4ESBA

Crystal structure of padr-like transcriptional regulator (bc4206) from bacillus cereus strain atcc 14579
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
SQMLKGVLEGCILYIISQEEVYGYELSTKLNKHGFTFVSEGSIYPLLLRMQKEKLIEGTLKASSLGPKRKYYHITDKGLEQLEEFKQSWGMVSTTVNNLLQGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PadR family
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esbA00
1R7JA 1IRGA 3IHUA 4RB1A 3COAC 5HDKA 4OOIA 2D2WA 3TDZC 1MDMB 5AIQA 1KQ0A 5D5VB 6PAXA 1IN5A 3BDDA 4BXUA 1GXQA 1KYWA 1ZLKA 1XGNA 4HF0A 3KETA 5HS7A 2EJRA 2CGPA 2RDPA 2MC3A 3HRUA 3T8TA 1R22A 2KIFA 3FM3A 2GAUA 3FMSA 1B6AA 1S6LA 2Z33A 4A2UA 3VEPA 2HS5A 5HVQC 4LLLA 3F6VA 4GYIA 4EJTA 3GFLA 2IA0A 5HS8A 4RAYA 4RGXA 3R4KA 3SFZA 2IPQX 2DW4A 2VBWA 3FM5A 2J5OA 3QU6A 1SMYF 1FT9A 2MA3A 1X3UA 1REPC 2MH2A 4HX8A 3L09A 3KP4A 4EJVA 1LQ1A 4I01A 2K7LA 1YW9A 3QP6A 3RPUA 4ESBA 3ML6A 1KU9A 5LHIA 3H92A 5FLXZ 1JXSA 2BEOA 2EFQA 2ZO4A 4EM2A 1WQ2A 3GO5A 1R5GA 4Q5SF 1IZ1A 2VONA 1IAWA 2O03A 3EYYA 3I54A 1J59A 4OIOF 4YFXF 3I59B 3SQNA 2EFPA 5HS9A 2QBYA 3TKYA 3E5XA 2ZKZA 3ECOA 3E5UA 3Q9VA 4N9HA 4R79A 3BJOA 1QNTA 1D3YA 4UV9A 1WWXA 1TQMA 4RB2C 3HRSA 1PUEE 3KP6A 4G7ZF 1YTYA 3R6SA 5J6XA 3M8FA 1HW1A 2NAZA 1F9NA 4EM1A 2RV8A 2F2EA 4DQ2A 4FX0A 4K2EA 4P9FA 1O3TA 4MQ9F 4ZYHA 2NS0A 1F4KA 1HW5A 1ON1A 5DCMB 4A12A 4EMSA 3BPXA 3ZQ7A 3HUGA 1TNTA 4KYWA 4ZYDA 4ESJA 1RIOH 2JSCA 5H6QA 4I09A 3R0AA 4UVCA 1I1SA 3K9TA 1G3TA 1MJ9A 4WXHA 5FO5A 3LA7A 4HAMA 1UB9A 4EQQA 2P6TA 4BHPA 4WWCA 2FXAA 2V9VA 2MLKA 2F5FA 4UVAA 2ELHA 1UHMA 2HYFA 3T8RA 1HBXG 1EH7A 3I64A 3I4PA 1D8KA 2VT3A 2E1NA 2QZ8A 1EV7A 1QZZA 4F7ZA 2P8TA 3FMQA 4U0WA 1YW7A 2GZWA 5DD4A 3ERED 1S7OA 3AAFA 4CDGA 4A0ZA 5E1ZB 4JQFA 1STZA 4U0YA 3CDHA 1FP1D 2WTEA 4GO1A 4RAZA 2JPBA 2L4MA 4LLGF 2HQNA 1P2FA 1QPMA 2QQAA 3LWFA 2EA2A 1QZYA 3QU3A 2FSWA 2IA1A 3F8NA 1R1TA 5BPDA 3S2WA 5DEQA 1R5HA 4LK0F 1XN7A 2OU2A 5JFRA 2MLGA 2DLLA 2VOOA 3GZ6A 3WU0A 1SAXA 2KIMA 4FT8A 4UHTA 2PJPA 1ZRDA 3HTSB 3KZYA 1U5TC 3JW4A 4RS8A 3WU1B 1XGSA 2HDCA 1FY7A 2YR2A 4OIPF 2DTRA 5IT3A 4HX4A 1TBXA 4KNYA 3F8BA 3IC7A 3CJNA 3J81K 2M8EA 3ISPA 2EK5A 3KEOA 5A2QK 1YG2A 4HX7A 5F1RA 3G3ZA 4XBFA 1FYLA 1XB4A 1ZGJA 1U8RA 3WE3A 2GXGA 1W5TA 4UNOA 1JGSA 3MZYA 3P9CA 1J7KA 3FZVA 3TOAA 3WE2A 1K78B 3HOTA 1B9NA 2PBIA 2E7WA 3GFMA 4AWXB 5D4RA 3IRRA 1DPUA 1E2XA 4HV5A 1G3SA 3K2ZA 3RIRA 5E20A 1LEAA 1RZ4A 4AVPA 1RUNA 2UXXA 1T98A 2QENA 2ADUA 3L00A 2FBKA 2FEZA 1Y0UA 4RB0A 1H9TA 2EFNA 4ENJA 3BROA 1HXDA 4A0YA 4HZFA 4HV6A 4L0ZB 4ZYEA 5HLGA 3F21A 1IN7A 2XASA 1LDJA 2IW5A 3RKWA 1SFXA 2HZTA 1KU2A 1WSUA 3HIFA 3WTYC 4EJWA 3J80Z 4NHJA 3V8JA 3OOPA 3GW2A 3T5XA 2H94A 3CUQC 3HRMA 1ZYRF 3KP7A 4CO8A 1A04A 2M30A 3TDUC 4EGZA 3DXJF 2EV5A 2JT1A 2O0YA 3C3WA 4UUVA 3C18A 2GA1A 2LSOA 1HSTA 4IRIA 4QLCU 1S7AA 2LF7A 3DQVC 2XAGA 3E97A 2ZMEA 4YIFA 2G7UA 1SFUA 3ZMVA 4AIKA 2STWA 3RJPA 5D5WB 2FBIA 2K27A 3RTRA 4EJUA 1BI1A 2O8XA 1OYYA 2ESNA 2ETHA 1P92A 3T1BA 2QVOA 3QPHA 3KFWX 1BN5A 2CG4A 2HEOA 1Z6TA 3WTZA 4M9XA 2RN7A 3DPLC 3O2PE 4O6JA 2UZKA 1B1BA 5IT9K 1IN6A 2XRNA 2BV6A 5KVRA 1OR7A 4L5JA 3O3KA 5D4SA 1G3WA 4H0EA 2HR3A 1F5TA 4LJZF 3RDIA 2IVMA 4KDPA 2BE5F 2BGCA 3GZ5A 2O3FA 4L9VA 5FFZA 2MH9A 1LEBA 2OAZA 2UXNA 1W7PA 4OU0A 4HQMA 2XVCA 4HDUA 4NQWA 3EETA 4E70A 1D5VA 1FBUA 3RPQA 2K86A 3SHFA 4AD9A 1LDKB 4LB5A 3F22A 3TGNA 3GFJA 4ASNA 3FXRA 4MNUA 2P6SA 3K1MA 1ZGAA 1T6SA 2EB7A 2M87A 4WX9A 4XRFA 5CLSA 5F6FA 4EVIA 2WV0A 4CGZA 3W6JB 5K1YA 3DV8A 2W24A 4GXOA 2NNYA 2QLZA 1BI3A 4JK1X 2H6BA 4IF4A 5L3DA 1KQ8A 4BAYA 3F8CA 2VBYA 3K1PA 2RGVA 3ZN1A 2RC4A 4MTEA 4PZJA 4PDKA 2DK8A 5HLIA 4UXNA 5EEHA 1FBQA 2P5KA 2NNNA 2DPDA 2H27A 3ZMDA 4CYDA 2WWYA 2EFWA 2D45A 4MTDA 2A6HF 3F72A 3MEXA 1BIBA 1O57A 4KMFA 2RKHA 5AIPA 3M8EA 2HTJA 2XGXA 1ZRCA 1ZG1A 2C6YA 3RKXA 2KRFA 4DNCA 3LAJA 5F64A 3SZPA 3R60A 2M1BA 4OINF 4Y15A 4HYEA 5K5RA 3PQKA 4Q4ZF 1EH8A 5CVIA 5TRDA 3HSRA 1CF7B 3ZMUA 2X4HA 1QO0D 4OIQF 5BMZA 5DUKA 3K1NA 2A69F 1FYMA 3ECHA 1AWCA 4M9ZA 3F23A 1LNWA 4MEXF 1LJ9A 1O3QA 4KIBA 4I2OA 2XAJA 2XAQA 1ON2A 4KIGA 1VTNC 4A6EA 1XSXA 1FX7A 3KLNA 5HDGA 2OD5A 4IPAA 2JTVA 4WCGA 2ZBKA 3WGGA 3JSOA 3F6OA 3BWGA 5H20A 3D0SA 3FWEA 1Z05A 5EEGA 4N9IA 1U5TA 2V6CA 4LMYA 3BY6A 3CLOA 2DQLA 4O5VA 4G8XA 4I0AA 2PN6A 1H0MA 1FNNA 3QRFF 1V3FA 1IW7F 3VODA 1ZN2A 2FMYA 1SD7A 3L2CA 4HBLA 3KE2A 5JHUA 2TDXA 3SZTA 1I6XA 2ZXJA 1RI7A 2EV6A 4LFUA 3WTWC 2FNPA 3RKYA 1IN8A 5LGNA 3LFKA 2L54A 5ICCA 3K0LA 3WGIA 3WTVC 1FC3A 4KN4X 4Y13A 4HOBA 3IKVA 3I0TA 2VT2A 4ZYGA 2W84A 2DQRA 1LB2A 2A5YB 4A6DA 2Z5UA 2V1DA 5LEJA 4M73A 2RQPA 4M71A 1R36A 2EWNA 1L0OC 1SD4A 1ZG3A 5E8IA 3ABUA 3V7RA 1TNSA 1G4DA 3FXUA 4Q48A 2PQ8A 4L18B 5DUIA 3E6DA 3V7SA 1BC7C 5CVUA 1O3RA 1PP8F 4CHUA 2G9WA 1UHWA 3DKWA 3GUDA 1QGPA 5LBQA 4P96A 3J81Z 4KMUX 5E1WA 2QBYB 3CUQA 3OV8A 4IVNA 2P4WA 2FA5A 4BNCA 3P9IA 3V8KA 3W6KB 4A5NA 1B9MA 1ULYA 3SXYA 1OKRA 4YFKF 1XCVA 5BQTA 2B0LA 3ZMTA 4D0PA 5LGUA 1ZHFA 1XDUA 1O7FA 2MBFA 2UWMA 3CTAA 4BH9A 1DPRA 1BI0A 4A0XA 3MAJA 1G3YA 1GVJA 5KK1A 1YLFA 2W85A 1HKQA 4I0BA 2A61A 3LAPA 3LA2A 3TQNA 3BPVA 3Q9SA 5D8KB 3L7WA 3WTSC 1BC8C 4I7HA 3HRTA 2V1XA 5CVVA 4OMYA 1U2WA 2FNAA 2DO7A 3M1EA 2DBBA 3FXQA 1T2KA 1SFEA 3I58A 2G7HA 2FE3A 2IP2A 2M5WA 1P4WA 1XSDA 5LHHA 1BM9A 4LB6B 2PEXA 4M9SA 2HKXA 2PMUA 3U1DA 2XAHA 1KQ9A 4HF1A 2RVCA 1UCRA 2XKPA 1Z91A 3JTGA 3MZHA 2D1VA 3FHZA 3HHGA 1FZPB 1IN4A 1USSA 4GCVA 1I1GA 3TO6A 2Y48A 3VFZA 4YFNF 1S8NA 1IXCA 3F3XA 4BYYA 1QQIA 3GLXA 3WTUC 1HKTA 2WC2A 3DF8A 3IKTA 2GQQA 4B8XA 5IT9Z 1B4AA 2KJBA 2YU3A 2EV0A 1KYZA 2R3SA 3JSPA 5JI6A 3U9GA 1ONVA 4OIRF 1MJBA 2DAOA 2ZNYA 4L9JA 3PQJA 2BBYA 2HWVA 5DCFA 2Y75A 1J75A 3BOQA 4LG0A 3E6CC 5E8GA 1ZARA 5FD6A 1ZREA 1KU3A 4Q47A 1FOKA 3NQOA 4S04A 4G7HF 4RGUA 3HOSA 2HGCA 1K6OA 4U0VA 2Z3YA 1GHCA 3QP5A 4MEYF 3WODF 5L3FA 2H09A 3QPTA 3ZMZA 4HDVA 3IRQA 2FBHA 1YYVA 2A3SA 1Z7UA 3TO9A 4ETSA 3CO6C 1TLHB 5LGTA 4RGSA 2ZCWA 3PFIA 2PI0A 5HOOA 4IHSA 2OQGA 3G73A 2KJCA 3LA3A 4P55A 3DP7A 1YQAA 1ZRFA 3VOEA 3GVAA 1I27A 5BOXA 1MDMA 5AONA 3ABTA 4MQVA 4GGGA 4IJAA 1FSHA 4IXAA 3E6MA 3ZP5A 1SD6A 3KP3A 2CWEA 2ZMEB 3DFGA 4U7BA 3F8FA 1AOYA 2JRTA 4YG2F 1TTYA 2PMHA 4KIFA 1J0RA 4XSZF 1Z6RA 2GWRA 1P4AA 1R23A 1IF1A 2JZYA 4HLYA 4RGRA 2GXBA 1BI2A 4XLNF 1GXPA 2VBXA 1J2XA 3WTXC 1IXSB 4CZZA 3KCCA 3ZPLA 2FF4A 2GA2A 1D8JA 3HTUA 3BZ6A 2F5CA 4A5MA 1YIOA 4U7DA 2A6EF 4LD5A 1XD7A 1WI9A 3DPTA 3GX4X 3RYRA 2Y0MA 2DU9A 3L9FA 5D8LB 1FPQA 3RI4A 3JAMK 3REOA 1B59A 1WKMA 5BPIA 4KUMA 3I59A 1S29A 1FBSA 3HYIA 2H6CA 2RNJA 5BS6A 2LKPA 2XIGA 1W7PB 2IRFG 3M7GA 5DDGA 2DK5A 1O7LA 3KLOA 3F8MA 2DI3A 5ICFA 3M9AA 4KN7X 3JTHA 3N97A 1IUYA 4WXCA 5L3GA 5LRSA 5K5QA 5DYMA 4ENMA 1S3JA 1JHFA 2D1HA 2HQRA 3R0JA 2VC0A 5DCMA 4XSXF 2JPCA 1R1VA 3H3UA 1P4XA 2HOEA 5LHGA 2A07F 2YX4A 3FMRA 4FX4A 2IJLA 5L3BA 1IXRC 1DP7P 2VBZA 3MFKA 1YW8A 1YS6A 4HQEA 2ZNZA 4HW0A 4M6XA 3KP5A 1T0FA 2QM3A 4N0BA 2ACJA 3EYIA 2OZ6A 3NRVA 3HSEA 4KT5C 2ZJ2A 2QQBA 5H6RA 1BJAA 1FLIA 2W57A 4M74A 3ZMSA 2P7CB 1XDSA 2YPRA 4IRHA 3R61A 4XLPF 2PLYA 3FX3A 2K4JA 2E7XA 3MQ0A 4ZH4F 5K5OA 2AXLA 4CXFA 5D6FA 4EGYA 2IT0A 2P5LC 1ZG5A 2J5PA 3V8LA 2QWWA 1USTA 1K7AA 2VODA 5D5UB 4IRGA 4O3MA 3J7AO 5FD5A 5ED4A 3V7CA 1OYWA 4UV8A 2QYOA 3ELKA 1H9GA 1RUOA 5JVTA 5FLXK 1XGOA 2R7DA 3E5QA 3Q5FA 3MCZA 5CJ9A 1FSEA 5FB2A 3GXOA 1U6GA 1FYKA 1MZBA 2KIUA 2P7VB 3GWZA 1DDNA 3LQQA 5CVRA 4HF2A 4HA8A 2LNBA 2STTA 1U5TB 4U88A 3C7JA 2YX7A 4HLXA 5A2QZ 2VOPA 4TV7A 3ROUA 5CYVA 4BQAA 4ZZDA 1U3EM 1U78A 1XCBA 1HW2A 1TW3A 5LLQA 1P6RA 1K78A 2R7FA 3P9KA 1IRFA 1F1ZA 4KICA 3EDPA 1JE8A 1WRJA 2DPUA 2OA4A 3N4MA 4G6DA 3O6BB 4L9TA 2Z99A 5D5XB 4L9NA 5LRRA 2IA2A 4P5OA 4UVBA 2CQKA 1MKMA 5JR3A 2GIVA 4NB5A 1L3LA 5D6EA 1W7PD 4G7OF 2XROA 3HSFA 1TQPA 4MHGA 5E18F 3T0YA 4G6QA 4BHBA 1ZLJA 2HYGD 2ISYA 5E1XA 5L3CA 1YO5C 1HKSA 3WTTC 2XUBA 2X0LA 1W5SA 3C1DA 4YIIA 1QBJA 4L5IA 1O3SA 1LDDA 3VB2A 4WF2A 2CFXA 3P7NA 3LQRA 3FF5A 1NHAA 5LEKA 1OPCA 2COMA 2O61A 2VE9A 2W25A 3CUQB 3NEUA 5ERIA 4B09A 5L3EA 2QUFA 2ESHA 2BYVE 1FP2A 3TO7A 5TJJA 3I5UA 1HSJA 1ZH5A 1R1UA 3IL2A 1LVAA 2A68F 2CO5A 2HFHA 3U2RA 2ZFWA 3H3ZA 4AIJA 4G94A 4M6YA 1T39A 5HLHA 2VN2A 2L4AA 2V79A 4AIHA 1OMIA 4P9UA 1JHHA 2AS5F 3KZZA 3HHHA 2Z9OA 3GEZA 3KEQA 1E17A 3EUHA 4M72A 1FWZA 4ENKA 3CO7C 1MD0A 4Z2YA 5J8FA 2KKOA 2NRAC 3EQLF 4CICA 5ILVA 4PGGA 2LDUA 5HDNA 2VXZA 2M45A 2XHKA 2VE8A 3ZN0A 1KU7A 4LLNA 1CGPA 4R1HA 3BJ6A 3CUOA 4GYGA 1TQIA 1MGTA 2Q2EA 2V1UA 5J8CA 4ON0A 4BHCA 3QAHA 5DD8A 2DFIA 1UFMA 4IHTA 2PG4A 2XV4S 3IWFA 2Q0OA 4ENNA 3TOBA 2EA4A 1YFHA 2FOKA 4PCQA 3B02A 3E3VA 2F5EA 3LSTA 5ILUA 4OMZA 1I5ZA 4JBAA 3WGHA 4PGHA 4EV0A 1R00A 1Z9CA 2FQ3A 1MJAA 3V4GA 4KFCA 1C0WA 2E1CA 5DV5A 1T38A 3GF2A 3E6BA 3WG9A 4L0YB 4I98B 3IWZA 3I71A 5ICGA 1PP7U 3BP8A 1EH6A 3ULQB 4FHTA 2L3DA 4ZZLA 2ISZA 4EJOA 1PDNC 1KA8A 4EM0B 2CSOA 1XGMA 2YSRA 5CVJA 3K69A 2K4BA 3J80K 1J9IA 2FRHA 3BJAA 2HTSA 4R8HA 1XMKA 1ODDA 5FGMA 4RB3C 2L01A 5ICEA 5ILSA 2OZUA 1SMTA 1G6NA 3GFIA 1W4MA 3JAMZ 4QWQA 2O6GE 4WK8F 4G9YA 1RNLA 2F5DA 1V4RA 2CW0F 3B73A 1YS7A 2Q8KA 4KA4A 3MWMA 2OBPA 1KGSA 2OQRA 4WXDA 4ESFA 1HQCA 4MGRA 2P5VA 4Y17A 2MD5A 2XAFA 4LGWA 1XMAA 4LG0B 4S05A 1OYIA 1K79A 2QQ9A 3GYHX 2VC1A 1TW2A 2EFOA 3KP2A 2CYYA 1BOAA 3DEUA 4I02A 1CF7A 2L02A 1XSVA 1R58A 2DT5A 3I53A 1BIAA 2PFBA 2HKOA 1J5YA 2K02A 3QOPA 2FU4A 2LF8A 1BBYA 5FFXA 2NYXA 2XKOA 1ZAOA 3D5LA 3RYPA 4LK1F 5E17F 1DUXC 1Z1DA 1SD5A 1Q1HA 2FMLA
chains in the Genus database with same CATH superfamily
3FXKA 2XAUA 1R7JA 1IRGA 3IHUA 4C3HJ 3GBGA 1APLC 4RB1A 3COAC 1ORKA 5HDKA 4IZZA 4OOIA 2D2WA 4BS9A 3SDBA 3CCVI 2XSJC 3TDZC 3W2VA 1MDMB 5AIQA 2VASA 3HC7A 1OCTC 1KQ0A 5D5VB 6PAXA 2DCEA 1IN5A 3BDDA 1A6QA 4CCMA 1MNDA 4BXUA 1GXQA 1KYWA 4J00A 1ZLKA 1XGNA 4HF0A 1OLTA 2W1OA 3KETA 1QZEA 3A4CA 5HS7A 2EJRA 2CGPA 2RDPA 3LSPA 2MC3A 1FEXA 2WY7Q 3HRUA 3X2QH 3L2RA 3S93A 2R5YA 5GAGJ 3T8TA 2VIXA 1R22A 2DOFA 2KIFA 3FM3A 2GAUA 3TMOA 3FMSA 1B6AA 1S6LA 3HL2A 1ZK8A 2Z33A 4LIVA 4A2UA 2M9HA 3PUBA 3VEPA 2JWTA 4XM3A 1G2HA 2HS5A 1DQUA 4PJNA 5HVQC 2BOLA 3FKIJ 4LLLA 3F6VA 3S32A 2L9RA 4GYIA 2R7XA 1JUSA 3L2VA 3SEZA 4HRIA 3G1OA 4EJTA 3GFLA 3KPHA 4E7KA 5KHDA 2IA0A 5HS8A 1OFCX 4RAYA 3VYTB 2ECBA 4RGXA 3R4KA 3SFZA 2IPQX 2DW4A 2VBWA 3OYFA 2L5QA 4NUBA 3FM5A 2VPRA 2J5OA 3QU6A 1SMYF 4HNTA 1YITI 1FT9A 2MA3A 1X3UA 1REPC 2MH2A 4HX8A 3L09A 3KP4A 4EJVA 1LQ1A 2JK3A 4A69C 4I01A 2K7LA 1YW9A 3QP6A 3RPUA 4ESBA 3ML6A 1KU9A 5LHIA 3H92A 3OIOA 3JRFA 4MFEA 5FLXZ 4CYCB 1JXSA 2BEOA 3ZQQA 3BG5A 1LE8B 4F3QA 2EFQA 1YX5A 2ZO4A 1QPIA 1OJLA 4EM2A 1WQ2A 3GO5A 1R5GA 3BG3A 1IZ1A 4ZC3A 4Z6YA 1YHQI 1IAWA 2O03A 2VONA 3B6CA 4C30A 3EYYA 3I54A 5EEAA 1J59A 4OIOF 1X3ZB 5EF6A 4YFXF 2K85A 3ESWB 4HEA2 3I59B 5GAEJ 4XRSA 3SQNA 2EFPA 2FUG2 3JRGA 5HS9A 2QBYA 3TKYA 3E5XA 2ZKZA 3ECOA 3E5UA 3G1LA 3Q9VA 4N9HA 3BJOA 4R79A 3OYAA 1RKWA 1QNTA 1HLVA 4PJMA 1D3YA 2Y30A 4UV9A 2K9SA 1WWXA 1A6IA 1TQMA 4RB2C 3CCYA 5F0CA 3K4JA 3HRSA 3CF5F 2VI6A 1PUEE 1GDTA 3KP6A 3JR9A 4G7ZF 3BR3A 1YTYA 5B5EC 4XICA 5HODA 2XF5A 2FQ4A 1R49A 2M4KA 3R6SA 5J6XA 3M8FA 1RKTA 2V9KA 1HW1A 2VB6A 2NAZA 1WFXA 1F9NA 4EM1A 1D1AA 2W7NA 2RV8A 3HDDA 2F2EA 4DQ2A 4FX0A 2CQQA 4K2EA 4P9FA 3I3LA 1U9OA 4C3IJ 2R7RA 1BR1A 2EH3A 4MQ9F 1O3TA 2V6EA 4ZYHA 1VQ5I 2DT7B 2NS0A 1F4KA 5EGOA 1HW5A 4E6KG 1ON1A 5DCMB 4A12A 4GDFA 2XPUA 4EMSA 3I56I 3TEDA 3BPXA 3ZQ7A 3HUGA 3S16J 4BXFA 1TNTA 2L9NA 4MFDA 1VQ4I 4KYWA 4ZYDA 2R7OA 1JKQC 4ESJA 1RIOH 2JSCA 5H6QA 4I09A 2JJ7A 2VQHA 2M2EA 3R0AA 2LY1A 2DJIA 4UVCA 1I1SA 2XC7A 1JKRC 1ZR4A 3K9TA 3OSFA 1ETOA 1G3TA 1MJ9A 4WXHA 1QA6A 4JX6A 5FO5A 3KZIC 2ZSIB 1JT0A 1X1BA 1MMDA 5EJCA 3LA7A 2CJJA 4DBRA 4HAMA 4DYQA 5IY5H 1UB9A 4YRVA 3ABLH 4EQQA 2P6TA 4BHPA 3GMEA 3A0HC 4WWCA 3NWTA 2FXAA 1Z3XA 2EQRA 2V9VA 2MLKA 2R0QC 2F5FA 2DOAA 1TT5B 4UVAA 1ZKGA 2ELHA 2PX9A 3M8JA 4XLEA 1UHMA 2HYFA 2VLAA 3T8RA 1HBXG 1EH7A 2ZC2A 4XOPA 1T95A 4IEJA 3I64A 5CQGA 2ICWG 2KZVA 3I4PA 1UELB 4I6ZA 3I4NJ 1D8KA 2JSPA 2R7WA 1Z0XA 2VT3A 2E1NA 2QZ8A 1EV7A 1QZZA 2P8TA 3FMQA 4F7ZA 2H1KA 4U0WA 1YW7A 4XKWA 2GZWA 5DD4A 3ERED 1LVKA 1S7OA 2BXYA 2QF7A 3AAFA 2W4SA 4CDGA 4A0ZA 5E1ZB 4JQFA 5GPCA 3TL4X 3HOXJ 3BG7A 1STZA 1MBKA 1R6RA 2V9PA 4U0YA 1VNDA 3OS0A 1HDDC 3CDHA 3OYIA 1FP1D 2WTEA 4FQGA 1EJ9A 2UUZA 4DBQA 1YJWI 4GO1A 3E1SA 2JPBA 2L4MA 4RAZA 4XR6A 4LLGF 2HQNA 2K9MA 3BTLA 1P2FA 2LBFA 1QPMA 2QQAA 3BTCA 3LWFA 1OQYA 2EA2A 2IGMA 1QZYA 2GM4A 2MYSA 3BR5A 3QU3A 2FSWA 5J1UA 2IA1A 3F8NA 1R1TA 1GV2A 3CJTB 5BPDA 3S2WA 4C2UA 5DEQA 1R5HA 4A3JJ 1M1EB 2QEXI 1BA5A 4LK0F 1XN7A 2OU2A 5JFRA 2MLGA 2DLLA 2F48A 2QKLB 3GZ6A 2VOOA 2W82A 3WU0A 1SAXA 2KIMA 1B8IA 4FT8A 3HOYJ 4UHTA 2PJPA 3M1CA 2BY2A 3O8GA 1X2MA 1XG1A 4II3A 2LKXA 1ZRDA 3HTSB 3KZYA 4A3LJ 2VQLA 2VJIA 5J47A 3BG9A 1WI3A 1U5TC 4JP0A 3JW4A 4RS8A 3WU1B 1XGSA 1F43A 2HDCA 2O9LA 1FY7A 2YR2A 3L2UA 1BR4A 3LOCA 2DTRA 5IT3A 4OIPF 4HX4A 1W36C 1TBXA 2CUJA 4KNYA 2ZXIA 3JRHA 3KYCB 3F8BA 3IC7A 3CJNA 3K4KA 4DJAA 3J81K 2M8EA 3ISPA 2EK5A 3KEOA 5A2QK 2HOTA 1YG2A 4II2A 4HX7A 4D1QA 5F1RA 2W00A 1AU7A 3G3ZA 2WAQN 1SAUA 4XBFA 5J1YA 1FYLA 5IYDJ 1D1BA 1XB4A 1ZGJA 2EINH 1JGGA 1U8RA 1GUUA 3EUAA 5FJ8J 2OCEA 3WE3A 1V54H 2GXGA 1W5TA 4UNOA 2OCCH 1VFCA 1TC3C 4XQFA 1JGSA 3MZYA 4Y33A 4Q5SF 3P9CA 1J7KA 1P9QC 3FZVA 3TOAA 3WE2A 1U8BA 1K78B 1WHUA 1HCRA 3DKXA 2A6TA 3HOTA 1B9NA 2PBIA 2E7WA 3GFMA 4AWXB 3JRDA 1RR8C 4QIWN 4GFBA 5D4RA 3IRRA 3QPLA 1ZR2A 1WVRA 1DPUA 1E2XA 3SDGA 2ZSHB 4HV5A 2MGQA 4ANJA 4FE4A 1G3SA 3K2ZA 3RIRA 5E20A 3OYCA 2HVSA 2E34A 4XK4A 2E60A 1LEAA 1RZ4A 1JTXA 4AVPA 1RUNA 5J4YA 4XN0A 3O8HA 1E0EA 2UXXA 1T98A 2QENA 2ADUA 3L00A 2FBKA 2FEZA 4YEJA 5FRMA 3NAUA 3ZR8X 1Y0UA 2XF7A 4RB0A 4KITB 3IP4B 1H9TA 2HZDA 2LOOA 4DOZA 2EFNA 2YS9A 1I3QJ 4ENJA 3BROA 1K4SA 1HXDA 4RLQA 1TZLA 4A0YA 4HZFA 4HV6A 4DZJA 2LVSA 4L0ZB 4ZYEA 2KRCA 2HDWA 5HLGA 4BE1A 3F21A 3V42A 1IN7A 2XASA 1LDJA 5EG0A 3CC7I 2IW5A 4UUSA 2HQ5A 1MBGA 3RKWA 1YRNA 1SFXA 2HZTA 3BZCA 1KU2A 1WSUA 3L2WA 3DPUA 3HIFA 3UNGC 3WTYC 1UAAA 4EJWA 3J80Z 4NHJA 3V8JA 3OOPA 2XRLA 4HPQA 3GW2A 3T5XA 1XX5A 4JYKA 2H94A 3SZGA 3K70C 2L9VA 3CUQC 3HRMA 3ERMA 1ZYRF 3KP7A 2E2IJ 2BHZA 3E0JB 1GV5A 4CO8A 2CUEA 3FDYA 4UB6C 1SANA 4OAYA 2FX0A 3CCUI 1A04A 2M30A 3TDUC 4BJ6C 3LSMA 2R5ZA 3RKQA 4EGZA 3DXJF 3KX2A 2OV7A 2EV5A 3GTGJ 5BNGA 2JT1A 3MKLA 1B72B 1TWGJ 2O0YA 3C3WA 2BVMA 4UUVA 3C18A 2GA1A 4BBRJ 2Z1DA 1X4PA 2LSOA 1HSTA 4IRIA 3TBIA 3CCEI 4QLCU 1S7AA 2LF7A 2CUFA 2LR8A 2XAGA 3DQVC 3E97A 2MSYA 2ZMEA 3CC2I 4YIFA 4G6TB 2G7UA 3HKZN 3OYGA 1SFUA 3ZMVA 4AIKA 4F55A 2VPLA 1IV8A 3CJRB 2STWA 4XKBA 3RJPA 2L9SA 2M7BA 3OYKA 2GOXB 2BHYA 5D5WB 1PUFB 2FBIA 3I4MJ 2Y9ZA 5K7ZA 1W0TA 2K27A 2R7ZJ 2H8RA 1XS9A 3BZKA 3D5SC 4PJ0C 3RTRA 3PUFA 4EJUA 1BI1A 3QPSA 2O8XA 1NH3A 2X6YA 2I10A 1OYYA 4XN3A 2ESNA 1IGNA 1OISA 2ETHA 1P92A 2IGNA 1S7EA 3T1BA 4B1RA 2QVOA 3MZ8A 2M0MA 5EZHA 1LKXA 3QPHA 3VWBA 3KFWX 1T33A 2DODA 3VSKA 5IYCJ 3H9QA 1BN5A 3OMYA 4CCKA 2GIZA 3M3YJ 1G59A 2CG4A 2XB5A 4IL6C 2EILH 3PO2J 2HEOA 4M3EA 3A01A 2DXIA 1FOXA 5KNLA 1Z6TA 1ENHA 3WTZA 4M9XA 2KMUA 2RN7A 3ZQHA 1Y8RB 1Z77A 1A31A 2O8KA 2KPMA 1IO2A 2QQ8A 3DPLC 1W0UA 4JOMA 1EKEA 3F0CA 3O2PE 1SFOJ 2JVHA 4O6JA 2V7FA 2VJJA 4XLAA 2UZKA 5KAIC 1ETKA 1B1BA 3EUKL 3GCMA 5IT9K 1IN6A 3DU5A 2A05A 1YRNB 2XRNA 2BV6A 5KVRA 1OR7A 1QRYA 2Q1ZB 3HGYA 4L5JA 3O3KA 5D4SA 2P81A 2DMNA 1G3WA 2Q2EB 5J1RA 2DA1A 4H0EA 2HR3A 4E7ZA 2DMTA 1F5TA 4LJZF 3RDIA 1I50J 2IVMA 4KDPA 2BE5F 2BGCA 1I6HJ 2MD0A 3GZ5A 2O3FA 4L9VA 4BE2A 2JRMA 5FFZA 5KCMA 2MH9A 1LEBA 1AA7A 2OAZA 2UXNA 3FIWA 1PJRA 1W7PA 1U9NA 4OU0A 4HQMA 2FD5A 5FKOA 2XVCA 3FHNA 4HDUA 4NQWA 3EETA 2PMZA 4CA0A 5GTIC 4E70A 1D5VA 1FBUA 2BY3A 3RPQA 1V5EA 2K86A 4BY7J 3SHFA 3JREA 4AD9A 1LDKB 4LB5A 2JA2A 1ETVA 3F22A 2F6CA 3TGNA 3GFJA 4ASNA 3FXRA 4MNUA 3WU2C 3OYMA 1FMVA 2P6SA 5F27A 1WJAA 3K1MA 3OWTA 1ZGAA 1BW6A 1T6SA 3CMYA 2RREA 2EB7A 2M87A 4WX9A 1WJ5A 2N8GA 3C2GA 4XRFA 5CLSA 5F6FA 4EVIA 2WV0A 2VQGA 4CGZA 2ECCA 3W6JB 3GLLA 2HVQA 3DV8A 2ID3A 5K1YA 2W24A 4GXOA 1IRZA 2NNYA 5CQEA 2QLZA 2LG4A 3FBNB 1ETQA 1BI3A 4JK1X 1RR7A 2XDVA 1SVLA 2Y2ZA 5IPAA 2H6BA 3GTLJ 4IF4A 4IKFA 2QGUA 5L3DA 1KQ8A 4BAYA 1V5GA 3F8CA 5KAFC 4IHYA 3J7ZI 2VBYA 3K1PA 2L7KA 2RGVA 3ZN1A 4AYBA 3A01B 2RC4A 2CV1A 4MTEA 4DW6A 1O4XA 4PZJA 2DN0A 2WBMA 3GTMJ 1JJ8C 3OOUA 3C2HA 2E36A 3EPZA 1HDPA 4PDKA 3ZGKA 3LNQA 2DK8A 5HLIA 2CMPA 4UXNA 5B1AH 1QHHD 3HJEA 5EEHA 4LIUA 2FJ1A 1I39A 3I55I 2XB0X 1Z3YA 4IOCF 1FBQA 2P5KA 4PSXA 1ETWA 1R5ID 1SVOA 2NNNA 2DPDA 2H27A 3ZMDA 4CYDA 2WWYA 4BBSJ 2EFWA 2ZMEC 4E7IA 3OIQA 2BY1A 2D45A 4BJ5C 4MTDA 4Y4RA 2A6HF 3F72A 3MEXA 1BIBA 1TL8A 1O57A 2ME0A 1UMQA 5M3MJ 2CQXA 4KMFA 2R7QA 2RKHA 4N4NB 5AIPA 3M8EA 2HTJA 2XGXA 1ZRCA 2KRHA 3OR2C 4I76A 4HNVA 1ZG1A 2IXSA 2QCOA 3K2AA 4BJTA 4BE0A 1WJFA 3ZQLA 3K4CA 1S72I 2C6YA 3RKXA 2Z16A 2I5UA 2KRFA 1NK3P 4NC6A 3A2KA 3OYHA 3G6EI 3JRAA 4DNCA 3LAJA 5F64A 3SZPA 5E79C 2HQAA 3BR6A 1K4TA 2M3AA 3TP3A 2DA4A 4EATA 3R60A 5C3EJ 2M1BA 3CDIA 4OINF 4Y15A 3CP2A 4HYEA 4GRIA 5K5RA 2DOEA 1X1DA 2HYJA 3PQKA 5GPAA 4Q4ZF 1EH8A 5CVIA 4KT6A 2I8DA 5TRDA 3HSRA 4L5EA 1IDYA 4Y52J 1CF7B 3ZMUA 2X4HA 3H5RA 1QO0D 2X6WA 4OIQF 1Q1VA 2JA5J 1MMNA 5BMZA 5DUKA 5FLVA 3K1NA 2A69F 3MN2A 4LITA 1FYMA 3ECHA 1AWCA 3RZOJ 4M9ZA 3F23A 1LNWA 4EEFG 1OR7C 2E2JJ 4MEXF 1LJ9A 4QPQA 4E4HA 1O3QA 2GXAA 4UY8I 4KIBA 4I2OA 2XAJA 2XAQA 3LL7A 1ON2A 3NARA 4KIGA 1VTNC 4A6EA 1XSXA 1FX7A 3KLNA 5HDGA 4BEHA 3A1YA 2OD5A 2JN6A 4IPAA 4PFPA 2JTVA 4WCGA 1RRJA 3K10A 3K4LA 3OYNA 2ZBKA 3WGGA 3JSOA 3F6OA 3BWGA 5H20A 3D0SA 1XPXA 2BZTA 3FWEA 1Z05A 1OCCH 4U87A 5EEGA 4N9IA 1U5TA 2V6CA 4NNJA 4DIQA 3KIOA 4FETA 4LMYA 3BY6A 3CLOA 2DQLA 4O5VA 4G8XA 4I0AA 2PN6A 2HVRA 4S0HB 1H0MA 1FNNA 3CZ6A 4MIMA 3QRFF 3IH3A 1V3FA 3HOZJ 1X3WB 2RNGA 1IW7F 1XMXA 1Z7LA 3VODA 5F08A 1ZN2A 2FMYA 1W5CC 2DMQA 2BVLA 2NVYJ 1Y1WJ 1SD7A 3L2CA 3IUOA 2IS2A 4HBLA 3KE2A 2PJRA 2WY8Q 5JHUA 1GT0C 2LREA 2TDXA 1X1PA 3SZTA 1DGWY 1I6XA 2R5YB 2ZXJA 1RI7A 2EV6A 1Y39A 2E1OA 4LFUA 5IP9J 3WTWC 4DYCA 2FNPA 3RKYA 3H5NA 1IN8A 3JCUC 5LGNA 5FRNA 1VI0A 5TISC 4XMYA 3LFKA 4M3GA 2L54A 5ICCA 1ZTRA 3K0LA 3WGIA 3KYDB 4XLCA 5B3SH 3WTVC 1FC3A 3CF2A 4KN4X 4M3BA 3MVPA 3OL4A 4XORA 4Y13A 4HOBA 3IKVA 3I0TA 1WH7A 3AL0C 3FK7A 1TP4A 2VT2A 1XTAA 2W84A 4ZYGA 2LYCA 2DQRA 2KQRA 1LB2A 1FOYA 1E3HA 2A5YB 3J7YJ 3FK6A 3G4SI 4A6DA 4ZJZA 2Z5UA 3BQYA 3QOEA 5E3OA 2V1DA 5LEJA 4M73A 2RQPA 2H1LA 2R7SA 4M71A 1R36A 2EWNA 1AKHA 1L0OC 3AG1H 1SD4A 1ZG3A 2QSHX 2HOAA 5E8IA 3ABUA 3V7RA 4CH7A 4A3MJ 1G8XA 1TNSA 2R93J 2EIJH 3FXUA 1G4DA 2XGCA 4Q48A 1IDZA 2Y31A 2PQ8A 3QWLA 4L18B 5DUIA 3E6DA 3H5AA 1BJZA 1SFKA 4PK4A 3V7SA 1BC7C 1A35A 5CVUA 1O3RA 1PP8F 4CHUA 2G9WA 1UHWA 3DKWA 3GUDA 1MH4A 5GADJ 1QGPA 3A03A 5LBQA 4P96A 3AKZA 3A02A 4ZDOA 4E7HA 2FOWA 4AUXA 2EBIA 3J81Z 4KMUX 5E1WA 2QBYB 3CC4I 3CUQA 3OV8A 4IVNA 2P4WA 1JKPC 1MW7A 4CCJA 3KYLA 4HSRA 3HBLA 1A36A 2FA5A 2HXOA 4BNCA 2IBDA 3HOVJ 3P9IA 3PSFA 2X6OA 3V8KA 3AFHA 3W6KB 5HNHA 1H88C 4PJJA 1WGXA 2VKVA 3TW6A 5E3MA 5CPRB 4A5NA 2K3PA 3SJMA 2D5VA 3DTKA 1MBHA 1X19A 1B9MA 4V2FA 1ULYA 3BQZA 2DTZA 3SXYA 1OKRA 4YFKF 4RBOA 1LUJB 1XCVA 5BQTA 3HM5A 4CCLA 3MD2A 1VQ6I 2B0LA 4BKXA 4J01A 3DCFA 2XPWA 3DBRB 3ZMTA 3VSLA 4CUGA 2NXNB 4D0PA 5LGUA 1ACIA 5EGOB 1ZHFA 1KZHA 1XDUA 1WJEA 9ANTA 5F04A 2CFOA 1O7FA 2MBFA 2Y9YA 3VPRA 3HUGB 3WHBA 2OUMA 5E3NA 4M3FA 5K7HA 3BTJA 1W1WE 2UWMA 2KZGA 1N25A 3PO3J 3CTAA 4BH9A 3PFYA 4RAGA 1DPRA 3OY9A 1BI0A 4A0XA 1ZGWA 3MKZA 3MAJA 1G3YA 1GVJA 2XSDC 2ZFUA 3OSGA 2ZXHA 5KK1A 1YLFA 1VQ9I 2BY0A 2ZXWH 4F91B 3PIPF 3HZJA 2W85A 5DTDA 3HOWJ 1HKQA 4I0BA 1YIJI 2X9DA 2A61A 3LAPA 2M8GX 3LA2A 2E5NA 5EZGA 3MKWB 2Y0SA 3K6GA 3TQNA 4C2MJ 4CCOA 1X1CA 5J4VA 2WAEA 3BPVA 3OYDA 3H35A 3Q9SA 5D8KB 3L7WA 3WTSC 3JRCA 5CKTA 1BC8C 3GTKJ 3DKYA 4I7HA 3ZXSA 4E7JA 4B3XA 3HRTA 3Q0UA 2V1XA 1BOBA 2DYSH 2L7FP 2E71A 5CVVA 4V19K 4OMYA 5EDNA 1U2WA 2NVUB 4N4OB 2FNAA 2VJ5A 1MBJA 2DO7A 4RM2A 4W97A 2HNHA 2OF7A 3M1EA 2DBBA 3FXQA 1T2KA 1FTTA 1N75A 4AU7A 1SFEA 2IAIA 3FXMA 3I58A 2G7HA 4XONA 2FE3A 2IP2A 2HI3A 2VKDA 3DTEA 2M5WA 2LD5A 1P4WA 3H0GJ 1XSDA 5LHHA 2NVTJ 1BM9A 4LB6B 2PEXA 4M9SA 2HKXA 3S8PA 2PMUA 3PNYA 3U1DA 2LBFB 2Y69H 1DGRM 2XAHA 1KQ9A 1GLNA 2DA3A 4HF1A 2RVCA 4UB8C 1UCRA 2Z2SB 2XKPA 1Z91A 3JRBA 3JTGA 1YJNI 3S17J 4IX7A 4ZDPA 3MZHA 2IS1A 2AXTC 2V4JC 2JQ7A 2K9LA 2D1VA 3FHZA 1YJ9I 3KEYA 3VYSB 3HHGA 2H8WA 3ASNH 1FZPB 2LMDA 4ZTFA 1IN4A 1USSA 2QSFX 2MG4A 1B8IB 4GCVA 4A3GJ 1D0XA 1I1GA 3TO6A 2Y48A 2VL8A 3VFZA 3VDXA 3ONQA 4YFNF 1S8NA 3CESA 1IXCA 3DEWA 3F3XA 4BYYA 1QQIA 1DU0A 3BR1A 4Y3OA 3GLXA 2HOSA 2BXZA 3WTUC 2E2HJ 1HKTA 2NOGA 2RQQA 2WC2A 2NS7A 2NS8A 2CU7A 3DF8A 3IKTA 2GQQA 4B8XA 3CQZJ 4X6AJ 1Y6IA 1B4AA 2CV0A 2KJBA 5IT9Z 2YU3A 2EV0A 1KYZA 2EIKH 1N77A 2R3SA 2TCTA 5F0HA 1Z67A 2JMWA 3JSPA 3PM1A 5JI6A 2DA2A 5K7FA 4IHWA 3U9GA 1ONVA 4RLFA 4OIRF 1P7IA 1MJBA 4BY1J 3RPUD 1PYVA 4B48A 3SYTA 2DAOA 3VYUB 2BW3A 1R4MB 2JVGA 4CZCA 4YIRX 2ZNYA 2F4OB 4L9JA 2LY2A 1NG7A 3PNTA 3PQJA 2E1MB 2HDDA 2BBYA 2HWVA 2VJ4A 2AQEA 5DCFA 2Y75A 1J75A 3BOQA 4LG0A 2KT0A 1ZQ3P 3E6CC 5E8GA 1ZARA 2RAEA 5FD6A 4B43A 1ZREA 1KU3A 3QODA 3BT9A 4Q47A 1OCOH 4RM3A 1FOKA 3NQOA 3QYBA 4S04A 4G7HF 3HB9A 4RGUA 2HGCA 3HOSA 3CD6I 1K6OA 4U0VA 2Z3YA 1GHCA 3QP5A 3BCAA 2QA4I 2KLOA 4MEYF 3WODF 2M4GA 3AG2H 5L3FA 2H09A 2KFDA 3QPTA 3ZMZA 4HDVA 2DA6A 3IRQA 1WH5A 2HU9A 2FBHA 3Q0VA 5JLWA 3CDLA 4BQQA 2X1EA 1WJCA 1YYVA 2A3SA 1Z7UA 3TO9A 2QSGX 4ETSA 5EG0B 3CO6C 4UUSB 1TLHB 3U1KA 5LGTA 4RGSA 1AHDP 2KP6A 3CLQA 2ZCWA 4UUTA 4XRMA 5M5XJ 3PFIA 3DEEA 2KIQA 1Y0NA 2EZLA 3LFUA 2PI0A 3DU6A 2PMZN 5HOOA 4IHSA 3FXJA 2F5VA 1XC5A 2OQGA 5EYRA 4G12A 2KJCA 3G73A 3LA3A 4P55A 3DP7A 2GLOA 3GTQJ 1TT0A 1YQAA 2CV2A 1ZRFA 3VOEA 2DA5A 3GVAA 1I27A 2HPIA 5BOXA 1JJ6C 4BDYA 3G2BA 2R5ZB 1MDMA 5AONA 3ABTA 1WJBA 4MQVA 2X1DA 4GGGA 4IJAA 2CH0A 1FSHA 4DZPA 2EIMH 1V5FA 2TRTA 3W3CA 4IXAA 3E6MA 1MBFA 2QKMB 3ZP5A 1FMWA 4FCYA 2NVXJ 1SD6A 3K4NA 3KP3A 4YELA 2X6XA 3RCOA 3IAM2 2V26A 2CWEA 2ZMEB 3DFGA 4U7BA 4HSTA 3F8FA 5LFAA 4Y7NJ 1MSEC 1AOYA 2JRTA 4YG2F 4A3IJ 3C2BA 5M5YJ 1TTYA 2PMHA 4KIFA 1J0RA 4XSZF 1X2NA 1Z6RA 2GWRA 1P4AA 3PL8A 4W1UA 1R23A 1IF1A 2JZYA 4B3AA 4HLYA 2ID6A 4RGRA 3LSGA 4AYBN 3RQIA 4BGDA 2GXBA 1BI2A 4XLNF 1GXPA 3B6AA 5JLXA 4A3BJ 3U21A 2VBXA 1J2XA 1IXSB 3EUHC 4FISA 3WTXC 3S2DJ 4CZZA 4XRSG 1UZCA 3KCCA 3ZPLA 3ASOH 2FF4A 3K70D 2GA2A 2JUCA 1HA8A 4LOCA 1POGA 1D8JA 4X0GA 3HTUA 1FOWA 3BZ6A 4BQNA 1X58A 2F5CA 4A5MA 2E35A 1YIOA 3CJQB 4MLOA 4BUPA 4U7DA 2A6EF 1WJDA 3CCMI 3LSJA 4LD5A 1XD7A 1WI9A 2KL4A 3DPTA 2K9QA 2K5CA 3GX4X 4D9JA 3RYRA 4A3EJ 2XGEA 2Y0MA 2DU9A 2IGKA 4CYCA 3MMYB 3WG7H 1LE8A 3L9FA 1MNMC 2WB1A 5D8LB 1FPQA 3RI4A 3JAMK 3VYRB 2K40A 3L1PA 3REOA 1B59A 5FKNA 1WKMA 5BPIA 5J3LA 4D7NA 4KUMA 3I59A 4M3DA 3GTOJ 3H1CA 3BTIA 1S29A 1FBSA 2MABA 3CMMA 2LKSA 1D5YA 3HYIA 5M3FJ 2H6CA 1EA3A 3FXOA 2IS4A 2RNJA 3BR2A 5BS6A 1Z21A 2LKPA 2EPFA 2IEKA 5JHFA 4RA2A 1MIJA 2XIGA 1J09A 1W7PB 4F52A 3ZQFA 2IRFG 3ABMH 3M7GA 2DA7A 5DDGA 1H89C 5B66C 1R9TJ 1LPQA 2DK5A 4NQWB 3PJRA 3CCSI 1O7LA 4A3CJ 3KLOA 3F8MA 2DI3A 5ICFA 3M9AA 2DYRH 1IUFA 4KN7X 4ZTJA 3JTHA 1WPKA 2E19A 4E7SA 3N97A 2EZHA 3K7AJ 3GTJJ 1IUYA 2X48A 2DJNA 4WXCA 5L3GA 5DYMA 5LRSA 5K5QA 4ENMA 1T08B 2M0CA 1S3JA 3IH2A 4D7MA 1JHFA 2D1HA 2HQRA 1IJWC 2F4MB 4ZYAA 3R0JA 2VC0A 4F93B 1VQNI 4IHXA 4FASD 3IH4A 5DCMA 4XSXF 2JPCA 1R1VA 3HXLA 3H3UA 1P4XA 2HOEA 3IV5A 5HLTA 5LHGA 4QTRA 2A07F 4NC8A 5IP6A 2ZB9A 2YX4A 3FMRA 4FX4A 2IJLA 5L3BA 1IXRC 1DP7P 1FIAA 2VBZA 3IAS2 1JUMA 3AL0B 3MFKA 2W48A 1YW8A 1YS6A 4HQEA 2ZNZA 4A3KJ 1UG2A 4HW0A 5F1JA 4M6XA 3KP5A 1T0FA 4NC7A 4XKVA 2QM3A 2M7AA 2DFFA 2VQCA 4N0BA 2OJED 2ACJA 3OR1C 3EYIA 2OZ6A 1JI8A 3H9GA 2AHQA 3NRVA 1RETA 1WCMJ 3HSEA 2ELJA 4H4KC 2ZJ2A 4KT5C 2QQBA 4NDLA 5H6RA 3PIOF 1BJAA 1FLIA 2MW8A 5DM7F 4ABZA 2W57A 4M74A 3ZMSA 2P7CB 1XDSA 1TWAJ 4ZDLA 2YPRA 4IRHA 2B63J 3R61A 4XLPF 2PLYA 4PFOA 3FX3A 3Q3SA 3A0BC 2O7OA 2DT6A 2K4JA 2E7XA 3LSRA 1QHGA 1VQKI 2A5WA 1SVMA 4IQ4A 3MQ0A 4ZH4F 5K5OA 2AXLA 2MFZA 4IO9F 4CXFA 5LD2C 1BR2A 2YUSA 1EF4A 5D6FA 2V1NA 4EGYA 3S3OA 2IT0A 1VQ8I 1HF0A 2P5LC 1ZG5A 2J5PA 3H36A 3V8LA 2QWWA 2CUZA 3LSHA 1USTA 2CQ7A 1K7AA 4NBQA 2VODA 5D5UB 3CCRI 2O5RA 4IRGA 1K61A 3HGGA 2CS3A 4O3MA 2NVQJ 2R7UA 3J7AO 1KONA 2OC6A 4XOTA 4A3FJ 5FD5A 5ED4A 3HEFA 3V7CA 3QYEA 3S3MA 1OYWA 1VQ7I 1IRXA 1RPWA 2IGOA 4UV8A 1D0YA 2QYOA 3ELKA 1H9GA 5FKMA 2B9SA 1RUOA 5JVTA 5FLXK 4OAZA 3S3NA 1XGOA 2R7DA 1JUPA 4BEHB 3E5QA 1BW5A 2JA8J 3Q5FA 3MCZA 5CJ9A 1FSEA 4LG3A 3G71I 5FB2A 1A5JA 3GXOA 3ZOBA 1U6GA 2K3FA 1FYKA 1MMSA 1MZBA 4BU2A 3OYLA 5GAHJ 2KIUA 2XF6A 2P7VB 3CCJI 3GWZA 2XGDA 1DDNA 1FTZA 3LQQA 5CVRA 4HF2A 4C3JJ 4HA8A 2LNBA 2STTA 3UKGA 1U5TB 4U88A 3C7JA 2YX7A 5JVGF 3BCBA 4HLXA 5GTHC 5A2QZ 4BACA 1ITYA 4XNFA 4D5CA 2VOPA 4P1WA 4TV7A 5IYBJ 3ROUA 5CYVA 4BQAA 3NWSA 4ZZDA 1YX3A 3TP0A 1U3EM 1U78A 1XCBA 4BDZA 1HW2A 1TW3A 3Q0WA 5LLQA 1P6RA 1RESA 2DFHA 2COBA 1K78A 5HNFA 3N05A 4HG2A 5DS9A 3CCLI 2PJRB 3S15J 2KHMA 2R7FA 3GTPJ 3QQAA 1NK2P 2DMPA 3P9KA 1IRFA 2KDZA 1F1ZA 4KICA 3EDPA 1JE8A 3LSKA 5E3LA 2VUMJ 1WRJA 2DPUA 2OA4A 3I9V2 3RQ4A 2G0EA 4OWRB 3N4MA 4AIDA 2R7TA 3H3VK 4G6DA 3O6BB 4L9TA 2Z99A 1HOMA 5D5XB 4L9NA 1OCPA 1LFBA 5LRRA 2IA2A 4P5OA 4UVBA 3P5JA 2CQKA 3TW7A 1T8IA 1MKMA 5JR3A 4M6VA 1MSFC 4E7LA 2OTLI 2GIVA 4NB5A 5FKKA 5D6EA 1L3LA 4IHVA 1T0FC 1W7PD 2GOMA 2HXIA 4G7OF 2Y0SN 4QPOA 2XROA 1UJ8A 4AC0A 3HSFA 4ITVA 1AKHB 1LFUP 3S1MJ 2OPTA 1TQPA 2WV1A 4MHGA 1NTCA 5E18F 3T0YA 4G6QA 2VKEA 4BHBA 1TWCJ 1ZLJA 2WAFA 2HYGD 2ISYA 5E1XA 1D1CA 1ZELA 4AVZA 5L3CA 4A3DJ 1YO5C 1HKSA 2LP0A 3WTTC 5C4XJ 2XUBA 2X0LA 1W5SA 3C1DA 2K9NA 2ZJRF 5C44J 4YIIA 4B47A 1QBJA 4L5IA 4DGWB 3BLYA 3ABKH 1O3SA 1LDDA 3VB2A 4WF2A 1IG7A 2LK2A 4XKCA 2CFXA 3P7NA 5GP9A 3LQRA 3FF5A 1V55H 2EZIA 1NHAA 2L0KA 4A93J 2R7VA 1T56A 5FKLA 3SFIA 5LEKA 3SEQA 3LSIA 1OPCA 2COMA 2O61A 2VE9A 4PJLA 2LLKA 2W25A 3CUQB 3NEUA 5ERIA 4B09A 2KISA 2YU9J 1E3OC 3H0DA 1B72A 5L3EA 2QUFA 3FKJA 2ESHA 3HPGA 1IV6A 2R4GA 1ETXA 4RDUA 2BYVE 1WZ2A 1FP2A 3TO7A 5TJJA 3I5UA 1HSJA 3MKYB 1ZH5A 1R1UA 1DU6A 3IL2A 1LVAA 4V2GA 2A68F 2P0WA 2CO5A 2HFHA 3U2RA 1VF9A 1PUFA 2LRDA 3K4BA 2ZFWA 3AG3H 3H3ZA 2WAQA 4AIJA 3S1QJ 4XLFA 4G94A 2IS6A 4M6YA 1T39A 3BC8A 3PNVA 5HLHA 2VN2A 2VKHA 2L4AA 2VXDA 2WADA 2ME6A 2V79A 4AIHA 1TWHJ 2E5ZA 5M5WJ 4BL0B 3L2QA 3OYBA 4IQJA 1YOVB 1OMIA 3OIPA 4P9UA 1VQPI 1GVDA 3QYFA 3CP8A 5H2FC 1JHHA 3PSIA 2AS5F 1VQMI 5DM6F 4AM3A 3KZZA 3HHHA 2Z9OA 3GEZA 3KEQA 1E17A 2CQNA 3D5RC 4FE7A 1N78A 3EUHA 4M72A 1FWZA 4ENKA 4KJZA 3CO7C 1ERDA 1MD0A 3W2WA 4Z2YA 2GBYA 1UHSA 4BXXJ 5J8FA 2DFEA 2DDBA 2KKOA 3EQLF 2NRAC 3WHCA 4C9YA 3DWLE 3DBLB 4CICA 5ILVA 1SEUA 4PGGA 3ZQCA 2LDUA 5HDNA 2VXZA 2M45A 2XHKA 1R71A 2VE8A 3ZN0A 3LMMA 1KU7A 1TWFJ 4QSHA 1CQTA 1MMGA 4LLNA 4B44A 1CGPA 1MBEA 4R1HA 1VQLI 3J7AY 3BJ6A 3W2AA 3CUOA 4GYGA 1Y56A 1TQIA 1MGTA 2EZKA 1YI2I 2Q2EA 2V1UA 2ZJQF 4DYRA 5J8CA 4ON0A 4BHCA 2KDOA 3QAHA 1Y1VJ 1ETYA 5DD8A 3DBHB 2AO9A 2DFIA 1UFMA 4IHTA 2PG4A 2ZJPF 2XV4S 2CW7A 1K6YA 3HPHA 3IWFA 4BQOA 2Q0OA 1DP3A 4ENNA 3TOBA 2EA4A 1YFHA 2FOKA 2DMUA 4PCQA 5F0FA 4X1EA 1LFPA 1S5LC 3ZRGA 3B02A 3CMAI 4J19A 3JRIA 3E3VA 4F92B 3RSNA 2F5EA 3LSTA 5ILUA 4OMZA 1I5ZA 4JBAA 5FLMJ 4FTHA 3RZDJ 3WGHA 1R4NB 2L2OA 4PGHA 4PSWA 4EV0A 1R00A 1Z9CA 1JKOC 2FQ3A 4MO7A 1MJAA 5IOZA 3V4GA 4KFCA 3F9KA 1C0WA 2E1CA 5DV5A 1T38A 1NG6A 3GF2A 1MNEA 3E6BA 1W36D 3W6VA 3WG9A 1I3AA 5J40A 4L0YB 3ZQIA 1YE9A 4I98B 4XL9A 2DDAA 3S1NJ 3IWZA 1K83J 3I71A 3HKZA 4JX5A 5ICGA 5C4JJ 1PP7U 3BP8A 1EH6A 3ULQB 4FHTA 2L3DA 4ZZLA 2ISZA 3ZQGA 4EJOA 3OYEA 2LTPA 1PDNC 3HG9A 1FIPA 1KA8A 4EM0B 2CSOA 2WA0A 1XGMA 2YSRA 5CVJA 3OS2A 3K69A 2K4BA 2B7EA 3J80K 1J9IA 2FRHA 1IC8A 1HC8A 2X85A 3BJAA 1Y8QB 2HTSA 1X1AA 1VZ0A 4R8HA 2CRGA 1XMKA 1ODDA 4XLHA 3E7LA 5FGMA 3BG6A 4RB3C 4C2TA 2L01A 2NOJB 3FXLA 4RMNA 2JUGA 5ICEA 5ILSA 2OZUA 3HOUJ 1SMTA 1G6NA 3GFIA 1W4MA 5FROA 1JT6A 3JAMZ 3H9JA 2LY9A 4QWQA 2X1CA 2O6GE 4WK8F 1F36A 4G9YA 4KISA 1RNLA 2OTJI 3CMEI 1MH3A 3GZNB 2F5DA 1V4RA 2L7MP 4IOAF 1P7JA 2CW0F 3BR0A 3B73A 1YS7A 2Q8KA 2E1MC 2CW8A 4KA4A 3MWMA 4XIDA 2BW3B 2OBPA 1UG0A 1KGSA 3CCQI 2OQRA 4WXDA 3DLLF 2XPVA 1HQCA 2LC2A 1QVUA 4ESFA 5IP7J 4MGRA 2P5VA 4Y17A 2MD5A 2XAFA 2AQFA 1OCRH 1MMAA 4LGWA 1SC7A 5IOYA 2JA7J 1XMAA 3M07A 4LG0B 4S05A 1OYIA 1K79A 1H8AC 2QQ9A 3OS1A 3GYHX 2VC1A 1QVTA 1TW2A 2EFOA 3KP2A 3S1RJ 2CYYA 5B1BH 2ELKA 2LH9A 1FJLA 1BOAA 2X51A 3DEUA 4I02A 1CF7A 2JA6J 2M34A 1U0JA 4B4CA 2L02A 1XSVA 2WB1N 3S2HJ 4JX4A 1OCZH 3AG4H 3FISA 3G1MA 1VQOI 3OL3A 4I99C 1R58A 2DT5A 3K4MA 3I53A 5TGTA 1BIAA 4CSWA 1D0ZA 4PUSA 2PFBA 2HKOA 1J5YA 2K02A 1JTYA 3S14J 3QOPA 3DTIA 4RAFA 1S9HA 3FBIB 3OYJA 1RC9A 2FU4A 2LF8A 3ZCOA 1BBYA 2UV1A 4HNUA 5FFXA 2NYXA 2HPMA 2XKOA 2R92J 3M4OJ 2LFBA 3D1NI 2F4IA 1ZAOA 3UR3C 3DLAA 1QU3A 1X4OA 2MC4A 1PVEA 3D5LA 3RYPA 1BL0A 4LK1F 2L7ZA 5E17F 4D5FA 4CCNA 1DUXC 1Z1DA 1SD5A 1Q1HA 1E3PA 2FMLA
chains in the Genus database with same CATH topology
1R7JA 1IRGA 3IHUA 4RB1A 3COAC 5HDKA 4OOIA 2D2WA 3TDZC 1MDMB 5AIQA 1KQ0A 5D5VB 6PAXA 1IN5A 3BDDA 4BXUA 1GXQA 1KYWA 1ZLKA 1XGNA 4HF0A 3KETA 5HS7A 2EJRA 2CGPA 2RDPA 2MC3A 3HRUA 3T8TA 1R22A 2KIFA 3FM3A 2GAUA 3FMSA 1B6AA 1S6LA 2Z33A 4A2UA 3VEPA 2HS5A 5HVQC 4LLLA 3F6VA 4GYIA 4EJTA 3GFLA 2IA0A 5HS8A 4RAYA 4RGXA 3R4KA 3SFZA 2IPQX 2DW4A 2VBWA 3FM5A 2J5OA 3QU6A 1SMYF 1FT9A 2MA3A 1X3UA 1REPC 2MH2A 4HX8A 3L09A 3KP4A 4EJVA 1LQ1A 4I01A 2K7LA 1YW9A 3QP6A 3RPUA 4ESBA 3ML6A 1KU9A 5LHIA 3H92A 5FLXZ 1JXSA 2BEOA 2EFQA 2ZO4A 4EM2A 1WQ2A 3GO5A 1R5GA 4Q5SF 1IZ1A 2VONA 1IAWA 2O03A 3EYYA 3I54A 1J59A 4OIOF 4YFXF 3I59B 3SQNA 2EFPA 5HS9A 2QBYA 3TKYA 3E5XA 2ZKZA 3ECOA 3E5UA 3Q9VA 4N9HA 4R79A 3BJOA 1QNTA 1D3YA 4UV9A 1WWXA 1TQMA 4RB2C 3HRSA 1PUEE 3KP6A 4G7ZF 1YTYA 3R6SA 5J6XA 3M8FA 1HW1A 2NAZA 1F9NA 4EM1A 2RV8A 2F2EA 4DQ2A 4FX0A 4K2EA 4P9FA 1O3TA 4MQ9F 4ZYHA 2NS0A 1F4KA 1HW5A 1ON1A 5DCMB 4A12A 4EMSA 3BPXA 3ZQ7A 3HUGA 1TNTA 4KYWA 4ZYDA 4ESJA 1RIOH 2JSCA 5H6QA 4I09A 3R0AA 4UVCA 1I1SA 3K9TA 1G3TA 1MJ9A 4WXHA 5FO5A 3LA7A 4HAMA 1UB9A 4EQQA 2P6TA 4BHPA 4WWCA 2FXAA 2V9VA 2MLKA 2F5FA 4UVAA 2ELHA 1UHMA 2HYFA 3T8RA 1HBXG 1EH7A 3I64A 3I4PA 1D8KA 2VT3A 2E1NA 2QZ8A 1EV7A 1QZZA 4F7ZA 2P8TA 3FMQA 4U0WA 1YW7A 2GZWA 5DD4A 3ERED 1S7OA 3AAFA 4CDGA 4A0ZA 5E1ZB 4JQFA 1STZA 4U0YA 3CDHA 1FP1D 2WTEA 4GO1A 4RAZA 2JPBA 2L4MA 4LLGF 2HQNA 1P2FA 1QPMA 2QQAA 3LWFA 2EA2A 1QZYA 3QU3A 2FSWA 2IA1A 3F8NA 1R1TA 5BPDA 3S2WA 5DEQA 1R5HA 4LK0F 1XN7A 2OU2A 5JFRA 2MLGA 2DLLA 2VOOA 3GZ6A 3WU0A 1SAXA 2KIMA 4FT8A 4UHTA 2PJPA 1ZRDA 3HTSB 3KZYA 1U5TC 3JW4A 4RS8A 3WU1B 1XGSA 2HDCA 1FY7A 2YR2A 4OIPF 2DTRA 5IT3A 4HX4A 1TBXA 4KNYA 3F8BA 3IC7A 3CJNA 3J81K 2M8EA 3ISPA 2EK5A 3KEOA 5A2QK 1YG2A 4HX7A 5F1RA 3G3ZA 4XBFA 1FYLA 1XB4A 1ZGJA 1U8RA 3WE3A 2GXGA 1W5TA 4UNOA 1JGSA 3MZYA 3P9CA 1J7KA 3FZVA 3TOAA 3WE2A 1K78B 3HOTA 1B9NA 2PBIA 2E7WA 3GFMA 4AWXB 5D4RA 3IRRA 1DPUA 1E2XA 4HV5A 1G3SA 3K2ZA 3RIRA 5E20A 1LEAA 1RZ4A 4AVPA 1RUNA 2UXXA 1T98A 2QENA 2ADUA 3L00A 2FBKA 2FEZA 1Y0UA 4RB0A 1H9TA 2EFNA 4ENJA 3BROA 1HXDA 4A0YA 4HZFA 4HV6A 4L0ZB 4ZYEA 5HLGA 3F21A 1IN7A 2XASA 1LDJA 2IW5A 3RKWA 1SFXA 2HZTA 1KU2A 1WSUA 3HIFA 3WTYC 4EJWA 3J80Z 4NHJA 3V8JA 3OOPA 3GW2A 3T5XA 2H94A 3CUQC 3HRMA 1ZYRF 3KP7A 4CO8A 1A04A 2M30A 3TDUC 4EGZA 3DXJF 2EV5A 2JT1A 2O0YA 3C3WA 4UUVA 3C18A 2GA1A 2LSOA 1HSTA 4IRIA 4QLCU 1S7AA 2LF7A 3DQVC 2XAGA 3E97A 2ZMEA 4YIFA 2G7UA 1SFUA 3ZMVA 4AIKA 2STWA 3RJPA 5D5WB 2FBIA 2K27A 3RTRA 4EJUA 1BI1A 2O8XA 1OYYA 2ESNA 2ETHA 1P92A 3T1BA 2QVOA 3QPHA 3KFWX 1BN5A 2CG4A 2HEOA 1Z6TA 3WTZA 4M9XA 2RN7A 3DPLC 3O2PE 4O6JA 2UZKA 1B1BA 5IT9K 1IN6A 2XRNA 2BV6A 5KVRA 1OR7A 4L5JA 3O3KA 5D4SA 1G3WA 4H0EA 2HR3A 1F5TA 4LJZF 3RDIA 2IVMA 4KDPA 2BE5F 2BGCA 3GZ5A 2O3FA 4L9VA 5FFZA 2MH9A 1LEBA 2OAZA 2UXNA 1W7PA 4OU0A 4HQMA 2XVCA 4HDUA 4NQWA 3EETA 4E70A 1D5VA 1FBUA 3RPQA 2K86A 3SHFA 4AD9A 1LDKB 4LB5A 3F22A 3TGNA 3GFJA 4ASNA 3FXRA 4MNUA 2P6SA 3K1MA 1ZGAA 1T6SA 2EB7A 2M87A 4WX9A 4XRFA 5CLSA 5F6FA 4EVIA 2WV0A 4CGZA 3W6JB 5K1YA 3DV8A 2W24A 4GXOA 2NNYA 2QLZA 1BI3A 4JK1X 2H6BA 4IF4A 5L3DA 1KQ8A 4BAYA 3F8CA 2VBYA 3K1PA 2RGVA 3ZN1A 2RC4A 4MTEA 4PZJA 4PDKA 2DK8A 5HLIA 4UXNA 5EEHA 1FBQA 2P5KA 2NNNA 2DPDA 2H27A 3ZMDA 4CYDA 2WWYA 2EFWA 2D45A 4MTDA 2A6HF 3F72A 3MEXA 1BIBA 1O57A 4KMFA 2RKHA 5AIPA 3M8EA 2HTJA 2XGXA 1ZRCA 1ZG1A 2C6YA 3RKXA 2KRFA 4DNCA 3LAJA 5F64A 3SZPA 3R60A 2M1BA 4OINF 4Y15A 4HYEA 5K5RA 3PQKA 4Q4ZF 1EH8A 5CVIA 5TRDA 3HSRA 1CF7B 3ZMUA 2X4HA 1QO0D 4OIQF 5BMZA 5DUKA 3K1NA 2A69F 1FYMA 3ECHA 1AWCA 4M9ZA 3F23A 1LNWA 4MEXF 1LJ9A 1O3QA 4KIBA 4I2OA 2XAJA 2XAQA 1ON2A 4KIGA 1VTNC 4A6EA 1XSXA 1FX7A 3KLNA 5HDGA 2OD5A 4IPAA 2JTVA 4WCGA 2ZBKA 3WGGA 3JSOA 3F6OA 3BWGA 5H20A 3D0SA 3FWEA 1Z05A 5EEGA 4N9IA 1U5TA 2V6CA 4LMYA 3BY6A 3CLOA 2DQLA 4O5VA 4G8XA 4I0AA 2PN6A 1H0MA 1FNNA 3QRFF 1V3FA 1IW7F 3VODA 1ZN2A 2FMYA 1SD7A 3L2CA 4HBLA 3KE2A 5JHUA 2TDXA 3SZTA 1I6XA 2ZXJA 1RI7A 2EV6A 4LFUA 3WTWC 2FNPA 3RKYA 1IN8A 5LGNA 3LFKA 2L54A 5ICCA 3K0LA 3WGIA 3WTVC 1FC3A 4KN4X 4Y13A 4HOBA 3IKVA 3I0TA 2VT2A 4ZYGA 2W84A 2DQRA 1LB2A 2A5YB 4A6DA 2Z5UA 2V1DA 5LEJA 4M73A 2RQPA 4M71A 1R36A 2EWNA 1L0OC 1SD4A 1ZG3A 5E8IA 3ABUA 3V7RA 1TNSA 1G4DA 3FXUA 4Q48A 2PQ8A 4L18B 5DUIA 3E6DA 3V7SA 1BC7C 5CVUA 1O3RA 1PP8F 4CHUA 2G9WA 1UHWA 3DKWA 3GUDA 1QGPA 5LBQA 4P96A 3J81Z 4KMUX 5E1WA 2QBYB 3CUQA 3OV8A 4IVNA 2P4WA 2FA5A 4BNCA 3P9IA 3V8KA 3W6KB 4A5NA 1B9MA 1ULYA 3SXYA 1OKRA 4YFKF 1XCVA 5BQTA 2B0LA 3ZMTA 4D0PA 5LGUA 1ZHFA 1XDUA 1O7FA 2MBFA 2UWMA 3CTAA 4BH9A 1DPRA 1BI0A 4A0XA 3MAJA 1G3YA 1GVJA 5KK1A 1YLFA 2W85A 1HKQA 4I0BA 2A61A 3LAPA 3LA2A 3TQNA 3BPVA 3Q9SA 5D8KB 3L7WA 3WTSC 1BC8C 4I7HA 3HRTA 2V1XA 5CVVA 4OMYA 1U2WA 2FNAA 2DO7A 3M1EA 2DBBA 3FXQA 1T2KA 1SFEA 3I58A 2G7HA 2FE3A 2IP2A 2M5WA 1P4WA 1XSDA 5LHHA 1BM9A 4LB6B 2PEXA 4M9SA 2HKXA 2PMUA 3U1DA 2XAHA 1KQ9A 4HF1A 2RVCA 1UCRA 2XKPA 1Z91A 3JTGA 3MZHA 2D1VA 3FHZA 3HHGA 1FZPB 1IN4A 1USSA 4GCVA 1I1GA 3TO6A 2Y48A 3VFZA 4YFNF 1S8NA 1IXCA 3F3XA 4BYYA 1QQIA 3GLXA 3WTUC 1HKTA 2WC2A 3DF8A 3IKTA 2GQQA 4B8XA 5IT9Z 1B4AA 2KJBA 2YU3A 2EV0A 1KYZA 2R3SA 3JSPA 5JI6A 3U9GA 1ONVA 4OIRF 1MJBA 2DAOA 2ZNYA 4L9JA 3PQJA 2BBYA 2HWVA 5DCFA 2Y75A 1J75A 3BOQA 4LG0A 3E6CC 5E8GA 1ZARA 5FD6A 1ZREA 1KU3A 4Q47A 1FOKA 3NQOA 4S04A 4G7HF 4RGUA 3HOSA 2HGCA 1K6OA 4U0VA 2Z3YA 1GHCA 3QP5A 4MEYF 3WODF 5L3FA 2H09A 3QPTA 3ZMZA 4HDVA 3IRQA 2FBHA 1YYVA 2A3SA 1Z7UA 3TO9A 4ETSA 3CO6C 1TLHB 5LGTA 4RGSA 2ZCWA 3PFIA 2PI0A 5HOOA 4IHSA 2OQGA 3G73A 2KJCA 3LA3A 4P55A 3DP7A 1YQAA 1ZRFA 3VOEA 3GVAA 1I27A 5BOXA 1MDMA 5AONA 3ABTA 4MQVA 4GGGA 4IJAA 1FSHA 4IXAA 3E6MA 3ZP5A 1SD6A 3KP3A 2CWEA 2ZMEB 3DFGA 4U7BA 3F8FA 1AOYA 2JRTA 4YG2F 1TTYA 2PMHA 4KIFA 1J0RA 4XSZF 1Z6RA 2GWRA 1P4AA 1R23A 1IF1A 2JZYA 4HLYA 4RGRA 2GXBA 1BI2A 4XLNF 1GXPA 2VBXA 1J2XA 3WTXC 1IXSB 4CZZA 3KCCA 3ZPLA 2FF4A 2GA2A 1D8JA 3HTUA 3BZ6A 2F5CA 4A5MA 1YIOA 4U7DA 2A6EF 4LD5A 1XD7A 1WI9A 3DPTA 3GX4X 3RYRA 2Y0MA 2DU9A 3L9FA 5D8LB 1FPQA 3RI4A 3JAMK 3REOA 1B59A 1WKMA 5BPIA 4KUMA 3I59A 1S29A 1FBSA 3HYIA 2H6CA 2RNJA 5BS6A 2LKPA 2XIGA 1W7PB 2IRFG 3M7GA 5DDGA 2DK5A 1O7LA 3KLOA 3F8MA 2DI3A 5ICFA 3M9AA 4KN7X 3JTHA 3N97A 1IUYA 4WXCA 5L3GA 5LRSA 5K5QA 5DYMA 4ENMA 1S3JA 1JHFA 2D1HA 2HQRA 3R0JA 2VC0A 5DCMA 4XSXF 2JPCA 1R1VA 3H3UA 1P4XA 2HOEA 5LHGA 2A07F 2YX4A 3FMRA 4FX4A 2IJLA 5L3BA 1IXRC 1DP7P 2VBZA 3MFKA 1YW8A 1YS6A 4HQEA 2ZNZA 4HW0A 4M6XA 3KP5A 1T0FA 2QM3A 4N0BA 2ACJA 3EYIA 2OZ6A 3NRVA 3HSEA 4KT5C 2ZJ2A 2QQBA 5H6RA 1BJAA 1FLIA 2W57A 4M74A 3ZMSA 2P7CB 1XDSA 2YPRA 4IRHA 3R61A 4XLPF 2PLYA 3FX3A 2K4JA 2E7XA 3MQ0A 4ZH4F 5K5OA 2AXLA 4CXFA 5D6FA 4EGYA 2IT0A 2P5LC 1ZG5A 2J5PA 3V8LA 2QWWA 1USTA 1K7AA 2VODA 5D5UB 4IRGA 4O3MA 3J7AO 5FD5A 5ED4A 3V7CA 1OYWA 4UV8A 2QYOA 3ELKA 1H9GA 1RUOA 5JVTA 5FLXK 1XGOA 2R7DA 3E5QA 3Q5FA 3MCZA 5CJ9A 1FSEA 5FB2A 3GXOA 1U6GA 1FYKA 1MZBA 2KIUA 2P7VB 3GWZA 1DDNA 3LQQA 5CVRA 4HF2A 4HA8A 2LNBA 2STTA 1U5TB 4U88A 3C7JA 2YX7A 4HLXA 5A2QZ 2VOPA 4TV7A 3ROUA 5CYVA 4BQAA 4ZZDA 1U3EM 1U78A 1XCBA 1HW2A 1TW3A 5LLQA 1P6RA 1K78A 2R7FA 3P9KA 1IRFA 1F1ZA 4KICA 3EDPA 1JE8A 1WRJA 2DPUA 2OA4A 3N4MA 4G6DA 3O6BB 4L9TA 2Z99A 5D5XB 4L9NA 5LRRA 2IA2A 4P5OA 4UVBA 2CQKA 1MKMA 5JR3A 2GIVA 4NB5A 1L3LA 5D6EA 1W7PD 4G7OF 2XROA 3HSFA 1TQPA 4MHGA 5E18F 3T0YA 4G6QA 4BHBA 1ZLJA 2HYGD 2ISYA 5E1XA 5L3CA 1YO5C 1HKSA 3WTTC 2XUBA 2X0LA 1W5SA 3C1DA 4YIIA 1QBJA 4L5IA 1O3SA 1LDDA 3VB2A 4WF2A 2CFXA 3P7NA 3LQRA 3FF5A 1NHAA 5LEKA 1OPCA 2COMA 2O61A 2VE9A 2W25A 3CUQB 3NEUA 5ERIA 4B09A 5L3EA 2QUFA 2ESHA 2BYVE 1FP2A 3TO7A 5TJJA 3I5UA 1HSJA 1ZH5A 1R1UA 3IL2A 1LVAA 2A68F 2CO5A 2HFHA 3U2RA 2ZFWA 3H3ZA 4AIJA 4G94A 4M6YA 1T39A 5HLHA 2VN2A 2L4AA 2V79A 4AIHA 1OMIA 4P9UA 1JHHA 2AS5F 3KZZA 3HHHA 2Z9OA 3GEZA 3KEQA 1E17A 3EUHA 4M72A 1FWZA 4ENKA 3CO7C 1MD0A 4Z2YA 5J8FA 2KKOA 2NRAC 3EQLF 4CICA 5ILVA 4PGGA 2LDUA 5HDNA 2VXZA 2M45A 2XHKA 2VE8A 3ZN0A 1KU7A 4LLNA 1CGPA 4R1HA 3BJ6A 3CUOA 4GYGA 1TQIA 1MGTA 2Q2EA 2V1UA 5J8CA 4ON0A 4BHCA 3QAHA 5DD8A 2DFIA 1UFMA 4IHTA 2PG4A 2XV4S 3IWFA 2Q0OA 4ENNA 3TOBA 2EA4A 1YFHA 2FOKA 4PCQA 3B02A 3E3VA 2F5EA 3LSTA 5ILUA 4OMZA 1I5ZA 4JBAA 3WGHA 4PGHA 4EV0A 1R00A 1Z9CA 2FQ3A 1MJAA 3V4GA 4KFCA 1C0WA 2E1CA 5DV5A 1T38A 3GF2A 3E6BA 3WG9A 4L0YB 4I98B 3IWZA 3I71A 5ICGA 1PP7U 3BP8A 1EH6A 3ULQB 4FHTA 2L3DA 4ZZLA 2ISZA 4EJOA 1PDNC 1KA8A 4EM0B 2CSOA 1XGMA 2YSRA 5CVJA 3K69A 2K4BA 3J80K 1J9IA 2FRHA 3BJAA 2HTSA 4R8HA 1XMKA 1ODDA 5FGMA 4RB3C 2L01A 5ICEA 5ILSA 2OZUA 1SMTA 1G6NA 3GFIA 1W4MA 3JAMZ 4QWQA 2O6GE 4WK8F 4G9YA 1RNLA 2F5DA 1V4RA 2CW0F 3B73A 1YS7A 2Q8KA 4KA4A 3MWMA 2OBPA 1KGSA 2OQRA 4WXDA 4ESFA 1HQCA 4MGRA 2P5VA 4Y17A 2MD5A 2XAFA 4LGWA 1XMAA 4LG0B 4S05A 1OYIA 1K79A 2QQ9A 3GYHX 2VC1A 1TW2A 2EFOA 3KP2A 2CYYA 1BOAA 3DEUA 4I02A 1CF7A 2L02A 1XSVA 1R58A 2DT5A 3I53A 1BIAA 2PFBA 2HKOA 1J5YA 2K02A 3QOPA 2FU4A 2LF8A 1BBYA 5FFXA 2NYXA 2XKOA 1ZAOA 3D5LA 3RYPA 4LK1F 5E17F 1DUXC 1Z1DA 1SD5A 1Q1HA 2FMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7J A;  1IRG A;  3IHU A;  4RB1 A;  3COA C;  5HDK A;  4OOI A;  2D2W A;  3TDZ C;  1MDM B;  5AIQ A;  1KQ0 A;  5D5V B;  6PAX A;  1IN5 A;  3BDD A;  4BXU A;  1GXQ A;  1KYW A;  1ZLK A;  1XGN A;  4HF0 A;  3KET A;  5HS7 A;  2EJR A;  2CGP A;  2RDP A;  2MC3 A;  3HRU A;  3T8T A;  1R22 A;  2KIF A;  3FM3 A;  2GAU A;  3FMS A;  1B6A A;  1S6L A;  2Z33 A;  4A2U A;  3VEP A;  2HS5 A;  5HVQ C;  4LLL A;  3F6V A;  4GYI A;  4EJT A;  3GFL A;  2IA0 A;  5HS8 A;  4RAY A;  4RGX A;  3R4K A;  3SFZ A;  2IPQ X;  2DW4 A;  2VBW A;  3FM5 A;  2J5O A;  3QU6 A;  1SMY F;  1FT9 A;  2MA3 A;  1X3U A;  1REP C;  2MH2 A;  4HX8 A;  3L09 A;  3KP4 A;  4EJV A;  1LQ1 A;  4I01 A;  2K7L A;  1YW9 A;  3QP6 A;  3RPU A;  4ESB A;  3ML6 A;  1KU9 A;  5LHI A;  3H92 A;  5FLX Z;  1JXS A;  2BEO A;  2EFQ A;  2ZO4 A;  4EM2 A;  1WQ2 A;  3GO5 A;  1R5G A;  4Q5S F;  1IZ1 A;  2VON A;  1IAW A;  2O03 A;  3EYY A;  3I54 A;  1J59 A;  4OIO F;  4YFX F;  3I59 B;  3SQN A;  2EFP A;  5HS9 A;  2QBY A;  3TKY A;  3E5X A;  2ZKZ A;  3ECO A;  3E5U A;  3Q9V A;  4N9H A;  4R79 A;  3BJO A;  1QNT A;  1D3Y A;  4UV9 A;  1WWX A;  1TQM A;  4RB2 C;  3HRS A;  1PUE E;  3KP6 A;  4G7Z F;  1YTY A;  3R6S A;  5J6X A;  3M8F A;  1HW1 A;  2NAZ A;  1F9N A;  4EM1 A;  2RV8 A;  2F2E A;  4DQ2 A;  4FX0 A;  4K2E A;  4P9F A;  1O3T A;  4MQ9 F;  4ZYH A;  2NS0 A;  1F4K A;  1HW5 A;  1ON1 A;  5DCM B;  4A12 A;  4EMS A;  3BPX A;  3ZQ7 A;  3HUG A;  1TNT A;  4KYW A;  4ZYD A;  4ESJ A;  1RIO H;  2JSC A;  5H6Q A;  4I09 A;  3R0A A;  4UVC A;  1I1S A;  3K9T A;  1G3T A;  1MJ9 A;  4WXH A;  5FO5 A;  3LA7 A;  4HAM A;  1UB9 A;  4EQQ A;  2P6T A;  4BHP A;  4WWC A;  2FXA A;  2V9V A;  2MLK A;  2F5F A;  4UVA A;  2ELH A;  1UHM A;  2HYF A;  3T8R A;  1HBX G;  1EH7 A;  3I64 A;  3I4P A;  1D8K A;  2VT3 A;  2E1N A;  2QZ8 A;  1EV7 A;  1QZZ A;  4F7Z A;  2P8T A;  3FMQ A;  4U0W A;  1YW7 A;  2GZW A;  5DD4 A;  3ERE D;  1S7O A;  3AAF A;  4CDG A;  4A0Z A;  5E1Z B;  4JQF A;  1STZ A;  4U0Y A;  3CDH A;  1FP1 D;  2WTE A;  4GO1 A;  4RAZ A;  2JPB A;  2L4M A;  4LLG F;  2HQN A;  1P2F A;  1QPM A;  2QQA A;  3LWF A;  2EA2 A;  1QZY A;  3QU3 A;  2FSW A;  2IA1 A;  3F8N A;  1R1T A;  5BPD A;  3S2W A;  5DEQ A;  1R5H A;  4LK0 F;  1XN7 A;  2OU2 A;  5JFR A;  2MLG A;  2DLL A;  2VOO A;  3GZ6 A;  3WU0 A;  1SAX A;  2KIM A;  4FT8 A;  4UHT A;  2PJP A;  1ZRD A;  3HTS B;  3KZY A;  1U5T C;  3JW4 A;  4RS8 A;  3WU1 B;  1XGS A;  2HDC A;  1FY7 A;  2YR2 A;  4OIP F;  2DTR A;  5IT3 A;  4HX4 A;  1TBX A;  4KNY A;  3F8B A;  3IC7 A;  3CJN A;  3J81 K;  2M8E A;  3ISP A;  2EK5 A;  3KEO A;  5A2Q K;  1YG2 A;  4HX7 A;  5F1R A;  3G3Z A;  4XBF A;  1FYL A;  1XB4 A;  1ZGJ A;  1U8R A;  3WE3 A;  2GXG A;  1W5T A;  4UNO A;  1JGS A;  3MZY A;  3P9C A;  1J7K A;  3FZV A;  3TOA A;  3WE2 A;  1K78 B;  3HOT A;  1B9N A;  2PBI A;  2E7W A;  3GFM A;  4AWX B;  5D4R A;  3IRR A;  1DPU A;  1E2X A;  4HV5 A;  1G3S A;  3K2Z A;  3RIR A;  5E20 A;  1LEA A;  1RZ4 A;  4AVP A;  1RUN A;  2UXX A;  1T98 A;  2QEN A;  2ADU A;  3L00 A;  2FBK A;  2FEZ A;  1Y0U A;  4RB0 A;  1H9T A;  2EFN A;  4ENJ A;  3BRO A;  1HXD A;  4A0Y A;  4HZF A;  4HV6 A;  4L0Z B;  4ZYE A;  5HLG A;  3F21 A;  1IN7 A;  2XAS A;  1LDJ A;  2IW5 A;  3RKW A;  1SFX A;  2HZT A;  1KU2 A;  1WSU A;  3HIF A;  3WTY C;  4EJW A;  3J80 Z;  4NHJ A;  3V8J A;  3OOP A;  3GW2 A;  3T5X A;  2H94 A;  3CUQ C;  3HRM A;  1ZYR F;  3KP7 A;  4CO8 A;  1A04 A;  2M30 A;  3TDU C;  4EGZ A;  3DXJ F;  2EV5 A;  2JT1 A;  2O0Y A;  3C3W A;  4UUV A;  3C18 A;  2GA1 A;  2LSO A;  1HST A;  4IRI A;  4QLC U;  1S7A A;  2LF7 A;  3DQV C;  2XAG A;  3E97 A;  2ZME A;  4YIF A;  2G7U A;  1SFU A;  3ZMV A;  4AIK A;  2STW A;  3RJP A;  5D5W B;  2FBI A;  2K27 A;  3RTR A;  4EJU A;  1BI1 A;  2O8X A;  1OYY A;  2ESN A;  2ETH A;  1P92 A;  3T1B A;  2QVO A;  3QPH A;  3KFW X;  1BN5 A;  2CG4 A;  2HEO A;  1Z6T A;  3WTZ A;  4M9X A;  2RN7 A;  3DPL C;  3O2P E;  4O6J A;  2UZK A;  1B1B A;  5IT9 K;  1IN6 A;  2XRN A;  2BV6 A;  5KVR A;  1OR7 A;  4L5J A;  3O3K A;  5D4S A;  1G3W A;  4H0E A;  2HR3 A;  1F5T A;  4LJZ F;  3RDI A;  2IVM A;  4KDP A;  2BE5 F;  2BGC A;  3GZ5 A;  2O3F A;  4L9V A;  5FFZ A;  2MH9 A;  1LEB A;  2OAZ A;  2UXN A;  1W7P A;  4OU0 A;  4HQM A;  2XVC A;  4HDU A;  4NQW A;  3EET A;  4E70 A;  1D5V A;  1FBU A;  3RPQ A;  2K86 A;  3SHF A;  4AD9 A;  1LDK B;  4LB5 A;  3F22 A;  3TGN A;  3GFJ A;  4ASN A;  3FXR A;  4MNU A;  2P6S A;  3K1M A;  1ZGA A;  1T6S A;  2EB7 A;  2M87 A;  4WX9 A;  4XRF A;  5CLS A;  5F6F A;  4EVI A;  2WV0 A;  4CGZ A;  3W6J B;  5K1Y A;  3DV8 A;  2W24 A;  4GXO A;  2NNY A;  2QLZ A;  1BI3 A;  4JK1 X;  2H6B A;  4IF4 A;  5L3D A;  1KQ8 A;  4BAY A;  3F8C A;  2VBY A;  3K1P A;  2RGV A;  3ZN1 A;  2RC4 A;  4MTE A;  4PZJ A;  4PDK A;  2DK8 A;  5HLI A;  4UXN A;  5EEH A;  1FBQ A;  2P5K A;  2NNN A;  2DPD A;  2H27 A;  3ZMD A;  4CYD A;  2WWY A;  2EFW A;  2D45 A;  4MTD A;  2A6H F;  3F72 A;  3MEX A;  1BIB A;  1O57 A;  4KMF A;  2RKH A;  5AIP A;  3M8E A;  2HTJ A;  2XGX A;  1ZRC A;  1ZG1 A;  2C6Y A;  3RKX A;  2KRF A;  4DNC A;  3LAJ A;  5F64 A;  3SZP A;  3R60 A;  2M1B A;  4OIN F;  4Y15 A;  4HYE A;  5K5R A;  3PQK A;  4Q4Z F;  1EH8 A;  5CVI A;  5TRD A;  3HSR A;  1CF7 B;  3ZMU A;  2X4H A;  1QO0 D;  4OIQ F;  5BMZ A;  5DUK A;  3K1N A;  2A69 F;  1FYM A;  3ECH A;  1AWC A;  4M9Z A;  3F23 A;  1LNW A;  4MEX F;  1LJ9 A;  1O3Q A;  4KIB A;  4I2O A;  2XAJ A;  2XAQ A;  1ON2 A;  4KIG A;  1VTN C;  4A6E A;  1XSX A;  1FX7 A;  3KLN A;  5HDG A;  2OD5 A;  4IPA A;  2JTV A;  4WCG A;  2ZBK A;  3WGG A;  3JSO A;  3F6O A;  3BWG A;  5H20 A;  3D0S A;  3FWE A;  1Z05 A;  5EEG A;  4N9I A;  1U5T A;  2V6C A;  4LMY A;  3BY6 A;  3CLO A;  2DQL A;  4O5V A;  4G8X A;  4I0A A;  2PN6 A;  1H0M A;  1FNN A;  3QRF F;  1V3F A;  1IW7 F;  3VOD A;  1ZN2 A;  2FMY A;  1SD7 A;  3L2C A;  4HBL A;  3KE2 A;  5JHU A;  2TDX A;  3SZT A;  1I6X A;  2ZXJ A;  1RI7 A;  2EV6 A;  4LFU A;  3WTW C;  2FNP A;  3RKY A;  1IN8 A;  5LGN A;  3LFK A;  2L54 A;  5ICC A;  3K0L A;  3WGI A;  3WTV C;  1FC3 A;  4KN4 X;  4Y13 A;  4HOB A;  3IKV A;  3I0T A;  2VT2 A;  4ZYG A;  2W84 A;  2DQR A;  1LB2 A;  2A5Y B;  4A6D A;  2Z5U A;  2V1D A;  5LEJ A;  4M73 A;  2RQP A;  4M71 A;  1R36 A;  2EWN A;  1L0O C;  1SD4 A;  1ZG3 A;  5E8I A;  3ABU A;  3V7R A;  1TNS A;  1G4D A;  3FXU A;  4Q48 A;  2PQ8 A;  4L18 B;  5DUI A;  3E6D A;  3V7S A;  1BC7 C;  5CVU A;  1O3R A;  1PP8 F;  4CHU A;  2G9W A;  1UHW A;  3DKW A;  3GUD A;  1QGP A;  5LBQ A;  4P96 A;  3J81 Z;  4KMU X;  5E1W A;  2QBY B;  3CUQ A;  3OV8 A;  4IVN A;  2P4W A;  2FA5 A;  4BNC A;  3P9I A;  3V8K A;  3W6K B;  4A5N A;  1B9M A;  1ULY A;  3SXY A;  1OKR A;  4YFK F;  1XCV A;  5BQT A;  2B0L A;  3ZMT A;  4D0P A;  5LGU A;  1ZHF A;  1XDU A;  1O7F A;  2MBF A;  2UWM A;  3CTA A;  4BH9 A;  1DPR A;  1BI0 A;  4A0X A;  3MAJ A;  1G3Y A;  1GVJ A;  5KK1 A;  1YLF A;  2W85 A;  1HKQ A;  4I0B A;  2A61 A;  3LAP A;  3LA2 A;  3TQN A;  3BPV A;  3Q9S A;  5D8K B;  3L7W A;  3WTS C;  1BC8 C;  4I7H A;  3HRT A;  2V1X A;  5CVV A;  4OMY A;  1U2W A;  2FNA A;  2DO7 A;  3M1E A;  2DBB A;  3FXQ A;  1T2K A;  1SFE A;  3I58 A;  2G7H A;  2FE3 A;  2IP2 A;  2M5W A;  1P4W A;  1XSD A;  5LHH A;  1BM9 A;  4LB6 B;  2PEX A;  4M9S A;  2HKX A;  2PMU A;  3U1D A;  2XAH A;  1KQ9 A;  4HF1 A;  2RVC A;  1UCR A;  2XKP A;  1Z91 A;  3JTG A;  3MZH A;  2D1V A;  3FHZ A;  3HHG A;  1FZP B;  1IN4 A;  1USS A;  4GCV A;  1I1G A;  3TO6 A;  2Y48 A;  3VFZ A;  4YFN F;  1S8N A;  1IXC A;  3F3X A;  4BYY A;  1QQI A;  3GLX A;  3WTU C;  1HKT A;  2WC2 A;  3DF8 A;  3IKT A;  2GQQ A;  4B8X A;  5IT9 Z;  1B4A A;  2KJB A;  2YU3 A;  2EV0 A;  1KYZ A;  2R3S A;  3JSP A;  5JI6 A;  3U9G A;  1ONV A;  4OIR F;  1MJB A;  2DAO A;  2ZNY A;  4L9J A;  3PQJ A;  2BBY A;  2HWV A;  5DCF A;  2Y75 A;  1J75 A;  3BOQ A;  4LG0 A;  3E6C C;  5E8G A;  1ZAR A;  5FD6 A;  1ZRE A;  1KU3 A;  4Q47 A;  1FOK A;  3NQO A;  4S04 A;  4G7H F;  4RGU A;  3HOS A;  2HGC A;  1K6O A;  4U0V A;  2Z3Y A;  1GHC A;  3QP5 A;  4MEY F;  3WOD F;  5L3F A;  2H09 A;  3QPT A;  3ZMZ A;  4HDV A;  3IRQ A;  2FBH A;  1YYV A;  2A3S A;  1Z7U A;  3TO9 A;  4ETS A;  3CO6 C;  1TLH B;  5LGT A;  4RGS A;  2ZCW A;  3PFI A;  2PI0 A;  5HOO A;  4IHS A;  2OQG A;  3G73 A;  2KJC A;  3LA3 A;  4P55 A;  3DP7 A;  1YQA A;  1ZRF A;  3VOE A;  3GVA A;  1I27 A;  5BOX A;  1MDM A;  5AON A;  3ABT A;  4MQV A;  4GGG A;  4IJA A;  1FSH A;  4IXA A;  3E6M A;  3ZP5 A;  1SD6 A;  3KP3 A;  2CWE A;  2ZME B;  3DFG A;  4U7B A;  3F8F A;  1AOY A;  2JRT A;  4YG2 F;  1TTY A;  2PMH A;  4KIF A;  1J0R A;  4XSZ F;  1Z6R A;  2GWR A;  1P4A A;  1R23 A;  1IF1 A;  2JZY A;  4HLY A;  4RGR A;  2GXB A;  1BI2 A;  4XLN F;  1GXP A;  2VBX A;  1J2X A;  3WTX C;  1IXS B;  4CZZ A;  3KCC A;  3ZPL A;  2FF4 A;  2GA2 A;  1D8J A;  3HTU A;  3BZ6 A;  2F5C A;  4A5M A;  1YIO A;  4U7D A;  2A6E F;  4LD5 A;  1XD7 A;  1WI9 A;  3DPT A;  3GX4 X;  3RYR A;  2Y0M A;  2DU9 A;  3L9F A;  5D8L B;  1FPQ A;  3RI4 A;  3JAM K;  3REO A;  1B59 A;  1WKM A;  5BPI A;  4KUM A;  3I59 A;  1S29 A;  1FBS A;  3HYI A;  2H6C A;  2RNJ A;  5BS6 A;  2LKP A;  2XIG A;  1W7P B;  2IRF G;  3M7G A;  5DDG A;  2DK5 A;  1O7L A;  3KLO A;  3F8M A;  2DI3 A;  5ICF A;  3M9A A;  4KN7 X;  3JTH A;  3N97 A;  1IUY A;  4WXC A;  5L3G A;  5LRS A;  5K5Q A;  5DYM A;  4ENM A;  1S3J A;  1JHF A;  2D1H A;  2HQR A;  3R0J A;  2VC0 A;  5DCM A;  4XSX F;  2JPC A;  1R1V A;  3H3U A;  1P4X A;  2HOE A;  5LHG A;  2A07 F;  2YX4 A;  3FMR A;  4FX4 A;  2IJL A;  5L3B A;  1IXR C;  1DP7 P;  2VBZ A;  3MFK A;  1YW8 A;  1YS6 A;  4HQE A;  2ZNZ A;  4HW0 A;  4M6X A;  3KP5 A;  1T0F A;  2QM3 A;  4N0B A;  2ACJ A;  3EYI A;  2OZ6 A;  3NRV A;  3HSE A;  4KT5 C;  2ZJ2 A;  2QQB A;  5H6R A;  1BJA A;  1FLI A;  2W57 A;  4M74 A;  3ZMS A;  2P7C B;  1XDS A;  2YPR A;  4IRH A;  3R61 A;  4XLP F;  2PLY A;  3FX3 A;  2K4J A;  2E7X A;  3MQ0 A;  4ZH4 F;  5K5O A;  2AXL A;  4CXF A;  5D6F A;  4EGY A;  2IT0 A;  2P5L C;  1ZG5 A;  2J5P A;  3V8L A;  2QWW A;  1UST A;  1K7A A;  2VOD A;  5D5U B;  4IRG A;  4O3M A;  3J7A O;  5FD5 A;  5ED4 A;  3V7C A;  1OYW A;  4UV8 A;  2QYO A;  3ELK A;  1H9G A;  1RUO A;  5JVT A;  5FLX K;  1XGO A;  2R7D A;  3E5Q A;  3Q5F A;  3MCZ A;  5CJ9 A;  1FSE A;  5FB2 A;  3GXO A;  1U6G A;  1FYK A;  1MZB A;  2KIU A;  2P7V B;  3GWZ A;  1DDN A;  3LQQ A;  5CVR A;  4HF2 A;  4HA8 A;  2LNB A;  2STT A;  1U5T B;  4U88 A;  3C7J A;  2YX7 A;  4HLX A;  5A2Q Z;  2VOP A;  4TV7 A;  3ROU A;  5CYV A;  4BQA A;  4ZZD A;  1U3E M;  1U78 A;  1XCB A;  1HW2 A;  1TW3 A;  5LLQ A;  1P6R A;  1K78 A;  2R7F A;  3P9K A;  1IRF A;  1F1Z A;  4KIC A;  3EDP A;  1JE8 A;  1WRJ A;  2DPU A;  2OA4 A;  3N4M A;  4G6D A;  3O6B B;  4L9T A;  2Z99 A;  5D5X B;  4L9N A;  5LRR A;  2IA2 A;  4P5O A;  4UVB A;  2CQK A;  1MKM A;  5JR3 A;  2GIV A;  4NB5 A;  1L3L A;  5D6E A;  1W7P D;  4G7O F;  2XRO A;  3HSF A;  1TQP A;  4MHG A;  5E18 F;  3T0Y A;  4G6Q A;  4BHB A;  1ZLJ A;  2HYG D;  2ISY A;  5E1X A;  5L3C A;  1YO5 C;  1HKS A;  3WTT C;  2XUB A;  2X0L A;  1W5S A;  3C1D A;  4YII A;  1QBJ A;  4L5I A;  1O3S A;  1LDD A;  3VB2 A;  4WF2 A;  2CFX A;  3P7N A;  3LQR A;  3FF5 A;  1NHA A;  5LEK A;  1OPC A;  2COM A;  2O61 A;  2VE9 A;  2W25 A;  3CUQ B;  3NEU A;  5ERI A;  4B09 A;  5L3E A;  2QUF A;  2ESH A;  2BYV E;  1FP2 A;  3TO7 A;  5TJJ A;  3I5U A;  1HSJ A;  1ZH5 A;  1R1U A;  3IL2 A;  1LVA A;  2A68 F;  2CO5 A;  2HFH A;  3U2R A;  2ZFW A;  3H3Z A;  4AIJ A;  4G94 A;  4M6Y A;  1T39 A;  5HLH A;  2VN2 A;  2L4A A;  2V79 A;  4AIH A;  1OMI A;  4P9U A;  1JHH A;  2AS5 F;  3KZZ A;  3HHH A;  2Z9O A;  3GEZ A;  3KEQ A;  1E17 A;  3EUH A;  4M72 A;  1FWZ A;  4ENK A;  3CO7 C;  1MD0 A;  4Z2Y A;  5J8F A;  2KKO A;  2NRA C;  3EQL F;  4CIC A;  5ILV A;  4PGG A;  2LDU A;  5HDN A;  2VXZ A;  2M45 A;  2XHK A;  2VE8 A;  3ZN0 A;  1KU7 A;  4LLN A;  1CGP A;  4R1H A;  3BJ6 A;  3CUO A;  4GYG A;  1TQI A;  1MGT A;  2Q2E A;  2V1U A;  5J8C A;  4ON0 A;  4BHC A;  3QAH A;  5DD8 A;  2DFI A;  1UFM A;  4IHT A;  2PG4 A;  2XV4 S;  3IWF A;  2Q0O A;  4ENN A;  3TOB A;  2EA4 A;  1YFH A;  2FOK A;  4PCQ A;  3B02 A;  3E3V A;  2F5E A;  3LST A;  5ILU A;  4OMZ A;  1I5Z A;  4JBA A;  3WGH A;  4PGH A;  4EV0 A;  1R00 A;  1Z9C A;  2FQ3 A;  1MJA A;  3V4G A;  4KFC A;  1C0W A;  2E1C A;  5DV5 A;  1T38 A;  3GF2 A;  3E6B A;  3WG9 A;  4L0Y B;  4I98 B;  3IWZ A;  3I71 A;  5ICG A;  1PP7 U;  3BP8 A;  1EH6 A;  3ULQ B;  4FHT A;  2L3D A;  4ZZL A;  2ISZ A;  4EJO A;  1PDN C;  1KA8 A;  4EM0 B;  2CSO A;  1XGM A;  2YSR A;  5CVJ A;  3K69 A;  2K4B A;  3J80 K;  1J9I A;  2FRH A;  3BJA A;  2HTS A;  4R8H A;  1XMK A;  1ODD A;  5FGM A;  4RB3 C;  2L01 A;  5ICE A;  5ILS A;  2OZU A;  1SMT A;  1G6N A;  3GFI A;  1W4M A;  3JAM Z;  4QWQ A;  2O6G E;  4WK8 F;  4G9Y A;  1RNL A;  2F5D A;  1V4R A;  2CW0 F;  3B73 A;  1YS7 A;  2Q8K A;  4KA4 A;  3MWM A;  2OBP A;  1KGS A;  2OQR A;  4WXD A;  4ESF A;  1HQC A;  4MGR A;  2P5V A;  4Y17 A;  2MD5 A;  2XAF A;  4LGW A;  1XMA A;  4LG0 B;  4S05 A;  1OYI A;  1K79 A;  2QQ9 A;  3GYH X;  2VC1 A;  1TW2 A;  2EFO A;  3KP2 A;  2CYY A;  1BOA A;  3DEU A;  4I02 A;  1CF7 A;  2L02 A;  1XSV A;  1R58 A;  2DT5 A;  3I53 A;  1BIA A;  2PFB A;  2HKO A;  1J5Y A;  2K02 A;  3QOP A;  2FU4 A;  2LF8 A;  1BBY A;  5FFX A;  2NYX A;  2XKO A;  1ZAO A;  3D5L A;  3RYP A;  4LK1 F;  5E17 F;  1DUX C;  1Z1D A;  1SD5 A;  1Q1H A;  2FML A; 
#chains in the Genus database with same CATH topology
 3FXK A;  2XAU A;  1R7J A;  1IRG A;  3IHU A;  4C3H J;  3GBG A;  1APL C;  4RB1 A;  3COA C;  1ORK A;  5HDK A;  4IZZ A;  4OOI A;  2D2W A;  4BS9 A;  3SDB A;  3CCV I;  2XSJ C;  3TDZ C;  3W2V A;  1MDM B;  5AIQ A;  2VAS A;  3HC7 A;  1OCT C;  1KQ0 A;  5D5V B;  6PAX A;  2DCE A;  1IN5 A;  3BDD A;  1A6Q A;  4CCM A;  1MND A;  4BXU A;  1GXQ A;  1KYW A;  4J00 A;  1ZLK A;  1XGN A;  4HF0 A;  1OLT A;  2W1O A;  3KET A;  1QZE A;  3A4C A;  5HS7 A;  2EJR A;  2CGP A;  2RDP A;  3LSP A;  2MC3 A;  1FEX A;  2WY7 Q;  3HRU A;  3X2Q H;  3L2R A;  3S93 A;  2R5Y A;  5GAG J;  3T8T A;  2VIX A;  1R22 A;  2DOF A;  2KIF A;  3FM3 A;  2GAU A;  3TMO A;  3FMS A;  1B6A A;  1S6L A;  3HL2 A;  1ZK8 A;  2Z33 A;  4LIV A;  4A2U A;  2M9H A;  3PUB A;  3VEP A;  2JWT A;  4XM3 A;  1G2H A;  2HS5 A;  1DQU A;  4PJN A;  5HVQ C;  2BOL A;  3FKI J;  4LLL A;  3F6V A;  3S32 A;  2L9R A;  4GYI A;  2R7X A;  1JUS A;  3L2V A;  3SEZ A;  4HRI A;  3G1O A;  4EJT A;  3GFL A;  3KPH A;  4E7K A;  5KHD A;  2IA0 A;  5HS8 A;  1OFC X;  4RAY A;  3VYT B;  2ECB A;  4RGX A;  3R4K A;  3SFZ A;  2IPQ X;  2DW4 A;  2VBW A;  3OYF A;  2L5Q A;  4NUB A;  3FM5 A;  2VPR A;  2J5O A;  3QU6 A;  1SMY F;  4HNT A;  1YIT I;  1FT9 A;  2MA3 A;  1X3U A;  1REP C;  2MH2 A;  4HX8 A;  3L09 A;  3KP4 A;  4EJV A;  1LQ1 A;  2JK3 A;  4A69 C;  4I01 A;  2K7L A;  1YW9 A;  3QP6 A;  3RPU A;  4ESB A;  3ML6 A;  1KU9 A;  5LHI A;  3H92 A;  3OIO A;  3JRF A;  4MFE A;  5FLX Z;  4CYC B;  1JXS A;  2BEO A;  3ZQQ A;  3BG5 A;  1LE8 B;  4F3Q A;  2EFQ A;  1YX5 A;  2ZO4 A;  1QPI A;  1OJL A;  4EM2 A;  1WQ2 A;  3GO5 A;  1R5G A;  3BG3 A;  1IZ1 A;  4ZC3 A;  4Z6Y A;  1YHQ I;  1IAW A;  2O03 A;  2VON A;  3B6C A;  4C30 A;  3EYY A;  3I54 A;  5EEA A;  1J59 A;  4OIO F;  1X3Z B;  5EF6 A;  4YFX F;  2K85 A;  3ESW B;  4HEA 2;  3I59 B;  5GAE J;  4XRS A;  3SQN A;  2EFP A;  2FUG 2;  3JRG A;  5HS9 A;  2QBY A;  3TKY A;  3E5X A;  2ZKZ A;  3ECO A;  3E5U A;  3G1L A;  3Q9V A;  4N9H A;  3BJO A;  4R79 A;  3OYA A;  1RKW A;  1QNT A;  1HLV A;  4PJM A;  1D3Y A;  2Y30 A;  4UV9 A;  2K9S A;  1WWX A;  1A6I A;  1TQM A;  4RB2 C;  3CCY A;  5F0C A;  3K4J A;  3HRS A;  3CF5 F;  2VI6 A;  1PUE E;  1GDT A;  3KP6 A;  3JR9 A;  4G7Z F;  3BR3 A;  1YTY A;  5B5E C;  4XIC A;  5HOD A;  2XF5 A;  2FQ4 A;  1R49 A;  2M4K A;  3R6S A;  5J6X A;  3M8F A;  1RKT A;  2V9K A;  1HW1 A;  2VB6 A;  2NAZ A;  1WFX A;  1F9N A;  4EM1 A;  1D1A A;  2W7N A;  2RV8 A;  3HDD A;  2F2E A;  4DQ2 A;  4FX0 A;  2CQQ A;  4K2E A;  4P9F A;  3I3L A;  1U9O A;  4C3I J;  2R7R A;  1BR1 A;  2EH3 A;  4MQ9 F;  1O3T A;  2V6E A;  4ZYH A;  1VQ5 I;  2DT7 B;  2NS0 A;  1F4K A;  5EGO A;  1HW5 A;  4E6K G;  1ON1 A;  5DCM B;  4A12 A;  4GDF A;  2XPU A;  4EMS A;  3I56 I;  3TED A;  3BPX A;  3ZQ7 A;  3HUG A;  3S16 J;  4BXF A;  1TNT A;  2L9N A;  4MFD A;  1VQ4 I;  4KYW A;  4ZYD A;  2R7O A;  1JKQ C;  4ESJ A;  1RIO H;  2JSC A;  5H6Q A;  4I09 A;  2JJ7 A;  2VQH A;  2M2E A;  3R0A A;  2LY1 A;  2DJI A;  4UVC A;  1I1S A;  2XC7 A;  1JKR C;  1ZR4 A;  3K9T A;  3OSF A;  1ETO A;  1G3T A;  1MJ9 A;  4WXH A;  1QA6 A;  4JX6 A;  5FO5 A;  3KZI C;  2ZSI B;  1JT0 A;  1X1B A;  1MMD A;  5EJC A;  3LA7 A;  2CJJ A;  4DBR A;  4HAM A;  4DYQ A;  5IY5 H;  1UB9 A;  4YRV A;  3ABL H;  4EQQ A;  2P6T A;  4BHP A;  3GME A;  3A0H C;  4WWC A;  3NWT A;  2FXA A;  1Z3X A;  2EQR A;  2V9V A;  2MLK A;  2R0Q C;  2F5F A;  2DOA A;  1TT5 B;  4UVA A;  1ZKG A;  2ELH A;  2PX9 A;  3M8J A;  4XLE A;  1UHM A;  2HYF A;  2VLA A;  3T8R A;  1HBX G;  1EH7 A;  2ZC2 A;  4XOP A;  1T95 A;  4IEJ A;  3I64 A;  5CQG A;  2ICW G;  2KZV A;  3I4P A;  1UEL B;  4I6Z A;  3I4N J;  1D8K A;  2JSP A;  2R7W A;  1Z0X A;  2VT3 A;  2E1N A;  2QZ8 A;  1EV7 A;  1QZZ A;  2P8T A;  3FMQ A;  4F7Z A;  2H1K A;  4U0W A;  1YW7 A;  4XKW A;  2GZW A;  5DD4 A;  3ERE D;  1LVK A;  1S7O A;  2BXY A;  2QF7 A;  3AAF A;  2W4S A;  4CDG A;  4A0Z A;  5E1Z B;  4JQF A;  5GPC A;  3TL4 X;  3HOX J;  3BG7 A;  1STZ A;  1MBK A;  1R6R A;  2V9P A;  4U0Y A;  1VND A;  3OS0 A;  1HDD C;  3CDH A;  3OYI A;  1FP1 D;  2WTE A;  4FQG A;  1EJ9 A;  2UUZ A;  4DBQ A;  1YJW I;  4GO1 A;  3E1S A;  2JPB A;  2L4M A;  4RAZ A;  4XR6 A;  4LLG F;  2HQN A;  2K9M A;  3BTL A;  1P2F A;  2LBF A;  1QPM A;  2QQA A;  3BTC A;  3LWF A;  1OQY A;  2EA2 A;  2IGM A;  1QZY A;  2GM4 A;  2MYS A;  3BR5 A;  3QU3 A;  2FSW A;  5J1U A;  2IA1 A;  3F8N A;  1R1T A;  1GV2 A;  3CJT B;  5BPD A;  3S2W A;  4C2U A;  5DEQ A;  1R5H A;  4A3J J;  1M1E B;  2QEX I;  1BA5 A;  4LK0 F;  1XN7 A;  2OU2 A;  5JFR A;  2MLG A;  2DLL A;  2F48 A;  2QKL B;  3GZ6 A;  2VOO A;  2W82 A;  3WU0 A;  1SAX A;  2KIM A;  1B8I A;  4FT8 A;  3HOY J;  4UHT A;  2PJP A;  3M1C A;  2BY2 A;  3O8G A;  1X2M A;  1XG1 A;  4II3 A;  2LKX A;  1ZRD A;  3HTS B;  3KZY A;  4A3L J;  2VQL A;  2VJI A;  5J47 A;  3BG9 A;  1WI3 A;  1U5T C;  4JP0 A;  3JW4 A;  4RS8 A;  3WU1 B;  1XGS A;  1F43 A;  2HDC A;  2O9L A;  1FY7 A;  2YR2 A;  3L2U A;  1BR4 A;  3LOC A;  2DTR A;  5IT3 A;  4OIP F;  4HX4 A;  1W36 C;  1TBX A;  2CUJ A;  4KNY A;  2ZXI A;  3JRH A;  3KYC B;  3F8B A;  3IC7 A;  3CJN A;  3K4K A;  4DJA A;  3J81 K;  2M8E A;  3ISP A;  2EK5 A;  3KEO A;  5A2Q K;  2HOT A;  1YG2 A;  4II2 A;  4HX7 A;  4D1Q A;  5F1R A;  2W00 A;  1AU7 A;  3G3Z A;  2WAQ N;  1SAU A;  4XBF A;  5J1Y A;  1FYL A;  5IYD J;  1D1B A;  1XB4 A;  1ZGJ A;  2EIN H;  1JGG A;  1U8R A;  1GUU A;  3EUA A;  5FJ8 J;  2OCE A;  3WE3 A;  1V54 H;  2GXG A;  1W5T A;  4UNO A;  2OCC H;  1VFC A;  1TC3 C;  4XQF A;  1JGS A;  3MZY A;  4Y33 A;  4Q5S F;  3P9C A;  1J7K A;  1P9Q C;  3FZV A;  3TOA A;  3WE2 A;  1U8B A;  1K78 B;  1WHU A;  1HCR A;  3DKX A;  2A6T A;  3HOT A;  1B9N A;  2PBI A;  2E7W A;  3GFM A;  4AWX B;  3JRD A;  1RR8 C;  4QIW N;  4GFB A;  5D4R A;  3IRR A;  3QPL A;  1ZR2 A;  1WVR A;  1DPU A;  1E2X A;  3SDG A;  2ZSH B;  4HV5 A;  2MGQ A;  4ANJ A;  4FE4 A;  1G3S A;  3K2Z A;  3RIR A;  5E20 A;  3OYC A;  2HVS A;  2E34 A;  4XK4 A;  2E60 A;  1LEA A;  1RZ4 A;  1JTX A;  4AVP A;  1RUN A;  5J4Y A;  4XN0 A;  3O8H A;  1E0E A;  2UXX A;  1T98 A;  2QEN A;  2ADU A;  3L00 A;  2FBK A;  2FEZ A;  4YEJ A;  5FRM A;  3NAU A;  3ZR8 X;  1Y0U A;  2XF7 A;  4RB0 A;  4KIT B;  3IP4 B;  1H9T A;  2HZD A;  2LOO A;  4DOZ A;  2EFN A;  2YS9 A;  1I3Q J;  4ENJ A;  3BRO A;  1K4S A;  1HXD A;  4RLQ A;  1TZL A;  4A0Y A;  4HZF A;  4HV6 A;  4DZJ A;  2LVS A;  4L0Z B;  4ZYE A;  2KRC A;  2HDW A;  5HLG A;  4BE1 A;  3F21 A;  3V42 A;  1IN7 A;  2XAS A;  1LDJ A;  5EG0 A;  3CC7 I;  2IW5 A;  4UUS A;  2HQ5 A;  1MBG A;  3RKW A;  1YRN A;  1SFX A;  2HZT A;  3BZC A;  1KU2 A;  1WSU A;  3L2W A;  3DPU A;  3HIF A;  3UNG C;  3WTY C;  1UAA A;  4EJW A;  3J80 Z;  4NHJ A;  3V8J A;  3OOP A;  2XRL A;  4HPQ A;  3GW2 A;  3T5X A;  1XX5 A;  4JYK A;  2H94 A;  3SZG A;  3K70 C;  2L9V A;  3CUQ C;  3HRM A;  3ERM A;  1ZYR F;  3KP7 A;  2E2I J;  2BHZ A;  3E0J B;  1GV5 A;  4CO8 A;  2CUE A;  3FDY A;  4UB6 C;  1SAN A;  4OAY A;  2FX0 A;  3CCU I;  1A04 A;  2M30 A;  3TDU C;  4BJ6 C;  3LSM A;  2R5Z A;  3RKQ A;  4EGZ A;  3DXJ F;  3KX2 A;  2OV7 A;  2EV5 A;  3GTG J;  5BNG A;  2JT1 A;  3MKL A;  1B72 B;  1TWG J;  2O0Y A;  3C3W A;  2BVM A;  4UUV A;  3C18 A;  2GA1 A;  4BBR J;  2Z1D A;  1X4P A;  2LSO A;  1HST A;  4IRI A;  3TBI A;  3CCE I;  4QLC U;  1S7A A;  2LF7 A;  2CUF A;  2LR8 A;  2XAG A;  3DQV C;  3E97 A;  2MSY A;  2ZME A;  3CC2 I;  4YIF A;  4G6T B;  2G7U A;  3HKZ N;  3OYG A;  1SFU A;  3ZMV A;  4AIK A;  4F55 A;  2VPL A;  1IV8 A;  3CJR B;  2STW A;  4XKB A;  3RJP A;  2L9S A;  2M7B A;  3OYK A;  2GOX B;  2BHY A;  5D5W B;  1PUF B;  2FBI A;  3I4M J;  2Y9Z A;  5K7Z A;  1W0T A;  2K27 A;  2R7Z J;  2H8R A;  1XS9 A;  3BZK A;  3D5S C;  4PJ0 C;  3RTR A;  3PUF A;  4EJU A;  1BI1 A;  3QPS A;  2O8X A;  1NH3 A;  2X6Y A;  2I10 A;  1OYY A;  4XN3 A;  2ESN A;  1IGN A;  1OIS A;  2ETH A;  1P92 A;  2IGN A;  1S7E A;  3T1B A;  4B1R A;  2QVO A;  3MZ8 A;  2M0M A;  5EZH A;  1LKX A;  3QPH A;  3VWB A;  3KFW X;  1T33 A;  2DOD A;  3VSK A;  5IYC J;  3H9Q A;  1BN5 A;  3OMY A;  4CCK A;  2GIZ A;  3M3Y J;  1G59 A;  2CG4 A;  2XB5 A;  4IL6 C;  2EIL H;  3PO2 J;  2HEO A;  4M3E A;  3A01 A;  2DXI A;  1FOX A;  5KNL A;  1Z6T A;  1ENH A;  3WTZ A;  4M9X A;  2KMU A;  2RN7 A;  3ZQH A;  1Y8R B;  1Z77 A;  1A31 A;  2O8K A;  2KPM A;  1IO2 A;  2QQ8 A;  3DPL C;  1W0U A;  4JOM A;  1EKE A;  3F0C A;  3O2P E;  1SFO J;  2JVH A;  4O6J A;  2V7F A;  2VJJ A;  4XLA A;  2UZK A;  5KAI C;  1ETK A;  1B1B A;  3EUK L;  3GCM A;  5IT9 K;  1IN6 A;  3DU5 A;  2A05 A;  1YRN B;  2XRN A;  2BV6 A;  5KVR A;  1OR7 A;  1QRY A;  2Q1Z B;  3HGY A;  4L5J A;  3O3K A;  5D4S A;  2P81 A;  2DMN A;  1G3W A;  2Q2E B;  5J1R A;  2DA1 A;  4H0E A;  2HR3 A;  4E7Z A;  2DMT A;  1F5T A;  4LJZ F;  3RDI A;  1I50 J;  2IVM A;  4KDP A;  2BE5 F;  2BGC A;  1I6H J;  2MD0 A;  3GZ5 A;  2O3F A;  4L9V A;  4BE2 A;  2JRM A;  5FFZ A;  5KCM A;  2MH9 A;  1LEB A;  1AA7 A;  2OAZ A;  2UXN A;  3FIW A;  1PJR A;  1W7P A;  1U9N A;  4OU0 A;  4HQM A;  2FD5 A;  5FKO A;  2XVC A;  3FHN A;  4HDU A;  4NQW A;  3EET A;  2PMZ A;  4CA0 A;  5GTI C;  4E70 A;  1D5V A;  1FBU A;  2BY3 A;  3RPQ A;  1V5E A;  2K86 A;  4BY7 J;  3SHF A;  3JRE A;  4AD9 A;  1LDK B;  4LB5 A;  2JA2 A;  1ETV A;  3F22 A;  2F6C A;  3TGN A;  3GFJ A;  4ASN A;  3FXR A;  4MNU A;  3WU2 C;  3OYM A;  1FMV A;  2P6S A;  5F27 A;  1WJA A;  3K1M A;  3OWT A;  1ZGA A;  1BW6 A;  1T6S A;  3CMY A;  2RRE A;  2EB7 A;  2M87 A;  4WX9 A;  1WJ5 A;  2N8G A;  3C2G A;  4XRF A;  5CLS A;  5F6F A;  4EVI A;  2WV0 A;  2VQG A;  4CGZ A;  2ECC A;  3W6J B;  3GLL A;  2HVQ A;  3DV8 A;  2ID3 A;  5K1Y A;  2W24 A;  4GXO A;  1IRZ A;  2NNY A;  5CQE A;  2QLZ A;  2LG4 A;  3FBN B;  1ETQ A;  1BI3 A;  4JK1 X;  1RR7 A;  2XDV A;  1SVL A;  2Y2Z A;  5IPA A;  2H6B A;  3GTL J;  4IF4 A;  4IKF A;  2QGU A;  5L3D A;  1KQ8 A;  4BAY A;  1V5G A;  3F8C A;  5KAF C;  4IHY A;  3J7Z I;  2VBY A;  3K1P A;  2L7K A;  2RGV A;  3ZN1 A;  4AYB A;  3A01 B;  2RC4 A;  2CV1 A;  4MTE A;  4DW6 A;  1O4X A;  4PZJ A;  2DN0 A;  2WBM A;  3GTM J;  1JJ8 C;  3OOU A;  3C2H A;  2E36 A;  3EPZ A;  1HDP A;  4PDK A;  3ZGK A;  3LNQ A;  2DK8 A;  5HLI A;  2CMP A;  4UXN A;  5B1A H;  1QHH D;  3HJE A;  5EEH A;  4LIU A;  2FJ1 A;  1I39 A;  3I55 I;  2XB0 X;  1Z3Y A;  4IOC F;  1FBQ A;  2P5K A;  4PSX A;  1ETW A;  1R5I D;  1SVO A;  2NNN A;  2DPD A;  2H27 A;  3ZMD A;  4CYD A;  2WWY A;  4BBS J;  2EFW A;  2ZME C;  4E7I A;  3OIQ A;  2BY1 A;  2D45 A;  4BJ5 C;  4MTD A;  4Y4R A;  2A6H F;  3F72 A;  3MEX A;  1BIB A;  1TL8 A;  1O57 A;  2ME0 A;  1UMQ A;  5M3M J;  2CQX A;  4KMF A;  2R7Q A;  2RKH A;  4N4N B;  5AIP A;  3M8E A;  2HTJ A;  2XGX A;  1ZRC A;  2KRH A;  3OR2 C;  4I76 A;  4HNV A;  1ZG1 A;  2IXS A;  2QCO A;  3K2A A;  4BJT A;  4BE0 A;  1WJF A;  3ZQL A;  3K4C A;  1S72 I;  2C6Y A;  3RKX A;  2Z16 A;  2I5U A;  2KRF A;  1NK3 P;  4NC6 A;  3A2K A;  3OYH A;  3G6E I;  3JRA A;  4DNC A;  3LAJ A;  5F64 A;  3SZP A;  5E79 C;  2HQA A;  3BR6 A;  1K4T A;  2M3A A;  3TP3 A;  2DA4 A;  4EAT A;  3R60 A;  5C3E J;  2M1B A;  3CDI A;  4OIN F;  4Y15 A;  3CP2 A;  4HYE A;  4GRI A;  5K5R A;  2DOE A;  1X1D A;  2HYJ A;  3PQK A;  5GPA A;  4Q4Z F;  1EH8 A;  5CVI A;  4KT6 A;  2I8D A;  5TRD A;  3HSR A;  4L5E A;  1IDY A;  4Y52 J;  1CF7 B;  3ZMU A;  2X4H A;  3H5R A;  1QO0 D;  2X6W A;  4OIQ F;  1Q1V A;  2JA5 J;  1MMN A;  5BMZ A;  5DUK A;  5FLV A;  3K1N A;  2A69 F;  3MN2 A;  4LIT A;  1FYM A;  3ECH A;  1AWC A;  3RZO J;  4M9Z A;  3F23 A;  1LNW A;  4EEF G;  1OR7 C;  2E2J J;  4MEX F;  1LJ9 A;  4QPQ A;  4E4H A;  1O3Q A;  2GXA A;  4UY8 I;  4KIB A;  4I2O A;  2XAJ A;  2XAQ A;  3LL7 A;  1ON2 A;  3NAR A;  4KIG A;  1VTN C;  4A6E A;  1XSX A;  1FX7 A;  3KLN A;  5HDG A;  4BEH A;  3A1Y A;  2OD5 A;  2JN6 A;  4IPA A;  4PFP A;  2JTV A;  4WCG A;  1RRJ A;  3K10 A;  3K4L A;  3OYN A;  2ZBK A;  3WGG A;  3JSO A;  3F6O A;  3BWG A;  5H20 A;  3D0S A;  1XPX A;  2BZT A;  3FWE A;  1Z05 A;  1OCC H;  4U87 A;  5EEG A;  4N9I A;  1U5T A;  2V6C A;  4NNJ A;  4DIQ A;  3KIO A;  4FET A;  4LMY A;  3BY6 A;  3CLO A;  2DQL A;  4O5V A;  4G8X A;  4I0A A;  2PN6 A;  2HVR A;  4S0H B;  1H0M A;  1FNN A;  3CZ6 A;  4MIM A;  3QRF F;  3IH3 A;  1V3F A;  3HOZ J;  1X3W B;  2RNG A;  1IW7 F;  1XMX A;  1Z7L A;  3VOD A;  5F08 A;  1ZN2 A;  2FMY A;  1W5C C;  2DMQ A;  2BVL A;  2NVY J;  1Y1W J;  1SD7 A;  3L2C A;  3IUO A;  2IS2 A;  4HBL A;  3KE2 A;  2PJR A;  2WY8 Q;  5JHU A;  1GT0 C;  2LRE A;  2TDX A;  1X1P A;  3SZT A;  1DGW Y;  1I6X A;  2R5Y B;  2ZXJ A;  1RI7 A;  2EV6 A;  1Y39 A;  2E1O A;  4LFU A;  5IP9 J;  3WTW C;  4DYC A;  2FNP A;  3RKY A;  3H5N A;  1IN8 A;  3JCU C;  5LGN A;  5FRN A;  1VI0 A;  5TIS C;  4XMY A;  3LFK A;  4M3G A;  2L54 A;  5ICC A;  1ZTR A;  3K0L A;  3WGI A;  3KYD B;  4XLC A;  5B3S H;  3WTV C;  1FC3 A;  3CF2 A;  4KN4 X;  4M3B A;  3MVP A;  3OL4 A;  4XOR A;  4Y13 A;  4HOB A;  3IKV A;  3I0T A;  1WH7 A;  3AL0 C;  3FK7 A;  1TP4 A;  2VT2 A;  1XTA A;  2W84 A;  4ZYG A;  2LYC A;  2DQR A;  2KQR A;  1LB2 A;  1FOY A;  1E3H A;  2A5Y B;  3J7Y J;  3FK6 A;  3G4S I;  4A6D A;  4ZJZ A;  2Z5U A;  3BQY A;  3QOE A;  5E3O A;  2V1D A;  5LEJ A;  4M73 A;  2RQP A;  2H1L A;  2R7S A;  4M71 A;  1R36 A;  2EWN A;  1AKH A;  1L0O C;  3AG1 H;  1SD4 A;  1ZG3 A;  2QSH X;  2HOA A;  5E8I A;  3ABU A;  3V7R A;  4CH7 A;  4A3M J;  1G8X A;  1TNS A;  2R93 J;  2EIJ H;  3FXU A;  1G4D A;  2XGC A;  4Q48 A;  1IDZ A;  2Y31 A;  2PQ8 A;  3QWL A;  4L18 B;  5DUI A;  3E6D A;  3H5A A;  1BJZ A;  1SFK A;  4PK4 A;  3V7S A;  1BC7 C;  1A35 A;  5CVU A;  1O3R A;  1PP8 F;  4CHU A;  2G9W A;  1UHW A;  3DKW A;  3GUD A;  1MH4 A;  5GAD J;  1QGP A;  3A03 A;  5LBQ A;  4P96 A;  3AKZ A;  3A02 A;  4ZDO A;  4E7H A;  2FOW A;  4AUX A;  2EBI A;  3J81 Z;  4KMU X;  5E1W A;  2QBY B;  3CC4 I;  3CUQ A;  3OV8 A;  4IVN A;  2P4W A;  1JKP C;  1MW7 A;  4CCJ A;  3KYL A;  4HSR A;  3HBL A;  1A36 A;  2FA5 A;  2HXO A;  4BNC A;  2IBD A;  3HOV J;  3P9I A;  3PSF A;  2X6O A;  3V8K A;  3AFH A;  3W6K B;  5HNH A;  1H88 C;  4PJJ A;  1WGX A;  2VKV A;  3TW6 A;  5E3M A;  5CPR B;  4A5N A;  2K3P A;  3SJM A;  2D5V A;  3DTK A;  1MBH A;  1X19 A;  1B9M A;  4V2F A;  1ULY A;  3BQZ A;  2DTZ A;  3SXY A;  1OKR A;  4YFK F;  4RBO A;  1LUJ B;  1XCV A;  5BQT A;  3HM5 A;  4CCL A;  3MD2 A;  1VQ6 I;  2B0L A;  4BKX A;  4J01 A;  3DCF A;  2XPW A;  3DBR B;  3ZMT A;  3VSL A;  4CUG A;  2NXN B;  4D0P A;  5LGU A;  1ACI A;  5EGO B;  1ZHF A;  1KZH A;  1XDU A;  1WJE A;  9ANT A;  5F04 A;  2CFO A;  1O7F A;  2MBF A;  2Y9Y A;  3VPR A;  3HUG B;  3WHB A;  2OUM A;  5E3N A;  4M3F A;  5K7H A;  3BTJ A;  1W1W E;  2UWM A;  2KZG A;  1N25 A;  3PO3 J;  3CTA A;  4BH9 A;  3PFY A;  4RAG A;  1DPR A;  3OY9 A;  1BI0 A;  4A0X A;  1ZGW A;  3MKZ A;  3MAJ A;  1G3Y A;  1GVJ A;  2XSD C;  2ZFU A;  3OSG A;  2ZXH A;  5KK1 A;  1YLF A;  1VQ9 I;  2BY0 A;  2ZXW H;  4F91 B;  3PIP F;  3HZJ A;  2W85 A;  5DTD A;  3HOW J;  1HKQ A;  4I0B A;  1YIJ I;  2X9D A;  2A61 A;  3LAP A;  2M8G X;  3LA2 A;  2E5N A;  5EZG A;  3MKW B;  2Y0S A;  3K6G A;  3TQN A;  4C2M J;  4CCO A;  1X1C A;  5J4V A;  2WAE A;  3BPV A;  3OYD A;  3H35 A;  3Q9S A;  5D8K B;  3L7W A;  3WTS C;  3JRC A;  5CKT A;  1BC8 C;  3GTK J;  3DKY A;  4I7H A;  3ZXS A;  4E7J A;  4B3X A;  3HRT A;  3Q0U A;  2V1X A;  1BOB A;  2DYS H;  2L7F P;  2E71 A;  5CVV A;  4V19 K;  4OMY A;  5EDN A;  1U2W A;  2NVU B;  4N4O B;  2FNA A;  2VJ5 A;  1MBJ A;  2DO7 A;  4RM2 A;  4W97 A;  2HNH A;  2OF7 A;  3M1E A;  2DBB A;  3FXQ A;  1T2K A;  1FTT A;  1N75 A;  4AU7 A;  1SFE A;  2IAI A;  3FXM A;  3I58 A;  2G7H A;  4XON A;  2FE3 A;  2IP2 A;  2HI3 A;  2VKD A;  3DTE A;  2M5W A;  2LD5 A;  1P4W A;  3H0G J;  1XSD A;  5LHH A;  2NVT J;  1BM9 A;  4LB6 B;  2PEX A;  4M9S A;  2HKX A;  3S8P A;  2PMU A;  3PNY A;  3U1D A;  2LBF B;  2Y69 H;  1DGR M;  2XAH A;  1KQ9 A;  1GLN A;  2DA3 A;  4HF1 A;  2RVC A;  4UB8 C;  1UCR A;  2Z2S B;  2XKP A;  1Z91 A;  3JRB A;  3JTG A;  1YJN I;  3S17 J;  4IX7 A;  4ZDP A;  3MZH A;  2IS1 A;  2AXT C;  2V4J C;  2JQ7 A;  2K9L A;  2D1V A;  3FHZ A;  1YJ9 I;  3KEY A;  3VYS B;  3HHG A;  2H8W A;  3ASN H;  1FZP B;  2LMD A;  4ZTF A;  1IN4 A;  1USS A;  2QSF X;  2MG4 A;  1B8I B;  4GCV A;  4A3G J;  1D0X A;  1I1G A;  3TO6 A;  2Y48 A;  2VL8 A;  3VFZ A;  3VDX A;  3ONQ A;  4YFN F;  1S8N A;  3CES A;  1IXC A;  3DEW A;  3F3X A;  4BYY A;  1QQI A;  1DU0 A;  3BR1 A;  4Y3O A;  3GLX A;  2HOS A;  2BXZ A;  3WTU C;  2E2H J;  1HKT A;  2NOG A;  2RQQ A;  2WC2 A;  2NS7 A;  2NS8 A;  2CU7 A;  3DF8 A;  3IKT A;  2GQQ A;  4B8X A;  3CQZ J;  4X6A J;  1Y6I A;  1B4A A;  2CV0 A;  2KJB A;  5IT9 Z;  2YU3 A;  2EV0 A;  1KYZ A;  2EIK H;  1N77 A;  2R3S A;  2TCT A;  5F0H A;  1Z67 A;  2JMW A;  3JSP A;  3PM1 A;  5JI6 A;  2DA2 A;  5K7F A;  4IHW A;  3U9G A;  1ONV A;  4RLF A;  4OIR F;  1P7I A;  1MJB A;  4BY1 J;  3RPU D;  1PYV A;  4B48 A;  3SYT A;  2DAO A;  3VYU B;  2BW3 A;  1R4M B;  2JVG A;  4CZC A;  4YIR X;  2ZNY A;  2F4O B;  4L9J A;  2LY2 A;  1NG7 A;  3PNT A;  3PQJ A;  2E1M B;  2HDD A;  2BBY A;  2HWV A;  2VJ4 A;  2AQE A;  5DCF A;  2Y75 A;  1J75 A;  3BOQ A;  4LG0 A;  2KT0 A;  1ZQ3 P;  3E6C C;  5E8G A;  1ZAR A;  2RAE A;  5FD6 A;  4B43 A;  1ZRE A;  1KU3 A;  3QOD A;  3BT9 A;  4Q47 A;  1OCO H;  4RM3 A;  1FOK A;  3NQO A;  3QYB A;  4S04 A;  4G7H F;  3HB9 A;  4RGU A;  2HGC A;  3HOS A;  3CD6 I;  1K6O A;  4U0V A;  2Z3Y A;  1GHC A;  3QP5 A;  3BCA A;  2QA4 I;  2KLO A;  4MEY F;  3WOD F;  2M4G A;  3AG2 H;  5L3F A;  2H09 A;  2KFD A;  3QPT A;  3ZMZ A;  4HDV A;  2DA6 A;  3IRQ A;  1WH5 A;  2HU9 A;  2FBH A;  3Q0V A;  5JLW A;  3CDL A;  4BQQ A;  2X1E A;  1WJC A;  1YYV A;  2A3S A;  1Z7U A;  3TO9 A;  2QSG X;  4ETS A;  5EG0 B;  3CO6 C;  4UUS B;  1TLH B;  3U1K A;  5LGT A;  4RGS A;  1AHD P;  2KP6 A;  3CLQ A;  2ZCW A;  4UUT A;  4XRM A;  5M5X J;  3PFI A;  3DEE A;  2KIQ A;  1Y0N A;  2EZL A;  3LFU A;  2PI0 A;  3DU6 A;  2PMZ N;  5HOO A;  4IHS A;  3FXJ A;  2F5V A;  1XC5 A;  2OQG A;  5EYR A;  4G12 A;  2KJC A;  3G73 A;  3LA3 A;  4P55 A;  3DP7 A;  2GLO A;  3GTQ J;  1TT0 A;  1YQA A;  2CV2 A;  1ZRF A;  3VOE A;  2DA5 A;  3GVA A;  1I27 A;  2HPI A;  5BOX A;  1JJ6 C;  4BDY A;  3G2B A;  2R5Z B;  1MDM A;  5AON A;  3ABT A;  1WJB A;  4MQV A;  2X1D A;  4GGG A;  4IJA A;  2CH0 A;  1FSH A;  4DZP A;  2EIM H;  1V5F A;  2TRT A;  3W3C A;  4IXA A;  3E6M A;  1MBF A;  2QKM B;  3ZP5 A;  1FMW A;  4FCY A;  2NVX J;  1SD6 A;  3K4N A;  3KP3 A;  4YEL A;  2X6X A;  3RCO A;  3IAM 2;  2V26 A;  2CWE A;  2ZME B;  3DFG A;  4U7B A;  4HST A;  3F8F A;  5LFA A;  4Y7N J;  1MSE C;  1AOY A;  2JRT A;  4YG2 F;  4A3I J;  3C2B A;  5M5Y J;  1TTY A;  2PMH A;  4KIF A;  1J0R A;  4XSZ F;  1X2N A;  1Z6R A;  2GWR A;  1P4A A;  3PL8 A;  4W1U A;  1R23 A;  1IF1 A;  2JZY A;  4B3A A;  4HLY A;  2ID6 A;  4RGR A;  3LSG A;  4AYB N;  3RQI A;  4BGD A;  2GXB A;  1BI2 A;  4XLN F;  1GXP A;  3B6A A;  5JLX A;  4A3B J;  3U21 A;  2VBX A;  1J2X A;  1IXS B;  3EUH C;  4FIS A;  3WTX C;  3S2D J;  4CZZ A;  4XRS G;  1UZC A;  3KCC A;  3ZPL A;  3ASO H;  2FF4 A;  3K70 D;  2GA2 A;  2JUC A;  1HA8 A;  4LOC A;  1POG A;  1D8J A;  4X0G A;  3HTU A;  1FOW A;  3BZ6 A;  4BQN A;  1X58 A;  2F5C A;  4A5M A;  2E35 A;  1YIO A;  3CJQ B;  4MLO A;  4BUP A;  4U7D A;  2A6E F;  1WJD A;  3CCM I;  3LSJ A;  4LD5 A;  1XD7 A;  1WI9 A;  2KL4 A;  3DPT A;  2K9Q A;  2K5C A;  3GX4 X;  4D9J A;  3RYR A;  4A3E J;  2XGE A;  2Y0M A;  2DU9 A;  2IGK A;  4CYC A;  3MMY B;  3WG7 H;  1LE8 A;  3L9F A;  1MNM C;  2WB1 A;  5D8L B;  1FPQ A;  3RI4 A;  3JAM K;  3VYR B;  2K40 A;  3L1P A;  3REO A;  1B59 A;  5FKN A;  1WKM A;  5BPI A;  5J3L A;  4D7N A;  4KUM A;  3I59 A;  4M3D A;  3GTO J;  3H1C A;  3BTI A;  1S29 A;  1FBS A;  2MAB A;  3CMM A;  2LKS A;  1D5Y A;  3HYI A;  5M3F J;  2H6C A;  1EA3 A;  3FXO A;  2IS4 A;  2RNJ A;  3BR2 A;  5BS6 A;  1Z21 A;  2LKP A;  2EPF A;  2IEK A;  5JHF A;  4RA2 A;  1MIJ A;  2XIG A;  1J09 A;  1W7P B;  4F52 A;  3ZQF A;  2IRF G;  3ABM H;  3M7G A;  2DA7 A;  5DDG A;  1H89 C;  5B66 C;  1R9T J;  1LPQ A;  2DK5 A;  4NQW B;  3PJR A;  3CCS I;  1O7L A;  4A3C J;  3KLO A;  3F8M A;  2DI3 A;  5ICF A;  3M9A A;  2DYR H;  1IUF A;  4KN7 X;  4ZTJ A;  3JTH A;  1WPK A;  2E19 A;  4E7S A;  3N97 A;  2EZH A;  3K7A J;  3GTJ J;  1IUY A;  2X48 A;  2DJN A;  4WXC A;  5L3G A;  5DYM A;  5LRS A;  5K5Q A;  4ENM A;  1T08 B;  2M0C A;  1S3J A;  3IH2 A;  4D7M A;  1JHF A;  2D1H A;  2HQR A;  1IJW C;  2F4M B;  4ZYA A;  3R0J A;  2VC0 A;  4F93 B;  1VQN I;  4IHX A;  4FAS D;  3IH4 A;  5DCM A;  4XSX F;  2JPC A;  1R1V A;  3HXL A;  3H3U A;  1P4X A;  2HOE A;  3IV5 A;  5HLT A;  5LHG A;  4QTR A;  2A07 F;  4NC8 A;  5IP6 A;  2ZB9 A;  2YX4 A;  3FMR A;  4FX4 A;  2IJL A;  5L3B A;  1IXR C;  1DP7 P;  1FIA A;  2VBZ A;  3IAS 2;  1JUM A;  3AL0 B;  3MFK A;  2W48 A;  1YW8 A;  1YS6 A;  4HQE A;  2ZNZ A;  4A3K J;  1UG2 A;  4HW0 A;  5F1J A;  4M6X A;  3KP5 A;  1T0F A;  4NC7 A;  4XKV A;  2QM3 A;  2M7A A;  2DFF A;  2VQC A;  4N0B A;  2OJE D;  2ACJ A;  3OR1 C;  3EYI A;  2OZ6 A;  1JI8 A;  3H9G A;  2AHQ A;  3NRV A;  1RET A;  1WCM J;  3HSE A;  2ELJ A;  4H4K C;  2ZJ2 A;  4KT5 C;  2QQB A;  4NDL A;  5H6R A;  3PIO F;  1BJA A;  1FLI A;  2MW8 A;  5DM7 F;  4ABZ A;  2W57 A;  4M74 A;  3ZMS A;  2P7C B;  1XDS A;  1TWA J;  4ZDL A;  2YPR A;  4IRH A;  2B63 J;  3R61 A;  4XLP F;  2PLY A;  4PFO A;  3FX3 A;  3Q3S A;  3A0B C;  2O7O A;  2DT6 A;  2K4J A;  2E7X A;  3LSR A;  1QHG A;  1VQK I;  2A5W A;  1SVM A;  4IQ4 A;  3MQ0 A;  4ZH4 F;  5K5O A;  2AXL A;  2MFZ A;  4IO9 F;  4CXF A;  5LD2 C;  1BR2 A;  2YUS A;  1EF4 A;  5D6F A;  2V1N A;  4EGY A;  3S3O A;  2IT0 A;  1VQ8 I;  1HF0 A;  2P5L C;  1ZG5 A;  2J5P A;  3H36 A;  3V8L A;  2QWW A;  2CUZ A;  3LSH A;  1UST A;  2CQ7 A;  1K7A A;  4NBQ A;  2VOD A;  5D5U B;  3CCR I;  2O5R A;  4IRG A;  1K61 A;  3HGG A;  2CS3 A;  4O3M A;  2NVQ J;  2R7U A;  3J7A O;  1KON A;  2OC6 A;  4XOT A;  4A3F J;  5FD5 A;  5ED4 A;  3HEF A;  3V7C A;  3QYE A;  3S3M A;  1OYW A;  1VQ7 I;  1IRX A;  1RPW A;  2IGO A;  4UV8 A;  1D0Y A;  2QYO A;  3ELK A;  1H9G A;  5FKM A;  2B9S A;  1RUO A;  5JVT A;  5FLX K;  4OAZ A;  3S3N A;  1XGO A;  2R7D A;  1JUP A;  4BEH B;  3E5Q A;  1BW5 A;  2JA8 J;  3Q5F A;  3MCZ A;  5CJ9 A;  1FSE A;  4LG3 A;  3G71 I;  5FB2 A;  1A5J A;  3GXO A;  3ZOB A;  1U6G A;  2K3F A;  1FYK A;  1MMS A;  1MZB A;  4BU2 A;  3OYL A;  5GAH J;  2KIU A;  2XF6 A;  2P7V B;  3CCJ I;  3GWZ A;  2XGD A;  1DDN A;  1FTZ A;  3LQQ A;  5CVR A;  4HF2 A;  4C3J J;  4HA8 A;  2LNB A;  2STT A;  3UKG A;  1U5T B;  4U88 A;  3C7J A;  2YX7 A;  5JVG F;  3BCB A;  4HLX A;  5GTH C;  5A2Q Z;  4BAC A;  1ITY A;  4XNF A;  4D5C A;  2VOP A;  4P1W A;  4TV7 A;  5IYB J;  3ROU A;  5CYV A;  4BQA A;  3NWS A;  4ZZD A;  1YX3 A;  3TP0 A;  1U3E M;  1U78 A;  1XCB A;  4BDZ A;  1HW2 A;  1TW3 A;  3Q0W A;  5LLQ A;  1P6R A;  1RES A;  2DFH A;  2COB A;  1K78 A;  5HNF A;  3N05 A;  4HG2 A;  5DS9 A;  3CCL I;  2PJR B;  3S15 J;  2KHM A;  2R7F A;  3GTP J;  3QQA A;  1NK2 P;  2DMP A;  3P9K A;  1IRF A;  2KDZ A;  1F1Z A;  4KIC A;  3EDP A;  1JE8 A;  3LSK A;  5E3L A;  2VUM J;  1WRJ A;  2DPU A;  2OA4 A;  3I9V 2;  3RQ4 A;  2G0E A;  4OWR B;  3N4M A;  4AID A;  2R7T A;  3H3V K;  4G6D A;  3O6B B;  4L9T A;  2Z99 A;  1HOM A;  5D5X B;  4L9N A;  1OCP A;  1LFB A;  5LRR A;  2IA2 A;  4P5O A;  4UVB A;  3P5J A;  2CQK A;  3TW7 A;  1T8I A;  1MKM A;  5JR3 A;  4M6V A;  1MSF C;  4E7L A;  2OTL I;  2GIV A;  4NB5 A;  5FKK A;  5D6E A;  1L3L A;  4IHV A;  1T0F C;  1W7P D;  2GOM A;  2HXI A;  4G7O F;  2Y0S N;  4QPO A;  2XRO A;  1UJ8 A;  4AC0 A;  3HSF A;  4ITV A;  1AKH B;  1LFU P;  3S1M J;  2OPT A;  1TQP A;  2WV1 A;  4MHG A;  1NTC A;  5E18 F;  3T0Y A;  4G6Q A;  2VKE A;  4BHB A;  1TWC J;  1ZLJ A;  2WAF A;  2HYG D;  2ISY A;  5E1X A;  1D1C A;  1ZEL A;  4AVZ A;  5L3C A;  4A3D J;  1YO5 C;  1HKS A;  2LP0 A;  3WTT C;  5C4X J;  2XUB A;  2X0L A;  1W5S A;  3C1D A;  2K9N A;  2ZJR F;  5C44 J;  4YII A;  4B47 A;  1QBJ A;  4L5I A;  4DGW B;  3BLY A;  3ABK H;  1O3S A;  1LDD A;  3VB2 A;  4WF2 A;  1IG7 A;  2LK2 A;  4XKC A;  2CFX A;  3P7N A;  5GP9 A;  3LQR A;  3FF5 A;  1V55 H;  2EZI A;  1NHA A;  2L0K A;  4A93 J;  2R7V A;  1T56 A;  5FKL A;  3SFI A;  5LEK A;  3SEQ A;  3LSI A;  1OPC A;  2COM A;  2O61 A;  2VE9 A;  4PJL A;  2LLK A;  2W25 A;  3CUQ B;  3NEU A;  5ERI A;  4B09 A;  2KIS A;  2YU9 J;  1E3O C;  3H0D A;  1B72 A;  5L3E A;  2QUF A;  3FKJ A;  2ESH A;  3HPG A;  1IV6 A;  2R4G A;  1ETX A;  4RDU A;  2BYV E;  1WZ2 A;  1FP2 A;  3TO7 A;  5TJJ A;  3I5U A;  1HSJ A;  3MKY B;  1ZH5 A;  1R1U A;  1DU6 A;  3IL2 A;  1LVA A;  4V2G A;  2A68 F;  2P0W A;  2CO5 A;  2HFH A;  3U2R A;  1VF9 A;  1PUF A;  2LRD A;  3K4B A;  2ZFW A;  3AG3 H;  3H3Z A;  2WAQ A;  4AIJ A;  3S1Q J;  4XLF A;  4G94 A;  2IS6 A;  4M6Y A;  1T39 A;  3BC8 A;  3PNV A;  5HLH A;  2VN2 A;  2VKH A;  2L4A A;  2VXD A;  2WAD A;  2ME6 A;  2V79 A;  4AIH A;  1TWH J;  2E5Z A;  5M5W J;  4BL0 B;  3L2Q A;  3OYB A;  4IQJ A;  1YOV B;  1OMI A;  3OIP A;  4P9U A;  1VQP I;  1GVD A;  3QYF A;  3CP8 A;  5H2F C;  1JHH A;  3PSI A;  2AS5 F;  1VQM I;  5DM6 F;  4AM3 A;  3KZZ A;  3HHH A;  2Z9O A;  3GEZ A;  3KEQ A;  1E17 A;  2CQN A;  3D5R C;  4FE7 A;  1N78 A;  3EUH A;  4M72 A;  1FWZ A;  4ENK A;  4KJZ A;  3CO7 C;  1ERD A;  1MD0 A;  3W2W A;  4Z2Y A;  2GBY A;  1UHS A;  4BXX J;  5J8F A;  2DFE A;  2DDB A;  2KKO A;  3EQL F;  2NRA C;  3WHC A;  4C9Y A;  3DWL E;  3DBL B;  4CIC A;  5ILV A;  1SEU A;  4PGG A;  3ZQC A;  2LDU A;  5HDN A;  2VXZ A;  2M45 A;  2XHK A;  1R71 A;  2VE8 A;  3ZN0 A;  3LMM A;  1KU7 A;  1TWF J;  4QSH A;  1CQT A;  1MMG A;  4LLN A;  4B44 A;  1CGP A;  1MBE A;  4R1H A;  1VQL I;  3J7A Y;  3BJ6 A;  3W2A A;  3CUO A;  4GYG A;  1Y56 A;  1TQI A;  1MGT A;  2EZK A;  1YI2 I;  2Q2E A;  2V1U A;  2ZJQ F;  4DYR A;  5J8C A;  4ON0 A;  4BHC A;  2KDO A;  3QAH A;  1Y1V J;  1ETY A;  5DD8 A;  3DBH B;  2AO9 A;  2DFI A;  1UFM A;  4IHT A;  2PG4 A;  2ZJP F;  2XV4 S;  2CW7 A;  1K6Y A;  3HPH A;  3IWF A;  4BQO A;  2Q0O A;  1DP3 A;  4ENN A;  3TOB A;  2EA4 A;  1YFH A;  2FOK A;  2DMU A;  4PCQ A;  5F0F A;  4X1E A;  1LFP A;  1S5L C;  3ZRG A;  3B02 A;  3CMA I;  4J19 A;  3JRI A;  3E3V A;  4F92 B;  3RSN A;  2F5E A;  3LST A;  5ILU A;  4OMZ A;  1I5Z A;  4JBA A;  5FLM J;  4FTH A;  3RZD J;  3WGH A;  1R4N B;  2L2O A;  4PGH A;  4PSW A;  4EV0 A;  1R00 A;  1Z9C A;  1JKO C;  2FQ3 A;  4MO7 A;  1MJA A;  5IOZ A;  3V4G A;  4KFC A;  3F9K A;  1C0W A;  2E1C A;  5DV5 A;  1T38 A;  1NG6 A;  3GF2 A;  1MNE A;  3E6B A;  1W36 D;  3W6V A;  3WG9 A;  1I3A A;  5J40 A;  4L0Y B;  3ZQI A;  1YE9 A;  4I98 B;  4XL9 A;  2DDA A;  3S1N J;  3IWZ A;  1K83 J;  3I71 A;  3HKZ A;  4JX5 A;  5ICG A;  5C4J J;  1PP7 U;  3BP8 A;  1EH6 A;  3ULQ B;  4FHT A;  2L3D A;  4ZZL A;  2ISZ A;  3ZQG A;  4EJO A;  3OYE A;  2LTP A;  1PDN C;  3HG9 A;  1FIP A;  1KA8 A;  4EM0 B;  2CSO A;  2WA0 A;  1XGM A;  2YSR A;  5CVJ A;  3OS2 A;  3K69 A;  2K4B A;  2B7E A;  3J80 K;  1J9I A;  2FRH A;  1IC8 A;  1HC8 A;  2X85 A;  3BJA A;  1Y8Q B;  2HTS A;  1X1A A;  1VZ0 A;  4R8H A;  2CRG A;  1XMK A;  1ODD A;  4XLH A;  3E7L A;  5FGM A;  3BG6 A;  4RB3 C;  4C2T A;  2L01 A;  2NOJ B;  3FXL A;  4RMN A;  2JUG A;  5ICE A;  5ILS A;  2OZU A;  3HOU J;  1SMT A;  1G6N A;  3GFI A;  1W4M A;  5FRO A;  1JT6 A;  3JAM Z;  3H9J A;  2LY9 A;  4QWQ A;  2X1C A;  2O6G E;  4WK8 F;  1F36 A;  4G9Y A;  4KIS A;  1RNL A;  2OTJ I;  3CME I;  1MH3 A;  3GZN B;  2F5D A;  1V4R A;  2L7M P;  4IOA F;  1P7J A;  2CW0 F;  3BR0 A;  3B73 A;  1YS7 A;  2Q8K A;  2E1M C;  2CW8 A;  4KA4 A;  3MWM A;  4XID A;  2BW3 B;  2OBP A;  1UG0 A;  1KGS A;  3CCQ I;  2OQR A;  4WXD A;  3DLL F;  2XPV A;  1HQC A;  2LC2 A;  1QVU A;  4ESF A;  5IP7 J;  4MGR A;  2P5V A;  4Y17 A;  2MD5 A;  2XAF A;  2AQF A;  1OCR H;  1MMA A;  4LGW A;  1SC7 A;  5IOY A;  2JA7 J;  1XMA A;  3M07 A;  4LG0 B;  4S05 A;  1OYI A;  1K79 A;  1H8A C;  2QQ9 A;  3OS1 A;  3GYH X;  2VC1 A;  1QVT A;  1TW2 A;  2EFO A;  3KP2 A;  3S1R J;  2CYY A;  5B1B H;  2ELK A;  2LH9 A;  1FJL A;  1BOA A;  2X51 A;  3DEU A;  4I02 A;  1CF7 A;  2JA6 J;  2M34 A;  1U0J A;  4B4C A;  2L02 A;  1XSV A;  2WB1 N;  3S2H J;  4JX4 A;  1OCZ H;  3AG4 H;  3FIS A;  3G1M A;  1VQO I;  3OL3 A;  4I99 C;  1R58 A;  2DT5 A;  3K4M A;  3I53 A;  5TGT A;  1BIA A;  4CSW A;  1D0Z A;  4PUS A;  2PFB A;  2HKO A;  1J5Y A;  2K02 A;  1JTY A;  3S14 J;  3QOP A;  3DTI A;  4RAF A;  1S9H A;  3FBI B;  3OYJ A;  1RC9 A;  2FU4 A;  2LF8 A;  3ZCO A;  1BBY A;  2UV1 A;  4HNU A;  5FFX A;  2NYX A;  2HPM A;  2XKO A;  2R92 J;  3M4O J;  2LFB A;  3D1N I;  2F4I A;  1ZAO A;  3UR3 C;  3DLA A;  1QU3 A;  1X4O A;  2MC4 A;  1PVE A;  3D5L A;  3RYP A;  1BL0 A;  4LK1 F;  2L7Z A;  5E17 F;  4D5F A;  4CCN A;  1DUX C;  1Z1D A;  1SD5 A;  1Q1H A;  1E3P A;  2FML A; 
#chains in the Genus database with same CATH homology
 1R7J A;  1IRG A;  3IHU A;  4RB1 A;  3COA C;  5HDK A;  4OOI A;  2D2W A;  3TDZ C;  1MDM B;  5AIQ A;  1KQ0 A;  5D5V B;  6PAX A;  1IN5 A;  3BDD A;  4BXU A;  1GXQ A;  1KYW A;  1ZLK A;  1XGN A;  4HF0 A;  3KET A;  5HS7 A;  2EJR A;  2CGP A;  2RDP A;  2MC3 A;  3HRU A;  3T8T A;  1R22 A;  2KIF A;  3FM3 A;  2GAU A;  3FMS A;  1B6A A;  1S6L A;  2Z33 A;  4A2U A;  3VEP A;  2HS5 A;  5HVQ C;  4LLL A;  3F6V A;  4GYI A;  4EJT A;  3GFL A;  2IA0 A;  5HS8 A;  4RAY A;  4RGX A;  3R4K A;  3SFZ A;  2IPQ X;  2DW4 A;  2VBW A;  3FM5 A;  2J5O A;  3QU6 A;  1SMY F;  1FT9 A;  2MA3 A;  1X3U A;  1REP C;  2MH2 A;  4HX8 A;  3L09 A;  3KP4 A;  4EJV A;  1LQ1 A;  4I01 A;  2K7L A;  1YW9 A;  3QP6 A;  3RPU A;  4ESB A;  3ML6 A;  1KU9 A;  5LHI A;  3H92 A;  5FLX Z;  1JXS A;  2BEO A;  2EFQ A;  2ZO4 A;  4EM2 A;  1WQ2 A;  3GO5 A;  1R5G A;  4Q5S F;  1IZ1 A;  2VON A;  1IAW A;  2O03 A;  3EYY A;  3I54 A;  1J59 A;  4OIO F;  4YFX F;  3I59 B;  3SQN A;  2EFP A;  5HS9 A;  2QBY A;  3TKY A;  3E5X A;  2ZKZ A;  3ECO A;  3E5U A;  3Q9V A;  4N9H A;  4R79 A;  3BJO A;  1QNT A;  1D3Y A;  4UV9 A;  1WWX A;  1TQM A;  4RB2 C;  3HRS A;  1PUE E;  3KP6 A;  4G7Z F;  1YTY A;  3R6S A;  5J6X A;  3M8F A;  1HW1 A;  2NAZ A;  1F9N A;  4EM1 A;  2RV8 A;  2F2E A;  4DQ2 A;  4FX0 A;  4K2E A;  4P9F A;  1O3T A;  4MQ9 F;  4ZYH A;  2NS0 A;  1F4K A;  1HW5 A;  1ON1 A;  5DCM B;  4A12 A;  4EMS A;  3BPX A;  3ZQ7 A;  3HUG A;  1TNT A;  4KYW A;  4ZYD A;  4ESJ A;  1RIO H;  2JSC A;  5H6Q A;  4I09 A;  3R0A A;  4UVC A;  1I1S A;  3K9T A;  1G3T A;  1MJ9 A;  4WXH A;  5FO5 A;  3LA7 A;  4HAM A;  1UB9 A;  4EQQ A;  2P6T A;  4BHP A;  4WWC A;  2FXA A;  2V9V A;  2MLK A;  2F5F A;  4UVA A;  2ELH A;  1UHM A;  2HYF A;  3T8R A;  1HBX G;  1EH7 A;  3I64 A;  3I4P A;  1D8K A;  2VT3 A;  2E1N A;  2QZ8 A;  1EV7 A;  1QZZ A;  4F7Z A;  2P8T A;  3FMQ A;  4U0W A;  1YW7 A;  2GZW A;  5DD4 A;  3ERE D;  1S7O A;  3AAF A;  4CDG A;  4A0Z A;  5E1Z B;  4JQF A;  1STZ A;  4U0Y A;  3CDH A;  1FP1 D;  2WTE A;  4GO1 A;  4RAZ A;  2JPB A;  2L4M A;  4LLG F;  2HQN A;  1P2F A;  1QPM A;  2QQA A;  3LWF A;  2EA2 A;  1QZY A;  3QU3 A;  2FSW A;  2IA1 A;  3F8N A;  1R1T A;  5BPD A;  3S2W A;  5DEQ A;  1R5H A;  4LK0 F;  1XN7 A;  2OU2 A;  5JFR A;  2MLG A;  2DLL A;  2VOO A;  3GZ6 A;  3WU0 A;  1SAX A;  2KIM A;  4FT8 A;  4UHT A;  2PJP A;  1ZRD A;  3HTS B;  3KZY A;  1U5T C;  3JW4 A;  4RS8 A;  3WU1 B;  1XGS A;  2HDC A;  1FY7 A;  2YR2 A;  4OIP F;  2DTR A;  5IT3 A;  4HX4 A;  1TBX A;  4KNY A;  3F8B A;  3IC7 A;  3CJN A;  3J81 K;  2M8E A;  3ISP A;  2EK5 A;  3KEO A;  5A2Q K;  1YG2 A;  4HX7 A;  5F1R A;  3G3Z A;  4XBF A;  1FYL A;  1XB4 A;  1ZGJ A;  1U8R A;  3WE3 A;  2GXG A;  1W5T A;  4UNO A;  1JGS A;  3MZY A;  3P9C A;  1J7K A;  3FZV A;  3TOA A;  3WE2 A;  1K78 B;  3HOT A;  1B9N A;  2PBI A;  2E7W A;  3GFM A;  4AWX B;  5D4R A;  3IRR A;  1DPU A;  1E2X A;  4HV5 A;  1G3S A;  3K2Z A;  3RIR A;  5E20 A;  1LEA A;  1RZ4 A;  4AVP A;  1RUN A;  2UXX A;  1T98 A;  2QEN A;  2ADU A;  3L00 A;  2FBK A;  2FEZ A;  1Y0U A;  4RB0 A;  1H9T A;  2EFN A;  4ENJ A;  3BRO A;  1HXD A;  4A0Y A;  4HZF A;  4HV6 A;  4L0Z B;  4ZYE A;  5HLG A;  3F21 A;  1IN7 A;  2XAS A;  1LDJ A;  2IW5 A;  3RKW A;  1SFX A;  2HZT A;  1KU2 A;  1WSU A;  3HIF A;  3WTY C;  4EJW A;  3J80 Z;  4NHJ A;  3V8J A;  3OOP A;  3GW2 A;  3T5X A;  2H94 A;  3CUQ C;  3HRM A;  1ZYR F;  3KP7 A;  4CO8 A;  1A04 A;  2M30 A;  3TDU C;  4EGZ A;  3DXJ F;  2EV5 A;  2JT1 A;  2O0Y A;  3C3W A;  4UUV A;  3C18 A;  2GA1 A;  2LSO A;  1HST A;  4IRI A;  4QLC U;  1S7A A;  2LF7 A;  3DQV C;  2XAG A;  3E97 A;  2ZME A;  4YIF A;  2G7U A;  1SFU A;  3ZMV A;  4AIK A;  2STW A;  3RJP A;  5D5W B;  2FBI A;  2K27 A;  3RTR A;  4EJU A;  1BI1 A;  2O8X A;  1OYY A;  2ESN A;  2ETH A;  1P92 A;  3T1B A;  2QVO A;  3QPH A;  3KFW X;  1BN5 A;  2CG4 A;  2HEO A;  1Z6T A;  3WTZ A;  4M9X A;  2RN7 A;  3DPL C;  3O2P E;  4O6J A;  2UZK A;  1B1B A;  5IT9 K;  1IN6 A;  2XRN A;  2BV6 A;  5KVR A;  1OR7 A;  4L5J A;  3O3K A;  5D4S A;  1G3W A;  4H0E A;  2HR3 A;  1F5T A;  4LJZ F;  3RDI A;  2IVM A;  4KDP A;  2BE5 F;  2BGC A;  3GZ5 A;  2O3F A;  4L9V A;  5FFZ A;  2MH9 A;  1LEB A;  2OAZ A;  2UXN A;  1W7P A;  4OU0 A;  4HQM A;  2XVC A;  4HDU A;  4NQW A;  3EET A;  4E70 A;  1D5V A;  1FBU A;  3RPQ A;  2K86 A;  3SHF A;  4AD9 A;  1LDK B;  4LB5 A;  3F22 A;  3TGN A;  3GFJ A;  4ASN A;  3FXR A;  4MNU A;  2P6S A;  3K1M A;  1ZGA A;  1T6S A;  2EB7 A;  2M87 A;  4WX9 A;  4XRF A;  5CLS A;  5F6F A;  4EVI A;  2WV0 A;  4CGZ A;  3W6J B;  5K1Y A;  3DV8 A;  2W24 A;  4GXO A;  2NNY A;  2QLZ A;  1BI3 A;  4JK1 X;  2H6B A;  4IF4 A;  5L3D A;  1KQ8 A;  4BAY A;  3F8C A;  2VBY A;  3K1P A;  2RGV A;  3ZN1 A;  2RC4 A;  4MTE A;  4PZJ A;  4PDK A;  2DK8 A;  5HLI A;  4UXN A;  5EEH A;  1FBQ A;  2P5K A;  2NNN A;  2DPD A;  2H27 A;  3ZMD A;  4CYD A;  2WWY A;  2EFW A;  2D45 A;  4MTD A;  2A6H F;  3F72 A;  3MEX A;  1BIB A;  1O57 A;  4KMF A;  2RKH A;  5AIP A;  3M8E A;  2HTJ A;  2XGX A;  1ZRC A;  1ZG1 A;  2C6Y A;  3RKX A;  2KRF A;  4DNC A;  3LAJ A;  5F64 A;  3SZP A;  3R60 A;  2M1B A;  4OIN F;  4Y15 A;  4HYE A;  5K5R A;  3PQK A;  4Q4Z F;  1EH8 A;  5CVI A;  5TRD A;  3HSR A;  1CF7 B;  3ZMU A;  2X4H A;  1QO0 D;  4OIQ F;  5BMZ A;  5DUK A;  3K1N A;  2A69 F;  1FYM A;  3ECH A;  1AWC A;  4M9Z A;  3F23 A;  1LNW A;  4MEX F;  1LJ9 A;  1O3Q A;  4KIB A;  4I2O A;  2XAJ A;  2XAQ A;  1ON2 A;  4KIG A;  1VTN C;  4A6E A;  1XSX A;  1FX7 A;  3KLN A;  5HDG A;  2OD5 A;  4IPA A;  2JTV A;  4WCG A;  2ZBK A;  3WGG A;  3JSO A;  3F6O A;  3BWG A;  5H20 A;  3D0S A;  3FWE A;  1Z05 A;  5EEG A;  4N9I A;  1U5T A;  2V6C A;  4LMY A;  3BY6 A;  3CLO A;  2DQL A;  4O5V A;  4G8X A;  4I0A A;  2PN6 A;  1H0M A;  1FNN A;  3QRF F;  1V3F A;  1IW7 F;  3VOD A;  1ZN2 A;  2FMY A;  1SD7 A;  3L2C A;  4HBL A;  3KE2 A;  5JHU A;  2TDX A;  3SZT A;  1I6X A;  2ZXJ A;  1RI7 A;  2EV6 A;  4LFU A;  3WTW C;  2FNP A;  3RKY A;  1IN8 A;  5LGN A;  3LFK A;  2L54 A;  5ICC A;  3K0L A;  3WGI A;  3WTV C;  1FC3 A;  4KN4 X;  4Y13 A;  4HOB A;  3IKV A;  3I0T A;  2VT2 A;  4ZYG A;  2W84 A;  2DQR A;  1LB2 A;  2A5Y B;  4A6D A;  2Z5U A;  2V1D A;  5LEJ A;  4M73 A;  2RQP A;  4M71 A;  1R36 A;  2EWN A;  1L0O C;  1SD4 A;  1ZG3 A;  5E8I A;  3ABU A;  3V7R A;  1TNS A;  1G4D A;  3FXU A;  4Q48 A;  2PQ8 A;  4L18 B;  5DUI A;  3E6D A;  3V7S A;  1BC7 C;  5CVU A;  1O3R A;  1PP8 F;  4CHU A;  2G9W A;  1UHW A;  3DKW A;  3GUD A;  1QGP A;  5LBQ A;  4P96 A;  3J81 Z;  4KMU X;  5E1W A;  2QBY B;  3CUQ A;  3OV8 A;  4IVN A;  2P4W A;  2FA5 A;  4BNC A;  3P9I A;  3V8K A;  3W6K B;  4A5N A;  1B9M A;  1ULY A;  3SXY A;  1OKR A;  4YFK F;  1XCV A;  5BQT A;  2B0L A;  3ZMT A;  4D0P A;  5LGU A;  1ZHF A;  1XDU A;  1O7F A;  2MBF A;  2UWM A;  3CTA A;  4BH9 A;  1DPR A;  1BI0 A;  4A0X A;  3MAJ A;  1G3Y A;  1GVJ A;  5KK1 A;  1YLF A;  2W85 A;  1HKQ A;  4I0B A;  2A61 A;  3LAP A;  3LA2 A;  3TQN A;  3BPV A;  3Q9S A;  5D8K B;  3L7W A;  3WTS C;  1BC8 C;  4I7H A;  3HRT A;  2V1X A;  5CVV A;  4OMY A;  1U2W A;  2FNA A;  2DO7 A;  3M1E A;  2DBB A;  3FXQ A;  1T2K A;  1SFE A;  3I58 A;  2G7H A;  2FE3 A;  2IP2 A;  2M5W A;  1P4W A;  1XSD A;  5LHH A;  1BM9 A;  4LB6 B;  2PEX A;  4M9S A;  2HKX A;  2PMU A;  3U1D A;  2XAH A;  1KQ9 A;  4HF1 A;  2RVC A;  1UCR A;  2XKP A;  1Z91 A;  3JTG A;  3MZH A;  2D1V A;  3FHZ A;  3HHG A;  1FZP B;  1IN4 A;  1USS A;  4GCV A;  1I1G A;  3TO6 A;  2Y48 A;  3VFZ A;  4YFN F;  1S8N A;  1IXC A;  3F3X A;  4BYY A;  1QQI A;  3GLX A;  3WTU C;  1HKT A;  2WC2 A;  3DF8 A;  3IKT A;  2GQQ A;  4B8X A;  5IT9 Z;  1B4A A;  2KJB A;  2YU3 A;  2EV0 A;  1KYZ A;  2R3S A;  3JSP A;  5JI6 A;  3U9G A;  1ONV A;  4OIR F;  1MJB A;  2DAO A;  2ZNY A;  4L9J A;  3PQJ A;  2BBY A;  2HWV A;  5DCF A;  2Y75 A;  1J75 A;  3BOQ A;  4LG0 A;  3E6C C;  5E8G A;  1ZAR A;  5FD6 A;  1ZRE A;  1KU3 A;  4Q47 A;  1FOK A;  3NQO A;  4S04 A;  4G7H F;  4RGU A;  3HOS A;  2HGC A;  1K6O A;  4U0V A;  2Z3Y A;  1GHC A;  3QP5 A;  4MEY F;  3WOD F;  5L3F A;  2H09 A;  3QPT A;  3ZMZ A;  4HDV A;  3IRQ A;  2FBH A;  1YYV A;  2A3S A;  1Z7U A;  3TO9 A;  4ETS A;  3CO6 C;  1TLH B;  5LGT A;  4RGS A;  2ZCW A;  3PFI A;  2PI0 A;  5HOO A;  4IHS A;  2OQG A;  3G73 A;  2KJC A;  3LA3 A;  4P55 A;  3DP7 A;  1YQA A;  1ZRF A;  3VOE A;  3GVA A;  1I27 A;  5BOX A;  1MDM A;  5AON A;  3ABT A;  4MQV A;  4GGG A;  4IJA A;  1FSH A;  4IXA A;  3E6M A;  3ZP5 A;  1SD6 A;  3KP3 A;  2CWE A;  2ZME B;  3DFG A;  4U7B A;  3F8F A;  1AOY A;  2JRT A;  4YG2 F;  1TTY A;  2PMH A;  4KIF A;  1J0R A;  4XSZ F;  1Z6R A;  2GWR A;  1P4A A;  1R23 A;  1IF1 A;  2JZY A;  4HLY A;  4RGR A;  2GXB A;  1BI2 A;  4XLN F;  1GXP A;  2VBX A;  1J2X A;  3WTX C;  1IXS B;  4CZZ A;  3KCC A;  3ZPL A;  2FF4 A;  2GA2 A;  1D8J A;  3HTU A;  3BZ6 A;  2F5C A;  4A5M A;  1YIO A;  4U7D A;  2A6E F;  4LD5 A;  1XD7 A;  1WI9 A;  3DPT A;  3GX4 X;  3RYR A;  2Y0M A;  2DU9 A;  3L9F A;  5D8L B;  1FPQ A;  3RI4 A;  3JAM K;  3REO A;  1B59 A;  1WKM A;  5BPI A;  4KUM A;  3I59 A;  1S29 A;  1FBS A;  3HYI A;  2H6C A;  2RNJ A;  5BS6 A;  2LKP A;  2XIG A;  1W7P B;  2IRF G;  3M7G A;  5DDG A;  2DK5 A;  1O7L A;  3KLO A;  3F8M A;  2DI3 A;  5ICF A;  3M9A A;  4KN7 X;  3JTH A;  3N97 A;  1IUY A;  4WXC A;  5L3G A;  5LRS A;  5K5Q A;  5DYM A;  4ENM A;  1S3J A;  1JHF A;  2D1H A;  2HQR A;  3R0J A;  2VC0 A;  5DCM A;  4XSX F;  2JPC A;  1R1V A;  3H3U A;  1P4X A;  2HOE A;  5LHG A;  2A07 F;  2YX4 A;  3FMR A;  4FX4 A;  2IJL A;  5L3B A;  1IXR C;  1DP7 P;  2VBZ A;  3MFK A;  1YW8 A;  1YS6 A;  4HQE A;  2ZNZ A;  4HW0 A;  4M6X A;  3KP5 A;  1T0F A;  2QM3 A;  4N0B A;  2ACJ A;  3EYI A;  2OZ6 A;  3NRV A;  3HSE A;  4KT5 C;  2ZJ2 A;  2QQB A;  5H6R A;  1BJA A;  1FLI A;  2W57 A;  4M74 A;  3ZMS A;  2P7C B;  1XDS A;  2YPR A;  4IRH A;  3R61 A;  4XLP F;  2PLY A;  3FX3 A;  2K4J A;  2E7X A;  3MQ0 A;  4ZH4 F;  5K5O A;  2AXL A;  4CXF A;  5D6F A;  4EGY A;  2IT0 A;  2P5L C;  1ZG5 A;  2J5P A;  3V8L A;  2QWW A;  1UST A;  1K7A A;  2VOD A;  5D5U B;  4IRG A;  4O3M A;  3J7A O;  5FD5 A;  5ED4 A;  3V7C A;  1OYW A;  4UV8 A;  2QYO A;  3ELK A;  1H9G A;  1RUO A;  5JVT A;  5FLX K;  1XGO A;  2R7D A;  3E5Q A;  3Q5F A;  3MCZ A;  5CJ9 A;  1FSE A;  5FB2 A;  3GXO A;  1U6G A;  1FYK A;  1MZB A;  2KIU A;  2P7V B;  3GWZ A;  1DDN A;  3LQQ A;  5CVR A;  4HF2 A;  4HA8 A;  2LNB A;  2STT A;  1U5T B;  4U88 A;  3C7J A;  2YX7 A;  4HLX A;  5A2Q Z;  2VOP A;  4TV7 A;  3ROU A;  5CYV A;  4BQA A;  4ZZD A;  1U3E M;  1U78 A;  1XCB A;  1HW2 A;  1TW3 A;  5LLQ A;  1P6R A;  1K78 A;  2R7F A;  3P9K A;  1IRF A;  1F1Z A;  4KIC A;  3EDP A;  1JE8 A;  1WRJ A;  2DPU A;  2OA4 A;  3N4M A;  4G6D A;  3O6B B;  4L9T A;  2Z99 A;  5D5X B;  4L9N A;  5LRR A;  2IA2 A;  4P5O A;  4UVB A;  2CQK A;  1MKM A;  5JR3 A;  2GIV A;  4NB5 A;  1L3L A;  5D6E A;  1W7P D;  4G7O F;  2XRO A;  3HSF A;  1TQP A;  4MHG A;  5E18 F;  3T0Y A;  4G6Q A;  4BHB A;  1ZLJ A;  2HYG D;  2ISY A;  5E1X A;  5L3C A;  1YO5 C;  1HKS A;  3WTT C;  2XUB A;  2X0L A;  1W5S A;  3C1D A;  4YII A;  1QBJ A;  4L5I A;  1O3S A;  1LDD A;  3VB2 A;  4WF2 A;  2CFX A;  3P7N A;  3LQR A;  3FF5 A;  1NHA A;  5LEK A;  1OPC A;  2COM A;  2O61 A;  2VE9 A;  2W25 A;  3CUQ B;  3NEU A;  5ERI A;  4B09 A;  5L3E A;  2QUF A;  2ESH A;  2BYV E;  1FP2 A;  3TO7 A;  5TJJ A;  3I5U A;  1HSJ A;  1ZH5 A;  1R1U A;  3IL2 A;  1LVA A;  2A68 F;  2CO5 A;  2HFH A;  3U2R A;  2ZFW A;  3H3Z A;  4AIJ A;  4G94 A;  4M6Y A;  1T39 A;  5HLH A;  2VN2 A;  2L4A A;  2V79 A;  4AIH A;  1OMI A;  4P9U A;  1JHH A;  2AS5 F;  3KZZ A;  3HHH A;  2Z9O A;  3GEZ A;  3KEQ A;  1E17 A;  3EUH A;  4M72 A;  1FWZ A;  4ENK A;  3CO7 C;  1MD0 A;  4Z2Y A;  5J8F A;  2KKO A;  2NRA C;  3EQL F;  4CIC A;  5ILV A;  4PGG A;  2LDU A;  5HDN A;  2VXZ A;  2M45 A;  2XHK A;  2VE8 A;  3ZN0 A;  1KU7 A;  4LLN A;  1CGP A;  4R1H A;  3BJ6 A;  3CUO A;  4GYG A;  1TQI A;  1MGT A;  2Q2E A;  2V1U A;  5J8C A;  4ON0 A;  4BHC A;  3QAH A;  5DD8 A;  2DFI A;  1UFM A;  4IHT A;  2PG4 A;  2XV4 S;  3IWF A;  2Q0O A;  4ENN A;  3TOB A;  2EA4 A;  1YFH A;  2FOK A;  4PCQ A;  3B02 A;  3E3V A;  2F5E A;  3LST A;  5ILU A;  4OMZ A;  1I5Z A;  4JBA A;  3WGH A;  4PGH A;  4EV0 A;  1R00 A;  1Z9C A;  2FQ3 A;  1MJA A;  3V4G A;  4KFC A;  1C0W A;  2E1C A;  5DV5 A;  1T38 A;  3GF2 A;  3E6B A;  3WG9 A;  4L0Y B;  4I98 B;  3IWZ A;  3I71 A;  5ICG A;  1PP7 U;  3BP8 A;  1EH6 A;  3ULQ B;  4FHT A;  2L3D A;  4ZZL A;  2ISZ A;  4EJO A;  1PDN C;  1KA8 A;  4EM0 B;  2CSO A;  1XGM A;  2YSR A;  5CVJ A;  3K69 A;  2K4B A;  3J80 K;  1J9I A;  2FRH A;  3BJA A;  2HTS A;  4R8H A;  1XMK A;  1ODD A;  5FGM A;  4RB3 C;  2L01 A;  5ICE A;  5ILS A;  2OZU A;  1SMT A;  1G6N A;  3GFI A;  1W4M A;  3JAM Z;  4QWQ A;  2O6G E;  4WK8 F;  4G9Y A;  1RNL A;  2F5D A;  1V4R A;  2CW0 F;  3B73 A;  1YS7 A;  2Q8K A;  4KA4 A;  3MWM A;  2OBP A;  1KGS A;  2OQR A;  4WXD A;  4ESF A;  1HQC A;  4MGR A;  2P5V A;  4Y17 A;  2MD5 A;  2XAF A;  4LGW A;  1XMA A;  4LG0 B;  4S05 A;  1OYI A;  1K79 A;  2QQ9 A;  3GYH X;  2VC1 A;  1TW2 A;  2EFO A;  3KP2 A;  2CYY A;  1BOA A;  3DEU A;  4I02 A;  1CF7 A;  2L02 A;  1XSV A;  1R58 A;  2DT5 A;  3I53 A;  1BIA A;  2PFB A;  2HKO A;  1J5Y A;  2K02 A;  3QOP A;  2FU4 A;  2LF8 A;  1BBY A;  5FFX A;  2NYX A;  2XKO A;  1ZAO A;  3D5L A;  3RYP A;  4LK1 F;  5E17 F;  1DUX C;  1Z1D A;  1SD5 A;  1Q1H A;  2FML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...