3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords PROTEIN FEV
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
1T2KA 2VBXA 1R22A 1R36A 3R0AA 5E1ZB 1HBXG 4I0BA 2L3DA 2HEOA 2VN2A 4OINF 3O2PE 3RTRA 2ZJ2A 4EJVA 1FLIA 2HWVA 3WU1B 3K2ZA 2EFNA 2C6YA 5ED4A 5E17F 4A12A 4PGHA 3S2WA 2VONA 3M9AA 2D2WA 2Q2EA 3ZN0A 4HV6A 4IJAA 3QU6A 1QQIA 2E7XA 1FBQA 2LKPA 1YTYA 3OOPA 3ZN1A 6PAXA 4WXDA 1J5YA 2VODA 1XMKA 4EJWA 4S05A 5J8CA 2HTSA 4KN4X 1R23A 5LLQA 4MNUA 3REOA 3B02A 1GXPA 1V3FA 3LQQA 4Q47A 1LDJA 2O61A 1F9NA 2MA3A 3QAHA 2A07F 3T8RA 2XGXA 1PDNC 3M1EA 1ULYA 4LLGF 2RVCA 4LFUA 2IT0A 2XAHA 1YIOA 5F6FA 3SFZA 3CDHA 3HSFA 4WX9A 2RGVA 2FXAA 5ILUA 1B59A 4ESFA 4A6DA 4L9NA 2QUFA 4ENKA 2NNNA 3CTAA 4HBLA 3KEQA 3R6SA 2V6CA 3GUDA 2NNYA 1HW1A 4EMSA 4M71A 5IT3A 2ZXJA 3C3WA 2E1CA 2H94A 4Y13A 1HKTA 1I6XA 2Y48A 2QBYB 1G3YA 2BE5F 5DCFA 1FBSA 4WCGA 2XAQA 1ZREA 1OKRA 1XDSA 3E3VA 4HX7A 1UHMA 2ZMEB 4ENMA 2JT1A 4BQAA 3GFJA 1U5TA 3BPVA 4BHCA 1TNSA 3L00A 4G6DA 4A0XA 2DFIA 1S7AA 1BIBA 1R00A 1B4AA 4YIIA 3V8KA 2F2EA 3ZMSA 4L5JA 3FF5A 4ZYGA 1UCRA 3DPTA 3HTUA 4XLNF 1KU2A 1EH7A 5FD5A 3EETA 2HYGD 3HHGA 3FWEA 1REPC 4G7ZF 1MJBA 1ZARA 1MJ9A 1IF1A 1STZA 1KU3A 4LK1F 1MKMA 4BNCA 2VBYA 1E17A 1WKMA 4ETSA 1HQCA 4R8HA 2QWWA 1XB4A 1PUEE 3GEZA 2IP2A 3I59A 3BJAA 1FSEA 5KK1A 1EH6A 1O3SA 1ZH5A 1TQMA 4CO8A 2KRFA 5EEGA 1IN7A 4CICA 3R61A 3ML6A 1IN6A 2VC0A 1OYIA 1KYZA 1KGSA 2CGPA 3RI4A 5JFRA 5HS9A 1D5VA 1ZHFA 1W7PB 3KP2A 1W7PA 3BZ6A 2PQ8A 4Q48A 4PDKA 1XSXA 2LF7A 5FD6A 1BI2A 3C1DA 4O6JA 1YLFA 2Y0MA 3ERED 1K79A 5CYVA 3GX4X 4RB0A 1ZGAA 2G7UA 1R5GA 4G9YA 1FYMA 1KYWA 1SD4A 4CYDA 5F1RA 3ZMVA 4MHGA 3V8LA 2JPCA 3F23A 4GXOA 1TW3A 2IA2A 5BQTA 5D5UB 2ETHA 1XSDA 2KJCA 1JHHA 2JZYA 3K1MA 4KIGA 4U88A 3SZTA 1BI1A 2ZKZA 5ICCA 1Z1DA 3WTYC 5EEHA 2DQRA 1OYYA 2H6CA 4YG2F 1D8JA 2ZBKA 1D3YA 2WWYA 1HSTA 5ICFA 4RGSA 4AIHA 1B9MA 1O7LA 5D5VB 2FEZA 5HOOA 3HYIA 1SD5A 5E8IA 3QRFF 2COMA 2TDXA 1UFMA 3EYYA 3F8CA 2P5VA 5ERIA 5IT9K 3F22A 1ZN2A 2XV4S 4KMUX 3QU3A 2VOPA 2PLYA 5F64A 3C7JA 3V7SA 5LBQA 3TOBA 1TNTA 1S3JA 2IA1A 1QNTA 1IW7F 3GZ5A 2KIMA 2KJBA 3ELKA 5FLXK 4GGGA 3TO6A 4RAYA 2KIFA 1ON1A 2PEXA 2NRAC 4I98B 1YG2A 2W25A 3RKYA 1KQ9A 3E6DA 4BHPA 3J7AO 2MBFA 3ZMUA 2XUBA 1RNLA 4I01A 2V79A 1QGPA 4O3MA 3QPTA 3MWMA 2FNPA 3IWZA 1XGOA 4XLPF 2DQLA 4RGRA 4ZYDA 3H92A 3KE2A 2VBWA 1O3RA 2H27A 4CGZA 1ODDA 3KP3A 2K27A 5CVVA 5BMZA 2DPDA 1LEBA 2VE8A 4L9VA 2QENA 4EM1A 1TQIA 3LAPA 2D1VA 1KU7A 1MJAA 3E5UA 1YS6A 1BIAA 2ZO4A 2A5YB 2O8XA 3LFKA 4ON0A 4UVBA 1FYKA 2B0LA 2L54A 4RAZA 3WTSC 5ILVA 1Z91A 3I59B 3TO9A 3TOAA 3AAFA 1TBXA 1ZRDA 4HW0A 3I53A 3SHFA 1DPRA 2XRNA 3F8NA 3F72A 3OV8A 2P6TA 4A0YA 2O6GE 1RUNA 3N97A 1EV7A 3KZZA 4HX8A 1W5TA 2UWMA 5L3CA 5JHUA 4ESJA 3MFKA 3LWFA 1IXSB 4IRGA 3ECOA 3ROUA 1U5TC 3FHZA 2Y75A 3K0LA 1BJAA 1FYLA 2MLGA 2QQ9A 5E1XA 1ZG3A 1H9GA 1USTA 5FFXA 3RPUA 1KA8A 4FHTA 2Q0OA 2JSCA 5CVRA 5TJJA 2O0YA 5DCMB 1T39A 2RC4A 3BP8A 1J2XA 2JPBA 1O7FA 1XCBA 5ILSA 3Q9VA 3W6KB 2DLLA 4MTDA 3F21A 5L3FA 1FBUA 1JGSA 3QPHA 4U7BA 3HRSA 5HLHA 2A3SA 3COAC 5LEJA 1FX7A 1YW7A 2BYVE 1LB2A 2RKHA 2K86A 3RPQA 3TDUC 5DCMA 4XRFA 5A2QZ 3WGIA 4LMYA 2YPRA 1SFEA 4N0BA 3FMQA 1VTNC 2KKOA 2Z5UA 4UV9A 1F4KA 2LSOA 3MAJA 4A5NA 3E97A 5BS6A 5FLXZ 4IVNA 4HDUA 4BH9A 2NS0A 3RIRA 3SZPA 2OQRA 3F8FA 4EJUA 4G6QA 4EGZA 1FP2A 1U6GA 2STTA 1J59A 1Z7UA 4L9TA 2HZTA 3K9TA 1OR7A 3CO7C 1RIOH 5DUIA 4G7HF 5H6QA 1SFXA 4M74A 2BGCA 2UZKA 3J80K 5E1WA 5AONA 5H6RA 3CJNA 4N9HA 3CO6C 1QPMA 4KFCA 3V7CA 2ESNA 3FMSA 1BI0A 4NHJA 4JBAA 1F1ZA 5ICEA 4LG0B 2HR3A 3IHUA 1UB9A 2DTRA 1UHWA 1RZ4A 4RGUA 2XVCA 4EJTA 5CVIA 2P5LC 4OMZA 2DT5A 2Z3YA 2QM3A 2ZFWA 4WWCA 4G8XA 4M9XA 4N9IA 3VFZA 2H09A 2F5CA 2CFXA 5D8KB 3EQLF 4YFKF 2FOKA 2ADUA 1FC3A 1HKQA 1R7JA 4GYGA 1J7KA 1W7PD 3WTXC 5D4RA 2LF8A 4EVIA 4A5MA 3NQOA 3WE2A 3Q5FA 1OPCA 2RQPA 2W57A 3TGNA 3GFLA 4GCVA 3QP5A 5D5WB 2V1DA 3IKTA 1XGSA 3F8MA 3DF8A 3P7NA 1B6AA 3K1NA 4P96A 1R1TA 2M87A 2FF4A 1QO0D 1ZYRF 2K4JA 3KETA 3HOTA 4HQEA 1KU9A 3DPLC 1R1VA 5FGMA 3GVAA 1DDNA 4AD9A 4NQWA 4A0ZA 1FY7A 3JSOA 1TLHB 3FX3A 4HYEA 2M30A 4KICA 1RUOA 4RB3C 2V1UA 3H3UA 1QZYA 3K69A 1Q1HA 1MDMB 2HTJA 2K7LA 4G94A 3FXQA 1YS7A 2W84A 5K5QA 4UVCA 4PCQA 2OD5A 1G3SA 2O3FA 3ECHA 3I5UA 1X3UA 3HRMA 2P7VB 3O3KA 5L3EA 1YYVA 2XAFA 5D4SA 1FOKA 4L0ZB 1MZBA 1J0RA 2XKPA 2LDUA 4KDPA 1IXCA 3RYRA 2EV0A 2GA2A 2J5PA 5JR3A 3HTSB 2IPQX 1WWXA 1YW8A 2P7CB 3ZPLA 3GO5A 1XGMA 1DPUA 2P6SA 5K5OA 4Q4ZF 2PJPA 2HDCA 2IA0A 4PGGA 1K78A 1LDDA 3HRUA 3ZP5A 3JAMK 4U0WA 3TQNA 3VOEA 2HQNA 4IPAA 1U3EM 5HVQC 5K1YA 1HKSA 5D6EA 1AOYA 2V9VA 3WGGA 3E6BA 2DK8A 1WQ2A 5DD8A 2FA5A 4P5OA 2L01A 3ZMTA 5LEKA 3L2CA 4AIKA 2CQKA 2VE9A 3KP5A 2PG4A 2XROA 2CSOA 4K2EA 4O5VA 3P9IA 3B73A 3H3ZA 1ZLJA 2HQRA 4AVPA 1CF7A 3E5QA 4XBFA 3T1BA 1IN4A 2L02A 3J81Z 1FNNA 2FBKA 3P9KA 5HLGA 4IF4A 2J5OA 1IN8A 2HKOA 2D45A 2FMLA 4F7ZA 1WI9A 5HS7A 3JAMZ 3DEUA 4QLCU 2ZMEA 3GWZA 1ONVA 5JVTA 4A6EA 3U9GA 3E5XA 3C18A 5HDGA 3IL2A 3IWFA 4B8XA 1V4RA 1BM9A 5A2QK 2PMHA 3GXOA 3T0YA 5CJ9A 2JTVA 3GW2A 4LK0F 3TDZC 1SMTA 4KT5C 4RB2C 2W85A 3HSEA 4DQ2A 1XN7A 4YFXF 3DQVC 1PP8F 4Q5SF 3Q9SA 4M72A 2VXZA 1JXSA 3KFWX 1O57A 4TV7A 1R58A 2UXNA 1H0MA 3JTHA 5LRSA 5BOXA 2ZNZA 2AS5F 3KP6A 4L18B 2YSRA 4HOBA 2RDPA 1LDKB 1GHCA 4KIBA 1CGPA 4ENNA 4M6YA 2DPUA 4R79A 2GXBA 2CYYA 4FX4A 1JHFA 4IRHA 5D8LB 2OQGA 5HLIA 4OIOF 3GFMA 4KYWA 3LA7A 4QWQA 2OU2A 3WTVC 1DUXC 3VB2A 1AWCA 2A68F 3DV8A 2UXXA 4M6XA 4I2OA 2GQQA 3KP4A 1S8NA 3R60A 3R4KA 2ZCWA 1YFHA 3SQNA 3FXRA 1XSVA 1FP1D 5HDNA 5LGUA 2DBBA 2W24A 1TTYA 1T38A 4LLNA 3M8EA 3PQKA 3WU0A 3M7GA 4NB5A 2G7HA 2XASA 1BC7C 3BDDA 2HKXA 3KP7A 4D0PA 1HSJA 2EFPA 4I02A 3NEUA 4ZZLA 4U0YA 4UV8A 4LGWA 1XD7A 4UVAA 1IN5A 4CZZA 4JK1X 2X0LA 2NYXA 4ESBA 2EA2A 3LAJA 4UUVA 3I58A 5IT9Z 1G4DA 5L3DA 1T98A 4BYYA 2DW4A 2L4MA 1USSA 3FZVA 1LEAA 2CO5A 4P9UA 1FZPB 3BOQA 2QQAA 4HF2A 2VOOA 2YX4A 4M9ZA 2R7FA 4FT8A 5E8GA 1LJ9A 1W5SA 4HZFA 1P4XA 4P55A 1JE8A 2A61A 1QBJA 1Y0UA 5AIPA 2FBIA 3MCZA 4EGYA 1T0FA 1DP7P 3KZYA 4BHBA 3J81K 3F3XA 2ISZA 3IRQA 3QOPA 4LB5A 3M8FA 1QZZA 2CWEA 4OU0A 4HF1A 1HXDA 4RB1A 4ASNA 1SAXA 1KQ0A 1PP7U 2Z99A 4Z2YA 2O03A 1FSHA 4MQVA 2F5EA 4ENJA 3O6BB 2EFOA 2YU3A 3W6JB 3WTTC 3GLXA 1D8KA 1TQPA 2XIGA 3ULQB 2OZ6A 2GAUA 1XGNA 1BN5A 2QZ8A 1IRGA 3MZHA 3FM5A 1IZ1A 3IKVA 4IHTA 2FBHA 1ZG5A 2V1XA 5CLSA 3RKWA 1S7OA 3I64A 5D5XB 4WF2A 2Z33A 3RJPA 2FSWA 3F6VA 2R3SA 3ZMDA 2GXGA 4CXFA 1U78A 5LGNA 4KA4A 2RNJA 4HX4A 4EM0B 2YR2A 3NRVA 4ZH4F 3EDPA 1U5TB 2BEOA 5J8FA 2OZUA 1U8RA 2NAZA 2M5WA 4XSZF 2P5KA 5H20A 1I27A 2OBPA 1T6SA 5HDKA 2DK5A 1G6NA 2X4HA 3T5XA 2A6EF 1SD6A 3KLOA 4I0AA 3TO7A 4UXNA 2OA4A 1O3QA 3VEPA 1OMIA 3WE3A 3L09A 5DD4A 3I4PA 2K02A 3GZ6A 5K5RA 3JW4A 2WTEA 1L0OC 4MTEA 4M9SA 3D5LA 3FXUA 1P6RA 3BJOA 1KQ8A 1NHAA 4UHTA 3HHHA 4L9JA 4UNOA 1YW9A 1G3TA 2XKOA 3HUGA 4FX0A 2G9WA 2GZWA 1HW2A 4S04A 4ZYHA 3WGHA 1P4WA 1ZRCA 1LQ1A 4Y15A 1MGTA 2ACJA 3V7RA 3K1PA 3DP7A 1K78B 2FE3A 4A2UA 4E70A 4IHSA 2KIUA 2F5DA 4OIPF 4MGRA 2E7WA 2PN6A 3GYHX 2MH2A 2PBIA 3RDIA 1FT9A 2D1HA 3L7WA 1YO5C 4IRIA 2FNAA 3HOSA 2QLZA 1MDMA 2EA4A 3HSRA 4CDGA 2HOEA 2QQBA 3KEOA 1O3TA 3IRRA 4MEXF 1I5ZA 2M8EA 4WK8F 3CUQC 4IXAA 3BY6A 2FU4A 1S29A 2ZNYA 3LSTA 1R1UA 2M45A 5LRRA 3JSPA 1B9NA 2ESHA 3CUQA 3WG9A 1H9TA 2PFBA 5E20A 4U7DA 3J80Z 2E1NA 1Z6TA 4H0EA 4LG0A 5LHHA 2A69F 2HFHA 2EK5A 4CHUA 1XMAA 1IUYA 2XAJA 4WXCA 2P4WA 2CW0F 2L4AA 3WTZA 2BV6A 2YX7A 3G73A 3ZQ7A 3ABTA 4WXHA 3P9CA 4GYIA 4KIFA 3MEXA 4I09A 5E18F 2HGCA 4YFNF 1GVJA 2BBYA 5TRDA 4PZJA 2WC2A 3D0SA 2AXLA 5DUKA 3WTWC 3DXJF 3V4GA 3G3ZA 2QYOA 3F6OA 5BPIA 4OMYA 4LJZF 1IRFA 5FO5A 1SMYF 4EV0A 4L5IA 4RS8A 4HLYA 2IRFG 3GFIA 4G7OF 3VODA 2EFQA 3EUHA 3HIFA 3I71A 3RKXA 2FRHA 3WTUC 2OAZA 5CVJA 5LHIA 4XSXF 5AIQA 4ZYEA 3IC7A 3ZMZA 3L9FA 2PI0A 1FWZA 1LNWA 5L3GA 1E2XA 1L3LA 4OIQF 4I7HA 5ICGA 2EV6A 3U1DA 1EH8A 2PMUA 3V8JA 4BXUA 2MC3A 4GO1A 1BC8C 1C0WA 3MQ0A 5DEQA 3JTGA 3LQRA 2Z9OA 1R5HA 3KCCA 2DU9A 1Z6RA 2P8TA 1J9IA 1G3WA 3WODF 2R7DA 3T8TA 2VBZA 3BWGA 3CUOA 2DI3A 1YQAA 3CUQB 3LA3A 1I1GA 4B09A 4OOIA 2MLKA 3BJ6A 3MZYA 4HF0A 4YIFA 2FMYA 1Z9CA 1U2WA 2IJLA 3E6CC 2JRTA 4EJOA 3U2RA 1SFUA 2HYFA 2EFWA 1RI7A 4L0YB 5J6XA 2GIVA 4OIRF 4EQQA 4KMFA 3RYPA 1CF7B 1BOAA 4U0VA 1WRJA 1K6OA 2XHKA 2DO7A 2A6HF 2RV8A 1ON2A 5L3BA 1MD0A 1BI3A 1TW2A 5DV5A 2EV5A 5D6FA 4HAMA 3BROA 5JI6A 5KVRA 2EJRA 2IVMA 5HS8A 4LLLA 2GWRA 1I1SA 3I54A 1HW5A 1J75A 2QVOA 1BBYA 3PFIA 4EM2A 5DDGA 4HDVA 3ABUA 4JQFA 2H6BA 4KNYA 3N4MA 2ELHA 4HA8A 5LHGA 1WSUA 2RN7A 3E6MA 1P2FA 1LVAA 1SD7A 1IAWA 2HS5A 5BPDA 4M73A 4LB6B 3DKWA 1Z05A 4HV5A 5DYMA 2Q8KA 4RGXA 4KN7X 3ISPA 1OYWA 1W4MA 4MQ9F 2IW5A 3HRTA 3FM3A 2K4BA 3SXYA 2VT2A 4P9FA 4AIJA 2M1BA 4R1HA 1A04A 4Y17A 1K7AA 3I0TA 2ISYA 4KUMA 3FMRA 2VT3A 1P92A 1F5TA 3QP6A 3BPXA 2XAGA 4BAYA 1P4AA 4HQMA 3GF2A 4HLXA 3EYIA 1S6LA 1B1BA 1XDUA 2EB7A 3R0JA 3DFGA 2FQ3A 3LA2A 5CVUA 2MD5A 3TKYA 1IXRC 4MEYF 5FB2A 1XCVA 4DNCA 3CLOA 5LGTA 2STWA 3KLNA 3PQJA 2F5FA 2DAOA 3F8BA 2LNBA 2VC1A 4ZZDA 2CG4A 1ZGJA 2GA1A 1ZG1A 5FFZA 1ZAOA 4LD5A 1FPQA 2WV0A 1ZRFA 2MH9A 1ZLKA 4AWXB 2EWNA 1GXQA 2QBYA
chains in the Genus database with same CATH superfamily
5EJCA 1T2KA 2X1DA 2VBXA 1R22A 1R36A 3R0AA 3JRFA 1XPXA 5E1ZB 1HBXG 4I0BA 2L3DA 5GAHJ 3CCUI 2DOAA 2HEOA 2GIZA 1HA8A 1IUFA 1RKWA 3H3VK 2VN2A 4OINF 3O2PE 3RTRA 2ZJ2A 4PK4A 4EJVA 1FLIA 1W36D 2HWVA 3WU1B 3K2ZA 4BDZA 2EFNA 2C6YA 4LIUA 5ED4A 2QQ8A 5E17F 2CQ7A 2ZC2A 1NH3A 2JA2A 4ZJZA 4A12A 4PGHA 2R7UA 3S2WA 1OCZH 1VQPI 2VONA 3OYJA 4C3JJ 3M9AA 2BVMA 3VSLA 2D2WA 2DN0A 4D1QA 2Q2EA 3ZN0A 1Y56A 4HV6A 4PJNA 5FLMJ 1LVKA 4IJAA 3LSMA 5F0CA 3ASOH 1QQIA 2E7XA 1FBQA 2EH3A 2LY1A 3QU6A 4XLHA 4PJMA 2QGUA 3L2QA 2LKPA 3FHNA 1B8IB 2WA0A 1YTYA 2R7RA 3OOPA 3ZN1A 6PAXA 5CKTA 4WXDA 1J5YA 2F6CA 2VODA 1XMKA 1I39A 3S8PA 4EJWA 4S05A 2MABA 2DFEA 5J8CA 2JMWA 3O8HA 1A31A 2HTSA 4XKBA 2LLKA 4KN4X 3CJTB 1H89C 1R23A 2WB1A 5LLQA 4MNUA 3REOA 3OS1A 3DTIA 4J19A 1IRZA 1V55H 4BQNA 3B02A 2DJIA 4U87A 1GXPA 3IH2A 1AU7A 1V3FA 2E1MB 3LQQA 4Q47A 1LDJA 2O61A 1F9NA 2MA3A 3QAHA 3K7AJ 3T8RA 2A07F 2K85A 2XGXA 1IV6A 1AKHA 1PDNC 1T95A 2CUZA 2Q2EB 3M1EA 1ULYA 1D0YA 2IGOA 4LLGF 1ZK8A 2RVCA 4LFUA 3BQZA 2CUJA 4IL6C 4XOTA 1ETWA 2IT0A 2XAHA 1VNDA 3E7LA 1VQ7I 1YIOA 2X6OA 5F6FA 1D1BA 1X4PA 2BOLA 2R7SA 3SFZA 3CDHA 1XX5A 3HSFA 4WX9A 2RGVA 2FXAA 3LSGA 5ILUA 1B59A 4ESFA 4MO7A 4A6DA 4L9NA 1KONA 2QUFA 4FCYA 3S1RJ 4ENKA 2NNNA 3CTAA 4HBLA 5M5WJ 3KEQA 3OL4A 3R6SA 2E5NA 2KFDA 2V6CA 2GXAA 3GUDA 2NNYA 1HW1A 4EMSA 4M71A 4PSXA 3LSKA 5IT3A 2BY1A 2ZXJA 3QQAA 4BJTA 4XKVA 3C3WA 2E1CA 2KL4A 2H94A 4Y13A 1HKTA 1I6XA 3LNQA 2WV1A 4RLQA 5J3LA 1RRJA 2R5ZB 2Y48A 2QBYB 3H9JA 2CUFA 1G3YA 2BE5F 5DCFA 3PIOF 1FBSA 3GCMA 4WCGA 1BR1A 1YI2I 2XAQA 2OTLI 1E3HA 1OFCX 5C4XJ 2X48A 3DLAA 3MN2A 3B6CA 1ZREA 3E1SA 2R5YA 1OKRA 2R7OA 1XDSA 3E3VA 4HX7A 3BTCA 1UHMA 4W1UA 2M4KA 4EATA 4XONA 2ZMEB 3NWTA 2WAQN 4IQ4A 4ENMA 2JT1A 4BQAA 1IO2A 2EZLA 3CLQA 1U5TA 3GFJA 5E3LA 3BPVA 4BHCA 5IPAA 4YRVA 1TNSA 3L00A 4G6DA 2VPRA 4PFOA 5M5YJ 5EGOB 4A0XA 2DFIA 1S7AA 2JA6J 4BBRJ 4ZDOA 1BIBA 1R00A 1B4AA 4YIIA 1MBJA 3V8KA 5GP9A 2F2EA 1UG0A 3ZMSA 2W82A 3FF5A 4L5JA 1GDTA 3M07A 1VZ0A 5HNHA 2QA4I 3HOWJ 2ID6A 4PFPA 2DMPA 2BW3A 2F4MB 4ZYGA 1UCRA 4BE2A 3DPTA 3HTUA 4XLNF 1KU2A 1EH7A 1OCRH 5FD5A 4Z6YA 3BZKA 3EETA 1JGGA 2HYGD 3DTKA 3HHGA 1SVOA 2CV2A 3FWEA 1PVEA 1REPC 4G7ZF 4BEHB 1MJBA 1ZARA 1MJ9A 2FD5A 1Y6IA 3JRHA 1IF1A 1STZA 4M3FA 1ZELA 2K5CA 1KU3A 2AHQA 2JJ7A 3TMOA 4FQGA 4LK1F 2KDZA 5JVGF 1MKMA 4BNCA 2VBYA 1E17A 1WKMA 2E1OA 2LVSA 3A0HC 4ETSA 3FK6A 1LPQA 2ZXHA 1HQCA 3C2GA 3QOEA 3DU5A 4R8HA 4J01A 2QWWA 1XB4A 4Y7NJ 2KRCA 1JJ8C 2ZJPF 1W0UA 1PUEE 4JX4A 3J7YJ 3GEZA 1LFBA 2IP2A 3HPHA 3I59A 3BJAA 3H0DA 1FSEA 5KK1A 5JLXA 2V9PA 1EH6A 4UUTA 2Y0SN 1O3SA 1ZH5A 1TQMA 2JUGA 4KJZA 4CO8A 4F52A 3OS0A 2KRFA 1GVDA 2L9SA 2H1KA 5EEGA 2R5ZA 1IN7A 2XF6A 3HOZJ 2TRTA 1SFKA 4CICA 1IV8A 1MH3A 3V42A 3R61A 3BR2A 3ML6A 4FISA 1IN6A 3G4SI 4AM3A 4MLOA 4Y52J 1V5FA 2IGKA 2VC0A 4XKCA 1OYIA 1MMDA 1KYZA 1KGSA 2CGPA 3OR1C 3RI4A 3TEDA 2LYCA 5JFRA 2WAFA 5HS9A 1D5VA 1ZHFA 4JYKA 4RMNA 3CCMI 1W7PB 4I76A 4E4HA 3KP2A 5E3OA 4V2FA 1U9NA 1W7PA 3BZ6A 1YIJI 2PQ8A 4Q48A 4IOCF 4PDKA 2W4SA 1XSXA 2LF7A 2UUZA 3S14J 5FD6A 3GZNB 1BI2A 1DU0A 4YELA 3OYLA 3QYEA 1BR4A 3C1DA 4O6JA 3OYHA 5IY5H 1R49A 1YLFA 2Y0MA 3ERED 3GTMJ 3I3LA 2DMUA 1JTXA 2MG4A 1K79A 3HZJA 4XNFA 1I3QJ 4RB0A 5CYVA 3GX4X 2QF7A 1FIAA 2FOWA 2BW3B 3DBRB 1K61A 1ZGAA 2G7UA 1R5GA 4G9YA 3B6AA 3HL2A 1FYMA 1KYWA 1SD4A 2LH9A 4CYDA 1FIPA 4RA2A 3VYSB 4ZDLA 5F1RA 9ANTA 3ZMVA 2WBMA 1LKXA 4XORA 4MHGA 3V8LA 2JPCA 1QRYA 1S9HA 2VQHA 2XPVA 5M5XJ 5DM6F 3F23A 1W36C 4GXOA 4A3LJ 1TW3A 2PMZN 2IA2A 5BQTA 5D5UB 3VYUB 2ETHA 1XSDA 3TP0A 1YRNB 2BHZA 3M8JA 3JR9A 2KJCA 2V4JC 1JHHA 3IUOA 2IS6A 2JZYA 3K1MA 1X1DA 2VB6A 4DZJA 3HUGB 4KIGA 3S3OA 4II3A 4U88A 3OYFA 2CUEA 4W97A 3SZTA 1MMGA 2ZKZA 1BI1A 4A93J 2I8DA 4IX7A 2A6TA 2EIJH 5ICCA 1Z1DA 2GOXB 3WTYC 1TT0A 2EZIA 4RBOA 2V9KA 3MD2A 5EEHA 2XC7A 2DQRA 1OYYA 1UMQA 2H6CA 2H8WA 4YG2F 3SYTA 1D8JA 2XSJC 2ZBKA 1D3YA 2WWYA 1HSTA 1TWAJ 5ICFA 3RSNA 1OCTC 4RGSA 4AIHA 1B9MA 1O7LA 5D5VB 1YJNI 2FEZA 1JKQC 5HOOA 5JLWA 4FE7A 3HYIA 1SD5A 5E8IA 3CC7I 2VJ5A 2HQ5A 3QRFF 4JX5A 2OF7A 2COMA 2TDXA 3SZGA 1ETYA 1Q1VA 1UFMA 3NAUA 4XICA 1Y39A 3EYYA 3L1PA 1OLTA 3F8CA 3FKJA 2P5VA 5ERIA 3OS2A 2QEXI 3FXJA 2E2HJ 3F22A 5IT9K 1A5JA 1ZN2A 2XV4S 3KYCB 4KMUX 3QU3A 2DT7B 1ETXA 1LUJB 2VOPA 2OC6A 4IZZA 2PLYA 2Z1DA 3L2VA 3M1CA 5F64A 3C7JA 3V7SA 5LBQA 3CMEI 3TOBA 1WJBA 3KPHA 1TNTA 1S3JA 1SVLA 5GADJ 2IA1A 1QNTA 3GZ5A 2Y30A 1IW7F 2KIMA 3RCOA 2KJBA 3ELKA 4P1WA 5FLXK 4GGGA 3TO6A 4RAYA 2KIFA 3NARA 1ON1A 2PEXA 2NRAC 2IS2A 4I98B 1H88C 1YG2A 4IKFA 3ZQFA 2W25A 2OCCH 4AYBA 3RKYA 1KQ9A 2ZSHB 3E6DA 3HKZN 4BHPA 1F36A 3TBIA 3J7AO 3D5RC 1JKRC 2MBFA 2XAUA 2E5ZA 1EJ9A 3ZMUA 2M8GX 4DGWB 2XUBA 1RNLA 4I01A 2QSFX 2V79A 1QGPA 5J1YA 4O3MA 1G2HA 2Y2ZA 2O5RA 3QPTA 4OWRB 2IEKA 3MWMA 3JRIA 2FNPA 4X6AJ 3CDIA 4CSWA 3M4OJ 3IWZA 4A3JJ 1XGOA 4XLPF 2DQLA 3LSHA 3DEWA 2X1CA 2P81A 2M2EA 1FOYA 2G0EA 2O7OA 3DWLE 4RGRA 4ZYDA 5EEAA 3H92A 5C44J 1DGWY 5GTHC 2VXDA 5E79C 1VQNI 2LMDA 3KE2A 2DT6A 2VBWA 3OYMA 4AC0A 3DCFA 1O3RA 5IOYA 2H27A 3QODA 1ODDA 4CGZA 3KP3A 1PUFB 2K27A 3K10A 5CVVA 5BMZA 2DPDA 1LEBA 2V26A 2R0QC 2VE8A 1VF9A 2E1MC 3HB9A 1I3AA 4L9VA 4CA0A 2QENA 4EM1A 1TQIA 1YE9A 1Y8QB 3LAPA 2H8RA 2D1VA 4XLEA 3CCQI 1KU7A 4A3FJ 5FRMA 2KMUA 1MJAA 3OSFA 3E5UA 1N78A 1VQ4I 1YS6A 1BIAA 2ZO4A 2A5YB 2O8XA 3LFKA 4ON0A 1EKEA 4IHYA 2E2JJ 4UVBA 2BY0A 4LG3A 1FYKA 4DBRA 4CCOA 2B0LA 2L54A 2LR8A 4RAZA 3IAS2 4BJ6C 1Z91A 3I59B 3TO9A 5ILVA 3WTSC 1XTAA 1HF0A 2IS1A 3DKXA 3CP8A 3TOAA 3AAFA 3FK7A 1TBXA 1OCCH 1ZRDA 4HW0A 1MNEA 3I53A 3SHFA 1JKPC 2ZXIA 1DPRA 5EZGA 2XRNA 1O4XA 3F8NA 5F1JA 1T8IA 2VJJA 4H4KC 2HQAA 3F72A 2XF7A 3OMYA 3OV8A 3CP2A 2P6TA 4A0YA 1WH7A 2O6GE 1RUNA 2D5VA 1K83J 3N97A 1EV7A 1V5GA 3KZZA 3QYFA 3S3MA 4HX8A 1W5TA 2UWMA 2XSDC 5L3CA 3FBIB 3OL3A 3CCVI 5JHUA 2K9NA 1A6IA 1QVUA 4DIQA 5EG0B 4ESJA 3MFKA 2CV1A 3OYKA 4XLAA 3LWFA 1IXSB 4NC7A 4IRGA 3ECOA 3ROUA 1WJCA 2LKSA 1U5TC 3FHZA 1X1BA 2Y75A 3K0LA 3VYRB 1BJAA 3HGGA 1AA7A 1FYLA 2MLGA 2PX9A 2QQ9A 5E1XA 3RZOJ 1P7IA 1H9GA 1ZG3A 1JTYA 1USTA 5FFXA 2IBDA 3RPUA 1KA8A 4FHTA 2Q0OA 2JSCA 1HCRA 5CVRA 5TJJA 2O0YA 5DCMB 1T39A 2RC4A 3ZQQA 3BT9A 3AG3H 3BP8A 3S1NJ 3BTLA 1X3WB 1J2XA 3K6GA 2JPBA 1O7FA 2HVRA 1XCBA 2ZJQF 4CCKA 1R5ID 5ILSA 2HPIA 3Q9VA 3WU2C 1PUFA 3W6KB 4XRMA 2DLLA 4MTDA 4D9JA 4I99C 2YUSA 2R4GA 3F21A 5H2FC 5L3FA 1FBUA 2DA4A 3L2RA 1JGSA 3QPHA 3AFHA 4U7BA 3HRSA 2F48A 2A3SA 5HLHA 3JRCA 3COAC 5LEJA 1FX7A 1YW7A 2BYVE 4MFEA 1LB2A 2RKHA 3HOXJ 1VQLI 3PNTA 1VQ5I 2K86A 3CC4I 5DM7F 2EZKA 3RPQA 5IOZA 3TDUC 4C2TA 2Y31A 4M6VA 5DCMA 1ZKGA 3WG7H 3E0JB 5EF6A 3W6VA 4XRFA 5A2QZ 3WGIA 4LMYA 2YPRA 1ERDA 1SFEA 4N0BA 3FMQA 2DA7A 3JRBA 1K6YA 1VTNC 1W1WE 2KKOA 2Z5UA 4HG2A 4QPOA 4UV9A 3U1KA 3F0CA 2EINH 1F4KA 2LSOA 2LC2A 3MAJA 5IYBJ 2VPLA 4A5NA 2LY2A 4LOCA 3E97A 3LL7A 5BS6A 5FLXZ 4E7JA 1A35A 2AO9A 2DA3A 4IVNA 2K9SA 2P0WA 4RLFA 3OYBA 4HDUA 4BH9A 4HSTA 2IS4A 1X4OA 5BNGA 2KZGA 3HM5A 2NS0A 3RIRA 3SZPA 1VI0A 2LREA 2OQRA 3F8FA 4EJUA 3GMEA 2FQ4A 4G6QA 4EGZA 1FP2A 1U6GA 2STTA 4C3IJ 1J59A 1MBFA 1Z7UA 3I55I 4L9TA 1Z7LA 2HZTA 3PUBA 3K9TA 1OR7A 3CO7C 1RIOH 5DUIA 2DJNA 4G7HF 1GUUA 3CJQB 2DODA 5H6QA 3CMMA 2V6EA 1SFXA 4M74A 1N77A 2BGCA 2UZKA 3J80K 1T56A 3LSJA 4OAYA 5E1WA 5AONA 5H6RA 4CYCA 5KAFC 4BUPA 2XF5A 1P7JA 2E36A 4XK4A 2OV7A 3CJNA 2EPFA 4N9HA 3CO6C 1QPMA 4KFCA 1X19A 3QWLA 3V7CA 4XQFA 3S93A 2HOTA 4HRIA 2ESNA 2M3AA 3FMSA 2F4OB 1BI0A 2ICWG 4NHJA 1Z3XA 1OR7C 4QTRA 1SANA 4BQQA 2WY7Q 4AVZA 4B48A 1WJDA 4JBAA 2L9NA 1F1ZA 5ICEA 4LG0B 5KAIC 2HR3A 3DTEA 2R7ZJ 3IHUA 1UB9A 5GPAA 2DTRA 4FTHA 1UHWA 3ZRGA 2KZVA 2VKEA 1RZ4A 4RGUA 4ZTJA 3H9GA 1ZR2A 2XVCA 4EJTA 1OCPA 3S1MJ 2W1OA 5CVIA 2P5LC 4IO9F 1GT0C 1R9TJ 1J09A 4OMZA 5EZHA 2V1NA 4FETA 2DT5A 4UY8I 3SDGA 2M34A 2Z3YA 2QM3A 2ZFWA 4WWCA 1ZQ3P 4HNUA 4G8XA 3LSIA 4IHWA 4M9XA 1VQ6I 4N9IA 3VFZA 2H09A 2F5CA 2HZDA 2DMQA 2CFXA 1HDDC 2ZMEC 3EQLF 5D8KB 2CQXA 4YFKF 1H8AC 2FOKA 5K7ZA 1B72A 1E3OC 1I50J 3BTJA 3Q0UA 2ADUA 5EGOA 1FC3A 1X1CA 2Y9ZA 1HKQA 1R7JA 4GYGA 1J7KA 3H5NA 1W7PD 3WTXC 5D4RA 2LF8A 4EVIA 1ORKA 3HPGA 4A5MA 3NQOA 1TL8A 5C4JJ 2MGQA 3WE2A 5KNLA 4B44A 3Q5FA 1OPCA 2RQPA 2W57A 4NDLA 3TGNA 4RDUA 1HOMA 2EIMH 1D1CA 3GFLA 4GCVA 4M3EA 3QP5A 2DMNA 5HNFA 5D5WB 2V1DA 3IKTA 3VWBA 2BY3A 1XGSA 3F8MA 3DF8A 3L2WA 3P7NA 5DS9A 1B6AA 3K1NA 3K70D 1QHHD 4P96A 3HC7A 1R1TA 2IAIA 2M87A 4E7LA 2V7FA 4LITA 3CD6I 2FF4A 5FKNA 2OUMA 2E19A 5IP6A 1QO0D 3S32A 1ZYRF 1JT6A 2K4JA 3KETA 1SVMA 3HOTA 4HQEA 1KU9A 1FOXA 3ERMA 3DPLC 3MZ8A 4B43A 1R1VA 3H9QA 5FGMA 3GVAA 4B3AA 2GLOA 3OIOA 4MFDA 4AD9A 4XLCA 1DDNA 4NQWA 3OYGA 4A0ZA 3H36A 3D5SC 2KP6A 1FY7A 3JSOA 3S3NA 1TLHB 3FX3A 2MFZA 4BE1A 4HYEA 2M30A 4G12A 4KICA 1RUOA 3K4BA 4RB3C 2VL8A 2V1UA 3ABLH 3H3UA 1A36A 2HXIA 1QZYA 3K69A 3GTPJ 3Q0WA 1Q1HA 1MDMB 4C2UA 2HTJA 1MH4A 2K7LA 4G94A 1QU3A 3FXOA 3FXQA 1YS7A 2W84A 3C2BA 4DZPA 4UVCA 2M9HA 5K5QA 3L2UA 3HOVJ 4PCQA 2OD5A 2E60A 2KLOA 3LFUA 2K40A 1G3SA 3JRAA 1SEUA 2QSGX 2O3FA 4ABZA 3ECHA 4RM3A 4V2GA 3ZXSA 4A3KJ 2HI3A 3K70C 3CCEI 3I5UA 1X3UA 3HRMA 1TWHJ 2P7VB 2X85A 4HPQA 3O3KA 2K9LA 4CCLA 5L3EA 1YYVA 2XAFA 1B8IA 5D4SA 1FOKA 4L0ZB 1MZBA 1J0RA 2XKPA 4PJJA 2LDUA 4KDPA 1IXCA 3RYRA 4G6TB 2EV0A 2GA2A 4CCMA 1MMSA 4C30A 1K4TA 2J5PA 5JR3A 3G6EI 3OYAA 3HTSB 2IPQX 4GFBA 2HVQA 1WWXA 1UZCA 1YW8A 3K4JA 2P7CB 3ZPLA 2ZB9A 3ZCOA 4I6ZA 4J00A 3GO5A 4ANJA 1XGMA 2JA8J 1DU6A 4JX6A 1ITYA 1DPUA 3RPUD 2P6SA 1Z3YA 3IH4A 1DP3A 1VQKI 5K5OA 1R4NB 4Q4ZF 2PJPA 1T08B 1WJEA 2HDCA 2L0KA 1ETQA 2X1EA 2IA0A 4PGGA 1QVTA 1K78A 3A4CA 1LFUP 1LDDA 3HRUA 4A3CJ 3K4LA 1A6QA 3ZP5A 3JAMK 4RM2A 4U0WA 3TQNA 4JOMA 3VOEA 2HQNA 4IPAA 2XB0X 5EYRA 5HVQC 1U3EM 1HKSA 2XPWA 5D6EA 2I10A 5K1YA 4A3BJ 1AOYA 2MYSA 2V9VA 2VJIA 3WGGA 1SC7A 5EDNA 2GM4A 3E6BA 2DK8A 1MNDA 1WQ2A 5DD8A 2FA5A 3GLLA 4P5OA 2W00A 2L01A 3ZMTA 5LEKA 3GTKJ 3L2CA 4AIKA 2CQKA 2VE9A 3KP5A 1MMAA 2PG4A 5FJ8J 4BGDA 2XROA 2CSOA 1FJLA 1BW6A 3PFYA 4K2EA 4O5VA 3P9IA 3SEZA 3B73A 3H3ZA 4EEFG 1ZLJA 2HQRA 3RZDJ 5J4VA 3GTQJ 2VUMJ 4AVPA 2RAEA 2GBYA 1CF7A 3E5QA 5K7HA 2ZJRF 4XBFA 4AU7A 2NS7A 2DA1A 3BG3A 1U9OA 3T1BA 4F91B 3JREA 2CQQA 1ZGWA 1IN4A 2L02A 1MBKA 1FNNA 2M0CA 3CCYA 4XL9A 3J81Z 2ME0A 4CZCA 2FBKA 4DYRA 3P9KA 5HLGA 4NUBA 4IF4A 4UUSB 3K4CA 1ETVA 2J5OA 4UB8C 2LP0A 1IN8A 2HKOA 2D45A 4XMYA 2LBFB 2JA5J 2FMLA 4F7ZA 1WI9A 5HS7A 5E3NA 3JAMZ 1QPIA 3DEUA 1X2MA 2IGMA 3SJMA 3CCRI 4QLCU 2NVQJ 2ZMEA 3GWZA 1ONVA 1IC8A 3I56I 2CV0A 5JVTA 3FXKA 4A6EA 4DBQA 5J1RA 3U9GA 3E5XA 2Y69H 2JUCA 2B9SA 1MMNA 3C18A 5HDGA 1G8XA 1R71A 3IL2A 3IWFA 4B8XA 5J4YA 4MIMA 1V4RA 1BM9A 5A2QK 1IDYA 1BR2A 2PMHA 3GXOA 3T0YA 5CJ9A 2JTVA 3GW2A 4LIVA 2X6YA 4LK0F 5C3EJ 3TDZC 3AG2H 1SMTA 4KT5C 4RB2C 5TISC 2W85A 5M3FJ 3HSEA 4DQ2A 2W48A 1XN7A 3OWTA 4YFXF 1Y8RB 3DQVC 3H35A 1PP8F 4Q5SF 3Q9SA 4M72A 2VXZA 1JXSA 3KFWX 1O57A 1X3ZB 1WFXA 3LOCA 1RPWA 4TV7A 1R58A 2UXNA 3A02A 1H0MA 3JTHA 4ZTFA 5LRSA 4BACA 5BOXA 2ZNZA 2QKMB 2AS5F 2KIQA 3KP6A 4L18B 1VQ8I 3AKZA 4XKWA 2Q1ZB 3KIOA 1TWFJ 2YSRA 4HOBA 1KZHA 2RDPA 1LDKB 3LSPA 3EUKL 3TP3A 1GHCA 4KIBA 1GV5A 4BXXJ 1CGPA 4ENNA 2F4IA 4CUGA 4M6YA 4BY7J 3BR3A 2UV1A 3ABKH 2NVUB 3BG9A 4FE4A 5GAGJ 2DPUA 1IRXA 4R79A 2GXBA 3OSGA 2CYYA 3BG6A 4FX4A 1JHFA 4IRHA 5HODA 2QCOA 1RKTA 5D8LB 2OQGA 5HLIA 4OIOF 3GFMA 2KRHA 2HPMA 1MIJA 3LA7A 3W3CA 4KYWA 3ZGKA 4QWQA 2OU2A 3WTVC 1ETKA 1DUXC 1U8BA 3VB2A 1AWCA 3BQYA 2A68F 3DV8A 3OOUA 3FXMA 2VI6A 2UXXA 4M6XA 4I2OA 2GQQA 3KP4A 4HNVA 4X1EA 2O8KA 1S8NA 4DOZA 4Y33A 2PJRB 3R60A 3R4KA 2ZCWA 1YFHA 2DFFA 3SQNA 3FXRA 4XIDA 5HLTA 2CRGA 1XSVA 1FP1D 4XN3A 2EBIA 5LGUA 5HDNA 2A5WA 2OPTA 4E7ZA 4QIWN 2DBBA 2W24A 1NK3P 1TTYA 2WADA 1T38A 4LLNA 3M8EA 3PQKA 3WU0A 1RC9A 4IHVA 2L5QA 3M7GA 4XM3A 4NB5A 2G7HA 3BC8A 2XASA 1BC7C 1P9QC 3A03A 2Z16A 1JUSA 3CJRB 4BL0B 3BDDA 5KHDA 3SDBA 2L2OA 2VQLA 2HKXA 2LTPA 3KP7A 2JK3A 4D0PA 1HSJA 2XGCA 2EFPA 1WVRA 4I02A 3NEUA 4ZZLA 4U0YA 4UV8A 2L7KA 4LGWA 3HG9A 4NBQA 1XD7A 2XRLA 4UVAA 1IN5A 4XR6A 4CZZA 4JK1X 3DU6A 2X0LA 2NOGA 2NYXA 4ESBA 2NVYJ 2RREA 2L7FP 2EA2A 3LAJA 2YS9A 2O9LA 2MD0A 4UUVA 4M3DA 5F04A 3I58A 1S72I 1XS9A 2FUG2 3CZ6A 1HC8A 5IT9Z 1WGXA 4PJLA 1G4DA 1T33A 4B3XA 4KT6A 1EA3A 4C3HJ 4BBSJ 2FJ1A 5L3DA 2AXTC 1T98A 4S0HB 4BYYA 2EIKH 1SAUA 3H1CA 2DW4A 2FX0A 1USSA 2L4MA 3FZVA 4BXFA 3S16J 5J40A 1WI3A 2VJ4A 3OYDA 3EPZA 3Q3SA 1LEAA 3W2AA 2CO5A 4P9UA 3BCAA 4KITB 1FZPB 2BXYA 3BOQA 5TGTA 4F93B 1MNMC 3OIPA 2QQAA 2JN6A 3D1NI 4HF2A 1WJAA 3OR2C 1YHQI 2VOOA 2JVGA 3MKLA 3CF5F 2YX4A 4M9ZA 1V54H 2R7FA 3A01A 4FT8A 5E8GA 1LJ9A 1JUMA 1W5SA 2ZXWH 4HZFA 1P4XA 4P55A 2K9MA 2JSPA 1JE8A 2A61A 1QBJA 2PMZA 1Y0UA 4GRIA 5AIPA 2FBIA 1M1EB 3MCZA 4EGYA 1T0FA 2DFHA 1DP7P 3KZYA 5LFAA 3ZQGA 4BHBA 3JRGA 3J81K 3F3XA 2EQRA 2LKXA 2ISZA 3IRQA 3QOPA 3WHCA 4LB5A 1IG7A 5FLVA 2CU7A 2ELJA 3M8FA 3ASNH 3HXLA 1PJRA 1QZZA 4F3QA 2CWEA 4OU0A 4F55A 4HF1A 4F92B 3A2KA 1HXDA 1X2NA 4RB1A 1X58A 4ASNA 1SAXA 2IXSA 1KQ0A 2Z99A 1PP7U 4Z2YA 2O03A 1NG7A 4DYQA 4MQVA 2BY2A 2XDVA 5J47A 2JQ7A 1FSHA 2F5EA 3O6BB 1W5CC 2EFOA 2YU3A 2OJED 3W6JB 4ENJA 2NXNB 3OY9A 2HU9A 4YEJA 3WTTC 3GLXA 3HOYJ 1D8KA 3QYBA 1TQPA 4A3EJ 2XIGA 3ULQB 4CCNA 1U0JA 2BXZA 2OZ6A 2ECCA 2F5VA 3K4MA 2GAUA 1XGNA 3UKGA 1BN5A 2MW8A 2QZ8A 3PM1A 1IRGA 4NC8A 3MZHA 3FM5A 4IOAF 4B4CA 1IZ1A 3CMAI 1ZTRA 3IKVA 4ZC3A 4IHTA 2FBHA 2OCEA 3BG7A 1ZG5A 1K4SA 2V1XA 5CLSA 3RKWA 1S7OA 3VYTB 3I64A 4BJ5C 5FKKA 1WJFA 4WF2A 5D5XB 3ABMH 4BY1J 2Z33A 1CQTA 3OYEA 3DBLB 3RJPA 5F0FA 2FSWA 3F6VA 2R3SA 4E7IA 3BZCA 3ZMDA 4FASD 5IP9J 1BA5A 2GXGA 4CXFA 4AIDA 1U78A 2Y0SA 5LGNA 4KA4A 3KX2A 2RNJA 4HX4A 4EM0B 1BOBA 1SFOJ 2YR2A 3NRVA 4ZH4F 4OAZA 3EDPA 1U5TB 2BEOA 2I5UA 3M3YJ 2EZHA 5J8FA 3QPLA 2HXOA 1HDPA 3ZQIA 2OZUA 1N25A 1OQYA 1U8RA 2NAZA 2M5WA 4XN0A 4DJAA 5GTIC 1VFCA 4XSZF 3FXLA 2P5KA 3BLYA 3BR5A 5H20A 1ACIA 2M7BA 1I27A 2OBPA 1T6SA 2DK5A 5HDKA 5LD2C 1F43A 1G6NA 2X4HA 3ZQLA 3T5XA 2A6EF 1SD6A 3S17J 2H1LA 3KLOA 3K4NA 1JUPA 3F9KA 4I0AA 3TO7A 5EG0A 4UXNA 2YU9J 2XGDA 2VQCA 2OA4A 1O3QA 3VEPA 2BZTA 1OMIA 2AQFA 3L09A 3WE3A 5DD4A 4NC6A 3DKYA 2HVSA 4BQOA 1QA6A 3I4PA 3PNYA 3CESA 2K02A 3GZ6A 5K5RA 3JW4A 4HSRA 2R7VA 1NTCA 1QHGA 5DTDA 1VQOI 1VQ9I 3IP4B 1FOWA 2WTEA 1L0OC 3W2VA 3JCUC 4MTEA 4CH7A 4M9SA 5F0HA 3D5LA 3BG5A 3FXUA 2LRDA 3PUFA 1P6RA 3BJOA 2E71A 2LFBA 2X6XA 3U21A 1NHAA 4UHTA 1KQ8A 4M3GA 3OYIA 3HHHA 4L9JA 3GTOJ 1MSFC 4UNOA 1YW9A 1G3TA 5GPCA 1N75A 2XKOA 4QPQA 2L7MP 3HUGA 4FX0A 2G9WA 2GZWA 4A69C 1HW2A 2LD5A 2VASA 3AG1H 4S04A 4ZYHA 3WGHA 1P4WA 4N4NB 3JRDA 3IH3A 1ZRCA 3KEYA 1BJZA 1LQ1A 4C2MJ 4Y15A 1MGTA 2ACJA 3V7RA 3K1PA 3DP7A 1K78B 2FE3A 4A2UA 4BS9A 4E70A 1FMVA 2L9VA 4QSHA 4IHSA 2KIUA 2F5DA 3HBLA 4OIPF 1TT5B 2XGEA 1V5EA 1Y1VJ 4MGRA 1S7EA 2E7WA 1YITI 1DGRM 4XOPA 2K3PA 2PN6A 2DDBA 3BTIA 2VLAA 1YJWI 3GYHX 2M4GA 2MH2A 2PBIA 2R5YB 3RDIA 1FT9A 1WPKA 1R6RA 2D1HA 1UAAA 3L7WA 1YO5C 3DBHB 4NQWB 4IRIA 4ITVA 5K7FA 2FNAA 1YOVB 1X1PA 1WCMJ 3HOSA 2QLZA 3KZIC 1MDMA 2GOMA 2EA4A 3K2AA 3HSRA 4CDGA 3X2QH 3ZQHA 3SFIA 2HOEA 2QQBA 2Y9YA 3PSIA 3KEOA 1O3TA 3PNVA 3IRRA 1HLVA 4MEXF 1I5ZA 2TCTA 2M8EA 5FKMA 4WK8F 3EUAA 3G1OA 2CFOA 3CUQC 3DEEA 4BDYA 3G1LA 4IXAA 2R92J 1FMWA 3BY6A 1Z67A 2FU4A 2DMTA 2AQEA 1S29A 2ZNYA 3LSTA 2LBFA 4IHXA 1R1UA 4D7MA 1YRNA 4N4OB 2M45A 5LRRA 3JSPA 1B9NA 2ESHA 3CUQA 5KCMA 3WG9A 1H9TA 2PFBA 5E20A 3S2DJ 4U7DA 3J80Z 3KYDB 2ELKA 1Z0XA 1B72B 2E1NA 1ETOA 1Z6TA 4H0EA 3TW6A 4LG0A 5LHHA 2A69F 2HFHA 1D0ZA 2DA5A 3OYNA 3Q0VA 4RAFA 1AKHB 1XC5A 2ZSIB 2EK5A 4D5FA 2VIXA 4CHUA 3IAM2 2XB5A 4JP0A 1XMAA 1IUYA 3CMYA 2XAJA 4WXCA 2P4WA 3GBGA 2CW0F 2L4AA 3WTZA 2ZFUA 2BV6A 4BEHA 1LE8A 3C2HA 2YX7A 2QKLB 2MSYA 3G73A 2JVHA 3ZQ7A 3ABTA 4WXHA 3P9CA 4GYIA 4KIFA 1NK2P 3MVPA 2HOAA 3MEXA 2R7XA 2CW7A 4I09A 5E18F 3GTJJ 3RQIA 4DYCA 2HGCA 1UJ8A 1G59A 2PJRA 2DYSH 4YFNF 3IV5A 1GVJA 4A3IJ 4BKXA 2BBYA 3ESWB 2L9RA 3FISA 5TRDA 4PZJA 2WC2A 3D0SA 2VKHA 2AXLA 5DUKA 1PYVA 2NS8A 1RR8C 2X9DA 3WTWC 3DXJF 3TW7A 2CJJA 1NG6A 5CPRB 3V4GA 1D0XA 1RR7A 3G3ZA 2NVTJ 2QYOA 3F6OA 5BPIA 2LG4A 2HNHA 3PL8A 4OMYA 2HDDA 5IP7J 4LJZF 4XRSA 1IRFA 5FO5A 1SMYF 1DQUA 3S2HJ 4EV0A 4L5IA 4RS8A 3G2BA 3FIWA 3UR3C 4HLYA 1LE8B 2IRFG 1Y0NA 3DPUA 3GFIA 3AG4H 4G7OF 4PUSA 3ONQA 3VODA 2ECBA 2EFQA 3BR1A 3EUHA 3HIFA 3I71A 3RKXA 4A3DJ 2E34A 2FRHA 4XLFA 4YIRX 2HOSA 3WTUC 2Z2SB 3I4MJ 2R7QA 2OAZA 5CVJA 5LHIA 2K9QA 2LOOA 2M0MA 2E35A 4XSXF 5AIQA 4ZYEA 3IC7A 3ZOBA 1RETA 3CCLI 5B1AH 3HJEA 3ZMZA 5M3MJ 1JI8A 3L9FA 2B7EA 2PI0A 1FWZA 1LNWA 1OISA 4CCJA 5L3GA 1E2XA 1L3LA 2KPMA 4OIQF 3EUHC 4I7HA 4V19K 4D7NA 5ICGA 3FBNB 1GLNA 2EV6A 3U1DA 1EH8A 2PMUA 3V8JA 1RESA 1LFPA 4BXUA 1D5YA 1TWGJ 2MC3A 5J1UA 1I6HJ 4GO1A 1BC8C 1C0WA 1TP4A 3DLLF 3MQ0A 4C9YA 5DEQA 3JTGA 2CMPA 3LQRA 2Z9OA 1MSEC 3J7AY 1R5HA 3KCCA 2E2IJ 2DU9A 4E7KA 3LMMA 3S15J 1JKOC 1Z6RA 2P8TA 4AUXA 1J9IA 1G3WA 3ZR8X 4E7HA 3A0BC 2W7NA 3WODF 2QSHX 4PSWA 2DXIA 2R7DA 3T8TA 4NNJA 2LK2A 2VBZA 3BWGA 1UELB 3MKYB 3CUOA 2WAQA 2DI3A 2A05A 1YQAA 2DYRH 1FTZA 3CUQB 3LA3A 1I1GA 4B09A 2B63J 4OOIA 2MLKA 3BJ6A 3MZYA 3P5JA 4HF0A 4YIFA 2FMYA 1Z9CA 1U2WA 2K3FA 2IJLA 3E6CC 2JRTA 3VSKA 2DOEA 2DDAA 4EJOA 3U2RA 2NVXJ 5FKOA 3G71I 1UHSA 1SFUA 2DOFA 2HYFA 3OIQA 2EFWA 1RI7A 2BVLA 2L7ZA 3PJRA 4IQJA 4L0YB 1YJ9I 2KT0A 2CW8A 1T0FC 2GIVA 5J6XA 1WH5A 3PSFA 4OIRF 4EQQA 4KMFA 3RYPA 2X51A 1CF7B 1FEXA 3TL4X 1BOAA 3CC2I 5FROA 3VDXA 3WHBA 2R93J 3O8GA 4U0VA 4B47A 1WRJA 1K6OA 2XHKA 1POGA 1XG1A 1Z21A 2MC4A 3FDYA 2DO7A 1JT0A 1XMXA 2A6HF 1VQMI 3AL0B 1TZLA 1Z77A 1AHDP 2RV8A 1ON2A 5L3BA 1JJ6C 1MD0A 1BI3A 1TW2A 3J7ZI 3NWSA 5DV5A 2EV5A 4BU2A 1Y1WJ 5D6FA 2NOJB 4HAMA 3CCSI 3BROA 5JI6A 5F27A 1BL0A 1FTTA 5KVRA 4X0GA 2EJRA 2IVMA 2KDOA 2DTZA 2BHYA 3H5RA 2R7TA 5HS8A 4LLLA 3SEQA 2GWRA 1I1SA 3I54A 1HW5A 1J75A 3W2WA 1MW7A 2CS3A 1UG2A 2VKDA 2QVOA 2VQGA 1BBYA 3PFIA 1S5LC 4EM2A 5DDGA 1WZ2A 4HDVA 3CQZJ 3ABUA 4E6KG 2RQQA 4JQFA 2H6BA 3I4NJ 2KHMA 3UNGC 3I9V2 4KNYA 3N4MA 3PIPF 2ELHA 4A3GJ 4HA8A 3N05A 5LHGA 1WSUA 2RN7A 3E6MA 4UB6C 1P2FA 2R7WA 1LVAA 3GTGJ 3RKQA 1ENHA 4HEA2 4D5CA 5E3MA 1SD7A 2HS5A 5BPDA 2WB1N 1IAWA 1APLC 3HOUJ 4M73A 4E7SA 4LB6B 3DKWA 1OJLA 1Z05A 4HV5A 5CQEA 5DYMA 2Q8KA 2X6WA 4RGXA 4KN7X 3RQ4A 3S1QJ 3ISPA 1OYWA 1R4MB 1W4MA 1OCOH 2CQNA 4MQ9F 2IW5A 5B1BH 3QPSA 3HRTA 3ZQCA 3FM3A 2K4BA 5B5EC 4KISA 2DA6A 3SXYA 2VT2A 4II2A 4P9FA 4B1RA 1E3PA 2M7AA 3HGYA 4A3MJ 4AIJA 2HDWA 2M1BA 1X1AA 5CQGA 2JA7J 4R1HA 1A04A 4Y17A 5GAEJ 1K7AA 1TWCJ 2HYJA 2ID3A 2ISYA 3I0TA 4ZDPA 4KUMA 1E0EA 3FMRA 2VT3A 1P92A 1F5TA 3QP6A 4XRSG 3BPXA 2XAGA 3HKZA 2KISA 4BAYA 1P4AA 1GV2A 4HQMA 3MKZA 4AYBN 2CH0A 3GF2A 1EF4A 1YX3A 2VKVA 4HLXA 3EYIA 2JWTA 3A1YA 1S6LA 3CCJI 1B1BA 1XDUA 2COBA 2EB7A 3R0JA 3VPRA 1WHUA 5F08A 3DFGA 3G1MA 3LSRA 1W0TA 2DCEA 3GTLJ 4Y4RA 4ZYAA 4L5EA 2IGNA 3MMYB 2FQ3A 3LA2A 3MKWB 1YX5A 3PO3J 5CVUA 4UUSA 5FKLA 1QZEA 2MD5A 3TKYA 1BW5A 2N8GA 1IXRC 4MEYF 5FB2A 5IYDJ 2ME6A 1XCVA 4DNCA 1D1AA 1TC3C 2WY8Q 3CLOA 5JHFA 3CF2A 2EILH 5LGTA 2STWA 3KLNA 3CDLA 1WJ5A 4BE0A 4PJ0C 3PQJA 4DW6A 3BR6A 2F5FA 2DAOA 3F8BA 4M3BA 3FKIJ 1MBGA 2LNBA 2VC1A 3A01B 3H0GJ 5IYCJ 2OTJI 4CYCB 4GDFA 4ZZDA 3HDDA 2CG4A 1ZGJA 4IEJA 1IDZA 3OYCA 5FRNA 3PO2J 2GA1A 5B3SH 4RAGA 1MBHA 1ZG1A 5FFZA 1ZR4A 3H5AA 3KYLA 3K4KA 1ZAOA 1IJWC 4LD5A 1FPQA 3HEFA 3BR0A 2WV0A 1ZRFA 2LY9A 3BCBA 4Y3OA 1IGNA 2MH9A 1ZLKA 2RNGA 2WAEA 4AWXB 2KQRA 2JRMA 4HNTA 2EWNA 1GXQA 2XPUA 1MBEA 2QBYA 3AL0C 5B66C 2DA2A
chains in the Genus database with same CATH topology
1T2KA 2VBXA 1R22A 1R36A 3R0AA 5E1ZB 1HBXG 4I0BA 2L3DA 2HEOA 2VN2A 4OINF 3O2PE 3RTRA 2ZJ2A 4EJVA 1FLIA 2HWVA 3WU1B 3K2ZA 2EFNA 2C6YA 5ED4A 5E17F 4A12A 4PGHA 3S2WA 2VONA 3M9AA 2D2WA 2Q2EA 3ZN0A 4HV6A 4IJAA 3QU6A 1QQIA 2E7XA 1FBQA 2LKPA 1YTYA 3OOPA 3ZN1A 6PAXA 4WXDA 1J5YA 2VODA 1XMKA 4EJWA 4S05A 5J8CA 2HTSA 4KN4X 1R23A 5LLQA 4MNUA 3REOA 3B02A 1GXPA 1V3FA 3LQQA 4Q47A 1LDJA 2O61A 1F9NA 2MA3A 3QAHA 2A07F 3T8RA 2XGXA 1PDNC 3M1EA 1ULYA 4LLGF 2RVCA 4LFUA 2IT0A 2XAHA 1YIOA 5F6FA 3SFZA 3CDHA 3HSFA 4WX9A 2RGVA 2FXAA 5ILUA 1B59A 4ESFA 4A6DA 4L9NA 2QUFA 4ENKA 2NNNA 3CTAA 4HBLA 3KEQA 3R6SA 2V6CA 3GUDA 2NNYA 1HW1A 4EMSA 4M71A 5IT3A 2ZXJA 3C3WA 2E1CA 2H94A 4Y13A 1HKTA 1I6XA 2Y48A 2QBYB 1G3YA 2BE5F 5DCFA 1FBSA 4WCGA 2XAQA 1ZREA 1OKRA 1XDSA 3E3VA 4HX7A 1UHMA 2ZMEB 4ENMA 2JT1A 4BQAA 3GFJA 1U5TA 3BPVA 4BHCA 1TNSA 3L00A 4G6DA 4A0XA 2DFIA 1S7AA 1BIBA 1R00A 1B4AA 4YIIA 3V8KA 2F2EA 3ZMSA 4L5JA 3FF5A 4ZYGA 1UCRA 3DPTA 3HTUA 4XLNF 1KU2A 1EH7A 5FD5A 3EETA 2HYGD 3HHGA 3FWEA 1REPC 4G7ZF 1MJBA 1ZARA 1MJ9A 1IF1A 1STZA 1KU3A 4LK1F 1MKMA 4BNCA 2VBYA 1E17A 1WKMA 4ETSA 1HQCA 4R8HA 2QWWA 1XB4A 1PUEE 3GEZA 2IP2A 3I59A 3BJAA 1FSEA 5KK1A 1EH6A 1O3SA 1ZH5A 1TQMA 4CO8A 2KRFA 5EEGA 1IN7A 4CICA 3R61A 3ML6A 1IN6A 2VC0A 1OYIA 1KYZA 1KGSA 2CGPA 3RI4A 5JFRA 5HS9A 1D5VA 1ZHFA 1W7PB 3KP2A 1W7PA 3BZ6A 2PQ8A 4Q48A 4PDKA 1XSXA 2LF7A 5FD6A 1BI2A 3C1DA 4O6JA 1YLFA 2Y0MA 3ERED 1K79A 5CYVA 3GX4X 4RB0A 1ZGAA 2G7UA 1R5GA 4G9YA 1FYMA 1KYWA 1SD4A 4CYDA 5F1RA 3ZMVA 4MHGA 3V8LA 2JPCA 3F23A 4GXOA 1TW3A 2IA2A 5BQTA 5D5UB 2ETHA 1XSDA 2KJCA 1JHHA 2JZYA 3K1MA 4KIGA 4U88A 3SZTA 1BI1A 2ZKZA 5ICCA 1Z1DA 3WTYC 5EEHA 2DQRA 1OYYA 2H6CA 4YG2F 1D8JA 2ZBKA 1D3YA 2WWYA 1HSTA 5ICFA 4RGSA 4AIHA 1B9MA 1O7LA 5D5VB 2FEZA 5HOOA 3HYIA 1SD5A 5E8IA 3QRFF 2COMA 2TDXA 1UFMA 3EYYA 3F8CA 2P5VA 5ERIA 5IT9K 3F22A 1ZN2A 2XV4S 4KMUX 3QU3A 2VOPA 2PLYA 5F64A 3C7JA 3V7SA 5LBQA 3TOBA 1TNTA 1S3JA 2IA1A 1QNTA 1IW7F 3GZ5A 2KIMA 2KJBA 3ELKA 5FLXK 4GGGA 3TO6A 4RAYA 2KIFA 1ON1A 2PEXA 2NRAC 4I98B 1YG2A 2W25A 3RKYA 1KQ9A 3E6DA 4BHPA 3J7AO 2MBFA 3ZMUA 2XUBA 1RNLA 4I01A 2V79A 1QGPA 4O3MA 3QPTA 3MWMA 2FNPA 3IWZA 1XGOA 4XLPF 2DQLA 4RGRA 4ZYDA 3H92A 3KE2A 2VBWA 1O3RA 2H27A 4CGZA 1ODDA 3KP3A 2K27A 5CVVA 5BMZA 2DPDA 1LEBA 2VE8A 4L9VA 2QENA 4EM1A 1TQIA 3LAPA 2D1VA 1KU7A 1MJAA 3E5UA 1YS6A 1BIAA 2ZO4A 2A5YB 2O8XA 3LFKA 4ON0A 4UVBA 1FYKA 2B0LA 2L54A 4RAZA 3WTSC 5ILVA 1Z91A 3I59B 3TO9A 3TOAA 3AAFA 1TBXA 1ZRDA 4HW0A 3I53A 3SHFA 1DPRA 2XRNA 3F8NA 3F72A 3OV8A 2P6TA 4A0YA 2O6GE 1RUNA 3N97A 1EV7A 3KZZA 4HX8A 1W5TA 2UWMA 5L3CA 5JHUA 4ESJA 3MFKA 3LWFA 1IXSB 4IRGA 3ECOA 3ROUA 1U5TC 3FHZA 2Y75A 3K0LA 1BJAA 1FYLA 2MLGA 2QQ9A 5E1XA 1ZG3A 1H9GA 1USTA 5FFXA 3RPUA 1KA8A 4FHTA 2Q0OA 2JSCA 5CVRA 5TJJA 2O0YA 5DCMB 1T39A 2RC4A 3BP8A 1J2XA 2JPBA 1O7FA 1XCBA 5ILSA 3Q9VA 3W6KB 2DLLA 4MTDA 3F21A 5L3FA 1FBUA 1JGSA 3QPHA 4U7BA 3HRSA 5HLHA 2A3SA 3COAC 5LEJA 1FX7A 1YW7A 2BYVE 1LB2A 2RKHA 2K86A 3RPQA 3TDUC 5DCMA 4XRFA 5A2QZ 3WGIA 4LMYA 2YPRA 1SFEA 4N0BA 3FMQA 1VTNC 2KKOA 2Z5UA 4UV9A 1F4KA 2LSOA 3MAJA 4A5NA 3E97A 5BS6A 5FLXZ 4IVNA 4HDUA 4BH9A 2NS0A 3RIRA 3SZPA 2OQRA 3F8FA 4EJUA 4G6QA 4EGZA 1FP2A 1U6GA 2STTA 1J59A 1Z7UA 4L9TA 2HZTA 3K9TA 1OR7A 3CO7C 1RIOH 5DUIA 4G7HF 5H6QA 1SFXA 4M74A 2BGCA 2UZKA 3J80K 5E1WA 5AONA 5H6RA 3CJNA 4N9HA 3CO6C 1QPMA 4KFCA 3V7CA 2ESNA 3FMSA 1BI0A 4NHJA 4JBAA 1F1ZA 5ICEA 4LG0B 2HR3A 3IHUA 1UB9A 2DTRA 1UHWA 1RZ4A 4RGUA 2XVCA 4EJTA 5CVIA 2P5LC 4OMZA 2DT5A 2Z3YA 2QM3A 2ZFWA 4WWCA 4G8XA 4M9XA 4N9IA 3VFZA 2H09A 2F5CA 2CFXA 5D8KB 3EQLF 4YFKF 2FOKA 2ADUA 1FC3A 1HKQA 1R7JA 4GYGA 1J7KA 1W7PD 3WTXC 5D4RA 2LF8A 4EVIA 4A5MA 3NQOA 3WE2A 3Q5FA 1OPCA 2RQPA 2W57A 3TGNA 3GFLA 4GCVA 3QP5A 5D5WB 2V1DA 3IKTA 1XGSA 3F8MA 3DF8A 3P7NA 1B6AA 3K1NA 4P96A 1R1TA 2M87A 2FF4A 1QO0D 1ZYRF 2K4JA 3KETA 3HOTA 4HQEA 1KU9A 3DPLC 1R1VA 5FGMA 3GVAA 1DDNA 4AD9A 4NQWA 4A0ZA 1FY7A 3JSOA 1TLHB 3FX3A 4HYEA 2M30A 4KICA 1RUOA 4RB3C 2V1UA 3H3UA 1QZYA 3K69A 1Q1HA 1MDMB 2HTJA 2K7LA 4G94A 3FXQA 1YS7A 2W84A 5K5QA 4UVCA 4PCQA 2OD5A 1G3SA 2O3FA 3ECHA 3I5UA 1X3UA 3HRMA 2P7VB 3O3KA 5L3EA 1YYVA 2XAFA 5D4SA 1FOKA 4L0ZB 1MZBA 1J0RA 2XKPA 2LDUA 4KDPA 1IXCA 3RYRA 2EV0A 2GA2A 2J5PA 5JR3A 3HTSB 2IPQX 1WWXA 1YW8A 2P7CB 3ZPLA 3GO5A 1XGMA 1DPUA 2P6SA 5K5OA 4Q4ZF 2PJPA 2HDCA 2IA0A 4PGGA 1K78A 1LDDA 3HRUA 3ZP5A 3JAMK 4U0WA 3TQNA 3VOEA 2HQNA 4IPAA 1U3EM 5HVQC 5K1YA 1HKSA 5D6EA 1AOYA 2V9VA 3WGGA 3E6BA 2DK8A 1WQ2A 5DD8A 2FA5A 4P5OA 2L01A 3ZMTA 5LEKA 3L2CA 4AIKA 2CQKA 2VE9A 3KP5A 2PG4A 2XROA 2CSOA 4K2EA 4O5VA 3P9IA 3B73A 3H3ZA 1ZLJA 2HQRA 4AVPA 1CF7A 3E5QA 4XBFA 3T1BA 1IN4A 2L02A 3J81Z 1FNNA 2FBKA 3P9KA 5HLGA 4IF4A 2J5OA 1IN8A 2HKOA 2D45A 2FMLA 4F7ZA 1WI9A 5HS7A 3JAMZ 3DEUA 4QLCU 2ZMEA 3GWZA 1ONVA 5JVTA 4A6EA 3U9GA 3E5XA 3C18A 5HDGA 3IL2A 3IWFA 4B8XA 1V4RA 1BM9A 5A2QK 2PMHA 3GXOA 3T0YA 5CJ9A 2JTVA 3GW2A 4LK0F 3TDZC 1SMTA 4KT5C 4RB2C 2W85A 3HSEA 4DQ2A 1XN7A 4YFXF 3DQVC 1PP8F 4Q5SF 3Q9SA 4M72A 2VXZA 1JXSA 3KFWX 1O57A 4TV7A 1R58A 2UXNA 1H0MA 3JTHA 5LRSA 5BOXA 2ZNZA 2AS5F 3KP6A 4L18B 2YSRA 4HOBA 2RDPA 1LDKB 1GHCA 4KIBA 1CGPA 4ENNA 4M6YA 2DPUA 4R79A 2GXBA 2CYYA 4FX4A 1JHFA 4IRHA 5D8LB 2OQGA 5HLIA 4OIOF 3GFMA 4KYWA 3LA7A 4QWQA 2OU2A 3WTVC 1DUXC 3VB2A 1AWCA 2A68F 3DV8A 2UXXA 4M6XA 4I2OA 2GQQA 3KP4A 1S8NA 3R60A 3R4KA 2ZCWA 1YFHA 3SQNA 3FXRA 1XSVA 1FP1D 5HDNA 5LGUA 2DBBA 2W24A 1TTYA 1T38A 4LLNA 3M8EA 3PQKA 3WU0A 3M7GA 4NB5A 2G7HA 2XASA 1BC7C 3BDDA 2HKXA 3KP7A 4D0PA 1HSJA 2EFPA 4I02A 3NEUA 4ZZLA 4U0YA 4UV8A 4LGWA 1XD7A 4UVAA 1IN5A 4CZZA 4JK1X 2X0LA 2NYXA 4ESBA 2EA2A 3LAJA 4UUVA 3I58A 5IT9Z 1G4DA 5L3DA 1T98A 4BYYA 2DW4A 2L4MA 1USSA 3FZVA 1LEAA 2CO5A 4P9UA 1FZPB 3BOQA 2QQAA 4HF2A 2VOOA 2YX4A 4M9ZA 2R7FA 4FT8A 5E8GA 1LJ9A 1W5SA 4HZFA 1P4XA 4P55A 1JE8A 2A61A 1QBJA 1Y0UA 5AIPA 2FBIA 3MCZA 4EGYA 1T0FA 1DP7P 3KZYA 4BHBA 3J81K 3F3XA 2ISZA 3IRQA 3QOPA 4LB5A 3M8FA 1QZZA 2CWEA 4OU0A 4HF1A 1HXDA 4RB1A 4ASNA 1SAXA 1KQ0A 1PP7U 2Z99A 4Z2YA 2O03A 1FSHA 4MQVA 2F5EA 4ENJA 3O6BB 2EFOA 2YU3A 3W6JB 3WTTC 3GLXA 1D8KA 1TQPA 2XIGA 3ULQB 2OZ6A 2GAUA 1XGNA 1BN5A 2QZ8A 1IRGA 3MZHA 3FM5A 1IZ1A 3IKVA 4IHTA 2FBHA 1ZG5A 2V1XA 5CLSA 3RKWA 1S7OA 3I64A 5D5XB 4WF2A 2Z33A 3RJPA 2FSWA 3F6VA 2R3SA 3ZMDA 2GXGA 4CXFA 1U78A 5LGNA 4KA4A 2RNJA 4HX4A 4EM0B 2YR2A 3NRVA 4ZH4F 3EDPA 1U5TB 2BEOA 5J8FA 2OZUA 1U8RA 2NAZA 2M5WA 4XSZF 2P5KA 5H20A 1I27A 2OBPA 1T6SA 5HDKA 2DK5A 1G6NA 2X4HA 3T5XA 2A6EF 1SD6A 3KLOA 4I0AA 3TO7A 4UXNA 2OA4A 1O3QA 3VEPA 1OMIA 3WE3A 3L09A 5DD4A 3I4PA 2K02A 3GZ6A 5K5RA 3JW4A 2WTEA 1L0OC 4MTEA 4M9SA 3D5LA 3FXUA 1P6RA 3BJOA 1KQ8A 1NHAA 4UHTA 3HHHA 4L9JA 4UNOA 1YW9A 1G3TA 2XKOA 3HUGA 4FX0A 2G9WA 2GZWA 1HW2A 4S04A 4ZYHA 3WGHA 1P4WA 1ZRCA 1LQ1A 4Y15A 1MGTA 2ACJA 3V7RA 3K1PA 3DP7A 1K78B 2FE3A 4A2UA 4E70A 4IHSA 2KIUA 2F5DA 4OIPF 4MGRA 2E7WA 2PN6A 3GYHX 2MH2A 2PBIA 3RDIA 1FT9A 2D1HA 3L7WA 1YO5C 4IRIA 2FNAA 3HOSA 2QLZA 1MDMA 2EA4A 3HSRA 4CDGA 2HOEA 2QQBA 3KEOA 1O3TA 3IRRA 4MEXF 1I5ZA 2M8EA 4WK8F 3CUQC 4IXAA 3BY6A 2FU4A 1S29A 2ZNYA 3LSTA 1R1UA 2M45A 5LRRA 3JSPA 1B9NA 2ESHA 3CUQA 3WG9A 1H9TA 2PFBA 5E20A 4U7DA 3J80Z 2E1NA 1Z6TA 4H0EA 4LG0A 5LHHA 2A69F 2HFHA 2EK5A 4CHUA 1XMAA 1IUYA 2XAJA 4WXCA 2P4WA 2CW0F 2L4AA 3WTZA 2BV6A 2YX7A 3G73A 3ZQ7A 3ABTA 4WXHA 3P9CA 4GYIA 4KIFA 3MEXA 4I09A 5E18F 2HGCA 4YFNF 1GVJA 2BBYA 5TRDA 4PZJA 2WC2A 3D0SA 2AXLA 5DUKA 3WTWC 3DXJF 3V4GA 3G3ZA 2QYOA 3F6OA 5BPIA 4OMYA 4LJZF 1IRFA 5FO5A 1SMYF 4EV0A 4L5IA 4RS8A 4HLYA 2IRFG 3GFIA 4G7OF 3VODA 2EFQA 3EUHA 3HIFA 3I71A 3RKXA 2FRHA 3WTUC 2OAZA 5CVJA 5LHIA 4XSXF 5AIQA 4ZYEA 3IC7A 3ZMZA 3L9FA 2PI0A 1FWZA 1LNWA 5L3GA 1E2XA 1L3LA 4OIQF 4I7HA 5ICGA 2EV6A 3U1DA 1EH8A 2PMUA 3V8JA 4BXUA 2MC3A 4GO1A 1BC8C 1C0WA 3MQ0A 5DEQA 3JTGA 3LQRA 2Z9OA 1R5HA 3KCCA 2DU9A 1Z6RA 2P8TA 1J9IA 1G3WA 3WODF 2R7DA 3T8TA 2VBZA 3BWGA 3CUOA 2DI3A 1YQAA 3CUQB 3LA3A 1I1GA 4B09A 4OOIA 2MLKA 3BJ6A 3MZYA 4HF0A 4YIFA 2FMYA 1Z9CA 1U2WA 2IJLA 3E6CC 2JRTA 4EJOA 3U2RA 1SFUA 2HYFA 2EFWA 1RI7A 4L0YB 5J6XA 2GIVA 4OIRF 4EQQA 4KMFA 3RYPA 1CF7B 1BOAA 4U0VA 1WRJA 1K6OA 2XHKA 2DO7A 2A6HF 2RV8A 1ON2A 5L3BA 1MD0A 1BI3A 1TW2A 5DV5A 2EV5A 5D6FA 4HAMA 3BROA 5JI6A 5KVRA 2EJRA 2IVMA 5HS8A 4LLLA 2GWRA 1I1SA 3I54A 1HW5A 1J75A 2QVOA 1BBYA 3PFIA 4EM2A 5DDGA 4HDVA 3ABUA 4JQFA 2H6BA 4KNYA 3N4MA 2ELHA 4HA8A 5LHGA 1WSUA 2RN7A 3E6MA 1P2FA 1LVAA 1SD7A 1IAWA 2HS5A 5BPDA 4M73A 4LB6B 3DKWA 1Z05A 4HV5A 5DYMA 2Q8KA 4RGXA 4KN7X 3ISPA 1OYWA 1W4MA 4MQ9F 2IW5A 3HRTA 3FM3A 2K4BA 3SXYA 2VT2A 4P9FA 4AIJA 2M1BA 4R1HA 1A04A 4Y17A 1K7AA 3I0TA 2ISYA 4KUMA 3FMRA 2VT3A 1P92A 1F5TA 3QP6A 3BPXA 2XAGA 4BAYA 1P4AA 4HQMA 3GF2A 4HLXA 3EYIA 1S6LA 1B1BA 1XDUA 2EB7A 3R0JA 3DFGA 2FQ3A 3LA2A 5CVUA 2MD5A 3TKYA 1IXRC 4MEYF 5FB2A 1XCVA 4DNCA 3CLOA 5LGTA 2STWA 3KLNA 3PQJA 2F5FA 2DAOA 3F8BA 2LNBA 2VC1A 4ZZDA 2CG4A 1ZGJA 2GA1A 1ZG1A 5FFZA 1ZAOA 4LD5A 1FPQA 2WV0A 1ZRFA 2MH9A 1ZLKA 4AWXB 2EWNA 1GXQA 2QBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K A;  2VBX A;  1R22 A;  1R36 A;  3R0A A;  5E1Z B;  1HBX G;  4I0B A;  2L3D A;  2HEO A;  2VN2 A;  4OIN F;  3O2P E;  3RTR A;  2ZJ2 A;  4EJV A;  1FLI A;  2HWV A;  3WU1 B;  3K2Z A;  2EFN A;  2C6Y A;  5ED4 A;  5E17 F;  4A12 A;  4PGH A;  3S2W A;  2VON A;  3M9A A;  2D2W A;  2Q2E A;  3ZN0 A;  4HV6 A;  4IJA A;  3QU6 A;  1QQI A;  2E7X A;  1FBQ A;  2LKP A;  1YTY A;  3OOP A;  3ZN1 A;  6PAX A;  4WXD A;  1J5Y A;  2VOD A;  1XMK A;  4EJW A;  4S05 A;  5J8C A;  2HTS A;  4KN4 X;  1R23 A;  5LLQ A;  4MNU A;  3REO A;  3B02 A;  1GXP A;  1V3F A;  3LQQ A;  4Q47 A;  1LDJ A;  2O61 A;  1F9N A;  2MA3 A;  3QAH A;  2A07 F;  3T8R A;  2XGX A;  1PDN C;  3M1E A;  1ULY A;  4LLG F;  2RVC A;  4LFU A;  2IT0 A;  2XAH A;  1YIO A;  5F6F A;  3SFZ A;  3CDH A;  3HSF A;  4WX9 A;  2RGV A;  2FXA A;  5ILU A;  1B59 A;  4ESF A;  4A6D A;  4L9N A;  2QUF A;  4ENK A;  2NNN A;  3CTA A;  4HBL A;  3KEQ A;  3R6S A;  2V6C A;  3GUD A;  2NNY A;  1HW1 A;  4EMS A;  4M71 A;  5IT3 A;  2ZXJ A;  3C3W A;  2E1C A;  2H94 A;  4Y13 A;  1HKT A;  1I6X A;  2Y48 A;  2QBY B;  1G3Y A;  2BE5 F;  5DCF A;  1FBS A;  4WCG A;  2XAQ A;  1ZRE A;  1OKR A;  1XDS A;  3E3V A;  4HX7 A;  1UHM A;  2ZME B;  4ENM A;  2JT1 A;  4BQA A;  3GFJ A;  1U5T A;  3BPV A;  4BHC A;  1TNS A;  3L00 A;  4G6D A;  4A0X A;  2DFI A;  1S7A A;  1BIB A;  1R00 A;  1B4A A;  4YII A;  3V8K A;  2F2E A;  3ZMS A;  4L5J A;  3FF5 A;  4ZYG A;  1UCR A;  3DPT A;  3HTU A;  4XLN F;  1KU2 A;  1EH7 A;  5FD5 A;  3EET A;  2HYG D;  3HHG A;  3FWE A;  1REP C;  4G7Z F;  1MJB A;  1ZAR A;  1MJ9 A;  1IF1 A;  1STZ A;  1KU3 A;  4LK1 F;  1MKM A;  4BNC A;  2VBY A;  1E17 A;  1WKM A;  4ETS A;  1HQC A;  4R8H A;  2QWW A;  1XB4 A;  1PUE E;  3GEZ A;  2IP2 A;  3I59 A;  3BJA A;  1FSE A;  5KK1 A;  1EH6 A;  1O3S A;  1ZH5 A;  1TQM A;  4CO8 A;  2KRF A;  5EEG A;  1IN7 A;  4CIC A;  3R61 A;  3ML6 A;  1IN6 A;  2VC0 A;  1OYI A;  1KYZ A;  1KGS A;  2CGP A;  3RI4 A;  5JFR A;  5HS9 A;  1D5V A;  1ZHF A;  1W7P B;  3KP2 A;  1W7P A;  3BZ6 A;  2PQ8 A;  4Q48 A;  4PDK A;  1XSX A;  2LF7 A;  5FD6 A;  1BI2 A;  3C1D A;  4O6J A;  1YLF A;  2Y0M A;  3ERE D;  1K79 A;  5CYV A;  3GX4 X;  4RB0 A;  1ZGA A;  2G7U A;  1R5G A;  4G9Y A;  1FYM A;  1KYW A;  1SD4 A;  4CYD A;  5F1R A;  3ZMV A;  4MHG A;  3V8L A;  2JPC A;  3F23 A;  4GXO A;  1TW3 A;  2IA2 A;  5BQT A;  5D5U B;  2ETH A;  1XSD A;  2KJC A;  1JHH A;  2JZY A;  3K1M A;  4KIG A;  4U88 A;  3SZT A;  1BI1 A;  2ZKZ A;  5ICC A;  1Z1D A;  3WTY C;  5EEH A;  2DQR A;  1OYY A;  2H6C A;  4YG2 F;  1D8J A;  2ZBK A;  1D3Y A;  2WWY A;  1HST A;  5ICF A;  4RGS A;  4AIH A;  1B9M A;  1O7L A;  5D5V B;  2FEZ A;  5HOO A;  3HYI A;  1SD5 A;  5E8I A;  3QRF F;  2COM A;  2TDX A;  1UFM A;  3EYY A;  3F8C A;  2P5V A;  5ERI A;  5IT9 K;  3F22 A;  1ZN2 A;  2XV4 S;  4KMU X;  3QU3 A;  2VOP A;  2PLY A;  5F64 A;  3C7J A;  3V7S A;  5LBQ A;  3TOB A;  1TNT A;  1S3J A;  2IA1 A;  1QNT A;  1IW7 F;  3GZ5 A;  2KIM A;  2KJB A;  3ELK A;  5FLX K;  4GGG A;  3TO6 A;  4RAY A;  2KIF A;  1ON1 A;  2PEX A;  2NRA C;  4I98 B;  1YG2 A;  2W25 A;  3RKY A;  1KQ9 A;  3E6D A;  4BHP A;  3J7A O;  2MBF A;  3ZMU A;  2XUB A;  1RNL A;  4I01 A;  2V79 A;  1QGP A;  4O3M A;  3QPT A;  3MWM A;  2FNP A;  3IWZ A;  1XGO A;  4XLP F;  2DQL A;  4RGR A;  4ZYD A;  3H92 A;  3KE2 A;  2VBW A;  1O3R A;  2H27 A;  4CGZ A;  1ODD A;  3KP3 A;  2K27 A;  5CVV A;  5BMZ A;  2DPD A;  1LEB A;  2VE8 A;  4L9V A;  2QEN A;  4EM1 A;  1TQI A;  3LAP A;  2D1V A;  1KU7 A;  1MJA A;  3E5U A;  1YS6 A;  1BIA A;  2ZO4 A;  2A5Y B;  2O8X A;  3LFK A;  4ON0 A;  4UVB A;  1FYK A;  2B0L A;  2L54 A;  4RAZ A;  3WTS C;  5ILV A;  1Z91 A;  3I59 B;  3TO9 A;  3TOA A;  3AAF A;  1TBX A;  1ZRD A;  4HW0 A;  3I53 A;  3SHF A;  1DPR A;  2XRN A;  3F8N A;  3F72 A;  3OV8 A;  2P6T A;  4A0Y A;  2O6G E;  1RUN A;  3N97 A;  1EV7 A;  3KZZ A;  4HX8 A;  1W5T A;  2UWM A;  5L3C A;  5JHU A;  4ESJ A;  3MFK A;  3LWF A;  1IXS B;  4IRG A;  3ECO A;  3ROU A;  1U5T C;  3FHZ A;  2Y75 A;  3K0L A;  1BJA A;  1FYL A;  2MLG A;  2QQ9 A;  5E1X A;  1ZG3 A;  1H9G A;  1UST A;  5FFX A;  3RPU A;  1KA8 A;  4FHT A;  2Q0O A;  2JSC A;  5CVR A;  5TJJ A;  2O0Y A;  5DCM B;  1T39 A;  2RC4 A;  3BP8 A;  1J2X A;  2JPB A;  1O7F A;  1XCB A;  5ILS A;  3Q9V A;  3W6K B;  2DLL A;  4MTD A;  3F21 A;  5L3F A;  1FBU A;  1JGS A;  3QPH A;  4U7B A;  3HRS A;  5HLH A;  2A3S A;  3COA C;  5LEJ A;  1FX7 A;  1YW7 A;  2BYV E;  1LB2 A;  2RKH A;  2K86 A;  3RPQ A;  3TDU C;  5DCM A;  4XRF A;  5A2Q Z;  3WGI A;  4LMY A;  2YPR A;  1SFE A;  4N0B A;  3FMQ A;  1VTN C;  2KKO A;  2Z5U A;  4UV9 A;  1F4K A;  2LSO A;  3MAJ A;  4A5N A;  3E97 A;  5BS6 A;  5FLX Z;  4IVN A;  4HDU A;  4BH9 A;  2NS0 A;  3RIR A;  3SZP A;  2OQR A;  3F8F A;  4EJU A;  4G6Q A;  4EGZ A;  1FP2 A;  1U6G A;  2STT A;  1J59 A;  1Z7U A;  4L9T A;  2HZT A;  3K9T A;  1OR7 A;  3CO7 C;  1RIO H;  5DUI A;  4G7H F;  5H6Q A;  1SFX A;  4M74 A;  2BGC A;  2UZK A;  3J80 K;  5E1W A;  5AON A;  5H6R A;  3CJN A;  4N9H A;  3CO6 C;  1QPM A;  4KFC A;  3V7C A;  2ESN A;  3FMS A;  1BI0 A;  4NHJ A;  4JBA A;  1F1Z A;  5ICE A;  4LG0 B;  2HR3 A;  3IHU A;  1UB9 A;  2DTR A;  1UHW A;  1RZ4 A;  4RGU A;  2XVC A;  4EJT A;  5CVI A;  2P5L C;  4OMZ A;  2DT5 A;  2Z3Y A;  2QM3 A;  2ZFW A;  4WWC A;  4G8X A;  4M9X A;  4N9I A;  3VFZ A;  2H09 A;  2F5C A;  2CFX A;  5D8K B;  3EQL F;  4YFK F;  2FOK A;  2ADU A;  1FC3 A;  1HKQ A;  1R7J A;  4GYG A;  1J7K A;  1W7P D;  3WTX C;  5D4R A;  2LF8 A;  4EVI A;  4A5M A;  3NQO A;  3WE2 A;  3Q5F A;  1OPC A;  2RQP A;  2W57 A;  3TGN A;  3GFL A;  4GCV A;  3QP5 A;  5D5W B;  2V1D A;  3IKT A;  1XGS A;  3F8M A;  3DF8 A;  3P7N A;  1B6A A;  3K1N A;  4P96 A;  1R1T A;  2M87 A;  2FF4 A;  1QO0 D;  1ZYR F;  2K4J A;  3KET A;  3HOT A;  4HQE A;  1KU9 A;  3DPL C;  1R1V A;  5FGM A;  3GVA A;  1DDN A;  4AD9 A;  4NQW A;  4A0Z A;  1FY7 A;  3JSO A;  1TLH B;  3FX3 A;  4HYE A;  2M30 A;  4KIC A;  1RUO A;  4RB3 C;  2V1U A;  3H3U A;  1QZY A;  3K69 A;  1Q1H A;  1MDM B;  2HTJ A;  2K7L A;  4G94 A;  3FXQ A;  1YS7 A;  2W84 A;  5K5Q A;  4UVC A;  4PCQ A;  2OD5 A;  1G3S A;  2O3F A;  3ECH A;  3I5U A;  1X3U A;  3HRM A;  2P7V B;  3O3K A;  5L3E A;  1YYV A;  2XAF A;  5D4S A;  1FOK A;  4L0Z B;  1MZB A;  1J0R A;  2XKP A;  2LDU A;  4KDP A;  1IXC A;  3RYR A;  2EV0 A;  2GA2 A;  2J5P A;  5JR3 A;  3HTS B;  2IPQ X;  1WWX A;  1YW8 A;  2P7C B;  3ZPL A;  3GO5 A;  1XGM A;  1DPU A;  2P6S A;  5K5O A;  4Q4Z F;  2PJP A;  2HDC A;  2IA0 A;  4PGG A;  1K78 A;  1LDD A;  3HRU A;  3ZP5 A;  3JAM K;  4U0W A;  3TQN A;  3VOE A;  2HQN A;  4IPA A;  1U3E M;  5HVQ C;  5K1Y A;  1HKS A;  5D6E A;  1AOY A;  2V9V A;  3WGG A;  3E6B A;  2DK8 A;  1WQ2 A;  5DD8 A;  2FA5 A;  4P5O A;  2L01 A;  3ZMT A;  5LEK A;  3L2C A;  4AIK A;  2CQK A;  2VE9 A;  3KP5 A;  2PG4 A;  2XRO A;  2CSO A;  4K2E A;  4O5V A;  3P9I A;  3B73 A;  3H3Z A;  1ZLJ A;  2HQR A;  4AVP A;  1CF7 A;  3E5Q A;  4XBF A;  3T1B A;  1IN4 A;  2L02 A;  3J81 Z;  1FNN A;  2FBK A;  3P9K A;  5HLG A;  4IF4 A;  2J5O A;  1IN8 A;  2HKO A;  2D45 A;  2FML A;  4F7Z A;  1WI9 A;  5HS7 A;  3JAM Z;  3DEU A;  4QLC U;  2ZME A;  3GWZ A;  1ONV A;  5JVT A;  4A6E A;  3U9G A;  3E5X A;  3C18 A;  5HDG A;  3IL2 A;  3IWF A;  4B8X A;  1V4R A;  1BM9 A;  5A2Q K;  2PMH A;  3GXO A;  3T0Y A;  5CJ9 A;  2JTV A;  3GW2 A;  4LK0 F;  3TDZ C;  1SMT A;  4KT5 C;  4RB2 C;  2W85 A;  3HSE A;  4DQ2 A;  1XN7 A;  4YFX F;  3DQV C;  1PP8 F;  4Q5S F;  3Q9S A;  4M72 A;  2VXZ A;  1JXS A;  3KFW X;  1O57 A;  4TV7 A;  1R58 A;  2UXN A;  1H0M A;  3JTH A;  5LRS A;  5BOX A;  2ZNZ A;  2AS5 F;  3KP6 A;  4L18 B;  2YSR A;  4HOB A;  2RDP A;  1LDK B;  1GHC A;  4KIB A;  1CGP A;  4ENN A;  4M6Y A;  2DPU A;  4R79 A;  2GXB A;  2CYY A;  4FX4 A;  1JHF A;  4IRH A;  5D8L B;  2OQG A;  5HLI A;  4OIO F;  3GFM A;  4KYW A;  3LA7 A;  4QWQ A;  2OU2 A;  3WTV C;  1DUX C;  3VB2 A;  1AWC A;  2A68 F;  3DV8 A;  2UXX A;  4M6X A;  4I2O A;  2GQQ A;  3KP4 A;  1S8N A;  3R60 A;  3R4K A;  2ZCW A;  1YFH A;  3SQN A;  3FXR A;  1XSV A;  1FP1 D;  5HDN A;  5LGU A;  2DBB A;  2W24 A;  1TTY A;  1T38 A;  4LLN A;  3M8E A;  3PQK A;  3WU0 A;  3M7G A;  4NB5 A;  2G7H A;  2XAS A;  1BC7 C;  3BDD A;  2HKX A;  3KP7 A;  4D0P A;  1HSJ A;  2EFP A;  4I02 A;  3NEU A;  4ZZL A;  4U0Y A;  4UV8 A;  4LGW A;  1XD7 A;  4UVA A;  1IN5 A;  4CZZ A;  4JK1 X;  2X0L A;  2NYX A;  4ESB A;  2EA2 A;  3LAJ A;  4UUV A;  3I58 A;  5IT9 Z;  1G4D A;  5L3D A;  1T98 A;  4BYY A;  2DW4 A;  2L4M A;  1USS A;  3FZV A;  1LEA A;  2CO5 A;  4P9U A;  1FZP B;  3BOQ A;  2QQA A;  4HF2 A;  2VOO A;  2YX4 A;  4M9Z A;  2R7F A;  4FT8 A;  5E8G A;  1LJ9 A;  1W5S A;  4HZF A;  1P4X A;  4P55 A;  1JE8 A;  2A61 A;  1QBJ A;  1Y0U A;  5AIP A;  2FBI A;  3MCZ A;  4EGY A;  1T0F A;  1DP7 P;  3KZY A;  4BHB A;  3J81 K;  3F3X A;  2ISZ A;  3IRQ A;  3QOP A;  4LB5 A;  3M8F A;  1QZZ A;  2CWE A;  4OU0 A;  4HF1 A;  1HXD A;  4RB1 A;  4ASN A;  1SAX A;  1KQ0 A;  1PP7 U;  2Z99 A;  4Z2Y A;  2O03 A;  1FSH A;  4MQV A;  2F5E A;  4ENJ A;  3O6B B;  2EFO A;  2YU3 A;  3W6J B;  3WTT C;  3GLX A;  1D8K A;  1TQP A;  2XIG A;  3ULQ B;  2OZ6 A;  2GAU A;  1XGN A;  1BN5 A;  2QZ8 A;  1IRG A;  3MZH A;  3FM5 A;  1IZ1 A;  3IKV A;  4IHT A;  2FBH A;  1ZG5 A;  2V1X A;  5CLS A;  3RKW A;  1S7O A;  3I64 A;  5D5X B;  4WF2 A;  2Z33 A;  3RJP A;  2FSW A;  3F6V A;  2R3S A;  3ZMD A;  2GXG A;  4CXF A;  1U78 A;  5LGN A;  4KA4 A;  2RNJ A;  4HX4 A;  4EM0 B;  2YR2 A;  3NRV A;  4ZH4 F;  3EDP A;  1U5T B;  2BEO A;  5J8F A;  2OZU A;  1U8R A;  2NAZ A;  2M5W A;  4XSZ F;  2P5K A;  5H20 A;  1I27 A;  2OBP A;  1T6S A;  5HDK A;  2DK5 A;  1G6N A;  2X4H A;  3T5X A;  2A6E F;  1SD6 A;  3KLO A;  4I0A A;  3TO7 A;  4UXN A;  2OA4 A;  1O3Q A;  3VEP A;  1OMI A;  3WE3 A;  3L09 A;  5DD4 A;  3I4P A;  2K02 A;  3GZ6 A;  5K5R A;  3JW4 A;  2WTE A;  1L0O C;  4MTE A;  4M9S A;  3D5L A;  3FXU A;  1P6R A;  3BJO A;  1KQ8 A;  1NHA A;  4UHT A;  3HHH A;  4L9J A;  4UNO A;  1YW9 A;  1G3T A;  2XKO A;  3HUG A;  4FX0 A;  2G9W A;  2GZW A;  1HW2 A;  4S04 A;  4ZYH A;  3WGH A;  1P4W A;  1ZRC A;  1LQ1 A;  4Y15 A;  1MGT A;  2ACJ A;  3V7R A;  3K1P A;  3DP7 A;  1K78 B;  2FE3 A;  4A2U A;  4E70 A;  4IHS A;  2KIU A;  2F5D A;  4OIP F;  4MGR A;  2E7W A;  2PN6 A;  3GYH X;  2MH2 A;  2PBI A;  3RDI A;  1FT9 A;  2D1H A;  3L7W A;  1YO5 C;  4IRI A;  2FNA A;  3HOS A;  2QLZ A;  1MDM A;  2EA4 A;  3HSR A;  4CDG A;  2HOE A;  2QQB A;  3KEO A;  1O3T A;  3IRR A;  4MEX F;  1I5Z A;  2M8E A;  4WK8 F;  3CUQ C;  4IXA A;  3BY6 A;  2FU4 A;  1S29 A;  2ZNY A;  3LST A;  1R1U A;  2M45 A;  5LRR A;  3JSP A;  1B9N A;  2ESH A;  3CUQ A;  3WG9 A;  1H9T A;  2PFB A;  5E20 A;  4U7D A;  3J80 Z;  2E1N A;  1Z6T A;  4H0E A;  4LG0 A;  5LHH A;  2A69 F;  2HFH A;  2EK5 A;  4CHU A;  1XMA A;  1IUY A;  2XAJ A;  4WXC A;  2P4W A;  2CW0 F;  2L4A A;  3WTZ A;  2BV6 A;  2YX7 A;  3G73 A;  3ZQ7 A;  3ABT A;  4WXH A;  3P9C A;  4GYI A;  4KIF A;  3MEX A;  4I09 A;  5E18 F;  2HGC A;  4YFN F;  1GVJ A;  2BBY A;  5TRD A;  4PZJ A;  2WC2 A;  3D0S A;  2AXL A;  5DUK A;  3WTW C;  3DXJ F;  3V4G A;  3G3Z A;  2QYO A;  3F6O A;  5BPI A;  4OMY A;  4LJZ F;  1IRF A;  5FO5 A;  1SMY F;  4EV0 A;  4L5I A;  4RS8 A;  4HLY A;  2IRF G;  3GFI A;  4G7O F;  3VOD A;  2EFQ A;  3EUH A;  3HIF A;  3I71 A;  3RKX A;  2FRH A;  3WTU C;  2OAZ A;  5CVJ A;  5LHI A;  4XSX F;  5AIQ A;  4ZYE A;  3IC7 A;  3ZMZ A;  3L9F A;  2PI0 A;  1FWZ A;  1LNW A;  5L3G A;  1E2X A;  1L3L A;  4OIQ F;  4I7H A;  5ICG A;  2EV6 A;  3U1D A;  1EH8 A;  2PMU A;  3V8J A;  4BXU A;  2MC3 A;  4GO1 A;  1BC8 C;  1C0W A;  3MQ0 A;  5DEQ A;  3JTG A;  3LQR A;  2Z9O A;  1R5H A;  3KCC A;  2DU9 A;  1Z6R A;  2P8T A;  1J9I A;  1G3W A;  3WOD F;  2R7D A;  3T8T A;  2VBZ A;  3BWG A;  3CUO A;  2DI3 A;  1YQA A;  3CUQ B;  3LA3 A;  1I1G A;  4B09 A;  4OOI A;  2MLK A;  3BJ6 A;  3MZY A;  4HF0 A;  4YIF A;  2FMY A;  1Z9C A;  1U2W A;  2IJL A;  3E6C C;  2JRT A;  4EJO A;  3U2R A;  1SFU A;  2HYF A;  2EFW A;  1RI7 A;  4L0Y B;  5J6X A;  2GIV A;  4OIR F;  4EQQ A;  4KMF A;  3RYP A;  1CF7 B;  1BOA A;  4U0V A;  1WRJ A;  1K6O A;  2XHK A;  2DO7 A;  2A6H F;  2RV8 A;  1ON2 A;  5L3B A;  1MD0 A;  1BI3 A;  1TW2 A;  5DV5 A;  2EV5 A;  5D6F A;  4HAM A;  3BRO A;  5JI6 A;  5KVR A;  2EJR A;  2IVM A;  5HS8 A;  4LLL A;  2GWR A;  1I1S A;  3I54 A;  1HW5 A;  1J75 A;  2QVO A;  1BBY A;  3PFI A;  4EM2 A;  5DDG A;  4HDV A;  3ABU A;  4JQF A;  2H6B A;  4KNY A;  3N4M A;  2ELH A;  4HA8 A;  5LHG A;  1WSU A;  2RN7 A;  3E6M A;  1P2F A;  1LVA A;  1SD7 A;  1IAW A;  2HS5 A;  5BPD A;  4M73 A;  4LB6 B;  3DKW A;  1Z05 A;  4HV5 A;  5DYM A;  2Q8K A;  4RGX A;  4KN7 X;  3ISP A;  1OYW A;  1W4M A;  4MQ9 F;  2IW5 A;  3HRT A;  3FM3 A;  2K4B A;  3SXY A;  2VT2 A;  4P9F A;  4AIJ A;  2M1B A;  4R1H A;  1A04 A;  4Y17 A;  1K7A A;  3I0T A;  2ISY A;  4KUM A;  3FMR A;  2VT3 A;  1P92 A;  1F5T A;  3QP6 A;  3BPX A;  2XAG A;  4BAY A;  1P4A A;  4HQM A;  3GF2 A;  4HLX A;  3EYI A;  1S6L A;  1B1B A;  1XDU A;  2EB7 A;  3R0J A;  3DFG A;  2FQ3 A;  3LA2 A;  5CVU A;  2MD5 A;  3TKY A;  1IXR C;  4MEY F;  5FB2 A;  1XCV A;  4DNC A;  3CLO A;  5LGT A;  2STW A;  3KLN A;  3PQJ A;  2F5F A;  2DAO A;  3F8B A;  2LNB A;  2VC1 A;  4ZZD A;  2CG4 A;  1ZGJ A;  2GA1 A;  1ZG1 A;  5FFZ A;  1ZAO A;  4LD5 A;  1FPQ A;  2WV0 A;  1ZRF A;  2MH9 A;  1ZLK A;  4AWX B;  2EWN A;  1GXQ A;  2QBY A; 
#chains in the Genus database with same CATH topology
 5EJC A;  1T2K A;  2X1D A;  2VBX A;  1R22 A;  1R36 A;  3R0A A;  3JRF A;  1XPX A;  5E1Z B;  1HBX G;  4I0B A;  2L3D A;  5GAH J;  3CCU I;  2DOA A;  2HEO A;  2GIZ A;  1HA8 A;  1IUF A;  1RKW A;  3H3V K;  2VN2 A;  4OIN F;  3O2P E;  3RTR A;  2ZJ2 A;  4PK4 A;  4EJV A;  1FLI A;  1W36 D;  2HWV A;  3WU1 B;  3K2Z A;  4BDZ A;  2EFN A;  2C6Y A;  4LIU A;  5ED4 A;  2QQ8 A;  5E17 F;  2CQ7 A;  2ZC2 A;  1NH3 A;  2JA2 A;  4ZJZ A;  4A12 A;  4PGH A;  2R7U A;  3S2W A;  1OCZ H;  1VQP I;  2VON A;  3OYJ A;  4C3J J;  3M9A A;  2BVM A;  3VSL A;  2D2W A;  2DN0 A;  4D1Q A;  2Q2E A;  3ZN0 A;  1Y56 A;  4HV6 A;  4PJN A;  5FLM J;  1LVK A;  4IJA A;  3LSM A;  5F0C A;  3ASO H;  1QQI A;  2E7X A;  1FBQ A;  2EH3 A;  2LY1 A;  3QU6 A;  4XLH A;  4PJM A;  2QGU A;  3L2Q A;  2LKP A;  3FHN A;  1B8I B;  2WA0 A;  1YTY A;  2R7R A;  3OOP A;  3ZN1 A;  6PAX A;  5CKT A;  4WXD A;  1J5Y A;  2F6C A;  2VOD A;  1XMK A;  1I39 A;  3S8P A;  4EJW A;  4S05 A;  2MAB A;  2DFE A;  5J8C A;  2JMW A;  3O8H A;  1A31 A;  2HTS A;  4XKB A;  2LLK A;  4KN4 X;  3CJT B;  1H89 C;  1R23 A;  2WB1 A;  5LLQ A;  4MNU A;  3REO A;  3OS1 A;  3DTI A;  4J19 A;  1IRZ A;  1V55 H;  4BQN A;  3B02 A;  2DJI A;  4U87 A;  1GXP A;  3IH2 A;  1AU7 A;  1V3F A;  2E1M B;  3LQQ A;  4Q47 A;  1LDJ A;  2O61 A;  1F9N A;  2MA3 A;  3QAH A;  3K7A J;  3T8R A;  2A07 F;  2K85 A;  2XGX A;  1IV6 A;  1AKH A;  1PDN C;  1T95 A;  2CUZ A;  2Q2E B;  3M1E A;  1ULY A;  1D0Y A;  2IGO A;  4LLG F;  1ZK8 A;  2RVC A;  4LFU A;  3BQZ A;  2CUJ A;  4IL6 C;  4XOT A;  1ETW A;  2IT0 A;  2XAH A;  1VND A;  3E7L A;  1VQ7 I;  1YIO A;  2X6O A;  5F6F A;  1D1B A;  1X4P A;  2BOL A;  2R7S A;  3SFZ A;  3CDH A;  1XX5 A;  3HSF A;  4WX9 A;  2RGV A;  2FXA A;  3LSG A;  5ILU A;  1B59 A;  4ESF A;  4MO7 A;  4A6D A;  4L9N A;  1KON A;  2QUF A;  4FCY A;  3S1R J;  4ENK A;  2NNN A;  3CTA A;  4HBL A;  5M5W J;  3KEQ A;  3OL4 A;  3R6S A;  2E5N A;  2KFD A;  2V6C A;  2GXA A;  3GUD A;  2NNY A;  1HW1 A;  4EMS A;  4M71 A;  4PSX A;  3LSK A;  5IT3 A;  2BY1 A;  2ZXJ A;  3QQA A;  4BJT A;  4XKV A;  3C3W A;  2E1C A;  2KL4 A;  2H94 A;  4Y13 A;  1HKT A;  1I6X A;  3LNQ A;  2WV1 A;  4RLQ A;  5J3L A;  1RRJ A;  2R5Z B;  2Y48 A;  2QBY B;  3H9J A;  2CUF A;  1G3Y A;  2BE5 F;  5DCF A;  3PIO F;  1FBS A;  3GCM A;  4WCG A;  1BR1 A;  1YI2 I;  2XAQ A;  2OTL I;  1E3H A;  1OFC X;  5C4X J;  2X48 A;  3DLA A;  3MN2 A;  3B6C A;  1ZRE A;  3E1S A;  2R5Y A;  1OKR A;  2R7O A;  1XDS A;  3E3V A;  4HX7 A;  3BTC A;  1UHM A;  4W1U A;  2M4K A;  4EAT A;  4XON A;  2ZME B;  3NWT A;  2WAQ N;  4IQ4 A;  4ENM A;  2JT1 A;  4BQA A;  1IO2 A;  2EZL A;  3CLQ A;  1U5T A;  3GFJ A;  5E3L A;  3BPV A;  4BHC A;  5IPA A;  4YRV A;  1TNS A;  3L00 A;  4G6D A;  2VPR A;  4PFO A;  5M5Y J;  5EGO B;  4A0X A;  2DFI A;  1S7A A;  2JA6 J;  4BBR J;  4ZDO A;  1BIB A;  1R00 A;  1B4A A;  4YII A;  1MBJ A;  3V8K A;  5GP9 A;  2F2E A;  1UG0 A;  3ZMS A;  2W82 A;  3FF5 A;  4L5J A;  1GDT A;  3M07 A;  1VZ0 A;  5HNH A;  2QA4 I;  3HOW J;  2ID6 A;  4PFP A;  2DMP A;  2BW3 A;  2F4M B;  4ZYG A;  1UCR A;  4BE2 A;  3DPT A;  3HTU A;  4XLN F;  1KU2 A;  1EH7 A;  1OCR H;  5FD5 A;  4Z6Y A;  3BZK A;  3EET A;  1JGG A;  2HYG D;  3DTK A;  3HHG A;  1SVO A;  2CV2 A;  3FWE A;  1PVE A;  1REP C;  4G7Z F;  4BEH B;  1MJB A;  1ZAR A;  1MJ9 A;  2FD5 A;  1Y6I A;  3JRH A;  1IF1 A;  1STZ A;  4M3F A;  1ZEL A;  2K5C A;  1KU3 A;  2AHQ A;  2JJ7 A;  3TMO A;  4FQG A;  4LK1 F;  2KDZ A;  5JVG F;  1MKM A;  4BNC A;  2VBY A;  1E17 A;  1WKM A;  2E1O A;  2LVS A;  3A0H C;  4ETS A;  3FK6 A;  1LPQ A;  2ZXH A;  1HQC A;  3C2G A;  3QOE A;  3DU5 A;  4R8H A;  4J01 A;  2QWW A;  1XB4 A;  4Y7N J;  2KRC A;  1JJ8 C;  2ZJP F;  1W0U A;  1PUE E;  4JX4 A;  3J7Y J;  3GEZ A;  1LFB A;  2IP2 A;  3HPH A;  3I59 A;  3BJA A;  3H0D A;  1FSE A;  5KK1 A;  5JLX A;  2V9P A;  1EH6 A;  4UUT A;  2Y0S N;  1O3S A;  1ZH5 A;  1TQM A;  2JUG A;  4KJZ A;  4CO8 A;  4F52 A;  3OS0 A;  2KRF A;  1GVD A;  2L9S A;  2H1K A;  5EEG A;  2R5Z A;  1IN7 A;  2XF6 A;  3HOZ J;  2TRT A;  1SFK A;  4CIC A;  1IV8 A;  1MH3 A;  3V42 A;  3R61 A;  3BR2 A;  3ML6 A;  4FIS A;  1IN6 A;  3G4S I;  4AM3 A;  4MLO A;  4Y52 J;  1V5F A;  2IGK A;  2VC0 A;  4XKC A;  1OYI A;  1MMD A;  1KYZ A;  1KGS A;  2CGP A;  3OR1 C;  3RI4 A;  3TED A;  2LYC A;  5JFR A;  2WAF A;  5HS9 A;  1D5V A;  1ZHF A;  4JYK A;  4RMN A;  3CCM I;  1W7P B;  4I76 A;  4E4H A;  3KP2 A;  5E3O A;  4V2F A;  1U9N A;  1W7P A;  3BZ6 A;  1YIJ I;  2PQ8 A;  4Q48 A;  4IOC F;  4PDK A;  2W4S A;  1XSX A;  2LF7 A;  2UUZ A;  3S14 J;  5FD6 A;  3GZN B;  1BI2 A;  1DU0 A;  4YEL A;  3OYL A;  3QYE A;  1BR4 A;  3C1D A;  4O6J A;  3OYH A;  5IY5 H;  1R49 A;  1YLF A;  2Y0M A;  3ERE D;  3GTM J;  3I3L A;  2DMU A;  1JTX A;  2MG4 A;  1K79 A;  3HZJ A;  4XNF A;  1I3Q J;  4RB0 A;  5CYV A;  3GX4 X;  2QF7 A;  1FIA A;  2FOW A;  2BW3 B;  3DBR B;  1K61 A;  1ZGA A;  2G7U A;  1R5G A;  4G9Y A;  3B6A A;  3HL2 A;  1FYM A;  1KYW A;  1SD4 A;  2LH9 A;  4CYD A;  1FIP A;  4RA2 A;  3VYS B;  4ZDL A;  5F1R A;  9ANT A;  3ZMV A;  2WBM A;  1LKX A;  4XOR A;  4MHG A;  3V8L A;  2JPC A;  1QRY A;  1S9H A;  2VQH A;  2XPV A;  5M5X J;  5DM6 F;  3F23 A;  1W36 C;  4GXO A;  4A3L J;  1TW3 A;  2PMZ N;  2IA2 A;  5BQT A;  5D5U B;  3VYU B;  2ETH A;  1XSD A;  3TP0 A;  1YRN B;  2BHZ A;  3M8J A;  3JR9 A;  2KJC A;  2V4J C;  1JHH A;  3IUO A;  2IS6 A;  2JZY A;  3K1M A;  1X1D A;  2VB6 A;  4DZJ A;  3HUG B;  4KIG A;  3S3O A;  4II3 A;  4U88 A;  3OYF A;  2CUE A;  4W97 A;  3SZT A;  1MMG A;  2ZKZ A;  1BI1 A;  4A93 J;  2I8D A;  4IX7 A;  2A6T A;  2EIJ H;  5ICC A;  1Z1D A;  2GOX B;  3WTY C;  1TT0 A;  2EZI A;  4RBO A;  2V9K A;  3MD2 A;  5EEH A;  2XC7 A;  2DQR A;  1OYY A;  1UMQ A;  2H6C A;  2H8W A;  4YG2 F;  3SYT A;  1D8J A;  2XSJ C;  2ZBK A;  1D3Y A;  2WWY A;  1HST A;  1TWA J;  5ICF A;  3RSN A;  1OCT C;  4RGS A;  4AIH A;  1B9M A;  1O7L A;  5D5V B;  1YJN I;  2FEZ A;  1JKQ C;  5HOO A;  5JLW A;  4FE7 A;  3HYI A;  1SD5 A;  5E8I A;  3CC7 I;  2VJ5 A;  2HQ5 A;  3QRF F;  4JX5 A;  2OF7 A;  2COM A;  2TDX A;  3SZG A;  1ETY A;  1Q1V A;  1UFM A;  3NAU A;  4XIC A;  1Y39 A;  3EYY A;  3L1P A;  1OLT A;  3F8C A;  3FKJ A;  2P5V A;  5ERI A;  3OS2 A;  2QEX I;  3FXJ A;  2E2H J;  3F22 A;  5IT9 K;  1A5J A;  1ZN2 A;  2XV4 S;  3KYC B;  4KMU X;  3QU3 A;  2DT7 B;  1ETX A;  1LUJ B;  2VOP A;  2OC6 A;  4IZZ A;  2PLY A;  2Z1D A;  3L2V A;  3M1C A;  5F64 A;  3C7J A;  3V7S A;  5LBQ A;  3CME I;  3TOB A;  1WJB A;  3KPH A;  1TNT A;  1S3J A;  1SVL A;  5GAD J;  2IA1 A;  1QNT A;  3GZ5 A;  2Y30 A;  1IW7 F;  2KIM A;  3RCO A;  2KJB A;  3ELK A;  4P1W A;  5FLX K;  4GGG A;  3TO6 A;  4RAY A;  2KIF A;  3NAR A;  1ON1 A;  2PEX A;  2NRA C;  2IS2 A;  4I98 B;  1H88 C;  1YG2 A;  4IKF A;  3ZQF A;  2W25 A;  2OCC H;  4AYB A;  3RKY A;  1KQ9 A;  2ZSH B;  3E6D A;  3HKZ N;  4BHP A;  1F36 A;  3TBI A;  3J7A O;  3D5R C;  1JKR C;  2MBF A;  2XAU A;  2E5Z A;  1EJ9 A;  3ZMU A;  2M8G X;  4DGW B;  2XUB A;  1RNL A;  4I01 A;  2QSF X;  2V79 A;  1QGP A;  5J1Y A;  4O3M A;  1G2H A;  2Y2Z A;  2O5R A;  3QPT A;  4OWR B;  2IEK A;  3MWM A;  3JRI A;  2FNP A;  4X6A J;  3CDI A;  4CSW A;  3M4O J;  3IWZ A;  4A3J J;  1XGO A;  4XLP F;  2DQL A;  3LSH A;  3DEW A;  2X1C A;  2P81 A;  2M2E A;  1FOY A;  2G0E A;  2O7O A;  3DWL E;  4RGR A;  4ZYD A;  5EEA A;  3H92 A;  5C44 J;  1DGW Y;  5GTH C;  2VXD A;  5E79 C;  1VQN I;  2LMD A;  3KE2 A;  2DT6 A;  2VBW A;  3OYM A;  4AC0 A;  3DCF A;  1O3R A;  5IOY A;  2H27 A;  3QOD A;  1ODD A;  4CGZ A;  3KP3 A;  1PUF B;  2K27 A;  3K10 A;  5CVV A;  5BMZ A;  2DPD A;  1LEB A;  2V26 A;  2R0Q C;  2VE8 A;  1VF9 A;  2E1M C;  3HB9 A;  1I3A A;  4L9V A;  4CA0 A;  2QEN A;  4EM1 A;  1TQI A;  1YE9 A;  1Y8Q B;  3LAP A;  2H8R A;  2D1V A;  4XLE A;  3CCQ I;  1KU7 A;  4A3F J;  5FRM A;  2KMU A;  1MJA A;  3OSF A;  3E5U A;  1N78 A;  1VQ4 I;  1YS6 A;  1BIA A;  2ZO4 A;  2A5Y B;  2O8X A;  3LFK A;  4ON0 A;  1EKE A;  4IHY A;  2E2J J;  4UVB A;  2BY0 A;  4LG3 A;  1FYK A;  4DBR A;  4CCO A;  2B0L A;  2L54 A;  2LR8 A;  4RAZ A;  3IAS 2;  4BJ6 C;  1Z91 A;  3I59 B;  3TO9 A;  5ILV A;  3WTS C;  1XTA A;  1HF0 A;  2IS1 A;  3DKX A;  3CP8 A;  3TOA A;  3AAF A;  3FK7 A;  1TBX A;  1OCC H;  1ZRD A;  4HW0 A;  1MNE A;  3I53 A;  3SHF A;  1JKP C;  2ZXI A;  1DPR A;  5EZG A;  2XRN A;  1O4X A;  3F8N A;  5F1J A;  1T8I A;  2VJJ A;  4H4K C;  2HQA A;  3F72 A;  2XF7 A;  3OMY A;  3OV8 A;  3CP2 A;  2P6T A;  4A0Y A;  1WH7 A;  2O6G E;  1RUN A;  2D5V A;  1K83 J;  3N97 A;  1EV7 A;  1V5G A;  3KZZ A;  3QYF A;  3S3M A;  4HX8 A;  1W5T A;  2UWM A;  2XSD C;  5L3C A;  3FBI B;  3OL3 A;  3CCV I;  5JHU A;  2K9N A;  1A6I A;  1QVU A;  4DIQ A;  5EG0 B;  4ESJ A;  3MFK A;  2CV1 A;  3OYK A;  4XLA A;  3LWF A;  1IXS B;  4NC7 A;  4IRG A;  3ECO A;  3ROU A;  1WJC A;  2LKS A;  1U5T C;  3FHZ A;  1X1B A;  2Y75 A;  3K0L A;  3VYR B;  1BJA A;  3HGG A;  1AA7 A;  1FYL A;  2MLG A;  2PX9 A;  2QQ9 A;  5E1X A;  3RZO J;  1P7I A;  1H9G A;  1ZG3 A;  1JTY A;  1UST A;  5FFX A;  2IBD A;  3RPU A;  1KA8 A;  4FHT A;  2Q0O A;  2JSC A;  1HCR A;  5CVR A;  5TJJ A;  2O0Y A;  5DCM B;  1T39 A;  2RC4 A;  3ZQQ A;  3BT9 A;  3AG3 H;  3BP8 A;  3S1N J;  3BTL A;  1X3W B;  1J2X A;  3K6G A;  2JPB A;  1O7F A;  2HVR A;  1XCB A;  2ZJQ F;  4CCK A;  1R5I D;  5ILS A;  2HPI A;  3Q9V A;  3WU2 C;  1PUF A;  3W6K B;  4XRM A;  2DLL A;  4MTD A;  4D9J A;  4I99 C;  2YUS A;  2R4G A;  3F21 A;  5H2F C;  5L3F A;  1FBU A;  2DA4 A;  3L2R A;  1JGS A;  3QPH A;  3AFH A;  4U7B A;  3HRS A;  2F48 A;  2A3S A;  5HLH A;  3JRC A;  3COA C;  5LEJ A;  1FX7 A;  1YW7 A;  2BYV E;  4MFE A;  1LB2 A;  2RKH A;  3HOX J;  1VQL I;  3PNT A;  1VQ5 I;  2K86 A;  3CC4 I;  5DM7 F;  2EZK A;  3RPQ A;  5IOZ A;  3TDU C;  4C2T A;  2Y31 A;  4M6V A;  5DCM A;  1ZKG A;  3WG7 H;  3E0J B;  5EF6 A;  3W6V A;  4XRF A;  5A2Q Z;  3WGI A;  4LMY A;  2YPR A;  1ERD A;  1SFE A;  4N0B A;  3FMQ A;  2DA7 A;  3JRB A;  1K6Y A;  1VTN C;  1W1W E;  2KKO A;  2Z5U A;  4HG2 A;  4QPO A;  4UV9 A;  3U1K A;  3F0C A;  2EIN H;  1F4K A;  2LSO A;  2LC2 A;  3MAJ A;  5IYB J;  2VPL A;  4A5N A;  2LY2 A;  4LOC A;  3E97 A;  3LL7 A;  5BS6 A;  5FLX Z;  4E7J A;  1A35 A;  2AO9 A;  2DA3 A;  4IVN A;  2K9S A;  2P0W A;  4RLF A;  3OYB A;  4HDU A;  4BH9 A;  4HST A;  2IS4 A;  1X4O A;  5BNG A;  2KZG A;  3HM5 A;  2NS0 A;  3RIR A;  3SZP A;  1VI0 A;  2LRE A;  2OQR A;  3F8F A;  4EJU A;  3GME A;  2FQ4 A;  4G6Q A;  4EGZ A;  1FP2 A;  1U6G A;  2STT A;  4C3I J;  1J59 A;  1MBF A;  1Z7U A;  3I55 I;  4L9T A;  1Z7L A;  2HZT A;  3PUB A;  3K9T A;  1OR7 A;  3CO7 C;  1RIO H;  5DUI A;  2DJN A;  4G7H F;  1GUU A;  3CJQ B;  2DOD A;  5H6Q A;  3CMM A;  2V6E A;  1SFX A;  4M74 A;  1N77 A;  2BGC A;  2UZK A;  3J80 K;  1T56 A;  3LSJ A;  4OAY A;  5E1W A;  5AON A;  5H6R A;  4CYC A;  5KAF C;  4BUP A;  2XF5 A;  1P7J A;  2E36 A;  4XK4 A;  2OV7 A;  3CJN A;  2EPF A;  4N9H A;  3CO6 C;  1QPM A;  4KFC A;  1X19 A;  3QWL A;  3V7C A;  4XQF A;  3S93 A;  2HOT A;  4HRI A;  2ESN A;  2M3A A;  3FMS A;  2F4O B;  1BI0 A;  2ICW G;  4NHJ A;  1Z3X A;  1OR7 C;  4QTR A;  1SAN A;  4BQQ A;  2WY7 Q;  4AVZ A;  4B48 A;  1WJD A;  4JBA A;  2L9N A;  1F1Z A;  5ICE A;  4LG0 B;  5KAI C;  2HR3 A;  3DTE A;  2R7Z J;  3IHU A;  1UB9 A;  5GPA A;  2DTR A;  4FTH A;  1UHW A;  3ZRG A;  2KZV A;  2VKE A;  1RZ4 A;  4RGU A;  4ZTJ A;  3H9G A;  1ZR2 A;  2XVC A;  4EJT A;  1OCP A;  3S1M J;  2W1O A;  5CVI A;  2P5L C;  4IO9 F;  1GT0 C;  1R9T J;  1J09 A;  4OMZ A;  5EZH A;  2V1N A;  4FET A;  2DT5 A;  4UY8 I;  3SDG A;  2M34 A;  2Z3Y A;  2QM3 A;  2ZFW A;  4WWC A;  1ZQ3 P;  4HNU A;  4G8X A;  3LSI A;  4IHW A;  4M9X A;  1VQ6 I;  4N9I A;  3VFZ A;  2H09 A;  2F5C A;  2HZD A;  2DMQ A;  2CFX A;  1HDD C;  2ZME C;  3EQL F;  5D8K B;  2CQX A;  4YFK F;  1H8A C;  2FOK A;  5K7Z A;  1B72 A;  1E3O C;  1I50 J;  3BTJ A;  3Q0U A;  2ADU A;  5EGO A;  1FC3 A;  1X1C A;  2Y9Z A;  1HKQ A;  1R7J A;  4GYG A;  1J7K A;  3H5N A;  1W7P D;  3WTX C;  5D4R A;  2LF8 A;  4EVI A;  1ORK A;  3HPG A;  4A5M A;  3NQO A;  1TL8 A;  5C4J J;  2MGQ A;  3WE2 A;  5KNL A;  4B44 A;  3Q5F A;  1OPC A;  2RQP A;  2W57 A;  4NDL A;  3TGN A;  4RDU A;  1HOM A;  2EIM H;  1D1C A;  3GFL A;  4GCV A;  4M3E A;  3QP5 A;  2DMN A;  5HNF A;  5D5W B;  2V1D A;  3IKT A;  3VWB A;  2BY3 A;  1XGS A;  3F8M A;  3DF8 A;  3L2W A;  3P7N A;  5DS9 A;  1B6A A;  3K1N A;  3K70 D;  1QHH D;  4P96 A;  3HC7 A;  1R1T A;  2IAI A;  2M87 A;  4E7L A;  2V7F A;  4LIT A;  3CD6 I;  2FF4 A;  5FKN A;  2OUM A;  2E19 A;  5IP6 A;  1QO0 D;  3S32 A;  1ZYR F;  1JT6 A;  2K4J A;  3KET A;  1SVM A;  3HOT A;  4HQE A;  1KU9 A;  1FOX A;  3ERM A;  3DPL C;  3MZ8 A;  4B43 A;  1R1V A;  3H9Q A;  5FGM A;  3GVA A;  4B3A A;  2GLO A;  3OIO A;  4MFD A;  4AD9 A;  4XLC A;  1DDN A;  4NQW A;  3OYG A;  4A0Z A;  3H36 A;  3D5S C;  2KP6 A;  1FY7 A;  3JSO A;  3S3N A;  1TLH B;  3FX3 A;  2MFZ A;  4BE1 A;  4HYE A;  2M30 A;  4G12 A;  4KIC A;  1RUO A;  3K4B A;  4RB3 C;  2VL8 A;  2V1U A;  3ABL H;  3H3U A;  1A36 A;  2HXI A;  1QZY A;  3K69 A;  3GTP J;  3Q0W A;  1Q1H A;  1MDM B;  4C2U A;  2HTJ A;  1MH4 A;  2K7L A;  4G94 A;  1QU3 A;  3FXO A;  3FXQ A;  1YS7 A;  2W84 A;  3C2B A;  4DZP A;  4UVC A;  2M9H A;  5K5Q A;  3L2U A;  3HOV J;  4PCQ A;  2OD5 A;  2E60 A;  2KLO A;  3LFU A;  2K40 A;  1G3S A;  3JRA A;  1SEU A;  2QSG X;  2O3F A;  4ABZ A;  3ECH A;  4RM3 A;  4V2G A;  3ZXS A;  4A3K J;  2HI3 A;  3K70 C;  3CCE I;  3I5U A;  1X3U A;  3HRM A;  1TWH J;  2P7V B;  2X85 A;  4HPQ A;  3O3K A;  2K9L A;  4CCL A;  5L3E A;  1YYV A;  2XAF A;  1B8I A;  5D4S A;  1FOK A;  4L0Z B;  1MZB A;  1J0R A;  2XKP A;  4PJJ A;  2LDU A;  4KDP A;  1IXC A;  3RYR A;  4G6T B;  2EV0 A;  2GA2 A;  4CCM A;  1MMS A;  4C30 A;  1K4T A;  2J5P A;  5JR3 A;  3G6E I;  3OYA A;  3HTS B;  2IPQ X;  4GFB A;  2HVQ A;  1WWX A;  1UZC A;  1YW8 A;  3K4J A;  2P7C B;  3ZPL A;  2ZB9 A;  3ZCO A;  4I6Z A;  4J00 A;  3GO5 A;  4ANJ A;  1XGM A;  2JA8 J;  1DU6 A;  4JX6 A;  1ITY A;  1DPU A;  3RPU D;  2P6S A;  1Z3Y A;  3IH4 A;  1DP3 A;  1VQK I;  5K5O A;  1R4N B;  4Q4Z F;  2PJP A;  1T08 B;  1WJE A;  2HDC A;  2L0K A;  1ETQ A;  2X1E A;  2IA0 A;  4PGG A;  1QVT A;  1K78 A;  3A4C A;  1LFU P;  1LDD A;  3HRU A;  4A3C J;  3K4L A;  1A6Q A;  3ZP5 A;  3JAM K;  4RM2 A;  4U0W A;  3TQN A;  4JOM A;  3VOE A;  2HQN A;  4IPA A;  2XB0 X;  5EYR A;  5HVQ C;  1U3E M;  1HKS A;  2XPW A;  5D6E A;  2I10 A;  5K1Y A;  4A3B J;  1AOY A;  2MYS A;  2V9V A;  2VJI A;  3WGG A;  1SC7 A;  5EDN A;  2GM4 A;  3E6B A;  2DK8 A;  1MND A;  1WQ2 A;  5DD8 A;  2FA5 A;  3GLL A;  4P5O A;  2W00 A;  2L01 A;  3ZMT A;  5LEK A;  3GTK J;  3L2C A;  4AIK A;  2CQK A;  2VE9 A;  3KP5 A;  1MMA A;  2PG4 A;  5FJ8 J;  4BGD A;  2XRO A;  2CSO A;  1FJL A;  1BW6 A;  3PFY A;  4K2E A;  4O5V A;  3P9I A;  3SEZ A;  3B73 A;  3H3Z A;  4EEF G;  1ZLJ A;  2HQR A;  3RZD J;  5J4V A;  3GTQ J;  2VUM J;  4AVP A;  2RAE A;  2GBY A;  1CF7 A;  3E5Q A;  5K7H A;  2ZJR F;  4XBF A;  4AU7 A;  2NS7 A;  2DA1 A;  3BG3 A;  1U9O A;  3T1B A;  4F91 B;  3JRE A;  2CQQ A;  1ZGW A;  1IN4 A;  2L02 A;  1MBK A;  1FNN A;  2M0C A;  3CCY A;  4XL9 A;  3J81 Z;  2ME0 A;  4CZC A;  2FBK A;  4DYR A;  3P9K A;  5HLG A;  4NUB A;  4IF4 A;  4UUS B;  3K4C A;  1ETV A;  2J5O A;  4UB8 C;  2LP0 A;  1IN8 A;  2HKO A;  2D45 A;  4XMY A;  2LBF B;  2JA5 J;  2FML A;  4F7Z A;  1WI9 A;  5HS7 A;  5E3N A;  3JAM Z;  1QPI A;  3DEU A;  1X2M A;  2IGM A;  3SJM A;  3CCR I;  4QLC U;  2NVQ J;  2ZME A;  3GWZ A;  1ONV A;  1IC8 A;  3I56 I;  2CV0 A;  5JVT A;  3FXK A;  4A6E A;  4DBQ A;  5J1R A;  3U9G A;  3E5X A;  2Y69 H;  2JUC A;  2B9S A;  1MMN A;  3C18 A;  5HDG A;  1G8X A;  1R71 A;  3IL2 A;  3IWF A;  4B8X A;  5J4Y A;  4MIM A;  1V4R A;  1BM9 A;  5A2Q K;  1IDY A;  1BR2 A;  2PMH A;  3GXO A;  3T0Y A;  5CJ9 A;  2JTV A;  3GW2 A;  4LIV A;  2X6Y A;  4LK0 F;  5C3E J;  3TDZ C;  3AG2 H;  1SMT A;  4KT5 C;  4RB2 C;  5TIS C;  2W85 A;  5M3F J;  3HSE A;  4DQ2 A;  2W48 A;  1XN7 A;  3OWT A;  4YFX F;  1Y8R B;  3DQV C;  3H35 A;  1PP8 F;  4Q5S F;  3Q9S A;  4M72 A;  2VXZ A;  1JXS A;  3KFW X;  1O57 A;  1X3Z B;  1WFX A;  3LOC A;  1RPW A;  4TV7 A;  1R58 A;  2UXN A;  3A02 A;  1H0M A;  3JTH A;  4ZTF A;  5LRS A;  4BAC A;  5BOX A;  2ZNZ A;  2QKM B;  2AS5 F;  2KIQ A;  3KP6 A;  4L18 B;  1VQ8 I;  3AKZ A;  4XKW A;  2Q1Z B;  3KIO A;  1TWF J;  2YSR A;  4HOB A;  1KZH A;  2RDP A;  1LDK B;  3LSP A;  3EUK L;  3TP3 A;  1GHC A;  4KIB A;  1GV5 A;  4BXX J;  1CGP A;  4ENN A;  2F4I A;  4CUG A;  4M6Y A;  4BY7 J;  3BR3 A;  2UV1 A;  3ABK H;  2NVU B;  3BG9 A;  4FE4 A;  5GAG J;  2DPU A;  1IRX A;  4R79 A;  2GXB A;  3OSG A;  2CYY A;  3BG6 A;  4FX4 A;  1JHF A;  4IRH A;  5HOD A;  2QCO A;  1RKT A;  5D8L B;  2OQG A;  5HLI A;  4OIO F;  3GFM A;  2KRH A;  2HPM A;  1MIJ A;  3LA7 A;  3W3C A;  4KYW A;  3ZGK A;  4QWQ A;  2OU2 A;  3WTV C;  1ETK A;  1DUX C;  1U8B A;  3VB2 A;  1AWC A;  3BQY A;  2A68 F;  3DV8 A;  3OOU A;  3FXM A;  2VI6 A;  2UXX A;  4M6X A;  4I2O A;  2GQQ A;  3KP4 A;  4HNV A;  4X1E A;  2O8K A;  1S8N A;  4DOZ A;  4Y33 A;  2PJR B;  3R60 A;  3R4K A;  2ZCW A;  1YFH A;  2DFF A;  3SQN A;  3FXR A;  4XID A;  5HLT A;  2CRG A;  1XSV A;  1FP1 D;  4XN3 A;  2EBI A;  5LGU A;  5HDN A;  2A5W A;  2OPT A;  4E7Z A;  4QIW N;  2DBB A;  2W24 A;  1NK3 P;  1TTY A;  2WAD A;  1T38 A;  4LLN A;  3M8E A;  3PQK A;  3WU0 A;  1RC9 A;  4IHV A;  2L5Q A;  3M7G A;  4XM3 A;  4NB5 A;  2G7H A;  3BC8 A;  2XAS A;  1BC7 C;  1P9Q C;  3A03 A;  2Z16 A;  1JUS A;  3CJR B;  4BL0 B;  3BDD A;  5KHD A;  3SDB A;  2L2O A;  2VQL A;  2HKX A;  2LTP A;  3KP7 A;  2JK3 A;  4D0P A;  1HSJ A;  2XGC A;  2EFP A;  1WVR A;  4I02 A;  3NEU A;  4ZZL A;  4U0Y A;  4UV8 A;  2L7K A;  4LGW A;  3HG9 A;  4NBQ A;  1XD7 A;  2XRL A;  4UVA A;  1IN5 A;  4XR6 A;  4CZZ A;  4JK1 X;  3DU6 A;  2X0L A;  2NOG A;  2NYX A;  4ESB A;  2NVY J;  2RRE A;  2L7F P;  2EA2 A;  3LAJ A;  2YS9 A;  2O9L A;  2MD0 A;  4UUV A;  4M3D A;  5F04 A;  3I58 A;  1S72 I;  1XS9 A;  2FUG 2;  3CZ6 A;  1HC8 A;  5IT9 Z;  1WGX A;  4PJL A;  1G4D A;  1T33 A;  4B3X A;  4KT6 A;  1EA3 A;  4C3H J;  4BBS J;  2FJ1 A;  5L3D A;  2AXT C;  1T98 A;  4S0H B;  4BYY A;  2EIK H;  1SAU A;  3H1C A;  2DW4 A;  2FX0 A;  1USS A;  2L4M A;  3FZV A;  4BXF A;  3S16 J;  5J40 A;  1WI3 A;  2VJ4 A;  3OYD A;  3EPZ A;  3Q3S A;  1LEA A;  3W2A A;  2CO5 A;  4P9U A;  3BCA A;  4KIT B;  1FZP B;  2BXY A;  3BOQ A;  5TGT A;  4F93 B;  1MNM C;  3OIP A;  2QQA A;  2JN6 A;  3D1N I;  4HF2 A;  1WJA A;  3OR2 C;  1YHQ I;  2VOO A;  2JVG A;  3MKL A;  3CF5 F;  2YX4 A;  4M9Z A;  1V54 H;  2R7F A;  3A01 A;  4FT8 A;  5E8G A;  1LJ9 A;  1JUM A;  1W5S A;  2ZXW H;  4HZF A;  1P4X A;  4P55 A;  2K9M A;  2JSP A;  1JE8 A;  2A61 A;  1QBJ A;  2PMZ A;  1Y0U A;  4GRI A;  5AIP A;  2FBI A;  1M1E B;  3MCZ A;  4EGY A;  1T0F A;  2DFH A;  1DP7 P;  3KZY A;  5LFA A;  3ZQG A;  4BHB A;  3JRG A;  3J81 K;  3F3X A;  2EQR A;  2LKX A;  2ISZ A;  3IRQ A;  3QOP A;  3WHC A;  4LB5 A;  1IG7 A;  5FLV A;  2CU7 A;  2ELJ A;  3M8F A;  3ASN H;  3HXL A;  1PJR A;  1QZZ A;  4F3Q A;  2CWE A;  4OU0 A;  4F55 A;  4HF1 A;  4F92 B;  3A2K A;  1HXD A;  1X2N A;  4RB1 A;  1X58 A;  4ASN A;  1SAX A;  2IXS A;  1KQ0 A;  2Z99 A;  1PP7 U;  4Z2Y A;  2O03 A;  1NG7 A;  4DYQ A;  4MQV A;  2BY2 A;  2XDV A;  5J47 A;  2JQ7 A;  1FSH A;  2F5E A;  3O6B B;  1W5C C;  2EFO A;  2YU3 A;  2OJE D;  3W6J B;  4ENJ A;  2NXN B;  3OY9 A;  2HU9 A;  4YEJ A;  3WTT C;  3GLX A;  3HOY J;  1D8K A;  3QYB A;  1TQP A;  4A3E J;  2XIG A;  3ULQ B;  4CCN A;  1U0J A;  2BXZ A;  2OZ6 A;  2ECC A;  2F5V A;  3K4M A;  2GAU A;  1XGN A;  3UKG A;  1BN5 A;  2MW8 A;  2QZ8 A;  3PM1 A;  1IRG A;  4NC8 A;  3MZH A;  3FM5 A;  4IOA F;  4B4C A;  1IZ1 A;  3CMA I;  1ZTR A;  3IKV A;  4ZC3 A;  4IHT A;  2FBH A;  2OCE A;  3BG7 A;  1ZG5 A;  1K4S A;  2V1X A;  5CLS A;  3RKW A;  1S7O A;  3VYT B;  3I64 A;  4BJ5 C;  5FKK A;  1WJF A;  4WF2 A;  5D5X B;  3ABM H;  4BY1 J;  2Z33 A;  1CQT A;  3OYE A;  3DBL B;  3RJP A;  5F0F A;  2FSW A;  3F6V A;  2R3S A;  4E7I A;  3BZC A;  3ZMD A;  4FAS D;  5IP9 J;  1BA5 A;  2GXG A;  4CXF A;  4AID A;  1U78 A;  2Y0S A;  5LGN A;  4KA4 A;  3KX2 A;  2RNJ A;  4HX4 A;  4EM0 B;  1BOB A;  1SFO J;  2YR2 A;  3NRV A;  4ZH4 F;  4OAZ A;  3EDP A;  1U5T B;  2BEO A;  2I5U A;  3M3Y J;  2EZH A;  5J8F A;  3QPL A;  2HXO A;  1HDP A;  3ZQI A;  2OZU A;  1N25 A;  1OQY A;  1U8R A;  2NAZ A;  2M5W A;  4XN0 A;  4DJA A;  5GTI C;  1VFC A;  4XSZ F;  3FXL A;  2P5K A;  3BLY A;  3BR5 A;  5H20 A;  1ACI A;  2M7B A;  1I27 A;  2OBP A;  1T6S A;  2DK5 A;  5HDK A;  5LD2 C;  1F43 A;  1G6N A;  2X4H A;  3ZQL A;  3T5X A;  2A6E F;  1SD6 A;  3S17 J;  2H1L A;  3KLO A;  3K4N A;  1JUP A;  3F9K A;  4I0A A;  3TO7 A;  5EG0 A;  4UXN A;  2YU9 J;  2XGD A;  2VQC A;  2OA4 A;  1O3Q A;  3VEP A;  2BZT A;  1OMI A;  2AQF A;  3L09 A;  3WE3 A;  5DD4 A;  4NC6 A;  3DKY A;  2HVS A;  4BQO A;  1QA6 A;  3I4P A;  3PNY A;  3CES A;  2K02 A;  3GZ6 A;  5K5R A;  3JW4 A;  4HSR A;  2R7V A;  1NTC A;  1QHG A;  5DTD A;  1VQO I;  1VQ9 I;  3IP4 B;  1FOW A;  2WTE A;  1L0O C;  3W2V A;  3JCU C;  4MTE A;  4CH7 A;  4M9S A;  5F0H A;  3D5L A;  3BG5 A;  3FXU A;  2LRD A;  3PUF A;  1P6R A;  3BJO A;  2E71 A;  2LFB A;  2X6X A;  3U21 A;  1NHA A;  4UHT A;  1KQ8 A;  4M3G A;  3OYI A;  3HHH A;  4L9J A;  3GTO J;  1MSF C;  4UNO A;  1YW9 A;  1G3T A;  5GPC A;  1N75 A;  2XKO A;  4QPQ A;  2L7M P;  3HUG A;  4FX0 A;  2G9W A;  2GZW A;  4A69 C;  1HW2 A;  2LD5 A;  2VAS A;  3AG1 H;  4S04 A;  4ZYH A;  3WGH A;  1P4W A;  4N4N B;  3JRD A;  3IH3 A;  1ZRC A;  3KEY A;  1BJZ A;  1LQ1 A;  4C2M J;  4Y15 A;  1MGT A;  2ACJ A;  3V7R A;  3K1P A;  3DP7 A;  1K78 B;  2FE3 A;  4A2U A;  4BS9 A;  4E70 A;  1FMV A;  2L9V A;  4QSH A;  4IHS A;  2KIU A;  2F5D A;  3HBL A;  4OIP F;  1TT5 B;  2XGE A;  1V5E A;  1Y1V J;  4MGR A;  1S7E A;  2E7W A;  1YIT I;  1DGR M;  4XOP A;  2K3P A;  2PN6 A;  2DDB A;  3BTI A;  2VLA A;  1YJW I;  3GYH X;  2M4G A;  2MH2 A;  2PBI A;  2R5Y B;  3RDI A;  1FT9 A;  1WPK A;  1R6R A;  2D1H A;  1UAA A;  3L7W A;  1YO5 C;  3DBH B;  4NQW B;  4IRI A;  4ITV A;  5K7F A;  2FNA A;  1YOV B;  1X1P A;  1WCM J;  3HOS A;  2QLZ A;  3KZI C;  1MDM A;  2GOM A;  2EA4 A;  3K2A A;  3HSR A;  4CDG A;  3X2Q H;  3ZQH A;  3SFI A;  2HOE A;  2QQB A;  2Y9Y A;  3PSI A;  3KEO A;  1O3T A;  3PNV A;  3IRR A;  1HLV A;  4MEX F;  1I5Z A;  2TCT A;  2M8E A;  5FKM A;  4WK8 F;  3EUA A;  3G1O A;  2CFO A;  3CUQ C;  3DEE A;  4BDY A;  3G1L A;  4IXA A;  2R92 J;  1FMW A;  3BY6 A;  1Z67 A;  2FU4 A;  2DMT A;  2AQE A;  1S29 A;  2ZNY A;  3LST A;  2LBF A;  4IHX A;  1R1U A;  4D7M A;  1YRN A;  4N4O B;  2M45 A;  5LRR A;  3JSP A;  1B9N A;  2ESH A;  3CUQ A;  5KCM A;  3WG9 A;  1H9T A;  2PFB A;  5E20 A;  3S2D J;  4U7D A;  3J80 Z;  3KYD B;  2ELK A;  1Z0X A;  1B72 B;  2E1N A;  1ETO A;  1Z6T A;  4H0E A;  3TW6 A;  4LG0 A;  5LHH A;  2A69 F;  2HFH A;  1D0Z A;  2DA5 A;  3OYN A;  3Q0V A;  4RAF A;  1AKH B;  1XC5 A;  2ZSI B;  2EK5 A;  4D5F A;  2VIX A;  4CHU A;  3IAM 2;  2XB5 A;  4JP0 A;  1XMA A;  1IUY A;  3CMY A;  2XAJ A;  4WXC A;  2P4W A;  3GBG A;  2CW0 F;  2L4A A;  3WTZ A;  2ZFU A;  2BV6 A;  4BEH A;  1LE8 A;  3C2H A;  2YX7 A;  2QKL B;  2MSY A;  3G73 A;  2JVH A;  3ZQ7 A;  3ABT A;  4WXH A;  3P9C A;  4GYI A;  4KIF A;  1NK2 P;  3MVP A;  2HOA A;  3MEX A;  2R7X A;  2CW7 A;  4I09 A;  5E18 F;  3GTJ J;  3RQI A;  4DYC A;  2HGC A;  1UJ8 A;  1G59 A;  2PJR A;  2DYS H;  4YFN F;  3IV5 A;  1GVJ A;  4A3I J;  4BKX A;  2BBY A;  3ESW B;  2L9R A;  3FIS A;  5TRD A;  4PZJ A;  2WC2 A;  3D0S A;  2VKH A;  2AXL A;  5DUK A;  1PYV A;  2NS8 A;  1RR8 C;  2X9D A;  3WTW C;  3DXJ F;  3TW7 A;  2CJJ A;  1NG6 A;  5CPR B;  3V4G A;  1D0X A;  1RR7 A;  3G3Z A;  2NVT J;  2QYO A;  3F6O A;  5BPI A;  2LG4 A;  2HNH A;  3PL8 A;  4OMY A;  2HDD A;  5IP7 J;  4LJZ F;  4XRS A;  1IRF A;  5FO5 A;  1SMY F;  1DQU A;  3S2H J;  4EV0 A;  4L5I A;  4RS8 A;  3G2B A;  3FIW A;  3UR3 C;  4HLY A;  1LE8 B;  2IRF G;  1Y0N A;  3DPU A;  3GFI A;  3AG4 H;  4G7O F;  4PUS A;  3ONQ A;  3VOD A;  2ECB A;  2EFQ A;  3BR1 A;  3EUH A;  3HIF A;  3I71 A;  3RKX A;  4A3D J;  2E34 A;  2FRH A;  4XLF A;  4YIR X;  2HOS A;  3WTU C;  2Z2S B;  3I4M J;  2R7Q A;  2OAZ A;  5CVJ A;  5LHI A;  2K9Q A;  2LOO A;  2M0M A;  2E35 A;  4XSX F;  5AIQ A;  4ZYE A;  3IC7 A;  3ZOB A;  1RET A;  3CCL I;  5B1A H;  3HJE A;  3ZMZ A;  5M3M J;  1JI8 A;  3L9F A;  2B7E A;  2PI0 A;  1FWZ A;  1LNW A;  1OIS A;  4CCJ A;  5L3G A;  1E2X A;  1L3L A;  2KPM A;  4OIQ F;  3EUH C;  4I7H A;  4V19 K;  4D7N A;  5ICG A;  3FBN B;  1GLN A;  2EV6 A;  3U1D A;  1EH8 A;  2PMU A;  3V8J A;  1RES A;  1LFP A;  4BXU A;  1D5Y A;  1TWG J;  2MC3 A;  5J1U A;  1I6H J;  4GO1 A;  1BC8 C;  1C0W A;  1TP4 A;  3DLL F;  3MQ0 A;  4C9Y A;  5DEQ A;  3JTG A;  2CMP A;  3LQR A;  2Z9O A;  1MSE C;  3J7A Y;  1R5H A;  3KCC A;  2E2I J;  2DU9 A;  4E7K A;  3LMM A;  3S15 J;  1JKO C;  1Z6R A;  2P8T A;  4AUX A;  1J9I A;  1G3W A;  3ZR8 X;  4E7H A;  3A0B C;  2W7N A;  3WOD F;  2QSH X;  4PSW A;  2DXI A;  2R7D A;  3T8T A;  4NNJ A;  2LK2 A;  2VBZ A;  3BWG A;  1UEL B;  3MKY B;  3CUO A;  2WAQ A;  2DI3 A;  2A05 A;  1YQA A;  2DYR H;  1FTZ A;  3CUQ B;  3LA3 A;  1I1G A;  4B09 A;  2B63 J;  4OOI A;  2MLK A;  3BJ6 A;  3MZY A;  3P5J A;  4HF0 A;  4YIF A;  2FMY A;  1Z9C A;  1U2W A;  2K3F A;  2IJL A;  3E6C C;  2JRT A;  3VSK A;  2DOE A;  2DDA A;  4EJO A;  3U2R A;  2NVX J;  5FKO A;  3G71 I;  1UHS A;  1SFU A;  2DOF A;  2HYF A;  3OIQ A;  2EFW A;  1RI7 A;  2BVL A;  2L7Z A;  3PJR A;  4IQJ A;  4L0Y B;  1YJ9 I;  2KT0 A;  2CW8 A;  1T0F C;  2GIV A;  5J6X A;  1WH5 A;  3PSF A;  4OIR F;  4EQQ A;  4KMF A;  3RYP A;  2X51 A;  1CF7 B;  1FEX A;  3TL4 X;  1BOA A;  3CC2 I;  5FRO A;  3VDX A;  3WHB A;  2R93 J;  3O8G A;  4U0V A;  4B47 A;  1WRJ A;  1K6O A;  2XHK A;  1POG A;  1XG1 A;  1Z21 A;  2MC4 A;  3FDY A;  2DO7 A;  1JT0 A;  1XMX A;  2A6H F;  1VQM I;  3AL0 B;  1TZL A;  1Z77 A;  1AHD P;  2RV8 A;  1ON2 A;  5L3B A;  1JJ6 C;  1MD0 A;  1BI3 A;  1TW2 A;  3J7Z I;  3NWS A;  5DV5 A;  2EV5 A;  4BU2 A;  1Y1W J;  5D6F A;  2NOJ B;  4HAM A;  3CCS I;  3BRO A;  5JI6 A;  5F27 A;  1BL0 A;  1FTT A;  5KVR A;  4X0G A;  2EJR A;  2IVM A;  2KDO A;  2DTZ A;  2BHY A;  3H5R A;  2R7T A;  5HS8 A;  4LLL A;  3SEQ A;  2GWR A;  1I1S A;  3I54 A;  1HW5 A;  1J75 A;  3W2W A;  1MW7 A;  2CS3 A;  1UG2 A;  2VKD A;  2QVO A;  2VQG A;  1BBY A;  3PFI A;  1S5L C;  4EM2 A;  5DDG A;  1WZ2 A;  4HDV A;  3CQZ J;  3ABU A;  4E6K G;  2RQQ A;  4JQF A;  2H6B A;  3I4N J;  2KHM A;  3UNG C;  3I9V 2;  4KNY A;  3N4M A;  3PIP F;  2ELH A;  4A3G J;  4HA8 A;  3N05 A;  5LHG A;  1WSU A;  2RN7 A;  3E6M A;  4UB6 C;  1P2F A;  2R7W A;  1LVA A;  3GTG J;  3RKQ A;  1ENH A;  4HEA 2;  4D5C A;  5E3M A;  1SD7 A;  2HS5 A;  5BPD A;  2WB1 N;  1IAW A;  1APL C;  3HOU J;  4M73 A;  4E7S A;  4LB6 B;  3DKW A;  1OJL A;  1Z05 A;  4HV5 A;  5CQE A;  5DYM A;  2Q8K A;  2X6W A;  4RGX A;  4KN7 X;  3RQ4 A;  3S1Q J;  3ISP A;  1OYW A;  1R4M B;  1W4M A;  1OCO H;  2CQN A;  4MQ9 F;  2IW5 A;  5B1B H;  3QPS A;  3HRT A;  3ZQC A;  3FM3 A;  2K4B A;  5B5E C;  4KIS A;  2DA6 A;  3SXY A;  2VT2 A;  4II2 A;  4P9F A;  4B1R A;  1E3P A;  2M7A A;  3HGY A;  4A3M J;  4AIJ A;  2HDW A;  2M1B A;  1X1A A;  5CQG A;  2JA7 J;  4R1H A;  1A04 A;  4Y17 A;  5GAE J;  1K7A A;  1TWC J;  2HYJ A;  2ID3 A;  2ISY A;  3I0T A;  4ZDP A;  4KUM A;  1E0E A;  3FMR A;  2VT3 A;  1P92 A;  1F5T A;  3QP6 A;  4XRS G;  3BPX A;  2XAG A;  3HKZ A;  2KIS A;  4BAY A;  1P4A A;  1GV2 A;  4HQM A;  3MKZ A;  4AYB N;  2CH0 A;  3GF2 A;  1EF4 A;  1YX3 A;  2VKV A;  4HLX A;  3EYI A;  2JWT A;  3A1Y A;  1S6L A;  3CCJ I;  1B1B A;  1XDU A;  2COB A;  2EB7 A;  3R0J A;  3VPR A;  1WHU A;  5F08 A;  3DFG A;  3G1M A;  3LSR A;  1W0T A;  2DCE A;  3GTL J;  4Y4R A;  4ZYA A;  4L5E A;  2IGN A;  3MMY B;  2FQ3 A;  3LA2 A;  3MKW B;  1YX5 A;  3PO3 J;  5CVU A;  4UUS A;  5FKL A;  1QZE A;  2MD5 A;  3TKY A;  1BW5 A;  2N8G A;  1IXR C;  4MEY F;  5FB2 A;  5IYD J;  2ME6 A;  1XCV A;  4DNC A;  1D1A A;  1TC3 C;  2WY8 Q;  3CLO A;  5JHF A;  3CF2 A;  2EIL H;  5LGT A;  2STW A;  3KLN A;  3CDL A;  1WJ5 A;  4BE0 A;  4PJ0 C;  3PQJ A;  4DW6 A;  3BR6 A;  2F5F A;  2DAO A;  3F8B A;  4M3B A;  3FKI J;  1MBG A;  2LNB A;  2VC1 A;  3A01 B;  3H0G J;  5IYC J;  2OTJ I;  4CYC B;  4GDF A;  4ZZD A;  3HDD A;  2CG4 A;  1ZGJ A;  4IEJ A;  1IDZ A;  3OYC A;  5FRN A;  3PO2 J;  2GA1 A;  5B3S H;  4RAG A;  1MBH A;  1ZG1 A;  5FFZ A;  1ZR4 A;  3H5A A;  3KYL A;  3K4K A;  1ZAO A;  1IJW C;  4LD5 A;  1FPQ A;  3HEF A;  3BR0 A;  2WV0 A;  1ZRF A;  2LY9 A;  3BCB A;  4Y3O A;  1IGN A;  2MH9 A;  1ZLK A;  2RNG A;  2WAE A;  4AWX B;  2KQR A;  2JRM A;  4HNT A;  2EWN A;  1GXQ A;  2XPU A;  1MBE A;  2QBY A;  3AL0 C;  5B66 C;  2DA2 A; 
#chains in the Genus database with same CATH homology
 1T2K A;  2VBX A;  1R22 A;  1R36 A;  3R0A A;  5E1Z B;  1HBX G;  4I0B A;  2L3D A;  2HEO A;  2VN2 A;  4OIN F;  3O2P E;  3RTR A;  2ZJ2 A;  4EJV A;  1FLI A;  2HWV A;  3WU1 B;  3K2Z A;  2EFN A;  2C6Y A;  5ED4 A;  5E17 F;  4A12 A;  4PGH A;  3S2W A;  2VON A;  3M9A A;  2D2W A;  2Q2E A;  3ZN0 A;  4HV6 A;  4IJA A;  3QU6 A;  1QQI A;  2E7X A;  1FBQ A;  2LKP A;  1YTY A;  3OOP A;  3ZN1 A;  6PAX A;  4WXD A;  1J5Y A;  2VOD A;  1XMK A;  4EJW A;  4S05 A;  5J8C A;  2HTS A;  4KN4 X;  1R23 A;  5LLQ A;  4MNU A;  3REO A;  3B02 A;  1GXP A;  1V3F A;  3LQQ A;  4Q47 A;  1LDJ A;  2O61 A;  1F9N A;  2MA3 A;  3QAH A;  2A07 F;  3T8R A;  2XGX A;  1PDN C;  3M1E A;  1ULY A;  4LLG F;  2RVC A;  4LFU A;  2IT0 A;  2XAH A;  1YIO A;  5F6F A;  3SFZ A;  3CDH A;  3HSF A;  4WX9 A;  2RGV A;  2FXA A;  5ILU A;  1B59 A;  4ESF A;  4A6D A;  4L9N A;  2QUF A;  4ENK A;  2NNN A;  3CTA A;  4HBL A;  3KEQ A;  3R6S A;  2V6C A;  3GUD A;  2NNY A;  1HW1 A;  4EMS A;  4M71 A;  5IT3 A;  2ZXJ A;  3C3W A;  2E1C A;  2H94 A;  4Y13 A;  1HKT A;  1I6X A;  2Y48 A;  2QBY B;  1G3Y A;  2BE5 F;  5DCF A;  1FBS A;  4WCG A;  2XAQ A;  1ZRE A;  1OKR A;  1XDS A;  3E3V A;  4HX7 A;  1UHM A;  2ZME B;  4ENM A;  2JT1 A;  4BQA A;  3GFJ A;  1U5T A;  3BPV A;  4BHC A;  1TNS A;  3L00 A;  4G6D A;  4A0X A;  2DFI A;  1S7A A;  1BIB A;  1R00 A;  1B4A A;  4YII A;  3V8K A;  2F2E A;  3ZMS A;  4L5J A;  3FF5 A;  4ZYG A;  1UCR A;  3DPT A;  3HTU A;  4XLN F;  1KU2 A;  1EH7 A;  5FD5 A;  3EET A;  2HYG D;  3HHG A;  3FWE A;  1REP C;  4G7Z F;  1MJB A;  1ZAR A;  1MJ9 A;  1IF1 A;  1STZ A;  1KU3 A;  4LK1 F;  1MKM A;  4BNC A;  2VBY A;  1E17 A;  1WKM A;  4ETS A;  1HQC A;  4R8H A;  2QWW A;  1XB4 A;  1PUE E;  3GEZ A;  2IP2 A;  3I59 A;  3BJA A;  1FSE A;  5KK1 A;  1EH6 A;  1O3S A;  1ZH5 A;  1TQM A;  4CO8 A;  2KRF A;  5EEG A;  1IN7 A;  4CIC A;  3R61 A;  3ML6 A;  1IN6 A;  2VC0 A;  1OYI A;  1KYZ A;  1KGS A;  2CGP A;  3RI4 A;  5JFR A;  5HS9 A;  1D5V A;  1ZHF A;  1W7P B;  3KP2 A;  1W7P A;  3BZ6 A;  2PQ8 A;  4Q48 A;  4PDK A;  1XSX A;  2LF7 A;  5FD6 A;  1BI2 A;  3C1D A;  4O6J A;  1YLF A;  2Y0M A;  3ERE D;  1K79 A;  5CYV A;  3GX4 X;  4RB0 A;  1ZGA A;  2G7U A;  1R5G A;  4G9Y A;  1FYM A;  1KYW A;  1SD4 A;  4CYD A;  5F1R A;  3ZMV A;  4MHG A;  3V8L A;  2JPC A;  3F23 A;  4GXO A;  1TW3 A;  2IA2 A;  5BQT A;  5D5U B;  2ETH A;  1XSD A;  2KJC A;  1JHH A;  2JZY A;  3K1M A;  4KIG A;  4U88 A;  3SZT A;  1BI1 A;  2ZKZ A;  5ICC A;  1Z1D A;  3WTY C;  5EEH A;  2DQR A;  1OYY A;  2H6C A;  4YG2 F;  1D8J A;  2ZBK A;  1D3Y A;  2WWY A;  1HST A;  5ICF A;  4RGS A;  4AIH A;  1B9M A;  1O7L A;  5D5V B;  2FEZ A;  5HOO A;  3HYI A;  1SD5 A;  5E8I A;  3QRF F;  2COM A;  2TDX A;  1UFM A;  3EYY A;  3F8C A;  2P5V A;  5ERI A;  5IT9 K;  3F22 A;  1ZN2 A;  2XV4 S;  4KMU X;  3QU3 A;  2VOP A;  2PLY A;  5F64 A;  3C7J A;  3V7S A;  5LBQ A;  3TOB A;  1TNT A;  1S3J A;  2IA1 A;  1QNT A;  1IW7 F;  3GZ5 A;  2KIM A;  2KJB A;  3ELK A;  5FLX K;  4GGG A;  3TO6 A;  4RAY A;  2KIF A;  1ON1 A;  2PEX A;  2NRA C;  4I98 B;  1YG2 A;  2W25 A;  3RKY A;  1KQ9 A;  3E6D A;  4BHP A;  3J7A O;  2MBF A;  3ZMU A;  2XUB A;  1RNL A;  4I01 A;  2V79 A;  1QGP A;  4O3M A;  3QPT A;  3MWM A;  2FNP A;  3IWZ A;  1XGO A;  4XLP F;  2DQL A;  4RGR A;  4ZYD A;  3H92 A;  3KE2 A;  2VBW A;  1O3R A;  2H27 A;  4CGZ A;  1ODD A;  3KP3 A;  2K27 A;  5CVV A;  5BMZ A;  2DPD A;  1LEB A;  2VE8 A;  4L9V A;  2QEN A;  4EM1 A;  1TQI A;  3LAP A;  2D1V A;  1KU7 A;  1MJA A;  3E5U A;  1YS6 A;  1BIA A;  2ZO4 A;  2A5Y B;  2O8X A;  3LFK A;  4ON0 A;  4UVB A;  1FYK A;  2B0L A;  2L54 A;  4RAZ A;  3WTS C;  5ILV A;  1Z91 A;  3I59 B;  3TO9 A;  3TOA A;  3AAF A;  1TBX A;  1ZRD A;  4HW0 A;  3I53 A;  3SHF A;  1DPR A;  2XRN A;  3F8N A;  3F72 A;  3OV8 A;  2P6T A;  4A0Y A;  2O6G E;  1RUN A;  3N97 A;  1EV7 A;  3KZZ A;  4HX8 A;  1W5T A;  2UWM A;  5L3C A;  5JHU A;  4ESJ A;  3MFK A;  3LWF A;  1IXS B;  4IRG A;  3ECO A;  3ROU A;  1U5T C;  3FHZ A;  2Y75 A;  3K0L A;  1BJA A;  1FYL A;  2MLG A;  2QQ9 A;  5E1X A;  1ZG3 A;  1H9G A;  1UST A;  5FFX A;  3RPU A;  1KA8 A;  4FHT A;  2Q0O A;  2JSC A;  5CVR A;  5TJJ A;  2O0Y A;  5DCM B;  1T39 A;  2RC4 A;  3BP8 A;  1J2X A;  2JPB A;  1O7F A;  1XCB A;  5ILS A;  3Q9V A;  3W6K B;  2DLL A;  4MTD A;  3F21 A;  5L3F A;  1FBU A;  1JGS A;  3QPH A;  4U7B A;  3HRS A;  5HLH A;  2A3S A;  3COA C;  5LEJ A;  1FX7 A;  1YW7 A;  2BYV E;  1LB2 A;  2RKH A;  2K86 A;  3RPQ A;  3TDU C;  5DCM A;  4XRF A;  5A2Q Z;  3WGI A;  4LMY A;  2YPR A;  1SFE A;  4N0B A;  3FMQ A;  1VTN C;  2KKO A;  2Z5U A;  4UV9 A;  1F4K A;  2LSO A;  3MAJ A;  4A5N A;  3E97 A;  5BS6 A;  5FLX Z;  4IVN A;  4HDU A;  4BH9 A;  2NS0 A;  3RIR A;  3SZP A;  2OQR A;  3F8F A;  4EJU A;  4G6Q A;  4EGZ A;  1FP2 A;  1U6G A;  2STT A;  1J59 A;  1Z7U A;  4L9T A;  2HZT A;  3K9T A;  1OR7 A;  3CO7 C;  1RIO H;  5DUI A;  4G7H F;  5H6Q A;  1SFX A;  4M74 A;  2BGC A;  2UZK A;  3J80 K;  5E1W A;  5AON A;  5H6R A;  3CJN A;  4N9H A;  3CO6 C;  1QPM A;  4KFC A;  3V7C A;  2ESN A;  3FMS A;  1BI0 A;  4NHJ A;  4JBA A;  1F1Z A;  5ICE A;  4LG0 B;  2HR3 A;  3IHU A;  1UB9 A;  2DTR A;  1UHW A;  1RZ4 A;  4RGU A;  2XVC A;  4EJT A;  5CVI A;  2P5L C;  4OMZ A;  2DT5 A;  2Z3Y A;  2QM3 A;  2ZFW A;  4WWC A;  4G8X A;  4M9X A;  4N9I A;  3VFZ A;  2H09 A;  2F5C A;  2CFX A;  5D8K B;  3EQL F;  4YFK F;  2FOK A;  2ADU A;  1FC3 A;  1HKQ A;  1R7J A;  4GYG A;  1J7K A;  1W7P D;  3WTX C;  5D4R A;  2LF8 A;  4EVI A;  4A5M A;  3NQO A;  3WE2 A;  3Q5F A;  1OPC A;  2RQP A;  2W57 A;  3TGN A;  3GFL A;  4GCV A;  3QP5 A;  5D5W B;  2V1D A;  3IKT A;  1XGS A;  3F8M A;  3DF8 A;  3P7N A;  1B6A A;  3K1N A;  4P96 A;  1R1T A;  2M87 A;  2FF4 A;  1QO0 D;  1ZYR F;  2K4J A;  3KET A;  3HOT A;  4HQE A;  1KU9 A;  3DPL C;  1R1V A;  5FGM A;  3GVA A;  1DDN A;  4AD9 A;  4NQW A;  4A0Z A;  1FY7 A;  3JSO A;  1TLH B;  3FX3 A;  4HYE A;  2M30 A;  4KIC A;  1RUO A;  4RB3 C;  2V1U A;  3H3U A;  1QZY A;  3K69 A;  1Q1H A;  1MDM B;  2HTJ A;  2K7L A;  4G94 A;  3FXQ A;  1YS7 A;  2W84 A;  5K5Q A;  4UVC A;  4PCQ A;  2OD5 A;  1G3S A;  2O3F A;  3ECH A;  3I5U A;  1X3U A;  3HRM A;  2P7V B;  3O3K A;  5L3E A;  1YYV A;  2XAF A;  5D4S A;  1FOK A;  4L0Z B;  1MZB A;  1J0R A;  2XKP A;  2LDU A;  4KDP A;  1IXC A;  3RYR A;  2EV0 A;  2GA2 A;  2J5P A;  5JR3 A;  3HTS B;  2IPQ X;  1WWX A;  1YW8 A;  2P7C B;  3ZPL A;  3GO5 A;  1XGM A;  1DPU A;  2P6S A;  5K5O A;  4Q4Z F;  2PJP A;  2HDC A;  2IA0 A;  4PGG A;  1K78 A;  1LDD A;  3HRU A;  3ZP5 A;  3JAM K;  4U0W A;  3TQN A;  3VOE A;  2HQN A;  4IPA A;  1U3E M;  5HVQ C;  5K1Y A;  1HKS A;  5D6E A;  1AOY A;  2V9V A;  3WGG A;  3E6B A;  2DK8 A;  1WQ2 A;  5DD8 A;  2FA5 A;  4P5O A;  2L01 A;  3ZMT A;  5LEK A;  3L2C A;  4AIK A;  2CQK A;  2VE9 A;  3KP5 A;  2PG4 A;  2XRO A;  2CSO A;  4K2E A;  4O5V A;  3P9I A;  3B73 A;  3H3Z A;  1ZLJ A;  2HQR A;  4AVP A;  1CF7 A;  3E5Q A;  4XBF A;  3T1B A;  1IN4 A;  2L02 A;  3J81 Z;  1FNN A;  2FBK A;  3P9K A;  5HLG A;  4IF4 A;  2J5O A;  1IN8 A;  2HKO A;  2D45 A;  2FML A;  4F7Z A;  1WI9 A;  5HS7 A;  3JAM Z;  3DEU A;  4QLC U;  2ZME A;  3GWZ A;  1ONV A;  5JVT A;  4A6E A;  3U9G A;  3E5X A;  3C18 A;  5HDG A;  3IL2 A;  3IWF A;  4B8X A;  1V4R A;  1BM9 A;  5A2Q K;  2PMH A;  3GXO A;  3T0Y A;  5CJ9 A;  2JTV A;  3GW2 A;  4LK0 F;  3TDZ C;  1SMT A;  4KT5 C;  4RB2 C;  2W85 A;  3HSE A;  4DQ2 A;  1XN7 A;  4YFX F;  3DQV C;  1PP8 F;  4Q5S F;  3Q9S A;  4M72 A;  2VXZ A;  1JXS A;  3KFW X;  1O57 A;  4TV7 A;  1R58 A;  2UXN A;  1H0M A;  3JTH A;  5LRS A;  5BOX A;  2ZNZ A;  2AS5 F;  3KP6 A;  4L18 B;  2YSR A;  4HOB A;  2RDP A;  1LDK B;  1GHC A;  4KIB A;  1CGP A;  4ENN A;  4M6Y A;  2DPU A;  4R79 A;  2GXB A;  2CYY A;  4FX4 A;  1JHF A;  4IRH A;  5D8L B;  2OQG A;  5HLI A;  4OIO F;  3GFM A;  4KYW A;  3LA7 A;  4QWQ A;  2OU2 A;  3WTV C;  1DUX C;  3VB2 A;  1AWC A;  2A68 F;  3DV8 A;  2UXX A;  4M6X A;  4I2O A;  2GQQ A;  3KP4 A;  1S8N A;  3R60 A;  3R4K A;  2ZCW A;  1YFH A;  3SQN A;  3FXR A;  1XSV A;  1FP1 D;  5HDN A;  5LGU A;  2DBB A;  2W24 A;  1TTY A;  1T38 A;  4LLN A;  3M8E A;  3PQK A;  3WU0 A;  3M7G A;  4NB5 A;  2G7H A;  2XAS A;  1BC7 C;  3BDD A;  2HKX A;  3KP7 A;  4D0P A;  1HSJ A;  2EFP A;  4I02 A;  3NEU A;  4ZZL A;  4U0Y A;  4UV8 A;  4LGW A;  1XD7 A;  4UVA A;  1IN5 A;  4CZZ A;  4JK1 X;  2X0L A;  2NYX A;  4ESB A;  2EA2 A;  3LAJ A;  4UUV A;  3I58 A;  5IT9 Z;  1G4D A;  5L3D A;  1T98 A;  4BYY A;  2DW4 A;  2L4M A;  1USS A;  3FZV A;  1LEA A;  2CO5 A;  4P9U A;  1FZP B;  3BOQ A;  2QQA A;  4HF2 A;  2VOO A;  2YX4 A;  4M9Z A;  2R7F A;  4FT8 A;  5E8G A;  1LJ9 A;  1W5S A;  4HZF A;  1P4X A;  4P55 A;  1JE8 A;  2A61 A;  1QBJ A;  1Y0U A;  5AIP A;  2FBI A;  3MCZ A;  4EGY A;  1T0F A;  1DP7 P;  3KZY A;  4BHB A;  3J81 K;  3F3X A;  2ISZ A;  3IRQ A;  3QOP A;  4LB5 A;  3M8F A;  1QZZ A;  2CWE A;  4OU0 A;  4HF1 A;  1HXD A;  4RB1 A;  4ASN A;  1SAX A;  1KQ0 A;  1PP7 U;  2Z99 A;  4Z2Y A;  2O03 A;  1FSH A;  4MQV A;  2F5E A;  4ENJ A;  3O6B B;  2EFO A;  2YU3 A;  3W6J B;  3WTT C;  3GLX A;  1D8K A;  1TQP A;  2XIG A;  3ULQ B;  2OZ6 A;  2GAU A;  1XGN A;  1BN5 A;  2QZ8 A;  1IRG A;  3MZH A;  3FM5 A;  1IZ1 A;  3IKV A;  4IHT A;  2FBH A;  1ZG5 A;  2V1X A;  5CLS A;  3RKW A;  1S7O A;  3I64 A;  5D5X B;  4WF2 A;  2Z33 A;  3RJP A;  2FSW A;  3F6V A;  2R3S A;  3ZMD A;  2GXG A;  4CXF A;  1U78 A;  5LGN A;  4KA4 A;  2RNJ A;  4HX4 A;  4EM0 B;  2YR2 A;  3NRV A;  4ZH4 F;  3EDP A;  1U5T B;  2BEO A;  5J8F A;  2OZU A;  1U8R A;  2NAZ A;  2M5W A;  4XSZ F;  2P5K A;  5H20 A;  1I27 A;  2OBP A;  1T6S A;  5HDK A;  2DK5 A;  1G6N A;  2X4H A;  3T5X A;  2A6E F;  1SD6 A;  3KLO A;  4I0A A;  3TO7 A;  4UXN A;  2OA4 A;  1O3Q A;  3VEP A;  1OMI A;  3WE3 A;  3L09 A;  5DD4 A;  3I4P A;  2K02 A;  3GZ6 A;  5K5R A;  3JW4 A;  2WTE A;  1L0O C;  4MTE A;  4M9S A;  3D5L A;  3FXU A;  1P6R A;  3BJO A;  1KQ8 A;  1NHA A;  4UHT A;  3HHH A;  4L9J A;  4UNO A;  1YW9 A;  1G3T A;  2XKO A;  3HUG A;  4FX0 A;  2G9W A;  2GZW A;  1HW2 A;  4S04 A;  4ZYH A;  3WGH A;  1P4W A;  1ZRC A;  1LQ1 A;  4Y15 A;  1MGT A;  2ACJ A;  3V7R A;  3K1P A;  3DP7 A;  1K78 B;  2FE3 A;  4A2U A;  4E70 A;  4IHS A;  2KIU A;  2F5D A;  4OIP F;  4MGR A;  2E7W A;  2PN6 A;  3GYH X;  2MH2 A;  2PBI A;  3RDI A;  1FT9 A;  2D1H A;  3L7W A;  1YO5 C;  4IRI A;  2FNA A;  3HOS A;  2QLZ A;  1MDM A;  2EA4 A;  3HSR A;  4CDG A;  2HOE A;  2QQB A;  3KEO A;  1O3T A;  3IRR A;  4MEX F;  1I5Z A;  2M8E A;  4WK8 F;  3CUQ C;  4IXA A;  3BY6 A;  2FU4 A;  1S29 A;  2ZNY A;  3LST A;  1R1U A;  2M45 A;  5LRR A;  3JSP A;  1B9N A;  2ESH A;  3CUQ A;  3WG9 A;  1H9T A;  2PFB A;  5E20 A;  4U7D A;  3J80 Z;  2E1N A;  1Z6T A;  4H0E A;  4LG0 A;  5LHH A;  2A69 F;  2HFH A;  2EK5 A;  4CHU A;  1XMA A;  1IUY A;  2XAJ A;  4WXC A;  2P4W A;  2CW0 F;  2L4A A;  3WTZ A;  2BV6 A;  2YX7 A;  3G73 A;  3ZQ7 A;  3ABT A;  4WXH A;  3P9C A;  4GYI A;  4KIF A;  3MEX A;  4I09 A;  5E18 F;  2HGC A;  4YFN F;  1GVJ A;  2BBY A;  5TRD A;  4PZJ A;  2WC2 A;  3D0S A;  2AXL A;  5DUK A;  3WTW C;  3DXJ F;  3V4G A;  3G3Z A;  2QYO A;  3F6O A;  5BPI A;  4OMY A;  4LJZ F;  1IRF A;  5FO5 A;  1SMY F;  4EV0 A;  4L5I A;  4RS8 A;  4HLY A;  2IRF G;  3GFI A;  4G7O F;  3VOD A;  2EFQ A;  3EUH A;  3HIF A;  3I71 A;  3RKX A;  2FRH A;  3WTU C;  2OAZ A;  5CVJ A;  5LHI A;  4XSX F;  5AIQ A;  4ZYE A;  3IC7 A;  3ZMZ A;  3L9F A;  2PI0 A;  1FWZ A;  1LNW A;  5L3G A;  1E2X A;  1L3L A;  4OIQ F;  4I7H A;  5ICG A;  2EV6 A;  3U1D A;  1EH8 A;  2PMU A;  3V8J A;  4BXU A;  2MC3 A;  4GO1 A;  1BC8 C;  1C0W A;  3MQ0 A;  5DEQ A;  3JTG A;  3LQR A;  2Z9O A;  1R5H A;  3KCC A;  2DU9 A;  1Z6R A;  2P8T A;  1J9I A;  1G3W A;  3WOD F;  2R7D A;  3T8T A;  2VBZ A;  3BWG A;  3CUO A;  2DI3 A;  1YQA A;  3CUQ B;  3LA3 A;  1I1G A;  4B09 A;  4OOI A;  2MLK A;  3BJ6 A;  3MZY A;  4HF0 A;  4YIF A;  2FMY A;  1Z9C A;  1U2W A;  2IJL A;  3E6C C;  2JRT A;  4EJO A;  3U2R A;  1SFU A;  2HYF A;  2EFW A;  1RI7 A;  4L0Y B;  5J6X A;  2GIV A;  4OIR F;  4EQQ A;  4KMF A;  3RYP A;  1CF7 B;  1BOA A;  4U0V A;  1WRJ A;  1K6O A;  2XHK A;  2DO7 A;  2A6H F;  2RV8 A;  1ON2 A;  5L3B A;  1MD0 A;  1BI3 A;  1TW2 A;  5DV5 A;  2EV5 A;  5D6F A;  4HAM A;  3BRO A;  5JI6 A;  5KVR A;  2EJR A;  2IVM A;  5HS8 A;  4LLL A;  2GWR A;  1I1S A;  3I54 A;  1HW5 A;  1J75 A;  2QVO A;  1BBY A;  3PFI A;  4EM2 A;  5DDG A;  4HDV A;  3ABU A;  4JQF A;  2H6B A;  4KNY A;  3N4M A;  2ELH A;  4HA8 A;  5LHG A;  1WSU A;  2RN7 A;  3E6M A;  1P2F A;  1LVA A;  1SD7 A;  1IAW A;  2HS5 A;  5BPD A;  4M73 A;  4LB6 B;  3DKW A;  1Z05 A;  4HV5 A;  5DYM A;  2Q8K A;  4RGX A;  4KN7 X;  3ISP A;  1OYW A;  1W4M A;  4MQ9 F;  2IW5 A;  3HRT A;  3FM3 A;  2K4B A;  3SXY A;  2VT2 A;  4P9F A;  4AIJ A;  2M1B A;  4R1H A;  1A04 A;  4Y17 A;  1K7A A;  3I0T A;  2ISY A;  4KUM A;  3FMR A;  2VT3 A;  1P92 A;  1F5T A;  3QP6 A;  3BPX A;  2XAG A;  4BAY A;  1P4A A;  4HQM A;  3GF2 A;  4HLX A;  3EYI A;  1S6L A;  1B1B A;  1XDU A;  2EB7 A;  3R0J A;  3DFG A;  2FQ3 A;  3LA2 A;  5CVU A;  2MD5 A;  3TKY A;  1IXR C;  4MEY F;  5FB2 A;  1XCV A;  4DNC A;  3CLO A;  5LGT A;  2STW A;  3KLN A;  3PQJ A;  2F5F A;  2DAO A;  3F8B A;  2LNB A;  2VC1 A;  4ZZD A;  2CG4 A;  1ZGJ A;  2GA1 A;  1ZG1 A;  5FFZ A;  1ZAO A;  4LD5 A;  1FPQ A;  2WV0 A;  1ZRF A;  2MH9 A;  1ZLK A;  4AWX B;  2EWN A;  1GXQ A;  2QBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...