1JKQC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*TP*AP*TP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkqC00
1MBEA 3F0CA 3TP3A 2L9RA 5IP7J 1X58A 5J1YA 2XGDA 5EG0B 3BTLA 4QTRA 5J3LA 3BG9A 4M3FA 2I10A 4V2FA 1VF9A 5K7ZA 1R9TJ 3ZQIA 3DEWA 1YRNB 1BW5A 1AHDP 4JX4A 5JLXA 1I3QJ 1XG1A 1ETYA 3C2BA 2D5VA 2XPWA 1K83J 3BR2A 4X1EA 5E3LA 2W48A 5C3EJ 5EG0A 3S2HJ 3GTLJ 2EQRA 2YU9J 1T33A 3GTQJ 1JJ8C 5F08A 1Z0XA 3IH2A 3OOUA 3CCYA 3RKQA 5E3NA 1RPWA 4RBOA 5HODA 3MVPA 3HOZJ 4D5FA 3NARA 3LSJA 4D5CA 2OF7A 1S7EA 4GFBA 1ZGWA 3CDLA 1K61A 3HOYJ 2HDDA 2P81A 4IHYA 1BJZA 1MBGA 4AYBN 2HXOA 5IPAA 9ANTA 2DMNA 2B63J 3BR6A 1XC5A 2ECBA 4A69C 4IEJA 4RDUA 3PM1A 3JRBA 2R5ZA 1IDZA 1IJWC 1ZR2A 3TW7A 2E2JJ 3RZDJ 3ZQHA 3GTPJ 1JUSA 2HOAA 5C4JJ 2FQ4A 3S1NJ 4A3BJ 2M8GX 4I76A 5IOYA 3CQZJ 2E19A 4B4CA 2E2HJ 2L7FP 1GT0C 2CUEA 1IUFA 5M5XJ 2NVQJ 3B6AA 2JA8J 1WPKA 4A3MJ 1JJ6C 2O8KA 1GVDA 2DMPA 1QPIA 3S14J 4A93J 2IBDA 3GTJJ 3G1MA 4M6VA 1IRZA 4JP0A 3OSFA 4MLOA 4BBSJ 4JX5A 3FISA 2QCOA 1RR7A 3BTJA 4AUXA 3SJMA 2CUFA 5F0HA 3ZQCA 3HOUJ 5FKOA 1LE8A 1GV5A 2LR8A 1W0UA 2LK2A 1WI3A 1H8AC 1MNMC 5EDNA 2K40A 2Y31A 1TWFJ 2DMQA 4BY1J 1X2MA 4M3EA 4MIMA 1H89C 1U78A 1I6HJ 1MH3A 5K7HA 4A3FJ 1GV2A 1UHSA 1MBFA 2LP0A 4IHXA 2CQXA 1ENHA 2ZB9A 2R0QC 3BQYA 2DA7A 3S1RJ 5M3FJ 1POGA 2L0KA 4FE7A 3RQIA 2JMWA 3M3YJ 3JRHA 1MSFC 1MBJA 2Y2ZA 1U9NA 2FJ1A 2JN6A 3G1OA 2VUMJ 3W6VA 3S1MJ 3QPSA 1JT6A 1GUUA 1A6IA 3JR9A 3QQAA 1ITYA 4C3HJ 2DMTA 1WH5A 3DCFA 3UKGA 1JKQC 4A3CJ 2HOSA 1AU7A 2YUSA 2DA6A 2L7MP 2N8GA 1RESA 3RZOJ 2GM4A 3JRFA 1VNDA 2JWTA 1PUFA 1ETOA 2HQ5A 2IEKA 1OCPA 2Y30A 3JRCA 1JKPC 3HDDA 4A3KJ 2RAEA 1QRYA 4BY7J 4IHVA 1HF0A 2ME6A 3WHCA 1NK3P 2AO9A 3A03A 1FEXA 2EBIA 4XICA 3PO2J 3JRGA 3HM5A 3ZQGA 4XIDA 2ID3A 5C4XJ 1MBHA 4XRSA 4W97A 5EF6A 3FKIJ 5FKLA 2K9NA 2R5ZB 1HLVA 2LD5A 3LSGA 1TWGJ 3Q3SA 3HKZN 4BBRJ 5IYCJ 1MSEC 4M3DA 4C3IJ 3IH3A 2WV1A 5J1UA 1OJLA 5IYDJ 3L1PA 4B1RA 3ZQLA 2EZHA 3HGGA 4HNVA 2MW8A 1JT0A 2ID6A 2JK3A 3HB9A 4W1UA 4FISA 1HDDC 4FE4A 3GTKJ 1WH7A 1B8IB 2NS7A 5FKMA 3LSRA 5GPCA 2M9HA 1IDYA 1B72B 1IGNA 2R92J 2X9DA 2EZIA 1ZTRA 2X6OA 1UG2A 2VPRA 5F0FA 4FTHA 4L5EA 4A3IJ 4B3AA 2XGEA 2NVTJ 2KDZA 2QF7A 4JX6A 3LSPA 2VKEA 2LLKA 1LE8B 1RKTA 5M5WJ 1B8IA 2JJ7A 5F27A 2LTPA 5IP9J 1B72A 4XK4A 2Y0SN 3HGYA 5EGOB 3O8GA 1ZQ3P 1EF4A 2DA2A 5IP6A 1ORKA 2NVYJ 3I4NJ 2O7OA 2AHQA 1FIPA 4CYCB 2HXIA 3FK6A 3D1NI 2MG4A 2R5YA 4S0HB 4FCYA 1HCRA 1W0TA 4V2GA 3MKLA 1WCMJ 5EGOA 1QVUA 4C3JJ 4QIWN 1TWAJ 3IH4A 1A5JA 1LFUP 2G0EA 1HDPA 5F0CA 4CYCA 1JKOC 2LY9A 5FJ8J 2Y9YA 1ZKGA 4EEFG 3S17J 3S2DJ 2NVXJ 3TW6A 2FX0A 4UUSB 1P7IA 1ETQA 2GLOA 3VPRA 2CU7A 2DA5A 1PUFB 4I6ZA 4DW6A 5M5YJ 5FLMJ 2IAIA 3NAUA 5DTDA 2XGCA 3B6CA 4UUTA 3WHBA 3BQZA 1ZR4A 1WGXA 3BT9A 2HI3A 1ETVA 3BTIA 5C44J 1H88C 2H1KA 2DA4A 3K2AA 5IOZA 3A01A 4UUSA 2TRTA 5DS9A 3LOCA 3G1LA 2K9QA 3OIOA 3JRDA 1Y1VJ 2WB1N 3M4OJ 2MGQA 1RKWA 1IG7A 4BKXA 2WAQN 4A3DJ 3LNQA 1JUMA 4M3BA 3A02A 3E7LA 2DJNA 3TP0A 1DU0A 3HOWJ 4Y52J 1FJLA 2XPVA 1VI0A 1F43A 4DZJA 4MFEA 2DN0A 1X2NA 3OSGA 2OPTA 2CQQA 1JTXA 4MFDA 1IV6A 2R7ZJ 3Q0WA 1GDTA 1SANA 4DYQA 1RETA 2ME0A 2LKXA 3S1QJ 3BR3A 1P7JA 1HOMA 4NDLA 1DU6A 3HEFA 3S16J 2H8RA 1FTTA 2COBA 3O8HA 3BR1A 4A3GJ 2O9LA 3S15J 2HYJA 3BG5A 2M2EA 5IYBJ 5M3MJ 5J1RA 2NS8A 1U8BA 4A3EJ 3JREA 1D5YA 1APLC 1BA5A 2CJJA 1Z77A 4XRMA 1O4XA 1JKRC 4C2MJ 2LFBA 1XS9A 1FIAA 2VI6A 1YRNA 3SDGA 1MBKA 2GBYA 1AKHB 3HOXJ 1ETWA 5EZHA 4ABZA 2L7ZA 3BR5A 4M3GA 3Q0VA 3TEDA 1BW6A 1F36A 2XB0X 1ZK8A 4G12A 4DYCA 1TC3C 4A3JJ 1I50J 4IHWA 3ZQFA 3IV5A 2TCTA 5FLVA 1E3OC 4JYKA 1Q1VA 3PO3J 5FKNA 1ETXA 2PMZN 2XB5A 5GPAA 2R5YB 1AKHA 2FD5A 3QPLA 5F04A 1LFBA 5JLWA 5F1JA 2KT0A 3K7AJ 3CMYA 2HOTA 5EYRA 3GTGJ 2R93J 4D7MA 2M0CA 3I4MJ 3HOVJ 2ECCA 2K9SA 4BXXJ 3BR0A 1NTCA 2DA1A 1OCTC 3BG3A 1U9OA 2JA6J 4DZPA 2DMUA 2M34A 2MSYA 5E3MA 5EEAA 2XSDC 1T56A 2JA5J 1UMQA 4QSHA 1IC8A 3FIWA 1JGGA 5EZGA 2Y9ZA 2XPUA 1TWCJ 4AC0A 2LVSA 2DTZA 2YS9A 5K7FA 4A3LJ 1MH4A 2EZKA 5FKKA 1OFCX 2NOGA 2EZLA 1TWHJ 1Y1WJ 3H3VK 2VKVA 2E1OA 3A01B 1QVTA 1FTZA 5BNGA 1BL0A 2CRGA 1CQTA 3JRAA 3HBLA 3GBGA 3Q0UA 1JTYA 1VFCA 3GTMJ 1JUPA 3SFIA 1G2HA 2ELKA 3ZOBA 4Y7NJ 1ETKA 3H0GJ 2EH3A 4DYRA 2XRLA 4J19A 4X6AJ 4D7NA 4MO7A 4LOCA 4XRSG 1NK2P 2DA3A 3GTOJ 2JA7J 1SFOJ 3MN2A 2X48A 3FK7A 3JRIA 5E3OA 5GP9A 2E2IJ 3BTCA
chains in the Genus database with same CATH superfamily
3GFJA 1Z67A 3L2QA 3K4LA 3F0CA 3L00A 2L9RA 4OAYA 4CCMA 1ZG5A 3IAM2 5J1YA 2A69F 4U0VA 5LFAA 5EG0B 3OS2A 4LD5A 3SHFA 2UV1A 2IT0A 4I01A 4BJ6C 1VF9A 3H5RA 2VQGA 3JSPA 2FBHA 5K7ZA 2VXZA 5ILVA 4ZYHA 1R9TJ 3EQLF 1YRNB 2JA2A 2HTSA 4KICA 4XQFA 1LVAA 5JLXA 2W84A 1ETYA 2W7NA 2ZXJA 1K83J 4ZZLA 2K4BA 2OUMA 2CV2A 3AKZA 2NNYA 2O61A 4OIPF 3BG6A 2KDOA 3DTEA 3S2HJ 4UUVA 2EQRA 2YU9J 3Q9VA 4ENNA 1G4DA 1TNSA 5F08A 4HV5A 1BOAA 3DBHB 1RPWA 1MGTA 2OTJI 3BC8A 3KETA 1J9IA 3LSIA 3MVPA 2Y75A 3I3LA 3F72A 1QHHD 1S7EA 2WAEA 3CUOA 3W3CA 4UHTA 3VYSB 4H4KC 4GFBA 1USTA 1YX5A 4MEXF 3HOYJ 2HDDA 1N78A 2P81A 4IHYA 1BJZA 3O3KA 4P5OA 3KLNA 4LG3A 2DMNA 3WTSC 4NC6A 3E6DA 3D5LA 3BR6A 1B9MA 3H92A 2GWRA 4AIJA 2R5ZA 1QBJA 1S5LC 2A6HF 1JE8A 3KLOA 2XDVA 4EJVA 2HOAA 5JHUA 3QYFA 2BY2A 2A07F 3MEXA 2WB1A 5DYMA 2DU9A 1LPQA 2QZ8A 2HQAA 2XF5A 4B4CA 4E7JA 1YS6A 2HS5A 4RB2C 2L9VA 2ZMEB 1MZBA 5JVGF 5M5XJ 3OMYA 4Y4RA 3B6AA 4F91B 1WPKA 4WCGA 3OL4A 3K2ZA 4HAMA 1JJ6C 2O8KA 1GVDA 3ISPA 4EV0A 3Q9SA 3G6EI 4OIRF 4BDYA 2ICWG 4HQMA 1IRZA 4HNTA 4MLOA 3RIRA 3WTXC 4AIDA 4BHBA 2B7EA 3MD2A 3WTTC 3BTJA 2EFNA 2O0YA 1R36A 4QWQA 1WJAA 4FHTA 5J4YA 5KNLA 2A3SA 1R7JA 3K9TA 1TW3A 4BS9A 4S04A 3ZQCA 2P5KA 3HOUJ 2FQ3A 1A35A 4ZC3A 1MNMC 3CJQB 5LBQA 2K40A 2DMQA 4CCJA 1X2MA 4M3EA 3GLLA 2JQ7A 4A12A 1FT9A 1LVKA 4HEA2 4A3FJ 1VQ9I 3B02A 4HSTA 4RM2A 2CQXA 1FBQA 2XAUA 4HF2A 1IRGA 3ZPLA 2MD0A 2STWA 2DA7A 2M4KA 3QODA 2HU9A 5M3FJ 3S1RJ 1T38A 1W5SA 1J59A 3PIOF 4RA2A 4XLNF 3DPTA 3RQIA 4A2UA 1DDNA 1MSFC 5FLXK 2Y2ZA 1RUOA 3GW2A 1FLIA 1U9NA 4IOAF 1MJBA 4HF0A 4B43A 1JT6A 2ZSIB 4A0XA 3IRQA 3RJPA 1WH5A 2DT7B 4JOMA 5IT9K 3UKGA 4RS8A 3ZP5A 3HHHA 3AFHA 2B9SA 1UB9A 2DA6A 2HTJA 2N8GA 2QM3A 1Y6IA 3DKXA 2COMA 3RZOJ 4A5MA 2GM4A 5LHHA 1VNDA 2ZJ2A 1FOWA 3GF2A 2FU4A 1PUFA 1PDNC 2HQ5A 1OCPA 2HNHA 3HDDA 3L7WA 4BY7J 4IHVA 3K70C 2K85A 2ME6A 2F4IA 4E7IA 3QYBA 2ESHA 3A03A 1R4MB 2EBIA 2JSPA 4XICA 1O3QA 1FEXA 4O6JA 3RTRA 4MGRA 2P6TA 4RAZA 4XIDA 2VOPA 2ID3A 1A04A 1W5CC 1U5TA 4L0ZB 1Z9CA 2F5EA 3HL2A 4W97A 5J40A 3F8CA 4JQFA 3FKIJ 2K9NA 1FBSA 2WADA 5ILUA 4U7BA 2P7CB 2R5ZB 1HLVA 2A68F 3Q3SA 4H0EA 2Z99A 1FYKA 1F5TA 3TO9A 1D0YA 4BXUA 3CO7C 4M3DA 5ERIA 5J1UA 2FEZA 1OJLA 1HW5A 1YIOA 3CCQI 2XRNA 4B1RA 2EZHA 2MW8A 3BPVA 1T98A 2JK3A 3HB9A 3KZIC 3UR3C 4RAGA 4I99C 4M6XA 3AG3H 2Q0OA 3EUKL 3T1BA 5FFZA 3QU3A 3CTAA 5GPCA 2M9HA 4HV6A 1JGSA 1IGNA 3J7AO 2EZIA 1ZTRA 3OYFA 2ZMEC 3G3ZA 2UXXA 4FTHA 2F48A 4A3IJ 2Q8KA 2XGEA 3JTGA 2WY8Q 2DYRH 1GLNA 3LSPA 1EH7A 2VPLA 3DLLF 3OYBA 4F52A 2MABA 1YITI 5KHDA 2F5DA 2F4OB 5EGOB 2DK8A 4RLQA 5KAFC 4EGYA 3I4NJ 2M0MA 2O7OA 3E6CC 2PX9A 2HZDA 2HXIA 1BIBA 4U0YA 2H1LA 2P8TA 3BP8A 2MG4A 1ON2A 2KZGA 4G6TB 3LA3A 1T08B 3WU2C 3H0DA 1WRJA 3HRMA 1VQ7I 1JHHA 4RGRA 4C3JJ 3ZN0A 4ZYGA 1XMKA 1FOYA 1TWAJ 1IN4A 1XCVA 3H5AA 3KCCA 4E7KA 3IH4A 2G0EA 5F0CA 4CYCA 1YYVA 1FSHA 1Z3XA 1Y39A 1ZKGA 2Q2EB 3S2DJ 1J2XA 2BYVE 2NVXJ 2FX0A 2TDXA 3PIPF 5CQGA 1XSDA 2RVCA 2GLOA 1V54H 5LEKA 2E5NA 2K4JA 3IWFA 2DA5A 3OYNA 3T8TA 1PUFB 2CFXA 1QPMA 4DW6A 5FLMJ 3IWZA 3NAUA 2IA1A 2LNBA 3OR1C 2IGMA 2IVMA 5DM7F 1ZR4A 1S29A 3BTIA 4HBLA 1QQIA 3GCMA 2OU2A 5IOZA 4UUSA 5DS9A 1YW7A 6PAXA 4XLCA 3I53A 4ZZDA 2JZYA 2MGQA 4YIFA 3I55I 1STZA 1X1CA 4HW0A 3I56I 4BKXA 3TO7A 3M1EA 1KZHA 1YX3A 5ICCA 1SFKA 3ONQA 2QSGX 3GWZA 3AL0B 2XGXA 5GAGJ 5LD2C 2XKPA 2P7VB 1D8JA 4BQQA 1T0FA 2ESNA 4I0AA 2GZWA 3H1CA 3HOWJ 3HRUA 1FJLA 1EH8A 3R0JA 4UY8I 1BC8C 2QBYB 4E7ZA 2I5UA 3FXJA 4RMNA 1SANA 2ME0A 1I5ZA 1U0JA 4P96A 3BR3A 2DDAA 1WKMA 1TL8A 3DEUA 2LBFA 1FTTA 2EK5A 5CPRB 2E7XA 1WHUA 2H09A 3BR1A 4ZDPA 4A3GJ 2O9LA 4DBQA 2K3FA 2R7TA 2HYJA 2GXBA 5J4VA 5J1RA 1U8BA 4A3EJ 3V8LA 3WGGA 2ZCWA 3ZRGA 5DM6F 1BA5A 3IHUA 1Z77A 5HOOA 3FDYA 1XS9A 4CGZA 1X1DA 4N9HA 3ZMSA 1EKEA 1N75A 1R00A 2KIQA 1ZELA 1AKHB 1ZYRF 4DIQA 2EIMH 5E79C 5KK1A 3BJOA 1R1TA 2HQRA 4I02A 1J75A 2DOEA 1F36A 3J7YJ 2K3PA 2DOAA 1E2XA 3L9FA 4A3JJ 3CZ6A 4ZTJA 4AM3A 3ZQFA 1E0EA 5J6XA 2M45A 2IW5A 1PP8F 1P4WA 3PO3J 5FKNA 2PMZN 4YIIA 1QZEA 5F04A 3BROA 5JLWA 2MC4A 3QYEA 2ZFUA 4I09A 4KITB 1V3FA 3GTGJ 2VBZA 4EJWA 3W6JB 3FBIB 3R4KA 2K27A 3GVAA 3GYHX 4BXFA 3VODA 3OYEA 2PMHA 3LSMA 3KP7A 4UVCA 1UELB 2EIJH 2FBKA 2M0CA 3S3MA 3HOVJ 3CUQA 1NH3A 1RRJA 2EIKH 4HDUA 1KONA 3L2UA 1V5EA 2XVCA 1LDJA 2JA6J 4D9JA 3GO5A 2DCEA 4Z6YA 1A31A 5E3MA 3EDPA 3W6KB 2M7BA 4PJMA 1IC8A 2D1VA 1P9QC 2Y9ZA 2WV0A 4HNUA 2LVSA 2DTZA 2YS9A 4ZH4F 5K7FA 3WTVC 2EZKA 2F5CA 4MQVA 1OFCX 2PI0A 4C2TA 1D1BA 2K7LA 4I98B 3CD6I 5K1YA 1FC3A 4KUMA 1F43A 1FTZA 4ETSA 2CRGA 1D3YA 3C2HA 4KIBA 2WBMA 1SAXA 3E0JB 3GBGA 2M7AA 3LQRA 4E70A 3PL8A 1VFCA 1JUPA 3ZOBA 3S3OA 1ONVA 2EH3A 1FP2A 4N4OB 1NG7A 2AQEA 3WU0A 1QHGA 1R1UA 2W4SA 2KZVA 4XOPA 2GXGA 2WWYA 2GAUA 3SZGA 4G6DA 4BEHA 4IOCF 1XPXA 3KYDB 4ENKA 3RKXA 1FMWA 2QVOA 5KVRA 1JHFA 4XLEA 4X6AJ 3QPHA 1ZGAA 2FRHA 2W1OA 5AIQA 1W36C 1IZ1A 4XRSG 1NK2P 2LC2A 1T95A 3GZNB 3C7JA 3O2PE 2ISZA 4N4NB 5LGNA 3AL0C 2X48A 2EILH 2LBFB 3JRIA 4OU0A 2ELJA 2KISA 3OIQA 3ZXSA 1OPCA 5IP7J 3V8JA 2XAHA 1YJNI 2XGDA 5H20A 5CYVA 1AWCA 1WI9A 3FXMA 4L9TA 2ACJA 4M3FA 3EETA 4V2FA 1TW2A 4LK0F 3RCOA 4R79A 4NQWB 2LSOA 1PYVA 4XN0A 3WTYC 3M9AA 1P6RA 1YG2A 3AG2H 1SAUA 1I3QJ 1N25A 2I8DA 4JX4A 5DD4A 2GQQA 2JT1A 3OYLA 3BR2A 2GIZA 5C3EJ 4DBRA 5EG0A 5FD6A 4I0BA 1IV8A 1TTYA 4RAFA 1ZAOA 4M9XA 5BS6A 1ZG1A 1JJ8C 1S7AA 2X4HA 4PSWA 2IS4A 2BV6A 3EYYA 4Q47A 1Z0XA 3IH2A 5D5XB 2MA3A 5AIPA 3RKQA 4Q4ZF 1W36D 1MMAA 5TISC 4RBOA 1DPRA 3HOZJ 2IJLA 3AAFA 3ECOA 2OF7A 1R5ID 2MD5A 2QKMB 1EV7A 1K61A 3E97A 3T8RA 3CCRI 5B5EC 1F1ZA 4YIRX 3NWSA 4AYBN 2KQRA 2XHKA 3CUQB 2B63J 2FUG2 1SEUA 3WTZA 4L9VA 3JRBA 3PM1A 2A61A 2LY2A 4IQ4A 1FYLA 4PZJA 5E1WA 1DP3A 2FQ4A 2IGKA 1X1BA 2FF4A 3CCMI 2JVHA 4B48A 1ULYA 3F8BA 2VC0A 2IS2A 5BPDA 1TT0A 2L7FP 4HF1A 4RB0A 2X0LA 1IUFA 2NVQJ 2LOOA 4Y13A 4ESJA 2JA8J 2DW4A 3PFYA 1T6SA 4IPAA 4PJNA 3S14J 1QPIA 1D8KA 3R0AA 3JAMK 1S72I 3G1MA 4TV7A 4M6VA 3OSFA 4BBSJ 4JX5A 4EM2A 1WJCA 3NRVA 2JUGA 4WF2A 3J81Z 3S93A 3V4GA 1BN5A 4EATA 4IZZA 3SJMA 3O6BB 4P9FA 2CWEA 1OKRA 2FNAA 3KEYA 5F0HA 3FXUA 3GZ5A 2PJPA 2P0WA 5DUKA 4BEHB 1GV5A 1W0UA 4AU7A 1WI3A 4GXOA 3DPLC 4KT6A 3SFZA 3VOEA 1BI3A 1XMXA 2L5QA 1TWFJ 3TOBA 1H89C 2V9KA 1TT5B 1LDKB 5BOXA 1L3LA 1MIJA 2CQ7A 1ZRDA 4IHXA 1GV2A 1UHSA 1UG0A 2ZKZA 2KRCA 4XLPF 3V7CA 1TZLA 1TNTA 2R0QC 1T0FC 3BQYA 3OYHA 4LFUA 3HSRA 4E7LA 2BHYA 2RREA 5GADJ 3QU6A 1SVLA 3ABUA 2R4GA 4NC8A 1T2KA 4OINF 3W6VA 2VUMJ 3QPSA 1DGRM 1FZPB 1GUUA 1A6IA 4BAYA 2LKSA 1MMGA 1G3YA 4KIGA 1ITYA 2DMTA 1O7LA 3HTUA 3KP4A 1IF1A 1W7PB 2YUSA 1Q1HA 1SMYF 2VASA 4GDFA 2XF7A 4RAYA 2Y0SA 3CC2I 2JWTA 2QEXI 2ZNZA 2MH2A 2X6WA 1AOYA 2YR2A 1WJFA 1XGMA 1QRYA 4M9SA 2ZBKA 3N05A 2JTVA 1VQLI 2DI3A 2OQRA 3SDBA 3QP5A 3WGHA 1YJ9I 3LSHA 3KEOA 2V6CA 2F4MB 1NHAA 4CH7A 1B9NA 3HM5A 3X2QH 2L2OA 3TDZC 4NC7A 2E7WA 2W25A 1G3TA 1E17A 1ON1A 2WAFA 3BG7A 3TBIA 2OD5A 1SVMA 3KYLA 1PVEA 1TWGJ 2XAJA 1R5GA 3DPUA 2R7DA 3F6OA 1IRFA 1O7FA 2PFBA 4C3IJ 3L1PA 3CUQC 3ZQLA 3HGGA 1F9NA 3M8JA 4W1UA 4FISA 1HDDC 5E20A 1MNEA 1TQPA 2NS7A 5FKMA 5IT3A 3GFMA 1IDYA 3BOQA 2X6OA 4BQAA 2AXLA 4N0BA 1VZ0A 3V7SA 3ZMTA 2VJ5A 2VPRA 1FPQA 4G94A 4L5EA 4CHUA 2VL8A 1J09A 3ASNH 4E4HA 1EJ9A 5L3FA 5JHFA 5CVUA 1H9TA 2VODA 3KP5A 2KDZA 2QF7A 3JTHA 1WSUA 2LLKA 2DODA 3BJAA 5M5WJ 4EM0B 2HQNA 4IJAA 1BR2A 3K1MA 1D0ZA 1KYWA 1S8NA 5ED4A 4OWRB 2VB6A 2OC6A 3L2CA 2NVYJ 2R7UA 3EPZA 3NEUA 2X1DA 2H6BA 2F5FA 5DUIA 4M73A 1FIPA 3FK6A 4Q5SF 1LFPA 1I3AA 2R7WA 2O03A 2STTA 2R5YA 3KIOA 5CKTA 4HSRA 2V7FA 4FCYA 1FMVA 3R60A 2KIMA 3MKLA 1WCMJ 3U21A 1QVUA 5EGOA 4ZTFA 2ZC2A 4QIWN 5JVTA 3COAC 1XDUA 2H6CA 4XSXF 2RN7A 1LFUP 1JKOC 2HZTA 2XASA 4YG2F 3TQNA 3U9GA 4XKVA 2V79A 3N4MA 1IUYA 1ZRCA 1P7IA 1ETQA 3PSFA 2L02A 2L01A 2WTEA 3VPRA 2RDPA 1GVJA 3HZJA 1MW7A 4I6ZA 1ZHFA 5DD8A 5DTDA 3TOAA 1YO5C 2XGCA 3PNTA 5D6FA 3B6CA 3WHBA 3BQZA 1HXDA 2IXSA 4UXNA 3N97A 5HDKA 1WGXA 3BT9A 2HI3A 4ZYEA 2OA4A 2Q2EA 2DA4A 2W24A 3E1SA 2DO7A 3OYJA 2TRTA 4RB1A 1G3WA 3OIOA 2K9QA 1OYIA 1Y1VJ 4LB5A 3CCEI 4KDPA 3M4OJ 3ZCOA 2BOLA 1R49A 3FXRA 3WODF 3FWEA 3J81K 4XM3A 3E7LA 5D8LB 4PJ0C 5D5WB 4Y52J 1B59A 3BZCA 1KA8A 2XPVA 3ZMDA 2RKHA 2GA2A 4M6YA 3T5XA 1HW1A 2CQQA 3OV8A 3J7ZI 3OYMA 2HVSA 3Q0WA 3VSKA 3H3ZA 3ZGKA 5BPIA 1FX7A 1RETA 1CF7B 2LKXA 2ISYA 3R61A 1WJ5A 1IN6A 4B3XA 1HOMA 2KHMA 3IP4B 4NDLA 1B6AA 1XMAA 1DU6A 1XSXA 2DPUA 4GYIA 1BI2A 3MKYB 1ZARA 3S15J 3BG5A 2QBYA 4BYYA 1ACIA 1OCCH 3MZ8A 1W7PD 3JREA 3SZTA 1D5YA 3E6BA 4L5IA 1APLC 5K5OA 3PJRA 4XRMA 1SFUA 5F64A 1O4XA 1I1SA 4C2MJ 2LFBA 1HQCA 1R22A 3CJTB 3GX4X 2KJCA 3PUBA 3LA7A 3WE2A 3OR2C 3P9IA 2VONA 1MBKA 1BBYA 3I5UA 4ON0A 4HX7A 4ABZA 1ZRFA 1JXSA 2R7XA 3ECHA 2DDBA 2L7ZA 4M3GA 2PG4A 5H6QA 1BW6A 4G12A 2XB0X 2O5RA 5B1AH 4XL9A 3M1CA 4FX4A 2XAQA 2OTLI 4GRIA 2GOXB 4KN4X 1E3OC 2Z3YA 1Y0NA 1Q1VA 4PK4A 2ETHA 2XB5A 5GPAA 2R5YB 3VDXA 1AKHA 3QPLA 3ABKH 4FETA 3LA2A 2FBIA 2OCEA 4BQNA 2HOTA 5EYRA 1HC8A 2K5CA 3EUHA 4D7MA 2F2EA 4KISA 4CA0A 2D1HA 4OOIA 4FQGA 3BR0A 4PFOA 3BG3A 2NVUB 1U9OA 1Z91A 4F55A 4DZPA 2DMUA 1VQNI 1TLHB 1UMQA 3FIWA 2R7RA 2LF7A 2XPUA 4AC0A 4F3QA 4A3LJ 3E6MA 2RNJA 3J80Z 2M4GA 3CJRB 1KU7A 3ML6A 2NOGA 2E1MB 3E5QA 4ITVA 3DKYA 2UUZA 3F6VA 2RC4A 2Z9OA 1A36A 1MJAA 3RPQA 1DUXC 1GXQA 1RI7A 3A1YA 5B3SH 2ZJRF 2HVRA 4XLAA 3F23A 1EH6A 2PN6A 2DFIA 2ZNYA 1JTYA 2XROA 3GTMJ 4I2OA 3SFIA 2L54A 2HEOA 3DU5A 3CF2A 4UNOA 1UJ8A 2BVMA 2FMLA 1SD4A 2JSCA 3DXJF 1TQIA 3ZQ7A 3I59B 4IX7A 4J19A 4BE1A 3PQJA 1A6QA 2X1CA 3HOTA 4XBFA 4CCOA 1X1AA 1S3JA 5FGMA 4MO7A 4Y3OA 1IAWA 2B0LA 4F92B 2G9WA 3PFIA 2HR3A 3MN2A 1SFOJ 1BOBA 5E18F 3CF5F 1QGPA 3FK7A 1YI2I 2KKOA 5E3OA 3GLXA 4R1HA 2E2IJ 5E8GA 2IS6A 5E1XA 2JUCA 4HLXA 4ZDOA 3TP3A 1IRXA 3VWBA 1K4SA 1KQ9A 2CV0A 1X58A 4I7HA 5D5VB 4EJOA 5DCFA 3OL3A 4FASD 1W5TA 5J8FA 4ENJA 2EPFA 3BG9A 1WFXA 2I10A 2GIVA 2X6XA 4BDZA 2DXIA 4E6KG 2M5WA 4AIKA 2VN2A 4F93B 3DEWA 2AS5F 1LKXA 1BW5A 3QWLA 1AHDP 1U8RA 4K2EA 5HNHA 3M7GA 2JVGA 1K79A 3WG7H 1XG1A 2OV7A 1RUNA 4JBAA 2D5VA 1RIOH 5E3LA 2VXDA 4A0YA 3GTLJ 3CESA 3GTQJ 2D2WA 2LG4A 4HOBA 5CVIA 3GFIA 1UZCA 1SVOA 2F6CA 4NQWA 2PLYA 1VQ6I 3LAJA 3IC7A 1I6XA 1DP7P 1G8XA 5HODA 3M07A 2A05A 4M9ZA 3LSJA 1Z6RA 1XSVA 3JW4A 4D5CA 4ZDLA 4B09A 1DQUA 1T8IA 4G9YA 4A6DA 2HKXA 2DT5A 3KZZA 1REPC 3WTUC 2PEXA 1UAAA 2G7HA 3HPHA 2HXOA 9ANTA 1N77A 4WK8F 4LG0B 3CLQA 4RDUA 4A69C 4PJJA 2FE3A 2R7VA 2BEOA 1IDZA 3QOPA 2E2JJ 3ZQHA 3GTPJ 2CS3A 3BZ6A 1FWZA 3DEEA 3I71A 3R6SA 3S1NJ 4M72A 4A3BJ 1FSEA 2M8GX 2NS0A 5IOYA 3NWTA 3CQZJ 2HDCA 4PCQA 5DV5A 2GXAA 1G6NA 1X4OA 1FYMA 5CQEA 1GT0C 2DOFA 1FNNA 3K0LA 2M1BA 1K4TA 4IHTA 3SQNA 3HRSA 3F3XA 2HFHA 2BBYA 1RZ4A 2IA2A 2BW3B 4A3MJ 2DMPA 4A93J 1R6RA 2IBDA 2R7FA 3GTJJ 3VYRB 1OCOH 3PQKA 4JP0A 2QUFA 1R1VA 4MHGA 3ROUA 2K86A 3FKJA 4BL0B 5L3CA 3FISA 2QCOA 1Z7UA 3MZYA 4U88A 2CW7A 3RKWA 3F21A 4IO9F 1WJBA 2WA0A 4MTEA 5F6FA 3RSNA 3IKTA 4O5VA 1U2WA 4CSWA 3ERED 2CW0F 4KNYA 3REOA 2LK2A 2CFOA 1KGSA 1QZYA 1H8AC 5EDNA 3HKZA 4BY1J 4MIMA 2ZSHB 2CW8A 1MBFA 1ZREA 1USSA 3TMOA 1ENHA 4QLCU 4HLYA 2Z2SB 1QA6A 2L9NA 4Q48A 4L9NA 1X1PA 2MH9A 4HA8A 5DCMA 2DK5A 2CMPA 1FY7A 2JMWA 1X4PA 3PSIA 1X3WB 3D0SA 3JRHA 1MBJA 2VJ4A 2O8XA 2EA2A 3K69A 3HPGA 3G1OA 1K6OA 3S3NA 3JR9A 3QQAA 3BJ6A 3GMEA 2BXYA 4PFPA 4C3HJ 2R7SA 3PNYA 3ZMUA 4DQ2A 2YX7A 4HYEA 2J5OA 1AU7A 3V8KA 3S8PA 3K4JA 3PUFA 4LIVA 1RESA 4RGSA 2G7UA 3SEQA 1KQ0A 3KX2A 3FMSA 1Y0UA 4PGHA 2QSHX 4KN7X 1CGPA 1ETOA 3MWMA 2PBIA 2Y30A 1JKPC 5D8KB 4LIUA 2DAOA 1W7PA 5ICGA 2E36A 3RDIA 3DLAA 3CCJI 1Y56A 2K02A 1Y8RB 2Z16A 3WHCA 1NK3P 1BR1A 2AO9A 3J80K 2HYFA 3MAJA 4WXDA 4KJZA 1IW7F 2AXTC 2E5ZA 4XORA 1YS7A 5CVRA 4CCNA 2VE9A 3LWFA 2UXNA 3AG4H 3SEZA 5TRDA 2NNNA 1MBHA 3A0BC 4UB8C 3ZMZA 4UVAA 3BPXA 5EF6A 2HYGD 5FO5A 2UZKA 3DV8A 4WWCA 1B1BA 4NNJA 5LRRA 2ZJPF 2CUZA 3OYDA 1VQMI 2LD5A 4OIQF 3LSGA 3FXLA 2BGCA 3GUDA 2VT2A 1XCBA 3IH3A 2ZJQF 3EUHC 1O3TA 2LYCA 1OQYA 5J8CA 4HNVA 1JT0A 4NBQA 4B44A 5L3BA 2V1DA 5E8IA 1LNWA 1XB4A 4Y33A 2C6YA 1WH7A 5BMZA 1B8IB 2L7KA 5HLGA 2QENA 2X1EA 3LSRA 3CC4I 1LJ9A 5GTHC 3F9KA 1B72B 2BHZA 2R92J 3ABLH 5LHIA 2NAZA 3KP6A 2E60A 1UG2A 3CLOA 5JR3A 2Z33A 3HTSB 4P1WA 1X19A 1HKSA 3H3UA 2K9LA 2LH9A 2P4WA 2NVTJ 3K1PA 3MMYB 3CCLI 3BWGA 2WAQA 1IN5A 3BZKA 4JX6A 2VKEA 1YFHA 1HA8A 3QAHA 1RNLA 3P9CA 2JRTA 2LTPA 4YFKF 2DPDA 4XK4A 3LFKA 2Y0SN 2F5VA 3O8GA 4IRHA 1ZQ3P 4HPQA 4BJTA 3J7AY 2DA2A 1ORKA 5BQTA 3K4CA 2IA0A 1D1CA 1XDSA 5ILSA 1MDMA 4BGDA 3H9JA 3SZPA 3D1NI 3FMRA 2ZXWH 5DCMB 1WVRA 3F8MA 2NRAC 3TDUC 3CCUI 4S0HB 3GFLA 1K78B 1HCRA 1W0TA 4QPQA 2J5PA 1MJ9A 4XN3A 3DBLB 2DT6A 3DF8A 3CCVI 1UFMA 1VTNC 2W85A 4PDKA 1BC7C 1P4AA 3GXOA 2R7QA 2VBYA 1A5JA 1HDPA 3DU6A 2LY9A 2W00A 1OR7A 3W2AA 3FF5A 4GO1A 1ERDA 1P2FA 1SC7A 3MKWB 3S17J 5ICEA 4YELA 2XF6A 3TW6A 2RQPA 5D4RA 1XGSA 2V4JC 3HJEA 2ELHA 3HIFA 3MKZA 2CU7A 3CO6C 3RYRA 4DNCA 4ZYAA 4F7ZA 2IAIA 1SFEA 4IXAA 3DKWA 1XX5A 4UUTA 4IVNA 5HDGA 4NUBA 5GTIC 1LQ1A 3LSTA 3OIPA 4KMUX 2CGPA 5C44J 1H88C 2H1KA 2CSOA 3H36A 3K2AA 2EFOA 3LOCA 2KFDA 3V7RA 3JRDA 1MMNA 4D1QA 2WB1N 2AQFA 4II2A 2LDUA 1RR8C 2BY3A 4XKWA 4ASNA 2XUBA 4A5NA 4A3DJ 1QZZA 2OAZA 3Q5FA 2OJED 3A02A 3HRTA 4M3BA 2QQ8A 2QSFX 2XAFA 1DU0A 5HLTA 1PUEE 3KP2A 1VI0A 1AA7A 2CQKA 4MFEA 2DN0A 1X2NA 5KCMA 3TO6A 4DZJA 5A2QZ 1R71A 5DDGA 1VQPI 1ZH5A 3W2VA 3JSOA 1R5HA 4MFDA 3OYIA 2H8WA 3S1QJ 2E71A 2EFQA 2EV6A 3CMMA 3MCZA 1HKTA 4LLLA 1FOKA 1WJEA 3S16J 1S9HA 2KMUA 2NYXA 2FMYA 3HG9A 2WY7Q 2COBA 1TBXA 3NQOA 5FB2A 4XONA 2M2EA 2HGCA 5M3MJ 1KU9A 2VIXA 5J47A 3TL4X 3ULQB 4EJUA 4RGXA 4YFXF 1CF7A 4M71A 4AVPA 4L9JA 2FXAA 3B73A 1FIAA 2VI6A 4WXCA 1FBUA 2GBYA 2QQAA 1I39A 2IGNA 2R7OA 3TEDA 1D1AA 2VLAA 2YX4A 2A6TA 5FFXA 1NG6A 1I50J 4IHWA 4YFNF 1MDMB 2TCTA 5FLVA 2VKDA 3CP2A 2E1CA 4L18B 3S32A 2V1UA 4C2UA 1QU3A 2FD5A 3ABMH 1WWXA 1HSJA 3FZVA 2KT0A 1MKMA 4RGUA 4NHJA 2E1NA 3FM5A 5HS7A 1QNTA 4C9YA 3L2WA 2BZTA 2L9SA 2KRFA 3I4MJ 3V42A 1E3PA 2K9SA 3HSFA 4XOTA 3DP7A 1OCTC 3L2RA 3FM3A 3OOPA 1BR4A 4XLHA 2UWMA 4BU2A 3GEZA 2M34A 2M87A 2FSWA 1XTAA 2NOJB 2RQQA 2H27A 2JA5J 3H5NA 4QSHA 1X3ZB 1JGGA 5EZGA 5JFRA 3E5XA 2M8EA 2CG4A 4G7HF 2BXZA 3QOEA 2EZLA 5AONA 3OS0A 3F22A 1Y1WJ 5DEQA 3H3VK 2VKVA 2E1OA 3UNGC 4BQOA 1HKQA 4CO8A 1QVTA 2OZ6A 2Q1ZB 3E5UA 1CQTA 4U87A 3JRAA 1IN7A 3ERMA 2P5VA 3QPTA 3RQ4A 3VB2A 1LDDA 1G2HA 4Y7NJ 1SD7A 2Z5UA 1ETKA 4L5JA 5ICFA 3T0YA 4DYRA 1VQ4I 3D5SC 1UHWA 1FOXA 2Y48A 2XRLA 3CMEI 3C18A 3G4SI 5HDNA 1S7OA 2LF8A 2IPQX 4IHSA 3KP3A 3P5JA 2MBFA 4CZCA 3GTOJ 1ZLKA 3DWLE 4ESBA 3H9QA 1I1GA 2A6EF 3I4PA 2VT3A 5GP9A 3BTCA 1QO0D 4KIFA 3I64A 2XC7A 3I59A 1YJWI 4XMYA 1MBEA 3U2RA 3CJNA 3CDHA 1YTYA 4PUSA 2ZO4A 3BTLA 3H9GA 4QTRA 5J3LA 3F8NA 4FT8A 1ZG3A 4PJLA 3ZQIA 3ZQQA 2JRMA 2XV4S 1X3UA 1OMIA 5LEJA 4UV8A 2QGUA 4ZJZA 2LKPA 2L4MA 1PJRA 2RNGA 1OISA 3C2BA 1I27A 2LY1A 2XPWA 2XIGA 4HDVA 4X1EA 1OCRH 2W48A 1SFXA 3U1KA 5EJCA 1T33A 3LAPA 3I0TA 3CMAI 3ESWB 2P5LC 3RI4A 1P92A 3F8FA 2IGOA 1VQ8I 4BE0A 1G59A 5EEGA 3FBNB 2KL4A 4GCVA 3OOUA 3CCYA 4II3A 4RLFA 2HWVA 4Y15A 5E3NA 4E7HA 3HHGA 2EINH 4D5FA 3NARA 2QKLB 2RV8A 3VSLA 3WU1B 4LLNA 1IXSB 1ZGWA 3KEQA 3CDLA 1PP7U 4XR6A 3KE2A 4ESFA 5LGUA 4YRVA 5LGTA 1MBGA 1C0WA 4GYGA 5IPAA 4S05A 1XC5A 2ECBA 2IP2A 2KIFA 4IEJA 2OBPA 5CVVA 3OYGA 1Z6TA 3C3WA 1IJWC 1ZR2A 3TW7A 3RZDJ 1JUSA 1FP1D 5LRSA 5C4JJ 4I76A 5K5QA 4KYWA 1EA3A 3P7NA 2E19A 2HDWA 2O6GE 2QA4I 4BUPA 2E2HJ 1YLFA 5A2QK 3K70D 1OR7C 2CUEA 4LG0A 1YIJI 3OWTA 1Z05A 2JPBA 4UB6C 3MFKA 2VQLA 4AWXB 1K6YA 2R3SA 3FXOA 1RR7A 3A0HC 1S6LA 2CUJA 3E3VA 3VEPA 4OAZA 3S2WA 2MLGA 4AUXA 1V5GA 2DFHA 5FRNA 2E34A 2CUFA 2VJIA 5LLQA 3K4KA 2YSRA 4B47A 5FKOA 1LE8A 5JI6A 2LR8A 2BW3A 2DJIA 4KT5C 4CCKA 3G2BA 3IUOA 3I54A 1YOVB 3BCBA 2Y31A 2VJJA 2HOEA 3D5RC 4JK1X 3ASOH 1U78A 2PMUA 2V1XA 4LMYA 1MH3A 1I6HJ 5K7HA 4FX0A 2LP0A 1J0RA 2Z1DA 2FNPA 4O3MA 2ZB9A 3VFZA 4P55A 1KU3A 5D5UB 3AG1H 1Y8QB 2PQ8A 4Z2YA 4CICA 1POGA 2L0KA 1R23A 2KP6A 4FE7A 3M3YJ 3H35A 2W57A 3M8FA 5CVJA 2VBXA 4MTDA 4G6QA 3VYUB 2FJ1A 4M74A 3QRFF 2JN6A 3HUGA 3DFGA 3S1MJ 2K9MA 4QPOA 1KU2A 1G3SA 2EV5A 3ZMVA 5GAEJ 2CH0A 2P6SA 1Z1DA 3DCFA 2BVLA 2DBBA 3SXYA 1OYYA 5GAHJ 1T39A 1JKQC 2BY1A 2CV1A 2HOSA 3IKVA 4DJAA 4A3CJ 3G71I 2L7MP 4V19K 3ELKA 3OYCA 4DGWB 1W1WE 4LJZF 3ZN1A 3JRFA 2E35A 3HC7A 1WQ2A 3P9KA 4HX4A 2IEKA 2XKOA 1U5TB 5HS9A 3JRCA 3OY9A 2JPCA 4A3KJ 5TJJA 2RAEA 5FD5A 4CXFA 1HF0A 2QQ9A 5E1ZB 3FX3A 5EEHA 3RYPA 4NB5A 3CCSI 4PGGA 3RPUD 2LRDA 3PO2J 1LEBA 4LGWA 3JRGA 1OLTA 2DTRA 2BY0A 3ZQGA 3K10A 3ZR8X 1YW9A 5C4XJ 4HG2A 4X0GA 4XRSA 5L3DA 3JAMZ 2XSJC 3BLYA 1D0XA 3GZ6A 1Z7LA 4BACA 5FKLA 2QWWA 5KAIC 1D5VA 3HKZN 4G8XA 4DOZA 4BBRJ 2EWNA 5IYCJ 2X85A 4ANJA 3U1DA 1MSEC 2WV1A 5IYDJ 2EB7A 5IY5H 2V1NA 4YEJA 1LB2A 2PJRA 2ZXIA 2L3DA 3DBRB 2ID6A 4Y17A 2HPMA 2M30A 4XRFA 1OYWA 2YU3A 2VKHA 4LITA 4FE4A 3GTKJ 1HBXG 2FOKA 1H9GA 1HW2A 2KPMA 2X6YA 3KZYA 4EQQA 4OIOF 3K4MA 4RB3C 1SD5A 2KJBA 2EJRA 1RC9A 2X9DA 3G73A 2BE5F 3FHZA 5F0FA 5D4SA 4B3AA 3W2WA 2V9PA 2VQCA 1GHCA 1LE8B 1RKTA 4R8HA 3WG9A 1B8IA 2JJ7A 4UV9A 5F27A 3K6GA 1XD7A 3LL7A 3LQQA 5IP9J 1B72A 4MNUA 4A0ZA 2DQRA 4MQ9F 3HGYA 2EV0A 1TP4A 1J7KA 1EF4A 1H0MA 1BI1A 1L0OC 3HYIA 5IP6A 4KMFA 3CDIA 2E1MC 3L09A 1WJDA 2AHQA 4A6EA 4D0PA 5H2FC 4CYCB 4C30A 4IRGA 5B66C 3IRRA 2MLKA 2FOWA 2X51A 1LEAA 4J00A 3FXKA 4WX9A 3K4BA 4V2GA 4HX8A 3HUGB 4PSXA 1VQKI 2KRHA 3PNVA 1WZ2A 3KPHA 5HS8A 1IN8A 1IXRC 2EFWA 5FJ8J 1ZLJA 2Y69H 2Y9YA 4EEFG 1O3SA 3WGIA 5L3EA 4UUSB 4J01A 1U6GA 1K78A 3A4CA 2ADUA 4XNFA 2A5YB 1U3EM 1E3HA 4XSZF 4G7ZF 1YHQI 4BJ5C 5M5YJ 3EUAA 4MEYF 1UHMA 2A5WA 1B4AA 4GGGA 5CJ9A 2DFEA 5L3GA 4BE2A 1O57A 4LB6B 2HKOA 4XKCA 3K4NA 4HRIA 3IAS2 1IXCA 4OMYA 5B1BH 2PMZA 1ETVA 3DTKA 2WC2A 4RM3A 2DQLA 4CUGA 3A01A 3SYTA 2W82A 5K5RA 5HLHA 3G1LA 1JI8A 3ABTA 1YW8A 1U5TC 2V9VA 1RKWA 2OCCH 1IG7A 3BY6A 1BJAA 2WAQN 4HQEA 2V6EA 5HNFA 3LNQA 1UCRA 1JUMA 3IL2A 1M1EB 1XGNA 1R58A 2DJNA 3TP0A 4AIHA 1LUJB 2ZXHA 4EM1A 2L4AA 5H6RA 1MMSA 1F4KA 4IRIA 3VYTB 3OSGA 2MC3A 2OPTA 3EYIA 1JTXA 1IV6A 2R7ZJ 1K7AA 2PJRB 4DYQA 2NXNB 1P7JA 2LMDA 1V4RA 2HVQA 4EJTA 3HEFA 3HXLA 2H8RA 3C1DA 3FXQA 1IO2A 1V55H 3O8HA 3LFUA 2HPIA 5E17F 3WE3A 2KIUA 3FHNA 5IYBJ 1ZGJA 1XGOA 2NS8A 3TGNA 1DPUA 4BHCA 2GA1A 4IL6C 2FA5A 1W4MA 2CJJA 4BH9A 1DGWY 5FRMA 1JKRC 4BNCA 1KYZA 4CZZA 1YRNA 3OS1A 3SDGA 4LK1F 2M3AA 1KQ8A 2LREA 3HOXJ 1ETWA 2H94A 3KYCB 2QYOA 5EZHA 4ZYDA 3QP6A 3BR5A 1GDTA 1VQ5I 2Y0MA 3Q0VA 1TC3C 3BDDA 1ZK8A 1OCZH 4DYCA 3TKYA 2IRFG 2VC1A 4KA4A 4IKFA 1MD0A 3OYAA 2V26A 3IV5A 4BHPA 2D45A 5FLXZ 4ENMA 4EMSA 4JYKA 4CCLA 2DLLA 1ETXA 2VE8A 3I58A 1SMTA 1P4XA 3MZHA 5TGTA 4UVBA 1LFBA 2OQGA 5F1JA 3K7AJ 3MQ0A 4EVIA 3CMYA 5IT9Z 1MNDA 3DQVC 4WXHA 3LSKA 2R93J 3DTIA 4E7SA 5D6EA 1Z21A 2DYSH 2ECCA 2CO5A 4AD9A 2CQNA 4BXXJ 4XKBA 2DFFA 1NTCA 5HVQC 2DA1A 2EA4A 2VBWA 2GOMA 4U0WA 2ZFWA 2CYYA 2RGVA 3FMQA 2MSYA 3JCUC 2XSDC 5EEAA 1T56A 1ODDA 1R4NB 3HOSA 1XN7A 5HLIA 4IF4A 3BCAA 1Z3YA 3C2GA 1TWCJ 3CC7I 3HSEA 2YPRA 5CLSA 1BIAA 2ZMEA 1MH4A 2QQBA 4B8XA 3WTWC 2EFPA 4LLGF 5FKKA 3OYKA 3LMMA 1BM9A 1TWHJ 4CYDA 5F1RA 1YE9A 4HZFA 3A01B 1YQAA 3CP8A 1TQMA 4N9IA 5BNGA 1BL0A 4L0YB 4OMZA 1HSTA 2MFZA 3HBLA 3Q0UA 1ZN2A 4U7DA 4IQJA 1J5YA 2OZUA 4G7OF 2ELKA 5LHGA 3A2KA 3H0GJ 1O3RA 4AYBA 2MYSA 3K1NA 5FROA 1MMDA 1V5FA 2VOOA 2IS1A 4P9UA 3I9V2 1VQOI 2VQHA 3M8EA 4CDGA 3KFWX 1GXPA 4D7NA 2QLZA 2XAGA 4EGZA 4LOCA 3L2VA 1BI0A 2DA3A 2O3FA 2JA7J 3RKYA 4XLFA 2KLOA 3RPUA 4AVZA 1SD6A 4KFCA
chains in the Genus database with same CATH topology
1MBEA 3F0CA 3TP3A 2L9RA 5IP7J 1X58A 5J1YA 2XGDA 5EG0B 3BTLA 4QTRA 5J3LA 3BG9A 4M3FA 2I10A 4V2FA 1VF9A 5K7ZA 1R9TJ 3ZQIA 3DEWA 1YRNB 1BW5A 1AHDP 4JX4A 5JLXA 1I3QJ 1XG1A 1ETYA 3C2BA 2D5VA 2XPWA 1K83J 3BR2A 4X1EA 5E3LA 2W48A 5C3EJ 5EG0A 3S2HJ 3GTLJ 2EQRA 2YU9J 1T33A 3GTQJ 1JJ8C 5F08A 1Z0XA 3IH2A 3OOUA 3CCYA 3RKQA 5E3NA 1RPWA 4RBOA 5HODA 3MVPA 3HOZJ 4D5FA 3NARA 3LSJA 4D5CA 2OF7A 1S7EA 4GFBA 1ZGWA 3CDLA 1K61A 3HOYJ 2HDDA 2P81A 4IHYA 1BJZA 1MBGA 4AYBN 2HXOA 5IPAA 9ANTA 2DMNA 2B63J 3BR6A 1XC5A 2ECBA 4A69C 4IEJA 4RDUA 3PM1A 3JRBA 2R5ZA 1IDZA 1IJWC 1ZR2A 3TW7A 2E2JJ 3RZDJ 3ZQHA 3GTPJ 1JUSA 2HOAA 5C4JJ 2FQ4A 3S1NJ 4A3BJ 2M8GX 4I76A 5IOYA 3CQZJ 2E19A 4B4CA 2E2HJ 2L7FP 1GT0C 2CUEA 1IUFA 5M5XJ 2NVQJ 3B6AA 2JA8J 1WPKA 4A3MJ 1JJ6C 2O8KA 1GVDA 2DMPA 1QPIA 3S14J 4A93J 2IBDA 3GTJJ 3G1MA 4M6VA 1IRZA 4JP0A 3OSFA 4MLOA 4BBSJ 4JX5A 3FISA 2QCOA 1RR7A 3BTJA 4AUXA 3SJMA 2CUFA 5F0HA 3ZQCA 3HOUJ 5FKOA 1LE8A 1GV5A 2LR8A 1W0UA 2LK2A 1WI3A 1H8AC 1MNMC 5EDNA 2K40A 2Y31A 1TWFJ 2DMQA 4BY1J 1X2MA 4M3EA 4MIMA 1H89C 1U78A 1I6HJ 1MH3A 5K7HA 4A3FJ 1GV2A 1UHSA 1MBFA 2LP0A 4IHXA 2CQXA 1ENHA 2ZB9A 2R0QC 3BQYA 2DA7A 3S1RJ 5M3FJ 1POGA 2L0KA 4FE7A 3RQIA 2JMWA 3M3YJ 3JRHA 1MSFC 1MBJA 2Y2ZA 1U9NA 2FJ1A 2JN6A 3G1OA 2VUMJ 3W6VA 3S1MJ 3QPSA 1JT6A 1GUUA 1A6IA 3JR9A 3QQAA 1ITYA 4C3HJ 2DMTA 1WH5A 3DCFA 3UKGA 1JKQC 4A3CJ 2HOSA 1AU7A 2YUSA 2DA6A 2L7MP 2N8GA 1RESA 3RZOJ 2GM4A 3JRFA 1VNDA 2JWTA 1PUFA 1ETOA 2HQ5A 2IEKA 1OCPA 2Y30A 3JRCA 1JKPC 3HDDA 4A3KJ 2RAEA 1QRYA 4BY7J 4IHVA 1HF0A 2ME6A 3WHCA 1NK3P 2AO9A 3A03A 1FEXA 2EBIA 4XICA 3PO2J 3JRGA 3HM5A 3ZQGA 4XIDA 2ID3A 5C4XJ 1MBHA 4XRSA 4W97A 5EF6A 3FKIJ 5FKLA 2K9NA 2R5ZB 1HLVA 2LD5A 3LSGA 1TWGJ 3Q3SA 3HKZN 4BBRJ 5IYCJ 1MSEC 4M3DA 4C3IJ 3IH3A 2WV1A 5J1UA 1OJLA 5IYDJ 3L1PA 4B1RA 3ZQLA 2EZHA 3HGGA 4HNVA 2MW8A 1JT0A 2ID6A 2JK3A 3HB9A 4W1UA 4FISA 1HDDC 4FE4A 3GTKJ 1WH7A 1B8IB 2NS7A 5FKMA 3LSRA 5GPCA 2M9HA 1IDYA 1B72B 1IGNA 2R92J 2X9DA 2EZIA 1ZTRA 2X6OA 1UG2A 2VPRA 5F0FA 4FTHA 4L5EA 4A3IJ 4B3AA 2XGEA 2NVTJ 2KDZA 2QF7A 4JX6A 3LSPA 2VKEA 2LLKA 1LE8B 1RKTA 5M5WJ 1B8IA 2JJ7A 5F27A 2LTPA 5IP9J 1B72A 4XK4A 2Y0SN 3HGYA 5EGOB 3O8GA 1ZQ3P 1EF4A 2DA2A 5IP6A 1ORKA 2NVYJ 3I4NJ 2O7OA 2AHQA 1FIPA 4CYCB 2HXIA 3FK6A 3D1NI 2MG4A 2R5YA 4S0HB 4FCYA 1HCRA 1W0TA 4V2GA 3MKLA 1WCMJ 5EGOA 1QVUA 4C3JJ 4QIWN 1TWAJ 3IH4A 1A5JA 1LFUP 2G0EA 1HDPA 5F0CA 4CYCA 1JKOC 2LY9A 5FJ8J 2Y9YA 1ZKGA 4EEFG 3S17J 3S2DJ 2NVXJ 3TW6A 2FX0A 4UUSB 1P7IA 1ETQA 2GLOA 3VPRA 2CU7A 2DA5A 1PUFB 4I6ZA 4DW6A 5M5YJ 5FLMJ 2IAIA 3NAUA 5DTDA 2XGCA 3B6CA 4UUTA 3WHBA 3BQZA 1ZR4A 1WGXA 3BT9A 2HI3A 1ETVA 3BTIA 5C44J 1H88C 2H1KA 2DA4A 3K2AA 5IOZA 3A01A 4UUSA 2TRTA 5DS9A 3LOCA 3G1LA 2K9QA 3OIOA 3JRDA 1Y1VJ 2WB1N 3M4OJ 2MGQA 1RKWA 1IG7A 4BKXA 2WAQN 4A3DJ 3LNQA 1JUMA 4M3BA 3A02A 3E7LA 2DJNA 3TP0A 1DU0A 3HOWJ 4Y52J 1FJLA 2XPVA 1VI0A 1F43A 4DZJA 4MFEA 2DN0A 1X2NA 3OSGA 2OPTA 2CQQA 1JTXA 4MFDA 1IV6A 2R7ZJ 3Q0WA 1GDTA 1SANA 4DYQA 1RETA 2ME0A 2LKXA 3S1QJ 3BR3A 1P7JA 1HOMA 4NDLA 1DU6A 3HEFA 3S16J 2H8RA 1FTTA 2COBA 3O8HA 3BR1A 4A3GJ 2O9LA 3S15J 2HYJA 3BG5A 2M2EA 5IYBJ 5M3MJ 5J1RA 2NS8A 1U8BA 4A3EJ 3JREA 1D5YA 1APLC 1BA5A 2CJJA 1Z77A 4XRMA 1O4XA 1JKRC 4C2MJ 2LFBA 1XS9A 1FIAA 2VI6A 1YRNA 3SDGA 1MBKA 2GBYA 1AKHB 3HOXJ 1ETWA 5EZHA 4ABZA 2L7ZA 3BR5A 4M3GA 3Q0VA 3TEDA 1BW6A 1F36A 2XB0X 1ZK8A 4G12A 4DYCA 1TC3C 4A3JJ 1I50J 4IHWA 3ZQFA 3IV5A 2TCTA 5FLVA 1E3OC 4JYKA 1Q1VA 3PO3J 5FKNA 1ETXA 2PMZN 2XB5A 5GPAA 2R5YB 1AKHA 2FD5A 3QPLA 5F04A 1LFBA 5JLWA 5F1JA 2KT0A 3K7AJ 3CMYA 2HOTA 5EYRA 3GTGJ 2R93J 4D7MA 2M0CA 3I4MJ 3HOVJ 2ECCA 2K9SA 4BXXJ 3BR0A 1NTCA 2DA1A 1OCTC 3BG3A 1U9OA 2JA6J 4DZPA 2DMUA 2M34A 2MSYA 5E3MA 5EEAA 2XSDC 1T56A 2JA5J 1UMQA 4QSHA 1IC8A 3FIWA 1JGGA 5EZGA 2Y9ZA 2XPUA 1TWCJ 4AC0A 2LVSA 2DTZA 2YS9A 5K7FA 4A3LJ 1MH4A 2EZKA 5FKKA 1OFCX 2NOGA 2EZLA 1TWHJ 1Y1WJ 3H3VK 2VKVA 2E1OA 3A01B 1QVTA 1FTZA 5BNGA 1BL0A 2CRGA 1CQTA 3JRAA 3HBLA 3GBGA 3Q0UA 1JTYA 1VFCA 3GTMJ 1JUPA 3SFIA 1G2HA 2ELKA 3ZOBA 4Y7NJ 1ETKA 3H0GJ 2EH3A 4DYRA 2XRLA 4J19A 4X6AJ 4D7NA 4MO7A 4LOCA 4XRSG 1NK2P 2DA3A 3GTOJ 2JA7J 1SFOJ 3MN2A 2X48A 3FK7A 3JRIA 5E3OA 5GP9A 2E2IJ 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBE A;  3F0C A;  3TP3 A;  2L9R A;  5IP7 J;  1X58 A;  5J1Y A;  2XGD A;  5EG0 B;  3BTL A;  4QTR A;  5J3L A;  3BG9 A;  4M3F A;  2I10 A;  4V2F A;  1VF9 A;  5K7Z A;  1R9T J;  3ZQI A;  3DEW A;  1YRN B;  1BW5 A;  1AHD P;  4JX4 A;  5JLX A;  1I3Q J;  1XG1 A;  1ETY A;  3C2B A;  2D5V A;  2XPW A;  1K83 J;  3BR2 A;  4X1E A;  5E3L A;  2W48 A;  5C3E J;  5EG0 A;  3S2H J;  3GTL J;  2EQR A;  2YU9 J;  1T33 A;  3GTQ J;  1JJ8 C;  5F08 A;  1Z0X A;  3IH2 A;  3OOU A;  3CCY A;  3RKQ A;  5E3N A;  1RPW A;  4RBO A;  5HOD A;  3MVP A;  3HOZ J;  4D5F A;  3NAR A;  3LSJ A;  4D5C A;  2OF7 A;  1S7E A;  4GFB A;  1ZGW A;  3CDL A;  1K61 A;  3HOY J;  2HDD A;  2P81 A;  4IHY A;  1BJZ A;  1MBG A;  4AYB N;  2HXO A;  5IPA A;  9ANT A;  2DMN A;  2B63 J;  3BR6 A;  1XC5 A;  2ECB A;  4A69 C;  4IEJ A;  4RDU A;  3PM1 A;  3JRB A;  2R5Z A;  1IDZ A;  1IJW C;  1ZR2 A;  3TW7 A;  2E2J J;  3RZD J;  3ZQH A;  3GTP J;  1JUS A;  2HOA A;  5C4J J;  2FQ4 A;  3S1N J;  4A3B J;  2M8G X;  4I76 A;  5IOY A;  3CQZ J;  2E19 A;  4B4C A;  2E2H J;  2L7F P;  1GT0 C;  2CUE A;  1IUF A;  5M5X J;  2NVQ J;  3B6A A;  2JA8 J;  1WPK A;  4A3M J;  1JJ6 C;  2O8K A;  1GVD A;  2DMP A;  1QPI A;  3S14 J;  4A93 J;  2IBD A;  3GTJ J;  3G1M A;  4M6V A;  1IRZ A;  4JP0 A;  3OSF A;  4MLO A;  4BBS J;  4JX5 A;  3FIS A;  2QCO A;  1RR7 A;  3BTJ A;  4AUX A;  3SJM A;  2CUF A;  5F0H A;  3ZQC A;  3HOU J;  5FKO A;  1LE8 A;  1GV5 A;  2LR8 A;  1W0U A;  2LK2 A;  1WI3 A;  1H8A C;  1MNM C;  5EDN A;  2K40 A;  2Y31 A;  1TWF J;  2DMQ A;  4BY1 J;  1X2M A;  4M3E A;  4MIM A;  1H89 C;  1U78 A;  1I6H J;  1MH3 A;  5K7H A;  4A3F J;  1GV2 A;  1UHS A;  1MBF A;  2LP0 A;  4IHX A;  2CQX A;  1ENH A;  2ZB9 A;  2R0Q C;  3BQY A;  2DA7 A;  3S1R J;  5M3F J;  1POG A;  2L0K A;  4FE7 A;  3RQI A;  2JMW A;  3M3Y J;  3JRH A;  1MSF C;  1MBJ A;  2Y2Z A;  1U9N A;  2FJ1 A;  2JN6 A;  3G1O A;  2VUM J;  3W6V A;  3S1M J;  3QPS A;  1JT6 A;  1GUU A;  1A6I A;  3JR9 A;  3QQA A;  1ITY A;  4C3H J;  2DMT A;  1WH5 A;  3DCF A;  3UKG A;  1JKQ C;  4A3C J;  2HOS A;  1AU7 A;  2YUS A;  2DA6 A;  2L7M P;  2N8G A;  1RES A;  3RZO J;  2GM4 A;  3JRF A;  1VND A;  2JWT A;  1PUF A;  1ETO A;  2HQ5 A;  2IEK A;  1OCP A;  2Y30 A;  3JRC A;  1JKP C;  3HDD A;  4A3K J;  2RAE A;  1QRY A;  4BY7 J;  4IHV A;  1HF0 A;  2ME6 A;  3WHC A;  1NK3 P;  2AO9 A;  3A03 A;  1FEX A;  2EBI A;  4XIC A;  3PO2 J;  3JRG A;  3HM5 A;  3ZQG A;  4XID A;  2ID3 A;  5C4X J;  1MBH A;  4XRS A;  4W97 A;  5EF6 A;  3FKI J;  5FKL A;  2K9N A;  2R5Z B;  1HLV A;  2LD5 A;  3LSG A;  1TWG J;  3Q3S A;  3HKZ N;  4BBR J;  5IYC J;  1MSE C;  4M3D A;  4C3I J;  3IH3 A;  2WV1 A;  5J1U A;  1OJL A;  5IYD J;  3L1P A;  4B1R A;  3ZQL A;  2EZH A;  3HGG A;  4HNV A;  2MW8 A;  1JT0 A;  2ID6 A;  2JK3 A;  3HB9 A;  4W1U A;  4FIS A;  1HDD C;  4FE4 A;  3GTK J;  1WH7 A;  1B8I B;  2NS7 A;  5FKM A;  3LSR A;  5GPC A;  2M9H A;  1IDY A;  1B72 B;  1IGN A;  2R92 J;  2X9D A;  2EZI A;  1ZTR A;  2X6O A;  1UG2 A;  2VPR A;  5F0F A;  4FTH A;  4L5E A;  4A3I J;  4B3A A;  2XGE A;  2NVT J;  2KDZ A;  2QF7 A;  4JX6 A;  3LSP A;  2VKE A;  2LLK A;  1LE8 B;  1RKT A;  5M5W J;  1B8I A;  2JJ7 A;  5F27 A;  2LTP A;  5IP9 J;  1B72 A;  4XK4 A;  2Y0S N;  3HGY A;  5EGO B;  3O8G A;  1ZQ3 P;  1EF4 A;  2DA2 A;  5IP6 A;  1ORK A;  2NVY J;  3I4N J;  2O7O A;  2AHQ A;  1FIP A;  4CYC B;  2HXI A;  3FK6 A;  3D1N I;  2MG4 A;  2R5Y A;  4S0H B;  4FCY A;  1HCR A;  1W0T A;  4V2G A;  3MKL A;  1WCM J;  5EGO A;  1QVU A;  4C3J J;  4QIW N;  1TWA J;  3IH4 A;  1A5J A;  1LFU P;  2G0E A;  1HDP A;  5F0C A;  4CYC A;  1JKO C;  2LY9 A;  5FJ8 J;  2Y9Y A;  1ZKG A;  4EEF G;  3S17 J;  3S2D J;  2NVX J;  3TW6 A;  2FX0 A;  4UUS B;  1P7I A;  1ETQ A;  2GLO A;  3VPR A;  2CU7 A;  2DA5 A;  1PUF B;  4I6Z A;  4DW6 A;  5M5Y J;  5FLM J;  2IAI A;  3NAU A;  5DTD A;  2XGC A;  3B6C A;  4UUT A;  3WHB A;  3BQZ A;  1ZR4 A;  1WGX A;  3BT9 A;  2HI3 A;  1ETV A;  3BTI A;  5C44 J;  1H88 C;  2H1K A;  2DA4 A;  3K2A A;  5IOZ A;  3A01 A;  4UUS A;  2TRT A;  5DS9 A;  3LOC A;  3G1L A;  2K9Q A;  3OIO A;  3JRD A;  1Y1V J;  2WB1 N;  3M4O J;  2MGQ A;  1RKW A;  1IG7 A;  4BKX A;  2WAQ N;  4A3D J;  3LNQ A;  1JUM A;  4M3B A;  3A02 A;  3E7L A;  2DJN A;  3TP0 A;  1DU0 A;  3HOW J;  4Y52 J;  1FJL A;  2XPV A;  1VI0 A;  1F43 A;  4DZJ A;  4MFE A;  2DN0 A;  1X2N A;  3OSG A;  2OPT A;  2CQQ A;  1JTX A;  4MFD A;  1IV6 A;  2R7Z J;  3Q0W A;  1GDT A;  1SAN A;  4DYQ A;  1RET A;  2ME0 A;  2LKX A;  3S1Q J;  3BR3 A;  1P7J A;  1HOM A;  4NDL A;  1DU6 A;  3HEF A;  3S16 J;  2H8R A;  1FTT A;  2COB A;  3O8H A;  3BR1 A;  4A3G J;  2O9L A;  3S15 J;  2HYJ A;  3BG5 A;  2M2E A;  5IYB J;  5M3M J;  5J1R A;  2NS8 A;  1U8B A;  4A3E J;  3JRE A;  1D5Y A;  1APL C;  1BA5 A;  2CJJ A;  1Z77 A;  4XRM A;  1O4X A;  1JKR C;  4C2M J;  2LFB A;  1XS9 A;  1FIA A;  2VI6 A;  1YRN A;  3SDG A;  1MBK A;  2GBY A;  1AKH B;  3HOX J;  1ETW A;  5EZH A;  4ABZ A;  2L7Z A;  3BR5 A;  4M3G A;  3Q0V A;  3TED A;  1BW6 A;  1F36 A;  2XB0 X;  1ZK8 A;  4G12 A;  4DYC A;  1TC3 C;  4A3J J;  1I50 J;  4IHW A;  3ZQF A;  3IV5 A;  2TCT A;  5FLV A;  1E3O C;  4JYK A;  1Q1V A;  3PO3 J;  5FKN A;  1ETX A;  2PMZ N;  2XB5 A;  5GPA A;  2R5Y B;  1AKH A;  2FD5 A;  3QPL A;  5F04 A;  1LFB A;  5JLW A;  5F1J A;  2KT0 A;  3K7A J;  3CMY A;  2HOT A;  5EYR A;  3GTG J;  2R93 J;  4D7M A;  2M0C A;  3I4M J;  3HOV J;  2ECC A;  2K9S A;  4BXX J;  3BR0 A;  1NTC A;  2DA1 A;  1OCT C;  3BG3 A;  1U9O A;  2JA6 J;  4DZP A;  2DMU A;  2M34 A;  2MSY A;  5E3M A;  5EEA A;  2XSD C;  1T56 A;  2JA5 J;  1UMQ A;  4QSH A;  1IC8 A;  3FIW A;  1JGG A;  5EZG A;  2Y9Z A;  2XPU A;  1TWC J;  4AC0 A;  2LVS A;  2DTZ A;  2YS9 A;  5K7F A;  4A3L J;  1MH4 A;  2EZK A;  5FKK A;  1OFC X;  2NOG A;  2EZL A;  1TWH J;  1Y1W J;  3H3V K;  2VKV A;  2E1O A;  3A01 B;  1QVT A;  1FTZ A;  5BNG A;  1BL0 A;  2CRG A;  1CQT A;  3JRA A;  3HBL A;  3GBG A;  3Q0U A;  1JTY A;  1VFC A;  3GTM J;  1JUP A;  3SFI A;  1G2H A;  2ELK A;  3ZOB A;  4Y7N J;  1ETK A;  3H0G J;  2EH3 A;  4DYR A;  2XRL A;  4J19 A;  4X6A J;  4D7N A;  4MO7 A;  4LOC A;  4XRS G;  1NK2 P;  2DA3 A;  3GTO J;  2JA7 J;  1SFO J;  3MN2 A;  2X48 A;  3FK7 A;  3JRI A;  5E3O A;  5GP9 A;  2E2I J;  3BTC A; 
#chains in the Genus database with same CATH topology
 3GFJ A;  1Z67 A;  3L2Q A;  3K4L A;  3F0C A;  3L00 A;  2L9R A;  4OAY A;  4CCM A;  1ZG5 A;  3IAM 2;  5J1Y A;  2A69 F;  4U0V A;  5LFA A;  5EG0 B;  3OS2 A;  4LD5 A;  3SHF A;  2UV1 A;  2IT0 A;  4I01 A;  4BJ6 C;  1VF9 A;  3H5R A;  2VQG A;  3JSP A;  2FBH A;  5K7Z A;  2VXZ A;  5ILV A;  4ZYH A;  1R9T J;  3EQL F;  1YRN B;  2JA2 A;  2HTS A;  4KIC A;  4XQF A;  1LVA A;  5JLX A;  2W84 A;  1ETY A;  2W7N A;  2ZXJ A;  1K83 J;  4ZZL A;  2K4B A;  2OUM A;  2CV2 A;  3AKZ A;  2NNY A;  2O61 A;  4OIP F;  3BG6 A;  2KDO A;  3DTE A;  3S2H J;  4UUV A;  2EQR A;  2YU9 J;  3Q9V A;  4ENN A;  1G4D A;  1TNS A;  5F08 A;  4HV5 A;  1BOA A;  3DBH B;  1RPW A;  1MGT A;  2OTJ I;  3BC8 A;  3KET A;  1J9I A;  3LSI A;  3MVP A;  2Y75 A;  3I3L A;  3F72 A;  1QHH D;  1S7E A;  2WAE A;  3CUO A;  3W3C A;  4UHT A;  3VYS B;  4H4K C;  4GFB A;  1UST A;  1YX5 A;  4MEX F;  3HOY J;  2HDD A;  1N78 A;  2P81 A;  4IHY A;  1BJZ A;  3O3K A;  4P5O A;  3KLN A;  4LG3 A;  2DMN A;  3WTS C;  4NC6 A;  3E6D A;  3D5L A;  3BR6 A;  1B9M A;  3H92 A;  2GWR A;  4AIJ A;  2R5Z A;  1QBJ A;  1S5L C;  2A6H F;  1JE8 A;  3KLO A;  2XDV A;  4EJV A;  2HOA A;  5JHU A;  3QYF A;  2BY2 A;  2A07 F;  3MEX A;  2WB1 A;  5DYM A;  2DU9 A;  1LPQ A;  2QZ8 A;  2HQA A;  2XF5 A;  4B4C A;  4E7J A;  1YS6 A;  2HS5 A;  4RB2 C;  2L9V A;  2ZME B;  1MZB A;  5JVG F;  5M5X J;  3OMY A;  4Y4R A;  3B6A A;  4F91 B;  1WPK A;  4WCG A;  3OL4 A;  3K2Z A;  4HAM A;  1JJ6 C;  2O8K A;  1GVD A;  3ISP A;  4EV0 A;  3Q9S A;  3G6E I;  4OIR F;  4BDY A;  2ICW G;  4HQM A;  1IRZ A;  4HNT A;  4MLO A;  3RIR A;  3WTX C;  4AID A;  4BHB A;  2B7E A;  3MD2 A;  3WTT C;  3BTJ A;  2EFN A;  2O0Y A;  1R36 A;  4QWQ A;  1WJA A;  4FHT A;  5J4Y A;  5KNL A;  2A3S A;  1R7J A;  3K9T A;  1TW3 A;  4BS9 A;  4S04 A;  3ZQC A;  2P5K A;  3HOU J;  2FQ3 A;  1A35 A;  4ZC3 A;  1MNM C;  3CJQ B;  5LBQ A;  2K40 A;  2DMQ A;  4CCJ A;  1X2M A;  4M3E A;  3GLL A;  2JQ7 A;  4A12 A;  1FT9 A;  1LVK A;  4HEA 2;  4A3F J;  1VQ9 I;  3B02 A;  4HST A;  4RM2 A;  2CQX A;  1FBQ A;  2XAU A;  4HF2 A;  1IRG A;  3ZPL A;  2MD0 A;  2STW A;  2DA7 A;  2M4K A;  3QOD A;  2HU9 A;  5M3F J;  3S1R J;  1T38 A;  1W5S A;  1J59 A;  3PIO F;  4RA2 A;  4XLN F;  3DPT A;  3RQI A;  4A2U A;  1DDN A;  1MSF C;  5FLX K;  2Y2Z A;  1RUO A;  3GW2 A;  1FLI A;  1U9N A;  4IOA F;  1MJB A;  4HF0 A;  4B43 A;  1JT6 A;  2ZSI B;  4A0X A;  3IRQ A;  3RJP A;  1WH5 A;  2DT7 B;  4JOM A;  5IT9 K;  3UKG A;  4RS8 A;  3ZP5 A;  3HHH A;  3AFH A;  2B9S A;  1UB9 A;  2DA6 A;  2HTJ A;  2N8G A;  2QM3 A;  1Y6I A;  3DKX A;  2COM A;  3RZO J;  4A5M A;  2GM4 A;  5LHH A;  1VND A;  2ZJ2 A;  1FOW A;  3GF2 A;  2FU4 A;  1PUF A;  1PDN C;  2HQ5 A;  1OCP A;  2HNH A;  3HDD A;  3L7W A;  4BY7 J;  4IHV A;  3K70 C;  2K85 A;  2ME6 A;  2F4I A;  4E7I A;  3QYB A;  2ESH A;  3A03 A;  1R4M B;  2EBI A;  2JSP A;  4XIC A;  1O3Q A;  1FEX A;  4O6J A;  3RTR A;  4MGR A;  2P6T A;  4RAZ A;  4XID A;  2VOP A;  2ID3 A;  1A04 A;  1W5C C;  1U5T A;  4L0Z B;  1Z9C A;  2F5E A;  3HL2 A;  4W97 A;  5J40 A;  3F8C A;  4JQF A;  3FKI J;  2K9N A;  1FBS A;  2WAD A;  5ILU A;  4U7B A;  2P7C B;  2R5Z B;  1HLV A;  2A68 F;  3Q3S A;  4H0E A;  2Z99 A;  1FYK A;  1F5T A;  3TO9 A;  1D0Y A;  4BXU A;  3CO7 C;  4M3D A;  5ERI A;  5J1U A;  2FEZ A;  1OJL A;  1HW5 A;  1YIO A;  3CCQ I;  2XRN A;  4B1R A;  2EZH A;  2MW8 A;  3BPV A;  1T98 A;  2JK3 A;  3HB9 A;  3KZI C;  3UR3 C;  4RAG A;  4I99 C;  4M6X A;  3AG3 H;  2Q0O A;  3EUK L;  3T1B A;  5FFZ A;  3QU3 A;  3CTA A;  5GPC A;  2M9H A;  4HV6 A;  1JGS A;  1IGN A;  3J7A O;  2EZI A;  1ZTR A;  3OYF A;  2ZME C;  3G3Z A;  2UXX A;  4FTH A;  2F48 A;  4A3I J;  2Q8K A;  2XGE A;  3JTG A;  2WY8 Q;  2DYR H;  1GLN A;  3LSP A;  1EH7 A;  2VPL A;  3DLL F;  3OYB A;  4F52 A;  2MAB A;  1YIT I;  5KHD A;  2F5D A;  2F4O B;  5EGO B;  2DK8 A;  4RLQ A;  5KAF C;  4EGY A;  3I4N J;  2M0M A;  2O7O A;  3E6C C;  2PX9 A;  2HZD A;  2HXI A;  1BIB A;  4U0Y A;  2H1L A;  2P8T A;  3BP8 A;  2MG4 A;  1ON2 A;  2KZG A;  4G6T B;  3LA3 A;  1T08 B;  3WU2 C;  3H0D A;  1WRJ A;  3HRM A;  1VQ7 I;  1JHH A;  4RGR A;  4C3J J;  3ZN0 A;  4ZYG A;  1XMK A;  1FOY A;  1TWA J;  1IN4 A;  1XCV A;  3H5A A;  3KCC A;  4E7K A;  3IH4 A;  2G0E A;  5F0C A;  4CYC A;  1YYV A;  1FSH A;  1Z3X A;  1Y39 A;  1ZKG A;  2Q2E B;  3S2D J;  1J2X A;  2BYV E;  2NVX J;  2FX0 A;  2TDX A;  3PIP F;  5CQG A;  1XSD A;  2RVC A;  2GLO A;  1V54 H;  5LEK A;  2E5N A;  2K4J A;  3IWF A;  2DA5 A;  3OYN A;  3T8T A;  1PUF B;  2CFX A;  1QPM A;  4DW6 A;  5FLM J;  3IWZ A;  3NAU A;  2IA1 A;  2LNB A;  3OR1 C;  2IGM A;  2IVM A;  5DM7 F;  1ZR4 A;  1S29 A;  3BTI A;  4HBL A;  1QQI A;  3GCM A;  2OU2 A;  5IOZ A;  4UUS A;  5DS9 A;  1YW7 A;  6PAX A;  4XLC A;  3I53 A;  4ZZD A;  2JZY A;  2MGQ A;  4YIF A;  3I55 I;  1STZ A;  1X1C A;  4HW0 A;  3I56 I;  4BKX A;  3TO7 A;  3M1E A;  1KZH A;  1YX3 A;  5ICC A;  1SFK A;  3ONQ A;  2QSG X;  3GWZ A;  3AL0 B;  2XGX A;  5GAG J;  5LD2 C;  2XKP A;  2P7V B;  1D8J A;  4BQQ A;  1T0F A;  2ESN A;  4I0A A;  2GZW A;  3H1C A;  3HOW J;  3HRU A;  1FJL A;  1EH8 A;  3R0J A;  4UY8 I;  1BC8 C;  2QBY B;  4E7Z A;  2I5U A;  3FXJ A;  4RMN A;  1SAN A;  2ME0 A;  1I5Z A;  1U0J A;  4P96 A;  3BR3 A;  2DDA A;  1WKM A;  1TL8 A;  3DEU A;  2LBF A;  1FTT A;  2EK5 A;  5CPR B;  2E7X A;  1WHU A;  2H09 A;  3BR1 A;  4ZDP A;  4A3G J;  2O9L A;  4DBQ A;  2K3F A;  2R7T A;  2HYJ A;  2GXB A;  5J4V A;  5J1R A;  1U8B A;  4A3E J;  3V8L A;  3WGG A;  2ZCW A;  3ZRG A;  5DM6 F;  1BA5 A;  3IHU A;  1Z77 A;  5HOO A;  3FDY A;  1XS9 A;  4CGZ A;  1X1D A;  4N9H A;  3ZMS A;  1EKE A;  1N75 A;  1R00 A;  2KIQ A;  1ZEL A;  1AKH B;  1ZYR F;  4DIQ A;  2EIM H;  5E79 C;  5KK1 A;  3BJO A;  1R1T A;  2HQR A;  4I02 A;  1J75 A;  2DOE A;  1F36 A;  3J7Y J;  2K3P A;  2DOA A;  1E2X A;  3L9F A;  4A3J J;  3CZ6 A;  4ZTJ A;  4AM3 A;  3ZQF A;  1E0E A;  5J6X A;  2M45 A;  2IW5 A;  1PP8 F;  1P4W A;  3PO3 J;  5FKN A;  2PMZ N;  4YII A;  1QZE A;  5F04 A;  3BRO A;  5JLW A;  2MC4 A;  3QYE A;  2ZFU A;  4I09 A;  4KIT B;  1V3F A;  3GTG J;  2VBZ A;  4EJW A;  3W6J B;  3FBI B;  3R4K A;  2K27 A;  3GVA A;  3GYH X;  4BXF A;  3VOD A;  3OYE A;  2PMH A;  3LSM A;  3KP7 A;  4UVC A;  1UEL B;  2EIJ H;  2FBK A;  2M0C A;  3S3M A;  3HOV J;  3CUQ A;  1NH3 A;  1RRJ A;  2EIK H;  4HDU A;  1KON A;  3L2U A;  1V5E A;  2XVC A;  1LDJ A;  2JA6 J;  4D9J A;  3GO5 A;  2DCE A;  4Z6Y A;  1A31 A;  5E3M A;  3EDP A;  3W6K B;  2M7B A;  4PJM A;  1IC8 A;  2D1V A;  1P9Q C;  2Y9Z A;  2WV0 A;  4HNU A;  2LVS A;  2DTZ A;  2YS9 A;  4ZH4 F;  5K7F A;  3WTV C;  2EZK A;  2F5C A;  4MQV A;  1OFC X;  2PI0 A;  4C2T A;  1D1B A;  2K7L A;  4I98 B;  3CD6 I;  5K1Y A;  1FC3 A;  4KUM A;  1F43 A;  1FTZ A;  4ETS A;  2CRG A;  1D3Y A;  3C2H A;  4KIB A;  2WBM A;  1SAX A;  3E0J B;  3GBG A;  2M7A A;  3LQR A;  4E70 A;  3PL8 A;  1VFC A;  1JUP A;  3ZOB A;  3S3O A;  1ONV A;  2EH3 A;  1FP2 A;  4N4O B;  1NG7 A;  2AQE A;  3WU0 A;  1QHG A;  1R1U A;  2W4S A;  2KZV A;  4XOP A;  2GXG A;  2WWY A;  2GAU A;  3SZG A;  4G6D A;  4BEH A;  4IOC F;  1XPX A;  3KYD B;  4ENK A;  3RKX A;  1FMW A;  2QVO A;  5KVR A;  1JHF A;  4XLE A;  4X6A J;  3QPH A;  1ZGA A;  2FRH A;  2W1O A;  5AIQ A;  1W36 C;  1IZ1 A;  4XRS G;  1NK2 P;  2LC2 A;  1T95 A;  3GZN B;  3C7J A;  3O2P E;  2ISZ A;  4N4N B;  5LGN A;  3AL0 C;  2X48 A;  2EIL H;  2LBF B;  3JRI A;  4OU0 A;  2ELJ A;  2KIS A;  3OIQ A;  3ZXS A;  1OPC A;  5IP7 J;  3V8J A;  2XAH A;  1YJN I;  2XGD A;  5H20 A;  5CYV A;  1AWC A;  1WI9 A;  3FXM A;  4L9T A;  2ACJ A;  4M3F A;  3EET A;  4V2F A;  1TW2 A;  4LK0 F;  3RCO A;  4R79 A;  4NQW B;  2LSO A;  1PYV A;  4XN0 A;  3WTY C;  3M9A A;  1P6R A;  1YG2 A;  3AG2 H;  1SAU A;  1I3Q J;  1N25 A;  2I8D A;  4JX4 A;  5DD4 A;  2GQQ A;  2JT1 A;  3OYL A;  3BR2 A;  2GIZ A;  5C3E J;  4DBR A;  5EG0 A;  5FD6 A;  4I0B A;  1IV8 A;  1TTY A;  4RAF A;  1ZAO A;  4M9X A;  5BS6 A;  1ZG1 A;  1JJ8 C;  1S7A A;  2X4H A;  4PSW A;  2IS4 A;  2BV6 A;  3EYY A;  4Q47 A;  1Z0X A;  3IH2 A;  5D5X B;  2MA3 A;  5AIP A;  3RKQ A;  4Q4Z F;  1W36 D;  1MMA A;  5TIS C;  4RBO A;  1DPR A;  3HOZ J;  2IJL A;  3AAF A;  3ECO A;  2OF7 A;  1R5I D;  2MD5 A;  2QKM B;  1EV7 A;  1K61 A;  3E97 A;  3T8R A;  3CCR I;  5B5E C;  1F1Z A;  4YIR X;  3NWS A;  4AYB N;  2KQR A;  2XHK A;  3CUQ B;  2B63 J;  2FUG 2;  1SEU A;  3WTZ A;  4L9V A;  3JRB A;  3PM1 A;  2A61 A;  2LY2 A;  4IQ4 A;  1FYL A;  4PZJ A;  5E1W A;  1DP3 A;  2FQ4 A;  2IGK A;  1X1B A;  2FF4 A;  3CCM I;  2JVH A;  4B48 A;  1ULY A;  3F8B A;  2VC0 A;  2IS2 A;  5BPD A;  1TT0 A;  2L7F P;  4HF1 A;  4RB0 A;  2X0L A;  1IUF A;  2NVQ J;  2LOO A;  4Y13 A;  4ESJ A;  2JA8 J;  2DW4 A;  3PFY A;  1T6S A;  4IPA A;  4PJN A;  3S14 J;  1QPI A;  1D8K A;  3R0A A;  3JAM K;  1S72 I;  3G1M A;  4TV7 A;  4M6V A;  3OSF A;  4BBS J;  4JX5 A;  4EM2 A;  1WJC A;  3NRV A;  2JUG A;  4WF2 A;  3J81 Z;  3S93 A;  3V4G A;  1BN5 A;  4EAT A;  4IZZ A;  3SJM A;  3O6B B;  4P9F A;  2CWE A;  1OKR A;  2FNA A;  3KEY A;  5F0H A;  3FXU A;  3GZ5 A;  2PJP A;  2P0W A;  5DUK A;  4BEH B;  1GV5 A;  1W0U A;  4AU7 A;  1WI3 A;  4GXO A;  3DPL C;  4KT6 A;  3SFZ A;  3VOE A;  1BI3 A;  1XMX A;  2L5Q A;  1TWF J;  3TOB A;  1H89 C;  2V9K A;  1TT5 B;  1LDK B;  5BOX A;  1L3L A;  1MIJ A;  2CQ7 A;  1ZRD A;  4IHX A;  1GV2 A;  1UHS A;  1UG0 A;  2ZKZ A;  2KRC A;  4XLP F;  3V7C A;  1TZL A;  1TNT A;  2R0Q C;  1T0F C;  3BQY A;  3OYH A;  4LFU A;  3HSR A;  4E7L A;  2BHY A;  2RRE A;  5GAD J;  3QU6 A;  1SVL A;  3ABU A;  2R4G A;  4NC8 A;  1T2K A;  4OIN F;  3W6V A;  2VUM J;  3QPS A;  1DGR M;  1FZP B;  1GUU A;  1A6I A;  4BAY A;  2LKS A;  1MMG A;  1G3Y A;  4KIG A;  1ITY A;  2DMT A;  1O7L A;  3HTU A;  3KP4 A;  1IF1 A;  1W7P B;  2YUS A;  1Q1H A;  1SMY F;  2VAS A;  4GDF A;  2XF7 A;  4RAY A;  2Y0S A;  3CC2 I;  2JWT A;  2QEX I;  2ZNZ A;  2MH2 A;  2X6W A;  1AOY A;  2YR2 A;  1WJF A;  1XGM A;  1QRY A;  4M9S A;  2ZBK A;  3N05 A;  2JTV A;  1VQL I;  2DI3 A;  2OQR A;  3SDB A;  3QP5 A;  3WGH A;  1YJ9 I;  3LSH A;  3KEO A;  2V6C A;  2F4M B;  1NHA A;  4CH7 A;  1B9N A;  3HM5 A;  3X2Q H;  2L2O A;  3TDZ C;  4NC7 A;  2E7W A;  2W25 A;  1G3T A;  1E17 A;  1ON1 A;  2WAF A;  3BG7 A;  3TBI A;  2OD5 A;  1SVM A;  3KYL A;  1PVE A;  1TWG J;  2XAJ A;  1R5G A;  3DPU A;  2R7D A;  3F6O A;  1IRF A;  1O7F A;  2PFB A;  4C3I J;  3L1P A;  3CUQ C;  3ZQL A;  3HGG A;  1F9N A;  3M8J A;  4W1U A;  4FIS A;  1HDD C;  5E20 A;  1MNE A;  1TQP A;  2NS7 A;  5FKM A;  5IT3 A;  3GFM A;  1IDY A;  3BOQ A;  2X6O A;  4BQA A;  2AXL A;  4N0B A;  1VZ0 A;  3V7S A;  3ZMT A;  2VJ5 A;  2VPR A;  1FPQ A;  4G94 A;  4L5E A;  4CHU A;  2VL8 A;  1J09 A;  3ASN H;  4E4H A;  1EJ9 A;  5L3F A;  5JHF A;  5CVU A;  1H9T A;  2VOD A;  3KP5 A;  2KDZ A;  2QF7 A;  3JTH A;  1WSU A;  2LLK A;  2DOD A;  3BJA A;  5M5W J;  4EM0 B;  2HQN A;  4IJA A;  1BR2 A;  3K1M A;  1D0Z A;  1KYW A;  1S8N A;  5ED4 A;  4OWR B;  2VB6 A;  2OC6 A;  3L2C A;  2NVY J;  2R7U A;  3EPZ A;  3NEU A;  2X1D A;  2H6B A;  2F5F A;  5DUI A;  4M73 A;  1FIP A;  3FK6 A;  4Q5S F;  1LFP A;  1I3A A;  2R7W A;  2O03 A;  2STT A;  2R5Y A;  3KIO A;  5CKT A;  4HSR A;  2V7F A;  4FCY A;  1FMV A;  3R60 A;  2KIM A;  3MKL A;  1WCM J;  3U21 A;  1QVU A;  5EGO A;  4ZTF A;  2ZC2 A;  4QIW N;  5JVT A;  3COA C;  1XDU A;  2H6C A;  4XSX F;  2RN7 A;  1LFU P;  1JKO C;  2HZT A;  2XAS A;  4YG2 F;  3TQN A;  3U9G A;  4XKV A;  2V79 A;  3N4M A;  1IUY A;  1ZRC A;  1P7I A;  1ETQ A;  3PSF A;  2L02 A;  2L01 A;  2WTE A;  3VPR A;  2RDP A;  1GVJ A;  3HZJ A;  1MW7 A;  4I6Z A;  1ZHF A;  5DD8 A;  5DTD A;  3TOA A;  1YO5 C;  2XGC A;  3PNT A;  5D6F A;  3B6C A;  3WHB A;  3BQZ A;  1HXD A;  2IXS A;  4UXN A;  3N97 A;  5HDK A;  1WGX A;  3BT9 A;  2HI3 A;  4ZYE A;  2OA4 A;  2Q2E A;  2DA4 A;  2W24 A;  3E1S A;  2DO7 A;  3OYJ A;  2TRT A;  4RB1 A;  1G3W A;  3OIO A;  2K9Q A;  1OYI A;  1Y1V J;  4LB5 A;  3CCE I;  4KDP A;  3M4O J;  3ZCO A;  2BOL A;  1R49 A;  3FXR A;  3WOD F;  3FWE A;  3J81 K;  4XM3 A;  3E7L A;  5D8L B;  4PJ0 C;  5D5W B;  4Y52 J;  1B59 A;  3BZC A;  1KA8 A;  2XPV A;  3ZMD A;  2RKH A;  2GA2 A;  4M6Y A;  3T5X A;  1HW1 A;  2CQQ A;  3OV8 A;  3J7Z I;  3OYM A;  2HVS A;  3Q0W A;  3VSK A;  3H3Z A;  3ZGK A;  5BPI A;  1FX7 A;  1RET A;  1CF7 B;  2LKX A;  2ISY A;  3R61 A;  1WJ5 A;  1IN6 A;  4B3X A;  1HOM A;  2KHM A;  3IP4 B;  4NDL A;  1B6A A;  1XMA A;  1DU6 A;  1XSX A;  2DPU A;  4GYI A;  1BI2 A;  3MKY B;  1ZAR A;  3S15 J;  3BG5 A;  2QBY A;  4BYY A;  1ACI A;  1OCC H;  3MZ8 A;  1W7P D;  3JRE A;  3SZT A;  1D5Y A;  3E6B A;  4L5I A;  1APL C;  5K5O A;  3PJR A;  4XRM A;  1SFU A;  5F64 A;  1O4X A;  1I1S A;  4C2M J;  2LFB A;  1HQC A;  1R22 A;  3CJT B;  3GX4 X;  2KJC A;  3PUB A;  3LA7 A;  3WE2 A;  3OR2 C;  3P9I A;  2VON A;  1MBK A;  1BBY A;  3I5U A;  4ON0 A;  4HX7 A;  4ABZ A;  1ZRF A;  1JXS A;  2R7X A;  3ECH A;  2DDB A;  2L7Z A;  4M3G A;  2PG4 A;  5H6Q A;  1BW6 A;  4G12 A;  2XB0 X;  2O5R A;  5B1A H;  4XL9 A;  3M1C A;  4FX4 A;  2XAQ A;  2OTL I;  4GRI A;  2GOX B;  4KN4 X;  1E3O C;  2Z3Y A;  1Y0N A;  1Q1V A;  4PK4 A;  2ETH A;  2XB5 A;  5GPA A;  2R5Y B;  3VDX A;  1AKH A;  3QPL A;  3ABK H;  4FET A;  3LA2 A;  2FBI A;  2OCE A;  4BQN A;  2HOT A;  5EYR A;  1HC8 A;  2K5C A;  3EUH A;  4D7M A;  2F2E A;  4KIS A;  4CA0 A;  2D1H A;  4OOI A;  4FQG A;  3BR0 A;  4PFO A;  3BG3 A;  2NVU B;  1U9O A;  1Z91 A;  4F55 A;  4DZP A;  2DMU A;  1VQN I;  1TLH B;  1UMQ A;  3FIW A;  2R7R A;  2LF7 A;  2XPU A;  4AC0 A;  4F3Q A;  4A3L J;  3E6M A;  2RNJ A;  3J80 Z;  2M4G A;  3CJR B;  1KU7 A;  3ML6 A;  2NOG A;  2E1M B;  3E5Q A;  4ITV A;  3DKY A;  2UUZ A;  3F6V A;  2RC4 A;  2Z9O A;  1A36 A;  1MJA A;  3RPQ A;  1DUX C;  1GXQ A;  1RI7 A;  3A1Y A;  5B3S H;  2ZJR F;  2HVR A;  4XLA A;  3F23 A;  1EH6 A;  2PN6 A;  2DFI A;  2ZNY A;  1JTY A;  2XRO A;  3GTM J;  4I2O A;  3SFI A;  2L54 A;  2HEO A;  3DU5 A;  3CF2 A;  4UNO A;  1UJ8 A;  2BVM A;  2FML A;  1SD4 A;  2JSC A;  3DXJ F;  1TQI A;  3ZQ7 A;  3I59 B;  4IX7 A;  4J19 A;  4BE1 A;  3PQJ A;  1A6Q A;  2X1C A;  3HOT A;  4XBF A;  4CCO A;  1X1A A;  1S3J A;  5FGM A;  4MO7 A;  4Y3O A;  1IAW A;  2B0L A;  4F92 B;  2G9W A;  3PFI A;  2HR3 A;  3MN2 A;  1SFO J;  1BOB A;  5E18 F;  3CF5 F;  1QGP A;  3FK7 A;  1YI2 I;  2KKO A;  5E3O A;  3GLX A;  4R1H A;  2E2I J;  5E8G A;  2IS6 A;  5E1X A;  2JUC A;  4HLX A;  4ZDO A;  3TP3 A;  1IRX A;  3VWB A;  1K4S A;  1KQ9 A;  2CV0 A;  1X58 A;  4I7H A;  5D5V B;  4EJO A;  5DCF A;  3OL3 A;  4FAS D;  1W5T A;  5J8F A;  4ENJ A;  2EPF A;  3BG9 A;  1WFX A;  2I10 A;  2GIV A;  2X6X A;  4BDZ A;  2DXI A;  4E6K G;  2M5W A;  4AIK A;  2VN2 A;  4F93 B;  3DEW A;  2AS5 F;  1LKX A;  1BW5 A;  3QWL A;  1AHD P;  1U8R A;  4K2E A;  5HNH A;  3M7G A;  2JVG A;  1K79 A;  3WG7 H;  1XG1 A;  2OV7 A;  1RUN A;  4JBA A;  2D5V A;  1RIO H;  5E3L A;  2VXD A;  4A0Y A;  3GTL J;  3CES A;  3GTQ J;  2D2W A;  2LG4 A;  4HOB A;  5CVI A;  3GFI A;  1UZC A;  1SVO A;  2F6C A;  4NQW A;  2PLY A;  1VQ6 I;  3LAJ A;  3IC7 A;  1I6X A;  1DP7 P;  1G8X A;  5HOD A;  3M07 A;  2A05 A;  4M9Z A;  3LSJ A;  1Z6R A;  1XSV A;  3JW4 A;  4D5C A;  4ZDL A;  4B09 A;  1DQU A;  1T8I A;  4G9Y A;  4A6D A;  2HKX A;  2DT5 A;  3KZZ A;  1REP C;  3WTU C;  2PEX A;  1UAA A;  2G7H A;  3HPH A;  2HXO A;  9ANT A;  1N77 A;  4WK8 F;  4LG0 B;  3CLQ A;  4RDU A;  4A69 C;  4PJJ A;  2FE3 A;  2R7V A;  2BEO A;  1IDZ A;  3QOP A;  2E2J J;  3ZQH A;  3GTP J;  2CS3 A;  3BZ6 A;  1FWZ A;  3DEE A;  3I71 A;  3R6S A;  3S1N J;  4M72 A;  4A3B J;  1FSE A;  2M8G X;  2NS0 A;  5IOY A;  3NWT A;  3CQZ J;  2HDC A;  4PCQ A;  5DV5 A;  2GXA A;  1G6N A;  1X4O A;  1FYM A;  5CQE A;  1GT0 C;  2DOF A;  1FNN A;  3K0L A;  2M1B A;  1K4T A;  4IHT A;  3SQN A;  3HRS A;  3F3X A;  2HFH A;  2BBY A;  1RZ4 A;  2IA2 A;  2BW3 B;  4A3M J;  2DMP A;  4A93 J;  1R6R A;  2IBD A;  2R7F A;  3GTJ J;  3VYR B;  1OCO H;  3PQK A;  4JP0 A;  2QUF A;  1R1V A;  4MHG A;  3ROU A;  2K86 A;  3FKJ A;  4BL0 B;  5L3C A;  3FIS A;  2QCO A;  1Z7U A;  3MZY A;  4U88 A;  2CW7 A;  3RKW A;  3F21 A;  4IO9 F;  1WJB A;  2WA0 A;  4MTE A;  5F6F A;  3RSN A;  3IKT A;  4O5V A;  1U2W A;  4CSW A;  3ERE D;  2CW0 F;  4KNY A;  3REO A;  2LK2 A;  2CFO A;  1KGS A;  1QZY A;  1H8A C;  5EDN A;  3HKZ A;  4BY1 J;  4MIM A;  2ZSH B;  2CW8 A;  1MBF A;  1ZRE A;  1USS A;  3TMO A;  1ENH A;  4QLC U;  4HLY A;  2Z2S B;  1QA6 A;  2L9N A;  4Q48 A;  4L9N A;  1X1P A;  2MH9 A;  4HA8 A;  5DCM A;  2DK5 A;  2CMP A;  1FY7 A;  2JMW A;  1X4P A;  3PSI A;  1X3W B;  3D0S A;  3JRH A;  1MBJ A;  2VJ4 A;  2O8X A;  2EA2 A;  3K69 A;  3HPG A;  3G1O A;  1K6O A;  3S3N A;  3JR9 A;  3QQA A;  3BJ6 A;  3GME A;  2BXY A;  4PFP A;  4C3H J;  2R7S A;  3PNY A;  3ZMU A;  4DQ2 A;  2YX7 A;  4HYE A;  2J5O A;  1AU7 A;  3V8K A;  3S8P A;  3K4J A;  3PUF A;  4LIV A;  1RES A;  4RGS A;  2G7U A;  3SEQ A;  1KQ0 A;  3KX2 A;  3FMS A;  1Y0U A;  4PGH A;  2QSH X;  4KN7 X;  1CGP A;  1ETO A;  3MWM A;  2PBI A;  2Y30 A;  1JKP C;  5D8K B;  4LIU A;  2DAO A;  1W7P A;  5ICG A;  2E36 A;  3RDI A;  3DLA A;  3CCJ I;  1Y56 A;  2K02 A;  1Y8R B;  2Z16 A;  3WHC A;  1NK3 P;  1BR1 A;  2AO9 A;  3J80 K;  2HYF A;  3MAJ A;  4WXD A;  4KJZ A;  1IW7 F;  2AXT C;  2E5Z A;  4XOR A;  1YS7 A;  5CVR A;  4CCN A;  2VE9 A;  3LWF A;  2UXN A;  3AG4 H;  3SEZ A;  5TRD A;  2NNN A;  1MBH A;  3A0B C;  4UB8 C;  3ZMZ A;  4UVA A;  3BPX A;  5EF6 A;  2HYG D;  5FO5 A;  2UZK A;  3DV8 A;  4WWC A;  1B1B A;  4NNJ A;  5LRR A;  2ZJP F;  2CUZ A;  3OYD A;  1VQM I;  2LD5 A;  4OIQ F;  3LSG A;  3FXL A;  2BGC A;  3GUD A;  2VT2 A;  1XCB A;  3IH3 A;  2ZJQ F;  3EUH C;  1O3T A;  2LYC A;  1OQY A;  5J8C A;  4HNV A;  1JT0 A;  4NBQ A;  4B44 A;  5L3B A;  2V1D A;  5E8I A;  1LNW A;  1XB4 A;  4Y33 A;  2C6Y A;  1WH7 A;  5BMZ A;  1B8I B;  2L7K A;  5HLG A;  2QEN A;  2X1E A;  3LSR A;  3CC4 I;  1LJ9 A;  5GTH C;  3F9K A;  1B72 B;  2BHZ A;  2R92 J;  3ABL H;  5LHI A;  2NAZ A;  3KP6 A;  2E60 A;  1UG2 A;  3CLO A;  5JR3 A;  2Z33 A;  3HTS B;  4P1W A;  1X19 A;  1HKS A;  3H3U A;  2K9L A;  2LH9 A;  2P4W A;  2NVT J;  3K1P A;  3MMY B;  3CCL I;  3BWG A;  2WAQ A;  1IN5 A;  3BZK A;  4JX6 A;  2VKE A;  1YFH A;  1HA8 A;  3QAH A;  1RNL A;  3P9C A;  2JRT A;  2LTP A;  4YFK F;  2DPD A;  4XK4 A;  3LFK A;  2Y0S N;  2F5V A;  3O8G A;  4IRH A;  1ZQ3 P;  4HPQ A;  4BJT A;  3J7A Y;  2DA2 A;  1ORK A;  5BQT A;  3K4C A;  2IA0 A;  1D1C A;  1XDS A;  5ILS A;  1MDM A;  4BGD A;  3H9J A;  3SZP A;  3D1N I;  3FMR A;  2ZXW H;  5DCM B;  1WVR A;  3F8M A;  2NRA C;  3TDU C;  3CCU I;  4S0H B;  3GFL A;  1K78 B;  1HCR A;  1W0T A;  4QPQ A;  2J5P A;  1MJ9 A;  4XN3 A;  3DBL B;  2DT6 A;  3DF8 A;  3CCV I;  1UFM A;  1VTN C;  2W85 A;  4PDK A;  1BC7 C;  1P4A A;  3GXO A;  2R7Q A;  2VBY A;  1A5J A;  1HDP A;  3DU6 A;  2LY9 A;  2W00 A;  1OR7 A;  3W2A A;  3FF5 A;  4GO1 A;  1ERD A;  1P2F A;  1SC7 A;  3MKW B;  3S17 J;  5ICE A;  4YEL A;  2XF6 A;  3TW6 A;  2RQP A;  5D4R A;  1XGS A;  2V4J C;  3HJE A;  2ELH A;  3HIF A;  3MKZ A;  2CU7 A;  3CO6 C;  3RYR A;  4DNC A;  4ZYA A;  4F7Z A;  2IAI A;  1SFE A;  4IXA A;  3DKW A;  1XX5 A;  4UUT A;  4IVN A;  5HDG A;  4NUB A;  5GTI C;  1LQ1 A;  3LST A;  3OIP A;  4KMU X;  2CGP A;  5C44 J;  1H88 C;  2H1K A;  2CSO A;  3H36 A;  3K2A A;  2EFO A;  3LOC A;  2KFD A;  3V7R A;  3JRD A;  1MMN A;  4D1Q A;  2WB1 N;  2AQF A;  4II2 A;  2LDU A;  1RR8 C;  2BY3 A;  4XKW A;  4ASN A;  2XUB A;  4A5N A;  4A3D J;  1QZZ A;  2OAZ A;  3Q5F A;  2OJE D;  3A02 A;  3HRT A;  4M3B A;  2QQ8 A;  2QSF X;  2XAF A;  1DU0 A;  5HLT A;  1PUE E;  3KP2 A;  1VI0 A;  1AA7 A;  2CQK A;  4MFE A;  2DN0 A;  1X2N A;  5KCM A;  3TO6 A;  4DZJ A;  5A2Q Z;  1R71 A;  5DDG A;  1VQP I;  1ZH5 A;  3W2V A;  3JSO A;  1R5H A;  4MFD A;  3OYI A;  2H8W A;  3S1Q J;  2E71 A;  2EFQ A;  2EV6 A;  3CMM A;  3MCZ A;  1HKT A;  4LLL A;  1FOK A;  1WJE A;  3S16 J;  1S9H A;  2KMU A;  2NYX A;  2FMY A;  3HG9 A;  2WY7 Q;  2COB A;  1TBX A;  3NQO A;  5FB2 A;  4XON A;  2M2E A;  2HGC A;  5M3M J;  1KU9 A;  2VIX A;  5J47 A;  3TL4 X;  3ULQ B;  4EJU A;  4RGX A;  4YFX F;  1CF7 A;  4M71 A;  4AVP A;  4L9J A;  2FXA A;  3B73 A;  1FIA A;  2VI6 A;  4WXC A;  1FBU A;  2GBY A;  2QQA A;  1I39 A;  2IGN A;  2R7O A;  3TED A;  1D1A A;  2VLA A;  2YX4 A;  2A6T A;  5FFX A;  1NG6 A;  1I50 J;  4IHW A;  4YFN F;  1MDM B;  2TCT A;  5FLV A;  2VKD A;  3CP2 A;  2E1C A;  4L18 B;  3S32 A;  2V1U A;  4C2U A;  1QU3 A;  2FD5 A;  3ABM H;  1WWX A;  1HSJ A;  3FZV A;  2KT0 A;  1MKM A;  4RGU A;  4NHJ A;  2E1N A;  3FM5 A;  5HS7 A;  1QNT A;  4C9Y A;  3L2W A;  2BZT A;  2L9S A;  2KRF A;  3I4M J;  3V42 A;  1E3P A;  2K9S A;  3HSF A;  4XOT A;  3DP7 A;  1OCT C;  3L2R A;  3FM3 A;  3OOP A;  1BR4 A;  4XLH A;  2UWM A;  4BU2 A;  3GEZ A;  2M34 A;  2M87 A;  2FSW A;  1XTA A;  2NOJ B;  2RQQ A;  2H27 A;  2JA5 J;  3H5N A;  4QSH A;  1X3Z B;  1JGG A;  5EZG A;  5JFR A;  3E5X A;  2M8E A;  2CG4 A;  4G7H F;  2BXZ A;  3QOE A;  2EZL A;  5AON A;  3OS0 A;  3F22 A;  1Y1W J;  5DEQ A;  3H3V K;  2VKV A;  2E1O A;  3UNG C;  4BQO A;  1HKQ A;  4CO8 A;  1QVT A;  2OZ6 A;  2Q1Z B;  3E5U A;  1CQT A;  4U87 A;  3JRA A;  1IN7 A;  3ERM A;  2P5V A;  3QPT A;  3RQ4 A;  3VB2 A;  1LDD A;  1G2H A;  4Y7N J;  1SD7 A;  2Z5U A;  1ETK A;  4L5J A;  5ICF A;  3T0Y A;  4DYR A;  1VQ4 I;  3D5S C;  1UHW A;  1FOX A;  2Y48 A;  2XRL A;  3CME I;  3C18 A;  3G4S I;  5HDN A;  1S7O A;  2LF8 A;  2IPQ X;  4IHS A;  3KP3 A;  3P5J A;  2MBF A;  4CZC A;  3GTO J;  1ZLK A;  3DWL E;  4ESB A;  3H9Q A;  1I1G A;  2A6E F;  3I4P A;  2VT3 A;  5GP9 A;  3BTC A;  1QO0 D;  4KIF A;  3I64 A;  2XC7 A;  3I59 A;  1YJW I;  4XMY A;  1MBE A;  3U2R A;  3CJN A;  3CDH A;  1YTY A;  4PUS A;  2ZO4 A;  3BTL A;  3H9G A;  4QTR A;  5J3L A;  3F8N A;  4FT8 A;  1ZG3 A;  4PJL A;  3ZQI A;  3ZQQ A;  2JRM A;  2XV4 S;  1X3U A;  1OMI A;  5LEJ A;  4UV8 A;  2QGU A;  4ZJZ A;  2LKP A;  2L4M A;  1PJR A;  2RNG A;  1OIS A;  3C2B A;  1I27 A;  2LY1 A;  2XPW A;  2XIG A;  4HDV A;  4X1E A;  1OCR H;  2W48 A;  1SFX A;  3U1K A;  5EJC A;  1T33 A;  3LAP A;  3I0T A;  3CMA I;  3ESW B;  2P5L C;  3RI4 A;  1P92 A;  3F8F A;  2IGO A;  1VQ8 I;  4BE0 A;  1G59 A;  5EEG A;  3FBN B;  2KL4 A;  4GCV A;  3OOU A;  3CCY A;  4II3 A;  4RLF A;  2HWV A;  4Y15 A;  5E3N A;  4E7H A;  3HHG A;  2EIN H;  4D5F A;  3NAR A;  2QKL B;  2RV8 A;  3VSL A;  3WU1 B;  4LLN A;  1IXS B;  1ZGW A;  3KEQ A;  3CDL A;  1PP7 U;  4XR6 A;  3KE2 A;  4ESF A;  5LGU A;  4YRV A;  5LGT A;  1MBG A;  1C0W A;  4GYG A;  5IPA A;  4S05 A;  1XC5 A;  2ECB A;  2IP2 A;  2KIF A;  4IEJ A;  2OBP A;  5CVV A;  3OYG A;  1Z6T A;  3C3W A;  1IJW C;  1ZR2 A;  3TW7 A;  3RZD J;  1JUS A;  1FP1 D;  5LRS A;  5C4J J;  4I76 A;  5K5Q A;  4KYW A;  1EA3 A;  3P7N A;  2E19 A;  2HDW A;  2O6G E;  2QA4 I;  4BUP A;  2E2H J;  1YLF A;  5A2Q K;  3K70 D;  1OR7 C;  2CUE A;  4LG0 A;  1YIJ I;  3OWT A;  1Z05 A;  2JPB A;  4UB6 C;  3MFK A;  2VQL A;  4AWX B;  1K6Y A;  2R3S A;  3FXO A;  1RR7 A;  3A0H C;  1S6L A;  2CUJ A;  3E3V A;  3VEP A;  4OAZ A;  3S2W A;  2MLG A;  4AUX A;  1V5G A;  2DFH A;  5FRN A;  2E34 A;  2CUF A;  2VJI A;  5LLQ A;  3K4K A;  2YSR A;  4B47 A;  5FKO A;  1LE8 A;  5JI6 A;  2LR8 A;  2BW3 A;  2DJI A;  4KT5 C;  4CCK A;  3G2B A;  3IUO A;  3I54 A;  1YOV B;  3BCB A;  2Y31 A;  2VJJ A;  2HOE A;  3D5R C;  4JK1 X;  3ASO H;  1U78 A;  2PMU A;  2V1X A;  4LMY A;  1MH3 A;  1I6H J;  5K7H A;  4FX0 A;  2LP0 A;  1J0R A;  2Z1D A;  2FNP A;  4O3M A;  2ZB9 A;  3VFZ A;  4P55 A;  1KU3 A;  5D5U B;  3AG1 H;  1Y8Q B;  2PQ8 A;  4Z2Y A;  4CIC A;  1POG A;  2L0K A;  1R23 A;  2KP6 A;  4FE7 A;  3M3Y J;  3H35 A;  2W57 A;  3M8F A;  5CVJ A;  2VBX A;  4MTD A;  4G6Q A;  3VYU B;  2FJ1 A;  4M74 A;  3QRF F;  2JN6 A;  3HUG A;  3DFG A;  3S1M J;  2K9M A;  4QPO A;  1KU2 A;  1G3S A;  2EV5 A;  3ZMV A;  5GAE J;  2CH0 A;  2P6S A;  1Z1D A;  3DCF A;  2BVL A;  2DBB A;  3SXY A;  1OYY A;  5GAH J;  1T39 A;  1JKQ C;  2BY1 A;  2CV1 A;  2HOS A;  3IKV A;  4DJA A;  4A3C J;  3G71 I;  2L7M P;  4V19 K;  3ELK A;  3OYC A;  4DGW B;  1W1W E;  4LJZ F;  3ZN1 A;  3JRF A;  2E35 A;  3HC7 A;  1WQ2 A;  3P9K A;  4HX4 A;  2IEK A;  2XKO A;  1U5T B;  5HS9 A;  3JRC A;  3OY9 A;  2JPC A;  4A3K J;  5TJJ A;  2RAE A;  5FD5 A;  4CXF A;  1HF0 A;  2QQ9 A;  5E1Z B;  3FX3 A;  5EEH A;  3RYP A;  4NB5 A;  3CCS I;  4PGG A;  3RPU D;  2LRD A;  3PO2 J;  1LEB A;  4LGW A;  3JRG A;  1OLT A;  2DTR A;  2BY0 A;  3ZQG A;  3K10 A;  3ZR8 X;  1YW9 A;  5C4X J;  4HG2 A;  4X0G A;  4XRS A;  5L3D A;  3JAM Z;  2XSJ C;  3BLY A;  1D0X A;  3GZ6 A;  1Z7L A;  4BAC A;  5FKL A;  2QWW A;  5KAI C;  1D5V A;  3HKZ N;  4G8X A;  4DOZ A;  4BBR J;  2EWN A;  5IYC J;  2X85 A;  4ANJ A;  3U1D A;  1MSE C;  2WV1 A;  5IYD J;  2EB7 A;  5IY5 H;  2V1N A;  4YEJ A;  1LB2 A;  2PJR A;  2ZXI A;  2L3D A;  3DBR B;  2ID6 A;  4Y17 A;  2HPM A;  2M30 A;  4XRF A;  1OYW A;  2YU3 A;  2VKH A;  4LIT A;  4FE4 A;  3GTK J;  1HBX G;  2FOK A;  1H9G A;  1HW2 A;  2KPM A;  2X6Y A;  3KZY A;  4EQQ A;  4OIO F;  3K4M A;  4RB3 C;  1SD5 A;  2KJB A;  2EJR A;  1RC9 A;  2X9D A;  3G73 A;  2BE5 F;  3FHZ A;  5F0F A;  5D4S A;  4B3A A;  3W2W A;  2V9P A;  2VQC A;  1GHC A;  1LE8 B;  1RKT A;  4R8H A;  3WG9 A;  1B8I A;  2JJ7 A;  4UV9 A;  5F27 A;  3K6G A;  1XD7 A;  3LL7 A;  3LQQ A;  5IP9 J;  1B72 A;  4MNU A;  4A0Z A;  2DQR A;  4MQ9 F;  3HGY A;  2EV0 A;  1TP4 A;  1J7K A;  1EF4 A;  1H0M A;  1BI1 A;  1L0O C;  3HYI A;  5IP6 A;  4KMF A;  3CDI A;  2E1M C;  3L09 A;  1WJD A;  2AHQ A;  4A6E A;  4D0P A;  5H2F C;  4CYC B;  4C30 A;  4IRG A;  5B66 C;  3IRR A;  2MLK A;  2FOW A;  2X51 A;  1LEA A;  4J00 A;  3FXK A;  4WX9 A;  3K4B A;  4V2G A;  4HX8 A;  3HUG B;  4PSX A;  1VQK I;  2KRH A;  3PNV A;  1WZ2 A;  3KPH A;  5HS8 A;  1IN8 A;  1IXR C;  2EFW A;  5FJ8 J;  1ZLJ A;  2Y69 H;  2Y9Y A;  4EEF G;  1O3S A;  3WGI A;  5L3E A;  4UUS B;  4J01 A;  1U6G A;  1K78 A;  3A4C A;  2ADU A;  4XNF A;  2A5Y B;  1U3E M;  1E3H A;  4XSZ F;  4G7Z F;  1YHQ I;  4BJ5 C;  5M5Y J;  3EUA A;  4MEY F;  1UHM A;  2A5W A;  1B4A A;  4GGG A;  5CJ9 A;  2DFE A;  5L3G A;  4BE2 A;  1O57 A;  4LB6 B;  2HKO A;  4XKC A;  3K4N A;  4HRI A;  3IAS 2;  1IXC A;  4OMY A;  5B1B H;  2PMZ A;  1ETV A;  3DTK A;  2WC2 A;  4RM3 A;  2DQL A;  4CUG A;  3A01 A;  3SYT A;  2W82 A;  5K5R A;  5HLH A;  3G1L A;  1JI8 A;  3ABT A;  1YW8 A;  1U5T C;  2V9V A;  1RKW A;  2OCC H;  1IG7 A;  3BY6 A;  1BJA A;  2WAQ N;  4HQE A;  2V6E A;  5HNF A;  3LNQ A;  1UCR A;  1JUM A;  3IL2 A;  1M1E B;  1XGN A;  1R58 A;  2DJN A;  3TP0 A;  4AIH A;  1LUJ B;  2ZXH A;  4EM1 A;  2L4A A;  5H6R A;  1MMS A;  1F4K A;  4IRI A;  3VYT B;  3OSG A;  2MC3 A;  2OPT A;  3EYI A;  1JTX A;  1IV6 A;  2R7Z J;  1K7A A;  2PJR B;  4DYQ A;  2NXN B;  1P7J A;  2LMD A;  1V4R A;  2HVQ A;  4EJT A;  3HEF A;  3HXL A;  2H8R A;  3C1D A;  3FXQ A;  1IO2 A;  1V55 H;  3O8H A;  3LFU A;  2HPI A;  5E17 F;  3WE3 A;  2KIU A;  3FHN A;  5IYB J;  1ZGJ A;  1XGO A;  2NS8 A;  3TGN A;  1DPU A;  4BHC A;  2GA1 A;  4IL6 C;  2FA5 A;  1W4M A;  2CJJ A;  4BH9 A;  1DGW Y;  5FRM A;  1JKR C;  4BNC A;  1KYZ A;  4CZZ A;  1YRN A;  3OS1 A;  3SDG A;  4LK1 F;  2M3A A;  1KQ8 A;  2LRE A;  3HOX J;  1ETW A;  2H94 A;  3KYC B;  2QYO A;  5EZH A;  4ZYD A;  3QP6 A;  3BR5 A;  1GDT A;  1VQ5 I;  2Y0M A;  3Q0V A;  1TC3 C;  3BDD A;  1ZK8 A;  1OCZ H;  4DYC A;  3TKY A;  2IRF G;  2VC1 A;  4KA4 A;  4IKF A;  1MD0 A;  3OYA A;  2V26 A;  3IV5 A;  4BHP A;  2D45 A;  5FLX Z;  4ENM A;  4EMS A;  4JYK A;  4CCL A;  2DLL A;  1ETX A;  2VE8 A;  3I58 A;  1SMT A;  1P4X A;  3MZH A;  5TGT A;  4UVB A;  1LFB A;  2OQG A;  5F1J A;  3K7A J;  3MQ0 A;  4EVI A;  3CMY A;  5IT9 Z;  1MND A;  3DQV C;  4WXH A;  3LSK A;  2R93 J;  3DTI A;  4E7S A;  5D6E A;  1Z21 A;  2DYS H;  2ECC A;  2CO5 A;  4AD9 A;  2CQN A;  4BXX J;  4XKB A;  2DFF A;  1NTC A;  5HVQ C;  2DA1 A;  2EA4 A;  2VBW A;  2GOM A;  4U0W A;  2ZFW A;  2CYY A;  2RGV A;  3FMQ A;  2MSY A;  3JCU C;  2XSD C;  5EEA A;  1T56 A;  1ODD A;  1R4N B;  3HOS A;  1XN7 A;  5HLI A;  4IF4 A;  3BCA A;  1Z3Y A;  3C2G A;  1TWC J;  3CC7 I;  3HSE A;  2YPR A;  5CLS A;  1BIA A;  2ZME A;  1MH4 A;  2QQB A;  4B8X A;  3WTW C;  2EFP A;  4LLG F;  5FKK A;  3OYK A;  3LMM A;  1BM9 A;  1TWH J;  4CYD A;  5F1R A;  1YE9 A;  4HZF A;  3A01 B;  1YQA A;  3CP8 A;  1TQM A;  4N9I A;  5BNG A;  1BL0 A;  4L0Y B;  4OMZ A;  1HST A;  2MFZ A;  3HBL A;  3Q0U A;  1ZN2 A;  4U7D A;  4IQJ A;  1J5Y A;  2OZU A;  4G7O F;  2ELK A;  5LHG A;  3A2K A;  3H0G J;  1O3R A;  4AYB A;  2MYS A;  3K1N A;  5FRO A;  1MMD A;  1V5F A;  2VOO A;  2IS1 A;  4P9U A;  3I9V 2;  1VQO I;  2VQH A;  3M8E A;  4CDG A;  3KFW X;  1GXP A;  4D7N A;  2QLZ A;  2XAG A;  4EGZ A;  4LOC A;  3L2V A;  1BI0 A;  2DA3 A;  2O3F A;  2JA7 J;  3RKY A;  4XLF A;  2KLO A;  3RPU A;  4AVZ A;  1SD6 A;  4KFC A; 
#chains in the Genus database with same CATH homology
 1MBE A;  3F0C A;  3TP3 A;  2L9R A;  5IP7 J;  1X58 A;  5J1Y A;  2XGD A;  5EG0 B;  3BTL A;  4QTR A;  5J3L A;  3BG9 A;  4M3F A;  2I10 A;  4V2F A;  1VF9 A;  5K7Z A;  1R9T J;  3ZQI A;  3DEW A;  1YRN B;  1BW5 A;  1AHD P;  4JX4 A;  5JLX A;  1I3Q J;  1XG1 A;  1ETY A;  3C2B A;  2D5V A;  2XPW A;  1K83 J;  3BR2 A;  4X1E A;  5E3L A;  2W48 A;  5C3E J;  5EG0 A;  3S2H J;  3GTL J;  2EQR A;  2YU9 J;  1T33 A;  3GTQ J;  1JJ8 C;  5F08 A;  1Z0X A;  3IH2 A;  3OOU A;  3CCY A;  3RKQ A;  5E3N A;  1RPW A;  4RBO A;  5HOD A;  3MVP A;  3HOZ J;  4D5F A;  3NAR A;  3LSJ A;  4D5C A;  2OF7 A;  1S7E A;  4GFB A;  1ZGW A;  3CDL A;  1K61 A;  3HOY J;  2HDD A;  2P81 A;  4IHY A;  1BJZ A;  1MBG A;  4AYB N;  2HXO A;  5IPA A;  9ANT A;  2DMN A;  2B63 J;  3BR6 A;  1XC5 A;  2ECB A;  4A69 C;  4IEJ A;  4RDU A;  3PM1 A;  3JRB A;  2R5Z A;  1IDZ A;  1IJW C;  1ZR2 A;  3TW7 A;  2E2J J;  3RZD J;  3ZQH A;  3GTP J;  1JUS A;  2HOA A;  5C4J J;  2FQ4 A;  3S1N J;  4A3B J;  2M8G X;  4I76 A;  5IOY A;  3CQZ J;  2E19 A;  4B4C A;  2E2H J;  2L7F P;  1GT0 C;  2CUE A;  1IUF A;  5M5X J;  2NVQ J;  3B6A A;  2JA8 J;  1WPK A;  4A3M J;  1JJ6 C;  2O8K A;  1GVD A;  2DMP A;  1QPI A;  3S14 J;  4A93 J;  2IBD A;  3GTJ J;  3G1M A;  4M6V A;  1IRZ A;  4JP0 A;  3OSF A;  4MLO A;  4BBS J;  4JX5 A;  3FIS A;  2QCO A;  1RR7 A;  3BTJ A;  4AUX A;  3SJM A;  2CUF A;  5F0H A;  3ZQC A;  3HOU J;  5FKO A;  1LE8 A;  1GV5 A;  2LR8 A;  1W0U A;  2LK2 A;  1WI3 A;  1H8A C;  1MNM C;  5EDN A;  2K40 A;  2Y31 A;  1TWF J;  2DMQ A;  4BY1 J;  1X2M A;  4M3E A;  4MIM A;  1H89 C;  1U78 A;  1I6H J;  1MH3 A;  5K7H A;  4A3F J;  1GV2 A;  1UHS A;  1MBF A;  2LP0 A;  4IHX A;  2CQX A;  1ENH A;  2ZB9 A;  2R0Q C;  3BQY A;  2DA7 A;  3S1R J;  5M3F J;  1POG A;  2L0K A;  4FE7 A;  3RQI A;  2JMW A;  3M3Y J;  3JRH A;  1MSF C;  1MBJ A;  2Y2Z A;  1U9N A;  2FJ1 A;  2JN6 A;  3G1O A;  2VUM J;  3W6V A;  3S1M J;  3QPS A;  1JT6 A;  1GUU A;  1A6I A;  3JR9 A;  3QQA A;  1ITY A;  4C3H J;  2DMT A;  1WH5 A;  3DCF A;  3UKG A;  1JKQ C;  4A3C J;  2HOS A;  1AU7 A;  2YUS A;  2DA6 A;  2L7M P;  2N8G A;  1RES A;  3RZO J;  2GM4 A;  3JRF A;  1VND A;  2JWT A;  1PUF A;  1ETO A;  2HQ5 A;  2IEK A;  1OCP A;  2Y30 A;  3JRC A;  1JKP C;  3HDD A;  4A3K J;  2RAE A;  1QRY A;  4BY7 J;  4IHV A;  1HF0 A;  2ME6 A;  3WHC A;  1NK3 P;  2AO9 A;  3A03 A;  1FEX A;  2EBI A;  4XIC A;  3PO2 J;  3JRG A;  3HM5 A;  3ZQG A;  4XID A;  2ID3 A;  5C4X J;  1MBH A;  4XRS A;  4W97 A;  5EF6 A;  3FKI J;  5FKL A;  2K9N A;  2R5Z B;  1HLV A;  2LD5 A;  3LSG A;  1TWG J;  3Q3S A;  3HKZ N;  4BBR J;  5IYC J;  1MSE C;  4M3D A;  4C3I J;  3IH3 A;  2WV1 A;  5J1U A;  1OJL A;  5IYD J;  3L1P A;  4B1R A;  3ZQL A;  2EZH A;  3HGG A;  4HNV A;  2MW8 A;  1JT0 A;  2ID6 A;  2JK3 A;  3HB9 A;  4W1U A;  4FIS A;  1HDD C;  4FE4 A;  3GTK J;  1WH7 A;  1B8I B;  2NS7 A;  5FKM A;  3LSR A;  5GPC A;  2M9H A;  1IDY A;  1B72 B;  1IGN A;  2R92 J;  2X9D A;  2EZI A;  1ZTR A;  2X6O A;  1UG2 A;  2VPR A;  5F0F A;  4FTH A;  4L5E A;  4A3I J;  4B3A A;  2XGE A;  2NVT J;  2KDZ A;  2QF7 A;  4JX6 A;  3LSP A;  2VKE A;  2LLK A;  1LE8 B;  1RKT A;  5M5W J;  1B8I A;  2JJ7 A;  5F27 A;  2LTP A;  5IP9 J;  1B72 A;  4XK4 A;  2Y0S N;  3HGY A;  5EGO B;  3O8G A;  1ZQ3 P;  1EF4 A;  2DA2 A;  5IP6 A;  1ORK A;  2NVY J;  3I4N J;  2O7O A;  2AHQ A;  1FIP A;  4CYC B;  2HXI A;  3FK6 A;  3D1N I;  2MG4 A;  2R5Y A;  4S0H B;  4FCY A;  1HCR A;  1W0T A;  4V2G A;  3MKL A;  1WCM J;  5EGO A;  1QVU A;  4C3J J;  4QIW N;  1TWA J;  3IH4 A;  1A5J A;  1LFU P;  2G0E A;  1HDP A;  5F0C A;  4CYC A;  1JKO C;  2LY9 A;  5FJ8 J;  2Y9Y A;  1ZKG A;  4EEF G;  3S17 J;  3S2D J;  2NVX J;  3TW6 A;  2FX0 A;  4UUS B;  1P7I A;  1ETQ A;  2GLO A;  3VPR A;  2CU7 A;  2DA5 A;  1PUF B;  4I6Z A;  4DW6 A;  5M5Y J;  5FLM J;  2IAI A;  3NAU A;  5DTD A;  2XGC A;  3B6C A;  4UUT A;  3WHB A;  3BQZ A;  1ZR4 A;  1WGX A;  3BT9 A;  2HI3 A;  1ETV A;  3BTI A;  5C44 J;  1H88 C;  2H1K A;  2DA4 A;  3K2A A;  5IOZ A;  3A01 A;  4UUS A;  2TRT A;  5DS9 A;  3LOC A;  3G1L A;  2K9Q A;  3OIO A;  3JRD A;  1Y1V J;  2WB1 N;  3M4O J;  2MGQ A;  1RKW A;  1IG7 A;  4BKX A;  2WAQ N;  4A3D J;  3LNQ A;  1JUM A;  4M3B A;  3A02 A;  3E7L A;  2DJN A;  3TP0 A;  1DU0 A;  3HOW J;  4Y52 J;  1FJL A;  2XPV A;  1VI0 A;  1F43 A;  4DZJ A;  4MFE A;  2DN0 A;  1X2N A;  3OSG A;  2OPT A;  2CQQ A;  1JTX A;  4MFD A;  1IV6 A;  2R7Z J;  3Q0W A;  1GDT A;  1SAN A;  4DYQ A;  1RET A;  2ME0 A;  2LKX A;  3S1Q J;  3BR3 A;  1P7J A;  1HOM A;  4NDL A;  1DU6 A;  3HEF A;  3S16 J;  2H8R A;  1FTT A;  2COB A;  3O8H A;  3BR1 A;  4A3G J;  2O9L A;  3S15 J;  2HYJ A;  3BG5 A;  2M2E A;  5IYB J;  5M3M J;  5J1R A;  2NS8 A;  1U8B A;  4A3E J;  3JRE A;  1D5Y A;  1APL C;  1BA5 A;  2CJJ A;  1Z77 A;  4XRM A;  1O4X A;  1JKR C;  4C2M J;  2LFB A;  1XS9 A;  1FIA A;  2VI6 A;  1YRN A;  3SDG A;  1MBK A;  2GBY A;  1AKH B;  3HOX J;  1ETW A;  5EZH A;  4ABZ A;  2L7Z A;  3BR5 A;  4M3G A;  3Q0V A;  3TED A;  1BW6 A;  1F36 A;  2XB0 X;  1ZK8 A;  4G12 A;  4DYC A;  1TC3 C;  4A3J J;  1I50 J;  4IHW A;  3ZQF A;  3IV5 A;  2TCT A;  5FLV A;  1E3O C;  4JYK A;  1Q1V A;  3PO3 J;  5FKN A;  1ETX A;  2PMZ N;  2XB5 A;  5GPA A;  2R5Y B;  1AKH A;  2FD5 A;  3QPL A;  5F04 A;  1LFB A;  5JLW A;  5F1J A;  2KT0 A;  3K7A J;  3CMY A;  2HOT A;  5EYR A;  3GTG J;  2R93 J;  4D7M A;  2M0C A;  3I4M J;  3HOV J;  2ECC A;  2K9S A;  4BXX J;  3BR0 A;  1NTC A;  2DA1 A;  1OCT C;  3BG3 A;  1U9O A;  2JA6 J;  4DZP A;  2DMU A;  2M34 A;  2MSY A;  5E3M A;  5EEA A;  2XSD C;  1T56 A;  2JA5 J;  1UMQ A;  4QSH A;  1IC8 A;  3FIW A;  1JGG A;  5EZG A;  2Y9Z A;  2XPU A;  1TWC J;  4AC0 A;  2LVS A;  2DTZ A;  2YS9 A;  5K7F A;  4A3L J;  1MH4 A;  2EZK A;  5FKK A;  1OFC X;  2NOG A;  2EZL A;  1TWH J;  1Y1W J;  3H3V K;  2VKV A;  2E1O A;  3A01 B;  1QVT A;  1FTZ A;  5BNG A;  1BL0 A;  2CRG A;  1CQT A;  3JRA A;  3HBL A;  3GBG A;  3Q0U A;  1JTY A;  1VFC A;  3GTM J;  1JUP A;  3SFI A;  1G2H A;  2ELK A;  3ZOB A;  4Y7N J;  1ETK A;  3H0G J;  2EH3 A;  4DYR A;  2XRL A;  4J19 A;  4X6A J;  4D7N A;  4MO7 A;  4LOC A;  4XRS G;  1NK2 P;  2DA3 A;  3GTO J;  2JA7 J;  1SFO J;  3MN2 A;  2X48 A;  3FK7 A;  3JRI A;  5E3O A;  5GP9 A;  2E2I J;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...