3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
5E18F 2YR2A 4U0VA 2QYOA 2OD5A 1GVJA 1ZHFA 2RNJA 2XVCA 3E5UA 4UVBA 1A04A 3WTZA 2FQ3A 4ON0A 4AWXB 3ZMZA 5ICFA 3DPTA 1WKMA 3B02A 2COMA 3TO6A 3I64A 1DDNA 4IHSA 1KYWA 5AIPA 1FBUA 3GUDA 6PAXA 2M5WA 1G3YA 2XV4S 2ACJA 4HF0A 3I53A 1WWXA 2W84A 4MTEA 5BPIA 2STWA 2PEXA 4HV6A 3AAFA 3V7RA 2DI3A 1ZN2A 4KA4A 3HRMA 3QP5A 2VBZA 2A69F 1T38A 2Y48A 5DCFA 2XAJA 1J75A 2GIVA 2VT3A 2F5CA 5JR3A 1T0FA 1Y0UA 2G7HA 3F23A 2QM3A 2Z33A 1UCRA 2QQAA 3KP6A 1S3JA 1I6XA 4LLLA 2FMLA 4LLNA 3C18A 3WTXC 3W6KB 1KU7A 5ICGA 4IRIA 2DU9A 1ULYA 4U7DA 2CG4A 1IN4A 3D5LA 3BPXA 3T8TA 5BQTA 3PFIA 5IT9Z 1C0WA 3NQOA 1RNLA 4LMYA 1LQ1A 4HDUA 1XSVA 3OOPA 5LRSA 3H3ZA 1U5TB 4L9JA 3ELKA 3FMSA 1U5TC 3HRTA 2VE9A 1K79A 1H9TA 3BP8A 5ILVA 3DXJF 4ENNA 2G9WA 5H6RA 4MEYF 2D1HA 4A6EA 1REPC 3ERED 4I01A 1O3QA 5LGUA 4O3MA 1ZG1A 3L7WA 2Y0MA 5HLGA 1BI3A 2F2EA 2W85A 4MQVA 1MDMA 4ENMA 1ZRCA 4AVPA 4MGRA 4P9UA 2K4BA 4UVCA 2PI0A 5K1YA 2FBKA 2Q8KA 2DLLA 3HSEA 4ZZDA 1W7PD 1U2WA 4HOBA 2V79A 2QBYB 1TBXA 1Q1HA 4Q5SF 3FX3A 2X4HA 4O5VA 4KNYA 1R1VA 2H94A 2GAUA 5AIQA 4I0AA 1OYWA 3RYRA 3F8NA 1IF1A 4E70A 3RDIA 2FRHA 1LDKB 2F5DA 2IPQX 5EEGA 3HTUA 4BXUA 3KP5A 5L3CA 2DQLA 3LA7A 1IRGA 2FEZA 4UUVA 1E17A 3H3UA 5DD8A 4UV8A 1L0OC 2ESHA 2LNBA 2LKPA 1HXDA 4ETSA 5HS8A 2ELHA 4B8XA 5DD4A 1GXPA 1K78B 3E6DA 3J81Z 1J7KA 5TJJA 1G3SA 2XRNA 2XKPA 1LVAA 5L3EA 4WXCA 5K5OA 1ON1A 1BOAA 5E20A 1MJAA 2A3SA 1PP8F 2HYGD 2XKOA 4JBAA 3K2ZA 3GFIA 3HRUA 5J8FA 3KP2A 2P5KA 3TKYA 1QPMA 1TQMA 3RTRA 4FHTA 4F7ZA 3KP4A 1KQ8A 4G94A 2ZMEB 3QU3A 1YS6A 4K2EA 2RN7A 2RVCA 2HZTA 1HKSA 1O3TA 4HLYA 1P92A 5JVTA 2BBYA 3WTUC 4U7BA 1BI1A 3WE3A 2NYXA 1FSHA 3MWMA 1K7AA 2DK5A 4P9FA 5JHUA 2GA2A 1SFEA 5ED4A 5EEHA 3O3KA 3J7AO 5D8KB 3GLXA 4OMYA 2ZBKA 4ZYEA 3JSPA 2CW0F 3F8FA 2MD5A 3FHZA 1SD4A 5E1ZB 2LF8A 4I09A 4CYDA 3DFGA 1XCBA 2IT0A 2DBBA 4OIOF 4IRGA 4BNCA 3CLOA 5A2QZ 2QQBA 1J59A 4KIFA 2DAOA 3EYIA 3ZMSA 1S7OA 2YPRA 2C6YA 5LHIA 3KLOA 2E1NA 5LLQA 5BMZA 2KIFA 3IC7A 3CUQB 1QZYA 5L3GA 3QP6A 1FOKA 4O6JA 5KVRA 5A2QK 1U5TA 1R58A 4OIPF 5D5VB 2LSOA 4OINF 4Y15A 4Z2YA 4LFUA 1BI2A 5DDGA 1V3FA 3MFKA 1BIAA 2HQRA 3LFKA 1V4RA 3K1PA 3LAJA 3K1MA 4OIQF 3D0SA 1G4DA 4XLNF 2DW4A 4A5NA 2MH2A 4WF2A 4ENJA 1BIBA 4CO8A 2HFHA 4G8XA 3TO7A 5L3BA 1YW8A 3IKTA 2GXBA 2FSWA 1WSUA 1SD5A 4UNOA 3M7GA 2QENA 3CTAA 5K5RA 2IA2A 3V8KA 2FNAA 4EM0B 3QOPA 3VEPA 4QLCU 2YX7A 2DO7A 4Q47A 3I59B 1HBXG 1QNTA 4RB3C 4EGZA 1R1UA 3TGNA 3IRRA 4WXHA 3DPLC 2OBPA 1QO0D 3T5XA 4RB0A 2QBYA 3ZMVA 3K1NA 4HDVA 5D8LB 1ZLJA 3R61A 3LQRA 2P6TA 4L18B 2RQPA 2FOKA 2DQRA 2DT5A 1I27A 1R22A 4PGHA 3ZN0A 1FC3A 1BI0A 2L01A 3P9KA 3KP3A 3F6OA 3DQVC 5FD5A 4H0EA 2IRFG 4HX7A 5CVVA 4YIIA 2P4WA 4XBFA 4ZH4F 1PDNC 4ZYHA 3ABUA 3KETA 2P5VA 4FT8A 4WXDA 4N9HA 1T39A 4N0BA 2IW5A 3GX4X 2FF4A 4KMUX 1IZ1A 4U0WA 2HR3A 1DUXC 3SZPA 1I5ZA 3F72A 2L4MA 2ZJ2A 2UXXA 3ABTA 2Q2EA 3DKWA 1XSXA 2R7DA 5ICCA 5F6FA 3V8LA 4FX4A 4P96A 4EVIA 1K78A 5KK1A 3EETA 1SD6A 3GFJA 3IWFA 1FP2A 2BE5F 2DFIA 2Z99A 5DYMA 4BHCA 3CO7C 2ZCWA 4L0ZB 3F3XA 1QZZA 1W4MA 1ZG3A 4DQ2A 3BJ6A 4KIBA 2H6CA 1H9GA 2BV6A 2FA5A 2FBIA 3WGIA 3IWZA 3V7CA 2KJCA 4BAYA 2NAZA 4ENKA 2CYYA 3I5UA 3L9FA 2ZMEA 5FO5A 4RGSA 3LA2A 3HYIA 2CQKA 5DUKA 2ETHA 3FWEA 1HW2A 2AXLA 3GZ5A 4CHUA 5LGNA 1KGSA 2FMYA 5BOXA 2VODA 3ROUA 2UWMA 1ODDA 1W7PB 3O6BB 4UHTA 3L00A 4EM2A 2H27A 2JPCA 3FXRA 1MD0A 3S2WA 3ZPLA 3Q9VA 3I4PA 2MBFA 1YG2A 1SFUA 2ZXJA 1IUYA 3OV8A 2GXGA 4RB2C 4KN7X 4GGGA 2XROA 2F5FA 2NS0A 1JE8A 3EDPA 1D8KA 4CXFA 2OZUA 3HOSA 4LK1F 4EJOA 4M73A 2YU3A 3CUQA 2K4JA 4KT5C 3I58A 2ZNYA 2M87A 1XMKA 4EM1A 3MZHA 4LK0F 2MC3A 1RI7A 4EJUA 4RGRA 2TDXA 5LRRA 2VXZA 3IRQA 5LGTA 4A0XA 3SXYA 5DEQA 1IN7A 3CJNA 1ON2A 4RAZA 2EFOA 1DPRA 2P7CB 3N97A 3M8EA 5JFRA 1MKMA 2ZNZA 5E1XA 2A07F 1AOYA 4AD9A 4EQQA 2HOEA 3IKVA 1CGPA 4IPAA 3BPVA 2V1UA 2V1XA 4KIGA 5AONA 2HKXA 3GF2A 1FX7A 3ECHA 5CVIA 4HQMA 1O7FA 2J5OA 1JHHA 1U8RA 1P2FA 1EH6A 3JW4A 1TLHB 1B59A 2O3FA 4CICA 3WGGA 3DEUA 3GZ6A 3I59A 2VBWA 4M9SA 1F1ZA 1G3TA 3M9AA 3FF5A 3NEUA 3BZ6A 1FYMA 4I98B 1RUOA 1MGTA 2Z5UA 3ZMUA 1BN5A 2QWWA 4RGUA 2MH9A 3WGHA 2PMHA 1TNTA 3T8RA 4UV9A 1FT9A 1WI9A 3ZMTA 5E1WA 4HX4A 5ILSA 2GQQA 2W57A 1FNNA 4HV5A 3E5XA 3JAMZ 1HKQA 2ZO4A 2PJPA 2ISZA 4UXNA 4HX8A 4LGWA 4KYWA 5FGMA 1G6NA 1EV7A 1HKTA 2P6SA 5H6QA 2XUBA 3KEQA 3QAHA 2DK8A 3U1DA 2WWYA 1U6GA 3F22A 2J5PA 1WRJA 4B09A 3F8BA 4I7HA 5H20A 4ASNA 5LEJA 1RZ4A 1O3SA 1PUEE 4NQWA 3JAMK 3M1EA 1LDJA 2ISYA 2CWEA 1XN7A 2JRTA 4YIFA 2CGPA 1STZA 4MHGA 3GFLA 4IRHA 4ZZLA 4N9IA 5LHGA 2WV0A 1ZH5A 1DP7P 3HRSA 3GVAA 2JPBA 3MCZA 3KP7A 4P55A 3R60A 3EYYA 2PN6A 4WCGA 1O57A 2G7UA 1FSEA 2MLGA 2WTEA 1LDDA 2O61A 1R36A 5HDKA 3IHUA 2HS5A 2ADUA 1SMTA 3JTGA 1FZPB 3BJAA 3G73A 1W7PA 2MA3A 1U78A 3F8CA 4JQFA 3ULQB 4CGZA 3I71A 2RC4A 1USSA 4HA8A 5ERIA 2FBHA 1YS7A 3E6BA 3K9TA 1YQAA 4P5OA 2K27A 3U9GA 1W5TA 4G6DA 3RYPA 3TQNA 3RI4A 2Q0OA 4ESBA 1B9NA 4GYGA 2W25A 2VONA 1Z6TA 1R1TA 4EJVA 3GFMA 5HOOA 2OZ6A 3NRVA 4JK1X 2XIGA 1W5SA 4LG0B 4BHBA 2HGCA 4AIKA 1Z05A 2VBXA 2HEOA 3VFZA 1OR7A 1P4XA 3R6SA 2RV8A 3E6MA 5HLHA 3SZTA 3EQLF 4KN4X 1IXRC 1FWZA 3QPHA 5LHHA 3HHHA 1CF7B 4G6QA 3GYHX 1BM9A 1HW5A 4HW0A 5DUIA 2DPUA 1LNWA 5E8GA 4GCVA 2CSOA 1FY7A 5CYVA 3V4GA 3TDUC 4MNUA 1ZAOA 2M45A 1B4AA 2D2WA 2BYVE 1DPUA 2KJBA 3FM5A 1FBQA 1MZBA 4BH9A 4G7HF 2OQGA 4A6DA 1SAXA 5CLSA 3QPTA 4EJTA 4BQAA 2NNYA 3F8MA 3W6JB 1QGPA 2IP2A 4YFNF 2F5EA 2L4AA 2EJRA 4I0BA 1YO5C 1L3LA 3WE2A 2EFWA 4U0YA 3F21A 4M9ZA 4HF1A 3C1DA 1Z1DA 4AIJA 1YIOA 2E1CA 3E6CC 2A68F 2Z9OA 3J80Z 1J5YA 1XMAA 5LEKA 1XSDA 1XDSA 4A12A 2OA4A 1HQCA 1LEAA 2EB7A 2QZ8A 5TRDA 4YG2F 3WTYC 1YW7A 1IN6A 1HW1A 2KIMA 3J80K 1RUNA 1FP1D 1J2XA 1GHCA 1F9NA 2FNPA 1Z6RA 4ZYGA 5LBQA 3HOTA 1LB2A 1USTA 5E17F 1TTYA 1E2XA 3E3VA 5CVUA 4R79A 3WU0A 2L02A 4L5IA 3R0JA 2P5LC 3KE2A 4M9XA 3QRFF 2HKOA 3FM3A 2STTA 3HTSB 5BS6A 2XGXA 2JTVA 2JZYA 3HHGA 1P4WA 4ESJA 5FLXK 2KRFA 4HBLA 4ZYDA 3MQ0A 5HVQC 3RKWA 5D4RA 1KQ9A 4G7ZF 4Q4ZF 1VTNC 1O7LA 2LDUA 1T98A 5ILUA 1OKRA 3FMQA 3CO6C 3WODF 1LEBA 2HDCA 2VE8A 4HQEA 3P9IA 2ZKZA 3LQQA 2EK5A 2W24A 4D0PA 1XGSA 5L3FA 1ZYRF 3HSFA 2D45A 4HAMA 1D5VA 2CO5A 1ZG5A 1IN8A 4LLGF 4LD5A 2FE3A 4EGYA 3KEOA 1UHMA 1SFXA 3B73A 1EH7A 3ZQ7A 1B6AA 3RJPA 1XDUA 4UVAA 2O8XA 1R5GA 4LJZF 2L3DA 1EH8A 2P7VB 4MQ9F 5HDNA 3K69A 2R3SA 3LWFA 4A2UA 3SHFA 2EV6A 1HSJA 1ZGJA 3T0YA 2YSRA 3RPQA 2V1DA 2BEOA 2EV5A 5CJ9A 4Q48A 2O03A 4S05A 5E8IA 1TW2A 1PP7U 2H09A 3RKYA 2OU2A 2MLKA 3BY6A 5D5UB 2K7LA 4NB5A 4OOIA 1FYKA 5L3DA 4LG0A 4KDPA 2E7WA 1MJ9A 3U2RA 5D4SA 3JTHA 5D6EA 2EFQA 1Z91A 1JXSA 3GWZA 2KKOA 2E7XA 4IF4A 2M1BA 3HIFA 4XLPF 3BROA 3TOBA 3DP7A 5F64A 2LF7A 1CF7A 3WG9A 3V7SA 1YYVA 3G3ZA 2QVOA 2XAQA 3LAPA 5IT9K 4G9YA 1R23A 2K02A 2FU4A 5DV5A 1BC7C 4WWCA 3PQJA 4MTDA 3HUGA 2HYFA 3SFZA 2HWVA 2M30A 2ZFWA 3FMRA 2XAGA 1RIOH 5FD6A 1Z9CA 1T2KA 3GW2A 2A5YB 2VN2A 1KU2A 3QU6A 4CDGA 4KICA 3WTTC 1ZLKA 1TW3A 2M8EA 4M71A 2V6CA 1IAWA 2JT1A 4PCQA 4M72A 3FZVA 3BOQA 3VOEA 2EWNA 1X3UA 3EUHA 3I54A 2P8TA 2EFNA 2A6EF 4EMSA 1UB9A 4OMZA 3IL2A 4XSXF 3RIRA 2HTJA 5IT3A 2NRAC 3WTVC 4HF2A 4M6YA 4PDKA 3E5QA 2OQRA 3COAC 2O0YA 1IW7F 3GO5A 2DPDA 4A5MA 1HSTA 2BGCA 3VB2A 1S29A 3MEXA 4HYEA 1NHAA 3ZMDA 2AS5F 4LB5A 3RPUA 3KFWX 1K6OA 4MEXF 2PFBA 2KIUA 4IJAA 3TOAA 3L09A 1KQ0A 4RB1A 3C7JA 1KYZA 5JI6A 4I02A 4OU0A 1WQ2A 2WC2A 1S8NA 3HSRA 4A0YA 4EV0A 4BHPA 4OIRF 3MAJA 3SQNA 5ICEA 4L0YB 3M8FA 4RGXA 3P7NA 1XD7A 1I1SA 2IA0A 2GZWA 5DCMA 4PZJA 3ZN1A 2K86A 5FFZA 3TDZC 2L54A 1UHWA 4L9TA 2PLYA 4L9VA 4RS8A 1IN5A 4WK8F 4WX9A 3LSTA 5CVRA 4YFKF 3C3WA 2V9VA 4TV7A 2A6HF 5F1RA 3Q5FA 1ZGAA 1D3YA 1IXCA 1P6RA 3TO9A 3P9CA 1ZARA 3N4MA 1FYLA 3BJOA 5FFXA 3DV8A 4LB6B 1KU3A 1FPQA 3WTSC 1TNSA 2DTRA 2R7FA 4M6XA 2HQNA 1SMYF 2D1VA 1H0MA 3CUOA 2GA1A 3J81K 4XRFA 1ZREA 2Z3YA 3E97A 4A0ZA 1TQIA 2RGVA 1R7JA 4EJWA 3T1BA 4L5JA 4RAYA 1ZRFA 2JSCA 3GEZA 4CZZA 1S7AA 3I0TA 1TQPA 4QWQA 2GWRA 3MZYA 3F6VA 3KZYA 4GYIA 4XSZF 3ML6A 3JSOA 2HTSA 2EV0A 4ESFA 1IRFA 2UXNA 1FLIA 2QQ9A 1R5HA 1XGMA 3R4KA 3WTWC 2EA2A 2PG4A 1BBYA 5HLIA 1J9IA 2CFXA 2RDPA 5D5WB 3WU1B 3LA3A 1XB4A 1ZRDA 4G7OF 4IHTA 3H92A 1SD7A 1BJAA 3V8JA 1D8JA 4FX0A 2EFPA 1YW9A 3CDHA 4BYYA 1OYIA 3BDDA 4AIHA 2QUFA 2VBYA 4R1HA 2XAHA 4Y13A 5D6FA 3KLNA 1UFMA 5J8CA 2H6BA 3DF8A 1KA8A 3CUQC 4HLXA 1FBSA 1R00A 5HS9A 4L9NA 1XGNA 2IA1A 4I2OA 5D5XB 4KUMA 1LJ9A 2PQ8A 3FXQA 3L2CA 3VODA 2EA4A 3O2PE 2VC1A 3R0AA 4U88A 1B1BA 1OMIA 4KFCA 1J0RA 2PBIA 2PMUA 1XCVA 2IVMA 2B0LA 3REOA 1QBJA 3BWGA 4KMFA 5HDGA 4Y17A 2VC0A 1S6LA 4GXOA 1MDMB 1KU9A 2IJLA 1YTYA 5FB2A 1XGOA 4PGGA 4NHJA 1AWCA 1JHFA 3PQKA 5J6XA 3GXOA 2VT2A 1O3RA 2UZKA 2VOOA 2OAZA 2Y75A 5K5QA 3RKXA 4DNCA 3FXUA 1F4KA 1IXSB 2ESNA 1BC8C 2A61A 1QQIA 2VOPA 3ZP5A 2FXAA 2X0LA 1I1GA 4YFXF 3K0LA 5HS7A 1YFHA 3ISPA 1P4AA 1T6SA 4GO1A 2O6GE 2XAFA 3KZZA 4M74A 1OPCA 1Z7UA 4IXAA 4IVNA 4S04A 3KCCA 5FLXZ 1ONVA 5DCMB 1JGSA 2XHKA 5BPDA 1G3WA 1U3EM 1OYYA 1MJBA 1B9MA 2QLZA 4R8HA 2XASA 3Q9SA 2YX4A 1F5TA 4HZFA 2RKHA 5CVJA 1GXQA 3ECOA 2NNNA 1YLFA
chains in the Genus database with same CATH superfamily
5E18F 2YR2A 3FK7A 3CC4I 2CW7A 4U0VA 2QYOA 2OD5A 4DYQA 2EBIA 2O8KA 1GVJA 1ZHFA 2RNJA 2XVCA 3H9GA 3E5UA 4A3GJ 4EEFG 4CCMA 5E79C 4UVBA 3ZXSA 1A04A 3WTZA 1MMSA 2FQ3A 4FASD 2JSPA 4NC8A 4ON0A 2DMUA 3DTEA 4AWXB 4XLAA 1SVMA 3ZMZA 3CJTB 5ICFA 3E7LA 3DPTA 1WKMA 1WCMJ 2LRDA 3CCQI 3B02A 2COMA 4QPQA 4D7NA 5FKLA 3TO6A 3I64A 1S7EA 1TWGJ 4NC6A 3ZQCA 3CQZJ 2M7AA 1DDNA 1Z0XA 2E60A 2E1MC 4IHSA 1KYWA 2R4GA 1Z3XA 1LKXA 2E34A 5AIPA 1FBUA 1OCRH 3OWTA 3GUDA 2DYSH 6PAXA 3S15J 2M5WA 1WPKA 4FETA 1D0ZA 1G3YA 2XV4S 2ACJA 4HF0A 3I53A 1WWXA 2VASA 3OYEA 2W84A 4MTEA 5BPIA 2STWA 2PEXA 2DFFA 4HV6A 2Y9YA 3AAFA 2KHMA 3OSFA 3V7RA 2DI3A 1ZN2A 2LC2A 4KA4A 3HRMA 1MBKA 2P81A 2VKDA 3QP5A 3S2HJ 2VBZA 2A69F 5EG0A 4II2A 4XN0A 4ZDPA 3ESWB 1T38A 3ZQIA 1NG6A 1I50J 2Y48A 1ERDA 1FOXA 5DCFA 4Y4RA 2XAJA 1PUFB 2I10A 2DA5A 5K7FA 1J75A 2GIVA 2VT3A 4XLEA 2F5CA 1T0FA 5JR3A 1Y0UA 2G7HA 3F23A 2DOEA 3KZIC 2QM3A 2Z33A 2QKLB 3GTOJ 5E3NA 2WAFA 5EGOA 4IOCF 1UMQA 5E3LA 1UCRA 2RNGA 4A3EJ 1MBHA 2QQAA 3BCBA 3KP6A 1S3JA 1I6XA 3MKLA 2LH9A 5F1JA 5C3EJ 4ZDOA 4JX4A 4LLLA 2FMLA 4LLNA 3C18A 3WTXC 3W6KB 4JX5A 1KU7A 1HF0A 4IOAF 2AQEA 5ICGA 4IRIA 2DU9A 1I39A 3BZKA 1ULYA 3OR2C 4U7DA 2CG4A 1IN4A 3D5LA 1XX5A 2LLKA 2JMWA 3BPXA 3T8TA 5BQTA 3JRBA 3CCMI 3IH4A 3PFIA 5IT9Z 2O9LA 1C0WA 2RQQA 3ZQHA 2BXYA 5DS9A 3JR9A 3LFUA 1FMVA 3NQOA 1RNLA 3DTIA 1GVDA 4CCJA 3BR3A 4ZC3A 4LMYA 1LQ1A 4HDUA 1XSVA 3OOPA 5LRSA 3H3ZA 1U5TB 1GV5A 4L9JA 3CP8A 5GAHJ 4C2MJ 3ELKA 3A02A 1U5TC 3FMSA 2P0WA 3HRTA 2QA4I 2HDDA 2VE9A 1MMNA 1WJFA 3BR6A 2R7ZJ 1K79A 1H9TA 3BP8A 5LFAA 1BW6A 2MFZA 1AKHA 2OJED 5ILVA 3CF5F 3CCRI 3I56I 5DM6F 4XLHA 3N05A 3DXJF 1FOYA 3A01B 3CCUI 4ENNA 2G9WA 5H6RA 1B72A 2QCOA 4MEYF 2D1HA 4A6EA 1REPC 3ERED 5FKKA 2QSHX 4BUPA 4I01A 1O3QA 5LGUA 1S72I 4O3MA 1ZG1A 4AUXA 2AQFA 2HPMA 1WJAA 3L7WA 2Y0MA 5HLGA 3OYMA 1VQ9I 1BI3A 2EZLA 4RBOA 3LSIA 3HBLA 2KDZA 2E2JJ 2F2EA 2W85A 4MQVA 4ZTJA 2X6XA 4BQQA 1MDMA 4ENMA 1ZRCA 4AVPA 4MGRA 3ZOBA 4P9UA 3I55I 1SVOA 1T56A 2R7XA 1JKQC 5CKTA 1IC8A 4CCLA 2QEXI 2Y0SA 2K4BA 4UVCA 3KIOA 2PI0A 5K1YA 3RSNA 2FBKA 2Q8KA 1UG2A 2DLLA 3GTKJ 3HSEA 1YIJI 4ZZDA 1W7PD 1WFXA 2GM4A 3AFHA 4A3LJ 1U2WA 4OAZA 2IGNA 4HOBA 4PSWA 2LKXA 4IQJA 2V79A 2VJ5A 2QBYB 1YRNB 2Y2ZA 1TBXA 2E35A 3AG2H 3DEWA 1Q1HA 4Q5SF 1ORKA 3FX3A 2X4HA 4O5VA 2GLOA 1R1VA 4KNYA 3S1RJ 4G6TB 2AXTC 2H94A 2XGCA 2GAUA 2ZFUA 5AIQA 4IHVA 4I0AA 1OYWA 1ZELA 2R7UA 3RYRA 1FJLA 4PUSA 3F8NA 1IF1A 4E70A 2JUGA 1TP4A 3ABMH 4IHXA 3RDIA 2Y69H 2KRHA 2JVGA 2DOFA 2CQNA 2FRHA 1LDKB 1ZGWA 1IO2A 2F5DA 2Y0SN 3S16J 1FTTA 2K9SA 2IPQX 4M3BA 5EDNA 2K3FA 5EEGA 3HTUA 4BXUA 2BW3A 3KP5A 5L3CA 2DQLA 3OYFA 3LA7A 4B3XA 4AM3A 1T95A 1IRGA 2FEZA 4UUVA 4F3QA 1V54H 2R5ZB 2PJRB 3L2WA 1E17A 2FOWA 3H3UA 4XNFA 2Q2EB 4PSXA 5DD8A 1HOMA 4UV8A 4RLFA 1L0OC 2ESHA 1JJ6C 2LNBA 2D5VA 2LKPA 1HXDA 3LSGA 4ETSA 5HS8A 4A3KJ 2ELHA 3CMEI 4BY1J 4B8XA 3PO3J 5DD4A 2VJJA 1GXPA 1YOVB 5K7HA 1K78B 3ASNH 1YX5A 1AHDP 2HVQA 3E6DA 4BBRJ 3J81Z 2M2EA 1J7KA 5TJJA 2HQ5A 1ZTRA 2WADA 4ANJA 1G3SA 2XRNA 2R7WA 1GT0C 2XKPA 1LVAA 2X1EA 4WXCA 5L3EA 5K5OA 1ON1A 1MBFA 1R4MB 1Y8QB 1BOAA 5E20A 1MJAA 1WJDA 2A3SA 1PP8F 2HYGD 2XKOA 4JBAA 3K2ZA 3AG1H 3GFIA 3HRUA 5J8FA 4GDFA 2WAQA 3KP2A 1X1BA 3U21A 4E7SA 2P5KA 3L2RA 1VQPI 3TKYA 1QPMA 1QRYA 1TQMA 3RTRA 4FHTA 4F7ZA 1K61A 4CCKA 2EZHA 3KP4A 1KQ8A 3MVPA 2MABA 1J09A 4G94A 2ZMEB 3QU3A 4JYKA 4ABZA 1YS6A 2ZMEC 1A5JA 2R93J 5F0HA 4K2EA 2RN7A 2VIXA 2RVCA 5IYDJ 3QYBA 2RREA 3CC2I 2VXDA 5E3OA 2VKVA 3DBHB 1Y56A 2HZTA 3SJMA 1HKSA 2R5YB 1H89C 1O3TA 1VQKI 4HLYA 1P92A 5JVTA 2BBYA 1G59A 2CFOA 2ZXIA 3WTUC 1HDPA 4U7BA 4BY7J 2KISA 1JTYA 1BI1A 2R7SA 2F48A 3WE3A 2NYXA 1FSHA 2VPRA 3MWMA 2DK5A 1K7AA 4P9FA 5JHUA 2GA2A 1SFEA 1OFCX 2XPVA 2K3PA 2HXOA 3BG9A 5ED4A 3IAM2 2WAQN 2JN6A 5EEHA 4AIDA 1Z7LA 3O3KA 2KQRA 1LVKA 4ZTFA 3J7AO 5D8KB 5F0FA 3GLXA 4OMYA 4F93B 2NVYJ 2ZBKA 1QHGA 1PUFA 2FX0A 2CUJA 4IL6C 3HC7A 4ZYEA 3B6AA 3JSPA 2CW0F 3I9V2 3M8JA 4YEJA 1E3OC 3FXLA 3F8FA 2F6CA 4HNUA 2R7QA 3BTLA 1WH5A 2MD5A 4DOZA 1SANA 3FHZA 4E7KA 4BQNA 5GPAA 2IS1A 3SEZA 1SD4A 5E1ZB 1YHQI 2LF8A 2DJNA 3HKZN 4I09A 4CYDA 3DFGA 3CCVI 2YU9J 5J1UA 2DFHA 1XCBA 5FLMJ 1X2MA 2ICWG 2IT0A 4MIMA 2DBBA 3HOYJ 4OIOF 4IRGA 4AYBA 4BNCA 3JRAA 3CLOA 5A2QZ 2QQBA 1TT0A 2WAEA 3JRCA 4KIFA 1TWFJ 2DAOA 1J59A 2CW8A 4UUTA 3ZMSA 3EYIA 1W1WE 1S7OA 2YPRA 4XN3A 2HOTA 2DA1A 2C6YA 5LHIA 3KLOA 2E1NA 5LLQA 5BMZA 2KIFA 3PO2J 5CQEA 3IAS2 3IC7A 4UY8I 3CUQB 3CCJI 1QZYA 5L3GA 1MNMC 3H5NA 3QP6A 1FOKA 4O6JA 3S1MJ 2ME6A 5KVRA 1AU7A 5A2QK 1U5TA 2CMPA 2IEKA 2F5VA 1R58A 4OIPF 5D5VB 2LSOA 3W6VA 3KYDB 4OINF 4Y15A 4Z2YA 3OOUA 4LFUA 3AL0C 1ITYA 4PK4A 1BA5A 2M4GA 1BI2A 5DDGA 1V3FA 3MFKA 1BIAA 2HQRA 3LFKA 2HZDA 3C2HA 1V4RA 4F91B 3K1PA 3LAJA 3K1MA 4OIQF 3D0SA 4JP0A 4U87A 2KIQA 2ECBA 1G4DA 3CESA 1GLNA 4XLNF 2DW4A 4GRIA 2HQAA 1W36D 4A5NA 2MH2A 4WF2A 5C4XJ 2X1CA 4ENJA 1BIBA 3LSHA 4CO8A 3A01A 2PMZA 2WB1N 2K5CA 1MMGA 4F52A 1RC9A 2HFHA 4G8XA 3OYGA 3G6EI 3TO7A 2ELKA 2X85A 3RQIA 5L3BA 1YW8A 3J7YJ 3K6GA 2R7RA 4L5EA 4OWRB 3Q0WA 2QSFX 3IKTA 2UUZA 2V1NA 3ZQQA 3OYAA 1VQMI 2GXBA 2FSWA 4E7JA 1WSUA 1SD5A 4UNOA 3M7GA 2QENA 1MW7A 3CTAA 1LFUP 5K5RA 2IA2A 4IHWA 5EZHA 4RA2A 3V8KA 3HOXJ 2FNAA 1UZCA 3QOPA 4EM0B 3UKGA 2F4MB 1VI0A 3S1QJ 2CH0A 2A05A 3VEPA 1OCCH 4NDLA 4QLCU 2YX7A 2DO7A 4Q47A 3I59B 1HBXG 5E3MA 1QNTA 4RB3C 4EGZA 1KZHA 5GTHC 1JUPA 1R1UA 3TGNA 4QIWN 3IRRA 4WXHA 3DPLC 2OBPA 3GLLA 4V19K 1E3PA 1QO0D 2EINH 4D5CA 3T5XA 3G1LA 3EUHC 2X6OA 4RB0A 3S8PA 3ZMVA 4RMNA 2V9KA 1YRNA 3K1NA 4HDVA 2QBYA 5D8LB 1ZLJA 3R61A 3LQRA 4YELA 2P6TA 4L18B 2JA6J 2RQPA 4XORA 2L5QA 2FOKA 2DQRA 2DT5A 1I27A 1R22A 4FE7A 4PGHA 3ZN0A 1FC3A 1BI0A 2AHQA 2EIJH 2L01A 3P9KA 3KP3A 3F6OA 5K7ZA 3DQVC 5FD5A 1RKTA 2GIZA 4H0EA 2IRFG 4A3BJ 2CUEA 2COBA 4HX7A 5TGTA 5CVVA 4YIIA 1VQ8I 2P4WA 3GTQJ 4XBFA 4ZH4F 3SDBA 2JQ7A 1PDNC 4ZYHA 3ABUA 3A2KA 4RLQA 3KETA 2P5VA 3IH2A 4FT8A 3PIPF 4WXDA 4N9HA 3QOEA 2H1LA 2HOAA 1T39A 1ETOA 3DWLE 2HU9A 4N0BA 2IW5A 3GX4X 2FF4A 1Y8RB 1IZ1A 2FJ1A 2HR3A 2NS7A 3BTCA 4KMUX 3HPGA 4U0WA 1I5ZA 2XGEA 3SZPA 3NWTA 1DUXC 3F72A 3UR3C 2R5ZA 2L4MA 2ZJ2A 2PJRA 4XM3A 2UXXA 3ABTA 2Q2EA 4BU2A 3DKWA 2JA5J 3CJQB 2M3AA 1QVUA 5B1AH 1XSXA 3TW6A 1ETKA 2R7DA 1X58A 5ICCA 1MSFC 5F6FA 3V8LA 4DYCA 4FX4A 2K9MA 1BR1A 2OCCH 4P96A 1IJWC 4EVIA 1VZ0A 2DA2A 5KK1A 1K78A 4NQWB 3EETA 1SD6A 1DGRM 4XK4A 3AG3H 3GFJA 3IWFA 4HSTA 1W0UA 1FP2A 2BE5F 2DFIA 2Z99A 5DYMA 4BHCA 4HNVA 4IZZA 3CO7C 2ZCWA 4L0ZB 3F3XA 1QZZA 1UAAA 3K4JA 1W4MA 1ZG3A 1OCPA 4XLCA 4DQ2A 3BJ6A 4KIBA 2H6CA 1H9GA 4XKVA 2BV6A 2FA5A 2FBIA 3BQZA 3GTGJ 1PJRA 3WGIA 3IWZA 1Y6IA 1VQOI 3V7CA 2KJCA 3HGGA 3ZGKA 4BAYA 2NAZA 1ENHA 1SC7A 2XF5A 1XTAA 2E1MB 2V9PA 4I6ZA 1DQUA 1D0YA 2W82A 3DU6A 2CYYA 4M3EA 4ENKA 3I5UA 1D1CA 3KYCB 3VSLA 3L9FA 4W1UA 2ZMEA 3SYTA 5FO5A 3NAUA 4RGSA 2JRMA 3LA2A 4HPQA 3HYIA 3S32A 1NG7A 1I3QJ 1FIAA 2CQKA 2M8GX 5DUKA 2ETHA 1ZR2A 3FWEA 1HW2A 2ZB9A 2R5YA 2LD5A 1IUFA 3CZ6A 2AXLA 3GZ5A 2ZSIB 2RAEA 2MSYA 4CHUA 5LGNA 1KGSA 3PIOF 2XGDA 2FMYA 5LD2C 4HSRA 5BOXA 4ITVA 5FKOA 2HPIA 3CC7I 1SEUA 2VODA 3ROUA 4Y7NJ 1EF4A 4PJMA 2UWMA 3PSIA 1ODDA 1D0XA 4F55A 1W7PB 2DA4A 3S3NA 3O6BB 4UHTA 3L00A 4EM2A 2H27A 1SFOJ 3LMMA 4M3DA 4LIUA 3FIWA 1MH4A 3LSJA 2JPCA 3IUOA 3FXRA 1MD0A 3S2WA 3ZPLA 1R9TJ 2QSGX 3K4LA 3Q9VA 3RPUD 2W4SA 3I4PA 1K4TA 2MBFA 3J7ZI 3OYKA 3HOZJ 1X4PA 1YG2A 2LR8A 1TWAJ 2DA3A 3K70D 3BG3A 2JA2A 1SFUA 2ZXJA 1IUYA 3IV5A 3OV8A 2GXGA 4RB2C 2YS9A 4KN7X 4GGGA 2WY7Q 2XROA 4NNJA 2F5FA 2LVSA 2NS0A 3JRIA 1JE8A 4BBSJ 1ETYA 3EDPA 2LY1A 4A3FJ 1E3HA 2O5RA 2GOXB 1D8KA 4CXFA 2OZUA 3HOSA 2ZSHB 3FBNB 2KT0A 4LK1F 3PUBA 3K4NA 2DJIA 4EJOA 3PFYA 2WY8Q 1Q1VA 5F0CA 4M73A 3VYUB 4B1RA 2YU3A 3CUQA 2IS2A 3EUAA 2K4JA 3LOCA 4KT5C 4B44A 3I58A 2ZNYA 2M87A 1OR7C 1EA3A 2BY2A 1XMKA 4LOCA 5TISC 4EM1A 1P9QC 4PJ0C 3MZHA 4LK0F 2MC3A 1RI7A 2I5UA 2KZGA 4FE4A 2BVMA 4EJUA 2XF7A 2TDXA 4RGRA 5LRRA 4HNTA 2R7TA 2VXZA 3IRQA 5C4JJ 5LGTA 2JWTA 1YJNI 4A0XA 5B3SH 2O7OA 3SXYA 5DEQA 1IN7A 3CJNA 2L9RA 3LSMA 3K2AA 5F27A 3LSRA 1ON2A 1WJEA 4RAZA 3FDYA 1UHSA 3PNTA 2EFOA 2ZXWH 1DPRA 1GV2A 2P7CB 2L7KA 3M8EA 3JRHA 2WBMA 5JFRA 3N97A 1MKMA 4X6AJ 2ZNZA 5E1XA 2A07F 2NVXJ 1AOYA 2CUFA 2IXSA 3PM1A 4AD9A 4EQQA 1X1AA 2W7NA 1YITI 2VPLA 2HOEA 3IKVA 1CGPA 4IPAA 3BPVA 2V1UA 3MD2A 1Z67A 4II3A 2V1XA 2IBDA 3CCLI 4OAYA 4KIGA 2KPMA 3A0BC 3E1SA 5AONA 2HKXA 4V2GA 1TL8A 3GF2A 1P7IA 1NK3P 3GTLJ 1FX7A 2B9SA 3ECHA 3AG4H 4B47A 3OL3A 5CVIA 4HQMA 4A69C 1O7FA 2XRLA 2KMUA 2J5OA 3OS2A 1JHHA 4IQ4A 2OPTA 1U8RA 3HOVJ 1ETQA 1P2FA 1TWHJ 3H36A 3SFIA 1EH6A 3Q0VA 3JW4A 2CQXA 1TLHB 3BG5A 2O3FA 1B59A 1RPWA 3BC8A 3IH3A 2X6YA 1Z77A 5B66C 2CUZA 4CICA 2LP0A 3WGGA 3DEUA 4DIQA 3GZ6A 4Y33A 4XL9A 5FRNA 3I59A 2VBWA 4M9SA 3G1OA 4B4CA 1F1ZA 1G3TA 4A93J 2LG4A 3M9AA 3CMAI 3FF5A 3NEUA 3BZ6A 1FYMA 5EZGA 4BDYA 5CPRB 4I98B 3DPUA 4FCYA 4RDUA 2NS8A 1RUOA 3RQ4A 1MGTA 2Z5UA 1OQYA 3ZMUA 3FK6A 1BN5A 2QWWA 4RGUA 1K4SA 1A6QA 1RR7A 2MH9A 3WGHA 2PMHA 1TNTA 5J3LA 3T8RA 1UJ8A 1T08B 2VJ4A 4UV9A 3MKYB 1FT9A 1WI9A 1Z21A 1B8IB 1ZK8A 5EF6A 3D1NI 5IP9J 5IYCJ 2K9NA 3ZMTA 5E1WA 4HX4A 5ILSA 3HPHA 2GQQA 1R6RA 2ECCA 2W57A 4D1QA 2EZIA 1FNNA 4HV5A 1U9OA 2LY9A 3FISA 3E5XA 3JAMZ 3M3YJ 5JLXA 1HKQA 3RKQA 2LBFB 2ZO4A 3ZRGA 2PJPA 3JRGA 3S3OA 2ISZA 2AO9A 4UXNA 3S1NJ 4HX8A 4LGWA 4KYWA 5FGMA 1V5GA 2DT6A 1ETWA 2V6EA 1G6NA 4A3JJ 1EV7A 3PUFA 1VQ6I 5J1YA 1HKTA 4DZJA 2P6SA 5H6QA 2XUBA 1IV6A 3KEQA 3QAHA 2DK8A 4MLOA 3U1DA 4Y52J 5IY5H 2WWYA 1U6GA 4LG3A 3F22A 2HVRA 1BL0A 2J5PA 1WRJA 2H8WA 4DZPA 4B09A 3F8BA 2DMPA 1YX3A 4BE0A 4I7HA 5H20A 4ASNA 5LEJA 1RZ4A 1O3SA 1PUEE 1IDZA 2E1OA 4C30A 4NQWA 3JAMK 3M1EA 1LDJA 2ISYA 3SDGA 3V42A 1X19A 2CWEA 1XN7A 3OMYA 4KJZA 2JUCA 2MC4A 1X1PA 2JRTA 4FTHA 4Y3OA 4YIFA 2VUMJ 2CGPA 2KZVA 1STZA 4MHGA 2XB0X 3GFLA 1WJ5A 3HB9A 4IRHA 4ZZLA 5DTDA 5DM7F 4LITA 1OCZH 1UELB 4N9IA 5LHGA 2Z2SB 2X51A 2WV0A 2X9DA 2QGUA 1ZH5A 1DP7P 1W36C 3HRSA 2H8RA 3FXJA 3GVAA 4RAFA 1VQ7I 5M5YJ 2X1DA 1Z3YA 1ETVA 2DCEA 3BCAA 1MNEA 3D5RC 2JPBA 3MCZA 3FXKA 3HKZA 3K7AJ 1I6HJ 3KP7A 5B5EC 2BOLA 4P55A 3MN2A 3R60A 3EYYA 1SFKA 1RESA 1XMXA 2DDBA 4CCOA 4ZDLA 1F43A 5IYBJ 3PNYA 3DKYA 2MW8A 3H3VK 3P5JA 4XKCA 2PN6A 4WCGA 5FRMA 4P1WA 1O57A 2G7UA 1Y0NA 1FSEA 2MLGA 4KITB 5IP6A 2WTEA 5IOYA 1LDDA 2O61A 1R36A 2A6TA 5HDKA 3IHUA 2HS5A 2XB5A 4A3CJ 2ADUA 1SMTA 3JRDA 3JTGA 4BE1A 3BJAA 1FZPB 3G73A 3VSKA 4XKBA 4QSHA 1W7PA 2MA3A 1ETXA 2V4JC 1U78A 3F8CA 4JQFA 3I4NJ 3ULQB 4CGZA 2NVUB 3W3CA 3ERMA 5F04A 1KONA 3I71A 3W2VA 2XPUA 2RC4A 1USSA 3I4MJ 4HA8A 5ERIA 4W97A 2BY0A 3ASOH 2FBHA 3Q0UA 1A35A 1OISA 1YS7A 3E6BA 3K9TA 1YQAA 3KEYA 4P5OA 2K27A 3VWBA 3U9GA 1W5TA 3ZR8X 3BT9A 1X3ZB 4G6DA 2DMQA 3RYPA 3TQNA 5HODA 2Q0OA 3W2WA 3RI4A 4ESBA 3CD6I 4XONA 4KT6A 3CDIA 3OYBA 1B9NA 2WB1A 4D9JA 4C3HJ 4GYGA 1SVLA 1VNDA 2W25A 1LPQA 2VONA 3HOUJ 1BW5A 1Z6TA 1R1TA 3G71I 4EJVA 1DP3A 3GFMA 5HOOA 2EQRA 3MKWB 2OZ6A 3GTPJ 3BLYA 3NRVA 2OF7A 1ZKGA 4JK1X 2XIGA 1W5SA 2E71A 4LG0B 3HZJA 4BHBA 2HGCA 3FBIB 4AIKA 1Z05A 2VBXA 2HEOA 3VPRA 3AL0B 3VFZA 1OR7A 2KRCA 3OYJA 1P4XA 3FXMA 3R6SA 3O8GA 2CS3A 1U0JA 2RV8A 5GP9A 1R49A 3E6MA 5HLHA 1D1BA 3LSPA 3SZTA 3EQLF 4YIRX 1HA8A 4KN4X 2R7OA 1IXRC 2FD5A 1FWZA 3QPHA 5LHHA 1JJ8C 3DCFA 3HHHA 4MFDA 2M7BA 1CF7B 1R4NB 2EH3A 4G6QA 3GYHX 4BXXJ 2IAIA 1BM9A 1HW5A 4M3FA 4HW0A 5DUIA 2DPUA 1LNWA 5E8GA 5BNGA 2CU7A 1TWCJ 2CSOA 1FY7A 2DN0A 4GCVA 5CYVA 4DBQA 4J00A 3DEEA 3HUGB 3TDUC 4MNUA 3V4GA 2E2IJ 1ZAOA 2OV7A 2M45A 1B4AA 2D2WA 2BYVE 1XS9A 2HI3A 1DPUA 3LSKA 4M6VA 3BR1A 2LTPA 4MO7A 4YRVA 2KJBA 3FM5A 2CJJA 1FBQA 1MZBA 4BH9A 4G7HF 2W48A 1LFPA 2OQGA 4A6DA 1WGXA 1SAXA 3HEFA 5CLSA 1X3WB 2FQ4A 3W2AA 4UB8C 4PJLA 3QPTA 4EJTA 2MG4A 4RM3A 2NNYA 3F8MA 4BQAA 2JA7J 1R5ID 3W6JB 1QGPA 1FEXA 2IP2A 4YFNF 2F5EA 2L4AA 2EJRA 4I0BA 1YO5C 4G12A 1L3LA 2DYRH 3WE2A 5EEAA 2EFWA 4U0YA 4A3IJ 3F21A 1F36A 4M9ZA 2LKSA 4HF1A 3C1DA 1BR2A 1Z1DA 1Y39A 2E19A 4AIJA 3KYLA 3WU2C 1YIOA 4LIVA 2E1CA 3E6CC 1V5EA 2A68F 1OLTA 2K40A 3CJRB 2BXZA 3K4MA 3J80Z 2Z9OA 1H8AC 1J5YA 1XMAA 1X1CA 2LREA 2VB6A 3H0GJ 3X2QH 4E7HA 5LEKA 5B1BH 3BG7A 1XSDA 1XDSA 3DKXA 4A12A 1S5LC 2OA4A 1X2NA 4ZJZA 5J47A 1HQCA 1LEAA 2EB7A 2QZ8A 5HNHA 2Y30A 1RR8C 5TRDA 3VYTB 4YG2F 2BY3A 1VQNI 3CCEI 3WTYC 1YW7A 3VYSB 2LMDA 2LFBA 1IN6A 3H9QA 1B8IA 1HW1A 1K6YA 2KIMA 3J80K 1P7JA 1RUNA 4QTRA 1FP1D 1J2XA 3K70C 4PJJA 1F9NA 2FNPA 2LYCA 1GHCA 4BS9A 1Z6RA 1VQLI 5GADJ 4ZYGA 5LBQA 1YI2I 3HOTA 1ZR4A 1LB2A 4CSWA 1USTA 2L0KA 2LBFA 4E7IA 5E17F 5J4VA 3RCOA 1TTYA 1H88C 3OYNA 1E2XA 3E3VA 3HG9A 5CVUA 3GZNB 4I76A 4R79A 1MMDA 4NBQA 2E5ZA 1XG1A 3M07A 3WU0A 2L02A 2E5NA 4L5IA 1MMAA 3ABLH 3R0JA 2P5LC 3KE2A 4M9XA 2L7ZA 4J19A 2HKOA 3QRFF 1A31A 1FTZA 4XRSA 3FM3A 1SAUA 2CQQA 2STTA 5IP7J 3HTSB 5BS6A 2XGXA 3A0HC 4XKWA 2R92J 2JTVA 1JT0A 2JZYA 3HHGA 1P4WA 4XOPA 4ESJA 4BKXA 4XRMA 2F4OB 1HDDC 3MZ8A 3F0CA 5FLXK 2KRFA 2VJIA 4UUSB 3ONQA 3JREA 4HBLA 4N4OB 4ZYDA 3MQ0A 5HVQC 2W00A 1PVEA 3RKWA 5D4RA 1KQ9A 3FXOA 4G7ZF 3OYHA 4XICA 3OIOA 4Q4ZF 3H5RA 1VTNC 1RRJA 1MBEA 1O7LA 2LDUA 4IX7A 3G1MA 1T98A 2XSDC 4F92B 5ILUA 1OKRA 4BQOA 2ZJQF 4H4KC 4C3IJ 3FMQA 1RKWA 3CO6C 4KISA 3TBIA 2KL4A 1TT5B 3WODF 3E0JB 1D5YA 3F9KA 2GXAA 2LOOA 1LEBA 5M3MJ 4PJNA 2HDCA 2VE8A 4HQEA 3P9IA 2ZKZA 3H35A 3LQQA 2EK5A 4XRSG 4CH7A 2W24A 4D0PA 1XGSA 5L3FA 1ZYRF 3HSFA 1QA6A 3WG7H 2M0MA 2Y31A 2D45A 2KLOA 1GDTA 4DJAA 3BR0A 4HAMA 2Q1ZB 1D5VA 1X4OA 2B7EA 5M5XJ 2CO5A 1ZG5A 1IN8A 3B6CA 2DMNA 4LLGF 3C2BA 2ID3A 4LD5A 2FE3A 4EGYA 2WV1A 2MGQA 2QF7A 3DLLF 1FIPA 4E6KG 2X48A 3KEOA 4NUBA 2OCEA 5JHFA 1TC3C 1UHMA 3KX2A 1SFXA 1ZQ3P 3B73A 4BEHB 4D5FA 4DYRA 1EH7A 3ZQ7A 1B6AA 3RJPA 1NK2P 1XDUA 2X6WA 3K4CA 4UVAA 2ZJPF 5M5WJ 1LE8B 2O8XA 1R5GA 4LJZF 1S9HA 4B43A 2IGMA 3HL2A 3J7AY 4NC7A 2L3DA 1EH8A 2P7VB 3H0DA 2ZC2A 4MQ9F 4BJ6C 4HRIA 2VL8A 5HDNA 3K69A 2R3SA 2JJ7A 3LWFA 5J1RA 4A2UA 3SHFA 2EV6A 1O4XA 4BACA 1HSJA 4HG2A 1ZGJA 3T0YA 2YSRA 3QYEA 3RPQA 2V1DA 3WHCA 2BEOA 2EV5A 5CJ9A 2NVTJ 1WI3A 4Q48A 3MMYB 2O03A 5J40A 2MYSA 4S05A 2XSJC 5E8IA 3NARA 2UV1A 1MBGA 1TW2A 1PP7U 2H09A 1RETA 3A03A 2OU2A 3RKYA 2MLKA 3BY6A 5D5UB 2DT7B 2K7LA 2XC7A 4NB5A 4OOIA 3MKZA 1IDYA 1FYKA 4CYCB 1U8BA 5L3DA 4LG0A 3QYFA 4KDPA 1MIJA 2E7WA 2Z1DA 5IOZA 4X0GA 1G2HA 2ID6A 3BG6A 5KAFC 4BJ5C 1MJ9A 3K4KA 3U2RA 1M1EB 5D4SA 3OS1A 3JTHA 5D6EA 2EFQA 2L9SA 3HJEA 1Z91A 2CV1A 1JXSA 3H1CA 3HGYA 3GWZA 2FUG2 1K83J 2KKOA 2E7XA 4IF4A 4XLFA 3A4CA 1BR4A 3OSGA 2M1BA 3WHBA 1QHHD 2R0QC 3HIFA 4XLPF 2ELJA 4XR6A 4E4HA 1DU6A 5GAEJ 3BROA 3TOBA 1G8XA 2F4IA 3DP7A 5F64A 2LF7A 3L2UA 3M1CA 1CF7A 3OYIA 3FKIJ 3WG9A 3Q3SA 3I3LA 3V7SA 1JI8A 1YYVA 3G3ZA 2QVOA 2XAQA 3LAPA 5IT9K 4G9YA 1R23A 4BJTA 2K02A 2FU4A 5H2FC 5DV5A 1BC7C 5FKNA 4I99C 4WWCA 3PQJA 2XPWA 5CQGA 3VYRB 2B63J 1NTCA 2HDWA 4MTDA 3HUGA 2HYFA 1OJLA 3SFZA 2HWVA 2M30A 5HNFA 2ZFWA 1POGA 1VF9A 3FMRA 2XAGA 2EIKH 3OYLA 4BDZA 4BGDA 2EILH 3JCUC 1RIOH 2M0CA 3K4BA 5FD6A 1Z9CA 1T2KA 3HDDA 2JVHA 3GW2A 2A5YB 2VN2A 1KU2A 4MFEA 3QU6A 4CDGA 2VQCA 4KICA 3WTTC 1QPIA 2CV2A 1ZLKA 1TW3A 2NVQJ 2M8EA 4M71A 2V6CA 2GOMA 1LUJB 2XAUA 2HNHA 4A3MJ 1IAWA 3OYCA 2JT1A 4QPOA 4PCQA 2XF6A 4M72A 3FZVA 4V2FA 5C44J 3BOQA 3VOEA 2EWNA 1N25A 1X3UA 3EUHA 2P8TA 2EFNA 3I54A 4BXFA 2A6EF 4EMSA 1UB9A 2BHZA 1Y1VJ 1FMWA 4OMZA 2V7FA 4Z6YA 3IL2A 4XSXF 1OCOH 3RIRA 2HTJA 5IT3A 2CQ7A 2NRAC 3PNVA 3WTVC 4HF2A 4M6YA 3QQAA 1N78A 4PDKA 3E5QA 2OQRA 3COAC 2O0YA 1IW7F 3GO5A 2Y9ZA 1IGNA 2DPDA 4A5MA 1HSTA 3EPZA 2BGCA 3VB2A 1S29A 2H1KA 5HLTA 4JX6A 3MEXA 2PX9A 4HYEA 1NHAA 2DDAA 3ZMDA 3CMYA 2AS5F 4LB5A 3RPUA 3KFWX 1K6OA 4MEXF 2PFBA 2KIUA 4C2UA 4IJAA 3TOAA 3U1KA 4M3GA 4B48A 3L09A 3TEDA 1KQ0A 4EATA 4RB1A 2KDOA 3C7JA 1KYZA 4BL0B 2HXIA 3BTJA 5JI6A 4I02A 1JKOC 4OU0A 5GTIC 1WQ2A 1IG7A 2WC2A 1S8NA 3HSRA 1T33A 3G4SI 4A0YA 4EV0A 3H9JA 4BHPA 4OIRF 3MAJA 4D7MA 3SQNA 3S14J 5ICEA 4L0YB 9ANTA 3M8FA 4RGXA 2K85A 3P7NA 2L9VA 1XD7A 4E7LA 1JTXA 2QKMB 1I1SA 2IA0A 4BE2A 1LFBA 2GZWA 5F08A 5DCMA 2DOAA 4PZJA 2I8DA 3ZN1A 2VKHA 3QPLA 2K86A 5FFZA 3TDZC 2ME0A 2L54A 3D5SC 3GTMJ 1UHWA 4L9TA 2PLYA 4L9VA 4RS8A 1IN5A 4WK8F 3M4OJ 4WX9A 1A36A 3LSTA 5CVRA 2XDVA 4YFKF 4HEA2 3C3WA 2V9VA 4TV7A 2A6HF 1N77A 5F1RA 2A5WA 3CLQA 1Y1WJ 2LY2A 1U9NA 4UUSA 3Q5FA 1ZGAA 4IEJA 1D3YA 1IRXA 1CQTA 1IXCA 2OTLI 2EIMH 2LK2A 1P6RA 2KP6A 2VQHA 3TO9A 2TRTA 3P9CA 1ZARA 3N4MA 3TMOA 1FYLA 2E2HJ 3BJOA 1QZEA 5FFXA 3DV8A 4LB6B 1KU3A 1FPQA 3WTSC 1TNSA 3DU5A 2DA6A 1HCRA 2DTRA 2R7FA 4M6XA 2HQNA 1SMYF 2D1VA 3FKJA 1H0MA 3CUOA 2GA1A 1BOBA 3J81K 4XRFA 3ZQFA 1APLC 1ZREA 1MBJA 2Z3YA 5FJ8J 1AA7A 3E97A 4A0ZA 1TQIA 2RGVA 1R7JA 1ACIA 3PJRA 2G0EA 4EJWA 1MSEC 3KPHA 3T1BA 4L5JA 4RAYA 1ZRFA 2JSCA 3GEZA 4JOMA 1NH3A 3DTKA 1JKPC 4CZZA 1S7AA 2N8GA 4AC0A 3GTJJ 3I0TA 3PL8A 1TQPA 5EG0B 4QWQA 3BR2A 2GWRA 3OYDA 1JKRC 3MZYA 3F6VA 3KZYA 4GYIA 4RAGA 4XSZF 4BEHA 3ML6A 4AU7A 3JSOA 4B3AA 5M3FJ 3BZCA 1HC8A 2HTSA 3BR5A 1LE8A 2EV0A 1QU3A 3OL4A 4ESFA 1IRFA 2EPFA 2UXNA 5GAGJ 1YE9A 3QWLA 1FLIA 2QQ9A 1XPXA 1R5HA 1XGMA 2MD0A 3R4KA 4ZYAA 3WTWC 1T0FC 4J01A 2EA2A 4PFPA 5EYRA 3IP4B 2PG4A 2V26A 1BBYA 4PFOA 5EGOB 5HLIA 1J9IA 2CFXA 2RDPA 3CCYA 4XMYA 5D5WB 2W1OA 3WU1B 3HOWJ 2KFDA 1XB4A 3LA3A 1ZRDA 4IHTA 4G7OF 1I3AA 3H92A 1SD7A 5KHDA 1WJCA 1BJAA 3CMMA 5EJCA 3V8JA 1JGGA 2IGOA 1EJ9A 1D8JA 3FHNA 1FOWA 4IO9F 3RZDJ 3SEQA 3L2VA 2L7FP 4FX0A 2EFPA 4C2TA 3OIQA 1YW9A 3CDHA 1MNDA 3S93A 4BYYA 1OYIA 2VLAA 2VQLA 1WZ2A 3BDDA 4AVZA 4AIHA 1X1DA 1QVTA 2QUFA 2VBYA 1V5FA 4CYCA 3NWSA 4R1HA 1N75A 2XAHA 2NOGA 3H5AA 1XC5A 3ABKH 4Y13A 5D6FA 3KLNA 1UFMA 5J8CA 2H6BA 2K9LA 4DGWB 2EZKA 2HVSA 3DF8A 3GBGA 3DBLB 1WHUA 2L7MP 2OC6A 4E7ZA 4C9YA 3OS0A 1KA8A 3CUQC 4HLXA 3L2QA 1FBSA 1IRZA 1UG0A 1JUSA 1R00A 2M34A 3S17J 5HS9A 4L9NA 2K9QA 1XGNA 1TZLA 3HXLA 4CA0A 2IA1A 3OR1C 1W0TA 5D5XB 4I2OA 1AKHB 1E0EA 4KUMA 3K10A 2DA7A 2CRGA 1T8IA 1LJ9A 5JLWA 3TP0A 3JRFA 4AYBN 2PQ8A 3FXQA 3L2CA 3DLAA 1VFCA 1YJ9I 2DXIA 2Z16A 3VODA 2CV0A 2EA4A 2VI6A 3CF2A 4X1EA 2M9HA 3O2PE 3L1PA 1B72B 2VC1A 2ZXHA 1PYVA 3DBRB 1OCTC 3R0AA 2DFEA 3QODA 4U88A 4IKFA 1B1BA 1OMIA 4KFCA 1W5CC 1JT6A 1J0RA 2PBIA 3S3MA 2PMUA 1JUMA 1XCVA 2HYJA 1VQ5I 1MH3A 2IVMA 2B0LA 3REOA 1QBJA 3BWGA 4KMFA 5HDGA 2IGKA 4Y17A 4CZCA 3GMEA 2IS6A 3LL7A 2VC0A 1D1AA 1S6LA 2BZTA 4XOTA 3ZQGA 4CCNA 3ZCOA 1WVRA 3CCSI 5JVGF 4GXOA 1MDMB 1KU9A 2IJLA 1YTYA 3TP3A 5FB2A 1DU0A 1XGOA 2L2OA 3LNQA 4PGGA 3AKZA 4NHJA 1AWCA 1JHFA 2QQ8A 3PQKA 2M4KA 5J6XA 4UB6C 3GXOA 1WH7A 2DTZA 4IHYA 1A6IA 2OUMA 2VT2A 2R7VA 3BTIA 3UNGC 3VDXA 1O3RA 2UZKA 5KAIC 2E36A 2VOOA 2OTJI 3CP2A 2NOJB 2OAZA 2Y75A 4XQFA 3CDLA 5FLVA 5K5QA 1VQ4I 3RKXA 2BHYA 4CUGA 4DNCA 3FXUA 2PMZN 1DGWY 3ZQLA 1YJWI 2DMTA 1WJBA 1F4KA 1IXSB 1GUUA 4N4NB 2ESNA 1BC8C 2A61A 1QQIA 2ZJRF 2VOPA 3ZP5A 2FXAA 1V55H 2X0LA 1I1GA 2JK3A 4YFXF 4XIDA 4GFBA 3K0LA 3TL4X 5GPCA 5HS7A 3S2DJ 1YFHA 3ISPA 1P4AA 2DODA 4FISA 1T6SA 4GO1A 4DW6A 2O6GE 2JA8J 2XAFA 3KZZA 5FKMA 4M74A 3RZOJ 2WA0A 1OPCA 3HM5A 1Z7UA 4IXAA 4S0HB 2BVLA 3TW7A 1EKEA 2YUSA 4IVNA 3O8HA 4S04A 3KCCA 5FLXZ 2BW3B 5KNLA 2L9NA 1BJZA 1ONVA 3G2BA 3A1YA 3PSFA 3C2GA 3OY9A 5DCMB 1JGSA 3EUKL 4RM2A 1HLVA 3GCMA 2XHKA 3SZGA 5FROA 2NXNB 5BPDA 1R71A 3QPSA 4FQGA 3BQYA 1G3WA 1U3EM 1OYYA 2BY1A 1MJBA 5KCMA 1B9MA 3OIPA 5J4YA 2IS4A 2TCTA 2GBYA 2QLZA 4R8HA 2XASA 2VKEA 3Q9SA 4DBRA 2HOSA 1IV8A 4C3JJ 5IPAA 2YX4A 1F5TA 4A3DJ 4HZFA 2RKHA 5CVJA 1GXQA 3ECOA 2NNNA 1YLFA 2VQGA
chains in the Genus database with same CATH topology
5E18F 2YR2A 4U0VA 2QYOA 2OD5A 1GVJA 1ZHFA 2RNJA 2XVCA 3E5UA 4UVBA 1A04A 3WTZA 2FQ3A 4ON0A 4AWXB 3ZMZA 5ICFA 3DPTA 1WKMA 3B02A 2COMA 3TO6A 3I64A 1DDNA 4IHSA 1KYWA 5AIPA 1FBUA 3GUDA 6PAXA 2M5WA 1G3YA 2XV4S 2ACJA 4HF0A 3I53A 1WWXA 2W84A 4MTEA 5BPIA 2STWA 2PEXA 4HV6A 3AAFA 3V7RA 2DI3A 1ZN2A 4KA4A 3HRMA 3QP5A 2VBZA 2A69F 1T38A 2Y48A 5DCFA 2XAJA 1J75A 2GIVA 2VT3A 2F5CA 5JR3A 1T0FA 1Y0UA 2G7HA 3F23A 2QM3A 2Z33A 1UCRA 2QQAA 3KP6A 1S3JA 1I6XA 4LLLA 2FMLA 4LLNA 3C18A 3WTXC 3W6KB 1KU7A 5ICGA 4IRIA 2DU9A 1ULYA 4U7DA 2CG4A 1IN4A 3D5LA 3BPXA 3T8TA 5BQTA 3PFIA 5IT9Z 1C0WA 3NQOA 1RNLA 4LMYA 1LQ1A 4HDUA 1XSVA 3OOPA 5LRSA 3H3ZA 1U5TB 4L9JA 3ELKA 3FMSA 1U5TC 3HRTA 2VE9A 1K79A 1H9TA 3BP8A 5ILVA 3DXJF 4ENNA 2G9WA 5H6RA 4MEYF 2D1HA 4A6EA 1REPC 3ERED 4I01A 1O3QA 5LGUA 4O3MA 1ZG1A 3L7WA 2Y0MA 5HLGA 1BI3A 2F2EA 2W85A 4MQVA 1MDMA 4ENMA 1ZRCA 4AVPA 4MGRA 4P9UA 2K4BA 4UVCA 2PI0A 5K1YA 2FBKA 2Q8KA 2DLLA 3HSEA 4ZZDA 1W7PD 1U2WA 4HOBA 2V79A 2QBYB 1TBXA 1Q1HA 4Q5SF 3FX3A 2X4HA 4O5VA 4KNYA 1R1VA 2H94A 2GAUA 5AIQA 4I0AA 1OYWA 3RYRA 3F8NA 1IF1A 4E70A 3RDIA 2FRHA 1LDKB 2F5DA 2IPQX 5EEGA 3HTUA 4BXUA 3KP5A 5L3CA 2DQLA 3LA7A 1IRGA 2FEZA 4UUVA 1E17A 3H3UA 5DD8A 4UV8A 1L0OC 2ESHA 2LNBA 2LKPA 1HXDA 4ETSA 5HS8A 2ELHA 4B8XA 5DD4A 1GXPA 1K78B 3E6DA 3J81Z 1J7KA 5TJJA 1G3SA 2XRNA 2XKPA 1LVAA 5L3EA 4WXCA 5K5OA 1ON1A 1BOAA 5E20A 1MJAA 2A3SA 1PP8F 2HYGD 2XKOA 4JBAA 3K2ZA 3GFIA 3HRUA 5J8FA 3KP2A 2P5KA 3TKYA 1QPMA 1TQMA 3RTRA 4FHTA 4F7ZA 3KP4A 1KQ8A 4G94A 2ZMEB 3QU3A 1YS6A 4K2EA 2RN7A 2RVCA 2HZTA 1HKSA 1O3TA 4HLYA 1P92A 5JVTA 2BBYA 3WTUC 4U7BA 1BI1A 3WE3A 2NYXA 1FSHA 3MWMA 1K7AA 2DK5A 4P9FA 5JHUA 2GA2A 1SFEA 5ED4A 5EEHA 3O3KA 3J7AO 5D8KB 3GLXA 4OMYA 2ZBKA 4ZYEA 3JSPA 2CW0F 3F8FA 2MD5A 3FHZA 1SD4A 5E1ZB 2LF8A 4I09A 4CYDA 3DFGA 1XCBA 2IT0A 2DBBA 4OIOF 4IRGA 4BNCA 3CLOA 5A2QZ 2QQBA 1J59A 4KIFA 2DAOA 3EYIA 3ZMSA 1S7OA 2YPRA 2C6YA 5LHIA 3KLOA 2E1NA 5LLQA 5BMZA 2KIFA 3IC7A 3CUQB 1QZYA 5L3GA 3QP6A 1FOKA 4O6JA 5KVRA 5A2QK 1U5TA 1R58A 4OIPF 5D5VB 2LSOA 4OINF 4Y15A 4Z2YA 4LFUA 1BI2A 5DDGA 1V3FA 3MFKA 1BIAA 2HQRA 3LFKA 1V4RA 3K1PA 3LAJA 3K1MA 4OIQF 3D0SA 1G4DA 4XLNF 2DW4A 4A5NA 2MH2A 4WF2A 4ENJA 1BIBA 4CO8A 2HFHA 4G8XA 3TO7A 5L3BA 1YW8A 3IKTA 2GXBA 2FSWA 1WSUA 1SD5A 4UNOA 3M7GA 2QENA 3CTAA 5K5RA 2IA2A 3V8KA 2FNAA 4EM0B 3QOPA 3VEPA 4QLCU 2YX7A 2DO7A 4Q47A 3I59B 1HBXG 1QNTA 4RB3C 4EGZA 1R1UA 3TGNA 3IRRA 4WXHA 3DPLC 2OBPA 1QO0D 3T5XA 4RB0A 2QBYA 3ZMVA 3K1NA 4HDVA 5D8LB 1ZLJA 3R61A 3LQRA 2P6TA 4L18B 2RQPA 2FOKA 2DQRA 2DT5A 1I27A 1R22A 4PGHA 3ZN0A 1FC3A 1BI0A 2L01A 3P9KA 3KP3A 3F6OA 3DQVC 5FD5A 4H0EA 2IRFG 4HX7A 5CVVA 4YIIA 2P4WA 4XBFA 4ZH4F 1PDNC 4ZYHA 3ABUA 3KETA 2P5VA 4FT8A 4WXDA 4N9HA 1T39A 4N0BA 2IW5A 3GX4X 2FF4A 4KMUX 1IZ1A 4U0WA 2HR3A 1DUXC 3SZPA 1I5ZA 3F72A 2L4MA 2ZJ2A 2UXXA 3ABTA 2Q2EA 3DKWA 1XSXA 2R7DA 5ICCA 5F6FA 3V8LA 4FX4A 4P96A 4EVIA 1K78A 5KK1A 3EETA 1SD6A 3GFJA 3IWFA 1FP2A 2BE5F 2DFIA 2Z99A 5DYMA 4BHCA 3CO7C 2ZCWA 4L0ZB 3F3XA 1QZZA 1W4MA 1ZG3A 4DQ2A 3BJ6A 4KIBA 2H6CA 1H9GA 2BV6A 2FA5A 2FBIA 3WGIA 3IWZA 3V7CA 2KJCA 4BAYA 2NAZA 4ENKA 2CYYA 3I5UA 3L9FA 2ZMEA 5FO5A 4RGSA 3LA2A 3HYIA 2CQKA 5DUKA 2ETHA 3FWEA 1HW2A 2AXLA 3GZ5A 4CHUA 5LGNA 1KGSA 2FMYA 5BOXA 2VODA 3ROUA 2UWMA 1ODDA 1W7PB 3O6BB 4UHTA 3L00A 4EM2A 2H27A 2JPCA 3FXRA 1MD0A 3S2WA 3ZPLA 3Q9VA 3I4PA 2MBFA 1YG2A 1SFUA 2ZXJA 1IUYA 3OV8A 2GXGA 4RB2C 4KN7X 4GGGA 2XROA 2F5FA 2NS0A 1JE8A 3EDPA 1D8KA 4CXFA 2OZUA 3HOSA 4LK1F 4EJOA 4M73A 2YU3A 3CUQA 2K4JA 4KT5C 3I58A 2ZNYA 2M87A 1XMKA 4EM1A 3MZHA 4LK0F 2MC3A 1RI7A 4EJUA 4RGRA 2TDXA 5LRRA 2VXZA 3IRQA 5LGTA 4A0XA 3SXYA 5DEQA 1IN7A 3CJNA 1ON2A 4RAZA 2EFOA 1DPRA 2P7CB 3N97A 3M8EA 5JFRA 1MKMA 2ZNZA 5E1XA 2A07F 1AOYA 4AD9A 4EQQA 2HOEA 3IKVA 1CGPA 4IPAA 3BPVA 2V1UA 2V1XA 4KIGA 5AONA 2HKXA 3GF2A 1FX7A 3ECHA 5CVIA 4HQMA 1O7FA 2J5OA 1JHHA 1U8RA 1P2FA 1EH6A 3JW4A 1TLHB 1B59A 2O3FA 4CICA 3WGGA 3DEUA 3GZ6A 3I59A 2VBWA 4M9SA 1F1ZA 1G3TA 3M9AA 3FF5A 3NEUA 3BZ6A 1FYMA 4I98B 1RUOA 1MGTA 2Z5UA 3ZMUA 1BN5A 2QWWA 4RGUA 2MH9A 3WGHA 2PMHA 1TNTA 3T8RA 4UV9A 1FT9A 1WI9A 3ZMTA 5E1WA 4HX4A 5ILSA 2GQQA 2W57A 1FNNA 4HV5A 3E5XA 3JAMZ 1HKQA 2ZO4A 2PJPA 2ISZA 4UXNA 4HX8A 4LGWA 4KYWA 5FGMA 1G6NA 1EV7A 1HKTA 2P6SA 5H6QA 2XUBA 3KEQA 3QAHA 2DK8A 3U1DA 2WWYA 1U6GA 3F22A 2J5PA 1WRJA 4B09A 3F8BA 4I7HA 5H20A 4ASNA 5LEJA 1RZ4A 1O3SA 1PUEE 4NQWA 3JAMK 3M1EA 1LDJA 2ISYA 2CWEA 1XN7A 2JRTA 4YIFA 2CGPA 1STZA 4MHGA 3GFLA 4IRHA 4ZZLA 4N9IA 5LHGA 2WV0A 1ZH5A 1DP7P 3HRSA 3GVAA 2JPBA 3MCZA 3KP7A 4P55A 3R60A 3EYYA 2PN6A 4WCGA 1O57A 2G7UA 1FSEA 2MLGA 2WTEA 1LDDA 2O61A 1R36A 5HDKA 3IHUA 2HS5A 2ADUA 1SMTA 3JTGA 1FZPB 3BJAA 3G73A 1W7PA 2MA3A 1U78A 3F8CA 4JQFA 3ULQB 4CGZA 3I71A 2RC4A 1USSA 4HA8A 5ERIA 2FBHA 1YS7A 3E6BA 3K9TA 1YQAA 4P5OA 2K27A 3U9GA 1W5TA 4G6DA 3RYPA 3TQNA 3RI4A 2Q0OA 4ESBA 1B9NA 4GYGA 2W25A 2VONA 1Z6TA 1R1TA 4EJVA 3GFMA 5HOOA 2OZ6A 3NRVA 4JK1X 2XIGA 1W5SA 4LG0B 4BHBA 2HGCA 4AIKA 1Z05A 2VBXA 2HEOA 3VFZA 1OR7A 1P4XA 3R6SA 2RV8A 3E6MA 5HLHA 3SZTA 3EQLF 4KN4X 1IXRC 1FWZA 3QPHA 5LHHA 3HHHA 1CF7B 4G6QA 3GYHX 1BM9A 1HW5A 4HW0A 5DUIA 2DPUA 1LNWA 5E8GA 4GCVA 2CSOA 1FY7A 5CYVA 3V4GA 3TDUC 4MNUA 1ZAOA 2M45A 1B4AA 2D2WA 2BYVE 1DPUA 2KJBA 3FM5A 1FBQA 1MZBA 4BH9A 4G7HF 2OQGA 4A6DA 1SAXA 5CLSA 3QPTA 4EJTA 4BQAA 2NNYA 3F8MA 3W6JB 1QGPA 2IP2A 4YFNF 2F5EA 2L4AA 2EJRA 4I0BA 1YO5C 1L3LA 3WE2A 2EFWA 4U0YA 3F21A 4M9ZA 4HF1A 3C1DA 1Z1DA 4AIJA 1YIOA 2E1CA 3E6CC 2A68F 2Z9OA 3J80Z 1J5YA 1XMAA 5LEKA 1XSDA 1XDSA 4A12A 2OA4A 1HQCA 1LEAA 2EB7A 2QZ8A 5TRDA 4YG2F 3WTYC 1YW7A 1IN6A 1HW1A 2KIMA 3J80K 1RUNA 1FP1D 1J2XA 1GHCA 1F9NA 2FNPA 1Z6RA 4ZYGA 5LBQA 3HOTA 1LB2A 1USTA 5E17F 1TTYA 1E2XA 3E3VA 5CVUA 4R79A 3WU0A 2L02A 4L5IA 3R0JA 2P5LC 3KE2A 4M9XA 3QRFF 2HKOA 3FM3A 2STTA 3HTSB 5BS6A 2XGXA 2JTVA 2JZYA 3HHGA 1P4WA 4ESJA 5FLXK 2KRFA 4HBLA 4ZYDA 3MQ0A 5HVQC 3RKWA 5D4RA 1KQ9A 4G7ZF 4Q4ZF 1VTNC 1O7LA 2LDUA 1T98A 5ILUA 1OKRA 3FMQA 3CO6C 3WODF 1LEBA 2HDCA 2VE8A 4HQEA 3P9IA 2ZKZA 3LQQA 2EK5A 2W24A 4D0PA 1XGSA 5L3FA 1ZYRF 3HSFA 2D45A 4HAMA 1D5VA 2CO5A 1ZG5A 1IN8A 4LLGF 4LD5A 2FE3A 4EGYA 3KEOA 1UHMA 1SFXA 3B73A 1EH7A 3ZQ7A 1B6AA 3RJPA 1XDUA 4UVAA 2O8XA 1R5GA 4LJZF 2L3DA 1EH8A 2P7VB 4MQ9F 5HDNA 3K69A 2R3SA 3LWFA 4A2UA 3SHFA 2EV6A 1HSJA 1ZGJA 3T0YA 2YSRA 3RPQA 2V1DA 2BEOA 2EV5A 5CJ9A 4Q48A 2O03A 4S05A 5E8IA 1TW2A 1PP7U 2H09A 3RKYA 2OU2A 2MLKA 3BY6A 5D5UB 2K7LA 4NB5A 4OOIA 1FYKA 5L3DA 4LG0A 4KDPA 2E7WA 1MJ9A 3U2RA 5D4SA 3JTHA 5D6EA 2EFQA 1Z91A 1JXSA 3GWZA 2KKOA 2E7XA 4IF4A 2M1BA 3HIFA 4XLPF 3BROA 3TOBA 3DP7A 5F64A 2LF7A 1CF7A 3WG9A 3V7SA 1YYVA 3G3ZA 2QVOA 2XAQA 3LAPA 5IT9K 4G9YA 1R23A 2K02A 2FU4A 5DV5A 1BC7C 4WWCA 3PQJA 4MTDA 3HUGA 2HYFA 3SFZA 2HWVA 2M30A 2ZFWA 3FMRA 2XAGA 1RIOH 5FD6A 1Z9CA 1T2KA 3GW2A 2A5YB 2VN2A 1KU2A 3QU6A 4CDGA 4KICA 3WTTC 1ZLKA 1TW3A 2M8EA 4M71A 2V6CA 1IAWA 2JT1A 4PCQA 4M72A 3FZVA 3BOQA 3VOEA 2EWNA 1X3UA 3EUHA 3I54A 2P8TA 2EFNA 2A6EF 4EMSA 1UB9A 4OMZA 3IL2A 4XSXF 3RIRA 2HTJA 5IT3A 2NRAC 3WTVC 4HF2A 4M6YA 4PDKA 3E5QA 2OQRA 3COAC 2O0YA 1IW7F 3GO5A 2DPDA 4A5MA 1HSTA 2BGCA 3VB2A 1S29A 3MEXA 4HYEA 1NHAA 3ZMDA 2AS5F 4LB5A 3RPUA 3KFWX 1K6OA 4MEXF 2PFBA 2KIUA 4IJAA 3TOAA 3L09A 1KQ0A 4RB1A 3C7JA 1KYZA 5JI6A 4I02A 4OU0A 1WQ2A 2WC2A 1S8NA 3HSRA 4A0YA 4EV0A 4BHPA 4OIRF 3MAJA 3SQNA 5ICEA 4L0YB 3M8FA 4RGXA 3P7NA 1XD7A 1I1SA 2IA0A 2GZWA 5DCMA 4PZJA 3ZN1A 2K86A 5FFZA 3TDZC 2L54A 1UHWA 4L9TA 2PLYA 4L9VA 4RS8A 1IN5A 4WK8F 4WX9A 3LSTA 5CVRA 4YFKF 3C3WA 2V9VA 4TV7A 2A6HF 5F1RA 3Q5FA 1ZGAA 1D3YA 1IXCA 1P6RA 3TO9A 3P9CA 1ZARA 3N4MA 1FYLA 3BJOA 5FFXA 3DV8A 4LB6B 1KU3A 1FPQA 3WTSC 1TNSA 2DTRA 2R7FA 4M6XA 2HQNA 1SMYF 2D1VA 1H0MA 3CUOA 2GA1A 3J81K 4XRFA 1ZREA 2Z3YA 3E97A 4A0ZA 1TQIA 2RGVA 1R7JA 4EJWA 3T1BA 4L5JA 4RAYA 1ZRFA 2JSCA 3GEZA 4CZZA 1S7AA 3I0TA 1TQPA 4QWQA 2GWRA 3MZYA 3F6VA 3KZYA 4GYIA 4XSZF 3ML6A 3JSOA 2HTSA 2EV0A 4ESFA 1IRFA 2UXNA 1FLIA 2QQ9A 1R5HA 1XGMA 3R4KA 3WTWC 2EA2A 2PG4A 1BBYA 5HLIA 1J9IA 2CFXA 2RDPA 5D5WB 3WU1B 3LA3A 1XB4A 1ZRDA 4G7OF 4IHTA 3H92A 1SD7A 1BJAA 3V8JA 1D8JA 4FX0A 2EFPA 1YW9A 3CDHA 4BYYA 1OYIA 3BDDA 4AIHA 2QUFA 2VBYA 4R1HA 2XAHA 4Y13A 5D6FA 3KLNA 1UFMA 5J8CA 2H6BA 3DF8A 1KA8A 3CUQC 4HLXA 1FBSA 1R00A 5HS9A 4L9NA 1XGNA 2IA1A 4I2OA 5D5XB 4KUMA 1LJ9A 2PQ8A 3FXQA 3L2CA 3VODA 2EA4A 3O2PE 2VC1A 3R0AA 4U88A 1B1BA 1OMIA 4KFCA 1J0RA 2PBIA 2PMUA 1XCVA 2IVMA 2B0LA 3REOA 1QBJA 3BWGA 4KMFA 5HDGA 4Y17A 2VC0A 1S6LA 4GXOA 1MDMB 1KU9A 2IJLA 1YTYA 5FB2A 1XGOA 4PGGA 4NHJA 1AWCA 1JHFA 3PQKA 5J6XA 3GXOA 2VT2A 1O3RA 2UZKA 2VOOA 2OAZA 2Y75A 5K5QA 3RKXA 4DNCA 3FXUA 1F4KA 1IXSB 2ESNA 1BC8C 2A61A 1QQIA 2VOPA 3ZP5A 2FXAA 2X0LA 1I1GA 4YFXF 3K0LA 5HS7A 1YFHA 3ISPA 1P4AA 1T6SA 4GO1A 2O6GE 2XAFA 3KZZA 4M74A 1OPCA 1Z7UA 4IXAA 4IVNA 4S04A 3KCCA 5FLXZ 1ONVA 5DCMB 1JGSA 2XHKA 5BPDA 1G3WA 1U3EM 1OYYA 1MJBA 1B9MA 2QLZA 4R8HA 2XASA 3Q9SA 2YX4A 1F5TA 4HZFA 2RKHA 5CVJA 1GXQA 3ECOA 2NNNA 1YLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E18 F;  2YR2 A;  4U0V A;  2QYO A;  2OD5 A;  1GVJ A;  1ZHF A;  2RNJ A;  2XVC A;  3E5U A;  4UVB A;  1A04 A;  3WTZ A;  2FQ3 A;  4ON0 A;  4AWX B;  3ZMZ A;  5ICF A;  3DPT A;  1WKM A;  3B02 A;  2COM A;  3TO6 A;  3I64 A;  1DDN A;  4IHS A;  1KYW A;  5AIP A;  1FBU A;  3GUD A;  6PAX A;  2M5W A;  1G3Y A;  2XV4 S;  2ACJ A;  4HF0 A;  3I53 A;  1WWX A;  2W84 A;  4MTE A;  5BPI A;  2STW A;  2PEX A;  4HV6 A;  3AAF A;  3V7R A;  2DI3 A;  1ZN2 A;  4KA4 A;  3HRM A;  3QP5 A;  2VBZ A;  2A69 F;  1T38 A;  2Y48 A;  5DCF A;  2XAJ A;  1J75 A;  2GIV A;  2VT3 A;  2F5C A;  5JR3 A;  1T0F A;  1Y0U A;  2G7H A;  3F23 A;  2QM3 A;  2Z33 A;  1UCR A;  2QQA A;  3KP6 A;  1S3J A;  1I6X A;  4LLL A;  2FML A;  4LLN A;  3C18 A;  3WTX C;  3W6K B;  1KU7 A;  5ICG A;  4IRI A;  2DU9 A;  1ULY A;  4U7D A;  2CG4 A;  1IN4 A;  3D5L A;  3BPX A;  3T8T A;  5BQT A;  3PFI A;  5IT9 Z;  1C0W A;  3NQO A;  1RNL A;  4LMY A;  1LQ1 A;  4HDU A;  1XSV A;  3OOP A;  5LRS A;  3H3Z A;  1U5T B;  4L9J A;  3ELK A;  3FMS A;  1U5T C;  3HRT A;  2VE9 A;  1K79 A;  1H9T A;  3BP8 A;  5ILV A;  3DXJ F;  4ENN A;  2G9W A;  5H6R A;  4MEY F;  2D1H A;  4A6E A;  1REP C;  3ERE D;  4I01 A;  1O3Q A;  5LGU A;  4O3M A;  1ZG1 A;  3L7W A;  2Y0M A;  5HLG A;  1BI3 A;  2F2E A;  2W85 A;  4MQV A;  1MDM A;  4ENM A;  1ZRC A;  4AVP A;  4MGR A;  4P9U A;  2K4B A;  4UVC A;  2PI0 A;  5K1Y A;  2FBK A;  2Q8K A;  2DLL A;  3HSE A;  4ZZD A;  1W7P D;  1U2W A;  4HOB A;  2V79 A;  2QBY B;  1TBX A;  1Q1H A;  4Q5S F;  3FX3 A;  2X4H A;  4O5V A;  4KNY A;  1R1V A;  2H94 A;  2GAU A;  5AIQ A;  4I0A A;  1OYW A;  3RYR A;  3F8N A;  1IF1 A;  4E70 A;  3RDI A;  2FRH A;  1LDK B;  2F5D A;  2IPQ X;  5EEG A;  3HTU A;  4BXU A;  3KP5 A;  5L3C A;  2DQL A;  3LA7 A;  1IRG A;  2FEZ A;  4UUV A;  1E17 A;  3H3U A;  5DD8 A;  4UV8 A;  1L0O C;  2ESH A;  2LNB A;  2LKP A;  1HXD A;  4ETS A;  5HS8 A;  2ELH A;  4B8X A;  5DD4 A;  1GXP A;  1K78 B;  3E6D A;  3J81 Z;  1J7K A;  5TJJ A;  1G3S A;  2XRN A;  2XKP A;  1LVA A;  5L3E A;  4WXC A;  5K5O A;  1ON1 A;  1BOA A;  5E20 A;  1MJA A;  2A3S A;  1PP8 F;  2HYG D;  2XKO A;  4JBA A;  3K2Z A;  3GFI A;  3HRU A;  5J8F A;  3KP2 A;  2P5K A;  3TKY A;  1QPM A;  1TQM A;  3RTR A;  4FHT A;  4F7Z A;  3KP4 A;  1KQ8 A;  4G94 A;  2ZME B;  3QU3 A;  1YS6 A;  4K2E A;  2RN7 A;  2RVC A;  2HZT A;  1HKS A;  1O3T A;  4HLY A;  1P92 A;  5JVT A;  2BBY A;  3WTU C;  4U7B A;  1BI1 A;  3WE3 A;  2NYX A;  1FSH A;  3MWM A;  1K7A A;  2DK5 A;  4P9F A;  5JHU A;  2GA2 A;  1SFE A;  5ED4 A;  5EEH A;  3O3K A;  3J7A O;  5D8K B;  3GLX A;  4OMY A;  2ZBK A;  4ZYE A;  3JSP A;  2CW0 F;  3F8F A;  2MD5 A;  3FHZ A;  1SD4 A;  5E1Z B;  2LF8 A;  4I09 A;  4CYD A;  3DFG A;  1XCB A;  2IT0 A;  2DBB A;  4OIO F;  4IRG A;  4BNC A;  3CLO A;  5A2Q Z;  2QQB A;  1J59 A;  4KIF A;  2DAO A;  3EYI A;  3ZMS A;  1S7O A;  2YPR A;  2C6Y A;  5LHI A;  3KLO A;  2E1N A;  5LLQ A;  5BMZ A;  2KIF A;  3IC7 A;  3CUQ B;  1QZY A;  5L3G A;  3QP6 A;  1FOK A;  4O6J A;  5KVR A;  5A2Q K;  1U5T A;  1R58 A;  4OIP F;  5D5V B;  2LSO A;  4OIN F;  4Y15 A;  4Z2Y A;  4LFU A;  1BI2 A;  5DDG A;  1V3F A;  3MFK A;  1BIA A;  2HQR A;  3LFK A;  1V4R A;  3K1P A;  3LAJ A;  3K1M A;  4OIQ F;  3D0S A;  1G4D A;  4XLN F;  2DW4 A;  4A5N A;  2MH2 A;  4WF2 A;  4ENJ A;  1BIB A;  4CO8 A;  2HFH A;  4G8X A;  3TO7 A;  5L3B A;  1YW8 A;  3IKT A;  2GXB A;  2FSW A;  1WSU A;  1SD5 A;  4UNO A;  3M7G A;  2QEN A;  3CTA A;  5K5R A;  2IA2 A;  3V8K A;  2FNA A;  4EM0 B;  3QOP A;  3VEP A;  4QLC U;  2YX7 A;  2DO7 A;  4Q47 A;  3I59 B;  1HBX G;  1QNT A;  4RB3 C;  4EGZ A;  1R1U A;  3TGN A;  3IRR A;  4WXH A;  3DPL C;  2OBP A;  1QO0 D;  3T5X A;  4RB0 A;  2QBY A;  3ZMV A;  3K1N A;  4HDV A;  5D8L B;  1ZLJ A;  3R61 A;  3LQR A;  2P6T A;  4L18 B;  2RQP A;  2FOK A;  2DQR A;  2DT5 A;  1I27 A;  1R22 A;  4PGH A;  3ZN0 A;  1FC3 A;  1BI0 A;  2L01 A;  3P9K A;  3KP3 A;  3F6O A;  3DQV C;  5FD5 A;  4H0E A;  2IRF G;  4HX7 A;  5CVV A;  4YII A;  2P4W A;  4XBF A;  4ZH4 F;  1PDN C;  4ZYH A;  3ABU A;  3KET A;  2P5V A;  4FT8 A;  4WXD A;  4N9H A;  1T39 A;  4N0B A;  2IW5 A;  3GX4 X;  2FF4 A;  4KMU X;  1IZ1 A;  4U0W A;  2HR3 A;  1DUX C;  3SZP A;  1I5Z A;  3F72 A;  2L4M A;  2ZJ2 A;  2UXX A;  3ABT A;  2Q2E A;  3DKW A;  1XSX A;  2R7D A;  5ICC A;  5F6F A;  3V8L A;  4FX4 A;  4P96 A;  4EVI A;  1K78 A;  5KK1 A;  3EET A;  1SD6 A;  3GFJ A;  3IWF A;  1FP2 A;  2BE5 F;  2DFI A;  2Z99 A;  5DYM A;  4BHC A;  3CO7 C;  2ZCW A;  4L0Z B;  3F3X A;  1QZZ A;  1W4M A;  1ZG3 A;  4DQ2 A;  3BJ6 A;  4KIB A;  2H6C A;  1H9G A;  2BV6 A;  2FA5 A;  2FBI A;  3WGI A;  3IWZ A;  3V7C A;  2KJC A;  4BAY A;  2NAZ A;  4ENK A;  2CYY A;  3I5U A;  3L9F A;  2ZME A;  5FO5 A;  4RGS A;  3LA2 A;  3HYI A;  2CQK A;  5DUK A;  2ETH A;  3FWE A;  1HW2 A;  2AXL A;  3GZ5 A;  4CHU A;  5LGN A;  1KGS A;  2FMY A;  5BOX A;  2VOD A;  3ROU A;  2UWM A;  1ODD A;  1W7P B;  3O6B B;  4UHT A;  3L00 A;  4EM2 A;  2H27 A;  2JPC A;  3FXR A;  1MD0 A;  3S2W A;  3ZPL A;  3Q9V A;  3I4P A;  2MBF A;  1YG2 A;  1SFU A;  2ZXJ A;  1IUY A;  3OV8 A;  2GXG A;  4RB2 C;  4KN7 X;  4GGG A;  2XRO A;  2F5F A;  2NS0 A;  1JE8 A;  3EDP A;  1D8K A;  4CXF A;  2OZU A;  3HOS A;  4LK1 F;  4EJO A;  4M73 A;  2YU3 A;  3CUQ A;  2K4J A;  4KT5 C;  3I58 A;  2ZNY A;  2M87 A;  1XMK A;  4EM1 A;  3MZH A;  4LK0 F;  2MC3 A;  1RI7 A;  4EJU A;  4RGR A;  2TDX A;  5LRR A;  2VXZ A;  3IRQ A;  5LGT A;  4A0X A;  3SXY A;  5DEQ A;  1IN7 A;  3CJN A;  1ON2 A;  4RAZ A;  2EFO A;  1DPR A;  2P7C B;  3N97 A;  3M8E A;  5JFR A;  1MKM A;  2ZNZ A;  5E1X A;  2A07 F;  1AOY A;  4AD9 A;  4EQQ A;  2HOE A;  3IKV A;  1CGP A;  4IPA A;  3BPV A;  2V1U A;  2V1X A;  4KIG A;  5AON A;  2HKX A;  3GF2 A;  1FX7 A;  3ECH A;  5CVI A;  4HQM A;  1O7F A;  2J5O A;  1JHH A;  1U8R A;  1P2F A;  1EH6 A;  3JW4 A;  1TLH B;  1B59 A;  2O3F A;  4CIC A;  3WGG A;  3DEU A;  3GZ6 A;  3I59 A;  2VBW A;  4M9S A;  1F1Z A;  1G3T A;  3M9A A;  3FF5 A;  3NEU A;  3BZ6 A;  1FYM A;  4I98 B;  1RUO A;  1MGT A;  2Z5U A;  3ZMU A;  1BN5 A;  2QWW A;  4RGU A;  2MH9 A;  3WGH A;  2PMH A;  1TNT A;  3T8R A;  4UV9 A;  1FT9 A;  1WI9 A;  3ZMT A;  5E1W A;  4HX4 A;  5ILS A;  2GQQ A;  2W57 A;  1FNN A;  4HV5 A;  3E5X A;  3JAM Z;  1HKQ A;  2ZO4 A;  2PJP A;  2ISZ A;  4UXN A;  4HX8 A;  4LGW A;  4KYW A;  5FGM A;  1G6N A;  1EV7 A;  1HKT A;  2P6S A;  5H6Q A;  2XUB A;  3KEQ A;  3QAH A;  2DK8 A;  3U1D A;  2WWY A;  1U6G A;  3F22 A;  2J5P A;  1WRJ A;  4B09 A;  3F8B A;  4I7H A;  5H20 A;  4ASN A;  5LEJ A;  1RZ4 A;  1O3S A;  1PUE E;  4NQW A;  3JAM K;  3M1E A;  1LDJ A;  2ISY A;  2CWE A;  1XN7 A;  2JRT A;  4YIF A;  2CGP A;  1STZ A;  4MHG A;  3GFL A;  4IRH A;  4ZZL A;  4N9I A;  5LHG A;  2WV0 A;  1ZH5 A;  1DP7 P;  3HRS A;  3GVA A;  2JPB A;  3MCZ A;  3KP7 A;  4P55 A;  3R60 A;  3EYY A;  2PN6 A;  4WCG A;  1O57 A;  2G7U A;  1FSE A;  2MLG A;  2WTE A;  1LDD A;  2O61 A;  1R36 A;  5HDK A;  3IHU A;  2HS5 A;  2ADU A;  1SMT A;  3JTG A;  1FZP B;  3BJA A;  3G73 A;  1W7P A;  2MA3 A;  1U78 A;  3F8C A;  4JQF A;  3ULQ B;  4CGZ A;  3I71 A;  2RC4 A;  1USS A;  4HA8 A;  5ERI A;  2FBH A;  1YS7 A;  3E6B A;  3K9T A;  1YQA A;  4P5O A;  2K27 A;  3U9G A;  1W5T A;  4G6D A;  3RYP A;  3TQN A;  3RI4 A;  2Q0O A;  4ESB A;  1B9N A;  4GYG A;  2W25 A;  2VON A;  1Z6T A;  1R1T A;  4EJV A;  3GFM A;  5HOO A;  2OZ6 A;  3NRV A;  4JK1 X;  2XIG A;  1W5S A;  4LG0 B;  4BHB A;  2HGC A;  4AIK A;  1Z05 A;  2VBX A;  2HEO A;  3VFZ A;  1OR7 A;  1P4X A;  3R6S A;  2RV8 A;  3E6M A;  5HLH A;  3SZT A;  3EQL F;  4KN4 X;  1IXR C;  1FWZ A;  3QPH A;  5LHH A;  3HHH A;  1CF7 B;  4G6Q A;  3GYH X;  1BM9 A;  1HW5 A;  4HW0 A;  5DUI A;  2DPU A;  1LNW A;  5E8G A;  4GCV A;  2CSO A;  1FY7 A;  5CYV A;  3V4G A;  3TDU C;  4MNU A;  1ZAO A;  2M45 A;  1B4A A;  2D2W A;  2BYV E;  1DPU A;  2KJB A;  3FM5 A;  1FBQ A;  1MZB A;  4BH9 A;  4G7H F;  2OQG A;  4A6D A;  1SAX A;  5CLS A;  3QPT A;  4EJT A;  4BQA A;  2NNY A;  3F8M A;  3W6J B;  1QGP A;  2IP2 A;  4YFN F;  2F5E A;  2L4A A;  2EJR A;  4I0B A;  1YO5 C;  1L3L A;  3WE2 A;  2EFW A;  4U0Y A;  3F21 A;  4M9Z A;  4HF1 A;  3C1D A;  1Z1D A;  4AIJ A;  1YIO A;  2E1C A;  3E6C C;  2A68 F;  2Z9O A;  3J80 Z;  1J5Y A;  1XMA A;  5LEK A;  1XSD A;  1XDS A;  4A12 A;  2OA4 A;  1HQC A;  1LEA A;  2EB7 A;  2QZ8 A;  5TRD A;  4YG2 F;  3WTY C;  1YW7 A;  1IN6 A;  1HW1 A;  2KIM A;  3J80 K;  1RUN A;  1FP1 D;  1J2X A;  1GHC A;  1F9N A;  2FNP A;  1Z6R A;  4ZYG A;  5LBQ A;  3HOT A;  1LB2 A;  1UST A;  5E17 F;  1TTY A;  1E2X A;  3E3V A;  5CVU A;  4R79 A;  3WU0 A;  2L02 A;  4L5I A;  3R0J A;  2P5L C;  3KE2 A;  4M9X A;  3QRF F;  2HKO A;  3FM3 A;  2STT A;  3HTS B;  5BS6 A;  2XGX A;  2JTV A;  2JZY A;  3HHG A;  1P4W A;  4ESJ A;  5FLX K;  2KRF A;  4HBL A;  4ZYD A;  3MQ0 A;  5HVQ C;  3RKW A;  5D4R A;  1KQ9 A;  4G7Z F;  4Q4Z F;  1VTN C;  1O7L A;  2LDU A;  1T98 A;  5ILU A;  1OKR A;  3FMQ A;  3CO6 C;  3WOD F;  1LEB A;  2HDC A;  2VE8 A;  4HQE A;  3P9I A;  2ZKZ A;  3LQQ A;  2EK5 A;  2W24 A;  4D0P A;  1XGS A;  5L3F A;  1ZYR F;  3HSF A;  2D45 A;  4HAM A;  1D5V A;  2CO5 A;  1ZG5 A;  1IN8 A;  4LLG F;  4LD5 A;  2FE3 A;  4EGY A;  3KEO A;  1UHM A;  1SFX A;  3B73 A;  1EH7 A;  3ZQ7 A;  1B6A A;  3RJP A;  1XDU A;  4UVA A;  2O8X A;  1R5G A;  4LJZ F;  2L3D A;  1EH8 A;  2P7V B;  4MQ9 F;  5HDN A;  3K69 A;  2R3S A;  3LWF A;  4A2U A;  3SHF A;  2EV6 A;  1HSJ A;  1ZGJ A;  3T0Y A;  2YSR A;  3RPQ A;  2V1D A;  2BEO A;  2EV5 A;  5CJ9 A;  4Q48 A;  2O03 A;  4S05 A;  5E8I A;  1TW2 A;  1PP7 U;  2H09 A;  3RKY A;  2OU2 A;  2MLK A;  3BY6 A;  5D5U B;  2K7L A;  4NB5 A;  4OOI A;  1FYK A;  5L3D A;  4LG0 A;  4KDP A;  2E7W A;  1MJ9 A;  3U2R A;  5D4S A;  3JTH A;  5D6E A;  2EFQ A;  1Z91 A;  1JXS A;  3GWZ A;  2KKO A;  2E7X A;  4IF4 A;  2M1B A;  3HIF A;  4XLP F;  3BRO A;  3TOB A;  3DP7 A;  5F64 A;  2LF7 A;  1CF7 A;  3WG9 A;  3V7S A;  1YYV A;  3G3Z A;  2QVO A;  2XAQ A;  3LAP A;  5IT9 K;  4G9Y A;  1R23 A;  2K02 A;  2FU4 A;  5DV5 A;  1BC7 C;  4WWC A;  3PQJ A;  4MTD A;  3HUG A;  2HYF A;  3SFZ A;  2HWV A;  2M30 A;  2ZFW A;  3FMR A;  2XAG A;  1RIO H;  5FD6 A;  1Z9C A;  1T2K A;  3GW2 A;  2A5Y B;  2VN2 A;  1KU2 A;  3QU6 A;  4CDG A;  4KIC A;  3WTT C;  1ZLK A;  1TW3 A;  2M8E A;  4M71 A;  2V6C A;  1IAW A;  2JT1 A;  4PCQ A;  4M72 A;  3FZV A;  3BOQ A;  3VOE A;  2EWN A;  1X3U A;  3EUH A;  3I54 A;  2P8T A;  2EFN A;  2A6E F;  4EMS A;  1UB9 A;  4OMZ A;  3IL2 A;  4XSX F;  3RIR A;  2HTJ A;  5IT3 A;  2NRA C;  3WTV C;  4HF2 A;  4M6Y A;  4PDK A;  3E5Q A;  2OQR A;  3COA C;  2O0Y A;  1IW7 F;  3GO5 A;  2DPD A;  4A5M A;  1HST A;  2BGC A;  3VB2 A;  1S29 A;  3MEX A;  4HYE A;  1NHA A;  3ZMD A;  2AS5 F;  4LB5 A;  3RPU A;  3KFW X;  1K6O A;  4MEX F;  2PFB A;  2KIU A;  4IJA A;  3TOA A;  3L09 A;  1KQ0 A;  4RB1 A;  3C7J A;  1KYZ A;  5JI6 A;  4I02 A;  4OU0 A;  1WQ2 A;  2WC2 A;  1S8N A;  3HSR A;  4A0Y A;  4EV0 A;  4BHP A;  4OIR F;  3MAJ A;  3SQN A;  5ICE A;  4L0Y B;  3M8F A;  4RGX A;  3P7N A;  1XD7 A;  1I1S A;  2IA0 A;  2GZW A;  5DCM A;  4PZJ A;  3ZN1 A;  2K86 A;  5FFZ A;  3TDZ C;  2L54 A;  1UHW A;  4L9T A;  2PLY A;  4L9V A;  4RS8 A;  1IN5 A;  4WK8 F;  4WX9 A;  3LST A;  5CVR A;  4YFK F;  3C3W A;  2V9V A;  4TV7 A;  2A6H F;  5F1R A;  3Q5F A;  1ZGA A;  1D3Y A;  1IXC A;  1P6R A;  3TO9 A;  3P9C A;  1ZAR A;  3N4M A;  1FYL A;  3BJO A;  5FFX A;  3DV8 A;  4LB6 B;  1KU3 A;  1FPQ A;  3WTS C;  1TNS A;  2DTR A;  2R7F A;  4M6X A;  2HQN A;  1SMY F;  2D1V A;  1H0M A;  3CUO A;  2GA1 A;  3J81 K;  4XRF A;  1ZRE A;  2Z3Y A;  3E97 A;  4A0Z A;  1TQI A;  2RGV A;  1R7J A;  4EJW A;  3T1B A;  4L5J A;  4RAY A;  1ZRF A;  2JSC A;  3GEZ A;  4CZZ A;  1S7A A;  3I0T A;  1TQP A;  4QWQ A;  2GWR A;  3MZY A;  3F6V A;  3KZY A;  4GYI A;  4XSZ F;  3ML6 A;  3JSO A;  2HTS A;  2EV0 A;  4ESF A;  1IRF A;  2UXN A;  1FLI A;  2QQ9 A;  1R5H A;  1XGM A;  3R4K A;  3WTW C;  2EA2 A;  2PG4 A;  1BBY A;  5HLI A;  1J9I A;  2CFX A;  2RDP A;  5D5W B;  3WU1 B;  3LA3 A;  1XB4 A;  1ZRD A;  4G7O F;  4IHT A;  3H92 A;  1SD7 A;  1BJA A;  3V8J A;  1D8J A;  4FX0 A;  2EFP A;  1YW9 A;  3CDH A;  4BYY A;  1OYI A;  3BDD A;  4AIH A;  2QUF A;  2VBY A;  4R1H A;  2XAH A;  4Y13 A;  5D6F A;  3KLN A;  1UFM A;  5J8C A;  2H6B A;  3DF8 A;  1KA8 A;  3CUQ C;  4HLX A;  1FBS A;  1R00 A;  5HS9 A;  4L9N A;  1XGN A;  2IA1 A;  4I2O A;  5D5X B;  4KUM A;  1LJ9 A;  2PQ8 A;  3FXQ A;  3L2C A;  3VOD A;  2EA4 A;  3O2P E;  2VC1 A;  3R0A A;  4U88 A;  1B1B A;  1OMI A;  4KFC A;  1J0R A;  2PBI A;  2PMU A;  1XCV A;  2IVM A;  2B0L A;  3REO A;  1QBJ A;  3BWG A;  4KMF A;  5HDG A;  4Y17 A;  2VC0 A;  1S6L A;  4GXO A;  1MDM B;  1KU9 A;  2IJL A;  1YTY A;  5FB2 A;  1XGO A;  4PGG A;  4NHJ A;  1AWC A;  1JHF A;  3PQK A;  5J6X A;  3GXO A;  2VT2 A;  1O3R A;  2UZK A;  2VOO A;  2OAZ A;  2Y75 A;  5K5Q A;  3RKX A;  4DNC A;  3FXU A;  1F4K A;  1IXS B;  2ESN A;  1BC8 C;  2A61 A;  1QQI A;  2VOP A;  3ZP5 A;  2FXA A;  2X0L A;  1I1G A;  4YFX F;  3K0L A;  5HS7 A;  1YFH A;  3ISP A;  1P4A A;  1T6S A;  4GO1 A;  2O6G E;  2XAF A;  3KZZ A;  4M74 A;  1OPC A;  1Z7U A;  4IXA A;  4IVN A;  4S04 A;  3KCC A;  5FLX Z;  1ONV A;  5DCM B;  1JGS A;  2XHK A;  5BPD A;  1G3W A;  1U3E M;  1OYY A;  1MJB A;  1B9M A;  2QLZ A;  4R8H A;  2XAS A;  3Q9S A;  2YX4 A;  1F5T A;  4HZF A;  2RKH A;  5CVJ A;  1GXQ A;  3ECO A;  2NNN A;  1YLF A; 
#chains in the Genus database with same CATH topology
 5E18 F;  2YR2 A;  3FK7 A;  3CC4 I;  2CW7 A;  4U0V A;  2QYO A;  2OD5 A;  4DYQ A;  2EBI A;  2O8K A;  1GVJ A;  1ZHF A;  2RNJ A;  2XVC A;  3H9G A;  3E5U A;  4A3G J;  4EEF G;  4CCM A;  5E79 C;  4UVB A;  3ZXS A;  1A04 A;  3WTZ A;  1MMS A;  2FQ3 A;  4FAS D;  2JSP A;  4NC8 A;  4ON0 A;  2DMU A;  3DTE A;  4AWX B;  4XLA A;  1SVM A;  3ZMZ A;  3CJT B;  5ICF A;  3E7L A;  3DPT A;  1WKM A;  1WCM J;  2LRD A;  3CCQ I;  3B02 A;  2COM A;  4QPQ A;  4D7N A;  5FKL A;  3TO6 A;  3I64 A;  1S7E A;  1TWG J;  4NC6 A;  3ZQC A;  3CQZ J;  2M7A A;  1DDN A;  1Z0X A;  2E60 A;  2E1M C;  4IHS A;  1KYW A;  2R4G A;  1Z3X A;  1LKX A;  2E34 A;  5AIP A;  1FBU A;  1OCR H;  3OWT A;  3GUD A;  2DYS H;  6PAX A;  3S15 J;  2M5W A;  1WPK A;  4FET A;  1D0Z A;  1G3Y A;  2XV4 S;  2ACJ A;  4HF0 A;  3I53 A;  1WWX A;  2VAS A;  3OYE A;  2W84 A;  4MTE A;  5BPI A;  2STW A;  2PEX A;  2DFF A;  4HV6 A;  2Y9Y A;  3AAF A;  2KHM A;  3OSF A;  3V7R A;  2DI3 A;  1ZN2 A;  2LC2 A;  4KA4 A;  3HRM A;  1MBK A;  2P81 A;  2VKD A;  3QP5 A;  3S2H J;  2VBZ A;  2A69 F;  5EG0 A;  4II2 A;  4XN0 A;  4ZDP A;  3ESW B;  1T38 A;  3ZQI A;  1NG6 A;  1I50 J;  2Y48 A;  1ERD A;  1FOX A;  5DCF A;  4Y4R A;  2XAJ A;  1PUF B;  2I10 A;  2DA5 A;  5K7F A;  1J75 A;  2GIV A;  2VT3 A;  4XLE A;  2F5C A;  1T0F A;  5JR3 A;  1Y0U A;  2G7H A;  3F23 A;  2DOE A;  3KZI C;  2QM3 A;  2Z33 A;  2QKL B;  3GTO J;  5E3N A;  2WAF A;  5EGO A;  4IOC F;  1UMQ A;  5E3L A;  1UCR A;  2RNG A;  4A3E J;  1MBH A;  2QQA A;  3BCB A;  3KP6 A;  1S3J A;  1I6X A;  3MKL A;  2LH9 A;  5F1J A;  5C3E J;  4ZDO A;  4JX4 A;  4LLL A;  2FML A;  4LLN A;  3C18 A;  3WTX C;  3W6K B;  4JX5 A;  1KU7 A;  1HF0 A;  4IOA F;  2AQE A;  5ICG A;  4IRI A;  2DU9 A;  1I39 A;  3BZK A;  1ULY A;  3OR2 C;  4U7D A;  2CG4 A;  1IN4 A;  3D5L A;  1XX5 A;  2LLK A;  2JMW A;  3BPX A;  3T8T A;  5BQT A;  3JRB A;  3CCM I;  3IH4 A;  3PFI A;  5IT9 Z;  2O9L A;  1C0W A;  2RQQ A;  3ZQH A;  2BXY A;  5DS9 A;  3JR9 A;  3LFU A;  1FMV A;  3NQO A;  1RNL A;  3DTI A;  1GVD A;  4CCJ A;  3BR3 A;  4ZC3 A;  4LMY A;  1LQ1 A;  4HDU A;  1XSV A;  3OOP A;  5LRS A;  3H3Z A;  1U5T B;  1GV5 A;  4L9J A;  3CP8 A;  5GAH J;  4C2M J;  3ELK A;  3A02 A;  1U5T C;  3FMS A;  2P0W A;  3HRT A;  2QA4 I;  2HDD A;  2VE9 A;  1MMN A;  1WJF A;  3BR6 A;  2R7Z J;  1K79 A;  1H9T A;  3BP8 A;  5LFA A;  1BW6 A;  2MFZ A;  1AKH A;  2OJE D;  5ILV A;  3CF5 F;  3CCR I;  3I56 I;  5DM6 F;  4XLH A;  3N05 A;  3DXJ F;  1FOY A;  3A01 B;  3CCU I;  4ENN A;  2G9W A;  5H6R A;  1B72 A;  2QCO A;  4MEY F;  2D1H A;  4A6E A;  1REP C;  3ERE D;  5FKK A;  2QSH X;  4BUP A;  4I01 A;  1O3Q A;  5LGU A;  1S72 I;  4O3M A;  1ZG1 A;  4AUX A;  2AQF A;  2HPM A;  1WJA A;  3L7W A;  2Y0M A;  5HLG A;  3OYM A;  1VQ9 I;  1BI3 A;  2EZL A;  4RBO A;  3LSI A;  3HBL A;  2KDZ A;  2E2J J;  2F2E A;  2W85 A;  4MQV A;  4ZTJ A;  2X6X A;  4BQQ A;  1MDM A;  4ENM A;  1ZRC A;  4AVP A;  4MGR A;  3ZOB A;  4P9U A;  3I55 I;  1SVO A;  1T56 A;  2R7X A;  1JKQ C;  5CKT A;  1IC8 A;  4CCL A;  2QEX I;  2Y0S A;  2K4B A;  4UVC A;  3KIO A;  2PI0 A;  5K1Y A;  3RSN A;  2FBK A;  2Q8K A;  1UG2 A;  2DLL A;  3GTK J;  3HSE A;  1YIJ I;  4ZZD A;  1W7P D;  1WFX A;  2GM4 A;  3AFH A;  4A3L J;  1U2W A;  4OAZ A;  2IGN A;  4HOB A;  4PSW A;  2LKX A;  4IQJ A;  2V79 A;  2VJ5 A;  2QBY B;  1YRN B;  2Y2Z A;  1TBX A;  2E35 A;  3AG2 H;  3DEW A;  1Q1H A;  4Q5S F;  1ORK A;  3FX3 A;  2X4H A;  4O5V A;  2GLO A;  1R1V A;  4KNY A;  3S1R J;  4G6T B;  2AXT C;  2H94 A;  2XGC A;  2GAU A;  2ZFU A;  5AIQ A;  4IHV A;  4I0A A;  1OYW A;  1ZEL A;  2R7U A;  3RYR A;  1FJL A;  4PUS A;  3F8N A;  1IF1 A;  4E70 A;  2JUG A;  1TP4 A;  3ABM H;  4IHX A;  3RDI A;  2Y69 H;  2KRH A;  2JVG A;  2DOF A;  2CQN A;  2FRH A;  1LDK B;  1ZGW A;  1IO2 A;  2F5D A;  2Y0S N;  3S16 J;  1FTT A;  2K9S A;  2IPQ X;  4M3B A;  5EDN A;  2K3F A;  5EEG A;  3HTU A;  4BXU A;  2BW3 A;  3KP5 A;  5L3C A;  2DQL A;  3OYF A;  3LA7 A;  4B3X A;  4AM3 A;  1T95 A;  1IRG A;  2FEZ A;  4UUV A;  4F3Q A;  1V54 H;  2R5Z B;  2PJR B;  3L2W A;  1E17 A;  2FOW A;  3H3U A;  4XNF A;  2Q2E B;  4PSX A;  5DD8 A;  1HOM A;  4UV8 A;  4RLF A;  1L0O C;  2ESH A;  1JJ6 C;  2LNB A;  2D5V A;  2LKP A;  1HXD A;  3LSG A;  4ETS A;  5HS8 A;  4A3K J;  2ELH A;  3CME I;  4BY1 J;  4B8X A;  3PO3 J;  5DD4 A;  2VJJ A;  1GXP A;  1YOV B;  5K7H A;  1K78 B;  3ASN H;  1YX5 A;  1AHD P;  2HVQ A;  3E6D A;  4BBR J;  3J81 Z;  2M2E A;  1J7K A;  5TJJ A;  2HQ5 A;  1ZTR A;  2WAD A;  4ANJ A;  1G3S A;  2XRN A;  2R7W A;  1GT0 C;  2XKP A;  1LVA A;  2X1E A;  4WXC A;  5L3E A;  5K5O A;  1ON1 A;  1MBF A;  1R4M B;  1Y8Q B;  1BOA A;  5E20 A;  1MJA A;  1WJD A;  2A3S A;  1PP8 F;  2HYG D;  2XKO A;  4JBA A;  3K2Z A;  3AG1 H;  3GFI A;  3HRU A;  5J8F A;  4GDF A;  2WAQ A;  3KP2 A;  1X1B A;  3U21 A;  4E7S A;  2P5K A;  3L2R A;  1VQP I;  3TKY A;  1QPM A;  1QRY A;  1TQM A;  3RTR A;  4FHT A;  4F7Z A;  1K61 A;  4CCK A;  2EZH A;  3KP4 A;  1KQ8 A;  3MVP A;  2MAB A;  1J09 A;  4G94 A;  2ZME B;  3QU3 A;  4JYK A;  4ABZ A;  1YS6 A;  2ZME C;  1A5J A;  2R93 J;  5F0H A;  4K2E A;  2RN7 A;  2VIX A;  2RVC A;  5IYD J;  3QYB A;  2RRE A;  3CC2 I;  2VXD A;  5E3O A;  2VKV A;  3DBH B;  1Y56 A;  2HZT A;  3SJM A;  1HKS A;  2R5Y B;  1H89 C;  1O3T A;  1VQK I;  4HLY A;  1P92 A;  5JVT A;  2BBY A;  1G59 A;  2CFO A;  2ZXI A;  3WTU C;  1HDP A;  4U7B A;  4BY7 J;  2KIS A;  1JTY A;  1BI1 A;  2R7S A;  2F48 A;  3WE3 A;  2NYX A;  1FSH A;  2VPR A;  3MWM A;  2DK5 A;  1K7A A;  4P9F A;  5JHU A;  2GA2 A;  1SFE A;  1OFC X;  2XPV A;  2K3P A;  2HXO A;  3BG9 A;  5ED4 A;  3IAM 2;  2WAQ N;  2JN6 A;  5EEH A;  4AID A;  1Z7L A;  3O3K A;  2KQR A;  1LVK A;  4ZTF A;  3J7A O;  5D8K B;  5F0F A;  3GLX A;  4OMY A;  4F93 B;  2NVY J;  2ZBK A;  1QHG A;  1PUF A;  2FX0 A;  2CUJ A;  4IL6 C;  3HC7 A;  4ZYE A;  3B6A A;  3JSP A;  2CW0 F;  3I9V 2;  3M8J A;  4YEJ A;  1E3O C;  3FXL A;  3F8F A;  2F6C A;  4HNU A;  2R7Q A;  3BTL A;  1WH5 A;  2MD5 A;  4DOZ A;  1SAN A;  3FHZ A;  4E7K A;  4BQN A;  5GPA A;  2IS1 A;  3SEZ A;  1SD4 A;  5E1Z B;  1YHQ I;  2LF8 A;  2DJN A;  3HKZ N;  4I09 A;  4CYD A;  3DFG A;  3CCV I;  2YU9 J;  5J1U A;  2DFH A;  1XCB A;  5FLM J;  1X2M A;  2ICW G;  2IT0 A;  4MIM A;  2DBB A;  3HOY J;  4OIO F;  4IRG A;  4AYB A;  4BNC A;  3JRA A;  3CLO A;  5A2Q Z;  2QQB A;  1TT0 A;  2WAE A;  3JRC A;  4KIF A;  1TWF J;  2DAO A;  1J59 A;  2CW8 A;  4UUT A;  3ZMS A;  3EYI A;  1W1W E;  1S7O A;  2YPR A;  4XN3 A;  2HOT A;  2DA1 A;  2C6Y A;  5LHI A;  3KLO A;  2E1N A;  5LLQ A;  5BMZ A;  2KIF A;  3PO2 J;  5CQE A;  3IAS 2;  3IC7 A;  4UY8 I;  3CUQ B;  3CCJ I;  1QZY A;  5L3G A;  1MNM C;  3H5N A;  3QP6 A;  1FOK A;  4O6J A;  3S1M J;  2ME6 A;  5KVR A;  1AU7 A;  5A2Q K;  1U5T A;  2CMP A;  2IEK A;  2F5V A;  1R58 A;  4OIP F;  5D5V B;  2LSO A;  3W6V A;  3KYD B;  4OIN F;  4Y15 A;  4Z2Y A;  3OOU A;  4LFU A;  3AL0 C;  1ITY A;  4PK4 A;  1BA5 A;  2M4G A;  1BI2 A;  5DDG A;  1V3F A;  3MFK A;  1BIA A;  2HQR A;  3LFK A;  2HZD A;  3C2H A;  1V4R A;  4F91 B;  3K1P A;  3LAJ A;  3K1M A;  4OIQ F;  3D0S A;  4JP0 A;  4U87 A;  2KIQ A;  2ECB A;  1G4D A;  3CES A;  1GLN A;  4XLN F;  2DW4 A;  4GRI A;  2HQA A;  1W36 D;  4A5N A;  2MH2 A;  4WF2 A;  5C4X J;  2X1C A;  4ENJ A;  1BIB A;  3LSH A;  4CO8 A;  3A01 A;  2PMZ A;  2WB1 N;  2K5C A;  1MMG A;  4F52 A;  1RC9 A;  2HFH A;  4G8X A;  3OYG A;  3G6E I;  3TO7 A;  2ELK A;  2X85 A;  3RQI A;  5L3B A;  1YW8 A;  3J7Y J;  3K6G A;  2R7R A;  4L5E A;  4OWR B;  3Q0W A;  2QSF X;  3IKT A;  2UUZ A;  2V1N A;  3ZQQ A;  3OYA A;  1VQM I;  2GXB A;  2FSW A;  4E7J A;  1WSU A;  1SD5 A;  4UNO A;  3M7G A;  2QEN A;  1MW7 A;  3CTA A;  1LFU P;  5K5R A;  2IA2 A;  4IHW A;  5EZH A;  4RA2 A;  3V8K A;  3HOX J;  2FNA A;  1UZC A;  3QOP A;  4EM0 B;  3UKG A;  2F4M B;  1VI0 A;  3S1Q J;  2CH0 A;  2A05 A;  3VEP A;  1OCC H;  4NDL A;  4QLC U;  2YX7 A;  2DO7 A;  4Q47 A;  3I59 B;  1HBX G;  5E3M A;  1QNT A;  4RB3 C;  4EGZ A;  1KZH A;  5GTH C;  1JUP A;  1R1U A;  3TGN A;  4QIW N;  3IRR A;  4WXH A;  3DPL C;  2OBP A;  3GLL A;  4V19 K;  1E3P A;  1QO0 D;  2EIN H;  4D5C A;  3T5X A;  3G1L A;  3EUH C;  2X6O A;  4RB0 A;  3S8P A;  3ZMV A;  4RMN A;  2V9K A;  1YRN A;  3K1N A;  4HDV A;  2QBY A;  5D8L B;  1ZLJ A;  3R61 A;  3LQR A;  4YEL A;  2P6T A;  4L18 B;  2JA6 J;  2RQP A;  4XOR A;  2L5Q A;  2FOK A;  2DQR A;  2DT5 A;  1I27 A;  1R22 A;  4FE7 A;  4PGH A;  3ZN0 A;  1FC3 A;  1BI0 A;  2AHQ A;  2EIJ H;  2L01 A;  3P9K A;  3KP3 A;  3F6O A;  5K7Z A;  3DQV C;  5FD5 A;  1RKT A;  2GIZ A;  4H0E A;  2IRF G;  4A3B J;  2CUE A;  2COB A;  4HX7 A;  5TGT A;  5CVV A;  4YII A;  1VQ8 I;  2P4W A;  3GTQ J;  4XBF A;  4ZH4 F;  3SDB A;  2JQ7 A;  1PDN C;  4ZYH A;  3ABU A;  3A2K A;  4RLQ A;  3KET A;  2P5V A;  3IH2 A;  4FT8 A;  3PIP F;  4WXD A;  4N9H A;  3QOE A;  2H1L A;  2HOA A;  1T39 A;  1ETO A;  3DWL E;  2HU9 A;  4N0B A;  2IW5 A;  3GX4 X;  2FF4 A;  1Y8R B;  1IZ1 A;  2FJ1 A;  2HR3 A;  2NS7 A;  3BTC A;  4KMU X;  3HPG A;  4U0W A;  1I5Z A;  2XGE A;  3SZP A;  3NWT A;  1DUX C;  3F72 A;  3UR3 C;  2R5Z A;  2L4M A;  2ZJ2 A;  2PJR A;  4XM3 A;  2UXX A;  3ABT A;  2Q2E A;  4BU2 A;  3DKW A;  2JA5 J;  3CJQ B;  2M3A A;  1QVU A;  5B1A H;  1XSX A;  3TW6 A;  1ETK A;  2R7D A;  1X58 A;  5ICC A;  1MSF C;  5F6F A;  3V8L A;  4DYC A;  4FX4 A;  2K9M A;  1BR1 A;  2OCC H;  4P96 A;  1IJW C;  4EVI A;  1VZ0 A;  2DA2 A;  5KK1 A;  1K78 A;  4NQW B;  3EET A;  1SD6 A;  1DGR M;  4XK4 A;  3AG3 H;  3GFJ A;  3IWF A;  4HST A;  1W0U A;  1FP2 A;  2BE5 F;  2DFI A;  2Z99 A;  5DYM A;  4BHC A;  4HNV A;  4IZZ A;  3CO7 C;  2ZCW A;  4L0Z B;  3F3X A;  1QZZ A;  1UAA A;  3K4J A;  1W4M A;  1ZG3 A;  1OCP A;  4XLC A;  4DQ2 A;  3BJ6 A;  4KIB A;  2H6C A;  1H9G A;  4XKV A;  2BV6 A;  2FA5 A;  2FBI A;  3BQZ A;  3GTG J;  1PJR A;  3WGI A;  3IWZ A;  1Y6I A;  1VQO I;  3V7C A;  2KJC A;  3HGG A;  3ZGK A;  4BAY A;  2NAZ A;  1ENH A;  1SC7 A;  2XF5 A;  1XTA A;  2E1M B;  2V9P A;  4I6Z A;  1DQU A;  1D0Y A;  2W82 A;  3DU6 A;  2CYY A;  4M3E A;  4ENK A;  3I5U A;  1D1C A;  3KYC B;  3VSL A;  3L9F A;  4W1U A;  2ZME A;  3SYT A;  5FO5 A;  3NAU A;  4RGS A;  2JRM A;  3LA2 A;  4HPQ A;  3HYI A;  3S32 A;  1NG7 A;  1I3Q J;  1FIA A;  2CQK A;  2M8G X;  5DUK A;  2ETH A;  1ZR2 A;  3FWE A;  1HW2 A;  2ZB9 A;  2R5Y A;  2LD5 A;  1IUF A;  3CZ6 A;  2AXL A;  3GZ5 A;  2ZSI B;  2RAE A;  2MSY A;  4CHU A;  5LGN A;  1KGS A;  3PIO F;  2XGD A;  2FMY A;  5LD2 C;  4HSR A;  5BOX A;  4ITV A;  5FKO A;  2HPI A;  3CC7 I;  1SEU A;  2VOD A;  3ROU A;  4Y7N J;  1EF4 A;  4PJM A;  2UWM A;  3PSI A;  1ODD A;  1D0X A;  4F55 A;  1W7P B;  2DA4 A;  3S3N A;  3O6B B;  4UHT A;  3L00 A;  4EM2 A;  2H27 A;  1SFO J;  3LMM A;  4M3D A;  4LIU A;  3FIW A;  1MH4 A;  3LSJ A;  2JPC A;  3IUO A;  3FXR A;  1MD0 A;  3S2W A;  3ZPL A;  1R9T J;  2QSG X;  3K4L A;  3Q9V A;  3RPU D;  2W4S A;  3I4P A;  1K4T A;  2MBF A;  3J7Z I;  3OYK A;  3HOZ J;  1X4P A;  1YG2 A;  2LR8 A;  1TWA J;  2DA3 A;  3K70 D;  3BG3 A;  2JA2 A;  1SFU A;  2ZXJ A;  1IUY A;  3IV5 A;  3OV8 A;  2GXG A;  4RB2 C;  2YS9 A;  4KN7 X;  4GGG A;  2WY7 Q;  2XRO A;  4NNJ A;  2F5F A;  2LVS A;  2NS0 A;  3JRI A;  1JE8 A;  4BBS J;  1ETY A;  3EDP A;  2LY1 A;  4A3F J;  1E3H A;  2O5R A;  2GOX B;  1D8K A;  4CXF A;  2OZU A;  3HOS A;  2ZSH B;  3FBN B;  2KT0 A;  4LK1 F;  3PUB A;  3K4N A;  2DJI A;  4EJO A;  3PFY A;  2WY8 Q;  1Q1V A;  5F0C A;  4M73 A;  3VYU B;  4B1R A;  2YU3 A;  3CUQ A;  2IS2 A;  3EUA A;  2K4J A;  3LOC A;  4KT5 C;  4B44 A;  3I58 A;  2ZNY A;  2M87 A;  1OR7 C;  1EA3 A;  2BY2 A;  1XMK A;  4LOC A;  5TIS C;  4EM1 A;  1P9Q C;  4PJ0 C;  3MZH A;  4LK0 F;  2MC3 A;  1RI7 A;  2I5U A;  2KZG A;  4FE4 A;  2BVM A;  4EJU A;  2XF7 A;  2TDX A;  4RGR A;  5LRR A;  4HNT A;  2R7T A;  2VXZ A;  3IRQ A;  5C4J J;  5LGT A;  2JWT A;  1YJN I;  4A0X A;  5B3S H;  2O7O A;  3SXY A;  5DEQ A;  1IN7 A;  3CJN A;  2L9R A;  3LSM A;  3K2A A;  5F27 A;  3LSR A;  1ON2 A;  1WJE A;  4RAZ A;  3FDY A;  1UHS A;  3PNT A;  2EFO A;  2ZXW H;  1DPR A;  1GV2 A;  2P7C B;  2L7K A;  3M8E A;  3JRH A;  2WBM A;  5JFR A;  3N97 A;  1MKM A;  4X6A J;  2ZNZ A;  5E1X A;  2A07 F;  2NVX J;  1AOY A;  2CUF A;  2IXS A;  3PM1 A;  4AD9 A;  4EQQ A;  1X1A A;  2W7N A;  1YIT I;  2VPL A;  2HOE A;  3IKV A;  1CGP A;  4IPA A;  3BPV A;  2V1U A;  3MD2 A;  1Z67 A;  4II3 A;  2V1X A;  2IBD A;  3CCL I;  4OAY A;  4KIG A;  2KPM A;  3A0B C;  3E1S A;  5AON A;  2HKX A;  4V2G A;  1TL8 A;  3GF2 A;  1P7I A;  1NK3 P;  3GTL J;  1FX7 A;  2B9S A;  3ECH A;  3AG4 H;  4B47 A;  3OL3 A;  5CVI A;  4HQM A;  4A69 C;  1O7F A;  2XRL A;  2KMU A;  2J5O A;  3OS2 A;  1JHH A;  4IQ4 A;  2OPT A;  1U8R A;  3HOV J;  1ETQ A;  1P2F A;  1TWH J;  3H36 A;  3SFI A;  1EH6 A;  3Q0V A;  3JW4 A;  2CQX A;  1TLH B;  3BG5 A;  2O3F A;  1B59 A;  1RPW A;  3BC8 A;  3IH3 A;  2X6Y A;  1Z77 A;  5B66 C;  2CUZ A;  4CIC A;  2LP0 A;  3WGG A;  3DEU A;  4DIQ A;  3GZ6 A;  4Y33 A;  4XL9 A;  5FRN A;  3I59 A;  2VBW A;  4M9S A;  3G1O A;  4B4C A;  1F1Z A;  1G3T A;  4A93 J;  2LG4 A;  3M9A A;  3CMA I;  3FF5 A;  3NEU A;  3BZ6 A;  1FYM A;  5EZG A;  4BDY A;  5CPR B;  4I98 B;  3DPU A;  4FCY A;  4RDU A;  2NS8 A;  1RUO A;  3RQ4 A;  1MGT A;  2Z5U A;  1OQY A;  3ZMU A;  3FK6 A;  1BN5 A;  2QWW A;  4RGU A;  1K4S A;  1A6Q A;  1RR7 A;  2MH9 A;  3WGH A;  2PMH A;  1TNT A;  5J3L A;  3T8R A;  1UJ8 A;  1T08 B;  2VJ4 A;  4UV9 A;  3MKY B;  1FT9 A;  1WI9 A;  1Z21 A;  1B8I B;  1ZK8 A;  5EF6 A;  3D1N I;  5IP9 J;  5IYC J;  2K9N A;  3ZMT A;  5E1W A;  4HX4 A;  5ILS A;  3HPH A;  2GQQ A;  1R6R A;  2ECC A;  2W57 A;  4D1Q A;  2EZI A;  1FNN A;  4HV5 A;  1U9O A;  2LY9 A;  3FIS A;  3E5X A;  3JAM Z;  3M3Y J;  5JLX A;  1HKQ A;  3RKQ A;  2LBF B;  2ZO4 A;  3ZRG A;  2PJP A;  3JRG A;  3S3O A;  2ISZ A;  2AO9 A;  4UXN A;  3S1N J;  4HX8 A;  4LGW A;  4KYW A;  5FGM A;  1V5G A;  2DT6 A;  1ETW A;  2V6E A;  1G6N A;  4A3J J;  1EV7 A;  3PUF A;  1VQ6 I;  5J1Y A;  1HKT A;  4DZJ A;  2P6S A;  5H6Q A;  2XUB A;  1IV6 A;  3KEQ A;  3QAH A;  2DK8 A;  4MLO A;  3U1D A;  4Y52 J;  5IY5 H;  2WWY A;  1U6G A;  4LG3 A;  3F22 A;  2HVR A;  1BL0 A;  2J5P A;  1WRJ A;  2H8W A;  4DZP A;  4B09 A;  3F8B A;  2DMP A;  1YX3 A;  4BE0 A;  4I7H A;  5H20 A;  4ASN A;  5LEJ A;  1RZ4 A;  1O3S A;  1PUE E;  1IDZ A;  2E1O A;  4C30 A;  4NQW A;  3JAM K;  3M1E A;  1LDJ A;  2ISY A;  3SDG A;  3V42 A;  1X19 A;  2CWE A;  1XN7 A;  3OMY A;  4KJZ A;  2JUC A;  2MC4 A;  1X1P A;  2JRT A;  4FTH A;  4Y3O A;  4YIF A;  2VUM J;  2CGP A;  2KZV A;  1STZ A;  4MHG A;  2XB0 X;  3GFL A;  1WJ5 A;  3HB9 A;  4IRH A;  4ZZL A;  5DTD A;  5DM7 F;  4LIT A;  1OCZ H;  1UEL B;  4N9I A;  5LHG A;  2Z2S B;  2X51 A;  2WV0 A;  2X9D A;  2QGU A;  1ZH5 A;  1DP7 P;  1W36 C;  3HRS A;  2H8R A;  3FXJ A;  3GVA A;  4RAF A;  1VQ7 I;  5M5Y J;  2X1D A;  1Z3Y A;  1ETV A;  2DCE A;  3BCA A;  1MNE A;  3D5R C;  2JPB A;  3MCZ A;  3FXK A;  3HKZ A;  3K7A J;  1I6H J;  3KP7 A;  5B5E C;  2BOL A;  4P55 A;  3MN2 A;  3R60 A;  3EYY A;  1SFK A;  1RES A;  1XMX A;  2DDB A;  4CCO A;  4ZDL A;  1F43 A;  5IYB J;  3PNY A;  3DKY A;  2MW8 A;  3H3V K;  3P5J A;  4XKC A;  2PN6 A;  4WCG A;  5FRM A;  4P1W A;  1O57 A;  2G7U A;  1Y0N A;  1FSE A;  2MLG A;  4KIT B;  5IP6 A;  2WTE A;  5IOY A;  1LDD A;  2O61 A;  1R36 A;  2A6T A;  5HDK A;  3IHU A;  2HS5 A;  2XB5 A;  4A3C J;  2ADU A;  1SMT A;  3JRD A;  3JTG A;  4BE1 A;  3BJA A;  1FZP B;  3G73 A;  3VSK A;  4XKB A;  4QSH A;  1W7P A;  2MA3 A;  1ETX A;  2V4J C;  1U78 A;  3F8C A;  4JQF A;  3I4N J;  3ULQ B;  4CGZ A;  2NVU B;  3W3C A;  3ERM A;  5F04 A;  1KON A;  3I71 A;  3W2V A;  2XPU A;  2RC4 A;  1USS A;  3I4M J;  4HA8 A;  5ERI A;  4W97 A;  2BY0 A;  3ASO H;  2FBH A;  3Q0U A;  1A35 A;  1OIS A;  1YS7 A;  3E6B A;  3K9T A;  1YQA A;  3KEY A;  4P5O A;  2K27 A;  3VWB A;  3U9G A;  1W5T A;  3ZR8 X;  3BT9 A;  1X3Z B;  4G6D A;  2DMQ A;  3RYP A;  3TQN A;  5HOD A;  2Q0O A;  3W2W A;  3RI4 A;  4ESB A;  3CD6 I;  4XON A;  4KT6 A;  3CDI A;  3OYB A;  1B9N A;  2WB1 A;  4D9J A;  4C3H J;  4GYG A;  1SVL A;  1VND A;  2W25 A;  1LPQ A;  2VON A;  3HOU J;  1BW5 A;  1Z6T A;  1R1T A;  3G71 I;  4EJV A;  1DP3 A;  3GFM A;  5HOO A;  2EQR A;  3MKW B;  2OZ6 A;  3GTP J;  3BLY A;  3NRV A;  2OF7 A;  1ZKG A;  4JK1 X;  2XIG A;  1W5S A;  2E71 A;  4LG0 B;  3HZJ A;  4BHB A;  2HGC A;  3FBI B;  4AIK A;  1Z05 A;  2VBX A;  2HEO A;  3VPR A;  3AL0 B;  3VFZ A;  1OR7 A;  2KRC A;  3OYJ A;  1P4X A;  3FXM A;  3R6S A;  3O8G A;  2CS3 A;  1U0J A;  2RV8 A;  5GP9 A;  1R49 A;  3E6M A;  5HLH A;  1D1B A;  3LSP A;  3SZT A;  3EQL F;  4YIR X;  1HA8 A;  4KN4 X;  2R7O A;  1IXR C;  2FD5 A;  1FWZ A;  3QPH A;  5LHH A;  1JJ8 C;  3DCF A;  3HHH A;  4MFD A;  2M7B A;  1CF7 B;  1R4N B;  2EH3 A;  4G6Q A;  3GYH X;  4BXX J;  2IAI A;  1BM9 A;  1HW5 A;  4M3F A;  4HW0 A;  5DUI A;  2DPU A;  1LNW A;  5E8G A;  5BNG A;  2CU7 A;  1TWC J;  2CSO A;  1FY7 A;  2DN0 A;  4GCV A;  5CYV A;  4DBQ A;  4J00 A;  3DEE A;  3HUG B;  3TDU C;  4MNU A;  3V4G A;  2E2I J;  1ZAO A;  2OV7 A;  2M45 A;  1B4A A;  2D2W A;  2BYV E;  1XS9 A;  2HI3 A;  1DPU A;  3LSK A;  4M6V A;  3BR1 A;  2LTP A;  4MO7 A;  4YRV A;  2KJB A;  3FM5 A;  2CJJ A;  1FBQ A;  1MZB A;  4BH9 A;  4G7H F;  2W48 A;  1LFP A;  2OQG A;  4A6D A;  1WGX A;  1SAX A;  3HEF A;  5CLS A;  1X3W B;  2FQ4 A;  3W2A A;  4UB8 C;  4PJL A;  3QPT A;  4EJT A;  2MG4 A;  4RM3 A;  2NNY A;  3F8M A;  4BQA A;  2JA7 J;  1R5I D;  3W6J B;  1QGP A;  1FEX A;  2IP2 A;  4YFN F;  2F5E A;  2L4A A;  2EJR A;  4I0B A;  1YO5 C;  4G12 A;  1L3L A;  2DYR H;  3WE2 A;  5EEA A;  2EFW A;  4U0Y A;  4A3I J;  3F21 A;  1F36 A;  4M9Z A;  2LKS A;  4HF1 A;  3C1D A;  1BR2 A;  1Z1D A;  1Y39 A;  2E19 A;  4AIJ A;  3KYL A;  3WU2 C;  1YIO A;  4LIV A;  2E1C A;  3E6C C;  1V5E A;  2A68 F;  1OLT A;  2K40 A;  3CJR B;  2BXZ A;  3K4M A;  3J80 Z;  2Z9O A;  1H8A C;  1J5Y A;  1XMA A;  1X1C A;  2LRE A;  2VB6 A;  3H0G J;  3X2Q H;  4E7H A;  5LEK A;  5B1B H;  3BG7 A;  1XSD A;  1XDS A;  3DKX A;  4A12 A;  1S5L C;  2OA4 A;  1X2N A;  4ZJZ A;  5J47 A;  1HQC A;  1LEA A;  2EB7 A;  2QZ8 A;  5HNH A;  2Y30 A;  1RR8 C;  5TRD A;  3VYT B;  4YG2 F;  2BY3 A;  1VQN I;  3CCE I;  3WTY C;  1YW7 A;  3VYS B;  2LMD A;  2LFB A;  1IN6 A;  3H9Q A;  1B8I A;  1HW1 A;  1K6Y A;  2KIM A;  3J80 K;  1P7J A;  1RUN A;  4QTR A;  1FP1 D;  1J2X A;  3K70 C;  4PJJ A;  1F9N A;  2FNP A;  2LYC A;  1GHC A;  4BS9 A;  1Z6R A;  1VQL I;  5GAD J;  4ZYG A;  5LBQ A;  1YI2 I;  3HOT A;  1ZR4 A;  1LB2 A;  4CSW A;  1UST A;  2L0K A;  2LBF A;  4E7I A;  5E17 F;  5J4V A;  3RCO A;  1TTY A;  1H88 C;  3OYN A;  1E2X A;  3E3V A;  3HG9 A;  5CVU A;  3GZN B;  4I76 A;  4R79 A;  1MMD A;  4NBQ A;  2E5Z A;  1XG1 A;  3M07 A;  3WU0 A;  2L02 A;  2E5N A;  4L5I A;  1MMA A;  3ABL H;  3R0J A;  2P5L C;  3KE2 A;  4M9X A;  2L7Z A;  4J19 A;  2HKO A;  3QRF F;  1A31 A;  1FTZ A;  4XRS A;  3FM3 A;  1SAU A;  2CQQ A;  2STT A;  5IP7 J;  3HTS B;  5BS6 A;  2XGX A;  3A0H C;  4XKW A;  2R92 J;  2JTV A;  1JT0 A;  2JZY A;  3HHG A;  1P4W A;  4XOP A;  4ESJ A;  4BKX A;  4XRM A;  2F4O B;  1HDD C;  3MZ8 A;  3F0C A;  5FLX K;  2KRF A;  2VJI A;  4UUS B;  3ONQ A;  3JRE A;  4HBL A;  4N4O B;  4ZYD A;  3MQ0 A;  5HVQ C;  2W00 A;  1PVE A;  3RKW A;  5D4R A;  1KQ9 A;  3FXO A;  4G7Z F;  3OYH A;  4XIC A;  3OIO A;  4Q4Z F;  3H5R A;  1VTN C;  1RRJ A;  1MBE A;  1O7L A;  2LDU A;  4IX7 A;  3G1M A;  1T98 A;  2XSD C;  4F92 B;  5ILU A;  1OKR A;  4BQO A;  2ZJQ F;  4H4K C;  4C3I J;  3FMQ A;  1RKW A;  3CO6 C;  4KIS A;  3TBI A;  2KL4 A;  1TT5 B;  3WOD F;  3E0J B;  1D5Y A;  3F9K A;  2GXA A;  2LOO A;  1LEB A;  5M3M J;  4PJN A;  2HDC A;  2VE8 A;  4HQE A;  3P9I A;  2ZKZ A;  3H35 A;  3LQQ A;  2EK5 A;  4XRS G;  4CH7 A;  2W24 A;  4D0P A;  1XGS A;  5L3F A;  1ZYR F;  3HSF A;  1QA6 A;  3WG7 H;  2M0M A;  2Y31 A;  2D45 A;  2KLO A;  1GDT A;  4DJA A;  3BR0 A;  4HAM A;  2Q1Z B;  1D5V A;  1X4O A;  2B7E A;  5M5X J;  2CO5 A;  1ZG5 A;  1IN8 A;  3B6C A;  2DMN A;  4LLG F;  3C2B A;  2ID3 A;  4LD5 A;  2FE3 A;  4EGY A;  2WV1 A;  2MGQ A;  2QF7 A;  3DLL F;  1FIP A;  4E6K G;  2X48 A;  3KEO A;  4NUB A;  2OCE A;  5JHF A;  1TC3 C;  1UHM A;  3KX2 A;  1SFX A;  1ZQ3 P;  3B73 A;  4BEH B;  4D5F A;  4DYR A;  1EH7 A;  3ZQ7 A;  1B6A A;  3RJP A;  1NK2 P;  1XDU A;  2X6W A;  3K4C A;  4UVA A;  2ZJP F;  5M5W J;  1LE8 B;  2O8X A;  1R5G A;  4LJZ F;  1S9H A;  4B43 A;  2IGM A;  3HL2 A;  3J7A Y;  4NC7 A;  2L3D A;  1EH8 A;  2P7V B;  3H0D A;  2ZC2 A;  4MQ9 F;  4BJ6 C;  4HRI A;  2VL8 A;  5HDN A;  3K69 A;  2R3S A;  2JJ7 A;  3LWF A;  5J1R A;  4A2U A;  3SHF A;  2EV6 A;  1O4X A;  4BAC A;  1HSJ A;  4HG2 A;  1ZGJ A;  3T0Y A;  2YSR A;  3QYE A;  3RPQ A;  2V1D A;  3WHC A;  2BEO A;  2EV5 A;  5CJ9 A;  2NVT J;  1WI3 A;  4Q48 A;  3MMY B;  2O03 A;  5J40 A;  2MYS A;  4S05 A;  2XSJ C;  5E8I A;  3NAR A;  2UV1 A;  1MBG A;  1TW2 A;  1PP7 U;  2H09 A;  1RET A;  3A03 A;  2OU2 A;  3RKY A;  2MLK A;  3BY6 A;  5D5U B;  2DT7 B;  2K7L A;  2XC7 A;  4NB5 A;  4OOI A;  3MKZ A;  1IDY A;  1FYK A;  4CYC B;  1U8B A;  5L3D A;  4LG0 A;  3QYF A;  4KDP A;  1MIJ A;  2E7W A;  2Z1D A;  5IOZ A;  4X0G A;  1G2H A;  2ID6 A;  3BG6 A;  5KAF C;  4BJ5 C;  1MJ9 A;  3K4K A;  3U2R A;  1M1E B;  5D4S A;  3OS1 A;  3JTH A;  5D6E A;  2EFQ A;  2L9S A;  3HJE A;  1Z91 A;  2CV1 A;  1JXS A;  3H1C A;  3HGY A;  3GWZ A;  2FUG 2;  1K83 J;  2KKO A;  2E7X A;  4IF4 A;  4XLF A;  3A4C A;  1BR4 A;  3OSG A;  2M1B A;  3WHB A;  1QHH D;  2R0Q C;  3HIF A;  4XLP F;  2ELJ A;  4XR6 A;  4E4H A;  1DU6 A;  5GAE J;  3BRO A;  3TOB A;  1G8X A;  2F4I A;  3DP7 A;  5F64 A;  2LF7 A;  3L2U A;  3M1C A;  1CF7 A;  3OYI A;  3FKI J;  3WG9 A;  3Q3S A;  3I3L A;  3V7S A;  1JI8 A;  1YYV A;  3G3Z A;  2QVO A;  2XAQ A;  3LAP A;  5IT9 K;  4G9Y A;  1R23 A;  4BJT A;  2K02 A;  2FU4 A;  5H2F C;  5DV5 A;  1BC7 C;  5FKN A;  4I99 C;  4WWC A;  3PQJ A;  2XPW A;  5CQG A;  3VYR B;  2B63 J;  1NTC A;  2HDW A;  4MTD A;  3HUG A;  2HYF A;  1OJL A;  3SFZ A;  2HWV A;  2M30 A;  5HNF A;  2ZFW A;  1POG A;  1VF9 A;  3FMR A;  2XAG A;  2EIK H;  3OYL A;  4BDZ A;  4BGD A;  2EIL H;  3JCU C;  1RIO H;  2M0C A;  3K4B A;  5FD6 A;  1Z9C A;  1T2K A;  3HDD A;  2JVH A;  3GW2 A;  2A5Y B;  2VN2 A;  1KU2 A;  4MFE A;  3QU6 A;  4CDG A;  2VQC A;  4KIC A;  3WTT C;  1QPI A;  2CV2 A;  1ZLK A;  1TW3 A;  2NVQ J;  2M8E A;  4M71 A;  2V6C A;  2GOM A;  1LUJ B;  2XAU A;  2HNH A;  4A3M J;  1IAW A;  3OYC A;  2JT1 A;  4QPO A;  4PCQ A;  2XF6 A;  4M72 A;  3FZV A;  4V2F A;  5C44 J;  3BOQ A;  3VOE A;  2EWN A;  1N25 A;  1X3U A;  3EUH A;  2P8T A;  2EFN A;  3I54 A;  4BXF A;  2A6E F;  4EMS A;  1UB9 A;  2BHZ A;  1Y1V J;  1FMW A;  4OMZ A;  2V7F A;  4Z6Y A;  3IL2 A;  4XSX F;  1OCO H;  3RIR A;  2HTJ A;  5IT3 A;  2CQ7 A;  2NRA C;  3PNV A;  3WTV C;  4HF2 A;  4M6Y A;  3QQA A;  1N78 A;  4PDK A;  3E5Q A;  2OQR A;  3COA C;  2O0Y A;  1IW7 F;  3GO5 A;  2Y9Z A;  1IGN A;  2DPD A;  4A5M A;  1HST A;  3EPZ A;  2BGC A;  3VB2 A;  1S29 A;  2H1K A;  5HLT A;  4JX6 A;  3MEX A;  2PX9 A;  4HYE A;  1NHA A;  2DDA A;  3ZMD A;  3CMY A;  2AS5 F;  4LB5 A;  3RPU A;  3KFW X;  1K6O A;  4MEX F;  2PFB A;  2KIU A;  4C2U A;  4IJA A;  3TOA A;  3U1K A;  4M3G A;  4B48 A;  3L09 A;  3TED A;  1KQ0 A;  4EAT A;  4RB1 A;  2KDO A;  3C7J A;  1KYZ A;  4BL0 B;  2HXI A;  3BTJ A;  5JI6 A;  4I02 A;  1JKO C;  4OU0 A;  5GTI C;  1WQ2 A;  1IG7 A;  2WC2 A;  1S8N A;  3HSR A;  1T33 A;  3G4S I;  4A0Y A;  4EV0 A;  3H9J A;  4BHP A;  4OIR F;  3MAJ A;  4D7M A;  3SQN A;  3S14 J;  5ICE A;  4L0Y B;  9ANT A;  3M8F A;  4RGX A;  2K85 A;  3P7N A;  2L9V A;  1XD7 A;  4E7L A;  1JTX A;  2QKM B;  1I1S A;  2IA0 A;  4BE2 A;  1LFB A;  2GZW A;  5F08 A;  5DCM A;  2DOA A;  4PZJ A;  2I8D A;  3ZN1 A;  2VKH A;  3QPL A;  2K86 A;  5FFZ A;  3TDZ C;  2ME0 A;  2L54 A;  3D5S C;  3GTM J;  1UHW A;  4L9T A;  2PLY A;  4L9V A;  4RS8 A;  1IN5 A;  4WK8 F;  3M4O J;  4WX9 A;  1A36 A;  3LST A;  5CVR A;  2XDV A;  4YFK F;  4HEA 2;  3C3W A;  2V9V A;  4TV7 A;  2A6H F;  1N77 A;  5F1R A;  2A5W A;  3CLQ A;  1Y1W J;  2LY2 A;  1U9N A;  4UUS A;  3Q5F A;  1ZGA A;  4IEJ A;  1D3Y A;  1IRX A;  1CQT A;  1IXC A;  2OTL I;  2EIM H;  2LK2 A;  1P6R A;  2KP6 A;  2VQH A;  3TO9 A;  2TRT A;  3P9C A;  1ZAR A;  3N4M A;  3TMO A;  1FYL A;  2E2H J;  3BJO A;  1QZE A;  5FFX A;  3DV8 A;  4LB6 B;  1KU3 A;  1FPQ A;  3WTS C;  1TNS A;  3DU5 A;  2DA6 A;  1HCR A;  2DTR A;  2R7F A;  4M6X A;  2HQN A;  1SMY F;  2D1V A;  3FKJ A;  1H0M A;  3CUO A;  2GA1 A;  1BOB A;  3J81 K;  4XRF A;  3ZQF A;  1APL C;  1ZRE A;  1MBJ A;  2Z3Y A;  5FJ8 J;  1AA7 A;  3E97 A;  4A0Z A;  1TQI A;  2RGV A;  1R7J A;  1ACI A;  3PJR A;  2G0E A;  4EJW A;  1MSE C;  3KPH A;  3T1B A;  4L5J A;  4RAY A;  1ZRF A;  2JSC A;  3GEZ A;  4JOM A;  1NH3 A;  3DTK A;  1JKP C;  4CZZ A;  1S7A A;  2N8G A;  4AC0 A;  3GTJ J;  3I0T A;  3PL8 A;  1TQP A;  5EG0 B;  4QWQ A;  3BR2 A;  2GWR A;  3OYD A;  1JKR C;  3MZY A;  3F6V A;  3KZY A;  4GYI A;  4RAG A;  4XSZ F;  4BEH A;  3ML6 A;  4AU7 A;  3JSO A;  4B3A A;  5M3F J;  3BZC A;  1HC8 A;  2HTS A;  3BR5 A;  1LE8 A;  2EV0 A;  1QU3 A;  3OL4 A;  4ESF A;  1IRF A;  2EPF A;  2UXN A;  5GAG J;  1YE9 A;  3QWL A;  1FLI A;  2QQ9 A;  1XPX A;  1R5H A;  1XGM A;  2MD0 A;  3R4K A;  4ZYA A;  3WTW C;  1T0F C;  4J01 A;  2EA2 A;  4PFP A;  5EYR A;  3IP4 B;  2PG4 A;  2V26 A;  1BBY A;  4PFO A;  5EGO B;  5HLI A;  1J9I A;  2CFX A;  2RDP A;  3CCY A;  4XMY A;  5D5W B;  2W1O A;  3WU1 B;  3HOW J;  2KFD A;  1XB4 A;  3LA3 A;  1ZRD A;  4IHT A;  4G7O F;  1I3A A;  3H92 A;  1SD7 A;  5KHD A;  1WJC A;  1BJA A;  3CMM A;  5EJC A;  3V8J A;  1JGG A;  2IGO A;  1EJ9 A;  1D8J A;  3FHN A;  1FOW A;  4IO9 F;  3RZD J;  3SEQ A;  3L2V A;  2L7F P;  4FX0 A;  2EFP A;  4C2T A;  3OIQ A;  1YW9 A;  3CDH A;  1MND A;  3S93 A;  4BYY A;  1OYI A;  2VLA A;  2VQL A;  1WZ2 A;  3BDD A;  4AVZ A;  4AIH A;  1X1D A;  1QVT A;  2QUF A;  2VBY A;  1V5F A;  4CYC A;  3NWS A;  4R1H A;  1N75 A;  2XAH A;  2NOG A;  3H5A A;  1XC5 A;  3ABK H;  4Y13 A;  5D6F A;  3KLN A;  1UFM A;  5J8C A;  2H6B A;  2K9L A;  4DGW B;  2EZK A;  2HVS A;  3DF8 A;  3GBG A;  3DBL B;  1WHU A;  2L7M P;  2OC6 A;  4E7Z A;  4C9Y A;  3OS0 A;  1KA8 A;  3CUQ C;  4HLX A;  3L2Q A;  1FBS A;  1IRZ A;  1UG0 A;  1JUS A;  1R00 A;  2M34 A;  3S17 J;  5HS9 A;  4L9N A;  2K9Q A;  1XGN A;  1TZL A;  3HXL A;  4CA0 A;  2IA1 A;  3OR1 C;  1W0T A;  5D5X B;  4I2O A;  1AKH B;  1E0E A;  4KUM A;  3K10 A;  2DA7 A;  2CRG A;  1T8I A;  1LJ9 A;  5JLW A;  3TP0 A;  3JRF A;  4AYB N;  2PQ8 A;  3FXQ A;  3L2C A;  3DLA A;  1VFC A;  1YJ9 I;  2DXI A;  2Z16 A;  3VOD A;  2CV0 A;  2EA4 A;  2VI6 A;  3CF2 A;  4X1E A;  2M9H A;  3O2P E;  3L1P A;  1B72 B;  2VC1 A;  2ZXH A;  1PYV A;  3DBR B;  1OCT C;  3R0A A;  2DFE A;  3QOD A;  4U88 A;  4IKF A;  1B1B A;  1OMI A;  4KFC A;  1W5C C;  1JT6 A;  1J0R A;  2PBI A;  3S3M A;  2PMU A;  1JUM A;  1XCV A;  2HYJ A;  1VQ5 I;  1MH3 A;  2IVM A;  2B0L A;  3REO A;  1QBJ A;  3BWG A;  4KMF A;  5HDG A;  2IGK A;  4Y17 A;  4CZC A;  3GME A;  2IS6 A;  3LL7 A;  2VC0 A;  1D1A A;  1S6L A;  2BZT A;  4XOT A;  3ZQG A;  4CCN A;  3ZCO A;  1WVR A;  3CCS I;  5JVG F;  4GXO A;  1MDM B;  1KU9 A;  2IJL A;  1YTY A;  3TP3 A;  5FB2 A;  1DU0 A;  1XGO A;  2L2O A;  3LNQ A;  4PGG A;  3AKZ A;  4NHJ A;  1AWC A;  1JHF A;  2QQ8 A;  3PQK A;  2M4K A;  5J6X A;  4UB6 C;  3GXO A;  1WH7 A;  2DTZ A;  4IHY A;  1A6I A;  2OUM A;  2VT2 A;  2R7V A;  3BTI A;  3UNG C;  3VDX A;  1O3R A;  2UZK A;  5KAI C;  2E36 A;  2VOO A;  2OTJ I;  3CP2 A;  2NOJ B;  2OAZ A;  2Y75 A;  4XQF A;  3CDL A;  5FLV A;  5K5Q A;  1VQ4 I;  3RKX A;  2BHY A;  4CUG A;  4DNC A;  3FXU A;  2PMZ N;  1DGW Y;  3ZQL A;  1YJW I;  2DMT A;  1WJB A;  1F4K A;  1IXS B;  1GUU A;  4N4N B;  2ESN A;  1BC8 C;  2A61 A;  1QQI A;  2ZJR F;  2VOP A;  3ZP5 A;  2FXA A;  1V55 H;  2X0L A;  1I1G A;  2JK3 A;  4YFX F;  4XID A;  4GFB A;  3K0L A;  3TL4 X;  5GPC A;  5HS7 A;  3S2D J;  1YFH A;  3ISP A;  1P4A A;  2DOD A;  4FIS A;  1T6S A;  4GO1 A;  4DW6 A;  2O6G E;  2JA8 J;  2XAF A;  3KZZ A;  5FKM A;  4M74 A;  3RZO J;  2WA0 A;  1OPC A;  3HM5 A;  1Z7U A;  4IXA A;  4S0H B;  2BVL A;  3TW7 A;  1EKE A;  2YUS A;  4IVN A;  3O8H A;  4S04 A;  3KCC A;  5FLX Z;  2BW3 B;  5KNL A;  2L9N A;  1BJZ A;  1ONV A;  3G2B A;  3A1Y A;  3PSF A;  3C2G A;  3OY9 A;  5DCM B;  1JGS A;  3EUK L;  4RM2 A;  1HLV A;  3GCM A;  2XHK A;  3SZG A;  5FRO A;  2NXN B;  5BPD A;  1R71 A;  3QPS A;  4FQG A;  3BQY A;  1G3W A;  1U3E M;  1OYY A;  2BY1 A;  1MJB A;  5KCM A;  1B9M A;  3OIP A;  5J4Y A;  2IS4 A;  2TCT A;  2GBY A;  2QLZ A;  4R8H A;  2XAS A;  2VKE A;  3Q9S A;  4DBR A;  2HOS A;  1IV8 A;  4C3J J;  5IPA A;  2YX4 A;  1F5T A;  4A3D J;  4HZF A;  2RKH A;  5CVJ A;  1GXQ A;  3ECO A;  2NNN A;  1YLF A;  2VQG A; 
#chains in the Genus database with same CATH homology
 5E18 F;  2YR2 A;  4U0V A;  2QYO A;  2OD5 A;  1GVJ A;  1ZHF A;  2RNJ A;  2XVC A;  3E5U A;  4UVB A;  1A04 A;  3WTZ A;  2FQ3 A;  4ON0 A;  4AWX B;  3ZMZ A;  5ICF A;  3DPT A;  1WKM A;  3B02 A;  2COM A;  3TO6 A;  3I64 A;  1DDN A;  4IHS A;  1KYW A;  5AIP A;  1FBU A;  3GUD A;  6PAX A;  2M5W A;  1G3Y A;  2XV4 S;  2ACJ A;  4HF0 A;  3I53 A;  1WWX A;  2W84 A;  4MTE A;  5BPI A;  2STW A;  2PEX A;  4HV6 A;  3AAF A;  3V7R A;  2DI3 A;  1ZN2 A;  4KA4 A;  3HRM A;  3QP5 A;  2VBZ A;  2A69 F;  1T38 A;  2Y48 A;  5DCF A;  2XAJ A;  1J75 A;  2GIV A;  2VT3 A;  2F5C A;  5JR3 A;  1T0F A;  1Y0U A;  2G7H A;  3F23 A;  2QM3 A;  2Z33 A;  1UCR A;  2QQA A;  3KP6 A;  1S3J A;  1I6X A;  4LLL A;  2FML A;  4LLN A;  3C18 A;  3WTX C;  3W6K B;  1KU7 A;  5ICG A;  4IRI A;  2DU9 A;  1ULY A;  4U7D A;  2CG4 A;  1IN4 A;  3D5L A;  3BPX A;  3T8T A;  5BQT A;  3PFI A;  5IT9 Z;  1C0W A;  3NQO A;  1RNL A;  4LMY A;  1LQ1 A;  4HDU A;  1XSV A;  3OOP A;  5LRS A;  3H3Z A;  1U5T B;  4L9J A;  3ELK A;  3FMS A;  1U5T C;  3HRT A;  2VE9 A;  1K79 A;  1H9T A;  3BP8 A;  5ILV A;  3DXJ F;  4ENN A;  2G9W A;  5H6R A;  4MEY F;  2D1H A;  4A6E A;  1REP C;  3ERE D;  4I01 A;  1O3Q A;  5LGU A;  4O3M A;  1ZG1 A;  3L7W A;  2Y0M A;  5HLG A;  1BI3 A;  2F2E A;  2W85 A;  4MQV A;  1MDM A;  4ENM A;  1ZRC A;  4AVP A;  4MGR A;  4P9U A;  2K4B A;  4UVC A;  2PI0 A;  5K1Y A;  2FBK A;  2Q8K A;  2DLL A;  3HSE A;  4ZZD A;  1W7P D;  1U2W A;  4HOB A;  2V79 A;  2QBY B;  1TBX A;  1Q1H A;  4Q5S F;  3FX3 A;  2X4H A;  4O5V A;  4KNY A;  1R1V A;  2H94 A;  2GAU A;  5AIQ A;  4I0A A;  1OYW A;  3RYR A;  3F8N A;  1IF1 A;  4E70 A;  3RDI A;  2FRH A;  1LDK B;  2F5D A;  2IPQ X;  5EEG A;  3HTU A;  4BXU A;  3KP5 A;  5L3C A;  2DQL A;  3LA7 A;  1IRG A;  2FEZ A;  4UUV A;  1E17 A;  3H3U A;  5DD8 A;  4UV8 A;  1L0O C;  2ESH A;  2LNB A;  2LKP A;  1HXD A;  4ETS A;  5HS8 A;  2ELH A;  4B8X A;  5DD4 A;  1GXP A;  1K78 B;  3E6D A;  3J81 Z;  1J7K A;  5TJJ A;  1G3S A;  2XRN A;  2XKP A;  1LVA A;  5L3E A;  4WXC A;  5K5O A;  1ON1 A;  1BOA A;  5E20 A;  1MJA A;  2A3S A;  1PP8 F;  2HYG D;  2XKO A;  4JBA A;  3K2Z A;  3GFI A;  3HRU A;  5J8F A;  3KP2 A;  2P5K A;  3TKY A;  1QPM A;  1TQM A;  3RTR A;  4FHT A;  4F7Z A;  3KP4 A;  1KQ8 A;  4G94 A;  2ZME B;  3QU3 A;  1YS6 A;  4K2E A;  2RN7 A;  2RVC A;  2HZT A;  1HKS A;  1O3T A;  4HLY A;  1P92 A;  5JVT A;  2BBY A;  3WTU C;  4U7B A;  1BI1 A;  3WE3 A;  2NYX A;  1FSH A;  3MWM A;  1K7A A;  2DK5 A;  4P9F A;  5JHU A;  2GA2 A;  1SFE A;  5ED4 A;  5EEH A;  3O3K A;  3J7A O;  5D8K B;  3GLX A;  4OMY A;  2ZBK A;  4ZYE A;  3JSP A;  2CW0 F;  3F8F A;  2MD5 A;  3FHZ A;  1SD4 A;  5E1Z B;  2LF8 A;  4I09 A;  4CYD A;  3DFG A;  1XCB A;  2IT0 A;  2DBB A;  4OIO F;  4IRG A;  4BNC A;  3CLO A;  5A2Q Z;  2QQB A;  1J59 A;  4KIF A;  2DAO A;  3EYI A;  3ZMS A;  1S7O A;  2YPR A;  2C6Y A;  5LHI A;  3KLO A;  2E1N A;  5LLQ A;  5BMZ A;  2KIF A;  3IC7 A;  3CUQ B;  1QZY A;  5L3G A;  3QP6 A;  1FOK A;  4O6J A;  5KVR A;  5A2Q K;  1U5T A;  1R58 A;  4OIP F;  5D5V B;  2LSO A;  4OIN F;  4Y15 A;  4Z2Y A;  4LFU A;  1BI2 A;  5DDG A;  1V3F A;  3MFK A;  1BIA A;  2HQR A;  3LFK A;  1V4R A;  3K1P A;  3LAJ A;  3K1M A;  4OIQ F;  3D0S A;  1G4D A;  4XLN F;  2DW4 A;  4A5N A;  2MH2 A;  4WF2 A;  4ENJ A;  1BIB A;  4CO8 A;  2HFH A;  4G8X A;  3TO7 A;  5L3B A;  1YW8 A;  3IKT A;  2GXB A;  2FSW A;  1WSU A;  1SD5 A;  4UNO A;  3M7G A;  2QEN A;  3CTA A;  5K5R A;  2IA2 A;  3V8K A;  2FNA A;  4EM0 B;  3QOP A;  3VEP A;  4QLC U;  2YX7 A;  2DO7 A;  4Q47 A;  3I59 B;  1HBX G;  1QNT A;  4RB3 C;  4EGZ A;  1R1U A;  3TGN A;  3IRR A;  4WXH A;  3DPL C;  2OBP A;  1QO0 D;  3T5X A;  4RB0 A;  2QBY A;  3ZMV A;  3K1N A;  4HDV A;  5D8L B;  1ZLJ A;  3R61 A;  3LQR A;  2P6T A;  4L18 B;  2RQP A;  2FOK A;  2DQR A;  2DT5 A;  1I27 A;  1R22 A;  4PGH A;  3ZN0 A;  1FC3 A;  1BI0 A;  2L01 A;  3P9K A;  3KP3 A;  3F6O A;  3DQV C;  5FD5 A;  4H0E A;  2IRF G;  4HX7 A;  5CVV A;  4YII A;  2P4W A;  4XBF A;  4ZH4 F;  1PDN C;  4ZYH A;  3ABU A;  3KET A;  2P5V A;  4FT8 A;  4WXD A;  4N9H A;  1T39 A;  4N0B A;  2IW5 A;  3GX4 X;  2FF4 A;  4KMU X;  1IZ1 A;  4U0W A;  2HR3 A;  1DUX C;  3SZP A;  1I5Z A;  3F72 A;  2L4M A;  2ZJ2 A;  2UXX A;  3ABT A;  2Q2E A;  3DKW A;  1XSX A;  2R7D A;  5ICC A;  5F6F A;  3V8L A;  4FX4 A;  4P96 A;  4EVI A;  1K78 A;  5KK1 A;  3EET A;  1SD6 A;  3GFJ A;  3IWF A;  1FP2 A;  2BE5 F;  2DFI A;  2Z99 A;  5DYM A;  4BHC A;  3CO7 C;  2ZCW A;  4L0Z B;  3F3X A;  1QZZ A;  1W4M A;  1ZG3 A;  4DQ2 A;  3BJ6 A;  4KIB A;  2H6C A;  1H9G A;  2BV6 A;  2FA5 A;  2FBI A;  3WGI A;  3IWZ A;  3V7C A;  2KJC A;  4BAY A;  2NAZ A;  4ENK A;  2CYY A;  3I5U A;  3L9F A;  2ZME A;  5FO5 A;  4RGS A;  3LA2 A;  3HYI A;  2CQK A;  5DUK A;  2ETH A;  3FWE A;  1HW2 A;  2AXL A;  3GZ5 A;  4CHU A;  5LGN A;  1KGS A;  2FMY A;  5BOX A;  2VOD A;  3ROU A;  2UWM A;  1ODD A;  1W7P B;  3O6B B;  4UHT A;  3L00 A;  4EM2 A;  2H27 A;  2JPC A;  3FXR A;  1MD0 A;  3S2W A;  3ZPL A;  3Q9V A;  3I4P A;  2MBF A;  1YG2 A;  1SFU A;  2ZXJ A;  1IUY A;  3OV8 A;  2GXG A;  4RB2 C;  4KN7 X;  4GGG A;  2XRO A;  2F5F A;  2NS0 A;  1JE8 A;  3EDP A;  1D8K A;  4CXF A;  2OZU A;  3HOS A;  4LK1 F;  4EJO A;  4M73 A;  2YU3 A;  3CUQ A;  2K4J A;  4KT5 C;  3I58 A;  2ZNY A;  2M87 A;  1XMK A;  4EM1 A;  3MZH A;  4LK0 F;  2MC3 A;  1RI7 A;  4EJU A;  4RGR A;  2TDX A;  5LRR A;  2VXZ A;  3IRQ A;  5LGT A;  4A0X A;  3SXY A;  5DEQ A;  1IN7 A;  3CJN A;  1ON2 A;  4RAZ A;  2EFO A;  1DPR A;  2P7C B;  3N97 A;  3M8E A;  5JFR A;  1MKM A;  2ZNZ A;  5E1X A;  2A07 F;  1AOY A;  4AD9 A;  4EQQ A;  2HOE A;  3IKV A;  1CGP A;  4IPA A;  3BPV A;  2V1U A;  2V1X A;  4KIG A;  5AON A;  2HKX A;  3GF2 A;  1FX7 A;  3ECH A;  5CVI A;  4HQM A;  1O7F A;  2J5O A;  1JHH A;  1U8R A;  1P2F A;  1EH6 A;  3JW4 A;  1TLH B;  1B59 A;  2O3F A;  4CIC A;  3WGG A;  3DEU A;  3GZ6 A;  3I59 A;  2VBW A;  4M9S A;  1F1Z A;  1G3T A;  3M9A A;  3FF5 A;  3NEU A;  3BZ6 A;  1FYM A;  4I98 B;  1RUO A;  1MGT A;  2Z5U A;  3ZMU A;  1BN5 A;  2QWW A;  4RGU A;  2MH9 A;  3WGH A;  2PMH A;  1TNT A;  3T8R A;  4UV9 A;  1FT9 A;  1WI9 A;  3ZMT A;  5E1W A;  4HX4 A;  5ILS A;  2GQQ A;  2W57 A;  1FNN A;  4HV5 A;  3E5X A;  3JAM Z;  1HKQ A;  2ZO4 A;  2PJP A;  2ISZ A;  4UXN A;  4HX8 A;  4LGW A;  4KYW A;  5FGM A;  1G6N A;  1EV7 A;  1HKT A;  2P6S A;  5H6Q A;  2XUB A;  3KEQ A;  3QAH A;  2DK8 A;  3U1D A;  2WWY A;  1U6G A;  3F22 A;  2J5P A;  1WRJ A;  4B09 A;  3F8B A;  4I7H A;  5H20 A;  4ASN A;  5LEJ A;  1RZ4 A;  1O3S A;  1PUE E;  4NQW A;  3JAM K;  3M1E A;  1LDJ A;  2ISY A;  2CWE A;  1XN7 A;  2JRT A;  4YIF A;  2CGP A;  1STZ A;  4MHG A;  3GFL A;  4IRH A;  4ZZL A;  4N9I A;  5LHG A;  2WV0 A;  1ZH5 A;  1DP7 P;  3HRS A;  3GVA A;  2JPB A;  3MCZ A;  3KP7 A;  4P55 A;  3R60 A;  3EYY A;  2PN6 A;  4WCG A;  1O57 A;  2G7U A;  1FSE A;  2MLG A;  2WTE A;  1LDD A;  2O61 A;  1R36 A;  5HDK A;  3IHU A;  2HS5 A;  2ADU A;  1SMT A;  3JTG A;  1FZP B;  3BJA A;  3G73 A;  1W7P A;  2MA3 A;  1U78 A;  3F8C A;  4JQF A;  3ULQ B;  4CGZ A;  3I71 A;  2RC4 A;  1USS A;  4HA8 A;  5ERI A;  2FBH A;  1YS7 A;  3E6B A;  3K9T A;  1YQA A;  4P5O A;  2K27 A;  3U9G A;  1W5T A;  4G6D A;  3RYP A;  3TQN A;  3RI4 A;  2Q0O A;  4ESB A;  1B9N A;  4GYG A;  2W25 A;  2VON A;  1Z6T A;  1R1T A;  4EJV A;  3GFM A;  5HOO A;  2OZ6 A;  3NRV A;  4JK1 X;  2XIG A;  1W5S A;  4LG0 B;  4BHB A;  2HGC A;  4AIK A;  1Z05 A;  2VBX A;  2HEO A;  3VFZ A;  1OR7 A;  1P4X A;  3R6S A;  2RV8 A;  3E6M A;  5HLH A;  3SZT A;  3EQL F;  4KN4 X;  1IXR C;  1FWZ A;  3QPH A;  5LHH A;  3HHH A;  1CF7 B;  4G6Q A;  3GYH X;  1BM9 A;  1HW5 A;  4HW0 A;  5DUI A;  2DPU A;  1LNW A;  5E8G A;  4GCV A;  2CSO A;  1FY7 A;  5CYV A;  3V4G A;  3TDU C;  4MNU A;  1ZAO A;  2M45 A;  1B4A A;  2D2W A;  2BYV E;  1DPU A;  2KJB A;  3FM5 A;  1FBQ A;  1MZB A;  4BH9 A;  4G7H F;  2OQG A;  4A6D A;  1SAX A;  5CLS A;  3QPT A;  4EJT A;  4BQA A;  2NNY A;  3F8M A;  3W6J B;  1QGP A;  2IP2 A;  4YFN F;  2F5E A;  2L4A A;  2EJR A;  4I0B A;  1YO5 C;  1L3L A;  3WE2 A;  2EFW A;  4U0Y A;  3F21 A;  4M9Z A;  4HF1 A;  3C1D A;  1Z1D A;  4AIJ A;  1YIO A;  2E1C A;  3E6C C;  2A68 F;  2Z9O A;  3J80 Z;  1J5Y A;  1XMA A;  5LEK A;  1XSD A;  1XDS A;  4A12 A;  2OA4 A;  1HQC A;  1LEA A;  2EB7 A;  2QZ8 A;  5TRD A;  4YG2 F;  3WTY C;  1YW7 A;  1IN6 A;  1HW1 A;  2KIM A;  3J80 K;  1RUN A;  1FP1 D;  1J2X A;  1GHC A;  1F9N A;  2FNP A;  1Z6R A;  4ZYG A;  5LBQ A;  3HOT A;  1LB2 A;  1UST A;  5E17 F;  1TTY A;  1E2X A;  3E3V A;  5CVU A;  4R79 A;  3WU0 A;  2L02 A;  4L5I A;  3R0J A;  2P5L C;  3KE2 A;  4M9X A;  3QRF F;  2HKO A;  3FM3 A;  2STT A;  3HTS B;  5BS6 A;  2XGX A;  2JTV A;  2JZY A;  3HHG A;  1P4W A;  4ESJ A;  5FLX K;  2KRF A;  4HBL A;  4ZYD A;  3MQ0 A;  5HVQ C;  3RKW A;  5D4R A;  1KQ9 A;  4G7Z F;  4Q4Z F;  1VTN C;  1O7L A;  2LDU A;  1T98 A;  5ILU A;  1OKR A;  3FMQ A;  3CO6 C;  3WOD F;  1LEB A;  2HDC A;  2VE8 A;  4HQE A;  3P9I A;  2ZKZ A;  3LQQ A;  2EK5 A;  2W24 A;  4D0P A;  1XGS A;  5L3F A;  1ZYR F;  3HSF A;  2D45 A;  4HAM A;  1D5V A;  2CO5 A;  1ZG5 A;  1IN8 A;  4LLG F;  4LD5 A;  2FE3 A;  4EGY A;  3KEO A;  1UHM A;  1SFX A;  3B73 A;  1EH7 A;  3ZQ7 A;  1B6A A;  3RJP A;  1XDU A;  4UVA A;  2O8X A;  1R5G A;  4LJZ F;  2L3D A;  1EH8 A;  2P7V B;  4MQ9 F;  5HDN A;  3K69 A;  2R3S A;  3LWF A;  4A2U A;  3SHF A;  2EV6 A;  1HSJ A;  1ZGJ A;  3T0Y A;  2YSR A;  3RPQ A;  2V1D A;  2BEO A;  2EV5 A;  5CJ9 A;  4Q48 A;  2O03 A;  4S05 A;  5E8I A;  1TW2 A;  1PP7 U;  2H09 A;  3RKY A;  2OU2 A;  2MLK A;  3BY6 A;  5D5U B;  2K7L A;  4NB5 A;  4OOI A;  1FYK A;  5L3D A;  4LG0 A;  4KDP A;  2E7W A;  1MJ9 A;  3U2R A;  5D4S A;  3JTH A;  5D6E A;  2EFQ A;  1Z91 A;  1JXS A;  3GWZ A;  2KKO A;  2E7X A;  4IF4 A;  2M1B A;  3HIF A;  4XLP F;  3BRO A;  3TOB A;  3DP7 A;  5F64 A;  2LF7 A;  1CF7 A;  3WG9 A;  3V7S A;  1YYV A;  3G3Z A;  2QVO A;  2XAQ A;  3LAP A;  5IT9 K;  4G9Y A;  1R23 A;  2K02 A;  2FU4 A;  5DV5 A;  1BC7 C;  4WWC A;  3PQJ A;  4MTD A;  3HUG A;  2HYF A;  3SFZ A;  2HWV A;  2M30 A;  2ZFW A;  3FMR A;  2XAG A;  1RIO H;  5FD6 A;  1Z9C A;  1T2K A;  3GW2 A;  2A5Y B;  2VN2 A;  1KU2 A;  3QU6 A;  4CDG A;  4KIC A;  3WTT C;  1ZLK A;  1TW3 A;  2M8E A;  4M71 A;  2V6C A;  1IAW A;  2JT1 A;  4PCQ A;  4M72 A;  3FZV A;  3BOQ A;  3VOE A;  2EWN A;  1X3U A;  3EUH A;  3I54 A;  2P8T A;  2EFN A;  2A6E F;  4EMS A;  1UB9 A;  4OMZ A;  3IL2 A;  4XSX F;  3RIR A;  2HTJ A;  5IT3 A;  2NRA C;  3WTV C;  4HF2 A;  4M6Y A;  4PDK A;  3E5Q A;  2OQR A;  3COA C;  2O0Y A;  1IW7 F;  3GO5 A;  2DPD A;  4A5M A;  1HST A;  2BGC A;  3VB2 A;  1S29 A;  3MEX A;  4HYE A;  1NHA A;  3ZMD A;  2AS5 F;  4LB5 A;  3RPU A;  3KFW X;  1K6O A;  4MEX F;  2PFB A;  2KIU A;  4IJA A;  3TOA A;  3L09 A;  1KQ0 A;  4RB1 A;  3C7J A;  1KYZ A;  5JI6 A;  4I02 A;  4OU0 A;  1WQ2 A;  2WC2 A;  1S8N A;  3HSR A;  4A0Y A;  4EV0 A;  4BHP A;  4OIR F;  3MAJ A;  3SQN A;  5ICE A;  4L0Y B;  3M8F A;  4RGX A;  3P7N A;  1XD7 A;  1I1S A;  2IA0 A;  2GZW A;  5DCM A;  4PZJ A;  3ZN1 A;  2K86 A;  5FFZ A;  3TDZ C;  2L54 A;  1UHW A;  4L9T A;  2PLY A;  4L9V A;  4RS8 A;  1IN5 A;  4WK8 F;  4WX9 A;  3LST A;  5CVR A;  4YFK F;  3C3W A;  2V9V A;  4TV7 A;  2A6H F;  5F1R A;  3Q5F A;  1ZGA A;  1D3Y A;  1IXC A;  1P6R A;  3TO9 A;  3P9C A;  1ZAR A;  3N4M A;  1FYL A;  3BJO A;  5FFX A;  3DV8 A;  4LB6 B;  1KU3 A;  1FPQ A;  3WTS C;  1TNS A;  2DTR A;  2R7F A;  4M6X A;  2HQN A;  1SMY F;  2D1V A;  1H0M A;  3CUO A;  2GA1 A;  3J81 K;  4XRF A;  1ZRE A;  2Z3Y A;  3E97 A;  4A0Z A;  1TQI A;  2RGV A;  1R7J A;  4EJW A;  3T1B A;  4L5J A;  4RAY A;  1ZRF A;  2JSC A;  3GEZ A;  4CZZ A;  1S7A A;  3I0T A;  1TQP A;  4QWQ A;  2GWR A;  3MZY A;  3F6V A;  3KZY A;  4GYI A;  4XSZ F;  3ML6 A;  3JSO A;  2HTS A;  2EV0 A;  4ESF A;  1IRF A;  2UXN A;  1FLI A;  2QQ9 A;  1R5H A;  1XGM A;  3R4K A;  3WTW C;  2EA2 A;  2PG4 A;  1BBY A;  5HLI A;  1J9I A;  2CFX A;  2RDP A;  5D5W B;  3WU1 B;  3LA3 A;  1XB4 A;  1ZRD A;  4G7O F;  4IHT A;  3H92 A;  1SD7 A;  1BJA A;  3V8J A;  1D8J A;  4FX0 A;  2EFP A;  1YW9 A;  3CDH A;  4BYY A;  1OYI A;  3BDD A;  4AIH A;  2QUF A;  2VBY A;  4R1H A;  2XAH A;  4Y13 A;  5D6F A;  3KLN A;  1UFM A;  5J8C A;  2H6B A;  3DF8 A;  1KA8 A;  3CUQ C;  4HLX A;  1FBS A;  1R00 A;  5HS9 A;  4L9N A;  1XGN A;  2IA1 A;  4I2O A;  5D5X B;  4KUM A;  1LJ9 A;  2PQ8 A;  3FXQ A;  3L2C A;  3VOD A;  2EA4 A;  3O2P E;  2VC1 A;  3R0A A;  4U88 A;  1B1B A;  1OMI A;  4KFC A;  1J0R A;  2PBI A;  2PMU A;  1XCV A;  2IVM A;  2B0L A;  3REO A;  1QBJ A;  3BWG A;  4KMF A;  5HDG A;  4Y17 A;  2VC0 A;  1S6L A;  4GXO A;  1MDM B;  1KU9 A;  2IJL A;  1YTY A;  5FB2 A;  1XGO A;  4PGG A;  4NHJ A;  1AWC A;  1JHF A;  3PQK A;  5J6X A;  3GXO A;  2VT2 A;  1O3R A;  2UZK A;  2VOO A;  2OAZ A;  2Y75 A;  5K5Q A;  3RKX A;  4DNC A;  3FXU A;  1F4K A;  1IXS B;  2ESN A;  1BC8 C;  2A61 A;  1QQI A;  2VOP A;  3ZP5 A;  2FXA A;  2X0L A;  1I1G A;  4YFX F;  3K0L A;  5HS7 A;  1YFH A;  3ISP A;  1P4A A;  1T6S A;  4GO1 A;  2O6G E;  2XAF A;  3KZZ A;  4M74 A;  1OPC A;  1Z7U A;  4IXA A;  4IVN A;  4S04 A;  3KCC A;  5FLX Z;  1ONV A;  5DCM B;  1JGS A;  2XHK A;  5BPD A;  1G3W A;  1U3E M;  1OYY A;  1MJB A;  1B9M A;  2QLZ A;  4R8H A;  2XAS A;  3Q9S A;  2YX4 A;  1F5T A;  4HZF A;  2RKH A;  5CVJ A;  1GXQ A;  3ECO A;  2NNN A;  1YLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...