3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords PROTEIN FEV
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
1PP7U 1R5GA 3FXRA 4NB5A 4OIPF 4EVIA 1T0FA 2E1CA 3HRSA 2PN6A 2A3SA 1BC8C 1YW8A 5ERIA 1K79A 1G4DA 2RVCA 3FHZA 5K5RA 2A6EF 2WV0A 5CLSA 4G94A 4KIBA 4YIFA 4HX4A 2HYFA 3RI4A 1KYWA 3TOAA 1XDUA 3MCZA 4KN7X 4A0ZA 3KP3A 2WC2A 3EDPA 4ZYEA 5AONA 3KLNA 4MNUA 3KP7A 3M7GA 3BPVA 4O3MA 2ZJ2A 3F8FA 3HHHA 3V7RA 3QU6A 2O61A 3I53A 2PG4A 3K0LA 1O3TA 2H09A 1T2KA 1DUXC 2TDXA 4RGUA 2PEXA 1VTNC 5FLXK 4XLNF 2YX4A 4M9XA 1JHFA 4M74A 3WTUC 4HW0A 3WGIA 5J8FA 2GXBA 1Z6RA 1ZH5A 1XMKA 4M72A 1DPRA 1ZG1A 1J0RA 2OA4A 5FFZA 2QBYA 2GWRA 4CDGA 3FZVA 4JBAA 1XGSA 4WXDA 5D6FA 5E1ZB 3ZMDA 2Z33A 5D5VB 1KU9A 4Q4ZF 2ZXJA 1YQAA 5DCFA 2VBWA 1TQPA 1O3SA 3Q5FA 2ZFWA 3Q9SA 1O57A 4GYIA 3C7JA 5HS8A 2OAZA 4HDUA 5CVJA 1R1UA 2NS0A 2EA4A 2JT1A 3ZMSA 5HS9A 1ZG3A 1LDDA 3GX4X 4MEXF 2FMYA 4EJOA 4ZZDA 4Z2YA 3FWEA 1H9GA 1RZ4A 2FBKA 3BJOA 1HKSA 1KGSA 1TW2A 4NHJA 3ISPA 1OYWA 3E6MA 3WTWC 4M9SA 2BEOA 3I71A 4N9IA 2COMA 4YFKF 2Q8KA 3MAJA 5DV5A 2CQKA 1I1SA 2MA3A 2L54A 5TRDA 4P9UA 3LA7A 2K86A 2HZTA 5CVUA 5BMZA 4EMSA 3TGNA 2AXLA 1B9NA 3QU3A 5BPIA 2OZUA 2X4HA 1TBXA 4Y13A 1FBUA 4BNCA 2Z99A 3WTVC 5JHUA 4EJWA 1AOYA 1ZN2A 1WRJA 4HF0A 5FB2A 2F5EA 3IRQA 4GCVA 1Z91A 4CHUA 2KIFA 1FYMA 3GEZA 2ZBKA 1P4WA 4YG2F 3F23A 2QWWA 4UHTA 5FFXA 2HKOA 1LJ9A 4H0EA 3HRTA 4ZYGA 2A69F 2LKPA 3P9IA 1I5ZA 3R4KA 2G7HA 3KEQA 4LJZF 5HDNA 4RB1A 3VB2A 2DK5A 3LWFA 3F8BA 2VE8A 1FWZA 5DCMB 1DDNA 3KCCA 2Z9OA 2JPBA 4UNOA 5DEQA 2K27A 4XRFA 4P5OA 1RNLA 5BS6A 2VOPA 3N97A 5KK1A 2LF8A 1G3TA 2Q0OA 4G7OF 1TLHB 5D5UB 3S2WA 3HTSB 1XB4A 2B0LA 2RNJA 1S3JA 2VODA 3L09A 1I27A 1V4RA 2IA1A 1XCVA 3IKVA 4LLNA 2ZMEA 5E17F 1YTYA 2JRTA 2ZNYA 2BYVE 1EH6A 2YU3A 5LHHA 3KP6A 5DDGA 1FP2A 1AWCA 4U0YA 1Z6TA 2NAZA 5LRRA 1QPMA 3LA2A 1ZHFA 3HOTA 2DQLA 4CICA 3BPXA 3SZPA 3V4GA 4AIJA 4P55A 1U5TC 3E5UA 1B6AA 2VN2A 5E20A 1USSA 3M1EA 2OQRA 2XAHA 4A2UA 3CJNA 2M5WA 1IN8A 2XAJA 1QBJA 2FMLA 2L4MA 4U7BA 5A2QK 4LLGF 2GA1A 2W84A 3HIFA 2DBBA 2VT2A 4WXHA 4R79A 4RB2C 2H6BA 5EEHA 3MZHA 2V9VA 3T5XA 2IW5A 2HFHA 2R7FA 3I5UA 1SFUA 1E17A 4FX0A 1XSDA 5D6EA 4L9JA 4CYDA 1W5SA 1U5TB 4TV7A 2UXNA 5E8GA 3CTAA 3J81Z 3RKXA 5D5WB 2O03A 1FP1D 4HX7A 1BI2A 1XCBA 4IRGA 3TDZC 1CGPA 1EH8A 4KDPA 2FOKA 4FT8A 4Q47A 5HDGA 1WQ2A 2FQ3A 2FXAA 3W6JB 2EWNA 2EV5A 2X0LA 3GO5A 1MKMA 4KICA 5D5XB 2C6YA 4MQVA 4LFUA 3L7WA 1U78A 3T8RA 4HX8A 4XLPF 1HBXG 1MD0A 2P7VB 4PDKA 5L3GA 4OIOF 1OMIA 3O3KA 2BE5F 2HKXA 1F4KA 5LGUA 1YYVA 2K4BA 4A0XA 4LD5A 3K1PA 1YLFA 2A68F 5LBQA 3GXOA 1CF7B 2QUFA 1JXSA 1PUEE 2UZKA 4L9VA 2K02A 1RIOH 4I02A 5BPDA 2JZYA 3JW4A 1IXCA 1ZRDA 1T98A 2Y0MA 4OIRF 3WTSC 1KYZA 4KUMA 2H6CA 3CUQA 4OU0A 2FU4A 3IWFA 4LG0B 3HSFA 3E3VA 2XROA 2P6SA 3HTUA 4I98B 3CLOA 3I58A 4I0AA 2W85A 2M1BA 3PQKA 4I09A 1ULYA 2XRNA 1YW9A 2HOEA 4G7HF 4RGSA 3TQNA 1S29A 1IRFA 4K2EA 1D8JA 3LAJA 2RN7A 1J2XA 1I1GA 3IC7A 3JAMK 1TNTA 4L18B 3HSRA 4FX4A 1LVAA 2RDPA 4L5IA 3QOPA 2ZCWA 4Q5SF 3IKTA 2E7WA 1BI1A 3BJ6A 4HA8A 2PMHA 1G3YA 3Q9VA 4B09A 5KVRA 1XSVA 3WTYC 2NNNA 1ZRFA 3LQQA 3WTXC 4LK1F 5HS7A 4LB5A 5L3FA 3T0YA 2FA5A 3ZQ7A 4KT5C 1B4AA 3ZMUA 2PMUA 2PFBA 3HRMA 4LGWA 3VFZA 5JFRA 4S04A 1D5VA 4M6YA 2MH2A 3O6BB 1W7PB 1IN7A 4ESJA 3KZZA 1W5TA 2GZWA 2VBYA 3FM5A 3R6SA 3WU1B 5L3EA 5CVIA 3FXUA 2G7UA 2MLGA 3DPLC 4P9FA 3T8TA 2STTA 2DO7A 1WKMA 4RAYA 5HDKA 5ILUA 2LSOA 3SXYA 4B8XA 3L2CA 1GVJA 2ADUA 4OMZA 3MZYA 4BYYA 1L3LA 2HYGD 3ABUA 1K6OA 4BH9A 3D5LA 2O8XA 2Z5UA 1G3SA 1IAWA 3MEXA 3QRFF 2KRFA 2V79A 2M45A 5J6XA 2GXGA 1L0OC 2IT0A 2ISYA 2XAGA 3GZ5A 1I6XA 1FT9A 3QPTA 1QNTA 2IA0A 3R0AA 2HTSA 5D4SA 2HEOA 2UWMA 4U0WA 4MHGA 1MJBA 4ON0A 3FX3A 2D45A 2O6GE 4A5NA 1YIOA 1SMTA 1HKTA 1QZYA 1BJAA 3L9FA 4CZZA 1JE8A 2JPCA 1CF7A 4ETSA 4KA4A 2EB7A 1JGSA 4M73A 1F9NA 4EJTA 3MWMA 2GQQA 3KP5A 5D4RA 3ROUA 4MGRA 4KNYA 1EV7A 4ENNA 3RPQA 3B02A 4KN4X 4R1HA 4ZYHA 2DAOA 3CUQC 1FLIA 3EETA 1HW2A 3DF8A 2IP2A 5TJJA 2QENA 2AS5F 3EYIA 2QLZA 2OZ6A 5LGTA 1UHMA 4HV5A 4S05A 3H3ZA 5HOOA 3COAC 3P7NA 4UUVA 2JSCA 2O3FA 1R1TA 3LSTA 1IN6A 4LB6B 4UVAA 1H9TA 5LHGA 4ASNA 2GA2A 1IUYA 4MTDA 1U2WA 3DQVC 1XGOA 4GYGA 4UVBA 1Z9CA 1IZ1A 3TDUC 1WI9A 3KETA 2G9WA 2P6TA 1FOKA 1ZRCA 2W57A 4A12A 1HW5A 2A6HF 3E6CC 4UV9A 1FBQA 2GIVA 3ZMVA 2ETHA 3EUHA 3JTHA 5CYVA 3TKYA 1R5HA 3L00A 4HF2A 2ESHA 1ZLJA 1LDJA 1ZARA 1P4AA 1TQMA 5CVVA 4UXNA 3FM3A 4WCGA 1P4XA 1YFHA 1FPQA 4O6JA 1KU3A 2VE9A 3JSPA 3HRUA 3RTRA 1IXSB 2XHKA 3WGGA 3QP5A 3J81K 1XMAA 4KIFA 5LRSA 1BBYA 2XKOA 5D8KB 1R7JA 4U0VA 3D0SA 1YO5C 2DK8A 3LAPA 3IL2A 3ZMZA 3ZMTA 4KFCA 3E6DA 4ZH4F 4HOBA 1E2XA 2HQNA 1MDMA 1TNSA 1G3WA 1Z1DA 4BHBA 3M8FA 3FF5A 4HLXA 3BZ6A 3N4MA 1FNNA 3JAMZ 2OQGA 3HSEA 1O3RA 2QQBA 3GWZA 4G9YA 5FD6A 1ZGJA 2NYXA 1LDKB 2DFIA 3GFLA 1MZBA 2HDCA 5EEGA 3IWZA 3ERED 3WU0A 1WSUA 4QLCU 2WWYA 3BOQA 3RPUA 1ZLKA 1BN5A 5FLXZ 3P9KA 1W4MA 3WODF 5A2QZ 2DI3A 2CSOA 2QZ8A 2W24A 3DPTA 4ZYDA 1BC7C 1C0WA 2K4JA 2XUBA 1XSXA 2UXXA 3F72A 5K5QA 3CO7C 4AIKA 4IPAA 4PGHA 5JVTA 3GF2A 1KA8A 4HAMA 4ENJA 2D1VA 2XIGA 1LEAA 1TTYA 4PCQA 1O7FA 5FD5A 2VBXA 2CG4A 5HVQC 1BI0A 3DKWA 3V7CA 4RGXA 1SD5A 3FMRA 3NEUA 5E1WA 3TOBA 3EYYA 3BROA 5LGNA 2JTVA 4L9TA 3I59A 3GFMA 1ZREA 2BGCA 3GW2A 3SZTA 1Z7UA 2PI0A 1J5YA 2EV0A 2FE3A 2ELHA 4EGZA 2ISZA 1QO0D 5LEJA 4HQMA 2V1UA 3PQJA 1G6NA 3NRVA 3G3ZA 4PZJA 2KKOA 1OKRA 2XV4S 1RUOA 4D0PA 5ICFA 2P8TA 3K9TA 2MD5A 1KQ0A 2CO5A 1P92A 3GLXA 2RC4A 3NQOA 5FO5A 1R58A 3SFZA 3GZ6A 1K78A 3I0TA 1QQIA 3HHGA 2A61A 5JI6A 3W6KB 1Y0UA 4PGGA 1QGPA 1KU2A 4IXAA 4KMUX 2E7XA 5H20A 3DV8A 1HSTA 1P6RA 2FEZA 1OR7A 1FYLA 2P5KA 3P9CA 2QVOA 2QYOA 1HSJA 4UVCA 4GXOA 1H0MA 1S7OA 5CVRA 3WTTC 5IT9Z 4L0YB 1O3QA 2MH9A 4AD9A 5HLHA 2DW4A 1LQ1A 2HGCA 3ZN1A 2IJLA 4MEYF 4RB0A 3U9GA 2V1DA 4AVPA 5LHIA 4GGGA 5CJ9A 1ONVA 5F6FA 3WE3A 1ODDA 1IRGA 3ECOA 3WGHA 1MGTA 2P5LC 1XD7A 3I59B 1UB9A 1LEBA 1IXRC 2FNPA 3LQRA 1SFEA 4LMYA 4F7ZA 3R61A 1EH7A 1MDMB 2FRHA 4ESFA 1S7AA 1B59A 3U2RA 4I01A 3BDDA 3LFKA 4Y17A 3WTZA 3FMQA 4MTEA 4WXCA 2EFNA 3RKYA 2P7CB 2D1HA 4I0BA 5ICGA 3QAHA 2F5CA 2QBYB 2Y48A 3C3WA 1ZG5A 2XGXA 5E18F 2FSWA 2IPQX 5AIQA 2VC1A 5L3DA 1STZA 5LEKA 4EQQA 3F6VA 3V8KA 1YG2A 4NQWA 3GFIA 2DTRA 5IT3A 4WK8F 2CW0F 2R3SA 3C18A 4YIIA 4P96A 2DT5A 2OD5A 4CO8A 4ZZLA 1XDSA 2MC3A 1O7LA 3G73A 2HTJA 4EM2A 3ZPLA 1J59A 2P5VA 4G6DA 4G7ZF 3C1DA 3CO6C 5HLGA 4Q48A 1F1ZA 3OOPA 2H94A 5ICCA 4IRIA 1J9IA 4CXFA 1FBSA 2J5OA 1SAXA 5D8LB 3JSOA 1FX7A 2V1XA 3ZP5A 2KIUA 3WG9A 4N9HA 1FZPB 5AIPA 2IA2A 2V6CA 3F6OA 1HQCA 3QP6A 2VXZA 2EK5A 2CFXA 3I4PA 4E70A 2HR3A 1IN4A 4HQEA 5LLQA 1REPC 4KYWA 3E97A 1J75A 1TQIA 5H6RA 1T6SA 2K7LA 3M8EA 5L3BA 5IT9K 1Z05A 3IRRA 3U1DA 1RUNA 2EFQA 2BV6A 1USTA 1MJAA 2CYYA 2MLKA 2DU9A 4QWQA 1P2FA 4O5VA 2EFWA 3KLOA 1ZYRF 4I2OA 5J8CA 2IRFG 2KJCA 3R0JA 1PP8F 4M6XA 5DD4A 1D3YA 2J5PA 2A07F 3E6BA 1Q1HA 2VC0A 3HUGA 5DYMA 4XBFA 1RI7A 2ESNA 4LG0A 3K1NA 3MFKA 3EQLF 3V8LA 2XVCA 3GYHX 1X3UA 2FF4A 2XKPA 1B9MA 2RGVA 3RYPA 3KP4A 3M9AA 1SD7A 2VT3A 1MJ9A 4M71A 2PBIA 5FGMA 4BQAA 2ZMEB 2CGPA 2H27A 3GVAA 2R7DA 3BY6A 4OOIA 4CGZA 3F8MA 1ZAOA 2F2EA 3J7AO 2W25A 3ELKA 4ENMA 3F8CA 2L02A 2NNYA 2L3DA 2ZKZA 5L3CA 2EFOA 3I54A 2FNAA 4I7HA 2KJBA 1OYIA 4YFXF 1QZZA 3V7SA 3SHFA 1K7AA 2RQPA 4XSXF 4RS8A 1SD6A 1A04A 3TO6A 3CUOA 1FC3A 5H6QA 2GAUA 2HQRA 3K1MA 3RKWA 4RAZA 3RDIA 4WF2A 2XAFA 3LA3A 4KIGA 3J80K 2L4AA 1ZGAA 1OYYA 3IHUA 3KP2A 5ED4A 4WWCA 1HW1A 1FSEA 3BP8A 4YFNF 2EA2A 2ACJA 1K78B 4IVNA 1W7PD 4OMYA 1KQ8A 3H3UA 2MBFA 4AWXB 2L01A 5DCMA 4HYEA 4HZFA 1U8RA 2P4WA 4EJVA 2DQRA 3ML6A 2NRAC 4BXUA 3F3XA 4L5JA 2F5FA 5E8IA 3GUDA 1XN7A 2LDUA 4HF1A 3H92A 3TO9A 1R00A 1NHAA 1B1BA 4BHPA 3QPHA 4L0ZB 2FBIA 5DUKA 3O2PE 2RKHA 1UFMA 2A5YB 3REOA 2DPDA 1BOAA 1GXQA 4LLLA 4A0YA 4A6DA 2XAQA 5F1RA 1UCRA 3V8JA 2QQ9A 4U88A 1UHWA 2LNBA 2HS5A 1YS6A 2YPRA 4XSZF 1GHCA 4U7DA 4IF4A 5BQTA 2IVMA 4DQ2A 1OPCA 3VODA 1R22A 4IRHA 3K2ZA 1BIBA 3RYRA 3AAFA 2XASA 2DLLA 3F21A 2QM3A 3FXQA 2LF7A 5K1YA 3VOEA 3BWGA 4Y15A 1BI3A 2E1NA 4BAYA 2FBHA 1YW7A 4R8HA 1IN5A 2KIMA 2HWVA 4HBLA 2OBPA 1PDNC 4UV8A 1YS7A 1LB2A 2YX7A 3OV8A 6PAXA 1HKQA 3E5XA 3PFIA 1ON2A 3DP7A 2WTEA 4MQ9F 2F5DA 5E1XA 4EM0B 2BBYA 1JHHA 5F64A 3VEPA 4EV0A 4HDVA 2ZNZA 2O0YA 3F22A 1SMYF 3TO7A 2QQAA 1WWXA 1IW7F 1DPUA 4IJAA 2RV8A 1D8KA 4WX9A 1TW3A 3KEOA 3ULQB 4ESBA 3KE2A 1FSHA 3SQNA 3J80Z 4BHCA 1J7KA 5JR3A 1KU7A 4IHSA 2M8EA 3RJPA 3RIRA 2M87A 3DEUA 3GFJA 4JK1X 4HLYA 1LNWA 3HYIA 3DFGA 4A5MA 1U6GA 3MQ0A 5ICEA 4A6EA 1DP7P 5ILSA 3HOSA 3ABTA 3ECHA 4L9NA 1SFXA 3F8NA 4M9ZA 2STWA 2M30A 3DXJF 1GXPA 3BJAA 1R23A 4OINF 5BOXA 4DNCA 1U5TA 2EFPA 1HXDA 3FMSA 3CDHA 2PLYA 4JQFA 1U3EM 1FY7A 5HLIA 1V3FA 5DD8A 4RB3C 2DPUA 4HV6A 4GO1A 1BIAA 5K5OA 4EGYA 1R1VA 1KQ9A 1SD4A 2Z3YA 1S8NA 2OU2A 3ZN0A 2PQ8A 1ON1A 5ILVA 4KMFA 1W7PA 1T38A 4FHTA 1S6LA 2Q2EA 4EJUA 2VBZA 2VONA 2PJPA 4N0BA 3E5QA 1T39A 1XGNA 1BM9A 2D2WA 4G6QA 3WE2A 4RGRA 1XGMA 3JTGA 2VOOA 3R60A 2YSRA 4G8XA 4EM1A 4ENKA 2Y75A 2EJRA 1F5TA 3K69A 3T1BA 4LK0F 2CWEA 2YR2A 5DUIA 3KZYA 4OIQF 2ZO4A 3B73A 4IHTA 1R36A 3CUQB 2EV6A 3I64A 1FYKA 4AIHA 1IF1A 3KFWX
chains in the Genus database with same CATH superfamily
4NNJA 1PP7U 1R5GA 3ABLH 3FXRA 3HB9A 4NB5A 4OIPF 2VUMJ 3K4BA 3A01A 4EVIA 3Q0WA 2WADA 1T0FA 2E1CA 3HRSA 2PN6A 2A3SA 1BC8C 1YW8A 5ERIA 1K79A 1G4DA 2R7SA 2RVCA 4F91B 4D9JA 3FHZA 5K5RA 5M5YJ 2VJIA 2PMZA 4J19A 4IHXA 3BTLA 2KLOA 2A6EF 2WV0A 3LSKA 5CLSA 3HPGA 4G94A 4KIBA 4YIFA 3LSIA 3CCLI 2CQNA 4HX4A 5F0CA 4EEFG 3VYUB 2HYFA 1D5YA 3RI4A 4A3JJ 5GTIC 1VQMI 1KYWA 2DOEA 3TOAA 1XDUA 3MCZA 4KN7X 4A0ZA 4D5CA 4D7NA 3CP8A 3KP3A 2E34A 2WC2A 1F43A 2BHZA 3EDPA 3RCOA 3HM5A 4ZYEA 2RNGA 3DBHB 3LSHA 2X1DA 2MC4A 5AONA 4C3IJ 2R0QC 3KLNA 1TT0A 2IS4A 2IGOA 1WPKA 4MNUA 3KP7A 3M7GA 3ZGKA 3BPVA 4BUPA 1OR7C 3HOYJ 4O3MA 2ZJ2A 2Z16A 3F8FA 4ITVA 3K6GA 3HHHA 3V7RA 3H5NA 1RKWA 3RKQA 2Z1DA 3QU6A 2O61A 3I53A 2PG4A 2ZXWH 4HG2A 1MMGA 2W48A 3K0LA 3K4CA 1O3TA 2H09A 1WZ2A 3BG6A 3GTLJ 1T2KA 1OCZH 1DUXC 2TDXA 4RGUA 2GOXB 2DFFA 2PEXA 5C44J 1VTNC 1Y8QB 1ZQ3P 2VPLA 5FLXK 4XLNF 2YX4A 3CCSI 4M9XA 1JHFA 3KX2A 2RREA 2X51A 4M74A 4F3QA 4PFPA 3QYFA 3HKZA 3JRAA 3WTUC 4HW0A 4BE1A 2NVTJ 3WGIA 2IS1A 5GADJ 2HZDA 2GXAA 5J8FA 2JA5J 2GXBA 1BR4A 1Z6RA 1JUPA 1X4OA 4CCNA 1ZH5A 1XMKA 2ZFUA 4E7SA 3QOEA 4M72A 4IQJA 4E7ZA 5C4JJ 1IV6A 1DPRA 1ZG1A 1J0RA 2OA4A 5FFZA 2QBYA 3HBLA 2GWRA 2L7ZA 2E2JJ 4XKWA 4CDGA 3FZVA 4JBAA 1XGSA 4WXDA 5D6FA 2E19A 1HF0A 3HGYA 5E1ZB 4M3FA 3ZMDA 4DGWB 2Z33A 1YITI 3QPSA 5D5VB 3HL2A 1KU9A 4JOMA 4Q4ZF 2ZXJA 1YQAA 1X2NA 4NBQA 2WV1A 2NVYJ 5DCFA 3TP0A 5K7ZA 3HC7A 4YIRX 3IV5A 4XK4A 2QA4I 5CQEA 3DBLB 1QHGA 5FKNA 3H1CA 2VBWA 1IC8A 1TQPA 1ENHA 2KPMA 1O3SA 3Q5FA 4HSRA 2ZFWA 3Q9SA 3CCMI 4IHYA 2NXNB 1O57A 4JYKA 4GYIA 2E36A 1Q1VA 3C7JA 5HS8A 4BJTA 2OAZA 2BOLA 2W00A 3DLAA 1JTXA 5B1BH 4HDUA 5CVJA 4PJNA 1R1UA 2NS0A 2F48A 2EA4A 2JT1A 3ZMSA 5HS9A 1ZG3A 1LDDA 4AM3A 3GX4X 4MEXF 3ZR8X 2FMYA 3W3CA 4EJOA 2H8RA 2L9RA 3WU2C 1BOBA 4ZZDA 4CSWA 2HXIA 2EQRA 4Z2YA 2LBFA 2VB6A 3FWEA 1VQLI 4IZZA 1H9GA 1RZ4A 1IRXA 2OPTA 2FBKA 3OSFA 1IDYA 4XOTA 2B63J 3BJOA 3S32A 1HKSA 1WGXA 2HOAA 1KGSA 4I76A 3G4SI 1TW2A 4NHJA 3ISPA 2WB1A 3EUHC 5HODA 2HQ5A 2IS6A 4IOCF 3OYNA 1OYWA 5M5WJ 3E6MA 5FKKA 3WTWC 4FETA 2RAEA 2DFHA 3MVPA 4M9SA 3A1YA 2BEOA 3I71A 4N9IA 2COMA 4A3KJ 4YFKF 2Q8KA 3OS2A 2XB0X 3FXOA 3BR3A 3MAJA 2M9HA 5DV5A 2CQKA 1I1SA 2MA3A 3ZQGA 2L54A 5TRDA 4P9UA 4V2GA 3LA7A 4KISA 2K86A 2WAQN 2HZTA 4XIDA 5CVUA 3A0HC 4EMSA 3TGNA 5BMZA 1UZCA 2LR8A 1U8BA 1MBKA 2LH9A 4C3HJ 1UG0A 1B9NA 2AXLA 3QU3A 4UY8I 5BPIA 2OZUA 2X4HA 1TBXA 4Y13A 1OCTC 3JRBA 1FBUA 4BNCA 1OCPA 4GDFA 2Z99A 2Q1ZB 3WTVC 5JHUA 2V7FA 4EJWA 2LREA 1AOYA 2GM4A 2KP6A 5E3OA 1ZN2A 2LK2A 3H35A 1WRJA 4HF0A 5FB2A 3GCMA 2F5EA 3IRQA 2AO9A 4GCVA 4XR6A 4BJ6C 1Z91A 4RAGA 1WVRA 4PFOA 4CHUA 1Z67A 2KIFA 1FYMA 4CCLA 2DTZA 3GEZA 2ZBKA 1QU3A 1GVDA 4OAZA 1P4WA 1K6YA 2DMTA 4YG2F 3F23A 1D0XA 2L7MP 2R7QA 3L2QA 2HXOA 3S1QJ 4D5FA 1G2HA 2QWWA 4UHTA 5FFXA 2HKOA 1AKHA 1LJ9A 4H0EA 3JREA 3HRTA 2HVQA 2R7RA 1ZELA 3HEFA 3KZIC 4ZYGA 2BY0A 1MSEC 2A69F 2LKPA 3S3MA 3P9IA 1I5ZA 2DYRH 3RPUD 1T0FC 3R4KA 2G7HA 4IX7A 3KEQA 3D5RC 4LJZF 4HRIA 5HDNA 1I3AA 3CDIA 1SEUA 4RB1A 3VB2A 1UELB 1N75A 2QSFX 2DK5A 3LWFA 1MH4A 4PJLA 5EJCA 3F8BA 3K10A 2VE8A 1FWZA 4BDYA 2DDBA 4C9YA 5DCMB 3VWBA 4YELA 1DDNA 3KCCA 3E7LA 2Z9OA 1BL0A 2JPBA 5DEQA 2K27A 4XRFA 3DEEA 2NVXJ 4UNOA 2V6EA 1Z3YA 4P5OA 3OY9A 2M4GA 1RNLA 2I5UA 5BS6A 2VOPA 2LKSA 3N97A 5KK1A 2LF8A 3KYLA 4L5EA 2MSYA 5TISC 1ZGWA 2X9DA 2CV1A 1BW6A 1G3TA 2Q0OA 2WY7Q 4A3BJ 3GTMJ 4G7OF 1TLHB 4JX6A 5D5UB 4CH7A 4BY1J 3S2WA 3HTSB 1XB4A 2F4IA 2KFDA 2B0LA 2RNJA 1S3JA 2BW3B 3UKGA 1YRNB 2VODA 3L09A 1NG6A 1I27A 4C3JJ 1V4RA 1BW5A 2IA1A 1XCVA 3ZQCA 3DTIA 3IKVA 4LLNA 2ZMEA 5E17F 1YTYA 2JRTA 2ZNYA 3OYDA 2BYVE 1EH6A 4IHWA 2ME6A 2DT6A 2YU3A 5LHHA 3KP6A 3OR2C 5DDGA 1FP2A 3AG2H 2R7OA 2HNHA 1AWCA 4U0YA 1Z6TA 2VL8A 5EGOA 2NAZA 1Y1WJ 5LRRA 3K4JA 1QPMA 3LA2A 1ZHFA 3HOTA 2DQLA 3J7AY 4CICA 2NVUB 1JT0A 2EZIA 3ZQHA 1Z7LA 1ETQA 4IKFA 2CMPA 3BPXA 3SZPA 2GBYA 3V4GA 4P55A 4AIJA 4QTRA 1U5TC 2M7BA 3KYCB 4F92B 3E5UA 1MBHA 1B6AA 2VN2A 1LFUP 5E20A 1USSA 3H5RA 3M1EA 2R92J 2OQRA 3K4LA 3GTJJ 2XAHA 4G12A 4RMNA 4XLFA 4A2UA 3CJNA 2KZGA 3CP2A 2M5WA 2R5ZA 1YI2I 1NK3P 1IN8A 4B3XA 2XAJA 1QBJA 5J40A 2FMLA 2L4MA 4U7BA 2DT7B 2FOWA 4XM3A 5A2QK 4LLGF 2GA1A 1SC7A 2W84A 3HIFA 1XTAA 2DBBA 2R5YA 2VT2A 4WXHA 4R79A 4RB2C 3K2AA 2H6BA 5EEHA 3FDYA 2Y2ZA 2V9VA 3MZHA 1R9TJ 2CUZA 3S17J 1HC8A 3G71I 1W1WE 3T5XA 2IW5A 2HFHA 1CQTA 2R7FA 3EUKL 3I5UA 3BG5A 1B72B 2VPRA 1SFUA 1E17A 1VQKI 4FX0A 1XSDA 2DOFA 2IEKA 2MABA 5D6EA 4L9JA 4CYDA 1W5SA 3PSIA 1U5TB 2EH3A 4TV7A 2UXNA 4BQOA 5E8GA 3CTAA 5JLXA 3J81Z 3RKXA 5D5WB 2O03A 4XKVA 3S3OA 1FP1D 3CD6I 1OJLA 3OIOA 3E1SA 3OL3A 3S16J 4HX7A 1BI2A 1XCBA 4LOCA 4C2UA 4IRGA 3TDZC 2JA8J 1OISA 1CGPA 1EH8A 1I50J 4KDPA 2FOKA 4FT8A 2MW8A 3CC7I 1X1DA 4Q47A 5HDGA 1WQ2A 2FQ3A 1LE8B 2FXAA 3W6JB 4A3GJ 1GV5A 5JHFA 2EWNA 4KJZA 2A05A 2EV5A 2OJED 2VKDA 2IGKA 2X0LA 3GO5A 1MKMA 3I3LA 4KICA 2YU9J 3HOZJ 3MZ8A 4C2MJ 5D5XB 2C6YA 4MQVA 1UMQA 3KPHA 4LFUA 3L7WA 1W0UA 1U78A 3T8RA 4I6ZA 2ME0A 4HX8A 4M6VA 3G1LA 4XLPF 1HBXG 1MD0A 2IGMA 2P7VB 4PDKA 5L3GA 4XLEA 4XQFA 5EEAA 3HGGA 4OIOF 1OMIA 3O3KA 3VSLA 2XGCA 3H5AA 2BE5F 1RR7A 2O7OA 2HKXA 2PJRA 2HOSA 1F4KA 5LGUA 1UAAA 3H9JA 3GTQJ 1YYVA 2K4BA 4A0XA 1W36C 2M8GX 4LD5A 3K1PA 4FCYA 1YLFA 2A68F 2DYSH 5LBQA 3BTIA 3GXOA 1X58A 4LIVA 1CF7B 3VDXA 2HDDA 2QUFA 2DA4A 2DMNA 2WY8Q 1JXSA 2E1MB 1PUEE 4U87A 2UZKA 4L9VA 2K02A 1B8IA 1RIOH 4I02A 5BPDA 2JZYA 3JW4A 1IXCA 3OYBA 1ZRDA 1T98A 3PIOF 3J7ZI 2Y0MA 1U9OA 4OIRF 1PJRA 1VF9A 3NWSA 3WTSC 4JX4A 3D5SC 1R71A 1LKXA 1KYZA 2PMZN 4KUMA 3BCAA 2H6CA 4BEHB 5KNLA 3CUQA 1TWHJ 5KAIC 3NWTA 5DM6F 4OU0A 3OYKA 1WH7A 2FU4A 4ANJA 3IWFA 2MFZA 4LG0B 3HSFA 4LITA 4M3EA 4XNFA 1IF1A 2LY1A 5F04A 1IG7A 3E3VA 2XROA 2X6OA 5KAFC 3CDLA 1Z21A 2W4SA 3LSMA 3SDGA 2P6SA 3HTUA 2F5VA 1ORKA 1UHSA 4I98B 3CLOA 5E3LA 2IBDA 3I58A 4F55A 4I0AA 2W85A 2M1BA 3PQKA 2JWTA 3MKWB 4I09A 1ULYA 3B6AA 2CH0A 1VQOI 5DTDA 3G6EI 3N05A 2XF6A 1JKQC 2XRNA 1YW9A 2DA2A 3X2QH 2HOEA 4YRVA 4G7HF 4RGSA 1MMNA 3PM1A 3TQNA 2ECBA 3NAUA 1S29A 3FK6A 2NS7A 1IRFA 4K2EA 1YJ9I 5FROA 1D8JA 1DU6A 3LAJA 2L7KA 1QHHD 2HQAA 2RN7A 5LFAA 1J2XA 1I1GA 3IC7A 3JAMK 1OQYA 1TNTA 4L18B 3HSRA 5FLMJ 1V5GA 4FX4A 3MKLA 1GUUA 4V2FA 3OWTA 4ZDLA 2RQQA 1LVAA 2ZJRF 2RDPA 4L5IA 5E3NA 1MBJA 3QOPA 3FBNB 5CPRB 1T8IA 2ZCWA 1ETOA 3G2BA 3KEYA 4Q5SF 3IKTA 2ZXIA 2CQQA 2AHQA 2E7WA 4UB8C 5F0FA 3LNQA 1BI1A 4UB6C 4OAYA 4HPQA 3BJ6A 4HA8A 1YOVB 4QPOA 2PMHA 1G3YA 3HXLA 3Q9VA 1K83J 4A3IJ 4B09A 1TC3C 3RZDJ 1TWFJ 5KVRA 1XSVA 3WTYC 2DODA 2NNNA 2Y30A 1ZRFA 3LQQA 1I6HJ 4UUSA 1A36A 3BTCA 3OIPA 4M3GA 3S2HJ 2XPWA 1YX3A 2VQHA 3WTXC 2ID3A 4LK1F 5HS7A 4LB5A 5L3FA 3BT9A 3CCJI 3T0YA 2CW7A 2FA5A 2JA2A 3ZQ7A 2JUGA 5J47A 4IL6C 2KISA 2FD5A 4KT5C 4S0HB 1WJAA 3A02A 1A5JA 1B4AA 2OC6A 2WAFA 3S8PA 1TWAJ 3ZMUA 2KT0A 1N77A 3V42A 3DLLF 1X1BA 2PMUA 2PFBA 1AHDP 2DMPA 3F9KA 2JMWA 3HRMA 3DKYA 2O5RA 3G1OA 4LGWA 1FOWA 1MMAA 2E5NA 3VFZA 3GZNB 4II3A 5JFRA 1A35A 4BDZA 1NK2P 4S04A 2X1CA 1D5VA 2XC7A 4M6YA 2MH2A 3O6BB 4B4CA 1SAUA 1W7PB 1IN7A 3EUAA 4ESJA 2XGDA 3KZZA 3ABKH 4FASD 1W5TA 2GZWA 1DU0A 2EINH 2VBYA 3FM5A 3R6SA 1Y56A 3WU1B 5L3EA 5CVIA 3FXUA 3CMAI 3SYTA 2NS8A 3S15J 2G7UA 3PIPF 2EIJH 2MLGA 4XICA 3DPLC 4P9FA 3T8TA 4B1RA 2STTA 4XLHA 3OOUA 2DO7A 5FKOA 2NVQJ 2B7EA 1WKMA 4RAYA 5HDKA 5ILUA 3ZQIA 2LSOA 3W6VA 3SXYA 4B8XA 3L2CA 2XB5A 3ZQQA 1T08B 4E7IA 1GVJA 4PJ0C 2ADUA 5GPCA 1MBGA 5TGTA 3SDBA 2CUEA 3CCEI 3JCUC 4OMZA 3MZYA 4BYYA 1L3LA 3PNTA 1BR1A 2HYGD 2M3AA 1H88C 3ABUA 1K6OA 4BH9A 3D5LA 2O8XA 2Z5UA 3AG4H 1G3SA 2HPMA 3I55I 2JA7J 1IAWA 2WAQA 4UUTA 3UR3C 2HI3A 4PSWA 3IH4A 3MEXA 3QRFF 2KRFA 3M3YJ 2V79A 3CMEI 2M45A 5J6XA 2L2OA 2DJIA 2GXGA 2DOAA 3CF5F 1L0OC 2IT0A 2ISYA 2XAGA 3A0BC 3GZ5A 4NDLA 1I6XA 1FT9A 4X6AJ 3QPTA 1QNTA 2IA0A 3R0AA 2HTSA 1VQ4I 4DOZA 4ZTJA 3JRFA 5D4SA 2HEOA 1Z77A 2UWMA 3BQYA 4U0WA 4MHGA 4RM3A 1MJBA 2BVMA 4ON0A 2R93J 3AG1H 3FX3A 5IP7J 4DW6A 3KYDB 4CCKA 2EIKH 2D45A 1U0JA 3PNVA 9ANTA 3VYTB 2O6GE 4DZJA 3ZQFA 1RESA 4A5NA 1YIOA 5IYBJ 1SMTA 2ZB9A 1QZYA 1HKTA 5IYCJ 1BJAA 4FE4A 3L9FA 4CZZA 1JE8A 3A03A 2JPCA 3BR6A 1RPWA 1CF7A 4ETSA 4KA4A 3WG7H 1JJ6C 1E3HA 3BC8A 4B48A 2EB7A 1JGSA 1UG2A 4M73A 3HOXJ 1F9NA 4EJTA 3C2GA 2QKMB 4XKBA 2TRTA 3BZCA 5FJ8J 5J1YA 3MWMA 1IGNA 4NC8A 2GQQA 3KP5A 2L7FP 2OCCH 5M5XJ 5D4RA 1LE8A 4BS9A 3ROUA 3W2AA 4DJAA 4MGRA 4KNYA 2K3FA 4G6TB 1EV7A 4ENNA 3RPQA 4BBRJ 3B02A 4KN4X 4R1HA 4ZYHA 1RRJA 2DAOA 3CUQC 1FLIA 1JTYA 1XMXA 3BR0A 3EETA 1HW2A 1R5ID 4DYCA 2WBMA 3DF8A 2IP2A 4CYCA 5TJJA 1MH3A 2QENA 2AS5F 2ZC2A 3EYIA 1VI0A 2QLZA 2Y0SN 3LMMA 1OCOH 2VKHA 2OZ6A 5LGTA 1UHMA 4HV5A 4CCMA 4S05A 2LOOA 4FQGA 3H3ZA 5HOOA 2HYJA 3KFWX 3IAS2 3COAC 2EILH 2WAEA 3P7NA 4UUVA 4A3LJ 2JSCA 3OR1C 1XS9A 1X1CA 1FTZA 2LLKA 2O3FA 1R1TA 2ZMEC 1V5EA 3LSTA 3H3VK 4RBOA 2JVHA 1HOMA 1IN6A 3DBRB 4LB6B 4UVAA 2EZHA 4XORA 1H9TA 2JVGA 2HPIA 3GTKJ 5LHGA 4ASNA 4DBQA 5B1AH 2GA2A 4N4OB 1SFOJ 5FRMA 1IUYA 1MMDA 4MTDA 3BG3A 3K4KA 3C2HA 5GAHJ 1U2WA 1ETKA 3DQVC 1XGOA 3A01B 4GYGA 4UVBA 2QF7A 1Z9CA 2GLOA 1WJDA 2OF7A 1IZ1A 3SJMA 3TDUC 3L1PA 1WI9A 3KETA 2G9WA 4Y7NJ 3I4NJ 2P6TA 2DA3A 1FOKA 1FJLA 4KT6A 1ZRCA 2W57A 4A12A 1HW5A 2A6HF 3E6CC 4UV9A 2FJ1A 1FBQA 2GIVA 3ZMVA 2BW3A 2ETHA 3EUHA 2IXSA 1YX5A 3JTHA 5CQGA 3LSRA 5CYVA 2LY9A 3TMOA 2LTPA 3TKYA 3BG7A 3VSKA 1R5HA 3L00A 1N78A 2ZSIB 3ZQLA 2DA1A 4HF2A 2ESHA 1ZLJA 3CCQI 1LDJA 1ZARA 1P4AA 2KHMA 2XDVA 1TQMA 5CVVA 4UXNA 2OV7A 3FM3A 3IUOA 4XLCA 3HJEA 2EZKA 4WCGA 1P4XA 1YFHA 2R7ZJ 4KITB 1FPQA 4O6JA 4V19K 5M3FJ 1J09A 3I9V2 1KU3A 3U21A 2VE9A 3BTJA 3JSPA 3IP4B 1JI8A 1IO2A 3DEWA 2ICWG 3HRUA 3RTRA 2R4GA 1IXSB 2XHKA 3WGGA 3QP5A 3H0GJ 3J81K 1XMAA 4KIFA 4B44A 1FOYA 5LRSA 1BBYA 1GDTA 1IDZA 2XKOA 2M2EA 5D8KB 1R7JA 1SFKA 4U0VA 3MKYB 1OFCX 3D0SA 1YO5C 2DK8A 3LAPA 4A3EJ 1ZK8A 3ZMZA 3IL2A 1W36D 3ZMTA 3VPRA 2LY2A 4KFCA 1W5CC 3S1NJ 4BACA 2LMDA 3E6DA 4ZH4F 2XGEA 4HOBA 3AKZA 1E2XA 4M3DA 2HQNA 2I8DA 1MDMA 1TNSA 1G3WA 1Z1DA 4BHBA 3M8FA 3FF5A 3CF2A 3EPZA 4XL9A 4HLXA 3HOUJ 1V55H 3FISA 4AC0A 2N8GA 3BZ6A 4DZPA 5BNGA 1F36A 3N4MA 1FNNA 2LYCA 1MW7A 3JAMZ 2OQGA 3HSEA 1O3RA 1KONA 1MBEA 2QQBA 3GWZA 4G9YA 5FD6A 3A2KA 1ZGJA 2JN6A 2NYXA 1XPXA 1LDKB 3RQ4A 2DFIA 3JRIA 1Y6IA 4I99C 3GFLA 3PFYA 1MZBA 1FTTA 2E2IJ 2H8WA 1VQ8I 2HDCA 5EEGA 5J3LA 5JVGF 1T33A 2EIMH 3AG3H 4PJMA 2A6TA 2CV0A 3WHCA 2P81A 1O4XA 2O8KA 2ZJQF 4P1WA 1POGA 1WJ5A 3IWZA 2E1OA 3FXMA 3ERED 1ERDA 4PK4A 3WU0A 4ZJZA 3HOVJ 1WSUA 2K9NA 5DM7F 3FKJA 4QLCU 2WWYA 3BOQA 3RPUA 3FIWA 1BN5A 5FLXZ 1QVUA 2CQ7A 1ZLKA 2BXZA 3P9KA 3HPHA 4C30A 1W4MA 3OYMA 3WODF 5A2QZ 1YIJI 2DI3A 3RZOJ 2CSOA 2QZ8A 3HZJA 4CA0A 2H1KA 4A3CJ 2K9QA 2W24A 3DPTA 4XRSA 4ZYDA 2TCTA 4XRMA 2IAIA 3LOCA 4RLFA 1BC7C 1C0WA 1W0TA 2KL4A 2K4JA 2XUBA 1XSXA 2UXXA 3F72A 5K5QA 1S5LC 3CO7C 4AIKA 1RC9A 4IPAA 1T56A 4PGHA 4DIQA 4D7MA 3K70C 5JVTA 3GF2A 2CUJA 4W1UA 3ERMA 1KA8A 4HAMA 4IQ4A 4ENJA 2D1VA 3GMEA 3HG9A 2O9LA 2XIGA 5C4XJ 1LEAA 1TTYA 1UJ8A 4PCQA 1O7FA 5FD5A 3ABMH 4F93B 1ZKGA 4FE7A 2VBXA 2CG4A 4Y4RA 5HVQC 1H8AC 4Y3OA 3LFUA 1BI0A 3DKWA 4PSXA 4PUSA 3O8GA 2CQXA 2K85A 2VQCA 3ASNH 3V7CA 1G59A 4RGXA 1SD5A 1Z3XA 3FMRA 3NEUA 5E1WA 4Z6YA 2PX9A 3TOBA 5J4VA 3EYYA 3BROA 2R5YB 5LGNA 1JT6A 2Y0SA 4BQQA 2JTVA 4L9TA 3I59A 3GFMA 1V5FA 1ZREA 2QKLB 1M1EB 2BGCA 3GW2A 2L9SA 3SZTA 1Z7UA 2XAUA 1EF4A 5HNFA 1JKOC 1K4SA 2PI0A 1J5YA 2EV0A 2FE3A 2ELHA 5EYRA 1RETA 4EGZA 2ISZA 4NC7A 1QO0D 1QA6A 2UV1A 4HQMA 3PQJA 5LEJA 1G6NA 2KZVA 3NRVA 2JQ7A 2V1UA 2IS2A 3G3ZA 2ZJPF 4PZJA 2KKOA 1OKRA 2XV4S 1LUJB 1RUOA 4D0PA 5ICFA 2P8TA 1H89C 3K9TA 2MD5A 4ABZA 3J7YJ 1KQ0A 2CO5A 1P92A 2F4OB 4CYCB 3GLXA 2RC4A 3CESA 3NQOA 5FO5A 3OYGA 1V54H 1R58A 4UUSB 3SFZA 1WJBA 3OSGA 1ACIA 3GZ6A 2EBIA 1K78A 4FISA 3I0TA 2VJJA 3OIQA 1QQIA 3HHGA 2KMUA 4HEA2 3SEZA 1TWGJ 3L2UA 2FX0A 1RKTA 2X6YA 1X19A 2A61A 5JI6A 3W6KB 1Y0UA 4PGGA 1X3WB 1QGPA 1R6RA 1KU2A 4IXAA 4KMUX 3FXJA 2QSHX 1HDPA 2E7XA 3TP3A 2KRHA 4Y52J 4FTHA 3S3NA 5H20A 5IY5H 2DN0A 3D1NI 3DV8A 2X6XA 1HSTA 2X1EA 1P6RA 1D0ZA 2Y31A 4E7JA 4E7LA 3TL4X 2FEZA 1OR7A 1FYLA 2P5KA 3ONQA 3AL0C 3P9CA 1FMWA 2QVOA 2QYOA 1HSJA 2DMQA 5FKLA 4UVCA 3K4MA 4GXOA 2XSJC 4HNTA 1H0MA 3PNYA 1S7OA 5CVRA 2ID6A 3WTTC 1BA5A 5IT9Z 4L0YB 1TZLA 1BR2A 3L2RA 1O3QA 2MH9A 4RLQA 4AD9A 5HLHA 2DW4A 1LQ1A 3CCVI 2HGCA 3ZN1A 3M4OJ 2IJLA 3OYHA 2F6CA 3L2WA 1MIJA 2QGUA 4MEYF 1VQ9I 4RB0A 3U9GA 2V1DA 3CC4I 1S9HA 2KIQA 5E79C 4AVPA 5LHIA 2EPFA 1ZTRA 4GGGA 5CJ9A 1ONVA 3OYLA 5FLVA 5F6FA 5EF6A 3WE3A 2V26A 5F27A 1ODDA 1IRGA 3ECOA 3WGHA 1XC5A 1FIAA 4XN3A 1MGTA 1PVEA 2V1NA 3RSNA 2VASA 3OS0A 2P5LC 2VQLA 2QQ8A 1ZR4A 3H36A 1XD7A 5DS9A 2M4KA 1ITYA 3I59B 1UB9A 2MG4A 2E71A 1VQPI 1LEBA 2JUCA 2R7TA 1IXRC 5HLTA 4A3MJ 2BVLA 2FNPA 3LQRA 1SFEA 4LMYA 4F7ZA 3R61A 1EH7A 2A5WA 1MDMB 2FRHA 2F4MB 4ESFA 1S7AA 1B59A 1S7EA 3U2RA 4I01A 3QPLA 3BDDA 3LFKA 3FKIJ 1APLC 2VKEA 1HA8A 4Y17A 2R7WA 2CU7A 2CRGA 2BXYA 3WTZA 5KHDA 3FMQA 4MTEA 4WXCA 2EFNA 3RKYA 3JRHA 2P7CB 1G8XA 2D1HA 3QYBA 3C2BA 4I0BA 4AYBN 3QAHA 2F5CA 5ICGA 2QBYB 3TEDA 1NTCA 2Y48A 3HOWJ 1SVOA 3C3WA 2R7UA 1ZG5A 2XGXA 1P7JA 5E18F 2FSWA 2IPQX 5AIQA 1Z0XA 1ETXA 2E35A 2VC1A 2VJ4A 5L3DA 1STZA 1HLVA 3GTGJ 3ZCOA 5LEKA 4CCOA 4EQQA 3PUBA 2K9LA 3JRDA 3F6VA 3V8KA 1YG2A 3FXLA 4XRSG 4XN0A 3ZXSA 1I39A 4A93J 4NQWA 1OCCH 3MN2A 3GFIA 1K61A 1R4NB 5FRNA 2DTRA 3OYCA 3I56I 5IT3A 4WK8F 2CW0F 2R3SA 1MBFA 3C18A 4YIIA 1WH5A 4CUGA 4P96A 2V9PA 2DDAA 2DT5A 2OD5A 3G1MA 4CO8A 4ZZLA 2VIXA 3CMYA 1LVKA 2Z2SB 3PUFA 4AU7A 1NG7A 4AVZA 4HNVA 3ASOH 1PYVA 2V9KA 3MKZA 1XDSA 2MC3A 5K7FA 2ELJA 4DBRA 2OTJI 1O7LA 3BLYA 4ZDOA 3G73A 2HTJA 4EM2A 2XF7A 1X4PA 2Y69H 3ZPLA 1J59A 1DGWY 2P5VA 1D0YA 4G6DA 3C1DA 4G7ZF 1YHQI 3CO6C 3PJRA 2K5CA 5HLGA 4Q48A 2G0EA 3TW7A 3CZ6A 5IPAA 3DCFA 3DTKA 1F1ZA 3OOPA 2H94A 5ICCA 4IRIA 1J9IA 1WJEA 4CXFA 1FBSA 2J5OA 1SAXA 3A4CA 5D8LB 3JSOA 4M3BA 3ZRGA 1FX7A 2YS9A 2V1XA 3ZP5A 2KIUA 3WG9A 4N9HA 4AIDA 3K7AJ 4XOPA 1TWCJ 1FZPB 2D5VA 5AIPA 2CFOA 2IA2A 2V6CA 2COBA 3F6OA 5J4YA 1HQCA 3S1MJ 2L9NA 3QP6A 2X6WA 2L0KA 2W7NA 3PO2J 2X85A 3PO3J 3HKZN 2VXZA 2EK5A 2CFXA 3I4PA 2ELKA 4E70A 5J1UA 5EGOB 2OUMA 2HR3A 1IN4A 4HQEA 3CLQA 5LLQA 1SANA 1REPC 4KYWA 2Y9ZA 3E97A 3S93A 3S2DJ 1J75A 1TQIA 3DPUA 2HVSA 1WJCA 1LPQA 5H6RA 1T6SA 2QSGX 2K7LA 3M8EA 5EZGA 5L3BA 5IT9K 1Z05A 4BBSJ 4NC6A 1MMSA 3IRRA 3ESWB 4ZTFA 1MNMC 3U1DA 1RUNA 3JR9A 2EFQA 2BV6A 2GIZA 1USTA 1MJAA 2CYYA 2VJ5A 2KDZA 2MLKA 2DU9A 4QWQA 1P2FA 3FXKA 4MLOA 4O5VA 3GLLA 2JA6J 1R4MB 2EFWA 3KLOA 2MYSA 1ZYRF 4B43A 3Q0VA 5K7HA 4ZYAA 4I2OA 5J8CA 3CQZJ 2VI6A 2IRFG 1X1AA 3OYFA 2K40A 2DFEA 2KJCA 3R0JA 5CKTA 1ZR2A 1PP8F 3BZKA 4M6XA 4NUBA 2DA5A 3CC2I 4XONA 4BQNA 5DD4A 1D3YA 2J5PA 3I4MJ 2A07F 3E6BA 4YEJA 2I10A 1Q1HA 2VC0A 4F52A 4JX5A 3HUGA 5DYMA 4XBFA 1RI7A 2ESNA 4LG0A 2LRDA 1PUFB 3K1NA 4XLAA 5EZHA 4A69C 3MFKA 5EG0A 3EQLF 4C2TA 3V8LA 1TT5B 2XVCA 3GYHX 1X3UA 4H4KC 2AQFA 3FHNA 2FF4A 3PL8A 3WHBA 2XKPA 1B9MA 3DKXA 2RGVA 4A3FJ 5IOYA 4BE2A 3RYPA 3KP4A 3RQIA 1Y8RB 3M9AA 3OL4A 1SD7A 3VYRB 4BL0B 2VT3A 2KDOA 1MJ9A 4MFEA 4M71A 2PBIA 1GLNA 5FGMA 5EG0B 4BQAA 2ZMEB 2CGPA 4XKCA 2P0WA 2H27A 1E3OC 1T95A 3GVAA 2R7DA 3HUGB 3P5JA 4AUXA 1PUFA 2NOJB 4LIUA 1P9QC 3QODA 3BY6A 4OOIA 5M3MJ 1GV2A 1QPIA 4CGZA 2B9SA 2M7AA 3BR5A 3F8MA 3VYSB 4BJ5C 2AQEA 3BG9A 2XSDC 1ZAOA 3HDDA 2E1MC 3QYEA 1HDDC 4IHVA 2F2EA 3J7AO 2W25A 3ELKA 4ENMA 4MIMA 2PJRB 3F8CA 2L02A 2K3PA 2L3DA 2NNYA 1VNDA 2ZKZA 4BE0A 5L3CA 2XPUA 2EFOA 1RR8C 3DWLE 5C3EJ 4IOAF 1WHUA 3I54A 1U9NA 2XRLA 5J1RA 2FNAA 4I7HA 3SZGA 3OYIA 2KJBA 1OYIA 3TW6A 1MNEA 4OWRB 5FKMA 4E7HA 4YFXF 1QZZA 4NQWB 3V7SA 3SHFA 1A6IA 4BGDA 1K7AA 2RQPA 4CCJA 4XSXF 4RS8A 1SD6A 1A04A 3CJTB 2BHYA 2MD0A 1ETWA 1X1PA 3TO6A 3CUOA 1VQNI 1EKEA 1TP4A 1FC3A 5IYDJ 5H6QA 2GAUA 2HQRA 2XPVA 3DU5A 4HSTA 2ECCA 4MO7A 3K1MA 3RKWA 4RAZA 5H2FC 4BXXJ 2AXTC 1AKHB 3RDIA 4WF2A 2XAFA 3TBIA 3LA3A 3LSJA 4D1QA 4KIGA 4BEHA 5GTHC 2L4AA 3J80K 2WA0A 1ZGAA 1HCRA 1OYYA 3IHUA 3K4NA 2QCOA 3AL0B 1K4TA 3KP2A 5ED4A 4A3DJ 1DP3A 4WWCA 1HW1A 2MGQA 5F0HA 1FSEA 3BP8A 4YFNF 1EJ9A 2EA2A 2ACJA 1A6QA 3F0CA 3ZOBA 1D1AA 1FIPA 1K78B 1IUFA 1LFBA 4E7KA 4IVNA 1X3ZB 1W7PD 2CW8A 1ETYA 4OMYA 1KQ8A 3H3UA 2MBFA 3OMYA 2L01A 4AWXB 1XG1A 1EA3A 3LL7A 1S72I 5DCMA 4HYEA 4HZFA 1XX5A 1U8RA 2P4WA 5B5EC 4PJJA 4EJVA 4QPQA 2DQRA 3QWLA 3ML6A 4BXUA 2NRAC 3W2WA 3F3XA 4L5JA 2F5FA 2M0MA 5E8IA 1WJFA 3GUDA 1XN7A 2LDUA 4HF1A 2VXDA 2VKVA 3H92A 3TO9A 2E5ZA 1R00A 1X2MA 1JUSA 1NHAA 3IH2A 3OYAA 1B1BA 4BHPA 3BR2A 3QPHA 4L0ZB 4AYBA 2KQRA 2FBIA 5DUKA 3CCYA 3O2PE 4X0GA 3GTPJ 1IV8A 2RKHA 1YJNI 1UFMA 2A5YB 2QEXI 3M07A 3REOA 2DPDA 2DMUA 1BOAA 1GXQA 2YUSA 4LLLA 1OLTA 4A0YA 4A6DA 1NH3A 2CS3A 5GP9A 2XAQA 4ZC3A 5F1RA 1UCRA 2DJNA 3V8JA 2LKXA 2QQ9A 2ZXHA 4QIWN 2BY1A 4U88A 2M0CA 1JUMA 1UHWA 4DYRA 2LNBA 4B47A 2HS5A 1YS6A 2YPRA 2LG4A 4XSZF 4U7DA 1GHCA 5F1JA 2VLAA 2E60A 2H1LA 1OCRH 4BKXA 3CCUI 4IF4A 5BQTA 3H9QA 2IVMA 4DQ2A 1OPCA 3VODA 1R22A 3LSPA 4IRHA 3K2ZA 1BIBA 5B3SH 3RYRA 3AAFA 1I3QJ 3M1CA 2XASA 2DLLA 3F21A 3SFIA 1VQ5I 2QM3A 2L5QA 3FXQA 3H9GA 2LF7A 5K1YA 3AFHA 3VOEA 3BWGA 5KCMA 4Y15A 1YRNA 1BI3A 3CCRI 2VQGA 2BZTA 2E1NA 2CV2A 1N25A 4B3AA 3CJRB 4IEJA 1E0EA 4BAYA 2FBHA 3CMMA 4MFDA 3S14J 1B72A 1YW7A 2EZLA 4QSHA 4R8HA 5IP6A 1IN5A 2FUG2 3CJQB 2KIMA 1Y0NA 4RM2A 1KZHA 2CUFA 2HWVA 3GTOJ 4HBLA 2OBPA 1PDNC 1WFXA 1A31A 4UV8A 1VFCA 1YS7A 1LB2A 2YX7A 3OV8A 6PAXA 1HKQA 3E5XA 3PFIA 4GRIA 1JKRC 1AU7A 1ON2A 3H0DA 3UNGC 2WB1N 3DP7A 1YE9A 2WTEA 2HDWA 3W2VA 3OS1A 5GAEJ 4MQ9F 2DA7A 2F5DA 1D1BA 2LFBA 2V4JC 5E1XA 4Y33A 4X1EA 3BCBA 4EM0B 2BBYA 1JHHA 3B6CA 2E2HJ 5F64A 4RAFA 3VEPA 2Q2EB 2IGNA 1GT0C 4EV0A 2JRMA 1VQ7I 4HDVA 3IAM2 3JRGA 2KRCA 4IO9F 2ZSHB 2ZNZA 4CZCA 2O0YA 4XMYA 3F22A 2R5ZB 2W1OA 1SMYF 3DU6A 3TO7A 2QQAA 1WWXA 4J00A 1IW7F 1DPUA 2NOGA 3OYJA 4IJAA 2RV8A 1D8KA 4WX9A 1TW3A 3KEOA 3ULQB 4BU2A 1VZ0A 1MSFC 2LVSA 4ESBA 1AA7A 2HVRA 3KE2A 1FSHA 1YJWI 1IJWC 3SQNA 3BQZA 3J80Z 4BHCA 3BR1A 1J7KA 5JR3A 1KU7A 4IHSA 1FEXA 1VQ6I 2M8EA 1R49A 2R7XA 4LG3A 3RJPA 3DTEA 3RIRA 2M87A 1QVTA 1Y1VJ 2BY2A 3DEUA 3GFJA 2DXIA 4JK1X 4HLYA 3FK7A 1QRYA 1LNWA 3HYIA 3DFGA 4A5MA 4BY7J 1U6GA 2K9MA 1TL8A 1JGGA 3MQ0A 3Q3SA 5ICEA 3O8HA 4DYQA 4JP0A 4A6EA 1DP7P 2FQ4A 5ILSA 3HOSA 1DGRM 3ABTA 3ECHA 3PSFA 2JK3A 4L9NA 5LD2C 1SFXA 2HU9A 1Y39A 2JJ7A 5F08A 4N4NB 3L2VA 3F8NA 4M9ZA 1P7IA 5JLWA 3M8JA 3NARA 2STWA 3Q0UA 2M30A 2K9SA 2LP0A 3DXJF 1GXPA 1MNDA 3BJAA 1R23A 4OINF 5BOXA 2X48A 2BY3A 4DNCA 1U5TA 2L9VA 2M34A 3U1KA 5GAGJ 2EFPA 1HXDA 3FMSA 2LC2A 5HNHA 3CDHA 2PLYA 4JQFA 1U3EM 1FY7A 5HLIA 1V3FA 5DD8A 4RB3C 2DPUA 4HV6A 4GO1A 1BIAA 1D1CA 5K5OA 4EGYA 1R1VA 1E3PA 1KQ9A 3OYEA 2CJJA 1SD4A 1DQUA 1QZEA 2Z3YA 4E6KG 1S8NA 3IH3A 3QQAA 2OU2A 3ZN0A 3MMYB 2PQ8A 3FBIB 5IOZA 2OTLI 2LBFB 1LFPA 5E3MA 2DA6A 4RA2A 2OCEA 4HNUA 1B8IB 2R7VA 2GOMA 1ON1A 3KIOA 5B66C 5ILVA 1W7PA 5EDNA 3LSGA 4FHTA 1T38A 4KMFA 1JKPC 1S6LA 2XF5A 2Q2EA 2VBZA 1SVMA 1ETVA 4ZDPA 4EJUA 2VONA 2PJPA 1FOXA 4N0BA 3K70D 2JSPA 4II2A 3E5QA 1IRZA 1T39A 1XGNA 1BM9A 2D2WA 4G6QA 5IP9J 1SVLA 3WE2A 4E4HA 4RGRA 5GPAA 4GFBA 4W97A 4J01A 1XGMA 3S1RJ 3JTGA 2LD5A 2VOOA 3MD2A 2DCEA 2YSRA 3R60A 4G8XA 4EM1A 4ENKA 2Y75A 3GBGA 2EJRA 1F5TA 3K69A 3T1BA 4LK0F 3SEQA 4BXFA 2W82A 2CWEA 1JJ8C 2YR2A 1FMVA 5DUIA 3JRCA 3KZYA 4OIQF 2ZO4A 3B73A 4IHTA 1BJZA 2Y9YA 4RDUA 1R36A 3CUQB 2EV6A 3I64A 1FYKA 4EATA 2HOTA 4AIHA 1WCMJ 3E0JB 1WI3A 2UUZA
chains in the Genus database with same CATH topology
1PP7U 1R5GA 3FXRA 4NB5A 4OIPF 4EVIA 1T0FA 2E1CA 3HRSA 2PN6A 2A3SA 1BC8C 1YW8A 5ERIA 1K79A 1G4DA 2RVCA 3FHZA 5K5RA 2A6EF 2WV0A 5CLSA 4G94A 4KIBA 4YIFA 4HX4A 2HYFA 3RI4A 1KYWA 3TOAA 1XDUA 3MCZA 4KN7X 4A0ZA 3KP3A 2WC2A 3EDPA 4ZYEA 5AONA 3KLNA 4MNUA 3KP7A 3M7GA 3BPVA 4O3MA 2ZJ2A 3F8FA 3HHHA 3V7RA 3QU6A 2O61A 3I53A 2PG4A 3K0LA 1O3TA 2H09A 1T2KA 1DUXC 2TDXA 4RGUA 2PEXA 1VTNC 5FLXK 4XLNF 2YX4A 4M9XA 1JHFA 4M74A 3WTUC 4HW0A 3WGIA 5J8FA 2GXBA 1Z6RA 1ZH5A 1XMKA 4M72A 1DPRA 1ZG1A 1J0RA 2OA4A 5FFZA 2QBYA 2GWRA 4CDGA 3FZVA 4JBAA 1XGSA 4WXDA 5D6FA 5E1ZB 3ZMDA 2Z33A 5D5VB 1KU9A 4Q4ZF 2ZXJA 1YQAA 5DCFA 2VBWA 1TQPA 1O3SA 3Q5FA 2ZFWA 3Q9SA 1O57A 4GYIA 3C7JA 5HS8A 2OAZA 4HDUA 5CVJA 1R1UA 2NS0A 2EA4A 2JT1A 3ZMSA 5HS9A 1ZG3A 1LDDA 3GX4X 4MEXF 2FMYA 4EJOA 4ZZDA 4Z2YA 3FWEA 1H9GA 1RZ4A 2FBKA 3BJOA 1HKSA 1KGSA 1TW2A 4NHJA 3ISPA 1OYWA 3E6MA 3WTWC 4M9SA 2BEOA 3I71A 4N9IA 2COMA 4YFKF 2Q8KA 3MAJA 5DV5A 2CQKA 1I1SA 2MA3A 2L54A 5TRDA 4P9UA 3LA7A 2K86A 2HZTA 5CVUA 5BMZA 4EMSA 3TGNA 2AXLA 1B9NA 3QU3A 5BPIA 2OZUA 2X4HA 1TBXA 4Y13A 1FBUA 4BNCA 2Z99A 3WTVC 5JHUA 4EJWA 1AOYA 1ZN2A 1WRJA 4HF0A 5FB2A 2F5EA 3IRQA 4GCVA 1Z91A 4CHUA 2KIFA 1FYMA 3GEZA 2ZBKA 1P4WA 4YG2F 3F23A 2QWWA 4UHTA 5FFXA 2HKOA 1LJ9A 4H0EA 3HRTA 4ZYGA 2A69F 2LKPA 3P9IA 1I5ZA 3R4KA 2G7HA 3KEQA 4LJZF 5HDNA 4RB1A 3VB2A 2DK5A 3LWFA 3F8BA 2VE8A 1FWZA 5DCMB 1DDNA 3KCCA 2Z9OA 2JPBA 4UNOA 5DEQA 2K27A 4XRFA 4P5OA 1RNLA 5BS6A 2VOPA 3N97A 5KK1A 2LF8A 1G3TA 2Q0OA 4G7OF 1TLHB 5D5UB 3S2WA 3HTSB 1XB4A 2B0LA 2RNJA 1S3JA 2VODA 3L09A 1I27A 1V4RA 2IA1A 1XCVA 3IKVA 4LLNA 2ZMEA 5E17F 1YTYA 2JRTA 2ZNYA 2BYVE 1EH6A 2YU3A 5LHHA 3KP6A 5DDGA 1FP2A 1AWCA 4U0YA 1Z6TA 2NAZA 5LRRA 1QPMA 3LA2A 1ZHFA 3HOTA 2DQLA 4CICA 3BPXA 3SZPA 3V4GA 4AIJA 4P55A 1U5TC 3E5UA 1B6AA 2VN2A 5E20A 1USSA 3M1EA 2OQRA 2XAHA 4A2UA 3CJNA 2M5WA 1IN8A 2XAJA 1QBJA 2FMLA 2L4MA 4U7BA 5A2QK 4LLGF 2GA1A 2W84A 3HIFA 2DBBA 2VT2A 4WXHA 4R79A 4RB2C 2H6BA 5EEHA 3MZHA 2V9VA 3T5XA 2IW5A 2HFHA 2R7FA 3I5UA 1SFUA 1E17A 4FX0A 1XSDA 5D6EA 4L9JA 4CYDA 1W5SA 1U5TB 4TV7A 2UXNA 5E8GA 3CTAA 3J81Z 3RKXA 5D5WB 2O03A 1FP1D 4HX7A 1BI2A 1XCBA 4IRGA 3TDZC 1CGPA 1EH8A 4KDPA 2FOKA 4FT8A 4Q47A 5HDGA 1WQ2A 2FQ3A 2FXAA 3W6JB 2EWNA 2EV5A 2X0LA 3GO5A 1MKMA 4KICA 5D5XB 2C6YA 4MQVA 4LFUA 3L7WA 1U78A 3T8RA 4HX8A 4XLPF 1HBXG 1MD0A 2P7VB 4PDKA 5L3GA 4OIOF 1OMIA 3O3KA 2BE5F 2HKXA 1F4KA 5LGUA 1YYVA 2K4BA 4A0XA 4LD5A 3K1PA 1YLFA 2A68F 5LBQA 3GXOA 1CF7B 2QUFA 1JXSA 1PUEE 2UZKA 4L9VA 2K02A 1RIOH 4I02A 5BPDA 2JZYA 3JW4A 1IXCA 1ZRDA 1T98A 2Y0MA 4OIRF 3WTSC 1KYZA 4KUMA 2H6CA 3CUQA 4OU0A 2FU4A 3IWFA 4LG0B 3HSFA 3E3VA 2XROA 2P6SA 3HTUA 4I98B 3CLOA 3I58A 4I0AA 2W85A 2M1BA 3PQKA 4I09A 1ULYA 2XRNA 1YW9A 2HOEA 4G7HF 4RGSA 3TQNA 1S29A 1IRFA 4K2EA 1D8JA 3LAJA 2RN7A 1J2XA 1I1GA 3IC7A 3JAMK 1TNTA 4L18B 3HSRA 4FX4A 1LVAA 2RDPA 4L5IA 3QOPA 2ZCWA 4Q5SF 3IKTA 2E7WA 1BI1A 3BJ6A 4HA8A 2PMHA 1G3YA 3Q9VA 4B09A 5KVRA 1XSVA 3WTYC 2NNNA 1ZRFA 3LQQA 3WTXC 4LK1F 5HS7A 4LB5A 5L3FA 3T0YA 2FA5A 3ZQ7A 4KT5C 1B4AA 3ZMUA 2PMUA 2PFBA 3HRMA 4LGWA 3VFZA 5JFRA 4S04A 1D5VA 4M6YA 2MH2A 3O6BB 1W7PB 1IN7A 4ESJA 3KZZA 1W5TA 2GZWA 2VBYA 3FM5A 3R6SA 3WU1B 5L3EA 5CVIA 3FXUA 2G7UA 2MLGA 3DPLC 4P9FA 3T8TA 2STTA 2DO7A 1WKMA 4RAYA 5HDKA 5ILUA 2LSOA 3SXYA 4B8XA 3L2CA 1GVJA 2ADUA 4OMZA 3MZYA 4BYYA 1L3LA 2HYGD 3ABUA 1K6OA 4BH9A 3D5LA 2O8XA 2Z5UA 1G3SA 1IAWA 3MEXA 3QRFF 2KRFA 2V79A 2M45A 5J6XA 2GXGA 1L0OC 2IT0A 2ISYA 2XAGA 3GZ5A 1I6XA 1FT9A 3QPTA 1QNTA 2IA0A 3R0AA 2HTSA 5D4SA 2HEOA 2UWMA 4U0WA 4MHGA 1MJBA 4ON0A 3FX3A 2D45A 2O6GE 4A5NA 1YIOA 1SMTA 1HKTA 1QZYA 1BJAA 3L9FA 4CZZA 1JE8A 2JPCA 1CF7A 4ETSA 4KA4A 2EB7A 1JGSA 4M73A 1F9NA 4EJTA 3MWMA 2GQQA 3KP5A 5D4RA 3ROUA 4MGRA 4KNYA 1EV7A 4ENNA 3RPQA 3B02A 4KN4X 4R1HA 4ZYHA 2DAOA 3CUQC 1FLIA 3EETA 1HW2A 3DF8A 2IP2A 5TJJA 2QENA 2AS5F 3EYIA 2QLZA 2OZ6A 5LGTA 1UHMA 4HV5A 4S05A 3H3ZA 5HOOA 3COAC 3P7NA 4UUVA 2JSCA 2O3FA 1R1TA 3LSTA 1IN6A 4LB6B 4UVAA 1H9TA 5LHGA 4ASNA 2GA2A 1IUYA 4MTDA 1U2WA 3DQVC 1XGOA 4GYGA 4UVBA 1Z9CA 1IZ1A 3TDUC 1WI9A 3KETA 2G9WA 2P6TA 1FOKA 1ZRCA 2W57A 4A12A 1HW5A 2A6HF 3E6CC 4UV9A 1FBQA 2GIVA 3ZMVA 2ETHA 3EUHA 3JTHA 5CYVA 3TKYA 1R5HA 3L00A 4HF2A 2ESHA 1ZLJA 1LDJA 1ZARA 1P4AA 1TQMA 5CVVA 4UXNA 3FM3A 4WCGA 1P4XA 1YFHA 1FPQA 4O6JA 1KU3A 2VE9A 3JSPA 3HRUA 3RTRA 1IXSB 2XHKA 3WGGA 3QP5A 3J81K 1XMAA 4KIFA 5LRSA 1BBYA 2XKOA 5D8KB 1R7JA 4U0VA 3D0SA 1YO5C 2DK8A 3LAPA 3IL2A 3ZMZA 3ZMTA 4KFCA 3E6DA 4ZH4F 4HOBA 1E2XA 2HQNA 1MDMA 1TNSA 1G3WA 1Z1DA 4BHBA 3M8FA 3FF5A 4HLXA 3BZ6A 3N4MA 1FNNA 3JAMZ 2OQGA 3HSEA 1O3RA 2QQBA 3GWZA 4G9YA 5FD6A 1ZGJA 2NYXA 1LDKB 2DFIA 3GFLA 1MZBA 2HDCA 5EEGA 3IWZA 3ERED 3WU0A 1WSUA 4QLCU 2WWYA 3BOQA 3RPUA 1ZLKA 1BN5A 5FLXZ 3P9KA 1W4MA 3WODF 5A2QZ 2DI3A 2CSOA 2QZ8A 2W24A 3DPTA 4ZYDA 1BC7C 1C0WA 2K4JA 2XUBA 1XSXA 2UXXA 3F72A 5K5QA 3CO7C 4AIKA 4IPAA 4PGHA 5JVTA 3GF2A 1KA8A 4HAMA 4ENJA 2D1VA 2XIGA 1LEAA 1TTYA 4PCQA 1O7FA 5FD5A 2VBXA 2CG4A 5HVQC 1BI0A 3DKWA 3V7CA 4RGXA 1SD5A 3FMRA 3NEUA 5E1WA 3TOBA 3EYYA 3BROA 5LGNA 2JTVA 4L9TA 3I59A 3GFMA 1ZREA 2BGCA 3GW2A 3SZTA 1Z7UA 2PI0A 1J5YA 2EV0A 2FE3A 2ELHA 4EGZA 2ISZA 1QO0D 5LEJA 4HQMA 2V1UA 3PQJA 1G6NA 3NRVA 3G3ZA 4PZJA 2KKOA 1OKRA 2XV4S 1RUOA 4D0PA 5ICFA 2P8TA 3K9TA 2MD5A 1KQ0A 2CO5A 1P92A 3GLXA 2RC4A 3NQOA 5FO5A 1R58A 3SFZA 3GZ6A 1K78A 3I0TA 1QQIA 3HHGA 2A61A 5JI6A 3W6KB 1Y0UA 4PGGA 1QGPA 1KU2A 4IXAA 4KMUX 2E7XA 5H20A 3DV8A 1HSTA 1P6RA 2FEZA 1OR7A 1FYLA 2P5KA 3P9CA 2QVOA 2QYOA 1HSJA 4UVCA 4GXOA 1H0MA 1S7OA 5CVRA 3WTTC 5IT9Z 4L0YB 1O3QA 2MH9A 4AD9A 5HLHA 2DW4A 1LQ1A 2HGCA 3ZN1A 2IJLA 4MEYF 4RB0A 3U9GA 2V1DA 4AVPA 5LHIA 4GGGA 5CJ9A 1ONVA 5F6FA 3WE3A 1ODDA 1IRGA 3ECOA 3WGHA 1MGTA 2P5LC 1XD7A 3I59B 1UB9A 1LEBA 1IXRC 2FNPA 3LQRA 1SFEA 4LMYA 4F7ZA 3R61A 1EH7A 1MDMB 2FRHA 4ESFA 1S7AA 1B59A 3U2RA 4I01A 3BDDA 3LFKA 4Y17A 3WTZA 3FMQA 4MTEA 4WXCA 2EFNA 3RKYA 2P7CB 2D1HA 4I0BA 5ICGA 3QAHA 2F5CA 2QBYB 2Y48A 3C3WA 1ZG5A 2XGXA 5E18F 2FSWA 2IPQX 5AIQA 2VC1A 5L3DA 1STZA 5LEKA 4EQQA 3F6VA 3V8KA 1YG2A 4NQWA 3GFIA 2DTRA 5IT3A 4WK8F 2CW0F 2R3SA 3C18A 4YIIA 4P96A 2DT5A 2OD5A 4CO8A 4ZZLA 1XDSA 2MC3A 1O7LA 3G73A 2HTJA 4EM2A 3ZPLA 1J59A 2P5VA 4G6DA 4G7ZF 3C1DA 3CO6C 5HLGA 4Q48A 1F1ZA 3OOPA 2H94A 5ICCA 4IRIA 1J9IA 4CXFA 1FBSA 2J5OA 1SAXA 5D8LB 3JSOA 1FX7A 2V1XA 3ZP5A 2KIUA 3WG9A 4N9HA 1FZPB 5AIPA 2IA2A 2V6CA 3F6OA 1HQCA 3QP6A 2VXZA 2EK5A 2CFXA 3I4PA 4E70A 2HR3A 1IN4A 4HQEA 5LLQA 1REPC 4KYWA 3E97A 1J75A 1TQIA 5H6RA 1T6SA 2K7LA 3M8EA 5L3BA 5IT9K 1Z05A 3IRRA 3U1DA 1RUNA 2EFQA 2BV6A 1USTA 1MJAA 2CYYA 2MLKA 2DU9A 4QWQA 1P2FA 4O5VA 2EFWA 3KLOA 1ZYRF 4I2OA 5J8CA 2IRFG 2KJCA 3R0JA 1PP8F 4M6XA 5DD4A 1D3YA 2J5PA 2A07F 3E6BA 1Q1HA 2VC0A 3HUGA 5DYMA 4XBFA 1RI7A 2ESNA 4LG0A 3K1NA 3MFKA 3EQLF 3V8LA 2XVCA 3GYHX 1X3UA 2FF4A 2XKPA 1B9MA 2RGVA 3RYPA 3KP4A 3M9AA 1SD7A 2VT3A 1MJ9A 4M71A 2PBIA 5FGMA 4BQAA 2ZMEB 2CGPA 2H27A 3GVAA 2R7DA 3BY6A 4OOIA 4CGZA 3F8MA 1ZAOA 2F2EA 3J7AO 2W25A 3ELKA 4ENMA 3F8CA 2L02A 2NNYA 2L3DA 2ZKZA 5L3CA 2EFOA 3I54A 2FNAA 4I7HA 2KJBA 1OYIA 4YFXF 1QZZA 3V7SA 3SHFA 1K7AA 2RQPA 4XSXF 4RS8A 1SD6A 1A04A 3TO6A 3CUOA 1FC3A 5H6QA 2GAUA 2HQRA 3K1MA 3RKWA 4RAZA 3RDIA 4WF2A 2XAFA 3LA3A 4KIGA 3J80K 2L4AA 1ZGAA 1OYYA 3IHUA 3KP2A 5ED4A 4WWCA 1HW1A 1FSEA 3BP8A 4YFNF 2EA2A 2ACJA 1K78B 4IVNA 1W7PD 4OMYA 1KQ8A 3H3UA 2MBFA 4AWXB 2L01A 5DCMA 4HYEA 4HZFA 1U8RA 2P4WA 4EJVA 2DQRA 3ML6A 2NRAC 4BXUA 3F3XA 4L5JA 2F5FA 5E8IA 3GUDA 1XN7A 2LDUA 4HF1A 3H92A 3TO9A 1R00A 1NHAA 1B1BA 4BHPA 3QPHA 4L0ZB 2FBIA 5DUKA 3O2PE 2RKHA 1UFMA 2A5YB 3REOA 2DPDA 1BOAA 1GXQA 4LLLA 4A0YA 4A6DA 2XAQA 5F1RA 1UCRA 3V8JA 2QQ9A 4U88A 1UHWA 2LNBA 2HS5A 1YS6A 2YPRA 4XSZF 1GHCA 4U7DA 4IF4A 5BQTA 2IVMA 4DQ2A 1OPCA 3VODA 1R22A 4IRHA 3K2ZA 1BIBA 3RYRA 3AAFA 2XASA 2DLLA 3F21A 2QM3A 3FXQA 2LF7A 5K1YA 3VOEA 3BWGA 4Y15A 1BI3A 2E1NA 4BAYA 2FBHA 1YW7A 4R8HA 1IN5A 2KIMA 2HWVA 4HBLA 2OBPA 1PDNC 4UV8A 1YS7A 1LB2A 2YX7A 3OV8A 6PAXA 1HKQA 3E5XA 3PFIA 1ON2A 3DP7A 2WTEA 4MQ9F 2F5DA 5E1XA 4EM0B 2BBYA 1JHHA 5F64A 3VEPA 4EV0A 4HDVA 2ZNZA 2O0YA 3F22A 1SMYF 3TO7A 2QQAA 1WWXA 1IW7F 1DPUA 4IJAA 2RV8A 1D8KA 4WX9A 1TW3A 3KEOA 3ULQB 4ESBA 3KE2A 1FSHA 3SQNA 3J80Z 4BHCA 1J7KA 5JR3A 1KU7A 4IHSA 2M8EA 3RJPA 3RIRA 2M87A 3DEUA 3GFJA 4JK1X 4HLYA 1LNWA 3HYIA 3DFGA 4A5MA 1U6GA 3MQ0A 5ICEA 4A6EA 1DP7P 5ILSA 3HOSA 3ABTA 3ECHA 4L9NA 1SFXA 3F8NA 4M9ZA 2STWA 2M30A 3DXJF 1GXPA 3BJAA 1R23A 4OINF 5BOXA 4DNCA 1U5TA 2EFPA 1HXDA 3FMSA 3CDHA 2PLYA 4JQFA 1U3EM 1FY7A 5HLIA 1V3FA 5DD8A 4RB3C 2DPUA 4HV6A 4GO1A 1BIAA 5K5OA 4EGYA 1R1VA 1KQ9A 1SD4A 2Z3YA 1S8NA 2OU2A 3ZN0A 2PQ8A 1ON1A 5ILVA 4KMFA 1W7PA 1T38A 4FHTA 1S6LA 2Q2EA 4EJUA 2VBZA 2VONA 2PJPA 4N0BA 3E5QA 1T39A 1XGNA 1BM9A 2D2WA 4G6QA 3WE2A 4RGRA 1XGMA 3JTGA 2VOOA 3R60A 2YSRA 4G8XA 4EM1A 4ENKA 2Y75A 2EJRA 1F5TA 3K69A 3T1BA 4LK0F 2CWEA 2YR2A 5DUIA 3KZYA 4OIQF 2ZO4A 3B73A 4IHTA 1R36A 3CUQB 2EV6A 3I64A 1FYKA 4AIHA 1IF1A 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP7 U;  1R5G A;  3FXR A;  4NB5 A;  4OIP F;  4EVI A;  1T0F A;  2E1C A;  3HRS A;  2PN6 A;  2A3S A;  1BC8 C;  1YW8 A;  5ERI A;  1K79 A;  1G4D A;  2RVC A;  3FHZ A;  5K5R A;  2A6E F;  2WV0 A;  5CLS A;  4G94 A;  4KIB A;  4YIF A;  4HX4 A;  2HYF A;  3RI4 A;  1KYW A;  3TOA A;  1XDU A;  3MCZ A;  4KN7 X;  4A0Z A;  3KP3 A;  2WC2 A;  3EDP A;  4ZYE A;  5AON A;  3KLN A;  4MNU A;  3KP7 A;  3M7G A;  3BPV A;  4O3M A;  2ZJ2 A;  3F8F A;  3HHH A;  3V7R A;  3QU6 A;  2O61 A;  3I53 A;  2PG4 A;  3K0L A;  1O3T A;  2H09 A;  1T2K A;  1DUX C;  2TDX A;  4RGU A;  2PEX A;  1VTN C;  5FLX K;  4XLN F;  2YX4 A;  4M9X A;  1JHF A;  4M74 A;  3WTU C;  4HW0 A;  3WGI A;  5J8F A;  2GXB A;  1Z6R A;  1ZH5 A;  1XMK A;  4M72 A;  1DPR A;  1ZG1 A;  1J0R A;  2OA4 A;  5FFZ A;  2QBY A;  2GWR A;  4CDG A;  3FZV A;  4JBA A;  1XGS A;  4WXD A;  5D6F A;  5E1Z B;  3ZMD A;  2Z33 A;  5D5V B;  1KU9 A;  4Q4Z F;  2ZXJ A;  1YQA A;  5DCF A;  2VBW A;  1TQP A;  1O3S A;  3Q5F A;  2ZFW A;  3Q9S A;  1O57 A;  4GYI A;  3C7J A;  5HS8 A;  2OAZ A;  4HDU A;  5CVJ A;  1R1U A;  2NS0 A;  2EA4 A;  2JT1 A;  3ZMS A;  5HS9 A;  1ZG3 A;  1LDD A;  3GX4 X;  4MEX F;  2FMY A;  4EJO A;  4ZZD A;  4Z2Y A;  3FWE A;  1H9G A;  1RZ4 A;  2FBK A;  3BJO A;  1HKS A;  1KGS A;  1TW2 A;  4NHJ A;  3ISP A;  1OYW A;  3E6M A;  3WTW C;  4M9S A;  2BEO A;  3I71 A;  4N9I A;  2COM A;  4YFK F;  2Q8K A;  3MAJ A;  5DV5 A;  2CQK A;  1I1S A;  2MA3 A;  2L54 A;  5TRD A;  4P9U A;  3LA7 A;  2K86 A;  2HZT A;  5CVU A;  5BMZ A;  4EMS A;  3TGN A;  2AXL A;  1B9N A;  3QU3 A;  5BPI A;  2OZU A;  2X4H A;  1TBX A;  4Y13 A;  1FBU A;  4BNC A;  2Z99 A;  3WTV C;  5JHU A;  4EJW A;  1AOY A;  1ZN2 A;  1WRJ A;  4HF0 A;  5FB2 A;  2F5E A;  3IRQ A;  4GCV A;  1Z91 A;  4CHU A;  2KIF A;  1FYM A;  3GEZ A;  2ZBK A;  1P4W A;  4YG2 F;  3F23 A;  2QWW A;  4UHT A;  5FFX A;  2HKO A;  1LJ9 A;  4H0E A;  3HRT A;  4ZYG A;  2A69 F;  2LKP A;  3P9I A;  1I5Z A;  3R4K A;  2G7H A;  3KEQ A;  4LJZ F;  5HDN A;  4RB1 A;  3VB2 A;  2DK5 A;  3LWF A;  3F8B A;  2VE8 A;  1FWZ A;  5DCM B;  1DDN A;  3KCC A;  2Z9O A;  2JPB A;  4UNO A;  5DEQ A;  2K27 A;  4XRF A;  4P5O A;  1RNL A;  5BS6 A;  2VOP A;  3N97 A;  5KK1 A;  2LF8 A;  1G3T A;  2Q0O A;  4G7O F;  1TLH B;  5D5U B;  3S2W A;  3HTS B;  1XB4 A;  2B0L A;  2RNJ A;  1S3J A;  2VOD A;  3L09 A;  1I27 A;  1V4R A;  2IA1 A;  1XCV A;  3IKV A;  4LLN A;  2ZME A;  5E17 F;  1YTY A;  2JRT A;  2ZNY A;  2BYV E;  1EH6 A;  2YU3 A;  5LHH A;  3KP6 A;  5DDG A;  1FP2 A;  1AWC A;  4U0Y A;  1Z6T A;  2NAZ A;  5LRR A;  1QPM A;  3LA2 A;  1ZHF A;  3HOT A;  2DQL A;  4CIC A;  3BPX A;  3SZP A;  3V4G A;  4AIJ A;  4P55 A;  1U5T C;  3E5U A;  1B6A A;  2VN2 A;  5E20 A;  1USS A;  3M1E A;  2OQR A;  2XAH A;  4A2U A;  3CJN A;  2M5W A;  1IN8 A;  2XAJ A;  1QBJ A;  2FML A;  2L4M A;  4U7B A;  5A2Q K;  4LLG F;  2GA1 A;  2W84 A;  3HIF A;  2DBB A;  2VT2 A;  4WXH A;  4R79 A;  4RB2 C;  2H6B A;  5EEH A;  3MZH A;  2V9V A;  3T5X A;  2IW5 A;  2HFH A;  2R7F A;  3I5U A;  1SFU A;  1E17 A;  4FX0 A;  1XSD A;  5D6E A;  4L9J A;  4CYD A;  1W5S A;  1U5T B;  4TV7 A;  2UXN A;  5E8G A;  3CTA A;  3J81 Z;  3RKX A;  5D5W B;  2O03 A;  1FP1 D;  4HX7 A;  1BI2 A;  1XCB A;  4IRG A;  3TDZ C;  1CGP A;  1EH8 A;  4KDP A;  2FOK A;  4FT8 A;  4Q47 A;  5HDG A;  1WQ2 A;  2FQ3 A;  2FXA A;  3W6J B;  2EWN A;  2EV5 A;  2X0L A;  3GO5 A;  1MKM A;  4KIC A;  5D5X B;  2C6Y A;  4MQV A;  4LFU A;  3L7W A;  1U78 A;  3T8R A;  4HX8 A;  4XLP F;  1HBX G;  1MD0 A;  2P7V B;  4PDK A;  5L3G A;  4OIO F;  1OMI A;  3O3K A;  2BE5 F;  2HKX A;  1F4K A;  5LGU A;  1YYV A;  2K4B A;  4A0X A;  4LD5 A;  3K1P A;  1YLF A;  2A68 F;  5LBQ A;  3GXO A;  1CF7 B;  2QUF A;  1JXS A;  1PUE E;  2UZK A;  4L9V A;  2K02 A;  1RIO H;  4I02 A;  5BPD A;  2JZY A;  3JW4 A;  1IXC A;  1ZRD A;  1T98 A;  2Y0M A;  4OIR F;  3WTS C;  1KYZ A;  4KUM A;  2H6C A;  3CUQ A;  4OU0 A;  2FU4 A;  3IWF A;  4LG0 B;  3HSF A;  3E3V A;  2XRO A;  2P6S A;  3HTU A;  4I98 B;  3CLO A;  3I58 A;  4I0A A;  2W85 A;  2M1B A;  3PQK A;  4I09 A;  1ULY A;  2XRN A;  1YW9 A;  2HOE A;  4G7H F;  4RGS A;  3TQN A;  1S29 A;  1IRF A;  4K2E A;  1D8J A;  3LAJ A;  2RN7 A;  1J2X A;  1I1G A;  3IC7 A;  3JAM K;  1TNT A;  4L18 B;  3HSR A;  4FX4 A;  1LVA A;  2RDP A;  4L5I A;  3QOP A;  2ZCW A;  4Q5S F;  3IKT A;  2E7W A;  1BI1 A;  3BJ6 A;  4HA8 A;  2PMH A;  1G3Y A;  3Q9V A;  4B09 A;  5KVR A;  1XSV A;  3WTY C;  2NNN A;  1ZRF A;  3LQQ A;  3WTX C;  4LK1 F;  5HS7 A;  4LB5 A;  5L3F A;  3T0Y A;  2FA5 A;  3ZQ7 A;  4KT5 C;  1B4A A;  3ZMU A;  2PMU A;  2PFB A;  3HRM A;  4LGW A;  3VFZ A;  5JFR A;  4S04 A;  1D5V A;  4M6Y A;  2MH2 A;  3O6B B;  1W7P B;  1IN7 A;  4ESJ A;  3KZZ A;  1W5T A;  2GZW A;  2VBY A;  3FM5 A;  3R6S A;  3WU1 B;  5L3E A;  5CVI A;  3FXU A;  2G7U A;  2MLG A;  3DPL C;  4P9F A;  3T8T A;  2STT A;  2DO7 A;  1WKM A;  4RAY A;  5HDK A;  5ILU A;  2LSO A;  3SXY A;  4B8X A;  3L2C A;  1GVJ A;  2ADU A;  4OMZ A;  3MZY A;  4BYY A;  1L3L A;  2HYG D;  3ABU A;  1K6O A;  4BH9 A;  3D5L A;  2O8X A;  2Z5U A;  1G3S A;  1IAW A;  3MEX A;  3QRF F;  2KRF A;  2V79 A;  2M45 A;  5J6X A;  2GXG A;  1L0O C;  2IT0 A;  2ISY A;  2XAG A;  3GZ5 A;  1I6X A;  1FT9 A;  3QPT A;  1QNT A;  2IA0 A;  3R0A A;  2HTS A;  5D4S A;  2HEO A;  2UWM A;  4U0W A;  4MHG A;  1MJB A;  4ON0 A;  3FX3 A;  2D45 A;  2O6G E;  4A5N A;  1YIO A;  1SMT A;  1HKT A;  1QZY A;  1BJA A;  3L9F A;  4CZZ A;  1JE8 A;  2JPC A;  1CF7 A;  4ETS A;  4KA4 A;  2EB7 A;  1JGS A;  4M73 A;  1F9N A;  4EJT A;  3MWM A;  2GQQ A;  3KP5 A;  5D4R A;  3ROU A;  4MGR A;  4KNY A;  1EV7 A;  4ENN A;  3RPQ A;  3B02 A;  4KN4 X;  4R1H A;  4ZYH A;  2DAO A;  3CUQ C;  1FLI A;  3EET A;  1HW2 A;  3DF8 A;  2IP2 A;  5TJJ A;  2QEN A;  2AS5 F;  3EYI A;  2QLZ A;  2OZ6 A;  5LGT A;  1UHM A;  4HV5 A;  4S05 A;  3H3Z A;  5HOO A;  3COA C;  3P7N A;  4UUV A;  2JSC A;  2O3F A;  1R1T A;  3LST A;  1IN6 A;  4LB6 B;  4UVA A;  1H9T A;  5LHG A;  4ASN A;  2GA2 A;  1IUY A;  4MTD A;  1U2W A;  3DQV C;  1XGO A;  4GYG A;  4UVB A;  1Z9C A;  1IZ1 A;  3TDU C;  1WI9 A;  3KET A;  2G9W A;  2P6T A;  1FOK A;  1ZRC A;  2W57 A;  4A12 A;  1HW5 A;  2A6H F;  3E6C C;  4UV9 A;  1FBQ A;  2GIV A;  3ZMV A;  2ETH A;  3EUH A;  3JTH A;  5CYV A;  3TKY A;  1R5H A;  3L00 A;  4HF2 A;  2ESH A;  1ZLJ A;  1LDJ A;  1ZAR A;  1P4A A;  1TQM A;  5CVV A;  4UXN A;  3FM3 A;  4WCG A;  1P4X A;  1YFH A;  1FPQ A;  4O6J A;  1KU3 A;  2VE9 A;  3JSP A;  3HRU A;  3RTR A;  1IXS B;  2XHK A;  3WGG A;  3QP5 A;  3J81 K;  1XMA A;  4KIF A;  5LRS A;  1BBY A;  2XKO A;  5D8K B;  1R7J A;  4U0V A;  3D0S A;  1YO5 C;  2DK8 A;  3LAP A;  3IL2 A;  3ZMZ A;  3ZMT A;  4KFC A;  3E6D A;  4ZH4 F;  4HOB A;  1E2X A;  2HQN A;  1MDM A;  1TNS A;  1G3W A;  1Z1D A;  4BHB A;  3M8F A;  3FF5 A;  4HLX A;  3BZ6 A;  3N4M A;  1FNN A;  3JAM Z;  2OQG A;  3HSE A;  1O3R A;  2QQB A;  3GWZ A;  4G9Y A;  5FD6 A;  1ZGJ A;  2NYX A;  1LDK B;  2DFI A;  3GFL A;  1MZB A;  2HDC A;  5EEG A;  3IWZ A;  3ERE D;  3WU0 A;  1WSU A;  4QLC U;  2WWY A;  3BOQ A;  3RPU A;  1ZLK A;  1BN5 A;  5FLX Z;  3P9K A;  1W4M A;  3WOD F;  5A2Q Z;  2DI3 A;  2CSO A;  2QZ8 A;  2W24 A;  3DPT A;  4ZYD A;  1BC7 C;  1C0W A;  2K4J A;  2XUB A;  1XSX A;  2UXX A;  3F72 A;  5K5Q A;  3CO7 C;  4AIK A;  4IPA A;  4PGH A;  5JVT A;  3GF2 A;  1KA8 A;  4HAM A;  4ENJ A;  2D1V A;  2XIG A;  1LEA A;  1TTY A;  4PCQ A;  1O7F A;  5FD5 A;  2VBX A;  2CG4 A;  5HVQ C;  1BI0 A;  3DKW A;  3V7C A;  4RGX A;  1SD5 A;  3FMR A;  3NEU A;  5E1W A;  3TOB A;  3EYY A;  3BRO A;  5LGN A;  2JTV A;  4L9T A;  3I59 A;  3GFM A;  1ZRE A;  2BGC A;  3GW2 A;  3SZT A;  1Z7U A;  2PI0 A;  1J5Y A;  2EV0 A;  2FE3 A;  2ELH A;  4EGZ A;  2ISZ A;  1QO0 D;  5LEJ A;  4HQM A;  2V1U A;  3PQJ A;  1G6N A;  3NRV A;  3G3Z A;  4PZJ A;  2KKO A;  1OKR A;  2XV4 S;  1RUO A;  4D0P A;  5ICF A;  2P8T A;  3K9T A;  2MD5 A;  1KQ0 A;  2CO5 A;  1P92 A;  3GLX A;  2RC4 A;  3NQO A;  5FO5 A;  1R58 A;  3SFZ A;  3GZ6 A;  1K78 A;  3I0T A;  1QQI A;  3HHG A;  2A61 A;  5JI6 A;  3W6K B;  1Y0U A;  4PGG A;  1QGP A;  1KU2 A;  4IXA A;  4KMU X;  2E7X A;  5H20 A;  3DV8 A;  1HST A;  1P6R A;  2FEZ A;  1OR7 A;  1FYL A;  2P5K A;  3P9C A;  2QVO A;  2QYO A;  1HSJ A;  4UVC A;  4GXO A;  1H0M A;  1S7O A;  5CVR A;  3WTT C;  5IT9 Z;  4L0Y B;  1O3Q A;  2MH9 A;  4AD9 A;  5HLH A;  2DW4 A;  1LQ1 A;  2HGC A;  3ZN1 A;  2IJL A;  4MEY F;  4RB0 A;  3U9G A;  2V1D A;  4AVP A;  5LHI A;  4GGG A;  5CJ9 A;  1ONV A;  5F6F A;  3WE3 A;  1ODD A;  1IRG A;  3ECO A;  3WGH A;  1MGT A;  2P5L C;  1XD7 A;  3I59 B;  1UB9 A;  1LEB A;  1IXR C;  2FNP A;  3LQR A;  1SFE A;  4LMY A;  4F7Z A;  3R61 A;  1EH7 A;  1MDM B;  2FRH A;  4ESF A;  1S7A A;  1B59 A;  3U2R A;  4I01 A;  3BDD A;  3LFK A;  4Y17 A;  3WTZ A;  3FMQ A;  4MTE A;  4WXC A;  2EFN A;  3RKY A;  2P7C B;  2D1H A;  4I0B A;  5ICG A;  3QAH A;  2F5C A;  2QBY B;  2Y48 A;  3C3W A;  1ZG5 A;  2XGX A;  5E18 F;  2FSW A;  2IPQ X;  5AIQ A;  2VC1 A;  5L3D A;  1STZ A;  5LEK A;  4EQQ A;  3F6V A;  3V8K A;  1YG2 A;  4NQW A;  3GFI A;  2DTR A;  5IT3 A;  4WK8 F;  2CW0 F;  2R3S A;  3C18 A;  4YII A;  4P96 A;  2DT5 A;  2OD5 A;  4CO8 A;  4ZZL A;  1XDS A;  2MC3 A;  1O7L A;  3G73 A;  2HTJ A;  4EM2 A;  3ZPL A;  1J59 A;  2P5V A;  4G6D A;  4G7Z F;  3C1D A;  3CO6 C;  5HLG A;  4Q48 A;  1F1Z A;  3OOP A;  2H94 A;  5ICC A;  4IRI A;  1J9I A;  4CXF A;  1FBS A;  2J5O A;  1SAX A;  5D8L B;  3JSO A;  1FX7 A;  2V1X A;  3ZP5 A;  2KIU A;  3WG9 A;  4N9H A;  1FZP B;  5AIP A;  2IA2 A;  2V6C A;  3F6O A;  1HQC A;  3QP6 A;  2VXZ A;  2EK5 A;  2CFX A;  3I4P A;  4E70 A;  2HR3 A;  1IN4 A;  4HQE A;  5LLQ A;  1REP C;  4KYW A;  3E97 A;  1J75 A;  1TQI A;  5H6R A;  1T6S A;  2K7L A;  3M8E A;  5L3B A;  5IT9 K;  1Z05 A;  3IRR A;  3U1D A;  1RUN A;  2EFQ A;  2BV6 A;  1UST A;  1MJA A;  2CYY A;  2MLK A;  2DU9 A;  4QWQ A;  1P2F A;  4O5V A;  2EFW A;  3KLO A;  1ZYR F;  4I2O A;  5J8C A;  2IRF G;  2KJC A;  3R0J A;  1PP8 F;  4M6X A;  5DD4 A;  1D3Y A;  2J5P A;  2A07 F;  3E6B A;  1Q1H A;  2VC0 A;  3HUG A;  5DYM A;  4XBF A;  1RI7 A;  2ESN A;  4LG0 A;  3K1N A;  3MFK A;  3EQL F;  3V8L A;  2XVC A;  3GYH X;  1X3U A;  2FF4 A;  2XKP A;  1B9M A;  2RGV A;  3RYP A;  3KP4 A;  3M9A A;  1SD7 A;  2VT3 A;  1MJ9 A;  4M71 A;  2PBI A;  5FGM A;  4BQA A;  2ZME B;  2CGP A;  2H27 A;  3GVA A;  2R7D A;  3BY6 A;  4OOI A;  4CGZ A;  3F8M A;  1ZAO A;  2F2E A;  3J7A O;  2W25 A;  3ELK A;  4ENM A;  3F8C A;  2L02 A;  2NNY A;  2L3D A;  2ZKZ A;  5L3C A;  2EFO A;  3I54 A;  2FNA A;  4I7H A;  2KJB A;  1OYI A;  4YFX F;  1QZZ A;  3V7S A;  3SHF A;  1K7A A;  2RQP A;  4XSX F;  4RS8 A;  1SD6 A;  1A04 A;  3TO6 A;  3CUO A;  1FC3 A;  5H6Q A;  2GAU A;  2HQR A;  3K1M A;  3RKW A;  4RAZ A;  3RDI A;  4WF2 A;  2XAF A;  3LA3 A;  4KIG A;  3J80 K;  2L4A A;  1ZGA A;  1OYY A;  3IHU A;  3KP2 A;  5ED4 A;  4WWC A;  1HW1 A;  1FSE A;  3BP8 A;  4YFN F;  2EA2 A;  2ACJ A;  1K78 B;  4IVN A;  1W7P D;  4OMY A;  1KQ8 A;  3H3U A;  2MBF A;  4AWX B;  2L01 A;  5DCM A;  4HYE A;  4HZF A;  1U8R A;  2P4W A;  4EJV A;  2DQR A;  3ML6 A;  2NRA C;  4BXU A;  3F3X A;  4L5J A;  2F5F A;  5E8I A;  3GUD A;  1XN7 A;  2LDU A;  4HF1 A;  3H92 A;  3TO9 A;  1R00 A;  1NHA A;  1B1B A;  4BHP A;  3QPH A;  4L0Z B;  2FBI A;  5DUK A;  3O2P E;  2RKH A;  1UFM A;  2A5Y B;  3REO A;  2DPD A;  1BOA A;  1GXQ A;  4LLL A;  4A0Y A;  4A6D A;  2XAQ A;  5F1R A;  1UCR A;  3V8J A;  2QQ9 A;  4U88 A;  1UHW A;  2LNB A;  2HS5 A;  1YS6 A;  2YPR A;  4XSZ F;  1GHC A;  4U7D A;  4IF4 A;  5BQT A;  2IVM A;  4DQ2 A;  1OPC A;  3VOD A;  1R22 A;  4IRH A;  3K2Z A;  1BIB A;  3RYR A;  3AAF A;  2XAS A;  2DLL A;  3F21 A;  2QM3 A;  3FXQ A;  2LF7 A;  5K1Y A;  3VOE A;  3BWG A;  4Y15 A;  1BI3 A;  2E1N A;  4BAY A;  2FBH A;  1YW7 A;  4R8H A;  1IN5 A;  2KIM A;  2HWV A;  4HBL A;  2OBP A;  1PDN C;  4UV8 A;  1YS7 A;  1LB2 A;  2YX7 A;  3OV8 A;  6PAX A;  1HKQ A;  3E5X A;  3PFI A;  1ON2 A;  3DP7 A;  2WTE A;  4MQ9 F;  2F5D A;  5E1X A;  4EM0 B;  2BBY A;  1JHH A;  5F64 A;  3VEP A;  4EV0 A;  4HDV A;  2ZNZ A;  2O0Y A;  3F22 A;  1SMY F;  3TO7 A;  2QQA A;  1WWX A;  1IW7 F;  1DPU A;  4IJA A;  2RV8 A;  1D8K A;  4WX9 A;  1TW3 A;  3KEO A;  3ULQ B;  4ESB A;  3KE2 A;  1FSH A;  3SQN A;  3J80 Z;  4BHC A;  1J7K A;  5JR3 A;  1KU7 A;  4IHS A;  2M8E A;  3RJP A;  3RIR A;  2M87 A;  3DEU A;  3GFJ A;  4JK1 X;  4HLY A;  1LNW A;  3HYI A;  3DFG A;  4A5M A;  1U6G A;  3MQ0 A;  5ICE A;  4A6E A;  1DP7 P;  5ILS A;  3HOS A;  3ABT A;  3ECH A;  4L9N A;  1SFX A;  3F8N A;  4M9Z A;  2STW A;  2M30 A;  3DXJ F;  1GXP A;  3BJA A;  1R23 A;  4OIN F;  5BOX A;  4DNC A;  1U5T A;  2EFP A;  1HXD A;  3FMS A;  3CDH A;  2PLY A;  4JQF A;  1U3E M;  1FY7 A;  5HLI A;  1V3F A;  5DD8 A;  4RB3 C;  2DPU A;  4HV6 A;  4GO1 A;  1BIA A;  5K5O A;  4EGY A;  1R1V A;  1KQ9 A;  1SD4 A;  2Z3Y A;  1S8N A;  2OU2 A;  3ZN0 A;  2PQ8 A;  1ON1 A;  5ILV A;  4KMF A;  1W7P A;  1T38 A;  4FHT A;  1S6L A;  2Q2E A;  4EJU A;  2VBZ A;  2VON A;  2PJP A;  4N0B A;  3E5Q A;  1T39 A;  1XGN A;  1BM9 A;  2D2W A;  4G6Q A;  3WE2 A;  4RGR A;  1XGM A;  3JTG A;  2VOO A;  3R60 A;  2YSR A;  4G8X A;  4EM1 A;  4ENK A;  2Y75 A;  2EJR A;  1F5T A;  3K69 A;  3T1B A;  4LK0 F;  2CWE A;  2YR2 A;  5DUI A;  3KZY A;  4OIQ F;  2ZO4 A;  3B73 A;  4IHT A;  1R36 A;  3CUQ B;  2EV6 A;  3I64 A;  1FYK A;  4AIH A;  1IF1 A;  3KFW X; 
#chains in the Genus database with same CATH topology
 4NNJ A;  1PP7 U;  1R5G A;  3ABL H;  3FXR A;  3HB9 A;  4NB5 A;  4OIP F;  2VUM J;  3K4B A;  3A01 A;  4EVI A;  3Q0W A;  2WAD A;  1T0F A;  2E1C A;  3HRS A;  2PN6 A;  2A3S A;  1BC8 C;  1YW8 A;  5ERI A;  1K79 A;  1G4D A;  2R7S A;  2RVC A;  4F91 B;  4D9J A;  3FHZ A;  5K5R A;  5M5Y J;  2VJI A;  2PMZ A;  4J19 A;  4IHX A;  3BTL A;  2KLO A;  2A6E F;  2WV0 A;  3LSK A;  5CLS A;  3HPG A;  4G94 A;  4KIB A;  4YIF A;  3LSI A;  3CCL I;  2CQN A;  4HX4 A;  5F0C A;  4EEF G;  3VYU B;  2HYF A;  1D5Y A;  3RI4 A;  4A3J J;  5GTI C;  1VQM I;  1KYW A;  2DOE A;  3TOA A;  1XDU A;  3MCZ A;  4KN7 X;  4A0Z A;  4D5C A;  4D7N A;  3CP8 A;  3KP3 A;  2E34 A;  2WC2 A;  1F43 A;  2BHZ A;  3EDP A;  3RCO A;  3HM5 A;  4ZYE A;  2RNG A;  3DBH B;  3LSH A;  2X1D A;  2MC4 A;  5AON A;  4C3I J;  2R0Q C;  3KLN A;  1TT0 A;  2IS4 A;  2IGO A;  1WPK A;  4MNU A;  3KP7 A;  3M7G A;  3ZGK A;  3BPV A;  4BUP A;  1OR7 C;  3HOY J;  4O3M A;  2ZJ2 A;  2Z16 A;  3F8F A;  4ITV A;  3K6G A;  3HHH A;  3V7R A;  3H5N A;  1RKW A;  3RKQ A;  2Z1D A;  3QU6 A;  2O61 A;  3I53 A;  2PG4 A;  2ZXW H;  4HG2 A;  1MMG A;  2W48 A;  3K0L A;  3K4C A;  1O3T A;  2H09 A;  1WZ2 A;  3BG6 A;  3GTL J;  1T2K A;  1OCZ H;  1DUX C;  2TDX A;  4RGU A;  2GOX B;  2DFF A;  2PEX A;  5C44 J;  1VTN C;  1Y8Q B;  1ZQ3 P;  2VPL A;  5FLX K;  4XLN F;  2YX4 A;  3CCS I;  4M9X A;  1JHF A;  3KX2 A;  2RRE A;  2X51 A;  4M74 A;  4F3Q A;  4PFP A;  3QYF A;  3HKZ A;  3JRA A;  3WTU C;  4HW0 A;  4BE1 A;  2NVT J;  3WGI A;  2IS1 A;  5GAD J;  2HZD A;  2GXA A;  5J8F A;  2JA5 J;  2GXB A;  1BR4 A;  1Z6R A;  1JUP A;  1X4O A;  4CCN A;  1ZH5 A;  1XMK A;  2ZFU A;  4E7S A;  3QOE A;  4M72 A;  4IQJ A;  4E7Z A;  5C4J J;  1IV6 A;  1DPR A;  1ZG1 A;  1J0R A;  2OA4 A;  5FFZ A;  2QBY A;  3HBL A;  2GWR A;  2L7Z A;  2E2J J;  4XKW A;  4CDG A;  3FZV A;  4JBA A;  1XGS A;  4WXD A;  5D6F A;  2E19 A;  1HF0 A;  3HGY A;  5E1Z B;  4M3F A;  3ZMD A;  4DGW B;  2Z33 A;  1YIT I;  3QPS A;  5D5V B;  3HL2 A;  1KU9 A;  4JOM A;  4Q4Z F;  2ZXJ A;  1YQA A;  1X2N A;  4NBQ A;  2WV1 A;  2NVY J;  5DCF A;  3TP0 A;  5K7Z A;  3HC7 A;  4YIR X;  3IV5 A;  4XK4 A;  2QA4 I;  5CQE A;  3DBL B;  1QHG A;  5FKN A;  3H1C A;  2VBW A;  1IC8 A;  1TQP A;  1ENH A;  2KPM A;  1O3S A;  3Q5F A;  4HSR A;  2ZFW A;  3Q9S A;  3CCM I;  4IHY A;  2NXN B;  1O57 A;  4JYK A;  4GYI A;  2E36 A;  1Q1V A;  3C7J A;  5HS8 A;  4BJT A;  2OAZ A;  2BOL A;  2W00 A;  3DLA A;  1JTX A;  5B1B H;  4HDU A;  5CVJ A;  4PJN A;  1R1U A;  2NS0 A;  2F48 A;  2EA4 A;  2JT1 A;  3ZMS A;  5HS9 A;  1ZG3 A;  1LDD A;  4AM3 A;  3GX4 X;  4MEX F;  3ZR8 X;  2FMY A;  3W3C A;  4EJO A;  2H8R A;  2L9R A;  3WU2 C;  1BOB A;  4ZZD A;  4CSW A;  2HXI A;  2EQR A;  4Z2Y A;  2LBF A;  2VB6 A;  3FWE A;  1VQL I;  4IZZ A;  1H9G A;  1RZ4 A;  1IRX A;  2OPT A;  2FBK A;  3OSF A;  1IDY A;  4XOT A;  2B63 J;  3BJO A;  3S32 A;  1HKS A;  1WGX A;  2HOA A;  1KGS A;  4I76 A;  3G4S I;  1TW2 A;  4NHJ A;  3ISP A;  2WB1 A;  3EUH C;  5HOD A;  2HQ5 A;  2IS6 A;  4IOC F;  3OYN A;  1OYW A;  5M5W J;  3E6M A;  5FKK A;  3WTW C;  4FET A;  2RAE A;  2DFH A;  3MVP A;  4M9S A;  3A1Y A;  2BEO A;  3I71 A;  4N9I A;  2COM A;  4A3K J;  4YFK F;  2Q8K A;  3OS2 A;  2XB0 X;  3FXO A;  3BR3 A;  3MAJ A;  2M9H A;  5DV5 A;  2CQK A;  1I1S A;  2MA3 A;  3ZQG A;  2L54 A;  5TRD A;  4P9U A;  4V2G A;  3LA7 A;  4KIS A;  2K86 A;  2WAQ N;  2HZT A;  4XID A;  5CVU A;  3A0H C;  4EMS A;  3TGN A;  5BMZ A;  1UZC A;  2LR8 A;  1U8B A;  1MBK A;  2LH9 A;  4C3H J;  1UG0 A;  1B9N A;  2AXL A;  3QU3 A;  4UY8 I;  5BPI A;  2OZU A;  2X4H A;  1TBX A;  4Y13 A;  1OCT C;  3JRB A;  1FBU A;  4BNC A;  1OCP A;  4GDF A;  2Z99 A;  2Q1Z B;  3WTV C;  5JHU A;  2V7F A;  4EJW A;  2LRE A;  1AOY A;  2GM4 A;  2KP6 A;  5E3O A;  1ZN2 A;  2LK2 A;  3H35 A;  1WRJ A;  4HF0 A;  5FB2 A;  3GCM A;  2F5E A;  3IRQ A;  2AO9 A;  4GCV A;  4XR6 A;  4BJ6 C;  1Z91 A;  4RAG A;  1WVR A;  4PFO A;  4CHU A;  1Z67 A;  2KIF A;  1FYM A;  4CCL A;  2DTZ A;  3GEZ A;  2ZBK A;  1QU3 A;  1GVD A;  4OAZ A;  1P4W A;  1K6Y A;  2DMT A;  4YG2 F;  3F23 A;  1D0X A;  2L7M P;  2R7Q A;  3L2Q A;  2HXO A;  3S1Q J;  4D5F A;  1G2H A;  2QWW A;  4UHT A;  5FFX A;  2HKO A;  1AKH A;  1LJ9 A;  4H0E A;  3JRE A;  3HRT A;  2HVQ A;  2R7R A;  1ZEL A;  3HEF A;  3KZI C;  4ZYG A;  2BY0 A;  1MSE C;  2A69 F;  2LKP A;  3S3M A;  3P9I A;  1I5Z A;  2DYR H;  3RPU D;  1T0F C;  3R4K A;  2G7H A;  4IX7 A;  3KEQ A;  3D5R C;  4LJZ F;  4HRI A;  5HDN A;  1I3A A;  3CDI A;  1SEU A;  4RB1 A;  3VB2 A;  1UEL B;  1N75 A;  2QSF X;  2DK5 A;  3LWF A;  1MH4 A;  4PJL A;  5EJC A;  3F8B A;  3K10 A;  2VE8 A;  1FWZ A;  4BDY A;  2DDB A;  4C9Y A;  5DCM B;  3VWB A;  4YEL A;  1DDN A;  3KCC A;  3E7L A;  2Z9O A;  1BL0 A;  2JPB A;  5DEQ A;  2K27 A;  4XRF A;  3DEE A;  2NVX J;  4UNO A;  2V6E A;  1Z3Y A;  4P5O A;  3OY9 A;  2M4G A;  1RNL A;  2I5U A;  5BS6 A;  2VOP A;  2LKS A;  3N97 A;  5KK1 A;  2LF8 A;  3KYL A;  4L5E A;  2MSY A;  5TIS C;  1ZGW A;  2X9D A;  2CV1 A;  1BW6 A;  1G3T A;  2Q0O A;  2WY7 Q;  4A3B J;  3GTM J;  4G7O F;  1TLH B;  4JX6 A;  5D5U B;  4CH7 A;  4BY1 J;  3S2W A;  3HTS B;  1XB4 A;  2F4I A;  2KFD A;  2B0L A;  2RNJ A;  1S3J A;  2BW3 B;  3UKG A;  1YRN B;  2VOD A;  3L09 A;  1NG6 A;  1I27 A;  4C3J J;  1V4R A;  1BW5 A;  2IA1 A;  1XCV A;  3ZQC A;  3DTI A;  3IKV A;  4LLN A;  2ZME A;  5E17 F;  1YTY A;  2JRT A;  2ZNY A;  3OYD A;  2BYV E;  1EH6 A;  4IHW A;  2ME6 A;  2DT6 A;  2YU3 A;  5LHH A;  3KP6 A;  3OR2 C;  5DDG A;  1FP2 A;  3AG2 H;  2R7O A;  2HNH A;  1AWC A;  4U0Y A;  1Z6T A;  2VL8 A;  5EGO A;  2NAZ A;  1Y1W J;  5LRR A;  3K4J A;  1QPM A;  3LA2 A;  1ZHF A;  3HOT A;  2DQL A;  3J7A Y;  4CIC A;  2NVU B;  1JT0 A;  2EZI A;  3ZQH A;  1Z7L A;  1ETQ A;  4IKF A;  2CMP A;  3BPX A;  3SZP A;  2GBY A;  3V4G A;  4P55 A;  4AIJ A;  4QTR A;  1U5T C;  2M7B A;  3KYC B;  4F92 B;  3E5U A;  1MBH A;  1B6A A;  2VN2 A;  1LFU P;  5E20 A;  1USS A;  3H5R A;  3M1E A;  2R92 J;  2OQR A;  3K4L A;  3GTJ J;  2XAH A;  4G12 A;  4RMN A;  4XLF A;  4A2U A;  3CJN A;  2KZG A;  3CP2 A;  2M5W A;  2R5Z A;  1YI2 I;  1NK3 P;  1IN8 A;  4B3X A;  2XAJ A;  1QBJ A;  5J40 A;  2FML A;  2L4M A;  4U7B A;  2DT7 B;  2FOW A;  4XM3 A;  5A2Q K;  4LLG F;  2GA1 A;  1SC7 A;  2W84 A;  3HIF A;  1XTA A;  2DBB A;  2R5Y A;  2VT2 A;  4WXH A;  4R79 A;  4RB2 C;  3K2A A;  2H6B A;  5EEH A;  3FDY A;  2Y2Z A;  2V9V A;  3MZH A;  1R9T J;  2CUZ A;  3S17 J;  1HC8 A;  3G71 I;  1W1W E;  3T5X A;  2IW5 A;  2HFH A;  1CQT A;  2R7F A;  3EUK L;  3I5U A;  3BG5 A;  1B72 B;  2VPR A;  1SFU A;  1E17 A;  1VQK I;  4FX0 A;  1XSD A;  2DOF A;  2IEK A;  2MAB A;  5D6E A;  4L9J A;  4CYD A;  1W5S A;  3PSI A;  1U5T B;  2EH3 A;  4TV7 A;  2UXN A;  4BQO A;  5E8G A;  3CTA A;  5JLX A;  3J81 Z;  3RKX A;  5D5W B;  2O03 A;  4XKV A;  3S3O A;  1FP1 D;  3CD6 I;  1OJL A;  3OIO A;  3E1S A;  3OL3 A;  3S16 J;  4HX7 A;  1BI2 A;  1XCB A;  4LOC A;  4C2U A;  4IRG A;  3TDZ C;  2JA8 J;  1OIS A;  1CGP A;  1EH8 A;  1I50 J;  4KDP A;  2FOK A;  4FT8 A;  2MW8 A;  3CC7 I;  1X1D A;  4Q47 A;  5HDG A;  1WQ2 A;  2FQ3 A;  1LE8 B;  2FXA A;  3W6J B;  4A3G J;  1GV5 A;  5JHF A;  2EWN A;  4KJZ A;  2A05 A;  2EV5 A;  2OJE D;  2VKD A;  2IGK A;  2X0L A;  3GO5 A;  1MKM A;  3I3L A;  4KIC A;  2YU9 J;  3HOZ J;  3MZ8 A;  4C2M J;  5D5X B;  2C6Y A;  4MQV A;  1UMQ A;  3KPH A;  4LFU A;  3L7W A;  1W0U A;  1U78 A;  3T8R A;  4I6Z A;  2ME0 A;  4HX8 A;  4M6V A;  3G1L A;  4XLP F;  1HBX G;  1MD0 A;  2IGM A;  2P7V B;  4PDK A;  5L3G A;  4XLE A;  4XQF A;  5EEA A;  3HGG A;  4OIO F;  1OMI A;  3O3K A;  3VSL A;  2XGC A;  3H5A A;  2BE5 F;  1RR7 A;  2O7O A;  2HKX A;  2PJR A;  2HOS A;  1F4K A;  5LGU A;  1UAA A;  3H9J A;  3GTQ J;  1YYV A;  2K4B A;  4A0X A;  1W36 C;  2M8G X;  4LD5 A;  3K1P A;  4FCY A;  1YLF A;  2A68 F;  2DYS H;  5LBQ A;  3BTI A;  3GXO A;  1X58 A;  4LIV A;  1CF7 B;  3VDX A;  2HDD A;  2QUF A;  2DA4 A;  2DMN A;  2WY8 Q;  1JXS A;  2E1M B;  1PUE E;  4U87 A;  2UZK A;  4L9V A;  2K02 A;  1B8I A;  1RIO H;  4I02 A;  5BPD A;  2JZY A;  3JW4 A;  1IXC A;  3OYB A;  1ZRD A;  1T98 A;  3PIO F;  3J7Z I;  2Y0M A;  1U9O A;  4OIR F;  1PJR A;  1VF9 A;  3NWS A;  3WTS C;  4JX4 A;  3D5S C;  1R71 A;  1LKX A;  1KYZ A;  2PMZ N;  4KUM A;  3BCA A;  2H6C A;  4BEH B;  5KNL A;  3CUQ A;  1TWH J;  5KAI C;  3NWT A;  5DM6 F;  4OU0 A;  3OYK A;  1WH7 A;  2FU4 A;  4ANJ A;  3IWF A;  2MFZ A;  4LG0 B;  3HSF A;  4LIT A;  4M3E A;  4XNF A;  1IF1 A;  2LY1 A;  5F04 A;  1IG7 A;  3E3V A;  2XRO A;  2X6O A;  5KAF C;  3CDL A;  1Z21 A;  2W4S A;  3LSM A;  3SDG A;  2P6S A;  3HTU A;  2F5V A;  1ORK A;  1UHS A;  4I98 B;  3CLO A;  5E3L A;  2IBD A;  3I58 A;  4F55 A;  4I0A A;  2W85 A;  2M1B A;  3PQK A;  2JWT A;  3MKW B;  4I09 A;  1ULY A;  3B6A A;  2CH0 A;  1VQO I;  5DTD A;  3G6E I;  3N05 A;  2XF6 A;  1JKQ C;  2XRN A;  1YW9 A;  2DA2 A;  3X2Q H;  2HOE A;  4YRV A;  4G7H F;  4RGS A;  1MMN A;  3PM1 A;  3TQN A;  2ECB A;  3NAU A;  1S29 A;  3FK6 A;  2NS7 A;  1IRF A;  4K2E A;  1YJ9 I;  5FRO A;  1D8J A;  1DU6 A;  3LAJ A;  2L7K A;  1QHH D;  2HQA A;  2RN7 A;  5LFA A;  1J2X A;  1I1G A;  3IC7 A;  3JAM K;  1OQY A;  1TNT A;  4L18 B;  3HSR A;  5FLM J;  1V5G A;  4FX4 A;  3MKL A;  1GUU A;  4V2F A;  3OWT A;  4ZDL A;  2RQQ A;  1LVA A;  2ZJR F;  2RDP A;  4L5I A;  5E3N A;  1MBJ A;  3QOP A;  3FBN B;  5CPR B;  1T8I A;  2ZCW A;  1ETO A;  3G2B A;  3KEY A;  4Q5S F;  3IKT A;  2ZXI A;  2CQQ A;  2AHQ A;  2E7W A;  4UB8 C;  5F0F A;  3LNQ A;  1BI1 A;  4UB6 C;  4OAY A;  4HPQ A;  3BJ6 A;  4HA8 A;  1YOV B;  4QPO A;  2PMH A;  1G3Y A;  3HXL A;  3Q9V A;  1K83 J;  4A3I J;  4B09 A;  1TC3 C;  3RZD J;  1TWF J;  5KVR A;  1XSV A;  3WTY C;  2DOD A;  2NNN A;  2Y30 A;  1ZRF A;  3LQQ A;  1I6H J;  4UUS A;  1A36 A;  3BTC A;  3OIP A;  4M3G A;  3S2H J;  2XPW A;  1YX3 A;  2VQH A;  3WTX C;  2ID3 A;  4LK1 F;  5HS7 A;  4LB5 A;  5L3F A;  3BT9 A;  3CCJ I;  3T0Y A;  2CW7 A;  2FA5 A;  2JA2 A;  3ZQ7 A;  2JUG A;  5J47 A;  4IL6 C;  2KIS A;  2FD5 A;  4KT5 C;  4S0H B;  1WJA A;  3A02 A;  1A5J A;  1B4A A;  2OC6 A;  2WAF A;  3S8P A;  1TWA J;  3ZMU A;  2KT0 A;  1N77 A;  3V42 A;  3DLL F;  1X1B A;  2PMU A;  2PFB A;  1AHD P;  2DMP A;  3F9K A;  2JMW A;  3HRM A;  3DKY A;  2O5R A;  3G1O A;  4LGW A;  1FOW A;  1MMA A;  2E5N A;  3VFZ A;  3GZN B;  4II3 A;  5JFR A;  1A35 A;  4BDZ A;  1NK2 P;  4S04 A;  2X1C A;  1D5V A;  2XC7 A;  4M6Y A;  2MH2 A;  3O6B B;  4B4C A;  1SAU A;  1W7P B;  1IN7 A;  3EUA A;  4ESJ A;  2XGD A;  3KZZ A;  3ABK H;  4FAS D;  1W5T A;  2GZW A;  1DU0 A;  2EIN H;  2VBY A;  3FM5 A;  3R6S A;  1Y56 A;  3WU1 B;  5L3E A;  5CVI A;  3FXU A;  3CMA I;  3SYT A;  2NS8 A;  3S15 J;  2G7U A;  3PIP F;  2EIJ H;  2MLG A;  4XIC A;  3DPL C;  4P9F A;  3T8T A;  4B1R A;  2STT A;  4XLH A;  3OOU A;  2DO7 A;  5FKO A;  2NVQ J;  2B7E A;  1WKM A;  4RAY A;  5HDK A;  5ILU A;  3ZQI A;  2LSO A;  3W6V A;  3SXY A;  4B8X A;  3L2C A;  2XB5 A;  3ZQQ A;  1T08 B;  4E7I A;  1GVJ A;  4PJ0 C;  2ADU A;  5GPC A;  1MBG A;  5TGT A;  3SDB A;  2CUE A;  3CCE I;  3JCU C;  4OMZ A;  3MZY A;  4BYY A;  1L3L A;  3PNT A;  1BR1 A;  2HYG D;  2M3A A;  1H88 C;  3ABU A;  1K6O A;  4BH9 A;  3D5L A;  2O8X A;  2Z5U A;  3AG4 H;  1G3S A;  2HPM A;  3I55 I;  2JA7 J;  1IAW A;  2WAQ A;  4UUT A;  3UR3 C;  2HI3 A;  4PSW A;  3IH4 A;  3MEX A;  3QRF F;  2KRF A;  3M3Y J;  2V79 A;  3CME I;  2M45 A;  5J6X A;  2L2O A;  2DJI A;  2GXG A;  2DOA A;  3CF5 F;  1L0O C;  2IT0 A;  2ISY A;  2XAG A;  3A0B C;  3GZ5 A;  4NDL A;  1I6X A;  1FT9 A;  4X6A J;  3QPT A;  1QNT A;  2IA0 A;  3R0A A;  2HTS A;  1VQ4 I;  4DOZ A;  4ZTJ A;  3JRF A;  5D4S A;  2HEO A;  1Z77 A;  2UWM A;  3BQY A;  4U0W A;  4MHG A;  4RM3 A;  1MJB A;  2BVM A;  4ON0 A;  2R93 J;  3AG1 H;  3FX3 A;  5IP7 J;  4DW6 A;  3KYD B;  4CCK A;  2EIK H;  2D45 A;  1U0J A;  3PNV A;  9ANT A;  3VYT B;  2O6G E;  4DZJ A;  3ZQF A;  1RES A;  4A5N A;  1YIO A;  5IYB J;  1SMT A;  2ZB9 A;  1QZY A;  1HKT A;  5IYC J;  1BJA A;  4FE4 A;  3L9F A;  4CZZ A;  1JE8 A;  3A03 A;  2JPC A;  3BR6 A;  1RPW A;  1CF7 A;  4ETS A;  4KA4 A;  3WG7 H;  1JJ6 C;  1E3H A;  3BC8 A;  4B48 A;  2EB7 A;  1JGS A;  1UG2 A;  4M73 A;  3HOX J;  1F9N A;  4EJT A;  3C2G A;  2QKM B;  4XKB A;  2TRT A;  3BZC A;  5FJ8 J;  5J1Y A;  3MWM A;  1IGN A;  4NC8 A;  2GQQ A;  3KP5 A;  2L7F P;  2OCC H;  5M5X J;  5D4R A;  1LE8 A;  4BS9 A;  3ROU A;  3W2A A;  4DJA A;  4MGR A;  4KNY A;  2K3F A;  4G6T B;  1EV7 A;  4ENN A;  3RPQ A;  4BBR J;  3B02 A;  4KN4 X;  4R1H A;  4ZYH A;  1RRJ A;  2DAO A;  3CUQ C;  1FLI A;  1JTY A;  1XMX A;  3BR0 A;  3EET A;  1HW2 A;  1R5I D;  4DYC A;  2WBM A;  3DF8 A;  2IP2 A;  4CYC A;  5TJJ A;  1MH3 A;  2QEN A;  2AS5 F;  2ZC2 A;  3EYI A;  1VI0 A;  2QLZ A;  2Y0S N;  3LMM A;  1OCO H;  2VKH A;  2OZ6 A;  5LGT A;  1UHM A;  4HV5 A;  4CCM A;  4S05 A;  2LOO A;  4FQG A;  3H3Z A;  5HOO A;  2HYJ A;  3KFW X;  3IAS 2;  3COA C;  2EIL H;  2WAE A;  3P7N A;  4UUV A;  4A3L J;  2JSC A;  3OR1 C;  1XS9 A;  1X1C A;  1FTZ A;  2LLK A;  2O3F A;  1R1T A;  2ZME C;  1V5E A;  3LST A;  3H3V K;  4RBO A;  2JVH A;  1HOM A;  1IN6 A;  3DBR B;  4LB6 B;  4UVA A;  2EZH A;  4XOR A;  1H9T A;  2JVG A;  2HPI A;  3GTK J;  5LHG A;  4ASN A;  4DBQ A;  5B1A H;  2GA2 A;  4N4O B;  1SFO J;  5FRM A;  1IUY A;  1MMD A;  4MTD A;  3BG3 A;  3K4K A;  3C2H A;  5GAH J;  1U2W A;  1ETK A;  3DQV C;  1XGO A;  3A01 B;  4GYG A;  4UVB A;  2QF7 A;  1Z9C A;  2GLO A;  1WJD A;  2OF7 A;  1IZ1 A;  3SJM A;  3TDU C;  3L1P A;  1WI9 A;  3KET A;  2G9W A;  4Y7N J;  3I4N J;  2P6T A;  2DA3 A;  1FOK A;  1FJL A;  4KT6 A;  1ZRC A;  2W57 A;  4A12 A;  1HW5 A;  2A6H F;  3E6C C;  4UV9 A;  2FJ1 A;  1FBQ A;  2GIV A;  3ZMV A;  2BW3 A;  2ETH A;  3EUH A;  2IXS A;  1YX5 A;  3JTH A;  5CQG A;  3LSR A;  5CYV A;  2LY9 A;  3TMO A;  2LTP A;  3TKY A;  3BG7 A;  3VSK A;  1R5H A;  3L00 A;  1N78 A;  2ZSI B;  3ZQL A;  2DA1 A;  4HF2 A;  2ESH A;  1ZLJ A;  3CCQ I;  1LDJ A;  1ZAR A;  1P4A A;  2KHM A;  2XDV A;  1TQM A;  5CVV A;  4UXN A;  2OV7 A;  3FM3 A;  3IUO A;  4XLC A;  3HJE A;  2EZK A;  4WCG A;  1P4X A;  1YFH A;  2R7Z J;  4KIT B;  1FPQ A;  4O6J A;  4V19 K;  5M3F J;  1J09 A;  3I9V 2;  1KU3 A;  3U21 A;  2VE9 A;  3BTJ A;  3JSP A;  3IP4 B;  1JI8 A;  1IO2 A;  3DEW A;  2ICW G;  3HRU A;  3RTR A;  2R4G A;  1IXS B;  2XHK A;  3WGG A;  3QP5 A;  3H0G J;  3J81 K;  1XMA A;  4KIF A;  4B44 A;  1FOY A;  5LRS A;  1BBY A;  1GDT A;  1IDZ A;  2XKO A;  2M2E A;  5D8K B;  1R7J A;  1SFK A;  4U0V A;  3MKY B;  1OFC X;  3D0S A;  1YO5 C;  2DK8 A;  3LAP A;  4A3E J;  1ZK8 A;  3ZMZ A;  3IL2 A;  1W36 D;  3ZMT A;  3VPR A;  2LY2 A;  4KFC A;  1W5C C;  3S1N J;  4BAC A;  2LMD A;  3E6D A;  4ZH4 F;  2XGE A;  4HOB A;  3AKZ A;  1E2X A;  4M3D A;  2HQN A;  2I8D A;  1MDM A;  1TNS A;  1G3W A;  1Z1D A;  4BHB A;  3M8F A;  3FF5 A;  3CF2 A;  3EPZ A;  4XL9 A;  4HLX A;  3HOU J;  1V55 H;  3FIS A;  4AC0 A;  2N8G A;  3BZ6 A;  4DZP A;  5BNG A;  1F36 A;  3N4M A;  1FNN A;  2LYC A;  1MW7 A;  3JAM Z;  2OQG A;  3HSE A;  1O3R A;  1KON A;  1MBE A;  2QQB A;  3GWZ A;  4G9Y A;  5FD6 A;  3A2K A;  1ZGJ A;  2JN6 A;  2NYX A;  1XPX A;  1LDK B;  3RQ4 A;  2DFI A;  3JRI A;  1Y6I A;  4I99 C;  3GFL A;  3PFY A;  1MZB A;  1FTT A;  2E2I J;  2H8W A;  1VQ8 I;  2HDC A;  5EEG A;  5J3L A;  5JVG F;  1T33 A;  2EIM H;  3AG3 H;  4PJM A;  2A6T A;  2CV0 A;  3WHC A;  2P81 A;  1O4X A;  2O8K A;  2ZJQ F;  4P1W A;  1POG A;  1WJ5 A;  3IWZ A;  2E1O A;  3FXM A;  3ERE D;  1ERD A;  4PK4 A;  3WU0 A;  4ZJZ A;  3HOV J;  1WSU A;  2K9N A;  5DM7 F;  3FKJ A;  4QLC U;  2WWY A;  3BOQ A;  3RPU A;  3FIW A;  1BN5 A;  5FLX Z;  1QVU A;  2CQ7 A;  1ZLK A;  2BXZ A;  3P9K A;  3HPH A;  4C30 A;  1W4M A;  3OYM A;  3WOD F;  5A2Q Z;  1YIJ I;  2DI3 A;  3RZO J;  2CSO A;  2QZ8 A;  3HZJ A;  4CA0 A;  2H1K A;  4A3C J;  2K9Q A;  2W24 A;  3DPT A;  4XRS A;  4ZYD A;  2TCT A;  4XRM A;  2IAI A;  3LOC A;  4RLF A;  1BC7 C;  1C0W A;  1W0T A;  2KL4 A;  2K4J A;  2XUB A;  1XSX A;  2UXX A;  3F72 A;  5K5Q A;  1S5L C;  3CO7 C;  4AIK A;  1RC9 A;  4IPA A;  1T56 A;  4PGH A;  4DIQ A;  4D7M A;  3K70 C;  5JVT A;  3GF2 A;  2CUJ A;  4W1U A;  3ERM A;  1KA8 A;  4HAM A;  4IQ4 A;  4ENJ A;  2D1V A;  3GME A;  3HG9 A;  2O9L A;  2XIG A;  5C4X J;  1LEA A;  1TTY A;  1UJ8 A;  4PCQ A;  1O7F A;  5FD5 A;  3ABM H;  4F93 B;  1ZKG A;  4FE7 A;  2VBX A;  2CG4 A;  4Y4R A;  5HVQ C;  1H8A C;  4Y3O A;  3LFU A;  1BI0 A;  3DKW A;  4PSX A;  4PUS A;  3O8G A;  2CQX A;  2K85 A;  2VQC A;  3ASN H;  3V7C A;  1G59 A;  4RGX A;  1SD5 A;  1Z3X A;  3FMR A;  3NEU A;  5E1W A;  4Z6Y A;  2PX9 A;  3TOB A;  5J4V A;  3EYY A;  3BRO A;  2R5Y B;  5LGN A;  1JT6 A;  2Y0S A;  4BQQ A;  2JTV A;  4L9T A;  3I59 A;  3GFM A;  1V5F A;  1ZRE A;  2QKL B;  1M1E B;  2BGC A;  3GW2 A;  2L9S A;  3SZT A;  1Z7U A;  2XAU A;  1EF4 A;  5HNF A;  1JKO C;  1K4S A;  2PI0 A;  1J5Y A;  2EV0 A;  2FE3 A;  2ELH A;  5EYR A;  1RET A;  4EGZ A;  2ISZ A;  4NC7 A;  1QO0 D;  1QA6 A;  2UV1 A;  4HQM A;  3PQJ A;  5LEJ A;  1G6N A;  2KZV A;  3NRV A;  2JQ7 A;  2V1U A;  2IS2 A;  3G3Z A;  2ZJP F;  4PZJ A;  2KKO A;  1OKR A;  2XV4 S;  1LUJ B;  1RUO A;  4D0P A;  5ICF A;  2P8T A;  1H89 C;  3K9T A;  2MD5 A;  4ABZ A;  3J7Y J;  1KQ0 A;  2CO5 A;  1P92 A;  2F4O B;  4CYC B;  3GLX A;  2RC4 A;  3CES A;  3NQO A;  5FO5 A;  3OYG A;  1V54 H;  1R58 A;  4UUS B;  3SFZ A;  1WJB A;  3OSG A;  1ACI A;  3GZ6 A;  2EBI A;  1K78 A;  4FIS A;  3I0T A;  2VJJ A;  3OIQ A;  1QQI A;  3HHG A;  2KMU A;  4HEA 2;  3SEZ A;  1TWG J;  3L2U A;  2FX0 A;  1RKT A;  2X6Y A;  1X19 A;  2A61 A;  5JI6 A;  3W6K B;  1Y0U A;  4PGG A;  1X3W B;  1QGP A;  1R6R A;  1KU2 A;  4IXA A;  4KMU X;  3FXJ A;  2QSH X;  1HDP A;  2E7X A;  3TP3 A;  2KRH A;  4Y52 J;  4FTH A;  3S3N A;  5H20 A;  5IY5 H;  2DN0 A;  3D1N I;  3DV8 A;  2X6X A;  1HST A;  2X1E A;  1P6R A;  1D0Z A;  2Y31 A;  4E7J A;  4E7L A;  3TL4 X;  2FEZ A;  1OR7 A;  1FYL A;  2P5K A;  3ONQ A;  3AL0 C;  3P9C A;  1FMW A;  2QVO A;  2QYO A;  1HSJ A;  2DMQ A;  5FKL A;  4UVC A;  3K4M A;  4GXO A;  2XSJ C;  4HNT A;  1H0M A;  3PNY A;  1S7O A;  5CVR A;  2ID6 A;  3WTT C;  1BA5 A;  5IT9 Z;  4L0Y B;  1TZL A;  1BR2 A;  3L2R A;  1O3Q A;  2MH9 A;  4RLQ A;  4AD9 A;  5HLH A;  2DW4 A;  1LQ1 A;  3CCV I;  2HGC A;  3ZN1 A;  3M4O J;  2IJL A;  3OYH A;  2F6C A;  3L2W A;  1MIJ A;  2QGU A;  4MEY F;  1VQ9 I;  4RB0 A;  3U9G A;  2V1D A;  3CC4 I;  1S9H A;  2KIQ A;  5E79 C;  4AVP A;  5LHI A;  2EPF A;  1ZTR A;  4GGG A;  5CJ9 A;  1ONV A;  3OYL A;  5FLV A;  5F6F A;  5EF6 A;  3WE3 A;  2V26 A;  5F27 A;  1ODD A;  1IRG A;  3ECO A;  3WGH A;  1XC5 A;  1FIA A;  4XN3 A;  1MGT A;  1PVE A;  2V1N A;  3RSN A;  2VAS A;  3OS0 A;  2P5L C;  2VQL A;  2QQ8 A;  1ZR4 A;  3H36 A;  1XD7 A;  5DS9 A;  2M4K A;  1ITY A;  3I59 B;  1UB9 A;  2MG4 A;  2E71 A;  1VQP I;  1LEB A;  2JUC A;  2R7T A;  1IXR C;  5HLT A;  4A3M J;  2BVL A;  2FNP A;  3LQR A;  1SFE A;  4LMY A;  4F7Z A;  3R61 A;  1EH7 A;  2A5W A;  1MDM B;  2FRH A;  2F4M B;  4ESF A;  1S7A A;  1B59 A;  1S7E A;  3U2R A;  4I01 A;  3QPL A;  3BDD A;  3LFK A;  3FKI J;  1APL C;  2VKE A;  1HA8 A;  4Y17 A;  2R7W A;  2CU7 A;  2CRG A;  2BXY A;  3WTZ A;  5KHD A;  3FMQ A;  4MTE A;  4WXC A;  2EFN A;  3RKY A;  3JRH A;  2P7C B;  1G8X A;  2D1H A;  3QYB A;  3C2B A;  4I0B A;  4AYB N;  3QAH A;  2F5C A;  5ICG A;  2QBY B;  3TED A;  1NTC A;  2Y48 A;  3HOW J;  1SVO A;  3C3W A;  2R7U A;  1ZG5 A;  2XGX A;  1P7J A;  5E18 F;  2FSW A;  2IPQ X;  5AIQ A;  1Z0X A;  1ETX A;  2E35 A;  2VC1 A;  2VJ4 A;  5L3D A;  1STZ A;  1HLV A;  3GTG J;  3ZCO A;  5LEK A;  4CCO A;  4EQQ A;  3PUB A;  2K9L A;  3JRD A;  3F6V A;  3V8K A;  1YG2 A;  3FXL A;  4XRS G;  4XN0 A;  3ZXS A;  1I39 A;  4A93 J;  4NQW A;  1OCC H;  3MN2 A;  3GFI A;  1K61 A;  1R4N B;  5FRN A;  2DTR A;  3OYC A;  3I56 I;  5IT3 A;  4WK8 F;  2CW0 F;  2R3S A;  1MBF A;  3C18 A;  4YII A;  1WH5 A;  4CUG A;  4P96 A;  2V9P A;  2DDA A;  2DT5 A;  2OD5 A;  3G1M A;  4CO8 A;  4ZZL A;  2VIX A;  3CMY A;  1LVK A;  2Z2S B;  3PUF A;  4AU7 A;  1NG7 A;  4AVZ A;  4HNV A;  3ASO H;  1PYV A;  2V9K A;  3MKZ A;  1XDS A;  2MC3 A;  5K7F A;  2ELJ A;  4DBR A;  2OTJ I;  1O7L A;  3BLY A;  4ZDO A;  3G73 A;  2HTJ A;  4EM2 A;  2XF7 A;  1X4P A;  2Y69 H;  3ZPL A;  1J59 A;  1DGW Y;  2P5V A;  1D0Y A;  4G6D A;  3C1D A;  4G7Z F;  1YHQ I;  3CO6 C;  3PJR A;  2K5C A;  5HLG A;  4Q48 A;  2G0E A;  3TW7 A;  3CZ6 A;  5IPA A;  3DCF A;  3DTK A;  1F1Z A;  3OOP A;  2H94 A;  5ICC A;  4IRI A;  1J9I A;  1WJE A;  4CXF A;  1FBS A;  2J5O A;  1SAX A;  3A4C A;  5D8L B;  3JSO A;  4M3B A;  3ZRG A;  1FX7 A;  2YS9 A;  2V1X A;  3ZP5 A;  2KIU A;  3WG9 A;  4N9H A;  4AID A;  3K7A J;  4XOP A;  1TWC J;  1FZP B;  2D5V A;  5AIP A;  2CFO A;  2IA2 A;  2V6C A;  2COB A;  3F6O A;  5J4Y A;  1HQC A;  3S1M J;  2L9N A;  3QP6 A;  2X6W A;  2L0K A;  2W7N A;  3PO2 J;  2X85 A;  3PO3 J;  3HKZ N;  2VXZ A;  2EK5 A;  2CFX A;  3I4P A;  2ELK A;  4E70 A;  5J1U A;  5EGO B;  2OUM A;  2HR3 A;  1IN4 A;  4HQE A;  3CLQ A;  5LLQ A;  1SAN A;  1REP C;  4KYW A;  2Y9Z A;  3E97 A;  3S93 A;  3S2D J;  1J75 A;  1TQI A;  3DPU A;  2HVS A;  1WJC A;  1LPQ A;  5H6R A;  1T6S A;  2QSG X;  2K7L A;  3M8E A;  5EZG A;  5L3B A;  5IT9 K;  1Z05 A;  4BBS J;  4NC6 A;  1MMS A;  3IRR A;  3ESW B;  4ZTF A;  1MNM C;  3U1D A;  1RUN A;  3JR9 A;  2EFQ A;  2BV6 A;  2GIZ A;  1UST A;  1MJA A;  2CYY A;  2VJ5 A;  2KDZ A;  2MLK A;  2DU9 A;  4QWQ A;  1P2F A;  3FXK A;  4MLO A;  4O5V A;  3GLL A;  2JA6 J;  1R4M B;  2EFW A;  3KLO A;  2MYS A;  1ZYR F;  4B43 A;  3Q0V A;  5K7H A;  4ZYA A;  4I2O A;  5J8C A;  3CQZ J;  2VI6 A;  2IRF G;  1X1A A;  3OYF A;  2K40 A;  2DFE A;  2KJC A;  3R0J A;  5CKT A;  1ZR2 A;  1PP8 F;  3BZK A;  4M6X A;  4NUB A;  2DA5 A;  3CC2 I;  4XON A;  4BQN A;  5DD4 A;  1D3Y A;  2J5P A;  3I4M J;  2A07 F;  3E6B A;  4YEJ A;  2I10 A;  1Q1H A;  2VC0 A;  4F52 A;  4JX5 A;  3HUG A;  5DYM A;  4XBF A;  1RI7 A;  2ESN A;  4LG0 A;  2LRD A;  1PUF B;  3K1N A;  4XLA A;  5EZH A;  4A69 C;  3MFK A;  5EG0 A;  3EQL F;  4C2T A;  3V8L A;  1TT5 B;  2XVC A;  3GYH X;  1X3U A;  4H4K C;  2AQF A;  3FHN A;  2FF4 A;  3PL8 A;  3WHB A;  2XKP A;  1B9M A;  3DKX A;  2RGV A;  4A3F J;  5IOY A;  4BE2 A;  3RYP A;  3KP4 A;  3RQI A;  1Y8R B;  3M9A A;  3OL4 A;  1SD7 A;  3VYR B;  4BL0 B;  2VT3 A;  2KDO A;  1MJ9 A;  4MFE A;  4M71 A;  2PBI A;  1GLN A;  5FGM A;  5EG0 B;  4BQA A;  2ZME B;  2CGP A;  4XKC A;  2P0W A;  2H27 A;  1E3O C;  1T95 A;  3GVA A;  2R7D A;  3HUG B;  3P5J A;  4AUX A;  1PUF A;  2NOJ B;  4LIU A;  1P9Q C;  3QOD A;  3BY6 A;  4OOI A;  5M3M J;  1GV2 A;  1QPI A;  4CGZ A;  2B9S A;  2M7A A;  3BR5 A;  3F8M A;  3VYS B;  4BJ5 C;  2AQE A;  3BG9 A;  2XSD C;  1ZAO A;  3HDD A;  2E1M C;  3QYE A;  1HDD C;  4IHV A;  2F2E A;  3J7A O;  2W25 A;  3ELK A;  4ENM A;  4MIM A;  2PJR B;  3F8C A;  2L02 A;  2K3P A;  2L3D A;  2NNY A;  1VND A;  2ZKZ A;  4BE0 A;  5L3C A;  2XPU A;  2EFO A;  1RR8 C;  3DWL E;  5C3E J;  4IOA F;  1WHU A;  3I54 A;  1U9N A;  2XRL A;  5J1R A;  2FNA A;  4I7H A;  3SZG A;  3OYI A;  2KJB A;  1OYI A;  3TW6 A;  1MNE A;  4OWR B;  5FKM A;  4E7H A;  4YFX F;  1QZZ A;  4NQW B;  3V7S A;  3SHF A;  1A6I A;  4BGD A;  1K7A A;  2RQP A;  4CCJ A;  4XSX F;  4RS8 A;  1SD6 A;  1A04 A;  3CJT B;  2BHY A;  2MD0 A;  1ETW A;  1X1P A;  3TO6 A;  3CUO A;  1VQN I;  1EKE A;  1TP4 A;  1FC3 A;  5IYD J;  5H6Q A;  2GAU A;  2HQR A;  2XPV A;  3DU5 A;  4HST A;  2ECC A;  4MO7 A;  3K1M A;  3RKW A;  4RAZ A;  5H2F C;  4BXX J;  2AXT C;  1AKH B;  3RDI A;  4WF2 A;  2XAF A;  3TBI A;  3LA3 A;  3LSJ A;  4D1Q A;  4KIG A;  4BEH A;  5GTH C;  2L4A A;  3J80 K;  2WA0 A;  1ZGA A;  1HCR A;  1OYY A;  3IHU A;  3K4N A;  2QCO A;  3AL0 B;  1K4T A;  3KP2 A;  5ED4 A;  4A3D J;  1DP3 A;  4WWC A;  1HW1 A;  2MGQ A;  5F0H A;  1FSE A;  3BP8 A;  4YFN F;  1EJ9 A;  2EA2 A;  2ACJ A;  1A6Q A;  3F0C A;  3ZOB A;  1D1A A;  1FIP A;  1K78 B;  1IUF A;  1LFB A;  4E7K A;  4IVN A;  1X3Z B;  1W7P D;  2CW8 A;  1ETY A;  4OMY A;  1KQ8 A;  3H3U A;  2MBF A;  3OMY A;  2L01 A;  4AWX B;  1XG1 A;  1EA3 A;  3LL7 A;  1S72 I;  5DCM A;  4HYE A;  4HZF A;  1XX5 A;  1U8R A;  2P4W A;  5B5E C;  4PJJ A;  4EJV A;  4QPQ A;  2DQR A;  3QWL A;  3ML6 A;  4BXU A;  2NRA C;  3W2W A;  3F3X A;  4L5J A;  2F5F A;  2M0M A;  5E8I A;  1WJF A;  3GUD A;  1XN7 A;  2LDU A;  4HF1 A;  2VXD A;  2VKV A;  3H92 A;  3TO9 A;  2E5Z A;  1R00 A;  1X2M A;  1JUS A;  1NHA A;  3IH2 A;  3OYA A;  1B1B A;  4BHP A;  3BR2 A;  3QPH A;  4L0Z B;  4AYB A;  2KQR A;  2FBI A;  5DUK A;  3CCY A;  3O2P E;  4X0G A;  3GTP J;  1IV8 A;  2RKH A;  1YJN I;  1UFM A;  2A5Y B;  2QEX I;  3M07 A;  3REO A;  2DPD A;  2DMU A;  1BOA A;  1GXQ A;  2YUS A;  4LLL A;  1OLT A;  4A0Y A;  4A6D A;  1NH3 A;  2CS3 A;  5GP9 A;  2XAQ A;  4ZC3 A;  5F1R A;  1UCR A;  2DJN A;  3V8J A;  2LKX A;  2QQ9 A;  2ZXH A;  4QIW N;  2BY1 A;  4U88 A;  2M0C A;  1JUM A;  1UHW A;  4DYR A;  2LNB A;  4B47 A;  2HS5 A;  1YS6 A;  2YPR A;  2LG4 A;  4XSZ F;  4U7D A;  1GHC A;  5F1J A;  2VLA A;  2E60 A;  2H1L A;  1OCR H;  4BKX A;  3CCU I;  4IF4 A;  5BQT A;  3H9Q A;  2IVM A;  4DQ2 A;  1OPC A;  3VOD A;  1R22 A;  3LSP A;  4IRH A;  3K2Z A;  1BIB A;  5B3S H;  3RYR A;  3AAF A;  1I3Q J;  3M1C A;  2XAS A;  2DLL A;  3F21 A;  3SFI A;  1VQ5 I;  2QM3 A;  2L5Q A;  3FXQ A;  3H9G A;  2LF7 A;  5K1Y A;  3AFH A;  3VOE A;  3BWG A;  5KCM A;  4Y15 A;  1YRN A;  1BI3 A;  3CCR I;  2VQG A;  2BZT A;  2E1N A;  2CV2 A;  1N25 A;  4B3A A;  3CJR B;  4IEJ A;  1E0E A;  4BAY A;  2FBH A;  3CMM A;  4MFD A;  3S14 J;  1B72 A;  1YW7 A;  2EZL A;  4QSH A;  4R8H A;  5IP6 A;  1IN5 A;  2FUG 2;  3CJQ B;  2KIM A;  1Y0N A;  4RM2 A;  1KZH A;  2CUF A;  2HWV A;  3GTO J;  4HBL A;  2OBP A;  1PDN C;  1WFX A;  1A31 A;  4UV8 A;  1VFC A;  1YS7 A;  1LB2 A;  2YX7 A;  3OV8 A;  6PAX A;  1HKQ A;  3E5X A;  3PFI A;  4GRI A;  1JKR C;  1AU7 A;  1ON2 A;  3H0D A;  3UNG C;  2WB1 N;  3DP7 A;  1YE9 A;  2WTE A;  2HDW A;  3W2V A;  3OS1 A;  5GAE J;  4MQ9 F;  2DA7 A;  2F5D A;  1D1B A;  2LFB A;  2V4J C;  5E1X A;  4Y33 A;  4X1E A;  3BCB A;  4EM0 B;  2BBY A;  1JHH A;  3B6C A;  2E2H J;  5F64 A;  4RAF A;  3VEP A;  2Q2E B;  2IGN A;  1GT0 C;  4EV0 A;  2JRM A;  1VQ7 I;  4HDV A;  3IAM 2;  3JRG A;  2KRC A;  4IO9 F;  2ZSH B;  2ZNZ A;  4CZC A;  2O0Y A;  4XMY A;  3F22 A;  2R5Z B;  2W1O A;  1SMY F;  3DU6 A;  3TO7 A;  2QQA A;  1WWX A;  4J00 A;  1IW7 F;  1DPU A;  2NOG A;  3OYJ A;  4IJA A;  2RV8 A;  1D8K A;  4WX9 A;  1TW3 A;  3KEO A;  3ULQ B;  4BU2 A;  1VZ0 A;  1MSF C;  2LVS A;  4ESB A;  1AA7 A;  2HVR A;  3KE2 A;  1FSH A;  1YJW I;  1IJW C;  3SQN A;  3BQZ A;  3J80 Z;  4BHC A;  3BR1 A;  1J7K A;  5JR3 A;  1KU7 A;  4IHS A;  1FEX A;  1VQ6 I;  2M8E A;  1R49 A;  2R7X A;  4LG3 A;  3RJP A;  3DTE A;  3RIR A;  2M87 A;  1QVT A;  1Y1V J;  2BY2 A;  3DEU A;  3GFJ A;  2DXI A;  4JK1 X;  4HLY A;  3FK7 A;  1QRY A;  1LNW A;  3HYI A;  3DFG A;  4A5M A;  4BY7 J;  1U6G A;  2K9M A;  1TL8 A;  1JGG A;  3MQ0 A;  3Q3S A;  5ICE A;  3O8H A;  4DYQ A;  4JP0 A;  4A6E A;  1DP7 P;  2FQ4 A;  5ILS A;  3HOS A;  1DGR M;  3ABT A;  3ECH A;  3PSF A;  2JK3 A;  4L9N A;  5LD2 C;  1SFX A;  2HU9 A;  1Y39 A;  2JJ7 A;  5F08 A;  4N4N B;  3L2V A;  3F8N A;  4M9Z A;  1P7I A;  5JLW A;  3M8J A;  3NAR A;  2STW A;  3Q0U A;  2M30 A;  2K9S A;  2LP0 A;  3DXJ F;  1GXP A;  1MND A;  3BJA A;  1R23 A;  4OIN F;  5BOX A;  2X48 A;  2BY3 A;  4DNC A;  1U5T A;  2L9V A;  2M34 A;  3U1K A;  5GAG J;  2EFP A;  1HXD A;  3FMS A;  2LC2 A;  5HNH A;  3CDH A;  2PLY A;  4JQF A;  1U3E M;  1FY7 A;  5HLI A;  1V3F A;  5DD8 A;  4RB3 C;  2DPU A;  4HV6 A;  4GO1 A;  1BIA A;  1D1C A;  5K5O A;  4EGY A;  1R1V A;  1E3P A;  1KQ9 A;  3OYE A;  2CJJ A;  1SD4 A;  1DQU A;  1QZE A;  2Z3Y A;  4E6K G;  1S8N A;  3IH3 A;  3QQA A;  2OU2 A;  3ZN0 A;  3MMY B;  2PQ8 A;  3FBI B;  5IOZ A;  2OTL I;  2LBF B;  1LFP A;  5E3M A;  2DA6 A;  4RA2 A;  2OCE A;  4HNU A;  1B8I B;  2R7V A;  2GOM A;  1ON1 A;  3KIO A;  5B66 C;  5ILV A;  1W7P A;  5EDN A;  3LSG A;  4FHT A;  1T38 A;  4KMF A;  1JKP C;  1S6L A;  2XF5 A;  2Q2E A;  2VBZ A;  1SVM A;  1ETV A;  4ZDP A;  4EJU A;  2VON A;  2PJP A;  1FOX A;  4N0B A;  3K70 D;  2JSP A;  4II2 A;  3E5Q A;  1IRZ A;  1T39 A;  1XGN A;  1BM9 A;  2D2W A;  4G6Q A;  5IP9 J;  1SVL A;  3WE2 A;  4E4H A;  4RGR A;  5GPA A;  4GFB A;  4W97 A;  4J01 A;  1XGM A;  3S1R J;  3JTG A;  2LD5 A;  2VOO A;  3MD2 A;  2DCE A;  2YSR A;  3R60 A;  4G8X A;  4EM1 A;  4ENK A;  2Y75 A;  3GBG A;  2EJR A;  1F5T A;  3K69 A;  3T1B A;  4LK0 F;  3SEQ A;  4BXF A;  2W82 A;  2CWE A;  1JJ8 C;  2YR2 A;  1FMV A;  5DUI A;  3JRC A;  3KZY A;  4OIQ F;  2ZO4 A;  3B73 A;  4IHT A;  1BJZ A;  2Y9Y A;  4RDU A;  1R36 A;  3CUQ B;  2EV6 A;  3I64 A;  1FYK A;  4EAT A;  2HOT A;  4AIH A;  1WCM J;  3E0J B;  1WI3 A;  2UUZ A; 
#chains in the Genus database with same CATH homology
 1PP7 U;  1R5G A;  3FXR A;  4NB5 A;  4OIP F;  4EVI A;  1T0F A;  2E1C A;  3HRS A;  2PN6 A;  2A3S A;  1BC8 C;  1YW8 A;  5ERI A;  1K79 A;  1G4D A;  2RVC A;  3FHZ A;  5K5R A;  2A6E F;  2WV0 A;  5CLS A;  4G94 A;  4KIB A;  4YIF A;  4HX4 A;  2HYF A;  3RI4 A;  1KYW A;  3TOA A;  1XDU A;  3MCZ A;  4KN7 X;  4A0Z A;  3KP3 A;  2WC2 A;  3EDP A;  4ZYE A;  5AON A;  3KLN A;  4MNU A;  3KP7 A;  3M7G A;  3BPV A;  4O3M A;  2ZJ2 A;  3F8F A;  3HHH A;  3V7R A;  3QU6 A;  2O61 A;  3I53 A;  2PG4 A;  3K0L A;  1O3T A;  2H09 A;  1T2K A;  1DUX C;  2TDX A;  4RGU A;  2PEX A;  1VTN C;  5FLX K;  4XLN F;  2YX4 A;  4M9X A;  1JHF A;  4M74 A;  3WTU C;  4HW0 A;  3WGI A;  5J8F A;  2GXB A;  1Z6R A;  1ZH5 A;  1XMK A;  4M72 A;  1DPR A;  1ZG1 A;  1J0R A;  2OA4 A;  5FFZ A;  2QBY A;  2GWR A;  4CDG A;  3FZV A;  4JBA A;  1XGS A;  4WXD A;  5D6F A;  5E1Z B;  3ZMD A;  2Z33 A;  5D5V B;  1KU9 A;  4Q4Z F;  2ZXJ A;  1YQA A;  5DCF A;  2VBW A;  1TQP A;  1O3S A;  3Q5F A;  2ZFW A;  3Q9S A;  1O57 A;  4GYI A;  3C7J A;  5HS8 A;  2OAZ A;  4HDU A;  5CVJ A;  1R1U A;  2NS0 A;  2EA4 A;  2JT1 A;  3ZMS A;  5HS9 A;  1ZG3 A;  1LDD A;  3GX4 X;  4MEX F;  2FMY A;  4EJO A;  4ZZD A;  4Z2Y A;  3FWE A;  1H9G A;  1RZ4 A;  2FBK A;  3BJO A;  1HKS A;  1KGS A;  1TW2 A;  4NHJ A;  3ISP A;  1OYW A;  3E6M A;  3WTW C;  4M9S A;  2BEO A;  3I71 A;  4N9I A;  2COM A;  4YFK F;  2Q8K A;  3MAJ A;  5DV5 A;  2CQK A;  1I1S A;  2MA3 A;  2L54 A;  5TRD A;  4P9U A;  3LA7 A;  2K86 A;  2HZT A;  5CVU A;  5BMZ A;  4EMS A;  3TGN A;  2AXL A;  1B9N A;  3QU3 A;  5BPI A;  2OZU A;  2X4H A;  1TBX A;  4Y13 A;  1FBU A;  4BNC A;  2Z99 A;  3WTV C;  5JHU A;  4EJW A;  1AOY A;  1ZN2 A;  1WRJ A;  4HF0 A;  5FB2 A;  2F5E A;  3IRQ A;  4GCV A;  1Z91 A;  4CHU A;  2KIF A;  1FYM A;  3GEZ A;  2ZBK A;  1P4W A;  4YG2 F;  3F23 A;  2QWW A;  4UHT A;  5FFX A;  2HKO A;  1LJ9 A;  4H0E A;  3HRT A;  4ZYG A;  2A69 F;  2LKP A;  3P9I A;  1I5Z A;  3R4K A;  2G7H A;  3KEQ A;  4LJZ F;  5HDN A;  4RB1 A;  3VB2 A;  2DK5 A;  3LWF A;  3F8B A;  2VE8 A;  1FWZ A;  5DCM B;  1DDN A;  3KCC A;  2Z9O A;  2JPB A;  4UNO A;  5DEQ A;  2K27 A;  4XRF A;  4P5O A;  1RNL A;  5BS6 A;  2VOP A;  3N97 A;  5KK1 A;  2LF8 A;  1G3T A;  2Q0O A;  4G7O F;  1TLH B;  5D5U B;  3S2W A;  3HTS B;  1XB4 A;  2B0L A;  2RNJ A;  1S3J A;  2VOD A;  3L09 A;  1I27 A;  1V4R A;  2IA1 A;  1XCV A;  3IKV A;  4LLN A;  2ZME A;  5E17 F;  1YTY A;  2JRT A;  2ZNY A;  2BYV E;  1EH6 A;  2YU3 A;  5LHH A;  3KP6 A;  5DDG A;  1FP2 A;  1AWC A;  4U0Y A;  1Z6T A;  2NAZ A;  5LRR A;  1QPM A;  3LA2 A;  1ZHF A;  3HOT A;  2DQL A;  4CIC A;  3BPX A;  3SZP A;  3V4G A;  4AIJ A;  4P55 A;  1U5T C;  3E5U A;  1B6A A;  2VN2 A;  5E20 A;  1USS A;  3M1E A;  2OQR A;  2XAH A;  4A2U A;  3CJN A;  2M5W A;  1IN8 A;  2XAJ A;  1QBJ A;  2FML A;  2L4M A;  4U7B A;  5A2Q K;  4LLG F;  2GA1 A;  2W84 A;  3HIF A;  2DBB A;  2VT2 A;  4WXH A;  4R79 A;  4RB2 C;  2H6B A;  5EEH A;  3MZH A;  2V9V A;  3T5X A;  2IW5 A;  2HFH A;  2R7F A;  3I5U A;  1SFU A;  1E17 A;  4FX0 A;  1XSD A;  5D6E A;  4L9J A;  4CYD A;  1W5S A;  1U5T B;  4TV7 A;  2UXN A;  5E8G A;  3CTA A;  3J81 Z;  3RKX A;  5D5W B;  2O03 A;  1FP1 D;  4HX7 A;  1BI2 A;  1XCB A;  4IRG A;  3TDZ C;  1CGP A;  1EH8 A;  4KDP A;  2FOK A;  4FT8 A;  4Q47 A;  5HDG A;  1WQ2 A;  2FQ3 A;  2FXA A;  3W6J B;  2EWN A;  2EV5 A;  2X0L A;  3GO5 A;  1MKM A;  4KIC A;  5D5X B;  2C6Y A;  4MQV A;  4LFU A;  3L7W A;  1U78 A;  3T8R A;  4HX8 A;  4XLP F;  1HBX G;  1MD0 A;  2P7V B;  4PDK A;  5L3G A;  4OIO F;  1OMI A;  3O3K A;  2BE5 F;  2HKX A;  1F4K A;  5LGU A;  1YYV A;  2K4B A;  4A0X A;  4LD5 A;  3K1P A;  1YLF A;  2A68 F;  5LBQ A;  3GXO A;  1CF7 B;  2QUF A;  1JXS A;  1PUE E;  2UZK A;  4L9V A;  2K02 A;  1RIO H;  4I02 A;  5BPD A;  2JZY A;  3JW4 A;  1IXC A;  1ZRD A;  1T98 A;  2Y0M A;  4OIR F;  3WTS C;  1KYZ A;  4KUM A;  2H6C A;  3CUQ A;  4OU0 A;  2FU4 A;  3IWF A;  4LG0 B;  3HSF A;  3E3V A;  2XRO A;  2P6S A;  3HTU A;  4I98 B;  3CLO A;  3I58 A;  4I0A A;  2W85 A;  2M1B A;  3PQK A;  4I09 A;  1ULY A;  2XRN A;  1YW9 A;  2HOE A;  4G7H F;  4RGS A;  3TQN A;  1S29 A;  1IRF A;  4K2E A;  1D8J A;  3LAJ A;  2RN7 A;  1J2X A;  1I1G A;  3IC7 A;  3JAM K;  1TNT A;  4L18 B;  3HSR A;  4FX4 A;  1LVA A;  2RDP A;  4L5I A;  3QOP A;  2ZCW A;  4Q5S F;  3IKT A;  2E7W A;  1BI1 A;  3BJ6 A;  4HA8 A;  2PMH A;  1G3Y A;  3Q9V A;  4B09 A;  5KVR A;  1XSV A;  3WTY C;  2NNN A;  1ZRF A;  3LQQ A;  3WTX C;  4LK1 F;  5HS7 A;  4LB5 A;  5L3F A;  3T0Y A;  2FA5 A;  3ZQ7 A;  4KT5 C;  1B4A A;  3ZMU A;  2PMU A;  2PFB A;  3HRM A;  4LGW A;  3VFZ A;  5JFR A;  4S04 A;  1D5V A;  4M6Y A;  2MH2 A;  3O6B B;  1W7P B;  1IN7 A;  4ESJ A;  3KZZ A;  1W5T A;  2GZW A;  2VBY A;  3FM5 A;  3R6S A;  3WU1 B;  5L3E A;  5CVI A;  3FXU A;  2G7U A;  2MLG A;  3DPL C;  4P9F A;  3T8T A;  2STT A;  2DO7 A;  1WKM A;  4RAY A;  5HDK A;  5ILU A;  2LSO A;  3SXY A;  4B8X A;  3L2C A;  1GVJ A;  2ADU A;  4OMZ A;  3MZY A;  4BYY A;  1L3L A;  2HYG D;  3ABU A;  1K6O A;  4BH9 A;  3D5L A;  2O8X A;  2Z5U A;  1G3S A;  1IAW A;  3MEX A;  3QRF F;  2KRF A;  2V79 A;  2M45 A;  5J6X A;  2GXG A;  1L0O C;  2IT0 A;  2ISY A;  2XAG A;  3GZ5 A;  1I6X A;  1FT9 A;  3QPT A;  1QNT A;  2IA0 A;  3R0A A;  2HTS A;  5D4S A;  2HEO A;  2UWM A;  4U0W A;  4MHG A;  1MJB A;  4ON0 A;  3FX3 A;  2D45 A;  2O6G E;  4A5N A;  1YIO A;  1SMT A;  1HKT A;  1QZY A;  1BJA A;  3L9F A;  4CZZ A;  1JE8 A;  2JPC A;  1CF7 A;  4ETS A;  4KA4 A;  2EB7 A;  1JGS A;  4M73 A;  1F9N A;  4EJT A;  3MWM A;  2GQQ A;  3KP5 A;  5D4R A;  3ROU A;  4MGR A;  4KNY A;  1EV7 A;  4ENN A;  3RPQ A;  3B02 A;  4KN4 X;  4R1H A;  4ZYH A;  2DAO A;  3CUQ C;  1FLI A;  3EET A;  1HW2 A;  3DF8 A;  2IP2 A;  5TJJ A;  2QEN A;  2AS5 F;  3EYI A;  2QLZ A;  2OZ6 A;  5LGT A;  1UHM A;  4HV5 A;  4S05 A;  3H3Z A;  5HOO A;  3COA C;  3P7N A;  4UUV A;  2JSC A;  2O3F A;  1R1T A;  3LST A;  1IN6 A;  4LB6 B;  4UVA A;  1H9T A;  5LHG A;  4ASN A;  2GA2 A;  1IUY A;  4MTD A;  1U2W A;  3DQV C;  1XGO A;  4GYG A;  4UVB A;  1Z9C A;  1IZ1 A;  3TDU C;  1WI9 A;  3KET A;  2G9W A;  2P6T A;  1FOK A;  1ZRC A;  2W57 A;  4A12 A;  1HW5 A;  2A6H F;  3E6C C;  4UV9 A;  1FBQ A;  2GIV A;  3ZMV A;  2ETH A;  3EUH A;  3JTH A;  5CYV A;  3TKY A;  1R5H A;  3L00 A;  4HF2 A;  2ESH A;  1ZLJ A;  1LDJ A;  1ZAR A;  1P4A A;  1TQM A;  5CVV A;  4UXN A;  3FM3 A;  4WCG A;  1P4X A;  1YFH A;  1FPQ A;  4O6J A;  1KU3 A;  2VE9 A;  3JSP A;  3HRU A;  3RTR A;  1IXS B;  2XHK A;  3WGG A;  3QP5 A;  3J81 K;  1XMA A;  4KIF A;  5LRS A;  1BBY A;  2XKO A;  5D8K B;  1R7J A;  4U0V A;  3D0S A;  1YO5 C;  2DK8 A;  3LAP A;  3IL2 A;  3ZMZ A;  3ZMT A;  4KFC A;  3E6D A;  4ZH4 F;  4HOB A;  1E2X A;  2HQN A;  1MDM A;  1TNS A;  1G3W A;  1Z1D A;  4BHB A;  3M8F A;  3FF5 A;  4HLX A;  3BZ6 A;  3N4M A;  1FNN A;  3JAM Z;  2OQG A;  3HSE A;  1O3R A;  2QQB A;  3GWZ A;  4G9Y A;  5FD6 A;  1ZGJ A;  2NYX A;  1LDK B;  2DFI A;  3GFL A;  1MZB A;  2HDC A;  5EEG A;  3IWZ A;  3ERE D;  3WU0 A;  1WSU A;  4QLC U;  2WWY A;  3BOQ A;  3RPU A;  1ZLK A;  1BN5 A;  5FLX Z;  3P9K A;  1W4M A;  3WOD F;  5A2Q Z;  2DI3 A;  2CSO A;  2QZ8 A;  2W24 A;  3DPT A;  4ZYD A;  1BC7 C;  1C0W A;  2K4J A;  2XUB A;  1XSX A;  2UXX A;  3F72 A;  5K5Q A;  3CO7 C;  4AIK A;  4IPA A;  4PGH A;  5JVT A;  3GF2 A;  1KA8 A;  4HAM A;  4ENJ A;  2D1V A;  2XIG A;  1LEA A;  1TTY A;  4PCQ A;  1O7F A;  5FD5 A;  2VBX A;  2CG4 A;  5HVQ C;  1BI0 A;  3DKW A;  3V7C A;  4RGX A;  1SD5 A;  3FMR A;  3NEU A;  5E1W A;  3TOB A;  3EYY A;  3BRO A;  5LGN A;  2JTV A;  4L9T A;  3I59 A;  3GFM A;  1ZRE A;  2BGC A;  3GW2 A;  3SZT A;  1Z7U A;  2PI0 A;  1J5Y A;  2EV0 A;  2FE3 A;  2ELH A;  4EGZ A;  2ISZ A;  1QO0 D;  5LEJ A;  4HQM A;  2V1U A;  3PQJ A;  1G6N A;  3NRV A;  3G3Z A;  4PZJ A;  2KKO A;  1OKR A;  2XV4 S;  1RUO A;  4D0P A;  5ICF A;  2P8T A;  3K9T A;  2MD5 A;  1KQ0 A;  2CO5 A;  1P92 A;  3GLX A;  2RC4 A;  3NQO A;  5FO5 A;  1R58 A;  3SFZ A;  3GZ6 A;  1K78 A;  3I0T A;  1QQI A;  3HHG A;  2A61 A;  5JI6 A;  3W6K B;  1Y0U A;  4PGG A;  1QGP A;  1KU2 A;  4IXA A;  4KMU X;  2E7X A;  5H20 A;  3DV8 A;  1HST A;  1P6R A;  2FEZ A;  1OR7 A;  1FYL A;  2P5K A;  3P9C A;  2QVO A;  2QYO A;  1HSJ A;  4UVC A;  4GXO A;  1H0M A;  1S7O A;  5CVR A;  3WTT C;  5IT9 Z;  4L0Y B;  1O3Q A;  2MH9 A;  4AD9 A;  5HLH A;  2DW4 A;  1LQ1 A;  2HGC A;  3ZN1 A;  2IJL A;  4MEY F;  4RB0 A;  3U9G A;  2V1D A;  4AVP A;  5LHI A;  4GGG A;  5CJ9 A;  1ONV A;  5F6F A;  3WE3 A;  1ODD A;  1IRG A;  3ECO A;  3WGH A;  1MGT A;  2P5L C;  1XD7 A;  3I59 B;  1UB9 A;  1LEB A;  1IXR C;  2FNP A;  3LQR A;  1SFE A;  4LMY A;  4F7Z A;  3R61 A;  1EH7 A;  1MDM B;  2FRH A;  4ESF A;  1S7A A;  1B59 A;  3U2R A;  4I01 A;  3BDD A;  3LFK A;  4Y17 A;  3WTZ A;  3FMQ A;  4MTE A;  4WXC A;  2EFN A;  3RKY A;  2P7C B;  2D1H A;  4I0B A;  5ICG A;  3QAH A;  2F5C A;  2QBY B;  2Y48 A;  3C3W A;  1ZG5 A;  2XGX A;  5E18 F;  2FSW A;  2IPQ X;  5AIQ A;  2VC1 A;  5L3D A;  1STZ A;  5LEK A;  4EQQ A;  3F6V A;  3V8K A;  1YG2 A;  4NQW A;  3GFI A;  2DTR A;  5IT3 A;  4WK8 F;  2CW0 F;  2R3S A;  3C18 A;  4YII A;  4P96 A;  2DT5 A;  2OD5 A;  4CO8 A;  4ZZL A;  1XDS A;  2MC3 A;  1O7L A;  3G73 A;  2HTJ A;  4EM2 A;  3ZPL A;  1J59 A;  2P5V A;  4G6D A;  4G7Z F;  3C1D A;  3CO6 C;  5HLG A;  4Q48 A;  1F1Z A;  3OOP A;  2H94 A;  5ICC A;  4IRI A;  1J9I A;  4CXF A;  1FBS A;  2J5O A;  1SAX A;  5D8L B;  3JSO A;  1FX7 A;  2V1X A;  3ZP5 A;  2KIU A;  3WG9 A;  4N9H A;  1FZP B;  5AIP A;  2IA2 A;  2V6C A;  3F6O A;  1HQC A;  3QP6 A;  2VXZ A;  2EK5 A;  2CFX A;  3I4P A;  4E70 A;  2HR3 A;  1IN4 A;  4HQE A;  5LLQ A;  1REP C;  4KYW A;  3E97 A;  1J75 A;  1TQI A;  5H6R A;  1T6S A;  2K7L A;  3M8E A;  5L3B A;  5IT9 K;  1Z05 A;  3IRR A;  3U1D A;  1RUN A;  2EFQ A;  2BV6 A;  1UST A;  1MJA A;  2CYY A;  2MLK A;  2DU9 A;  4QWQ A;  1P2F A;  4O5V A;  2EFW A;  3KLO A;  1ZYR F;  4I2O A;  5J8C A;  2IRF G;  2KJC A;  3R0J A;  1PP8 F;  4M6X A;  5DD4 A;  1D3Y A;  2J5P A;  2A07 F;  3E6B A;  1Q1H A;  2VC0 A;  3HUG A;  5DYM A;  4XBF A;  1RI7 A;  2ESN A;  4LG0 A;  3K1N A;  3MFK A;  3EQL F;  3V8L A;  2XVC A;  3GYH X;  1X3U A;  2FF4 A;  2XKP A;  1B9M A;  2RGV A;  3RYP A;  3KP4 A;  3M9A A;  1SD7 A;  2VT3 A;  1MJ9 A;  4M71 A;  2PBI A;  5FGM A;  4BQA A;  2ZME B;  2CGP A;  2H27 A;  3GVA A;  2R7D A;  3BY6 A;  4OOI A;  4CGZ A;  3F8M A;  1ZAO A;  2F2E A;  3J7A O;  2W25 A;  3ELK A;  4ENM A;  3F8C A;  2L02 A;  2NNY A;  2L3D A;  2ZKZ A;  5L3C A;  2EFO A;  3I54 A;  2FNA A;  4I7H A;  2KJB A;  1OYI A;  4YFX F;  1QZZ A;  3V7S A;  3SHF A;  1K7A A;  2RQP A;  4XSX F;  4RS8 A;  1SD6 A;  1A04 A;  3TO6 A;  3CUO A;  1FC3 A;  5H6Q A;  2GAU A;  2HQR A;  3K1M A;  3RKW A;  4RAZ A;  3RDI A;  4WF2 A;  2XAF A;  3LA3 A;  4KIG A;  3J80 K;  2L4A A;  1ZGA A;  1OYY A;  3IHU A;  3KP2 A;  5ED4 A;  4WWC A;  1HW1 A;  1FSE A;  3BP8 A;  4YFN F;  2EA2 A;  2ACJ A;  1K78 B;  4IVN A;  1W7P D;  4OMY A;  1KQ8 A;  3H3U A;  2MBF A;  4AWX B;  2L01 A;  5DCM A;  4HYE A;  4HZF A;  1U8R A;  2P4W A;  4EJV A;  2DQR A;  3ML6 A;  2NRA C;  4BXU A;  3F3X A;  4L5J A;  2F5F A;  5E8I A;  3GUD A;  1XN7 A;  2LDU A;  4HF1 A;  3H92 A;  3TO9 A;  1R00 A;  1NHA A;  1B1B A;  4BHP A;  3QPH A;  4L0Z B;  2FBI A;  5DUK A;  3O2P E;  2RKH A;  1UFM A;  2A5Y B;  3REO A;  2DPD A;  1BOA A;  1GXQ A;  4LLL A;  4A0Y A;  4A6D A;  2XAQ A;  5F1R A;  1UCR A;  3V8J A;  2QQ9 A;  4U88 A;  1UHW A;  2LNB A;  2HS5 A;  1YS6 A;  2YPR A;  4XSZ F;  1GHC A;  4U7D A;  4IF4 A;  5BQT A;  2IVM A;  4DQ2 A;  1OPC A;  3VOD A;  1R22 A;  4IRH A;  3K2Z A;  1BIB A;  3RYR A;  3AAF A;  2XAS A;  2DLL A;  3F21 A;  2QM3 A;  3FXQ A;  2LF7 A;  5K1Y A;  3VOE A;  3BWG A;  4Y15 A;  1BI3 A;  2E1N A;  4BAY A;  2FBH A;  1YW7 A;  4R8H A;  1IN5 A;  2KIM A;  2HWV A;  4HBL A;  2OBP A;  1PDN C;  4UV8 A;  1YS7 A;  1LB2 A;  2YX7 A;  3OV8 A;  6PAX A;  1HKQ A;  3E5X A;  3PFI A;  1ON2 A;  3DP7 A;  2WTE A;  4MQ9 F;  2F5D A;  5E1X A;  4EM0 B;  2BBY A;  1JHH A;  5F64 A;  3VEP A;  4EV0 A;  4HDV A;  2ZNZ A;  2O0Y A;  3F22 A;  1SMY F;  3TO7 A;  2QQA A;  1WWX A;  1IW7 F;  1DPU A;  4IJA A;  2RV8 A;  1D8K A;  4WX9 A;  1TW3 A;  3KEO A;  3ULQ B;  4ESB A;  3KE2 A;  1FSH A;  3SQN A;  3J80 Z;  4BHC A;  1J7K A;  5JR3 A;  1KU7 A;  4IHS A;  2M8E A;  3RJP A;  3RIR A;  2M87 A;  3DEU A;  3GFJ A;  4JK1 X;  4HLY A;  1LNW A;  3HYI A;  3DFG A;  4A5M A;  1U6G A;  3MQ0 A;  5ICE A;  4A6E A;  1DP7 P;  5ILS A;  3HOS A;  3ABT A;  3ECH A;  4L9N A;  1SFX A;  3F8N A;  4M9Z A;  2STW A;  2M30 A;  3DXJ F;  1GXP A;  3BJA A;  1R23 A;  4OIN F;  5BOX A;  4DNC A;  1U5T A;  2EFP A;  1HXD A;  3FMS A;  3CDH A;  2PLY A;  4JQF A;  1U3E M;  1FY7 A;  5HLI A;  1V3F A;  5DD8 A;  4RB3 C;  2DPU A;  4HV6 A;  4GO1 A;  1BIA A;  5K5O A;  4EGY A;  1R1V A;  1KQ9 A;  1SD4 A;  2Z3Y A;  1S8N A;  2OU2 A;  3ZN0 A;  2PQ8 A;  1ON1 A;  5ILV A;  4KMF A;  1W7P A;  1T38 A;  4FHT A;  1S6L A;  2Q2E A;  4EJU A;  2VBZ A;  2VON A;  2PJP A;  4N0B A;  3E5Q A;  1T39 A;  1XGN A;  1BM9 A;  2D2W A;  4G6Q A;  3WE2 A;  4RGR A;  1XGM A;  3JTG A;  2VOO A;  3R60 A;  2YSR A;  4G8X A;  4EM1 A;  4ENK A;  2Y75 A;  2EJR A;  1F5T A;  3K69 A;  3T1B A;  4LK0 F;  2CWE A;  2YR2 A;  5DUI A;  3KZY A;  4OIQ F;  2ZO4 A;  3B73 A;  4IHT A;  1R36 A;  3CUQ B;  2EV6 A;  3I64 A;  1FYK A;  4AIH A;  1IF1 A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...