4ESBA

Crystal structure of padr-like transcriptional regulator (bc4206) from bacillus cereus strain atcc 14579
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
b'SQMLKGVLEGCILYIISQEEVYGYELSTKLNKHGFTFVSEGSIYPLLLRMQKEKLIEGTLKASSLGPKRKYYHITDKGLEQLEEFKQSWGMVSTTVNNLLQGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PadR family
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esbA00
2VOOA 4XLNF 5IT3A 2L01A 3FXRA 1T6SA 2O03A 4HDVA 2QQAA 2STTA 1MGTA 2V1DA 2DFIA 3RTRA 2D2WA 1D5VA 1YG2A 2IA1A 3WTUC 1KA8A 2PFBA 4R8HA 1BC8C 3LWFA 4HAMA 1ON2A 1R7JA 4HBLA 1FYKA 5D8LB 1JHHA 3DPLC 5E20A 3BPVA 1R5GA 2GAUA 3PFIA 2OZ6A 4L5IA 4HDUA 1HKSA 1YTYA 2XV4S 1FLIA 4RGRA 1WI9A 4TV7A 5BPIA 4BAYA 3F23A 3HUGA 2PMHA 1DUXC 1WQ2A 1R1TA 2VOPA 1EH8A 4XSXF 1G3TA 4OMYA 3RIRA 5K5RA 4GYIA 1I5ZA 5AIQA 1XMAA 3K2ZA 3I4PA 2KKOA 2PBIA 2PI0A 1UB9A 1ZH5A 3MZHA 2DPUA 2JPCA 3E6CC 3HTSB 4G6DA 1R22A 1XDSA 5D5VB 2ZMEA 4BQAA 3K69A 1JHFA 1USSA 5FGMA 4ZYDA 4KA4A 3I59B 1P92A 4I98B 4G8XA 3ZN0A 4KMFA 4RGUA 3F22A 1K78B 1HW1A 1KQ0A 1G6NA 2DW4A 3MEXA 3I64A 3D0SA 1ODDA 1LDJA 4Q47A 5J8CA 4LD5A 2CYYA 4P55A 3WGGA 2A68F 5H6QA 4IPAA 2HOEA 2FRHA 4MTEA 1Z05A 3DF8A 2X0LA 3DFGA 4I0AA 4WXCA 2GXBA 2E7XA 2UZKA 4HZFA 3LAJA 5CJ9A 3REOA 1OYIA 4WWCA 4IXAA 5E18F 2V9VA 1TW3A 1B6AA 4EJUA 2OD5A 3E5QA 1PP7U 3F8BA 3BJAA 3VFZA 4PZJA 1B4AA 2E7WA 4MTDA 5K1YA 2CWEA 3EETA 5DCMB 2IVMA 3CUQA 4RB3C 2FEZA 3KFWX 2NAZA 1Z6TA 4BYYA 1J9IA 2DO7A 1XCVA 1ON1A 3HRTA 2XROA 2YPRA 2VT3A 4DQ2A 4M9ZA 4ZH4F 4HW0A 2TDXA 3L7WA 3SZPA 4JQFA 2KIFA 2QENA 3WODF 4BXUA 3HTUA 2EJRA 1F9NA 4FX0A 3WTXC 5E1WA 5CVIA 3LA7A 4CHUA 2EA2A 3RKYA 2EK5A 1XMKA 3WTTC 4EQQA 5E1ZB 2EA4A 2PMUA 1UCRA 2AS5F 4U0VA 1R5HA 3FMQA 1YW9A 1J75A 4EM0B 4HOBA 1ZARA 2E1NA 2ADUA 4N0BA 2RKHA 3IRQA 3SFZA 2EV6A 3CUOA 1F4KA 5FLXZ 3RPQA 1CF7B 3R0JA 5TRDA 5AIPA 3EYIA 4HA8A 4LB6B 5ILVA 1YS7A 2M45A 1AOYA 2D45A 2CQKA 2XAQA 1U6GA 4NB5A 3JW4A 1OPCA 3KP2A 2HS5A 3BDDA 5HDNA 3JSOA 4XBFA 2VODA 2VC1A 1DPRA 1P4XA 2JT1A 1BI1A 4UXNA 1FNNA 4I02A 5ILSA 3COAC 4YFNF 5IT9K 5E8IA 3FM5A 2O0YA 1IXSB 4MHGA 1LVAA 1BI2A 3BY6A 2HDCA 1XSDA 4MQ9F 5LGUA 2EFNA 3EUHA 3V8JA 3I59A 2LDUA 3ISPA 2IJLA 1XGMA 3B73A 2GA1A 2K27A 1QO0D 3LQRA 4WXDA 1U5TC 1YO5C 2NNYA 3ERED 1ZG1A 1KQ9A 3RKXA 1LJ9A 3ELKA 3HYIA 4Q5SF 1ZLJA 4BHPA 2Z99A 2QQ9A 4EM2A 3T0YA 3T8RA 4RGSA 4D0PA 1O57A 5ICCA 2F5DA 3WTVC 4EGYA 3WE3A 4ZYGA 3PQKA 5LEJA 1BC7C 3DXJF 2XUBA 1ULYA 2WV0A 1FX7A 5FO5A 5DUIA 4ASNA 3ECHA 4P9FA 1B9NA 1MZBA 2D1HA 1BOAA 2F5FA 2X4HA 2J5PA 2C6YA 3DV8A 1KU7A 3EDPA 3U9GA 4G7HF 4XLPF 4XRFA 5LGTA 3IL2A 2Y48A 5BOXA 1IN4A 1S29A 5FFZA 4GGGA 4HYEA 2IPQX 3ZMSA 1O7FA 4A2UA 1HW5A 1P2FA 5D4RA 3ZQ7A 4YIFA 1HBXG 4HLXA 1J5YA 3W6KB 3GO5A 4LFUA 2STWA 2DLLA 3IHUA 3TOBA 1DP7P 1I1GA 1A04A 1TQMA 2YR2A 4FT8A 2FQ3A 4AIHA 3MZYA 4LLGF 2EWNA 3RKWA 1TNTA 2YU3A 4KUMA 3ZP5A 1KYZA 1TQIA 2LSOA 1TNSA 4IJAA 3GYHX 2VC0A 1JXSA 4OU0A 4ESBA 1S6LA 3V7CA 3R61A 4WF2A 2EFOA 3C7JA 5LRRA 4EMSA 1TTYA 2QYOA 3Q5FA 4RGXA 5D6EA 2GZWA 2Z9OA 1O3QA 4ESFA 2XKOA 2L3DA 1QGPA 4OIQF 4OOIA 1W7PB 3HIFA 5EEGA 2MBFA 1T39A 1XB4A 1B9MA 4ENJA 3HSEA 3KLOA 5F6FA 4I09A 1XN7A 5L3CA 1XD7A 2CG4A 2GXGA 2RQPA 1V3FA 3K0LA 2O8XA 4HV5A 4YIIA 4HQEA 4I7HA 3IKVA 4RB0A 3MQ0A 4GXOA 1C0WA 2Y75A 4KFCA 2A3SA 4EJOA 1ZAOA 1H9GA 1ZRDA 2H6CA 3C1DA 2XVCA 3ZMTA 3BPXA 1WWXA 3I54A 3NRVA 3KP6A 2W85A 1YW7A 2VXZA 2BYVE 2G9WA 3QPHA 3BJ6A 4EJVA 2MLKA 3VODA 4A0YA 4L18B 1LDKB 1G3SA 2XAGA 2L4MA 1U2WA 5FD6A 4O3MA 5CVRA 2XRNA 4N9IA 2RN7A 1W5SA 2GIVA 4UNOA 4E70A 5JHUA 4N9HA 3F6OA 1RIOH 4CZZA 3J81Z 3L00A 4BHCA 3FF5A 4O5VA 2FU4A 5K5OA 1LNWA 1O7LA 2HWVA 5ICFA 1K79A 4HLYA 2ZJ2A 3KP4A 4ZZLA 2ACJA 4HV6A 5H20A 4UUVA 2OU2A 3E6MA 3P7NA 3ABTA 1O3SA 3HRUA 3M8EA 1FT9A 1BN5A 2CFXA 2VE9A 3VB2A 1KQ8A 5FLXK 2UXXA 5DUKA 2FE3A 1FC3A 2HTSA 4AWXB 2OZUA 1HQCA 2KIUA 4GCVA 1I27A 2COMA 1Z1DA 3GW2A 3P9IA 5J8FA 4L0YB 3EQLF 4KMUX 3LSTA 4LMYA 2IT0A 2FOKA 2MA3A 1NHAA 2JRTA 1RUOA 2Q2EA 5BPDA 2ESHA 3HSRA 2Z3YA 1B1BA 1LEBA 4LK1F 3SZTA 3DEUA 4NQWA 3B02A 1EV7A 1TW2A 2LKPA 4CO8A 1P6RA 3Q9VA 1HKQA 2XGXA 4M6XA 1HSTA 4PGHA 2DK5A 4WXHA 4UHTA 2AXLA 4ETSA 1LQ1A 3KZZA 1VTNC 4S05A 4WCGA 5HS7A 3M7GA 5L3DA 2XASA 5L3GA 2K7LA 4HX4A 2OAZA 4B8XA 5LHHA 5LHGA 1W5TA 2PEXA 1Z9CA 4RB2C 2RNJA 3TGNA 1GXQA 1BIBA 2JZYA 2M1BA 2R7DA 3WGHA 4P5OA 5CLSA 1J59A 4I0BA 1IF1A 4UV8A 2UWMA 3QP5A 1U5TB 1SMTA 3JAMK 1R36A 1OYYA 1S3JA 2P6SA 2RV8A 5ED4A 2F5EA 3KLNA 2D1VA 2LF8A 2ZBKA 2IA0A 3FXUA 1H9TA 3TDUC 3TQNA 4LG0B 2RC4A 4U7BA 5HLGA 1BI0A 3F72A 3NQOA 3RPUA 3W6JB 3E97A 2R3SA 2OQRA 2CW0F 3O6BB 1OYWA 3IC7A 3KEQA 4A0ZA 1L3LA 3J80Z 3JTHA 3GUDA 1TLHB 1FOKA 3QPTA 5D5WB 3HOSA 2HQNA 1XDUA 2M8EA 2GQQA 2FF4A 1Q1HA 2ZFWA 1Z6RA 3FXQA 1KU2A 3U1DA 2H6BA 1QNTA 3KE2A 5KVRA 4A6EA 3KCCA 3FWEA 3IRRA 1FBUA 3IWFA 4CYDA 3C3WA 1IUYA 2FXAA 2VT2A 3GZ6A 5KK1A 1SMYF 3E3VA 3KZYA 2PJPA 2QBYB 3I0TA 5BQTA 4OIOF 1J2XA 2FNPA 1JGSA 3I53A 3H92A 1HW2A 3WTZA 3QRFF 3KEOA 4LB5A 1F1ZA 3ZPLA 3I58A 4IRIA 4Q48A 5JFRA 2HYFA 5A2QZ 1E2XA 3FZVA 4CDGA 3DP7A 5DDGA 1PDNC 2L54A 5FD5A 4L5JA 3HHHA 2NYXA 1ZG5A 4RAYA 3K9TA 3GEZA 3OV8A 2JTVA 4G9YA 2WTEA 4U0WA 1K78A 2YX7A 2W84A 3QAHA 1AWCA 2WC2A 1Y0UA 1R58A 3OOPA 4L9VA 2ISYA 3WE2A 1DDNA 4UVCA 5HVQC 2JSCA 3R6SA 4ON0A 3CTAA 5ICEA 5L3FA 3R0AA 1XSXA 4RS8A 1XGNA 2ESNA 4PCQA 3C18A 3FMSA 1R00A 2Z5UA 5D5XB 1V4RA 5L3BA 4EJTA 5CVJA 1B59A 5ERIA 3WTYC 1FBSA 2A69F 3V4GA 2FBHA 3WTSC 5AONA 1F5TA 1T38A 2FBIA 1U8RA 3TOAA 5DCMA 1U5TA 2VBXA 1RI7A 3F6VA 4EGZA 3P9CA 4ZYHA 1R1VA 1FY7A 3GFLA 1WSUA 1Z7UA 1FSEA 2ISZA 5HLHA 1HKTA 4HX7A 3LA3A 3QU6A 2Q8KA 3V8LA 1G4DA 3BJOA 2DQLA 1RZ4A 2HFHA 5F1RA 1JE8A 4KT5C 2P8TA 4G6QA 2HKOA 3T5XA 2FSWA 1GHCA 5CVUA 2ZKZA 2M87A 2XAJA 1IAWA 1L0OC 2G7HA 4O6JA 2V6CA 3JTGA 3CO6C 4Y13A 3MCZA 4AIKA 2Z33A 2QUFA 5EEHA 3KP7A 1ZRCA 3CLOA 2BE5F 1QPMA 2ZMEB 4HF1A 1BJAA 2MC3A 3I71A 3N97A 4PGGA 4LGWA 1XGSA 3WG9A 1RNLA 4KN7X 3O3KA 3ROUA 2CGPA 1CF7A 3PQJA 1G3WA 1REPC 4IRGA 1IZ1A 1YLFA 4HF0A 1QBJA 3WU0A 4FHTA 1K6OA 3GFJA 5LHIA 3V7RA 2XKPA 4U88A 3E5UA 2HKXA 4L9TA 4FX4A 2VN2A 2QBYA 1TBXA 2XIGA 5DYMA 3H3ZA 2OQGA 1O3TA 1LB2A 2K4BA 3K1NA 4F7ZA 3TO7A 4WX9A 2ZNYA 4AD9A 1FYMA 5H6RA 1X3UA 3P9KA 2VBYA 4CICA 3U2RA 3ULQB 2KJCA 5CVVA 2GWRA 3DKWA 3EYYA 3ZMVA 5D4SA 2J5OA 3JSPA 2A61A 1IXCA 3CUQB 4M9XA 2DU9A 5D8KB 1FPQA 2DQRA 1IXRC 3ZMDA 2L4AA 3T1BA 2KRFA 1SAXA 2FBKA 2K4JA 4QLCU 5LRSA 3BOQA 4EM1A 5DD8A 1W7PD 4MEYF 3MFKA 3ABUA 1I6XA 4U0YA 2BBYA 4U7DA 3HHGA 3J80K 3WU1B 1BI3A 2DAOA 1CGPA 5FFXA 1MJBA 4L9JA 1R23A 3Q9SA 1T98A 1BM9A 3M1EA 4OMZA 3J7AO 4A5NA 3QU3A 3CO7C 5DV5A 2YX4A 2DPDA 1UHWA 1KU3A 1ZRFA 2MLGA 1IRGA 4KDPA 1PUEE 4KN4X 3G3ZA 1Z91A 5BMZA 3L09A 4M73A 5ICGA 4G7ZF 2MD5A 2QWWA 2DTRA 4MQVA 3BP8A 2PQ8A 3DQVC 2JPBA 4IHSA 2HZTA 4DNCA 1FZPB 3K1MA 3V8KA 4GO1A 1FYLA 2FMLA 3IWZA 2A07F 1IN5A 2PLYA 2L02A 3R4KA 4MGRA 2QQBA 4G94A 2VE8A 5LGNA 1SD5A 5TJJA 4I01A 1U78A 1TQPA 1W4MA 3FMRA 1E17A 2DT5A 5A2QK 4AVPA 2DK8A 2W57A 2FA5A 2F5CA 3I5UA 3M9AA 4R1HA 4P96A 2ZXJA 1W7PA 2IRFG 4RB1A 3SHFA 2QLZA 4LJZF 3FX3A 1YS6A 2YSRA 2M30A 2GA2A 1U3EM 5LBQA 2ZO4A 3CUQC 1ZLKA 2EFWA 3TDZC 5JI6A 1DPUA 2CSOA 2F2EA 1S7AA 5LLQA 2ETHA 4M72A 2P4WA 1QZYA 1SD6A 3O2PE 2EB7A 4KICA 2ELHA 4KYWA 3GF2A 4KNYA 2BGCA 2E1CA 2W25A 4IHTA 3WTWC 1MDMB 5JVTA 4LLLA 1ZREA 4UVBA 3CDHA 3HSFA 3K1PA 2A6HF 1KGSA 2EV5A 4H0EA 1YW8A 4A6DA 1MJ9A 3MAJA 5BS6A 1USTA 2WWYA 3F8MA 2FMYA 2OBPA 3FHZA 2KIMA 2IW5A 1UHMA 5K5QA 2A6EF 4A0XA 3F3XA 4KIFA 4GYGA 4ZZDA 1SD4A 4S04A 4MEXF 3CJNA 1ZGJA 5FB2A 1UFMA 1YYVA 5E8GA 3L9FA 4Q4ZF 2HTJA 1IRFA 5F64A 1XCBA 4HX8A 3GFMA 3LAPA 2ZNZA 1SFXA 3R60A 4Y15A 1ZN2A 3RYRA 3GVAA 2XAHA 1IN7A 4ENNA 4XSZF 2PN6A 4ESJA 1SFUA 3ML6A 2Q0OA 4EV0A 1ZYRF 1IW7F 4M6YA 3M8FA 1GVJA 2V1UA 2EFPA 1XSVA 4LK0F 5HS9A 1FBQA 2EV0A 4OINF 3RJPA 1IN8A 5DCFA 2RVCA 2H09A 4NHJA 3E6BA 2MH9A 2V79A 3F8CA 3RDIA 3SXYA 4AIJA 1MD0A 2P5LC 4Y17A 1QQIA 1ZHFA 2O3FA 4YFKF 4CGZA 1FWZA 1ZGAA 1EH6A 1QZZA 4KIBA 1MKMA 3BZ6A 2QM3A 4G7OF 4MNUA 4LLNA 3TO9A 1T0FA 2G7UA 5HDGA 6PAXA 1G3YA 2HQRA 4HQMA 5E1XA 2QVOA 1D8KA 1XGOA 4CXFA 4EJWA 3ECOA 3BWGA 3H3UA 3GX4X 4OIPF 4ENMA 2PG4A 2RGVA 3TO6A 4YG2F 2ZCWA 4UVAA 1S8NA 2K86A 1D3YA 2O6GE 3N4MA 3MWMA 3GFIA 2LF7A 2NS0A 4A5MA 3GLXA 5D6FA 3QP6A 3GWZA 4Z2YA 4OIRF 4ZYEA 2M5WA 4M71A 1LDDA 3HRMA 1K7AA 1EH7A 1S7OA 1FP1D 2O61A 2P7CB 3KP5A 2HR3A 5HS8A 4R79A 4IVNA 3LFKA 4JBAA 1ONVA 2H94A 3WGIA 1YFHA 2HEOA 3VOEA 4IRHA 5J6XA 4B09A 1D8JA 3G73A 2P7VB 5DD4A 5DEQA 1IN6A 2FNAA 2CO5A 4BHBA 3V7SA 4BH9A 4P9UA 1MDMA 3KP3A 3IKTA 2VBWA 1LEAA 3J81K 4L0ZB 3ZMUA 1BIAA 3JAMZ 1H0MA 3VEPA 5JR3A 1BBYA 1HSJA 5CYVA 3D5LA 1R1UA 2UXNA 2OA4A 2Y0MA 1KU9A 2DBBA 4LG0A 2W24A 4M9SA 1I1SA 4KIGA 1SFEA 2IA2A 1STZA 3F21A 5HDKA 4RAZA 1KYWA 3GZ5A 1P4AA 4ENKA 2A5YB 1O3RA 3LQQA 2XAFA 2RDPA 4JK1X 1OMIA 1ZG3A 2KJBA 4A12A 3E6DA 3ZN1A 1PP8F 3HRSA 1WKMA 3HOTA 3F8FA 1GXPA 5LEKA 4I2OA 3L2CA 3E5XA 1P4WA 1YIOA 3QOPA 4HF2A 1HXDA 1OKRA 1FSHA 2VONA 3DPTA 3RYPA 3NEUA 5E17F 2R7FA 1J0RA 3BROA 3LA2A 1J7KA 4IF4A 2HGCA 3AAFA 5D5UB 2QZ8A 4BNCA 4WK8F 1RUNA 5L3EA 2LNBA 2V1XA 1MJAA 3SQNA 1OR7A 2H27A 4QWQA 5IT9Z 2P6TA 5ILUA 3F8NA 2P5VA 2EFQA 1SD7A 1YQAA 5HLIA 1T2KA 2BEOA 2VBZA 2NNNA 2XHKA 4EVIA 5HOOA 3S2WA 3TKYA 3T8TA 1WRJA 3RI4A 2P5KA 4PDKA 3KETA 2DI3A 3GXOA 2NRAC 2MH2A 4L9NA 2B0LA 2BV6A 3ZMZA 1FP2A 2HYGD 4UV9A 2K02A 4M74A 2IP2A 3FM3A 4K2EA 4YFXF
chains in the Genus database with same CATH superfamily
2XC7A 2VOOA 4XLNF 5IT3A 4V2GA 2Y69H 2L01A 2R7OA 3FXRA 1Z67A 2CMPA 1X4PA 2PJRB 1X4OA 1T6SA 3GTKJ 2O03A 3BR3A 4HDVA 2QQAA 1MMSA 2LTPA 2OCCH 2STTA 1WFXA 1MGTA 2V1DA 5FROA 4BJTA 2DFIA 3GTQJ 2RAEA 3RTRA 1YX3A 2D2WA 1X2NA 1YG2A 2IA1A 3NAUA 2BVLA 1D5VA 3WTUC 2ECCA 1KA8A 2PFBA 4R8HA 3AL0B 4FQGA 2MD0A 1BC8C 3ABLH 3IUOA 3LWFA 4HAMA 2DT6A 3M3YJ 1ON2A 1R7JA 4HBLA 1FYKA 2VPRA 5D8LB 1JHHA 1FMVA 3DPLC 5E20A 3BPVA 1R5GA 1JUMA 2GAUA 3K4KA 3IV5A 1S7EA 2E19A 2W00A 4XOTA 1NK3P 3PFIA 2OZ6A 4L5IA 3IH2A 4HDUA 1HKSA 3G1OA 1Y1VJ 1YTYA 4BL0B 2XV4S 1K83J 1UJ8A 1FLIA 1IV8A 4CCOA 4RGRA 1WI9A 4TV7A 4KT6A 5BPIA 1X19A 4BAYA 2ECBA 3F23A 3HUGA 4XRSG 4B43A 2DYRH 2PMHA 1DUXC 1WZ2A 1WQ2A 3HGGA 1R1TA 1HCRA 4IKFA 1NTCA 1XG1A 4DGWB 3B6CA 1WJ5A 3JRCA 1XMXA 3S93A 2VOPA 1EH8A 4XSXF 1G3TA 5GPAA 4OMYA 3RIRA 5K5RA 4GYIA 4QIWN 1I5ZA 2Y9YA 1VQ5I 2LMDA 2XGEA 1LFUP 1W1WE 4MLOA 1BA5A 5AIQA 4BXFA 1XMAA 1FMWA 3K2ZA 4CSWA 3I4PA 2KKOA 2PBIA 2W4SA 4D1QA 4E4HA 2PI0A 2YUSA 1UB9A 2VLAA 4HRIA 1U0JA 1ZKGA 1ZH5A 3MZHA 3BQYA 2DPUA 2JPCA 2GBYA 3E6CC 2LRDA 4DBRA 4XR6A 3ZQHA 2V26A 1VQ7I 3HTSB 2L5QA 3A4CA 3CP8A 1QVTA 4G6DA 1R22A 1XDSA 5D5VB 2ZMEA 1Y39A 1FEXA 2EINH 4BQAA 3K69A 2XSJC 1JHFA 2IS4A 1W36D 1USSA 5FGMA 2K3PA 2AQFA 4RM2A 5FKKA 4FASD 4ZYDA 3G71I 5J47A 4KA4A 1VQ4I 4AC0A 1VI0A 3I59B 1P92A 3ZCOA 2V9KA 4I98B 4G8XA 3ZN0A 4KMFA 4RGUA 4BJ5C 1JKOC 3F22A 1K78B 1HW1A 1KQ0A 2GIZA 1VFCA 1G6NA 2CJJA 2DW4A 1MMAA 4D7NA 3MEXA 2OTJI 1TWHJ 1FOYA 2CW7A 3I64A 3IAM2 4B48A 3A01B 3D0SA 1ODDA 1LDJA 4Q47A 3KYCB 5J8CA 2RQQA 1EF4A 4LD5A 2CYYA 4P55A 4YIRX 3WGGA 2A68F 1T08B 2XF6A 5H6QA 4IPAA 2HOEA 4A3FJ 2BY1A 2FRHA 3LSGA 4MTEA 1Z05A 3DF8A 2X0LA 3DFGA 3VYSB 3OYGA 4I0AA 1VQMI 4BE1A 3A0BC 2NXNB 3SEZA 4WXCA 3PIOF 2GXBA 2E7XA 2UZKA 2K9LA 4HZFA 3LAJA 4EEFG 3AL0C 2CQNA 1D1BA 4MFDA 5CJ9A 1OYIA 3A0HC 3REOA 4WWCA 4IXAA 5TISC 5E18F 2V9VA 1TW3A 1I6HJ 1B6AA 4IOCF 1RETA 2EH3A 2UUZA 4EJUA 1QHHD 4E7LA 3RCOA 2OD5A 3E5QA 1PP7U 3F8BA 3BJAA 3VFZA 4PZJA 1B4AA 2E7WA 4MTDA 4D7MA 3OS2A 3HPGA 5K1YA 1B72B 2CWEA 1RR8C 4W1UA 2HQAA 3EETA 5DCMB 3CCYA 2IVMA 4PJJA 3SZGA 3CUQA 4RB3C 2FEZA 3KFWX 2NAZA 2P81A 1Z6TA 4XRMA 3L2UA 2X1CA 2E2HJ 2VIXA 2OV7A 4BYYA 1J9IA 2DO7A 1XCVA 1ON1A 2FQ4A 3JREA 2DN0A 1ORKA 3HRTA 2BHZA 1JJ6C 2XROA 4YRVA 2M34A 2YPRA 5K7FA 1MIJA 2VT3A 1RRJA 4DQ2A 4M9ZA 3JRDA 4ZH4F 4HW0A 2TDXA 3WHBA 3L7WA 3SZPA 5IYCJ 2X9DA 3DBLB 4JQFA 2K9SA 3JRFA 1TWGJ 1W5CC 2KIFA 2QENA 3I9V2 3WODF 2KZVA 4XLHA 4BXUA 2XF7A 3I4NJ 3BG6A 2R5YA 3HTUA 2EJRA 1F9NA 4FX0A 2DT7B 3WTXC 2VUMJ 2YU9J 5E1WA 3OWTA 2BXZA 3CC2I 5CVIA 4D5CA 2M7AA 1DP3A 4XL9A 3LA7A 4CHUA 2HU9A 2EA2A 3RKYA 4UY8I 2EK5A 3IAS2 1XMKA 3WTTC 3RSNA 4EQQA 3VWBA 3BG7A 5E1ZB 2EA4A 2PMUA 1UCRA 1AKHA 2W1OA 2AS5F 4U0VA 1R5HA 1OCPA 3H36A 3FMQA 1V55H 4XN3A 1PUFB 1YW9A 1J75A 3TW7A 3H0DA 4EM0B 4HOBA 2PX9A 2KMUA 3CCMI 1ZARA 4PK4A 2E1NA 1QU3A 2ADUA 4W97A 4N0BA 2IGKA 2LY2A 5EYRA 2RKHA 2CUJA 3IRQA 1QVUA 1WJAA 3SFZA 3G4SI 4B1RA 4BUPA 2EV6A 3S1RJ 3CUOA 2WBMA 3EUHC 2E35A 1F4KA 5FLXZ 1ZTRA 3RPQA 3J7AY 1CF7B 1LVKA 3QPSA 3R0JA 2F48A 2AXTC 5TRDA 2CUFA 5AIPA 4C3HJ 3EYIA 4HA8A 4NC7A 2JUGA 4M3GA 4PJ0C 2XAUA 2K3FA 4LB6B 4H4KC 5ILVA 2DMTA 3H0GJ 3CMEI 1HA8A 3H9JA 2QGUA 1YS7A 2M45A 1AOYA 1IRXA 4CYCB 2D45A 4GDFA 4XKWA 4NBQA 4X6AJ 5FJ8J 2CQKA 2XAQA 4OAYA 3KIOA 1U6GA 2LY9A 4BQQA 3MD2A 5J4YA 2JN6A 1H89C 4NB5A 3JW4A 1E3HA 2JA2A 1OPCA 5FLVA 3KP2A 3I4MJ 1JI8A 2E34A 2HS5A 2DFFA 2A05A 5DM7F 1EKEA 3W3CA 3ZGKA 3BDDA 5HDNA 3FKIJ 2E36A 3JSOA 4XBFA 2VODA 2VC1A 1DPRA 1P4XA 1YIJI 2NOJB 2W48A 2JT1A 4XIDA 4I99C 1BI1A 1KONA 1IO2A 4UXNA 1FNNA 4I02A 5ILSA 1QZEA 1X1PA 3ZXSA 3COAC 2ID3A 4YFNF 5IT9K 5E8IA 3FM5A 2O0YA 1IXSB 4A3KJ 3PL8A 2IGOA 4ZC3A 5FRNA 5K7HA 2CUEA 4MHGA 1JGGA 3RKQA 1LVAA 3BY6A 1BI2A 3QYBA 2HDCA 1XSDA 4MQ9F 1JTYA 3ZQCA 5LGUA 2V7FA 2EFNA 2DYSH 3EUHA 3V8JA 3FXMA 5IYBJ 3I59A 2LDUA 5J1RA 4UB6C 3ISPA 5H2FC 3LNQA 2IJLA 1XGMA 3B73A 2GA1A 2M4KA 2K27A 1GVDA 4HSRA 1QO0D 3A2KA 3LQRA 3JR9A 4WXDA 1U5TC 1YO5C 3K4LA 2KP6A 3BR1A 2E71A 2NNYA 2E2JJ 3J7YJ 3HC7A 2CS3A 4B44A 3ERED 1ZG1A 1KQ9A 2L2OA 3RKXA 1LJ9A 3CCLI 3ELKA 1ZR4A 4XLEA 3HYIA 4Q5SF 1ZLJA 3ESWB 2HNHA 4BHPA 2MW8A 3KYLA 2Z99A 2QQ9A 1JKQC 1WH5A 2DFEA 2M9HA 4EM2A 4UUSB 2FOWA 2RNGA 3T0YA 3T8RA 2COBA 4ZDLA 4RGSA 4D0PA 1O57A 3BR2A 5ICCA 1Y56A 2F5DA 4IHWA 3WTVC 4EGYA 3WE3A 4ZYGA 2HVSA 4BY1J 2X6OA 3PQKA 5LEJA 2WAQA 3DXJF 2XUBA 1ULYA 1BC7C 2K85A 2WV0A 3PO2J 1FX7A 5FO5A 4JYKA 3E7LA 2KISA 3GBGA 5DUIA 3HG9A 3HJEA 4ASNA 2Y9ZA 3ECHA 4P9FA 5J40A 1X58A 3OYEA 2LBFB 1B9NA 1DGRM 1F36A 4BKXA 1MZBA 2D1HA 1BOAA 2BY2A 2F5FA 2X4HA 4LIVA 2J5PA 2C6YA 1A5JA 1B72A 4YEJA 3DV8A 1KU7A 3EDPA 3U9GA 3DU6A 3WG7H 2LOOA 3OYAA 3I55I 1TWAJ 4XLPF 4G7HF 4XRFA 5LGTA 2LKSA 2WA0A 1MSEC 2O5RA 3OS0A 5E79C 2E1OA 3IL2A 2Y48A 2GLOA 5BOXA 1IN4A 2HXOA 1S29A 2ZXHA 5FFZA 1GLNA 4GGGA 3DBHB 4HYEA 2IPQX 3ZMSA 1O7FA 4LG3A 1HW5A 4A2UA 3OYDA 1FOXA 3GLLA 3M8JA 1P2FA 2JSPA 5D4RA 3ZQ7A 3GTMJ 4YIFA 1HBXG 4HLXA 1J5YA 3W6KB 2LK2A 3GO5A 3QYEA 4LFUA 1M1EB 3M07A 2STWA 2DLLA 4V2FA 2CV1A 1X2MA 3IHUA 3TOBA 1DP7P 1I1GA 3KPHA 2A5WA 1A04A 1TQMA 4BE0A 2YR2A 3TP3A 4C9YA 4FT8A 3C2GA 2FQ3A 5KCMA 4AIHA 2E1MB 3MZYA 2EWNA 4LLGF 3RKWA 3OYBA 1TNTA 1YX5A 2VKVA 2YU3A 1VQNI 4KUMA 3ZP5A 1KYZA 1TQIA 2NOGA 2LSOA 3A03A 3JRAA 2WB1N 1TNSA 4IJAA 3GYHX 2VC0A 1JXSA 4OU0A 3BZKA 4ESBA 1S6LA 1SEUA 2B7EA 3V7CA 1A6QA 3R61A 4WF2A 2EFOA 1XPXA 4IL6C 3C7JA 5LRRA 4EMSA 2DA7A 4AM3A 1TTYA 2QYOA 2DMUA 3CCRI 4A3DJ 3Q5FA 4RGXA 5D6EA 2IGNA 2NVUB 4NQWB 2WADA 2AQEA 2GZWA 2MC4A 1V5EA 4NUBA 2Z9OA 2LG4A 4N4NB 1O3QA 4ESFA 1YRNB 2XPUA 5F1JA 2XKOA 2L3DA 1QGPA 4G12A 4OIQF 4DW6A 4XRSA 4OOIA 1W7PB 1VQ8I 3HIFA 5EEGA 3S14J 2MBFA 3DLLF 1T39A 1XB4A 3FKJA 2ZB9A 1B9MA 4CYCA 4ENJA 3HSEA 5EF6A 3KLOA 4E7HA 5F6FA 1I50J 4I09A 3L2VA 2H8RA 4RM3A 1XN7A 2VKHA 1JT6A 4HNUA 5L3CA 5GADJ 1XD7A 2CG4A 4J19A 2GXGA 3SDBA 2RQPA 4FE7A 1V3FA 1JKPC 4BDYA 2JRMA 3K0LA 2O8XA 5JLXA 4HV5A 3OYHA 3VYTB 1DU6A 3Q0VA 4AIDA 4J00A 4YIIA 1I39A 2L7ZA 3X2QH 1TWCJ 1W0UA 4CCNA 4HQEA 3H5AA 4ZTJA 4I7HA 5B3SH 2Y31A 3IKVA 1BW5A 4RB0A 3MQ0A 4GXOA 4LOCA 2W82A 1ZR2A 4PJMA 4F3QA 5IP6A 2CUZA 1C0WA 3Q0UA 2Y75A 1P7JA 4KFCA 2L9VA 1OCOH 2A3SA 3W2WA 2DODA 1ZAOA 4EJOA 3ZR8X 3HGYA 3M1CA 1H9GA 2DMQA 1ETOA 4F55A 3ZQFA 1IG7A 2H6CA 3C1DA 1ZRDA 2XVCA 3IH4A 3ZMTA 1WVRA 1WWXA 3BPXA 3I3LA 2V6EA 3I54A 3NRVA 3KP6A 1IUFA 2AO9A 4BDZA 2W85A 1YW7A 5FKOA 2WAEA 2VXZA 2BYVE 2G9WA 2TRTA 1RR7A 3CJTB 3QPHA 2VL8A 3BJ6A 4MIMA 4EJVA 2MLKA 4IHYA 3BTLA 3VODA 4A0YA 5E3OA 4L18B 1LDKB 1X1CA 3K4JA 1G3SA 3WU2C 3S3NA 2R7RA 2XAGA 1XTAA 2R5ZB 2DOFA 2L4MA 4CA0A 4E6KG 1U2WA 2HPMA 5FD6A 2JVHA 1KZHA 4O3MA 2KLOA 2QA4I 4UUSA 5CVRA 1GUUA 2XRNA 1BJZA 4N9IA 3OL3A 2RN7A 4LITA 1W5SA 5E3MA 2GIVA 4UNOA 4E70A 4X0GA 5JHUA 4N9HA 1T56A 5FLMJ 1LE8B 3F6OA 3ASOH 5EZGA 5GAEJ 2KFDA 1RIOH 2LH9A 4CZZA 3J81Z 3L00A 4BHCA 1IC8A 3FF5A 1APLC 3FBIB 1ETKA 4O5VA 2E1MC 2FU4A 5CKTA 5B5EC 5K5OA 1LNWA 1O7LA 2HWVA 5ICFA 2L9SA 2BW3B 1K79A 2LD5A 1HC8A 4HLYA 3BC8A 1VQOI 2ZJ2A 1VNDA 3L2RA 1Z3XA 3KP4A 4ZZLA 2ZC2A 4BS9A 4HV6A 2ACJA 3DU5A 5H20A 1S72I 4UUVA 2OU2A 3E6MA 3CCSI 2VJJA 3P7NA 3ABTA 1MH3A 2R93J 3A1YA 1Y0NA 1O3SA 3HRUA 3M8EA 4J01A 4XLCA 2VKDA 1FT9A 3HKZA 2EZIA 2JMWA 3CCVI 2NS8A 1BN5A 3LOCA 2CFXA 2VE9A 3VB2A 3N05A 3P5JA 4UB8C 1KQ8A 3U21A 3GCMA 2KPMA 1YJNI 5FLXK 2DA5A 4JOMA 2UXXA 2UV1A 1FIPA 5DUKA 2YS9A 2CH0A 3OSGA 4XM3A 2FE3A 1HOMA 2R7ZJ 3CESA 1FC3A 2HTSA 3PNVA 4AWXB 3K70D 2XSDC 2OZUA 1HQCA 2KIUA 2JUCA 4GCVA 5JHFA 1I27A 2COMA 3HOVJ 1Z1DA 3GW2A 3P9IA 5J8FA 3Q3SA 1S9HA 3FISA 1MMDA 2KL4A 1W0TA 4L0YB 3EQLF 4KMUX 2B63J 2EQRA 1XC5A 3LSTA 4LMYA 3S8PA 2IT0A 2LYCA 2FOKA 2MA3A 1NHAA 2VJIA 3ZQGA 5FKNA 2JRTA 3TP0A 1ETXA 3MVPA 2Q2EA 1RUOA 1B8IB 5HNFA 1E3OC 5DS9A 3OYJA 2ESHA 1G8XA 5BPDA 3DWLE 3HSRA 2PMZN 3HXLA 2Z3YA 3MN2A 3S32A 4QPOA 1B1BA 1LEBA 4LK1F 3SZTA 3BTIA 3DEUA 4N4OB 4NQWA 3SJMA 4PJLA 3B02A 1EV7A 1TW2A 2LKPA 4CO8A 1P6RA 3Q9VA 1HF0A 4IEJA 1HKQA 3DTKA 4F52A 2XGXA 1ERDA 2IGMA 2X1DA 4M6XA 4DJAA 1HSTA 4PGHA 3HM5A 2DA1A 2DK5A 4WXHA 4UHTA 4BXXJ 2AXLA 2W7NA 3HBLA 4ETSA 3S1QJ 3FDYA 4IZZA 1LQ1A 3KZZA 1VTNC 3TBIA 5JLWA 1O4XA 4S05A 4JP0A 4BEHB 1U9NA 3IP4B 4WCGA 4A3EJ 5HS7A 2X51A 1D5YA 2L7KA 3M7GA 5L3DA 2XASA 5L3GA 5C4JJ 3AG2H 3CC4I 2K7LA 3PUFA 4HX4A 4BY7J 2OAZA 2OCEA 4B8XA 4II3A 5LHHA 2X6YA 5LHGA 3I56I 2ID6A 1NK2P 1W5TA 2PEXA 4E7KA 1Z9CA 4RB2C 3BG3A 2RNJA 3TGNA 2LP0A 1GXQA 1FJLA 4CH7A 3GTGJ 1UG2A 2CFOA 1W36C 1BIBA 1Y8RB 2JZYA 5KAIC 2M1BA 2R7DA 2ZSHB 4P5OA 3WGHA 5CLSA 3CJRB 5E3NA 1J59A 4I0BA 3H9GA 1IF1A 4UV8A 2UWMA 3QP5A 1U5TB 1SMTA 3JAMK 1MBGA 4NC8A 1R36A 1OYYA 2BXYA 5M3MJ 1E3PA 2D5VA 1S3JA 4DZJA 2P6SA 2RV8A 5ED4A 2F5EA 3KLNA 5IY5H 2D1VA 1LKXA 2NS7A 2BY0A 2LF8A 2FX0A 2ZBKA 2R7SA 1R4NB 2IA0A 3FXUA 1H9TA 1Z7LA 2XGCA 1SFKA 3TDUC 3TQNA 2JWTA 3HOUJ 2PJRA 3BTCA 4MO7A 4LG0B 2RC4A 4U7BA 5HLGA 1BI0A 1I3QJ 2VJ5A 3F72A 4A3JJ 3NQOA 2DA6A 3RPUA 3W6JB 3E97A 3PSIA 2DOEA 1ETWA 1ZQ3P 5JVGF 2R3SA 2GXAA 2OQRA 2M4GA 4L5EA 2CW0F 3O6BB 3GTPJ 4PSXA 3EPZA 4AU7A 1OYWA 3IC7A 3KEQA 4RMNA 4A0ZA 1L3LA 2HQ5A 3CMAI 1K6YA 5TGTA 3J80Z 1WPKA 3JTHA 1BR4A 3GUDA 3HEFA 4Z6YA 1TLHB 2F4OB 1GDTA 4BQNA 1FOKA 3QPTA 5D5WB 3HOSA 2BZTA 4A3CJ 2HQNA 5C44J 1T0FC 2QEXI 2WB1A 1XDUA 4KJZA 2M8EA 2DMPA 2GQQA 2BW3A 1X3WB 2FF4A 1Q1HA 3FXLA 4AYBA 5HLTA 2ZFWA 3G1MA 1V5FA 5B1BH 5K7ZA 1Z6RA 3FXQA 3RZDJ 1KU2A 3U1DA 4LIUA 2H6BA 3A02A 4IOAF 1QNTA 3KE2A 5KVRA 3PM1A 4E7ZA 1Z21A 4A6EA 3KCCA 3FWEA 3IRRA 1FBUA 1UHSA 1WCMJ 1ZELA 3NWSA 3IWFA 3S17J 4CYDA 1NG7A 1DGWY 2JA5J 1Y1WJ 4A3BJ 3C3WA 2EIMH 4G6TB 1Z3YA 2GOXB 2OUMA 5J1UA 1IUYA 3O8GA 2FXAA 3PNYA 1MBEA 2VT2A 2M7BA 4AVZA 2XPWA 4U87A 3GZ6A 1VQPI 5KK1A 4ZTFA 2NVXJ 2VJ4A 4XLFA 3UNGC 1VQLI 2ELKA 1RKTA 1SMYF 3E3VA 3KZYA 2PJPA 4ABZA 2QF7A 3DCFA 2QBYB 1GV2A 3I0TA 3CP2A 5BQTA 4OIOF 1IDZA 1J2XA 2FNPA 2R7QA 3QODA 3BR0A 2ICWG 4XKCA 1JGSA 3M4OJ 3I53A 3H92A 3JCUC 1OCCH 1HW2A 1VF9A 2IXSA 3L2QA 3WTZA 3QRFF 1P7IA 3KEOA 4LB5A 2R7XA 1F1ZA 3ZPLA 2Z16A 3I58A 2CRGA 4IRIA 3LSHA 4Q48A 5JFRA 2HYFA 2OC6A 2LFBA 3OYKA 5A2QZ 1E2XA 3FZVA 4CDGA 5C3EJ 3DP7A 5DDGA 1PDNC 2L54A 5FD5A 2BY3A 4L5JA 3HHHA 5CPRB 2ZXWH 2NYXA 5F0CA 2VPLA 1ZG5A 4RAYA 3K9TA 2JQ7A 3GEZA 3OV8A 2KQRA 4HPQA 2Q1ZB 2JTVA 4G9YA 4A3LJ 2WTEA 1BR2A 4PFPA 5J3LA 4U0WA 1K78A 2YX7A 2W84A 4FCYA 2RREA 3QAHA 1WHUA 1AWCA 2E60A 3A01A 2WC2A 1OQYA 5B66C 2M0MA 2N8GA 3BT9A 1Y0UA 1R58A 3OOPA 4L9VA 2ISYA 3K7AJ 3WE2A 3K4MA 3G6EI 1DDNA 4XQFA 5GP9A 4UVCA 3FK7A 5HVQC 3OIQA 2JSCA 3R6SA 1DQUA 3DLAA 4ON0A 3CTAA 5ICEA 2CV0A 3DTEA 4QTRA 5L3FA 3R0AA 3L2WA 2K40A 2V9PA 1XSXA 4RS8A 1XGNA 2QQ8A 3W2VA 3MKLA 2ESNA 4PCQA 3C18A 3FMSA 5KNLA 1R00A 2Z5UA 2LLKA 5D5XB 1V4RA 2V4JC 5L3BA 4EJTA 5CVJA 1V5GA 1B59A 3ASNH 5ERIA 1WJCA 5GTHC 3S3OA 2CQQA 3WTYC 1FBSA 2A69F 3V4GA 2FBHA 3WTSC 2EZLA 3FHNA 5AONA 5EG0B 3ABKH 1F5TA 1T38A 2VQCA 2FBIA 3K2AA 1AHDP 1QHGA 1MW7A 3CCJI 1U8RA 3TOAA 5DCMA 1U5TA 2VBXA 1RI7A 2IS1A 3F6VA 4NC6A 4JX5A 4C2UA 2FD5A 4EGZA 5IPAA 2XPVA 1T95A 1XX5A 3P9CA 2XF5A 5DTDA 4ZYHA 2CQXA 3G2BA 4IX7A 1R1VA 5IYDJ 1FY7A 3GFLA 4DOZA 1S5LC 1Z7UA 1FSEA 3H1CA 1WSUA 4DIQA 5HLHA 1EJ9A 2ISZA 1HKTA 4HX7A 3LA3A 4C30A 3J7ZI 3QU6A 3BLYA 2Q8KA 3V8LA 1G4DA 2Y2ZA 3BJOA 1RZ4A 2DQLA 2HFHA 2XB5A 1IGNA 2MG4A 5DM6F 5F1RA 4B47A 1JE8A 2DOAA 4DBQA 1MBHA 3HPHA 4KT5C 2F4MB 1RC9A 2P8TA 5CQGA 4G6QA 2ZJPF 1QRYA 4D9JA 4RA2A 2HKOA 1ITYA 3T5XA 3LFUA 2FSWA 4XONA 2LC2A 5CVUA 4JX6A 2R4GA 1GHCA 2ZKZA 2M87A 2XAJA 2QSGX 3PFYA 1IAWA 1VQ6I 1L0OC 1JT0A 2G7HA 5EDNA 4O6JA 2V6CA 3JTGA 3CO6C 3S1MJ 3MMYB 3L1PA 4Y13A 5FRMA 3MCZA 1OR7C 4AIKA 1PUFA 2Z33A 2QUFA 5EEHA 1CQTA 2ZJRF 5F27A 1F43A 3KP7A 2L0KA 1T8IA 1ZRCA 3CLOA 2BE5F 4XICA 3HDDA 1QPMA 4A3IJ 2ZMEB 4HF1A 1BJAA 2MC3A 3I71A 3PNTA 4PGGA 3N97A 4LGWA 2PMZA 3CDLA 1XGSA 3WG9A 1RNLA 5M5WJ 2X85A 4KN7X 1PVEA 3O3KA 3ROUA 2CGPA 2JA8J 1CF7A 3VDXA 3PQJA 3LSIA 1IRZA 1BR1A 2KIQA 1G3WA 2XGDA 1REPC 3KYDB 4IRGA 1IZ1A 1YLFA 1JTXA 4HF0A 1QBJA 2EPFA 2LR8A 3WU0A 4Y7NJ 4F91B 1MBJA 4FHTA 2P0WA 3GFJA 1K6OA 3RQIA 5LHIA 1RKWA 4PFOA 4IQ4A 3V7RA 3OR2C 5J1YA 3ABMH 5M5YJ 2XKPA 4U88A 4M3BA 3E5UA 2K9QA 1IJWC 2IS6A 2HKXA 1JUPA 4IHXA 4L9TA 4FX4A 2Y0SN 1DU0A 2VN2A 1LPQA 2QBYA 3PUBA 4HG2A 4KITB 1K4TA 4BE2A 1TBXA 2XIGA 3H3VK 1D0XA 5DYMA 2VQLA 1FOWA 5F0HA 3H3ZA 1X1AA 2JK3A 2OQGA 2MSYA 3LSPA 1O3TA 4B3AA 1LB2A 1QA6A 4HEA2 2K4BA 3HOYJ 5J4VA 2HXIA 2FUG2 2DMNA 3DEEA 3K1NA 4F7ZA 1WI3A 3TO7A 2IAIA 1YHQI 4K2EA 4WX9A 3CC7I 3OIPA 2ZNYA 3CZ6A 1N77A 2IEKA 4AD9A 4ZDPA 1FYMA 5H6RA 4XN0A 1X3UA 3P9KA 2VBYA 3CMMA 4CICA 3U2RA 3ULQB 2KJCA 5CVVA 2GWRA 1SVMA 3DKWA 4B4CA 3EYYA 3ZMVA 1SAUA 3GTJJ 4CCJA 2DJNA 5D4SA 2J5OA 3JSPA 1UZCA 2A61A 1IXCA 3CUQB 3OOUA 2EZHA 2OJED 4F92B 4M9XA 1Z0XA 2DU9A 5D8KB 1FPQA 1ZK8A 2DQRA 3ZQIA 1R49A 1EA3A 2HOSA 1BOBA 4FE4A 3H5RA 1IXRC 3S16J 3ZMDA 2L4AA 3SFIA 1MH4A 2DDAA 3BR6A 1MMGA 4CCMA 2DFHA 1Y6IA 3VPRA 3F0CA 3OS1A 3T1BA 3IH3A 1G59A 2R5YB 2KRFA 1SAXA 2NVYJ 2FBKA 2K4JA 1MNDA 4ANJA 4QLCU 5LRSA 3BOQA 2KRHA 2IBDA 3H5NA 5GPCA 4EM1A 5M3FJ 1WJEA 5DD8A 1W7PD 2V1NA 4MEYF 3MFKA 3ABUA 1I6XA 4U0YA 2BBYA 3BZCA 4U7DA 2R7TA 3HHGA 3J80K 3BG5A 3WU1B 1BI3A 2DAOA 2E5ZA 4XNFA 2CQ7A 1CGPA 5IOYA 1ETVA 2LBFA 3NWTA 5FFXA 1XS9A 2WAQN 1MJBA 5EG0A 1N25A 4L9JA 2M3AA 1AKHB 4CUGA 1R23A 2BOLA 3Q9SA 1PJRA 1T98A 1BM9A 4UUTA 3M1EA 4OMZA 3J7AO 4A5NA 3W2AA 3QU3A 3CO7C 5DV5A 2YX4A 2JVGA 3BCBA 2DPDA 3TL4X 2BHYA 3DBRB 1X1BA 2ZMEC 3QPLA 1UHWA 3B6AA 1KU3A 1ZRFA 2MLGA 4NNJA 1UG0A 4CCLA 1IRGA 4KDPA 4KISA 3F9KA 4M3FA 2WY7Q 1PUEE 4KN4X 3G3ZA 1Z91A 2ZSIB 4M3EA 5BMZA 2I8DA 1K4SA 5F08A 4NDLA 3HL2A 3L09A 1WGXA 4M73A 5ICGA 4BBSJ 4G7ZF 2MD5A 3QQAA 2CV2A 2QWWA 1RPWA 2DTRA 4MQVA 3BP8A 1BW6A 1YE9A 4RDUA 2HVQA 3OYNA 2PQ8A 3DQVC 3PSFA 1WH7A 3TW6A 3HZJA 3E0JB 2JPBA 4IHSA 2HZTA 1SANA 1HLVA 4HSTA 3H35A 4DNCA 1FZPB 1ZGWA 4BU2A 3K1MA 3V8KA 2AHQA 4GO1A 5IP7J 1FYLA 2FMLA 1MBFA 3IWZA 1VZ0A 2HZDA 2DDBA 2DJIA 2VB6A 2A07F 1IN5A 3RPUD 2PLYA 2L02A 3R4KA 4MGRA 2QQBA 3S1NJ 4G94A 3D5RC 3MZ8A 2VE8A 1SVOA 5LGNA 5LD2C 3HOZJ 2NVTJ 1SD5A 5TJJA 4I01A 1A31A 3LSMA 1U78A 3EUAA 1TQPA 1W4MA 2KRCA 3FMRA 1E17A 2DT5A 4PSWA 5A2QK 3LSKA 3AG1H 4AVPA 3AG3H 1TC3C 2R7UA 2DK8A 2WV1A 2W57A 1YITI 2QKMB 1A36A 2FA5A 2F5CA 5GAGJ 1YRNA 3I5UA 3M9AA 4R1HA 1AU7A 2QSHX 3HOWJ 4P96A 2ZXJA 3C2HA 4A3MJ 1W7PA 2IRFG 4RB1A 3SHFA 2QLZA 2VKEA 2M2EA 3FX3A 4LJZF 4E7SA 1YS6A 2YSRA 2M30A 3ZQLA 2ZJQF 2GA2A 4ZYAA 5LBQA 1U3EM 3FXKA 2L7FP 2XB0X 2ZO4A 3CUQC 4C3IJ 2EFWA 1ZLKA 3TDZC 3D1NI 2H1KA 4IQJA 1PYVA 1I3AA 5JI6A 3K6GA 1DPUA 3K70C 2MFZA 3CCEI 2CSOA 4PJNA 2F2EA 1S7AA 1MMNA 3JRBA 5LLQA 2LVSA 5EGOB 2ETHA 4M72A 2KDZA 2OTLI 4B3XA 2HYJA 4E7IA 2P4WA 1QZYA 3DTIA 1SD6A 1N75A 3O2PE 3KEYA 2EB7A 4KICA 3GTLJ 1MNEA 2ELHA 4KYWA 3GF2A 4KNYA 2BGCA 2E1CA 2W25A 1SFOJ 3FBNB 2EILH 3VYUB 4IHTA 1GT0C 1D1AA 3WTWC 4P1WA 1MDMB 1JKRC 3K4NA 1OJLA 5JVTA 4LLLA 3PIPF 3CD6I 1ZREA 5BNGA 1H88C 4UVBA 3CDHA 1A35A 2NVQJ 3HSFA 3K1PA 2M8GX 2A6HF 1KGSA 5HODA 2EV5A 4QPQA 4H0EA 1YW8A 3BCAA 4A6DA 2GOMA 3AFHA 4RLQA 1R4MB 1MJ9A 3MAJA 3MKYB 4M3DA 1UMQA 5BS6A 3GMEA 1D0ZA 2X6WA 1USTA 2WWYA 3F8MA 2FMYA 2OBPA 3FHZA 2VQGA 2KIMA 4F93B 2IW5A 1YJWI 1UHMA 4OAZA 2I5UA 5EZHA 5K5QA 3O8HA 2A6EF 1V54H 1HDPA 4A0XA 3F3XA 4DYCA 1TT0A 1YI2I 2IS2A 4KIFA 2EIKH 4GYGA 4ZZDA 1SD4A 4S04A 1NG6A 2R5ZA 4MEXF 3CJNA 4JX4A 2QCOA 2VQHA 1ZGJA 5FB2A 1J09A 2TCTA 3S2HJ 1UFMA 2DA4A 1TZLA 3W6VA 3CCQI 2OF7A 3VSKA 2DXIA 1ETYA 3DEWA 1YYVA 5E8GA 2MABA 3L9FA 3OL4A 5F0FA 4Q4ZF 3LSJA 2LY1A 2HTJA 2HDDA 2X1EA 1IRFA 3HOXJ 5GAHJ 5F64A 1XCBA 1LE8A 4HX8A 2CW8A 3GFMA 9ANTA 1Z77A 3LAPA 2WY8Q 2ZNZA 4I6ZA 4C2MJ 1SFXA 2HVRA 4M6VA 3R60A 2F5VA 3FXOA 4XMYA 4Y15A 1R71A 1ZN2A 1BL0A 3RYRA 2O9LA 3GVAA 2XAHA 1IN7A 2E5NA 2G0EA 3RZOJ 4ENNA 1OFCX 2B9SA 4XSZF 2PN6A 3KX2A 4BACA 4ESJA 1SFUA 3ML6A 1RESA 1YOVB 2Q0OA 4EV0A 5LFAA 1ZYRF 1IW7F 4M6YA 3M8FA 2JJ7A 1GVJA 2VASA 2V1UA 2EFPA 1MSFC 1X1DA 4Y3OA 1XSVA 4LK0F 5HS9A 1FBQA 3OIOA 2EV0A 4OINF 3CLQA 3RJPA 1IN8A 2HPIA 5DCFA 2RVCA 2H09A 2Z1DA 3UR3C 4S0HB 4NHJA 3E6BA 2MH9A 2DTZA 4PUSA 2V79A 4AUXA 3CF5F 3F8CA 3RDIA 3BTJA 4II2A 3SXYA 3RQ4A 4AIJA 1MD0A 2P5LC 4Y17A 1QQIA 1ZHFA 4A3GJ 2O3FA 3MKZA 4YFKF 4XK4A 5GTIC 1FWZA 4CGZA 1ZGAA 1EH6A 1QZZA 1ENHA 4RLFA 2Y30A 1OCTC 2F6CA 4KIBA 4Y4RA 3HKZN 2L9NA 5FKLA 3K10A 2QSFX 3EUKL 4Y33A 1MKMA 3QWLA 3BZ6A 5IP9J 2DA2A 2VI6A 1TT5B 2QM3A 4G7OF 4MNUA 4I76A 3OYLA 1JJ8C 2Y0SA 1Y8QB 4LLNA 3TO9A 2HOTA 4BBRJ 3NARA 2O8KA 1T0FA 2G7UA 5HDGA 1OISA 1R9TJ 3S2DJ 1U8BA 4XLAA 6PAXA 1VQ9I 1G3YA 2HQRA 2XRLA 4HQMA 2QVOA 5E1XA 2ME6A 1GV5A 1D8KA 1XGOA 1ETQA 4CXFA 3CJQB 4EJWA 3OYFA 3ECOA 3BWGA 3DPUA 3OYCA 3H3UA 1FTZA 2LREA 3PJRA 5F04A 1B8IA 3CF2A 3GX4X 4OIPF 4ENMA 1TP4A 1FTTA 2PG4A 2RGVA 3TO6A 2ZCWA 4UVAA 1S8NA 4YG2F 2K86A 1D3YA 2X6XA 2I10A 2O6GE 3CCUI 4QSHA 3N4MA 3MWMA 4EATA 3GFIA 2LF7A 2NS0A 1A6IA 4A5MA 3GLXA 5D6FA 3QP6A 5B1AH 3GWZA 4Z2YA 4OIRF 4ZYEA 2M5WA 4M71A 1LDDA 3HRMA 1K7AA 1EH7A 1S7OA 1FP1D 2O61A 3PO3J 2P7CB 3KP5A 2HR3A 5HS8A 3CMYA 5C4XJ 4R79A 4IVNA 3BQZA 3C2BA 4ZDOA 3LFKA 4JBAA 1SC7A 2XDVA 1VQKI 1ONVA 2KT0A 4OWRB 1JUSA 1MNMC 2H94A 3WGIA 1ACIA 4E7JA 1YFHA 4BEHA 3VOEA 2HEOA 4CCKA 4IRHA 3SYTA 4B09A 5J6XA 1D8JA 3V42A 5EGOA 3G73A 2P7VB 5DD4A 2OPTA 2MYSA 2KDOA 3LSRA 5DEQA 4BGDA 1UAAA 2CU7A 1IN6A 5HNHA 4IO9F 3HB9A 2FNAA 2CO5A 1D0YA 2HDWA 4A93J 4BHBA 4RAGA 3V7SA 4BH9A 5EEAA 1NH3A 4P9UA 1MDMA 2A6TA 3KP3A 1AA7A 1U9OA 2HOAA 3IKTA 2VBWA 5M5XJ 2Z2SB 1LEAA 4V19K 3ZQQA 3J81K 1G2HA 2E2IJ 4L0ZB 3ZMUA 1BIAA 3DKXA 4FTHA 3JAMZ 1H0MA 2R92J 3VEPA 3E1SA 5JR3A 1BBYA 1HSJA 1LFBA 2O7OA 5KAFC 3MKWB 1Q1VA 2EZKA 1E0EA 3BG9A 5CYVA 3D5LA 1R1UA 2UXNA 5E3LA 3OYIA 3HUGB 2WAFA 2OA4A 2Y0MA 1OLTA 1KU9A 3BR5A 2DBBA 4LG0A 4GFBA 1TWFJ 2R7WA 3FXJA 1UELB 2W24A 4M9SA 1I1SA 4KIGA 3FK6A 1SFEA 4BJ6C 1WJDA 3GTOJ 2IA2A 1STZA 3ZOBA 3F21A 1FIAA 2FJ1A 5HDKA 3U1KA 4DYRA 2R0QC 4RAZA 2EBIA 2KZGA 1YJ9I 4A69C 2X48A 1KYWA 2KHMA 4HNTA 1POGA 3JRHA 3GZ5A 1K61A 3S15J 1P4AA 4ENKA 3QYFA 2K9NA 4IHVA 2A5YB 5KHDA 1O3RA 3LQQA 4XOPA 1IV6A 2XAFA 5CQEA 2RDPA 4ITVA 4JK1X 1OMIA 3K4BA 1ZG3A 2KJBA 4A12A 3OR1C 3E6DA 2VXDA 3ZN1A 4X1EA 3VSLA 1PP8F 2H8WA 3OY9A 3HRSA 2M0CA 3VYRB 3UKGA 2L9RA 1WKMA 3TEDA 3ERMA 3HOTA 2GM4A 4FETA 3G1LA 2R7VA 2ELJA 3F8FA 1WJBA 3OMYA 3Q0WA 5EJCA 3ZRGA 4D5FA 5LEKA 1GXPA 1T33A 3L2CA 4I2OA 1D1CA 3CDIA 3E5XA 4YELA 4Y52J 1P9QC 1R5ID 1P4WA 1WJFA 1IDYA 1YIOA 3QOPA 1HXDA 2Q2EB 4HF2A 5IOZA 1OKRA 3LL7A 1FSHA 2BVMA 4GRIA 3FIWA 2VONA 1R6RA 3DPTA 3RYPA 2QKLB 4AYBN 5FKMA 2MGQA 3NEUA 5E17F 3JRGA 3AKZA 4CZCA 2R7FA 1J0RA 4DYQA 3BROA 2DA3A 3LA2A 4ZJZA 1J7KA 3WHCA 4IF4A 2HGCA 4XKBA 3AAFA 5D5UB 2QZ8A 3TMOA 3K4CA 3OSFA 3SEQA 4BNCA 3CQZJ 3ONQA 4WK8F 2JA7J 1RUNA 1X3ZB 1OCZH 5L3EA 3D5SC 2LNBA 4C3JJ 2V1XA 3OYMA 1MJAA 3SQNA 1LUJB 2ZXIA 3S3MA 3QOEA 1OR7A 2H27A 2EIJH 1N78A 4QWQA 3AG4H 2DCEA 5IT9Z 2P6TA 5ILUA 3F8NA 1TL8A 2P5VA 2EFQA 3DKYA 1SD7A 1YQAA 4RAFA 1OCRH 2ME0A 1LFPA 5HLIA 1T2KA 2BEOA 2VBZA 2NNNA 2L7MP 3KZIC 4XKVA 2XHKA 4MFEA 4EVIA 5HOOA 3S2WA 3TKYA 4XORA 3T8TA 2LKXA 1SVLA 1WRJA 3GZNB 1HDDC 2JA6J 2K9MA 3RI4A 3SDGA 2P5KA 4PDKA 3KETA 4BQOA 1QPIA 2DI3A 3GXOA 4HNVA 4RBOA 4C2TA 2NRAC 3LMMA 3H9QA 4FISA 2K5CA 2F4IA 2MH2A 4L9NA 2B0LA 2BV6A 3ZMZA 4DZPA 2H1LA 1H8AC 1FP2A 1MBKA 3JRIA 2HYGD 2HI3A 4UV9A 2K02A 4M74A 2IP2A 2ZFUA 3FM3A 4YFXF
chains in the Genus database with same CATH topology
2VOOA 4XLNF 5IT3A 2L01A 3FXRA 1T6SA 2O03A 4HDVA 2QQAA 2STTA 1MGTA 2V1DA 2DFIA 3RTRA 2D2WA 1D5VA 1YG2A 2IA1A 3WTUC 1KA8A 2PFBA 4R8HA 1BC8C 3LWFA 4HAMA 1ON2A 1R7JA 4HBLA 1FYKA 5D8LB 1JHHA 3DPLC 5E20A 3BPVA 1R5GA 2GAUA 3PFIA 2OZ6A 4L5IA 4HDUA 1HKSA 1YTYA 2XV4S 1FLIA 4RGRA 1WI9A 4TV7A 5BPIA 4BAYA 3F23A 3HUGA 2PMHA 1DUXC 1WQ2A 1R1TA 2VOPA 1EH8A 4XSXF 1G3TA 4OMYA 3RIRA 5K5RA 4GYIA 1I5ZA 5AIQA 1XMAA 3K2ZA 3I4PA 2KKOA 2PBIA 2PI0A 1UB9A 1ZH5A 3MZHA 2DPUA 2JPCA 3E6CC 3HTSB 4G6DA 1R22A 1XDSA 5D5VB 2ZMEA 4BQAA 3K69A 1JHFA 1USSA 5FGMA 4ZYDA 4KA4A 3I59B 1P92A 4I98B 4G8XA 3ZN0A 4KMFA 4RGUA 3F22A 1K78B 1HW1A 1KQ0A 1G6NA 2DW4A 3MEXA 3I64A 3D0SA 1ODDA 1LDJA 4Q47A 5J8CA 4LD5A 2CYYA 4P55A 3WGGA 2A68F 5H6QA 4IPAA 2HOEA 2FRHA 4MTEA 1Z05A 3DF8A 2X0LA 3DFGA 4I0AA 4WXCA 2GXBA 2E7XA 2UZKA 4HZFA 3LAJA 5CJ9A 3REOA 1OYIA 4WWCA 4IXAA 5E18F 2V9VA 1TW3A 1B6AA 4EJUA 2OD5A 3E5QA 1PP7U 3F8BA 3BJAA 3VFZA 4PZJA 1B4AA 2E7WA 4MTDA 5K1YA 2CWEA 3EETA 5DCMB 2IVMA 3CUQA 4RB3C 2FEZA 3KFWX 2NAZA 1Z6TA 4BYYA 1J9IA 2DO7A 1XCVA 1ON1A 3HRTA 2XROA 2YPRA 2VT3A 4DQ2A 4M9ZA 4ZH4F 4HW0A 2TDXA 3L7WA 3SZPA 4JQFA 2KIFA 2QENA 3WODF 4BXUA 3HTUA 2EJRA 1F9NA 4FX0A 3WTXC 5E1WA 5CVIA 3LA7A 4CHUA 2EA2A 3RKYA 2EK5A 1XMKA 3WTTC 4EQQA 5E1ZB 2EA4A 2PMUA 1UCRA 2AS5F 4U0VA 1R5HA 3FMQA 1YW9A 1J75A 4EM0B 4HOBA 1ZARA 2E1NA 2ADUA 4N0BA 2RKHA 3IRQA 3SFZA 2EV6A 3CUOA 1F4KA 5FLXZ 3RPQA 1CF7B 3R0JA 5TRDA 5AIPA 3EYIA 4HA8A 4LB6B 5ILVA 1YS7A 2M45A 1AOYA 2D45A 2CQKA 2XAQA 1U6GA 4NB5A 3JW4A 1OPCA 3KP2A 2HS5A 3BDDA 5HDNA 3JSOA 4XBFA 2VODA 2VC1A 1DPRA 1P4XA 2JT1A 1BI1A 4UXNA 1FNNA 4I02A 5ILSA 3COAC 4YFNF 5IT9K 5E8IA 3FM5A 2O0YA 1IXSB 4MHGA 1LVAA 1BI2A 3BY6A 2HDCA 1XSDA 4MQ9F 5LGUA 2EFNA 3EUHA 3V8JA 3I59A 2LDUA 3ISPA 2IJLA 1XGMA 3B73A 2GA1A 2K27A 1QO0D 3LQRA 4WXDA 1U5TC 1YO5C 2NNYA 3ERED 1ZG1A 1KQ9A 3RKXA 1LJ9A 3ELKA 3HYIA 4Q5SF 1ZLJA 4BHPA 2Z99A 2QQ9A 4EM2A 3T0YA 3T8RA 4RGSA 4D0PA 1O57A 5ICCA 2F5DA 3WTVC 4EGYA 3WE3A 4ZYGA 3PQKA 5LEJA 1BC7C 3DXJF 2XUBA 1ULYA 2WV0A 1FX7A 5FO5A 5DUIA 4ASNA 3ECHA 4P9FA 1B9NA 1MZBA 2D1HA 1BOAA 2F5FA 2X4HA 2J5PA 2C6YA 3DV8A 1KU7A 3EDPA 3U9GA 4G7HF 4XLPF 4XRFA 5LGTA 3IL2A 2Y48A 5BOXA 1IN4A 1S29A 5FFZA 4GGGA 4HYEA 2IPQX 3ZMSA 1O7FA 4A2UA 1HW5A 1P2FA 5D4RA 3ZQ7A 4YIFA 1HBXG 4HLXA 1J5YA 3W6KB 3GO5A 4LFUA 2STWA 2DLLA 3IHUA 3TOBA 1DP7P 1I1GA 1A04A 1TQMA 2YR2A 4FT8A 2FQ3A 4AIHA 3MZYA 4LLGF 2EWNA 3RKWA 1TNTA 2YU3A 4KUMA 3ZP5A 1KYZA 1TQIA 2LSOA 1TNSA 4IJAA 3GYHX 2VC0A 1JXSA 4OU0A 4ESBA 1S6LA 3V7CA 3R61A 4WF2A 2EFOA 3C7JA 5LRRA 4EMSA 1TTYA 2QYOA 3Q5FA 4RGXA 5D6EA 2GZWA 2Z9OA 1O3QA 4ESFA 2XKOA 2L3DA 1QGPA 4OIQF 4OOIA 1W7PB 3HIFA 5EEGA 2MBFA 1T39A 1XB4A 1B9MA 4ENJA 3HSEA 3KLOA 5F6FA 4I09A 1XN7A 5L3CA 1XD7A 2CG4A 2GXGA 2RQPA 1V3FA 3K0LA 2O8XA 4HV5A 4YIIA 4HQEA 4I7HA 3IKVA 4RB0A 3MQ0A 4GXOA 1C0WA 2Y75A 4KFCA 2A3SA 4EJOA 1ZAOA 1H9GA 1ZRDA 2H6CA 3C1DA 2XVCA 3ZMTA 3BPXA 1WWXA 3I54A 3NRVA 3KP6A 2W85A 1YW7A 2VXZA 2BYVE 2G9WA 3QPHA 3BJ6A 4EJVA 2MLKA 3VODA 4A0YA 4L18B 1LDKB 1G3SA 2XAGA 2L4MA 1U2WA 5FD6A 4O3MA 5CVRA 2XRNA 4N9IA 2RN7A 1W5SA 2GIVA 4UNOA 4E70A 5JHUA 4N9HA 3F6OA 1RIOH 4CZZA 3J81Z 3L00A 4BHCA 3FF5A 4O5VA 2FU4A 5K5OA 1LNWA 1O7LA 2HWVA 5ICFA 1K79A 4HLYA 2ZJ2A 3KP4A 4ZZLA 2ACJA 4HV6A 5H20A 4UUVA 2OU2A 3E6MA 3P7NA 3ABTA 1O3SA 3HRUA 3M8EA 1FT9A 1BN5A 2CFXA 2VE9A 3VB2A 1KQ8A 5FLXK 2UXXA 5DUKA 2FE3A 1FC3A 2HTSA 4AWXB 2OZUA 1HQCA 2KIUA 4GCVA 1I27A 2COMA 1Z1DA 3GW2A 3P9IA 5J8FA 4L0YB 3EQLF 4KMUX 3LSTA 4LMYA 2IT0A 2FOKA 2MA3A 1NHAA 2JRTA 1RUOA 2Q2EA 5BPDA 2ESHA 3HSRA 2Z3YA 1B1BA 1LEBA 4LK1F 3SZTA 3DEUA 4NQWA 3B02A 1EV7A 1TW2A 2LKPA 4CO8A 1P6RA 3Q9VA 1HKQA 2XGXA 4M6XA 1HSTA 4PGHA 2DK5A 4WXHA 4UHTA 2AXLA 4ETSA 1LQ1A 3KZZA 1VTNC 4S05A 4WCGA 5HS7A 3M7GA 5L3DA 2XASA 5L3GA 2K7LA 4HX4A 2OAZA 4B8XA 5LHHA 5LHGA 1W5TA 2PEXA 1Z9CA 4RB2C 2RNJA 3TGNA 1GXQA 1BIBA 2JZYA 2M1BA 2R7DA 3WGHA 4P5OA 5CLSA 1J59A 4I0BA 1IF1A 4UV8A 2UWMA 3QP5A 1U5TB 1SMTA 3JAMK 1R36A 1OYYA 1S3JA 2P6SA 2RV8A 5ED4A 2F5EA 3KLNA 2D1VA 2LF8A 2ZBKA 2IA0A 3FXUA 1H9TA 3TDUC 3TQNA 4LG0B 2RC4A 4U7BA 5HLGA 1BI0A 3F72A 3NQOA 3RPUA 3W6JB 3E97A 2R3SA 2OQRA 2CW0F 3O6BB 1OYWA 3IC7A 3KEQA 4A0ZA 1L3LA 3J80Z 3JTHA 3GUDA 1TLHB 1FOKA 3QPTA 5D5WB 3HOSA 2HQNA 1XDUA 2M8EA 2GQQA 2FF4A 1Q1HA 2ZFWA 1Z6RA 3FXQA 1KU2A 3U1DA 2H6BA 1QNTA 3KE2A 5KVRA 4A6EA 3KCCA 3FWEA 3IRRA 1FBUA 3IWFA 4CYDA 3C3WA 1IUYA 2FXAA 2VT2A 3GZ6A 5KK1A 1SMYF 3E3VA 3KZYA 2PJPA 2QBYB 3I0TA 5BQTA 4OIOF 1J2XA 2FNPA 1JGSA 3I53A 3H92A 1HW2A 3WTZA 3QRFF 3KEOA 4LB5A 1F1ZA 3ZPLA 3I58A 4IRIA 4Q48A 5JFRA 2HYFA 5A2QZ 1E2XA 3FZVA 4CDGA 3DP7A 5DDGA 1PDNC 2L54A 5FD5A 4L5JA 3HHHA 2NYXA 1ZG5A 4RAYA 3K9TA 3GEZA 3OV8A 2JTVA 4G9YA 2WTEA 4U0WA 1K78A 2YX7A 2W84A 3QAHA 1AWCA 2WC2A 1Y0UA 1R58A 3OOPA 4L9VA 2ISYA 3WE2A 1DDNA 4UVCA 5HVQC 2JSCA 3R6SA 4ON0A 3CTAA 5ICEA 5L3FA 3R0AA 1XSXA 4RS8A 1XGNA 2ESNA 4PCQA 3C18A 3FMSA 1R00A 2Z5UA 5D5XB 1V4RA 5L3BA 4EJTA 5CVJA 1B59A 5ERIA 3WTYC 1FBSA 2A69F 3V4GA 2FBHA 3WTSC 5AONA 1F5TA 1T38A 2FBIA 1U8RA 3TOAA 5DCMA 1U5TA 2VBXA 1RI7A 3F6VA 4EGZA 3P9CA 4ZYHA 1R1VA 1FY7A 3GFLA 1WSUA 1Z7UA 1FSEA 2ISZA 5HLHA 1HKTA 4HX7A 3LA3A 3QU6A 2Q8KA 3V8LA 1G4DA 3BJOA 2DQLA 1RZ4A 2HFHA 5F1RA 1JE8A 4KT5C 2P8TA 4G6QA 2HKOA 3T5XA 2FSWA 1GHCA 5CVUA 2ZKZA 2M87A 2XAJA 1IAWA 1L0OC 2G7HA 4O6JA 2V6CA 3JTGA 3CO6C 4Y13A 3MCZA 4AIKA 2Z33A 2QUFA 5EEHA 3KP7A 1ZRCA 3CLOA 2BE5F 1QPMA 2ZMEB 4HF1A 1BJAA 2MC3A 3I71A 3N97A 4PGGA 4LGWA 1XGSA 3WG9A 1RNLA 4KN7X 3O3KA 3ROUA 2CGPA 1CF7A 3PQJA 1G3WA 1REPC 4IRGA 1IZ1A 1YLFA 4HF0A 1QBJA 3WU0A 4FHTA 1K6OA 3GFJA 5LHIA 3V7RA 2XKPA 4U88A 3E5UA 2HKXA 4L9TA 4FX4A 2VN2A 2QBYA 1TBXA 2XIGA 5DYMA 3H3ZA 2OQGA 1O3TA 1LB2A 2K4BA 3K1NA 4F7ZA 3TO7A 4WX9A 2ZNYA 4AD9A 1FYMA 5H6RA 1X3UA 3P9KA 2VBYA 4CICA 3U2RA 3ULQB 2KJCA 5CVVA 2GWRA 3DKWA 3EYYA 3ZMVA 5D4SA 2J5OA 3JSPA 2A61A 1IXCA 3CUQB 4M9XA 2DU9A 5D8KB 1FPQA 2DQRA 1IXRC 3ZMDA 2L4AA 3T1BA 2KRFA 1SAXA 2FBKA 2K4JA 4QLCU 5LRSA 3BOQA 4EM1A 5DD8A 1W7PD 4MEYF 3MFKA 3ABUA 1I6XA 4U0YA 2BBYA 4U7DA 3HHGA 3J80K 3WU1B 1BI3A 2DAOA 1CGPA 5FFXA 1MJBA 4L9JA 1R23A 3Q9SA 1T98A 1BM9A 3M1EA 4OMZA 3J7AO 4A5NA 3QU3A 3CO7C 5DV5A 2YX4A 2DPDA 1UHWA 1KU3A 1ZRFA 2MLGA 1IRGA 4KDPA 1PUEE 4KN4X 3G3ZA 1Z91A 5BMZA 3L09A 4M73A 5ICGA 4G7ZF 2MD5A 2QWWA 2DTRA 4MQVA 3BP8A 2PQ8A 3DQVC 2JPBA 4IHSA 2HZTA 4DNCA 1FZPB 3K1MA 3V8KA 4GO1A 1FYLA 2FMLA 3IWZA 2A07F 1IN5A 2PLYA 2L02A 3R4KA 4MGRA 2QQBA 4G94A 2VE8A 5LGNA 1SD5A 5TJJA 4I01A 1U78A 1TQPA 1W4MA 3FMRA 1E17A 2DT5A 5A2QK 4AVPA 2DK8A 2W57A 2FA5A 2F5CA 3I5UA 3M9AA 4R1HA 4P96A 2ZXJA 1W7PA 2IRFG 4RB1A 3SHFA 2QLZA 4LJZF 3FX3A 1YS6A 2YSRA 2M30A 2GA2A 1U3EM 5LBQA 2ZO4A 3CUQC 1ZLKA 2EFWA 3TDZC 5JI6A 1DPUA 2CSOA 2F2EA 1S7AA 5LLQA 2ETHA 4M72A 2P4WA 1QZYA 1SD6A 3O2PE 2EB7A 4KICA 2ELHA 4KYWA 3GF2A 4KNYA 2BGCA 2E1CA 2W25A 4IHTA 3WTWC 1MDMB 5JVTA 4LLLA 1ZREA 4UVBA 3CDHA 3HSFA 3K1PA 2A6HF 1KGSA 2EV5A 4H0EA 1YW8A 4A6DA 1MJ9A 3MAJA 5BS6A 1USTA 2WWYA 3F8MA 2FMYA 2OBPA 3FHZA 2KIMA 2IW5A 1UHMA 5K5QA 2A6EF 4A0XA 3F3XA 4KIFA 4GYGA 4ZZDA 1SD4A 4S04A 4MEXF 3CJNA 1ZGJA 5FB2A 1UFMA 1YYVA 5E8GA 3L9FA 4Q4ZF 2HTJA 1IRFA 5F64A 1XCBA 4HX8A 3GFMA 3LAPA 2ZNZA 1SFXA 3R60A 4Y15A 1ZN2A 3RYRA 3GVAA 2XAHA 1IN7A 4ENNA 4XSZF 2PN6A 4ESJA 1SFUA 3ML6A 2Q0OA 4EV0A 1ZYRF 1IW7F 4M6YA 3M8FA 1GVJA 2V1UA 2EFPA 1XSVA 4LK0F 5HS9A 1FBQA 2EV0A 4OINF 3RJPA 1IN8A 5DCFA 2RVCA 2H09A 4NHJA 3E6BA 2MH9A 2V79A 3F8CA 3RDIA 3SXYA 4AIJA 1MD0A 2P5LC 4Y17A 1QQIA 1ZHFA 2O3FA 4YFKF 4CGZA 1FWZA 1ZGAA 1EH6A 1QZZA 4KIBA 1MKMA 3BZ6A 2QM3A 4G7OF 4MNUA 4LLNA 3TO9A 1T0FA 2G7UA 5HDGA 6PAXA 1G3YA 2HQRA 4HQMA 5E1XA 2QVOA 1D8KA 1XGOA 4CXFA 4EJWA 3ECOA 3BWGA 3H3UA 3GX4X 4OIPF 4ENMA 2PG4A 2RGVA 3TO6A 4YG2F 2ZCWA 4UVAA 1S8NA 2K86A 1D3YA 2O6GE 3N4MA 3MWMA 3GFIA 2LF7A 2NS0A 4A5MA 3GLXA 5D6FA 3QP6A 3GWZA 4Z2YA 4OIRF 4ZYEA 2M5WA 4M71A 1LDDA 3HRMA 1K7AA 1EH7A 1S7OA 1FP1D 2O61A 2P7CB 3KP5A 2HR3A 5HS8A 4R79A 4IVNA 3LFKA 4JBAA 1ONVA 2H94A 3WGIA 1YFHA 2HEOA 3VOEA 4IRHA 5J6XA 4B09A 1D8JA 3G73A 2P7VB 5DD4A 5DEQA 1IN6A 2FNAA 2CO5A 4BHBA 3V7SA 4BH9A 4P9UA 1MDMA 3KP3A 3IKTA 2VBWA 1LEAA 3J81K 4L0ZB 3ZMUA 1BIAA 3JAMZ 1H0MA 3VEPA 5JR3A 1BBYA 1HSJA 5CYVA 3D5LA 1R1UA 2UXNA 2OA4A 2Y0MA 1KU9A 2DBBA 4LG0A 2W24A 4M9SA 1I1SA 4KIGA 1SFEA 2IA2A 1STZA 3F21A 5HDKA 4RAZA 1KYWA 3GZ5A 1P4AA 4ENKA 2A5YB 1O3RA 3LQQA 2XAFA 2RDPA 4JK1X 1OMIA 1ZG3A 2KJBA 4A12A 3E6DA 3ZN1A 1PP8F 3HRSA 1WKMA 3HOTA 3F8FA 1GXPA 5LEKA 4I2OA 3L2CA 3E5XA 1P4WA 1YIOA 3QOPA 4HF2A 1HXDA 1OKRA 1FSHA 2VONA 3DPTA 3RYPA 3NEUA 5E17F 2R7FA 1J0RA 3BROA 3LA2A 1J7KA 4IF4A 2HGCA 3AAFA 5D5UB 2QZ8A 4BNCA 4WK8F 1RUNA 5L3EA 2LNBA 2V1XA 1MJAA 3SQNA 1OR7A 2H27A 4QWQA 5IT9Z 2P6TA 5ILUA 3F8NA 2P5VA 2EFQA 1SD7A 1YQAA 5HLIA 1T2KA 2BEOA 2VBZA 2NNNA 2XHKA 4EVIA 5HOOA 3S2WA 3TKYA 3T8TA 1WRJA 3RI4A 2P5KA 4PDKA 3KETA 2DI3A 3GXOA 2NRAC 2MH2A 4L9NA 2B0LA 2BV6A 3ZMZA 1FP2A 2HYGD 4UV9A 2K02A 4M74A 2IP2A 3FM3A 4K2EA 4YFXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VOO A;  4XLN F;  5IT3 A;  2L01 A;  3FXR A;  1T6S A;  2O03 A;  4HDV A;  2QQA A;  2STT A;  1MGT A;  2V1D A;  2DFI A;  3RTR A;  2D2W A;  1D5V A;  1YG2 A;  2IA1 A;  3WTU C;  1KA8 A;  2PFB A;  4R8H A;  1BC8 C;  3LWF A;  4HAM A;  1ON2 A;  1R7J A;  4HBL A;  1FYK A;  5D8L B;  1JHH A;  3DPL C;  5E20 A;  3BPV A;  1R5G A;  2GAU A;  3PFI A;  2OZ6 A;  4L5I A;  4HDU A;  1HKS A;  1YTY A;  2XV4 S;  1FLI A;  4RGR A;  1WI9 A;  4TV7 A;  5BPI A;  4BAY A;  3F23 A;  3HUG A;  2PMH A;  1DUX C;  1WQ2 A;  1R1T A;  2VOP A;  1EH8 A;  4XSX F;  1G3T A;  4OMY A;  3RIR A;  5K5R A;  4GYI A;  1I5Z A;  5AIQ A;  1XMA A;  3K2Z A;  3I4P A;  2KKO A;  2PBI A;  2PI0 A;  1UB9 A;  1ZH5 A;  3MZH A;  2DPU A;  2JPC A;  3E6C C;  3HTS B;  4G6D A;  1R22 A;  1XDS A;  5D5V B;  2ZME A;  4BQA A;  3K69 A;  1JHF A;  1USS A;  5FGM A;  4ZYD A;  4KA4 A;  3I59 B;  1P92 A;  4I98 B;  4G8X A;  3ZN0 A;  4KMF A;  4RGU A;  3F22 A;  1K78 B;  1HW1 A;  1KQ0 A;  1G6N A;  2DW4 A;  3MEX A;  3I64 A;  3D0S A;  1ODD A;  1LDJ A;  4Q47 A;  5J8C A;  4LD5 A;  2CYY A;  4P55 A;  3WGG A;  2A68 F;  5H6Q A;  4IPA A;  2HOE A;  2FRH A;  4MTE A;  1Z05 A;  3DF8 A;  2X0L A;  3DFG A;  4I0A A;  4WXC A;  2GXB A;  2E7X A;  2UZK A;  4HZF A;  3LAJ A;  5CJ9 A;  3REO A;  1OYI A;  4WWC A;  4IXA A;  5E18 F;  2V9V A;  1TW3 A;  1B6A A;  4EJU A;  2OD5 A;  3E5Q A;  1PP7 U;  3F8B A;  3BJA A;  3VFZ A;  4PZJ A;  1B4A A;  2E7W A;  4MTD A;  5K1Y A;  2CWE A;  3EET A;  5DCM B;  2IVM A;  3CUQ A;  4RB3 C;  2FEZ A;  3KFW X;  2NAZ A;  1Z6T A;  4BYY A;  1J9I A;  2DO7 A;  1XCV A;  1ON1 A;  3HRT A;  2XRO A;  2YPR A;  2VT3 A;  4DQ2 A;  4M9Z A;  4ZH4 F;  4HW0 A;  2TDX A;  3L7W A;  3SZP A;  4JQF A;  2KIF A;  2QEN A;  3WOD F;  4BXU A;  3HTU A;  2EJR A;  1F9N A;  4FX0 A;  3WTX C;  5E1W A;  5CVI A;  3LA7 A;  4CHU A;  2EA2 A;  3RKY A;  2EK5 A;  1XMK A;  3WTT C;  4EQQ A;  5E1Z B;  2EA4 A;  2PMU A;  1UCR A;  2AS5 F;  4U0V A;  1R5H A;  3FMQ A;  1YW9 A;  1J75 A;  4EM0 B;  4HOB A;  1ZAR A;  2E1N A;  2ADU A;  4N0B A;  2RKH A;  3IRQ A;  3SFZ A;  2EV6 A;  3CUO A;  1F4K A;  5FLX Z;  3RPQ A;  1CF7 B;  3R0J A;  5TRD A;  5AIP A;  3EYI A;  4HA8 A;  4LB6 B;  5ILV A;  1YS7 A;  2M45 A;  1AOY A;  2D45 A;  2CQK A;  2XAQ A;  1U6G A;  4NB5 A;  3JW4 A;  1OPC A;  3KP2 A;  2HS5 A;  3BDD A;  5HDN A;  3JSO A;  4XBF A;  2VOD A;  2VC1 A;  1DPR A;  1P4X A;  2JT1 A;  1BI1 A;  4UXN A;  1FNN A;  4I02 A;  5ILS A;  3COA C;  4YFN F;  5IT9 K;  5E8I A;  3FM5 A;  2O0Y A;  1IXS B;  4MHG A;  1LVA A;  1BI2 A;  3BY6 A;  2HDC A;  1XSD A;  4MQ9 F;  5LGU A;  2EFN A;  3EUH A;  3V8J A;  3I59 A;  2LDU A;  3ISP A;  2IJL A;  1XGM A;  3B73 A;  2GA1 A;  2K27 A;  1QO0 D;  3LQR A;  4WXD A;  1U5T C;  1YO5 C;  2NNY A;  3ERE D;  1ZG1 A;  1KQ9 A;  3RKX A;  1LJ9 A;  3ELK A;  3HYI A;  4Q5S F;  1ZLJ A;  4BHP A;  2Z99 A;  2QQ9 A;  4EM2 A;  3T0Y A;  3T8R A;  4RGS A;  4D0P A;  1O57 A;  5ICC A;  2F5D A;  3WTV C;  4EGY A;  3WE3 A;  4ZYG A;  3PQK A;  5LEJ A;  1BC7 C;  3DXJ F;  2XUB A;  1ULY A;  2WV0 A;  1FX7 A;  5FO5 A;  5DUI A;  4ASN A;  3ECH A;  4P9F A;  1B9N A;  1MZB A;  2D1H A;  1BOA A;  2F5F A;  2X4H A;  2J5P A;  2C6Y A;  3DV8 A;  1KU7 A;  3EDP A;  3U9G A;  4G7H F;  4XLP F;  4XRF A;  5LGT A;  3IL2 A;  2Y48 A;  5BOX A;  1IN4 A;  1S29 A;  5FFZ A;  4GGG A;  4HYE A;  2IPQ X;  3ZMS A;  1O7F A;  4A2U A;  1HW5 A;  1P2F A;  5D4R A;  3ZQ7 A;  4YIF A;  1HBX G;  4HLX A;  1J5Y A;  3W6K B;  3GO5 A;  4LFU A;  2STW A;  2DLL A;  3IHU A;  3TOB A;  1DP7 P;  1I1G A;  1A04 A;  1TQM A;  2YR2 A;  4FT8 A;  2FQ3 A;  4AIH A;  3MZY A;  4LLG F;  2EWN A;  3RKW A;  1TNT A;  2YU3 A;  4KUM A;  3ZP5 A;  1KYZ A;  1TQI A;  2LSO A;  1TNS A;  4IJA A;  3GYH X;  2VC0 A;  1JXS A;  4OU0 A;  4ESB A;  1S6L A;  3V7C A;  3R61 A;  4WF2 A;  2EFO A;  3C7J A;  5LRR A;  4EMS A;  1TTY A;  2QYO A;  3Q5F A;  4RGX A;  5D6E A;  2GZW A;  2Z9O A;  1O3Q A;  4ESF A;  2XKO A;  2L3D A;  1QGP A;  4OIQ F;  4OOI A;  1W7P B;  3HIF A;  5EEG A;  2MBF A;  1T39 A;  1XB4 A;  1B9M A;  4ENJ A;  3HSE A;  3KLO A;  5F6F A;  4I09 A;  1XN7 A;  5L3C A;  1XD7 A;  2CG4 A;  2GXG A;  2RQP A;  1V3F A;  3K0L A;  2O8X A;  4HV5 A;  4YII A;  4HQE A;  4I7H A;  3IKV A;  4RB0 A;  3MQ0 A;  4GXO A;  1C0W A;  2Y75 A;  4KFC A;  2A3S A;  4EJO A;  1ZAO A;  1H9G A;  1ZRD A;  2H6C A;  3C1D A;  2XVC A;  3ZMT A;  3BPX A;  1WWX A;  3I54 A;  3NRV A;  3KP6 A;  2W85 A;  1YW7 A;  2VXZ A;  2BYV E;  2G9W A;  3QPH A;  3BJ6 A;  4EJV A;  2MLK A;  3VOD A;  4A0Y A;  4L18 B;  1LDK B;  1G3S A;  2XAG A;  2L4M A;  1U2W A;  5FD6 A;  4O3M A;  5CVR A;  2XRN A;  4N9I A;  2RN7 A;  1W5S A;  2GIV A;  4UNO A;  4E70 A;  5JHU A;  4N9H A;  3F6O A;  1RIO H;  4CZZ A;  3J81 Z;  3L00 A;  4BHC A;  3FF5 A;  4O5V A;  2FU4 A;  5K5O A;  1LNW A;  1O7L A;  2HWV A;  5ICF A;  1K79 A;  4HLY A;  2ZJ2 A;  3KP4 A;  4ZZL A;  2ACJ A;  4HV6 A;  5H20 A;  4UUV A;  2OU2 A;  3E6M A;  3P7N A;  3ABT A;  1O3S A;  3HRU A;  3M8E A;  1FT9 A;  1BN5 A;  2CFX A;  2VE9 A;  3VB2 A;  1KQ8 A;  5FLX K;  2UXX A;  5DUK A;  2FE3 A;  1FC3 A;  2HTS A;  4AWX B;  2OZU A;  1HQC A;  2KIU A;  4GCV A;  1I27 A;  2COM A;  1Z1D A;  3GW2 A;  3P9I A;  5J8F A;  4L0Y B;  3EQL F;  4KMU X;  3LST A;  4LMY A;  2IT0 A;  2FOK A;  2MA3 A;  1NHA A;  2JRT A;  1RUO A;  2Q2E A;  5BPD A;  2ESH A;  3HSR A;  2Z3Y A;  1B1B A;  1LEB A;  4LK1 F;  3SZT A;  3DEU A;  4NQW A;  3B02 A;  1EV7 A;  1TW2 A;  2LKP A;  4CO8 A;  1P6R A;  3Q9V A;  1HKQ A;  2XGX A;  4M6X A;  1HST A;  4PGH A;  2DK5 A;  4WXH A;  4UHT A;  2AXL A;  4ETS A;  1LQ1 A;  3KZZ A;  1VTN C;  4S05 A;  4WCG A;  5HS7 A;  3M7G A;  5L3D A;  2XAS A;  5L3G A;  2K7L A;  4HX4 A;  2OAZ A;  4B8X A;  5LHH A;  5LHG A;  1W5T A;  2PEX A;  1Z9C A;  4RB2 C;  2RNJ A;  3TGN A;  1GXQ A;  1BIB A;  2JZY A;  2M1B A;  2R7D A;  3WGH A;  4P5O A;  5CLS A;  1J59 A;  4I0B A;  1IF1 A;  4UV8 A;  2UWM A;  3QP5 A;  1U5T B;  1SMT A;  3JAM K;  1R36 A;  1OYY A;  1S3J A;  2P6S A;  2RV8 A;  5ED4 A;  2F5E A;  3KLN A;  2D1V A;  2LF8 A;  2ZBK A;  2IA0 A;  3FXU A;  1H9T A;  3TDU C;  3TQN A;  4LG0 B;  2RC4 A;  4U7B A;  5HLG A;  1BI0 A;  3F72 A;  3NQO A;  3RPU A;  3W6J B;  3E97 A;  2R3S A;  2OQR A;  2CW0 F;  3O6B B;  1OYW A;  3IC7 A;  3KEQ A;  4A0Z A;  1L3L A;  3J80 Z;  3JTH A;  3GUD A;  1TLH B;  1FOK A;  3QPT A;  5D5W B;  3HOS A;  2HQN A;  1XDU A;  2M8E A;  2GQQ A;  2FF4 A;  1Q1H A;  2ZFW A;  1Z6R A;  3FXQ A;  1KU2 A;  3U1D A;  2H6B A;  1QNT A;  3KE2 A;  5KVR A;  4A6E A;  3KCC A;  3FWE A;  3IRR A;  1FBU A;  3IWF A;  4CYD A;  3C3W A;  1IUY A;  2FXA A;  2VT2 A;  3GZ6 A;  5KK1 A;  1SMY F;  3E3V A;  3KZY A;  2PJP A;  2QBY B;  3I0T A;  5BQT A;  4OIO F;  1J2X A;  2FNP A;  1JGS A;  3I53 A;  3H92 A;  1HW2 A;  3WTZ A;  3QRF F;  3KEO A;  4LB5 A;  1F1Z A;  3ZPL A;  3I58 A;  4IRI A;  4Q48 A;  5JFR A;  2HYF A;  5A2Q Z;  1E2X A;  3FZV A;  4CDG A;  3DP7 A;  5DDG A;  1PDN C;  2L54 A;  5FD5 A;  4L5J A;  3HHH A;  2NYX A;  1ZG5 A;  4RAY A;  3K9T A;  3GEZ A;  3OV8 A;  2JTV A;  4G9Y A;  2WTE A;  4U0W A;  1K78 A;  2YX7 A;  2W84 A;  3QAH A;  1AWC A;  2WC2 A;  1Y0U A;  1R58 A;  3OOP A;  4L9V A;  2ISY A;  3WE2 A;  1DDN A;  4UVC A;  5HVQ C;  2JSC A;  3R6S A;  4ON0 A;  3CTA A;  5ICE A;  5L3F A;  3R0A A;  1XSX A;  4RS8 A;  1XGN A;  2ESN A;  4PCQ A;  3C18 A;  3FMS A;  1R00 A;  2Z5U A;  5D5X B;  1V4R A;  5L3B A;  4EJT A;  5CVJ A;  1B59 A;  5ERI A;  3WTY C;  1FBS A;  2A69 F;  3V4G A;  2FBH A;  3WTS C;  5AON A;  1F5T A;  1T38 A;  2FBI A;  1U8R A;  3TOA A;  5DCM A;  1U5T A;  2VBX A;  1RI7 A;  3F6V A;  4EGZ A;  3P9C A;  4ZYH A;  1R1V A;  1FY7 A;  3GFL A;  1WSU A;  1Z7U A;  1FSE A;  2ISZ A;  5HLH A;  1HKT A;  4HX7 A;  3LA3 A;  3QU6 A;  2Q8K A;  3V8L A;  1G4D A;  3BJO A;  2DQL A;  1RZ4 A;  2HFH A;  5F1R A;  1JE8 A;  4KT5 C;  2P8T A;  4G6Q A;  2HKO A;  3T5X A;  2FSW A;  1GHC A;  5CVU A;  2ZKZ A;  2M87 A;  2XAJ A;  1IAW A;  1L0O C;  2G7H A;  4O6J A;  2V6C A;  3JTG A;  3CO6 C;  4Y13 A;  3MCZ A;  4AIK A;  2Z33 A;  2QUF A;  5EEH A;  3KP7 A;  1ZRC A;  3CLO A;  2BE5 F;  1QPM A;  2ZME B;  4HF1 A;  1BJA A;  2MC3 A;  3I71 A;  3N97 A;  4PGG A;  4LGW A;  1XGS A;  3WG9 A;  1RNL A;  4KN7 X;  3O3K A;  3ROU A;  2CGP A;  1CF7 A;  3PQJ A;  1G3W A;  1REP C;  4IRG A;  1IZ1 A;  1YLF A;  4HF0 A;  1QBJ A;  3WU0 A;  4FHT A;  1K6O A;  3GFJ A;  5LHI A;  3V7R A;  2XKP A;  4U88 A;  3E5U A;  2HKX A;  4L9T A;  4FX4 A;  2VN2 A;  2QBY A;  1TBX A;  2XIG A;  5DYM A;  3H3Z A;  2OQG A;  1O3T A;  1LB2 A;  2K4B A;  3K1N A;  4F7Z A;  3TO7 A;  4WX9 A;  2ZNY A;  4AD9 A;  1FYM A;  5H6R A;  1X3U A;  3P9K A;  2VBY A;  4CIC A;  3U2R A;  3ULQ B;  2KJC A;  5CVV A;  2GWR A;  3DKW A;  3EYY A;  3ZMV A;  5D4S A;  2J5O A;  3JSP A;  2A61 A;  1IXC A;  3CUQ B;  4M9X A;  2DU9 A;  5D8K B;  1FPQ A;  2DQR A;  1IXR C;  3ZMD A;  2L4A A;  3T1B A;  2KRF A;  1SAX A;  2FBK A;  2K4J A;  4QLC U;  5LRS A;  3BOQ A;  4EM1 A;  5DD8 A;  1W7P D;  4MEY F;  3MFK A;  3ABU A;  1I6X A;  4U0Y A;  2BBY A;  4U7D A;  3HHG A;  3J80 K;  3WU1 B;  1BI3 A;  2DAO A;  1CGP A;  5FFX A;  1MJB A;  4L9J A;  1R23 A;  3Q9S A;  1T98 A;  1BM9 A;  3M1E A;  4OMZ A;  3J7A O;  4A5N A;  3QU3 A;  3CO7 C;  5DV5 A;  2YX4 A;  2DPD A;  1UHW A;  1KU3 A;  1ZRF A;  2MLG A;  1IRG A;  4KDP A;  1PUE E;  4KN4 X;  3G3Z A;  1Z91 A;  5BMZ A;  3L09 A;  4M73 A;  5ICG A;  4G7Z F;  2MD5 A;  2QWW A;  2DTR A;  4MQV A;  3BP8 A;  2PQ8 A;  3DQV C;  2JPB A;  4IHS A;  2HZT A;  4DNC A;  1FZP B;  3K1M A;  3V8K A;  4GO1 A;  1FYL A;  2FML A;  3IWZ A;  2A07 F;  1IN5 A;  2PLY A;  2L02 A;  3R4K A;  4MGR A;  2QQB A;  4G94 A;  2VE8 A;  5LGN A;  1SD5 A;  5TJJ A;  4I01 A;  1U78 A;  1TQP A;  1W4M A;  3FMR A;  1E17 A;  2DT5 A;  5A2Q K;  4AVP A;  2DK8 A;  2W57 A;  2FA5 A;  2F5C A;  3I5U A;  3M9A A;  4R1H A;  4P96 A;  2ZXJ A;  1W7P A;  2IRF G;  4RB1 A;  3SHF A;  2QLZ A;  4LJZ F;  3FX3 A;  1YS6 A;  2YSR A;  2M30 A;  2GA2 A;  1U3E M;  5LBQ A;  2ZO4 A;  3CUQ C;  1ZLK A;  2EFW A;  3TDZ C;  5JI6 A;  1DPU A;  2CSO A;  2F2E A;  1S7A A;  5LLQ A;  2ETH A;  4M72 A;  2P4W A;  1QZY A;  1SD6 A;  3O2P E;  2EB7 A;  4KIC A;  2ELH A;  4KYW A;  3GF2 A;  4KNY A;  2BGC A;  2E1C A;  2W25 A;  4IHT A;  3WTW C;  1MDM B;  5JVT A;  4LLL A;  1ZRE A;  4UVB A;  3CDH A;  3HSF A;  3K1P A;  2A6H F;  1KGS A;  2EV5 A;  4H0E A;  1YW8 A;  4A6D A;  1MJ9 A;  3MAJ A;  5BS6 A;  1UST A;  2WWY A;  3F8M A;  2FMY A;  2OBP A;  3FHZ A;  2KIM A;  2IW5 A;  1UHM A;  5K5Q A;  2A6E F;  4A0X A;  3F3X A;  4KIF A;  4GYG A;  4ZZD A;  1SD4 A;  4S04 A;  4MEX F;  3CJN A;  1ZGJ A;  5FB2 A;  1UFM A;  1YYV A;  5E8G A;  3L9F A;  4Q4Z F;  2HTJ A;  1IRF A;  5F64 A;  1XCB A;  4HX8 A;  3GFM A;  3LAP A;  2ZNZ A;  1SFX A;  3R60 A;  4Y15 A;  1ZN2 A;  3RYR A;  3GVA A;  2XAH A;  1IN7 A;  4ENN A;  4XSZ F;  2PN6 A;  4ESJ A;  1SFU A;  3ML6 A;  2Q0O A;  4EV0 A;  1ZYR F;  1IW7 F;  4M6Y A;  3M8F A;  1GVJ A;  2V1U A;  2EFP A;  1XSV A;  4LK0 F;  5HS9 A;  1FBQ A;  2EV0 A;  4OIN F;  3RJP A;  1IN8 A;  5DCF A;  2RVC A;  2H09 A;  4NHJ A;  3E6B A;  2MH9 A;  2V79 A;  3F8C A;  3RDI A;  3SXY A;  4AIJ A;  1MD0 A;  2P5L C;  4Y17 A;  1QQI A;  1ZHF A;  2O3F A;  4YFK F;  4CGZ A;  1FWZ A;  1ZGA A;  1EH6 A;  1QZZ A;  4KIB A;  1MKM A;  3BZ6 A;  2QM3 A;  4G7O F;  4MNU A;  4LLN A;  3TO9 A;  1T0F A;  2G7U A;  5HDG A;  6PAX A;  1G3Y A;  2HQR A;  4HQM A;  5E1X A;  2QVO A;  1D8K A;  1XGO A;  4CXF A;  4EJW A;  3ECO A;  3BWG A;  3H3U A;  3GX4 X;  4OIP F;  4ENM A;  2PG4 A;  2RGV A;  3TO6 A;  4YG2 F;  2ZCW A;  4UVA A;  1S8N A;  2K86 A;  1D3Y A;  2O6G E;  3N4M A;  3MWM A;  3GFI A;  2LF7 A;  2NS0 A;  4A5M A;  3GLX A;  5D6F A;  3QP6 A;  3GWZ A;  4Z2Y A;  4OIR F;  4ZYE A;  2M5W A;  4M71 A;  1LDD A;  3HRM A;  1K7A A;  1EH7 A;  1S7O A;  1FP1 D;  2O61 A;  2P7C B;  3KP5 A;  2HR3 A;  5HS8 A;  4R79 A;  4IVN A;  3LFK A;  4JBA A;  1ONV A;  2H94 A;  3WGI A;  1YFH A;  2HEO A;  3VOE A;  4IRH A;  5J6X A;  4B09 A;  1D8J A;  3G73 A;  2P7V B;  5DD4 A;  5DEQ A;  1IN6 A;  2FNA A;  2CO5 A;  4BHB A;  3V7S A;  4BH9 A;  4P9U A;  1MDM A;  3KP3 A;  3IKT A;  2VBW A;  1LEA A;  3J81 K;  4L0Z B;  3ZMU A;  1BIA A;  3JAM Z;  1H0M A;  3VEP A;  5JR3 A;  1BBY A;  1HSJ A;  5CYV A;  3D5L A;  1R1U A;  2UXN A;  2OA4 A;  2Y0M A;  1KU9 A;  2DBB A;  4LG0 A;  2W24 A;  4M9S A;  1I1S A;  4KIG A;  1SFE A;  2IA2 A;  1STZ A;  3F21 A;  5HDK A;  4RAZ A;  1KYW A;  3GZ5 A;  1P4A A;  4ENK A;  2A5Y B;  1O3R A;  3LQQ A;  2XAF A;  2RDP A;  4JK1 X;  1OMI A;  1ZG3 A;  2KJB A;  4A12 A;  3E6D A;  3ZN1 A;  1PP8 F;  3HRS A;  1WKM A;  3HOT A;  3F8F A;  1GXP A;  5LEK A;  4I2O A;  3L2C A;  3E5X A;  1P4W A;  1YIO A;  3QOP A;  4HF2 A;  1HXD A;  1OKR A;  1FSH A;  2VON A;  3DPT A;  3RYP A;  3NEU A;  5E17 F;  2R7F A;  1J0R A;  3BRO A;  3LA2 A;  1J7K A;  4IF4 A;  2HGC A;  3AAF A;  5D5U B;  2QZ8 A;  4BNC A;  4WK8 F;  1RUN A;  5L3E A;  2LNB A;  2V1X A;  1MJA A;  3SQN A;  1OR7 A;  2H27 A;  4QWQ A;  5IT9 Z;  2P6T A;  5ILU A;  3F8N A;  2P5V A;  2EFQ A;  1SD7 A;  1YQA A;  5HLI A;  1T2K A;  2BEO A;  2VBZ A;  2NNN A;  2XHK A;  4EVI A;  5HOO A;  3S2W A;  3TKY A;  3T8T A;  1WRJ A;  3RI4 A;  2P5K A;  4PDK A;  3KET A;  2DI3 A;  3GXO A;  2NRA C;  2MH2 A;  4L9N A;  2B0L A;  2BV6 A;  3ZMZ A;  1FP2 A;  2HYG D;  4UV9 A;  2K02 A;  4M74 A;  2IP2 A;  3FM3 A;  4K2E A;  4YFX F; 
#chains in the Genus database with same CATH topology
 2XC7 A;  2VOO A;  4XLN F;  5IT3 A;  4V2G A;  2Y69 H;  2L01 A;  2R7O A;  3FXR A;  1Z67 A;  2CMP A;  1X4P A;  2PJR B;  1X4O A;  1T6S A;  3GTK J;  2O03 A;  3BR3 A;  4HDV A;  2QQA A;  1MMS A;  2LTP A;  2OCC H;  2STT A;  1WFX A;  1MGT A;  2V1D A;  5FRO A;  4BJT A;  2DFI A;  3GTQ J;  2RAE A;  3RTR A;  1YX3 A;  2D2W A;  1X2N A;  1YG2 A;  2IA1 A;  3NAU A;  2BVL A;  1D5V A;  3WTU C;  2ECC A;  1KA8 A;  2PFB A;  4R8H A;  3AL0 B;  4FQG A;  2MD0 A;  1BC8 C;  3ABL H;  3IUO A;  3LWF A;  4HAM A;  2DT6 A;  3M3Y J;  1ON2 A;  1R7J A;  4HBL A;  1FYK A;  2VPR A;  5D8L B;  1JHH A;  1FMV A;  3DPL C;  5E20 A;  3BPV A;  1R5G A;  1JUM A;  2GAU A;  3K4K A;  3IV5 A;  1S7E A;  2E19 A;  2W00 A;  4XOT A;  1NK3 P;  3PFI A;  2OZ6 A;  4L5I A;  3IH2 A;  4HDU A;  1HKS A;  3G1O A;  1Y1V J;  1YTY A;  4BL0 B;  2XV4 S;  1K83 J;  1UJ8 A;  1FLI A;  1IV8 A;  4CCO A;  4RGR A;  1WI9 A;  4TV7 A;  4KT6 A;  5BPI A;  1X19 A;  4BAY A;  2ECB A;  3F23 A;  3HUG A;  4XRS G;  4B43 A;  2DYR H;  2PMH A;  1DUX C;  1WZ2 A;  1WQ2 A;  3HGG A;  1R1T A;  1HCR A;  4IKF A;  1NTC A;  1XG1 A;  4DGW B;  3B6C A;  1WJ5 A;  3JRC A;  1XMX A;  3S93 A;  2VOP A;  1EH8 A;  4XSX F;  1G3T A;  5GPA A;  4OMY A;  3RIR A;  5K5R A;  4GYI A;  4QIW N;  1I5Z A;  2Y9Y A;  1VQ5 I;  2LMD A;  2XGE A;  1LFU P;  1W1W E;  4MLO A;  1BA5 A;  5AIQ A;  4BXF A;  1XMA A;  1FMW A;  3K2Z A;  4CSW A;  3I4P A;  2KKO A;  2PBI A;  2W4S A;  4D1Q A;  4E4H A;  2PI0 A;  2YUS A;  1UB9 A;  2VLA A;  4HRI A;  1U0J A;  1ZKG A;  1ZH5 A;  3MZH A;  3BQY A;  2DPU A;  2JPC A;  2GBY A;  3E6C C;  2LRD A;  4DBR A;  4XR6 A;  3ZQH A;  2V26 A;  1VQ7 I;  3HTS B;  2L5Q A;  3A4C A;  3CP8 A;  1QVT A;  4G6D A;  1R22 A;  1XDS A;  5D5V B;  2ZME A;  1Y39 A;  1FEX A;  2EIN H;  4BQA A;  3K69 A;  2XSJ C;  1JHF A;  2IS4 A;  1W36 D;  1USS A;  5FGM A;  2K3P A;  2AQF A;  4RM2 A;  5FKK A;  4FAS D;  4ZYD A;  3G71 I;  5J47 A;  4KA4 A;  1VQ4 I;  4AC0 A;  1VI0 A;  3I59 B;  1P92 A;  3ZCO A;  2V9K A;  4I98 B;  4G8X A;  3ZN0 A;  4KMF A;  4RGU A;  4BJ5 C;  1JKO C;  3F22 A;  1K78 B;  1HW1 A;  1KQ0 A;  2GIZ A;  1VFC A;  1G6N A;  2CJJ A;  2DW4 A;  1MMA A;  4D7N A;  3MEX A;  2OTJ I;  1TWH J;  1FOY A;  2CW7 A;  3I64 A;  3IAM 2;  4B48 A;  3A01 B;  3D0S A;  1ODD A;  1LDJ A;  4Q47 A;  3KYC B;  5J8C A;  2RQQ A;  1EF4 A;  4LD5 A;  2CYY A;  4P55 A;  4YIR X;  3WGG A;  2A68 F;  1T08 B;  2XF6 A;  5H6Q A;  4IPA A;  2HOE A;  4A3F J;  2BY1 A;  2FRH A;  3LSG A;  4MTE A;  1Z05 A;  3DF8 A;  2X0L A;  3DFG A;  3VYS B;  3OYG A;  4I0A A;  1VQM I;  4BE1 A;  3A0B C;  2NXN B;  3SEZ A;  4WXC A;  3PIO F;  2GXB A;  2E7X A;  2UZK A;  2K9L A;  4HZF A;  3LAJ A;  4EEF G;  3AL0 C;  2CQN A;  1D1B A;  4MFD A;  5CJ9 A;  1OYI A;  3A0H C;  3REO A;  4WWC A;  4IXA A;  5TIS C;  5E18 F;  2V9V A;  1TW3 A;  1I6H J;  1B6A A;  4IOC F;  1RET A;  2EH3 A;  2UUZ A;  4EJU A;  1QHH D;  4E7L A;  3RCO A;  2OD5 A;  3E5Q A;  1PP7 U;  3F8B A;  3BJA A;  3VFZ A;  4PZJ A;  1B4A A;  2E7W A;  4MTD A;  4D7M A;  3OS2 A;  3HPG A;  5K1Y A;  1B72 B;  2CWE A;  1RR8 C;  4W1U A;  2HQA A;  3EET A;  5DCM B;  3CCY A;  2IVM A;  4PJJ A;  3SZG A;  3CUQ A;  4RB3 C;  2FEZ A;  3KFW X;  2NAZ A;  2P81 A;  1Z6T A;  4XRM A;  3L2U A;  2X1C A;  2E2H J;  2VIX A;  2OV7 A;  4BYY A;  1J9I A;  2DO7 A;  1XCV A;  1ON1 A;  2FQ4 A;  3JRE A;  2DN0 A;  1ORK A;  3HRT A;  2BHZ A;  1JJ6 C;  2XRO A;  4YRV A;  2M34 A;  2YPR A;  5K7F A;  1MIJ A;  2VT3 A;  1RRJ A;  4DQ2 A;  4M9Z A;  3JRD A;  4ZH4 F;  4HW0 A;  2TDX A;  3WHB A;  3L7W A;  3SZP A;  5IYC J;  2X9D A;  3DBL B;  4JQF A;  2K9S A;  3JRF A;  1TWG J;  1W5C C;  2KIF A;  2QEN A;  3I9V 2;  3WOD F;  2KZV A;  4XLH A;  4BXU A;  2XF7 A;  3I4N J;  3BG6 A;  2R5Y A;  3HTU A;  2EJR A;  1F9N A;  4FX0 A;  2DT7 B;  3WTX C;  2VUM J;  2YU9 J;  5E1W A;  3OWT A;  2BXZ A;  3CC2 I;  5CVI A;  4D5C A;  2M7A A;  1DP3 A;  4XL9 A;  3LA7 A;  4CHU A;  2HU9 A;  2EA2 A;  3RKY A;  4UY8 I;  2EK5 A;  3IAS 2;  1XMK A;  3WTT C;  3RSN A;  4EQQ A;  3VWB A;  3BG7 A;  5E1Z B;  2EA4 A;  2PMU A;  1UCR A;  1AKH A;  2W1O A;  2AS5 F;  4U0V A;  1R5H A;  1OCP A;  3H36 A;  3FMQ A;  1V55 H;  4XN3 A;  1PUF B;  1YW9 A;  1J75 A;  3TW7 A;  3H0D A;  4EM0 B;  4HOB A;  2PX9 A;  2KMU A;  3CCM I;  1ZAR A;  4PK4 A;  2E1N A;  1QU3 A;  2ADU A;  4W97 A;  4N0B A;  2IGK A;  2LY2 A;  5EYR A;  2RKH A;  2CUJ A;  3IRQ A;  1QVU A;  1WJA A;  3SFZ A;  3G4S I;  4B1R A;  4BUP A;  2EV6 A;  3S1R J;  3CUO A;  2WBM A;  3EUH C;  2E35 A;  1F4K A;  5FLX Z;  1ZTR A;  3RPQ A;  3J7A Y;  1CF7 B;  1LVK A;  3QPS A;  3R0J A;  2F48 A;  2AXT C;  5TRD A;  2CUF A;  5AIP A;  4C3H J;  3EYI A;  4HA8 A;  4NC7 A;  2JUG A;  4M3G A;  4PJ0 C;  2XAU A;  2K3F A;  4LB6 B;  4H4K C;  5ILV A;  2DMT A;  3H0G J;  3CME I;  1HA8 A;  3H9J A;  2QGU A;  1YS7 A;  2M45 A;  1AOY A;  1IRX A;  4CYC B;  2D45 A;  4GDF A;  4XKW A;  4NBQ A;  4X6A J;  5FJ8 J;  2CQK A;  2XAQ A;  4OAY A;  3KIO A;  1U6G A;  2LY9 A;  4BQQ A;  3MD2 A;  5J4Y A;  2JN6 A;  1H89 C;  4NB5 A;  3JW4 A;  1E3H A;  2JA2 A;  1OPC A;  5FLV A;  3KP2 A;  3I4M J;  1JI8 A;  2E34 A;  2HS5 A;  2DFF A;  2A05 A;  5DM7 F;  1EKE A;  3W3C A;  3ZGK A;  3BDD A;  5HDN A;  3FKI J;  2E36 A;  3JSO A;  4XBF A;  2VOD A;  2VC1 A;  1DPR A;  1P4X A;  1YIJ I;  2NOJ B;  2W48 A;  2JT1 A;  4XID A;  4I99 C;  1BI1 A;  1KON A;  1IO2 A;  4UXN A;  1FNN A;  4I02 A;  5ILS A;  1QZE A;  1X1P A;  3ZXS A;  3COA C;  2ID3 A;  4YFN F;  5IT9 K;  5E8I A;  3FM5 A;  2O0Y A;  1IXS B;  4A3K J;  3PL8 A;  2IGO A;  4ZC3 A;  5FRN A;  5K7H A;  2CUE A;  4MHG A;  1JGG A;  3RKQ A;  1LVA A;  3BY6 A;  1BI2 A;  3QYB A;  2HDC A;  1XSD A;  4MQ9 F;  1JTY A;  3ZQC A;  5LGU A;  2V7F A;  2EFN A;  2DYS H;  3EUH A;  3V8J A;  3FXM A;  5IYB J;  3I59 A;  2LDU A;  5J1R A;  4UB6 C;  3ISP A;  5H2F C;  3LNQ A;  2IJL A;  1XGM A;  3B73 A;  2GA1 A;  2M4K A;  2K27 A;  1GVD A;  4HSR A;  1QO0 D;  3A2K A;  3LQR A;  3JR9 A;  4WXD A;  1U5T C;  1YO5 C;  3K4L A;  2KP6 A;  3BR1 A;  2E71 A;  2NNY A;  2E2J J;  3J7Y J;  3HC7 A;  2CS3 A;  4B44 A;  3ERE D;  1ZG1 A;  1KQ9 A;  2L2O A;  3RKX A;  1LJ9 A;  3CCL I;  3ELK A;  1ZR4 A;  4XLE A;  3HYI A;  4Q5S F;  1ZLJ A;  3ESW B;  2HNH A;  4BHP A;  2MW8 A;  3KYL A;  2Z99 A;  2QQ9 A;  1JKQ C;  1WH5 A;  2DFE A;  2M9H A;  4EM2 A;  4UUS B;  2FOW A;  2RNG A;  3T0Y A;  3T8R A;  2COB A;  4ZDL A;  4RGS A;  4D0P A;  1O57 A;  3BR2 A;  5ICC A;  1Y56 A;  2F5D A;  4IHW A;  3WTV C;  4EGY A;  3WE3 A;  4ZYG A;  2HVS A;  4BY1 J;  2X6O A;  3PQK A;  5LEJ A;  2WAQ A;  3DXJ F;  2XUB A;  1ULY A;  1BC7 C;  2K85 A;  2WV0 A;  3PO2 J;  1FX7 A;  5FO5 A;  4JYK A;  3E7L A;  2KIS A;  3GBG A;  5DUI A;  3HG9 A;  3HJE A;  4ASN A;  2Y9Z A;  3ECH A;  4P9F A;  5J40 A;  1X58 A;  3OYE A;  2LBF B;  1B9N A;  1DGR M;  1F36 A;  4BKX A;  1MZB A;  2D1H A;  1BOA A;  2BY2 A;  2F5F A;  2X4H A;  4LIV A;  2J5P A;  2C6Y A;  1A5J A;  1B72 A;  4YEJ A;  3DV8 A;  1KU7 A;  3EDP A;  3U9G A;  3DU6 A;  3WG7 H;  2LOO A;  3OYA A;  3I55 I;  1TWA J;  4XLP F;  4G7H F;  4XRF A;  5LGT A;  2LKS A;  2WA0 A;  1MSE C;  2O5R A;  3OS0 A;  5E79 C;  2E1O A;  3IL2 A;  2Y48 A;  2GLO A;  5BOX A;  1IN4 A;  2HXO A;  1S29 A;  2ZXH A;  5FFZ A;  1GLN A;  4GGG A;  3DBH B;  4HYE A;  2IPQ X;  3ZMS A;  1O7F A;  4LG3 A;  1HW5 A;  4A2U A;  3OYD A;  1FOX A;  3GLL A;  3M8J A;  1P2F A;  2JSP A;  5D4R A;  3ZQ7 A;  3GTM J;  4YIF A;  1HBX G;  4HLX A;  1J5Y A;  3W6K B;  2LK2 A;  3GO5 A;  3QYE A;  4LFU A;  1M1E B;  3M07 A;  2STW A;  2DLL A;  4V2F A;  2CV1 A;  1X2M A;  3IHU A;  3TOB A;  1DP7 P;  1I1G A;  3KPH A;  2A5W A;  1A04 A;  1TQM A;  4BE0 A;  2YR2 A;  3TP3 A;  4C9Y A;  4FT8 A;  3C2G A;  2FQ3 A;  5KCM A;  4AIH A;  2E1M B;  3MZY A;  2EWN A;  4LLG F;  3RKW A;  3OYB A;  1TNT A;  1YX5 A;  2VKV A;  2YU3 A;  1VQN I;  4KUM A;  3ZP5 A;  1KYZ A;  1TQI A;  2NOG A;  2LSO A;  3A03 A;  3JRA A;  2WB1 N;  1TNS A;  4IJA A;  3GYH X;  2VC0 A;  1JXS A;  4OU0 A;  3BZK A;  4ESB A;  1S6L A;  1SEU A;  2B7E A;  3V7C A;  1A6Q A;  3R61 A;  4WF2 A;  2EFO A;  1XPX A;  4IL6 C;  3C7J A;  5LRR A;  4EMS A;  2DA7 A;  4AM3 A;  1TTY A;  2QYO A;  2DMU A;  3CCR I;  4A3D J;  3Q5F A;  4RGX A;  5D6E A;  2IGN A;  2NVU B;  4NQW B;  2WAD A;  2AQE A;  2GZW A;  2MC4 A;  1V5E A;  4NUB A;  2Z9O A;  2LG4 A;  4N4N B;  1O3Q A;  4ESF A;  1YRN B;  2XPU A;  5F1J A;  2XKO A;  2L3D A;  1QGP A;  4G12 A;  4OIQ F;  4DW6 A;  4XRS A;  4OOI A;  1W7P B;  1VQ8 I;  3HIF A;  5EEG A;  3S14 J;  2MBF A;  3DLL F;  1T39 A;  1XB4 A;  3FKJ A;  2ZB9 A;  1B9M A;  4CYC A;  4ENJ A;  3HSE A;  5EF6 A;  3KLO A;  4E7H A;  5F6F A;  1I50 J;  4I09 A;  3L2V A;  2H8R A;  4RM3 A;  1XN7 A;  2VKH A;  1JT6 A;  4HNU A;  5L3C A;  5GAD J;  1XD7 A;  2CG4 A;  4J19 A;  2GXG A;  3SDB A;  2RQP A;  4FE7 A;  1V3F A;  1JKP C;  4BDY A;  2JRM A;  3K0L A;  2O8X A;  5JLX A;  4HV5 A;  3OYH A;  3VYT B;  1DU6 A;  3Q0V A;  4AID A;  4J00 A;  4YII A;  1I39 A;  2L7Z A;  3X2Q H;  1TWC J;  1W0U A;  4CCN A;  4HQE A;  3H5A A;  4ZTJ A;  4I7H A;  5B3S H;  2Y31 A;  3IKV A;  1BW5 A;  4RB0 A;  3MQ0 A;  4GXO A;  4LOC A;  2W82 A;  1ZR2 A;  4PJM A;  4F3Q A;  5IP6 A;  2CUZ A;  1C0W A;  3Q0U A;  2Y75 A;  1P7J A;  4KFC A;  2L9V A;  1OCO H;  2A3S A;  3W2W A;  2DOD A;  1ZAO A;  4EJO A;  3ZR8 X;  3HGY A;  3M1C A;  1H9G A;  2DMQ A;  1ETO A;  4F55 A;  3ZQF A;  1IG7 A;  2H6C A;  3C1D A;  1ZRD A;  2XVC A;  3IH4 A;  3ZMT A;  1WVR A;  1WWX A;  3BPX A;  3I3L A;  2V6E A;  3I54 A;  3NRV A;  3KP6 A;  1IUF A;  2AO9 A;  4BDZ A;  2W85 A;  1YW7 A;  5FKO A;  2WAE A;  2VXZ A;  2BYV E;  2G9W A;  2TRT A;  1RR7 A;  3CJT B;  3QPH A;  2VL8 A;  3BJ6 A;  4MIM A;  4EJV A;  2MLK A;  4IHY A;  3BTL A;  3VOD A;  4A0Y A;  5E3O A;  4L18 B;  1LDK B;  1X1C A;  3K4J A;  1G3S A;  3WU2 C;  3S3N A;  2R7R A;  2XAG A;  1XTA A;  2R5Z B;  2DOF A;  2L4M A;  4CA0 A;  4E6K G;  1U2W A;  2HPM A;  5FD6 A;  2JVH A;  1KZH A;  4O3M A;  2KLO A;  2QA4 I;  4UUS A;  5CVR A;  1GUU A;  2XRN A;  1BJZ A;  4N9I A;  3OL3 A;  2RN7 A;  4LIT A;  1W5S A;  5E3M A;  2GIV A;  4UNO A;  4E70 A;  4X0G A;  5JHU A;  4N9H A;  1T56 A;  5FLM J;  1LE8 B;  3F6O A;  3ASO H;  5EZG A;  5GAE J;  2KFD A;  1RIO H;  2LH9 A;  4CZZ A;  3J81 Z;  3L00 A;  4BHC A;  1IC8 A;  3FF5 A;  1APL C;  3FBI B;  1ETK A;  4O5V A;  2E1M C;  2FU4 A;  5CKT A;  5B5E C;  5K5O A;  1LNW A;  1O7L A;  2HWV A;  5ICF A;  2L9S A;  2BW3 B;  1K79 A;  2LD5 A;  1HC8 A;  4HLY A;  3BC8 A;  1VQO I;  2ZJ2 A;  1VND A;  3L2R A;  1Z3X A;  3KP4 A;  4ZZL A;  2ZC2 A;  4BS9 A;  4HV6 A;  2ACJ A;  3DU5 A;  5H20 A;  1S72 I;  4UUV A;  2OU2 A;  3E6M A;  3CCS I;  2VJJ A;  3P7N A;  3ABT A;  1MH3 A;  2R93 J;  3A1Y A;  1Y0N A;  1O3S A;  3HRU A;  3M8E A;  4J01 A;  4XLC A;  2VKD A;  1FT9 A;  3HKZ A;  2EZI A;  2JMW A;  3CCV I;  2NS8 A;  1BN5 A;  3LOC A;  2CFX A;  2VE9 A;  3VB2 A;  3N05 A;  3P5J A;  4UB8 C;  1KQ8 A;  3U21 A;  3GCM A;  2KPM A;  1YJN I;  5FLX K;  2DA5 A;  4JOM A;  2UXX A;  2UV1 A;  1FIP A;  5DUK A;  2YS9 A;  2CH0 A;  3OSG A;  4XM3 A;  2FE3 A;  1HOM A;  2R7Z J;  3CES A;  1FC3 A;  2HTS A;  3PNV A;  4AWX B;  3K70 D;  2XSD C;  2OZU A;  1HQC A;  2KIU A;  2JUC A;  4GCV A;  5JHF A;  1I27 A;  2COM A;  3HOV J;  1Z1D A;  3GW2 A;  3P9I A;  5J8F A;  3Q3S A;  1S9H A;  3FIS A;  1MMD A;  2KL4 A;  1W0T A;  4L0Y B;  3EQL F;  4KMU X;  2B63 J;  2EQR A;  1XC5 A;  3LST A;  4LMY A;  3S8P A;  2IT0 A;  2LYC A;  2FOK A;  2MA3 A;  1NHA A;  2VJI A;  3ZQG A;  5FKN A;  2JRT A;  3TP0 A;  1ETX A;  3MVP A;  2Q2E A;  1RUO A;  1B8I B;  5HNF A;  1E3O C;  5DS9 A;  3OYJ A;  2ESH A;  1G8X A;  5BPD A;  3DWL E;  3HSR A;  2PMZ N;  3HXL A;  2Z3Y A;  3MN2 A;  3S32 A;  4QPO A;  1B1B A;  1LEB A;  4LK1 F;  3SZT A;  3BTI A;  3DEU A;  4N4O B;  4NQW A;  3SJM A;  4PJL A;  3B02 A;  1EV7 A;  1TW2 A;  2LKP A;  4CO8 A;  1P6R A;  3Q9V A;  1HF0 A;  4IEJ A;  1HKQ A;  3DTK A;  4F52 A;  2XGX A;  1ERD A;  2IGM A;  2X1D A;  4M6X A;  4DJA A;  1HST A;  4PGH A;  3HM5 A;  2DA1 A;  2DK5 A;  4WXH A;  4UHT A;  4BXX J;  2AXL A;  2W7N A;  3HBL A;  4ETS A;  3S1Q J;  3FDY A;  4IZZ A;  1LQ1 A;  3KZZ A;  1VTN C;  3TBI A;  5JLW A;  1O4X A;  4S05 A;  4JP0 A;  4BEH B;  1U9N A;  3IP4 B;  4WCG A;  4A3E J;  5HS7 A;  2X51 A;  1D5Y A;  2L7K A;  3M7G A;  5L3D A;  2XAS A;  5L3G A;  5C4J J;  3AG2 H;  3CC4 I;  2K7L A;  3PUF A;  4HX4 A;  4BY7 J;  2OAZ A;  2OCE A;  4B8X A;  4II3 A;  5LHH A;  2X6Y A;  5LHG A;  3I56 I;  2ID6 A;  1NK2 P;  1W5T A;  2PEX A;  4E7K A;  1Z9C A;  4RB2 C;  3BG3 A;  2RNJ A;  3TGN A;  2LP0 A;  1GXQ A;  1FJL A;  4CH7 A;  3GTG J;  1UG2 A;  2CFO A;  1W36 C;  1BIB A;  1Y8R B;  2JZY A;  5KAI C;  2M1B A;  2R7D A;  2ZSH B;  4P5O A;  3WGH A;  5CLS A;  3CJR B;  5E3N A;  1J59 A;  4I0B A;  3H9G A;  1IF1 A;  4UV8 A;  2UWM A;  3QP5 A;  1U5T B;  1SMT A;  3JAM K;  1MBG A;  4NC8 A;  1R36 A;  1OYY A;  2BXY A;  5M3M J;  1E3P A;  2D5V A;  1S3J A;  4DZJ A;  2P6S A;  2RV8 A;  5ED4 A;  2F5E A;  3KLN A;  5IY5 H;  2D1V A;  1LKX A;  2NS7 A;  2BY0 A;  2LF8 A;  2FX0 A;  2ZBK A;  2R7S A;  1R4N B;  2IA0 A;  3FXU A;  1H9T A;  1Z7L A;  2XGC A;  1SFK A;  3TDU C;  3TQN A;  2JWT A;  3HOU J;  2PJR A;  3BTC A;  4MO7 A;  4LG0 B;  2RC4 A;  4U7B A;  5HLG A;  1BI0 A;  1I3Q J;  2VJ5 A;  3F72 A;  4A3J J;  3NQO A;  2DA6 A;  3RPU A;  3W6J B;  3E97 A;  3PSI A;  2DOE A;  1ETW A;  1ZQ3 P;  5JVG F;  2R3S A;  2GXA A;  2OQR A;  2M4G A;  4L5E A;  2CW0 F;  3O6B B;  3GTP J;  4PSX A;  3EPZ A;  4AU7 A;  1OYW A;  3IC7 A;  3KEQ A;  4RMN A;  4A0Z A;  1L3L A;  2HQ5 A;  3CMA I;  1K6Y A;  5TGT A;  3J80 Z;  1WPK A;  3JTH A;  1BR4 A;  3GUD A;  3HEF A;  4Z6Y A;  1TLH B;  2F4O B;  1GDT A;  4BQN A;  1FOK A;  3QPT A;  5D5W B;  3HOS A;  2BZT A;  4A3C J;  2HQN A;  5C44 J;  1T0F C;  2QEX I;  2WB1 A;  1XDU A;  4KJZ A;  2M8E A;  2DMP A;  2GQQ A;  2BW3 A;  1X3W B;  2FF4 A;  1Q1H A;  3FXL A;  4AYB A;  5HLT A;  2ZFW A;  3G1M A;  1V5F A;  5B1B H;  5K7Z A;  1Z6R A;  3FXQ A;  3RZD J;  1KU2 A;  3U1D A;  4LIU A;  2H6B A;  3A02 A;  4IOA F;  1QNT A;  3KE2 A;  5KVR A;  3PM1 A;  4E7Z A;  1Z21 A;  4A6E A;  3KCC A;  3FWE A;  3IRR A;  1FBU A;  1UHS A;  1WCM J;  1ZEL A;  3NWS A;  3IWF A;  3S17 J;  4CYD A;  1NG7 A;  1DGW Y;  2JA5 J;  1Y1W J;  4A3B J;  3C3W A;  2EIM H;  4G6T B;  1Z3Y A;  2GOX B;  2OUM A;  5J1U A;  1IUY A;  3O8G A;  2FXA A;  3PNY A;  1MBE A;  2VT2 A;  2M7B A;  4AVZ A;  2XPW A;  4U87 A;  3GZ6 A;  1VQP I;  5KK1 A;  4ZTF A;  2NVX J;  2VJ4 A;  4XLF A;  3UNG C;  1VQL I;  2ELK A;  1RKT A;  1SMY F;  3E3V A;  3KZY A;  2PJP A;  4ABZ A;  2QF7 A;  3DCF A;  2QBY B;  1GV2 A;  3I0T A;  3CP2 A;  5BQT A;  4OIO F;  1IDZ A;  1J2X A;  2FNP A;  2R7Q A;  3QOD A;  3BR0 A;  2ICW G;  4XKC A;  1JGS A;  3M4O J;  3I53 A;  3H92 A;  3JCU C;  1OCC H;  1HW2 A;  1VF9 A;  2IXS A;  3L2Q A;  3WTZ A;  3QRF F;  1P7I A;  3KEO A;  4LB5 A;  2R7X A;  1F1Z A;  3ZPL A;  2Z16 A;  3I58 A;  2CRG A;  4IRI A;  3LSH A;  4Q48 A;  5JFR A;  2HYF A;  2OC6 A;  2LFB A;  3OYK A;  5A2Q Z;  1E2X A;  3FZV A;  4CDG A;  5C3E J;  3DP7 A;  5DDG A;  1PDN C;  2L54 A;  5FD5 A;  2BY3 A;  4L5J A;  3HHH A;  5CPR B;  2ZXW H;  2NYX A;  5F0C A;  2VPL A;  1ZG5 A;  4RAY A;  3K9T A;  2JQ7 A;  3GEZ A;  3OV8 A;  2KQR A;  4HPQ A;  2Q1Z B;  2JTV A;  4G9Y A;  4A3L J;  2WTE A;  1BR2 A;  4PFP A;  5J3L A;  4U0W A;  1K78 A;  2YX7 A;  2W84 A;  4FCY A;  2RRE A;  3QAH A;  1WHU A;  1AWC A;  2E60 A;  3A01 A;  2WC2 A;  1OQY A;  5B66 C;  2M0M A;  2N8G A;  3BT9 A;  1Y0U A;  1R58 A;  3OOP A;  4L9V A;  2ISY A;  3K7A J;  3WE2 A;  3K4M A;  3G6E I;  1DDN A;  4XQF A;  5GP9 A;  4UVC A;  3FK7 A;  5HVQ C;  3OIQ A;  2JSC A;  3R6S A;  1DQU A;  3DLA A;  4ON0 A;  3CTA A;  5ICE A;  2CV0 A;  3DTE A;  4QTR A;  5L3F A;  3R0A A;  3L2W A;  2K40 A;  2V9P A;  1XSX A;  4RS8 A;  1XGN A;  2QQ8 A;  3W2V A;  3MKL A;  2ESN A;  4PCQ A;  3C18 A;  3FMS A;  5KNL A;  1R00 A;  2Z5U A;  2LLK A;  5D5X B;  1V4R A;  2V4J C;  5L3B A;  4EJT A;  5CVJ A;  1V5G A;  1B59 A;  3ASN H;  5ERI A;  1WJC A;  5GTH C;  3S3O A;  2CQQ A;  3WTY C;  1FBS A;  2A69 F;  3V4G A;  2FBH A;  3WTS C;  2EZL A;  3FHN A;  5AON A;  5EG0 B;  3ABK H;  1F5T A;  1T38 A;  2VQC A;  2FBI A;  3K2A A;  1AHD P;  1QHG A;  1MW7 A;  3CCJ I;  1U8R A;  3TOA A;  5DCM A;  1U5T A;  2VBX A;  1RI7 A;  2IS1 A;  3F6V A;  4NC6 A;  4JX5 A;  4C2U A;  2FD5 A;  4EGZ A;  5IPA A;  2XPV A;  1T95 A;  1XX5 A;  3P9C A;  2XF5 A;  5DTD A;  4ZYH A;  2CQX A;  3G2B A;  4IX7 A;  1R1V A;  5IYD J;  1FY7 A;  3GFL A;  4DOZ A;  1S5L C;  1Z7U A;  1FSE A;  3H1C A;  1WSU A;  4DIQ A;  5HLH A;  1EJ9 A;  2ISZ A;  1HKT A;  4HX7 A;  3LA3 A;  4C30 A;  3J7Z I;  3QU6 A;  3BLY A;  2Q8K A;  3V8L A;  1G4D A;  2Y2Z A;  3BJO A;  1RZ4 A;  2DQL A;  2HFH A;  2XB5 A;  1IGN A;  2MG4 A;  5DM6 F;  5F1R A;  4B47 A;  1JE8 A;  2DOA A;  4DBQ A;  1MBH A;  3HPH A;  4KT5 C;  2F4M B;  1RC9 A;  2P8T A;  5CQG A;  4G6Q A;  2ZJP F;  1QRY A;  4D9J A;  4RA2 A;  2HKO A;  1ITY A;  3T5X A;  3LFU A;  2FSW A;  4XON A;  2LC2 A;  5CVU A;  4JX6 A;  2R4G A;  1GHC A;  2ZKZ A;  2M87 A;  2XAJ A;  2QSG X;  3PFY A;  1IAW A;  1VQ6 I;  1L0O C;  1JT0 A;  2G7H A;  5EDN A;  4O6J A;  2V6C A;  3JTG A;  3CO6 C;  3S1M J;  3MMY B;  3L1P A;  4Y13 A;  5FRM A;  3MCZ A;  1OR7 C;  4AIK A;  1PUF A;  2Z33 A;  2QUF A;  5EEH A;  1CQT A;  2ZJR F;  5F27 A;  1F43 A;  3KP7 A;  2L0K A;  1T8I A;  1ZRC A;  3CLO A;  2BE5 F;  4XIC A;  3HDD A;  1QPM A;  4A3I J;  2ZME B;  4HF1 A;  1BJA A;  2MC3 A;  3I71 A;  3PNT A;  4PGG A;  3N97 A;  4LGW A;  2PMZ A;  3CDL A;  1XGS A;  3WG9 A;  1RNL A;  5M5W J;  2X85 A;  4KN7 X;  1PVE A;  3O3K A;  3ROU A;  2CGP A;  2JA8 J;  1CF7 A;  3VDX A;  3PQJ A;  3LSI A;  1IRZ A;  1BR1 A;  2KIQ A;  1G3W A;  2XGD A;  1REP C;  3KYD B;  4IRG A;  1IZ1 A;  1YLF A;  1JTX A;  4HF0 A;  1QBJ A;  2EPF A;  2LR8 A;  3WU0 A;  4Y7N J;  4F91 B;  1MBJ A;  4FHT A;  2P0W A;  3GFJ A;  1K6O A;  3RQI A;  5LHI A;  1RKW A;  4PFO A;  4IQ4 A;  3V7R A;  3OR2 C;  5J1Y A;  3ABM H;  5M5Y J;  2XKP A;  4U88 A;  4M3B A;  3E5U A;  2K9Q A;  1IJW C;  2IS6 A;  2HKX A;  1JUP A;  4IHX A;  4L9T A;  4FX4 A;  2Y0S N;  1DU0 A;  2VN2 A;  1LPQ A;  2QBY A;  3PUB A;  4HG2 A;  4KIT B;  1K4T A;  4BE2 A;  1TBX A;  2XIG A;  3H3V K;  1D0X A;  5DYM A;  2VQL A;  1FOW A;  5F0H A;  3H3Z A;  1X1A A;  2JK3 A;  2OQG A;  2MSY A;  3LSP A;  1O3T A;  4B3A A;  1LB2 A;  1QA6 A;  4HEA 2;  2K4B A;  3HOY J;  5J4V A;  2HXI A;  2FUG 2;  2DMN A;  3DEE A;  3K1N A;  4F7Z A;  1WI3 A;  3TO7 A;  2IAI A;  1YHQ I;  4K2E A;  4WX9 A;  3CC7 I;  3OIP A;  2ZNY A;  3CZ6 A;  1N77 A;  2IEK A;  4AD9 A;  4ZDP A;  1FYM A;  5H6R A;  4XN0 A;  1X3U A;  3P9K A;  2VBY A;  3CMM A;  4CIC A;  3U2R A;  3ULQ B;  2KJC A;  5CVV A;  2GWR A;  1SVM A;  3DKW A;  4B4C A;  3EYY A;  3ZMV A;  1SAU A;  3GTJ J;  4CCJ A;  2DJN A;  5D4S A;  2J5O A;  3JSP A;  1UZC A;  2A61 A;  1IXC A;  3CUQ B;  3OOU A;  2EZH A;  2OJE D;  4F92 B;  4M9X A;  1Z0X A;  2DU9 A;  5D8K B;  1FPQ A;  1ZK8 A;  2DQR A;  3ZQI A;  1R49 A;  1EA3 A;  2HOS A;  1BOB A;  4FE4 A;  3H5R A;  1IXR C;  3S16 J;  3ZMD A;  2L4A A;  3SFI A;  1MH4 A;  2DDA A;  3BR6 A;  1MMG A;  4CCM A;  2DFH A;  1Y6I A;  3VPR A;  3F0C A;  3OS1 A;  3T1B A;  3IH3 A;  1G59 A;  2R5Y B;  2KRF A;  1SAX A;  2NVY J;  2FBK A;  2K4J A;  1MND A;  4ANJ A;  4QLC U;  5LRS A;  3BOQ A;  2KRH A;  2IBD A;  3H5N A;  5GPC A;  4EM1 A;  5M3F J;  1WJE A;  5DD8 A;  1W7P D;  2V1N A;  4MEY F;  3MFK A;  3ABU A;  1I6X A;  4U0Y A;  2BBY A;  3BZC A;  4U7D A;  2R7T A;  3HHG A;  3J80 K;  3BG5 A;  3WU1 B;  1BI3 A;  2DAO A;  2E5Z A;  4XNF A;  2CQ7 A;  1CGP A;  5IOY A;  1ETV A;  2LBF A;  3NWT A;  5FFX A;  1XS9 A;  2WAQ N;  1MJB A;  5EG0 A;  1N25 A;  4L9J A;  2M3A A;  1AKH B;  4CUG A;  1R23 A;  2BOL A;  3Q9S A;  1PJR A;  1T98 A;  1BM9 A;  4UUT A;  3M1E A;  4OMZ A;  3J7A O;  4A5N A;  3W2A A;  3QU3 A;  3CO7 C;  5DV5 A;  2YX4 A;  2JVG A;  3BCB A;  2DPD A;  3TL4 X;  2BHY A;  3DBR B;  1X1B A;  2ZME C;  3QPL A;  1UHW A;  3B6A A;  1KU3 A;  1ZRF A;  2MLG A;  4NNJ A;  1UG0 A;  4CCL A;  1IRG A;  4KDP A;  4KIS A;  3F9K A;  4M3F A;  2WY7 Q;  1PUE E;  4KN4 X;  3G3Z A;  1Z91 A;  2ZSI B;  4M3E A;  5BMZ A;  2I8D A;  1K4S A;  5F08 A;  4NDL A;  3HL2 A;  3L09 A;  1WGX A;  4M73 A;  5ICG A;  4BBS J;  4G7Z F;  2MD5 A;  3QQA A;  2CV2 A;  2QWW A;  1RPW A;  2DTR A;  4MQV A;  3BP8 A;  1BW6 A;  1YE9 A;  4RDU A;  2HVQ A;  3OYN A;  2PQ8 A;  3DQV C;  3PSF A;  1WH7 A;  3TW6 A;  3HZJ A;  3E0J B;  2JPB A;  4IHS A;  2HZT A;  1SAN A;  1HLV A;  4HST A;  3H35 A;  4DNC A;  1FZP B;  1ZGW A;  4BU2 A;  3K1M A;  3V8K A;  2AHQ A;  4GO1 A;  5IP7 J;  1FYL A;  2FML A;  1MBF A;  3IWZ A;  1VZ0 A;  2HZD A;  2DDB A;  2DJI A;  2VB6 A;  2A07 F;  1IN5 A;  3RPU D;  2PLY A;  2L02 A;  3R4K A;  4MGR A;  2QQB A;  3S1N J;  4G94 A;  3D5R C;  3MZ8 A;  2VE8 A;  1SVO A;  5LGN A;  5LD2 C;  3HOZ J;  2NVT J;  1SD5 A;  5TJJ A;  4I01 A;  1A31 A;  3LSM A;  1U78 A;  3EUA A;  1TQP A;  1W4M A;  2KRC A;  3FMR A;  1E17 A;  2DT5 A;  4PSW A;  5A2Q K;  3LSK A;  3AG1 H;  4AVP A;  3AG3 H;  1TC3 C;  2R7U A;  2DK8 A;  2WV1 A;  2W57 A;  1YIT I;  2QKM B;  1A36 A;  2FA5 A;  2F5C A;  5GAG J;  1YRN A;  3I5U A;  3M9A A;  4R1H A;  1AU7 A;  2QSH X;  3HOW J;  4P96 A;  2ZXJ A;  3C2H A;  4A3M J;  1W7P A;  2IRF G;  4RB1 A;  3SHF A;  2QLZ A;  2VKE A;  2M2E A;  3FX3 A;  4LJZ F;  4E7S A;  1YS6 A;  2YSR A;  2M30 A;  3ZQL A;  2ZJQ F;  2GA2 A;  4ZYA A;  5LBQ A;  1U3E M;  3FXK A;  2L7F P;  2XB0 X;  2ZO4 A;  3CUQ C;  4C3I J;  2EFW A;  1ZLK A;  3TDZ C;  3D1N I;  2H1K A;  4IQJ A;  1PYV A;  1I3A A;  5JI6 A;  3K6G A;  1DPU A;  3K70 C;  2MFZ A;  3CCE I;  2CSO A;  4PJN A;  2F2E A;  1S7A A;  1MMN A;  3JRB A;  5LLQ A;  2LVS A;  5EGO B;  2ETH A;  4M72 A;  2KDZ A;  2OTL I;  4B3X A;  2HYJ A;  4E7I A;  2P4W A;  1QZY A;  3DTI A;  1SD6 A;  1N75 A;  3O2P E;  3KEY A;  2EB7 A;  4KIC A;  3GTL J;  1MNE A;  2ELH A;  4KYW A;  3GF2 A;  4KNY A;  2BGC A;  2E1C A;  2W25 A;  1SFO J;  3FBN B;  2EIL H;  3VYU B;  4IHT A;  1GT0 C;  1D1A A;  3WTW C;  4P1W A;  1MDM B;  1JKR C;  3K4N A;  1OJL A;  5JVT A;  4LLL A;  3PIP F;  3CD6 I;  1ZRE A;  5BNG A;  1H88 C;  4UVB A;  3CDH A;  1A35 A;  2NVQ J;  3HSF A;  3K1P A;  2M8G X;  2A6H F;  1KGS A;  5HOD A;  2EV5 A;  4QPQ A;  4H0E A;  1YW8 A;  3BCA A;  4A6D A;  2GOM A;  3AFH A;  4RLQ A;  1R4M B;  1MJ9 A;  3MAJ A;  3MKY B;  4M3D A;  1UMQ A;  5BS6 A;  3GME A;  1D0Z A;  2X6W A;  1UST A;  2WWY A;  3F8M A;  2FMY A;  2OBP A;  3FHZ A;  2VQG A;  2KIM A;  4F93 B;  2IW5 A;  1YJW I;  1UHM A;  4OAZ A;  2I5U A;  5EZH A;  5K5Q A;  3O8H A;  2A6E F;  1V54 H;  1HDP A;  4A0X A;  3F3X A;  4DYC A;  1TT0 A;  1YI2 I;  2IS2 A;  4KIF A;  2EIK H;  4GYG A;  4ZZD A;  1SD4 A;  4S04 A;  1NG6 A;  2R5Z A;  4MEX F;  3CJN A;  4JX4 A;  2QCO A;  2VQH A;  1ZGJ A;  5FB2 A;  1J09 A;  2TCT A;  3S2H J;  1UFM A;  2DA4 A;  1TZL A;  3W6V A;  3CCQ I;  2OF7 A;  3VSK A;  2DXI A;  1ETY A;  3DEW A;  1YYV A;  5E8G A;  2MAB A;  3L9F A;  3OL4 A;  5F0F A;  4Q4Z F;  3LSJ A;  2LY1 A;  2HTJ A;  2HDD A;  2X1E A;  1IRF A;  3HOX J;  5GAH J;  5F64 A;  1XCB A;  1LE8 A;  4HX8 A;  2CW8 A;  3GFM A;  9ANT A;  1Z77 A;  3LAP A;  2WY8 Q;  2ZNZ A;  4I6Z A;  4C2M J;  1SFX A;  2HVR A;  4M6V A;  3R60 A;  2F5V A;  3FXO A;  4XMY A;  4Y15 A;  1R71 A;  1ZN2 A;  1BL0 A;  3RYR A;  2O9L A;  3GVA A;  2XAH A;  1IN7 A;  2E5N A;  2G0E A;  3RZO J;  4ENN A;  1OFC X;  2B9S A;  4XSZ F;  2PN6 A;  3KX2 A;  4BAC A;  4ESJ A;  1SFU A;  3ML6 A;  1RES A;  1YOV B;  2Q0O A;  4EV0 A;  5LFA A;  1ZYR F;  1IW7 F;  4M6Y A;  3M8F A;  2JJ7 A;  1GVJ A;  2VAS A;  2V1U A;  2EFP A;  1MSF C;  1X1D A;  4Y3O A;  1XSV A;  4LK0 F;  5HS9 A;  1FBQ A;  3OIO A;  2EV0 A;  4OIN F;  3CLQ A;  3RJP A;  1IN8 A;  2HPI A;  5DCF A;  2RVC A;  2H09 A;  2Z1D A;  3UR3 C;  4S0H B;  4NHJ A;  3E6B A;  2MH9 A;  2DTZ A;  4PUS A;  2V79 A;  4AUX A;  3CF5 F;  3F8C A;  3RDI A;  3BTJ A;  4II2 A;  3SXY A;  3RQ4 A;  4AIJ A;  1MD0 A;  2P5L C;  4Y17 A;  1QQI A;  1ZHF A;  4A3G J;  2O3F A;  3MKZ A;  4YFK F;  4XK4 A;  5GTI C;  1FWZ A;  4CGZ A;  1ZGA A;  1EH6 A;  1QZZ A;  1ENH A;  4RLF A;  2Y30 A;  1OCT C;  2F6C A;  4KIB A;  4Y4R A;  3HKZ N;  2L9N A;  5FKL A;  3K10 A;  2QSF X;  3EUK L;  4Y33 A;  1MKM A;  3QWL A;  3BZ6 A;  5IP9 J;  2DA2 A;  2VI6 A;  1TT5 B;  2QM3 A;  4G7O F;  4MNU A;  4I76 A;  3OYL A;  1JJ8 C;  2Y0S A;  1Y8Q B;  4LLN A;  3TO9 A;  2HOT A;  4BBR J;  3NAR A;  2O8K A;  1T0F A;  2G7U A;  5HDG A;  1OIS A;  1R9T J;  3S2D J;  1U8B A;  4XLA A;  6PAX A;  1VQ9 I;  1G3Y A;  2HQR A;  2XRL A;  4HQM A;  2QVO A;  5E1X A;  2ME6 A;  1GV5 A;  1D8K A;  1XGO A;  1ETQ A;  4CXF A;  3CJQ B;  4EJW A;  3OYF A;  3ECO A;  3BWG A;  3DPU A;  3OYC A;  3H3U A;  1FTZ A;  2LRE A;  3PJR A;  5F04 A;  1B8I A;  3CF2 A;  3GX4 X;  4OIP F;  4ENM A;  1TP4 A;  1FTT A;  2PG4 A;  2RGV A;  3TO6 A;  2ZCW A;  4UVA A;  1S8N A;  4YG2 F;  2K86 A;  1D3Y A;  2X6X A;  2I10 A;  2O6G E;  3CCU I;  4QSH A;  3N4M A;  3MWM A;  4EAT A;  3GFI A;  2LF7 A;  2NS0 A;  1A6I A;  4A5M A;  3GLX A;  5D6F A;  3QP6 A;  5B1A H;  3GWZ A;  4Z2Y A;  4OIR F;  4ZYE A;  2M5W A;  4M71 A;  1LDD A;  3HRM A;  1K7A A;  1EH7 A;  1S7O A;  1FP1 D;  2O61 A;  3PO3 J;  2P7C B;  3KP5 A;  2HR3 A;  5HS8 A;  3CMY A;  5C4X J;  4R79 A;  4IVN A;  3BQZ A;  3C2B A;  4ZDO A;  3LFK A;  4JBA A;  1SC7 A;  2XDV A;  1VQK I;  1ONV A;  2KT0 A;  4OWR B;  1JUS A;  1MNM C;  2H94 A;  3WGI A;  1ACI A;  4E7J A;  1YFH A;  4BEH A;  3VOE A;  2HEO A;  4CCK A;  4IRH A;  3SYT A;  4B09 A;  5J6X A;  1D8J A;  3V42 A;  5EGO A;  3G73 A;  2P7V B;  5DD4 A;  2OPT A;  2MYS A;  2KDO A;  3LSR A;  5DEQ A;  4BGD A;  1UAA A;  2CU7 A;  1IN6 A;  5HNH A;  4IO9 F;  3HB9 A;  2FNA A;  2CO5 A;  1D0Y A;  2HDW A;  4A93 J;  4BHB A;  4RAG A;  3V7S A;  4BH9 A;  5EEA A;  1NH3 A;  4P9U A;  1MDM A;  2A6T A;  3KP3 A;  1AA7 A;  1U9O A;  2HOA A;  3IKT A;  2VBW A;  5M5X J;  2Z2S B;  1LEA A;  4V19 K;  3ZQQ A;  3J81 K;  1G2H A;  2E2I J;  4L0Z B;  3ZMU A;  1BIA A;  3DKX A;  4FTH A;  3JAM Z;  1H0M A;  2R92 J;  3VEP A;  3E1S A;  5JR3 A;  1BBY A;  1HSJ A;  1LFB A;  2O7O A;  5KAF C;  3MKW B;  1Q1V A;  2EZK A;  1E0E A;  3BG9 A;  5CYV A;  3D5L A;  1R1U A;  2UXN A;  5E3L A;  3OYI A;  3HUG B;  2WAF A;  2OA4 A;  2Y0M A;  1OLT A;  1KU9 A;  3BR5 A;  2DBB A;  4LG0 A;  4GFB A;  1TWF J;  2R7W A;  3FXJ A;  1UEL B;  2W24 A;  4M9S A;  1I1S A;  4KIG A;  3FK6 A;  1SFE A;  4BJ6 C;  1WJD A;  3GTO J;  2IA2 A;  1STZ A;  3ZOB A;  3F21 A;  1FIA A;  2FJ1 A;  5HDK A;  3U1K A;  4DYR A;  2R0Q C;  4RAZ A;  2EBI A;  2KZG A;  1YJ9 I;  4A69 C;  2X48 A;  1KYW A;  2KHM A;  4HNT A;  1POG A;  3JRH A;  3GZ5 A;  1K61 A;  3S15 J;  1P4A A;  4ENK A;  3QYF A;  2K9N A;  4IHV A;  2A5Y B;  5KHD A;  1O3R A;  3LQQ A;  4XOP A;  1IV6 A;  2XAF A;  5CQE A;  2RDP A;  4ITV A;  4JK1 X;  1OMI A;  3K4B A;  1ZG3 A;  2KJB A;  4A12 A;  3OR1 C;  3E6D A;  2VXD A;  3ZN1 A;  4X1E A;  3VSL A;  1PP8 F;  2H8W A;  3OY9 A;  3HRS A;  2M0C A;  3VYR B;  3UKG A;  2L9R A;  1WKM A;  3TED A;  3ERM A;  3HOT A;  2GM4 A;  4FET A;  3G1L A;  2R7V A;  2ELJ A;  3F8F A;  1WJB A;  3OMY A;  3Q0W A;  5EJC A;  3ZRG A;  4D5F A;  5LEK A;  1GXP A;  1T33 A;  3L2C A;  4I2O A;  1D1C A;  3CDI A;  3E5X A;  4YEL A;  4Y52 J;  1P9Q C;  1R5I D;  1P4W A;  1WJF A;  1IDY A;  1YIO A;  3QOP A;  1HXD A;  2Q2E B;  4HF2 A;  5IOZ A;  1OKR A;  3LL7 A;  1FSH A;  2BVM A;  4GRI A;  3FIW A;  2VON A;  1R6R A;  3DPT A;  3RYP A;  2QKL B;  4AYB N;  5FKM A;  2MGQ A;  3NEU A;  5E17 F;  3JRG A;  3AKZ A;  4CZC A;  2R7F A;  1J0R A;  4DYQ A;  3BRO A;  2DA3 A;  3LA2 A;  4ZJZ A;  1J7K A;  3WHC A;  4IF4 A;  2HGC A;  4XKB A;  3AAF A;  5D5U B;  2QZ8 A;  3TMO A;  3K4C A;  3OSF A;  3SEQ A;  4BNC A;  3CQZ J;  3ONQ A;  4WK8 F;  2JA7 J;  1RUN A;  1X3Z B;  1OCZ H;  5L3E A;  3D5S C;  2LNB A;  4C3J J;  2V1X A;  3OYM A;  1MJA A;  3SQN A;  1LUJ B;  2ZXI A;  3S3M A;  3QOE A;  1OR7 A;  2H27 A;  2EIJ H;  1N78 A;  4QWQ A;  3AG4 H;  2DCE A;  5IT9 Z;  2P6T A;  5ILU A;  3F8N A;  1TL8 A;  2P5V A;  2EFQ A;  3DKY A;  1SD7 A;  1YQA A;  4RAF A;  1OCR H;  2ME0 A;  1LFP A;  5HLI A;  1T2K A;  2BEO A;  2VBZ A;  2NNN A;  2L7M P;  3KZI C;  4XKV A;  2XHK A;  4MFE A;  4EVI A;  5HOO A;  3S2W A;  3TKY A;  4XOR A;  3T8T A;  2LKX A;  1SVL A;  1WRJ A;  3GZN B;  1HDD C;  2JA6 J;  2K9M A;  3RI4 A;  3SDG A;  2P5K A;  4PDK A;  3KET A;  4BQO A;  1QPI A;  2DI3 A;  3GXO A;  4HNV A;  4RBO A;  4C2T A;  2NRA C;  3LMM A;  3H9Q A;  4FIS A;  2K5C A;  2F4I A;  2MH2 A;  4L9N A;  2B0L A;  2BV6 A;  3ZMZ A;  4DZP A;  2H1L A;  1H8A C;  1FP2 A;  1MBK A;  3JRI A;  2HYG D;  2HI3 A;  4UV9 A;  2K02 A;  4M74 A;  2IP2 A;  2ZFU A;  3FM3 A;  4YFX F; 
#chains in the Genus database with same CATH homology
 2VOO A;  4XLN F;  5IT3 A;  2L01 A;  3FXR A;  1T6S A;  2O03 A;  4HDV A;  2QQA A;  2STT A;  1MGT A;  2V1D A;  2DFI A;  3RTR A;  2D2W A;  1D5V A;  1YG2 A;  2IA1 A;  3WTU C;  1KA8 A;  2PFB A;  4R8H A;  1BC8 C;  3LWF A;  4HAM A;  1ON2 A;  1R7J A;  4HBL A;  1FYK A;  5D8L B;  1JHH A;  3DPL C;  5E20 A;  3BPV A;  1R5G A;  2GAU A;  3PFI A;  2OZ6 A;  4L5I A;  4HDU A;  1HKS A;  1YTY A;  2XV4 S;  1FLI A;  4RGR A;  1WI9 A;  4TV7 A;  5BPI A;  4BAY A;  3F23 A;  3HUG A;  2PMH A;  1DUX C;  1WQ2 A;  1R1T A;  2VOP A;  1EH8 A;  4XSX F;  1G3T A;  4OMY A;  3RIR A;  5K5R A;  4GYI A;  1I5Z A;  5AIQ A;  1XMA A;  3K2Z A;  3I4P A;  2KKO A;  2PBI A;  2PI0 A;  1UB9 A;  1ZH5 A;  3MZH A;  2DPU A;  2JPC A;  3E6C C;  3HTS B;  4G6D A;  1R22 A;  1XDS A;  5D5V B;  2ZME A;  4BQA A;  3K69 A;  1JHF A;  1USS A;  5FGM A;  4ZYD A;  4KA4 A;  3I59 B;  1P92 A;  4I98 B;  4G8X A;  3ZN0 A;  4KMF A;  4RGU A;  3F22 A;  1K78 B;  1HW1 A;  1KQ0 A;  1G6N A;  2DW4 A;  3MEX A;  3I64 A;  3D0S A;  1ODD A;  1LDJ A;  4Q47 A;  5J8C A;  4LD5 A;  2CYY A;  4P55 A;  3WGG A;  2A68 F;  5H6Q A;  4IPA A;  2HOE A;  2FRH A;  4MTE A;  1Z05 A;  3DF8 A;  2X0L A;  3DFG A;  4I0A A;  4WXC A;  2GXB A;  2E7X A;  2UZK A;  4HZF A;  3LAJ A;  5CJ9 A;  3REO A;  1OYI A;  4WWC A;  4IXA A;  5E18 F;  2V9V A;  1TW3 A;  1B6A A;  4EJU A;  2OD5 A;  3E5Q A;  1PP7 U;  3F8B A;  3BJA A;  3VFZ A;  4PZJ A;  1B4A A;  2E7W A;  4MTD A;  5K1Y A;  2CWE A;  3EET A;  5DCM B;  2IVM A;  3CUQ A;  4RB3 C;  2FEZ A;  3KFW X;  2NAZ A;  1Z6T A;  4BYY A;  1J9I A;  2DO7 A;  1XCV A;  1ON1 A;  3HRT A;  2XRO A;  2YPR A;  2VT3 A;  4DQ2 A;  4M9Z A;  4ZH4 F;  4HW0 A;  2TDX A;  3L7W A;  3SZP A;  4JQF A;  2KIF A;  2QEN A;  3WOD F;  4BXU A;  3HTU A;  2EJR A;  1F9N A;  4FX0 A;  3WTX C;  5E1W A;  5CVI A;  3LA7 A;  4CHU A;  2EA2 A;  3RKY A;  2EK5 A;  1XMK A;  3WTT C;  4EQQ A;  5E1Z B;  2EA4 A;  2PMU A;  1UCR A;  2AS5 F;  4U0V A;  1R5H A;  3FMQ A;  1YW9 A;  1J75 A;  4EM0 B;  4HOB A;  1ZAR A;  2E1N A;  2ADU A;  4N0B A;  2RKH A;  3IRQ A;  3SFZ A;  2EV6 A;  3CUO A;  1F4K A;  5FLX Z;  3RPQ A;  1CF7 B;  3R0J A;  5TRD A;  5AIP A;  3EYI A;  4HA8 A;  4LB6 B;  5ILV A;  1YS7 A;  2M45 A;  1AOY A;  2D45 A;  2CQK A;  2XAQ A;  1U6G A;  4NB5 A;  3JW4 A;  1OPC A;  3KP2 A;  2HS5 A;  3BDD A;  5HDN A;  3JSO A;  4XBF A;  2VOD A;  2VC1 A;  1DPR A;  1P4X A;  2JT1 A;  1BI1 A;  4UXN A;  1FNN A;  4I02 A;  5ILS A;  3COA C;  4YFN F;  5IT9 K;  5E8I A;  3FM5 A;  2O0Y A;  1IXS B;  4MHG A;  1LVA A;  1BI2 A;  3BY6 A;  2HDC A;  1XSD A;  4MQ9 F;  5LGU A;  2EFN A;  3EUH A;  3V8J A;  3I59 A;  2LDU A;  3ISP A;  2IJL A;  1XGM A;  3B73 A;  2GA1 A;  2K27 A;  1QO0 D;  3LQR A;  4WXD A;  1U5T C;  1YO5 C;  2NNY A;  3ERE D;  1ZG1 A;  1KQ9 A;  3RKX A;  1LJ9 A;  3ELK A;  3HYI A;  4Q5S F;  1ZLJ A;  4BHP A;  2Z99 A;  2QQ9 A;  4EM2 A;  3T0Y A;  3T8R A;  4RGS A;  4D0P A;  1O57 A;  5ICC A;  2F5D A;  3WTV C;  4EGY A;  3WE3 A;  4ZYG A;  3PQK A;  5LEJ A;  1BC7 C;  3DXJ F;  2XUB A;  1ULY A;  2WV0 A;  1FX7 A;  5FO5 A;  5DUI A;  4ASN A;  3ECH A;  4P9F A;  1B9N A;  1MZB A;  2D1H A;  1BOA A;  2F5F A;  2X4H A;  2J5P A;  2C6Y A;  3DV8 A;  1KU7 A;  3EDP A;  3U9G A;  4G7H F;  4XLP F;  4XRF A;  5LGT A;  3IL2 A;  2Y48 A;  5BOX A;  1IN4 A;  1S29 A;  5FFZ A;  4GGG A;  4HYE A;  2IPQ X;  3ZMS A;  1O7F A;  4A2U A;  1HW5 A;  1P2F A;  5D4R A;  3ZQ7 A;  4YIF A;  1HBX G;  4HLX A;  1J5Y A;  3W6K B;  3GO5 A;  4LFU A;  2STW A;  2DLL A;  3IHU A;  3TOB A;  1DP7 P;  1I1G A;  1A04 A;  1TQM A;  2YR2 A;  4FT8 A;  2FQ3 A;  4AIH A;  3MZY A;  4LLG F;  2EWN A;  3RKW A;  1TNT A;  2YU3 A;  4KUM A;  3ZP5 A;  1KYZ A;  1TQI A;  2LSO A;  1TNS A;  4IJA A;  3GYH X;  2VC0 A;  1JXS A;  4OU0 A;  4ESB A;  1S6L A;  3V7C A;  3R61 A;  4WF2 A;  2EFO A;  3C7J A;  5LRR A;  4EMS A;  1TTY A;  2QYO A;  3Q5F A;  4RGX A;  5D6E A;  2GZW A;  2Z9O A;  1O3Q A;  4ESF A;  2XKO A;  2L3D A;  1QGP A;  4OIQ F;  4OOI A;  1W7P B;  3HIF A;  5EEG A;  2MBF A;  1T39 A;  1XB4 A;  1B9M A;  4ENJ A;  3HSE A;  3KLO A;  5F6F A;  4I09 A;  1XN7 A;  5L3C A;  1XD7 A;  2CG4 A;  2GXG A;  2RQP A;  1V3F A;  3K0L A;  2O8X A;  4HV5 A;  4YII A;  4HQE A;  4I7H A;  3IKV A;  4RB0 A;  3MQ0 A;  4GXO A;  1C0W A;  2Y75 A;  4KFC A;  2A3S A;  4EJO A;  1ZAO A;  1H9G A;  1ZRD A;  2H6C A;  3C1D A;  2XVC A;  3ZMT A;  3BPX A;  1WWX A;  3I54 A;  3NRV A;  3KP6 A;  2W85 A;  1YW7 A;  2VXZ A;  2BYV E;  2G9W A;  3QPH A;  3BJ6 A;  4EJV A;  2MLK A;  3VOD A;  4A0Y A;  4L18 B;  1LDK B;  1G3S A;  2XAG A;  2L4M A;  1U2W A;  5FD6 A;  4O3M A;  5CVR A;  2XRN A;  4N9I A;  2RN7 A;  1W5S A;  2GIV A;  4UNO A;  4E70 A;  5JHU A;  4N9H A;  3F6O A;  1RIO H;  4CZZ A;  3J81 Z;  3L00 A;  4BHC A;  3FF5 A;  4O5V A;  2FU4 A;  5K5O A;  1LNW A;  1O7L A;  2HWV A;  5ICF A;  1K79 A;  4HLY A;  2ZJ2 A;  3KP4 A;  4ZZL A;  2ACJ A;  4HV6 A;  5H20 A;  4UUV A;  2OU2 A;  3E6M A;  3P7N A;  3ABT A;  1O3S A;  3HRU A;  3M8E A;  1FT9 A;  1BN5 A;  2CFX A;  2VE9 A;  3VB2 A;  1KQ8 A;  5FLX K;  2UXX A;  5DUK A;  2FE3 A;  1FC3 A;  2HTS A;  4AWX B;  2OZU A;  1HQC A;  2KIU A;  4GCV A;  1I27 A;  2COM A;  1Z1D A;  3GW2 A;  3P9I A;  5J8F A;  4L0Y B;  3EQL F;  4KMU X;  3LST A;  4LMY A;  2IT0 A;  2FOK A;  2MA3 A;  1NHA A;  2JRT A;  1RUO A;  2Q2E A;  5BPD A;  2ESH A;  3HSR A;  2Z3Y A;  1B1B A;  1LEB A;  4LK1 F;  3SZT A;  3DEU A;  4NQW A;  3B02 A;  1EV7 A;  1TW2 A;  2LKP A;  4CO8 A;  1P6R A;  3Q9V A;  1HKQ A;  2XGX A;  4M6X A;  1HST A;  4PGH A;  2DK5 A;  4WXH A;  4UHT A;  2AXL A;  4ETS A;  1LQ1 A;  3KZZ A;  1VTN C;  4S05 A;  4WCG A;  5HS7 A;  3M7G A;  5L3D A;  2XAS A;  5L3G A;  2K7L A;  4HX4 A;  2OAZ A;  4B8X A;  5LHH A;  5LHG A;  1W5T A;  2PEX A;  1Z9C A;  4RB2 C;  2RNJ A;  3TGN A;  1GXQ A;  1BIB A;  2JZY A;  2M1B A;  2R7D A;  3WGH A;  4P5O A;  5CLS A;  1J59 A;  4I0B A;  1IF1 A;  4UV8 A;  2UWM A;  3QP5 A;  1U5T B;  1SMT A;  3JAM K;  1R36 A;  1OYY A;  1S3J A;  2P6S A;  2RV8 A;  5ED4 A;  2F5E A;  3KLN A;  2D1V A;  2LF8 A;  2ZBK A;  2IA0 A;  3FXU A;  1H9T A;  3TDU C;  3TQN A;  4LG0 B;  2RC4 A;  4U7B A;  5HLG A;  1BI0 A;  3F72 A;  3NQO A;  3RPU A;  3W6J B;  3E97 A;  2R3S A;  2OQR A;  2CW0 F;  3O6B B;  1OYW A;  3IC7 A;  3KEQ A;  4A0Z A;  1L3L A;  3J80 Z;  3JTH A;  3GUD A;  1TLH B;  1FOK A;  3QPT A;  5D5W B;  3HOS A;  2HQN A;  1XDU A;  2M8E A;  2GQQ A;  2FF4 A;  1Q1H A;  2ZFW A;  1Z6R A;  3FXQ A;  1KU2 A;  3U1D A;  2H6B A;  1QNT A;  3KE2 A;  5KVR A;  4A6E A;  3KCC A;  3FWE A;  3IRR A;  1FBU A;  3IWF A;  4CYD A;  3C3W A;  1IUY A;  2FXA A;  2VT2 A;  3GZ6 A;  5KK1 A;  1SMY F;  3E3V A;  3KZY A;  2PJP A;  2QBY B;  3I0T A;  5BQT A;  4OIO F;  1J2X A;  2FNP A;  1JGS A;  3I53 A;  3H92 A;  1HW2 A;  3WTZ A;  3QRF F;  3KEO A;  4LB5 A;  1F1Z A;  3ZPL A;  3I58 A;  4IRI A;  4Q48 A;  5JFR A;  2HYF A;  5A2Q Z;  1E2X A;  3FZV A;  4CDG A;  3DP7 A;  5DDG A;  1PDN C;  2L54 A;  5FD5 A;  4L5J A;  3HHH A;  2NYX A;  1ZG5 A;  4RAY A;  3K9T A;  3GEZ A;  3OV8 A;  2JTV A;  4G9Y A;  2WTE A;  4U0W A;  1K78 A;  2YX7 A;  2W84 A;  3QAH A;  1AWC A;  2WC2 A;  1Y0U A;  1R58 A;  3OOP A;  4L9V A;  2ISY A;  3WE2 A;  1DDN A;  4UVC A;  5HVQ C;  2JSC A;  3R6S A;  4ON0 A;  3CTA A;  5ICE A;  5L3F A;  3R0A A;  1XSX A;  4RS8 A;  1XGN A;  2ESN A;  4PCQ A;  3C18 A;  3FMS A;  1R00 A;  2Z5U A;  5D5X B;  1V4R A;  5L3B A;  4EJT A;  5CVJ A;  1B59 A;  5ERI A;  3WTY C;  1FBS A;  2A69 F;  3V4G A;  2FBH A;  3WTS C;  5AON A;  1F5T A;  1T38 A;  2FBI A;  1U8R A;  3TOA A;  5DCM A;  1U5T A;  2VBX A;  1RI7 A;  3F6V A;  4EGZ A;  3P9C A;  4ZYH A;  1R1V A;  1FY7 A;  3GFL A;  1WSU A;  1Z7U A;  1FSE A;  2ISZ A;  5HLH A;  1HKT A;  4HX7 A;  3LA3 A;  3QU6 A;  2Q8K A;  3V8L A;  1G4D A;  3BJO A;  2DQL A;  1RZ4 A;  2HFH A;  5F1R A;  1JE8 A;  4KT5 C;  2P8T A;  4G6Q A;  2HKO A;  3T5X A;  2FSW A;  1GHC A;  5CVU A;  2ZKZ A;  2M87 A;  2XAJ A;  1IAW A;  1L0O C;  2G7H A;  4O6J A;  2V6C A;  3JTG A;  3CO6 C;  4Y13 A;  3MCZ A;  4AIK A;  2Z33 A;  2QUF A;  5EEH A;  3KP7 A;  1ZRC A;  3CLO A;  2BE5 F;  1QPM A;  2ZME B;  4HF1 A;  1BJA A;  2MC3 A;  3I71 A;  3N97 A;  4PGG A;  4LGW A;  1XGS A;  3WG9 A;  1RNL A;  4KN7 X;  3O3K A;  3ROU A;  2CGP A;  1CF7 A;  3PQJ A;  1G3W A;  1REP C;  4IRG A;  1IZ1 A;  1YLF A;  4HF0 A;  1QBJ A;  3WU0 A;  4FHT A;  1K6O A;  3GFJ A;  5LHI A;  3V7R A;  2XKP A;  4U88 A;  3E5U A;  2HKX A;  4L9T A;  4FX4 A;  2VN2 A;  2QBY A;  1TBX A;  2XIG A;  5DYM A;  3H3Z A;  2OQG A;  1O3T A;  1LB2 A;  2K4B A;  3K1N A;  4F7Z A;  3TO7 A;  4WX9 A;  2ZNY A;  4AD9 A;  1FYM A;  5H6R A;  1X3U A;  3P9K A;  2VBY A;  4CIC A;  3U2R A;  3ULQ B;  2KJC A;  5CVV A;  2GWR A;  3DKW A;  3EYY A;  3ZMV A;  5D4S A;  2J5O A;  3JSP A;  2A61 A;  1IXC A;  3CUQ B;  4M9X A;  2DU9 A;  5D8K B;  1FPQ A;  2DQR A;  1IXR C;  3ZMD A;  2L4A A;  3T1B A;  2KRF A;  1SAX A;  2FBK A;  2K4J A;  4QLC U;  5LRS A;  3BOQ A;  4EM1 A;  5DD8 A;  1W7P D;  4MEY F;  3MFK A;  3ABU A;  1I6X A;  4U0Y A;  2BBY A;  4U7D A;  3HHG A;  3J80 K;  3WU1 B;  1BI3 A;  2DAO A;  1CGP A;  5FFX A;  1MJB A;  4L9J A;  1R23 A;  3Q9S A;  1T98 A;  1BM9 A;  3M1E A;  4OMZ A;  3J7A O;  4A5N A;  3QU3 A;  3CO7 C;  5DV5 A;  2YX4 A;  2DPD A;  1UHW A;  1KU3 A;  1ZRF A;  2MLG A;  1IRG A;  4KDP A;  1PUE E;  4KN4 X;  3G3Z A;  1Z91 A;  5BMZ A;  3L09 A;  4M73 A;  5ICG A;  4G7Z F;  2MD5 A;  2QWW A;  2DTR A;  4MQV A;  3BP8 A;  2PQ8 A;  3DQV C;  2JPB A;  4IHS A;  2HZT A;  4DNC A;  1FZP B;  3K1M A;  3V8K A;  4GO1 A;  1FYL A;  2FML A;  3IWZ A;  2A07 F;  1IN5 A;  2PLY A;  2L02 A;  3R4K A;  4MGR A;  2QQB A;  4G94 A;  2VE8 A;  5LGN A;  1SD5 A;  5TJJ A;  4I01 A;  1U78 A;  1TQP A;  1W4M A;  3FMR A;  1E17 A;  2DT5 A;  5A2Q K;  4AVP A;  2DK8 A;  2W57 A;  2FA5 A;  2F5C A;  3I5U A;  3M9A A;  4R1H A;  4P96 A;  2ZXJ A;  1W7P A;  2IRF G;  4RB1 A;  3SHF A;  2QLZ A;  4LJZ F;  3FX3 A;  1YS6 A;  2YSR A;  2M30 A;  2GA2 A;  1U3E M;  5LBQ A;  2ZO4 A;  3CUQ C;  1ZLK A;  2EFW A;  3TDZ C;  5JI6 A;  1DPU A;  2CSO A;  2F2E A;  1S7A A;  5LLQ A;  2ETH A;  4M72 A;  2P4W A;  1QZY A;  1SD6 A;  3O2P E;  2EB7 A;  4KIC A;  2ELH A;  4KYW A;  3GF2 A;  4KNY A;  2BGC A;  2E1C A;  2W25 A;  4IHT A;  3WTW C;  1MDM B;  5JVT A;  4LLL A;  1ZRE A;  4UVB A;  3CDH A;  3HSF A;  3K1P A;  2A6H F;  1KGS A;  2EV5 A;  4H0E A;  1YW8 A;  4A6D A;  1MJ9 A;  3MAJ A;  5BS6 A;  1UST A;  2WWY A;  3F8M A;  2FMY A;  2OBP A;  3FHZ A;  2KIM A;  2IW5 A;  1UHM A;  5K5Q A;  2A6E F;  4A0X A;  3F3X A;  4KIF A;  4GYG A;  4ZZD A;  1SD4 A;  4S04 A;  4MEX F;  3CJN A;  1ZGJ A;  5FB2 A;  1UFM A;  1YYV A;  5E8G A;  3L9F A;  4Q4Z F;  2HTJ A;  1IRF A;  5F64 A;  1XCB A;  4HX8 A;  3GFM A;  3LAP A;  2ZNZ A;  1SFX A;  3R60 A;  4Y15 A;  1ZN2 A;  3RYR A;  3GVA A;  2XAH A;  1IN7 A;  4ENN A;  4XSZ F;  2PN6 A;  4ESJ A;  1SFU A;  3ML6 A;  2Q0O A;  4EV0 A;  1ZYR F;  1IW7 F;  4M6Y A;  3M8F A;  1GVJ A;  2V1U A;  2EFP A;  1XSV A;  4LK0 F;  5HS9 A;  1FBQ A;  2EV0 A;  4OIN F;  3RJP A;  1IN8 A;  5DCF A;  2RVC A;  2H09 A;  4NHJ A;  3E6B A;  2MH9 A;  2V79 A;  3F8C A;  3RDI A;  3SXY A;  4AIJ A;  1MD0 A;  2P5L C;  4Y17 A;  1QQI A;  1ZHF A;  2O3F A;  4YFK F;  4CGZ A;  1FWZ A;  1ZGA A;  1EH6 A;  1QZZ A;  4KIB A;  1MKM A;  3BZ6 A;  2QM3 A;  4G7O F;  4MNU A;  4LLN A;  3TO9 A;  1T0F A;  2G7U A;  5HDG A;  6PAX A;  1G3Y A;  2HQR A;  4HQM A;  5E1X A;  2QVO A;  1D8K A;  1XGO A;  4CXF A;  4EJW A;  3ECO A;  3BWG A;  3H3U A;  3GX4 X;  4OIP F;  4ENM A;  2PG4 A;  2RGV A;  3TO6 A;  4YG2 F;  2ZCW A;  4UVA A;  1S8N A;  2K86 A;  1D3Y A;  2O6G E;  3N4M A;  3MWM A;  3GFI A;  2LF7 A;  2NS0 A;  4A5M A;  3GLX A;  5D6F A;  3QP6 A;  3GWZ A;  4Z2Y A;  4OIR F;  4ZYE A;  2M5W A;  4M71 A;  1LDD A;  3HRM A;  1K7A A;  1EH7 A;  1S7O A;  1FP1 D;  2O61 A;  2P7C B;  3KP5 A;  2HR3 A;  5HS8 A;  4R79 A;  4IVN A;  3LFK A;  4JBA A;  1ONV A;  2H94 A;  3WGI A;  1YFH A;  2HEO A;  3VOE A;  4IRH A;  5J6X A;  4B09 A;  1D8J A;  3G73 A;  2P7V B;  5DD4 A;  5DEQ A;  1IN6 A;  2FNA A;  2CO5 A;  4BHB A;  3V7S A;  4BH9 A;  4P9U A;  1MDM A;  3KP3 A;  3IKT A;  2VBW A;  1LEA A;  3J81 K;  4L0Z B;  3ZMU A;  1BIA A;  3JAM Z;  1H0M A;  3VEP A;  5JR3 A;  1BBY A;  1HSJ A;  5CYV A;  3D5L A;  1R1U A;  2UXN A;  2OA4 A;  2Y0M A;  1KU9 A;  2DBB A;  4LG0 A;  2W24 A;  4M9S A;  1I1S A;  4KIG A;  1SFE A;  2IA2 A;  1STZ A;  3F21 A;  5HDK A;  4RAZ A;  1KYW A;  3GZ5 A;  1P4A A;  4ENK A;  2A5Y B;  1O3R A;  3LQQ A;  2XAF A;  2RDP A;  4JK1 X;  1OMI A;  1ZG3 A;  2KJB A;  4A12 A;  3E6D A;  3ZN1 A;  1PP8 F;  3HRS A;  1WKM A;  3HOT A;  3F8F A;  1GXP A;  5LEK A;  4I2O A;  3L2C A;  3E5X A;  1P4W A;  1YIO A;  3QOP A;  4HF2 A;  1HXD A;  1OKR A;  1FSH A;  2VON A;  3DPT A;  3RYP A;  3NEU A;  5E17 F;  2R7F A;  1J0R A;  3BRO A;  3LA2 A;  1J7K A;  4IF4 A;  2HGC A;  3AAF A;  5D5U B;  2QZ8 A;  4BNC A;  4WK8 F;  1RUN A;  5L3E A;  2LNB A;  2V1X A;  1MJA A;  3SQN A;  1OR7 A;  2H27 A;  4QWQ A;  5IT9 Z;  2P6T A;  5ILU A;  3F8N A;  2P5V A;  2EFQ A;  1SD7 A;  1YQA A;  5HLI A;  1T2K A;  2BEO A;  2VBZ A;  2NNN A;  2XHK A;  4EVI A;  5HOO A;  3S2W A;  3TKY A;  3T8T A;  1WRJ A;  3RI4 A;  2P5K A;  4PDK A;  3KET A;  2DI3 A;  3GXO A;  2NRA C;  2MH2 A;  4L9N A;  2B0L A;  2BV6 A;  3ZMZ A;  1FP2 A;  2HYG D;  4UV9 A;  2K02 A;  4M74 A;  2IP2 A;  3FM3 A;  4K2E A;  4YFX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...