3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
b'SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
4EJWA 4EGYA 3U2RA 3J80Z 1LNWA 3MEXA 4MHGA 4ESJA 2ISYA 1T0FA 5ICEA 2MA3A 1ON1A 1F5TA 1GVJA 3WGGA 2QWWA 1J5YA 4LMYA 1P2FA 5ILUA 4NQWA 1S6LA 4RAZA 3RKWA 4GO1A 3RJPA 4BH9A 3CUQB 1FPQA 2TDXA 4BXUA 4XSZF 4BAYA 2IVMA 3QPTA 1PDNC 1HQCA 4DNCA 1Y0UA 3K2ZA 3L09A 3GW2A 4ZYHA 5L3EA 4EM0B 2KIUA 3I5UA 4L9NA 2K02A 1B4AA 3TOAA 4RB0A 5LHHA 3HSRA 2HTJA 2QM3A 2CFXA 1ZRDA 3KP2A 1A04A 2L02A 4IF4A 1T39A 5L3CA 2KIMA 3DFGA 4OMZA 2Y48A 1IW7F 4ZYEA 2VE8A 4IHSA 1IN6A 3SZPA 4WXDA 3KP3A 3ECOA 4HF0A 1IN4A 3KEOA 2FOKA 1T6SA 1XD7A 3IWFA 1TW3A 3N4MA 1HW5A 3I59B 3VOEA 1GXPA 1U5TB 3IKTA 1U6GA 1HSTA 3F72A 1MDMB 1MJAA 4WXHA 1Z6TA 2PQ8A 3MAJA 3RIRA 1K78B 4ZYDA 2YU3A 1LJ9A 1WWXA 3CLOA 1KQ0A 2V1DA 1DUXC 4PGHA 3RPQA 4HDVA 1QZZA 3NQOA 4KIFA 3R60A 4L5JA 2MD5A 2Z99A 1DPUA 3NRVA 5DEQA 3QP5A 2H6BA 2EFWA 3SFZA 4B09A 3HUGA 4IHTA 1FP1D 4MQVA 1QPMA 3LA2A 2E1NA 3U1DA 2CW0F 1O3RA 4Q5SF 2RQPA 1AOYA 5LGTA 2PN6A 4LLNA 4CDGA 2CO5A 3IKVA 2ZKZA 4MNUA 3S2WA 4HYEA 4RGXA 3V8KA 2KJCA 5LGUA 1PP8F 1XN7A 4OIQF 5F6FA 3OV8A 5HS7A 2PMHA 3QU6A 3ZMVA 1LQ1A 3ERED 3DF8A 1R7JA 2VC0A 1ZLKA 3J81K 5JHUA 3QRFF 1RNLA 4JK1X 3REOA 1U3EM 2D1HA 2K86A 1STZA 2FNAA 3J7AO 2EB7A 2OAZA 2HR3A 3LQQA 4G7HF 3RTRA 2VODA 4PGGA 5LHGA 3ZMSA 1IZ1A 2RKHA 4ENNA 4KYWA 1G3WA 1UHWA 3SZTA 1OKRA 4F7ZA 3FX3A 2HTSA 4RGSA 2KJBA 4PCQA 5E1XA 5BPIA 4GYGA 3DPLC 4MTEA 3LSTA 2BGCA 5LEJA 3VEPA 3WTTC 4LLGF 3FMSA 1FWZA 3T8RA 3P9IA 2L54A 1XGMA 1ULYA 2LF7A 4A6EA 4LK1F 5FD6A 4HQEA 1L3LA 2Z33A 2BEOA 3K69A 1QNTA 3I4PA 4AD9A 5IT9K 5BMZA 2K7LA 2VT3A 1S7OA 4M9SA 1REPC 4O3MA 3C7JA 3LA7A 1S7AA 2E1CA 4L9VA 4BQAA 3HSEA 5LBQA 2C6YA 3FXUA 4ETSA 2X4HA 5D6FA 3MZHA 3L00A 1H0MA 4ZZDA 5LGNA 1ZG5A 1Z6RA 2EJRA 2BV6A 3M8EA 1H9GA 3ECHA 3KP7A 3KZZA 2LKPA 2OQRA 3BJ6A 2LDUA 2IRFG 5ED4A 2XIGA 4I7HA 2A07F 3L7WA 4ASNA 4MTDA 3F8MA 2GAUA 4S05A 5JR3A 2W25A 3ELKA 1E17A 5KK1A 1XSDA 5D4RA 1ZN2A 5J6XA 2FXAA 3HHGA 3C1DA 2O6GE 3R4KA 1O7LA 2YX4A 4A12A 4AIKA 4M72A 2IA1A 4P5OA 5DYMA 3WTSC 2H6CA 4RB3C 5JVTA 2ZNYA 4CICA 1J2XA 4A6DA 1Z9CA 1O7FA 2MH2A 1R5HA 4Z2YA 3WE3A 5E1WA 4A0XA 2DQRA 3K9TA 2KRFA 2PI0A 2RN7A 1OPCA 1DP7P 3BJAA 4H0EA 4S04A 4Y15A 1LVAA 1BIBA 3F21A 2A69F 5D5WB 3I53A 2EA2A 3ROUA 2J5PA 3KZYA 5L3DA 3VB2A 3VODA 2HZTA 1FZPB 2LNBA 2F2EA 2PJPA 3JAMZ 4GGGA 2V9VA 1ZRFA 5CVUA 2XAQA 4HBLA 2GWRA 3CO7C 4U7BA 1RI7A 1ZLJA 3FXRA 4RB2C 1FOKA 3EETA 1F4KA 1IF1A 1FNNA 4G6QA 1FBUA 3ZMDA 2QZ8A 2QQAA 4UVCA 2ETHA 2QQBA 3F8FA 3WODF 3HRTA 4UV8A 1OR7A 5J8CA 4CGZA 3GZ5A 3O6BB 2OBPA 5A2QZ 4QLCU 4FHTA 2JTVA 4L18B 4HX8A 4EM2A 1TTYA 4P96A 5BOXA 3CDHA 3E6CC 5DUIA 1GHCA 4L9JA 4EQQA 3WTUC 5E18F 4AVPA 5H20A 2FBIA 3GXOA 2VOPA 5DCFA 1X3UA 5HDKA 2KKOA 2P8TA 3GO5A 4FX0A 3KFWX 3ZMTA 4KN4X 2P6TA 2IPQX 2E7WA 4ON0A 3CJNA 1XCVA 2OU2A 1OYWA 3RPUA 3LA3A 5E8GA 3R0JA 2HGCA 5DCMA 4HQMA 3E5QA 1O3SA 2DLLA 1LEBA 3WGHA 3E6DA 4IRGA 1SAXA 4RS8A 2VN2A 4K2EA 3H92A 1IAWA 1YYVA 1I27A 1L0OC 1W5SA 4FX4A 5HOOA 2Z5UA 3QAHA 5FO5A 2QBYA 3RI4A 1MD0A 1UB9A 1ODDA 3KETA 1UCRA 2FBKA 2QQ9A 1SD5A 2WC2A 3HOTA 5FLXK 2A3SA 2NRAC 1TBXA 3HOSA 1SMTA 3I54A 4M71A 1KQ9A 3K1NA 1BBYA 4L9TA 2AXLA 1IRGA 2W24A 3ZQ7A 3NEUA 1O3QA 3CO6C 2O0YA 2MBFA 2EA4A 2DFIA 4P55A 1FYMA 2H94A 1LDDA 1FYKA 5D8KB 4OIOF 1DPRA 4Q48A 2M8EA 2ZBKA 3EYYA 1LDJA 4UV9A 2HFHA 1W5TA 1R1VA 3F8NA 3GFLA 4HDUA 2XASA 1S29A 3J80K 3F6OA 3FM5A 2VOOA 4L0YB 5CVJA 5TJJA 4UXNA 3TDUC 3IRQA 3FHZA 1R1TA 4YFKF 2JPCA 1C0WA 3DQVC 4LLLA 4HX4A 2QENA 2V1XA 4GCVA 4KFCA 1W7PD 2COMA 1KU2A 3QPHA 4LG0A 5CJ9A 3D0SA 2ADUA 2H09A 2A6HF 3GFMA 1KU9A 5BPDA 2VONA 3M1EA 5E1ZB 5BQTA 3CUOA 3DPTA 1WI9A 1USSA 3TOBA 2Q0OA 3BPVA 3MFKA 4RGRA 4EV0A 4ENKA 1I6XA 1XDUA 4IJAA 4Y17A 3SXYA 5K5RA 1YW7A 3FM3A 3CUQC 1FC3A 3V7SA 5LHIA 3F3XA 5J8FA 1R58A 3N97A 1U2WA 5TRDA 3C18A 1KYWA 4HZFA 4L5IA 2QVOA 3BDDA 3BROA 1TQMA 5DUKA 3J81Z 1OYYA 4N9IA 3ABTA 2FEZA 3P9CA 1U8RA 2NAZA 5DCMB 5LLQA 1B6AA 1R00A 2M5WA 3E5XA 2VC1A 1F1ZA 4PZJA 3JSPA 3BP8A 2NNNA 3HRMA 1FLIA 3SHFA 4ESBA 3B02A 3H3ZA 1SFEA 3RDIA 4P9FA 2UXXA 3E5UA 2J5OA 1B59A 2DO7A 2K27A 4RGUA 4HW0A 1BJAA 4U0WA 4YIFA 5H6QA 3F23A 4E70A 1P4AA 1HKTA 1U5TC 3PFIA 4GYIA 1D5VA 4R8HA 2QBYB 2VBWA 2BBYA 1SFUA 2GXBA 2FMYA 3F8BA 2MC3A 1FYLA 2A61A 1ZREA 1TLHB 3D5LA 1P4XA 4XSXF 2GQQA 2HWVA 3Q9VA 1VTNC 4OINF 2RNJA 4M73A 2STWA 5D5XB 2M30A 2QLZA 3RKYA 4UHTA 4U88A 4NB5A 3ISPA 5FFZA 5E17F 4RAYA 4PDKA 2EFQA 3L2CA 2A5YB 2ACJA 3LQRA 2FBHA 4EJVA 1P6RA 5F64A 1XMAA 4TV7A 1XB4A 4HV6A 2IA2A 4G8XA 4WXCA 3IHUA 2ESNA 1E2XA 1Z7UA 1IXSB 4AIHA 5L3GA 3BPXA 4KIBA 2PFBA 3IWZA 2UWMA 3T1BA 2YSRA 1O57A 2P4WA 4KA4A 4LG0B 4A5NA 2V6CA 4O5VA 4IRIA 2FU4A 5ICGA 1MJ9A 1ZHFA 1UHMA 3WG9A 1BC7C 5FD5A 4M6YA 2DPUA 4YFNF 1R5GA 3HSFA 2L3DA 3BWGA 4BHPA 3H3UA 2XROA 5KVRA 4OOIA 3R0AA 1J75A 1K6OA 2X0LA 2E7XA 1BIAA 4KT5C 5ICCA 4BNCA 4D0PA 1FSHA 2YR2A 3V8JA 1OYIA 5DDGA 1W7PA 1YIOA 4A0YA 2G7HA 3GEZA 1SFXA 3TQNA 3KE2A 2DW4A 2ZMEA 1ON2A 3KLNA 2OQGA 5LRRA 2PEXA 1FBSA 4L0ZB 3I71A 1BC8C 5HS9A 4KMUX 2G7UA 4MQ9F 1RIOH 5HLGA 1CGPA 1XGSA 3K0LA 1SD6A 4A0ZA 1HW1A 1H9TA 3GWZA 2DTRA 3F6VA 1FBQA 2XRNA 1SD7A 2FQ3A 1RUOA 2OD5A 1T38A 3JW4A 3WE2A 1XDSA 3CTAA 3EQLF 3FF5A 2R7DA 4XLPF 3EUHA 4Q47A 3V8LA 1MGTA 1NHAA 2F5FA 4HX7A 3E6BA 1XMKA 3LAPA 2ZXJA 3KLOA 1YLFA 3K1PA 4G94A 1GXQA 3G3ZA 4IVNA 1J9IA 3ABUA 1R36A 3WU1B 4WF2A 2P7VB 1V3FA 3WTYC 3RYRA 1G3SA 3MWMA 1K78A 5E20A 4IPAA 3K1MA 3MCZA 1SD4A 4IXAA 2K4JA 1G3YA 5FGMA 1ZYRF 2W57A 4KIGA 1Z91A 4UVAA 4LGWA 1QQIA 2EV6A 3JTHA 3COAC 1P4WA 2QYOA 4EJUA 3JAMK 2V1UA 4O6JA 1JXSA 3G73A 3MQ0A 2EFOA 1J7KA 2WTEA 2KIFA 2IW5A 1HSJA 4DQ2A 4WK8F 3E3VA 3DKWA 2CG4A 3HYIA 1EH7A 2JT1A 1B9NA 2XUBA 3IC7A 2P6SA 4R1HA 5HLIA 2V79A 1BI2A 2MH9A 1PP7U 2ZFWA 3TO9A 3P9KA 4AWXB 5DV5A 5A2QK 2Q2EA 1MKMA 2Z3YA 2XGXA 2EWNA 1BI3A 4UNOA 3I58A 5JI6A 5K1YA 2PMUA 4UVBA 1DDNA 3KP5A 2W84A 2NNYA 1YTYA 3U9GA 1WKMA 3EDPA 3L9FA 2CYYA 5LRSA 1KU7A 4G7ZF 1ZG1A 3RKXA 2XVCA 4KDPA 1TQIA 3GZ6A 2ZJ2A 2DI3A 3M7GA 3WTVC 1XSXA 1YW8A 2XHKA 1FY7A 4CZZA 1EH6A 1CF7A 3ULQB 2DK8A 4LB5A 1IN7A 1W7PB 4HF2A 2WWYA 1HBXG 5IT3A 4CYDA 3GF2A 2VBYA 2WV0A 1KGSA 2HKOA 1XGNA 1K79A 3C3WA 1XGOA 4FT8A 2ZMEB 1Z05A 2M45A 4EGZA 2RVCA 3PQKA 5LEKA 4A5MA 2CWEA 1IN5A 3KEQA 3E97A 1G4DA 4LD5A 1WRJA 3KCCA 4I02A 4BYYA 3GFIA 3ZN0A 1LB2A 2M87A 3PQJA 1D8KA 3DXJF 2Y75A 2ZO4A 4JBAA 3T8TA 2PBIA 5F1RA 4EMSA 4EVIA 2O3FA 2HYFA 4P9UA 5FFXA 3Q5FA 2P7CB 1JHFA 4G7OF 3GFJA 2DK5A 3LAJA 4ZYGA 4LFUA 4OIRF 1YS6A 2VT2A 4XBFA 1V4RA 4ZZLA 1BI0A 2O61A 3B73A 1T2KA 2GA2A 4HF1A 1OMIA 5ILVA 1PUEE 2IP2A 1EV7A 2ELHA 4G6DA 3HTSB 4ENJA 2HQNA 1BM9A 1USTA 4MEYF 5E8IA 3HRUA 5HDGA 1MZBA 4U0YA 3IRRA 1HXDA 1J59A 3Q9SA 2EK5A 2FMLA 2EV0A 2FNPA 1QO0D 5ICFA 2R3SA 1U78A 1YQAA 5BS6A 3LFKA 5CYVA 1XSVA 4HOBA 2Z9OA 1HKSA 5CVRA 3O2PE 4IRHA 3E6MA 3V7CA 1IXCA 3T5XA 2Y0MA 2OZUA 3ZMZA 1ZGJA 4NHJA 1KQ8A 2XKPA 1S3JA 5EEHA 1I5ZA 3TKYA 1J0RA 3O3KA 2O03A 4KICA 1W4MA 2XKOA 3M9AA 3WTZA 1T98A 4KN7X 3R61A 4I01A 3M8FA 2D2WA 1R22A 1TNSA 1D8JA 2FRHA 3FWEA 2HQRA 1YFHA 3SQNA 5IT9Z 3MZYA 2GA1A 1JGSA 2HS5A 2XAJA 5ILSA 2XAFA 2UZKA 1FSEA 1K7AA 2P5VA 3TO7A 2LF8A 2YPRA 1B9MA 2Q8KA 1CF7B 2UXNA 3ZPLA 2K4BA 4I98B 4HAMA 4M6XA 4CO8A 1I1SA 5K5OA 1QZYA 2DU9A 3RYPA 2VBZA 3AAFA 2RDPA 1ONVA 5HS8A 2BE5F 2PG4A 2IJLA 2B0LA 4M74A 5L3BA 3F22A 4EJOA 2ESHA 2IT0A 5D4SA 3VFZA 3ML6A 4OU0A 4M9XA 4HLYA 3WU0A 2EFPA 3QU3A 5FB2A 1KA8A 4BHCA 3TGNA 5D5VB 4LB6B 5K5QA 4RB1A 2RGVA 2GIVA 1O3TA 3HRSA 2JRTA 3R6SA 3ZN1A 3GVAA 4AIJA 1FX7A 2LSOA 5EEGA 5HLHA 3LWFA 2HKXA 1WQ2A 1BI1A 3V7RA 4I2OA 4HA8A 2P5LC 4LK0F 3JTGA 2JPBA 2FA5A 2AS5F 3W6KB 5ERIA 5HVQC 4OMYA 2OZ6A 1TW2A 3DV8A 2P5KA 3F8CA 2A68F 1QGPA 1ZAOA 2FSWA 4EM1A 4Q4ZF 1R1UA 5DD4A 5AIPA 1P92A 2FF4A 1I1GA 5L3FA 4ENMA 1SMYF 3OOPA 4WX9A 2L01A 2OA4A 4BHBA 5AONA 2JZYA 2HOEA 2STTA 2F5CA 1WSUA 2GXGA 3T0YA 4A2UA 1BN5A 2JSCA 3EYIA 1XCBA 1JHHA 3V4GA 1B1BA 3W6JB 2CSOA 1RUNA 1FT9A 2VXZA 2NYXA 4OIPF 2W85A 4WCGA 1D3YA 4XRFA 1Z1DA 1G3TA 2ZNZA 4ESFA 3DEUA 2IA0A 4KUMA 2DAOA 2F5DA 2HDCA 3CUQA 1F9NA 2DBBA 1BOAA 1IUYA 4JQFA 2NS0A 2O8XA 4HLXA 2DPDA 1FP2A 2ISZA 1LEAA 2VE9A 4XLNF 3JSOA 1IRFA 4ZH4F 2M1BA 5CLSA 2MLGA 3GYHX 1ZG3A 4G9YA 1UFMA 2DT5A 1EH8A 2GZWA 2DQLA 5CVIA 1YS7A 3BY6A 2QUFA 2RC4A 2HEOA 3BZ6A 3TO6A 1ZGAA 2MLKA 2XV4S 4KNYA 1S8NA 4I0AA 5AIQA 3GX4X 1IN8A 2H27A 5D6EA 3KP4A 4HV5A 2F5EA 3WTXC 2L4MA 2YX7A 4KMFA 2PLYA 1TNTA 3I59A 4MGRA 2EFNA 1U5TA 1MDMA 3ZMUA 1HW2A 2XAHA 5D8LB 2XAGA 4I09A 4EJTA 2R7FA 3DP7A 3I0TA 3FXQA 3TDZC 4I0BA 3ZP5A 1HKQA 2A6EF 3BOQA 4U7DA 1MJBA 1KU3A 3FMQA 3GLXA 4GXOA 1IXRC 1QBJA 3QP6A 2L4AA 1ZARA 3GUDA 2FE3A 4CXFA 2D45A 6PAXA 2CQKA 3HIFA 4QWQA 2ZCWA 3HTUA 3HHHA 1KYZA 4LJZF 4MEXF 1YG2A 3FZVA 3I64A 2G9WA 4U0VA 4Y13A 2VBXA 1LDKB 3WTWC 5DD8A 3QOPA 5D5UB 1JE8A 1ZRCA 1RZ4A 4WWCA 5HDNA 5FLXZ 1YO5C 4CHUA 2RV8A 4M9ZA 4N9HA 1Q1HA 3P7NA 2D1VA 5H6RA 4R79A 2EV5A 2CGPA 5CVVA 1AWCA 3BJOA 4UUVA 2BYVE 4B8XA 3KP6A 3IL2A 4YG2F 3WGIA 1ZH5A 1YW9A 2HYGD 3FMRA 4YFXF 1TQPA 4YIIA 1R23A 4N0BA 1G6NA 5JFRA
chains in the Genus database with same CATH superfamily
4XOPA 2LK2A 2XF5A 4EJWA 4EGYA 3OYMA 4BQNA 3MKLA 3U2RA 3J80Z 4ZTFA 1E3OC 2K9NA 1LNWA 3MEXA 4MHGA 2MSYA 4ESJA 2ISYA 1T0FA 4XRSG 2QEXI 5ICEA 2MA3A 1ON1A 1F5TA 1HC8A 1GVJA 3WGGA 2QWWA 4M3DA 4MIMA 1J5YA 1OCZH 3UNGC 1U9NA 4LMYA 4XLHA 5J1YA 1P2FA 3AG2H 5ILUA 2KMUA 4NQWA 1S6LA 2CFOA 4RAZA 3RKWA 4GO1A 3RJPA 2BY2A 4BH9A 3K4MA 3CUQB 1O4XA 1FPQA 2TDXA 1X1BA 4BXUA 2XDVA 4XSZF 2E2IJ 4PFPA 4CCOA 4BAYA 5E3OA 2IVMA 2WY7Q 4RM3A 3QPTA 2DODA 3OS2A 1CQTA 1PDNC 1ETYA 1HQCA 4DNCA 1Y0UA 3K2ZA 1UMQA 3L09A 5BNGA 4IX7A 3GW2A 4ZYHA 3GBGA 4QSHA 5IP7J 3D1NI 1LPQA 5L3EA 3J7YJ 4EM0B 2KIUA 3I5UA 4AM3A 4L9NA 2K02A 2UV1A 4AU7A 1B4AA 3TOAA 4RB0A 5LHHA 4W1UA 3HSRA 4RLQA 2HTJA 3K4NA 2QM3A 1UZCA 2CFXA 4XMYA 1LFUP 4CSWA 1ZRDA 3KP2A 1A04A 4EATA 3PNYA 2L02A 1S5LC 3GTMJ 3CC2I 3SFIA 1UAAA 4IF4A 1T39A 3HXLA 4D5FA 1YJNI 5L3CA 5EF6A 1YX5A 2KIMA 4NDLA 3DFGA 4OMZA 1LKXA 2Y48A 1IW7F 4ZYEA 3GTOJ 2R7VA 1NG6A 2VE8A 2KQRA 4IHSA 1IDYA 1IN6A 3SZPA 3K6GA 5GPCA 5CQGA 4WXDA 3OY9A 3KP3A 3ECOA 2Y0SA 4HF0A 1IN4A 3KEOA 2FOKA 2LC2A 4FQGA 1T6SA 1XD7A 3IWFA 1TW3A 3N4MA 1HW5A 1S7EA 2EH3A 2R4GA 3I59B 3VOEA 1U5TB 1GXPA 4KISA 3IKTA 1U6GA 1HSTA 3F72A 1MDMB 1MJAA 4WXHA 3I4MJ 2MFZA 3VDXA 1Z6TA 2JJ7A 2PQ8A 4Z6YA 3MAJA 3RIRA 1D1CA 1K78B 4ZYDA 2CRGA 2YU3A 1LJ9A 1QHGA 5HNHA 1TWFJ 1WWXA 2X51A 4HSRA 3CLOA 1RKTA 2CUFA 1KQ0A 1QHHD 2V1DA 1YITI 1PJRA 1NK2P 2WB1A 2R7WA 1DUXC 3S3NA 4PGHA 3RPQA 5H2FC 3CCVI 4HDVA 1QZZA 3NQOA 4KIFA 3R60A 3OWTA 4L5JA 2MD5A 2OF7A 2O7OA 2Z99A 1UJ8A 2IAIA 1GLNA 2ZMEC 4BBSJ 2Z2SB 4BGDA 2XB0X 3ONQA 1DPUA 3H1CA 3NRVA 3LSMA 5DEQA 4B3XA 5FROA 3QP5A 2L0KA 1G2HA 2H6BA 2EFWA 3SFZA 2X9DA 4B09A 3HUGA 3C2GA 1ZGWA 1G59A 4IHTA 1VQ9I 1FP1D 4MQVA 5E3LA 4H4KC 2ID3A 1QPMA 3LA2A 1EA3A 2E1NA 3U1DA 2CW0F 1FIPA 3TP0A 2H1KA 1IG7A 1O3RA 4Q5SF 2RQPA 1AOYA 1VQ4I 3DEWA 3IH3A 5LGTA 2VPRA 2PN6A 4LLNA 4CDGA 2CO5A 2EINH 3D5SC 3IKVA 3LFUA 2ZKZA 4C3HJ 4MNUA 3OYNA 2KZVA 2W48A 3S2WA 2OUMA 3EUHC 4HYEA 4RGXA 3V8KA 2KJCA 5LGUA 1PP8F 1XN7A 3U21A 4OIQF 4NC6A 4X6AJ 5F6FA 1TZLA 1WJDA 3OV8A 2P0WA 4HRIA 5HS7A 2PMHA 1Y1VJ 2IXSA 1YOVB 2KDZA 4E6KG 3QU6A 3SEZA 2KRCA 3ZMVA 3ERED 1LQ1A 2Y2ZA 4EEFG 2OC6A 2XC7A 4PJJA 3DF8A 1QVTA 1R7JA 2VC0A 3ESWB 1ZLKA 3J81K 4B48A 5JHUA 3QRFF 1RNLA 2RREA 1I39A 4JK1X 3REOA 4DW6A 1U3EM 2D1HA 2K86A 2MABA 1STZA 2FNAA 2QKLB 4AYBA 3SJMA 2EB7A 3J7AO 3VYRB 1ZQ3P 1QA6A 4E7ZA 3S93A 4DYRA 1YJ9I 2OAZA 2VQHA 2HR3A 1JUPA 3LQQA 2DOAA 2X1CA 4G7HF 4ZDOA 2W00A 4E7KA 3RTRA 2Y31A 2TCTA 3RPUD 2VODA 2NVQJ 4PGGA 5LHGA 3ZMSA 4IEJA 1IZ1A 2RKHA 4ENNA 1I6HJ 4KYWA 1X4OA 1G3WA 1UHWA 1Y0NA 2FQ4A 5F27A 4NQWB 3SZTA 4RAGA 1OKRA 4A3LJ 4F7ZA 3S16J 2VXDA 3FX3A 2HTSA 4DYQA 1QPIA 2E5NA 4RGSA 3HOXJ 1LUJB 4M3EA 2KJBA 2A05A 3TP3A 1ZR2A 4PCQA 3EUAA 5E1XA 3K10A 4ZJZA 5BPIA 4GYGA 3DPLC 2N8GA 4MTEA 3OIQA 3LSTA 2BGCA 5LEJA 3VEPA 3WTTC 1ZR4A 4LLGF 2IGMA 1N77A 3FMSA 3NWSA 1FWZA 3K4KA 5F0CA 2L9SA 3T8RA 4F92B 3P9IA 2L54A 1XGMA 1ULYA 2K5CA 2LF7A 4A6EA 4LK1F 4BE2A 4OAYA 2IS1A 3KZIC 5FD6A 1DQUA 4HQEA 2OV7A 1L3LA 2JA7J 2Z33A 2BEOA 1WPKA 3K69A 1WJAA 3L2WA 1QNTA 3I4PA 2K3FA 4AD9A 5IT9K 5BMZA 1X1PA 3DPUA 1FTZA 5J4VA 1VQKI 4A3BJ 1A6IA 2K7LA 3OSFA 1HLVA 2VT3A 1S7OA 4M9SA 1V5EA 1REPC 4O3MA 3C7JA 2DA5A 4BXXJ 3LA7A 1T56A 1S7AA 2E1CA 3P5JA 4L9VA 2RAEA 4BQAA 3HSEA 2EIMH 3MN2A 5LBQA 3C2BA 1ZTRA 4B47A 2C6YA 3A01A 1OCCH 3FXUA 4G6TB 2VJ4A 4ETSA 2X4HA 5D6FA 1RETA 3MZHA 1U8BA 3L00A 3J7AY 1H0MA 3S1QJ 4ZZDA 2LH9A 5EJCA 5LGNA 1Z6RA 1XTAA 2HPIA 4XICA 4RBOA 3Q0WA 1ZG5A 1MBFA 4E7SA 2WAQA 1POGA 2EJRA 2BV6A 3M8EA 1H9GA 5CQEA 3DLAA 1MSEC 3AL0B 3ECHA 2H8RA 3KP7A 3KZZA 1GDTA 2LKPA 5IOYA 1H88C 2OQRA 3BJ6A 2LDUA 1AKHB 4XL9A 2IRFG 5ED4A 1VQ6I 2XIGA 3O8HA 4I7HA 2A07F 5B3SH 3L7WA 3DCFA 3CDLA 4ASNA 4MTDA 3HJEA 1B72A 2HDWA 3F8MA 2GAUA 4ZDPA 1ORKA 2AO9A 5GAGJ 3DBRB 4S05A 5JR3A 2R7XA 2W25A 3I9V2 3QOEA 3HOVJ 2W1OA 3ELKA 1E17A 2XGCA 3BG7A 3ZXSA 5KK1A 4BDZA 1XSDA 1D1AA 5D4RA 1R4NB 4Y7NJ 1ZN2A 5J6XA 1SFKA 2FXAA 3HHGA 3C1DA 3PNVA 5GAEJ 1JJ6C 1A36A 2O6GE 3R4KA 1O7LA 4A3EJ 2YX4A 3OYAA 2LTPA 4A12A 4AIKA 4M72A 2DXIA 3OL4A 2IA1A 3VPRA 4P5OA 5DYMA 3WTSC 2H6CA 2ZJPF 4RAFA 4HPQA 4A3FJ 4RB3C 2ZXIA 5JVTA 1SFOJ 2ZNYA 4CICA 1J2XA 2DMUA 4A6DA 1Z9CA 1V55H 4RLFA 2XPVA 1O7FA 3H0GJ 4XLFA 2MH2A 1R5HA 4BQQA 1D1BA 4Z2YA 3WE3A 3G71I 4XNFA 5E1WA 4A0XA 2QCOA 4QPOA 3BCBA 2DQRA 3K9TA 3S15J 2KRFA 4PFOA 2PI0A 3HPHA 2CQXA 2RN7A 2XB5A 4XLEA 1OPCA 1DP7P 1R5ID 3BJAA 3W3CA 4H0EA 4E7LA 4S04A 4PK4A 4Y15A 1LVAA 2RNGA 1BIBA 3F21A 2CJJA 3EUKL 2A69F 3O8GA 3NARA 5D5WB 1W0UA 3I53A 4A3DJ 2EA2A 3ROUA 2J5PA 3FK7A 3KZYA 5L3DA 3VB2A 3VODA 4GDFA 2A6TA 2HZTA 1FZPB 2LNBA 3UR3C 2X6XA 2F2EA 2HQ5A 4Y33A 2KFDA 2EZIA 5IOZA 3LSKA 2ZJRF 3BR0A 1KONA 1K6YA 2PJPA 3G1MA 4M3GA 4BDYA 3PUFA 3JAMZ 3LL7A 4XKCA 1IGNA 3KIOA 4GGGA 4JX6A 2V9VA 1ZRFA 5CVUA 2EZKA 2XAQA 4M3FA 2DA1A 4HBLA 1AHDP 2GWRA 3PFYA 3CO7C 3VSLA 4U7BA 1RI7A 1ZLJA 2AQEA 3FXRA 4RB2C 1FOKA 2VKVA 2LKXA 1BW5A 3EETA 1YX3A 1F4KA 1IF1A 1FNNA 4G6QA 1VQOI 3RZOJ 2R7ZJ 4BXFA 1FBUA 3ZMDA 2QZ8A 2QQAA 2R7SA 4UVCA 2ETHA 1Y6IA 4C3JJ 2QQBA 3TBIA 2HNHA 3F8FA 3GCMA 2NVUB 3DU6A 3WODF 4BQOA 3HRTA 4UV8A 2MD0A 1OR7A 3SZGA 1DU0A 5J8CA 3DTIA 4CGZA 2F48A 3MKZA 3CCJI 3GZ5A 3O6BB 2OBPA 5A2QZ 4QLCU 4FHTA 2JTVA 2E1MC 3HB9A 3OSGA 2LBFA 4L18B 4HX8A 4EM2A 2KLOA 4FISA 1TTYA 4P96A 5BOXA 3H5NA 3CDHA 2OCCH 5DUIA 2BW3A 3E6CC 2Y9ZA 1GHCA 4L9JA 4EQQA 3WTUC 2AHQA 5E18F 1R4MB 2L7KA 4AVPA 5H20A 2DFEA 2FBIA 3GXOA 4HNUA 2VOPA 5DCFA 1X3UA 2NVXJ 5HDKA 2KKOA 2P8TA 3GO5A 4FX0A 3KFWX 4ZDLA 5DTDA 3ZMTA 3JRGA 4KN4X 2P6TA 2IPQX 2KZGA 3HEFA 2E7WA 4BY1J 2M7BA 5IYCJ 4ON0A 4F52A 2VQCA 3CJNA 2PMZN 1XCVA 2OU2A 1OYWA 3OR2C 3RPUA 3LA3A 3HKZA 3TL4X 2XF7A 2E5ZA 2V1NA 5E8GA 4ANJA 3R0JA 2HGCA 4A3MJ 5DCMA 2ZSHB 1WH5A 1IC8A 2DYRH 4LIUA 4HQMA 1JTXA 3E5QA 1O3SA 2DLLA 2DTZA 1LEBA 3FXJA 1TWCJ 1E3PA 3PM1A 3WGHA 4A3CJ 1A5JA 3E6DA 4IRGA 1SAXA 4RS8A 3AG3H 2BHYA 3ABLH 4DOZA 3S14J 4BE0A 1OLTA 3GLLA 2VN2A 2JRMA 1M1EB 2CQNA 4K2EA 3M3YJ 3H92A 1U9OA 2KL4A 1FEXA 2KIQA 3RKQA 1YYVA 1ZKGA 1IAWA 1K61A 4JOMA 1I27A 3JRDA 1BR1A 1L0OC 1W5SA 5M5XJ 4FX4A 2R7RA 2QGUA 5HOOA 2Z5UA 3QAHA 5FO5A 2QBYA 3RI4A 1MD0A 1UB9A 1MBHA 2LR8A 1ODDA 3KETA 3VYSB 1FMWA 2M34A 1UCRA 1MBEA 2M4GA 4IHYA 2FBKA 4PJLA 1BR4A 2HOTA 2QQ9A 1SD5A 2WC2A 3DBLB 3HOTA 4W97A 4NC8A 5FLXK 4PJMA 3OIPA 2M0CA 2A3SA 3ASOH 5EZGA 4PJNA 2NRAC 1TBXA 3HOSA 2R7UA 3SDBA 3BR5A 1SMTA 3I54A 4M71A 4RDUA 2K40A 2R92J 1KQ9A 3IUOA 3K1NA 1LFPA 5JVGF 2D5VA 1BBYA 3HOYJ 4L9TA 2AXLA 4IHXA 3OYCA 1IRGA 3FIWA 2W24A 3IAS2 3ZQ7A 3NEUA 3A0BC 1O3QA 1VF9A 3CO6C 1FMVA 2O0YA 2Q1ZB 1OQYA 2MBFA 2EA4A 1RPWA 2V9KA 1LFBA 2DFIA 2MC4A 2P81A 4P55A 1FYMA 2H94A 1LDDA 3VSKA 4FE4A 2QQ8A 1JKOC 2X6WA 3TEDA 1FYKA 1BJZA 5D8KB 3FKIJ 1XMXA 4OIOF 1DPRA 4Q48A 2M8EA 2ZBKA 1DGRM 3EYYA 1LDJA 4ABZA 1T95A 2COBA 4UV9A 2HFHA 3FK6A 1ENHA 4C2TA 2VJJA 1W5TA 2QF7A 3SYTA 1SEUA 1R1VA 3F8NA 3GFLA 4HDUA 2XASA 1S29A 2F5VA 3J80K 2JK3A 3F6OA 4HG2A 2VQLA 3FM5A 4MO7A 1VQMI 2VOOA 3S1RJ 4Y3OA 4L0YB 2DA2A 4DJAA 5CVJA 5TJJA 4UXNA 3TDUC 2M4KA 3IRQA 3FHZA 4UUTA 4UB6C 1R1TA 5J1RA 4YFKF 2JPCA 1C0WA 2JA2A 3DQVC 4LLLA 1WJFA 3ZQFA 3GZNB 3CCUI 4HX4A 1N25A 2QENA 2V1XA 4GCVA 2FJ1A 4KFCA 1HA8A 1W7PD 3BTIA 2COMA 1KU2A 3BQYA 3QPHA 4LG0A 5F1JA 2XPWA 5CJ9A 3D0SA 2ADUA 2H09A 3PIOF 2A6HF 3BG6A 1KU9A 3GFMA 3S1NJ 1QU3A 3HM5A 5BPDA 2DMNA 3PNTA 3AKZA 3BTJA 2VONA 1MNMC 3M1EA 2VKDA 1R49A 1GT0C 4MFDA 2LOOA 5E1ZB 3CDIA 5BQTA 3KEYA 2ZXHA 3E0JB 5J47A 3CUOA 3HOUJ 2DA6A 3CCMI 2F6CA 2CV2A 4IOCF 3DPTA 1WI9A 3OYLA 5DM6F 3BQZA 3PSFA 1USSA 3TOBA 2Q0OA 2LD5A 3LSGA 2W7NA 3BPVA 3MFKA 4RGRA 2LBFB 3W2VA 4EV0A 4BL0B 4ENKA 4XN0A 1IRZA 1I6XA 1XDUA 1SVOA 4IJAA 2LMDA 4A3KJ 2VL8A 4OAZA 4Y17A 3K4LA 3SXYA 5K5RA 2BW3B 2CUEA 5IP6A 4D5CA 3DBHB 1YW7A 3FM3A 2R5YA 4N4OB 1WGXA 3H9JA 3IAM2 4B4CA 2ECBA 1PYVA 1Z3YA 3CUQC 4D7MA 1FC3A 3V7SA 1ETKA 1MNDA 2HVSA 5LHIA 3F3XA 5J8FA 1R58A 3N97A 5F04A 1U2WA 5TRDA 5KAFC 5LD2C 2ECCA 2X1DA 1VQNI 2NVTJ 3TMOA 3C18A 4XONA 4CYCA 2K9LA 5EG0A 1KYWA 4HZFA 4L5IA 3CP8A 2QVOA 3BDDA 3BROA 3FXKA 1TQMA 5DUKA 3J81Z 3ERMA 2JA6J 2Z1DA 1OYYA 2CUZA 3IV5A 2EZHA 4N9IA 1Y39A 1OFCX 3ABTA 2FEZA 3P9CA 1U8RA 1RR7A 4RA2A 1K4TA 2NAZA 3M1CA 5DCMB 1LE8A 5LLQA 1B6AA 1DGWY 3KYDB 5J1UA 1R00A 2BXYA 3HZJA 2M5WA 4N4NB 3E5XA 2VC1A 1F1ZA 3L2VA 4PZJA 3JSPA 5M3FJ 3BP8A 3IP4B 2NNNA 3HRMA 2JUGA 1FLIA 3SHFA 4DBQA 3B02A 4ESBA 3H3ZA 1SFEA 3RDIA 2BZTA 3FDYA 4P9FA 2UXXA 3E5UA 4V2GA 3VYUB 3HG9A 2J5OA 2HVRA 1D0ZA 1B59A 2DO7A 2K27A 4RGUA 2FX0A 1QRYA 1P7JA 3KX2A 3ZQQA 4HW0A 1BJAA 5IPAA 3A03A 4U0WA 3RCOA 3PO3J 4YIFA 5H6QA 3F23A 4E70A 1P4AA 1HKTA 4LOCA 1RC9A 3CMAI 2PJRA 1P7IA 1U5TC 5K7FA 3M4OJ 3PFIA 4GYIA 1D5VA 4R8HA 2KP6A 5FKNA 2UUZA 1P9QC 2QBYB 2VBWA 2EILH 2BBYA 2VB6A 3OL3A 3VYTB 1SFUA 2GXBA 2FMYA 2LYCA 1ETQA 3F8BA 4ZTJA 2LVSA 4B44A 2M7AA 2I5UA 1UELB 3S8PA 4D7NA 2BXZA 3QYBA 3CZ6A 2MC3A 4LG3A 1FYLA 3CCEI 2A61A 1ZREA 1TLHB 3F9KA 3D5LA 1P4XA 1OR7C 4XSXF 2HXIA 1SAUA 2GQQA 2HWVA 3Q9VA 2EIJH 4DIQA 1WFXA 1VTNC 4OINF 2RNJA 1XG1A 3M07A 4V2FA 2CW7A 3H36A 4JX4A 4M73A 2STWA 5D5XB 2M30A 2QLZA 1MIJA 3RKYA 1WI3A 1EKEA 2LREA 4UHTA 4U88A 4NB5A 1FJLA 2GLOA 1Z7LA 3ISPA 5FFZA 2ME0A 5E17F 3FXLA 1X19A 4RAYA 3CLQA 2EFQA 4PDKA 2A5YB 3L2CA 3MKWB 2ACJA 3LQRA 3ZQCA 4J19A 3QYFA 2FBHA 3H5RA 1I3AA 4EJVA 3MD2A 1HOMA 3BG5A 4IKFA 4Y52J 3K70C 3I3LA 1P6RA 1PUFA 5F64A 3ZGKA 2BHZA 3IH4A 4RM2A 1XMAA 4TV7A 1XB4A 4HV6A 1MMSA 2IA2A 2GXAA 4G8XA 2JQ7A 2A5WA 4WXCA 1TWHJ 3ZRGA 2DMQA 1W36D 3IHUA 3BC8A 2ZJQF 5M5WJ 2IS4A 2DOEA 2KDOA 2ESNA 1DU6A 1E2XA 2ID6A 1Z7UA 2NVYJ 3BR1A 3RQIA 5GADJ 1IXSB 1Z0XA 4XLCA 4AIHA 1Z77A 1I3QJ 5L3GA 3BPXA 2L5QA 4KIBA 2PFBA 3IWZA 2UWMA 4NUBA 3T1BA 2DFHA 4I6ZA 3X2QH 2YSRA 1O57A 1H89C 2ZC2A 1PVEA 2LY2A 2P4WA 3BZKA 3OYKA 4KA4A 4LG0B 2NOGA 4A5NA 2W82A 5IY5H 2B7EA 2HYJA 4CCNA 4BJ5C 1N75A 4XRMA 2V6CA 4O5VA 3H35A 4IRIA 4IO9F 1OCOH 2FU4A 5ICGA 1MJ9A 4DGWB 3OS1A 1W36C 1ZHFA 2QKMB 1NTCA 4PSXA 3KYLA 1UHMA 2DDAA 3WG9A 1BC7C 1JKPC 5FD5A 4M6YA 4BUPA 2LY9A 4YFNF 2DPUA 1APLC 1R5GA 3AFHA 3HSFA 2L3DA 3BWGA 3I4NJ 4BHPA 2K3PA 3H3UA 4BBRJ 2WBMA 3CCYA 2XROA 1RKWA 2FUG2 5KVRA 3QODA 4OOIA 3CCRI 1MMNA 2R5ZA 3SEQA 3S1MJ 1T0FC 3R0AA 1XS9A 2ZXWH 4J01A 1K6OA 1J75A 2X0LA 3OYJA 2E7XA 2E2JJ 1EJ9A 1WJCA 1BIAA 4KT5C 5ICCA 2I10A 4PUSA 4BNCA 2BY1A 4D0PA 1FSHA 2R5YB 2YR2A 3V8JA 1OYIA 5DDGA 4XKVA 4F93B 2K9SA 1W7PA 2JN6A 3NWTA 2VPLA 3V42A 4CCMA 2CMPA 1YIOA 1A6QA 2EBIA 4A0YA 1VQPI 2G7HA 3GEZA 1ETWA 5FKKA 1SFXA 3H0DA 2WADA 2ICWG 4XIDA 3TQNA 4C2UA 1GVDA 3OYHA 3HDDA 3KE2A 4IOAF 2DW4A 2ZMEA 3HUGB 3OIOA 5C3EJ 5TISC 1ON2A 4CYCB 4UUSA 3JR9A 3BZCA 3KLNA 1ZELA 2OQGA 5EG0B 3BR3A 3LSIA 5LRRA 2PEXA 3OYIA 1FBSA 4L0ZB 2NXNB 3HPGA 3I71A 1BC8C 5HS9A 1BOBA 1E0EA 3C2HA 4KMUX 2G7UA 1WH7A 4MQ9F 1MMDA 2DOFA 1RIOH 4IZZA 5HLTA 5HLGA 1CGPA 1XGSA 3K0LA 1SD6A 4A0ZA 1HW1A 4PSWA 5B5EC 3PO2J 1H9TA 3GWZA 1LE8B 2DTRA 2R7OA 4MLOA 1JKQC 2HQAA 3F6VA 4XRSA 1FBQA 2XRNA 2DJNA 3S3OA 1SD7A 4HNVA 2FQ3A 2CU7A 3F0CA 1V5GA 5M3MJ 2TRTA 1RUOA 1EF4A 2LY1A 2OD5A 5K7HA 3K7AJ 4RMNA 2GOXB 3G4SI 1T38A 1JT0A 2DT7B 3JW4A 3WE2A 1XDSA 2KRHA 3CTAA 3J7ZI 2JVHA 3EQLF 4E4HA 3FF5A 2R7DA 4XLPF 2B63J 2IS6A 2CQQA 1WVRA 3EUHA 4C2MJ 4Q47A 2F4MB 3V8LA 1D5YA 1MGTA 4IQ4A 1N78A 1NHAA 2F5FA 2M3AA 4HX7A 2CW8A 1NG7A 3E6BA 1XMKA 2ZB9A 3LAPA 2ZXJA 3KLOA 1YLFA 3K1PA 2PJRB 3AL0C 1ACIA 4FCYA 4G94A 2JMWA 2X48A 5JLXA 1W5CC 4JYKA 2PX9A 3H3VK 3A4CA 1RR8C 1GXQA 2OJED 3GTLJ 3G3ZA 4IVNA 3DKYA 3S3MA 1VQ5I 1J9IA 3ABUA 4B1RA 2XGEA 3SDGA 1R36A 2E34A 3WU1B 1MMGA 2G0EA 4WF2A 4CH7A 3HOWJ 2P7VB 1V3FA 3WTYC 1X1AA 4JP0A 3RYRA 3RQ4A 1G3SA 3MWMA 2DN0A 4AVZA 1K78A 2IGNA 5EZHA 2E36A 5E20A 4IPAA 2XF6A 4BEHA 3K1MA 3CD6I 3MCZA 1SD4A 2L7MP 4IXAA 4DBRA 1MBKA 2K4JA 1G3YA 5FGMA 1YE9A 1RRJA 3HL2A 1ZYRF 2W57A 4KIGA 1Z91A 2F4IA 4UVAA 4LGWA 3QQAA 4DZPA 1ETXA 1QQIA 1K83J 2EV6A 3JTHA 3RSNA 4XLAA 3COAC 2YU9J 3CC4I 1P4WA 1VQLI 1MH4A 2HXOA 2QYOA 4EJUA 3JAMK 2V1UA 3L1PA 1VI0A 4O6JA 1JXSA 3G73A 2O5RA 3MQ0A 5TGTA 1Y8QB 2EFOA 4XKBA 1J7KA 2W4SA 2WTEA 2KIFA 3A0HC 3LSRA 3GMEA 4GFBA 2IW5A 3OYEA 3Q0UA 2IS2A 1U0JA 1PUFB 1HSJA 4QTRA 4DQ2A 4WK8F 1IV6A 1BR2A 1IUFA 3E3VA 3DKWA 3HGYA 2VKEA 3JRBA 4I76A 2CG4A 3HYIA 1EH7A 2Y0SN 2JT1A 2CV1A 2QSFX 1B9NA 1F43A 3OYDA 2XUBA 3IC7A 3DKXA 3ZCOA 1OISA 2P6SA 4R1HA 5HLIA 2V79A 1BI2A 4P1WA 2MH9A 5KAIC 1PP7U 4NBQA 2ZFWA 3TO9A 2L9VA 3P9KA 4AWXB 5DV5A 3A01B 5CPRB 5A2QK 4KITB 1XC5A 2Q2EA 1MKMA 3DEEA 2ELJA 2Z3YA 2LFBA 3MMYB 2XGXA 2WAEA 5B1AH 3ASNH 2EWNA 3W2WA 1BI3A 4A3GJ 4UNOA 1WCMJ 3I58A 5JI6A 5K1YA 5HODA 1GV2A 2PMUA 4L5EA 4MFEA 2LP0A 4UVBA 5CKTA 1DDNA 4F55A 3KP5A 5DS9A 2W84A 2WB1N 2NNYA 3CF5F 1YTYA 1JT6A 3U9GA 1WKMA 3EDPA 3L9FA 1JUMA 2I8DA 1QVUA 2CYYA 5LRSA 1IDZA 2OCEA 1B72B 5GTHC 1KU7A 2Y69H 4FETA 4G7ZF 1ZG1A 1YIJI 5C4XJ 4BY7J 2V6EA 3RKXA 4F3QA 2XVCA 4KDPA 1UG0A 1TQIA 3OYBA 3GZ6A 4PJ0C 2ZJ2A 2DCEA 2DI3A 3ZQIA 3K4JA 2R5ZB 3LSHA 3ZQHA 1QZEA 3M7GA 3WTVC 1XSXA 2NOJB 2ELKA 1YW8A 5M5YJ 2XHKA 3CJQB 1FY7A 2DT6A 4CZZA 1TWGJ 1EH6A 2BY0A 3CJRB 1CF7A 1FIAA 3ULQB 5FKLA 2DK8A 4LB5A 3FBIB 1IN7A 1X1CA 1W7PB 4ZC3A 4FTHA 4HF2A 2WWYA 1HBXG 3WHCA 5IT3A 4CYDA 5JHFA 1S9HA 2MGQA 3GF2A 2V9PA 1OJLA 2VBYA 2WV0A 3CF2A 2QSGX 1KGSA 2HKOA 5IP9J 1XGNA 1K79A 3C3WA 1XGOA 1SANA 4FT8A 3TW7A 3W6VA 2ZMEB 2DDBA 1E3HA 3H9QA 4UUSB 3LMMA 1Z05A 4II3A 5JLWA 3ZOBA 2M45A 3DTEA 2KISA 3AG1H 4EGZA 2RVCA 1YHQI 3E7LA 2X6YA 3PQKA 2E71A 3LSPA 5LEKA 4QPQA 4A5MA 2CWEA 1IN5A 3KEQA 1X1DA 3E97A 1G4DA 4LD5A 1WRJA 3KCCA 4I02A 3JRHA 4BKXA 4BYYA 3GFIA 4YELA 3ZN0A 2R7TA 1LB2A 4CA0A 1UG2A 3I56I 2M87A 3CESA 3PQJA 1D8KA 3DXJF 2Y75A 2ZO4A 4JBAA 4UY8I 2AQFA 2NS8A 2K9MA 3T8TA 2PBIA 2HU9A 5F1RA 1JTYA 4EMSA 2BOLA 4AYBN 4XORA 3JCUC 4XKWA 3S2DJ 4EVIA 3E1SA 2O3FA 2HYFA 2HOSA 4P9UA 5FFXA 3Q5FA 4ITVA 2P7CB 3AG4H 5C44J 1JHFA 3JRFA 5J4YA 2R7QA 2R0QC 5EYRA 2PMZA 4DZJA 4G7OF 3FXOA 3GFJA 2OTLI 2DK5A 3PSIA 4FASD 3LAJA 1BL0A 4ZYGA 2M2EA 2YUSA 1VZ0A 4LFUA 4IL6C 4OIRF 1T08B 2XAUA 4LIVA 2K9QA 1OCPA 2L7FP 4E7HA 1YS6A 1B8IA 2VT2A 5FRNA 1IV8A 1JI8A 1X4PA 2VASA 4XBFA 1V4RA 4ZZLA 1AKHA 2K85A 3G6EI 1IO2A 1BI0A 2XSJC 2JUCA 2O61A 3B73A 3S2HJ 2KT0A 4BEHB 2EPFA 1IRXA 4X0GA 1T2KA 1Y56A 2GA2A 3PIPF 1SVLA 4UB8C 2H8WA 4HF1A 1OMIA 2HI3A 5ILVA 1NK3P 5EGOA 1LVKA 2DA4A 3CMMA 4E7IA 1PUEE 4IHVA 1X58A 1T33A 4YEJA 2IP2A 1EV7A 5FKOA 1D0XA 2ELHA 4G6DA 3CCQI 3HTSB 5GTIC 4ENJA 1D0YA 2HQNA 3H9GA 1BM9A 1JJ8C 1USTA 4MEYF 5E8IA 3HRUA 5HDGA 2Y30A 5FRMA 1MZBA 4U0YA 3IRRA 5IYBJ 3HOZJ 1HXDA 1FOXA 1J59A 3QWLA 4S0HB 3QYEA 3Q9SA 1ZK8A 1Q1VA 4BJ6C 2EK5A 2FMLA 2EV0A 2FNPA 1QO0D 4X1EA 2HVQA 2CUJA 5ICFA 4I99C 2OTJI 1VNDA 2R3SA 1U78A 2WAQN 1YQAA 1X2NA 3PL8A 3WG7H 5BS6A 3LFKA 5CYVA 1XSVA 3A02A 4HOBA 1ERDA 2Z9OA 1HKSA 5CVRA 3O2PE 1AU7A 4IRHA 3E6MA 3V7CA 1ETOA 1IXCA 2Q2EB 1Y1WJ 3S17J 4A3JJ 3M8JA 3T5XA 3CJTB 3GTPJ 2Y0MA 2OZUA 3ZMZA 4BU2A 2XRLA 5IYDJ 4JX5A 1ZGJA 4NHJA 2IEKA 1KQ8A 4NC7A 2GBYA 1HDPA 2XKPA 1S3JA 2EQRA 5EEHA 1I5ZA 3TKYA 9ANTA 1J0RA 2DA3A 2O9LA 1AA7A 3O3KA 1NH3A 1HCRA 2O03A 2CV0A 4KICA 2VJ5A 3LSJA 1W4MA 2XKOA 3M9AA 3WTZA 5E3NA 1T98A 4KN7X 4C30A 5E3MA 3R61A 2VLAA 4I01A 3ZQLA 3M8FA 2D2WA 1R22A 1TNSA 5HNFA 4AIDA 1D8JA 2FRHA 3BT9A 3FWEA 2HQRA 1BA5A 1YFHA 2ME6A 3ABMH 3SQNA 5IT9Z 3MZYA 2GA1A 1DP3A 1YRNA 3K70D 1JGSA 2HS5A 2XAJA 5ILSA 4BACA 2XAFA 4IHWA 2UZKA 1R6RA 2ZFUA 1FSEA 1K7AA 1TT5B 2P5VA 3TO7A 2LF8A 2YPRA 1B9MA 2Q8KA 1CF7B 5KCMA 2UXNA 3ZPLA 2K4BA 2GIZA 4I98B 3GTJJ 2VUMJ 4HAMA 5F0FA 3TW6A 4BE1A 4M6XA 4CO8A 2IBDA 1I1SA 1YI2I 3G1OA 5K5OA 1QZYA 2DU9A 3RYPA 2EIKH 2VBZA 2QA4I 3AAFA 2RDPA 4AUXA 3JRAA 1ONVA 3CCLI 4QIWN 2BE5F 5HS8A 4NNJA 1MSFC 2PG4A 3G1LA 2IJLA 2B0LA 4M74A 5L3BA 3F22A 4EJOA 2ESHA 5GPAA 2IT0A 5D4SA 2HOAA 3VFZA 3ML6A 4E7JA 4OU0A 4M9XA 3JREA 3DLLF 1MH3A 4HLYA 3WU0A 2EFPA 3ZQGA 5FLVA 3QU3A 1JUSA 4XQFA 5FB2A 1KA8A 4BHCA 3TGNA 5D5VB 2E19A 4C3IJ 4LB6B 5K5QA 4RB1A 2RGVA 1KZHA 2GIVA 4D1QA 1SVMA 2OPTA 1O3TA 1MW7A 2WY8Q 2WA0A 3HRSA 2JRTA 3R6SA 3HGGA 2HZDA 1WJBA 3ABKH 3GVAA 3ZN1A 4AIJA 4OWRB 5EEAA 2O8KA 5GP9A 1JGGA 2QSHX 3OS0A 1FX7A 2CS3A 2LSOA 5EEGA 2AXTC 5HLHA 1K4SA 3LWFA 2HKXA 3QPSA 3CMEI 1GUUA 1WQ2A 1IJWC 1BI1A 3V7RA 4I2OA 1MBGA 3Q3SA 2KPMA 4HA8A 2P5LC 4LK0F 3JTGA 1TT0A 4CCLA 5FLMJ 2JPBA 1Y8RB 1T8IA 2FA5A 2AS5F 3W6KB 5ERIA 5HVQC 4M6VA 4OMYA 3S32A 2OZ6A 3BTCA 1TW2A 5GAHJ 5EDNA 3DV8A 2E1OA 2H1LA 3BTLA 5FKMA 1V5FA 3VWBA 2P5KA 3F8CA 2A68F 2MG4A 3NAUA 5F08A 1QGPA 4YRVA 1ZAOA 2L7ZA 2FSWA 4V19K 3DTKA 1FOYA 4EM1A 4Q4ZF 4KJZA 1R1UA 5DD4A 2BVLA 5AIPA 5B1BH 3BLYA 4A93J 1P92A 1B8IB 2LRDA 2FF4A 4IQJA 3FXMA 1I1GA 3FBNB 5L3FA 4AC0A 4ENMA 1SMYF 1X3ZB 3OOPA 4WX9A 2L01A 1Z21A 2OA4A 4BHBA 5AONA 2JZYA 2HOEA 4GRIA 4HSTA 2STTA 2F5CA 1VQ8I 1WSUA 4XR6A 2DMPA 2GXGA 2E2HJ 3T0YA 4A2UA 1BN5A 2JSCA 3EYIA 4XOTA 1XCBA 1JHHA 3V4GA 3LNQA 1B1BA 3N05A 2BY3A 3W6JB 3GTKJ 2CSOA 1RUNA 3L2QA 1FT9A 2VXZA 2NYXA 2E1MB 3BG9A 2JA5J 1ITYA 5E79C 4OIPF 5EGOB 2W85A 4WCGA 1D3YA 3OYFA 1R71A 4XRFA 1W1WE 2E60A 4HEA2 2FOWA 4FE7A 3ZR8X 1Z1DA 3MZ8A 1OCTC 2R93J 4B43A 1UHSA 1G3TA 2Y9YA 2ZNZA 3HKZN 4ESFA 3DEUA 2L9RA 2IA0A 2Z16A 4KUMA 2JA8J 2DFFA 2DAOA 2F5DA 1W0TA 2VKHA 1RESA 2HDCA 3I55I 3CUQA 1S72I 3OR1C 1F9NA 2BVMA 2DBBA 3IH2A 2X6OA 5FJ8J 1BOAA 1IUYA 4JQFA 2NS0A 2O8XA 3B6CA 3BCAA 4HLXA 2DPDA 1FP2A 1BW6A 1Z67A 2ISZA 4II2A 1LEAA 2JSPA 5J40A 2VE9A 3A2KA 1WHUA 4XLNF 3JSOA 1IRFA 4ZH4F 1GV5A 2M1BA 4M3BA 3L2RA 5CLSA 2MLGA 3GYHX 3UKGA 1ZG3A 1V54H 3BR6A 2L9NA 4G9YA 1UFMA 2DT5A 1EH8A 4LITA 5B66C 2GZWA 5C4JJ 2WAFA 4D9JA 2DQLA 1XPXA 5CVIA 2MW8A 2CH0A 3A1YA 3KPHA 5F0HA 2VQGA 1YS7A 3BY6A 1HF0A 2QUFA 2RC4A 2HEOA 3BZ6A 3HBLA 4DYCA 1A31A 1OCRH 3TO6A 1ZGAA 2MLKA 5J3LA 4YIRX 4BJTA 2XV4S 2DJIA 2X85A 3FHNA 4KNYA 1S8NA 1ETVA 4G12A 1G8XA 2XSDC 4I0AA 4XM3A 4A69C 3HC7A 1X2MA 3JRIA 5AIQA 3GX4X 1IN8A 2IGOA 3PUBA 1H8AC 2GOMA 3H5AA 2H27A 5D6EA 3KP4A 3OMYA 1VFCA 4HV5A 1SC7A 2F5EA 3G2BA 2L2OA 3K4BA 3WTXC 2L4MA 2HDDA 4C9YA 3W2AA 2WV1A 2YX7A 4KMFA 1WJEA 2PLYA 2IGKA 1TNTA 3I59A 4KT6A 2EFNA 4MGRA 1U5TA 4ZYAA 4HNTA 3K4CA 1TP4A 1MDMA 1YRNB 3ZMUA 1HW2A 2XAHA 5D8LB 2XAGA 5K7ZA 4I09A 1JKRC 4EJTA 1WJ5A 2R7FA 3DP7A 3I0TA 3FXQA 2FD5A 3TDZC 4I0BA 2VJIA 4CZCA 3ZP5A 4F91B 1WZ2A 3B6AA 3JRCA 1HKQA 4CCJA 1X3WB 2V7FA 2V4JC 1R9TJ 2A6EF 5KHDA 3RZDJ 3BOQA 2E35A 4U7DA 1MJBA 1Z3XA 1KU3A 2XPUA 3FMQA 4CCKA 1YJWI 3GLXA 4GXOA 1MNEA 1IXRC 2NS7A 1QBJA 3KYCB 2DYSH 3QP6A 2DMTA 2MYSA 2RQQA 2X1EA 2LLKA 3QPLA 3GTGJ 2L4AA 2HPMA 1ZARA 3EPZA 3CMYA 3GUDA 3MKYB 2LKSA 2FE3A 4CXFA 3CCSI 2D45A 6PAXA 2CQKA 3HIFA 2EZLA 1XX5A 4QWQA 2ZCWA 3HTUA 3CC7I 4XK4A 3HHHA 2DA7A 1KYZA 4LJZF 4MEXF 1YG2A 3BR2A 3FZVA 4XN3A 1MBJA 3I64A 1F36A 2G9WA 4U0VA 4Y13A 3GTQJ 3WU2C 2VBXA 1LDKB 3WTWC 5KNLA 5DD8A 1TL8A 3QOPA 3OYGA 3DU5A 5D5UB 1JE8A 1ZRCA 5DM7F 1RZ4A 1I50J 2JWTA 1TC3C 2M8GX 4WWCA 2M9HA 5HDNA 1J09A 5FLXZ 2XGDA 2B9SA 2GM4A 1YO5C 1HDDC 3BG3A 4A3IJ 4CHUA 2RV8A 4M9ZA 4N9HA 4J00A 1Q1HA 2VI6A 4B3AA 2VIXA 3P7NA 1MMAA 3WHBA 1VQ7I 3FISA 2D1VA 5H6RA 1FTTA 2F4OB 2KHMA 4R79A 3Q0VA 2EV5A 3FKJA 2CGPA 4Y4RA 5LFAA 2YS9A 3LOCA 5CVVA 1AWCA 3K2AA 3CQZJ 3PJRA 1TWAJ 1FOWA 2ZSIB 3BJOA 4UUVA 2BYVE 2LG4A 3U1KA 4B8XA 3MVPA 3KP6A 3IL2A 3OOUA 1A35A 4YG2F 3CP2A 4U87A 3DWLE 3D5RC 3WGIA 1ZH5A 1YW9A 2HYGD 2CQ7A 3FMRA 4YFXF 2V26A 1TQPA 4YIIA 1R23A 4CUGA 4BS9A 2JVGA 3L2UA 2M0MA 4N0BA 1G6NA 5JFRA
chains in the Genus database with same CATH topology
4EJWA 4EGYA 3U2RA 3J80Z 1LNWA 3MEXA 4MHGA 4ESJA 2ISYA 1T0FA 5ICEA 2MA3A 1ON1A 1F5TA 1GVJA 3WGGA 2QWWA 1J5YA 4LMYA 1P2FA 5ILUA 4NQWA 1S6LA 4RAZA 3RKWA 4GO1A 3RJPA 4BH9A 3CUQB 1FPQA 2TDXA 4BXUA 4XSZF 4BAYA 2IVMA 3QPTA 1PDNC 1HQCA 4DNCA 1Y0UA 3K2ZA 3L09A 3GW2A 4ZYHA 5L3EA 4EM0B 2KIUA 3I5UA 4L9NA 2K02A 1B4AA 3TOAA 4RB0A 5LHHA 3HSRA 2HTJA 2QM3A 2CFXA 1ZRDA 3KP2A 1A04A 2L02A 4IF4A 1T39A 5L3CA 2KIMA 3DFGA 4OMZA 2Y48A 1IW7F 4ZYEA 2VE8A 4IHSA 1IN6A 3SZPA 4WXDA 3KP3A 3ECOA 4HF0A 1IN4A 3KEOA 2FOKA 1T6SA 1XD7A 3IWFA 1TW3A 3N4MA 1HW5A 3I59B 3VOEA 1GXPA 1U5TB 3IKTA 1U6GA 1HSTA 3F72A 1MDMB 1MJAA 4WXHA 1Z6TA 2PQ8A 3MAJA 3RIRA 1K78B 4ZYDA 2YU3A 1LJ9A 1WWXA 3CLOA 1KQ0A 2V1DA 1DUXC 4PGHA 3RPQA 4HDVA 1QZZA 3NQOA 4KIFA 3R60A 4L5JA 2MD5A 2Z99A 1DPUA 3NRVA 5DEQA 3QP5A 2H6BA 2EFWA 3SFZA 4B09A 3HUGA 4IHTA 1FP1D 4MQVA 1QPMA 3LA2A 2E1NA 3U1DA 2CW0F 1O3RA 4Q5SF 2RQPA 1AOYA 5LGTA 2PN6A 4LLNA 4CDGA 2CO5A 3IKVA 2ZKZA 4MNUA 3S2WA 4HYEA 4RGXA 3V8KA 2KJCA 5LGUA 1PP8F 1XN7A 4OIQF 5F6FA 3OV8A 5HS7A 2PMHA 3QU6A 3ZMVA 1LQ1A 3ERED 3DF8A 1R7JA 2VC0A 1ZLKA 3J81K 5JHUA 3QRFF 1RNLA 4JK1X 3REOA 1U3EM 2D1HA 2K86A 1STZA 2FNAA 3J7AO 2EB7A 2OAZA 2HR3A 3LQQA 4G7HF 3RTRA 2VODA 4PGGA 5LHGA 3ZMSA 1IZ1A 2RKHA 4ENNA 4KYWA 1G3WA 1UHWA 3SZTA 1OKRA 4F7ZA 3FX3A 2HTSA 4RGSA 2KJBA 4PCQA 5E1XA 5BPIA 4GYGA 3DPLC 4MTEA 3LSTA 2BGCA 5LEJA 3VEPA 3WTTC 4LLGF 3FMSA 1FWZA 3T8RA 3P9IA 2L54A 1XGMA 1ULYA 2LF7A 4A6EA 4LK1F 5FD6A 4HQEA 1L3LA 2Z33A 2BEOA 3K69A 1QNTA 3I4PA 4AD9A 5IT9K 5BMZA 2K7LA 2VT3A 1S7OA 4M9SA 1REPC 4O3MA 3C7JA 3LA7A 1S7AA 2E1CA 4L9VA 4BQAA 3HSEA 5LBQA 2C6YA 3FXUA 4ETSA 2X4HA 5D6FA 3MZHA 3L00A 1H0MA 4ZZDA 5LGNA 1ZG5A 1Z6RA 2EJRA 2BV6A 3M8EA 1H9GA 3ECHA 3KP7A 3KZZA 2LKPA 2OQRA 3BJ6A 2LDUA 2IRFG 5ED4A 2XIGA 4I7HA 2A07F 3L7WA 4ASNA 4MTDA 3F8MA 2GAUA 4S05A 5JR3A 2W25A 3ELKA 1E17A 5KK1A 1XSDA 5D4RA 1ZN2A 5J6XA 2FXAA 3HHGA 3C1DA 2O6GE 3R4KA 1O7LA 2YX4A 4A12A 4AIKA 4M72A 2IA1A 4P5OA 5DYMA 3WTSC 2H6CA 4RB3C 5JVTA 2ZNYA 4CICA 1J2XA 4A6DA 1Z9CA 1O7FA 2MH2A 1R5HA 4Z2YA 3WE3A 5E1WA 4A0XA 2DQRA 3K9TA 2KRFA 2PI0A 2RN7A 1OPCA 1DP7P 3BJAA 4H0EA 4S04A 4Y15A 1LVAA 1BIBA 3F21A 2A69F 5D5WB 3I53A 2EA2A 3ROUA 2J5PA 3KZYA 5L3DA 3VB2A 3VODA 2HZTA 1FZPB 2LNBA 2F2EA 2PJPA 3JAMZ 4GGGA 2V9VA 1ZRFA 5CVUA 2XAQA 4HBLA 2GWRA 3CO7C 4U7BA 1RI7A 1ZLJA 3FXRA 4RB2C 1FOKA 3EETA 1F4KA 1IF1A 1FNNA 4G6QA 1FBUA 3ZMDA 2QZ8A 2QQAA 4UVCA 2ETHA 2QQBA 3F8FA 3WODF 3HRTA 4UV8A 1OR7A 5J8CA 4CGZA 3GZ5A 3O6BB 2OBPA 5A2QZ 4QLCU 4FHTA 2JTVA 4L18B 4HX8A 4EM2A 1TTYA 4P96A 5BOXA 3CDHA 3E6CC 5DUIA 1GHCA 4L9JA 4EQQA 3WTUC 5E18F 4AVPA 5H20A 2FBIA 3GXOA 2VOPA 5DCFA 1X3UA 5HDKA 2KKOA 2P8TA 3GO5A 4FX0A 3KFWX 3ZMTA 4KN4X 2P6TA 2IPQX 2E7WA 4ON0A 3CJNA 1XCVA 2OU2A 1OYWA 3RPUA 3LA3A 5E8GA 3R0JA 2HGCA 5DCMA 4HQMA 3E5QA 1O3SA 2DLLA 1LEBA 3WGHA 3E6DA 4IRGA 1SAXA 4RS8A 2VN2A 4K2EA 3H92A 1IAWA 1YYVA 1I27A 1L0OC 1W5SA 4FX4A 5HOOA 2Z5UA 3QAHA 5FO5A 2QBYA 3RI4A 1MD0A 1UB9A 1ODDA 3KETA 1UCRA 2FBKA 2QQ9A 1SD5A 2WC2A 3HOTA 5FLXK 2A3SA 2NRAC 1TBXA 3HOSA 1SMTA 3I54A 4M71A 1KQ9A 3K1NA 1BBYA 4L9TA 2AXLA 1IRGA 2W24A 3ZQ7A 3NEUA 1O3QA 3CO6C 2O0YA 2MBFA 2EA4A 2DFIA 4P55A 1FYMA 2H94A 1LDDA 1FYKA 5D8KB 4OIOF 1DPRA 4Q48A 2M8EA 2ZBKA 3EYYA 1LDJA 4UV9A 2HFHA 1W5TA 1R1VA 3F8NA 3GFLA 4HDUA 2XASA 1S29A 3J80K 3F6OA 3FM5A 2VOOA 4L0YB 5CVJA 5TJJA 4UXNA 3TDUC 3IRQA 3FHZA 1R1TA 4YFKF 2JPCA 1C0WA 3DQVC 4LLLA 4HX4A 2QENA 2V1XA 4GCVA 4KFCA 1W7PD 2COMA 1KU2A 3QPHA 4LG0A 5CJ9A 3D0SA 2ADUA 2H09A 2A6HF 3GFMA 1KU9A 5BPDA 2VONA 3M1EA 5E1ZB 5BQTA 3CUOA 3DPTA 1WI9A 1USSA 3TOBA 2Q0OA 3BPVA 3MFKA 4RGRA 4EV0A 4ENKA 1I6XA 1XDUA 4IJAA 4Y17A 3SXYA 5K5RA 1YW7A 3FM3A 3CUQC 1FC3A 3V7SA 5LHIA 3F3XA 5J8FA 1R58A 3N97A 1U2WA 5TRDA 3C18A 1KYWA 4HZFA 4L5IA 2QVOA 3BDDA 3BROA 1TQMA 5DUKA 3J81Z 1OYYA 4N9IA 3ABTA 2FEZA 3P9CA 1U8RA 2NAZA 5DCMB 5LLQA 1B6AA 1R00A 2M5WA 3E5XA 2VC1A 1F1ZA 4PZJA 3JSPA 3BP8A 2NNNA 3HRMA 1FLIA 3SHFA 4ESBA 3B02A 3H3ZA 1SFEA 3RDIA 4P9FA 2UXXA 3E5UA 2J5OA 1B59A 2DO7A 2K27A 4RGUA 4HW0A 1BJAA 4U0WA 4YIFA 5H6QA 3F23A 4E70A 1P4AA 1HKTA 1U5TC 3PFIA 4GYIA 1D5VA 4R8HA 2QBYB 2VBWA 2BBYA 1SFUA 2GXBA 2FMYA 3F8BA 2MC3A 1FYLA 2A61A 1ZREA 1TLHB 3D5LA 1P4XA 4XSXF 2GQQA 2HWVA 3Q9VA 1VTNC 4OINF 2RNJA 4M73A 2STWA 5D5XB 2M30A 2QLZA 3RKYA 4UHTA 4U88A 4NB5A 3ISPA 5FFZA 5E17F 4RAYA 4PDKA 2EFQA 3L2CA 2A5YB 2ACJA 3LQRA 2FBHA 4EJVA 1P6RA 5F64A 1XMAA 4TV7A 1XB4A 4HV6A 2IA2A 4G8XA 4WXCA 3IHUA 2ESNA 1E2XA 1Z7UA 1IXSB 4AIHA 5L3GA 3BPXA 4KIBA 2PFBA 3IWZA 2UWMA 3T1BA 2YSRA 1O57A 2P4WA 4KA4A 4LG0B 4A5NA 2V6CA 4O5VA 4IRIA 2FU4A 5ICGA 1MJ9A 1ZHFA 1UHMA 3WG9A 1BC7C 5FD5A 4M6YA 2DPUA 4YFNF 1R5GA 3HSFA 2L3DA 3BWGA 4BHPA 3H3UA 2XROA 5KVRA 4OOIA 3R0AA 1J75A 1K6OA 2X0LA 2E7XA 1BIAA 4KT5C 5ICCA 4BNCA 4D0PA 1FSHA 2YR2A 3V8JA 1OYIA 5DDGA 1W7PA 1YIOA 4A0YA 2G7HA 3GEZA 1SFXA 3TQNA 3KE2A 2DW4A 2ZMEA 1ON2A 3KLNA 2OQGA 5LRRA 2PEXA 1FBSA 4L0ZB 3I71A 1BC8C 5HS9A 4KMUX 2G7UA 4MQ9F 1RIOH 5HLGA 1CGPA 1XGSA 3K0LA 1SD6A 4A0ZA 1HW1A 1H9TA 3GWZA 2DTRA 3F6VA 1FBQA 2XRNA 1SD7A 2FQ3A 1RUOA 2OD5A 1T38A 3JW4A 3WE2A 1XDSA 3CTAA 3EQLF 3FF5A 2R7DA 4XLPF 3EUHA 4Q47A 3V8LA 1MGTA 1NHAA 2F5FA 4HX7A 3E6BA 1XMKA 3LAPA 2ZXJA 3KLOA 1YLFA 3K1PA 4G94A 1GXQA 3G3ZA 4IVNA 1J9IA 3ABUA 1R36A 3WU1B 4WF2A 2P7VB 1V3FA 3WTYC 3RYRA 1G3SA 3MWMA 1K78A 5E20A 4IPAA 3K1MA 3MCZA 1SD4A 4IXAA 2K4JA 1G3YA 5FGMA 1ZYRF 2W57A 4KIGA 1Z91A 4UVAA 4LGWA 1QQIA 2EV6A 3JTHA 3COAC 1P4WA 2QYOA 4EJUA 3JAMK 2V1UA 4O6JA 1JXSA 3G73A 3MQ0A 2EFOA 1J7KA 2WTEA 2KIFA 2IW5A 1HSJA 4DQ2A 4WK8F 3E3VA 3DKWA 2CG4A 3HYIA 1EH7A 2JT1A 1B9NA 2XUBA 3IC7A 2P6SA 4R1HA 5HLIA 2V79A 1BI2A 2MH9A 1PP7U 2ZFWA 3TO9A 3P9KA 4AWXB 5DV5A 5A2QK 2Q2EA 1MKMA 2Z3YA 2XGXA 2EWNA 1BI3A 4UNOA 3I58A 5JI6A 5K1YA 2PMUA 4UVBA 1DDNA 3KP5A 2W84A 2NNYA 1YTYA 3U9GA 1WKMA 3EDPA 3L9FA 2CYYA 5LRSA 1KU7A 4G7ZF 1ZG1A 3RKXA 2XVCA 4KDPA 1TQIA 3GZ6A 2ZJ2A 2DI3A 3M7GA 3WTVC 1XSXA 1YW8A 2XHKA 1FY7A 4CZZA 1EH6A 1CF7A 3ULQB 2DK8A 4LB5A 1IN7A 1W7PB 4HF2A 2WWYA 1HBXG 5IT3A 4CYDA 3GF2A 2VBYA 2WV0A 1KGSA 2HKOA 1XGNA 1K79A 3C3WA 1XGOA 4FT8A 2ZMEB 1Z05A 2M45A 4EGZA 2RVCA 3PQKA 5LEKA 4A5MA 2CWEA 1IN5A 3KEQA 3E97A 1G4DA 4LD5A 1WRJA 3KCCA 4I02A 4BYYA 3GFIA 3ZN0A 1LB2A 2M87A 3PQJA 1D8KA 3DXJF 2Y75A 2ZO4A 4JBAA 3T8TA 2PBIA 5F1RA 4EMSA 4EVIA 2O3FA 2HYFA 4P9UA 5FFXA 3Q5FA 2P7CB 1JHFA 4G7OF 3GFJA 2DK5A 3LAJA 4ZYGA 4LFUA 4OIRF 1YS6A 2VT2A 4XBFA 1V4RA 4ZZLA 1BI0A 2O61A 3B73A 1T2KA 2GA2A 4HF1A 1OMIA 5ILVA 1PUEE 2IP2A 1EV7A 2ELHA 4G6DA 3HTSB 4ENJA 2HQNA 1BM9A 1USTA 4MEYF 5E8IA 3HRUA 5HDGA 1MZBA 4U0YA 3IRRA 1HXDA 1J59A 3Q9SA 2EK5A 2FMLA 2EV0A 2FNPA 1QO0D 5ICFA 2R3SA 1U78A 1YQAA 5BS6A 3LFKA 5CYVA 1XSVA 4HOBA 2Z9OA 1HKSA 5CVRA 3O2PE 4IRHA 3E6MA 3V7CA 1IXCA 3T5XA 2Y0MA 2OZUA 3ZMZA 1ZGJA 4NHJA 1KQ8A 2XKPA 1S3JA 5EEHA 1I5ZA 3TKYA 1J0RA 3O3KA 2O03A 4KICA 1W4MA 2XKOA 3M9AA 3WTZA 1T98A 4KN7X 3R61A 4I01A 3M8FA 2D2WA 1R22A 1TNSA 1D8JA 2FRHA 3FWEA 2HQRA 1YFHA 3SQNA 5IT9Z 3MZYA 2GA1A 1JGSA 2HS5A 2XAJA 5ILSA 2XAFA 2UZKA 1FSEA 1K7AA 2P5VA 3TO7A 2LF8A 2YPRA 1B9MA 2Q8KA 1CF7B 2UXNA 3ZPLA 2K4BA 4I98B 4HAMA 4M6XA 4CO8A 1I1SA 5K5OA 1QZYA 2DU9A 3RYPA 2VBZA 3AAFA 2RDPA 1ONVA 5HS8A 2BE5F 2PG4A 2IJLA 2B0LA 4M74A 5L3BA 3F22A 4EJOA 2ESHA 2IT0A 5D4SA 3VFZA 3ML6A 4OU0A 4M9XA 4HLYA 3WU0A 2EFPA 3QU3A 5FB2A 1KA8A 4BHCA 3TGNA 5D5VB 4LB6B 5K5QA 4RB1A 2RGVA 2GIVA 1O3TA 3HRSA 2JRTA 3R6SA 3ZN1A 3GVAA 4AIJA 1FX7A 2LSOA 5EEGA 5HLHA 3LWFA 2HKXA 1WQ2A 1BI1A 3V7RA 4I2OA 4HA8A 2P5LC 4LK0F 3JTGA 2JPBA 2FA5A 2AS5F 3W6KB 5ERIA 5HVQC 4OMYA 2OZ6A 1TW2A 3DV8A 2P5KA 3F8CA 2A68F 1QGPA 1ZAOA 2FSWA 4EM1A 4Q4ZF 1R1UA 5DD4A 5AIPA 1P92A 2FF4A 1I1GA 5L3FA 4ENMA 1SMYF 3OOPA 4WX9A 2L01A 2OA4A 4BHBA 5AONA 2JZYA 2HOEA 2STTA 2F5CA 1WSUA 2GXGA 3T0YA 4A2UA 1BN5A 2JSCA 3EYIA 1XCBA 1JHHA 3V4GA 1B1BA 3W6JB 2CSOA 1RUNA 1FT9A 2VXZA 2NYXA 4OIPF 2W85A 4WCGA 1D3YA 4XRFA 1Z1DA 1G3TA 2ZNZA 4ESFA 3DEUA 2IA0A 4KUMA 2DAOA 2F5DA 2HDCA 3CUQA 1F9NA 2DBBA 1BOAA 1IUYA 4JQFA 2NS0A 2O8XA 4HLXA 2DPDA 1FP2A 2ISZA 1LEAA 2VE9A 4XLNF 3JSOA 1IRFA 4ZH4F 2M1BA 5CLSA 2MLGA 3GYHX 1ZG3A 4G9YA 1UFMA 2DT5A 1EH8A 2GZWA 2DQLA 5CVIA 1YS7A 3BY6A 2QUFA 2RC4A 2HEOA 3BZ6A 3TO6A 1ZGAA 2MLKA 2XV4S 4KNYA 1S8NA 4I0AA 5AIQA 3GX4X 1IN8A 2H27A 5D6EA 3KP4A 4HV5A 2F5EA 3WTXC 2L4MA 2YX7A 4KMFA 2PLYA 1TNTA 3I59A 4MGRA 2EFNA 1U5TA 1MDMA 3ZMUA 1HW2A 2XAHA 5D8LB 2XAGA 4I09A 4EJTA 2R7FA 3DP7A 3I0TA 3FXQA 3TDZC 4I0BA 3ZP5A 1HKQA 2A6EF 3BOQA 4U7DA 1MJBA 1KU3A 3FMQA 3GLXA 4GXOA 1IXRC 1QBJA 3QP6A 2L4AA 1ZARA 3GUDA 2FE3A 4CXFA 2D45A 6PAXA 2CQKA 3HIFA 4QWQA 2ZCWA 3HTUA 3HHHA 1KYZA 4LJZF 4MEXF 1YG2A 3FZVA 3I64A 2G9WA 4U0VA 4Y13A 2VBXA 1LDKB 3WTWC 5DD8A 3QOPA 5D5UB 1JE8A 1ZRCA 1RZ4A 4WWCA 5HDNA 5FLXZ 1YO5C 4CHUA 2RV8A 4M9ZA 4N9HA 1Q1HA 3P7NA 2D1VA 5H6RA 4R79A 2EV5A 2CGPA 5CVVA 1AWCA 3BJOA 4UUVA 2BYVE 4B8XA 3KP6A 3IL2A 4YG2F 3WGIA 1ZH5A 1YW9A 2HYGD 3FMRA 4YFXF 1TQPA 4YIIA 1R23A 4N0BA 1G6NA 5JFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJW A;  4EGY A;  3U2R A;  3J80 Z;  1LNW A;  3MEX A;  4MHG A;  4ESJ A;  2ISY A;  1T0F A;  5ICE A;  2MA3 A;  1ON1 A;  1F5T A;  1GVJ A;  3WGG A;  2QWW A;  1J5Y A;  4LMY A;  1P2F A;  5ILU A;  4NQW A;  1S6L A;  4RAZ A;  3RKW A;  4GO1 A;  3RJP A;  4BH9 A;  3CUQ B;  1FPQ A;  2TDX A;  4BXU A;  4XSZ F;  4BAY A;  2IVM A;  3QPT A;  1PDN C;  1HQC A;  4DNC A;  1Y0U A;  3K2Z A;  3L09 A;  3GW2 A;  4ZYH A;  5L3E A;  4EM0 B;  2KIU A;  3I5U A;  4L9N A;  2K02 A;  1B4A A;  3TOA A;  4RB0 A;  5LHH A;  3HSR A;  2HTJ A;  2QM3 A;  2CFX A;  1ZRD A;  3KP2 A;  1A04 A;  2L02 A;  4IF4 A;  1T39 A;  5L3C A;  2KIM A;  3DFG A;  4OMZ A;  2Y48 A;  1IW7 F;  4ZYE A;  2VE8 A;  4IHS A;  1IN6 A;  3SZP A;  4WXD A;  3KP3 A;  3ECO A;  4HF0 A;  1IN4 A;  3KEO A;  2FOK A;  1T6S A;  1XD7 A;  3IWF A;  1TW3 A;  3N4M A;  1HW5 A;  3I59 B;  3VOE A;  1GXP A;  1U5T B;  3IKT A;  1U6G A;  1HST A;  3F72 A;  1MDM B;  1MJA A;  4WXH A;  1Z6T A;  2PQ8 A;  3MAJ A;  3RIR A;  1K78 B;  4ZYD A;  2YU3 A;  1LJ9 A;  1WWX A;  3CLO A;  1KQ0 A;  2V1D A;  1DUX C;  4PGH A;  3RPQ A;  4HDV A;  1QZZ A;  3NQO A;  4KIF A;  3R60 A;  4L5J A;  2MD5 A;  2Z99 A;  1DPU A;  3NRV A;  5DEQ A;  3QP5 A;  2H6B A;  2EFW A;  3SFZ A;  4B09 A;  3HUG A;  4IHT A;  1FP1 D;  4MQV A;  1QPM A;  3LA2 A;  2E1N A;  3U1D A;  2CW0 F;  1O3R A;  4Q5S F;  2RQP A;  1AOY A;  5LGT A;  2PN6 A;  4LLN A;  4CDG A;  2CO5 A;  3IKV A;  2ZKZ A;  4MNU A;  3S2W A;  4HYE A;  4RGX A;  3V8K A;  2KJC A;  5LGU A;  1PP8 F;  1XN7 A;  4OIQ F;  5F6F A;  3OV8 A;  5HS7 A;  2PMH A;  3QU6 A;  3ZMV A;  1LQ1 A;  3ERE D;  3DF8 A;  1R7J A;  2VC0 A;  1ZLK A;  3J81 K;  5JHU A;  3QRF F;  1RNL A;  4JK1 X;  3REO A;  1U3E M;  2D1H A;  2K86 A;  1STZ A;  2FNA A;  3J7A O;  2EB7 A;  2OAZ A;  2HR3 A;  3LQQ A;  4G7H F;  3RTR A;  2VOD A;  4PGG A;  5LHG A;  3ZMS A;  1IZ1 A;  2RKH A;  4ENN A;  4KYW A;  1G3W A;  1UHW A;  3SZT A;  1OKR A;  4F7Z A;  3FX3 A;  2HTS A;  4RGS A;  2KJB A;  4PCQ A;  5E1X A;  5BPI A;  4GYG A;  3DPL C;  4MTE A;  3LST A;  2BGC A;  5LEJ A;  3VEP A;  3WTT C;  4LLG F;  3FMS A;  1FWZ A;  3T8R A;  3P9I A;  2L54 A;  1XGM A;  1ULY A;  2LF7 A;  4A6E A;  4LK1 F;  5FD6 A;  4HQE A;  1L3L A;  2Z33 A;  2BEO A;  3K69 A;  1QNT A;  3I4P A;  4AD9 A;  5IT9 K;  5BMZ A;  2K7L A;  2VT3 A;  1S7O A;  4M9S A;  1REP C;  4O3M A;  3C7J A;  3LA7 A;  1S7A A;  2E1C A;  4L9V A;  4BQA A;  3HSE A;  5LBQ A;  2C6Y A;  3FXU A;  4ETS A;  2X4H A;  5D6F A;  3MZH A;  3L00 A;  1H0M A;  4ZZD A;  5LGN A;  1ZG5 A;  1Z6R A;  2EJR A;  2BV6 A;  3M8E A;  1H9G A;  3ECH A;  3KP7 A;  3KZZ A;  2LKP A;  2OQR A;  3BJ6 A;  2LDU A;  2IRF G;  5ED4 A;  2XIG A;  4I7H A;  2A07 F;  3L7W A;  4ASN A;  4MTD A;  3F8M A;  2GAU A;  4S05 A;  5JR3 A;  2W25 A;  3ELK A;  1E17 A;  5KK1 A;  1XSD A;  5D4R A;  1ZN2 A;  5J6X A;  2FXA A;  3HHG A;  3C1D A;  2O6G E;  3R4K A;  1O7L A;  2YX4 A;  4A12 A;  4AIK A;  4M72 A;  2IA1 A;  4P5O A;  5DYM A;  3WTS C;  2H6C A;  4RB3 C;  5JVT A;  2ZNY A;  4CIC A;  1J2X A;  4A6D A;  1Z9C A;  1O7F A;  2MH2 A;  1R5H A;  4Z2Y A;  3WE3 A;  5E1W A;  4A0X A;  2DQR A;  3K9T A;  2KRF A;  2PI0 A;  2RN7 A;  1OPC A;  1DP7 P;  3BJA A;  4H0E A;  4S04 A;  4Y15 A;  1LVA A;  1BIB A;  3F21 A;  2A69 F;  5D5W B;  3I53 A;  2EA2 A;  3ROU A;  2J5P A;  3KZY A;  5L3D A;  3VB2 A;  3VOD A;  2HZT A;  1FZP B;  2LNB A;  2F2E A;  2PJP A;  3JAM Z;  4GGG A;  2V9V A;  1ZRF A;  5CVU A;  2XAQ A;  4HBL A;  2GWR A;  3CO7 C;  4U7B A;  1RI7 A;  1ZLJ A;  3FXR A;  4RB2 C;  1FOK A;  3EET A;  1F4K A;  1IF1 A;  1FNN A;  4G6Q A;  1FBU A;  3ZMD A;  2QZ8 A;  2QQA A;  4UVC A;  2ETH A;  2QQB A;  3F8F A;  3WOD F;  3HRT A;  4UV8 A;  1OR7 A;  5J8C A;  4CGZ A;  3GZ5 A;  3O6B B;  2OBP A;  5A2Q Z;  4QLC U;  4FHT A;  2JTV A;  4L18 B;  4HX8 A;  4EM2 A;  1TTY A;  4P96 A;  5BOX A;  3CDH A;  3E6C C;  5DUI A;  1GHC A;  4L9J A;  4EQQ A;  3WTU C;  5E18 F;  4AVP A;  5H20 A;  2FBI A;  3GXO A;  2VOP A;  5DCF A;  1X3U A;  5HDK A;  2KKO A;  2P8T A;  3GO5 A;  4FX0 A;  3KFW X;  3ZMT A;  4KN4 X;  2P6T A;  2IPQ X;  2E7W A;  4ON0 A;  3CJN A;  1XCV A;  2OU2 A;  1OYW A;  3RPU A;  3LA3 A;  5E8G A;  3R0J A;  2HGC A;  5DCM A;  4HQM A;  3E5Q A;  1O3S A;  2DLL A;  1LEB A;  3WGH A;  3E6D A;  4IRG A;  1SAX A;  4RS8 A;  2VN2 A;  4K2E A;  3H92 A;  1IAW A;  1YYV A;  1I27 A;  1L0O C;  1W5S A;  4FX4 A;  5HOO A;  2Z5U A;  3QAH A;  5FO5 A;  2QBY A;  3RI4 A;  1MD0 A;  1UB9 A;  1ODD A;  3KET A;  1UCR A;  2FBK A;  2QQ9 A;  1SD5 A;  2WC2 A;  3HOT A;  5FLX K;  2A3S A;  2NRA C;  1TBX A;  3HOS A;  1SMT A;  3I54 A;  4M71 A;  1KQ9 A;  3K1N A;  1BBY A;  4L9T A;  2AXL A;  1IRG A;  2W24 A;  3ZQ7 A;  3NEU A;  1O3Q A;  3CO6 C;  2O0Y A;  2MBF A;  2EA4 A;  2DFI A;  4P55 A;  1FYM A;  2H94 A;  1LDD A;  1FYK A;  5D8K B;  4OIO F;  1DPR A;  4Q48 A;  2M8E A;  2ZBK A;  3EYY A;  1LDJ A;  4UV9 A;  2HFH A;  1W5T A;  1R1V A;  3F8N A;  3GFL A;  4HDU A;  2XAS A;  1S29 A;  3J80 K;  3F6O A;  3FM5 A;  2VOO A;  4L0Y B;  5CVJ A;  5TJJ A;  4UXN A;  3TDU C;  3IRQ A;  3FHZ A;  1R1T A;  4YFK F;  2JPC A;  1C0W A;  3DQV C;  4LLL A;  4HX4 A;  2QEN A;  2V1X A;  4GCV A;  4KFC A;  1W7P D;  2COM A;  1KU2 A;  3QPH A;  4LG0 A;  5CJ9 A;  3D0S A;  2ADU A;  2H09 A;  2A6H F;  3GFM A;  1KU9 A;  5BPD A;  2VON A;  3M1E A;  5E1Z B;  5BQT A;  3CUO A;  3DPT A;  1WI9 A;  1USS A;  3TOB A;  2Q0O A;  3BPV A;  3MFK A;  4RGR A;  4EV0 A;  4ENK A;  1I6X A;  1XDU A;  4IJA A;  4Y17 A;  3SXY A;  5K5R A;  1YW7 A;  3FM3 A;  3CUQ C;  1FC3 A;  3V7S A;  5LHI A;  3F3X A;  5J8F A;  1R58 A;  3N97 A;  1U2W A;  5TRD A;  3C18 A;  1KYW A;  4HZF A;  4L5I A;  2QVO A;  3BDD A;  3BRO A;  1TQM A;  5DUK A;  3J81 Z;  1OYY A;  4N9I A;  3ABT A;  2FEZ A;  3P9C A;  1U8R A;  2NAZ A;  5DCM B;  5LLQ A;  1B6A A;  1R00 A;  2M5W A;  3E5X A;  2VC1 A;  1F1Z A;  4PZJ A;  3JSP A;  3BP8 A;  2NNN A;  3HRM A;  1FLI A;  3SHF A;  4ESB A;  3B02 A;  3H3Z A;  1SFE A;  3RDI A;  4P9F A;  2UXX A;  3E5U A;  2J5O A;  1B59 A;  2DO7 A;  2K27 A;  4RGU A;  4HW0 A;  1BJA A;  4U0W A;  4YIF A;  5H6Q A;  3F23 A;  4E70 A;  1P4A A;  1HKT A;  1U5T C;  3PFI A;  4GYI A;  1D5V A;  4R8H A;  2QBY B;  2VBW A;  2BBY A;  1SFU A;  2GXB A;  2FMY A;  3F8B A;  2MC3 A;  1FYL A;  2A61 A;  1ZRE A;  1TLH B;  3D5L A;  1P4X A;  4XSX F;  2GQQ A;  2HWV A;  3Q9V A;  1VTN C;  4OIN F;  2RNJ A;  4M73 A;  2STW A;  5D5X B;  2M30 A;  2QLZ A;  3RKY A;  4UHT A;  4U88 A;  4NB5 A;  3ISP A;  5FFZ A;  5E17 F;  4RAY A;  4PDK A;  2EFQ A;  3L2C A;  2A5Y B;  2ACJ A;  3LQR A;  2FBH A;  4EJV A;  1P6R A;  5F64 A;  1XMA A;  4TV7 A;  1XB4 A;  4HV6 A;  2IA2 A;  4G8X A;  4WXC A;  3IHU A;  2ESN A;  1E2X A;  1Z7U A;  1IXS B;  4AIH A;  5L3G A;  3BPX A;  4KIB A;  2PFB A;  3IWZ A;  2UWM A;  3T1B A;  2YSR A;  1O57 A;  2P4W A;  4KA4 A;  4LG0 B;  4A5N A;  2V6C A;  4O5V A;  4IRI A;  2FU4 A;  5ICG A;  1MJ9 A;  1ZHF A;  1UHM A;  3WG9 A;  1BC7 C;  5FD5 A;  4M6Y A;  2DPU A;  4YFN F;  1R5G A;  3HSF A;  2L3D A;  3BWG A;  4BHP A;  3H3U A;  2XRO A;  5KVR A;  4OOI A;  3R0A A;  1J75 A;  1K6O A;  2X0L A;  2E7X A;  1BIA A;  4KT5 C;  5ICC A;  4BNC A;  4D0P A;  1FSH A;  2YR2 A;  3V8J A;  1OYI A;  5DDG A;  1W7P A;  1YIO A;  4A0Y A;  2G7H A;  3GEZ A;  1SFX A;  3TQN A;  3KE2 A;  2DW4 A;  2ZME A;  1ON2 A;  3KLN A;  2OQG A;  5LRR A;  2PEX A;  1FBS A;  4L0Z B;  3I71 A;  1BC8 C;  5HS9 A;  4KMU X;  2G7U A;  4MQ9 F;  1RIO H;  5HLG A;  1CGP A;  1XGS A;  3K0L A;  1SD6 A;  4A0Z A;  1HW1 A;  1H9T A;  3GWZ A;  2DTR A;  3F6V A;  1FBQ A;  2XRN A;  1SD7 A;  2FQ3 A;  1RUO A;  2OD5 A;  1T38 A;  3JW4 A;  3WE2 A;  1XDS A;  3CTA A;  3EQL F;  3FF5 A;  2R7D A;  4XLP F;  3EUH A;  4Q47 A;  3V8L A;  1MGT A;  1NHA A;  2F5F A;  4HX7 A;  3E6B A;  1XMK A;  3LAP A;  2ZXJ A;  3KLO A;  1YLF A;  3K1P A;  4G94 A;  1GXQ A;  3G3Z A;  4IVN A;  1J9I A;  3ABU A;  1R36 A;  3WU1 B;  4WF2 A;  2P7V B;  1V3F A;  3WTY C;  3RYR A;  1G3S A;  3MWM A;  1K78 A;  5E20 A;  4IPA A;  3K1M A;  3MCZ A;  1SD4 A;  4IXA A;  2K4J A;  1G3Y A;  5FGM A;  1ZYR F;  2W57 A;  4KIG A;  1Z91 A;  4UVA A;  4LGW A;  1QQI A;  2EV6 A;  3JTH A;  3COA C;  1P4W A;  2QYO A;  4EJU A;  3JAM K;  2V1U A;  4O6J A;  1JXS A;  3G73 A;  3MQ0 A;  2EFO A;  1J7K A;  2WTE A;  2KIF A;  2IW5 A;  1HSJ A;  4DQ2 A;  4WK8 F;  3E3V A;  3DKW A;  2CG4 A;  3HYI A;  1EH7 A;  2JT1 A;  1B9N A;  2XUB A;  3IC7 A;  2P6S A;  4R1H A;  5HLI A;  2V79 A;  1BI2 A;  2MH9 A;  1PP7 U;  2ZFW A;  3TO9 A;  3P9K A;  4AWX B;  5DV5 A;  5A2Q K;  2Q2E A;  1MKM A;  2Z3Y A;  2XGX A;  2EWN A;  1BI3 A;  4UNO A;  3I58 A;  5JI6 A;  5K1Y A;  2PMU A;  4UVB A;  1DDN A;  3KP5 A;  2W84 A;  2NNY A;  1YTY A;  3U9G A;  1WKM A;  3EDP A;  3L9F A;  2CYY A;  5LRS A;  1KU7 A;  4G7Z F;  1ZG1 A;  3RKX A;  2XVC A;  4KDP A;  1TQI A;  3GZ6 A;  2ZJ2 A;  2DI3 A;  3M7G A;  3WTV C;  1XSX A;  1YW8 A;  2XHK A;  1FY7 A;  4CZZ A;  1EH6 A;  1CF7 A;  3ULQ B;  2DK8 A;  4LB5 A;  1IN7 A;  1W7P B;  4HF2 A;  2WWY A;  1HBX G;  5IT3 A;  4CYD A;  3GF2 A;  2VBY A;  2WV0 A;  1KGS A;  2HKO A;  1XGN A;  1K79 A;  3C3W A;  1XGO A;  4FT8 A;  2ZME B;  1Z05 A;  2M45 A;  4EGZ A;  2RVC A;  3PQK A;  5LEK A;  4A5M A;  2CWE A;  1IN5 A;  3KEQ A;  3E97 A;  1G4D A;  4LD5 A;  1WRJ A;  3KCC A;  4I02 A;  4BYY A;  3GFI A;  3ZN0 A;  1LB2 A;  2M87 A;  3PQJ A;  1D8K A;  3DXJ F;  2Y75 A;  2ZO4 A;  4JBA A;  3T8T A;  2PBI A;  5F1R A;  4EMS A;  4EVI A;  2O3F A;  2HYF A;  4P9U A;  5FFX A;  3Q5F A;  2P7C B;  1JHF A;  4G7O F;  3GFJ A;  2DK5 A;  3LAJ A;  4ZYG A;  4LFU A;  4OIR F;  1YS6 A;  2VT2 A;  4XBF A;  1V4R A;  4ZZL A;  1BI0 A;  2O61 A;  3B73 A;  1T2K A;  2GA2 A;  4HF1 A;  1OMI A;  5ILV A;  1PUE E;  2IP2 A;  1EV7 A;  2ELH A;  4G6D A;  3HTS B;  4ENJ A;  2HQN A;  1BM9 A;  1UST A;  4MEY F;  5E8I A;  3HRU A;  5HDG A;  1MZB A;  4U0Y A;  3IRR A;  1HXD A;  1J59 A;  3Q9S A;  2EK5 A;  2FML A;  2EV0 A;  2FNP A;  1QO0 D;  5ICF A;  2R3S A;  1U78 A;  1YQA A;  5BS6 A;  3LFK A;  5CYV A;  1XSV A;  4HOB A;  2Z9O A;  1HKS A;  5CVR A;  3O2P E;  4IRH A;  3E6M A;  3V7C A;  1IXC A;  3T5X A;  2Y0M A;  2OZU A;  3ZMZ A;  1ZGJ A;  4NHJ A;  1KQ8 A;  2XKP A;  1S3J A;  5EEH A;  1I5Z A;  3TKY A;  1J0R A;  3O3K A;  2O03 A;  4KIC A;  1W4M A;  2XKO A;  3M9A A;  3WTZ A;  1T98 A;  4KN7 X;  3R61 A;  4I01 A;  3M8F A;  2D2W A;  1R22 A;  1TNS A;  1D8J A;  2FRH A;  3FWE A;  2HQR A;  1YFH A;  3SQN A;  5IT9 Z;  3MZY A;  2GA1 A;  1JGS A;  2HS5 A;  2XAJ A;  5ILS A;  2XAF A;  2UZK A;  1FSE A;  1K7A A;  2P5V A;  3TO7 A;  2LF8 A;  2YPR A;  1B9M A;  2Q8K A;  1CF7 B;  2UXN A;  3ZPL A;  2K4B A;  4I98 B;  4HAM A;  4M6X A;  4CO8 A;  1I1S A;  5K5O A;  1QZY A;  2DU9 A;  3RYP A;  2VBZ A;  3AAF A;  2RDP A;  1ONV A;  5HS8 A;  2BE5 F;  2PG4 A;  2IJL A;  2B0L A;  4M74 A;  5L3B A;  3F22 A;  4EJO A;  2ESH A;  2IT0 A;  5D4S A;  3VFZ A;  3ML6 A;  4OU0 A;  4M9X A;  4HLY A;  3WU0 A;  2EFP A;  3QU3 A;  5FB2 A;  1KA8 A;  4BHC A;  3TGN A;  5D5V B;  4LB6 B;  5K5Q A;  4RB1 A;  2RGV A;  2GIV A;  1O3T A;  3HRS A;  2JRT A;  3R6S A;  3ZN1 A;  3GVA A;  4AIJ A;  1FX7 A;  2LSO A;  5EEG A;  5HLH A;  3LWF A;  2HKX A;  1WQ2 A;  1BI1 A;  3V7R A;  4I2O A;  4HA8 A;  2P5L C;  4LK0 F;  3JTG A;  2JPB A;  2FA5 A;  2AS5 F;  3W6K B;  5ERI A;  5HVQ C;  4OMY A;  2OZ6 A;  1TW2 A;  3DV8 A;  2P5K A;  3F8C A;  2A68 F;  1QGP A;  1ZAO A;  2FSW A;  4EM1 A;  4Q4Z F;  1R1U A;  5DD4 A;  5AIP A;  1P92 A;  2FF4 A;  1I1G A;  5L3F A;  4ENM A;  1SMY F;  3OOP A;  4WX9 A;  2L01 A;  2OA4 A;  4BHB A;  5AON A;  2JZY A;  2HOE A;  2STT A;  2F5C A;  1WSU A;  2GXG A;  3T0Y A;  4A2U A;  1BN5 A;  2JSC A;  3EYI A;  1XCB A;  1JHH A;  3V4G A;  1B1B A;  3W6J B;  2CSO A;  1RUN A;  1FT9 A;  2VXZ A;  2NYX A;  4OIP F;  2W85 A;  4WCG A;  1D3Y A;  4XRF A;  1Z1D A;  1G3T A;  2ZNZ A;  4ESF A;  3DEU A;  2IA0 A;  4KUM A;  2DAO A;  2F5D A;  2HDC A;  3CUQ A;  1F9N A;  2DBB A;  1BOA A;  1IUY A;  4JQF A;  2NS0 A;  2O8X A;  4HLX A;  2DPD A;  1FP2 A;  2ISZ A;  1LEA A;  2VE9 A;  4XLN F;  3JSO A;  1IRF A;  4ZH4 F;  2M1B A;  5CLS A;  2MLG A;  3GYH X;  1ZG3 A;  4G9Y A;  1UFM A;  2DT5 A;  1EH8 A;  2GZW A;  2DQL A;  5CVI A;  1YS7 A;  3BY6 A;  2QUF A;  2RC4 A;  2HEO A;  3BZ6 A;  3TO6 A;  1ZGA A;  2MLK A;  2XV4 S;  4KNY A;  1S8N A;  4I0A A;  5AIQ A;  3GX4 X;  1IN8 A;  2H27 A;  5D6E A;  3KP4 A;  4HV5 A;  2F5E A;  3WTX C;  2L4M A;  2YX7 A;  4KMF A;  2PLY A;  1TNT A;  3I59 A;  4MGR A;  2EFN A;  1U5T A;  1MDM A;  3ZMU A;  1HW2 A;  2XAH A;  5D8L B;  2XAG A;  4I09 A;  4EJT A;  2R7F A;  3DP7 A;  3I0T A;  3FXQ A;  3TDZ C;  4I0B A;  3ZP5 A;  1HKQ A;  2A6E F;  3BOQ A;  4U7D A;  1MJB A;  1KU3 A;  3FMQ A;  3GLX A;  4GXO A;  1IXR C;  1QBJ A;  3QP6 A;  2L4A A;  1ZAR A;  3GUD A;  2FE3 A;  4CXF A;  2D45 A;  6PAX A;  2CQK A;  3HIF A;  4QWQ A;  2ZCW A;  3HTU A;  3HHH A;  1KYZ A;  4LJZ F;  4MEX F;  1YG2 A;  3FZV A;  3I64 A;  2G9W A;  4U0V A;  4Y13 A;  2VBX A;  1LDK B;  3WTW C;  5DD8 A;  3QOP A;  5D5U B;  1JE8 A;  1ZRC A;  1RZ4 A;  4WWC A;  5HDN A;  5FLX Z;  1YO5 C;  4CHU A;  2RV8 A;  4M9Z A;  4N9H A;  1Q1H A;  3P7N A;  2D1V A;  5H6R A;  4R79 A;  2EV5 A;  2CGP A;  5CVV A;  1AWC A;  3BJO A;  4UUV A;  2BYV E;  4B8X A;  3KP6 A;  3IL2 A;  4YG2 F;  3WGI A;  1ZH5 A;  1YW9 A;  2HYG D;  3FMR A;  4YFX F;  1TQP A;  4YII A;  1R23 A;  4N0B A;  1G6N A;  5JFR A; 
#chains in the Genus database with same CATH topology
 4XOP A;  2LK2 A;  2XF5 A;  4EJW A;  4EGY A;  3OYM A;  4BQN A;  3MKL A;  3U2R A;  3J80 Z;  4ZTF A;  1E3O C;  2K9N A;  1LNW A;  3MEX A;  4MHG A;  2MSY A;  4ESJ A;  2ISY A;  1T0F A;  4XRS G;  2QEX I;  5ICE A;  2MA3 A;  1ON1 A;  1F5T A;  1HC8 A;  1GVJ A;  3WGG A;  2QWW A;  4M3D A;  4MIM A;  1J5Y A;  1OCZ H;  3UNG C;  1U9N A;  4LMY A;  4XLH A;  5J1Y A;  1P2F A;  3AG2 H;  5ILU A;  2KMU A;  4NQW A;  1S6L A;  2CFO A;  4RAZ A;  3RKW A;  4GO1 A;  3RJP A;  2BY2 A;  4BH9 A;  3K4M A;  3CUQ B;  1O4X A;  1FPQ A;  2TDX A;  1X1B A;  4BXU A;  2XDV A;  4XSZ F;  2E2I J;  4PFP A;  4CCO A;  4BAY A;  5E3O A;  2IVM A;  2WY7 Q;  4RM3 A;  3QPT A;  2DOD A;  3OS2 A;  1CQT A;  1PDN C;  1ETY A;  1HQC A;  4DNC A;  1Y0U A;  3K2Z A;  1UMQ A;  3L09 A;  5BNG A;  4IX7 A;  3GW2 A;  4ZYH A;  3GBG A;  4QSH A;  5IP7 J;  3D1N I;  1LPQ A;  5L3E A;  3J7Y J;  4EM0 B;  2KIU A;  3I5U A;  4AM3 A;  4L9N A;  2K02 A;  2UV1 A;  4AU7 A;  1B4A A;  3TOA A;  4RB0 A;  5LHH A;  4W1U A;  3HSR A;  4RLQ A;  2HTJ A;  3K4N A;  2QM3 A;  1UZC A;  2CFX A;  4XMY A;  1LFU P;  4CSW A;  1ZRD A;  3KP2 A;  1A04 A;  4EAT A;  3PNY A;  2L02 A;  1S5L C;  3GTM J;  3CC2 I;  3SFI A;  1UAA A;  4IF4 A;  1T39 A;  3HXL A;  4D5F A;  1YJN I;  5L3C A;  5EF6 A;  1YX5 A;  2KIM A;  4NDL A;  3DFG A;  4OMZ A;  1LKX A;  2Y48 A;  1IW7 F;  4ZYE A;  3GTO J;  2R7V A;  1NG6 A;  2VE8 A;  2KQR A;  4IHS A;  1IDY A;  1IN6 A;  3SZP A;  3K6G A;  5GPC A;  5CQG A;  4WXD A;  3OY9 A;  3KP3 A;  3ECO A;  2Y0S A;  4HF0 A;  1IN4 A;  3KEO A;  2FOK A;  2LC2 A;  4FQG A;  1T6S A;  1XD7 A;  3IWF A;  1TW3 A;  3N4M A;  1HW5 A;  1S7E A;  2EH3 A;  2R4G A;  3I59 B;  3VOE A;  1U5T B;  1GXP A;  4KIS A;  3IKT A;  1U6G A;  1HST A;  3F72 A;  1MDM B;  1MJA A;  4WXH A;  3I4M J;  2MFZ A;  3VDX A;  1Z6T A;  2JJ7 A;  2PQ8 A;  4Z6Y A;  3MAJ A;  3RIR A;  1D1C A;  1K78 B;  4ZYD A;  2CRG A;  2YU3 A;  1LJ9 A;  1QHG A;  5HNH A;  1TWF J;  1WWX A;  2X51 A;  4HSR A;  3CLO A;  1RKT A;  2CUF A;  1KQ0 A;  1QHH D;  2V1D A;  1YIT I;  1PJR A;  1NK2 P;  2WB1 A;  2R7W A;  1DUX C;  3S3N A;  4PGH A;  3RPQ A;  5H2F C;  3CCV I;  4HDV A;  1QZZ A;  3NQO A;  4KIF A;  3R60 A;  3OWT A;  4L5J A;  2MD5 A;  2OF7 A;  2O7O A;  2Z99 A;  1UJ8 A;  2IAI A;  1GLN A;  2ZME C;  4BBS J;  2Z2S B;  4BGD A;  2XB0 X;  3ONQ A;  1DPU A;  3H1C A;  3NRV A;  3LSM A;  5DEQ A;  4B3X A;  5FRO A;  3QP5 A;  2L0K A;  1G2H A;  2H6B A;  2EFW A;  3SFZ A;  2X9D A;  4B09 A;  3HUG A;  3C2G A;  1ZGW A;  1G59 A;  4IHT A;  1VQ9 I;  1FP1 D;  4MQV A;  5E3L A;  4H4K C;  2ID3 A;  1QPM A;  3LA2 A;  1EA3 A;  2E1N A;  3U1D A;  2CW0 F;  1FIP A;  3TP0 A;  2H1K A;  1IG7 A;  1O3R A;  4Q5S F;  2RQP A;  1AOY A;  1VQ4 I;  3DEW A;  3IH3 A;  5LGT A;  2VPR A;  2PN6 A;  4LLN A;  4CDG A;  2CO5 A;  2EIN H;  3D5S C;  3IKV A;  3LFU A;  2ZKZ A;  4C3H J;  4MNU A;  3OYN A;  2KZV A;  2W48 A;  3S2W A;  2OUM A;  3EUH C;  4HYE A;  4RGX A;  3V8K A;  2KJC A;  5LGU A;  1PP8 F;  1XN7 A;  3U21 A;  4OIQ F;  4NC6 A;  4X6A J;  5F6F A;  1TZL A;  1WJD A;  3OV8 A;  2P0W A;  4HRI A;  5HS7 A;  2PMH A;  1Y1V J;  2IXS A;  1YOV B;  2KDZ A;  4E6K G;  3QU6 A;  3SEZ A;  2KRC A;  3ZMV A;  3ERE D;  1LQ1 A;  2Y2Z A;  4EEF G;  2OC6 A;  2XC7 A;  4PJJ A;  3DF8 A;  1QVT A;  1R7J A;  2VC0 A;  3ESW B;  1ZLK A;  3J81 K;  4B48 A;  5JHU A;  3QRF F;  1RNL A;  2RRE A;  1I39 A;  4JK1 X;  3REO A;  4DW6 A;  1U3E M;  2D1H A;  2K86 A;  2MAB A;  1STZ A;  2FNA A;  2QKL B;  4AYB A;  3SJM A;  2EB7 A;  3J7A O;  3VYR B;  1ZQ3 P;  1QA6 A;  4E7Z A;  3S93 A;  4DYR A;  1YJ9 I;  2OAZ A;  2VQH A;  2HR3 A;  1JUP A;  3LQQ A;  2DOA A;  2X1C A;  4G7H F;  4ZDO A;  2W00 A;  4E7K A;  3RTR A;  2Y31 A;  2TCT A;  3RPU D;  2VOD A;  2NVQ J;  4PGG A;  5LHG A;  3ZMS A;  4IEJ A;  1IZ1 A;  2RKH A;  4ENN A;  1I6H J;  4KYW A;  1X4O A;  1G3W A;  1UHW A;  1Y0N A;  2FQ4 A;  5F27 A;  4NQW B;  3SZT A;  4RAG A;  1OKR A;  4A3L J;  4F7Z A;  3S16 J;  2VXD A;  3FX3 A;  2HTS A;  4DYQ A;  1QPI A;  2E5N A;  4RGS A;  3HOX J;  1LUJ B;  4M3E A;  2KJB A;  2A05 A;  3TP3 A;  1ZR2 A;  4PCQ A;  3EUA A;  5E1X A;  3K10 A;  4ZJZ A;  5BPI A;  4GYG A;  3DPL C;  2N8G A;  4MTE A;  3OIQ A;  3LST A;  2BGC A;  5LEJ A;  3VEP A;  3WTT C;  1ZR4 A;  4LLG F;  2IGM A;  1N77 A;  3FMS A;  3NWS A;  1FWZ A;  3K4K A;  5F0C A;  2L9S A;  3T8R A;  4F92 B;  3P9I A;  2L54 A;  1XGM A;  1ULY A;  2K5C A;  2LF7 A;  4A6E A;  4LK1 F;  4BE2 A;  4OAY A;  2IS1 A;  3KZI C;  5FD6 A;  1DQU A;  4HQE A;  2OV7 A;  1L3L A;  2JA7 J;  2Z33 A;  2BEO A;  1WPK A;  3K69 A;  1WJA A;  3L2W A;  1QNT A;  3I4P A;  2K3F A;  4AD9 A;  5IT9 K;  5BMZ A;  1X1P A;  3DPU A;  1FTZ A;  5J4V A;  1VQK I;  4A3B J;  1A6I A;  2K7L A;  3OSF A;  1HLV A;  2VT3 A;  1S7O A;  4M9S A;  1V5E A;  1REP C;  4O3M A;  3C7J A;  2DA5 A;  4BXX J;  3LA7 A;  1T56 A;  1S7A A;  2E1C A;  3P5J A;  4L9V A;  2RAE A;  4BQA A;  3HSE A;  2EIM H;  3MN2 A;  5LBQ A;  3C2B A;  1ZTR A;  4B47 A;  2C6Y A;  3A01 A;  1OCC H;  3FXU A;  4G6T B;  2VJ4 A;  4ETS A;  2X4H A;  5D6F A;  1RET A;  3MZH A;  1U8B A;  3L00 A;  3J7A Y;  1H0M A;  3S1Q J;  4ZZD A;  2LH9 A;  5EJC A;  5LGN A;  1Z6R A;  1XTA A;  2HPI A;  4XIC A;  4RBO A;  3Q0W A;  1ZG5 A;  1MBF A;  4E7S A;  2WAQ A;  1POG A;  2EJR A;  2BV6 A;  3M8E A;  1H9G A;  5CQE A;  3DLA A;  1MSE C;  3AL0 B;  3ECH A;  2H8R A;  3KP7 A;  3KZZ A;  1GDT A;  2LKP A;  5IOY A;  1H88 C;  2OQR A;  3BJ6 A;  2LDU A;  1AKH B;  4XL9 A;  2IRF G;  5ED4 A;  1VQ6 I;  2XIG A;  3O8H A;  4I7H A;  2A07 F;  5B3S H;  3L7W A;  3DCF A;  3CDL A;  4ASN A;  4MTD A;  3HJE A;  1B72 A;  2HDW A;  3F8M A;  2GAU A;  4ZDP A;  1ORK A;  2AO9 A;  5GAG J;  3DBR B;  4S05 A;  5JR3 A;  2R7X A;  2W25 A;  3I9V 2;  3QOE A;  3HOV J;  2W1O A;  3ELK A;  1E17 A;  2XGC A;  3BG7 A;  3ZXS A;  5KK1 A;  4BDZ A;  1XSD A;  1D1A A;  5D4R A;  1R4N B;  4Y7N J;  1ZN2 A;  5J6X A;  1SFK A;  2FXA A;  3HHG A;  3C1D A;  3PNV A;  5GAE J;  1JJ6 C;  1A36 A;  2O6G E;  3R4K A;  1O7L A;  4A3E J;  2YX4 A;  3OYA A;  2LTP A;  4A12 A;  4AIK A;  4M72 A;  2DXI A;  3OL4 A;  2IA1 A;  3VPR A;  4P5O A;  5DYM A;  3WTS C;  2H6C A;  2ZJP F;  4RAF A;  4HPQ A;  4A3F J;  4RB3 C;  2ZXI A;  5JVT A;  1SFO J;  2ZNY A;  4CIC A;  1J2X A;  2DMU A;  4A6D A;  1Z9C A;  1V55 H;  4RLF A;  2XPV A;  1O7F A;  3H0G J;  4XLF A;  2MH2 A;  1R5H A;  4BQQ A;  1D1B A;  4Z2Y A;  3WE3 A;  3G71 I;  4XNF A;  5E1W A;  4A0X A;  2QCO A;  4QPO A;  3BCB A;  2DQR A;  3K9T A;  3S15 J;  2KRF A;  4PFO A;  2PI0 A;  3HPH A;  2CQX A;  2RN7 A;  2XB5 A;  4XLE A;  1OPC A;  1DP7 P;  1R5I D;  3BJA A;  3W3C A;  4H0E A;  4E7L A;  4S04 A;  4PK4 A;  4Y15 A;  1LVA A;  2RNG A;  1BIB A;  3F21 A;  2CJJ A;  3EUK L;  2A69 F;  3O8G A;  3NAR A;  5D5W B;  1W0U A;  3I53 A;  4A3D J;  2EA2 A;  3ROU A;  2J5P A;  3FK7 A;  3KZY A;  5L3D A;  3VB2 A;  3VOD A;  4GDF A;  2A6T A;  2HZT A;  1FZP B;  2LNB A;  3UR3 C;  2X6X A;  2F2E A;  2HQ5 A;  4Y33 A;  2KFD A;  2EZI A;  5IOZ A;  3LSK A;  2ZJR F;  3BR0 A;  1KON A;  1K6Y A;  2PJP A;  3G1M A;  4M3G A;  4BDY A;  3PUF A;  3JAM Z;  3LL7 A;  4XKC A;  1IGN A;  3KIO A;  4GGG A;  4JX6 A;  2V9V A;  1ZRF A;  5CVU A;  2EZK A;  2XAQ A;  4M3F A;  2DA1 A;  4HBL A;  1AHD P;  2GWR A;  3PFY A;  3CO7 C;  3VSL A;  4U7B A;  1RI7 A;  1ZLJ A;  2AQE A;  3FXR A;  4RB2 C;  1FOK A;  2VKV A;  2LKX A;  1BW5 A;  3EET A;  1YX3 A;  1F4K A;  1IF1 A;  1FNN A;  4G6Q A;  1VQO I;  3RZO J;  2R7Z J;  4BXF A;  1FBU A;  3ZMD A;  2QZ8 A;  2QQA A;  2R7S A;  4UVC A;  2ETH A;  1Y6I A;  4C3J J;  2QQB A;  3TBI A;  2HNH A;  3F8F A;  3GCM A;  2NVU B;  3DU6 A;  3WOD F;  4BQO A;  3HRT A;  4UV8 A;  2MD0 A;  1OR7 A;  3SZG A;  1DU0 A;  5J8C A;  3DTI A;  4CGZ A;  2F48 A;  3MKZ A;  3CCJ I;  3GZ5 A;  3O6B B;  2OBP A;  5A2Q Z;  4QLC U;  4FHT A;  2JTV A;  2E1M C;  3HB9 A;  3OSG A;  2LBF A;  4L18 B;  4HX8 A;  4EM2 A;  2KLO A;  4FIS A;  1TTY A;  4P96 A;  5BOX A;  3H5N A;  3CDH A;  2OCC H;  5DUI A;  2BW3 A;  3E6C C;  2Y9Z A;  1GHC A;  4L9J A;  4EQQ A;  3WTU C;  2AHQ A;  5E18 F;  1R4M B;  2L7K A;  4AVP A;  5H20 A;  2DFE A;  2FBI A;  3GXO A;  4HNU A;  2VOP A;  5DCF A;  1X3U A;  2NVX J;  5HDK A;  2KKO A;  2P8T A;  3GO5 A;  4FX0 A;  3KFW X;  4ZDL A;  5DTD A;  3ZMT A;  3JRG A;  4KN4 X;  2P6T A;  2IPQ X;  2KZG A;  3HEF A;  2E7W A;  4BY1 J;  2M7B A;  5IYC J;  4ON0 A;  4F52 A;  2VQC A;  3CJN A;  2PMZ N;  1XCV A;  2OU2 A;  1OYW A;  3OR2 C;  3RPU A;  3LA3 A;  3HKZ A;  3TL4 X;  2XF7 A;  2E5Z A;  2V1N A;  5E8G A;  4ANJ A;  3R0J A;  2HGC A;  4A3M J;  5DCM A;  2ZSH B;  1WH5 A;  1IC8 A;  2DYR H;  4LIU A;  4HQM A;  1JTX A;  3E5Q A;  1O3S A;  2DLL A;  2DTZ A;  1LEB A;  3FXJ A;  1TWC J;  1E3P A;  3PM1 A;  3WGH A;  4A3C J;  1A5J A;  3E6D A;  4IRG A;  1SAX A;  4RS8 A;  3AG3 H;  2BHY A;  3ABL H;  4DOZ A;  3S14 J;  4BE0 A;  1OLT A;  3GLL A;  2VN2 A;  2JRM A;  1M1E B;  2CQN A;  4K2E A;  3M3Y J;  3H92 A;  1U9O A;  2KL4 A;  1FEX A;  2KIQ A;  3RKQ A;  1YYV A;  1ZKG A;  1IAW A;  1K61 A;  4JOM A;  1I27 A;  3JRD A;  1BR1 A;  1L0O C;  1W5S A;  5M5X J;  4FX4 A;  2R7R A;  2QGU A;  5HOO A;  2Z5U A;  3QAH A;  5FO5 A;  2QBY A;  3RI4 A;  1MD0 A;  1UB9 A;  1MBH A;  2LR8 A;  1ODD A;  3KET A;  3VYS B;  1FMW A;  2M34 A;  1UCR A;  1MBE A;  2M4G A;  4IHY A;  2FBK A;  4PJL A;  1BR4 A;  2HOT A;  2QQ9 A;  1SD5 A;  2WC2 A;  3DBL B;  3HOT A;  4W97 A;  4NC8 A;  5FLX K;  4PJM A;  3OIP A;  2M0C A;  2A3S A;  3ASO H;  5EZG A;  4PJN A;  2NRA C;  1TBX A;  3HOS A;  2R7U A;  3SDB A;  3BR5 A;  1SMT A;  3I54 A;  4M71 A;  4RDU A;  2K40 A;  2R92 J;  1KQ9 A;  3IUO A;  3K1N A;  1LFP A;  5JVG F;  2D5V A;  1BBY A;  3HOY J;  4L9T A;  2AXL A;  4IHX A;  3OYC A;  1IRG A;  3FIW A;  2W24 A;  3IAS 2;  3ZQ7 A;  3NEU A;  3A0B C;  1O3Q A;  1VF9 A;  3CO6 C;  1FMV A;  2O0Y A;  2Q1Z B;  1OQY A;  2MBF A;  2EA4 A;  1RPW A;  2V9K A;  1LFB A;  2DFI A;  2MC4 A;  2P81 A;  4P55 A;  1FYM A;  2H94 A;  1LDD A;  3VSK A;  4FE4 A;  2QQ8 A;  1JKO C;  2X6W A;  3TED A;  1FYK A;  1BJZ A;  5D8K B;  3FKI J;  1XMX A;  4OIO F;  1DPR A;  4Q48 A;  2M8E A;  2ZBK A;  1DGR M;  3EYY A;  1LDJ A;  4ABZ A;  1T95 A;  2COB A;  4UV9 A;  2HFH A;  3FK6 A;  1ENH A;  4C2T A;  2VJJ A;  1W5T A;  2QF7 A;  3SYT A;  1SEU A;  1R1V A;  3F8N A;  3GFL A;  4HDU A;  2XAS A;  1S29 A;  2F5V A;  3J80 K;  2JK3 A;  3F6O A;  4HG2 A;  2VQL A;  3FM5 A;  4MO7 A;  1VQM I;  2VOO A;  3S1R J;  4Y3O A;  4L0Y B;  2DA2 A;  4DJA A;  5CVJ A;  5TJJ A;  4UXN A;  3TDU C;  2M4K A;  3IRQ A;  3FHZ A;  4UUT A;  4UB6 C;  1R1T A;  5J1R A;  4YFK F;  2JPC A;  1C0W A;  2JA2 A;  3DQV C;  4LLL A;  1WJF A;  3ZQF A;  3GZN B;  3CCU I;  4HX4 A;  1N25 A;  2QEN A;  2V1X A;  4GCV A;  2FJ1 A;  4KFC A;  1HA8 A;  1W7P D;  3BTI A;  2COM A;  1KU2 A;  3BQY A;  3QPH A;  4LG0 A;  5F1J A;  2XPW A;  5CJ9 A;  3D0S A;  2ADU A;  2H09 A;  3PIO F;  2A6H F;  3BG6 A;  1KU9 A;  3GFM A;  3S1N J;  1QU3 A;  3HM5 A;  5BPD A;  2DMN A;  3PNT A;  3AKZ A;  3BTJ A;  2VON A;  1MNM C;  3M1E A;  2VKD A;  1R49 A;  1GT0 C;  4MFD A;  2LOO A;  5E1Z B;  3CDI A;  5BQT A;  3KEY A;  2ZXH A;  3E0J B;  5J47 A;  3CUO A;  3HOU J;  2DA6 A;  3CCM I;  2F6C A;  2CV2 A;  4IOC F;  3DPT A;  1WI9 A;  3OYL A;  5DM6 F;  3BQZ A;  3PSF A;  1USS A;  3TOB A;  2Q0O A;  2LD5 A;  3LSG A;  2W7N A;  3BPV A;  3MFK A;  4RGR A;  2LBF B;  3W2V A;  4EV0 A;  4BL0 B;  4ENK A;  4XN0 A;  1IRZ A;  1I6X A;  1XDU A;  1SVO A;  4IJA A;  2LMD A;  4A3K J;  2VL8 A;  4OAZ A;  4Y17 A;  3K4L A;  3SXY A;  5K5R A;  2BW3 B;  2CUE A;  5IP6 A;  4D5C A;  3DBH B;  1YW7 A;  3FM3 A;  2R5Y A;  4N4O B;  1WGX A;  3H9J A;  3IAM 2;  4B4C A;  2ECB A;  1PYV A;  1Z3Y A;  3CUQ C;  4D7M A;  1FC3 A;  3V7S A;  1ETK A;  1MND A;  2HVS A;  5LHI A;  3F3X A;  5J8F A;  1R58 A;  3N97 A;  5F04 A;  1U2W A;  5TRD A;  5KAF C;  5LD2 C;  2ECC A;  2X1D A;  1VQN I;  2NVT J;  3TMO A;  3C18 A;  4XON A;  4CYC A;  2K9L A;  5EG0 A;  1KYW A;  4HZF A;  4L5I A;  3CP8 A;  2QVO A;  3BDD A;  3BRO A;  3FXK A;  1TQM A;  5DUK A;  3J81 Z;  3ERM A;  2JA6 J;  2Z1D A;  1OYY A;  2CUZ A;  3IV5 A;  2EZH A;  4N9I A;  1Y39 A;  1OFC X;  3ABT A;  2FEZ A;  3P9C A;  1U8R A;  1RR7 A;  4RA2 A;  1K4T A;  2NAZ A;  3M1C A;  5DCM B;  1LE8 A;  5LLQ A;  1B6A A;  1DGW Y;  3KYD B;  5J1U A;  1R00 A;  2BXY A;  3HZJ A;  2M5W A;  4N4N B;  3E5X A;  2VC1 A;  1F1Z A;  3L2V A;  4PZJ A;  3JSP A;  5M3F J;  3BP8 A;  3IP4 B;  2NNN A;  3HRM A;  2JUG A;  1FLI A;  3SHF A;  4DBQ A;  3B02 A;  4ESB A;  3H3Z A;  1SFE A;  3RDI A;  2BZT A;  3FDY A;  4P9F A;  2UXX A;  3E5U A;  4V2G A;  3VYU B;  3HG9 A;  2J5O A;  2HVR A;  1D0Z A;  1B59 A;  2DO7 A;  2K27 A;  4RGU A;  2FX0 A;  1QRY A;  1P7J A;  3KX2 A;  3ZQQ A;  4HW0 A;  1BJA A;  5IPA A;  3A03 A;  4U0W A;  3RCO A;  3PO3 J;  4YIF A;  5H6Q A;  3F23 A;  4E70 A;  1P4A A;  1HKT A;  4LOC A;  1RC9 A;  3CMA I;  2PJR A;  1P7I A;  1U5T C;  5K7F A;  3M4O J;  3PFI A;  4GYI A;  1D5V A;  4R8H A;  2KP6 A;  5FKN A;  2UUZ A;  1P9Q C;  2QBY B;  2VBW A;  2EIL H;  2BBY A;  2VB6 A;  3OL3 A;  3VYT B;  1SFU A;  2GXB A;  2FMY A;  2LYC A;  1ETQ A;  3F8B A;  4ZTJ A;  2LVS A;  4B44 A;  2M7A A;  2I5U A;  1UEL B;  3S8P A;  4D7N A;  2BXZ A;  3QYB A;  3CZ6 A;  2MC3 A;  4LG3 A;  1FYL A;  3CCE I;  2A61 A;  1ZRE A;  1TLH B;  3F9K A;  3D5L A;  1P4X A;  1OR7 C;  4XSX F;  2HXI A;  1SAU A;  2GQQ A;  2HWV A;  3Q9V A;  2EIJ H;  4DIQ A;  1WFX A;  1VTN C;  4OIN F;  2RNJ A;  1XG1 A;  3M07 A;  4V2F A;  2CW7 A;  3H36 A;  4JX4 A;  4M73 A;  2STW A;  5D5X B;  2M30 A;  2QLZ A;  1MIJ A;  3RKY A;  1WI3 A;  1EKE A;  2LRE A;  4UHT A;  4U88 A;  4NB5 A;  1FJL A;  2GLO A;  1Z7L A;  3ISP A;  5FFZ A;  2ME0 A;  5E17 F;  3FXL A;  1X19 A;  4RAY A;  3CLQ A;  2EFQ A;  4PDK A;  2A5Y B;  3L2C A;  3MKW B;  2ACJ A;  3LQR A;  3ZQC A;  4J19 A;  3QYF A;  2FBH A;  3H5R A;  1I3A A;  4EJV A;  3MD2 A;  1HOM A;  3BG5 A;  4IKF A;  4Y52 J;  3K70 C;  3I3L A;  1P6R A;  1PUF A;  5F64 A;  3ZGK A;  2BHZ A;  3IH4 A;  4RM2 A;  1XMA A;  4TV7 A;  1XB4 A;  4HV6 A;  1MMS A;  2IA2 A;  2GXA A;  4G8X A;  2JQ7 A;  2A5W A;  4WXC A;  1TWH J;  3ZRG A;  2DMQ A;  1W36 D;  3IHU A;  3BC8 A;  2ZJQ F;  5M5W J;  2IS4 A;  2DOE A;  2KDO A;  2ESN A;  1DU6 A;  1E2X A;  2ID6 A;  1Z7U A;  2NVY J;  3BR1 A;  3RQI A;  5GAD J;  1IXS B;  1Z0X A;  4XLC A;  4AIH A;  1Z77 A;  1I3Q J;  5L3G A;  3BPX A;  2L5Q A;  4KIB A;  2PFB A;  3IWZ A;  2UWM A;  4NUB A;  3T1B A;  2DFH A;  4I6Z A;  3X2Q H;  2YSR A;  1O57 A;  1H89 C;  2ZC2 A;  1PVE A;  2LY2 A;  2P4W A;  3BZK A;  3OYK A;  4KA4 A;  4LG0 B;  2NOG A;  4A5N A;  2W82 A;  5IY5 H;  2B7E A;  2HYJ A;  4CCN A;  4BJ5 C;  1N75 A;  4XRM A;  2V6C A;  4O5V A;  3H35 A;  4IRI A;  4IO9 F;  1OCO H;  2FU4 A;  5ICG A;  1MJ9 A;  4DGW B;  3OS1 A;  1W36 C;  1ZHF A;  2QKM B;  1NTC A;  4PSX A;  3KYL A;  1UHM A;  2DDA A;  3WG9 A;  1BC7 C;  1JKP C;  5FD5 A;  4M6Y A;  4BUP A;  2LY9 A;  4YFN F;  2DPU A;  1APL C;  1R5G A;  3AFH A;  3HSF A;  2L3D A;  3BWG A;  3I4N J;  4BHP A;  2K3P A;  3H3U A;  4BBR J;  2WBM A;  3CCY A;  2XRO A;  1RKW A;  2FUG 2;  5KVR A;  3QOD A;  4OOI A;  3CCR I;  1MMN A;  2R5Z A;  3SEQ A;  3S1M J;  1T0F C;  3R0A A;  1XS9 A;  2ZXW H;  4J01 A;  1K6O A;  1J75 A;  2X0L A;  3OYJ A;  2E7X A;  2E2J J;  1EJ9 A;  1WJC A;  1BIA A;  4KT5 C;  5ICC A;  2I10 A;  4PUS A;  4BNC A;  2BY1 A;  4D0P A;  1FSH A;  2R5Y B;  2YR2 A;  3V8J A;  1OYI A;  5DDG A;  4XKV A;  4F93 B;  2K9S A;  1W7P A;  2JN6 A;  3NWT A;  2VPL A;  3V42 A;  4CCM A;  2CMP A;  1YIO A;  1A6Q A;  2EBI A;  4A0Y A;  1VQP I;  2G7H A;  3GEZ A;  1ETW A;  5FKK A;  1SFX A;  3H0D A;  2WAD A;  2ICW G;  4XID A;  3TQN A;  4C2U A;  1GVD A;  3OYH A;  3HDD A;  3KE2 A;  4IOA F;  2DW4 A;  2ZME A;  3HUG B;  3OIO A;  5C3E J;  5TIS C;  1ON2 A;  4CYC B;  4UUS A;  3JR9 A;  3BZC A;  3KLN A;  1ZEL A;  2OQG A;  5EG0 B;  3BR3 A;  3LSI A;  5LRR A;  2PEX A;  3OYI A;  1FBS A;  4L0Z B;  2NXN B;  3HPG A;  3I71 A;  1BC8 C;  5HS9 A;  1BOB A;  1E0E A;  3C2H A;  4KMU X;  2G7U A;  1WH7 A;  4MQ9 F;  1MMD A;  2DOF A;  1RIO H;  4IZZ A;  5HLT A;  5HLG A;  1CGP A;  1XGS A;  3K0L A;  1SD6 A;  4A0Z A;  1HW1 A;  4PSW A;  5B5E C;  3PO2 J;  1H9T A;  3GWZ A;  1LE8 B;  2DTR A;  2R7O A;  4MLO A;  1JKQ C;  2HQA A;  3F6V A;  4XRS A;  1FBQ A;  2XRN A;  2DJN A;  3S3O A;  1SD7 A;  4HNV A;  2FQ3 A;  2CU7 A;  3F0C A;  1V5G A;  5M3M J;  2TRT A;  1RUO A;  1EF4 A;  2LY1 A;  2OD5 A;  5K7H A;  3K7A J;  4RMN A;  2GOX B;  3G4S I;  1T38 A;  1JT0 A;  2DT7 B;  3JW4 A;  3WE2 A;  1XDS A;  2KRH A;  3CTA A;  3J7Z I;  2JVH A;  3EQL F;  4E4H A;  3FF5 A;  2R7D A;  4XLP F;  2B63 J;  2IS6 A;  2CQQ A;  1WVR A;  3EUH A;  4C2M J;  4Q47 A;  2F4M B;  3V8L A;  1D5Y A;  1MGT A;  4IQ4 A;  1N78 A;  1NHA A;  2F5F A;  2M3A A;  4HX7 A;  2CW8 A;  1NG7 A;  3E6B A;  1XMK A;  2ZB9 A;  3LAP A;  2ZXJ A;  3KLO A;  1YLF A;  3K1P A;  2PJR B;  3AL0 C;  1ACI A;  4FCY A;  4G94 A;  2JMW A;  2X48 A;  5JLX A;  1W5C C;  4JYK A;  2PX9 A;  3H3V K;  3A4C A;  1RR8 C;  1GXQ A;  2OJE D;  3GTL J;  3G3Z A;  4IVN A;  3DKY A;  3S3M A;  1VQ5 I;  1J9I A;  3ABU A;  4B1R A;  2XGE A;  3SDG A;  1R36 A;  2E34 A;  3WU1 B;  1MMG A;  2G0E A;  4WF2 A;  4CH7 A;  3HOW J;  2P7V B;  1V3F A;  3WTY C;  1X1A A;  4JP0 A;  3RYR A;  3RQ4 A;  1G3S A;  3MWM A;  2DN0 A;  4AVZ A;  1K78 A;  2IGN A;  5EZH A;  2E36 A;  5E20 A;  4IPA A;  2XF6 A;  4BEH A;  3K1M A;  3CD6 I;  3MCZ A;  1SD4 A;  2L7M P;  4IXA A;  4DBR A;  1MBK A;  2K4J A;  1G3Y A;  5FGM A;  1YE9 A;  1RRJ A;  3HL2 A;  1ZYR F;  2W57 A;  4KIG A;  1Z91 A;  2F4I A;  4UVA A;  4LGW A;  3QQA A;  4DZP A;  1ETX A;  1QQI A;  1K83 J;  2EV6 A;  3JTH A;  3RSN A;  4XLA A;  3COA C;  2YU9 J;  3CC4 I;  1P4W A;  1VQL I;  1MH4 A;  2HXO A;  2QYO A;  4EJU A;  3JAM K;  2V1U A;  3L1P A;  1VI0 A;  4O6J A;  1JXS A;  3G73 A;  2O5R A;  3MQ0 A;  5TGT A;  1Y8Q B;  2EFO A;  4XKB A;  1J7K A;  2W4S A;  2WTE A;  2KIF A;  3A0H C;  3LSR A;  3GME A;  4GFB A;  2IW5 A;  3OYE A;  3Q0U A;  2IS2 A;  1U0J A;  1PUF B;  1HSJ A;  4QTR A;  4DQ2 A;  4WK8 F;  1IV6 A;  1BR2 A;  1IUF A;  3E3V A;  3DKW A;  3HGY A;  2VKE A;  3JRB A;  4I76 A;  2CG4 A;  3HYI A;  1EH7 A;  2Y0S N;  2JT1 A;  2CV1 A;  2QSF X;  1B9N A;  1F43 A;  3OYD A;  2XUB A;  3IC7 A;  3DKX A;  3ZCO A;  1OIS A;  2P6S A;  4R1H A;  5HLI A;  2V79 A;  1BI2 A;  4P1W A;  2MH9 A;  5KAI C;  1PP7 U;  4NBQ A;  2ZFW A;  3TO9 A;  2L9V A;  3P9K A;  4AWX B;  5DV5 A;  3A01 B;  5CPR B;  5A2Q K;  4KIT B;  1XC5 A;  2Q2E A;  1MKM A;  3DEE A;  2ELJ A;  2Z3Y A;  2LFB A;  3MMY B;  2XGX A;  2WAE A;  5B1A H;  3ASN H;  2EWN A;  3W2W A;  1BI3 A;  4A3G J;  4UNO A;  1WCM J;  3I58 A;  5JI6 A;  5K1Y A;  5HOD A;  1GV2 A;  2PMU A;  4L5E A;  4MFE A;  2LP0 A;  4UVB A;  5CKT A;  1DDN A;  4F55 A;  3KP5 A;  5DS9 A;  2W84 A;  2WB1 N;  2NNY A;  3CF5 F;  1YTY A;  1JT6 A;  3U9G A;  1WKM A;  3EDP A;  3L9F A;  1JUM A;  2I8D A;  1QVU A;  2CYY A;  5LRS A;  1IDZ A;  2OCE A;  1B72 B;  5GTH C;  1KU7 A;  2Y69 H;  4FET A;  4G7Z F;  1ZG1 A;  1YIJ I;  5C4X J;  4BY7 J;  2V6E A;  3RKX A;  4F3Q A;  2XVC A;  4KDP A;  1UG0 A;  1TQI A;  3OYB A;  3GZ6 A;  4PJ0 C;  2ZJ2 A;  2DCE A;  2DI3 A;  3ZQI A;  3K4J A;  2R5Z B;  3LSH A;  3ZQH A;  1QZE A;  3M7G A;  3WTV C;  1XSX A;  2NOJ B;  2ELK A;  1YW8 A;  5M5Y J;  2XHK A;  3CJQ B;  1FY7 A;  2DT6 A;  4CZZ A;  1TWG J;  1EH6 A;  2BY0 A;  3CJR B;  1CF7 A;  1FIA A;  3ULQ B;  5FKL A;  2DK8 A;  4LB5 A;  3FBI B;  1IN7 A;  1X1C A;  1W7P B;  4ZC3 A;  4FTH A;  4HF2 A;  2WWY A;  1HBX G;  3WHC A;  5IT3 A;  4CYD A;  5JHF A;  1S9H A;  2MGQ A;  3GF2 A;  2V9P A;  1OJL A;  2VBY A;  2WV0 A;  3CF2 A;  2QSG X;  1KGS A;  2HKO A;  5IP9 J;  1XGN A;  1K79 A;  3C3W A;  1XGO A;  1SAN A;  4FT8 A;  3TW7 A;  3W6V A;  2ZME B;  2DDB A;  1E3H A;  3H9Q A;  4UUS B;  3LMM A;  1Z05 A;  4II3 A;  5JLW A;  3ZOB A;  2M45 A;  3DTE A;  2KIS A;  3AG1 H;  4EGZ A;  2RVC A;  1YHQ I;  3E7L A;  2X6Y A;  3PQK A;  2E71 A;  3LSP A;  5LEK A;  4QPQ A;  4A5M A;  2CWE A;  1IN5 A;  3KEQ A;  1X1D A;  3E97 A;  1G4D A;  4LD5 A;  1WRJ A;  3KCC A;  4I02 A;  3JRH A;  4BKX A;  4BYY A;  3GFI A;  4YEL A;  3ZN0 A;  2R7T A;  1LB2 A;  4CA0 A;  1UG2 A;  3I56 I;  2M87 A;  3CES A;  3PQJ A;  1D8K A;  3DXJ F;  2Y75 A;  2ZO4 A;  4JBA A;  4UY8 I;  2AQF A;  2NS8 A;  2K9M A;  3T8T A;  2PBI A;  2HU9 A;  5F1R A;  1JTY A;  4EMS A;  2BOL A;  4AYB N;  4XOR A;  3JCU C;  4XKW A;  3S2D J;  4EVI A;  3E1S A;  2O3F A;  2HYF A;  2HOS A;  4P9U A;  5FFX A;  3Q5F A;  4ITV A;  2P7C B;  3AG4 H;  5C44 J;  1JHF A;  3JRF A;  5J4Y A;  2R7Q A;  2R0Q C;  5EYR A;  2PMZ A;  4DZJ A;  4G7O F;  3FXO A;  3GFJ A;  2OTL I;  2DK5 A;  3PSI A;  4FAS D;  3LAJ A;  1BL0 A;  4ZYG A;  2M2E A;  2YUS A;  1VZ0 A;  4LFU A;  4IL6 C;  4OIR F;  1T08 B;  2XAU A;  4LIV A;  2K9Q A;  1OCP A;  2L7F P;  4E7H A;  1YS6 A;  1B8I A;  2VT2 A;  5FRN A;  1IV8 A;  1JI8 A;  1X4P A;  2VAS A;  4XBF A;  1V4R A;  4ZZL A;  1AKH A;  2K85 A;  3G6E I;  1IO2 A;  1BI0 A;  2XSJ C;  2JUC A;  2O61 A;  3B73 A;  3S2H J;  2KT0 A;  4BEH B;  2EPF A;  1IRX A;  4X0G A;  1T2K A;  1Y56 A;  2GA2 A;  3PIP F;  1SVL A;  4UB8 C;  2H8W A;  4HF1 A;  1OMI A;  2HI3 A;  5ILV A;  1NK3 P;  5EGO A;  1LVK A;  2DA4 A;  3CMM A;  4E7I A;  1PUE E;  4IHV A;  1X58 A;  1T33 A;  4YEJ A;  2IP2 A;  1EV7 A;  5FKO A;  1D0X A;  2ELH A;  4G6D A;  3CCQ I;  3HTS B;  5GTI C;  4ENJ A;  1D0Y A;  2HQN A;  3H9G A;  1BM9 A;  1JJ8 C;  1UST A;  4MEY F;  5E8I A;  3HRU A;  5HDG A;  2Y30 A;  5FRM A;  1MZB A;  4U0Y A;  3IRR A;  5IYB J;  3HOZ J;  1HXD A;  1FOX A;  1J59 A;  3QWL A;  4S0H B;  3QYE A;  3Q9S A;  1ZK8 A;  1Q1V A;  4BJ6 C;  2EK5 A;  2FML A;  2EV0 A;  2FNP A;  1QO0 D;  4X1E A;  2HVQ A;  2CUJ A;  5ICF A;  4I99 C;  2OTJ I;  1VND A;  2R3S A;  1U78 A;  2WAQ N;  1YQA A;  1X2N A;  3PL8 A;  3WG7 H;  5BS6 A;  3LFK A;  5CYV A;  1XSV A;  3A02 A;  4HOB A;  1ERD A;  2Z9O A;  1HKS A;  5CVR A;  3O2P E;  1AU7 A;  4IRH A;  3E6M A;  3V7C A;  1ETO A;  1IXC A;  2Q2E B;  1Y1W J;  3S17 J;  4A3J J;  3M8J A;  3T5X A;  3CJT B;  3GTP J;  2Y0M A;  2OZU A;  3ZMZ A;  4BU2 A;  2XRL A;  5IYD J;  4JX5 A;  1ZGJ A;  4NHJ A;  2IEK A;  1KQ8 A;  4NC7 A;  2GBY A;  1HDP A;  2XKP A;  1S3J A;  2EQR A;  5EEH A;  1I5Z A;  3TKY A;  9ANT A;  1J0R A;  2DA3 A;  2O9L A;  1AA7 A;  3O3K A;  1NH3 A;  1HCR A;  2O03 A;  2CV0 A;  4KIC A;  2VJ5 A;  3LSJ A;  1W4M A;  2XKO A;  3M9A A;  3WTZ A;  5E3N A;  1T98 A;  4KN7 X;  4C30 A;  5E3M A;  3R61 A;  2VLA A;  4I01 A;  3ZQL A;  3M8F A;  2D2W A;  1R22 A;  1TNS A;  5HNF A;  4AID A;  1D8J A;  2FRH A;  3BT9 A;  3FWE A;  2HQR A;  1BA5 A;  1YFH A;  2ME6 A;  3ABM H;  3SQN A;  5IT9 Z;  3MZY A;  2GA1 A;  1DP3 A;  1YRN A;  3K70 D;  1JGS A;  2HS5 A;  2XAJ A;  5ILS A;  4BAC A;  2XAF A;  4IHW A;  2UZK A;  1R6R A;  2ZFU A;  1FSE A;  1K7A A;  1TT5 B;  2P5V A;  3TO7 A;  2LF8 A;  2YPR A;  1B9M A;  2Q8K A;  1CF7 B;  5KCM A;  2UXN A;  3ZPL A;  2K4B A;  2GIZ A;  4I98 B;  3GTJ J;  2VUM J;  4HAM A;  5F0F A;  3TW6 A;  4BE1 A;  4M6X A;  4CO8 A;  2IBD A;  1I1S A;  1YI2 I;  3G1O A;  5K5O A;  1QZY A;  2DU9 A;  3RYP A;  2EIK H;  2VBZ A;  2QA4 I;  3AAF A;  2RDP A;  4AUX A;  3JRA A;  1ONV A;  3CCL I;  4QIW N;  2BE5 F;  5HS8 A;  4NNJ A;  1MSF C;  2PG4 A;  3G1L A;  2IJL A;  2B0L A;  4M74 A;  5L3B A;  3F22 A;  4EJO A;  2ESH A;  5GPA A;  2IT0 A;  5D4S A;  2HOA A;  3VFZ A;  3ML6 A;  4E7J A;  4OU0 A;  4M9X A;  3JRE A;  3DLL F;  1MH3 A;  4HLY A;  3WU0 A;  2EFP A;  3ZQG A;  5FLV A;  3QU3 A;  1JUS A;  4XQF A;  5FB2 A;  1KA8 A;  4BHC A;  3TGN A;  5D5V B;  2E19 A;  4C3I J;  4LB6 B;  5K5Q A;  4RB1 A;  2RGV A;  1KZH A;  2GIV A;  4D1Q A;  1SVM A;  2OPT A;  1O3T A;  1MW7 A;  2WY8 Q;  2WA0 A;  3HRS A;  2JRT A;  3R6S A;  3HGG A;  2HZD A;  1WJB A;  3ABK H;  3GVA A;  3ZN1 A;  4AIJ A;  4OWR B;  5EEA A;  2O8K A;  5GP9 A;  1JGG A;  2QSH X;  3OS0 A;  1FX7 A;  2CS3 A;  2LSO A;  5EEG A;  2AXT C;  5HLH A;  1K4S A;  3LWF A;  2HKX A;  3QPS A;  3CME I;  1GUU A;  1WQ2 A;  1IJW C;  1BI1 A;  3V7R A;  4I2O A;  1MBG A;  3Q3S A;  2KPM A;  4HA8 A;  2P5L C;  4LK0 F;  3JTG A;  1TT0 A;  4CCL A;  5FLM J;  2JPB A;  1Y8R B;  1T8I A;  2FA5 A;  2AS5 F;  3W6K B;  5ERI A;  5HVQ C;  4M6V A;  4OMY A;  3S32 A;  2OZ6 A;  3BTC A;  1TW2 A;  5GAH J;  5EDN A;  3DV8 A;  2E1O A;  2H1L A;  3BTL A;  5FKM A;  1V5F A;  3VWB A;  2P5K A;  3F8C A;  2A68 F;  2MG4 A;  3NAU A;  5F08 A;  1QGP A;  4YRV A;  1ZAO A;  2L7Z A;  2FSW A;  4V19 K;  3DTK A;  1FOY A;  4EM1 A;  4Q4Z F;  4KJZ A;  1R1U A;  5DD4 A;  2BVL A;  5AIP A;  5B1B H;  3BLY A;  4A93 J;  1P92 A;  1B8I B;  2LRD A;  2FF4 A;  4IQJ A;  3FXM A;  1I1G A;  3FBN B;  5L3F A;  4AC0 A;  4ENM A;  1SMY F;  1X3Z B;  3OOP A;  4WX9 A;  2L01 A;  1Z21 A;  2OA4 A;  4BHB A;  5AON A;  2JZY A;  2HOE A;  4GRI A;  4HST A;  2STT A;  2F5C A;  1VQ8 I;  1WSU A;  4XR6 A;  2DMP A;  2GXG A;  2E2H J;  3T0Y A;  4A2U A;  1BN5 A;  2JSC A;  3EYI A;  4XOT A;  1XCB A;  1JHH A;  3V4G A;  3LNQ A;  1B1B A;  3N05 A;  2BY3 A;  3W6J B;  3GTK J;  2CSO A;  1RUN A;  3L2Q A;  1FT9 A;  2VXZ A;  2NYX A;  2E1M B;  3BG9 A;  2JA5 J;  1ITY A;  5E79 C;  4OIP F;  5EGO B;  2W85 A;  4WCG A;  1D3Y A;  3OYF A;  1R71 A;  4XRF A;  1W1W E;  2E60 A;  4HEA 2;  2FOW A;  4FE7 A;  3ZR8 X;  1Z1D A;  3MZ8 A;  1OCT C;  2R93 J;  4B43 A;  1UHS A;  1G3T A;  2Y9Y A;  2ZNZ A;  3HKZ N;  4ESF A;  3DEU A;  2L9R A;  2IA0 A;  2Z16 A;  4KUM A;  2JA8 J;  2DFF A;  2DAO A;  2F5D A;  1W0T A;  2VKH A;  1RES A;  2HDC A;  3I55 I;  3CUQ A;  1S72 I;  3OR1 C;  1F9N A;  2BVM A;  2DBB A;  3IH2 A;  2X6O A;  5FJ8 J;  1BOA A;  1IUY A;  4JQF A;  2NS0 A;  2O8X A;  3B6C A;  3BCA A;  4HLX A;  2DPD A;  1FP2 A;  1BW6 A;  1Z67 A;  2ISZ A;  4II2 A;  1LEA A;  2JSP A;  5J40 A;  2VE9 A;  3A2K A;  1WHU A;  4XLN F;  3JSO A;  1IRF A;  4ZH4 F;  1GV5 A;  2M1B A;  4M3B A;  3L2R A;  5CLS A;  2MLG A;  3GYH X;  3UKG A;  1ZG3 A;  1V54 H;  3BR6 A;  2L9N A;  4G9Y A;  1UFM A;  2DT5 A;  1EH8 A;  4LIT A;  5B66 C;  2GZW A;  5C4J J;  2WAF A;  4D9J A;  2DQL A;  1XPX A;  5CVI A;  2MW8 A;  2CH0 A;  3A1Y A;  3KPH A;  5F0H A;  2VQG A;  1YS7 A;  3BY6 A;  1HF0 A;  2QUF A;  2RC4 A;  2HEO A;  3BZ6 A;  3HBL A;  4DYC A;  1A31 A;  1OCR H;  3TO6 A;  1ZGA A;  2MLK A;  5J3L A;  4YIR X;  4BJT A;  2XV4 S;  2DJI A;  2X85 A;  3FHN A;  4KNY A;  1S8N A;  1ETV A;  4G12 A;  1G8X A;  2XSD C;  4I0A A;  4XM3 A;  4A69 C;  3HC7 A;  1X2M A;  3JRI A;  5AIQ A;  3GX4 X;  1IN8 A;  2IGO A;  3PUB A;  1H8A C;  2GOM A;  3H5A A;  2H27 A;  5D6E A;  3KP4 A;  3OMY A;  1VFC A;  4HV5 A;  1SC7 A;  2F5E A;  3G2B A;  2L2O A;  3K4B A;  3WTX C;  2L4M A;  2HDD A;  4C9Y A;  3W2A A;  2WV1 A;  2YX7 A;  4KMF A;  1WJE A;  2PLY A;  2IGK A;  1TNT A;  3I59 A;  4KT6 A;  2EFN A;  4MGR A;  1U5T A;  4ZYA A;  4HNT A;  3K4C A;  1TP4 A;  1MDM A;  1YRN B;  3ZMU A;  1HW2 A;  2XAH A;  5D8L B;  2XAG A;  5K7Z A;  4I09 A;  1JKR C;  4EJT A;  1WJ5 A;  2R7F A;  3DP7 A;  3I0T A;  3FXQ A;  2FD5 A;  3TDZ C;  4I0B A;  2VJI A;  4CZC A;  3ZP5 A;  4F91 B;  1WZ2 A;  3B6A A;  3JRC A;  1HKQ A;  4CCJ A;  1X3W B;  2V7F A;  2V4J C;  1R9T J;  2A6E F;  5KHD A;  3RZD J;  3BOQ A;  2E35 A;  4U7D A;  1MJB A;  1Z3X A;  1KU3 A;  2XPU A;  3FMQ A;  4CCK A;  1YJW I;  3GLX A;  4GXO A;  1MNE A;  1IXR C;  2NS7 A;  1QBJ A;  3KYC B;  2DYS H;  3QP6 A;  2DMT A;  2MYS A;  2RQQ A;  2X1E A;  2LLK A;  3QPL A;  3GTG J;  2L4A A;  2HPM A;  1ZAR A;  3EPZ A;  3CMY A;  3GUD A;  3MKY B;  2LKS A;  2FE3 A;  4CXF A;  3CCS I;  2D45 A;  6PAX A;  2CQK A;  3HIF A;  2EZL A;  1XX5 A;  4QWQ A;  2ZCW A;  3HTU A;  3CC7 I;  4XK4 A;  3HHH A;  2DA7 A;  1KYZ A;  4LJZ F;  4MEX F;  1YG2 A;  3BR2 A;  3FZV A;  4XN3 A;  1MBJ A;  3I64 A;  1F36 A;  2G9W A;  4U0V A;  4Y13 A;  3GTQ J;  3WU2 C;  2VBX A;  1LDK B;  3WTW C;  5KNL A;  5DD8 A;  1TL8 A;  3QOP A;  3OYG A;  3DU5 A;  5D5U B;  1JE8 A;  1ZRC A;  5DM7 F;  1RZ4 A;  1I50 J;  2JWT A;  1TC3 C;  2M8G X;  4WWC A;  2M9H A;  5HDN A;  1J09 A;  5FLX Z;  2XGD A;  2B9S A;  2GM4 A;  1YO5 C;  1HDD C;  3BG3 A;  4A3I J;  4CHU A;  2RV8 A;  4M9Z A;  4N9H A;  4J00 A;  1Q1H A;  2VI6 A;  4B3A A;  2VIX A;  3P7N A;  1MMA A;  3WHB A;  1VQ7 I;  3FIS A;  2D1V A;  5H6R A;  1FTT A;  2F4O B;  2KHM A;  4R79 A;  3Q0V A;  2EV5 A;  3FKJ A;  2CGP A;  4Y4R A;  5LFA A;  2YS9 A;  3LOC A;  5CVV A;  1AWC A;  3K2A A;  3CQZ J;  3PJR A;  1TWA J;  1FOW A;  2ZSI B;  3BJO A;  4UUV A;  2BYV E;  2LG4 A;  3U1K A;  4B8X A;  3MVP A;  3KP6 A;  3IL2 A;  3OOU A;  1A35 A;  4YG2 F;  3CP2 A;  4U87 A;  3DWL E;  3D5R C;  3WGI A;  1ZH5 A;  1YW9 A;  2HYG D;  2CQ7 A;  3FMR A;  4YFX F;  2V26 A;  1TQP A;  4YII A;  1R23 A;  4CUG A;  4BS9 A;  2JVG A;  3L2U A;  2M0M A;  4N0B A;  1G6N A;  5JFR A; 
#chains in the Genus database with same CATH homology
 4EJW A;  4EGY A;  3U2R A;  3J80 Z;  1LNW A;  3MEX A;  4MHG A;  4ESJ A;  2ISY A;  1T0F A;  5ICE A;  2MA3 A;  1ON1 A;  1F5T A;  1GVJ A;  3WGG A;  2QWW A;  1J5Y A;  4LMY A;  1P2F A;  5ILU A;  4NQW A;  1S6L A;  4RAZ A;  3RKW A;  4GO1 A;  3RJP A;  4BH9 A;  3CUQ B;  1FPQ A;  2TDX A;  4BXU A;  4XSZ F;  4BAY A;  2IVM A;  3QPT A;  1PDN C;  1HQC A;  4DNC A;  1Y0U A;  3K2Z A;  3L09 A;  3GW2 A;  4ZYH A;  5L3E A;  4EM0 B;  2KIU A;  3I5U A;  4L9N A;  2K02 A;  1B4A A;  3TOA A;  4RB0 A;  5LHH A;  3HSR A;  2HTJ A;  2QM3 A;  2CFX A;  1ZRD A;  3KP2 A;  1A04 A;  2L02 A;  4IF4 A;  1T39 A;  5L3C A;  2KIM A;  3DFG A;  4OMZ A;  2Y48 A;  1IW7 F;  4ZYE A;  2VE8 A;  4IHS A;  1IN6 A;  3SZP A;  4WXD A;  3KP3 A;  3ECO A;  4HF0 A;  1IN4 A;  3KEO A;  2FOK A;  1T6S A;  1XD7 A;  3IWF A;  1TW3 A;  3N4M A;  1HW5 A;  3I59 B;  3VOE A;  1GXP A;  1U5T B;  3IKT A;  1U6G A;  1HST A;  3F72 A;  1MDM B;  1MJA A;  4WXH A;  1Z6T A;  2PQ8 A;  3MAJ A;  3RIR A;  1K78 B;  4ZYD A;  2YU3 A;  1LJ9 A;  1WWX A;  3CLO A;  1KQ0 A;  2V1D A;  1DUX C;  4PGH A;  3RPQ A;  4HDV A;  1QZZ A;  3NQO A;  4KIF A;  3R60 A;  4L5J A;  2MD5 A;  2Z99 A;  1DPU A;  3NRV A;  5DEQ A;  3QP5 A;  2H6B A;  2EFW A;  3SFZ A;  4B09 A;  3HUG A;  4IHT A;  1FP1 D;  4MQV A;  1QPM A;  3LA2 A;  2E1N A;  3U1D A;  2CW0 F;  1O3R A;  4Q5S F;  2RQP A;  1AOY A;  5LGT A;  2PN6 A;  4LLN A;  4CDG A;  2CO5 A;  3IKV A;  2ZKZ A;  4MNU A;  3S2W A;  4HYE A;  4RGX A;  3V8K A;  2KJC A;  5LGU A;  1PP8 F;  1XN7 A;  4OIQ F;  5F6F A;  3OV8 A;  5HS7 A;  2PMH A;  3QU6 A;  3ZMV A;  1LQ1 A;  3ERE D;  3DF8 A;  1R7J A;  2VC0 A;  1ZLK A;  3J81 K;  5JHU A;  3QRF F;  1RNL A;  4JK1 X;  3REO A;  1U3E M;  2D1H A;  2K86 A;  1STZ A;  2FNA A;  3J7A O;  2EB7 A;  2OAZ A;  2HR3 A;  3LQQ A;  4G7H F;  3RTR A;  2VOD A;  4PGG A;  5LHG A;  3ZMS A;  1IZ1 A;  2RKH A;  4ENN A;  4KYW A;  1G3W A;  1UHW A;  3SZT A;  1OKR A;  4F7Z A;  3FX3 A;  2HTS A;  4RGS A;  2KJB A;  4PCQ A;  5E1X A;  5BPI A;  4GYG A;  3DPL C;  4MTE A;  3LST A;  2BGC A;  5LEJ A;  3VEP A;  3WTT C;  4LLG F;  3FMS A;  1FWZ A;  3T8R A;  3P9I A;  2L54 A;  1XGM A;  1ULY A;  2LF7 A;  4A6E A;  4LK1 F;  5FD6 A;  4HQE A;  1L3L A;  2Z33 A;  2BEO A;  3K69 A;  1QNT A;  3I4P A;  4AD9 A;  5IT9 K;  5BMZ A;  2K7L A;  2VT3 A;  1S7O A;  4M9S A;  1REP C;  4O3M A;  3C7J A;  3LA7 A;  1S7A A;  2E1C A;  4L9V A;  4BQA A;  3HSE A;  5LBQ A;  2C6Y A;  3FXU A;  4ETS A;  2X4H A;  5D6F A;  3MZH A;  3L00 A;  1H0M A;  4ZZD A;  5LGN A;  1ZG5 A;  1Z6R A;  2EJR A;  2BV6 A;  3M8E A;  1H9G A;  3ECH A;  3KP7 A;  3KZZ A;  2LKP A;  2OQR A;  3BJ6 A;  2LDU A;  2IRF G;  5ED4 A;  2XIG A;  4I7H A;  2A07 F;  3L7W A;  4ASN A;  4MTD A;  3F8M A;  2GAU A;  4S05 A;  5JR3 A;  2W25 A;  3ELK A;  1E17 A;  5KK1 A;  1XSD A;  5D4R A;  1ZN2 A;  5J6X A;  2FXA A;  3HHG A;  3C1D A;  2O6G E;  3R4K A;  1O7L A;  2YX4 A;  4A12 A;  4AIK A;  4M72 A;  2IA1 A;  4P5O A;  5DYM A;  3WTS C;  2H6C A;  4RB3 C;  5JVT A;  2ZNY A;  4CIC A;  1J2X A;  4A6D A;  1Z9C A;  1O7F A;  2MH2 A;  1R5H A;  4Z2Y A;  3WE3 A;  5E1W A;  4A0X A;  2DQR A;  3K9T A;  2KRF A;  2PI0 A;  2RN7 A;  1OPC A;  1DP7 P;  3BJA A;  4H0E A;  4S04 A;  4Y15 A;  1LVA A;  1BIB A;  3F21 A;  2A69 F;  5D5W B;  3I53 A;  2EA2 A;  3ROU A;  2J5P A;  3KZY A;  5L3D A;  3VB2 A;  3VOD A;  2HZT A;  1FZP B;  2LNB A;  2F2E A;  2PJP A;  3JAM Z;  4GGG A;  2V9V A;  1ZRF A;  5CVU A;  2XAQ A;  4HBL A;  2GWR A;  3CO7 C;  4U7B A;  1RI7 A;  1ZLJ A;  3FXR A;  4RB2 C;  1FOK A;  3EET A;  1F4K A;  1IF1 A;  1FNN A;  4G6Q A;  1FBU A;  3ZMD A;  2QZ8 A;  2QQA A;  4UVC A;  2ETH A;  2QQB A;  3F8F A;  3WOD F;  3HRT A;  4UV8 A;  1OR7 A;  5J8C A;  4CGZ A;  3GZ5 A;  3O6B B;  2OBP A;  5A2Q Z;  4QLC U;  4FHT A;  2JTV A;  4L18 B;  4HX8 A;  4EM2 A;  1TTY A;  4P96 A;  5BOX A;  3CDH A;  3E6C C;  5DUI A;  1GHC A;  4L9J A;  4EQQ A;  3WTU C;  5E18 F;  4AVP A;  5H20 A;  2FBI A;  3GXO A;  2VOP A;  5DCF A;  1X3U A;  5HDK A;  2KKO A;  2P8T A;  3GO5 A;  4FX0 A;  3KFW X;  3ZMT A;  4KN4 X;  2P6T A;  2IPQ X;  2E7W A;  4ON0 A;  3CJN A;  1XCV A;  2OU2 A;  1OYW A;  3RPU A;  3LA3 A;  5E8G A;  3R0J A;  2HGC A;  5DCM A;  4HQM A;  3E5Q A;  1O3S A;  2DLL A;  1LEB A;  3WGH A;  3E6D A;  4IRG A;  1SAX A;  4RS8 A;  2VN2 A;  4K2E A;  3H92 A;  1IAW A;  1YYV A;  1I27 A;  1L0O C;  1W5S A;  4FX4 A;  5HOO A;  2Z5U A;  3QAH A;  5FO5 A;  2QBY A;  3RI4 A;  1MD0 A;  1UB9 A;  1ODD A;  3KET A;  1UCR A;  2FBK A;  2QQ9 A;  1SD5 A;  2WC2 A;  3HOT A;  5FLX K;  2A3S A;  2NRA C;  1TBX A;  3HOS A;  1SMT A;  3I54 A;  4M71 A;  1KQ9 A;  3K1N A;  1BBY A;  4L9T A;  2AXL A;  1IRG A;  2W24 A;  3ZQ7 A;  3NEU A;  1O3Q A;  3CO6 C;  2O0Y A;  2MBF A;  2EA4 A;  2DFI A;  4P55 A;  1FYM A;  2H94 A;  1LDD A;  1FYK A;  5D8K B;  4OIO F;  1DPR A;  4Q48 A;  2M8E A;  2ZBK A;  3EYY A;  1LDJ A;  4UV9 A;  2HFH A;  1W5T A;  1R1V A;  3F8N A;  3GFL A;  4HDU A;  2XAS A;  1S29 A;  3J80 K;  3F6O A;  3FM5 A;  2VOO A;  4L0Y B;  5CVJ A;  5TJJ A;  4UXN A;  3TDU C;  3IRQ A;  3FHZ A;  1R1T A;  4YFK F;  2JPC A;  1C0W A;  3DQV C;  4LLL A;  4HX4 A;  2QEN A;  2V1X A;  4GCV A;  4KFC A;  1W7P D;  2COM A;  1KU2 A;  3QPH A;  4LG0 A;  5CJ9 A;  3D0S A;  2ADU A;  2H09 A;  2A6H F;  3GFM A;  1KU9 A;  5BPD A;  2VON A;  3M1E A;  5E1Z B;  5BQT A;  3CUO A;  3DPT A;  1WI9 A;  1USS A;  3TOB A;  2Q0O A;  3BPV A;  3MFK A;  4RGR A;  4EV0 A;  4ENK A;  1I6X A;  1XDU A;  4IJA A;  4Y17 A;  3SXY A;  5K5R A;  1YW7 A;  3FM3 A;  3CUQ C;  1FC3 A;  3V7S A;  5LHI A;  3F3X A;  5J8F A;  1R58 A;  3N97 A;  1U2W A;  5TRD A;  3C18 A;  1KYW A;  4HZF A;  4L5I A;  2QVO A;  3BDD A;  3BRO A;  1TQM A;  5DUK A;  3J81 Z;  1OYY A;  4N9I A;  3ABT A;  2FEZ A;  3P9C A;  1U8R A;  2NAZ A;  5DCM B;  5LLQ A;  1B6A A;  1R00 A;  2M5W A;  3E5X A;  2VC1 A;  1F1Z A;  4PZJ A;  3JSP A;  3BP8 A;  2NNN A;  3HRM A;  1FLI A;  3SHF A;  4ESB A;  3B02 A;  3H3Z A;  1SFE A;  3RDI A;  4P9F A;  2UXX A;  3E5U A;  2J5O A;  1B59 A;  2DO7 A;  2K27 A;  4RGU A;  4HW0 A;  1BJA A;  4U0W A;  4YIF A;  5H6Q A;  3F23 A;  4E70 A;  1P4A A;  1HKT A;  1U5T C;  3PFI A;  4GYI A;  1D5V A;  4R8H A;  2QBY B;  2VBW A;  2BBY A;  1SFU A;  2GXB A;  2FMY A;  3F8B A;  2MC3 A;  1FYL A;  2A61 A;  1ZRE A;  1TLH B;  3D5L A;  1P4X A;  4XSX F;  2GQQ A;  2HWV A;  3Q9V A;  1VTN C;  4OIN F;  2RNJ A;  4M73 A;  2STW A;  5D5X B;  2M30 A;  2QLZ A;  3RKY A;  4UHT A;  4U88 A;  4NB5 A;  3ISP A;  5FFZ A;  5E17 F;  4RAY A;  4PDK A;  2EFQ A;  3L2C A;  2A5Y B;  2ACJ A;  3LQR A;  2FBH A;  4EJV A;  1P6R A;  5F64 A;  1XMA A;  4TV7 A;  1XB4 A;  4HV6 A;  2IA2 A;  4G8X A;  4WXC A;  3IHU A;  2ESN A;  1E2X A;  1Z7U A;  1IXS B;  4AIH A;  5L3G A;  3BPX A;  4KIB A;  2PFB A;  3IWZ A;  2UWM A;  3T1B A;  2YSR A;  1O57 A;  2P4W A;  4KA4 A;  4LG0 B;  4A5N A;  2V6C A;  4O5V A;  4IRI A;  2FU4 A;  5ICG A;  1MJ9 A;  1ZHF A;  1UHM A;  3WG9 A;  1BC7 C;  5FD5 A;  4M6Y A;  2DPU A;  4YFN F;  1R5G A;  3HSF A;  2L3D A;  3BWG A;  4BHP A;  3H3U A;  2XRO A;  5KVR A;  4OOI A;  3R0A A;  1J75 A;  1K6O A;  2X0L A;  2E7X A;  1BIA A;  4KT5 C;  5ICC A;  4BNC A;  4D0P A;  1FSH A;  2YR2 A;  3V8J A;  1OYI A;  5DDG A;  1W7P A;  1YIO A;  4A0Y A;  2G7H A;  3GEZ A;  1SFX A;  3TQN A;  3KE2 A;  2DW4 A;  2ZME A;  1ON2 A;  3KLN A;  2OQG A;  5LRR A;  2PEX A;  1FBS A;  4L0Z B;  3I71 A;  1BC8 C;  5HS9 A;  4KMU X;  2G7U A;  4MQ9 F;  1RIO H;  5HLG A;  1CGP A;  1XGS A;  3K0L A;  1SD6 A;  4A0Z A;  1HW1 A;  1H9T A;  3GWZ A;  2DTR A;  3F6V A;  1FBQ A;  2XRN A;  1SD7 A;  2FQ3 A;  1RUO A;  2OD5 A;  1T38 A;  3JW4 A;  3WE2 A;  1XDS A;  3CTA A;  3EQL F;  3FF5 A;  2R7D A;  4XLP F;  3EUH A;  4Q47 A;  3V8L A;  1MGT A;  1NHA A;  2F5F A;  4HX7 A;  3E6B A;  1XMK A;  3LAP A;  2ZXJ A;  3KLO A;  1YLF A;  3K1P A;  4G94 A;  1GXQ A;  3G3Z A;  4IVN A;  1J9I A;  3ABU A;  1R36 A;  3WU1 B;  4WF2 A;  2P7V B;  1V3F A;  3WTY C;  3RYR A;  1G3S A;  3MWM A;  1K78 A;  5E20 A;  4IPA A;  3K1M A;  3MCZ A;  1SD4 A;  4IXA A;  2K4J A;  1G3Y A;  5FGM A;  1ZYR F;  2W57 A;  4KIG A;  1Z91 A;  4UVA A;  4LGW A;  1QQI A;  2EV6 A;  3JTH A;  3COA C;  1P4W A;  2QYO A;  4EJU A;  3JAM K;  2V1U A;  4O6J A;  1JXS A;  3G73 A;  3MQ0 A;  2EFO A;  1J7K A;  2WTE A;  2KIF A;  2IW5 A;  1HSJ A;  4DQ2 A;  4WK8 F;  3E3V A;  3DKW A;  2CG4 A;  3HYI A;  1EH7 A;  2JT1 A;  1B9N A;  2XUB A;  3IC7 A;  2P6S A;  4R1H A;  5HLI A;  2V79 A;  1BI2 A;  2MH9 A;  1PP7 U;  2ZFW A;  3TO9 A;  3P9K A;  4AWX B;  5DV5 A;  5A2Q K;  2Q2E A;  1MKM A;  2Z3Y A;  2XGX A;  2EWN A;  1BI3 A;  4UNO A;  3I58 A;  5JI6 A;  5K1Y A;  2PMU A;  4UVB A;  1DDN A;  3KP5 A;  2W84 A;  2NNY A;  1YTY A;  3U9G A;  1WKM A;  3EDP A;  3L9F A;  2CYY A;  5LRS A;  1KU7 A;  4G7Z F;  1ZG1 A;  3RKX A;  2XVC A;  4KDP A;  1TQI A;  3GZ6 A;  2ZJ2 A;  2DI3 A;  3M7G A;  3WTV C;  1XSX A;  1YW8 A;  2XHK A;  1FY7 A;  4CZZ A;  1EH6 A;  1CF7 A;  3ULQ B;  2DK8 A;  4LB5 A;  1IN7 A;  1W7P B;  4HF2 A;  2WWY A;  1HBX G;  5IT3 A;  4CYD A;  3GF2 A;  2VBY A;  2WV0 A;  1KGS A;  2HKO A;  1XGN A;  1K79 A;  3C3W A;  1XGO A;  4FT8 A;  2ZME B;  1Z05 A;  2M45 A;  4EGZ A;  2RVC A;  3PQK A;  5LEK A;  4A5M A;  2CWE A;  1IN5 A;  3KEQ A;  3E97 A;  1G4D A;  4LD5 A;  1WRJ A;  3KCC A;  4I02 A;  4BYY A;  3GFI A;  3ZN0 A;  1LB2 A;  2M87 A;  3PQJ A;  1D8K A;  3DXJ F;  2Y75 A;  2ZO4 A;  4JBA A;  3T8T A;  2PBI A;  5F1R A;  4EMS A;  4EVI A;  2O3F A;  2HYF A;  4P9U A;  5FFX A;  3Q5F A;  2P7C B;  1JHF A;  4G7O F;  3GFJ A;  2DK5 A;  3LAJ A;  4ZYG A;  4LFU A;  4OIR F;  1YS6 A;  2VT2 A;  4XBF A;  1V4R A;  4ZZL A;  1BI0 A;  2O61 A;  3B73 A;  1T2K A;  2GA2 A;  4HF1 A;  1OMI A;  5ILV A;  1PUE E;  2IP2 A;  1EV7 A;  2ELH A;  4G6D A;  3HTS B;  4ENJ A;  2HQN A;  1BM9 A;  1UST A;  4MEY F;  5E8I A;  3HRU A;  5HDG A;  1MZB A;  4U0Y A;  3IRR A;  1HXD A;  1J59 A;  3Q9S A;  2EK5 A;  2FML A;  2EV0 A;  2FNP A;  1QO0 D;  5ICF A;  2R3S A;  1U78 A;  1YQA A;  5BS6 A;  3LFK A;  5CYV A;  1XSV A;  4HOB A;  2Z9O A;  1HKS A;  5CVR A;  3O2P E;  4IRH A;  3E6M A;  3V7C A;  1IXC A;  3T5X A;  2Y0M A;  2OZU A;  3ZMZ A;  1ZGJ A;  4NHJ A;  1KQ8 A;  2XKP A;  1S3J A;  5EEH A;  1I5Z A;  3TKY A;  1J0R A;  3O3K A;  2O03 A;  4KIC A;  1W4M A;  2XKO A;  3M9A A;  3WTZ A;  1T98 A;  4KN7 X;  3R61 A;  4I01 A;  3M8F A;  2D2W A;  1R22 A;  1TNS A;  1D8J A;  2FRH A;  3FWE A;  2HQR A;  1YFH A;  3SQN A;  5IT9 Z;  3MZY A;  2GA1 A;  1JGS A;  2HS5 A;  2XAJ A;  5ILS A;  2XAF A;  2UZK A;  1FSE A;  1K7A A;  2P5V A;  3TO7 A;  2LF8 A;  2YPR A;  1B9M A;  2Q8K A;  1CF7 B;  2UXN A;  3ZPL A;  2K4B A;  4I98 B;  4HAM A;  4M6X A;  4CO8 A;  1I1S A;  5K5O A;  1QZY A;  2DU9 A;  3RYP A;  2VBZ A;  3AAF A;  2RDP A;  1ONV A;  5HS8 A;  2BE5 F;  2PG4 A;  2IJL A;  2B0L A;  4M74 A;  5L3B A;  3F22 A;  4EJO A;  2ESH A;  2IT0 A;  5D4S A;  3VFZ A;  3ML6 A;  4OU0 A;  4M9X A;  4HLY A;  3WU0 A;  2EFP A;  3QU3 A;  5FB2 A;  1KA8 A;  4BHC A;  3TGN A;  5D5V B;  4LB6 B;  5K5Q A;  4RB1 A;  2RGV A;  2GIV A;  1O3T A;  3HRS A;  2JRT A;  3R6S A;  3ZN1 A;  3GVA A;  4AIJ A;  1FX7 A;  2LSO A;  5EEG A;  5HLH A;  3LWF A;  2HKX A;  1WQ2 A;  1BI1 A;  3V7R A;  4I2O A;  4HA8 A;  2P5L C;  4LK0 F;  3JTG A;  2JPB A;  2FA5 A;  2AS5 F;  3W6K B;  5ERI A;  5HVQ C;  4OMY A;  2OZ6 A;  1TW2 A;  3DV8 A;  2P5K A;  3F8C A;  2A68 F;  1QGP A;  1ZAO A;  2FSW A;  4EM1 A;  4Q4Z F;  1R1U A;  5DD4 A;  5AIP A;  1P92 A;  2FF4 A;  1I1G A;  5L3F A;  4ENM A;  1SMY F;  3OOP A;  4WX9 A;  2L01 A;  2OA4 A;  4BHB A;  5AON A;  2JZY A;  2HOE A;  2STT A;  2F5C A;  1WSU A;  2GXG A;  3T0Y A;  4A2U A;  1BN5 A;  2JSC A;  3EYI A;  1XCB A;  1JHH A;  3V4G A;  1B1B A;  3W6J B;  2CSO A;  1RUN A;  1FT9 A;  2VXZ A;  2NYX A;  4OIP F;  2W85 A;  4WCG A;  1D3Y A;  4XRF A;  1Z1D A;  1G3T A;  2ZNZ A;  4ESF A;  3DEU A;  2IA0 A;  4KUM A;  2DAO A;  2F5D A;  2HDC A;  3CUQ A;  1F9N A;  2DBB A;  1BOA A;  1IUY A;  4JQF A;  2NS0 A;  2O8X A;  4HLX A;  2DPD A;  1FP2 A;  2ISZ A;  1LEA A;  2VE9 A;  4XLN F;  3JSO A;  1IRF A;  4ZH4 F;  2M1B A;  5CLS A;  2MLG A;  3GYH X;  1ZG3 A;  4G9Y A;  1UFM A;  2DT5 A;  1EH8 A;  2GZW A;  2DQL A;  5CVI A;  1YS7 A;  3BY6 A;  2QUF A;  2RC4 A;  2HEO A;  3BZ6 A;  3TO6 A;  1ZGA A;  2MLK A;  2XV4 S;  4KNY A;  1S8N A;  4I0A A;  5AIQ A;  3GX4 X;  1IN8 A;  2H27 A;  5D6E A;  3KP4 A;  4HV5 A;  2F5E A;  3WTX C;  2L4M A;  2YX7 A;  4KMF A;  2PLY A;  1TNT A;  3I59 A;  4MGR A;  2EFN A;  1U5T A;  1MDM A;  3ZMU A;  1HW2 A;  2XAH A;  5D8L B;  2XAG A;  4I09 A;  4EJT A;  2R7F A;  3DP7 A;  3I0T A;  3FXQ A;  3TDZ C;  4I0B A;  3ZP5 A;  1HKQ A;  2A6E F;  3BOQ A;  4U7D A;  1MJB A;  1KU3 A;  3FMQ A;  3GLX A;  4GXO A;  1IXR C;  1QBJ A;  3QP6 A;  2L4A A;  1ZAR A;  3GUD A;  2FE3 A;  4CXF A;  2D45 A;  6PAX A;  2CQK A;  3HIF A;  4QWQ A;  2ZCW A;  3HTU A;  3HHH A;  1KYZ A;  4LJZ F;  4MEX F;  1YG2 A;  3FZV A;  3I64 A;  2G9W A;  4U0V A;  4Y13 A;  2VBX A;  1LDK B;  3WTW C;  5DD8 A;  3QOP A;  5D5U B;  1JE8 A;  1ZRC A;  1RZ4 A;  4WWC A;  5HDN A;  5FLX Z;  1YO5 C;  4CHU A;  2RV8 A;  4M9Z A;  4N9H A;  1Q1H A;  3P7N A;  2D1V A;  5H6R A;  4R79 A;  2EV5 A;  2CGP A;  5CVV A;  1AWC A;  3BJO A;  4UUV A;  2BYV E;  4B8X A;  3KP6 A;  3IL2 A;  4YG2 F;  3WGI A;  1ZH5 A;  1YW9 A;  2HYG D;  3FMR A;  4YFX F;  1TQP A;  4YII A;  1R23 A;  4N0B A;  1G6N A;  5JFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...