4ESBA

Crystal structure of padr-like transcriptional regulator (bc4206) from bacillus cereus strain atcc 14579
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
SQMLKGVLEGCILYIISQEEVYGYELSTKLNKHGFTFVSEGSIYPLLLRMQKEKLIEGTLKASSLGPKRKYYHITDKGLEQLEEFKQSWGMVSTTVNNLLQGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Two Transcriptional Regulators from Bacillus cereus Define the Conserved Structural Features of a PadR Subfamily.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transcription
molecule keywords Transcriptional regulator, PadR family
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esbA00
4EJTA 3BDDA 4G7OF 5JFRA 5LHGA 4KMUX 1FY7A 4IHTA 1ZG1A 2M5WA 3FMSA 2BE5F 1TBXA 3KEQA 3TDUC 1OPCA 4G9YA 3MQ0A 1BI2A 1XGNA 3EDPA 3E5QA 2HZTA 5LGTA 4L0ZB 2FSWA 1G6NA 4OIPF 4KICA 4M74A 3O3KA 3RIRA 3E97A 3EYYA 3KZYA 5KVRA 3TQNA 2K4BA 2R3SA 1F4KA 2K86A 2PEXA 1O3RA 4U88A 1IRFA 4GYGA 4HV6A 2HQRA 5D8KB 4UUVA 4OOIA 1S29A 1FLIA 2ZKZA 5E1XA 1PP8F 4GXOA 3F6OA 1DPRA 2D2WA 3CTAA 2FNPA 1JHHA 1S7OA 3WTVC 3CUQC 1ZLJA 2HDCA 2FMLA 4G7HF 3GX4X 3WU1B 1LB2A 3ZN1A 3V7CA 2GAUA 3E5UA 3CO6C 1E17A 3I0TA 2IA0A 3LQQA 4Y17A 1HBXG 3FXUA 3MFKA 2LSOA 2EFPA 4L5JA 2CG4A 3RPQA 4NB5A 3VOEA 4XLNF 1ZREA 3U1DA 3WGGA 2BEOA 5J8CA 2H6BA 3E6DA 2ZJ2A 2XUBA 1SMTA 5DD4A 2NNYA 5D5WB 2OU2A 3IRQA 2HTJA 4I01A 1HQCA 2IRFG 1JGSA 2L3DA 1YYVA 4QWQA 1FP1D 2HOEA 3OV8A 5CVJA 1BM9A 4EMSA 4WXCA 1SD4A 1ZLKA 1F5TA 2MBFA 5HVQC 1C0WA 1HW5A 4LG0B 2ISYA 2STWA 4QLCU 4HF1A 1J0RA 4EM0B 4LMYA 2X0LA 2XHKA 2RDPA 3HSEA 1MJBA 4KT5C 4MQVA 3P9CA 4KA4A 2YX4A 5AONA 4LD5A 3GLXA 1Z7UA 3K0LA 1TW3A 1FSEA 4OINF 3HTUA 1Z91A 4BAYA 3JAMZ 2JPCA 2PQ8A 5AIQA 3RI4A 4N0BA 1SFUA 5LLQA 4LB5A 3M9AA 3DF8A 2XV4S 3FMRA 2EV5A 2KIFA 3E5XA 1L0OC 4UV9A 1Z9CA 4OU0A 2DI3A 2Z5UA 2XRNA 1Z1DA 3U9GA 1XSVA 1BI1A 1R5GA 5LEKA 3BJ6A 2RV8A 2CWEA 4ESBA 3TO7A 4ZYDA 1KU9A 2PN6A 2VOPA 1SD5A 3HRMA 3GZ6A 1U5TC 2EFWA 1IN7A 3I59B 5ED4A 4PCQA 1KQ8A 2XAFA 1WWXA 3RYPA 2QVOA 4KN7X 2P7CB 1BOAA 1U6GA 1MD0A 1D8KA 4Q4ZF 3U2RA 3GFJA 3DEUA 3IC7A 4RAZA 2VODA 3QU3A 3CDHA 4ESJA 2E1CA 1FYKA 5JI6A 2E7XA 4LLLA 1R1VA 3N4MA 2UZKA 5E1WA 3O2PE 2ETHA 5EEHA 3I54A 3HRTA 3ZMVA 5E20A 3R0JA 2WC2A 2NAZA 2V1DA 4YG2F 2XROA 3EYIA 3NQOA 2RNJA 4A6DA 4HZFA 3LA3A 1P6RA 1KQ9A 5BMZA 2XASA 4BQAA 3KLNA 2K02A 2LF8A 3L2CA 1BC7C 3I59A 4LK1F 2DLLA 3L00A 1I1SA 1QNTA 3ZP5A 4EGZA 1T0FA 1SFEA 5DCMA 3R6SA 2H09A 3RJPA 4XRFA 2EFNA 5DV5A 4YIFA 3V8KA 1R22A 1NHAA 3DQVC 2XAHA 2QBYB 4I0BA 1YIOA 3VB2A 2P8TA 4JQFA 2W24A 4IVNA 3KP3A 2W85A 2L4AA 2A61A 4TV7A 2GWRA 3ROUA 4ZYGA 1U3EM 4UVBA 3S2WA 3KP2A 1R1UA 4ON0A 5L3EA 1J9IA 4G94A 5ICEA 4HLXA 2FE3A 2PMUA 2JZYA 4A0ZA 3T8TA 5FFXA 4DNCA 2FA5A 3RYRA 4AIKA 4PDKA 4HQMA 2V1XA 1U5TA 1YS6A 4R8HA 2EWNA 4M72A 1KQ0A 1YS7A 3LFKA 3IKVA 2X4HA 4M9ZA 5DEQA 2K27A 3O6BB 3PQKA 1RNLA 3T0YA 1FYMA 5HLGA 1IN8A 2DAOA 4RB1A 3K1NA 3QU6A 1Z6RA 2PG4A 1O3QA 5A2QK 2QBYA 1H0MA 3NEUA 3BWGA 4ESFA 1U2WA 1HXDA 2FQ3A 1LDKB 1R7JA 1G3SA 3PQJA 3RTRA 1HW2A 1J5YA 2R7FA 1USSA 4KIGA 2NS0A 2EFQA 2ZFWA 1BJAA 4RGSA 1PDNC 3E6CC 5LRRA 5F64A 3SZTA 4I98B 2W57A 3R61A 2DQRA 4FX0A 1ZG5A 3R0AA 1UCRA 1G3WA 5CVRA 3F21A 5ILVA 4RAYA 4M6YA 2XKOA 4EJVA 2K7LA 2ESHA 2QQ9A 1SAXA 1EV7A 3TGNA 1FC3A 2VE9A 5ILUA 2V9VA 2RC4A 1JE8A 3MZYA 2CGPA 3FXRA 3I4PA 1XDSA 1P4WA 3MCZA 3KFWX 4I09A 3I71A 3V4GA 4EVIA 4EM1A 2QENA 1A04A 3GEZA 2KRFA 5TJJA 1PP7U 4WK8F 3TOBA 1O7FA 1XDUA 4M71A 3ZQ7A 2OD5A 3MEXA 3WGIA 1FPQA 2O03A 1T2KA 5CJ9A 4ENKA 3DV8A 4YFNF 3FMQA 1RUNA 2EA4A 1KGSA 1F1ZA 4IXAA 3V8JA 4HYEA 3FX3A 4BHBA 3LAJA 3FWEA 3WTTC 3F8BA 2YX7A 2ELHA 1WKMA 2P6SA 1OR7A 2OZUA 3F8NA 1AOYA 1MJ9A 5JVTA 4AIJA 4M73A 4EJOA 1MDMA 3AAFA 1GVJA 2L02A 1JHFA 2DU9A 3ELKA 3K2ZA 3H3UA 3BY6A 1B9MA 1ONVA 2FBHA 3FHZA 4WXDA 1ZARA 2GXGA 5FFZA 5HDGA 4R1HA 5DUIA 2O61A 4BHCA 1IXRC 1QZYA 1Z05A 4RGUA 2UXNA 3C1DA 1MZBA 1TNSA 1F9NA 2VE8A 4A12A 2WV0A 4GO1A 2VONA 1YW8A 2AS5F 3GFIA 4U7DA 2R7DA 2A07F 4I7HA 3CUQA 3DP7A 4S04A 2XAQA 5HOOA 4OIRF 1P4AA 5F6FA 2NRAC 1HKSA 4HDVA 5LBQA 2DTRA 1H9GA 5H6QA 5DD8A 4L9VA 2P6TA 2PMHA 2PI0A 2O0YA 3KP4A 3HRSA 1EH6A 1LDJA 5TRDA 3GFMA 1W7PB 3HOTA 4UHTA 1T6SA 2L01A 3R60A 1STZA 1IXSB 1BIBA 2MH9A 1LNWA 1LDDA 2F5FA 3W6JB 2GQQA 4IHSA 2QQAA 2DO7A 3G73A 3KLOA 3V7SA 3KP5A 4HW0A 4XSXF 4BYYA 3LAPA 3F72A 5CVUA 2PFBA 1YO5C 5BOXA 5BPIA 1YFHA 1I27A 3BZ6A 2CFXA 3TO6A 3DKWA 1J59A 3WGHA 4RGXA 4R79A 5FD6A 5KK1A 3Q5FA 3IHUA 4RS8A 5CVVA 2BGCA 3DPTA 4GGGA 1Y0UA 1I5ZA 1B1BA 1B4AA 3T8RA 3ULQB 2VXZA 1ZH5A 2ZCWA 4CXFA 2Y0MA 4BH9A 2JT1A 3V8LA 1OMIA 1QGPA 5FD5A 2P5LC 1FNNA 3ML6A 5E1ZB 3J80K 1TQMA 3WTZA 1ZYRF 4G6QA 3P7NA 2KJBA 1O57A 1BC8C 2HTSA 3JTGA 2OQRA 2ZBKA 1Z6TA 3SXYA 2A6EF 2J5PA 2M87A 1ULYA 4JK1X 3I53A 2P5KA 3WG9A 2LDUA 4AWXB 1MGTA 1T98A 2PBIA 1RIOH 3L7WA 2CW0F 1SFXA 2V6CA 3SFZA 4A2UA 2HS5A 1BIAA 1KA8A 1QZZA 3G3ZA 1ZAOA 4LG0A 2EK5A 5DYMA 2YPRA 1DUXC 3FXQA 1XGMA 4LFUA 2FOKA 4OIOF 2BYVE 2J5OA 2A68F 1ODDA 4HX4A 2ZMEB 3ZMUA 2O8XA 4GYIA 1O3TA 4CZZA 4Z2YA 3IRRA 5HLIA 4EJWA 1YTYA 3HSFA 2ESNA 5HS9A 2DK5A 1XMAA 2P4WA 1IW7F 1OYIA 3GWZA 1W5TA 3F8MA 2Y75A 2ZNYA 4BHPA 1D3YA 2FXAA 1FBUA 4LLNA 1ZGJA 3GVAA 4WX9A 3F22A 4AD9A 4U0WA 3HIFA 3R4KA 4WCGA 1G3TA 2VT2A 1IN5A 3RKWA 2VT3A 2HYFA 4B8XA 1KU7A 2HKXA 1HKTA 2EJRA 3KEOA 2MC3A 3WTSC 2D1HA 3ABUA 4I2OA 2QWWA 2K4JA 1FWZA 3C7JA 1XD7A 5FO5A 1QBJA 3MWMA 3SHFA 3GZ5A 4Y13A 3H92A 3ZMTA 2GA2A 3F8CA 2Z99A 3T5XA 2IA1A 2COMA 1W5SA 2IP2A 4MHGA 3TKYA 1T38A 2RN7A 4GCVA 3HHHA 1P2FA 4HDUA 1J7KA 5D5XB 1KU3A 4AIHA 1WQ2A 1BN5A 2B0LA 5D6EA 3GXOA 4OMYA 3CO7C 2D45A 2OA4A 1FBQA 3COAC 4B09A 1RZ4A 2XIGA 2QM3A 2GA1A 4XLPF 1K6OA 1CF7B 1YLFA 2VC0A 4KYWA 2W25A 1ZRDA 2YR2A 4N9HA 4OIQF 4A5MA 2JSCA 3BROA 1LEBA 1R23A 4HAMA 4WWCA 4ENNA 1BBYA 5F1RA 3RDIA 2ISZA 2VBXA 4ZH4F 1R00A 2EB7A 2HFHA 3HRUA 2XKPA 1XN7A 2QUFA 3JTHA 4HX7A 1GHCA 4RB0A 5K5OA 3BJAA 2IJLA 2DPUA 1TQIA 1YG2A 4M6XA 3WTWC 2OBPA 3IL2A 4K2EA 1HSJA 2WTEA 3VODA 5HDKA 3HSRA 2AXLA 5K1YA 3IKTA 1HW1A 2G7UA 4PZJA 2YU3A 4YFKF 2VOOA 2IW5A 3LQRA 3E6BA 1S3JA 5D4RA 1B6AA 4L9JA 4O5VA 1TLHB 2V1UA 2E1NA 4YFXF 2HWVA 2MA3A 2UXXA 3ZN0A 4IJAA 4CGZA 3E6MA 2M45A 4L5IA 3J7AO 1CF7A 4FT8A 1YW9A 4ZZLA 3QP6A 4L9TA 6PAXA 4BXUA 1LQ1A 3DPLC 3GF2A 1MJAA 2WWYA 2UWMA 2FBKA 5L3GA 2DPDA 3I58A 4G6DA 1TQPA 1IZ1A 2JTVA 2MLGA 1J75A 2KKOA 2ZO4A 1RUOA 5LEJA 2FEZA 1UHMA 1S7AA 4UVAA 1U78A 4KN4X 2H6CA 3KE2A 4KUMA 5D8LB 1W4MA 5CYVA 4D0PA 4IPAA 1DP7P 2RGVA 5DUKA 2E7WA 1R58A 4H0EA 4HA8A 2RVCA 5J6XA 1ON1A 2G9WA 3C3WA 3B73A 1U5TB 2RQPA 4IRIA 1XSXA 4O3MA 5BQTA 2VBZA 3LA7A 1USTA 5L3DA 3E3VA 1I1GA 4HQEA 2XAGA 3KCCA 2EA2A 3WE2A 5K5RA 3VFZA 1T39A 1YQAA 1FSHA 3KP7A 2D1VA 4AVPA 4HLYA 1VTNC 4Q47A 4U7BA 1U8RA 3T1BA 4HF2A 5ICFA 1UHWA 3V7RA 1R1TA 5CLSA 3ECHA 4WXHA 4EQQA 4P55A 3RKXA 2LNBA 4EM2A 3VEPA 4NQWA 2P7VB 3CUOA 3FM3A 3ZMDA 1XB4A 2Q2EA 4LJZF 2DT5A 4PGGA 3K69A 4L18B 2A5YB 3IWZA 3P9IA 4MTEA 4UVCA 4P9UA 5D5UB 3J80Z 4RGRA 1B9NA 1CGPA 3DFGA 5HS8A 4N9IA 4CHUA 2RKHA 3OOPA 3SQNA 4UNOA 4CO8A 3M7GA 3F8FA 2CSOA 2QQBA 4BNCA 4ENJA 1O7LA 1D8JA 2CQKA 4U0VA 4XBFA 5HDNA 2ZMEA 3IWFA 2H27A 1IAWA 4M9XA 4I0AA 3H3ZA 2XAJA 1R36A 2PLYA 3K1MA 1IN6A 1XGSA 1V4RA 3RKYA 1G3YA 2OZ6A 3GFLA 2A3SA 3RPUA 3ZPLA 2DQLA 1BI0A 3HTSB 2ZNZA 3K9TA 3TDZC 3F23A 1R5HA 5FB2A 3MAJA 3WODF 5IT3A 3HYIA 4LGWA 1ZRCA 4HX8A 5L3CA 2PJPA 5LGNA 4YIIA 1SMYF 4RB2C 3KP6A 3QOPA 3QRFF 4CDGA 3QAHA 1ZG3A 5FLXK 2EFOA 3B02A 1RI7A 4LLGF 2VN2A 5LHIA 2A6HF 2EV0A 2KIMA 3ABTA 1FT9A 2FRHA 3Q9VA 3K1PA 1IXCA 4A5NA 3C18A 1FYLA 4IRHA 3FF5A 4CICA 1QPMA 4MQ9F 4KIBA 4WF2A 2ZXJA 1KYWA 4P96A 5CVIA 1XGOA 4ZZDA 3CUQB 2LF7A 2IT0A 2EV6A 4LK0F 1S8NA 4EV0A 1LEAA 5HLHA 4P9FA 1X3UA 2FBIA 4ASNA 2YSRA 3I64A 5DCMB 3M8EA 2G7HA 1EH7A 1TNTA 4RB3C 3GYHX 1QQIA 4O6JA 4HBLA 3ERED 1ZRFA 2VBWA 5LGUA 3JSOA 2F5CA 2GZWA 3J81K 2P5VA 1ZGAA 4HF0A 2Z33A 2ACJA 3CJNA 3I5UA 2HEOA 5J8FA 5L3BA 2M8EA 3N97A 1MDMB 4MNUA 3HUGA 2O6GE 3EQLF 3ZMZA 3HHGA 3MZHA 3BPVA 1GXQA 3REOA 4IF4A 4ETSA 2FMYA 5BS6A 4KDPA 1XCBA 1K78B 5ERIA 3SZPA 3LSTA 2LKPA 2MLKA 5ICCA 1FBSA 3WTYC 1FOKA 2QZ8A 4A0XA 1S6LA 2STTA 4KNYA 3BP8A 5K5QA 3TOAA 4DQ2A 1IUYA 5FLXZ 2QLZA 1W7PD 1K7AA 2JPBA 3FZVA 1SD7A 2L54A 1L3LA 4KIFA 4HV5A 3WU0A 1FP2A 1GXPA 2HR3A 2Z9OA 4L9NA 2F2EA 2L4MA 2HKOA 2KIUA 5JR3A 1EH8A 4G8XA 5LRSA 2DBBA 5H20A 2OQGA 2M1BA 3LWFA 1XSDA 2BV6A 1D5VA 5JHUA 2GXBA 1B59A 2DK8A 2VC1A 2Z3YA 1WI9A 3BJOA 3F6VA 1HSTA 5BPDA 5E17F 5HS7A 4A0YA 1XMKA 1AWCA 3ISPA 1IN4A 3JAMK 1K78A 4PGHA 2NNNA 2IA2A 3LA2A 3PFIA 1HKQA 4FX4A 4G7ZF 1J2XA 1I6XA 1BI3A 2H94A 1G4DA 1WRJA 2F5DA 4UV8A 4ENMA 1E2XA 5H6RA 3BPXA 3QP5A 4MEYF 2HYGD 4M9SA 2VBYA 3J81Z 1H9TA 1LVAA 3HOSA 2OAZA 2IVMA 2XVCA 3Q9SA 2C6YA 3D0SA 4E70A 4ZYEA 2MD5A 1YW7A 2M30A 3D5LA 3EUHA 4MEXF 3L09A 2CO5A 4Y15A 4P5OA 1OYWA 1MKMA 1DDNA 5A2QZ 1Q1HA 5FGMA 1DPUA 1SD6A 5DCFA 4Q5SF 3GW2A 1OKRA 4ZYHA 4KFCA 4NHJA 1KU2A 4EGYA 2MH2A 2O3FA 1PUEE 2FF4A 1ON2A 2A69F 4HOBA 4S05A 4UXNA 2DFIA 5E18F 1ZHFA 2W84A 4IRGA 2TDXA 5D4SA 3W6KB 3WTUC 3JW4A 3M1EA 2XGXA 2QYOA 4JBAA 3ZMSA 5DDGA 1LJ9A 5D6FA 1XCVA 5EEGA 1V3FA 2F5EA 4FHTA 3TO9A 5E8IA 1O3SA 4EJUA 2KJCA 1TW2A 3WE3A 5IT9Z 4I02A 4A6EA 3QPTA 1REPC 1P92A 2FU4A 3F3XA 1FX7A 2NYXA 5LHHA 4OMZA 3BOQA 1UFMA 1UB9A 1QO0D 2IPQX 4CYDA 2HQNA 3QPHA 4XSZF 2JRTA 4L0YB 5IT9K 3NRVA 1FZPB 3M8FA 3EETA 5ICGA 2V79A 3ECOA 3JSPA 2DW4A 1IRGA 2CYYA 4Q48A 3P9KA 2BBYA 1KYZA 3GO5A 3KETA 1K79A 3GUDA 5E8GA 1P4XA 4KMFA 4U0YA 3L9FA 5L3FA 4F7ZA 1ZN2A 1TTYA 2ADUA 3FM5A 1JXSA 3DXJF 5AIPA 2Y48A 4MGRA 1IF1A 1W7PA 5D5VB 2Q0OA 3KZZA 2GIVA 4LB6B 5ILSA 3WTXC 3CLOA 1WSUA 2Q8KA 2HGCA 4MTDA 1OYYA 2FNAA
chains in the Genus database with same CATH superfamily
1X1DA 4EJTA 3BDDA 4AYBN 4G7OF 1I50J 5JFRA 4YIRX 5TISC 3AG3H 2HYJA 4NBQA 2EINH 5LHGA 2JJ7A 4KMUX 1FY7A 1D0YA 4IHTA 4GFBA 3GTKJ 1ZG1A 2M5WA 3PO3J 1A6QA 3FMSA 4BE2A 2BE5F 1TBXA 2EPFA 3KEQA 3TDUC 1OPCA 4G9YA 2HDDA 3MQ0A 1BI2A 1XGNA 2AHQA 3EDPA 3E5QA 2NVTJ 2HZTA 2JQ7A 3BG5A 5LGTA 1X4OA 4L0ZB 2FSWA 3BG9A 1G6NA 4F93B 4M3BA 3CMEI 4OIPF 4KICA 4M74A 3O3KA 4NDLA 3RIRA 2Y2ZA 3SDBA 3GCMA 3E97A 2JMWA 3EYYA 3KZYA 1J09A 1QVTA 5KVRA 3TQNA 2X6WA 2VQHA 2NVQJ 3OYJA 3EUAA 3GTMJ 2K4BA 2MW8A 2O9LA 3JRBA 3C2GA 3K70C 2PJRA 2M9HA 2E19A 2R3SA 2CW7A 1MMGA 1F4KA 2K86A 2PEXA 4E6KG 4U88A 1O3RA 1IRFA 1BA5A 3PIPF 4GYGA 1RETA 4HV6A 2HQRA 2RAEA 3A01A 1QZEA 5D8KB 4UUVA 4OOIA 1S29A 3RCOA 1D5YA 1FLIA 1N75A 2OUMA 2ZKZA 2KDZA 5E1XA 1PP8F 4GXOA 3F6OA 5EGOB 1DPRA 2D2WA 3CTAA 1AA7A 2FNPA 1JHHA 1P7IA 1S7OA 3WTVC 3CUQC 3UKGA 1ZLJA 5IOYA 4RDUA 3A4CA 2HDCA 4DOZA 2Y69H 2R7OA 1TWGJ 4IOCF 2FMLA 2AQEA 2K9LA 1A6IA 4G7HF 4CA0A 4E7IA 3GX4X 3BCBA 3CESA 3WU1B 1LB2A 3S3OA 3ZN1A 3V7CA 2GAUA 2AO9A 1P9QC 3E5UA 5FLVA 3CO6C 1E17A 3I0TA 2IA0A 5J4VA 3LQQA 2VPRA 1U9NA 2JUGA 2QCOA 2LREA 4Y17A 3BR6A 1HBXG 3FXUA 3MFKA 4NNJA 2LSOA 2LFBA 2EILH 2EFPA 4BY1J 5FRMA 2X85A 2CG4A 4L5JA 3RPQA 4NB5A 3L2RA 3VOEA 4XLNF 1ZREA 3FIWA 2I5UA 3U1DA 4ZDLA 1MW7A 3ABKH 2VKHA 1VZ0A 3WGGA 3KYLA 2BEOA 3ZR8X 5J8CA 1M1EB 1IV8A 2H6BA 3K4CA 4PJLA 2N8GA 3BR3A 2V26A 3E6DA 2ZJ2A 2XUBA 4XKWA 1SMTA 5DD4A 3HC7A 3OR1C 2L7KA 2NNYA 3A1YA 3HOWJ 4UB6C 1SANA 5D5WB 1V5EA 2OU2A 3IRQA 2HTJA 2VIXA 4L5EA 1X3ZB 4I01A 1ITYA 2BVMA 1HQCA 2IRFG 1JGSA 2L3DA 5FROA 2DOFA 1YYVA 4QWQA 4RA2A 1EF4A 1FP1D 1YIJI 4GRIA 2HOEA 3I56I 3OV8A 5CVJA 4I76A 1BM9A 2E5ZA 3IH3A 3BCAA 3K7AJ 5IPAA 4EMSA 3W2VA 1UAAA 4WXCA 5JLWA 4BQQA 1SD4A 4IO9F 1ZLKA 1F5TA 2MBFA 2WY8Q 1R71A 5HVQC 1DQUA 5J47A 1C0WA 5GTHC 1HW5A 2DA4A 3G71I 4LG0B 2ISYA 1A35A 2R0QC 1R49A 2STWA 2V9PA 1WGXA 4QLCU 4A3KJ 1OCCH 4HF1A 1G59A 1J0RA 4EM0B 1LPQA 3QQAA 2DN0A 1MMNA 4LMYA 1XX5A 2X0LA 2XHKA 2RDPA 1OCZH 3HSEA 1EKEA 4XRSG 1MJBA 4KT5C 3CQZJ 3VSKA 3S3NA 4DZPA 2MFZA 2MG4A 2DYSH 5B1BH 3OIPA 4MQVA 1GVDA 3L1PA 3ZRGA 3P9CA 4KA4A 2YX4A 5AONA 2LK2A 2KZVA 4LD5A 3GLXA 1Z7UA 3A2KA 1WJDA 3ZQLA 3K0LA 1TW3A 1FSEA 4E7LA 2IS2A 4OINF 3HTUA 2QGUA 3S2HJ 1Z91A 3CCLI 2QF7A 4BAYA 3G1LA 3LMMA 4CSWA 5M5YJ 2ZJRF 2HOSA 3JAMZ 2XPWA 1OFCX 4NQWB 2JPCA 4CCJA 2PQ8A 2WAEA 2Y30A 2R5YB 1WH7A 3QOEA 5AIQA 1TL8A 3RI4A 1QA6A 4N0BA 3WHBA 3RPUD 1SFUA 5LLQA 4LB5A 3CJQB 3M9AA 3DF8A 2XV4S 5GTIC 3FMRA 2EV5A 2JA7J 2F4OB 2KIFA 3S32A 4FISA 3E5XA 2RREA 1L0OC 4UV9A 1Z9CA 3JRGA 4RBOA 4CYCB 4OU0A 5K7FA 2DI3A 4DYRA 1S7EA 3K4JA 2Z5UA 3H5NA 2GM4A 4QPQA 2XRNA 4D1QA 3JRDA 4XN0A 4F55A 4QTRA 3PNTA 5F08A 2X6YA 1Z1DA 3U9GA 1XSVA 2KT0A 2XDVA 2L7FP 2BW3B 1BI1A 1R5GA 2LBFB 3ASNH 1S5LC 2W7NA 2JA2A 5LEKA 3M1CA 3A0HC 3BJ6A 3DTKA 5JLXA 3B6AA 2RV8A 2CWEA 4H4KC 4ESBA 3TO7A 4F92B 4IX7A 4ZYDA 2BY3A 1KU9A 1ZK8A 1HDDC 2PN6A 2VI6A 2W00A 1SD5A 3HRMA 2VOPA 1LKXA 3GZ6A 1R4NB 4V2FA 3S15J 5E3MA 1U5TC 2EFWA 1IN7A 3I59B 5ED4A 2JN6A 4PCQA 1KQ8A 2X1EA 1WCMJ 2XSDC 2XAFA 4BE1A 1VQ5I 1WWXA 3RYPA 3D1NI 2QVOA 1QPIA 3H3VK 1HLVA 4KN7X 2P7CB 1BOAA 2CUZA 1U6GA 4E4HA 1MD0A 1D8KA 4XICA 4Q4ZF 1VQPI 3LSHA 3U2RA 3GFJA 3DEUA 3IC7A 4RAZA 4XQFA 2VODA 3CJRB 3QU3A 2HVQA 3CDHA 4Y52J 4ESJA 1UMQA 3RZDJ 4EATA 3CZ6A 2E1CA 5GPCA 1FYKA 5JI6A 2E7XA 4JX4A 3U21A 4A3LJ 2K85A 4LLLA 1R1VA 3G1MA 3CCMI 3ESWB 3SZGA 3FISA 3N4MA 2HXOA 3WG7H 2UZKA 2QSGX 5E1WA 3K6GA 1FOXA 3O8GA 3O2PE 3FHNA 2AQFA 2ETHA 5EEHA 3TL4X 3I54A 3HRTA 4BE0A 3ZMVA 3CDLA 3H9JA 5E20A 3R0JA 4QIWN 1HOMA 2WC2A 2NAZA 2CFOA 2V1DA 4YG2F 3L2VA 2XROA 3EYIA 2M3AA 3NQOA 2MSYA 2RNJA 4A6DA 4B3XA 2CH0A 1NTCA 4HZFA 2QKLB 1P6RA 3LA3A 1KQ9A 1NH3A 5BMZA 2K3PA 1ETOA 2XASA 4HNVA 4BQAA 2RNGA 1JKRC 3KLNA 2K02A 3K2AA 2LF8A 3L2CA 1BC7C 1TWFJ 3I59A 2F48A 4X6AJ 2HOAA 4LK1F 2DLLA 4BJ5C 5F1JA 4A3JJ 5EYRA 3HOVJ 3L00A 2O8KA 1I1SA 2ZXWH 1QNTA 3ZP5A 4EGZA 3HOYJ 1T0FA 4BEHA 1SFEA 2WB1A 1E0EA 4B3AA 5DCMA 4PJMA 2FJ1A 3R6SA 2E35A 2H09A 4A3EJ 3RJPA 1W0UA 1T08B 4XRFA 2EFNA 5DV5A 4YIFA 3V8KA 3H0GJ 1VQ6I 1R22A 3BR0A 2DFEA 4RLQA 1B8IA 1NHAA 4GDFA 2VUMJ 3DQVC 2XAHA 3K4MA 4BBRJ 3JR9A 2QBYB 2LBFA 4I0BA 1P7JA 1YIOA 3VB2A 1ZKGA 2YS9A 4MFDA 3IAM2 2P8TA 4JQFA 3CCRI 3CC2I 2DJNA 2W24A 4YRVA 4IVNA 4ZJZA 2QSFX 3KP3A 2W85A 2L4AA 5CPRB 2R5YA 2A61A 4TV7A 2GWRA 3ROUA 4ZYGA 1OR7C 2DTZA 2R7SA 1Y0NA 3HUGB 1U3EM 4CUGA 4UVBA 4E7SA 1F36A 3S2WA 3D5RC 3KP2A 2JSPA 3KX2A 1R1UA 3OIOA 4ON0A 5L3EA 4X0GA 2B63J 1W0TA 1WI3A 1J9IA 4V19K 4G94A 1PJRA 5ICEA 1AKHA 4HLXA 1ETVA 2FE3A 4XR6A 2DJIA 2PMUA 2JZYA 1WVRA 2WV1A 2KZGA 1W5CC 4A0ZA 4BS9A 2D5VA 3T8TA 3CCJI 2DMUA 4D7NA 5FFXA 4DNCA 2FA5A 3BZKA 3ZQHA 3RYRA 1X1AA 2CW8A 4AIKA 4PDKA 1LE8B 4HQMA 2V1XA 1U5TA 1YS6A 4R8HA 3PSFA 2EWNA 4M72A 4CCKA 1KQ0A 1YS7A 3LFKA 4B48A 3IKVA 5GAHJ 2X4HA 4M9ZA 2OPTA 5DEQA 2K27A 3O6BB 2KRHA 3PQKA 1RNLA 4Y3OA 3H5AA 3T0YA 1FYMA 5HLGA 1TWHJ 3HKZA 1FJLA 2E2HJ 5EEAA 5H2FC 3ZQCA 3FDYA 4XNFA 4C2MJ 1IN8A 1Y8QB 2DAOA 2E1MC 4PK4A 3K1NA 4RB1A 3QU6A 1X3WB 1Z6RA 1A5JA 2PG4A 1O3QA 5A2QK 3BC8A 3FXKA 2QBYA 3E1SA 1YJWI 1H0MA 1YHQI 3AFHA 3NEUA 3BWGA 4ESFA 2BVLA 2H1KA 2JWTA 4C9YA 2BZTA 1U2WA 2I10A 2R4GA 4FE7A 3CDIA 1HXDA 2FQ3A 2BXZA 1LDKB 1R7JA 1G3SA 4NC6A 5M3FJ 3PQJA 2EBIA 2XRLA 3RTRA 1MNEA 1YJNI 2IS4A 5FRNA 1XMXA 1J5YA 1HW2A 4XLAA 2R7FA 4EEFG 2EIMH 5HNHA 1USSA 4KIGA 1UG2A 2NS0A 1YRNA 2ZFWA 2EFQA 1BJAA 2F6CA 3ZQQA 4RGSA 3W2AA 3M8JA 3FK6A 1PDNC 4B43A 5J40A 5LRRA 4FETA 5F64A 3E6CC 1OCPA 2Y0SA 1N77A 2R5ZB 2HU9A 3S8PA 3LOCA 3PFYA 3SZTA 1UELB 4I98B 2W57A 4IHYA 2KP6A 3R61A 2DQRA 4FX0A 1ZG5A 4C2TA 3R0AA 1UCRA 1G3WA 5CVRA 3F21A 1X2MA 5ILVA 2K9SA 3VYUB 2K3FA 2M4GA 2XPVA 3LSKA 4RAYA 4M6YA 1MBHA 2XKOA 4EJVA 2K7LA 3S3MA 1BR4A 1K83J 1N25A 1TT5B 2ESHA 4ANJA 4PJ0C 1X58A 4PUSA 3TP3A 2QQ9A 1SAXA 1YJ9I 2CRGA 3HL2A 1EV7A 1MSFC 3TGNA 4ZTJA 2VXDA 1FC3A 2VE9A 3LL7A 5EF6A 5ILUA 1DU6A 2V9VA 5KAFC 4M3GA 1VQ4I 5LD2C 2RC4A 3LNQA 1E3PA 1JE8A 3PO2J 3QPLA 3MZYA 2CGPA 3FXRA 3I4MJ 3I4PA 1K6YA 1XDSA 1P4WA 5J3LA 4DYCA 1XS9A 2ID6A 3MCZA 3KFWX 4I09A 3I71A 3V4GA 4EVIA 1I39A 4EM1A 2QENA 3OYDA 1A04A 4J01A 3GEZA 2KRFA 3BR2A 5TJJA 3ZQGA 1PP7U 4HPQA 5GADJ 3CC7I 3RKQA 3ZGKA 1TT0A 4WK8F 3TOBA 2H8WA 1AHDP 1O7FA 1XDUA 4M71A 3ZQ7A 1FIPA 2YUSA 2OD5A 3MEXA 3OYBA 4LG3A 3OS0A 3FKJA 1Y1WJ 3WGIA 1IRXA 1FPQA 2O03A 1T2KA 5CJ9A 4AC0A 4ENKA 1OCOH 1X19A 1R5ID 2Q1ZB 3DV8A 1OYYA 4XN3A 2CJJA 2LP0A 4YFNF 3A02A 3FMQA 1RUNA 3LSPA 1ZR4A 2EA4A 2W1OA 2IBDA 3GZNB 5KCMA 1KGSA 1F1ZA 4IXAA 3V8JA 4HYEA 3FX3A 4BHBA 2IS6A 3LAJA 3FWEA 3WTTC 3F8BA 4D7MA 2YX7A 5GPAA 2ELHA 1WKMA 2ZJQF 2P6SA 4A69C 1OR7A 5KHDA 2OZUA 3F8NA 5HNFA 5HODA 2BY0A 2KL4A 1AOYA 1MJ9A 1IGNA 2XF6A 1WJEA 3CCYA 2Z2SB 5JVTA 4AIJA 4B4CA 4M73A 1N78A 4FQGA 4EJOA 1MDMA 4CCMA 3PL8A 2JUCA 3AAFA 1GVJA 2L02A 1XG1A 2DA5A 5TGTA 2DA3A 2JA5J 1JHFA 2DU9A 1VQMI 3ELKA 3K2ZA 3H3UA 3BY6A 1B9MA 1ONVA 2FBHA 2JVGA 2R7RA 3M3YJ 3FBIB 4WXDA 3FHZA 4C2UA 1ZARA 2GXGA 5FFZA 5HDGA 1ZTRA 4X1EA 1Q1VA 2XF5A 3UNGC 3RSNA 4R1HA 3QWLA 2LR8A 5DUIA 2O61A 2M4KA 1F43A 4BHCA 3RZOJ 1BW5A 1IXRC 1QZYA 1WJFA 1Z05A 4RGUA 2UXNA 4UY8I 3J7AY 1HC8A 3C1DA 1MZBA 4HEA2 2GIZA 4XLCA 3O8HA 1TNSA 1F9NA 2CUFA 2VE8A 1ZGWA 2GXAA 4II3A 1D1AA 4A12A 2WV0A 5F0FA 1ZR2A 2KDOA 4GO1A 2VONA 3M4OJ 1YW8A 2AS5F 3GFIA 3IUOA 4BACA 4U7DA 1JUMA 2XF7A 2R7DA 2A07F 3BQZA 4I7HA 3CUQA 3I3LA 3DP7A 3HKZN 4S04A 2XAQA 5HOOA 4OIRF 1P4AA 5F6FA 2NRAC 1HKSA 4HDVA 2ME0A 1AU7A 5LBQA 1JKOC 2R92J 2DTRA 1H9GA 3LSGA 2XB5A 2E2IJ 3FK7A 1VQLI 5H6QA 3OYIA 2V6EA 4XRSA 5DD8A 4L9VA 2P6TA 3LSIA 4M3FA 5GAGJ 2PMHA 2LY2A 4PJNA 2O0YA 3HG9A 3ABLH 2PI0A 1A36A 3KP4A 3TMOA 2LKXA 1FTTA 1YX5A 3HRSA 9ANTA 1EH6A 1LDJA 5TRDA 2VQLA 3LFUA 2MD0A 1ENHA 3GFMA 1W7PB 3W3CA 4BGDA 4BY7J 1SC7A 1NG7A 3HOTA 3H35A 1QVUA 1RESA 2DFHA 2VB6A 4UHTA 1T6SA 1JT6A 2L01A 3MKLA 3ONQA 3R60A 1STZA 1IXSB 5FKOA 1BIBA 2MH9A 1IO2A 5IYDJ 1LNWA 3F0CA 1LDDA 1Z3XA 2F5FA 3W6JB 2GQQA 4IHSA 1IG7A 2I8DA 2VL8A 3GTQJ 2HVSA 2X1DA 3CLQA 2BY1A 2CQQA 2QQAA 2DO7A 4N4OB 5DM6F 3BLYA 3G73A 1K4SA 3KLOA 3V7SA 2R7UA 3KP5A 4HW0A 4XSXF 4BYYA 3LAPA 3F72A 5CVUA 1D1CA 2PFBA 2F4IA 1YO5C 5BOXA 2FOWA 1Y56A 3HEFA 5BPIA 4J00A 1YFHA 1X1PA 3CMAI 1I27A 3BZ6A 2CFXA 3TO6A 5IP7J 3DKWA 5KNLA 1J59A 3WGHA 1ETXA 4RGXA 4R79A 3ZOBA 2BOLA 5FD6A 5KK1A 2HXIA 3Q5FA 3IHUA 4RS8A 5CVVA 2BGCA 3OS1A 4JP0A 4M3EA 3DPTA 4GGGA 3A03A 1Y0UA 5FKKA 2XPUA 2LOOA 4BJTA 1I5ZA 1B1BA 1B4AA 3T8RA 3ULQB 2VXZA 1ZH5A 5EG0A 2ZCWA 4P1WA 4ABZA 2DMQA 4CXFA 1E3OC 2Y0MA 4BH9A 3U1KA 2JT1A 3V8LA 4ZYAA 3BG3A 4PJJA 4LOCA 1FIAA 4DBQA 1V55H 2KFDA 1OMIA 1QGPA 3K4KA 3MVPA 5FD5A 1QRYA 2P5LC 1W36D 1FNNA 3ML6A 3JRHA 5E1ZB 3JRAA 3J80K 2XGEA 1TQMA 3WTZA 1ZYRF 4A93J 4G6QA 5IY5H 2CUEA 3P7NA 2KJBA 3AG1H 4MLOA 3M07A 4BXXJ 4E7ZA 3HJEA 2H8RA 2ZMEC 1O57A 2JVHA 1BC8C 5CQEA 2HTSA 2NS8A 3JTGA 2OQRA 2ZBKA 1Z6TA 3E0JB 3MD2A 3SXYA 2A6EF 2J5PA 2M87A 1ULYA 3S1NJ 4JK1X 2W4SA 3I53A 2E60A 2P5KA 2LDUA 3WG9A 4NUBA 2CU7A 3EUHC 4AWXB 1MGTA 1T98A 2PBIA 2DA2A 1D0ZA 2DODA 1RIOH 3L7WA 5F04A 4BEHB 3X2QH 4FASD 2CW0F 1SFXA 3ZMTA 1V54H 2V6CA 3SFZA 2HPMA 4A2UA 1WJBA 2HS5A 5E79C 2HZDA 5EDNA 1BIAA 1OQYA 1YX3A 3BT9A 4IEJA 1KA8A 1QZZA 2V7FA 3G3ZA 1ERDA 4IKFA 1ETYA 1I3QJ 5EZGA 1ZAOA 3I9V2 4LG0A 1S9HA 4XKCA 4B47A 1FMVA 2EK5A 3Q3SA 5DYMA 2YPRA 3OWTA 3DU5A 1DUXC 2WAQA 1XGMA 3FXQA 5EGOA 1X2NA 4LFUA 5GAEJ 2FOKA 1VF9A 3K4LA 3CCEI 4OIOF 2M7AA 2BYVE 3A0BC 3GTJJ 2J5OA 2A68F 1ODDA 4HX4A 2ZMEB 3ZMUA 4RMNA 1VFCA 2O8XA 4C3JJ 4GYIA 1O3TA 3S1QJ 3H5RA 4CZZA 4Z2YA 3IRRA 1B72A 5HLIA 4EJWA 2LY1A 3HBLA 1YTYA 1RPWA 3GBGA 3HSFA 3VYTB 2ESNA 5HS9A 1QHHD 2DK5A 1XMAA 2JA6J 4Y4RA 2P4WA 4JX6A 1IW7F 1OYIA 3GWZA 4A3IJ 1W5TA 3K4BA 2P0WA 3F8MA 4LIUA 5BNGA 2Y75A 2ZNYA 2COBA 2ZC2A 4BHPA 4IOAF 1D3YA 2FXAA 2BY2A 3W2WA 5M3MJ 3OYEA 4A3CJ 1FBUA 2MGQA 4LLNA 3G2BA 1ZELA 5E3LA 1ZGJA 5FKLA 3GVAA 1K61A 4Y7NJ 1YI2I 4WX9A 1O4XA 3F22A 4YELA 4AD9A 1R9TJ 4U0WA 1H8AC 3BG6A 3HIFA 3R4KA 2FX0A 4WCGA 2ID3A 1CQTA 3GTPJ 1G3TA 2G0EA 2VT2A 5JHFA 2R5ZA 1IN5A 2O5RA 2WAQN 3MKWB 3FXLA 3GTGJ 3FKIJ 3RKWA 2VT3A 2HYFA 4B8XA 3Q0VA 2K9NA 1KU7A 2HKXA 3BR1A 1HKTA 2EJRA 3KEOA 3KPHA 2MC3A 2DYRH 3WTSC 2D1HA 2EZKA 1TP4A 3ABUA 4I2OA 4F91B 2QWWA 2K4JA 3OYCA 1FWZA 3C7JA 4XLEA 1XD7A 1JJ8C 4AM3A 5FO5A 1QBJA 2V4JC 3NARA 3MWMA 3SHFA 2DOEA 2MABA 3GZ5A 4Y13A 3H92A 2CS3A 1X1CA 1SFKA 2GA2A 3F8CA 2K40A 2Z99A 2E36A 4KT6A 4MFEA 3SFIA 2VJ5A 3T5XA 2IA1A 2COMA 1R6RA 4BXFA 1W5SA 5LFAA 2IP2A 4MHGA 3HM5A 1MSEC 3HB9A 1BW6A 2VJ4A 3CJTB 3TKYA 1T38A 2RN7A 5FLXK 4GCVA 3HHHA 2LH9A 3HOXJ 1P2FA 4HDUA 1J7KA 5D5XB 1KU3A 1LUJB 1OJLA 4AIHA 1IRZA 1WQ2A 2DT7B 1MNDA 3ABMH 5FKNA 1BN5A 2B0LA 5D6EA 3GXOA 4OMYA 1FMWA 1UJ8A 3CO7C 2E5NA 2D45A 3HXLA 2K9MA 2OA4A 1FBQA 3HDDA 4PSXA 3COAC 1IDYA 4B09A 4CYCA 1RZ4A 2XIGA 2QM3A 2GA1A 2UUZA 4XLPF 1K6OA 5EG0B 2IS1A 1CF7B 3NWTA 3E7LA 1YLFA 1MBKA 2BHZA 4OWRB 2VC0A 3D5SC 5EZHA 4I99C 4KYWA 2R7ZJ 3SJMA 1WJAA 1NG6A 2W25A 3PNYA 2HQ5A 2L7ZA 1ZRDA 3JREA 3K10A 1Y1VJ 4YEJA 2YR2A 4N9HA 4OIQF 4A5MA 2M0MA 2PJRB 3AKZA 2L9RA 3OYMA 1BL0A 2JSCA 1ETQA 3BROA 5HLTA 1LEBA 1R23A 4HAMA 2DA1A 4WWCA 3VYRB 2NS7A 3OL3A 2ZSHB 2KISA 4ENNA 3OSFA 1JTXA 2WADA 4F3QA 1BBYA 3OYNA 2X1CA 4IZZA 5KAIC 5IP6A 1VQ7I 3BTLA 2DCEA 1GV2A 4BKXA 4CCLA 3RQIA 4IQ4A 2CV1A 1ACIA 1IDZA 1TZLA 2VLAA 5F1RA 2DMNA 2KQRA 2LLKA 3RDIA 4A3FJ 2ISZA 1U8BA 2VBXA 1MBJA 4ZH4F 5F0HA 3L2UA 1R00A 2EB7A 2HFHA 3HRUA 1DGRM 1W36C 2XKPA 1HA8A 1XN7A 2QUFA 3JTHA 4HX7A 1GHCA 4RB0A 4XLFA 2RQQA 2L9VA 3BJAA 4D9JA 2HI3A 5K5OA 4E7JA 2WB1N 2Q2EB 2IJLA 4ZTFA 3G1OA 2DPUA 1TQIA 1WH5A 3OL4A 2UV1A 2TCTA 2LG4A 1YG2A 2OJED 2HPIA 4M6XA 3WTWC 4A3MJ 2OBPA 1QU3A 3IL2A 3QODA 2BHYA 4K2EA 1HSJA 3ZQFA 2WTEA 2ZJPF 3VODA 1OCRH 4FE4A 3DPUA 3TW6A 4DZJA 3DU6A 3DKXA 5HDKA 3L2QA 3HSRA 1GT0C 2AXLA 2ELKA 5K1YA 3IKTA 1HW1A 4IHWA 5M5WJ 2YU9J 1BJZA 2G7UA 1BR1A 2F4MB 4PZJA 1IJWC 2YU3A 4YFKF 2VOOA 4XORA 3CP8A 1Z3YA 2IW5A 3LQRA 3E6BA 3DBLB 1S3JA 1Y8RB 2XSJC 4ZDPA 5D4RA 1B6AA 1T8IA 4M3DA 4L9JA 4O5VA 2GLOA 1TLHB 3G6EI 2V1UA 2NVUB 2E1NA 2PX9A 4JOMA 1IC8A 4YFXF 2HWVA 5EJCA 4XLHA 1MBGA 1MH4A 2MA3A 4XOPA 1MMAA 2IGNA 2UXXA 2F5VA 3ZN0A 5J1UA 4IJAA 4CGZA 2EQRA 4XIDA 3KYDB 3E6MA 1ETWA 5IOZA 2B9SA 1VQ8I 3S1MJ 1V5GA 3PUFA 2M45A 2CV0A 2R93J 4E7KA 1Z7LA 4L5IA 3J7AO 1ZQ3P 2OCEA 4PFPA 1RKWA 2XGCA 1CF7A 1MMDA 4FT8A 1YW9A 2LVSA 4ZZLA 3QP6A 4L9TA 6PAXA 3HOZJ 1B8IB 4BXUA 4CCNA 4DBRA 3CF5F 2VQGA 1LQ1A 3DPLC 3GF2A 1MJAA 2WBMA 2WWYA 2UWMA 2FBKA 5L3GA 2DPDA 3I58A 3DEEA 3N05A 4G6DA 3QYEA 1QHGA 1TQPA 4J19A 4IQJA 1IZ1A 3OOUA 3TBIA 3HGYA 1MIJA 2JTVA 4LIVA 2MLGA 2VASA 1J75A 2KKOA 3BTIA 1PUFB 1VI0A 2ECBA 2ZO4A 1RUOA 2CV2A 1JI8A 1XTAA 3AG4H 5LEJA 2FEZA 1T56A 1UHMA 1APLC 1SVOA 2IGOA 1S7AA 4UVAA 1U78A 4KN4X 2H6CA 5B3SH 2QEXI 4HRIA 3S2DJ 3KE2A 4KUMA 5D8LB 1W4MA 5CYVA 2WY7Q 1IV6A 1I3AA 4D0PA 4IPAA 1DP7P 3MKYB 2RGVA 1OLTA 5DUKA 1KZHA 4AYBA 2E7WA 2LD5A 4CH7A 1KONA 1R58A 3CP2A 4XM3A 4HA8A 4H0EA 2RVCA 5J6XA 4XL9A 3EPZA 1ON1A 1BOBA 1T33A 3NWSA 2LMDA 4RAGA 2X51A 4KJZA 2G9WA 3C3WA 3B73A 1U5TB 4BL0B 3CCQI 2IEKA 2RQPA 3ERMA 3OIQA 4IRIA 1XSXA 2ZXIA 4O3MA 1YRNB 1NK2P 2A6TA 5BQTA 1JUSA 2VBZA 1K4TA 3QYBA 3LA7A 1USTA 1JJ6C 3P5JA 2GBYA 5L3DA 4ZC3A 3E3VA 1I1GA 1WZ2A 4HQEA 2XAGA 3KCCA 3DEWA 2EA2A 3WE2A 3F9KA 5K5RA 3AL0C 1WHUA 4FTHA 2DA7A 1T95A 5K7HA 2EZIA 3VFZA 3FXJA 1T39A 1YQAA 1FSHA 2B7EA 1VQNI 3TEDA 3CD6I 3MZ8A 3KP7A 3SYTA 1YE9A 2D1VA 4AVPA 4HLYA 3PNVA 1EA3A 2M34A 1VTNC 2A05A 4Q47A 4U7BA 1U8RA 1VQKI 3QPSA 3T1BA 1WJCA 3ASOH 3G4SI 4HF2A 5ICFA 1UHWA 3OMYA 4V2GA 3V7RA 4S0HB 1R1TA 1HCRA 5CLSA 1FEXA 3ECHA 5DM7F 4F52A 4WXHA 4EQQA 4P55A 3DTIA 3RKXA 1WFXA 2PMZN 2LNBA 3OR2C 4EM2A 3VEPA 2E34A 4NQWA 2P7VB 3CUOA 3FM3A 2M0CA 2OTLI 3BTJA 1Z77A 3ZMDA 1XB4A 4A3BJ 2L9NA 2Q2EA 3H9GA 4LJZF 1VQ9I 3IAS2 2DT5A 4PGGA 2EZHA 2XC7A 3K69A 4L18B 3VWBA 2A5YB 2P81A 3IWZA 3P9IA 4MTEA 4UVCA 3BZCA 4P9UA 5D5UB 2KMUA 2LTPA 1GDTA 3OY9A 3HGGA 3QYFA 4PFOA 3J80Z 4RGRA 5J1YA 1B9NA 1CGPA 4XOTA 3DFGA 5HS8A 5JVGF 2M2EA 4N9IA 4XK4A 4CHUA 2RKHA 4NC8A 3BG7A 3OOPA 3AG2H 3SQNA 4UNOA 4CO8A 3M7GA 2BW3A 3CMMA 3UR3C 1IUFA 2HQAA 3F8FA 2NVXJ 3MKZA 2LKSA 2CSOA 3C2BA 4HSTA 2QQBA 2LY9A 4BNCA 2FUG2 3CCSI 2FQ4A 3CMYA 1WPKA 4ENJA 1OISA 1O7LA 2NVYJ 3SEQA 2CQKA 1D8JA 5GP9A 3V42A 2ZXHA 4U0VA 1A31A 4XBFA 5HDNA 2ZMEA 3DTEA 3IWFA 2DT6A 2H27A 1IAWA 1HDPA 5E3OA 2NOJB 3DBHB 2OC6A 4D5CA 1I6HJ 4M9XA 4I0AA 3I55I 3H3ZA 2Y9YA 1R36A 2XAJA 2PLYA 3K1MA 5CKTA 1IN6A 4LITA 4BQOA 1XGSA 4U87A 1V4RA 3RKYA 1GLNA 1G3YA 2OZ6A 3GFLA 2A3SA 3S1RJ 3RPUA 4RM2A 2VKVA 1R4MB 3ZPLA 2DQLA 4Z6YA 1SEUA 4A3GJ 1BI0A 2GOMA 3HTSB 1MBFA 4IL6C 4II2A 2ZNZA 1Z21A 4QPOA 3HZJA 1BR2A 1Y39A 2BXYA 3K9TA 1FOYA 3Q0UA 3TDZC 1JKPC 3F23A 1R5HA 5FB2A 4BBSJ 2R7TA 2ZB9A 4A3DJ 2NOGA 3MAJA 4C3HJ 2XAUA 3WODF 4N4NB 2R7VA 5IT3A 3IV5A 3HYIA 4LGWA 3J7ZI 3PIOF 5B66C 2IAIA 1ZRCA 4HX8A 5L3CA 2K9QA 2PJPA 5LGNA 4YIIA 1SMYF 2VKEA 4RB2C 3KP6A 1U9OA 3PM1A 1RC9A 3QOPA 3QRFF 1VNDA 3QAHA 4MO7A 4CDGA 1UHSA 3PUBA 1ZG3A 3LSJA 2QQ8A 4G12A 2EFOA 2W48A 1RI7A 3B02A 4LLGF 2KLOA 2VN2A 2E71A 4AVZA 3OYHA 5LHIA 1H88C 2A6HF 1DGWY 2DOAA 1E3HA 2EV0A 2LRDA 1JT0A 3DLAA 2KIMA 3H1CA 3ABTA 1FT9A 2L5QA 3BR5A 4DGWB 2FRHA 3Q9VA 3K1PA 1IXCA 1PVEA 4A5NA 3C18A 1FYLA 2DMTA 5E3NA 4IRHA 2HOTA 3FF5A 5IYBJ 4CICA 3OS2A 1QPMA 4MQ9F 4KIBA 4WF2A 4E7HA 3OYGA 2JA8J 2ZXJA 1KYWA 4ITVA 4P96A 5CVIA 1XGOA 4ZZDA 4AU7A 2E1MB 1FOWA 3CUQB 2LF7A 1XPXA 2IT0A 2EV6A 4LK0F 1S8NA 4EV0A 1LEAA 5HLHA 2DXIA 4JYKA 3OYFA 3OYLA 4C30A 4P9FA 1X3UA 2FBIA 4ASNA 2YSRA 3I64A 5DCMB 3M8EA 1FTZA 1EH7A 2G7HA 1LVKA 4XKBA 1TNTA 4RM3A 4RB3C 3GYHX 1QQIA 2GOXB 4O6JA 4AUXA 2Z1DA 4HBLA 4RAFA 5FLMJ 3ERED 4W1UA 1LE8A 3NAUA 1ZRFA 4CZCA 4KISA 2VBWA 5LGUA 3JSOA 2DMPA 2F5CA 3JCUC 2GZWA 3DCFA 1S72I 3J81K 4BDYA 2P5VA 1ZGAA 4HF0A 1JKQC 2Z33A 2Y9ZA 3CJNA 3I5UA 4QSHA 2ACJA 3DLLF 2OF7A 5J8FA 2HEOA 3LSMA 3JRIA 2DDAA 3KEYA 5L3BA 3MN2A 2M8EA 1SFOJ 3N97A 1TWAJ 1MDMB 4MNUA 2R7QA 3HUGA 1RKTA 2O6GE 4UB8C 4UUSB 2K5CA 3EQLF 2ME6A 3ZMZA 2EH3A 5K7ZA 3HHGA 3J7YJ 3MZHA 3BPVA 1GXQA 4IHXA 3REOA 1LFPA 5C44J 2R7WA 3HOUJ 4IF4A 4ETSA 2FMYA 5BS6A 4KDPA 1XCBA 1K78B 5ERIA 3SZPA 3OYAA 3LSTA 2LKPA 3ZCOA 2HDWA 3JRCA 2MLKA 5ICCA 1FBSA 1G8XA 3WTYC 5C4JJ 1FOKA 2QZ8A 4A0XA 1S6LA 2STTA 4KNYA 3BP8A 2CQ7A 2VJIA 4OAYA 5K5QA 3TOAA 2Y0SN 2ECCA 4W97A 4DQ2A 2ZFUA 1IUYA 5FLXZ 2QLZA 3VDXA 5C3EJ 1W7PD 1K7AA 2JPBA 3FZVA 2CQNA 1SD7A 2L54A 1L3LA 3I4NJ 4KIFA 1DP3A 4HV5A 3WU0A 1FP2A 1GXPA 2HR3A 3VSLA 2Z9OA 2X6OA 4L9NA 2F2EA 2L4MA 2HKOA 3TP0A 3OYKA 2KIUA 5JR3A 1EH8A 2ELJA 1MMSA 2AXTC 4G8XA 5LRSA 2FD5A 2VQCA 2W82A 2DBBA 5H20A 2OQGA 3LSRA 2M1BA 1AKHB 1LFUP 3LWFA 1XSDA 2BV6A 1D5VA 5JHUA 2GXBA 1UZCA 1B59A 1XC5A 2DK8A 2X9DA 2VC1A 2Z3YA 3TW7A 5M5XJ 5FJ8J 1WI9A 3DKYA 3BJOA 1U0JA 3F6VA 1HSTA 5BPDA 3OSGA 3IP4B 4NC7A 4DIQA 5E17F 5HS7A 4A0YA 1XMKA 2EZLA 3W6VA 1AWCA 3ISPA 3DWLE 4XKVA 3WU2C 2IXSA 2IGMA 1IN4A 3JAMK 3H0DA 4PGHA 2NNNA 5F27A 1K78A 1H89C 2IA2A 3LA2A 1VQOI 3PFIA 1HKQA 4FX4A 4UUTA 1LFBA 4ZDOA 3GMEA 4I6ZA 4G7ZF 1J2XA 1I6XA 3FXOA 4DYQA 1MBEA 1BI3A 2JRMA 2H94A 4BJ6C 1G4DA 1WRJA 2KHMA 1GUUA 2CUJA 2F5DA 4UV8A 4ENMA 1E2XA 3S14J 5H6RA 1X4PA 3BPXA 2Z16A 1SVMA 3QP5A 4MEYF 1EJ9A 2HYGD 4DJAA 2OCCH 4M9SA 1GV5A 2VBYA 3FBNB 2QSHX 5F0CA 2WA0A 1D0XA 1TC3C 3J81Z 1H9TA 2V1NA 1SAUA 1LVAA 2L0KA 1Z0XA 2E1OA 2OAZA 5FKMA 3HOSA 5J4YA 2IVMA 2XVCA 3Q9SA 1RR7A 3HPHA 2R7XA 2HNHA 2C6YA 3D0SA 5C4XJ 4E70A 4HSRA 4ZYEA 2MD5A 4UUSA 3C2HA 1YW7A 2M30A 3IH2A 1V5FA 3D5LA 1W1WE 3EUHA 4MEXF 1PYVA 3L09A 4MIMA 2CO5A 2VKDA 4Y15A 4P5OA 3MMYB 1OYWA 4OAZA 1MKMA 2DDBA 4PSWA 5B5EC 2L7MP 4RLFA 1DDNA 2XGDA 5A2QZ 2CQXA 2NXNB 1Q1HA 5FGMA 1DPUA 2DFFA 1SD6A 3KZIC 2KIQA 5DCFA 1ETKA 2CMPA 4Q5SF 3WHCA 2VJJA 3GW2A 1OKRA 4ZYHA 1NK3P 4KFCA 4NHJA 1KU2A 4EGYA 2IGKA 2MH2A 2O3FA 5B1AH 3SDGA 1PUEE 2FF4A 3CF2A 1IF1A 1ON2A 2A69F 1DU0A 2PMZA 3PSIA 4JX5A 4C3IJ 1PUFA 1HF0A 1YOVB 2JK3A 1B72B 1TWCJ 4HOBA 4S05A 3BTCA 4UXNA 3A01B 2LC2A 1POGA 1MNMC 2DFIA 5E18F 2L2OA 4IHVA 1ZHFA 2W84A 2EIJH 2Y31A 3GLLA 3RQ4A 2KPMA 2TDXA 4IRGA 5D4SA 4BUPA 3ZXSA 3L2WA 3W6KB 3WTUC 2VPLA 2LYCA 3JW4A 3M1EA 2XGXA 1OCTC 2QYOA 2H1LA 4JBAA 1X1BA 1SVLA 3ZMSA 5DDGA 1LJ9A 5D6FA 1XCVA 5EEGA 1V3FA 2F5EA 2EIKH 3H36A 3GTLJ 4FHTA 1JUPA 4BQNA 2HVRA 3TO9A 1JGGA 1ORKA 4CCOA 4HNUA 5E8IA 3AL0B 5J1RA 1O3SA 4EJUA 3S16J 2KJCA 4HG2A 1TW2A 3WE3A 5IT9Z 4M6VA 4XONA 4I02A 3CC4I 1G2HA 4A6EA 3QPTA 1REPC 3KYCB 3B6CA 4B44A 1P92A 2MYSA 2FU4A 2ZSIB 3F3XA 1FX7A 1D1BA 1T0FC 4B1RA 3FXMA 4XRMA 1JTYA 3HPGA 4XMYA 2NYXA 5LHHA 4OMZA 3CCUI 2WAFA 3BOQA 1YITI 1UFMA 2O7OA 1UB9A 1QO0D 3S17J 2IPQX 2XB0X 2X48A 2HQNA 3QPHA 4CYDA 4XSZF 5IYCJ 3PJRA 2JRTA 4L0YB 2L9SA 5IT9K 3DBRB 3CCVI 3ZQIA 2ICWG 3NRVA 1FZPB 3M8FA 3EETA 5ICGA 3Q0WA 2MC4A 3VPRA 2V79A 3ECOA 3JSPA 2DW4A 1Y6IA 1IRGA 2CYYA 5CQGA 4Q48A 2QKMB 5IP9J 3P9KA 2BBYA 1KYZA 1RRJA 3GO5A 3KETA 2E2JJ 1K79A 3GUDA 5E8GA 1P4XA 4KMFA 4U0YA 3L9FA 2DA6A 3VYSB 4D5FA 2OTJI 5L3FA 2X6XA 3SEZA 4HNTA 4F7ZA 4BU2A 3GTOJ 2M8GX 1RR8C 1UG0A 3JRFA 1ZN2A 5DS9A 1TTYA 2ADUA 3BQYA 5DTDA 3FM5A 2QA4I 1JXSA 3DXJF 5AIPA 3S93A 4DW6A 4KITB 2M7BA 2Y48A 2OV7A 4AIDA 1W7PA 1Z67A 2Q0OA 2V9KA 3KZZA 1WJ5A 4MGRA 2GIVA 3K4NA 4Y33A 4LB6B 5D5VB 3IH4A 4BDZA 5ILSA 2TRTA 3WTXC 3CLOA 3EUKL 4G6TB 1WSUA 2Q8KA 2HGCA 3H9QA 2KRCA 4FCYA 4MTDA 1MH3A 3KIOA 2A5WA 3K70D 2FNAA
chains in the Genus database with same CATH topology
4EJTA 3BDDA 4G7OF 5JFRA 5LHGA 4KMUX 1FY7A 4IHTA 1ZG1A 2M5WA 3FMSA 2BE5F 1TBXA 3KEQA 3TDUC 1OPCA 4G9YA 3MQ0A 1BI2A 1XGNA 3EDPA 3E5QA 2HZTA 5LGTA 4L0ZB 2FSWA 1G6NA 4OIPF 4KICA 4M74A 3O3KA 3RIRA 3E97A 3EYYA 3KZYA 5KVRA 3TQNA 2K4BA 2R3SA 1F4KA 2K86A 2PEXA 1O3RA 4U88A 1IRFA 4GYGA 4HV6A 2HQRA 5D8KB 4UUVA 4OOIA 1S29A 1FLIA 2ZKZA 5E1XA 1PP8F 4GXOA 3F6OA 1DPRA 2D2WA 3CTAA 2FNPA 1JHHA 1S7OA 3WTVC 3CUQC 1ZLJA 2HDCA 2FMLA 4G7HF 3GX4X 3WU1B 1LB2A 3ZN1A 3V7CA 2GAUA 3E5UA 3CO6C 1E17A 3I0TA 2IA0A 3LQQA 4Y17A 1HBXG 3FXUA 3MFKA 2LSOA 2EFPA 4L5JA 2CG4A 3RPQA 4NB5A 3VOEA 4XLNF 1ZREA 3U1DA 3WGGA 2BEOA 5J8CA 2H6BA 3E6DA 2ZJ2A 2XUBA 1SMTA 5DD4A 2NNYA 5D5WB 2OU2A 3IRQA 2HTJA 4I01A 1HQCA 2IRFG 1JGSA 2L3DA 1YYVA 4QWQA 1FP1D 2HOEA 3OV8A 5CVJA 1BM9A 4EMSA 4WXCA 1SD4A 1ZLKA 1F5TA 2MBFA 5HVQC 1C0WA 1HW5A 4LG0B 2ISYA 2STWA 4QLCU 4HF1A 1J0RA 4EM0B 4LMYA 2X0LA 2XHKA 2RDPA 3HSEA 1MJBA 4KT5C 4MQVA 3P9CA 4KA4A 2YX4A 5AONA 4LD5A 3GLXA 1Z7UA 3K0LA 1TW3A 1FSEA 4OINF 3HTUA 1Z91A 4BAYA 3JAMZ 2JPCA 2PQ8A 5AIQA 3RI4A 4N0BA 1SFUA 5LLQA 4LB5A 3M9AA 3DF8A 2XV4S 3FMRA 2EV5A 2KIFA 3E5XA 1L0OC 4UV9A 1Z9CA 4OU0A 2DI3A 2Z5UA 2XRNA 1Z1DA 3U9GA 1XSVA 1BI1A 1R5GA 5LEKA 3BJ6A 2RV8A 2CWEA 4ESBA 3TO7A 4ZYDA 1KU9A 2PN6A 2VOPA 1SD5A 3HRMA 3GZ6A 1U5TC 2EFWA 1IN7A 3I59B 5ED4A 4PCQA 1KQ8A 2XAFA 1WWXA 3RYPA 2QVOA 4KN7X 2P7CB 1BOAA 1U6GA 1MD0A 1D8KA 4Q4ZF 3U2RA 3GFJA 3DEUA 3IC7A 4RAZA 2VODA 3QU3A 3CDHA 4ESJA 2E1CA 1FYKA 5JI6A 2E7XA 4LLLA 1R1VA 3N4MA 2UZKA 5E1WA 3O2PE 2ETHA 5EEHA 3I54A 3HRTA 3ZMVA 5E20A 3R0JA 2WC2A 2NAZA 2V1DA 4YG2F 2XROA 3EYIA 3NQOA 2RNJA 4A6DA 4HZFA 3LA3A 1P6RA 1KQ9A 5BMZA 2XASA 4BQAA 3KLNA 2K02A 2LF8A 3L2CA 1BC7C 3I59A 4LK1F 2DLLA 3L00A 1I1SA 1QNTA 3ZP5A 4EGZA 1T0FA 1SFEA 5DCMA 3R6SA 2H09A 3RJPA 4XRFA 2EFNA 5DV5A 4YIFA 3V8KA 1R22A 1NHAA 3DQVC 2XAHA 2QBYB 4I0BA 1YIOA 3VB2A 2P8TA 4JQFA 2W24A 4IVNA 3KP3A 2W85A 2L4AA 2A61A 4TV7A 2GWRA 3ROUA 4ZYGA 1U3EM 4UVBA 3S2WA 3KP2A 1R1UA 4ON0A 5L3EA 1J9IA 4G94A 5ICEA 4HLXA 2FE3A 2PMUA 2JZYA 4A0ZA 3T8TA 5FFXA 4DNCA 2FA5A 3RYRA 4AIKA 4PDKA 4HQMA 2V1XA 1U5TA 1YS6A 4R8HA 2EWNA 4M72A 1KQ0A 1YS7A 3LFKA 3IKVA 2X4HA 4M9ZA 5DEQA 2K27A 3O6BB 3PQKA 1RNLA 3T0YA 1FYMA 5HLGA 1IN8A 2DAOA 4RB1A 3K1NA 3QU6A 1Z6RA 2PG4A 1O3QA 5A2QK 2QBYA 1H0MA 3NEUA 3BWGA 4ESFA 1U2WA 1HXDA 2FQ3A 1LDKB 1R7JA 1G3SA 3PQJA 3RTRA 1HW2A 1J5YA 2R7FA 1USSA 4KIGA 2NS0A 2EFQA 2ZFWA 1BJAA 4RGSA 1PDNC 3E6CC 5LRRA 5F64A 3SZTA 4I98B 2W57A 3R61A 2DQRA 4FX0A 1ZG5A 3R0AA 1UCRA 1G3WA 5CVRA 3F21A 5ILVA 4RAYA 4M6YA 2XKOA 4EJVA 2K7LA 2ESHA 2QQ9A 1SAXA 1EV7A 3TGNA 1FC3A 2VE9A 5ILUA 2V9VA 2RC4A 1JE8A 3MZYA 2CGPA 3FXRA 3I4PA 1XDSA 1P4WA 3MCZA 3KFWX 4I09A 3I71A 3V4GA 4EVIA 4EM1A 2QENA 1A04A 3GEZA 2KRFA 5TJJA 1PP7U 4WK8F 3TOBA 1O7FA 1XDUA 4M71A 3ZQ7A 2OD5A 3MEXA 3WGIA 1FPQA 2O03A 1T2KA 5CJ9A 4ENKA 3DV8A 4YFNF 3FMQA 1RUNA 2EA4A 1KGSA 1F1ZA 4IXAA 3V8JA 4HYEA 3FX3A 4BHBA 3LAJA 3FWEA 3WTTC 3F8BA 2YX7A 2ELHA 1WKMA 2P6SA 1OR7A 2OZUA 3F8NA 1AOYA 1MJ9A 5JVTA 4AIJA 4M73A 4EJOA 1MDMA 3AAFA 1GVJA 2L02A 1JHFA 2DU9A 3ELKA 3K2ZA 3H3UA 3BY6A 1B9MA 1ONVA 2FBHA 3FHZA 4WXDA 1ZARA 2GXGA 5FFZA 5HDGA 4R1HA 5DUIA 2O61A 4BHCA 1IXRC 1QZYA 1Z05A 4RGUA 2UXNA 3C1DA 1MZBA 1TNSA 1F9NA 2VE8A 4A12A 2WV0A 4GO1A 2VONA 1YW8A 2AS5F 3GFIA 4U7DA 2R7DA 2A07F 4I7HA 3CUQA 3DP7A 4S04A 2XAQA 5HOOA 4OIRF 1P4AA 5F6FA 2NRAC 1HKSA 4HDVA 5LBQA 2DTRA 1H9GA 5H6QA 5DD8A 4L9VA 2P6TA 2PMHA 2PI0A 2O0YA 3KP4A 3HRSA 1EH6A 1LDJA 5TRDA 3GFMA 1W7PB 3HOTA 4UHTA 1T6SA 2L01A 3R60A 1STZA 1IXSB 1BIBA 2MH9A 1LNWA 1LDDA 2F5FA 3W6JB 2GQQA 4IHSA 2QQAA 2DO7A 3G73A 3KLOA 3V7SA 3KP5A 4HW0A 4XSXF 4BYYA 3LAPA 3F72A 5CVUA 2PFBA 1YO5C 5BOXA 5BPIA 1YFHA 1I27A 3BZ6A 2CFXA 3TO6A 3DKWA 1J59A 3WGHA 4RGXA 4R79A 5FD6A 5KK1A 3Q5FA 3IHUA 4RS8A 5CVVA 2BGCA 3DPTA 4GGGA 1Y0UA 1I5ZA 1B1BA 1B4AA 3T8RA 3ULQB 2VXZA 1ZH5A 2ZCWA 4CXFA 2Y0MA 4BH9A 2JT1A 3V8LA 1OMIA 1QGPA 5FD5A 2P5LC 1FNNA 3ML6A 5E1ZB 3J80K 1TQMA 3WTZA 1ZYRF 4G6QA 3P7NA 2KJBA 1O57A 1BC8C 2HTSA 3JTGA 2OQRA 2ZBKA 1Z6TA 3SXYA 2A6EF 2J5PA 2M87A 1ULYA 4JK1X 3I53A 2P5KA 3WG9A 2LDUA 4AWXB 1MGTA 1T98A 2PBIA 1RIOH 3L7WA 2CW0F 1SFXA 2V6CA 3SFZA 4A2UA 2HS5A 1BIAA 1KA8A 1QZZA 3G3ZA 1ZAOA 4LG0A 2EK5A 5DYMA 2YPRA 1DUXC 3FXQA 1XGMA 4LFUA 2FOKA 4OIOF 2BYVE 2J5OA 2A68F 1ODDA 4HX4A 2ZMEB 3ZMUA 2O8XA 4GYIA 1O3TA 4CZZA 4Z2YA 3IRRA 5HLIA 4EJWA 1YTYA 3HSFA 2ESNA 5HS9A 2DK5A 1XMAA 2P4WA 1IW7F 1OYIA 3GWZA 1W5TA 3F8MA 2Y75A 2ZNYA 4BHPA 1D3YA 2FXAA 1FBUA 4LLNA 1ZGJA 3GVAA 4WX9A 3F22A 4AD9A 4U0WA 3HIFA 3R4KA 4WCGA 1G3TA 2VT2A 1IN5A 3RKWA 2VT3A 2HYFA 4B8XA 1KU7A 2HKXA 1HKTA 2EJRA 3KEOA 2MC3A 3WTSC 2D1HA 3ABUA 4I2OA 2QWWA 2K4JA 1FWZA 3C7JA 1XD7A 5FO5A 1QBJA 3MWMA 3SHFA 3GZ5A 4Y13A 3H92A 3ZMTA 2GA2A 3F8CA 2Z99A 3T5XA 2IA1A 2COMA 1W5SA 2IP2A 4MHGA 3TKYA 1T38A 2RN7A 4GCVA 3HHHA 1P2FA 4HDUA 1J7KA 5D5XB 1KU3A 4AIHA 1WQ2A 1BN5A 2B0LA 5D6EA 3GXOA 4OMYA 3CO7C 2D45A 2OA4A 1FBQA 3COAC 4B09A 1RZ4A 2XIGA 2QM3A 2GA1A 4XLPF 1K6OA 1CF7B 1YLFA 2VC0A 4KYWA 2W25A 1ZRDA 2YR2A 4N9HA 4OIQF 4A5MA 2JSCA 3BROA 1LEBA 1R23A 4HAMA 4WWCA 4ENNA 1BBYA 5F1RA 3RDIA 2ISZA 2VBXA 4ZH4F 1R00A 2EB7A 2HFHA 3HRUA 2XKPA 1XN7A 2QUFA 3JTHA 4HX7A 1GHCA 4RB0A 5K5OA 3BJAA 2IJLA 2DPUA 1TQIA 1YG2A 4M6XA 3WTWC 2OBPA 3IL2A 4K2EA 1HSJA 2WTEA 3VODA 5HDKA 3HSRA 2AXLA 5K1YA 3IKTA 1HW1A 2G7UA 4PZJA 2YU3A 4YFKF 2VOOA 2IW5A 3LQRA 3E6BA 1S3JA 5D4RA 1B6AA 4L9JA 4O5VA 1TLHB 2V1UA 2E1NA 4YFXF 2HWVA 2MA3A 2UXXA 3ZN0A 4IJAA 4CGZA 3E6MA 2M45A 4L5IA 3J7AO 1CF7A 4FT8A 1YW9A 4ZZLA 3QP6A 4L9TA 6PAXA 4BXUA 1LQ1A 3DPLC 3GF2A 1MJAA 2WWYA 2UWMA 2FBKA 5L3GA 2DPDA 3I58A 4G6DA 1TQPA 1IZ1A 2JTVA 2MLGA 1J75A 2KKOA 2ZO4A 1RUOA 5LEJA 2FEZA 1UHMA 1S7AA 4UVAA 1U78A 4KN4X 2H6CA 3KE2A 4KUMA 5D8LB 1W4MA 5CYVA 4D0PA 4IPAA 1DP7P 2RGVA 5DUKA 2E7WA 1R58A 4H0EA 4HA8A 2RVCA 5J6XA 1ON1A 2G9WA 3C3WA 3B73A 1U5TB 2RQPA 4IRIA 1XSXA 4O3MA 5BQTA 2VBZA 3LA7A 1USTA 5L3DA 3E3VA 1I1GA 4HQEA 2XAGA 3KCCA 2EA2A 3WE2A 5K5RA 3VFZA 1T39A 1YQAA 1FSHA 3KP7A 2D1VA 4AVPA 4HLYA 1VTNC 4Q47A 4U7BA 1U8RA 3T1BA 4HF2A 5ICFA 1UHWA 3V7RA 1R1TA 5CLSA 3ECHA 4WXHA 4EQQA 4P55A 3RKXA 2LNBA 4EM2A 3VEPA 4NQWA 2P7VB 3CUOA 3FM3A 3ZMDA 1XB4A 2Q2EA 4LJZF 2DT5A 4PGGA 3K69A 4L18B 2A5YB 3IWZA 3P9IA 4MTEA 4UVCA 4P9UA 5D5UB 3J80Z 4RGRA 1B9NA 1CGPA 3DFGA 5HS8A 4N9IA 4CHUA 2RKHA 3OOPA 3SQNA 4UNOA 4CO8A 3M7GA 3F8FA 2CSOA 2QQBA 4BNCA 4ENJA 1O7LA 1D8JA 2CQKA 4U0VA 4XBFA 5HDNA 2ZMEA 3IWFA 2H27A 1IAWA 4M9XA 4I0AA 3H3ZA 2XAJA 1R36A 2PLYA 3K1MA 1IN6A 1XGSA 1V4RA 3RKYA 1G3YA 2OZ6A 3GFLA 2A3SA 3RPUA 3ZPLA 2DQLA 1BI0A 3HTSB 2ZNZA 3K9TA 3TDZC 3F23A 1R5HA 5FB2A 3MAJA 3WODF 5IT3A 3HYIA 4LGWA 1ZRCA 4HX8A 5L3CA 2PJPA 5LGNA 4YIIA 1SMYF 4RB2C 3KP6A 3QOPA 3QRFF 4CDGA 3QAHA 1ZG3A 5FLXK 2EFOA 3B02A 1RI7A 4LLGF 2VN2A 5LHIA 2A6HF 2EV0A 2KIMA 3ABTA 1FT9A 2FRHA 3Q9VA 3K1PA 1IXCA 4A5NA 3C18A 1FYLA 4IRHA 3FF5A 4CICA 1QPMA 4MQ9F 4KIBA 4WF2A 2ZXJA 1KYWA 4P96A 5CVIA 1XGOA 4ZZDA 3CUQB 2LF7A 2IT0A 2EV6A 4LK0F 1S8NA 4EV0A 1LEAA 5HLHA 4P9FA 1X3UA 2FBIA 4ASNA 2YSRA 3I64A 5DCMB 3M8EA 2G7HA 1EH7A 1TNTA 4RB3C 3GYHX 1QQIA 4O6JA 4HBLA 3ERED 1ZRFA 2VBWA 5LGUA 3JSOA 2F5CA 2GZWA 3J81K 2P5VA 1ZGAA 4HF0A 2Z33A 2ACJA 3CJNA 3I5UA 2HEOA 5J8FA 5L3BA 2M8EA 3N97A 1MDMB 4MNUA 3HUGA 2O6GE 3EQLF 3ZMZA 3HHGA 3MZHA 3BPVA 1GXQA 3REOA 4IF4A 4ETSA 2FMYA 5BS6A 4KDPA 1XCBA 1K78B 5ERIA 3SZPA 3LSTA 2LKPA 2MLKA 5ICCA 1FBSA 3WTYC 1FOKA 2QZ8A 4A0XA 1S6LA 2STTA 4KNYA 3BP8A 5K5QA 3TOAA 4DQ2A 1IUYA 5FLXZ 2QLZA 1W7PD 1K7AA 2JPBA 3FZVA 1SD7A 2L54A 1L3LA 4KIFA 4HV5A 3WU0A 1FP2A 1GXPA 2HR3A 2Z9OA 4L9NA 2F2EA 2L4MA 2HKOA 2KIUA 5JR3A 1EH8A 4G8XA 5LRSA 2DBBA 5H20A 2OQGA 2M1BA 3LWFA 1XSDA 2BV6A 1D5VA 5JHUA 2GXBA 1B59A 2DK8A 2VC1A 2Z3YA 1WI9A 3BJOA 3F6VA 1HSTA 5BPDA 5E17F 5HS7A 4A0YA 1XMKA 1AWCA 3ISPA 1IN4A 3JAMK 1K78A 4PGHA 2NNNA 2IA2A 3LA2A 3PFIA 1HKQA 4FX4A 4G7ZF 1J2XA 1I6XA 1BI3A 2H94A 1G4DA 1WRJA 2F5DA 4UV8A 4ENMA 1E2XA 5H6RA 3BPXA 3QP5A 4MEYF 2HYGD 4M9SA 2VBYA 3J81Z 1H9TA 1LVAA 3HOSA 2OAZA 2IVMA 2XVCA 3Q9SA 2C6YA 3D0SA 4E70A 4ZYEA 2MD5A 1YW7A 2M30A 3D5LA 3EUHA 4MEXF 3L09A 2CO5A 4Y15A 4P5OA 1OYWA 1MKMA 1DDNA 5A2QZ 1Q1HA 5FGMA 1DPUA 1SD6A 5DCFA 4Q5SF 3GW2A 1OKRA 4ZYHA 4KFCA 4NHJA 1KU2A 4EGYA 2MH2A 2O3FA 1PUEE 2FF4A 1ON2A 2A69F 4HOBA 4S05A 4UXNA 2DFIA 5E18F 1ZHFA 2W84A 4IRGA 2TDXA 5D4SA 3W6KB 3WTUC 3JW4A 3M1EA 2XGXA 2QYOA 4JBAA 3ZMSA 5DDGA 1LJ9A 5D6FA 1XCVA 5EEGA 1V3FA 2F5EA 4FHTA 3TO9A 5E8IA 1O3SA 4EJUA 2KJCA 1TW2A 3WE3A 5IT9Z 4I02A 4A6EA 3QPTA 1REPC 1P92A 2FU4A 3F3XA 1FX7A 2NYXA 5LHHA 4OMZA 3BOQA 1UFMA 1UB9A 1QO0D 2IPQX 4CYDA 2HQNA 3QPHA 4XSZF 2JRTA 4L0YB 5IT9K 3NRVA 1FZPB 3M8FA 3EETA 5ICGA 2V79A 3ECOA 3JSPA 2DW4A 1IRGA 2CYYA 4Q48A 3P9KA 2BBYA 1KYZA 3GO5A 3KETA 1K79A 3GUDA 5E8GA 1P4XA 4KMFA 4U0YA 3L9FA 5L3FA 4F7ZA 1ZN2A 1TTYA 2ADUA 3FM5A 1JXSA 3DXJF 5AIPA 2Y48A 4MGRA 1IF1A 1W7PA 5D5VB 2Q0OA 3KZZA 2GIVA 4LB6B 5ILSA 3WTXC 3CLOA 1WSUA 2Q8KA 2HGCA 4MTDA 1OYYA 2FNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJT A;  3BDD A;  4G7O F;  5JFR A;  5LHG A;  4KMU X;  1FY7 A;  4IHT A;  1ZG1 A;  2M5W A;  3FMS A;  2BE5 F;  1TBX A;  3KEQ A;  3TDU C;  1OPC A;  4G9Y A;  3MQ0 A;  1BI2 A;  1XGN A;  3EDP A;  3E5Q A;  2HZT A;  5LGT A;  4L0Z B;  2FSW A;  1G6N A;  4OIP F;  4KIC A;  4M74 A;  3O3K A;  3RIR A;  3E97 A;  3EYY A;  3KZY A;  5KVR A;  3TQN A;  2K4B A;  2R3S A;  1F4K A;  2K86 A;  2PEX A;  1O3R A;  4U88 A;  1IRF A;  4GYG A;  4HV6 A;  2HQR A;  5D8K B;  4UUV A;  4OOI A;  1S29 A;  1FLI A;  2ZKZ A;  5E1X A;  1PP8 F;  4GXO A;  3F6O A;  1DPR A;  2D2W A;  3CTA A;  2FNP A;  1JHH A;  1S7O A;  3WTV C;  3CUQ C;  1ZLJ A;  2HDC A;  2FML A;  4G7H F;  3GX4 X;  3WU1 B;  1LB2 A;  3ZN1 A;  3V7C A;  2GAU A;  3E5U A;  3CO6 C;  1E17 A;  3I0T A;  2IA0 A;  3LQQ A;  4Y17 A;  1HBX G;  3FXU A;  3MFK A;  2LSO A;  2EFP A;  4L5J A;  2CG4 A;  3RPQ A;  4NB5 A;  3VOE A;  4XLN F;  1ZRE A;  3U1D A;  3WGG A;  2BEO A;  5J8C A;  2H6B A;  3E6D A;  2ZJ2 A;  2XUB A;  1SMT A;  5DD4 A;  2NNY A;  5D5W B;  2OU2 A;  3IRQ A;  2HTJ A;  4I01 A;  1HQC A;  2IRF G;  1JGS A;  2L3D A;  1YYV A;  4QWQ A;  1FP1 D;  2HOE A;  3OV8 A;  5CVJ A;  1BM9 A;  4EMS A;  4WXC A;  1SD4 A;  1ZLK A;  1F5T A;  2MBF A;  5HVQ C;  1C0W A;  1HW5 A;  4LG0 B;  2ISY A;  2STW A;  4QLC U;  4HF1 A;  1J0R A;  4EM0 B;  4LMY A;  2X0L A;  2XHK A;  2RDP A;  3HSE A;  1MJB A;  4KT5 C;  4MQV A;  3P9C A;  4KA4 A;  2YX4 A;  5AON A;  4LD5 A;  3GLX A;  1Z7U A;  3K0L A;  1TW3 A;  1FSE A;  4OIN F;  3HTU A;  1Z91 A;  4BAY A;  3JAM Z;  2JPC A;  2PQ8 A;  5AIQ A;  3RI4 A;  4N0B A;  1SFU A;  5LLQ A;  4LB5 A;  3M9A A;  3DF8 A;  2XV4 S;  3FMR A;  2EV5 A;  2KIF A;  3E5X A;  1L0O C;  4UV9 A;  1Z9C A;  4OU0 A;  2DI3 A;  2Z5U A;  2XRN A;  1Z1D A;  3U9G A;  1XSV A;  1BI1 A;  1R5G A;  5LEK A;  3BJ6 A;  2RV8 A;  2CWE A;  4ESB A;  3TO7 A;  4ZYD A;  1KU9 A;  2PN6 A;  2VOP A;  1SD5 A;  3HRM A;  3GZ6 A;  1U5T C;  2EFW A;  1IN7 A;  3I59 B;  5ED4 A;  4PCQ A;  1KQ8 A;  2XAF A;  1WWX A;  3RYP A;  2QVO A;  4KN7 X;  2P7C B;  1BOA A;  1U6G A;  1MD0 A;  1D8K A;  4Q4Z F;  3U2R A;  3GFJ A;  3DEU A;  3IC7 A;  4RAZ A;  2VOD A;  3QU3 A;  3CDH A;  4ESJ A;  2E1C A;  1FYK A;  5JI6 A;  2E7X A;  4LLL A;  1R1V A;  3N4M A;  2UZK A;  5E1W A;  3O2P E;  2ETH A;  5EEH A;  3I54 A;  3HRT A;  3ZMV A;  5E20 A;  3R0J A;  2WC2 A;  2NAZ A;  2V1D A;  4YG2 F;  2XRO A;  3EYI A;  3NQO A;  2RNJ A;  4A6D A;  4HZF A;  3LA3 A;  1P6R A;  1KQ9 A;  5BMZ A;  2XAS A;  4BQA A;  3KLN A;  2K02 A;  2LF8 A;  3L2C A;  1BC7 C;  3I59 A;  4LK1 F;  2DLL A;  3L00 A;  1I1S A;  1QNT A;  3ZP5 A;  4EGZ A;  1T0F A;  1SFE A;  5DCM A;  3R6S A;  2H09 A;  3RJP A;  4XRF A;  2EFN A;  5DV5 A;  4YIF A;  3V8K A;  1R22 A;  1NHA A;  3DQV C;  2XAH A;  2QBY B;  4I0B A;  1YIO A;  3VB2 A;  2P8T A;  4JQF A;  2W24 A;  4IVN A;  3KP3 A;  2W85 A;  2L4A A;  2A61 A;  4TV7 A;  2GWR A;  3ROU A;  4ZYG A;  1U3E M;  4UVB A;  3S2W A;  3KP2 A;  1R1U A;  4ON0 A;  5L3E A;  1J9I A;  4G94 A;  5ICE A;  4HLX A;  2FE3 A;  2PMU A;  2JZY A;  4A0Z A;  3T8T A;  5FFX A;  4DNC A;  2FA5 A;  3RYR A;  4AIK A;  4PDK A;  4HQM A;  2V1X A;  1U5T A;  1YS6 A;  4R8H A;  2EWN A;  4M72 A;  1KQ0 A;  1YS7 A;  3LFK A;  3IKV A;  2X4H A;  4M9Z A;  5DEQ A;  2K27 A;  3O6B B;  3PQK A;  1RNL A;  3T0Y A;  1FYM A;  5HLG A;  1IN8 A;  2DAO A;  4RB1 A;  3K1N A;  3QU6 A;  1Z6R A;  2PG4 A;  1O3Q A;  5A2Q K;  2QBY A;  1H0M A;  3NEU A;  3BWG A;  4ESF A;  1U2W A;  1HXD A;  2FQ3 A;  1LDK B;  1R7J A;  1G3S A;  3PQJ A;  3RTR A;  1HW2 A;  1J5Y A;  2R7F A;  1USS A;  4KIG A;  2NS0 A;  2EFQ A;  2ZFW A;  1BJA A;  4RGS A;  1PDN C;  3E6C C;  5LRR A;  5F64 A;  3SZT A;  4I98 B;  2W57 A;  3R61 A;  2DQR A;  4FX0 A;  1ZG5 A;  3R0A A;  1UCR A;  1G3W A;  5CVR A;  3F21 A;  5ILV A;  4RAY A;  4M6Y A;  2XKO A;  4EJV A;  2K7L A;  2ESH A;  2QQ9 A;  1SAX A;  1EV7 A;  3TGN A;  1FC3 A;  2VE9 A;  5ILU A;  2V9V A;  2RC4 A;  1JE8 A;  3MZY A;  2CGP A;  3FXR A;  3I4P A;  1XDS A;  1P4W A;  3MCZ A;  3KFW X;  4I09 A;  3I71 A;  3V4G A;  4EVI A;  4EM1 A;  2QEN A;  1A04 A;  3GEZ A;  2KRF A;  5TJJ A;  1PP7 U;  4WK8 F;  3TOB A;  1O7F A;  1XDU A;  4M71 A;  3ZQ7 A;  2OD5 A;  3MEX A;  3WGI A;  1FPQ A;  2O03 A;  1T2K A;  5CJ9 A;  4ENK A;  3DV8 A;  4YFN F;  3FMQ A;  1RUN A;  2EA4 A;  1KGS A;  1F1Z A;  4IXA A;  3V8J A;  4HYE A;  3FX3 A;  4BHB A;  3LAJ A;  3FWE A;  3WTT C;  3F8B A;  2YX7 A;  2ELH A;  1WKM A;  2P6S A;  1OR7 A;  2OZU A;  3F8N A;  1AOY A;  1MJ9 A;  5JVT A;  4AIJ A;  4M73 A;  4EJO A;  1MDM A;  3AAF A;  1GVJ A;  2L02 A;  1JHF A;  2DU9 A;  3ELK A;  3K2Z A;  3H3U A;  3BY6 A;  1B9M A;  1ONV A;  2FBH A;  3FHZ A;  4WXD A;  1ZAR A;  2GXG A;  5FFZ A;  5HDG A;  4R1H A;  5DUI A;  2O61 A;  4BHC A;  1IXR C;  1QZY A;  1Z05 A;  4RGU A;  2UXN A;  3C1D A;  1MZB A;  1TNS A;  1F9N A;  2VE8 A;  4A12 A;  2WV0 A;  4GO1 A;  2VON A;  1YW8 A;  2AS5 F;  3GFI A;  4U7D A;  2R7D A;  2A07 F;  4I7H A;  3CUQ A;  3DP7 A;  4S04 A;  2XAQ A;  5HOO A;  4OIR F;  1P4A A;  5F6F A;  2NRA C;  1HKS A;  4HDV A;  5LBQ A;  2DTR A;  1H9G A;  5H6Q A;  5DD8 A;  4L9V A;  2P6T A;  2PMH A;  2PI0 A;  2O0Y A;  3KP4 A;  3HRS A;  1EH6 A;  1LDJ A;  5TRD A;  3GFM A;  1W7P B;  3HOT A;  4UHT A;  1T6S A;  2L01 A;  3R60 A;  1STZ A;  1IXS B;  1BIB A;  2MH9 A;  1LNW A;  1LDD A;  2F5F A;  3W6J B;  2GQQ A;  4IHS A;  2QQA A;  2DO7 A;  3G73 A;  3KLO A;  3V7S A;  3KP5 A;  4HW0 A;  4XSX F;  4BYY A;  3LAP A;  3F72 A;  5CVU A;  2PFB A;  1YO5 C;  5BOX A;  5BPI A;  1YFH A;  1I27 A;  3BZ6 A;  2CFX A;  3TO6 A;  3DKW A;  1J59 A;  3WGH A;  4RGX A;  4R79 A;  5FD6 A;  5KK1 A;  3Q5F A;  3IHU A;  4RS8 A;  5CVV A;  2BGC A;  3DPT A;  4GGG A;  1Y0U A;  1I5Z A;  1B1B A;  1B4A A;  3T8R A;  3ULQ B;  2VXZ A;  1ZH5 A;  2ZCW A;  4CXF A;  2Y0M A;  4BH9 A;  2JT1 A;  3V8L A;  1OMI A;  1QGP A;  5FD5 A;  2P5L C;  1FNN A;  3ML6 A;  5E1Z B;  3J80 K;  1TQM A;  3WTZ A;  1ZYR F;  4G6Q A;  3P7N A;  2KJB A;  1O57 A;  1BC8 C;  2HTS A;  3JTG A;  2OQR A;  2ZBK A;  1Z6T A;  3SXY A;  2A6E F;  2J5P A;  2M87 A;  1ULY A;  4JK1 X;  3I53 A;  2P5K A;  3WG9 A;  2LDU A;  4AWX B;  1MGT A;  1T98 A;  2PBI A;  1RIO H;  3L7W A;  2CW0 F;  1SFX A;  2V6C A;  3SFZ A;  4A2U A;  2HS5 A;  1BIA A;  1KA8 A;  1QZZ A;  3G3Z A;  1ZAO A;  4LG0 A;  2EK5 A;  5DYM A;  2YPR A;  1DUX C;  3FXQ A;  1XGM A;  4LFU A;  2FOK A;  4OIO F;  2BYV E;  2J5O A;  2A68 F;  1ODD A;  4HX4 A;  2ZME B;  3ZMU A;  2O8X A;  4GYI A;  1O3T A;  4CZZ A;  4Z2Y A;  3IRR A;  5HLI A;  4EJW A;  1YTY A;  3HSF A;  2ESN A;  5HS9 A;  2DK5 A;  1XMA A;  2P4W A;  1IW7 F;  1OYI A;  3GWZ A;  1W5T A;  3F8M A;  2Y75 A;  2ZNY A;  4BHP A;  1D3Y A;  2FXA A;  1FBU A;  4LLN A;  1ZGJ A;  3GVA A;  4WX9 A;  3F22 A;  4AD9 A;  4U0W A;  3HIF A;  3R4K A;  4WCG A;  1G3T A;  2VT2 A;  1IN5 A;  3RKW A;  2VT3 A;  2HYF A;  4B8X A;  1KU7 A;  2HKX A;  1HKT A;  2EJR A;  3KEO A;  2MC3 A;  3WTS C;  2D1H A;  3ABU A;  4I2O A;  2QWW A;  2K4J A;  1FWZ A;  3C7J A;  1XD7 A;  5FO5 A;  1QBJ A;  3MWM A;  3SHF A;  3GZ5 A;  4Y13 A;  3H92 A;  3ZMT A;  2GA2 A;  3F8C A;  2Z99 A;  3T5X A;  2IA1 A;  2COM A;  1W5S A;  2IP2 A;  4MHG A;  3TKY A;  1T38 A;  2RN7 A;  4GCV A;  3HHH A;  1P2F A;  4HDU A;  1J7K A;  5D5X B;  1KU3 A;  4AIH A;  1WQ2 A;  1BN5 A;  2B0L A;  5D6E A;  3GXO A;  4OMY A;  3CO7 C;  2D45 A;  2OA4 A;  1FBQ A;  3COA C;  4B09 A;  1RZ4 A;  2XIG A;  2QM3 A;  2GA1 A;  4XLP F;  1K6O A;  1CF7 B;  1YLF A;  2VC0 A;  4KYW A;  2W25 A;  1ZRD A;  2YR2 A;  4N9H A;  4OIQ F;  4A5M A;  2JSC A;  3BRO A;  1LEB A;  1R23 A;  4HAM A;  4WWC A;  4ENN A;  1BBY A;  5F1R A;  3RDI A;  2ISZ A;  2VBX A;  4ZH4 F;  1R00 A;  2EB7 A;  2HFH A;  3HRU A;  2XKP A;  1XN7 A;  2QUF A;  3JTH A;  4HX7 A;  1GHC A;  4RB0 A;  5K5O A;  3BJA A;  2IJL A;  2DPU A;  1TQI A;  1YG2 A;  4M6X A;  3WTW C;  2OBP A;  3IL2 A;  4K2E A;  1HSJ A;  2WTE A;  3VOD A;  5HDK A;  3HSR A;  2AXL A;  5K1Y A;  3IKT A;  1HW1 A;  2G7U A;  4PZJ A;  2YU3 A;  4YFK F;  2VOO A;  2IW5 A;  3LQR A;  3E6B A;  1S3J A;  5D4R A;  1B6A A;  4L9J A;  4O5V A;  1TLH B;  2V1U A;  2E1N A;  4YFX F;  2HWV A;  2MA3 A;  2UXX A;  3ZN0 A;  4IJA A;  4CGZ A;  3E6M A;  2M45 A;  4L5I A;  3J7A O;  1CF7 A;  4FT8 A;  1YW9 A;  4ZZL A;  3QP6 A;  4L9T A;  6PAX A;  4BXU A;  1LQ1 A;  3DPL C;  3GF2 A;  1MJA A;  2WWY A;  2UWM A;  2FBK A;  5L3G A;  2DPD A;  3I58 A;  4G6D A;  1TQP A;  1IZ1 A;  2JTV A;  2MLG A;  1J75 A;  2KKO A;  2ZO4 A;  1RUO A;  5LEJ A;  2FEZ A;  1UHM A;  1S7A A;  4UVA A;  1U78 A;  4KN4 X;  2H6C A;  3KE2 A;  4KUM A;  5D8L B;  1W4M A;  5CYV A;  4D0P A;  4IPA A;  1DP7 P;  2RGV A;  5DUK A;  2E7W A;  1R58 A;  4H0E A;  4HA8 A;  2RVC A;  5J6X A;  1ON1 A;  2G9W A;  3C3W A;  3B73 A;  1U5T B;  2RQP A;  4IRI A;  1XSX A;  4O3M A;  5BQT A;  2VBZ A;  3LA7 A;  1UST A;  5L3D A;  3E3V A;  1I1G A;  4HQE A;  2XAG A;  3KCC A;  2EA2 A;  3WE2 A;  5K5R A;  3VFZ A;  1T39 A;  1YQA A;  1FSH A;  3KP7 A;  2D1V A;  4AVP A;  4HLY A;  1VTN C;  4Q47 A;  4U7B A;  1U8R A;  3T1B A;  4HF2 A;  5ICF A;  1UHW A;  3V7R A;  1R1T A;  5CLS A;  3ECH A;  4WXH A;  4EQQ A;  4P55 A;  3RKX A;  2LNB A;  4EM2 A;  3VEP A;  4NQW A;  2P7V B;  3CUO A;  3FM3 A;  3ZMD A;  1XB4 A;  2Q2E A;  4LJZ F;  2DT5 A;  4PGG A;  3K69 A;  4L18 B;  2A5Y B;  3IWZ A;  3P9I A;  4MTE A;  4UVC A;  4P9U A;  5D5U B;  3J80 Z;  4RGR A;  1B9N A;  1CGP A;  3DFG A;  5HS8 A;  4N9I A;  4CHU A;  2RKH A;  3OOP A;  3SQN A;  4UNO A;  4CO8 A;  3M7G A;  3F8F A;  2CSO A;  2QQB A;  4BNC A;  4ENJ A;  1O7L A;  1D8J A;  2CQK A;  4U0V A;  4XBF A;  5HDN A;  2ZME A;  3IWF A;  2H27 A;  1IAW A;  4M9X A;  4I0A A;  3H3Z A;  2XAJ A;  1R36 A;  2PLY A;  3K1M A;  1IN6 A;  1XGS A;  1V4R A;  3RKY A;  1G3Y A;  2OZ6 A;  3GFL A;  2A3S A;  3RPU A;  3ZPL A;  2DQL A;  1BI0 A;  3HTS B;  2ZNZ A;  3K9T A;  3TDZ C;  3F23 A;  1R5H A;  5FB2 A;  3MAJ A;  3WOD F;  5IT3 A;  3HYI A;  4LGW A;  1ZRC A;  4HX8 A;  5L3C A;  2PJP A;  5LGN A;  4YII A;  1SMY F;  4RB2 C;  3KP6 A;  3QOP A;  3QRF F;  4CDG A;  3QAH A;  1ZG3 A;  5FLX K;  2EFO A;  3B02 A;  1RI7 A;  4LLG F;  2VN2 A;  5LHI A;  2A6H F;  2EV0 A;  2KIM A;  3ABT A;  1FT9 A;  2FRH A;  3Q9V A;  3K1P A;  1IXC A;  4A5N A;  3C18 A;  1FYL A;  4IRH A;  3FF5 A;  4CIC A;  1QPM A;  4MQ9 F;  4KIB A;  4WF2 A;  2ZXJ A;  1KYW A;  4P96 A;  5CVI A;  1XGO A;  4ZZD A;  3CUQ B;  2LF7 A;  2IT0 A;  2EV6 A;  4LK0 F;  1S8N A;  4EV0 A;  1LEA A;  5HLH A;  4P9F A;  1X3U A;  2FBI A;  4ASN A;  2YSR A;  3I64 A;  5DCM B;  3M8E A;  2G7H A;  1EH7 A;  1TNT A;  4RB3 C;  3GYH X;  1QQI A;  4O6J A;  4HBL A;  3ERE D;  1ZRF A;  2VBW A;  5LGU A;  3JSO A;  2F5C A;  2GZW A;  3J81 K;  2P5V A;  1ZGA A;  4HF0 A;  2Z33 A;  2ACJ A;  3CJN A;  3I5U A;  2HEO A;  5J8F A;  5L3B A;  2M8E A;  3N97 A;  1MDM B;  4MNU A;  3HUG A;  2O6G E;  3EQL F;  3ZMZ A;  3HHG A;  3MZH A;  3BPV A;  1GXQ A;  3REO A;  4IF4 A;  4ETS A;  2FMY A;  5BS6 A;  4KDP A;  1XCB A;  1K78 B;  5ERI A;  3SZP A;  3LST A;  2LKP A;  2MLK A;  5ICC A;  1FBS A;  3WTY C;  1FOK A;  2QZ8 A;  4A0X A;  1S6L A;  2STT A;  4KNY A;  3BP8 A;  5K5Q A;  3TOA A;  4DQ2 A;  1IUY A;  5FLX Z;  2QLZ A;  1W7P D;  1K7A A;  2JPB A;  3FZV A;  1SD7 A;  2L54 A;  1L3L A;  4KIF A;  4HV5 A;  3WU0 A;  1FP2 A;  1GXP A;  2HR3 A;  2Z9O A;  4L9N A;  2F2E A;  2L4M A;  2HKO A;  2KIU A;  5JR3 A;  1EH8 A;  4G8X A;  5LRS A;  2DBB A;  5H20 A;  2OQG A;  2M1B A;  3LWF A;  1XSD A;  2BV6 A;  1D5V A;  5JHU A;  2GXB A;  1B59 A;  2DK8 A;  2VC1 A;  2Z3Y A;  1WI9 A;  3BJO A;  3F6V A;  1HST A;  5BPD A;  5E17 F;  5HS7 A;  4A0Y A;  1XMK A;  1AWC A;  3ISP A;  1IN4 A;  3JAM K;  1K78 A;  4PGH A;  2NNN A;  2IA2 A;  3LA2 A;  3PFI A;  1HKQ A;  4FX4 A;  4G7Z F;  1J2X A;  1I6X A;  1BI3 A;  2H94 A;  1G4D A;  1WRJ A;  2F5D A;  4UV8 A;  4ENM A;  1E2X A;  5H6R A;  3BPX A;  3QP5 A;  4MEY F;  2HYG D;  4M9S A;  2VBY A;  3J81 Z;  1H9T A;  1LVA A;  3HOS A;  2OAZ A;  2IVM A;  2XVC A;  3Q9S A;  2C6Y A;  3D0S A;  4E70 A;  4ZYE A;  2MD5 A;  1YW7 A;  2M30 A;  3D5L A;  3EUH A;  4MEX F;  3L09 A;  2CO5 A;  4Y15 A;  4P5O A;  1OYW A;  1MKM A;  1DDN A;  5A2Q Z;  1Q1H A;  5FGM A;  1DPU A;  1SD6 A;  5DCF A;  4Q5S F;  3GW2 A;  1OKR A;  4ZYH A;  4KFC A;  4NHJ A;  1KU2 A;  4EGY A;  2MH2 A;  2O3F A;  1PUE E;  2FF4 A;  1ON2 A;  2A69 F;  4HOB A;  4S05 A;  4UXN A;  2DFI A;  5E18 F;  1ZHF A;  2W84 A;  4IRG A;  2TDX A;  5D4S A;  3W6K B;  3WTU C;  3JW4 A;  3M1E A;  2XGX A;  2QYO A;  4JBA A;  3ZMS A;  5DDG A;  1LJ9 A;  5D6F A;  1XCV A;  5EEG A;  1V3F A;  2F5E A;  4FHT A;  3TO9 A;  5E8I A;  1O3S A;  4EJU A;  2KJC A;  1TW2 A;  3WE3 A;  5IT9 Z;  4I02 A;  4A6E A;  3QPT A;  1REP C;  1P92 A;  2FU4 A;  3F3X A;  1FX7 A;  2NYX A;  5LHH A;  4OMZ A;  3BOQ A;  1UFM A;  1UB9 A;  1QO0 D;  2IPQ X;  4CYD A;  2HQN A;  3QPH A;  4XSZ F;  2JRT A;  4L0Y B;  5IT9 K;  3NRV A;  1FZP B;  3M8F A;  3EET A;  5ICG A;  2V79 A;  3ECO A;  3JSP A;  2DW4 A;  1IRG A;  2CYY A;  4Q48 A;  3P9K A;  2BBY A;  1KYZ A;  3GO5 A;  3KET A;  1K79 A;  3GUD A;  5E8G A;  1P4X A;  4KMF A;  4U0Y A;  3L9F A;  5L3F A;  4F7Z A;  1ZN2 A;  1TTY A;  2ADU A;  3FM5 A;  1JXS A;  3DXJ F;  5AIP A;  2Y48 A;  4MGR A;  1IF1 A;  1W7P A;  5D5V B;  2Q0O A;  3KZZ A;  2GIV A;  4LB6 B;  5ILS A;  3WTX C;  3CLO A;  1WSU A;  2Q8K A;  2HGC A;  4MTD A;  1OYY A;  2FNA A; 
#chains in the Genus database with same CATH topology
 1X1D A;  4EJT A;  3BDD A;  4AYB N;  4G7O F;  1I50 J;  5JFR A;  4YIR X;  5TIS C;  3AG3 H;  2HYJ A;  4NBQ A;  2EIN H;  5LHG A;  2JJ7 A;  4KMU X;  1FY7 A;  1D0Y A;  4IHT A;  4GFB A;  3GTK J;  1ZG1 A;  2M5W A;  3PO3 J;  1A6Q A;  3FMS A;  4BE2 A;  2BE5 F;  1TBX A;  2EPF A;  3KEQ A;  3TDU C;  1OPC A;  4G9Y A;  2HDD A;  3MQ0 A;  1BI2 A;  1XGN A;  2AHQ A;  3EDP A;  3E5Q A;  2NVT J;  2HZT A;  2JQ7 A;  3BG5 A;  5LGT A;  1X4O A;  4L0Z B;  2FSW A;  3BG9 A;  1G6N A;  4F93 B;  4M3B A;  3CME I;  4OIP F;  4KIC A;  4M74 A;  3O3K A;  4NDL A;  3RIR A;  2Y2Z A;  3SDB A;  3GCM A;  3E97 A;  2JMW A;  3EYY A;  3KZY A;  1J09 A;  1QVT A;  5KVR A;  3TQN A;  2X6W A;  2VQH A;  2NVQ J;  3OYJ A;  3EUA A;  3GTM J;  2K4B A;  2MW8 A;  2O9L A;  3JRB A;  3C2G A;  3K70 C;  2PJR A;  2M9H A;  2E19 A;  2R3S A;  2CW7 A;  1MMG A;  1F4K A;  2K86 A;  2PEX A;  4E6K G;  4U88 A;  1O3R A;  1IRF A;  1BA5 A;  3PIP F;  4GYG A;  1RET A;  4HV6 A;  2HQR A;  2RAE A;  3A01 A;  1QZE A;  5D8K B;  4UUV A;  4OOI A;  1S29 A;  3RCO A;  1D5Y A;  1FLI A;  1N75 A;  2OUM A;  2ZKZ A;  2KDZ A;  5E1X A;  1PP8 F;  4GXO A;  3F6O A;  5EGO B;  1DPR A;  2D2W A;  3CTA A;  1AA7 A;  2FNP A;  1JHH A;  1P7I A;  1S7O A;  3WTV C;  3CUQ C;  3UKG A;  1ZLJ A;  5IOY A;  4RDU A;  3A4C A;  2HDC A;  4DOZ A;  2Y69 H;  2R7O A;  1TWG J;  4IOC F;  2FML A;  2AQE A;  2K9L A;  1A6I A;  4G7H F;  4CA0 A;  4E7I A;  3GX4 X;  3BCB A;  3CES A;  3WU1 B;  1LB2 A;  3S3O A;  3ZN1 A;  3V7C A;  2GAU A;  2AO9 A;  1P9Q C;  3E5U A;  5FLV A;  3CO6 C;  1E17 A;  3I0T A;  2IA0 A;  5J4V A;  3LQQ A;  2VPR A;  1U9N A;  2JUG A;  2QCO A;  2LRE A;  4Y17 A;  3BR6 A;  1HBX G;  3FXU A;  3MFK A;  4NNJ A;  2LSO A;  2LFB A;  2EIL H;  2EFP A;  4BY1 J;  5FRM A;  2X85 A;  2CG4 A;  4L5J A;  3RPQ A;  4NB5 A;  3L2R A;  3VOE A;  4XLN F;  1ZRE A;  3FIW A;  2I5U A;  3U1D A;  4ZDL A;  1MW7 A;  3ABK H;  2VKH A;  1VZ0 A;  3WGG A;  3KYL A;  2BEO A;  3ZR8 X;  5J8C A;  1M1E B;  1IV8 A;  2H6B A;  3K4C A;  4PJL A;  2N8G A;  3BR3 A;  2V26 A;  3E6D A;  2ZJ2 A;  2XUB A;  4XKW A;  1SMT A;  5DD4 A;  3HC7 A;  3OR1 C;  2L7K A;  2NNY A;  3A1Y A;  3HOW J;  4UB6 C;  1SAN A;  5D5W B;  1V5E A;  2OU2 A;  3IRQ A;  2HTJ A;  2VIX A;  4L5E A;  1X3Z B;  4I01 A;  1ITY A;  2BVM A;  1HQC A;  2IRF G;  1JGS A;  2L3D A;  5FRO A;  2DOF A;  1YYV A;  4QWQ A;  4RA2 A;  1EF4 A;  1FP1 D;  1YIJ I;  4GRI A;  2HOE A;  3I56 I;  3OV8 A;  5CVJ A;  4I76 A;  1BM9 A;  2E5Z A;  3IH3 A;  3BCA A;  3K7A J;  5IPA A;  4EMS A;  3W2V A;  1UAA A;  4WXC A;  5JLW A;  4BQQ A;  1SD4 A;  4IO9 F;  1ZLK A;  1F5T A;  2MBF A;  2WY8 Q;  1R71 A;  5HVQ C;  1DQU A;  5J47 A;  1C0W A;  5GTH C;  1HW5 A;  2DA4 A;  3G71 I;  4LG0 B;  2ISY A;  1A35 A;  2R0Q C;  1R49 A;  2STW A;  2V9P A;  1WGX A;  4QLC U;  4A3K J;  1OCC H;  4HF1 A;  1G59 A;  1J0R A;  4EM0 B;  1LPQ A;  3QQA A;  2DN0 A;  1MMN A;  4LMY A;  1XX5 A;  2X0L A;  2XHK A;  2RDP A;  1OCZ H;  3HSE A;  1EKE A;  4XRS G;  1MJB A;  4KT5 C;  3CQZ J;  3VSK A;  3S3N A;  4DZP A;  2MFZ A;  2MG4 A;  2DYS H;  5B1B H;  3OIP A;  4MQV A;  1GVD A;  3L1P A;  3ZRG A;  3P9C A;  4KA4 A;  2YX4 A;  5AON A;  2LK2 A;  2KZV A;  4LD5 A;  3GLX A;  1Z7U A;  3A2K A;  1WJD A;  3ZQL A;  3K0L A;  1TW3 A;  1FSE A;  4E7L A;  2IS2 A;  4OIN F;  3HTU A;  2QGU A;  3S2H J;  1Z91 A;  3CCL I;  2QF7 A;  4BAY A;  3G1L A;  3LMM A;  4CSW A;  5M5Y J;  2ZJR F;  2HOS A;  3JAM Z;  2XPW A;  1OFC X;  4NQW B;  2JPC A;  4CCJ A;  2PQ8 A;  2WAE A;  2Y30 A;  2R5Y B;  1WH7 A;  3QOE A;  5AIQ A;  1TL8 A;  3RI4 A;  1QA6 A;  4N0B A;  3WHB A;  3RPU D;  1SFU A;  5LLQ A;  4LB5 A;  3CJQ B;  3M9A A;  3DF8 A;  2XV4 S;  5GTI C;  3FMR A;  2EV5 A;  2JA7 J;  2F4O B;  2KIF A;  3S32 A;  4FIS A;  3E5X A;  2RRE A;  1L0O C;  4UV9 A;  1Z9C A;  3JRG A;  4RBO A;  4CYC B;  4OU0 A;  5K7F A;  2DI3 A;  4DYR A;  1S7E A;  3K4J A;  2Z5U A;  3H5N A;  2GM4 A;  4QPQ A;  2XRN A;  4D1Q A;  3JRD A;  4XN0 A;  4F55 A;  4QTR A;  3PNT A;  5F08 A;  2X6Y A;  1Z1D A;  3U9G A;  1XSV A;  2KT0 A;  2XDV A;  2L7F P;  2BW3 B;  1BI1 A;  1R5G A;  2LBF B;  3ASN H;  1S5L C;  2W7N A;  2JA2 A;  5LEK A;  3M1C A;  3A0H C;  3BJ6 A;  3DTK A;  5JLX A;  3B6A A;  2RV8 A;  2CWE A;  4H4K C;  4ESB A;  3TO7 A;  4F92 B;  4IX7 A;  4ZYD A;  2BY3 A;  1KU9 A;  1ZK8 A;  1HDD C;  2PN6 A;  2VI6 A;  2W00 A;  1SD5 A;  3HRM A;  2VOP A;  1LKX A;  3GZ6 A;  1R4N B;  4V2F A;  3S15 J;  5E3M A;  1U5T C;  2EFW A;  1IN7 A;  3I59 B;  5ED4 A;  2JN6 A;  4PCQ A;  1KQ8 A;  2X1E A;  1WCM J;  2XSD C;  2XAF A;  4BE1 A;  1VQ5 I;  1WWX A;  3RYP A;  3D1N I;  2QVO A;  1QPI A;  3H3V K;  1HLV A;  4KN7 X;  2P7C B;  1BOA A;  2CUZ A;  1U6G A;  4E4H A;  1MD0 A;  1D8K A;  4XIC A;  4Q4Z F;  1VQP I;  3LSH A;  3U2R A;  3GFJ A;  3DEU A;  3IC7 A;  4RAZ A;  4XQF A;  2VOD A;  3CJR B;  3QU3 A;  2HVQ A;  3CDH A;  4Y52 J;  4ESJ A;  1UMQ A;  3RZD J;  4EAT A;  3CZ6 A;  2E1C A;  5GPC A;  1FYK A;  5JI6 A;  2E7X A;  4JX4 A;  3U21 A;  4A3L J;  2K85 A;  4LLL A;  1R1V A;  3G1M A;  3CCM I;  3ESW B;  3SZG A;  3FIS A;  3N4M A;  2HXO A;  3WG7 H;  2UZK A;  2QSG X;  5E1W A;  3K6G A;  1FOX A;  3O8G A;  3O2P E;  3FHN A;  2AQF A;  2ETH A;  5EEH A;  3TL4 X;  3I54 A;  3HRT A;  4BE0 A;  3ZMV A;  3CDL A;  3H9J A;  5E20 A;  3R0J A;  4QIW N;  1HOM A;  2WC2 A;  2NAZ A;  2CFO A;  2V1D A;  4YG2 F;  3L2V A;  2XRO A;  3EYI A;  2M3A A;  3NQO A;  2MSY A;  2RNJ A;  4A6D A;  4B3X A;  2CH0 A;  1NTC A;  4HZF A;  2QKL B;  1P6R A;  3LA3 A;  1KQ9 A;  1NH3 A;  5BMZ A;  2K3P A;  1ETO A;  2XAS A;  4HNV A;  4BQA A;  2RNG A;  1JKR C;  3KLN A;  2K02 A;  3K2A A;  2LF8 A;  3L2C A;  1BC7 C;  1TWF J;  3I59 A;  2F48 A;  4X6A J;  2HOA A;  4LK1 F;  2DLL A;  4BJ5 C;  5F1J A;  4A3J J;  5EYR A;  3HOV J;  3L00 A;  2O8K A;  1I1S A;  2ZXW H;  1QNT A;  3ZP5 A;  4EGZ A;  3HOY J;  1T0F A;  4BEH A;  1SFE A;  2WB1 A;  1E0E A;  4B3A A;  5DCM A;  4PJM A;  2FJ1 A;  3R6S A;  2E35 A;  2H09 A;  4A3E J;  3RJP A;  1W0U A;  1T08 B;  4XRF A;  2EFN A;  5DV5 A;  4YIF A;  3V8K A;  3H0G J;  1VQ6 I;  1R22 A;  3BR0 A;  2DFE A;  4RLQ A;  1B8I A;  1NHA A;  4GDF A;  2VUM J;  3DQV C;  2XAH A;  3K4M A;  4BBR J;  3JR9 A;  2QBY B;  2LBF A;  4I0B A;  1P7J A;  1YIO A;  3VB2 A;  1ZKG A;  2YS9 A;  4MFD A;  3IAM 2;  2P8T A;  4JQF A;  3CCR I;  3CC2 I;  2DJN A;  2W24 A;  4YRV A;  4IVN A;  4ZJZ A;  2QSF X;  3KP3 A;  2W85 A;  2L4A A;  5CPR B;  2R5Y A;  2A61 A;  4TV7 A;  2GWR A;  3ROU A;  4ZYG A;  1OR7 C;  2DTZ A;  2R7S A;  1Y0N A;  3HUG B;  1U3E M;  4CUG A;  4UVB A;  4E7S A;  1F36 A;  3S2W A;  3D5R C;  3KP2 A;  2JSP A;  3KX2 A;  1R1U A;  3OIO A;  4ON0 A;  5L3E A;  4X0G A;  2B63 J;  1W0T A;  1WI3 A;  1J9I A;  4V19 K;  4G94 A;  1PJR A;  5ICE A;  1AKH A;  4HLX A;  1ETV A;  2FE3 A;  4XR6 A;  2DJI A;  2PMU A;  2JZY A;  1WVR A;  2WV1 A;  2KZG A;  1W5C C;  4A0Z A;  4BS9 A;  2D5V A;  3T8T A;  3CCJ I;  2DMU A;  4D7N A;  5FFX A;  4DNC A;  2FA5 A;  3BZK A;  3ZQH A;  3RYR A;  1X1A A;  2CW8 A;  4AIK A;  4PDK A;  1LE8 B;  4HQM A;  2V1X A;  1U5T A;  1YS6 A;  4R8H A;  3PSF A;  2EWN A;  4M72 A;  4CCK A;  1KQ0 A;  1YS7 A;  3LFK A;  4B48 A;  3IKV A;  5GAH J;  2X4H A;  4M9Z A;  2OPT A;  5DEQ A;  2K27 A;  3O6B B;  2KRH A;  3PQK A;  1RNL A;  4Y3O A;  3H5A A;  3T0Y A;  1FYM A;  5HLG A;  1TWH J;  3HKZ A;  1FJL A;  2E2H J;  5EEA A;  5H2F C;  3ZQC A;  3FDY A;  4XNF A;  4C2M J;  1IN8 A;  1Y8Q B;  2DAO A;  2E1M C;  4PK4 A;  3K1N A;  4RB1 A;  3QU6 A;  1X3W B;  1Z6R A;  1A5J A;  2PG4 A;  1O3Q A;  5A2Q K;  3BC8 A;  3FXK A;  2QBY A;  3E1S A;  1YJW I;  1H0M A;  1YHQ I;  3AFH A;  3NEU A;  3BWG A;  4ESF A;  2BVL A;  2H1K A;  2JWT A;  4C9Y A;  2BZT A;  1U2W A;  2I10 A;  2R4G A;  4FE7 A;  3CDI A;  1HXD A;  2FQ3 A;  2BXZ A;  1LDK B;  1R7J A;  1G3S A;  4NC6 A;  5M3F J;  3PQJ A;  2EBI A;  2XRL A;  3RTR A;  1MNE A;  1YJN I;  2IS4 A;  5FRN A;  1XMX A;  1J5Y A;  1HW2 A;  4XLA A;  2R7F A;  4EEF G;  2EIM H;  5HNH A;  1USS A;  4KIG A;  1UG2 A;  2NS0 A;  1YRN A;  2ZFW A;  2EFQ A;  1BJA A;  2F6C A;  3ZQQ A;  4RGS A;  3W2A A;  3M8J A;  3FK6 A;  1PDN C;  4B43 A;  5J40 A;  5LRR A;  4FET A;  5F64 A;  3E6C C;  1OCP A;  2Y0S A;  1N77 A;  2R5Z B;  2HU9 A;  3S8P A;  3LOC A;  3PFY A;  3SZT A;  1UEL B;  4I98 B;  2W57 A;  4IHY A;  2KP6 A;  3R61 A;  2DQR A;  4FX0 A;  1ZG5 A;  4C2T A;  3R0A A;  1UCR A;  1G3W A;  5CVR A;  3F21 A;  1X2M A;  5ILV A;  2K9S A;  3VYU B;  2K3F A;  2M4G A;  2XPV A;  3LSK A;  4RAY A;  4M6Y A;  1MBH A;  2XKO A;  4EJV A;  2K7L A;  3S3M A;  1BR4 A;  1K83 J;  1N25 A;  1TT5 B;  2ESH A;  4ANJ A;  4PJ0 C;  1X58 A;  4PUS A;  3TP3 A;  2QQ9 A;  1SAX A;  1YJ9 I;  2CRG A;  3HL2 A;  1EV7 A;  1MSF C;  3TGN A;  4ZTJ A;  2VXD A;  1FC3 A;  2VE9 A;  3LL7 A;  5EF6 A;  5ILU A;  1DU6 A;  2V9V A;  5KAF C;  4M3G A;  1VQ4 I;  5LD2 C;  2RC4 A;  3LNQ A;  1E3P A;  1JE8 A;  3PO2 J;  3QPL A;  3MZY A;  2CGP A;  3FXR A;  3I4M J;  3I4P A;  1K6Y A;  1XDS A;  1P4W A;  5J3L A;  4DYC A;  1XS9 A;  2ID6 A;  3MCZ A;  3KFW X;  4I09 A;  3I71 A;  3V4G A;  4EVI A;  1I39 A;  4EM1 A;  2QEN A;  3OYD A;  1A04 A;  4J01 A;  3GEZ A;  2KRF A;  3BR2 A;  5TJJ A;  3ZQG A;  1PP7 U;  4HPQ A;  5GAD J;  3CC7 I;  3RKQ A;  3ZGK A;  1TT0 A;  4WK8 F;  3TOB A;  2H8W A;  1AHD P;  1O7F A;  1XDU A;  4M71 A;  3ZQ7 A;  1FIP A;  2YUS A;  2OD5 A;  3MEX A;  3OYB A;  4LG3 A;  3OS0 A;  3FKJ A;  1Y1W J;  3WGI A;  1IRX A;  1FPQ A;  2O03 A;  1T2K A;  5CJ9 A;  4AC0 A;  4ENK A;  1OCO H;  1X19 A;  1R5I D;  2Q1Z B;  3DV8 A;  1OYY A;  4XN3 A;  2CJJ A;  2LP0 A;  4YFN F;  3A02 A;  3FMQ A;  1RUN A;  3LSP A;  1ZR4 A;  2EA4 A;  2W1O A;  2IBD A;  3GZN B;  5KCM A;  1KGS A;  1F1Z A;  4IXA A;  3V8J A;  4HYE A;  3FX3 A;  4BHB A;  2IS6 A;  3LAJ A;  3FWE A;  3WTT C;  3F8B A;  4D7M A;  2YX7 A;  5GPA A;  2ELH A;  1WKM A;  2ZJQ F;  2P6S A;  4A69 C;  1OR7 A;  5KHD A;  2OZU A;  3F8N A;  5HNF A;  5HOD A;  2BY0 A;  2KL4 A;  1AOY A;  1MJ9 A;  1IGN A;  2XF6 A;  1WJE A;  3CCY A;  2Z2S B;  5JVT A;  4AIJ A;  4B4C A;  4M73 A;  1N78 A;  4FQG A;  4EJO A;  1MDM A;  4CCM A;  3PL8 A;  2JUC A;  3AAF A;  1GVJ A;  2L02 A;  1XG1 A;  2DA5 A;  5TGT A;  2DA3 A;  2JA5 J;  1JHF A;  2DU9 A;  1VQM I;  3ELK A;  3K2Z A;  3H3U A;  3BY6 A;  1B9M A;  1ONV A;  2FBH A;  2JVG A;  2R7R A;  3M3Y J;  3FBI B;  4WXD A;  3FHZ A;  4C2U A;  1ZAR A;  2GXG A;  5FFZ A;  5HDG A;  1ZTR A;  4X1E A;  1Q1V A;  2XF5 A;  3UNG C;  3RSN A;  4R1H A;  3QWL A;  2LR8 A;  5DUI A;  2O61 A;  2M4K A;  1F43 A;  4BHC A;  3RZO J;  1BW5 A;  1IXR C;  1QZY A;  1WJF A;  1Z05 A;  4RGU A;  2UXN A;  4UY8 I;  3J7A Y;  1HC8 A;  3C1D A;  1MZB A;  4HEA 2;  2GIZ A;  4XLC A;  3O8H A;  1TNS A;  1F9N A;  2CUF A;  2VE8 A;  1ZGW A;  2GXA A;  4II3 A;  1D1A A;  4A12 A;  2WV0 A;  5F0F A;  1ZR2 A;  2KDO A;  4GO1 A;  2VON A;  3M4O J;  1YW8 A;  2AS5 F;  3GFI A;  3IUO A;  4BAC A;  4U7D A;  1JUM A;  2XF7 A;  2R7D A;  2A07 F;  3BQZ A;  4I7H A;  3CUQ A;  3I3L A;  3DP7 A;  3HKZ N;  4S04 A;  2XAQ A;  5HOO A;  4OIR F;  1P4A A;  5F6F A;  2NRA C;  1HKS A;  4HDV A;  2ME0 A;  1AU7 A;  5LBQ A;  1JKO C;  2R92 J;  2DTR A;  1H9G A;  3LSG A;  2XB5 A;  2E2I J;  3FK7 A;  1VQL I;  5H6Q A;  3OYI A;  2V6E A;  4XRS A;  5DD8 A;  4L9V A;  2P6T A;  3LSI A;  4M3F A;  5GAG J;  2PMH A;  2LY2 A;  4PJN A;  2O0Y A;  3HG9 A;  3ABL H;  2PI0 A;  1A36 A;  3KP4 A;  3TMO A;  2LKX A;  1FTT A;  1YX5 A;  3HRS A;  9ANT A;  1EH6 A;  1LDJ A;  5TRD A;  2VQL A;  3LFU A;  2MD0 A;  1ENH A;  3GFM A;  1W7P B;  3W3C A;  4BGD A;  4BY7 J;  1SC7 A;  1NG7 A;  3HOT A;  3H35 A;  1QVU A;  1RES A;  2DFH A;  2VB6 A;  4UHT A;  1T6S A;  1JT6 A;  2L01 A;  3MKL A;  3ONQ A;  3R60 A;  1STZ A;  1IXS B;  5FKO A;  1BIB A;  2MH9 A;  1IO2 A;  5IYD J;  1LNW A;  3F0C A;  1LDD A;  1Z3X A;  2F5F A;  3W6J B;  2GQQ A;  4IHS A;  1IG7 A;  2I8D A;  2VL8 A;  3GTQ J;  2HVS A;  2X1D A;  3CLQ A;  2BY1 A;  2CQQ A;  2QQA A;  2DO7 A;  4N4O B;  5DM6 F;  3BLY A;  3G73 A;  1K4S A;  3KLO A;  3V7S A;  2R7U A;  3KP5 A;  4HW0 A;  4XSX F;  4BYY A;  3LAP A;  3F72 A;  5CVU A;  1D1C A;  2PFB A;  2F4I A;  1YO5 C;  5BOX A;  2FOW A;  1Y56 A;  3HEF A;  5BPI A;  4J00 A;  1YFH A;  1X1P A;  3CMA I;  1I27 A;  3BZ6 A;  2CFX A;  3TO6 A;  5IP7 J;  3DKW A;  5KNL A;  1J59 A;  3WGH A;  1ETX A;  4RGX A;  4R79 A;  3ZOB A;  2BOL A;  5FD6 A;  5KK1 A;  2HXI A;  3Q5F A;  3IHU A;  4RS8 A;  5CVV A;  2BGC A;  3OS1 A;  4JP0 A;  4M3E A;  3DPT A;  4GGG A;  3A03 A;  1Y0U A;  5FKK A;  2XPU A;  2LOO A;  4BJT A;  1I5Z A;  1B1B A;  1B4A A;  3T8R A;  3ULQ B;  2VXZ A;  1ZH5 A;  5EG0 A;  2ZCW A;  4P1W A;  4ABZ A;  2DMQ A;  4CXF A;  1E3O C;  2Y0M A;  4BH9 A;  3U1K A;  2JT1 A;  3V8L A;  4ZYA A;  3BG3 A;  4PJJ A;  4LOC A;  1FIA A;  4DBQ A;  1V55 H;  2KFD A;  1OMI A;  1QGP A;  3K4K A;  3MVP A;  5FD5 A;  1QRY A;  2P5L C;  1W36 D;  1FNN A;  3ML6 A;  3JRH A;  5E1Z B;  3JRA A;  3J80 K;  2XGE A;  1TQM A;  3WTZ A;  1ZYR F;  4A93 J;  4G6Q A;  5IY5 H;  2CUE A;  3P7N A;  2KJB A;  3AG1 H;  4MLO A;  3M07 A;  4BXX J;  4E7Z A;  3HJE A;  2H8R A;  2ZME C;  1O57 A;  2JVH A;  1BC8 C;  5CQE A;  2HTS A;  2NS8 A;  3JTG A;  2OQR A;  2ZBK A;  1Z6T A;  3E0J B;  3MD2 A;  3SXY A;  2A6E F;  2J5P A;  2M87 A;  1ULY A;  3S1N J;  4JK1 X;  2W4S A;  3I53 A;  2E60 A;  2P5K A;  2LDU A;  3WG9 A;  4NUB A;  2CU7 A;  3EUH C;  4AWX B;  1MGT A;  1T98 A;  2PBI A;  2DA2 A;  1D0Z A;  2DOD A;  1RIO H;  3L7W A;  5F04 A;  4BEH B;  3X2Q H;  4FAS D;  2CW0 F;  1SFX A;  3ZMT A;  1V54 H;  2V6C A;  3SFZ A;  2HPM A;  4A2U A;  1WJB A;  2HS5 A;  5E79 C;  2HZD A;  5EDN A;  1BIA A;  1OQY A;  1YX3 A;  3BT9 A;  4IEJ A;  1KA8 A;  1QZZ A;  2V7F A;  3G3Z A;  1ERD A;  4IKF A;  1ETY A;  1I3Q J;  5EZG A;  1ZAO A;  3I9V 2;  4LG0 A;  1S9H A;  4XKC A;  4B47 A;  1FMV A;  2EK5 A;  3Q3S A;  5DYM A;  2YPR A;  3OWT A;  3DU5 A;  1DUX C;  2WAQ A;  1XGM A;  3FXQ A;  5EGO A;  1X2N A;  4LFU A;  5GAE J;  2FOK A;  1VF9 A;  3K4L A;  3CCE I;  4OIO F;  2M7A A;  2BYV E;  3A0B C;  3GTJ J;  2J5O A;  2A68 F;  1ODD A;  4HX4 A;  2ZME B;  3ZMU A;  4RMN A;  1VFC A;  2O8X A;  4C3J J;  4GYI A;  1O3T A;  3S1Q J;  3H5R A;  4CZZ A;  4Z2Y A;  3IRR A;  1B72 A;  5HLI A;  4EJW A;  2LY1 A;  3HBL A;  1YTY A;  1RPW A;  3GBG A;  3HSF A;  3VYT B;  2ESN A;  5HS9 A;  1QHH D;  2DK5 A;  1XMA A;  2JA6 J;  4Y4R A;  2P4W A;  4JX6 A;  1IW7 F;  1OYI A;  3GWZ A;  4A3I J;  1W5T A;  3K4B A;  2P0W A;  3F8M A;  4LIU A;  5BNG A;  2Y75 A;  2ZNY A;  2COB A;  2ZC2 A;  4BHP A;  4IOA F;  1D3Y A;  2FXA A;  2BY2 A;  3W2W A;  5M3M J;  3OYE A;  4A3C J;  1FBU A;  2MGQ A;  4LLN A;  3G2B A;  1ZEL A;  5E3L A;  1ZGJ A;  5FKL A;  3GVA A;  1K61 A;  4Y7N J;  1YI2 I;  4WX9 A;  1O4X A;  3F22 A;  4YEL A;  4AD9 A;  1R9T J;  4U0W A;  1H8A C;  3BG6 A;  3HIF A;  3R4K A;  2FX0 A;  4WCG A;  2ID3 A;  1CQT A;  3GTP J;  1G3T A;  2G0E A;  2VT2 A;  5JHF A;  2R5Z A;  1IN5 A;  2O5R A;  2WAQ N;  3MKW B;  3FXL A;  3GTG J;  3FKI J;  3RKW A;  2VT3 A;  2HYF A;  4B8X A;  3Q0V A;  2K9N A;  1KU7 A;  2HKX A;  3BR1 A;  1HKT A;  2EJR A;  3KEO A;  3KPH A;  2MC3 A;  2DYR H;  3WTS C;  2D1H A;  2EZK A;  1TP4 A;  3ABU A;  4I2O A;  4F91 B;  2QWW A;  2K4J A;  3OYC A;  1FWZ A;  3C7J A;  4XLE A;  1XD7 A;  1JJ8 C;  4AM3 A;  5FO5 A;  1QBJ A;  2V4J C;  3NAR A;  3MWM A;  3SHF A;  2DOE A;  2MAB A;  3GZ5 A;  4Y13 A;  3H92 A;  2CS3 A;  1X1C A;  1SFK A;  2GA2 A;  3F8C A;  2K40 A;  2Z99 A;  2E36 A;  4KT6 A;  4MFE A;  3SFI A;  2VJ5 A;  3T5X A;  2IA1 A;  2COM A;  1R6R A;  4BXF A;  1W5S A;  5LFA A;  2IP2 A;  4MHG A;  3HM5 A;  1MSE C;  3HB9 A;  1BW6 A;  2VJ4 A;  3CJT B;  3TKY A;  1T38 A;  2RN7 A;  5FLX K;  4GCV A;  3HHH A;  2LH9 A;  3HOX J;  1P2F A;  4HDU A;  1J7K A;  5D5X B;  1KU3 A;  1LUJ B;  1OJL A;  4AIH A;  1IRZ A;  1WQ2 A;  2DT7 B;  1MND A;  3ABM H;  5FKN A;  1BN5 A;  2B0L A;  5D6E A;  3GXO A;  4OMY A;  1FMW A;  1UJ8 A;  3CO7 C;  2E5N A;  2D45 A;  3HXL A;  2K9M A;  2OA4 A;  1FBQ A;  3HDD A;  4PSX A;  3COA C;  1IDY A;  4B09 A;  4CYC A;  1RZ4 A;  2XIG A;  2QM3 A;  2GA1 A;  2UUZ A;  4XLP F;  1K6O A;  5EG0 B;  2IS1 A;  1CF7 B;  3NWT A;  3E7L A;  1YLF A;  1MBK A;  2BHZ A;  4OWR B;  2VC0 A;  3D5S C;  5EZH A;  4I99 C;  4KYW A;  2R7Z J;  3SJM A;  1WJA A;  1NG6 A;  2W25 A;  3PNY A;  2HQ5 A;  2L7Z A;  1ZRD A;  3JRE A;  3K10 A;  1Y1V J;  4YEJ A;  2YR2 A;  4N9H A;  4OIQ F;  4A5M A;  2M0M A;  2PJR B;  3AKZ A;  2L9R A;  3OYM A;  1BL0 A;  2JSC A;  1ETQ A;  3BRO A;  5HLT A;  1LEB A;  1R23 A;  4HAM A;  2DA1 A;  4WWC A;  3VYR B;  2NS7 A;  3OL3 A;  2ZSH B;  2KIS A;  4ENN A;  3OSF A;  1JTX A;  2WAD A;  4F3Q A;  1BBY A;  3OYN A;  2X1C A;  4IZZ A;  5KAI C;  5IP6 A;  1VQ7 I;  3BTL A;  2DCE A;  1GV2 A;  4BKX A;  4CCL A;  3RQI A;  4IQ4 A;  2CV1 A;  1ACI A;  1IDZ A;  1TZL A;  2VLA A;  5F1R A;  2DMN A;  2KQR A;  2LLK A;  3RDI A;  4A3F J;  2ISZ A;  1U8B A;  2VBX A;  1MBJ A;  4ZH4 F;  5F0H A;  3L2U A;  1R00 A;  2EB7 A;  2HFH A;  3HRU A;  1DGR M;  1W36 C;  2XKP A;  1HA8 A;  1XN7 A;  2QUF A;  3JTH A;  4HX7 A;  1GHC A;  4RB0 A;  4XLF A;  2RQQ A;  2L9V A;  3BJA A;  4D9J A;  2HI3 A;  5K5O A;  4E7J A;  2WB1 N;  2Q2E B;  2IJL A;  4ZTF A;  3G1O A;  2DPU A;  1TQI A;  1WH5 A;  3OL4 A;  2UV1 A;  2TCT A;  2LG4 A;  1YG2 A;  2OJE D;  2HPI A;  4M6X A;  3WTW C;  4A3M J;  2OBP A;  1QU3 A;  3IL2 A;  3QOD A;  2BHY A;  4K2E A;  1HSJ A;  3ZQF A;  2WTE A;  2ZJP F;  3VOD A;  1OCR H;  4FE4 A;  3DPU A;  3TW6 A;  4DZJ A;  3DU6 A;  3DKX A;  5HDK A;  3L2Q A;  3HSR A;  1GT0 C;  2AXL A;  2ELK A;  5K1Y A;  3IKT A;  1HW1 A;  4IHW A;  5M5W J;  2YU9 J;  1BJZ A;  2G7U A;  1BR1 A;  2F4M B;  4PZJ A;  1IJW C;  2YU3 A;  4YFK F;  2VOO A;  4XOR A;  3CP8 A;  1Z3Y A;  2IW5 A;  3LQR A;  3E6B A;  3DBL B;  1S3J A;  1Y8R B;  2XSJ C;  4ZDP A;  5D4R A;  1B6A A;  1T8I A;  4M3D A;  4L9J A;  4O5V A;  2GLO A;  1TLH B;  3G6E I;  2V1U A;  2NVU B;  2E1N A;  2PX9 A;  4JOM A;  1IC8 A;  4YFX F;  2HWV A;  5EJC A;  4XLH A;  1MBG A;  1MH4 A;  2MA3 A;  4XOP A;  1MMA A;  2IGN A;  2UXX A;  2F5V A;  3ZN0 A;  5J1U A;  4IJA A;  4CGZ A;  2EQR A;  4XID A;  3KYD B;  3E6M A;  1ETW A;  5IOZ A;  2B9S A;  1VQ8 I;  3S1M J;  1V5G A;  3PUF A;  2M45 A;  2CV0 A;  2R93 J;  4E7K A;  1Z7L A;  4L5I A;  3J7A O;  1ZQ3 P;  2OCE A;  4PFP A;  1RKW A;  2XGC A;  1CF7 A;  1MMD A;  4FT8 A;  1YW9 A;  2LVS A;  4ZZL A;  3QP6 A;  4L9T A;  6PAX A;  3HOZ J;  1B8I B;  4BXU A;  4CCN A;  4DBR A;  3CF5 F;  2VQG A;  1LQ1 A;  3DPL C;  3GF2 A;  1MJA A;  2WBM A;  2WWY A;  2UWM A;  2FBK A;  5L3G A;  2DPD A;  3I58 A;  3DEE A;  3N05 A;  4G6D A;  3QYE A;  1QHG A;  1TQP A;  4J19 A;  4IQJ A;  1IZ1 A;  3OOU A;  3TBI A;  3HGY A;  1MIJ A;  2JTV A;  4LIV A;  2MLG A;  2VAS A;  1J75 A;  2KKO A;  3BTI A;  1PUF B;  1VI0 A;  2ECB A;  2ZO4 A;  1RUO A;  2CV2 A;  1JI8 A;  1XTA A;  3AG4 H;  5LEJ A;  2FEZ A;  1T56 A;  1UHM A;  1APL C;  1SVO A;  2IGO A;  1S7A A;  4UVA A;  1U78 A;  4KN4 X;  2H6C A;  5B3S H;  2QEX I;  4HRI A;  3S2D J;  3KE2 A;  4KUM A;  5D8L B;  1W4M A;  5CYV A;  2WY7 Q;  1IV6 A;  1I3A A;  4D0P A;  4IPA A;  1DP7 P;  3MKY B;  2RGV A;  1OLT A;  5DUK A;  1KZH A;  4AYB A;  2E7W A;  2LD5 A;  4CH7 A;  1KON A;  1R58 A;  3CP2 A;  4XM3 A;  4HA8 A;  4H0E A;  2RVC A;  5J6X A;  4XL9 A;  3EPZ A;  1ON1 A;  1BOB A;  1T33 A;  3NWS A;  2LMD A;  4RAG A;  2X51 A;  4KJZ A;  2G9W A;  3C3W A;  3B73 A;  1U5T B;  4BL0 B;  3CCQ I;  2IEK A;  2RQP A;  3ERM A;  3OIQ A;  4IRI A;  1XSX A;  2ZXI A;  4O3M A;  1YRN B;  1NK2 P;  2A6T A;  5BQT A;  1JUS A;  2VBZ A;  1K4T A;  3QYB A;  3LA7 A;  1UST A;  1JJ6 C;  3P5J A;  2GBY A;  5L3D A;  4ZC3 A;  3E3V A;  1I1G A;  1WZ2 A;  4HQE A;  2XAG A;  3KCC A;  3DEW A;  2EA2 A;  3WE2 A;  3F9K A;  5K5R A;  3AL0 C;  1WHU A;  4FTH A;  2DA7 A;  1T95 A;  5K7H A;  2EZI A;  3VFZ A;  3FXJ A;  1T39 A;  1YQA A;  1FSH A;  2B7E A;  1VQN I;  3TED A;  3CD6 I;  3MZ8 A;  3KP7 A;  3SYT A;  1YE9 A;  2D1V A;  4AVP A;  4HLY A;  3PNV A;  1EA3 A;  2M34 A;  1VTN C;  2A05 A;  4Q47 A;  4U7B A;  1U8R A;  1VQK I;  3QPS A;  3T1B A;  1WJC A;  3ASO H;  3G4S I;  4HF2 A;  5ICF A;  1UHW A;  3OMY A;  4V2G A;  3V7R A;  4S0H B;  1R1T A;  1HCR A;  5CLS A;  1FEX A;  3ECH A;  5DM7 F;  4F52 A;  4WXH A;  4EQQ A;  4P55 A;  3DTI A;  3RKX A;  1WFX A;  2PMZ N;  2LNB A;  3OR2 C;  4EM2 A;  3VEP A;  2E34 A;  4NQW A;  2P7V B;  3CUO A;  3FM3 A;  2M0C A;  2OTL I;  3BTJ A;  1Z77 A;  3ZMD A;  1XB4 A;  4A3B J;  2L9N A;  2Q2E A;  3H9G A;  4LJZ F;  1VQ9 I;  3IAS 2;  2DT5 A;  4PGG A;  2EZH A;  2XC7 A;  3K69 A;  4L18 B;  3VWB A;  2A5Y B;  2P81 A;  3IWZ A;  3P9I A;  4MTE A;  4UVC A;  3BZC A;  4P9U A;  5D5U B;  2KMU A;  2LTP A;  1GDT A;  3OY9 A;  3HGG A;  3QYF A;  4PFO A;  3J80 Z;  4RGR A;  5J1Y A;  1B9N A;  1CGP A;  4XOT A;  3DFG A;  5HS8 A;  5JVG F;  2M2E A;  4N9I A;  4XK4 A;  4CHU A;  2RKH A;  4NC8 A;  3BG7 A;  3OOP A;  3AG2 H;  3SQN A;  4UNO A;  4CO8 A;  3M7G A;  2BW3 A;  3CMM A;  3UR3 C;  1IUF A;  2HQA A;  3F8F A;  2NVX J;  3MKZ A;  2LKS A;  2CSO A;  3C2B A;  4HST A;  2QQB A;  2LY9 A;  4BNC A;  2FUG 2;  3CCS I;  2FQ4 A;  3CMY A;  1WPK A;  4ENJ A;  1OIS A;  1O7L A;  2NVY J;  3SEQ A;  2CQK A;  1D8J A;  5GP9 A;  3V42 A;  2ZXH A;  4U0V A;  1A31 A;  4XBF A;  5HDN A;  2ZME A;  3DTE A;  3IWF A;  2DT6 A;  2H27 A;  1IAW A;  1HDP A;  5E3O A;  2NOJ B;  3DBH B;  2OC6 A;  4D5C A;  1I6H J;  4M9X A;  4I0A A;  3I55 I;  3H3Z A;  2Y9Y A;  1R36 A;  2XAJ A;  2PLY A;  3K1M A;  5CKT A;  1IN6 A;  4LIT A;  4BQO A;  1XGS A;  4U87 A;  1V4R A;  3RKY A;  1GLN A;  1G3Y A;  2OZ6 A;  3GFL A;  2A3S A;  3S1R J;  3RPU A;  4RM2 A;  2VKV A;  1R4M B;  3ZPL A;  2DQL A;  4Z6Y A;  1SEU A;  4A3G J;  1BI0 A;  2GOM A;  3HTS B;  1MBF A;  4IL6 C;  4II2 A;  2ZNZ A;  1Z21 A;  4QPO A;  3HZJ A;  1BR2 A;  1Y39 A;  2BXY A;  3K9T A;  1FOY A;  3Q0U A;  3TDZ C;  1JKP C;  3F23 A;  1R5H A;  5FB2 A;  4BBS J;  2R7T A;  2ZB9 A;  4A3D J;  2NOG A;  3MAJ A;  4C3H J;  2XAU A;  3WOD F;  4N4N B;  2R7V A;  5IT3 A;  3IV5 A;  3HYI A;  4LGW A;  3J7Z I;  3PIO F;  5B66 C;  2IAI A;  1ZRC A;  4HX8 A;  5L3C A;  2K9Q A;  2PJP A;  5LGN A;  4YII A;  1SMY F;  2VKE A;  4RB2 C;  3KP6 A;  1U9O A;  3PM1 A;  1RC9 A;  3QOP A;  3QRF F;  1VND A;  3QAH A;  4MO7 A;  4CDG A;  1UHS A;  3PUB A;  1ZG3 A;  3LSJ A;  2QQ8 A;  4G12 A;  2EFO A;  2W48 A;  1RI7 A;  3B02 A;  4LLG F;  2KLO A;  2VN2 A;  2E71 A;  4AVZ A;  3OYH A;  5LHI A;  1H88 C;  2A6H F;  1DGW Y;  2DOA A;  1E3H A;  2EV0 A;  2LRD A;  1JT0 A;  3DLA A;  2KIM A;  3H1C A;  3ABT A;  1FT9 A;  2L5Q A;  3BR5 A;  4DGW B;  2FRH A;  3Q9V A;  3K1P A;  1IXC A;  1PVE A;  4A5N A;  3C18 A;  1FYL A;  2DMT A;  5E3N A;  4IRH A;  2HOT A;  3FF5 A;  5IYB J;  4CIC A;  3OS2 A;  1QPM A;  4MQ9 F;  4KIB A;  4WF2 A;  4E7H A;  3OYG A;  2JA8 J;  2ZXJ A;  1KYW A;  4ITV A;  4P96 A;  5CVI A;  1XGO A;  4ZZD A;  4AU7 A;  2E1M B;  1FOW A;  3CUQ B;  2LF7 A;  1XPX A;  2IT0 A;  2EV6 A;  4LK0 F;  1S8N A;  4EV0 A;  1LEA A;  5HLH A;  2DXI A;  4JYK A;  3OYF A;  3OYL A;  4C30 A;  4P9F A;  1X3U A;  2FBI A;  4ASN A;  2YSR A;  3I64 A;  5DCM B;  3M8E A;  1FTZ A;  1EH7 A;  2G7H A;  1LVK A;  4XKB A;  1TNT A;  4RM3 A;  4RB3 C;  3GYH X;  1QQI A;  2GOX B;  4O6J A;  4AUX A;  2Z1D A;  4HBL A;  4RAF A;  5FLM J;  3ERE D;  4W1U A;  1LE8 A;  3NAU A;  1ZRF A;  4CZC A;  4KIS A;  2VBW A;  5LGU A;  3JSO A;  2DMP A;  2F5C A;  3JCU C;  2GZW A;  3DCF A;  1S72 I;  3J81 K;  4BDY A;  2P5V A;  1ZGA A;  4HF0 A;  1JKQ C;  2Z33 A;  2Y9Z A;  3CJN A;  3I5U A;  4QSH A;  2ACJ A;  3DLL F;  2OF7 A;  5J8F A;  2HEO A;  3LSM A;  3JRI A;  2DDA A;  3KEY A;  5L3B A;  3MN2 A;  2M8E A;  1SFO J;  3N97 A;  1TWA J;  1MDM B;  4MNU A;  2R7Q A;  3HUG A;  1RKT A;  2O6G E;  4UB8 C;  4UUS B;  2K5C A;  3EQL F;  2ME6 A;  3ZMZ A;  2EH3 A;  5K7Z A;  3HHG A;  3J7Y J;  3MZH A;  3BPV A;  1GXQ A;  4IHX A;  3REO A;  1LFP A;  5C44 J;  2R7W A;  3HOU J;  4IF4 A;  4ETS A;  2FMY A;  5BS6 A;  4KDP A;  1XCB A;  1K78 B;  5ERI A;  3SZP A;  3OYA A;  3LST A;  2LKP A;  3ZCO A;  2HDW A;  3JRC A;  2MLK A;  5ICC A;  1FBS A;  1G8X A;  3WTY C;  5C4J J;  1FOK A;  2QZ8 A;  4A0X A;  1S6L A;  2STT A;  4KNY A;  3BP8 A;  2CQ7 A;  2VJI A;  4OAY A;  5K5Q A;  3TOA A;  2Y0S N;  2ECC A;  4W97 A;  4DQ2 A;  2ZFU A;  1IUY A;  5FLX Z;  2QLZ A;  3VDX A;  5C3E J;  1W7P D;  1K7A A;  2JPB A;  3FZV A;  2CQN A;  1SD7 A;  2L54 A;  1L3L A;  3I4N J;  4KIF A;  1DP3 A;  4HV5 A;  3WU0 A;  1FP2 A;  1GXP A;  2HR3 A;  3VSL A;  2Z9O A;  2X6O A;  4L9N A;  2F2E A;  2L4M A;  2HKO A;  3TP0 A;  3OYK A;  2KIU A;  5JR3 A;  1EH8 A;  2ELJ A;  1MMS A;  2AXT C;  4G8X A;  5LRS A;  2FD5 A;  2VQC A;  2W82 A;  2DBB A;  5H20 A;  2OQG A;  3LSR A;  2M1B A;  1AKH B;  1LFU P;  3LWF A;  1XSD A;  2BV6 A;  1D5V A;  5JHU A;  2GXB A;  1UZC A;  1B59 A;  1XC5 A;  2DK8 A;  2X9D A;  2VC1 A;  2Z3Y A;  3TW7 A;  5M5X J;  5FJ8 J;  1WI9 A;  3DKY A;  3BJO A;  1U0J A;  3F6V A;  1HST A;  5BPD A;  3OSG A;  3IP4 B;  4NC7 A;  4DIQ A;  5E17 F;  5HS7 A;  4A0Y A;  1XMK A;  2EZL A;  3W6V A;  1AWC A;  3ISP A;  3DWL E;  4XKV A;  3WU2 C;  2IXS A;  2IGM A;  1IN4 A;  3JAM K;  3H0D A;  4PGH A;  2NNN A;  5F27 A;  1K78 A;  1H89 C;  2IA2 A;  3LA2 A;  1VQO I;  3PFI A;  1HKQ A;  4FX4 A;  4UUT A;  1LFB A;  4ZDO A;  3GME A;  4I6Z A;  4G7Z F;  1J2X A;  1I6X A;  3FXO A;  4DYQ A;  1MBE A;  1BI3 A;  2JRM A;  2H94 A;  4BJ6 C;  1G4D A;  1WRJ A;  2KHM A;  1GUU A;  2CUJ A;  2F5D A;  4UV8 A;  4ENM A;  1E2X A;  3S14 J;  5H6R A;  1X4P A;  3BPX A;  2Z16 A;  1SVM A;  3QP5 A;  4MEY F;  1EJ9 A;  2HYG D;  4DJA A;  2OCC H;  4M9S A;  1GV5 A;  2VBY A;  3FBN B;  2QSH X;  5F0C A;  2WA0 A;  1D0X A;  1TC3 C;  3J81 Z;  1H9T A;  2V1N A;  1SAU A;  1LVA A;  2L0K A;  1Z0X A;  2E1O A;  2OAZ A;  5FKM A;  3HOS A;  5J4Y A;  2IVM A;  2XVC A;  3Q9S A;  1RR7 A;  3HPH A;  2R7X A;  2HNH A;  2C6Y A;  3D0S A;  5C4X J;  4E70 A;  4HSR A;  4ZYE A;  2MD5 A;  4UUS A;  3C2H A;  1YW7 A;  2M30 A;  3IH2 A;  1V5F A;  3D5L A;  1W1W E;  3EUH A;  4MEX F;  1PYV A;  3L09 A;  4MIM A;  2CO5 A;  2VKD A;  4Y15 A;  4P5O A;  3MMY B;  1OYW A;  4OAZ A;  1MKM A;  2DDB A;  4PSW A;  5B5E C;  2L7M P;  4RLF A;  1DDN A;  2XGD A;  5A2Q Z;  2CQX A;  2NXN B;  1Q1H A;  5FGM A;  1DPU A;  2DFF A;  1SD6 A;  3KZI C;  2KIQ A;  5DCF A;  1ETK A;  2CMP A;  4Q5S F;  3WHC A;  2VJJ A;  3GW2 A;  1OKR A;  4ZYH A;  1NK3 P;  4KFC A;  4NHJ A;  1KU2 A;  4EGY A;  2IGK A;  2MH2 A;  2O3F A;  5B1A H;  3SDG A;  1PUE E;  2FF4 A;  3CF2 A;  1IF1 A;  1ON2 A;  2A69 F;  1DU0 A;  2PMZ A;  3PSI A;  4JX5 A;  4C3I J;  1PUF A;  1HF0 A;  1YOV B;  2JK3 A;  1B72 B;  1TWC J;  4HOB A;  4S05 A;  3BTC A;  4UXN A;  3A01 B;  2LC2 A;  1POG A;  1MNM C;  2DFI A;  5E18 F;  2L2O A;  4IHV A;  1ZHF A;  2W84 A;  2EIJ H;  2Y31 A;  3GLL A;  3RQ4 A;  2KPM A;  2TDX A;  4IRG A;  5D4S A;  4BUP A;  3ZXS A;  3L2W A;  3W6K B;  3WTU C;  2VPL A;  2LYC A;  3JW4 A;  3M1E A;  2XGX A;  1OCT C;  2QYO A;  2H1L A;  4JBA A;  1X1B A;  1SVL A;  3ZMS A;  5DDG A;  1LJ9 A;  5D6F A;  1XCV A;  5EEG A;  1V3F A;  2F5E A;  2EIK H;  3H36 A;  3GTL J;  4FHT A;  1JUP A;  4BQN A;  2HVR A;  3TO9 A;  1JGG A;  1ORK A;  4CCO A;  4HNU A;  5E8I A;  3AL0 B;  5J1R A;  1O3S A;  4EJU A;  3S16 J;  2KJC A;  4HG2 A;  1TW2 A;  3WE3 A;  5IT9 Z;  4M6V A;  4XON A;  4I02 A;  3CC4 I;  1G2H A;  4A6E A;  3QPT A;  1REP C;  3KYC B;  3B6C A;  4B44 A;  1P92 A;  2MYS A;  2FU4 A;  2ZSI B;  3F3X A;  1FX7 A;  1D1B A;  1T0F C;  4B1R A;  3FXM A;  4XRM A;  1JTY A;  3HPG A;  4XMY A;  2NYX A;  5LHH A;  4OMZ A;  3CCU I;  2WAF A;  3BOQ A;  1YIT I;  1UFM A;  2O7O A;  1UB9 A;  1QO0 D;  3S17 J;  2IPQ X;  2XB0 X;  2X48 A;  2HQN A;  3QPH A;  4CYD A;  4XSZ F;  5IYC J;  3PJR A;  2JRT A;  4L0Y B;  2L9S A;  5IT9 K;  3DBR B;  3CCV I;  3ZQI A;  2ICW G;  3NRV A;  1FZP B;  3M8F A;  3EET A;  5ICG A;  3Q0W A;  2MC4 A;  3VPR A;  2V79 A;  3ECO A;  3JSP A;  2DW4 A;  1Y6I A;  1IRG A;  2CYY A;  5CQG A;  4Q48 A;  2QKM B;  5IP9 J;  3P9K A;  2BBY A;  1KYZ A;  1RRJ A;  3GO5 A;  3KET A;  2E2J J;  1K79 A;  3GUD A;  5E8G A;  1P4X A;  4KMF A;  4U0Y A;  3L9F A;  2DA6 A;  3VYS B;  4D5F A;  2OTJ I;  5L3F A;  2X6X A;  3SEZ A;  4HNT A;  4F7Z A;  4BU2 A;  3GTO J;  2M8G X;  1RR8 C;  1UG0 A;  3JRF A;  1ZN2 A;  5DS9 A;  1TTY A;  2ADU A;  3BQY A;  5DTD A;  3FM5 A;  2QA4 I;  1JXS A;  3DXJ F;  5AIP A;  3S93 A;  4DW6 A;  4KIT B;  2M7B A;  2Y48 A;  2OV7 A;  4AID A;  1W7P A;  1Z67 A;  2Q0O A;  2V9K A;  3KZZ A;  1WJ5 A;  4MGR A;  2GIV A;  3K4N A;  4Y33 A;  4LB6 B;  5D5V B;  3IH4 A;  4BDZ A;  5ILS A;  2TRT A;  3WTX C;  3CLO A;  3EUK L;  4G6T B;  1WSU A;  2Q8K A;  2HGC A;  3H9Q A;  2KRC A;  4FCY A;  4MTD A;  1MH3 A;  3KIO A;  2A5W A;  3K70 D;  2FNA A; 
#chains in the Genus database with same CATH homology
 4EJT A;  3BDD A;  4G7O F;  5JFR A;  5LHG A;  4KMU X;  1FY7 A;  4IHT A;  1ZG1 A;  2M5W A;  3FMS A;  2BE5 F;  1TBX A;  3KEQ A;  3TDU C;  1OPC A;  4G9Y A;  3MQ0 A;  1BI2 A;  1XGN A;  3EDP A;  3E5Q A;  2HZT A;  5LGT A;  4L0Z B;  2FSW A;  1G6N A;  4OIP F;  4KIC A;  4M74 A;  3O3K A;  3RIR A;  3E97 A;  3EYY A;  3KZY A;  5KVR A;  3TQN A;  2K4B A;  2R3S A;  1F4K A;  2K86 A;  2PEX A;  1O3R A;  4U88 A;  1IRF A;  4GYG A;  4HV6 A;  2HQR A;  5D8K B;  4UUV A;  4OOI A;  1S29 A;  1FLI A;  2ZKZ A;  5E1X A;  1PP8 F;  4GXO A;  3F6O A;  1DPR A;  2D2W A;  3CTA A;  2FNP A;  1JHH A;  1S7O A;  3WTV C;  3CUQ C;  1ZLJ A;  2HDC A;  2FML A;  4G7H F;  3GX4 X;  3WU1 B;  1LB2 A;  3ZN1 A;  3V7C A;  2GAU A;  3E5U A;  3CO6 C;  1E17 A;  3I0T A;  2IA0 A;  3LQQ A;  4Y17 A;  1HBX G;  3FXU A;  3MFK A;  2LSO A;  2EFP A;  4L5J A;  2CG4 A;  3RPQ A;  4NB5 A;  3VOE A;  4XLN F;  1ZRE A;  3U1D A;  3WGG A;  2BEO A;  5J8C A;  2H6B A;  3E6D A;  2ZJ2 A;  2XUB A;  1SMT A;  5DD4 A;  2NNY A;  5D5W B;  2OU2 A;  3IRQ A;  2HTJ A;  4I01 A;  1HQC A;  2IRF G;  1JGS A;  2L3D A;  1YYV A;  4QWQ A;  1FP1 D;  2HOE A;  3OV8 A;  5CVJ A;  1BM9 A;  4EMS A;  4WXC A;  1SD4 A;  1ZLK A;  1F5T A;  2MBF A;  5HVQ C;  1C0W A;  1HW5 A;  4LG0 B;  2ISY A;  2STW A;  4QLC U;  4HF1 A;  1J0R A;  4EM0 B;  4LMY A;  2X0L A;  2XHK A;  2RDP A;  3HSE A;  1MJB A;  4KT5 C;  4MQV A;  3P9C A;  4KA4 A;  2YX4 A;  5AON A;  4LD5 A;  3GLX A;  1Z7U A;  3K0L A;  1TW3 A;  1FSE A;  4OIN F;  3HTU A;  1Z91 A;  4BAY A;  3JAM Z;  2JPC A;  2PQ8 A;  5AIQ A;  3RI4 A;  4N0B A;  1SFU A;  5LLQ A;  4LB5 A;  3M9A A;  3DF8 A;  2XV4 S;  3FMR A;  2EV5 A;  2KIF A;  3E5X A;  1L0O C;  4UV9 A;  1Z9C A;  4OU0 A;  2DI3 A;  2Z5U A;  2XRN A;  1Z1D A;  3U9G A;  1XSV A;  1BI1 A;  1R5G A;  5LEK A;  3BJ6 A;  2RV8 A;  2CWE A;  4ESB A;  3TO7 A;  4ZYD A;  1KU9 A;  2PN6 A;  2VOP A;  1SD5 A;  3HRM A;  3GZ6 A;  1U5T C;  2EFW A;  1IN7 A;  3I59 B;  5ED4 A;  4PCQ A;  1KQ8 A;  2XAF A;  1WWX A;  3RYP A;  2QVO A;  4KN7 X;  2P7C B;  1BOA A;  1U6G A;  1MD0 A;  1D8K A;  4Q4Z F;  3U2R A;  3GFJ A;  3DEU A;  3IC7 A;  4RAZ A;  2VOD A;  3QU3 A;  3CDH A;  4ESJ A;  2E1C A;  1FYK A;  5JI6 A;  2E7X A;  4LLL A;  1R1V A;  3N4M A;  2UZK A;  5E1W A;  3O2P E;  2ETH A;  5EEH A;  3I54 A;  3HRT A;  3ZMV A;  5E20 A;  3R0J A;  2WC2 A;  2NAZ A;  2V1D A;  4YG2 F;  2XRO A;  3EYI A;  3NQO A;  2RNJ A;  4A6D A;  4HZF A;  3LA3 A;  1P6R A;  1KQ9 A;  5BMZ A;  2XAS A;  4BQA A;  3KLN A;  2K02 A;  2LF8 A;  3L2C A;  1BC7 C;  3I59 A;  4LK1 F;  2DLL A;  3L00 A;  1I1S A;  1QNT A;  3ZP5 A;  4EGZ A;  1T0F A;  1SFE A;  5DCM A;  3R6S A;  2H09 A;  3RJP A;  4XRF A;  2EFN A;  5DV5 A;  4YIF A;  3V8K A;  1R22 A;  1NHA A;  3DQV C;  2XAH A;  2QBY B;  4I0B A;  1YIO A;  3VB2 A;  2P8T A;  4JQF A;  2W24 A;  4IVN A;  3KP3 A;  2W85 A;  2L4A A;  2A61 A;  4TV7 A;  2GWR A;  3ROU A;  4ZYG A;  1U3E M;  4UVB A;  3S2W A;  3KP2 A;  1R1U A;  4ON0 A;  5L3E A;  1J9I A;  4G94 A;  5ICE A;  4HLX A;  2FE3 A;  2PMU A;  2JZY A;  4A0Z A;  3T8T A;  5FFX A;  4DNC A;  2FA5 A;  3RYR A;  4AIK A;  4PDK A;  4HQM A;  2V1X A;  1U5T A;  1YS6 A;  4R8H A;  2EWN A;  4M72 A;  1KQ0 A;  1YS7 A;  3LFK A;  3IKV A;  2X4H A;  4M9Z A;  5DEQ A;  2K27 A;  3O6B B;  3PQK A;  1RNL A;  3T0Y A;  1FYM A;  5HLG A;  1IN8 A;  2DAO A;  4RB1 A;  3K1N A;  3QU6 A;  1Z6R A;  2PG4 A;  1O3Q A;  5A2Q K;  2QBY A;  1H0M A;  3NEU A;  3BWG A;  4ESF A;  1U2W A;  1HXD A;  2FQ3 A;  1LDK B;  1R7J A;  1G3S A;  3PQJ A;  3RTR A;  1HW2 A;  1J5Y A;  2R7F A;  1USS A;  4KIG A;  2NS0 A;  2EFQ A;  2ZFW A;  1BJA A;  4RGS A;  1PDN C;  3E6C C;  5LRR A;  5F64 A;  3SZT A;  4I98 B;  2W57 A;  3R61 A;  2DQR A;  4FX0 A;  1ZG5 A;  3R0A A;  1UCR A;  1G3W A;  5CVR A;  3F21 A;  5ILV A;  4RAY A;  4M6Y A;  2XKO A;  4EJV A;  2K7L A;  2ESH A;  2QQ9 A;  1SAX A;  1EV7 A;  3TGN A;  1FC3 A;  2VE9 A;  5ILU A;  2V9V A;  2RC4 A;  1JE8 A;  3MZY A;  2CGP A;  3FXR A;  3I4P A;  1XDS A;  1P4W A;  3MCZ A;  3KFW X;  4I09 A;  3I71 A;  3V4G A;  4EVI A;  4EM1 A;  2QEN A;  1A04 A;  3GEZ A;  2KRF A;  5TJJ A;  1PP7 U;  4WK8 F;  3TOB A;  1O7F A;  1XDU A;  4M71 A;  3ZQ7 A;  2OD5 A;  3MEX A;  3WGI A;  1FPQ A;  2O03 A;  1T2K A;  5CJ9 A;  4ENK A;  3DV8 A;  4YFN F;  3FMQ A;  1RUN A;  2EA4 A;  1KGS A;  1F1Z A;  4IXA A;  3V8J A;  4HYE A;  3FX3 A;  4BHB A;  3LAJ A;  3FWE A;  3WTT C;  3F8B A;  2YX7 A;  2ELH A;  1WKM A;  2P6S A;  1OR7 A;  2OZU A;  3F8N A;  1AOY A;  1MJ9 A;  5JVT A;  4AIJ A;  4M73 A;  4EJO A;  1MDM A;  3AAF A;  1GVJ A;  2L02 A;  1JHF A;  2DU9 A;  3ELK A;  3K2Z A;  3H3U A;  3BY6 A;  1B9M A;  1ONV A;  2FBH A;  3FHZ A;  4WXD A;  1ZAR A;  2GXG A;  5FFZ A;  5HDG A;  4R1H A;  5DUI A;  2O61 A;  4BHC A;  1IXR C;  1QZY A;  1Z05 A;  4RGU A;  2UXN A;  3C1D A;  1MZB A;  1TNS A;  1F9N A;  2VE8 A;  4A12 A;  2WV0 A;  4GO1 A;  2VON A;  1YW8 A;  2AS5 F;  3GFI A;  4U7D A;  2R7D A;  2A07 F;  4I7H A;  3CUQ A;  3DP7 A;  4S04 A;  2XAQ A;  5HOO A;  4OIR F;  1P4A A;  5F6F A;  2NRA C;  1HKS A;  4HDV A;  5LBQ A;  2DTR A;  1H9G A;  5H6Q A;  5DD8 A;  4L9V A;  2P6T A;  2PMH A;  2PI0 A;  2O0Y A;  3KP4 A;  3HRS A;  1EH6 A;  1LDJ A;  5TRD A;  3GFM A;  1W7P B;  3HOT A;  4UHT A;  1T6S A;  2L01 A;  3R60 A;  1STZ A;  1IXS B;  1BIB A;  2MH9 A;  1LNW A;  1LDD A;  2F5F A;  3W6J B;  2GQQ A;  4IHS A;  2QQA A;  2DO7 A;  3G73 A;  3KLO A;  3V7S A;  3KP5 A;  4HW0 A;  4XSX F;  4BYY A;  3LAP A;  3F72 A;  5CVU A;  2PFB A;  1YO5 C;  5BOX A;  5BPI A;  1YFH A;  1I27 A;  3BZ6 A;  2CFX A;  3TO6 A;  3DKW A;  1J59 A;  3WGH A;  4RGX A;  4R79 A;  5FD6 A;  5KK1 A;  3Q5F A;  3IHU A;  4RS8 A;  5CVV A;  2BGC A;  3DPT A;  4GGG A;  1Y0U A;  1I5Z A;  1B1B A;  1B4A A;  3T8R A;  3ULQ B;  2VXZ A;  1ZH5 A;  2ZCW A;  4CXF A;  2Y0M A;  4BH9 A;  2JT1 A;  3V8L A;  1OMI A;  1QGP A;  5FD5 A;  2P5L C;  1FNN A;  3ML6 A;  5E1Z B;  3J80 K;  1TQM A;  3WTZ A;  1ZYR F;  4G6Q A;  3P7N A;  2KJB A;  1O57 A;  1BC8 C;  2HTS A;  3JTG A;  2OQR A;  2ZBK A;  1Z6T A;  3SXY A;  2A6E F;  2J5P A;  2M87 A;  1ULY A;  4JK1 X;  3I53 A;  2P5K A;  3WG9 A;  2LDU A;  4AWX B;  1MGT A;  1T98 A;  2PBI A;  1RIO H;  3L7W A;  2CW0 F;  1SFX A;  2V6C A;  3SFZ A;  4A2U A;  2HS5 A;  1BIA A;  1KA8 A;  1QZZ A;  3G3Z A;  1ZAO A;  4LG0 A;  2EK5 A;  5DYM A;  2YPR A;  1DUX C;  3FXQ A;  1XGM A;  4LFU A;  2FOK A;  4OIO F;  2BYV E;  2J5O A;  2A68 F;  1ODD A;  4HX4 A;  2ZME B;  3ZMU A;  2O8X A;  4GYI A;  1O3T A;  4CZZ A;  4Z2Y A;  3IRR A;  5HLI A;  4EJW A;  1YTY A;  3HSF A;  2ESN A;  5HS9 A;  2DK5 A;  1XMA A;  2P4W A;  1IW7 F;  1OYI A;  3GWZ A;  1W5T A;  3F8M A;  2Y75 A;  2ZNY A;  4BHP A;  1D3Y A;  2FXA A;  1FBU A;  4LLN A;  1ZGJ A;  3GVA A;  4WX9 A;  3F22 A;  4AD9 A;  4U0W A;  3HIF A;  3R4K A;  4WCG A;  1G3T A;  2VT2 A;  1IN5 A;  3RKW A;  2VT3 A;  2HYF A;  4B8X A;  1KU7 A;  2HKX A;  1HKT A;  2EJR A;  3KEO A;  2MC3 A;  3WTS C;  2D1H A;  3ABU A;  4I2O A;  2QWW A;  2K4J A;  1FWZ A;  3C7J A;  1XD7 A;  5FO5 A;  1QBJ A;  3MWM A;  3SHF A;  3GZ5 A;  4Y13 A;  3H92 A;  3ZMT A;  2GA2 A;  3F8C A;  2Z99 A;  3T5X A;  2IA1 A;  2COM A;  1W5S A;  2IP2 A;  4MHG A;  3TKY A;  1T38 A;  2RN7 A;  4GCV A;  3HHH A;  1P2F A;  4HDU A;  1J7K A;  5D5X B;  1KU3 A;  4AIH A;  1WQ2 A;  1BN5 A;  2B0L A;  5D6E A;  3GXO A;  4OMY A;  3CO7 C;  2D45 A;  2OA4 A;  1FBQ A;  3COA C;  4B09 A;  1RZ4 A;  2XIG A;  2QM3 A;  2GA1 A;  4XLP F;  1K6O A;  1CF7 B;  1YLF A;  2VC0 A;  4KYW A;  2W25 A;  1ZRD A;  2YR2 A;  4N9H A;  4OIQ F;  4A5M A;  2JSC A;  3BRO A;  1LEB A;  1R23 A;  4HAM A;  4WWC A;  4ENN A;  1BBY A;  5F1R A;  3RDI A;  2ISZ A;  2VBX A;  4ZH4 F;  1R00 A;  2EB7 A;  2HFH A;  3HRU A;  2XKP A;  1XN7 A;  2QUF A;  3JTH A;  4HX7 A;  1GHC A;  4RB0 A;  5K5O A;  3BJA A;  2IJL A;  2DPU A;  1TQI A;  1YG2 A;  4M6X A;  3WTW C;  2OBP A;  3IL2 A;  4K2E A;  1HSJ A;  2WTE A;  3VOD A;  5HDK A;  3HSR A;  2AXL A;  5K1Y A;  3IKT A;  1HW1 A;  2G7U A;  4PZJ A;  2YU3 A;  4YFK F;  2VOO A;  2IW5 A;  3LQR A;  3E6B A;  1S3J A;  5D4R A;  1B6A A;  4L9J A;  4O5V A;  1TLH B;  2V1U A;  2E1N A;  4YFX F;  2HWV A;  2MA3 A;  2UXX A;  3ZN0 A;  4IJA A;  4CGZ A;  3E6M A;  2M45 A;  4L5I A;  3J7A O;  1CF7 A;  4FT8 A;  1YW9 A;  4ZZL A;  3QP6 A;  4L9T A;  6PAX A;  4BXU A;  1LQ1 A;  3DPL C;  3GF2 A;  1MJA A;  2WWY A;  2UWM A;  2FBK A;  5L3G A;  2DPD A;  3I58 A;  4G6D A;  1TQP A;  1IZ1 A;  2JTV A;  2MLG A;  1J75 A;  2KKO A;  2ZO4 A;  1RUO A;  5LEJ A;  2FEZ A;  1UHM A;  1S7A A;  4UVA A;  1U78 A;  4KN4 X;  2H6C A;  3KE2 A;  4KUM A;  5D8L B;  1W4M A;  5CYV A;  4D0P A;  4IPA A;  1DP7 P;  2RGV A;  5DUK A;  2E7W A;  1R58 A;  4H0E A;  4HA8 A;  2RVC A;  5J6X A;  1ON1 A;  2G9W A;  3C3W A;  3B73 A;  1U5T B;  2RQP A;  4IRI A;  1XSX A;  4O3M A;  5BQT A;  2VBZ A;  3LA7 A;  1UST A;  5L3D A;  3E3V A;  1I1G A;  4HQE A;  2XAG A;  3KCC A;  2EA2 A;  3WE2 A;  5K5R A;  3VFZ A;  1T39 A;  1YQA A;  1FSH A;  3KP7 A;  2D1V A;  4AVP A;  4HLY A;  1VTN C;  4Q47 A;  4U7B A;  1U8R A;  3T1B A;  4HF2 A;  5ICF A;  1UHW A;  3V7R A;  1R1T A;  5CLS A;  3ECH A;  4WXH A;  4EQQ A;  4P55 A;  3RKX A;  2LNB A;  4EM2 A;  3VEP A;  4NQW A;  2P7V B;  3CUO A;  3FM3 A;  3ZMD A;  1XB4 A;  2Q2E A;  4LJZ F;  2DT5 A;  4PGG A;  3K69 A;  4L18 B;  2A5Y B;  3IWZ A;  3P9I A;  4MTE A;  4UVC A;  4P9U A;  5D5U B;  3J80 Z;  4RGR A;  1B9N A;  1CGP A;  3DFG A;  5HS8 A;  4N9I A;  4CHU A;  2RKH A;  3OOP A;  3SQN A;  4UNO A;  4CO8 A;  3M7G A;  3F8F A;  2CSO A;  2QQB A;  4BNC A;  4ENJ A;  1O7L A;  1D8J A;  2CQK A;  4U0V A;  4XBF A;  5HDN A;  2ZME A;  3IWF A;  2H27 A;  1IAW A;  4M9X A;  4I0A A;  3H3Z A;  2XAJ A;  1R36 A;  2PLY A;  3K1M A;  1IN6 A;  1XGS A;  1V4R A;  3RKY A;  1G3Y A;  2OZ6 A;  3GFL A;  2A3S A;  3RPU A;  3ZPL A;  2DQL A;  1BI0 A;  3HTS B;  2ZNZ A;  3K9T A;  3TDZ C;  3F23 A;  1R5H A;  5FB2 A;  3MAJ A;  3WOD F;  5IT3 A;  3HYI A;  4LGW A;  1ZRC A;  4HX8 A;  5L3C A;  2PJP A;  5LGN A;  4YII A;  1SMY F;  4RB2 C;  3KP6 A;  3QOP A;  3QRF F;  4CDG A;  3QAH A;  1ZG3 A;  5FLX K;  2EFO A;  3B02 A;  1RI7 A;  4LLG F;  2VN2 A;  5LHI A;  2A6H F;  2EV0 A;  2KIM A;  3ABT A;  1FT9 A;  2FRH A;  3Q9V A;  3K1P A;  1IXC A;  4A5N A;  3C18 A;  1FYL A;  4IRH A;  3FF5 A;  4CIC A;  1QPM A;  4MQ9 F;  4KIB A;  4WF2 A;  2ZXJ A;  1KYW A;  4P96 A;  5CVI A;  1XGO A;  4ZZD A;  3CUQ B;  2LF7 A;  2IT0 A;  2EV6 A;  4LK0 F;  1S8N A;  4EV0 A;  1LEA A;  5HLH A;  4P9F A;  1X3U A;  2FBI A;  4ASN A;  2YSR A;  3I64 A;  5DCM B;  3M8E A;  2G7H A;  1EH7 A;  1TNT A;  4RB3 C;  3GYH X;  1QQI A;  4O6J A;  4HBL A;  3ERE D;  1ZRF A;  2VBW A;  5LGU A;  3JSO A;  2F5C A;  2GZW A;  3J81 K;  2P5V A;  1ZGA A;  4HF0 A;  2Z33 A;  2ACJ A;  3CJN A;  3I5U A;  2HEO A;  5J8F A;  5L3B A;  2M8E A;  3N97 A;  1MDM B;  4MNU A;  3HUG A;  2O6G E;  3EQL F;  3ZMZ A;  3HHG A;  3MZH A;  3BPV A;  1GXQ A;  3REO A;  4IF4 A;  4ETS A;  2FMY A;  5BS6 A;  4KDP A;  1XCB A;  1K78 B;  5ERI A;  3SZP A;  3LST A;  2LKP A;  2MLK A;  5ICC A;  1FBS A;  3WTY C;  1FOK A;  2QZ8 A;  4A0X A;  1S6L A;  2STT A;  4KNY A;  3BP8 A;  5K5Q A;  3TOA A;  4DQ2 A;  1IUY A;  5FLX Z;  2QLZ A;  1W7P D;  1K7A A;  2JPB A;  3FZV A;  1SD7 A;  2L54 A;  1L3L A;  4KIF A;  4HV5 A;  3WU0 A;  1FP2 A;  1GXP A;  2HR3 A;  2Z9O A;  4L9N A;  2F2E A;  2L4M A;  2HKO A;  2KIU A;  5JR3 A;  1EH8 A;  4G8X A;  5LRS A;  2DBB A;  5H20 A;  2OQG A;  2M1B A;  3LWF A;  1XSD A;  2BV6 A;  1D5V A;  5JHU A;  2GXB A;  1B59 A;  2DK8 A;  2VC1 A;  2Z3Y A;  1WI9 A;  3BJO A;  3F6V A;  1HST A;  5BPD A;  5E17 F;  5HS7 A;  4A0Y A;  1XMK A;  1AWC A;  3ISP A;  1IN4 A;  3JAM K;  1K78 A;  4PGH A;  2NNN A;  2IA2 A;  3LA2 A;  3PFI A;  1HKQ A;  4FX4 A;  4G7Z F;  1J2X A;  1I6X A;  1BI3 A;  2H94 A;  1G4D A;  1WRJ A;  2F5D A;  4UV8 A;  4ENM A;  1E2X A;  5H6R A;  3BPX A;  3QP5 A;  4MEY F;  2HYG D;  4M9S A;  2VBY A;  3J81 Z;  1H9T A;  1LVA A;  3HOS A;  2OAZ A;  2IVM A;  2XVC A;  3Q9S A;  2C6Y A;  3D0S A;  4E70 A;  4ZYE A;  2MD5 A;  1YW7 A;  2M30 A;  3D5L A;  3EUH A;  4MEX F;  3L09 A;  2CO5 A;  4Y15 A;  4P5O A;  1OYW A;  1MKM A;  1DDN A;  5A2Q Z;  1Q1H A;  5FGM A;  1DPU A;  1SD6 A;  5DCF A;  4Q5S F;  3GW2 A;  1OKR A;  4ZYH A;  4KFC A;  4NHJ A;  1KU2 A;  4EGY A;  2MH2 A;  2O3F A;  1PUE E;  2FF4 A;  1ON2 A;  2A69 F;  4HOB A;  4S05 A;  4UXN A;  2DFI A;  5E18 F;  1ZHF A;  2W84 A;  4IRG A;  2TDX A;  5D4S A;  3W6K B;  3WTU C;  3JW4 A;  3M1E A;  2XGX A;  2QYO A;  4JBA A;  3ZMS A;  5DDG A;  1LJ9 A;  5D6F A;  1XCV A;  5EEG A;  1V3F A;  2F5E A;  4FHT A;  3TO9 A;  5E8I A;  1O3S A;  4EJU A;  2KJC A;  1TW2 A;  3WE3 A;  5IT9 Z;  4I02 A;  4A6E A;  3QPT A;  1REP C;  1P92 A;  2FU4 A;  3F3X A;  1FX7 A;  2NYX A;  5LHH A;  4OMZ A;  3BOQ A;  1UFM A;  1UB9 A;  1QO0 D;  2IPQ X;  4CYD A;  2HQN A;  3QPH A;  4XSZ F;  2JRT A;  4L0Y B;  5IT9 K;  3NRV A;  1FZP B;  3M8F A;  3EET A;  5ICG A;  2V79 A;  3ECO A;  3JSP A;  2DW4 A;  1IRG A;  2CYY A;  4Q48 A;  3P9K A;  2BBY A;  1KYZ A;  3GO5 A;  3KET A;  1K79 A;  3GUD A;  5E8G A;  1P4X A;  4KMF A;  4U0Y A;  3L9F A;  5L3F A;  4F7Z A;  1ZN2 A;  1TTY A;  2ADU A;  3FM5 A;  1JXS A;  3DXJ F;  5AIP A;  2Y48 A;  4MGR A;  1IF1 A;  1W7P A;  5D5V B;  2Q0O A;  3KZZ A;  2GIV A;  4LB6 B;  5ILS A;  3WTX C;  3CLO A;  1WSU A;  2Q8K A;  2HGC A;  4MTD A;  1OYY A;  2FNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...