1JKQC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*TP*AP*TP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkqC00
1LFUP 1JTXA 2E1OA 2EH3A 5IYDJ 1JT6A 1PUFA 2DMPA 3CCYA 1MSEC 2XGEA 2XGDA 2DTZA 5M3FJ 3LSRA 2MG4A 1RPWA 2NS7A 2Y0SN 2KDZA 4A3KJ 3HBLA 3TW7A 2R5ZA 1A6IA 5J1YA 1B72A 1W0UA 2MSYA 4IEJA 1XG1A 3A03A 3ZQIA 4A3JJ 1GV5A 3B6CA 3HOWJ 3S2HJ 5EGOA 1I50J 1MH3A 2GBYA 4QIWN 3BTIA 1ZQ3P 4XRMA 2MW8A 5EEAA 3Q0UA 3S1RJ 4A3DJ 1EF4A 2X48A 1G2HA 2R5YA 3E7LA 1WGXA 2DA3A 1OFCX 2VKEA 4M3FA 1APLC 2E19A 4D7MA 5BNGA 2DMNA 3BG3A 2LKXA 3LSJA 4D7NA 2M2EA 4V2FA 4D5FA 1F43A 1WPKA 1NTCA 2LFBA 3ZQFA 2CQQA 4MO7A 2E2HJ 1MBGA 3M3YJ 3CQZJ 4A3CJ 1VFCA 3S1MJ 4BXXJ 1DU0A 2VUMJ 3IH4A 2M8GX 3ZQLA 1BL0A 3MKLA 2ID6A 2XGCA 4BBSJ 5IYCJ 1IC8A 3C2BA 1WI3A 1ETWA 1FEXA 1FIAA 1I3QJ 3IH3A 1W0TA 2I10A 3JRBA 1ETXA 1U9NA 2YU9J 2EQRA 4XIDA 4LOCA 3W6VA 2ECCA 2M9HA 4JX4A 2DA7A 3BTLA 3UKGA 4A3FJ 3S15J 3B6AA 4M3DA 2GM4A 4QSHA 1ZTRA 1IDYA 3FK6A 2CUFA 4B1RA 2L7FP 2FX0A 5IYBJ 5EG0B 5J1RA 5DS9A 5JLWA 1ITYA 5F1JA 2QCOA 1IRZA 1Y1VJ 2FQ4A 4AC0A 5FKNA 5J3LA 2JA6J 5E3LA 3HKZN 5FLVA 1YRNB 4MFEA 1ZKGA 2JA5J 3OIOA 3GTOJ 3HDDA 3RZOJ 4AUXA 1IG7A 4AYBN 3S2DJ 1JUPA 2LTPA 2EZKA 3Q3SA 4M3GA 1BA5A 4V2GA 4XRSA 1TWGJ 1B8IB 1ETYA 3G1MA 3OOUA 5F0FA 3HOZJ 1T33A 4A3MJ 1X2NA 4DZJA 4FE7A 1PUFB 3GTPJ 1MSFC 2NOGA 1JUSA 1VNDA 4IHVA 5M3MJ 2Y2ZA 4B3AA 3D1NI 2L7ZA 4G12A 1E3OC 2M0CA 2WV1A 1GUUA 2NVYJ 3H3VK 2R5ZB 4A3BJ 1B72B 1A5JA 2R0QC 1WH7A 1U8BA 5C3EJ 1MH4A 3GBGA 2GLOA 4BY1J 1HF0A 1JKOC 4BKXA 5EGOB 2IEKA 5K7HA 5C44J 4BBRJ 3H0GJ 5F0CA 2YS9A 3L1PA 2R5YB 4MIMA 1K61A 2X6OA 2LVSA 1JTYA 2CRGA 3SFIA 2PMZN 1JT0A 2NVXJ 2JMWA 1VF9A 4IHXA 1ETQA 3HOYJ 4FTHA 1S7EA 1HDDC 1TC3C 4A3IJ 3JREA 4DYRA 2O8KA 3BG5A 4M6VA 5EYRA 3IH2A 5FKLA 4UUSA 3JRAA 1H88C 1H89C 2E2IJ 2XSDC 2G0EA 3BT9A 3JRGA 3K7AJ 2N8GA 3O8GA 2Y9ZA 2XPUA 4ABZA 3RKQA 2IBDA 1TWFJ 1HCRA 1O4XA 4MFDA 4UUTA 5EZGA 1HDPA 1NK3P 4I6ZA 1AKHA 1R9TJ 5EF6A 5FKOA 2VPRA 3HOXJ 1F36A 2P81A 3PM1A 3CMYA 4RBOA 2HXIA 5FKMA 3QPSA 1IDZA 2ZB9A 5JLXA 1CQTA 3ZQCA 3BTCA 1AU7A 2DA4A 3G1LA 2EZHA 2L7MP 5F0HA 3OSFA 3GTJJ 3HGYA 5IP9J 1VI0A 5FLMJ 3K2AA 2DA2A 3BR5A 1ETKA 9ANTA 2LK2A 3RQIA 2H8RA 1RKTA 3S14J 3M4OJ 2O7OA 3BQYA 4XK4A 3HM5A 1FTTA 2FD5A 1QRYA 5IOYA 1Q1VA 3BG9A 2TCTA 1MNMC 2DMTA 2XRLA 2L9RA 2JA8J 4DW6A 2JK3A 1T56A 1JUMA 3TP0A 1SFOJ 1OCPA 4C2MJ 5K7FA 4B4CA 2HI3A 1QVUA 2RAEA 3F0CA 2VI6A 4DZPA 2HOTA 5C4XJ 3HB9A 1ENHA 3LOCA 3S16J 4IHYA 2Y31A 4A69C 5EDNA 3HGGA 2DA6A 5GPAA 2DA5A 4A3EJ 1P7IA 1ZK8A 3NARA 2IAIA 3HEFA 1LE8A 5EZHA 5E3MA 3MN2A 4FE4A 1HLVA 3BR6A 1IV6A 2OPTA 1MBKA 5GP9A 3TP3A 1MBHA 5IP7J 1FIPA 2ECBA 3BR2A 4QTRA 2HOAA 3DEWA 3FK7A 3JRFA 3A01A 1FTZA 1WH5A 1XC5A 3I4MJ 2OF7A 2VKVA 4JYKA 1K83J 2R93J 1POGA 2CU7A 4CYCA 3CDLA 1JJ8C 4FCYA 2X9DA 4C3JJ 2D5VA 4C3HJ 4Y7NJ 2K9SA 5DTDA 5IP6A 2WAQN 4W1UA 2R7ZJ 1ETVA 3ZOBA 5FKKA 1RESA 1JJ6C 1TWHJ 2AHQA 3LSGA 5E3OA 4D5CA 3BQZA 1MBFA 2QF7A 2XB0X 2KT0A 2DA1A 1MBJA 2HOSA 2JWTA 2EZIA 1X58A 1BW6A 3G1OA 4UUSB 2FJ1A 2Y30A 2Y9YA 2AO9A 3GTLJ 5GPCA 3IV5A 3VPRA 4M3EA 4X6AJ 3SJMA 1LFBA 2H1KA 1GT0C 2CUEA 5F27A 2HYJA 3JRHA 2ID3A 2XB5A 4MLOA 2XPWA 1QPIA 4Y52J 3WHBA 1JKPC 5IOZA 1GV2A 3FKIJ 1JKQC 1Z77A 1TWCJ 3GTMJ 2EBIA 4A3GJ 3S1QJ 4L5EA 5M5YJ 1D5YA 2DJNA 2LR8A 1AKHB 5FJ8J 3NAUA 4RDUA 1XS9A 4GFBA 2LD5A 1QVTA 2LY9A 4DYQA 3I4NJ 4JX5A 3JRIA 3A02A 1IJWC 2MGQA 4EEFG 5HODA 3Q0VA 2ME0A 1ZGWA 1ETOA 3MVPA 4I76A 3QPLA 4M3BA 2K9NA 4FISA 3S1NJ 4A93J 3GTKJ 3FIWA 3JRDA 1I6HJ 1JKRC 1P7JA 2M34A 3LSPA 4IHWA 3RZDJ 3SDGA 3HOVJ 2LLKA 2CJJA 2B63J 4DYCA 3BR3A 2HXOA 2COBA 3PO3J 1NK2P 3DCFA 4W97A 3OSGA 3WHCA 2E2JJ 3S17J 5C4JJ 2CQXA 3TW6A 1JGGA 1BW5A 2JA7J 2ELKA 5F08A 4BY7J 3QQAA 3PO2J 1WCMJ 2NS8A 3GTQJ 3ZQGA 1IUFA 3BR1A 1OCTC 5E3NA 1ORKA 5IPAA 1X2MA 2JJ7A 1GVDA 3BTJA 2NVQJ 1RR7A 2HDDA 3JR9A 5M5XJ 4JP0A 1GDTA 4JX6A 1UHSA 4NDLA 2LP0A 4XICA 5M5WJ 1RETA 2DMUA 2DMQA 2O9LA 3HOUJ 2K9QA 4HNVA 1LE8B 3GTGJ 4A3LJ 1ZR4A 1BJZA 1UG2A 1Z0XA 3JRCA 2ME6A 1UMQA 1Y1WJ 2K40A 4XRSG 4C3IJ 2DN0A 4X1EA 1SANA 5J1UA 5EG0A 1OJLA 4S0HB 2EZLA 3A01B 3O8HA 1MBEA 3Q0WA 1IGNA 1FJLA 2YUSA 3BR0A 4J19A 3LNQA 2WB1N 2L0KA 2TRTA 1U78A 2XPVA 4CYCB 5K7ZA 1YRNA 2JN6A 3TEDA 2NVTJ 2R92J 1AHDP 1U9OA 5F04A 3FISA 1ZR2A 1TWAJ 1H8AC 3ZQHA 1RKWA 1B8IA 1HOMA 1DU6A 2HQ5A 2W48A
chains in the Genus database with same CATH superfamily
1I5ZA 3OS0A 1ZRCA 4RLFA 2MC3A 1YIOA 1JT6A 2K5CA 3CCSI 1FBQA 2DMPA 2F5FA 4R1HA 1R1UA 3VWBA 3W3CA 3TO6A 4Z2YA 2QKLB 1JHFA 1RPWA 3CF2A 1KQ0A 2Y0SN 3DPLC 4CICA 4RB2C 3BJAA 4ASNA 1I3AA 4B47A 2RNGA 1IN7A 4EM2A 4BE1A 2GXAA 4IEJA 1ZN2A 4I0BA 1W5CC 2F4OB 5D5UB 3A03A 3TL4X 1K78B 1XGSA 3CLQA 2KRFA 4G9YA 2ZFUA 4YEJA 2X4HA 2EK5A 3K4KA 4QIWN 3S1RJ 2DBBA 2LREA 4JK1X 3CC4I 1T2KA 1Z6TA 5HDGA 5DDGA 3F8BA 1UAAA 2VKEA 4M3FA 3FHZA 4FX0A 2BXYA 2LG4A 3HIFA 4I2OA 3KP2A 3AAFA 1NG7A 5JVGF 5BNGA 2CH0A 3ZPLA 1OISA 1K4TA 1MMAA 2HYGD 3BG3A 2P4WA 4C2UA 2E7XA 3LSJA 2RN7A 4XOPA 2PLYA 2EIKH 2PMUA 4QPOA 1UB9A 3LQQA 4AIJA 1F43A 1WPKA 1VQ9I 4YG2F 2E2HJ 2CQQA 4KFCA 3A4CA 3M3YJ 2X1CA 1LNWA 4E7LA 4Y15A 3EQLF 2ZJRF 3CD6I 4OINF 4NC6A 4BXXJ 4DJAA 3VSKA 4BQQA 3ZQLA 3MZHA 1BL0A 1W5SA 1GXPA 2ID6A 4KDPA 1UFMA 1E17A 4BDZA 4BBSJ 2A68F 4M73A 1PYVA 3HXLA 1HXDA 1WRJA 2HKXA 3OYKA 4QPQA 1IC8A 1CF7A 1WI3A 1WJ5A 4YFXF 1V5FA 1VZ0A 3H36A 2LF8A 3VYUB 3FXKA 3G3ZA 4LB5A 4I7HA 5B5EC 4HV6A 2EFPA 1X1BA 2QSFX 2VBZA 4H4KC 4BYYA 1R22A 2YU9J 3KEYA 2PG4A 5ICEA 2MH9A 1YYVA 2DFIA 4PFPA 5LGTA 4WCGA 4JX4A 3JSPA 5HS9A 1JI8A 5H2FC 3WU0A 3ERMA 1KQ8A 3ZN1A 4Y17A 1ZTRA 1RRJA 1FSHA 3KP5A 4B1RA 4UUVA 2L7FP 1W36C 1Z7UA 3H92A 1BI3A 1X1DA 4X0GA 2CW8A 3ZN0A 2X85A 2V9VA 3RTRA 1W7PB 1T0FC 4AIKA 2FQ4A 1D8JA 2M5WA 3ZXSA 4AC0A 5D4SA 4E7IA 2KDOA 5J3LA 2OCEA 2JA6J 3CUQB 1FBSA 2CWEA 2JA5J 5IT3A 3VB2A 3GTOJ 3P9KA 3HDDA 3NRVA 2V1UA 2Z33A 1WHUA 4AYBN 2JTVA 1JUPA 2JSCA 3Q3SA 1FBUA 4PJ0C 2W7NA 4LGWA 1I1GA 1XPXA 1IAWA 2F4IA 1D1CA 1RUOA 2BV6A 3OOUA 2IRFG 1IXCA 2QVOA 3DLLF 1J59A 4NBQA 2NNYA 4QWQA 4L5IA 4M9XA 2OV7A 3DPUA 1PUFB 1MDMB 3KFWX 1FLIA 2PX9A 2KIUA 4BXFA 1MSFC 4IHVA 1Z21A 5M3MJ 5FRNA 4B3AA 3PFYA 3PSIA 3D1NI 2LBFB 2R7UA 3CO6C 3MZYA 1P4XA 4YRVA 4D1QA 4II2A 2M0CA 3FMQA 4GCVA 2BW3B 2XF6A 2FXAA 2L9VA 2R0QC 4EJVA 2KLOA 3V7RA 2A6EF 2ISYA 3IKTA 3EYYA 2QQ9A 2UXNA 4GYGA 3EYIA 1HKSA 2FU4A 1JKOC 2Y48A 4BE2A 5C44J 4IHTA 4PZJA 1I1SA 3CTAA 1K61A 2X6OA 1JTYA 3K1NA 3CJNA 3KE2A 3MZ8A 5FRMA 2R7WA 3G71I 5LEKA 2ISZA 3HYIA 1JGSA 2JMWA 1UHWA 1LEBA 3R61A 3E5UA 3WGHA 2F5EA 4EVIA 2JQ7A 3R6SA 2QUFA 3QODA 2DAOA 2WA0A 1WJCA 2M87A 3BG5A 4O6JA 2GOXB 3PNTA 3PJRA 3DU5A 5FKLA 3CO7C 4OIOF 3RKWA 2VOPA 3EUKL 4MTDA 1E2XA 5FROA 2G0EA 1DGRM 3BT9A 5E20A 3OYHA 3JRGA 2JPCA 2Z2SB 3CUOA 3RCOA 5BMZA 2N8GA 1V55H 2ZO4A 2WY7Q 3RKQA 2K4JA 1D3YA 3PSFA 3LSMA 1O4XA 2VN2A 1N78A 4G7OF 1HDPA 5CVJA 2PBIA 5CKTA 1WWXA 1G4DA 1R9TJ 1XSVA 4MEXF 3VEPA 2CMPA 1C0WA 1OYIA 2FEZA 2F5VA 3ZCOA 3GW2A 1OQYA 4MTEA 4II3A 2ZFWA 3ZMVA 3PM1A 4XLFA 2QBYB 3FMRA 4GGGA 4RBOA 2R7VA 2HXIA 3LQRA 3QPSA 1G3SA 1IDZA 1FT9A 1FX7A 1AU7A 2BHZA 3G1LA 1XX5A 1QPMA 3G2BA 4LMYA 2YPRA 2ZXJA 5D8LB 3OSFA 1YLFA 3CJQB 1KYWA 3BR5A 3T8TA 4WK8F 3P7NA 3E5XA 1B1BA 1Z6RA 1SD7A 4U0WA 3IHUA 3RQIA 4CH7A 2O7OA 3OYCA 3S14J 4HNTA 1DP3A 2DU9A 2FQ3A 3BPVA 1FTTA 4BEHB 2ZSIB 2Y0SA 3J7AO 2QWWA 4Q47A 2KJBA 2R7TA 1QZEA 2I8DA 4G6DA 3DQVC 1OCOH 2OTLI 1MNMC 4UB6C 2VONA 1JUMA 3FXLA 3M9AA 4YIRX 1SFOJ 3TDUC 1YW8A 2HDWA 3OL3A 4G94A 4LIVA 5K7FA 4Q48A 1G6NA 1YS6A 4ZZDA 4AWXB 2FBKA 5B66C 2AS5F 1XN7A 4BXUA 1REPC 4DZPA 4L9VA 5C4XJ 3HB9A 1UZCA 3KP6A 1SFUA 2AQEA 3GZNB 2DA6A 4CZCA 4JQFA 4A3EJ 4A12A 1IW7F 3HEFA 5E18F 3E3VA 2OUMA 1KU9A 4FE4A 4OIQF 2NVUB 5GP9A 3DEEA 1ZG1A 2FNAA 2V79A 1TNSA 3FKJA 5HDKA 2BHYA 4LIUA 1IN4A 4L18B 4NNJA 1FTZA 1XC5A 2OZ6A 3NQOA 1K6OA 3KP7A 2MD5A 3OIPA 4EJUA 2IS2A 4PDKA 4ZYHA 4HW0A 3X2QH 3QAHA 5K5OA 1N75A 2VT3A 3CDLA 2XAGA 1ZARA 2ETHA 6PAXA 4LITA 2WAQN 4KIFA 4KN7X 3E6BA 2R7ZJ 4B3XA 2P7CB 3LFKA 1QZZA 4XLAA 5E1WA 1RESA 2DO7A 1G3TA 1JJ6C 5E3OA 4ZTJA 4D5CA 1VQNI 1MBFA 5GTIC 2DA1A 5J8FA 1FYLA 2VLAA 1BBYA 4A5NA 3G1OA 2Y9YA 2R7FA 5FGMA 4L9JA 2V1DA 2NS0A 1S7AA 2A61A 1GT0C 2CUEA 2FE3A 4KT6A 4D0PA 1EA3A 2HYJA 3CZ6A 3JRHA 3KCCA 4KNYA 2AXTC 4PJMA 3WHBA 1HSJA 2FBIA 3LMMA 3TOAA 2EBIA 1HW5A 3UNGC 2L4MA 2EIJH 2DJNA 3DLAA 4M9SA 2LR8A 4S04A 1YX5A 4RDUA 4CCOA 4C2TA 2LD5A 1QVTA 3OR2C 3EUHC 4GYIA 4DYQA 4E7ZA 3M1EA 3A02A 2Q8KA 2LNBA 1DGWY 2B7EA 4BACA 2MGQA 1BJAA 3ZMZA 2OZUA 3FBNB 1XCBA 3NWSA 3Q0VA 3FXUA 4CSWA 4IOAF 5HLHA 2VQHA 3HRTA 4YELA 1U8RA 4AIHA 3K1PA 1JE8A 2TDXA 4A93J 3GTKJ 2E1MB 2Q2EA 3QPTA 3V4GA 2E1NA 2M34A 3FHNA 1WJBA 3LSPA 5HNHA 3H1CA 2GA2A 3SDGA 3RZDJ 3BJOA 2VXDA 4ZYAA 1O7FA 2LLKA 2EV5A 2ZMEB 3DKXA 2HXOA 4Y33A 3S32A 4HEA2 2E71A 1NK2P 3ASNH 2C6YA 4MHGA 1SAUA 4HG2A 3MAJA 2HOEA 4A6DA 3QPHA 3TW6A 4BQAA 5DV5A 4BY7J 4HQMA 3QQAA 3G73A 5KAIC 4F52A 2ICWG 1E3HA 4BAYA 5LGNA 3H9JA 2KP6A 3ZQGA 4A0ZA 3KEQA 1R5ID 3L9FA 1ORKA 2P7VB 2BY1A 5IPAA 5L3GA 1HQCA 4LK0F 3MFKA 3JAMZ 1RR7A 4HX7A 2CFOA 4I99C 2NVQJ 3JR9A 1T8IA 3KLNA 4NDLA 1GDTA 1ULYA 2M1BA 2XC7A 5M5WJ 2VE9A 2DMUA 1R49A 2GAUA 2E5ZA 3H5RA 2K02A 3H9GA 2O9LA 2W4SA 4N9HA 4KISA 2K4BA 4A3LJ 4O3MA 3HUGA 1UG2A 5F1RA 3JRCA 5FLXZ 1IO2A 2BGCA 4XRSG 1WJAA 2DN0A 3TOBA 1YX3A 5J1UA 1ZG3A 2F4MB 4UXNA 5J6XA 3AL0B 2M7BA 3O3KA 3Q0WA 4RB0A 2L54A 2YUSA 5H6QA 4OWRB 3CCMI 4U0YA 2MLGA 1U78A 3TO7A 3CESA 4CYCB 3GZ6A 1U0JA 1D0XA 4ZJZA 2R7SA 2OA4A 1U9OA 3FISA 2HR3A 2JUGA 1NH3A 1TWAJ 3OR1C 4B09A 5ICCA 1H8AC 3ZQHA 1YE9A 3KYDB 3ABLH 3L2UA 2EFQA 1DU6A 4YFNF 5KK1A 4IHSA 4DBQA 1GLNA 1JTXA 2VASA 2H1LA 3H3ZA 3F6OA 4PCQA 3CCYA 3L09A 1MSEC 3L2VA 2XGEA 4FX4A 2WAFA 2RKHA 4HSRA 3LSRA 3BPXA 2MG4A 4DIQA 4A6EA 2NS7A 4XSXF 4ESBA 1STZA 3I4PA 3T1BA 3HBLA 1XDSA 1T0FA 2R5ZA 1MGTA 3T8RA 5J1YA 1B72A 3H5AA 4FETA 3FF5A 3SZTA 4CO8A 5A2QZ 3CCJI 3F21A 2NYXA 1UG0A 2DDAA 3S2HJ 2ACJA 3KP4A 3KX2A 1X19A 2GBYA 4WXHA 1J09A 1W7PD 2CUJA 3I64A 5EEAA 1EF4A 1G2HA 4DOZA 3E7LA 1EH6A 5DEQA 1B9MA 1OFCX 2EV0A 4DQ2A 3WTVC 4R79A 4KMFA 4P9UA 1MMGA 2E19A 2LMDA 2DMNA 5DUKA 2DODA 2HQNA 2KIMA 4GDFA 2Z3YA 2OQRA 2M2EA 3E0JB 4RGSA 1SVMA 3NWTA 2LFBA 4MO7A 3K4CA 2HPIA 3QP5A 3RYPA 3FZVA 4JBAA 3GUDA 4L9NA 2XGCA 1OLTA 5IYCJ 5D8KB 4M74A 3RSNA 3DKWA 1ON2A 1YW7A 2J5PA 2B9SA 1T6SA 4PSWA 2FA5A 2HFHA 2D2WA 2WB1A 3J81Z 4GRIA 3CJTB 2O0YA 2CO5A 1ETXA 4UVBA 2HKOA 4XIDA 1D0YA 2CS3A 3K4BA 4OMYA 4MEYF 2ECCA 1RIOH 2M9HA 2QQ8A 2DA7A 2GA1A 2MBFA 3CMAI 4A3FJ 2VXZA 1MZBA 4HX8A 1VQLI 1LVKA 4XL9A 1I6XA 2CQ7A 4U0VA 4F93B 4M71A 1TP4A 4IRIA 2VQCA 5J1RA 3DXJF 5JLWA 2K86A 3PUFA 2QSHX 4IJAA 2P5VA 3ABTA 1S8NA 1X1CA 2MYSA 3DP7A 4XKBA 3AG1H 2M4GA 5FLVA 3P9IA 2VL8A 4I0AA 4MFEA 1YRNB 2UWMA 4ENNA 3FWEA 4ZZLA 2BYVE 2D1VA 1WZ2A 1IN8A 4AUXA 3PFIA 1IG7A 3S2DJ 1O3QA 1BA5A 1EV7A 4EMSA 2KISA 4LK1F 3HTSB 1ETYA 3JTGA 1PP8F 5ERIA 3PQJA 5JFRA 1XSXA 2M4KA 4XKVA 4LLNA 4FE7A 3BZKA 4RB3C 3OYNA 2HGCA 3SDBA 2NOGA 1VNDA 3U1DA 2K9MA 5F6FA 3MKYB 2O03A 2L7ZA 4G12A 5JR3A 1G3YA 1LDKB 2PJRA 1OPCA 1R71A 4RM2A 1WH7A 1U8BA 1MH4A 3GBGA 2NAZA 1PVEA 2D45A 4Y4RA 1XMAA 1LJ9A 4UY8I 1P4WA 1LPQA 1USTA 4AVZA 5ILVA 3GCMA 2Y69H 1SAXA 2IGOA 1PP7U 2IVMA 2QZ8A 4AVPA 2LVSA 2CRGA 1N25A 3SFIA 4EQQA 4XLNF 1WKMA 3CF5F 2CFXA 2DOEA 2NVXJ 1XD7A 2V9KA 2P5KA 1ETQA 4RAYA 3HOYJ 4FTHA 1TQIA 1HDDC 1TC3C 3E6DA 5B1BH 1OR7C 3N05A 4A3IJ 1HKTA 5DM6F 2M45A 4DYRA 1NHAA 2PEXA 5EYRA 3IH2A 2OD5A 4UUSA 3OYEA 3JRAA 3ZRGA 1H88C 3TDZC 3WGIA 2XSDC 3OYJA 1T95A 3J80Z 3N97A 3GMEA 3VYTB 4ZDOA 3K7AJ 1CF7B 2EIMH 2RREA 1G3WA 2CV0A 5DD8A 4IRGA 3HOTA 2IBDA 1TWFJ 4UNOA 2L5QA 5DCMA 1R6RA 5EZGA 2DQLA 4BQOA 4XKWA 5K5RA 2W25A 2KFDA 2HTJA 5EF6A 5E17F 3KEOA 1KQ9A 5D5VB 4ZC3A 3WTYC 3WODF 2IXSA 3WGGA 1R5GA 4DBRA 2RDPA 4E4HA 5J40A 3U2RA 3LSKA 2P81A 4CCMA 2EFOA 3CMYA 5AIPA 5FB2A 1ZHFA 1WFXA 2WAEA 1XMXA 3PIPF 3ZQCA 1V4RA 3F6VA 1U5TC 3BTCA 4MQVA 3K4MA 1Z9CA 2KHMA 1YO5C 2L7MP 3GTJJ 3LA3A 1S72I 2DA2A 2LK2A 4OIPF 3M4OJ 1RKTA 1BN5A 1FYKA 3EUAA 2R7DA 2XGXA 2E5NA 1WJEA 1YI2I 4XK4A 3C1DA 3HM5A 4XN3A 3WE2A 3DBHB 3DF8A 2CYYA 4IKFA 5K1YA 3RKYA 2TCTA 1HW1A 3F3XA 2DTRA 2KJCA 4DW6A 2R4GA 3EUHA 2K3PA 4BHCA 2ZXHA 3VOEA 3OYDA 3ZMTA 1PDNC 2HI3A 1QVUA 2RAEA 3L2RA 1MW7A 3B73A 4U87A 2FRHA 4BJTA 4P96A 1ENHA 1R23A 3S16J 2A07F 2Y31A 4A69C 5EDNA 2R3SA 2E36A 1MD0A 3HL2A 1FOKA 3RJPA 1GXQA 3NARA 3WG9A 2EFWA 2QQAA 1LE8A 5EZHA 1KYZA 3ECHA 2LF7A 3IAS2 3MN2A 3E6MA 3BR6A 2K85A 5GAHJ 3D0SA 3LA7A 1MBKA 2VIXA 1YHQI 1V3FA 3WU1B 2IS6A 3TP3A 2L7KA 3CMEI 3BR2A 4RM3A 3I56I 4BS9A 4EGZA 1T98A 2FNPA 3A01A 1BM9A 1WH5A 2PFBA 1X3UA 2R7OA 1QHGA 4JYKA 3SEQA 4E7HA 2CU7A 2X51A 1U3EM 4A5MA 2X9DA 4C3JJ 1UJ8A 4Y7NJ 2OAZA 5D6EA 5IP6A 1QBJA 1YQAA 1J75A 3SEZA 4KUMA 2HVRA 1XGNA 5FKKA 3ERED 5LGUA 2LY1A 3QYEA 1J0RA 2X6YA 2O8XA 4L5JA 4L9TA 3BQZA 3K70C 2F48A 2QF7A 4FASD 2KT0A 4KMUX 2JWTA 3TMOA 2EZIA 4HNUA 1X58A 2WADA 3MEXA 5J4VA 2FJ1A 5L3DA 5TISC 1B4AA 1KONA 2VJ5A 3FMSA 4RAZA 1B6AA 3CJRB 4R8HA 4BE0A 1B59A 3IV5A 5CVVA 1X1PA 3WTSC 5FFZA 1S5LC 4L0ZB 4X6AJ 4XMYA 4XN0A 1LFBA 4PFOA 1KU7A 1W5TA 3ABUA 2XASA 3FX3A 2X1DA 5AIQA 1JKPC 4LFUA 2KRHA 3COAC 3FKIJ 1Z77A 2IPQX 1MMNA 1WJDA 2WBMA 3S1QJ 3BG6A 1QQIA 2STWA 1FZPB 1D5YA 1SFXA 3NAUA 1QGPA 4GFBA 2XRNA 3K4JA 4UVCA 4ZTFA 4ENJA 2A05A 4HOBA 5HODA 2KMUA 4NQWA 1BIBA 2ME0A 3MVPA 1MNDA 2ZBKA 2Z16A 1R1VA 3PIOF 4IPAA 1LB2A 1Z91A 3OIQA 1P7JA 2ZSHB 3AFHA 3HRUA 4M6XA 1FWZA 1R58A 4IQ4A 3CCUI 3HOVJ 4F92B 2L02A 4A0XA 2CJJA 3CP2A 1DP7P 3HZJA 2B63J 2KIFA 2QQBA 3BLYA 3FXQA 3WTXC 1BI2A 2CW0F 4P5OA 3DCFA 1W36D 2CV1A 3A2KA 1T39A 3ELKA 3S17J 1VQOI 1LDDA 2ELKA 5F08A 1ACIA 3RI4A 2DQRA 2HQRA 2L2OA 5HVQC 3PO2J 4ZYEA 1I39A 2MFZA 1WCMJ 3MMYB 2PMHA 3BR1A 3E1SA 1G59A 1ZGAA 3U9GA 3TO9A 2DT6A 1FOWA 2JJ7A 1GVDA 1WSUA 3IL2A 2IGNA 4JP0A 3I58A 4JX6A 3Q5FA 1QA6A 2WTEA 4XICA 2I5UA 3SZGA 4PSXA 4AIDA 4CHUA 2K9QA 5B1AH 2M7AA 2ESNA 1YOVB 3WTTC 4GXOA 4HZFA 3ESWB 2ME6A 3H5NA 4IL6C 4EJOA 2KQRA 2K40A 4LG0A 5EG0A 4CGZA 1JXSA 2KKOA 2EZLA 3W2WA 3VFZA 3DV8A 1IGNA 1F4KA 2ADUA 2WC2A 2HTSA 2OTJI 2WB1N 3IC7A 2TRTA 5J8CA 5LD2C 3DFGA 4ZDPA 3O2PE 2JN6A 2Z9OA 2NVTJ 2YR2A 4BGDA 5F04A 3OYIA 1ZR2A 3D5RC 5BOXA 1USSA 3ZGKA 2UV1A 1RKWA 1B8IA 2EINH 1HOMA 4M9ZA 2HDCA 4O5VA 3ROUA 1SD5A 3QU3A 5HLTA 1IUYA 2F5CA 2A3SA 3T0YA 2WWYA 3EDPA 2ZNZA 1LFUP 2EH3A 2VQGA 3ZMSA 5GAEJ 5IYDJ 2IGKA 1MJBA 3E5QA 2E35A 2XGDA 5H6RA 1YJWI 5BS6A 5M3FJ 2GIVA 1J2XA 4RGRA 4HPQA 5CYVA 2RGVA 2Z5UA 1SFEA 2QGUA 2KDZA 4BDYA 3JTHA 3R0JA 1A6IA 1Q1HA 2ELJA 2W57A 2MSYA 1XG1A 4BL0B 2RQPA 1QU3A 2XF5A 3L2CA 4HV5A 3ZQIA 3L00A 3B6CA 3HOWJ 3B02A 2LKPA 5ILUA 5EGOA 4EATA 3GFJA 2VJJA 3BTIA 2BZTA 4XRMA 1Y0UA 2MW8A 3Q0UA 4A3DJ 2A6TA 2R5YA 2VBXA 3QRFF 2R7RA 4P55A 1LQ1A 1ZG5A 1K79A 3GWZA 4D7MA 4ENKA 1N77A 3I59A 2Q2EB 4I01A 1G8XA 2DJIA 3DBLB 2W82A 1IF1A 4XLPF 4F7ZA 1BOBA 3W2AA 3TQNA 4D7NA 1HW2A 4ZYGA 4V2FA 2E7WA 5F64A 3GVAA 1TLHB 1FNNA 4XLEA 2ZXIA 3C3WA 1MBGA 4A3CJ 1X1AA 3CQZJ 2VT2A 2KZGA 4IX7A 1SC7A 4FHTA 1DU0A 2A6HF 4HF1A 3MKLA 4J00A 3V7SA 1D8KA 1D1BA 3CUQC 4UVAA 1D1AA 3C2BA 1VQKI 5KHDA 1KA8A 5GAGJ 3K4NA 3OYAA 2RC4A 3MD2A 2I10A 5LHGA 3JRBA 1ZRFA 3PUBA 1O57A 2DCEA 4ITVA 5EEGA 3VODA 4HDUA 2GZWA 3M8EA 5IT9Z 3BTLA 3DPTA 4ZYDA 3I54A 2XAFA 2NRAC 4XR6A 5K5QA 5HDNA 2L9NA 2W1OA 4J01A 3HUGB 1H9GA 3F9KA 3PNVA 3FK6A 1O3RA 1XTAA 2CUFA 2VKHA 2FX0A 3LL7A 1IRXA 1XMKA 5IYBJ 1FC3A 1WI9A 3JAMK 4EV0A 2V7FA 5E1ZB 5DS9A 3TGNA 3S93A 4HBLA 3FM5A 1IRZA 3ISPA 3CP8A 2FMYA 1M1EB 2JT1A 2EFNA 3PQKA 5E3LA 3HKZN 2ZJQF 3FM3A 2BEOA 4MGRA 1ZKGA 3OYMA 2P6TA 2XAJA 4CZZA 3M1CA 1VQ7I 5FLXK 2UZKA 3RZOJ 5DUIA 2KZVA 2LTPA 2EZKA 3Q9VA 4M3GA 1WJFA 4V2GA 5HS7A 3E6CC 4XLHA 3G1MA 3ZMUA 3HOZJ 3ZR8X 3TKYA 1S7OA 2H94A 2GXGA 2ZKZA 4HX4A 2H09A 3ZP5A 2DOAA 2GXBA 2Y75A 4XKCA 2Y2ZA 3DTEA 2HU9A 3BZCA 1Y8QB 4F91B 1XGMA 1E3OC 3I9V2 1XDUA 3HRMA 2NVYJ 4UV8A 5CVIA 2R5ZB 1U5TA 4A3BJ 3HSRA 1H9TA 1B72B 4IO9F 4NB5A 1Z67A 1EH8A 5C3EJ 5KAFC 5JI6A 2GLOA 3KETA 2DXIA 3DTKA 3FXMA 1BI0A 3OL4A 5TJJA 3DKYA 2JPBA 1RI7A 4BKXA 2IEKA 4BBRJ 3ZMDA 3H0GJ 4F55A 4QLCU 1P92A 3GLXA 3MWMA 1V54H 2EPFA 3M8JA 2GOMA 3CLOA 2O3FA 3K2ZA 3VYSB 2IT0A 3V42A 1V5EA 4MNUA 3LA2A 3O6BB 4L0YB 1VF9A 2VPLA 5A2QK 1MIJA 2FBHA 3C18A 4B48A 1T08B 4E7JA 4XONA 2V4JC 1EKEA 3VSLA 1R4NB 1HBXG 3LSTA 3JREA 3GYHX 1K6YA 1E0EA 3F72A 1IRGA 5KNLA 1CGPA 2QENA 2VC1A 3BROA 1T38A 2Q1ZB 1VQMI 2HZTA 1KGSA 4ETSA 2P8TA 1YITI 5IY5H 5ILSA 2Y9ZA 2W00A 2JRTA 2VBWA 3LFUA 4KJZA 3BZ6A 4ABZA 4DGWB 2CSOA 1HCRA 2HPMA 4Q5SF 3OYGA 4A2UA 2XAQA 4MFDA 1D0ZA 5DM7F 4FQGA 3CDIA 3J7AY 1AKHA 1VQ4I 1W4MA 3HTUA 4M72A 2EWNA 3QOEA 2OQGA 3HOXJ 2CUZA 3ECOA 5HOOA 3Q9SA 1I27A 1TT0A 2JVGA 1AOYA 3DBRB 1X3WB 3FXJA 2DYSH 3J81K 1ZH5A 5CQEA 3MKZA 2ZC2A 2QSGX 1FMWA 2VBYA 5H20A 4OMZA 1HKQA 5F0HA 1BR1A 2EA4A 4XM3A 4HLXA 5IP9J 1VI0A 2OC6A 1VQ8I 4BJ6C 3D5LA 3HHGA 3JW4A 5KCMA 3A0HC 4ON0A 2QLZA 2KPMA 1DUXC 9ANTA 2H8RA 3BQYA 4WXCA 1R7JA 2FD5A 3VYRB 5IOYA 1Q1VA 1SMTA 1Y8RB 2IGMA 2UXXA 3BG9A 3HG9A 2L9RA 1O3TA 2JA8J 2JK3A 2YU3A 1T56A 2ZXWH 3TP0A 2PI0A 1IRFA 3R0AA 2O6GE 4C9YA 4IZZA 2HZDA 2X6XA 3MKWB 2PMZA 5LBQA 4G7ZF 3F0CA 4XQFA 4RAFA 4C30A 1ZELA 2HOTA 2L01A 3HSFA 4I09A 3LOCA 4IHYA 1ONVA 2DA5A 3GXOA 3FDYA 3CCRI 1ZK8A 3FXRA 2PJRB 4HYEA 1TQPA 1LVAA 2CQKA 3CMMA 3IRQA 5DCFA 3SFZA 1IV6A 2DFHA 4M6YA 2HS5A 4HA8A 1FIPA 1A6QA 3DEWA 2E1CA 4PK4A 1BI1A 1XSDA 3K0LA 2LOOA 2EJRA 4XRFA 1TNTA 2H6BA 2MD0A 3I4MJ 3L7WA 5FD5A 5LHIA 5BPIA 2RV8A 1X3ZB 3KPHA 2R93J 2EA2A 1QZYA 2W84A 3ZQQA 1RR8C 4C3HJ 5HS8A 2L9SA 3M8FA 1LUJB 4OAYA 3WU2C 3DWLE 1SFKA 1ETVA 2LH9A 3LWFA 3ZOBA 1NG6A 3BCBA 3ZQ7A 1TWHJ 2AHQA 3LSGA 3BCAA 3S3OA 2XB0X 3IWFA 2HOSA 1P2FA 2E1MC 4UUSB 5CQGA 2AO9A 1UELB 3GTLJ 4XSZF 5GPCA 1Z3XA 3VPRA 2JA2A 3F22A 4M3EA 2VOOA 3FBIB 2ZMEC 4KA4A 1ZREA 3QWLA 2BBYA 2B0LA 4RB1A 2ID3A 4MLOA 2HVQA 1QPIA 1TL8A 3A1YA 2HYFA 2MABA 1Z3YA 3ASOH 3QU6A 5IOZA 1GV2A 3OS1A 3GTMJ 1TWCJ 5DCMB 3V8KA 3KYCB 4BQNA 5M5YJ 1TT5B 1K78A 2F6CA 5FJ8J 1XS9A 1R36A 5L3EA 2LY9A 4KYWA 4JX5A 5DD4A 5JHFA 3J80K 3HKZA 3JRIA 2YSRA 4LB6B 3DEUA 1ZGWA 2LSOA 3HC7A 2KL4A 3D5SC 4M3BA 2EILH 2VJ4A 4AU7A 1TBXA 4FISA 3S1NJ 1L0OC 2CW7A 1IXSB 3FIWA 1SVOA 4U7BA 3JRDA 1JKRC 2R7XA 4HRIA 3IKVA 2H6CA 2IA1A 2XVCA 3IAM2 5HLGA 5CVRA 4PGGA 2QKMB 3C2HA 2XROA 3BR3A 2V6CA 1FPQA 2COBA 1OCCH 3RQ4A 4BUPA 1KU2A 2CGPA 4ZH4F 1IZ1A 4OIRF 5EEHA 2JSPA 3OSGA 5FO5A 2E2JJ 3AL0C 1S3JA 5C4JJ 4G7HF 1BW5A 2JA7J 2A69F 3K69A 4RGXA 1QNTA 2XKPA 4CYDA 1F9NA 4WX9A 3GTQJ 1IUFA 2COMA 1ZGJA 1OCTC 5E3NA 1R4MB 4CCKA 3I53A 2HDDA 1ON1A 5M5XJ 2HNHA 1HA8A 2JRMA 2F5DA 1UHSA 2LP0A 5J47A 5EJCA 5LHHA 3J7YJ 1RETA 4ENMA 1P4AA 2M30A 4OAZA 3BDDA 4G6QA 4F3QA 1LDJA 2DPUA 4E7SA 3GTGJ 4CCLA 1LE8B 1BJZA 1Z0XA 5HLIA 4XNFA 4P1WA 3AKZA 1UMQA 2HWVA 3V7CA 1SANA 4BJ5C 3I0TA 4HF2A 4S0HB 1IV8A 3R4KA 1YJNI 1W7PA 3O8HA 5FFXA 3A01B 1MBEA 4RGUA 3AG3H 3C2GA 2QEXI 4IVNA 4J19A 2L0KA 4CCJA 2XPVA 3CUQA 3RPQA 5K7ZA 3HJEA 5KVRA 1ZLJA 2KIQA 1YTYA 2BVMA 4PJNA 4WF2A 2XKOA 1MJAA 1MKMA 3SZPA 3IP4B 2HVSA 3CCLI 1A35A 2XV4S 3F8FA 4B8XA 2BE5F 2E1OA 5E8IA 3K6GA 2IJLA 3R60A 4U7DA 3NEUA 1PUFA 1MDMA 4S05A 1ZRDA 3L2WA 4HAMA 4D9JA 3K4LA 1Y6IA 2DTZA 4N0BA 2LBFA 2OJED 1R5HA 4A3KJ 1O3SA 1DPUA 4B44A 1U2WA 2BW3A 3U21A 1RZ4A 3TW7A 2DK5A 1W0UA 1Y56A 2DLLA 5B3SH 1AA7A 3QYFA 4HQEA 4A3JJ 4AD9A 4A0YA 1FMVA 1GV5A 3BOQA 2FOKA 4UHTA 1I50J 1MH3A 4NC7A 1SD6A 4NUBA 1ZQ3P 4PUSA 1AWCA 3H3UA 5ICGA 3HOSA 2X48A 3IRRA 2V9PA 4NQWB 1U6GA 1WGXA 2DA3A 3I3LA 1MNEA 3WE3A 1UHMA 2MC4A 2JZYA 2G7HA 2NOJB 1APLC 1BIAA 3ABKH 4K2EA 2VQLA 1OYYA 2ZCWA 3RPUA 3WTWC 1HSTA 2LKXA 1KU3A 3HHHA 3KZYA 4D5FA 1GVJA 4N4NB 1NTCA 3ZQFA 2DI3A 4EM0B 2WV0A 3BWGA 1VFCA 1IN5A 1IXRC 5GADJ 2DOFA 3S1MJ 2VODA 1K7AA 3OYLA 3IH4A 2M8GX 2VUMJ 2OCCH 3HPGA 3CCVI 3A0BC 5E1XA 2M0MA 3K10A 2R7QA 3GO5A 1JHHA 1ETWA 1Z1DA 3OMYA 2LRDA 4LD5A 1FEXA 1YFHA 2ZJPF 1FIAA 1BR4A 1VQ5I 1I3QJ 3IH3A 2M8EA 3L2QA 3QYBA 1W0TA 2ZJ2A 3LSIA 1A31A 1YIJI 4HF0A 1U9NA 2EQRA 4RAGA 2E34A 4LOCA 3W6VA 3F23A 1F1ZA 3UKGA 2QM3A 3S15J 3B6AA 4M3DA 4ESJA 2GM4A 4N9IA 3I5UA 4QSHA 1IDYA 3WG7H 4RS8A 3GEZA 4E7KA 5JHUA 3FXOA 4LG0B 1V5GA 2QBYA 5EG0B 2ELHA 2VB6A 3K1MA 1FP1D 1UCRA 1ITYA 5F1JA 2QCOA 1Y1VJ 3S8PA 1K4SA 5FKNA 2QYOA 5ED4A 3WTUC 2STTA 4ANJA 2XUBA 4E6KG 4N4OB 4PJJA 2MH2A 3HPHA 3IUOA 1RC9A 3OIOA 3EPZA 4YIIA 1TTYA 5D6FA 4BEHA 4XRSA 1TWGJ 3H0DA 1B8IB 3SXYA 3KIOA 4HDVA 5F0FA 1T33A 1FP2A 3JSOA 1BOAA 4A3MJ 1X2NA 1BR2A 4DZJA 1D5VA 2LC2A 2QA4I 4YIFA 5LFAA 3GTPJ 1JUSA 5LRRA 2YX4A 2YX7A 2JUCA 3K9TA 4HSTA 1XB4A 1WVRA 4WXDA 2DFEA 2WV1A 1GUUA 5LEJA 2XHKA 3K70D 3H3VK 2XAHA 3GX4X 2M3AA 1A5JA 4IF4A 1SVLA 4CA0A 2FF4A 4BY1J 5FD6A 2K9LA 1Y0NA 1HF0A 2DFFA 2IA0A 3BG7A 5EGOB 5D5WB 5K7HA 4PJLA 1PUEE 3DU6A 1EH7A 5F0CA 2IP2A 1YW9A 2YS9A 4LLGF 3L1PA 2R5YB 4MIMA 2DT5A 5ICFA 4YFKF 1VQ6I 5CJ9A 2PMZN 1L3LA 4NC8A 5DYMA 2IW5A 3BP8A 1X4OA 5E79C 4LLLA 1JT0A 3I59B 1S29A 1X4PA 3F8CA 4IHXA 2L3DA 3W6JB 3CCEI 1S7EA 4KN4X 2V1XA 1P9QC 2RNJA 2O8KA 3TBIA 3KZIC 5D4RA 4E70A 4M6VA 4XOTA 4HLYA 2LDUA 1A36A 3VDXA 2E2IJ 1H89C 2J5OA 3BC8A 2WY8Q 4BNCA 3F8MA 1OYWA 2O5RA 2DPDA 2XAUA 3KZZA 4KIBA 4IQJA 3O8GA 3BY6A 2XPUA 2W24A 5L3FA 3OWTA 4KITB 3ML6A 1OKRA 4UUTA 4Y3OA 1NK3P 5J4YA 4I6ZA 2A5WA 1QHHD 3IWZA 3S2WA 4AYBA 2X0LA 4I02A 1P6RA 2FSWA 2EV6A 1DDNA 5FKOA 2VPRA 3RIRA 1DPRA 2L4AA 1F36A 2Q0OA 1ERDA 1XCVA 3G4SI 5CPRB 2E60A 5FKMA 5BPDA 2CG4A 4H0EA 1J5YA 1WQ2A 3QP6A 3SHFA 1FY7A 2ZB9A 3AG2H 5JLXA 1CQTA 1ZYRF 2DA4A 1OR7A 2EZHA 1H0MA 5IT9K 3HGYA 2G7UA 2BY3A 5FLMJ 3K2AA 2ZMEA 1W1WE 3CC7I 5E8GA 1ETKA 4LG3A 4TV7A 2OU2A 3SQNA 3W6KB 3ONQA 2UUZA 2MLKA 5L3CA 4KICA 1OCZH 3BJ6A 2CQNA 1QRYA 4IRHA 4G8XA 4MQ9F 4RA2A 3SYTA 4EJWA 1QO0D 2DK8A 2Y0MA 1TW2A 5TRDA 2DMTA 1BC8C 3GFLA 2XRLA 3LSHA 5LLQA 1A04A 1YJ9I 1PJRA 1OCPA 4C2MJ 1YS7A 3OOPA 4PGHA 4EJTA 4B4CA 4XBFA 3LAPA 3F8NA 2Z1DA 3GFMA 3RYRA 2ZNYA 2VI6A 4UB8C 2V6EA 1VQPI 4Q4ZF 3EETA 2IS1A 3PL8A 1MMSA 3HGGA 3JCUC 5GPAA 2X1EA 5TGTA 1P7IA 2AQFA 2PJPA 1U5TB 1F5TA 2EB7A 2IAIA 5AONA 5E3MA 1LKXA 2DW4A 2KRCA 1HLVA 2OPTA 5CLSA 1R1TA 1MBHA 5IP7J 2ECBA 4QTRA 2NXNB 2HOAA 3QOPA 3FK7A 3JRFA 5JVTA 4IXAA 2IS4A 2P0WA 2PQ8A 2VJIA 3CCQI 2RQQA 4EM1A 2FOWA 2OF7A 3S3NA 2VKVA 4RLQA 1K83J 1POGA 3V8JA 1DQUA 2LYCA 4CYCA 1JJ8C 4FCYA 1S6LA 2BOLA 2D5VA 2K9SA 5DTDA 5D5XB 4W1UA 1YG2A 3LAJA 1O7LA 3DTIA 3GLLA 3U1KA 3W2VA 1SD4A 1MBJA 2MA3A 4LJZF 3H9QA 1BW6A 2BY0A 2P6SA 2XF7A 2XIGA 2Y30A 2H27A 1IN6A 3MQ0A 2VC0A 4XORA 3SJMA 1SMYF 5BQTA 1E3PA 2H1KA 4CCNA 5F27A 4XLCA 3E97A 5L3BA 2GIZA 2XB5A 1BC7C 2CV2A 2XPWA 4CDGA 4NHJA 4Y52J 3GF2A 3OV8A 3RKXA 2GWRA 3P5JA 2IA2A 3M7GA 1JKQC 3ABMH 3ULQB 4A3GJ 1OMIA 4Z6YA 4L5EA 3J7ZI 3T5XA 2PN6A 3KP3A 1AKHB 4EGYA 3C7JA 1LEAA 1XGOA 2XDVA 3I4NJ 3V8LA 4BHPA 1IJWC 4EEFG 3M07A 1ETOA 4I76A 3WTZA 3OYFA 3QPLA 2FUG2 2K9NA 4CUGA 4JOMA 4KIGA 2P5LC 1SEUA 1I6HJ 3GFIA 4IHWA 2AXLA 4G6TB 4UV9A 4BH9A 2V26A 2BXZA 2BVLA 4U88A 4KT5C 4DYCA 1ZLKA 4OOIA 2RVCA 2LKSA 4RMNA 3CC2I 1Y39A 2OBPA 2K7LA 3OS2A 3PO3J 4W97A 2DYRH 1ZAOA 4P9FA 3WHCA 3HRSA 3GZ5A 4WWCA 5CVUA 4Y13A 2K3FA 2CQXA 2FMLA 1JGGA 3REOA 1J7KA 3PNYA 4V19K 4ESFA 3KYLA 1GHCA 2NNNA 2NS8A 1TW3A 3CDHA 2BY2A 2DT7B 4CXFA 3RDIA 1X2MA 3BTJA 2DDBA 2A5YB 2JVHA 1FYMA 2D1HA 1MJ9A 4FT8A 1R00A 2VKDA 3P9CA 1RNLA 2DMQA 2WAQA 2HEOA 2V1NA 1TQMA 2H8WA 2HQAA 4I98B 3OY9A 3HOUJ 3MCZA 4HNVA 3G6EI 1ZR4A 2ESHA 3OYBA 2O61A 3I71A 1FSEA 3RPUD 3I55I 1Y1WJ 3KLOA 4C3IJ 4X1EA 1FOYA 2VE8A 1Z05A 1MMDA 4GO1A 5GTHC 3S3MA 1J9IA 2LY2A 1TZLA 1OJLA 4AM3A 1B9NA 1Z7LA 2K27A 1FJLA 4B43A 3BR0A 3LNQA 4IOCF 1FOXA 1OCRH 4BU2A 4OU0A 3H35A 5LRSA 1VTNC 1YRNA 1HC8A 5HNFA 2G9WA 2W85A 3TEDA 2R92J 1ODDA 1AHDP 3N4MA 1S9HA 1LFPA 1EJ9A 2GQQA 2F2EA 2Z99A 3AG4H 3HSEA 4DNCA 2XSJC 4BHBA 2X6WA 3UR3C 2HQ5A 1KZHA 2W48A 1RUNA 4ZDLA
chains in the Genus database with same CATH topology
1LFUP 1JTXA 2E1OA 2EH3A 5IYDJ 1JT6A 1PUFA 2DMPA 3CCYA 1MSEC 2XGEA 2XGDA 2DTZA 5M3FJ 3LSRA 2MG4A 1RPWA 2NS7A 2Y0SN 2KDZA 4A3KJ 3HBLA 3TW7A 2R5ZA 1A6IA 5J1YA 1B72A 1W0UA 2MSYA 4IEJA 1XG1A 3A03A 3ZQIA 4A3JJ 1GV5A 3B6CA 3HOWJ 3S2HJ 5EGOA 1I50J 1MH3A 2GBYA 4QIWN 3BTIA 1ZQ3P 4XRMA 2MW8A 5EEAA 3Q0UA 3S1RJ 4A3DJ 1EF4A 2X48A 1G2HA 2R5YA 3E7LA 1WGXA 2DA3A 1OFCX 2VKEA 4M3FA 1APLC 2E19A 4D7MA 5BNGA 2DMNA 3BG3A 2LKXA 3LSJA 4D7NA 2M2EA 4V2FA 4D5FA 1F43A 1WPKA 1NTCA 2LFBA 3ZQFA 2CQQA 4MO7A 2E2HJ 1MBGA 3M3YJ 3CQZJ 4A3CJ 1VFCA 3S1MJ 4BXXJ 1DU0A 2VUMJ 3IH4A 2M8GX 3ZQLA 1BL0A 3MKLA 2ID6A 2XGCA 4BBSJ 5IYCJ 1IC8A 3C2BA 1WI3A 1ETWA 1FEXA 1FIAA 1I3QJ 3IH3A 1W0TA 2I10A 3JRBA 1ETXA 1U9NA 2YU9J 2EQRA 4XIDA 4LOCA 3W6VA 2ECCA 2M9HA 4JX4A 2DA7A 3BTLA 3UKGA 4A3FJ 3S15J 3B6AA 4M3DA 2GM4A 4QSHA 1ZTRA 1IDYA 3FK6A 2CUFA 4B1RA 2L7FP 2FX0A 5IYBJ 5EG0B 5J1RA 5DS9A 5JLWA 1ITYA 5F1JA 2QCOA 1IRZA 1Y1VJ 2FQ4A 4AC0A 5FKNA 5J3LA 2JA6J 5E3LA 3HKZN 5FLVA 1YRNB 4MFEA 1ZKGA 2JA5J 3OIOA 3GTOJ 3HDDA 3RZOJ 4AUXA 1IG7A 4AYBN 3S2DJ 1JUPA 2LTPA 2EZKA 3Q3SA 4M3GA 1BA5A 4V2GA 4XRSA 1TWGJ 1B8IB 1ETYA 3G1MA 3OOUA 5F0FA 3HOZJ 1T33A 4A3MJ 1X2NA 4DZJA 4FE7A 1PUFB 3GTPJ 1MSFC 2NOGA 1JUSA 1VNDA 4IHVA 5M3MJ 2Y2ZA 4B3AA 3D1NI 2L7ZA 4G12A 1E3OC 2M0CA 2WV1A 1GUUA 2NVYJ 3H3VK 2R5ZB 4A3BJ 1B72B 1A5JA 2R0QC 1WH7A 1U8BA 5C3EJ 1MH4A 3GBGA 2GLOA 4BY1J 1HF0A 1JKOC 4BKXA 5EGOB 2IEKA 5K7HA 5C44J 4BBRJ 3H0GJ 5F0CA 2YS9A 3L1PA 2R5YB 4MIMA 1K61A 2X6OA 2LVSA 1JTYA 2CRGA 3SFIA 2PMZN 1JT0A 2NVXJ 2JMWA 1VF9A 4IHXA 1ETQA 3HOYJ 4FTHA 1S7EA 1HDDC 1TC3C 4A3IJ 3JREA 4DYRA 2O8KA 3BG5A 4M6VA 5EYRA 3IH2A 5FKLA 4UUSA 3JRAA 1H88C 1H89C 2E2IJ 2XSDC 2G0EA 3BT9A 3JRGA 3K7AJ 2N8GA 3O8GA 2Y9ZA 2XPUA 4ABZA 3RKQA 2IBDA 1TWFJ 1HCRA 1O4XA 4MFDA 4UUTA 5EZGA 1HDPA 1NK3P 4I6ZA 1AKHA 1R9TJ 5EF6A 5FKOA 2VPRA 3HOXJ 1F36A 2P81A 3PM1A 3CMYA 4RBOA 2HXIA 5FKMA 3QPSA 1IDZA 2ZB9A 5JLXA 1CQTA 3ZQCA 3BTCA 1AU7A 2DA4A 3G1LA 2EZHA 2L7MP 5F0HA 3OSFA 3GTJJ 3HGYA 5IP9J 1VI0A 5FLMJ 3K2AA 2DA2A 3BR5A 1ETKA 9ANTA 2LK2A 3RQIA 2H8RA 1RKTA 3S14J 3M4OJ 2O7OA 3BQYA 4XK4A 3HM5A 1FTTA 2FD5A 1QRYA 5IOYA 1Q1VA 3BG9A 2TCTA 1MNMC 2DMTA 2XRLA 2L9RA 2JA8J 4DW6A 2JK3A 1T56A 1JUMA 3TP0A 1SFOJ 1OCPA 4C2MJ 5K7FA 4B4CA 2HI3A 1QVUA 2RAEA 3F0CA 2VI6A 4DZPA 2HOTA 5C4XJ 3HB9A 1ENHA 3LOCA 3S16J 4IHYA 2Y31A 4A69C 5EDNA 3HGGA 2DA6A 5GPAA 2DA5A 4A3EJ 1P7IA 1ZK8A 3NARA 2IAIA 3HEFA 1LE8A 5EZHA 5E3MA 3MN2A 4FE4A 1HLVA 3BR6A 1IV6A 2OPTA 1MBKA 5GP9A 3TP3A 1MBHA 5IP7J 1FIPA 2ECBA 3BR2A 4QTRA 2HOAA 3DEWA 3FK7A 3JRFA 3A01A 1FTZA 1WH5A 1XC5A 3I4MJ 2OF7A 2VKVA 4JYKA 1K83J 2R93J 1POGA 2CU7A 4CYCA 3CDLA 1JJ8C 4FCYA 2X9DA 4C3JJ 2D5VA 4C3HJ 4Y7NJ 2K9SA 5DTDA 5IP6A 2WAQN 4W1UA 2R7ZJ 1ETVA 3ZOBA 5FKKA 1RESA 1JJ6C 1TWHJ 2AHQA 3LSGA 5E3OA 4D5CA 3BQZA 1MBFA 2QF7A 2XB0X 2KT0A 2DA1A 1MBJA 2HOSA 2JWTA 2EZIA 1X58A 1BW6A 3G1OA 4UUSB 2FJ1A 2Y30A 2Y9YA 2AO9A 3GTLJ 5GPCA 3IV5A 3VPRA 4M3EA 4X6AJ 3SJMA 1LFBA 2H1KA 1GT0C 2CUEA 5F27A 2HYJA 3JRHA 2ID3A 2XB5A 4MLOA 2XPWA 1QPIA 4Y52J 3WHBA 1JKPC 5IOZA 1GV2A 3FKIJ 1JKQC 1Z77A 1TWCJ 3GTMJ 2EBIA 4A3GJ 3S1QJ 4L5EA 5M5YJ 1D5YA 2DJNA 2LR8A 1AKHB 5FJ8J 3NAUA 4RDUA 1XS9A 4GFBA 2LD5A 1QVTA 2LY9A 4DYQA 3I4NJ 4JX5A 3JRIA 3A02A 1IJWC 2MGQA 4EEFG 5HODA 3Q0VA 2ME0A 1ZGWA 1ETOA 3MVPA 4I76A 3QPLA 4M3BA 2K9NA 4FISA 3S1NJ 4A93J 3GTKJ 3FIWA 3JRDA 1I6HJ 1JKRC 1P7JA 2M34A 3LSPA 4IHWA 3RZDJ 3SDGA 3HOVJ 2LLKA 2CJJA 2B63J 4DYCA 3BR3A 2HXOA 2COBA 3PO3J 1NK2P 3DCFA 4W97A 3OSGA 3WHCA 2E2JJ 3S17J 5C4JJ 2CQXA 3TW6A 1JGGA 1BW5A 2JA7J 2ELKA 5F08A 4BY7J 3QQAA 3PO2J 1WCMJ 2NS8A 3GTQJ 3ZQGA 1IUFA 3BR1A 1OCTC 5E3NA 1ORKA 5IPAA 1X2MA 2JJ7A 1GVDA 3BTJA 2NVQJ 1RR7A 2HDDA 3JR9A 5M5XJ 4JP0A 1GDTA 4JX6A 1UHSA 4NDLA 2LP0A 4XICA 5M5WJ 1RETA 2DMUA 2DMQA 2O9LA 3HOUJ 2K9QA 4HNVA 1LE8B 3GTGJ 4A3LJ 1ZR4A 1BJZA 1UG2A 1Z0XA 3JRCA 2ME6A 1UMQA 1Y1WJ 2K40A 4XRSG 4C3IJ 2DN0A 4X1EA 1SANA 5J1UA 5EG0A 1OJLA 4S0HB 2EZLA 3A01B 3O8HA 1MBEA 3Q0WA 1IGNA 1FJLA 2YUSA 3BR0A 4J19A 3LNQA 2WB1N 2L0KA 2TRTA 1U78A 2XPVA 4CYCB 5K7ZA 1YRNA 2JN6A 3TEDA 2NVTJ 2R92J 1AHDP 1U9OA 5F04A 3FISA 1ZR2A 1TWAJ 1H8AC 3ZQHA 1RKWA 1B8IA 1HOMA 1DU6A 2HQ5A 2W48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFU P;  1JTX A;  2E1O A;  2EH3 A;  5IYD J;  1JT6 A;  1PUF A;  2DMP A;  3CCY A;  1MSE C;  2XGE A;  2XGD A;  2DTZ A;  5M3F J;  3LSR A;  2MG4 A;  1RPW A;  2NS7 A;  2Y0S N;  2KDZ A;  4A3K J;  3HBL A;  3TW7 A;  2R5Z A;  1A6I A;  5J1Y A;  1B72 A;  1W0U A;  2MSY A;  4IEJ A;  1XG1 A;  3A03 A;  3ZQI A;  4A3J J;  1GV5 A;  3B6C A;  3HOW J;  3S2H J;  5EGO A;  1I50 J;  1MH3 A;  2GBY A;  4QIW N;  3BTI A;  1ZQ3 P;  4XRM A;  2MW8 A;  5EEA A;  3Q0U A;  3S1R J;  4A3D J;  1EF4 A;  2X48 A;  1G2H A;  2R5Y A;  3E7L A;  1WGX A;  2DA3 A;  1OFC X;  2VKE A;  4M3F A;  1APL C;  2E19 A;  4D7M A;  5BNG A;  2DMN A;  3BG3 A;  2LKX A;  3LSJ A;  4D7N A;  2M2E A;  4V2F A;  4D5F A;  1F43 A;  1WPK A;  1NTC A;  2LFB A;  3ZQF A;  2CQQ A;  4MO7 A;  2E2H J;  1MBG A;  3M3Y J;  3CQZ J;  4A3C J;  1VFC A;  3S1M J;  4BXX J;  1DU0 A;  2VUM J;  3IH4 A;  2M8G X;  3ZQL A;  1BL0 A;  3MKL A;  2ID6 A;  2XGC A;  4BBS J;  5IYC J;  1IC8 A;  3C2B A;  1WI3 A;  1ETW A;  1FEX A;  1FIA A;  1I3Q J;  3IH3 A;  1W0T A;  2I10 A;  3JRB A;  1ETX A;  1U9N A;  2YU9 J;  2EQR A;  4XID A;  4LOC A;  3W6V A;  2ECC A;  2M9H A;  4JX4 A;  2DA7 A;  3BTL A;  3UKG A;  4A3F J;  3S15 J;  3B6A A;  4M3D A;  2GM4 A;  4QSH A;  1ZTR A;  1IDY A;  3FK6 A;  2CUF A;  4B1R A;  2L7F P;  2FX0 A;  5IYB J;  5EG0 B;  5J1R A;  5DS9 A;  5JLW A;  1ITY A;  5F1J A;  2QCO A;  1IRZ A;  1Y1V J;  2FQ4 A;  4AC0 A;  5FKN A;  5J3L A;  2JA6 J;  5E3L A;  3HKZ N;  5FLV A;  1YRN B;  4MFE A;  1ZKG A;  2JA5 J;  3OIO A;  3GTO J;  3HDD A;  3RZO J;  4AUX A;  1IG7 A;  4AYB N;  3S2D J;  1JUP A;  2LTP A;  2EZK A;  3Q3S A;  4M3G A;  1BA5 A;  4V2G A;  4XRS A;  1TWG J;  1B8I B;  1ETY A;  3G1M A;  3OOU A;  5F0F A;  3HOZ J;  1T33 A;  4A3M J;  1X2N A;  4DZJ A;  4FE7 A;  1PUF B;  3GTP J;  1MSF C;  2NOG A;  1JUS A;  1VND A;  4IHV A;  5M3M J;  2Y2Z A;  4B3A A;  3D1N I;  2L7Z A;  4G12 A;  1E3O C;  2M0C A;  2WV1 A;  1GUU A;  2NVY J;  3H3V K;  2R5Z B;  4A3B J;  1B72 B;  1A5J A;  2R0Q C;  1WH7 A;  1U8B A;  5C3E J;  1MH4 A;  3GBG A;  2GLO A;  4BY1 J;  1HF0 A;  1JKO C;  4BKX A;  5EGO B;  2IEK A;  5K7H A;  5C44 J;  4BBR J;  3H0G J;  5F0C A;  2YS9 A;  3L1P A;  2R5Y B;  4MIM A;  1K61 A;  2X6O A;  2LVS A;  1JTY A;  2CRG A;  3SFI A;  2PMZ N;  1JT0 A;  2NVX J;  2JMW A;  1VF9 A;  4IHX A;  1ETQ A;  3HOY J;  4FTH A;  1S7E A;  1HDD C;  1TC3 C;  4A3I J;  3JRE A;  4DYR A;  2O8K A;  3BG5 A;  4M6V A;  5EYR A;  3IH2 A;  5FKL A;  4UUS A;  3JRA A;  1H88 C;  1H89 C;  2E2I J;  2XSD C;  2G0E A;  3BT9 A;  3JRG A;  3K7A J;  2N8G A;  3O8G A;  2Y9Z A;  2XPU A;  4ABZ A;  3RKQ A;  2IBD A;  1TWF J;  1HCR A;  1O4X A;  4MFD A;  4UUT A;  5EZG A;  1HDP A;  1NK3 P;  4I6Z A;  1AKH A;  1R9T J;  5EF6 A;  5FKO A;  2VPR A;  3HOX J;  1F36 A;  2P81 A;  3PM1 A;  3CMY A;  4RBO A;  2HXI A;  5FKM A;  3QPS A;  1IDZ A;  2ZB9 A;  5JLX A;  1CQT A;  3ZQC A;  3BTC A;  1AU7 A;  2DA4 A;  3G1L A;  2EZH A;  2L7M P;  5F0H A;  3OSF A;  3GTJ J;  3HGY A;  5IP9 J;  1VI0 A;  5FLM J;  3K2A A;  2DA2 A;  3BR5 A;  1ETK A;  9ANT A;  2LK2 A;  3RQI A;  2H8R A;  1RKT A;  3S14 J;  3M4O J;  2O7O A;  3BQY A;  4XK4 A;  3HM5 A;  1FTT A;  2FD5 A;  1QRY A;  5IOY A;  1Q1V A;  3BG9 A;  2TCT A;  1MNM C;  2DMT A;  2XRL A;  2L9R A;  2JA8 J;  4DW6 A;  2JK3 A;  1T56 A;  1JUM A;  3TP0 A;  1SFO J;  1OCP A;  4C2M J;  5K7F A;  4B4C A;  2HI3 A;  1QVU A;  2RAE A;  3F0C A;  2VI6 A;  4DZP A;  2HOT A;  5C4X J;  3HB9 A;  1ENH A;  3LOC A;  3S16 J;  4IHY A;  2Y31 A;  4A69 C;  5EDN A;  3HGG A;  2DA6 A;  5GPA A;  2DA5 A;  4A3E J;  1P7I A;  1ZK8 A;  3NAR A;  2IAI A;  3HEF A;  1LE8 A;  5EZH A;  5E3M A;  3MN2 A;  4FE4 A;  1HLV A;  3BR6 A;  1IV6 A;  2OPT A;  1MBK A;  5GP9 A;  3TP3 A;  1MBH A;  5IP7 J;  1FIP A;  2ECB A;  3BR2 A;  4QTR A;  2HOA A;  3DEW A;  3FK7 A;  3JRF A;  3A01 A;  1FTZ A;  1WH5 A;  1XC5 A;  3I4M J;  2OF7 A;  2VKV A;  4JYK A;  1K83 J;  2R93 J;  1POG A;  2CU7 A;  4CYC A;  3CDL A;  1JJ8 C;  4FCY A;  2X9D A;  4C3J J;  2D5V A;  4C3H J;  4Y7N J;  2K9S A;  5DTD A;  5IP6 A;  2WAQ N;  4W1U A;  2R7Z J;  1ETV A;  3ZOB A;  5FKK A;  1RES A;  1JJ6 C;  1TWH J;  2AHQ A;  3LSG A;  5E3O A;  4D5C A;  3BQZ A;  1MBF A;  2QF7 A;  2XB0 X;  2KT0 A;  2DA1 A;  1MBJ A;  2HOS A;  2JWT A;  2EZI A;  1X58 A;  1BW6 A;  3G1O A;  4UUS B;  2FJ1 A;  2Y30 A;  2Y9Y A;  2AO9 A;  3GTL J;  5GPC A;  3IV5 A;  3VPR A;  4M3E A;  4X6A J;  3SJM A;  1LFB A;  2H1K A;  1GT0 C;  2CUE A;  5F27 A;  2HYJ A;  3JRH A;  2ID3 A;  2XB5 A;  4MLO A;  2XPW A;  1QPI A;  4Y52 J;  3WHB A;  1JKP C;  5IOZ A;  1GV2 A;  3FKI J;  1JKQ C;  1Z77 A;  1TWC J;  3GTM J;  2EBI A;  4A3G J;  3S1Q J;  4L5E A;  5M5Y J;  1D5Y A;  2DJN A;  2LR8 A;  1AKH B;  5FJ8 J;  3NAU A;  4RDU A;  1XS9 A;  4GFB A;  2LD5 A;  1QVT A;  2LY9 A;  4DYQ A;  3I4N J;  4JX5 A;  3JRI A;  3A02 A;  1IJW C;  2MGQ A;  4EEF G;  5HOD A;  3Q0V A;  2ME0 A;  1ZGW A;  1ETO A;  3MVP A;  4I76 A;  3QPL A;  4M3B A;  2K9N A;  4FIS A;  3S1N J;  4A93 J;  3GTK J;  3FIW A;  3JRD A;  1I6H J;  1JKR C;  1P7J A;  2M34 A;  3LSP A;  4IHW A;  3RZD J;  3SDG A;  3HOV J;  2LLK A;  2CJJ A;  2B63 J;  4DYC A;  3BR3 A;  2HXO A;  2COB A;  3PO3 J;  1NK2 P;  3DCF A;  4W97 A;  3OSG A;  3WHC A;  2E2J J;  3S17 J;  5C4J J;  2CQX A;  3TW6 A;  1JGG A;  1BW5 A;  2JA7 J;  2ELK A;  5F08 A;  4BY7 J;  3QQA A;  3PO2 J;  1WCM J;  2NS8 A;  3GTQ J;  3ZQG A;  1IUF A;  3BR1 A;  1OCT C;  5E3N A;  1ORK A;  5IPA A;  1X2M A;  2JJ7 A;  1GVD A;  3BTJ A;  2NVQ J;  1RR7 A;  2HDD A;  3JR9 A;  5M5X J;  4JP0 A;  1GDT A;  4JX6 A;  1UHS A;  4NDL A;  2LP0 A;  4XIC A;  5M5W J;  1RET A;  2DMU A;  2DMQ A;  2O9L A;  3HOU J;  2K9Q A;  4HNV A;  1LE8 B;  3GTG J;  4A3L J;  1ZR4 A;  1BJZ A;  1UG2 A;  1Z0X A;  3JRC A;  2ME6 A;  1UMQ A;  1Y1W J;  2K40 A;  4XRS G;  4C3I J;  2DN0 A;  4X1E A;  1SAN A;  5J1U A;  5EG0 A;  1OJL A;  4S0H B;  2EZL A;  3A01 B;  3O8H A;  1MBE A;  3Q0W A;  1IGN A;  1FJL A;  2YUS A;  3BR0 A;  4J19 A;  3LNQ A;  2WB1 N;  2L0K A;  2TRT A;  1U78 A;  2XPV A;  4CYC B;  5K7Z A;  1YRN A;  2JN6 A;  3TED A;  2NVT J;  2R92 J;  1AHD P;  1U9O A;  5F04 A;  3FIS A;  1ZR2 A;  1TWA J;  1H8A C;  3ZQH A;  1RKW A;  1B8I A;  1HOM A;  1DU6 A;  2HQ5 A;  2W48 A; 
#chains in the Genus database with same CATH topology
 1I5Z A;  3OS0 A;  1ZRC A;  4RLF A;  2MC3 A;  1YIO A;  1JT6 A;  2K5C A;  3CCS I;  1FBQ A;  2DMP A;  2F5F A;  4R1H A;  1R1U A;  3VWB A;  3W3C A;  3TO6 A;  4Z2Y A;  2QKL B;  1JHF A;  1RPW A;  3CF2 A;  1KQ0 A;  2Y0S N;  3DPL C;  4CIC A;  4RB2 C;  3BJA A;  4ASN A;  1I3A A;  4B47 A;  2RNG A;  1IN7 A;  4EM2 A;  4BE1 A;  2GXA A;  4IEJ A;  1ZN2 A;  4I0B A;  1W5C C;  2F4O B;  5D5U B;  3A03 A;  3TL4 X;  1K78 B;  1XGS A;  3CLQ A;  2KRF A;  4G9Y A;  2ZFU A;  4YEJ A;  2X4H A;  2EK5 A;  3K4K A;  4QIW N;  3S1R J;  2DBB A;  2LRE A;  4JK1 X;  3CC4 I;  1T2K A;  1Z6T A;  5HDG A;  5DDG A;  3F8B A;  1UAA A;  2VKE A;  4M3F A;  3FHZ A;  4FX0 A;  2BXY A;  2LG4 A;  3HIF A;  4I2O A;  3KP2 A;  3AAF A;  1NG7 A;  5JVG F;  5BNG A;  2CH0 A;  3ZPL A;  1OIS A;  1K4T A;  1MMA A;  2HYG D;  3BG3 A;  2P4W A;  4C2U A;  2E7X A;  3LSJ A;  2RN7 A;  4XOP A;  2PLY A;  2EIK H;  2PMU A;  4QPO A;  1UB9 A;  3LQQ A;  4AIJ A;  1F43 A;  1WPK A;  1VQ9 I;  4YG2 F;  2E2H J;  2CQQ A;  4KFC A;  3A4C A;  3M3Y J;  2X1C A;  1LNW A;  4E7L A;  4Y15 A;  3EQL F;  2ZJR F;  3CD6 I;  4OIN F;  4NC6 A;  4BXX J;  4DJA A;  3VSK A;  4BQQ A;  3ZQL A;  3MZH A;  1BL0 A;  1W5S A;  1GXP A;  2ID6 A;  4KDP A;  1UFM A;  1E17 A;  4BDZ A;  4BBS J;  2A68 F;  4M73 A;  1PYV A;  3HXL A;  1HXD A;  1WRJ A;  2HKX A;  3OYK A;  4QPQ A;  1IC8 A;  1CF7 A;  1WI3 A;  1WJ5 A;  4YFX F;  1V5F A;  1VZ0 A;  3H36 A;  2LF8 A;  3VYU B;  3FXK A;  3G3Z A;  4LB5 A;  4I7H A;  5B5E C;  4HV6 A;  2EFP A;  1X1B A;  2QSF X;  2VBZ A;  4H4K C;  4BYY A;  1R22 A;  2YU9 J;  3KEY A;  2PG4 A;  5ICE A;  2MH9 A;  1YYV A;  2DFI A;  4PFP A;  5LGT A;  4WCG A;  4JX4 A;  3JSP A;  5HS9 A;  1JI8 A;  5H2F C;  3WU0 A;  3ERM A;  1KQ8 A;  3ZN1 A;  4Y17 A;  1ZTR A;  1RRJ A;  1FSH A;  3KP5 A;  4B1R A;  4UUV A;  2L7F P;  1W36 C;  1Z7U A;  3H92 A;  1BI3 A;  1X1D A;  4X0G A;  2CW8 A;  3ZN0 A;  2X85 A;  2V9V A;  3RTR A;  1W7P B;  1T0F C;  4AIK A;  2FQ4 A;  1D8J A;  2M5W A;  3ZXS A;  4AC0 A;  5D4S A;  4E7I A;  2KDO A;  5J3L A;  2OCE A;  2JA6 J;  3CUQ B;  1FBS A;  2CWE A;  2JA5 J;  5IT3 A;  3VB2 A;  3GTO J;  3P9K A;  3HDD A;  3NRV A;  2V1U A;  2Z33 A;  1WHU A;  4AYB N;  2JTV A;  1JUP A;  2JSC A;  3Q3S A;  1FBU A;  4PJ0 C;  2W7N A;  4LGW A;  1I1G A;  1XPX A;  1IAW A;  2F4I A;  1D1C A;  1RUO A;  2BV6 A;  3OOU A;  2IRF G;  1IXC A;  2QVO A;  3DLL F;  1J59 A;  4NBQ A;  2NNY A;  4QWQ A;  4L5I A;  4M9X A;  2OV7 A;  3DPU A;  1PUF B;  1MDM B;  3KFW X;  1FLI A;  2PX9 A;  2KIU A;  4BXF A;  1MSF C;  4IHV A;  1Z21 A;  5M3M J;  5FRN A;  4B3A A;  3PFY A;  3PSI A;  3D1N I;  2LBF B;  2R7U A;  3CO6 C;  3MZY A;  1P4X A;  4YRV A;  4D1Q A;  4II2 A;  2M0C A;  3FMQ A;  4GCV A;  2BW3 B;  2XF6 A;  2FXA A;  2L9V A;  2R0Q C;  4EJV A;  2KLO A;  3V7R A;  2A6E F;  2ISY A;  3IKT A;  3EYY A;  2QQ9 A;  2UXN A;  4GYG A;  3EYI A;  1HKS A;  2FU4 A;  1JKO C;  2Y48 A;  4BE2 A;  5C44 J;  4IHT A;  4PZJ A;  1I1S A;  3CTA A;  1K61 A;  2X6O A;  1JTY A;  3K1N A;  3CJN A;  3KE2 A;  3MZ8 A;  5FRM A;  2R7W A;  3G71 I;  5LEK A;  2ISZ A;  3HYI A;  1JGS A;  2JMW A;  1UHW A;  1LEB A;  3R61 A;  3E5U A;  3WGH A;  2F5E A;  4EVI A;  2JQ7 A;  3R6S A;  2QUF A;  3QOD A;  2DAO A;  2WA0 A;  1WJC A;  2M87 A;  3BG5 A;  4O6J A;  2GOX B;  3PNT A;  3PJR A;  3DU5 A;  5FKL A;  3CO7 C;  4OIO F;  3RKW A;  2VOP A;  3EUK L;  4MTD A;  1E2X A;  5FRO A;  2G0E A;  1DGR M;  3BT9 A;  5E20 A;  3OYH A;  3JRG A;  2JPC A;  2Z2S B;  3CUO A;  3RCO A;  5BMZ A;  2N8G A;  1V55 H;  2ZO4 A;  2WY7 Q;  3RKQ A;  2K4J A;  1D3Y A;  3PSF A;  3LSM A;  1O4X A;  2VN2 A;  1N78 A;  4G7O F;  1HDP A;  5CVJ A;  2PBI A;  5CKT A;  1WWX A;  1G4D A;  1R9T J;  1XSV A;  4MEX F;  3VEP A;  2CMP A;  1C0W A;  1OYI A;  2FEZ A;  2F5V A;  3ZCO A;  3GW2 A;  1OQY A;  4MTE A;  4II3 A;  2ZFW A;  3ZMV A;  3PM1 A;  4XLF A;  2QBY B;  3FMR A;  4GGG A;  4RBO A;  2R7V A;  2HXI A;  3LQR A;  3QPS A;  1G3S A;  1IDZ A;  1FT9 A;  1FX7 A;  1AU7 A;  2BHZ A;  3G1L A;  1XX5 A;  1QPM A;  3G2B A;  4LMY A;  2YPR A;  2ZXJ A;  5D8L B;  3OSF A;  1YLF A;  3CJQ B;  1KYW A;  3BR5 A;  3T8T A;  4WK8 F;  3P7N A;  3E5X A;  1B1B A;  1Z6R A;  1SD7 A;  4U0W A;  3IHU A;  3RQI A;  4CH7 A;  2O7O A;  3OYC A;  3S14 J;  4HNT A;  1DP3 A;  2DU9 A;  2FQ3 A;  3BPV A;  1FTT A;  4BEH B;  2ZSI B;  2Y0S A;  3J7A O;  2QWW A;  4Q47 A;  2KJB A;  2R7T A;  1QZE A;  2I8D A;  4G6D A;  3DQV C;  1OCO H;  2OTL I;  1MNM C;  4UB6 C;  2VON A;  1JUM A;  3FXL A;  3M9A A;  4YIR X;  1SFO J;  3TDU C;  1YW8 A;  2HDW A;  3OL3 A;  4G94 A;  4LIV A;  5K7F A;  4Q48 A;  1G6N A;  1YS6 A;  4ZZD A;  4AWX B;  2FBK A;  5B66 C;  2AS5 F;  1XN7 A;  4BXU A;  1REP C;  4DZP A;  4L9V A;  5C4X J;  3HB9 A;  1UZC A;  3KP6 A;  1SFU A;  2AQE A;  3GZN B;  2DA6 A;  4CZC A;  4JQF A;  4A3E J;  4A12 A;  1IW7 F;  3HEF A;  5E18 F;  3E3V A;  2OUM A;  1KU9 A;  4FE4 A;  4OIQ F;  2NVU B;  5GP9 A;  3DEE A;  1ZG1 A;  2FNA A;  2V79 A;  1TNS A;  3FKJ A;  5HDK A;  2BHY A;  4LIU A;  1IN4 A;  4L18 B;  4NNJ A;  1FTZ A;  1XC5 A;  2OZ6 A;  3NQO A;  1K6O A;  3KP7 A;  2MD5 A;  3OIP A;  4EJU A;  2IS2 A;  4PDK A;  4ZYH A;  4HW0 A;  3X2Q H;  3QAH A;  5K5O A;  1N75 A;  2VT3 A;  3CDL A;  2XAG A;  1ZAR A;  2ETH A;  6PAX A;  4LIT A;  2WAQ N;  4KIF A;  4KN7 X;  3E6B A;  2R7Z J;  4B3X A;  2P7C B;  3LFK A;  1QZZ A;  4XLA A;  5E1W A;  1RES A;  2DO7 A;  1G3T A;  1JJ6 C;  5E3O A;  4ZTJ A;  4D5C A;  1VQN I;  1MBF A;  5GTI C;  2DA1 A;  5J8F A;  1FYL A;  2VLA A;  1BBY A;  4A5N A;  3G1O A;  2Y9Y A;  2R7F A;  5FGM A;  4L9J A;  2V1D A;  2NS0 A;  1S7A A;  2A61 A;  1GT0 C;  2CUE A;  2FE3 A;  4KT6 A;  4D0P A;  1EA3 A;  2HYJ A;  3CZ6 A;  3JRH A;  3KCC A;  4KNY A;  2AXT C;  4PJM A;  3WHB A;  1HSJ A;  2FBI A;  3LMM A;  3TOA A;  2EBI A;  1HW5 A;  3UNG C;  2L4M A;  2EIJ H;  2DJN A;  3DLA A;  4M9S A;  2LR8 A;  4S04 A;  1YX5 A;  4RDU A;  4CCO A;  4C2T A;  2LD5 A;  1QVT A;  3OR2 C;  3EUH C;  4GYI A;  4DYQ A;  4E7Z A;  3M1E A;  3A02 A;  2Q8K A;  2LNB A;  1DGW Y;  2B7E A;  4BAC A;  2MGQ A;  1BJA A;  3ZMZ A;  2OZU A;  3FBN B;  1XCB A;  3NWS A;  3Q0V A;  3FXU A;  4CSW A;  4IOA F;  5HLH A;  2VQH A;  3HRT A;  4YEL A;  1U8R A;  4AIH A;  3K1P A;  1JE8 A;  2TDX A;  4A93 J;  3GTK J;  2E1M B;  2Q2E A;  3QPT A;  3V4G A;  2E1N A;  2M34 A;  3FHN A;  1WJB A;  3LSP A;  5HNH A;  3H1C A;  2GA2 A;  3SDG A;  3RZD J;  3BJO A;  2VXD A;  4ZYA A;  1O7F A;  2LLK A;  2EV5 A;  2ZME B;  3DKX A;  2HXO A;  4Y33 A;  3S32 A;  4HEA 2;  2E71 A;  1NK2 P;  3ASN H;  2C6Y A;  4MHG A;  1SAU A;  4HG2 A;  3MAJ A;  2HOE A;  4A6D A;  3QPH A;  3TW6 A;  4BQA A;  5DV5 A;  4BY7 J;  4HQM A;  3QQA A;  3G73 A;  5KAI C;  4F52 A;  2ICW G;  1E3H A;  4BAY A;  5LGN A;  3H9J A;  2KP6 A;  3ZQG A;  4A0Z A;  3KEQ A;  1R5I D;  3L9F A;  1ORK A;  2P7V B;  2BY1 A;  5IPA A;  5L3G A;  1HQC A;  4LK0 F;  3MFK A;  3JAM Z;  1RR7 A;  4HX7 A;  2CFO A;  4I99 C;  2NVQ J;  3JR9 A;  1T8I A;  3KLN A;  4NDL A;  1GDT A;  1ULY A;  2M1B A;  2XC7 A;  5M5W J;  2VE9 A;  2DMU A;  1R49 A;  2GAU A;  2E5Z A;  3H5R A;  2K02 A;  3H9G A;  2O9L A;  2W4S A;  4N9H A;  4KIS A;  2K4B A;  4A3L J;  4O3M A;  3HUG A;  1UG2 A;  5F1R A;  3JRC A;  5FLX Z;  1IO2 A;  2BGC A;  4XRS G;  1WJA A;  2DN0 A;  3TOB A;  1YX3 A;  5J1U A;  1ZG3 A;  2F4M B;  4UXN A;  5J6X A;  3AL0 B;  2M7B A;  3O3K A;  3Q0W A;  4RB0 A;  2L54 A;  2YUS A;  5H6Q A;  4OWR B;  3CCM I;  4U0Y A;  2MLG A;  1U78 A;  3TO7 A;  3CES A;  4CYC B;  3GZ6 A;  1U0J A;  1D0X A;  4ZJZ A;  2R7S A;  2OA4 A;  1U9O A;  3FIS A;  2HR3 A;  2JUG A;  1NH3 A;  1TWA J;  3OR1 C;  4B09 A;  5ICC A;  1H8A C;  3ZQH A;  1YE9 A;  3KYD B;  3ABL H;  3L2U A;  2EFQ A;  1DU6 A;  4YFN F;  5KK1 A;  4IHS A;  4DBQ A;  1GLN A;  1JTX A;  2VAS A;  2H1L A;  3H3Z A;  3F6O A;  4PCQ A;  3CCY A;  3L09 A;  1MSE C;  3L2V A;  2XGE A;  4FX4 A;  2WAF A;  2RKH A;  4HSR A;  3LSR A;  3BPX A;  2MG4 A;  4DIQ A;  4A6E A;  2NS7 A;  4XSX F;  4ESB A;  1STZ A;  3I4P A;  3T1B A;  3HBL A;  1XDS A;  1T0F A;  2R5Z A;  1MGT A;  3T8R A;  5J1Y A;  1B72 A;  3H5A A;  4FET A;  3FF5 A;  3SZT A;  4CO8 A;  5A2Q Z;  3CCJ I;  3F21 A;  2NYX A;  1UG0 A;  2DDA A;  3S2H J;  2ACJ A;  3KP4 A;  3KX2 A;  1X19 A;  2GBY A;  4WXH A;  1J09 A;  1W7P D;  2CUJ A;  3I64 A;  5EEA A;  1EF4 A;  1G2H A;  4DOZ A;  3E7L A;  1EH6 A;  5DEQ A;  1B9M A;  1OFC X;  2EV0 A;  4DQ2 A;  3WTV C;  4R79 A;  4KMF A;  4P9U A;  1MMG A;  2E19 A;  2LMD A;  2DMN A;  5DUK A;  2DOD A;  2HQN A;  2KIM A;  4GDF A;  2Z3Y A;  2OQR A;  2M2E A;  3E0J B;  4RGS A;  1SVM A;  3NWT A;  2LFB A;  4MO7 A;  3K4C A;  2HPI A;  3QP5 A;  3RYP A;  3FZV A;  4JBA A;  3GUD A;  4L9N A;  2XGC A;  1OLT A;  5IYC J;  5D8K B;  4M74 A;  3RSN A;  3DKW A;  1ON2 A;  1YW7 A;  2J5P A;  2B9S A;  1T6S A;  4PSW A;  2FA5 A;  2HFH A;  2D2W A;  2WB1 A;  3J81 Z;  4GRI A;  3CJT B;  2O0Y A;  2CO5 A;  1ETX A;  4UVB A;  2HKO A;  4XID A;  1D0Y A;  2CS3 A;  3K4B A;  4OMY A;  4MEY F;  2ECC A;  1RIO H;  2M9H A;  2QQ8 A;  2DA7 A;  2GA1 A;  2MBF A;  3CMA I;  4A3F J;  2VXZ A;  1MZB A;  4HX8 A;  1VQL I;  1LVK A;  4XL9 A;  1I6X A;  2CQ7 A;  4U0V A;  4F93 B;  4M71 A;  1TP4 A;  4IRI A;  2VQC A;  5J1R A;  3DXJ F;  5JLW A;  2K86 A;  3PUF A;  2QSH X;  4IJA A;  2P5V A;  3ABT A;  1S8N A;  1X1C A;  2MYS A;  3DP7 A;  4XKB A;  3AG1 H;  2M4G A;  5FLV A;  3P9I A;  2VL8 A;  4I0A A;  4MFE A;  1YRN B;  2UWM A;  4ENN A;  3FWE A;  4ZZL A;  2BYV E;  2D1V A;  1WZ2 A;  1IN8 A;  4AUX A;  3PFI A;  1IG7 A;  3S2D J;  1O3Q A;  1BA5 A;  1EV7 A;  4EMS A;  2KIS A;  4LK1 F;  3HTS B;  1ETY A;  3JTG A;  1PP8 F;  5ERI A;  3PQJ A;  5JFR A;  1XSX A;  2M4K A;  4XKV A;  4LLN A;  4FE7 A;  3BZK A;  4RB3 C;  3OYN A;  2HGC A;  3SDB A;  2NOG A;  1VND A;  3U1D A;  2K9M A;  5F6F A;  3MKY B;  2O03 A;  2L7Z A;  4G12 A;  5JR3 A;  1G3Y A;  1LDK B;  2PJR A;  1OPC A;  1R71 A;  4RM2 A;  1WH7 A;  1U8B A;  1MH4 A;  3GBG A;  2NAZ A;  1PVE A;  2D45 A;  4Y4R A;  1XMA A;  1LJ9 A;  4UY8 I;  1P4W A;  1LPQ A;  1UST A;  4AVZ A;  5ILV A;  3GCM A;  2Y69 H;  1SAX A;  2IGO A;  1PP7 U;  2IVM A;  2QZ8 A;  4AVP A;  2LVS A;  2CRG A;  1N25 A;  3SFI A;  4EQQ A;  4XLN F;  1WKM A;  3CF5 F;  2CFX A;  2DOE A;  2NVX J;  1XD7 A;  2V9K A;  2P5K A;  1ETQ A;  4RAY A;  3HOY J;  4FTH A;  1TQI A;  1HDD C;  1TC3 C;  3E6D A;  5B1B H;  1OR7 C;  3N05 A;  4A3I J;  1HKT A;  5DM6 F;  2M45 A;  4DYR A;  1NHA A;  2PEX A;  5EYR A;  3IH2 A;  2OD5 A;  4UUS A;  3OYE A;  3JRA A;  3ZRG A;  1H88 C;  3TDZ C;  3WGI A;  2XSD C;  3OYJ A;  1T95 A;  3J80 Z;  3N97 A;  3GME A;  3VYT B;  4ZDO A;  3K7A J;  1CF7 B;  2EIM H;  2RRE A;  1G3W A;  2CV0 A;  5DD8 A;  4IRG A;  3HOT A;  2IBD A;  1TWF J;  4UNO A;  2L5Q A;  5DCM A;  1R6R A;  5EZG A;  2DQL A;  4BQO A;  4XKW A;  5K5R A;  2W25 A;  2KFD A;  2HTJ A;  5EF6 A;  5E17 F;  3KEO A;  1KQ9 A;  5D5V B;  4ZC3 A;  3WTY C;  3WOD F;  2IXS A;  3WGG A;  1R5G A;  4DBR A;  2RDP A;  4E4H A;  5J40 A;  3U2R A;  3LSK A;  2P81 A;  4CCM A;  2EFO A;  3CMY A;  5AIP A;  5FB2 A;  1ZHF A;  1WFX A;  2WAE A;  1XMX A;  3PIP F;  3ZQC A;  1V4R A;  3F6V A;  1U5T C;  3BTC A;  4MQV A;  3K4M A;  1Z9C A;  2KHM A;  1YO5 C;  2L7M P;  3GTJ J;  3LA3 A;  1S72 I;  2DA2 A;  2LK2 A;  4OIP F;  3M4O J;  1RKT A;  1BN5 A;  1FYK A;  3EUA A;  2R7D A;  2XGX A;  2E5N A;  1WJE A;  1YI2 I;  4XK4 A;  3C1D A;  3HM5 A;  4XN3 A;  3WE2 A;  3DBH B;  3DF8 A;  2CYY A;  4IKF A;  5K1Y A;  3RKY A;  2TCT A;  1HW1 A;  3F3X A;  2DTR A;  2KJC A;  4DW6 A;  2R4G A;  3EUH A;  2K3P A;  4BHC A;  2ZXH A;  3VOE A;  3OYD A;  3ZMT A;  1PDN C;  2HI3 A;  1QVU A;  2RAE A;  3L2R A;  1MW7 A;  3B73 A;  4U87 A;  2FRH A;  4BJT A;  4P96 A;  1ENH A;  1R23 A;  3S16 J;  2A07 F;  2Y31 A;  4A69 C;  5EDN A;  2R3S A;  2E36 A;  1MD0 A;  3HL2 A;  1FOK A;  3RJP A;  1GXQ A;  3NAR A;  3WG9 A;  2EFW A;  2QQA A;  1LE8 A;  5EZH A;  1KYZ A;  3ECH A;  2LF7 A;  3IAS 2;  3MN2 A;  3E6M A;  3BR6 A;  2K85 A;  5GAH J;  3D0S A;  3LA7 A;  1MBK A;  2VIX A;  1YHQ I;  1V3F A;  3WU1 B;  2IS6 A;  3TP3 A;  2L7K A;  3CME I;  3BR2 A;  4RM3 A;  3I56 I;  4BS9 A;  4EGZ A;  1T98 A;  2FNP A;  3A01 A;  1BM9 A;  1WH5 A;  2PFB A;  1X3U A;  2R7O A;  1QHG A;  4JYK A;  3SEQ A;  4E7H A;  2CU7 A;  2X51 A;  1U3E M;  4A5M A;  2X9D A;  4C3J J;  1UJ8 A;  4Y7N J;  2OAZ A;  5D6E A;  5IP6 A;  1QBJ A;  1YQA A;  1J75 A;  3SEZ A;  4KUM A;  2HVR A;  1XGN A;  5FKK A;  3ERE D;  5LGU A;  2LY1 A;  3QYE A;  1J0R A;  2X6Y A;  2O8X A;  4L5J A;  4L9T A;  3BQZ A;  3K70 C;  2F48 A;  2QF7 A;  4FAS D;  2KT0 A;  4KMU X;  2JWT A;  3TMO A;  2EZI A;  4HNU A;  1X58 A;  2WAD A;  3MEX A;  5J4V A;  2FJ1 A;  5L3D A;  5TIS C;  1B4A A;  1KON A;  2VJ5 A;  3FMS A;  4RAZ A;  1B6A A;  3CJR B;  4R8H A;  4BE0 A;  1B59 A;  3IV5 A;  5CVV A;  1X1P A;  3WTS C;  5FFZ A;  1S5L C;  4L0Z B;  4X6A J;  4XMY A;  4XN0 A;  1LFB A;  4PFO A;  1KU7 A;  1W5T A;  3ABU A;  2XAS A;  3FX3 A;  2X1D A;  5AIQ A;  1JKP C;  4LFU A;  2KRH A;  3COA C;  3FKI J;  1Z77 A;  2IPQ X;  1MMN A;  1WJD A;  2WBM A;  3S1Q J;  3BG6 A;  1QQI A;  2STW A;  1FZP B;  1D5Y A;  1SFX A;  3NAU A;  1QGP A;  4GFB A;  2XRN A;  3K4J A;  4UVC A;  4ZTF A;  4ENJ A;  2A05 A;  4HOB A;  5HOD A;  2KMU A;  4NQW A;  1BIB A;  2ME0 A;  3MVP A;  1MND A;  2ZBK A;  2Z16 A;  1R1V A;  3PIO F;  4IPA A;  1LB2 A;  1Z91 A;  3OIQ A;  1P7J A;  2ZSH B;  3AFH A;  3HRU A;  4M6X A;  1FWZ A;  1R58 A;  4IQ4 A;  3CCU I;  3HOV J;  4F92 B;  2L02 A;  4A0X A;  2CJJ A;  3CP2 A;  1DP7 P;  3HZJ A;  2B63 J;  2KIF A;  2QQB A;  3BLY A;  3FXQ A;  3WTX C;  1BI2 A;  2CW0 F;  4P5O A;  3DCF A;  1W36 D;  2CV1 A;  3A2K A;  1T39 A;  3ELK A;  3S17 J;  1VQO I;  1LDD A;  2ELK A;  5F08 A;  1ACI A;  3RI4 A;  2DQR A;  2HQR A;  2L2O A;  5HVQ C;  3PO2 J;  4ZYE A;  1I39 A;  2MFZ A;  1WCM J;  3MMY B;  2PMH A;  3BR1 A;  3E1S A;  1G59 A;  1ZGA A;  3U9G A;  3TO9 A;  2DT6 A;  1FOW A;  2JJ7 A;  1GVD A;  1WSU A;  3IL2 A;  2IGN A;  4JP0 A;  3I58 A;  4JX6 A;  3Q5F A;  1QA6 A;  2WTE A;  4XIC A;  2I5U A;  3SZG A;  4PSX A;  4AID A;  4CHU A;  2K9Q A;  5B1A H;  2M7A A;  2ESN A;  1YOV B;  3WTT C;  4GXO A;  4HZF A;  3ESW B;  2ME6 A;  3H5N A;  4IL6 C;  4EJO A;  2KQR A;  2K40 A;  4LG0 A;  5EG0 A;  4CGZ A;  1JXS A;  2KKO A;  2EZL A;  3W2W A;  3VFZ A;  3DV8 A;  1IGN A;  1F4K A;  2ADU A;  2WC2 A;  2HTS A;  2OTJ I;  2WB1 N;  3IC7 A;  2TRT A;  5J8C A;  5LD2 C;  3DFG A;  4ZDP A;  3O2P E;  2JN6 A;  2Z9O A;  2NVT J;  2YR2 A;  4BGD A;  5F04 A;  3OYI A;  1ZR2 A;  3D5R C;  5BOX A;  1USS A;  3ZGK A;  2UV1 A;  1RKW A;  1B8I A;  2EIN H;  1HOM A;  4M9Z A;  2HDC A;  4O5V A;  3ROU A;  1SD5 A;  3QU3 A;  5HLT A;  1IUY A;  2F5C A;  2A3S A;  3T0Y A;  2WWY A;  3EDP A;  2ZNZ A;  1LFU P;  2EH3 A;  2VQG A;  3ZMS A;  5GAE J;  5IYD J;  2IGK A;  1MJB A;  3E5Q A;  2E35 A;  2XGD A;  5H6R A;  1YJW I;  5BS6 A;  5M3F J;  2GIV A;  1J2X A;  4RGR A;  4HPQ A;  5CYV A;  2RGV A;  2Z5U A;  1SFE A;  2QGU A;  2KDZ A;  4BDY A;  3JTH A;  3R0J A;  1A6I A;  1Q1H A;  2ELJ A;  2W57 A;  2MSY A;  1XG1 A;  4BL0 B;  2RQP A;  1QU3 A;  2XF5 A;  3L2C A;  4HV5 A;  3ZQI A;  3L00 A;  3B6C A;  3HOW J;  3B02 A;  2LKP A;  5ILU A;  5EGO A;  4EAT A;  3GFJ A;  2VJJ A;  3BTI A;  2BZT A;  4XRM A;  1Y0U A;  2MW8 A;  3Q0U A;  4A3D J;  2A6T A;  2R5Y A;  2VBX A;  3QRF F;  2R7R A;  4P55 A;  1LQ1 A;  1ZG5 A;  1K79 A;  3GWZ A;  4D7M A;  4ENK A;  1N77 A;  3I59 A;  2Q2E B;  4I01 A;  1G8X A;  2DJI A;  3DBL B;  2W82 A;  1IF1 A;  4XLP F;  4F7Z A;  1BOB A;  3W2A A;  3TQN A;  4D7N A;  1HW2 A;  4ZYG A;  4V2F A;  2E7W A;  5F64 A;  3GVA A;  1TLH B;  1FNN A;  4XLE A;  2ZXI A;  3C3W A;  1MBG A;  4A3C J;  1X1A A;  3CQZ J;  2VT2 A;  2KZG A;  4IX7 A;  1SC7 A;  4FHT A;  1DU0 A;  2A6H F;  4HF1 A;  3MKL A;  4J00 A;  3V7S A;  1D8K A;  1D1B A;  3CUQ C;  4UVA A;  1D1A A;  3C2B A;  1VQK I;  5KHD A;  1KA8 A;  5GAG J;  3K4N A;  3OYA A;  2RC4 A;  3MD2 A;  2I10 A;  5LHG A;  3JRB A;  1ZRF A;  3PUB A;  1O57 A;  2DCE A;  4ITV A;  5EEG A;  3VOD A;  4HDU A;  2GZW A;  3M8E A;  5IT9 Z;  3BTL A;  3DPT A;  4ZYD A;  3I54 A;  2XAF A;  2NRA C;  4XR6 A;  5K5Q A;  5HDN A;  2L9N A;  2W1O A;  4J01 A;  3HUG B;  1H9G A;  3F9K A;  3PNV A;  3FK6 A;  1O3R A;  1XTA A;  2CUF A;  2VKH A;  2FX0 A;  3LL7 A;  1IRX A;  1XMK A;  5IYB J;  1FC3 A;  1WI9 A;  3JAM K;  4EV0 A;  2V7F A;  5E1Z B;  5DS9 A;  3TGN A;  3S93 A;  4HBL A;  3FM5 A;  1IRZ A;  3ISP A;  3CP8 A;  2FMY A;  1M1E B;  2JT1 A;  2EFN A;  3PQK A;  5E3L A;  3HKZ N;  2ZJQ F;  3FM3 A;  2BEO A;  4MGR A;  1ZKG A;  3OYM A;  2P6T A;  2XAJ A;  4CZZ A;  3M1C A;  1VQ7 I;  5FLX K;  2UZK A;  3RZO J;  5DUI A;  2KZV A;  2LTP A;  2EZK A;  3Q9V A;  4M3G A;  1WJF A;  4V2G A;  5HS7 A;  3E6C C;  4XLH A;  3G1M A;  3ZMU A;  3HOZ J;  3ZR8 X;  3TKY A;  1S7O A;  2H94 A;  2GXG A;  2ZKZ A;  4HX4 A;  2H09 A;  3ZP5 A;  2DOA A;  2GXB A;  2Y75 A;  4XKC A;  2Y2Z A;  3DTE A;  2HU9 A;  3BZC A;  1Y8Q B;  4F91 B;  1XGM A;  1E3O C;  3I9V 2;  1XDU A;  3HRM A;  2NVY J;  4UV8 A;  5CVI A;  2R5Z B;  1U5T A;  4A3B J;  3HSR A;  1H9T A;  1B72 B;  4IO9 F;  4NB5 A;  1Z67 A;  1EH8 A;  5C3E J;  5KAF C;  5JI6 A;  2GLO A;  3KET A;  2DXI A;  3DTK A;  3FXM A;  1BI0 A;  3OL4 A;  5TJJ A;  3DKY A;  2JPB A;  1RI7 A;  4BKX A;  2IEK A;  4BBR J;  3ZMD A;  3H0G J;  4F55 A;  4QLC U;  1P92 A;  3GLX A;  3MWM A;  1V54 H;  2EPF A;  3M8J A;  2GOM A;  3CLO A;  2O3F A;  3K2Z A;  3VYS B;  2IT0 A;  3V42 A;  1V5E A;  4MNU A;  3LA2 A;  3O6B B;  4L0Y B;  1VF9 A;  2VPL A;  5A2Q K;  1MIJ A;  2FBH A;  3C18 A;  4B48 A;  1T08 B;  4E7J A;  4XON A;  2V4J C;  1EKE A;  3VSL A;  1R4N B;  1HBX G;  3LST A;  3JRE A;  3GYH X;  1K6Y A;  1E0E A;  3F72 A;  1IRG A;  5KNL A;  1CGP A;  2QEN A;  2VC1 A;  3BRO A;  1T38 A;  2Q1Z B;  1VQM I;  2HZT A;  1KGS A;  4ETS A;  2P8T A;  1YIT I;  5IY5 H;  5ILS A;  2Y9Z A;  2W00 A;  2JRT A;  2VBW A;  3LFU A;  4KJZ A;  3BZ6 A;  4ABZ A;  4DGW B;  2CSO A;  1HCR A;  2HPM A;  4Q5S F;  3OYG A;  4A2U A;  2XAQ A;  4MFD A;  1D0Z A;  5DM7 F;  4FQG A;  3CDI A;  3J7A Y;  1AKH A;  1VQ4 I;  1W4M A;  3HTU A;  4M72 A;  2EWN A;  3QOE A;  2OQG A;  3HOX J;  2CUZ A;  3ECO A;  5HOO A;  3Q9S A;  1I27 A;  1TT0 A;  2JVG A;  1AOY A;  3DBR B;  1X3W B;  3FXJ A;  2DYS H;  3J81 K;  1ZH5 A;  5CQE A;  3MKZ A;  2ZC2 A;  2QSG X;  1FMW A;  2VBY A;  5H20 A;  4OMZ A;  1HKQ A;  5F0H A;  1BR1 A;  2EA4 A;  4XM3 A;  4HLX A;  5IP9 J;  1VI0 A;  2OC6 A;  1VQ8 I;  4BJ6 C;  3D5L A;  3HHG A;  3JW4 A;  5KCM A;  3A0H C;  4ON0 A;  2QLZ A;  2KPM A;  1DUX C;  9ANT A;  2H8R A;  3BQY A;  4WXC A;  1R7J A;  2FD5 A;  3VYR B;  5IOY A;  1Q1V A;  1SMT A;  1Y8R B;  2IGM A;  2UXX A;  3BG9 A;  3HG9 A;  2L9R A;  1O3T A;  2JA8 J;  2JK3 A;  2YU3 A;  1T56 A;  2ZXW H;  3TP0 A;  2PI0 A;  1IRF A;  3R0A A;  2O6G E;  4C9Y A;  4IZZ A;  2HZD A;  2X6X A;  3MKW B;  2PMZ A;  5LBQ A;  4G7Z F;  3F0C A;  4XQF A;  4RAF A;  4C30 A;  1ZEL A;  2HOT A;  2L01 A;  3HSF A;  4I09 A;  3LOC A;  4IHY A;  1ONV A;  2DA5 A;  3GXO A;  3FDY A;  3CCR I;  1ZK8 A;  3FXR A;  2PJR B;  4HYE A;  1TQP A;  1LVA A;  2CQK A;  3CMM A;  3IRQ A;  5DCF A;  3SFZ A;  1IV6 A;  2DFH A;  4M6Y A;  2HS5 A;  4HA8 A;  1FIP A;  1A6Q A;  3DEW A;  2E1C A;  4PK4 A;  1BI1 A;  1XSD A;  3K0L A;  2LOO A;  2EJR A;  4XRF A;  1TNT A;  2H6B A;  2MD0 A;  3I4M J;  3L7W A;  5FD5 A;  5LHI A;  5BPI A;  2RV8 A;  1X3Z B;  3KPH A;  2R93 J;  2EA2 A;  1QZY A;  2W84 A;  3ZQQ A;  1RR8 C;  4C3H J;  5HS8 A;  2L9S A;  3M8F A;  1LUJ B;  4OAY A;  3WU2 C;  3DWL E;  1SFK A;  1ETV A;  2LH9 A;  3LWF A;  3ZOB A;  1NG6 A;  3BCB A;  3ZQ7 A;  1TWH J;  2AHQ A;  3LSG A;  3BCA A;  3S3O A;  2XB0 X;  3IWF A;  2HOS A;  1P2F A;  2E1M C;  4UUS B;  5CQG A;  2AO9 A;  1UEL B;  3GTL J;  4XSZ F;  5GPC A;  1Z3X A;  3VPR A;  2JA2 A;  3F22 A;  4M3E A;  2VOO A;  3FBI B;  2ZME C;  4KA4 A;  1ZRE A;  3QWL A;  2BBY A;  2B0L A;  4RB1 A;  2ID3 A;  4MLO A;  2HVQ A;  1QPI A;  1TL8 A;  3A1Y A;  2HYF A;  2MAB A;  1Z3Y A;  3ASO H;  3QU6 A;  5IOZ A;  1GV2 A;  3OS1 A;  3GTM J;  1TWC J;  5DCM B;  3V8K A;  3KYC B;  4BQN A;  5M5Y J;  1TT5 B;  1K78 A;  2F6C A;  5FJ8 J;  1XS9 A;  1R36 A;  5L3E A;  2LY9 A;  4KYW A;  4JX5 A;  5DD4 A;  5JHF A;  3J80 K;  3HKZ A;  3JRI A;  2YSR A;  4LB6 B;  3DEU A;  1ZGW A;  2LSO A;  3HC7 A;  2KL4 A;  3D5S C;  4M3B A;  2EIL H;  2VJ4 A;  4AU7 A;  1TBX A;  4FIS A;  3S1N J;  1L0O C;  2CW7 A;  1IXS B;  3FIW A;  1SVO A;  4U7B A;  3JRD A;  1JKR C;  2R7X A;  4HRI A;  3IKV A;  2H6C A;  2IA1 A;  2XVC A;  3IAM 2;  5HLG A;  5CVR A;  4PGG A;  2QKM B;  3C2H A;  2XRO A;  3BR3 A;  2V6C A;  1FPQ A;  2COB A;  1OCC H;  3RQ4 A;  4BUP A;  1KU2 A;  2CGP A;  4ZH4 F;  1IZ1 A;  4OIR F;  5EEH A;  2JSP A;  3OSG A;  5FO5 A;  2E2J J;  3AL0 C;  1S3J A;  5C4J J;  4G7H F;  1BW5 A;  2JA7 J;  2A69 F;  3K69 A;  4RGX A;  1QNT A;  2XKP A;  4CYD A;  1F9N A;  4WX9 A;  3GTQ J;  1IUF A;  2COM A;  1ZGJ A;  1OCT C;  5E3N A;  1R4M B;  4CCK A;  3I53 A;  2HDD A;  1ON1 A;  5M5X J;  2HNH A;  1HA8 A;  2JRM A;  2F5D A;  1UHS A;  2LP0 A;  5J47 A;  5EJC A;  5LHH A;  3J7Y J;  1RET A;  4ENM A;  1P4A A;  2M30 A;  4OAZ A;  3BDD A;  4G6Q A;  4F3Q A;  1LDJ A;  2DPU A;  4E7S A;  3GTG J;  4CCL A;  1LE8 B;  1BJZ A;  1Z0X A;  5HLI A;  4XNF A;  4P1W A;  3AKZ A;  1UMQ A;  2HWV A;  3V7C A;  1SAN A;  4BJ5 C;  3I0T A;  4HF2 A;  4S0H B;  1IV8 A;  3R4K A;  1YJN I;  1W7P A;  3O8H A;  5FFX A;  3A01 B;  1MBE A;  4RGU A;  3AG3 H;  3C2G A;  2QEX I;  4IVN A;  4J19 A;  2L0K A;  4CCJ A;  2XPV A;  3CUQ A;  3RPQ A;  5K7Z A;  3HJE A;  5KVR A;  1ZLJ A;  2KIQ A;  1YTY A;  2BVM A;  4PJN A;  4WF2 A;  2XKO A;  1MJA A;  1MKM A;  3SZP A;  3IP4 B;  2HVS A;  3CCL I;  1A35 A;  2XV4 S;  3F8F A;  4B8X A;  2BE5 F;  2E1O A;  5E8I A;  3K6G A;  2IJL A;  3R60 A;  4U7D A;  3NEU A;  1PUF A;  1MDM A;  4S05 A;  1ZRD A;  3L2W A;  4HAM A;  4D9J A;  3K4L A;  1Y6I A;  2DTZ A;  4N0B A;  2LBF A;  2OJE D;  1R5H A;  4A3K J;  1O3S A;  1DPU A;  4B44 A;  1U2W A;  2BW3 A;  3U21 A;  1RZ4 A;  3TW7 A;  2DK5 A;  1W0U A;  1Y56 A;  2DLL A;  5B3S H;  1AA7 A;  3QYF A;  4HQE A;  4A3J J;  4AD9 A;  4A0Y A;  1FMV A;  1GV5 A;  3BOQ A;  2FOK A;  4UHT A;  1I50 J;  1MH3 A;  4NC7 A;  1SD6 A;  4NUB A;  1ZQ3 P;  4PUS A;  1AWC A;  3H3U A;  5ICG A;  3HOS A;  2X48 A;  3IRR A;  2V9P A;  4NQW B;  1U6G A;  1WGX A;  2DA3 A;  3I3L A;  1MNE A;  3WE3 A;  1UHM A;  2MC4 A;  2JZY A;  2G7H A;  2NOJ B;  1APL C;  1BIA A;  3ABK H;  4K2E A;  2VQL A;  1OYY A;  2ZCW A;  3RPU A;  3WTW C;  1HST A;  2LKX A;  1KU3 A;  3HHH A;  3KZY A;  4D5F A;  1GVJ A;  4N4N B;  1NTC A;  3ZQF A;  2DI3 A;  4EM0 B;  2WV0 A;  3BWG A;  1VFC A;  1IN5 A;  1IXR C;  5GAD J;  2DOF A;  3S1M J;  2VOD A;  1K7A A;  3OYL A;  3IH4 A;  2M8G X;  2VUM J;  2OCC H;  3HPG A;  3CCV I;  3A0B C;  5E1X A;  2M0M A;  3K10 A;  2R7Q A;  3GO5 A;  1JHH A;  1ETW A;  1Z1D A;  3OMY A;  2LRD A;  4LD5 A;  1FEX A;  1YFH A;  2ZJP F;  1FIA A;  1BR4 A;  1VQ5 I;  1I3Q J;  3IH3 A;  2M8E A;  3L2Q A;  3QYB A;  1W0T A;  2ZJ2 A;  3LSI A;  1A31 A;  1YIJ I;  4HF0 A;  1U9N A;  2EQR A;  4RAG A;  2E34 A;  4LOC A;  3W6V A;  3F23 A;  1F1Z A;  3UKG A;  2QM3 A;  3S15 J;  3B6A A;  4M3D A;  4ESJ A;  2GM4 A;  4N9I A;  3I5U A;  4QSH A;  1IDY A;  3WG7 H;  4RS8 A;  3GEZ A;  4E7K A;  5JHU A;  3FXO A;  4LG0 B;  1V5G A;  2QBY A;  5EG0 B;  2ELH A;  2VB6 A;  3K1M A;  1FP1 D;  1UCR A;  1ITY A;  5F1J A;  2QCO A;  1Y1V J;  3S8P A;  1K4S A;  5FKN A;  2QYO A;  5ED4 A;  3WTU C;  2STT A;  4ANJ A;  2XUB A;  4E6K G;  4N4O B;  4PJJ A;  2MH2 A;  3HPH A;  3IUO A;  1RC9 A;  3OIO A;  3EPZ A;  4YII A;  1TTY A;  5D6F A;  4BEH A;  4XRS A;  1TWG J;  3H0D A;  1B8I B;  3SXY A;  3KIO A;  4HDV A;  5F0F A;  1T33 A;  1FP2 A;  3JSO A;  1BOA A;  4A3M J;  1X2N A;  1BR2 A;  4DZJ A;  1D5V A;  2LC2 A;  2QA4 I;  4YIF A;  5LFA A;  3GTP J;  1JUS A;  5LRR A;  2YX4 A;  2YX7 A;  2JUC A;  3K9T A;  4HST A;  1XB4 A;  1WVR A;  4WXD A;  2DFE A;  2WV1 A;  1GUU A;  5LEJ A;  2XHK A;  3K70 D;  3H3V K;  2XAH A;  3GX4 X;  2M3A A;  1A5J A;  4IF4 A;  1SVL A;  4CA0 A;  2FF4 A;  4BY1 J;  5FD6 A;  2K9L A;  1Y0N A;  1HF0 A;  2DFF A;  2IA0 A;  3BG7 A;  5EGO B;  5D5W B;  5K7H A;  4PJL A;  1PUE E;  3DU6 A;  1EH7 A;  5F0C A;  2IP2 A;  1YW9 A;  2YS9 A;  4LLG F;  3L1P A;  2R5Y B;  4MIM A;  2DT5 A;  5ICF A;  4YFK F;  1VQ6 I;  5CJ9 A;  2PMZ N;  1L3L A;  4NC8 A;  5DYM A;  2IW5 A;  3BP8 A;  1X4O A;  5E79 C;  4LLL A;  1JT0 A;  3I59 B;  1S29 A;  1X4P A;  3F8C A;  4IHX A;  2L3D A;  3W6J B;  3CCE I;  1S7E A;  4KN4 X;  2V1X A;  1P9Q C;  2RNJ A;  2O8K A;  3TBI A;  3KZI C;  5D4R A;  4E70 A;  4M6V A;  4XOT A;  4HLY A;  2LDU A;  1A36 A;  3VDX A;  2E2I J;  1H89 C;  2J5O A;  3BC8 A;  2WY8 Q;  4BNC A;  3F8M A;  1OYW A;  2O5R A;  2DPD A;  2XAU A;  3KZZ A;  4KIB A;  4IQJ A;  3O8G A;  3BY6 A;  2XPU A;  2W24 A;  5L3F A;  3OWT A;  4KIT B;  3ML6 A;  1OKR A;  4UUT A;  4Y3O A;  1NK3 P;  5J4Y A;  4I6Z A;  2A5W A;  1QHH D;  3IWZ A;  3S2W A;  4AYB A;  2X0L A;  4I02 A;  1P6R A;  2FSW A;  2EV6 A;  1DDN A;  5FKO A;  2VPR A;  3RIR A;  1DPR A;  2L4A A;  1F36 A;  2Q0O A;  1ERD A;  1XCV A;  3G4S I;  5CPR B;  2E60 A;  5FKM A;  5BPD A;  2CG4 A;  4H0E A;  1J5Y A;  1WQ2 A;  3QP6 A;  3SHF A;  1FY7 A;  2ZB9 A;  3AG2 H;  5JLX A;  1CQT A;  1ZYR F;  2DA4 A;  1OR7 A;  2EZH A;  1H0M A;  5IT9 K;  3HGY A;  2G7U A;  2BY3 A;  5FLM J;  3K2A A;  2ZME A;  1W1W E;  3CC7 I;  5E8G A;  1ETK A;  4LG3 A;  4TV7 A;  2OU2 A;  3SQN A;  3W6K B;  3ONQ A;  2UUZ A;  2MLK A;  5L3C A;  4KIC A;  1OCZ H;  3BJ6 A;  2CQN A;  1QRY A;  4IRH A;  4G8X A;  4MQ9 F;  4RA2 A;  3SYT A;  4EJW A;  1QO0 D;  2DK8 A;  2Y0M A;  1TW2 A;  5TRD A;  2DMT A;  1BC8 C;  3GFL A;  2XRL A;  3LSH A;  5LLQ A;  1A04 A;  1YJ9 I;  1PJR A;  1OCP A;  4C2M J;  1YS7 A;  3OOP A;  4PGH A;  4EJT A;  4B4C A;  4XBF A;  3LAP A;  3F8N A;  2Z1D A;  3GFM A;  3RYR A;  2ZNY A;  2VI6 A;  4UB8 C;  2V6E A;  1VQP I;  4Q4Z F;  3EET A;  2IS1 A;  3PL8 A;  1MMS A;  3HGG A;  3JCU C;  5GPA A;  2X1E A;  5TGT A;  1P7I A;  2AQF A;  2PJP A;  1U5T B;  1F5T A;  2EB7 A;  2IAI A;  5AON A;  5E3M A;  1LKX A;  2DW4 A;  2KRC A;  1HLV A;  2OPT A;  5CLS A;  1R1T A;  1MBH A;  5IP7 J;  2ECB A;  4QTR A;  2NXN B;  2HOA A;  3QOP A;  3FK7 A;  3JRF A;  5JVT A;  4IXA A;  2IS4 A;  2P0W A;  2PQ8 A;  2VJI A;  3CCQ I;  2RQQ A;  4EM1 A;  2FOW A;  2OF7 A;  3S3N A;  2VKV A;  4RLQ A;  1K83 J;  1POG A;  3V8J A;  1DQU A;  2LYC A;  4CYC A;  1JJ8 C;  4FCY A;  1S6L A;  2BOL A;  2D5V A;  2K9S A;  5DTD A;  5D5X B;  4W1U A;  1YG2 A;  3LAJ A;  1O7L A;  3DTI A;  3GLL A;  3U1K A;  3W2V A;  1SD4 A;  1MBJ A;  2MA3 A;  4LJZ F;  3H9Q A;  1BW6 A;  2BY0 A;  2P6S A;  2XF7 A;  2XIG A;  2Y30 A;  2H27 A;  1IN6 A;  3MQ0 A;  2VC0 A;  4XOR A;  3SJM A;  1SMY F;  5BQT A;  1E3P A;  2H1K A;  4CCN A;  5F27 A;  4XLC A;  3E97 A;  5L3B A;  2GIZ A;  2XB5 A;  1BC7 C;  2CV2 A;  2XPW A;  4CDG A;  4NHJ A;  4Y52 J;  3GF2 A;  3OV8 A;  3RKX A;  2GWR A;  3P5J A;  2IA2 A;  3M7G A;  1JKQ C;  3ABM H;  3ULQ B;  4A3G J;  1OMI A;  4Z6Y A;  4L5E A;  3J7Z I;  3T5X A;  2PN6 A;  3KP3 A;  1AKH B;  4EGY A;  3C7J A;  1LEA A;  1XGO A;  2XDV A;  3I4N J;  3V8L A;  4BHP A;  1IJW C;  4EEF G;  3M07 A;  1ETO A;  4I76 A;  3WTZ A;  3OYF A;  3QPL A;  2FUG 2;  2K9N A;  4CUG A;  4JOM A;  4KIG A;  2P5L C;  1SEU A;  1I6H J;  3GFI A;  4IHW A;  2AXL A;  4G6T B;  4UV9 A;  4BH9 A;  2V26 A;  2BXZ A;  2BVL A;  4U88 A;  4KT5 C;  4DYC A;  1ZLK A;  4OOI A;  2RVC A;  2LKS A;  4RMN A;  3CC2 I;  1Y39 A;  2OBP A;  2K7L A;  3OS2 A;  3PO3 J;  4W97 A;  2DYR H;  1ZAO A;  4P9F A;  3WHC A;  3HRS A;  3GZ5 A;  4WWC A;  5CVU A;  4Y13 A;  2K3F A;  2CQX A;  2FML A;  1JGG A;  3REO A;  1J7K A;  3PNY A;  4V19 K;  4ESF A;  3KYL A;  1GHC A;  2NNN A;  2NS8 A;  1TW3 A;  3CDH A;  2BY2 A;  2DT7 B;  4CXF A;  3RDI A;  1X2M A;  3BTJ A;  2DDB A;  2A5Y B;  2JVH A;  1FYM A;  2D1H A;  1MJ9 A;  4FT8 A;  1R00 A;  2VKD A;  3P9C A;  1RNL A;  2DMQ A;  2WAQ A;  2HEO A;  2V1N A;  1TQM A;  2H8W A;  2HQA A;  4I98 B;  3OY9 A;  3HOU J;  3MCZ A;  4HNV A;  3G6E I;  1ZR4 A;  2ESH A;  3OYB A;  2O61 A;  3I71 A;  1FSE A;  3RPU D;  3I55 I;  1Y1W J;  3KLO A;  4C3I J;  4X1E A;  1FOY A;  2VE8 A;  1Z05 A;  1MMD A;  4GO1 A;  5GTH C;  3S3M A;  1J9I A;  2LY2 A;  1TZL A;  1OJL A;  4AM3 A;  1B9N A;  1Z7L A;  2K27 A;  1FJL A;  4B43 A;  3BR0 A;  3LNQ A;  4IOC F;  1FOX A;  1OCR H;  4BU2 A;  4OU0 A;  3H35 A;  5LRS A;  1VTN C;  1YRN A;  1HC8 A;  5HNF A;  2G9W A;  2W85 A;  3TED A;  2R92 J;  1ODD A;  1AHD P;  3N4M A;  1S9H A;  1LFP A;  1EJ9 A;  2GQQ A;  2F2E A;  2Z99 A;  3AG4 H;  3HSE A;  4DNC A;  2XSJ C;  4BHB A;  2X6W A;  3UR3 C;  2HQ5 A;  1KZH A;  2W48 A;  1RUN A;  4ZDL A; 
#chains in the Genus database with same CATH homology
 1LFU P;  1JTX A;  2E1O A;  2EH3 A;  5IYD J;  1JT6 A;  1PUF A;  2DMP A;  3CCY A;  1MSE C;  2XGE A;  2XGD A;  2DTZ A;  5M3F J;  3LSR A;  2MG4 A;  1RPW A;  2NS7 A;  2Y0S N;  2KDZ A;  4A3K J;  3HBL A;  3TW7 A;  2R5Z A;  1A6I A;  5J1Y A;  1B72 A;  1W0U A;  2MSY A;  4IEJ A;  1XG1 A;  3A03 A;  3ZQI A;  4A3J J;  1GV5 A;  3B6C A;  3HOW J;  3S2H J;  5EGO A;  1I50 J;  1MH3 A;  2GBY A;  4QIW N;  3BTI A;  1ZQ3 P;  4XRM A;  2MW8 A;  5EEA A;  3Q0U A;  3S1R J;  4A3D J;  1EF4 A;  2X48 A;  1G2H A;  2R5Y A;  3E7L A;  1WGX A;  2DA3 A;  1OFC X;  2VKE A;  4M3F A;  1APL C;  2E19 A;  4D7M A;  5BNG A;  2DMN A;  3BG3 A;  2LKX A;  3LSJ A;  4D7N A;  2M2E A;  4V2F A;  4D5F A;  1F43 A;  1WPK A;  1NTC A;  2LFB A;  3ZQF A;  2CQQ A;  4MO7 A;  2E2H J;  1MBG A;  3M3Y J;  3CQZ J;  4A3C J;  1VFC A;  3S1M J;  4BXX J;  1DU0 A;  2VUM J;  3IH4 A;  2M8G X;  3ZQL A;  1BL0 A;  3MKL A;  2ID6 A;  2XGC A;  4BBS J;  5IYC J;  1IC8 A;  3C2B A;  1WI3 A;  1ETW A;  1FEX A;  1FIA A;  1I3Q J;  3IH3 A;  1W0T A;  2I10 A;  3JRB A;  1ETX A;  1U9N A;  2YU9 J;  2EQR A;  4XID A;  4LOC A;  3W6V A;  2ECC A;  2M9H A;  4JX4 A;  2DA7 A;  3BTL A;  3UKG A;  4A3F J;  3S15 J;  3B6A A;  4M3D A;  2GM4 A;  4QSH A;  1ZTR A;  1IDY A;  3FK6 A;  2CUF A;  4B1R A;  2L7F P;  2FX0 A;  5IYB J;  5EG0 B;  5J1R A;  5DS9 A;  5JLW A;  1ITY A;  5F1J A;  2QCO A;  1IRZ A;  1Y1V J;  2FQ4 A;  4AC0 A;  5FKN A;  5J3L A;  2JA6 J;  5E3L A;  3HKZ N;  5FLV A;  1YRN B;  4MFE A;  1ZKG A;  2JA5 J;  3OIO A;  3GTO J;  3HDD A;  3RZO J;  4AUX A;  1IG7 A;  4AYB N;  3S2D J;  1JUP A;  2LTP A;  2EZK A;  3Q3S A;  4M3G A;  1BA5 A;  4V2G A;  4XRS A;  1TWG J;  1B8I B;  1ETY A;  3G1M A;  3OOU A;  5F0F A;  3HOZ J;  1T33 A;  4A3M J;  1X2N A;  4DZJ A;  4FE7 A;  1PUF B;  3GTP J;  1MSF C;  2NOG A;  1JUS A;  1VND A;  4IHV A;  5M3M J;  2Y2Z A;  4B3A A;  3D1N I;  2L7Z A;  4G12 A;  1E3O C;  2M0C A;  2WV1 A;  1GUU A;  2NVY J;  3H3V K;  2R5Z B;  4A3B J;  1B72 B;  1A5J A;  2R0Q C;  1WH7 A;  1U8B A;  5C3E J;  1MH4 A;  3GBG A;  2GLO A;  4BY1 J;  1HF0 A;  1JKO C;  4BKX A;  5EGO B;  2IEK A;  5K7H A;  5C44 J;  4BBR J;  3H0G J;  5F0C A;  2YS9 A;  3L1P A;  2R5Y B;  4MIM A;  1K61 A;  2X6O A;  2LVS A;  1JTY A;  2CRG A;  3SFI A;  2PMZ N;  1JT0 A;  2NVX J;  2JMW A;  1VF9 A;  4IHX A;  1ETQ A;  3HOY J;  4FTH A;  1S7E A;  1HDD C;  1TC3 C;  4A3I J;  3JRE A;  4DYR A;  2O8K A;  3BG5 A;  4M6V A;  5EYR A;  3IH2 A;  5FKL A;  4UUS A;  3JRA A;  1H88 C;  1H89 C;  2E2I J;  2XSD C;  2G0E A;  3BT9 A;  3JRG A;  3K7A J;  2N8G A;  3O8G A;  2Y9Z A;  2XPU A;  4ABZ A;  3RKQ A;  2IBD A;  1TWF J;  1HCR A;  1O4X A;  4MFD A;  4UUT A;  5EZG A;  1HDP A;  1NK3 P;  4I6Z A;  1AKH A;  1R9T J;  5EF6 A;  5FKO A;  2VPR A;  3HOX J;  1F36 A;  2P81 A;  3PM1 A;  3CMY A;  4RBO A;  2HXI A;  5FKM A;  3QPS A;  1IDZ A;  2ZB9 A;  5JLX A;  1CQT A;  3ZQC A;  3BTC A;  1AU7 A;  2DA4 A;  3G1L A;  2EZH A;  2L7M P;  5F0H A;  3OSF A;  3GTJ J;  3HGY A;  5IP9 J;  1VI0 A;  5FLM J;  3K2A A;  2DA2 A;  3BR5 A;  1ETK A;  9ANT A;  2LK2 A;  3RQI A;  2H8R A;  1RKT A;  3S14 J;  3M4O J;  2O7O A;  3BQY A;  4XK4 A;  3HM5 A;  1FTT A;  2FD5 A;  1QRY A;  5IOY A;  1Q1V A;  3BG9 A;  2TCT A;  1MNM C;  2DMT A;  2XRL A;  2L9R A;  2JA8 J;  4DW6 A;  2JK3 A;  1T56 A;  1JUM A;  3TP0 A;  1SFO J;  1OCP A;  4C2M J;  5K7F A;  4B4C A;  2HI3 A;  1QVU A;  2RAE A;  3F0C A;  2VI6 A;  4DZP A;  2HOT A;  5C4X J;  3HB9 A;  1ENH A;  3LOC A;  3S16 J;  4IHY A;  2Y31 A;  4A69 C;  5EDN A;  3HGG A;  2DA6 A;  5GPA A;  2DA5 A;  4A3E J;  1P7I A;  1ZK8 A;  3NAR A;  2IAI A;  3HEF A;  1LE8 A;  5EZH A;  5E3M A;  3MN2 A;  4FE4 A;  1HLV A;  3BR6 A;  1IV6 A;  2OPT A;  1MBK A;  5GP9 A;  3TP3 A;  1MBH A;  5IP7 J;  1FIP A;  2ECB A;  3BR2 A;  4QTR A;  2HOA A;  3DEW A;  3FK7 A;  3JRF A;  3A01 A;  1FTZ A;  1WH5 A;  1XC5 A;  3I4M J;  2OF7 A;  2VKV A;  4JYK A;  1K83 J;  2R93 J;  1POG A;  2CU7 A;  4CYC A;  3CDL A;  1JJ8 C;  4FCY A;  2X9D A;  4C3J J;  2D5V A;  4C3H J;  4Y7N J;  2K9S A;  5DTD A;  5IP6 A;  2WAQ N;  4W1U A;  2R7Z J;  1ETV A;  3ZOB A;  5FKK A;  1RES A;  1JJ6 C;  1TWH J;  2AHQ A;  3LSG A;  5E3O A;  4D5C A;  3BQZ A;  1MBF A;  2QF7 A;  2XB0 X;  2KT0 A;  2DA1 A;  1MBJ A;  2HOS A;  2JWT A;  2EZI A;  1X58 A;  1BW6 A;  3G1O A;  4UUS B;  2FJ1 A;  2Y30 A;  2Y9Y A;  2AO9 A;  3GTL J;  5GPC A;  3IV5 A;  3VPR A;  4M3E A;  4X6A J;  3SJM A;  1LFB A;  2H1K A;  1GT0 C;  2CUE A;  5F27 A;  2HYJ A;  3JRH A;  2ID3 A;  2XB5 A;  4MLO A;  2XPW A;  1QPI A;  4Y52 J;  3WHB A;  1JKP C;  5IOZ A;  1GV2 A;  3FKI J;  1JKQ C;  1Z77 A;  1TWC J;  3GTM J;  2EBI A;  4A3G J;  3S1Q J;  4L5E A;  5M5Y J;  1D5Y A;  2DJN A;  2LR8 A;  1AKH B;  5FJ8 J;  3NAU A;  4RDU A;  1XS9 A;  4GFB A;  2LD5 A;  1QVT A;  2LY9 A;  4DYQ A;  3I4N J;  4JX5 A;  3JRI A;  3A02 A;  1IJW C;  2MGQ A;  4EEF G;  5HOD A;  3Q0V A;  2ME0 A;  1ZGW A;  1ETO A;  3MVP A;  4I76 A;  3QPL A;  4M3B A;  2K9N A;  4FIS A;  3S1N J;  4A93 J;  3GTK J;  3FIW A;  3JRD A;  1I6H J;  1JKR C;  1P7J A;  2M34 A;  3LSP A;  4IHW A;  3RZD J;  3SDG A;  3HOV J;  2LLK A;  2CJJ A;  2B63 J;  4DYC A;  3BR3 A;  2HXO A;  2COB A;  3PO3 J;  1NK2 P;  3DCF A;  4W97 A;  3OSG A;  3WHC A;  2E2J J;  3S17 J;  5C4J J;  2CQX A;  3TW6 A;  1JGG A;  1BW5 A;  2JA7 J;  2ELK A;  5F08 A;  4BY7 J;  3QQA A;  3PO2 J;  1WCM J;  2NS8 A;  3GTQ J;  3ZQG A;  1IUF A;  3BR1 A;  1OCT C;  5E3N A;  1ORK A;  5IPA A;  1X2M A;  2JJ7 A;  1GVD A;  3BTJ A;  2NVQ J;  1RR7 A;  2HDD A;  3JR9 A;  5M5X J;  4JP0 A;  1GDT A;  4JX6 A;  1UHS A;  4NDL A;  2LP0 A;  4XIC A;  5M5W J;  1RET A;  2DMU A;  2DMQ A;  2O9L A;  3HOU J;  2K9Q A;  4HNV A;  1LE8 B;  3GTG J;  4A3L J;  1ZR4 A;  1BJZ A;  1UG2 A;  1Z0X A;  3JRC A;  2ME6 A;  1UMQ A;  1Y1W J;  2K40 A;  4XRS G;  4C3I J;  2DN0 A;  4X1E A;  1SAN A;  5J1U A;  5EG0 A;  1OJL A;  4S0H B;  2EZL A;  3A01 B;  3O8H A;  1MBE A;  3Q0W A;  1IGN A;  1FJL A;  2YUS A;  3BR0 A;  4J19 A;  3LNQ A;  2WB1 N;  2L0K A;  2TRT A;  1U78 A;  2XPV A;  4CYC B;  5K7Z A;  1YRN A;  2JN6 A;  3TED A;  2NVT J;  2R92 J;  1AHD P;  1U9O A;  5F04 A;  3FIS A;  1ZR2 A;  1TWA J;  1H8A C;  3ZQH A;  1RKW A;  1B8I A;  1HOM A;  1DU6 A;  2HQ5 A;  2W48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...