2LD5A

Solution nmr-derived complex structure of hoxa13 dna binding domain bound to dna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
67
structure length
67
Chain Sequence
GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Hox-A13
publication title Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 24
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ld5A00
2DJNA 2N8GA 2Y9ZA 2ECBA 2DA2A 2R5YB 3BR6A 5E3OA 1QPIA 5IP9J 5EGOA 1RESA 1TWGJ 2Y0SN 3JREA 1WH5A 1JUSA 5E3NA 1MBFA 4BXXJ 3K7AJ 2EZKA 2HXOA 3LSJA 3OIOA 1H8AC 1S7EA 5FLMJ 1HDPA 5F0HA 4IHYA 1ETQA 3RKQA 3JRFA 2DMTA 3TW6A 4A3CJ 1W0TA 5IYDJ 3DCFA 1LE8B 1TC3C 2VKVA 1AHDP 1JKOC 4B1RA 1ETYA 3MVPA 2E2IJ 4XK4A 2E1OA 3JRGA 3I4MJ 3LOCA 2K9QA 2DA1A 4RDUA 1H88C 4QTRA 3BR0A 3WHBA 3MKLA 1XG1A 3BQZA 3JRBA 1TWFJ 2CUEA 5IOZA 3A02A 2EQRA 1O4XA 1AKHA 1IDYA 1JKRC 2L7FP 5EEAA 4C3HJ 5IYBJ 4IHXA 1ITYA 3FIWA 2VI6A 4Y7NJ 1UG2A 2TRTA 3S1MJ 1RETA 1RPWA 2L7MP 4JX6A 2OPTA 2XSDC 2R5ZA 2EZLA 5F0CA 1AU7A 4D5CA 2Y9YA 2TCTA 3BTCA 1ZGWA 1T56A 4J19A 1FIAA 4UUTA 3S15J 2FJ1A 1P7IA 4A3FJ 1A5JA 3ZQGA 2X9DA 2JMWA 3LSGA 4DYQA 2MGQA 2LP0A 3SDGA 1DU0A 1ETKA 3SFIA 4A3GJ 1PUFA 1DU6A 2M2EA 2EH3A 2NVTJ 2IAIA 3G1MA 4HNVA 2XPUA 2W48A 4MFDA 1B72B 3FISA 1MH3A 2IEKA 2DTZA 1WH7A 4AUXA 3BR1A 3HDDA 2YUSA 4S0HB 2LFBA 4XIDA 2JA5J 4AYBN 1A6IA 4B3AA 1JJ6C 2FD5A 3L1PA 1FEXA 2RAEA 1ETXA 3JRDA 5C4XJ 2DMUA 1HCRA 2JA8J 2NOGA 1F43A 2CRGA 2OF7A 1T33A 1UHSA 2JWTA 2JK3A 3B6CA 5IP6A 2LVSA 1ZQ3P 1X2NA 2ZB9A 2NVQJ 5M5YJ 2P81A 1JTYA 3Q0WA 2LTPA 4D7NA 4QSHA 3ZQLA 2ID3A 3BR2A 4A3JJ 3HB9A 5IYCJ 2X48A 4L5EA 3BT9A 1F36A 3BR3A 3GBGA 2NS7A 2K40A 3HOXJ 3ZQIA 2ID6A 2KT0A 4JX5A 2COBA 1QVTA 3BTJA 1ETOA 1BJZA 1HOMA 3S1QJ 4GFBA 3Q3SA 1B8IA 4EEFG 4DYRA 2I10A 1Z77A 2HQ5A 2FX0A 2G0EA 4FISA 1ORKA 3HOVJ 2AO9A 2CUFA 1IV6A 5EZHA 5FJ8J 1D5YA 2XGCA 4IHWA 3K2AA 2FQ4A 2NVYJ 4UUSA 1IUFA 1HF0A 5EG0A 4FE4A 1ZTRA 3HGGA 3W6VA 1JT6A 2DA4A 1MH4A 3JR9A 4XRMA 5EGOB 1NK2P 5C3EJ 3E7LA 5E3LA 5K7ZA 5EG0B 1CQTA 5FLVA 3IV5A 2R93J 1ZK8A 1POGA 1VNDA 2K9NA 4M6VA 5F27A 3GTQJ 4G12A 3O8HA 1Q1VA 1IJWC 2O8KA 2R7ZJ 1IGNA 4IEJA 3FK7A 2M0CA 5EYRA 3S2DJ 4I6ZA 3PM1A 3I4NJ 2K9SA 1FJLA 4I76A 3GTMJ 5FKKA 2GM4A 1H89C 3BG5A 5F1JA 2ECCA 2M9HA 3O8GA 3D1NI 2HOSA 3NAUA 2HXIA 3JRCA 3S1NJ 1SANA 5C4JJ 2EZIA 1LFUP 2LY9A 2M8GX 3G1OA 4X1EA 1JGGA 4C3JJ 2JA6J 3TP3A 2Y2ZA 2IBDA 3HOYJ 3S16J 4A3DJ 2H1KA 4A3IJ 1UMQA 2XB5A 4Y52J 4V2GA 2VUMJ 3BQYA 2LLKA 3HEFA 1ZR4A 4A93J 1AKHB 2DN0A 1JKQC 2JA7J 5F04A 1BL0A 3VPRA 3TP0A 2XGEA 3F0CA 4MIMA 4IHVA 5E3MA 3HGYA 2GLOA 3DEWA 2CJJA 2R5ZB 3M4OJ 3OSGA 1GT0C 1HLVA 1XS9A 1X58A 2JJ7A 3LSRA 1OJLA 1GVDA 1TWHJ 4MLOA 3A03A 4CYCA 1PUFB 3Q0UA 5J1UA 5K7FA 2GBYA 1OCTC 5HODA 2HYJA 2PMZN 1FTTA 2EZHA 2WB1N 2LK2A 2KDZA 2ELKA 2MW8A 2R0QC 1QVUA 3BTIA 1MBJA 2M34A 4BBRJ 4M3DA 2MG4A 4M3BA 2MSYA 2Y31A 2DA7A 2L9RA 4M3EA 1MBKA 5GP9A 3HOZJ 1RKTA 4M3FA 2WAQN 1JTXA 2LD5A 5K7HA 5BNGA 1X2MA 2E2HJ 2QCOA 2DA6A 1U9OA 5M5XJ 1WCMJ 1I50J 4BY7J 3LSPA 1JUMA 2HOTA 1VI0A 3CCYA 4MO7A 3ZOBA 5F08A 1WGXA 4X6AJ 5GPAA 1Y1VJ 3OOUA 1K61A 5JLWA 3A01A 4XRSG 2R92J 4RBOA 3GTGJ 3ZQCA 1G2HA 1Y1WJ 1ZR2A 3GTOJ 1Z0XA 3FKIJ 1MNMC 4A3LJ 2QF7A 1I6HJ 2B63J 1BW5A 3A01B 1B8IB 4JP0A 1ETVA 2DA3A 4JX4A 4XRSA 2O9LA 4LOCA 4D7MA 2R5YA 5GPCA 1WPKA 3TEDA 4A3MJ 3JRAA 3S1RJ 4UUSB 2HDDA 3H3VK 1HDDC 4C2MJ 5M3FJ 1IRZA 1EF4A 2DMNA 3C2BA 5F0FA 1NK3P 2JN6A 1SFOJ 1WI3A 4W97A 3IH4A 4DZPA 3BG3A 1GDTA 1BA5A 2DMQA 3QPSA 3B6AA 3BG9A 3CDLA 3PO3J 1IC8A 5J3LA 3JRIA 4A3EJ 4V2FA 5J1RA 4A69C 1VFCA 1JKPC 3CQZJ 3UKGA 1LE8A 3Q0VA 3S2HJ 1GV2A 1P7JA 2CQXA 1IDZA 3H0GJ 3CMYA 1JT0A 1I3QJ 3BTLA 4B4CA 2NVXJ 2ME6A 1GUUA 9ANTA 1MBGA 1W0UA 1FTZA 3HBLA 3LNQA 3RQIA 3GTJJ 4A3KJ 4XICA 2DA5A 1MBHA 3HM5A 1OCPA 4C3IJ 1NTCA 3QQAA 5FKNA 3M3YJ 4BBSJ 1JUPA 4MFEA 1MSFC 5FKMA 5J1YA 1ETWA 1TWCJ 2LKXA 4DYCA 2XGDA 2E19A 3OSFA 4AC0A 4BKXA 2EBIA 1MBEA 5IPAA 4DW6A 3SJMA 1MSEC 5FKOA 1IG7A 4D5FA 1LFBA 5FKLA 3ZQHA 1R9TJ 2XRLA 3HKZN 2E2JJ 2XPWA 1ZKGA 2HI3A 2O7OA 4M3GA 1B72A 5EF6A 2VPRA 4CYCB 3IH3A 4ABZA 3PO2J 5EZGA 2HOAA 2AHQA 2DMPA 5JLXA 2X6OA 5DS9A 5C44J 3QPLA 3TW7A 2L7ZA 4FTHA 2XPVA 1U78A 1U9NA 1JJ8C 4A3BJ 4BY1J 3RZDJ 3JRHA 5IOYA 3FK6A 2L0KA 5DTDA 1YRNA 4JYKA 1GV5A 2WV1A 2NS8A 1QRYA 3MN2A 2YU9J 4QIWN 1K83J 3GTPJ 1VF9A 3WHCA 3S17J 4FE7A 3S14J 1OFCX 1RR7A 2D5VA 1E3OC 1XC5A 3GTLJ 1YRNB 1U8BA 5IP7J 2Y30A 2LR8A 5M3MJ 3HOUJ 3BR5A 1FIPA 4DZJA 2VKEA 1ENHA 2H8RA 2YS9A 1TWAJ 3NARA 2ME0A 3IH2A 5M5WJ 3G1LA 2CQQA 3GTKJ 3HOWJ 3RZOJ 2XB0X 3ZQFA 2CU7A 4FCYA 4NDLA 5EDNA 1APLC 1RKWA 1BW6A 4W1UA
chains in the Genus database with same CATH superfamily
4AYBA 1L3LA 3D0SA 4YELA 3J81K 5ICFA 2I5UA 2XDVA 5E3OA 2XHKA 1U3EM 5IP9J 2VQGA 3ZMDA 1TWGJ 1VQ5I 2MFZA 4JK1X 2JZYA 1GLNA 2H94A 1G59A 4LIUA 4WCGA 2EZKA 5HS9A 3LSJA 2QBYA 3M8JA 1N75A 1H8AC 1S7EA 4BJTA 5FLMJ 2CG4A 2QWWA 1QQIA 3GX4X 1JI8A 4JOMA 2HS5A 1HDPA 3HZJA 2OAZA 3AG3H 3ZMVA 1QHHD 2WWYA 2BY3A 2HDWA 2DMTA 2LH9A 3ASNH 4XQFA 3CUQB 2DYSH 1TC3C 3GMEA 2HPIA 1JKOC 3WE3A 3LQQA 1ETYA 2E2IJ 3F9KA 4XK4A 3I4MJ 3LOCA 4KIBA 2DA1A 2OQRA 4OWRB 3MKZA 3DFGA 4YFNF 2DBBA 1FY7A 1XG1A 1TWFJ 4NHJA 2CUEA 1FYMA 3CUOA 4HV6A 4IF4A 5CQGA 2P6TA 3GLLA 4KDPA 2EQRA 4KIGA 3LA7A 5HS8A 4RMNA 1O3SA 3TDZC 3BG6A 1O4XA 1AKHA 1IUYA 1A04A 4WXCA 1OISA 3FM5A 1D8KA 1LEBA 5IYBJ 1ITYA 2VI6A 2X6XA 4Y7NJ 2FQ3A 2ZMEA 2IA0A 2L7MP 2FNAA 1BI2A 4IXAA 2OPTA 5E79C 2EZLA 1AU7A 3CZ6A 4XBFA 4D5CA 3PNYA 2TCTA 1ZGWA 1K4SA 1DGWY 1KU2A 2OZ6A 3MKYB 2MGQA 1N25A 3H3ZA 2OA4A 2VC0A 3SDGA 1OR7A 4RM3A 4A3GJ 4E7HA 5DCFA 2M2EA 2NVTJ 2L9VA 2UXXA 2IEKA 1KU7A 1IN8A 3DLAA 4S0HB 4F3QA 1WJBA 1XX5A 4B3AA 1JJ6C 3L1PA 3ISPA 5JVGF 1F1ZA 1FEXA 3VB2A 2P6SA 2WAFA 4E6KG 3BOQA 2F5CA 2JA8J 2E35A 1LDKB 2WAEA 4O6JA 1A36A 1F43A 2HKOA 5GAHJ 1IO2A 1UHSA 3E5XA 2JVHA 2HTJA 1ZQ3P 2CQ7A 4RS8A 4CGZA 4IOAF 2P81A 4WXHA 1LVKA 4DJAA 2M5WA 1F4KA 3DWLE 4N0BA 2OZUA 3BR2A 2IGKA 5IYCJ 1C0WA 5H2FC 3CP8A 2WADA 3BR3A 3R0AA 4KMUX 3JTHA 3P5JA 2ID6A 2IXSA 2ZFUA 5D8LB 1J09A 1KYWA 2COBA 3BTJA 1BJZA 3SZGA 3S1QJ 3ZQ7A 1LQ1A 3JSPA 1FWZA 2FA5A 2OUMA 4RB0A 1AWCA 4FISA 2WB1A 3W2AA 2XGXA 3SHFA 2ZC2A 4H4KC 5EG0A 3S3NA 1VQOI 2M45A 2V79A 3W6VA 4CCLA 4CSWA 3JR9A 4XRMA 4I0AA 2VE8A 4AVPA 1QNTA 3PQJA 4HYEA 2YU3A 2NVUB 1POGA 1R22A 1IV8A 3RKWA 4BU2A 3F6OA 1Y8RB 1X1BA 3CESA 1TQMA 1FMWA 1EJ9A 3DPUA 5CVUA 2R7ZJ 2JVGA 4EATA 1CF7B 2ELJA 5HDNA 4IEJA 3T1BA 4ZTJA 4BXFA 3MKWB 2MH2A 2K4BA 3S2DJ 3IWZA 2YR2A 3GXOA 2L01A 4F7ZA 1S5LC 1O3TA 2HTSA 1JHFA 1K7AA 1R49A 3MAJA 3BG5A 2XROA 1Y39A 3DTKA 1KYZA 3O8GA 3K1PA 3L00A 2CFOA 1S6LA 2HXIA 4ENKA 5C4JJ 3TP3A 2QQAA 2IBDA 2Y2ZA 3HOYJ 3HXLA 3KYLA 5HLGA 2BY1A 4F52A 1ONVA 3LWFA 3BROA 4A3IJ 1SD7A 5B5EC 4Y52J 2I8DA 4P1WA 5CJ9A 3NRVA 3WG7H 3HEFA 3DBLB 3EQLF 3WTVC 3V7SA 1GXPA 4AIKA 1K4TA 4UB8C 5F04A 2XGEA 2V9VA 2QKMB 3K4CA 4BEHA 4ZJZA 1ZREA 3I54A 4ZYEA 3CP2A 2R5ZB 3M4OJ 3LFKA 3Q9VA 1IXSB 1GT0C 3S3MA 1X58A 1K78A 1G8XA 1SFKA 2IS4A 3HHHA 2ICWG 1GVDA 1HSJA 3QP5A 4NC6A 1TWHJ 4XORA 4A6EA 4MLOA 3HSFA 3BJAA 3BDDA 4CYCA 1SC7A 3ZXSA 1FYLA 2AXTC 2QVOA 3RPQA 5J1UA 3PFIA 2EZHA 2ZO4A 2LK2A 1LDDA 2KIQA 1MMDA 2HQAA 1ACIA 1H9TA 1QVUA 1MBJA 4BBRJ 1Z6RA 3LL7A 2PMUA 4XNFA 4NB5A 5FROA 2DT5A 2VBYA 3L2UA 1MBKA 1I1GA 5GP9A 3HOZJ 4ON0A 4FQGA 1T6SA 4M3FA 2WAQN 4CHUA 3K70D 5LGUA 2LD5A 2XC7A 5JVTA 4OINF 2HNHA 5BNGA 2E2HJ 3HL2A 3OL3A 2QCOA 5E8GA 1R23A 2DA6A 3CCSI 2V1UA 4HF2A 2QA4I 3GF2A 4BGDA 3LSPA 4NQWA 2HOTA 1JUMA 3ZOBA 1GXQA 5F08A 2KIUA 3OYNA 4B8XA 5L3BA 4X6AJ 5GPAA 3WGHA 5D5UB 2ZCWA 2KIMA 4XLCA 2B0LA 2K9LA 3PUBA 5TGTA 3SEZA 1Y0NA 5JLWA 4EMSA 3A01A 1R1TA 1UB9A 5FFZA 4XRSG 4LLNA 1E2XA 1SVLA 1REPC 1Y1WJ 1ZR2A 3AG4H 4FX0A 4RGSA 5D4SA 1IRFA 3M9AA 2M0MA 1I3AA 1B8IB 4OIPF 4ZYDA 1D1BA 3C3WA 2XKPA 4LOCA 2VL8A 5ILVA 3QAHA 5GPCA 2FF4A 4EV0A 3E6BA 4UUSB 1B4AA 1XPXA 1IRZA 4A2UA 3KX2A 3CD6I 2JN6A 1SFOJ 1R36A 3F8BA 4C30A 2RREA 3HUGB 1WVRA 3LSMA 2YPRA 1SFEA 1O7FA 4PSWA 1FBSA 3REOA 3WU0A 4A69C 4A0YA 1LE8A 3S2HJ 1W5SA 3OYEA 1GV2A 1DPUA 1RUOA 1SAUA 4AD9A 3H0GJ 1JT0A 1I3QJ 4XN0A 4B4CA 2ME6A 1U6GA 1BR1A 1MBGA 4O3MA 4LG3A 5DCMA 4CCNA 3GTJJ 4HSRA 1OCPA 4Z6YA 5LGTA 1PVEA 3OS2A 2BYVE 1FBQA 4ZYAA 3QRFF 4WWCA 2X85A 2ZSHB 2VQLA 3VYUB 4XM3A 1FP1D 4BBSJ 3HTSB 1G6NA 2LKPA 3FM3A 2E7XA 5HNFA 5FKMA 4HQMA 3FHZA 5DDGA 3V8KA 1ETWA 2LKXA 4YRVA 2ZKZA 3U2RA 1R5GA 4ESBA 2E19A 3F8MA 3OSFA 2QM3A 4BKXA 1V4RA 1USTA 4BH9A 3QU6A 2L7KA 2E1MB 4P9FA 3OS1A 4DW6A 2FEZA 2E1NA 2DJIA 2OU2A 1A6QA 4HBLA 3X2QH 1YS7A 1LVAA 5FKLA 2PI0A 2OCEA 2XRLA 2XPWA 2R7QA 4MTDA 4RLFA 4AIDA 2P7CB 3F21A 1FT9A 2O7OA 1SVOA 4AU7A 2QQ8A 1YX3A 2AHQA 3RYRA 4LD5A 4UXNA 2DMPA 1EA3A 3PIOF 4L18B 4XL9A 1X1DA 3ECOA 3M07A 3GZNB 2ZNZA 3QODA 4YIRX 4BXUA 1Z7UA 1Y0UA 3E5UA 4IQJA 2V6CA 3RI4A 1U9NA 1QPMA 2A3SA 1U78A 1JJ8C 2A05A 2DYRH 2D2WA 3RTRA 2PEXA 3L09A 3VFZA 5FD5A 5GTHC 3R60A 4GYIA 2FMLA 3VYTB 3GVAA 2L0KA 2RDPA 1YTYA 1W7PD 3DPLC 4LGWA 1OYYA 2NS8A 2QUFA 4MEYF 5LLQA 4CDGA 2FUG2 3GTPJ 4I7HA 4XN3A 1VF9A 5ERIA 3WHCA 3C1DA 1OFCX 1TT5B 3P9IA 2E36A 3FXQA 1FC3A 2W85A 4HOBA 3K0LA 2Q1ZB 3HOUJ 3BR5A 2XIGA 2H8WA 4LMYA 1OCZH 3QYEA 2H8RA 3K4KA 3E6CC 3WTZA 3IAM2 3IH2A 2COMA 3G1LA 2CQQA 2VC1A 3DF8A 2IS2A 1U5TC 2QYOA 2HWVA 3OR1C 2EV5A 4C9YA 2XB0X 4OIRF 2IA2A 4KT5C 2EFPA 4UHTA 1APLC 1BW6A 4W1UA 2O8XA 2DJNA 3ZGKA 6PAXA 2ECBA 1GVJA 2AQFA 1VQ8I 3N97A 2OV7A 3BR6A 4XLNF 4LIVA 2R5YB 2FOKA 5EEGA 4WXDA 1VTNC 1YW9A 2UXNA 1RESA 1ULYA 1E3PA 2M7BA 1IN6A 3C2GA 1HC8A 2BV6A 2MH9A 3G3ZA 2VOPA 3NWSA 4BXXJ 2HVSA 1AOYA 2HXOA 2W4SA 4WX9A 2J5OA 4CCOA 2P5LC 1T38A 2RN7A 1VQMI 2KMUA 4XLAA 2BGCA 2ACJA 3PL8A 1FMVA 2EIKH 3LAPA 1JHHA 5F0HA 4IVNA 3RKQA 3JTGA 4XKVA 1VQPI 2NAZA 2VQHA 3OYFA 5BOXA 2ZMEC 1ZGAA 1VQ4I 3DCFA 3W2WA 3WE2A 1YJWI 5CVJA 4L5JA 2V26A 1AHDP 5GAGJ 2KJCA 4CZZA 4NNJA 2E1OA 3JRGA 1KGSA 4XR6A 4PDKA 3DTIA 1H88C 1BM9A 3MKLA 1X4PA 2V9KA 3BQZA 3JRBA 1F5TA 1VQ7I 1OR7C 1XCBA 3H3UA 5IOZA 2O5RA 1J2XA 4Y4RA 1TQIA 5KHDA 3KYDB 4HEA2 4KYWA 4HG2A 1WJDA 1IRGA 5BPIA 2ETHA 2LBFA 5L3DA 2L7FP 5HNHA 3ABLH 4U0YA 2X51A 3C18A 2A61A 4RAZA 2X6WA 3HJEA 4GCVA 2TRTA 3JW4A 2RQQA 1RPWA 3BCBA 5F0CA 2MLGA 1T0FC 2Y9YA 1Q1HA 4QPOA 4XLEA 2FJ1A 2K5CA 2CH0A 3LSGA 4KIFA 4DYQA 5JI6A 3BPVA 2LP0A 2DOEA 1PUFA 1T98A 2FSWA 3O3KA 5BPDA 4HNUA 4HNVA 3I59A 1MH3A 5ICCA 1V3FA 4RAYA 1UCRA 2DPUA 2O61A 2CUJA 2YUSA 3TQNA 2JA5J 1A6IA 4PSXA 2FD5A 1T8IA 3V8JA 3VODA 4BS9A 2FOWA 2RAEA 3BLYA 2XAFA 5HS7A 3KETA 1FOKA 2NOGA 4G94A 3V7RA 2XAUA 2CRGA 2W57A 2EB7A 1Z91A 2JWTA 4OMZA 2JK3A 4IL6C 1K6YA 5IP6A 3E6MA 2PX9A 4UV8A 1X2NA 2CWEA 5D5VB 5LHIA 1TL8A 2NVQJ 2LRDA 2LTPA 1TNTA 5H20A 4EGYA 3GZ6A 3TKYA 3WTXC 3HB9A 2JQ7A 2ESHA 1F36A 5BQTA 2K40A 3HOXJ 3ZQIA 2KT0A 4KFCA 3ESWB 5IT9Z 2IW5A 3DU6A 4H0EA 3H0DA 2Z2SB 1HOMA 4GFBA 4P96A 2K86A 5A2QK 3TO7A 4EEFG 1I27A 2G7UA 5KK1A 4DYRA 1ON1A 3CCUI 2HQ5A 3FZVA 3D5LA 2FX0A 5TJJA 3F22A 1STZA 2HVRA 1EKEA 2G0EA 1FPQA 1S3JA 3K4JA 3HOVJ 2CS3A 2AO9A 2KJBA 5EZHA 4ENJA 1D5YA 1U0JA 2FQ4A 2NVYJ 4LK1F 4AWXB 3WTYC 1R6RA 4IHSA 2VPLA 4BDYA 2DA4A 3FXLA 1MH4A 1BR4A 5EGOB 2Q2EA 2JUCA 5D5WB 4EJWA 5JFRA 4I99C 4U7BA 3JAMZ 1D1CA 4HQEA 1U5TA 5TRDA 5EG0B 1CQTA 1XTAA 5FLVA 2JRTA 1WWXA 2WAQA 3WTWC 4N9IA 5F27A 3GTQJ 2JSCA 1JXSA 1IGNA 1XDSA 4MQ9F 3KZIC 3KIOA 2BBYA 5JR3A 2V7FA 2EIMH 5LEKA 3KEOA 1FOWA 3T5XA 1H89C 3F8CA 3FX3A 3W6JB 3D1NI 1J5YA 4GYGA 4BDZA 1FSHA 4BE0A 3H9QA 2HOSA 3E97A 2GQQA 3NAUA 3S1NJ 1YJNI 2LY2A 5AIQA 2LY9A 3G1OA 5F6FA 2L54A 3K9TA 4C3JJ 2Z9OA 2JA6J 1T95A 3I0TA 2XF6A 3S16J 2DI3A 2M4GA 2E5NA 1FOYA 2HYFA 2NNNA 1YS6A 2VUMJ 3BQYA 2LLKA 2LF8A 3OYCA 1ZR4A 2KRFA 3K6GA 3DU5A 2F48A 3HSEA 2CW8A 1W7PA 3CLQA 3ZMUA 1BL0A 3KZZA 3VPRA 2JA7J 3G2BA 1XSDA 1QU3A 4S04A 2HDCA 2NXNB 3H1CA 3BWGA 2X1DA 4PJNA 3DEWA 2M8EA 1TT0A 1MMAA 1ZRCA 3KP3A 2F4OB 1TZLA 1P4WA 3S8PA 1I5ZA 2DODA 1BOBA 3EETA 2DTRA 3FMQA 1LFPA 3V4GA 3FXOA 3I4PA 4PJLA 1LKXA 1OJLA 5D8KB 1QA6A 4B44A 5K5RA 1ZLJA 2ZXIA 1TNSA 1D0ZA 3P7NA 5JHUA 1FSEA 5F1RA 4IPAA 1OCTC 5B3SH 1NG7A 3GLXA 5D6FA 1FNNA 4UUVA 1T0FA 1J0RA 4QPQA 1KQ0A 4ITVA 4XSXF 4HV5A 4E7KA 1QHGA 2M34A 4ZH4F 4M6YA 4M3DA 2MG4A 2Z5UA 3IKTA 2DA7A 5HLTA 1PP8F 3HHGA 2DW4A 4PJJA 2VKHA 1H0MA 2VQCA 1L0OC 2CSOA 4RGXA 5DD8A 5K7HA 3CMMA 1X2MA 4XKCA 3G73A 1U9OA 1CGPA 1WCMJ 3VDXA 2STWA 5FLXZ 4MO7A 3ZQQA 2BXZA 4LG0B 1W5CC 5GADJ 4RLQA 3GFMA 3MD2A 4UB6C 3HPGA 1K61A 3L9FA 1KZHA 1XGSA 1EH6A 1U8RA 5DEQA 1BOAA 5J6XA 2R92J 4EQQA 2R7XA 4ZC3A 3GTGJ 2BW3A 2HQNA 4M9ZA 3ZQCA 1G2HA 3GTOJ 1Z0XA 1Z21A 3FKIJ 1RUNA 1MNMC 1I6XA 2AS5F 4DQ2A 4BHBA 1BW5A 3A01B 3I55I 4KJZA 4JP0A 1ETVA 1WQ2A 1ZGJA 3HTUA 3KP4A 1WHUA 4I0BA 3OIPA 4JX4A 4XRSA 4OIOF 3KE2A 5J40A 4PFPA 4Y15A 2EILH 4A3MJ 2V9PA 3A4CA 3VYRB 4F92B 4M9SA 4P55A 2X6YA 4BAYA 3H3VK 1HDDC 4P5OA 1XN7A 1B59A 4Y17A 2VLAA 1OYIA 2P4WA 1Z67A 4OAZA 5JHFA 1DGRM 2VXZA 2DMQA 1YG2A 4IOCF 3BG9A 3AL0B 5J3LA 3WU1B 3FMRA 1MZBA 1YX5A 3COAC 2QSGX 3WTUC 3CJTB 5J1RA 3OS0A 2VE9A 2CYYA 2DFIA 2WV0A 1MW7A 1JKPC 3CUQA 1R4MB 4GRIA 2QZ8A 4P9UA 3M1EA 2R7OA 3LAJA 4EM2A 1G3TA 2FU4A 3K1NA 1BIBA 2NS0A 3CCQI 5E1XA 3G71I 2XF5A 2ZSIB 1E0EA 4ZTFA 1LJ9A 4LB5A 4ZDOA 1S7OA 1GUUA 3CF2A 4IZZA 1MGTA 3GW2A 3CC4I 2L3DA 2R7WA 1ZG1A 4Q5SF 4D1QA 2ZXWH 3V7CA 4XICA 2DCEA 4CCMA 2BVMA 2YSRA 3I3LA 3IAS2 3IHUA 3L2WA 4GDFA 2IA1A 3HPHA 4C3IJ 2EJRA 1NTCA 3CC2I 3QQAA 5DCMB 3CMAI 1XGMA 4KICA 1MSFC 4E7ZA 3J80K 3A0HC 4IRHA 1T2KA 3FBNB 1TWCJ 1TQPA 2B7EA 2K3FA 1HW5A 2XKOA 3FXJA 4B47A 4DYCA 4AC0A 2XV4S 1W1WE 2A68F 2CW0F 1ODDA 3OYMA 3SJMA 2LC2A 4CZCA 1D8JA 4LB6B 3BCAA 2R7UA 5FKOA 4D5FA 3KP6A 3H36A 3ZQHA 3HKZN 4HX7A 4ZYHA 2D1VA 1KQ8A 4PJMA 1MJ9A 2L02A 3E6DA 3GZ5A 1Z05A 4ABZA 4U0VA 1P9QC 1ZN2A 3RKXA 4U7DA 3PO2J 1B1BA 3ROUA 5EZGA 4CCJA 1B9MA 2H6BA 1LEAA 3ABMH 2E7WA 4NBQA 1A35A 3DKXA 2L5QA 1YHQI 1S9HA 5ILUA 1W36D 4E7IA 3SFZA 4IKFA 3MZHA 2BY0A 3QPLA 4I01A 2PN6A 5LFAA 4BHCA 4L0ZB 2MD0A 2CQNA 1PUEE 1IZ1A 1RRJA 2XPVA 4BY1J 3DBRB 2XAJA 3P9KA 1YW8A 4LLGF 2EPFA 3RQ4A 3RZDJ 2F2EA 3B02A 3EPZA 4EJVA 2ZFWA 5IOYA 3FK6A 2BE5F 2VT2A 3I5UA 2GOMA 5DTDA 2EFNA 2WY8Q 1YRNA 4LLLA 4KUMA 3J81Z 2PG4A 1I1SA 2YU9J 4QIWN 1K83J 3O2PE 3CJNA 5L3FA 3LQRA 1XD7A 3LSHA 1E3OC 1WFXA 2R7TA 4J01A 1BN5A 4HPQA 5IP7J 1U8BA 2Y30A 1YITI 4HF1A 2LR8A 3EYYA 2LG4A 2HZDA 4G6TB 5CVIA 3H5RA 4HLYA 2MD5A 1BC8C 5J8CA 2GZWA 5M5WJ 1T39A 3T0YA 5CVVA 4BQQA 3HOWJ 2MYSA 3ZMZA 2B9SA 4KN7X 1BJAA 1XDUA 4N4OB 1V5FA 4PJ0C 5CPRB 4F91B 3ZQFA 2A6TA 2DXIA 4EM0B 1DP7P 4NDLA 2MC4A 2L9NA 4DOZA 1RKWA 1IXCA 3EUKL 1S8NA 2N8GA 4RB1A 2UZKA 4XKBA 2DA2A 4EJTA 3OL4A 1VQ9I 1D5VA 4BJ5C 2Y0SN 3JREA 3BP8A 1WH5A 1JUSA 5GAEJ 2JTVA 5HLHA 1MBFA 4U87A 3ZMSA 2F5VA 1KQ9A 1MNDA 3K7AJ 3S3OA 2GIZA 2Y75A 1W36C 2MC3A 2V1NA 2EIJH 2P7VB 4A0ZA 1P6RA 2DFHA 2O0YA 4OAYA 1CF7A 4CICA 4E4HA 3GFLA 2QLZA 4LK0F 4IHYA 3H5AA 2IJLA 4HZFA 3K70C 3TW6A 4A3CJ 3IWFA 2R7VA 2DO7A 4ZYGA 1VQLI 1W0TA 3PNVA 2EWNA 4G7ZF 4B1RA 4FETA 2E1MC 4U88A 2BVLA 4QTRA 3BR0A 4RA2A 3LSKA 4XLHA 2KRCA 3ZN1A 2RVCA 2JRMA 3ABTA 2HR3A 3A02A 5HOOA 3CO7C 4BE2A 3J7AO 3EDPA 2AXLA 1ZELA 1IDYA 3MMYB 1JKRC 5EEAA 2VASA 2JPCA 4IHXA 3FIWA 4G8XA 2K4JA 5HDKA 4XONA 3C7JA 2E5ZA 2CV2A 1DUXC 5L3CA 3VSKA 2XSDC 2R5ZA 1F9NA 4ZZLA 1K79A 2LF7A 5CVRA 3ZN0A 4BQOA 2ESNA 1P7IA 1KU9A 1QBJA 1A5JA 3ZQGA 4CO8A 2IT0A 2JMWA 4ESJA 3PSIA 1G4DA 1K6OA 3V8LA 1ETKA 1R5HA 3SFIA 1X4OA 3F8FA 3MZYA 2GXGA 2EH3A 3HG9A 2IAIA 3G1MA 2HKXA 2W24A 2W48A 2XPUA 2Y69H 3KYCB 4MFDA 3FISA 2F4IA 1JE8A 1B72B 4UVCA 2DTZA 1V55H 2CMPA 1RNLA 5KVRA 2P0WA 1NHAA 2LNBA 2LFBA 4XIDA 5FRNA 4CYDA 2KP6A 3DV8A 2HFHA 3I59B 3I53A 4DBQA 2L9SA 1BI1A 2DMUA 1HCRA 2V4JC 2RNJA 1T33A 1WJEA 5E18F 3B6CA 1IAWA 1LDJA 4XOTA 1IN7A 1H9GA 3A1YA 1MKMA 5M5YJ 3TO6A 3L2CA 4UNOA 1JTYA 3Q0WA 4QSHA 3QYFA 4N9HA 3ZQLA 1MDMB 4K2EA 2ID3A 2W84A 3F3XA 2E1CA 4KITB 3CDIA 5LRSA 4L5EA 3MEXA 2UWMA 3BT9A 4QWQA 4Q47A 4QLCU 3GBGA 3KPHA 2NS7A 3OV8A 2DT7B 4XKWA 1EH7A 2WBMA 2GXBA 4UVAA 2FE3A 3ELKA 1QGPA 3H9JA 4JX5A 4CA0A 4A5MA 2EA2A 1QVTA 2GAUA 1ETOA 3HOSA 4HLXA 1NH3A 2XVCA 2FBHA 1B8IA 4B09A 3H5NA 4HSTA 3IRQA 2X4HA 4PUSA 3CCJI 3TGNA 4EM1A 1YJ9I 3L2QA 1Z77A 3PFYA 1ORKA 3DEUA 2CV1A 3ZRGA 1IV6A 4IHWA 2XGCA 5FFXA 3K2AA 2KZGA 4DIQA 3CCMI 4UUSA 1IUFA 1TW3A 5LHGA 1WZ2A 4FE4A 2RGVA 1JT6A 2EV0A 4RM2A 4HDUA 3FHNA 2NYXA 2K85A 5B1BH 3HUGA 5E1ZB 3OYGA 3IV5A 1ZK8A 1RI7A 1VNDA 2R93J 2K9NA 4M6VA 3N4MA 4G12A 5H6RA 3O8HA 2QBYB 4HA8A 1IJWC 2O8KA 1IRXA 1O57A 3FK7A 3I58A 4PGHA 1PP7U 5EJCA 1PDNC 4I6ZA 3WTSC 3PM1A 2K9SA 3RYPA 1FJLA 1XMAA 4I76A 3GTMJ 2HU9A 2TDXA 1S72I 1J9IA 3RJPA 2M9HA 4FASD 4M9XA 3BPXA 3K2ZA 5BS6A 3EUHC 2BHZA 3JRCA 1SANA 2EZIA 4YFKF 2M8GX 3K4NA 1OKRA 2OQGA 4M74A 1YE9A 2YX4A 3NEUA 2H1KA 3KP2A 3LFUA 4Q4ZF 2XB5A 3DEEA 4ENNA 4F93B 4V2GA 2KDOA 4MGRA 2DLLA 4A93J 1AKHB 2DN0A 2MA3A 3AG2H 1JKQC 4ENMA 2RQPA 3TP0A 2DK8A 4MIMA 4IHVA 5E3MA 2ZMEB 2NNYA 2GLOA 1SVMA 2ISYA 2O3FA 5F64A 1WI9A 2F5FA 1LB2A 5ICGA 3OSGA 2IP2A 3FBIB 5KCMA 3AKZA 4RAFA 2OJED 1KU3A 3BJ6A 3LSRA 4IHTA 1SFUA 2DQRA 2CGPA 3M8FA 4L5IA 4M6XA 2BOLA 2Z33A 3A03A 3CMEI 5LGNA 4A12A 2A69F 3IUOA 2A6HF 2RNGA 3RKYA 5K7FA 2A5WA 2M7AA 4RB3C 2HYJA 2R7SA 2PMZN 1D1AA 3ULQB 1FTTA 2G7HA 3BC8A 4HNTA 1Z9CA 4RB2C 2M4KA 3H9GA 2MW8A 2R0QC 3BTIA 2R3SA 1RZ4A 2FBKA 1BI0A 1YO5C 1N78A 4M73A 2K9MA 4L0YB 3CLOA 1TTYA 2STTA 3M1CA 2XAHA 4M71A 2JT1A 3TL4X 5K1YA 1YIJI 1RKTA 3HSRA 1JTXA 3K4MA 2KRHA 2K3PA 2JSPA 5KAFC 1WKMA 1V5EA 4ASNA 3CC7I 2VONA 2MABA 1QZEA 1I50J 4BY7J 1R1UA 3Q5FA 3D5SC 1VI0A 3CCYA 2H27A 1WGXA 1IN5A 4O5VA 5HLIA 4IJAA 4PK4A 4HAMA 3OOUA 3L2RA 5D4RA 1Z1DA 3HKZA 1S29A 4RBOA 1J7KA 1HQCA 2DU9A 2OTJI 3RDIA 4I02A 1VZ0A 2ZBKA 3R0JA 2CFXA 1I6HJ 2B63J 2BHYA 3MWMA 2DA3A 4PGGA 3CUQC 5LEJA 1LNWA 1G3SA 5CLSA 1RIOH 3SZTA 4D7MA 4L9VA 1BI3A 2R5YA 1N77A 4I2OA 2LKSA 2DT6A 2IGOA 2V6EA 3W3CA 4PFOA 2RKHA 4RGRA 2H09A 1UZCA 4C2MJ 2DFEA 4U0WA 5M3FJ 2Z99A 1EF4A 2DMNA 3C2BA 2DPDA 5F0FA 2JA2A 2K7LA 2KIFA 3F6VA 2EFQA 3A0BC 1WI3A 2PFBA 4R8HA 2ZXHA 4BJ6C 4GXOA 3SDBA 3BG3A 1GDTA 1BA5A 3QPSA 3R6SA 3AG1H 3CDLA 3BZCA 4MNUA 1FZPB 2H6CA 4A3EJ 4V2FA 3IKVA 1WJFA 1ZH5A 2FXAA 2JPBA 3W2VA 1KA8A 3CQZJ 3T8RA 3HC7A 2BEOA 5HVQC 2EV6A 2GXAA 4ESFA 2VODA 2XF7A 2HPMA 1P7JA 2DK5A 4DNCA 2CQXA 1IDZA 4HRIA 3DTEA 3BTLA 4XLPF 1W0UA 2PJRA 2F6CA 3HBLA 2E60A 3LNQA 4BNCA 4ZZDA 2DA5A 1MBHA 4A0XA 4G7OF 3H92A 1HA8A 2XUBA 4DGWB 5FKNA 1O7LA 3M3YJ 1JUPA 2BY2A 1Y56A 5J1YA 4E7JA 2Y0SA 1J75A 2XGDA 1IW7F 3EUHA 1XMKA 4BEHB 4BYYA 2EBIA 3OYIA 5IPAA 3R4KA 3PQKA 2OCCH 1X19A 2X0LA 2ZJ2A 3TMOA 1MSEC 2VKDA 1QZZA 4BACA 3ECHA 2CQKA 1IG7A 1K78B 3LA2A 5ED4A 1LFBA 3FXMA 2E2JJ 1B6AA 1FOXA 4R79A 2Z3YA 4KNYA 1ZKGA 4LJZF 2C6YA 4HF0A 1R1VA 5HDGA 5ICEA 3CTAA 3KCCA 1Z6TA 4BQAA 4M3GA 5IT3A 4FX4A 1YFHA 1ZRDA 1G3WA 1IXRC 2VPRA 2R7RA 4KISA 4CYCB 2F5EA 3IH3A 2HOAA 5K5OA 3OYJA 1X1PA 2X6OA 1HW1A 1SMYF 2EA4A 2L7ZA 4TV7A 3RSNA 3WODF 2GA2A 3GFJA 4FTHA 1A31A 4II3A 2DFFA 4A5NA 5GTIC 4C2TA 4A3BJ 1HKSA 1ON2A 2IGMA 3JRHA 4ZDLA 2VXDA 1SEUA 4WF2A 1OPCA 2E71A 5CYVA 4FHTA 1R7JA 2M3AA 4KMFA 4JYKA 1O3RA 1UFMA 3KEQA 1VQKI 3HOTA 3K4LA 3CF5F 4L9NA 3N05A 5LRRA 4FE7A 2LREA 3S14J 2KQRA 1RR7A 3GTLJ 1YRNB 4C2UA 1IF1A 2FRHA 4NQWB 2OC6A 4B48A 1FIPA 4DZJA 2W1OA 2VKEA 1ENHA 2VT3A 2YS9A 1TWAJ 3NARA 2ME0A 1TW2A 4II2A 1QZYA 1ERDA 1FBUA 1EH8A 5DUIA 3AL0C 3TOAA 3OYBA 1X3WB 1RC9A 1U2WA 2HGCA 4RAGA 3JSOA 2NRAC 1KONA 2CU7A 3UR3C 4WK8F 3ZR8X 3K69A 5EDNA 1OLTA 3K1MA 3CDHA 3RPUD 5AONA 3AAFA 1VQNI 4GGGA 2Y9ZA 3GUDA 1QPIA 5EGOA 1QO0D 2K27A 3ABKH 5E3NA 1YQAA 2CV0A 4N4NB 2W7NA 2IVMA 4G6DA 4ZDPA 2LMDA 4YFXF 2KISA 1OCCH 3OIOA 1D3YA 1DDNA 2Q8KA 3PNTA 3OYHA 5E1WA 1ETQA 2LYCA 4MEXF 3JRFA 2L2OA 1V54H 1P2FA 3FWEA 3OIQA 5J4VA 4Q48A 1R5ID 5IYDJ 1LE8B 2ZNYA 2R7DA 2V1DA 3DKWA 2VKVA 5DV5A 1UHWA 2EINH 3MVPA 1HW2A 2IPQX 2XRNA 2K9QA 1WJCA 3L7WA 2HVQA 4RDUA 2QSHX 3WHBA 4MQVA 2IRFG 1HKTA 1LUJB 1X3ZB 3CCEI 2XAQA 3PIPF 3KP5A 2PMHA 5FO5A 1M1EB 1BR2A 2AQEA 2DOAA 1R00A 2L4MA 3QU3A 2M30A 5KNLA 3K4BA 3SYTA 3U1KA 2PBIA 3KLOA 1D0YA 2IS6A 5E17F 3E1SA 1T08B 4C3HJ 3SEQA 1UELB 1UG2A 3Q9SA 1E17A 3S1MJ 1RETA 4JX6A 1W5TA 3U1DA 5J8FA 3BTCA 3P9CA 1T56A 2W82A 2OD5A 3AFHA 1FIAA 4IRGA 4UUTA 4J19A 3QPHA 3S15J 2IS1A 3E0JB 4A3FJ 3HRMA 2G9WA 2X9DA 5DD4A 5B1AH 1DU0A 2O03A 2R7FA 3WGIA 2M1BA 1DU6A 3PJRA 2QKLB 3HRSA 1MMSA 3NQOA 3TOBA 3UNGC 1FLIA 1WH7A 4AUXA 3BR1A 2X1CA 3HDDA 3KFWX 3F23A 3WG9A 4AYBN 2KFDA 2VJJA 2RV8A 1YW7A 1ETXA 4XSZF 3MZ8A 3JRDA 5ILSA 5C4XJ 5A2QZ 1ZG5A 1S7AA 2OF7A 3T8TA 1XGNA 3PUFA 1B9NA 2V1XA 2Q0OA 4XLFA 2E34A 2LVSA 5K5QA 3CCVI 1XSVA 2ZJPF 2P8TA 2ZB9A 2XASA 1GHCA 3V42A 4D7NA 1YOVB 5IY5H 4A3JJ 2OTLI 3FMSA 3CCRI 1PJRA 2X48A 4LG0A 3I9V2 5LHHA 4F55A 2LDUA 3HYIA 3FDYA 1P92A 2UV1A 4HW0A 3J7AY 3GWZA 5LD2C 3KLNA 2M87A 3WU2C 4YG2F 2KL4A 4BL0B 3Q3SA 1RR8C 2CUZA 2WA0A 5KAIC 1ZYRF 2I10A 2A5YB 4KT6A 2ADUA 2KLOA 2PMZA 1SFXA 2MBFA 4Z2YA 2CUFA 3C2HA 1SAXA 5FJ8J 5AIPA 2W00A 2P5VA 2LSOA 3DLLF 3TDUC 1HF0A 1I39A 2VJ4A 1ZTRA 3QOEA 3HGGA 3LSIA 5FD6A 3U21A 1IN4A 1PYVA 3OMYA 1NK2P 5C3EJ 3E7LA 5D6EA 5E3LA 3HIFA 5K7ZA 3GYHX 5L3GA 1XB4A 2HZTA 1XGOA 1ZARA 2F5DA 5IT9K 1MMNA 1DPRA 1Q1VA 4X0GA 2VBWA 4UVBA 2UUZA 1MJBA 2M0CA 3A2KA 1P4AA 1R4NB 3OWTA 3BZKA 5EYRA 1Z3XA 3J7ZI 3MQ0A 3LA3A 5CQEA 4MHGA 4E7SA 1Z3YA 3I4NJ 4D0PA 1YYVA 5FKKA 4AVZA 2GM4A 5F1JA 4PZJA 3M8EA 2ECCA 3VOEA 1TBXA 3KZYA 1WJ5A 4OMYA 2ELHA 1ZAOA 1LPQA 5DYMA 1JGGA 1LFUP 1WRJA 1YLFA 4X1EA 2WC2A 4XRFA 1MMGA 4GO1A 3RCOA 3VSLA 4UV9A 3VWBA 3JAMK 4A3DJ 3BY6A 3F72A 3D5RC 3DKYA 1Y8QB 1UMQA 3R61A 4B43A 2Y48A 3KEYA 4IO9F 2CO5A 3L2VA 3CO6C 3ZP5A 3JCUC 4PCQA 1V5GA 2LBFB 2XAGA 2VOOA 3QWLA 4HX4A 3F0CA 1FYKA 1G3YA 3HGYA 5J47A 2L4AA 2CJJA 3CJRB 2NOJB 4CUGA 3OY9A 3OYKA 1MD0A 3EUAA 2QEXI 3NWTA 5LBQA 3ERMA 1HLVA 4DBRA 2QQ9A 1XS9A 5TISC 4IQ4A 2HQRA 2JJ7A 2J5PA 3SXYA 5FRMA 1UJ8A 1SMTA 3VEPA 4G9YA 1X1AA 4CXFA 2QENA 1PUFB 2ISZA 4A6DA 1BIAA 3Q0UA 2GBYA 5HODA 5E20A 2WY7Q 4J00A 3S93A 2WB1N 3RPUA 2KDZA 3QOPA 2BXYA 1ZLKA 2BZTA 3ABUA 5FGMA 2ELKA 4L9TA 1P4XA 3TO9A 1TP4A 2MSYA 4M3BA 3OYAA 1DP3A 4JBAA 2Y31A 2CW7A 4BQNA 2L9RA 1HBXG 4M3EA 1ZRFA 3QP6A 2XSJC 3WTTC 4XOPA 1DQUA 1OMIA 3LSTA 5L3EA 3PSFA 3BJOA 4Y13A 1HXDA 1UAAA 3GEZA 2FNPA 3RIRA 2D1HA 5M5XJ 4MTEA 3S2WA 1SD6A 4NC7A 4V19K 4E70A 1Y1VJ 1BBYA 2X1EA 3IRRA 4R1HA 2Z1DA 3EYIA 3F8NA 2F4MB 1UHMA 4LFUA 1W4MA 3IP4B 5D5XB 4EGZA 3MFKA 1YIOA 1OCRH 2KZVA 3G6EI 4HDVA 1WSUA 4RGUA 4IRIA 4A3LJ 2QF7A 5FB2A 2PJPA 2QGUA 3KP7A 3B73A 3I56I 3DXJF 1NG6A 4AIHA 2O9LA 4JQFA 1OYWA 3HRTA 2IGNA 1WPKA 3IL2A 3TEDA 2VBZA 4YEJA 4EJOA 3JRAA 3S1RJ 3FXRA 3S32A 2VBXA 2HDDA 3SZPA 2FBIA 1FP2A 1O3QA 2LOOA 5FLXK 4EJUA 2A07F 1NK3P 4AIJA 2Q2EB 3GFIA 4OU0A 5DUKA 1XCVA 1Z7LA 4FT8A 4L9JA 4W97A 3IH4A 2VJ5A 1HKQA 3M7GA 5BMZA 1U5TB 4DZPA 3I71A 2DAOA 3ZMTA 1XSXA 3B6AA 1HSTA 2DDAA 4YIFA 3OYLA 1OCOH 1IC8A 3PO3J 3OR2C 4HX8A 3JRIA 3J80Z 3FXUA 1EV7A 4ETSA 3OOPA 1TLHB 1VFCA 3ZCOA 2JUGA 3DPTA 3J7YJ 3UKGA 3Q0VA 3FF5A 4CH7A 5E8IA 1J59A 4KN4X 4B3XA 2Z16A 2GWRA 2RC4A 3CMYA 4OOIA 3DBHB 4XMYA 4BE1A 2NVXJ 4AM3A 9ANTA 4LITA 5EEHA 4I98B 2KHMA 4S05A 2FMYA 3DP7A 4BUPA 1FTZA 2K02A 2DDBA 3CJQB 4YIIA 3RQIA 4A3KJ 3HM5A 2HYGD 4EVIA 2W25A 5J4YA 2ZJRF 3WGGA 3O6BB 2PJRB 3HRUA 1R71A 3K10A 1JGSA 1UG0A 3DQVC 5DM7F 2A6EF 5DM6F 2KPMA 4MFEA 1X1CA 2R4GA 2PQ8A 1MNEA 2Y0MA 3GCMA 3ONQA 3ML6A 1MIJA 4IX7A 2LY1A 5B66C 1W7PB 2GIVA 2HOEA 3ZPLA 4NC8A 2DOFA 1ZG3A 1MBEA 3OYDA 3W6KB 2ZJQF 2OBPA 4CCKA 2D45A 2VB6A 2PLYA 1X3UA 3TBIA 1R9TJ 1XMXA 2HI3A 3MCZA 4G7HF 4E7LA 4UY8I 2O6GE 3U9GA 1B72A 3E5QA 5EF6A 1WJAA 3IC7A 2KKOA 1SD5A 4BHPA 1SD4A 3FKJA 3G4SI 2HEOA 5JLXA 5DS9A 2GOXB 2QSFX 1AA7A 1MJAA 5C44J 1VQ6I 3TW7A 5CKTA 5H6QA 3BG7A 2EK5A 4KA4A 3ASOH 1Y6IA 3GO5A 2VJIA 3SQNA 4Y3OA 2EFWA 1D0XA 1GV5A 1ZHFA 2WV1A 1QRYA 3MN2A 2H1LA 1FX7A 4Y33A 1OQYA 1MDMA 2VIXA 4I09A 3S17J 1E3HA 4M72A 2D5VA 1XC5A 2MLKA 5M3MJ 1BC7C 4ANJA 3VYSB 2WTEA 3CCLI 2VN2A 2YX7A 3FXKA 2GA1A 3I64A 1YI2I 3QYBA 3H35A 3E3VA 4G6QA 2P5KA 2ZXJA 4NUBA 1R58A 1USSA 3GTKJ 2BW3B 3RZOJ 3ERED 2DQLA 4OIQF 3BZ6A 3QPTA 3LMMA 4FCYA 4D9JA 2QQBA 2EFOA
chains in the Genus database with same CATH topology
2DJNA 2N8GA 2Y9ZA 2ECBA 2DA2A 2R5YB 3BR6A 5E3OA 1QPIA 5IP9J 5EGOA 1RESA 1TWGJ 2Y0SN 3JREA 1WH5A 1JUSA 5E3NA 1MBFA 4BXXJ 3K7AJ 2EZKA 2HXOA 3LSJA 3OIOA 1H8AC 1S7EA 5FLMJ 1HDPA 5F0HA 4IHYA 1ETQA 3RKQA 3JRFA 2DMTA 3TW6A 4A3CJ 1W0TA 5IYDJ 3DCFA 1LE8B 1TC3C 2VKVA 1AHDP 1JKOC 4B1RA 1ETYA 3MVPA 2E2IJ 4XK4A 2E1OA 3JRGA 3I4MJ 3LOCA 2K9QA 2DA1A 4RDUA 1H88C 4QTRA 3BR0A 3WHBA 3MKLA 1XG1A 3BQZA 3JRBA 1TWFJ 2CUEA 5IOZA 3A02A 2EQRA 1O4XA 1AKHA 1IDYA 1JKRC 2L7FP 5EEAA 4C3HJ 5IYBJ 4IHXA 1ITYA 3FIWA 2VI6A 4Y7NJ 1UG2A 2TRTA 3S1MJ 1RETA 1RPWA 2L7MP 4JX6A 2OPTA 2XSDC 2R5ZA 2EZLA 5F0CA 1AU7A 4D5CA 2Y9YA 2TCTA 3BTCA 1ZGWA 1T56A 4J19A 1FIAA 4UUTA 3S15J 2FJ1A 1P7IA 4A3FJ 1A5JA 3ZQGA 2X9DA 2JMWA 3LSGA 4DYQA 2MGQA 2LP0A 3SDGA 1DU0A 1ETKA 3SFIA 4A3GJ 1PUFA 1DU6A 2M2EA 2EH3A 2NVTJ 2IAIA 3G1MA 4HNVA 2XPUA 2W48A 4MFDA 1B72B 3FISA 1MH3A 2IEKA 2DTZA 1WH7A 4AUXA 3BR1A 3HDDA 2YUSA 4S0HB 2LFBA 4XIDA 2JA5J 4AYBN 1A6IA 4B3AA 1JJ6C 2FD5A 3L1PA 1FEXA 2RAEA 1ETXA 3JRDA 5C4XJ 2DMUA 1HCRA 2JA8J 2NOGA 1F43A 2CRGA 2OF7A 1T33A 1UHSA 2JWTA 2JK3A 3B6CA 5IP6A 2LVSA 1ZQ3P 1X2NA 2ZB9A 2NVQJ 5M5YJ 2P81A 1JTYA 3Q0WA 2LTPA 4D7NA 4QSHA 3ZQLA 2ID3A 3BR2A 4A3JJ 3HB9A 5IYCJ 2X48A 4L5EA 3BT9A 1F36A 3BR3A 3GBGA 2NS7A 2K40A 3HOXJ 3ZQIA 2ID6A 2KT0A 4JX5A 2COBA 1QVTA 3BTJA 1ETOA 1BJZA 1HOMA 3S1QJ 4GFBA 3Q3SA 1B8IA 4EEFG 4DYRA 2I10A 1Z77A 2HQ5A 2FX0A 2G0EA 4FISA 1ORKA 3HOVJ 2AO9A 2CUFA 1IV6A 5EZHA 5FJ8J 1D5YA 2XGCA 4IHWA 3K2AA 2FQ4A 2NVYJ 4UUSA 1IUFA 1HF0A 5EG0A 4FE4A 1ZTRA 3HGGA 3W6VA 1JT6A 2DA4A 1MH4A 3JR9A 4XRMA 5EGOB 1NK2P 5C3EJ 3E7LA 5E3LA 5K7ZA 5EG0B 1CQTA 5FLVA 3IV5A 2R93J 1ZK8A 1POGA 1VNDA 2K9NA 4M6VA 5F27A 3GTQJ 4G12A 3O8HA 1Q1VA 1IJWC 2O8KA 2R7ZJ 1IGNA 4IEJA 3FK7A 2M0CA 5EYRA 3S2DJ 4I6ZA 3PM1A 3I4NJ 2K9SA 1FJLA 4I76A 3GTMJ 5FKKA 2GM4A 1H89C 3BG5A 5F1JA 2ECCA 2M9HA 3O8GA 3D1NI 2HOSA 3NAUA 2HXIA 3JRCA 3S1NJ 1SANA 5C4JJ 2EZIA 1LFUP 2LY9A 2M8GX 3G1OA 4X1EA 1JGGA 4C3JJ 2JA6J 3TP3A 2Y2ZA 2IBDA 3HOYJ 3S16J 4A3DJ 2H1KA 4A3IJ 1UMQA 2XB5A 4Y52J 4V2GA 2VUMJ 3BQYA 2LLKA 3HEFA 1ZR4A 4A93J 1AKHB 2DN0A 1JKQC 2JA7J 5F04A 1BL0A 3VPRA 3TP0A 2XGEA 3F0CA 4MIMA 4IHVA 5E3MA 3HGYA 2GLOA 3DEWA 2CJJA 2R5ZB 3M4OJ 3OSGA 1GT0C 1HLVA 1XS9A 1X58A 2JJ7A 3LSRA 1OJLA 1GVDA 1TWHJ 4MLOA 3A03A 4CYCA 1PUFB 3Q0UA 5J1UA 5K7FA 2GBYA 1OCTC 5HODA 2HYJA 2PMZN 1FTTA 2EZHA 2WB1N 2LK2A 2KDZA 2ELKA 2MW8A 2R0QC 1QVUA 3BTIA 1MBJA 2M34A 4BBRJ 4M3DA 2MG4A 4M3BA 2MSYA 2Y31A 2DA7A 2L9RA 4M3EA 1MBKA 5GP9A 3HOZJ 1RKTA 4M3FA 2WAQN 1JTXA 2LD5A 5K7HA 5BNGA 1X2MA 2E2HJ 2QCOA 2DA6A 1U9OA 5M5XJ 1WCMJ 1I50J 4BY7J 3LSPA 1JUMA 2HOTA 1VI0A 3CCYA 4MO7A 3ZOBA 5F08A 1WGXA 4X6AJ 5GPAA 1Y1VJ 3OOUA 1K61A 5JLWA 3A01A 4XRSG 2R92J 4RBOA 3GTGJ 3ZQCA 1G2HA 1Y1WJ 1ZR2A 3GTOJ 1Z0XA 3FKIJ 1MNMC 4A3LJ 2QF7A 1I6HJ 2B63J 1BW5A 3A01B 1B8IB 4JP0A 1ETVA 2DA3A 4JX4A 4XRSA 2O9LA 4LOCA 4D7MA 2R5YA 5GPCA 1WPKA 3TEDA 4A3MJ 3JRAA 3S1RJ 4UUSB 2HDDA 3H3VK 1HDDC 4C2MJ 5M3FJ 1IRZA 1EF4A 2DMNA 3C2BA 5F0FA 1NK3P 2JN6A 1SFOJ 1WI3A 4W97A 3IH4A 4DZPA 3BG3A 1GDTA 1BA5A 2DMQA 3QPSA 3B6AA 3BG9A 3CDLA 3PO3J 1IC8A 5J3LA 3JRIA 4A3EJ 4V2FA 5J1RA 4A69C 1VFCA 1JKPC 3CQZJ 3UKGA 1LE8A 3Q0VA 3S2HJ 1GV2A 1P7JA 2CQXA 1IDZA 3H0GJ 3CMYA 1JT0A 1I3QJ 3BTLA 4B4CA 2NVXJ 2ME6A 1GUUA 9ANTA 1MBGA 1W0UA 1FTZA 3HBLA 3LNQA 3RQIA 3GTJJ 4A3KJ 4XICA 2DA5A 1MBHA 3HM5A 1OCPA 4C3IJ 1NTCA 3QQAA 5FKNA 3M3YJ 4BBSJ 1JUPA 4MFEA 1MSFC 5FKMA 5J1YA 1ETWA 1TWCJ 2LKXA 4DYCA 2XGDA 2E19A 3OSFA 4AC0A 4BKXA 2EBIA 1MBEA 5IPAA 4DW6A 3SJMA 1MSEC 5FKOA 1IG7A 4D5FA 1LFBA 5FKLA 3ZQHA 1R9TJ 2XRLA 3HKZN 2E2JJ 2XPWA 1ZKGA 2HI3A 2O7OA 4M3GA 1B72A 5EF6A 2VPRA 4CYCB 3IH3A 4ABZA 3PO2J 5EZGA 2HOAA 2AHQA 2DMPA 5JLXA 2X6OA 5DS9A 5C44J 3QPLA 3TW7A 2L7ZA 4FTHA 2XPVA 1U78A 1U9NA 1JJ8C 4A3BJ 4BY1J 3RZDJ 3JRHA 5IOYA 3FK6A 2L0KA 5DTDA 1YRNA 4JYKA 1GV5A 2WV1A 2NS8A 1QRYA 3MN2A 2YU9J 4QIWN 1K83J 3GTPJ 1VF9A 3WHCA 3S17J 4FE7A 3S14J 1OFCX 1RR7A 2D5VA 1E3OC 1XC5A 3GTLJ 1YRNB 1U8BA 5IP7J 2Y30A 2LR8A 5M3MJ 3HOUJ 3BR5A 1FIPA 4DZJA 2VKEA 1ENHA 2H8RA 2YS9A 1TWAJ 3NARA 2ME0A 3IH2A 5M5WJ 3G1LA 2CQQA 3GTKJ 3HOWJ 3RZOJ 2XB0X 3ZQFA 2CU7A 4FCYA 4NDLA 5EDNA 1APLC 1RKWA 1BW6A 4W1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJN A;  2N8G A;  2Y9Z A;  2ECB A;  2DA2 A;  2R5Y B;  3BR6 A;  5E3O A;  1QPI A;  5IP9 J;  5EGO A;  1RES A;  1TWG J;  2Y0S N;  3JRE A;  1WH5 A;  1JUS A;  5E3N A;  1MBF A;  4BXX J;  3K7A J;  2EZK A;  2HXO A;  3LSJ A;  3OIO A;  1H8A C;  1S7E A;  5FLM J;  1HDP A;  5F0H A;  4IHY A;  1ETQ A;  3RKQ A;  3JRF A;  2DMT A;  3TW6 A;  4A3C J;  1W0T A;  5IYD J;  3DCF A;  1LE8 B;  1TC3 C;  2VKV A;  1AHD P;  1JKO C;  4B1R A;  1ETY A;  3MVP A;  2E2I J;  4XK4 A;  2E1O A;  3JRG A;  3I4M J;  3LOC A;  2K9Q A;  2DA1 A;  4RDU A;  1H88 C;  4QTR A;  3BR0 A;  3WHB A;  3MKL A;  1XG1 A;  3BQZ A;  3JRB A;  1TWF J;  2CUE A;  5IOZ A;  3A02 A;  2EQR A;  1O4X A;  1AKH A;  1IDY A;  1JKR C;  2L7F P;  5EEA A;  4C3H J;  5IYB J;  4IHX A;  1ITY A;  3FIW A;  2VI6 A;  4Y7N J;  1UG2 A;  2TRT A;  3S1M J;  1RET A;  1RPW A;  2L7M P;  4JX6 A;  2OPT A;  2XSD C;  2R5Z A;  2EZL A;  5F0C A;  1AU7 A;  4D5C A;  2Y9Y A;  2TCT A;  3BTC A;  1ZGW A;  1T56 A;  4J19 A;  1FIA A;  4UUT A;  3S15 J;  2FJ1 A;  1P7I A;  4A3F J;  1A5J A;  3ZQG A;  2X9D A;  2JMW A;  3LSG A;  4DYQ A;  2MGQ A;  2LP0 A;  3SDG A;  1DU0 A;  1ETK A;  3SFI A;  4A3G J;  1PUF A;  1DU6 A;  2M2E A;  2EH3 A;  2NVT J;  2IAI A;  3G1M A;  4HNV A;  2XPU A;  2W48 A;  4MFD A;  1B72 B;  3FIS A;  1MH3 A;  2IEK A;  2DTZ A;  1WH7 A;  4AUX A;  3BR1 A;  3HDD A;  2YUS A;  4S0H B;  2LFB A;  4XID A;  2JA5 J;  4AYB N;  1A6I A;  4B3A A;  1JJ6 C;  2FD5 A;  3L1P A;  1FEX A;  2RAE A;  1ETX A;  3JRD A;  5C4X J;  2DMU A;  1HCR A;  2JA8 J;  2NOG A;  1F43 A;  2CRG A;  2OF7 A;  1T33 A;  1UHS A;  2JWT A;  2JK3 A;  3B6C A;  5IP6 A;  2LVS A;  1ZQ3 P;  1X2N A;  2ZB9 A;  2NVQ J;  5M5Y J;  2P81 A;  1JTY A;  3Q0W A;  2LTP A;  4D7N A;  4QSH A;  3ZQL A;  2ID3 A;  3BR2 A;  4A3J J;  3HB9 A;  5IYC J;  2X48 A;  4L5E A;  3BT9 A;  1F36 A;  3BR3 A;  3GBG A;  2NS7 A;  2K40 A;  3HOX J;  3ZQI A;  2ID6 A;  2KT0 A;  4JX5 A;  2COB A;  1QVT A;  3BTJ A;  1ETO A;  1BJZ A;  1HOM A;  3S1Q J;  4GFB A;  3Q3S A;  1B8I A;  4EEF G;  4DYR A;  2I10 A;  1Z77 A;  2HQ5 A;  2FX0 A;  2G0E A;  4FIS A;  1ORK A;  3HOV J;  2AO9 A;  2CUF A;  1IV6 A;  5EZH A;  5FJ8 J;  1D5Y A;  2XGC A;  4IHW A;  3K2A A;  2FQ4 A;  2NVY J;  4UUS A;  1IUF A;  1HF0 A;  5EG0 A;  4FE4 A;  1ZTR A;  3HGG A;  3W6V A;  1JT6 A;  2DA4 A;  1MH4 A;  3JR9 A;  4XRM A;  5EGO B;  1NK2 P;  5C3E J;  3E7L A;  5E3L A;  5K7Z A;  5EG0 B;  1CQT A;  5FLV A;  3IV5 A;  2R93 J;  1ZK8 A;  1POG A;  1VND A;  2K9N A;  4M6V A;  5F27 A;  3GTQ J;  4G12 A;  3O8H A;  1Q1V A;  1IJW C;  2O8K A;  2R7Z J;  1IGN A;  4IEJ A;  3FK7 A;  2M0C A;  5EYR A;  3S2D J;  4I6Z A;  3PM1 A;  3I4N J;  2K9S A;  1FJL A;  4I76 A;  3GTM J;  5FKK A;  2GM4 A;  1H89 C;  3BG5 A;  5F1J A;  2ECC A;  2M9H A;  3O8G A;  3D1N I;  2HOS A;  3NAU A;  2HXI A;  3JRC A;  3S1N J;  1SAN A;  5C4J J;  2EZI A;  1LFU P;  2LY9 A;  2M8G X;  3G1O A;  4X1E A;  1JGG A;  4C3J J;  2JA6 J;  3TP3 A;  2Y2Z A;  2IBD A;  3HOY J;  3S16 J;  4A3D J;  2H1K A;  4A3I J;  1UMQ A;  2XB5 A;  4Y52 J;  4V2G A;  2VUM J;  3BQY A;  2LLK A;  3HEF A;  1ZR4 A;  4A93 J;  1AKH B;  2DN0 A;  1JKQ C;  2JA7 J;  5F04 A;  1BL0 A;  3VPR A;  3TP0 A;  2XGE A;  3F0C A;  4MIM A;  4IHV A;  5E3M A;  3HGY A;  2GLO A;  3DEW A;  2CJJ A;  2R5Z B;  3M4O J;  3OSG A;  1GT0 C;  1HLV A;  1XS9 A;  1X58 A;  2JJ7 A;  3LSR A;  1OJL A;  1GVD A;  1TWH J;  4MLO A;  3A03 A;  4CYC A;  1PUF B;  3Q0U A;  5J1U A;  5K7F A;  2GBY A;  1OCT C;  5HOD A;  2HYJ A;  2PMZ N;  1FTT A;  2EZH A;  2WB1 N;  2LK2 A;  2KDZ A;  2ELK A;  2MW8 A;  2R0Q C;  1QVU A;  3BTI A;  1MBJ A;  2M34 A;  4BBR J;  4M3D A;  2MG4 A;  4M3B A;  2MSY A;  2Y31 A;  2DA7 A;  2L9R A;  4M3E A;  1MBK A;  5GP9 A;  3HOZ J;  1RKT A;  4M3F A;  2WAQ N;  1JTX A;  2LD5 A;  5K7H A;  5BNG A;  1X2M A;  2E2H J;  2QCO A;  2DA6 A;  1U9O A;  5M5X J;  1WCM J;  1I50 J;  4BY7 J;  3LSP A;  1JUM A;  2HOT A;  1VI0 A;  3CCY A;  4MO7 A;  3ZOB A;  5F08 A;  1WGX A;  4X6A J;  5GPA A;  1Y1V J;  3OOU A;  1K61 A;  5JLW A;  3A01 A;  4XRS G;  2R92 J;  4RBO A;  3GTG J;  3ZQC A;  1G2H A;  1Y1W J;  1ZR2 A;  3GTO J;  1Z0X A;  3FKI J;  1MNM C;  4A3L J;  2QF7 A;  1I6H J;  2B63 J;  1BW5 A;  3A01 B;  1B8I B;  4JP0 A;  1ETV A;  2DA3 A;  4JX4 A;  4XRS A;  2O9L A;  4LOC A;  4D7M A;  2R5Y A;  5GPC A;  1WPK A;  3TED A;  4A3M J;  3JRA A;  3S1R J;  4UUS B;  2HDD A;  3H3V K;  1HDD C;  4C2M J;  5M3F J;  1IRZ A;  1EF4 A;  2DMN A;  3C2B A;  5F0F A;  1NK3 P;  2JN6 A;  1SFO J;  1WI3 A;  4W97 A;  3IH4 A;  4DZP A;  3BG3 A;  1GDT A;  1BA5 A;  2DMQ A;  3QPS A;  3B6A A;  3BG9 A;  3CDL A;  3PO3 J;  1IC8 A;  5J3L A;  3JRI A;  4A3E J;  4V2F A;  5J1R A;  4A69 C;  1VFC A;  1JKP C;  3CQZ J;  3UKG A;  1LE8 A;  3Q0V A;  3S2H J;  1GV2 A;  1P7J A;  2CQX A;  1IDZ A;  3H0G J;  3CMY A;  1JT0 A;  1I3Q J;  3BTL A;  4B4C A;  2NVX J;  2ME6 A;  1GUU A;  9ANT A;  1MBG A;  1W0U A;  1FTZ A;  3HBL A;  3LNQ A;  3RQI A;  3GTJ J;  4A3K J;  4XIC A;  2DA5 A;  1MBH A;  3HM5 A;  1OCP A;  4C3I J;  1NTC A;  3QQA A;  5FKN A;  3M3Y J;  4BBS J;  1JUP A;  4MFE A;  1MSF C;  5FKM A;  5J1Y A;  1ETW A;  1TWC J;  2LKX A;  4DYC A;  2XGD A;  2E19 A;  3OSF A;  4AC0 A;  4BKX A;  2EBI A;  1MBE A;  5IPA A;  4DW6 A;  3SJM A;  1MSE C;  5FKO A;  1IG7 A;  4D5F A;  1LFB A;  5FKL A;  3ZQH A;  1R9T J;  2XRL A;  3HKZ N;  2E2J J;  2XPW A;  1ZKG A;  2HI3 A;  2O7O A;  4M3G A;  1B72 A;  5EF6 A;  2VPR A;  4CYC B;  3IH3 A;  4ABZ A;  3PO2 J;  5EZG A;  2HOA A;  2AHQ A;  2DMP A;  5JLX A;  2X6O A;  5DS9 A;  5C44 J;  3QPL A;  3TW7 A;  2L7Z A;  4FTH A;  2XPV A;  1U78 A;  1U9N A;  1JJ8 C;  4A3B J;  4BY1 J;  3RZD J;  3JRH A;  5IOY A;  3FK6 A;  2L0K A;  5DTD A;  1YRN A;  4JYK A;  1GV5 A;  2WV1 A;  2NS8 A;  1QRY A;  3MN2 A;  2YU9 J;  4QIW N;  1K83 J;  3GTP J;  1VF9 A;  3WHC A;  3S17 J;  4FE7 A;  3S14 J;  1OFC X;  1RR7 A;  2D5V A;  1E3O C;  1XC5 A;  3GTL J;  1YRN B;  1U8B A;  5IP7 J;  2Y30 A;  2LR8 A;  5M3M J;  3HOU J;  3BR5 A;  1FIP A;  4DZJ A;  2VKE A;  1ENH A;  2H8R A;  2YS9 A;  1TWA J;  3NAR A;  2ME0 A;  3IH2 A;  5M5W J;  3G1L A;  2CQQ A;  3GTK J;  3HOW J;  3RZO J;  2XB0 X;  3ZQF A;  2CU7 A;  4FCY A;  4NDL A;  5EDN A;  1APL C;  1RKW A;  1BW6 A;  4W1U A; 
#chains in the Genus database with same CATH topology
 4AYB A;  1L3L A;  3D0S A;  4YEL A;  3J81 K;  5ICF A;  2I5U A;  2XDV A;  5E3O A;  2XHK A;  1U3E M;  5IP9 J;  2VQG A;  3ZMD A;  1TWG J;  1VQ5 I;  2MFZ A;  4JK1 X;  2JZY A;  1GLN A;  2H94 A;  1G59 A;  4LIU A;  4WCG A;  2EZK A;  5HS9 A;  3LSJ A;  2QBY A;  3M8J A;  1N75 A;  1H8A C;  1S7E A;  4BJT A;  5FLM J;  2CG4 A;  2QWW A;  1QQI A;  3GX4 X;  1JI8 A;  4JOM A;  2HS5 A;  1HDP A;  3HZJ A;  2OAZ A;  3AG3 H;  3ZMV A;  1QHH D;  2WWY A;  2BY3 A;  2HDW A;  2DMT A;  2LH9 A;  3ASN H;  4XQF A;  3CUQ B;  2DYS H;  1TC3 C;  3GME A;  2HPI A;  1JKO C;  3WE3 A;  3LQQ A;  1ETY A;  2E2I J;  3F9K A;  4XK4 A;  3I4M J;  3LOC A;  4KIB A;  2DA1 A;  2OQR A;  4OWR B;  3MKZ A;  3DFG A;  4YFN F;  2DBB A;  1FY7 A;  1XG1 A;  1TWF J;  4NHJ A;  2CUE A;  1FYM A;  3CUO A;  4HV6 A;  4IF4 A;  5CQG A;  2P6T A;  3GLL A;  4KDP A;  2EQR A;  4KIG A;  3LA7 A;  5HS8 A;  4RMN A;  1O3S A;  3TDZ C;  3BG6 A;  1O4X A;  1AKH A;  1IUY A;  1A04 A;  4WXC A;  1OIS A;  3FM5 A;  1D8K A;  1LEB A;  5IYB J;  1ITY A;  2VI6 A;  2X6X A;  4Y7N J;  2FQ3 A;  2ZME A;  2IA0 A;  2L7M P;  2FNA A;  1BI2 A;  4IXA A;  2OPT A;  5E79 C;  2EZL A;  1AU7 A;  3CZ6 A;  4XBF A;  4D5C A;  3PNY A;  2TCT A;  1ZGW A;  1K4S A;  1DGW Y;  1KU2 A;  2OZ6 A;  3MKY B;  2MGQ A;  1N25 A;  3H3Z A;  2OA4 A;  2VC0 A;  3SDG A;  1OR7 A;  4RM3 A;  4A3G J;  4E7H A;  5DCF A;  2M2E A;  2NVT J;  2L9V A;  2UXX A;  2IEK A;  1KU7 A;  1IN8 A;  3DLA A;  4S0H B;  4F3Q A;  1WJB A;  1XX5 A;  4B3A A;  1JJ6 C;  3L1P A;  3ISP A;  5JVG F;  1F1Z A;  1FEX A;  3VB2 A;  2P6S A;  2WAF A;  4E6K G;  3BOQ A;  2F5C A;  2JA8 J;  2E35 A;  1LDK B;  2WAE A;  4O6J A;  1A36 A;  1F43 A;  2HKO A;  5GAH J;  1IO2 A;  1UHS A;  3E5X A;  2JVH A;  2HTJ A;  1ZQ3 P;  2CQ7 A;  4RS8 A;  4CGZ A;  4IOA F;  2P81 A;  4WXH A;  1LVK A;  4DJA A;  2M5W A;  1F4K A;  3DWL E;  4N0B A;  2OZU A;  3BR2 A;  2IGK A;  5IYC J;  1C0W A;  5H2F C;  3CP8 A;  2WAD A;  3BR3 A;  3R0A A;  4KMU X;  3JTH A;  3P5J A;  2ID6 A;  2IXS A;  2ZFU A;  5D8L B;  1J09 A;  1KYW A;  2COB A;  3BTJ A;  1BJZ A;  3SZG A;  3S1Q J;  3ZQ7 A;  1LQ1 A;  3JSP A;  1FWZ A;  2FA5 A;  2OUM A;  4RB0 A;  1AWC A;  4FIS A;  2WB1 A;  3W2A A;  2XGX A;  3SHF A;  2ZC2 A;  4H4K C;  5EG0 A;  3S3N A;  1VQO I;  2M45 A;  2V79 A;  3W6V A;  4CCL A;  4CSW A;  3JR9 A;  4XRM A;  4I0A A;  2VE8 A;  4AVP A;  1QNT A;  3PQJ A;  4HYE A;  2YU3 A;  2NVU B;  1POG A;  1R22 A;  1IV8 A;  3RKW A;  4BU2 A;  3F6O A;  1Y8R B;  1X1B A;  3CES A;  1TQM A;  1FMW A;  1EJ9 A;  3DPU A;  5CVU A;  2R7Z J;  2JVG A;  4EAT A;  1CF7 B;  2ELJ A;  5HDN A;  4IEJ A;  3T1B A;  4ZTJ A;  4BXF A;  3MKW B;  2MH2 A;  2K4B A;  3S2D J;  3IWZ A;  2YR2 A;  3GXO A;  2L01 A;  4F7Z A;  1S5L C;  1O3T A;  2HTS A;  1JHF A;  1K7A A;  1R49 A;  3MAJ A;  3BG5 A;  2XRO A;  1Y39 A;  3DTK A;  1KYZ A;  3O8G A;  3K1P A;  3L00 A;  2CFO A;  1S6L A;  2HXI A;  4ENK A;  5C4J J;  3TP3 A;  2QQA A;  2IBD A;  2Y2Z A;  3HOY J;  3HXL A;  3KYL A;  5HLG A;  2BY1 A;  4F52 A;  1ONV A;  3LWF A;  3BRO A;  4A3I J;  1SD7 A;  5B5E C;  4Y52 J;  2I8D A;  4P1W A;  5CJ9 A;  3NRV A;  3WG7 H;  3HEF A;  3DBL B;  3EQL F;  3WTV C;  3V7S A;  1GXP A;  4AIK A;  1K4T A;  4UB8 C;  5F04 A;  2XGE A;  2V9V A;  2QKM B;  3K4C A;  4BEH A;  4ZJZ A;  1ZRE A;  3I54 A;  4ZYE A;  3CP2 A;  2R5Z B;  3M4O J;  3LFK A;  3Q9V A;  1IXS B;  1GT0 C;  3S3M A;  1X58 A;  1K78 A;  1G8X A;  1SFK A;  2IS4 A;  3HHH A;  2ICW G;  1GVD A;  1HSJ A;  3QP5 A;  4NC6 A;  1TWH J;  4XOR A;  4A6E A;  4MLO A;  3HSF A;  3BJA A;  3BDD A;  4CYC A;  1SC7 A;  3ZXS A;  1FYL A;  2AXT C;  2QVO A;  3RPQ A;  5J1U A;  3PFI A;  2EZH A;  2ZO4 A;  2LK2 A;  1LDD A;  2KIQ A;  1MMD A;  2HQA A;  1ACI A;  1H9T A;  1QVU A;  1MBJ A;  4BBR J;  1Z6R A;  3LL7 A;  2PMU A;  4XNF A;  4NB5 A;  5FRO A;  2DT5 A;  2VBY A;  3L2U A;  1MBK A;  1I1G A;  5GP9 A;  3HOZ J;  4ON0 A;  4FQG A;  1T6S A;  4M3F A;  2WAQ N;  4CHU A;  3K70 D;  5LGU A;  2LD5 A;  2XC7 A;  5JVT A;  4OIN F;  2HNH A;  5BNG A;  2E2H J;  3HL2 A;  3OL3 A;  2QCO A;  5E8G A;  1R23 A;  2DA6 A;  3CCS I;  2V1U A;  4HF2 A;  2QA4 I;  3GF2 A;  4BGD A;  3LSP A;  4NQW A;  2HOT A;  1JUM A;  3ZOB A;  1GXQ A;  5F08 A;  2KIU A;  3OYN A;  4B8X A;  5L3B A;  4X6A J;  5GPA A;  3WGH A;  5D5U B;  2ZCW A;  2KIM A;  4XLC A;  2B0L A;  2K9L A;  3PUB A;  5TGT A;  3SEZ A;  1Y0N A;  5JLW A;  4EMS A;  3A01 A;  1R1T A;  1UB9 A;  5FFZ A;  4XRS G;  4LLN A;  1E2X A;  1SVL A;  1REP C;  1Y1W J;  1ZR2 A;  3AG4 H;  4FX0 A;  4RGS A;  5D4S A;  1IRF A;  3M9A A;  2M0M A;  1I3A A;  1B8I B;  4OIP F;  4ZYD A;  1D1B A;  3C3W A;  2XKP A;  4LOC A;  2VL8 A;  5ILV A;  3QAH A;  5GPC A;  2FF4 A;  4EV0 A;  3E6B A;  4UUS B;  1B4A A;  1XPX A;  1IRZ A;  4A2U A;  3KX2 A;  3CD6 I;  2JN6 A;  1SFO J;  1R36 A;  3F8B A;  4C30 A;  2RRE A;  3HUG B;  1WVR A;  3LSM A;  2YPR A;  1SFE A;  1O7F A;  4PSW A;  1FBS A;  3REO A;  3WU0 A;  4A69 C;  4A0Y A;  1LE8 A;  3S2H J;  1W5S A;  3OYE A;  1GV2 A;  1DPU A;  1RUO A;  1SAU A;  4AD9 A;  3H0G J;  1JT0 A;  1I3Q J;  4XN0 A;  4B4C A;  2ME6 A;  1U6G A;  1BR1 A;  1MBG A;  4O3M A;  4LG3 A;  5DCM A;  4CCN A;  3GTJ J;  4HSR A;  1OCP A;  4Z6Y A;  5LGT A;  1PVE A;  3OS2 A;  2BYV E;  1FBQ A;  4ZYA A;  3QRF F;  4WWC A;  2X85 A;  2ZSH B;  2VQL A;  3VYU B;  4XM3 A;  1FP1 D;  4BBS J;  3HTS B;  1G6N A;  2LKP A;  3FM3 A;  2E7X A;  5HNF A;  5FKM A;  4HQM A;  3FHZ A;  5DDG A;  3V8K A;  1ETW A;  2LKX A;  4YRV A;  2ZKZ A;  3U2R A;  1R5G A;  4ESB A;  2E19 A;  3F8M A;  3OSF A;  2QM3 A;  4BKX A;  1V4R A;  1UST A;  4BH9 A;  3QU6 A;  2L7K A;  2E1M B;  4P9F A;  3OS1 A;  4DW6 A;  2FEZ A;  2E1N A;  2DJI A;  2OU2 A;  1A6Q A;  4HBL A;  3X2Q H;  1YS7 A;  1LVA A;  5FKL A;  2PI0 A;  2OCE A;  2XRL A;  2XPW A;  2R7Q A;  4MTD A;  4RLF A;  4AID A;  2P7C B;  3F21 A;  1FT9 A;  2O7O A;  1SVO A;  4AU7 A;  2QQ8 A;  1YX3 A;  2AHQ A;  3RYR A;  4LD5 A;  4UXN A;  2DMP A;  1EA3 A;  3PIO F;  4L18 B;  4XL9 A;  1X1D A;  3ECO A;  3M07 A;  3GZN B;  2ZNZ A;  3QOD A;  4YIR X;  4BXU A;  1Z7U A;  1Y0U A;  3E5U A;  4IQJ A;  2V6C A;  3RI4 A;  1U9N A;  1QPM A;  2A3S A;  1U78 A;  1JJ8 C;  2A05 A;  2DYR H;  2D2W A;  3RTR A;  2PEX A;  3L09 A;  3VFZ A;  5FD5 A;  5GTH C;  3R60 A;  4GYI A;  2FML A;  3VYT B;  3GVA A;  2L0K A;  2RDP A;  1YTY A;  1W7P D;  3DPL C;  4LGW A;  1OYY A;  2NS8 A;  2QUF A;  4MEY F;  5LLQ A;  4CDG A;  2FUG 2;  3GTP J;  4I7H A;  4XN3 A;  1VF9 A;  5ERI A;  3WHC A;  3C1D A;  1OFC X;  1TT5 B;  3P9I A;  2E36 A;  3FXQ A;  1FC3 A;  2W85 A;  4HOB A;  3K0L A;  2Q1Z B;  3HOU J;  3BR5 A;  2XIG A;  2H8W A;  4LMY A;  1OCZ H;  3QYE A;  2H8R A;  3K4K A;  3E6C C;  3WTZ A;  3IAM 2;  3IH2 A;  2COM A;  3G1L A;  2CQQ A;  2VC1 A;  3DF8 A;  2IS2 A;  1U5T C;  2QYO A;  2HWV A;  3OR1 C;  2EV5 A;  4C9Y A;  2XB0 X;  4OIR F;  2IA2 A;  4KT5 C;  2EFP A;  4UHT A;  1APL C;  1BW6 A;  4W1U A;  2O8X A;  2DJN A;  3ZGK A;  6PAX A;  2ECB A;  1GVJ A;  2AQF A;  1VQ8 I;  3N97 A;  2OV7 A;  3BR6 A;  4XLN F;  4LIV A;  2R5Y B;  2FOK A;  5EEG A;  4WXD A;  1VTN C;  1YW9 A;  2UXN A;  1RES A;  1ULY A;  1E3P A;  2M7B A;  1IN6 A;  3C2G A;  1HC8 A;  2BV6 A;  2MH9 A;  3G3Z A;  2VOP A;  3NWS A;  4BXX J;  2HVS A;  1AOY A;  2HXO A;  2W4S A;  4WX9 A;  2J5O A;  4CCO A;  2P5L C;  1T38 A;  2RN7 A;  1VQM I;  2KMU A;  4XLA A;  2BGC A;  2ACJ A;  3PL8 A;  1FMV A;  2EIK H;  3LAP A;  1JHH A;  5F0H A;  4IVN A;  3RKQ A;  3JTG A;  4XKV A;  1VQP I;  2NAZ A;  2VQH A;  3OYF A;  5BOX A;  2ZME C;  1ZGA A;  1VQ4 I;  3DCF A;  3W2W A;  3WE2 A;  1YJW I;  5CVJ A;  4L5J A;  2V26 A;  1AHD P;  5GAG J;  2KJC A;  4CZZ A;  4NNJ A;  2E1O A;  3JRG A;  1KGS A;  4XR6 A;  4PDK A;  3DTI A;  1H88 C;  1BM9 A;  3MKL A;  1X4P A;  2V9K A;  3BQZ A;  3JRB A;  1F5T A;  1VQ7 I;  1OR7 C;  1XCB A;  3H3U A;  5IOZ A;  2O5R A;  1J2X A;  4Y4R A;  1TQI A;  5KHD A;  3KYD B;  4HEA 2;  4KYW A;  4HG2 A;  1WJD A;  1IRG A;  5BPI A;  2ETH A;  2LBF A;  5L3D A;  2L7F P;  5HNH A;  3ABL H;  4U0Y A;  2X51 A;  3C18 A;  2A61 A;  4RAZ A;  2X6W A;  3HJE A;  4GCV A;  2TRT A;  3JW4 A;  2RQQ A;  1RPW A;  3BCB A;  5F0C A;  2MLG A;  1T0F C;  2Y9Y A;  1Q1H A;  4QPO A;  4XLE A;  2FJ1 A;  2K5C A;  2CH0 A;  3LSG A;  4KIF A;  4DYQ A;  5JI6 A;  3BPV A;  2LP0 A;  2DOE A;  1PUF A;  1T98 A;  2FSW A;  3O3K A;  5BPD A;  4HNU A;  4HNV A;  3I59 A;  1MH3 A;  5ICC A;  1V3F A;  4RAY A;  1UCR A;  2DPU A;  2O61 A;  2CUJ A;  2YUS A;  3TQN A;  2JA5 J;  1A6I A;  4PSX A;  2FD5 A;  1T8I A;  3V8J A;  3VOD A;  4BS9 A;  2FOW A;  2RAE A;  3BLY A;  2XAF A;  5HS7 A;  3KET A;  1FOK A;  2NOG A;  4G94 A;  3V7R A;  2XAU A;  2CRG A;  2W57 A;  2EB7 A;  1Z91 A;  2JWT A;  4OMZ A;  2JK3 A;  4IL6 C;  1K6Y A;  5IP6 A;  3E6M A;  2PX9 A;  4UV8 A;  1X2N A;  2CWE A;  5D5V B;  5LHI A;  1TL8 A;  2NVQ J;  2LRD A;  2LTP A;  1TNT A;  5H20 A;  4EGY A;  3GZ6 A;  3TKY A;  3WTX C;  3HB9 A;  2JQ7 A;  2ESH A;  1F36 A;  5BQT A;  2K40 A;  3HOX J;  3ZQI A;  2KT0 A;  4KFC A;  3ESW B;  5IT9 Z;  2IW5 A;  3DU6 A;  4H0E A;  3H0D A;  2Z2S B;  1HOM A;  4GFB A;  4P96 A;  2K86 A;  5A2Q K;  3TO7 A;  4EEF G;  1I27 A;  2G7U A;  5KK1 A;  4DYR A;  1ON1 A;  3CCU I;  2HQ5 A;  3FZV A;  3D5L A;  2FX0 A;  5TJJ A;  3F22 A;  1STZ A;  2HVR A;  1EKE A;  2G0E A;  1FPQ A;  1S3J A;  3K4J A;  3HOV J;  2CS3 A;  2AO9 A;  2KJB A;  5EZH A;  4ENJ A;  1D5Y A;  1U0J A;  2FQ4 A;  2NVY J;  4LK1 F;  4AWX B;  3WTY C;  1R6R A;  4IHS A;  2VPL A;  4BDY A;  2DA4 A;  3FXL A;  1MH4 A;  1BR4 A;  5EGO B;  2Q2E A;  2JUC A;  5D5W B;  4EJW A;  5JFR A;  4I99 C;  4U7B A;  3JAM Z;  1D1C A;  4HQE A;  1U5T A;  5TRD A;  5EG0 B;  1CQT A;  1XTA A;  5FLV A;  2JRT A;  1WWX A;  2WAQ A;  3WTW C;  4N9I A;  5F27 A;  3GTQ J;  2JSC A;  1JXS A;  1IGN A;  1XDS A;  4MQ9 F;  3KZI C;  3KIO A;  2BBY A;  5JR3 A;  2V7F A;  2EIM H;  5LEK A;  3KEO A;  1FOW A;  3T5X A;  1H89 C;  3F8C A;  3FX3 A;  3W6J B;  3D1N I;  1J5Y A;  4GYG A;  4BDZ A;  1FSH A;  4BE0 A;  3H9Q A;  2HOS A;  3E97 A;  2GQQ A;  3NAU A;  3S1N J;  1YJN I;  2LY2 A;  5AIQ A;  2LY9 A;  3G1O A;  5F6F A;  2L54 A;  3K9T A;  4C3J J;  2Z9O A;  2JA6 J;  1T95 A;  3I0T A;  2XF6 A;  3S16 J;  2DI3 A;  2M4G A;  2E5N A;  1FOY A;  2HYF A;  2NNN A;  1YS6 A;  2VUM J;  3BQY A;  2LLK A;  2LF8 A;  3OYC A;  1ZR4 A;  2KRF A;  3K6G A;  3DU5 A;  2F48 A;  3HSE A;  2CW8 A;  1W7P A;  3CLQ A;  3ZMU A;  1BL0 A;  3KZZ A;  3VPR A;  2JA7 J;  3G2B A;  1XSD A;  1QU3 A;  4S04 A;  2HDC A;  2NXN B;  3H1C A;  3BWG A;  2X1D A;  4PJN A;  3DEW A;  2M8E A;  1TT0 A;  1MMA A;  1ZRC A;  3KP3 A;  2F4O B;  1TZL A;  1P4W A;  3S8P A;  1I5Z A;  2DOD A;  1BOB A;  3EET A;  2DTR A;  3FMQ A;  1LFP A;  3V4G A;  3FXO A;  3I4P A;  4PJL A;  1LKX A;  1OJL A;  5D8K B;  1QA6 A;  4B44 A;  5K5R A;  1ZLJ A;  2ZXI A;  1TNS A;  1D0Z A;  3P7N A;  5JHU A;  1FSE A;  5F1R A;  4IPA A;  1OCT C;  5B3S H;  1NG7 A;  3GLX A;  5D6F A;  1FNN A;  4UUV A;  1T0F A;  1J0R A;  4QPQ A;  1KQ0 A;  4ITV A;  4XSX F;  4HV5 A;  4E7K A;  1QHG A;  2M34 A;  4ZH4 F;  4M6Y A;  4M3D A;  2MG4 A;  2Z5U A;  3IKT A;  2DA7 A;  5HLT A;  1PP8 F;  3HHG A;  2DW4 A;  4PJJ A;  2VKH A;  1H0M A;  2VQC A;  1L0O C;  2CSO A;  4RGX A;  5DD8 A;  5K7H A;  3CMM A;  1X2M A;  4XKC A;  3G73 A;  1U9O A;  1CGP A;  1WCM J;  3VDX A;  2STW A;  5FLX Z;  4MO7 A;  3ZQQ A;  2BXZ A;  4LG0 B;  1W5C C;  5GAD J;  4RLQ A;  3GFM A;  3MD2 A;  4UB6 C;  3HPG A;  1K61 A;  3L9F A;  1KZH A;  1XGS A;  1EH6 A;  1U8R A;  5DEQ A;  1BOA A;  5J6X A;  2R92 J;  4EQQ A;  2R7X A;  4ZC3 A;  3GTG J;  2BW3 A;  2HQN A;  4M9Z A;  3ZQC A;  1G2H A;  3GTO J;  1Z0X A;  1Z21 A;  3FKI J;  1RUN A;  1MNM C;  1I6X A;  2AS5 F;  4DQ2 A;  4BHB A;  1BW5 A;  3A01 B;  3I55 I;  4KJZ A;  4JP0 A;  1ETV A;  1WQ2 A;  1ZGJ A;  3HTU A;  3KP4 A;  1WHU A;  4I0B A;  3OIP A;  4JX4 A;  4XRS A;  4OIO F;  3KE2 A;  5J40 A;  4PFP A;  4Y15 A;  2EIL H;  4A3M J;  2V9P A;  3A4C A;  3VYR B;  4F92 B;  4M9S A;  4P55 A;  2X6Y A;  4BAY A;  3H3V K;  1HDD C;  4P5O A;  1XN7 A;  1B59 A;  4Y17 A;  2VLA A;  1OYI A;  2P4W A;  1Z67 A;  4OAZ A;  5JHF A;  1DGR M;  2VXZ A;  2DMQ A;  1YG2 A;  4IOC F;  3BG9 A;  3AL0 B;  5J3L A;  3WU1 B;  3FMR A;  1MZB A;  1YX5 A;  3COA C;  2QSG X;  3WTU C;  3CJT B;  5J1R A;  3OS0 A;  2VE9 A;  2CYY A;  2DFI A;  2WV0 A;  1MW7 A;  1JKP C;  3CUQ A;  1R4M B;  4GRI A;  2QZ8 A;  4P9U A;  3M1E A;  2R7O A;  3LAJ A;  4EM2 A;  1G3T A;  2FU4 A;  3K1N A;  1BIB A;  2NS0 A;  3CCQ I;  5E1X A;  3G71 I;  2XF5 A;  2ZSI B;  1E0E A;  4ZTF A;  1LJ9 A;  4LB5 A;  4ZDO A;  1S7O A;  1GUU A;  3CF2 A;  4IZZ A;  1MGT A;  3GW2 A;  3CC4 I;  2L3D A;  2R7W A;  1ZG1 A;  4Q5S F;  4D1Q A;  2ZXW H;  3V7C A;  4XIC A;  2DCE A;  4CCM A;  2BVM A;  2YSR A;  3I3L A;  3IAS 2;  3IHU A;  3L2W A;  4GDF A;  2IA1 A;  3HPH A;  4C3I J;  2EJR A;  1NTC A;  3CC2 I;  3QQA A;  5DCM B;  3CMA I;  1XGM A;  4KIC A;  1MSF C;  4E7Z A;  3J80 K;  3A0H C;  4IRH A;  1T2K A;  3FBN B;  1TWC J;  1TQP A;  2B7E A;  2K3F A;  1HW5 A;  2XKO A;  3FXJ A;  4B47 A;  4DYC A;  4AC0 A;  2XV4 S;  1W1W E;  2A68 F;  2CW0 F;  1ODD A;  3OYM A;  3SJM A;  2LC2 A;  4CZC A;  1D8J A;  4LB6 B;  3BCA A;  2R7U A;  5FKO A;  4D5F A;  3KP6 A;  3H36 A;  3ZQH A;  3HKZ N;  4HX7 A;  4ZYH A;  2D1V A;  1KQ8 A;  4PJM A;  1MJ9 A;  2L02 A;  3E6D A;  3GZ5 A;  1Z05 A;  4ABZ A;  4U0V A;  1P9Q C;  1ZN2 A;  3RKX A;  4U7D A;  3PO2 J;  1B1B A;  3ROU A;  5EZG A;  4CCJ A;  1B9M A;  2H6B A;  1LEA A;  3ABM H;  2E7W A;  4NBQ A;  1A35 A;  3DKX A;  2L5Q A;  1YHQ I;  1S9H A;  5ILU A;  1W36 D;  4E7I A;  3SFZ A;  4IKF A;  3MZH A;  2BY0 A;  3QPL A;  4I01 A;  2PN6 A;  5LFA A;  4BHC A;  4L0Z B;  2MD0 A;  2CQN A;  1PUE E;  1IZ1 A;  1RRJ A;  2XPV A;  4BY1 J;  3DBR B;  2XAJ A;  3P9K A;  1YW8 A;  4LLG F;  2EPF A;  3RQ4 A;  3RZD J;  2F2E A;  3B02 A;  3EPZ A;  4EJV A;  2ZFW A;  5IOY A;  3FK6 A;  2BE5 F;  2VT2 A;  3I5U A;  2GOM A;  5DTD A;  2EFN A;  2WY8 Q;  1YRN A;  4LLL A;  4KUM A;  3J81 Z;  2PG4 A;  1I1S A;  2YU9 J;  4QIW N;  1K83 J;  3O2P E;  3CJN A;  5L3F A;  3LQR A;  1XD7 A;  3LSH A;  1E3O C;  1WFX A;  2R7T A;  4J01 A;  1BN5 A;  4HPQ A;  5IP7 J;  1U8B A;  2Y30 A;  1YIT I;  4HF1 A;  2LR8 A;  3EYY A;  2LG4 A;  2HZD A;  4G6T B;  5CVI A;  3H5R A;  4HLY A;  2MD5 A;  1BC8 C;  5J8C A;  2GZW A;  5M5W J;  1T39 A;  3T0Y A;  5CVV A;  4BQQ A;  3HOW J;  2MYS A;  3ZMZ A;  2B9S A;  4KN7 X;  1BJA A;  1XDU A;  4N4O B;  1V5F A;  4PJ0 C;  5CPR B;  4F91 B;  3ZQF A;  2A6T A;  2DXI A;  4EM0 B;  1DP7 P;  4NDL A;  2MC4 A;  2L9N A;  4DOZ A;  1RKW A;  1IXC A;  3EUK L;  1S8N A;  2N8G A;  4RB1 A;  2UZK A;  4XKB A;  2DA2 A;  4EJT A;  3OL4 A;  1VQ9 I;  1D5V A;  4BJ5 C;  2Y0S N;  3JRE A;  3BP8 A;  1WH5 A;  1JUS A;  5GAE J;  2JTV A;  5HLH A;  1MBF A;  4U87 A;  3ZMS A;  2F5V A;  1KQ9 A;  1MND A;  3K7A J;  3S3O A;  2GIZ A;  2Y75 A;  1W36 C;  2MC3 A;  2V1N A;  2EIJ H;  2P7V B;  4A0Z A;  1P6R A;  2DFH A;  2O0Y A;  4OAY A;  1CF7 A;  4CIC A;  4E4H A;  3GFL A;  2QLZ A;  4LK0 F;  4IHY A;  3H5A A;  2IJL A;  4HZF A;  3K70 C;  3TW6 A;  4A3C J;  3IWF A;  2R7V A;  2DO7 A;  4ZYG A;  1VQL I;  1W0T A;  3PNV A;  2EWN A;  4G7Z F;  4B1R A;  4FET A;  2E1M C;  4U88 A;  2BVL A;  4QTR A;  3BR0 A;  4RA2 A;  3LSK A;  4XLH A;  2KRC A;  3ZN1 A;  2RVC A;  2JRM A;  3ABT A;  2HR3 A;  3A02 A;  5HOO A;  3CO7 C;  4BE2 A;  3J7A O;  3EDP A;  2AXL A;  1ZEL A;  1IDY A;  3MMY B;  1JKR C;  5EEA A;  2VAS A;  2JPC A;  4IHX A;  3FIW A;  4G8X A;  2K4J A;  5HDK A;  4XON A;  3C7J A;  2E5Z A;  2CV2 A;  1DUX C;  5L3C A;  3VSK A;  2XSD C;  2R5Z A;  1F9N A;  4ZZL A;  1K79 A;  2LF7 A;  5CVR A;  3ZN0 A;  4BQO A;  2ESN A;  1P7I A;  1KU9 A;  1QBJ A;  1A5J A;  3ZQG A;  4CO8 A;  2IT0 A;  2JMW A;  4ESJ A;  3PSI A;  1G4D A;  1K6O A;  3V8L A;  1ETK A;  1R5H A;  3SFI A;  1X4O A;  3F8F A;  3MZY A;  2GXG A;  2EH3 A;  3HG9 A;  2IAI A;  3G1M A;  2HKX A;  2W24 A;  2W48 A;  2XPU A;  2Y69 H;  3KYC B;  4MFD A;  3FIS A;  2F4I A;  1JE8 A;  1B72 B;  4UVC A;  2DTZ A;  1V55 H;  2CMP A;  1RNL A;  5KVR A;  2P0W A;  1NHA A;  2LNB A;  2LFB A;  4XID A;  5FRN A;  4CYD A;  2KP6 A;  3DV8 A;  2HFH A;  3I59 B;  3I53 A;  4DBQ A;  2L9S A;  1BI1 A;  2DMU A;  1HCR A;  2V4J C;  2RNJ A;  1T33 A;  1WJE A;  5E18 F;  3B6C A;  1IAW A;  1LDJ A;  4XOT A;  1IN7 A;  1H9G A;  3A1Y A;  1MKM A;  5M5Y J;  3TO6 A;  3L2C A;  4UNO A;  1JTY A;  3Q0W A;  4QSH A;  3QYF A;  4N9H A;  3ZQL A;  1MDM B;  4K2E A;  2ID3 A;  2W84 A;  3F3X A;  2E1C A;  4KIT B;  3CDI A;  5LRS A;  4L5E A;  3MEX A;  2UWM A;  3BT9 A;  4QWQ A;  4Q47 A;  4QLC U;  3GBG A;  3KPH A;  2NS7 A;  3OV8 A;  2DT7 B;  4XKW A;  1EH7 A;  2WBM A;  2GXB A;  4UVA A;  2FE3 A;  3ELK A;  1QGP A;  3H9J A;  4JX5 A;  4CA0 A;  4A5M A;  2EA2 A;  1QVT A;  2GAU A;  1ETO A;  3HOS A;  4HLX A;  1NH3 A;  2XVC A;  2FBH A;  1B8I A;  4B09 A;  3H5N A;  4HST A;  3IRQ A;  2X4H A;  4PUS A;  3CCJ I;  3TGN A;  4EM1 A;  1YJ9 I;  3L2Q A;  1Z77 A;  3PFY A;  1ORK A;  3DEU A;  2CV1 A;  3ZRG A;  1IV6 A;  4IHW A;  2XGC A;  5FFX A;  3K2A A;  2KZG A;  4DIQ A;  3CCM I;  4UUS A;  1IUF A;  1TW3 A;  5LHG A;  1WZ2 A;  4FE4 A;  2RGV A;  1JT6 A;  2EV0 A;  4RM2 A;  4HDU A;  3FHN A;  2NYX A;  2K85 A;  5B1B H;  3HUG A;  5E1Z B;  3OYG A;  3IV5 A;  1ZK8 A;  1RI7 A;  1VND A;  2R93 J;  2K9N A;  4M6V A;  3N4M A;  4G12 A;  5H6R A;  3O8H A;  2QBY B;  4HA8 A;  1IJW C;  2O8K A;  1IRX A;  1O57 A;  3FK7 A;  3I58 A;  4PGH A;  1PP7 U;  5EJC A;  1PDN C;  4I6Z A;  3WTS C;  3PM1 A;  2K9S A;  3RYP A;  1FJL A;  1XMA A;  4I76 A;  3GTM J;  2HU9 A;  2TDX A;  1S72 I;  1J9I A;  3RJP A;  2M9H A;  4FAS D;  4M9X A;  3BPX A;  3K2Z A;  5BS6 A;  3EUH C;  2BHZ A;  3JRC A;  1SAN A;  2EZI A;  4YFK F;  2M8G X;  3K4N A;  1OKR A;  2OQG A;  4M74 A;  1YE9 A;  2YX4 A;  3NEU A;  2H1K A;  3KP2 A;  3LFU A;  4Q4Z F;  2XB5 A;  3DEE A;  4ENN A;  4F93 B;  4V2G A;  2KDO A;  4MGR A;  2DLL A;  4A93 J;  1AKH B;  2DN0 A;  2MA3 A;  3AG2 H;  1JKQ C;  4ENM A;  2RQP A;  3TP0 A;  2DK8 A;  4MIM A;  4IHV A;  5E3M A;  2ZME B;  2NNY A;  2GLO A;  1SVM A;  2ISY A;  2O3F A;  5F64 A;  1WI9 A;  2F5F A;  1LB2 A;  5ICG A;  3OSG A;  2IP2 A;  3FBI B;  5KCM A;  3AKZ A;  4RAF A;  2OJE D;  1KU3 A;  3BJ6 A;  3LSR A;  4IHT A;  1SFU A;  2DQR A;  2CGP A;  3M8F A;  4L5I A;  4M6X A;  2BOL A;  2Z33 A;  3A03 A;  3CME I;  5LGN A;  4A12 A;  2A69 F;  3IUO A;  2A6H F;  2RNG A;  3RKY A;  5K7F A;  2A5W A;  2M7A A;  4RB3 C;  2HYJ A;  2R7S A;  2PMZ N;  1D1A A;  3ULQ B;  1FTT A;  2G7H A;  3BC8 A;  4HNT A;  1Z9C A;  4RB2 C;  2M4K A;  3H9G A;  2MW8 A;  2R0Q C;  3BTI A;  2R3S A;  1RZ4 A;  2FBK A;  1BI0 A;  1YO5 C;  1N78 A;  4M73 A;  2K9M A;  4L0Y B;  3CLO A;  1TTY A;  2STT A;  3M1C A;  2XAH A;  4M71 A;  2JT1 A;  3TL4 X;  5K1Y A;  1YIJ I;  1RKT A;  3HSR A;  1JTX A;  3K4M A;  2KRH A;  2K3P A;  2JSP A;  5KAF C;  1WKM A;  1V5E A;  4ASN A;  3CC7 I;  2VON A;  2MAB A;  1QZE A;  1I50 J;  4BY7 J;  1R1U A;  3Q5F A;  3D5S C;  1VI0 A;  3CCY A;  2H27 A;  1WGX A;  1IN5 A;  4O5V A;  5HLI A;  4IJA A;  4PK4 A;  4HAM A;  3OOU A;  3L2R A;  5D4R A;  1Z1D A;  3HKZ A;  1S29 A;  4RBO A;  1J7K A;  1HQC A;  2DU9 A;  2OTJ I;  3RDI A;  4I02 A;  1VZ0 A;  2ZBK A;  3R0J A;  2CFX A;  1I6H J;  2B63 J;  2BHY A;  3MWM A;  2DA3 A;  4PGG A;  3CUQ C;  5LEJ A;  1LNW A;  1G3S A;  5CLS A;  1RIO H;  3SZT A;  4D7M A;  4L9V A;  1BI3 A;  2R5Y A;  1N77 A;  4I2O A;  2LKS A;  2DT6 A;  2IGO A;  2V6E A;  3W3C A;  4PFO A;  2RKH A;  4RGR A;  2H09 A;  1UZC A;  4C2M J;  2DFE A;  4U0W A;  5M3F J;  2Z99 A;  1EF4 A;  2DMN A;  3C2B A;  2DPD A;  5F0F A;  2JA2 A;  2K7L A;  2KIF A;  3F6V A;  2EFQ A;  3A0B C;  1WI3 A;  2PFB A;  4R8H A;  2ZXH A;  4BJ6 C;  4GXO A;  3SDB A;  3BG3 A;  1GDT A;  1BA5 A;  3QPS A;  3R6S A;  3AG1 H;  3CDL A;  3BZC A;  4MNU A;  1FZP B;  2H6C A;  4A3E J;  4V2F A;  3IKV A;  1WJF A;  1ZH5 A;  2FXA A;  2JPB A;  3W2V A;  1KA8 A;  3CQZ J;  3T8R A;  3HC7 A;  2BEO A;  5HVQ C;  2EV6 A;  2GXA A;  4ESF A;  2VOD A;  2XF7 A;  2HPM A;  1P7J A;  2DK5 A;  4DNC A;  2CQX A;  1IDZ A;  4HRI A;  3DTE A;  3BTL A;  4XLP F;  1W0U A;  2PJR A;  2F6C A;  3HBL A;  2E60 A;  3LNQ A;  4BNC A;  4ZZD A;  2DA5 A;  1MBH A;  4A0X A;  4G7O F;  3H92 A;  1HA8 A;  2XUB A;  4DGW B;  5FKN A;  1O7L A;  3M3Y J;  1JUP A;  2BY2 A;  1Y56 A;  5J1Y A;  4E7J A;  2Y0S A;  1J75 A;  2XGD A;  1IW7 F;  3EUH A;  1XMK A;  4BEH B;  4BYY A;  2EBI A;  3OYI A;  5IPA A;  3R4K A;  3PQK A;  2OCC H;  1X19 A;  2X0L A;  2ZJ2 A;  3TMO A;  1MSE C;  2VKD A;  1QZZ A;  4BAC A;  3ECH A;  2CQK A;  1IG7 A;  1K78 B;  3LA2 A;  5ED4 A;  1LFB A;  3FXM A;  2E2J J;  1B6A A;  1FOX A;  4R79 A;  2Z3Y A;  4KNY A;  1ZKG A;  4LJZ F;  2C6Y A;  4HF0 A;  1R1V A;  5HDG A;  5ICE A;  3CTA A;  3KCC A;  1Z6T A;  4BQA A;  4M3G A;  5IT3 A;  4FX4 A;  1YFH A;  1ZRD A;  1G3W A;  1IXR C;  2VPR A;  2R7R A;  4KIS A;  4CYC B;  2F5E A;  3IH3 A;  2HOA A;  5K5O A;  3OYJ A;  1X1P A;  2X6O A;  1HW1 A;  1SMY F;  2EA4 A;  2L7Z A;  4TV7 A;  3RSN A;  3WOD F;  2GA2 A;  3GFJ A;  4FTH A;  1A31 A;  4II3 A;  2DFF A;  4A5N A;  5GTI C;  4C2T A;  4A3B J;  1HKS A;  1ON2 A;  2IGM A;  3JRH A;  4ZDL A;  2VXD A;  1SEU A;  4WF2 A;  1OPC A;  2E71 A;  5CYV A;  4FHT A;  1R7J A;  2M3A A;  4KMF A;  4JYK A;  1O3R A;  1UFM A;  3KEQ A;  1VQK I;  3HOT A;  3K4L A;  3CF5 F;  4L9N A;  3N05 A;  5LRR A;  4FE7 A;  2LRE A;  3S14 J;  2KQR A;  1RR7 A;  3GTL J;  1YRN B;  4C2U A;  1IF1 A;  2FRH A;  4NQW B;  2OC6 A;  4B48 A;  1FIP A;  4DZJ A;  2W1O A;  2VKE A;  1ENH A;  2VT3 A;  2YS9 A;  1TWA J;  3NAR A;  2ME0 A;  1TW2 A;  4II2 A;  1QZY A;  1ERD A;  1FBU A;  1EH8 A;  5DUI A;  3AL0 C;  3TOA A;  3OYB A;  1X3W B;  1RC9 A;  1U2W A;  2HGC A;  4RAG A;  3JSO A;  2NRA C;  1KON A;  2CU7 A;  3UR3 C;  4WK8 F;  3ZR8 X;  3K69 A;  5EDN A;  1OLT A;  3K1M A;  3CDH A;  3RPU D;  5AON A;  3AAF A;  1VQN I;  4GGG A;  2Y9Z A;  3GUD A;  1QPI A;  5EGO A;  1QO0 D;  2K27 A;  3ABK H;  5E3N A;  1YQA A;  2CV0 A;  4N4N B;  2W7N A;  2IVM A;  4G6D A;  4ZDP A;  2LMD A;  4YFX F;  2KIS A;  1OCC H;  3OIO A;  1D3Y A;  1DDN A;  2Q8K A;  3PNT A;  3OYH A;  5E1W A;  1ETQ A;  2LYC A;  4MEX F;  3JRF A;  2L2O A;  1V54 H;  1P2F A;  3FWE A;  3OIQ A;  5J4V A;  4Q48 A;  1R5I D;  5IYD J;  1LE8 B;  2ZNY A;  2R7D A;  2V1D A;  3DKW A;  2VKV A;  5DV5 A;  1UHW A;  2EIN H;  3MVP A;  1HW2 A;  2IPQ X;  2XRN A;  2K9Q A;  1WJC A;  3L7W A;  2HVQ A;  4RDU A;  2QSH X;  3WHB A;  4MQV A;  2IRF G;  1HKT A;  1LUJ B;  1X3Z B;  3CCE I;  2XAQ A;  3PIP F;  3KP5 A;  2PMH A;  5FO5 A;  1M1E B;  1BR2 A;  2AQE A;  2DOA A;  1R00 A;  2L4M A;  3QU3 A;  2M30 A;  5KNL A;  3K4B A;  3SYT A;  3U1K A;  2PBI A;  3KLO A;  1D0Y A;  2IS6 A;  5E17 F;  3E1S A;  1T08 B;  4C3H J;  3SEQ A;  1UEL B;  1UG2 A;  3Q9S A;  1E17 A;  3S1M J;  1RET A;  4JX6 A;  1W5T A;  3U1D A;  5J8F A;  3BTC A;  3P9C A;  1T56 A;  2W82 A;  2OD5 A;  3AFH A;  1FIA A;  4IRG A;  4UUT A;  4J19 A;  3QPH A;  3S15 J;  2IS1 A;  3E0J B;  4A3F J;  3HRM A;  2G9W A;  2X9D A;  5DD4 A;  5B1A H;  1DU0 A;  2O03 A;  2R7F A;  3WGI A;  2M1B A;  1DU6 A;  3PJR A;  2QKL B;  3HRS A;  1MMS A;  3NQO A;  3TOB A;  3UNG C;  1FLI A;  1WH7 A;  4AUX A;  3BR1 A;  2X1C A;  3HDD A;  3KFW X;  3F23 A;  3WG9 A;  4AYB N;  2KFD A;  2VJJ A;  2RV8 A;  1YW7 A;  1ETX A;  4XSZ F;  3MZ8 A;  3JRD A;  5ILS A;  5C4X J;  5A2Q Z;  1ZG5 A;  1S7A A;  2OF7 A;  3T8T A;  1XGN A;  3PUF A;  1B9N A;  2V1X A;  2Q0O A;  4XLF A;  2E34 A;  2LVS A;  5K5Q A;  3CCV I;  1XSV A;  2ZJP F;  2P8T A;  2ZB9 A;  2XAS A;  1GHC A;  3V42 A;  4D7N A;  1YOV B;  5IY5 H;  4A3J J;  2OTL I;  3FMS A;  3CCR I;  1PJR A;  2X48 A;  4LG0 A;  3I9V 2;  5LHH A;  4F55 A;  2LDU A;  3HYI A;  3FDY A;  1P92 A;  2UV1 A;  4HW0 A;  3J7A Y;  3GWZ A;  5LD2 C;  3KLN A;  2M87 A;  3WU2 C;  4YG2 F;  2KL4 A;  4BL0 B;  3Q3S A;  1RR8 C;  2CUZ A;  2WA0 A;  5KAI C;  1ZYR F;  2I10 A;  2A5Y B;  4KT6 A;  2ADU A;  2KLO A;  2PMZ A;  1SFX A;  2MBF A;  4Z2Y A;  2CUF A;  3C2H A;  1SAX A;  5FJ8 J;  5AIP A;  2W00 A;  2P5V A;  2LSO A;  3DLL F;  3TDU C;  1HF0 A;  1I39 A;  2VJ4 A;  1ZTR A;  3QOE A;  3HGG A;  3LSI A;  5FD6 A;  3U21 A;  1IN4 A;  1PYV A;  3OMY A;  1NK2 P;  5C3E J;  3E7L A;  5D6E A;  5E3L A;  3HIF A;  5K7Z A;  3GYH X;  5L3G A;  1XB4 A;  2HZT A;  1XGO A;  1ZAR A;  2F5D A;  5IT9 K;  1MMN A;  1DPR A;  1Q1V A;  4X0G A;  2VBW A;  4UVB A;  2UUZ A;  1MJB A;  2M0C A;  3A2K A;  1P4A A;  1R4N B;  3OWT A;  3BZK A;  5EYR A;  1Z3X A;  3J7Z I;  3MQ0 A;  3LA3 A;  5CQE A;  4MHG A;  4E7S A;  1Z3Y A;  3I4N J;  4D0P A;  1YYV A;  5FKK A;  4AVZ A;  2GM4 A;  5F1J A;  4PZJ A;  3M8E A;  2ECC A;  3VOE A;  1TBX A;  3KZY A;  1WJ5 A;  4OMY A;  2ELH A;  1ZAO A;  1LPQ A;  5DYM A;  1JGG A;  1LFU P;  1WRJ A;  1YLF A;  4X1E A;  2WC2 A;  4XRF A;  1MMG A;  4GO1 A;  3RCO A;  3VSL A;  4UV9 A;  3VWB A;  3JAM K;  4A3D J;  3BY6 A;  3F72 A;  3D5R C;  3DKY A;  1Y8Q B;  1UMQ A;  3R61 A;  4B43 A;  2Y48 A;  3KEY A;  4IO9 F;  2CO5 A;  3L2V A;  3CO6 C;  3ZP5 A;  3JCU C;  4PCQ A;  1V5G A;  2LBF B;  2XAG A;  2VOO A;  3QWL A;  4HX4 A;  3F0C A;  1FYK A;  1G3Y A;  3HGY A;  5J47 A;  2L4A A;  2CJJ A;  3CJR B;  2NOJ B;  4CUG A;  3OY9 A;  3OYK A;  1MD0 A;  3EUA A;  2QEX I;  3NWT A;  5LBQ A;  3ERM A;  1HLV A;  4DBR A;  2QQ9 A;  1XS9 A;  5TIS C;  4IQ4 A;  2HQR A;  2JJ7 A;  2J5P A;  3SXY A;  5FRM A;  1UJ8 A;  1SMT A;  3VEP A;  4G9Y A;  1X1A A;  4CXF A;  2QEN A;  1PUF B;  2ISZ A;  4A6D A;  1BIA A;  3Q0U A;  2GBY A;  5HOD A;  5E20 A;  2WY7 Q;  4J00 A;  3S93 A;  2WB1 N;  3RPU A;  2KDZ A;  3QOP A;  2BXY A;  1ZLK A;  2BZT A;  3ABU A;  5FGM A;  2ELK A;  4L9T A;  1P4X A;  3TO9 A;  1TP4 A;  2MSY A;  4M3B A;  3OYA A;  1DP3 A;  4JBA A;  2Y31 A;  2CW7 A;  4BQN A;  2L9R A;  1HBX G;  4M3E A;  1ZRF A;  3QP6 A;  2XSJ C;  3WTT C;  4XOP A;  1DQU A;  1OMI A;  3LST A;  5L3E A;  3PSF A;  3BJO A;  4Y13 A;  1HXD A;  1UAA A;  3GEZ A;  2FNP A;  3RIR A;  2D1H A;  5M5X J;  4MTE A;  3S2W A;  1SD6 A;  4NC7 A;  4V19 K;  4E70 A;  1Y1V J;  1BBY A;  2X1E A;  3IRR A;  4R1H A;  2Z1D A;  3EYI A;  3F8N A;  2F4M B;  1UHM A;  4LFU A;  1W4M A;  3IP4 B;  5D5X B;  4EGZ A;  3MFK A;  1YIO A;  1OCR H;  2KZV A;  3G6E I;  4HDV A;  1WSU A;  4RGU A;  4IRI A;  4A3L J;  2QF7 A;  5FB2 A;  2PJP A;  2QGU A;  3KP7 A;  3B73 A;  3I56 I;  3DXJ F;  1NG6 A;  4AIH A;  2O9L A;  4JQF A;  1OYW A;  3HRT A;  2IGN A;  1WPK A;  3IL2 A;  3TED A;  2VBZ A;  4YEJ A;  4EJO A;  3JRA A;  3S1R J;  3FXR A;  3S32 A;  2VBX A;  2HDD A;  3SZP A;  2FBI A;  1FP2 A;  1O3Q A;  2LOO A;  5FLX K;  4EJU A;  2A07 F;  1NK3 P;  4AIJ A;  2Q2E B;  3GFI A;  4OU0 A;  5DUK A;  1XCV A;  1Z7L A;  4FT8 A;  4L9J A;  4W97 A;  3IH4 A;  2VJ5 A;  1HKQ A;  3M7G A;  5BMZ A;  1U5T B;  4DZP A;  3I71 A;  2DAO A;  3ZMT A;  1XSX A;  3B6A A;  1HST A;  2DDA A;  4YIF A;  3OYL A;  1OCO H;  1IC8 A;  3PO3 J;  3OR2 C;  4HX8 A;  3JRI A;  3J80 Z;  3FXU A;  1EV7 A;  4ETS A;  3OOP A;  1TLH B;  1VFC A;  3ZCO A;  2JUG A;  3DPT A;  3J7Y J;  3UKG A;  3Q0V A;  3FF5 A;  4CH7 A;  5E8I A;  1J59 A;  4KN4 X;  4B3X A;  2Z16 A;  2GWR A;  2RC4 A;  3CMY A;  4OOI A;  3DBH B;  4XMY A;  4BE1 A;  2NVX J;  4AM3 A;  9ANT A;  4LIT A;  5EEH A;  4I98 B;  2KHM A;  4S05 A;  2FMY A;  3DP7 A;  4BUP A;  1FTZ A;  2K02 A;  2DDB A;  3CJQ B;  4YII A;  3RQI A;  4A3K J;  3HM5 A;  2HYG D;  4EVI A;  2W25 A;  5J4Y A;  2ZJR F;  3WGG A;  3O6B B;  2PJR B;  3HRU A;  1R71 A;  3K10 A;  1JGS A;  1UG0 A;  3DQV C;  5DM7 F;  2A6E F;  5DM6 F;  2KPM A;  4MFE A;  1X1C A;  2R4G A;  2PQ8 A;  1MNE A;  2Y0M A;  3GCM A;  3ONQ A;  3ML6 A;  1MIJ A;  4IX7 A;  2LY1 A;  5B66 C;  1W7P B;  2GIV A;  2HOE A;  3ZPL A;  4NC8 A;  2DOF A;  1ZG3 A;  1MBE A;  3OYD A;  3W6K B;  2ZJQ F;  2OBP A;  4CCK A;  2D45 A;  2VB6 A;  2PLY A;  1X3U A;  3TBI A;  1R9T J;  1XMX A;  2HI3 A;  3MCZ A;  4G7H F;  4E7L A;  4UY8 I;  2O6G E;  3U9G A;  1B72 A;  3E5Q A;  5EF6 A;  1WJA A;  3IC7 A;  2KKO A;  1SD5 A;  4BHP A;  1SD4 A;  3FKJ A;  3G4S I;  2HEO A;  5JLX A;  5DS9 A;  2GOX B;  2QSF X;  1AA7 A;  1MJA A;  5C44 J;  1VQ6 I;  3TW7 A;  5CKT A;  5H6Q A;  3BG7 A;  2EK5 A;  4KA4 A;  3ASO H;  1Y6I A;  3GO5 A;  2VJI A;  3SQN A;  4Y3O A;  2EFW A;  1D0X A;  1GV5 A;  1ZHF A;  2WV1 A;  1QRY A;  3MN2 A;  2H1L A;  1FX7 A;  4Y33 A;  1OQY A;  1MDM A;  2VIX A;  4I09 A;  3S17 J;  1E3H A;  4M72 A;  2D5V A;  1XC5 A;  2MLK A;  5M3M J;  1BC7 C;  4ANJ A;  3VYS B;  2WTE A;  3CCL I;  2VN2 A;  2YX7 A;  3FXK A;  2GA1 A;  3I64 A;  1YI2 I;  3QYB A;  3H35 A;  3E3V A;  4G6Q A;  2P5K A;  2ZXJ A;  4NUB A;  1R58 A;  1USS A;  3GTK J;  2BW3 B;  3RZO J;  3ERE D;  2DQL A;  4OIQ F;  3BZ6 A;  3QPT A;  3LMM A;  4FCY A;  4D9J A;  2QQB A;  2EFO A; 
#chains in the Genus database with same CATH homology
 2DJN A;  2N8G A;  2Y9Z A;  2ECB A;  2DA2 A;  2R5Y B;  3BR6 A;  5E3O A;  1QPI A;  5IP9 J;  5EGO A;  1RES A;  1TWG J;  2Y0S N;  3JRE A;  1WH5 A;  1JUS A;  5E3N A;  1MBF A;  4BXX J;  3K7A J;  2EZK A;  2HXO A;  3LSJ A;  3OIO A;  1H8A C;  1S7E A;  5FLM J;  1HDP A;  5F0H A;  4IHY A;  1ETQ A;  3RKQ A;  3JRF A;  2DMT A;  3TW6 A;  4A3C J;  1W0T A;  5IYD J;  3DCF A;  1LE8 B;  1TC3 C;  2VKV A;  1AHD P;  1JKO C;  4B1R A;  1ETY A;  3MVP A;  2E2I J;  4XK4 A;  2E1O A;  3JRG A;  3I4M J;  3LOC A;  2K9Q A;  2DA1 A;  4RDU A;  1H88 C;  4QTR A;  3BR0 A;  3WHB A;  3MKL A;  1XG1 A;  3BQZ A;  3JRB A;  1TWF J;  2CUE A;  5IOZ A;  3A02 A;  2EQR A;  1O4X A;  1AKH A;  1IDY A;  1JKR C;  2L7F P;  5EEA A;  4C3H J;  5IYB J;  4IHX A;  1ITY A;  3FIW A;  2VI6 A;  4Y7N J;  1UG2 A;  2TRT A;  3S1M J;  1RET A;  1RPW A;  2L7M P;  4JX6 A;  2OPT A;  2XSD C;  2R5Z A;  2EZL A;  5F0C A;  1AU7 A;  4D5C A;  2Y9Y A;  2TCT A;  3BTC A;  1ZGW A;  1T56 A;  4J19 A;  1FIA A;  4UUT A;  3S15 J;  2FJ1 A;  1P7I A;  4A3F J;  1A5J A;  3ZQG A;  2X9D A;  2JMW A;  3LSG A;  4DYQ A;  2MGQ A;  2LP0 A;  3SDG A;  1DU0 A;  1ETK A;  3SFI A;  4A3G J;  1PUF A;  1DU6 A;  2M2E A;  2EH3 A;  2NVT J;  2IAI A;  3G1M A;  4HNV A;  2XPU A;  2W48 A;  4MFD A;  1B72 B;  3FIS A;  1MH3 A;  2IEK A;  2DTZ A;  1WH7 A;  4AUX A;  3BR1 A;  3HDD A;  2YUS A;  4S0H B;  2LFB A;  4XID A;  2JA5 J;  4AYB N;  1A6I A;  4B3A A;  1JJ6 C;  2FD5 A;  3L1P A;  1FEX A;  2RAE A;  1ETX A;  3JRD A;  5C4X J;  2DMU A;  1HCR A;  2JA8 J;  2NOG A;  1F43 A;  2CRG A;  2OF7 A;  1T33 A;  1UHS A;  2JWT A;  2JK3 A;  3B6C A;  5IP6 A;  2LVS A;  1ZQ3 P;  1X2N A;  2ZB9 A;  2NVQ J;  5M5Y J;  2P81 A;  1JTY A;  3Q0W A;  2LTP A;  4D7N A;  4QSH A;  3ZQL A;  2ID3 A;  3BR2 A;  4A3J J;  3HB9 A;  5IYC J;  2X48 A;  4L5E A;  3BT9 A;  1F36 A;  3BR3 A;  3GBG A;  2NS7 A;  2K40 A;  3HOX J;  3ZQI A;  2ID6 A;  2KT0 A;  4JX5 A;  2COB A;  1QVT A;  3BTJ A;  1ETO A;  1BJZ A;  1HOM A;  3S1Q J;  4GFB A;  3Q3S A;  1B8I A;  4EEF G;  4DYR A;  2I10 A;  1Z77 A;  2HQ5 A;  2FX0 A;  2G0E A;  4FIS A;  1ORK A;  3HOV J;  2AO9 A;  2CUF A;  1IV6 A;  5EZH A;  5FJ8 J;  1D5Y A;  2XGC A;  4IHW A;  3K2A A;  2FQ4 A;  2NVY J;  4UUS A;  1IUF A;  1HF0 A;  5EG0 A;  4FE4 A;  1ZTR A;  3HGG A;  3W6V A;  1JT6 A;  2DA4 A;  1MH4 A;  3JR9 A;  4XRM A;  5EGO B;  1NK2 P;  5C3E J;  3E7L A;  5E3L A;  5K7Z A;  5EG0 B;  1CQT A;  5FLV A;  3IV5 A;  2R93 J;  1ZK8 A;  1POG A;  1VND A;  2K9N A;  4M6V A;  5F27 A;  3GTQ J;  4G12 A;  3O8H A;  1Q1V A;  1IJW C;  2O8K A;  2R7Z J;  1IGN A;  4IEJ A;  3FK7 A;  2M0C A;  5EYR A;  3S2D J;  4I6Z A;  3PM1 A;  3I4N J;  2K9S A;  1FJL A;  4I76 A;  3GTM J;  5FKK A;  2GM4 A;  1H89 C;  3BG5 A;  5F1J A;  2ECC A;  2M9H A;  3O8G A;  3D1N I;  2HOS A;  3NAU A;  2HXI A;  3JRC A;  3S1N J;  1SAN A;  5C4J J;  2EZI A;  1LFU P;  2LY9 A;  2M8G X;  3G1O A;  4X1E A;  1JGG A;  4C3J J;  2JA6 J;  3TP3 A;  2Y2Z A;  2IBD A;  3HOY J;  3S16 J;  4A3D J;  2H1K A;  4A3I J;  1UMQ A;  2XB5 A;  4Y52 J;  4V2G A;  2VUM J;  3BQY A;  2LLK A;  3HEF A;  1ZR4 A;  4A93 J;  1AKH B;  2DN0 A;  1JKQ C;  2JA7 J;  5F04 A;  1BL0 A;  3VPR A;  3TP0 A;  2XGE A;  3F0C A;  4MIM A;  4IHV A;  5E3M A;  3HGY A;  2GLO A;  3DEW A;  2CJJ A;  2R5Z B;  3M4O J;  3OSG A;  1GT0 C;  1HLV A;  1XS9 A;  1X58 A;  2JJ7 A;  3LSR A;  1OJL A;  1GVD A;  1TWH J;  4MLO A;  3A03 A;  4CYC A;  1PUF B;  3Q0U A;  5J1U A;  5K7F A;  2GBY A;  1OCT C;  5HOD A;  2HYJ A;  2PMZ N;  1FTT A;  2EZH A;  2WB1 N;  2LK2 A;  2KDZ A;  2ELK A;  2MW8 A;  2R0Q C;  1QVU A;  3BTI A;  1MBJ A;  2M34 A;  4BBR J;  4M3D A;  2MG4 A;  4M3B A;  2MSY A;  2Y31 A;  2DA7 A;  2L9R A;  4M3E A;  1MBK A;  5GP9 A;  3HOZ J;  1RKT A;  4M3F A;  2WAQ N;  1JTX A;  2LD5 A;  5K7H A;  5BNG A;  1X2M A;  2E2H J;  2QCO A;  2DA6 A;  1U9O A;  5M5X J;  1WCM J;  1I50 J;  4BY7 J;  3LSP A;  1JUM A;  2HOT A;  1VI0 A;  3CCY A;  4MO7 A;  3ZOB A;  5F08 A;  1WGX A;  4X6A J;  5GPA A;  1Y1V J;  3OOU A;  1K61 A;  5JLW A;  3A01 A;  4XRS G;  2R92 J;  4RBO A;  3GTG J;  3ZQC A;  1G2H A;  1Y1W J;  1ZR2 A;  3GTO J;  1Z0X A;  3FKI J;  1MNM C;  4A3L J;  2QF7 A;  1I6H J;  2B63 J;  1BW5 A;  3A01 B;  1B8I B;  4JP0 A;  1ETV A;  2DA3 A;  4JX4 A;  4XRS A;  2O9L A;  4LOC A;  4D7M A;  2R5Y A;  5GPC A;  1WPK A;  3TED A;  4A3M J;  3JRA A;  3S1R J;  4UUS B;  2HDD A;  3H3V K;  1HDD C;  4C2M J;  5M3F J;  1IRZ A;  1EF4 A;  2DMN A;  3C2B A;  5F0F A;  1NK3 P;  2JN6 A;  1SFO J;  1WI3 A;  4W97 A;  3IH4 A;  4DZP A;  3BG3 A;  1GDT A;  1BA5 A;  2DMQ A;  3QPS A;  3B6A A;  3BG9 A;  3CDL A;  3PO3 J;  1IC8 A;  5J3L A;  3JRI A;  4A3E J;  4V2F A;  5J1R A;  4A69 C;  1VFC A;  1JKP C;  3CQZ J;  3UKG A;  1LE8 A;  3Q0V A;  3S2H J;  1GV2 A;  1P7J A;  2CQX A;  1IDZ A;  3H0G J;  3CMY A;  1JT0 A;  1I3Q J;  3BTL A;  4B4C A;  2NVX J;  2ME6 A;  1GUU A;  9ANT A;  1MBG A;  1W0U A;  1FTZ A;  3HBL A;  3LNQ A;  3RQI A;  3GTJ J;  4A3K J;  4XIC A;  2DA5 A;  1MBH A;  3HM5 A;  1OCP A;  4C3I J;  1NTC A;  3QQA A;  5FKN A;  3M3Y J;  4BBS J;  1JUP A;  4MFE A;  1MSF C;  5FKM A;  5J1Y A;  1ETW A;  1TWC J;  2LKX A;  4DYC A;  2XGD A;  2E19 A;  3OSF A;  4AC0 A;  4BKX A;  2EBI A;  1MBE A;  5IPA A;  4DW6 A;  3SJM A;  1MSE C;  5FKO A;  1IG7 A;  4D5F A;  1LFB A;  5FKL A;  3ZQH A;  1R9T J;  2XRL A;  3HKZ N;  2E2J J;  2XPW A;  1ZKG A;  2HI3 A;  2O7O A;  4M3G A;  1B72 A;  5EF6 A;  2VPR A;  4CYC B;  3IH3 A;  4ABZ A;  3PO2 J;  5EZG A;  2HOA A;  2AHQ A;  2DMP A;  5JLX A;  2X6O A;  5DS9 A;  5C44 J;  3QPL A;  3TW7 A;  2L7Z A;  4FTH A;  2XPV A;  1U78 A;  1U9N A;  1JJ8 C;  4A3B J;  4BY1 J;  3RZD J;  3JRH A;  5IOY A;  3FK6 A;  2L0K A;  5DTD A;  1YRN A;  4JYK A;  1GV5 A;  2WV1 A;  2NS8 A;  1QRY A;  3MN2 A;  2YU9 J;  4QIW N;  1K83 J;  3GTP J;  1VF9 A;  3WHC A;  3S17 J;  4FE7 A;  3S14 J;  1OFC X;  1RR7 A;  2D5V A;  1E3O C;  1XC5 A;  3GTL J;  1YRN B;  1U8B A;  5IP7 J;  2Y30 A;  2LR8 A;  5M3M J;  3HOU J;  3BR5 A;  1FIP A;  4DZJ A;  2VKE A;  1ENH A;  2H8R A;  2YS9 A;  1TWA J;  3NAR A;  2ME0 A;  3IH2 A;  5M5W J;  3G1L A;  2CQQ A;  3GTK J;  3HOW J;  3RZO J;  2XB0 X;  3ZQF A;  2CU7 A;  4FCY A;  4NDL A;  5EDN A;  1APL C;  1RKW A;  1BW6 A;  4W1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...