KONA 3EUAA 3R60A 1IGNA 1IRXA 2NNYA 3WGHA 4GYGA 2X6YA 2OCEA 2A6HF 2GA1A 2XASA 3OY9A 2M4GA 2LG4A 3Q0WA 2VKEA 2WBMA 3HOSA 3D5LA 2CO5A 2NS8A 4LLLA 2MFZA 2DTRA 3IUOA 4N4OB 3TDZC 2LR8A 2R5YB 2OAZA 1LFUP 4XLHA 4EJTA 1WCMJ 4RA2A 1N78A 1J9IA 3ZQCA 4BJ5C 4C30A 5D6FA 4B4CA 3FMSA 1W1WE 5LHHA 1S8NA 2Q1ZB 1Z7LA 4ZDOA 2XAGA 2A3SA 5L3GA 1TQIA 2KZVA 2AO9A 2DK8A 2XVCA 1ON1A 4BL0B 1R00A 2L5QA 2M4KA 2VJJA 4RM3A 3HSEA 2COBA 4K2EA 3HDDA 1VF9A 2XAFA 5IP6A 1BW5A 4I02A 1ETVA 1WJEA 4Y33A 2EFPA 3JCUC 1UZCA 1YHQI 1YJWI 3CC7I 3DEWA 3CUQA 2X1CA 4GRIA 1FLIA 1JGGA 2LKSA 3HSRA 2Y30A 1WHUA 2ZNZA 4MEYF 1USSA 1GLNA 2IGMA 3KZZA 1NH3A 2YX7A 5KAIC 2KDOA 1P4WA 3W6KB 2E36A 3GZ6A 1I3AA 2L9NA 2YS9A 2VE9A 4IKFA 2LY9A 1LDDA 3LSIA 4DYRA 2P5LC 5D5WB 5K5RA 4GYIA 1JJ6C 2HTSA 3IKVA 3KYLA 1JE8A 2K3PA 5GTHC 2WAEA 1DU0A 1FYMA 3CC2I 1KQ9A 3G2BA 2PMZA 2HOEA 1DPRA 2E5NA 3GUDA 4LFUA 4LJZF 4BYYA 3L2RA 5DV5A 2XRNA 4ETSA 3K4BA 4PFPA 4GFBA 1HQCA 3TL4X 1FOWA 1LE8B 2LFBA 3HOZJ 3IKTA 3ZMDA 2M0MA 1GXQA 2RAEA 2RQQA 2Y69H 3K0LA 1IW7F 3TDUC 2LF7A 2Y75A 1R71A 3GW2A 2HS5A 4U0YA 2TCTA 2EIKH 3CF5F 3JREA 1J0RA 3SQNA 3OL4A 2CUFA 4XOTA 3J80K 2W7NA 1U5TB 3GTGJ 3S32A 4BAYA 2CQQA 1SD7A 5JLXA 3JAMZ 1XGMA 3KEYA 2CYYA 4XSXF 2DMUA 2XC7A 1OCCH 3HTSB 1WH5A 2W82A 4FTHA 2R7WA 3ZQHA 2B7EA 4P9UA 1AKHA 2R7VA 2LP0A 4HV5A 4CCJA 4IZZA 4HF0A 3QPSA 3CO6C 4RMNA 1LDJA 3L1PA 4BACA 1OCTC 2J5PA 5C4JJ 3Q9SA 1PP7U 3KZIC 4RB1A 4CICA 1XCBA 2AHQA 2L9VA 3E6BA 3FZVA 1GUUA 2A68F 3E5QA 1ZG3A 2RGVA 2VT3A 1H9GA 3GMEA 2Z2SB 4ENJA 2XDVA 4D7MA 3L2WA 3G71I 4D5FA 1F43A 2EFNA 3EYIA 1XCVA 1DGRM 1ZH5A 4UUSB 1LUJB 2V6EA 3QRFF 2FU4A 2ADUA 3MZ8A 4XNFA 1U78A 2ZCWA 2CQ7A 4P96A 4HAMA 2LBFA 3DCFA 1Y1WJ 4UVCA 4KNYA 1X19A 2UUZA 4A3LJ 1MBEA 3TW6A 1F4KA 2KLOA 2E71A 4E7IA 2L4MA 4J00A 2XB0X 4DBQA 2XAHA 1GVDA 1X2MA 2E1NA 3TO7A 4Z6YA 2E1OA 2EIMH 1WJ5A 3LA7A 3QP5A 4I99C 3UKGA 2GLOA 4PJNA 4ZYAA 2HEOA 2IVMA 5D6EA 5B3SH 2CUEA 2JPBA 2F6CA 2LY2A 3FKIJ 1PUFA 1MBGA 2RNGA 4JQFA 2PMZN 1OCRH 1TWCJ 2VUMJ 2ETHA 3S3NA 4M3GA 1FP1D 5LGUA 2OTLI 2IA1A 1SFXA 3W2WA 1RNLA 2VJ5A 2Y2ZA 1BOAA 5F1RA 3OOPA 1QRYA 1I6XA 3OYKA 3QP6A 2JVHA 1XX5A 1Z77A 2HQ5A 2NAZA 3CLOA 5LRSA 2QCOA 1G6NA 3MVPA 3GTQJ 3DBHB 3HRMA 1HDDC 4IHYA 1Z6TA 5DCMB 3KPHA 3A01A 2MD0A 3HIFA 4XK4A 2V26A 1YG2A 2ZFUA 3ABUA 5IP9J 3L2QA 2VXDA 2DDAA 3HRTA 1XDSA 1VQ6I 3G1OA 2R7SA 4WK8F 2K27A 4WWCA 2O9LA 1FTTA 1QHGA 1GT0C 1JHHA 1FYLA 2VKHA 5M3MJ 4MQ9F 2W84A 3F22A 4YIFA 2DPDA 4XMYA 5FD5A 2QWWA 2DW4A 2ZJPF 4ZC3A 4HX7A 2OPTA 2NOJB 1WJDA 1Z05A 3VEPA 1K7AA 4Y7NJ 4HNVA 3PO3J 2XAUA 3WGGA 1E3PA 5BS6A 1QVTA 2R7ZJ 3H3ZA 4QTRA 2LDUA 1HLVA 3LFUA 4WX9A 3KCCA 1FZPB 1UELB 2K86A 4IHVA 2ECBA 2ZMEB 5HNFA 3ZRGA 1BJZA 3WTXC 4JBAA 4D1QA 4JX5A 4O5VA 2GOMA 3GZ5A 4FE4A 2DMQA 4LOCA 2NXNB 5D5UB 2HYJA 1SMTA 4CZZA 5A2QK 2IT0A 1XG1A 5LGNA 4OU0A 1U0JA 5HLTA 2A05A 1FBQA 4IRGA 1U8RA 2JMWA 2H27A 2KMUA 3EUHA 1FWZA 4G9YA 3AFHA 4ZTJA 4ENMA 1EJ9A 2E35A 2F5VA 2M34A 2KIQA 5E8IA 3IL2A 3ZN1A 3I9V2 2YPRA 2ZSHB 1X3WB 5KCMA 1IV6A 4L18B 1LDKB 2Y0SA 3G1MA 1RPWA 2BHZA 2ZB9A 4A5NA 4OINF 2ZMEC 4DZJA 4JX4A 5IT3A 4KDPA 2IJLA 3RPUA 4LG3A 2Z5UA 3ZN0A 2E5ZA 2DK5A 3K2ZA 2W85A 2OTJI 1TT0A 3FISA 3DKWA 2DDBA 1R4MB 4BE0A 3BCBA 4A3EJ 5JI6A 4OMYA 5EEHA 2XV4S 4BJ6C 4I76A 1I6HJ 2F5FA 3D5SC 3FHNA 5HS7A 5IOYA 2YUSA 3GF2A 3KETA 3SJMA 4BH9A 4XKWA 1RC9A 4XM3A 3KEOA 4D0PA 1SVLA 2Q2EA 1DGWY 1AU7A 3M7GA 2V79A 3R0JA 4L5IA 1ZHFA 2F5CA 2LK2A 5KNLA 4BHBA 3GCMA 4LB5A 3HEFA 1D1BA 2JUGA 4I01A 2E60A 3E0JB 3H35A 4HNUA 2HGCA 2E7WA 2VL8A 3CMYA 1LEAA 3NWTA 2CV0A 3IH2A 5B66C 1T0FC 2LYCA 4CYDA 1L3LA 4HZFA 2E2JJ 2QENA 3TBIA 2IA2A 3JRHA 1ZK8A 2HPMA 1AOYA 4RAYA 4XBFA 4ON0A 1TP4A 2YU3A 1OLTA 1YX5A 2KL4A 1A5JA 1R5ID 1UB9A 2Z99A 2O8KA 2HOSA 3F9KA 1XS9A 2CW7A 3FXKA 5TISC 3L9FA 3I54A 4OIOF 2H09A 1ETYA 3H5AA 1WI9A 1YRNA 3K1PA 3MN2A 4PFOA 1VQMI 2P7VB 5L3CA 3B6CA 2V4JC 1ETXA 1WSUA 1MNMC 3ZQ7A 4UV9A 2X85A 2A5WA 2OJED 2CMPA 4H4KC 2P5VA 1D0YA 5F08A 5IT9Z 4CYCA 5CQGA 1UHMA 4LG0B 1O4XA 2O5RA 4UHTA 3I59A 2Y0SN 1FP2A 2G0EA 2R5ZA 3ROUA 4WXHA 2ZBKA 1XDUA 2FF4A 2XSJC 2HVSA 2K9QA 1HOMA 4IOCF 3KLOA 3OYFA 5CPRB 1YOVB 1H89C 3M8EA 1V55H 2RNJA 3J7ZI 2KZGA 2V7FA 4PCQA 3JRFA 5J4VA 2FMYA 2HKXA 2JUCA 4Y3OA 3M3YJ 2R7UA 1P7IA 2W57A 3S93A 4Y13A 1T08B 4U7BA 1MMGA 1V5EA 1FC3A 2EZHA 1EKEA 2L7FP 3E7LA 2GXGA 1B8IA 2K4JA 4HDVA 1TL8A 5JR3A 2TDXA 1S9HA 2VPRA 5EGOA 1P2FA 2FSWA 1N25A 2X6WA 2JSPA 2OBPA 2Z33A 4HLYA 3CQZJ 1O3QA 2DJNA 1UG0A 3A0BC 1VNDA 4LB6B 1IN6A 5JFRA 4Q5SF 3BJOA 1KYWA 1W7PA 2DI3A 1ZRCA 4BEHA 5K7FA 5IY5H 5D5XB 2I8DA 4JP0A 3J7AY 4O3MA 1FX7A 2VI6A 4L0ZB 5GTIC 3FBIB 1T8IA 1GDTA 4M6YA 3HGYA 1G2HA 3BR6A 4E7ZA 3S3MA 1I27A 1S3JA 1A31A 3O8GA 2QKLB 2CFXA 2K7LA 3M1CA 4U7DA 4DIQA 3DV8A 4W97A 2HOAA 2R7RA 4XORA 1Y39A 4I2OA 3K4KA 3LWFA 3JRAA 3CCYA 3V8JA 5F0HA 2FMLA 3IRQA 4L9JA 5E1ZB 4ESJA 2NVUB 3VB2A 4BNCA 5C44J 1S7AA 3CZ6A 3PQKA 3V7CA 3ZQLA 1NHAA 2ZKZA 2DN0A 1NK2P 2QQAA 4YFNF 2B9SA 3MAJA 5E17F 1Z21A 5J8CA 3MKYB 3MCZA 5DUKA 1J75A 2E19A 2EQRA 2JWTA 4NDLA 2DPUA 3DTEA 2UZKA 3S1RJ 3OYJA 1R6RA 5M5WJ 3V8LA 2OCCH 5JLWA 2OQRA 3A4CA 3TO9A 4U88A 2X6OA 1IV8A 3BR3A 3KP5A 3WTYC 3OOUA 1H0MA 1R1UA 3IWZA 3QYBA 3W3CA 2DJIA 2IGOA 2OUMA 1MH3A 1QHHD 1X3ZB 2WAQN 1YW8A 3WU1B 3FMQA 3I5UA 5LBQA 4ZDPA 4RGXA 4B09A 3D1NI 2BGCA 1K78A 4F55A 1IAWA 3DPTA 2E1CA 4W1UA 3FM5A 3T0YA 4AYBA 3NWSA 1BN5A 2VC0A 2ZXHA 5BQTA 3P9CA 4S05A 4BKXA 2X1EA 3H3UA 3ZMSA 1IRFA 2DOEA 4L9TA 3HG9A 2JZYA 3L2UA 2DT7B 2ZXWH 4IF4A 4OAZA 3M8JA 3WE2A 1Z0XA 5IYBJ 3R4KA 3P7NA 4AIDA 4BQOA 4BXFA 5EJCA 3NQOA 1SFKA 2OV7A 4A2UA 1W5TA 3RDIA 2BY2A 2PJPA 3S16J 5FJ8J 1S7EA 2HQNA 5E8GA 1KU3A 5IPAA 4A69C 4KJZA 3I55I 2LD5A 3DEUA 2F4OB 2W00A 4QWQA 2HWVA 4LD5A 3BR2A 3IRRA 2GXAA 3B02A 4BHCA 1BC8C 1YX3A 1ZGWA 2K5CA 1JKPC 2N8GA 5AIPA 3BLYA 3DTKA 3C7JA 1P9QC 2RC4A 4G8XA 2G9WA 1DUXC 4II2A 2DQRA 2HDCA 1VTNC 1D5VA 2MLKA 2FXAA 4RS8A 3GWZA 3RKYA 4XRSA 3CC4I 4V2FA 1J2XA 4XRMA 2IBDA 3LSPA 1NK3P 2XPWA 4UUVA 1S29A 3CUQB 5ICCA 2JPCA 2OZ6A 4ZDLA 3V4GA 1WZ2A 3PFYA 3C2HA 4YFXF 1HA8A 2HXOA 1U3EM 4L5JA 2LNBA 4Y17A 1JXSA 4AVZA 4LK0F 2LKPA 2EK5A 5FKKA 1FOYA 2KRCA 3CTAA 4XKVA 2ELJA 3J7YJ 2E7XA 5KAFC 2L4AA 4HX8A 2IS4A 1LVKA 1X2NA 2P0WA 5M5XJ 2K02A 2L54A 1TTYA 3G1LA 4HX4A 5ICGA 1H9TA 3BWGA 2JT1A 4KICA 4ZZLA 3WTVC 5F04A 4E7LA 1V5GA 3UR3C 1B72B 3BQZA 3CUQC 5GADJ 3FHZA 4DZPA 2KKOA 4RAGA 2BBYA 1YW9A 2L01A 3WTUC 3OS2A 1T95A 4QLCU 5E3NA 1BI3A 2M5WA 4NUBA 2A6TA 4KIFA 1UMQA 5CKTA 4AYBN 4Y4RA 1XSDA 4YIRX 2K3FA 1RR8C 2O8XA 1ZARA 4D5CA 2HFHA 2VXZA 1AKHB 4OIQF 1W36D 1FIPA 2OC6A 1X1DA 1XGOA 2K9LA 2XUBA 5HDNA 2WTEA 3R6SA 3WHCA 5E1WA 3RZDJ 1JKQC 4YG2F 2FOKA 1IUYA 1W5SA 5FLXZ 2P5KA 1H8AC 3H9JA 3ZQGA 3TEDA 4LIUA 3A03A 4BE2A 3PSIA 4BBSJ 3RIRA 2YSRA 3FDYA 4C2TA 4AUXA 4JX6A 3HHGA 1QGPA 2M87A 3BG7A 2TRTA 2JA7J 3QOPA 3TW7A 5HLIA 3GTMJ 1QA6A 2LBFB 1OR7A 3DQVC 4F52A 1PDNC 2PFBA 3ZMVA 5FKMA 2JRMA 4I6ZA 4F92B 4P5OA 3GVAA 3CMAI 4MQVA 2K9SA 4IVNA 4E7HA 2JJ7A 4KFCA 2L9RA 3S15J 5J1UA 2DFIA 1PJRA 2F48A 3E6CC 3F21A 1I50J 5DD4A 2IGNA 2KHMA 4DYQA 1YE9A 3ULQB 1J7KA 1R4NB 4IXAA 3MKZA 1ZR4A 2VJIA 4EJVA 3CDLA 1IRZA 1GHCA 3SZPA 1PUFB 1VQKI 3JRDA 3U9GA 1XSVA 2KIFA 2V1DA 2VB6A 1ZG5A 5HDGA 4YELA 2OQGA 1HSJA 2UXNA 4R1HA 2FBHA 5KHDA 2GZWA 2ZXJA 3GTKJ 3BR0A 1MMAA 3KLNA 1SAUA 3DF8A 1BM9A 3F3XA 1QBJA 2K9MA 3E5XA 3IV5A 1X58A 2A69F 4BY7J 1MH4A 1T56A 4ZJZA 1S6LA 3MMYB 4DYCA 2EZKA 3ZXSA 1P92A 3MD2A 2R93J 4D7NA 3LA2A 4ASNA 2DA3A 5FLVA 4NB5A 2VJ4A 5TRDA 3GFMA 1MNDA 4I0AA 1K61A 2DOAA 2EPFA 2BEOA 2HU9A 2P81A 1D5YA 3W2VA 1LFBA 1SFUA 4RB3C 2PJRA 3V42A 1WFXA 3F8BA 2IRFG 3KP2A 1NG7A 2HNHA 4KT6A 5DEQA 4B47A 1I1GA 3ZMZA 2NS0A 3LSKA 2CQKA 1FTZA 3AG4H 3E6DA 1WGXA 3FX3A 1ZGJA 2NVXJ 1B9MA 2DOFA 4LK1F 3GYHX 1U5TC 3Q3SA 2GXBA 3ZMUA 2CW0F 2D1VA 2MYSA 2R7FA 3AG3H 4G12A 3ABKH 1EV7A 4KMFA 1U6GA 3ELKA 3OL3A 2EWNA 5F1JA 1WVRA 2O61A 5D4SA 5JVGF 2EILH 5IYDJ 4KIGA 1MSFC 2MC4A 1ERDA 2MC3A 2XPUA 3OYMA 4G94A 1FIAA 2L7ZA 2CV2A 1Y1VJ 2VQLA 4MFEA 3V8KA 1REPC 3F8CA 4HLXA 1VQLI 2DCEA 2Z16A 3CLQA 5GAGJ 2K85A 4IEJA 3GFJA 1BJAA 3CP8A 3I4PA 3I56I 4M71A 4A3CJ 3J81K 4G6DA 1W5CC 3OMYA 2GA2A 5E79C 5FLMJ 3JAMK 3WTSC 4N9IA 4KA4A 3QOEA 1BA5A 5HNHA 3KP4A 2KP6A 4AC0A 3QYFA 4G6QA 3W6JB 2DYRH 3HPHA 1X1AA 3HGGA 4CCLA 1IC8A 2V1NA 5D4RA 1B1BA 3EDPA 5FKOA 2CSOA 2KDZA 1RESA 5DTDA 2V6CA 3TP0A 2Z3YA 3BPXA 4G6TB 4DW6A 3PNTA 4XLCA 4DNCA 2F4IA 2CV1A 5CVUA 2H6BA 4A3JJ 3NAUA 4O6JA 4I98B 3CCUI 2L9SA 3UNGC 3AKZA 2ACJA 4A12A 1UFMA 4BBRJ 4E7SA 4XLPF 3N97A 5KK1A 1MBJA 3HSFA 4IL6C 1HXDA 1XTAA 5E3MA 2DMNA 2DYSH 4NC8A 1TBXA 4BS9A 2KJCA 3OYCA 2XF7A 1HKQA 3S1MJ 2STTA 3F6OA 2V1XA 3CJNA 2KIUA 4EEFG 4UB6C 4XIDA 3RQ4A 3T1BA 3H92A 3SDGA 3U2RA 2A07F 1OCOH 3WE3A 1IZ1A 2VLAA 2IS2A 4C3HJ 4CCKA 4EGYA 4RGUA 4JK1X 3KZYA 3I58A 3RCOA 1N77A 3BC8A 1OJLA 1YJNI 4AIJA 2EIJH 1MSEC 1QVUA 4FX4A 4GXOA 1ZGAA 2CUZA 3L09A 1O7LA 4CGZA 2XAQA 4KMUX 3MWMA 3Q0VA 3ZR8X 3H0DA 1SD6A 4C2UA 3KYCB 4PJJA 2B63J 4PGHA 3RPUD 4RB2C 4XL9A 5BMZA 5EEAA 2ECCA 2Q0OA 3OYAA 3TGNA 5CLSA 4M6XA 4PDKA 2E2HJ 3BCAA 3PUBA 1Y8QB 3LSGA 1YRNB 5BPDA 2VKDA 3G73A 4UUTA 1OYYA 2W24A 1LVAA 3P9IA 4CO8A 1MJ9A 2OZUA 3RPQA 1RI7A 3AL0B 4KYWA 2IS6A 4I7HA 2O03A 1ETKA 4WXDA 3H0GJ 5E3OA 1TC3C 1S72I 2DODA 4CYCB 2VPLA 1UHWA 1XSXA 4X1EA 5DM6F 1B6AA 4NBQA 3RI4A 1IDZA 4FCYA 2L0KA 3I59B 4G7OF 4C3JJ 1OMIA 2D2WA 2R5ZB 1GV2A 4U87A 3DU6A 4HNTA 1XGSA 4QIWN 1SFOJ 4AWXB 1G3YA 2X1DA 1HC8A 1ZN2A 2NRAC 4ZZDA 1ZRFA 3BJ6A 2DA2A 2BXZA 1XGNA 4MFDA 2WB1A 1POGA 2KISA 5KVRA 1FY7A 2IEKA 1JI8A 3FXUA 3GTPJ 2X4HA 5HS8A 4N9HA 4FX0A 2MSYA 2STWA 3E3VA 4CSWA 2CG4A 2HDWA 1ZELA 3P9KA 5CVRA 5BOXA 1MKMA 1ZQ3P 2VE8A 4OWRB 1RR7A 1QZEA 1B59A 2HPIA 1MMNA 2PI0A 1QU3A 1ONVA 1STZA 4MLOA 2VQGA 1D8JA 3JRIA 2ICWG 2KT0A 1R22A 2E2IJ 3WGIA 4IOAF 2HR3A 4RM2A 1RZ4A 5J40A 5LGTA 4BEHB 3SEQA 4JOMA 2FOWA 1USTA 1UCRA 4UV8A 9ANTA 1OCZH 4GGGA 1ZLKA 2LY1A 3OWTA 4LLGF 4MNUA 4DOZA 2DFFA 4J01A 1PYVA 4MTEA 1QQIA 3GXOA 2FX0A 3HL2A 1MBHA 5HODA 1FSHA 3E6MA 3JRBA 2CH0A 5DS9A 2LC2A 5J1YA 4IHSA 1EH6A 1X4PA 2W25A 4PUSA 2XF6A 3BG9A 3HOWJ 3S8PA 4CDGA 4HF2A 4ANJA 4AM3A 2FBKA 4I09A 2QBYA 3KP6A 3O8HA 3B73A 2ZMEA 2VBZA 3W6VA 1PVEA 3OS1A 4YEJA 3FM3A 3KYDB 1M1EB 5F0FA 5J1RA 3I64A 3HOUJ 1W0UA 2CFOA 2DQLA 2MW8A 3SXYA 3HXLA 4FHTA 3TOAA 3MQ0A 1F1ZA 2KJBA 2XROA 2BY0A 1EA3A 2YX4A 2JTVA 4B44A 3F8MA 2HZDA 1FJLA 1K79A 2Q8KA 5FRNA 1DU6A 4X0GA 2ZJRF 1V5FA 4NQWA 1YITI 3OSFA 1JUMA 3ISPA 4UNOA 4YRVA 2P6TA 3OSGA 1IXCA 2UXXA 2GQQA 1W7PD 1A6IA 2QSFX 4HDUA 2GWRA 4LIVA 4A93J 2VOPA 2FD5A 3CP2A 3FXMA 2G7UA 3WU0A 1O3RA 4EATA 3CF2A 3FMRA 4N4NB 2CRGA 4ZTFA 5ILSA 2Y31A 4ESBA 3PIPF 2I5UA 3MZYA 2CS3A 3HM5A 4FETA 3F6VA 3TQNA 3SEZA
chains in the Genus database with same CATH topology
5LEKA 1ZG1A 1T2KA 1ODDA 3GFIA 1T0FA 2KRFA 3JTHA 2IP2A 2ZJ2A 1O3TA 2VT2A 3ZMTA 5DYMA 1K78B 5CYVA 2PMHA 4ENKA 2FEZA 1QPMA 2HYFA 1L0OC 5D8KB 4GO1A 4CXFA 3Q5FA 4WCGA 1I5ZA 3FF5A 1J59A 3ZPLA 5IT9K 1O57A 3IC7A 2A5YB 3BROA 2ISZA 1GXPA 4MGRA 3KEQA 1CF7A 2PBIA 1YQAA 2O0YA 5HDKA 3GLXA 3EQLF 3DFGA 1RUOA 2D1HA 3J7AO 3SHFA 1S7OA 2EA2A 1HKTA 4U0WA 4CHUA 1G3SA 3T8TA 2F5DA 2X0LA 1MDMA 2QLZA 3RTRA 3HUGA 4KT5C 1PP8F 3KP7A 2XGXA 4IRIA 4AIKA 2RV8A 2GIVA 2D45A 4RAZA 1XB4A 3WTZA 1IRGA 4RGSA 4L9NA 5AONA 2P6SA 1HW1A 1LJ9A 1O7FA 5L3BA 3T5XA 1YFHA 2VBWA 1G3TA 3ZP5A 1HW5A 2CGPA 3RKXA 3QPHA 1ZRDA 5ED4A 1ZYRF 4IPAA 2OU2A 5DCFA 1T6SA 3LA3A 2QVOA 1YO5C 1HBXG 1R1VA 3NEUA 2VN2A 3COAC 6PAXA 1YTYA 1HSTA 1WWXA 2FBIA 1BC7C 2M30A 3K1MA 4RGRA 5FO5A 2JRTA 4KN4X 2GAUA 1KYZA 1KGSA 3HYIA 3LAPA 1IN8A 3QU3A 2DLLA 3ECHA 5K1YA 1OKRA 1MD0A 1FBUA 3FXRA 3I0TA 3O6BB 4P9FA 1SAXA 2RVCA 1YS7A 1G4DA 4Y15A 2B0LA 1D3YA 2Y48A 1FT9A 3L00A 1FBSA 3K1NA 5DD8A 2ZO4A 4MHGA 1B9NA 2FA5A 5HLHA 1JHFA 2FRHA 1XN7A 3BZ6A 1KU9A 5LLQA 2EFWA 2HQRA 5TJJA 2P8TA 2IA0A 4YIIA 1KU2A 4AIHA 5ILVA 3R61A 4OOIA 3REOA 3WTWC 3RJPA 1P4XA 5DUIA 1HW2A 4HYEA 2Z9OA 2RN7A 3N4MA 3MFKA 5FD6A 3EYYA 3BP8A 2VBYA 2MA3A 2XHKA 4ENNA 2OD5A 2F2EA 3GEZA 3DPLC 5CVVA 1IXSB 3J80Z 2MH2A 1QNTA 1SFEA 4Q4ZF 3CUOA 3ML6A 2PEXA 4F7ZA 2PMUA 1BBYA 2HTJA 3ERED 2BE5F 1FYKA 4EGZA 3V7SA 3MEXA 3LQRA 1BI1A 4BXUA 1O3SA 3LSTA 5FFXA 5HOOA 5FFZA 2V9VA 2ISYA 1B4AA 3SZTA 2PN6A 2LSOA 1Y0UA 3HTUA 2P7CB 3G3ZA 4ESFA 1MJBA 4YFKF 4E70A 4ZH4F 3JSPA 1ZAOA 4RB0A 5FB2A 2FNAA 4EJWA 5FLXK 2JSCA 5LEJA 1P6RA 2DAOA 5EEGA 1PUEE 1R58A 2M8EA 2R3SA 2EA4A 3PFIA 2EV0A 2XKOA 4L9VA 3F8NA 1EH7A 2G7HA 1KA8A 3J81Z 3BDDA 1FNNA 4A6DA 3FWEA 3HOTA 2MH9A 1ULYA 1V4RA 4UVAA 5FGMA 2IPQX 3BPVA 4A5MA 1Z7UA 5HS9A 2VONA 1D8KA 2DU9A 2PG4A 3FXQA 1YLFA 4EVIA 2BYVE 4HA8A 3BOQA 2L3DA 2QQ9A 5J6XA 1DDNA 2VC1A 1DP7P 3V7RA 1TW2A 5DDGA 3VFZA 5H6QA 1CGPA 2RQPA 1MZBA 4DQ2A 3CDHA 2XAJA 2P4WA 4WXCA 1ON2A 2V1UA 1A04A 3ECOA 3OV8A 3U1DA 4A0XA 1YYVA 1HKSA 1W4MA 1V3FA 1SMYF 2M1BA 2DO7A 4IJAA 5A2QZ 2EV6A 3BJAA 2C6YA 1U5TA 4A0YA 1LEBA 4S04A 2EFQA 2HKOA 5E20A 1F5TA 2XKPA 4EJUA 1XD7A 1R23A 4R8HA 4PZJA 3Q9VA 1LNWA 3I53A 4HF1A 1IN5A 5LHIA 1IXRC 3DP7A 5H6RA 5K5OA 5ILUA 3JW4A 1MJAA 1IN7A 4XSZF 1Z6RA 4M72A 4IHTA 4KUMA 4BQAA 1ZLJA 1YS6A 4AD9A 1WKMA 2WC2A 1OYIA 1SD4A 2F5EA 3M8FA 4NHJA 1KQ8A 4M9ZA 1J5YA 2FQ3A 5CVIA 3LFKA 4MEXF 2MLGA 2QBYB 4KN7X 4WF2A 4HQMA 3HRSA 4AVPA 1Q1HA 3QAHA 5E18F 5HLGA 1TQMA 5L3DA 2EFOA 1Z9CA 4MTDA 4XRFA 1T38A 2KIMA 3C18A 5LRRA 2QQBA 2EV5A 4EJOA 5AIQA 2R7DA 1X3UA 1TLHB 1XMKA 2H94A 1R36A 4I0BA 2ZNYA 4HW0A 3AAFA 2QUFA 2QM3A 3JTGA 2EJRA 5DCMA 1WQ2A 4EMSA 1IF1A 3LAJA 4M74A 2A6EF 2IW5A 2O3FA 3E97A 4EM2A 2QYOA 3HRUA 2VBXA 4M9SA 2FE3A 1W7PB 3D0SA 2PLYA 5JVTA 3DXJF 4FT8A 3ABTA 3GX4X 3WODF 4L0YB 1Z91A 2ESNA 4EM1A 1QZZA 3PQJA 4UVBA 1U2WA 4Q48A 3WTTC 4HOBA 4N0BA 1P4AA 2Y0MA 4BHPA 4ZYEA 1R5GA 1TW3A 1CF7B 4LGWA 4H0EA 2DBBA 4R79A 4P55A 4UXNA 1I1SA 2CWEA 1MGTA 4KIBA 4B8XA 1FSEA 5E1XA 5CVJA 3F72A 1FPQA 1MDMB 2MBFA 4OIRF 2WV0A 2XIGA 3O2PE 4Z2YA 3K9TA 1LB2A 3VOEA 2YR2A 4EV0A 3E5UA 4LMYA 1TNSA 2BV6A 3QU6A 5K5QA 3TOBA 5JHUA 1R1TA 2FNPA 3JSOA 3CO7C 2PQ8A 1TQPA 1QZYA 3GFLA 1AWCA 4GCVA 1KU7A 1SD5A 2K4BA 4OMZA 2H6CA 2AS5F 3LQQA 2RDPA 3M1EA 3QPTA 2ELHA 5D8LB 1JGSA 3R0AA 2RKHA 1YW7A 1KQ0A 4G7ZF 3RKWA 2M45A 1XMAA 2COMA 5F64A 2A61A 2ESHA 4PGGA 3RYPA 1EH8A 3L2CA 1R5HA 3F23A 2WWYA 5HVQC 5L3FA 2DT5A 2L02A 3F8FA 4HV6A 3L7WA 2O6GE 4M9XA 3HHHA 1G3WA 5CJ9A 3MZHA 4EM0B 3KE2A 3GO5A 2UWMA 4HQEA 2NNNA 4IRHA 3KP3A 1C0WA 5D5VB 1BI2A 1K6OA 4LG0A 4ZYGA 1TNTA 2J5OA 1QO0D 3WG9A 1GVJA 1E17A 2LF8A 1RUNA 1Z1DA 5L3EA 5BPIA 2HYGD 2EB7A 4ZYDA 3TKYA 1BIBA 3BY6A 2OA4A 3S2WA 1OYWA 5ICFA 2MD5A 1F9NA 2AXLA 1IN4A 3SFZA 4XLNF 4ZYHA 1T39A 3RYRA 3KFWX 4HBLA 3VODA 1WRJA 5F6FA 2QZ8A 5H20A 4A6EA 1YIOA 1DPUA 3EETA 3IWFA 4EQQA 3NRVA 3I71A 1LQ1A 4G7HF 1E2XA 1OPCA 1FOKA 2ZFWA 4Q47A 3IHUA 1T98A 4TV7A 3C1DA 4OIPF 5ERIA 5LHGA 4A0ZA 3K69A 4M73A 4U0VA 1ZREA 1RIOH 5J8FA 1BIAA 3T8RA 2NYXA 4LLNA 1R7JA 2VOOA 5ICEA 3TO6A 2VODA 1BI0A 3C3WA 2HZTA 3M9AA 3O3KA 3R60A 2NNYA 3WGHA 4GYGA 2A6HF 2GA1A 2XASA 3HOSA 3D5LA 2CO5A 4LLLA 2DTRA 3TDZC 2OAZA 4EJTA 1J9IA 5D6FA 3FMSA 5LHHA 1S8NA 2XAGA 2A3SA 5L3GA 1TQIA 2DK8A 2XVCA 1ON1A 1R00A 3HSEA 4K2EA 2XAFA 4I02A 2EFPA 3CUQA 1FLIA 3HSRA 2ZNZA 4MEYF 1USSA 3KZZA 2YX7A 1P4WA 3W6KB 3GZ6A 2VE9A 1LDDA 2P5LC 5D5WB 5K5RA 4GYIA 2HTSA 3IKVA 1JE8A 1FYMA 1KQ9A 2HOEA 1DPRA 4BYYA 3GUDA 4LFUA 4LJZF 5DV5A 2XRNA 4ETSA 1HQCA 3IKTA 3ZMDA 1GXQA 3K0LA 3TDUC 1IW7F 2LF7A 2Y75A 3GW2A 2HS5A 4U0YA 1J0RA 3SQNA 3J80K 1U5TB 4BAYA 1SD7A 3JAMZ 1XGMA 2CYYA 4XSXF 3HTSB 4P9UA 4HV5A 4HF0A 3CO6C 1LDJA 2J5PA 3Q9SA 1PP7U 4RB1A 4CICA 1XCBA 3E6BA 3FZVA 2A68F 3E5QA 1ZG3A 2RGVA 2VT3A 1H9GA 4ENJA 2EFNA 3EYIA 1XCVA 1ZH5A 3QRFF 2FU4A 2ADUA 1U78A 2ZCWA 4P96A 4HAMA 4UVCA 4KNYA 1F4KA 2L4MA 2XAHA 2E1NA 3TO7A 3LA7A 3QP5A 2HEOA 2IVMA 5D6EA 2JPBA 4JQFA 2ETHA 5LGUA 1FP1D 2IA1A 1SFXA 1RNLA 1BOAA 5F1RA 3OOPA 1I6XA 3QP6A 2NAZA 3CLOA 5LRSA 1G6NA 3HRMA 1Z6TA 5DCMB 3HIFA 1YG2A 3ABUA 3HRTA 1XDSA 4WK8F 2K27A 4WWCA 1JHHA 1FYLA 4MQ9F 2W84A 3F22A 4YIFA 2DPDA 5FD5A 2QWWA 2DW4A 4HX7A 1Z05A 3VEPA 1K7AA 3WGGA 5BS6A 3H3ZA 2LDUA 4WX9A 3KCCA 1FZPB 2K86A 2ZMEB 3WTXC 4JBAA 4O5VA 3GZ5A 5D5UB 1SMTA 4CZZA 5A2QK 2IT0A 5LGNA 4OU0A 1FBQA 4IRGA 1U8RA 2H27A 3EUHA 1FWZA 4G9YA 4ENMA 5E8IA 3IL2A 3ZN1A 2YPRA 4L18B 1LDKB 4A5NA 4OINF 5IT3A 4KDPA 2IJLA 3RPUA 2Z5UA 3ZN0A 2DK5A 3K2ZA 2W85A 3DKWA 5JI6A 4OMYA 5EEHA 2XV4S 2F5FA 5HS7A 3GF2A 3KETA 4BH9A 3KEOA 4D0PA 2Q2EA 3M7GA 2V79A 3R0JA 4L5IA 1ZHFA 2F5CA 4BHBA 4LB5A 4I01A 2HGCA 2E7WA 1LEAA 4CYDA 1L3LA 4HZFA 2QENA 2IA2A 1AOYA 4RAYA 4XBFA 4ON0A 2YU3A 1UB9A 2Z99A 3L9FA 3I54A 4OIOF 2H09A 1WI9A 3K1PA 2P7VB 5L3CA 1WSUA 3ZQ7A 4UV9A 2P5VA 5IT9Z 1UHMA 4LG0B 4UHTA 3I59A 1FP2A 3ROUA 4WXHA 2ZBKA 1XDUA 2FF4A 3KLOA 3M8EA 2RNJA 4PCQA 2FMYA 2HKXA 2W57A 4Y13A 4U7BA 1FC3A 2GXGA 2K4JA 4HDVA 5JR3A 2TDXA 1P2FA 2FSWA 2OBPA 2Z33A 4HLYA 1O3QA 4LB6B 1IN6A 5JFRA 4Q5SF 3BJOA 1KYWA 1W7PA 2DI3A 1ZRCA 5D5XB 4O3MA 1FX7A 4L0ZB 4M6YA 1I27A 1S3JA 2CFXA 2K7LA 4U7DA 3DV8A 4I2OA 3LWFA 3V8JA 2FMLA 3IRQA 4L9JA 5E1ZB 4ESJA 3VB2A 4BNCA 1S7AA 3PQKA 3V7CA 1NHAA 2ZKZA 2QQAA 4YFNF 3MAJA 5E17F 5J8CA 3MCZA 5DUKA 1J75A 2DPUA 2UZKA 3V8LA 2OQRA 3TO9A 4U88A 3KP5A 3WTYC 1H0MA 1R1UA 3IWZA 1YW8A 3WU1B 3FMQA 3I5UA 5LBQA 4RGXA 4B09A 2BGCA 1K78A 1IAWA 3DPTA 2E1CA 3FM5A 3T0YA 1BN5A 2VC0A 5BQTA 3P9CA 4S05A 3H3UA 3ZMSA 1IRFA 4L9TA 2JZYA 4IF4A 3WE2A 3R4KA 3P7NA 4A2UA 3NQOA 1W5TA 3RDIA 2PJPA 2HQNA 5E8GA 1KU3A 3DEUA 4QWQA 2HWVA 4LD5A 3IRRA 3B02A 4BHCA 1BC8C 5AIPA 3C7JA 2RC4A 4G8XA 2G9WA 1DUXC 2HDCA 2DQRA 1VTNC 1D5VA 2MLKA 2FXAA 4RS8A 3GWZA 3RKYA 1J2XA 4UUVA 1S29A 3CUQB 5ICCA 2JPCA 2OZ6A 3V4GA 4YFXF 1U3EM 4L5JA 2LNBA 4Y17A 1JXSA 4LK0F 2LKPA 2EK5A 3CTAA 2E7XA 2L4AA 4HX8A 2K02A 2L54A 1TTYA 4HX4A 5ICGA 1H9TA 3BWGA 2JT1A 4KICA 4ZZLA 3WTVC 3CUQC 3FHZA 2KKOA 2BBYA 1YW9A 2L01A 3WTUC 4QLCU 1BI3A 2M5WA 4KIFA 1XSDA 2O8XA 1ZARA 2HFHA 2VXZA 4OIQF 1XGOA 2XUBA 5HDNA 2WTEA 3R6SA 5E1WA 4YG2F 2FOKA 1IUYA 1W5SA 5FLXZ 2P5KA 3RIRA 2YSRA 3HHGA 1QGPA 2M87A 3QOPA 5HLIA 1OR7A 3DQVC 1PDNC 2PFBA 3ZMVA 4P5OA 3GVAA 4MQVA 4IVNA 4KFCA 2DFIA 3E6CC 3F21A 5DD4A 3ULQB 1J7KA 4IXAA 4EJVA 1GHCA 3SZPA 3U9GA 1XSVA 2KIFA 2V1DA 1ZG5A 5HDGA 2OQGA 1HSJA 2UXNA 4R1HA 2FBHA 2GZWA 2ZXJA 3KLNA 3DF8A 1BM9A 3F3XA 1QBJA 3E5XA 2A69F 1S6LA 1P92A 3LA2A 4ASNA 4NB5A 5TRDA 3GFMA 4I0AA 2BEOA 1SFUA 4RB3C 3F8BA 2IRFG 3KP2A 5DEQA 1I1GA 3ZMZA 2NS0A 2CQKA 3E6DA 3FX3A 1ZGJA 1B9MA 4LK1F 3GYHX 1U5TC 2GXBA 3ZMUA 2CW0F 2D1VA 2R7FA 1EV7A 4KMFA 1U6GA 3ELKA 2EWNA 2O61A 5D4SA 4KIGA 2MC3A 4G94A 3V8KA 1REPC 3F8CA 4HLXA 3GFJA 1BJAA 3I4PA 4M71A 3J81K 4G6DA 2GA2A 3JAMK 3WTSC 4N9IA 4KA4A 3KP4A 4G6QA 3W6JB 5D4RA 1B1BA 3EDPA 2CSOA 2V6CA 2Z3YA 3BPXA 4DNCA 5CVUA 2H6BA 4O6JA 4I98B 2ACJA 4A12A 1UFMA 4XLPF 3N97A 5KK1A 3HSFA 1HXDA 1TBXA 2KJCA 1HKQA 2STTA 3F6OA 2V1XA 3CJNA 2KIUA 3T1BA 3H92A 3U2RA 2A07F 3WE3A 1IZ1A 4EGYA 4RGUA 4JK1X 3KZYA 3I58A 4AIJA 4FX4A 4GXOA 1ZGAA 3L09A 4CGZA 1O7LA 2XAQA 4KMUX 3MWMA 1SD6A 4PGHA 4RB2C 5BMZA 2Q0OA 3TGNA 5CLSA 4M6XA 4PDKA 5BPDA 3G73A 1OYYA 2W24A 1LVAA 3P9IA 4CO8A 1MJ9A 2OZUA 3RPQA 1RI7A 4KYWA 4I7HA 2O03A 4WXDA 1UHWA 1XSXA 1B6AA 3RI4A 3I59B 4G7OF 1OMIA 2D2WA 1XGSA 4AWXB 1G3YA 1ZN2A 2NRAC 4ZZDA 1ZRFA 3BJ6A 1XGNA 5KVRA 1FY7A 3FXUA 2X4HA 5HS8A 4N9HA 4FX0A 2STWA 3E3VA 2CG4A 3P9KA 5CVRA 5BOXA 1MKMA 2VE8A 1B59A 2PI0A 1ONVA 1STZA 1D8JA 1R22A 3WGIA 2HR3A 1RZ4A 5LGTA 4UV8A 1USTA 1UCRA 4GGGA 1ZLKA 4LLGF 4MNUA 4MTEA 1QQIA 3GXOA 1FSHA 3E6MA 4IHSA 1EH6A 2W25A 4CDGA 4HF2A 2FBKA 4I09A 2QBYA 3KP6A 3B73A 2ZMEA 2VBZA 3FM3A 3I64A 2DQLA 3SXYA 4FHTA 3TOAA 3MQ0A 1F1ZA 2KJBA 2XROA 2YX4A 2JTVA 3F8MA 1K79A 2Q8KA 4NQWA 3ISPA 4UNOA 2P6TA 1IXCA 2UXXA 2GQQA 1W7PD 4HDUA 2GWRA 2VOPA 2G7UA 3WU0A 1O3RA 3FMRA 5ILSA 4ESBA 3MZYA 3F6VA 3TQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LEK A;  1ZG1 A;  1T2K A;  1ODD A;  3GFI A;  1T0F A;  2KRF A;  3JTH A;  2IP2 A;  2ZJ2 A;  1O3T A;  2VT2 A;  3ZMT A;  5DYM A;  1K78 B;  5CYV A;  2PMH A;  4ENK A;  2FEZ A;  1QPM A;  2HYF A;  1L0O C;  5D8K B;  4GO1 A;  4CXF A;  3Q5F A;  4WCG A;  1I5Z A;  3FF5 A;  1J59 A;  3ZPL A;  5IT9 K;  1O57 A;  3IC7 A;  2A5Y B;  3BRO A;  2ISZ A;  1GXP A;  4MGR A;  3KEQ A;  1CF7 A;  2PBI A;  1YQA A;  2O0Y A;  5HDK A;  3GLX A;  3EQL F;  3DFG A;  1RUO A;  2D1H A;  3J7A O;  3SHF A;  1S7O A;  2EA2 A;  1HKT A;  4U0W A;  4CHU A;  1G3S A;  3T8T A;  2F5D A;  2X0L A;  1MDM A;  2QLZ A;  3RTR A;  3HUG A;  4KT5 C;  1PP8 F;  3KP7 A;  2XGX A;  4IRI A;  4AIK A;  2RV8 A;  2GIV A;  2D45 A;  4RAZ A;  1XB4 A;  3WTZ A;  1IRG A;  4RGS A;  4L9N A;  5AON A;  2P6S A;  1HW1 A;  1LJ9 A;  1O7F A;  5L3B A;  3T5X A;  1YFH A;  2VBW A;  1G3T A;  3ZP5 A;  1HW5 A;  2CGP A;  3RKX A;  3QPH A;  1ZRD A;  5ED4 A;  1ZYR F;  4IPA A;  2OU2 A;  5DCF A;  1T6S A;  3LA3 A;  2QVO A;  1YO5 C;  1HBX G;  1R1V A;  3NEU A;  2VN2 A;  3COA C;  6PAX A;  1YTY A;  1HST A;  1WWX A;  2FBI A;  1BC7 C;  2M30 A;  3K1M A;  4RGR A;  5FO5 A;  2JRT A;  4KN4 X;  2GAU A;  1KYZ A;  1KGS A;  3HYI A;  3LAP A;  1IN8 A;  3QU3 A;  2DLL A;  3ECH A;  5K1Y A;  1OKR A;  1MD0 A;  1FBU A;  3FXR A;  3I0T A;  3O6B B;  4P9F A;  1SAX A;  2RVC A;  1YS7 A;  1G4D A;  4Y15 A;  2B0L A;  1D3Y A;  2Y48 A;  1FT9 A;  3L00 A;  1FBS A;  3K1N A;  5DD8 A;  2ZO4 A;  4MHG A;  1B9N A;  2FA5 A;  5HLH A;  1JHF A;  2FRH A;  1XN7 A;  3BZ6 A;  1KU9 A;  5LLQ A;  2EFW A;  2HQR A;  5TJJ A;  2P8T A;  2IA0 A;  4YII A;  1KU2 A;  4AIH A;  5ILV A;  3R61 A;  4OOI A;  3REO A;  3WTW C;  3RJP A;  1P4X A;  5DUI A;  1HW2 A;  4HYE A;  2Z9O A;  2RN7 A;  3N4M A;  3MFK A;  5FD6 A;  3EYY A;  3BP8 A;  2VBY A;  2MA3 A;  2XHK A;  4ENN A;  2OD5 A;  2F2E A;  3GEZ A;  3DPL C;  5CVV A;  1IXS B;  3J80 Z;  2MH2 A;  1QNT A;  1SFE A;  4Q4Z F;  3CUO A;  3ML6 A;  2PEX A;  4F7Z A;  2PMU A;  1BBY A;  2HTJ A;  3ERE D;  2BE5 F;  1FYK A;  4EGZ A;  3V7S A;  3MEX A;  3LQR A;  1BI1 A;  4BXU A;  1O3S A;  3LST A;  5FFX A;  5HOO A;  5FFZ A;  2V9V A;  2ISY A;  1B4A A;  3SZT A;  2PN6 A;  2LSO A;  1Y0U A;  3HTU A;  2P7C B;  3G3Z A;  4ESF A;  1MJB A;  4YFK F;  4E70 A;  4ZH4 F;  3JSP A;  1ZAO A;  4RB0 A;  5FB2 A;  2FNA A;  4EJW A;  5FLX K;  2JSC A;  5LEJ A;  1P6R A;  2DAO A;  5EEG A;  1PUE E;  1R58 A;  2M8E A;  2R3S A;  2EA4 A;  3PFI A;  2EV0 A;  2XKO A;  4L9V A;  3F8N A;  1EH7 A;  2G7H A;  1KA8 A;  3J81 Z;  3BDD A;  1FNN A;  4A6D A;  3FWE A;  3HOT A;  2MH9 A;  1ULY A;  1V4R A;  4UVA A;  5FGM A;  2IPQ X;  3BPV A;  4A5M A;  1Z7U A;  5HS9 A;  2VON A;  1D8K A;  2DU9 A;  2PG4 A;  3FXQ A;  1YLF A;  4EVI A;  2BYV E;  4HA8 A;  3BOQ A;  2L3D A;  2QQ9 A;  5J6X A;  1DDN A;  2VC1 A;  1DP7 P;  3V7R A;  1TW2 A;  5DDG A;  3VFZ A;  5H6Q A;  1CGP A;  2RQP A;  1MZB A;  4DQ2 A;  3CDH A;  2XAJ A;  2P4W A;  4WXC A;  1ON2 A;  2V1U A;  1A04 A;  3ECO A;  3OV8 A;  3U1D A;  4A0X A;  1YYV A;  1HKS A;  1W4M A;  1V3F A;  1SMY F;  2M1B A;  2DO7 A;  4IJA A;  5A2Q Z;  2EV6 A;  3BJA A;  2C6Y A;  1U5T A;  4A0Y A;  1LEB A;  4S04 A;  2EFQ A;  2HKO A;  5E20 A;  1F5T A;  2XKP A;  4EJU A;  1XD7 A;  1R23 A;  4R8H A;  4PZJ A;  3Q9V A;  1LNW A;  3I53 A;  4HF1 A;  1IN5 A;  5LHI A;  1IXR C;  3DP7 A;  5H6R A;  5K5O A;  5ILU A;  3JW4 A;  1MJA A;  1IN7 A;  4XSZ F;  1Z6R A;  4M72 A;  4IHT A;  4KUM A;  4BQA A;  1ZLJ A;  1YS6 A;  4AD9 A;  1WKM A;  2WC2 A;  1OYI A;  1SD4 A;  2F5E A;  3M8F A;  4NHJ A;  1KQ8 A;  4M9Z A;  1J5Y A;  2FQ3 A;  5CVI A;  3LFK A;  4MEX F;  2MLG A;  2QBY B;  4KN7 X;  4WF2 A;  4HQM A;  3HRS A;  4AVP A;  1Q1H A;  3QAH A;  5E18 F;  5HLG A;  1TQM A;  5L3D A;  2EFO A;  1Z9C A;  4MTD A;  4XRF A;  1T38 A;  2KIM A;  3C18 A;  5LRR A;  2QQB A;  2EV5 A;  4EJO A;  5AIQ A;  2R7D A;  1X3U A;  1TLH B;  1XMK A;  2H94 A;  1R36 A;  4I0B A;  2ZNY A;  4HW0 A;  3AAF A;  2QUF A;  2QM3 A;  3JTG A;  2EJR A;  5DCM A;  1WQ2 A;  4EMS A;  1IF1 A;  3LAJ A;  4M74 A;  2A6E F;  2IW5 A;  2O3F A;  3E97 A;  4EM2 A;  2QYO A;  3HRU A;  2VBX A;  4M9S A;  2FE3 A;  1W7P B;  3D0S A;  2PLY A;  5JVT A;  3DXJ F;  4FT8 A;  3ABT A;  3GX4 X;  3WOD F;  4L0Y B;  1Z91 A;  2ESN A;  4EM1 A;  1QZZ A;  3PQJ A;  4UVB A;  1U2W A;  4Q48 A;  3WTT C;  4HOB A;  4N0B A;  1P4A A;  2Y0M A;  4BHP A;  4ZYE A;  1R5G A;  1TW3 A;  1CF7 B;  4LGW A;  4H0E A;  2DBB A;  4R79 A;  4P55 A;  4UXN A;  1I1S A;  2CWE A;  1MGT A;  4KIB A;  4B8X A;  1FSE A;  5E1X A;  5CVJ A;  3F72 A;  1FPQ A;  1MDM B;  2MBF A;  4OIR F;  2WV0 A;  2XIG A;  3O2P E;  4Z2Y A;  3K9T A;  1LB2 A;  3VOE A;  2YR2 A;  4EV0 A;  3E5U A;  4LMY A;  1TNS A;  2BV6 A;  3QU6 A;  5K5Q A;  3TOB A;  5JHU A;  1R1T A;  2FNP A;  3JSO A;  3CO7 C;  2PQ8 A;  1TQP A;  1QZY A;  3GFL A;  1AWC A;  4GCV A;  1KU7 A;  1SD5 A;  2K4B A;  4OMZ A;  2H6C A;  2AS5 F;  3LQQ A;  2RDP A;  3M1E A;  3QPT A;  2ELH A;  5D8L B;  1JGS A;  3R0A A;  2RKH A;  1YW7 A;  1KQ0 A;  4G7Z F;  3RKW A;  2M45 A;  1XMA A;  2COM A;  5F64 A;  2A61 A;  2ESH A;  4PGG A;  3RYP A;  1EH8 A;  3L2C A;  1R5H A;  3F23 A;  2WWY A;  5HVQ C;  5L3F A;  2DT5 A;  2L02 A;  3F8F A;  4HV6 A;  3L7W A;  2O6G E;  4M9X A;  3HHH A;  1G3W A;  5CJ9 A;  3MZH A;  4EM0 B;  3KE2 A;  3GO5 A;  2UWM A;  4HQE A;  2NNN A;  4IRH A;  3KP3 A;  1C0W A;  5D5V B;  1BI2 A;  1K6O A;  4LG0 A;  4ZYG A;  1TNT A;  2J5O A;  1QO0 D;  3WG9 A;  1GVJ A;  1E17 A;  2LF8 A;  1RUN A;  1Z1D A;  5L3E A;  5BPI A;  2HYG D;  2EB7 A;  4ZYD A;  3TKY A;  1BIB A;  3BY6 A;  2OA4 A;  3S2W A;  1OYW A;  5ICF A;  2MD5 A;  1F9N A;  2AXL A;  1IN4 A;  3SFZ A;  4XLN F;  4ZYH A;  1T39 A;  3RYR A;  3KFW X;  4HBL A;  3VOD A;  1WRJ A;  5F6F A;  2QZ8 A;  5H20 A;  4A6E A;  1YIO A;  1DPU A;  3EET A;  3IWF A;  4EQQ A;  3NRV A;  3I71 A;  1LQ1 A;  4G7H F;  1E2X A;  1OPC A;  1FOK A;  2ZFW A;  4Q47 A;  3IHU A;  1T98 A;  4TV7 A;  3C1D A;  4OIP F;  5ERI A;  5LHG A;  4A0Z A;  3K69 A;  4M73 A;  4U0V A;  1ZRE A;  1RIO H;  5J8F A;  1BIA A;  3T8R A;  2NYX A;  4LLN A;  1R7J A;  2VOO A;  5ICE A;  3TO6 A;  2VOD A;  1BI0 A;  3C3W A;  2HZT A;  3M9A A;  3O3K A;  3R60 A;  2NNY A;  3WGH A;  4GYG A;  2A6H F;  2GA1 A;  2XAS A;  3HOS A;  3D5L A;  2CO5 A;  4LLL A;  2DTR A;  3TDZ C;  2OAZ A;  4EJT A;  1J9I A;  5D6F A;  3FMS A;  5LHH A;  1S8N A;  2XAG A;  2A3S A;  5L3G A;  1TQI A;  2DK8 A;  2XVC A;  1ON1 A;  1R00 A;  3HSE A;  4K2E A;  2XAF A;  4I02 A;  2EFP A;  3CUQ A;  1FLI A;  3HSR A;  2ZNZ A;  4MEY F;  1USS A;  3KZZ A;  2YX7 A;  1P4W A;  3W6K B;  3GZ6 A;  2VE9 A;  1LDD A;  2P5L C;  5D5W B;  5K5R A;  4GYI A;  2HTS A;  3IKV A;  1JE8 A;  1FYM A;  1KQ9 A;  2HOE A;  1DPR A;  4BYY A;  3GUD A;  4LFU A;  4LJZ F;  5DV5 A;  2XRN A;  4ETS A;  1HQC A;  3IKT A;  3ZMD A;  1GXQ A;  3K0L A;  3TDU C;  1IW7 F;  2LF7 A;  2Y75 A;  3GW2 A;  2HS5 A;  4U0Y A;  1J0R A;  3SQN A;  3J80 K;  1U5T B;  4BAY A;  1SD7 A;  3JAM Z;  1XGM A;  2CYY A;  4XSX F;  3HTS B;  4P9U A;  4HV5 A;  4HF0 A;  3CO6 C;  1LDJ A;  2J5P A;  3Q9S A;  1PP7 U;  4RB1 A;  4CIC A;  1XCB A;  3E6B A;  3FZV A;  2A68 F;  3E5Q A;  1ZG3 A;  2RGV A;  2VT3 A;  1H9G A;  4ENJ A;  2EFN A;  3EYI A;  1XCV A;  1ZH5 A;  3QRF F;  2FU4 A;  2ADU A;  1U78 A;  2ZCW A;  4P96 A;  4HAM A;  4UVC A;  4KNY A;  1F4K A;  2L4M A;  2XAH A;  2E1N A;  3TO7 A;  3LA7 A;  3QP5 A;  2HEO A;  2IVM A;  5D6E A;  2JPB A;  4JQF A;  2ETH A;  5LGU A;  1FP1 D;  2IA1 A;  1SFX A;  1RNL A;  1BOA A;  5F1R A;  3OOP A;  1I6X A;  3QP6 A;  2NAZ A;  3CLO A;  5LRS A;  1G6N A;  3HRM A;  1Z6T A;  5DCM B;  3HIF A;  1YG2 A;  3ABU A;  3HRT A;  1XDS A;  4WK8 F;  2K27 A;  4WWC A;  1JHH A;  1FYL A;  4MQ9 F;  2W84 A;  3F22 A;  4YIF A;  2DPD A;  5FD5 A;  2QWW A;  2DW4 A;  4HX7 A;  1Z05 A;  3VEP A;  1K7A A;  3WGG A;  5BS6 A;  3H3Z A;  2LDU A;  4WX9 A;  3KCC A;  1FZP B;  2K86 A;  2ZME B;  3WTX C;  4JBA A;  4O5V A;  3GZ5 A;  5D5U B;  1SMT A;  4CZZ A;  5A2Q K;  2IT0 A;  5LGN A;  4OU0 A;  1FBQ A;  4IRG A;  1U8R A;  2H27 A;  3EUH A;  1FWZ A;  4G9Y A;  4ENM A;  5E8I A;  3IL2 A;  3ZN1 A;  2YPR A;  4L18 B;  1LDK B;  4A5N A;  4OIN F;  5IT3 A;  4KDP A;  2IJL A;  3RPU A;  2Z5U A;  3ZN0 A;  2DK5 A;  3K2Z A;  2W85 A;  3DKW A;  5JI6 A;  4OMY A;  5EEH A;  2XV4 S;  2F5F A;  5HS7 A;  3GF2 A;  3KET A;  4BH9 A;  3KEO A;  4D0P A;  2Q2E A;  3M7G A;  2V79 A;  3R0J A;  4L5I A;  1ZHF A;  2F5C A;  4BHB A;  4LB5 A;  4I01 A;  2HGC A;  2E7W A;  1LEA A;  4CYD A;  1L3L A;  4HZF A;  2QEN A;  2IA2 A;  1AOY A;  4RAY A;  4XBF A;  4ON0 A;  2YU3 A;  1UB9 A;  2Z99 A;  3L9F A;  3I54 A;  4OIO F;  2H09 A;  1WI9 A;  3K1P A;  2P7V B;  5L3C A;  1WSU A;  3ZQ7 A;  4UV9 A;  2P5V A;  5IT9 Z;  1UHM A;  4LG0 B;  4UHT A;  3I59 A;  1FP2 A;  3ROU A;  4WXH A;  2ZBK A;  1XDU A;  2FF4 A;  3KLO A;  3M8E A;  2RNJ A;  4PCQ A;  2FMY A;  2HKX A;  2W57 A;  4Y13 A;  4U7B A;  1FC3 A;  2GXG A;  2K4J A;  4HDV A;  5JR3 A;  2TDX A;  1P2F A;  2FSW A;  2OBP A;  2Z33 A;  4HLY A;  1O3Q A;  4LB6 B;  1IN6 A;  5JFR A;  4Q5S F;  3BJO A;  1KYW A;  1W7P A;  2DI3 A;  1ZRC A;  5D5X B;  4O3M A;  1FX7 A;  4L0Z B;  4M6Y A;  1I27 A;  1S3J A;  2CFX A;  2K7L A;  4U7D A;  3DV8 A;  4I2O A;  3LWF A;  3V8J A;  2FML A;  3IRQ A;  4L9J A;  5E1Z B;  4ESJ A;  3VB2 A;  4BNC A;  1S7A A;  3PQK A;  3V7C A;  1NHA A;  2ZKZ A;  2QQA A;  4YFN F;  3MAJ A;  5E17 F;  5J8C A;  3MCZ A;  5DUK A;  1J75 A;  2DPU A;  2UZK A;  3V8L A;  2OQR A;  3TO9 A;  4U88 A;  3KP5 A;  3WTY C;  1H0M A;  1R1U A;  3IWZ A;  1YW8 A;  3WU1 B;  3FMQ A;  3I5U A;  5LBQ A;  4RGX A;  4B09 A;  2BGC A;  1K78 A;  1IAW A;  3DPT A;  2E1C A;  3FM5 A;  3T0Y A;  1BN5 A;  2VC0 A;  5BQT A;  3P9C A;  4S05 A;  3H3U A;  3ZMS A;  1IRF A;  4L9T A;  2JZY A;  4IF4 A;  3WE2 A;  3R4K A;  3P7N A;  4A2U A;  3NQO A;  1W5T A;  3RDI A;  2PJP A;  2HQN A;  5E8G A;  1KU3 A;  3DEU A;  4QWQ A;  2HWV A;  4LD5 A;  3IRR A;  3B02 A;  4BHC A;  1BC8 C;  5AIP A;  3C7J A;  2RC4 A;  4G8X A;  2G9W A;  1DUX C;  2HDC A;  2DQR A;  1VTN C;  1D5V A;  2MLK A;  2FXA A;  4RS8 A;  3GWZ A;  3RKY A;  1J2X A;  4UUV A;  1S29 A;  3CUQ B;  5ICC A;  2JPC A;  2OZ6 A;  3V4G A;  4YFX F;  1U3E M;  4L5J A;  2LNB A;  4Y17 A;  1JXS A;  4LK0 F;  2LKP A;  2EK5 A;  3CTA A;  2E7X A;  2L4A A;  4HX8 A;  2K02 A;  2L54 A;  1TTY A;  4HX4 A;  5ICG A;  1H9T A;  3BWG A;  2JT1 A;  4KIC A;  4ZZL A;  3WTV C;  3CUQ C;  3FHZ A;  2KKO A;  2BBY A;  1YW9 A;  2L01 A;  3WTU C;  4QLC U;  1BI3 A;  2M5W A;  4KIF A;  1XSD A;  2O8X A;  1ZAR A;  2HFH A;  2VXZ A;  4OIQ F;  1XGO A;  2XUB A;  5HDN A;  2WTE A;  3R6S A;  5E1W A;  4YG2 F;  2FOK A;  1IUY A;  1W5S A;  5FLX Z;  2P5K A;  3RIR A;  2YSR A;  3HHG A;  1QGP A;  2M87 A;  3QOP A;  5HLI A;  1OR7 A;  3DQV C;  1PDN C;  2PFB A;  3ZMV A;  4P5O A;  3GVA A;  4MQV A;  4IVN A;  4KFC A;  2DFI A;  3E6C C;  3F21 A;  5DD4 A;  3ULQ B;  1J7K A;  4IXA A;  4EJV A;  1GHC A;  3SZP A;  3U9G A;  1XSV A;  2KIF A;  2V1D A;  1ZG5 A;  5HDG A;  2OQG A;  1HSJ A;  2UXN A;  4R1H A;  2FBH A;  2GZW A;  2ZXJ A;  3KLN A;  3DF8 A;  1BM9 A;  3F3X A;  1QBJ A;  3E5X A;  2A69 F;  1S6L A;  1P92 A;  3LA2 A;  4ASN A;  4NB5 A;  5TRD A;  3GFM A;  4I0A A;  2BEO A;  1SFU A;  4RB3 C;  3F8B A;  2IRF G;  3KP2 A;  5DEQ A;  1I1G A;  3ZMZ A;  2NS0 A;  2CQK A;  3E6D A;  3FX3 A;  1ZGJ A;  1B9M A;  4LK1 F;  3GYH X;  1U5T C;  2GXB A;  3ZMU A;  2CW0 F;  2D1V A;  2R7F A;  1EV7 A;  4KMF A;  1U6G A;  3ELK A;  2EWN A;  2O61 A;  5D4S A;  4KIG A;  2MC3 A;  4G94 A;  3V8K A;  1REP C;  3F8C A;  4HLX A;  3GFJ A;  1BJA A;  3I4P A;  4M71 A;  3J81 K;  4G6D A;  2GA2 A;  3JAM K;  3WTS C;  4N9I A;  4KA4 A;  3KP4 A;  4G6Q A;  3W6J B;  5D4R A;  1B1B A;  3EDP A;  2CSO A;  2V6C A;  2Z3Y A;  3BPX A;  4DNC A;  5CVU A;  2H6B A;  4O6J A;  4I98 B;  2ACJ A;  4A12 A;  1UFM A;  4XLP F;  3N97 A;  5KK1 A;  3HSF A;  1HXD A;  1TBX A;  2KJC A;  1HKQ A;  2STT A;  3F6O A;  2V1X A;  3CJN A;  2KIU A;  3T1B A;  3H92 A;  3U2R A;  2A07 F;  3WE3 A;  1IZ1 A;  4EGY A;  4RGU A;  4JK1 X;  3KZY A;  3I58 A;  4AIJ A;  4FX4 A;  4GXO A;  1ZGA A;  3L09 A;  4CGZ A;  1O7L A;  2XAQ A;  4KMU X;  3MWM A;  1SD6 A;  4PGH A;  4RB2 C;  5BMZ A;  2Q0O A;  3TGN A;  5CLS A;  4M6X A;  4PDK A;  5BPD A;  3G73 A;  1OYY A;  2W24 A;  1LVA A;  3P9I A;  4CO8 A;  1MJ9 A;  2OZU A;  3RPQ A;  1RI7 A;  4KYW A;  4I7H A;  2O03 A;  4WXD A;  1UHW A;  1XSX A;  1B6A A;  3RI4 A;  3I59 B;  4G7O F;  1OMI A;  2D2W A;  1XGS A;  4AWX B;  1G3Y A;  1ZN2 A;  2NRA C;  4ZZD A;  1ZRF A;  3BJ6 A;  1XGN A;  5KVR A;  1FY7 A;  3FXU A;  2X4H A;  5HS8 A;  4N9H A;  4FX0 A;  2STW A;  3E3V A;  2CG4 A;  3P9K A;  5CVR A;  5BOX A;  1MKM A;  2VE8 A;  1B59 A;  2PI0 A;  1ONV A;  1STZ A;  1D8J A;  1R22 A;  3WGI A;  2HR3 A;  1RZ4 A;  5LGT A;  4UV8 A;  1UST A;  1UCR A;  4GGG A;  1ZLK A;  4LLG F;  4MNU A;  4MTE A;  1QQI A;  3GXO A;  1FSH A;  3E6M A;  4IHS A;  1EH6 A;  2W25 A;  4CDG A;  4HF2 A;  2FBK A;  4I09 A;  2QBY A;  3KP6 A;  3B73 A;  2ZME A;  2VBZ A;  3FM3 A;  3I64 A;  2DQL A;  3SXY A;  4FHT A;  3TOA A;  3MQ0 A;  1F1Z A;  2KJB A;  2XRO A;  2YX4 A;  2JTV A;  3F8M A;  1K79 A;  2Q8K A;  4NQW A;  3ISP A;  4UNO A;  2P6T A;  1IXC A;  2UXX A;  2GQQ A;  1W7P D;  4HDU A;  2GWR A;  2VOP A;  2G7U A;  3WU0 A;  1O3R A;  3FMR A;  5ILS A;  4ESB A;  3MZY A;  3F6V A;  3TQN A; 
#chains in the Genus database with same CATH topology
 3BR5 A;  1NG6 A;  5LEK A;  2WAF A;  2WB1 N;  1ZG1 A;  1T2K A;  1ODD A;  3GFI A;  1A35 A;  1T0F A;  1VQP I;  2KRF A;  5M3F J;  3JTH A;  2BY1 A;  5JHF A;  2IP2 A;  2MG4 A;  2ZJ2 A;  1TZL A;  2HXI A;  1O3T A;  3QWL A;  2VT2 A;  1UAA A;  1FOX A;  3ZMT A;  5DYM A;  1K78 B;  5CYV A;  2PMH A;  3JR9 A;  4ENK A;  2FEZ A;  1QPM A;  1JKR C;  2HYF A;  2ME0 A;  1L0O C;  5D8K B;  2EIN H;  4GO1 A;  2M8G X;  3ASO H;  3PO2 J;  3JRC A;  3FK7 A;  4CXF A;  3Q5F A;  4WCG A;  1I5Z A;  3FF5 A;  1J59 A;  3ZPL A;  5IT9 K;  1O57 A;  4IX7 A;  3IC7 A;  2A5Y B;  3BRO A;  2ISZ A;  1GXP A;  4MGR A;  1RRJ A;  1VQ7 I;  3KEQ A;  3M07 A;  2PBI A;  1CF7 A;  1YQA A;  2O0Y A;  4HPQ A;  1SEU A;  5HDK A;  3GLX A;  3EQL F;  3DFG A;  1D1A A;  2D1H A;  1RUO A;  3J7A O;  1JT6 A;  3SHF A;  3CES A;  2CJJ A;  4XLA A;  1S7O A;  2E34 A;  2EA2 A;  1HKT A;  4U0W A;  1MBF A;  4CHU A;  1G3S A;  2JN6 A;  4L5E A;  3U1K A;  3T8T A;  4AU7 A;  3IAM 2;  2F5D A;  2X0L A;  2PX9 A;  2R4G A;  3HKZ A;  1MDM A;  2QLZ A;  3RTR A;  4DJA A;  3HUG A;  2GIZ A;  3Q0U A;  2ID6 A;  2KQR A;  4KT5 C;  1PP8 F;  3KP7 A;  4FE7 A;  1JTY A;  1HF0 A;  1ENH A;  2JVG A;  2XGE A;  2XGX A;  4IRI A;  2MAB A;  4BY1 J;  4AIK A;  4XOP A;  2RV8 A;  2GIV A;  2D45 A;  4RAZ A;  4F93 B;  1XB4 A;  3WTZ A;  3DKY A;  1JJ8 C;  1IRG A;  2AXT C;  1BL0 A;  4RGS A;  4L9N A;  5AON A;  3CCL I;  2P6S A;  1HW1 A;  1LJ9 A;  3LSJ A;  1P7J A;  2EZL A;  1O7F A;  5L3B A;  3T5X A;  3WHB A;  1YFH A;  2VBW A;  1G3T A;  1Z67 A;  3ZP5 A;  4II3 A;  1HW5 A;  2CGP A;  1K6Y A;  3RKX A;  3QPH A;  1ZRD A;  5ED4 A;  1ZYR F;  4CCO A;  1WI3 A;  4IPA A;  3JRG A;  3DLA A;  2OU2 A;  1ORK A;  5DCF A;  1IUF A;  2JA8 J;  1T6S A;  3BG5 A;  1UG2 A;  3OYN A;  2K40 A;  3LA3 A;  2QVO A;  1YO5 C;  1SC7 A;  1F36 A;  1ZKG A;  2AQF A;  4XKB A;  1HBX G;  1D0X A;  1R1V A;  3CCM I;  3NEU A;  5IOZ A;  2VN2 A;  1ZR2 A;  3K4N A;  2BVM A;  3H9G A;  3COA C;  1A6Q A;  2XRL A;  1YTY A;  6PAX A;  1HST A;  1ETW A;  5FRM A;  1WWX A;  2BY3 A;  4D9J A;  2FBI A;  1BC7 C;  2M30 A;  3K1M A;  1TWH J;  4FAS D;  3QPL A;  3K10 A;  4RGR A;  1WH7 A;  3X2Q H;  1A36 A;  5FO5 A;  4E7K A;  2R92 J;  2JRT A;  4KN4 X;  2GAU A;  2R7T A;  1U9O A;  1KYZ A;  3HPG A;  1KGS A;  3HYI A;  3LAP A;  1IN8 A;  4FIS A;  3IAS 2;  4HRI A;  3QU3 A;  2JA2 A;  1K4T A;  2DLL A;  3ECH A;  1R9T J;  3HJE A;  3ZCO A;  5K1Y A;  1OKR A;  3GLL A;  1MD0 A;  4GDF A;  2ME6 A;  5EF6 A;  1ACI A;  1FBU A;  3FXR A;  3I0T A;  3OS0 A;  3O6B B;  1G59 A;  4P9F A;  4HSR A;  2DMP A;  1SAX A;  2RVC A;  1YS7 A;  1S5L C;  1G4D A;  4Y15 A;  3H36 A;  2B0L A;  5LD2 C;  1D3Y A;  3VSL A;  5EYR A;  3K70 D;  2Y48 A;  3VYU B;  1FT9 A;  3HKZ N;  3D5R C;  3L00 A;  5IP7 J;  4S0H B;  1JUP A;  1VI0 A;  1FBS A;  3LMM A;  3OYE A;  1RET A;  1JTX A;  1XMX A;  3K1N A;  5DD8 A;  5J4Y A;  2ZO4 A;  3BG6 A;  4MHG A;  1B9N A;  2BVL A;  2FA5 A;  3GTJ J;  3MKL A;  2L7M P;  5HLH A;  1BR2 A;  1JHF A;  2BW3 A;  2HDD A;  4IQ4 A;  2FRH A;  1XN7 A;  3I4M J;  1K4S A;  1VQ4 I;  5K7Z A;  3BZ6 A;  5J47 A;  3QOD A;  2YU9 J;  4RLQ A;  2BHY A;  1KU9 A;  2XGC A;  4OAY A;  5LLQ A;  1W36 C;  2EFW A;  2HQR A;  3DTI A;  2X48 A;  5TJJ A;  2E1M B;  1OR7 C;  2P8T A;  5EG0 A;  3FIW A;  2M0C A;  3ZQI A;  2IA0 A;  2LMD A;  1Q1V A;  3OIO A;  4PSX A;  1YJ9 I;  4YII A;  3HZJ A;  4LIT A;  3HB9 A;  1NTC A;  1HCR A;  5EDN A;  1KU2 A;  2I10 A;  2VKV A;  4AIH A;  5ILV A;  4E4H A;  3R61 A;  5GAH J;  3H9Q A;  4OOI A;  3REO A;  1VQ9 I;  3LNQ A;  3WTW C;  3RJP A;  1P4X A;  5DUI A;  1HW2 A;  4HYE A;  2PJR B;  2Z9O A;  4RDU A;  2NVT J;  2RN7 A;  3N4M A;  2X9D A;  3MFK A;  4ITV A;  4A3G J;  5FD6 A;  3EYY A;  3BTI A;  3BP8 A;  2VBY A;  2MA3 A;  4A3M J;  3S17 J;  2XHK A;  4ENN A;  3A2K A;  2WY7 Q;  2OD5 A;  2W4S A;  2E1M C;  2F2E A;  2H1K A;  3GEZ A;  4BU2 A;  3DPL C;  5CVV A;  1IXS B;  3J80 Z;  4IQJ A;  3OYB A;  1AA7 A;  2MH2 A;  1TWF J;  3IP4 B;  4BDY A;  2QSG X;  1QNT A;  1SFE A;  2FJ1 A;  4Q4Z F;  4UY8 I;  3CUO A;  1RKW A;  3K2A A;  4M3D A;  3VPR A;  1JKO C;  3ML6 A;  2PEX A;  4F7Z A;  1JUS A;  4P1W A;  2PMU A;  1BBY A;  2HTJ A;  3ERE D;  2HI3 A;  5H2F C;  2BE5 F;  1FYK A;  2WA0 A;  4EGZ A;  3V7S A;  3MEX A;  2WAD A;  3LQR A;  1BI1 A;  1OQY A;  3A0H C;  3FKJ A;  4BXU A;  1APL C;  4M3E A;  1O3S A;  3LST A;  5FFX A;  2NVY J;  5HOO A;  3OYG A;  5FFZ A;  3BTJ A;  4B48 A;  3QYE A;  3H3V K;  5E3L A;  2V9V A;  2ISY A;  1B4A A;  3HC7 A;  3SZT A;  2PN6 A;  2EZI A;  4CCN A;  2LSO A;  3EPZ A;  2L2O A;  1QPI A;  1Y0U A;  3HTU A;  2P7C B;  4QPO A;  3G3Z A;  3LOC A;  3G4S I;  4ESF A;  1MJB A;  4YFK F;  4E70 A;  4ZH4 F;  3JSP A;  4KIS A;  2GOX B;  4BQQ A;  4V2G A;  1ZAO A;  3ESW B;  4RB0 A;  5FB2 A;  1Y8R B;  2XF5 A;  2FNA A;  1Y0N A;  4EJW A;  5FLX K;  1X1B A;  3A01 B;  2JSC A;  5LEJ A;  1P6R A;  1B72 A;  2DAO A;  3HBL A;  5EEG A;  1PUE E;  1R58 A;  1SAN A;  2NOG A;  3HOX J;  5F27 A;  2M8E A;  2R3S A;  2EA4 A;  3N05 A;  3PFI A;  4BE1 A;  2EV0 A;  2KRH A;  2ZJQ F;  2XKO A;  3NAR A;  2QF7 A;  4L9V A;  2QSH X;  3F8N A;  5GPC A;  3G6E I;  2R5Y A;  3H5N A;  1EH7 A;  2G7H A;  1KA8 A;  3DBR B;  3J81 Z;  3BDD A;  1FNN A;  4A6D A;  3FWE A;  4CA0 A;  1OFC X;  2CQX A;  3HOT A;  3S14 J;  2MH9 A;  1ULY A;  2F4M B;  1V4R A;  4UVA A;  1BW6 A;  5FGM A;  4KIT B;  3KIO A;  2ZC2 A;  1VQ8 I;  2LH9 A;  4PSW A;  4BQN A;  2IPQ X;  3VYS B;  3P5J A;  3BPV A;  3S3O A;  4A5M A;  1Z7U A;  5IYC J;  5HS9 A;  2VON A;  1D8K A;  1BR1 A;  3PL8 A;  2DU9 A;  2ID3 A;  2PG4 A;  3FXQ A;  1YLF A;  1Z3X A;  2QGU A;  4EVI A;  2XGD A;  2BYV E;  4HA8 A;  1DQU A;  3BOQ A;  2L3D A;  4C3I J;  2QQ9 A;  2BOL A;  5J6X A;  2BZT A;  3DWL E;  3BR1 A;  1DDN A;  2VC1 A;  1Y6I A;  1DP7 P;  3V7R A;  1TW2 A;  2HVQ A;  5FKN A;  5DDG A;  5GPA A;  3VFZ A;  3PUF A;  3C2G A;  3LSH A;  1IO2 A;  5H6Q A;  1CGP A;  2RQP A;  2XB5 A;  1MZB A;  4DQ2 A;  2DXI A;  3VWB A;  3CDH A;  3K4L A;  4IHX A;  2XAJ A;  2P4W A;  4WXC A;  1ON2 A;  4A3B J;  1U8B A;  2V1U A;  2H8R A;  3TP3 A;  5B1B H;  1A04 A;  3ECO A;  1T33 A;  3OV8 A;  2M9H A;  3SYT A;  3U1D A;  1YYV A;  4A0X A;  1G8X A;  1LE8 A;  1HKS A;  2KPM A;  3PSF A;  1W4M A;  1V3F A;  2QA4 I;  1U9N A;  1UHS A;  1D1C A;  1SMY F;  4MO7 A;  3OYH A;  3RKQ A;  2M1B A;  2DO7 A;  4IJA A;  4XR6 A;  3CCS I;  2GM4 A;  5A2Q Z;  2EV6 A;  3VDX A;  2DA7 A;  3OYL A;  3BJA A;  5J3L A;  3RZO J;  2C6Y A;  1U5T A;  3EUH C;  3ZOB A;  4PJ0 C;  2DA4 A;  3DPU A;  4B1R A;  4X6A J;  4A0Y A;  3A1Y A;  1LEB A;  4S04 A;  3FXJ A;  2EFQ A;  2HKO A;  3MKW B;  2Q2E B;  5E20 A;  3F0C A;  1F5T A;  4RBO A;  2XKP A;  1VFC A;  3SZG A;  1XD7 A;  4EJU A;  1R23 A;  4R8H A;  4PZJ A;  5EZH A;  3Q9V A;  1LNW A;  4E6K G;  3FK6 A;  3I53 A;  4HF1 A;  1IN5 A;  5LHI A;  5F0C A;  1IXR C;  3DP7 A;  3CCV I;  3PNV A;  1TT5 B;  5H6R A;  5K5O A;  1IG7 A;  5ILU A;  4RAF A;  3JW4 A;  1MJA A;  2IGK A;  3CCR I;  1MMS A;  1IN7 A;  3CCJ I;  1Z6R A;  4XSZ F;  4M72 A;  3ZGK A;  5K7H A;  2VIX A;  4IHT A;  4KUM A;  4BQA A;  1ZLJ A;  1YS6 A;  2RRE A;  3BQY A;  3BTL A;  4Y52 J;  3RSN A;  4AD9 A;  3VYR B;  2QEX I;  1WKM A;  4XN0 A;  2WC2 A;  4RLF A;  3CJT B;  1YIJ I;  1OYI A;  1SD4 A;  4UUS A;  4B43 A;  2F5E A;  2X6X A;  3M8F A;  4NHJ A;  1KQ8 A;  4DBR A;  3CD6 I;  4M9Z A;  2WV1 A;  4M3F A;  1J5Y A;  2LRD A;  2FQ3 A;  2VQC A;  4NC7 A;  5CVI A;  2VQH A;  3LFK A;  4MEX F;  2MLG A;  2QBY B;  4KN7 X;  4NC6 A;  4F91 B;  4WF2 A;  4HQM A;  3HRS A;  4AVP A;  1Q1H A;  4XKC A;  3QAH A;  5E18 F;  4F3Q A;  5HLG A;  1TQM A;  3OIQ A;  4V19 K;  1I39 A;  5L3D A;  4CUG A;  3I4N J;  2EFO A;  3S2D J;  1Z9C A;  2KFD A;  4MTD A;  4M6V A;  2DA5 A;  4XRF A;  2K9N A;  2HVR A;  1T38 A;  2KIM A;  3C18 A;  5LRR A;  2Y9Z A;  2QQB A;  2EV5 A;  5FKL A;  4EJO A;  3S2H J;  4UB8 C;  3IH4 A;  4NQW B;  2LKX A;  5AIQ A;  4E7J A;  4MIM A;  2R7D A;  1X3U A;  3K6G A;  3CCE I;  1TLH B;  1XMK A;  2H94 A;  1R36 A;  1LFP A;  4A3F J;  4I0B A;  2ZNY A;  1BR4 A;  2Y9Y A;  4HW0 A;  3AAF A;  2W48 A;  2QUF A;  1BOB A;  1J09 A;  1TWA J;  2LTP A;  2M7B A;  2QM3 A;  3JTG A;  2EJR A;  2FUG 2;  5DCM A;  3AL0 C;  3GBG A;  3PNY A;  2HQA A;  1B8I B;  3IH3 A;  1WQ2 A;  4EMS A;  4J19 A;  3BG3 A;  2M3A A;  3LAJ A;  1IF1 A;  2MGQ A;  4M74 A;  2A6E F;  5EGO B;  2IW5 A;  1I3Q J;  2O3F A;  3FXO A;  5LFA A;  4JYK A;  3E97 A;  4EM2 A;  3PM1 A;  2QYO A;  4M3B A;  3TMO A;  3M4O J;  3HRU A;  3CCQ I;  2VBX A;  2DFE A;  2FE3 A;  4M9S A;  1W7P B;  4XIC A;  3D0S A;  1YI2 I;  2PLY A;  5JVT A;  3DXJ F;  4FT8 A;  2M2E A;  3ABT A;  3L2V A;  3GX4 X;  3WOD F;  4L0Y B;  1Z91 A;  2ESN A;  4EM1 A;  5TGT A;  1QZZ A;  2M7A A;  3E1S A;  3PQJ A;  4UVB A;  1U2W A;  2H1L A;  5CQE A;  4Q48 A;  3WTT C;  5B1A H;  4HOB A;  3W2A A;  2D5V A;  4N0B A;  2DT6 A;  1WJC A;  1P4A A;  2Y0M A;  3LL7 A;  1H88 C;  3SFI A;  1ITY A;  1XC5 A;  4XLE A;  4BHP A;  4ZYE A;  3LSR A;  1R5G A;  1TW3 A;  3H5R A;  5GP9 A;  4XLF A;  1CF7 B;  4LGW A;  3K4C A;  4H0E A;  3WG7 H;  3B6A A;  2DBB A;  4R79 A;  4CZC A;  4P55 A;  4UXN A;  4PJL A;  1I1S A;  4XQF A;  1N75 A;  2CWE A;  3C2B A;  1MGT A;  1LPQ A;  1D0Z A;  4KIB A;  1ETQ A;  4B8X A;  1OIS A;  3VSK A;  3HOV J;  1EF4 A;  3DEE A;  1FSE A;  2BXY A;  3FXL A;  4XON A;  5CVJ A;  2EBI A;  5E1X A;  3U21 A;  3PIO F;  4FQG A;  3F72 A;  1VQN I;  3BTC A;  1FPQ A;  1CQT A;  1MDM B;  2MBF A;  1ZTR A;  3HUG B;  4OIR F;  2WV0 A;  2XIG A;  3O2P E;  4Z2Y A;  2NS7 A;  1DP3 A;  4BJT A;  1Y56 A;  3K9T A;  1LB2 A;  1E3H A;  3VOE A;  4BGD A;  2YR2 A;  4EV0 A;  1OCP A;  3E5U A;  4LMY A;  1TNS A;  2WY8 Q;  2UV1 A;  2ZXI A;  3LSM A;  1MMD A;  2BV6 A;  3QU6 A;  2R7O A;  2LOO A;  5K5Q A;  3TOB A;  5JHU A;  1R1T A;  2JA6 J;  4B3A A;  2FNP A;  3JSO A;  3CO7 C;  2PQ8 A;  2WAQ A;  3OYI A;  1TQP A;  1QZY A;  3GFL A;  3OR1 C;  1AWC A;  4GCV A;  5B5E C;  1KU7 A;  1SD5 A;  4B3X A;  2R7Q A;  2LLK A;  3OIP A;  3BZK A;  2K4B A;  4OMZ A;  2L7K A;  2H6C A;  3DKX A;  2AS5 F;  2JQ7 A;  1SVM A;  3LQQ A;  2RDP A;  3M1E A;  2CQN A;  3QPT A;  2ELH A;  3SDB A;  5D8L B;  1JGS A;  3R0A A;  2AQE A;  2DA6 A;  3ABM H;  4BUP A;  3CME I;  1MNE A;  2RKH A;  3ABL H;  1YW7 A;  1KQ0 A;  2FQ4 A;  2H8W A;  1FMV A;  4G7Z F;  3RKW A;  2CUJ A;  2M45 A;  1XMA A;  1Z3Y A;  2COM A;  5F64 A;  1MBK A;  2A61 A;  3VYT B;  2ESH A;  4PGG A;  2DFH A;  1IDY A;  2W1O A;  3CJR B;  4QPQ A;  3RYP A;  1EH8 A;  3L2C A;  1R5H A;  3F23 A;  4HST A;  3ONQ A;  2WWY A;  5HVQ C;  1AHD P;  3QQA A;  3ZQQ A;  5L3F A;  2DT5 A;  2L02 A;  1TWG J;  3F8F A;  3L7W A;  4HV6 A;  4M9X A;  2O6G E;  3HHH A;  3K4J A;  1G3W A;  4A3I J;  5CJ9 A;  3MZH A;  2QQ8 A;  4EM0 B;  3KE2 A;  3RQI A;  3GO5 A;  3ZQF A;  2UWM A;  2JK3 A;  2O7O A;  2IS1 A;  4HQE A;  2NNN A;  2LRE A;  4PJM A;  4QSH A;  3GTL J;  4IRH A;  3EUK L;  3KP3 A;  1C0W A;  1WJA A;  2DA1 A;  5D5V B;  4IHW A;  1W0T A;  3ERM A;  3BT9 A;  1BI2 A;  1KZH A;  1K6O A;  4LG0 A;  4ZYG A;  1X1C A;  1TNT A;  3S1Q J;  2JA5 J;  1E3O C;  2CU7 A;  2J5O A;  4NNJ A;  1QO0 D;  3WG9 A;  1GVJ A;  4CCM A;  1JT0 A;  1E17 A;  3DLL F;  2LF8 A;  2BW3 B;  3GTO J;  1V54 H;  1MW7 A;  5BNG A;  1RUN A;  1Z1D A;  5L3E A;  5BPI A;  4IO9 F;  2HYG D;  3AG2 H;  4C2M J;  2EB7 A;  4ZYD A;  5M5Y J;  3I3L A;  4ABZ A;  5EZG A;  5DM7 F;  3TKY A;  1SVO A;  5GAE J;  3BY6 A;  1BIB A;  2LVS A;  1UJ8 A;  5EG0 B;  2OA4 A;  2EH3 A;  4HEA 2;  3K7A J;  3S2W A;  1OYW A;  2IXS A;  2CW8 A;  4CH7 A;  3OYD A;  5ICF A;  2MD5 A;  3H1C A;  1R49 A;  3DBL B;  3GZN B;  4XN3 A;  1F9N A;  1VZ0 A;  2XPV A;  2VAS A;  1WPK A;  2IAI A;  2V9P A;  2AXL A;  1IN4 A;  3SFZ A;  4XLN F;  4ZYH A;  2R0Q C;  3FBN B;  1T39 A;  3RYR A;  2NVQ J;  3KFW X;  1FMW A;  2OF7 A;  3S1N J;  4HBL A;  1MIJ A;  3VOD A;  4A3D J;  5FRO A;  1HDP A;  1WRJ A;  2ELK A;  4A3K J;  5F6F A;  5C4X J;  4BDZ A;  2QZ8 A;  3PJR A;  1ETO A;  3A02 A;  3BZC A;  2GBY A;  2V9K A;  3AG1 H;  5H20 A;  5C3E J;  4A6E A;  1YIO A;  1DPU A;  3K70 C;  3CDI A;  2DMT A;  3CJQ B;  3EET A;  2R7X A;  3CMM A;  1X1P A;  1K83 J;  1LKX A;  3IWF A;  2HOT A;  4EQQ A;  3NRV A;  1WJB A;  3I71 A;  4DGW B;  4G7H F;  1LQ1 A;  1RKT A;  1E2X A;  1GV5 A;  4HG2 A;  4PK4 A;  1OPC A;  1XPX A;  1FOK A;  2ZFW A;  3K4M A;  4Q47 A;  1VQO I;  3IHU A;  1FEX A;  3WU2 C;  1E0E A;  1T98 A;  4TV7 A;  3C1D A;  2QKM B;  4OIP F;  2X51 A;  3HOY J;  2XSD C;  2DTZ A;  4BXX J;  4C9Y A;  5ERI A;  5LHG A;  4A0Z A;  3K69 A;  4M73 A;  4U0V A;  1ZRE A;  3ASN H;  1RIO H;  3DU5 A;  5J8F A;  1IJW C;  1BIA A;  2Z1D A;  1X4O A;  3T8R A;  1WJF A;  3OR2 C;  2NYX A;  1VQ5 I;  2ZSI B;  4LLN A;  1R7J A;  2VOO A;  5ICE A;  3TO6 A;  2VOD A;  1BI0 A;  3C3W A;  4XRS G;  2HZT A;  3M9A A;  3KX2 A;  3O3K A;  1KON A;  3EUA A;  3R60 A;  1IGN A;  1IRX A;  2NNY A;  3WGH A;  4GYG A;  2X6Y A;  2OCE A;  2A6H F;  2GA1 A;  2XAS A;  3OY9 A;  2M4G A;  2LG4 A;  3Q0W A;  2VKE A;  2WBM A;  3HOS A;  3D5L A;  2CO5 A;  2NS8 A;  4LLL A;  2MFZ A;  2DTR A;  3IUO A;  4N4O B;  3TDZ C;  2LR8 A;  2R5Y B;  2OAZ A;  1LFU P;  4XLH A;  4EJT A;  1WCM J;  4RA2 A;  1N78 A;  1J9I A;  3ZQC A;  4BJ5 C;  4C30 A;  5D6F A;  4B4C A;  3FMS A;  1W1W E;  5LHH A;  1S8N A;  2Q1Z B;  1Z7L A;  4ZDO A;  2XAG A;  2A3S A;  5L3G A;  1TQI A;  2KZV A;  2AO9 A;  2DK8 A;  2XVC A;  1ON1 A;  4BL0 B;  1R00 A;  2L5Q A;  2M4K A;  2VJJ A;  4RM3 A;  3HSE A;  2COB A;  4K2E A;  3HDD A;  1VF9 A;  2XAF A;  5IP6 A;  1BW5 A;  4I02 A;  1ETV A;  1WJE A;  4Y33 A;  2EFP A;  3JCU C;  1UZC A;  1YHQ I;  1YJW I;  3CC7 I;  3DEW A;  3CUQ A;  2X1C A;  4GRI A;  1FLI A;  1JGG A;  2LKS A;  3HSR A;  2Y30 A;  1WHU A;  2ZNZ A;  4MEY F;  1USS A;  1GLN A;  2IGM A;  3KZZ A;  1NH3 A;  2YX7 A;  5KAI C;  2KDO A;  1P4W A;  3W6K B;  2E36 A;  3GZ6 A;  1I3A A;  2L9N A;  2YS9 A;  2VE9 A;  4IKF A;  2LY9 A;  1LDD A;  3LSI A;  4DYR A;  2P5L C;  5D5W B;  5K5R A;  4GYI A;  1JJ6 C;  2HTS A;  3IKV A;  3KYL A;  1JE8 A;  2K3P A;  5GTH C;  2WAE A;  1DU0 A;  1FYM A;  3CC2 I;  1KQ9 A;  3G2B A;  2PMZ A;  2HOE A;  1DPR A;  2E5N A;  3GUD A;  4LFU A;  4LJZ F;  4BYY A;  3L2R A;  5DV5 A;  2XRN A;  4ETS A;  3K4B A;  4PFP A;  4GFB A;  1HQC A;  3TL4 X;  1FOW A;  1LE8 B;  2LFB A;  3HOZ J;  3IKT A;  3ZMD A;  2M0M A;  1GXQ A;  2RAE A;  2RQQ A;  2Y69 H;  3K0L A;  1IW7 F;  3TDU C;  2LF7 A;  2Y75 A;  1R71 A;  3GW2 A;  2HS5 A;  4U0Y A;  2TCT A;  2EIK H;  3CF5 F;  3JRE A;  1J0R A;  3SQN A;  3OL4 A;  2CUF A;  4XOT A;  3J80 K;  2W7N A;  1U5T B;  3GTG J;  3S32 A;  4BAY A;  2CQQ A;  1SD7 A;  5JLX A;  3JAM Z;  1XGM A;  3KEY A;  2CYY A;  4XSX F;  2DMU A;  2XC7 A;  1OCC H;  3HTS B;  1WH5 A;  2W82 A;  4FTH A;  2R7W A;  3ZQH A;  2B7E A;  4P9U A;  1AKH A;  2R7V A;  2LP0 A;  4HV5 A;  4CCJ A;  4IZZ A;  4HF0 A;  3QPS A;  3CO6 C;  4RMN A;  1LDJ A;  3L1P A;  4BAC A;  1OCT C;  2J5P A;  5C4J J;  3Q9S A;  1PP7 U;  3KZI C;  4RB1 A;  4CIC A;  1XCB A;  2AHQ A;  2L9V A;  3E6B A;  3FZV A;  1GUU A;  2A68 F;  3E5Q A;  1ZG3 A;  2RGV A;  2VT3 A;  1H9G A;  3GME A;  2Z2S B;  4ENJ A;  2XDV A;  4D7M A;  3L2W A;  3G71 I;  4D5F A;  1F43 A;  2EFN A;  3EYI A;  1XCV A;  1DGR M;  1ZH5 A;  4UUS B;  1LUJ B;  2V6E A;  3QRF F;  2FU4 A;  2ADU A;  3MZ8 A;  4XNF A;  1U78 A;  2ZCW A;  2CQ7 A;  4P96 A;  4HAM A;  2LBF A;  3DCF A;  1Y1W J;  4UVC A;  4KNY A;  1X19 A;  2UUZ A;  4A3L J;  1MBE A;  3TW6 A;  1F4K A;  2KLO A;  2E71 A;  4E7I A;  2L4M A;  4J00 A;  2XB0 X;  4DBQ A;  2XAH A;  1GVD A;  1X2M A;  2E1N A;  3TO7 A;  4Z6Y A;  2E1O A;  2EIM H;  1WJ5 A;  3LA7 A;  3QP5 A;  4I99 C;  3UKG A;  2GLO A;  4PJN A;  4ZYA A;  2HEO A;  2IVM A;  5D6E A;  5B3S H;  2CUE A;  2JPB A;  2F6C A;  2LY2 A;  3FKI J;  1PUF A;  1MBG A;  2RNG A;  4JQF A;  2PMZ N;  1OCR H;  1TWC J;  2VUM J;  2ETH A;  3S3N A;  4M3G A;  1FP1 D;  5LGU A;  2OTL I;  2IA1 A;  1SFX A;  3W2W A;  1RNL A;  2VJ5 A;  2Y2Z A;  1BOA A;  5F1R A;  3OOP A;  1QRY A;  1I6X A;  3OYK A;  3QP6 A;  2JVH A;  1XX5 A;  1Z77 A;  2HQ5 A;  2NAZ A;  3CLO A;  5LRS A;  2QCO A;  1G6N A;  3MVP A;  3GTQ J;  3DBH B;  3HRM A;  1HDD C;  4IHY A;  1Z6T A;  5DCM B;  3KPH A;  3A01 A;  2MD0 A;  3HIF A;  4XK4 A;  2V26 A;  1YG2 A;  2ZFU A;  3ABU A;  5IP9 J;  3L2Q A;  2VXD A;  2DDA A;  3HRT A;  1XDS A;  1VQ6 I;  3G1O A;  2R7S A;  4WK8 F;  2K27 A;  4WWC A;  2O9L A;  1FTT A;  1QHG A;  1GT0 C;  1JHH A;  1FYL A;  2VKH A;  5M3M J;  4MQ9 F;  2W84 A;  3F22 A;  4YIF A;  2DPD A;  4XMY A;  5FD5 A;  2QWW A;  2DW4 A;  2ZJP F;  4ZC3 A;  4HX7 A;  2OPT A;  2NOJ B;  1WJD A;  1Z05 A;  3VEP A;  1K7A A;  4Y7N J;  4HNV A;  3PO3 J;  2XAU A;  3WGG A;  1E3P A;  5BS6 A;  1QVT A;  2R7Z J;  3H3Z A;  4QTR A;  2LDU A;  1HLV A;  3LFU A;  4WX9 A;  3KCC A;  1FZP B;  1UEL B;  2K86 A;  4IHV A;  2ECB A;  2ZME B;  5HNF A;  3ZRG A;  1BJZ A;  3WTX C;  4JBA A;  4D1Q A;  4JX5 A;  4O5V A;  2GOM A;  3GZ5 A;  4FE4 A;  2DMQ A;  4LOC A;  2NXN B;  5D5U B;  2HYJ A;  1SMT A;  4CZZ A;  5A2Q K;  2IT0 A;  1XG1 A;  5LGN A;  4OU0 A;  1U0J A;  5HLT A;  2A05 A;  1FBQ A;  4IRG A;  1U8R A;  2JMW A;  2H27 A;  2KMU A;  3EUH A;  1FWZ A;  4G9Y A;  3AFH A;  4ZTJ A;  4ENM A;  1EJ9 A;  2E35 A;  2F5V A;  2M34 A;  2KIQ A;  5E8I A;  3IL2 A;  3ZN1 A;  3I9V 2;  2YPR A;  2ZSH B;  1X3W B;  5KCM A;  1IV6 A;  4L18 B;  1LDK B;  2Y0S A;  3G1M A;  1RPW A;  2BHZ A;  2ZB9 A;  4A5N A;  4OIN F;  2ZME C;  4DZJ A;  4JX4 A;  5IT3 A;  4KDP A;  2IJL A;  3RPU A;  4LG3 A;  2Z5U A;  3ZN0 A;  2E5Z A;  2DK5 A;  3K2Z A;  2W85 A;  2OTJ I;  1TT0 A;  3FIS A;  3DKW A;  2DDB A;  1R4M B;  4BE0 A;  3BCB A;  4A3E J;  5JI6 A;  4OMY A;  5EEH A;  2XV4 S;  4BJ6 C;  4I76 A;  1I6H J;  2F5F A;  3D5S C;  3FHN A;  5HS7 A;  5IOY A;  2YUS A;  3GF2 A;  3KET A;  3SJM A;  4BH9 A;  4XKW A;  1RC9 A;  4XM3 A;  3KEO A;  4D0P A;  1SVL A;  2Q2E A;  1DGW Y;  1AU7 A;  3M7G A;  2V79 A;  3R0J A;  4L5I A;  1ZHF A;  2F5C A;  2LK2 A;  5KNL A;  4BHB A;  3GCM A;  4LB5 A;  3HEF A;  1D1B A;  2JUG A;  4I01 A;  2E60 A;  3E0J B;  3H35 A;  4HNU A;  2HGC A;  2E7W A;  2VL8 A;  3CMY A;  1LEA A;  3NWT A;  2CV0 A;  3IH2 A;  5B66 C;  1T0F C;  2LYC A;  4CYD A;  1L3L A;  4HZF A;  2E2J J;  2QEN A;  3TBI A;  2IA2 A;  3JRH A;  1ZK8 A;  2HPM A;  1AOY A;  4RAY A;  4XBF A;  4ON0 A;  1TP4 A;  2YU3 A;  1OLT A;  1YX5 A;  2KL4 A;  1A5J A;  1R5I D;  1UB9 A;  2Z99 A;  2O8K A;  2HOS A;  3F9K A;  1XS9 A;  2CW7 A;  3FXK A;  5TIS C;  3L9F A;  3I54 A;  4OIO F;  2H09 A;  1ETY A;  3H5A A;  1WI9 A;  1YRN A;  3K1P A;  3MN2 A;  4PFO A;  1VQM I;  2P7V B;  5L3C A;  3B6C A;  2V4J C;  1ETX A;  1WSU A;  1MNM C;  3ZQ7 A;  4UV9 A;  2X85 A;  2A5W A;  2OJE D;  2CMP A;  4H4K C;  2P5V A;  1D0Y A;  5F08 A;  5IT9 Z;  4CYC A;  5CQG A;  1UHM A;  4LG0 B;  1O4X A;  2O5R A;  4UHT A;  3I59 A;  2Y0S N;  1FP2 A;  2G0E A;  2R5Z A;  3ROU A;  4WXH A;  2ZBK A;  1XDU A;  2FF4 A;  2XSJ C;  2HVS A;  2K9Q A;  1HOM A;  4IOC F;  3KLO A;  3OYF A;  5CPR B;  1YOV B;  1H89 C;  3M8E A;  1V55 H;  2RNJ A;  3J7Z I;  2KZG A;  2V7F A;  4PCQ A;  3JRF A;  5J4V A;  2FMY A;  2HKX A;  2JUC A;  4Y3O A;  3M3Y J;  2R7U A;  1P7I A;  2W57 A;  3S93 A;  4Y13 A;  1T08 B;  4U7B A;  1MMG A;  1V5E A;  1FC3 A;  2EZH A;  1EKE A;  2L7F P;  3E7L A;  2GXG A;  1B8I A;  2K4J A;  4HDV A;  1TL8 A;  5JR3 A;  2TDX A;  1S9H A;  2VPR A;  5EGO A;  1P2F A;  2FSW A;  1N25 A;  2X6W A;  2JSP A;  2OBP A;  2Z33 A;  4HLY A;  3CQZ J;  1O3Q A;  2DJN A;  1UG0 A;  3A0B C;  1VND A;  4LB6 B;  1IN6 A;  5JFR A;  4Q5S F;  3BJO A;  1KYW A;  1W7P A;  2DI3 A;  1ZRC A;  4BEH A;  5K7F A;  5IY5 H;  5D5X B;  2I8D A;  4JP0 A;  3J7A Y;  4O3M A;  1FX7 A;  2VI6 A;  4L0Z B;  5GTI C;  3FBI B;  1T8I A;  1GDT A;  4M6Y A;  3HGY A;  1G2H A;  3BR6 A;  4E7Z A;  3S3M A;  1I27 A;  1S3J A;  1A31 A;  3O8G A;  2QKL B;  2CFX A;  2K7L A;  3M1C A;  4U7D A;  4DIQ A;  3DV8 A;  4W97 A;  2HOA A;  2R7R A;  4XOR A;  1Y39 A;  4I2O A;  3K4K A;  3LWF A;  3JRA A;  3CCY A;  3V8J A;  5F0H A;  2FML A;  3IRQ A;  4L9J A;  5E1Z B;  4ESJ A;  2NVU B;  3VB2 A;  4BNC A;  5C44 J;  1S7A A;  3CZ6 A;  3PQK A;  3V7C A;  3ZQL A;  1NHA A;  2ZKZ A;  2DN0 A;  1NK2 P;  2QQA A;  4YFN F;  2B9S A;  3MAJ A;  5E17 F;  1Z21 A;  5J8C A;  3MKY B;  3MCZ A;  5DUK A;  1J75 A;  2E19 A;  2EQR A;  2JWT A;  4NDL A;  2DPU A;  3DTE A;  2UZK A;  3S1R J;  3OYJ A;  1R6R A;  5M5W J;  3V8L A;  2OCC H;  5JLW A;  2OQR A;  3A4C A;  3TO9 A;  4U88 A;  2X6O A;  1IV8 A;  3BR3 A;  3KP5 A;  3WTY C;  3OOU A;  1H0M A;  1R1U A;  3IWZ A;  3QYB A;  3W3C A;  2DJI A;  2IGO A;  2OUM A;  1MH3 A;  1QHH D;  1X3Z B;  2WAQ N;  1YW8 A;  3WU1 B;  3FMQ A;  3I5U A;  5LBQ A;  4ZDP A;  4RGX A;  4B09 A;  3D1N I;  2BGC A;  1K78 A;  4F55 A;  1IAW A;  3DPT A;  2E1C A;  4W1U A;  3FM5 A;  3T0Y A;  4AYB A;  3NWS A;  1BN5 A;  2VC0 A;  2ZXH A;  5BQT A;  3P9C A;  4S05 A;  4BKX A;  2X1E A;  3H3U A;  3ZMS A;  1IRF A;  2DOE A;  4L9T A;  3HG9 A;  2JZY A;  3L2U A;  2DT7 B;  2ZXW H;  4IF4 A;  4OAZ A;  3M8J A;  3WE2 A;  1Z0X A;  5IYB J;  3R4K A;  3P7N A;  4AID A;  4BQO A;  4BXF A;  5EJC A;  3NQO A;  1SFK A;  2OV7 A;  4A2U A;  1W5T A;  3RDI A;  2BY2 A;  2PJP A;  3S16 J;  5FJ8 J;  1S7E A;  2HQN A;  5E8G A;  1KU3 A;  5IPA A;  4A69 C;  4KJZ A;  3I55 I;  2LD5 A;  3DEU A;  2F4O B;  2W00 A;  4QWQ A;  2HWV A;  4LD5 A;  3BR2 A;  3IRR A;  2GXA A;  3B02 A;  4BHC A;  1BC8 C;  1YX3 A;  1ZGW A;  2K5C A;  1JKP C;  2N8G A;  5AIP A;  3BLY A;  3DTK A;  3C7J A;  1P9Q C;  2RC4 A;  4G8X A;  2G9W A;  1DUX C;  4II2 A;  2DQR A;  2HDC A;  1VTN C;  1D5V A;  2MLK A;  2FXA A;  4RS8 A;  3GWZ A;  3RKY A;  4XRS A;  3CC4 I;  4V2F A;  1J2X A;  4XRM A;  2IBD A;  3LSP A;  1NK3 P;  2XPW A;  4UUV A;  1S29 A;  3CUQ B;  5ICC A;  2JPC A;  2OZ6 A;  4ZDL A;  3V4G A;  1WZ2 A;  3PFY A;  3C2H A;  4YFX F;  1HA8 A;  2HXO A;  1U3E M;  4L5J A;  2LNB A;  4Y17 A;  1JXS A;  4AVZ A;  4LK0 F;  2LKP A;  2EK5 A;  5FKK A;  1FOY A;  2KRC A;  3CTA A;  4XKV A;  2ELJ A;  3J7Y J;  2E7X A;  5KAF C;  2L4A A;  4HX8 A;  2IS4 A;  1LVK A;  1X2N A;  2P0W A;  5M5X J;  2K02 A;  2L54 A;  1TTY A;  3G1L A;  4HX4 A;  5ICG A;  1H9T A;  3BWG A;  2JT1 A;  4KIC A;  4ZZL A;  3WTV C;  5F04 A;  4E7L A;  1V5G A;  3UR3 C;  1B72 B;  3BQZ A;  3CUQ C;  5GAD J;  3FHZ A;  4DZP A;  2KKO A;  4RAG A;  2BBY A;  1YW9 A;  2L01 A;  3WTU C;  3OS2 A;  1T95 A;  4QLC U;  5E3N A;  1BI3 A;  2M5W A;  4NUB A;  2A6T A;  4KIF A;  1UMQ A;  5CKT A;  4AYB N;  4Y4R A;  1XSD A;  4YIR X;  2K3F A;  1RR8 C;  2O8X A;  1ZAR A;  4D5C A;  2HFH A;  2VXZ A;  1AKH B;  4OIQ F;  1W36 D;  1FIP A;  2OC6 A;  1X1D A;  1XGO A;  2K9L A;  2XUB A;  5HDN A;  2WTE A;  3R6S A;  3WHC A;  5E1W A;  3RZD J;  1JKQ C;  4YG2 F;  2FOK A;  1IUY A;  1W5S A;  5FLX Z;  2P5K A;  1H8A C;  3H9J A;  3ZQG A;  3TED A;  4LIU A;  3A03 A;  4BE2 A;  3PSI A;  4BBS J;  3RIR A;  2YSR A;  3FDY A;  4C2T A;  4AUX A;  4JX6 A;  3HHG A;  1QGP A;  2M87 A;  3BG7 A;  2TRT A;  2JA7 J;  3QOP A;  3TW7 A;  5HLI A;  3GTM J;  1QA6 A;  2LBF B;  1OR7 A;  3DQV C;  4F52 A;  1PDN C;  2PFB A;  3ZMV A;  5FKM A;  2JRM A;  4I6Z A;  4F92 B;  4P5O A;  3GVA A;  3CMA I;  4MQV A;  2K9S A;  4IVN A;  4E7H A;  2JJ7 A;  4KFC A;  2L9R A;  3S15 J;  5J1U A;  2DFI A;  1PJR A;  2F48 A;  3E6C C;  3F21 A;  1I50 J;  5DD4 A;  2IGN A;  2KHM A;  4DYQ A;  1YE9 A;  3ULQ B;  1J7K A;  1R4N B;  4IXA A;  3MKZ A;  1ZR4 A;  2VJI A;  4EJV A;  3CDL A;  1IRZ A;  1GHC A;  3SZP A;  1PUF B;  1VQK I;  3JRD A;  3U9G A;  1XSV A;  2KIF A;  2V1D A;  2VB6 A;  1ZG5 A;  5HDG A;  4YEL A;  2OQG A;  1HSJ A;  2UXN A;  4R1H A;  2FBH A;  5KHD A;  2GZW A;  2ZXJ A;  3GTK J;  3BR0 A;  1MMA A;  3KLN A;  1SAU A;  3DF8 A;  1BM9 A;  3F3X A;  1QBJ A;  2K9M A;  3E5X A;  3IV5 A;  1X58 A;  2A69 F;  4BY7 J;  1MH4 A;  1T56 A;  4ZJZ A;  1S6L A;  3MMY B;  4DYC A;  2EZK A;  3ZXS A;  1P92 A;  3MD2 A;  2R93 J;  4D7N A;  3LA2 A;  4ASN A;  2DA3 A;  5FLV A;  4NB5 A;  2VJ4 A;  5TRD A;  3GFM A;  1MND A;  4I0A A;  1K61 A;  2DOA A;  2EPF A;  2BEO A;  2HU9 A;  2P81 A;  1D5Y A;  3W2V A;  1LFB A;  1SFU A;  4RB3 C;  2PJR A;  3V42 A;  1WFX A;  3F8B A;  2IRF G;  3KP2 A;  1NG7 A;  2HNH A;  4KT6 A;  5DEQ A;  4B47 A;  1I1G A;  3ZMZ A;  2NS0 A;  3LSK A;  2CQK A;  1FTZ A;  3AG4 H;  3E6D A;  1WGX A;  3FX3 A;  1ZGJ A;  2NVX J;  1B9M A;  2DOF A;  4LK1 F;  3GYH X;  1U5T C;  3Q3S A;  2GXB A;  3ZMU A;  2CW0 F;  2D1V A;  2MYS A;  2R7F A;  3AG3 H;  4G12 A;  3ABK H;  1EV7 A;  4KMF A;  1U6G A;  3ELK A;  3OL3 A;  2EWN A;  5F1J A;  1WVR A;  2O61 A;  5D4S A;  5JVG F;  2EIL H;  5IYD J;  4KIG A;  1MSF C;  2MC4 A;  1ERD A;  2MC3 A;  2XPU A;  3OYM A;  4G94 A;  1FIA A;  2L7Z A;  2CV2 A;  1Y1V J;  2VQL A;  4MFE A;  3V8K A;  1REP C;  3F8C A;  4HLX A;  1VQL I;  2DCE A;  2Z16 A;  3CLQ A;  5GAG J;  2K85 A;  4IEJ A;  3GFJ A;  1BJA A;  3CP8 A;  3I4P A;  3I56 I;  4M71 A;  4A3C J;  3J81 K;  4G6D A;  1W5C C;  3OMY A;  2GA2 A;  5E79 C;  5FLM J;  3JAM K;  3WTS C;  4N9I A;  4KA4 A;  3QOE A;  1BA5 A;  5HNH A;  3KP4 A;  2KP6 A;  4AC0 A;  3QYF A;  4G6Q A;  3W6J B;  2DYR H;  3HPH A;  1X1A A;  3HGG A;  4CCL A;  1IC8 A;  2V1N A;  5D4R A;  1B1B A;  3EDP A;  5FKO A;  2CSO A;  2KDZ A;  1RES A;  5DTD A;  2V6C A;  3TP0 A;  2Z3Y A;  3BPX A;  4G6T B;  4DW6 A;  3PNT A;  4XLC A;  4DNC A;  2F4I A;  2CV1 A;  5CVU A;  2H6B A;  4A3J J;  3NAU A;  4O6J A;  4I98 B;  3CCU I;  2L9S A;  3UNG C;  3AKZ A;  2ACJ A;  4A12 A;  1UFM A;  4BBR J;  4E7S A;  4XLP F;  3N97 A;  5KK1 A;  1MBJ A;  3HSF A;  4IL6 C;  1HXD A;  1XTA A;  5E3M A;  2DMN A;  2DYS H;  4NC8 A;  1TBX A;  4BS9 A;  2KJC A;  3OYC A;  2XF7 A;  1HKQ A;  3S1M J;  2STT A;  3F6O A;  2V1X A;  3CJN A;  2KIU A;  4EEF G;  4UB6 C;  4XID A;  3RQ4 A;  3T1B A;  3H92 A;  3SDG A;  3U2R A;  2A07 F;  1OCO H;  3WE3 A;  1IZ1 A;  2VLA A;  2IS2 A;  4C3H J;  4CCK A;  4EGY A;  4RGU A;  4JK1 X;  3KZY A;  3I58 A;  3RCO A;  1N77 A;  3BC8 A;  1OJL A;  1YJN I;  4AIJ A;  2EIJ H;  1MSE C;  1QVU A;  4FX4 A;  4GXO A;  1ZGA A;  2CUZ A;  3L09 A;  1O7L A;  4CGZ A;  2XAQ A;  4KMU X;  3MWM A;  3Q0V A;  3ZR8 X;  3H0D A;  1SD6 A;  4C2U A;  3KYC B;  4PJJ A;  2B63 J;  4PGH A;  3RPU D;  4RB2 C;  4XL9 A;  5BMZ A;  5EEA A;  2ECC A;  2Q0O A;  3OYA A;  3TGN A;  5CLS A;  4M6X A;  4PDK A;  2E2H J;  3BCA A;  3PUB A;  1Y8Q B;  3LSG A;  1YRN B;  5BPD A;  2VKD A;  3G73 A;  4UUT A;  1OYY A;  2W24 A;  1LVA A;  3P9I A;  4CO8 A;  1MJ9 A;  2OZU A;  3RPQ A;  1RI7 A;  3AL0 B;  4KYW A;  2IS6 A;  4I7H A;  2O03 A;  1ETK A;  4WXD A;  3H0G J;  5E3O A;  1TC3 C;  1S72 I;  2DOD A;  4CYC B;  2VPL A;  1UHW A;  1XSX A;  4X1E A;  5DM6 F;  1B6A A;  4NBQ A;  3RI4 A;  1IDZ A;  4FCY A;  2L0K A;  3I59 B;  4G7O F;  4C3J J;  1OMI A;  2D2W A;  2R5Z B;  1GV2 A;  4U87 A;  3DU6 A;  4HNT A;  1XGS A;  4QIW N;  1SFO J;  4AWX B;  1G3Y A;  2X1D A;  1HC8 A;  1ZN2 A;  2NRA C;  4ZZD A;  1ZRF A;  3BJ6 A;  2DA2 A;  2BXZ A;  1XGN A;  4MFD A;  2WB1 A;  1POG A;  2KIS A;  5KVR A;  1FY7 A;  2IEK A;  1JI8 A;  3FXU A;  3GTP J;  2X4H A;  5HS8 A;  4N9H A;  4FX0 A;  2MSY A;  2STW A;  3E3V A;  4CSW A;  2CG4 A;  2HDW A;  1ZEL A;  3P9K A;  5CVR A;  5BOX A;  1MKM A;  1ZQ3 P;  2VE8 A;  4OWR B;  1RR7 A;  1QZE A;  1B59 A;  2HPI A;  1MMN A;  2PI0 A;  1QU3 A;  1ONV A;  1STZ A;  4MLO A;  2VQG A;  1D8J A;  3JRI A;  2ICW G;  2KT0 A;  1R22 A;  2E2I J;  3WGI A;  4IOA F;  2HR3 A;  4RM2 A;  1RZ4 A;  5J40 A;  5LGT A;  4BEH B;  3SEQ A;  4JOM A;  2FOW A;  1UST A;  1UCR A;  4UV8 A;  9ANT A;  1OCZ H;  4GGG A;  1ZLK A;  2LY1 A;  3OWT A;  4LLG F;  4MNU A;  4DOZ A;  2DFF A;  4J01 A;  1PYV A;  4MTE A;  1QQI A;  3GXO A;  2FX0 A;  3HL2 A;  1MBH A;  5HOD A;  1FSH A;  3E6M A;  3JRB A;  2CH0 A;  5DS9 A;  2LC2 A;  5J1Y A;  4IHS A;  1EH6 A;  1X4P A;  2W25 A;  4PUS A;  2XF6 A;  3BG9 A;  3HOW J;  3S8P A;  4CDG A;  4HF2 A;  4ANJ A;  4AM3 A;  2FBK A;  4I09 A;  2QBY A;  3KP6 A;  3O8H A;  3B73 A;  2ZME A;  2VBZ A;  3W6V A;  1PVE A;  3OS1 A;  4YEJ A;  3FM3 A;  3KYD B;  1M1E B;  5F0F A;  5J1R A;  3I64 A;  3HOU J;  1W0U A;  2CFO A;  2DQL A;  2MW8 A;  3SXY A;  3HXL A;  4FHT A;  3TOA A;  3MQ0 A;  1F1Z A;  2KJB A;  2XRO A;  2BY0 A;  1EA3 A;  2YX4 A;  2JTV A;  4B44 A;  3F8M A;  2HZD A;  1FJL A;  1K79 A;  2Q8K A;  5FRN A;  1DU6 A;  4X0G A;  2ZJR F;  1V5F A;  4NQW A;  1YIT I;  3OSF A;  1JUM A;  3ISP A;  4UNO A;  4YRV A;  2P6T A;  3OSG A;  1IXC A;  2UXX A;  2GQQ A;  1W7P D;  1A6I A;  2QSF X;  4HDU A;  2GWR A;  4LIV A;  4A93 J;  2VOP A;  2FD5 A;  3CP2 A;  3FXM A;  2G7U A;  3WU0 A;  1O3R A;  4EAT A;  3CF2 A;  3FMR A;  4N4N B;  2CRG A;  4ZTF A;  5ILS A;  2Y31 A;  4ESB A;  3PIP F;  2I5U A;  3MZY A;  2CS3 A;  3HM5 A;  4FET A;  3F6V A;  3TQN A;  3SEZ A; 
#chains in the Genus database with same CATH homology
 5LEK A;  1ZG1 A;  1T2K A;  1ODD A;  3GFI A;  1T0F A;  2KRF A;  3JTH A;  2IP2 A;  2ZJ2 A;  1O3T A;  2VT2 A;  3ZMT A;  5DYM A;  1K78 B;  5CYV A;  2PMH A;  4ENK A;  2FEZ A;  1QPM A;  2HYF A;  1L0O C;  5D8K B;  4GO1 A;  4CXF A;  3Q5F A;  4WCG A;  1I5Z A;  3FF5 A;  1J59 A;  3ZPL A;  5IT9 K;  1O57 A;  3IC7 A;  2A5Y B;  3BRO A;  2ISZ A;  1GXP A;  4MGR A;  3KEQ A;  1CF7 A;  2PBI A;  1YQA A;  2O0Y A;  5HDK A;  3GLX A;  3EQL F;  3DFG A;  1RUO A;  2D1H A;  3J7A O;  3SHF A;  1S7O A;  2EA2 A;  1HKT A;  4U0W A;  4CHU A;  1G3S A;  3T8T A;  2F5D A;  2X0L A;  1MDM A;  2QLZ A;  3RTR A;  3HUG A;  4KT5 C;  1PP8 F;  3KP7 A;  2XGX A;  4IRI A;  4AIK A;  2RV8 A;  2GIV A;  2D45 A;  4RAZ A;  1XB4 A;  3WTZ A;  1IRG A;  4RGS A;  4L9N A;  5AON A;  2P6S A;  1HW1 A;  1LJ9 A;  1O7F A;  5L3B A;  3T5X A;  1YFH A;  2VBW A;  1G3T A;  3ZP5 A;  1HW5 A;  2CGP A;  3RKX A;  3QPH A;  1ZRD A;  5ED4 A;  1ZYR F;  4IPA A;  2OU2 A;  5DCF A;  1T6S A;  3LA3 A;  2QVO A;  1YO5 C;  1HBX G;  1R1V A;  3NEU A;  2VN2 A;  3COA C;  6PAX A;  1YTY A;  1HST A;  1WWX A;  2FBI A;  1BC7 C;  2M30 A;  3K1M A;  4RGR A;  5FO5 A;  2JRT A;  4KN4 X;  2GAU A;  1KYZ A;  1KGS A;  3HYI A;  3LAP A;  1IN8 A;  3QU3 A;  2DLL A;  3ECH A;  5K1Y A;  1OKR A;  1MD0 A;  1FBU A;  3FXR A;  3I0T A;  3O6B B;  4P9F A;  1SAX A;  2RVC A;  1YS7 A;  1G4D A;  4Y15 A;  2B0L A;  1D3Y A;  2Y48 A;  1FT9 A;  3L00 A;  1FBS A;  3K1N A;  5DD8 A;  2ZO4 A;  4MHG A;  1B9N A;  2FA5 A;  5HLH A;  1JHF A;  2FRH A;  1XN7 A;  3BZ6 A;  1KU9 A;  5LLQ A;  2EFW A;  2HQR A;  5TJJ A;  2P8T A;  2IA0 A;  4YII A;  1KU2 A;  4AIH A;  5ILV A;  3R61 A;  4OOI A;  3REO A;  3WTW C;  3RJP A;  1P4X A;  5DUI A;  1HW2 A;  4HYE A;  2Z9O A;  2RN7 A;  3N4M A;  3MFK A;  5FD6 A;  3EYY A;  3BP8 A;  2VBY A;  2MA3 A;  2XHK A;  4ENN A;  2OD5 A;  2F2E A;  3GEZ A;  3DPL C;  5CVV A;  1IXS B;  3J80 Z;  2MH2 A;  1QNT A;  1SFE A;  4Q4Z F;  3CUO A;  3ML6 A;  2PEX A;  4F7Z A;  2PMU A;  1BBY A;  2HTJ A;  3ERE D;  2BE5 F;  1FYK A;  4EGZ A;  3V7S A;  3MEX A;  3LQR A;  1BI1 A;  4BXU A;  1O3S A;  3LST A;  5FFX A;  5HOO A;  5FFZ A;  2V9V A;  2ISY A;  1B4A A;  3SZT A;  2PN6 A;  2LSO A;  1Y0U A;  3HTU A;  2P7C B;  3G3Z A;  4ESF A;  1MJB A;  4YFK F;  4E70 A;  4ZH4 F;  3JSP A;  1ZAO A;  4RB0 A;  5FB2 A;  2FNA A;  4EJW A;  5FLX K;  2JSC A;  5LEJ A;  1P6R A;  2DAO A;  5EEG A;  1PUE E;  1R58 A;  2M8E A;  2R3S A;  2EA4 A;  3PFI A;  2EV0 A;  2XKO A;  4L9V A;  3F8N A;  1EH7 A;  2G7H A;  1KA8 A;  3J81 Z;  3BDD A;  1FNN A;  4A6D A;  3FWE A;  3HOT A;  2MH9 A;  1ULY A;  1V4R A;  4UVA A;  5FGM A;  2IPQ X;  3BPV A;  4A5M A;  1Z7U A;  5HS9 A;  2VON A;  1D8K A;  2DU9 A;  2PG4 A;  3FXQ A;  1YLF A;  4EVI A;  2BYV E;  4HA8 A;  3BOQ A;  2L3D A;  2QQ9 A;  5J6X A;  1DDN A;  2VC1 A;  1DP7 P;  3V7R A;  1TW2 A;  5DDG A;  3VFZ A;  5H6Q A;  1CGP A;  2RQP A;  1MZB A;  4DQ2 A;  3CDH A;  2XAJ A;  2P4W A;  4WXC A;  1ON2 A;  2V1U A;  1A04 A;  3ECO A;  3OV8 A;  3U1D A;  4A0X A;  1YYV A;  1HKS A;  1W4M A;  1V3F A;  1SMY F;  2M1B A;  2DO7 A;  4IJA A;  5A2Q Z;  2EV6 A;  3BJA A;  2C6Y A;  1U5T A;  4A0Y A;  1LEB A;  4S04 A;  2EFQ A;  2HKO A;  5E20 A;  1F5T A;  2XKP A;  4EJU A;  1XD7 A;  1R23 A;  4R8H A;  4PZJ A;  3Q9V A;  1LNW A;  3I53 A;  4HF1 A;  1IN5 A;  5LHI A;  1IXR C;  3DP7 A;  5H6R A;  5K5O A;  5ILU A;  3JW4 A;  1MJA A;  1IN7 A;  4XSZ F;  1Z6R A;  4M72 A;  4IHT A;  4KUM A;  4BQA A;  1ZLJ A;  1YS6 A;  4AD9 A;  1WKM A;  2WC2 A;  1OYI A;  1SD4 A;  2F5E A;  3M8F A;  4NHJ A;  1KQ8 A;  4M9Z A;  1J5Y A;  2FQ3 A;  5CVI A;  3LFK A;  4MEX F;  2MLG A;  2QBY B;  4KN7 X;  4WF2 A;  4HQM A;  3HRS A;  4AVP A;  1Q1H A;  3QAH A;  5E18 F;  5HLG A;  1TQM A;  5L3D A;  2EFO A;  1Z9C A;  4MTD A;  4XRF A;  1T38 A;  2KIM A;  3C18 A;  5LRR A;  2QQB A;  2EV5 A;  4EJO A;  5AIQ A;  2R7D A;  1X3U A;  1TLH B;  1XMK A;  2H94 A;  1R36 A;  4I0B A;  2ZNY A;  4HW0 A;  3AAF A;  2QUF A;  2QM3 A;  3JTG A;  2EJR A;  5DCM A;  1WQ2 A;  4EMS A;  1IF1 A;  3LAJ A;  4M74 A;  2A6E F;  2IW5 A;  2O3F A;  3E97 A;  4EM2 A;  2QYO A;  3HRU A;  2VBX A;  4M9S A;  2FE3 A;  1W7P B;  3D0S A;  2PLY A;  5JVT A;  3DXJ F;  4FT8 A;  3ABT A;  3GX4 X;  3WOD F;  4L0Y B;  1Z91 A;  2ESN A;  4EM1 A;  1QZZ A;  3PQJ A;  4UVB A;  1U2W A;  4Q48 A;  3WTT C;  4HOB A;  4N0B A;  1P4A A;  2Y0M A;  4BHP A;  4ZYE A;  1R5G A;  1TW3 A;  1CF7 B;  4LGW A;  4H0E A;  2DBB A;  4R79 A;  4P55 A;  4UXN A;  1I1S A;  2CWE A;  1MGT A;  4KIB A;  4B8X A;  1FSE A;  5E1X A;  5CVJ A;  3F72 A;  1FPQ A;  1MDM B;  2MBF A;  4OIR F;  2WV0 A;  2XIG A;  3O2P E;  4Z2Y A;  3K9T A;  1LB2 A;  3VOE A;  2YR2 A;  4EV0 A;  3E5U A;  4LMY A;  1TNS A;  2BV6 A;  3QU6 A;  5K5Q A;  3TOB A;  5JHU A;  1R1T A;  2FNP A;  3JSO A;  3CO7 C;  2PQ8 A;  1TQP A;  1QZY A;  3GFL A;  1AWC A;  4GCV A;  1KU7 A;  1SD5 A;  2K4B A;  4OMZ A;  2H6C A;  2AS5 F;  3LQQ A;  2RDP A;  3M1E A;  3QPT A;  2ELH A;  5D8L B;  1JGS A;  3R0A A;  2RKH A;  1YW7 A;  1KQ0 A;  4G7Z F;  3RKW A;  2M45 A;  1XMA A;  2COM A;  5F64 A;  2A61 A;  2ESH A;  4PGG A;  3RYP A;  1EH8 A;  3L2C A;  1R5H A;  3F23 A;  2WWY A;  5HVQ C;  5L3F A;  2DT5 A;  2L02 A;  3F8F A;  4HV6 A;  3L7W A;  2O6G E;  4M9X A;  3HHH A;  1G3W A;  5CJ9 A;  3MZH A;  4EM0 B;  3KE2 A;  3GO5 A;  2UWM A;  4HQE A;  2NNN A;  4IRH A;  3KP3 A;  1C0W A;  5D5V B;  1BI2 A;  1K6O A;  4LG0 A;  4ZYG A;  1TNT A;  2J5O A;  1QO0 D;  3WG9 A;  1GVJ A;  1E17 A;  2LF8 A;  1RUN A;  1Z1D A;  5L3E A;  5BPI A;  2HYG D;  2EB7 A;  4ZYD A;  3TKY A;  1BIB A;  3BY6 A;  2OA4 A;  3S2W A;  1OYW A;  5ICF A;  2MD5 A;  1F9N A;  2AXL A;  1IN4 A;  3SFZ A;  4XLN F;  4ZYH A;  1T39 A;  3RYR A;  3KFW X;  4HBL A;  3VOD A;  1WRJ A;  5F6F A;  2QZ8 A;  5H20 A;  4A6E A;  1YIO A;  1DPU A;  3EET A;  3IWF A;  4EQQ A;  3NRV A;  3I71 A;  1LQ1 A;  4G7H F;  1E2X A;  1OPC A;  1FOK A;  2ZFW A;  4Q47 A;  3IHU A;  1T98 A;  4TV7 A;  3C1D A;  4OIP F;  5ERI A;  5LHG A;  4A0Z A;  3K69 A;  4M73 A;  4U0V A;  1ZRE A;  1RIO H;  5J8F A;  1BIA A;  3T8R A;  2NYX A;  4LLN A;  1R7J A;  2VOO A;  5ICE A;  3TO6 A;  2VOD A;  1BI0 A;  3C3W A;  2HZT A;  3M9A A;  3O3K A;  3R60 A;  2NNY A;  3WGH A;  4GYG A;  2A6H F;  2GA1 A;  2XAS A;  3HOS A;  3D5L A;  2CO5 A;  4LLL A;  2DTR A;  3TDZ C;  2OAZ A;  4EJT A;  1J9I A;  5D6F A;  3FMS A;  5LHH A;  1S8N A;  2XAG A;  2A3S A;  5L3G A;  1TQI A;  2DK8 A;  2XVC A;  1ON1 A;  1R00 A;  3HSE A;  4K2E A;  2XAF A;  4I02 A;  2EFP A;  3CUQ A;  1FLI A;  3HSR A;  2ZNZ A;  4MEY F;  1USS A;  3KZZ A;  2YX7 A;  1P4W A;  3W6K B;  3GZ6 A;  2VE9 A;  1LDD A;  2P5L C;  5D5W B;  5K5R A;  4GYI A;  2HTS A;  3IKV A;  1JE8 A;  1FYM A;  1KQ9 A;  2HOE A;  1DPR A;  4BYY A;  3GUD A;  4LFU A;  4LJZ F;  5DV5 A;  2XRN A;  4ETS A;  1HQC A;  3IKT A;  3ZMD A;  1GXQ A;  3K0L A;  3TDU C;  1IW7 F;  2LF7 A;  2Y75 A;  3GW2 A;  2HS5 A;  4U0Y A;  1J0R A;  3SQN A;  3J80 K;  1U5T B;  4BAY A;  1SD7 A;  3JAM Z;  1XGM A;  2CYY A;  4XSX F;  3HTS B;  4P9U A;  4HV5 A;  4HF0 A;  3CO6 C;  1LDJ A;  2J5P A;  3Q9S A;  1PP7 U;  4RB1 A;  4CIC A;  1XCB A;  3E6B A;  3FZV A;  2A68 F;  3E5Q A;  1ZG3 A;  2RGV A;  2VT3 A;  1H9G A;  4ENJ A;  2EFN A;  3EYI A;  1XCV A;  1ZH5 A;  3QRF F;  2FU4 A;  2ADU A;  1U78 A;  2ZCW A;  4P96 A;  4HAM A;  4UVC A;  4KNY A;  1F4K A;  2L4M A;  2XAH A;  2E1N A;  3TO7 A;  3LA7 A;  3QP5 A;  2HEO A;  2IVM A;  5D6E A;  2JPB A;  4JQF A;  2ETH A;  5LGU A;  1FP1 D;  2IA1 A;  1SFX A;  1RNL A;  1BOA A;  5F1R A;  3OOP A;  1I6X A;  3QP6 A;  2NAZ A;  3CLO A;  5LRS A;  1G6N A;  3HRM A;  1Z6T A;  5DCM B;  3HIF A;  1YG2 A;  3ABU A;  3HRT A;  1XDS A;  4WK8 F;  2K27 A;  4WWC A;  1JHH A;  1FYL A;  4MQ9 F;  2W84 A;  3F22 A;  4YIF A;  2DPD A;  5FD5 A;  2QWW A;  2DW4 A;  4HX7 A;  1Z05 A;  3VEP A;  1K7A A;  3WGG A;  5BS6 A;  3H3Z A;  2LDU A;  4WX9 A;  3KCC A;  1FZP B;  2K86 A;  2ZME B;  3WTX C;  4JBA A;  4O5V A;  3GZ5 A;  5D5U B;  1SMT A;  4CZZ A;  5A2Q K;  2IT0 A;  5LGN A;  4OU0 A;  1FBQ A;  4IRG A;  1U8R A;  2H27 A;  3EUH A;  1FWZ A;  4G9Y A;  4ENM A;  5E8I A;  3IL2 A;  3ZN1 A;  2YPR A;  4L18 B;  1LDK B;  4A5N A;  4OIN F;  5IT3 A;  4KDP A;  2IJL A;  3RPU A;  2Z5U A;  3ZN0 A;  2DK5 A;  3K2Z A;  2W85 A;  3DKW A;  5JI6 A;  4OMY A;  5EEH A;  2XV4 S;  2F5F A;  5HS7 A;  3GF2 A;  3KET A;  4BH9 A;  3KEO A;  4D0P A;  2Q2E A;  3M7G A;  2V79 A;  3R0J A;  4L5I A;  1ZHF A;  2F5C A;  4BHB A;  4LB5 A;  4I01 A;  2HGC A;  2E7W A;  1LEA A;  4CYD A;  1L3L A;  4HZF A;  2QEN A;  2IA2 A;  1AOY A;  4RAY A;  4XBF A;  4ON0 A;  2YU3 A;  1UB9 A;  2Z99 A;  3L9F A;  3I54 A;  4OIO F;  2H09 A;  1WI9 A;  3K1P A;  2P7V B;  5L3C A;  1WSU A;  3ZQ7 A;  4UV9 A;  2P5V A;  5IT9 Z;  1UHM A;  4LG0 B;  4UHT A;  3I59 A;  1FP2 A;  3ROU A;  4WXH A;  2ZBK A;  1XDU A;  2FF4 A;  3KLO A;  3M8E A;  2RNJ A;  4PCQ A;  2FMY A;  2HKX A;  2W57 A;  4Y13 A;  4U7B A;  1FC3 A;  2GXG A;  2K4J A;  4HDV A;  5JR3 A;  2TDX A;  1P2F A;  2FSW A;  2OBP A;  2Z33 A;  4HLY A;  1O3Q A;  4LB6 B;  1IN6 A;  5JFR A;  4Q5S F;  3BJO A;  1KYW A;  1W7P A;  2DI3 A;  1ZRC A;  5D5X B;  4O3M A;  1FX7 A;  4L0Z B;  4M6Y A;  1I27 A;  1S3J A;  2CFX A;  2K7L A;  4U7D A;  3DV8 A;  4I2O A;  3LWF A;  3V8J A;  2FML A;  3IRQ A;  4L9J A;  5E1Z B;  4ESJ A;  3VB2 A;  4BNC A;  1S7A A;  3PQK A;  3V7C A;  1NHA A;  2ZKZ A;  2QQA A;  4YFN F;  3MAJ A;  5E17 F;  5J8C A;  3MCZ A;  5DUK A;  1J75 A;  2DPU A;  2UZK A;  3V8L A;  2OQR A;  3TO9 A;  4U88 A;  3KP5 A;  3WTY C;  1H0M A;  1R1U A;  3IWZ A;  1YW8 A;  3WU1 B;  3FMQ A;  3I5U A;  5LBQ A;  4RGX A;  4B09 A;  2BGC A;  1K78 A;  1IAW A;  3DPT A;  2E1C A;  3FM5 A;  3T0Y A;  1BN5 A;  2VC0 A;  5BQT A;  3P9C A;  4S05 A;  3H3U A;  3ZMS A;  1IRF A;  4L9T A;  2JZY A;  4IF4 A;  3WE2 A;  3R4K A;  3P7N A;  4A2U A;  3NQO A;  1W5T A;  3RDI A;  2PJP A;  2HQN A;  5E8G A;  1KU3 A;  3DEU A;  4QWQ A;  2HWV A;  4LD5 A;  3IRR A;  3B02 A;  4BHC A;  1BC8 C;  5AIP A;  3C7J A;  2RC4 A;  4G8X A;  2G9W A;  1DUX C;  2HDC A;  2DQR A;  1VTN C;  1D5V A;  2MLK A;  2FXA A;  4RS8 A;  3GWZ A;  3RKY A;  1J2X A;  4UUV A;  1S29 A;  3CUQ B;  5ICC A;  2JPC A;  2OZ6 A;  3V4G A;  4YFX F;  1U3E M;  4L5J A;  2LNB A;  4Y17 A;  1JXS A;  4LK0 F;  2LKP A;  2EK5 A;  3CTA A;  2E7X A;  2L4A A;  4HX8 A;  2K02 A;  2L54 A;  1TTY A;  4HX4 A;  5ICG A;  1H9T A;  3BWG A;  2JT1 A;  4KIC A;  4ZZL A;  3WTV C;  3CUQ C;  3FHZ A;  2KKO A;  2BBY A;  1YW9 A;  2L01 A;  3WTU C;  4QLC U;  1BI3 A;  2M5W A;  4KIF A;  1XSD A;  2O8X A;  1ZAR A;  2HFH A;  2VXZ A;  4OIQ F;  1XGO A;  2XUB A;  5HDN A;  2WTE A;  3R6S A;  5E1W A;  4YG2 F;  2FOK A;  1IUY A;  1W5S A;  5FLX Z;  2P5K A;  3RIR A;  2YSR A;  3HHG A;  1QGP A;  2M87 A;  3QOP A;  5HLI A;  1OR7 A;  3DQV C;  1PDN C;  2PFB A;  3ZMV A;  4P5O A;  3GVA A;  4MQV A;  4IVN A;  4KFC A;  2DFI A;  3E6C C;  3F21 A;  5DD4 A;  3ULQ B;  1J7K A;  4IXA A;  4EJV A;  1GHC A;  3SZP A;  3U9G A;  1XSV A;  2KIF A;  2V1D A;  1ZG5 A;  5HDG A;  2OQG A;  1HSJ A;  2UXN A;  4R1H A;  2FBH A;  2GZW A;  2ZXJ A;  3KLN A;  3DF8 A;  1BM9 A;  3F3X A;  1QBJ A;  3E5X A;  2A69 F;  1S6L A;  1P92 A;  3LA2 A;  4ASN A;  4NB5 A;  5TRD A;  3GFM A;  4I0A A;  2BEO A;  1SFU A;  4RB3 C;  3F8B A;  2IRF G;  3KP2 A;  5DEQ A;  1I1G A;  3ZMZ A;  2NS0 A;  2CQK A;  3E6D A;  3FX3 A;  1ZGJ A;  1B9M A;  4LK1 F;  3GYH X;  1U5T C;  2GXB A;  3ZMU A;  2CW0 F;  2D1V A;  2R7F A;  1EV7 A;  4KMF A;  1U6G A;  3ELK A;  2EWN A;  2O61 A;  5D4S A;  4KIG A;  2MC3 A;  4G94 A;  3V8K A;  1REP C;  3F8C A;  4HLX A;  3GFJ A;  1BJA A;  3I4P A;  4M71 A;  3J81 K;  4G6D A;  2GA2 A;  3JAM K;  3WTS C;  4N9I A;  4KA4 A;  3KP4 A;  4G6Q A;  3W6J B;  5D4R A;  1B1B A;  3EDP A;  2CSO A;  2V6C A;  2Z3Y A;  3BPX A;  4DNC A;  5CVU A;  2H6B A;  4O6J A;  4I98 B;  2ACJ A;  4A12 A;  1UFM A;  4XLP F;  3N97 A;  5KK1 A;  3HSF A;  1HXD A;  1TBX A;  2KJC A;  1HKQ A;  2STT A;  3F6O A;  2V1X A;  3CJN A;  2KIU A;  3T1B A;  3H92 A;  3U2R A;  2A07 F;  3WE3 A;  1IZ1 A;  4EGY A;  4RGU A;  4JK1 X;  3KZY A;  3I58 A;  4AIJ A;  4FX4 A;  4GXO A;  1ZGA A;  3L09 A;  4CGZ A;  1O7L A;  2XAQ A;  4KMU X;  3MWM A;  1SD6 A;  4PGH A;  4RB2 C;  5BMZ A;  2Q0O A;  3TGN A;  5CLS A;  4M6X A;  4PDK A;  5BPD A;  3G73 A;  1OYY A;  2W24 A;  1LVA A;  3P9I A;  4CO8 A;  1MJ9 A;  2OZU A;  3RPQ A;  1RI7 A;  4KYW A;  4I7H A;  2O03 A;  4WXD A;  1UHW A;  1XSX A;  1B6A A;  3RI4 A;  3I59 B;  4G7O F;  1OMI A;  2D2W A;  1XGS A;  4AWX B;  1G3Y A;  1ZN2 A;  2NRA C;  4ZZD A;  1ZRF A;  3BJ6 A;  1XGN A;  5KVR A;  1FY7 A;  3FXU A;  2X4H A;  5HS8 A;  4N9H A;  4FX0 A;  2STW A;  3E3V A;  2CG4 A;  3P9K A;  5CVR A;  5BOX A;  1MKM A;  2VE8 A;  1B59 A;  2PI0 A;  1ONV A;  1STZ A;  1D8J A;  1R22 A;  3WGI A;  2HR3 A;  1RZ4 A;  5LGT A;  4UV8 A;  1UST A;  1UCR A;  4GGG A;  1ZLK A;  4LLG F;  4MNU A;  4MTE A;  1QQI A;  3GXO A;  1FSH A;  3E6M A;  4IHS A;  1EH6 A;  2W25 A;  4CDG A;  4HF2 A;  2FBK A;  4I09 A;  2QBY A;  3KP6 A;  3B73 A;  2ZME A;  2VBZ A;  3FM3 A;  3I64 A;  2DQL A;  3SXY A;  4FHT A;  3TOA A;  3MQ0 A;  1F1Z A;  2KJB A;  2XRO A;  2YX4 A;  2JTV A;  3F8M A;  1K79 A;  2Q8K A;  4NQW A;  3ISP A;  4UNO A;  2P6T A;  1IXC A;  2UXX A;  2GQQ A;  1W7P D;  4HDU A;  2GWR A;  2VOP A;  2G7U A;  3WU0 A;  1O3R A;  3FMR A;  5ILS A;  4ESB A;  3MZY A;  3F6V A;  3TQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...