2LD5A

Solution nmr-derived complex structure of hoxa13 dna binding domain bound to dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
67
structure length
67
Chain Sequence
GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Homeobox protein Hox-A13
total genus 24
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ld5A00
3TW6A 1UMQA 3LSPA 1GT0C 2HXOA 3LSGA 1IV6A 1YRNB 3FKIJ 3S1QJ 3GTKJ 2MW8A 3LNQA 5FKOA 4V2GA 1K83J 1WH7A 3S16J 2ZB9A 3VPRA 4CYCB 2MSYA 2HDDA 2DA5A 3JRHA 4A3IJ 2E2JJ 4HNVA 1JT6A 1UHSA 1ETWA 1ETXA 1ZTRA 1Y1VJ 3JRFA 2HYJA 3GTMJ 1NK2P 2NVXJ 5K7ZA 2LY9A 4LOCA 2DA4A 4GFBA 1I3QJ 2JWTA 1IDZA 1SANA 1Z77A 4BKXA 2ID3A 1QVUA 4A3LJ 3PO2J 1HF0A 2O8KA 1GV5A 1T33A 3A03A 1MBHA 5JLWA 5IOZA 2X9DA 4FCYA 1QVTA 2M8GX 2NS8A 3TP3A 3ZQGA 2DMQA 4A93J 1OJLA 3HOXJ 1ZQ3P 2HOSA 1JGGA 1W0UA 3ZQIA 1RETA 1P7JA 4IHXA 4FTHA 5F0HA 1RKTA 1NK3P 1RKWA 2Y30A 2DN0A 3HGYA 5M3FJ 5FLVA 4JX4A 3ZQLA 1O4XA 3QQAA 2XRLA 4A69C 5F08A 4X6AJ 2AHQA 1U78A 1P7IA 5EG0A 1F36A 5IYCJ 1ORKA 3Q0UA 1B72A 1X2NA 3UKGA 4FE7A 5K7FA 2FQ4A 3ZOBA 5FKKA 1IUFA 1VFCA 3JREA 2XPUA 2CRGA 3HOVJ 4A3KJ 2DJNA 1MBJA 3I4MJ 1POGA 1ETKA 3JRGA 3BR0A 3BQYA 1JUPA 4V2FA 1NTCA 3OSFA 3ZQCA 2XGCA 4QTRA 4B4CA 4UUSA 1AHDP 3BTCA 3G1OA 3Q0WA 5HODA 2VUMJ 4A3GJ 2R5YB 2ECBA 1ENHA 5GP9A 9ANTA 3JR9A 1BW6A 1HDPA 5F27A 2EH3A 1OCTC 3QPSA 3FIWA 2XSDC 4DYRA 1AKHA 4M3EA 3OOUA 2E2IJ 2O7OA 1GVDA 1GDTA 3SDGA 2DMNA 4XRMA 2K40A 5C44J 4RBOA 4L5EA 2CUFA 3W6VA 1XG1A 3RZOJ 2EZIA 3LSJA 1HDDC 2FJ1A 1JJ6C 1U8BA 2EZHA 3C2BA 1XS9A 3I4NJ 3BT9A 3BR5A 3TW7A 3BTJA 3PO3J 5EZHA 1D5YA 2IAIA 3BG5A 3RZDJ 3CCYA 1OCPA 4W97A 5IP9J 3BR1A 1ETYA 2K9NA 2VI6A 2EZLA 2JA5J 4C3IJ 4D7MA 5C4XJ 5IYDJ 3LSRA 1QPIA 2R92J 3HOYJ 2JK3A 3S1RJ 3M4OJ 3IH3A 3MN2A 4M3GA 1XC5A 2JMWA 1IDYA 4IHWA 2WAQN 2XB0X 5F04A 4JX5A 3ZQFA 1DU6A 1LFUP 1IG7A 2H1KA 2KT0A 3BR3A 2QF7A 2ECCA 2LR8A 2DA2A 2LD5A 2DMTA 2MGQA 3A01A 5EYRA 3MKLA 2IEKA 1FIAA 3IV5A 2XGDA 4M3FA 2R0QC 1MBGA 3FK7A 3BR6A 1JTXA 5IP7J 3JRDA 1IC8A 1FEXA 1Y1WJ 5J1RA 4AUXA 4MLOA 4Y7NJ 3WHCA 1ZGWA 1QRYA 1ETVA 5FKNA 3B6AA 3IH2A 3H0GJ 4A3JJ 3O8HA 4A3MJ 3A02A 2FX0A 4W1UA 4QIWN 1ETOA 2ME6A 1DU0A 1ZK8A 1ZR2A 1I6HJ 4M3BA 1RESA 5DTDA 1JTYA 1JT0A 3WHBA 4AC0A 2KDZA 1Q1VA 1WPKA 4IEJA 4BBRJ 2ID6A 5EZGA 3S2DJ 2LFBA 2XPWA 4BY1J 1H89C 5E3LA 3GTLJ 3D1NI 2JA8J 2I10A 5FLMJ 2JA7J 5E3OA 4RDUA 4BY7J 2Y9ZA 1WH5A 3HGGA 3BTIA 1YRNA 4ABZA 4DZPA 4JX6A 2CQXA 5GPCA 4C2MJ 1G2HA 1JUSA 3HBLA 4D7NA 5M5XJ 3BG3A 3FISA 2P81A 1U9NA 4DZJA 2XB5A 1HOMA 5F0CA 1ZKGA 4IHVA 2LLKA 3JRCA 2HI3A 2MG4A 3GBGA 2B63J 1TWHJ 1X58A 3JRBA 1B72B 2L0KA 2XGEA 3NARA 3CMYA 1LE8A 5EEAA 3JRIA 2DTZA 5EGOB 1U9OA 2DA7A 5C3EJ 2D5VA 2LTPA 3K7AJ 2R93J 2L7ZA 4A3DJ 4MFDA 3RQIA 3Q0VA 1T56A 2YUSA 3HOZJ 1EF4A 3S1MJ 3PM1A 2TRTA 1ETQA 2R5ZB 4JYKA 2CU7A 2M0CA 2ME0A 1JKQC 4JP0A 2RAEA 5C4JJ 5K7HA 1SFOJ 1S7EA 4XIDA 3OIOA 3H3VK 2CQQA 4A3BJ 4J19A 2X48A 2WV1A 4FISA 3CDLA 5FKMA 2Y0SN 2Y2ZA 3HM5A 4MFEA 5IYBJ 4A3EJ 1F43A 5EG0B 4DYCA 5JLXA 1H8AC 4MO7A 2AO9A 3TP0A 1TWGJ 1TWFJ 2HOTA 1RR7A 4DYQA 5EF6A 3GTOJ 3BG9A 3S15J 3S14J 2CJJA 3DEWA 3BTLA 2CUEA 3RKQA 3GTGJ 2K9QA 3G1MA 2M34A 5M3MJ 3GTQJ 1JKOC 5M5WJ 1RPWA 2HQ5A 1A5JA 2M9HA 4MIMA 2WB1N 1H88C 1K61A 3SJMA 1PUFA 5EDNA 1B8IA 2PMZN 5IPAA 3CQZJ 1MSEC 3S1NJ 2OPTA 3SFIA 1VI0A 2M2EA 4EEFG 4D5FA 1JUMA 5J1YA 2EZKA 2LK2A 5FJ8J 1MSFC 2R5YA 3BR2A 4FE4A 4G12A 4B3AA 1MH3A 2DA1A 2Y9YA 2G0EA 1ZR4A 3S2HJ 2EQRA 1I50J 2OF7A 1JKPC 1X2MA 2LVSA 4I6ZA 3S17J 1GUUA 1HLVA 2GLOA 3A01B 2ELKA 2W48A 3GTJJ 3HEFA 4A3CJ 5GPAA 1R9TJ 3DCFA 1BL0A 4UUSB 1AKHB 2GM4A 5F1JA 2E19A 5BNGA 1A6IA 2DMPA 2LP0A 2VPRA 3L1PA 3HOUJ 4XK4A 3G1LA 5IOYA 4I76A 5J3LA 5F0FA 2NS7A 5M5YJ 4CYCA 1GV2A 2Y31A 3OSGA 2HXIA 3O8GA 2NVYJ 5EGOA 4M6VA 2YS9A 1MBFA 4IHYA 2E2HJ 3HOWJ 4D5CA 2L7MP 3F0CA 3QPLA 3M3YJ 3ZQHA 2HOAA 2LKXA 2XPVA 1CQTA 1APLC 1E3OC 2H8RA 4M3DA 2NVTJ 3LOCA 2FD5A 2QCOA 1OFCX 4B1RA 1TWAJ 2N8GA 4XRSG 4DW6A 5IP6A 1TWCJ 3Q3SA 1WGXA 1JJ8C 2EBIA 3JRAA 3HDDA 2L7FP 4AYBN 1BJZA 2JN6A 5FKLA 1MH4A 1WCMJ 3BQZA 2L9RA 1FIPA 1IJWC 2NVQJ 4X1EA 2GBYA 3HB9A 1HCRA 2R5ZA 1B8IB 1Z0XA 4UUTA 2DA3A 2JJ7A 1LE8B 4Y52J 2K9SA 4C3JJ 4QSHA 1WI3A 2E1OA 3E7LA 4XRSA 3B6CA 4C3HJ 3IH4A 1JKRC 4A3FJ 1FTZA 2VKVA 4S0HB 1AU7A 1IRZA 2X6OA 1MBEA 3FK6A 4XICA 1MNMC 4BXXJ 2IBDA 3NAUA 5J1UA 2COBA 5DS9A 2DA6A 2TCTA 2YU9J 2DMUA 3GTPJ 3MVPA 4NDLA 1ITYA 3HKZN 1W0TA 1UG2A 2R7ZJ 5E3NA 2O9LA 1FTTA 1TC3C 1BA5A 2JA6J 1FJLA 3K2AA 5E3MA 1BW5A 4BBSJ 1MBKA 1LFBA 2NOGA 2VKEA 1VF9A 1IGNA 1VNDA 3TEDA 1PUFB
chains in the Genus database with same CATH superfamily
1FLIA 2AXTC 3ZRGA 1KZHA 4ZTJA 3FBNB 3DTIA 5JHFA 5BOXA 1DP3A 3E6CC 3DU6A 1ZARA 3P5JA 4HPQA 3IKTA 1F1ZA 3CTAA 1OCCH 2VQCA 2XROA 1TW3A 2Z3YA 3HUGA 4XN0A 2JRTA 1KU9A 3SZGA 3VPRA 5HLHA 3TBIA 2HDDA 4CICA 2DA5A 2KRFA 4XOTA 4A3IJ 2ZBKA 2E2JJ 4HNVA 2ZMEA 1ETXA 1XCVA 1UELB 1Y1VJ 1K6OA 1FP1D 2NAZA 3GTMJ 2LY2A 2X6WA 2ACJA 4LOCA 1HKQA 2DA4A 1TLHB 4HV6A 4KIBA 3G4SI 4GFBA 4PFOA 3HSFA 2FU4A 3SZPA 1Z77A 2K27A 5CVUA 1BR4A 2ID3A 4AVZA 4A3LJ 1HF0A 1GV5A 5JLWA 2QKMB 2X9DA 1SEUA 5J6XA 1QVTA 2M8GX 3FXLA 2FOWA 1OJLA 1ZQ3P 3IUOA 3WG9A 3NEUA 2HOSA 3U1KA 3ZQIA 4KIGA 1SAXA 3EETA 4HSRA 4WXDA 1FSHA 1FBQA 4YFXF 4LGWA 3MWMA 1NK3P 1RKWA 5M3FJ 2DN0A 1Z6RA 4KNYA 5FLVA 4JX4A 4XL9A 1O4XA 3W6JB 2JSCA 5DD8A 4A69C 5F08A 4HV5A 1SAUA 1XB4A 2MD5A 2E1MC 5FLXK 1P7IA 1O3RA 4LK0F 1G59A 1YTYA 4HEA2 1N78A 3CESA 4IOAF 5DUIA 2ESNA 3R6SA 1B72A 3WTZA 1X2NA 2FNPA 5GTIC 5H2FC 2KIQA 3UKGA 2A07F 2FQ4A 1YX3A 2CUZA 4YFKF 1C0WA 1IXSB 2EV6A 2QSHX 1WJDA 3LA3A 5FKKA 1VFCA 3JREA 2OZ6A 1A04A 3ZMTA 5KAFC 2RKHA 2XPUA 2VLAA 2A6EF 2DJNA 1MBJA 3I4MJ 2HTSA 1GXPA 3FXMA 4I02A 5CQGA 4E7HA 3BWGA 4XKCA 1DPRA 4ZDLA 1I6XA 3RSNA 1E17A 2VBXA 1ZGJA 1R6RA 2XGCA 2QM3A 4B4CA 2QQAA 1AHDP 3AG3H 2VODA 4CH7A 5HODA 3SYTA 2QWWA 3V7CA 9ANTA 2FUG2 5F27A 1N25A 1O3TA 3FIWA 4DYRA 4M3EA 4YELA 1GDTA 4CCJA 2K40A 4J01A 3WGGA 4EJWA 3AFHA 2Q8KA 3RKXA 1U8RA 5HDGA 1YS7A 4K2EA 3FWEA 2R3SA 3MD2A 4HA8A 2ZMEB 2LOOA 2IGOA 2WADA 3EYYA 2CQKA 3OYCA 2E35A 3J7YJ 2R7XA 1DGWY 1XS9A 4G94A 2R7FA 1TBXA 3QPTA 2MYSA 3BR5A 2Q0OA 3GLXA 4GYGA 3WE3A 4PFPA 3FZVA 1SVMA 5EZHA 5LBQA 2IAIA 3NWTA 4BJ5C 3ERMA 3CCYA 4A5NA 3AG1H 3VDXA 2FXAA 1ETYA 1YW9A 2K9NA 1IXRC 3DKXA 2VI6A 4CXFA 2BYVE 1ULYA 2BV6A 2IXSA 4RLQA 5C4XJ 3I71A 4NC6A 2ZC2A 3LSRA 2R92J 3S1RJ 3IH3A 4ENKA 2ZMEC 3CJRB 2MBFA 1KA8A 5FLXZ 4O5VA 3MMYB 1IDYA 4IHWA 4LG0B 5GAGJ 3BG6A 2BY2A 1SMYF 2QQ8A 2A6TA 2FSWA 4HF0A 4RB2C 5ILVA 1B59A 1DU6A 1QQIA 1LFUP 1X4OA 3CUQA 1H0MA 4HNUA 2KT0A 4XSZF 4ZYDA 2QF7A 2BZTA 4OIRF 2ECCA 5GTHC 2OTJI 4NUBA 3RKWA 2DA2A 4BHCA 2EFWA 2MGQA 4BQQA 1PJRA 4KJZA 2B7EA 1FIAA 1K78B 4XBFA 2KHMA 3W2VA 4BXFA 4M3FA 2A5YB 4Q4ZF 3JCUC 1JTXA 3JRDA 3F22A 4L0YB 5J1RA 1D8JA 4RM2A 1AA7A 1O7FA 3BP8A 3OWTA 4F3QA 4R79A 3R0JA 3B6AA 3N97A 3A02A 4P5OA 1VQMI 3DTKA 4QIWN 1KQ9A 4XLPF 1ZK8A 2E71A 2HGCA 2Q2EA 4WXHA 4IZZA 2V1DA 1WPKA 4IEJA 4BBRJ 2KMUA 4BY1J 3JAMK 1F5TA 3H9GA 3F8FA 2JA8J 3FMQA 4EQQA 1LB2A 3FMSA 1ERDA 4HBLA 5E8GA 2ADUA 3S8PA 1I5ZA 3U1DA 4MEYF 1X3UA 3PSIA 1FOXA 2WWYA 3HGGA 4CCOA 2V4JC 3QYBA 3KX2A 2D45A 4DZPA 2CQXA 3RJPA 5GPCA 1G2HA 1JUSA 3F8BA 2OA4A 1U2WA 2GXBA 4G6DA 5AIPA 5EJCA 3OYLA 4G7OF 1J7KA 5TRDA 1TTYA 1MD0A 2UWMA 1VZ0A 3RKYA 1HXDA 5L3GA 2XB5A 1VQLI 5K5RA 4IHVA 3SEQA 4KYWA 1TQIA 1YG2A 1UB9A 2MG4A 2OV7A 2DT5A 2R7QA 1FWZA 3SQNA 1TWHJ 1X58A 2L0KA 3GF2A 3CMYA 5KVRA 1S29A 2YX7A 1NG6A 2P6TA 3GCMA 2PLYA 1K4SA 3H3ZA 5ICFA 3CCSI 2D5VA 3VYRB 2LTPA 3LSHA 3K6GA 2M8EA 2L7ZA 2HVQA 1IF1A 4KICA 2NNNA 3ONQA 3Q0VA 4RAFA 3HTSB 4XLAA 3HOZJ 2V79A 4JYKA 2M0CA 1JKQC 1RNLA 2VOOA 2RAEA 3L2QA 2HYGD 4GXOA 4XIDA 2F5DA 4LB5A 1SVLA 3O6BB 2CS3A 3E5UA 3JW4A 4F92B 1PP7U 1EJ9A 3J7AY 1S8NA 2X48A 3OS0A 1BR2A 4UXNA 3Q9VA 3BOQA 2KISA 2Y0SN 1LVKA 4DYCA 2ZSHB 2CG4A 2BHZA 4M73A 1HW5A 3EDPA 3QU6A 1QA6A 4DYQA 2P7CB 4WWCA 4JK1X 3DEWA 1UFMA 3RKQA 3GTGJ 3KP6A 3G1MA 4DJAA 1FBUA 4RAZA 1SD4A 1R71A 1REPC 1RPWA 1J5YA 1A5JA 3LSKA 3I9V2 4A0XA 2WB1N 1OR7C 1ZG5A 1PUFA 5EDNA 5FRMA 3CQZJ 1B9NA 2OC6A 1RI7A 2I5UA 4KN4X 4U0WA 3J7ZI 5B1AH 3S1NJ 3FXRA 2DDAA 2DDBA 2K3PA 3L2UA 4IRIA 4EEFG 2DK8A 2EILH 3L2CA 2XF6A 1Z7LA 1ZR4A 4UUVA 2XC7A 1I50J 2EB7A 2VJ5A 3HPGA 1MJAA 2OF7A 3WU2C 1X2MA 4CDGA 1TP4A 4B09A 3W6KB 2LVSA 3E5QA 3S32A 4LD5A 3BJOA 4X0GA 4B47A 2ELKA 2GXGA 4A3CJ 1R9TJ 3EUAA 3F23A 1JHHA 3ESWB 4AIHA 4BDYA 3DCFA 3FXJA 2EINH 2P6SA 4Y3OA 1ON2A 1WQ2A 1A6IA 2RC4A 4HYEA 3I58A 3ECHA 4XK4A 3E6BA 5KNLA 3E6DA 3QPHA 4N4NB 2O03A 5F0FA 1BBYA 2NS7A 2DT7B 2WAFA 2OZUA 1GV2A 1FOYA 3OSGA 4LLGF 3C2HA 3O8GA 4HLXA 3GZ6A 1W7PB 4XOPA 4D1QA 3QYFA 1WI9A 3OV8A 4EM0B 2W7NA 3ECOA 1P6RA 2KFDA 4II2A 4AVPA 4IQ4A 4D5CA 1E3HA 5B3SH 1YJWI 3ZQHA 2ZJPF 3GXOA 5IY5H 1A35A 2R7OA 3OYBA 1APLC 3HKZA 4G8XA 2H8RA 2YX4A 3I56I 4IX7A 1MNEA 2VBYA 4B1RA 2J5PA 4B48A 1TWAJ 5J40A 1BC7C 2N8GA 1O3QA 4HX7A 5D5WB 3VODA 5IP6A 4KUMA 4DBRA 1MMAA 1J0RA 1JJ8C 1WGXA 2ZFWA 1X3ZB 4I01A 4M9XA 2HU9A 1S72I 4JBAA 1FYKA 2L9RA 1FIPA 2H6CA 4A0YA 1ZLKA 1XTAA 2IRFG 2GXAA 3HSRA 1HCRA 2R5ZA 1B8IB 3CCQI 1Z0XA 2XRNA 2F4OB 2XSJC 4UUTA 2DA3A 1Z67A 4BU2A 4XONA 2VN2A 2W24A 5IT9K 1LPQA 3K4NA 1TT5B 3OS1A 4E4HA 1IUYA 4C3HJ 3I53A 4S0HB 4RS8A 1R36A 2IBDA 5J1UA 5DS9A 1ZELA 2DA6A 4YFNF 1G3YA 3CJNA 3JTGA 4NDLA 2WB1A 3HOSA 2BEOA 4QWQA 2DCEA 2R7ZJ 5E3NA 1BA5A 4MQ9F 3JSOA 2OAZA 4L0ZB 3L2RA 2LRDA 3KP3A 2K4BA 1PUEE 2BY0A 2VKEA 1KGSA 2L4MA 3CCVI 4BL0B 2Z5UA 4LG0A 5K5OA 4KMUX 1K6YA 2PMHA 1QO0D 2H6BA 3FM3A 3GZNB 3LSPA 4XLNF 2HXOA 3LSGA 3HRMA 3FKIJ 3SZTA 4LK1F 3GTKJ 2X51A 4WK8F 1YS6A 4JOMA 5FKOA 4V2GA 2XKOA 1WH7A 3IAM2 3S16J 1XDSA 3WTUC 1PDNC 2UXXA 3CUQC 2MSYA 3QYEA 3DEUA 4A12A 4RGRA 1JT6A 1XGOA 1VQ8I 2CW8A 2UUZA 3JRFA 3GFMA 2RN7A 4DNCA 1Y39A 2LY9A 1MJBA 1XD7A 1Z9CA 2I8DA 2JWTA 3L2WA 1HW2A 2EIMH 1LQ1A 1I27A 2LKSA 5J8CA 4BKXA 4A0ZA 2R7UA 3CCLI 2VPLA 2DODA 1T33A 1MBHA 3C7JA 1DUXC 2QEXI 3HG9A 4A93J 2DBBA 2X85A 3HOXJ 3DP7A 1JGGA 1VQ9I 1R7JA 3KP2A 1RUOA 1SFKA 2G7UA 2JSPA 5D5XB 1FMVA 4EV0A 3MAJA 5F0HA 1XGSA 2A68F 2W4SA 5FFXA 2E34A 5IT3A 1WRJA 2O8XA 3KLNA 4I98B 1B9MA 1T8IA 3OOPA 3GYHX 1XPXA 2WAEA 5E79C 2H8WA 3GO5A 3TL4X 3ZN0A 5JFRA 1ORKA 3ZMDA 3Q0UA 5LEJA 4OU0A 3V8JA 3LA2A 2UXNA 4FE7A 1E0EA 3ZOBA 1QZEA 2HTJA 4NQWA 2IA2A 4GDFA 2LREA 1R1UA 2OQGA 2TDXA 1R5GA 2ETHA 1WZ2A 5J47A 2ZXJA 4CYDA 4EJOA 1POGA 3KEOA 5CVJA 3JRGA 5BQTA 2EIJH 2QQ9A 4R8HA 2PJPA 2BXZA 1T98A 2O0YA 1YW7A 3ZQCA 1GXQA 4PGGA 4UUSA 3G1OA 4UNOA 2RV8A 1MJ9A 1LEBA 2JUCA 2ECBA 2XHKA 4PJMA 3K4CA 3VYTB 3JR9A 1HDPA 1SVOA 1Y56A 3H92A 1KONA 1OCTC 4M71A 3GX4X 3I64A 3OOUA 3L00A 2O7OA 1GVDA 2E2IJ 3SDGA 2QUFA 5C44J 3CLOA 1PYVA 1WJAA 4F55A 4L5EA 1LDKB 1X1CA 1CF7A 3OYIA 4CGZA 4M9SA 1XG1A 3HSEA 4IPAA 2LNBA 3WGHA 2BW3A 1W5TA 2FJ1A 3AAFA 3ZXSA 2LSOA 4DGWB 4AIDA 3Q9SA 3UNGC 4J00A 1P4AA 2F5VA 2VONA 3MZ8A 2FOKA 4QLCU 5E1XA 3BTJA 2DYRH 2A05A 3KPHA 5HS9A 4U0YA 3CCRI 4W97A 1N75A 3MEXA 1KYWA 2E1NA 2JA5J 4OIPF 3RYRA 3RIRA 1QBJA 2L5QA 4EM1A 3HOYJ 2ELHA 3CMAI 3MN2A 3M4OJ 1L0OC 2JMWA 3G2BA 3O2PE 4MNUA 2XB0X 2AQEA 5F04A 3W2AA 5CVVA 3FM5A 3ZQFA 4I0AA 3K1MA 4BAYA 5F64A 1IG7A 1MNDA 1Z7UA 2H1KA 3PSFA 4O6JA 4EATA 3T8TA 4ZYHA 3I5UA 1I39A 3GWZA 2EPFA 5F1RA 3CJTB 2HKOA 3A01A 3HZJA 2IEKA 4ZJZA 3K0LA 3IV5A 4KISA 2R0QC 1BJAA 3FK7A 2KJCA 4L18B 1IC8A 5IP7J 1Y1WJ 4Y15A 4LITA 3JAMZ 1Z3XA 4XKWA 1ZGWA 3LWFA 2CV1A 4P9UA 1QRYA 1JHFA 3H0GJ 3MZYA 4L9JA 5FFZA 4XN3A 3KZYA 1G3WA 4OWRB 4M3BA 1RESA 1P4XA 1ZRCA 1FNNA 5DTDA 2V1UA 2MLKA 3CZ6A 1R22A 1JT0A 1R58A 4OOIA 4ZZDA 3M9AA 3BROA 3OL3A 2KDZA 1L3LA 1Q1VA 2H94A 4GCVA 2PQ8A 3GTLJ 4P96A 5J4YA 2I10A 1WWXA 1Y6IA 2IS2A 1IRXA 1DGRM 4BY7J 3RPUA 2R7WA 2Y9ZA 4I0BA 1WH5A 5D6EA 1P9QC 3BTIA 1YRNA 1BI3A 4ABZA 2HVSA 1SFUA 3VOEA 2F2EA 3V8KA 1OISA 4LIVA 4C2MJ 2K9LA 4BQAA 3FKJA 4P1WA 3VB2A 2H09A 2DW4A 1WJCA 3G71I 3KYCB 3FISA 4BJ6C 4BE1A 2AQFA 2YU3A 3BJ6A 1W36D 3T8RA 1U9NA 2XAUA 1U3EM 2IVMA 5F0CA 3S93A 1ZKGA 2W84A 5CJ9A 1FBSA 3FHNA 5DM7F 1P2FA 2HI3A 4CO8A 4FT8A 3D5RC 3GBGA 1YYVA 4H0EA 2STTA 3H36A 3NARA 3VYSB 1LE8A 2DO7A 5EEAA 3BY6A 1MIJA 2DTZA 3M8JA 5C3EJ 1EH7A 3WTSC 3K7AJ 4WX9A 2PG4A 2LF8A 2PN6A 2ZJ2A 3ZQQA 1OYWA 3B73A 3LL7A 4ZC3A 2YUSA 2DOAA 2IGNA 3GEZA 4RGXA 2M3AA 2EFPA 4Y33A 3T0YA 5K1YA 2TRTA 4BXUA 1ETQA 3E1SA 3F8NA 2ME0A 1R4NB 4H4KC 3J7AO 5EEHA 1SFOJ 1FSEA 1S7EA 3QOEA 2M5WA 3H3VK 4KA4A 1GHCA 5LRRA 4DBQA 3Q5FA 4FASD 1CGPA 3QWLA 2IT0A 4FISA 2K4JA 3CDLA 5FKMA 4IOCF 1KU7A 3HM5A 3DQVC 3L7WA 4MFEA 4A3EJ 3ASNH 4GRIA 5EG0B 4RB1A 5JLXA 4AYBA 1W5CC 2AO9A 1MGTA 3TP0A 1TWGJ 3ABKH 1ZG1A 1TWFJ 1RR7A 1Y8RB 2L9SA 3KYDB 3GTOJ 3BDDA 2DT6A 2ISZA 2ZFUA 3HL2A 2CJJA 3CCMI 3BTLA 3SDBA 3DBLB 5AIQA 3GTQJ 3H0DA 4MIMA 1H9GA 1YLFA 1K79A 1XCBA 3SJMA 3OYAA 2WV0A 2IW5A 2W25A 4AWXB 4BNCA 4C2UA 1Z3YA 4II3A 4HNTA 3W2WA 3ABMH 2EWNA 4RM3A 2W85A 2JPCA 2OPTA 2M2EA 4D5FA 2LK2A 3CO7C 2R7SA 5B1BH 1Y8QB 4PSXA 4B3AA 2FMYA 1MH3A 3KE2A 3R4KA 3DWLE 1B4AA 2O3FA 3A0BC 5H6RA 2IGMA 3WTVC 3BC8A 3VYUB 3A01B 2Q2EB 2IS1A 2W48A 3EUKL 3HEFA 3ISPA 5B5EC 3PQKA 4QPQA 3ABLH 1FOWA 3PJRA 4BUPA 3CP2A 1AKHB 3DBHB 1Y0NA 5BNGA 4BGDA 3IRRA 3PIOF 2LP0A 2VPRA 3L1PA 3HOUJ 3WE2A 3IL2A 3ZMZA 4I76A 5DCFA 3W3CA 2IPQX 2KL4A 2X4HA 5DEQA 1ZG3A 2VQLA 2XV4S 2UZKA 2CW7A 2NVYJ 3EUHA 4M6VA 3I59A 4KT6A 1R1TA 2JRMA 1T95A 2VQGA 1WJBA 1AOYA 1VQKI 1U5TC 3M3YJ 1VQ5I 2ZXIA 4IJAA 2IS6A 2LBFB 2MD0A 2RDPA 3DF8A 2HOAA 4FETA 2FA5A 1CQTA 1BR1A 1E3OC 4B3XA 2NVTJ 3ZP5A 4L5IA 3VFZA 2VL8A 5ED4A 3OYMA 2FD5A 2QCOA 2ELJA 3DBRB 5L3FA 4BQNA 1UJ8A 2VB6A 3CUQB 4GYIA 4DW6A 3HRUA 1TWCJ 1K4TA 3OYHA 2GIZA 4G9YA 4ZDOA 2PMZA 2GA2A 2L02A 2M7AA 5LGNA 3QAHA 4HW0A 3JRAA 2VQHA 1SC7A 4AYBN 3A0HC 1BJZA 5J8FA 5IT9Z 5FB2A 1VQOI 1QPMA 2L54A 3TOBA 5FKLA 1MH4A 3BQZA 3TGNA 1IJWC 2QENA 1UZCA 2HKXA 4X1EA 3F21A 4ON0A 2GBYA 4XKVA 2WAQA 1A36A 1V3FA 1DP7P 4KITB 4NC7A 1LE8B 3VSLA 3HJEA 2K9SA 4ZH4F 4QSHA 2NNYA 2E1OA 3F6OA 3ELKA 3HYIA 5E20A 4XRSA 3F8MA 3IH4A 2F5CA 1X1DA 3M07A 3SFZA 1U5TA 3OYDA 2VKHA 2CFOA 3F72A 3FK6A 4XICA 4U0VA 1X19A 1VQ7I 1YJ9I 2TCTA 2YU9J 3ZMVA 5LGTA 3GTPJ 1UHWA 3CJQB 1YO5C 1S7OA 2BVLA 1KU3A 1TC3C 2O9LA 3BPVA 1W1WE 2F4IA 2M4GA 1R00A 1FJLA 3K2AA 5E3MA 2R7RA 1W36C 1LFBA 1J09A 2NOGA 5FROA 4N9HA 1VNDA 3V8LA 1HKTA 3TEDA 3S3MA 3TW6A 3ASOH 2JZYA 3S1QJ 4CCKA 1IV6A 2V1NA 1YRNB 2CW0F 1RRJA 5DM6F 2M87A 4XR6A 3P9KA 3LNQA 3P9CA 1MDMB 1K83J 1IZ1A 3F8CA 2L2OA 5AONA 3L09A 1XSVA 2VXDA 2QA4I 2HS5A 2OD5A 2V6EA 1BI2A 2L9NA 2X6XA 3FDYA 1ZTRA 2VE9A 4FHTA 2DFEA 2HYJA 2HYFA 2Y0SA 5K7ZA 1WJEA 3QRFF 1T6SA 2QVOA 3MFKA 1IDZA 2OQRA 5DYMA 3DKWA 2L01A 3K1NA 3LQQA 4XKBA 4EM2A 3OYKA 2E7WA 4IHSA 1QVUA 5A2QK 1P92A 3AKZA 2O8KA 2IJLA 5FD5A 3KEQA 5IOZA 2LKPA 2NS8A 3TP3A 2K85A 5DD4A 1G3TA 5FO5A 3GMEA 4F7ZA 4OMZA 1MMDA 2QSGX 1W0UA 3M1EA 2KIFA 2V1XA 1RETA 1NG7A 4IHXA 2EJRA 3IKVA 2DI3A 4IVNA 4QPOA 2Y30A 3NRVA 4XLEA 4E70A 4EMSA 2XGXA 3S3NA 2FE3A 4BS9A 3GVAA 2KRHA 3E3VA 3PNVA 5D4SA 3QQAA 2P5KA 4X6AJ 1BM9A 5TISC 2FQ3A 2V9VA 2ZCWA 2MH9A 2ZO4A 3PUFA 3PNYA 2FF4A 2NS0A 4A6EA 5EG0A 3WTYC 2HDCA 1F36A 5IYCJ 1FYLA 1JGSA 3N05A 2E1CA 3GLLA 3LSTA 4P9FA 5ICGA 2K86A 4E7ZA 2V6CA 1MMSA 1T2KA 2M0MA 3CUOA 1HSJA 5ILSA 1USSA 4PUSA 4ASNA 2Z9OA 2KQRA 2VBZA 2WY8Q 3U21A 1X1BA 4OINF 3HOVJ 1E3PA 4NNJA 4WF2A 3P7NA 1ON1A 4Y4RA 5L3DA 1ETKA 1I3AA 4YIIA 1JUPA 4EGYA 4V2FA 1GLNA 5LHGA 3SXYA 4MTDA 2RGVA 1XSDA 4QTRA 4XSXF 3BTCA 2VJ4A 4LLLA 2VUMJ 4A3GJ 2R5YB 2Y0MA 1ENHA 5GP9A 1HBXG 4E7JA 3MQ0A 1D8KA 1BW6A 4YIFA 3L2VA 4Y13A 4BE0A 3QPSA 2XSDC 2LDUA 2OJED 2HFHA 3QOPA 1IN5A 2DMNA 3EYIA 2LG4A 3MZHA 1S7AA 1G6NA 3RCOA 2CUFA 4U7DA 4NBQA 3BG7A 3RZOJ 4OAZA 2G7HA 1X1AA 1K7AA 4PSWA 1JJ6C 5K5QA 3I4NJ 1RC9A 1LUJB 3K10A 4C30A 5JVGF 4RMNA 4MQVA 4EJTA 3K1PA 2JVHA 4L9NA 3KZIC 1D5YA 3BG5A 2XAHA 2HR3A 3TOAA 2CQNA 1FMWA 4BDZA 2ZKZA 5IP9J 3BR1A 3T1BA 3OYFA 1STZA 4V19K 2EZLA 3OL4A 1MW7A 4C3IJ 4XM3A 5IYDJ 4YEJA 1QPIA 2BHYA 2JK3A 1BI0A 2QKLB 4M3GA 5DCMA 1XC5A 1RR8C 2IP2A 2WAQN 3MKZA 4HX4A 1T0FA 2M30A 4LJZF 3H9QA 1XDUA 1MMGA 3E6MA 5LHIA 5LHHA 3K4KA 1ZH5A 3ZGKA 1WJ5A 2YPRA 1OCOH 4XLFA 4IRGA 2PI0A 3K2ZA 3SHFA 4HX8A 2OTLI 5EYRA 3TDZC 4ESBA 2GQQA 5HNFA 1AWCA 3DPLC 2XGDA 4BQOA 5L3EA 1MBGA 4Z2YA 3HTUA 2ZJRF 4E7LA 2XF7A 4ESFA 2Z16A 4GO1A 1JXSA 4MLOA 4HQMA 2A6HF 4LLNA 1U5TB 1EV7A 3IH2A 1OCRH 4A3JJ 2FX0A 4BH9A 3RYPA 2VT3A 5EEGA 5E17F 2ME6A 2A61A 1HKSA 4PK4A 1I6HJ 3CDHA 3C18A 4UVAA 4HQEA 1K78A 2RNGA 3TO6A 3OMYA 4AC0A 1ONVA 1OCZH 1IN7A 2R4GA 5EZGA 4FQGA 2XPWA 1V4RA 3D1NI 3D0SA 4YIRX 4AIKA 2M1BA 2JA7J 5E3OA 3M8FA 4HRIA 3FXUA 3J81K 1NH3A 1ACIA 2XKPA 1R5ID 4U88A 1FYMA 2BBYA 4AIJA 1S5LC 4D7NA 1SD5A 3RTRA 4CUGA 1D1AA 1LDJA 1YX5A 2JTVA 3M7GA 3BG3A 2IS4A 2YSRA 3K4JA 3RQ4A 5J4VA 3H9JA 4BHBA 4B43A 4DZJA 4BEHB 2LLKA 4ENJA 3JRCA 3E0JB 1ZAOA 1WHUA 5HLTA 3WTTC 4OIQF 1LFPA 1T08B 1J2XA 3JRBA 3J80K 2XGEA 2COMA 4TV7A 3K69A 4PJNA 3GW2A 3JRIA 5ICCA 4F52A 2CV2A 4OIOF 1W7PA 1ZGAA 1VQ6I 4FX0A 1U9OA 1LVAA 3OY9A 4CHUA 1WVRA 2R93J 1XMKA 3K70D 2XAFA 5HLGA 2A69F 1TNSA 2HZDA 3KEYA 2RREA 4IXAA 4MFDA 1BOAA 4G6QA 1T56A 2VKDA 3HIFA 5BS6A 2EV0A 1YFHA 3DU5A 3UR3C 2JPBA 2HOEA 2R5ZB 2BOLA 2MLGA 1JE8A 5LGUA 3VSKA 3SEZA 2XUBA 4JP0A 2QQBA 5K7HA 2HDWA 3QP6A 4G7HF 3OIOA 4S05A 2P0WA 3WGIA 1IV8A 1UG0A 4R1HA 3HOTA 2M7BA 2Y2ZA 3V7SA 2CGPA 3IC7A 1ZHFA 2DPDA 1BN5A 4MO7A 5E8IA 5FRNA 5D4RA 2HOTA 3LSMA 3AL0B 1ZLJA 5EF6A 2AXLA 2OU2A 3S15J 4BE2A 1YHQI 3S14J 5BMZA 2JT1A 4E7SA 2L3DA 2CUEA 3E5XA 3DEEA 3H35A 5HLIA 2QGUA 3WU1B 4E7IA 1QZYA 2KJBA 2XASA 5M3MJ 3COAC 2STWA 2A3SA 2KRCA 3KIOA 5TJJA 3J81Z 2E5ZA 3A4CA 3KP5A 1H88C 4IKFA 4M74A 4G7ZF 3S3OA 2Y48A 1DQUA 5IPAA 2HNHA 3G73A 1HC8A 4HZFA 4PDKA 1YIOA 3MKWB 2X0LA 3SFIA 1VI0A 5LRSA 5FGMA 1F4KA 3LMMA 2EZKA 4XMYA 5FJ8J 1FP2A 2UV1A 1MSFC 2HEOA 3BR2A 2PMUA 4FE4A 4G12A 4RGUA 4ZYAA 2G0EA 2EQRA 3BZCA 1MMNA 1WJFA 1IRGA 3ML6A 4I6ZA 3S17J 1GUUA 1HLVA 2CYYA 1GVJA 2Z33A 3GTJJ 1EH8A 2QLZA 4RB3C 3J80Z 3IWFA 2WC2A 3DXJF 3IP4B 2HPMA 1BL0A 3K4LA 4UUSB 2VOPA 5F1JA 2E19A 2NVUB 2P5VA 2DMPA 2LC2A 4IRHA 4PGHA 1OYYA 5IOYA 2J5OA 1ZRDA 2KKOA 2V26A 4ENMA 5J3LA 5CQEA 2OBPA 3CP8A 2E7XA 5M5YJ 3I54A 2Y31A 4CYCA 4KDPA 3G6EI 2HPIA 4A5MA 3PFYA 1TL8A 1RZ4A 2EIKH 2ISYA 1MBFA 2V9KA 4KIFA 2FBHA 2CUJA 4PJLA 2E2HJ 1DPUA 3RI4A 2L7MP 3F0CA 4AD9A 3QPLA 2CQ7A 1V5EA 3V42A 5JI6A 1ZREA 5LD2C 4JQFA 1D3YA 5D5UB 4MHGA 3OYEA 4EJVA 1X1PA 1QZZA 1B6AA 5KK1A 2WTEA 3AG2H 1OFCX 1SFEA 3K4MA 4Y17A 2EK5A 2VIXA 4HLYA 3PQJA 2B0LA 2L7KA 3KP7A 3BJAA 2EBIA 5HDNA 3HDDA 4WXCA 5HOOA 4P55A 3KLOA 4ENNA 1UAAA 2VASA 1V54H 2QZ8A 4I7HA 1G3SA 3ERED 3T5XA 4O3MA 1YE9A 5HVQC 1WCMJ 1XSXA 2GA1A 3PUBA 2NVQJ 4IL6C 2FBIA 3I3LA 4A6DA 1VTNC 2CMPA 3HRSA 2JJ7A 4UV8A 4PZJA 5D6FA 1IO2A 4Y52J 4M6YA 4C3JJ 1U0JA 2HQNA 2PEXA 3H3UA 2C6YA 3E7LA 3DPUA 3BCBA 3C2GA 2QBYA 1LNWA 5LFAA 1QHGA 2E1MB 1JKRC 2OUMA 1AU7A 2X6OA 4B44A 1T0FC 3CCEI 4ZZLA 2WBMA 1MNMC 4BXXJ 1D5VA 3KCCA 3D5SC 3WODF 3E97A 1TZLA 2DMUA 4ZDPA 5D8KB 1S9HA 3HKZN 3FBIB 1W0TA 5HS8A 2BY3A 5FD6A 1FTTA 1QGPA 2MA3A 2ICWG 3R0AA 3LSIA 5JR3A 2JA6J 3IRQA 2R7DA 1BW5A 4BBSJ 4KN7X 1MBKA 2IA1A 3G3ZA 2VC0A 3ZMSA 1VF9A 3N4MA 4UVCA 1PUFB 1BC8C 1UMQA 4ESJA 2RQPA 2JVGA 1GT0C 4YG2F 3FXKA 2VC1A 1R4MB 1EA3A 4BACA 3HC7A 1OPCA 2MW8A 1TW2A 1MZBA 1O57A 2MC3A 4UHTA 2M45A 4A2UA 2AS5F 1OMIA 2ZB9A 4CYCB 3K70C 1CF7B 5A2QZ 2Q1ZB 3F3XA 3ZN1A 3JRHA 4U7BA 4NHJA 4RAGA 4UVBA 2BW3B 1YW8A 4BEHA 1UHSA 1ETWA 3PIPF 2LH9A 3M1CA 1O3SA 2A5WA 2CO5A 2XVCA 3DLLF 5HNHA 1NK2P 3OIQA 4RA2A 5DV5A 2NVXJ 2R7VA 2HVRA 2NOJB 1I3QJ 2KPMA 3REOA 3X2QH 3WTWC 3LFUA 1SANA 2Z99A 2RQQA 1DDNA 1YOVB 3PO2J 3CC7I 3BCAA 1PVEA 2BE5F 3A03A 5KHDA 4UV9A 4PJ0C 3CD6I 4FCYA 2X1DA 3ZQGA 2DMQA 2ZSIB 6PAXA 5TGTA 4ETSA 1FX7A 3H5RA 4LMYA 1P7JA 4FTHA 1RKTA 1XMAA 3ROUA 3I4PA 3BZ6A 3HGYA 2O61A 2K7LA 4NQWB 2O5RA 3ZQLA 3ZCOA 3VWBA 2GOMA 4Q5SF 2DOEA 2CFXA 2M4KA 2CSOA 2XRLA 3QP5A 1OKRA 4RLFA 5CYVA 1IXCA 2AHQA 1WSUA 2OCEA 1U78A 4EJUA 3CCUI 2P4WA 3BZKA 1TQPA 5E1ZB 5B66C 2GZWA 4L9VA 3GFLA 1YI2I 1OR7A 1R1VA 1T38A 1OYIA 1YJNI 5K7FA 2BGCA 1UHMA 4AM3A 2XAGA 2KDOA 1W4MA 4CZZA 1IUFA 2CRGA 2EFQA 2IA0A 2VT2A 5CPRB 5HDKA 4A3KJ 4DQ2A 1XMXA 4XLCA 1J75A 3HHGA 2RVCA 1TQMA 2P7VB 3BR0A 2DFIA 3BQYA 2PX9A 1IAWA 2D2WA 1HSTA 1ZYRF 1YQAA 4C2TA 3LQRA 1NTCA 2HQRA 1B1BA 2DAOA 3OSFA 3EUHC 3P9IA 2QYOA 3I0TA 2OCCH 1YIJI 3K4BA 5DUKA 3Q0WA 4UB8C 3L9FA 1HQCA 2MFZA 3DTEA 4BJTA 4OMYA 3JTHA 5GADJ 2EH3A 1KYZA 2K02A 3FMRA 1AKHA 2VJJA 4N9IA 3OYGA 1FOKA 3DFGA 4XRMA 5CVRA 4RBOA 3TKYA 2QSFX 3KETA 3W6VA 2KP6A 1OLTA 4ZYEA 2VXZA 3U2RA 2EZIA 3LSJA 1JI8A 3KP4A 4N4OB 1P4WA 1HDDC 2BXYA 1U8BA 1VQNI 2EZHA 4XORA 3C2BA 2X1CA 4B8XA 4N0BA 2F5EA 1D1BA 3BT9A 3TW7A 3A1YA 3ZMUA 3PO3J 1XX5A 4Q47A 3RZDJ 2PJRA 1OCPA 3S2WA 1TNTA 1IRFA 2GOXB 3AG4H 4XLHA 2QBYB 1D0ZA 1MDMA 2O6GE 3IAS2 3C3WA 4HDUA 2EFNA 1R49A 4D7MA 2Y69H 2JA2A 2HQAA 2W00A 3OR1C 3PL8A 2L4AA 2X6YA 2YR2A 3ZR8X 4GGGA 3ZQ7A 1BIAA 5E18F 4JX5A 1W7PD 2XIGA 3GZ5A 3RPQA 3BR3A 1WKMA 3RDIA 4RGSA 2LR8A 4F91B 2LD5A 2DMTA 2DFFA 1QU3A 3MKLA 1HA8A 2NXNB 3CCJI 2B9SA 2LYCA 1X3WB 3DLAA 3BR6A 3FXOA 1FEXA 3ABTA 2BVMA 4DOZA 1ZRFA 1KQ0A 4AUXA 2KIMA 4Y7NJ 3WHCA 1IW7F 2IGKA 5JHUA 4HOBA 1ETVA 2MC4A 5FKNA 2DOFA 3F6VA 4LG3A 3U9GA 3K9TA 2G9WA 3O8HA 4A3MJ 4LIUA 4W1UA 1SD6A 1A6QA 2CV0A 1BI1A 1ODDA 1ETOA 3FXQA 3TQNA 2DYSH 1EKEA 1ZR2A 4E7KA 1LKXA 1M1EB 1DU0A 3CF5F 4KFCA 1JTYA 5E1WA 3I59B 1XGMA 3WTXC 3F9KA 3DKYA 3WHBA 4MEXF 4CCNA 3WU0A 3CC4I 2ID6A 3S2DJ 2LFBA 1H89C 4M9ZA 5E3LA 1FC3A 4XRFA 5KAIC 5FLMJ 5JVTA 4HAMA 4RDUA 3PFIA 3FHZA 1HW1A 2XDVA 5BPDA 3C1DA 1KU2A 4OAYA 4E6KG 1V5GA 2EA4A 4CZCA 3H5AA 2F5FA 2WY7Q 4JX6A 4MGRA 3ZPLA 3WG7H 3HBLA 3OYJA 1R5HA 1LJ9A 5M5XJ 4MTEA 4F93B 3H1CA 3LFKA 1V55H 2PBIA 1YITI 3AL0C 4WCGA 2JQ7A 3CF2A 2P81A 2DTRA 2FBKA 1HOMA 2VE8A 3B02A 4IHTA 1XGNA 4I99C 1A31A 3RPUD 3CMMA 3H5NA 1I1GA 2F4MB 4BHPA 4RB0A 1LEAA 2X1EA 4UB6C 2DXIA 3CLQA 3MKYB 4AU7A 2B63J 2DK5A 5HS7A 4ZTFA 1B72B 1W5SA 1RUNA 3MCZA 1LDDA 2DQLA 2V7FA 4XNFA 2LF7A 3I55I 3V4GA 2XF5A 5EGOB 2P5LC 4I2OA 1Z1DA 2DA7A 5ILUA 1I1SA 3LAPA 3BPXA 2CWEA 3HRTA 4A3DJ 3RQIA 2LY1A 4S04A 5L3BA 1EF4A 3OS2A 3S1MJ 3PM1A 3IWZA 5CVIA 3O3KA 2CU7A 5C4JJ 1BIBA 3CMEI 3TDUC 3KZZA 2CQQA 2VJIA 4A3BJ 3HHHA 4J19A 1XN7A 1UCRA 4HF2A 2DPUA 2GAUA 4L5JA 2WV1A 2E5NA 2V9PA 3ULQB 4KMFA 3GFJA 5IYBJ 1F43A 5ICEA 2ZNYA 1H8AC 4U87A 3GUDA 4KT5C 2D1HA 5LEKA 4I09A 4IF4A 3FX3A 3NQOA 1J59A 4CCLA 3BG9A 2R7TA 2KZVA 2FRHA 5F6FA 2CH0A 4CSWA 2K9QA 4HG2A 2E36A 3BLYA 2M34A 4BYYA 2ZXWH 5CLSA 1JKOC 5M5WJ 3OR2C 2HQ5A 2H27A 3DV8A 2M9HA 3DPTA 3HPHA 3QU3A 4ZYGA 1D1CA 2F6CA 2W1OA 4HSTA 1K61A 3EPZA 1S6LA 1B8IA 2PMZN 3CO6C 1WFXA 4Z6YA 1BOBA 2E60A 5H20A 4ITVA 3VEPA 3OYNA 1MSEC 1T39A 2KIUA 2K5CA 3HXLA 1JUMA 5J1YA 1MKMA 1USTA 3HUGB 1Y0UA 2R5YA 2DA1A 2Y9YA 2FEZA 3S2HJ 2PFBA 1VQPI 2VBWA 4PCQA 1N77A 1JKPC 1V5FA 3OIPA 1RIOH 4DIQA 2GLOA 1VQ4I 2JUGA 2Y75A 5GPAA 4FX4A 2NYXA 5BPIA 1FY7A 4ANJA 2Z1DA 4M72A 1SD7A 1QNTA 4YRVA 2MABA 5D5VB 1Q1HA 2GM4A 2PJRB 1EH6A 1Z91A 1TT0A 3G1LA 3QODA 2LBFA 2P8TA 2EA2A 1Z6TA 4IO9F 1Z21A 4XQFA 2HZTA 4NB5A 4HDVA 1IN8A 2GWRA 1KQ8A 2HXIA 1H9TA 5DCMB 2H1LA 5EGOA 2YS9A 4IHYA 4HF1A 2DQRA 4CA0A 3HOWJ 4D9JA 2ZNZA 1G8XA 5DDGA 2BY1A 4RAYA 2KLOA 1F9NA 2GIVA 5GAEJ 4IQJA 3IHUA 3PNTA 2LKXA 1O7LA 4LB6B 2XPVA 2NRAC 1Z05A 2FNAA 1FPQA 3LA7A 1SFXA 4M3DA 3KFWX 3LOCA 1U6GA 5KCMA 4G6TB 3CDIA 4XRSG 2EV5A 2KZGA 3A2KA 3ABUA 4Q48A 3CC2I 3TO7A 2LMDA 3TO9A 3Q3SA 5D8LB 2MH2A 3R61A 2L7FP 1SMTA 2JN6A 2L9VA 5ERIA 1QHHD 5L3CA 2XAJA 3LAJA 2RNJA 2EFOA 5LLQA 1X4PA 1NHAA 3HB9A 3EQLF 4M6XA 4C9YA 1FT9A 3NWSA 4D0PA 1J9IA 2HWVA 3FF5A 4NC8A 4PJJA 3M8EA 2F48A 4EGZA 1PP8F 1WI3A 2Z2SB 1R23A 3B6CA 2DJIA 2FMLA 2K3FA 4A3FJ 1S3JA 3V7RA 1FTZA 2VKVA 2DLLA 2ZJQF 4CCMA 1IRZA 1MBEA 2K9MA 1D0XA 2D1VA 3D5LA 3NAUA 2W57A 2COBA 1OQYA 3R60A 1IN6A 5GAHJ 2W82A 2ESHA 4LFUA 2DFHA 3MVPA 1ITYA 2XAQA 1UG2A 5H6QA 2ZXHA 1E2XA 4UY8I 3TMOA 4EVIA 5CKTA 4L9TA 3KYLA 1G4DA 1IN4A 2WA0A 3JSPA 1ZN2A 2DU9A 3GFIA 1IGNA 1D0YA 1FZPB
chains in the Genus database with same CATH topology
3TW6A 1UMQA 3LSPA 1GT0C 2HXOA 3LSGA 1IV6A 1YRNB 3FKIJ 3S1QJ 3GTKJ 2MW8A 3LNQA 5FKOA 4V2GA 1K83J 1WH7A 3S16J 2ZB9A 3VPRA 4CYCB 2MSYA 2HDDA 2DA5A 3JRHA 4A3IJ 2E2JJ 4HNVA 1JT6A 1UHSA 1ETWA 1ETXA 1ZTRA 1Y1VJ 3JRFA 2HYJA 3GTMJ 1NK2P 2NVXJ 5K7ZA 2LY9A 4LOCA 2DA4A 4GFBA 1I3QJ 2JWTA 1IDZA 1SANA 1Z77A 4BKXA 2ID3A 1QVUA 4A3LJ 3PO2J 1HF0A 2O8KA 1GV5A 1T33A 3A03A 1MBHA 5JLWA 5IOZA 2X9DA 4FCYA 1QVTA 2M8GX 2NS8A 3TP3A 3ZQGA 2DMQA 4A93J 1OJLA 3HOXJ 1ZQ3P 2HOSA 1JGGA 1W0UA 3ZQIA 1RETA 1P7JA 4IHXA 4FTHA 5F0HA 1RKTA 1NK3P 1RKWA 2Y30A 2DN0A 3HGYA 5M3FJ 5FLVA 4JX4A 3ZQLA 1O4XA 3QQAA 2XRLA 4A69C 5F08A 4X6AJ 2AHQA 1U78A 1P7IA 5EG0A 1F36A 5IYCJ 1ORKA 3Q0UA 1B72A 1X2NA 3UKGA 4FE7A 5K7FA 2FQ4A 3ZOBA 5FKKA 1IUFA 1VFCA 3JREA 2XPUA 2CRGA 3HOVJ 4A3KJ 2DJNA 1MBJA 3I4MJ 1POGA 1ETKA 3JRGA 3BR0A 3BQYA 1JUPA 4V2FA 1NTCA 3OSFA 3ZQCA 2XGCA 4QTRA 4B4CA 4UUSA 1AHDP 3BTCA 3G1OA 3Q0WA 5HODA 2VUMJ 4A3GJ 2R5YB 2ECBA 1ENHA 5GP9A 9ANTA 3JR9A 1BW6A 1HDPA 5F27A 2EH3A 1OCTC 3QPSA 3FIWA 2XSDC 4DYRA 1AKHA 4M3EA 3OOUA 2E2IJ 2O7OA 1GVDA 1GDTA 3SDGA 2DMNA 4XRMA 2K40A 5C44J 4RBOA 4L5EA 2CUFA 3W6VA 1XG1A 3RZOJ 2EZIA 3LSJA 1HDDC 2FJ1A 1JJ6C 1U8BA 2EZHA 3C2BA 1XS9A 3I4NJ 3BT9A 3BR5A 3TW7A 3BTJA 3PO3J 5EZHA 1D5YA 2IAIA 3BG5A 3RZDJ 3CCYA 1OCPA 4W97A 5IP9J 3BR1A 1ETYA 2K9NA 2VI6A 2EZLA 2JA5J 4C3IJ 4D7MA 5C4XJ 5IYDJ 3LSRA 1QPIA 2R92J 3HOYJ 2JK3A 3S1RJ 3M4OJ 3IH3A 3MN2A 4M3GA 1XC5A 2JMWA 1IDYA 4IHWA 2WAQN 2XB0X 5F04A 4JX5A 3ZQFA 1DU6A 1LFUP 1IG7A 2H1KA 2KT0A 3BR3A 2QF7A 2ECCA 2LR8A 2DA2A 2LD5A 2DMTA 2MGQA 3A01A 5EYRA 3MKLA 2IEKA 1FIAA 3IV5A 2XGDA 4M3FA 2R0QC 1MBGA 3FK7A 3BR6A 1JTXA 5IP7J 3JRDA 1IC8A 1FEXA 1Y1WJ 5J1RA 4AUXA 4MLOA 4Y7NJ 3WHCA 1ZGWA 1QRYA 1ETVA 5FKNA 3B6AA 3IH2A 3H0GJ 4A3JJ 3O8HA 4A3MJ 3A02A 2FX0A 4W1UA 4QIWN 1ETOA 2ME6A 1DU0A 1ZK8A 1ZR2A 1I6HJ 4M3BA 1RESA 5DTDA 1JTYA 1JT0A 3WHBA 4AC0A 2KDZA 1Q1VA 1WPKA 4IEJA 4BBRJ 2ID6A 5EZGA 3S2DJ 2LFBA 2XPWA 4BY1J 1H89C 5E3LA 3GTLJ 3D1NI 2JA8J 2I10A 5FLMJ 2JA7J 5E3OA 4RDUA 4BY7J 2Y9ZA 1WH5A 3HGGA 3BTIA 1YRNA 4ABZA 4DZPA 4JX6A 2CQXA 5GPCA 4C2MJ 1G2HA 1JUSA 3HBLA 4D7NA 5M5XJ 3BG3A 3FISA 2P81A 1U9NA 4DZJA 2XB5A 1HOMA 5F0CA 1ZKGA 4IHVA 2LLKA 3JRCA 2HI3A 2MG4A 3GBGA 2B63J 1TWHJ 1X58A 3JRBA 1B72B 2L0KA 2XGEA 3NARA 3CMYA 1LE8A 5EEAA 3JRIA 2DTZA 5EGOB 1U9OA 2DA7A 5C3EJ 2D5VA 2LTPA 3K7AJ 2R93J 2L7ZA 4A3DJ 4MFDA 3RQIA 3Q0VA 1T56A 2YUSA 3HOZJ 1EF4A 3S1MJ 3PM1A 2TRTA 1ETQA 2R5ZB 4JYKA 2CU7A 2M0CA 2ME0A 1JKQC 4JP0A 2RAEA 5C4JJ 5K7HA 1SFOJ 1S7EA 4XIDA 3OIOA 3H3VK 2CQQA 4A3BJ 4J19A 2X48A 2WV1A 4FISA 3CDLA 5FKMA 2Y0SN 2Y2ZA 3HM5A 4MFEA 5IYBJ 4A3EJ 1F43A 5EG0B 4DYCA 5JLXA 1H8AC 4MO7A 2AO9A 3TP0A 1TWGJ 1TWFJ 2HOTA 1RR7A 4DYQA 5EF6A 3GTOJ 3BG9A 3S15J 3S14J 2CJJA 3DEWA 3BTLA 2CUEA 3RKQA 3GTGJ 2K9QA 3G1MA 2M34A 5M3MJ 3GTQJ 1JKOC 5M5WJ 1RPWA 2HQ5A 1A5JA 2M9HA 4MIMA 2WB1N 1H88C 1K61A 3SJMA 1PUFA 5EDNA 1B8IA 2PMZN 5IPAA 3CQZJ 1MSEC 3S1NJ 2OPTA 3SFIA 1VI0A 2M2EA 4EEFG 4D5FA 1JUMA 5J1YA 2EZKA 2LK2A 5FJ8J 1MSFC 2R5YA 3BR2A 4FE4A 4G12A 4B3AA 1MH3A 2DA1A 2Y9YA 2G0EA 1ZR4A 3S2HJ 2EQRA 1I50J 2OF7A 1JKPC 1X2MA 2LVSA 4I6ZA 3S17J 1GUUA 1HLVA 2GLOA 3A01B 2ELKA 2W48A 3GTJJ 3HEFA 4A3CJ 5GPAA 1R9TJ 3DCFA 1BL0A 4UUSB 1AKHB 2GM4A 5F1JA 2E19A 5BNGA 1A6IA 2DMPA 2LP0A 2VPRA 3L1PA 3HOUJ 4XK4A 3G1LA 5IOYA 4I76A 5J3LA 5F0FA 2NS7A 5M5YJ 4CYCA 1GV2A 2Y31A 3OSGA 2HXIA 3O8GA 2NVYJ 5EGOA 4M6VA 2YS9A 1MBFA 4IHYA 2E2HJ 3HOWJ 4D5CA 2L7MP 3F0CA 3QPLA 3M3YJ 3ZQHA 2HOAA 2LKXA 2XPVA 1CQTA 1APLC 1E3OC 2H8RA 4M3DA 2NVTJ 3LOCA 2FD5A 2QCOA 1OFCX 4B1RA 1TWAJ 2N8GA 4XRSG 4DW6A 5IP6A 1TWCJ 3Q3SA 1WGXA 1JJ8C 2EBIA 3JRAA 3HDDA 2L7FP 4AYBN 1BJZA 2JN6A 5FKLA 1MH4A 1WCMJ 3BQZA 2L9RA 1FIPA 1IJWC 2NVQJ 4X1EA 2GBYA 3HB9A 1HCRA 2R5ZA 1B8IB 1Z0XA 4UUTA 2DA3A 2JJ7A 1LE8B 4Y52J 2K9SA 4C3JJ 4QSHA 1WI3A 2E1OA 3E7LA 4XRSA 3B6CA 4C3HJ 3IH4A 1JKRC 4A3FJ 1FTZA 2VKVA 4S0HB 1AU7A 1IRZA 2X6OA 1MBEA 3FK6A 4XICA 1MNMC 4BXXJ 2IBDA 3NAUA 5J1UA 2COBA 5DS9A 2DA6A 2TCTA 2YU9J 2DMUA 3GTPJ 3MVPA 4NDLA 1ITYA 3HKZN 1W0TA 1UG2A 2R7ZJ 5E3NA 2O9LA 1FTTA 1TC3C 1BA5A 2JA6J 1FJLA 3K2AA 5E3MA 1BW5A 4BBSJ 1MBKA 1LFBA 2NOGA 2VKEA 1VF9A 1IGNA 1VNDA 3TEDA 1PUFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW6 A;  1UMQ A;  3LSP A;  1GT0 C;  2HXO A;  3LSG A;  1IV6 A;  1YRN B;  3FKI J;  3S1Q J;  3GTK J;  2MW8 A;  3LNQ A;  5FKO A;  4V2G A;  1K83 J;  1WH7 A;  3S16 J;  2ZB9 A;  3VPR A;  4CYC B;  2MSY A;  2HDD A;  2DA5 A;  3JRH A;  4A3I J;  2E2J J;  4HNV A;  1JT6 A;  1UHS A;  1ETW A;  1ETX A;  1ZTR A;  1Y1V J;  3JRF A;  2HYJ A;  3GTM J;  1NK2 P;  2NVX J;  5K7Z A;  2LY9 A;  4LOC A;  2DA4 A;  4GFB A;  1I3Q J;  2JWT A;  1IDZ A;  1SAN A;  1Z77 A;  4BKX A;  2ID3 A;  1QVU A;  4A3L J;  3PO2 J;  1HF0 A;  2O8K A;  1GV5 A;  1T33 A;  3A03 A;  1MBH A;  5JLW A;  5IOZ A;  2X9D A;  4FCY A;  1QVT A;  2M8G X;  2NS8 A;  3TP3 A;  3ZQG A;  2DMQ A;  4A93 J;  1OJL A;  3HOX J;  1ZQ3 P;  2HOS A;  1JGG A;  1W0U A;  3ZQI A;  1RET A;  1P7J A;  4IHX A;  4FTH A;  5F0H A;  1RKT A;  1NK3 P;  1RKW A;  2Y30 A;  2DN0 A;  3HGY A;  5M3F J;  5FLV A;  4JX4 A;  3ZQL A;  1O4X A;  3QQA A;  2XRL A;  4A69 C;  5F08 A;  4X6A J;  2AHQ A;  1U78 A;  1P7I A;  5EG0 A;  1F36 A;  5IYC J;  1ORK A;  3Q0U A;  1B72 A;  1X2N A;  3UKG A;  4FE7 A;  5K7F A;  2FQ4 A;  3ZOB A;  5FKK A;  1IUF A;  1VFC A;  3JRE A;  2XPU A;  2CRG A;  3HOV J;  4A3K J;  2DJN A;  1MBJ A;  3I4M J;  1POG A;  1ETK A;  3JRG A;  3BR0 A;  3BQY A;  1JUP A;  4V2F A;  1NTC A;  3OSF A;  3ZQC A;  2XGC A;  4QTR A;  4B4C A;  4UUS A;  1AHD P;  3BTC A;  3G1O A;  3Q0W A;  5HOD A;  2VUM J;  4A3G J;  2R5Y B;  2ECB A;  1ENH A;  5GP9 A;  9ANT A;  3JR9 A;  1BW6 A;  1HDP A;  5F27 A;  2EH3 A;  1OCT C;  3QPS A;  3FIW A;  2XSD C;  4DYR A;  1AKH A;  4M3E A;  3OOU A;  2E2I J;  2O7O A;  1GVD A;  1GDT A;  3SDG A;  2DMN A;  4XRM A;  2K40 A;  5C44 J;  4RBO A;  4L5E A;  2CUF A;  3W6V A;  1XG1 A;  3RZO J;  2EZI A;  3LSJ A;  1HDD C;  2FJ1 A;  1JJ6 C;  1U8B A;  2EZH A;  3C2B A;  1XS9 A;  3I4N J;  3BT9 A;  3BR5 A;  3TW7 A;  3BTJ A;  3PO3 J;  5EZH A;  1D5Y A;  2IAI A;  3BG5 A;  3RZD J;  3CCY A;  1OCP A;  4W97 A;  5IP9 J;  3BR1 A;  1ETY A;  2K9N A;  2VI6 A;  2EZL A;  2JA5 J;  4C3I J;  4D7M A;  5C4X J;  5IYD J;  3LSR A;  1QPI A;  2R92 J;  3HOY J;  2JK3 A;  3S1R J;  3M4O J;  3IH3 A;  3MN2 A;  4M3G A;  1XC5 A;  2JMW A;  1IDY A;  4IHW A;  2WAQ N;  2XB0 X;  5F04 A;  4JX5 A;  3ZQF A;  1DU6 A;  1LFU P;  1IG7 A;  2H1K A;  2KT0 A;  3BR3 A;  2QF7 A;  2ECC A;  2LR8 A;  2DA2 A;  2LD5 A;  2DMT A;  2MGQ A;  3A01 A;  5EYR A;  3MKL A;  2IEK A;  1FIA A;  3IV5 A;  2XGD A;  4M3F A;  2R0Q C;  1MBG A;  3FK7 A;  3BR6 A;  1JTX A;  5IP7 J;  3JRD A;  1IC8 A;  1FEX A;  1Y1W J;  5J1R A;  4AUX A;  4MLO A;  4Y7N J;  3WHC A;  1ZGW A;  1QRY A;  1ETV A;  5FKN A;  3B6A A;  3IH2 A;  3H0G J;  4A3J J;  3O8H A;  4A3M J;  3A02 A;  2FX0 A;  4W1U A;  4QIW N;  1ETO A;  2ME6 A;  1DU0 A;  1ZK8 A;  1ZR2 A;  1I6H J;  4M3B A;  1RES A;  5DTD A;  1JTY A;  1JT0 A;  3WHB A;  4AC0 A;  2KDZ A;  1Q1V A;  1WPK A;  4IEJ A;  4BBR J;  2ID6 A;  5EZG A;  3S2D J;  2LFB A;  2XPW A;  4BY1 J;  1H89 C;  5E3L A;  3GTL J;  3D1N I;  2JA8 J;  2I10 A;  5FLM J;  2JA7 J;  5E3O A;  4RDU A;  4BY7 J;  2Y9Z A;  1WH5 A;  3HGG A;  3BTI A;  1YRN A;  4ABZ A;  4DZP A;  4JX6 A;  2CQX A;  5GPC A;  4C2M J;  1G2H A;  1JUS A;  3HBL A;  4D7N A;  5M5X J;  3BG3 A;  3FIS A;  2P81 A;  1U9N A;  4DZJ A;  2XB5 A;  1HOM A;  5F0C A;  1ZKG A;  4IHV A;  2LLK A;  3JRC A;  2HI3 A;  2MG4 A;  3GBG A;  2B63 J;  1TWH J;  1X58 A;  3JRB A;  1B72 B;  2L0K A;  2XGE A;  3NAR A;  3CMY A;  1LE8 A;  5EEA A;  3JRI A;  2DTZ A;  5EGO B;  1U9O A;  2DA7 A;  5C3E J;  2D5V A;  2LTP A;  3K7A J;  2R93 J;  2L7Z A;  4A3D J;  4MFD A;  3RQI A;  3Q0V A;  1T56 A;  2YUS A;  3HOZ J;  1EF4 A;  3S1M J;  3PM1 A;  2TRT A;  1ETQ A;  2R5Z B;  4JYK A;  2CU7 A;  2M0C A;  2ME0 A;  1JKQ C;  4JP0 A;  2RAE A;  5C4J J;  5K7H A;  1SFO J;  1S7E A;  4XID A;  3OIO A;  3H3V K;  2CQQ A;  4A3B J;  4J19 A;  2X48 A;  2WV1 A;  4FIS A;  3CDL A;  5FKM A;  2Y0S N;  2Y2Z A;  3HM5 A;  4MFE A;  5IYB J;  4A3E J;  1F43 A;  5EG0 B;  4DYC A;  5JLX A;  1H8A C;  4MO7 A;  2AO9 A;  3TP0 A;  1TWG J;  1TWF J;  2HOT A;  1RR7 A;  4DYQ A;  5EF6 A;  3GTO J;  3BG9 A;  3S15 J;  3S14 J;  2CJJ A;  3DEW A;  3BTL A;  2CUE A;  3RKQ A;  3GTG J;  2K9Q A;  3G1M A;  2M34 A;  5M3M J;  3GTQ J;  1JKO C;  5M5W J;  1RPW A;  2HQ5 A;  1A5J A;  2M9H A;  4MIM A;  2WB1 N;  1H88 C;  1K61 A;  3SJM A;  1PUF A;  5EDN A;  1B8I A;  2PMZ N;  5IPA A;  3CQZ J;  1MSE C;  3S1N J;  2OPT A;  3SFI A;  1VI0 A;  2M2E A;  4EEF G;  4D5F A;  1JUM A;  5J1Y A;  2EZK A;  2LK2 A;  5FJ8 J;  1MSF C;  2R5Y A;  3BR2 A;  4FE4 A;  4G12 A;  4B3A A;  1MH3 A;  2DA1 A;  2Y9Y A;  2G0E A;  1ZR4 A;  3S2H J;  2EQR A;  1I50 J;  2OF7 A;  1JKP C;  1X2M A;  2LVS A;  4I6Z A;  3S17 J;  1GUU A;  1HLV A;  2GLO A;  3A01 B;  2ELK A;  2W48 A;  3GTJ J;  3HEF A;  4A3C J;  5GPA A;  1R9T J;  3DCF A;  1BL0 A;  4UUS B;  1AKH B;  2GM4 A;  5F1J A;  2E19 A;  5BNG A;  1A6I A;  2DMP A;  2LP0 A;  2VPR A;  3L1P A;  3HOU J;  4XK4 A;  3G1L A;  5IOY A;  4I76 A;  5J3L A;  5F0F A;  2NS7 A;  5M5Y J;  4CYC A;  1GV2 A;  2Y31 A;  3OSG A;  2HXI A;  3O8G A;  2NVY J;  5EGO A;  4M6V A;  2YS9 A;  1MBF A;  4IHY A;  2E2H J;  3HOW J;  4D5C A;  2L7M P;  3F0C A;  3QPL A;  3M3Y J;  3ZQH A;  2HOA A;  2LKX A;  2XPV A;  1CQT A;  1APL C;  1E3O C;  2H8R A;  4M3D A;  2NVT J;  3LOC A;  2FD5 A;  2QCO A;  1OFC X;  4B1R A;  1TWA J;  2N8G A;  4XRS G;  4DW6 A;  5IP6 A;  1TWC J;  3Q3S A;  1WGX A;  1JJ8 C;  2EBI A;  3JRA A;  3HDD A;  2L7F P;  4AYB N;  1BJZ A;  2JN6 A;  5FKL A;  1MH4 A;  1WCM J;  3BQZ A;  2L9R A;  1FIP A;  1IJW C;  2NVQ J;  4X1E A;  2GBY A;  3HB9 A;  1HCR A;  2R5Z A;  1B8I B;  1Z0X A;  4UUT A;  2DA3 A;  2JJ7 A;  1LE8 B;  4Y52 J;  2K9S A;  4C3J J;  4QSH A;  1WI3 A;  2E1O A;  3E7L A;  4XRS A;  3B6C A;  4C3H J;  3IH4 A;  1JKR C;  4A3F J;  1FTZ A;  2VKV A;  4S0H B;  1AU7 A;  1IRZ A;  2X6O A;  1MBE A;  3FK6 A;  4XIC A;  1MNM C;  4BXX J;  2IBD A;  3NAU A;  5J1U A;  2COB A;  5DS9 A;  2DA6 A;  2TCT A;  2YU9 J;  2DMU A;  3GTP J;  3MVP A;  4NDL A;  1ITY A;  3HKZ N;  1W0T A;  1UG2 A;  2R7Z J;  5E3N A;  2O9L A;  1FTT A;  1TC3 C;  1BA5 A;  2JA6 J;  1FJL A;  3K2A A;  5E3M A;  1BW5 A;  4BBS J;  1MBK A;  1LFB A;  2NOG A;  2VKE A;  1VF9 A;  1IGN A;  1VND A;  3TED A;  1PUF B; 
#chains in the Genus database with same CATH topology
 1FLI A;  2AXT C;  3ZRG A;  1KZH A;  4ZTJ A;  3FBN B;  3DTI A;  5JHF A;  5BOX A;  1DP3 A;  3E6C C;  3DU6 A;  1ZAR A;  3P5J A;  4HPQ A;  3IKT A;  1F1Z A;  3CTA A;  1OCC H;  2VQC A;  2XRO A;  1TW3 A;  2Z3Y A;  3HUG A;  4XN0 A;  2JRT A;  1KU9 A;  3SZG A;  3VPR A;  5HLH A;  3TBI A;  2HDD A;  4CIC A;  2DA5 A;  2KRF A;  4XOT A;  4A3I J;  2ZBK A;  2E2J J;  4HNV A;  2ZME A;  1ETX A;  1XCV A;  1UEL B;  1Y1V J;  1K6O A;  1FP1 D;  2NAZ A;  3GTM J;  2LY2 A;  2X6W A;  2ACJ A;  4LOC A;  1HKQ A;  2DA4 A;  1TLH B;  4HV6 A;  4KIB A;  3G4S I;  4GFB A;  4PFO A;  3HSF A;  2FU4 A;  3SZP A;  1Z77 A;  2K27 A;  5CVU A;  1BR4 A;  2ID3 A;  4AVZ A;  4A3L J;  1HF0 A;  1GV5 A;  5JLW A;  2QKM B;  2X9D A;  1SEU A;  5J6X A;  1QVT A;  2M8G X;  3FXL A;  2FOW A;  1OJL A;  1ZQ3 P;  3IUO A;  3WG9 A;  3NEU A;  2HOS A;  3U1K A;  3ZQI A;  4KIG A;  1SAX A;  3EET A;  4HSR A;  4WXD A;  1FSH A;  1FBQ A;  4YFX F;  4LGW A;  3MWM A;  1NK3 P;  1RKW A;  5M3F J;  2DN0 A;  1Z6R A;  4KNY A;  5FLV A;  4JX4 A;  4XL9 A;  1O4X A;  3W6J B;  2JSC A;  5DD8 A;  4A69 C;  5F08 A;  4HV5 A;  1SAU A;  1XB4 A;  2MD5 A;  2E1M C;  5FLX K;  1P7I A;  1O3R A;  4LK0 F;  1G59 A;  1YTY A;  4HEA 2;  1N78 A;  3CES A;  4IOA F;  5DUI A;  2ESN A;  3R6S A;  1B72 A;  3WTZ A;  1X2N A;  2FNP A;  5GTI C;  5H2F C;  2KIQ A;  3UKG A;  2A07 F;  2FQ4 A;  1YX3 A;  2CUZ A;  4YFK F;  1C0W A;  1IXS B;  2EV6 A;  2QSH X;  1WJD A;  3LA3 A;  5FKK A;  1VFC A;  3JRE A;  2OZ6 A;  1A04 A;  3ZMT A;  5KAF C;  2RKH A;  2XPU A;  2VLA A;  2A6E F;  2DJN A;  1MBJ A;  3I4M J;  2HTS A;  1GXP A;  3FXM A;  4I02 A;  5CQG A;  4E7H A;  3BWG A;  4XKC A;  1DPR A;  4ZDL A;  1I6X A;  3RSN A;  1E17 A;  2VBX A;  1ZGJ A;  1R6R A;  2XGC A;  2QM3 A;  4B4C A;  2QQA A;  1AHD P;  3AG3 H;  2VOD A;  4CH7 A;  5HOD A;  3SYT A;  2QWW A;  3V7C A;  9ANT A;  2FUG 2;  5F27 A;  1N25 A;  1O3T A;  3FIW A;  4DYR A;  4M3E A;  4YEL A;  1GDT A;  4CCJ A;  2K40 A;  4J01 A;  3WGG A;  4EJW A;  3AFH A;  2Q8K A;  3RKX A;  1U8R A;  5HDG A;  1YS7 A;  4K2E A;  3FWE A;  2R3S A;  3MD2 A;  4HA8 A;  2ZME B;  2LOO A;  2IGO A;  2WAD A;  3EYY A;  2CQK A;  3OYC A;  2E35 A;  3J7Y J;  2R7X A;  1DGW Y;  1XS9 A;  4G94 A;  2R7F A;  1TBX A;  3QPT A;  2MYS A;  3BR5 A;  2Q0O A;  3GLX A;  4GYG A;  3WE3 A;  4PFP A;  3FZV A;  1SVM A;  5EZH A;  5LBQ A;  2IAI A;  3NWT A;  4BJ5 C;  3ERM A;  3CCY A;  4A5N A;  3AG1 H;  3VDX A;  2FXA A;  1ETY A;  1YW9 A;  2K9N A;  1IXR C;  3DKX A;  2VI6 A;  4CXF A;  2BYV E;  1ULY A;  2BV6 A;  2IXS A;  4RLQ A;  5C4X J;  3I71 A;  4NC6 A;  2ZC2 A;  3LSR A;  2R92 J;  3S1R J;  3IH3 A;  4ENK A;  2ZME C;  3CJR B;  2MBF A;  1KA8 A;  5FLX Z;  4O5V A;  3MMY B;  1IDY A;  4IHW A;  4LG0 B;  5GAG J;  3BG6 A;  2BY2 A;  1SMY F;  2QQ8 A;  2A6T A;  2FSW A;  4HF0 A;  4RB2 C;  5ILV A;  1B59 A;  1DU6 A;  1QQI A;  1LFU P;  1X4O A;  3CUQ A;  1H0M A;  4HNU A;  2KT0 A;  4XSZ F;  4ZYD A;  2QF7 A;  2BZT A;  4OIR F;  2ECC A;  5GTH C;  2OTJ I;  4NUB A;  3RKW A;  2DA2 A;  4BHC A;  2EFW A;  2MGQ A;  4BQQ A;  1PJR A;  4KJZ A;  2B7E A;  1FIA A;  1K78 B;  4XBF A;  2KHM A;  3W2V A;  4BXF A;  4M3F A;  2A5Y B;  4Q4Z F;  3JCU C;  1JTX A;  3JRD A;  3F22 A;  4L0Y B;  5J1R A;  1D8J A;  4RM2 A;  1AA7 A;  1O7F A;  3BP8 A;  3OWT A;  4F3Q A;  4R79 A;  3R0J A;  3B6A A;  3N97 A;  3A02 A;  4P5O A;  1VQM I;  3DTK A;  4QIW N;  1KQ9 A;  4XLP F;  1ZK8 A;  2E71 A;  2HGC A;  2Q2E A;  4WXH A;  4IZZ A;  2V1D A;  1WPK A;  4IEJ A;  4BBR J;  2KMU A;  4BY1 J;  3JAM K;  1F5T A;  3H9G A;  3F8F A;  2JA8 J;  3FMQ A;  4EQQ A;  1LB2 A;  3FMS A;  1ERD A;  4HBL A;  5E8G A;  2ADU A;  3S8P A;  1I5Z A;  3U1D A;  4MEY F;  1X3U A;  3PSI A;  1FOX A;  2WWY A;  3HGG A;  4CCO A;  2V4J C;  3QYB A;  3KX2 A;  2D45 A;  4DZP A;  2CQX A;  3RJP A;  5GPC A;  1G2H A;  1JUS A;  3F8B A;  2OA4 A;  1U2W A;  2GXB A;  4G6D A;  5AIP A;  5EJC A;  3OYL A;  4G7O F;  1J7K A;  5TRD A;  1TTY A;  1MD0 A;  2UWM A;  1VZ0 A;  3RKY A;  1HXD A;  5L3G A;  2XB5 A;  1VQL I;  5K5R A;  4IHV A;  3SEQ A;  4KYW A;  1TQI A;  1YG2 A;  1UB9 A;  2MG4 A;  2OV7 A;  2DT5 A;  2R7Q A;  1FWZ A;  3SQN A;  1TWH J;  1X58 A;  2L0K A;  3GF2 A;  3CMY A;  5KVR A;  1S29 A;  2YX7 A;  1NG6 A;  2P6T A;  3GCM A;  2PLY A;  1K4S A;  3H3Z A;  5ICF A;  3CCS I;  2D5V A;  3VYR B;  2LTP A;  3LSH A;  3K6G A;  2M8E A;  2L7Z A;  2HVQ A;  1IF1 A;  4KIC A;  2NNN A;  3ONQ A;  3Q0V A;  4RAF A;  3HTS B;  4XLA A;  3HOZ J;  2V79 A;  4JYK A;  2M0C A;  1JKQ C;  1RNL A;  2VOO A;  2RAE A;  3L2Q A;  2HYG D;  4GXO A;  4XID A;  2F5D A;  4LB5 A;  1SVL A;  3O6B B;  2CS3 A;  3E5U A;  3JW4 A;  4F92 B;  1PP7 U;  1EJ9 A;  3J7A Y;  1S8N A;  2X48 A;  3OS0 A;  1BR2 A;  4UXN A;  3Q9V A;  3BOQ A;  2KIS A;  2Y0S N;  1LVK A;  4DYC A;  2ZSH B;  2CG4 A;  2BHZ A;  4M73 A;  1HW5 A;  3EDP A;  3QU6 A;  1QA6 A;  4DYQ A;  2P7C B;  4WWC A;  4JK1 X;  3DEW A;  1UFM A;  3RKQ A;  3GTG J;  3KP6 A;  3G1M A;  4DJA A;  1FBU A;  4RAZ A;  1SD4 A;  1R71 A;  1REP C;  1RPW A;  1J5Y A;  1A5J A;  3LSK A;  3I9V 2;  4A0X A;  2WB1 N;  1OR7 C;  1ZG5 A;  1PUF A;  5EDN A;  5FRM A;  3CQZ J;  1B9N A;  2OC6 A;  1RI7 A;  2I5U A;  4KN4 X;  4U0W A;  3J7Z I;  5B1A H;  3S1N J;  3FXR A;  2DDA A;  2DDB A;  2K3P A;  3L2U A;  4IRI A;  4EEF G;  2DK8 A;  2EIL H;  3L2C A;  2XF6 A;  1Z7L A;  1ZR4 A;  4UUV A;  2XC7 A;  1I50 J;  2EB7 A;  2VJ5 A;  3HPG A;  1MJA A;  2OF7 A;  3WU2 C;  1X2M A;  4CDG A;  1TP4 A;  4B09 A;  3W6K B;  2LVS A;  3E5Q A;  3S32 A;  4LD5 A;  3BJO A;  4X0G A;  4B47 A;  2ELK A;  2GXG A;  4A3C J;  1R9T J;  3EUA A;  3F23 A;  1JHH A;  3ESW B;  4AIH A;  4BDY A;  3DCF A;  3FXJ A;  2EIN H;  2P6S A;  4Y3O A;  1ON2 A;  1WQ2 A;  1A6I A;  2RC4 A;  4HYE A;  3I58 A;  3ECH A;  4XK4 A;  3E6B A;  5KNL A;  3E6D A;  3QPH A;  4N4N B;  2O03 A;  5F0F A;  1BBY A;  2NS7 A;  2DT7 B;  2WAF A;  2OZU A;  1GV2 A;  1FOY A;  3OSG A;  4LLG F;  3C2H A;  3O8G A;  4HLX A;  3GZ6 A;  1W7P B;  4XOP A;  4D1Q A;  3QYF A;  1WI9 A;  3OV8 A;  4EM0 B;  2W7N A;  3ECO A;  1P6R A;  2KFD A;  4II2 A;  4AVP A;  4IQ4 A;  4D5C A;  1E3H A;  5B3S H;  1YJW I;  3ZQH A;  2ZJP F;  3GXO A;  5IY5 H;  1A35 A;  2R7O A;  3OYB A;  1APL C;  3HKZ A;  4G8X A;  2H8R A;  2YX4 A;  3I56 I;  4IX7 A;  1MNE A;  2VBY A;  4B1R A;  2J5P A;  4B48 A;  1TWA J;  5J40 A;  1BC7 C;  2N8G A;  1O3Q A;  4HX7 A;  5D5W B;  3VOD A;  5IP6 A;  4KUM A;  4DBR A;  1MMA A;  1J0R A;  1JJ8 C;  1WGX A;  2ZFW A;  1X3Z B;  4I01 A;  4M9X A;  2HU9 A;  1S72 I;  4JBA A;  1FYK A;  2L9R A;  1FIP A;  2H6C A;  4A0Y A;  1ZLK A;  1XTA A;  2IRF G;  2GXA A;  3HSR A;  1HCR A;  2R5Z A;  1B8I B;  3CCQ I;  1Z0X A;  2XRN A;  2F4O B;  2XSJ C;  4UUT A;  2DA3 A;  1Z67 A;  4BU2 A;  4XON A;  2VN2 A;  2W24 A;  5IT9 K;  1LPQ A;  3K4N A;  1TT5 B;  3OS1 A;  4E4H A;  1IUY A;  4C3H J;  3I53 A;  4S0H B;  4RS8 A;  1R36 A;  2IBD A;  5J1U A;  5DS9 A;  1ZEL A;  2DA6 A;  4YFN F;  1G3Y A;  3CJN A;  3JTG A;  4NDL A;  2WB1 A;  3HOS A;  2BEO A;  4QWQ A;  2DCE A;  2R7Z J;  5E3N A;  1BA5 A;  4MQ9 F;  3JSO A;  2OAZ A;  4L0Z B;  3L2R A;  2LRD A;  3KP3 A;  2K4B A;  1PUE E;  2BY0 A;  2VKE A;  1KGS A;  2L4M A;  3CCV I;  4BL0 B;  2Z5U A;  4LG0 A;  5K5O A;  4KMU X;  1K6Y A;  2PMH A;  1QO0 D;  2H6B A;  3FM3 A;  3GZN B;  3LSP A;  4XLN F;  2HXO A;  3LSG A;  3HRM A;  3FKI J;  3SZT A;  4LK1 F;  3GTK J;  2X51 A;  4WK8 F;  1YS6 A;  4JOM A;  5FKO A;  4V2G A;  2XKO A;  1WH7 A;  3IAM 2;  3S16 J;  1XDS A;  3WTU C;  1PDN C;  2UXX A;  3CUQ C;  2MSY A;  3QYE A;  3DEU A;  4A12 A;  4RGR A;  1JT6 A;  1XGO A;  1VQ8 I;  2CW8 A;  2UUZ A;  3JRF A;  3GFM A;  2RN7 A;  4DNC A;  1Y39 A;  2LY9 A;  1MJB A;  1XD7 A;  1Z9C A;  2I8D A;  2JWT A;  3L2W A;  1HW2 A;  2EIM H;  1LQ1 A;  1I27 A;  2LKS A;  5J8C A;  4BKX A;  4A0Z A;  2R7U A;  3CCL I;  2VPL A;  2DOD A;  1T33 A;  1MBH A;  3C7J A;  1DUX C;  2QEX I;  3HG9 A;  4A93 J;  2DBB A;  2X85 A;  3HOX J;  3DP7 A;  1JGG A;  1VQ9 I;  1R7J A;  3KP2 A;  1RUO A;  1SFK A;  2G7U A;  2JSP A;  5D5X B;  1FMV A;  4EV0 A;  3MAJ A;  5F0H A;  1XGS A;  2A68 F;  2W4S A;  5FFX A;  2E34 A;  5IT3 A;  1WRJ A;  2O8X A;  3KLN A;  4I98 B;  1B9M A;  1T8I A;  3OOP A;  3GYH X;  1XPX A;  2WAE A;  5E79 C;  2H8W A;  3GO5 A;  3TL4 X;  3ZN0 A;  5JFR A;  1ORK A;  3ZMD A;  3Q0U A;  5LEJ A;  4OU0 A;  3V8J A;  3LA2 A;  2UXN A;  4FE7 A;  1E0E A;  3ZOB A;  1QZE A;  2HTJ A;  4NQW A;  2IA2 A;  4GDF A;  2LRE A;  1R1U A;  2OQG A;  2TDX A;  1R5G A;  2ETH A;  1WZ2 A;  5J47 A;  2ZXJ A;  4CYD A;  4EJO A;  1POG A;  3KEO A;  5CVJ A;  3JRG A;  5BQT A;  2EIJ H;  2QQ9 A;  4R8H A;  2PJP A;  2BXZ A;  1T98 A;  2O0Y A;  1YW7 A;  3ZQC A;  1GXQ A;  4PGG A;  4UUS A;  3G1O A;  4UNO A;  2RV8 A;  1MJ9 A;  1LEB A;  2JUC A;  2ECB A;  2XHK A;  4PJM A;  3K4C A;  3VYT B;  3JR9 A;  1HDP A;  1SVO A;  1Y56 A;  3H92 A;  1KON A;  1OCT C;  4M71 A;  3GX4 X;  3I64 A;  3OOU A;  3L00 A;  2O7O A;  1GVD A;  2E2I J;  3SDG A;  2QUF A;  5C44 J;  3CLO A;  1PYV A;  1WJA A;  4F55 A;  4L5E A;  1LDK B;  1X1C A;  1CF7 A;  3OYI A;  4CGZ A;  4M9S A;  1XG1 A;  3HSE A;  4IPA A;  2LNB A;  3WGH A;  2BW3 A;  1W5T A;  2FJ1 A;  3AAF A;  3ZXS A;  2LSO A;  4DGW B;  4AID A;  3Q9S A;  3UNG C;  4J00 A;  1P4A A;  2F5V A;  2VON A;  3MZ8 A;  2FOK A;  4QLC U;  5E1X A;  3BTJ A;  2DYR H;  2A05 A;  3KPH A;  5HS9 A;  4U0Y A;  3CCR I;  4W97 A;  1N75 A;  3MEX A;  1KYW A;  2E1N A;  2JA5 J;  4OIP F;  3RYR A;  3RIR A;  1QBJ A;  2L5Q A;  4EM1 A;  3HOY J;  2ELH A;  3CMA I;  3MN2 A;  3M4O J;  1L0O C;  2JMW A;  3G2B A;  3O2P E;  4MNU A;  2XB0 X;  2AQE A;  5F04 A;  3W2A A;  5CVV A;  3FM5 A;  3ZQF A;  4I0A A;  3K1M A;  4BAY A;  5F64 A;  1IG7 A;  1MND A;  1Z7U A;  2H1K A;  3PSF A;  4O6J A;  4EAT A;  3T8T A;  4ZYH A;  3I5U A;  1I39 A;  3GWZ A;  2EPF A;  5F1R A;  3CJT B;  2HKO A;  3A01 A;  3HZJ A;  2IEK A;  4ZJZ A;  3K0L A;  3IV5 A;  4KIS A;  2R0Q C;  1BJA A;  3FK7 A;  2KJC A;  4L18 B;  1IC8 A;  5IP7 J;  1Y1W J;  4Y15 A;  4LIT A;  3JAM Z;  1Z3X A;  4XKW A;  1ZGW A;  3LWF A;  2CV1 A;  4P9U A;  1QRY A;  1JHF A;  3H0G J;  3MZY A;  4L9J A;  5FFZ A;  4XN3 A;  3KZY A;  1G3W A;  4OWR B;  4M3B A;  1RES A;  1P4X A;  1ZRC A;  1FNN A;  5DTD A;  2V1U A;  2MLK A;  3CZ6 A;  1R22 A;  1JT0 A;  1R58 A;  4OOI A;  4ZZD A;  3M9A A;  3BRO A;  3OL3 A;  2KDZ A;  1L3L A;  1Q1V A;  2H94 A;  4GCV A;  2PQ8 A;  3GTL J;  4P96 A;  5J4Y A;  2I10 A;  1WWX A;  1Y6I A;  2IS2 A;  1IRX A;  1DGR M;  4BY7 J;  3RPU A;  2R7W A;  2Y9Z A;  4I0B A;  1WH5 A;  5D6E A;  1P9Q C;  3BTI A;  1YRN A;  1BI3 A;  4ABZ A;  2HVS A;  1SFU A;  3VOE A;  2F2E A;  3V8K A;  1OIS A;  4LIV A;  4C2M J;  2K9L A;  4BQA A;  3FKJ A;  4P1W A;  3VB2 A;  2H09 A;  2DW4 A;  1WJC A;  3G71 I;  3KYC B;  3FIS A;  4BJ6 C;  4BE1 A;  2AQF A;  2YU3 A;  3BJ6 A;  1W36 D;  3T8R A;  1U9N A;  2XAU A;  1U3E M;  2IVM A;  5F0C A;  3S93 A;  1ZKG A;  2W84 A;  5CJ9 A;  1FBS A;  3FHN A;  5DM7 F;  1P2F A;  2HI3 A;  4CO8 A;  4FT8 A;  3D5R C;  3GBG A;  1YYV A;  4H0E A;  2STT A;  3H36 A;  3NAR A;  3VYS B;  1LE8 A;  2DO7 A;  5EEA A;  3BY6 A;  1MIJ A;  2DTZ A;  3M8J A;  5C3E J;  1EH7 A;  3WTS C;  3K7A J;  4WX9 A;  2PG4 A;  2LF8 A;  2PN6 A;  2ZJ2 A;  3ZQQ A;  1OYW A;  3B73 A;  3LL7 A;  4ZC3 A;  2YUS A;  2DOA A;  2IGN A;  3GEZ A;  4RGX A;  2M3A A;  2EFP A;  4Y33 A;  3T0Y A;  5K1Y A;  2TRT A;  4BXU A;  1ETQ A;  3E1S A;  3F8N A;  2ME0 A;  1R4N B;  4H4K C;  3J7A O;  5EEH A;  1SFO J;  1FSE A;  1S7E A;  3QOE A;  2M5W A;  3H3V K;  4KA4 A;  1GHC A;  5LRR A;  4DBQ A;  3Q5F A;  4FAS D;  1CGP A;  3QWL A;  2IT0 A;  4FIS A;  2K4J A;  3CDL A;  5FKM A;  4IOC F;  1KU7 A;  3HM5 A;  3DQV C;  3L7W A;  4MFE A;  4A3E J;  3ASN H;  4GRI A;  5EG0 B;  4RB1 A;  5JLX A;  4AYB A;  1W5C C;  2AO9 A;  1MGT A;  3TP0 A;  1TWG J;  3ABK H;  1ZG1 A;  1TWF J;  1RR7 A;  1Y8R B;  2L9S A;  3KYD B;  3GTO J;  3BDD A;  2DT6 A;  2ISZ A;  2ZFU A;  3HL2 A;  2CJJ A;  3CCM I;  3BTL A;  3SDB A;  3DBL B;  5AIQ A;  3GTQ J;  3H0D A;  4MIM A;  1H9G A;  1YLF A;  1K79 A;  1XCB A;  3SJM A;  3OYA A;  2WV0 A;  2IW5 A;  2W25 A;  4AWX B;  4BNC A;  4C2U A;  1Z3Y A;  4II3 A;  4HNT A;  3W2W A;  3ABM H;  2EWN A;  4RM3 A;  2W85 A;  2JPC A;  2OPT A;  2M2E A;  4D5F A;  2LK2 A;  3CO7 C;  2R7S A;  5B1B H;  1Y8Q B;  4PSX A;  4B3A A;  2FMY A;  1MH3 A;  3KE2 A;  3R4K A;  3DWL E;  1B4A A;  2O3F A;  3A0B C;  5H6R A;  2IGM A;  3WTV C;  3BC8 A;  3VYU B;  3A01 B;  2Q2E B;  2IS1 A;  2W48 A;  3EUK L;  3HEF A;  3ISP A;  5B5E C;  3PQK A;  4QPQ A;  3ABL H;  1FOW A;  3PJR A;  4BUP A;  3CP2 A;  1AKH B;  3DBH B;  1Y0N A;  5BNG A;  4BGD A;  3IRR A;  3PIO F;  2LP0 A;  2VPR A;  3L1P A;  3HOU J;  3WE2 A;  3IL2 A;  3ZMZ A;  4I76 A;  5DCF A;  3W3C A;  2IPQ X;  2KL4 A;  2X4H A;  5DEQ A;  1ZG3 A;  2VQL A;  2XV4 S;  2UZK A;  2CW7 A;  2NVY J;  3EUH A;  4M6V A;  3I59 A;  4KT6 A;  1R1T A;  2JRM A;  1T95 A;  2VQG A;  1WJB A;  1AOY A;  1VQK I;  1U5T C;  3M3Y J;  1VQ5 I;  2ZXI A;  4IJA A;  2IS6 A;  2LBF B;  2MD0 A;  2RDP A;  3DF8 A;  2HOA A;  4FET A;  2FA5 A;  1CQT A;  1BR1 A;  1E3O C;  4B3X A;  2NVT J;  3ZP5 A;  4L5I A;  3VFZ A;  2VL8 A;  5ED4 A;  3OYM A;  2FD5 A;  2QCO A;  2ELJ A;  3DBR B;  5L3F A;  4BQN A;  1UJ8 A;  2VB6 A;  3CUQ B;  4GYI A;  4DW6 A;  3HRU A;  1TWC J;  1K4T A;  3OYH A;  2GIZ A;  4G9Y A;  4ZDO A;  2PMZ A;  2GA2 A;  2L02 A;  2M7A A;  5LGN A;  3QAH A;  4HW0 A;  3JRA A;  2VQH A;  1SC7 A;  4AYB N;  3A0H C;  1BJZ A;  5J8F A;  5IT9 Z;  5FB2 A;  1VQO I;  1QPM A;  2L54 A;  3TOB A;  5FKL A;  1MH4 A;  3BQZ A;  3TGN A;  1IJW C;  2QEN A;  1UZC A;  2HKX A;  4X1E A;  3F21 A;  4ON0 A;  2GBY A;  4XKV A;  2WAQ A;  1A36 A;  1V3F A;  1DP7 P;  4KIT B;  4NC7 A;  1LE8 B;  3VSL A;  3HJE A;  2K9S A;  4ZH4 F;  4QSH A;  2NNY A;  2E1O A;  3F6O A;  3ELK A;  3HYI A;  5E20 A;  4XRS A;  3F8M A;  3IH4 A;  2F5C A;  1X1D A;  3M07 A;  3SFZ A;  1U5T A;  3OYD A;  2VKH A;  2CFO A;  3F72 A;  3FK6 A;  4XIC A;  4U0V A;  1X19 A;  1VQ7 I;  1YJ9 I;  2TCT A;  2YU9 J;  3ZMV A;  5LGT A;  3GTP J;  1UHW A;  3CJQ B;  1YO5 C;  1S7O A;  2BVL A;  1KU3 A;  1TC3 C;  2O9L A;  3BPV A;  1W1W E;  2F4I A;  2M4G A;  1R00 A;  1FJL A;  3K2A A;  5E3M A;  2R7R A;  1W36 C;  1LFB A;  1J09 A;  2NOG A;  5FRO A;  4N9H A;  1VND A;  3V8L A;  1HKT A;  3TED A;  3S3M A;  3TW6 A;  3ASO H;  2JZY A;  3S1Q J;  4CCK A;  1IV6 A;  2V1N A;  1YRN B;  2CW0 F;  1RRJ A;  5DM6 F;  2M87 A;  4XR6 A;  3P9K A;  3LNQ A;  3P9C A;  1MDM B;  1K83 J;  1IZ1 A;  3F8C A;  2L2O A;  5AON A;  3L09 A;  1XSV A;  2VXD A;  2QA4 I;  2HS5 A;  2OD5 A;  2V6E A;  1BI2 A;  2L9N A;  2X6X A;  3FDY A;  1ZTR A;  2VE9 A;  4FHT A;  2DFE A;  2HYJ A;  2HYF A;  2Y0S A;  5K7Z A;  1WJE A;  3QRF F;  1T6S A;  2QVO A;  3MFK A;  1IDZ A;  2OQR A;  5DYM A;  3DKW A;  2L01 A;  3K1N A;  3LQQ A;  4XKB A;  4EM2 A;  3OYK A;  2E7W A;  4IHS A;  1QVU A;  5A2Q K;  1P92 A;  3AKZ A;  2O8K A;  2IJL A;  5FD5 A;  3KEQ A;  5IOZ A;  2LKP A;  2NS8 A;  3TP3 A;  2K85 A;  5DD4 A;  1G3T A;  5FO5 A;  3GME A;  4F7Z A;  4OMZ A;  1MMD A;  2QSG X;  1W0U A;  3M1E A;  2KIF A;  2V1X A;  1RET A;  1NG7 A;  4IHX A;  2EJR A;  3IKV A;  2DI3 A;  4IVN A;  4QPO A;  2Y30 A;  3NRV A;  4XLE A;  4E70 A;  4EMS A;  2XGX A;  3S3N A;  2FE3 A;  4BS9 A;  3GVA A;  2KRH A;  3E3V A;  3PNV A;  5D4S A;  3QQA A;  2P5K A;  4X6A J;  1BM9 A;  5TIS C;  2FQ3 A;  2V9V A;  2ZCW A;  2MH9 A;  2ZO4 A;  3PUF A;  3PNY A;  2FF4 A;  2NS0 A;  4A6E A;  5EG0 A;  3WTY C;  2HDC A;  1F36 A;  5IYC J;  1FYL A;  1JGS A;  3N05 A;  2E1C A;  3GLL A;  3LST A;  4P9F A;  5ICG A;  2K86 A;  4E7Z A;  2V6C A;  1MMS A;  1T2K A;  2M0M A;  3CUO A;  1HSJ A;  5ILS A;  1USS A;  4PUS A;  4ASN A;  2Z9O A;  2KQR A;  2VBZ A;  2WY8 Q;  3U21 A;  1X1B A;  4OIN F;  3HOV J;  1E3P A;  4NNJ A;  4WF2 A;  3P7N A;  1ON1 A;  4Y4R A;  5L3D A;  1ETK A;  1I3A A;  4YII A;  1JUP A;  4EGY A;  4V2F A;  1GLN A;  5LHG A;  3SXY A;  4MTD A;  2RGV A;  1XSD A;  4QTR A;  4XSX F;  3BTC A;  2VJ4 A;  4LLL A;  2VUM J;  4A3G J;  2R5Y B;  2Y0M A;  1ENH A;  5GP9 A;  1HBX G;  4E7J A;  3MQ0 A;  1D8K A;  1BW6 A;  4YIF A;  3L2V A;  4Y13 A;  4BE0 A;  3QPS A;  2XSD C;  2LDU A;  2OJE D;  2HFH A;  3QOP A;  1IN5 A;  2DMN A;  3EYI A;  2LG4 A;  3MZH A;  1S7A A;  1G6N A;  3RCO A;  2CUF A;  4U7D A;  4NBQ A;  3BG7 A;  3RZO J;  4OAZ A;  2G7H A;  1X1A A;  1K7A A;  4PSW A;  1JJ6 C;  5K5Q A;  3I4N J;  1RC9 A;  1LUJ B;  3K10 A;  4C30 A;  5JVG F;  4RMN A;  4MQV A;  4EJT A;  3K1P A;  2JVH A;  4L9N A;  3KZI C;  1D5Y A;  3BG5 A;  2XAH A;  2HR3 A;  3TOA A;  2CQN A;  1FMW A;  4BDZ A;  2ZKZ A;  5IP9 J;  3BR1 A;  3T1B A;  3OYF A;  1STZ A;  4V19 K;  2EZL A;  3OL4 A;  1MW7 A;  4C3I J;  4XM3 A;  5IYD J;  4YEJ A;  1QPI A;  2BHY A;  2JK3 A;  1BI0 A;  2QKL B;  4M3G A;  5DCM A;  1XC5 A;  1RR8 C;  2IP2 A;  2WAQ N;  3MKZ A;  4HX4 A;  1T0F A;  2M30 A;  4LJZ F;  3H9Q A;  1XDU A;  1MMG A;  3E6M A;  5LHI A;  5LHH A;  3K4K A;  1ZH5 A;  3ZGK A;  1WJ5 A;  2YPR A;  1OCO H;  4XLF A;  4IRG A;  2PI0 A;  3K2Z A;  3SHF A;  4HX8 A;  2OTL I;  5EYR A;  3TDZ C;  4ESB A;  2GQQ A;  5HNF A;  1AWC A;  3DPL C;  2XGD A;  4BQO A;  5L3E A;  1MBG A;  4Z2Y A;  3HTU A;  2ZJR F;  4E7L A;  2XF7 A;  4ESF A;  2Z16 A;  4GO1 A;  1JXS A;  4MLO A;  4HQM A;  2A6H F;  4LLN A;  1U5T B;  1EV7 A;  3IH2 A;  1OCR H;  4A3J J;  2FX0 A;  4BH9 A;  3RYP A;  2VT3 A;  5EEG A;  5E17 F;  2ME6 A;  2A61 A;  1HKS A;  4PK4 A;  1I6H J;  3CDH A;  3C18 A;  4UVA A;  4HQE A;  1K78 A;  2RNG A;  3TO6 A;  3OMY A;  4AC0 A;  1ONV A;  1OCZ H;  1IN7 A;  2R4G A;  5EZG A;  4FQG A;  2XPW A;  1V4R A;  3D1N I;  3D0S A;  4YIR X;  4AIK A;  2M1B A;  2JA7 J;  5E3O A;  3M8F A;  4HRI A;  3FXU A;  3J81 K;  1NH3 A;  1ACI A;  2XKP A;  1R5I D;  4U88 A;  1FYM A;  2BBY A;  4AIJ A;  1S5L C;  4D7N A;  1SD5 A;  3RTR A;  4CUG A;  1D1A A;  1LDJ A;  1YX5 A;  2JTV A;  3M7G A;  3BG3 A;  2IS4 A;  2YSR A;  3K4J A;  3RQ4 A;  5J4V A;  3H9J A;  4BHB A;  4B43 A;  4DZJ A;  4BEH B;  2LLK A;  4ENJ A;  3JRC A;  3E0J B;  1ZAO A;  1WHU A;  5HLT A;  3WTT C;  4OIQ F;  1LFP A;  1T08 B;  1J2X A;  3JRB A;  3J80 K;  2XGE A;  2COM A;  4TV7 A;  3K69 A;  4PJN A;  3GW2 A;  3JRI A;  5ICC A;  4F52 A;  2CV2 A;  4OIO F;  1W7P A;  1ZGA A;  1VQ6 I;  4FX0 A;  1U9O A;  1LVA A;  3OY9 A;  4CHU A;  1WVR A;  2R93 J;  1XMK A;  3K70 D;  2XAF A;  5HLG A;  2A69 F;  1TNS A;  2HZD A;  3KEY A;  2RRE A;  4IXA A;  4MFD A;  1BOA A;  4G6Q A;  1T56 A;  2VKD A;  3HIF A;  5BS6 A;  2EV0 A;  1YFH A;  3DU5 A;  3UR3 C;  2JPB A;  2HOE A;  2R5Z B;  2BOL A;  2MLG A;  1JE8 A;  5LGU A;  3VSK A;  3SEZ A;  2XUB A;  4JP0 A;  2QQB A;  5K7H A;  2HDW A;  3QP6 A;  4G7H F;  3OIO A;  4S05 A;  2P0W A;  3WGI A;  1IV8 A;  1UG0 A;  4R1H A;  3HOT A;  2M7B A;  2Y2Z A;  3V7S A;  2CGP A;  3IC7 A;  1ZHF A;  2DPD A;  1BN5 A;  4MO7 A;  5E8I A;  5FRN A;  5D4R A;  2HOT A;  3LSM A;  3AL0 B;  1ZLJ A;  5EF6 A;  2AXL A;  2OU2 A;  3S15 J;  4BE2 A;  1YHQ I;  3S14 J;  5BMZ A;  2JT1 A;  4E7S A;  2L3D A;  2CUE A;  3E5X A;  3DEE A;  3H35 A;  5HLI A;  2QGU A;  3WU1 B;  4E7I A;  1QZY A;  2KJB A;  2XAS A;  5M3M J;  3COA C;  2STW A;  2A3S A;  2KRC A;  3KIO A;  5TJJ A;  3J81 Z;  2E5Z A;  3A4C A;  3KP5 A;  1H88 C;  4IKF A;  4M74 A;  4G7Z F;  3S3O A;  2Y48 A;  1DQU A;  5IPA A;  2HNH A;  3G73 A;  1HC8 A;  4HZF A;  4PDK A;  1YIO A;  3MKW B;  2X0L A;  3SFI A;  1VI0 A;  5LRS A;  5FGM A;  1F4K A;  3LMM A;  2EZK A;  4XMY A;  5FJ8 J;  1FP2 A;  2UV1 A;  1MSF C;  2HEO A;  3BR2 A;  2PMU A;  4FE4 A;  4G12 A;  4RGU A;  4ZYA A;  2G0E A;  2EQR A;  3BZC A;  1MMN A;  1WJF A;  1IRG A;  3ML6 A;  4I6Z A;  3S17 J;  1GUU A;  1HLV A;  2CYY A;  1GVJ A;  2Z33 A;  3GTJ J;  1EH8 A;  2QLZ A;  4RB3 C;  3J80 Z;  3IWF A;  2WC2 A;  3DXJ F;  3IP4 B;  2HPM A;  1BL0 A;  3K4L A;  4UUS B;  2VOP A;  5F1J A;  2E19 A;  2NVU B;  2P5V A;  2DMP A;  2LC2 A;  4IRH A;  4PGH A;  1OYY A;  5IOY A;  2J5O A;  1ZRD A;  2KKO A;  2V26 A;  4ENM A;  5J3L A;  5CQE A;  2OBP A;  3CP8 A;  2E7X A;  5M5Y J;  3I54 A;  2Y31 A;  4CYC A;  4KDP A;  3G6E I;  2HPI A;  4A5M A;  3PFY A;  1TL8 A;  1RZ4 A;  2EIK H;  2ISY A;  1MBF A;  2V9K A;  4KIF A;  2FBH A;  2CUJ A;  4PJL A;  2E2H J;  1DPU A;  3RI4 A;  2L7M P;  3F0C A;  4AD9 A;  3QPL A;  2CQ7 A;  1V5E A;  3V42 A;  5JI6 A;  1ZRE A;  5LD2 C;  4JQF A;  1D3Y A;  5D5U B;  4MHG A;  3OYE A;  4EJV A;  1X1P A;  1QZZ A;  1B6A A;  5KK1 A;  2WTE A;  3AG2 H;  1OFC X;  1SFE A;  3K4M A;  4Y17 A;  2EK5 A;  2VIX A;  4HLY A;  3PQJ A;  2B0L A;  2L7K A;  3KP7 A;  3BJA A;  2EBI A;  5HDN A;  3HDD A;  4WXC A;  5HOO A;  4P55 A;  3KLO A;  4ENN A;  1UAA A;  2VAS A;  1V54 H;  2QZ8 A;  4I7H A;  1G3S A;  3ERE D;  3T5X A;  4O3M A;  1YE9 A;  5HVQ C;  1WCM J;  1XSX A;  2GA1 A;  3PUB A;  2NVQ J;  4IL6 C;  2FBI A;  3I3L A;  4A6D A;  1VTN C;  2CMP A;  3HRS A;  2JJ7 A;  4UV8 A;  4PZJ A;  5D6F A;  1IO2 A;  4Y52 J;  4M6Y A;  4C3J J;  1U0J A;  2HQN A;  2PEX A;  3H3U A;  2C6Y A;  3E7L A;  3DPU A;  3BCB A;  3C2G A;  2QBY A;  1LNW A;  5LFA A;  1QHG A;  2E1M B;  1JKR C;  2OUM A;  1AU7 A;  2X6O A;  4B44 A;  1T0F C;  3CCE I;  4ZZL A;  2WBM A;  1MNM C;  4BXX J;  1D5V A;  3KCC A;  3D5S C;  3WOD F;  3E97 A;  1TZL A;  2DMU A;  4ZDP A;  5D8K B;  1S9H A;  3HKZ N;  3FBI B;  1W0T A;  5HS8 A;  2BY3 A;  5FD6 A;  1FTT A;  1QGP A;  2MA3 A;  2ICW G;  3R0A A;  3LSI A;  5JR3 A;  2JA6 J;  3IRQ A;  2R7D A;  1BW5 A;  4BBS J;  4KN7 X;  1MBK A;  2IA1 A;  3G3Z A;  2VC0 A;  3ZMS A;  1VF9 A;  3N4M A;  4UVC A;  1PUF B;  1BC8 C;  1UMQ A;  4ESJ A;  2RQP A;  2JVG A;  1GT0 C;  4YG2 F;  3FXK A;  2VC1 A;  1R4M B;  1EA3 A;  4BAC A;  3HC7 A;  1OPC A;  2MW8 A;  1TW2 A;  1MZB A;  1O57 A;  2MC3 A;  4UHT A;  2M45 A;  4A2U A;  2AS5 F;  1OMI A;  2ZB9 A;  4CYC B;  3K70 C;  1CF7 B;  5A2Q Z;  2Q1Z B;  3F3X A;  3ZN1 A;  3JRH A;  4U7B A;  4NHJ A;  4RAG A;  4UVB A;  2BW3 B;  1YW8 A;  4BEH A;  1UHS A;  1ETW A;  3PIP F;  2LH9 A;  3M1C A;  1O3S A;  2A5W A;  2CO5 A;  2XVC A;  3DLL F;  5HNH A;  1NK2 P;  3OIQ A;  4RA2 A;  5DV5 A;  2NVX J;  2R7V A;  2HVR A;  2NOJ B;  1I3Q J;  2KPM A;  3REO A;  3X2Q H;  3WTW C;  3LFU A;  1SAN A;  2Z99 A;  2RQQ A;  1DDN A;  1YOV B;  3PO2 J;  3CC7 I;  3BCA A;  1PVE A;  2BE5 F;  3A03 A;  5KHD A;  4UV9 A;  4PJ0 C;  3CD6 I;  4FCY A;  2X1D A;  3ZQG A;  2DMQ A;  2ZSI B;  6PAX A;  5TGT A;  4ETS A;  1FX7 A;  3H5R A;  4LMY A;  1P7J A;  4FTH A;  1RKT A;  1XMA A;  3ROU A;  3I4P A;  3BZ6 A;  3HGY A;  2O61 A;  2K7L A;  4NQW B;  2O5R A;  3ZQL A;  3ZCO A;  3VWB A;  2GOM A;  4Q5S F;  2DOE A;  2CFX A;  2M4K A;  2CSO A;  2XRL A;  3QP5 A;  1OKR A;  4RLF A;  5CYV A;  1IXC A;  2AHQ A;  1WSU A;  2OCE A;  1U78 A;  4EJU A;  3CCU I;  2P4W A;  3BZK A;  1TQP A;  5E1Z B;  5B66 C;  2GZW A;  4L9V A;  3GFL A;  1YI2 I;  1OR7 A;  1R1V A;  1T38 A;  1OYI A;  1YJN I;  5K7F A;  2BGC A;  1UHM A;  4AM3 A;  2XAG A;  2KDO A;  1W4M A;  4CZZ A;  1IUF A;  2CRG A;  2EFQ A;  2IA0 A;  2VT2 A;  5CPR B;  5HDK A;  4A3K J;  4DQ2 A;  1XMX A;  4XLC A;  1J75 A;  3HHG A;  2RVC A;  1TQM A;  2P7V B;  3BR0 A;  2DFI A;  3BQY A;  2PX9 A;  1IAW A;  2D2W A;  1HST A;  1ZYR F;  1YQA A;  4C2T A;  3LQR A;  1NTC A;  2HQR A;  1B1B A;  2DAO A;  3OSF A;  3EUH C;  3P9I A;  2QYO A;  3I0T A;  2OCC H;  1YIJ I;  3K4B A;  5DUK A;  3Q0W A;  4UB8 C;  3L9F A;  1HQC A;  2MFZ A;  3DTE A;  4BJT A;  4OMY A;  3JTH A;  5GAD J;  2EH3 A;  1KYZ A;  2K02 A;  3FMR A;  1AKH A;  2VJJ A;  4N9I A;  3OYG A;  1FOK A;  3DFG A;  4XRM A;  5CVR A;  4RBO A;  3TKY A;  2QSF X;  3KET A;  3W6V A;  2KP6 A;  1OLT A;  4ZYE A;  2VXZ A;  3U2R A;  2EZI A;  3LSJ A;  1JI8 A;  3KP4 A;  4N4O B;  1P4W A;  1HDD C;  2BXY A;  1U8B A;  1VQN I;  2EZH A;  4XOR A;  3C2B A;  2X1C A;  4B8X A;  4N0B A;  2F5E A;  1D1B A;  3BT9 A;  3TW7 A;  3A1Y A;  3ZMU A;  3PO3 J;  1XX5 A;  4Q47 A;  3RZD J;  2PJR A;  1OCP A;  3S2W A;  1TNT A;  1IRF A;  2GOX B;  3AG4 H;  4XLH A;  2QBY B;  1D0Z A;  1MDM A;  2O6G E;  3IAS 2;  3C3W A;  4HDU A;  2EFN A;  1R49 A;  4D7M A;  2Y69 H;  2JA2 A;  2HQA A;  2W00 A;  3OR1 C;  3PL8 A;  2L4A A;  2X6Y A;  2YR2 A;  3ZR8 X;  4GGG A;  3ZQ7 A;  1BIA A;  5E18 F;  4JX5 A;  1W7P D;  2XIG A;  3GZ5 A;  3RPQ A;  3BR3 A;  1WKM A;  3RDI A;  4RGS A;  2LR8 A;  4F91 B;  2LD5 A;  2DMT A;  2DFF A;  1QU3 A;  3MKL A;  1HA8 A;  2NXN B;  3CCJ I;  2B9S A;  2LYC A;  1X3W B;  3DLA A;  3BR6 A;  3FXO A;  1FEX A;  3ABT A;  2BVM A;  4DOZ A;  1ZRF A;  1KQ0 A;  4AUX A;  2KIM A;  4Y7N J;  3WHC A;  1IW7 F;  2IGK A;  5JHU A;  4HOB A;  1ETV A;  2MC4 A;  5FKN A;  2DOF A;  3F6V A;  4LG3 A;  3U9G A;  3K9T A;  2G9W A;  3O8H A;  4A3M J;  4LIU A;  4W1U A;  1SD6 A;  1A6Q A;  2CV0 A;  1BI1 A;  1ODD A;  1ETO A;  3FXQ A;  3TQN A;  2DYS H;  1EKE A;  1ZR2 A;  4E7K A;  1LKX A;  1M1E B;  1DU0 A;  3CF5 F;  4KFC A;  1JTY A;  5E1W A;  3I59 B;  1XGM A;  3WTX C;  3F9K A;  3DKY A;  3WHB A;  4MEX F;  4CCN A;  3WU0 A;  3CC4 I;  2ID6 A;  3S2D J;  2LFB A;  1H89 C;  4M9Z A;  5E3L A;  1FC3 A;  4XRF A;  5KAI C;  5FLM J;  5JVT A;  4HAM A;  4RDU A;  3PFI A;  3FHZ A;  1HW1 A;  2XDV A;  5BPD A;  3C1D A;  1KU2 A;  4OAY A;  4E6K G;  1V5G A;  2EA4 A;  4CZC A;  3H5A A;  2F5F A;  2WY7 Q;  4JX6 A;  4MGR A;  3ZPL A;  3WG7 H;  3HBL A;  3OYJ A;  1R5H A;  1LJ9 A;  5M5X J;  4MTE A;  4F93 B;  3H1C A;  3LFK A;  1V55 H;  2PBI A;  1YIT I;  3AL0 C;  4WCG A;  2JQ7 A;  3CF2 A;  2P81 A;  2DTR A;  2FBK A;  1HOM A;  2VE8 A;  3B02 A;  4IHT A;  1XGN A;  4I99 C;  1A31 A;  3RPU D;  3CMM A;  3H5N A;  1I1G A;  2F4M B;  4BHP A;  4RB0 A;  1LEA A;  2X1E A;  4UB6 C;  2DXI A;  3CLQ A;  3MKY B;  4AU7 A;  2B63 J;  2DK5 A;  5HS7 A;  4ZTF A;  1B72 B;  1W5S A;  1RUN A;  3MCZ A;  1LDD A;  2DQL A;  2V7F A;  4XNF A;  2LF7 A;  3I55 I;  3V4G A;  2XF5 A;  5EGO B;  2P5L C;  4I2O A;  1Z1D A;  2DA7 A;  5ILU A;  1I1S A;  3LAP A;  3BPX A;  2CWE A;  3HRT A;  4A3D J;  3RQI A;  2LY1 A;  4S04 A;  5L3B A;  1EF4 A;  3OS2 A;  3S1M J;  3PM1 A;  3IWZ A;  5CVI A;  3O3K A;  2CU7 A;  5C4J J;  1BIB A;  3CME I;  3TDU C;  3KZZ A;  2CQQ A;  2VJI A;  4A3B J;  3HHH A;  4J19 A;  1XN7 A;  1UCR A;  4HF2 A;  2DPU A;  2GAU A;  4L5J A;  2WV1 A;  2E5N A;  2V9P A;  3ULQ B;  4KMF A;  3GFJ A;  5IYB J;  1F43 A;  5ICE A;  2ZNY A;  1H8A C;  4U87 A;  3GUD A;  4KT5 C;  2D1H A;  5LEK A;  4I09 A;  4IF4 A;  3FX3 A;  3NQO A;  1J59 A;  4CCL A;  3BG9 A;  2R7T A;  2KZV A;  2FRH A;  5F6F A;  2CH0 A;  4CSW A;  2K9Q A;  4HG2 A;  2E36 A;  3BLY A;  2M34 A;  4BYY A;  2ZXW H;  5CLS A;  1JKO C;  5M5W J;  3OR2 C;  2HQ5 A;  2H27 A;  3DV8 A;  2M9H A;  3DPT A;  3HPH A;  3QU3 A;  4ZYG A;  1D1C A;  2F6C A;  2W1O A;  4HST A;  1K61 A;  3EPZ A;  1S6L A;  1B8I A;  2PMZ N;  3CO6 C;  1WFX A;  4Z6Y A;  1BOB A;  2E60 A;  5H20 A;  4ITV A;  3VEP A;  3OYN A;  1MSE C;  1T39 A;  2KIU A;  2K5C A;  3HXL A;  1JUM A;  5J1Y A;  1MKM A;  1UST A;  3HUG B;  1Y0U A;  2R5Y A;  2DA1 A;  2Y9Y A;  2FEZ A;  3S2H J;  2PFB A;  1VQP I;  2VBW A;  4PCQ A;  1N77 A;  1JKP C;  1V5F A;  3OIP A;  1RIO H;  4DIQ A;  2GLO A;  1VQ4 I;  2JUG A;  2Y75 A;  5GPA A;  4FX4 A;  2NYX A;  5BPI A;  1FY7 A;  4ANJ A;  2Z1D A;  4M72 A;  1SD7 A;  1QNT A;  4YRV A;  2MAB A;  5D5V B;  1Q1H A;  2GM4 A;  2PJR B;  1EH6 A;  1Z91 A;  1TT0 A;  3G1L A;  3QOD A;  2LBF A;  2P8T A;  2EA2 A;  1Z6T A;  4IO9 F;  1Z21 A;  4XQF A;  2HZT A;  4NB5 A;  4HDV A;  1IN8 A;  2GWR A;  1KQ8 A;  2HXI A;  1H9T A;  5DCM B;  2H1L A;  5EGO A;  2YS9 A;  4IHY A;  4HF1 A;  2DQR A;  4CA0 A;  3HOW J;  4D9J A;  2ZNZ A;  1G8X A;  5DDG A;  2BY1 A;  4RAY A;  2KLO A;  1F9N A;  2GIV A;  5GAE J;  4IQJ A;  3IHU A;  3PNT A;  2LKX A;  1O7L A;  4LB6 B;  2XPV A;  2NRA C;  1Z05 A;  2FNA A;  1FPQ A;  3LA7 A;  1SFX A;  4M3D A;  3KFW X;  3LOC A;  1U6G A;  5KCM A;  4G6T B;  3CDI A;  4XRS G;  2EV5 A;  2KZG A;  3A2K A;  3ABU A;  4Q48 A;  3CC2 I;  3TO7 A;  2LMD A;  3TO9 A;  3Q3S A;  5D8L B;  2MH2 A;  3R61 A;  2L7F P;  1SMT A;  2JN6 A;  2L9V A;  5ERI A;  1QHH D;  5L3C A;  2XAJ A;  3LAJ A;  2RNJ A;  2EFO A;  5LLQ A;  1X4P A;  1NHA A;  3HB9 A;  3EQL F;  4M6X A;  4C9Y A;  1FT9 A;  3NWS A;  4D0P A;  1J9I A;  2HWV A;  3FF5 A;  4NC8 A;  4PJJ A;  3M8E A;  2F48 A;  4EGZ A;  1PP8 F;  1WI3 A;  2Z2S B;  1R23 A;  3B6C A;  2DJI A;  2FML A;  2K3F A;  4A3F J;  1S3J A;  3V7R A;  1FTZ A;  2VKV A;  2DLL A;  2ZJQ F;  4CCM A;  1IRZ A;  1MBE A;  2K9M A;  1D0X A;  2D1V A;  3D5L A;  3NAU A;  2W57 A;  2COB A;  1OQY A;  3R60 A;  1IN6 A;  5GAH J;  2W82 A;  2ESH A;  4LFU A;  2DFH A;  3MVP A;  1ITY A;  2XAQ A;  1UG2 A;  5H6Q A;  2ZXH A;  1E2X A;  4UY8 I;  3TMO A;  4EVI A;  5CKT A;  4L9T A;  3KYL A;  1G4D A;  1IN4 A;  2WA0 A;  3JSP A;  1ZN2 A;  2DU9 A;  3GFI A;  1IGN A;  1D0Y A;  1FZP B; 
#chains in the Genus database with same CATH homology
 3TW6 A;  1UMQ A;  3LSP A;  1GT0 C;  2HXO A;  3LSG A;  1IV6 A;  1YRN B;  3FKI J;  3S1Q J;  3GTK J;  2MW8 A;  3LNQ A;  5FKO A;  4V2G A;  1K83 J;  1WH7 A;  3S16 J;  2ZB9 A;  3VPR A;  4CYC B;  2MSY A;  2HDD A;  2DA5 A;  3JRH A;  4A3I J;  2E2J J;  4HNV A;  1JT6 A;  1UHS A;  1ETW A;  1ETX A;  1ZTR A;  1Y1V J;  3JRF A;  2HYJ A;  3GTM J;  1NK2 P;  2NVX J;  5K7Z A;  2LY9 A;  4LOC A;  2DA4 A;  4GFB A;  1I3Q J;  2JWT A;  1IDZ A;  1SAN A;  1Z77 A;  4BKX A;  2ID3 A;  1QVU A;  4A3L J;  3PO2 J;  1HF0 A;  2O8K A;  1GV5 A;  1T33 A;  3A03 A;  1MBH A;  5JLW A;  5IOZ A;  2X9D A;  4FCY A;  1QVT A;  2M8G X;  2NS8 A;  3TP3 A;  3ZQG A;  2DMQ A;  4A93 J;  1OJL A;  3HOX J;  1ZQ3 P;  2HOS A;  1JGG A;  1W0U A;  3ZQI A;  1RET A;  1P7J A;  4IHX A;  4FTH A;  5F0H A;  1RKT A;  1NK3 P;  1RKW A;  2Y30 A;  2DN0 A;  3HGY A;  5M3F J;  5FLV A;  4JX4 A;  3ZQL A;  1O4X A;  3QQA A;  2XRL A;  4A69 C;  5F08 A;  4X6A J;  2AHQ A;  1U78 A;  1P7I A;  5EG0 A;  1F36 A;  5IYC J;  1ORK A;  3Q0U A;  1B72 A;  1X2N A;  3UKG A;  4FE7 A;  5K7F A;  2FQ4 A;  3ZOB A;  5FKK A;  1IUF A;  1VFC A;  3JRE A;  2XPU A;  2CRG A;  3HOV J;  4A3K J;  2DJN A;  1MBJ A;  3I4M J;  1POG A;  1ETK A;  3JRG A;  3BR0 A;  3BQY A;  1JUP A;  4V2F A;  1NTC A;  3OSF A;  3ZQC A;  2XGC A;  4QTR A;  4B4C A;  4UUS A;  1AHD P;  3BTC A;  3G1O A;  3Q0W A;  5HOD A;  2VUM J;  4A3G J;  2R5Y B;  2ECB A;  1ENH A;  5GP9 A;  9ANT A;  3JR9 A;  1BW6 A;  1HDP A;  5F27 A;  2EH3 A;  1OCT C;  3QPS A;  3FIW A;  2XSD C;  4DYR A;  1AKH A;  4M3E A;  3OOU A;  2E2I J;  2O7O A;  1GVD A;  1GDT A;  3SDG A;  2DMN A;  4XRM A;  2K40 A;  5C44 J;  4RBO A;  4L5E A;  2CUF A;  3W6V A;  1XG1 A;  3RZO J;  2EZI A;  3LSJ A;  1HDD C;  2FJ1 A;  1JJ6 C;  1U8B A;  2EZH A;  3C2B A;  1XS9 A;  3I4N J;  3BT9 A;  3BR5 A;  3TW7 A;  3BTJ A;  3PO3 J;  5EZH A;  1D5Y A;  2IAI A;  3BG5 A;  3RZD J;  3CCY A;  1OCP A;  4W97 A;  5IP9 J;  3BR1 A;  1ETY A;  2K9N A;  2VI6 A;  2EZL A;  2JA5 J;  4C3I J;  4D7M A;  5C4X J;  5IYD J;  3LSR A;  1QPI A;  2R92 J;  3HOY J;  2JK3 A;  3S1R J;  3M4O J;  3IH3 A;  3MN2 A;  4M3G A;  1XC5 A;  2JMW A;  1IDY A;  4IHW A;  2WAQ N;  2XB0 X;  5F04 A;  4JX5 A;  3ZQF A;  1DU6 A;  1LFU P;  1IG7 A;  2H1K A;  2KT0 A;  3BR3 A;  2QF7 A;  2ECC A;  2LR8 A;  2DA2 A;  2LD5 A;  2DMT A;  2MGQ A;  3A01 A;  5EYR A;  3MKL A;  2IEK A;  1FIA A;  3IV5 A;  2XGD A;  4M3F A;  2R0Q C;  1MBG A;  3FK7 A;  3BR6 A;  1JTX A;  5IP7 J;  3JRD A;  1IC8 A;  1FEX A;  1Y1W J;  5J1R A;  4AUX A;  4MLO A;  4Y7N J;  3WHC A;  1ZGW A;  1QRY A;  1ETV A;  5FKN A;  3B6A A;  3IH2 A;  3H0G J;  4A3J J;  3O8H A;  4A3M J;  3A02 A;  2FX0 A;  4W1U A;  4QIW N;  1ETO A;  2ME6 A;  1DU0 A;  1ZK8 A;  1ZR2 A;  1I6H J;  4M3B A;  1RES A;  5DTD A;  1JTY A;  1JT0 A;  3WHB A;  4AC0 A;  2KDZ A;  1Q1V A;  1WPK A;  4IEJ A;  4BBR J;  2ID6 A;  5EZG A;  3S2D J;  2LFB A;  2XPW A;  4BY1 J;  1H89 C;  5E3L A;  3GTL J;  3D1N I;  2JA8 J;  2I10 A;  5FLM J;  2JA7 J;  5E3O A;  4RDU A;  4BY7 J;  2Y9Z A;  1WH5 A;  3HGG A;  3BTI A;  1YRN A;  4ABZ A;  4DZP A;  4JX6 A;  2CQX A;  5GPC A;  4C2M J;  1G2H A;  1JUS A;  3HBL A;  4D7N A;  5M5X J;  3BG3 A;  3FIS A;  2P81 A;  1U9N A;  4DZJ A;  2XB5 A;  1HOM A;  5F0C A;  1ZKG A;  4IHV A;  2LLK A;  3JRC A;  2HI3 A;  2MG4 A;  3GBG A;  2B63 J;  1TWH J;  1X58 A;  3JRB A;  1B72 B;  2L0K A;  2XGE A;  3NAR A;  3CMY A;  1LE8 A;  5EEA A;  3JRI A;  2DTZ A;  5EGO B;  1U9O A;  2DA7 A;  5C3E J;  2D5V A;  2LTP A;  3K7A J;  2R93 J;  2L7Z A;  4A3D J;  4MFD A;  3RQI A;  3Q0V A;  1T56 A;  2YUS A;  3HOZ J;  1EF4 A;  3S1M J;  3PM1 A;  2TRT A;  1ETQ A;  2R5Z B;  4JYK A;  2CU7 A;  2M0C A;  2ME0 A;  1JKQ C;  4JP0 A;  2RAE A;  5C4J J;  5K7H A;  1SFO J;  1S7E A;  4XID A;  3OIO A;  3H3V K;  2CQQ A;  4A3B J;  4J19 A;  2X48 A;  2WV1 A;  4FIS A;  3CDL A;  5FKM A;  2Y0S N;  2Y2Z A;  3HM5 A;  4MFE A;  5IYB J;  4A3E J;  1F43 A;  5EG0 B;  4DYC A;  5JLX A;  1H8A C;  4MO7 A;  2AO9 A;  3TP0 A;  1TWG J;  1TWF J;  2HOT A;  1RR7 A;  4DYQ A;  5EF6 A;  3GTO J;  3BG9 A;  3S15 J;  3S14 J;  2CJJ A;  3DEW A;  3BTL A;  2CUE A;  3RKQ A;  3GTG J;  2K9Q A;  3G1M A;  2M34 A;  5M3M J;  3GTQ J;  1JKO C;  5M5W J;  1RPW A;  2HQ5 A;  1A5J A;  2M9H A;  4MIM A;  2WB1 N;  1H88 C;  1K61 A;  3SJM A;  1PUF A;  5EDN A;  1B8I A;  2PMZ N;  5IPA A;  3CQZ J;  1MSE C;  3S1N J;  2OPT A;  3SFI A;  1VI0 A;  2M2E A;  4EEF G;  4D5F A;  1JUM A;  5J1Y A;  2EZK A;  2LK2 A;  5FJ8 J;  1MSF C;  2R5Y A;  3BR2 A;  4FE4 A;  4G12 A;  4B3A A;  1MH3 A;  2DA1 A;  2Y9Y A;  2G0E A;  1ZR4 A;  3S2H J;  2EQR A;  1I50 J;  2OF7 A;  1JKP C;  1X2M A;  2LVS A;  4I6Z A;  3S17 J;  1GUU A;  1HLV A;  2GLO A;  3A01 B;  2ELK A;  2W48 A;  3GTJ J;  3HEF A;  4A3C J;  5GPA A;  1R9T J;  3DCF A;  1BL0 A;  4UUS B;  1AKH B;  2GM4 A;  5F1J A;  2E19 A;  5BNG A;  1A6I A;  2DMP A;  2LP0 A;  2VPR A;  3L1P A;  3HOU J;  4XK4 A;  3G1L A;  5IOY A;  4I76 A;  5J3L A;  5F0F A;  2NS7 A;  5M5Y J;  4CYC A;  1GV2 A;  2Y31 A;  3OSG A;  2HXI A;  3O8G A;  2NVY J;  5EGO A;  4M6V A;  2YS9 A;  1MBF A;  4IHY A;  2E2H J;  3HOW J;  4D5C A;  2L7M P;  3F0C A;  3QPL A;  3M3Y J;  3ZQH A;  2HOA A;  2LKX A;  2XPV A;  1CQT A;  1APL C;  1E3O C;  2H8R A;  4M3D A;  2NVT J;  3LOC A;  2FD5 A;  2QCO A;  1OFC X;  4B1R A;  1TWA J;  2N8G A;  4XRS G;  4DW6 A;  5IP6 A;  1TWC J;  3Q3S A;  1WGX A;  1JJ8 C;  2EBI A;  3JRA A;  3HDD A;  2L7F P;  4AYB N;  1BJZ A;  2JN6 A;  5FKL A;  1MH4 A;  1WCM J;  3BQZ A;  2L9R A;  1FIP A;  1IJW C;  2NVQ J;  4X1E A;  2GBY A;  3HB9 A;  1HCR A;  2R5Z A;  1B8I B;  1Z0X A;  4UUT A;  2DA3 A;  2JJ7 A;  1LE8 B;  4Y52 J;  2K9S A;  4C3J J;  4QSH A;  1WI3 A;  2E1O A;  3E7L A;  4XRS A;  3B6C A;  4C3H J;  3IH4 A;  1JKR C;  4A3F J;  1FTZ A;  2VKV A;  4S0H B;  1AU7 A;  1IRZ A;  2X6O A;  1MBE A;  3FK6 A;  4XIC A;  1MNM C;  4BXX J;  2IBD A;  3NAU A;  5J1U A;  2COB A;  5DS9 A;  2DA6 A;  2TCT A;  2YU9 J;  2DMU A;  3GTP J;  3MVP A;  4NDL A;  1ITY A;  3HKZ N;  1W0T A;  1UG2 A;  2R7Z J;  5E3N A;  2O9L A;  1FTT A;  1TC3 C;  1BA5 A;  2JA6 J;  1FJL A;  3K2A A;  5E3M A;  1BW5 A;  4BBS J;  1MBK A;  1LFB A;  2NOG A;  2VKE A;  1VF9 A;  1IGN A;  1VND A;  3TED A;  1PUF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...