1FYLA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head-to-head orientation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
85
Chain Sequence
RPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAD-TO-HEAD HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 23
structure length 85
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fylA00
2CYYA 3VOEA 3V7SA 2ZO4A 4IRGA 2E7XA 4ZYEA 4I0BA 4CGZA 2R7DA 1D8JA 1OYWA 1WWXA 2ZKZA 3I5UA 3EETA 1O7FA 1PDNC 4LFUA 3O3KA 4OIPF 2LNBA 5E8GA 5E8IA 2K02A 2XKOA 5K5RA 5LHGA 4WCGA 3GXOA 1U6GA 1TTYA 1S8NA 3EDPA 1KQ0A 1BOAA 1BBYA 3DPLC 4LLGF 1I5ZA 3PFIA 1XN7A 1J5YA 4DNCA 4R1HA 4UVBA 4MQ9F 3ERED 3CUQA 2XAFA 3IHUA 1U5TC 4EMSA 3V8JA 5D5UB 2ZBKA 5DCMA 3DPTA 2Y48A 1S29A 2H94A 5D6FA 3FMRA 2RGVA 3H92A 2CGPA 3RIRA 4BHCA 4XSZF 4IRHA 4WWCA 3RKYA 3FM3A 4QLCU 1XDUA 5HS7A 1WRJA 3B02A 4BH9A 3HTSB 1QPMA 3ZMVA 3FMSA 4LMYA 1IN5A 5TJJA 1O57A 4YFNF 2PLYA 2ISYA 4BYYA 1C0WA 2Q0OA 1KGSA 2A69F 3LSTA 2FU4A 3FX3A 2AXLA 3DEUA 3ECHA 1ZRFA 3JSOA 2IP2A 3WTYC 2L02A 1IN8A 2PFBA 3Q9SA 1XD7A 1O7LA 2KIFA 4ZYDA 1XMKA 4HQEA 2DU9A 4EM2A 1LJ9A 2B0LA 5ERIA 5L3FA 2VBXA 4M74A 4G7HF 3OV8A 2QQ9A 2ZJ2A 4IJAA 4LLNA 2K4BA 3MFKA 4GYGA 3I53A 3HRMA 3Q5FA 2ZNZA 2L4MA 1MJ9A 2P5VA 3O2PE 2PG4A 1U5TB 5E17F 2E1NA 1R7JA 1MGTA 1W5TA 5DEQA 3QOPA 1OYIA 2OU2A 2ESHA 3ZPLA 1ZG5A 2VN2A 3MAJA 1ZARA 4KN7X 4ENJA 1BIBA 1HW1A 3ZN1A 2K27A 5HLIA 4FX0A 2H6BA 5A2QZ 1FC3A 2YX7A 4OOIA 3TOAA 3F8MA 5AIQA 3CTAA 4GO1A 5IT9K 4EM0B 2W24A 1IN6A 2WV0A 3KZYA 2RQPA 4LG0A 5D8LB 2P5LC 3WE2A 4ESJA 2MLKA 3QU6A 1WKMA 3H3UA 2WTEA 4LK0F 4U7DA 2X0LA 5D4SA 3J7AO 2C6YA 2FMLA 2P4WA 3S2WA 2BEOA 2FMYA 3N97A 4HBLA 1OMIA 4XLNF 2MBFA 4U0YA 2E1CA 1JHHA 1SD7A 5D4RA 4JK1X 3LA3A 1ZLKA 1K78A 4L9VA 3GFJA 2K4JA 2XIGA 5HOOA 2KJBA 3TKYA 4HDUA 2Z99A 3D5LA 2EFNA 4ZZLA 4LB5A 2YU3A 5HDGA 3V7CA 4RS8A 3L2CA 2O8XA 1E17A 2P7VB 1QQIA 3T5XA 1ON2A 3WTWC 2FA5A 5D5XB 1U78A 2KIMA 4AVPA 1B1BA 1H9TA 4EJTA 5DCFA 3G73A 1HSTA 4FT8A 4TV7A 3JTHA 3QU3A 2A07F 4LGWA 2A68F 1FBSA 2V1DA 3V8KA 2ELHA 1EH7A 2RDPA 5BS6A 3R0AA 5D6EA 4AIKA 3BY6A 1ULYA 2PN6A 2DT5A 3E3VA 4ENNA 3GWZA 1I1SA 5FLXZ 3E5UA 2RN7A 2LF7A 4LK1F 1YW9A 4M72A 1FYKA 2ACJA 2DQRA 2QYOA 2ETHA 1ONVA 3HIFA 4NQWA 1IXCA 5FB2A 4B09A 4A5MA 4PZJA 4PDKA 1S3JA 3COAC 3ZN0A 1Z9CA 4UV8A 4CICA 1R22A 5E18F 2FXAA 1USTA 4CDGA 4RB3C 4FX4A 1O3SA 3L9FA 3F3XA 3M9AA 4FHTA 2L01A 1PUEE 2VC0A 3MZHA 3U2RA 3F8BA 3TQNA 2DBBA 3BP8A 3LFKA 2PI0A 2H27A 3WU0A 4R79A 3CJNA 3E5QA 2XUBA 1T39A 2XAQA 5FD6A 3QP5A 5CVVA 3I58A 5HS8A 2G7HA 2DO7A 2VBYA 2FSWA 2H6CA 4A0ZA 5J8FA 3AAFA 1DDNA 1U3EM 3WODF 1Z05A 4XBFA 2OQRA 2Y75A 5TRDA 5A2QK 1ZH5A 3F6VA 5L3GA 3MCZA 4BXUA 3NQOA 5FGMA 3ABUA 4OIRF 1IUYA 2CWEA 2E7WA 4RAYA 3DF8A 4L9NA 1G4DA 1IRGA 4HV6A 3KEQA 2HGCA 1FOKA 4Q48A 3FF5A 1HW5A 1XGNA 5L3DA 2XKPA 4F7ZA 3KZZA 2FBKA 1FY7A 1EH8A 2O3FA 4EM1A 3ULQB 4M71A 5BOXA 3K1MA 2HKXA 5CVIA 3GYHX 5FFXA 2HEOA 5H20A 3LAPA 3VFZA 3RTRA 2DTRA 1MDMA 2FNAA 3BJAA 5LRSA 5J8CA 5JVTA 3FXUA 3KLOA 3BROA 4KMUX 1K6OA 4DQ2A 4L9JA 3C7JA 3R4KA 1R36A 2X4HA 2FQ3A 2CW0F 1FLIA 2HQRA 3T8TA 1A04A 4WXDA 2NRAC 3QP6A 3RYPA 4OIOF 1R1TA 3FWEA 1IW7F 1BJAA 4Z2YA 1FSEA 2IW5A 2K86A 1SD4A 2HQNA 3WTTC 1J9IA 2IVMA 2MA3A 2BE5F 3GUDA 1JE8A 2GXGA 4HF1A 5FLXK 3WTUC 1XSXA 4GGGA 4D0PA 2EA2A 1P4WA 1YW7A 1LQ1A 1TQIA 1XCBA 4HX8A 3F22A 2XHKA 2NAZA 2FNPA 5BPIA 1Z6TA 1HSJA 1R1UA 1LDKB 1R00A 4K2EA 2UXNA 4HQMA 1SFXA 4XSXF 4OU0A 1FZPB 2D1VA 2STWA 1FT9A 3RI4A 1KA8A 4Y17A 2VE9A 1GXPA 4R8HA 2EV5A 3BWGA 2ZMEA 1XGSA 4HF0A 3KP3A 3WE3A 1MJBA 3K1PA 1U2WA 2EWNA 1IXRC 2O03A 4WK8F 3SFZA 2LKPA 4L0ZB 4CYDA 2P7CB 3HOSA 2JSCA 4I2OA 3TDUC 5HDNA 3M7GA 1P92A 1HQCA 3L7WA 3IKVA 1ZREA 2BYVE 1XGOA 4M73A 2D2WA 4EV0A 2EFWA 1J0RA 1UHWA 2XVCA 3HYIA 2DFIA 3VB2A 3LQQA 4O5VA 1OPCA 1RI7A 2IA1A 3CUQC 4S05A 2HR3A 1G3TA 1SMTA 1ON1A 1JHFA 2V6CA 3WGGA 2BBYA 4HA8A 3W6KB 2MH2A 3P9IA 4ENMA 1LB2A 4ASNA 1RNLA 1Y0UA 2VE8A 2MLGA 4RGSA 2D1HA 4P55A 1Z91A 1T2KA 3TO6A 1QO0D 3DXJF 1PP7U 2BGCA 2DLLA 4XLPF 1OYYA 1IRFA 2RV8A 4P9UA 1IAWA 4M9ZA 3U9GA 4MQVA 1MD0A 1NHAA 3E97A 3ELKA 1JXSA 1U8RA 2FRHA 4HDVA 4EVIA 1J2XA 2IA2A 2YPRA 1GVJA 2BV6A 3K9TA 4Q4ZF 3WTSC 5CLSA 4RGRA 4UV9A 3FXQA 2W57A 1IXSB 4U0WA 1OKRA 1T38A 1MZBA 5CVJA 1KU7A 3E6BA 4E70A 4KFCA 4ZZDA 2GA2A 1KYWA 3F6OA 2GXBA 2VOOA 1EH6A 2EV0A 2NYXA 2JTVA 3BPXA 4YIFA 3R6SA 5DD4A 4JQFA 3K1NA 3DP7A 3MQ0A 4AD9A 1XSVA 5KK1A 3JTGA 3BPVA 3I0TA 1IN4A 3F8NA 5DUIA 3D0SA 4LD5A 2GAUA 5DD8A 1XDSA 3BOQA 4N9HA 4YFXF 3CUQB 1AWCA 1Z7UA 1FBQA 4UVAA 2F5DA 5DCMB 3KP5A 2QQBA 3CO7C 2L54A 3HOTA 1FWZA 4YFKF 1LDDA 2M30A 5E1ZB 1ODDA 4UVCA 2HTJA 2GIVA 4RGUA 5H6RA 5F1RA 1BM9A 1FX7A 1B9MA 3CDHA 5CJ9A 3P9KA 4YIIA 4N0BA 4OMZA 1BN5A 3HSRA 1F1ZA 2FEZA 1W5SA 2HWVA 4U7BA 1YTYA 2TDXA 3WGIA 3K2ZA 4KNYA 4WX9A 3JW4A 3KLNA 2JRTA 4N9IA 4HLXA 1USSA 1YIOA 1ZRDA 1SFUA 1SFEA 3WU1B 3ML6A 1XSDA 1YS7A 3K0LA 4RAZA 4I0AA 1P2FA 1SD5A 1BI2A 1HXDA 1JGSA 5BMZA 3L09A 2RC4A 4L9TA 4MNUA 2FBHA 1LVAA 2F5EA 3DV8A 2G7UA 2HYGD 2O0YA 1TW2A 3ISPA 1FP1D 1YG2A 3HTUA 2HYFA 1STZA 1ZGJA 3JSPA 1KU9A 2HTSA 3BDDA 2Z33A 5IT3A 4AIJA 4ENKA 5EEHA 3FXRA 5LGTA 4RGXA 1UB9A 2GQQA 3U1DA 2KKOA 4EJVA 1WSUA 4Y15A 3GFMA 4OINF 1LEBA 2VODA 2WWYA 3GO5A 5LRRA 3SZTA 5JR3A 1F5TA 2OAZA 1D5VA 4JBAA 3MZYA 4M6XA 2EFPA 4B8XA 2UZKA 3DFGA 1H9GA 4G6DA 3SHFA 1XGMA 2EJRA 2Q8KA 1BI3A 3T8RA 1I6XA 1KYZA 2XASA 5K5OA 4RB2C 3TDZC 1ZRCA 2P5KA 5HVQC 2IT0A 4A6EA 4LG0B 3IWFA 2AS5F 2VONA 1F9NA 3MEXA 5FFZA 3IKTA 4M9XA 3HHGA 3BJOA 2DK8A 2Q2EA 3W6JB 4Q5SF 3WTXC 2YX4A 3MWMA 1J75A 5HLGA 1KQ9A 3WG9A 1G3WA 2O61A 5DYMA 2ESNA 4LLLA 1P4AA 5LBQA 4KIGA 1K78B 1ZG1A 1HBXG 2P6SA 2IPQX 2IJLA 5D5VB 3I64A 4L18B 1UCRA 1SAXA 1ZN2A 3M8FA 2IA0A 5LHHA 1IZ1A 4I98B 3F21A 2QBYA 1FYLA 2PBIA 3RPQA 3TOBA 3H3ZA 3I59A 5HDKA 2DI3A 5ILUA 1QNTA 2RKHA 4A6DA 5FD5A 2W25A 2XRNA 2YSRA 1WI9A 4HX4A 1V4RA 2HZTA 2MC3A 5LGUA 4G8XA 3BJ6A 3J81Z 1UHMA 1YQAA 3ZP5A 2UWMA 4OMYA 2M45A 4ZH4F 2M8EA 4P9FA 1TNSA 2ZFWA 4ZYGA 3R61A 1D8KA 4H0EA 4IPAA 2OQGA 3JAMZ 2QENA 2YR2A 3QAHA 4U0VA 4A0XA 2JPCA 4P96A 1J7KA 1YW8A 4PGGA 2DPUA 2OA4A 1B9NA 3E6MA 2FE3A 2W84A 4ON0A 2QQAA 3ZQ7A 3I54A 4CHUA 4CXFA 2CO5A 1HKSA 3RKXA 5ILVA 2R7FA 4HF2A 1ZHFA 1TQMA 5AIPA 5E1WA 3SZPA 1BC8C 2FBIA 3I4PA 1UFMA 4PCQA 1R5HA 4MTDA 2ADUA 3F72A 3G3ZA 2Z3YA 2CFXA 1PP8F 2ZCWA 1HKTA 4I02A 1AOYA 2LDUA 3QPTA 1W7PA 2OZ6A 4I7HA 2CQKA 4BQAA 2V1XA 2L4AA 4I01A 1QZYA 4BNCA 1IN7A 3K69A 2DQLA 3HRSA 3CO6C 1R58A 2J5PA 2P6TA 2P8TA 3QRFF 1FPQA 3BZ6A 2EB7A 3ECOA 5K1YA 3SQNA 1FBUA 3J80Z 3IRQA 2GZWA 4WXCA 4IHTA 1S7OA 2GA1A 3I71A 4RB0A 2QWWA 3Q9VA 5IT9Z 2JPBA 5J6XA 2EFQA 4KIBA 4S04A 5LEKA 4EJUA 2MH9A 5ILSA 2DPDA 2LSOA 2HDCA 3GZ6A 2IRFG 1MDMB 4IRIA 1KU2A 4UUVA 3GW2A 1XCVA 3GLXA 3KFWX 3WTVC 3EUHA 3NEUA 1U5TA 5D8KB 3WTZA 5LGNA 3FMQA 1I1GA 4NB5A 3RYRA 5H6QA 4HOBA 4A0YA 3LQRA 2EK5A 2WC2A 4ZYHA 3C3WA 4KMFA 1Q1HA 1BC7C 4EJWA 3PQKA 3CUOA 3FM5A 2EA4A 3J81K 2M5WA 1TLHB 2GWRA 4G6QA 3ZMTA 4HYEA 2V1UA 6PAXA 1P4XA 1L0OC 3JAMK 1J59A 1ZGAA 5LLQA 1W7PB 2HS5A 2OBPA 1S6LA 5ICCA 1GHCA 4ESBA 5K5QA 2KJCA 1RUNA 4MTEA 1W4MA 1O3TA 4WF2A 3EQLF 3KP7A 1ZYRF 3LAJA 4OIQF 1YYVA 5KVRA 4A5NA 2VC1A 2A6HF 1LNWA 2ZMEB 2Z9OA 1HKQA 3O6BB 5L3BA 3V8LA 2JZYA 1IF1A 1W7PD 2ISZA 2DAOA 4O3MA 2CG4A 4EGZA 1FSHA 2F2EA 1L3LA 1DP7P 4KUMA 1SD6A 4KA4A 2OZUA 5BQTA 3RJPA 4P5OA 2HFHA 4RB1A 5JHUA 2VBWA 2OD5A 3REOA 3T0YA 1O3RA 3KP6A 2W85A 2Y0MA 4EGYA 4M9SA 5CVRA 3WGHA 3ZMZA 1T6SA 3ZMUA 3ZMDA 1O3QA 3N4MA 4HV5A 3TGNA 2A6EF 1I27A 4QWQA 4EJOA 3J80K 4HX7A 4G7ZF 4GYIA 2ZXJA 5HLHA 2QLZA 4L0YB 3F8FA 1RUOA 1T98A 1RZ4A 3IWZA 1EV7A 1XMAA 1CGPA 5EEGA 5JI6A 4IVNA 2FOKA 2D45A 4M6YA 2QZ8A 2F5FA 5LHIA 1DUXC 4GXOA 1BI1A 3HUGA 2PQ8A 1SMYF 2XAGA 3VODA 1QGPA 2XV4S 2Z5UA 3KE2A 4AWXB 5CVUA 2ZNYA 2L3DA 1P6RA 3SXYA 4KYWA 2A3SA 1B4AA 1ZG3A 2LF8A 2A5YB 4MEYF 3L00A 4MHGA 3LWFA 1WQ2A 4ETSA 3P9CA 1FP2A 4BHPA 3LA7A 5AONA 3KP4A 2EV6A 4UHTA 5DV5A 3V4GA 3LA2A 4GCVA 2JT1A 3GX4X 3DKWA 2H09A 4KDPA 3OOPA 3HRUA 3R60A 2PEXA 5ED4A 2J5OA 2DK5A 1QZZA 4A2UA 4Q47A 3PQJA 1BI0A 1OR7A 1CF7A 1ZAOA 5ICGA 2XGXA 3HSFA 3GFLA 1X3UA 1K79A 1B59A 3TO7A 3RDIA 2XAHA 2NNNA 4WXHA 1TBXA 3P7NA 5E1XA 3VEPA 4CZZA 3GEZA 5FO5A 3IRRA 4I09A 5HS9A 3ZMSA 3E5XA 1S7AA 4IF4A 3E6CC 1D3YA 1DPUA 3KEOA 3M8EA 1KU3A 2F5CA 1B6AA 4ESFA 3GF2A 4LB6B 3EYYA 4G9YA 3KCCA 1H0MA 2EFOA 5CYVA 2COMA 1G6NA 1FNNA 4O6JA 3R0JA 2PJPA 3ROUA 2XAJA 3E6DA 2RVCA 4IHSA 2QVOA 4HAMA 4G7OF 4MEXF 2STTA 5E20A 5F6FA 1R23A 2V9VA 3FZVA 1YO5C 1R5GA 3C18A 4BAYA 3B73A 1V3FA 5BPDA 4NHJA 1DPRA 4YG2F 2FF4A 3IC7A 1HW2A 4L5IA 3RPUA 4BHBA 2MD5A 3FHZA 2QUFA 5F64A 5DDGA 5JFRA 2M1BA 3V7RA 4PGHA 5D5WB 3C1DA 2VT3A 4Y13A 4UNOA 2M87A 4UXNA 3T1BA 1MJAA 2O6GE 4KT5C 3IL2A 3CLOA 1Z6RA 1FYMA 1RIOH 1G3YA 4KN4X 1R1VA 2R3SA 1CF7B 2VBZA 3HHHA 2DW4A 4U88A 1QBJA 3F23A 2NS0A 2KRFA 2VXZA 5DUKA 2RNJA 5LEJA 2VOPA 1Z1DA 3F8CA 1YFHA 3KETA 1REPC 1G3SA 3QPHA 1ZLJA 2XROA 2A61A 1YLFA 2UXXA 4HZFA 4KICA 1TW3A 2NNYA 1XB4A 1VTNC 1T0FA 1K7AA 1MKMA 3ABTA 2V79A 3GZ5A 1LEAA 2PMUA 2QM3A 4AIHA 1GXQA 4G94A 3RKWA 2PMHA 2VT2A 4CO8A 4MGRA 3HRTA 5L3CA 4L5JA 5L3EA 2KIUA 2HKOA 4EQQA 3NRVA 4HLYA 2CSOA 3EYIA 2HOEA 2QBYB 1LDJA 3I59B 1TNTA 4IXAA 4KIFA 4XRFA 1BIAA 4A12A 3DQVC 3GVAA 1KQ8A 3M1EA 1TQPA 4LJZF 2K7LA 5ICFA 2G9WA 3GFIA 1F4KA 3HSEA 1YS6A 5ICEA 4HW0A 1E2XA 3TO9A 3KP2A
chains in the Genus database with same CATH superfamily
2CYYA 3VOEA 4A3FJ 3V7SA 1TWHJ 2ZO4A 4IRGA 3HG9A 4E7IA 2XPWA 2E7XA 4ZYEA 3BR5A 1OQYA 4I0BA 3OS1A 3L2WA 4CGZA 2R7DA 1D8JA 1OYWA 1WWXA 2ZKZA 4XN3A 3I5UA 3IP4B 3EETA 2YS9A 3RPUD 1O7FA 4E6KG 2R4GA 1PDNC 2V9PA 2K5CA 4Y33A 4LFUA 3O3KA 3CF5F 4OIPF 2LNBA 4D7MA 2KISA 2HVSA 3GBGA 5E8GA 5E8IA 3S17J 2XF5A 2K02A 2R7SA 5GAEJ 2XKOA 4HSRA 5K5RA 1YE9A 5LHGA 3K4LA 4C3HJ 3N05A 4WCGA 2JVHA 3GXOA 1U6GA 1TTYA 1S8NA 5IP9J 3EDPA 1B72B 3G2BA 4LG3A 1KQ0A 3HGGA 3DTIA 4X1EA 1BOAA 1BBYA 3DPLC 4LLGF 1I5ZA 3VYRB 2DYSH 3LOCA 3PFIA 4XLEA 1HLVA 1XN7A 2M4KA 2MABA 4S0HB 3BT9A 1J5YA 4DNCA 2VQGA 4R1HA 2QA4I 4UVBA 4MQ9F 3ERED 3CUQA 3IH3A 3EUHC 1VQPI 2XAFA 3HOUJ 5JVGF 3IHUA 3B6CA 2W4SA 1U5TC 3LL7A 4EMSA 3FK6A 3V8JA 2LY9A 2QSHX 1VQ7I 5D5UB 2R7OA 1IG7A 2ZBKA 4BGDA 3M8JA 5DCMA 3TEDA 2P0WA 1LVKA 1X1DA 3DPTA 2Y48A 1HA8A 1S29A 1VQOI 2H94A 4IEJA 5D6FA 3FMRA 1X1CA 2RGVA 3H92A 3W2WA 2HPMA 2CGPA 1DU6A 2VIXA 3RIRA 1P9QC 1KONA 2CQXA 2CUJA 4XLFA 4BHCA 4XSZF 4FISA 3H1CA 1BR1A 1XPXA 1IRZA 1WGXA 4IRHA 3IH4A 2HVQA 2QF7A 1UZCA 2CQNA 2DA1A 3Q0UA 5FKMA 2BY2A 3OOUA 4WWCA 3S1RJ 1RKWA 5J4VA 3RKYA 3FM3A 4QLCU 5IP7J 1XDUA 5HS7A 1WRJA 1H8AC 3CCUI 1ZELA 4KJZA 3B02A 1D5YA 4BH9A 3HTSB 2A5WA 2H8RA 1QPMA 1YOVB 4NC8A 3ZMVA 1BOBA 3G1OA 3FMSA 4LMYA 1IN5A 2VPRA 3GTJJ 1FIAA 3K2AA 5TJJA 4CCKA 1O57A 5IYBJ 1MH3A 4YFNF 2PLYA 4BJ5C 2EZIA 4HNTA 1YJ9I 1SVOA 1DQUA 3HPGA 4QTRA 4BBSJ 2ISYA 4BYYA 1C0WA 2Q0OA 3S16J 1FIPA 2CJJA 1KGSA 5GAHJ 2A69F 2F6CA 2VB6A 3LSTA 3LSIA 2FU4A 3LSHA 2EINH 3FX3A 5GP9A 1PJRA 1HDDC 2AXLA 2OCCH 3DEUA 3TW6A 1YI2I 2R7XA 4W97A 3ECHA 1WHUA 1ZRFA 3CC7I 3JSOA 2IP2A 3WTYC 1JT6A 4A3KJ 2L02A 1IN8A 2PFBA 3Q9SA 3OY9A 3OYHA 1XD7A 1O7LA 2HNHA 2KIFA 4AU7A 4XKVA 4ZYDA 1XMKA 3BTCA 4HQEA 2DU9A 4XR6A 1X2NA 4EM2A 4JX5A 4HSTA 1LJ9A 2GIZA 2B0LA 5ERIA 5L3FA 2VBXA 4M74A 2LKSA 4G7HF 1JJ6C 3OV8A 4E7SA 9ANTA 2DJNA 2QQ9A 2YUSA 3LFUA 2ZJ2A 4IJAA 4E7KA 3KYLA 4LLNA 2K4BA 3MFKA 4GYGA 1T95A 3I53A 2E19A 3HRMA 3Q5FA 2ZNZA 2L4MA 1MJ9A 2HXIA 2BW3A 2P5VA 3O2PE 3QOEA 1GUUA 2PG4A 1U5TB 3JRFA 5E17F 2E1NA 2VASA 1R7JA 3RQ4A 3LSPA 3H3VK 1U9OA 1MGTA 1W5TA 1EF4A 2WAQA 4PFOA 1RRJA 5DEQA 3QOPA 1YX5A 3CCEI 1OYIA 2OU2A 2ESHA 3ZPLA 3ZQHA 1YRNB 1ZG5A 1X3WB 2VN2A 2GLOA 3VSKA 3ASNH 3CDIA 4M3GA 1OCTC 3MAJA 1ZARA 3H9JA 3I9V2 4KN7X 2KDOA 4ZDOA 4D7NA 2HPIA 4ENJA 1BIBA 1HW1A 5DM6F 3ZN1A 4PFPA 1VZ0A 4J01A 2K27A 4XMYA 1TC3C 4BQOA 5HLIA 4FX0A 2H6BA 4A69C 1D1AA 5A2QZ 1FC3A 2YX7A 4OOIA 3TOAA 3F8MA 2DDBA 5AIQA 5BNGA 3GLLA 1WJEA 3CTAA 3FXOA 4GO1A 5IT9K 1Y1WJ 1D1BA 1ETKA 4EM0B 4ZYAA 2W24A 1IN6A 2WV0A 3KZYA 3S3OA 2RQPA 4LG0A 3ZGKA 5D8LB 2P5LC 3WE2A 4ESJA 2MLKA 2WV1A 3QU6A 3RQIA 4XONA 3VDXA 1WKMA 4CYCA 3H3UA 2OTLI 2WTEA 1B8IA 5F27A 4RDUA 4LK0F 4U7DA 2Z16A 2X0LA 5D4SA 2KDZA 1SC7A 2XPVA 3J7AO 2C6YA 2FMLA 4XICA 2P4WA 2EIKH 3S2WA 2KT0A 2BEOA 2BY1A 2FMYA 1UMQA 2DDAA 2E36A 2LBFA 5LD2C 3N97A 3FXKA 5KNLA 4HBLA 1OMIA 4XLNF 3ZRGA 2MBFA 1ZKGA 1TT0A 4U0YA 2E1CA 1JHHA 3AG4H 1SD7A 5D4RA 5C4XJ 3DTKA 4JK1X 3LA3A 1ZLKA 3PIPF 1K78A 3MN2A 2K9MA 4L9VA 3GFJA 2XGCA 2K4JA 2XIGA 4UUTA 4NBQA 5HOOA 2KJBA 3TKYA 4ZDPA 4HDUA 2Z99A 3D5LA 1VQNI 3QPSA 1UG2A 2EFNA 2VJ5A 4ZZLA 1OLTA 4I6ZA 4LB5A 2ZXIA 2YU3A 5HDGA 5CQEA 4AYBN 3V7CA 2R93J 4RS8A 3L2CA 1G8XA 2OUMA 2EZKA 1POGA 2DMTA 2O8XA 1E17A 2KP6A 1OISA 2CFOA 2P7VB 1QQIA 3T5XA 3CCYA 1ON2A 3K6GA 3TMOA 5EGOA 3WTWC 2FA5A 5D5XB 4DBQA 1LE8B 1I3QJ 1U78A 2KIMA 2MG4A 4AVPA 1B1BA 1H9TA 1DP3A 4EJTA 4NC7A 5DCFA 1HSTA 2WB1N 3G73A 2HYJA 3EUKL 1JKOC 1X4PA 1YJNI 4FT8A 1T56A 4HRIA 3A02A 2IGNA 4TV7A 1A6IA 1LUJB 3JTHA 2BW3B 2E60A 3QU3A 1ZR4A 2A07F 2HOSA 4LGWA 2A68F 1FBSA 2F48A 2V1DA 5J47A 1VF9A 3V8KA 1JI8A 3OR2C 3I56I 2ELHA 1EH7A 2RDPA 5BS6A 2JA5J 1SVLA 3R0AA 4BEHB 1OR7C 2HQAA 2QKLB 5D6EA 4AIKA 3BY6A 1ULYA 5FKNA 2PN6A 4A3IJ 5H2FC 2VJIA 2DT5A 3E3VA 4ENNA 3GWZA 1I1SA 5FLXZ 3CJQB 3E5UA 4BXXJ 2RN7A 3OYBA 2LF7A 1MNDA 5FRNA 4LK1F 1YW9A 4M72A 1FYKA 2ACJA 3WU2C 2DQRA 2JJ7A 4MO7A 3K4MA 2ME0A 2QYOA 2ETHA 3DLAA 4ZTFA 1ONVA 5IY5H 3BTJA 2W1OA 3HIFA 4BU2A 4NQWA 4A3DJ 4KITB 1IXCA 5FB2A 4CZCA 4B09A 4A5MA 5FKKA 4PZJA 1BJZA 3ONQA 4PDKA 1S3JA 3COAC 1MIJA 4V2GA 3ZN0A 3H0DA 1Z9CA 4UV8A 2EIMH 1FOXA 4CICA 1R22A 5E18F 2FXAA 1USTA 4CDGA 4RB3C 4FX4A 1O3SA 1ETQA 3L9FA 2PMZN 3HUGB 3F3XA 3M9AA 3FISA 1JT0A 2VKVA 4FHTA 2L01A 2VJ4A 1PUEE 2VC0A 3A01A 3MZHA 3U2RA 3F8BA 3TQNA 2WAEA 2DBBA 3BP8A 3LFKA 1EKEA 2PI0A 4MIMA 3WU0A 2H27A 2K3FA 4R79A 3CJNA 1LFUP 1X4OA 3E5QA 2XUBA 2LK2A 1T39A 2XAQA 5CKTA 5FD6A 1AA7A 3BTIA 3QP5A 3ZQGA 4NDLA 5CVVA 3I58A 5HS8A 2G7HA 2K9SA 4LIVA 2L2OA 2VKHA 2DO7A 3ZXSA 2VBYA 2XAUA 4BE2A 2FSWA 2H6CA 4A0ZA 5CPRB 3CD6I 5J8FA 1DGRM 3AAFA 1DDNA 2FUG2 2H1KA 1U3EM 3WODF 1Z05A 1WJBA 1YIJI 4XBFA 2OQRA 2Y75A 4ZC3A 5TRDA 5A2QK 4Y4RA 5EGOB 3F6VA 1ZH5A 5L3GA 3MCZA 3WHBA 4BXUA 4J00A 3NQOA 3PSFA 5FGMA 5GAGJ 3ABUA 1A36A 4DOZA 4OIRF 2E1OA 1IUYA 2L0KA 3I55I 3UR3C 3S3NA 2K40A 2CWEA 2E7WA 4RAYA 3DF8A 4L9NA 1OCPA 1G4DA 4A3LJ 3CC4I 3LSKA 1D0YA 4NNJA 1IRGA 2DMPA 4HV6A 3KEQA 2HGCA 2XGDA 4Q48A 1FOKA 3FF5A 1QZEA 3IUOA 2R7RA 1XS9A 3OSGA 1HW5A 1XGNA 5L3DA 2XKPA 3LMMA 2IS6A 4F7ZA 3KZZA 2FBKA 1FY7A 1EH8A 2O3FA 3DBHB 4EM1A 1RKTA 3ULQB 4M71A 5BOXA 3K1MA 2HKXA 1JJ8C 5CVIA 3GYHX 5FFXA 1AHDP 1FOWA 2HEOA 3H35A 1IV6A 5H20A 1R4MB 1YX3A 3LAPA 3H36A 2RNGA 2E5ZA 3BTLA 2E35A 1YHQI 2NXNB 3VFZA 3NWSA 3U21A 3HB9A 4PJJA 3RTRA 2DTRA 1MDMA 2FNAA 1IGNA 3BJAA 2ELJA 1A5JA 4PUSA 2BY0A 1T33A 4PJLA 1BL0A 5LRSA 5J8CA 5JVTA 3FXUA 2FQ4A 3KLOA 3BROA 4N4NB 5F0CA 4KMUX 1QA6A 2DJIA 5J1UA 5J3LA 4MFDA 3CC2I 1K6OA 4DQ2A 4L9JA 5FLMJ 4IHXA 5LFAA 2ZJRF 2E2JJ 1D0XA 3C7JA 3R4KA 1R36A 1T0FC 2X4HA 2FQ3A 2CW0F 3K4JA 2L7KA 4BJTA 2VXDA 1FLIA 2OCEA 4DYQA 2HQRA 3T8TA 1A04A 1H89C 4WXDA 4GFBA 1NTCA 1GVDA 2NRAC 3QP6A 4AVZA 2TCTA 3RYPA 2Q1ZB 4DGWB 2ZFUA 4OIOF 1R1TA 4BY7J 2GOMA 3FWEA 1IW7F 1BJAA 2LFBA 3I4NJ 3M1CA 1FSEA 2IW5A 4Z2YA 2K86A 4P1WA 1SD4A 3K7AJ 2HQNA 3ZQIA 3OIPA 2DA2A 3WTTC 1J9IA 2VL8A 2IVMA 4PJ0C 2MA3A 2HI3A 2BE5F 1O4XA 3GUDA 1HDPA 1JE8A 3ZQCA 2GXGA 2K9NA 4B3AA 4HF1A 5FLXK 1H88C 3WTUC 5FKOA 3BQZA 4GDFA 4BBRJ 2E5NA 4IL6C 2R5ZA 5IYDJ 1XSXA 4GGGA 4XN0A 3BR1A 4D0PA 2EA2A 2H1LA 5M5XJ 1A6QA 4BL0B 2CW7A 3DU5A 2LP0A 2V4JC 1MMAA 3PL8A 1P4WA 1YW7A 3CCVI 1TQIA 1XCBA 1LQ1A 4HX8A 3ABLH 4UB8C 3F22A 5KCMA 2XHKA 1K61A 2NAZA 2FNPA 3CLQA 1OJLA 4DBRA 3B6AA 5BPIA 1Z6TA 3H5RA 1HSJA 1R1UA 1AKHA 1LDKB 1R00A 2BZTA 2MSYA 4K2EA 4QPOA 1K4SA 4X6AJ 2O5RA 3OR1C 3K70C 2UXNA 4HQMA 1SFXA 2BVMA 4XSXF 4OU0A 1FZPB 1D0ZA 2D1VA 1S5LC 2VKEA 3OIQA 3VWBA 2STWA 4XLHA 1FT9A 3KZIC 2H8WA 1ETVA 3RI4A 1KA8A 4Y17A 2VE9A 1GXPA 4R8HA 2EV5A 2VQHA 1BW5A 3BWGA 2ZMEA 1XGSA 2Y30A 4ITVA 2DMUA 4HF0A 3KP3A 3WE3A 1A35A 4D5CA 1MJBA 3TL4X 3K1PA 1X58A 1S9HA 2R5YA 1U2WA 2EWNA 3VYSB 1IXRC 2O03A 3OWTA 2F5VA 3E7LA 4XOPA 4WK8F 3SFZA 2LKPA 4L0ZB 3IAS2 2NVYJ 2LLKA 4CYDA 1ERDA 2P7CB 2AQEA 3HOSA 4BDZA 1A31A 3FHNA 1TWFJ 2BVLA 5IPAA 1TWAJ 2JN6A 1P7JA 2JSCA 4I2OA 2Y9YA 3TDUC 3G6EI 5HDNA 3M7GA 3S2HJ 1SVMA 2L9SA 3W2VA 3SEQA 1P92A 1HQCA 3L7WA 2LRDA 3IKVA 3FKIJ 1ZREA 5IOZA 2V1NA 2BYVE 2M9HA 2BHZA 3AG3H 2Y69H 2ECCA 1XGOA 3PNTA 4M73A 1R9TJ 4IHYA 1JUMA 2D2WA 3DCFA 3S2DJ 4EV0A 2EFWA 1J0RA 1UHWA 2XVCA 3HYIA 2DFIA 5FLVA 2Y0SN 3S15J 3VB2A 3D5RC 3LQQA 1OPCA 4O5VA 1Z77A 5EG0B 1RI7A 2IA1A 2E34A 3CUQC 4D9JA 3GTKJ 4S05A 1VI0A 1XMXA 2HR3A 2VI6A 1SMTA 1G3TA 1ON1A 1Z3XA 2CW8A 2L7FP 3U1KA 1JHFA 2B7EA 2FOWA 2DA4A 2V6CA 3WGGA 2BBYA 1S7EA 2X1CA 4HA8A 3W6KB 3D1NI 4IQJA 2MH2A 1U0JA 2NOJB 3P9IA 4ENMA 1UJ8A 1LB2A 1TP4A 4ASNA 1RNLA 2DN0A 1GT0C 3PO2J 3M4OJ 2W7NA 1Y0UA 2KHMA 2VE8A 4F91B 1BR4A 2MLGA 3ASOH 4RGSA 2D1HA 3A2KA 4P55A 4PSXA 1Z91A 3JRCA 1T2KA 4E7JA 3BC8A 1PVEA 2ZJQF 3BG5A 3TO6A 1QO0D 1Y8RB 3DXJF 1PP7U 2BGCA 2DLLA 5EZHA 4XLPF 1DGWY 4UUSB 1OYYA 2LY1A 4EATA 4CCMA 1JTXA 1IRFA 4HG2A 2RV8A 4P9UA 3HZJA 4B47A 1E3PA 4ZTJA 4CH7A 1IAWA 2GOXB 4M9ZA 3U9GA 2KFDA 2MD0A 4MQVA 1MD0A 1NHAA 3E97A 3ELKA 5FRMA 1JXSA 1U8RA 2FRHA 4HDVA 3FBIB 3S8PA 3OS2A 3CMEI 4N4OB 2ZXWH 4EVIA 1J2XA 3A03A 2IA2A 2HU9A 2YPRA 1GVJA 5E3LA 2BV6A 5F08A 3K9TA 4Q4ZF 3WTSC 5CLSA 3CDLA 4RGRA 4UV9A 2QCOA 3LSGA 3J7ZI 3FXQA 2W57A 4HNUA 3E0JB 1IXSB 4LOCA 4U0WA 1OKRA 1T38A 1MZBA 4A3JJ 5CVJA 1KU7A 3E6BA 4E70A 3K70D 4KFCA 4ZZDA 2GA2A 2R5YB 5M3FJ 1KYWA 3F6OA 4IZZA 2GXBA 2VOOA 1EH6A 1XTAA 2EV0A 4AYBA 3L1PA 2NYXA 2JTVA 3BPXA 4YIFA 3R6SA 5DD4A 4DIQA 4RAGA 1WI3A 4JQFA 3FXMA 3K1NA 3DP7A 3MQ0A 4BACA 2DMNA 4AD9A 1JTYA 1XSVA 5KK1A 3JTGA 1TT5B 3BPVA 1IN4A 3F8NA 3I0TA 5DUIA 2UUZA 3D0SA 4LD5A 3L2UA 2PJRA 2GAUA 3F9KA 5DD8A 2R7TA 2MW8A 1XDSA 4F55A 3BOQA 4N9HA 4YFXF 2VQCA 3KYCB 3CUQB 1AWCA 3BR6A 2WB1A 1Z7UA 2LH9A 3CCLI 1FBQA 3RSNA 4UVAA 3PFYA 2F5DA 3TP0A 4KISA 3DBLB 4D1QA 5DCMB 3CCQI 3KP5A 2QQBA 2L54A 3CO7C 3HOTA 1FWZA 4YFKF 1LDDA 3PSIA 2QSFX 2M30A 4NUBA 3D5SC 1ODDA 4UVCA 5E1ZB 4E7LA 2HTJA 2ZJPF 2I5UA 3PNYA 2GBYA 3AFHA 3FBNB 2GIVA 1BA5A 3VYUB 1LFBA 2F4MB 2O7OA 4RGUA 1BM9A 5H6RA 5F1RA 1IDYA 5E3MA 1FX7A 1B9MA 4IOCF 3RZOJ 3CDHA 2JUGA 3AG2H 5C4JJ 5CJ9A 1I50J 3OMYA 3P9KA 2V26A 4YIIA 4N0BA 3P5JA 4OMZA 1BN5A 3HSRA 1W36C 1F1ZA 2FEZA 1SAUA 1X3ZB 1W5SA 2HWVA 4U7BA 2LD5A 2UV1A 1TZLA 1YTYA 2TDXA 4YELA 4BE1A 1QHGA 3WGIA 3K2ZA 3QODA 4KNYA 4J19A 4WX9A 3JW4A 3S1MJ 3KLNA 2JRTA 1EA3A 4N9IA 1NH3A 1I3AA 4RM3A 2AXTC 2BXYA 1USSA 4HLXA 5CQGA 1YIOA 2EZHA 1ZRDA 1SFUA 1SFEA 3WU1B 3ML6A 2KIQA 2M34A 3Q0WA 4FETA 2PMZA 1XSDA 1YS7A 3K0LA 4RAZA 1M1EB 2JRMA 2CV2A 5B5EC 4I0AA 1P2FA 2AHQA 5E3OA 1SD5A 1BI2A 2AQFA 1HXDA 2JA7J 1W5CC 1IDZA 4YIRX 1JGSA 2IBDA 3GZNB 5BMZA 2GXAA 4F93B 4FQGA 1R4NB 3L09A 2Y2ZA 2RC4A 4L9TA 4MNUA 2FBHA 1LVAA 2F5EA 2G0EA 3DV8A 4DYCA 2BOLA 2G7UA 2HYGD 2X9DA 5EJCA 3MKZA 2M7AA 2O0YA 4Z6YA 1TW2A 3CESA 3Q0VA 3ISPA 4XIDA 3CZ6A 2LREA 3HXLA 1FP1D 2XSDC 4RLQA 1YG2A 1STZA 2HYFA 3HTUA 5HNHA 4X0GA 3JRHA 3MD2A 1ZGJA 3OYCA 2M8GX 3JSPA 3HBLA 3GTPJ 1KU9A 1AU7A 2HTSA 3BDDA 4I99C 2Z33A 3PUBA 5IT3A 4AIJA 2QKMB 1N75A 2BHYA 4ENKA 3QQAA 5KAIC 1T08B 4CCLA 5EEHA 3CMMA 3FXRA 1VQMI 5LGTA 4RGXA 1UB9A 1SFOJ 2WAQN 2RREA 3LSMA 3MMYB 4JP0A 2GQQA 3EPZA 4MFEA 2BXZA 3U1DA 5F0FA 2KKOA 4EJVA 5J4YA 1WSUA 1ETYA 4GRIA 5GPAA 4Y15A 3VYTB 2DCEA 2VPLA 4HEA2 3GFMA 3SYTA 4OINF 3JREA 1LEBA 2VODA 3BZCA 2WWYA 3GO5A 1V55H 5LRRA 1X1BA 3SZTA 5JR3A 2JSPA 1F5TA 2OAZA 1GDTA 1MMDA 1Y8QB 4XQFA 1D5VA 4JBAA 3MZYA 4M6XA 2EFPA 4B8XA 1NK2P 3VPRA 1Z7LA 3DTEA 5HLTA 3OYEA 2UZKA 4U87A 4ABZA 2MFZA 2V9KA 3OS0A 3DFGA 4DYRA 1H9GA 1WJFA 4G6DA 3SHFA 1XGMA 2EJRA 3BR3A 2Q8KA 3G71I 1BI3A 4BXFA 2OPTA 4RMNA 3T8RA 1IUFA 1I6XA 1KYZA 2XASA 3BCAA 5K5OA 4RB2C 3TDZC 4KT6A 1ZRCA 3W6VA 2P5KA 5HVQC 2IT0A 2CV1A 4A6EA 5GTIC 3FK7A 4LG0B 3IWFA 1PUFA 4BKXA 2AS5F 1MH4A 2VONA 1F9NA 4CYCB 3MEXA 2OF7A 3LSRA 2JK3A 5FFZA 5EF6A 3IKTA 1B8IB 1R49A 3C2GA 4M9XA 3HHGA 4AM3A 3BJOA 2DK8A 2KQRA 2Q2EA 3W6JB 4M3BA 4Q5SF 2LBFB 2ELKA 3WTXC 2YX4A 3OL4A 2M0MA 5TGTA 3MWMA 2LTPA 1J75A 4YEJA 5HLGA 1MNEA 1KQ9A 2CUZA 3WG9A 1TWCJ 3TW7A 3HOYJ 1G3WA 2O61A 5DYMA 1QVTA 2HXOA 2ESNA 3FXLA 2R0QC 1W36D 4LLLA 1P4AA 5LBQA 4KIGA 2ECBA 2EQRA 1K78B 1Z67A 1ZG1A 1S72I 1HBXG 2P6SA 2IPQX 2IJLA 3FXJA 2LC2A 5D5VB 2XSJC 5J1RA 3I64A 1Y6IA 3KEYA 4L18B 3GMEA 1UCRA 3HC7A 1ZN2A 1SAXA 4A3EJ 3FDYA 2V7FA 3M8FA 5K7ZA 1RR7A 2IA0A 5LHHA 1IZ1A 4I98B 3F21A 5M5WJ 2QBYA 2DOFA 1FYLA 2PBIA 2A6TA 3RPQA 3TOBA 5B1AH 3H3ZA 3I59A 3BR2A 1F43A 5HDKA 2DI3A 5ILUA 1MBEA 3ZQLA 2B63J 1QNTA 2RKHA 4A6DA 4CCNA 4OAZA 5FD5A 2W25A 2XRNA 2YSRA 4W1UA 1WI9A 4HX4A 1V4RA 5IOYA 1VQ8I 2HZTA 2MC3A 5LGUA 4G8XA 2DODA 3BJ6A 2JA6J 3K4NA 3J81Z 1YJWI 1UHMA 1YQAA 1OCOH 2XF6A 3BG7A 1RESA 1MMSA 3ZP5A 3CCJI 2UWMA 4OMYA 1E0EA 2LMDA 2M45A 2N8GA 4BE0A 4ZH4F 2M8EA 4A93J 4P9FA 1TNSA 4RLFA 2ZFWA 2ID6A 3CMAI 4ZYGA 3R61A 1D8KA 2A05A 4H0EA 3CP8A 4IPAA 2XRLA 2OQGA 3JAMZ 2CU7A 4B4CA 3CCSI 1V54H 2QENA 2YR2A 3S93A 4LIUA 3OYMA 4M6VA 3QAHA 2OJED 3BLYA 4PK4A 4U0VA 3HOXJ 2QEXI 5C44J 1X1AA 4A0XA 4FE4A 5IP6A 2JPCA 4P96A 1J7KA 1YW8A 2TRTA 3EUAA 4PGGA 3ZCOA 2CQQA 3JCUC 4NQWB 2DPUA 4EEFG 2M0CA 2OA4A 3IH2A 1B9NA 3E6MA 2VQLA 1ZGWA 1WJ5A 2FE3A 2W84A 4F52A 2F4IA 3NARA 1IJWC 4ON0A 2QQAA 3ZQ7A 1ZR2A 3IAM2 3SFIA 4ZJZA 2IAIA 5B66C 4DJAA 1MBJA 2L5QA 4XNFA 3I54A 1E3HA 2AO9A 4FCYA 4UB6C 4CHUA 4CXFA 1VQ4I 2CO5A 1YITI 1HKSA 3C2BA 3HGYA 3RKXA 5ILVA 1VNDA 2R7FA 3S32A 4HF2A 2ZB9A 1ZHFA 1TQMA 4IHWA 3H9QA 4BS9A 3BG6A 5AIPA 4CCJA 3A01B 1X19A 4C2UA 3OYKA 1JKRC 5E1WA 3IV5A 3HOZJ 2MGQA 3SZPA 1BC8C 2Y0SA 2FBIA 3I4PA 1UFMA 4PCQA 4C30A 5C3EJ 3BG9A 3RCOA 1R5HA 5JLXA 2NVQJ 1BW6A 4MTDA 2JWTA 2ADUA 5DS9A 4XLCA 3OYDA 3F72A 2OC6A 3WG7H 3G3ZA 1IC8A 1APLC 2Z3YA 4B44A 2CFXA 1PP8F 2ME6A 4XRMA 2ZCWA 2XC7A 4I02A 1JGGA 1AOYA 2LDUA 3QPTA 3F0CA 1HKTA 1UG0A 1W7PA 2OZ6A 4I7HA 2CQKA 1WJCA 4BQAA 1ZQ3P 2WY7Q 1MMGA 2HVRA 2P81A 2V1XA 2L4AA 3JRAA 4I01A 1QZYA 4BNCA 5DM7F 1IN7A 3K69A 2K3PA 2DQLA 3HRSA 4XKBA 3CO6C 3J7YJ 1R58A 3OYGA 2J5PA 3TBIA 2IS2A 2WY8Q 4XOTA 5GTHC 3S1NJ 1NG6A 2P6TA 4F3QA 2P8TA 3QRFF 4E7HA 2DA7A 1FPQA 3BZ6A 5KAFC 5E79C 2FX0A 3MKWB 3UKGA 4IO9F 2EB7A 4XORA 3ECOA 2VLAA 5K1YA 1Z0XA 3SQNA 1FBUA 3J80Z 3IRQA 1VFCA 2R7ZJ 5EEAA 2GZWA 2NVXJ 5EDNA 3ABKH 2ZXHA 4WXCA 2DOEA 4IHTA 1S7OA 2L9NA 4AUXA 2EPFA 2GA1A 1XG1A 3GTMJ 2ZMEC 3I71A 4RB0A 1Y1VJ 1CQTA 2QWWA 3Q9VA 5IT9Z 2E2HJ 2JPBA 3LNQA 1FTZA 5J6XA 5M3MJ 2EFQA 2EH3A 4KIBA 4II3A 4S04A 5LEKA 4EJUA 2MH9A 2Z2SB 5FKLA 5ILSA 2DPDA 1QU3A 2LSOA 2CMPA 3GZ6A 2HDCA 4XM3A 3CQZJ 3HKZN 2IRFG 4F92B 4A3MJ 2JUCA 1MDMB 4IRIA 2F4OB 4RA2A 3HM5A 3KX2A 1KU2A 3PUFA 3X2QH 3QYFA 5GADJ 4UUVA 2E1MC 3GW2A 5F1JA 1XCVA 5GPCA 5IYCJ 3GLXA 3KFWX 2E2IJ 3WTVC 3EUHA 1U9NA 1XC5A 3NEUA 1WH7A 2XB0X 3GCMA 3OYJA 2JA2A 3CCRI 1U5TA 5D8KB 3WTZA 5LGNA 3FMQA 1I1GA 4NB5A 4E4HA 4G12A 3RYRA 5H6QA 3L2RA 4HOBA 3DEEA 4A0YA 4IHVA 4DW6A 3AKZA 3LQRA 1VQLI 2EK5A 2WC2A 4ZYHA 3C3WA 1MNMC 4KMFA 1MMNA 1YRNA 1Q1HA 2DA5A 1BC7C 3S1QJ 4EJWA 3PQKA 3CUOA 3FM5A 3KYDB 4G6TB 2EA4A 3J81K 2K9QA 3DLLF 1V5EA 1UELB 5E3NA 2M5WA 3JRBA 1TLHB 1MBGA 2GWRA 4G6QA 3ZMTA 1HF0A 4IKFA 1ZTRA 4HYEA 2V1UA 1VQ5I 1WJDA 6PAXA 3VSLA 3DBRB 3OL3A 3HPHA 1WVRA 3JRDA 4QIWN 1W0UA 1P4XA 1L0OC 1DU0A 3A0HC 5FROA 3JAMK 2VJJA 1J59A 3K10A 3PJRA 2R5ZB 1ZGAA 3MZ8A 5LLQA 1W7PB 3UNGC 4BDYA 2GM4A 4BQNA 1Z3YA 2HS5A 1ETWA 3RZDJ 2OBPA 2IS1A 3K4BA 1FJLA 1S6LA 3GTQJ 3K4KA 5K7FA 3C2HA 5B3SH 1ETOA 2DA6A 1N78A 4C2MJ 4CUGA 5ICCA 1GHCA 1AKHB 4ESBA 5K5QA 2KJCA 1RUNA 1JUPA 4MTEA 1W4MA 2WBMA 3ABMH 4OWRB 1Q1VA 1O3TA 3BZKA 4WF2A 3SZGA 3JR9A 3EQLF 3KP7A 1ZYRF 1J09A 3LAJA 4OIQF 1YYVA 5KVRA 2O9LA 4A5NA 2VC1A 1OCRH 2A6HF 1WH5A 2IS4A 1FOYA 1LNWA 2ZMEB 2Z9OA 1HKQA 3O6BB 1Y0NA 5L3BA 3DKYA 4C9YA 1HCRA 3V8LA 1WZ2A 2JZYA 2R7UA 2M3AA 2ZC2A 3ESWB 3QYEA 1IF1A 1W7PD 2ISZA 2DAOA 1V5GA 2X1DA 2KMUA 2LYCA 1KZHA 4O3MA 1BR2A 2CG4A 4EGZA 2DXIA 3ZR8X 1FSHA 2IXSA 2F2EA 5KHDA 4B3XA 2CV0A 4AIDA 1L3LA 1DP7P 4KUMA 1SD6A 4KA4A 2E1MB 2LR8A 3K4CA 1LKXA 2X51A 2OZUA 1R71A 5BQTA 3CF2A 2W00A 3RJPA 4P5OA 2HFHA 1OFCX 1LE8A 4RB1A 4D5FA 5JHUA 2VBWA 3OYLA 2QSGX 3J7AY 3CMYA 2OD5A 2K85A 3REOA 3T0YA 3L2QA 1O3RA 3KP6A 2W85A 2Y0MA 3GTGJ 3H0GJ 4DZPA 2ICWG 4EGYA 4M9SA 5CVRA 3QPLA 3WGHA 1OCZH 3ZMZA 1T6SA 3ZMUA 1TWGJ 3BQYA 4DZJA 3ZMDA 3CCMI 1O3QA 4UY8I 4C3JJ 3BR0A 4V2FA 4BEHA 3N4MA 3CJTB 5JHFA 3H5AA 2FD5A 3CJRB 4HV5A 3TGNA 1K6YA 2IGMA 2A6EF 1X1PA 4IQ4A 3W3CA 1T8IA 2R7QA 2CH0A 1HOMA 2X1EA 1I27A 4QWQA 4EJOA 3SDBA 3KPHA 4QPQA 2EILH 3J80K 2QQ8A 2X6WA 4HX7A 5EZGA 2NVUB 2BY3A 2R92J 4G7ZF 4GYIA 1IO2A 2JA8J 4Y3OA 5B1BH 2ZXJA 5HLHA 3LSJA 2QLZA 3SJMA 4L0YB 3F8FA 4XRSA 1RUOA 1T98A 2CS3A 1RZ4A 3IWZA 1EV7A 1XMAA 3JRGA 3DKXA 1SEUA 2OV7A 2PX9A 1CGPA 1MSEC 2KRHA 2ZSIB 5EEGA 5JI6A 4IVNA 2FOKA 2D45A 4M6YA 2QZ8A 2F5FA 2Y9ZA 1MSFC 5LHIA 1DUXC 2DA3A 3OYFA 5M5YJ 3M07A 4IX7A 4GXOA 4BUPA 2O8KA 1BI1A 3OYIA 3HUGA 1PYVA 2PQ8A 1NK3P 4XL9A 4JX4A 1SMYF 2XAGA 3DEWA 3VODA 1I39A 2IEKA 1QGPA 2Y31A 2XV4S 1IRXA 3JRIA 4RBOA 4AC0A 4RM2A 2Z5UA 3A0BC 1VQ9I 3KE2A 2XPUA 4AWXB 5CVUA 2ZNYA 2L3DA 3OYNA 3L2VA 1P6RA 4XKWA 5EYRA 3SXYA 2EBIA 4KYWA 2A3SA 2ZSHB 2KL4A 1B4AA 1ZG3A 2LOOA 2LF8A 1ETXA 1R6RA 2A5YB 4MEYF 3L00A 4CCOA 3V42A 4MHGA 3LWFA 1WCMJ 1WQ2A 3SEZA 4ETSA 1HC8A 3P9CA 1FP2A 3PM1A 2OTJI 2MYSA 4BHPA 2V6EA 4HNVA 3LA7A 1U8BA 5AONA 2ID3A 2M4GA 2XGEA 3KP4A 2EV6A 4UHTA 4C2TA 2DT6A 5DV5A 3OYAA 4PJNA 3V4GA 3I3LA 4I76A 3LA2A 4GCVA 2L9RA 2Z1DA 2JT1A 2EIJH 2RAEA 3GX4X 5J40A 3DKWA 2H09A 4KDPA 3OOPA 3HRUA 3R60A 3H5NA 1FMVA 2HQ5A 1WFXA 2PEXA 5ED4A 2NS7A 2PJRB 3I4MJ 2J5OA 3ZQFA 2XDVA 2DK5A 1QZZA 1NG7A 2VKDA 4A2UA 4Q47A 2JMWA 3PQJA 3G1MA 3S3MA 4PSWA 1BI0A 4IOAF 1OR7A 5DTDA 2DMQA 1CF7A 3ERMA 3HL2A 2KPMA 1ZAOA 2WAFA 1ITYA 5ICGA 2XGXA 1UHSA 3HSFA 4JYKA 2DFFA 3GFLA 3ZOBA 1X3UA 3DWLE 1K79A 3CP2A 1B59A 4HPQA 3TO7A 3RDIA 2XAHA 1TL8A 3QWLA 3HOWJ 2NNNA 4WXHA 1TBXA 2HOAA 3P7NA 4YRVA 3MKLA 1G59A 4Y7NJ 5E1XA 3VEPA 4JX6A 2I8DA 4CZZA 2KZVA 3GEZA 5FO5A 2L7MP 3IRRA 4I09A 5HS9A 3ZMSA 3BG3A 3E5XA 1Y56A 1S7AA 4IF4A 3WHCA 3E6CC 1D3YA 1F36A 3KEOA 3Q3SA 4V19K 3M8EA 1DPUA 2X6YA 1G2HA 1KU3A 2F5CA 1B6AA 1FMWA 3FKJA 3KIOA 3GF2A 4LB6B 4ESFA 3EYYA 3PNVA 4G9YA 2I10A 2DYRH 2DOAA 3KCCA 5K7HA 1MBHA 1H0MA 2EFOA 5CYVA 3QYBA 2COMA 2X6OA 3M3YJ 1G6NA 1FNNA 2CUEA 4O6JA 4E7ZA 3R0JA 5J1YA 2PJPA 2IGKA 2XAJA 3E6DA 3ROUA 5HNFA 2RVCA 2NVTJ 2DFEA 2QVOA 4IHSA 2DTZA 1QVUA 3O8GA 2LKXA 2L7ZA 4HAMA 2QGUA 1R5ID 4G7OF 4B1RA 4MEXF 4L5EA 3FIWA 2COBA 2STTA 4QSHA 4PJMA 3HOVJ 5E20A 2HOTA 5F6FA 1I6HJ 1VQ6I 2V9VA 1IV8A 1R23A 2L9VA 1RR8C 3FZVA 1YO5C 1R5GA 3C18A 2W48A 4BAYA 3MVPA 3B73A 1V3FA 1VQKI 4M3FA 4BQQA 5BPDA 4NHJA 1DPRA 4XKCA 4YG2F 2FF4A 3IC7A 1QPIA 1MBKA 1FTTA 1HW2A 2DFHA 4L5IA 3RPUA 1K83J 4M3DA 4BHBA 2M2EA 1GV5A 2B9SA 2MD5A 3FHZA 3AL0C 1D1CA 2JVGA 2QUFA 5F64A 2E71A 5DDGA 5JFRA 2NOGA 4H4KC 2YU9J 2M1BA 3V7RA 4PGHA 5D5WB 2NS8A 3C1DA 2LVSA 3A1YA 2VT3A 4Y13A 3ZQQA 4UNOA 2M87A 4UXNA 3T1BA 1MJAA 3GTLJ 3OIOA 2O6GE 5HODA 4ZDLA 1ORKA 4KT5C 2K9LA 2JQ7A 5F0HA 3IL2A 3CLOA 1V5FA 1Z6RA 1FYMA 3TP3A 1RIOH 3E1SA 1G3YA 4KN4X 1R1VA 2X85A 2XF7A 3OSFA 2W82A 2R3SA 2X6XA 1CF7B 2VBZA 3HHHA 1JUSA 2DW4A 1OCCH 4U88A 1ENHA 4Y52J 1QBJA 2LG4A 3F23A 2NS0A 1JKQC 2KRFA 4BY1J 3A4CA 4B48A 4RAFA 4BJ6C 3HEFA 2VXZA 5DUKA 2RNJA 5LEJA 1EJ9A 4M3EA 2VOPA 2R7VA 1QRYA 1Z1DA 3F8CA 1YFHA 2DT7B 2RQQA 3HDDA 3KETA 1LFPA 1FEXA 1RETA 3DU6A 1REPC 1G3SA 2CQ7A 3HJEA 4B43A 3QPHA 4FASD 3BCBA 1ZLJA 3PIOF 2XROA 2A61A 1YLFA 2UXXA 1WPKA 4HZFA 2D5VA 5F04A 2MC4A 4KICA 1B72A 4CSWA 1MBFA 1PUFB 2CUFA 2X48A 4II2A 1TW3A 4A3CJ 2NNYA 1SFKA 2HDDA 1RC9A 2WADA 1Y39A 3HKZA 2M7BA 1XB4A 1XX5A 5FJ8J 4XLAA 2EZLA 1VTNC 1P7IA 3DPUA 4ANJA 2R7WA 3NAUA 1MW7A 1T0FA 2Q2EB 1W1WE 3H9GA 1MKMA 2IGOA 1K7AA 5TISC 3W2AA 3ABTA 1E3OC 1N25A 1K4TA 3MKYB 2V79A 3GZ5A 1JKPC 1LEAA 2PMUA 2HZDA 2QM3A 4LITA 4AIHA 5EG0A 1GXQA 4G94A 2LY2A 3NWTA 2PMHA 2VT2A 3RKWA 3G1LA 1ZK8A 4CO8A 3AG1H 4MGRA 3S14J 1Z21A 3HRTA 4A3BJ 1UAAA 5L3CA 1GV2A 4L5JA 1X2MA 5L3EA 2KIUA 2HKOA 4EQQA 3NRVA 1W0TA 4HLYA 1SANA 2CSOA 3G4SI 3EYIA 2HOEA 4XK4A 2XB5A 3PO3J 2FJ1A 2QBYB 1ACIA 2CRGA 3AL0B 1LDJA 3I59B 1TNTA 4IXAA 3SDGA 4JOMA 4CA0A 4KIFA 4XRFA 1BIAA 4A12A 4XRSG 3DQVC 4A3GJ 1RPWA 3GVAA 1QHHD 1N77A 3M1EA 1KQ8A 4FE7A 1TQPA 4LJZF 3RKQA 4UUSA 2KZGA 4FTHA 2K7LA 4NC6A 5ICFA 1WJAA 2G9WA 3O8HA 3GFIA 1F4KA 1GLNA 4MLOA 3HSEA 1YS6A 1LPQA 4C3IJ 5ICEA 5JLWA 4OAYA 2KLOA 2WA0A 4HW0A 3GTOJ 2KRCA 1E2XA 3TO9A 2VUMJ 2HDWA 3KP2A
chains in the Genus database with same CATH topology
2CYYA 3VOEA 3V7SA 2ZO4A 4IRGA 2E7XA 4ZYEA 4I0BA 4CGZA 2R7DA 1D8JA 1OYWA 1WWXA 2ZKZA 3I5UA 3EETA 1O7FA 1PDNC 4LFUA 3O3KA 4OIPF 2LNBA 5E8GA 5E8IA 2K02A 2XKOA 5K5RA 5LHGA 4WCGA 3GXOA 1U6GA 1TTYA 1S8NA 3EDPA 1KQ0A 1BOAA 1BBYA 3DPLC 4LLGF 1I5ZA 3PFIA 1XN7A 1J5YA 4DNCA 4R1HA 4UVBA 4MQ9F 3ERED 3CUQA 2XAFA 3IHUA 1U5TC 4EMSA 3V8JA 5D5UB 2ZBKA 5DCMA 3DPTA 2Y48A 1S29A 2H94A 5D6FA 3FMRA 2RGVA 3H92A 2CGPA 3RIRA 4BHCA 4XSZF 4IRHA 4WWCA 3RKYA 3FM3A 4QLCU 1XDUA 5HS7A 1WRJA 3B02A 4BH9A 3HTSB 1QPMA 3ZMVA 3FMSA 4LMYA 1IN5A 5TJJA 1O57A 4YFNF 2PLYA 2ISYA 4BYYA 1C0WA 2Q0OA 1KGSA 2A69F 3LSTA 2FU4A 3FX3A 2AXLA 3DEUA 3ECHA 1ZRFA 3JSOA 2IP2A 3WTYC 2L02A 1IN8A 2PFBA 3Q9SA 1XD7A 1O7LA 2KIFA 4ZYDA 1XMKA 4HQEA 2DU9A 4EM2A 1LJ9A 2B0LA 5ERIA 5L3FA 2VBXA 4M74A 4G7HF 3OV8A 2QQ9A 2ZJ2A 4IJAA 4LLNA 2K4BA 3MFKA 4GYGA 3I53A 3HRMA 3Q5FA 2ZNZA 2L4MA 1MJ9A 2P5VA 3O2PE 2PG4A 1U5TB 5E17F 2E1NA 1R7JA 1MGTA 1W5TA 5DEQA 3QOPA 1OYIA 2OU2A 2ESHA 3ZPLA 1ZG5A 2VN2A 3MAJA 1ZARA 4KN7X 4ENJA 1BIBA 1HW1A 3ZN1A 2K27A 5HLIA 4FX0A 2H6BA 5A2QZ 1FC3A 2YX7A 4OOIA 3TOAA 3F8MA 5AIQA 3CTAA 4GO1A 5IT9K 4EM0B 2W24A 1IN6A 2WV0A 3KZYA 2RQPA 4LG0A 5D8LB 2P5LC 3WE2A 4ESJA 2MLKA 3QU6A 1WKMA 3H3UA 2WTEA 4LK0F 4U7DA 2X0LA 5D4SA 3J7AO 2C6YA 2FMLA 2P4WA 3S2WA 2BEOA 2FMYA 3N97A 4HBLA 1OMIA 4XLNF 2MBFA 4U0YA 2E1CA 1JHHA 1SD7A 5D4RA 4JK1X 3LA3A 1ZLKA 1K78A 4L9VA 3GFJA 2K4JA 2XIGA 5HOOA 2KJBA 3TKYA 4HDUA 2Z99A 3D5LA 2EFNA 4ZZLA 4LB5A 2YU3A 5HDGA 3V7CA 4RS8A 3L2CA 2O8XA 1E17A 2P7VB 1QQIA 3T5XA 1ON2A 3WTWC 2FA5A 5D5XB 1U78A 2KIMA 4AVPA 1B1BA 1H9TA 4EJTA 5DCFA 3G73A 1HSTA 4FT8A 4TV7A 3JTHA 3QU3A 2A07F 4LGWA 2A68F 1FBSA 2V1DA 3V8KA 2ELHA 1EH7A 2RDPA 5BS6A 3R0AA 5D6EA 4AIKA 3BY6A 1ULYA 2PN6A 2DT5A 3E3VA 4ENNA 3GWZA 1I1SA 5FLXZ 3E5UA 2RN7A 2LF7A 4LK1F 1YW9A 4M72A 1FYKA 2ACJA 2DQRA 2QYOA 2ETHA 1ONVA 3HIFA 4NQWA 1IXCA 5FB2A 4B09A 4A5MA 4PZJA 4PDKA 1S3JA 3COAC 3ZN0A 1Z9CA 4UV8A 4CICA 1R22A 5E18F 2FXAA 1USTA 4CDGA 4RB3C 4FX4A 1O3SA 3L9FA 3F3XA 3M9AA 4FHTA 2L01A 1PUEE 2VC0A 3MZHA 3U2RA 3F8BA 3TQNA 2DBBA 3BP8A 3LFKA 2PI0A 2H27A 3WU0A 4R79A 3CJNA 3E5QA 2XUBA 1T39A 2XAQA 5FD6A 3QP5A 5CVVA 3I58A 5HS8A 2G7HA 2DO7A 2VBYA 2FSWA 2H6CA 4A0ZA 5J8FA 3AAFA 1DDNA 1U3EM 3WODF 1Z05A 4XBFA 2OQRA 2Y75A 5TRDA 5A2QK 1ZH5A 3F6VA 5L3GA 3MCZA 4BXUA 3NQOA 5FGMA 3ABUA 4OIRF 1IUYA 2CWEA 2E7WA 4RAYA 3DF8A 4L9NA 1G4DA 1IRGA 4HV6A 3KEQA 2HGCA 1FOKA 4Q48A 3FF5A 1HW5A 1XGNA 5L3DA 2XKPA 4F7ZA 3KZZA 2FBKA 1FY7A 1EH8A 2O3FA 4EM1A 3ULQB 4M71A 5BOXA 3K1MA 2HKXA 5CVIA 3GYHX 5FFXA 2HEOA 5H20A 3LAPA 3VFZA 3RTRA 2DTRA 1MDMA 2FNAA 3BJAA 5LRSA 5J8CA 5JVTA 3FXUA 3KLOA 3BROA 4KMUX 1K6OA 4DQ2A 4L9JA 3C7JA 3R4KA 1R36A 2X4HA 2FQ3A 2CW0F 1FLIA 2HQRA 3T8TA 1A04A 4WXDA 2NRAC 3QP6A 3RYPA 4OIOF 1R1TA 3FWEA 1IW7F 1BJAA 4Z2YA 1FSEA 2IW5A 2K86A 1SD4A 2HQNA 3WTTC 1J9IA 2IVMA 2MA3A 2BE5F 3GUDA 1JE8A 2GXGA 4HF1A 5FLXK 3WTUC 1XSXA 4GGGA 4D0PA 2EA2A 1P4WA 1YW7A 1LQ1A 1TQIA 1XCBA 4HX8A 3F22A 2XHKA 2NAZA 2FNPA 5BPIA 1Z6TA 1HSJA 1R1UA 1LDKB 1R00A 4K2EA 2UXNA 4HQMA 1SFXA 4XSXF 4OU0A 1FZPB 2D1VA 2STWA 1FT9A 3RI4A 1KA8A 4Y17A 2VE9A 1GXPA 4R8HA 2EV5A 3BWGA 2ZMEA 1XGSA 4HF0A 3KP3A 3WE3A 1MJBA 3K1PA 1U2WA 2EWNA 1IXRC 2O03A 4WK8F 3SFZA 2LKPA 4L0ZB 4CYDA 2P7CB 3HOSA 2JSCA 4I2OA 3TDUC 5HDNA 3M7GA 1P92A 1HQCA 3L7WA 3IKVA 1ZREA 2BYVE 1XGOA 4M73A 2D2WA 4EV0A 2EFWA 1J0RA 1UHWA 2XVCA 3HYIA 2DFIA 3VB2A 3LQQA 4O5VA 1OPCA 1RI7A 2IA1A 3CUQC 4S05A 2HR3A 1G3TA 1SMTA 1ON1A 1JHFA 2V6CA 3WGGA 2BBYA 4HA8A 3W6KB 2MH2A 3P9IA 4ENMA 1LB2A 4ASNA 1RNLA 1Y0UA 2VE8A 2MLGA 4RGSA 2D1HA 4P55A 1Z91A 1T2KA 3TO6A 1QO0D 3DXJF 1PP7U 2BGCA 2DLLA 4XLPF 1OYYA 1IRFA 2RV8A 4P9UA 1IAWA 4M9ZA 3U9GA 4MQVA 1MD0A 1NHAA 3E97A 3ELKA 1JXSA 1U8RA 2FRHA 4HDVA 4EVIA 1J2XA 2IA2A 2YPRA 1GVJA 2BV6A 3K9TA 4Q4ZF 3WTSC 5CLSA 4RGRA 4UV9A 3FXQA 2W57A 1IXSB 4U0WA 1OKRA 1T38A 1MZBA 5CVJA 1KU7A 3E6BA 4E70A 4KFCA 4ZZDA 2GA2A 1KYWA 3F6OA 2GXBA 2VOOA 1EH6A 2EV0A 2NYXA 2JTVA 3BPXA 4YIFA 3R6SA 5DD4A 4JQFA 3K1NA 3DP7A 3MQ0A 4AD9A 1XSVA 5KK1A 3JTGA 3BPVA 3I0TA 1IN4A 3F8NA 5DUIA 3D0SA 4LD5A 2GAUA 5DD8A 1XDSA 3BOQA 4N9HA 4YFXF 3CUQB 1AWCA 1Z7UA 1FBQA 4UVAA 2F5DA 5DCMB 3KP5A 2QQBA 3CO7C 2L54A 3HOTA 1FWZA 4YFKF 1LDDA 2M30A 5E1ZB 1ODDA 4UVCA 2HTJA 2GIVA 4RGUA 5H6RA 5F1RA 1BM9A 1FX7A 1B9MA 3CDHA 5CJ9A 3P9KA 4YIIA 4N0BA 4OMZA 1BN5A 3HSRA 1F1ZA 2FEZA 1W5SA 2HWVA 4U7BA 1YTYA 2TDXA 3WGIA 3K2ZA 4KNYA 4WX9A 3JW4A 3KLNA 2JRTA 4N9IA 4HLXA 1USSA 1YIOA 1ZRDA 1SFUA 1SFEA 3WU1B 3ML6A 1XSDA 1YS7A 3K0LA 4RAZA 4I0AA 1P2FA 1SD5A 1BI2A 1HXDA 1JGSA 5BMZA 3L09A 2RC4A 4L9TA 4MNUA 2FBHA 1LVAA 2F5EA 3DV8A 2G7UA 2HYGD 2O0YA 1TW2A 3ISPA 1FP1D 1YG2A 3HTUA 2HYFA 1STZA 1ZGJA 3JSPA 1KU9A 2HTSA 3BDDA 2Z33A 5IT3A 4AIJA 4ENKA 5EEHA 3FXRA 5LGTA 4RGXA 1UB9A 2GQQA 3U1DA 2KKOA 4EJVA 1WSUA 4Y15A 3GFMA 4OINF 1LEBA 2VODA 2WWYA 3GO5A 5LRRA 3SZTA 5JR3A 1F5TA 2OAZA 1D5VA 4JBAA 3MZYA 4M6XA 2EFPA 4B8XA 2UZKA 3DFGA 1H9GA 4G6DA 3SHFA 1XGMA 2EJRA 2Q8KA 1BI3A 3T8RA 1I6XA 1KYZA 2XASA 5K5OA 4RB2C 3TDZC 1ZRCA 2P5KA 5HVQC 2IT0A 4A6EA 4LG0B 3IWFA 2AS5F 2VONA 1F9NA 3MEXA 5FFZA 3IKTA 4M9XA 3HHGA 3BJOA 2DK8A 2Q2EA 3W6JB 4Q5SF 3WTXC 2YX4A 3MWMA 1J75A 5HLGA 1KQ9A 3WG9A 1G3WA 2O61A 5DYMA 2ESNA 4LLLA 1P4AA 5LBQA 4KIGA 1K78B 1ZG1A 1HBXG 2P6SA 2IPQX 2IJLA 5D5VB 3I64A 4L18B 1UCRA 1SAXA 1ZN2A 3M8FA 2IA0A 5LHHA 1IZ1A 4I98B 3F21A 2QBYA 1FYLA 2PBIA 3RPQA 3TOBA 3H3ZA 3I59A 5HDKA 2DI3A 5ILUA 1QNTA 2RKHA 4A6DA 5FD5A 2W25A 2XRNA 2YSRA 1WI9A 4HX4A 1V4RA 2HZTA 2MC3A 5LGUA 4G8XA 3BJ6A 3J81Z 1UHMA 1YQAA 3ZP5A 2UWMA 4OMYA 2M45A 4ZH4F 2M8EA 4P9FA 1TNSA 2ZFWA 4ZYGA 3R61A 1D8KA 4H0EA 4IPAA 2OQGA 3JAMZ 2QENA 2YR2A 3QAHA 4U0VA 4A0XA 2JPCA 4P96A 1J7KA 1YW8A 4PGGA 2DPUA 2OA4A 1B9NA 3E6MA 2FE3A 2W84A 4ON0A 2QQAA 3ZQ7A 3I54A 4CHUA 4CXFA 2CO5A 1HKSA 3RKXA 5ILVA 2R7FA 4HF2A 1ZHFA 1TQMA 5AIPA 5E1WA 3SZPA 1BC8C 2FBIA 3I4PA 1UFMA 4PCQA 1R5HA 4MTDA 2ADUA 3F72A 3G3ZA 2Z3YA 2CFXA 1PP8F 2ZCWA 1HKTA 4I02A 1AOYA 2LDUA 3QPTA 1W7PA 2OZ6A 4I7HA 2CQKA 4BQAA 2V1XA 2L4AA 4I01A 1QZYA 4BNCA 1IN7A 3K69A 2DQLA 3HRSA 3CO6C 1R58A 2J5PA 2P6TA 2P8TA 3QRFF 1FPQA 3BZ6A 2EB7A 3ECOA 5K1YA 3SQNA 1FBUA 3J80Z 3IRQA 2GZWA 4WXCA 4IHTA 1S7OA 2GA1A 3I71A 4RB0A 2QWWA 3Q9VA 5IT9Z 2JPBA 5J6XA 2EFQA 4KIBA 4S04A 5LEKA 4EJUA 2MH9A 5ILSA 2DPDA 2LSOA 2HDCA 3GZ6A 2IRFG 1MDMB 4IRIA 1KU2A 4UUVA 3GW2A 1XCVA 3GLXA 3KFWX 3WTVC 3EUHA 3NEUA 1U5TA 5D8KB 3WTZA 5LGNA 3FMQA 1I1GA 4NB5A 3RYRA 5H6QA 4HOBA 4A0YA 3LQRA 2EK5A 2WC2A 4ZYHA 3C3WA 4KMFA 1Q1HA 1BC7C 4EJWA 3PQKA 3CUOA 3FM5A 2EA4A 3J81K 2M5WA 1TLHB 2GWRA 4G6QA 3ZMTA 4HYEA 2V1UA 6PAXA 1P4XA 1L0OC 3JAMK 1J59A 1ZGAA 5LLQA 1W7PB 2HS5A 2OBPA 1S6LA 5ICCA 1GHCA 4ESBA 5K5QA 2KJCA 1RUNA 4MTEA 1W4MA 1O3TA 4WF2A 3EQLF 3KP7A 1ZYRF 3LAJA 4OIQF 1YYVA 5KVRA 4A5NA 2VC1A 2A6HF 1LNWA 2ZMEB 2Z9OA 1HKQA 3O6BB 5L3BA 3V8LA 2JZYA 1IF1A 1W7PD 2ISZA 2DAOA 4O3MA 2CG4A 4EGZA 1FSHA 2F2EA 1L3LA 1DP7P 4KUMA 1SD6A 4KA4A 2OZUA 5BQTA 3RJPA 4P5OA 2HFHA 4RB1A 5JHUA 2VBWA 2OD5A 3REOA 3T0YA 1O3RA 3KP6A 2W85A 2Y0MA 4EGYA 4M9SA 5CVRA 3WGHA 3ZMZA 1T6SA 3ZMUA 3ZMDA 1O3QA 3N4MA 4HV5A 3TGNA 2A6EF 1I27A 4QWQA 4EJOA 3J80K 4HX7A 4G7ZF 4GYIA 2ZXJA 5HLHA 2QLZA 4L0YB 3F8FA 1RUOA 1T98A 1RZ4A 3IWZA 1EV7A 1XMAA 1CGPA 5EEGA 5JI6A 4IVNA 2FOKA 2D45A 4M6YA 2QZ8A 2F5FA 5LHIA 1DUXC 4GXOA 1BI1A 3HUGA 2PQ8A 1SMYF 2XAGA 3VODA 1QGPA 2XV4S 2Z5UA 3KE2A 4AWXB 5CVUA 2ZNYA 2L3DA 1P6RA 3SXYA 4KYWA 2A3SA 1B4AA 1ZG3A 2LF8A 2A5YB 4MEYF 3L00A 4MHGA 3LWFA 1WQ2A 4ETSA 3P9CA 1FP2A 4BHPA 3LA7A 5AONA 3KP4A 2EV6A 4UHTA 5DV5A 3V4GA 3LA2A 4GCVA 2JT1A 3GX4X 3DKWA 2H09A 4KDPA 3OOPA 3HRUA 3R60A 2PEXA 5ED4A 2J5OA 2DK5A 1QZZA 4A2UA 4Q47A 3PQJA 1BI0A 1OR7A 1CF7A 1ZAOA 5ICGA 2XGXA 3HSFA 3GFLA 1X3UA 1K79A 1B59A 3TO7A 3RDIA 2XAHA 2NNNA 4WXHA 1TBXA 3P7NA 5E1XA 3VEPA 4CZZA 3GEZA 5FO5A 3IRRA 4I09A 5HS9A 3ZMSA 3E5XA 1S7AA 4IF4A 3E6CC 1D3YA 1DPUA 3KEOA 3M8EA 1KU3A 2F5CA 1B6AA 4ESFA 3GF2A 4LB6B 3EYYA 4G9YA 3KCCA 1H0MA 2EFOA 5CYVA 2COMA 1G6NA 1FNNA 4O6JA 3R0JA 2PJPA 3ROUA 2XAJA 3E6DA 2RVCA 4IHSA 2QVOA 4HAMA 4G7OF 4MEXF 2STTA 5E20A 5F6FA 1R23A 2V9VA 3FZVA 1YO5C 1R5GA 3C18A 4BAYA 3B73A 1V3FA 5BPDA 4NHJA 1DPRA 4YG2F 2FF4A 3IC7A 1HW2A 4L5IA 3RPUA 4BHBA 2MD5A 3FHZA 2QUFA 5F64A 5DDGA 5JFRA 2M1BA 3V7RA 4PGHA 5D5WB 3C1DA 2VT3A 4Y13A 4UNOA 2M87A 4UXNA 3T1BA 1MJAA 2O6GE 4KT5C 3IL2A 3CLOA 1Z6RA 1FYMA 1RIOH 1G3YA 4KN4X 1R1VA 2R3SA 1CF7B 2VBZA 3HHHA 2DW4A 4U88A 1QBJA 3F23A 2NS0A 2KRFA 2VXZA 5DUKA 2RNJA 5LEJA 2VOPA 1Z1DA 3F8CA 1YFHA 3KETA 1REPC 1G3SA 3QPHA 1ZLJA 2XROA 2A61A 1YLFA 2UXXA 4HZFA 4KICA 1TW3A 2NNYA 1XB4A 1VTNC 1T0FA 1K7AA 1MKMA 3ABTA 2V79A 3GZ5A 1LEAA 2PMUA 2QM3A 4AIHA 1GXQA 4G94A 3RKWA 2PMHA 2VT2A 4CO8A 4MGRA 3HRTA 5L3CA 4L5JA 5L3EA 2KIUA 2HKOA 4EQQA 3NRVA 4HLYA 2CSOA 3EYIA 2HOEA 2QBYB 1LDJA 3I59B 1TNTA 4IXAA 4KIFA 4XRFA 1BIAA 4A12A 3DQVC 3GVAA 1KQ8A 3M1EA 1TQPA 4LJZF 2K7LA 5ICFA 2G9WA 3GFIA 1F4KA 3HSEA 1YS6A 5ICEA 4HW0A 1E2XA 3TO9A 3KP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYY A;  3VOE A;  3V7S A;  2ZO4 A;  4IRG A;  2E7X A;  4ZYE A;  4I0B A;  4CGZ A;  2R7D A;  1D8J A;  1OYW A;  1WWX A;  2ZKZ A;  3I5U A;  3EET A;  1O7F A;  1PDN C;  4LFU A;  3O3K A;  4OIP F;  2LNB A;  5E8G A;  5E8I A;  2K02 A;  2XKO A;  5K5R A;  5LHG A;  4WCG A;  3GXO A;  1U6G A;  1TTY A;  1S8N A;  3EDP A;  1KQ0 A;  1BOA A;  1BBY A;  3DPL C;  4LLG F;  1I5Z A;  3PFI A;  1XN7 A;  1J5Y A;  4DNC A;  4R1H A;  4UVB A;  4MQ9 F;  3ERE D;  3CUQ A;  2XAF A;  3IHU A;  1U5T C;  4EMS A;  3V8J A;  5D5U B;  2ZBK A;  5DCM A;  3DPT A;  2Y48 A;  1S29 A;  2H94 A;  5D6F A;  3FMR A;  2RGV A;  3H92 A;  2CGP A;  3RIR A;  4BHC A;  4XSZ F;  4IRH A;  4WWC A;  3RKY A;  3FM3 A;  4QLC U;  1XDU A;  5HS7 A;  1WRJ A;  3B02 A;  4BH9 A;  3HTS B;  1QPM A;  3ZMV A;  3FMS A;  4LMY A;  1IN5 A;  5TJJ A;  1O57 A;  4YFN F;  2PLY A;  2ISY A;  4BYY A;  1C0W A;  2Q0O A;  1KGS A;  2A69 F;  3LST A;  2FU4 A;  3FX3 A;  2AXL A;  3DEU A;  3ECH A;  1ZRF A;  3JSO A;  2IP2 A;  3WTY C;  2L02 A;  1IN8 A;  2PFB A;  3Q9S A;  1XD7 A;  1O7L A;  2KIF A;  4ZYD A;  1XMK A;  4HQE A;  2DU9 A;  4EM2 A;  1LJ9 A;  2B0L A;  5ERI A;  5L3F A;  2VBX A;  4M74 A;  4G7H F;  3OV8 A;  2QQ9 A;  2ZJ2 A;  4IJA A;  4LLN A;  2K4B A;  3MFK A;  4GYG A;  3I53 A;  3HRM A;  3Q5F A;  2ZNZ A;  2L4M A;  1MJ9 A;  2P5V A;  3O2P E;  2PG4 A;  1U5T B;  5E17 F;  2E1N A;  1R7J A;  1MGT A;  1W5T A;  5DEQ A;  3QOP A;  1OYI A;  2OU2 A;  2ESH A;  3ZPL A;  1ZG5 A;  2VN2 A;  3MAJ A;  1ZAR A;  4KN7 X;  4ENJ A;  1BIB A;  1HW1 A;  3ZN1 A;  2K27 A;  5HLI A;  4FX0 A;  2H6B A;  5A2Q Z;  1FC3 A;  2YX7 A;  4OOI A;  3TOA A;  3F8M A;  5AIQ A;  3CTA A;  4GO1 A;  5IT9 K;  4EM0 B;  2W24 A;  1IN6 A;  2WV0 A;  3KZY A;  2RQP A;  4LG0 A;  5D8L B;  2P5L C;  3WE2 A;  4ESJ A;  2MLK A;  3QU6 A;  1WKM A;  3H3U A;  2WTE A;  4LK0 F;  4U7D A;  2X0L A;  5D4S A;  3J7A O;  2C6Y A;  2FML A;  2P4W A;  3S2W A;  2BEO A;  2FMY A;  3N97 A;  4HBL A;  1OMI A;  4XLN F;  2MBF A;  4U0Y A;  2E1C A;  1JHH A;  1SD7 A;  5D4R A;  4JK1 X;  3LA3 A;  1ZLK A;  1K78 A;  4L9V A;  3GFJ A;  2K4J A;  2XIG A;  5HOO A;  2KJB A;  3TKY A;  4HDU A;  2Z99 A;  3D5L A;  2EFN A;  4ZZL A;  4LB5 A;  2YU3 A;  5HDG A;  3V7C A;  4RS8 A;  3L2C A;  2O8X A;  1E17 A;  2P7V B;  1QQI A;  3T5X A;  1ON2 A;  3WTW C;  2FA5 A;  5D5X B;  1U78 A;  2KIM A;  4AVP A;  1B1B A;  1H9T A;  4EJT A;  5DCF A;  3G73 A;  1HST A;  4FT8 A;  4TV7 A;  3JTH A;  3QU3 A;  2A07 F;  4LGW A;  2A68 F;  1FBS A;  2V1D A;  3V8K A;  2ELH A;  1EH7 A;  2RDP A;  5BS6 A;  3R0A A;  5D6E A;  4AIK A;  3BY6 A;  1ULY A;  2PN6 A;  2DT5 A;  3E3V A;  4ENN A;  3GWZ A;  1I1S A;  5FLX Z;  3E5U A;  2RN7 A;  2LF7 A;  4LK1 F;  1YW9 A;  4M72 A;  1FYK A;  2ACJ A;  2DQR A;  2QYO A;  2ETH A;  1ONV A;  3HIF A;  4NQW A;  1IXC A;  5FB2 A;  4B09 A;  4A5M A;  4PZJ A;  4PDK A;  1S3J A;  3COA C;  3ZN0 A;  1Z9C A;  4UV8 A;  4CIC A;  1R22 A;  5E18 F;  2FXA A;  1UST A;  4CDG A;  4RB3 C;  4FX4 A;  1O3S A;  3L9F A;  3F3X A;  3M9A A;  4FHT A;  2L01 A;  1PUE E;  2VC0 A;  3MZH A;  3U2R A;  3F8B A;  3TQN A;  2DBB A;  3BP8 A;  3LFK A;  2PI0 A;  2H27 A;  3WU0 A;  4R79 A;  3CJN A;  3E5Q A;  2XUB A;  1T39 A;  2XAQ A;  5FD6 A;  3QP5 A;  5CVV A;  3I58 A;  5HS8 A;  2G7H A;  2DO7 A;  2VBY A;  2FSW A;  2H6C A;  4A0Z A;  5J8F A;  3AAF A;  1DDN A;  1U3E M;  3WOD F;  1Z05 A;  4XBF A;  2OQR A;  2Y75 A;  5TRD A;  5A2Q K;  1ZH5 A;  3F6V A;  5L3G A;  3MCZ A;  4BXU A;  3NQO A;  5FGM A;  3ABU A;  4OIR F;  1IUY A;  2CWE A;  2E7W A;  4RAY A;  3DF8 A;  4L9N A;  1G4D A;  1IRG A;  4HV6 A;  3KEQ A;  2HGC A;  1FOK A;  4Q48 A;  3FF5 A;  1HW5 A;  1XGN A;  5L3D A;  2XKP A;  4F7Z A;  3KZZ A;  2FBK A;  1FY7 A;  1EH8 A;  2O3F A;  4EM1 A;  3ULQ B;  4M71 A;  5BOX A;  3K1M A;  2HKX A;  5CVI A;  3GYH X;  5FFX A;  2HEO A;  5H20 A;  3LAP A;  3VFZ A;  3RTR A;  2DTR A;  1MDM A;  2FNA A;  3BJA A;  5LRS A;  5J8C A;  5JVT A;  3FXU A;  3KLO A;  3BRO A;  4KMU X;  1K6O A;  4DQ2 A;  4L9J A;  3C7J A;  3R4K A;  1R36 A;  2X4H A;  2FQ3 A;  2CW0 F;  1FLI A;  2HQR A;  3T8T A;  1A04 A;  4WXD A;  2NRA C;  3QP6 A;  3RYP A;  4OIO F;  1R1T A;  3FWE A;  1IW7 F;  1BJA A;  4Z2Y A;  1FSE A;  2IW5 A;  2K86 A;  1SD4 A;  2HQN A;  3WTT C;  1J9I A;  2IVM A;  2MA3 A;  2BE5 F;  3GUD A;  1JE8 A;  2GXG A;  4HF1 A;  5FLX K;  3WTU C;  1XSX A;  4GGG A;  4D0P A;  2EA2 A;  1P4W A;  1YW7 A;  1LQ1 A;  1TQI A;  1XCB A;  4HX8 A;  3F22 A;  2XHK A;  2NAZ A;  2FNP A;  5BPI A;  1Z6T A;  1HSJ A;  1R1U A;  1LDK B;  1R00 A;  4K2E A;  2UXN A;  4HQM A;  1SFX A;  4XSX F;  4OU0 A;  1FZP B;  2D1V A;  2STW A;  1FT9 A;  3RI4 A;  1KA8 A;  4Y17 A;  2VE9 A;  1GXP A;  4R8H A;  2EV5 A;  3BWG A;  2ZME A;  1XGS A;  4HF0 A;  3KP3 A;  3WE3 A;  1MJB A;  3K1P A;  1U2W A;  2EWN A;  1IXR C;  2O03 A;  4WK8 F;  3SFZ A;  2LKP A;  4L0Z B;  4CYD A;  2P7C B;  3HOS A;  2JSC A;  4I2O A;  3TDU C;  5HDN A;  3M7G A;  1P92 A;  1HQC A;  3L7W A;  3IKV A;  1ZRE A;  2BYV E;  1XGO A;  4M73 A;  2D2W A;  4EV0 A;  2EFW A;  1J0R A;  1UHW A;  2XVC A;  3HYI A;  2DFI A;  3VB2 A;  3LQQ A;  4O5V A;  1OPC A;  1RI7 A;  2IA1 A;  3CUQ C;  4S05 A;  2HR3 A;  1G3T A;  1SMT A;  1ON1 A;  1JHF A;  2V6C A;  3WGG A;  2BBY A;  4HA8 A;  3W6K B;  2MH2 A;  3P9I A;  4ENM A;  1LB2 A;  4ASN A;  1RNL A;  1Y0U A;  2VE8 A;  2MLG A;  4RGS A;  2D1H A;  4P55 A;  1Z91 A;  1T2K A;  3TO6 A;  1QO0 D;  3DXJ F;  1PP7 U;  2BGC A;  2DLL A;  4XLP F;  1OYY A;  1IRF A;  2RV8 A;  4P9U A;  1IAW A;  4M9Z A;  3U9G A;  4MQV A;  1MD0 A;  1NHA A;  3E97 A;  3ELK A;  1JXS A;  1U8R A;  2FRH A;  4HDV A;  4EVI A;  1J2X A;  2IA2 A;  2YPR A;  1GVJ A;  2BV6 A;  3K9T A;  4Q4Z F;  3WTS C;  5CLS A;  4RGR A;  4UV9 A;  3FXQ A;  2W57 A;  1IXS B;  4U0W A;  1OKR A;  1T38 A;  1MZB A;  5CVJ A;  1KU7 A;  3E6B A;  4E70 A;  4KFC A;  4ZZD A;  2GA2 A;  1KYW A;  3F6O A;  2GXB A;  2VOO A;  1EH6 A;  2EV0 A;  2NYX A;  2JTV A;  3BPX A;  4YIF A;  3R6S A;  5DD4 A;  4JQF A;  3K1N A;  3DP7 A;  3MQ0 A;  4AD9 A;  1XSV A;  5KK1 A;  3JTG A;  3BPV A;  3I0T A;  1IN4 A;  3F8N A;  5DUI A;  3D0S A;  4LD5 A;  2GAU A;  5DD8 A;  1XDS A;  3BOQ A;  4N9H A;  4YFX F;  3CUQ B;  1AWC A;  1Z7U A;  1FBQ A;  4UVA A;  2F5D A;  5DCM B;  3KP5 A;  2QQB A;  3CO7 C;  2L54 A;  3HOT A;  1FWZ A;  4YFK F;  1LDD A;  2M30 A;  5E1Z B;  1ODD A;  4UVC A;  2HTJ A;  2GIV A;  4RGU A;  5H6R A;  5F1R A;  1BM9 A;  1FX7 A;  1B9M A;  3CDH A;  5CJ9 A;  3P9K A;  4YII A;  4N0B A;  4OMZ A;  1BN5 A;  3HSR A;  1F1Z A;  2FEZ A;  1W5S A;  2HWV A;  4U7B A;  1YTY A;  2TDX A;  3WGI A;  3K2Z A;  4KNY A;  4WX9 A;  3JW4 A;  3KLN A;  2JRT A;  4N9I A;  4HLX A;  1USS A;  1YIO A;  1ZRD A;  1SFU A;  1SFE A;  3WU1 B;  3ML6 A;  1XSD A;  1YS7 A;  3K0L A;  4RAZ A;  4I0A A;  1P2F A;  1SD5 A;  1BI2 A;  1HXD A;  1JGS A;  5BMZ A;  3L09 A;  2RC4 A;  4L9T A;  4MNU A;  2FBH A;  1LVA A;  2F5E A;  3DV8 A;  2G7U A;  2HYG D;  2O0Y A;  1TW2 A;  3ISP A;  1FP1 D;  1YG2 A;  3HTU A;  2HYF A;  1STZ A;  1ZGJ A;  3JSP A;  1KU9 A;  2HTS A;  3BDD A;  2Z33 A;  5IT3 A;  4AIJ A;  4ENK A;  5EEH A;  3FXR A;  5LGT A;  4RGX A;  1UB9 A;  2GQQ A;  3U1D A;  2KKO A;  4EJV A;  1WSU A;  4Y15 A;  3GFM A;  4OIN F;  1LEB A;  2VOD A;  2WWY A;  3GO5 A;  5LRR A;  3SZT A;  5JR3 A;  1F5T A;  2OAZ A;  1D5V A;  4JBA A;  3MZY A;  4M6X A;  2EFP A;  4B8X A;  2UZK A;  3DFG A;  1H9G A;  4G6D A;  3SHF A;  1XGM A;  2EJR A;  2Q8K A;  1BI3 A;  3T8R A;  1I6X A;  1KYZ A;  2XAS A;  5K5O A;  4RB2 C;  3TDZ C;  1ZRC A;  2P5K A;  5HVQ C;  2IT0 A;  4A6E A;  4LG0 B;  3IWF A;  2AS5 F;  2VON A;  1F9N A;  3MEX A;  5FFZ A;  3IKT A;  4M9X A;  3HHG A;  3BJO A;  2DK8 A;  2Q2E A;  3W6J B;  4Q5S F;  3WTX C;  2YX4 A;  3MWM A;  1J75 A;  5HLG A;  1KQ9 A;  3WG9 A;  1G3W A;  2O61 A;  5DYM A;  2ESN A;  4LLL A;  1P4A A;  5LBQ A;  4KIG A;  1K78 B;  1ZG1 A;  1HBX G;  2P6S A;  2IPQ X;  2IJL A;  5D5V B;  3I64 A;  4L18 B;  1UCR A;  1SAX A;  1ZN2 A;  3M8F A;  2IA0 A;  5LHH A;  1IZ1 A;  4I98 B;  3F21 A;  2QBY A;  1FYL A;  2PBI A;  3RPQ A;  3TOB A;  3H3Z A;  3I59 A;  5HDK A;  2DI3 A;  5ILU A;  1QNT A;  2RKH A;  4A6D A;  5FD5 A;  2W25 A;  2XRN A;  2YSR A;  1WI9 A;  4HX4 A;  1V4R A;  2HZT A;  2MC3 A;  5LGU A;  4G8X A;  3BJ6 A;  3J81 Z;  1UHM A;  1YQA A;  3ZP5 A;  2UWM A;  4OMY A;  2M45 A;  4ZH4 F;  2M8E A;  4P9F A;  1TNS A;  2ZFW A;  4ZYG A;  3R61 A;  1D8K A;  4H0E A;  4IPA A;  2OQG A;  3JAM Z;  2QEN A;  2YR2 A;  3QAH A;  4U0V A;  4A0X A;  2JPC A;  4P96 A;  1J7K A;  1YW8 A;  4PGG A;  2DPU A;  2OA4 A;  1B9N A;  3E6M A;  2FE3 A;  2W84 A;  4ON0 A;  2QQA A;  3ZQ7 A;  3I54 A;  4CHU A;  4CXF A;  2CO5 A;  1HKS A;  3RKX A;  5ILV A;  2R7F A;  4HF2 A;  1ZHF A;  1TQM A;  5AIP A;  5E1W A;  3SZP A;  1BC8 C;  2FBI A;  3I4P A;  1UFM A;  4PCQ A;  1R5H A;  4MTD A;  2ADU A;  3F72 A;  3G3Z A;  2Z3Y A;  2CFX A;  1PP8 F;  2ZCW A;  1HKT A;  4I02 A;  1AOY A;  2LDU A;  3QPT A;  1W7P A;  2OZ6 A;  4I7H A;  2CQK A;  4BQA A;  2V1X A;  2L4A A;  4I01 A;  1QZY A;  4BNC A;  1IN7 A;  3K69 A;  2DQL A;  3HRS A;  3CO6 C;  1R58 A;  2J5P A;  2P6T A;  2P8T A;  3QRF F;  1FPQ A;  3BZ6 A;  2EB7 A;  3ECO A;  5K1Y A;  3SQN A;  1FBU A;  3J80 Z;  3IRQ A;  2GZW A;  4WXC A;  4IHT A;  1S7O A;  2GA1 A;  3I71 A;  4RB0 A;  2QWW A;  3Q9V A;  5IT9 Z;  2JPB A;  5J6X A;  2EFQ A;  4KIB A;  4S04 A;  5LEK A;  4EJU A;  2MH9 A;  5ILS A;  2DPD A;  2LSO A;  2HDC A;  3GZ6 A;  2IRF G;  1MDM B;  4IRI A;  1KU2 A;  4UUV A;  3GW2 A;  1XCV A;  3GLX A;  3KFW X;  3WTV C;  3EUH A;  3NEU A;  1U5T A;  5D8K B;  3WTZ A;  5LGN A;  3FMQ A;  1I1G A;  4NB5 A;  3RYR A;  5H6Q A;  4HOB A;  4A0Y A;  3LQR A;  2EK5 A;  2WC2 A;  4ZYH A;  3C3W A;  4KMF A;  1Q1H A;  1BC7 C;  4EJW A;  3PQK A;  3CUO A;  3FM5 A;  2EA4 A;  3J81 K;  2M5W A;  1TLH B;  2GWR A;  4G6Q A;  3ZMT A;  4HYE A;  2V1U A;  6PAX A;  1P4X A;  1L0O C;  3JAM K;  1J59 A;  1ZGA A;  5LLQ A;  1W7P B;  2HS5 A;  2OBP A;  1S6L A;  5ICC A;  1GHC A;  4ESB A;  5K5Q A;  2KJC A;  1RUN A;  4MTE A;  1W4M A;  1O3T A;  4WF2 A;  3EQL F;  3KP7 A;  1ZYR F;  3LAJ A;  4OIQ F;  1YYV A;  5KVR A;  4A5N A;  2VC1 A;  2A6H F;  1LNW A;  2ZME B;  2Z9O A;  1HKQ A;  3O6B B;  5L3B A;  3V8L A;  2JZY A;  1IF1 A;  1W7P D;  2ISZ A;  2DAO A;  4O3M A;  2CG4 A;  4EGZ A;  1FSH A;  2F2E A;  1L3L A;  1DP7 P;  4KUM A;  1SD6 A;  4KA4 A;  2OZU A;  5BQT A;  3RJP A;  4P5O A;  2HFH A;  4RB1 A;  5JHU A;  2VBW A;  2OD5 A;  3REO A;  3T0Y A;  1O3R A;  3KP6 A;  2W85 A;  2Y0M A;  4EGY A;  4M9S A;  5CVR A;  3WGH A;  3ZMZ A;  1T6S A;  3ZMU A;  3ZMD A;  1O3Q A;  3N4M A;  4HV5 A;  3TGN A;  2A6E F;  1I27 A;  4QWQ A;  4EJO A;  3J80 K;  4HX7 A;  4G7Z F;  4GYI A;  2ZXJ A;  5HLH A;  2QLZ A;  4L0Y B;  3F8F A;  1RUO A;  1T98 A;  1RZ4 A;  3IWZ A;  1EV7 A;  1XMA A;  1CGP A;  5EEG A;  5JI6 A;  4IVN A;  2FOK A;  2D45 A;  4M6Y A;  2QZ8 A;  2F5F A;  5LHI A;  1DUX C;  4GXO A;  1BI1 A;  3HUG A;  2PQ8 A;  1SMY F;  2XAG A;  3VOD A;  1QGP A;  2XV4 S;  2Z5U A;  3KE2 A;  4AWX B;  5CVU A;  2ZNY A;  2L3D A;  1P6R A;  3SXY A;  4KYW A;  2A3S A;  1B4A A;  1ZG3 A;  2LF8 A;  2A5Y B;  4MEY F;  3L00 A;  4MHG A;  3LWF A;  1WQ2 A;  4ETS A;  3P9C A;  1FP2 A;  4BHP A;  3LA7 A;  5AON A;  3KP4 A;  2EV6 A;  4UHT A;  5DV5 A;  3V4G A;  3LA2 A;  4GCV A;  2JT1 A;  3GX4 X;  3DKW A;  2H09 A;  4KDP A;  3OOP A;  3HRU A;  3R60 A;  2PEX A;  5ED4 A;  2J5O A;  2DK5 A;  1QZZ A;  4A2U A;  4Q47 A;  3PQJ A;  1BI0 A;  1OR7 A;  1CF7 A;  1ZAO A;  5ICG A;  2XGX A;  3HSF A;  3GFL A;  1X3U A;  1K79 A;  1B59 A;  3TO7 A;  3RDI A;  2XAH A;  2NNN A;  4WXH A;  1TBX A;  3P7N A;  5E1X A;  3VEP A;  4CZZ A;  3GEZ A;  5FO5 A;  3IRR A;  4I09 A;  5HS9 A;  3ZMS A;  3E5X A;  1S7A A;  4IF4 A;  3E6C C;  1D3Y A;  1DPU A;  3KEO A;  3M8E A;  1KU3 A;  2F5C A;  1B6A A;  4ESF A;  3GF2 A;  4LB6 B;  3EYY A;  4G9Y A;  3KCC A;  1H0M A;  2EFO A;  5CYV A;  2COM A;  1G6N A;  1FNN A;  4O6J A;  3R0J A;  2PJP A;  3ROU A;  2XAJ A;  3E6D A;  2RVC A;  4IHS A;  2QVO A;  4HAM A;  4G7O F;  4MEX F;  2STT A;  5E20 A;  5F6F A;  1R23 A;  2V9V A;  3FZV A;  1YO5 C;  1R5G A;  3C18 A;  4BAY A;  3B73 A;  1V3F A;  5BPD A;  4NHJ A;  1DPR A;  4YG2 F;  2FF4 A;  3IC7 A;  1HW2 A;  4L5I A;  3RPU A;  4BHB A;  2MD5 A;  3FHZ A;  2QUF A;  5F64 A;  5DDG A;  5JFR A;  2M1B A;  3V7R A;  4PGH A;  5D5W B;  3C1D A;  2VT3 A;  4Y13 A;  4UNO A;  2M87 A;  4UXN A;  3T1B A;  1MJA A;  2O6G E;  4KT5 C;  3IL2 A;  3CLO A;  1Z6R A;  1FYM A;  1RIO H;  1G3Y A;  4KN4 X;  1R1V A;  2R3S A;  1CF7 B;  2VBZ A;  3HHH A;  2DW4 A;  4U88 A;  1QBJ A;  3F23 A;  2NS0 A;  2KRF A;  2VXZ A;  5DUK A;  2RNJ A;  5LEJ A;  2VOP A;  1Z1D A;  3F8C A;  1YFH A;  3KET A;  1REP C;  1G3S A;  3QPH A;  1ZLJ A;  2XRO A;  2A61 A;  1YLF A;  2UXX A;  4HZF A;  4KIC A;  1TW3 A;  2NNY A;  1XB4 A;  1VTN C;  1T0F A;  1K7A A;  1MKM A;  3ABT A;  2V79 A;  3GZ5 A;  1LEA A;  2PMU A;  2QM3 A;  4AIH A;  1GXQ A;  4G94 A;  3RKW A;  2PMH A;  2VT2 A;  4CO8 A;  4MGR A;  3HRT A;  5L3C A;  4L5J A;  5L3E A;  2KIU A;  2HKO A;  4EQQ A;  3NRV A;  4HLY A;  2CSO A;  3EYI A;  2HOE A;  2QBY B;  1LDJ A;  3I59 B;  1TNT A;  4IXA A;  4KIF A;  4XRF A;  1BIA A;  4A12 A;  3DQV C;  3GVA A;  1KQ8 A;  3M1E A;  1TQP A;  4LJZ F;  2K7L A;  5ICF A;  2G9W A;  3GFI A;  1F4K A;  3HSE A;  1YS6 A;  5ICE A;  4HW0 A;  1E2X A;  3TO9 A;  3KP2 A; 
#chains in the Genus database with same CATH topology
 2CYY A;  3VOE A;  4A3F J;  3V7S A;  1TWH J;  2ZO4 A;  4IRG A;  3HG9 A;  4E7I A;  2XPW A;  2E7X A;  4ZYE A;  3BR5 A;  1OQY A;  4I0B A;  3OS1 A;  3L2W A;  4CGZ A;  2R7D A;  1D8J A;  1OYW A;  1WWX A;  2ZKZ A;  4XN3 A;  3I5U A;  3IP4 B;  3EET A;  2YS9 A;  3RPU D;  1O7F A;  4E6K G;  2R4G A;  1PDN C;  2V9P A;  2K5C A;  4Y33 A;  4LFU A;  3O3K A;  3CF5 F;  4OIP F;  2LNB A;  4D7M A;  2KIS A;  2HVS A;  3GBG A;  5E8G A;  5E8I A;  3S17 J;  2XF5 A;  2K02 A;  2R7S A;  5GAE J;  2XKO A;  4HSR A;  5K5R A;  1YE9 A;  5LHG A;  3K4L A;  4C3H J;  3N05 A;  4WCG A;  2JVH A;  3GXO A;  1U6G A;  1TTY A;  1S8N A;  5IP9 J;  3EDP A;  1B72 B;  3G2B A;  4LG3 A;  1KQ0 A;  3HGG A;  3DTI A;  4X1E A;  1BOA A;  1BBY A;  3DPL C;  4LLG F;  1I5Z A;  3VYR B;  2DYS H;  3LOC A;  3PFI A;  4XLE A;  1HLV A;  1XN7 A;  2M4K A;  2MAB A;  4S0H B;  3BT9 A;  1J5Y A;  4DNC A;  2VQG A;  4R1H A;  2QA4 I;  4UVB A;  4MQ9 F;  3ERE D;  3CUQ A;  3IH3 A;  3EUH C;  1VQP I;  2XAF A;  3HOU J;  5JVG F;  3IHU A;  3B6C A;  2W4S A;  1U5T C;  3LL7 A;  4EMS A;  3FK6 A;  3V8J A;  2LY9 A;  2QSH X;  1VQ7 I;  5D5U B;  2R7O A;  1IG7 A;  2ZBK A;  4BGD A;  3M8J A;  5DCM A;  3TED A;  2P0W A;  1LVK A;  1X1D A;  3DPT A;  2Y48 A;  1HA8 A;  1S29 A;  1VQO I;  2H94 A;  4IEJ A;  5D6F A;  3FMR A;  1X1C A;  2RGV A;  3H92 A;  3W2W A;  2HPM A;  2CGP A;  1DU6 A;  2VIX A;  3RIR A;  1P9Q C;  1KON A;  2CQX A;  2CUJ A;  4XLF A;  4BHC A;  4XSZ F;  4FIS A;  3H1C A;  1BR1 A;  1XPX A;  1IRZ A;  1WGX A;  4IRH A;  3IH4 A;  2HVQ A;  2QF7 A;  1UZC A;  2CQN A;  2DA1 A;  3Q0U A;  5FKM A;  2BY2 A;  3OOU A;  4WWC A;  3S1R J;  1RKW A;  5J4V A;  3RKY A;  3FM3 A;  4QLC U;  5IP7 J;  1XDU A;  5HS7 A;  1WRJ A;  1H8A C;  3CCU I;  1ZEL A;  4KJZ A;  3B02 A;  1D5Y A;  4BH9 A;  3HTS B;  2A5W A;  2H8R A;  1QPM A;  1YOV B;  4NC8 A;  3ZMV A;  1BOB A;  3G1O A;  3FMS A;  4LMY A;  1IN5 A;  2VPR A;  3GTJ J;  1FIA A;  3K2A A;  5TJJ A;  4CCK A;  1O57 A;  5IYB J;  1MH3 A;  4YFN F;  2PLY A;  4BJ5 C;  2EZI A;  4HNT A;  1YJ9 I;  1SVO A;  1DQU A;  3HPG A;  4QTR A;  4BBS J;  2ISY A;  4BYY A;  1C0W A;  2Q0O A;  3S16 J;  1FIP A;  2CJJ A;  1KGS A;  5GAH J;  2A69 F;  2F6C A;  2VB6 A;  3LST A;  3LSI A;  2FU4 A;  3LSH A;  2EIN H;  3FX3 A;  5GP9 A;  1PJR A;  1HDD C;  2AXL A;  2OCC H;  3DEU A;  3TW6 A;  1YI2 I;  2R7X A;  4W97 A;  3ECH A;  1WHU A;  1ZRF A;  3CC7 I;  3JSO A;  2IP2 A;  3WTY C;  1JT6 A;  4A3K J;  2L02 A;  1IN8 A;  2PFB A;  3Q9S A;  3OY9 A;  3OYH A;  1XD7 A;  1O7L A;  2HNH A;  2KIF A;  4AU7 A;  4XKV A;  4ZYD A;  1XMK A;  3BTC A;  4HQE A;  2DU9 A;  4XR6 A;  1X2N A;  4EM2 A;  4JX5 A;  4HST A;  1LJ9 A;  2GIZ A;  2B0L A;  5ERI A;  5L3F A;  2VBX A;  4M74 A;  2LKS A;  4G7H F;  1JJ6 C;  3OV8 A;  4E7S A;  9ANT A;  2DJN A;  2QQ9 A;  2YUS A;  3LFU A;  2ZJ2 A;  4IJA A;  4E7K A;  3KYL A;  4LLN A;  2K4B A;  3MFK A;  4GYG A;  1T95 A;  3I53 A;  2E19 A;  3HRM A;  3Q5F A;  2ZNZ A;  2L4M A;  1MJ9 A;  2HXI A;  2BW3 A;  2P5V A;  3O2P E;  3QOE A;  1GUU A;  2PG4 A;  1U5T B;  3JRF A;  5E17 F;  2E1N A;  2VAS A;  1R7J A;  3RQ4 A;  3LSP A;  3H3V K;  1U9O A;  1MGT A;  1W5T A;  1EF4 A;  2WAQ A;  4PFO A;  1RRJ A;  5DEQ A;  3QOP A;  1YX5 A;  3CCE I;  1OYI A;  2OU2 A;  2ESH A;  3ZPL A;  3ZQH A;  1YRN B;  1ZG5 A;  1X3W B;  2VN2 A;  2GLO A;  3VSK A;  3ASN H;  3CDI A;  4M3G A;  1OCT C;  3MAJ A;  1ZAR A;  3H9J A;  3I9V 2;  4KN7 X;  2KDO A;  4ZDO A;  4D7N A;  2HPI A;  4ENJ A;  1BIB A;  1HW1 A;  5DM6 F;  3ZN1 A;  4PFP A;  1VZ0 A;  4J01 A;  2K27 A;  4XMY A;  1TC3 C;  4BQO A;  5HLI A;  4FX0 A;  2H6B A;  4A69 C;  1D1A A;  5A2Q Z;  1FC3 A;  2YX7 A;  4OOI A;  3TOA A;  3F8M A;  2DDB A;  5AIQ A;  5BNG A;  3GLL A;  1WJE A;  3CTA A;  3FXO A;  4GO1 A;  5IT9 K;  1Y1W J;  1D1B A;  1ETK A;  4EM0 B;  4ZYA A;  2W24 A;  1IN6 A;  2WV0 A;  3KZY A;  3S3O A;  2RQP A;  4LG0 A;  3ZGK A;  5D8L B;  2P5L C;  3WE2 A;  4ESJ A;  2MLK A;  2WV1 A;  3QU6 A;  3RQI A;  4XON A;  3VDX A;  1WKM A;  4CYC A;  3H3U A;  2OTL I;  2WTE A;  1B8I A;  5F27 A;  4RDU A;  4LK0 F;  4U7D A;  2Z16 A;  2X0L A;  5D4S A;  2KDZ A;  1SC7 A;  2XPV A;  3J7A O;  2C6Y A;  2FML A;  4XIC A;  2P4W A;  2EIK H;  3S2W A;  2KT0 A;  2BEO A;  2BY1 A;  2FMY A;  1UMQ A;  2DDA A;  2E36 A;  2LBF A;  5LD2 C;  3N97 A;  3FXK A;  5KNL A;  4HBL A;  1OMI A;  4XLN F;  3ZRG A;  2MBF A;  1ZKG A;  1TT0 A;  4U0Y A;  2E1C A;  1JHH A;  3AG4 H;  1SD7 A;  5D4R A;  5C4X J;  3DTK A;  4JK1 X;  3LA3 A;  1ZLK A;  3PIP F;  1K78 A;  3MN2 A;  2K9M A;  4L9V A;  3GFJ A;  2XGC A;  2K4J A;  2XIG A;  4UUT A;  4NBQ A;  5HOO A;  2KJB A;  3TKY A;  4ZDP A;  4HDU A;  2Z99 A;  3D5L A;  1VQN I;  3QPS A;  1UG2 A;  2EFN A;  2VJ5 A;  4ZZL A;  1OLT A;  4I6Z A;  4LB5 A;  2ZXI A;  2YU3 A;  5HDG A;  5CQE A;  4AYB N;  3V7C A;  2R93 J;  4RS8 A;  3L2C A;  1G8X A;  2OUM A;  2EZK A;  1POG A;  2DMT A;  2O8X A;  1E17 A;  2KP6 A;  1OIS A;  2CFO A;  2P7V B;  1QQI A;  3T5X A;  3CCY A;  1ON2 A;  3K6G A;  3TMO A;  5EGO A;  3WTW C;  2FA5 A;  5D5X B;  4DBQ A;  1LE8 B;  1I3Q J;  1U78 A;  2KIM A;  2MG4 A;  4AVP A;  1B1B A;  1H9T A;  1DP3 A;  4EJT A;  4NC7 A;  5DCF A;  1HST A;  2WB1 N;  3G73 A;  2HYJ A;  3EUK L;  1JKO C;  1X4P A;  1YJN I;  4FT8 A;  1T56 A;  4HRI A;  3A02 A;  2IGN A;  4TV7 A;  1A6I A;  1LUJ B;  3JTH A;  2BW3 B;  2E60 A;  3QU3 A;  1ZR4 A;  2A07 F;  2HOS A;  4LGW A;  2A68 F;  1FBS A;  2F48 A;  2V1D A;  5J47 A;  1VF9 A;  3V8K A;  1JI8 A;  3OR2 C;  3I56 I;  2ELH A;  1EH7 A;  2RDP A;  5BS6 A;  2JA5 J;  1SVL A;  3R0A A;  4BEH B;  1OR7 C;  2HQA A;  2QKL B;  5D6E A;  4AIK A;  3BY6 A;  1ULY A;  5FKN A;  2PN6 A;  4A3I J;  5H2F C;  2VJI A;  2DT5 A;  3E3V A;  4ENN A;  3GWZ A;  1I1S A;  5FLX Z;  3CJQ B;  3E5U A;  4BXX J;  2RN7 A;  3OYB A;  2LF7 A;  1MND A;  5FRN A;  4LK1 F;  1YW9 A;  4M72 A;  1FYK A;  2ACJ A;  3WU2 C;  2DQR A;  2JJ7 A;  4MO7 A;  3K4M A;  2ME0 A;  2QYO A;  2ETH A;  3DLA A;  4ZTF A;  1ONV A;  5IY5 H;  3BTJ A;  2W1O A;  3HIF A;  4BU2 A;  4NQW A;  4A3D J;  4KIT B;  1IXC A;  5FB2 A;  4CZC A;  4B09 A;  4A5M A;  5FKK A;  4PZJ A;  1BJZ A;  3ONQ A;  4PDK A;  1S3J A;  3COA C;  1MIJ A;  4V2G A;  3ZN0 A;  3H0D A;  1Z9C A;  4UV8 A;  2EIM H;  1FOX A;  4CIC A;  1R22 A;  5E18 F;  2FXA A;  1UST A;  4CDG A;  4RB3 C;  4FX4 A;  1O3S A;  1ETQ A;  3L9F A;  2PMZ N;  3HUG B;  3F3X A;  3M9A A;  3FIS A;  1JT0 A;  2VKV A;  4FHT A;  2L01 A;  2VJ4 A;  1PUE E;  2VC0 A;  3A01 A;  3MZH A;  3U2R A;  3F8B A;  3TQN A;  2WAE A;  2DBB A;  3BP8 A;  3LFK A;  1EKE A;  2PI0 A;  4MIM A;  3WU0 A;  2H27 A;  2K3F A;  4R79 A;  3CJN A;  1LFU P;  1X4O A;  3E5Q A;  2XUB A;  2LK2 A;  1T39 A;  2XAQ A;  5CKT A;  5FD6 A;  1AA7 A;  3BTI A;  3QP5 A;  3ZQG A;  4NDL A;  5CVV A;  3I58 A;  5HS8 A;  2G7H A;  2K9S A;  4LIV A;  2L2O A;  2VKH A;  2DO7 A;  3ZXS A;  2VBY A;  2XAU A;  4BE2 A;  2FSW A;  2H6C A;  4A0Z A;  5CPR B;  3CD6 I;  5J8F A;  1DGR M;  3AAF A;  1DDN A;  2FUG 2;  2H1K A;  1U3E M;  3WOD F;  1Z05 A;  1WJB A;  1YIJ I;  4XBF A;  2OQR A;  2Y75 A;  4ZC3 A;  5TRD A;  5A2Q K;  4Y4R A;  5EGO B;  3F6V A;  1ZH5 A;  5L3G A;  3MCZ A;  3WHB A;  4BXU A;  4J00 A;  3NQO A;  3PSF A;  5FGM A;  5GAG J;  3ABU A;  1A36 A;  4DOZ A;  4OIR F;  2E1O A;  1IUY A;  2L0K A;  3I55 I;  3UR3 C;  3S3N A;  2K40 A;  2CWE A;  2E7W A;  4RAY A;  3DF8 A;  4L9N A;  1OCP A;  1G4D A;  4A3L J;  3CC4 I;  3LSK A;  1D0Y A;  4NNJ A;  1IRG A;  2DMP A;  4HV6 A;  3KEQ A;  2HGC A;  2XGD A;  4Q48 A;  1FOK A;  3FF5 A;  1QZE A;  3IUO A;  2R7R A;  1XS9 A;  3OSG A;  1HW5 A;  1XGN A;  5L3D A;  2XKP A;  3LMM A;  2IS6 A;  4F7Z A;  3KZZ A;  2FBK A;  1FY7 A;  1EH8 A;  2O3F A;  3DBH B;  4EM1 A;  1RKT A;  3ULQ B;  4M71 A;  5BOX A;  3K1M A;  2HKX A;  1JJ8 C;  5CVI A;  3GYH X;  5FFX A;  1AHD P;  1FOW A;  2HEO A;  3H35 A;  1IV6 A;  5H20 A;  1R4M B;  1YX3 A;  3LAP A;  3H36 A;  2RNG A;  2E5Z A;  3BTL A;  2E35 A;  1YHQ I;  2NXN B;  3VFZ A;  3NWS A;  3U21 A;  3HB9 A;  4PJJ A;  3RTR A;  2DTR A;  1MDM A;  2FNA A;  1IGN A;  3BJA A;  2ELJ A;  1A5J A;  4PUS A;  2BY0 A;  1T33 A;  4PJL A;  1BL0 A;  5LRS A;  5J8C A;  5JVT A;  3FXU A;  2FQ4 A;  3KLO A;  3BRO A;  4N4N B;  5F0C A;  4KMU X;  1QA6 A;  2DJI A;  5J1U A;  5J3L A;  4MFD A;  3CC2 I;  1K6O A;  4DQ2 A;  4L9J A;  5FLM J;  4IHX A;  5LFA A;  2ZJR F;  2E2J J;  1D0X A;  3C7J A;  3R4K A;  1R36 A;  1T0F C;  2X4H A;  2FQ3 A;  2CW0 F;  3K4J A;  2L7K A;  4BJT A;  2VXD A;  1FLI A;  2OCE A;  4DYQ A;  2HQR A;  3T8T A;  1A04 A;  1H89 C;  4WXD A;  4GFB A;  1NTC A;  1GVD A;  2NRA C;  3QP6 A;  4AVZ A;  2TCT A;  3RYP A;  2Q1Z B;  4DGW B;  2ZFU A;  4OIO F;  1R1T A;  4BY7 J;  2GOM A;  3FWE A;  1IW7 F;  1BJA A;  2LFB A;  3I4N J;  3M1C A;  1FSE A;  2IW5 A;  4Z2Y A;  2K86 A;  4P1W A;  1SD4 A;  3K7A J;  2HQN A;  3ZQI A;  3OIP A;  2DA2 A;  3WTT C;  1J9I A;  2VL8 A;  2IVM A;  4PJ0 C;  2MA3 A;  2HI3 A;  2BE5 F;  1O4X A;  3GUD A;  1HDP A;  1JE8 A;  3ZQC A;  2GXG A;  2K9N A;  4B3A A;  4HF1 A;  5FLX K;  1H88 C;  3WTU C;  5FKO A;  3BQZ A;  4GDF A;  4BBR J;  2E5N A;  4IL6 C;  2R5Z A;  5IYD J;  1XSX A;  4GGG A;  4XN0 A;  3BR1 A;  4D0P A;  2EA2 A;  2H1L A;  5M5X J;  1A6Q A;  4BL0 B;  2CW7 A;  3DU5 A;  2LP0 A;  2V4J C;  1MMA A;  3PL8 A;  1P4W A;  1YW7 A;  3CCV I;  1TQI A;  1XCB A;  1LQ1 A;  4HX8 A;  3ABL H;  4UB8 C;  3F22 A;  5KCM A;  2XHK A;  1K61 A;  2NAZ A;  2FNP A;  3CLQ A;  1OJL A;  4DBR A;  3B6A A;  5BPI A;  1Z6T A;  3H5R A;  1HSJ A;  1R1U A;  1AKH A;  1LDK B;  1R00 A;  2BZT A;  2MSY A;  4K2E A;  4QPO A;  1K4S A;  4X6A J;  2O5R A;  3OR1 C;  3K70 C;  2UXN A;  4HQM A;  1SFX A;  2BVM A;  4XSX F;  4OU0 A;  1FZP B;  1D0Z A;  2D1V A;  1S5L C;  2VKE A;  3OIQ A;  3VWB A;  2STW A;  4XLH A;  1FT9 A;  3KZI C;  2H8W A;  1ETV A;  3RI4 A;  1KA8 A;  4Y17 A;  2VE9 A;  1GXP A;  4R8H A;  2EV5 A;  2VQH A;  1BW5 A;  3BWG A;  2ZME A;  1XGS A;  2Y30 A;  4ITV A;  2DMU A;  4HF0 A;  3KP3 A;  3WE3 A;  1A35 A;  4D5C A;  1MJB A;  3TL4 X;  3K1P A;  1X58 A;  1S9H A;  2R5Y A;  1U2W A;  2EWN A;  3VYS B;  1IXR C;  2O03 A;  3OWT A;  2F5V A;  3E7L A;  4XOP A;  4WK8 F;  3SFZ A;  2LKP A;  4L0Z B;  3IAS 2;  2NVY J;  2LLK A;  4CYD A;  1ERD A;  2P7C B;  2AQE A;  3HOS A;  4BDZ A;  1A31 A;  3FHN A;  1TWF J;  2BVL A;  5IPA A;  1TWA J;  2JN6 A;  1P7J A;  2JSC A;  4I2O A;  2Y9Y A;  3TDU C;  3G6E I;  5HDN A;  3M7G A;  3S2H J;  1SVM A;  2L9S A;  3W2V A;  3SEQ A;  1P92 A;  1HQC A;  3L7W A;  2LRD A;  3IKV A;  3FKI J;  1ZRE A;  5IOZ A;  2V1N A;  2BYV E;  2M9H A;  2BHZ A;  3AG3 H;  2Y69 H;  2ECC A;  1XGO A;  3PNT A;  4M73 A;  1R9T J;  4IHY A;  1JUM A;  2D2W A;  3DCF A;  3S2D J;  4EV0 A;  2EFW A;  1J0R A;  1UHW A;  2XVC A;  3HYI A;  2DFI A;  5FLV A;  2Y0S N;  3S15 J;  3VB2 A;  3D5R C;  3LQQ A;  1OPC A;  4O5V A;  1Z77 A;  5EG0 B;  1RI7 A;  2IA1 A;  2E34 A;  3CUQ C;  4D9J A;  3GTK J;  4S05 A;  1VI0 A;  1XMX A;  2HR3 A;  2VI6 A;  1SMT A;  1G3T A;  1ON1 A;  1Z3X A;  2CW8 A;  2L7F P;  3U1K A;  1JHF A;  2B7E A;  2FOW A;  2DA4 A;  2V6C A;  3WGG A;  2BBY A;  1S7E A;  2X1C A;  4HA8 A;  3W6K B;  3D1N I;  4IQJ A;  2MH2 A;  1U0J A;  2NOJ B;  3P9I A;  4ENM A;  1UJ8 A;  1LB2 A;  1TP4 A;  4ASN A;  1RNL A;  2DN0 A;  1GT0 C;  3PO2 J;  3M4O J;  2W7N A;  1Y0U A;  2KHM A;  2VE8 A;  4F91 B;  1BR4 A;  2MLG A;  3ASO H;  4RGS A;  2D1H A;  3A2K A;  4P55 A;  4PSX A;  1Z91 A;  3JRC A;  1T2K A;  4E7J A;  3BC8 A;  1PVE A;  2ZJQ F;  3BG5 A;  3TO6 A;  1QO0 D;  1Y8R B;  3DXJ F;  1PP7 U;  2BGC A;  2DLL A;  5EZH A;  4XLP F;  1DGW Y;  4UUS B;  1OYY A;  2LY1 A;  4EAT A;  4CCM A;  1JTX A;  1IRF A;  4HG2 A;  2RV8 A;  4P9U A;  3HZJ A;  4B47 A;  1E3P A;  4ZTJ A;  4CH7 A;  1IAW A;  2GOX B;  4M9Z A;  3U9G A;  2KFD A;  2MD0 A;  4MQV A;  1MD0 A;  1NHA A;  3E97 A;  3ELK A;  5FRM A;  1JXS A;  1U8R A;  2FRH A;  4HDV A;  3FBI B;  3S8P A;  3OS2 A;  3CME I;  4N4O B;  2ZXW H;  4EVI A;  1J2X A;  3A03 A;  2IA2 A;  2HU9 A;  2YPR A;  1GVJ A;  5E3L A;  2BV6 A;  5F08 A;  3K9T A;  4Q4Z F;  3WTS C;  5CLS A;  3CDL A;  4RGR A;  4UV9 A;  2QCO A;  3LSG A;  3J7Z I;  3FXQ A;  2W57 A;  4HNU A;  3E0J B;  1IXS B;  4LOC A;  4U0W A;  1OKR A;  1T38 A;  1MZB A;  4A3J J;  5CVJ A;  1KU7 A;  3E6B A;  4E70 A;  3K70 D;  4KFC A;  4ZZD A;  2GA2 A;  2R5Y B;  5M3F J;  1KYW A;  3F6O A;  4IZZ A;  2GXB A;  2VOO A;  1EH6 A;  1XTA A;  2EV0 A;  4AYB A;  3L1P A;  2NYX A;  2JTV A;  3BPX A;  4YIF A;  3R6S A;  5DD4 A;  4DIQ A;  4RAG A;  1WI3 A;  4JQF A;  3FXM A;  3K1N A;  3DP7 A;  3MQ0 A;  4BAC A;  2DMN A;  4AD9 A;  1JTY A;  1XSV A;  5KK1 A;  3JTG A;  1TT5 B;  3BPV A;  1IN4 A;  3F8N A;  3I0T A;  5DUI A;  2UUZ A;  3D0S A;  4LD5 A;  3L2U A;  2PJR A;  2GAU A;  3F9K A;  5DD8 A;  2R7T A;  2MW8 A;  1XDS A;  4F55 A;  3BOQ A;  4N9H A;  4YFX F;  2VQC A;  3KYC B;  3CUQ B;  1AWC A;  3BR6 A;  2WB1 A;  1Z7U A;  2LH9 A;  3CCL I;  1FBQ A;  3RSN A;  4UVA A;  3PFY A;  2F5D A;  3TP0 A;  4KIS A;  3DBL B;  4D1Q A;  5DCM B;  3CCQ I;  3KP5 A;  2QQB A;  2L54 A;  3CO7 C;  3HOT A;  1FWZ A;  4YFK F;  1LDD A;  3PSI A;  2QSF X;  2M30 A;  4NUB A;  3D5S C;  1ODD A;  4UVC A;  5E1Z B;  4E7L A;  2HTJ A;  2ZJP F;  2I5U A;  3PNY A;  2GBY A;  3AFH A;  3FBN B;  2GIV A;  1BA5 A;  3VYU B;  1LFB A;  2F4M B;  2O7O A;  4RGU A;  1BM9 A;  5H6R A;  5F1R A;  1IDY A;  5E3M A;  1FX7 A;  1B9M A;  4IOC F;  3RZO J;  3CDH A;  2JUG A;  3AG2 H;  5C4J J;  5CJ9 A;  1I50 J;  3OMY A;  3P9K A;  2V26 A;  4YII A;  4N0B A;  3P5J A;  4OMZ A;  1BN5 A;  3HSR A;  1W36 C;  1F1Z A;  2FEZ A;  1SAU A;  1X3Z B;  1W5S A;  2HWV A;  4U7B A;  2LD5 A;  2UV1 A;  1TZL A;  1YTY A;  2TDX A;  4YEL A;  4BE1 A;  1QHG A;  3WGI A;  3K2Z A;  3QOD A;  4KNY A;  4J19 A;  4WX9 A;  3JW4 A;  3S1M J;  3KLN A;  2JRT A;  1EA3 A;  4N9I A;  1NH3 A;  1I3A A;  4RM3 A;  2AXT C;  2BXY A;  1USS A;  4HLX A;  5CQG A;  1YIO A;  2EZH A;  1ZRD A;  1SFU A;  1SFE A;  3WU1 B;  3ML6 A;  2KIQ A;  2M34 A;  3Q0W A;  4FET A;  2PMZ A;  1XSD A;  1YS7 A;  3K0L A;  4RAZ A;  1M1E B;  2JRM A;  2CV2 A;  5B5E C;  4I0A A;  1P2F A;  2AHQ A;  5E3O A;  1SD5 A;  1BI2 A;  2AQF A;  1HXD A;  2JA7 J;  1W5C C;  1IDZ A;  4YIR X;  1JGS A;  2IBD A;  3GZN B;  5BMZ A;  2GXA A;  4F93 B;  4FQG A;  1R4N B;  3L09 A;  2Y2Z A;  2RC4 A;  4L9T A;  4MNU A;  2FBH A;  1LVA A;  2F5E A;  2G0E A;  3DV8 A;  4DYC A;  2BOL A;  2G7U A;  2HYG D;  2X9D A;  5EJC A;  3MKZ A;  2M7A A;  2O0Y A;  4Z6Y A;  1TW2 A;  3CES A;  3Q0V A;  3ISP A;  4XID A;  3CZ6 A;  2LRE A;  3HXL A;  1FP1 D;  2XSD C;  4RLQ A;  1YG2 A;  1STZ A;  2HYF A;  3HTU A;  5HNH A;  4X0G A;  3JRH A;  3MD2 A;  1ZGJ A;  3OYC A;  2M8G X;  3JSP A;  3HBL A;  3GTP J;  1KU9 A;  1AU7 A;  2HTS A;  3BDD A;  4I99 C;  2Z33 A;  3PUB A;  5IT3 A;  4AIJ A;  2QKM B;  1N75 A;  2BHY A;  4ENK A;  3QQA A;  5KAI C;  1T08 B;  4CCL A;  5EEH A;  3CMM A;  3FXR A;  1VQM I;  5LGT A;  4RGX A;  1UB9 A;  1SFO J;  2WAQ N;  2RRE A;  3LSM A;  3MMY B;  4JP0 A;  2GQQ A;  3EPZ A;  4MFE A;  2BXZ A;  3U1D A;  5F0F A;  2KKO A;  4EJV A;  5J4Y A;  1WSU A;  1ETY A;  4GRI A;  5GPA A;  4Y15 A;  3VYT B;  2DCE A;  2VPL A;  4HEA 2;  3GFM A;  3SYT A;  4OIN F;  3JRE A;  1LEB A;  2VOD A;  3BZC A;  2WWY A;  3GO5 A;  1V55 H;  5LRR A;  1X1B A;  3SZT A;  5JR3 A;  2JSP A;  1F5T A;  2OAZ A;  1GDT A;  1MMD A;  1Y8Q B;  4XQF A;  1D5V A;  4JBA A;  3MZY A;  4M6X A;  2EFP A;  4B8X A;  1NK2 P;  3VPR A;  1Z7L A;  3DTE A;  5HLT A;  3OYE A;  2UZK A;  4U87 A;  4ABZ A;  2MFZ A;  2V9K A;  3OS0 A;  3DFG A;  4DYR A;  1H9G A;  1WJF A;  4G6D A;  3SHF A;  1XGM A;  2EJR A;  3BR3 A;  2Q8K A;  3G71 I;  1BI3 A;  4BXF A;  2OPT A;  4RMN A;  3T8R A;  1IUF A;  1I6X A;  1KYZ A;  2XAS A;  3BCA A;  5K5O A;  4RB2 C;  3TDZ C;  4KT6 A;  1ZRC A;  3W6V A;  2P5K A;  5HVQ C;  2IT0 A;  2CV1 A;  4A6E A;  5GTI C;  3FK7 A;  4LG0 B;  3IWF A;  1PUF A;  4BKX A;  2AS5 F;  1MH4 A;  2VON A;  1F9N A;  4CYC B;  3MEX A;  2OF7 A;  3LSR A;  2JK3 A;  5FFZ A;  5EF6 A;  3IKT A;  1B8I B;  1R49 A;  3C2G A;  4M9X A;  3HHG A;  4AM3 A;  3BJO A;  2DK8 A;  2KQR A;  2Q2E A;  3W6J B;  4M3B A;  4Q5S F;  2LBF B;  2ELK A;  3WTX C;  2YX4 A;  3OL4 A;  2M0M A;  5TGT A;  3MWM A;  2LTP A;  1J75 A;  4YEJ A;  5HLG A;  1MNE A;  1KQ9 A;  2CUZ A;  3WG9 A;  1TWC J;  3TW7 A;  3HOY J;  1G3W A;  2O61 A;  5DYM A;  1QVT A;  2HXO A;  2ESN A;  3FXL A;  2R0Q C;  1W36 D;  4LLL A;  1P4A A;  5LBQ A;  4KIG A;  2ECB A;  2EQR A;  1K78 B;  1Z67 A;  1ZG1 A;  1S72 I;  1HBX G;  2P6S A;  2IPQ X;  2IJL A;  3FXJ A;  2LC2 A;  5D5V B;  2XSJ C;  5J1R A;  3I64 A;  1Y6I A;  3KEY A;  4L18 B;  3GME A;  1UCR A;  3HC7 A;  1ZN2 A;  1SAX A;  4A3E J;  3FDY A;  2V7F A;  3M8F A;  5K7Z A;  1RR7 A;  2IA0 A;  5LHH A;  1IZ1 A;  4I98 B;  3F21 A;  5M5W J;  2QBY A;  2DOF A;  1FYL A;  2PBI A;  2A6T A;  3RPQ A;  3TOB A;  5B1A H;  3H3Z A;  3I59 A;  3BR2 A;  1F43 A;  5HDK A;  2DI3 A;  5ILU A;  1MBE A;  3ZQL A;  2B63 J;  1QNT A;  2RKH A;  4A6D A;  4CCN A;  4OAZ A;  5FD5 A;  2W25 A;  2XRN A;  2YSR A;  4W1U A;  1WI9 A;  4HX4 A;  1V4R A;  5IOY A;  1VQ8 I;  2HZT A;  2MC3 A;  5LGU A;  4G8X A;  2DOD A;  3BJ6 A;  2JA6 J;  3K4N A;  3J81 Z;  1YJW I;  1UHM A;  1YQA A;  1OCO H;  2XF6 A;  3BG7 A;  1RES A;  1MMS A;  3ZP5 A;  3CCJ I;  2UWM A;  4OMY A;  1E0E A;  2LMD A;  2M45 A;  2N8G A;  4BE0 A;  4ZH4 F;  2M8E A;  4A93 J;  4P9F A;  1TNS A;  4RLF A;  2ZFW A;  2ID6 A;  3CMA I;  4ZYG A;  3R61 A;  1D8K A;  2A05 A;  4H0E A;  3CP8 A;  4IPA A;  2XRL A;  2OQG A;  3JAM Z;  2CU7 A;  4B4C A;  3CCS I;  1V54 H;  2QEN A;  2YR2 A;  3S93 A;  4LIU A;  3OYM A;  4M6V A;  3QAH A;  2OJE D;  3BLY A;  4PK4 A;  4U0V A;  3HOX J;  2QEX I;  5C44 J;  1X1A A;  4A0X A;  4FE4 A;  5IP6 A;  2JPC A;  4P96 A;  1J7K A;  1YW8 A;  2TRT A;  3EUA A;  4PGG A;  3ZCO A;  2CQQ A;  3JCU C;  4NQW B;  2DPU A;  4EEF G;  2M0C A;  2OA4 A;  3IH2 A;  1B9N A;  3E6M A;  2VQL A;  1ZGW A;  1WJ5 A;  2FE3 A;  2W84 A;  4F52 A;  2F4I A;  3NAR A;  1IJW C;  4ON0 A;  2QQA A;  3ZQ7 A;  1ZR2 A;  3IAM 2;  3SFI A;  4ZJZ A;  2IAI A;  5B66 C;  4DJA A;  1MBJ A;  2L5Q A;  4XNF A;  3I54 A;  1E3H A;  2AO9 A;  4FCY A;  4UB6 C;  4CHU A;  4CXF A;  1VQ4 I;  2CO5 A;  1YIT I;  1HKS A;  3C2B A;  3HGY A;  3RKX A;  5ILV A;  1VND A;  2R7F A;  3S32 A;  4HF2 A;  2ZB9 A;  1ZHF A;  1TQM A;  4IHW A;  3H9Q A;  4BS9 A;  3BG6 A;  5AIP A;  4CCJ A;  3A01 B;  1X19 A;  4C2U A;  3OYK A;  1JKR C;  5E1W A;  3IV5 A;  3HOZ J;  2MGQ A;  3SZP A;  1BC8 C;  2Y0S A;  2FBI A;  3I4P A;  1UFM A;  4PCQ A;  4C30 A;  5C3E J;  3BG9 A;  3RCO A;  1R5H A;  5JLX A;  2NVQ J;  1BW6 A;  4MTD A;  2JWT A;  2ADU A;  5DS9 A;  4XLC A;  3OYD A;  3F72 A;  2OC6 A;  3WG7 H;  3G3Z A;  1IC8 A;  1APL C;  2Z3Y A;  4B44 A;  2CFX A;  1PP8 F;  2ME6 A;  4XRM A;  2ZCW A;  2XC7 A;  4I02 A;  1JGG A;  1AOY A;  2LDU A;  3QPT A;  3F0C A;  1HKT A;  1UG0 A;  1W7P A;  2OZ6 A;  4I7H A;  2CQK A;  1WJC A;  4BQA A;  1ZQ3 P;  2WY7 Q;  1MMG A;  2HVR A;  2P81 A;  2V1X A;  2L4A A;  3JRA A;  4I01 A;  1QZY A;  4BNC A;  5DM7 F;  1IN7 A;  3K69 A;  2K3P A;  2DQL A;  3HRS A;  4XKB A;  3CO6 C;  3J7Y J;  1R58 A;  3OYG A;  2J5P A;  3TBI A;  2IS2 A;  2WY8 Q;  4XOT A;  5GTH C;  3S1N J;  1NG6 A;  2P6T A;  4F3Q A;  2P8T A;  3QRF F;  4E7H A;  2DA7 A;  1FPQ A;  3BZ6 A;  5KAF C;  5E79 C;  2FX0 A;  3MKW B;  3UKG A;  4IO9 F;  2EB7 A;  4XOR A;  3ECO A;  2VLA A;  5K1Y A;  1Z0X A;  3SQN A;  1FBU A;  3J80 Z;  3IRQ A;  1VFC A;  2R7Z J;  5EEA A;  2GZW A;  2NVX J;  5EDN A;  3ABK H;  2ZXH A;  4WXC A;  2DOE A;  4IHT A;  1S7O A;  2L9N A;  4AUX A;  2EPF A;  2GA1 A;  1XG1 A;  3GTM J;  2ZME C;  3I71 A;  4RB0 A;  1Y1V J;  1CQT A;  2QWW A;  3Q9V A;  5IT9 Z;  2E2H J;  2JPB A;  3LNQ A;  1FTZ A;  5J6X A;  5M3M J;  2EFQ A;  2EH3 A;  4KIB A;  4II3 A;  4S04 A;  5LEK A;  4EJU A;  2MH9 A;  2Z2S B;  5FKL A;  5ILS A;  2DPD A;  1QU3 A;  2LSO A;  2CMP A;  3GZ6 A;  2HDC A;  4XM3 A;  3CQZ J;  3HKZ N;  2IRF G;  4F92 B;  4A3M J;  2JUC A;  1MDM B;  4IRI A;  2F4O B;  4RA2 A;  3HM5 A;  3KX2 A;  1KU2 A;  3PUF A;  3X2Q H;  3QYF A;  5GAD J;  4UUV A;  2E1M C;  3GW2 A;  5F1J A;  1XCV A;  5GPC A;  5IYC J;  3GLX A;  3KFW X;  2E2I J;  3WTV C;  3EUH A;  1U9N A;  1XC5 A;  3NEU A;  1WH7 A;  2XB0 X;  3GCM A;  3OYJ A;  2JA2 A;  3CCR I;  1U5T A;  5D8K B;  3WTZ A;  5LGN A;  3FMQ A;  1I1G A;  4NB5 A;  4E4H A;  4G12 A;  3RYR A;  5H6Q A;  3L2R A;  4HOB A;  3DEE A;  4A0Y A;  4IHV A;  4DW6 A;  3AKZ A;  3LQR A;  1VQL I;  2EK5 A;  2WC2 A;  4ZYH A;  3C3W A;  1MNM C;  4KMF A;  1MMN A;  1YRN A;  1Q1H A;  2DA5 A;  1BC7 C;  3S1Q J;  4EJW A;  3PQK A;  3CUO A;  3FM5 A;  3KYD B;  4G6T B;  2EA4 A;  3J81 K;  2K9Q A;  3DLL F;  1V5E A;  1UEL B;  5E3N A;  2M5W A;  3JRB A;  1TLH B;  1MBG A;  2GWR A;  4G6Q A;  3ZMT A;  1HF0 A;  4IKF A;  1ZTR A;  4HYE A;  2V1U A;  1VQ5 I;  1WJD A;  6PAX A;  3VSL A;  3DBR B;  3OL3 A;  3HPH A;  1WVR A;  3JRD A;  4QIW N;  1W0U A;  1P4X A;  1L0O C;  1DU0 A;  3A0H C;  5FRO A;  3JAM K;  2VJJ A;  1J59 A;  3K10 A;  3PJR A;  2R5Z B;  1ZGA A;  3MZ8 A;  5LLQ A;  1W7P B;  3UNG C;  4BDY A;  2GM4 A;  4BQN A;  1Z3Y A;  2HS5 A;  1ETW A;  3RZD J;  2OBP A;  2IS1 A;  3K4B A;  1FJL A;  1S6L A;  3GTQ J;  3K4K A;  5K7F A;  3C2H A;  5B3S H;  1ETO A;  2DA6 A;  1N78 A;  4C2M J;  4CUG A;  5ICC A;  1GHC A;  1AKH B;  4ESB A;  5K5Q A;  2KJC A;  1RUN A;  1JUP A;  4MTE A;  1W4M A;  2WBM A;  3ABM H;  4OWR B;  1Q1V A;  1O3T A;  3BZK A;  4WF2 A;  3SZG A;  3JR9 A;  3EQL F;  3KP7 A;  1ZYR F;  1J09 A;  3LAJ A;  4OIQ F;  1YYV A;  5KVR A;  2O9L A;  4A5N A;  2VC1 A;  1OCR H;  2A6H F;  1WH5 A;  2IS4 A;  1FOY A;  1LNW A;  2ZME B;  2Z9O A;  1HKQ A;  3O6B B;  1Y0N A;  5L3B A;  3DKY A;  4C9Y A;  1HCR A;  3V8L A;  1WZ2 A;  2JZY A;  2R7U A;  2M3A A;  2ZC2 A;  3ESW B;  3QYE A;  1IF1 A;  1W7P D;  2ISZ A;  2DAO A;  1V5G A;  2X1D A;  2KMU A;  2LYC A;  1KZH A;  4O3M A;  1BR2 A;  2CG4 A;  4EGZ A;  2DXI A;  3ZR8 X;  1FSH A;  2IXS A;  2F2E A;  5KHD A;  4B3X A;  2CV0 A;  4AID A;  1L3L A;  1DP7 P;  4KUM A;  1SD6 A;  4KA4 A;  2E1M B;  2LR8 A;  3K4C A;  1LKX A;  2X51 A;  2OZU A;  1R71 A;  5BQT A;  3CF2 A;  2W00 A;  3RJP A;  4P5O A;  2HFH A;  1OFC X;  1LE8 A;  4RB1 A;  4D5F A;  5JHU A;  2VBW A;  3OYL A;  2QSG X;  3J7A Y;  3CMY A;  2OD5 A;  2K85 A;  3REO A;  3T0Y A;  3L2Q A;  1O3R A;  3KP6 A;  2W85 A;  2Y0M A;  3GTG J;  3H0G J;  4DZP A;  2ICW G;  4EGY A;  4M9S A;  5CVR A;  3QPL A;  3WGH A;  1OCZ H;  3ZMZ A;  1T6S A;  3ZMU A;  1TWG J;  3BQY A;  4DZJ A;  3ZMD A;  3CCM I;  1O3Q A;  4UY8 I;  4C3J J;  3BR0 A;  4V2F A;  4BEH A;  3N4M A;  3CJT B;  5JHF A;  3H5A A;  2FD5 A;  3CJR B;  4HV5 A;  3TGN A;  1K6Y A;  2IGM A;  2A6E F;  1X1P A;  4IQ4 A;  3W3C A;  1T8I A;  2R7Q A;  2CH0 A;  1HOM A;  2X1E A;  1I27 A;  4QWQ A;  4EJO A;  3SDB A;  3KPH A;  4QPQ A;  2EIL H;  3J80 K;  2QQ8 A;  2X6W A;  4HX7 A;  5EZG A;  2NVU B;  2BY3 A;  2R92 J;  4G7Z F;  4GYI A;  1IO2 A;  2JA8 J;  4Y3O A;  5B1B H;  2ZXJ A;  5HLH A;  3LSJ A;  2QLZ A;  3SJM A;  4L0Y B;  3F8F A;  4XRS A;  1RUO A;  1T98 A;  2CS3 A;  1RZ4 A;  3IWZ A;  1EV7 A;  1XMA A;  3JRG A;  3DKX A;  1SEU A;  2OV7 A;  2PX9 A;  1CGP A;  1MSE C;  2KRH A;  2ZSI B;  5EEG A;  5JI6 A;  4IVN A;  2FOK A;  2D45 A;  4M6Y A;  2QZ8 A;  2F5F A;  2Y9Z A;  1MSF C;  5LHI A;  1DUX C;  2DA3 A;  3OYF A;  5M5Y J;  3M07 A;  4IX7 A;  4GXO A;  4BUP A;  2O8K A;  1BI1 A;  3OYI A;  3HUG A;  1PYV A;  2PQ8 A;  1NK3 P;  4XL9 A;  4JX4 A;  1SMY F;  2XAG A;  3DEW A;  3VOD A;  1I39 A;  2IEK A;  1QGP A;  2Y31 A;  2XV4 S;  1IRX A;  3JRI A;  4RBO A;  4AC0 A;  4RM2 A;  2Z5U A;  3A0B C;  1VQ9 I;  3KE2 A;  2XPU A;  4AWX B;  5CVU A;  2ZNY A;  2L3D A;  3OYN A;  3L2V A;  1P6R A;  4XKW A;  5EYR A;  3SXY A;  2EBI A;  4KYW A;  2A3S A;  2ZSH B;  2KL4 A;  1B4A A;  1ZG3 A;  2LOO A;  2LF8 A;  1ETX A;  1R6R A;  2A5Y B;  4MEY F;  3L00 A;  4CCO A;  3V42 A;  4MHG A;  3LWF A;  1WCM J;  1WQ2 A;  3SEZ A;  4ETS A;  1HC8 A;  3P9C A;  1FP2 A;  3PM1 A;  2OTJ I;  2MYS A;  4BHP A;  2V6E A;  4HNV A;  3LA7 A;  1U8B A;  5AON A;  2ID3 A;  2M4G A;  2XGE A;  3KP4 A;  2EV6 A;  4UHT A;  4C2T A;  2DT6 A;  5DV5 A;  3OYA A;  4PJN A;  3V4G A;  3I3L A;  4I76 A;  3LA2 A;  4GCV A;  2L9R A;  2Z1D A;  2JT1 A;  2EIJ H;  2RAE A;  3GX4 X;  5J40 A;  3DKW A;  2H09 A;  4KDP A;  3OOP A;  3HRU A;  3R60 A;  3H5N A;  1FMV A;  2HQ5 A;  1WFX A;  2PEX A;  5ED4 A;  2NS7 A;  2PJR B;  3I4M J;  2J5O A;  3ZQF A;  2XDV A;  2DK5 A;  1QZZ A;  1NG7 A;  2VKD A;  4A2U A;  4Q47 A;  2JMW A;  3PQJ A;  3G1M A;  3S3M A;  4PSW A;  1BI0 A;  4IOA F;  1OR7 A;  5DTD A;  2DMQ A;  1CF7 A;  3ERM A;  3HL2 A;  2KPM A;  1ZAO A;  2WAF A;  1ITY A;  5ICG A;  2XGX A;  1UHS A;  3HSF A;  4JYK A;  2DFF A;  3GFL A;  3ZOB A;  1X3U A;  3DWL E;  1K79 A;  3CP2 A;  1B59 A;  4HPQ A;  3TO7 A;  3RDI A;  2XAH A;  1TL8 A;  3QWL A;  3HOW J;  2NNN A;  4WXH A;  1TBX A;  2HOA A;  3P7N A;  4YRV A;  3MKL A;  1G59 A;  4Y7N J;  5E1X A;  3VEP A;  4JX6 A;  2I8D A;  4CZZ A;  2KZV A;  3GEZ A;  5FO5 A;  2L7M P;  3IRR A;  4I09 A;  5HS9 A;  3ZMS A;  3BG3 A;  3E5X A;  1Y56 A;  1S7A A;  4IF4 A;  3WHC A;  3E6C C;  1D3Y A;  1F36 A;  3KEO A;  3Q3S A;  4V19 K;  3M8E A;  1DPU A;  2X6Y A;  1G2H A;  1KU3 A;  2F5C A;  1B6A A;  1FMW A;  3FKJ A;  3KIO A;  3GF2 A;  4LB6 B;  4ESF A;  3EYY A;  3PNV A;  4G9Y A;  2I10 A;  2DYR H;  2DOA A;  3KCC A;  5K7H A;  1MBH A;  1H0M A;  2EFO A;  5CYV A;  3QYB A;  2COM A;  2X6O A;  3M3Y J;  1G6N A;  1FNN A;  2CUE A;  4O6J A;  4E7Z A;  3R0J A;  5J1Y A;  2PJP A;  2IGK A;  2XAJ A;  3E6D A;  3ROU A;  5HNF A;  2RVC A;  2NVT J;  2DFE A;  2QVO A;  4IHS A;  2DTZ A;  1QVU A;  3O8G A;  2LKX A;  2L7Z A;  4HAM A;  2QGU A;  1R5I D;  4G7O F;  4B1R A;  4MEX F;  4L5E A;  3FIW A;  2COB A;  2STT A;  4QSH A;  4PJM A;  3HOV J;  5E20 A;  2HOT A;  5F6F A;  1I6H J;  1VQ6 I;  2V9V A;  1IV8 A;  1R23 A;  2L9V A;  1RR8 C;  3FZV A;  1YO5 C;  1R5G A;  3C18 A;  2W48 A;  4BAY A;  3MVP A;  3B73 A;  1V3F A;  1VQK I;  4M3F A;  4BQQ A;  5BPD A;  4NHJ A;  1DPR A;  4XKC A;  4YG2 F;  2FF4 A;  3IC7 A;  1QPI A;  1MBK A;  1FTT A;  1HW2 A;  2DFH A;  4L5I A;  3RPU A;  1K83 J;  4M3D A;  4BHB A;  2M2E A;  1GV5 A;  2B9S A;  2MD5 A;  3FHZ A;  3AL0 C;  1D1C A;  2JVG A;  2QUF A;  5F64 A;  2E71 A;  5DDG A;  5JFR A;  2NOG A;  4H4K C;  2YU9 J;  2M1B A;  3V7R A;  4PGH A;  5D5W B;  2NS8 A;  3C1D A;  2LVS A;  3A1Y A;  2VT3 A;  4Y13 A;  3ZQQ A;  4UNO A;  2M87 A;  4UXN A;  3T1B A;  1MJA A;  3GTL J;  3OIO A;  2O6G E;  5HOD A;  4ZDL A;  1ORK A;  4KT5 C;  2K9L A;  2JQ7 A;  5F0H A;  3IL2 A;  3CLO A;  1V5F A;  1Z6R A;  1FYM A;  3TP3 A;  1RIO H;  3E1S A;  1G3Y A;  4KN4 X;  1R1V A;  2X85 A;  2XF7 A;  3OSF A;  2W82 A;  2R3S A;  2X6X A;  1CF7 B;  2VBZ A;  3HHH A;  1JUS A;  2DW4 A;  1OCC H;  4U88 A;  1ENH A;  4Y52 J;  1QBJ A;  2LG4 A;  3F23 A;  2NS0 A;  1JKQ C;  2KRF A;  4BY1 J;  3A4C A;  4B48 A;  4RAF A;  4BJ6 C;  3HEF A;  2VXZ A;  5DUK A;  2RNJ A;  5LEJ A;  1EJ9 A;  4M3E A;  2VOP A;  2R7V A;  1QRY A;  1Z1D A;  3F8C A;  1YFH A;  2DT7 B;  2RQQ A;  3HDD A;  3KET A;  1LFP A;  1FEX A;  1RET A;  3DU6 A;  1REP C;  1G3S A;  2CQ7 A;  3HJE A;  4B43 A;  3QPH A;  4FAS D;  3BCB A;  1ZLJ A;  3PIO F;  2XRO A;  2A61 A;  1YLF A;  2UXX A;  1WPK A;  4HZF A;  2D5V A;  5F04 A;  2MC4 A;  4KIC A;  1B72 A;  4CSW A;  1MBF A;  1PUF B;  2CUF A;  2X48 A;  4II2 A;  1TW3 A;  4A3C J;  2NNY A;  1SFK A;  2HDD A;  1RC9 A;  2WAD A;  1Y39 A;  3HKZ A;  2M7B A;  1XB4 A;  1XX5 A;  5FJ8 J;  4XLA A;  2EZL A;  1VTN C;  1P7I A;  3DPU A;  4ANJ A;  2R7W A;  3NAU A;  1MW7 A;  1T0F A;  2Q2E B;  1W1W E;  3H9G A;  1MKM A;  2IGO A;  1K7A A;  5TIS C;  3W2A A;  3ABT A;  1E3O C;  1N25 A;  1K4T A;  3MKY B;  2V79 A;  3GZ5 A;  1JKP C;  1LEA A;  2PMU A;  2HZD A;  2QM3 A;  4LIT A;  4AIH A;  5EG0 A;  1GXQ A;  4G94 A;  2LY2 A;  3NWT A;  2PMH A;  2VT2 A;  3RKW A;  3G1L A;  1ZK8 A;  4CO8 A;  3AG1 H;  4MGR A;  3S14 J;  1Z21 A;  3HRT A;  4A3B J;  1UAA A;  5L3C A;  1GV2 A;  4L5J A;  1X2M A;  5L3E A;  2KIU A;  2HKO A;  4EQQ A;  3NRV A;  1W0T A;  4HLY A;  1SAN A;  2CSO A;  3G4S I;  3EYI A;  2HOE A;  4XK4 A;  2XB5 A;  3PO3 J;  2FJ1 A;  2QBY B;  1ACI A;  2CRG A;  3AL0 B;  1LDJ A;  3I59 B;  1TNT A;  4IXA A;  3SDG A;  4JOM A;  4CA0 A;  4KIF A;  4XRF A;  1BIA A;  4A12 A;  4XRS G;  3DQV C;  4A3G J;  1RPW A;  3GVA A;  1QHH D;  1N77 A;  3M1E A;  1KQ8 A;  4FE7 A;  1TQP A;  4LJZ F;  3RKQ A;  4UUS A;  2KZG A;  4FTH A;  2K7L A;  4NC6 A;  5ICF A;  1WJA A;  2G9W A;  3O8H A;  3GFI A;  1F4K A;  1GLN A;  4MLO A;  3HSE A;  1YS6 A;  1LPQ A;  4C3I J;  5ICE A;  5JLW A;  4OAY A;  2KLO A;  2WA0 A;  4HW0 A;  3GTO J;  2KRC A;  1E2X A;  3TO9 A;  2VUM J;  2HDW A;  3KP2 A; 
#chains in the Genus database with same CATH homology
 2CYY A;  3VOE A;  3V7S A;  2ZO4 A;  4IRG A;  2E7X A;  4ZYE A;  4I0B A;  4CGZ A;  2R7D A;  1D8J A;  1OYW A;  1WWX A;  2ZKZ A;  3I5U A;  3EET A;  1O7F A;  1PDN C;  4LFU A;  3O3K A;  4OIP F;  2LNB A;  5E8G A;  5E8I A;  2K02 A;  2XKO A;  5K5R A;  5LHG A;  4WCG A;  3GXO A;  1U6G A;  1TTY A;  1S8N A;  3EDP A;  1KQ0 A;  1BOA A;  1BBY A;  3DPL C;  4LLG F;  1I5Z A;  3PFI A;  1XN7 A;  1J5Y A;  4DNC A;  4R1H A;  4UVB A;  4MQ9 F;  3ERE D;  3CUQ A;  2XAF A;  3IHU A;  1U5T C;  4EMS A;  3V8J A;  5D5U B;  2ZBK A;  5DCM A;  3DPT A;  2Y48 A;  1S29 A;  2H94 A;  5D6F A;  3FMR A;  2RGV A;  3H92 A;  2CGP A;  3RIR A;  4BHC A;  4XSZ F;  4IRH A;  4WWC A;  3RKY A;  3FM3 A;  4QLC U;  1XDU A;  5HS7 A;  1WRJ A;  3B02 A;  4BH9 A;  3HTS B;  1QPM A;  3ZMV A;  3FMS A;  4LMY A;  1IN5 A;  5TJJ A;  1O57 A;  4YFN F;  2PLY A;  2ISY A;  4BYY A;  1C0W A;  2Q0O A;  1KGS A;  2A69 F;  3LST A;  2FU4 A;  3FX3 A;  2AXL A;  3DEU A;  3ECH A;  1ZRF A;  3JSO A;  2IP2 A;  3WTY C;  2L02 A;  1IN8 A;  2PFB A;  3Q9S A;  1XD7 A;  1O7L A;  2KIF A;  4ZYD A;  1XMK A;  4HQE A;  2DU9 A;  4EM2 A;  1LJ9 A;  2B0L A;  5ERI A;  5L3F A;  2VBX A;  4M74 A;  4G7H F;  3OV8 A;  2QQ9 A;  2ZJ2 A;  4IJA A;  4LLN A;  2K4B A;  3MFK A;  4GYG A;  3I53 A;  3HRM A;  3Q5F A;  2ZNZ A;  2L4M A;  1MJ9 A;  2P5V A;  3O2P E;  2PG4 A;  1U5T B;  5E17 F;  2E1N A;  1R7J A;  1MGT A;  1W5T A;  5DEQ A;  3QOP A;  1OYI A;  2OU2 A;  2ESH A;  3ZPL A;  1ZG5 A;  2VN2 A;  3MAJ A;  1ZAR A;  4KN7 X;  4ENJ A;  1BIB A;  1HW1 A;  3ZN1 A;  2K27 A;  5HLI A;  4FX0 A;  2H6B A;  5A2Q Z;  1FC3 A;  2YX7 A;  4OOI A;  3TOA A;  3F8M A;  5AIQ A;  3CTA A;  4GO1 A;  5IT9 K;  4EM0 B;  2W24 A;  1IN6 A;  2WV0 A;  3KZY A;  2RQP A;  4LG0 A;  5D8L B;  2P5L C;  3WE2 A;  4ESJ A;  2MLK A;  3QU6 A;  1WKM A;  3H3U A;  2WTE A;  4LK0 F;  4U7D A;  2X0L A;  5D4S A;  3J7A O;  2C6Y A;  2FML A;  2P4W A;  3S2W A;  2BEO A;  2FMY A;  3N97 A;  4HBL A;  1OMI A;  4XLN F;  2MBF A;  4U0Y A;  2E1C A;  1JHH A;  1SD7 A;  5D4R A;  4JK1 X;  3LA3 A;  1ZLK A;  1K78 A;  4L9V A;  3GFJ A;  2K4J A;  2XIG A;  5HOO A;  2KJB A;  3TKY A;  4HDU A;  2Z99 A;  3D5L A;  2EFN A;  4ZZL A;  4LB5 A;  2YU3 A;  5HDG A;  3V7C A;  4RS8 A;  3L2C A;  2O8X A;  1E17 A;  2P7V B;  1QQI A;  3T5X A;  1ON2 A;  3WTW C;  2FA5 A;  5D5X B;  1U78 A;  2KIM A;  4AVP A;  1B1B A;  1H9T A;  4EJT A;  5DCF A;  3G73 A;  1HST A;  4FT8 A;  4TV7 A;  3JTH A;  3QU3 A;  2A07 F;  4LGW A;  2A68 F;  1FBS A;  2V1D A;  3V8K A;  2ELH A;  1EH7 A;  2RDP A;  5BS6 A;  3R0A A;  5D6E A;  4AIK A;  3BY6 A;  1ULY A;  2PN6 A;  2DT5 A;  3E3V A;  4ENN A;  3GWZ A;  1I1S A;  5FLX Z;  3E5U A;  2RN7 A;  2LF7 A;  4LK1 F;  1YW9 A;  4M72 A;  1FYK A;  2ACJ A;  2DQR A;  2QYO A;  2ETH A;  1ONV A;  3HIF A;  4NQW A;  1IXC A;  5FB2 A;  4B09 A;  4A5M A;  4PZJ A;  4PDK A;  1S3J A;  3COA C;  3ZN0 A;  1Z9C A;  4UV8 A;  4CIC A;  1R22 A;  5E18 F;  2FXA A;  1UST A;  4CDG A;  4RB3 C;  4FX4 A;  1O3S A;  3L9F A;  3F3X A;  3M9A A;  4FHT A;  2L01 A;  1PUE E;  2VC0 A;  3MZH A;  3U2R A;  3F8B A;  3TQN A;  2DBB A;  3BP8 A;  3LFK A;  2PI0 A;  2H27 A;  3WU0 A;  4R79 A;  3CJN A;  3E5Q A;  2XUB A;  1T39 A;  2XAQ A;  5FD6 A;  3QP5 A;  5CVV A;  3I58 A;  5HS8 A;  2G7H A;  2DO7 A;  2VBY A;  2FSW A;  2H6C A;  4A0Z A;  5J8F A;  3AAF A;  1DDN A;  1U3E M;  3WOD F;  1Z05 A;  4XBF A;  2OQR A;  2Y75 A;  5TRD A;  5A2Q K;  1ZH5 A;  3F6V A;  5L3G A;  3MCZ A;  4BXU A;  3NQO A;  5FGM A;  3ABU A;  4OIR F;  1IUY A;  2CWE A;  2E7W A;  4RAY A;  3DF8 A;  4L9N A;  1G4D A;  1IRG A;  4HV6 A;  3KEQ A;  2HGC A;  1FOK A;  4Q48 A;  3FF5 A;  1HW5 A;  1XGN A;  5L3D A;  2XKP A;  4F7Z A;  3KZZ A;  2FBK A;  1FY7 A;  1EH8 A;  2O3F A;  4EM1 A;  3ULQ B;  4M71 A;  5BOX A;  3K1M A;  2HKX A;  5CVI A;  3GYH X;  5FFX A;  2HEO A;  5H20 A;  3LAP A;  3VFZ A;  3RTR A;  2DTR A;  1MDM A;  2FNA A;  3BJA A;  5LRS A;  5J8C A;  5JVT A;  3FXU A;  3KLO A;  3BRO A;  4KMU X;  1K6O A;  4DQ2 A;  4L9J A;  3C7J A;  3R4K A;  1R36 A;  2X4H A;  2FQ3 A;  2CW0 F;  1FLI A;  2HQR A;  3T8T A;  1A04 A;  4WXD A;  2NRA C;  3QP6 A;  3RYP A;  4OIO F;  1R1T A;  3FWE A;  1IW7 F;  1BJA A;  4Z2Y A;  1FSE A;  2IW5 A;  2K86 A;  1SD4 A;  2HQN A;  3WTT C;  1J9I A;  2IVM A;  2MA3 A;  2BE5 F;  3GUD A;  1JE8 A;  2GXG A;  4HF1 A;  5FLX K;  3WTU C;  1XSX A;  4GGG A;  4D0P A;  2EA2 A;  1P4W A;  1YW7 A;  1LQ1 A;  1TQI A;  1XCB A;  4HX8 A;  3F22 A;  2XHK A;  2NAZ A;  2FNP A;  5BPI A;  1Z6T A;  1HSJ A;  1R1U A;  1LDK B;  1R00 A;  4K2E A;  2UXN A;  4HQM A;  1SFX A;  4XSX F;  4OU0 A;  1FZP B;  2D1V A;  2STW A;  1FT9 A;  3RI4 A;  1KA8 A;  4Y17 A;  2VE9 A;  1GXP A;  4R8H A;  2EV5 A;  3BWG A;  2ZME A;  1XGS A;  4HF0 A;  3KP3 A;  3WE3 A;  1MJB A;  3K1P A;  1U2W A;  2EWN A;  1IXR C;  2O03 A;  4WK8 F;  3SFZ A;  2LKP A;  4L0Z B;  4CYD A;  2P7C B;  3HOS A;  2JSC A;  4I2O A;  3TDU C;  5HDN A;  3M7G A;  1P92 A;  1HQC A;  3L7W A;  3IKV A;  1ZRE A;  2BYV E;  1XGO A;  4M73 A;  2D2W A;  4EV0 A;  2EFW A;  1J0R A;  1UHW A;  2XVC A;  3HYI A;  2DFI A;  3VB2 A;  3LQQ A;  4O5V A;  1OPC A;  1RI7 A;  2IA1 A;  3CUQ C;  4S05 A;  2HR3 A;  1G3T A;  1SMT A;  1ON1 A;  1JHF A;  2V6C A;  3WGG A;  2BBY A;  4HA8 A;  3W6K B;  2MH2 A;  3P9I A;  4ENM A;  1LB2 A;  4ASN A;  1RNL A;  1Y0U A;  2VE8 A;  2MLG A;  4RGS A;  2D1H A;  4P55 A;  1Z91 A;  1T2K A;  3TO6 A;  1QO0 D;  3DXJ F;  1PP7 U;  2BGC A;  2DLL A;  4XLP F;  1OYY A;  1IRF A;  2RV8 A;  4P9U A;  1IAW A;  4M9Z A;  3U9G A;  4MQV A;  1MD0 A;  1NHA A;  3E97 A;  3ELK A;  1JXS A;  1U8R A;  2FRH A;  4HDV A;  4EVI A;  1J2X A;  2IA2 A;  2YPR A;  1GVJ A;  2BV6 A;  3K9T A;  4Q4Z F;  3WTS C;  5CLS A;  4RGR A;  4UV9 A;  3FXQ A;  2W57 A;  1IXS B;  4U0W A;  1OKR A;  1T38 A;  1MZB A;  5CVJ A;  1KU7 A;  3E6B A;  4E70 A;  4KFC A;  4ZZD A;  2GA2 A;  1KYW A;  3F6O A;  2GXB A;  2VOO A;  1EH6 A;  2EV0 A;  2NYX A;  2JTV A;  3BPX A;  4YIF A;  3R6S A;  5DD4 A;  4JQF A;  3K1N A;  3DP7 A;  3MQ0 A;  4AD9 A;  1XSV A;  5KK1 A;  3JTG A;  3BPV A;  3I0T A;  1IN4 A;  3F8N A;  5DUI A;  3D0S A;  4LD5 A;  2GAU A;  5DD8 A;  1XDS A;  3BOQ A;  4N9H A;  4YFX F;  3CUQ B;  1AWC A;  1Z7U A;  1FBQ A;  4UVA A;  2F5D A;  5DCM B;  3KP5 A;  2QQB A;  3CO7 C;  2L54 A;  3HOT A;  1FWZ A;  4YFK F;  1LDD A;  2M30 A;  5E1Z B;  1ODD A;  4UVC A;  2HTJ A;  2GIV A;  4RGU A;  5H6R A;  5F1R A;  1BM9 A;  1FX7 A;  1B9M A;  3CDH A;  5CJ9 A;  3P9K A;  4YII A;  4N0B A;  4OMZ A;  1BN5 A;  3HSR A;  1F1Z A;  2FEZ A;  1W5S A;  2HWV A;  4U7B A;  1YTY A;  2TDX A;  3WGI A;  3K2Z A;  4KNY A;  4WX9 A;  3JW4 A;  3KLN A;  2JRT A;  4N9I A;  4HLX A;  1USS A;  1YIO A;  1ZRD A;  1SFU A;  1SFE A;  3WU1 B;  3ML6 A;  1XSD A;  1YS7 A;  3K0L A;  4RAZ A;  4I0A A;  1P2F A;  1SD5 A;  1BI2 A;  1HXD A;  1JGS A;  5BMZ A;  3L09 A;  2RC4 A;  4L9T A;  4MNU A;  2FBH A;  1LVA A;  2F5E A;  3DV8 A;  2G7U A;  2HYG D;  2O0Y A;  1TW2 A;  3ISP A;  1FP1 D;  1YG2 A;  3HTU A;  2HYF A;  1STZ A;  1ZGJ A;  3JSP A;  1KU9 A;  2HTS A;  3BDD A;  2Z33 A;  5IT3 A;  4AIJ A;  4ENK A;  5EEH A;  3FXR A;  5LGT A;  4RGX A;  1UB9 A;  2GQQ A;  3U1D A;  2KKO A;  4EJV A;  1WSU A;  4Y15 A;  3GFM A;  4OIN F;  1LEB A;  2VOD A;  2WWY A;  3GO5 A;  5LRR A;  3SZT A;  5JR3 A;  1F5T A;  2OAZ A;  1D5V A;  4JBA A;  3MZY A;  4M6X A;  2EFP A;  4B8X A;  2UZK A;  3DFG A;  1H9G A;  4G6D A;  3SHF A;  1XGM A;  2EJR A;  2Q8K A;  1BI3 A;  3T8R A;  1I6X A;  1KYZ A;  2XAS A;  5K5O A;  4RB2 C;  3TDZ C;  1ZRC A;  2P5K A;  5HVQ C;  2IT0 A;  4A6E A;  4LG0 B;  3IWF A;  2AS5 F;  2VON A;  1F9N A;  3MEX A;  5FFZ A;  3IKT A;  4M9X A;  3HHG A;  3BJO A;  2DK8 A;  2Q2E A;  3W6J B;  4Q5S F;  3WTX C;  2YX4 A;  3MWM A;  1J75 A;  5HLG A;  1KQ9 A;  3WG9 A;  1G3W A;  2O61 A;  5DYM A;  2ESN A;  4LLL A;  1P4A A;  5LBQ A;  4KIG A;  1K78 B;  1ZG1 A;  1HBX G;  2P6S A;  2IPQ X;  2IJL A;  5D5V B;  3I64 A;  4L18 B;  1UCR A;  1SAX A;  1ZN2 A;  3M8F A;  2IA0 A;  5LHH A;  1IZ1 A;  4I98 B;  3F21 A;  2QBY A;  1FYL A;  2PBI A;  3RPQ A;  3TOB A;  3H3Z A;  3I59 A;  5HDK A;  2DI3 A;  5ILU A;  1QNT A;  2RKH A;  4A6D A;  5FD5 A;  2W25 A;  2XRN A;  2YSR A;  1WI9 A;  4HX4 A;  1V4R A;  2HZT A;  2MC3 A;  5LGU A;  4G8X A;  3BJ6 A;  3J81 Z;  1UHM A;  1YQA A;  3ZP5 A;  2UWM A;  4OMY A;  2M45 A;  4ZH4 F;  2M8E A;  4P9F A;  1TNS A;  2ZFW A;  4ZYG A;  3R61 A;  1D8K A;  4H0E A;  4IPA A;  2OQG A;  3JAM Z;  2QEN A;  2YR2 A;  3QAH A;  4U0V A;  4A0X A;  2JPC A;  4P96 A;  1J7K A;  1YW8 A;  4PGG A;  2DPU A;  2OA4 A;  1B9N A;  3E6M A;  2FE3 A;  2W84 A;  4ON0 A;  2QQA A;  3ZQ7 A;  3I54 A;  4CHU A;  4CXF A;  2CO5 A;  1HKS A;  3RKX A;  5ILV A;  2R7F A;  4HF2 A;  1ZHF A;  1TQM A;  5AIP A;  5E1W A;  3SZP A;  1BC8 C;  2FBI A;  3I4P A;  1UFM A;  4PCQ A;  1R5H A;  4MTD A;  2ADU A;  3F72 A;  3G3Z A;  2Z3Y A;  2CFX A;  1PP8 F;  2ZCW A;  1HKT A;  4I02 A;  1AOY A;  2LDU A;  3QPT A;  1W7P A;  2OZ6 A;  4I7H A;  2CQK A;  4BQA A;  2V1X A;  2L4A A;  4I01 A;  1QZY A;  4BNC A;  1IN7 A;  3K69 A;  2DQL A;  3HRS A;  3CO6 C;  1R58 A;  2J5P A;  2P6T A;  2P8T A;  3QRF F;  1FPQ A;  3BZ6 A;  2EB7 A;  3ECO A;  5K1Y A;  3SQN A;  1FBU A;  3J80 Z;  3IRQ A;  2GZW A;  4WXC A;  4IHT A;  1S7O A;  2GA1 A;  3I71 A;  4RB0 A;  2QWW A;  3Q9V A;  5IT9 Z;  2JPB A;  5J6X A;  2EFQ A;  4KIB A;  4S04 A;  5LEK A;  4EJU A;  2MH9 A;  5ILS A;  2DPD A;  2LSO A;  2HDC A;  3GZ6 A;  2IRF G;  1MDM B;  4IRI A;  1KU2 A;  4UUV A;  3GW2 A;  1XCV A;  3GLX A;  3KFW X;  3WTV C;  3EUH A;  3NEU A;  1U5T A;  5D8K B;  3WTZ A;  5LGN A;  3FMQ A;  1I1G A;  4NB5 A;  3RYR A;  5H6Q A;  4HOB A;  4A0Y A;  3LQR A;  2EK5 A;  2WC2 A;  4ZYH A;  3C3W A;  4KMF A;  1Q1H A;  1BC7 C;  4EJW A;  3PQK A;  3CUO A;  3FM5 A;  2EA4 A;  3J81 K;  2M5W A;  1TLH B;  2GWR A;  4G6Q A;  3ZMT A;  4HYE A;  2V1U A;  6PAX A;  1P4X A;  1L0O C;  3JAM K;  1J59 A;  1ZGA A;  5LLQ A;  1W7P B;  2HS5 A;  2OBP A;  1S6L A;  5ICC A;  1GHC A;  4ESB A;  5K5Q A;  2KJC A;  1RUN A;  4MTE A;  1W4M A;  1O3T A;  4WF2 A;  3EQL F;  3KP7 A;  1ZYR F;  3LAJ A;  4OIQ F;  1YYV A;  5KVR A;  4A5N A;  2VC1 A;  2A6H F;  1LNW A;  2ZME B;  2Z9O A;  1HKQ A;  3O6B B;  5L3B A;  3V8L A;  2JZY A;  1IF1 A;  1W7P D;  2ISZ A;  2DAO A;  4O3M A;  2CG4 A;  4EGZ A;  1FSH A;  2F2E A;  1L3L A;  1DP7 P;  4KUM A;  1SD6 A;  4KA4 A;  2OZU A;  5BQT A;  3RJP A;  4P5O A;  2HFH A;  4RB1 A;  5JHU A;  2VBW A;  2OD5 A;  3REO A;  3T0Y A;  1O3R A;  3KP6 A;  2W85 A;  2Y0M A;  4EGY A;  4M9S A;  5CVR A;  3WGH A;  3ZMZ A;  1T6S A;  3ZMU A;  3ZMD A;  1O3Q A;  3N4M A;  4HV5 A;  3TGN A;  2A6E F;  1I27 A;  4QWQ A;  4EJO A;  3J80 K;  4HX7 A;  4G7Z F;  4GYI A;  2ZXJ A;  5HLH A;  2QLZ A;  4L0Y B;  3F8F A;  1RUO A;  1T98 A;  1RZ4 A;  3IWZ A;  1EV7 A;  1XMA A;  1CGP A;  5EEG A;  5JI6 A;  4IVN A;  2FOK A;  2D45 A;  4M6Y A;  2QZ8 A;  2F5F A;  5LHI A;  1DUX C;  4GXO A;  1BI1 A;  3HUG A;  2PQ8 A;  1SMY F;  2XAG A;  3VOD A;  1QGP A;  2XV4 S;  2Z5U A;  3KE2 A;  4AWX B;  5CVU A;  2ZNY A;  2L3D A;  1P6R A;  3SXY A;  4KYW A;  2A3S A;  1B4A A;  1ZG3 A;  2LF8 A;  2A5Y B;  4MEY F;  3L00 A;  4MHG A;  3LWF A;  1WQ2 A;  4ETS A;  3P9C A;  1FP2 A;  4BHP A;  3LA7 A;  5AON A;  3KP4 A;  2EV6 A;  4UHT A;  5DV5 A;  3V4G A;  3LA2 A;  4GCV A;  2JT1 A;  3GX4 X;  3DKW A;  2H09 A;  4KDP A;  3OOP A;  3HRU A;  3R60 A;  2PEX A;  5ED4 A;  2J5O A;  2DK5 A;  1QZZ A;  4A2U A;  4Q47 A;  3PQJ A;  1BI0 A;  1OR7 A;  1CF7 A;  1ZAO A;  5ICG A;  2XGX A;  3HSF A;  3GFL A;  1X3U A;  1K79 A;  1B59 A;  3TO7 A;  3RDI A;  2XAH A;  2NNN A;  4WXH A;  1TBX A;  3P7N A;  5E1X A;  3VEP A;  4CZZ A;  3GEZ A;  5FO5 A;  3IRR A;  4I09 A;  5HS9 A;  3ZMS A;  3E5X A;  1S7A A;  4IF4 A;  3E6C C;  1D3Y A;  1DPU A;  3KEO A;  3M8E A;  1KU3 A;  2F5C A;  1B6A A;  4ESF A;  3GF2 A;  4LB6 B;  3EYY A;  4G9Y A;  3KCC A;  1H0M A;  2EFO A;  5CYV A;  2COM A;  1G6N A;  1FNN A;  4O6J A;  3R0J A;  2PJP A;  3ROU A;  2XAJ A;  3E6D A;  2RVC A;  4IHS A;  2QVO A;  4HAM A;  4G7O F;  4MEX F;  2STT A;  5E20 A;  5F6F A;  1R23 A;  2V9V A;  3FZV A;  1YO5 C;  1R5G A;  3C18 A;  4BAY A;  3B73 A;  1V3F A;  5BPD A;  4NHJ A;  1DPR A;  4YG2 F;  2FF4 A;  3IC7 A;  1HW2 A;  4L5I A;  3RPU A;  4BHB A;  2MD5 A;  3FHZ A;  2QUF A;  5F64 A;  5DDG A;  5JFR A;  2M1B A;  3V7R A;  4PGH A;  5D5W B;  3C1D A;  2VT3 A;  4Y13 A;  4UNO A;  2M87 A;  4UXN A;  3T1B A;  1MJA A;  2O6G E;  4KT5 C;  3IL2 A;  3CLO A;  1Z6R A;  1FYM A;  1RIO H;  1G3Y A;  4KN4 X;  1R1V A;  2R3S A;  1CF7 B;  2VBZ A;  3HHH A;  2DW4 A;  4U88 A;  1QBJ A;  3F23 A;  2NS0 A;  2KRF A;  2VXZ A;  5DUK A;  2RNJ A;  5LEJ A;  2VOP A;  1Z1D A;  3F8C A;  1YFH A;  3KET A;  1REP C;  1G3S A;  3QPH A;  1ZLJ A;  2XRO A;  2A61 A;  1YLF A;  2UXX A;  4HZF A;  4KIC A;  1TW3 A;  2NNY A;  1XB4 A;  1VTN C;  1T0F A;  1K7A A;  1MKM A;  3ABT A;  2V79 A;  3GZ5 A;  1LEA A;  2PMU A;  2QM3 A;  4AIH A;  1GXQ A;  4G94 A;  3RKW A;  2PMH A;  2VT2 A;  4CO8 A;  4MGR A;  3HRT A;  5L3C A;  4L5J A;  5L3E A;  2KIU A;  2HKO A;  4EQQ A;  3NRV A;  4HLY A;  2CSO A;  3EYI A;  2HOE A;  2QBY B;  1LDJ A;  3I59 B;  1TNT A;  4IXA A;  4KIF A;  4XRF A;  1BIA A;  4A12 A;  3DQV C;  3GVA A;  1KQ8 A;  3M1E A;  1TQP A;  4LJZ F;  2K7L A;  5ICF A;  2G9W A;  3GFI A;  1F4K A;  3HSE A;  1YS6 A;  5ICE A;  4HW0 A;  1E2X A;  3TO9 A;  3KP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...