4ESBA

Crystal structure of padr-like transcriptional regulator (bc4206) from bacillus cereus strain atcc 14579
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
SQMLKGVLEGCILYIISQEEVYGYELSTKLNKHGFTFVSEGSIYPLLLRMQKEKLIEGTLKASSLGPKRKYYHITDKGLEQLEEFKQSWGMVSTTVNNLLQGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, PadR family
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esbA00
3EDPA 1JHHA 2KIUA 2LF7A 4UVCA 5BPDA 3G73A 4WXHA 4PDKA 1P2FA 3WE2A 3P9CA 1S3JA 1L3LA 4LB5A 4IRGA 3CTAA 5HVQC 5LEJA 5CYVA 2EFPA 2FMLA 5CVIA 4NB5A 1RUNA 4XLNF 2W85A 1T39A 3GUDA 3KEQA 2W25A 2A5YB 1S7AA 2ESNA 2WV0A 3KEOA 4N9IA 4L0YB 1TW3A 2QWWA 4B8XA 4M6XA 3M7GA 1P4WA 3G3ZA 1MGTA 4KMFA 1EH8A 1ON2A 2RGVA 3GEZA 2XAHA 4P5OA 3TO7A 5E20A 4U88A 4XLPF 5LRSA 3F23A 2HS5A 4XRFA 5JVTA 3R61A 2O03A 1SD7A 3VB2A 4A5MA 3HTSB 2P7VB 2CWEA 2M87A 1DUXC 1G3WA 2F5FA 2VODA 3M1EA 3I0TA 2QENA 4L9JA 5LEKA 2BYVE 3RKYA 2FSWA 4UVBA 1ZRDA 3ISPA 2PLYA 3MEXA 4L0ZB 2P6TA 2PJPA 1OYIA 3FF5A 1G3SA 4ZZDA 2IW5A 4UVAA 3HHHA 2Z3YA 5J8CA 1LEAA 1PP8F 3RTRA 1UB9A 4OINF 4S05A 2MH9A 4PGGA 5HOOA 3BJOA 1O3SA 4P9FA 2FNAA 2E1CA 2OU2A 4M9ZA 1P92A 5K5RA 2DTRA 2FBHA 1U5TC 3WGGA 4PGHA 3CJNA 4I09A 1Z7UA 4HLXA 2DLLA 3KLNA 4KFCA 1JGSA 1KYWA 3RYRA 4RS8A 4XBFA 1KQ8A 2HEOA 2EJRA 3KP2A 5BMZA 2MBFA 3RJPA 5E1WA 4BHPA 1IXCA 3WGIA 2A07F 1J0RA 1K6OA 3WTSC 3R6SA 1JE8A 1R22A 3DXJF 2DU9A 5ICGA 2M30A 3GLXA 4HAMA 3BROA 3V7RA 3FM5A 3HSFA 1EH6A 4M9XA 2OAZA 1T6SA 2QQAA 3C7JA 4DQ2A 5CJ9A 1P4XA 2W84A 4XSXF 1FT9A 2QZ8A 1B9MA 2TDXA 2DBBA 2XAQA 4U7DA 1PP7U 1QO0D 4I02A 1NHAA 3ZMSA 2P5VA 2ZFWA 1LDKB 4ZYDA 1LJ9A 2H94A 1F1ZA 1SFEA 4LLLA 3ZMDA 1O3TA 3O6BB 3N4MA 2EK5A 1W7PB 5LGNA 2RQPA 5E8IA 3ABUA 3EUHA 1GVJA 1OPCA 1T0FA 5L3EA 5BPIA 1WI9A 2MC3A 1H9TA 1T38A 2J5OA 3ZMUA 2D1VA 2DFIA 2Q8KA 1D5VA 1IZ1A 3QRFF 1XSDA 2ZJ2A 1TQPA 3DFGA 3TO9A 3V8KA 2VONA 3ABTA 1STZA 3BPVA 3W6JB 3D5LA 3P7NA 2FOKA 3TOBA 3HRTA 3QU3A 4R1HA 3QP6A 3ERED 3QPHA 1LB2A 2DQRA 3GWZA 4HOBA 4AIHA 3IC7A 2XKPA 5K5OA 4MTDA 1J75A 2DT5A 2AS5F 1TLHB 2ISZA 1UHWA 1OYYA 1TTYA 3WODF 1B1BA 1USSA 3F8CA 1ULYA 3HTUA 2RDPA 1QZYA 1UCRA 1W7PD 1YS7A 2EA2A 4GYIA 4A5NA 4G94A 1DPRA 2XGXA 5DV5A 4LG0B 2FBIA 2IT0A 2PN6A 1EV7A 5FFZA 4HZFA 1U5TB 2JPBA 2ETHA 5CVUA 1SAXA 4DNCA 2JT1A 3REOA 1K7AA 3LQQA 3NEUA 2A6HF 4ZZLA 4A0YA 1FYMA 5A2QK 3ZMVA 5HLHA 1PUEE 1D8KA 1S8NA 3J81K 2DK8A 3FZVA 4G7ZF 2CYYA 4N9HA 2COMA 4EV0A 2A6EF 1LDDA 1GXQA 4QWQA 4UXNA 2A68F 3CO6C 2XAFA 1ZREA 2HKXA 2JRTA 3TO6A 4ENMA 1QGPA 4YFKF 5LHGA 4HX8A 1G6NA 2VBYA 3K69A 1EH7A 3LFKA 4A2UA 4KT5C 1TNSA 3ZQ7A 2AXLA 1B6AA 2L3DA 2RN7A 5DYMA 1CGPA 2FMYA 1HKSA 2GA2A 2P8TA 2BEOA 3KP4A 1BN5A 2E7XA 3SZTA 3VOEA 1W4MA 2XUBA 3HRMA 3J80K 2K4BA 2HGCA 2GXGA 4CYDA 1R5HA 1ZG5A 4Y15A 1R00A 2D1HA 4EM2A 2K4JA 3FM3A 1ZARA 1XSXA 4F7ZA 2STWA 2Y0MA 3I64A 1XD7A 4MEXF 1W5SA 1YG2A 5E8GA 1TQIA 1O3QA 1ZLKA 5CVRA 1CF7A 4HYEA 3HRUA 4JQFA 3I71A 2K86A 4G6QA 4G8XA 5L3BA 3ML6A 1KQ0A 1QPMA 3E6MA 4GO1A 3HUGA 2Z5UA 1TW2A 3L00A 1KU2A 1YIOA 1KA8A 4CO8A 2KIFA 1ZHFA 4ESFA 4I2OA 3RDIA 1OMIA 2A69F 4U7BA 3E3VA 3KZZA 4L9NA 4EGZA 4G7HF 3VEPA 3KZYA 3H92A 3VODA 2PBIA 1ZRCA 3JW4A 1BI3A 1I27A 3ELKA 1YW7A 1J5YA 1V4RA 4OIPF 2D45A 1HQCA 4EGYA 5AONA 3RKWA 5HS8A 1ZN2A 2Y75A 3FXUA 4OOIA 1TBXA 5HLGA 3DF8A 1MDMB 4KYWA 3J80Z 2MLKA 1Z05A 4ZYEA 2E1NA 2V1XA 5J6XA 2HR3A 3LAJA 1F5TA 4I0AA 2VT2A 2V1UA 2X0LA 3PQKA 3MQ0A 4M72A 5D4RA 3T8RA 1BC8C 1XGOA 2W57A 3I53A 1YW9A 1ON1A 4L9VA 5E1XA 5DEQA 1D3YA 2QYOA 3GF2A 1ZGAA 2H6BA 2CQKA 1MKMA 3TQNA 2FEZA 3WTZA 4KN7X 5LHHA 3ROUA 1T98A 2P6SA 2D2WA 2H09A 3EETA 1YTYA 3ZN0A 3K9TA 4RGXA 3JAMK 6PAXA 1REPC 1KU3A 4S04A 3KCCA 2CFXA 4FX0A 2PG4A 2V6CA 2ZNYA 3KFWX 4M6YA 3FMQA 2IJLA 5DCFA 4KMUX 1U6GA 2ZO4A 4IVNA 2RKHA 4G6DA 1BI0A 1J9IA 3SHFA 1E2XA 3DV8A 3ZN1A 1XB4A 1H0MA 3GFLA 2FRHA 3R60A 3QPTA 4Q4ZF 5DUKA 1HW1A 4HX4A 5HDKA 5HLIA 4MHGA 3COAC 2G9WA 1Q1HA 3TGNA 2OD5A 3QU6A 2JZYA 3CDHA 2R7DA 3BY6A 3RYPA 2EA4A 3E5QA 4QLCU 1UFMA 1AOYA 3OOPA 2Q0OA 2Z33A 1IXRC 3R0JA 5L3FA 4EJOA 2LSOA 2GA1A 3CUQA 3DPTA 1FOKA 2ZMEA 1A04A 3J7AO 4L5JA 1UHMA 3JAMZ 5HS9A 1ODDA 4B09A 2NNNA 5E18F 2G7UA 1K78B 2F5DA 3TDZC 4K2EA 5L3CA 2YPRA 4HV6A 1J7KA 3U1DA 1B9NA 4R79A 4M71A 2ZXJA 4KNYA 1MDMA 4IHSA 1KU9A 4LMYA 1O57A 4RGUA 5LRRA 3CLOA 4M73A 1DP7P 3F72A 1FBSA 1BI2A 3BZ6A 1HSTA 2A61A 2PFBA 4ZH4F 4O6JA 3WG9A 1I5ZA 4IRIA 3MCZA 1SD5A 3HOTA 2EV0A 4LK0F 2P4WA 5IT3A 5HDGA 2XROA 3CO7C 3EYIA 3HSRA 2XV4S 2HKOA 3ZPLA 4GXOA 3GW2A 4BHCA 1SFUA 1RI7A 2L02A 2QBYB 2HQNA 2CGPA 5CVJA 5FD5A 1JXSA 2CW0F 3E97A 4KN4X 1RNLA 3GVAA 3LQRA 2EFNA 5H20A 1FYLA 3JTHA 1Z1DA 4RB1A 2HYGD 2KRFA 5DD8A 3E6CC 4HLYA 1U78A 4WXCA 5E1ZB 2UWMA 2VE8A 3WGHA 1BBYA 2A3SA 2PEXA 1QQIA 5D5VB 5K1YA 1R36A 3V7CA 2X4HA 2GZWA 4YFNF 4HF0A 3BJ6A 2GAUA 4Q48A 3GZ6A 3EYYA 3I59B 5FLXK 3HSEA 2HFHA 3CUOA 5BOXA 2VBZA 2O6GE 5FO5A 1IN7A 3IWZA 3V8LA 2HZTA 2XHKA 1OR7A 2L4AA 4KA4A 1HBXG 4A0ZA 1R5GA 3HOSA 1T2KA 4P55A 1O7LA 3WTUC 1BIBA 3DQVC 4CDGA 4LB6B 2F2EA 2IA0A 4CXFA 4BQAA 3V8JA 4R8HA 2BE5F 4U0YA 4Z2YA 2W24A 5D4SA 2VN2A 1YO5C 2VT3A 1IUYA 3C3WA 4KIFA 3BDDA 2KJBA 4YFXF 2QQBA 2ESHA 5F6FA 4OMYA 3KP3A 2WTEA 2R7FA 3WU0A 3K1PA 4RAYA 1BJAA 3L9FA 3WTTC 2O61A 4AWXB 1LEBA 1U8RA 2HWVA 2P7CB 3GXOA 1F9NA 1S7OA 1R7JA 2OZ6A 4WK8F 1D8JA 1S6LA 2E7WA 4EM1A 4AIKA 5FLXZ 4I98B 2DW4A 3LSTA 4LLGF 3ECHA 2XKOA 3PFIA 4TV7A 3RPQA 1P6RA 2OBPA 3F8MA 4CICA 3K0LA 3GX4X 2PMUA 1LQ1A 5H6QA 4ENJA 5AIPA 5CLSA 2XAJA 4OIRF 4OIQF 3IRRA 4PCQA 3SFZA 4A0XA 4L18B 4ZYGA 5JHUA 1ONVA 1XCBA 3GFMA 3WU1B 3U9GA 1FBQA 3M8EA 1OKRA 4YIIA 1FLIA 1SFXA 2ZNZA 2P5KA 1ZG3A 2Q2EA 4CHUA 3TKYA 3P9KA 3V7SA 1C0WA 1GHCA 1F4KA 1ZH5A 3M9AA 5LGTA 1YYVA 3E6DA 3RIRA 1K79A 2YU3A 2JSCA 1V3FA 3C18A 1L0OC 4JK1X 3F21A 1H9GA 5D6FA 2GXBA 2VBXA 4MTEA 2FQ3A 4WX9A 1W7PA 1WWXA 3FXRA 1LVAA 4HF1A 1IN5A 4OMZA 2BV6A 2EFQA 3GZ5A 5DD4A 2MH2A 2QVOA 4XSZF 3R4KA 4PZJA 4Q47A 5EEGA 1R1VA 2Y48A 1J2XA 1IN6A 3T1BA 5HS7A 5TRDA 3Q9VA 3K2ZA 3OV8A 2MA3A 3FHZA 5L3DA 3QP5A 5ICFA 4MNUA 4KIBA 3JSPA 1LNWA 3SZPA 4BHBA 1LDJA 5ERIA 5ILUA 2NRAC 1KU7A 2HQRA 3NRVA 3ZMZA 2JPCA 1FBUA 1WKMA 4BH9A 1I6XA 3Q5FA 1B59A 1FNNA 5KK1A 3BPXA 3HYIA 4I0BA 1IW7F 3F6VA 4LLNA 3C1DA 2OQRA 4LG0A 4KDPA 2WWYA 3GO5A 2ZCWA 1HKTA 1U5TA 2G7HA 3T0YA 3KLOA 2UZKA 2P5LC 2QM3A 2ADUA 4ASNA 2BGCA 2LDUA 1YFHA 1PDNC 4A6DA 1IN4A 1FP1D 4RGRA 5H6RA 3GFJA 4U0WA 1RIOH 3T8TA 1ZLJA 2CG4A 3P9IA 3WTWC 4O3MA 2NNYA 1U2WA 2ISYA 1ZRFA 1FX7A 1ZG1A 1MJBA 4WF2A 4KUMA 3T5XA 1KQ9A 1SD6A 4HX7A 3WE3A 3E5UA 4H0EA 2XIGA 2KKOA 4G7OF 5IT9K 1OYWA 1SMYF 5FB2A 2K7LA 3M8FA 4UV8A 3AAFA 3HHGA 1S29A 4EJUA 3FMSA 1RUOA 2UXXA 1BC7C 4GCVA 1XGSA 2IA2A 3I5UA 4LGWA 2MLGA 2QLZA 3L09A 5KVRA 4I01A 2HTJA 3VFZA 1U3EM 3LA3A 5JI6A 2C6YA 4IJAA 3BJAA 5TJJA 4WWCA 3SXYA 2YSRA 2H6CA 3PQJA 4GYGA 2DPDA 3LA2A 3TOAA 1G3TA 3E6BA 3BP8A 2ZKZA 4BXUA 3BWGA 4BAYA 2L01A 3LWFA 2XAGA 1J59A 1YQAA 1WRJA 4IF4A 2EV5A 1GXPA 1R58A 3KP6A 2YX7A 1BOAA 4M9SA 4MEYF 3LA7A 4FHTA 2NAZA 3IL2A 4JBAA 5IT9Z 1R1UA 2VC1A 1HXDA 3F6OA 4O5VA 4IXAA 2R3SA 4AIJA 4OU0A 4AD9A 3U2RA 2HYFA 4ON0A 4EJTA 1RZ4A 4UNOA 2Z9OA 2L4MA 1MD0A 2QUFA 2UXNA 3WTYC 5ICEA 2IPQX 3IHUA 4HDUA 3IRQA 2V79A 2RC4A 3K1NA 1AWCA 3KE2A 4ESBA 1JHFA 5LBQA 1IN8A 3FX3A 2M5WA 3QAHA 4HF2A 3K1MA 2PI0A 2OA4A 1MJ9A 2STTA 2FNPA 2O3FA 3IWFA 3RKXA 2KIMA 4P96A 1O7FA 3RPUA 2VE9A 3Q9SA 4HQMA 4EJWA 2XRNA 2DO7A 1FP2A 2IVMA 3ZP5A 2RV8A 1USTA 3MWMA 5DDGA 4Y17A 5DCMB 4EMSA 4MGRA 3QOPA 1ZYRF 1IXSB 2LF8A 3FWEA 1XCVA 2V9VA 1E17A 4LFUA 5D6EA 1G4DA 2HTSA 3IKVA 2FF4A 1TNTA 1WQ2A 3KP7A 1G3YA 2Z99A 2J5PA 3MFKA 4ENNA 2DK5A 1Z6RA 1BM9A 3B02A 3MZHA 1IF1A 5LGUA 1IAWA 3H3UA 2PMHA 1YLFA 3F8FA 3L2CA 3JTGA 4IPAA 5BS6A 3HIFA 1BIAA 3E5XA 4RAZA 3GYHX 1R1TA 2VBWA 3KP5A 4LD5A 4OIOF 3D0SA 1FSEA 1XDSA 1XSVA 5HDNA 4CZZA 5DUIA 2O8XA 3LAPA 1CF7B 1MZBA 4ESJA 1FZPB 2NS0A 4LK1F 4RB0A 1TQMA 2IA1A 2JTVA 5JR3A 1Z91A 1FY7A 1Y0UA 4UV9A 5EEHA 3F3XA 2B0LA 5LHIA 1XMKA 4FX4A 1KYZA 3I4PA 1XDUA 2ELHA 3NQOA 4RB3C 1IRFA 1YW8A 4NHJA 3R0AA 1KGSA 1K78A 2QQ9A 2VOOA 3ULQB 1P4AA 3CUQC 4MQ9F 3WTXC 5JFRA 2EV6A 2WC2A 5FD6A 2M8EA 2ACJA 5LLQA 4KIGA 1VTNC 4KICA 5J8FA 2FU4A 1BI1A 3GFIA 4EQQA 2FA5A 4CGZA 3BOQA 5K5QA 2EWNA 2KJCA 4M74A 3O2PE 3F8BA 5ICCA 1SMTA 2DI3A 2L54A 4RGSA 2V1DA 2GQQA 2M1BA 4IRHA 5D8LB 4AVPA 4GGGA 4NQWA 3H3ZA 3HRSA 2HOEA 4HA8A 2QBYA 5DCMA 2VOPA 2BBYA 5D5WB 1XGMA 4HV5A 4LJZF 4G9YA 1DPUA 1B4AA 4N0BA 4IHTA 1ZGJA 3EQLF 4EJVA 4ZYHA 4WXDA 2IRFG 2H27A 1FWZA 1HSJA 2PQ8A 3N97A 2F5EA 4FT8A 5D5XB 1XMAA 5ILSA 2EFWA 1I1GA 1XGNA 2DQLA 3W6KB 3FXQA 5D5UB 5L3GA 5D8KB 4Q5SF 3DKWA 3SQNA 1FYKA 1FC3A 5FGMA 3L7WA 4BNCA 5E17F 2CSOA 2XVCA 4L5IA 3I59A 4L9TA 1R23A 3DEUA 2M45A 3I54A 2FXAA 4HW0A 1DDNA 4P9UA 2ZBKA 3O3KA 2GWRA 4EVIA 4ENKA 2DAOA 1Z6TA 5BQTA 2DPUA 1IRGA 4D0PA 5F1RA 4U0VA 1MJAA 5A2QZ 2EB7A 1HW5A 2YX4A 2FE3A 2K02A 1XN7A 3J81Z 2LKPA 2RNJA 3WTVC 4BYYA 4A12A 5CVVA 5F64A 3DPLC 3TDUC 1FSHA 2GIVA 1QNTA 3I58A 4UUVA 3CUQB 2VC0A 4HQEA 2ZMEB 2CO5A 1YS6A 2EFOA 2MD5A 2VXZA 4A6EA 3F22A 2OQGA 4YIFA 1O3RA 4EM0B 3DP7A 3MAJA 3S2WA 1HW2A 4E70A 4HBLA 1FPQA 3ZMTA 2HDCA 4Y13A 3KETA 1SD4A 4RB2C 2RVCA 3IKTA 2NYXA 5ED4A 2YR2A 2K27A 1X3UA 5ILVA 4UHTA 3MZYA 1I1SA 2OZUA 5AIQA 3JSOA 3F8NA 3FMRA 2XASA 1QZZA 4MQVA 3ECOA 1ZAOA 3RI4A 4YG2F 4WCGA 2O0YA 4HDVA 3B73A 2IP2A 1Z9CA 1HKQA 4I7HA 5FFXA 1QBJA 3V4GA 4ETSA 2F5CA 2FBKA 1W5TA 2LNBA 1WSUA
chains in the Genus database with same CATH superfamily
2JA6J 3H3VK 1LPQA 3J7AY 5HNHA 2NVYJ 3EDPA 1H88C 1JHHA 3U1KA 1U9NA 3JRHA 3DTKA 3CCQI 2KIUA 2LF7A 4UVCA 1A31A 5BPDA 3G73A 4WXHA 4PDKA 2E5NA 1P2FA 3SYTA 3WE2A 3P9CA 1S3JA 1BOBA 3MD2A 4XICA 1L3LA 4LB5A 3FHNA 2JA7J 4IRGA 1ZQ3P 3CTAA 2EIMH 2RREA 5HVQC 4AU7A 5LEJA 1ACIA 4JP0A 5CYVA 4RMNA 2EFPA 2FMLA 3P5JA 3DCFA 5CVIA 4NB5A 1T33A 3VYRB 1RUNA 4II3A 5F0CA 2JWTA 4XLNF 2W85A 1AKHB 1T39A 3GUDA 3BR6A 2XF5A 1X2MA 3KEQA 2W25A 1S5LC 2A5YB 1S7AA 2ESNA 3OYHA 2RQQA 2WV0A 3A0BC 3KEOA 2XC7A 2O7OA 2LBFA 2LVSA 2LFBA 4A3GJ 4GFBA 4BU2A 4N9IA 2HOTA 3MKZA 3RZDJ 4L0YB 1TW3A 2QWWA 4B8XA 1X1DA 3K7AJ 3TP3A 1DU0A 4D9JA 4M6XA 5EDNA 3IP4B 1EJ9A 3M7GA 1P4WA 3G3ZA 5KNLA 1MGTA 1F43A 1MNEA 1SAUA 4LG3A 4AUXA 1S9HA 4KMFA 1EH8A 1ON2A 3CCLI 5EJCA 2RGVA 4XLEA 3GEZA 2XAHA 3M4OJ 4CYCA 4P5OA 2CW7A 4E4HA 4A3FJ 3TO7A 2VQCA 5E20A 4U88A 4KITB 4XLPF 4E7JA 5LRSA 3F23A 4GDFA 4IKFA 2HS5A 4D5CA 4XRFA 5J40A 2MABA 3K4MA 4XR6A 1Y6IA 2VQHA 5JVTA 1OLTA 2ICWG 3R61A 2LRDA 4Y52J 2O03A 1SD7A 3BG9A 3VB2A 4A5MA 2Y30A 1VQ7I 3HTSB 2P7VB 2CWEA 2M87A 2OUMA 1QPIA 1A6QA 1DUXC 4BDZA 1G3WA 2F5FA 4CUGA 2VODA 3M1EA 1V54H 4QSHA 3CJQB 5HNFA 5B5EC 1A35A 5K7ZA 3I0TA 1YX5A 2QENA 4L9JA 5LEKA 1MBGA 2AQFA 2BYVE 4DW6A 3RKYA 2FSWA 2JSPA 4UVBA 1ZRDA 3ISPA 4S0HB 5IOYA 2PLYA 3QYEA 3MEXA 2BHZA 4L0ZB 2LD5A 1CQTA 2P6TA 2PJPA 2AHQA 1OYIA 3FF5A 1G3SA 3OOUA 1WCMJ 1ZR2A 1BR2A 4ZZDA 5F08A 2OCEA 2CUEA 5JLXA 1OQYA 3DTIA 2IW5A 4UVAA 1E3HA 2Z3YA 3HHHA 1LEAA 5J8CA 2ZJQF 2A05A 1PP8F 2NS8A 3S1NJ 1IDYA 1NG7A 2R7RA 1GV5A 3I4MJ 1ZKGA 3ZOBA 2R93J 4FISA 3RTRA 4F3QA 4CH7A 1UB9A 4OWRB 3LSHA 3LNQA 1VFCA 4OINF 2IS4A 3OYGA 2EBIA 4S05A 2CS3A 3OYAA 2MH9A 4PGGA 5HOOA 3BJOA 1O3SA 2LY9A 4J00A 1GLNA 4P9FA 2FNAA 2E1CA 2OU2A 2MC4A 3HPHA 2DJNA 4M9ZA 3NARA 3SEQA 1P92A 3Q0VA 3S1RJ 2MYSA 4C3HJ 5K5RA 2DTRA 3ABLH 1OCTC 2FBHA 4N4NB 4G12A 1U5TC 1JUPA 3WGGA 4C9YA 4PGHA 4RLQA 3CJNA 4I09A 5H2FC 5HODA 1Z7UA 1N77A 2F4MB 4HLXA 4HRIA 2DLLA 3S1MJ 3KLNA 4KFCA 1JGSA 1KYWA 2XSDC 3RYRA 3A01B 4RS8A 4XBFA 2KDZA 1KQ8A 2HEOA 2BHYA 3TW6A 3FXKA 2EJRA 3BCBA 3KP2A 4XKCA 5BMZA 2MBFA 1Z3XA 4XRSA 3RJPA 3IH3A 2WB1N 5E1WA 4BHPA 3D1NI 1IXCA 4ZTJA 1FIAA 3JRAA 3WGIA 2A07F 1J0RA 2V9PA 3HEFA 3O8HA 3CCEI 1K6OA 3WTSC 3R6SA 3DEWA 1JE8A 1BL0A 1R22A 3DXJF 2DU9A 1YJ9I 5ICGA 1D0YA 1MNDA 4F52A 3KYLA 2JA2A 2M30A 3GLXA 3OWTA 4HAMA 3H9QA 1T8IA 3BROA 4ZYAA 3V7RA 3FM5A 3HSFA 4KJZA 1ETVA 1EH6A 3Q0WA 2Q2EB 3IV5A 2LG4A 4B48A 1ZR4A 2M4GA 2OAZA 4M9XA 2R7UA 1T6SA 5M5WJ 2QQAA 2Y31A 3C7JA 4DQ2A 5CJ9A 1P4XA 3SFIA 2W84A 4XSXF 1FT9A 2L7MP 2QZ8A 3SDBA 4QPOA 1B9MA 2NVQJ 2TDXA 2DBBA 1S72I 2XAQA 2R7OA 4U7DA 3GTJJ 1PP7U 4BQOA 1QO0D 1RPWA 2OC6A 3G1LA 4I02A 2EQRA 1NHAA 4AM3A 1LFPA 3HKZN 3ZMSA 2P5VA 2X6WA 5E79C 4E6KG 2ZFWA 2E2HJ 1IO2A 4B43A 1LDKB 4ABZA 2HI3A 4ZYDA 1LJ9A 1R5ID 3W6VA 2H94A 3DBHB 1F1ZA 5IPAA 1SFEA 2HQAA 4LLLA 3ZMDA 1O3TA 2CUZA 3O6BB 3N4MA 2ZSHB 2OTLI 2EK5A 1W7PB 4Z6YA 5LGNA 2RQPA 3RZOJ 5E8IA 3ABUA 1R49A 1D0ZA 1RC9A 3EUHA 4HNTA 1GVJA 1G59A 5F0HA 1OPCA 4XIDA 1T0FA 5L3EA 3K70D 5BPIA 2VKHA 1WI9A 4X0GA 4XRSG 1Z77A 2M7BA 2MC3A 3C2HA 1MMDA 4A69C 2ZJPF 1H9TA 4B44A 1T38A 3CCSI 2J5OA 4Y3OA 2IBDA 2COBA 2DCEA 4FE4A 3ZMUA 2D1VA 2DFIA 2Q8KA 1D5VA 1LUJB 1IZ1A 3QRFF 1XSDA 2ZJ2A 2RAEA 2Z1DA 1TQPA 3DFGA 3OYLA 4FTHA 3TO9A 3HUGB 1QHHD 2LMDA 4LITA 3V8KA 4I99C 2VONA 3GBGA 1WI3A 3ABTA 1STZA 2ZC2A 3BPVA 2X9DA 3W6JB 1TWFJ 3D5LA 4M3DA 3CQZJ 3P7NA 2FX0A 5B1BH 2FOKA 1PUFB 3L2UA 3JRBA 3TOBA 4X6AJ 4J19A 3HRTA 3BR3A 3PSIA 3QU3A 4R1HA 2DT7B 1I39A 1LE8B 1T08B 1NTCA 3QP6A 4PFPA 2VXDA 4IHYA 4PJNA 1JKRC 3ERED 1P7IA 3QPHA 1LB2A 2DQRA 3GWZA 4HOBA 4AIHA 3IC7A 2XKPA 4XLCA 3DEEA 5F0FA 5K5OA 4MTDA 1J75A 3BG5A 4BXXJ 2DT5A 3CCUI 4YELA 4XONA 1TLHB 2AS5F 2ISZA 4F55A 3A02A 2DA4A 1UHWA 1OYYA 1TTYA 3Q0UA 3L2VA 3WODF 4ZDPA 1B1BA 1USSA 3HL2A 3F8CA 4A3DJ 3BR5A 1ULYA 2Z2SB 1MMAA 2WY7Q 3HTUA 2RDPA 1QZYA 1UCRA 1W7PD 1YS7A 4CZCA 1R4MB 2EA2A 4GYIA 3DLLF 4A5NA 2DDBA 4G94A 1DPRA 1XX5A 2NS7A 3S14J 2KRHA 4KT6A 2XGXA 5DV5A 4LG0B 2XPUA 2FBIA 1HOMA 2L7FP 2DMNA 2IT0A 1B72B 2PN6A 1EV7A 2LC2A 3OIQA 5FFZA 1E3OC 4HZFA 4FCYA 5GP9A 1U5TB 2JPBA 4EEFG 2ETHA 2DMPA 5CVUA 4D1QA 1SAXA 4DNCA 2JT1A 3REOA 1K7AA 4E7LA 1FMVA 1HF0A 1VQ6I 3LQQA 3NEUA 2IXSA 2A6HF 4ZZLA 3BG3A 1SEUA 2TCTA 4PJMA 2K3FA 4PJJA 2I8DA 4A0YA 1YIJI 1FYMA 2PX9A 3A01A 2KISA 5A2QK 3ZMVA 5HLHA 1PUEE 1D8KA 3K4KA 1S8NA 3J81K 2DK8A 4HSTA 3FZVA 4G7ZF 2CYYA 2DFEA 4N9HA 2COMA 4EV0A 2A6EF 3I4NJ 2XPWA 3L2RA 3CC2I 1LDDA 1GXQA 4QWQA 3FBNB 4UXNA 2KPMA 2A68F 2DA1A 1IRXA 2DYSH 3B6AA 2IGNA 2VJ5A 1WH7A 3HC7A 3CO6C 2A6TA 2XAFA 1VQOI 1ZREA 1ETXA 2HKXA 2JRTA 3BZKA 3TO6A 2ZXHA 2CRGA 4ENMA 1WGXA 1QGPA 4YFKF 3OL3A 5LHGA 2PMZN 4HX8A 1YOVB 1G6NA 1R4NB 1TWCJ 2VBYA 3K69A 1EH7A 1RESA 3J7ZI 1NH3A 3LFKA 4A2UA 2BY2A 3AG3H 4KT5C 1YI2I 1VQ4I 1TNSA 3ZQ7A 3K4CA 2AXLA 1B6AA 4DZPA 3NWSA 2L3DA 2RN7A 5DYMA 1QHGA 3WHBA 1CGPA 2XAUA 2FMYA 1JKOC 1JGGA 1HKSA 2GA2A 2P8TA 2BEOA 1JT6A 1BN5A 3KP4A 2E7XA 3OS0A 3SZTA 2E1MC 3VOEA 1W4MA 4CCNA 2XUBA 3HRMA 2K4BA 3J80K 2HGCA 2GXGA 4NUBA 3CJRB 3RCOA 4CYDA 1R5HA 4RA2A 2M2EA 3OYFA 2HOAA 1ZG5A 4Y15A 1R00A 2HU9A 2EILH 1JJ6C 2D1HA 3W2WA 4EM2A 5EZGA 2K4JA 3FM3A 2LYCA 1ZARA 1XSXA 4F7ZA 2STWA 2BZTA 2Y0MA 3I64A 1XD7A 4MEXF 1W5SA 1XMXA 1YG2A 5E8GA 1SFOJ 1TQIA 1O3QA 3PJRA 1ZLKA 5CVRA 1CF7A 4HYEA 3HRUA 4JQFA 3I71A 2K86A 1VQ9I 4G6QA 4G8XA 2TRTA 4J01A 2HYJA 3BZCA 5L3BA 3ML6A 1PYVA 1GVDA 1KQ0A 1QPMA 1Y8RB 1T95A 4F91B 1XC5A 3E6MA 4GO1A 3OSGA 3DBLB 3HUGA 2Z5UA 3B6CA 1V5GA 1TW2A 4IEJA 3L00A 4XRMA 1KU2A 5GAHJ 2R7WA 1YIOA 1KA8A 2M0CA 4HPQA 3PNTA 3CCJI 4CO8A 4JYKA 2KIFA 2XF6A 4A3KJ 2JUGA 3GMEA 1ZHFA 4ESFA 3W3CA 4I2OA 3RDIA 1JKPC 3AG4H 1OMIA 2A69F 4U7BA 1SC7A 3E3VA 3QYBA 3KZZA 4L9NA 4EGZA 1X58A 4G7HF 3G2BA 3VEPA 2W7NA 1ZGWA 3HOXJ 4LOCA 3S17J 1RKWA 1IG7A 3KZYA 2DN0A 2HVRA 3H92A 2K5CA 3VODA 3A2KA 2PBIA 1ZRCA 3AL0C 3PO2J 3JW4A 1BI3A 1I27A 3TL4X 4CCLA 3ELKA 1YW7A 2KZVA 1J5YA 1V4RA 2CV1A 5CKTA 2D45A 4OIPF 5C4XJ 1HQCA 4EGYA 5AONA 3PSFA 3RKWA 5HS8A 3M07A 1ZN2A 1W1WE 4HNUA 2Y75A 3FXUA 3ZQIA 4OOIA 5J47A 1TBXA 5HLGA 3DF8A 4U87A 1U8BA 1MDMB 1FTZA 4KYWA 2XB0X 3J80Z 4IOAF 1M1EB 2LKSA 2XGDA 5B66C 2KDOA 1MBHA 1TC3C 2DMTA 2MLKA 3CJTB 5DS9A 4XL9A 1Z05A 4UUSB 4A3MJ 4ZYEA 4BGDA 2E2JJ 1LFBA 2D5VA 2E1NA 2V1XA 3ASOH 5J6XA 3ZQCA 2HR3A 3LAJA 3QPLA 3ZQQA 4I0AA 2VT2A 1D1AA 1F5TA 5GPCA 1B72A 2V1UA 2X0LA 3PQKA 4BY7J 5M3MJ 1K4SA 3MQ0A 2H1LA 5GAGJ 1TWAJ 3HOWJ 3D5RC 3FISA 3LSGA 4M72A 2JMWA 5D4RA 2R7ZJ 3T8RA 2ECBA 1BC8C 1XGOA 1MMNA 2W57A 2EIKH 3G1MA 3I53A 1YW9A 1ON1A 2X1DA 1YITI 4L9VA 4YIRX 4XLFA 5E1XA 5DEQA 1D3YA 4HSRA 5IYBJ 3TBIA 2AO9A 2W48A 2B7EA 4QPQA 2QYOA 5C44J 2EZIA 3H1CA 4JX6A 3GF2A 3RQIA 2ELJA 1ZGAA 2H6BA 1I6HJ 3K10A 2CQKA 1MKMA 3TQNA 2FEZA 1O4XA 3WTZA 4KN7X 5LHHA 4PJLA 2L7KA 5EGOA 2EH3A 3ROUA 1SFKA 1T98A 2DODA 4F92B 2P6SA 2P81A 2Y0SN 2DOFA 2D2WA 2H09A 3EETA 1YTYA 5E3MA 3LFUA 3ZN0A 3K9TA 4RGXA 2CV0A 3JAMK 6PAXA 2YUSA 1DGRM 1REPC 1KU3A 4S04A 3KCCA 2K9LA 2CFXA 2E71A 4FX0A 2M3AA 2PG4A 1VQNI 1MBFA 2LREA 2V6CA 4YRVA 3F9KA 4DZJA 2BOLA 2ZNYA 3GCMA 3KFWX 3FXMA 4M6YA 3FMQA 2IJLA 2MW8A 4RAFA 2Y0SA 1WVRA 5DCFA 1TL8A 2FUG2 1I3QJ 4XOTA 4KMUX 1Z67A 2CUFA 1U6GA 2CQ7A 2ZO4A 4IVNA 2RKHA 3DPUA 2DMUA 4G6DA 1BI0A 3CCMI 1J9IA 3SHFA 1E2XA 4BUPA 3DV8A 2E2IJ 3ZN1A 2R5ZA 1XB4A 1H0MA 2R7QA 3GFLA 2FRHA 3R60A 3VPRA 1AU7A 4C2UA 3QPTA 5FLMJ 3HXLA 3HGGA 2DA7A 1JT0A 5M5XJ 5DUKA 4Q4ZF 2LK2A 1HW1A 3PNVA 4HX4A 5HDKA 5HLIA 2N8GA 3BTIA 4MHGA 3COAC 2G9WA 2JA5J 1Q1HA 1VQ8I 2EINH 3TGNA 3RPUD 5IY5H 2DOEA 2XF7A 2OD5A 3OIPA 3QU6A 5IOZA 2CQNA 2JZYA 3CDHA 2R7DA 4UY8I 1R6RA 2WADA 3BY6A 2JJ7A 2DA3A 3RYPA 3ZQFA 3CDIA 2EA4A 4FETA 1VQMI 2V1NA 3CDLA 3E5QA 3S3OA 4QLCU 1UFMA 3OSFA 1AOYA 1OCRH 2VKDA 3X2QH 3OOPA 5FRNA 1BA5A 2Q0OA 2HDWA 3CMYA 2Z33A 3CMMA 5FJ8J 2BW3A 4BQNA 2HZDA 1IXRC 3R0JA 5L3FA 1WPKA 4EJOA 2LSOA 2GA1A 3CUQA 3OL4A 1ERDA 3DPTA 1FOKA 3BC8A 2ZMEA 1IDZA 2RNGA 1A04A 3S8PA 4L5JA 3J7AO 1UHMA 1WJCA 3L1PA 3A0HC 3M8JA 4I6ZA 3JAMZ 5HS9A 2HVSA 1ODDA 4B09A 5E3OA 1GT0C 2NNNA 5E18F 1FOWA 2G7UA 2CMPA 3PUBA 4PUSA 1K78B 2F5DA 3TDZC 4K2EA 2CW8A 5L3CA 2NVXJ 1J09A 2L9NA 2YPRA 4HV6A 1J7KA 3U1DA 3I56I 4A93J 3FDYA 1B9NA 5CQEA 4R79A 2E1OA 4UB8C 3OMYA 2L7ZA 4M71A 2ZXJA 4XN0A 1MDMA 4IHSA 4KNYA 1KU9A 1VI0A 4LMYA 1O57A 4E7IA 3PO3J 1XG1A 2DYRH 4RGUA 5LRRA 3S32A 3G6EI 2HDDA 3FK7A 2M9HA 1IV8A 3CLOA 4M73A 4UUSA 3OS1A 2R5YA 1DP7P 1FTTA 1WJ5A 2DDAA 2WAFA 3S16J 3F72A 4CSWA 2ZSIB 4D5FA 1FBSA 4M3EA 1BI2A 3BZ6A 2ID6A 2MFZA 1DQUA 1HSTA 1MH4A 2A61A 2PFBA 2X51A 4P1WA 4ZH4F 4O6JA 3WG9A 1I5ZA 1Z0XA 3SEZA 3OYDA 3MCZA 2AQEA 4IRIA 1SD5A 3HOTA 1MMGA 4XQFA 3KIOA 5FKKA 3BTJA 2EV0A 4LK0F 1B8IB 2F4OB 1YRNB 4MFDA 5EEAA 2P4WA 5IT3A 5HDGA 3HOYJ 3HDDA 3Q3SA 4NC6A 2XROA 3CO7C 3L2QA 2GOMA 2HXOA 3EYIA 3DTEA 3HSRA 2XV4S 2HKOA 3ZPLA 3ZGKA 4GXOA 3CCYA 3CCVI 5J4VA 3GW2A 4BHCA 1QU3A 4PSXA 1SFUA 1RI7A 2L02A 2QBYB 2ME6A 1D1BA 2HQNA 2CGPA 5CVJA 5FD5A 1JXSA 2CW0F 3E97A 3PL8A 4KN4X 1RNLA 4AVZA 2ZFUA 3GVAA 3LQRA 2EFNA 1H89C 5H20A 3CCRI 1FYLA 3JTHA 1Z1DA 4BDYA 2WBMA 4PFOA 4RB1A 2VASA 2PJRB 2E34A 2W00A 4UB6C 2HYGD 2KRFA 5DD8A 1AKHA 1VQLI 3E6CC 4HLYA 1U78A 2CV2A 4WXCA 3I3LA 5E1ZB 2O9LA 2UWMA 3S3NA 1K61A 2VE8A 3OR2C 3WGHA 3AFHA 2WAQN 3H0GJ 4DYCA 1BBYA 2A3SA 4RM2A 2PEXA 3MKYB 3W2VA 3BR2A 4NDLA 3QOEA 1QQIA 5D5VB 5K1YA 5FLVA 1R36A 4DYQA 3V7CA 3VYUB 2VB6A 5IP7J 1Z7LA 1HLVA 2X4HA 3AG1H 2GZWA 3ZR8X 4YFNF 4HF0A 5DM6F 1G8XA 3BJ6A 2IGKA 2GAUA 3OYNA 2W1OA 3BTCA 4Q48A 3GZ6A 3EYYA 2WAQA 2DOAA 3G4SI 3I59B 3CP8A 5FLXK 3HSEA 2HFHA 3CUOA 1R71A 5BOXA 3O8GA 4PJ0C 1HC8A 2VBZA 2V4JC 1RR8C 5FO5A 2O6GE 1IN7A 3IWZA 1ETQA 2E5ZA 3KZIC 1MH3A 2W82A 4JX5A 3V8LA 4ZDOA 2CJJA 2UUZA 3BG6A 2ELKA 2HZTA 1MW7A 4L5EA 1JI8A 2XHKA 1OR7A 2L4AA 2LLKA 4KA4A 2VI6A 5F1JA 1I50J 1YJNI 5DM7F 2R4GA 2NOJB 1HBXG 1P7JA 4A0ZA 1R5GA 3A03A 3HOSA 2GBYA 1DGWY 4MO7A 1T2KA 3M1CA 4P55A 1O7LA 3WTUC 3CC4I 1BIBA 4QTRA 3S1QJ 3DQVC 4CDGA 4LB6B 3TP0A 2F2EA 4M6VA 2IA0A 4CXFA 2E19A 2DA6A 4BQAA 3V8JA 1WHUA 3DBRB 4R8HA 2BE5F 2WA0A 3AG2H 4NBQA 4Z2YA 4U0YA 1HDDC 5JLWA 2W24A 2H1KA 2QA4I 5D4SA 3EUAA 3F0CA 3H9JA 3D5SC 2VN2A 1YO5C 2HVQA 2VT3A 1IUYA 4D7NA 3C3WA 4KIFA 3HPGA 3BDDA 5KAIC 1K6YA 4BEHB 2KJBA 3FXLA 2QQBA 2ESHA 4YFXF 5F6FA 4OMYA 5IP6A 2VPLA 1IRZA 3KP3A 4ZDLA 2WTEA 2QKMB 2R7FA 5B3SH 2K9NA 2QSHX 2FJ1A 3WU0A 3K1PA 1DP3A 4RAYA 2XB5A 1BJAA 3L9FA 3WTTC 2O61A 4AWXB 4BE1A 2VL8A 1LEBA 4UUTA 2ZXIA 1U8RA 1F36A 2HWVA 2P7CB 3GXOA 1F9NA 1S7OA 1R7JA 2OZ6A 1MIJA 2KP6A 4WK8F 1D8JA 1S6LA 2E7WA 1SVOA 4M3FA 2EIJH 4EM1A 1QZEA 4AIKA 5FLXZ 2K9SA 2GLOA 1WJAA 2LY2A 2KZGA 4I98B 4E7ZA 2DW4A 3LSTA 4HG2A 4LLGF 4BE0A 3BQZA 3ECHA 1SVLA 2XKOA 4GRIA 2BY1A 3QPSA 3PFIA 5GPAA 2JRMA 3IAS2 4XNFA 4IQJA 4JOMA 3KPHA 3S93A 4TV7A 3RPQA 1B8IA 1P6RA 2OBPA 3F8MA 4CICA 3L2WA 3K0LA 2R7VA 2HOSA 5IYCJ 3GX4X 2PMUA 1LQ1A 1ETKA 5H6QA 4ENJA 2NVTJ 5AIPA 5CLSA 2OPTA 2XAJA 4OIRF 4OIQF 3IRRA 1WH5A 3PIOF 4PCQA 2K85A 4NNJA 1NK2P 3K2AA 3SFZA 4IHVA 4A0XA 4FASD 4L18B 4AYBA 4ZYGA 5JHUA 1ONVA 1XCBA 3GFMA 3WU1B 3U9GA 3GTGJ 1UHSA 2BXZA 2K9QA 2VJIA 1FBQA 2F6CA 1OKRA 2X6OA 3M8EA 4YIIA 4DBRA 5GAEJ 1FLIA 1SFXA 2ZNZA 2P5KA 2P0WA 2VLAA 2QEXI 1ZG3A 2Q2EA 2IS1A 3TEDA 4ZC3A 4CHUA 5B1AH 3DLAA 3TKYA 2OTJI 3P9KA 3V7SA 1C0WA 1GHCA 2DFHA 2F48A 1FOYA 1F4KA 2JN6A 3TW7A 4XLAA 5EF6A 4IX7A 4BY1J 1VNDA 1Y1VJ 1ZH5A 3CMAI 1H8AC 3M9AA 5LGTA 1YYVA 1YJWI 3E6DA 3ZRGA 2VQLA 3RIRA 1K79A 2KMUA 2MSYA 2YU3A 3PFYA 2V7FA 2JSCA 1ETOA 3JRIA 1BR1A 3JRGA 1V3FA 3C18A 5F04A 1L0OC 3WU2C 2L9RA 4NC7A 4JK1X 3F21A 1H9GA 2ME0A 5D6FA 4IO9F 1OFCX 2GXBA 3GTLJ 2VBXA 2KHMA 1E3PA 4MTEA 1X3ZB 2FQ3A 4WX9A 1W7PA 5FKMA 1WWXA 3LSIA 3UNGC 4PK4A 3FXRA 1LVAA 4HF1A 1FIPA 1IN5A 2VKVA 2XSJC 2MGQA 3ONQA 2CFOA 4OMZA 4C3IJ 4XKBA 2BV6A 5BNGA 3DKXA 1IJWC 1QA6A 1WZ2A 2EFQA 2VIXA 1RETA 1UG2A 3CP2A 3CF5F 3GZ5A 1N25A 3C2BA 1X1CA 3S15J 3HM5A 5FKNA 5DD4A 5F27A 2MH2A 2QVOA 4XSZF 4XK4A 3EUHC 2O8KA 3GTKJ 3R4KA 1T0FC 4PZJA 4Q47A 5EEGA 1R1VA 2Y48A 4CYCB 1Y39A 1NK3P 1J2XA 1XS9A 1IN6A 3T1BA 5HS7A 5TRDA 3Q9VA 1HA8A 1ETYA 2BVMA 1ZK8A 3K2ZA 3V42A 5FRMA 3OV8A 2MA3A 2XRLA 1SANA 1OCZH 3FHZA 5L3DA 4II2A 4A3LJ 1PUFA 1BR4A 2KL4A 3QP5A 5ICFA 3SZGA 4MNUA 5IYDJ 1LE8A 1Z3YA 4KIBA 4V2FA 3JSPA 1LNWA 3SZPA 5K7FA 4BHBA 1LDJA 5ERIA 5ILUA 2NRAC 4MFEA 3MMYB 1LFUP 2H8RA 1KU7A 2I10A 2HQRA 3NRVA 2JVGA 2JPCA 1FBUA 3ZMZA 1WKMA 1IC8A 4BH9A 1FOXA 3H35A 1Y8QB 1JTYA 3HBLA 2L9SA 1I6XA 3Q5FA 4AIDA 4BE2A 2R7TA 1B59A 1FNNA 3LSJA 4A3IJ 3MKWB 5KK1A 2HQ5A 3BPXA 3HYIA 4I0BA 4ANJA 3HZJA 1X1PA 1G2HA 1IW7F 3F6VA 5GTHC 4LLNA 4DYRA 3OYCA 1EA3A 3C1DA 3OYEA 4C3JJ 3SJMA 4RM3A 2OQRA 4LG0A 4KDPA 2M4KA 1X19A 5C3EJ 2WWYA 1UG0A 2AXTC 3GO5A 2ZCWA 1Z21A 1HKTA 3A1YA 3S2HJ 1D5YA 2CQXA 1U5TA 2L2OA 2G7HA 3T0YA 3HOZJ 2UV1A 3KLOA 2UZKA 2P5LC 2NXNB 2QM3A 2ADUA 4ASNA 2K9MA 1VQPI 2BGCA 2GOXB 2LDUA 3OYBA 1YFHA 2OV7A 1PDNC 3MN2A 3VDXA 1JKQC 2QKLB 1OJLA 2DXIA 4CA0A 5GADJ 4A6DA 2XGCA 4CCJA 3CLQA 1X2NA 1IN4A 3HJEA 1FP1D 4RGRA 1I3AA 5H6RA 4B3AA 3GFJA 2OCCH 1MSEC 4U0WA 4DJAA 1RIOH 3T8TA 5LD2C 1ZLJA 1N78A 3ERMA 1UELB 4C2MJ 2CG4A 1D1CA 2JUCA 5GTIC 2MG4A 2CU7A 3P9IA 3WTWC 4O3MA 3OR1C 2NNYA 1U2WA 2ISYA 1NG6A 3DWLE 1WJFA 1ZRFA 1FX7A 4W1UA 2R7XA 5C4JJ 1ZG1A 4XMYA 4A3BJ 1MJBA 4WF2A 4BJ6C 4KUMA 3T5XA 1KQ9A 1ORKA 2LKXA 1SD6A 4HX7A 3WE3A 3E5UA 4H0EA 2XIGA 3H5NA 2KKOA 4G7OF 5IT9K 3ABKH 1GDTA 1OYWA 1SMYF 5FB2A 2K7LA 3M8FA 4UV8A 1RKTA 4BS9A 2WY8Q 3K4LA 3AAFA 4Y4RA 3HHGA 1S29A 4EJUA 3FMSA 1RUOA 2UXXA 3EUKL 4XORA 4D7MA 1RRJA 2E1MB 1BC7C 2Y69H 3IUOA 4GCVA 1XGSA 2IA2A 1WJEA 3I5UA 4LGWA 5HLTA 2MLGA 2QLZA 3L09A 4IL6C 4I01A 5KVRA 3VYTB 3VSLA 2HTJA 3VFZA 1U3EM 3BG7A 3LA3A 3AKZA 3K6GA 4CCOA 5JI6A 2C6YA 4IJAA 1JTXA 3BJAA 3NAUA 2DMQA 1BW6A 2X6XA 4RLFA 5TJJA 2CH0A 4WWCA 3SXYA 3CESA 2E35A 2YSRA 2H6CA 3PQJA 4GYGA 2DPDA 3LA2A 2JA8J 3C2GA 3S3MA 1KZHA 2KT0A 3TOAA 1Y1WJ 1FEXA 4AC0A 2QGUA 2X6YA 1HCRA 3KX2A 1X1AA 1G3TA 3E6BA 3OS2A 1U0JA 3BP8A 2ZJRF 2DT6A 1QVUA 2ZKZA 4XN3A 4BXUA 3BWGA 4BAYA 2L01A 3LWFA 4F93B 3S2DJ 4B1RA 2XAGA 1J59A 1YQAA 3H9GA 4QIWN 2GIZA 1WRJA 1IV6A 2X1CA 4MLOA 1AHDP 1W36C 4IF4A 2EV5A 5FKLA 4IOCF 1GXPA 1R58A 3KP6A 2YX7A 2EZLA 5M3FJ 3GTQJ 3JR9A 1BOAA 3N05A 4M9SA 2L5QA 4EATA 4MEYF 4CCKA 3OYMA 1APLC 3FIWA 3RSNA 1N75A 3LA7A 2M34A 2FD5A 2NAZA 4FHTA 4A3JJ 2B9SA 3AL0B 3GTMJ 4BJTA 1Q1VA 3IL2A 3LOCA 4JBAA 5IT9Z 1R1UA 2VC1A 5CQGA 3EPZA 5IP9J 1HXDA 4E7HA 2X48A 1MBEA 3F6OA 1FMWA 4IXAA 2R3SA 2WV1A 4O5VA 2L0KA 2XDVA 4AIJA 1MBKA 2Y9YA 2ZXWH 1D0XA 4OU0A 4AD9A 4DOZA 3U2RA 4IHWA 2HYFA 4ON0A 4EJTA 5FKOA 1RZ4A 4OAZA 2X85A 4UNOA 2F4IA 3J7YJ 3PNYA 2Z9OA 2L4MA 3I9V2 1MD0A 1R9TJ 2E36A 4LIVA 2QUFA 2UXNA 3WTYC 5ICEA 2IPQX 3IHUA 4HDUA 3IRQA 2V79A 4FQGA 2RC4A 3DU6A 3K1NA 1AWCA 3KE2A 4RAGA 4ESBA 1JHFA 5LBQA 1IN8A 3FX3A 2M5WA 3QAHA 3ASNH 1FJLA 4V19K 2VJJA 4HF2A 3K1MA 2PI0A 2OA4A 5EZHA 4ZJZA 1MJ9A 2STTA 2CQQA 4HNVA 2FNPA 3K4JA 2O3FA 2IEKA 3IWFA 3RKXA 2JK3A 1K83J 2KIMA 2X1EA 1TT5B 4P96A 1O7FA 2NOGA 2JVHA 3RQ4A 3RPUA 5TGTA 1XPXA 2VE9A 3Q9SA 4HQMA 4EJWA 3H5RA 1LVKA 2XRNA 3QWLA 1V5EA 1EKEA 4Y7NJ 2DO7A 1FP2A 4DGWB 2IVMA 3BT9A 4BBRJ 3ZP5A 2RV8A 3DU5A 1USTA 5J1RA 2O5RA 4NQWB 3MWMA 5DDGA 4Y17A 5DCMB 4EMSA 4MGRA 3QOPA 1ZYRF 3GLLA 1IXSB 2LF8A 1V5FA 3FWEA 4BQQA 4E7SA 1XCVA 2V9VA 1E17A 4LFUA 5D6EA 3PIPF 2IAIA 1G4DA 3MVPA 2HTSA 3IKVA 2BXYA 2FF4A 1TNTA 3KEYA 1WQ2A 2W4SA 3KP7A 3CF2A 3OYKA 1G3YA 1YHQI 2Z99A 4YEJA 4A3EJ 9ANTA 2J5PA 3MFKA 1MSFC 4ENNA 2DK5A 1Z6RA 2HPIA 2WB1A 4LIUA 1IGNA 1BM9A 3B02A 3MZHA 5EG0B 1IF1A 5LGUA 1IAWA 3H3UA 4W97A 3VSKA 2R7SA 1WJBA 2PMHA 4NC8A 1YLFA 2R0QC 3HG9A 3F8FA 2EPFA 2QCOA 3L2CA 1JJ8C 2HPMA 3JTGA 4IPAA 1A5JA 5BS6A 3HIFA 3H0DA 1BIAA 3E5XA 2Y9ZA 3PM1A 4XKVA 1AA7A 4RAZA 3NWTA 1R1TA 1XTAA 2VBWA 3GYHX 3KP5A 1UMQA 3DKYA 4I76A 2OF7A 3E7LA 4LD5A 1YE9A 2VPRA 3LSRA 4A3CJ 4OIOF 2IGMA 3D0SA 2OJED 1FSEA 1U9OA 1XDSA 3M3YJ 1XSVA 5HDNA 2DA5A 4N4OB 5KAFC 3HKZA 2I5UA 2M7AA 4V2GA 1OCOH 2K3PA 5FROA 3ABMH 5E3LA 4CZZA 5DUIA 1QVTA 2O8XA 3LAPA 1CF7B 3CC7I 1MZBA 5K7HA 2BY3A 2VQGA 3BQYA 2F5VA 3OIOA 4ESJA 1FZPB 2M8GX 1P9QC 2NS0A 1A36A 4LK1F 4BACA 4RB0A 1TQMA 2IA1A 1ITYA 2H8WA 2JTVA 5JR3A 3BR1A 1Z91A 1FY7A 2K40A 1Y0UA 3E0JB 4UV9A 5EEHA 3JRFA 1MMSA 3F3XA 2B0LA 5LHIA 1XMKA 2EZKA 4DIQA 4FX4A 1KYZA 3SDGA 3I4PA 3G71I 1XDUA 2ELHA 1KONA 5M5YJ 4C30A 4IHXA 1Y56A 1K4TA 1LKXA 3NQOA 4RB3C 3HOVJ 1IRFA 1YW8A 3BLYA 4NHJA 3R0AA 1KGSA 3CD6I 4IZZA 2VUMJ 3PUFA 1K78A 2QQ9A 2VOOA 3ULQB 1P4AA 3CUQC 1W0TA 1HDPA 4MQ9F 3WTXC 4BBSJ 2ZMEC 5JFRA 2EV6A 4MIMA 2WC2A 5FD6A 1GUUA 2V6EA 2Z16A 2M8EA 2ACJA 3FXJA 5LLQA 3KYCB 2V9KA 5J1YA 4KIGA 1VTNC 3JRCA 1UJ8A 1TZLA 3MZ8A 2VKEA 4KICA 2DFFA 5J8FA 2FU4A 2LR8A 4M3BA 1UZCA 1BI1A 3GFIA 1TT0A 3K4BA 4EQQA 2BVLA 2FA5A 4CGZA 3BOQA 1PJRA 4FE7A 3RKQA 1A6IA 5K5QA 2EWNA 3CZ6A 2JQ7A 3HGYA 2KJCA 2R92J 3I55I 4M74A 3LMMA 1W36D 1BW5A 3O2PE 1X4PA 1ZTRA 3F8BA 5ICCA 2ID3A 4AYBN 1SMTA 3GTOJ 3ZCOA 3QYFA 1YRNA 5KCMA 2DI3A 2L54A 2GXAA 4KISA 4OAYA 1TP4A 2FQ4A 4RGSA 2HNHA 2FOWA 2V1DA 1ZELA 2DTZA 2GQQA 2M1BA 4IRHA 5D8LB 3IAM2 3LSPA 4AVPA 5J3LA 1VQKI 1IUFA 2KRCA 4GGGA 3BTLA 3HOUJ 4NQWA 3U21A 2MD0A 3H3ZA 3HRSA 2Q1ZB 2HOEA 3QODA 4HA8A 4XM3A 4Y33A 2QBYA 2LY1A 5DCMA 2VOPA 2KLOA 2BBYA 5D5WB 2NVUB 1XGMA 4HV5A 4LJZF 3ZQHA 4G9YA 1DPUA 1B4AA 2A5WA 4N0BA 4IHTA 3FKJA 1ZGJA 2E60A 3EQLF 3BCAA 4EJVA 4ZYHA 5EGOB 3UR3C 2PJRA 3H5AA 4WXDA 2DJIA 2IRFG 1JUSA 2H27A 1FWZA 1OISA 1HSJA 2QQ8A 2PQ8A 5TISC 3N97A 3UKGA 2F5EA 3K4NA 1ETWA 4FT8A 5D5XB 1XMAA 3IH2A 5ILSA 2EFWA 1I1GA 1XGNA 4XKWA 2DQLA 3W6KB 2YU9J 3FXQA 5D5UB 5L3GA 5EG0A 5D8KB 4Q5SF 4C2TA 3DKWA 3SQNA 1POGA 3ZQLA 1FYKA 2HXIA 4B47A 1FC3A 5FGMA 3ZXSA 3L7WA 2LBFB 2GM4A 4BNCA 2IS6A 5E17F 2PMZA 3OYIA 3MKLA 2CSOA 2XVCA 4L5IA 3I59A 4B3XA 2LOOA 2R5ZB 4L9TA 2KQRA 1X1BA 1Y0NA 3FXOA 1R23A 3FBIB 1QRYA 3DEUA 1X3WB 2M45A 3I54A 4XOPA 1DU6A 2DA2A 2FXAA 4HW0A 1DDNA 5KHDA 2M0MA 4P9UA 1TWHJ 2ZBKA 3O3KA 2GWRA 4EVIA 4ENKA 3G1OA 5LFAA 2DAOA 3OYJA 2VJ4A 1Z6TA 5BQTA 2DPUA 1IRGA 4D0PA 5F1RA 4IQ4A 4U0VA 3VYSB 2L9VA 3LSKA 1MJAA 4M3GA 3OY9A 2EB7A 1HW5A 2YX4A 2FE3A 4XLHA 5A2QZ 2EZHA 4CCMA 2K02A 1XN7A 3J81Z 2LKPA 1VQ5I 2RNJA 2XPVA 3WTVC 1OR7C 2G0EA 3ZQGA 2BW3B 4BYYA 4B4CA 4A12A 5CVVA 5F64A 2CUJA 3DPLC 3H36A 3TDUC 1FSHA 1X4OA 2GIVA 1MBJA 3FK6A 4BJ5C 1QNTA 2LP0A 3I58A 4UUVA 3CUQB 2VC0A 4HQEA 2ZMEB 1JUMA 2QSGX 1MNMC 5DTDA 4E7KA 2CO5A 1YS6A 3VWBA 4ZTFA 2ECCA 2IGOA 3TMOA 4BEHA 1V55H 2EFOA 2IS2A 1E0EA 1ENHA 2MD5A 2VXZA 4A6EA 3F22A 2OQGA 3GZNB 4YIFA 3JRDA 2KIQA 1O3RA 4G6TB 4EM0B 2QF7A 2ZB9A 3DP7A 3MAJA 3S2WA 1HW2A 1TWGJ 4E70A 4HBLA 1FPQA 3KYDB 5CPRB 3ZMTA 3FKIJ 2HDCA 1W0UA 5JHFA 2KFDA 4Y13A 4RDUA 5JVGF 3KETA 3W2AA 1SD4A 1WJDA 4RB2C 2RVCA 3IKTA 2NYXA 5ED4A 2YR2A 2K27A 1X3UA 3LSMA 3WHCA 1RR7A 5ILVA 5EYRA 2XGEA 3JCUC 4UHTA 4BL0B 4HEA2 5J4YA 4H4KC 1VZ0A 1YX3A 1OCCH 2QSFX 1SVMA 1T56A 1W5CC 3IH4A 3MZYA 3CMEI 3LL7A 2R5YB 1I1SA 1UAAA 5J1UA 2OZUA 2BY0A 5AIQA 3JREA 3JSOA 2LH9A 3F8NA 3FMRA 3HB9A 4JX4A 1PVEA 3ESWB 2V26A 2WAEA 4BKXA 2XASA 1QZZA 4MQVA 3ECOA 2B63J 1S7EA 4RBOA 4ITVA 1ZAOA 3RI4A 3E1SA 4YG2F 3A4CA 4WCGA 2Y2ZA 2O0YA 5E3NA 3BR0A 4X1EA 4HDVA 3QQAA 2LTPA 4BXFA 3B73A 1WFXA 2IP2A 3K70C 1HKQA 4I7HA 5FFXA 1Z9CA 2YS9A 1QBJA 1GV2A 3V4GA 1BJZA 1OCPA 4ETSA 3GTPJ 2F5CA 1EF4A 4PSWA 1VF9A 1W5TA 2LNBA 2FBKA 4DBQA 3WG7H 1WSUA
chains in the Genus database with same CATH topology
3EDPA 1JHHA 2KIUA 2LF7A 4UVCA 5BPDA 3G73A 4WXHA 4PDKA 1P2FA 3WE2A 3P9CA 1S3JA 1L3LA 4LB5A 4IRGA 3CTAA 5HVQC 5LEJA 5CYVA 2EFPA 2FMLA 5CVIA 4NB5A 1RUNA 4XLNF 2W85A 1T39A 3GUDA 3KEQA 2W25A 2A5YB 1S7AA 2ESNA 2WV0A 3KEOA 4N9IA 4L0YB 1TW3A 2QWWA 4B8XA 4M6XA 3M7GA 1P4WA 3G3ZA 1MGTA 4KMFA 1EH8A 1ON2A 2RGVA 3GEZA 2XAHA 4P5OA 3TO7A 5E20A 4U88A 4XLPF 5LRSA 3F23A 2HS5A 4XRFA 5JVTA 3R61A 2O03A 1SD7A 3VB2A 4A5MA 3HTSB 2P7VB 2CWEA 2M87A 1DUXC 1G3WA 2F5FA 2VODA 3M1EA 3I0TA 2QENA 4L9JA 5LEKA 2BYVE 3RKYA 2FSWA 4UVBA 1ZRDA 3ISPA 2PLYA 3MEXA 4L0ZB 2P6TA 2PJPA 1OYIA 3FF5A 1G3SA 4ZZDA 2IW5A 4UVAA 3HHHA 2Z3YA 5J8CA 1LEAA 1PP8F 3RTRA 1UB9A 4OINF 4S05A 2MH9A 4PGGA 5HOOA 3BJOA 1O3SA 4P9FA 2FNAA 2E1CA 2OU2A 4M9ZA 1P92A 5K5RA 2DTRA 2FBHA 1U5TC 3WGGA 4PGHA 3CJNA 4I09A 1Z7UA 4HLXA 2DLLA 3KLNA 4KFCA 1JGSA 1KYWA 3RYRA 4RS8A 4XBFA 1KQ8A 2HEOA 2EJRA 3KP2A 5BMZA 2MBFA 3RJPA 5E1WA 4BHPA 1IXCA 3WGIA 2A07F 1J0RA 1K6OA 3WTSC 3R6SA 1JE8A 1R22A 3DXJF 2DU9A 5ICGA 2M30A 3GLXA 4HAMA 3BROA 3V7RA 3FM5A 3HSFA 1EH6A 4M9XA 2OAZA 1T6SA 2QQAA 3C7JA 4DQ2A 5CJ9A 1P4XA 2W84A 4XSXF 1FT9A 2QZ8A 1B9MA 2TDXA 2DBBA 2XAQA 4U7DA 1PP7U 1QO0D 4I02A 1NHAA 3ZMSA 2P5VA 2ZFWA 1LDKB 4ZYDA 1LJ9A 2H94A 1F1ZA 1SFEA 4LLLA 3ZMDA 1O3TA 3O6BB 3N4MA 2EK5A 1W7PB 5LGNA 2RQPA 5E8IA 3ABUA 3EUHA 1GVJA 1OPCA 1T0FA 5L3EA 5BPIA 1WI9A 2MC3A 1H9TA 1T38A 2J5OA 3ZMUA 2D1VA 2DFIA 2Q8KA 1D5VA 1IZ1A 3QRFF 1XSDA 2ZJ2A 1TQPA 3DFGA 3TO9A 3V8KA 2VONA 3ABTA 1STZA 3BPVA 3W6JB 3D5LA 3P7NA 2FOKA 3TOBA 3HRTA 3QU3A 4R1HA 3QP6A 3ERED 3QPHA 1LB2A 2DQRA 3GWZA 4HOBA 4AIHA 3IC7A 2XKPA 5K5OA 4MTDA 1J75A 2DT5A 2AS5F 1TLHB 2ISZA 1UHWA 1OYYA 1TTYA 3WODF 1B1BA 1USSA 3F8CA 1ULYA 3HTUA 2RDPA 1QZYA 1UCRA 1W7PD 1YS7A 2EA2A 4GYIA 4A5NA 4G94A 1DPRA 2XGXA 5DV5A 4LG0B 2FBIA 2IT0A 2PN6A 1EV7A 5FFZA 4HZFA 1U5TB 2JPBA 2ETHA 5CVUA 1SAXA 4DNCA 2JT1A 3REOA 1K7AA 3LQQA 3NEUA 2A6HF 4ZZLA 4A0YA 1FYMA 5A2QK 3ZMVA 5HLHA 1PUEE 1D8KA 1S8NA 3J81K 2DK8A 3FZVA 4G7ZF 2CYYA 4N9HA 2COMA 4EV0A 2A6EF 1LDDA 1GXQA 4QWQA 4UXNA 2A68F 3CO6C 2XAFA 1ZREA 2HKXA 2JRTA 3TO6A 4ENMA 1QGPA 4YFKF 5LHGA 4HX8A 1G6NA 2VBYA 3K69A 1EH7A 3LFKA 4A2UA 4KT5C 1TNSA 3ZQ7A 2AXLA 1B6AA 2L3DA 2RN7A 5DYMA 1CGPA 2FMYA 1HKSA 2GA2A 2P8TA 2BEOA 3KP4A 1BN5A 2E7XA 3SZTA 3VOEA 1W4MA 2XUBA 3HRMA 3J80K 2K4BA 2HGCA 2GXGA 4CYDA 1R5HA 1ZG5A 4Y15A 1R00A 2D1HA 4EM2A 2K4JA 3FM3A 1ZARA 1XSXA 4F7ZA 2STWA 2Y0MA 3I64A 1XD7A 4MEXF 1W5SA 1YG2A 5E8GA 1TQIA 1O3QA 1ZLKA 5CVRA 1CF7A 4HYEA 3HRUA 4JQFA 3I71A 2K86A 4G6QA 4G8XA 5L3BA 3ML6A 1KQ0A 1QPMA 3E6MA 4GO1A 3HUGA 2Z5UA 1TW2A 3L00A 1KU2A 1YIOA 1KA8A 4CO8A 2KIFA 1ZHFA 4ESFA 4I2OA 3RDIA 1OMIA 2A69F 4U7BA 3E3VA 3KZZA 4L9NA 4EGZA 4G7HF 3VEPA 3KZYA 3H92A 3VODA 2PBIA 1ZRCA 3JW4A 1BI3A 1I27A 3ELKA 1YW7A 1J5YA 1V4RA 4OIPF 2D45A 1HQCA 4EGYA 5AONA 3RKWA 5HS8A 1ZN2A 2Y75A 3FXUA 4OOIA 1TBXA 5HLGA 3DF8A 1MDMB 4KYWA 3J80Z 2MLKA 1Z05A 4ZYEA 2E1NA 2V1XA 5J6XA 2HR3A 3LAJA 1F5TA 4I0AA 2VT2A 2V1UA 2X0LA 3PQKA 3MQ0A 4M72A 5D4RA 3T8RA 1BC8C 1XGOA 2W57A 3I53A 1YW9A 1ON1A 4L9VA 5E1XA 5DEQA 1D3YA 2QYOA 3GF2A 1ZGAA 2H6BA 2CQKA 1MKMA 3TQNA 2FEZA 3WTZA 4KN7X 5LHHA 3ROUA 1T98A 2P6SA 2D2WA 2H09A 3EETA 1YTYA 3ZN0A 3K9TA 4RGXA 3JAMK 6PAXA 1REPC 1KU3A 4S04A 3KCCA 2CFXA 4FX0A 2PG4A 2V6CA 2ZNYA 3KFWX 4M6YA 3FMQA 2IJLA 5DCFA 4KMUX 1U6GA 2ZO4A 4IVNA 2RKHA 4G6DA 1BI0A 1J9IA 3SHFA 1E2XA 3DV8A 3ZN1A 1XB4A 1H0MA 3GFLA 2FRHA 3R60A 3QPTA 4Q4ZF 5DUKA 1HW1A 4HX4A 5HDKA 5HLIA 4MHGA 3COAC 2G9WA 1Q1HA 3TGNA 2OD5A 3QU6A 2JZYA 3CDHA 2R7DA 3BY6A 3RYPA 2EA4A 3E5QA 4QLCU 1UFMA 1AOYA 3OOPA 2Q0OA 2Z33A 1IXRC 3R0JA 5L3FA 4EJOA 2LSOA 2GA1A 3CUQA 3DPTA 1FOKA 2ZMEA 1A04A 3J7AO 4L5JA 1UHMA 3JAMZ 5HS9A 1ODDA 4B09A 2NNNA 5E18F 2G7UA 1K78B 2F5DA 3TDZC 4K2EA 5L3CA 2YPRA 4HV6A 1J7KA 3U1DA 1B9NA 4R79A 4M71A 2ZXJA 4KNYA 1MDMA 4IHSA 1KU9A 4LMYA 1O57A 4RGUA 5LRRA 3CLOA 4M73A 1DP7P 3F72A 1FBSA 1BI2A 3BZ6A 1HSTA 2A61A 2PFBA 4ZH4F 4O6JA 3WG9A 1I5ZA 4IRIA 3MCZA 1SD5A 3HOTA 2EV0A 4LK0F 2P4WA 5IT3A 5HDGA 2XROA 3CO7C 3EYIA 3HSRA 2XV4S 2HKOA 3ZPLA 4GXOA 3GW2A 4BHCA 1SFUA 1RI7A 2L02A 2QBYB 2HQNA 2CGPA 5CVJA 5FD5A 1JXSA 2CW0F 3E97A 4KN4X 1RNLA 3GVAA 3LQRA 2EFNA 5H20A 1FYLA 3JTHA 1Z1DA 4RB1A 2HYGD 2KRFA 5DD8A 3E6CC 4HLYA 1U78A 4WXCA 5E1ZB 2UWMA 2VE8A 3WGHA 1BBYA 2A3SA 2PEXA 1QQIA 5D5VB 5K1YA 1R36A 3V7CA 2X4HA 2GZWA 4YFNF 4HF0A 3BJ6A 2GAUA 4Q48A 3GZ6A 3EYYA 3I59B 5FLXK 3HSEA 2HFHA 3CUOA 5BOXA 2VBZA 2O6GE 5FO5A 1IN7A 3IWZA 3V8LA 2HZTA 2XHKA 1OR7A 2L4AA 4KA4A 1HBXG 4A0ZA 1R5GA 3HOSA 1T2KA 4P55A 1O7LA 3WTUC 1BIBA 3DQVC 4CDGA 4LB6B 2F2EA 2IA0A 4CXFA 4BQAA 3V8JA 4R8HA 2BE5F 4U0YA 4Z2YA 2W24A 5D4SA 2VN2A 1YO5C 2VT3A 1IUYA 3C3WA 4KIFA 3BDDA 2KJBA 4YFXF 2QQBA 2ESHA 5F6FA 4OMYA 3KP3A 2WTEA 2R7FA 3WU0A 3K1PA 4RAYA 1BJAA 3L9FA 3WTTC 2O61A 4AWXB 1LEBA 1U8RA 2HWVA 2P7CB 3GXOA 1F9NA 1S7OA 1R7JA 2OZ6A 4WK8F 1D8JA 1S6LA 2E7WA 4EM1A 4AIKA 5FLXZ 4I98B 2DW4A 3LSTA 4LLGF 3ECHA 2XKOA 3PFIA 4TV7A 3RPQA 1P6RA 2OBPA 3F8MA 4CICA 3K0LA 3GX4X 2PMUA 1LQ1A 5H6QA 4ENJA 5AIPA 5CLSA 2XAJA 4OIRF 4OIQF 3IRRA 4PCQA 3SFZA 4A0XA 4L18B 4ZYGA 5JHUA 1ONVA 1XCBA 3GFMA 3WU1B 3U9GA 1FBQA 3M8EA 1OKRA 4YIIA 1FLIA 1SFXA 2ZNZA 2P5KA 1ZG3A 2Q2EA 4CHUA 3TKYA 3P9KA 3V7SA 1C0WA 1GHCA 1F4KA 1ZH5A 3M9AA 5LGTA 1YYVA 3E6DA 3RIRA 1K79A 2YU3A 2JSCA 1V3FA 3C18A 1L0OC 4JK1X 3F21A 1H9GA 5D6FA 2GXBA 2VBXA 4MTEA 2FQ3A 4WX9A 1W7PA 1WWXA 3FXRA 1LVAA 4HF1A 1IN5A 4OMZA 2BV6A 2EFQA 3GZ5A 5DD4A 2MH2A 2QVOA 4XSZF 3R4KA 4PZJA 4Q47A 5EEGA 1R1VA 2Y48A 1J2XA 1IN6A 3T1BA 5HS7A 5TRDA 3Q9VA 3K2ZA 3OV8A 2MA3A 3FHZA 5L3DA 3QP5A 5ICFA 4MNUA 4KIBA 3JSPA 1LNWA 3SZPA 4BHBA 1LDJA 5ERIA 5ILUA 2NRAC 1KU7A 2HQRA 3NRVA 3ZMZA 2JPCA 1FBUA 1WKMA 4BH9A 1I6XA 3Q5FA 1B59A 1FNNA 5KK1A 3BPXA 3HYIA 4I0BA 1IW7F 3F6VA 4LLNA 3C1DA 2OQRA 4LG0A 4KDPA 2WWYA 3GO5A 2ZCWA 1HKTA 1U5TA 2G7HA 3T0YA 3KLOA 2UZKA 2P5LC 2QM3A 2ADUA 4ASNA 2BGCA 2LDUA 1YFHA 1PDNC 4A6DA 1IN4A 1FP1D 4RGRA 5H6RA 3GFJA 4U0WA 1RIOH 3T8TA 1ZLJA 2CG4A 3P9IA 3WTWC 4O3MA 2NNYA 1U2WA 2ISYA 1ZRFA 1FX7A 1ZG1A 1MJBA 4WF2A 4KUMA 3T5XA 1KQ9A 1SD6A 4HX7A 3WE3A 3E5UA 4H0EA 2XIGA 2KKOA 4G7OF 5IT9K 1OYWA 1SMYF 5FB2A 2K7LA 3M8FA 4UV8A 3AAFA 3HHGA 1S29A 4EJUA 3FMSA 1RUOA 2UXXA 1BC7C 4GCVA 1XGSA 2IA2A 3I5UA 4LGWA 2MLGA 2QLZA 3L09A 5KVRA 4I01A 2HTJA 3VFZA 1U3EM 3LA3A 5JI6A 2C6YA 4IJAA 3BJAA 5TJJA 4WWCA 3SXYA 2YSRA 2H6CA 3PQJA 4GYGA 2DPDA 3LA2A 3TOAA 1G3TA 3E6BA 3BP8A 2ZKZA 4BXUA 3BWGA 4BAYA 2L01A 3LWFA 2XAGA 1J59A 1YQAA 1WRJA 4IF4A 2EV5A 1GXPA 1R58A 3KP6A 2YX7A 1BOAA 4M9SA 4MEYF 3LA7A 4FHTA 2NAZA 3IL2A 4JBAA 5IT9Z 1R1UA 2VC1A 1HXDA 3F6OA 4O5VA 4IXAA 2R3SA 4AIJA 4OU0A 4AD9A 3U2RA 2HYFA 4ON0A 4EJTA 1RZ4A 4UNOA 2Z9OA 2L4MA 1MD0A 2QUFA 2UXNA 3WTYC 5ICEA 2IPQX 3IHUA 4HDUA 3IRQA 2V79A 2RC4A 3K1NA 1AWCA 3KE2A 4ESBA 1JHFA 5LBQA 1IN8A 3FX3A 2M5WA 3QAHA 4HF2A 3K1MA 2PI0A 2OA4A 1MJ9A 2STTA 2FNPA 2O3FA 3IWFA 3RKXA 2KIMA 4P96A 1O7FA 3RPUA 2VE9A 3Q9SA 4HQMA 4EJWA 2XRNA 2DO7A 1FP2A 2IVMA 3ZP5A 2RV8A 1USTA 3MWMA 5DDGA 4Y17A 5DCMB 4EMSA 4MGRA 3QOPA 1ZYRF 1IXSB 2LF8A 3FWEA 1XCVA 2V9VA 1E17A 4LFUA 5D6EA 1G4DA 2HTSA 3IKVA 2FF4A 1TNTA 1WQ2A 3KP7A 1G3YA 2Z99A 2J5PA 3MFKA 4ENNA 2DK5A 1Z6RA 1BM9A 3B02A 3MZHA 1IF1A 5LGUA 1IAWA 3H3UA 2PMHA 1YLFA 3F8FA 3L2CA 3JTGA 4IPAA 5BS6A 3HIFA 1BIAA 3E5XA 4RAZA 3GYHX 1R1TA 2VBWA 3KP5A 4LD5A 4OIOF 3D0SA 1FSEA 1XDSA 1XSVA 5HDNA 4CZZA 5DUIA 2O8XA 3LAPA 1CF7B 1MZBA 4ESJA 1FZPB 2NS0A 4LK1F 4RB0A 1TQMA 2IA1A 2JTVA 5JR3A 1Z91A 1FY7A 1Y0UA 4UV9A 5EEHA 3F3XA 2B0LA 5LHIA 1XMKA 4FX4A 1KYZA 3I4PA 1XDUA 2ELHA 3NQOA 4RB3C 1IRFA 1YW8A 4NHJA 3R0AA 1KGSA 1K78A 2QQ9A 2VOOA 3ULQB 1P4AA 3CUQC 4MQ9F 3WTXC 5JFRA 2EV6A 2WC2A 5FD6A 2M8EA 2ACJA 5LLQA 4KIGA 1VTNC 4KICA 5J8FA 2FU4A 1BI1A 3GFIA 4EQQA 2FA5A 4CGZA 3BOQA 5K5QA 2EWNA 2KJCA 4M74A 3O2PE 3F8BA 5ICCA 1SMTA 2DI3A 2L54A 4RGSA 2V1DA 2GQQA 2M1BA 4IRHA 5D8LB 4AVPA 4GGGA 4NQWA 3H3ZA 3HRSA 2HOEA 4HA8A 2QBYA 5DCMA 2VOPA 2BBYA 5D5WB 1XGMA 4HV5A 4LJZF 4G9YA 1DPUA 1B4AA 4N0BA 4IHTA 1ZGJA 3EQLF 4EJVA 4ZYHA 4WXDA 2IRFG 2H27A 1FWZA 1HSJA 2PQ8A 3N97A 2F5EA 4FT8A 5D5XB 1XMAA 5ILSA 2EFWA 1I1GA 1XGNA 2DQLA 3W6KB 3FXQA 5D5UB 5L3GA 5D8KB 4Q5SF 3DKWA 3SQNA 1FYKA 1FC3A 5FGMA 3L7WA 4BNCA 5E17F 2CSOA 2XVCA 4L5IA 3I59A 4L9TA 1R23A 3DEUA 2M45A 3I54A 2FXAA 4HW0A 1DDNA 4P9UA 2ZBKA 3O3KA 2GWRA 4EVIA 4ENKA 2DAOA 1Z6TA 5BQTA 2DPUA 1IRGA 4D0PA 5F1RA 4U0VA 1MJAA 5A2QZ 2EB7A 1HW5A 2YX4A 2FE3A 2K02A 1XN7A 3J81Z 2LKPA 2RNJA 3WTVC 4BYYA 4A12A 5CVVA 5F64A 3DPLC 3TDUC 1FSHA 2GIVA 1QNTA 3I58A 4UUVA 3CUQB 2VC0A 4HQEA 2ZMEB 2CO5A 1YS6A 2EFOA 2MD5A 2VXZA 4A6EA 3F22A 2OQGA 4YIFA 1O3RA 4EM0B 3DP7A 3MAJA 3S2WA 1HW2A 4E70A 4HBLA 1FPQA 3ZMTA 2HDCA 4Y13A 3KETA 1SD4A 4RB2C 2RVCA 3IKTA 2NYXA 5ED4A 2YR2A 2K27A 1X3UA 5ILVA 4UHTA 3MZYA 1I1SA 2OZUA 5AIQA 3JSOA 3F8NA 3FMRA 2XASA 1QZZA 4MQVA 3ECOA 1ZAOA 3RI4A 4YG2F 4WCGA 2O0YA 4HDVA 3B73A 2IP2A 1Z9CA 1HKQA 4I7HA 5FFXA 1QBJA 3V4GA 4ETSA 2F5CA 2FBKA 1W5TA 2LNBA 1WSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDP A;  1JHH A;  2KIU A;  2LF7 A;  4UVC A;  5BPD A;  3G73 A;  4WXH A;  4PDK A;  1P2F A;  3WE2 A;  3P9C A;  1S3J A;  1L3L A;  4LB5 A;  4IRG A;  3CTA A;  5HVQ C;  5LEJ A;  5CYV A;  2EFP A;  2FML A;  5CVI A;  4NB5 A;  1RUN A;  4XLN F;  2W85 A;  1T39 A;  3GUD A;  3KEQ A;  2W25 A;  2A5Y B;  1S7A A;  2ESN A;  2WV0 A;  3KEO A;  4N9I A;  4L0Y B;  1TW3 A;  2QWW A;  4B8X A;  4M6X A;  3M7G A;  1P4W A;  3G3Z A;  1MGT A;  4KMF A;  1EH8 A;  1ON2 A;  2RGV A;  3GEZ A;  2XAH A;  4P5O A;  3TO7 A;  5E20 A;  4U88 A;  4XLP F;  5LRS A;  3F23 A;  2HS5 A;  4XRF A;  5JVT A;  3R61 A;  2O03 A;  1SD7 A;  3VB2 A;  4A5M A;  3HTS B;  2P7V B;  2CWE A;  2M87 A;  1DUX C;  1G3W A;  2F5F A;  2VOD A;  3M1E A;  3I0T A;  2QEN A;  4L9J A;  5LEK A;  2BYV E;  3RKY A;  2FSW A;  4UVB A;  1ZRD A;  3ISP A;  2PLY A;  3MEX A;  4L0Z B;  2P6T A;  2PJP A;  1OYI A;  3FF5 A;  1G3S A;  4ZZD A;  2IW5 A;  4UVA A;  3HHH A;  2Z3Y A;  5J8C A;  1LEA A;  1PP8 F;  3RTR A;  1UB9 A;  4OIN F;  4S05 A;  2MH9 A;  4PGG A;  5HOO A;  3BJO A;  1O3S A;  4P9F A;  2FNA A;  2E1C A;  2OU2 A;  4M9Z A;  1P92 A;  5K5R A;  2DTR A;  2FBH A;  1U5T C;  3WGG A;  4PGH A;  3CJN A;  4I09 A;  1Z7U A;  4HLX A;  2DLL A;  3KLN A;  4KFC A;  1JGS A;  1KYW A;  3RYR A;  4RS8 A;  4XBF A;  1KQ8 A;  2HEO A;  2EJR A;  3KP2 A;  5BMZ A;  2MBF A;  3RJP A;  5E1W A;  4BHP A;  1IXC A;  3WGI A;  2A07 F;  1J0R A;  1K6O A;  3WTS C;  3R6S A;  1JE8 A;  1R22 A;  3DXJ F;  2DU9 A;  5ICG A;  2M30 A;  3GLX A;  4HAM A;  3BRO A;  3V7R A;  3FM5 A;  3HSF A;  1EH6 A;  4M9X A;  2OAZ A;  1T6S A;  2QQA A;  3C7J A;  4DQ2 A;  5CJ9 A;  1P4X A;  2W84 A;  4XSX F;  1FT9 A;  2QZ8 A;  1B9M A;  2TDX A;  2DBB A;  2XAQ A;  4U7D A;  1PP7 U;  1QO0 D;  4I02 A;  1NHA A;  3ZMS A;  2P5V A;  2ZFW A;  1LDK B;  4ZYD A;  1LJ9 A;  2H94 A;  1F1Z A;  1SFE A;  4LLL A;  3ZMD A;  1O3T A;  3O6B B;  3N4M A;  2EK5 A;  1W7P B;  5LGN A;  2RQP A;  5E8I A;  3ABU A;  3EUH A;  1GVJ A;  1OPC A;  1T0F A;  5L3E A;  5BPI A;  1WI9 A;  2MC3 A;  1H9T A;  1T38 A;  2J5O A;  3ZMU A;  2D1V A;  2DFI A;  2Q8K A;  1D5V A;  1IZ1 A;  3QRF F;  1XSD A;  2ZJ2 A;  1TQP A;  3DFG A;  3TO9 A;  3V8K A;  2VON A;  3ABT A;  1STZ A;  3BPV A;  3W6J B;  3D5L A;  3P7N A;  2FOK A;  3TOB A;  3HRT A;  3QU3 A;  4R1H A;  3QP6 A;  3ERE D;  3QPH A;  1LB2 A;  2DQR A;  3GWZ A;  4HOB A;  4AIH A;  3IC7 A;  2XKP A;  5K5O A;  4MTD A;  1J75 A;  2DT5 A;  2AS5 F;  1TLH B;  2ISZ A;  1UHW A;  1OYY A;  1TTY A;  3WOD F;  1B1B A;  1USS A;  3F8C A;  1ULY A;  3HTU A;  2RDP A;  1QZY A;  1UCR A;  1W7P D;  1YS7 A;  2EA2 A;  4GYI A;  4A5N A;  4G94 A;  1DPR A;  2XGX A;  5DV5 A;  4LG0 B;  2FBI A;  2IT0 A;  2PN6 A;  1EV7 A;  5FFZ A;  4HZF A;  1U5T B;  2JPB A;  2ETH A;  5CVU A;  1SAX A;  4DNC A;  2JT1 A;  3REO A;  1K7A A;  3LQQ A;  3NEU A;  2A6H F;  4ZZL A;  4A0Y A;  1FYM A;  5A2Q K;  3ZMV A;  5HLH A;  1PUE E;  1D8K A;  1S8N A;  3J81 K;  2DK8 A;  3FZV A;  4G7Z F;  2CYY A;  4N9H A;  2COM A;  4EV0 A;  2A6E F;  1LDD A;  1GXQ A;  4QWQ A;  4UXN A;  2A68 F;  3CO6 C;  2XAF A;  1ZRE A;  2HKX A;  2JRT A;  3TO6 A;  4ENM A;  1QGP A;  4YFK F;  5LHG A;  4HX8 A;  1G6N A;  2VBY A;  3K69 A;  1EH7 A;  3LFK A;  4A2U A;  4KT5 C;  1TNS A;  3ZQ7 A;  2AXL A;  1B6A A;  2L3D A;  2RN7 A;  5DYM A;  1CGP A;  2FMY A;  1HKS A;  2GA2 A;  2P8T A;  2BEO A;  3KP4 A;  1BN5 A;  2E7X A;  3SZT A;  3VOE A;  1W4M A;  2XUB A;  3HRM A;  3J80 K;  2K4B A;  2HGC A;  2GXG A;  4CYD A;  1R5H A;  1ZG5 A;  4Y15 A;  1R00 A;  2D1H A;  4EM2 A;  2K4J A;  3FM3 A;  1ZAR A;  1XSX A;  4F7Z A;  2STW A;  2Y0M A;  3I64 A;  1XD7 A;  4MEX F;  1W5S A;  1YG2 A;  5E8G A;  1TQI A;  1O3Q A;  1ZLK A;  5CVR A;  1CF7 A;  4HYE A;  3HRU A;  4JQF A;  3I71 A;  2K86 A;  4G6Q A;  4G8X A;  5L3B A;  3ML6 A;  1KQ0 A;  1QPM A;  3E6M A;  4GO1 A;  3HUG A;  2Z5U A;  1TW2 A;  3L00 A;  1KU2 A;  1YIO A;  1KA8 A;  4CO8 A;  2KIF A;  1ZHF A;  4ESF A;  4I2O A;  3RDI A;  1OMI A;  2A69 F;  4U7B A;  3E3V A;  3KZZ A;  4L9N A;  4EGZ A;  4G7H F;  3VEP A;  3KZY A;  3H92 A;  3VOD A;  2PBI A;  1ZRC A;  3JW4 A;  1BI3 A;  1I27 A;  3ELK A;  1YW7 A;  1J5Y A;  1V4R A;  4OIP F;  2D45 A;  1HQC A;  4EGY A;  5AON A;  3RKW A;  5HS8 A;  1ZN2 A;  2Y75 A;  3FXU A;  4OOI A;  1TBX A;  5HLG A;  3DF8 A;  1MDM B;  4KYW A;  3J80 Z;  2MLK A;  1Z05 A;  4ZYE A;  2E1N A;  2V1X A;  5J6X A;  2HR3 A;  3LAJ A;  1F5T A;  4I0A A;  2VT2 A;  2V1U A;  2X0L A;  3PQK A;  3MQ0 A;  4M72 A;  5D4R A;  3T8R A;  1BC8 C;  1XGO A;  2W57 A;  3I53 A;  1YW9 A;  1ON1 A;  4L9V A;  5E1X A;  5DEQ A;  1D3Y A;  2QYO A;  3GF2 A;  1ZGA A;  2H6B A;  2CQK A;  1MKM A;  3TQN A;  2FEZ A;  3WTZ A;  4KN7 X;  5LHH A;  3ROU A;  1T98 A;  2P6S A;  2D2W A;  2H09 A;  3EET A;  1YTY A;  3ZN0 A;  3K9T A;  4RGX A;  3JAM K;  6PAX A;  1REP C;  1KU3 A;  4S04 A;  3KCC A;  2CFX A;  4FX0 A;  2PG4 A;  2V6C A;  2ZNY A;  3KFW X;  4M6Y A;  3FMQ A;  2IJL A;  5DCF A;  4KMU X;  1U6G A;  2ZO4 A;  4IVN A;  2RKH A;  4G6D A;  1BI0 A;  1J9I A;  3SHF A;  1E2X A;  3DV8 A;  3ZN1 A;  1XB4 A;  1H0M A;  3GFL A;  2FRH A;  3R60 A;  3QPT A;  4Q4Z F;  5DUK A;  1HW1 A;  4HX4 A;  5HDK A;  5HLI A;  4MHG A;  3COA C;  2G9W A;  1Q1H A;  3TGN A;  2OD5 A;  3QU6 A;  2JZY A;  3CDH A;  2R7D A;  3BY6 A;  3RYP A;  2EA4 A;  3E5Q A;  4QLC U;  1UFM A;  1AOY A;  3OOP A;  2Q0O A;  2Z33 A;  1IXR C;  3R0J A;  5L3F A;  4EJO A;  2LSO A;  2GA1 A;  3CUQ A;  3DPT A;  1FOK A;  2ZME A;  1A04 A;  3J7A O;  4L5J A;  1UHM A;  3JAM Z;  5HS9 A;  1ODD A;  4B09 A;  2NNN A;  5E18 F;  2G7U A;  1K78 B;  2F5D A;  3TDZ C;  4K2E A;  5L3C A;  2YPR A;  4HV6 A;  1J7K A;  3U1D A;  1B9N A;  4R79 A;  4M71 A;  2ZXJ A;  4KNY A;  1MDM A;  4IHS A;  1KU9 A;  4LMY A;  1O57 A;  4RGU A;  5LRR A;  3CLO A;  4M73 A;  1DP7 P;  3F72 A;  1FBS A;  1BI2 A;  3BZ6 A;  1HST A;  2A61 A;  2PFB A;  4ZH4 F;  4O6J A;  3WG9 A;  1I5Z A;  4IRI A;  3MCZ A;  1SD5 A;  3HOT A;  2EV0 A;  4LK0 F;  2P4W A;  5IT3 A;  5HDG A;  2XRO A;  3CO7 C;  3EYI A;  3HSR A;  2XV4 S;  2HKO A;  3ZPL A;  4GXO A;  3GW2 A;  4BHC A;  1SFU A;  1RI7 A;  2L02 A;  2QBY B;  2HQN A;  2CGP A;  5CVJ A;  5FD5 A;  1JXS A;  2CW0 F;  3E97 A;  4KN4 X;  1RNL A;  3GVA A;  3LQR A;  2EFN A;  5H20 A;  1FYL A;  3JTH A;  1Z1D A;  4RB1 A;  2HYG D;  2KRF A;  5DD8 A;  3E6C C;  4HLY A;  1U78 A;  4WXC A;  5E1Z B;  2UWM A;  2VE8 A;  3WGH A;  1BBY A;  2A3S A;  2PEX A;  1QQI A;  5D5V B;  5K1Y A;  1R36 A;  3V7C A;  2X4H A;  2GZW A;  4YFN F;  4HF0 A;  3BJ6 A;  2GAU A;  4Q48 A;  3GZ6 A;  3EYY A;  3I59 B;  5FLX K;  3HSE A;  2HFH A;  3CUO A;  5BOX A;  2VBZ A;  2O6G E;  5FO5 A;  1IN7 A;  3IWZ A;  3V8L A;  2HZT A;  2XHK A;  1OR7 A;  2L4A A;  4KA4 A;  1HBX G;  4A0Z A;  1R5G A;  3HOS A;  1T2K A;  4P55 A;  1O7L A;  3WTU C;  1BIB A;  3DQV C;  4CDG A;  4LB6 B;  2F2E A;  2IA0 A;  4CXF A;  4BQA A;  3V8J A;  4R8H A;  2BE5 F;  4U0Y A;  4Z2Y A;  2W24 A;  5D4S A;  2VN2 A;  1YO5 C;  2VT3 A;  1IUY A;  3C3W A;  4KIF A;  3BDD A;  2KJB A;  4YFX F;  2QQB A;  2ESH A;  5F6F A;  4OMY A;  3KP3 A;  2WTE A;  2R7F A;  3WU0 A;  3K1P A;  4RAY A;  1BJA A;  3L9F A;  3WTT C;  2O61 A;  4AWX B;  1LEB A;  1U8R A;  2HWV A;  2P7C B;  3GXO A;  1F9N A;  1S7O A;  1R7J A;  2OZ6 A;  4WK8 F;  1D8J A;  1S6L A;  2E7W A;  4EM1 A;  4AIK A;  5FLX Z;  4I98 B;  2DW4 A;  3LST A;  4LLG F;  3ECH A;  2XKO A;  3PFI A;  4TV7 A;  3RPQ A;  1P6R A;  2OBP A;  3F8M A;  4CIC A;  3K0L A;  3GX4 X;  2PMU A;  1LQ1 A;  5H6Q A;  4ENJ A;  5AIP A;  5CLS A;  2XAJ A;  4OIR F;  4OIQ F;  3IRR A;  4PCQ A;  3SFZ A;  4A0X A;  4L18 B;  4ZYG A;  5JHU A;  1ONV A;  1XCB A;  3GFM A;  3WU1 B;  3U9G A;  1FBQ A;  3M8E A;  1OKR A;  4YII A;  1FLI A;  1SFX A;  2ZNZ A;  2P5K A;  1ZG3 A;  2Q2E A;  4CHU A;  3TKY A;  3P9K A;  3V7S A;  1C0W A;  1GHC A;  1F4K A;  1ZH5 A;  3M9A A;  5LGT A;  1YYV A;  3E6D A;  3RIR A;  1K79 A;  2YU3 A;  2JSC A;  1V3F A;  3C18 A;  1L0O C;  4JK1 X;  3F21 A;  1H9G A;  5D6F A;  2GXB A;  2VBX A;  4MTE A;  2FQ3 A;  4WX9 A;  1W7P A;  1WWX A;  3FXR A;  1LVA A;  4HF1 A;  1IN5 A;  4OMZ A;  2BV6 A;  2EFQ A;  3GZ5 A;  5DD4 A;  2MH2 A;  2QVO A;  4XSZ F;  3R4K A;  4PZJ A;  4Q47 A;  5EEG A;  1R1V A;  2Y48 A;  1J2X A;  1IN6 A;  3T1B A;  5HS7 A;  5TRD A;  3Q9V A;  3K2Z A;  3OV8 A;  2MA3 A;  3FHZ A;  5L3D A;  3QP5 A;  5ICF A;  4MNU A;  4KIB A;  3JSP A;  1LNW A;  3SZP A;  4BHB A;  1LDJ A;  5ERI A;  5ILU A;  2NRA C;  1KU7 A;  2HQR A;  3NRV A;  3ZMZ A;  2JPC A;  1FBU A;  1WKM A;  4BH9 A;  1I6X A;  3Q5F A;  1B59 A;  1FNN A;  5KK1 A;  3BPX A;  3HYI A;  4I0B A;  1IW7 F;  3F6V A;  4LLN A;  3C1D A;  2OQR A;  4LG0 A;  4KDP A;  2WWY A;  3GO5 A;  2ZCW A;  1HKT A;  1U5T A;  2G7H A;  3T0Y A;  3KLO A;  2UZK A;  2P5L C;  2QM3 A;  2ADU A;  4ASN A;  2BGC A;  2LDU A;  1YFH A;  1PDN C;  4A6D A;  1IN4 A;  1FP1 D;  4RGR A;  5H6R A;  3GFJ A;  4U0W A;  1RIO H;  3T8T A;  1ZLJ A;  2CG4 A;  3P9I A;  3WTW C;  4O3M A;  2NNY A;  1U2W A;  2ISY A;  1ZRF A;  1FX7 A;  1ZG1 A;  1MJB A;  4WF2 A;  4KUM A;  3T5X A;  1KQ9 A;  1SD6 A;  4HX7 A;  3WE3 A;  3E5U A;  4H0E A;  2XIG A;  2KKO A;  4G7O F;  5IT9 K;  1OYW A;  1SMY F;  5FB2 A;  2K7L A;  3M8F A;  4UV8 A;  3AAF A;  3HHG A;  1S29 A;  4EJU A;  3FMS A;  1RUO A;  2UXX A;  1BC7 C;  4GCV A;  1XGS A;  2IA2 A;  3I5U A;  4LGW A;  2MLG A;  2QLZ A;  3L09 A;  5KVR A;  4I01 A;  2HTJ A;  3VFZ A;  1U3E M;  3LA3 A;  5JI6 A;  2C6Y A;  4IJA A;  3BJA A;  5TJJ A;  4WWC A;  3SXY A;  2YSR A;  2H6C A;  3PQJ A;  4GYG A;  2DPD A;  3LA2 A;  3TOA A;  1G3T A;  3E6B A;  3BP8 A;  2ZKZ A;  4BXU A;  3BWG A;  4BAY A;  2L01 A;  3LWF A;  2XAG A;  1J59 A;  1YQA A;  1WRJ A;  4IF4 A;  2EV5 A;  1GXP A;  1R58 A;  3KP6 A;  2YX7 A;  1BOA A;  4M9S A;  4MEY F;  3LA7 A;  4FHT A;  2NAZ A;  3IL2 A;  4JBA A;  5IT9 Z;  1R1U A;  2VC1 A;  1HXD A;  3F6O A;  4O5V A;  4IXA A;  2R3S A;  4AIJ A;  4OU0 A;  4AD9 A;  3U2R A;  2HYF A;  4ON0 A;  4EJT A;  1RZ4 A;  4UNO A;  2Z9O A;  2L4M A;  1MD0 A;  2QUF A;  2UXN A;  3WTY C;  5ICE A;  2IPQ X;  3IHU A;  4HDU A;  3IRQ A;  2V79 A;  2RC4 A;  3K1N A;  1AWC A;  3KE2 A;  4ESB A;  1JHF A;  5LBQ A;  1IN8 A;  3FX3 A;  2M5W A;  3QAH A;  4HF2 A;  3K1M A;  2PI0 A;  2OA4 A;  1MJ9 A;  2STT A;  2FNP A;  2O3F A;  3IWF A;  3RKX A;  2KIM A;  4P96 A;  1O7F A;  3RPU A;  2VE9 A;  3Q9S A;  4HQM A;  4EJW A;  2XRN A;  2DO7 A;  1FP2 A;  2IVM A;  3ZP5 A;  2RV8 A;  1UST A;  3MWM A;  5DDG A;  4Y17 A;  5DCM B;  4EMS A;  4MGR A;  3QOP A;  1ZYR F;  1IXS B;  2LF8 A;  3FWE A;  1XCV A;  2V9V A;  1E17 A;  4LFU A;  5D6E A;  1G4D A;  2HTS A;  3IKV A;  2FF4 A;  1TNT A;  1WQ2 A;  3KP7 A;  1G3Y A;  2Z99 A;  2J5P A;  3MFK A;  4ENN A;  2DK5 A;  1Z6R A;  1BM9 A;  3B02 A;  3MZH A;  1IF1 A;  5LGU A;  1IAW A;  3H3U A;  2PMH A;  1YLF A;  3F8F A;  3L2C A;  3JTG A;  4IPA A;  5BS6 A;  3HIF A;  1BIA A;  3E5X A;  4RAZ A;  3GYH X;  1R1T A;  2VBW A;  3KP5 A;  4LD5 A;  4OIO F;  3D0S A;  1FSE A;  1XDS A;  1XSV A;  5HDN A;  4CZZ A;  5DUI A;  2O8X A;  3LAP A;  1CF7 B;  1MZB A;  4ESJ A;  1FZP B;  2NS0 A;  4LK1 F;  4RB0 A;  1TQM A;  2IA1 A;  2JTV A;  5JR3 A;  1Z91 A;  1FY7 A;  1Y0U A;  4UV9 A;  5EEH A;  3F3X A;  2B0L A;  5LHI A;  1XMK A;  4FX4 A;  1KYZ A;  3I4P A;  1XDU A;  2ELH A;  3NQO A;  4RB3 C;  1IRF A;  1YW8 A;  4NHJ A;  3R0A A;  1KGS A;  1K78 A;  2QQ9 A;  2VOO A;  3ULQ B;  1P4A A;  3CUQ C;  4MQ9 F;  3WTX C;  5JFR A;  2EV6 A;  2WC2 A;  5FD6 A;  2M8E A;  2ACJ A;  5LLQ A;  4KIG A;  1VTN C;  4KIC A;  5J8F A;  2FU4 A;  1BI1 A;  3GFI A;  4EQQ A;  2FA5 A;  4CGZ A;  3BOQ A;  5K5Q A;  2EWN A;  2KJC A;  4M74 A;  3O2P E;  3F8B A;  5ICC A;  1SMT A;  2DI3 A;  2L54 A;  4RGS A;  2V1D A;  2GQQ A;  2M1B A;  4IRH A;  5D8L B;  4AVP A;  4GGG A;  4NQW A;  3H3Z A;  3HRS A;  2HOE A;  4HA8 A;  2QBY A;  5DCM A;  2VOP A;  2BBY A;  5D5W B;  1XGM A;  4HV5 A;  4LJZ F;  4G9Y A;  1DPU A;  1B4A A;  4N0B A;  4IHT A;  1ZGJ A;  3EQL F;  4EJV A;  4ZYH A;  4WXD A;  2IRF G;  2H27 A;  1FWZ A;  1HSJ A;  2PQ8 A;  3N97 A;  2F5E A;  4FT8 A;  5D5X B;  1XMA A;  5ILS A;  2EFW A;  1I1G A;  1XGN A;  2DQL A;  3W6K B;  3FXQ A;  5D5U B;  5L3G A;  5D8K B;  4Q5S F;  3DKW A;  3SQN A;  1FYK A;  1FC3 A;  5FGM A;  3L7W A;  4BNC A;  5E17 F;  2CSO A;  2XVC A;  4L5I A;  3I59 A;  4L9T A;  1R23 A;  3DEU A;  2M45 A;  3I54 A;  2FXA A;  4HW0 A;  1DDN A;  4P9U A;  2ZBK A;  3O3K A;  2GWR A;  4EVI A;  4ENK A;  2DAO A;  1Z6T A;  5BQT A;  2DPU A;  1IRG A;  4D0P A;  5F1R A;  4U0V A;  1MJA A;  5A2Q Z;  2EB7 A;  1HW5 A;  2YX4 A;  2FE3 A;  2K02 A;  1XN7 A;  3J81 Z;  2LKP A;  2RNJ A;  3WTV C;  4BYY A;  4A12 A;  5CVV A;  5F64 A;  3DPL C;  3TDU C;  1FSH A;  2GIV A;  1QNT A;  3I58 A;  4UUV A;  3CUQ B;  2VC0 A;  4HQE A;  2ZME B;  2CO5 A;  1YS6 A;  2EFO A;  2MD5 A;  2VXZ A;  4A6E A;  3F22 A;  2OQG A;  4YIF A;  1O3R A;  4EM0 B;  3DP7 A;  3MAJ A;  3S2W A;  1HW2 A;  4E70 A;  4HBL A;  1FPQ A;  3ZMT A;  2HDC A;  4Y13 A;  3KET A;  1SD4 A;  4RB2 C;  2RVC A;  3IKT A;  2NYX A;  5ED4 A;  2YR2 A;  2K27 A;  1X3U A;  5ILV A;  4UHT A;  3MZY A;  1I1S A;  2OZU A;  5AIQ A;  3JSO A;  3F8N A;  3FMR A;  2XAS A;  1QZZ A;  4MQV A;  3ECO A;  1ZAO A;  3RI4 A;  4YG2 F;  4WCG A;  2O0Y A;  4HDV A;  3B73 A;  2IP2 A;  1Z9C A;  1HKQ A;  4I7H A;  5FFX A;  1QBJ A;  3V4G A;  4ETS A;  2F5C A;  2FBK A;  1W5T A;  2LNB A;  1WSU A; 
#chains in the Genus database with same CATH topology
 2JA6 J;  3H3V K;  1LPQ A;  3J7A Y;  5HNH A;  2NVY J;  3EDP A;  1H88 C;  1JHH A;  3U1K A;  1U9N A;  3JRH A;  3DTK A;  3CCQ I;  2KIU A;  2LF7 A;  4UVC A;  1A31 A;  5BPD A;  3G73 A;  4WXH A;  4PDK A;  2E5N A;  1P2F A;  3SYT A;  3WE2 A;  3P9C A;  1S3J A;  1BOB A;  3MD2 A;  4XIC A;  1L3L A;  4LB5 A;  3FHN A;  2JA7 J;  4IRG A;  1ZQ3 P;  3CTA A;  2EIM H;  2RRE A;  5HVQ C;  4AU7 A;  5LEJ A;  1ACI A;  4JP0 A;  5CYV A;  4RMN A;  2EFP A;  2FML A;  3P5J A;  3DCF A;  5CVI A;  4NB5 A;  1T33 A;  3VYR B;  1RUN A;  4II3 A;  5F0C A;  2JWT A;  4XLN F;  2W85 A;  1AKH B;  1T39 A;  3GUD A;  3BR6 A;  2XF5 A;  1X2M A;  3KEQ A;  2W25 A;  1S5L C;  2A5Y B;  1S7A A;  2ESN A;  3OYH A;  2RQQ A;  2WV0 A;  3A0B C;  3KEO A;  2XC7 A;  2O7O A;  2LBF A;  2LVS A;  2LFB A;  4A3G J;  4GFB A;  4BU2 A;  4N9I A;  2HOT A;  3MKZ A;  3RZD J;  4L0Y B;  1TW3 A;  2QWW A;  4B8X A;  1X1D A;  3K7A J;  3TP3 A;  1DU0 A;  4D9J A;  4M6X A;  5EDN A;  3IP4 B;  1EJ9 A;  3M7G A;  1P4W A;  3G3Z A;  5KNL A;  1MGT A;  1F43 A;  1MNE A;  1SAU A;  4LG3 A;  4AUX A;  1S9H A;  4KMF A;  1EH8 A;  1ON2 A;  3CCL I;  5EJC A;  2RGV A;  4XLE A;  3GEZ A;  2XAH A;  3M4O J;  4CYC A;  4P5O A;  2CW7 A;  4E4H A;  4A3F J;  3TO7 A;  2VQC A;  5E20 A;  4U88 A;  4KIT B;  4XLP F;  4E7J A;  5LRS A;  3F23 A;  4GDF A;  4IKF A;  2HS5 A;  4D5C A;  4XRF A;  5J40 A;  2MAB A;  3K4M A;  4XR6 A;  1Y6I A;  2VQH A;  5JVT A;  1OLT A;  2ICW G;  3R61 A;  2LRD A;  4Y52 J;  2O03 A;  1SD7 A;  3BG9 A;  3VB2 A;  4A5M A;  2Y30 A;  1VQ7 I;  3HTS B;  2P7V B;  2CWE A;  2M87 A;  2OUM A;  1QPI A;  1A6Q A;  1DUX C;  4BDZ A;  1G3W A;  2F5F A;  4CUG A;  2VOD A;  3M1E A;  1V54 H;  4QSH A;  3CJQ B;  5HNF A;  5B5E C;  1A35 A;  5K7Z A;  3I0T A;  1YX5 A;  2QEN A;  4L9J A;  5LEK A;  1MBG A;  2AQF A;  2BYV E;  4DW6 A;  3RKY A;  2FSW A;  2JSP A;  4UVB A;  1ZRD A;  3ISP A;  4S0H B;  5IOY A;  2PLY A;  3QYE A;  3MEX A;  2BHZ A;  4L0Z B;  2LD5 A;  1CQT A;  2P6T A;  2PJP A;  2AHQ A;  1OYI A;  3FF5 A;  1G3S A;  3OOU A;  1WCM J;  1ZR2 A;  1BR2 A;  4ZZD A;  5F08 A;  2OCE A;  2CUE A;  5JLX A;  1OQY A;  3DTI A;  2IW5 A;  4UVA A;  1E3H A;  2Z3Y A;  3HHH A;  1LEA A;  5J8C A;  2ZJQ F;  2A05 A;  1PP8 F;  2NS8 A;  3S1N J;  1IDY A;  1NG7 A;  2R7R A;  1GV5 A;  3I4M J;  1ZKG A;  3ZOB A;  2R93 J;  4FIS A;  3RTR A;  4F3Q A;  4CH7 A;  1UB9 A;  4OWR B;  3LSH A;  3LNQ A;  1VFC A;  4OIN F;  2IS4 A;  3OYG A;  2EBI A;  4S05 A;  2CS3 A;  3OYA A;  2MH9 A;  4PGG A;  5HOO A;  3BJO A;  1O3S A;  2LY9 A;  4J00 A;  1GLN A;  4P9F A;  2FNA A;  2E1C A;  2OU2 A;  2MC4 A;  3HPH A;  2DJN A;  4M9Z A;  3NAR A;  3SEQ A;  1P92 A;  3Q0V A;  3S1R J;  2MYS A;  4C3H J;  5K5R A;  2DTR A;  3ABL H;  1OCT C;  2FBH A;  4N4N B;  4G12 A;  1U5T C;  1JUP A;  3WGG A;  4C9Y A;  4PGH A;  4RLQ A;  3CJN A;  4I09 A;  5H2F C;  5HOD A;  1Z7U A;  1N77 A;  2F4M B;  4HLX A;  4HRI A;  2DLL A;  3S1M J;  3KLN A;  4KFC A;  1JGS A;  1KYW A;  2XSD C;  3RYR A;  3A01 B;  4RS8 A;  4XBF A;  2KDZ A;  1KQ8 A;  2HEO A;  2BHY A;  3TW6 A;  3FXK A;  2EJR A;  3BCB A;  3KP2 A;  4XKC A;  5BMZ A;  2MBF A;  1Z3X A;  4XRS A;  3RJP A;  3IH3 A;  2WB1 N;  5E1W A;  4BHP A;  3D1N I;  1IXC A;  4ZTJ A;  1FIA A;  3JRA A;  3WGI A;  2A07 F;  1J0R A;  2V9P A;  3HEF A;  3O8H A;  3CCE I;  1K6O A;  3WTS C;  3R6S A;  3DEW A;  1JE8 A;  1BL0 A;  1R22 A;  3DXJ F;  2DU9 A;  1YJ9 I;  5ICG A;  1D0Y A;  1MND A;  4F52 A;  3KYL A;  2JA2 A;  2M30 A;  3GLX A;  3OWT A;  4HAM A;  3H9Q A;  1T8I A;  3BRO A;  4ZYA A;  3V7R A;  3FM5 A;  3HSF A;  4KJZ A;  1ETV A;  1EH6 A;  3Q0W A;  2Q2E B;  3IV5 A;  2LG4 A;  4B48 A;  1ZR4 A;  2M4G A;  2OAZ A;  4M9X A;  2R7U A;  1T6S A;  5M5W J;  2QQA A;  2Y31 A;  3C7J A;  4DQ2 A;  5CJ9 A;  1P4X A;  3SFI A;  2W84 A;  4XSX F;  1FT9 A;  2L7M P;  2QZ8 A;  3SDB A;  4QPO A;  1B9M A;  2NVQ J;  2TDX A;  2DBB A;  1S72 I;  2XAQ A;  2R7O A;  4U7D A;  3GTJ J;  1PP7 U;  4BQO A;  1QO0 D;  1RPW A;  2OC6 A;  3G1L A;  4I02 A;  2EQR A;  1NHA A;  4AM3 A;  1LFP A;  3HKZ N;  3ZMS A;  2P5V A;  2X6W A;  5E79 C;  4E6K G;  2ZFW A;  2E2H J;  1IO2 A;  4B43 A;  1LDK B;  4ABZ A;  2HI3 A;  4ZYD A;  1LJ9 A;  1R5I D;  3W6V A;  2H94 A;  3DBH B;  1F1Z A;  5IPA A;  1SFE A;  2HQA A;  4LLL A;  3ZMD A;  1O3T A;  2CUZ A;  3O6B B;  3N4M A;  2ZSH B;  2OTL I;  2EK5 A;  1W7P B;  4Z6Y A;  5LGN A;  2RQP A;  3RZO J;  5E8I A;  3ABU A;  1R49 A;  1D0Z A;  1RC9 A;  3EUH A;  4HNT A;  1GVJ A;  1G59 A;  5F0H A;  1OPC A;  4XID A;  1T0F A;  5L3E A;  3K70 D;  5BPI A;  2VKH A;  1WI9 A;  4X0G A;  4XRS G;  1Z77 A;  2M7B A;  2MC3 A;  3C2H A;  1MMD A;  4A69 C;  2ZJP F;  1H9T A;  4B44 A;  1T38 A;  3CCS I;  2J5O A;  4Y3O A;  2IBD A;  2COB A;  2DCE A;  4FE4 A;  3ZMU A;  2D1V A;  2DFI A;  2Q8K A;  1D5V A;  1LUJ B;  1IZ1 A;  3QRF F;  1XSD A;  2ZJ2 A;  2RAE A;  2Z1D A;  1TQP A;  3DFG A;  3OYL A;  4FTH A;  3TO9 A;  3HUG B;  1QHH D;  2LMD A;  4LIT A;  3V8K A;  4I99 C;  2VON A;  3GBG A;  1WI3 A;  3ABT A;  1STZ A;  2ZC2 A;  3BPV A;  2X9D A;  3W6J B;  1TWF J;  3D5L A;  4M3D A;  3CQZ J;  3P7N A;  2FX0 A;  5B1B H;  2FOK A;  1PUF B;  3L2U A;  3JRB A;  3TOB A;  4X6A J;  4J19 A;  3HRT A;  3BR3 A;  3PSI A;  3QU3 A;  4R1H A;  2DT7 B;  1I39 A;  1LE8 B;  1T08 B;  1NTC A;  3QP6 A;  4PFP A;  2VXD A;  4IHY A;  4PJN A;  1JKR C;  3ERE D;  1P7I A;  3QPH A;  1LB2 A;  2DQR A;  3GWZ A;  4HOB A;  4AIH A;  3IC7 A;  2XKP A;  4XLC A;  3DEE A;  5F0F A;  5K5O A;  4MTD A;  1J75 A;  3BG5 A;  4BXX J;  2DT5 A;  3CCU I;  4YEL A;  4XON A;  1TLH B;  2AS5 F;  2ISZ A;  4F55 A;  3A02 A;  2DA4 A;  1UHW A;  1OYY A;  1TTY A;  3Q0U A;  3L2V A;  3WOD F;  4ZDP A;  1B1B A;  1USS A;  3HL2 A;  3F8C A;  4A3D J;  3BR5 A;  1ULY A;  2Z2S B;  1MMA A;  2WY7 Q;  3HTU A;  2RDP A;  1QZY A;  1UCR A;  1W7P D;  1YS7 A;  4CZC A;  1R4M B;  2EA2 A;  4GYI A;  3DLL F;  4A5N A;  2DDB A;  4G94 A;  1DPR A;  1XX5 A;  2NS7 A;  3S14 J;  2KRH A;  4KT6 A;  2XGX A;  5DV5 A;  4LG0 B;  2XPU A;  2FBI A;  1HOM A;  2L7F P;  2DMN A;  2IT0 A;  1B72 B;  2PN6 A;  1EV7 A;  2LC2 A;  3OIQ A;  5FFZ A;  1E3O C;  4HZF A;  4FCY A;  5GP9 A;  1U5T B;  2JPB A;  4EEF G;  2ETH A;  2DMP A;  5CVU A;  4D1Q A;  1SAX A;  4DNC A;  2JT1 A;  3REO A;  1K7A A;  4E7L A;  1FMV A;  1HF0 A;  1VQ6 I;  3LQQ A;  3NEU A;  2IXS A;  2A6H F;  4ZZL A;  3BG3 A;  1SEU A;  2TCT A;  4PJM A;  2K3F A;  4PJJ A;  2I8D A;  4A0Y A;  1YIJ I;  1FYM A;  2PX9 A;  3A01 A;  2KIS A;  5A2Q K;  3ZMV A;  5HLH A;  1PUE E;  1D8K A;  3K4K A;  1S8N A;  3J81 K;  2DK8 A;  4HST A;  3FZV A;  4G7Z F;  2CYY A;  2DFE A;  4N9H A;  2COM A;  4EV0 A;  2A6E F;  3I4N J;  2XPW A;  3L2R A;  3CC2 I;  1LDD A;  1GXQ A;  4QWQ A;  3FBN B;  4UXN A;  2KPM A;  2A68 F;  2DA1 A;  1IRX A;  2DYS H;  3B6A A;  2IGN A;  2VJ5 A;  1WH7 A;  3HC7 A;  3CO6 C;  2A6T A;  2XAF A;  1VQO I;  1ZRE A;  1ETX A;  2HKX A;  2JRT A;  3BZK A;  3TO6 A;  2ZXH A;  2CRG A;  4ENM A;  1WGX A;  1QGP A;  4YFK F;  3OL3 A;  5LHG A;  2PMZ N;  4HX8 A;  1YOV B;  1G6N A;  1R4N B;  1TWC J;  2VBY A;  3K69 A;  1EH7 A;  1RES A;  3J7Z I;  1NH3 A;  3LFK A;  4A2U A;  2BY2 A;  3AG3 H;  4KT5 C;  1YI2 I;  1VQ4 I;  1TNS A;  3ZQ7 A;  3K4C A;  2AXL A;  1B6A A;  4DZP A;  3NWS A;  2L3D A;  2RN7 A;  5DYM A;  1QHG A;  3WHB A;  1CGP A;  2XAU A;  2FMY A;  1JKO C;  1JGG A;  1HKS A;  2GA2 A;  2P8T A;  2BEO A;  1JT6 A;  1BN5 A;  3KP4 A;  2E7X A;  3OS0 A;  3SZT A;  2E1M C;  3VOE A;  1W4M A;  4CCN A;  2XUB A;  3HRM A;  2K4B A;  3J80 K;  2HGC A;  2GXG A;  4NUB A;  3CJR B;  3RCO A;  4CYD A;  1R5H A;  4RA2 A;  2M2E A;  3OYF A;  2HOA A;  1ZG5 A;  4Y15 A;  1R00 A;  2HU9 A;  2EIL H;  1JJ6 C;  2D1H A;  3W2W A;  4EM2 A;  5EZG A;  2K4J A;  3FM3 A;  2LYC A;  1ZAR A;  1XSX A;  4F7Z A;  2STW A;  2BZT A;  2Y0M A;  3I64 A;  1XD7 A;  4MEX F;  1W5S A;  1XMX A;  1YG2 A;  5E8G A;  1SFO J;  1TQI A;  1O3Q A;  3PJR A;  1ZLK A;  5CVR A;  1CF7 A;  4HYE A;  3HRU A;  4JQF A;  3I71 A;  2K86 A;  1VQ9 I;  4G6Q A;  4G8X A;  2TRT A;  4J01 A;  2HYJ A;  3BZC A;  5L3B A;  3ML6 A;  1PYV A;  1GVD A;  1KQ0 A;  1QPM A;  1Y8R B;  1T95 A;  4F91 B;  1XC5 A;  3E6M A;  4GO1 A;  3OSG A;  3DBL B;  3HUG A;  2Z5U A;  3B6C A;  1V5G A;  1TW2 A;  4IEJ A;  3L00 A;  4XRM A;  1KU2 A;  5GAH J;  2R7W A;  1YIO A;  1KA8 A;  2M0C A;  4HPQ A;  3PNT A;  3CCJ I;  4CO8 A;  4JYK A;  2KIF A;  2XF6 A;  4A3K J;  2JUG A;  3GME A;  1ZHF A;  4ESF A;  3W3C A;  4I2O A;  3RDI A;  1JKP C;  3AG4 H;  1OMI A;  2A69 F;  4U7B A;  1SC7 A;  3E3V A;  3QYB A;  3KZZ A;  4L9N A;  4EGZ A;  1X58 A;  4G7H F;  3G2B A;  3VEP A;  2W7N A;  1ZGW A;  3HOX J;  4LOC A;  3S17 J;  1RKW A;  1IG7 A;  3KZY A;  2DN0 A;  2HVR A;  3H92 A;  2K5C A;  3VOD A;  3A2K A;  2PBI A;  1ZRC A;  3AL0 C;  3PO2 J;  3JW4 A;  1BI3 A;  1I27 A;  3TL4 X;  4CCL A;  3ELK A;  1YW7 A;  2KZV A;  1J5Y A;  1V4R A;  2CV1 A;  5CKT A;  2D45 A;  4OIP F;  5C4X J;  1HQC A;  4EGY A;  5AON A;  3PSF A;  3RKW A;  5HS8 A;  3M07 A;  1ZN2 A;  1W1W E;  4HNU A;  2Y75 A;  3FXU A;  3ZQI A;  4OOI A;  5J47 A;  1TBX A;  5HLG A;  3DF8 A;  4U87 A;  1U8B A;  1MDM B;  1FTZ A;  4KYW A;  2XB0 X;  3J80 Z;  4IOA F;  1M1E B;  2LKS A;  2XGD A;  5B66 C;  2KDO A;  1MBH A;  1TC3 C;  2DMT A;  2MLK A;  3CJT B;  5DS9 A;  4XL9 A;  1Z05 A;  4UUS B;  4A3M J;  4ZYE A;  4BGD A;  2E2J J;  1LFB A;  2D5V A;  2E1N A;  2V1X A;  3ASO H;  5J6X A;  3ZQC A;  2HR3 A;  3LAJ A;  3QPL A;  3ZQQ A;  4I0A A;  2VT2 A;  1D1A A;  1F5T A;  5GPC A;  1B72 A;  2V1U A;  2X0L A;  3PQK A;  4BY7 J;  5M3M J;  1K4S A;  3MQ0 A;  2H1L A;  5GAG J;  1TWA J;  3HOW J;  3D5R C;  3FIS A;  3LSG A;  4M72 A;  2JMW A;  5D4R A;  2R7Z J;  3T8R A;  2ECB A;  1BC8 C;  1XGO A;  1MMN A;  2W57 A;  2EIK H;  3G1M A;  3I53 A;  1YW9 A;  1ON1 A;  2X1D A;  1YIT I;  4L9V A;  4YIR X;  4XLF A;  5E1X A;  5DEQ A;  1D3Y A;  4HSR A;  5IYB J;  3TBI A;  2AO9 A;  2W48 A;  2B7E A;  4QPQ A;  2QYO A;  5C44 J;  2EZI A;  3H1C A;  4JX6 A;  3GF2 A;  3RQI A;  2ELJ A;  1ZGA A;  2H6B A;  1I6H J;  3K10 A;  2CQK A;  1MKM A;  3TQN A;  2FEZ A;  1O4X A;  3WTZ A;  4KN7 X;  5LHH A;  4PJL A;  2L7K A;  5EGO A;  2EH3 A;  3ROU A;  1SFK A;  1T98 A;  2DOD A;  4F92 B;  2P6S A;  2P81 A;  2Y0S N;  2DOF A;  2D2W A;  2H09 A;  3EET A;  1YTY A;  5E3M A;  3LFU A;  3ZN0 A;  3K9T A;  4RGX A;  2CV0 A;  3JAM K;  6PAX A;  2YUS A;  1DGR M;  1REP C;  1KU3 A;  4S04 A;  3KCC A;  2K9L A;  2CFX A;  2E71 A;  4FX0 A;  2M3A A;  2PG4 A;  1VQN I;  1MBF A;  2LRE A;  2V6C A;  4YRV A;  3F9K A;  4DZJ A;  2BOL A;  2ZNY A;  3GCM A;  3KFW X;  3FXM A;  4M6Y A;  3FMQ A;  2IJL A;  2MW8 A;  4RAF A;  2Y0S A;  1WVR A;  5DCF A;  1TL8 A;  2FUG 2;  1I3Q J;  4XOT A;  4KMU X;  1Z67 A;  2CUF A;  1U6G A;  2CQ7 A;  2ZO4 A;  4IVN A;  2RKH A;  3DPU A;  2DMU A;  4G6D A;  1BI0 A;  3CCM I;  1J9I A;  3SHF A;  1E2X A;  4BUP A;  3DV8 A;  2E2I J;  3ZN1 A;  2R5Z A;  1XB4 A;  1H0M A;  2R7Q A;  3GFL A;  2FRH A;  3R60 A;  3VPR A;  1AU7 A;  4C2U A;  3QPT A;  5FLM J;  3HXL A;  3HGG A;  2DA7 A;  1JT0 A;  5M5X J;  5DUK A;  4Q4Z F;  2LK2 A;  1HW1 A;  3PNV A;  4HX4 A;  5HDK A;  5HLI A;  2N8G A;  3BTI A;  4MHG A;  3COA C;  2G9W A;  2JA5 J;  1Q1H A;  1VQ8 I;  2EIN H;  3TGN A;  3RPU D;  5IY5 H;  2DOE A;  2XF7 A;  2OD5 A;  3OIP A;  3QU6 A;  5IOZ A;  2CQN A;  2JZY A;  3CDH A;  2R7D A;  4UY8 I;  1R6R A;  2WAD A;  3BY6 A;  2JJ7 A;  2DA3 A;  3RYP A;  3ZQF A;  3CDI A;  2EA4 A;  4FET A;  1VQM I;  2V1N A;  3CDL A;  3E5Q A;  3S3O A;  4QLC U;  1UFM A;  3OSF A;  1AOY A;  1OCR H;  2VKD A;  3X2Q H;  3OOP A;  5FRN A;  1BA5 A;  2Q0O A;  2HDW A;  3CMY A;  2Z33 A;  3CMM A;  5FJ8 J;  2BW3 A;  4BQN A;  2HZD A;  1IXR C;  3R0J A;  5L3F A;  1WPK A;  4EJO A;  2LSO A;  2GA1 A;  3CUQ A;  3OL4 A;  1ERD A;  3DPT A;  1FOK A;  3BC8 A;  2ZME A;  1IDZ A;  2RNG A;  1A04 A;  3S8P A;  4L5J A;  3J7A O;  1UHM A;  1WJC A;  3L1P A;  3A0H C;  3M8J A;  4I6Z A;  3JAM Z;  5HS9 A;  2HVS A;  1ODD A;  4B09 A;  5E3O A;  1GT0 C;  2NNN A;  5E18 F;  1FOW A;  2G7U A;  2CMP A;  3PUB A;  4PUS A;  1K78 B;  2F5D A;  3TDZ C;  4K2E A;  2CW8 A;  5L3C A;  2NVX J;  1J09 A;  2L9N A;  2YPR A;  4HV6 A;  1J7K A;  3U1D A;  3I56 I;  4A93 J;  3FDY A;  1B9N A;  5CQE A;  4R79 A;  2E1O A;  4UB8 C;  3OMY A;  2L7Z A;  4M71 A;  2ZXJ A;  4XN0 A;  1MDM A;  4IHS A;  4KNY A;  1KU9 A;  1VI0 A;  4LMY A;  1O57 A;  4E7I A;  3PO3 J;  1XG1 A;  2DYR H;  4RGU A;  5LRR A;  3S32 A;  3G6E I;  2HDD A;  3FK7 A;  2M9H A;  1IV8 A;  3CLO A;  4M73 A;  4UUS A;  3OS1 A;  2R5Y A;  1DP7 P;  1FTT A;  1WJ5 A;  2DDA A;  2WAF A;  3S16 J;  3F72 A;  4CSW A;  2ZSI B;  4D5F A;  1FBS A;  4M3E A;  1BI2 A;  3BZ6 A;  2ID6 A;  2MFZ A;  1DQU A;  1HST A;  1MH4 A;  2A61 A;  2PFB A;  2X51 A;  4P1W A;  4ZH4 F;  4O6J A;  3WG9 A;  1I5Z A;  1Z0X A;  3SEZ A;  3OYD A;  3MCZ A;  2AQE A;  4IRI A;  1SD5 A;  3HOT A;  1MMG A;  4XQF A;  3KIO A;  5FKK A;  3BTJ A;  2EV0 A;  4LK0 F;  1B8I B;  2F4O B;  1YRN B;  4MFD A;  5EEA A;  2P4W A;  5IT3 A;  5HDG A;  3HOY J;  3HDD A;  3Q3S A;  4NC6 A;  2XRO A;  3CO7 C;  3L2Q A;  2GOM A;  2HXO A;  3EYI A;  3DTE A;  3HSR A;  2XV4 S;  2HKO A;  3ZPL A;  3ZGK A;  4GXO A;  3CCY A;  3CCV I;  5J4V A;  3GW2 A;  4BHC A;  1QU3 A;  4PSX A;  1SFU A;  1RI7 A;  2L02 A;  2QBY B;  2ME6 A;  1D1B A;  2HQN A;  2CGP A;  5CVJ A;  5FD5 A;  1JXS A;  2CW0 F;  3E97 A;  3PL8 A;  4KN4 X;  1RNL A;  4AVZ A;  2ZFU A;  3GVA A;  3LQR A;  2EFN A;  1H89 C;  5H20 A;  3CCR I;  1FYL A;  3JTH A;  1Z1D A;  4BDY A;  2WBM A;  4PFO A;  4RB1 A;  2VAS A;  2PJR B;  2E34 A;  2W00 A;  4UB6 C;  2HYG D;  2KRF A;  5DD8 A;  1AKH A;  1VQL I;  3E6C C;  4HLY A;  1U78 A;  2CV2 A;  4WXC A;  3I3L A;  5E1Z B;  2O9L A;  2UWM A;  3S3N A;  1K61 A;  2VE8 A;  3OR2 C;  3WGH A;  3AFH A;  2WAQ N;  3H0G J;  4DYC A;  1BBY A;  2A3S A;  4RM2 A;  2PEX A;  3MKY B;  3W2V A;  3BR2 A;  4NDL A;  3QOE A;  1QQI A;  5D5V B;  5K1Y A;  5FLV A;  1R36 A;  4DYQ A;  3V7C A;  3VYU B;  2VB6 A;  5IP7 J;  1Z7L A;  1HLV A;  2X4H A;  3AG1 H;  2GZW A;  3ZR8 X;  4YFN F;  4HF0 A;  5DM6 F;  1G8X A;  3BJ6 A;  2IGK A;  2GAU A;  3OYN A;  2W1O A;  3BTC A;  4Q48 A;  3GZ6 A;  3EYY A;  2WAQ A;  2DOA A;  3G4S I;  3I59 B;  3CP8 A;  5FLX K;  3HSE A;  2HFH A;  3CUO A;  1R71 A;  5BOX A;  3O8G A;  4PJ0 C;  1HC8 A;  2VBZ A;  2V4J C;  1RR8 C;  5FO5 A;  2O6G E;  1IN7 A;  3IWZ A;  1ETQ A;  2E5Z A;  3KZI C;  1MH3 A;  2W82 A;  4JX5 A;  3V8L A;  4ZDO A;  2CJJ A;  2UUZ A;  3BG6 A;  2ELK A;  2HZT A;  1MW7 A;  4L5E A;  1JI8 A;  2XHK A;  1OR7 A;  2L4A A;  2LLK A;  4KA4 A;  2VI6 A;  5F1J A;  1I50 J;  1YJN I;  5DM7 F;  2R4G A;  2NOJ B;  1HBX G;  1P7J A;  4A0Z A;  1R5G A;  3A03 A;  3HOS A;  2GBY A;  1DGW Y;  4MO7 A;  1T2K A;  3M1C A;  4P55 A;  1O7L A;  3WTU C;  3CC4 I;  1BIB A;  4QTR A;  3S1Q J;  3DQV C;  4CDG A;  4LB6 B;  3TP0 A;  2F2E A;  4M6V A;  2IA0 A;  4CXF A;  2E19 A;  2DA6 A;  4BQA A;  3V8J A;  1WHU A;  3DBR B;  4R8H A;  2BE5 F;  2WA0 A;  3AG2 H;  4NBQ A;  4Z2Y A;  4U0Y A;  1HDD C;  5JLW A;  2W24 A;  2H1K A;  2QA4 I;  5D4S A;  3EUA A;  3F0C A;  3H9J A;  3D5S C;  2VN2 A;  1YO5 C;  2HVQ A;  2VT3 A;  1IUY A;  4D7N A;  3C3W A;  4KIF A;  3HPG A;  3BDD A;  5KAI C;  1K6Y A;  4BEH B;  2KJB A;  3FXL A;  2QQB A;  2ESH A;  4YFX F;  5F6F A;  4OMY A;  5IP6 A;  2VPL A;  1IRZ A;  3KP3 A;  4ZDL A;  2WTE A;  2QKM B;  2R7F A;  5B3S H;  2K9N A;  2QSH X;  2FJ1 A;  3WU0 A;  3K1P A;  1DP3 A;  4RAY A;  2XB5 A;  1BJA A;  3L9F A;  3WTT C;  2O61 A;  4AWX B;  4BE1 A;  2VL8 A;  1LEB A;  4UUT A;  2ZXI A;  1U8R A;  1F36 A;  2HWV A;  2P7C B;  3GXO A;  1F9N A;  1S7O A;  1R7J A;  2OZ6 A;  1MIJ A;  2KP6 A;  4WK8 F;  1D8J A;  1S6L A;  2E7W A;  1SVO A;  4M3F A;  2EIJ H;  4EM1 A;  1QZE A;  4AIK A;  5FLX Z;  2K9S A;  2GLO A;  1WJA A;  2LY2 A;  2KZG A;  4I98 B;  4E7Z A;  2DW4 A;  3LST A;  4HG2 A;  4LLG F;  4BE0 A;  3BQZ A;  3ECH A;  1SVL A;  2XKO A;  4GRI A;  2BY1 A;  3QPS A;  3PFI A;  5GPA A;  2JRM A;  3IAS 2;  4XNF A;  4IQJ A;  4JOM A;  3KPH A;  3S93 A;  4TV7 A;  3RPQ A;  1B8I A;  1P6R A;  2OBP A;  3F8M A;  4CIC A;  3L2W A;  3K0L A;  2R7V A;  2HOS A;  5IYC J;  3GX4 X;  2PMU A;  1LQ1 A;  1ETK A;  5H6Q A;  4ENJ A;  2NVT J;  5AIP A;  5CLS A;  2OPT A;  2XAJ A;  4OIR F;  4OIQ F;  3IRR A;  1WH5 A;  3PIO F;  4PCQ A;  2K85 A;  4NNJ A;  1NK2 P;  3K2A A;  3SFZ A;  4IHV A;  4A0X A;  4FAS D;  4L18 B;  4AYB A;  4ZYG A;  5JHU A;  1ONV A;  1XCB A;  3GFM A;  3WU1 B;  3U9G A;  3GTG J;  1UHS A;  2BXZ A;  2K9Q A;  2VJI A;  1FBQ A;  2F6C A;  1OKR A;  2X6O A;  3M8E A;  4YII A;  4DBR A;  5GAE J;  1FLI A;  1SFX A;  2ZNZ A;  2P5K A;  2P0W A;  2VLA A;  2QEX I;  1ZG3 A;  2Q2E A;  2IS1 A;  3TED A;  4ZC3 A;  4CHU A;  5B1A H;  3DLA A;  3TKY A;  2OTJ I;  3P9K A;  3V7S A;  1C0W A;  1GHC A;  2DFH A;  2F48 A;  1FOY A;  1F4K A;  2JN6 A;  3TW7 A;  4XLA A;  5EF6 A;  4IX7 A;  4BY1 J;  1VND A;  1Y1V J;  1ZH5 A;  3CMA I;  1H8A C;  3M9A A;  5LGT A;  1YYV A;  1YJW I;  3E6D A;  3ZRG A;  2VQL A;  3RIR A;  1K79 A;  2KMU A;  2MSY A;  2YU3 A;  3PFY A;  2V7F A;  2JSC A;  1ETO A;  3JRI A;  1BR1 A;  3JRG A;  1V3F A;  3C18 A;  5F04 A;  1L0O C;  3WU2 C;  2L9R A;  4NC7 A;  4JK1 X;  3F21 A;  1H9G A;  2ME0 A;  5D6F A;  4IO9 F;  1OFC X;  2GXB A;  3GTL J;  2VBX A;  2KHM A;  1E3P A;  4MTE A;  1X3Z B;  2FQ3 A;  4WX9 A;  1W7P A;  5FKM A;  1WWX A;  3LSI A;  3UNG C;  4PK4 A;  3FXR A;  1LVA A;  4HF1 A;  1FIP A;  1IN5 A;  2VKV A;  2XSJ C;  2MGQ A;  3ONQ A;  2CFO A;  4OMZ A;  4C3I J;  4XKB A;  2BV6 A;  5BNG A;  3DKX A;  1IJW C;  1QA6 A;  1WZ2 A;  2EFQ A;  2VIX A;  1RET A;  1UG2 A;  3CP2 A;  3CF5 F;  3GZ5 A;  1N25 A;  3C2B A;  1X1C A;  3S15 J;  3HM5 A;  5FKN A;  5DD4 A;  5F27 A;  2MH2 A;  2QVO A;  4XSZ F;  4XK4 A;  3EUH C;  2O8K A;  3GTK J;  3R4K A;  1T0F C;  4PZJ A;  4Q47 A;  5EEG A;  1R1V A;  2Y48 A;  4CYC B;  1Y39 A;  1NK3 P;  1J2X A;  1XS9 A;  1IN6 A;  3T1B A;  5HS7 A;  5TRD A;  3Q9V A;  1HA8 A;  1ETY A;  2BVM A;  1ZK8 A;  3K2Z A;  3V42 A;  5FRM A;  3OV8 A;  2MA3 A;  2XRL A;  1SAN A;  1OCZ H;  3FHZ A;  5L3D A;  4II2 A;  4A3L J;  1PUF A;  1BR4 A;  2KL4 A;  3QP5 A;  5ICF A;  3SZG A;  4MNU A;  5IYD J;  1LE8 A;  1Z3Y A;  4KIB A;  4V2F A;  3JSP A;  1LNW A;  3SZP A;  5K7F A;  4BHB A;  1LDJ A;  5ERI A;  5ILU A;  2NRA C;  4MFE A;  3MMY B;  1LFU P;  2H8R A;  1KU7 A;  2I10 A;  2HQR A;  3NRV A;  2JVG A;  2JPC A;  1FBU A;  3ZMZ A;  1WKM A;  1IC8 A;  4BH9 A;  1FOX A;  3H35 A;  1Y8Q B;  1JTY A;  3HBL A;  2L9S A;  1I6X A;  3Q5F A;  4AID A;  4BE2 A;  2R7T A;  1B59 A;  1FNN A;  3LSJ A;  4A3I J;  3MKW B;  5KK1 A;  2HQ5 A;  3BPX A;  3HYI A;  4I0B A;  4ANJ A;  3HZJ A;  1X1P A;  1G2H A;  1IW7 F;  3F6V A;  5GTH C;  4LLN A;  4DYR A;  3OYC A;  1EA3 A;  3C1D A;  3OYE A;  4C3J J;  3SJM A;  4RM3 A;  2OQR A;  4LG0 A;  4KDP A;  2M4K A;  1X19 A;  5C3E J;  2WWY A;  1UG0 A;  2AXT C;  3GO5 A;  2ZCW A;  1Z21 A;  1HKT A;  3A1Y A;  3S2H J;  1D5Y A;  2CQX A;  1U5T A;  2L2O A;  2G7H A;  3T0Y A;  3HOZ J;  2UV1 A;  3KLO A;  2UZK A;  2P5L C;  2NXN B;  2QM3 A;  2ADU A;  4ASN A;  2K9M A;  1VQP I;  2BGC A;  2GOX B;  2LDU A;  3OYB A;  1YFH A;  2OV7 A;  1PDN C;  3MN2 A;  3VDX A;  1JKQ C;  2QKL B;  1OJL A;  2DXI A;  4CA0 A;  5GAD J;  4A6D A;  2XGC A;  4CCJ A;  3CLQ A;  1X2N A;  1IN4 A;  3HJE A;  1FP1 D;  4RGR A;  1I3A A;  5H6R A;  4B3A A;  3GFJ A;  2OCC H;  1MSE C;  4U0W A;  4DJA A;  1RIO H;  3T8T A;  5LD2 C;  1ZLJ A;  1N78 A;  3ERM A;  1UEL B;  4C2M J;  2CG4 A;  1D1C A;  2JUC A;  5GTI C;  2MG4 A;  2CU7 A;  3P9I A;  3WTW C;  4O3M A;  3OR1 C;  2NNY A;  1U2W A;  2ISY A;  1NG6 A;  3DWL E;  1WJF A;  1ZRF A;  1FX7 A;  4W1U A;  2R7X A;  5C4J J;  1ZG1 A;  4XMY A;  4A3B J;  1MJB A;  4WF2 A;  4BJ6 C;  4KUM A;  3T5X A;  1KQ9 A;  1ORK A;  2LKX A;  1SD6 A;  4HX7 A;  3WE3 A;  3E5U A;  4H0E A;  2XIG A;  3H5N A;  2KKO A;  4G7O F;  5IT9 K;  3ABK H;  1GDT A;  1OYW A;  1SMY F;  5FB2 A;  2K7L A;  3M8F A;  4UV8 A;  1RKT A;  4BS9 A;  2WY8 Q;  3K4L A;  3AAF A;  4Y4R A;  3HHG A;  1S29 A;  4EJU A;  3FMS A;  1RUO A;  2UXX A;  3EUK L;  4XOR A;  4D7M A;  1RRJ A;  2E1M B;  1BC7 C;  2Y69 H;  3IUO A;  4GCV A;  1XGS A;  2IA2 A;  1WJE A;  3I5U A;  4LGW A;  5HLT A;  2MLG A;  2QLZ A;  3L09 A;  4IL6 C;  4I01 A;  5KVR A;  3VYT B;  3VSL A;  2HTJ A;  3VFZ A;  1U3E M;  3BG7 A;  3LA3 A;  3AKZ A;  3K6G A;  4CCO A;  5JI6 A;  2C6Y A;  4IJA A;  1JTX A;  3BJA A;  3NAU A;  2DMQ A;  1BW6 A;  2X6X A;  4RLF A;  5TJJ A;  2CH0 A;  4WWC A;  3SXY A;  3CES A;  2E35 A;  2YSR A;  2H6C A;  3PQJ A;  4GYG A;  2DPD A;  3LA2 A;  2JA8 J;  3C2G A;  3S3M A;  1KZH A;  2KT0 A;  3TOA A;  1Y1W J;  1FEX A;  4AC0 A;  2QGU A;  2X6Y A;  1HCR A;  3KX2 A;  1X1A A;  1G3T A;  3E6B A;  3OS2 A;  1U0J A;  3BP8 A;  2ZJR F;  2DT6 A;  1QVU A;  2ZKZ A;  4XN3 A;  4BXU A;  3BWG A;  4BAY A;  2L01 A;  3LWF A;  4F93 B;  3S2D J;  4B1R A;  2XAG A;  1J59 A;  1YQA A;  3H9G A;  4QIW N;  2GIZ A;  1WRJ A;  1IV6 A;  2X1C A;  4MLO A;  1AHD P;  1W36 C;  4IF4 A;  2EV5 A;  5FKL A;  4IOC F;  1GXP A;  1R58 A;  3KP6 A;  2YX7 A;  2EZL A;  5M3F J;  3GTQ J;  3JR9 A;  1BOA A;  3N05 A;  4M9S A;  2L5Q A;  4EAT A;  4MEY F;  4CCK A;  3OYM A;  1APL C;  3FIW A;  3RSN A;  1N75 A;  3LA7 A;  2M34 A;  2FD5 A;  2NAZ A;  4FHT A;  4A3J J;  2B9S A;  3AL0 B;  3GTM J;  4BJT A;  1Q1V A;  3IL2 A;  3LOC A;  4JBA A;  5IT9 Z;  1R1U A;  2VC1 A;  5CQG A;  3EPZ A;  5IP9 J;  1HXD A;  4E7H A;  2X48 A;  1MBE A;  3F6O A;  1FMW A;  4IXA A;  2R3S A;  2WV1 A;  4O5V A;  2L0K A;  2XDV A;  4AIJ A;  1MBK A;  2Y9Y A;  2ZXW H;  1D0X A;  4OU0 A;  4AD9 A;  4DOZ A;  3U2R A;  4IHW A;  2HYF A;  4ON0 A;  4EJT A;  5FKO A;  1RZ4 A;  4OAZ A;  2X85 A;  4UNO A;  2F4I A;  3J7Y J;  3PNY A;  2Z9O A;  2L4M A;  3I9V 2;  1MD0 A;  1R9T J;  2E36 A;  4LIV A;  2QUF A;  2UXN A;  3WTY C;  5ICE A;  2IPQ X;  3IHU A;  4HDU A;  3IRQ A;  2V79 A;  4FQG A;  2RC4 A;  3DU6 A;  3K1N A;  1AWC A;  3KE2 A;  4RAG A;  4ESB A;  1JHF A;  5LBQ A;  1IN8 A;  3FX3 A;  2M5W A;  3QAH A;  3ASN H;  1FJL A;  4V19 K;  2VJJ A;  4HF2 A;  3K1M A;  2PI0 A;  2OA4 A;  5EZH A;  4ZJZ A;  1MJ9 A;  2STT A;  2CQQ A;  4HNV A;  2FNP A;  3K4J A;  2O3F A;  2IEK A;  3IWF A;  3RKX A;  2JK3 A;  1K83 J;  2KIM A;  2X1E A;  1TT5 B;  4P96 A;  1O7F A;  2NOG A;  2JVH A;  3RQ4 A;  3RPU A;  5TGT A;  1XPX A;  2VE9 A;  3Q9S A;  4HQM A;  4EJW A;  3H5R A;  1LVK A;  2XRN A;  3QWL A;  1V5E A;  1EKE A;  4Y7N J;  2DO7 A;  1FP2 A;  4DGW B;  2IVM A;  3BT9 A;  4BBR J;  3ZP5 A;  2RV8 A;  3DU5 A;  1UST A;  5J1R A;  2O5R A;  4NQW B;  3MWM A;  5DDG A;  4Y17 A;  5DCM B;  4EMS A;  4MGR A;  3QOP A;  1ZYR F;  3GLL A;  1IXS B;  2LF8 A;  1V5F A;  3FWE A;  4BQQ A;  4E7S A;  1XCV A;  2V9V A;  1E17 A;  4LFU A;  5D6E A;  3PIP F;  2IAI A;  1G4D A;  3MVP A;  2HTS A;  3IKV A;  2BXY A;  2FF4 A;  1TNT A;  3KEY A;  1WQ2 A;  2W4S A;  3KP7 A;  3CF2 A;  3OYK A;  1G3Y A;  1YHQ I;  2Z99 A;  4YEJ A;  4A3E J;  9ANT A;  2J5P A;  3MFK A;  1MSF C;  4ENN A;  2DK5 A;  1Z6R A;  2HPI A;  2WB1 A;  4LIU A;  1IGN A;  1BM9 A;  3B02 A;  3MZH A;  5EG0 B;  1IF1 A;  5LGU A;  1IAW A;  3H3U A;  4W97 A;  3VSK A;  2R7S A;  1WJB A;  2PMH A;  4NC8 A;  1YLF A;  2R0Q C;  3HG9 A;  3F8F A;  2EPF A;  2QCO A;  3L2C A;  1JJ8 C;  2HPM A;  3JTG A;  4IPA A;  1A5J A;  5BS6 A;  3HIF A;  3H0D A;  1BIA A;  3E5X A;  2Y9Z A;  3PM1 A;  4XKV A;  1AA7 A;  4RAZ A;  3NWT A;  1R1T A;  1XTA A;  2VBW A;  3GYH X;  3KP5 A;  1UMQ A;  3DKY A;  4I76 A;  2OF7 A;  3E7L A;  4LD5 A;  1YE9 A;  2VPR A;  3LSR A;  4A3C J;  4OIO F;  2IGM A;  3D0S A;  2OJE D;  1FSE A;  1U9O A;  1XDS A;  3M3Y J;  1XSV A;  5HDN A;  2DA5 A;  4N4O B;  5KAF C;  3HKZ A;  2I5U A;  2M7A A;  4V2G A;  1OCO H;  2K3P A;  5FRO A;  3ABM H;  5E3L A;  4CZZ A;  5DUI A;  1QVT A;  2O8X A;  3LAP A;  1CF7 B;  3CC7 I;  1MZB A;  5K7H A;  2BY3 A;  2VQG A;  3BQY A;  2F5V A;  3OIO A;  4ESJ A;  1FZP B;  2M8G X;  1P9Q C;  2NS0 A;  1A36 A;  4LK1 F;  4BAC A;  4RB0 A;  1TQM A;  2IA1 A;  1ITY A;  2H8W A;  2JTV A;  5JR3 A;  3BR1 A;  1Z91 A;  1FY7 A;  2K40 A;  1Y0U A;  3E0J B;  4UV9 A;  5EEH A;  3JRF A;  1MMS A;  3F3X A;  2B0L A;  5LHI A;  1XMK A;  2EZK A;  4DIQ A;  4FX4 A;  1KYZ A;  3SDG A;  3I4P A;  3G71 I;  1XDU A;  2ELH A;  1KON A;  5M5Y J;  4C30 A;  4IHX A;  1Y56 A;  1K4T A;  1LKX A;  3NQO A;  4RB3 C;  3HOV J;  1IRF A;  1YW8 A;  3BLY A;  4NHJ A;  3R0A A;  1KGS A;  3CD6 I;  4IZZ A;  2VUM J;  3PUF A;  1K78 A;  2QQ9 A;  2VOO A;  3ULQ B;  1P4A A;  3CUQ C;  1W0T A;  1HDP A;  4MQ9 F;  3WTX C;  4BBS J;  2ZME C;  5JFR A;  2EV6 A;  4MIM A;  2WC2 A;  5FD6 A;  1GUU A;  2V6E A;  2Z16 A;  2M8E A;  2ACJ A;  3FXJ A;  5LLQ A;  3KYC B;  2V9K A;  5J1Y A;  4KIG A;  1VTN C;  3JRC A;  1UJ8 A;  1TZL A;  3MZ8 A;  2VKE A;  4KIC A;  2DFF A;  5J8F A;  2FU4 A;  2LR8 A;  4M3B A;  1UZC A;  1BI1 A;  3GFI A;  1TT0 A;  3K4B A;  4EQQ A;  2BVL A;  2FA5 A;  4CGZ A;  3BOQ A;  1PJR A;  4FE7 A;  3RKQ A;  1A6I A;  5K5Q A;  2EWN A;  3CZ6 A;  2JQ7 A;  3HGY A;  2KJC A;  2R92 J;  3I55 I;  4M74 A;  3LMM A;  1W36 D;  1BW5 A;  3O2P E;  1X4P A;  1ZTR A;  3F8B A;  5ICC A;  2ID3 A;  4AYB N;  1SMT A;  3GTO J;  3ZCO A;  3QYF A;  1YRN A;  5KCM A;  2DI3 A;  2L54 A;  2GXA A;  4KIS A;  4OAY A;  1TP4 A;  2FQ4 A;  4RGS A;  2HNH A;  2FOW A;  2V1D A;  1ZEL A;  2DTZ A;  2GQQ A;  2M1B A;  4IRH A;  5D8L B;  3IAM 2;  3LSP A;  4AVP A;  5J3L A;  1VQK I;  1IUF A;  2KRC A;  4GGG A;  3BTL A;  3HOU J;  4NQW A;  3U21 A;  2MD0 A;  3H3Z A;  3HRS A;  2Q1Z B;  2HOE A;  3QOD A;  4HA8 A;  4XM3 A;  4Y33 A;  2QBY A;  2LY1 A;  5DCM A;  2VOP A;  2KLO A;  2BBY A;  5D5W B;  2NVU B;  1XGM A;  4HV5 A;  4LJZ F;  3ZQH A;  4G9Y A;  1DPU A;  1B4A A;  2A5W A;  4N0B A;  4IHT A;  3FKJ A;  1ZGJ A;  2E60 A;  3EQL F;  3BCA A;  4EJV A;  4ZYH A;  5EGO B;  3UR3 C;  2PJR A;  3H5A A;  4WXD A;  2DJI A;  2IRF G;  1JUS A;  2H27 A;  1FWZ A;  1OIS A;  1HSJ A;  2QQ8 A;  2PQ8 A;  5TIS C;  3N97 A;  3UKG A;  2F5E A;  3K4N A;  1ETW A;  4FT8 A;  5D5X B;  1XMA A;  3IH2 A;  5ILS A;  2EFW A;  1I1G A;  1XGN A;  4XKW A;  2DQL A;  3W6K B;  2YU9 J;  3FXQ A;  5D5U B;  5L3G A;  5EG0 A;  5D8K B;  4Q5S F;  4C2T A;  3DKW A;  3SQN A;  1POG A;  3ZQL A;  1FYK A;  2HXI A;  4B47 A;  1FC3 A;  5FGM A;  3ZXS A;  3L7W A;  2LBF B;  2GM4 A;  4BNC A;  2IS6 A;  5E17 F;  2PMZ A;  3OYI A;  3MKL A;  2CSO A;  2XVC A;  4L5I A;  3I59 A;  4B3X A;  2LOO A;  2R5Z B;  4L9T A;  2KQR A;  1X1B A;  1Y0N A;  3FXO A;  1R23 A;  3FBI B;  1QRY A;  3DEU A;  1X3W B;  2M45 A;  3I54 A;  4XOP A;  1DU6 A;  2DA2 A;  2FXA A;  4HW0 A;  1DDN A;  5KHD A;  2M0M A;  4P9U A;  1TWH J;  2ZBK A;  3O3K A;  2GWR A;  4EVI A;  4ENK A;  3G1O A;  5LFA A;  2DAO A;  3OYJ A;  2VJ4 A;  1Z6T A;  5BQT A;  2DPU A;  1IRG A;  4D0P A;  5F1R A;  4IQ4 A;  4U0V A;  3VYS B;  2L9V A;  3LSK A;  1MJA A;  4M3G A;  3OY9 A;  2EB7 A;  1HW5 A;  2YX4 A;  2FE3 A;  4XLH A;  5A2Q Z;  2EZH A;  4CCM A;  2K02 A;  1XN7 A;  3J81 Z;  2LKP A;  1VQ5 I;  2RNJ A;  2XPV A;  3WTV C;  1OR7 C;  2G0E A;  3ZQG A;  2BW3 B;  4BYY A;  4B4C A;  4A12 A;  5CVV A;  5F64 A;  2CUJ A;  3DPL C;  3H36 A;  3TDU C;  1FSH A;  1X4O A;  2GIV A;  1MBJ A;  3FK6 A;  4BJ5 C;  1QNT A;  2LP0 A;  3I58 A;  4UUV A;  3CUQ B;  2VC0 A;  4HQE A;  2ZME B;  1JUM A;  2QSG X;  1MNM C;  5DTD A;  4E7K A;  2CO5 A;  1YS6 A;  3VWB A;  4ZTF A;  2ECC A;  2IGO A;  3TMO A;  4BEH A;  1V55 H;  2EFO A;  2IS2 A;  1E0E A;  1ENH A;  2MD5 A;  2VXZ A;  4A6E A;  3F22 A;  2OQG A;  3GZN B;  4YIF A;  3JRD A;  2KIQ A;  1O3R A;  4G6T B;  4EM0 B;  2QF7 A;  2ZB9 A;  3DP7 A;  3MAJ A;  3S2W A;  1HW2 A;  1TWG J;  4E70 A;  4HBL A;  1FPQ A;  3KYD B;  5CPR B;  3ZMT A;  3FKI J;  2HDC A;  1W0U A;  5JHF A;  2KFD A;  4Y13 A;  4RDU A;  5JVG F;  3KET A;  3W2A A;  1SD4 A;  1WJD A;  4RB2 C;  2RVC A;  3IKT A;  2NYX A;  5ED4 A;  2YR2 A;  2K27 A;  1X3U A;  3LSM A;  3WHC A;  1RR7 A;  5ILV A;  5EYR A;  2XGE A;  3JCU C;  4UHT A;  4BL0 B;  4HEA 2;  5J4Y A;  4H4K C;  1VZ0 A;  1YX3 A;  1OCC H;  2QSF X;  1SVM A;  1T56 A;  1W5C C;  3IH4 A;  3MZY A;  3CME I;  3LL7 A;  2R5Y B;  1I1S A;  1UAA A;  5J1U A;  2OZU A;  2BY0 A;  5AIQ A;  3JRE A;  3JSO A;  2LH9 A;  3F8N A;  3FMR A;  3HB9 A;  4JX4 A;  1PVE A;  3ESW B;  2V26 A;  2WAE A;  4BKX A;  2XAS A;  1QZZ A;  4MQV A;  3ECO A;  2B63 J;  1S7E A;  4RBO A;  4ITV A;  1ZAO A;  3RI4 A;  3E1S A;  4YG2 F;  3A4C A;  4WCG A;  2Y2Z A;  2O0Y A;  5E3N A;  3BR0 A;  4X1E A;  4HDV A;  3QQA A;  2LTP A;  4BXF A;  3B73 A;  1WFX A;  2IP2 A;  3K70 C;  1HKQ A;  4I7H A;  5FFX A;  1Z9C A;  2YS9 A;  1QBJ A;  1GV2 A;  3V4G A;  1BJZ A;  1OCP A;  4ETS A;  3GTP J;  2F5C A;  1EF4 A;  4PSW A;  1VF9 A;  1W5T A;  2LNB A;  2FBK A;  4DBQ A;  3WG7 H;  1WSU A; 
#chains in the Genus database with same CATH homology
 3EDP A;  1JHH A;  2KIU A;  2LF7 A;  4UVC A;  5BPD A;  3G73 A;  4WXH A;  4PDK A;  1P2F A;  3WE2 A;  3P9C A;  1S3J A;  1L3L A;  4LB5 A;  4IRG A;  3CTA A;  5HVQ C;  5LEJ A;  5CYV A;  2EFP A;  2FML A;  5CVI A;  4NB5 A;  1RUN A;  4XLN F;  2W85 A;  1T39 A;  3GUD A;  3KEQ A;  2W25 A;  2A5Y B;  1S7A A;  2ESN A;  2WV0 A;  3KEO A;  4N9I A;  4L0Y B;  1TW3 A;  2QWW A;  4B8X A;  4M6X A;  3M7G A;  1P4W A;  3G3Z A;  1MGT A;  4KMF A;  1EH8 A;  1ON2 A;  2RGV A;  3GEZ A;  2XAH A;  4P5O A;  3TO7 A;  5E20 A;  4U88 A;  4XLP F;  5LRS A;  3F23 A;  2HS5 A;  4XRF A;  5JVT A;  3R61 A;  2O03 A;  1SD7 A;  3VB2 A;  4A5M A;  3HTS B;  2P7V B;  2CWE A;  2M87 A;  1DUX C;  1G3W A;  2F5F A;  2VOD A;  3M1E A;  3I0T A;  2QEN A;  4L9J A;  5LEK A;  2BYV E;  3RKY A;  2FSW A;  4UVB A;  1ZRD A;  3ISP A;  2PLY A;  3MEX A;  4L0Z B;  2P6T A;  2PJP A;  1OYI A;  3FF5 A;  1G3S A;  4ZZD A;  2IW5 A;  4UVA A;  3HHH A;  2Z3Y A;  5J8C A;  1LEA A;  1PP8 F;  3RTR A;  1UB9 A;  4OIN F;  4S05 A;  2MH9 A;  4PGG A;  5HOO A;  3BJO A;  1O3S A;  4P9F A;  2FNA A;  2E1C A;  2OU2 A;  4M9Z A;  1P92 A;  5K5R A;  2DTR A;  2FBH A;  1U5T C;  3WGG A;  4PGH A;  3CJN A;  4I09 A;  1Z7U A;  4HLX A;  2DLL A;  3KLN A;  4KFC A;  1JGS A;  1KYW A;  3RYR A;  4RS8 A;  4XBF A;  1KQ8 A;  2HEO A;  2EJR A;  3KP2 A;  5BMZ A;  2MBF A;  3RJP A;  5E1W A;  4BHP A;  1IXC A;  3WGI A;  2A07 F;  1J0R A;  1K6O A;  3WTS C;  3R6S A;  1JE8 A;  1R22 A;  3DXJ F;  2DU9 A;  5ICG A;  2M30 A;  3GLX A;  4HAM A;  3BRO A;  3V7R A;  3FM5 A;  3HSF A;  1EH6 A;  4M9X A;  2OAZ A;  1T6S A;  2QQA A;  3C7J A;  4DQ2 A;  5CJ9 A;  1P4X A;  2W84 A;  4XSX F;  1FT9 A;  2QZ8 A;  1B9M A;  2TDX A;  2DBB A;  2XAQ A;  4U7D A;  1PP7 U;  1QO0 D;  4I02 A;  1NHA A;  3ZMS A;  2P5V A;  2ZFW A;  1LDK B;  4ZYD A;  1LJ9 A;  2H94 A;  1F1Z A;  1SFE A;  4LLL A;  3ZMD A;  1O3T A;  3O6B B;  3N4M A;  2EK5 A;  1W7P B;  5LGN A;  2RQP A;  5E8I A;  3ABU A;  3EUH A;  1GVJ A;  1OPC A;  1T0F A;  5L3E A;  5BPI A;  1WI9 A;  2MC3 A;  1H9T A;  1T38 A;  2J5O A;  3ZMU A;  2D1V A;  2DFI A;  2Q8K A;  1D5V A;  1IZ1 A;  3QRF F;  1XSD A;  2ZJ2 A;  1TQP A;  3DFG A;  3TO9 A;  3V8K A;  2VON A;  3ABT A;  1STZ A;  3BPV A;  3W6J B;  3D5L A;  3P7N A;  2FOK A;  3TOB A;  3HRT A;  3QU3 A;  4R1H A;  3QP6 A;  3ERE D;  3QPH A;  1LB2 A;  2DQR A;  3GWZ A;  4HOB A;  4AIH A;  3IC7 A;  2XKP A;  5K5O A;  4MTD A;  1J75 A;  2DT5 A;  2AS5 F;  1TLH B;  2ISZ A;  1UHW A;  1OYY A;  1TTY A;  3WOD F;  1B1B A;  1USS A;  3F8C A;  1ULY A;  3HTU A;  2RDP A;  1QZY A;  1UCR A;  1W7P D;  1YS7 A;  2EA2 A;  4GYI A;  4A5N A;  4G94 A;  1DPR A;  2XGX A;  5DV5 A;  4LG0 B;  2FBI A;  2IT0 A;  2PN6 A;  1EV7 A;  5FFZ A;  4HZF A;  1U5T B;  2JPB A;  2ETH A;  5CVU A;  1SAX A;  4DNC A;  2JT1 A;  3REO A;  1K7A A;  3LQQ A;  3NEU A;  2A6H F;  4ZZL A;  4A0Y A;  1FYM A;  5A2Q K;  3ZMV A;  5HLH A;  1PUE E;  1D8K A;  1S8N A;  3J81 K;  2DK8 A;  3FZV A;  4G7Z F;  2CYY A;  4N9H A;  2COM A;  4EV0 A;  2A6E F;  1LDD A;  1GXQ A;  4QWQ A;  4UXN A;  2A68 F;  3CO6 C;  2XAF A;  1ZRE A;  2HKX A;  2JRT A;  3TO6 A;  4ENM A;  1QGP A;  4YFK F;  5LHG A;  4HX8 A;  1G6N A;  2VBY A;  3K69 A;  1EH7 A;  3LFK A;  4A2U A;  4KT5 C;  1TNS A;  3ZQ7 A;  2AXL A;  1B6A A;  2L3D A;  2RN7 A;  5DYM A;  1CGP A;  2FMY A;  1HKS A;  2GA2 A;  2P8T A;  2BEO A;  3KP4 A;  1BN5 A;  2E7X A;  3SZT A;  3VOE A;  1W4M A;  2XUB A;  3HRM A;  3J80 K;  2K4B A;  2HGC A;  2GXG A;  4CYD A;  1R5H A;  1ZG5 A;  4Y15 A;  1R00 A;  2D1H A;  4EM2 A;  2K4J A;  3FM3 A;  1ZAR A;  1XSX A;  4F7Z A;  2STW A;  2Y0M A;  3I64 A;  1XD7 A;  4MEX F;  1W5S A;  1YG2 A;  5E8G A;  1TQI A;  1O3Q A;  1ZLK A;  5CVR A;  1CF7 A;  4HYE A;  3HRU A;  4JQF A;  3I71 A;  2K86 A;  4G6Q A;  4G8X A;  5L3B A;  3ML6 A;  1KQ0 A;  1QPM A;  3E6M A;  4GO1 A;  3HUG A;  2Z5U A;  1TW2 A;  3L00 A;  1KU2 A;  1YIO A;  1KA8 A;  4CO8 A;  2KIF A;  1ZHF A;  4ESF A;  4I2O A;  3RDI A;  1OMI A;  2A69 F;  4U7B A;  3E3V A;  3KZZ A;  4L9N A;  4EGZ A;  4G7H F;  3VEP A;  3KZY A;  3H92 A;  3VOD A;  2PBI A;  1ZRC A;  3JW4 A;  1BI3 A;  1I27 A;  3ELK A;  1YW7 A;  1J5Y A;  1V4R A;  4OIP F;  2D45 A;  1HQC A;  4EGY A;  5AON A;  3RKW A;  5HS8 A;  1ZN2 A;  2Y75 A;  3FXU A;  4OOI A;  1TBX A;  5HLG A;  3DF8 A;  1MDM B;  4KYW A;  3J80 Z;  2MLK A;  1Z05 A;  4ZYE A;  2E1N A;  2V1X A;  5J6X A;  2HR3 A;  3LAJ A;  1F5T A;  4I0A A;  2VT2 A;  2V1U A;  2X0L A;  3PQK A;  3MQ0 A;  4M72 A;  5D4R A;  3T8R A;  1BC8 C;  1XGO A;  2W57 A;  3I53 A;  1YW9 A;  1ON1 A;  4L9V A;  5E1X A;  5DEQ A;  1D3Y A;  2QYO A;  3GF2 A;  1ZGA A;  2H6B A;  2CQK A;  1MKM A;  3TQN A;  2FEZ A;  3WTZ A;  4KN7 X;  5LHH A;  3ROU A;  1T98 A;  2P6S A;  2D2W A;  2H09 A;  3EET A;  1YTY A;  3ZN0 A;  3K9T A;  4RGX A;  3JAM K;  6PAX A;  1REP C;  1KU3 A;  4S04 A;  3KCC A;  2CFX A;  4FX0 A;  2PG4 A;  2V6C A;  2ZNY A;  3KFW X;  4M6Y A;  3FMQ A;  2IJL A;  5DCF A;  4KMU X;  1U6G A;  2ZO4 A;  4IVN A;  2RKH A;  4G6D A;  1BI0 A;  1J9I A;  3SHF A;  1E2X A;  3DV8 A;  3ZN1 A;  1XB4 A;  1H0M A;  3GFL A;  2FRH A;  3R60 A;  3QPT A;  4Q4Z F;  5DUK A;  1HW1 A;  4HX4 A;  5HDK A;  5HLI A;  4MHG A;  3COA C;  2G9W A;  1Q1H A;  3TGN A;  2OD5 A;  3QU6 A;  2JZY A;  3CDH A;  2R7D A;  3BY6 A;  3RYP A;  2EA4 A;  3E5Q A;  4QLC U;  1UFM A;  1AOY A;  3OOP A;  2Q0O A;  2Z33 A;  1IXR C;  3R0J A;  5L3F A;  4EJO A;  2LSO A;  2GA1 A;  3CUQ A;  3DPT A;  1FOK A;  2ZME A;  1A04 A;  3J7A O;  4L5J A;  1UHM A;  3JAM Z;  5HS9 A;  1ODD A;  4B09 A;  2NNN A;  5E18 F;  2G7U A;  1K78 B;  2F5D A;  3TDZ C;  4K2E A;  5L3C A;  2YPR A;  4HV6 A;  1J7K A;  3U1D A;  1B9N A;  4R79 A;  4M71 A;  2ZXJ A;  4KNY A;  1MDM A;  4IHS A;  1KU9 A;  4LMY A;  1O57 A;  4RGU A;  5LRR A;  3CLO A;  4M73 A;  1DP7 P;  3F72 A;  1FBS A;  1BI2 A;  3BZ6 A;  1HST A;  2A61 A;  2PFB A;  4ZH4 F;  4O6J A;  3WG9 A;  1I5Z A;  4IRI A;  3MCZ A;  1SD5 A;  3HOT A;  2EV0 A;  4LK0 F;  2P4W A;  5IT3 A;  5HDG A;  2XRO A;  3CO7 C;  3EYI A;  3HSR A;  2XV4 S;  2HKO A;  3ZPL A;  4GXO A;  3GW2 A;  4BHC A;  1SFU A;  1RI7 A;  2L02 A;  2QBY B;  2HQN A;  2CGP A;  5CVJ A;  5FD5 A;  1JXS A;  2CW0 F;  3E97 A;  4KN4 X;  1RNL A;  3GVA A;  3LQR A;  2EFN A;  5H20 A;  1FYL A;  3JTH A;  1Z1D A;  4RB1 A;  2HYG D;  2KRF A;  5DD8 A;  3E6C C;  4HLY A;  1U78 A;  4WXC A;  5E1Z B;  2UWM A;  2VE8 A;  3WGH A;  1BBY A;  2A3S A;  2PEX A;  1QQI A;  5D5V B;  5K1Y A;  1R36 A;  3V7C A;  2X4H A;  2GZW A;  4YFN F;  4HF0 A;  3BJ6 A;  2GAU A;  4Q48 A;  3GZ6 A;  3EYY A;  3I59 B;  5FLX K;  3HSE A;  2HFH A;  3CUO A;  5BOX A;  2VBZ A;  2O6G E;  5FO5 A;  1IN7 A;  3IWZ A;  3V8L A;  2HZT A;  2XHK A;  1OR7 A;  2L4A A;  4KA4 A;  1HBX G;  4A0Z A;  1R5G A;  3HOS A;  1T2K A;  4P55 A;  1O7L A;  3WTU C;  1BIB A;  3DQV C;  4CDG A;  4LB6 B;  2F2E A;  2IA0 A;  4CXF A;  4BQA A;  3V8J A;  4R8H A;  2BE5 F;  4U0Y A;  4Z2Y A;  2W24 A;  5D4S A;  2VN2 A;  1YO5 C;  2VT3 A;  1IUY A;  3C3W A;  4KIF A;  3BDD A;  2KJB A;  4YFX F;  2QQB A;  2ESH A;  5F6F A;  4OMY A;  3KP3 A;  2WTE A;  2R7F A;  3WU0 A;  3K1P A;  4RAY A;  1BJA A;  3L9F A;  3WTT C;  2O61 A;  4AWX B;  1LEB A;  1U8R A;  2HWV A;  2P7C B;  3GXO A;  1F9N A;  1S7O A;  1R7J A;  2OZ6 A;  4WK8 F;  1D8J A;  1S6L A;  2E7W A;  4EM1 A;  4AIK A;  5FLX Z;  4I98 B;  2DW4 A;  3LST A;  4LLG F;  3ECH A;  2XKO A;  3PFI A;  4TV7 A;  3RPQ A;  1P6R A;  2OBP A;  3F8M A;  4CIC A;  3K0L A;  3GX4 X;  2PMU A;  1LQ1 A;  5H6Q A;  4ENJ A;  5AIP A;  5CLS A;  2XAJ A;  4OIR F;  4OIQ F;  3IRR A;  4PCQ A;  3SFZ A;  4A0X A;  4L18 B;  4ZYG A;  5JHU A;  1ONV A;  1XCB A;  3GFM A;  3WU1 B;  3U9G A;  1FBQ A;  3M8E A;  1OKR A;  4YII A;  1FLI A;  1SFX A;  2ZNZ A;  2P5K A;  1ZG3 A;  2Q2E A;  4CHU A;  3TKY A;  3P9K A;  3V7S A;  1C0W A;  1GHC A;  1F4K A;  1ZH5 A;  3M9A A;  5LGT A;  1YYV A;  3E6D A;  3RIR A;  1K79 A;  2YU3 A;  2JSC A;  1V3F A;  3C18 A;  1L0O C;  4JK1 X;  3F21 A;  1H9G A;  5D6F A;  2GXB A;  2VBX A;  4MTE A;  2FQ3 A;  4WX9 A;  1W7P A;  1WWX A;  3FXR A;  1LVA A;  4HF1 A;  1IN5 A;  4OMZ A;  2BV6 A;  2EFQ A;  3GZ5 A;  5DD4 A;  2MH2 A;  2QVO A;  4XSZ F;  3R4K A;  4PZJ A;  4Q47 A;  5EEG A;  1R1V A;  2Y48 A;  1J2X A;  1IN6 A;  3T1B A;  5HS7 A;  5TRD A;  3Q9V A;  3K2Z A;  3OV8 A;  2MA3 A;  3FHZ A;  5L3D A;  3QP5 A;  5ICF A;  4MNU A;  4KIB A;  3JSP A;  1LNW A;  3SZP A;  4BHB A;  1LDJ A;  5ERI A;  5ILU A;  2NRA C;  1KU7 A;  2HQR A;  3NRV A;  3ZMZ A;  2JPC A;  1FBU A;  1WKM A;  4BH9 A;  1I6X A;  3Q5F A;  1B59 A;  1FNN A;  5KK1 A;  3BPX A;  3HYI A;  4I0B A;  1IW7 F;  3F6V A;  4LLN A;  3C1D A;  2OQR A;  4LG0 A;  4KDP A;  2WWY A;  3GO5 A;  2ZCW A;  1HKT A;  1U5T A;  2G7H A;  3T0Y A;  3KLO A;  2UZK A;  2P5L C;  2QM3 A;  2ADU A;  4ASN A;  2BGC A;  2LDU A;  1YFH A;  1PDN C;  4A6D A;  1IN4 A;  1FP1 D;  4RGR A;  5H6R A;  3GFJ A;  4U0W A;  1RIO H;  3T8T A;  1ZLJ A;  2CG4 A;  3P9I A;  3WTW C;  4O3M A;  2NNY A;  1U2W A;  2ISY A;  1ZRF A;  1FX7 A;  1ZG1 A;  1MJB A;  4WF2 A;  4KUM A;  3T5X A;  1KQ9 A;  1SD6 A;  4HX7 A;  3WE3 A;  3E5U A;  4H0E A;  2XIG A;  2KKO A;  4G7O F;  5IT9 K;  1OYW A;  1SMY F;  5FB2 A;  2K7L A;  3M8F A;  4UV8 A;  3AAF A;  3HHG A;  1S29 A;  4EJU A;  3FMS A;  1RUO A;  2UXX A;  1BC7 C;  4GCV A;  1XGS A;  2IA2 A;  3I5U A;  4LGW A;  2MLG A;  2QLZ A;  3L09 A;  5KVR A;  4I01 A;  2HTJ A;  3VFZ A;  1U3E M;  3LA3 A;  5JI6 A;  2C6Y A;  4IJA A;  3BJA A;  5TJJ A;  4WWC A;  3SXY A;  2YSR A;  2H6C A;  3PQJ A;  4GYG A;  2DPD A;  3LA2 A;  3TOA A;  1G3T A;  3E6B A;  3BP8 A;  2ZKZ A;  4BXU A;  3BWG A;  4BAY A;  2L01 A;  3LWF A;  2XAG A;  1J59 A;  1YQA A;  1WRJ A;  4IF4 A;  2EV5 A;  1GXP A;  1R58 A;  3KP6 A;  2YX7 A;  1BOA A;  4M9S A;  4MEY F;  3LA7 A;  4FHT A;  2NAZ A;  3IL2 A;  4JBA A;  5IT9 Z;  1R1U A;  2VC1 A;  1HXD A;  3F6O A;  4O5V A;  4IXA A;  2R3S A;  4AIJ A;  4OU0 A;  4AD9 A;  3U2R A;  2HYF A;  4ON0 A;  4EJT A;  1RZ4 A;  4UNO A;  2Z9O A;  2L4M A;  1MD0 A;  2QUF A;  2UXN A;  3WTY C;  5ICE A;  2IPQ X;  3IHU A;  4HDU A;  3IRQ A;  2V79 A;  2RC4 A;  3K1N A;  1AWC A;  3KE2 A;  4ESB A;  1JHF A;  5LBQ A;  1IN8 A;  3FX3 A;  2M5W A;  3QAH A;  4HF2 A;  3K1M A;  2PI0 A;  2OA4 A;  1MJ9 A;  2STT A;  2FNP A;  2O3F A;  3IWF A;  3RKX A;  2KIM A;  4P96 A;  1O7F A;  3RPU A;  2VE9 A;  3Q9S A;  4HQM A;  4EJW A;  2XRN A;  2DO7 A;  1FP2 A;  2IVM A;  3ZP5 A;  2RV8 A;  1UST A;  3MWM A;  5DDG A;  4Y17 A;  5DCM B;  4EMS A;  4MGR A;  3QOP A;  1ZYR F;  1IXS B;  2LF8 A;  3FWE A;  1XCV A;  2V9V A;  1E17 A;  4LFU A;  5D6E A;  1G4D A;  2HTS A;  3IKV A;  2FF4 A;  1TNT A;  1WQ2 A;  3KP7 A;  1G3Y A;  2Z99 A;  2J5P A;  3MFK A;  4ENN A;  2DK5 A;  1Z6R A;  1BM9 A;  3B02 A;  3MZH A;  1IF1 A;  5LGU A;  1IAW A;  3H3U A;  2PMH A;  1YLF A;  3F8F A;  3L2C A;  3JTG A;  4IPA A;  5BS6 A;  3HIF A;  1BIA A;  3E5X A;  4RAZ A;  3GYH X;  1R1T A;  2VBW A;  3KP5 A;  4LD5 A;  4OIO F;  3D0S A;  1FSE A;  1XDS A;  1XSV A;  5HDN A;  4CZZ A;  5DUI A;  2O8X A;  3LAP A;  1CF7 B;  1MZB A;  4ESJ A;  1FZP B;  2NS0 A;  4LK1 F;  4RB0 A;  1TQM A;  2IA1 A;  2JTV A;  5JR3 A;  1Z91 A;  1FY7 A;  1Y0U A;  4UV9 A;  5EEH A;  3F3X A;  2B0L A;  5LHI A;  1XMK A;  4FX4 A;  1KYZ A;  3I4P A;  1XDU A;  2ELH A;  3NQO A;  4RB3 C;  1IRF A;  1YW8 A;  4NHJ A;  3R0A A;  1KGS A;  1K78 A;  2QQ9 A;  2VOO A;  3ULQ B;  1P4A A;  3CUQ C;  4MQ9 F;  3WTX C;  5JFR A;  2EV6 A;  2WC2 A;  5FD6 A;  2M8E A;  2ACJ A;  5LLQ A;  4KIG A;  1VTN C;  4KIC A;  5J8F A;  2FU4 A;  1BI1 A;  3GFI A;  4EQQ A;  2FA5 A;  4CGZ A;  3BOQ A;  5K5Q A;  2EWN A;  2KJC A;  4M74 A;  3O2P E;  3F8B A;  5ICC A;  1SMT A;  2DI3 A;  2L54 A;  4RGS A;  2V1D A;  2GQQ A;  2M1B A;  4IRH A;  5D8L B;  4AVP A;  4GGG A;  4NQW A;  3H3Z A;  3HRS A;  2HOE A;  4HA8 A;  2QBY A;  5DCM A;  2VOP A;  2BBY A;  5D5W B;  1XGM A;  4HV5 A;  4LJZ F;  4G9Y A;  1DPU A;  1B4A A;  4N0B A;  4IHT A;  1ZGJ A;  3EQL F;  4EJV A;  4ZYH A;  4WXD A;  2IRF G;  2H27 A;  1FWZ A;  1HSJ A;  2PQ8 A;  3N97 A;  2F5E A;  4FT8 A;  5D5X B;  1XMA A;  5ILS A;  2EFW A;  1I1G A;  1XGN A;  2DQL A;  3W6K B;  3FXQ A;  5D5U B;  5L3G A;  5D8K B;  4Q5S F;  3DKW A;  3SQN A;  1FYK A;  1FC3 A;  5FGM A;  3L7W A;  4BNC A;  5E17 F;  2CSO A;  2XVC A;  4L5I A;  3I59 A;  4L9T A;  1R23 A;  3DEU A;  2M45 A;  3I54 A;  2FXA A;  4HW0 A;  1DDN A;  4P9U A;  2ZBK A;  3O3K A;  2GWR A;  4EVI A;  4ENK A;  2DAO A;  1Z6T A;  5BQT A;  2DPU A;  1IRG A;  4D0P A;  5F1R A;  4U0V A;  1MJA A;  5A2Q Z;  2EB7 A;  1HW5 A;  2YX4 A;  2FE3 A;  2K02 A;  1XN7 A;  3J81 Z;  2LKP A;  2RNJ A;  3WTV C;  4BYY A;  4A12 A;  5CVV A;  5F64 A;  3DPL C;  3TDU C;  1FSH A;  2GIV A;  1QNT A;  3I58 A;  4UUV A;  3CUQ B;  2VC0 A;  4HQE A;  2ZME B;  2CO5 A;  1YS6 A;  2EFO A;  2MD5 A;  2VXZ A;  4A6E A;  3F22 A;  2OQG A;  4YIF A;  1O3R A;  4EM0 B;  3DP7 A;  3MAJ A;  3S2W A;  1HW2 A;  4E70 A;  4HBL A;  1FPQ A;  3ZMT A;  2HDC A;  4Y13 A;  3KET A;  1SD4 A;  4RB2 C;  2RVC A;  3IKT A;  2NYX A;  5ED4 A;  2YR2 A;  2K27 A;  1X3U A;  5ILV A;  4UHT A;  3MZY A;  1I1S A;  2OZU A;  5AIQ A;  3JSO A;  3F8N A;  3FMR A;  2XAS A;  1QZZ A;  4MQV A;  3ECO A;  1ZAO A;  3RI4 A;  4YG2 F;  4WCG A;  2O0Y A;  4HDV A;  3B73 A;  2IP2 A;  1Z9C A;  1HKQ A;  4I7H A;  5FFX A;  1QBJ A;  3V4G A;  4ETS A;  2F5C A;  2FBK A;  1W5T A;  2LNB A;  1WSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...