1JKQC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*TP*AP*TP*AP*AP*GP*A)-3'
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkqC00
1WCMJ 5FKOA 3BTIA 3A03A 1MSFC 1VFCA 4BY1J 3GTOJ 3BTJA 1W0UA 2JA8J 4A93J 3HKZN 2B63J 3HBLA 2P81A 5GPAA 1U78A 1JUSA 5EGOB 3ZQLA 4M3EA 3CMYA 1GUUA 2XB5A 3DEWA 5F0HA 2MW8A 2JJ7A 1QVTA 2DMQA 2FJ1A 2CUEA 3LOCA 5GPCA 1IV6A 2GBYA 3MKLA 2DTZA 2JMWA 3JRFA 1IJWC 3UKGA 4CYCA 1ZGWA 1GDTA 1TC3C 1UG2A 1AU7A 4IHWA 2JA7J 1WH5A 1XC5A 3HOUJ 4B1RA 3IH3A 3BTCA 2FD5A 2R5YA 4A3BJ 3OOUA 2R92J 2ECCA 2COBA 2HXIA 4B4CA 2M8GX 2IAIA 2K40A 1JT6A 3TP3A 3S14J 2R5ZB 4XICA 1I6HJ 1HCRA 1ITYA 1RESA 4A3MJ 2Y31A 4A3CJ 4BY7J 3IH2A 4V2FA 3MN2A 2TRTA 1ZR2A 5E3MA 2E2IJ 3BQYA 2HQ5A 2XB0X 1UMQA 3Q0VA 1GVDA 1VNDA 5HODA 1FJLA 2GM4A 4IHXA 2O7OA 3S15J 1CQTA 3ZQGA 1JT0A 4A3LJ 1U9NA 2DJNA 9ANTA 3ZQIA 4A3IJ 2NS7A 5F1JA 1LE8A 1P7IA 1GV2A 1MBEA 3JRDA 2XGDA 3O8GA 1S7EA 3RKQA 1HDDC 2Y0SN 3TW6A 1BW6A 1FEXA 5EEAA 2MGQA 2WAQN 3TP0A 3BR3A 4IHVA 4A69C 2EQRA 1QPIA 2XPUA 4JP0A 3PO2J 1RKWA 3OSGA 2LR8A 4JX4A 2WB1N 3JRGA 2Y9ZA 3QPLA 3SFIA 1XS9A 3I4NJ 4M3FA 2R0QC 1BL0A 2EZIA 5FJ8J 4RDUA 4MLOA 3FK7A 2KT0A 4QIWN 3ZQCA 3S16J 4D7NA 1MBHA 2K9QA 4C3JJ 4BBRJ 5F0CA 5DTDA 2HXOA 2XRLA 3GTGJ 4L5EA 2E1OA 1POGA 4MFEA 1JKPC 4XIDA 4CYCB 2DMNA 2L7FP 2XGCA 2CQQA 5FLVA 4A3DJ 5EDNA 3BR1A 1I50J 5FKLA 5K7ZA 3BR5A 4UUTA 2LP0A 2M2EA 1JKQC 1OJLA 2HOAA 3ZOBA 1Y1VJ 3FKIJ 5J3LA 3DCFA 2VPRA 1B72B 4DYRA 3WHBA 3HOYJ 3OSFA 3LSGA 4M3GA 2R5ZA 3HGGA 5BNGA 2MSYA 5FKMA 5E3LA 3ZQFA 3GTPJ 3O8HA 4BKXA 1F43A 2OPTA 1RETA 1HLVA 2LKXA 1ETXA 1ETOA 1X58A 4IEJA 4FCYA 4LOCA 3M4OJ 5JLWA 5EYRA 3HM5A 1WPKA 5F04A 1W0TA 5EZGA 2ELKA 1FIAA 1U9OA 2VKEA 3BG5A 4A3FJ 5IOYA 4XRMA 1I3QJ 3SJMA 5EG0A 2DA7A 2EZLA 3G1LA 2N8GA 2JK3A 3HOZJ 2CUFA 2EH3A 3CDLA 1IC8A 2Y9YA 1WGXA 1B8IA 3Q0UA 2DA5A 3RQIA 2HI3A 3PO3J 1TWAJ 4MO7A 2IBDA 3HDDA 1ETQA 5F08A 5M5YJ 1RPWA 1H88C 1QRYA 3JREA 1RKTA 4B3AA 2DA6A 5DS9A 4XK4A 1PUFA 4I76A 4DW6A 3FK6A 2CJJA 3L1PA 2NVYJ 4RBOA 1VI0A 2XSDC 1IRZA 4V2GA 2PMZN 2EZKA 3IH4A 1IG7A 2IEKA 3BTLA 1U8BA 1DU6A 1MBKA 1SANA 3K7AJ 2AO9A 1JUMA 5JLXA 4M3DA 2JA6J 1T33A 2ME6A 2O8KA 2Y30A 3LNQA 3BR2A 2L0KA 3BG3A 1Y1WJ 1X2NA 2OF7A 2HOTA 1APLC 2CRGA 3BR0A 4JX6A 3F0CA 2LVSA 1AKHA 1ETYA 2D5VA 2JN6A 2W48A 3IV5A 4JX5A 2VKVA 2L7MP 1WI3A 3VPRA 3B6CA 5K7FA 2KDZA 3G1OA 2M34A 1FIPA 1RR7A 2CU7A 3WHCA 3S17J 5FKNA 5EGOA 1MBJA 2LY9A 3D1NI 1BW5A 3GTMJ 3W6VA 2YS9A 3BR6A 3E7LA 1D5YA 4MIMA 2X9DA 3HEFA 4M6VA 4G12A 4X1EA 1JGGA 2YU9J 3ZQHA 1MNMC 1JUPA 2LFBA 2E2HJ 1O4XA 1ZTRA 5GP9A 3TW7A 2LD5A 2H8RA 4J19A 2K9NA 4BXXJ 3FIWA 5EG0B 2X6OA 1BA5A 1JTXA 1ETVA 2YUSA 2R5YB 4FTHA 2M9HA 1K61A 4AUXA 3HOVJ 2HDDA 1LE8B 4QTRA 3A01A 2RAEA 3B6AA 3M3YJ 3S1MJ 1XG1A 2ID6A 4AC0A 1JJ8C 1TWHJ 1MH3A 3JRHA 4D5CA 3S1RJ 2ID3A 4C3IJ 1IGNA 2I10A 4A3JJ 2DMUA 1MH4A 1LFBA 4S0HB 4DYCA 3QQAA 5IYDJ 3CQZJ 3LSRA 4C3HJ 5E3NA 4FE7A 4IHYA 3S2HJ 3NARA 3GTLJ 4ABZA 4XRSG 3JRAA 1NTCA 5IYCJ 2GLOA 1LFUP 2QCOA 3JRCA 2E2JJ 2O9LA 1WH7A 1HF0A 1F36A 2NS8A 2L9RA 3GBGA 3A02A 2R7ZJ 2R93J 3QPSA 5J1YA 3SDGA 3PM1A 1FTTA 5IOZA 1ZR4A 2ECBA 1JKOC 2NVQJ 2NVTJ 1QVUA 3GTJJ 4I6ZA 4FISA 4JYKA 5C3EJ 1X2MA 1GT0C 3BG9A 1YRNA 1AKHB 2L7ZA 2NVXJ 5IP9J 2CQXA 1ETKA 2MG4A 1H89C 5EZHA 2JWTA 2LLKA 4Y7NJ 1Q1VA 1ORKA 5F27A 2K9SA 1MBGA 1G2HA 1UHSA 4UUSA 1K83J 2DA2A 2VUMJ 5EF6A 4D7MA 5FKKA 1B72A 5C44J 4EEFG 2LTPA 5J1UA 1R9TJ 3S1QJ 5K7HA 3G1MA 2DA1A 4GFBA 5M5XJ 5C4JJ 4AYBN 2JA5J 1HOMA 1NK3P 5IPAA 2M0CA 3H3VK 1EF4A 1IDYA 1GV5A 2AHQA 2Y2ZA 3GTQJ 2XPWA 5IP6A 1ETWA 1OCPA 2X48A 2HOSA 5C4XJ 3FISA 2DA3A 2DA4A 2EZHA 3S1NJ 2ME0A 3HB9A 3C2BA 4Y52J 1JJ6C 1H8AC 3MVPA 1IDZA 1Z77A 3A01B 2DN0A 3HGYA 3CCYA 4W1UA 1TWGJ 1JKRC 2HYJA 2LK2A 2TCTA 1TWFJ 3OIOA 1AHDP 5M3FJ 2FX0A 4NDLA 3JR9A 3LSPA 3TEDA 4QSHA 2XPVA 1OFCX 2H1KA 1B8IB 3GTKJ 4D5FA 1OCTC 3Q3SA 4BBSJ 2DMTA 3Q0WA 1JTYA 1Z0XA 4X6AJ 4W97A 5IYBJ 3BT9A 2XGEA 4MFDA 1P7JA 4FE4A 1T56A 1PUFB 4XRSA 1A6IA 5M3MJ 1E3OC 5F0FA 4HNVA 5J1RA 4DZPA 4A3GJ 4A3EJ 2DMPA 2VI6A 5IP7J 1A5JA 1VF9A 3K2AA 2WV1A 1ZKGA 1NK2P 1TWCJ 5FLMJ 3BQZA 2E19A 3I4MJ 2QF7A 3HOWJ 2FQ4A 1YRNB 3NAUA 1BJZA 3LSJA 5M5WJ 2G0EA 4DZJA 1SFOJ 3S2DJ 3RZDJ 4M3BA 1HDPA 4A3KJ 1IUFA 3RZOJ 1ZK8A 1DU0A 1ENHA 3H0GJ 1ZQ3P 1MBFA 4DYQA 2ZB9A 5E3OA 2NOGA 1FTZA 3HOXJ 2EBIA 3JRIA 3JRBA 4UUSB 4C2MJ 1MSEC
chains in the Genus database with same CATH superfamily
5D8KB 1WJ5A 1HKQA 1MSFC 4QPOA 1I27A 2LH9A 1W0UA 1D0XA 2QBYB 4JOMA 3HBLA 3WTVC 3MKWB 4F93B 4CCOA 1O7LA 4RB3C 4ETSA 1XCBA 3ZQLA 2ZFWA 3OIQA 4M3EA 4PSWA 5E20A 1GUUA 4ZYHA 3CMYA 2A6TA 2A6EF 2MW8A 5KNLA 3OYLA 2DMQA 2FJ1A 2BXYA 5FB2A 4GYGA 2QUFA 1Z1DA 3BPXA 5GPCA 3L2CA 5FROA 3AFHA 3H9QA 3JRFA 4IO9F 5GTHC 3RI4A 1TC3C 1GDTA 2BY1A 3JSPA 3HJEA 2KISA 2BY3A 4NB5A 2LDUA 4HQEA 1WH5A 1XC5A 3EQLF 4YFNF 2V9KA 5LFAA 1Z67A 3OOUA 2R7OA 1XB4A 1YW9A 4QLCU 4B4CA 2XSJC 5LEKA 1OR7A 4BS9A 2DFIA 1UCRA 2KIMA 4HDVA 3RCOA 3S14J 3J81Z 3ZP5A 1WZ2A 1I6HJ 4U88A 4A3CJ 2CW0F 4A3MJ 2EFOA 2EA2A 3C2GA 4M73A 1Z91A 3ZMZA 4IPAA 3IH2A 4RA2A 4QWQA 4V2FA 4BY7J 4Y13A 1HSJA 2KJCA 1TW2A 2GQQA 2LRDA 3QU6A 1VQ7I 1IN7A 5ED4A 4IHXA 1FJLA 2GM4A 2ZSIB 1ZRDA 3PSFA 4HX7A 2DJNA 1MDMB 2QKLB 4RLFA 2PJRB 1DGWY 3ZQIA 1OCZH 2MYSA 1F1ZA 3I59B 4B48A 1LE8A 4BEHB 1GV2A 4D9JA 3E6MA 1WJEA 5DUIA 3A0HC 4AIKA 2XGDA 4H4KC 3O8GA 3N97A 3TW6A 1FEXA 1BW6A 1X1AA 3GF2A 2M7AA 3DKXA 3K70C 2LREA 2NAZA 2IGNA 2ICWG 2XPUA 4BYYA 1R1UA 4JP0A 3L2VA 3S32A 2YX4A 5LGUA 4OIRF 3CUQA 2BHYA 4CXFA 3A4CA 4JX4A 3FXMA 1TNSA 4WCGA 5IY5H 2UZKA 1MJ9A 1UG0A 2R7XA 3I4NJ 2R7SA 2LKSA 3SZTA 1WJBA 1TNTA 3LSTA 1IN8A 4OINF 5K5QA 2EFNA 1OMIA 2OCEA 2VBWA 3R0AA 1OCRH 4Q48A 4Y4RA 4B8XA 2VONA 4LLLA 1H9TA 3LFUA 1GXQA 3CC2I 4XOTA 1X3ZB 1MBHA 1S7OA 1H0MA 4P55A 5F0CA 4BBRJ 3MZ8A 3CCUI 4IKFA 3DWLE 3GTGJ 2E1OA 4ZYGA 2V7FA 4MFEA 2HVRA 1BR1A 4KFCA 2DOEA 1U0JA 2YX7A 1A36A 1RIOH 3PQJA 3PJRA 4B3XA 3NEUA 2KIUA 4A3DJ 5EDNA 5FKLA 4BXFA 2RQPA 3U1KA 2GXGA 5K7ZA 3BR5A 4YFKF 4UUTA 2VE8A 5K1YA 2ZNZA 2FBIA 4A2UA 1KYZA 2M1BA 5J3LA 1O3RA 2K85A 3KEYA 1B72B 2JVHA 4DYRA 4FQGA 4ZC3A 3TDUC 5AONA 4D1QA 1FP1D 1ZHFA 3LSGA 4NNJA 5DCMA 4M3GA 1SVLA 4CCJA 3HGGA 1U5TA 2MSYA 2JT1A 5FKMA 3ZQFA 3GTPJ 4KMFA 1HW2A 1WQ2A 5AIQA 3M7GA 2MD0A 3DQVC 4BQOA 2UUZA 3RDIA 1RETA 2LKXA 2V1XA 2QENA 3K4LA 1YX3A 3PSIA 3TQNA 3JAMK 1ETXA 2JA2A 5BQTA 4FCYA 3R61A 1AOYA 3HM5A 2JSCA 1WPKA 5EZGA 2H6BA 1FIAA 1HW1A 3BG5A 4A3FJ 4L9VA 4I01A 1XMAA 2IGMA 1U6GA 4FASD 2DA7A 1BIBA 4UVAA 2N8GA 3HOZJ 1G3WA 4XMYA 2Y9YA 2D45A 1JHHA 1WGXA 1FX7A 4BHPA 2OCCH 1QZZA 1VQ5I 3PO3J 1XSDA 1QU3A 2IBDA 5E1ZB 1D8JA 4CH7A 4F52A 3HDDA 4G6TB 2HYGD 1H88C 1MZBA 3JREA 1QO0D 4EQQA 4F92B 3CJRB 3CCLI 3H5AA 4XK4A 3GUDA 2WY7Q 1Z21A 1VQPI 1IRFA 5LEJA 3ROUA 3W6KB 2GIVA 1K78A 4F91B 2X6XA 2XSDC 2WV0A 3FKJA 3IH4A 2L3DA 3BTLA 3KCCA 4ESJA 2AS5F 2R7TA 3VEPA 1GLNA 5J40A 2DT6A 3AG3H 2IRFG 4A5NA 2RKHA 3K7AJ 2LSOA 2M8EA 2WY8Q 5ILUA 3BG3A 1Y1WJ 4HNTA 2H27A 2IS1A 5KK1A 1X2NA 2HOTA 4Y33A 1W36C 1E17A 3BZKA 4JX6A 3F0CA 2CV0A 3QWLA 5D4SA 3FXLA 4PUSA 2VKVA 1MMDA 5LD2C 3FMQA 2WAFA 5K7FA 2KDZA 1FMWA 1LEAA 4RB0A 3I3LA 3MQ0A 2CU7A 1PP7U 2ELHA 4PGGA 1MBJA 1BW5A 2ESNA 3I54A 3CC4I 1FZPB 3W6VA 2VE9A 3ECHA 3S2WA 3E7LA 3I64A 4IVNA 4MIMA 3QOEA 4PJMA 1TBXA 2X9DA 2XGXA 3HEFA 4CO8A 4G12A 1BOBA 2OV7A 2NYXA 3MMYB 4YFXF 2KFDA 1TT0A 1L3LA 4EM1A 1QZEA 1R5HA 2L01A 4EJVA 2OQGA 4BACA 2LD5A 5DCFA 2PJPA 3P9KA 4J19A 1TTYA 3KP2A 3CCQI 3FXJA 2K4BA 3FIWA 5EG0B 3FM3A 2P6SA 1MGTA 1JTXA 3LAPA 3I9V2 3SZPA 3OMYA 2OTJI 5J4YA 3PFYA 4AUXA 5ILVA 2HDDA 2EILH 3I59A 4QTRA 1LE8B 3B6AA 1LVAA 2JUCA 2ID6A 3DKYA 4AC0A 4X0GA 3OYNA 1TWHJ 1Z3XA 3P5JA 3TBIA 2XC7A 3BJOA 3JRHA 3K69A 2Q2EA 2X0LA 3GEZA 1I39A 2QZ8A 2WA0A 1T0FA 1TP4A 2E5ZA 4A3JJ 1VQLI 2OZ6A 1LFBA 4S0HB 2ELJA 5D5XB 1SFUA 5IYDJ 3LSRA 3LA2A 2EIMH 1X3UA 2KRFA 3R6SA 2K02A 4FE7A 4WF2A 5HNFA 3NARA 3JRAA 2FNAA 2P5VA 4HW0A 3GO5A 3KP6A 3ML6A 2L4MA 2MLGA 4KISA 2DT5A 3CESA 2L9RA 3GBGA 5FD6A 1LNWA 1YJNI 2R93J 3FDYA 5J1YA 3SDGA 2DBBA 2ISZA 3QYBA 2F2EA 2IGOA 2M4KA 3U21A 4CCLA 3HC7A 1ZR4A 2ECBA 2R7WA 4PGHA 2XV4S 1X2MA 3F9KA 3RPUA 4PK4A 1AKHB 3WU1B 2L7ZA 3CMMA 2K4JA 2NVXJ 3WG7H 2GXBA 2HZDA 2LY2A 4EGZA 2VC0A 1R7JA 4IHSA 2RREA 1S8NA 1UAAA 4Y7NJ 1Q1VA 2EFQA 1ORKA 1FOWA 2AXTC 1PYVA 2X4HA 4MEYF 4BXUA 2V9VA 2X1EA 3KE2A 4KIFA 4UUSA 2BHZA 5TJJA 5FFZA 5EF6A 5FKKA 1B72A 5IT3A 2LTPA 1ZGAA 3AAFA 2CS3A 3KFWX 2IW5A 3G1MA 2HQNA 1W7PA 1KQ9A 5LGNA 1IV8A 4S04A 5C4JJ 2P0WA 4AYBN 4C9YA 2JA5J 1GVJA 2STTA 1HOMA 1NK3P 3J7AY 1GV5A 2QQAA 2A05A 4GYIA 3WG9A 4PCQA 1RC9A 4HF1A 3FISA 2ZMEB 1O3TA 3DTIA 4K2EA 2F4IA 3HL2A 2TDXA 3C2BA 1WJCA 4FHTA 1H8AC 3EYIA 2M4GA 2M30A 1JKRC 2KPMA 2HYJA 2LK2A 4IX7A 4XLPF 2J5PA 1SD6A 1AHDP 2W57A 5M3FJ 3JR9A 2ZJRF 2E7XA 5EEHA 4Z6YA 4PDKA 3LSPA 5E17F 4BE1A 2XPVA 3GTKJ 2H1KA 2VIXA 1OCTC 1JHFA 4BBSJ 3M1CA 1G8XA 2A61A 1Z0XA 1F9NA 3HYIA 2MBFA 4M9XA 5LRRA 2WBMA 3E0JB 3E97A 3Q9VA 1FNNA 4U7DA 1QHHD 3BDDA 5CJ9A 4A6EA 4N9HA 1DDNA 2BOLA 3V7CA 2R7DA 1A6IA 3K1PA 5M3MJ 4UNOA 2YU3A 4A3EJ 3S3NA 2HYFA 4C30A 3C18A 4GRIA 1ACIA 2OTLI 1TWCJ 2ZXHA 2V26A 1XTAA 4PJNA 3M07A 5BMZA 1SFKA 1ZG5A 4L9TA 3OYEA 2FQ4A 3NAUA 1J59A 1IV6A 3LSJA 5M5WJ 2G0EA 1YIOA 2RNJA 2KLOA 3ULQB 1OYIA 2BXZA 3AL0C 2XF5A 3F6VA 2L2OA 1IUFA 2NRAC 3PFIA 1XN7A 4XRFA 1W5SA 1UJ8A 5KVRA 2NOGA 3G6EI 3OYDA 1ULYA 4L9JA 3JRIA 3JRBA 5H6QA 1CGPA 5J6XA 1OCCH 2VJ4A 2A07F 1WCMJ 5FKOA 1BC7C 2HTSA 2KZVA 3A03A 4Q47A 3V8JA 4NQWA 1VFCA 3GTOJ 2IS4A 1OISA 4KN4X 3WGIA 1Z05A 2AQEA 3QOPA 4HAMA 4KITB 1P92A 3HKZN 3IAM2 2P5LC 3I56I 5GPAA 2P81A 2B63J 1U78A 1JUSA 1P2FA 2O6GE 2PG4A 3R4KA 1HSTA 2CV1A 5LHIA 2JJ7A 2G7UA 4J00A 1OR7C 2CUEA 3CLOA 3H5NA 3EUKL 3BPVA 2LMDA 2ZXWH 4CYCA 2QGUA 2QQ8A 3GFMA 5JFRA 3CF5F 1TQMA 2AXLA 4RM2A 1KQ8A 4AIJA 3OV8A 2VBXA 1AA7A 3I55I 1STZA 1AWCA 4MNUA 2VXDA 3RTRA 1FYKA 2HXIA 1MD0A 2M8GX 2IAIA 4E6KG 1N77A 3BOQA 1LB2A 2GOMA 2KZGA 4FX0A 4XICA 1HCRA 2Q2EB 1ITYA 1RESA 1YW8A 2Y31A 4KT6A 3P7NA 1KQ0A 2WAQA 1EKEA 1QQIA 1XDUA 4IHTA 5D6FA 3MN2A 1WJFA 1ZR2A 3BQYA 2HQ5A 1L0OC 1GVDA 2O7OA 4PFOA 1CQTA 3MD2A 4Y17A 2UV1A 3ASOH 3O3KA 9ANTA 4H0EA 1N75A 2EWNA 4A3IJ 4UV8A 2Z1DA 2IA2A 5HS9A 5LBQA 5FLXZ 2Q0OA 1U8RA 4P9FA 4HZFA 5HDKA 1LDJA 4OIPF 5EEAA 2HKOA 2XASA 4UXNA 5JHFA 3BR3A 4BAYA 5GAGJ 2BBYA 2E60A 2M0MA 2ZNYA 2EIJH 5GAHJ 2W25A 3WODF 1KYWA 1U2WA 1BI2A 1SC7A 2O03A 3I53A 1V5EA 1V5GA 4UVCA 3S93A 4ENMA 4ZZLA 4KA4A 2P5KA 5EJCA 4M3FA 3H36A 3I58A 3CCVI 2DFFA 2R0QC 1SFEA 3DEUA 1BL0A 2PEXA 2Y75A 2EZIA 1IAWA 2G7HA 1IRXA 2H94A 3JTHA 4N4OB 5L3BA 3QU3A 1NH3A 1IXSB 4M72A 4B47A 1QHGA 4RDUA 2DYSH 1Q1HA 1ON2A 1DQUA 1N78A 4UY8I 2KT0A 5DDGA 3S16J 1YOVB 4D7NA 4GDFA 4MGRA 4Y15A 2EK5A 2HXOA 2XRLA 3ZN1A 1W4MA 4L5EA 1EA3A 5CKTA 5TRDA 1FBSA 1G4DA 1D5VA 3FF5A 4XONA 1VQ4I 2C6YA 4HLYA 2E36A 3I0TA 1QZYA 4P1WA 4LFUA 3O6BB 1JKQC 1MMAA 1XPXA 4OMZA 4R79A 2O3FA 3CJTB 1G59A 2BW3A 3TL4X 4ZJZA 3ZRGA 1HBXG 3CDIA 4AIDA 3K1NA 3CTAA 2K3FA 5E1XA 2VOPA 2M87A 5BNGA 5HLTA 3DP7A 1R5ID 1LUJB 1T2KA 3B73A 2HDWA 1IW7F 2XVCA 5CVUA 5LGTA 2OPTA 3KEQA 1ETOA 1X58A 2IP2A 2QA4I 3HG9A 3FXRA 3U1DA 3A1YA 1MDMA 1HXDA 2W24A 3OS0A 2RDPA 2DXIA 5F04A 3TOBA 2OC6A 3AG4H 4BEHA 2F5DA 2Z5UA 2LF7A 2LKPA 1QA6A 3HSEA 3RKXA 3ABKH 1B4AA 2VN2A 4YELA 3GFJA 2JK3A 2DDBA 2EH3A 2FOWA 3LWFA 1B8IA 1QGPA 3G71I 2IA1A 3Q0UA 3AL0B 2DA5A 3V4GA 3PUBA 3S3OA 1TWAJ 4MO7A 4TV7A 3CCEI 1PDNC 4LK0F 3RPUD 2L9VA 2K27A 1A6QA 3CUQB 1ETQA 1HQCA 2VJ5A 3CCSI 2DA6A 4A0XA 2W4SA 5ICEA 3OYAA 2NVYJ 3V7SA 2KRHA 4XSZF 4PJ0C 4DJAA 1Z7UA 3DV8A 3IWFA 1NG6A 1MMNA 3NWSA 1VI0A 2HQRA 4YIFA 2VXZA 2EZKA 3KETA 4KUMA 1XGSA 3I4PA 1YJ9I 1BR2A 1SMYF 1S6LA 4CGZA 3AKZA 4OOIA 1SANA 3HZJA 3A0BC 2KHMA 4RAGA 2ME6A 4YEJA 4BJ5C 3LNQA 5FGMA 2OU2A 3WU2C 4MTDA 4IJAA 1WHUA 2DO7A 2FEZA 4LD5A 3S3MA 1MJAA 2OF7A 2W00A 3DBLB 4L5IA 1APLC 2KQRA 2CRGA 4G7HF 2LVSA 2STWA 2HPMA 2F5EA 2P7CB 3GWZA 2R4GA 2JN6A 2PMHA 3HIFA 4O5VA 3RJPA 3IV5A 2DOFA 1TW3A 2E7WA 1UHMA 4JX5A 2HOEA 4M74A 2L7MP 2ZJ2A 4ZZDA 1FIPA 1ZLJA 3KEOA 3KYDB 3OIPA 3WHCA 5A2QK 1YO5C 5CVIA 3S17J 5EGOA 3D1NI 1IZ1A 1XD7A 4LMYA 1EH8A 1U3EM 1Y8QB 3VYTB 1TZLA 2YSRA 5L3CA 1XSVA 2VQCA 3CP8A 3IUOA 4XN0A 4DBRA 1Z6RA 3PIPF 1XMKA 1ZRFA 1OYYA 1P4XA 3HRUA 3HHGA 4U87A 2MFZA 2YU9J 2DDAA 3BCAA 3MEXA 3R0JA 4ZYAA 4MQVA 1IXCA 4EJUA 1R6RA 2GIZA 2UXNA 5BOXA 5JVGF 4KYWA 3LFKA 1FOYA 2R5YB 3QODA 1KU9A 4ITVA 1K61A 1S5LC 5JHUA 3HOSA 4RAYA 3IRRA 3L09A 5K5RA 3A01A 3N05A 1IF1A 4CCMA 2HFHA 4D5CA 3CMAI 1PP8F 1FYLA 2HKXA 2I10A 3FXUA 4B44A 2DMUA 1I1GA 1J75A 3V8KA 4DYCA 1SD4A 3K2ZA 4IF4A 2EB7A 2A5YB 1JXSA 3GTLJ 3J81K 3ZXSA 3ZQ7A 5IYCJ 1K78B 2GXAA 1E3HA 2HR3A 4XLHA 4JBAA 2QCOA 4E4HA 2HS5A 2CUJA 2O9LA 4HBLA 2ZXJA 5D8LB 3N4MA 5FRMA 2IGKA 3OL4A 1FOXA 3A02A 2Y69H 3ECOA 2XF6A 1FTTA 3VDXA 1HKSA 1JKOC 3IC7A 3TMOA 3GTJJ 3PNYA 4FISA 5C3EJ 4I6ZA 3RYRA 1G3YA 1GT0C 4ASNA 2X1DA 2RNGA 1YRNA 2MG4A 1JE8A 2JWTA 5J8FA 1IN5A 2QWWA 3MFKA 1X4PA 1ZG1A 2FMLA 3F72A 2BYVE 2J5OA 2XHKA 5CPRB 5KAFC 2WTEA 2IS2A 3C3WA 3OY9A 2XUBA 2R7VA 3KP5A 1ONVA 2XAGA 2DA2A 1WFXA 4KICA 4XLFA 5C44J 2LF8A 5K7HA 3ZPLA 4E7KA 3D5RC 2WADA 1XX5A 2RQQA 3SEZA 3EYYA 5IPAA 2F5CA 1IDYA 2Y2ZA 1FY7A 1H9GA 4JQFA 5J47A 3RYPA 3GTQJ 2XPWA 4G6QA 3CCMI 4CA0A 4HYEA 5C4XJ 1YFHA 3BP8A 2JRMA 1KU3A 3CUOA 5LHGA 4ZTFA 4Y52J 1PVEA 3MVPA 1R23A 1D1AA 1Z77A 2DN0A 1UB9A 1TWGJ 1YITI 1FLIA 2X85A 4IRGA 1N25A 2TCTA 2VASA 5F6FA 1TWFJ 5HDNA 4E7JA 5CQGA 4EJWA 3OL3A 4XKBA 1VQMI 3KIOA 1RUOA 1B8IB 4D5FA 2AQFA 1VQ9I 2O0YA 2CH0A 1Y6IA 2DMTA 2B7EA 1B59A 1WJAA 3FHZA 2CGPA 1MJBA 4LIVA 3UR3C 3OS1A 2R3SA 3L2WA 3BT9A 1T98A 4MFDA 3H0DA 4FE4A 1T56A 4MHGA 4ZDPA 2NVUB 5LRSA 4XRSA 4G8XA 5J1RA 4BDYA 3EUHA 4A3GJ 3X2QH 4RGUA 2XKOA 3JW4A 2V1NA 2DT7B 5IP7J 1RR8C 3HRTA 3WTXC 3H3ZA 4GCVA 2ZKZA 3J80Z 4IRHA 4IOCF 2E19A 4XNFA 3I4MJ 2QF7A 1K4TA 2FE3A 4IQ4A 1MNEA 4PZJA 3H92A 4E70A 3BJ6A 1SAXA 1RZ4A 1UZCA 3TO6A 1V3FA 2QLZA 4M3BA 4J01A 1J7KA 2HNHA 1HDPA 3J7ZI 3M9AA 5JR3A 1ZK8A 3MKZA 1DU0A 2KL4A 3DBHB 1X1BA 5E3OA 2MLKA 3S8PA 5E79C 4HRIA 1FTZA 4ZTJA 3OR1C 5HNHA 4UUSB 3ERED 1YHQI 2VJJA 3WE3A 3KX2A 4EGYA 4BY1J 3K0LA 3BTJA 2JA8J 4A93J 3C2HA 4CYDA 3LA7A 2JRTA 1X19A 5EGOB 4G6DA 3GMEA 3DEWA 4L5JA 4B43A 4BJTA 5F0HA 4BQNA 2WWYA 4XM3A 1RUNA 5B5EC 4LG0B 1V55H 1DP7P 2FUG2 3SZGA 2L5QA 3WTUC 5ICGA 2JMWA 2NOJB 3ELKA 5TISC 1J0RA 1D3YA 4DOZA 3ASNH 3VWBA 3DLAA 4AWXB 3ABLH 3CMEI 2JA7J 1V5FA 4GXOA 4BE0A 2E1CA 2HU9A 1SD5A 1S7AA 5D6EA 4XBFA 4HLXA 2A69F 5FFXA 1K4SA 4UB8C 2R5YA 2FD5A 2VKHA 3M1EA 3FX3A 4I02A 4HV5A 3OYBA 4P9UA 1JT6A 1YS6A 2PQ8A 3TP3A 2R5ZB 4ON0A 1YJWI 4EJTA 1FBQA 2JPCA 4CZCA 4PJJA 3G73A 3QP6A 2FQ3A 2COMA 4XLAA 1TLHB 1B6AA 1Y56A 2TRTA 1ZH5A 5GADJ 5E3MA 2O8XA 2E2IJ 1B9MA 1UMQA 3Q0VA 5DD8A 5L3EA 4GO1A 4KDPA 1IRGA 2IJLA 3S15J 4A3LJ 3ZQGA 1JT0A 1U9NA 4XL9A 2DCEA 1YS7A 2DQLA 2E71A 3DF8A 3NWTA 5CVRA 4A0YA 5LLQA 1W7PD 2Z2SB 1P7IA 4NC7A 3RPQA 5B1AH 1R49A 1MBEA 3W2WA 2VODA 1LVKA 5HLGA 3RKQA 4LB6B 1TQIA 2W1OA 1HDDC 2F5VA 1KZHA 4IL6C 4RB1A 2MGQA 2EINH 2WAQN 1I5ZA 2F4OB 3TP0A 2A68F 4A69C 1W36D 2EQRA 2DTRA 3KLOA 4I0AA 4BL0B 3OYMA 1K6YA 2Z16A 2O61A 2CV2A 1RKWA 4KN7X 4LJZF 3TDZC 3UNGC 1ZLKA 2LR8A 1P9QC 3KYCB 4LLNA 1X1PA 2K3PA 2Y9ZA 3QPLA 1OPCA 3SFIA 1R36A 5ICCA 1XS9A 1FWZA 4CUGA 4EV0A 5E18F 4P5OA 1BI0A 3GLXA 3NQOA 1ZG3A 4YIRX 3HXLA 5FJ8J 3F8MA 1OKRA 3WTZA 2A3SA 1YI2I 2GAUA 3ZQCA 1Y8RB 2K9QA 3F6OA 4HV6A 5DTDA 2EV0A 1XGMA 2VT2A 1JKPC 4XIDA 2CQKA 5FD5A 4CYCB 4E7LA 2DMNA 3JTGA 5GTIC 2XGCA 2WAEA 3BC8A 3F21A 3DBRB 3W2VA 2ZFUA 5K5OA 3CCRI 1G3SA 3FMSA 4O3MA 3FXKA 1YE9A 5L3FA 4QPQA 4Q5SF 2CYYA 1OJLA 2L54A 2HOAA 2QVOA 4BDZA 2B9SA 4FX4A 4ZDOA 2XROA 2JUGA 2VPRA 2KMUA 4FETA 2CMPA 4F55A 3DTEA 1ZREA 2ZMEC 1X1DA 3WGHA 1BOAA 4HA8A 3SYTA 4OIQF 4BKXA 1X4OA 3ONQA 5H20A 4RB2C 4U0YA 1HLVA 2CG4A 4IEJA 1S9HA 5CYVA 3OR2C 5JLWA 3L2QA 3LQRA 1ERDA 4OMYA 4AD9A 5EYRA 1FSEA 1W0TA 2ELKA 4MTEA 1U9OA 4NHJA 2WC2A 2LY1A 5IOYA 2R7RA 1I3QJ 3SJMA 2EZLA 3G1LA 4I99C 3E5UA 3DU6A 3W3CA 1ODDA 1FYMA 4BQAA 3IKTA 3CDLA 1IC8A 4U0VA 1DP3A 2EV6A 2QSHX 3RQIA 1GXPA 2CWEA 2HI3A 3H1CA 4KMUX 2OZUA 3RIRA 3CJQB 5D5WB 1HW5A 2GZWA 2P4WA 5DD4A 2M7BA 1C0WA 2VLAA 3ZMDA 2NS0A 4HSRA 5F08A 4G94A 5M5YJ 1TQPA 2VL8A 3CZ6A 1QRYA 3GXOA 3P9IA 5DS9A 3G3ZA 2A6HF 1LDKB 2CQ7A 2OD5A 3TO7A 1PUFA 5HLIA 4A6DA 1I6XA 5LHHA 2CJJA 4KIGA 4I2OA 1P4AA 4II3A 4I09A 2BZTA 4IRIA 1YIJI 1IRZA 3FXOA 2YPRA 3REOA 3GZ6A 1IG7A 3K6GA 2LBFB 2G9WA 1U8BA 4Y3OA 3ZMUA 3U9GA 3KP3A 4UHTA 2AO9A 5JLXA 3KZIC 1EV7A 1T33A 4M3DA 4BGDA 3FZVA 2Y30A 1Y0UA 2GA1A 2L0KA 4XQFA 4A12A 3ESWB 5KAIC 1P6RA 4XN3A 5B66C 4LG0A 1UFMA 3BR0A 2DJIA 4EMSA 4LIUA 2W48A 3T1BA 2VBZA 2BW3B 1WI3A 3BJAA 2L9SA 3VPRA 4DQ2A 1OQYA 1FP2A 2M34A 4II2A 1NHAA 2LY9A 3MZYA 3CD6I 4RGSA 4ZDLA 3MWMA 2E5NA 4WXHA 1HC8A 2E1MC 2MABA 1A04A 1D5YA 1BM9A 4M6VA 1V54H 2ZO4A 4X1EA 2BY2A 3E5XA 2GA2A 3ZQHA 1MNMC 2VPLA 1VQ8I 5J4VA 1O4XA 1ZTRA 2LG4A 3M8EA 3TW7A 3KYLA 4GGGA 1S72I 2VB6A 4XKCA 2F48A 2XAQA 4L0ZB 1BA5A 1EJ9A 1ETVA 4FTHA 3A2KA 4XKWA 2F4MB 3HOVJ 3M3YJ 2RAEA 1XG1A 1JJ8C 4OIOF 2Y0SA 3L2UA 1MH3A 3DEEA 2X51A 4JK1X 5HVQC 1R71A 3OWTA 3S1RJ 2ID3A 4C3IJ 1IGNA 3VYUB 2R7FA 3K4MA 1R4NB 5ERIA 4OU0A 1A35A 3CJNA 1MH4A 2L9NA 3O2PE 2H8WA 2Z33A 3LMMA 2WB1A 4YIIA 2VBYA 1KU2A 5E3NA 2E35A 4IHYA 4YG2F 3OYKA 2GWRA 2EA4A 1NTCA 2VQGA 1YG2A 3HUGB 1CF7A 2GLOA 1X3WB 3IAS2 3CDHA 4V19K 3JRCA 1WH7A 1WWXA 2ZBKA 2ZCWA 4Z2YA 5CVVA 2NS8A 1W5TA 3EPZA 2R7ZJ 3B02A 3WTSC 5HS8A 5IOZA 2NVTJ 1I1SA 1D0ZA 1KGSA 4HEA2 4JYKA 1T95A 5HS7A 4I98B 5J8CA 3BG9A 1UHWA 3H9JA 4ZYEA 3KLNA 2CQXA 1H89C 1T08B 3K10A 4NBQA 2PLYA 2MC3A 2VT3A 1K6OA 2LLKA 2FOKA 2MH9A 3J80K 4RGXA 3V7RA 1X1CA 2EFPA 3I71A 3HSRA 5F27A 1LDDA 3ZGKA 2CO5A 4RMNA 1K83J 2OA4A 4EVIA 4D7MA 2EIKH 3QYEA 4EEFG 3D5SC 4CHUA 3J7AO 4N0BA 2ESHA 1XGNA 1O3SA 3ABUA 1PUEE 2QBYA 4M71A 4ENNA 1MW7A 3HHHA 1VQOI 2M0CA 5B3SH 4PSXA 3H3VK 4G7OF 1EF4A 2AHQA 2CUZA 4PFPA 2RV8A 2UWMA 4OAYA 2VOOA 2FU4A 2ISYA 3IL2A 1IN4A 1ETWA 2X48A 2HOSA 2PX9A 1LPQA 1XDSA 3BROA 3VYRB 4XLCA 2EZHA 2BVMA 4G7ZF 2ME0A 3HB9A 4LITA 3S1NJ 2H6CA 3MCZA 2ZJPF 5HOOA 4BQQA 3E6CC 1JJ6C 5D4RA 1IDZA 4B09A 1ZARA 4OAZA 3FBIB 3A01B 5A2QZ 2MD5A 4W1UA 5DYMA 3DFGA 3ERMA 2PFBA 3VFZA 1FC3A 2HZTA 3D0SA 3BLYA 2FX0A 4XLEA 4NDLA 2Z3YA 1KU7A 3ZMTA 3FMRA 2RVCA 1Z9CA 2FA5A 2JPBA 5BS6A 2PMUA 1G6NA 3F23A 4I0BA 2NXNB 3GVAA 6PAXA 3T8TA 3FHNA 1WKMA 4W97A 3G2BA 3VSKA 2M45A 2IXSA 4KT5C 4F7ZA 2XRNA 3R60A 1K7AA 3C7JA 1QPMA 2XGEA 1P7JA 1PUFB 2EPFA 1E3OC 3HKZA 1DPUA 2ETHA 4CSWA 4DZPA 3BG7A 2IA0A 3L7WA 2V1UA 2VI6A 3OYFA 2MH2A 1A5JA 2DFHA 3K2AA 2WV1A 4R1HA 2D1VA 1NK2P 3BQZA 3ABTA 2BEOA 3HOWJ 3I5UA 5IT9K 4LK1F 1YRNB 3ISPA 1BJZA 3CF2A 1SFOJ 3PUFA 2ZJQF 3RZDJ 1A31A 1FOKA 2NNYA 2I5UA 3RZOJ 2JVGA 3SDBA 1ENHA 5FRNA 3H0GJ 3IKVA 4HPQA 1MBFA 1ZQ3P 4DYQA 2H1LA 4ZYDA 2PMZA 3QAHA 3AG2H 4LGWA 4LLGF 5ICFA 2EBIA 3PIOF 1J2XA 2RN7A 4LG3A 3ZMSA 4C2MJ 1SEUA 3BG6A 4A0ZA 1MSEC 2FSWA 1QNTA 3BTIA 3P9CA 1B1BA 4XORA 4UV9A 4M6XA 3IHUA 3ABMH 4RLQA 4HSTA 4ZH4F 2XB5A 1SVMA 3PL8A 2H09A 1QVTA 4ANJA 4E7HA 4BH9A 4CICA 3LOCA 4M6YA 4AIHA 2GBYA 3WTWC 3MKLA 2DTZA 4I7HA 1IJWC 2M5WA 2DFEA 3UKGA 1GHCA 4NC6A 1ZGWA 3TGNA 3H3UA 4BE2A 2ZSHB 1UG2A 5F64A 1BI3A 1TT5B 2ACJA 1AU7A 3DPTA 4IHWA 4RS8A 5DM6F 3WGGA 1R1VA 3VODA 1SMTA 4B1RA 3EUAA 3HOUJ 3IH3A 1PJRA 4F3QA 1KA8A 3V8LA 3BTCA 4XLNF 4A3BJ 2R92J 2ECCA 4ENKA 2COBA 3K4JA 4DGWB 1UELB 5D5UB 2V9PA 3H5RA 2K40A 4L9NA 3QP5A 2QQBA 4RM3A 3RKYA 1O7FA 4HX4A 4C2TA 1EH6A 1MKMA 3EDPA 4IXAA 4MQ9F 2JQ7A 4S05A 4LB5A 2XB0X 2CW7A 1VNDA 5HODA 1OYWA 2FBHA 2OQRA 2KJBA 2NS7A 5F1JA 5HDGA 1JI8A 4AYBA 1WRJA 1J5YA 1FMVA 4DBQA 3JRDA 3DKWA 2E1MB 3ZCOA 1S7EA 1WI9A 5L3GA 2Y0SN 4WX9A 1VTNC 3DTKA 3OYJA 4IHVA 4C2UA 4UUVA 1ZN2A 2Z9OA 3VOEA 4AM3A 2LYCA 2HQAA 1Z7LA 1QPIA 3PO2J 1XSXA 3OSGA 3HPHA 3EUHC 4KNYA 2WB1N 1YYVA 2LNBA 3JRGA 3GFIA 2P8TA 3HOTA 2GOXB 4CZZA 4FT8A 3DU5A 1R1TA 3T8RA 4EM0B 3RSNA 4BHCA 3CO7C 2QYOA 3LA3A 1E0EA 5CQEA 2D1HA 3E5QA 1Z3YA 1Z6TA 4MLOA 3FK7A 1J09A 2RGVA 2W7NA 2MC4A 4QIWN 3AG1H 1XMXA 3ZN0A 5H2FC 2HDCA 1XGOA 2DPDA 4C3JJ 4HOBA 1ON1A 1BIAA 2V1DA 1POGA 3LSKA 3F8CA 3L00A 2A5WA 2L7FP 2CQQA 5FLVA 1YLFA 2HVQA 4WWCA 3SFZA 3BR1A 1I50J 1ZAOA 1WSUA 4IZZA 1EH7A 2KIQA 2LP0A 2OUMA 1D1BA 5CLSA 2M2EA 3SHFA 1FPQA 3RQ4A 3ZOBA 2DYRH 2CW8A 4DIQA 3IRQA 1M1EB 1Y1VJ 2HWVA 3FKIJ 4A5MA 3DCFA 3IWZA 2JTVA 4HX8A 3SEQA 5E8GA 3WHBA 3HOYJ 3GYHX 2DAOA 3OSFA 2W82A 4U7BA 2R5ZA 5KHDA 1J9IA 1LFPA 1LJ9A 5E3LA 3H9GA 2HEOA 3O8HA 2QQ9A 3LL7A 1F43A 2VJIA 5F1RA 2V6EA 2JSPA 3Q9SA 1MNDA 3DXJF 4L18B 4CCNA 4E7SA 2PN6A 4ESBA 2DW4A 4LOCA 3M4OJ 2NNNA 1FBUA 2OAZA 3LSIA 4P96A 2L7KA 1FSHA 2E1NA 2IPQX 3K4KA 1IUYA 2VKEA 3WE2A 4XRMA 3WTTC 4E7IA 3QRFF 5EG0A 3GZ5A 3BWGA 1DUXC 2K7LA 4HDUA 2CUFA 1DPRA 2V6CA 3MKYB 2XAFA 3OYIA 1RI7A 2KRCA 2W85A 1RRJA 1BR4A 4OWRB 4RGRA 3K70D 2V4JC 4ESFA 3BY6A 1USSA 2OJED 3ZR8X 4AVZA 2D2WA 3DPLC 3F8FA 3OYGA 2CFXA 3FWEA 4BNCA 3K4BA 1RPWA 3E6BA 4MEXF 1RKTA 4B3AA 2VKDA 5IT9Z 4I76A 3JSOA 4DW6A 3RKWA 3OYCA 3K9TA 1WVRA 3FK6A 3KPHA 3L1PA 2E34A 1VQNI 1D0YA 1VQKI 4M9SA 1LEBA 4RBOA 3KZZA 1SVOA 4V2GA 1F5TA 1V4RA 2DU9A 2PMZN 3ZMVA 1R58A 2IEKA 2BE5F 4XKVA 3QPHA 4PJLA 1DU6A 1MBKA 3PQKA 3DLLF 1T38A 2JZYA 1VQ6I 2BVLA 2X6YA 1JUMA 2XAHA 2JA6J 3QYFA 1K79A 5E8IA 2XAUA 1BJAA 3U2RA 2O8KA 3BR2A 1YX5A 2M3AA 3CLQA 2MA3A 1JGSA 3T0YA 2QSGX 1ZELA 2BY0A 3TOAA 3MAJA 2CFOA 3KP7A 1AKHA 3IP4B 1ETYA 2D5VA 1SFXA 2K9LA 2CSOA 3V42A 3OOPA 4Q4ZF 2DODA 2QSFX 3SXYA 2K86A 5L3DA 2X6WA 3F8NA 4IQJA 3B6CA 4KJZA 3G1OA 2PI0A 2OBPA 3LQQA 1RR7A 5FKNA 2HTJA 1U5TC 1E2XA 1SAUA 1Y39A 4O6JA 3BZ6A 3HTSB 3GTMJ 2YS9A 2XDVA 3CP2A 5KCMA 2DOAA 1OLTA 3BR6A 2FMYA 1XCVA 1S29A 1W7PB 1ZRCA 3KZYA 4UB6C 2FF4A 1JGGA 1RNLA 4RAZA 2EFWA 1JUPA 2LFBA 2E2HJ 2DI3A 5GP9A 4E7ZA 2H8RA 3KP4A 5D5VB 3T5XA 2FXAA 2K9NA 2O5RA 1IN6A 4BXXJ 3WTYC 2PBIA 2ZMEA 3D5LA 3PNVA 1R4MB 2X6OA 4BU2A 4WK8F 2YUSA 2M9HA 3GFLA 3E6DA 4HF0A 4WXCA 5EEGA 1ZGJA 4NUBA 1YQAA 1YW7A 1E3PA 3FM5A 5AIPA 3S1MJ 2KDOA 3OYHA 3QPTA 3CC7I 3TKYA 2LC2A 2Y0MA 4HNUA 2XIGA 2I8DA 3GZNB 4KIBA 2Y48A 3K4NA 1W1WE 2BGCA 3E1SA 3VB2A 5JI6A 2IT0A 2YR2A 3QQAA 2P7VB 2QEXI 2X1CA 1BN5A 3CQZJ 4NC8A 2P6TA 4C3HJ 3M8JA 4DNCA 2DK5A 3H35A 1BI1A 2PJRA 4R8HA 3S2HJ 3MZHA 4ABZA 4XRSG 5TGTA 4XR6A 3C1DA 3LAJA 1MMSA 3GW2A 1BC8C 1T6SA 3ZQQA 1LFUP 3GLLA 2L4AA 1W5CC 1T8IA 1D8KA 2HGCA 1WJDA 2E2JJ 5H6RA 1HF0A 2LBFA 5B1BH 1F36A 1P4WA 3K4CA 2DQRA 5DV5A 3J7YJ 1NG7A 3QPSA 1HA8A 3PM1A 2K5CA 3W2AA 3EETA 1MMGA 2NVQJ 4UVBA 2Q8KA 1O57A 1QVUA 2L02A 2FRHA 1R00A 3CO6C 2XF7A 1T0FC 1QBJA 5IP9J 1ETKA 5EZHA 1B9NA 4BHBA 2HPIA 2ADUA 5GAEJ 2LOOA 1D1CA 3G4SI 1IO2A 2K9SA 1MBGA 2V79A 1G2HA 1FT9A 1UHSA 5E1WA 4BUPA 2ZXIA 2BV6A 1REPC 4YRVA 2VUMJ 1R5GA 2Q1ZB 4NQWB 2EJRA 1LKXA 4IOAF 5J1UA 1R9TJ 3S1QJ 2DA1A 4GFBA 1VZ0A 5M5XJ 1USTA 3L9FA 5BPDA 3PNTA 2DLLA 4CDGA 3F22A 1O3QA 3BCBA 3JAMZ 2KKOA 3GCMA 1TL8A 2KP6A 2ZC2A 3NRVA 5IP6A 4N9IA 3K1MA 1OCPA 2DA3A 2DA4A 2XKPA 2FBKA 4BJ6C 5CVJA 2VC1A 4M9ZA 3JCUC 4AU7A 1KONA 3HGYA 3CCYA 4EM2A 1BBYA 2RC4A 5DCMB 3FXQA 5FLXK 3FBNB 2R7UA 2F5FA 1MIJA 1U5TB 3LSHA 3OIOA 4D0PA 3CCJI 4WXDA 2DK8A 3TEDA 4QSHA 2CQNA 2R7QA 1OFCX 3Q3SA 3BZCA 3DPUA 2W84A 3W6JB 1OCOH 3COAC 3Q0WA 2KIFA 5DEQA 4RAFA 1JTYA 2Z99A 4X6AJ 5DUKA 3HPGA 1ZYRF 2QM3A 5FO5A 5IYBJ 3HUGA 4CCKA 3L2RA 3VSLA 1CF7B 1HKTA 2F6CA 1G3TA 1F4KA 2IS6A 3E3VA 2K9MA 1I3AA 4AVPA 5F0FA 4HNVA 1SD7A 3OS2A 3GX4X 5DM7F 2EV5A 2DMPA 1YTYA 2DPUA 1R22A 2B0LA 5BPIA 1VF9A 2IVMA 5JVTA 4ENJA 1ZKGA 2QKMB 2UXXA 4XOPA 5FLMJ 3SQNA 2VQHA 4EATA 4HF2A 2HVSA 4HG2A 5HLHA 4XSXF 2VQLA 3TO9A 3HSFA 4DZJA 3Q5FA 1IXRC 3S2DJ 4N4NB 3M8FA 4G9YA 3F3XA 4L0YB 4A3KJ 2XAJA 3HRMA 4HQMA 5ILSA 3LSMA 4U0WA 2ZB9A 1Y0NA 1DGRM 3HOXJ 3F8BA 3VYSB 4EJOA 1LQ1A 3HRSA 3CUQC 3HTUA 2FNPA 1T39A 1S3JA 3WU0A
chains in the Genus database with same CATH topology
1WCMJ 5FKOA 3BTIA 3A03A 1MSFC 1VFCA 4BY1J 3GTOJ 3BTJA 1W0UA 2JA8J 4A93J 3HKZN 2B63J 3HBLA 2P81A 5GPAA 1U78A 1JUSA 5EGOB 3ZQLA 4M3EA 3CMYA 1GUUA 2XB5A 3DEWA 5F0HA 2MW8A 2JJ7A 1QVTA 2DMQA 2FJ1A 2CUEA 3LOCA 5GPCA 1IV6A 2GBYA 3MKLA 2DTZA 2JMWA 3JRFA 1IJWC 3UKGA 4CYCA 1ZGWA 1GDTA 1TC3C 1UG2A 1AU7A 4IHWA 2JA7J 1WH5A 1XC5A 3HOUJ 4B1RA 3IH3A 3BTCA 2FD5A 2R5YA 4A3BJ 3OOUA 2R92J 2ECCA 2COBA 2HXIA 4B4CA 2M8GX 2IAIA 2K40A 1JT6A 3TP3A 3S14J 2R5ZB 4XICA 1I6HJ 1HCRA 1ITYA 1RESA 4A3MJ 2Y31A 4A3CJ 4BY7J 3IH2A 4V2FA 3MN2A 2TRTA 1ZR2A 5E3MA 2E2IJ 3BQYA 2HQ5A 2XB0X 1UMQA 3Q0VA 1GVDA 1VNDA 5HODA 1FJLA 2GM4A 4IHXA 2O7OA 3S15J 1CQTA 3ZQGA 1JT0A 4A3LJ 1U9NA 2DJNA 9ANTA 3ZQIA 4A3IJ 2NS7A 5F1JA 1LE8A 1P7IA 1GV2A 1MBEA 3JRDA 2XGDA 3O8GA 1S7EA 3RKQA 1HDDC 2Y0SN 3TW6A 1BW6A 1FEXA 5EEAA 2MGQA 2WAQN 3TP0A 3BR3A 4IHVA 4A69C 2EQRA 1QPIA 2XPUA 4JP0A 3PO2J 1RKWA 3OSGA 2LR8A 4JX4A 2WB1N 3JRGA 2Y9ZA 3QPLA 3SFIA 1XS9A 3I4NJ 4M3FA 2R0QC 1BL0A 2EZIA 5FJ8J 4RDUA 4MLOA 3FK7A 2KT0A 4QIWN 3ZQCA 3S16J 4D7NA 1MBHA 2K9QA 4C3JJ 4BBRJ 5F0CA 5DTDA 2HXOA 2XRLA 3GTGJ 4L5EA 2E1OA 1POGA 4MFEA 1JKPC 4XIDA 4CYCB 2DMNA 2L7FP 2XGCA 2CQQA 5FLVA 4A3DJ 5EDNA 3BR1A 1I50J 5FKLA 5K7ZA 3BR5A 4UUTA 2LP0A 2M2EA 1JKQC 1OJLA 2HOAA 3ZOBA 1Y1VJ 3FKIJ 5J3LA 3DCFA 2VPRA 1B72B 4DYRA 3WHBA 3HOYJ 3OSFA 3LSGA 4M3GA 2R5ZA 3HGGA 5BNGA 2MSYA 5FKMA 5E3LA 3ZQFA 3GTPJ 3O8HA 4BKXA 1F43A 2OPTA 1RETA 1HLVA 2LKXA 1ETXA 1ETOA 1X58A 4IEJA 4FCYA 4LOCA 3M4OJ 5JLWA 5EYRA 3HM5A 1WPKA 5F04A 1W0TA 5EZGA 2ELKA 1FIAA 1U9OA 2VKEA 3BG5A 4A3FJ 5IOYA 4XRMA 1I3QJ 3SJMA 5EG0A 2DA7A 2EZLA 3G1LA 2N8GA 2JK3A 3HOZJ 2CUFA 2EH3A 3CDLA 1IC8A 2Y9YA 1WGXA 1B8IA 3Q0UA 2DA5A 3RQIA 2HI3A 3PO3J 1TWAJ 4MO7A 2IBDA 3HDDA 1ETQA 5F08A 5M5YJ 1RPWA 1H88C 1QRYA 3JREA 1RKTA 4B3AA 2DA6A 5DS9A 4XK4A 1PUFA 4I76A 4DW6A 3FK6A 2CJJA 3L1PA 2NVYJ 4RBOA 1VI0A 2XSDC 1IRZA 4V2GA 2PMZN 2EZKA 3IH4A 1IG7A 2IEKA 3BTLA 1U8BA 1DU6A 1MBKA 1SANA 3K7AJ 2AO9A 1JUMA 5JLXA 4M3DA 2JA6J 1T33A 2ME6A 2O8KA 2Y30A 3LNQA 3BR2A 2L0KA 3BG3A 1Y1WJ 1X2NA 2OF7A 2HOTA 1APLC 2CRGA 3BR0A 4JX6A 3F0CA 2LVSA 1AKHA 1ETYA 2D5VA 2JN6A 2W48A 3IV5A 4JX5A 2VKVA 2L7MP 1WI3A 3VPRA 3B6CA 5K7FA 2KDZA 3G1OA 2M34A 1FIPA 1RR7A 2CU7A 3WHCA 3S17J 5FKNA 5EGOA 1MBJA 2LY9A 3D1NI 1BW5A 3GTMJ 3W6VA 2YS9A 3BR6A 3E7LA 1D5YA 4MIMA 2X9DA 3HEFA 4M6VA 4G12A 4X1EA 1JGGA 2YU9J 3ZQHA 1MNMC 1JUPA 2LFBA 2E2HJ 1O4XA 1ZTRA 5GP9A 3TW7A 2LD5A 2H8RA 4J19A 2K9NA 4BXXJ 3FIWA 5EG0B 2X6OA 1BA5A 1JTXA 1ETVA 2YUSA 2R5YB 4FTHA 2M9HA 1K61A 4AUXA 3HOVJ 2HDDA 1LE8B 4QTRA 3A01A 2RAEA 3B6AA 3M3YJ 3S1MJ 1XG1A 2ID6A 4AC0A 1JJ8C 1TWHJ 1MH3A 3JRHA 4D5CA 3S1RJ 2ID3A 4C3IJ 1IGNA 2I10A 4A3JJ 2DMUA 1MH4A 1LFBA 4S0HB 4DYCA 3QQAA 5IYDJ 3CQZJ 3LSRA 4C3HJ 5E3NA 4FE7A 4IHYA 3S2HJ 3NARA 3GTLJ 4ABZA 4XRSG 3JRAA 1NTCA 5IYCJ 2GLOA 1LFUP 2QCOA 3JRCA 2E2JJ 2O9LA 1WH7A 1HF0A 1F36A 2NS8A 2L9RA 3GBGA 3A02A 2R7ZJ 2R93J 3QPSA 5J1YA 3SDGA 3PM1A 1FTTA 5IOZA 1ZR4A 2ECBA 1JKOC 2NVQJ 2NVTJ 1QVUA 3GTJJ 4I6ZA 4FISA 4JYKA 5C3EJ 1X2MA 1GT0C 3BG9A 1YRNA 1AKHB 2L7ZA 2NVXJ 5IP9J 2CQXA 1ETKA 2MG4A 1H89C 5EZHA 2JWTA 2LLKA 4Y7NJ 1Q1VA 1ORKA 5F27A 2K9SA 1MBGA 1G2HA 1UHSA 4UUSA 1K83J 2DA2A 2VUMJ 5EF6A 4D7MA 5FKKA 1B72A 5C44J 4EEFG 2LTPA 5J1UA 1R9TJ 3S1QJ 5K7HA 3G1MA 2DA1A 4GFBA 5M5XJ 5C4JJ 4AYBN 2JA5J 1HOMA 1NK3P 5IPAA 2M0CA 3H3VK 1EF4A 1IDYA 1GV5A 2AHQA 2Y2ZA 3GTQJ 2XPWA 5IP6A 1ETWA 1OCPA 2X48A 2HOSA 5C4XJ 3FISA 2DA3A 2DA4A 2EZHA 3S1NJ 2ME0A 3HB9A 3C2BA 4Y52J 1JJ6C 1H8AC 3MVPA 1IDZA 1Z77A 3A01B 2DN0A 3HGYA 3CCYA 4W1UA 1TWGJ 1JKRC 2HYJA 2LK2A 2TCTA 1TWFJ 3OIOA 1AHDP 5M3FJ 2FX0A 4NDLA 3JR9A 3LSPA 3TEDA 4QSHA 2XPVA 1OFCX 2H1KA 1B8IB 3GTKJ 4D5FA 1OCTC 3Q3SA 4BBSJ 2DMTA 3Q0WA 1JTYA 1Z0XA 4X6AJ 4W97A 5IYBJ 3BT9A 2XGEA 4MFDA 1P7JA 4FE4A 1T56A 1PUFB 4XRSA 1A6IA 5M3MJ 1E3OC 5F0FA 4HNVA 5J1RA 4DZPA 4A3GJ 4A3EJ 2DMPA 2VI6A 5IP7J 1A5JA 1VF9A 3K2AA 2WV1A 1ZKGA 1NK2P 1TWCJ 5FLMJ 3BQZA 2E19A 3I4MJ 2QF7A 3HOWJ 2FQ4A 1YRNB 3NAUA 1BJZA 3LSJA 5M5WJ 2G0EA 4DZJA 1SFOJ 3S2DJ 3RZDJ 4M3BA 1HDPA 4A3KJ 1IUFA 3RZOJ 1ZK8A 1DU0A 1ENHA 3H0GJ 1ZQ3P 1MBFA 4DYQA 2ZB9A 5E3OA 2NOGA 1FTZA 3HOXJ 2EBIA 3JRIA 3JRBA 4UUSB 4C2MJ 1MSEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM J;  5FKO A;  3BTI A;  3A03 A;  1MSF C;  1VFC A;  4BY1 J;  3GTO J;  3BTJ A;  1W0U A;  2JA8 J;  4A93 J;  3HKZ N;  2B63 J;  3HBL A;  2P81 A;  5GPA A;  1U78 A;  1JUS A;  5EGO B;  3ZQL A;  4M3E A;  3CMY A;  1GUU A;  2XB5 A;  3DEW A;  5F0H A;  2MW8 A;  2JJ7 A;  1QVT A;  2DMQ A;  2FJ1 A;  2CUE A;  3LOC A;  5GPC A;  1IV6 A;  2GBY A;  3MKL A;  2DTZ A;  2JMW A;  3JRF A;  1IJW C;  3UKG A;  4CYC A;  1ZGW A;  1GDT A;  1TC3 C;  1UG2 A;  1AU7 A;  4IHW A;  2JA7 J;  1WH5 A;  1XC5 A;  3HOU J;  4B1R A;  3IH3 A;  3BTC A;  2FD5 A;  2R5Y A;  4A3B J;  3OOU A;  2R92 J;  2ECC A;  2COB A;  2HXI A;  4B4C A;  2M8G X;  2IAI A;  2K40 A;  1JT6 A;  3TP3 A;  3S14 J;  2R5Z B;  4XIC A;  1I6H J;  1HCR A;  1ITY A;  1RES A;  4A3M J;  2Y31 A;  4A3C J;  4BY7 J;  3IH2 A;  4V2F A;  3MN2 A;  2TRT A;  1ZR2 A;  5E3M A;  2E2I J;  3BQY A;  2HQ5 A;  2XB0 X;  1UMQ A;  3Q0V A;  1GVD A;  1VND A;  5HOD A;  1FJL A;  2GM4 A;  4IHX A;  2O7O A;  3S15 J;  1CQT A;  3ZQG A;  1JT0 A;  4A3L J;  1U9N A;  2DJN A;  9ANT A;  3ZQI A;  4A3I J;  2NS7 A;  5F1J A;  1LE8 A;  1P7I A;  1GV2 A;  1MBE A;  3JRD A;  2XGD A;  3O8G A;  1S7E A;  3RKQ A;  1HDD C;  2Y0S N;  3TW6 A;  1BW6 A;  1FEX A;  5EEA A;  2MGQ A;  2WAQ N;  3TP0 A;  3BR3 A;  4IHV A;  4A69 C;  2EQR A;  1QPI A;  2XPU A;  4JP0 A;  3PO2 J;  1RKW A;  3OSG A;  2LR8 A;  4JX4 A;  2WB1 N;  3JRG A;  2Y9Z A;  3QPL A;  3SFI A;  1XS9 A;  3I4N J;  4M3F A;  2R0Q C;  1BL0 A;  2EZI A;  5FJ8 J;  4RDU A;  4MLO A;  3FK7 A;  2KT0 A;  4QIW N;  3ZQC A;  3S16 J;  4D7N A;  1MBH A;  2K9Q A;  4C3J J;  4BBR J;  5F0C A;  5DTD A;  2HXO A;  2XRL A;  3GTG J;  4L5E A;  2E1O A;  1POG A;  4MFE A;  1JKP C;  4XID A;  4CYC B;  2DMN A;  2L7F P;  2XGC A;  2CQQ A;  5FLV A;  4A3D J;  5EDN A;  3BR1 A;  1I50 J;  5FKL A;  5K7Z A;  3BR5 A;  4UUT A;  2LP0 A;  2M2E A;  1JKQ C;  1OJL A;  2HOA A;  3ZOB A;  1Y1V J;  3FKI J;  5J3L A;  3DCF A;  2VPR A;  1B72 B;  4DYR A;  3WHB A;  3HOY J;  3OSF A;  3LSG A;  4M3G A;  2R5Z A;  3HGG A;  5BNG A;  2MSY A;  5FKM A;  5E3L A;  3ZQF A;  3GTP J;  3O8H A;  4BKX A;  1F43 A;  2OPT A;  1RET A;  1HLV A;  2LKX A;  1ETX A;  1ETO A;  1X58 A;  4IEJ A;  4FCY A;  4LOC A;  3M4O J;  5JLW A;  5EYR A;  3HM5 A;  1WPK A;  5F04 A;  1W0T A;  5EZG A;  2ELK A;  1FIA A;  1U9O A;  2VKE A;  3BG5 A;  4A3F J;  5IOY A;  4XRM A;  1I3Q J;  3SJM A;  5EG0 A;  2DA7 A;  2EZL A;  3G1L A;  2N8G A;  2JK3 A;  3HOZ J;  2CUF A;  2EH3 A;  3CDL A;  1IC8 A;  2Y9Y A;  1WGX A;  1B8I A;  3Q0U A;  2DA5 A;  3RQI A;  2HI3 A;  3PO3 J;  1TWA J;  4MO7 A;  2IBD A;  3HDD A;  1ETQ A;  5F08 A;  5M5Y J;  1RPW A;  1H88 C;  1QRY A;  3JRE A;  1RKT A;  4B3A A;  2DA6 A;  5DS9 A;  4XK4 A;  1PUF A;  4I76 A;  4DW6 A;  3FK6 A;  2CJJ A;  3L1P A;  2NVY J;  4RBO A;  1VI0 A;  2XSD C;  1IRZ A;  4V2G A;  2PMZ N;  2EZK A;  3IH4 A;  1IG7 A;  2IEK A;  3BTL A;  1U8B A;  1DU6 A;  1MBK A;  1SAN A;  3K7A J;  2AO9 A;  1JUM A;  5JLX A;  4M3D A;  2JA6 J;  1T33 A;  2ME6 A;  2O8K A;  2Y30 A;  3LNQ A;  3BR2 A;  2L0K A;  3BG3 A;  1Y1W J;  1X2N A;  2OF7 A;  2HOT A;  1APL C;  2CRG A;  3BR0 A;  4JX6 A;  3F0C A;  2LVS A;  1AKH A;  1ETY A;  2D5V A;  2JN6 A;  2W48 A;  3IV5 A;  4JX5 A;  2VKV A;  2L7M P;  1WI3 A;  3VPR A;  3B6C A;  5K7F A;  2KDZ A;  3G1O A;  2M34 A;  1FIP A;  1RR7 A;  2CU7 A;  3WHC A;  3S17 J;  5FKN A;  5EGO A;  1MBJ A;  2LY9 A;  3D1N I;  1BW5 A;  3GTM J;  3W6V A;  2YS9 A;  3BR6 A;  3E7L A;  1D5Y A;  4MIM A;  2X9D A;  3HEF A;  4M6V A;  4G12 A;  4X1E A;  1JGG A;  2YU9 J;  3ZQH A;  1MNM C;  1JUP A;  2LFB A;  2E2H J;  1O4X A;  1ZTR A;  5GP9 A;  3TW7 A;  2LD5 A;  2H8R A;  4J19 A;  2K9N A;  4BXX J;  3FIW A;  5EG0 B;  2X6O A;  1BA5 A;  1JTX A;  1ETV A;  2YUS A;  2R5Y B;  4FTH A;  2M9H A;  1K61 A;  4AUX A;  3HOV J;  2HDD A;  1LE8 B;  4QTR A;  3A01 A;  2RAE A;  3B6A A;  3M3Y J;  3S1M J;  1XG1 A;  2ID6 A;  4AC0 A;  1JJ8 C;  1TWH J;  1MH3 A;  3JRH A;  4D5C A;  3S1R J;  2ID3 A;  4C3I J;  1IGN A;  2I10 A;  4A3J J;  2DMU A;  1MH4 A;  1LFB A;  4S0H B;  4DYC A;  3QQA A;  5IYD J;  3CQZ J;  3LSR A;  4C3H J;  5E3N A;  4FE7 A;  4IHY A;  3S2H J;  3NAR A;  3GTL J;  4ABZ A;  4XRS G;  3JRA A;  1NTC A;  5IYC J;  2GLO A;  1LFU P;  2QCO A;  3JRC A;  2E2J J;  2O9L A;  1WH7 A;  1HF0 A;  1F36 A;  2NS8 A;  2L9R A;  3GBG A;  3A02 A;  2R7Z J;  2R93 J;  3QPS A;  5J1Y A;  3SDG A;  3PM1 A;  1FTT A;  5IOZ A;  1ZR4 A;  2ECB A;  1JKO C;  2NVQ J;  2NVT J;  1QVU A;  3GTJ J;  4I6Z A;  4FIS A;  4JYK A;  5C3E J;  1X2M A;  1GT0 C;  3BG9 A;  1YRN A;  1AKH B;  2L7Z A;  2NVX J;  5IP9 J;  2CQX A;  1ETK A;  2MG4 A;  1H89 C;  5EZH A;  2JWT A;  2LLK A;  4Y7N J;  1Q1V A;  1ORK A;  5F27 A;  2K9S A;  1MBG A;  1G2H A;  1UHS A;  4UUS A;  1K83 J;  2DA2 A;  2VUM J;  5EF6 A;  4D7M A;  5FKK A;  1B72 A;  5C44 J;  4EEF G;  2LTP A;  5J1U A;  1R9T J;  3S1Q J;  5K7H A;  3G1M A;  2DA1 A;  4GFB A;  5M5X J;  5C4J J;  4AYB N;  2JA5 J;  1HOM A;  1NK3 P;  5IPA A;  2M0C A;  3H3V K;  1EF4 A;  1IDY A;  1GV5 A;  2AHQ A;  2Y2Z A;  3GTQ J;  2XPW A;  5IP6 A;  1ETW A;  1OCP A;  2X48 A;  2HOS A;  5C4X J;  3FIS A;  2DA3 A;  2DA4 A;  2EZH A;  3S1N J;  2ME0 A;  3HB9 A;  3C2B A;  4Y52 J;  1JJ6 C;  1H8A C;  3MVP A;  1IDZ A;  1Z77 A;  3A01 B;  2DN0 A;  3HGY A;  3CCY A;  4W1U A;  1TWG J;  1JKR C;  2HYJ A;  2LK2 A;  2TCT A;  1TWF J;  3OIO A;  1AHD P;  5M3F J;  2FX0 A;  4NDL A;  3JR9 A;  3LSP A;  3TED A;  4QSH A;  2XPV A;  1OFC X;  2H1K A;  1B8I B;  3GTK J;  4D5F A;  1OCT C;  3Q3S A;  4BBS J;  2DMT A;  3Q0W A;  1JTY A;  1Z0X A;  4X6A J;  4W97 A;  5IYB J;  3BT9 A;  2XGE A;  4MFD A;  1P7J A;  4FE4 A;  1T56 A;  1PUF B;  4XRS A;  1A6I A;  5M3M J;  1E3O C;  5F0F A;  4HNV A;  5J1R A;  4DZP A;  4A3G J;  4A3E J;  2DMP A;  2VI6 A;  5IP7 J;  1A5J A;  1VF9 A;  3K2A A;  2WV1 A;  1ZKG A;  1NK2 P;  1TWC J;  5FLM J;  3BQZ A;  2E19 A;  3I4M J;  2QF7 A;  3HOW J;  2FQ4 A;  1YRN B;  3NAU A;  1BJZ A;  3LSJ A;  5M5W J;  2G0E A;  4DZJ A;  1SFO J;  3S2D J;  3RZD J;  4M3B A;  1HDP A;  4A3K J;  1IUF A;  3RZO J;  1ZK8 A;  1DU0 A;  1ENH A;  3H0G J;  1ZQ3 P;  1MBF A;  4DYQ A;  2ZB9 A;  5E3O A;  2NOG A;  1FTZ A;  3HOX J;  2EBI A;  3JRI A;  3JRB A;  4UUS B;  4C2M J;  1MSE C; 
#chains in the Genus database with same CATH topology
 5D8K B;  1WJ5 A;  1HKQ A;  1MSF C;  4QPO A;  1I27 A;  2LH9 A;  1W0U A;  1D0X A;  2QBY B;  4JOM A;  3HBL A;  3WTV C;  3MKW B;  4F93 B;  4CCO A;  1O7L A;  4RB3 C;  4ETS A;  1XCB A;  3ZQL A;  2ZFW A;  3OIQ A;  4M3E A;  4PSW A;  5E20 A;  1GUU A;  4ZYH A;  3CMY A;  2A6T A;  2A6E F;  2MW8 A;  5KNL A;  3OYL A;  2DMQ A;  2FJ1 A;  2BXY A;  5FB2 A;  4GYG A;  2QUF A;  1Z1D A;  3BPX A;  5GPC A;  3L2C A;  5FRO A;  3AFH A;  3H9Q A;  3JRF A;  4IO9 F;  5GTH C;  3RI4 A;  1TC3 C;  1GDT A;  2BY1 A;  3JSP A;  3HJE A;  2KIS A;  2BY3 A;  4NB5 A;  2LDU A;  4HQE A;  1WH5 A;  1XC5 A;  3EQL F;  4YFN F;  2V9K A;  5LFA A;  1Z67 A;  3OOU A;  2R7O A;  1XB4 A;  1YW9 A;  4QLC U;  4B4C A;  2XSJ C;  5LEK A;  1OR7 A;  4BS9 A;  2DFI A;  1UCR A;  2KIM A;  4HDV A;  3RCO A;  3S14 J;  3J81 Z;  3ZP5 A;  1WZ2 A;  1I6H J;  4U88 A;  4A3C J;  2CW0 F;  4A3M J;  2EFO A;  2EA2 A;  3C2G A;  4M73 A;  1Z91 A;  3ZMZ A;  4IPA A;  3IH2 A;  4RA2 A;  4QWQ A;  4V2F A;  4BY7 J;  4Y13 A;  1HSJ A;  2KJC A;  1TW2 A;  2GQQ A;  2LRD A;  3QU6 A;  1VQ7 I;  1IN7 A;  5ED4 A;  4IHX A;  1FJL A;  2GM4 A;  2ZSI B;  1ZRD A;  3PSF A;  4HX7 A;  2DJN A;  1MDM B;  2QKL B;  4RLF A;  2PJR B;  1DGW Y;  3ZQI A;  1OCZ H;  2MYS A;  1F1Z A;  3I59 B;  4B48 A;  1LE8 A;  4BEH B;  1GV2 A;  4D9J A;  3E6M A;  1WJE A;  5DUI A;  3A0H C;  4AIK A;  2XGD A;  4H4K C;  3O8G A;  3N97 A;  3TW6 A;  1FEX A;  1BW6 A;  1X1A A;  3GF2 A;  2M7A A;  3DKX A;  3K70 C;  2LRE A;  2NAZ A;  2IGN A;  2ICW G;  2XPU A;  4BYY A;  1R1U A;  4JP0 A;  3L2V A;  3S32 A;  2YX4 A;  5LGU A;  4OIR F;  3CUQ A;  2BHY A;  4CXF A;  3A4C A;  4JX4 A;  3FXM A;  1TNS A;  4WCG A;  5IY5 H;  2UZK A;  1MJ9 A;  1UG0 A;  2R7X A;  3I4N J;  2R7S A;  2LKS A;  3SZT A;  1WJB A;  1TNT A;  3LST A;  1IN8 A;  4OIN F;  5K5Q A;  2EFN A;  1OMI A;  2OCE A;  2VBW A;  3R0A A;  1OCR H;  4Q48 A;  4Y4R A;  4B8X A;  2VON A;  4LLL A;  1H9T A;  3LFU A;  1GXQ A;  3CC2 I;  4XOT A;  1X3Z B;  1MBH A;  1S7O A;  1H0M A;  4P55 A;  5F0C A;  4BBR J;  3MZ8 A;  3CCU I;  4IKF A;  3DWL E;  3GTG J;  2E1O A;  4ZYG A;  2V7F A;  4MFE A;  2HVR A;  1BR1 A;  4KFC A;  2DOE A;  1U0J A;  2YX7 A;  1A36 A;  1RIO H;  3PQJ A;  3PJR A;  4B3X A;  3NEU A;  2KIU A;  4A3D J;  5EDN A;  5FKL A;  4BXF A;  2RQP A;  3U1K A;  2GXG A;  5K7Z A;  3BR5 A;  4YFK F;  4UUT A;  2VE8 A;  5K1Y A;  2ZNZ A;  2FBI A;  4A2U A;  1KYZ A;  2M1B A;  5J3L A;  1O3R A;  2K85 A;  3KEY A;  1B72 B;  2JVH A;  4DYR A;  4FQG A;  4ZC3 A;  3TDU C;  5AON A;  4D1Q A;  1FP1 D;  1ZHF A;  3LSG A;  4NNJ A;  5DCM A;  4M3G A;  1SVL A;  4CCJ A;  3HGG A;  1U5T A;  2MSY A;  2JT1 A;  5FKM A;  3ZQF A;  3GTP J;  4KMF A;  1HW2 A;  1WQ2 A;  5AIQ A;  3M7G A;  2MD0 A;  3DQV C;  4BQO A;  2UUZ A;  3RDI A;  1RET A;  2LKX A;  2V1X A;  2QEN A;  3K4L A;  1YX3 A;  3PSI A;  3TQN A;  3JAM K;  1ETX A;  2JA2 A;  5BQT A;  4FCY A;  3R61 A;  1AOY A;  3HM5 A;  2JSC A;  1WPK A;  5EZG A;  2H6B A;  1FIA A;  1HW1 A;  3BG5 A;  4A3F J;  4L9V A;  4I01 A;  1XMA A;  2IGM A;  1U6G A;  4FAS D;  2DA7 A;  1BIB A;  4UVA A;  2N8G A;  3HOZ J;  1G3W A;  4XMY A;  2Y9Y A;  2D45 A;  1JHH A;  1WGX A;  1FX7 A;  4BHP A;  2OCC H;  1QZZ A;  1VQ5 I;  3PO3 J;  1XSD A;  1QU3 A;  2IBD A;  5E1Z B;  1D8J A;  4CH7 A;  4F52 A;  3HDD A;  4G6T B;  2HYG D;  1H88 C;  1MZB A;  3JRE A;  1QO0 D;  4EQQ A;  4F92 B;  3CJR B;  3CCL I;  3H5A A;  4XK4 A;  3GUD A;  2WY7 Q;  1Z21 A;  1VQP I;  1IRF A;  5LEJ A;  3ROU A;  3W6K B;  2GIV A;  1K78 A;  4F91 B;  2X6X A;  2XSD C;  2WV0 A;  3FKJ A;  3IH4 A;  2L3D A;  3BTL A;  3KCC A;  4ESJ A;  2AS5 F;  2R7T A;  3VEP A;  1GLN A;  5J40 A;  2DT6 A;  3AG3 H;  2IRF G;  4A5N A;  2RKH A;  3K7A J;  2LSO A;  2M8E A;  2WY8 Q;  5ILU A;  3BG3 A;  1Y1W J;  4HNT A;  2H27 A;  2IS1 A;  5KK1 A;  1X2N A;  2HOT A;  4Y33 A;  1W36 C;  1E17 A;  3BZK A;  4JX6 A;  3F0C A;  2CV0 A;  3QWL A;  5D4S A;  3FXL A;  4PUS A;  2VKV A;  1MMD A;  5LD2 C;  3FMQ A;  2WAF A;  5K7F A;  2KDZ A;  1FMW A;  1LEA A;  4RB0 A;  3I3L A;  3MQ0 A;  2CU7 A;  1PP7 U;  2ELH A;  4PGG A;  1MBJ A;  1BW5 A;  2ESN A;  3I54 A;  3CC4 I;  1FZP B;  3W6V A;  2VE9 A;  3ECH A;  3S2W A;  3E7L A;  3I64 A;  4IVN A;  4MIM A;  3QOE A;  4PJM A;  1TBX A;  2X9D A;  2XGX A;  3HEF A;  4CO8 A;  4G12 A;  1BOB A;  2OV7 A;  2NYX A;  3MMY B;  4YFX F;  2KFD A;  1TT0 A;  1L3L A;  4EM1 A;  1QZE A;  1R5H A;  2L01 A;  4EJV A;  2OQG A;  4BAC A;  2LD5 A;  5DCF A;  2PJP A;  3P9K A;  4J19 A;  1TTY A;  3KP2 A;  3CCQ I;  3FXJ A;  2K4B A;  3FIW A;  5EG0 B;  3FM3 A;  2P6S A;  1MGT A;  1JTX A;  3LAP A;  3I9V 2;  3SZP A;  3OMY A;  2OTJ I;  5J4Y A;  3PFY A;  4AUX A;  5ILV A;  2HDD A;  2EIL H;  3I59 A;  4QTR A;  1LE8 B;  3B6A A;  1LVA A;  2JUC A;  2ID6 A;  3DKY A;  4AC0 A;  4X0G A;  3OYN A;  1TWH J;  1Z3X A;  3P5J A;  3TBI A;  2XC7 A;  3BJO A;  3JRH A;  3K69 A;  2Q2E A;  2X0L A;  3GEZ A;  1I39 A;  2QZ8 A;  2WA0 A;  1T0F A;  1TP4 A;  2E5Z A;  4A3J J;  1VQL I;  2OZ6 A;  1LFB A;  4S0H B;  2ELJ A;  5D5X B;  1SFU A;  5IYD J;  3LSR A;  3LA2 A;  2EIM H;  1X3U A;  2KRF A;  3R6S A;  2K02 A;  4FE7 A;  4WF2 A;  5HNF A;  3NAR A;  3JRA A;  2FNA A;  2P5V A;  4HW0 A;  3GO5 A;  3KP6 A;  3ML6 A;  2L4M A;  2MLG A;  4KIS A;  2DT5 A;  3CES A;  2L9R A;  3GBG A;  5FD6 A;  1LNW A;  1YJN I;  2R93 J;  3FDY A;  5J1Y A;  3SDG A;  2DBB A;  2ISZ A;  3QYB A;  2F2E A;  2IGO A;  2M4K A;  3U21 A;  4CCL A;  3HC7 A;  1ZR4 A;  2ECB A;  2R7W A;  4PGH A;  2XV4 S;  1X2M A;  3F9K A;  3RPU A;  4PK4 A;  1AKH B;  3WU1 B;  2L7Z A;  3CMM A;  2K4J A;  2NVX J;  3WG7 H;  2GXB A;  2HZD A;  2LY2 A;  4EGZ A;  2VC0 A;  1R7J A;  4IHS A;  2RRE A;  1S8N A;  1UAA A;  4Y7N J;  1Q1V A;  2EFQ A;  1ORK A;  1FOW A;  2AXT C;  1PYV A;  2X4H A;  4MEY F;  4BXU A;  2V9V A;  2X1E A;  3KE2 A;  4KIF A;  4UUS A;  2BHZ A;  5TJJ A;  5FFZ A;  5EF6 A;  5FKK A;  1B72 A;  5IT3 A;  2LTP A;  1ZGA A;  3AAF A;  2CS3 A;  3KFW X;  2IW5 A;  3G1M A;  2HQN A;  1W7P A;  1KQ9 A;  5LGN A;  1IV8 A;  4S04 A;  5C4J J;  2P0W A;  4AYB N;  4C9Y A;  2JA5 J;  1GVJ A;  2STT A;  1HOM A;  1NK3 P;  3J7A Y;  1GV5 A;  2QQA A;  2A05 A;  4GYI A;  3WG9 A;  4PCQ A;  1RC9 A;  4HF1 A;  3FIS A;  2ZME B;  1O3T A;  3DTI A;  4K2E A;  2F4I A;  3HL2 A;  2TDX A;  3C2B A;  1WJC A;  4FHT A;  1H8A C;  3EYI A;  2M4G A;  2M30 A;  1JKR C;  2KPM A;  2HYJ A;  2LK2 A;  4IX7 A;  4XLP F;  2J5P A;  1SD6 A;  1AHD P;  2W57 A;  5M3F J;  3JR9 A;  2ZJR F;  2E7X A;  5EEH A;  4Z6Y A;  4PDK A;  3LSP A;  5E17 F;  4BE1 A;  2XPV A;  3GTK J;  2H1K A;  2VIX A;  1OCT C;  1JHF A;  4BBS J;  3M1C A;  1G8X A;  2A61 A;  1Z0X A;  1F9N A;  3HYI A;  2MBF A;  4M9X A;  5LRR A;  2WBM A;  3E0J B;  3E97 A;  3Q9V A;  1FNN A;  4U7D A;  1QHH D;  3BDD A;  5CJ9 A;  4A6E A;  4N9H A;  1DDN A;  2BOL A;  3V7C A;  2R7D A;  1A6I A;  3K1P A;  5M3M J;  4UNO A;  2YU3 A;  4A3E J;  3S3N A;  2HYF A;  4C30 A;  3C18 A;  4GRI A;  1ACI A;  2OTL I;  1TWC J;  2ZXH A;  2V26 A;  1XTA A;  4PJN A;  3M07 A;  5BMZ A;  1SFK A;  1ZG5 A;  4L9T A;  3OYE A;  2FQ4 A;  3NAU A;  1J59 A;  1IV6 A;  3LSJ A;  5M5W J;  2G0E A;  1YIO A;  2RNJ A;  2KLO A;  3ULQ B;  1OYI A;  2BXZ A;  3AL0 C;  2XF5 A;  3F6V A;  2L2O A;  1IUF A;  2NRA C;  3PFI A;  1XN7 A;  4XRF A;  1W5S A;  1UJ8 A;  5KVR A;  2NOG A;  3G6E I;  3OYD A;  1ULY A;  4L9J A;  3JRI A;  3JRB A;  5H6Q A;  1CGP A;  5J6X A;  1OCC H;  2VJ4 A;  2A07 F;  1WCM J;  5FKO A;  1BC7 C;  2HTS A;  2KZV A;  3A03 A;  4Q47 A;  3V8J A;  4NQW A;  1VFC A;  3GTO J;  2IS4 A;  1OIS A;  4KN4 X;  3WGI A;  1Z05 A;  2AQE A;  3QOP A;  4HAM A;  4KIT B;  1P92 A;  3HKZ N;  3IAM 2;  2P5L C;  3I56 I;  5GPA A;  2P81 A;  2B63 J;  1U78 A;  1JUS A;  1P2F A;  2O6G E;  2PG4 A;  3R4K A;  1HST A;  2CV1 A;  5LHI A;  2JJ7 A;  2G7U A;  4J00 A;  1OR7 C;  2CUE A;  3CLO A;  3H5N A;  3EUK L;  3BPV A;  2LMD A;  2ZXW H;  4CYC A;  2QGU A;  2QQ8 A;  3GFM A;  5JFR A;  3CF5 F;  1TQM A;  2AXL A;  4RM2 A;  1KQ8 A;  4AIJ A;  3OV8 A;  2VBX A;  1AA7 A;  3I55 I;  1STZ A;  1AWC A;  4MNU A;  2VXD A;  3RTR A;  1FYK A;  2HXI A;  1MD0 A;  2M8G X;  2IAI A;  4E6K G;  1N77 A;  3BOQ A;  1LB2 A;  2GOM A;  2KZG A;  4FX0 A;  4XIC A;  1HCR A;  2Q2E B;  1ITY A;  1RES A;  1YW8 A;  2Y31 A;  4KT6 A;  3P7N A;  1KQ0 A;  2WAQ A;  1EKE A;  1QQI A;  1XDU A;  4IHT A;  5D6F A;  3MN2 A;  1WJF A;  1ZR2 A;  3BQY A;  2HQ5 A;  1L0O C;  1GVD A;  2O7O A;  4PFO A;  1CQT A;  3MD2 A;  4Y17 A;  2UV1 A;  3ASO H;  3O3K A;  9ANT A;  4H0E A;  1N75 A;  2EWN A;  4A3I J;  4UV8 A;  2Z1D A;  2IA2 A;  5HS9 A;  5LBQ A;  5FLX Z;  2Q0O A;  1U8R A;  4P9F A;  4HZF A;  5HDK A;  1LDJ A;  4OIP F;  5EEA A;  2HKO A;  2XAS A;  4UXN A;  5JHF A;  3BR3 A;  4BAY A;  5GAG J;  2BBY A;  2E60 A;  2M0M A;  2ZNY A;  2EIJ H;  5GAH J;  2W25 A;  3WOD F;  1KYW A;  1U2W A;  1BI2 A;  1SC7 A;  2O03 A;  3I53 A;  1V5E A;  1V5G A;  4UVC A;  3S93 A;  4ENM A;  4ZZL A;  4KA4 A;  2P5K A;  5EJC A;  4M3F A;  3H36 A;  3I58 A;  3CCV I;  2DFF A;  2R0Q C;  1SFE A;  3DEU A;  1BL0 A;  2PEX A;  2Y75 A;  2EZI A;  1IAW A;  2G7H A;  1IRX A;  2H94 A;  3JTH A;  4N4O B;  5L3B A;  3QU3 A;  1NH3 A;  1IXS B;  4M72 A;  4B47 A;  1QHG A;  4RDU A;  2DYS H;  1Q1H A;  1ON2 A;  1DQU A;  1N78 A;  4UY8 I;  2KT0 A;  5DDG A;  3S16 J;  1YOV B;  4D7N A;  4GDF A;  4MGR A;  4Y15 A;  2EK5 A;  2HXO A;  2XRL A;  3ZN1 A;  1W4M A;  4L5E A;  1EA3 A;  5CKT A;  5TRD A;  1FBS A;  1G4D A;  1D5V A;  3FF5 A;  4XON A;  1VQ4 I;  2C6Y A;  4HLY A;  2E36 A;  3I0T A;  1QZY A;  4P1W A;  4LFU A;  3O6B B;  1JKQ C;  1MMA A;  1XPX A;  4OMZ A;  4R79 A;  2O3F A;  3CJT B;  1G59 A;  2BW3 A;  3TL4 X;  4ZJZ A;  3ZRG A;  1HBX G;  3CDI A;  4AID A;  3K1N A;  3CTA A;  2K3F A;  5E1X A;  2VOP A;  2M87 A;  5BNG A;  5HLT A;  3DP7 A;  1R5I D;  1LUJ B;  1T2K A;  3B73 A;  2HDW A;  1IW7 F;  2XVC A;  5CVU A;  5LGT A;  2OPT A;  3KEQ A;  1ETO A;  1X58 A;  2IP2 A;  2QA4 I;  3HG9 A;  3FXR A;  3U1D A;  3A1Y A;  1MDM A;  1HXD A;  2W24 A;  3OS0 A;  2RDP A;  2DXI A;  5F04 A;  3TOB A;  2OC6 A;  3AG4 H;  4BEH A;  2F5D A;  2Z5U A;  2LF7 A;  2LKP A;  1QA6 A;  3HSE A;  3RKX A;  3ABK H;  1B4A A;  2VN2 A;  4YEL A;  3GFJ A;  2JK3 A;  2DDB A;  2EH3 A;  2FOW A;  3LWF A;  1B8I A;  1QGP A;  3G71 I;  2IA1 A;  3Q0U A;  3AL0 B;  2DA5 A;  3V4G A;  3PUB A;  3S3O A;  1TWA J;  4MO7 A;  4TV7 A;  3CCE I;  1PDN C;  4LK0 F;  3RPU D;  2L9V A;  2K27 A;  1A6Q A;  3CUQ B;  1ETQ A;  1HQC A;  2VJ5 A;  3CCS I;  2DA6 A;  4A0X A;  2W4S A;  5ICE A;  3OYA A;  2NVY J;  3V7S A;  2KRH A;  4XSZ F;  4PJ0 C;  4DJA A;  1Z7U A;  3DV8 A;  3IWF A;  1NG6 A;  1MMN A;  3NWS A;  1VI0 A;  2HQR A;  4YIF A;  2VXZ A;  2EZK A;  3KET A;  4KUM A;  1XGS A;  3I4P A;  1YJ9 I;  1BR2 A;  1SMY F;  1S6L A;  4CGZ A;  3AKZ A;  4OOI A;  1SAN A;  3HZJ A;  3A0B C;  2KHM A;  4RAG A;  2ME6 A;  4YEJ A;  4BJ5 C;  3LNQ A;  5FGM A;  2OU2 A;  3WU2 C;  4MTD A;  4IJA A;  1WHU A;  2DO7 A;  2FEZ A;  4LD5 A;  3S3M A;  1MJA A;  2OF7 A;  2W00 A;  3DBL B;  4L5I A;  1APL C;  2KQR A;  2CRG A;  4G7H F;  2LVS A;  2STW A;  2HPM A;  2F5E A;  2P7C B;  3GWZ A;  2R4G A;  2JN6 A;  2PMH A;  3HIF A;  4O5V A;  3RJP A;  3IV5 A;  2DOF A;  1TW3 A;  2E7W A;  1UHM A;  4JX5 A;  2HOE A;  4M74 A;  2L7M P;  2ZJ2 A;  4ZZD A;  1FIP A;  1ZLJ A;  3KEO A;  3KYD B;  3OIP A;  3WHC A;  5A2Q K;  1YO5 C;  5CVI A;  3S17 J;  5EGO A;  3D1N I;  1IZ1 A;  1XD7 A;  4LMY A;  1EH8 A;  1U3E M;  1Y8Q B;  3VYT B;  1TZL A;  2YSR A;  5L3C A;  1XSV A;  2VQC A;  3CP8 A;  3IUO A;  4XN0 A;  4DBR A;  1Z6R A;  3PIP F;  1XMK A;  1ZRF A;  1OYY A;  1P4X A;  3HRU A;  3HHG A;  4U87 A;  2MFZ A;  2YU9 J;  2DDA A;  3BCA A;  3MEX A;  3R0J A;  4ZYA A;  4MQV A;  1IXC A;  4EJU A;  1R6R A;  2GIZ A;  2UXN A;  5BOX A;  5JVG F;  4KYW A;  3LFK A;  1FOY A;  2R5Y B;  3QOD A;  1KU9 A;  4ITV A;  1K61 A;  1S5L C;  5JHU A;  3HOS A;  4RAY A;  3IRR A;  3L09 A;  5K5R A;  3A01 A;  3N05 A;  1IF1 A;  4CCM A;  2HFH A;  4D5C A;  3CMA I;  1PP8 F;  1FYL A;  2HKX A;  2I10 A;  3FXU A;  4B44 A;  2DMU A;  1I1G A;  1J75 A;  3V8K A;  4DYC A;  1SD4 A;  3K2Z A;  4IF4 A;  2EB7 A;  2A5Y B;  1JXS A;  3GTL J;  3J81 K;  3ZXS A;  3ZQ7 A;  5IYC J;  1K78 B;  2GXA A;  1E3H A;  2HR3 A;  4XLH A;  4JBA A;  2QCO A;  4E4H A;  2HS5 A;  2CUJ A;  2O9L A;  4HBL A;  2ZXJ A;  5D8L B;  3N4M A;  5FRM A;  2IGK A;  3OL4 A;  1FOX A;  3A02 A;  2Y69 H;  3ECO A;  2XF6 A;  1FTT A;  3VDX A;  1HKS A;  1JKO C;  3IC7 A;  3TMO A;  3GTJ J;  3PNY A;  4FIS A;  5C3E J;  4I6Z A;  3RYR A;  1G3Y A;  1GT0 C;  4ASN A;  2X1D A;  2RNG A;  1YRN A;  2MG4 A;  1JE8 A;  2JWT A;  5J8F A;  1IN5 A;  2QWW A;  3MFK A;  1X4P A;  1ZG1 A;  2FML A;  3F72 A;  2BYV E;  2J5O A;  2XHK A;  5CPR B;  5KAF C;  2WTE A;  2IS2 A;  3C3W A;  3OY9 A;  2XUB A;  2R7V A;  3KP5 A;  1ONV A;  2XAG A;  2DA2 A;  1WFX A;  4KIC A;  4XLF A;  5C44 J;  2LF8 A;  5K7H A;  3ZPL A;  4E7K A;  3D5R C;  2WAD A;  1XX5 A;  2RQQ A;  3SEZ A;  3EYY A;  5IPA A;  2F5C A;  1IDY A;  2Y2Z A;  1FY7 A;  1H9G A;  4JQF A;  5J47 A;  3RYP A;  3GTQ J;  2XPW A;  4G6Q A;  3CCM I;  4CA0 A;  4HYE A;  5C4X J;  1YFH A;  3BP8 A;  2JRM A;  1KU3 A;  3CUO A;  5LHG A;  4ZTF A;  4Y52 J;  1PVE A;  3MVP A;  1R23 A;  1D1A A;  1Z77 A;  2DN0 A;  1UB9 A;  1TWG J;  1YIT I;  1FLI A;  2X85 A;  4IRG A;  1N25 A;  2TCT A;  2VAS A;  5F6F A;  1TWF J;  5HDN A;  4E7J A;  5CQG A;  4EJW A;  3OL3 A;  4XKB A;  1VQM I;  3KIO A;  1RUO A;  1B8I B;  4D5F A;  2AQF A;  1VQ9 I;  2O0Y A;  2CH0 A;  1Y6I A;  2DMT A;  2B7E A;  1B59 A;  1WJA A;  3FHZ A;  2CGP A;  1MJB A;  4LIV A;  3UR3 C;  3OS1 A;  2R3S A;  3L2W A;  3BT9 A;  1T98 A;  4MFD A;  3H0D A;  4FE4 A;  1T56 A;  4MHG A;  4ZDP A;  2NVU B;  5LRS A;  4XRS A;  4G8X A;  5J1R A;  4BDY A;  3EUH A;  4A3G J;  3X2Q H;  4RGU A;  2XKO A;  3JW4 A;  2V1N A;  2DT7 B;  5IP7 J;  1RR8 C;  3HRT A;  3WTX C;  3H3Z A;  4GCV A;  2ZKZ A;  3J80 Z;  4IRH A;  4IOC F;  2E19 A;  4XNF A;  3I4M J;  2QF7 A;  1K4T A;  2FE3 A;  4IQ4 A;  1MNE A;  4PZJ A;  3H92 A;  4E70 A;  3BJ6 A;  1SAX A;  1RZ4 A;  1UZC A;  3TO6 A;  1V3F A;  2QLZ A;  4M3B A;  4J01 A;  1J7K A;  2HNH A;  1HDP A;  3J7Z I;  3M9A A;  5JR3 A;  1ZK8 A;  3MKZ A;  1DU0 A;  2KL4 A;  3DBH B;  1X1B A;  5E3O A;  2MLK A;  3S8P A;  5E79 C;  4HRI A;  1FTZ A;  4ZTJ A;  3OR1 C;  5HNH A;  4UUS B;  3ERE D;  1YHQ I;  2VJJ A;  3WE3 A;  3KX2 A;  4EGY A;  4BY1 J;  3K0L A;  3BTJ A;  2JA8 J;  4A93 J;  3C2H A;  4CYD A;  3LA7 A;  2JRT A;  1X19 A;  5EGO B;  4G6D A;  3GME A;  3DEW A;  4L5J A;  4B43 A;  4BJT A;  5F0H A;  4BQN A;  2WWY A;  4XM3 A;  1RUN A;  5B5E C;  4LG0 B;  1V55 H;  1DP7 P;  2FUG 2;  3SZG A;  2L5Q A;  3WTU C;  5ICG A;  2JMW A;  2NOJ B;  3ELK A;  5TIS C;  1J0R A;  1D3Y A;  4DOZ A;  3ASN H;  3VWB A;  3DLA A;  4AWX B;  3ABL H;  3CME I;  2JA7 J;  1V5F A;  4GXO A;  4BE0 A;  2E1C A;  2HU9 A;  1SD5 A;  1S7A A;  5D6E A;  4XBF A;  4HLX A;  2A69 F;  5FFX A;  1K4S A;  4UB8 C;  2R5Y A;  2FD5 A;  2VKH A;  3M1E A;  3FX3 A;  4I02 A;  4HV5 A;  3OYB A;  4P9U A;  1JT6 A;  1YS6 A;  2PQ8 A;  3TP3 A;  2R5Z B;  4ON0 A;  1YJW I;  4EJT A;  1FBQ A;  2JPC A;  4CZC A;  4PJJ A;  3G73 A;  3QP6 A;  2FQ3 A;  2COM A;  4XLA A;  1TLH B;  1B6A A;  1Y56 A;  2TRT A;  1ZH5 A;  5GAD J;  5E3M A;  2O8X A;  2E2I J;  1B9M A;  1UMQ A;  3Q0V A;  5DD8 A;  5L3E A;  4GO1 A;  4KDP A;  1IRG A;  2IJL A;  3S15 J;  4A3L J;  3ZQG A;  1JT0 A;  1U9N A;  4XL9 A;  2DCE A;  1YS7 A;  2DQL A;  2E71 A;  3DF8 A;  3NWT A;  5CVR A;  4A0Y A;  5LLQ A;  1W7P D;  2Z2S B;  1P7I A;  4NC7 A;  3RPQ A;  5B1A H;  1R49 A;  1MBE A;  3W2W A;  2VOD A;  1LVK A;  5HLG A;  3RKQ A;  4LB6 B;  1TQI A;  2W1O A;  1HDD C;  2F5V A;  1KZH A;  4IL6 C;  4RB1 A;  2MGQ A;  2EIN H;  2WAQ N;  1I5Z A;  2F4O B;  3TP0 A;  2A68 F;  4A69 C;  1W36 D;  2EQR A;  2DTR A;  3KLO A;  4I0A A;  4BL0 B;  3OYM A;  1K6Y A;  2Z16 A;  2O61 A;  2CV2 A;  1RKW A;  4KN7 X;  4LJZ F;  3TDZ C;  3UNG C;  1ZLK A;  2LR8 A;  1P9Q C;  3KYC B;  4LLN A;  1X1P A;  2K3P A;  2Y9Z A;  3QPL A;  1OPC A;  3SFI A;  1R36 A;  5ICC A;  1XS9 A;  1FWZ A;  4CUG A;  4EV0 A;  5E18 F;  4P5O A;  1BI0 A;  3GLX A;  3NQO A;  1ZG3 A;  4YIR X;  3HXL A;  5FJ8 J;  3F8M A;  1OKR A;  3WTZ A;  2A3S A;  1YI2 I;  2GAU A;  3ZQC A;  1Y8R B;  2K9Q A;  3F6O A;  4HV6 A;  5DTD A;  2EV0 A;  1XGM A;  2VT2 A;  1JKP C;  4XID A;  2CQK A;  5FD5 A;  4CYC B;  4E7L A;  2DMN A;  3JTG A;  5GTI C;  2XGC A;  2WAE A;  3BC8 A;  3F21 A;  3DBR B;  3W2V A;  2ZFU A;  5K5O A;  3CCR I;  1G3S A;  3FMS A;  4O3M A;  3FXK A;  1YE9 A;  5L3F A;  4QPQ A;  4Q5S F;  2CYY A;  1OJL A;  2L54 A;  2HOA A;  2QVO A;  4BDZ A;  2B9S A;  4FX4 A;  4ZDO A;  2XRO A;  2JUG A;  2VPR A;  2KMU A;  4FET A;  2CMP A;  4F55 A;  3DTE A;  1ZRE A;  2ZME C;  1X1D A;  3WGH A;  1BOA A;  4HA8 A;  3SYT A;  4OIQ F;  4BKX A;  1X4O A;  3ONQ A;  5H20 A;  4RB2 C;  4U0Y A;  1HLV A;  2CG4 A;  4IEJ A;  1S9H A;  5CYV A;  3OR2 C;  5JLW A;  3L2Q A;  3LQR A;  1ERD A;  4OMY A;  4AD9 A;  5EYR A;  1FSE A;  1W0T A;  2ELK A;  4MTE A;  1U9O A;  4NHJ A;  2WC2 A;  2LY1 A;  5IOY A;  2R7R A;  1I3Q J;  3SJM A;  2EZL A;  3G1L A;  4I99 C;  3E5U A;  3DU6 A;  3W3C A;  1ODD A;  1FYM A;  4BQA A;  3IKT A;  3CDL A;  1IC8 A;  4U0V A;  1DP3 A;  2EV6 A;  2QSH X;  3RQI A;  1GXP A;  2CWE A;  2HI3 A;  3H1C A;  4KMU X;  2OZU A;  3RIR A;  3CJQ B;  5D5W B;  1HW5 A;  2GZW A;  2P4W A;  5DD4 A;  2M7B A;  1C0W A;  2VLA A;  3ZMD A;  2NS0 A;  4HSR A;  5F08 A;  4G94 A;  5M5Y J;  1TQP A;  2VL8 A;  3CZ6 A;  1QRY A;  3GXO A;  3P9I A;  5DS9 A;  3G3Z A;  2A6H F;  1LDK B;  2CQ7 A;  2OD5 A;  3TO7 A;  1PUF A;  5HLI A;  4A6D A;  1I6X A;  5LHH A;  2CJJ A;  4KIG A;  4I2O A;  1P4A A;  4II3 A;  4I09 A;  2BZT A;  4IRI A;  1YIJ I;  1IRZ A;  3FXO A;  2YPR A;  3REO A;  3GZ6 A;  1IG7 A;  3K6G A;  2LBF B;  2G9W A;  1U8B A;  4Y3O A;  3ZMU A;  3U9G A;  3KP3 A;  4UHT A;  2AO9 A;  5JLX A;  3KZI C;  1EV7 A;  1T33 A;  4M3D A;  4BGD A;  3FZV A;  2Y30 A;  1Y0U A;  2GA1 A;  2L0K A;  4XQF A;  4A12 A;  3ESW B;  5KAI C;  1P6R A;  4XN3 A;  5B66 C;  4LG0 A;  1UFM A;  3BR0 A;  2DJI A;  4EMS A;  4LIU A;  2W48 A;  3T1B A;  2VBZ A;  2BW3 B;  1WI3 A;  3BJA A;  2L9S A;  3VPR A;  4DQ2 A;  1OQY A;  1FP2 A;  2M34 A;  4II2 A;  1NHA A;  2LY9 A;  3MZY A;  3CD6 I;  4RGS A;  4ZDL A;  3MWM A;  2E5N A;  4WXH A;  1HC8 A;  2E1M C;  2MAB A;  1A04 A;  1D5Y A;  1BM9 A;  4M6V A;  1V54 H;  2ZO4 A;  4X1E A;  2BY2 A;  3E5X A;  2GA2 A;  3ZQH A;  1MNM C;  2VPL A;  1VQ8 I;  5J4V A;  1O4X A;  1ZTR A;  2LG4 A;  3M8E A;  3TW7 A;  3KYL A;  4GGG A;  1S72 I;  2VB6 A;  4XKC A;  2F48 A;  2XAQ A;  4L0Z B;  1BA5 A;  1EJ9 A;  1ETV A;  4FTH A;  3A2K A;  4XKW A;  2F4M B;  3HOV J;  3M3Y J;  2RAE A;  1XG1 A;  1JJ8 C;  4OIO F;  2Y0S A;  3L2U A;  1MH3 A;  3DEE A;  2X51 A;  4JK1 X;  5HVQ C;  1R71 A;  3OWT A;  3S1R J;  2ID3 A;  4C3I J;  1IGN A;  3VYU B;  2R7F A;  3K4M A;  1R4N B;  5ERI A;  4OU0 A;  1A35 A;  3CJN A;  1MH4 A;  2L9N A;  3O2P E;  2H8W A;  2Z33 A;  3LMM A;  2WB1 A;  4YII A;  2VBY A;  1KU2 A;  5E3N A;  2E35 A;  4IHY A;  4YG2 F;  3OYK A;  2GWR A;  2EA4 A;  1NTC A;  2VQG A;  1YG2 A;  3HUG B;  1CF7 A;  2GLO A;  1X3W B;  3IAS 2;  3CDH A;  4V19 K;  3JRC A;  1WH7 A;  1WWX A;  2ZBK A;  2ZCW A;  4Z2Y A;  5CVV A;  2NS8 A;  1W5T A;  3EPZ A;  2R7Z J;  3B02 A;  3WTS C;  5HS8 A;  5IOZ A;  2NVT J;  1I1S A;  1D0Z A;  1KGS A;  4HEA 2;  4JYK A;  1T95 A;  5HS7 A;  4I98 B;  5J8C A;  3BG9 A;  1UHW A;  3H9J A;  4ZYE A;  3KLN A;  2CQX A;  1H89 C;  1T08 B;  3K10 A;  4NBQ A;  2PLY A;  2MC3 A;  2VT3 A;  1K6O A;  2LLK A;  2FOK A;  2MH9 A;  3J80 K;  4RGX A;  3V7R A;  1X1C A;  2EFP A;  3I71 A;  3HSR A;  5F27 A;  1LDD A;  3ZGK A;  2CO5 A;  4RMN A;  1K83 J;  2OA4 A;  4EVI A;  4D7M A;  2EIK H;  3QYE A;  4EEF G;  3D5S C;  4CHU A;  3J7A O;  4N0B A;  2ESH A;  1XGN A;  1O3S A;  3ABU A;  1PUE E;  2QBY A;  4M71 A;  4ENN A;  1MW7 A;  3HHH A;  1VQO I;  2M0C A;  5B3S H;  4PSX A;  3H3V K;  4G7O F;  1EF4 A;  2AHQ A;  2CUZ A;  4PFP A;  2RV8 A;  2UWM A;  4OAY A;  2VOO A;  2FU4 A;  2ISY A;  3IL2 A;  1IN4 A;  1ETW A;  2X48 A;  2HOS A;  2PX9 A;  1LPQ A;  1XDS A;  3BRO A;  3VYR B;  4XLC A;  2EZH A;  2BVM A;  4G7Z F;  2ME0 A;  3HB9 A;  4LIT A;  3S1N J;  2H6C A;  3MCZ A;  2ZJP F;  5HOO A;  4BQQ A;  3E6C C;  1JJ6 C;  5D4R A;  1IDZ A;  4B09 A;  1ZAR A;  4OAZ A;  3FBI B;  3A01 B;  5A2Q Z;  2MD5 A;  4W1U A;  5DYM A;  3DFG A;  3ERM A;  2PFB A;  3VFZ A;  1FC3 A;  2HZT A;  3D0S A;  3BLY A;  2FX0 A;  4XLE A;  4NDL A;  2Z3Y A;  1KU7 A;  3ZMT A;  3FMR A;  2RVC A;  1Z9C A;  2FA5 A;  2JPB A;  5BS6 A;  2PMU A;  1G6N A;  3F23 A;  4I0B A;  2NXN B;  3GVA A;  6PAX A;  3T8T A;  3FHN A;  1WKM A;  4W97 A;  3G2B A;  3VSK A;  2M45 A;  2IXS A;  4KT5 C;  4F7Z A;  2XRN A;  3R60 A;  1K7A A;  3C7J A;  1QPM A;  2XGE A;  1P7J A;  1PUF B;  2EPF A;  1E3O C;  3HKZ A;  1DPU A;  2ETH A;  4CSW A;  4DZP A;  3BG7 A;  2IA0 A;  3L7W A;  2V1U A;  2VI6 A;  3OYF A;  2MH2 A;  1A5J A;  2DFH A;  3K2A A;  2WV1 A;  4R1H A;  2D1V A;  1NK2 P;  3BQZ A;  3ABT A;  2BEO A;  3HOW J;  3I5U A;  5IT9 K;  4LK1 F;  1YRN B;  3ISP A;  1BJZ A;  3CF2 A;  1SFO J;  3PUF A;  2ZJQ F;  3RZD J;  1A31 A;  1FOK A;  2NNY A;  2I5U A;  3RZO J;  2JVG A;  3SDB A;  1ENH A;  5FRN A;  3H0G J;  3IKV A;  4HPQ A;  1MBF A;  1ZQ3 P;  4DYQ A;  2H1L A;  4ZYD A;  2PMZ A;  3QAH A;  3AG2 H;  4LGW A;  4LLG F;  5ICF A;  2EBI A;  3PIO F;  1J2X A;  2RN7 A;  4LG3 A;  3ZMS A;  4C2M J;  1SEU A;  3BG6 A;  4A0Z A;  1MSE C;  2FSW A;  1QNT A;  3BTI A;  3P9C A;  1B1B A;  4XOR A;  4UV9 A;  4M6X A;  3IHU A;  3ABM H;  4RLQ A;  4HST A;  4ZH4 F;  2XB5 A;  1SVM A;  3PL8 A;  2H09 A;  1QVT A;  4ANJ A;  4E7H A;  4BH9 A;  4CIC A;  3LOC A;  4M6Y A;  4AIH A;  2GBY A;  3WTW C;  3MKL A;  2DTZ A;  4I7H A;  1IJW C;  2M5W A;  2DFE A;  3UKG A;  1GHC A;  4NC6 A;  1ZGW A;  3TGN A;  3H3U A;  4BE2 A;  2ZSH B;  1UG2 A;  5F64 A;  1BI3 A;  1TT5 B;  2ACJ A;  1AU7 A;  3DPT A;  4IHW A;  4RS8 A;  5DM6 F;  3WGG A;  1R1V A;  3VOD A;  1SMT A;  4B1R A;  3EUA A;  3HOU J;  3IH3 A;  1PJR A;  4F3Q A;  1KA8 A;  3V8L A;  3BTC A;  4XLN F;  4A3B J;  2R92 J;  2ECC A;  4ENK A;  2COB A;  3K4J A;  4DGW B;  1UEL B;  5D5U B;  2V9P A;  3H5R A;  2K40 A;  4L9N A;  3QP5 A;  2QQB A;  4RM3 A;  3RKY A;  1O7F A;  4HX4 A;  4C2T A;  1EH6 A;  1MKM A;  3EDP A;  4IXA A;  4MQ9 F;  2JQ7 A;  4S05 A;  4LB5 A;  2XB0 X;  2CW7 A;  1VND A;  5HOD A;  1OYW A;  2FBH A;  2OQR A;  2KJB A;  2NS7 A;  5F1J A;  5HDG A;  1JI8 A;  4AYB A;  1WRJ A;  1J5Y A;  1FMV A;  4DBQ A;  3JRD A;  3DKW A;  2E1M B;  3ZCO A;  1S7E A;  1WI9 A;  5L3G A;  2Y0S N;  4WX9 A;  1VTN C;  3DTK A;  3OYJ A;  4IHV A;  4C2U A;  4UUV A;  1ZN2 A;  2Z9O A;  3VOE A;  4AM3 A;  2LYC A;  2HQA A;  1Z7L A;  1QPI A;  3PO2 J;  1XSX A;  3OSG A;  3HPH A;  3EUH C;  4KNY A;  2WB1 N;  1YYV A;  2LNB A;  3JRG A;  3GFI A;  2P8T A;  3HOT A;  2GOX B;  4CZZ A;  4FT8 A;  3DU5 A;  1R1T A;  3T8R A;  4EM0 B;  3RSN A;  4BHC A;  3CO7 C;  2QYO A;  3LA3 A;  1E0E A;  5CQE A;  2D1H A;  3E5Q A;  1Z3Y A;  1Z6T A;  4MLO A;  3FK7 A;  1J09 A;  2RGV A;  2W7N A;  2MC4 A;  4QIW N;  3AG1 H;  1XMX A;  3ZN0 A;  5H2F C;  2HDC A;  1XGO A;  2DPD A;  4C3J J;  4HOB A;  1ON1 A;  1BIA A;  2V1D A;  1POG A;  3LSK A;  3F8C A;  3L00 A;  2A5W A;  2L7F P;  2CQQ A;  5FLV A;  1YLF A;  2HVQ A;  4WWC A;  3SFZ A;  3BR1 A;  1I50 J;  1ZAO A;  1WSU A;  4IZZ A;  1EH7 A;  2KIQ A;  2LP0 A;  2OUM A;  1D1B A;  5CLS A;  2M2E A;  3SHF A;  1FPQ A;  3RQ4 A;  3ZOB A;  2DYR H;  2CW8 A;  4DIQ A;  3IRQ A;  1M1E B;  1Y1V J;  2HWV A;  3FKI J;  4A5M A;  3DCF A;  3IWZ A;  2JTV A;  4HX8 A;  3SEQ A;  5E8G A;  3WHB A;  3HOY J;  3GYH X;  2DAO A;  3OSF A;  2W82 A;  4U7B A;  2R5Z A;  5KHD A;  1J9I A;  1LFP A;  1LJ9 A;  5E3L A;  3H9G A;  2HEO A;  3O8H A;  2QQ9 A;  3LL7 A;  1F43 A;  2VJI A;  5F1R A;  2V6E A;  2JSP A;  3Q9S A;  1MND A;  3DXJ F;  4L18 B;  4CCN A;  4E7S A;  2PN6 A;  4ESB A;  2DW4 A;  4LOC A;  3M4O J;  2NNN A;  1FBU A;  2OAZ A;  3LSI A;  4P96 A;  2L7K A;  1FSH A;  2E1N A;  2IPQ X;  3K4K A;  1IUY A;  2VKE A;  3WE2 A;  4XRM A;  3WTT C;  4E7I A;  3QRF F;  5EG0 A;  3GZ5 A;  3BWG A;  1DUX C;  2K7L A;  4HDU A;  2CUF A;  1DPR A;  2V6C A;  3MKY B;  2XAF A;  3OYI A;  1RI7 A;  2KRC A;  2W85 A;  1RRJ A;  1BR4 A;  4OWR B;  4RGR A;  3K70 D;  2V4J C;  4ESF A;  3BY6 A;  1USS A;  2OJE D;  3ZR8 X;  4AVZ A;  2D2W A;  3DPL C;  3F8F A;  3OYG A;  2CFX A;  3FWE A;  4BNC A;  3K4B A;  1RPW A;  3E6B A;  4MEX F;  1RKT A;  4B3A A;  2VKD A;  5IT9 Z;  4I76 A;  3JSO A;  4DW6 A;  3RKW A;  3OYC A;  3K9T A;  1WVR A;  3FK6 A;  3KPH A;  3L1P A;  2E34 A;  1VQN I;  1D0Y A;  1VQK I;  4M9S A;  1LEB A;  4RBO A;  3KZZ A;  1SVO A;  4V2G A;  1F5T A;  1V4R A;  2DU9 A;  2PMZ N;  3ZMV A;  1R58 A;  2IEK A;  2BE5 F;  4XKV A;  3QPH A;  4PJL A;  1DU6 A;  1MBK A;  3PQK A;  3DLL F;  1T38 A;  2JZY A;  1VQ6 I;  2BVL A;  2X6Y A;  1JUM A;  2XAH A;  2JA6 J;  3QYF A;  1K79 A;  5E8I A;  2XAU A;  1BJA A;  3U2R A;  2O8K A;  3BR2 A;  1YX5 A;  2M3A A;  3CLQ A;  2MA3 A;  1JGS A;  3T0Y A;  2QSG X;  1ZEL A;  2BY0 A;  3TOA A;  3MAJ A;  2CFO A;  3KP7 A;  1AKH A;  3IP4 B;  1ETY A;  2D5V A;  1SFX A;  2K9L A;  2CSO A;  3V42 A;  3OOP A;  4Q4Z F;  2DOD A;  2QSF X;  3SXY A;  2K86 A;  5L3D A;  2X6W A;  3F8N A;  4IQJ A;  3B6C A;  4KJZ A;  3G1O A;  2PI0 A;  2OBP A;  3LQQ A;  1RR7 A;  5FKN A;  2HTJ A;  1U5T C;  1E2X A;  1SAU A;  1Y39 A;  4O6J A;  3BZ6 A;  3HTS B;  3GTM J;  2YS9 A;  2XDV A;  3CP2 A;  5KCM A;  2DOA A;  1OLT A;  3BR6 A;  2FMY A;  1XCV A;  1S29 A;  1W7P B;  1ZRC A;  3KZY A;  4UB6 C;  2FF4 A;  1JGG A;  1RNL A;  4RAZ A;  2EFW A;  1JUP A;  2LFB A;  2E2H J;  2DI3 A;  5GP9 A;  4E7Z A;  2H8R A;  3KP4 A;  5D5V B;  3T5X A;  2FXA A;  2K9N A;  2O5R A;  1IN6 A;  4BXX J;  3WTY C;  2PBI A;  2ZME A;  3D5L A;  3PNV A;  1R4M B;  2X6O A;  4BU2 A;  4WK8 F;  2YUS A;  2M9H A;  3GFL A;  3E6D A;  4HF0 A;  4WXC A;  5EEG A;  1ZGJ A;  4NUB A;  1YQA A;  1YW7 A;  1E3P A;  3FM5 A;  5AIP A;  3S1M J;  2KDO A;  3OYH A;  3QPT A;  3CC7 I;  3TKY A;  2LC2 A;  2Y0M A;  4HNU A;  2XIG A;  2I8D A;  3GZN B;  4KIB A;  2Y48 A;  3K4N A;  1W1W E;  2BGC A;  3E1S A;  3VB2 A;  5JI6 A;  2IT0 A;  2YR2 A;  3QQA A;  2P7V B;  2QEX I;  2X1C A;  1BN5 A;  3CQZ J;  4NC8 A;  2P6T A;  4C3H J;  3M8J A;  4DNC A;  2DK5 A;  3H35 A;  1BI1 A;  2PJR A;  4R8H A;  3S2H J;  3MZH A;  4ABZ A;  4XRS G;  5TGT A;  4XR6 A;  3C1D A;  3LAJ A;  1MMS A;  3GW2 A;  1BC8 C;  1T6S A;  3ZQQ A;  1LFU P;  3GLL A;  2L4A A;  1W5C C;  1T8I A;  1D8K A;  2HGC A;  1WJD A;  2E2J J;  5H6R A;  1HF0 A;  2LBF A;  5B1B H;  1F36 A;  1P4W A;  3K4C A;  2DQR A;  5DV5 A;  3J7Y J;  1NG7 A;  3QPS A;  1HA8 A;  3PM1 A;  2K5C A;  3W2A A;  3EET A;  1MMG A;  2NVQ J;  4UVB A;  2Q8K A;  1O57 A;  1QVU A;  2L02 A;  2FRH A;  1R00 A;  3CO6 C;  2XF7 A;  1T0F C;  1QBJ A;  5IP9 J;  1ETK A;  5EZH A;  1B9N A;  4BHB A;  2HPI A;  2ADU A;  5GAE J;  2LOO A;  1D1C A;  3G4S I;  1IO2 A;  2K9S A;  1MBG A;  2V79 A;  1G2H A;  1FT9 A;  1UHS A;  5E1W A;  4BUP A;  2ZXI A;  2BV6 A;  1REP C;  4YRV A;  2VUM J;  1R5G A;  2Q1Z B;  4NQW B;  2EJR A;  1LKX A;  4IOA F;  5J1U A;  1R9T J;  3S1Q J;  2DA1 A;  4GFB A;  1VZ0 A;  5M5X J;  1UST A;  3L9F A;  5BPD A;  3PNT A;  2DLL A;  4CDG A;  3F22 A;  1O3Q A;  3BCB A;  3JAM Z;  2KKO A;  3GCM A;  1TL8 A;  2KP6 A;  2ZC2 A;  3NRV A;  5IP6 A;  4N9I A;  3K1M A;  1OCP A;  2DA3 A;  2DA4 A;  2XKP A;  2FBK A;  4BJ6 C;  5CVJ A;  2VC1 A;  4M9Z A;  3JCU C;  4AU7 A;  1KON A;  3HGY A;  3CCY A;  4EM2 A;  1BBY A;  2RC4 A;  5DCM B;  3FXQ A;  5FLX K;  3FBN B;  2R7U A;  2F5F A;  1MIJ A;  1U5T B;  3LSH A;  3OIO A;  4D0P A;  3CCJ I;  4WXD A;  2DK8 A;  3TED A;  4QSH A;  2CQN A;  2R7Q A;  1OFC X;  3Q3S A;  3BZC A;  3DPU A;  2W84 A;  3W6J B;  1OCO H;  3COA C;  3Q0W A;  2KIF A;  5DEQ A;  4RAF A;  1JTY A;  2Z99 A;  4X6A J;  5DUK A;  3HPG A;  1ZYR F;  2QM3 A;  5FO5 A;  5IYB J;  3HUG A;  4CCK A;  3L2R A;  3VSL A;  1CF7 B;  1HKT A;  2F6C A;  1G3T A;  1F4K A;  2IS6 A;  3E3V A;  2K9M A;  1I3A A;  4AVP A;  5F0F A;  4HNV A;  1SD7 A;  3OS2 A;  3GX4 X;  5DM7 F;  2EV5 A;  2DMP A;  1YTY A;  2DPU A;  1R22 A;  2B0L A;  5BPI A;  1VF9 A;  2IVM A;  5JVT A;  4ENJ A;  1ZKG A;  2QKM B;  2UXX A;  4XOP A;  5FLM J;  3SQN A;  2VQH A;  4EAT A;  4HF2 A;  2HVS A;  4HG2 A;  5HLH A;  4XSX F;  2VQL A;  3TO9 A;  3HSF A;  4DZJ A;  3Q5F A;  1IXR C;  3S2D J;  4N4N B;  3M8F A;  4G9Y A;  3F3X A;  4L0Y B;  4A3K J;  2XAJ A;  3HRM A;  4HQM A;  5ILS A;  3LSM A;  4U0W A;  2ZB9 A;  1Y0N A;  1DGR M;  3HOX J;  3F8B A;  3VYS B;  4EJO A;  1LQ1 A;  3HRS A;  3CUQ C;  3HTU A;  2FNP A;  1T39 A;  1S3J A;  3WU0 A; 
#chains in the Genus database with same CATH homology
 1WCM J;  5FKO A;  3BTI A;  3A03 A;  1MSF C;  1VFC A;  4BY1 J;  3GTO J;  3BTJ A;  1W0U A;  2JA8 J;  4A93 J;  3HKZ N;  2B63 J;  3HBL A;  2P81 A;  5GPA A;  1U78 A;  1JUS A;  5EGO B;  3ZQL A;  4M3E A;  3CMY A;  1GUU A;  2XB5 A;  3DEW A;  5F0H A;  2MW8 A;  2JJ7 A;  1QVT A;  2DMQ A;  2FJ1 A;  2CUE A;  3LOC A;  5GPC A;  1IV6 A;  2GBY A;  3MKL A;  2DTZ A;  2JMW A;  3JRF A;  1IJW C;  3UKG A;  4CYC A;  1ZGW A;  1GDT A;  1TC3 C;  1UG2 A;  1AU7 A;  4IHW A;  2JA7 J;  1WH5 A;  1XC5 A;  3HOU J;  4B1R A;  3IH3 A;  3BTC A;  2FD5 A;  2R5Y A;  4A3B J;  3OOU A;  2R92 J;  2ECC A;  2COB A;  2HXI A;  4B4C A;  2M8G X;  2IAI A;  2K40 A;  1JT6 A;  3TP3 A;  3S14 J;  2R5Z B;  4XIC A;  1I6H J;  1HCR A;  1ITY A;  1RES A;  4A3M J;  2Y31 A;  4A3C J;  4BY7 J;  3IH2 A;  4V2F A;  3MN2 A;  2TRT A;  1ZR2 A;  5E3M A;  2E2I J;  3BQY A;  2HQ5 A;  2XB0 X;  1UMQ A;  3Q0V A;  1GVD A;  1VND A;  5HOD A;  1FJL A;  2GM4 A;  4IHX A;  2O7O A;  3S15 J;  1CQT A;  3ZQG A;  1JT0 A;  4A3L J;  1U9N A;  2DJN A;  9ANT A;  3ZQI A;  4A3I J;  2NS7 A;  5F1J A;  1LE8 A;  1P7I A;  1GV2 A;  1MBE A;  3JRD A;  2XGD A;  3O8G A;  1S7E A;  3RKQ A;  1HDD C;  2Y0S N;  3TW6 A;  1BW6 A;  1FEX A;  5EEA A;  2MGQ A;  2WAQ N;  3TP0 A;  3BR3 A;  4IHV A;  4A69 C;  2EQR A;  1QPI A;  2XPU A;  4JP0 A;  3PO2 J;  1RKW A;  3OSG A;  2LR8 A;  4JX4 A;  2WB1 N;  3JRG A;  2Y9Z A;  3QPL A;  3SFI A;  1XS9 A;  3I4N J;  4M3F A;  2R0Q C;  1BL0 A;  2EZI A;  5FJ8 J;  4RDU A;  4MLO A;  3FK7 A;  2KT0 A;  4QIW N;  3ZQC A;  3S16 J;  4D7N A;  1MBH A;  2K9Q A;  4C3J J;  4BBR J;  5F0C A;  5DTD A;  2HXO A;  2XRL A;  3GTG J;  4L5E A;  2E1O A;  1POG A;  4MFE A;  1JKP C;  4XID A;  4CYC B;  2DMN A;  2L7F P;  2XGC A;  2CQQ A;  5FLV A;  4A3D J;  5EDN A;  3BR1 A;  1I50 J;  5FKL A;  5K7Z A;  3BR5 A;  4UUT A;  2LP0 A;  2M2E A;  1JKQ C;  1OJL A;  2HOA A;  3ZOB A;  1Y1V J;  3FKI J;  5J3L A;  3DCF A;  2VPR A;  1B72 B;  4DYR A;  3WHB A;  3HOY J;  3OSF A;  3LSG A;  4M3G A;  2R5Z A;  3HGG A;  5BNG A;  2MSY A;  5FKM A;  5E3L A;  3ZQF A;  3GTP J;  3O8H A;  4BKX A;  1F43 A;  2OPT A;  1RET A;  1HLV A;  2LKX A;  1ETX A;  1ETO A;  1X58 A;  4IEJ A;  4FCY A;  4LOC A;  3M4O J;  5JLW A;  5EYR A;  3HM5 A;  1WPK A;  5F04 A;  1W0T A;  5EZG A;  2ELK A;  1FIA A;  1U9O A;  2VKE A;  3BG5 A;  4A3F J;  5IOY A;  4XRM A;  1I3Q J;  3SJM A;  5EG0 A;  2DA7 A;  2EZL A;  3G1L A;  2N8G A;  2JK3 A;  3HOZ J;  2CUF A;  2EH3 A;  3CDL A;  1IC8 A;  2Y9Y A;  1WGX A;  1B8I A;  3Q0U A;  2DA5 A;  3RQI A;  2HI3 A;  3PO3 J;  1TWA J;  4MO7 A;  2IBD A;  3HDD A;  1ETQ A;  5F08 A;  5M5Y J;  1RPW A;  1H88 C;  1QRY A;  3JRE A;  1RKT A;  4B3A A;  2DA6 A;  5DS9 A;  4XK4 A;  1PUF A;  4I76 A;  4DW6 A;  3FK6 A;  2CJJ A;  3L1P A;  2NVY J;  4RBO A;  1VI0 A;  2XSD C;  1IRZ A;  4V2G A;  2PMZ N;  2EZK A;  3IH4 A;  1IG7 A;  2IEK A;  3BTL A;  1U8B A;  1DU6 A;  1MBK A;  1SAN A;  3K7A J;  2AO9 A;  1JUM A;  5JLX A;  4M3D A;  2JA6 J;  1T33 A;  2ME6 A;  2O8K A;  2Y30 A;  3LNQ A;  3BR2 A;  2L0K A;  3BG3 A;  1Y1W J;  1X2N A;  2OF7 A;  2HOT A;  1APL C;  2CRG A;  3BR0 A;  4JX6 A;  3F0C A;  2LVS A;  1AKH A;  1ETY A;  2D5V A;  2JN6 A;  2W48 A;  3IV5 A;  4JX5 A;  2VKV A;  2L7M P;  1WI3 A;  3VPR A;  3B6C A;  5K7F A;  2KDZ A;  3G1O A;  2M34 A;  1FIP A;  1RR7 A;  2CU7 A;  3WHC A;  3S17 J;  5FKN A;  5EGO A;  1MBJ A;  2LY9 A;  3D1N I;  1BW5 A;  3GTM J;  3W6V A;  2YS9 A;  3BR6 A;  3E7L A;  1D5Y A;  4MIM A;  2X9D A;  3HEF A;  4M6V A;  4G12 A;  4X1E A;  1JGG A;  2YU9 J;  3ZQH A;  1MNM C;  1JUP A;  2LFB A;  2E2H J;  1O4X A;  1ZTR A;  5GP9 A;  3TW7 A;  2LD5 A;  2H8R A;  4J19 A;  2K9N A;  4BXX J;  3FIW A;  5EG0 B;  2X6O A;  1BA5 A;  1JTX A;  1ETV A;  2YUS A;  2R5Y B;  4FTH A;  2M9H A;  1K61 A;  4AUX A;  3HOV J;  2HDD A;  1LE8 B;  4QTR A;  3A01 A;  2RAE A;  3B6A A;  3M3Y J;  3S1M J;  1XG1 A;  2ID6 A;  4AC0 A;  1JJ8 C;  1TWH J;  1MH3 A;  3JRH A;  4D5C A;  3S1R J;  2ID3 A;  4C3I J;  1IGN A;  2I10 A;  4A3J J;  2DMU A;  1MH4 A;  1LFB A;  4S0H B;  4DYC A;  3QQA A;  5IYD J;  3CQZ J;  3LSR A;  4C3H J;  5E3N A;  4FE7 A;  4IHY A;  3S2H J;  3NAR A;  3GTL J;  4ABZ A;  4XRS G;  3JRA A;  1NTC A;  5IYC J;  2GLO A;  1LFU P;  2QCO A;  3JRC A;  2E2J J;  2O9L A;  1WH7 A;  1HF0 A;  1F36 A;  2NS8 A;  2L9R A;  3GBG A;  3A02 A;  2R7Z J;  2R93 J;  3QPS A;  5J1Y A;  3SDG A;  3PM1 A;  1FTT A;  5IOZ A;  1ZR4 A;  2ECB A;  1JKO C;  2NVQ J;  2NVT J;  1QVU A;  3GTJ J;  4I6Z A;  4FIS A;  4JYK A;  5C3E J;  1X2M A;  1GT0 C;  3BG9 A;  1YRN A;  1AKH B;  2L7Z A;  2NVX J;  5IP9 J;  2CQX A;  1ETK A;  2MG4 A;  1H89 C;  5EZH A;  2JWT A;  2LLK A;  4Y7N J;  1Q1V A;  1ORK A;  5F27 A;  2K9S A;  1MBG A;  1G2H A;  1UHS A;  4UUS A;  1K83 J;  2DA2 A;  2VUM J;  5EF6 A;  4D7M A;  5FKK A;  1B72 A;  5C44 J;  4EEF G;  2LTP A;  5J1U A;  1R9T J;  3S1Q J;  5K7H A;  3G1M A;  2DA1 A;  4GFB A;  5M5X J;  5C4J J;  4AYB N;  2JA5 J;  1HOM A;  1NK3 P;  5IPA A;  2M0C A;  3H3V K;  1EF4 A;  1IDY A;  1GV5 A;  2AHQ A;  2Y2Z A;  3GTQ J;  2XPW A;  5IP6 A;  1ETW A;  1OCP A;  2X48 A;  2HOS A;  5C4X J;  3FIS A;  2DA3 A;  2DA4 A;  2EZH A;  3S1N J;  2ME0 A;  3HB9 A;  3C2B A;  4Y52 J;  1JJ6 C;  1H8A C;  3MVP A;  1IDZ A;  1Z77 A;  3A01 B;  2DN0 A;  3HGY A;  3CCY A;  4W1U A;  1TWG J;  1JKR C;  2HYJ A;  2LK2 A;  2TCT A;  1TWF J;  3OIO A;  1AHD P;  5M3F J;  2FX0 A;  4NDL A;  3JR9 A;  3LSP A;  3TED A;  4QSH A;  2XPV A;  1OFC X;  2H1K A;  1B8I B;  3GTK J;  4D5F A;  1OCT C;  3Q3S A;  4BBS J;  2DMT A;  3Q0W A;  1JTY A;  1Z0X A;  4X6A J;  4W97 A;  5IYB J;  3BT9 A;  2XGE A;  4MFD A;  1P7J A;  4FE4 A;  1T56 A;  1PUF B;  4XRS A;  1A6I A;  5M3M J;  1E3O C;  5F0F A;  4HNV A;  5J1R A;  4DZP A;  4A3G J;  4A3E J;  2DMP A;  2VI6 A;  5IP7 J;  1A5J A;  1VF9 A;  3K2A A;  2WV1 A;  1ZKG A;  1NK2 P;  1TWC J;  5FLM J;  3BQZ A;  2E19 A;  3I4M J;  2QF7 A;  3HOW J;  2FQ4 A;  1YRN B;  3NAU A;  1BJZ A;  3LSJ A;  5M5W J;  2G0E A;  4DZJ A;  1SFO J;  3S2D J;  3RZD J;  4M3B A;  1HDP A;  4A3K J;  1IUF A;  3RZO J;  1ZK8 A;  1DU0 A;  1ENH A;  3H0G J;  1ZQ3 P;  1MBF A;  4DYQ A;  2ZB9 A;  5E3O A;  2NOG A;  1FTZ A;  3HOX J;  2EBI A;  3JRI A;  3JRB A;  4UUS B;  4C2M J;  1MSE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...