1FYLA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head-to-head orientation
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
85
Chain Sequence
RPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAD-TO-HEAD HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 23
structure length 85
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fylA00
4MTEA 2QM3A 1VTNC 2X4HA 1S29A 2RQPA 2ESHA 1ZG1A 2GAUA 2HGCA 3E6DA 3G3ZA 5HLHA 1B9NA 3LQQA 4QWQA 3V8LA 4L9VA 5HS7A 5KK1A 3KP7A 3HHHA 1XGMA 3WGGA 3FX3A 4LLLA 3EDPA 4LFUA 4HV6A 4JK1X 5LHIA 4L9NA 4F7ZA 2ADUA 4FT8A 4RGRA 4G8XA 2CFXA 3BPVA 2ZMEA 4XBFA 1J9IA 1MJ9A 2VODA 4YFKF 3BDDA 3WTSC 5DUKA 3RPUA 1G3YA 2QUFA 3IRRA 3ZMZA 3W6JB 1KU7A 1FY7A 2RVCA 3N4MA 4IF4A 2ISYA 2ZXJA 4M9ZA 4RGXA 3WTVC 5D5VB 1Q1HA 4IPAA 4EJUA 5KVRA 3FXUA 4LMYA 3J80K 5BS6A 2LF7A 3ABTA 4G7HF 5D4RA 2STWA 4MGRA 4YFNF 1HW2A 2ZMEB 2F5FA 3B02A 2L3DA 4OOIA 3MCZA 2XUBA 3P7NA 1R5GA 1IF1A 4N9IA 4M74A 4BHPA 3WG9A 2VC0A 3FZVA 2EFPA 5LRSA 1YG2A 3GLXA 3PFIA 1B59A 1YS6A 5DD4A 1XDUA 3TKYA 3L9FA 2GQQA 5E18F 2P7VB 3KP5A 1TQMA 4G7ZF 2GA2A 1I27A 1REPC 1FBQA 2PMUA 3J81Z 3E5QA 2Z33A 4OIRF 3KETA 3ML6A 1SD7A 6PAXA 3ZN1A 4RB0A 2PEXA 3H3ZA 4BHCA 2DI3A 3FMSA 5FD6A 1DUXC 3EYYA 1YYVA 1P4AA 4KYWA 3DPLC 2P6SA 2EA2A 5ICCA 3DFGA 1FZPB 1R58A 2MLGA 3TO9A 1LEBA 4A0YA 3F8BA 3IL2A 2DQRA 2OQGA 3WU1B 5D8KB 2Z5UA 2UZKA 2VT2A 3WODF 4D0PA 2G7UA 3GYHX 3DEUA 2QBYA 4I01A 4EJOA 4HX8A 1JE8A 2VE9A 3WTUC 5DUIA 2BV6A 4HF0A 2H6BA 3SZPA 3EETA 4ESJA 4A12A 1B1BA 5E1WA 4LLGF 3V8JA 3AAFA 3REOA 2O3FA 2CGPA 3FM3A 2DLLA 2XKOA 3FM5A 4HLYA 1IN4A 1XSDA 2ZNYA 3VEPA 4EM1A 2XGXA 2DU9A 2OU2A 1YTYA 3JW4A 1HSJA 1U8RA 3I64A 5CVUA 3MFKA 3HIFA 1J0RA 4LG0B 1TLHB 1K6OA 4Q47A 4ENJA 1J5YA 1G3TA 2VONA 2D1VA 2OA4A 1QBJA 1SD6A 2HTJA 1YO5C 3U1DA 3QP5A 1QNTA 5HDKA 1OR7A 3JAMK 4KNYA 1BBYA 1QZYA 3QPHA 4L9JA 4PCQA 2A07F 1IAWA 2QZ8A 4HOBA 1LDKB 3QPTA 1EH6A 1XD7A 1FBUA 4JQFA 1JXSA 2XRNA 3V4GA 1U78A 3TDUC 3IC7A 4KA4A 1DP7P 1LEAA 3Q5FA 5LLQA 4XLPF 2BGCA 1KYZA 2OD5A 2FU4A 5L3FA 4HX4A 2Z9OA 1IXSB 1YS7A 5JR3A 2RV8A 1W5TA 3HTUA 1KU3A 2GZWA 1P4XA 1W5SA 3K9TA 3CUOA 3SXYA 2DPUA 2XAHA 3KFWX 2RC4A 2DW4A 4EJWA 1BM9A 2VOOA 1R5HA 1Z6RA 4BYYA 3MWMA 2KRFA 3MZYA 4WF2A 4UHTA 3D5LA 1ON2A 5A2QK 3LAJA 2DK5A 3E5UA 1ZYRF 2YPRA 1G6NA 1EH7A 1IW7F 5LBQA 2Z99A 2JSCA 2O03A 3LQRA 3K1NA 2BBYA 2HQNA 2F5EA 2LDUA 1GXPA 3WTWC 3BP8A 3GEZA 3R6SA 4WX9A 3U2RA 4LK0F 3ZMTA 2K4JA 1ON1A 4HBLA 4M73A 5E1XA 4EGYA 2L4AA 2QLZA 2IPQX 4CZZA 1Z1DA 4LB5A 4E70A 4RAYA 1CF7A 2E7WA 4N9HA 2J5OA 3EQLF 5F1RA 2Y75A 1HKTA 2WWYA 1T38A 3HSEA 2DPDA 3FMRA 2XASA 1T39A 2M87A 2XAQA 2W84A 4HLXA 1OPCA 1YW8A 3FMQA 2DK8A 4FX4A 2D45A 4KIGA 1HKQA 3Q9VA 3CO6C 2HOEA 1FC3A 3QRFF 4HV5A 4I0BA 4WK8F 3K1PA 5E1ZB 1O3TA 4MQ9F 4KFCA 2XKPA 2R7FA 4MQVA 1R1UA 1SAXA 1KYWA 3V7SA 2P8TA 2FE3A 4M6XA 5DD8A 1TNSA 4HQMA 2O6GE 1YFHA 1PUEE 1V3FA 2HQRA 5ICEA 4I2OA 4L0YB 1U5TB 3KZYA 2VC1A 1BC7C 1IRGA 5BPIA 2GXBA 3BWGA 2FQ3A 3WE3A 4ESFA 2R7DA 2MLKA 1R7JA 4IHSA 2GWRA 4I02A 5DEQA 1FNNA 2Q8KA 5D8LB 4HX7A 5L3CA 5FO5A 5H6RA 2NS0A 3LA3A 5CLSA 1E17A 1UB9A 1XGOA 4XSXF 2RGVA 1O3RA 5IT3A 4YFXF 4HYEA 4UXNA 4R8HA 2IW5A 4K2EA 4U88A 2YX7A 5JFRA 4ETSA 2Q2EA 4WXCA 4B8XA 3COAC 4A6DA 4PGHA 2IA1A 1CGPA 5EEHA 1BI1A 1IZ1A 1FWZA 1FT9A 4ASNA 1SD4A 2G9WA 4I98B 4HW0A 2HZTA 1WSUA 4FX0A 3B73A 4ZYGA 2VBWA 4UNOA 3J7AO 3BROA 1V4RA 5F6FA 5D4SA 1IXRC 1FYLA 4ON0A 2XAGA 1FOKA 1G3WA 2FBKA 3GW2A 4EJVA 1IN6A 3J81K 3ZMDA 1T6SA 3GX4X 5LHHA 3IWZA 3R4KA 1FLIA 5FGMA 1YQAA 3F3XA 3WE2A 3L00A 1BI2A 5E20A 4A5NA 4ZYHA 4RAZA 2A5YB 3I5UA 1SD5A 4ENKA 1FSHA 1O3QA 2KIMA 5J6XA 2QQ9A 4OIOF 4ZYDA 1FBSA 2A6EF 2FRHA 4RGSA 3SQNA 5K1YA 2KJCA 1ZN2A 4G7OF 4WWCA 2M45A 5E8IA 1KU9A 1LNWA 3ZMVA 5K5QA 2F5DA 3I54A 1TBXA 3CJNA 3RPQA 1P92A 5D5XB 2VBZA 3TO7A 4WCGA 1XCVA 3M8EA 1P6RA 1A04A 2PJPA 2CSOA 1UHWA 1SMYF 2QENA 3T5XA 3GFLA 5DCMB 3F8FA 1WRJA 3I71A 4P5OA 1LJ9A 2CG4A 4HA8A 1WKMA 1ZARA 1HXDA 1TTYA 2EA4A 5HOOA 4KICA 4DNCA 1S8NA 3M9AA 3BPXA 2KJBA 1PP8F 3C18A 2VOPA 3RKYA 2FNAA 2BYVE 2CQKA 2XROA 2P6TA 4N0BA 2RN7A 3IKTA 2GXGA 1JGSA 5DYMA 1RI7A 3CUQB 3F72A 4RB1A 2UXNA 3PQKA 3KP6A 2JPBA 2DTRA 2WV0A 4ZZDA 5ICGA 2NRAC 2FMYA 1KQ9A 5FLXZ 4L0ZB 1U6GA 4LGWA 3VOEA 2RDPA 1DPUA 1S7OA 5TJJA 2L02A 4KT5C 4XRFA 1K79A 2V1UA 5HDGA 5FB2A 1R36A 2A61A 1MD0A 3KE2A 5FD5A 1MJBA 2V79A 4YG2F 3LFKA 3E6MA 1Z05A 4ESBA 3O3KA 3V8KA 3ZP5A 4LG0A 1O7FA 3M8FA 5JHUA 2FMLA 1D8KA 2H94A 4HZFA 3LWFA 5HLGA 3GZ6A 1ZH5A 1HSTA 3I4PA 4KUMA 3C1DA 4ZYEA 1WQ2A 4RS8A 5FFZA 2OBPA 3DKWA 2CW0F 1MJAA 3WTTC 3CDHA 4S05A 2V9VA 2Z3YA 1UHMA 2TDXA 2NNYA 2A3SA 1K7AA 3R60A 3IRQA 4B09A 4L18B 4Y15A 1QO0D 2P5LC 1YIOA 3R0JA 3FF5A 2DQLA 2FNPA 3MQ0A 1YW7A 5TRDA 4GYGA 5EEGA 5CVVA 2OQRA 5CVIA 1SFUA 1KQ0A 1HW5A 4R79A 3GXOA 2VBXA 3NRVA 1SMTA 4A6EA 3F22A 3KP2A 3HSFA 4GYIA 1TW3A 3OOPA 2FF4A 1ZRFA 2HKOA 1HQCA 3KP3A 2O8XA 5CVRA 2EV6A 3F8CA 1F1ZA 1MZBA 2PMHA 5HVQC 1YLFA 2HFHA 3QP6A 2RKHA 3EYIA 3RI4A 1D3YA 4HDVA 3CLOA 1TQPA 2A68F 1IN8A 3L09A 3ZMUA 1ZRDA 5D5WB 1U3EM 1RNLA 1USTA 2QYOA 1IN5A 5D6EA 3TGNA 1QQIA 3HSRA 3DV8A 1B9MA 3VODA 3LSTA 5BPDA 3HUGA 1Z9CA 2BE5F 1ZREA 5LGNA 2ISZA 1RUOA 3RTRA 1XGNA 3TO6A 4TV7A 2QWWA 4RB3C 3SHFA 3CUQC 4MEYF 4GO1A 1W7PB 4KIFA 1TNTA 2LNBA 3M1EA 5IT9K 5K5OA 1I6XA 2XAJA 2XVCA 2VT3A 2V1DA 3ERED 1FYKA 4P55A 2OZUA 4OMYA 1FP2A 2HDCA 5LGTA 4IVNA 1HKSA 5ICFA 3RIRA 3WTXC 1ZHFA 2JRTA 2E7XA 2H09A 2EB7A 1JHHA 3SFZA 3HRSA 5LHGA 2G7HA 3K2ZA 2ZFWA 4M72A 3RJPA 1BI0A 1KGSA 2XAFA 2IRFG 4L5IA 5D6FA 1BIAA 4EGZA 3KEOA 2H6CA 5L3DA 1BOAA 3RKXA 1R22A 3LAPA 2K7LA 3HOTA 3HOSA 3D0SA 3HYIA 4R1HA 5HLIA 1RUNA 5HS8A 1U5TA 2ZJ2A 4LLNA 3OV8A 2DBBA 2M8EA 1S6LA 4LK1F 1AOYA 3Q9SA 3JAMZ 4YIIA 4IJAA 2XV4S 4AD9A 2M30A 1YW9A 3ECOA 3MEXA 3G73A 2E1NA 2PN6A 2YU3A 2OZ6A 2EFQA 1T0FA 2V6CA 4YIFA 2IJLA 2IA0A 1FSEA 4UVCA 3HTSB 2L54A 2ZNZA 1JHFA 4EM2A 3TQNA 2M1BA 5AONA 4CO8A 2X0LA 3F8MA 1QGPA 1ZRCA 3GFIA 3HRMA 4EVIA 3KCCA 2PBIA 3KZZA 3GF2A 1ZLJA 1L0OC 1Y0UA 3WTZA 4MHGA 4BHBA 2HYGD 4DQ2A 1S7AA 3H3UA 1NHAA 2A6HF 1I1SA 1T98A 4G9YA 1R23A 2LKPA 2VBYA 3WGHA 2EFWA 4RB2C 3ZQ7A 4LD5A 2K02A 4O3MA 3C3WA 3U9GA 3H92A 5J8CA 3HRUA 2ESNA 4KN7X 4M9SA 2D2WA 1IRFA 4P96A 3HHGA 4L9TA 4UVBA 1BC8C 4LB6B 1XDSA 1O7LA 3BOQA 4ZZLA 2J5PA 4Z2YA 4IXAA 3GO5A 3JTGA 3KLNA 2WTEA 2P5KA 4QLCU 2VXZA 3S2WA 1KU2A 2EV0A 2P7CB 3I59B 4OMZA 3K0LA 4S04A 1STZA 1K78B 4JBAA 3F8NA 3DXJF 4U0WA 5FLXK 2A69F 4O6JA 2IP2A 2F5CA 1ZGJA 4AIHA 3GZ5A 2JZYA 3IWFA 2Q0OA 4U7DA 1RZ4A 2MD5A 2ZKZA 4ENNA 2K86A 2OAZA 2DFIA 3EUHA 3FXRA 1TQIA 1XSVA 3E3VA 1L3LA 2COMA 3NEUA 5DCMA 4EMSA 4U7BA 4HDUA 4CICA 4OU0A 1LDJA 5DCFA 1P4WA 4A5MA 3LA2A 2YX4A 5LGUA 3BJ6A 5FFXA 1UCRA 1ZG3A 1LQ1A 1USSA 1MGTA 1T2KA 3R61A 2Y48A 4I0AA 5HDNA 1OYIA 5AIQA 3JSOA 1XMKA 3V7CA 2MBFA 4OINF 4RGUA 3CUQA 3I53A 3RYRA 2R3SA 1GXQA 1GHCA 5H6QA 3TOBA 3SZTA 4A0ZA 2GIVA 3R0AA 1I5ZA 2EWNA 3VB2A 2K27A 3ECHA 3FWEA 1X3UA 4Q48A 1IN7A 1J7KA 1QZZA 2PI0A 4G94A 5F64A 5J8FA 5L3BA 3E5XA 1Z7UA 2RNJA 4KIBA 3I58A 1PP7U 2KKOA 3KP4A 4U0VA 1U5TC 2NNNA 4OIPF 2B0LA 1ULYA 2EFNA 3GFJA 2QQBA 3RYPA 3ROUA 1P2FA 1HBXG 3E97A 4M6YA 3RDIA 1PDNC 5LEJA 2NYXA 3JSPA 2H27A 4GCVA 3BY6A 5LEKA 5DV5A 3WTYC 2EK5A 3E6CC 1XN7A 2PQ8A 3CTAA 1IXCA 3W6KB 2FXAA 3K1MA 3BZ6A 3PQJA 1ZLKA 2FA5A 2HTSA 2E1CA 5CVJA 4Q5SF 1KQ8A 2LSOA 5JI6A 4P9UA 3HRTA 2MH2A 3F6VA 2O61A 3O2PE 1R1TA 4KDPA 5H20A 1OMIA 2ZO4A 1XSXA 2KIUA 4IRIA 3KEQA 2C6YA 2D1HA 5ERIA 2ZCWA 1I1GA 2FOKA 3ZN0A 4HAMA 1XMAA 4PDKA 4WXDA 4M71A 4U0YA 2ACJA 1J2XA 4G6DA 1XB4A 1J75A 2W25A 2EV5A 4GXOA 2EJRA 2DAOA 1FX7A 2HS5A 3O6BB 3I0TA 4MEXF 1H9GA 4HQEA 1F9NA 1R1VA 1B6AA 3MZHA 2QVOA 1BIBA 4GGGA 5K5RA 4L5JA 4KMFA 2CO5A 3WU0A 1O3SA 4EQQA 1OKRA 1XGSA 3DF8A 1E2XA 4XSZF 1H9TA 3IHUA 1C0WA 3J80Z 3WGIA 1AWCA 4P9FA 4AVPA 2HEOA 5JVTA 4CXFA 2F2EA 2IA2A 4AIKA 4CDGA 4Y17A 2V1XA 1ZAOA 2LF8A 2PLYA 1FP1D 2QBYB 2YSRA 2M5WA 3F23A 4ENMA 1G3SA 2VN2A 2UXXA 1W7PD 3NQOA 4HF2A 3T1BA 4OIQF 1W7PA 2BEOA 3ULQB 2EFOA 4O5VA 1FPQA 1EH8A 1ODDA 3K69A 4BNCA 5BMZA 2WC2A 3DQVC 2CYYA 1WWXA 2L4MA 2JPCA 2CWEA 1DDNA 3ABUA 4WXHA 2ELHA 2JTVA 3ZMSA 2L01A 5CYVA 4ZH4F 3QAHA 2W85A 3QU6A 3T0YA 5AIPA 3P9IA 4PZJA 5LRRA 1EV7A 2QQAA 1D5VA 2KIFA 3VFZA 1H0MA 4BAYA 3TOAA 3BJOA 3M7GA 1D8JA 4G6QA 3LA7A 1TW2A 1MDMA 3KLOA 4UUVA 2NAZA 1BN5A 2FEZA 3T8RA 3GUDA 1Z6TA 3DPTA 4BH9A 3QOPA 1G4DA 3P9CA 2W24A 4AIJA 4I09A 4CYDA 4I7HA 1MKMA 4H0EA 1SFXA 3TDZC 1RIOH 4UVAA 4NQWA 5BQTA 3IKVA 1QPMA 2HWVA 3L2CA 2XHKA 3RKWA 3CO7C 2HKXA 5D5UB 2MC3A 4MTDA 3V7RA 2FBIA 4KN4X 4CGZA 4XLNF 2FSWA 4IRGA 3GFMA 1Z91A 2IT0A 4NHJA 1MDMB 1LB2A 1GVJA 5HS9A 1O57A 5ILVA 1B4AA 3FHZA 3QU3A 4UV9A 4Y13A 4UV8A 3P9KA 1IUYA 2K4BA 2JT1A 2UWMA 1ZGAA 4CHUA 3T8TA 3F6OA 2PG4A 5CJ9A 4LJZF 1OYYA 1R00A 3L7WA 5DDGA 3MAJA 1ONVA 2GA1A 5ED4A 3N97A 1FYMA 1BI3A 2VE8A 5BOXA 2W57A 2DO7A 2MA3A 2O0YA 4Q4ZF 1S3JA 3ELKA 1HW1A 4IHTA 5ILSA 1OYWA 1DPRA 2Y0MA 1W4MA 5ILUA 2DT5A 4A0XA 1CF7B 4PGGA 1KA8A 1UFMA 4EV0A 5L3GA 1U2WA 5E17F 4MNUA 4HF1A 2HR3A 3E6BA 3BJAA 4A2UA 1F5TA 1WI9A 3GWZA 2AS5F 2STTA 2FBHA 4AWXB 3I59A 4KMUX 1SFEA 2ETHA 5IT9Z 1LVAA 1K78A 2YR2A 4M9XA 3GVAA 2XIGA 5A2QZ 1BJAA 1F4KA 2P4WA 4NB5A 4BQAA 5E8GA 2ZBKA 3DP7A 1LDDA 4EM0B 3F21A 3JTHA 1J59A 2AXLA 4IRHA 2PFBA 3ZPLA 1XCBA 4EJTA 2IVMA 4FHTA 5L3EA 1ZG5A 3C7JA 3FXQA 2HYFA 2P5VA 4BXUA 2MH9A 3ISPA
chains in the Genus database with same CATH superfamily
2B7EA 3CQZJ 3GTGJ 2HQAA 4MTEA 3QWLA 2QM3A 3HOXJ 1RESA 1LFPA 1VTNC 2X4HA 1YJ9I 2IGOA 1S29A 2RQPA 4NC8A 1MMDA 1EJ9A 3D1NI 2ESHA 1ZG1A 1U0JA 2GAUA 2HGCA 3C2HA 2WA0A 1ZTRA 3E6DA 2MG4A 3H9GA 3LSKA 4MO7A 2OTJI 3G3ZA 5HLHA 1B9NA 2X6OA 3LQQA 4QWQA 3V8LA 1IUFA 4L9VA 5HS7A 1QRYA 5KK1A 5GTIC 3KP7A 3HHHA 1XGMA 2Q2EB 3WGGA 5M5WJ 3FX3A 3QODA 3OS1A 2OCEA 4LLLA 3JRFA 2BHZA 1ORKA 1D0ZA 3EDPA 4LFUA 5K7HA 4PJNA 4HV6A 4A3FJ 2EZKA 4BQOA 4IHYA 4BQNA 1YITI 4JK1X 2EINH 1IV6A 3CMYA 2VUMJ 2A6TA 4C3JJ 3MKZA 1VQ5I 2HOTA 5LHIA 2XGEA 1OFCX 4L9NA 3A0HC 4F7ZA 2ADUA 4FT8A 3GZNB 2BVLA 4RGRA 4G8XA 2CFXA 3BPVA 4C2TA 2ZMEA 3K7AJ 4XBFA 5F0HA 1J9IA 1W0UA 1MJ9A 1WHUA 4BDYA 2JA6J 2VODA 2IGNA 2N8GA 3RPUD 4YFKF 1X1DA 3BT9A 3BDDA 3WTSC 1W36C 5DUKA 3RPUA 3DWLE 1Z3XA 1WJAA 3KYCB 1G3YA 3DTKA 1JTXA 2JSPA 2QUFA 3B6AA 3IRRA 3ZMZA 1FMVA 3W6JB 1CQTA 2XF6A 3L2UA 1Y56A 1KU7A 1FY7A 5CQEA 2IXSA 3GBGA 5IP6A 2RVCA 2P81A 3N4MA 2MFZA 4I76A 4OAYA 1GV5A 4PFOA 2EILH 4IF4A 5GPCA 2ISYA 2ZXJA 3VYRB 4M9ZA 4MIMA 2DA4A 4RGXA 4B4CA 4ANJA 5F27A 3WTVC 5D5VB 1X19A 5FLVA 3CC7I 1Q1HA 4IPAA 4EJUA 5KVRA 4M3DA 3FXUA 4HG2A 4LMYA 3J80K 1IJWC 5BS6A 2LF7A 4BBSJ 3ABTA 2QEXI 4G7HF 5D4RA 3DTIA 1YRNA 4V2GA 2STWA 2ECBA 2M3AA 4MGRA 4YFNF 1HW2A 2ZMEB 2F5FA 3PNVA 1IC8A 2FX0A 4BBRJ 3KEYA 3B02A 3Q3SA 2L3DA 3A4CA 4OOIA 3MCZA 2XUBA 3GMEA 3P7NA 1R5GA 3SYTA 3E7LA 1IF1A 3UKGA 3A01B 4N9IA 2X1EA 2XSDC 4M74A 1U9OA 4BHPA 3WG9A 2OJED 2VC0A 3FZVA 2QGUA 4QIWN 2PJRB 4XRMA 2LY1A 2EFPA 5LRSA 1R71A 1YG2A 3GLXA 2M0CA 1B59A 3PFIA 2HZDA 1YS6A 3C2GA 3TP3A 2EBIA 5DD4A 1XDUA 3TKYA 1JT0A 3S3OA 3L9FA 2GQQA 5EYRA 5E18F 1RPWA 4D5FA 1AKHA 2LOOA 2KQRA 4E4HA 1V54H 4CYCB 2VKHA 4FTHA 2P7VB 3KP5A 1TQMA 2E5NA 4G7ZF 3RZOJ 2ME0A 2ELKA 2VJ5A 1JUPA 2K9SA 2GA2A 1I27A 2OUMA 1REPC 4XKBA 1FBQA 2PMUA 3J81Z 1EA3A 4OWRB 3E5QA 3ZQQA 3CCYA 2HDWA 3I3LA 4OIRF 2Z33A 3S16J 3KETA 1H88C 3ML6A 1SD7A 2VJ4A 4E7IA 1UJ8A 1MNEA 2I8DA 6PAXA 3ZN1A 1X3WB 2ID6A 2PEXA 3H3ZA 4RB0A 4BHCA 2DI3A 4Y4RA 3FMSA 5FD6A 2MW8A 1VFCA 1DUXC 4ITVA 2HVRA 3EYYA 4BY7J 1YYVA 1P4AA 4KYWA 3DPLC 1VQLI 4II2A 5FROA 1Y39A 2CV2A 2P6SA 2EA2A 2LYCA 2XRLA 5ICCA 4EATA 3DFGA 1R49A 1FZPB 1R58A 2MLGA 3TO9A 1LEBA 4A0YA 2QA4I 3G1OA 3F8BA 3IL2A 2DQRA 2OQGA 3WU1B 3OYKA 5D8KB 2Z5UA 2UZKA 2VT2A 3WODF 1FJLA 3GTMJ 4IL6C 4D0PA 1WPKA 2G7UA 1MMAA 2JMWA 3GYHX 3CMEI 3DEUA 4E7JA 2JVGA 2QBYA 4I01A 2R5ZB 1D1AA 4EJOA 4HX8A 1JE8A 2VE9A 3WTUC 5DUIA 2BV6A 4HF0A 3VYSB 2H6BA 3SZPA 3EETA 3JRAA 3SZGA 4ESJA 3CESA 3DU6A 4A12A 5HNHA 1S9HA 1B1BA 5E1WA 2WAFA 4LIUA 4LLGF 5EJCA 3V8JA 3AAFA 3OWTA 3REOA 2O3FA 2CGPA 3FM3A 1UG2A 2F5VA 1XG1A 2DLLA 2O7OA 2XKOA 3AG3H 3W3CA 3LSJA 1BL0A 1A6QA 3CLQA 3IH4A 4GFBA 1RC9A 3VPRA 1PJRA 5LD2C 3FM5A 4HLYA 1IN4A 1XSDA 2ZNYA 2L7MP 3IP4B 3VEPA 4EM1A 2GXAA 2HDDA 2XGXA 2DU9A 2OU2A 3TBIA 1YTYA 1Y8QB 1UHSA 3JW4A 1HSJA 1Y0NA 1U8RA 2JJ7A 2L7ZA 2XDVA 1MMSA 1Y1VJ 4CCKA 3S1QJ 2BZTA 1JJ8C 1ETVA 1Q1VA 2DMUA 1GDTA 3I64A 5CVUA 3MFKA 2D5VA 3HIFA 1V5EA 1SC7A 1J0RA 3LFUA 4LG0B 4ZYAA 4QSHA 1TLHB 1K6OA 2XAUA 4Q47A 1P7JA 2VKEA 4ENJA 2JA7J 3BG6A 1J5YA 1G3TA 3PO2J 2VONA 2LVSA 2D1VA 3I55I 2ZXWH 2OA4A 3A0BC 2HQ5A 1QBJA 1SD6A 5EF6A 2HTJA 1YO5C 3U1DA 3QP5A 2ICWG 2LRDA 2ECCA 2O9LA 5B66C 1QNTA 5HDKA 1OR7A 3JAMK 4KNYA 5C3EJ 2Y30A 4UY8I 1PYVA 1BBYA 1QZYA 3TEDA 3OYAA 3QPHA 4L9JA 3CMMA 4PCQA 4XKWA 3OYCA 5E3MA 2A07F 3OYGA 1IAWA 2QZ8A 4HOBA 1LDKB 5J1RA 3QPTA 1EH6A 1XD7A 1FBUA 5M5XJ 4JQFA 2VLAA 1JXSA 1V55H 2XF5A 1ETXA 2XRNA 4IO9F 3V4GA 1U78A 2V9PA 3JRHA 3TDUC 3IC7A 3QPSA 4M3BA 3G2BA 4KA4A 1X2NA 1H8AC 2VI6A 4V2FA 1R6RA 2Y2ZA 3DU5A 1S72I 1LEAA 2ZMEC 4DW6A 1DP7P 3Q5FA 2XB5A 5LLQA 2H1KA 1G59A 2R7RA 4E7HA 1POGA 1TWCJ 4G12A 4XLPF 3AL0B 1SANA 2BGCA 2AQEA 2DA5A 1KYZA 2OD5A 2FU4A 5L3FA 2CUZA 4HX4A 4HSTA 2Z9OA 3BCBA 1IXSB 1YS7A 5JR3A 2CQXA 2RV8A 1W5TA 3MMYB 1WJEA 1MBFA 3HTUA 4Y7NJ 4ZDOA 1KU3A 2GZWA 5J3LA 1P4XA 1W5SA 3K9TA 1NG6A 3E0JB 3CUOA 2KZGA 3PIOF 5M3FJ 3SXYA 1QPIA 2DPUA 1E0EA 2QQ8A 2HVSA 2XAHA 3CMAI 3KFWX 2ZXIA 5E3NA 3JREA 2RC4A 2DW4A 1MSFC 3HPGA 3K6GA 2PX9A 3S2DJ 4EJWA 2R92J 1BM9A 4A3BJ 2BXZA 2VOOA 4BU2A 4AYBA 1ZQ3P 1R5HA 2DT7B 4L5EA 3BR0A 4X1EA 1Z6RA 2DA6A 2PMZA 4BYYA 3MWMA 2KRFA 1HLVA 3MZYA 1HF0A 3A03A 4HEA2 4RLQA 4WF2A 4UHTA 2R93J 3OR1C 3D5LA 1ON2A 2LBFA 1W36D 4UUSA 4RA2A 5A2QK 3BTLA 3LAJA 2WY8Q 1N77A 3ZQLA 2DK5A 4IOAF 4PK4A 3M07A 3E5UA 1SEUA 3ZQIA 4DIQA 2KFDA 1ZYRF 2YPRA 1G6NA 1EH7A 2F4MB 2M0MA 1IW7F 1ETWA 2VKDA 3X2QH 5LBQA 5DS9A 2Z99A 2JSCA 3SEZA 2NVUB 3J7AY 2O03A 3LQRA 3K1NA 3TW7A 4W1UA 1Z67A 3BG3A 1GLNA 3IH3A 2BBYA 2HQNA 3HUGB 2X1DA 2F5EA 2LDUA 1GXPA 3WTWC 3BP8A 2V9KA 3DBLB 3GEZA 3OSFA 3R6SA 3HOWJ 4XICA 4WX9A 1Y1WJ 3FXMA 3U2RA 4LK0F 3H1CA 4HBLA 2K4JA 1ON1A 3K2AA 4M73A 5E1XA 3ZMTA 5CKTA 2BY2A 1SFOJ 4CUGA 4EGYA 2L4AA 2QLZA 2IPQX 1BA5A 2X6WA 1ENHA 5IP9J 4XLHA 4CZZA 1Z1DA 3HZJA 4LB5A 3H36A 1FOWA 1XC5A 4E70A 3D5SC 4RAYA 5EZHA 4IOCF 2DTZA 2CUEA 1CF7A 2E7WA 4N9HA 2J5OA 3FXOA 3EQLF 4BJ6C 5F1RA 2Y75A 1HKTA 1WCMJ 2WWYA 1T38A 3PUBA 3BTJA 3KIOA 3HSEA 2DPDA 3FMRA 2XASA 1T39A 4BJ5C 2M87A 2XAQA 2W84A 2IBDA 4HLXA 1OPCA 4CCJA 4LIVA 3JRIA 1RRJA 1NK3P 1YW8A 2XPUA 3HOYJ 1E3PA 3QOEA 3CF5F 3FMQA 2DK8A 4XKCA 4FX4A 2D45A 4KIGA 1HKQA 2F6CA 3I4MJ 1FOYA 3Q9VA 3CO6C 2HOEA 1FC3A 3QRFF 2LTPA 3Q0UA 2DA1A 1WZ2A 1G2HA 4HV5A 4I0BA 2CUJA 4B3AA 4WK8F 2KT0A 3K1PA 4ZJZA 1IDYA 5E1ZB 1O3TA 2ELJA 3IV5A 2E71A 3UNGC 1P9QC 4MQ9F 5K7ZA 1F36A 4RDUA 2KISA 4A3EJ 2ZFUA 4AC0A 4KFCA 2XKPA 2DODA 2K3FA 1VI0A 2R7FA 2L9SA 4MQVA 1R1UA 1SAXA 4JX4A 1KYWA 3V7SA 4EEFG 4BQQA 2AQFA 1XMXA 3DTEA 2P8TA 2FE3A 3GCMA 4M6XA 5DD8A 1JTYA 1TNSA 1T33A 3HOVJ 4HQMA 4M3FA 1YIJI 2VPRA 2X9DA 2XGCA 2CW8A 2O6GE 1YFHA 1PUEE 1V3FA 2HQRA 4HSRA 1TWAJ 5ICEA 4I2OA 2BOLA 3S17J 4L0YB 1U5TB 2MD0A 3K4BA 3KZYA 3LSIA 3LSMA 2VC1A 3FXLA 1BC7C 1IRGA 5BPIA 2GXBA 1PUFB 4F55A 2GM4A 5EGOA 3QYBA 3GTKJ 3BWGA 2FQ3A 2L7KA 3WE3A 4ESFA 1IV8A 1D5YA 2R7DA 5HNFA 2BW3A 3S15J 2MLKA 2QCOA 1R7JA 4IHSA 2GWRA 3ZXSA 4I02A 5DEQA 2B9SA 5FRNA 4P1WA 2IS4A 1FNNA 3HXLA 2HPIA 2Q8KA 5D8LB 4HX7A 1WH5A 5L3CA 4I6ZA 3BCAA 5FO5A 5H6RA 4IQJA 2NS0A 2DCEA 4M3EA 3CP2A 3LA3A 5CQGA 3HL2A 5CLSA 2A5WA 3K4NA 1QHGA 5TGTA 1E17A 1UB9A 1XGOA 4XSXF 2RGVA 1O3RA 1TWHJ 5IT3A 4YFXF 4HYEA 4UXNA 4R8HA 2NS8A 2IW5A 4K2EA 4U88A 2YX7A 5JFRA 2Y0SA 4ETSA 3OYIA 2WB1A 1WVRA 2Q2EA 4B48A 4WXCA 1QZEA 4B8XA 1LUJB 3BG5A 3COAC 3G1MA 1X4PA 4A6DA 4PGHA 2IA1A 1MBGA 3K70D 1CGPA 1WJBA 2WV1A 5EEHA 1BI1A 1IZ1A 1FWZA 1FT9A 4ASNA 4AU7A 3ZQFA 4AVZA 1SD4A 2G9WA 4I98B 3FDYA 3BR3A 2HVQA 4HW0A 2HZTA 1WSUA 3ZRGA 4FX0A 3B73A 4ZYGA 3K4JA 4D9JA 2VBWA 4UNOA 3J7AO 2MGQA 1ETQA 4BEHB 3BROA 2O5RA 1V4RA 5F6FA 5D4SA 3GTQJ 2R7UA 1RR7A 3DBRB 1IXRC 2KRCA 1FYLA 4N4OB 4ON0A 2XAGA 1FOKA 1G3WA 2HNHA 4DJAA 3LSPA 2IS6A 2HOAA 1E3HA 2FBKA 3GW2A 4EJVA 4J00A 1IN6A 2R5YB 3J81K 3ABMH 2LFBA 3ZMDA 5JLWA 2R7XA 1T6SA 3GX4X 5EDNA 4JP0A 1A6IA 5LHHA 4BE2A 3IWZA 3R4KA 1ZR4A 1FLIA 5FGMA 4NNJA 1YQAA 3F3XA 3QPLA 1TT5B 3WE2A 1K6YA 1BW6A 3L00A 1BI2A 2JWTA 5E20A 4YIRX 3SFIA 1OCZH 2AHQA 2E2HJ 4A5NA 4ZYHA 4RAZA 2EZHA 1X1BA 2A5YB 2ID3A 3I5UA 1SD5A 4ENKA 4AUXA 5FLMJ 3OS2A 1ACIA 1FSHA 2JA8J 1O3QA 1DU0A 2KIMA 4NUBA 5J6XA 4DBQA 2QQ9A 2CQ7A 3L2WA 4OIOF 4ZYDA 1DP3A 3PL8A 1FBSA 3S32A 3OYNA 2A6EF 2FRHA 1B72B 3IAS2 4RGSA 5B3SH 1QHHD 2ZJRF 1OCRH 4CCNA 3OL3A 3SQNA 5GPAA 5K1YA 1ETOA 3A01A 4BJTA 2KJCA 2L9NA 1ZN2A 4G7OF 3H9JA 4MFEA 2PJRA 4WWCA 5J4YA 3U1KA 1BR4A 2M45A 5E8IA 1KU9A 1IGNA 1LNWA 2DXIA 3ZMVA 2KHMA 2W1OA 5K5QA 2F5DA 3CCJI 2MABA 3HGYA 1S5LC 2KL4A 3I54A 1VQ8I 1TBXA 2CQQA 2H1LA 3CJNA 3RPQA 3WU2C 4CYCA 2VB6A 1P92A 1X58A 2VBZA 3BR1A 5D5XB 3CC2I 1ETYA 3TO7A 4WCGA 1XCVA 1AHDP 3M8EA 1P6RA 1A04A 4JOMA 2PJPA 3CCSI 2CSOA 1UHWA 1SMYF 2QENA 5B1BH 3T5XA 1O4XA 3GFLA 1UG0A 2JK3A 5DCMB 3F8FA 4J19A 2XC7A 1WRJA 3I71A 2CS3A 3QYEA 4BDZA 4P5OA 1LJ9A 3FHNA 2CG4A 1MW7A 3G1LA 4HA8A 1WKMA 1ZARA 4ZC3A 1QU3A 1SFKA 1BR1A 4U87A 4F91B 4E7LA 1HXDA 1TTYA 2EA4A 3HB9A 5GADJ 4KICA 5HOOA 4DNCA 3PO3J 1S8NA 3HBLA 3M9AA 3CDLA 3IH2A 3W6VA 3BPXA 2KJBA 1PP8F 3D5RC 3C18A 4DOZA 1EF4A 3ASOH 2VOPA 1A36A 4M3GA 1WJ5A 3JCUC 2FNAA 2BYVE 1OCOH 2RREA 2CQKA 3HEFA 3RKYA 2XROA 2P6TA 2W00A 3TP0A 3GTLJ 4N0BA 3H0DA 4NC6A 1AA7A 4KISA 2RN7A 3SDGA 1FIAA 1GV2A 3IKTA 2GXGA 3F9KA 4A3JJ 1JGSA 5DYMA 4XOPA 1RI7A 2IGMA 2R5ZA 3V42A 3CUQB 3F72A 4RB1A 2UXNA 4Z6YA 3PQKA 3KP6A 2JPBA 4I99C 2DTRA 1T0FC 2WV0A 1R9TJ 2CH0A 4ZZDA 5IYCJ 2YUSA 4IEJA 4FCYA 2R7VA 5IYDJ 5ICGA 1RETA 4XLCA 3VYTB 2NRAC 4XNFA 2FMYA 2K9NA 1KQ9A 5FLXZ 4L0ZB 3EPZA 1U6GA 4LGWA 3AG2H 2V4JC 5F08A 2GIZA 3VOEA 1R5ID 2RDPA 4KJZA 1DPUA 2DA7A 1S7OA 1NK2P 5TJJA 2L02A 4KT5C 2XB0X 5KAIC 4XRFA 1K79A 2V1UA 1FTTA 1XPXA 5J1YA 2KDZA 5HDGA 1UELB 5FB2A 3F0CA 1R36A 2A61A 1JKOC 1MD0A 3KE2A 5GTHC 5FD5A 4B43A 1MJBA 2V79A 4YG2F 3LFKA 3E6MA 1Z05A 1RKTA 4ESBA 3G4SI 4ZDLA 3O3KA 3OR2C 3V8KA 3ZP5A 1VQ9I 4LG0A 2ZC2A 4DZPA 1O7FA 2Z2SB 2BY1A 3M8FA 2JRMA 1LFUP 5JHUA 2FMLA 1D8KA 2H94A 4HZFA 2Y69H 3LWFA 5HLGA 3GZ6A 1V5GA 1ZH5A 1HSTA 1TWFJ 3EUAA 2K3PA 3I4PA 5FJ8J 5TISC 4KUMA 3C1DA 4ZYEA 1WQ2A 4RS8A 5FFZA 2OBPA 4RBOA 2LP0A 3DKWA 4BGDA 3IUOA 2CW0F 1MJAA 2NVTJ 3WTTC 3K70C 3CDHA 3BR2A 3NAUA 3S1MJ 2LR8A 4S05A 4UB6C 2V9VA 4BE1A 2Z3YA 2B63J 2KDOA 1UHMA 3H5AA 1LKXA 1ERDA 5KAFC 2TDXA 2NNYA 2A3SA 1K7AA 3R60A 3IRQA 3L2QA 4B09A 4L18B 4HNTA 2K5CA 4Y15A 3LNQA 1QO0D 2WAEA 3CJRB 3OYDA 3H9QA 3CCQI 1I3QJ 2P5LC 4X0GA 1YIOA 3R0JA 3FF5A 2DQLA 2FNPA 2ZB9A 3MQ0A 1YW7A 5FKNA 2K9MA 4DYCA 5TRDA 4GYGA 3VSKA 5J47A 2F4OB 5EEGA 4D7MA 5CVVA 2OQRA 5CVIA 2Z16A 1SFUA 1HCRA 2LY2A 1KQ0A 3CZ6A 1T8IA 3ABKH 3NWTA 4F93B 1HW5A 2OTLI 4R79A 2DOFA 4PSXA 2VASA 4XOTA 2VBXA 3GXOA 3NRVA 1SMTA 4A6EA 4E7SA 1D0XA 1LFBA 4C3HJ 3F22A 4KITB 1UMQA 4A3MJ 3KP2A 3HSFA 4GYIA 1TW3A 3OOPA 2FF4A 2DMTA 1ZRFA 2HKOA 1NTCA 2AO9A 4AIDA 1HQCA 3KP3A 2O8XA 5CVRA 2DOEA 2EV6A 4YRVA 4V19K 3F8CA 1F1ZA 1MZBA 2PMHA 3EUHC 4F92B 5HVQC 1YLFA 2HFHA 3QP6A 2RKHA 3EYIA 3RI4A 3PNTA 1D3YA 4HDVA 3CLOA 2X48A 1TQPA 2DFFA 3B6CA 2A68F 1RKWA 1GUUA 1IN8A 3L09A 3OYLA 3ZMUA 1ZRDA 5D5WB 1U3EM 1IRXA 1RNLA 1USTA 2DMQA 1T08B 2QYOA 1BW5A 3OS0A 1IN5A 2LD5A 3BG9A 5D6EA 2DN0A 3TGNA 1FEXA 1WFXA 1FTZA 1QQIA 3HSRA 3DV8A 4NDLA 2L0KA 1B9MA 3HOUJ 3VODA 3LSTA 5BPDA 3HUGA 1Z9CA 2BE5F 1ZREA 4B1RA 3CDIA 1LVKA 2I5UA 4JX6A 5LGNA 2ISZA 1PVEA 1RUOA 3AG4H 3RTRA 1XGNA 2R7OA 4IQ4A 2XPVA 3TO6A 3AKZA 4TV7A 2QWWA 4RB3C 3S1NJ 5HLTA 3DLLF 1Z21A 3SHFA 3CUQC 2EIKH 5J4VA 4MEYF 1VZ0A 3ZCOA 5EEAA 3PIPF 3RCOA 3DEWA 1S7EA 4GO1A 1W7PB 2EQRA 3I9V2 4KIFA 2JVHA 1TNTA 1U9NA 2WAQN 2LNBA 3M1EA 4C2UA 4CZCA 4C30A 3OYJA 5K5OA 1I6XA 5IT9K 2XAJA 2XVCA 2FD5A 2VT3A 3HKZN 2V1DA 3ERED 2JUCA 1FYKA 3H3VK 1ITYA 2BY0A 1X4OA 4P55A 2OZUA 3ABLH 4PFPA 3OYHA 4OMYA 3HOZJ 4RLFA 1FP2A 2JA5J 3A2KA 3G6EI 4YELA 2HDCA 5LGTA 4IVNA 3L1PA 1HKSA 5ICFA 4A93J 3RIRA 2CQNA 3HG9A 3WTXC 3JRCA 1N75A 1ZHFA 2JRTA 5E79C 2E7XA 1VQ4I 2H09A 5DM7F 4ZTFA 2EB7A 1JHHA 3LL7A 3WHBA 3SFZA 3BQZA 1Y8RB 3HRSA 5LHGA 1W5CC 2G7HA 3K2ZA 3ZQHA 5B5EC 1ZR2A 2W48A 2DJIA 1RR8C 3S2HJ 3UR3C 1J09A 2ZFWA 4M72A 3RJPA 3OY9A 2NVQJ 1BI0A 3DCFA 1KGSA 2XAFA 2IRFG 4L5IA 5D6FA 1BIAA 4EGZA 3GTPJ 2LMDA 3KEOA 2H6CA 1D1BA 1MBHA 3K10A 5L3DA 1BOAA 5EG0B 3RKXA 1R22A 2VIXA 1WJDA 4IHXA 3ZR8X 3LAPA 2K7LA 5JLXA 3HOTA 1IO2A 3FXJA 3HOSA 3D0SA 3HYIA 4R1HA 2ME6A 2R7QA 4BL0B 5HLIA 1RUNA 1QVTA 5HS8A 2CUFA 1U5TA 2ZJ2A 3VDXA 5F1JA 4LLNA 3OV8A 5FKMA 2DBBA 1MMGA 2M8EA 2IS1A 4NQWB 1S6LA 2BW3B 3K4LA 4LK1F 1PUFA 3CJQB 3WHCA 4IHVA 1AOYA 3BTIA 1I39A 3Q9SA 4M6VA 1I6HJ 3NARA 1HDPA 1GT0C 3JAMZ 4YIIA 2CV0A 4IJAA 2XV4S 4A3CJ 3H35A 4AD9A 1FOXA 2M30A 1YW9A 3ECOA 3MEXA 3G73A 2E1NA 1ZELA 2K85A 1YX5A 1HDDC 2PN6A 2YU3A 3BZCA 2FQ4A 2OZ6A 3HDDA 2EFQA 2LKSA 1T0FA 2V6CA 3L2VA 2R7TA 4YIFA 2IJLA 2IA0A 1FSEA 2VQGA 4PSWA 1X1PA 2L54A 4UVCA 4BKXA 3JR9A 2ZNZA 1JHFA 4A69C 3CCEI 3HTSB 4EM2A 4BXXJ 3TQNA 2M1BA 4IZZA 4IHWA 1YX3A 5AONA 4CO8A 2X0LA 4FE7A 2JN6A 3F8MA 1QGPA 5GAGJ 1ZRCA 1U8BA 2M2EA 3GFIA 2MSYA 3HRMA 4EVIA 1EKEA 2YU9J 3KCCA 5DM6F 4DZJA 2PBIA 2K40A 2X1CA 3KZZA 3GF2A 1ZLJA 1KONA 1L0OC 1Y0UA 4RM2A 3WTZA 3BR5A 4MHGA 5FKKA 1DU6A 3SJMA 2BY3A 2E2JJ 2LG4A 5IYBJ 2HYGD 2Z1DA 4BHBA 4DQ2A 1Z0XA 1S7AA 3H3UA 1NHAA 2A6HF 2NOGA 4BEHA 1I1SA 3TMOA 4CH7A 1T98A 4G9YA 5F0CA 1R23A 3JRDA 2LKPA 2VBYA 3MKYB 3WGHA 4D7NA 2EFWA 4RB2C 5IP7J 1I50J 4XORA 2QKMB 3ZQ7A 4BE0A 4BY1J 5J1UA 3AL0C 4LD5A 2K02A 4O3MA 1OISA 3C3WA 3CD6I 1JKRC 1FIPA 3U9GA 3H92A 3LSGA 5J8CA 2R5YA 2V26A 1I3AA 4FETA 2DFEA 3HRUA 4X6AJ 2ESNA 4KN7X 2DDBA 4M9SA 1LE8B 1X2MA 4FE4A 2NVXJ 1VQNI 2LK2A 2D2WA 4YEJA 4BS9A 1IRFA 2VXDA 3O8HA 1A5JA 4P96A 2M7BA 3HHGA 4L9TA 1ZKGA 4QPQA 4XM3A 4UVBA 5DTDA 1BC8C 4LB6B 1XDSA 4RMNA 2P0WA 1HA8A 1O7LA 3BOQA 4ZZLA 4B3XA 2J5PA 3HJEA 4XN3A 5JHFA 2K9LA 3FXKA 1B8IB 1TWGJ 4Z2YA 4ABZA 2F48A 4IXAA 2E1OA 2FUG2 4XLEA 3GO5A 3JTGA 2Y31A 3KLNA 1TP4A 2OCCH 2WTEA 2P5KA 1OCTC 2CMPA 2GOMA 1B72A 4RM3A 5KCMA 5B1AH 3A1YA 4QLCU 2VXZA 3S2WA 2X6YA 2LREA 4W97A 1KU2A 2EV0A 3JRGA 2P7CB 3I59B 2E35A 4OMZA 3K0LA 4S04A 3M4OJ 1STZA 1K78B 4JBAA 3F8NA 2LH9A 1VNDA 2E34A 3ONQA 3DXJF 4U0WA 4HNVA 5C4JJ 5FLXK 2A69F 4FQGA 2CJJA 1JT6A 2M9HA 4O6JA 2IP2A 5F0FA 2NVYJ 5H2FC 1A35A 2F5CA 1ZGJA 4LOCA 3LSHA 4AIHA 3LSRA 2Y9YA 3GZ5A 2JZYA 3IWFA 1D0YA 2Q0OA 4U7DA 1RZ4A 3RKQA 2ZKZA 4ENNA 1UZCA 2K86A 1APLC 2OAZA 2M8GX 1K4TA 2KLOA 2DFIA 5KHDA 3EUHA 1OLTA 3FXRA 1TQIA 1XSVA 2G0EA 3E3VA 3HM5A 1L3LA 2COMA 3NEUA 5DCMA 4EMSA 1H89C 4U7BA 4HDUA 2VL8A 2L5QA 4XRSG 4CICA 4OU0A 2W82A 2V7FA 1YOVB 3H0GJ 3O8GA 1LDJA 2W7NA 5DCFA 2QSGX 1P4WA 4A5MA 3LA2A 2YX4A 5LGUA 2KMUA 3BJ6A 5FFXA 2MC4A 4S0HB 5LFAA 2CRGA 1UCRA 1ZG3A 1LQ1A 1UAAA 5BNGA 1AU7A 1BOBA 4LITA 1K83J 1USSA 1MGTA 1YHQI 1T2KA 5IY5H 3BR6A 5E3OA 3R61A 2Y48A 1OCPA 4I0AA 5HDNA 1OYIA 2DOAA 5AIQA 3JSOA 2DDAA 2E36A 5J40A 1XMKA 3V7CA 2UUZA 3CF2A 3OIOA 2MBFA 4OINF 4RGUA 2DA3A 3CUQA 3I53A 4N4NB 3RYRA 2CW7A 4F52A 2RAEA 2R3SA 2ZXHA 4XL9A 2OC6A 1GXQA 1TT0A 1GHCA 5H6QA 3TOBA 3SZTA 4A0ZA 1BJZA 2GIVA 3W2AA 3R0AA 1I5ZA 2EWNA 3VB2A 2K27A 3ECHA 3FWEA 1X3UA 3W2VA 4Q48A 4HPQA 3OYEA 1IN7A 1J7KA 2IAIA 3LOCA 1QZZA 2PI0A 4G94A 5F64A 3WG7H 5J8FA 5L3BA 3E5XA 1TL8A 1Z7UA 2RNJA 4KIBA 2IGKA 3I58A 1PP7U 2KKOA 3KP4A 4U0VA 2JQ7A 3M8JA 1U5TC 2NNNA 1IDZA 4OIPF 3K4KA 2B0LA 2EIMH 2XSJC 3QYFA 2COBA 1ULYA 2EFNA 1N78A 3BG7A 3GFJA 2QQBA 2M7AA 4XMYA 3RYPA 3L2RA 1MBJA 3ROUA 5IOYA 1P2FA 1HBXG 1MH4A 3E97A 2E1MB 4M6YA 3SDBA 3RDIA 1PDNC 3A02A 2NS7A 5LEJA 2NYXA 4B47A 3DPUA 3BC8A 3JSPA 2QKLB 2H27A 4GCVA 3BY6A 3DLAA 3BQYA 4DYRA 2O8KA 1LPQA 2OPTA 2X6XA 3H5NA 3ZGKA 2M34A 2F4IA 4NC7A 3MKWB 3OYBA 5LEKA 3CCRI 2KPMA 5DV5A 3WTYC 3AG1H 1NG7A 2L9RA 1JUSA 2EK5A 3E6CC 1XN7A 3CP8A 2PQ8A 3VSLA 3AFHA 1IXCA 3CTAA 3W6KB 1IG7A 2FXAA 3K1MA 4ZDPA 1JGGA 3BZ6A 3E1SA 3PQJA 2FA5A 1ZLKA 2R7SA 2HTSA 3PNYA 3ZOBA 2E1CA 1Z3YA 1SVMA 4PJLA 5CVJA 4Q5SF 1KQ8A 3KX2A 2JA2A 5GP9A 1OQYA 2LSOA 3IAM2 5K7FA 1JKPC 1T56A 5JI6A 4DYQA 3C2BA 4P9UA 1YRNB 3HRTA 2MH2A 3I4NJ 1TZLA 3F6VA 3FBNB 1YJNI 2O61A 3O2PE 1JJ6C 1R1TA 1MMNA 2WY7Q 4KDPA 1DGRM 2EPFA 5H20A 1OMIA 4J01A 2VQCA 4AM3A 1WGXA 1XSXA 2ZO4A 4E7ZA 2KIUA 4IRIA 2ZSHB 3KEQA 2C6YA 2OV7A 1VQ7I 4D5CA 1XX5A 1NH3A 2D1HA 5ERIA 3S93A 2ZCWA 1I1GA 2FOKA 3MD2A 3ZN0A 5IPAA 3OMYA 2UV1A 4HAMA 4CCLA 4DGWB 1XMAA 4PDKA 1BR2A 4WXDA 4ZTJA 4M71A 3H5RA 4PJ0C 3OIQA 4U0YA 3PM1A 2ACJA 1R4NB 1J2XA 2KP6A 2EH3A 1AKHB 2E2IJ 3S14J 2E19A 4G6DA 2DMPA 1XB4A 1KZHA 2W25A 1J75A 2EV5A 4GXOA 2EJRA 2DAOA 3M1CA 1FX7A 3FKIJ 2HS5A 3O6BB 4RAGA 2EZIA 3I0TA 4E7KA 1X3ZB 4XIDA 2KIQA 4BXFA 4MEXF 1H9GA 2HXOA 4IX7A 4HQEA 1F9NA 3J7ZI 5JVGF 1R1VA 1B6AA 3CJTB 3MZHA 2QVOA 3P5JA 3CCMI 3TL4X 2A05A 2RNGA 1M1EB 4G6TB 1BIBA 4GGGA 5K5RA 3Q0VA 4L5JA 4KMFA 2CO5A 2OF7A 3HC7A 3WU0A 4A3GJ 1O3SA 4EQQA 4XLFA 3DKYA 3GLLA 1OKRA 1XGSA 3DF8A 1E2XA 4B44A 3ISPA 2ZJPF 2DFHA 4XSZF 4CCMA 1OJLA 1VQOI 1H9TA 3FISA 3IHUA 3J80Z 3WGIA 1C0WA 1AWCA 4P9FA 1WJCA 4AVPA 2HEOA 5JVTA 4HRIA 4IKFA 4C2MJ 2NXNB 4CXFA 2F2EA 2IA2A 1ZK8A 4AIKA 4LG3A 9ANTA 4A3IJ 5GAHJ 4CDGA 2VJIA 2DT6A 4Y17A 3BLYA 2V1XA 3S3NA 1ZAOA 2KRHA 2LF8A 3PFYA 3OOUA 1YJWI 3MVPA 2PLYA 1FP1D 2QBYB 2HXIA 5M3MJ 2L9VA 1QA6A 4XRSA 2EZLA 3PSFA 3CCVI 1ZGWA 2YSRA 2E60A 2WBMA 1W0TA 4AYBN 3OSGA 2M5WA 3F23A 4ENMA 2PMZN 3Q0WA 4XN0A 1G3SA 2VN2A 5E3LA 2UXXA 2VQHA 5IOZA 1W7PD 3NQOA 4HF2A 3T1BA 3NWSA 5M5YJ 4OIQF 4XONA 3BTCA 1W7PA 2BEOA 1MIJA 3ULQB 5HODA 1X1AA 2EFOA 4O5VA 4FASD 4GDFA 4KT6A 2HU9A 1HC8A 1FPQA 1Z77A 1WH7A 3RQIA 1EH8A 2IS2A 1ODDA 4C9YA 1DGWY 3VWBA 3K69A 3KPHA 1Y6IA 3DEEA 3KYDB 4BNCA 3RSNA 3W2WA 5BMZA 2WC2A 3DQVC 2CYYA 4Y3OA 1WWXA 2L4MA 2JPCA 5EZGA 2CWEA 2M4GA 1DDNA 1JUMA 3ABUA 2ELHA 2JTVA 4WXHA 3ZMSA 1VQPI 1VQ6I 1SAUA 3K4MA 2L01A 1MBEA 5CYVA 4ZH4F 4QTRA 2E1MC 3QAHA 2W85A 3QU6A 3T0YA 4A3DJ 5AIPA 4UB8C 3P9IA 4PZJA 5LRRA 1EV7A 1MNMC 1X1CA 2QQAA 2VQLA 1D5VA 2KIFA 2VKVA 4XR6A 3RQ4A 2GBYA 3VFZA 1H0MA 4BAYA 2K9QA 2H8WA 4FISA 3TOAA 5FRMA 3BJOA 1F43A 3M7GA 1D8JA 4HNUA 4G6QA 3K4CA 3FBIB 3PSIA 2VPLA 1VF9A 3LA7A 1TW2A 1MDMA 3KLOA 4UUVA 2HI3A 2NAZA 1BN5A 2FEZA 3CC4I 5EG0A 3T8RA 3GUDA 1Z6TA 3DPTA 3FKJA 4BH9A 3QOPA 3GTJJ 1D1CA 1MBKA 1G4DA 2AXTC 3P9CA 2IEKA 2W24A 4AIJA 1YI2I 4I09A 4CYDA 4I7HA 4GRIA 1MKMA 1YE9A 4H0EA 4XLAA 1SFXA 3TDZC 1RIOH 4UVAA 4NQWA 5FKOA 5BQTA 1G8XA 3IKVA 1QPMA 2HWVA 3ZQCA 2YS9A 3L2CA 2KZVA 3MN2A 5GAEJ 1JI8A 4MLOA 3DKXA 2XHKA 3RKWA 4XKVA 3CO7C 2HKXA 2CV1A 3PUFA 4Y33A 3MKLA 1JKQC 1V5FA 2DA2A 1QVUA 3CCUI 1TC3C 5D5UB 2BVMA 2M4KA 3I56I 2MC3A 4MTDA 2QF7A 3OYMA 4JX5A 3V7RA 2FBIA 2JUGA 2W4SA 4KN4X 4CGZA 4XLNF 2FSWA 2TRTA 4IRGA 3GFMA 1Z91A 2IT0A 3OIPA 4NHJA 1MDMB 1LB2A 1GVJA 1R4MB 1O57A 5HS9A 1GVDA 2DMNA 4DBRA 2XPWA 4CCOA 1HOMA 5ILVA 4XQFA 1B4AA 3FHZA 2X85A 3QU3A 2Y9ZA 4UV9A 4Y13A 2H8RA 2BXYA 4UV8A 3QQAA 2Q1ZB 4D1QA 4A3KJ 1ETKA 2ZJQF 4CA0A 1N25A 2LC2A 4PJJA 1K4SA 1K61A 3P9KA 1W1WE 1IUYA 2K4BA 1WJFA 2FJ1A 4C3IJ 2CU7A 2JT1A 2UWMA 1ZGAA 4CHUA 3T8TA 3F6OA 2LBFB 4UUSB 3SEQA 3KZIC 4H4KC 2PG4A 5CJ9A 2DYRH 4XK4A 4LJZF 1OYYA 1R00A 2VJJA 2WAQA 3EUKL 3L7WA 2DJNA 1MNDA 2FOWA 3MAJA 4JYKA 1ONVA 5DDGA 2QSHX 2GA1A 1Z7LA 5ED4A 3N97A 1FYMA 3CCLI 2Y0SN 3HKZA 4BACA 3S1RJ 1BI3A 1T95A 2VE8A 3ZQGA 2WB1N 3G71I 3U21A 2R7WA 3HPHA 2RQQA 5BOXA 4PJMA 4F3QA 2W57A 1SVLA 3RZDJ 1XS9A 3KYLA 2X51A 3N05A 2NOJB 4BUPA 2DO7A 2MA3A 2O0YA 4UUTA 3VYUB 4Q4ZF 1S3JA 5KNLA 3ELKA 1HW1A 1LE8A 4IHTA 1MH3A 5ILSA 5C44J 1E3OC 1OYWA 2CFOA 2GLOA 1DPRA 2Y0MA 3ASNH 1W4MA 3S3MA 5ILUA 4QPOA 2QSFX 2DT5A 1XTAA 4A0XA 3JRBA 1CF7B 5F04A 4PGGA 4CSWA 5FKLA 2XF7A 2HPMA 1B8IA 1KA8A 1UFMA 4II3A 3FK7A 4EV0A 3ESWB 1P7IA 5L3GA 3BZKA 2LKXA 1U2WA 2V6EA 3DBHB 2R4GA 5E17F 3J7YJ 4MNUA 1VQKI 4HF1A 2HR3A 3E6BA 3BJAA 4A2UA 1F5TA 2L7FP 1MSEC 3MZ8A 1WI9A 3GWZA 2AS5F 3LMMA 2STTA 2FBHA 2I10A 4AWXB 4E6KG 3I59A 3ERMA 4Y52J 2E5ZA 4KMUX 1SFEA 4PUSA 1A31A 2MYSA 2ETHA 2R7ZJ 5IT9Z 1LVAA 1K78A 2YR2A 4M9XA 4OAZA 3GVAA 2XIGA 5A2QZ 2HYJA 1BJAA 2WADA 1F4KA 2P4WA 1FMWA 2XGDA 1OCCH 3PJRA 4NB5A 2V1NA 3HGGA 4BQAA 5E8GA 1VQMI 2ZBKA 1DQUA 2HOSA 2EIJH 3M3YJ 5C4XJ 2L2OA 2LY9A 3TW6A 3DP7A 2BHYA 1SVOA 3OL4A 1LDDA 4EM0B 3F21A 3GTOJ 3JTHA 1IRZA 4MFDA 1J59A 2AXLA 2GOXB 4IRHA 2DYSH 2PFBA 3ZPLA 3S8PA 2ZSIB 1OR7C 5CPRB 1WI3A 1XCBA 3FIWA 2LLKA 4EJTA 2IVMA 4FHTA 2TCTA 5L3EA 4A3LJ 4NBQA 2R0QC 1ZG5A 3C7JA 5EGOB 3FXQA 2HYFA 2P5VA 4BXUA 2MH9A 3OYFA 4RAFA 2MD5A 3FK6A
chains in the Genus database with same CATH topology
4MTEA 2QM3A 1VTNC 2X4HA 1S29A 2RQPA 2ESHA 1ZG1A 2GAUA 2HGCA 3E6DA 3G3ZA 5HLHA 1B9NA 3LQQA 4QWQA 3V8LA 4L9VA 5HS7A 5KK1A 3KP7A 3HHHA 1XGMA 3WGGA 3FX3A 4LLLA 3EDPA 4LFUA 4HV6A 4JK1X 5LHIA 4L9NA 4F7ZA 2ADUA 4FT8A 4RGRA 4G8XA 2CFXA 3BPVA 2ZMEA 4XBFA 1J9IA 1MJ9A 2VODA 4YFKF 3BDDA 3WTSC 5DUKA 3RPUA 1G3YA 2QUFA 3IRRA 3ZMZA 3W6JB 1KU7A 1FY7A 2RVCA 3N4MA 4IF4A 2ISYA 2ZXJA 4M9ZA 4RGXA 3WTVC 5D5VB 1Q1HA 4IPAA 4EJUA 5KVRA 3FXUA 4LMYA 3J80K 5BS6A 2LF7A 3ABTA 4G7HF 5D4RA 2STWA 4MGRA 4YFNF 1HW2A 2ZMEB 2F5FA 3B02A 2L3DA 4OOIA 3MCZA 2XUBA 3P7NA 1R5GA 1IF1A 4N9IA 4M74A 4BHPA 3WG9A 2VC0A 3FZVA 2EFPA 5LRSA 1YG2A 3GLXA 3PFIA 1B59A 1YS6A 5DD4A 1XDUA 3TKYA 3L9FA 2GQQA 5E18F 2P7VB 3KP5A 1TQMA 4G7ZF 2GA2A 1I27A 1REPC 1FBQA 2PMUA 3J81Z 3E5QA 2Z33A 4OIRF 3KETA 3ML6A 1SD7A 6PAXA 3ZN1A 4RB0A 2PEXA 3H3ZA 4BHCA 2DI3A 3FMSA 5FD6A 1DUXC 3EYYA 1YYVA 1P4AA 4KYWA 3DPLC 2P6SA 2EA2A 5ICCA 3DFGA 1FZPB 1R58A 2MLGA 3TO9A 1LEBA 4A0YA 3F8BA 3IL2A 2DQRA 2OQGA 3WU1B 5D8KB 2Z5UA 2UZKA 2VT2A 3WODF 4D0PA 2G7UA 3GYHX 3DEUA 2QBYA 4I01A 4EJOA 4HX8A 1JE8A 2VE9A 3WTUC 5DUIA 2BV6A 4HF0A 2H6BA 3SZPA 3EETA 4ESJA 4A12A 1B1BA 5E1WA 4LLGF 3V8JA 3AAFA 3REOA 2O3FA 2CGPA 3FM3A 2DLLA 2XKOA 3FM5A 4HLYA 1IN4A 1XSDA 2ZNYA 3VEPA 4EM1A 2XGXA 2DU9A 2OU2A 1YTYA 3JW4A 1HSJA 1U8RA 3I64A 5CVUA 3MFKA 3HIFA 1J0RA 4LG0B 1TLHB 1K6OA 4Q47A 4ENJA 1J5YA 1G3TA 2VONA 2D1VA 2OA4A 1QBJA 1SD6A 2HTJA 1YO5C 3U1DA 3QP5A 1QNTA 5HDKA 1OR7A 3JAMK 4KNYA 1BBYA 1QZYA 3QPHA 4L9JA 4PCQA 2A07F 1IAWA 2QZ8A 4HOBA 1LDKB 3QPTA 1EH6A 1XD7A 1FBUA 4JQFA 1JXSA 2XRNA 3V4GA 1U78A 3TDUC 3IC7A 4KA4A 1DP7P 1LEAA 3Q5FA 5LLQA 4XLPF 2BGCA 1KYZA 2OD5A 2FU4A 5L3FA 4HX4A 2Z9OA 1IXSB 1YS7A 5JR3A 2RV8A 1W5TA 3HTUA 1KU3A 2GZWA 1P4XA 1W5SA 3K9TA 3CUOA 3SXYA 2DPUA 2XAHA 3KFWX 2RC4A 2DW4A 4EJWA 1BM9A 2VOOA 1R5HA 1Z6RA 4BYYA 3MWMA 2KRFA 3MZYA 4WF2A 4UHTA 3D5LA 1ON2A 5A2QK 3LAJA 2DK5A 3E5UA 1ZYRF 2YPRA 1G6NA 1EH7A 1IW7F 5LBQA 2Z99A 2JSCA 2O03A 3LQRA 3K1NA 2BBYA 2HQNA 2F5EA 2LDUA 1GXPA 3WTWC 3BP8A 3GEZA 3R6SA 4WX9A 3U2RA 4LK0F 3ZMTA 2K4JA 1ON1A 4HBLA 4M73A 5E1XA 4EGYA 2L4AA 2QLZA 2IPQX 4CZZA 1Z1DA 4LB5A 4E70A 4RAYA 1CF7A 2E7WA 4N9HA 2J5OA 3EQLF 5F1RA 2Y75A 1HKTA 2WWYA 1T38A 3HSEA 2DPDA 3FMRA 2XASA 1T39A 2M87A 2XAQA 2W84A 4HLXA 1OPCA 1YW8A 3FMQA 2DK8A 4FX4A 2D45A 4KIGA 1HKQA 3Q9VA 3CO6C 2HOEA 1FC3A 3QRFF 4HV5A 4I0BA 4WK8F 3K1PA 5E1ZB 1O3TA 4MQ9F 4KFCA 2XKPA 2R7FA 4MQVA 1R1UA 1SAXA 1KYWA 3V7SA 2P8TA 2FE3A 4M6XA 5DD8A 1TNSA 4HQMA 2O6GE 1YFHA 1PUEE 1V3FA 2HQRA 5ICEA 4I2OA 4L0YB 1U5TB 3KZYA 2VC1A 1BC7C 1IRGA 5BPIA 2GXBA 3BWGA 2FQ3A 3WE3A 4ESFA 2R7DA 2MLKA 1R7JA 4IHSA 2GWRA 4I02A 5DEQA 1FNNA 2Q8KA 5D8LB 4HX7A 5L3CA 5FO5A 5H6RA 2NS0A 3LA3A 5CLSA 1E17A 1UB9A 1XGOA 4XSXF 2RGVA 1O3RA 5IT3A 4YFXF 4HYEA 4UXNA 4R8HA 2IW5A 4K2EA 4U88A 2YX7A 5JFRA 4ETSA 2Q2EA 4WXCA 4B8XA 3COAC 4A6DA 4PGHA 2IA1A 1CGPA 5EEHA 1BI1A 1IZ1A 1FWZA 1FT9A 4ASNA 1SD4A 2G9WA 4I98B 4HW0A 2HZTA 1WSUA 4FX0A 3B73A 4ZYGA 2VBWA 4UNOA 3J7AO 3BROA 1V4RA 5F6FA 5D4SA 1IXRC 1FYLA 4ON0A 2XAGA 1FOKA 1G3WA 2FBKA 3GW2A 4EJVA 1IN6A 3J81K 3ZMDA 1T6SA 3GX4X 5LHHA 3IWZA 3R4KA 1FLIA 5FGMA 1YQAA 3F3XA 3WE2A 3L00A 1BI2A 5E20A 4A5NA 4ZYHA 4RAZA 2A5YB 3I5UA 1SD5A 4ENKA 1FSHA 1O3QA 2KIMA 5J6XA 2QQ9A 4OIOF 4ZYDA 1FBSA 2A6EF 2FRHA 4RGSA 3SQNA 5K1YA 2KJCA 1ZN2A 4G7OF 4WWCA 2M45A 5E8IA 1KU9A 1LNWA 3ZMVA 5K5QA 2F5DA 3I54A 1TBXA 3CJNA 3RPQA 1P92A 5D5XB 2VBZA 3TO7A 4WCGA 1XCVA 3M8EA 1P6RA 1A04A 2PJPA 2CSOA 1UHWA 1SMYF 2QENA 3T5XA 3GFLA 5DCMB 3F8FA 1WRJA 3I71A 4P5OA 1LJ9A 2CG4A 4HA8A 1WKMA 1ZARA 1HXDA 1TTYA 2EA4A 5HOOA 4KICA 4DNCA 1S8NA 3M9AA 3BPXA 2KJBA 1PP8F 3C18A 2VOPA 3RKYA 2FNAA 2BYVE 2CQKA 2XROA 2P6TA 4N0BA 2RN7A 3IKTA 2GXGA 1JGSA 5DYMA 1RI7A 3CUQB 3F72A 4RB1A 2UXNA 3PQKA 3KP6A 2JPBA 2DTRA 2WV0A 4ZZDA 5ICGA 2NRAC 2FMYA 1KQ9A 5FLXZ 4L0ZB 1U6GA 4LGWA 3VOEA 2RDPA 1DPUA 1S7OA 5TJJA 2L02A 4KT5C 4XRFA 1K79A 2V1UA 5HDGA 5FB2A 1R36A 2A61A 1MD0A 3KE2A 5FD5A 1MJBA 2V79A 4YG2F 3LFKA 3E6MA 1Z05A 4ESBA 3O3KA 3V8KA 3ZP5A 4LG0A 1O7FA 3M8FA 5JHUA 2FMLA 1D8KA 2H94A 4HZFA 3LWFA 5HLGA 3GZ6A 1ZH5A 1HSTA 3I4PA 4KUMA 3C1DA 4ZYEA 1WQ2A 4RS8A 5FFZA 2OBPA 3DKWA 2CW0F 1MJAA 3WTTC 3CDHA 4S05A 2V9VA 2Z3YA 1UHMA 2TDXA 2NNYA 2A3SA 1K7AA 3R60A 3IRQA 4B09A 4L18B 4Y15A 1QO0D 2P5LC 1YIOA 3R0JA 3FF5A 2DQLA 2FNPA 3MQ0A 1YW7A 5TRDA 4GYGA 5EEGA 5CVVA 2OQRA 5CVIA 1SFUA 1KQ0A 1HW5A 4R79A 3GXOA 2VBXA 3NRVA 1SMTA 4A6EA 3F22A 3KP2A 3HSFA 4GYIA 1TW3A 3OOPA 2FF4A 1ZRFA 2HKOA 1HQCA 3KP3A 2O8XA 5CVRA 2EV6A 3F8CA 1F1ZA 1MZBA 2PMHA 5HVQC 1YLFA 2HFHA 3QP6A 2RKHA 3EYIA 3RI4A 1D3YA 4HDVA 3CLOA 1TQPA 2A68F 1IN8A 3L09A 3ZMUA 1ZRDA 5D5WB 1U3EM 1RNLA 1USTA 2QYOA 1IN5A 5D6EA 3TGNA 1QQIA 3HSRA 3DV8A 1B9MA 3VODA 3LSTA 5BPDA 3HUGA 1Z9CA 2BE5F 1ZREA 5LGNA 2ISZA 1RUOA 3RTRA 1XGNA 3TO6A 4TV7A 2QWWA 4RB3C 3SHFA 3CUQC 4MEYF 4GO1A 1W7PB 4KIFA 1TNTA 2LNBA 3M1EA 5IT9K 5K5OA 1I6XA 2XAJA 2XVCA 2VT3A 2V1DA 3ERED 1FYKA 4P55A 2OZUA 4OMYA 1FP2A 2HDCA 5LGTA 4IVNA 1HKSA 5ICFA 3RIRA 3WTXC 1ZHFA 2JRTA 2E7XA 2H09A 2EB7A 1JHHA 3SFZA 3HRSA 5LHGA 2G7HA 3K2ZA 2ZFWA 4M72A 3RJPA 1BI0A 1KGSA 2XAFA 2IRFG 4L5IA 5D6FA 1BIAA 4EGZA 3KEOA 2H6CA 5L3DA 1BOAA 3RKXA 1R22A 3LAPA 2K7LA 3HOTA 3HOSA 3D0SA 3HYIA 4R1HA 5HLIA 1RUNA 5HS8A 1U5TA 2ZJ2A 4LLNA 3OV8A 2DBBA 2M8EA 1S6LA 4LK1F 1AOYA 3Q9SA 3JAMZ 4YIIA 4IJAA 2XV4S 4AD9A 2M30A 1YW9A 3ECOA 3MEXA 3G73A 2E1NA 2PN6A 2YU3A 2OZ6A 2EFQA 1T0FA 2V6CA 4YIFA 2IJLA 2IA0A 1FSEA 4UVCA 3HTSB 2L54A 2ZNZA 1JHFA 4EM2A 3TQNA 2M1BA 5AONA 4CO8A 2X0LA 3F8MA 1QGPA 1ZRCA 3GFIA 3HRMA 4EVIA 3KCCA 2PBIA 3KZZA 3GF2A 1ZLJA 1L0OC 1Y0UA 3WTZA 4MHGA 4BHBA 2HYGD 4DQ2A 1S7AA 3H3UA 1NHAA 2A6HF 1I1SA 1T98A 4G9YA 1R23A 2LKPA 2VBYA 3WGHA 2EFWA 4RB2C 3ZQ7A 4LD5A 2K02A 4O3MA 3C3WA 3U9GA 3H92A 5J8CA 3HRUA 2ESNA 4KN7X 4M9SA 2D2WA 1IRFA 4P96A 3HHGA 4L9TA 4UVBA 1BC8C 4LB6B 1XDSA 1O7LA 3BOQA 4ZZLA 2J5PA 4Z2YA 4IXAA 3GO5A 3JTGA 3KLNA 2WTEA 2P5KA 4QLCU 2VXZA 3S2WA 1KU2A 2EV0A 2P7CB 3I59B 4OMZA 3K0LA 4S04A 1STZA 1K78B 4JBAA 3F8NA 3DXJF 4U0WA 5FLXK 2A69F 4O6JA 2IP2A 2F5CA 1ZGJA 4AIHA 3GZ5A 2JZYA 3IWFA 2Q0OA 4U7DA 1RZ4A 2MD5A 2ZKZA 4ENNA 2K86A 2OAZA 2DFIA 3EUHA 3FXRA 1TQIA 1XSVA 3E3VA 1L3LA 2COMA 3NEUA 5DCMA 4EMSA 4U7BA 4HDUA 4CICA 4OU0A 1LDJA 5DCFA 1P4WA 4A5MA 3LA2A 2YX4A 5LGUA 3BJ6A 5FFXA 1UCRA 1ZG3A 1LQ1A 1USSA 1MGTA 1T2KA 3R61A 2Y48A 4I0AA 5HDNA 1OYIA 5AIQA 3JSOA 1XMKA 3V7CA 2MBFA 4OINF 4RGUA 3CUQA 3I53A 3RYRA 2R3SA 1GXQA 1GHCA 5H6QA 3TOBA 3SZTA 4A0ZA 2GIVA 3R0AA 1I5ZA 2EWNA 3VB2A 2K27A 3ECHA 3FWEA 1X3UA 4Q48A 1IN7A 1J7KA 1QZZA 2PI0A 4G94A 5F64A 5J8FA 5L3BA 3E5XA 1Z7UA 2RNJA 4KIBA 3I58A 1PP7U 2KKOA 3KP4A 4U0VA 1U5TC 2NNNA 4OIPF 2B0LA 1ULYA 2EFNA 3GFJA 2QQBA 3RYPA 3ROUA 1P2FA 1HBXG 3E97A 4M6YA 3RDIA 1PDNC 5LEJA 2NYXA 3JSPA 2H27A 4GCVA 3BY6A 5LEKA 5DV5A 3WTYC 2EK5A 3E6CC 1XN7A 2PQ8A 3CTAA 1IXCA 3W6KB 2FXAA 3K1MA 3BZ6A 3PQJA 1ZLKA 2FA5A 2HTSA 2E1CA 5CVJA 4Q5SF 1KQ8A 2LSOA 5JI6A 4P9UA 3HRTA 2MH2A 3F6VA 2O61A 3O2PE 1R1TA 4KDPA 5H20A 1OMIA 2ZO4A 1XSXA 2KIUA 4IRIA 3KEQA 2C6YA 2D1HA 5ERIA 2ZCWA 1I1GA 2FOKA 3ZN0A 4HAMA 1XMAA 4PDKA 4WXDA 4M71A 4U0YA 2ACJA 1J2XA 4G6DA 1XB4A 1J75A 2W25A 2EV5A 4GXOA 2EJRA 2DAOA 1FX7A 2HS5A 3O6BB 3I0TA 4MEXF 1H9GA 4HQEA 1F9NA 1R1VA 1B6AA 3MZHA 2QVOA 1BIBA 4GGGA 5K5RA 4L5JA 4KMFA 2CO5A 3WU0A 1O3SA 4EQQA 1OKRA 1XGSA 3DF8A 1E2XA 4XSZF 1H9TA 3IHUA 1C0WA 3J80Z 3WGIA 1AWCA 4P9FA 4AVPA 2HEOA 5JVTA 4CXFA 2F2EA 2IA2A 4AIKA 4CDGA 4Y17A 2V1XA 1ZAOA 2LF8A 2PLYA 1FP1D 2QBYB 2YSRA 2M5WA 3F23A 4ENMA 1G3SA 2VN2A 2UXXA 1W7PD 3NQOA 4HF2A 3T1BA 4OIQF 1W7PA 2BEOA 3ULQB 2EFOA 4O5VA 1FPQA 1EH8A 1ODDA 3K69A 4BNCA 5BMZA 2WC2A 3DQVC 2CYYA 1WWXA 2L4MA 2JPCA 2CWEA 1DDNA 3ABUA 4WXHA 2ELHA 2JTVA 3ZMSA 2L01A 5CYVA 4ZH4F 3QAHA 2W85A 3QU6A 3T0YA 5AIPA 3P9IA 4PZJA 5LRRA 1EV7A 2QQAA 1D5VA 2KIFA 3VFZA 1H0MA 4BAYA 3TOAA 3BJOA 3M7GA 1D8JA 4G6QA 3LA7A 1TW2A 1MDMA 3KLOA 4UUVA 2NAZA 1BN5A 2FEZA 3T8RA 3GUDA 1Z6TA 3DPTA 4BH9A 3QOPA 1G4DA 3P9CA 2W24A 4AIJA 4I09A 4CYDA 4I7HA 1MKMA 4H0EA 1SFXA 3TDZC 1RIOH 4UVAA 4NQWA 5BQTA 3IKVA 1QPMA 2HWVA 3L2CA 2XHKA 3RKWA 3CO7C 2HKXA 5D5UB 2MC3A 4MTDA 3V7RA 2FBIA 4KN4X 4CGZA 4XLNF 2FSWA 4IRGA 3GFMA 1Z91A 2IT0A 4NHJA 1MDMB 1LB2A 1GVJA 5HS9A 1O57A 5ILVA 1B4AA 3FHZA 3QU3A 4UV9A 4Y13A 4UV8A 3P9KA 1IUYA 2K4BA 2JT1A 2UWMA 1ZGAA 4CHUA 3T8TA 3F6OA 2PG4A 5CJ9A 4LJZF 1OYYA 1R00A 3L7WA 5DDGA 3MAJA 1ONVA 2GA1A 5ED4A 3N97A 1FYMA 1BI3A 2VE8A 5BOXA 2W57A 2DO7A 2MA3A 2O0YA 4Q4ZF 1S3JA 3ELKA 1HW1A 4IHTA 5ILSA 1OYWA 1DPRA 2Y0MA 1W4MA 5ILUA 2DT5A 4A0XA 1CF7B 4PGGA 1KA8A 1UFMA 4EV0A 5L3GA 1U2WA 5E17F 4MNUA 4HF1A 2HR3A 3E6BA 3BJAA 4A2UA 1F5TA 1WI9A 3GWZA 2AS5F 2STTA 2FBHA 4AWXB 3I59A 4KMUX 1SFEA 2ETHA 5IT9Z 1LVAA 1K78A 2YR2A 4M9XA 3GVAA 2XIGA 5A2QZ 1BJAA 1F4KA 2P4WA 4NB5A 4BQAA 5E8GA 2ZBKA 3DP7A 1LDDA 4EM0B 3F21A 3JTHA 1J59A 2AXLA 4IRHA 2PFBA 3ZPLA 1XCBA 4EJTA 2IVMA 4FHTA 5L3EA 1ZG5A 3C7JA 3FXQA 2HYFA 2P5VA 4BXUA 2MH9A 3ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTE A;  2QM3 A;  1VTN C;  2X4H A;  1S29 A;  2RQP A;  2ESH A;  1ZG1 A;  2GAU A;  2HGC A;  3E6D A;  3G3Z A;  5HLH A;  1B9N A;  3LQQ A;  4QWQ A;  3V8L A;  4L9V A;  5HS7 A;  5KK1 A;  3KP7 A;  3HHH A;  1XGM A;  3WGG A;  3FX3 A;  4LLL A;  3EDP A;  4LFU A;  4HV6 A;  4JK1 X;  5LHI A;  4L9N A;  4F7Z A;  2ADU A;  4FT8 A;  4RGR A;  4G8X A;  2CFX A;  3BPV A;  2ZME A;  4XBF A;  1J9I A;  1MJ9 A;  2VOD A;  4YFK F;  3BDD A;  3WTS C;  5DUK A;  3RPU A;  1G3Y A;  2QUF A;  3IRR A;  3ZMZ A;  3W6J B;  1KU7 A;  1FY7 A;  2RVC A;  3N4M A;  4IF4 A;  2ISY A;  2ZXJ A;  4M9Z A;  4RGX A;  3WTV C;  5D5V B;  1Q1H A;  4IPA A;  4EJU A;  5KVR A;  3FXU A;  4LMY A;  3J80 K;  5BS6 A;  2LF7 A;  3ABT A;  4G7H F;  5D4R A;  2STW A;  4MGR A;  4YFN F;  1HW2 A;  2ZME B;  2F5F A;  3B02 A;  2L3D A;  4OOI A;  3MCZ A;  2XUB A;  3P7N A;  1R5G A;  1IF1 A;  4N9I A;  4M74 A;  4BHP A;  3WG9 A;  2VC0 A;  3FZV A;  2EFP A;  5LRS A;  1YG2 A;  3GLX A;  3PFI A;  1B59 A;  1YS6 A;  5DD4 A;  1XDU A;  3TKY A;  3L9F A;  2GQQ A;  5E18 F;  2P7V B;  3KP5 A;  1TQM A;  4G7Z F;  2GA2 A;  1I27 A;  1REP C;  1FBQ A;  2PMU A;  3J81 Z;  3E5Q A;  2Z33 A;  4OIR F;  3KET A;  3ML6 A;  1SD7 A;  6PAX A;  3ZN1 A;  4RB0 A;  2PEX A;  3H3Z A;  4BHC A;  2DI3 A;  3FMS A;  5FD6 A;  1DUX C;  3EYY A;  1YYV A;  1P4A A;  4KYW A;  3DPL C;  2P6S A;  2EA2 A;  5ICC A;  3DFG A;  1FZP B;  1R58 A;  2MLG A;  3TO9 A;  1LEB A;  4A0Y A;  3F8B A;  3IL2 A;  2DQR A;  2OQG A;  3WU1 B;  5D8K B;  2Z5U A;  2UZK A;  2VT2 A;  3WOD F;  4D0P A;  2G7U A;  3GYH X;  3DEU A;  2QBY A;  4I01 A;  4EJO A;  4HX8 A;  1JE8 A;  2VE9 A;  3WTU C;  5DUI A;  2BV6 A;  4HF0 A;  2H6B A;  3SZP A;  3EET A;  4ESJ A;  4A12 A;  1B1B A;  5E1W A;  4LLG F;  3V8J A;  3AAF A;  3REO A;  2O3F A;  2CGP A;  3FM3 A;  2DLL A;  2XKO A;  3FM5 A;  4HLY A;  1IN4 A;  1XSD A;  2ZNY A;  3VEP A;  4EM1 A;  2XGX A;  2DU9 A;  2OU2 A;  1YTY A;  3JW4 A;  1HSJ A;  1U8R A;  3I64 A;  5CVU A;  3MFK A;  3HIF A;  1J0R A;  4LG0 B;  1TLH B;  1K6O A;  4Q47 A;  4ENJ A;  1J5Y A;  1G3T A;  2VON A;  2D1V A;  2OA4 A;  1QBJ A;  1SD6 A;  2HTJ A;  1YO5 C;  3U1D A;  3QP5 A;  1QNT A;  5HDK A;  1OR7 A;  3JAM K;  4KNY A;  1BBY A;  1QZY A;  3QPH A;  4L9J A;  4PCQ A;  2A07 F;  1IAW A;  2QZ8 A;  4HOB A;  1LDK B;  3QPT A;  1EH6 A;  1XD7 A;  1FBU A;  4JQF A;  1JXS A;  2XRN A;  3V4G A;  1U78 A;  3TDU C;  3IC7 A;  4KA4 A;  1DP7 P;  1LEA A;  3Q5F A;  5LLQ A;  4XLP F;  2BGC A;  1KYZ A;  2OD5 A;  2FU4 A;  5L3F A;  4HX4 A;  2Z9O A;  1IXS B;  1YS7 A;  5JR3 A;  2RV8 A;  1W5T A;  3HTU A;  1KU3 A;  2GZW A;  1P4X A;  1W5S A;  3K9T A;  3CUO A;  3SXY A;  2DPU A;  2XAH A;  3KFW X;  2RC4 A;  2DW4 A;  4EJW A;  1BM9 A;  2VOO A;  1R5H A;  1Z6R A;  4BYY A;  3MWM A;  2KRF A;  3MZY A;  4WF2 A;  4UHT A;  3D5L A;  1ON2 A;  5A2Q K;  3LAJ A;  2DK5 A;  3E5U A;  1ZYR F;  2YPR A;  1G6N A;  1EH7 A;  1IW7 F;  5LBQ A;  2Z99 A;  2JSC A;  2O03 A;  3LQR A;  3K1N A;  2BBY A;  2HQN A;  2F5E A;  2LDU A;  1GXP A;  3WTW C;  3BP8 A;  3GEZ A;  3R6S A;  4WX9 A;  3U2R A;  4LK0 F;  3ZMT A;  2K4J A;  1ON1 A;  4HBL A;  4M73 A;  5E1X A;  4EGY A;  2L4A A;  2QLZ A;  2IPQ X;  4CZZ A;  1Z1D A;  4LB5 A;  4E70 A;  4RAY A;  1CF7 A;  2E7W A;  4N9H A;  2J5O A;  3EQL F;  5F1R A;  2Y75 A;  1HKT A;  2WWY A;  1T38 A;  3HSE A;  2DPD A;  3FMR A;  2XAS A;  1T39 A;  2M87 A;  2XAQ A;  2W84 A;  4HLX A;  1OPC A;  1YW8 A;  3FMQ A;  2DK8 A;  4FX4 A;  2D45 A;  4KIG A;  1HKQ A;  3Q9V A;  3CO6 C;  2HOE A;  1FC3 A;  3QRF F;  4HV5 A;  4I0B A;  4WK8 F;  3K1P A;  5E1Z B;  1O3T A;  4MQ9 F;  4KFC A;  2XKP A;  2R7F A;  4MQV A;  1R1U A;  1SAX A;  1KYW A;  3V7S A;  2P8T A;  2FE3 A;  4M6X A;  5DD8 A;  1TNS A;  4HQM A;  2O6G E;  1YFH A;  1PUE E;  1V3F A;  2HQR A;  5ICE A;  4I2O A;  4L0Y B;  1U5T B;  3KZY A;  2VC1 A;  1BC7 C;  1IRG A;  5BPI A;  2GXB A;  3BWG A;  2FQ3 A;  3WE3 A;  4ESF A;  2R7D A;  2MLK A;  1R7J A;  4IHS A;  2GWR A;  4I02 A;  5DEQ A;  1FNN A;  2Q8K A;  5D8L B;  4HX7 A;  5L3C A;  5FO5 A;  5H6R A;  2NS0 A;  3LA3 A;  5CLS A;  1E17 A;  1UB9 A;  1XGO A;  4XSX F;  2RGV A;  1O3R A;  5IT3 A;  4YFX F;  4HYE A;  4UXN A;  4R8H A;  2IW5 A;  4K2E A;  4U88 A;  2YX7 A;  5JFR A;  4ETS A;  2Q2E A;  4WXC A;  4B8X A;  3COA C;  4A6D A;  4PGH A;  2IA1 A;  1CGP A;  5EEH A;  1BI1 A;  1IZ1 A;  1FWZ A;  1FT9 A;  4ASN A;  1SD4 A;  2G9W A;  4I98 B;  4HW0 A;  2HZT A;  1WSU A;  4FX0 A;  3B73 A;  4ZYG A;  2VBW A;  4UNO A;  3J7A O;  3BRO A;  1V4R A;  5F6F A;  5D4S A;  1IXR C;  1FYL A;  4ON0 A;  2XAG A;  1FOK A;  1G3W A;  2FBK A;  3GW2 A;  4EJV A;  1IN6 A;  3J81 K;  3ZMD A;  1T6S A;  3GX4 X;  5LHH A;  3IWZ A;  3R4K A;  1FLI A;  5FGM A;  1YQA A;  3F3X A;  3WE2 A;  3L00 A;  1BI2 A;  5E20 A;  4A5N A;  4ZYH A;  4RAZ A;  2A5Y B;  3I5U A;  1SD5 A;  4ENK A;  1FSH A;  1O3Q A;  2KIM A;  5J6X A;  2QQ9 A;  4OIO F;  4ZYD A;  1FBS A;  2A6E F;  2FRH A;  4RGS A;  3SQN A;  5K1Y A;  2KJC A;  1ZN2 A;  4G7O F;  4WWC A;  2M45 A;  5E8I A;  1KU9 A;  1LNW A;  3ZMV A;  5K5Q A;  2F5D A;  3I54 A;  1TBX A;  3CJN A;  3RPQ A;  1P92 A;  5D5X B;  2VBZ A;  3TO7 A;  4WCG A;  1XCV A;  3M8E A;  1P6R A;  1A04 A;  2PJP A;  2CSO A;  1UHW A;  1SMY F;  2QEN A;  3T5X A;  3GFL A;  5DCM B;  3F8F A;  1WRJ A;  3I71 A;  4P5O A;  1LJ9 A;  2CG4 A;  4HA8 A;  1WKM A;  1ZAR A;  1HXD A;  1TTY A;  2EA4 A;  5HOO A;  4KIC A;  4DNC A;  1S8N A;  3M9A A;  3BPX A;  2KJB A;  1PP8 F;  3C18 A;  2VOP A;  3RKY A;  2FNA A;  2BYV E;  2CQK A;  2XRO A;  2P6T A;  4N0B A;  2RN7 A;  3IKT A;  2GXG A;  1JGS A;  5DYM A;  1RI7 A;  3CUQ B;  3F72 A;  4RB1 A;  2UXN A;  3PQK A;  3KP6 A;  2JPB A;  2DTR A;  2WV0 A;  4ZZD A;  5ICG A;  2NRA C;  2FMY A;  1KQ9 A;  5FLX Z;  4L0Z B;  1U6G A;  4LGW A;  3VOE A;  2RDP A;  1DPU A;  1S7O A;  5TJJ A;  2L02 A;  4KT5 C;  4XRF A;  1K79 A;  2V1U A;  5HDG A;  5FB2 A;  1R36 A;  2A61 A;  1MD0 A;  3KE2 A;  5FD5 A;  1MJB A;  2V79 A;  4YG2 F;  3LFK A;  3E6M A;  1Z05 A;  4ESB A;  3O3K A;  3V8K A;  3ZP5 A;  4LG0 A;  1O7F A;  3M8F A;  5JHU A;  2FML A;  1D8K A;  2H94 A;  4HZF A;  3LWF A;  5HLG A;  3GZ6 A;  1ZH5 A;  1HST A;  3I4P A;  4KUM A;  3C1D A;  4ZYE A;  1WQ2 A;  4RS8 A;  5FFZ A;  2OBP A;  3DKW A;  2CW0 F;  1MJA A;  3WTT C;  3CDH A;  4S05 A;  2V9V A;  2Z3Y A;  1UHM A;  2TDX A;  2NNY A;  2A3S A;  1K7A A;  3R60 A;  3IRQ A;  4B09 A;  4L18 B;  4Y15 A;  1QO0 D;  2P5L C;  1YIO A;  3R0J A;  3FF5 A;  2DQL A;  2FNP A;  3MQ0 A;  1YW7 A;  5TRD A;  4GYG A;  5EEG A;  5CVV A;  2OQR A;  5CVI A;  1SFU A;  1KQ0 A;  1HW5 A;  4R79 A;  3GXO A;  2VBX A;  3NRV A;  1SMT A;  4A6E A;  3F22 A;  3KP2 A;  3HSF A;  4GYI A;  1TW3 A;  3OOP A;  2FF4 A;  1ZRF A;  2HKO A;  1HQC A;  3KP3 A;  2O8X A;  5CVR A;  2EV6 A;  3F8C A;  1F1Z A;  1MZB A;  2PMH A;  5HVQ C;  1YLF A;  2HFH A;  3QP6 A;  2RKH A;  3EYI A;  3RI4 A;  1D3Y A;  4HDV A;  3CLO A;  1TQP A;  2A68 F;  1IN8 A;  3L09 A;  3ZMU A;  1ZRD A;  5D5W B;  1U3E M;  1RNL A;  1UST A;  2QYO A;  1IN5 A;  5D6E A;  3TGN A;  1QQI A;  3HSR A;  3DV8 A;  1B9M A;  3VOD A;  3LST A;  5BPD A;  3HUG A;  1Z9C A;  2BE5 F;  1ZRE A;  5LGN A;  2ISZ A;  1RUO A;  3RTR A;  1XGN A;  3TO6 A;  4TV7 A;  2QWW A;  4RB3 C;  3SHF A;  3CUQ C;  4MEY F;  4GO1 A;  1W7P B;  4KIF A;  1TNT A;  2LNB A;  3M1E A;  5IT9 K;  5K5O A;  1I6X A;  2XAJ A;  2XVC A;  2VT3 A;  2V1D A;  3ERE D;  1FYK A;  4P55 A;  2OZU A;  4OMY A;  1FP2 A;  2HDC A;  5LGT A;  4IVN A;  1HKS A;  5ICF A;  3RIR A;  3WTX C;  1ZHF A;  2JRT A;  2E7X A;  2H09 A;  2EB7 A;  1JHH A;  3SFZ A;  3HRS A;  5LHG A;  2G7H A;  3K2Z A;  2ZFW A;  4M72 A;  3RJP A;  1BI0 A;  1KGS A;  2XAF A;  2IRF G;  4L5I A;  5D6F A;  1BIA A;  4EGZ A;  3KEO A;  2H6C A;  5L3D A;  1BOA A;  3RKX A;  1R22 A;  3LAP A;  2K7L A;  3HOT A;  3HOS A;  3D0S A;  3HYI A;  4R1H A;  5HLI A;  1RUN A;  5HS8 A;  1U5T A;  2ZJ2 A;  4LLN A;  3OV8 A;  2DBB A;  2M8E A;  1S6L A;  4LK1 F;  1AOY A;  3Q9S A;  3JAM Z;  4YII A;  4IJA A;  2XV4 S;  4AD9 A;  2M30 A;  1YW9 A;  3ECO A;  3MEX A;  3G73 A;  2E1N A;  2PN6 A;  2YU3 A;  2OZ6 A;  2EFQ A;  1T0F A;  2V6C A;  4YIF A;  2IJL A;  2IA0 A;  1FSE A;  4UVC A;  3HTS B;  2L54 A;  2ZNZ A;  1JHF A;  4EM2 A;  3TQN A;  2M1B A;  5AON A;  4CO8 A;  2X0L A;  3F8M A;  1QGP A;  1ZRC A;  3GFI A;  3HRM A;  4EVI A;  3KCC A;  2PBI A;  3KZZ A;  3GF2 A;  1ZLJ A;  1L0O C;  1Y0U A;  3WTZ A;  4MHG A;  4BHB A;  2HYG D;  4DQ2 A;  1S7A A;  3H3U A;  1NHA A;  2A6H F;  1I1S A;  1T98 A;  4G9Y A;  1R23 A;  2LKP A;  2VBY A;  3WGH A;  2EFW A;  4RB2 C;  3ZQ7 A;  4LD5 A;  2K02 A;  4O3M A;  3C3W A;  3U9G A;  3H92 A;  5J8C A;  3HRU A;  2ESN A;  4KN7 X;  4M9S A;  2D2W A;  1IRF A;  4P96 A;  3HHG A;  4L9T A;  4UVB A;  1BC8 C;  4LB6 B;  1XDS A;  1O7L A;  3BOQ A;  4ZZL A;  2J5P A;  4Z2Y A;  4IXA A;  3GO5 A;  3JTG A;  3KLN A;  2WTE A;  2P5K A;  4QLC U;  2VXZ A;  3S2W A;  1KU2 A;  2EV0 A;  2P7C B;  3I59 B;  4OMZ A;  3K0L A;  4S04 A;  1STZ A;  1K78 B;  4JBA A;  3F8N A;  3DXJ F;  4U0W A;  5FLX K;  2A69 F;  4O6J A;  2IP2 A;  2F5C A;  1ZGJ A;  4AIH A;  3GZ5 A;  2JZY A;  3IWF A;  2Q0O A;  4U7D A;  1RZ4 A;  2MD5 A;  2ZKZ A;  4ENN A;  2K86 A;  2OAZ A;  2DFI A;  3EUH A;  3FXR A;  1TQI A;  1XSV A;  3E3V A;  1L3L A;  2COM A;  3NEU A;  5DCM A;  4EMS A;  4U7B A;  4HDU A;  4CIC A;  4OU0 A;  1LDJ A;  5DCF A;  1P4W A;  4A5M A;  3LA2 A;  2YX4 A;  5LGU A;  3BJ6 A;  5FFX A;  1UCR A;  1ZG3 A;  1LQ1 A;  1USS A;  1MGT A;  1T2K A;  3R61 A;  2Y48 A;  4I0A A;  5HDN A;  1OYI A;  5AIQ A;  3JSO A;  1XMK A;  3V7C A;  2MBF A;  4OIN F;  4RGU A;  3CUQ A;  3I53 A;  3RYR A;  2R3S A;  1GXQ A;  1GHC A;  5H6Q A;  3TOB A;  3SZT A;  4A0Z A;  2GIV A;  3R0A A;  1I5Z A;  2EWN A;  3VB2 A;  2K27 A;  3ECH A;  3FWE A;  1X3U A;  4Q48 A;  1IN7 A;  1J7K A;  1QZZ A;  2PI0 A;  4G94 A;  5F64 A;  5J8F A;  5L3B A;  3E5X A;  1Z7U A;  2RNJ A;  4KIB A;  3I58 A;  1PP7 U;  2KKO A;  3KP4 A;  4U0V A;  1U5T C;  2NNN A;  4OIP F;  2B0L A;  1ULY A;  2EFN A;  3GFJ A;  2QQB A;  3RYP A;  3ROU A;  1P2F A;  1HBX G;  3E97 A;  4M6Y A;  3RDI A;  1PDN C;  5LEJ A;  2NYX A;  3JSP A;  2H27 A;  4GCV A;  3BY6 A;  5LEK A;  5DV5 A;  3WTY C;  2EK5 A;  3E6C C;  1XN7 A;  2PQ8 A;  3CTA A;  1IXC A;  3W6K B;  2FXA A;  3K1M A;  3BZ6 A;  3PQJ A;  1ZLK A;  2FA5 A;  2HTS A;  2E1C A;  5CVJ A;  4Q5S F;  1KQ8 A;  2LSO A;  5JI6 A;  4P9U A;  3HRT A;  2MH2 A;  3F6V A;  2O61 A;  3O2P E;  1R1T A;  4KDP A;  5H20 A;  1OMI A;  2ZO4 A;  1XSX A;  2KIU A;  4IRI A;  3KEQ A;  2C6Y A;  2D1H A;  5ERI A;  2ZCW A;  1I1G A;  2FOK A;  3ZN0 A;  4HAM A;  1XMA A;  4PDK A;  4WXD A;  4M71 A;  4U0Y A;  2ACJ A;  1J2X A;  4G6D A;  1XB4 A;  1J75 A;  2W25 A;  2EV5 A;  4GXO A;  2EJR A;  2DAO A;  1FX7 A;  2HS5 A;  3O6B B;  3I0T A;  4MEX F;  1H9G A;  4HQE A;  1F9N A;  1R1V A;  1B6A A;  3MZH A;  2QVO A;  1BIB A;  4GGG A;  5K5R A;  4L5J A;  4KMF A;  2CO5 A;  3WU0 A;  1O3S A;  4EQQ A;  1OKR A;  1XGS A;  3DF8 A;  1E2X A;  4XSZ F;  1H9T A;  3IHU A;  1C0W A;  3J80 Z;  3WGI A;  1AWC A;  4P9F A;  4AVP A;  2HEO A;  5JVT A;  4CXF A;  2F2E A;  2IA2 A;  4AIK A;  4CDG A;  4Y17 A;  2V1X A;  1ZAO A;  2LF8 A;  2PLY A;  1FP1 D;  2QBY B;  2YSR A;  2M5W A;  3F23 A;  4ENM A;  1G3S A;  2VN2 A;  2UXX A;  1W7P D;  3NQO A;  4HF2 A;  3T1B A;  4OIQ F;  1W7P A;  2BEO A;  3ULQ B;  2EFO A;  4O5V A;  1FPQ A;  1EH8 A;  1ODD A;  3K69 A;  4BNC A;  5BMZ A;  2WC2 A;  3DQV C;  2CYY A;  1WWX A;  2L4M A;  2JPC A;  2CWE A;  1DDN A;  3ABU A;  4WXH A;  2ELH A;  2JTV A;  3ZMS A;  2L01 A;  5CYV A;  4ZH4 F;  3QAH A;  2W85 A;  3QU6 A;  3T0Y A;  5AIP A;  3P9I A;  4PZJ A;  5LRR A;  1EV7 A;  2QQA A;  1D5V A;  2KIF A;  3VFZ A;  1H0M A;  4BAY A;  3TOA A;  3BJO A;  3M7G A;  1D8J A;  4G6Q A;  3LA7 A;  1TW2 A;  1MDM A;  3KLO A;  4UUV A;  2NAZ A;  1BN5 A;  2FEZ A;  3T8R A;  3GUD A;  1Z6T A;  3DPT A;  4BH9 A;  3QOP A;  1G4D A;  3P9C A;  2W24 A;  4AIJ A;  4I09 A;  4CYD A;  4I7H A;  1MKM A;  4H0E A;  1SFX A;  3TDZ C;  1RIO H;  4UVA A;  4NQW A;  5BQT A;  3IKV A;  1QPM A;  2HWV A;  3L2C A;  2XHK A;  3RKW A;  3CO7 C;  2HKX A;  5D5U B;  2MC3 A;  4MTD A;  3V7R A;  2FBI A;  4KN4 X;  4CGZ A;  4XLN F;  2FSW A;  4IRG A;  3GFM A;  1Z91 A;  2IT0 A;  4NHJ A;  1MDM B;  1LB2 A;  1GVJ A;  5HS9 A;  1O57 A;  5ILV A;  1B4A A;  3FHZ A;  3QU3 A;  4UV9 A;  4Y13 A;  4UV8 A;  3P9K A;  1IUY A;  2K4B A;  2JT1 A;  2UWM A;  1ZGA A;  4CHU A;  3T8T A;  3F6O A;  2PG4 A;  5CJ9 A;  4LJZ F;  1OYY A;  1R00 A;  3L7W A;  5DDG A;  3MAJ A;  1ONV A;  2GA1 A;  5ED4 A;  3N97 A;  1FYM A;  1BI3 A;  2VE8 A;  5BOX A;  2W57 A;  2DO7 A;  2MA3 A;  2O0Y A;  4Q4Z F;  1S3J A;  3ELK A;  1HW1 A;  4IHT A;  5ILS A;  1OYW A;  1DPR A;  2Y0M A;  1W4M A;  5ILU A;  2DT5 A;  4A0X A;  1CF7 B;  4PGG A;  1KA8 A;  1UFM A;  4EV0 A;  5L3G A;  1U2W A;  5E17 F;  4MNU A;  4HF1 A;  2HR3 A;  3E6B A;  3BJA A;  4A2U A;  1F5T A;  1WI9 A;  3GWZ A;  2AS5 F;  2STT A;  2FBH A;  4AWX B;  3I59 A;  4KMU X;  1SFE A;  2ETH A;  5IT9 Z;  1LVA A;  1K78 A;  2YR2 A;  4M9X A;  3GVA A;  2XIG A;  5A2Q Z;  1BJA A;  1F4K A;  2P4W A;  4NB5 A;  4BQA A;  5E8G A;  2ZBK A;  3DP7 A;  1LDD A;  4EM0 B;  3F21 A;  3JTH A;  1J59 A;  2AXL A;  4IRH A;  2PFB A;  3ZPL A;  1XCB A;  4EJT A;  2IVM A;  4FHT A;  5L3E A;  1ZG5 A;  3C7J A;  3FXQ A;  2HYF A;  2P5V A;  4BXU A;  2MH9 A;  3ISP A; 
#chains in the Genus database with same CATH topology
 2B7E A;  3CQZ J;  3GTG J;  2HQA A;  4MTE A;  3QWL A;  2QM3 A;  3HOX J;  1RES A;  1LFP A;  1VTN C;  2X4H A;  1YJ9 I;  2IGO A;  1S29 A;  2RQP A;  4NC8 A;  1MMD A;  1EJ9 A;  3D1N I;  2ESH A;  1ZG1 A;  1U0J A;  2GAU A;  2HGC A;  3C2H A;  2WA0 A;  1ZTR A;  3E6D A;  2MG4 A;  3H9G A;  3LSK A;  4MO7 A;  2OTJ I;  3G3Z A;  5HLH A;  1B9N A;  2X6O A;  3LQQ A;  4QWQ A;  3V8L A;  1IUF A;  4L9V A;  5HS7 A;  1QRY A;  5KK1 A;  5GTI C;  3KP7 A;  3HHH A;  1XGM A;  2Q2E B;  3WGG A;  5M5W J;  3FX3 A;  3QOD A;  3OS1 A;  2OCE A;  4LLL A;  3JRF A;  2BHZ A;  1ORK A;  1D0Z A;  3EDP A;  4LFU A;  5K7H A;  4PJN A;  4HV6 A;  4A3F J;  2EZK A;  4BQO A;  4IHY A;  4BQN A;  1YIT I;  4JK1 X;  2EIN H;  1IV6 A;  3CMY A;  2VUM J;  2A6T A;  4C3J J;  3MKZ A;  1VQ5 I;  2HOT A;  5LHI A;  2XGE A;  1OFC X;  4L9N A;  3A0H C;  4F7Z A;  2ADU A;  4FT8 A;  3GZN B;  2BVL A;  4RGR A;  4G8X A;  2CFX A;  3BPV A;  4C2T A;  2ZME A;  3K7A J;  4XBF A;  5F0H A;  1J9I A;  1W0U A;  1MJ9 A;  1WHU A;  4BDY A;  2JA6 J;  2VOD A;  2IGN A;  2N8G A;  3RPU D;  4YFK F;  1X1D A;  3BT9 A;  3BDD A;  3WTS C;  1W36 C;  5DUK A;  3RPU A;  3DWL E;  1Z3X A;  1WJA A;  3KYC B;  1G3Y A;  3DTK A;  1JTX A;  2JSP A;  2QUF A;  3B6A A;  3IRR A;  3ZMZ A;  1FMV A;  3W6J B;  1CQT A;  2XF6 A;  3L2U A;  1Y56 A;  1KU7 A;  1FY7 A;  5CQE A;  2IXS A;  3GBG A;  5IP6 A;  2RVC A;  2P81 A;  3N4M A;  2MFZ A;  4I76 A;  4OAY A;  1GV5 A;  4PFO A;  2EIL H;  4IF4 A;  5GPC A;  2ISY A;  2ZXJ A;  3VYR B;  4M9Z A;  4MIM A;  2DA4 A;  4RGX A;  4B4C A;  4ANJ A;  5F27 A;  3WTV C;  5D5V B;  1X19 A;  5FLV A;  3CC7 I;  1Q1H A;  4IPA A;  4EJU A;  5KVR A;  4M3D A;  3FXU A;  4HG2 A;  4LMY A;  3J80 K;  1IJW C;  5BS6 A;  2LF7 A;  4BBS J;  3ABT A;  2QEX I;  4G7H F;  5D4R A;  3DTI A;  1YRN A;  4V2G A;  2STW A;  2ECB A;  2M3A A;  4MGR A;  4YFN F;  1HW2 A;  2ZME B;  2F5F A;  3PNV A;  1IC8 A;  2FX0 A;  4BBR J;  3KEY A;  3B02 A;  3Q3S A;  2L3D A;  3A4C A;  4OOI A;  3MCZ A;  2XUB A;  3GME A;  3P7N A;  1R5G A;  3SYT A;  3E7L A;  1IF1 A;  3UKG A;  3A01 B;  4N9I A;  2X1E A;  2XSD C;  4M74 A;  1U9O A;  4BHP A;  3WG9 A;  2OJE D;  2VC0 A;  3FZV A;  2QGU A;  4QIW N;  2PJR B;  4XRM A;  2LY1 A;  2EFP A;  5LRS A;  1R71 A;  1YG2 A;  3GLX A;  2M0C A;  1B59 A;  3PFI A;  2HZD A;  1YS6 A;  3C2G A;  3TP3 A;  2EBI A;  5DD4 A;  1XDU A;  3TKY A;  1JT0 A;  3S3O A;  3L9F A;  2GQQ A;  5EYR A;  5E18 F;  1RPW A;  4D5F A;  1AKH A;  2LOO A;  2KQR A;  4E4H A;  1V54 H;  4CYC B;  2VKH A;  4FTH A;  2P7V B;  3KP5 A;  1TQM A;  2E5N A;  4G7Z F;  3RZO J;  2ME0 A;  2ELK A;  2VJ5 A;  1JUP A;  2K9S A;  2GA2 A;  1I27 A;  2OUM A;  1REP C;  4XKB A;  1FBQ A;  2PMU A;  3J81 Z;  1EA3 A;  4OWR B;  3E5Q A;  3ZQQ A;  3CCY A;  2HDW A;  3I3L A;  4OIR F;  2Z33 A;  3S16 J;  3KET A;  1H88 C;  3ML6 A;  1SD7 A;  2VJ4 A;  4E7I A;  1UJ8 A;  1MNE A;  2I8D A;  6PAX A;  3ZN1 A;  1X3W B;  2ID6 A;  2PEX A;  3H3Z A;  4RB0 A;  4BHC A;  2DI3 A;  4Y4R A;  3FMS A;  5FD6 A;  2MW8 A;  1VFC A;  1DUX C;  4ITV A;  2HVR A;  3EYY A;  4BY7 J;  1YYV A;  1P4A A;  4KYW A;  3DPL C;  1VQL I;  4II2 A;  5FRO A;  1Y39 A;  2CV2 A;  2P6S A;  2EA2 A;  2LYC A;  2XRL A;  5ICC A;  4EAT A;  3DFG A;  1R49 A;  1FZP B;  1R58 A;  2MLG A;  3TO9 A;  1LEB A;  4A0Y A;  2QA4 I;  3G1O A;  3F8B A;  3IL2 A;  2DQR A;  2OQG A;  3WU1 B;  3OYK A;  5D8K B;  2Z5U A;  2UZK A;  2VT2 A;  3WOD F;  1FJL A;  3GTM J;  4IL6 C;  4D0P A;  1WPK A;  2G7U A;  1MMA A;  2JMW A;  3GYH X;  3CME I;  3DEU A;  4E7J A;  2JVG A;  2QBY A;  4I01 A;  2R5Z B;  1D1A A;  4EJO A;  4HX8 A;  1JE8 A;  2VE9 A;  3WTU C;  5DUI A;  2BV6 A;  4HF0 A;  3VYS B;  2H6B A;  3SZP A;  3EET A;  3JRA A;  3SZG A;  4ESJ A;  3CES A;  3DU6 A;  4A12 A;  5HNH A;  1S9H A;  1B1B A;  5E1W A;  2WAF A;  4LIU A;  4LLG F;  5EJC A;  3V8J A;  3AAF A;  3OWT A;  3REO A;  2O3F A;  2CGP A;  3FM3 A;  1UG2 A;  2F5V A;  1XG1 A;  2DLL A;  2O7O A;  2XKO A;  3AG3 H;  3W3C A;  3LSJ A;  1BL0 A;  1A6Q A;  3CLQ A;  3IH4 A;  4GFB A;  1RC9 A;  3VPR A;  1PJR A;  5LD2 C;  3FM5 A;  4HLY A;  1IN4 A;  1XSD A;  2ZNY A;  2L7M P;  3IP4 B;  3VEP A;  4EM1 A;  2GXA A;  2HDD A;  2XGX A;  2DU9 A;  2OU2 A;  3TBI A;  1YTY A;  1Y8Q B;  1UHS A;  3JW4 A;  1HSJ A;  1Y0N A;  1U8R A;  2JJ7 A;  2L7Z A;  2XDV A;  1MMS A;  1Y1V J;  4CCK A;  3S1Q J;  2BZT A;  1JJ8 C;  1ETV A;  1Q1V A;  2DMU A;  1GDT A;  3I64 A;  5CVU A;  3MFK A;  2D5V A;  3HIF A;  1V5E A;  1SC7 A;  1J0R A;  3LFU A;  4LG0 B;  4ZYA A;  4QSH A;  1TLH B;  1K6O A;  2XAU A;  4Q47 A;  1P7J A;  2VKE A;  4ENJ A;  2JA7 J;  3BG6 A;  1J5Y A;  1G3T A;  3PO2 J;  2VON A;  2LVS A;  2D1V A;  3I55 I;  2ZXW H;  2OA4 A;  3A0B C;  2HQ5 A;  1QBJ A;  1SD6 A;  5EF6 A;  2HTJ A;  1YO5 C;  3U1D A;  3QP5 A;  2ICW G;  2LRD A;  2ECC A;  2O9L A;  5B66 C;  1QNT A;  5HDK A;  1OR7 A;  3JAM K;  4KNY A;  5C3E J;  2Y30 A;  4UY8 I;  1PYV A;  1BBY A;  1QZY A;  3TED A;  3OYA A;  3QPH A;  4L9J A;  3CMM A;  4PCQ A;  4XKW A;  3OYC A;  5E3M A;  2A07 F;  3OYG A;  1IAW A;  2QZ8 A;  4HOB A;  1LDK B;  5J1R A;  3QPT A;  1EH6 A;  1XD7 A;  1FBU A;  5M5X J;  4JQF A;  2VLA A;  1JXS A;  1V55 H;  2XF5 A;  1ETX A;  2XRN A;  4IO9 F;  3V4G A;  1U78 A;  2V9P A;  3JRH A;  3TDU C;  3IC7 A;  3QPS A;  4M3B A;  3G2B A;  4KA4 A;  1X2N A;  1H8A C;  2VI6 A;  4V2F A;  1R6R A;  2Y2Z A;  3DU5 A;  1S72 I;  1LEA A;  2ZME C;  4DW6 A;  1DP7 P;  3Q5F A;  2XB5 A;  5LLQ A;  2H1K A;  1G59 A;  2R7R A;  4E7H A;  1POG A;  1TWC J;  4G12 A;  4XLP F;  3AL0 B;  1SAN A;  2BGC A;  2AQE A;  2DA5 A;  1KYZ A;  2OD5 A;  2FU4 A;  5L3F A;  2CUZ A;  4HX4 A;  4HST A;  2Z9O A;  3BCB A;  1IXS B;  1YS7 A;  5JR3 A;  2CQX A;  2RV8 A;  1W5T A;  3MMY B;  1WJE A;  1MBF A;  3HTU A;  4Y7N J;  4ZDO A;  1KU3 A;  2GZW A;  5J3L A;  1P4X A;  1W5S A;  3K9T A;  1NG6 A;  3E0J B;  3CUO A;  2KZG A;  3PIO F;  5M3F J;  3SXY A;  1QPI A;  2DPU A;  1E0E A;  2QQ8 A;  2HVS A;  2XAH A;  3CMA I;  3KFW X;  2ZXI A;  5E3N A;  3JRE A;  2RC4 A;  2DW4 A;  1MSF C;  3HPG A;  3K6G A;  2PX9 A;  3S2D J;  4EJW A;  2R92 J;  1BM9 A;  4A3B J;  2BXZ A;  2VOO A;  4BU2 A;  4AYB A;  1ZQ3 P;  1R5H A;  2DT7 B;  4L5E A;  3BR0 A;  4X1E A;  1Z6R A;  2DA6 A;  2PMZ A;  4BYY A;  3MWM A;  2KRF A;  1HLV A;  3MZY A;  1HF0 A;  3A03 A;  4HEA 2;  4RLQ A;  4WF2 A;  4UHT A;  2R93 J;  3OR1 C;  3D5L A;  1ON2 A;  2LBF A;  1W36 D;  4UUS A;  4RA2 A;  5A2Q K;  3BTL A;  3LAJ A;  2WY8 Q;  1N77 A;  3ZQL A;  2DK5 A;  4IOA F;  4PK4 A;  3M07 A;  3E5U A;  1SEU A;  3ZQI A;  4DIQ A;  2KFD A;  1ZYR F;  2YPR A;  1G6N A;  1EH7 A;  2F4M B;  2M0M A;  1IW7 F;  1ETW A;  2VKD A;  3X2Q H;  5LBQ A;  5DS9 A;  2Z99 A;  2JSC A;  3SEZ A;  2NVU B;  3J7A Y;  2O03 A;  3LQR A;  3K1N A;  3TW7 A;  4W1U A;  1Z67 A;  3BG3 A;  1GLN A;  3IH3 A;  2BBY A;  2HQN A;  3HUG B;  2X1D A;  2F5E A;  2LDU A;  1GXP A;  3WTW C;  3BP8 A;  2V9K A;  3DBL B;  3GEZ A;  3OSF A;  3R6S A;  3HOW J;  4XIC A;  4WX9 A;  1Y1W J;  3FXM A;  3U2R A;  4LK0 F;  3H1C A;  4HBL A;  2K4J A;  1ON1 A;  3K2A A;  4M73 A;  5E1X A;  3ZMT A;  5CKT A;  2BY2 A;  1SFO J;  4CUG A;  4EGY A;  2L4A A;  2QLZ A;  2IPQ X;  1BA5 A;  2X6W A;  1ENH A;  5IP9 J;  4XLH A;  4CZZ A;  1Z1D A;  3HZJ A;  4LB5 A;  3H36 A;  1FOW A;  1XC5 A;  4E70 A;  3D5S C;  4RAY A;  5EZH A;  4IOC F;  2DTZ A;  2CUE A;  1CF7 A;  2E7W A;  4N9H A;  2J5O A;  3FXO A;  3EQL F;  4BJ6 C;  5F1R A;  2Y75 A;  1HKT A;  1WCM J;  2WWY A;  1T38 A;  3PUB A;  3BTJ A;  3KIO A;  3HSE A;  2DPD A;  3FMR A;  2XAS A;  1T39 A;  4BJ5 C;  2M87 A;  2XAQ A;  2W84 A;  2IBD A;  4HLX A;  1OPC A;  4CCJ A;  4LIV A;  3JRI A;  1RRJ A;  1NK3 P;  1YW8 A;  2XPU A;  3HOY J;  1E3P A;  3QOE A;  3CF5 F;  3FMQ A;  2DK8 A;  4XKC A;  4FX4 A;  2D45 A;  4KIG A;  1HKQ A;  2F6C A;  3I4M J;  1FOY A;  3Q9V A;  3CO6 C;  2HOE A;  1FC3 A;  3QRF F;  2LTP A;  3Q0U A;  2DA1 A;  1WZ2 A;  1G2H A;  4HV5 A;  4I0B A;  2CUJ A;  4B3A A;  4WK8 F;  2KT0 A;  3K1P A;  4ZJZ A;  1IDY A;  5E1Z B;  1O3T A;  2ELJ A;  3IV5 A;  2E71 A;  3UNG C;  1P9Q C;  4MQ9 F;  5K7Z A;  1F36 A;  4RDU A;  2KIS A;  4A3E J;  2ZFU A;  4AC0 A;  4KFC A;  2XKP A;  2DOD A;  2K3F A;  1VI0 A;  2R7F A;  2L9S A;  4MQV A;  1R1U A;  1SAX A;  4JX4 A;  1KYW A;  3V7S A;  4EEF G;  4BQQ A;  2AQF A;  1XMX A;  3DTE A;  2P8T A;  2FE3 A;  3GCM A;  4M6X A;  5DD8 A;  1JTY A;  1TNS A;  1T33 A;  3HOV J;  4HQM A;  4M3F A;  1YIJ I;  2VPR A;  2X9D A;  2XGC A;  2CW8 A;  2O6G E;  1YFH A;  1PUE E;  1V3F A;  2HQR A;  4HSR A;  1TWA J;  5ICE A;  4I2O A;  2BOL A;  3S17 J;  4L0Y B;  1U5T B;  2MD0 A;  3K4B A;  3KZY A;  3LSI A;  3LSM A;  2VC1 A;  3FXL A;  1BC7 C;  1IRG A;  5BPI A;  2GXB A;  1PUF B;  4F55 A;  2GM4 A;  5EGO A;  3QYB A;  3GTK J;  3BWG A;  2FQ3 A;  2L7K A;  3WE3 A;  4ESF A;  1IV8 A;  1D5Y A;  2R7D A;  5HNF A;  2BW3 A;  3S15 J;  2MLK A;  2QCO A;  1R7J A;  4IHS A;  2GWR A;  3ZXS A;  4I02 A;  5DEQ A;  2B9S A;  5FRN A;  4P1W A;  2IS4 A;  1FNN A;  3HXL A;  2HPI A;  2Q8K A;  5D8L B;  4HX7 A;  1WH5 A;  5L3C A;  4I6Z A;  3BCA A;  5FO5 A;  5H6R A;  4IQJ A;  2NS0 A;  2DCE A;  4M3E A;  3CP2 A;  3LA3 A;  5CQG A;  3HL2 A;  5CLS A;  2A5W A;  3K4N A;  1QHG A;  5TGT A;  1E17 A;  1UB9 A;  1XGO A;  4XSX F;  2RGV A;  1O3R A;  1TWH J;  5IT3 A;  4YFX F;  4HYE A;  4UXN A;  4R8H A;  2NS8 A;  2IW5 A;  4K2E A;  4U88 A;  2YX7 A;  5JFR A;  2Y0S A;  4ETS A;  3OYI A;  2WB1 A;  1WVR A;  2Q2E A;  4B48 A;  4WXC A;  1QZE A;  4B8X A;  1LUJ B;  3BG5 A;  3COA C;  3G1M A;  1X4P A;  4A6D A;  4PGH A;  2IA1 A;  1MBG A;  3K70 D;  1CGP A;  1WJB A;  2WV1 A;  5EEH A;  1BI1 A;  1IZ1 A;  1FWZ A;  1FT9 A;  4ASN A;  4AU7 A;  3ZQF A;  4AVZ A;  1SD4 A;  2G9W A;  4I98 B;  3FDY A;  3BR3 A;  2HVQ A;  4HW0 A;  2HZT A;  1WSU A;  3ZRG A;  4FX0 A;  3B73 A;  4ZYG A;  3K4J A;  4D9J A;  2VBW A;  4UNO A;  3J7A O;  2MGQ A;  1ETQ A;  4BEH B;  3BRO A;  2O5R A;  1V4R A;  5F6F A;  5D4S A;  3GTQ J;  2R7U A;  1RR7 A;  3DBR B;  1IXR C;  2KRC A;  1FYL A;  4N4O B;  4ON0 A;  2XAG A;  1FOK A;  1G3W A;  2HNH A;  4DJA A;  3LSP A;  2IS6 A;  2HOA A;  1E3H A;  2FBK A;  3GW2 A;  4EJV A;  4J00 A;  1IN6 A;  2R5Y B;  3J81 K;  3ABM H;  2LFB A;  3ZMD A;  5JLW A;  2R7X A;  1T6S A;  3GX4 X;  5EDN A;  4JP0 A;  1A6I A;  5LHH A;  4BE2 A;  3IWZ A;  3R4K A;  1ZR4 A;  1FLI A;  5FGM A;  4NNJ A;  1YQA A;  3F3X A;  3QPL A;  1TT5 B;  3WE2 A;  1K6Y A;  1BW6 A;  3L00 A;  1BI2 A;  2JWT A;  5E20 A;  4YIR X;  3SFI A;  1OCZ H;  2AHQ A;  2E2H J;  4A5N A;  4ZYH A;  4RAZ A;  2EZH A;  1X1B A;  2A5Y B;  2ID3 A;  3I5U A;  1SD5 A;  4ENK A;  4AUX A;  5FLM J;  3OS2 A;  1ACI A;  1FSH A;  2JA8 J;  1O3Q A;  1DU0 A;  2KIM A;  4NUB A;  5J6X A;  4DBQ A;  2QQ9 A;  2CQ7 A;  3L2W A;  4OIO F;  4ZYD A;  1DP3 A;  3PL8 A;  1FBS A;  3S32 A;  3OYN A;  2A6E F;  2FRH A;  1B72 B;  3IAS 2;  4RGS A;  5B3S H;  1QHH D;  2ZJR F;  1OCR H;  4CCN A;  3OL3 A;  3SQN A;  5GPA A;  5K1Y A;  1ETO A;  3A01 A;  4BJT A;  2KJC A;  2L9N A;  1ZN2 A;  4G7O F;  3H9J A;  4MFE A;  2PJR A;  4WWC A;  5J4Y A;  3U1K A;  1BR4 A;  2M45 A;  5E8I A;  1KU9 A;  1IGN A;  1LNW A;  2DXI A;  3ZMV A;  2KHM A;  2W1O A;  5K5Q A;  2F5D A;  3CCJ I;  2MAB A;  3HGY A;  1S5L C;  2KL4 A;  3I54 A;  1VQ8 I;  1TBX A;  2CQQ A;  2H1L A;  3CJN A;  3RPQ A;  3WU2 C;  4CYC A;  2VB6 A;  1P92 A;  1X58 A;  2VBZ A;  3BR1 A;  5D5X B;  3CC2 I;  1ETY A;  3TO7 A;  4WCG A;  1XCV A;  1AHD P;  3M8E A;  1P6R A;  1A04 A;  4JOM A;  2PJP A;  3CCS I;  2CSO A;  1UHW A;  1SMY F;  2QEN A;  5B1B H;  3T5X A;  1O4X A;  3GFL A;  1UG0 A;  2JK3 A;  5DCM B;  3F8F A;  4J19 A;  2XC7 A;  1WRJ A;  3I71 A;  2CS3 A;  3QYE A;  4BDZ A;  4P5O A;  1LJ9 A;  3FHN A;  2CG4 A;  1MW7 A;  3G1L A;  4HA8 A;  1WKM A;  1ZAR A;  4ZC3 A;  1QU3 A;  1SFK A;  1BR1 A;  4U87 A;  4F91 B;  4E7L A;  1HXD A;  1TTY A;  2EA4 A;  3HB9 A;  5GAD J;  4KIC A;  5HOO A;  4DNC A;  3PO3 J;  1S8N A;  3HBL A;  3M9A A;  3CDL A;  3IH2 A;  3W6V A;  3BPX A;  2KJB A;  1PP8 F;  3D5R C;  3C18 A;  4DOZ A;  1EF4 A;  3ASO H;  2VOP A;  1A36 A;  4M3G A;  1WJ5 A;  3JCU C;  2FNA A;  2BYV E;  1OCO H;  2RRE A;  2CQK A;  3HEF A;  3RKY A;  2XRO A;  2P6T A;  2W00 A;  3TP0 A;  3GTL J;  4N0B A;  3H0D A;  4NC6 A;  1AA7 A;  4KIS A;  2RN7 A;  3SDG A;  1FIA A;  1GV2 A;  3IKT A;  2GXG A;  3F9K A;  4A3J J;  1JGS A;  5DYM A;  4XOP A;  1RI7 A;  2IGM A;  2R5Z A;  3V42 A;  3CUQ B;  3F72 A;  4RB1 A;  2UXN A;  4Z6Y A;  3PQK A;  3KP6 A;  2JPB A;  4I99 C;  2DTR A;  1T0F C;  2WV0 A;  1R9T J;  2CH0 A;  4ZZD A;  5IYC J;  2YUS A;  4IEJ A;  4FCY A;  2R7V A;  5IYD J;  5ICG A;  1RET A;  4XLC A;  3VYT B;  2NRA C;  4XNF A;  2FMY A;  2K9N A;  1KQ9 A;  5FLX Z;  4L0Z B;  3EPZ A;  1U6G A;  4LGW A;  3AG2 H;  2V4J C;  5F08 A;  2GIZ A;  3VOE A;  1R5I D;  2RDP A;  4KJZ A;  1DPU A;  2DA7 A;  1S7O A;  1NK2 P;  5TJJ A;  2L02 A;  4KT5 C;  2XB0 X;  5KAI C;  4XRF A;  1K79 A;  2V1U A;  1FTT A;  1XPX A;  5J1Y A;  2KDZ A;  5HDG A;  1UEL B;  5FB2 A;  3F0C A;  1R36 A;  2A61 A;  1JKO C;  1MD0 A;  3KE2 A;  5GTH C;  5FD5 A;  4B43 A;  1MJB A;  2V79 A;  4YG2 F;  3LFK A;  3E6M A;  1Z05 A;  1RKT A;  4ESB A;  3G4S I;  4ZDL A;  3O3K A;  3OR2 C;  3V8K A;  3ZP5 A;  1VQ9 I;  4LG0 A;  2ZC2 A;  4DZP A;  1O7F A;  2Z2S B;  2BY1 A;  3M8F A;  2JRM A;  1LFU P;  5JHU A;  2FML A;  1D8K A;  2H94 A;  4HZF A;  2Y69 H;  3LWF A;  5HLG A;  3GZ6 A;  1V5G A;  1ZH5 A;  1HST A;  1TWF J;  3EUA A;  2K3P A;  3I4P A;  5FJ8 J;  5TIS C;  4KUM A;  3C1D A;  4ZYE A;  1WQ2 A;  4RS8 A;  5FFZ A;  2OBP A;  4RBO A;  2LP0 A;  3DKW A;  4BGD A;  3IUO A;  2CW0 F;  1MJA A;  2NVT J;  3WTT C;  3K70 C;  3CDH A;  3BR2 A;  3NAU A;  3S1M J;  2LR8 A;  4S05 A;  4UB6 C;  2V9V A;  4BE1 A;  2Z3Y A;  2B63 J;  2KDO A;  1UHM A;  3H5A A;  1LKX A;  1ERD A;  5KAF C;  2TDX A;  2NNY A;  2A3S A;  1K7A A;  3R60 A;  3IRQ A;  3L2Q A;  4B09 A;  4L18 B;  4HNT A;  2K5C A;  4Y15 A;  3LNQ A;  1QO0 D;  2WAE A;  3CJR B;  3OYD A;  3H9Q A;  3CCQ I;  1I3Q J;  2P5L C;  4X0G A;  1YIO A;  3R0J A;  3FF5 A;  2DQL A;  2FNP A;  2ZB9 A;  3MQ0 A;  1YW7 A;  5FKN A;  2K9M A;  4DYC A;  5TRD A;  4GYG A;  3VSK A;  5J47 A;  2F4O B;  5EEG A;  4D7M A;  5CVV A;  2OQR A;  5CVI A;  2Z16 A;  1SFU A;  1HCR A;  2LY2 A;  1KQ0 A;  3CZ6 A;  1T8I A;  3ABK H;  3NWT A;  4F93 B;  1HW5 A;  2OTL I;  4R79 A;  2DOF A;  4PSX A;  2VAS A;  4XOT A;  2VBX A;  3GXO A;  3NRV A;  1SMT A;  4A6E A;  4E7S A;  1D0X A;  1LFB A;  4C3H J;  3F22 A;  4KIT B;  1UMQ A;  4A3M J;  3KP2 A;  3HSF A;  4GYI A;  1TW3 A;  3OOP A;  2FF4 A;  2DMT A;  1ZRF A;  2HKO A;  1NTC A;  2AO9 A;  4AID A;  1HQC A;  3KP3 A;  2O8X A;  5CVR A;  2DOE A;  2EV6 A;  4YRV A;  4V19 K;  3F8C A;  1F1Z A;  1MZB A;  2PMH A;  3EUH C;  4F92 B;  5HVQ C;  1YLF A;  2HFH A;  3QP6 A;  2RKH A;  3EYI A;  3RI4 A;  3PNT A;  1D3Y A;  4HDV A;  3CLO A;  2X48 A;  1TQP A;  2DFF A;  3B6C A;  2A68 F;  1RKW A;  1GUU A;  1IN8 A;  3L09 A;  3OYL A;  3ZMU A;  1ZRD A;  5D5W B;  1U3E M;  1IRX A;  1RNL A;  1UST A;  2DMQ A;  1T08 B;  2QYO A;  1BW5 A;  3OS0 A;  1IN5 A;  2LD5 A;  3BG9 A;  5D6E A;  2DN0 A;  3TGN A;  1FEX A;  1WFX A;  1FTZ A;  1QQI A;  3HSR A;  3DV8 A;  4NDL A;  2L0K A;  1B9M A;  3HOU J;  3VOD A;  3LST A;  5BPD A;  3HUG A;  1Z9C A;  2BE5 F;  1ZRE A;  4B1R A;  3CDI A;  1LVK A;  2I5U A;  4JX6 A;  5LGN A;  2ISZ A;  1PVE A;  1RUO A;  3AG4 H;  3RTR A;  1XGN A;  2R7O A;  4IQ4 A;  2XPV A;  3TO6 A;  3AKZ A;  4TV7 A;  2QWW A;  4RB3 C;  3S1N J;  5HLT A;  3DLL F;  1Z21 A;  3SHF A;  3CUQ C;  2EIK H;  5J4V A;  4MEY F;  1VZ0 A;  3ZCO A;  5EEA A;  3PIP F;  3RCO A;  3DEW A;  1S7E A;  4GO1 A;  1W7P B;  2EQR A;  3I9V 2;  4KIF A;  2JVH A;  1TNT A;  1U9N A;  2WAQ N;  2LNB A;  3M1E A;  4C2U A;  4CZC A;  4C30 A;  3OYJ A;  5K5O A;  1I6X A;  5IT9 K;  2XAJ A;  2XVC A;  2FD5 A;  2VT3 A;  3HKZ N;  2V1D A;  3ERE D;  2JUC A;  1FYK A;  3H3V K;  1ITY A;  2BY0 A;  1X4O A;  4P55 A;  2OZU A;  3ABL H;  4PFP A;  3OYH A;  4OMY A;  3HOZ J;  4RLF A;  1FP2 A;  2JA5 J;  3A2K A;  3G6E I;  4YEL A;  2HDC A;  5LGT A;  4IVN A;  3L1P A;  1HKS A;  5ICF A;  4A93 J;  3RIR A;  2CQN A;  3HG9 A;  3WTX C;  3JRC A;  1N75 A;  1ZHF A;  2JRT A;  5E79 C;  2E7X A;  1VQ4 I;  2H09 A;  5DM7 F;  4ZTF A;  2EB7 A;  1JHH A;  3LL7 A;  3WHB A;  3SFZ A;  3BQZ A;  1Y8R B;  3HRS A;  5LHG A;  1W5C C;  2G7H A;  3K2Z A;  3ZQH A;  5B5E C;  1ZR2 A;  2W48 A;  2DJI A;  1RR8 C;  3S2H J;  3UR3 C;  1J09 A;  2ZFW A;  4M72 A;  3RJP A;  3OY9 A;  2NVQ J;  1BI0 A;  3DCF A;  1KGS A;  2XAF A;  2IRF G;  4L5I A;  5D6F A;  1BIA A;  4EGZ A;  3GTP J;  2LMD A;  3KEO A;  2H6C A;  1D1B A;  1MBH A;  3K10 A;  5L3D A;  1BOA A;  5EG0 B;  3RKX A;  1R22 A;  2VIX A;  1WJD A;  4IHX A;  3ZR8 X;  3LAP A;  2K7L A;  5JLX A;  3HOT A;  1IO2 A;  3FXJ A;  3HOS A;  3D0S A;  3HYI A;  4R1H A;  2ME6 A;  2R7Q A;  4BL0 B;  5HLI A;  1RUN A;  1QVT A;  5HS8 A;  2CUF A;  1U5T A;  2ZJ2 A;  3VDX A;  5F1J A;  4LLN A;  3OV8 A;  5FKM A;  2DBB A;  1MMG A;  2M8E A;  2IS1 A;  4NQW B;  1S6L A;  2BW3 B;  3K4L A;  4LK1 F;  1PUF A;  3CJQ B;  3WHC A;  4IHV A;  1AOY A;  3BTI A;  1I39 A;  3Q9S A;  4M6V A;  1I6H J;  3NAR A;  1HDP A;  1GT0 C;  3JAM Z;  4YII A;  2CV0 A;  4IJA A;  2XV4 S;  4A3C J;  3H35 A;  4AD9 A;  1FOX A;  2M30 A;  1YW9 A;  3ECO A;  3MEX A;  3G73 A;  2E1N A;  1ZEL A;  2K85 A;  1YX5 A;  1HDD C;  2PN6 A;  2YU3 A;  3BZC A;  2FQ4 A;  2OZ6 A;  3HDD A;  2EFQ A;  2LKS A;  1T0F A;  2V6C A;  3L2V A;  2R7T A;  4YIF A;  2IJL A;  2IA0 A;  1FSE A;  2VQG A;  4PSW A;  1X1P A;  2L54 A;  4UVC A;  4BKX A;  3JR9 A;  2ZNZ A;  1JHF A;  4A69 C;  3CCE I;  3HTS B;  4EM2 A;  4BXX J;  3TQN A;  2M1B A;  4IZZ A;  4IHW A;  1YX3 A;  5AON A;  4CO8 A;  2X0L A;  4FE7 A;  2JN6 A;  3F8M A;  1QGP A;  5GAG J;  1ZRC A;  1U8B A;  2M2E A;  3GFI A;  2MSY A;  3HRM A;  4EVI A;  1EKE A;  2YU9 J;  3KCC A;  5DM6 F;  4DZJ A;  2PBI A;  2K40 A;  2X1C A;  3KZZ A;  3GF2 A;  1ZLJ A;  1KON A;  1L0O C;  1Y0U A;  4RM2 A;  3WTZ A;  3BR5 A;  4MHG A;  5FKK A;  1DU6 A;  3SJM A;  2BY3 A;  2E2J J;  2LG4 A;  5IYB J;  2HYG D;  2Z1D A;  4BHB A;  4DQ2 A;  1Z0X A;  1S7A A;  3H3U A;  1NHA A;  2A6H F;  2NOG A;  4BEH A;  1I1S A;  3TMO A;  4CH7 A;  1T98 A;  4G9Y A;  5F0C A;  1R23 A;  3JRD A;  2LKP A;  2VBY A;  3MKY B;  3WGH A;  4D7N A;  2EFW A;  4RB2 C;  5IP7 J;  1I50 J;  4XOR A;  2QKM B;  3ZQ7 A;  4BE0 A;  4BY1 J;  5J1U A;  3AL0 C;  4LD5 A;  2K02 A;  4O3M A;  1OIS A;  3C3W A;  3CD6 I;  1JKR C;  1FIP A;  3U9G A;  3H92 A;  3LSG A;  5J8C A;  2R5Y A;  2V26 A;  1I3A A;  4FET A;  2DFE A;  3HRU A;  4X6A J;  2ESN A;  4KN7 X;  2DDB A;  4M9S A;  1LE8 B;  1X2M A;  4FE4 A;  2NVX J;  1VQN I;  2LK2 A;  2D2W A;  4YEJ A;  4BS9 A;  1IRF A;  2VXD A;  3O8H A;  1A5J A;  4P96 A;  2M7B A;  3HHG A;  4L9T A;  1ZKG A;  4QPQ A;  4XM3 A;  4UVB A;  5DTD A;  1BC8 C;  4LB6 B;  1XDS A;  4RMN A;  2P0W A;  1HA8 A;  1O7L A;  3BOQ A;  4ZZL A;  4B3X A;  2J5P A;  3HJE A;  4XN3 A;  5JHF A;  2K9L A;  3FXK A;  1B8I B;  1TWG J;  4Z2Y A;  4ABZ A;  2F48 A;  4IXA A;  2E1O A;  2FUG 2;  4XLE A;  3GO5 A;  3JTG A;  2Y31 A;  3KLN A;  1TP4 A;  2OCC H;  2WTE A;  2P5K A;  1OCT C;  2CMP A;  2GOM A;  1B72 A;  4RM3 A;  5KCM A;  5B1A H;  3A1Y A;  4QLC U;  2VXZ A;  3S2W A;  2X6Y A;  2LRE A;  4W97 A;  1KU2 A;  2EV0 A;  3JRG A;  2P7C B;  3I59 B;  2E35 A;  4OMZ A;  3K0L A;  4S04 A;  3M4O J;  1STZ A;  1K78 B;  4JBA A;  3F8N A;  2LH9 A;  1VND A;  2E34 A;  3ONQ A;  3DXJ F;  4U0W A;  4HNV A;  5C4J J;  5FLX K;  2A69 F;  4FQG A;  2CJJ A;  1JT6 A;  2M9H A;  4O6J A;  2IP2 A;  5F0F A;  2NVY J;  5H2F C;  1A35 A;  2F5C A;  1ZGJ A;  4LOC A;  3LSH A;  4AIH A;  3LSR A;  2Y9Y A;  3GZ5 A;  2JZY A;  3IWF A;  1D0Y A;  2Q0O A;  4U7D A;  1RZ4 A;  3RKQ A;  2ZKZ A;  4ENN A;  1UZC A;  2K86 A;  1APL C;  2OAZ A;  2M8G X;  1K4T A;  2KLO A;  2DFI A;  5KHD A;  3EUH A;  1OLT A;  3FXR A;  1TQI A;  1XSV A;  2G0E A;  3E3V A;  3HM5 A;  1L3L A;  2COM A;  3NEU A;  5DCM A;  4EMS A;  1H89 C;  4U7B A;  4HDU A;  2VL8 A;  2L5Q A;  4XRS G;  4CIC A;  4OU0 A;  2W82 A;  2V7F A;  1YOV B;  3H0G J;  3O8G A;  1LDJ A;  2W7N A;  5DCF A;  2QSG X;  1P4W A;  4A5M A;  3LA2 A;  2YX4 A;  5LGU A;  2KMU A;  3BJ6 A;  5FFX A;  2MC4 A;  4S0H B;  5LFA A;  2CRG A;  1UCR A;  1ZG3 A;  1LQ1 A;  1UAA A;  5BNG A;  1AU7 A;  1BOB A;  4LIT A;  1K83 J;  1USS A;  1MGT A;  1YHQ I;  1T2K A;  5IY5 H;  3BR6 A;  5E3O A;  3R61 A;  2Y48 A;  1OCP A;  4I0A A;  5HDN A;  1OYI A;  2DOA A;  5AIQ A;  3JSO A;  2DDA A;  2E36 A;  5J40 A;  1XMK A;  3V7C A;  2UUZ A;  3CF2 A;  3OIO A;  2MBF A;  4OIN F;  4RGU A;  2DA3 A;  3CUQ A;  3I53 A;  4N4N B;  3RYR A;  2CW7 A;  4F52 A;  2RAE A;  2R3S A;  2ZXH A;  4XL9 A;  2OC6 A;  1GXQ A;  1TT0 A;  1GHC A;  5H6Q A;  3TOB A;  3SZT A;  4A0Z A;  1BJZ A;  2GIV A;  3W2A A;  3R0A A;  1I5Z A;  2EWN A;  3VB2 A;  2K27 A;  3ECH A;  3FWE A;  1X3U A;  3W2V A;  4Q48 A;  4HPQ A;  3OYE A;  1IN7 A;  1J7K A;  2IAI A;  3LOC A;  1QZZ A;  2PI0 A;  4G94 A;  5F64 A;  3WG7 H;  5J8F A;  5L3B A;  3E5X A;  1TL8 A;  1Z7U A;  2RNJ A;  4KIB A;  2IGK A;  3I58 A;  1PP7 U;  2KKO A;  3KP4 A;  4U0V A;  2JQ7 A;  3M8J A;  1U5T C;  2NNN A;  1IDZ A;  4OIP F;  3K4K A;  2B0L A;  2EIM H;  2XSJ C;  3QYF A;  2COB A;  1ULY A;  2EFN A;  1N78 A;  3BG7 A;  3GFJ A;  2QQB A;  2M7A A;  4XMY A;  3RYP A;  3L2R A;  1MBJ A;  3ROU A;  5IOY A;  1P2F A;  1HBX G;  1MH4 A;  3E97 A;  2E1M B;  4M6Y A;  3SDB A;  3RDI A;  1PDN C;  3A02 A;  2NS7 A;  5LEJ A;  2NYX A;  4B47 A;  3DPU A;  3BC8 A;  3JSP A;  2QKL B;  2H27 A;  4GCV A;  3BY6 A;  3DLA A;  3BQY A;  4DYR A;  2O8K A;  1LPQ A;  2OPT A;  2X6X A;  3H5N A;  3ZGK A;  2M34 A;  2F4I A;  4NC7 A;  3MKW B;  3OYB A;  5LEK A;  3CCR I;  2KPM A;  5DV5 A;  3WTY C;  3AG1 H;  1NG7 A;  2L9R A;  1JUS A;  2EK5 A;  3E6C C;  1XN7 A;  3CP8 A;  2PQ8 A;  3VSL A;  3AFH A;  1IXC A;  3CTA A;  3W6K B;  1IG7 A;  2FXA A;  3K1M A;  4ZDP A;  1JGG A;  3BZ6 A;  3E1S A;  3PQJ A;  2FA5 A;  1ZLK A;  2R7S A;  2HTS A;  3PNY A;  3ZOB A;  2E1C A;  1Z3Y A;  1SVM A;  4PJL A;  5CVJ A;  4Q5S F;  1KQ8 A;  3KX2 A;  2JA2 A;  5GP9 A;  1OQY A;  2LSO A;  3IAM 2;  5K7F A;  1JKP C;  1T56 A;  5JI6 A;  4DYQ A;  3C2B A;  4P9U A;  1YRN B;  3HRT A;  2MH2 A;  3I4N J;  1TZL A;  3F6V A;  3FBN B;  1YJN I;  2O61 A;  3O2P E;  1JJ6 C;  1R1T A;  1MMN A;  2WY7 Q;  4KDP A;  1DGR M;  2EPF A;  5H20 A;  1OMI A;  4J01 A;  2VQC A;  4AM3 A;  1WGX A;  1XSX A;  2ZO4 A;  4E7Z A;  2KIU A;  4IRI A;  2ZSH B;  3KEQ A;  2C6Y A;  2OV7 A;  1VQ7 I;  4D5C A;  1XX5 A;  1NH3 A;  2D1H A;  5ERI A;  3S93 A;  2ZCW A;  1I1G A;  2FOK A;  3MD2 A;  3ZN0 A;  5IPA A;  3OMY A;  2UV1 A;  4HAM A;  4CCL A;  4DGW B;  1XMA A;  4PDK A;  1BR2 A;  4WXD A;  4ZTJ A;  4M71 A;  3H5R A;  4PJ0 C;  3OIQ A;  4U0Y A;  3PM1 A;  2ACJ A;  1R4N B;  1J2X A;  2KP6 A;  2EH3 A;  1AKH B;  2E2I J;  3S14 J;  2E19 A;  4G6D A;  2DMP A;  1XB4 A;  1KZH A;  2W25 A;  1J75 A;  2EV5 A;  4GXO A;  2EJR A;  2DAO A;  3M1C A;  1FX7 A;  3FKI J;  2HS5 A;  3O6B B;  4RAG A;  2EZI A;  3I0T A;  4E7K A;  1X3Z B;  4XID A;  2KIQ A;  4BXF A;  4MEX F;  1H9G A;  2HXO A;  4IX7 A;  4HQE A;  1F9N A;  3J7Z I;  5JVG F;  1R1V A;  1B6A A;  3CJT B;  3MZH A;  2QVO A;  3P5J A;  3CCM I;  3TL4 X;  2A05 A;  2RNG A;  1M1E B;  4G6T B;  1BIB A;  4GGG A;  5K5R A;  3Q0V A;  4L5J A;  4KMF A;  2CO5 A;  2OF7 A;  3HC7 A;  3WU0 A;  4A3G J;  1O3S A;  4EQQ A;  4XLF A;  3DKY A;  3GLL A;  1OKR A;  1XGS A;  3DF8 A;  1E2X A;  4B44 A;  3ISP A;  2ZJP F;  2DFH A;  4XSZ F;  4CCM A;  1OJL A;  1VQO I;  1H9T A;  3FIS A;  3IHU A;  3J80 Z;  3WGI A;  1C0W A;  1AWC A;  4P9F A;  1WJC A;  4AVP A;  2HEO A;  5JVT A;  4HRI A;  4IKF A;  4C2M J;  2NXN B;  4CXF A;  2F2E A;  2IA2 A;  1ZK8 A;  4AIK A;  4LG3 A;  9ANT A;  4A3I J;  5GAH J;  4CDG A;  2VJI A;  2DT6 A;  4Y17 A;  3BLY A;  2V1X A;  3S3N A;  1ZAO A;  2KRH A;  2LF8 A;  3PFY A;  3OOU A;  1YJW I;  3MVP A;  2PLY A;  1FP1 D;  2QBY B;  2HXI A;  5M3M J;  2L9V A;  1QA6 A;  4XRS A;  2EZL A;  3PSF A;  3CCV I;  1ZGW A;  2YSR A;  2E60 A;  2WBM A;  1W0T A;  4AYB N;  3OSG A;  2M5W A;  3F23 A;  4ENM A;  2PMZ N;  3Q0W A;  4XN0 A;  1G3S A;  2VN2 A;  5E3L A;  2UXX A;  2VQH A;  5IOZ A;  1W7P D;  3NQO A;  4HF2 A;  3T1B A;  3NWS A;  5M5Y J;  4OIQ F;  4XON A;  3BTC A;  1W7P A;  2BEO A;  1MIJ A;  3ULQ B;  5HOD A;  1X1A A;  2EFO A;  4O5V A;  4FAS D;  4GDF A;  4KT6 A;  2HU9 A;  1HC8 A;  1FPQ A;  1Z77 A;  1WH7 A;  3RQI A;  1EH8 A;  2IS2 A;  1ODD A;  4C9Y A;  1DGW Y;  3VWB A;  3K69 A;  3KPH A;  1Y6I A;  3DEE A;  3KYD B;  4BNC A;  3RSN A;  3W2W A;  5BMZ A;  2WC2 A;  3DQV C;  2CYY A;  4Y3O A;  1WWX A;  2L4M A;  2JPC A;  5EZG A;  2CWE A;  2M4G A;  1DDN A;  1JUM A;  3ABU A;  2ELH A;  2JTV A;  4WXH A;  3ZMS A;  1VQP I;  1VQ6 I;  1SAU A;  3K4M A;  2L01 A;  1MBE A;  5CYV A;  4ZH4 F;  4QTR A;  2E1M C;  3QAH A;  2W85 A;  3QU6 A;  3T0Y A;  4A3D J;  5AIP A;  4UB8 C;  3P9I A;  4PZJ A;  5LRR A;  1EV7 A;  1MNM C;  1X1C A;  2QQA A;  2VQL A;  1D5V A;  2KIF A;  2VKV A;  4XR6 A;  3RQ4 A;  2GBY A;  3VFZ A;  1H0M A;  4BAY A;  2K9Q A;  2H8W A;  4FIS A;  3TOA A;  5FRM A;  3BJO A;  1F43 A;  3M7G A;  1D8J A;  4HNU A;  4G6Q A;  3K4C A;  3FBI B;  3PSI A;  2VPL A;  1VF9 A;  3LA7 A;  1TW2 A;  1MDM A;  3KLO A;  4UUV A;  2HI3 A;  2NAZ A;  1BN5 A;  2FEZ A;  3CC4 I;  5EG0 A;  3T8R A;  3GUD A;  1Z6T A;  3DPT A;  3FKJ A;  4BH9 A;  3QOP A;  3GTJ J;  1D1C A;  1MBK A;  1G4D A;  2AXT C;  3P9C A;  2IEK A;  2W24 A;  4AIJ A;  1YI2 I;  4I09 A;  4CYD A;  4I7H A;  4GRI A;  1MKM A;  1YE9 A;  4H0E A;  4XLA A;  1SFX A;  3TDZ C;  1RIO H;  4UVA A;  4NQW A;  5FKO A;  5BQT A;  1G8X A;  3IKV A;  1QPM A;  2HWV A;  3ZQC A;  2YS9 A;  3L2C A;  2KZV A;  3MN2 A;  5GAE J;  1JI8 A;  4MLO A;  3DKX A;  2XHK A;  3RKW A;  4XKV A;  3CO7 C;  2HKX A;  2CV1 A;  3PUF A;  4Y33 A;  3MKL A;  1JKQ C;  1V5F A;  2DA2 A;  1QVU A;  3CCU I;  1TC3 C;  5D5U B;  2BVM A;  2M4K A;  3I56 I;  2MC3 A;  4MTD A;  2QF7 A;  3OYM A;  4JX5 A;  3V7R A;  2FBI A;  2JUG A;  2W4S A;  4KN4 X;  4CGZ A;  4XLN F;  2FSW A;  2TRT A;  4IRG A;  3GFM A;  1Z91 A;  2IT0 A;  3OIP A;  4NHJ A;  1MDM B;  1LB2 A;  1GVJ A;  1R4M B;  1O57 A;  5HS9 A;  1GVD A;  2DMN A;  4DBR A;  2XPW A;  4CCO A;  1HOM A;  5ILV A;  4XQF A;  1B4A A;  3FHZ A;  2X85 A;  3QU3 A;  2Y9Z A;  4UV9 A;  4Y13 A;  2H8R A;  2BXY A;  4UV8 A;  3QQA A;  2Q1Z B;  4D1Q A;  4A3K J;  1ETK A;  2ZJQ F;  4CA0 A;  1N25 A;  2LC2 A;  4PJJ A;  1K4S A;  1K61 A;  3P9K A;  1W1W E;  1IUY A;  2K4B A;  1WJF A;  2FJ1 A;  4C3I J;  2CU7 A;  2JT1 A;  2UWM A;  1ZGA A;  4CHU A;  3T8T A;  3F6O A;  2LBF B;  4UUS B;  3SEQ A;  3KZI C;  4H4K C;  2PG4 A;  5CJ9 A;  2DYR H;  4XK4 A;  4LJZ F;  1OYY A;  1R00 A;  2VJJ A;  2WAQ A;  3EUK L;  3L7W A;  2DJN A;  1MND A;  2FOW A;  3MAJ A;  4JYK A;  1ONV A;  5DDG A;  2QSH X;  2GA1 A;  1Z7L A;  5ED4 A;  3N97 A;  1FYM A;  3CCL I;  2Y0S N;  3HKZ A;  4BAC A;  3S1R J;  1BI3 A;  1T95 A;  2VE8 A;  3ZQG A;  2WB1 N;  3G71 I;  3U21 A;  2R7W A;  3HPH A;  2RQQ A;  5BOX A;  4PJM A;  4F3Q A;  2W57 A;  1SVL A;  3RZD J;  1XS9 A;  3KYL A;  2X51 A;  3N05 A;  2NOJ B;  4BUP A;  2DO7 A;  2MA3 A;  2O0Y A;  4UUT A;  3VYU B;  4Q4Z F;  1S3J A;  5KNL A;  3ELK A;  1HW1 A;  1LE8 A;  4IHT A;  1MH3 A;  5ILS A;  5C44 J;  1E3O C;  1OYW A;  2CFO A;  2GLO A;  1DPR A;  2Y0M A;  3ASN H;  1W4M A;  3S3M A;  5ILU A;  4QPO A;  2QSF X;  2DT5 A;  1XTA A;  4A0X A;  3JRB A;  1CF7 B;  5F04 A;  4PGG A;  4CSW A;  5FKL A;  2XF7 A;  2HPM A;  1B8I A;  1KA8 A;  1UFM A;  4II3 A;  3FK7 A;  4EV0 A;  3ESW B;  1P7I A;  5L3G A;  3BZK A;  2LKX A;  1U2W A;  2V6E A;  3DBH B;  2R4G A;  5E17 F;  3J7Y J;  4MNU A;  1VQK I;  4HF1 A;  2HR3 A;  3E6B A;  3BJA A;  4A2U A;  1F5T A;  2L7F P;  1MSE C;  3MZ8 A;  1WI9 A;  3GWZ A;  2AS5 F;  3LMM A;  2STT A;  2FBH A;  2I10 A;  4AWX B;  4E6K G;  3I59 A;  3ERM A;  4Y52 J;  2E5Z A;  4KMU X;  1SFE A;  4PUS A;  1A31 A;  2MYS A;  2ETH A;  2R7Z J;  5IT9 Z;  1LVA A;  1K78 A;  2YR2 A;  4M9X A;  4OAZ A;  3GVA A;  2XIG A;  5A2Q Z;  2HYJ A;  1BJA A;  2WAD A;  1F4K A;  2P4W A;  1FMW A;  2XGD A;  1OCC H;  3PJR A;  4NB5 A;  2V1N A;  3HGG A;  4BQA A;  5E8G A;  1VQM I;  2ZBK A;  1DQU A;  2HOS A;  2EIJ H;  3M3Y J;  5C4X J;  2L2O A;  2LY9 A;  3TW6 A;  3DP7 A;  2BHY A;  1SVO A;  3OL4 A;  1LDD A;  4EM0 B;  3F21 A;  3GTO J;  3JTH A;  1IRZ A;  4MFD A;  1J59 A;  2AXL A;  2GOX B;  4IRH A;  2DYS H;  2PFB A;  3ZPL A;  3S8P A;  2ZSI B;  1OR7 C;  5CPR B;  1WI3 A;  1XCB A;  3FIW A;  2LLK A;  4EJT A;  2IVM A;  4FHT A;  2TCT A;  5L3E A;  4A3L J;  4NBQ A;  2R0Q C;  1ZG5 A;  3C7J A;  5EGO B;  3FXQ A;  2HYF A;  2P5V A;  4BXU A;  2MH9 A;  3OYF A;  4RAF A;  2MD5 A;  3FK6 A; 
#chains in the Genus database with same CATH homology
 4MTE A;  2QM3 A;  1VTN C;  2X4H A;  1S29 A;  2RQP A;  2ESH A;  1ZG1 A;  2GAU A;  2HGC A;  3E6D A;  3G3Z A;  5HLH A;  1B9N A;  3LQQ A;  4QWQ A;  3V8L A;  4L9V A;  5HS7 A;  5KK1 A;  3KP7 A;  3HHH A;  1XGM A;  3WGG A;  3FX3 A;  4LLL A;  3EDP A;  4LFU A;  4HV6 A;  4JK1 X;  5LHI A;  4L9N A;  4F7Z A;  2ADU A;  4FT8 A;  4RGR A;  4G8X A;  2CFX A;  3BPV A;  2ZME A;  4XBF A;  1J9I A;  1MJ9 A;  2VOD A;  4YFK F;  3BDD A;  3WTS C;  5DUK A;  3RPU A;  1G3Y A;  2QUF A;  3IRR A;  3ZMZ A;  3W6J B;  1KU7 A;  1FY7 A;  2RVC A;  3N4M A;  4IF4 A;  2ISY A;  2ZXJ A;  4M9Z A;  4RGX A;  3WTV C;  5D5V B;  1Q1H A;  4IPA A;  4EJU A;  5KVR A;  3FXU A;  4LMY A;  3J80 K;  5BS6 A;  2LF7 A;  3ABT A;  4G7H F;  5D4R A;  2STW A;  4MGR A;  4YFN F;  1HW2 A;  2ZME B;  2F5F A;  3B02 A;  2L3D A;  4OOI A;  3MCZ A;  2XUB A;  3P7N A;  1R5G A;  1IF1 A;  4N9I A;  4M74 A;  4BHP A;  3WG9 A;  2VC0 A;  3FZV A;  2EFP A;  5LRS A;  1YG2 A;  3GLX A;  3PFI A;  1B59 A;  1YS6 A;  5DD4 A;  1XDU A;  3TKY A;  3L9F A;  2GQQ A;  5E18 F;  2P7V B;  3KP5 A;  1TQM A;  4G7Z F;  2GA2 A;  1I27 A;  1REP C;  1FBQ A;  2PMU A;  3J81 Z;  3E5Q A;  2Z33 A;  4OIR F;  3KET A;  3ML6 A;  1SD7 A;  6PAX A;  3ZN1 A;  4RB0 A;  2PEX A;  3H3Z A;  4BHC A;  2DI3 A;  3FMS A;  5FD6 A;  1DUX C;  3EYY A;  1YYV A;  1P4A A;  4KYW A;  3DPL C;  2P6S A;  2EA2 A;  5ICC A;  3DFG A;  1FZP B;  1R58 A;  2MLG A;  3TO9 A;  1LEB A;  4A0Y A;  3F8B A;  3IL2 A;  2DQR A;  2OQG A;  3WU1 B;  5D8K B;  2Z5U A;  2UZK A;  2VT2 A;  3WOD F;  4D0P A;  2G7U A;  3GYH X;  3DEU A;  2QBY A;  4I01 A;  4EJO A;  4HX8 A;  1JE8 A;  2VE9 A;  3WTU C;  5DUI A;  2BV6 A;  4HF0 A;  2H6B A;  3SZP A;  3EET A;  4ESJ A;  4A12 A;  1B1B A;  5E1W A;  4LLG F;  3V8J A;  3AAF A;  3REO A;  2O3F A;  2CGP A;  3FM3 A;  2DLL A;  2XKO A;  3FM5 A;  4HLY A;  1IN4 A;  1XSD A;  2ZNY A;  3VEP A;  4EM1 A;  2XGX A;  2DU9 A;  2OU2 A;  1YTY A;  3JW4 A;  1HSJ A;  1U8R A;  3I64 A;  5CVU A;  3MFK A;  3HIF A;  1J0R A;  4LG0 B;  1TLH B;  1K6O A;  4Q47 A;  4ENJ A;  1J5Y A;  1G3T A;  2VON A;  2D1V A;  2OA4 A;  1QBJ A;  1SD6 A;  2HTJ A;  1YO5 C;  3U1D A;  3QP5 A;  1QNT A;  5HDK A;  1OR7 A;  3JAM K;  4KNY A;  1BBY A;  1QZY A;  3QPH A;  4L9J A;  4PCQ A;  2A07 F;  1IAW A;  2QZ8 A;  4HOB A;  1LDK B;  3QPT A;  1EH6 A;  1XD7 A;  1FBU A;  4JQF A;  1JXS A;  2XRN A;  3V4G A;  1U78 A;  3TDU C;  3IC7 A;  4KA4 A;  1DP7 P;  1LEA A;  3Q5F A;  5LLQ A;  4XLP F;  2BGC A;  1KYZ A;  2OD5 A;  2FU4 A;  5L3F A;  4HX4 A;  2Z9O A;  1IXS B;  1YS7 A;  5JR3 A;  2RV8 A;  1W5T A;  3HTU A;  1KU3 A;  2GZW A;  1P4X A;  1W5S A;  3K9T A;  3CUO A;  3SXY A;  2DPU A;  2XAH A;  3KFW X;  2RC4 A;  2DW4 A;  4EJW A;  1BM9 A;  2VOO A;  1R5H A;  1Z6R A;  4BYY A;  3MWM A;  2KRF A;  3MZY A;  4WF2 A;  4UHT A;  3D5L A;  1ON2 A;  5A2Q K;  3LAJ A;  2DK5 A;  3E5U A;  1ZYR F;  2YPR A;  1G6N A;  1EH7 A;  1IW7 F;  5LBQ A;  2Z99 A;  2JSC A;  2O03 A;  3LQR A;  3K1N A;  2BBY A;  2HQN A;  2F5E A;  2LDU A;  1GXP A;  3WTW C;  3BP8 A;  3GEZ A;  3R6S A;  4WX9 A;  3U2R A;  4LK0 F;  3ZMT A;  2K4J A;  1ON1 A;  4HBL A;  4M73 A;  5E1X A;  4EGY A;  2L4A A;  2QLZ A;  2IPQ X;  4CZZ A;  1Z1D A;  4LB5 A;  4E70 A;  4RAY A;  1CF7 A;  2E7W A;  4N9H A;  2J5O A;  3EQL F;  5F1R A;  2Y75 A;  1HKT A;  2WWY A;  1T38 A;  3HSE A;  2DPD A;  3FMR A;  2XAS A;  1T39 A;  2M87 A;  2XAQ A;  2W84 A;  4HLX A;  1OPC A;  1YW8 A;  3FMQ A;  2DK8 A;  4FX4 A;  2D45 A;  4KIG A;  1HKQ A;  3Q9V A;  3CO6 C;  2HOE A;  1FC3 A;  3QRF F;  4HV5 A;  4I0B A;  4WK8 F;  3K1P A;  5E1Z B;  1O3T A;  4MQ9 F;  4KFC A;  2XKP A;  2R7F A;  4MQV A;  1R1U A;  1SAX A;  1KYW A;  3V7S A;  2P8T A;  2FE3 A;  4M6X A;  5DD8 A;  1TNS A;  4HQM A;  2O6G E;  1YFH A;  1PUE E;  1V3F A;  2HQR A;  5ICE A;  4I2O A;  4L0Y B;  1U5T B;  3KZY A;  2VC1 A;  1BC7 C;  1IRG A;  5BPI A;  2GXB A;  3BWG A;  2FQ3 A;  3WE3 A;  4ESF A;  2R7D A;  2MLK A;  1R7J A;  4IHS A;  2GWR A;  4I02 A;  5DEQ A;  1FNN A;  2Q8K A;  5D8L B;  4HX7 A;  5L3C A;  5FO5 A;  5H6R A;  2NS0 A;  3LA3 A;  5CLS A;  1E17 A;  1UB9 A;  1XGO A;  4XSX F;  2RGV A;  1O3R A;  5IT3 A;  4YFX F;  4HYE A;  4UXN A;  4R8H A;  2IW5 A;  4K2E A;  4U88 A;  2YX7 A;  5JFR A;  4ETS A;  2Q2E A;  4WXC A;  4B8X A;  3COA C;  4A6D A;  4PGH A;  2IA1 A;  1CGP A;  5EEH A;  1BI1 A;  1IZ1 A;  1FWZ A;  1FT9 A;  4ASN A;  1SD4 A;  2G9W A;  4I98 B;  4HW0 A;  2HZT A;  1WSU A;  4FX0 A;  3B73 A;  4ZYG A;  2VBW A;  4UNO A;  3J7A O;  3BRO A;  1V4R A;  5F6F A;  5D4S A;  1IXR C;  1FYL A;  4ON0 A;  2XAG A;  1FOK A;  1G3W A;  2FBK A;  3GW2 A;  4EJV A;  1IN6 A;  3J81 K;  3ZMD A;  1T6S A;  3GX4 X;  5LHH A;  3IWZ A;  3R4K A;  1FLI A;  5FGM A;  1YQA A;  3F3X A;  3WE2 A;  3L00 A;  1BI2 A;  5E20 A;  4A5N A;  4ZYH A;  4RAZ A;  2A5Y B;  3I5U A;  1SD5 A;  4ENK A;  1FSH A;  1O3Q A;  2KIM A;  5J6X A;  2QQ9 A;  4OIO F;  4ZYD A;  1FBS A;  2A6E F;  2FRH A;  4RGS A;  3SQN A;  5K1Y A;  2KJC A;  1ZN2 A;  4G7O F;  4WWC A;  2M45 A;  5E8I A;  1KU9 A;  1LNW A;  3ZMV A;  5K5Q A;  2F5D A;  3I54 A;  1TBX A;  3CJN A;  3RPQ A;  1P92 A;  5D5X B;  2VBZ A;  3TO7 A;  4WCG A;  1XCV A;  3M8E A;  1P6R A;  1A04 A;  2PJP A;  2CSO A;  1UHW A;  1SMY F;  2QEN A;  3T5X A;  3GFL A;  5DCM B;  3F8F A;  1WRJ A;  3I71 A;  4P5O A;  1LJ9 A;  2CG4 A;  4HA8 A;  1WKM A;  1ZAR A;  1HXD A;  1TTY A;  2EA4 A;  5HOO A;  4KIC A;  4DNC A;  1S8N A;  3M9A A;  3BPX A;  2KJB A;  1PP8 F;  3C18 A;  2VOP A;  3RKY A;  2FNA A;  2BYV E;  2CQK A;  2XRO A;  2P6T A;  4N0B A;  2RN7 A;  3IKT A;  2GXG A;  1JGS A;  5DYM A;  1RI7 A;  3CUQ B;  3F72 A;  4RB1 A;  2UXN A;  3PQK A;  3KP6 A;  2JPB A;  2DTR A;  2WV0 A;  4ZZD A;  5ICG A;  2NRA C;  2FMY A;  1KQ9 A;  5FLX Z;  4L0Z B;  1U6G A;  4LGW A;  3VOE A;  2RDP A;  1DPU A;  1S7O A;  5TJJ A;  2L02 A;  4KT5 C;  4XRF A;  1K79 A;  2V1U A;  5HDG A;  5FB2 A;  1R36 A;  2A61 A;  1MD0 A;  3KE2 A;  5FD5 A;  1MJB A;  2V79 A;  4YG2 F;  3LFK A;  3E6M A;  1Z05 A;  4ESB A;  3O3K A;  3V8K A;  3ZP5 A;  4LG0 A;  1O7F A;  3M8F A;  5JHU A;  2FML A;  1D8K A;  2H94 A;  4HZF A;  3LWF A;  5HLG A;  3GZ6 A;  1ZH5 A;  1HST A;  3I4P A;  4KUM A;  3C1D A;  4ZYE A;  1WQ2 A;  4RS8 A;  5FFZ A;  2OBP A;  3DKW A;  2CW0 F;  1MJA A;  3WTT C;  3CDH A;  4S05 A;  2V9V A;  2Z3Y A;  1UHM A;  2TDX A;  2NNY A;  2A3S A;  1K7A A;  3R60 A;  3IRQ A;  4B09 A;  4L18 B;  4Y15 A;  1QO0 D;  2P5L C;  1YIO A;  3R0J A;  3FF5 A;  2DQL A;  2FNP A;  3MQ0 A;  1YW7 A;  5TRD A;  4GYG A;  5EEG A;  5CVV A;  2OQR A;  5CVI A;  1SFU A;  1KQ0 A;  1HW5 A;  4R79 A;  3GXO A;  2VBX A;  3NRV A;  1SMT A;  4A6E A;  3F22 A;  3KP2 A;  3HSF A;  4GYI A;  1TW3 A;  3OOP A;  2FF4 A;  1ZRF A;  2HKO A;  1HQC A;  3KP3 A;  2O8X A;  5CVR A;  2EV6 A;  3F8C A;  1F1Z A;  1MZB A;  2PMH A;  5HVQ C;  1YLF A;  2HFH A;  3QP6 A;  2RKH A;  3EYI A;  3RI4 A;  1D3Y A;  4HDV A;  3CLO A;  1TQP A;  2A68 F;  1IN8 A;  3L09 A;  3ZMU A;  1ZRD A;  5D5W B;  1U3E M;  1RNL A;  1UST A;  2QYO A;  1IN5 A;  5D6E A;  3TGN A;  1QQI A;  3HSR A;  3DV8 A;  1B9M A;  3VOD A;  3LST A;  5BPD A;  3HUG A;  1Z9C A;  2BE5 F;  1ZRE A;  5LGN A;  2ISZ A;  1RUO A;  3RTR A;  1XGN A;  3TO6 A;  4TV7 A;  2QWW A;  4RB3 C;  3SHF A;  3CUQ C;  4MEY F;  4GO1 A;  1W7P B;  4KIF A;  1TNT A;  2LNB A;  3M1E A;  5IT9 K;  5K5O A;  1I6X A;  2XAJ A;  2XVC A;  2VT3 A;  2V1D A;  3ERE D;  1FYK A;  4P55 A;  2OZU A;  4OMY A;  1FP2 A;  2HDC A;  5LGT A;  4IVN A;  1HKS A;  5ICF A;  3RIR A;  3WTX C;  1ZHF A;  2JRT A;  2E7X A;  2H09 A;  2EB7 A;  1JHH A;  3SFZ A;  3HRS A;  5LHG A;  2G7H A;  3K2Z A;  2ZFW A;  4M72 A;  3RJP A;  1BI0 A;  1KGS A;  2XAF A;  2IRF G;  4L5I A;  5D6F A;  1BIA A;  4EGZ A;  3KEO A;  2H6C A;  5L3D A;  1BOA A;  3RKX A;  1R22 A;  3LAP A;  2K7L A;  3HOT A;  3HOS A;  3D0S A;  3HYI A;  4R1H A;  5HLI A;  1RUN A;  5HS8 A;  1U5T A;  2ZJ2 A;  4LLN A;  3OV8 A;  2DBB A;  2M8E A;  1S6L A;  4LK1 F;  1AOY A;  3Q9S A;  3JAM Z;  4YII A;  4IJA A;  2XV4 S;  4AD9 A;  2M30 A;  1YW9 A;  3ECO A;  3MEX A;  3G73 A;  2E1N A;  2PN6 A;  2YU3 A;  2OZ6 A;  2EFQ A;  1T0F A;  2V6C A;  4YIF A;  2IJL A;  2IA0 A;  1FSE A;  4UVC A;  3HTS B;  2L54 A;  2ZNZ A;  1JHF A;  4EM2 A;  3TQN A;  2M1B A;  5AON A;  4CO8 A;  2X0L A;  3F8M A;  1QGP A;  1ZRC A;  3GFI A;  3HRM A;  4EVI A;  3KCC A;  2PBI A;  3KZZ A;  3GF2 A;  1ZLJ A;  1L0O C;  1Y0U A;  3WTZ A;  4MHG A;  4BHB A;  2HYG D;  4DQ2 A;  1S7A A;  3H3U A;  1NHA A;  2A6H F;  1I1S A;  1T98 A;  4G9Y A;  1R23 A;  2LKP A;  2VBY A;  3WGH A;  2EFW A;  4RB2 C;  3ZQ7 A;  4LD5 A;  2K02 A;  4O3M A;  3C3W A;  3U9G A;  3H92 A;  5J8C A;  3HRU A;  2ESN A;  4KN7 X;  4M9S A;  2D2W A;  1IRF A;  4P96 A;  3HHG A;  4L9T A;  4UVB A;  1BC8 C;  4LB6 B;  1XDS A;  1O7L A;  3BOQ A;  4ZZL A;  2J5P A;  4Z2Y A;  4IXA A;  3GO5 A;  3JTG A;  3KLN A;  2WTE A;  2P5K A;  4QLC U;  2VXZ A;  3S2W A;  1KU2 A;  2EV0 A;  2P7C B;  3I59 B;  4OMZ A;  3K0L A;  4S04 A;  1STZ A;  1K78 B;  4JBA A;  3F8N A;  3DXJ F;  4U0W A;  5FLX K;  2A69 F;  4O6J A;  2IP2 A;  2F5C A;  1ZGJ A;  4AIH A;  3GZ5 A;  2JZY A;  3IWF A;  2Q0O A;  4U7D A;  1RZ4 A;  2MD5 A;  2ZKZ A;  4ENN A;  2K86 A;  2OAZ A;  2DFI A;  3EUH A;  3FXR A;  1TQI A;  1XSV A;  3E3V A;  1L3L A;  2COM A;  3NEU A;  5DCM A;  4EMS A;  4U7B A;  4HDU A;  4CIC A;  4OU0 A;  1LDJ A;  5DCF A;  1P4W A;  4A5M A;  3LA2 A;  2YX4 A;  5LGU A;  3BJ6 A;  5FFX A;  1UCR A;  1ZG3 A;  1LQ1 A;  1USS A;  1MGT A;  1T2K A;  3R61 A;  2Y48 A;  4I0A A;  5HDN A;  1OYI A;  5AIQ A;  3JSO A;  1XMK A;  3V7C A;  2MBF A;  4OIN F;  4RGU A;  3CUQ A;  3I53 A;  3RYR A;  2R3S A;  1GXQ A;  1GHC A;  5H6Q A;  3TOB A;  3SZT A;  4A0Z A;  2GIV A;  3R0A A;  1I5Z A;  2EWN A;  3VB2 A;  2K27 A;  3ECH A;  3FWE A;  1X3U A;  4Q48 A;  1IN7 A;  1J7K A;  1QZZ A;  2PI0 A;  4G94 A;  5F64 A;  5J8F A;  5L3B A;  3E5X A;  1Z7U A;  2RNJ A;  4KIB A;  3I58 A;  1PP7 U;  2KKO A;  3KP4 A;  4U0V A;  1U5T C;  2NNN A;  4OIP F;  2B0L A;  1ULY A;  2EFN A;  3GFJ A;  2QQB A;  3RYP A;  3ROU A;  1P2F A;  1HBX G;  3E97 A;  4M6Y A;  3RDI A;  1PDN C;  5LEJ A;  2NYX A;  3JSP A;  2H27 A;  4GCV A;  3BY6 A;  5LEK A;  5DV5 A;  3WTY C;  2EK5 A;  3E6C C;  1XN7 A;  2PQ8 A;  3CTA A;  1IXC A;  3W6K B;  2FXA A;  3K1M A;  3BZ6 A;  3PQJ A;  1ZLK A;  2FA5 A;  2HTS A;  2E1C A;  5CVJ A;  4Q5S F;  1KQ8 A;  2LSO A;  5JI6 A;  4P9U A;  3HRT A;  2MH2 A;  3F6V A;  2O61 A;  3O2P E;  1R1T A;  4KDP A;  5H20 A;  1OMI A;  2ZO4 A;  1XSX A;  2KIU A;  4IRI A;  3KEQ A;  2C6Y A;  2D1H A;  5ERI A;  2ZCW A;  1I1G A;  2FOK A;  3ZN0 A;  4HAM A;  1XMA A;  4PDK A;  4WXD A;  4M71 A;  4U0Y A;  2ACJ A;  1J2X A;  4G6D A;  1XB4 A;  1J75 A;  2W25 A;  2EV5 A;  4GXO A;  2EJR A;  2DAO A;  1FX7 A;  2HS5 A;  3O6B B;  3I0T A;  4MEX F;  1H9G A;  4HQE A;  1F9N A;  1R1V A;  1B6A A;  3MZH A;  2QVO A;  1BIB A;  4GGG A;  5K5R A;  4L5J A;  4KMF A;  2CO5 A;  3WU0 A;  1O3S A;  4EQQ A;  1OKR A;  1XGS A;  3DF8 A;  1E2X A;  4XSZ F;  1H9T A;  3IHU A;  1C0W A;  3J80 Z;  3WGI A;  1AWC A;  4P9F A;  4AVP A;  2HEO A;  5JVT A;  4CXF A;  2F2E A;  2IA2 A;  4AIK A;  4CDG A;  4Y17 A;  2V1X A;  1ZAO A;  2LF8 A;  2PLY A;  1FP1 D;  2QBY B;  2YSR A;  2M5W A;  3F23 A;  4ENM A;  1G3S A;  2VN2 A;  2UXX A;  1W7P D;  3NQO A;  4HF2 A;  3T1B A;  4OIQ F;  1W7P A;  2BEO A;  3ULQ B;  2EFO A;  4O5V A;  1FPQ A;  1EH8 A;  1ODD A;  3K69 A;  4BNC A;  5BMZ A;  2WC2 A;  3DQV C;  2CYY A;  1WWX A;  2L4M A;  2JPC A;  2CWE A;  1DDN A;  3ABU A;  4WXH A;  2ELH A;  2JTV A;  3ZMS A;  2L01 A;  5CYV A;  4ZH4 F;  3QAH A;  2W85 A;  3QU6 A;  3T0Y A;  5AIP A;  3P9I A;  4PZJ A;  5LRR A;  1EV7 A;  2QQA A;  1D5V A;  2KIF A;  3VFZ A;  1H0M A;  4BAY A;  3TOA A;  3BJO A;  3M7G A;  1D8J A;  4G6Q A;  3LA7 A;  1TW2 A;  1MDM A;  3KLO A;  4UUV A;  2NAZ A;  1BN5 A;  2FEZ A;  3T8R A;  3GUD A;  1Z6T A;  3DPT A;  4BH9 A;  3QOP A;  1G4D A;  3P9C A;  2W24 A;  4AIJ A;  4I09 A;  4CYD A;  4I7H A;  1MKM A;  4H0E A;  1SFX A;  3TDZ C;  1RIO H;  4UVA A;  4NQW A;  5BQT A;  3IKV A;  1QPM A;  2HWV A;  3L2C A;  2XHK A;  3RKW A;  3CO7 C;  2HKX A;  5D5U B;  2MC3 A;  4MTD A;  3V7R A;  2FBI A;  4KN4 X;  4CGZ A;  4XLN F;  2FSW A;  4IRG A;  3GFM A;  1Z91 A;  2IT0 A;  4NHJ A;  1MDM B;  1LB2 A;  1GVJ A;  5HS9 A;  1O57 A;  5ILV A;  1B4A A;  3FHZ A;  3QU3 A;  4UV9 A;  4Y13 A;  4UV8 A;  3P9K A;  1IUY A;  2K4B A;  2JT1 A;  2UWM A;  1ZGA A;  4CHU A;  3T8T A;  3F6O A;  2PG4 A;  5CJ9 A;  4LJZ F;  1OYY A;  1R00 A;  3L7W A;  5DDG A;  3MAJ A;  1ONV A;  2GA1 A;  5ED4 A;  3N97 A;  1FYM A;  1BI3 A;  2VE8 A;  5BOX A;  2W57 A;  2DO7 A;  2MA3 A;  2O0Y A;  4Q4Z F;  1S3J A;  3ELK A;  1HW1 A;  4IHT A;  5ILS A;  1OYW A;  1DPR A;  2Y0M A;  1W4M A;  5ILU A;  2DT5 A;  4A0X A;  1CF7 B;  4PGG A;  1KA8 A;  1UFM A;  4EV0 A;  5L3G A;  1U2W A;  5E17 F;  4MNU A;  4HF1 A;  2HR3 A;  3E6B A;  3BJA A;  4A2U A;  1F5T A;  1WI9 A;  3GWZ A;  2AS5 F;  2STT A;  2FBH A;  4AWX B;  3I59 A;  4KMU X;  1SFE A;  2ETH A;  5IT9 Z;  1LVA A;  1K78 A;  2YR2 A;  4M9X A;  3GVA A;  2XIG A;  5A2Q Z;  1BJA A;  1F4K A;  2P4W A;  4NB5 A;  4BQA A;  5E8G A;  2ZBK A;  3DP7 A;  1LDD A;  4EM0 B;  3F21 A;  3JTH A;  1J59 A;  2AXL A;  4IRH A;  2PFB A;  3ZPL A;  1XCB A;  4EJT A;  2IVM A;  4FHT A;  5L3E A;  1ZG5 A;  3C7J A;  3FXQ A;  2HYF A;  2P5V A;  4BXU A;  2MH9 A;  3ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...