1FYLA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head-to-head orientation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
85
Chain Sequence
RPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords HEAD-TO-HEAD HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 23
structure length 85
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fylA00
3KP4A 5AIPA 2QQBA 4CGZA 1STZA 1SD7A 4WX9A 5JI6A 5DEQA 2O8XA 3ECHA 2HDCA 4R1HA 3TO6A 1CF7B 3DV8A 2OBPA 2LDUA 5DD4A 4M71A 2K02A 1RI7A 5D8LB 3HRSA 2IRFG 1YS6A 3ZMZA 3O3KA 3I54A 1K6OA 1HW5A 4F7ZA 1G3TA 5L3BA 5FLXK 4BAYA 4OOIA 1YTYA 2IA1A 3ISPA 2XUBA 2XAJA 4KUMA 4RB2C 3KCCA 3KEQA 3FM3A 4L18B 2GZWA 4G6QA 3MFKA 3BROA 4RGUA 2IJLA 5BPIA 1PP8F 2BV6A 2EFWA 4M9SA 1USTA 4ASNA 4BHBA 1V4RA 2GA2A 4UVAA 1FLIA 3RJPA 1BC8C 3GX4X 2F5FA 2UXNA 3N97A 1H9TA 4HA8A 1XB4A 5E18F 2JSCA 2VBYA 4OU0A 3WTWC 4Z2YA 1B1BA 4N0BA 3ABTA 1Y0UA 5DV5A 3GFMA 3P9CA 4HX4A 1UHWA 4RAZA 1KU9A 1R5GA 2DT5A 1YO5C 2K4JA 3F8BA 4AD9A 3F21A 1B6AA 4YFKF 3M7GA 2XAFA 4LG0A 3K9TA 4HZFA 5D6EA 2CG4A 5HDGA 3DPLC 2IVMA 1HW1A 2OU2A 5ICFA 3E5QA 1WKMA 4A6DA 1SD6A 3M9AA 1J5YA 2ZMEB 1T0FA 3JAMZ 2HYFA 2H94A 2K86A 3LQQA 3RTRA 2CFXA 1ZRCA 3JTHA 3MWMA 1IN5A 5J8CA 4ETSA 3QAHA 2ZNZA 3H3UA 4IVNA 2XAQA 4CXFA 2RGVA 2WV0A 1BI2A 4HLXA 2JPBA 1ULYA 2MA3A 4HV6A 4G6DA 2ZMEA 4M74A 1SMTA 4GO1A 2VBWA 5BMZA 2KJCA 4AIHA 1BM9A 4MQ9F 2PMUA 1W5TA 4ZZDA 2O03A 4R8HA 1U5TC 1WQ2A 2DPUA 1XCBA 3F23A 3J7AO 4L9VA 3JAMK 2Q0OA 1U2WA 3GFLA 3EUHA 3I4PA 2EV0A 3C7JA 3T5XA 3GFJA 2DI3A 1Z6RA 3LWFA 5CLSA 4P5OA 3VODA 3BDDA 1RIOH 4WXDA 4MGRA 2Z5UA 4XRFA 4OIPF 3IHUA 2CQKA 3Q5FA 4A0YA 4EGYA 3LA3A 1FPQA 4UNOA 1O7LA 3FXUA 2GXBA 2HFHA 2P8TA 2XHKA 2EJRA 5DDGA 2V6CA 1QPMA 3RKXA 2VE8A 1KQ9A 5DCMB 2V9VA 4BH9A 4BXUA 1WRJA 2Z33A 1FP1D 4HBLA 4I09A 3L9FA 1JGSA 3KP5A 2F5CA 5E8IA 1HSJA 4M6XA 2W84A 1GXPA 2MLKA 5L3CA 1J9IA 4XSZF 1FSHA 3T8RA 5LHGA 2NNYA 3TDZC 4AVPA 5L3EA 4IRHA 3W6KB 3U2RA 1MDMB 1OYWA 4RB1A 5DCMA 1IN7A 1EH8A 2ISYA 3HSEA 1JXSA 3P9IA 1FWZA 5JFRA 1MD0A 4UUVA 3F6OA 4OIRF 5E1ZB 6PAXA 1U8RA 5J8FA 1SFUA 2V1DA 1YYVA 2A3SA 3FZVA 1R23A 1U5TB 1BI0A 1F4KA 3ELKA 3J81Z 1PP7U 3M8FA 5E8GA 1Z91A 4EM2A 1XGOA 4Y13A 5K5OA 1JHHA 2ELHA 2CO5A 5FD6A 1AOYA 1ZAOA 2FMYA 1NHAA 1HBXG 3R4KA 4I2OA 2O6GE 4KFCA 2D45A 1K79A 1GHCA 3QRFF 2VBXA 3IKTA 1LDJA 1J0RA 2IA0A 3F3XA 2J5OA 1TNSA 2HEOA 1OYYA 1QZYA 2ADUA 1U5TA 1U6GA 4L9JA 3U9GA 2STTA 2X4HA 2F5EA 2EA2A 5LGTA 4A12A 4Q47A 2MC3A 5K1YA 3K2ZA 5FFXA 3NQOA 4S04A 3COAC 1KU7A 4Y15A 4HQMA 4DNCA 4ENNA 2GQQA 3FF5A 2DAOA 3V7RA 2PLYA 2FE3A 3FM5A 2IW5A 4ENMA 4ON0A 4ENKA 2AS5F 5ERIA 4KYWA 1B59A 1XDSA 2D1VA 1P92A 3DEUA 1ZGJA 4HDVA 2L54A 2EK5A 2A61A 4UVCA 2RVCA 1LEBA 1BN5A 4OIOF 4IF4A 3CJNA 4I0AA 1G4DA 2P7CB 1EH7A 2H09A 1KU3A 4WF2A 2WC2A 4U0WA 2FRHA 1FNNA 1YW9A 1EH6A 2ETHA 3Q9SA 1LQ1A 2GWRA 2QWWA 2ZBKA 1XMKA 2PBIA 4EM1A 2UWMA 4HF0A 4Q4ZF 5D5WB 5E1WA 5TRDA 3R0JA 5H6QA 3SZPA 2J5PA 1XGSA 2Y48A 3ERED 2NRAC 4EJWA 5LHHA 2VBZA 5LEJA 5DUIA 1WI9A 5LRSA 2ISZA 1ZN2A 1FYMA 2NS0A 2RN7A 4LLLA 2KKOA 4MEXF 1MKMA 4MEYF 3RI4A 2FMLA 1YW7A 4U0VA 2M5WA 1H0MA 1IZ1A 2W57A 1L3LA 3FMQA 2BBYA 2Q2EA 5H6RA 1LNWA 3CDHA 4FX4A 5FLXZ 2ZKZA 4KMUX 4CHUA 5HDNA 3Q9VA 1RUNA 4Q5SF 5HLHA 3SFZA 3BZ6A 4I01A 4HW0A 4L5JA 3F8CA 3GFIA 2XAGA 1Q1HA 1MJ9A 1HQCA 3EQLF 1IUYA 2VC1A 4IHTA 3F8MA 4EM0B 3F22A 1XN7A 1ZHFA 1HSTA 4WK8F 2XASA 3BOQA 4G7OF 1B9NA 2YU3A 1QZZA 1O3RA 3K1MA 2NNNA 4H0EA 2MBFA 5D4RA 1K78B 1ZLJA 4CYDA 3KLNA 4KIGA 4HF2A 4PGGA 4M72A 3V7CA 4ENJA 3S2WA 3ECOA 2BEOA 3HSRA 3EYYA 2CYYA 1YG2A 4M9XA 2LF8A 4PDKA 4FHTA 1FBSA 4PGHA 1CF7A 5BOXA 3GO5A 3C1DA 1R1VA 2QENA 1G3WA 1K78A 4CDGA 3FHZA 1Z6TA 1FZPB 2ESHA 1Z1DA 3EYIA 2UXXA 4HOBA 3WTTC 5F64A 3IWFA 1T38A 4MTEA 4EJOA 2EB7A 4M9ZA 2A07F 5HDKA 4YFNF 4G7ZF 3HOTA 2YX7A 4S05A 3C18A 3FXRA 2GXGA 2H27A 5FD5A 3WU1B 2FBKA 3ML6A 4HF1A 3V4GA 3E6CC 4MNUA 1E17A 5ICGA 2A68F 1IAWA 3MAJA 2XKPA 4CZZA 3HTSB 2COMA 2OAZA 3NRVA 2UZKA 4YIFA 2DTRA 2A6HF 3K1PA 4UXNA 1HXDA 1P4XA 3FX3A 5HLIA 3GUDA 5AIQA 5L3DA 5ILVA 3J80K 3DKWA 2XROA 3B73A 5LGUA 3BJAA 1W7PB 4Y17A 3I5UA 3HUGA 3LA7A 3CUQB 5H20A 2JTVA 4I02A 4RB0A 3C3WA 4P96A 1P4WA 1SD5A 2BGCA 4L9TA 3DF8A 2G7HA 2FF4A 1XD7A 1W4MA 3DXJF 4FT8A 2OQGA 3FXQA 4PZJA 1SFXA 5LRRA 2VC0A 3WTYC 1R7JA 1YIOA 5FO5A 4EGZA 1HKSA 3ZPLA 4LFUA 4G7HF 1F9NA 5FFZA 2KRFA 4GXOA 1BJAA 3I58A 3BPXA 2KIFA 2YR2A 4EVIA 2IP2A 2VXZA 3T0YA 5TJJA 5ICEA 4KA4A 3TO7A 2PEXA 3E5XA 2FOKA 3GYHX 3E97A 1XGNA 3WU0A 3R6SA 4KICA 1S8NA 2K7LA 4A2UA 5FGMA 4EJTA 4HYEA 4LD5A 2ZCWA 1S29A 3KEOA 4IPAA 3I59B 2DK8A 5D4SA 1QNTA 2Z3YA 4LJZF 4QWQA 2Z9OA 3BY6A 4OINF 5IT3A 3D5LA 4IHSA 3H92A 2EFQA 1BIAA 1LDDA 3V8LA 2M87A 2RV8A 5BS6A 3D0SA 1XSDA 2OD5A 3TOBA 2QM3A 2DO7A 3TQNA 3RDIA 2QLZA 5A2QZ 4U88A 2PFBA 3RPQA 5D6FA 2HWVA 4KN4X 4WWCA 4IXAA 3QOPA 4JBAA 4NHJA 3DQVC 1ON2A 4LB5A 4GCVA 1DUXC 1R1TA 4WXCA 1J7KA 1D5VA 3HRMA 1SAXA 2E7WA 1TLHB 2EV6A 3HHHA 4DQ2A 2DK5A 1ON1A 5L3FA 4ESFA 1ZYRF 1KQ8A 4O6JA 3QP5A 3QP6A 4NQWA 4LB6B 4HLYA 2FNAA 3BJ6A 2M30A 2P5LC 1MDMA 2DW4A 1SMYF 5HOOA 1G3SA 2HYGD 5CVRA 4ESBA 5A2QK 3WTZA 4G94A 4HX7A 3L00A 1T39A 2EFNA 3EDPA 1OMIA 2YPRA 1HKTA 2FBIA 2OZUA 4OMZA 3ROUA 4I7HA 2P4WA 3LAPA 1FBUA 2L02A 2BYVE 2FA5A 1FYLA 4MTDA 1TTYA 2TDXA 4RGSA 1O3SA 2JPCA 1R1UA 1ZGAA 3JTGA 1BOAA 4KDPA 2ZJ2A 3I0TA 4UHTA 2M8EA 5CVVA 4ZYEA 1F5TA 5D8KB 3WTXC 4N9IA 1J59A 4I98B 3LAJA 4HV5A 3P9KA 3KZYA 3VFZA 3HOSA 4CICA 2KIUA 2EFOA 2OQRA 1TQMA 3LFKA 2M45A 3BP8A 1A04A 5AONA 3I53A 1W5SA 3ZP5A 2XKOA 2IT0A 4UV8A 1U3EM 4WCGA 1FYKA 3GZ6A 4GYIA 1MZBA 3KETA 1LJ9A 4KMFA 4K2EA 4AWXB 1UFMA 1OKRA 3KP6A 1R22A 1S7AA 2HKOA 2QBYB 1XDUA 3F8NA 3O6BB 4LLGF 1KU2A 1V3FA 2PJPA 3RYPA 4M6YA 1D3YA 2A69F 2V79A 3K69A 4UV9A 3RKWA 2HTJA 1VTNC 2HGCA 2GAUA 1LB2A 2F2EA 4HQEA 3KP7A 1B4AA 1W7PD 4Q48A 1ZRDA 3VEPA 2H6CA 3R0AA 1G3YA 2R7FA 3ZN0A 5JVTA 1KGSA 1BBYA 5K5QA 5CVIA 2A5YB 5HVQC 1QQIA 5F6FA 1I1GA 1SD4A 1IN6A 4NB5A 4WXHA 1P4AA 3T1BA 1BIBA 4GYGA 2L3DA 2L4MA 3LQRA 2X0LA 1ZRFA 3DFGA 1FC3A 3JW4A 4MQVA 2NAZA 2KJBA 2E1CA 2M1BA 2DQLA 3L09A 3SXYA 1YLFA 2Y75A 3DPTA 4A5MA 3I64A 3PQJA 3TGNA 1TBXA 1QO0D 4RGRA 3ABUA 2JRTA 4B09A 5CJ9A 1PUEE 4M73A 3HTUA 2P6TA 2HQNA 3HIFA 4AIKA 3G73A 2RNJA 1ZARA 3IRQA 3GVAA 5HS9A 2CSOA 3BWGA 1SFEA 3G3ZA 5ILSA 2RQPA 1J2XA 4KT5C 1IXRC 2DFIA 3CUQC 1LDKB 4BHCA 1LVAA 3GW2A 1Z9CA 1I5ZA 2R7DA 3F6VA 4EJUA 2A6EF 4L9NA 4ESJA 2IPQX 5CVUA 4RS8A 2ESNA 1TW2A 3ULQB 1DP7P 4R79A 3K0LA 3V8JA 2V1XA 1BC7C 2QYOA 1FOKA 1S3JA 3M8EA 2RDPA 4RB3C 3HYIA 3FMRA 1OR7A 5LEKA 1R36A 3KE2A 3J80Z 2E1NA 1R00A 1RNLA 2QZ8A 2QQ9A 3MCZA 4JK1X 2JT1A 1BI1A 2P5VA 1JHFA 3JSOA 3CO7C 3GF2A 5FB2A 2VOOA 2ZO4A 4U7DA 2D2WA 1USSA 4LG0B 4IRIA 1O7FA 2ACJA 4GGGA 3CUOA 1T6SA 5D5VB 2PQ8A 4U0YA 5J6XA 2FEZA 4HAMA 5HLGA 5DUKA 1O57A 2XIGA 2G9WA 3REOA 4ZYHA 5KK1A 3IRRA 1U78A 3ZQ7A 4O5VA 1TQIA 5LBQA 1P6RA 1KYZA 3CO6C 3KZZA 5JR3A 4A0ZA 2W85A 2MH9A 1ODDA 5LLQA 1DDNA 2ZXJA 3WGGA 4YFXF 2XRNA 4IJAA 2GA1A 3MZHA 4HX8A 4RGXA 2MH2A 1WWXA 4G8XA 4EQQA 2YSRA 2QVOA 1AWCA 5CVJA 2HR3A 1S6LA 1H9GA 3I71A 2VT2A 3ZMVA 2Y0MA 1D8JA 3F8FA 4RAYA 4L0YB 1S7OA 2VN2A 4YIIA 5DCFA 4OMYA 3MEXA 3BJOA 3P7NA 1XMAA 3NEUA 2K27A 3E6BA 4BYYA 1W7PA 4EV0A 4ZH4F 3GXOA 2EFPA 1ZG3A 4P55A 1UCRA 3EETA 2FXAA 1GVJA 4ZYDA 3CUQA 3WG9A 3WTVC 4BNCA 1L0OC 5IT9Z 1IN4A 2OA4A 4N9HA 5BPDA 4PCQA 5L3GA 2F5DA 3RKYA 2JZYA 3ZMDA 1RZ4A 4O3MA 2PG4A 2DPDA 3CTAA 4KIBA 2CW0F 2V1UA 3OOPA 3L2CA 1ZG5A 2LF7A 3PQKA 4LGWA 2L4AA 3K1NA 4P9UA 4LK1F 2P7VB 2HTSA 3HRTA 1R5HA 3CLOA 4E70A 1XGMA 1J75A 1O3QA 2ZNYA 4G9YA 3FMSA 3KLOA 2Q8KA 1CGPA 4EMSA 1I6XA 3E5UA 4UVBA 3KP2A 4L5IA 1JE8A 2K4BA 3TOAA 1IN8A 5IT9K 1F1ZA 1ZREA 2VT3A 5K5RA 1P2FA 1IRFA 2W24A 4CO8A 3JSPA 1FP2A 2DU9A 3I59A 1LEAA 3ZMTA 1XSVA 4YG2F 1EV7A 1G6NA 2FBHA 4A5NA 3F72A 3WGHA 3R61A 4IRGA 3V7SA 3WE3A 3QPTA 3QU6A 2DLLA 1K7AA 2P6SA 2YX4A 3BPVA 1YQAA 1FBQA 4L0ZB 2IA2A 5E17F 1ZG1A 1UHMA 4KIFA 3RIRA 3M1EA 4AIJA 2O0YA 5HS7A 3H3ZA 1TW3A 1XCVA 2LSOA 2C6YA 3SZTA 3R60A 2FQ3A 2GIVA 1DPUA 2CWEA 5ICCA 2XV4S 2FNPA 1KA8A 3T8TA 3WGIA 1UB9A 5CYVA 3L7WA 3B02A 4ZZLA 5LGNA 3GZ5A 1Z05A 3IKVA 2VONA 4LK0F 5KVRA 3E6DA 1FSEA 1ZLKA 3E6MA 3SQNA 3AAFA 4LLNA 5HS8A 3TKYA 1IRGA 3OV8A 2L01A 3HRUA 4P9FA 4BHPA 4KN7X 2WTEA 3FWEA 2H6BA 4I0BA 4XSXF 2WWYA 3GEZA 1GXQA 1IXCA 3HHGA 5DYMA 3ZN1A 3IL2A 4ZYGA 3LSTA 1MJAA 3W6JB 5ED4A 2R3SA 3N4MA 2RC4A 1FX7A 1XSXA 4OIQF 2MD5A 2KIMA 3DP7A 4QLCU 5EEHA 4D0PA 3IC7A 3J81K 3E3VA 1YFHA 1R58A 2G7UA 3GWZA 3MQ0A 1T2KA 3LA2A 1ZH5A 1OYIA 5EEGA 2HKXA 2DQRA 4B8XA 4TV7A 2P5KA 2BE5F 4MHGA 2FU4A 2HS5A 2XAHA 4XLPF 4A0XA 1YS7A 2B0LA 1TNTA 2XGXA 3IWZA 1C0WA 5LHIA 1HW2A 1I27A 1FT9A 1X3UA 3O2PE 3TDUC 2QQAA 3VB2A 1KYWA 2PN6A 2LNBA 2W25A 2RKHA 2DBBA 1WSUA 4HDUA 1QBJA 3QU3A 1D8KA 4LMYA 1QGPA 2QUFA 5DD8A 1RUOA 3MZYA 3WE2A 1FY7A 5BQTA 1I1SA 5E1XA 3HSFA 2PI0A 2HZTA 4XBFA 3SHFA 1DPRA 1O3TA 2STWA 2D1HA 1OPCA 3ZMUA 1B9MA 2E7XA 3V8KA 1IXSB 1IF1A 2ZFWA 1E2XA 3WTSC 2VODA 2FSWA 1T98A 2QBYA 2VE9A 1TQPA 2PMHA 3GLXA 1BI3A 3PFIA 2O3FA 1IW7F 3KFWX 3VOEA 1ONVA 2OZ6A 2LKPA 4U7BA 3WTUC 4FX0A 1Z7UA 2CGPA 3WODF 2NYXA 3QPHA 3ZMSA 2EWNA 1HKQA 2O61A 2EA4A 1REPC 2XVCA 4A6EA 2HOEA 3RYRA 1YW8A 2MLGA 2AXLA 3U1DA 1KQ0A 2VOPA 4XLNF 5F1RA 4BQAA 3TO9A 5D5XB 4EJVA 5JHUA 5E20A 4KNYA 3KP3A 1PDNC 5ILUA 1MGTA 2HQRA 5D5UB 1MJBA 3RPUA 2EV5A 2Z99A 4JQFA
chains in the Genus database with same CATH superfamily
3QYFA 3KP4A 5AIPA 2QQBA 4CGZA 1STZA 1SD7A 3A4CA 2L7KA 4WX9A 5JI6A 4BUPA 3HB9A 5DEQA 2O8XA 3ECHA 1EJ9A 1Q1VA 2HDCA 4R1HA 3TO6A 3CMAI 1CF7B 3DV8A 2OBPA 2LDUA 3H1CA 5DD4A 4M71A 1E0EA 2WB1N 3DLLF 2O8KA 3K10A 2K02A 3I4NJ 1RI7A 3BZCA 2M34A 5D8LB 2ELJA 1H89C 3FK7A 3HRSA 2IRFG 2R7WA 1YS6A 2Y30A 3ZMZA 3OSFA 3O3KA 4PFOA 2OJED 1RETA 3I54A 5DM7F 1K6OA 1HW5A 1V5GA 3GCMA 4F7ZA 1G3TA 5L3BA 5FLXK 3MMYB 4BAYA 1J09A 4OOIA 1YTYA 3GTKJ 2IA1A 3ISPA 3M8JA 2W1OA 1Y1WJ 3EUHC 2XUBA 5JVGF 3CMEI 2XAJA 3S14J 4KUMA 2E1OA 3KCCA 3DKXA 4E7SA 5FJ8J 4RB2C 1NG6A 4UUTA 1WPKA 3KEQA 1Y56A 3DEEA 2WV1A 3FM3A 3ABKH 1S5LC 2IGOA 4L18B 2GZWA 3MKWB 4G6QA 1X2NA 3MFKA 3BROA 4RGUA 3BR2A 2IJLA 5BPIA 1PP8F 2BV6A 2EFWA 4MFEA 4M9SA 1USTA 4ASNA 4I99C 4BHBA 1N77A 2WY7Q 1V4RA 2GA2A 9ANTA 4UVAA 2HVSA 2MSYA 1FLIA 3RJPA 1BC8C 3GX4X 3BR0A 3EPZA 3OYCA 1YJ9I 3BTLA 2CUJA 3DWLE 2LR8A 2F5FA 2UXNA 3N97A 1HDPA 1H9TA 1VQ8I 3HPGA 4HA8A 1XB4A 1DU6A 4BQOA 5E18F 2VI6A 2JSCA 2VBYA 4Y52J 1PJRA 1YJNI 4OU0A 3WTWC 4A3IJ 4Z2YA 1B1BA 4N0BA 3ABTA 4V2FA 2HNHA 2BOLA 4RM3A 1Y0UA 2XB5A 5DV5A 2ZJPF 3BTIA 1IGNA 3GFMA 3P9CA 4HX4A 3FBNB 3S2HJ 3H9GA 1UHWA 2DA5A 4RAZA 1KU9A 3SYTA 1R5GA 2DT5A 1YO5C 4BJ5C 3D1NI 1MBGA 2K4JA 4D1QA 3F8BA 3PUBA 4AD9A 3F21A 1B6AA 4YFKF 3M7GA 2XAFA 1ETQA 2OTJI 2H1KA 2KISA 4LG0A 3K9TA 3OOUA 3HXLA 3HUGB 4HZFA 4W1UA 5DTDA 1Y39A 3DBRB 4V2GA 5D6EA 2CG4A 5HDGA 2OF7A 4F92B 1B72B 4X6AJ 3DPLC 2IVMA 3E1SA 1HW1A 1RRJA 1EF4A 3CCVI 2OU2A 5ICFA 3E5QA 3O8HA 2JN6A 4BL0B 1WH7A 3C2BA 2M8GX 1WKMA 4A6DA 1SD6A 3CZ6A 3I9V2 4D7NA 3A03A 5DS9A 3M9AA 3OYMA 1J5YA 1XTAA 1XG1A 2ZMEB 1T0FA 3HZJA 3JAMZ 3G1OA 3HBLA 2HYFA 4J19A 2H94A 2K86A 3LQQA 2BY2A 3RTRA 1VQ9I 2CFXA 1ZRCA 2EZLA 2NOJB 3MZ8A 3ESWB 3QOEA 4BXXJ 3JTHA 5EDNA 1JKPC 2DFFA 1V5EA 3MWMA 1IN5A 5J8CA 5CQGA 3G6EI 1ETKA 2V9PA 3K4JA 4ETSA 1VQOI 4N4OB 3QAHA 2ZNZA 3H3UA 3HOWJ 4IVNA 4FE4A 2XAQA 2JVGA 4CXFA 1XS9A 2O5RA 4MO7A 3OYJA 2RGVA 2WV0A 3PFYA 1A5JA 1BI2A 5E3LA 3CMYA 4HLXA 2BW3A 2JPBA 1ULYA 2AO9A 5E3OA 1V55H 2BHYA 2MA3A 4HV6A 5IYCJ 4ZTJA 2WB1A 1YE9A 4G6DA 2ZMEA 4A3KJ 3FXJA 4M74A 3SFIA 1SMTA 4GO1A 1SANA 2VBWA 4IQ4A 3S8PA 5BMZA 2ZB9A 2KJCA 3H5NA 4AIHA 4QPQA 1BM9A 2XPWA 4BQNA 4RMNA 4MQ9F 2PMUA 1W5TA 4ZZDA 2O03A 4R8HA 1GVDA 4GDFA 1VZ0A 5HNFA 1BL0A 1U5TC 1I39A 1NTCA 3BTJA 1WQ2A 2E2JJ 2DPUA 4M3DA 1XCBA 3F23A 4XLEA 3J7AO 4UY8I 4L9VA 3W6VA 3JAMK 2Q0OA 1U2WA 2NVTJ 3GFLA 3EUHA 3I4PA 1MSFC 1FOYA 2EV0A 2DCEA 3KX2A 2F4IA 3C7JA 3T5XA 3GFJA 2DI3A 2FUG2 1Z6RA 2VKHA 3LWFA 4Z6YA 5CLSA 4JX6A 1FTZA 4AYBA 4P5OA 2NVQJ 3VODA 3BDDA 1RIOH 4WXDA 4MGRA 1KONA 2Z5UA 3RQ4A 4XRFA 4OIPF 4LITA 2EINH 3IHUA 2CQKA 3Q5FA 4A0YA 4EGYA 2Q1ZB 4XKVA 3CCLI 4A3MJ 4A3BJ 2CW7A 3LA3A 4E6KG 5CKTA 1FPQA 4UNOA 3OL4A 4CCOA 1O7LA 2DN0A 3FXUA 2GXBA 4A93J 2X6YA 2KL4A 5HODA 2HFHA 4RAGA 2P8TA 2XHKA 2E35A 3M1CA 3NARA 3ZOBA 3BCAA 2QSFX 1UHSA 3E0JB 2EJRA 5DDGA 3ZCOA 3AG2H 2V6CA 3G71I 1XC5A 1ERDA 2EH3A 2GOMA 2Z16A 3PNTA 1O4XA 1QPMA 3RKXA 1CQTA 2VE8A 1UG2A 1KQ9A 2VJJA 5DCMB 2RNGA 1WGXA 2V9VA 4BH9A 4BXUA 2HXIA 1IUFA 1AKHB 1WRJA 2K3FA 5IYDJ 4HG2A 2Z33A 1G2HA 1FP1D 4HBLA 4I09A 3DLAA 3L9FA 4QPOA 2L2OA 1JGSA 3KP5A 2F5CA 3S15J 5E8IA 1HSJA 1B8IA 4M6XA 2W84A 3TEDA 3JRGA 1GXPA 3CQZJ 2MLKA 3FDYA 1AA7A 4XNFA 1ZGWA 5L3CA 1DGRM 5KAIC 1J9IA 2CQNA 4XLHA 1JUMA 4I6ZA 1XMXA 4XSZF 3OYDA 1JI8A 1FSHA 3T8RA 5LHGA 2NNYA 2EZHA 3TDZC 4AVPA 5L3EA 4IRHA 4IHVA 2CMPA 3W6KB 3U2RA 4DYQA 1MDMB 5J1YA 1OYWA 4RB1A 3GTOJ 5DCMA 1OCZH 1IN7A 2O9LA 1HLVA 1EH8A 2ISYA 4KT6A 3HSEA 1JXSA 1BW6A 3P9IA 1AKHA 1FWZA 5JFRA 1MD0A 4UUVA 2HXOA 3BLYA 3F6OA 1MMGA 4OIRF 5E1ZB 6PAXA 1U8RA 5J8FA 2CV2A 3LSMA 1SFUA 2V1DA 1YYVA 2M3AA 2VASA 2A3SA 3ZQFA 3FZVA 1R23A 3QPSA 1WZ2A 1U5TB 1BI0A 1MSEC 5KCMA 1F4KA 3ELKA 5FKNA 4IHYA 3J81Z 5FKLA 2TRTA 1PP7U 3HOVJ 3M8FA 5E8GA 1D1BA 1Z91A 3IAM2 3V42A 4EM2A 1XGOA 4Y13A 1AU7A 1ZQ3P 5K5OA 1JHHA 4RDUA 2ELHA 1P7JA 2CO5A 5FD6A 3J7ZI 3GLLA 3MKLA 1AOYA 1A6QA 3H9QA 1ZAOA 4NC8A 2FMYA 1NHAA 1HBXG 3R4KA 2LRDA 2HDWA 1D0YA 3BR3A 4I2OA 2O6GE 4KFCA 2HDDA 2D45A 5M3MJ 1K79A 1GHCA 4GFBA 3QRFF 2VBXA 2HOSA 3K7AJ 3IKTA 4DZPA 1LDJA 1J0RA 2IA0A 3F3XA 3L2RA 2J5OA 3IUOA 1TNSA 2HEOA 1VQNI 4E7JA 1OYYA 4RA2A 1QZYA 2ADUA 1U5TA 1YOVB 3ABMH 3HG9A 4XOTA 1U6GA 4L9JA 3JRHA 3U9GA 3AKZA 2STTA 2MC4A 2X4HA 4CCJA 2F5EA 1TT0A 2EA2A 5LGTA 2KRHA 4A12A 4ZDPA 4Q47A 2MC3A 5K1YA 3K2ZA 4DYRA 2X1EA 2PJRA 5FFXA 2BHZA 3NQOA 5FLVA 5F0FA 4S04A 3AL0C 1OCOH 3COAC 1KU7A 4Y15A 1Z3YA 4HQMA 4DNCA 4ENNA 1QHHD 1I3QJ 2GQQA 3FF5A 2DAOA 4B43A 2DDBA 3OYLA 4PUSA 3V7RA 2PLYA 2FE3A 3FM5A 3LOCA 5C4JJ 2IW5A 4ENMA 1IRZA 1U0JA 3OR1C 4HSTA 1TC3C 4ON0A 4ENKA 2AS5F 3BC8A 5ERIA 4KYWA 1B59A 1XDSA 2D1VA 3S3OA 3SEZA 3ASOH 5GAGJ 1P92A 3DEUA 1ZGJA 5EZGA 3QWLA 3X2QH 3OYAA 4HDVA 5K7HA 2L54A 2EK5A 4MFDA 2KZGA 2A61A 4UVCA 2XSDC 2CQXA 2RVCA 3H0DA 2ME6A 1OFCX 1LEBA 2M4KA 1D0XA 2KHMA 1BN5A 2JVHA 2LBFB 4YRVA 3LSIA 4IF4A 1A31A 5KAFC 4OIOF 4PFPA 4ZJZA 3CJNA 1P7IA 4I0AA 1G4DA 2E5NA 2P7CB 1EH7A 2H09A 1KU3A 1ENHA 2WC2A 2X6OA 4WF2A 5F04A 1Z67A 4U0WA 2FRHA 1FNNA 2L0KA 1YW9A 1EH6A 2NS8A 2ETHA 1IV6A 3Q9SA 2VPRA 1LQ1A 5F08A 1W5CC 2VLAA 2GWRA 2QWWA 4CCKA 2X6XA 2DMTA 3CF2A 3P5JA 2ZBKA 1XMKA 2PBIA 4BQQA 4EM1A 2UWMA 3OYFA 4HF0A 3W2VA 4Q4ZF 2NVYJ 4BE2A 1FTTA 1JKOC 1GDTA 2NOGA 5D5WB 5E1WA 2ZJQF 1T95A 5TRDA 3R0JA 2JRMA 3JRFA 2R5YA 4F93B 3CCUI 1BOBA 2Q2EB 2LBFA 2B7EA 1W0UA 5H6QA 1SC7A 2X85A 3ZQLA 3SZPA 3CDIA 4EATA 2W4SA 2J5PA 1XGSA 3ZQHA 1JTXA 2JWTA 2Y48A 3ERED 2Y9ZA 2NRAC 4EJWA 3OIPA 5LHHA 2VBZA 5LEJA 1PUFA 3HDDA 5DUIA 1WI9A 2HVQA 3CJTB 2XPUA 1WJDA 5LRSA 2ISZA 3PNVA 1QZEA 4AIDA 2LVSA 2VIXA 5J4YA 1ZN2A 1FYMA 2NS0A 2F48A 2RN7A 4LLLA 3OYEA 4DBQA 2KKOA 4MEXF 1MKMA 2IAIA 4MEYF 2FMLA 1YW7A 1XX5A 3RI4A 1I6HJ 4UUSB 4U0VA 1E3PA 2M5WA 2VKVA 3CCQI 1H0MA 4J01A 1IZ1A 2W57A 1L3LA 2D5VA 3FMQA 2BBYA 2Q2EA 5H6RA 3FXOA 1LNWA 3CDHA 3ZGKA 3CDLA 4FX4A 3L2UA 1JT0A 1G59A 1QU3A 5FLXZ 2DA1A 2ZKZA 2ZSIB 4KMUX 4CHUA 5HDNA 3Q9VA 1RUNA 4Q5SF 5HLHA 3SFZA 4HSRA 3VYTB 3BZ6A 3GTLJ 4I01A 4HW0A 3U21A 2DA3A 4L5JA 3F8CA 3GFIA 1IDZA 2I8DA 5FLMJ 2LY9A 2W82A 3CCMI 2XAGA 1Q1HA 1MJ9A 1HQCA 1YIJI 1RKWA 3EQLF 4JYKA 4IEJA 4XKWA 2LYCA 2ID6A 2IXSA 3TL4X 1OCTC 1IUYA 2VC1A 2DOFA 4IHTA 1UMQA 3F8MA 1T8IA 3FXMA 2R4GA 1X1PA 1IJWC 2CUFA 1LE8B 4BACA 2Y0SN 4EM0B 1APLC 3F22A 4CSWA 5JHFA 3HKZN 3WG7H 1WI3A 1XN7A 3VSKA 1TWCJ 1ZHFA 1HSTA 2DDAA 4WK8F 1OCCH 2XASA 1LUJB 1TWHJ 2PX9A 3BOQA 3N05A 3MN2A 4G7OF 1B9NA 2YU3A 1BW5A 2ZMEC 1QZZA 1O3RA 2Y2ZA 2JK3A 4BBSJ 1Y6IA 3K1MA 2NNNA 4H0EA 2HPMA 4U87A 2MBFA 5D4RA 5J47A 1K78B 1ZLJA 4CYDA 4YEJA 3KLNA 4KIGA 4HF2A 1OISA 2LREA 4PGGA 2XAUA 2LG4A 3K4MA 3K4BA 2Y9YA 4M72A 4Y33A 1MH4A 3RQIA 3V7CA 4ENJA 3S2WA 3ECOA 2BEOA 2Y31A 4X1EA 1YHQI 3HSRA 4A3CJ 1MIJA 1POGA 3EYYA 2CYYA 1S9HA 1YG2A 1JGGA 1GLNA 5M5WJ 1ZR2A 1LE8A 2IGNA 3UNGC 4M9XA 1LFUP 1U9OA 4B1RA 2LF8A 4PDKA 4FHTA 1FBSA 1R49A 2K5CA 4PGHA 2CV0A 1CF7A 1DU0A 2HZDA 5BOXA 3GO5A 3C1DA 5KHDA 3G1LA 1JJ8C 1R1VA 2GXAA 4XRSG 4PK4A 2QENA 1G3WA 1K78A 4CDGA 3FHZA 1Z6TA 2EZIA 1FZPB 1RESA 1Z1DA 2ESHA 2L9SA 4PSWA 3UR3C 1UJ8A 4FETA 3EYIA 1QVUA 1FIAA 2UXXA 3H3VK 4BBRJ 2RREA 4HOBA 3WTTC 5F64A 3IWFA 3K6GA 4XRMA 2M4GA 1SVMA 3PUFA 2EIJH 3LSPA 1X1CA 1QPIA 3F0CA 1T38A 3RCOA 4MTEA 3G1MA 1SFKA 2P81A 4EJOA 5B5EC 1WJFA 2EB7A 4M9ZA 1FOWA 3S93A 5HDKA 2A07F 2HPIA 4YFNF 2DMUA 4G7ZF 1MBFA 3HOTA 3H5AA 2XC7A 2BXZA 2YX7A 4S05A 1Z0XA 3C18A 3FXRA 2GXGA 1MMNA 2LY1A 3M4OJ 2H27A 1JKRC 2O7OA 5FD5A 3WU1B 2FBKA 3ML6A 4HF1A 2DTZA 4BE0A 3V4GA 3S2DJ 2ZXWH 3SDBA 3E6CC 2VQHA 1D1AA 2DOEA 4MNUA 4PJ0C 4XRSA 2R7RA 1T08B 1WHUA 3DBHB 1E17A 5CQEA 5ICGA 2A68F 1IAWA 1HA8A 2KIQA 2GIZA 2JUGA 3MAJA 2XKPA 2HOTA 4C2MJ 4CZZA 4CYCB 2IS2A 3HTSB 2COMA 3ZQQA 1X1AA 2COBA 2I10A 2OAZA 2FD5A 2OC6A 2KDOA 2ECBA 3NRVA 1OCPA 2UZKA 4F52A 5DM6F 4YIFA 3LSKA 2DTRA 1GV2A 2A6HF 2HU9A 2M0CA 1SVLA 1HF0A 3K1PA 4UXNA 1HXDA 3TBIA 1P4XA 3FX3A 5JLWA 5HLIA 3GUDA 5AIQA 5L3DA 2DMPA 4XKBA 5ILVA 3DKWA 4BU2A 3J80K 2XROA 3G4SI 4XOPA 3PO3J 1IDYA 3B73A 2IBDA 4P1WA 3IP4B 1YJWI 3AG4H 5LGUA 1LKXA 3BJAA 1MBJA 2IS1A 1W7PB 4A3DJ 1Z3XA 2PMZN 4Y17A 3I5UA 3HUGA 3LA7A 5GPCA 3CUQB 1B72A 2VKEA 5H20A 2JTVA 2Y0SA 4ITVA 4I02A 4RB0A 4CYCA 3C3WA 4P96A 1P4WA 3IH4A 1QA6A 2NVXJ 1SD5A 2BGCA 3JRCA 5J1RA 4L9TA 3DF8A 2WAFA 4C2UA 2G7HA 2FF4A 2K9MA 2P0WA 3ZXSA 1XD7A 2HQAA 3M07A 3H0GJ 3VWBA 1W4MA 1MNDA 3DXJF 2R7QA 2XSJC 4FT8A 4CCLA 3FXLA 4XLCA 1VQKI 1DP3A 2KPMA 2NS7A 2OQGA 1W1WE 3FXQA 4PZJA 1SFXA 5LRRA 1VFCA 2VC0A 4E7KA 4ZYAA 1LPQA 3WTYC 1R7JA 1YIOA 5FO5A 5F0HA 4EGZA 4IHXA 4KISA 1HKSA 3ZPLA 2CQ7A 4LFUA 4C2TA 2Z2SB 1F9NA 5FFZA 4G7HF 2KRFA 4GXOA 3I55I 1BJAA 3I58A 3ABLH 3BG3A 3BPXA 5FKMA 2WBMA 1YRNB 3MVPA 3L2VA 5KNLA 1EA3A 2KIFA 2YR2A 1OJLA 4EVIA 2IP2A 2VXZA 3T0YA 4NC7A 3IH3A 4HPQA 5TJJA 5ICEA 3S1MJ 1QVTA 4AUXA 4KA4A 3TO7A 2PEXA 1WJCA 3E5XA 2XB0X 3CC7I 4F91B 5B66C 2FOKA 2K9QA 2F4OB 3GYHX 3E97A 3O8GA 1XGNA 2V1NA 4NDLA 1FEXA 1K4TA 3HOYJ 3WU0A 4XL9A 3R6SA 3PJRA 3D5SC 4KICA 2QF7A 5TISC 2AHQA 5LFAA 1S8NA 1BR2A 1K83J 1X2MA 3PIOF 4QSHA 2K7LA 4D5FA 5IOYA 3NWTA 4YELA 4A2UA 5FGMA 2H1LA 4EJTA 1R4NB 3BG6A 3A01B 2L7FP 4HYEA 4RBOA 2W7NA 4CUGA 4LD5A 2ZCWA 1S29A 3KEOA 1HOMA 4IPAA 4FTHA 1NK2P 1YRNA 2L7ZA 3I59B 2DK8A 5D4SA 1QNTA 2Z3YA 4LJZF 4QWQA 2Z9OA 3BY6A 3CCEI 4OINF 5IT3A 3D5LA 4IHSA 3H92A 3S32A 2EFQA 1BIAA 4F55A 1LDDA 3V8LA 2M87A 2RV8A 2VJ4A 5BS6A 1FIPA 2BVLA 3D0SA 1NG7A 2OD5A 2QGUA 2DFEA 1XSDA 2YU9J 3LNQA 3TOBA 2E1MC 2DXIA 1NK3P 2QM3A 2DO7A 3BG5A 4M3BA 1Y0NA 3ONQA 2LD5A 4BEHB 3TQNA 4LG3A 1I50J 3HJEA 3RDIA 4NQWB 5F1JA 4NBQA 5B1BH 3FK6A 2QLZA 5A2QZ 3A01A 4U88A 4A3JJ 2PFBA 3RPQA 5D6FA 2HWVA 4KN4X 4ABZA 4WWCA 3PL8A 4IXAA 4A3LJ 4BE1A 1FJLA 3QOPA 4LIVA 2K9NA 4JBAA 4NHJA 3DQVC 5GTHC 3HOXJ 3H9JA 3FHNA 3CF5F 2X1DA 1ON2A 4LB5A 4OWRB 4GCVA 5FRNA 3J7AY 2R7TA 3Q0WA 1W36D 1DUXC 4XN3A 1R1TA 1X3ZB 1J7KA 2ZXHA 4WXCA 1D5VA 1ZKGA 3HRMA 5C44J 1SAXA 2JA7J 2E7WA 4IL6C 1A35A 1TLHB 3PSIA 4B3XA 2EV6A 1WJAA 2KLOA 3DKYA 4XONA 3SDGA 4BXFA 4IX7A 2KRCA 1YI2I 3GTMJ 3HHHA 4DQ2A 2CV1A 2UUZA 2DK5A 1ON1A 1R5ID 5L3FA 4ESFA 1ZYRF 1KQ8A 4O6JA 1WCMJ 3QP5A 1S72I 2H8WA 2KDZA 1E3OC 3QP6A 3DEWA 4JX4A 4NQWA 4LB6B 2MW8A 2FJ1A 2VUMJ 3OY9A 4HLYA 2FNAA 1BA5A 3BJ6A 1JUPA 2M30A 3AG3H 3TP3A 2P5LC 2ZFUA 2IGMA 2TCTA 2MG4A 4L5EA 4B4CA 1MDMA 1JUSA 2DW4A 1SMYF 3HGGA 1LVKA 5HOOA 1G3SA 1VI0A 2HYGD 2ELKA 5CVRA 1QHGA 4ESBA 4A69C 5A2QK 3BQYA 3CCYA 2HI3A 3S3MA 1AHDP 3WTZA 4G94A 1TWGJ 1K4SA 3LL7A 1ZK8A 2JJ7A 4CA0A 4HX7A 3L00A 1T39A 2EFNA 3PSFA 3L2WA 1HDDC 3EDPA 1OMIA 1RC9A 2YPRA 2FBIA 5J1UA 1HKTA 2OZUA 3B6CA 4OMZA 4F3QA 2ICWG 3ROUA 4I7HA 2P4WA 3LAPA 2UV1A 4G12A 4IOAF 1FBUA 2X51A 1MH3A 2L02A 2BYVE 2FA5A 2VQCA 2FX0A 1FYLA 4MTDA 1TT5B 1TTYA 2TDXA 4RGSA 3LSRA 5K7ZA 3CJRB 1O3SA 2DJIA 2JPCA 3E7LA 4DOZA 1R1UA 1ZGAA 2GBYA 4DZJA 3JTGA 2EZKA 3BR1A 2MGQA 1BOAA 3AG1H 4KDPA 4NUBA 1W36C 2E1MB 2YS9A 2ZJ2A 3GBGA 3I0TA 4UHTA 4BDYA 3LMMA 3RKQA 2GOXB 3ASNH 1IG7A 1D0ZA 1SAUA 2M8EA 5CVVA 2R92J 4UB8C 4ZYEA 2KZVA 2WY8Q 2EILH 1F5TA 1ACIA 5D8KB 3PNYA 1ITYA 3WTXC 4N9IA 4FQGA 3OYGA 2XDVA 3AFHA 1J59A 4I98B 4DBRA 3LAJA 2K9LA 1W0TA 2DYSH 3OWTA 4HV5A 1WH5A 5GAEJ 3P9KA 4BGDA 2DYRH 3KZYA 3VFZA 2DT6A 2XGCA 3HOSA 2R7VA 4CICA 2DJNA 2KIUA 2EFOA 1ETVA 2OQRA 4A3FJ 1YX5A 1ZTRA 2M9HA 4AVZA 1TQMA 3LFKA 2DODA 2M45A 3A1YA 2K3PA 3BP8A 1A04A 2L7MP 5AONA 4E7IA 3I53A 1W5SA 2K9SA 1D1CA 3ZP5A 2XKOA 3MD2A 3LSHA 4X0GA 4XKCA 2KQRA 5GPAA 5CPRB 5IY5H 2IT0A 1BR1A 4B48A 1LFPA 4UV8A 4IO9F 1X1DA 2DMNA 1U3EM 2ME0A 4WCGA 1FYKA 3OMYA 4M3GA 4C9YA 3GZ6A 4GYIA 1MZBA 3KETA 1LJ9A 4QIWN 3GZNB 2JQ7A 4BY1J 4KMFA 4DW6A 1T33A 3DTIA 1VQ7I 3K70D 3K4CA 4K2EA 2BVMA 1UFMA 4AWXB 1OKRA 1DGWY 3H36A 3JCUC 3KP6A 2F4MB 4HRIA 3KEYA 1R22A 3A2KA 1S7AA 5FKOA 3OS1A 2VPLA 2HKOA 3SZGA 1OR7C 2QBYB 4C30A 1XDUA 3F8NA 3O6BB 3F9KA 4PJMA 4LLGF 3OS2A 2CS3A 1KU2A 1V3FA 2LC2A 2PJPA 3RYPA 1Y1VJ 5EZHA 4B44A 5EEAA 4M6YA 2JA5J 1D3YA 1E3HA 3WHBA 3OIQA 2A69F 2V79A 3HOZJ 5HNHA 3K69A 4UV9A 3RKWA 2HTJA 1VTNC 2HYJA 2HGCA 2GAUA 1LB2A 2F2EA 4HQEA 3KP7A 2QQ8A 1B4AA 1W7PD 4BY7J 4Q48A 1ZRDA 3VEPA 2H6CA 3R0AA 1G3YA 2R7FA 4CCMA 3ZN0A 4BJ6C 2GM4A 5JVTA 1VQ4I 1KGSA 2E71A 1BBYA 5K5QA 2OUMA 5CVIA 4IQJA 2A5YB 2Z1DA 4II2A 5HVQC 2JMWA 1QQIA 5F6FA 4YIRX 2XF5A 2QSHX 1I1GA 1SD4A 1WJEA 1IN6A 1MW7A 2KP6A 4NB5A 4WXHA 1P4AA 2CQQA 3T1BA 1Z21A 5K7FA 1BIBA 3KIOA 2VL8A 4GYGA 3VPRA 2L3DA 2L4MA 3LQRA 1OQYA 2X0LA 2HQ5A 1ZRFA 3DFGA 3A0HC 2V4JC 1FC3A 3GTJJ 3JW4A 3S16J 1K61A 3JREA 4MQVA 1H88C 2NAZA 4ZTFA 5J4VA 2KJBA 3OIOA 2CFOA 1M1EB 2M1BA 2E1CA 2DQLA 3L09A 3SXYA 1F36A 1YLFA 2Y75A 3DPTA 2LKSA 4JX5A 3DCFA 3PO2J 5IOZA 2I5UA 4A5MA 3I64A 3PQJA 3EUAA 3K70C 3HM5A 3WU2C 3H35A 4UUSA 1TL8A 2RAEA 5C4XJ 3TGNA 5F0CA 1VQ5I 1TBXA 1QO0D 3NWSA 2BXYA 4RGRA 3ABUA 2M0MA 2JRTA 4AC0A 1YITI 2NVUB 1NH3A 4B09A 2F6CA 1MNMC 5CJ9A 2OCEA 2JA2A 2OCCH 3RZDJ 1WVRA 1PUEE 4M73A 3HTUA 5EG0B 3GTGJ 2WADA 2P6TA 3BQZA 2HQNA 3HIFA 4AIKA 5IPAA 3G73A 2E60A 2RNJA 3J7YJ 1ZARA 3VYRB 2XF6A 3GVAA 3IRQA 5HS9A 4JOMA 2CSOA 1MBEA 4V19K 5GTIC 3A0BC 3BWGA 1SFEA 3G3ZA 2V9KA 5ILSA 2RQPA 1J2XA 5JLXA 2VKDA 4BKXA 4KT5C 1IXRC 2CRGA 2IGKA 3PM1A 4ZC3A 2DFIA 3CUQC 1IO2A 1LDKB 4BHCA 1LVAA 3GW2A 4ZDLA 1Z9CA 1I5ZA 4XK4A 4XORA 2R7DA 4C3HJ 3F6VA 4EJUA 2A6EF 4L9NA 4D5CA 2QEXI 4ESJA 2IPQX 3MKZA 2EIMH 4MLOA 5CVUA 4OAZA 3VDXA 5EG0A 4S0HB 3ERMA 4RS8A 2ESNA 3OYKA 4IZZA 1TW2A 2CW8A 4XR6A 2G0EA 3ULQB 4NC6A 1DP7P 2GLOA 4R79A 3K0LA 3V8JA 4E7LA 2V1XA 1BC7C 2LFBA 2QYOA 1FOKA 2EBIA 1S3JA 3M8EA 2RDPA 4RB3C 2R7UA 2ZSHB 4LOCA 5C3EJ 3HYIA 3FMRA 2R0QC 1OR7A 3TW6A 5LEKA 4AU7A 1R36A 3KE2A 3J80Z 1ETYA 2E1NA 1PYVA 1MBKA 1R00A 3S1NJ 3BZKA 4AYBN 1RNLA 2QZ8A 2L9VA 2QQ9A 3MCZA 4JK1X 2JT1A 1BI1A 2P5VA 1JHFA 4FASD 3JSOA 1WFXA 3CO7C 3GF2A 3EUKL 2WAEA 2CU7A 5FB2A 2M2EA 3LSGA 2VOOA 2ZO4A 4U7DA 3TP0A 2D2WA 1USSA 2DMQA 5EF6A 4DJAA 1U8BA 4LG0B 4IRIA 1GV5A 1O7FA 3W2AA 2ACJA 1HCRA 3L1PA 1T56A 4GGGA 5E3NA 3CUOA 2LKXA 1T6SA 5D5VB 1U9NA 3HPHA 2PQ8A 4U0YA 1N78A 2XGEA 1IV8A 2FEZA 4HAMA 5J6XA 2BZTA 4OAYA 2QCOA 5HLGA 5DUKA 1O57A 4EEFG 2XIGA 4FCYA 2G9WA 1FMVA 3REOA 3K4KA 2QKMB 4ZYHA 1RR7A 1VF9A 5KK1A 2E34A 3IRRA 3GTPJ 1U78A 3ZQ7A 4O5VA 1TQIA 5LBQA 1P6RA 5IP6A 3CCJI 3DBLB 3C2HA 1PVEA 1KYZA 3OYNA 3GMEA 3CO6C 3KZZA 5JR3A 2FQ4A 4A0ZA 2W85A 3BCBA 2MH9A 1K6YA 1ODDA 3DTKA 3K2AA 3FKJA 5EJCA 5LLQA 2AQEA 3OYHA 1DDNA 2ZXJA 3WGGA 4YFXF 1P9QC 2XRNA 4AM3A 1UG0A 1Y8RB 4IJAA 2ZJRF 2GA1A 3FXKA 3OR2C 1XPXA 2VB6A 3MZHA 4HX8A 4RGXA 2BW3B 2MH2A 1WWXA 2OPTA 2DFHA 4G8XA 4EQQA 2BY0A 2JA6J 2YSRA 4M3EA 2QVOA 2A05A 3PIPF 3W2WA 3H5RA 1MMAA 1AWCA 3OYBA 5CVJA 2AXTC 1R6RA 2HR3A 1S6LA 2K40A 1H9GA 4XQFA 3CC2I 3I71A 2VT2A 3ZMVA 3HKZA 2LY2A 2Y0MA 1D8JA 3F8FA 4RAYA 4L0YB 1VQPI 1S7OA 2VN2A 3SJMA 1ZELA 4XLAA 3BR6A 2X9DA 5FROA 4YIIA 4M3FA 5DCFA 3D5RC 4OMYA 3MEXA 2CH0A 3BJOA 3P7NA 1JJ6C 1I3AA 3LSJA 1XMAA 1GT0C 5EGOB 3NEUA 2K27A 2MABA 3VYUB 2R7ZJ 4Y4RA 3E6BA 4BYYA 1W7PA 4EV0A 1RPWA 4ZH4F 3GXOA 1VQLI 2EFPA 1ZG3A 4P55A 1UCRA 4XLFA 3EETA 2FXAA 1GVJA 4ZYDA 5J40A 3CUQA 3WG9A 2YUSA 3WTVC 4BNCA 4B47A 1MBHA 1L0OC 2OTLI 3KPHA 2L5QA 4LIUA 5IT9Z 4Y7NJ 1UAAA 1IN4A 2EIKH 2OA4A 4N9HA 5BPDA 3IV5A 2JSPA 4XMYA 1FMWA 4PCQA 2ZXIA 4Y3OA 5L3GA 2F5DA 3RKYA 4D7MA 1V54H 3NAUA 1VQ6I 2JZYA 3QQAA 3ZMDA 1RZ4A 1Z77A 4O3MA 2PG4A 1X1BA 2E36A 2ECCA 2DPDA 3CTAA 4KJZA 4KIBA 2CW0F 2E19A 1X19A 2V1UA 4XICA 5EGOA 3DTEA 2W00A 3OOPA 3L2CA 2ID3A 1ZG5A 3A02A 2JA8J 3OL3A 2LF7A 5HLTA 3PQKA 4LGWA 2L4AA 2MYSA 3K1NA 4P9UA 5GP9A 4LK1F 2P7VB 2HTSA 4XN0A 4IOCF 2WA0A 3HRTA 1B8IB 1A6IA 1R5HA 3CLOA 3L2QA 2E5ZA 2XGDA 4E70A 4UB6C 1SFOJ 2EPFA 2Y69H 3JRIA 5FKKA 3CJQB 1XGMA 1J75A 3W3CA 3JR9A 3SEQA 1O3QA 2ZNYA 4HNVA 4G9YA 1YX3A 3FMSA 3KLOA 3I4MJ 2Q8KA 1CGPA 4EMSA 1I6XA 3E5UA 4UVBA 3KYDB 2DA6A 2WAQN 1JT6A 3KP2A 4L5IA 1JE8A 2K4BA 2L9RA 4DYCA 3TOAA 1IN8A 1ORKA 2IS4A 5IT9K 5EYRA 1D5YA 1F1ZA 1BJZA 1ZREA 2VT3A 2W48A 5K5RA 1P2FA 1Z7LA 3S1QJ 1IRFA 2W24A 4CO8A 3RZOJ 3JSPA 3BG7A 3ZQCA 1FP2A 1TWAJ 2DU9A 3DU6A 3I59A 1LEAA 3ZMTA 1XSVA 4YG2F 1N75A 3QODA 1EV7A 1G6NA 2FBHA 3K4NA 4A5NA 1ETXA 3F72A 3WGHA 3R61A 3FIWA 4IRGA 3V7SA 3ZQGA 3WE3A 3QPTA 2R5ZB 3IH2A 3QU6A 2DLLA 2K85A 1ETOA 1K7AA 2P6SA 2YX4A 2LOOA 3BPVA 3CLQA 3FISA 5IP9J 1YQAA 1FBQA 4L0ZB 4J00A 4A3EJ 2IA2A 5E17F 2EQRA 2OV7A 2CUZA 3VSLA 3RPUD 5E3MA 3OSGA 3WHCA 1WJBA 1ZG1A 2H8RA 4RLQA 1UHMA 3DPUA 4KIFA 4IKFA 2PMZA 2JUCA 3RIRA 4BEHA 4W97A 3M1EA 5TGTA 4AIJA 2O0YA 3K4LA 3H3ZA 5HS7A 1TW3A 2VJ5A 1XCVA 3I56I 3CCSI 2LSOA 5M5YJ 2C6YA 3SZTA 3R60A 2FQ3A 2GIVA 1DPUA 2CWEA 4JP0A 1MMSA 5ICCA 3VYSB 3MKYB 2XV4S 2FNPA 1KA8A 2F5VA 2AQFA 3QYEA 3CP8A 3T8TA 3WGIA 1VNDA 2FOWA 1UB9A 3Q0VA 2VJIA 5CYVA 3BTCA 3L7WA 3B02A 1OLTA 4ZZLA 3HC7A 5LGNA 3S1RJ 2R5ZA 2XPVA 3GZ5A 3OYIA 1G8XA 4CZCA 1DQUA 1Z05A 2DA7A 1R71A 3IKVA 2VONA 2R7XA 3BT9A 4LK0F 2R7OA 4BJTA 5KVRA 1LFBA 2BY1A 3E6DA 1FSEA 1ZLKA 3C2GA 3E6MA 4BS9A 4KITB 3SQNA 3AAFA 4LLNA 2LP0A 2E2IJ 4RM2A 4N4NB 5HS8A 3TKYA 2X48A 2NXNB 3HGYA 2PJRB 3HL2A 5H2FC 1IRGA 4PJJA 3OV8A 2L01A 3HRUA 5E79C 4P9FA 4BHPA 4G6TB 2M7AA 4KN7X 2B9SA 2V7FA 3TMOA 4C3JJ 2LH9A 2WTEA 3FBIB 3JRDA 3FWEA 2H6BA 4CCNA 4I0BA 4E4HA 2R7SA 4XSXF 2WWYA 3GEZA 2A6TA 3HEFA 1GXQA 1IXCA 3HHGA 5DYMA 2LLKA 5IP7J 3S3NA 1ZR4A 1R4MB 2MFZA 4FISA 3ZN1A 4C3IJ 2QA4I 4CH7A 5B1AH 5M5XJ 3IL2A 3LSTA 3W6JB 1MJAA 2VQLA 4ZYGA 5ED4A 3KZIC 3LFUA 2VQGA 2R3SA 3N4MA 1X4PA 3S17J 3I3LA 2RC4A 4D9JA 1A36A 1FX7A 4I76A 1XSXA 4OIQF 1SVOA 1Y8QB 3U1KA 2MD5A 2KIMA 3BR5A 3DP7A 4QLCU 2E2HJ 1IC8A 3ZRGA 5F27A 1TWFJ 4RAFA 5EEHA 4D0PA 3IC7A 4GRIA 3J81K 3HOUJ 3E3VA 4B3AA 1YFHA 3TW7A 1R58A 1X58A 1N25A 2G7UA 2X6WA 3GWZA 4HNTA 3MQ0A 1MNEA 1T2KA 4MIMA 3JRBA 3LA2A 1ZH5A 1OYIA 5EEGA 2V26A 2HKXA 2DQRA 3CESA 1EKEA 4PJNA 4B8XA 2RQQA 4TV7A 2P5KA 2BE5F 2WAQA 4MHGA 1TZLA 2FU4A 2HS5A 2V6EA 2XAHA 2MD0A 2DOAA 3DU5A 3GTQJ 2KMUA 4XLPF 4A0XA 3CMMA 1YS7A 5M3FJ 3Q3SA 4HEA2 2LTPA 2B0LA 2QSGX 1TNTA 1V5FA 2XGXA 1BR4A 3B6AA 3IWZA 1C0WA 2R5YB 5LHIA 1HW2A 1I27A 1HC8A 1FT9A 1X3UA 3O2PE 3TDUC 4H4KC 2M7BA 4ZDOA 2QQAA 3VB2A 1KYWA 2PN6A 2LNBA 5FRMA 2W25A 2RKHA 4XIDA 3ZQIA 1X3WB 2DBBA 1X4OA 1PUFB 1WSUA 3ZR8X 4HDUA 1RKTA 1QBJA 3QU3A 1D8KA 1FOXA 4E7HA 1TP4A 4LMYA 1QGPA 2QUFA 5DD8A 2XRLA 1RUOA 3MZYA 3Q0UA 3WE2A 4DIQA 1WJ5A 3QPLA 4ANJA 1MMDA 1FY7A 4XM3A 5BQTA 1I1SA 1QRYA 5E1XA 2ZC2A 3HSFA 2PI0A 2HZTA 1RR8C 3UKGA 4XBFA 2LK2A 2R93J 3SHFA 2IEKA 1DPRA 1O3TA 2A5WA 2STWA 2CJJA 2D1HA 1OPCA 1SEUA 3ZMUA 2DA4A 1B9MA 2XF7A 2E7XA 3V8KA 1IXSB 1VQMI 2ZFWA 1E2XA 1IF1A 3QYBA 3WTSC 2VODA 2FSWA 1T98A 2BY3A 1H8AC 4QTRA 2VE9A 2QBYA 1TQPA 1GUUA 3OS0A 4IHWA 2B63J 2PMHA 3GLXA 1BI3A 3PFIA 2O3FA 1IW7F 2N8GA 1ETWA 2QKLB 3KFWX 1R9TJ 1F43A 3VOEA 1ONVA 3IAS2 5LD2C 4A3GJ 4HNUA 2LMDA 4RLFA 2OZ6A 2LKPA 5J3LA 4U7BA 3WTUC 2IS6A 5GADJ 4FX0A 1OCRH 1Z7UA 3BG9A 4FE7A 2CGPA 3WODF 2NYXA 3QPHA 3KYCB 3ZMSA 3JRAA 3AL0B 2CUEA 2EWNA 2DT7B 2HVRA 1S7EA 5IYBJ 1HKQA 3FKIJ 2KT0A 2O61A 2EA4A 4E7ZA 1REPC 2XVCA 2KFDA 4A6EA 3KYLA 4DGWB 2HOEA 3RYRA 1UZCA 1YW8A 4BDZA 2HOAA 2MLGA 2VXDA 2X1CA 1KZHA 1JTYA 2AXLA 3U1DA 1T0FC 3RSNA 1KQ0A 3CP2A 5GAHJ 2VOPA 4II3A 4XLNF 3CD6I 5F1RA 5B3SH 4BQAA 3TO9A 5D5XB 4EJVA 5JHUA 4PJLA 3M3YJ 2DA2A 5E20A 4KNYA 1JKQC 3KP3A 1PDNC 3CCRI 5BNGA 3CC4I 4NNJA 5ILUA 1MGTA 2HQRA 2L9NA 5D5UB 3G2BA 1MJBA 4M6VA 1UELB 3RPUA 2EV5A 2Z99A 1IRXA 4JQFA 4PSXA
chains in the Genus database with same CATH topology
3KP4A 5AIPA 2QQBA 4CGZA 1STZA 1SD7A 4WX9A 5JI6A 5DEQA 2O8XA 3ECHA 2HDCA 4R1HA 3TO6A 1CF7B 3DV8A 2OBPA 2LDUA 5DD4A 4M71A 2K02A 1RI7A 5D8LB 3HRSA 2IRFG 1YS6A 3ZMZA 3O3KA 3I54A 1K6OA 1HW5A 4F7ZA 1G3TA 5L3BA 5FLXK 4BAYA 4OOIA 1YTYA 2IA1A 3ISPA 2XUBA 2XAJA 4KUMA 4RB2C 3KCCA 3KEQA 3FM3A 4L18B 2GZWA 4G6QA 3MFKA 3BROA 4RGUA 2IJLA 5BPIA 1PP8F 2BV6A 2EFWA 4M9SA 1USTA 4ASNA 4BHBA 1V4RA 2GA2A 4UVAA 1FLIA 3RJPA 1BC8C 3GX4X 2F5FA 2UXNA 3N97A 1H9TA 4HA8A 1XB4A 5E18F 2JSCA 2VBYA 4OU0A 3WTWC 4Z2YA 1B1BA 4N0BA 3ABTA 1Y0UA 5DV5A 3GFMA 3P9CA 4HX4A 1UHWA 4RAZA 1KU9A 1R5GA 2DT5A 1YO5C 2K4JA 3F8BA 4AD9A 3F21A 1B6AA 4YFKF 3M7GA 2XAFA 4LG0A 3K9TA 4HZFA 5D6EA 2CG4A 5HDGA 3DPLC 2IVMA 1HW1A 2OU2A 5ICFA 3E5QA 1WKMA 4A6DA 1SD6A 3M9AA 1J5YA 2ZMEB 1T0FA 3JAMZ 2HYFA 2H94A 2K86A 3LQQA 3RTRA 2CFXA 1ZRCA 3JTHA 3MWMA 1IN5A 5J8CA 4ETSA 3QAHA 2ZNZA 3H3UA 4IVNA 2XAQA 4CXFA 2RGVA 2WV0A 1BI2A 4HLXA 2JPBA 1ULYA 2MA3A 4HV6A 4G6DA 2ZMEA 4M74A 1SMTA 4GO1A 2VBWA 5BMZA 2KJCA 4AIHA 1BM9A 4MQ9F 2PMUA 1W5TA 4ZZDA 2O03A 4R8HA 1U5TC 1WQ2A 2DPUA 1XCBA 3F23A 3J7AO 4L9VA 3JAMK 2Q0OA 1U2WA 3GFLA 3EUHA 3I4PA 2EV0A 3C7JA 3T5XA 3GFJA 2DI3A 1Z6RA 3LWFA 5CLSA 4P5OA 3VODA 3BDDA 1RIOH 4WXDA 4MGRA 2Z5UA 4XRFA 4OIPF 3IHUA 2CQKA 3Q5FA 4A0YA 4EGYA 3LA3A 1FPQA 4UNOA 1O7LA 3FXUA 2GXBA 2HFHA 2P8TA 2XHKA 2EJRA 5DDGA 2V6CA 1QPMA 3RKXA 2VE8A 1KQ9A 5DCMB 2V9VA 4BH9A 4BXUA 1WRJA 2Z33A 1FP1D 4HBLA 4I09A 3L9FA 1JGSA 3KP5A 2F5CA 5E8IA 1HSJA 4M6XA 2W84A 1GXPA 2MLKA 5L3CA 1J9IA 4XSZF 1FSHA 3T8RA 5LHGA 2NNYA 3TDZC 4AVPA 5L3EA 4IRHA 3W6KB 3U2RA 1MDMB 1OYWA 4RB1A 5DCMA 1IN7A 1EH8A 2ISYA 3HSEA 1JXSA 3P9IA 1FWZA 5JFRA 1MD0A 4UUVA 3F6OA 4OIRF 5E1ZB 6PAXA 1U8RA 5J8FA 1SFUA 2V1DA 1YYVA 2A3SA 3FZVA 1R23A 1U5TB 1BI0A 1F4KA 3ELKA 3J81Z 1PP7U 3M8FA 5E8GA 1Z91A 4EM2A 1XGOA 4Y13A 5K5OA 1JHHA 2ELHA 2CO5A 5FD6A 1AOYA 1ZAOA 2FMYA 1NHAA 1HBXG 3R4KA 4I2OA 2O6GE 4KFCA 2D45A 1K79A 1GHCA 3QRFF 2VBXA 3IKTA 1LDJA 1J0RA 2IA0A 3F3XA 2J5OA 1TNSA 2HEOA 1OYYA 1QZYA 2ADUA 1U5TA 1U6GA 4L9JA 3U9GA 2STTA 2X4HA 2F5EA 2EA2A 5LGTA 4A12A 4Q47A 2MC3A 5K1YA 3K2ZA 5FFXA 3NQOA 4S04A 3COAC 1KU7A 4Y15A 4HQMA 4DNCA 4ENNA 2GQQA 3FF5A 2DAOA 3V7RA 2PLYA 2FE3A 3FM5A 2IW5A 4ENMA 4ON0A 4ENKA 2AS5F 5ERIA 4KYWA 1B59A 1XDSA 2D1VA 1P92A 3DEUA 1ZGJA 4HDVA 2L54A 2EK5A 2A61A 4UVCA 2RVCA 1LEBA 1BN5A 4OIOF 4IF4A 3CJNA 4I0AA 1G4DA 2P7CB 1EH7A 2H09A 1KU3A 4WF2A 2WC2A 4U0WA 2FRHA 1FNNA 1YW9A 1EH6A 2ETHA 3Q9SA 1LQ1A 2GWRA 2QWWA 2ZBKA 1XMKA 2PBIA 4EM1A 2UWMA 4HF0A 4Q4ZF 5D5WB 5E1WA 5TRDA 3R0JA 5H6QA 3SZPA 2J5PA 1XGSA 2Y48A 3ERED 2NRAC 4EJWA 5LHHA 2VBZA 5LEJA 5DUIA 1WI9A 5LRSA 2ISZA 1ZN2A 1FYMA 2NS0A 2RN7A 4LLLA 2KKOA 4MEXF 1MKMA 4MEYF 3RI4A 2FMLA 1YW7A 4U0VA 2M5WA 1H0MA 1IZ1A 2W57A 1L3LA 3FMQA 2BBYA 2Q2EA 5H6RA 1LNWA 3CDHA 4FX4A 5FLXZ 2ZKZA 4KMUX 4CHUA 5HDNA 3Q9VA 1RUNA 4Q5SF 5HLHA 3SFZA 3BZ6A 4I01A 4HW0A 4L5JA 3F8CA 3GFIA 2XAGA 1Q1HA 1MJ9A 1HQCA 3EQLF 1IUYA 2VC1A 4IHTA 3F8MA 4EM0B 3F22A 1XN7A 1ZHFA 1HSTA 4WK8F 2XASA 3BOQA 4G7OF 1B9NA 2YU3A 1QZZA 1O3RA 3K1MA 2NNNA 4H0EA 2MBFA 5D4RA 1K78B 1ZLJA 4CYDA 3KLNA 4KIGA 4HF2A 4PGGA 4M72A 3V7CA 4ENJA 3S2WA 3ECOA 2BEOA 3HSRA 3EYYA 2CYYA 1YG2A 4M9XA 2LF8A 4PDKA 4FHTA 1FBSA 4PGHA 1CF7A 5BOXA 3GO5A 3C1DA 1R1VA 2QENA 1G3WA 1K78A 4CDGA 3FHZA 1Z6TA 1FZPB 2ESHA 1Z1DA 3EYIA 2UXXA 4HOBA 3WTTC 5F64A 3IWFA 1T38A 4MTEA 4EJOA 2EB7A 4M9ZA 2A07F 5HDKA 4YFNF 4G7ZF 3HOTA 2YX7A 4S05A 3C18A 3FXRA 2GXGA 2H27A 5FD5A 3WU1B 2FBKA 3ML6A 4HF1A 3V4GA 3E6CC 4MNUA 1E17A 5ICGA 2A68F 1IAWA 3MAJA 2XKPA 4CZZA 3HTSB 2COMA 2OAZA 3NRVA 2UZKA 4YIFA 2DTRA 2A6HF 3K1PA 4UXNA 1HXDA 1P4XA 3FX3A 5HLIA 3GUDA 5AIQA 5L3DA 5ILVA 3J80K 3DKWA 2XROA 3B73A 5LGUA 3BJAA 1W7PB 4Y17A 3I5UA 3HUGA 3LA7A 3CUQB 5H20A 2JTVA 4I02A 4RB0A 3C3WA 4P96A 1P4WA 1SD5A 2BGCA 4L9TA 3DF8A 2G7HA 2FF4A 1XD7A 1W4MA 3DXJF 4FT8A 2OQGA 3FXQA 4PZJA 1SFXA 5LRRA 2VC0A 3WTYC 1R7JA 1YIOA 5FO5A 4EGZA 1HKSA 3ZPLA 4LFUA 4G7HF 1F9NA 5FFZA 2KRFA 4GXOA 1BJAA 3I58A 3BPXA 2KIFA 2YR2A 4EVIA 2IP2A 2VXZA 3T0YA 5TJJA 5ICEA 4KA4A 3TO7A 2PEXA 3E5XA 2FOKA 3GYHX 3E97A 1XGNA 3WU0A 3R6SA 4KICA 1S8NA 2K7LA 4A2UA 5FGMA 4EJTA 4HYEA 4LD5A 2ZCWA 1S29A 3KEOA 4IPAA 3I59B 2DK8A 5D4SA 1QNTA 2Z3YA 4LJZF 4QWQA 2Z9OA 3BY6A 4OINF 5IT3A 3D5LA 4IHSA 3H92A 2EFQA 1BIAA 1LDDA 3V8LA 2M87A 2RV8A 5BS6A 3D0SA 1XSDA 2OD5A 3TOBA 2QM3A 2DO7A 3TQNA 3RDIA 2QLZA 5A2QZ 4U88A 2PFBA 3RPQA 5D6FA 2HWVA 4KN4X 4WWCA 4IXAA 3QOPA 4JBAA 4NHJA 3DQVC 1ON2A 4LB5A 4GCVA 1DUXC 1R1TA 4WXCA 1J7KA 1D5VA 3HRMA 1SAXA 2E7WA 1TLHB 2EV6A 3HHHA 4DQ2A 2DK5A 1ON1A 5L3FA 4ESFA 1ZYRF 1KQ8A 4O6JA 3QP5A 3QP6A 4NQWA 4LB6B 4HLYA 2FNAA 3BJ6A 2M30A 2P5LC 1MDMA 2DW4A 1SMYF 5HOOA 1G3SA 2HYGD 5CVRA 4ESBA 5A2QK 3WTZA 4G94A 4HX7A 3L00A 1T39A 2EFNA 3EDPA 1OMIA 2YPRA 1HKTA 2FBIA 2OZUA 4OMZA 3ROUA 4I7HA 2P4WA 3LAPA 1FBUA 2L02A 2BYVE 2FA5A 1FYLA 4MTDA 1TTYA 2TDXA 4RGSA 1O3SA 2JPCA 1R1UA 1ZGAA 3JTGA 1BOAA 4KDPA 2ZJ2A 3I0TA 4UHTA 2M8EA 5CVVA 4ZYEA 1F5TA 5D8KB 3WTXC 4N9IA 1J59A 4I98B 3LAJA 4HV5A 3P9KA 3KZYA 3VFZA 3HOSA 4CICA 2KIUA 2EFOA 2OQRA 1TQMA 3LFKA 2M45A 3BP8A 1A04A 5AONA 3I53A 1W5SA 3ZP5A 2XKOA 2IT0A 4UV8A 1U3EM 4WCGA 1FYKA 3GZ6A 4GYIA 1MZBA 3KETA 1LJ9A 4KMFA 4K2EA 4AWXB 1UFMA 1OKRA 3KP6A 1R22A 1S7AA 2HKOA 2QBYB 1XDUA 3F8NA 3O6BB 4LLGF 1KU2A 1V3FA 2PJPA 3RYPA 4M6YA 1D3YA 2A69F 2V79A 3K69A 4UV9A 3RKWA 2HTJA 1VTNC 2HGCA 2GAUA 1LB2A 2F2EA 4HQEA 3KP7A 1B4AA 1W7PD 4Q48A 1ZRDA 3VEPA 2H6CA 3R0AA 1G3YA 2R7FA 3ZN0A 5JVTA 1KGSA 1BBYA 5K5QA 5CVIA 2A5YB 5HVQC 1QQIA 5F6FA 1I1GA 1SD4A 1IN6A 4NB5A 4WXHA 1P4AA 3T1BA 1BIBA 4GYGA 2L3DA 2L4MA 3LQRA 2X0LA 1ZRFA 3DFGA 1FC3A 3JW4A 4MQVA 2NAZA 2KJBA 2E1CA 2M1BA 2DQLA 3L09A 3SXYA 1YLFA 2Y75A 3DPTA 4A5MA 3I64A 3PQJA 3TGNA 1TBXA 1QO0D 4RGRA 3ABUA 2JRTA 4B09A 5CJ9A 1PUEE 4M73A 3HTUA 2P6TA 2HQNA 3HIFA 4AIKA 3G73A 2RNJA 1ZARA 3IRQA 3GVAA 5HS9A 2CSOA 3BWGA 1SFEA 3G3ZA 5ILSA 2RQPA 1J2XA 4KT5C 1IXRC 2DFIA 3CUQC 1LDKB 4BHCA 1LVAA 3GW2A 1Z9CA 1I5ZA 2R7DA 3F6VA 4EJUA 2A6EF 4L9NA 4ESJA 2IPQX 5CVUA 4RS8A 2ESNA 1TW2A 3ULQB 1DP7P 4R79A 3K0LA 3V8JA 2V1XA 1BC7C 2QYOA 1FOKA 1S3JA 3M8EA 2RDPA 4RB3C 3HYIA 3FMRA 1OR7A 5LEKA 1R36A 3KE2A 3J80Z 2E1NA 1R00A 1RNLA 2QZ8A 2QQ9A 3MCZA 4JK1X 2JT1A 1BI1A 2P5VA 1JHFA 3JSOA 3CO7C 3GF2A 5FB2A 2VOOA 2ZO4A 4U7DA 2D2WA 1USSA 4LG0B 4IRIA 1O7FA 2ACJA 4GGGA 3CUOA 1T6SA 5D5VB 2PQ8A 4U0YA 5J6XA 2FEZA 4HAMA 5HLGA 5DUKA 1O57A 2XIGA 2G9WA 3REOA 4ZYHA 5KK1A 3IRRA 1U78A 3ZQ7A 4O5VA 1TQIA 5LBQA 1P6RA 1KYZA 3CO6C 3KZZA 5JR3A 4A0ZA 2W85A 2MH9A 1ODDA 5LLQA 1DDNA 2ZXJA 3WGGA 4YFXF 2XRNA 4IJAA 2GA1A 3MZHA 4HX8A 4RGXA 2MH2A 1WWXA 4G8XA 4EQQA 2YSRA 2QVOA 1AWCA 5CVJA 2HR3A 1S6LA 1H9GA 3I71A 2VT2A 3ZMVA 2Y0MA 1D8JA 3F8FA 4RAYA 4L0YB 1S7OA 2VN2A 4YIIA 5DCFA 4OMYA 3MEXA 3BJOA 3P7NA 1XMAA 3NEUA 2K27A 3E6BA 4BYYA 1W7PA 4EV0A 4ZH4F 3GXOA 2EFPA 1ZG3A 4P55A 1UCRA 3EETA 2FXAA 1GVJA 4ZYDA 3CUQA 3WG9A 3WTVC 4BNCA 1L0OC 5IT9Z 1IN4A 2OA4A 4N9HA 5BPDA 4PCQA 5L3GA 2F5DA 3RKYA 2JZYA 3ZMDA 1RZ4A 4O3MA 2PG4A 2DPDA 3CTAA 4KIBA 2CW0F 2V1UA 3OOPA 3L2CA 1ZG5A 2LF7A 3PQKA 4LGWA 2L4AA 3K1NA 4P9UA 4LK1F 2P7VB 2HTSA 3HRTA 1R5HA 3CLOA 4E70A 1XGMA 1J75A 1O3QA 2ZNYA 4G9YA 3FMSA 3KLOA 2Q8KA 1CGPA 4EMSA 1I6XA 3E5UA 4UVBA 3KP2A 4L5IA 1JE8A 2K4BA 3TOAA 1IN8A 5IT9K 1F1ZA 1ZREA 2VT3A 5K5RA 1P2FA 1IRFA 2W24A 4CO8A 3JSPA 1FP2A 2DU9A 3I59A 1LEAA 3ZMTA 1XSVA 4YG2F 1EV7A 1G6NA 2FBHA 4A5NA 3F72A 3WGHA 3R61A 4IRGA 3V7SA 3WE3A 3QPTA 3QU6A 2DLLA 1K7AA 2P6SA 2YX4A 3BPVA 1YQAA 1FBQA 4L0ZB 2IA2A 5E17F 1ZG1A 1UHMA 4KIFA 3RIRA 3M1EA 4AIJA 2O0YA 5HS7A 3H3ZA 1TW3A 1XCVA 2LSOA 2C6YA 3SZTA 3R60A 2FQ3A 2GIVA 1DPUA 2CWEA 5ICCA 2XV4S 2FNPA 1KA8A 3T8TA 3WGIA 1UB9A 5CYVA 3L7WA 3B02A 4ZZLA 5LGNA 3GZ5A 1Z05A 3IKVA 2VONA 4LK0F 5KVRA 3E6DA 1FSEA 1ZLKA 3E6MA 3SQNA 3AAFA 4LLNA 5HS8A 3TKYA 1IRGA 3OV8A 2L01A 3HRUA 4P9FA 4BHPA 4KN7X 2WTEA 3FWEA 2H6BA 4I0BA 4XSXF 2WWYA 3GEZA 1GXQA 1IXCA 3HHGA 5DYMA 3ZN1A 3IL2A 4ZYGA 3LSTA 1MJAA 3W6JB 5ED4A 2R3SA 3N4MA 2RC4A 1FX7A 1XSXA 4OIQF 2MD5A 2KIMA 3DP7A 4QLCU 5EEHA 4D0PA 3IC7A 3J81K 3E3VA 1YFHA 1R58A 2G7UA 3GWZA 3MQ0A 1T2KA 3LA2A 1ZH5A 1OYIA 5EEGA 2HKXA 2DQRA 4B8XA 4TV7A 2P5KA 2BE5F 4MHGA 2FU4A 2HS5A 2XAHA 4XLPF 4A0XA 1YS7A 2B0LA 1TNTA 2XGXA 3IWZA 1C0WA 5LHIA 1HW2A 1I27A 1FT9A 1X3UA 3O2PE 3TDUC 2QQAA 3VB2A 1KYWA 2PN6A 2LNBA 2W25A 2RKHA 2DBBA 1WSUA 4HDUA 1QBJA 3QU3A 1D8KA 4LMYA 1QGPA 2QUFA 5DD8A 1RUOA 3MZYA 3WE2A 1FY7A 5BQTA 1I1SA 5E1XA 3HSFA 2PI0A 2HZTA 4XBFA 3SHFA 1DPRA 1O3TA 2STWA 2D1HA 1OPCA 3ZMUA 1B9MA 2E7XA 3V8KA 1IXSB 1IF1A 2ZFWA 1E2XA 3WTSC 2VODA 2FSWA 1T98A 2QBYA 2VE9A 1TQPA 2PMHA 3GLXA 1BI3A 3PFIA 2O3FA 1IW7F 3KFWX 3VOEA 1ONVA 2OZ6A 2LKPA 4U7BA 3WTUC 4FX0A 1Z7UA 2CGPA 3WODF 2NYXA 3QPHA 3ZMSA 2EWNA 1HKQA 2O61A 2EA4A 1REPC 2XVCA 4A6EA 2HOEA 3RYRA 1YW8A 2MLGA 2AXLA 3U1DA 1KQ0A 2VOPA 4XLNF 5F1RA 4BQAA 3TO9A 5D5XB 4EJVA 5JHUA 5E20A 4KNYA 3KP3A 1PDNC 5ILUA 1MGTA 2HQRA 5D5UB 1MJBA 3RPUA 2EV5A 2Z99A 4JQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP4 A;  5AIP A;  2QQB A;  4CGZ A;  1STZ A;  1SD7 A;  4WX9 A;  5JI6 A;  5DEQ A;  2O8X A;  3ECH A;  2HDC A;  4R1H A;  3TO6 A;  1CF7 B;  3DV8 A;  2OBP A;  2LDU A;  5DD4 A;  4M71 A;  2K02 A;  1RI7 A;  5D8L B;  3HRS A;  2IRF G;  1YS6 A;  3ZMZ A;  3O3K A;  3I54 A;  1K6O A;  1HW5 A;  4F7Z A;  1G3T A;  5L3B A;  5FLX K;  4BAY A;  4OOI A;  1YTY A;  2IA1 A;  3ISP A;  2XUB A;  2XAJ A;  4KUM A;  4RB2 C;  3KCC A;  3KEQ A;  3FM3 A;  4L18 B;  2GZW A;  4G6Q A;  3MFK A;  3BRO A;  4RGU A;  2IJL A;  5BPI A;  1PP8 F;  2BV6 A;  2EFW A;  4M9S A;  1UST A;  4ASN A;  4BHB A;  1V4R A;  2GA2 A;  4UVA A;  1FLI A;  3RJP A;  1BC8 C;  3GX4 X;  2F5F A;  2UXN A;  3N97 A;  1H9T A;  4HA8 A;  1XB4 A;  5E18 F;  2JSC A;  2VBY A;  4OU0 A;  3WTW C;  4Z2Y A;  1B1B A;  4N0B A;  3ABT A;  1Y0U A;  5DV5 A;  3GFM A;  3P9C A;  4HX4 A;  1UHW A;  4RAZ A;  1KU9 A;  1R5G A;  2DT5 A;  1YO5 C;  2K4J A;  3F8B A;  4AD9 A;  3F21 A;  1B6A A;  4YFK F;  3M7G A;  2XAF A;  4LG0 A;  3K9T A;  4HZF A;  5D6E A;  2CG4 A;  5HDG A;  3DPL C;  2IVM A;  1HW1 A;  2OU2 A;  5ICF A;  3E5Q A;  1WKM A;  4A6D A;  1SD6 A;  3M9A A;  1J5Y A;  2ZME B;  1T0F A;  3JAM Z;  2HYF A;  2H94 A;  2K86 A;  3LQQ A;  3RTR A;  2CFX A;  1ZRC A;  3JTH A;  3MWM A;  1IN5 A;  5J8C A;  4ETS A;  3QAH A;  2ZNZ A;  3H3U A;  4IVN A;  2XAQ A;  4CXF A;  2RGV A;  2WV0 A;  1BI2 A;  4HLX A;  2JPB A;  1ULY A;  2MA3 A;  4HV6 A;  4G6D A;  2ZME A;  4M74 A;  1SMT A;  4GO1 A;  2VBW A;  5BMZ A;  2KJC A;  4AIH A;  1BM9 A;  4MQ9 F;  2PMU A;  1W5T A;  4ZZD A;  2O03 A;  4R8H A;  1U5T C;  1WQ2 A;  2DPU A;  1XCB A;  3F23 A;  3J7A O;  4L9V A;  3JAM K;  2Q0O A;  1U2W A;  3GFL A;  3EUH A;  3I4P A;  2EV0 A;  3C7J A;  3T5X A;  3GFJ A;  2DI3 A;  1Z6R A;  3LWF A;  5CLS A;  4P5O A;  3VOD A;  3BDD A;  1RIO H;  4WXD A;  4MGR A;  2Z5U A;  4XRF A;  4OIP F;  3IHU A;  2CQK A;  3Q5F A;  4A0Y A;  4EGY A;  3LA3 A;  1FPQ A;  4UNO A;  1O7L A;  3FXU A;  2GXB A;  2HFH A;  2P8T A;  2XHK A;  2EJR A;  5DDG A;  2V6C A;  1QPM A;  3RKX A;  2VE8 A;  1KQ9 A;  5DCM B;  2V9V A;  4BH9 A;  4BXU A;  1WRJ A;  2Z33 A;  1FP1 D;  4HBL A;  4I09 A;  3L9F A;  1JGS A;  3KP5 A;  2F5C A;  5E8I A;  1HSJ A;  4M6X A;  2W84 A;  1GXP A;  2MLK A;  5L3C A;  1J9I A;  4XSZ F;  1FSH A;  3T8R A;  5LHG A;  2NNY A;  3TDZ C;  4AVP A;  5L3E A;  4IRH A;  3W6K B;  3U2R A;  1MDM B;  1OYW A;  4RB1 A;  5DCM A;  1IN7 A;  1EH8 A;  2ISY A;  3HSE A;  1JXS A;  3P9I A;  1FWZ A;  5JFR A;  1MD0 A;  4UUV A;  3F6O A;  4OIR F;  5E1Z B;  6PAX A;  1U8R A;  5J8F A;  1SFU A;  2V1D A;  1YYV A;  2A3S A;  3FZV A;  1R23 A;  1U5T B;  1BI0 A;  1F4K A;  3ELK A;  3J81 Z;  1PP7 U;  3M8F A;  5E8G A;  1Z91 A;  4EM2 A;  1XGO A;  4Y13 A;  5K5O A;  1JHH A;  2ELH A;  2CO5 A;  5FD6 A;  1AOY A;  1ZAO A;  2FMY A;  1NHA A;  1HBX G;  3R4K A;  4I2O A;  2O6G E;  4KFC A;  2D45 A;  1K79 A;  1GHC A;  3QRF F;  2VBX A;  3IKT A;  1LDJ A;  1J0R A;  2IA0 A;  3F3X A;  2J5O A;  1TNS A;  2HEO A;  1OYY A;  1QZY A;  2ADU A;  1U5T A;  1U6G A;  4L9J A;  3U9G A;  2STT A;  2X4H A;  2F5E A;  2EA2 A;  5LGT A;  4A12 A;  4Q47 A;  2MC3 A;  5K1Y A;  3K2Z A;  5FFX A;  3NQO A;  4S04 A;  3COA C;  1KU7 A;  4Y15 A;  4HQM A;  4DNC A;  4ENN A;  2GQQ A;  3FF5 A;  2DAO A;  3V7R A;  2PLY A;  2FE3 A;  3FM5 A;  2IW5 A;  4ENM A;  4ON0 A;  4ENK A;  2AS5 F;  5ERI A;  4KYW A;  1B59 A;  1XDS A;  2D1V A;  1P92 A;  3DEU A;  1ZGJ A;  4HDV A;  2L54 A;  2EK5 A;  2A61 A;  4UVC A;  2RVC A;  1LEB A;  1BN5 A;  4OIO F;  4IF4 A;  3CJN A;  4I0A A;  1G4D A;  2P7C B;  1EH7 A;  2H09 A;  1KU3 A;  4WF2 A;  2WC2 A;  4U0W A;  2FRH A;  1FNN A;  1YW9 A;  1EH6 A;  2ETH A;  3Q9S A;  1LQ1 A;  2GWR A;  2QWW A;  2ZBK A;  1XMK A;  2PBI A;  4EM1 A;  2UWM A;  4HF0 A;  4Q4Z F;  5D5W B;  5E1W A;  5TRD A;  3R0J A;  5H6Q A;  3SZP A;  2J5P A;  1XGS A;  2Y48 A;  3ERE D;  2NRA C;  4EJW A;  5LHH A;  2VBZ A;  5LEJ A;  5DUI A;  1WI9 A;  5LRS A;  2ISZ A;  1ZN2 A;  1FYM A;  2NS0 A;  2RN7 A;  4LLL A;  2KKO A;  4MEX F;  1MKM A;  4MEY F;  3RI4 A;  2FML A;  1YW7 A;  4U0V A;  2M5W A;  1H0M A;  1IZ1 A;  2W57 A;  1L3L A;  3FMQ A;  2BBY A;  2Q2E A;  5H6R A;  1LNW A;  3CDH A;  4FX4 A;  5FLX Z;  2ZKZ A;  4KMU X;  4CHU A;  5HDN A;  3Q9V A;  1RUN A;  4Q5S F;  5HLH A;  3SFZ A;  3BZ6 A;  4I01 A;  4HW0 A;  4L5J A;  3F8C A;  3GFI A;  2XAG A;  1Q1H A;  1MJ9 A;  1HQC A;  3EQL F;  1IUY A;  2VC1 A;  4IHT A;  3F8M A;  4EM0 B;  3F22 A;  1XN7 A;  1ZHF A;  1HST A;  4WK8 F;  2XAS A;  3BOQ A;  4G7O F;  1B9N A;  2YU3 A;  1QZZ A;  1O3R A;  3K1M A;  2NNN A;  4H0E A;  2MBF A;  5D4R A;  1K78 B;  1ZLJ A;  4CYD A;  3KLN A;  4KIG A;  4HF2 A;  4PGG A;  4M72 A;  3V7C A;  4ENJ A;  3S2W A;  3ECO A;  2BEO A;  3HSR A;  3EYY A;  2CYY A;  1YG2 A;  4M9X A;  2LF8 A;  4PDK A;  4FHT A;  1FBS A;  4PGH A;  1CF7 A;  5BOX A;  3GO5 A;  3C1D A;  1R1V A;  2QEN A;  1G3W A;  1K78 A;  4CDG A;  3FHZ A;  1Z6T A;  1FZP B;  2ESH A;  1Z1D A;  3EYI A;  2UXX A;  4HOB A;  3WTT C;  5F64 A;  3IWF A;  1T38 A;  4MTE A;  4EJO A;  2EB7 A;  4M9Z A;  2A07 F;  5HDK A;  4YFN F;  4G7Z F;  3HOT A;  2YX7 A;  4S05 A;  3C18 A;  3FXR A;  2GXG A;  2H27 A;  5FD5 A;  3WU1 B;  2FBK A;  3ML6 A;  4HF1 A;  3V4G A;  3E6C C;  4MNU A;  1E17 A;  5ICG A;  2A68 F;  1IAW A;  3MAJ A;  2XKP A;  4CZZ A;  3HTS B;  2COM A;  2OAZ A;  3NRV A;  2UZK A;  4YIF A;  2DTR A;  2A6H F;  3K1P A;  4UXN A;  1HXD A;  1P4X A;  3FX3 A;  5HLI A;  3GUD A;  5AIQ A;  5L3D A;  5ILV A;  3J80 K;  3DKW A;  2XRO A;  3B73 A;  5LGU A;  3BJA A;  1W7P B;  4Y17 A;  3I5U A;  3HUG A;  3LA7 A;  3CUQ B;  5H20 A;  2JTV A;  4I02 A;  4RB0 A;  3C3W A;  4P96 A;  1P4W A;  1SD5 A;  2BGC A;  4L9T A;  3DF8 A;  2G7H A;  2FF4 A;  1XD7 A;  1W4M A;  3DXJ F;  4FT8 A;  2OQG A;  3FXQ A;  4PZJ A;  1SFX A;  5LRR A;  2VC0 A;  3WTY C;  1R7J A;  1YIO A;  5FO5 A;  4EGZ A;  1HKS A;  3ZPL A;  4LFU A;  4G7H F;  1F9N A;  5FFZ A;  2KRF A;  4GXO A;  1BJA A;  3I58 A;  3BPX A;  2KIF A;  2YR2 A;  4EVI A;  2IP2 A;  2VXZ A;  3T0Y A;  5TJJ A;  5ICE A;  4KA4 A;  3TO7 A;  2PEX A;  3E5X A;  2FOK A;  3GYH X;  3E97 A;  1XGN A;  3WU0 A;  3R6S A;  4KIC A;  1S8N A;  2K7L A;  4A2U A;  5FGM A;  4EJT A;  4HYE A;  4LD5 A;  2ZCW A;  1S29 A;  3KEO A;  4IPA A;  3I59 B;  2DK8 A;  5D4S A;  1QNT A;  2Z3Y A;  4LJZ F;  4QWQ A;  2Z9O A;  3BY6 A;  4OIN F;  5IT3 A;  3D5L A;  4IHS A;  3H92 A;  2EFQ A;  1BIA A;  1LDD A;  3V8L A;  2M87 A;  2RV8 A;  5BS6 A;  3D0S A;  1XSD A;  2OD5 A;  3TOB A;  2QM3 A;  2DO7 A;  3TQN A;  3RDI A;  2QLZ A;  5A2Q Z;  4U88 A;  2PFB A;  3RPQ A;  5D6F A;  2HWV A;  4KN4 X;  4WWC A;  4IXA A;  3QOP A;  4JBA A;  4NHJ A;  3DQV C;  1ON2 A;  4LB5 A;  4GCV A;  1DUX C;  1R1T A;  4WXC A;  1J7K A;  1D5V A;  3HRM A;  1SAX A;  2E7W A;  1TLH B;  2EV6 A;  3HHH A;  4DQ2 A;  2DK5 A;  1ON1 A;  5L3F A;  4ESF A;  1ZYR F;  1KQ8 A;  4O6J A;  3QP5 A;  3QP6 A;  4NQW A;  4LB6 B;  4HLY A;  2FNA A;  3BJ6 A;  2M30 A;  2P5L C;  1MDM A;  2DW4 A;  1SMY F;  5HOO A;  1G3S A;  2HYG D;  5CVR A;  4ESB A;  5A2Q K;  3WTZ A;  4G94 A;  4HX7 A;  3L00 A;  1T39 A;  2EFN A;  3EDP A;  1OMI A;  2YPR A;  1HKT A;  2FBI A;  2OZU A;  4OMZ A;  3ROU A;  4I7H A;  2P4W A;  3LAP A;  1FBU A;  2L02 A;  2BYV E;  2FA5 A;  1FYL A;  4MTD A;  1TTY A;  2TDX A;  4RGS A;  1O3S A;  2JPC A;  1R1U A;  1ZGA A;  3JTG A;  1BOA A;  4KDP A;  2ZJ2 A;  3I0T A;  4UHT A;  2M8E A;  5CVV A;  4ZYE A;  1F5T A;  5D8K B;  3WTX C;  4N9I A;  1J59 A;  4I98 B;  3LAJ A;  4HV5 A;  3P9K A;  3KZY A;  3VFZ A;  3HOS A;  4CIC A;  2KIU A;  2EFO A;  2OQR A;  1TQM A;  3LFK A;  2M45 A;  3BP8 A;  1A04 A;  5AON A;  3I53 A;  1W5S A;  3ZP5 A;  2XKO A;  2IT0 A;  4UV8 A;  1U3E M;  4WCG A;  1FYK A;  3GZ6 A;  4GYI A;  1MZB A;  3KET A;  1LJ9 A;  4KMF A;  4K2E A;  4AWX B;  1UFM A;  1OKR A;  3KP6 A;  1R22 A;  1S7A A;  2HKO A;  2QBY B;  1XDU A;  3F8N A;  3O6B B;  4LLG F;  1KU2 A;  1V3F A;  2PJP A;  3RYP A;  4M6Y A;  1D3Y A;  2A69 F;  2V79 A;  3K69 A;  4UV9 A;  3RKW A;  2HTJ A;  1VTN C;  2HGC A;  2GAU A;  1LB2 A;  2F2E A;  4HQE A;  3KP7 A;  1B4A A;  1W7P D;  4Q48 A;  1ZRD A;  3VEP A;  2H6C A;  3R0A A;  1G3Y A;  2R7F A;  3ZN0 A;  5JVT A;  1KGS A;  1BBY A;  5K5Q A;  5CVI A;  2A5Y B;  5HVQ C;  1QQI A;  5F6F A;  1I1G A;  1SD4 A;  1IN6 A;  4NB5 A;  4WXH A;  1P4A A;  3T1B A;  1BIB A;  4GYG A;  2L3D A;  2L4M A;  3LQR A;  2X0L A;  1ZRF A;  3DFG A;  1FC3 A;  3JW4 A;  4MQV A;  2NAZ A;  2KJB A;  2E1C A;  2M1B A;  2DQL A;  3L09 A;  3SXY A;  1YLF A;  2Y75 A;  3DPT A;  4A5M A;  3I64 A;  3PQJ A;  3TGN A;  1TBX A;  1QO0 D;  4RGR A;  3ABU A;  2JRT A;  4B09 A;  5CJ9 A;  1PUE E;  4M73 A;  3HTU A;  2P6T A;  2HQN A;  3HIF A;  4AIK A;  3G73 A;  2RNJ A;  1ZAR A;  3IRQ A;  3GVA A;  5HS9 A;  2CSO A;  3BWG A;  1SFE A;  3G3Z A;  5ILS A;  2RQP A;  1J2X A;  4KT5 C;  1IXR C;  2DFI A;  3CUQ C;  1LDK B;  4BHC A;  1LVA A;  3GW2 A;  1Z9C A;  1I5Z A;  2R7D A;  3F6V A;  4EJU A;  2A6E F;  4L9N A;  4ESJ A;  2IPQ X;  5CVU A;  4RS8 A;  2ESN A;  1TW2 A;  3ULQ B;  1DP7 P;  4R79 A;  3K0L A;  3V8J A;  2V1X A;  1BC7 C;  2QYO A;  1FOK A;  1S3J A;  3M8E A;  2RDP A;  4RB3 C;  3HYI A;  3FMR A;  1OR7 A;  5LEK A;  1R36 A;  3KE2 A;  3J80 Z;  2E1N A;  1R00 A;  1RNL A;  2QZ8 A;  2QQ9 A;  3MCZ A;  4JK1 X;  2JT1 A;  1BI1 A;  2P5V A;  1JHF A;  3JSO A;  3CO7 C;  3GF2 A;  5FB2 A;  2VOO A;  2ZO4 A;  4U7D A;  2D2W A;  1USS A;  4LG0 B;  4IRI A;  1O7F A;  2ACJ A;  4GGG A;  3CUO A;  1T6S A;  5D5V B;  2PQ8 A;  4U0Y A;  5J6X A;  2FEZ A;  4HAM A;  5HLG A;  5DUK A;  1O57 A;  2XIG A;  2G9W A;  3REO A;  4ZYH A;  5KK1 A;  3IRR A;  1U78 A;  3ZQ7 A;  4O5V A;  1TQI A;  5LBQ A;  1P6R A;  1KYZ A;  3CO6 C;  3KZZ A;  5JR3 A;  4A0Z A;  2W85 A;  2MH9 A;  1ODD A;  5LLQ A;  1DDN A;  2ZXJ A;  3WGG A;  4YFX F;  2XRN A;  4IJA A;  2GA1 A;  3MZH A;  4HX8 A;  4RGX A;  2MH2 A;  1WWX A;  4G8X A;  4EQQ A;  2YSR A;  2QVO A;  1AWC A;  5CVJ A;  2HR3 A;  1S6L A;  1H9G A;  3I71 A;  2VT2 A;  3ZMV A;  2Y0M A;  1D8J A;  3F8F A;  4RAY A;  4L0Y B;  1S7O A;  2VN2 A;  4YII A;  5DCF A;  4OMY A;  3MEX A;  3BJO A;  3P7N A;  1XMA A;  3NEU A;  2K27 A;  3E6B A;  4BYY A;  1W7P A;  4EV0 A;  4ZH4 F;  3GXO A;  2EFP A;  1ZG3 A;  4P55 A;  1UCR A;  3EET A;  2FXA A;  1GVJ A;  4ZYD A;  3CUQ A;  3WG9 A;  3WTV C;  4BNC A;  1L0O C;  5IT9 Z;  1IN4 A;  2OA4 A;  4N9H A;  5BPD A;  4PCQ A;  5L3G A;  2F5D A;  3RKY A;  2JZY A;  3ZMD A;  1RZ4 A;  4O3M A;  2PG4 A;  2DPD A;  3CTA A;  4KIB A;  2CW0 F;  2V1U A;  3OOP A;  3L2C A;  1ZG5 A;  2LF7 A;  3PQK A;  4LGW A;  2L4A A;  3K1N A;  4P9U A;  4LK1 F;  2P7V B;  2HTS A;  3HRT A;  1R5H A;  3CLO A;  4E70 A;  1XGM A;  1J75 A;  1O3Q A;  2ZNY A;  4G9Y A;  3FMS A;  3KLO A;  2Q8K A;  1CGP A;  4EMS A;  1I6X A;  3E5U A;  4UVB A;  3KP2 A;  4L5I A;  1JE8 A;  2K4B A;  3TOA A;  1IN8 A;  5IT9 K;  1F1Z A;  1ZRE A;  2VT3 A;  5K5R A;  1P2F A;  1IRF A;  2W24 A;  4CO8 A;  3JSP A;  1FP2 A;  2DU9 A;  3I59 A;  1LEA A;  3ZMT A;  1XSV A;  4YG2 F;  1EV7 A;  1G6N A;  2FBH A;  4A5N A;  3F72 A;  3WGH A;  3R61 A;  4IRG A;  3V7S A;  3WE3 A;  3QPT A;  3QU6 A;  2DLL A;  1K7A A;  2P6S A;  2YX4 A;  3BPV A;  1YQA A;  1FBQ A;  4L0Z B;  2IA2 A;  5E17 F;  1ZG1 A;  1UHM A;  4KIF A;  3RIR A;  3M1E A;  4AIJ A;  2O0Y A;  5HS7 A;  3H3Z A;  1TW3 A;  1XCV A;  2LSO A;  2C6Y A;  3SZT A;  3R60 A;  2FQ3 A;  2GIV A;  1DPU A;  2CWE A;  5ICC A;  2XV4 S;  2FNP A;  1KA8 A;  3T8T A;  3WGI A;  1UB9 A;  5CYV A;  3L7W A;  3B02 A;  4ZZL A;  5LGN A;  3GZ5 A;  1Z05 A;  3IKV A;  2VON A;  4LK0 F;  5KVR A;  3E6D A;  1FSE A;  1ZLK A;  3E6M A;  3SQN A;  3AAF A;  4LLN A;  5HS8 A;  3TKY A;  1IRG A;  3OV8 A;  2L01 A;  3HRU A;  4P9F A;  4BHP A;  4KN7 X;  2WTE A;  3FWE A;  2H6B A;  4I0B A;  4XSX F;  2WWY A;  3GEZ A;  1GXQ A;  1IXC A;  3HHG A;  5DYM A;  3ZN1 A;  3IL2 A;  4ZYG A;  3LST A;  1MJA A;  3W6J B;  5ED4 A;  2R3S A;  3N4M A;  2RC4 A;  1FX7 A;  1XSX A;  4OIQ F;  2MD5 A;  2KIM A;  3DP7 A;  4QLC U;  5EEH A;  4D0P A;  3IC7 A;  3J81 K;  3E3V A;  1YFH A;  1R58 A;  2G7U A;  3GWZ A;  3MQ0 A;  1T2K A;  3LA2 A;  1ZH5 A;  1OYI A;  5EEG A;  2HKX A;  2DQR A;  4B8X A;  4TV7 A;  2P5K A;  2BE5 F;  4MHG A;  2FU4 A;  2HS5 A;  2XAH A;  4XLP F;  4A0X A;  1YS7 A;  2B0L A;  1TNT A;  2XGX A;  3IWZ A;  1C0W A;  5LHI A;  1HW2 A;  1I27 A;  1FT9 A;  1X3U A;  3O2P E;  3TDU C;  2QQA A;  3VB2 A;  1KYW A;  2PN6 A;  2LNB A;  2W25 A;  2RKH A;  2DBB A;  1WSU A;  4HDU A;  1QBJ A;  3QU3 A;  1D8K A;  4LMY A;  1QGP A;  2QUF A;  5DD8 A;  1RUO A;  3MZY A;  3WE2 A;  1FY7 A;  5BQT A;  1I1S A;  5E1X A;  3HSF A;  2PI0 A;  2HZT A;  4XBF A;  3SHF A;  1DPR A;  1O3T A;  2STW A;  2D1H A;  1OPC A;  3ZMU A;  1B9M A;  2E7X A;  3V8K A;  1IXS B;  1IF1 A;  2ZFW A;  1E2X A;  3WTS C;  2VOD A;  2FSW A;  1T98 A;  2QBY A;  2VE9 A;  1TQP A;  2PMH A;  3GLX A;  1BI3 A;  3PFI A;  2O3F A;  1IW7 F;  3KFW X;  3VOE A;  1ONV A;  2OZ6 A;  2LKP A;  4U7B A;  3WTU C;  4FX0 A;  1Z7U A;  2CGP A;  3WOD F;  2NYX A;  3QPH A;  3ZMS A;  2EWN A;  1HKQ A;  2O61 A;  2EA4 A;  1REP C;  2XVC A;  4A6E A;  2HOE A;  3RYR A;  1YW8 A;  2MLG A;  2AXL A;  3U1D A;  1KQ0 A;  2VOP A;  4XLN F;  5F1R A;  4BQA A;  3TO9 A;  5D5X B;  4EJV A;  5JHU A;  5E20 A;  4KNY A;  3KP3 A;  1PDN C;  5ILU A;  1MGT A;  2HQR A;  5D5U B;  1MJB A;  3RPU A;  2EV5 A;  2Z99 A;  4JQF A; 
#chains in the Genus database with same CATH topology
 3QYF A;  3KP4 A;  5AIP A;  2QQB A;  4CGZ A;  1STZ A;  1SD7 A;  3A4C A;  2L7K A;  4WX9 A;  5JI6 A;  4BUP A;  3HB9 A;  5DEQ A;  2O8X A;  3ECH A;  1EJ9 A;  1Q1V A;  2HDC A;  4R1H A;  3TO6 A;  3CMA I;  1CF7 B;  3DV8 A;  2OBP A;  2LDU A;  3H1C A;  5DD4 A;  4M71 A;  1E0E A;  2WB1 N;  3DLL F;  2O8K A;  3K10 A;  2K02 A;  3I4N J;  1RI7 A;  3BZC A;  2M34 A;  5D8L B;  2ELJ A;  1H89 C;  3FK7 A;  3HRS A;  2IRF G;  2R7W A;  1YS6 A;  2Y30 A;  3ZMZ A;  3OSF A;  3O3K A;  4PFO A;  2OJE D;  1RET A;  3I54 A;  5DM7 F;  1K6O A;  1HW5 A;  1V5G A;  3GCM A;  4F7Z A;  1G3T A;  5L3B A;  5FLX K;  3MMY B;  4BAY A;  1J09 A;  4OOI A;  1YTY A;  3GTK J;  2IA1 A;  3ISP A;  3M8J A;  2W1O A;  1Y1W J;  3EUH C;  2XUB A;  5JVG F;  3CME I;  2XAJ A;  3S14 J;  4KUM A;  2E1O A;  3KCC A;  3DKX A;  4E7S A;  5FJ8 J;  4RB2 C;  1NG6 A;  4UUT A;  1WPK A;  3KEQ A;  1Y56 A;  3DEE A;  2WV1 A;  3FM3 A;  3ABK H;  1S5L C;  2IGO A;  4L18 B;  2GZW A;  3MKW B;  4G6Q A;  1X2N A;  3MFK A;  3BRO A;  4RGU A;  3BR2 A;  2IJL A;  5BPI A;  1PP8 F;  2BV6 A;  2EFW A;  4MFE A;  4M9S A;  1UST A;  4ASN A;  4I99 C;  4BHB A;  1N77 A;  2WY7 Q;  1V4R A;  2GA2 A;  9ANT A;  4UVA A;  2HVS A;  2MSY A;  1FLI A;  3RJP A;  1BC8 C;  3GX4 X;  3BR0 A;  3EPZ A;  3OYC A;  1YJ9 I;  3BTL A;  2CUJ A;  3DWL E;  2LR8 A;  2F5F A;  2UXN A;  3N97 A;  1HDP A;  1H9T A;  1VQ8 I;  3HPG A;  4HA8 A;  1XB4 A;  1DU6 A;  4BQO A;  5E18 F;  2VI6 A;  2JSC A;  2VBY A;  4Y52 J;  1PJR A;  1YJN I;  4OU0 A;  3WTW C;  4A3I J;  4Z2Y A;  1B1B A;  4N0B A;  3ABT A;  4V2F A;  2HNH A;  2BOL A;  4RM3 A;  1Y0U A;  2XB5 A;  5DV5 A;  2ZJP F;  3BTI A;  1IGN A;  3GFM A;  3P9C A;  4HX4 A;  3FBN B;  3S2H J;  3H9G A;  1UHW A;  2DA5 A;  4RAZ A;  1KU9 A;  3SYT A;  1R5G A;  2DT5 A;  1YO5 C;  4BJ5 C;  3D1N I;  1MBG A;  2K4J A;  4D1Q A;  3F8B A;  3PUB A;  4AD9 A;  3F21 A;  1B6A A;  4YFK F;  3M7G A;  2XAF A;  1ETQ A;  2OTJ I;  2H1K A;  2KIS A;  4LG0 A;  3K9T A;  3OOU A;  3HXL A;  3HUG B;  4HZF A;  4W1U A;  5DTD A;  1Y39 A;  3DBR B;  4V2G A;  5D6E A;  2CG4 A;  5HDG A;  2OF7 A;  4F92 B;  1B72 B;  4X6A J;  3DPL C;  2IVM A;  3E1S A;  1HW1 A;  1RRJ A;  1EF4 A;  3CCV I;  2OU2 A;  5ICF A;  3E5Q A;  3O8H A;  2JN6 A;  4BL0 B;  1WH7 A;  3C2B A;  2M8G X;  1WKM A;  4A6D A;  1SD6 A;  3CZ6 A;  3I9V 2;  4D7N A;  3A03 A;  5DS9 A;  3M9A A;  3OYM A;  1J5Y A;  1XTA A;  1XG1 A;  2ZME B;  1T0F A;  3HZJ A;  3JAM Z;  3G1O A;  3HBL A;  2HYF A;  4J19 A;  2H94 A;  2K86 A;  3LQQ A;  2BY2 A;  3RTR A;  1VQ9 I;  2CFX A;  1ZRC A;  2EZL A;  2NOJ B;  3MZ8 A;  3ESW B;  3QOE A;  4BXX J;  3JTH A;  5EDN A;  1JKP C;  2DFF A;  1V5E A;  3MWM A;  1IN5 A;  5J8C A;  5CQG A;  3G6E I;  1ETK A;  2V9P A;  3K4J A;  4ETS A;  1VQO I;  4N4O B;  3QAH A;  2ZNZ A;  3H3U A;  3HOW J;  4IVN A;  4FE4 A;  2XAQ A;  2JVG A;  4CXF A;  1XS9 A;  2O5R A;  4MO7 A;  3OYJ A;  2RGV A;  2WV0 A;  3PFY A;  1A5J A;  1BI2 A;  5E3L A;  3CMY A;  4HLX A;  2BW3 A;  2JPB A;  1ULY A;  2AO9 A;  5E3O A;  1V55 H;  2BHY A;  2MA3 A;  4HV6 A;  5IYC J;  4ZTJ A;  2WB1 A;  1YE9 A;  4G6D A;  2ZME A;  4A3K J;  3FXJ A;  4M74 A;  3SFI A;  1SMT A;  4GO1 A;  1SAN A;  2VBW A;  4IQ4 A;  3S8P A;  5BMZ A;  2ZB9 A;  2KJC A;  3H5N A;  4AIH A;  4QPQ A;  1BM9 A;  2XPW A;  4BQN A;  4RMN A;  4MQ9 F;  2PMU A;  1W5T A;  4ZZD A;  2O03 A;  4R8H A;  1GVD A;  4GDF A;  1VZ0 A;  5HNF A;  1BL0 A;  1U5T C;  1I39 A;  1NTC A;  3BTJ A;  1WQ2 A;  2E2J J;  2DPU A;  4M3D A;  1XCB A;  3F23 A;  4XLE A;  3J7A O;  4UY8 I;  4L9V A;  3W6V A;  3JAM K;  2Q0O A;  1U2W A;  2NVT J;  3GFL A;  3EUH A;  3I4P A;  1MSF C;  1FOY A;  2EV0 A;  2DCE A;  3KX2 A;  2F4I A;  3C7J A;  3T5X A;  3GFJ A;  2DI3 A;  2FUG 2;  1Z6R A;  2VKH A;  3LWF A;  4Z6Y A;  5CLS A;  4JX6 A;  1FTZ A;  4AYB A;  4P5O A;  2NVQ J;  3VOD A;  3BDD A;  1RIO H;  4WXD A;  4MGR A;  1KON A;  2Z5U A;  3RQ4 A;  4XRF A;  4OIP F;  4LIT A;  2EIN H;  3IHU A;  2CQK A;  3Q5F A;  4A0Y A;  4EGY A;  2Q1Z B;  4XKV A;  3CCL I;  4A3M J;  4A3B J;  2CW7 A;  3LA3 A;  4E6K G;  5CKT A;  1FPQ A;  4UNO A;  3OL4 A;  4CCO A;  1O7L A;  2DN0 A;  3FXU A;  2GXB A;  4A93 J;  2X6Y A;  2KL4 A;  5HOD A;  2HFH A;  4RAG A;  2P8T A;  2XHK A;  2E35 A;  3M1C A;  3NAR A;  3ZOB A;  3BCA A;  2QSF X;  1UHS A;  3E0J B;  2EJR A;  5DDG A;  3ZCO A;  3AG2 H;  2V6C A;  3G71 I;  1XC5 A;  1ERD A;  2EH3 A;  2GOM A;  2Z16 A;  3PNT A;  1O4X A;  1QPM A;  3RKX A;  1CQT A;  2VE8 A;  1UG2 A;  1KQ9 A;  2VJJ A;  5DCM B;  2RNG A;  1WGX A;  2V9V A;  4BH9 A;  4BXU A;  2HXI A;  1IUF A;  1AKH B;  1WRJ A;  2K3F A;  5IYD J;  4HG2 A;  2Z33 A;  1G2H A;  1FP1 D;  4HBL A;  4I09 A;  3DLA A;  3L9F A;  4QPO A;  2L2O A;  1JGS A;  3KP5 A;  2F5C A;  3S15 J;  5E8I A;  1HSJ A;  1B8I A;  4M6X A;  2W84 A;  3TED A;  3JRG A;  1GXP A;  3CQZ J;  2MLK A;  3FDY A;  1AA7 A;  4XNF A;  1ZGW A;  5L3C A;  1DGR M;  5KAI C;  1J9I A;  2CQN A;  4XLH A;  1JUM A;  4I6Z A;  1XMX A;  4XSZ F;  3OYD A;  1JI8 A;  1FSH A;  3T8R A;  5LHG A;  2NNY A;  2EZH A;  3TDZ C;  4AVP A;  5L3E A;  4IRH A;  4IHV A;  2CMP A;  3W6K B;  3U2R A;  4DYQ A;  1MDM B;  5J1Y A;  1OYW A;  4RB1 A;  3GTO J;  5DCM A;  1OCZ H;  1IN7 A;  2O9L A;  1HLV A;  1EH8 A;  2ISY A;  4KT6 A;  3HSE A;  1JXS A;  1BW6 A;  3P9I A;  1AKH A;  1FWZ A;  5JFR A;  1MD0 A;  4UUV A;  2HXO A;  3BLY A;  3F6O A;  1MMG A;  4OIR F;  5E1Z B;  6PAX A;  1U8R A;  5J8F A;  2CV2 A;  3LSM A;  1SFU A;  2V1D A;  1YYV A;  2M3A A;  2VAS A;  2A3S A;  3ZQF A;  3FZV A;  1R23 A;  3QPS A;  1WZ2 A;  1U5T B;  1BI0 A;  1MSE C;  5KCM A;  1F4K A;  3ELK A;  5FKN A;  4IHY A;  3J81 Z;  5FKL A;  2TRT A;  1PP7 U;  3HOV J;  3M8F A;  5E8G A;  1D1B A;  1Z91 A;  3IAM 2;  3V42 A;  4EM2 A;  1XGO A;  4Y13 A;  1AU7 A;  1ZQ3 P;  5K5O A;  1JHH A;  4RDU A;  2ELH A;  1P7J A;  2CO5 A;  5FD6 A;  3J7Z I;  3GLL A;  3MKL A;  1AOY A;  1A6Q A;  3H9Q A;  1ZAO A;  4NC8 A;  2FMY A;  1NHA A;  1HBX G;  3R4K A;  2LRD A;  2HDW A;  1D0Y A;  3BR3 A;  4I2O A;  2O6G E;  4KFC A;  2HDD A;  2D45 A;  5M3M J;  1K79 A;  1GHC A;  4GFB A;  3QRF F;  2VBX A;  2HOS A;  3K7A J;  3IKT A;  4DZP A;  1LDJ A;  1J0R A;  2IA0 A;  3F3X A;  3L2R A;  2J5O A;  3IUO A;  1TNS A;  2HEO A;  1VQN I;  4E7J A;  1OYY A;  4RA2 A;  1QZY A;  2ADU A;  1U5T A;  1YOV B;  3ABM H;  3HG9 A;  4XOT A;  1U6G A;  4L9J A;  3JRH A;  3U9G A;  3AKZ A;  2STT A;  2MC4 A;  2X4H A;  4CCJ A;  2F5E A;  1TT0 A;  2EA2 A;  5LGT A;  2KRH A;  4A12 A;  4ZDP A;  4Q47 A;  2MC3 A;  5K1Y A;  3K2Z A;  4DYR A;  2X1E A;  2PJR A;  5FFX A;  2BHZ A;  3NQO A;  5FLV A;  5F0F A;  4S04 A;  3AL0 C;  1OCO H;  3COA C;  1KU7 A;  4Y15 A;  1Z3Y A;  4HQM A;  4DNC A;  4ENN A;  1QHH D;  1I3Q J;  2GQQ A;  3FF5 A;  2DAO A;  4B43 A;  2DDB A;  3OYL A;  4PUS A;  3V7R A;  2PLY A;  2FE3 A;  3FM5 A;  3LOC A;  5C4J J;  2IW5 A;  4ENM A;  1IRZ A;  1U0J A;  3OR1 C;  4HST A;  1TC3 C;  4ON0 A;  4ENK A;  2AS5 F;  3BC8 A;  5ERI A;  4KYW A;  1B59 A;  1XDS A;  2D1V A;  3S3O A;  3SEZ A;  3ASO H;  5GAG J;  1P92 A;  3DEU A;  1ZGJ A;  5EZG A;  3QWL A;  3X2Q H;  3OYA A;  4HDV A;  5K7H A;  2L54 A;  2EK5 A;  4MFD A;  2KZG A;  2A61 A;  4UVC A;  2XSD C;  2CQX A;  2RVC A;  3H0D A;  2ME6 A;  1OFC X;  1LEB A;  2M4K A;  1D0X A;  2KHM A;  1BN5 A;  2JVH A;  2LBF B;  4YRV A;  3LSI A;  4IF4 A;  1A31 A;  5KAF C;  4OIO F;  4PFP A;  4ZJZ A;  3CJN A;  1P7I A;  4I0A A;  1G4D A;  2E5N A;  2P7C B;  1EH7 A;  2H09 A;  1KU3 A;  1ENH A;  2WC2 A;  2X6O A;  4WF2 A;  5F04 A;  1Z67 A;  4U0W A;  2FRH A;  1FNN A;  2L0K A;  1YW9 A;  1EH6 A;  2NS8 A;  2ETH A;  1IV6 A;  3Q9S A;  2VPR A;  1LQ1 A;  5F08 A;  1W5C C;  2VLA A;  2GWR A;  2QWW A;  4CCK A;  2X6X A;  2DMT A;  3CF2 A;  3P5J A;  2ZBK A;  1XMK A;  2PBI A;  4BQQ A;  4EM1 A;  2UWM A;  3OYF A;  4HF0 A;  3W2V A;  4Q4Z F;  2NVY J;  4BE2 A;  1FTT A;  1JKO C;  1GDT A;  2NOG A;  5D5W B;  5E1W A;  2ZJQ F;  1T95 A;  5TRD A;  3R0J A;  2JRM A;  3JRF A;  2R5Y A;  4F93 B;  3CCU I;  1BOB A;  2Q2E B;  2LBF A;  2B7E A;  1W0U A;  5H6Q A;  1SC7 A;  2X85 A;  3ZQL A;  3SZP A;  3CDI A;  4EAT A;  2W4S A;  2J5P A;  1XGS A;  3ZQH A;  1JTX A;  2JWT A;  2Y48 A;  3ERE D;  2Y9Z A;  2NRA C;  4EJW A;  3OIP A;  5LHH A;  2VBZ A;  5LEJ A;  1PUF A;  3HDD A;  5DUI A;  1WI9 A;  2HVQ A;  3CJT B;  2XPU A;  1WJD A;  5LRS A;  2ISZ A;  3PNV A;  1QZE A;  4AID A;  2LVS A;  2VIX A;  5J4Y A;  1ZN2 A;  1FYM A;  2NS0 A;  2F48 A;  2RN7 A;  4LLL A;  3OYE A;  4DBQ A;  2KKO A;  4MEX F;  1MKM A;  2IAI A;  4MEY F;  2FML A;  1YW7 A;  1XX5 A;  3RI4 A;  1I6H J;  4UUS B;  4U0V A;  1E3P A;  2M5W A;  2VKV A;  3CCQ I;  1H0M A;  4J01 A;  1IZ1 A;  2W57 A;  1L3L A;  2D5V A;  3FMQ A;  2BBY A;  2Q2E A;  5H6R A;  3FXO A;  1LNW A;  3CDH A;  3ZGK A;  3CDL A;  4FX4 A;  3L2U A;  1JT0 A;  1G59 A;  1QU3 A;  5FLX Z;  2DA1 A;  2ZKZ A;  2ZSI B;  4KMU X;  4CHU A;  5HDN A;  3Q9V A;  1RUN A;  4Q5S F;  5HLH A;  3SFZ A;  4HSR A;  3VYT B;  3BZ6 A;  3GTL J;  4I01 A;  4HW0 A;  3U21 A;  2DA3 A;  4L5J A;  3F8C A;  3GFI A;  1IDZ A;  2I8D A;  5FLM J;  2LY9 A;  2W82 A;  3CCM I;  2XAG A;  1Q1H A;  1MJ9 A;  1HQC A;  1YIJ I;  1RKW A;  3EQL F;  4JYK A;  4IEJ A;  4XKW A;  2LYC A;  2ID6 A;  2IXS A;  3TL4 X;  1OCT C;  1IUY A;  2VC1 A;  2DOF A;  4IHT A;  1UMQ A;  3F8M A;  1T8I A;  3FXM A;  2R4G A;  1X1P A;  1IJW C;  2CUF A;  1LE8 B;  4BAC A;  2Y0S N;  4EM0 B;  1APL C;  3F22 A;  4CSW A;  5JHF A;  3HKZ N;  3WG7 H;  1WI3 A;  1XN7 A;  3VSK A;  1TWC J;  1ZHF A;  1HST A;  2DDA A;  4WK8 F;  1OCC H;  2XAS A;  1LUJ B;  1TWH J;  2PX9 A;  3BOQ A;  3N05 A;  3MN2 A;  4G7O F;  1B9N A;  2YU3 A;  1BW5 A;  2ZME C;  1QZZ A;  1O3R A;  2Y2Z A;  2JK3 A;  4BBS J;  1Y6I A;  3K1M A;  2NNN A;  4H0E A;  2HPM A;  4U87 A;  2MBF A;  5D4R A;  5J47 A;  1K78 B;  1ZLJ A;  4CYD A;  4YEJ A;  3KLN A;  4KIG A;  4HF2 A;  1OIS A;  2LRE A;  4PGG A;  2XAU A;  2LG4 A;  3K4M A;  3K4B A;  2Y9Y A;  4M72 A;  4Y33 A;  1MH4 A;  3RQI A;  3V7C A;  4ENJ A;  3S2W A;  3ECO A;  2BEO A;  2Y31 A;  4X1E A;  1YHQ I;  3HSR A;  4A3C J;  1MIJ A;  1POG A;  3EYY A;  2CYY A;  1S9H A;  1YG2 A;  1JGG A;  1GLN A;  5M5W J;  1ZR2 A;  1LE8 A;  2IGN A;  3UNG C;  4M9X A;  1LFU P;  1U9O A;  4B1R A;  2LF8 A;  4PDK A;  4FHT A;  1FBS A;  1R49 A;  2K5C A;  4PGH A;  2CV0 A;  1CF7 A;  1DU0 A;  2HZD A;  5BOX A;  3GO5 A;  3C1D A;  5KHD A;  3G1L A;  1JJ8 C;  1R1V A;  2GXA A;  4XRS G;  4PK4 A;  2QEN A;  1G3W A;  1K78 A;  4CDG A;  3FHZ A;  1Z6T A;  2EZI A;  1FZP B;  1RES A;  1Z1D A;  2ESH A;  2L9S A;  4PSW A;  3UR3 C;  1UJ8 A;  4FET A;  3EYI A;  1QVU A;  1FIA A;  2UXX A;  3H3V K;  4BBR J;  2RRE A;  4HOB A;  3WTT C;  5F64 A;  3IWF A;  3K6G A;  4XRM A;  2M4G A;  1SVM A;  3PUF A;  2EIJ H;  3LSP A;  1X1C A;  1QPI A;  3F0C A;  1T38 A;  3RCO A;  4MTE A;  3G1M A;  1SFK A;  2P81 A;  4EJO A;  5B5E C;  1WJF A;  2EB7 A;  4M9Z A;  1FOW A;  3S93 A;  5HDK A;  2A07 F;  2HPI A;  4YFN F;  2DMU A;  4G7Z F;  1MBF A;  3HOT A;  3H5A A;  2XC7 A;  2BXZ A;  2YX7 A;  4S05 A;  1Z0X A;  3C18 A;  3FXR A;  2GXG A;  1MMN A;  2LY1 A;  3M4O J;  2H27 A;  1JKR C;  2O7O A;  5FD5 A;  3WU1 B;  2FBK A;  3ML6 A;  4HF1 A;  2DTZ A;  4BE0 A;  3V4G A;  3S2D J;  2ZXW H;  3SDB A;  3E6C C;  2VQH A;  1D1A A;  2DOE A;  4MNU A;  4PJ0 C;  4XRS A;  2R7R A;  1T08 B;  1WHU A;  3DBH B;  1E17 A;  5CQE A;  5ICG A;  2A68 F;  1IAW A;  1HA8 A;  2KIQ A;  2GIZ A;  2JUG A;  3MAJ A;  2XKP A;  2HOT A;  4C2M J;  4CZZ A;  4CYC B;  2IS2 A;  3HTS B;  2COM A;  3ZQQ A;  1X1A A;  2COB A;  2I10 A;  2OAZ A;  2FD5 A;  2OC6 A;  2KDO A;  2ECB A;  3NRV A;  1OCP A;  2UZK A;  4F52 A;  5DM6 F;  4YIF A;  3LSK A;  2DTR A;  1GV2 A;  2A6H F;  2HU9 A;  2M0C A;  1SVL A;  1HF0 A;  3K1P A;  4UXN A;  1HXD A;  3TBI A;  1P4X A;  3FX3 A;  5JLW A;  5HLI A;  3GUD A;  5AIQ A;  5L3D A;  2DMP A;  4XKB A;  5ILV A;  3DKW A;  4BU2 A;  3J80 K;  2XRO A;  3G4S I;  4XOP A;  3PO3 J;  1IDY A;  3B73 A;  2IBD A;  4P1W A;  3IP4 B;  1YJW I;  3AG4 H;  5LGU A;  1LKX A;  3BJA A;  1MBJ A;  2IS1 A;  1W7P B;  4A3D J;  1Z3X A;  2PMZ N;  4Y17 A;  3I5U A;  3HUG A;  3LA7 A;  5GPC A;  3CUQ B;  1B72 A;  2VKE A;  5H20 A;  2JTV A;  2Y0S A;  4ITV A;  4I02 A;  4RB0 A;  4CYC A;  3C3W A;  4P96 A;  1P4W A;  3IH4 A;  1QA6 A;  2NVX J;  1SD5 A;  2BGC A;  3JRC A;  5J1R A;  4L9T A;  3DF8 A;  2WAF A;  4C2U A;  2G7H A;  2FF4 A;  2K9M A;  2P0W A;  3ZXS A;  1XD7 A;  2HQA A;  3M07 A;  3H0G J;  3VWB A;  1W4M A;  1MND A;  3DXJ F;  2R7Q A;  2XSJ C;  4FT8 A;  4CCL A;  3FXL A;  4XLC A;  1VQK I;  1DP3 A;  2KPM A;  2NS7 A;  2OQG A;  1W1W E;  3FXQ A;  4PZJ A;  1SFX A;  5LRR A;  1VFC A;  2VC0 A;  4E7K A;  4ZYA A;  1LPQ A;  3WTY C;  1R7J A;  1YIO A;  5FO5 A;  5F0H A;  4EGZ A;  4IHX A;  4KIS A;  1HKS A;  3ZPL A;  2CQ7 A;  4LFU A;  4C2T A;  2Z2S B;  1F9N A;  5FFZ A;  4G7H F;  2KRF A;  4GXO A;  3I55 I;  1BJA A;  3I58 A;  3ABL H;  3BG3 A;  3BPX A;  5FKM A;  2WBM A;  1YRN B;  3MVP A;  3L2V A;  5KNL A;  1EA3 A;  2KIF A;  2YR2 A;  1OJL A;  4EVI A;  2IP2 A;  2VXZ A;  3T0Y A;  4NC7 A;  3IH3 A;  4HPQ A;  5TJJ A;  5ICE A;  3S1M J;  1QVT A;  4AUX A;  4KA4 A;  3TO7 A;  2PEX A;  1WJC A;  3E5X A;  2XB0 X;  3CC7 I;  4F91 B;  5B66 C;  2FOK A;  2K9Q A;  2F4O B;  3GYH X;  3E97 A;  3O8G A;  1XGN A;  2V1N A;  4NDL A;  1FEX A;  1K4T A;  3HOY J;  3WU0 A;  4XL9 A;  3R6S A;  3PJR A;  3D5S C;  4KIC A;  2QF7 A;  5TIS C;  2AHQ A;  5LFA A;  1S8N A;  1BR2 A;  1K83 J;  1X2M A;  3PIO F;  4QSH A;  2K7L A;  4D5F A;  5IOY A;  3NWT A;  4YEL A;  4A2U A;  5FGM A;  2H1L A;  4EJT A;  1R4N B;  3BG6 A;  3A01 B;  2L7F P;  4HYE A;  4RBO A;  2W7N A;  4CUG A;  4LD5 A;  2ZCW A;  1S29 A;  3KEO A;  1HOM A;  4IPA A;  4FTH A;  1NK2 P;  1YRN A;  2L7Z A;  3I59 B;  2DK8 A;  5D4S A;  1QNT A;  2Z3Y A;  4LJZ F;  4QWQ A;  2Z9O A;  3BY6 A;  3CCE I;  4OIN F;  5IT3 A;  3D5L A;  4IHS A;  3H92 A;  3S32 A;  2EFQ A;  1BIA A;  4F55 A;  1LDD A;  3V8L A;  2M87 A;  2RV8 A;  2VJ4 A;  5BS6 A;  1FIP A;  2BVL A;  3D0S A;  1NG7 A;  2OD5 A;  2QGU A;  2DFE A;  1XSD A;  2YU9 J;  3LNQ A;  3TOB A;  2E1M C;  2DXI A;  1NK3 P;  2QM3 A;  2DO7 A;  3BG5 A;  4M3B A;  1Y0N A;  3ONQ A;  2LD5 A;  4BEH B;  3TQN A;  4LG3 A;  1I50 J;  3HJE A;  3RDI A;  4NQW B;  5F1J A;  4NBQ A;  5B1B H;  3FK6 A;  2QLZ A;  5A2Q Z;  3A01 A;  4U88 A;  4A3J J;  2PFB A;  3RPQ A;  5D6F A;  2HWV A;  4KN4 X;  4ABZ A;  4WWC A;  3PL8 A;  4IXA A;  4A3L J;  4BE1 A;  1FJL A;  3QOP A;  4LIV A;  2K9N A;  4JBA A;  4NHJ A;  3DQV C;  5GTH C;  3HOX J;  3H9J A;  3FHN A;  3CF5 F;  2X1D A;  1ON2 A;  4LB5 A;  4OWR B;  4GCV A;  5FRN A;  3J7A Y;  2R7T A;  3Q0W A;  1W36 D;  1DUX C;  4XN3 A;  1R1T A;  1X3Z B;  1J7K A;  2ZXH A;  4WXC A;  1D5V A;  1ZKG A;  3HRM A;  5C44 J;  1SAX A;  2JA7 J;  2E7W A;  4IL6 C;  1A35 A;  1TLH B;  3PSI A;  4B3X A;  2EV6 A;  1WJA A;  2KLO A;  3DKY A;  4XON A;  3SDG A;  4BXF A;  4IX7 A;  2KRC A;  1YI2 I;  3GTM J;  3HHH A;  4DQ2 A;  2CV1 A;  2UUZ A;  2DK5 A;  1ON1 A;  1R5I D;  5L3F A;  4ESF A;  1ZYR F;  1KQ8 A;  4O6J A;  1WCM J;  3QP5 A;  1S72 I;  2H8W A;  2KDZ A;  1E3O C;  3QP6 A;  3DEW A;  4JX4 A;  4NQW A;  4LB6 B;  2MW8 A;  2FJ1 A;  2VUM J;  3OY9 A;  4HLY A;  2FNA A;  1BA5 A;  3BJ6 A;  1JUP A;  2M30 A;  3AG3 H;  3TP3 A;  2P5L C;  2ZFU A;  2IGM A;  2TCT A;  2MG4 A;  4L5E A;  4B4C A;  1MDM A;  1JUS A;  2DW4 A;  1SMY F;  3HGG A;  1LVK A;  5HOO A;  1G3S A;  1VI0 A;  2HYG D;  2ELK A;  5CVR A;  1QHG A;  4ESB A;  4A69 C;  5A2Q K;  3BQY A;  3CCY A;  2HI3 A;  3S3M A;  1AHD P;  3WTZ A;  4G94 A;  1TWG J;  1K4S A;  3LL7 A;  1ZK8 A;  2JJ7 A;  4CA0 A;  4HX7 A;  3L00 A;  1T39 A;  2EFN A;  3PSF A;  3L2W A;  1HDD C;  3EDP A;  1OMI A;  1RC9 A;  2YPR A;  2FBI A;  5J1U A;  1HKT A;  2OZU A;  3B6C A;  4OMZ A;  4F3Q A;  2ICW G;  3ROU A;  4I7H A;  2P4W A;  3LAP A;  2UV1 A;  4G12 A;  4IOA F;  1FBU A;  2X51 A;  1MH3 A;  2L02 A;  2BYV E;  2FA5 A;  2VQC A;  2FX0 A;  1FYL A;  4MTD A;  1TT5 B;  1TTY A;  2TDX A;  4RGS A;  3LSR A;  5K7Z A;  3CJR B;  1O3S A;  2DJI A;  2JPC A;  3E7L A;  4DOZ A;  1R1U A;  1ZGA A;  2GBY A;  4DZJ A;  3JTG A;  2EZK A;  3BR1 A;  2MGQ A;  1BOA A;  3AG1 H;  4KDP A;  4NUB A;  1W36 C;  2E1M B;  2YS9 A;  2ZJ2 A;  3GBG A;  3I0T A;  4UHT A;  4BDY A;  3LMM A;  3RKQ A;  2GOX B;  3ASN H;  1IG7 A;  1D0Z A;  1SAU A;  2M8E A;  5CVV A;  2R92 J;  4UB8 C;  4ZYE A;  2KZV A;  2WY8 Q;  2EIL H;  1F5T A;  1ACI A;  5D8K B;  3PNY A;  1ITY A;  3WTX C;  4N9I A;  4FQG A;  3OYG A;  2XDV A;  3AFH A;  1J59 A;  4I98 B;  4DBR A;  3LAJ A;  2K9L A;  1W0T A;  2DYS H;  3OWT A;  4HV5 A;  1WH5 A;  5GAE J;  3P9K A;  4BGD A;  2DYR H;  3KZY A;  3VFZ A;  2DT6 A;  2XGC A;  3HOS A;  2R7V A;  4CIC A;  2DJN A;  2KIU A;  2EFO A;  1ETV A;  2OQR A;  4A3F J;  1YX5 A;  1ZTR A;  2M9H A;  4AVZ A;  1TQM A;  3LFK A;  2DOD A;  2M45 A;  3A1Y A;  2K3P A;  3BP8 A;  1A04 A;  2L7M P;  5AON A;  4E7I A;  3I53 A;  1W5S A;  2K9S A;  1D1C A;  3ZP5 A;  2XKO A;  3MD2 A;  3LSH A;  4X0G A;  4XKC A;  2KQR A;  5GPA A;  5CPR B;  5IY5 H;  2IT0 A;  1BR1 A;  4B48 A;  1LFP A;  4UV8 A;  4IO9 F;  1X1D A;  2DMN A;  1U3E M;  2ME0 A;  4WCG A;  1FYK A;  3OMY A;  4M3G A;  4C9Y A;  3GZ6 A;  4GYI A;  1MZB A;  3KET A;  1LJ9 A;  4QIW N;  3GZN B;  2JQ7 A;  4BY1 J;  4KMF A;  4DW6 A;  1T33 A;  3DTI A;  1VQ7 I;  3K70 D;  3K4C A;  4K2E A;  2BVM A;  1UFM A;  4AWX B;  1OKR A;  1DGW Y;  3H36 A;  3JCU C;  3KP6 A;  2F4M B;  4HRI A;  3KEY A;  1R22 A;  3A2K A;  1S7A A;  5FKO A;  3OS1 A;  2VPL A;  2HKO A;  3SZG A;  1OR7 C;  2QBY B;  4C30 A;  1XDU A;  3F8N A;  3O6B B;  3F9K A;  4PJM A;  4LLG F;  3OS2 A;  2CS3 A;  1KU2 A;  1V3F A;  2LC2 A;  2PJP A;  3RYP A;  1Y1V J;  5EZH A;  4B44 A;  5EEA A;  4M6Y A;  2JA5 J;  1D3Y A;  1E3H A;  3WHB A;  3OIQ A;  2A69 F;  2V79 A;  3HOZ J;  5HNH A;  3K69 A;  4UV9 A;  3RKW A;  2HTJ A;  1VTN C;  2HYJ A;  2HGC A;  2GAU A;  1LB2 A;  2F2E A;  4HQE A;  3KP7 A;  2QQ8 A;  1B4A A;  1W7P D;  4BY7 J;  4Q48 A;  1ZRD A;  3VEP A;  2H6C A;  3R0A A;  1G3Y A;  2R7F A;  4CCM A;  3ZN0 A;  4BJ6 C;  2GM4 A;  5JVT A;  1VQ4 I;  1KGS A;  2E71 A;  1BBY A;  5K5Q A;  2OUM A;  5CVI A;  4IQJ A;  2A5Y B;  2Z1D A;  4II2 A;  5HVQ C;  2JMW A;  1QQI A;  5F6F A;  4YIR X;  2XF5 A;  2QSH X;  1I1G A;  1SD4 A;  1WJE A;  1IN6 A;  1MW7 A;  2KP6 A;  4NB5 A;  4WXH A;  1P4A A;  2CQQ A;  3T1B A;  1Z21 A;  5K7F A;  1BIB A;  3KIO A;  2VL8 A;  4GYG A;  3VPR A;  2L3D A;  2L4M A;  3LQR A;  1OQY A;  2X0L A;  2HQ5 A;  1ZRF A;  3DFG A;  3A0H C;  2V4J C;  1FC3 A;  3GTJ J;  3JW4 A;  3S16 J;  1K61 A;  3JRE A;  4MQV A;  1H88 C;  2NAZ A;  4ZTF A;  5J4V A;  2KJB A;  3OIO A;  2CFO A;  1M1E B;  2M1B A;  2E1C A;  2DQL A;  3L09 A;  3SXY A;  1F36 A;  1YLF A;  2Y75 A;  3DPT A;  2LKS A;  4JX5 A;  3DCF A;  3PO2 J;  5IOZ A;  2I5U A;  4A5M A;  3I64 A;  3PQJ A;  3EUA A;  3K70 C;  3HM5 A;  3WU2 C;  3H35 A;  4UUS A;  1TL8 A;  2RAE A;  5C4X J;  3TGN A;  5F0C A;  1VQ5 I;  1TBX A;  1QO0 D;  3NWS A;  2BXY A;  4RGR A;  3ABU A;  2M0M A;  2JRT A;  4AC0 A;  1YIT I;  2NVU B;  1NH3 A;  4B09 A;  2F6C A;  1MNM C;  5CJ9 A;  2OCE A;  2JA2 A;  2OCC H;  3RZD J;  1WVR A;  1PUE E;  4M73 A;  3HTU A;  5EG0 B;  3GTG J;  2WAD A;  2P6T A;  3BQZ A;  2HQN A;  3HIF A;  4AIK A;  5IPA A;  3G73 A;  2E60 A;  2RNJ A;  3J7Y J;  1ZAR A;  3VYR B;  2XF6 A;  3GVA A;  3IRQ A;  5HS9 A;  4JOM A;  2CSO A;  1MBE A;  4V19 K;  5GTI C;  3A0B C;  3BWG A;  1SFE A;  3G3Z A;  2V9K A;  5ILS A;  2RQP A;  1J2X A;  5JLX A;  2VKD A;  4BKX A;  4KT5 C;  1IXR C;  2CRG A;  2IGK A;  3PM1 A;  4ZC3 A;  2DFI A;  3CUQ C;  1IO2 A;  1LDK B;  4BHC A;  1LVA A;  3GW2 A;  4ZDL A;  1Z9C A;  1I5Z A;  4XK4 A;  4XOR A;  2R7D A;  4C3H J;  3F6V A;  4EJU A;  2A6E F;  4L9N A;  4D5C A;  2QEX I;  4ESJ A;  2IPQ X;  3MKZ A;  2EIM H;  4MLO A;  5CVU A;  4OAZ A;  3VDX A;  5EG0 A;  4S0H B;  3ERM A;  4RS8 A;  2ESN A;  3OYK A;  4IZZ A;  1TW2 A;  2CW8 A;  4XR6 A;  2G0E A;  3ULQ B;  4NC6 A;  1DP7 P;  2GLO A;  4R79 A;  3K0L A;  3V8J A;  4E7L A;  2V1X A;  1BC7 C;  2LFB A;  2QYO A;  1FOK A;  2EBI A;  1S3J A;  3M8E A;  2RDP A;  4RB3 C;  2R7U A;  2ZSH B;  4LOC A;  5C3E J;  3HYI A;  3FMR A;  2R0Q C;  1OR7 A;  3TW6 A;  5LEK A;  4AU7 A;  1R36 A;  3KE2 A;  3J80 Z;  1ETY A;  2E1N A;  1PYV A;  1MBK A;  1R00 A;  3S1N J;  3BZK A;  4AYB N;  1RNL A;  2QZ8 A;  2L9V A;  2QQ9 A;  3MCZ A;  4JK1 X;  2JT1 A;  1BI1 A;  2P5V A;  1JHF A;  4FAS D;  3JSO A;  1WFX A;  3CO7 C;  3GF2 A;  3EUK L;  2WAE A;  2CU7 A;  5FB2 A;  2M2E A;  3LSG A;  2VOO A;  2ZO4 A;  4U7D A;  3TP0 A;  2D2W A;  1USS A;  2DMQ A;  5EF6 A;  4DJA A;  1U8B A;  4LG0 B;  4IRI A;  1GV5 A;  1O7F A;  3W2A A;  2ACJ A;  1HCR A;  3L1P A;  1T56 A;  4GGG A;  5E3N A;  3CUO A;  2LKX A;  1T6S A;  5D5V B;  1U9N A;  3HPH A;  2PQ8 A;  4U0Y A;  1N78 A;  2XGE A;  1IV8 A;  2FEZ A;  4HAM A;  5J6X A;  2BZT A;  4OAY A;  2QCO A;  5HLG A;  5DUK A;  1O57 A;  4EEF G;  2XIG A;  4FCY A;  2G9W A;  1FMV A;  3REO A;  3K4K A;  2QKM B;  4ZYH A;  1RR7 A;  1VF9 A;  5KK1 A;  2E34 A;  3IRR A;  3GTP J;  1U78 A;  3ZQ7 A;  4O5V A;  1TQI A;  5LBQ A;  1P6R A;  5IP6 A;  3CCJ I;  3DBL B;  3C2H A;  1PVE A;  1KYZ A;  3OYN A;  3GME A;  3CO6 C;  3KZZ A;  5JR3 A;  2FQ4 A;  4A0Z A;  2W85 A;  3BCB A;  2MH9 A;  1K6Y A;  1ODD A;  3DTK A;  3K2A A;  3FKJ A;  5EJC A;  5LLQ A;  2AQE A;  3OYH A;  1DDN A;  2ZXJ A;  3WGG A;  4YFX F;  1P9Q C;  2XRN A;  4AM3 A;  1UG0 A;  1Y8R B;  4IJA A;  2ZJR F;  2GA1 A;  3FXK A;  3OR2 C;  1XPX A;  2VB6 A;  3MZH A;  4HX8 A;  4RGX A;  2BW3 B;  2MH2 A;  1WWX A;  2OPT A;  2DFH A;  4G8X A;  4EQQ A;  2BY0 A;  2JA6 J;  2YSR A;  4M3E A;  2QVO A;  2A05 A;  3PIP F;  3W2W A;  3H5R A;  1MMA A;  1AWC A;  3OYB A;  5CVJ A;  2AXT C;  1R6R A;  2HR3 A;  1S6L A;  2K40 A;  1H9G A;  4XQF A;  3CC2 I;  3I71 A;  2VT2 A;  3ZMV A;  3HKZ A;  2LY2 A;  2Y0M A;  1D8J A;  3F8F A;  4RAY A;  4L0Y B;  1VQP I;  1S7O A;  2VN2 A;  3SJM A;  1ZEL A;  4XLA A;  3BR6 A;  2X9D A;  5FRO A;  4YII A;  4M3F A;  5DCF A;  3D5R C;  4OMY A;  3MEX A;  2CH0 A;  3BJO A;  3P7N A;  1JJ6 C;  1I3A A;  3LSJ A;  1XMA A;  1GT0 C;  5EGO B;  3NEU A;  2K27 A;  2MAB A;  3VYU B;  2R7Z J;  4Y4R A;  3E6B A;  4BYY A;  1W7P A;  4EV0 A;  1RPW A;  4ZH4 F;  3GXO A;  1VQL I;  2EFP A;  1ZG3 A;  4P55 A;  1UCR A;  4XLF A;  3EET A;  2FXA A;  1GVJ A;  4ZYD A;  5J40 A;  3CUQ A;  3WG9 A;  2YUS A;  3WTV C;  4BNC A;  4B47 A;  1MBH A;  1L0O C;  2OTL I;  3KPH A;  2L5Q A;  4LIU A;  5IT9 Z;  4Y7N J;  1UAA A;  1IN4 A;  2EIK H;  2OA4 A;  4N9H A;  5BPD A;  3IV5 A;  2JSP A;  4XMY A;  1FMW A;  4PCQ A;  2ZXI A;  4Y3O A;  5L3G A;  2F5D A;  3RKY A;  4D7M A;  1V54 H;  3NAU A;  1VQ6 I;  2JZY A;  3QQA A;  3ZMD A;  1RZ4 A;  1Z77 A;  4O3M A;  2PG4 A;  1X1B A;  2E36 A;  2ECC A;  2DPD A;  3CTA A;  4KJZ A;  4KIB A;  2CW0 F;  2E19 A;  1X19 A;  2V1U A;  4XIC A;  5EGO A;  3DTE A;  2W00 A;  3OOP A;  3L2C A;  2ID3 A;  1ZG5 A;  3A02 A;  2JA8 J;  3OL3 A;  2LF7 A;  5HLT A;  3PQK A;  4LGW A;  2L4A A;  2MYS A;  3K1N A;  4P9U A;  5GP9 A;  4LK1 F;  2P7V B;  2HTS A;  4XN0 A;  4IOC F;  2WA0 A;  3HRT A;  1B8I B;  1A6I A;  1R5H A;  3CLO A;  3L2Q A;  2E5Z A;  2XGD A;  4E70 A;  4UB6 C;  1SFO J;  2EPF A;  2Y69 H;  3JRI A;  5FKK A;  3CJQ B;  1XGM A;  1J75 A;  3W3C A;  3JR9 A;  3SEQ A;  1O3Q A;  2ZNY A;  4HNV A;  4G9Y A;  1YX3 A;  3FMS A;  3KLO A;  3I4M J;  2Q8K A;  1CGP A;  4EMS A;  1I6X A;  3E5U A;  4UVB A;  3KYD B;  2DA6 A;  2WAQ N;  1JT6 A;  3KP2 A;  4L5I A;  1JE8 A;  2K4B A;  2L9R A;  4DYC A;  3TOA A;  1IN8 A;  1ORK A;  2IS4 A;  5IT9 K;  5EYR A;  1D5Y A;  1F1Z A;  1BJZ A;  1ZRE A;  2VT3 A;  2W48 A;  5K5R A;  1P2F A;  1Z7L A;  3S1Q J;  1IRF A;  2W24 A;  4CO8 A;  3RZO J;  3JSP A;  3BG7 A;  3ZQC A;  1FP2 A;  1TWA J;  2DU9 A;  3DU6 A;  3I59 A;  1LEA A;  3ZMT A;  1XSV A;  4YG2 F;  1N75 A;  3QOD A;  1EV7 A;  1G6N A;  2FBH A;  3K4N A;  4A5N A;  1ETX A;  3F72 A;  3WGH A;  3R61 A;  3FIW A;  4IRG A;  3V7S A;  3ZQG A;  3WE3 A;  3QPT A;  2R5Z B;  3IH2 A;  3QU6 A;  2DLL A;  2K85 A;  1ETO A;  1K7A A;  2P6S A;  2YX4 A;  2LOO A;  3BPV A;  3CLQ A;  3FIS A;  5IP9 J;  1YQA A;  1FBQ A;  4L0Z B;  4J00 A;  4A3E J;  2IA2 A;  5E17 F;  2EQR A;  2OV7 A;  2CUZ A;  3VSL A;  3RPU D;  5E3M A;  3OSG A;  3WHC A;  1WJB A;  1ZG1 A;  2H8R A;  4RLQ A;  1UHM A;  3DPU A;  4KIF A;  4IKF A;  2PMZ A;  2JUC A;  3RIR A;  4BEH A;  4W97 A;  3M1E A;  5TGT A;  4AIJ A;  2O0Y A;  3K4L A;  3H3Z A;  5HS7 A;  1TW3 A;  2VJ5 A;  1XCV A;  3I56 I;  3CCS I;  2LSO A;  5M5Y J;  2C6Y A;  3SZT A;  3R60 A;  2FQ3 A;  2GIV A;  1DPU A;  2CWE A;  4JP0 A;  1MMS A;  5ICC A;  3VYS B;  3MKY B;  2XV4 S;  2FNP A;  1KA8 A;  2F5V A;  2AQF A;  3QYE A;  3CP8 A;  3T8T A;  3WGI A;  1VND A;  2FOW A;  1UB9 A;  3Q0V A;  2VJI A;  5CYV A;  3BTC A;  3L7W A;  3B02 A;  1OLT A;  4ZZL A;  3HC7 A;  5LGN A;  3S1R J;  2R5Z A;  2XPV A;  3GZ5 A;  3OYI A;  1G8X A;  4CZC A;  1DQU A;  1Z05 A;  2DA7 A;  1R71 A;  3IKV A;  2VON A;  2R7X A;  3BT9 A;  4LK0 F;  2R7O A;  4BJT A;  5KVR A;  1LFB A;  2BY1 A;  3E6D A;  1FSE A;  1ZLK A;  3C2G A;  3E6M A;  4BS9 A;  4KIT B;  3SQN A;  3AAF A;  4LLN A;  2LP0 A;  2E2I J;  4RM2 A;  4N4N B;  5HS8 A;  3TKY A;  2X48 A;  2NXN B;  3HGY A;  2PJR B;  3HL2 A;  5H2F C;  1IRG A;  4PJJ A;  3OV8 A;  2L01 A;  3HRU A;  5E79 C;  4P9F A;  4BHP A;  4G6T B;  2M7A A;  4KN7 X;  2B9S A;  2V7F A;  3TMO A;  4C3J J;  2LH9 A;  2WTE A;  3FBI B;  3JRD A;  3FWE A;  2H6B A;  4CCN A;  4I0B A;  4E4H A;  2R7S A;  4XSX F;  2WWY A;  3GEZ A;  2A6T A;  3HEF A;  1GXQ A;  1IXC A;  3HHG A;  5DYM A;  2LLK A;  5IP7 J;  3S3N A;  1ZR4 A;  1R4M B;  2MFZ A;  4FIS A;  3ZN1 A;  4C3I J;  2QA4 I;  4CH7 A;  5B1A H;  5M5X J;  3IL2 A;  3LST A;  3W6J B;  1MJA A;  2VQL A;  4ZYG A;  5ED4 A;  3KZI C;  3LFU A;  2VQG A;  2R3S A;  3N4M A;  1X4P A;  3S17 J;  3I3L A;  2RC4 A;  4D9J A;  1A36 A;  1FX7 A;  4I76 A;  1XSX A;  4OIQ F;  1SVO A;  1Y8Q B;  3U1K A;  2MD5 A;  2KIM A;  3BR5 A;  3DP7 A;  4QLC U;  2E2H J;  1IC8 A;  3ZRG A;  5F27 A;  1TWF J;  4RAF A;  5EEH A;  4D0P A;  3IC7 A;  4GRI A;  3J81 K;  3HOU J;  3E3V A;  4B3A A;  1YFH A;  3TW7 A;  1R58 A;  1X58 A;  1N25 A;  2G7U A;  2X6W A;  3GWZ A;  4HNT A;  3MQ0 A;  1MNE A;  1T2K A;  4MIM A;  3JRB A;  3LA2 A;  1ZH5 A;  1OYI A;  5EEG A;  2V26 A;  2HKX A;  2DQR A;  3CES A;  1EKE A;  4PJN A;  4B8X A;  2RQQ A;  4TV7 A;  2P5K A;  2BE5 F;  2WAQ A;  4MHG A;  1TZL A;  2FU4 A;  2HS5 A;  2V6E A;  2XAH A;  2MD0 A;  2DOA A;  3DU5 A;  3GTQ J;  2KMU A;  4XLP F;  4A0X A;  3CMM A;  1YS7 A;  5M3F J;  3Q3S A;  4HEA 2;  2LTP A;  2B0L A;  2QSG X;  1TNT A;  1V5F A;  2XGX A;  1BR4 A;  3B6A A;  3IWZ A;  1C0W A;  2R5Y B;  5LHI A;  1HW2 A;  1I27 A;  1HC8 A;  1FT9 A;  1X3U A;  3O2P E;  3TDU C;  4H4K C;  2M7B A;  4ZDO A;  2QQA A;  3VB2 A;  1KYW A;  2PN6 A;  2LNB A;  5FRM A;  2W25 A;  2RKH A;  4XID A;  3ZQI A;  1X3W B;  2DBB A;  1X4O A;  1PUF B;  1WSU A;  3ZR8 X;  4HDU A;  1RKT A;  1QBJ A;  3QU3 A;  1D8K A;  1FOX A;  4E7H A;  1TP4 A;  4LMY A;  1QGP A;  2QUF A;  5DD8 A;  2XRL A;  1RUO A;  3MZY A;  3Q0U A;  3WE2 A;  4DIQ A;  1WJ5 A;  3QPL A;  4ANJ A;  1MMD A;  1FY7 A;  4XM3 A;  5BQT A;  1I1S A;  1QRY A;  5E1X A;  2ZC2 A;  3HSF A;  2PI0 A;  2HZT A;  1RR8 C;  3UKG A;  4XBF A;  2LK2 A;  2R93 J;  3SHF A;  2IEK A;  1DPR A;  1O3T A;  2A5W A;  2STW A;  2CJJ A;  2D1H A;  1OPC A;  1SEU A;  3ZMU A;  2DA4 A;  1B9M A;  2XF7 A;  2E7X A;  3V8K A;  1IXS B;  1VQM I;  2ZFW A;  1E2X A;  1IF1 A;  3QYB A;  3WTS C;  2VOD A;  2FSW A;  1T98 A;  2BY3 A;  1H8A C;  4QTR A;  2VE9 A;  2QBY A;  1TQP A;  1GUU A;  3OS0 A;  4IHW A;  2B63 J;  2PMH A;  3GLX A;  1BI3 A;  3PFI A;  2O3F A;  1IW7 F;  2N8G A;  1ETW A;  2QKL B;  3KFW X;  1R9T J;  1F43 A;  3VOE A;  1ONV A;  3IAS 2;  5LD2 C;  4A3G J;  4HNU A;  2LMD A;  4RLF A;  2OZ6 A;  2LKP A;  5J3L A;  4U7B A;  3WTU C;  2IS6 A;  5GAD J;  4FX0 A;  1OCR H;  1Z7U A;  3BG9 A;  4FE7 A;  2CGP A;  3WOD F;  2NYX A;  3QPH A;  3KYC B;  3ZMS A;  3JRA A;  3AL0 B;  2CUE A;  2EWN A;  2DT7 B;  2HVR A;  1S7E A;  5IYB J;  1HKQ A;  3FKI J;  2KT0 A;  2O61 A;  2EA4 A;  4E7Z A;  1REP C;  2XVC A;  2KFD A;  4A6E A;  3KYL A;  4DGW B;  2HOE A;  3RYR A;  1UZC A;  1YW8 A;  4BDZ A;  2HOA A;  2MLG A;  2VXD A;  2X1C A;  1KZH A;  1JTY A;  2AXL A;  3U1D A;  1T0F C;  3RSN A;  1KQ0 A;  3CP2 A;  5GAH J;  2VOP A;  4II3 A;  4XLN F;  3CD6 I;  5F1R A;  5B3S H;  4BQA A;  3TO9 A;  5D5X B;  4EJV A;  5JHU A;  4PJL A;  3M3Y J;  2DA2 A;  5E20 A;  4KNY A;  1JKQ C;  3KP3 A;  1PDN C;  3CCR I;  5BNG A;  3CC4 I;  4NNJ A;  5ILU A;  1MGT A;  2HQR A;  2L9N A;  5D5U B;  3G2B A;  1MJB A;  4M6V A;  1UEL B;  3RPU A;  2EV5 A;  2Z99 A;  1IRX A;  4JQF A;  4PSX A; 
#chains in the Genus database with same CATH homology
 3KP4 A;  5AIP A;  2QQB A;  4CGZ A;  1STZ A;  1SD7 A;  4WX9 A;  5JI6 A;  5DEQ A;  2O8X A;  3ECH A;  2HDC A;  4R1H A;  3TO6 A;  1CF7 B;  3DV8 A;  2OBP A;  2LDU A;  5DD4 A;  4M71 A;  2K02 A;  1RI7 A;  5D8L B;  3HRS A;  2IRF G;  1YS6 A;  3ZMZ A;  3O3K A;  3I54 A;  1K6O A;  1HW5 A;  4F7Z A;  1G3T A;  5L3B A;  5FLX K;  4BAY A;  4OOI A;  1YTY A;  2IA1 A;  3ISP A;  2XUB A;  2XAJ A;  4KUM A;  4RB2 C;  3KCC A;  3KEQ A;  3FM3 A;  4L18 B;  2GZW A;  4G6Q A;  3MFK A;  3BRO A;  4RGU A;  2IJL A;  5BPI A;  1PP8 F;  2BV6 A;  2EFW A;  4M9S A;  1UST A;  4ASN A;  4BHB A;  1V4R A;  2GA2 A;  4UVA A;  1FLI A;  3RJP A;  1BC8 C;  3GX4 X;  2F5F A;  2UXN A;  3N97 A;  1H9T A;  4HA8 A;  1XB4 A;  5E18 F;  2JSC A;  2VBY A;  4OU0 A;  3WTW C;  4Z2Y A;  1B1B A;  4N0B A;  3ABT A;  1Y0U A;  5DV5 A;  3GFM A;  3P9C A;  4HX4 A;  1UHW A;  4RAZ A;  1KU9 A;  1R5G A;  2DT5 A;  1YO5 C;  2K4J A;  3F8B A;  4AD9 A;  3F21 A;  1B6A A;  4YFK F;  3M7G A;  2XAF A;  4LG0 A;  3K9T A;  4HZF A;  5D6E A;  2CG4 A;  5HDG A;  3DPL C;  2IVM A;  1HW1 A;  2OU2 A;  5ICF A;  3E5Q A;  1WKM A;  4A6D A;  1SD6 A;  3M9A A;  1J5Y A;  2ZME B;  1T0F A;  3JAM Z;  2HYF A;  2H94 A;  2K86 A;  3LQQ A;  3RTR A;  2CFX A;  1ZRC A;  3JTH A;  3MWM A;  1IN5 A;  5J8C A;  4ETS A;  3QAH A;  2ZNZ A;  3H3U A;  4IVN A;  2XAQ A;  4CXF A;  2RGV A;  2WV0 A;  1BI2 A;  4HLX A;  2JPB A;  1ULY A;  2MA3 A;  4HV6 A;  4G6D A;  2ZME A;  4M74 A;  1SMT A;  4GO1 A;  2VBW A;  5BMZ A;  2KJC A;  4AIH A;  1BM9 A;  4MQ9 F;  2PMU A;  1W5T A;  4ZZD A;  2O03 A;  4R8H A;  1U5T C;  1WQ2 A;  2DPU A;  1XCB A;  3F23 A;  3J7A O;  4L9V A;  3JAM K;  2Q0O A;  1U2W A;  3GFL A;  3EUH A;  3I4P A;  2EV0 A;  3C7J A;  3T5X A;  3GFJ A;  2DI3 A;  1Z6R A;  3LWF A;  5CLS A;  4P5O A;  3VOD A;  3BDD A;  1RIO H;  4WXD A;  4MGR A;  2Z5U A;  4XRF A;  4OIP F;  3IHU A;  2CQK A;  3Q5F A;  4A0Y A;  4EGY A;  3LA3 A;  1FPQ A;  4UNO A;  1O7L A;  3FXU A;  2GXB A;  2HFH A;  2P8T A;  2XHK A;  2EJR A;  5DDG A;  2V6C A;  1QPM A;  3RKX A;  2VE8 A;  1KQ9 A;  5DCM B;  2V9V A;  4BH9 A;  4BXU A;  1WRJ A;  2Z33 A;  1FP1 D;  4HBL A;  4I09 A;  3L9F A;  1JGS A;  3KP5 A;  2F5C A;  5E8I A;  1HSJ A;  4M6X A;  2W84 A;  1GXP A;  2MLK A;  5L3C A;  1J9I A;  4XSZ F;  1FSH A;  3T8R A;  5LHG A;  2NNY A;  3TDZ C;  4AVP A;  5L3E A;  4IRH A;  3W6K B;  3U2R A;  1MDM B;  1OYW A;  4RB1 A;  5DCM A;  1IN7 A;  1EH8 A;  2ISY A;  3HSE A;  1JXS A;  3P9I A;  1FWZ A;  5JFR A;  1MD0 A;  4UUV A;  3F6O A;  4OIR F;  5E1Z B;  6PAX A;  1U8R A;  5J8F A;  1SFU A;  2V1D A;  1YYV A;  2A3S A;  3FZV A;  1R23 A;  1U5T B;  1BI0 A;  1F4K A;  3ELK A;  3J81 Z;  1PP7 U;  3M8F A;  5E8G A;  1Z91 A;  4EM2 A;  1XGO A;  4Y13 A;  5K5O A;  1JHH A;  2ELH A;  2CO5 A;  5FD6 A;  1AOY A;  1ZAO A;  2FMY A;  1NHA A;  1HBX G;  3R4K A;  4I2O A;  2O6G E;  4KFC A;  2D45 A;  1K79 A;  1GHC A;  3QRF F;  2VBX A;  3IKT A;  1LDJ A;  1J0R A;  2IA0 A;  3F3X A;  2J5O A;  1TNS A;  2HEO A;  1OYY A;  1QZY A;  2ADU A;  1U5T A;  1U6G A;  4L9J A;  3U9G A;  2STT A;  2X4H A;  2F5E A;  2EA2 A;  5LGT A;  4A12 A;  4Q47 A;  2MC3 A;  5K1Y A;  3K2Z A;  5FFX A;  3NQO A;  4S04 A;  3COA C;  1KU7 A;  4Y15 A;  4HQM A;  4DNC A;  4ENN A;  2GQQ A;  3FF5 A;  2DAO A;  3V7R A;  2PLY A;  2FE3 A;  3FM5 A;  2IW5 A;  4ENM A;  4ON0 A;  4ENK A;  2AS5 F;  5ERI A;  4KYW A;  1B59 A;  1XDS A;  2D1V A;  1P92 A;  3DEU A;  1ZGJ A;  4HDV A;  2L54 A;  2EK5 A;  2A61 A;  4UVC A;  2RVC A;  1LEB A;  1BN5 A;  4OIO F;  4IF4 A;  3CJN A;  4I0A A;  1G4D A;  2P7C B;  1EH7 A;  2H09 A;  1KU3 A;  4WF2 A;  2WC2 A;  4U0W A;  2FRH A;  1FNN A;  1YW9 A;  1EH6 A;  2ETH A;  3Q9S A;  1LQ1 A;  2GWR A;  2QWW A;  2ZBK A;  1XMK A;  2PBI A;  4EM1 A;  2UWM A;  4HF0 A;  4Q4Z F;  5D5W B;  5E1W A;  5TRD A;  3R0J A;  5H6Q A;  3SZP A;  2J5P A;  1XGS A;  2Y48 A;  3ERE D;  2NRA C;  4EJW A;  5LHH A;  2VBZ A;  5LEJ A;  5DUI A;  1WI9 A;  5LRS A;  2ISZ A;  1ZN2 A;  1FYM A;  2NS0 A;  2RN7 A;  4LLL A;  2KKO A;  4MEX F;  1MKM A;  4MEY F;  3RI4 A;  2FML A;  1YW7 A;  4U0V A;  2M5W A;  1H0M A;  1IZ1 A;  2W57 A;  1L3L A;  3FMQ A;  2BBY A;  2Q2E A;  5H6R A;  1LNW A;  3CDH A;  4FX4 A;  5FLX Z;  2ZKZ A;  4KMU X;  4CHU A;  5HDN A;  3Q9V A;  1RUN A;  4Q5S F;  5HLH A;  3SFZ A;  3BZ6 A;  4I01 A;  4HW0 A;  4L5J A;  3F8C A;  3GFI A;  2XAG A;  1Q1H A;  1MJ9 A;  1HQC A;  3EQL F;  1IUY A;  2VC1 A;  4IHT A;  3F8M A;  4EM0 B;  3F22 A;  1XN7 A;  1ZHF A;  1HST A;  4WK8 F;  2XAS A;  3BOQ A;  4G7O F;  1B9N A;  2YU3 A;  1QZZ A;  1O3R A;  3K1M A;  2NNN A;  4H0E A;  2MBF A;  5D4R A;  1K78 B;  1ZLJ A;  4CYD A;  3KLN A;  4KIG A;  4HF2 A;  4PGG A;  4M72 A;  3V7C A;  4ENJ A;  3S2W A;  3ECO A;  2BEO A;  3HSR A;  3EYY A;  2CYY A;  1YG2 A;  4M9X A;  2LF8 A;  4PDK A;  4FHT A;  1FBS A;  4PGH A;  1CF7 A;  5BOX A;  3GO5 A;  3C1D A;  1R1V A;  2QEN A;  1G3W A;  1K78 A;  4CDG A;  3FHZ A;  1Z6T A;  1FZP B;  2ESH A;  1Z1D A;  3EYI A;  2UXX A;  4HOB A;  3WTT C;  5F64 A;  3IWF A;  1T38 A;  4MTE A;  4EJO A;  2EB7 A;  4M9Z A;  2A07 F;  5HDK A;  4YFN F;  4G7Z F;  3HOT A;  2YX7 A;  4S05 A;  3C18 A;  3FXR A;  2GXG A;  2H27 A;  5FD5 A;  3WU1 B;  2FBK A;  3ML6 A;  4HF1 A;  3V4G A;  3E6C C;  4MNU A;  1E17 A;  5ICG A;  2A68 F;  1IAW A;  3MAJ A;  2XKP A;  4CZZ A;  3HTS B;  2COM A;  2OAZ A;  3NRV A;  2UZK A;  4YIF A;  2DTR A;  2A6H F;  3K1P A;  4UXN A;  1HXD A;  1P4X A;  3FX3 A;  5HLI A;  3GUD A;  5AIQ A;  5L3D A;  5ILV A;  3J80 K;  3DKW A;  2XRO A;  3B73 A;  5LGU A;  3BJA A;  1W7P B;  4Y17 A;  3I5U A;  3HUG A;  3LA7 A;  3CUQ B;  5H20 A;  2JTV A;  4I02 A;  4RB0 A;  3C3W A;  4P96 A;  1P4W A;  1SD5 A;  2BGC A;  4L9T A;  3DF8 A;  2G7H A;  2FF4 A;  1XD7 A;  1W4M A;  3DXJ F;  4FT8 A;  2OQG A;  3FXQ A;  4PZJ A;  1SFX A;  5LRR A;  2VC0 A;  3WTY C;  1R7J A;  1YIO A;  5FO5 A;  4EGZ A;  1HKS A;  3ZPL A;  4LFU A;  4G7H F;  1F9N A;  5FFZ A;  2KRF A;  4GXO A;  1BJA A;  3I58 A;  3BPX A;  2KIF A;  2YR2 A;  4EVI A;  2IP2 A;  2VXZ A;  3T0Y A;  5TJJ A;  5ICE A;  4KA4 A;  3TO7 A;  2PEX A;  3E5X A;  2FOK A;  3GYH X;  3E97 A;  1XGN A;  3WU0 A;  3R6S A;  4KIC A;  1S8N A;  2K7L A;  4A2U A;  5FGM A;  4EJT A;  4HYE A;  4LD5 A;  2ZCW A;  1S29 A;  3KEO A;  4IPA A;  3I59 B;  2DK8 A;  5D4S A;  1QNT A;  2Z3Y A;  4LJZ F;  4QWQ A;  2Z9O A;  3BY6 A;  4OIN F;  5IT3 A;  3D5L A;  4IHS A;  3H92 A;  2EFQ A;  1BIA A;  1LDD A;  3V8L A;  2M87 A;  2RV8 A;  5BS6 A;  3D0S A;  1XSD A;  2OD5 A;  3TOB A;  2QM3 A;  2DO7 A;  3TQN A;  3RDI A;  2QLZ A;  5A2Q Z;  4U88 A;  2PFB A;  3RPQ A;  5D6F A;  2HWV A;  4KN4 X;  4WWC A;  4IXA A;  3QOP A;  4JBA A;  4NHJ A;  3DQV C;  1ON2 A;  4LB5 A;  4GCV A;  1DUX C;  1R1T A;  4WXC A;  1J7K A;  1D5V A;  3HRM A;  1SAX A;  2E7W A;  1TLH B;  2EV6 A;  3HHH A;  4DQ2 A;  2DK5 A;  1ON1 A;  5L3F A;  4ESF A;  1ZYR F;  1KQ8 A;  4O6J A;  3QP5 A;  3QP6 A;  4NQW A;  4LB6 B;  4HLY A;  2FNA A;  3BJ6 A;  2M30 A;  2P5L C;  1MDM A;  2DW4 A;  1SMY F;  5HOO A;  1G3S A;  2HYG D;  5CVR A;  4ESB A;  5A2Q K;  3WTZ A;  4G94 A;  4HX7 A;  3L00 A;  1T39 A;  2EFN A;  3EDP A;  1OMI A;  2YPR A;  1HKT A;  2FBI A;  2OZU A;  4OMZ A;  3ROU A;  4I7H A;  2P4W A;  3LAP A;  1FBU A;  2L02 A;  2BYV E;  2FA5 A;  1FYL A;  4MTD A;  1TTY A;  2TDX A;  4RGS A;  1O3S A;  2JPC A;  1R1U A;  1ZGA A;  3JTG A;  1BOA A;  4KDP A;  2ZJ2 A;  3I0T A;  4UHT A;  2M8E A;  5CVV A;  4ZYE A;  1F5T A;  5D8K B;  3WTX C;  4N9I A;  1J59 A;  4I98 B;  3LAJ A;  4HV5 A;  3P9K A;  3KZY A;  3VFZ A;  3HOS A;  4CIC A;  2KIU A;  2EFO A;  2OQR A;  1TQM A;  3LFK A;  2M45 A;  3BP8 A;  1A04 A;  5AON A;  3I53 A;  1W5S A;  3ZP5 A;  2XKO A;  2IT0 A;  4UV8 A;  1U3E M;  4WCG A;  1FYK A;  3GZ6 A;  4GYI A;  1MZB A;  3KET A;  1LJ9 A;  4KMF A;  4K2E A;  4AWX B;  1UFM A;  1OKR A;  3KP6 A;  1R22 A;  1S7A A;  2HKO A;  2QBY B;  1XDU A;  3F8N A;  3O6B B;  4LLG F;  1KU2 A;  1V3F A;  2PJP A;  3RYP A;  4M6Y A;  1D3Y A;  2A69 F;  2V79 A;  3K69 A;  4UV9 A;  3RKW A;  2HTJ A;  1VTN C;  2HGC A;  2GAU A;  1LB2 A;  2F2E A;  4HQE A;  3KP7 A;  1B4A A;  1W7P D;  4Q48 A;  1ZRD A;  3VEP A;  2H6C A;  3R0A A;  1G3Y A;  2R7F A;  3ZN0 A;  5JVT A;  1KGS A;  1BBY A;  5K5Q A;  5CVI A;  2A5Y B;  5HVQ C;  1QQI A;  5F6F A;  1I1G A;  1SD4 A;  1IN6 A;  4NB5 A;  4WXH A;  1P4A A;  3T1B A;  1BIB A;  4GYG A;  2L3D A;  2L4M A;  3LQR A;  2X0L A;  1ZRF A;  3DFG A;  1FC3 A;  3JW4 A;  4MQV A;  2NAZ A;  2KJB A;  2E1C A;  2M1B A;  2DQL A;  3L09 A;  3SXY A;  1YLF A;  2Y75 A;  3DPT A;  4A5M A;  3I64 A;  3PQJ A;  3TGN A;  1TBX A;  1QO0 D;  4RGR A;  3ABU A;  2JRT A;  4B09 A;  5CJ9 A;  1PUE E;  4M73 A;  3HTU A;  2P6T A;  2HQN A;  3HIF A;  4AIK A;  3G73 A;  2RNJ A;  1ZAR A;  3IRQ A;  3GVA A;  5HS9 A;  2CSO A;  3BWG A;  1SFE A;  3G3Z A;  5ILS A;  2RQP A;  1J2X A;  4KT5 C;  1IXR C;  2DFI A;  3CUQ C;  1LDK B;  4BHC A;  1LVA A;  3GW2 A;  1Z9C A;  1I5Z A;  2R7D A;  3F6V A;  4EJU A;  2A6E F;  4L9N A;  4ESJ A;  2IPQ X;  5CVU A;  4RS8 A;  2ESN A;  1TW2 A;  3ULQ B;  1DP7 P;  4R79 A;  3K0L A;  3V8J A;  2V1X A;  1BC7 C;  2QYO A;  1FOK A;  1S3J A;  3M8E A;  2RDP A;  4RB3 C;  3HYI A;  3FMR A;  1OR7 A;  5LEK A;  1R36 A;  3KE2 A;  3J80 Z;  2E1N A;  1R00 A;  1RNL A;  2QZ8 A;  2QQ9 A;  3MCZ A;  4JK1 X;  2JT1 A;  1BI1 A;  2P5V A;  1JHF A;  3JSO A;  3CO7 C;  3GF2 A;  5FB2 A;  2VOO A;  2ZO4 A;  4U7D A;  2D2W A;  1USS A;  4LG0 B;  4IRI A;  1O7F A;  2ACJ A;  4GGG A;  3CUO A;  1T6S A;  5D5V B;  2PQ8 A;  4U0Y A;  5J6X A;  2FEZ A;  4HAM A;  5HLG A;  5DUK A;  1O57 A;  2XIG A;  2G9W A;  3REO A;  4ZYH A;  5KK1 A;  3IRR A;  1U78 A;  3ZQ7 A;  4O5V A;  1TQI A;  5LBQ A;  1P6R A;  1KYZ A;  3CO6 C;  3KZZ A;  5JR3 A;  4A0Z A;  2W85 A;  2MH9 A;  1ODD A;  5LLQ A;  1DDN A;  2ZXJ A;  3WGG A;  4YFX F;  2XRN A;  4IJA A;  2GA1 A;  3MZH A;  4HX8 A;  4RGX A;  2MH2 A;  1WWX A;  4G8X A;  4EQQ A;  2YSR A;  2QVO A;  1AWC A;  5CVJ A;  2HR3 A;  1S6L A;  1H9G A;  3I71 A;  2VT2 A;  3ZMV A;  2Y0M A;  1D8J A;  3F8F A;  4RAY A;  4L0Y B;  1S7O A;  2VN2 A;  4YII A;  5DCF A;  4OMY A;  3MEX A;  3BJO A;  3P7N A;  1XMA A;  3NEU A;  2K27 A;  3E6B A;  4BYY A;  1W7P A;  4EV0 A;  4ZH4 F;  3GXO A;  2EFP A;  1ZG3 A;  4P55 A;  1UCR A;  3EET A;  2FXA A;  1GVJ A;  4ZYD A;  3CUQ A;  3WG9 A;  3WTV C;  4BNC A;  1L0O C;  5IT9 Z;  1IN4 A;  2OA4 A;  4N9H A;  5BPD A;  4PCQ A;  5L3G A;  2F5D A;  3RKY A;  2JZY A;  3ZMD A;  1RZ4 A;  4O3M A;  2PG4 A;  2DPD A;  3CTA A;  4KIB A;  2CW0 F;  2V1U A;  3OOP A;  3L2C A;  1ZG5 A;  2LF7 A;  3PQK A;  4LGW A;  2L4A A;  3K1N A;  4P9U A;  4LK1 F;  2P7V B;  2HTS A;  3HRT A;  1R5H A;  3CLO A;  4E70 A;  1XGM A;  1J75 A;  1O3Q A;  2ZNY A;  4G9Y A;  3FMS A;  3KLO A;  2Q8K A;  1CGP A;  4EMS A;  1I6X A;  3E5U A;  4UVB A;  3KP2 A;  4L5I A;  1JE8 A;  2K4B A;  3TOA A;  1IN8 A;  5IT9 K;  1F1Z A;  1ZRE A;  2VT3 A;  5K5R A;  1P2F A;  1IRF A;  2W24 A;  4CO8 A;  3JSP A;  1FP2 A;  2DU9 A;  3I59 A;  1LEA A;  3ZMT A;  1XSV A;  4YG2 F;  1EV7 A;  1G6N A;  2FBH A;  4A5N A;  3F72 A;  3WGH A;  3R61 A;  4IRG A;  3V7S A;  3WE3 A;  3QPT A;  3QU6 A;  2DLL A;  1K7A A;  2P6S A;  2YX4 A;  3BPV A;  1YQA A;  1FBQ A;  4L0Z B;  2IA2 A;  5E17 F;  1ZG1 A;  1UHM A;  4KIF A;  3RIR A;  3M1E A;  4AIJ A;  2O0Y A;  5HS7 A;  3H3Z A;  1TW3 A;  1XCV A;  2LSO A;  2C6Y A;  3SZT A;  3R60 A;  2FQ3 A;  2GIV A;  1DPU A;  2CWE A;  5ICC A;  2XV4 S;  2FNP A;  1KA8 A;  3T8T A;  3WGI A;  1UB9 A;  5CYV A;  3L7W A;  3B02 A;  4ZZL A;  5LGN A;  3GZ5 A;  1Z05 A;  3IKV A;  2VON A;  4LK0 F;  5KVR A;  3E6D A;  1FSE A;  1ZLK A;  3E6M A;  3SQN A;  3AAF A;  4LLN A;  5HS8 A;  3TKY A;  1IRG A;  3OV8 A;  2L01 A;  3HRU A;  4P9F A;  4BHP A;  4KN7 X;  2WTE A;  3FWE A;  2H6B A;  4I0B A;  4XSX F;  2WWY A;  3GEZ A;  1GXQ A;  1IXC A;  3HHG A;  5DYM A;  3ZN1 A;  3IL2 A;  4ZYG A;  3LST A;  1MJA A;  3W6J B;  5ED4 A;  2R3S A;  3N4M A;  2RC4 A;  1FX7 A;  1XSX A;  4OIQ F;  2MD5 A;  2KIM A;  3DP7 A;  4QLC U;  5EEH A;  4D0P A;  3IC7 A;  3J81 K;  3E3V A;  1YFH A;  1R58 A;  2G7U A;  3GWZ A;  3MQ0 A;  1T2K A;  3LA2 A;  1ZH5 A;  1OYI A;  5EEG A;  2HKX A;  2DQR A;  4B8X A;  4TV7 A;  2P5K A;  2BE5 F;  4MHG A;  2FU4 A;  2HS5 A;  2XAH A;  4XLP F;  4A0X A;  1YS7 A;  2B0L A;  1TNT A;  2XGX A;  3IWZ A;  1C0W A;  5LHI A;  1HW2 A;  1I27 A;  1FT9 A;  1X3U A;  3O2P E;  3TDU C;  2QQA A;  3VB2 A;  1KYW A;  2PN6 A;  2LNB A;  2W25 A;  2RKH A;  2DBB A;  1WSU A;  4HDU A;  1QBJ A;  3QU3 A;  1D8K A;  4LMY A;  1QGP A;  2QUF A;  5DD8 A;  1RUO A;  3MZY A;  3WE2 A;  1FY7 A;  5BQT A;  1I1S A;  5E1X A;  3HSF A;  2PI0 A;  2HZT A;  4XBF A;  3SHF A;  1DPR A;  1O3T A;  2STW A;  2D1H A;  1OPC A;  3ZMU A;  1B9M A;  2E7X A;  3V8K A;  1IXS B;  1IF1 A;  2ZFW A;  1E2X A;  3WTS C;  2VOD A;  2FSW A;  1T98 A;  2QBY A;  2VE9 A;  1TQP A;  2PMH A;  3GLX A;  1BI3 A;  3PFI A;  2O3F A;  1IW7 F;  3KFW X;  3VOE A;  1ONV A;  2OZ6 A;  2LKP A;  4U7B A;  3WTU C;  4FX0 A;  1Z7U A;  2CGP A;  3WOD F;  2NYX A;  3QPH A;  3ZMS A;  2EWN A;  1HKQ A;  2O61 A;  2EA4 A;  1REP C;  2XVC A;  4A6E A;  2HOE A;  3RYR A;  1YW8 A;  2MLG A;  2AXL A;  3U1D A;  1KQ0 A;  2VOP A;  4XLN F;  5F1R A;  4BQA A;  3TO9 A;  5D5X B;  4EJV A;  5JHU A;  5E20 A;  4KNY A;  3KP3 A;  1PDN C;  5ILU A;  1MGT A;  2HQR A;  5D5U B;  1MJB A;  3RPU A;  2EV5 A;  2Z99 A;  4JQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...