3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
3CUQC 2YPRA 1ZHFA 3HRTA 4KYWA 1LJ9A 4YIIA 5CVRA 1R22A 1S29A 1I27A 1SFEA 3IWZA 1IN5A 5FB2A 1ZAOA 1EV7A 1H9TA 4AIJA 1RZ4A 3Q5FA 4BH9A 5DCMA 5HOOA 2A5YB 1JHFA 2C6YA 4PGHA 4RAZA 3EYIA 3WTYC 1JGSA 2G9WA 2RQPA 1FLIA 2A6EF 4KFCA 3HRUA 2BBYA 2EFPA 3PQKA 3P9IA 1MD0A 3IRRA 3E6MA 2UXXA 2HEOA 1QZYA 3RDIA 3ZMSA 1IF1A 5CVVA 3MQ0A 1UHWA 2NYXA 4MNUA 5F6FA 2DK8A 3L7WA 2WV0A 4HQEA 5CJ9A 1P6RA 4LK0F 2QENA 2FBHA 3ZMVA 1HBXG 4KNYA 1X3UA 3EDPA 4IXAA 1CF7A 1FBSA 3ULQB 3MAJA 3K69A 4OMZA 4GXOA 4U0WA 5ILUA 5L3FA 2VOPA 2FRHA 3QU6A 4G7HF 1EH7A 3S2WA 1Y0UA 4Q5SF 1MDMB 3U2RA 2FNPA 1FYMA 2L02A 2XASA 2K4BA 2OU2A 4A6DA 1ZG5A 3ERED 4O3MA 4ON0A 1IN7A 3FM5A 1QO0D 3LA7A 3WGHA 2KIUA 4M6XA 3LAPA 2XAHA 4S04A 4G7OF 1KU2A 4LGWA 1I5ZA 2HR3A 2LDUA 3FXQA 1FSHA 4ZZDA 4B09A 3GFIA 3N4MA 3FXRA 2VBZA 2JPBA 2LF7A 1AWCA 1J7KA 1G3SA 1CF7B 3F8FA 3FMRA 3ABUA 1XMKA 4AD9A 3REOA 1SD6A 2OBPA 1XGOA 4ESFA 1WSUA 3RYPA 1LEBA 2NNNA 2CQKA 4WCGA 1KU7A 3WG9A 2MLGA 3CLOA 2V1DA 5DDGA 2CWEA 1TQPA 4M72A 4BQAA 1T39A 3KEOA 4OIQF 4Q4ZF 1AOYA 3FHZA 2E7WA 2P7CB 2FXAA 3SHFA 1QPMA 3JTHA 4CZZA 4RB3C 3ZMTA 4OINF 1GXQA 1W7PA 3F6OA 3SZTA 1ULYA 1USTA 4KIFA 4A5MA 5E18F 1EH8A 4G7ZF 1NHAA 4KMFA 4MQ9F 3JSOA 4HX8A 1SMTA 3K1MA 3T0YA 2XAFA 4I7HA 2ZBKA 3L09A 1CGPA 4DQ2A 1DDNA 2F2EA 2RVCA 2B0LA 1ZG1A 2VE9A 4PZJA 2ZKZA 3F8CA 3F8BA 2VC1A 2K86A 4WK8F 1OYWA 5LHHA 3T8RA 3GVAA 1IN6A 4RB2C 2DPDA 1A04A 1TNTA 1C0WA 3K9TA 3HIFA 2PMHA 3HSEA 4HA8A 4CGZA 2PEXA 2BYVE 5BQTA 1W7PB 2KJBA 3O3KA 5LGTA 1STZA 2MBFA 5E1XA 3KZZA 4G9YA 1G4DA 2OZUA 3AAFA 2NRAC 5F1RA 4LLLA 2EJRA 4UNOA 4MTEA 2UZKA 3IHUA 4FT8A 3TO6A 3HUGA 3KP6A 3L2CA 3P9CA 2Q0OA 3MEXA 4A6EA 4EGZA 1Z05A 4XBFA 3DKWA 2A68F 4HF2A 3ZMUA 1T98A 4EJTA 4L9TA 3NRVA 1SD4A 1J59A 2HFHA 1WWXA 1YFHA 2A69F 1D8KA 3RKWA 1FY7A 1WKMA 4P9FA 3F21A 1DPRA 4ETSA 1S7OA 1D5VA 1XB4A 1FWZA 2PMUA 1YIOA 3KE2A 2QZ8A 2A61A 3H3UA 1W4MA 5HDKA 3JAMZ 2PJPA 2PG4A 1XCVA 4BYYA 2CFXA 4ASNA 2ZXJA 1U5TC 3HOSA 5D5UB 1T6SA 4CYDA 1BI2A 1ZH5A 1BIBA 1REPC 4EVIA 1J75A 4UHTA 3TDZC 3VB2A 4EM0B 2HGCA 2GAUA 4RB0A 2XAQA 4KT5C 1HXDA 2LKPA 5H6RA 2FU4A 4CO8A 4LMYA 5FD6A 4IHTA 2D1VA 3ABTA 3K1PA 4ENMA 4OMYA 3TDUC 1KQ8A 3J81Z 3R6SA 2JPCA 2W25A 4RGSA 2YR2A 2DI3A 2HDCA 2H6BA 5HDNA 2V1UA 5J8CA 4ESBA 5HLGA 1ZRFA 4LB5A 1TNSA 1B1BA 5AIQA 2L4AA 3E6BA 2PBIA 4I09A 2ZNZA 3GZ6A 1YS7A 4IRHA 4YFKF 1HKTA 1ZRCA 1L3LA 1YYVA 3LFKA 2A3SA 5K5RA 2L01A 5D6FA 2X4HA 1MGTA 4IPAA 1YTYA 5FO5A 1MZBA 4M74A 1FNNA 2HTSA 3IKTA 2Z99A 3WGIA 3HRMA 4LLGF 3RPQA 2IW5A 1R1UA 1XMAA 3FWEA 3CO7C 2F5CA 3V8LA 3RI4A 3ZP5A 1J5YA 4UV9A 3JSPA 2J5OA 1R5HA 4HF0A 5KK1A 1R1VA 3TO9A 5A2QK 4QWQA 3KLNA 3KFWX 5IT9Z 2VBWA 5DYMA 2XIGA 3R0AA 4R8HA 1KU3A 1XD7A 3HHHA 1ZARA 2QQ9A 5CVIA 4EQQA 3H92A 2UWMA 5H20A 3V8JA 2K4JA 1WQ2A 4Y15A 4P96A 4JQFA 1MJAA 1G3WA 2XAJA 2RGVA 4IHSA 4E70A 3KP5A 3CJNA 3GUDA 4IF4A 1QZZA 3QPHA 2FBKA 3E5UA 4YG2F 4NQWA 1IXCA 3R4KA 4R79A 1YW9A 4UV8A 3KLOA 3LWFA 3W6JB 1B59A 4XLPF 3WODF 5E1WA 1QBJA 2M30A 3V4GA 3KEQA 3EQLF 1KA8A 1IXRC 2P5KA 2DAOA 1D3YA 2IA0A 2HYFA 1UFMA 5EEGA 4HLXA 3FM3A 5DEQA 1FYKA 3F72A 2XROA 4P5OA 3W6KB 2WTEA 1Z7UA 5K5QA 2IA2A 2AXLA 4P55A 2V1XA 4A5NA 2ZJ2A 3E6DA 3DFGA 1B9NA 5E17F 3TO7A 2FA5A 1O57A 2HS5A 2XAGA 4D0PA 2FQ3A 5D5WB 3OV8A 1YW7A 4BHPA 1HQCA 1R5GA 2ZMEA 2OAZA 3WTZA 4DNCA 3E6CC 3GW2A 2L54A 2HKOA 4AIHA 1W7PD 3Q9SA 5HS9A 3GFJA 4KIBA 1JHHA 3FMSA 5DCMB 5BPIA 3E5QA 2M45A 1U6GA 1J0RA 2XRNA 1BC7C 4MQVA 1P4XA 2P5LC 2R7DA 4Q47A 3KP3A 4ZYGA 3KP7A 1B9MA 2GQQA 1LB2A 3ECOA 2PI0A 4L9JA 2P6SA 3WE2A 2YX4A 2FE3A 1F4KA 1KQ0A 1O7LA 3T5XA 1I1SA 4CDGA 1SAXA 3O2PE 2P8TA 3E3VA 3ZN0A 1RUOA 4G8XA 1D8JA 4KDPA 1YS6A 1SD5A 1XDSA 1HW5A 5TRDA 2F5FA 4WXHA 5JVTA 4IJAA 3JW4A 3L00A 2W84A 3TOAA 3VEPA 3I71A 3RYRA 3M1EA 1XDUA 1O3RA 3VFZA 4LK1F 3D0SA 4RS8A 1TQIA 1IUYA 3E97A 1HW2A 2XV4S 3ROUA 1L0OC 3GWZA 3K2ZA 1FP1D 4ENNA 5JFRA 2UXNA 3E5XA 1YLFA 1FT9A 2IPQX 1FZPB 3TKYA 2HQNA 4NHJA 2DTRA 3TOBA 4I2OA 3BROA 4O6JA 2FSWA 4RGUA 2FBIA 1SD7A 1XGSA 3ZN1A 1BIAA 2KRFA 3RTRA 2WWYA 1OKRA 2ADUA 2KJCA 3KP4A 4L9VA 3C3WA 2CGPA 2NNYA 2YSRA 4G6DA 1UCRA 1FPQA 1GHCA 5L3BA 3F3XA 1IRFA 2OZ6A 1ZG3A 1KYZA 3DV8A 4HDVA 4UVCA 1IN8A 3LA2A 4U88A 2OQGA 2ESHA 2P7VB 4OIPF 1XSXA 2ZO4A 2CO5A 5JHUA 4JBAA 1I1GA 2D45A 3HSFA 3WGGA 5FD5A 2O8XA 3LSTA 2DLLA 4YIFA 4WXCA 1U3EM 5CYVA 4OIOF 3BOQA 2GXBA 1FC3A 4ZYEA 2ZCWA 1LDKB 3DF8A 4L18B 3BDDA 3D5LA 4OIRF 2OD5A 3HRSA 2HOEA 1W5SA 3K0LA 1HSTA 1Q1HA 1KYWA 3M8FA 3GFLA 1SFUA 1U5TA 2JT1A 4MEXF 4OU0A 2EWNA 1R58A 2MC3A 1ZLJA 3WTUC 1FSEA 2DU9A 3WU0A 4A0XA 4I02A 1J9IA 3F22A 5D5XB 3V7RA 4A2UA 3EYYA 1BI0A 4OOIA 2H94A 3QOPA 4HV5A 2H27A 5D4RA 1Z91A 5ICCA 2COMA 4Y13A 1OR7A 2RC4A 2Y0MA 4QLCU 2FMYA 2Z9OA 4AVPA 4AWXB 3M9AA 1YW8A 2X0LA 3IWFA 2Q8KA 3OOPA 2P4WA 4L5IA 4RGXA 5LRSA 1BJAA 3L9FA 1UB9A 1LNWA 1IXSB 1F9NA 3B73A 1XSVA 3KP2A 2W24A 3TGNA 2Z3YA 4EJOA 2ETHA 1B6AA 3I53A 5E8GA 2MLKA 3COAC 3N97A 2YU3A 4YFNF 1LDDA 1H0MA 2WC2A 4RB1A 5FFXA 3HSRA 4KICA 5LGNA 4N0BA 1BN5A 4F7ZA 1S6LA 1HW1A 1XCBA 2RDPA 1V3FA 3IL2A 4FX0A 3GYHX 1S3JA 2STTA 3WTWC 3C1DA 3RPUA 2QM3A 4WWCA 5FFZA 3WE3A 2Q2EA 5IT3A 1VTNC 5JR3A 4KIGA 2EV6A 2XKOA 5DCFA 5LEJA 4Z2YA 1ZREA 3QPTA 4LD5A 4PCQA 4O5VA 3J80K 1KU9A 3MWMA 4HBLA 5BS6A 4TV7A 4LLNA 4S05A 2IRFG 2DFIA 1W5TA 4LFUA 4ESJA 2RNJA 1DP7P 3DEUA 3I64A 4PDKA 2XUBA 2NAZA 4U0VA 3BJ6A 3G73A 5HLIA 1T38A 2NS0A 2P6TA 1MJBA 1RNLA 2V9VA 2PFBA 2HQRA 1HSJA 1SMYF 1MKMA 2IT0A 3BPVA 2GXGA 1I6XA 3ZMZA 3ISPA 5L3EA 3BZ6A 4HYEA 4K2EA 4G94A 1IZ1A 2HKXA 5D4SA 5DD4A 2EB7A 5E20A 1V4RA 4Y17A 2A07F 3I58A 2GIVA 3ML6A 2QUFA 4MGRA 4KA4A 5E1ZB 6PAXA 3CUQA 5D8LB 3WTTC 4MEYF 3HYIA 4KMUX 5A2QZ 3QP6A 3BY6A 3M8EA 2EFNA 4EGYA 4I0BA 2IVMA 2ISYA 1YO5C 5L3DA 2LNBA 3IKVA 5CVUA 1R36A 1LQ1A 4R1HA 5FLXK 4XLNF 1ZLKA 2CYYA 2QQBA 4AIKA 1LEAA 3QRFF 2DBBA 5AONA 2G7UA 1HKSA 1QNTA 2RV8A 3EUHA 1KGSA 2XHKA 4WXDA 3RKYA 1Z6RA 4G6QA 2EK5A 3MCZA 5FGMA 4EJUA 4LJZF 5LBQA 1R1TA 1DPUA 3FMQA 3T1BA 3I0TA 4HX4A 3F23A 1OMIA 3SQNA 3WU1B 4RAYA 2FNAA 2K7LA 4YFXF 4ENKA 3CUQB 3CTAA 3F6VA 2CW0F 1G3TA 4FX4A 3PQJA 3R60A 4RGRA 4EV0A 2VODA 4XSZF 3NQOA 2V6CA 3O6BB 4HLYA 3P9KA 4M9ZA 1IN4A 3KETA 1BC8C 1RI7A 1ONVA 1O3QA 2O3FA 3RIRA 5HLHA 4HAMA 4P9UA 3T8TA 5JI6A 3MZHA 2R7FA 5J6XA 1R7JA 3ZPLA 3KCCA 1P4WA 5F64A 5J8FA 3F8MA 2IA1A 3QU3A 2QLZA 1K78A 5LEKA 5ICFA 3JTGA 3R0JA 2YX7A 2JSCA 1MDMA 1ODDA 2HZTA 1TBXA 2STWA 3I54A 2VONA 2ZNYA 4B8XA 5ERIA 3HOTA 5D8KB 3I4PA 4WF2A 1UHMA 5DV5A 4KN4X 1KQ9A 3RKXA 2EFQA 1IAWA 4M9SA 2VXZA 1GXPA 5LGUA 3ZMDA 1YG2A 5K1YA 2V79A 4LB6B 2G7HA 3VODA 5LRRA 3GFMA 2D2WA 1P4AA 4L0ZB 5K5OA 1FBUA 1R23A 2VC0A 4U7BA 4I01A 4A0ZA 3VOEA 2EA2A 3QP5A 5TJJA 1BM9A 2KIFA 1RUNA 1K78B 2XVCA 2MD5A 4PGGA 4M71A 2GWRA 2XGXA 3LAJA 3FXUA 3GF2A 2FF4A 4HDUA 3NEUA 5ILVA 1T0FA 3GO5A 4HF1A 3V7CA 5DUKA 2L4MA 1F1ZA 2ZMEB 1K6OA 2EFWA 3C18A 2DW4A 2FEZA 4JK1X 2EV0A 4GYGA 1PP8F 2D1HA 3BJOA 2ELHA 3DPLC 5D6EA 3ELKA 1ON2A 2Z33A 1S7AA 1G3YA 2P5VA 3V8KA 1TQMA 1TW3A 3CUOA 3GX4X 4MHGA 3SZPA 5BOXA 2F5EA 2CG4A 3FX3A 2XKPA 1PDNC 3BPXA 4L0YB 4GO1A 2M87A 2OQRA 4WX9A 1OPCA 4GGGA 1FOKA 2R3SA 1J2XA 1EH6A 2Y75A 5DUIA 1HKQA 2W85A 2O0YA 2RKHA 2ISZA 1BI1A 1QQIA 2O03A 2KKOA 1R00A 2BGCA 1IRGA 2VT2A 4EM1A 4N9IA 1PP7U 4IRIA 3FZVA 4IVNA 4GCVA 4HQMA 2DK5A 4ENJA 1Z1DA 3EETA 3R61A 4L5JA 1O7FA 4CHUA 4BHCA 1YQAA 4FHTA 5HS8A 3SXYA 1ZGAA 5ICGA 1FBQA 3U1DA 3F8NA 1K7AA 2EV5A 1LDJA 3J7AO 4H0EA 4M9XA 3HHGA 3Q9VA 2QWWA 1P92A 4HZFA 5LLQA 1U2WA 3K1NA 2QBYA 5H6QA 4CICA 1Z9CA 4EMSA 2F5DA 1LVAA 3CO6C 2HWVA 1E17A 1QGPA 2FMLA 2OA4A 1E2XA 3I5UA 1WI9A 3LQRA 4NB5A 2DPUA 3M7GA 2E7XA 5EEHA 5HDGA 4EM2A 4UUVA 2M8EA 2GZWA 4MTDA 1JE8A 4ZH4F 2PLYA 2EA4A 2O6GE 2VN2A 3H3ZA 5BPDA 2K27A 2ESNA 1RIOH 1WRJA 2MH9A 4UVBA 3BJAA 4EJWA 1IW7F 2BEOA 3B02A 1U5TB 4LG0A 2QBYB 1H9GA 5BMZA 2MH2A 1O3TA 2H09A 1SFXA 1K79A 3JAMK 3TQNA 2GA2A 2VT3A 3V7SA 1FX7A 2K02A 4HOBA 3G3ZA 2BE5F 1FP2A 5HVQC 2QVOA 5ED4A 1G6NA 2HYGD 2M5WA 2VBXA 3WTVC 4KUMA 2VOOA 4A12A 4GYIA 3GXOA 2TDXA 5CLSA 1TTYA 2RN7A 1P2FA 2VE8A 1DUXC 4KN7X 4I98B 1ON1A 3KZYA 4BXUA 1BOAA 4L9NA 3LQQA 4HV6A 1ZRDA 2M1BA 2PQ8A 3BWGA 1XSDA 1PUEE 4UVAA 1U8RA 2LSOA 3J81K 5L3CA 4U7DA 2E1NA 3J80Z 1GVJA 4LG0B 2QYOA 3IRQA 2LF8A 4XRFA 2CSOA 2DQLA 2BV6A 1F5TA 2GA1A 2A6HF 3HTSB 1BI3A 1T2KA 4M73A 3RJPA 4A0YA 5AIPA 3SFZA 4M6YA 1XGMA 1MJ9A 2DT5A 1O3SA 5L3GA 1USSA 3FF5A 4Q48A 4ZYHA 3WTXC 4IRGA 2HTJA 2PN6A 4XSXF 5E8IA 5ILSA 3ZQ7A 2EFOA 2JTVA 3QAHA 2JZYA 3CDHA 2ACJA 2JRTA 4BHBA 3P7NA 2IJLA 4I0AA 4HX7A 1TLHB 5KVRA 2QQAA 1BBYA 4EJVA 2Z5UA 3DP7A 2DQRA 1S8NA 5LHGA 1OYYA 3GLXA 1TW2A 2IP2A 4UXNA 5ICEA 3LA3A 4CXFA 3ECHA 3I59A 1FYLA 1U78A 2H6CA 3HTUA 4BAYA 5FLXZ 5IT9K 3WTSC 2VBYA 2KIMA 5CVJA 2AS5F 4ZYDA 2E1CA 1ZGJA 4BNCA 2MA3A 2O61A 3DQVC 3DXJF 2Y48A 3PFIA 3C7JA 3BP8A 3IC7A 3MZYA 2DO7A 1XN7A 2L3DA 3GZ5A 3DPTA 1B4AA 4ZZLA 5LHIA 5HS7A 2J5PA 1OYIA 4HW0A 3MFKA 2ZFWA 1ZYRF 1Z6TA 3GEZA 1XGNA 4U0YA 5DD8A 2FOKA 3U9GA 5D5VB 2W57A 3I59B 1ZN2A 4N9HA 1JXSA
chains in the Genus database with same CATH superfamily
3CUQC 1POGA 2BW3A 2YPRA 1ZHFA 2W82A 3HRTA 4KYWA 2VQGA 5FROA 1LJ9A 1G59A 4YIIA 3M8JA 5CVRA 4IX7A 2K85A 2DA3A 3DBRB 1R22A 4HSTA 4XKWA 1S29A 2WV1A 2GLOA 1I27A 1SFEA 3IWZA 5J40A 1IN5A 5FB2A 1ZAOA 1EV7A 2R5ZB 1H9TA 5EEAA 5HODA 1I3AA 4AIJA 1MNEA 1RZ4A 3FXOA 2VJIA 3Q5FA 3G1MA 4M3GA 2F5VA 3PO3J 5EZGA 4BH9A 2QSFX 2CV2A 5GAGJ 1IG7A 3CCQI 5DCMA 3S14J 5HOOA 4UY8I 2A5YB 1JHFA 3KIOA 2GM4A 2C6YA 4PGHA 5J47A 4RAZA 2DA2A 3EYIA 3WTYC 4E7LA 3NWSA 2AQFA 2KDOA 3EUHC 4HRIA 4J19A 1JGSA 2G9WA 2RQPA 3OS2A 1FLIA 2A6EF 4KFCA 4E7KA 3HRUA 2BBYA 2EFPA 1A5JA 4NC8A 5IYBJ 4A3CJ 1N78A 3K4MA 3PQKA 3P9IA 1YJ9I 1MD0A 2MABA 3IRRA 3JRFA 5H2FC 3E6MA 2UXXA 1IV6A 2M7BA 2HEOA 1QZYA 3RDIA 1WZ2A 1XG1A 4NNJA 1U0JA 2ECCA 4MFDA 2JQ7A 3ZMSA 1MIJA 1IF1A 5CVVA 3MQ0A 1UHWA 2NYXA 2AQEA 4MNUA 5F6FA 2DK8A 3HDDA 3O8HA 1X19A 1U9OA 3L7WA 1LFBA 2WV0A 3MD2A 2DT6A 1OCZH 4HQEA 3S3NA 5CJ9A 1ACIA 2XB5A 1ETYA 1MW7A 1P6RA 4LK0F 2QENA 1W5CC 2XF7A 3PJRA 2W1OA 2FBHA 1GT0C 4BXXJ 3M3YJ 3ZMVA 4DGWB 2L7ZA 4G6TB 1HBXG 2X6WA 2GBYA 3PUFA 4KNYA 1X3UA 3EDPA 4IXAA 1CF7A 1FBSA 3GTKJ 3ULQB 5KNLA 5B3SH 3MAJA 5JHFA 3CC2I 3K69A 1YE9A 4OMZA 4GXOA 2K3PA 4U0WA 5ILUA 2DMQA 1MMGA 5FKNA 3OSFA 2LLKA 5L3FA 1IRXA 2VOPA 4PJLA 2FRHA 3QU6A 4G7HF 1D5YA 1ENHA 1EH7A 3S2WA 3OIOA 3VYRB 5EF6A 1Y0UA 4M3FA 1MDMB 2LTPA 4Q5SF 3U2RA 2DDAA 2FNPA 2NVTJ 1FYMA 2L02A 2XASA 2K4BA 2OU2A 5C3EJ 3LSMA 4A6DA 1R4MB 4B3AA 2ME0A 3FXMA 1ZG5A 1I6HJ 3ERED 4A3GJ 2R7VA 4XMYA 4O3MA 2LVSA 3F9KA 4ON0A 2ID3A 2LBFA 2L9VA 2DA6A 1IN7A 3FM5A 3TL4X 1LVKA 1QO0D 3LA7A 3KX2A 2WY8Q 3WGHA 2KIUA 3MKLA 4M6XA 2K9SA 3LAPA 1PUFB 2XAHA 2DOEA 4S04A 4G7OF 1KU2A 3HC7A 4BXFA 4LGWA 1I5ZA 2HR3A 2LDUA 4X6AJ 3ONQA 3FXQA 1FSHA 1P7JA 1DGWY 2XPVA 4ZZDA 4B09A 2Y0SA 3IH2A 3GFIA 3N4MA 2V1NA 3FXRA 2VBZA 2JPBA 5IP9J 4E7HA 2WADA 2V4JC 2LF7A 1AWCA 3PSIA 1J7KA 1G3SA 1CF7B 3F8FA 3FMRA 4XL9A 3ABUA 3GTOJ 1XMKA 4AD9A 3REOA 2YU9J 2JRMA 5FKOA 2NVUB 2QKMB 1SD6A 3QODA 2OBPA 2VUMJ 2DFEA 3OYFA 4IO9F 3G4SI 1VQ7I 3JREA 2HU9A 1XGOA 4ESFA 3L2WA 4PFPA 3SDBA 1WSUA 3RYPA 3B6AA 2BY3A 1LEBA 2EINH 2NNNA 2A5WA 2CQKA 4WCGA 1KU7A 3WU2C 3HGGA 1R49A 1N77A 3WG9A 2VQHA 2MLGA 4XQFA 3JRGA 3CLOA 3OYNA 2JA8J 2V1DA 5DDGA 2CWEA 1TQPA 3JRAA 1QRYA 4M72A 2FD5A 2ZC2A 1T39A 3FXLA 3KEOA 4BQAA 1ZELA 2KPMA 2Y30A 4OIQF 2ZXIA 3K4KA 4RM2A 4Q4ZF 2LBFB 2RREA 3FHZA 1AOYA 1MNDA 2E7WA 2P7CB 2VIXA 2FXAA 3SHFA 1QPMA 3CP2A 4F55A 3BG5A 3JTHA 4CZZA 4RB3C 4C2TA 3SYTA 1K83J 3ZMTA 4OINF 1FJLA 1GXQA 1W7PA 3MVPA 3F6OA 3KYCB 3SZTA 3CC4I 1ULYA 1USTA 4KIFA 2R7QA 4A5MA 3BQYA 4HG2A 2TRTA 3W2WA 5E18F 1EH8A 4G7ZF 4DIQA 1NHAA 3OL3A 1T0FC 3TMOA 4KMFA 4RA2A 4C3HJ 4MQ9F 3JSOA 4HX8A 1SMTA 3K1MA 2K9MA 2DMNA 1VQNI 3T0YA 3ZQQA 2XAFA 1WPKA 4I7HA 2ZBKA 3L09A 1CGPA 3HKZA 4BQNA 3QQAA 4DQ2A 1DDNA 1YITI 1DQUA 2F2EA 4HNUA 2RVCA 5F1JA 2B0LA 3TEDA 1ZG1A 2VE9A 4PZJA 1BR4A 3H1CA 4PJJA 4AVZA 2ZJQF 3CCMI 3ZQLA 1Z0XA 2ZKZA 3F8CA 2HQ5A 3F8BA 4XR6A 2JA2A 2VC1A 1X58A 1QVTA 2K86A 4WK8F 1OYWA 1SFOJ 3GTJJ 5LHHA 3T8RA 3GVAA 4XN0A 1IN6A 2PMZN 1LFUP 2OF7A 3RPUD 3SEQA 4RB2C 2DPDA 1A04A 1RR7A 4FISA 1TNTA 5M5WJ 1C0WA 3K9TA 5GP9A 4XLHA 3HIFA 4XRSG 2PMHA 3HSEA 1GV5A 3OYJA 4HA8A 2AHQA 4CGZA 2PEXA 4P1WA 1H88C 2BYVE 1JKOC 1FOYA 4IZZA 5BQTA 1W7PB 2N8GA 2KJBA 3O3KA 3BR0A 1STZA 3A0BC 2FUG2 5LGTA 1W0TA 2MBFA 3C2HA 5E1XA 3KZZA 2E2HJ 2ZJRF 1IUFA 4G9YA 3HBLA 3FBIB 1G4DA 2OZUA 3AAFA 2HVSA 3GTPJ 5KAIC 2NRAC 5F1RA 4LLLA 2EJRA 4UNOA 2M34A 5FKMA 2RQQA 4MTEA 2UZKA 2Q1ZB 3IHUA 3DTKA 2X51A 4FQGA 4FT8A 1VF9A 2WAQA 3TO6A 2PJRA 2HXIA 4QSHA 3HUGA 2M7AA 3PNVA 1TP4A 3KP6A 3L2CA 3NAUA 3P9CA 2G0EA 4RBOA 2Q0OA 3MEXA 2BY1A 1BR2A 1P9QC 1XPXA 4A6EA 3RQ4A 4EGZA 4CYCB 3J7AY 1MMDA 1Z05A 4M6VA 4XBFA 4E6KG 3DKWA 5IOZA 2A68F 4XOPA 4CUGA 4HF2A 3ZMUA 2CUEA 1T98A 4MO7A 1JKPC 4BY1J 1TWGJ 4EJTA 4L9TA 5M5YJ 3NRVA 3OYIA 1SD4A 3U1KA 5F08A 1J59A 3OYAA 4JOMA 1Y8RB 2HFHA 2QGUA 1WWXA 4G12A 1YFHA 2A69F 1D8KA 2MGQA 3DU5A 3RKWA 1FY7A 2EPFA 2OJED 1WKMA 2F6CA 1SANA 3PSFA 4P9FA 3GTLJ 2EZLA 4DYCA 3F21A 4PJNA 1DPRA 1VFCA 4ETSA 5C44J 1S7OA 3HXLA 3L2VA 1FOWA 1D5VA 1ZKGA 2X6XA 3VSLA 1XB4A 2UUZA 3DBHB 1FWZA 2MD0A 2PMUA 1YIOA 3KE2A 4ZJZA 3H5RA 3E7LA 4ABZA 2QZ8A 2A61A 3H3UA 1W4MA 5HDKA 3I56I 3JAMZ 2PJPA 2HZDA 2L5QA 4XLEA 2PG4A 3G71I 1XCVA 4BYYA 2CFXA 2WB1A 4ASNA 5DM7F 2H8WA 4M3DA 2DXIA 2R7RA 1YX3A 1XS9A 2ZXJA 2IS6A 1U5TC 3HOSA 1MBEA 2E1MB 1T6SA 5D5UB 3HGYA 2GIZA 4CYDA 1BI2A 4DJAA 1ZH5A 3DCFA 1IV8A 2KLOA 4RMNA 1BIBA 4JX6A 1N25A 1REPC 4EVIA 1Y0NA 2E5NA 2F4OB 4UHTA 3TDZC 2W7NA 2QF7A 1J75A 3VB2A 4EM0B 2HGCA 2KFDA 2TCTA 2GAUA 4RB0A 2XAQA 4KT5C 1HXDA 2LKPA 1WGXA 4B48A 5H6RA 1NH3A 2FU4A 2KP6A 4CO8A 4LMYA 3OSGA 5FD6A 4IHTA 2CV0A 2D1VA 3ABTA 2EIJH 3K1PA 4ENMA 4OMYA 3TDUC 3AKZA 5B1BH 3K4CA 1UAAA 1KQ8A 3J81Z 3K70D 4CCNA 4ZYAA 4UB8C 5FLVA 2OTJI 3S93A 4D9JA 2WAFA 3R6SA 2JPCA 2JK3A 2W25A 2YUSA 4RGSA 2YR2A 2O7OA 3L2RA 2DI3A 4UB6C 5GAEJ 1OR7C 1X1DA 2VXDA 3HJEA 4HNVA 2HDCA 2H6BA 5HDNA 3L2UA 2V1UA 5J8CA 4ESBA 4A3JJ 2LD5A 5DTDA 3QPSA 5HLGA 1ZRFA 3AL0B 4LB5A 2VJ5A 1TNSA 3DKYA 1B1BA 5AIQA 2L4AA 4YEJA 3E6BA 2PBIA 4PJMA 4AC0A 4I09A 2ZNZA 3GZ6A 5M3FJ 1YS7A 4II3A 4IRHA 1ETWA 1X1CA 2Y2ZA 3KPHA 4BE1A 4YFKF 3BR2A 1HKTA 1X1BA 1O4XA 1ZRCA 4AIDA 1VQ8I 3IH4A 3W2AA 1DGRM 1PVEA 1L3LA 2PX9A 2I5UA 3CQZJ 1YYVA 3LFKA 2A3SA 3OS1A 2DFHA 2KIQA 5B5EC 5K5RA 3JRCA 5CPRB 2L01A 3VYUB 3Q0VA 5IOYA 5D6FA 2X4HA 1B72A 1MGTA 4IPAA 1YTYA 5FO5A 3LMMA 1MZBA 4M74A 1V55H 1FNNA 1V54H 2HTSA 2IXSA 2CUZA 4XKVA 3GLLA 2ELJA 2M2EA 3IKTA 4A3IJ 4NBQA 4FASD 2Z99A 1D1CA 2DT7B 4CZCA 3WGIA 3HRMA 4LLGF 3RPQA 2IW5A 2XPWA 1R1UA 1XMAA 3FWEA 3FXKA 3MN2A 5CKTA 4XICA 3CO7C 1S9HA 2F5CA 3V8LA 3CF5F 3RI4A 3ZP5A 2WAEA 3CD6I 1J5YA 4UV9A 4XORA 5HNFA 2J5OA 1R5HA 2VASA 3JSPA 4HF0A 4IHVA 4MFEA 3QYEA 5KK1A 1R1VA 2KHMA 2L9SA 3TO9A 5A2QK 2NOJB 4QWQA 3KLNA 3KFWX 2OCCH 4PSWA 5J3LA 5FJ8J 5IT9Z 4BU2A 3ZOBA 3BG3A 4A69C 2VBWA 5DYMA 2XIGA 3R0AA 4R8HA 1KU3A 1XD7A 4UUTA 3JR9A 1YRNA 3HHHA 3OYCA 1ZARA 4M3BA 3K4NA 1VI0A 2WY7Q 1QHHD 2VJJA 4BBSJ 2QQ9A 2DJIA 4D7MA 5CVIA 4B43A 5E3NA 3HOYJ 4EQQA 3H92A 2UWMA 2R93J 5H20A 3V8JA 2K4JA 1WQ2A 3UKGA 4HEA2 4UUSB 1YJWI 4Y15A 2LG4A 4P96A 2R7UA 4JQFA 1MJAA 4YRVA 1G3WA 3OOUA 2LMDA 2JA5J 2XAJA 2RGVA 2H1LA 1ORKA 4IHSA 2OPTA 4E70A 2OCEA 3KP5A 4ZTJA 4U87A 3CJNA 3GUDA 4C30A 4IF4A 2AO9A 1FMVA 1QZZA 2FX0A 2XF6A 3QPHA 3AG2H 4EEFG 2FBKA 2M3AA 4IKFA 3E5UA 2W00A 4NDLA 2OV7A 3RZOJ 1RPWA 1Z7LA 1IRZA 4YG2F 1T95A 4NQWA 1U8BA 4C3IJ 1IXCA 3R4KA 1VQ4I 4B47A 1LKXA 2XGCA 4R79A 1YW9A 2BOLA 4UV8A 1MMAA 3K7AJ 1MH4A 3A0HC 3KLOA 3LWFA 3W6JB 1UELB 4IQ4A 1B59A 4M3EA 4XLPF 2VLAA 5FKLA 3WODF 1R71A 3OYBA 5E1WA 1QBJA 2M30A 1YJNI 1R9TJ 3V4GA 1YRNB 3S15J 3KEQA 1OQYA 3EQLF 1KA8A 1IXRC 2P5KA 1R6RA 2DAOA 1D3YA 4X0GA 1RKWA 2DTZA 3G2BA 3CF2A 4B1RA 3PM1A 4W97A 1WJBA 2IA0A 2HYFA 2KZVA 1UFMA 5EEGA 1YIJI 4HLXA 3FM3A 5J4VA 5F0HA 1X3ZB 2FQ4A 3CCEI 5DEQA 2CUJA 2LOOA 1FYKA 1AKHB 3F72A 2XROA 4P5OA 2MG4A 3W6KB 2EH3A 2WTEA 1Z7UA 2A6TA 5K5QA 3HOUJ 2IA2A 3K70C 2AXLA 4P55A 2CQQA 2DYRH 2V1XA 4A5NA 2R7OA 2ZJ2A 3E6DA 5EG0A 3DFGA 1B9NA 3VPRA 1DU6A 3HEFA 4NQWB 1RRJA 3FK7A 4C2MJ 4IHXA 5E17F 3TO7A 4XM3A 4PSXA 1HF0A 2BW3B 2FA5A 1O57A 2Y9YA 2HS5A 2XAGA 2FQ3A 3NWTA 4D0PA 2R7SA 1FTTA 4HPQA 5D5WB 3OV8A 2B63J 1YW7A 3BC8A 4BHPA 1HQCA 1R5GA 2NVQJ 3OYLA 2HDWA 3QPLA 3S8PA 3SZGA 3IV5A 2ZMEA 2DODA 2OAZA 2XRLA 3S3MA 1G8XA 3WTZA 4BEHA 4DNCA 2JJ7A 4CSWA 1YHQI 3E6CC 1NK2P 5B1AH 3GW2A 2L54A 2HKOA 2X48A 4AIHA 3ZGKA 3J7YJ 4ANJA 1W7PD 3Q9SA 5HS9A 5LFAA 3FDYA 4BACA 3GFJA 5IP7J 4KIBA 4XNFA 1JHHA 3FMSA 4CCMA 1GDTA 3DLAA 5DCMB 5BPIA 3E5QA 2M45A 5M5XJ 1U6GA 1J0RA 4F52A 1MNMC 2DA5A 2L9NA 4AUXA 2XRNA 1X1PA 1BC7C 2YS9A 4MQVA 1P4XA 4BGDA 3OYEA 2P5LC 2R7DA 4Q47A 2E35A 3KP3A 2X1DA 4ZYGA 3KP7A 2ZSIB 4PK4A 1B9MA 2GQQA 1LB2A 3ECOA 3ASNH 1ETVA 2LKSA 4L9JA 2PI0A 2MFZA 3RQIA 4CH7A 2P6SA 5EG0B 3WE2A 3QYFA 2YX4A 2FE3A 1F4KA 1Y39A 2HVRA 1KQ0A 1O7LA 5F27A 3S2DJ 3T5XA 1I1SA 3BR6A 1BJZA 3MMYB 2ZSHB 4CDGA 1SAXA 3O2PE 2P8TA 3E3VA 3ZN0A 3IAS2 1RUOA 3K2AA 4G8XA 1MBKA 2JSPA 3O8GA 4KDPA 1T8IA 4YIRX 1D8JA 1YS6A 3FKIJ 1SD5A 1LUJB 1HW5A 1XDSA 5TRDA 2F5FA 4WXHA 4MIMA 5JVTA 4H4KC 4HSRA 5LD2C 4IJAA 3JW4A 3L00A 1YOVB 2W84A 3TOAA 3VEPA 1Y8QB 3I71A 4BEHB 1E3OC 4J00A 3RYRA 3M1EA 2JUCA 1WJEA 1JUMA 1XDUA 1O3RA 3VFZA 3BTLA 4LK1F 4BDZA 3D0SA 1A36A 4L5EA 4RS8A 2LC2A 1TQIA 1IUYA 1IO2A 1U9NA 3E97A 3DU6A 4F92B 2BXZA 1HW2A 3BTCA 3H9JA 2XV4S 3ROUA 2V9KA 1Z67A 3JRDA 1L0OC 4BY7J 3GWZA 3K2ZA 1FP1D 2CS3A 4ENNA 4JP0A 5JFRA 2UXNA 1R5ID 3E5XA 4Y33A 1YLFA 3KZIC 1R4NB 5IY5H 1FT9A 2E60A 2IPQX 1FZPB 3TKYA 2HQNA 5IYDJ 4NHJA 5JVGF 1GV2A 2DTRA 3LSIA 2E1OA 4DOZA 1V5EA 3TOBA 4I76A 4I2OA 3BROA 2ICWG 4O6JA 1EF4A 1ZQ3P 2FSWA 4RGUA 2L2OA 2FBIA 1SD7A 2LY1A 1XGSA 3ZN1A 4BUPA 1BIAA 2KRFA 3RTRA 2WWYA 1WHUA 1ZK8A 3OS0A 1OKRA 2DMUA 2ADUA 2KJCA 3KP4A 4E4HA 2IGMA 4L9VA 3C3WA 3HKZN 3X2QH 2RNGA 2NNYA 2CGPA 2YSRA 3OR2C 4G6DA 2R5YA 1UCRA 1HLVA 1X1AA 1FPQA 1GHCA 5L3BA 3F3XA 1IRFA 2OZ6A 4OWRB 1ZG3A 3FISA 4XONA 1KYZA 2CH0A 1JUSA 3DV8A 2CRGA 4HDVA 4UVCA 1IN8A 3LA2A 4U88A 2OQGA 4CA0A 3CCJI 2ESHA 2P7VB 2K3FA 4OIPF 2DOFA 2BVMA 1HDPA 3LFUA 1XSXA 3DWLE 2ZO4A 1Q1VA 2CO5A 1WJFA 1IDZA 5JHUA 4JBAA 1I1GA 1X2NA 2HNHA 3BG7A 3QOEA 2D45A 3FK6A 2DFFA 3HSFA 3WGGA 3TP3A 5EZHA 3GTGJ 5FD5A 1IGNA 2O8XA 4E7IA 3LSTA 2COBA 2DLLA 3TP0A 4YIFA 4WXCA 1U3EM 5CYVA 4JX5A 3BOQA 4OIOF 3BCAA 5FRNA 3C2BA 2LKXA 2GXBA 1VZ0A 1FC3A 2E71A 1K4TA 1VQ5I 4J01A 2LYCA 1EJ9A 1UG0A 1HC8A 4ZYEA 3LNQA 2ZCWA 1LDKB 5GADJ 4GRIA 3OYDA 1D0XA 2WAQN 3DF8A 3BDDA 4L18B 3D5LA 2B7EA 4OIRF 2OD5A 1MBFA 5M3MJ 3HRSA 4RLQA 2Z16A 4AYBN 2HOEA 1W5SA 2VL8A 3K0LA 1JKQC 1HSTA 1Q1HA 1KYWA 3M8FA 4CCJA 3JRIA 3S1NJ 4CCKA 1FIPA 1YX5A 3GFLA 2EIMH 1SFUA 4BQOA 1U5TA 2JT1A 1OISA 1IJWC 4MEXF 2EWNA 4OU0A 4BE2A 1R58A 1A35A 1ZR2A 2R7WA 2EILH 3MKZA 2MC3A 1ZLJA 3WTUC 1T08B 1FSEA 4F91B 2DU9A 4MLOA 3CMMA 3WU0A 3GZNB 3SFIA 2JN6A 2Z2SB 3ZQHA 4A0XA 4CCLA 5HNHA 2L7FP 4I02A 1LFPA 1F43A 1DU0A 2V6EA 4RM3A 1J9IA 2DN0A 3F22A 5D5XB 3B6CA 3V7RA 5K7ZA 2CFOA 3IAM2 4A2UA 3EYYA 1BI0A 4OOIA 2R92J 5EJCA 3DTEA 2H94A 3QOPA 4HV5A 3WHCA 2DOAA 2H27A 2Y31A 5EDNA 1W1WE 5D4RA 3ASOH 3H9GA 1Z91A 5ICCA 2COMA 4Y13A 1OR7A 2RC4A 2Y0MA 4QLCU 1VQ6I 2FMYA 2Z9OA 4KISA 4AVPA 2XSDC 3H9QA 3ZQIA 4AWXB 3M9AA 2V26A 1YW8A 1T56A 2X0LA 3IWFA 2Q8KA 3OOPA 3S32A 1LPQA 3IUOA 2P4WA 2R4GA 4L5IA 4RGXA 2DMTA 4LIUA 2QA4I 5LRSA 1BJAA 4BS9A 4Z6YA 3L9FA 4Y7NJ 1Z21A 1UB9A 2EQRA 1LNWA 1IXSB 1FIAA 1SEUA 1F9NA 2B9SA 1CQTA 3B73A 1XSVA 1ZTRA 3KP2A 3W3CA 2W24A 3TGNA 2Z3YA 4EJOA 2ETHA 2PJRB 4Y4RA 1B6AA 3HUGB 3I53A 5E8GA 2MLKA 3COAC 3N97A 2YU3A 1HCRA 2ZFUA 4YFNF 4IHWA 1LDDA 1NK3P 5EGOA 1H0MA 2WC2A 4RB1A 1Y1WJ 5FFXA 1OCOH 1QA6A 4BKXA 3I4NJ 3HSRA 4KICA 5LGNA 2X85A 3CCRI 4N0BA 4A3LJ 1BN5A 1TC3C 5KCMA 4F7ZA 1S6LA 1HW1A 2DJNA 1VQPI 1XCBA 2RDPA 3K4LA 1X4PA 1V3FA 3IL2A 1BOBA 4FX0A 3GYHX 1S3JA 2STTA 3WTWC 3C1DA 3RPUA 1JT0A 2E1MC 1D0ZA 2QM3A 4WWCA 5FFZA 3WE3A 2Q2EA 1QZEA 3AG4H 3RZDJ 5IT3A 1VTNC 2CMPA 2P81A 2DA1A 5JR3A 1AU7A 4KIGA 2EV6A 2JVHA 3H0DA 1ZR4A 2XKOA 1E0EA 4NC7A 1OLTA 5DCFA 4ZDOA 5LEJA 1UHSA 4Z2YA 1ZREA 3QPTA 3BCBA 4B3XA 4GFBA 3M4OJ 4LD5A 3CDLA 4PCQA 5F0CA 4O5VA 3J80K 1BL0A 3K10A 1KU9A 3MWMA 3S2HJ 4HBLA 5BS6A 1XX5A 3PNYA 3K4JA 4TV7A 4BJTA 1AHDP 3DEWA 4LLNA 4S05A 2IRFG 2E34A 2H8RA 2DFIA 5J4YA 3OIQA 3A02A 1W5TA 4LFUA 4D1QA 3LSPA 2HXOA 2RNJA 4ESJA 1DP7P 3DEUA 3I64A 4PDKA 2XUBA 2NAZA 4U0VA 5EGOB 3BJ6A 3G73A 5HLIA 4BJ6C 1T38A 1TWCJ 2NS0A 2P6TA 1BW5A 1MJBA 1RNLA 1YI2I 2V9VA 2PFBA 2HQRA 1HSJA 1F36A 1SMYF 1VQKI 1MKMA 3AG1H 2VKVA 3AL0C 2IT0A 2XC7A 3BPVA 1WJAA 2GXGA 3BTIA 5JLXA 1I6XA 3ZMZA 4E7SA 3ISPA 5L3EA 1SFKA 2L7KA 5KAFC 3OWTA 3BZ6A 4HYEA 4K2EA 3S3OA 4G94A 4QIWN 1IZ1A 3G1OA 2HKXA 2IBDA 5D4SA 3DEEA 5DD4A 2EB7A 2E2JJ 5E20A 1V4RA 4Y17A 3AFHA 2A07F 3I58A 3LSGA 2FOWA 2GIVA 3ML6A 4RDUA 2D5VA 2QUFA 4A3EJ 5GPAA 4MGRA 4KA4A 5E1ZB 9ANTA 6PAXA 3CUQA 2R7ZJ 2KRHA 3OY9A 2HPMA 5D8LB 3ZRGA 4D5CA 3G6EI 3WTTC 4FE4A 4MEYF 3DPUA 3HYIA 4KMUX 2HOTA 2QQ8A 4Y52J 1A6QA 5A2QZ 3J7ZI 4QPQA 3QP6A 3BY6A 3M8EA 2EFNA 4EGYA 2L9RA 4I0BA 4ZDPA 1VQ9I 2IVMA 3HOWJ 2BY2A 2ISYA 1JI8A 5JLWA 2F4IA 4IQJA 1JT6A 5F04A 2FJ1A 2LNBA 5L3DA 1YO5C 3GMEA 1B8IA 2OTLI 3IKVA 5CVUA 3H5NA 1R36A 2IEKA 1LQ1A 2I8DA 3GCMA 2IGOA 4R1HA 4E7JA 3E1SA 4YELA 5FLXK 4XLNF 2LRDA 3VDXA 3DKXA 1ZLKA 2CYYA 2QQBA 4XKCA 1LEAA 2ME6A 4AIKA 3QRFF 2DBBA 1QVUA 3LSHA 5AONA 4PFOA 2G7UA 1HKSA 1QNTA 1B72B 3CESA 4N4OB 2RV8A 2BHYA 3EUHA 3PIOF 2MC4A 1KGSA 2XHKA 3VSKA 3F0CA 3FHNA 4WXDA 3RKYA 1PJRA 1Z6RA 4G6QA 2MSYA 2EK5A 3MCZA 1K4SA 3GBGA 5FGMA 2M9HA 4EJUA 4LJZF 5LBQA 4A3MJ 1R1TA 3I3LA 2R5ZA 1DPUA 3FMQA 3T1BA 3HL2A 2CQNA 3I0TA 2CUFA 3CJTB 4HX4A 1WJ5A 2JWTA 3F23A 1ETOA 3Q0UA 1OMIA 3SQNA 3WU1B 4RAYA 2FNAA 1OCPA 2KMUA 2K7LA 5C4JJ 2K9QA 3H36A 2MYSA 4YFXF 2W4SA 4ENKA 3CUQB 3CTAA 3F6VA 3ABMH 2CW0F 5IYCJ 2QSHX 3A4CA 5GTHC 2O8KA 1G3TA 1SVLA 4FX4A 1OJLA 3TW7A 3PQJA 3BTJA 1Z3YA 2M8GX 1JTYA 3R60A 4RGRA 4EV0A 4A3FJ 2VODA 5IPAA 2X6OA 3OIPA 3VYTB 2QEXI 1TL8A 1EA3A 4XSZF 3NQOA 2KQRA 2V6CA 3O6BB 4HLYA 1B8IB 3P9KA 4M9ZA 2NS7A 2HVQA 1IN4A 1K6YA 3M07A 3KETA 1BC8C 1RI7A 1D0YA 1ONVA 5GTIC 2CW8A 1O3QA 3SJMA 3FIWA 2O3FA 3RIRA 2CV1A 4A93J 1WH5A 5GPCA 5HLHA 3NARA 4HAMA 4P9UA 3T8TA 1LE8A 2KL4A 5JI6A 3MZHA 1I3QJ 2KISA 2R7FA 5J6XA 1R7JA 3ZPLA 4GDFA 3ZQCA 3HZJA 3KCCA 3HOVJ 1P4WA 2ECBA 4KJZA 4IL6C 5F64A 1OCTC 5J8FA 3F8MA 2IA1A 4BJ5C 3QU3A 4B44A 4BBRJ 4FTHA 2QLZA 1K78A 1WJCA 5LEKA 5ICFA 3JTGA 3W6VA 2NVYJ 3R0JA 2EZHA 2YX7A 2JSCA 3BR3A 2VI6A 4IEJA 1I39A 2H1KA 2LFBA 1JUPA 1MDMA 1ODDA 2HZTA 4XLFA 1TBXA 2HOSA 3I54A 2STWA 2ZNYA 2VONA 3A2KA 2BY0A 3WHBA 3CDIA 4B8XA 4KITB 3WG7H 1S5LC 4DW6A 5ERIA 3VWBA 4BQQA 3HOTA 3A1YA 5D8KB 2RAEA 3I4PA 1GLNA 1X3WB 3BG6A 4WF2A 1UHMA 3K6GA 3BR1A 4KN4X 5DV5A 1KQ9A 3RKXA 2XGDA 3CCLI 1WFXA 1UJ8A 3Q3SA 3CJRB 2EFQA 3G1LA 4V19K 1IAWA 4M9SA 2VXZA 1TWHJ 1GXPA 5LGUA 5J1RA 3ZMDA 1YG2A 4W1UA 2V79A 4LB6B 1QHGA 5K1YA 1PUFA 1D1BA 4LG3A 2MW8A 2G7HA 3VODA 1E3HA 5LRRA 3GFMA 2IS4A 2R7XA 2D2WA 2R0QC 1ETKA 1P4AA 4C9YA 1LE8B 2LY2A 4L0ZB 4IHYA 2LK2A 2X6YA 3D5SC 4RAGA 5K5OA 2JA6J 1SVOA 1FBUA 4XOTA 1R23A 2VC0A 4U7BA 3GTQJ 4DYRA 4I01A 4A0ZA 1BW6A 3LL7A 3VOEA 2EA2A 2F4MB 3QP5A 3HPGA 1BM9A 5TJJA 2KIFA 1RUNA 3BT9A 1K78B 3BQZA 2XVCA 2ZXWH 1WJDA 5E3OA 3CMYA 3S1MJ 2MD5A 3H5AA 5KHDA 4PGGA 1S7EA 2BHZA 4M71A 3L1PA 2GWRA 2ID6A 4XLCA 2Y0SN 2W48A 2XGXA 4XK4A 3LAJA 3FXUA 3GF2A 1Y56A 2FF4A 3S17J 3PFYA 4HDUA 1OFCX 2E5ZA 3NEUA 5ILVA 4NUBA 1T0FA 4D7NA 2BXYA 4DZPA 3GO5A 1VQOI 4X1EA 4HF1A 5IP6A 1W36D 1RR8C 1HDDC 3L2QA 3V7CA 1MMNA 5DUKA 2L4MA 1F1ZA 2DMPA 2ZMEB 1K6OA 3PIPF 3C18A 2EFWA 1QU3A 5J1UA 2DW4A 2FEZA 2VKHA 1VNDA 3MZ8A 3H0GJ 1XC5A 4JK1X 4AM3A 2EV0A 4GYGA 3CMEI 1PP8F 2D1HA 1UZCA 3BJOA 3CCYA 2WBMA 3E0JB 4DBQA 4FCYA 2ELHA 3DPLC 5D6EA 3ELKA 4LITA 1ON2A 2Z33A 1S7AA 3OYHA 1G3YA 2X9DA 1MSFC 4PJ0C 2LH9A 5C4XJ 2P5VA 2ZMEC 3V8KA 3BZKA 5DS9A 1TQMA 1TW3A 3CUOA 4C3JJ 3GX4X 4EATA 4MHGA 3SZPA 1JGGA 5BOXA 3LSJA 2IS2A 5CQGA 1GUUA 1SAUA 2F5EA 2E2IJ 2CG4A 3FX3A 2XKPA 1PDNC 3BPXA 3HM5A 4XN3A 3OYMA 4IOCF 2VPLA 1AA7A 4L0YB 1WVRA 4GO1A 2M87A 2UV1A 2OQRA 4WX9A 1OPCA 4GGGA 2XF5A 5BNGA 1ETXA 3HOZJ 1FOKA 2VKDA 2R3SA 1J2XA 1EH6A 2Y75A 2KZGA 3CZ6A 4A3DJ 1HA8A 1KZHA 5DUIA 1HKQA 2W85A 3UNGC 2O0YA 1V5FA 2RKHA 2ISZA 1BI1A 3S16J 2VKEA 2DCEA 3ZCOA 1QQIA 1BR1A 3HOXJ 2O03A 4PUSA 2KKOA 1FOXA 2XPUA 4I6ZA 2K5CA 1R00A 3BR5A 5K7FA 2BGCA 3PUBA 1IRGA 1Z77A 2VT2A 4EM1A 3OYGA 2Y69H 4N9IA 2KDZA 3CMAI 4C2UA 2CQXA 3I9V2 4BL0B 1PP7U 4IRIA 3EUAA 1IDYA 3FZVA 2IS1A 4IVNA 2JVGA 4GCVA 4HQMA 2DK5A 2E36A 4ITVA 4XRSA 4ENJA 1Z1DA 3EETA 3R61A 4L5JA 1O7FA 4CHUA 3KYLA 2JUGA 3I55I 4N4NB 3CC7I 4BHCA 3N05A 3RSNA 1YQAA 4FHTA 3CP8A 5HS8A 1TWFJ 4CYCA 1K61A 1X2MA 3VYSB 3SXYA 1ZGAA 1JTXA 3OR1C 5ICGA 1FBQA 3U1DA 3MKWB 3F8NA 1K7AA 3D1NI 5DM6F 3Q0WA 2EV5A 2GOMA 3ZQGA 1LDJA 3J7AO 2EZKA 4QPOA 4H0EA 4M9XA 2R5YB 3HHGA 1J09A 3Q9VA 1H89C 2QWWA 1P92A 4BE0A 1G2HA 4HZFA 5TGTA 5LLQA 2EZIA 2F48A 2M4KA 1U2WA 3K1NA 2QBYA 2XGEA 5H6QA 1ZGWA 2M0CA 1MBJA 2VQLA 3ZR8X 4LOCA 4CICA 1Z9CA 2VB6A 4EMSA 2I10A 1UMQA 2F5DA 1LVAA 3CO6C 2HWVA 4BDYA 1E17A 2O5RA 2PMZA 1QGPA 2FMLA 4A3KJ 3U21A 2OA4A 1E2XA 3LSKA 3I5UA 2HYJA 1WI9A 5EYRA 2NS8A 4KT6A 2CW7A 3LQRA 4B4CA 4XIDA 2QKLB 4NB5A 2DPUA 2IGKA 3W2VA 3S1QJ 4DBRA 3EPZA 3M7GA 1BA5A 5J1YA 2E7XA 5EEHA 2NXNB 5CQEA 5HDGA 2KRCA 3PO2J 3RCOA 3KEYA 4AYBA 4EM2A 4UUVA 1UG2A 2BVLA 2EBIA 1ITYA 2M8EA 2GZWA 4MTDA 3CLQA 2DYSH 2K40A 1JE8A 4ZH4F 2PLYA 4NC6A 3A01A 2EA4A 2HPIA 2NOGA 2O6GE 3FKJA 1MH3A 1X4OA 3ZQFA 2VN2A 3H3ZA 1D1AA 2K27A 2WB1N 5BPDA 1DP3A 2ESNA 1RIOH 3I4MJ 1WRJA 3EUKL 2M0MA 2LY9A 2JA7J 2MH9A 4UVBA 3BJAA 4EJWA 3ABLH 5K7HA 2VPRA 1IW7F 3QYBA 4JX4A 3GTMJ 2BEOA 3B02A 2NVXJ 1VQMI 1OCCH 1U5TB 2CU7A 1FEXA 1QPIA 1W36C 4LG0A 2V7FA 2QBYB 1H9GA 5BMZA 5E3LA 2MH2A 1O3TA 2QSGX 2H09A 3CCUI 1SFXA 3FXJA 1NG7A 1K79A 3JAMK 4FETA 2GA2A 2VT3A 3TQNA 3V7SA 1FX7A 2K02A 2LP0A 4HOBA 3G3ZA 2BE5F 1FP2A 2L0KA 5HVQC 3BLYA 3FBNB 2QVOA 5ED4A 1G6NA 2HYGD 2M5WA 2WA0A 2ZXHA 2VBXA 3UR3C 4DZJA 1Y1VJ 4DYQA 2IAIA 4KUMA 4OAZA 3WTVC 4A12A 2VOOA 4GYIA 3GXOA 2TDXA 2V9PA 1MBGA 2VJ4A 2XDVA 1TTYA 2RN7A 5CLSA 1P2FA 2X1EA 4OAYA 2Z1DA 3QWLA 2VE8A 1T33A 3A01B 1DUXC 4XRMA 5E79C 4KN7X 4I98B 1ON1A 1P7IA 3P5JA 3KZYA 4BXUA 1BOAA 4L9NA 3PL8A 2XSJC 3LQQA 1M1EB 1Z3XA 3LOCA 2K9NA 4RAFA 3CJQB 4HV6A 1ZRDA 2M1BA 1I50J 2XAUA 2PQ8A 3BWGA 1XSDA 1H8AC 4I99C 1PUEE 4UVAA 4XLAA 2HQAA 1U8RA 2LSOA 3J81K 5L3CA 4V2GA 4U7DA 2E1NA 4RLFA 3J80Z 1GVJA 1TZLA 2JMWA 3K4BA 4LG0B 2QYOA 5F0FA 3IRQA 2LF8A 4XRFA 4A3BJ 2CSOA 2DQLA 2BV6A 4V2FA 1F5TA 2HDDA 2GA1A 4D5FA 5FLMJ 2A6HF 3HTSB 1XTAA 2GXAA 1GVDA 1BI3A 1T2KA 4M73A 3RJPA 4A0YA 5AIPA 3SFZA 4M6YA 2P0WA 4HNTA 2R7TA 1MBHA 1XGMA 2ZJPF 4FE7A 4II2A 1MJ9A 3DBLB 2DT5A 3RKQA 1O3SA 1JKRC 1TWAJ 3H3VK 3HB9A 5L3GA 1USSA 3FF5A 1TT0A 4Q48A 5TISC 1XMXA 4ZYHA 4Y3OA 1MMSA 5GAHJ 3KYDB 3WTXC 2BZTA 2X1CA 3LSRA 1NTCA 4ZTFA 4IRGA 3ESWB 1MSEC 2HTJA 3TW6A 3SEZA 3JRHA 1S72I 4IOAF 4ZC3A 2PN6A 2LR8A 1PYVA 4XSXF 5E8IA 2Q2EB 5ILSA 1NG6A 3ZQ7A 2EFOA 2JTVA 3QAHA 1VQLI 5HLTA 2HI3A 3AG3H 2DA7A 2JZYA 3CDHA 2QCOA 2ACJA 3ERMA 2JRTA 4BHBA 3P7NA 4UUSA 3IP4B 1TT5B 3CCVI 3A03A 2VQCA 2IJLA 3ZXSA 1APLC 4I0AA 1RKTA 4HX7A 1TLHB 3D5RC 3HG9A 5KVRA 1WI3A 2ELKA 2QQAA 4XKBA 1BBYA 1A31A 4EJVA 2Z5UA 3DP7A 2DQRA 2OC6A 1ERDA 1S8NA 5LHGA 1OYYA 3DTIA 3GLXA 1TW2A 5E3MA 3PNTA 2AXTC 2IP2A 3M1CA 5FRMA 3JCUC 1FTZA 4UXNA 4S0HB 5ICEA 3LA3A 4CXFA 1ETQA 3ECHA 3I59A 2IGNA 3HPHA 1Y6IA 1FYLA 1U78A 2H6CA 3TBIA 3HTUA 4BAYA 5FLXZ 1RESA 5IT9K 4JYKA 2HOAA 1KONA 3WTSC 2VBYA 3MKYB 1IC8A 2KIMA 2GOXB 1JJ8C 2EIKH 3JRBA 1A6IA 5CVJA 2AS5F 4ZYDA 2E1CA 2LREA 1ZGJA 1SC7A 2M4GA 4BNCA 2A05A 2MA3A 2O61A 3OMYA 3DQVC 3DXJF 2Y48A 3PFIA 2KT0A 3C7JA 2E19A 1RC9A 3H35A 2K9LA 3SDGA 3BP8A 1OCRH 1WCMJ 3IC7A 2O9LA 3DLLF 3MZYA 2DO7A 3BZCA 1XN7A 1W0UA 2L3DA 1WH7A 3ABKH 3GZ5A 3DPTA 1RETA 1B4AA 3V42A 4ZZLA 1E3PA 5LHIA 5FKKA 2ZB9A 1FMWA 5HS7A 4LIVA 4ZDLA 1AKHA 1N75A 1JJ6C 1HOMA 2J5PA 3CCSI 4F93B 1OYIA 3OYKA 4HW0A 3MFKA 2CJJA 2ZFWA 3BG9A 1EKEA 3C2GA 2OUMA 1ZYRF 5B66C 1Z6TA 4E7ZA 4F3QA 4QTRA 2XB0X 1V5GA 2CQ7A 3GEZA 2Y9ZA 1XGNA 4U0YA 5DD8A 2DA4A 1SVMA 2FOKA 3U9GA 5D5VB 3S1RJ 4CCOA 2W57A 3I59B 2DDBA 3IH3A 1ZN2A 3OL4A 4N9HA 1JXSA 4AU7A 2L7MP
chains in the Genus database with same CATH topology
3CUQC 2YPRA 1ZHFA 3HRTA 4KYWA 1LJ9A 4YIIA 5CVRA 1R22A 1S29A 1I27A 1SFEA 3IWZA 1IN5A 5FB2A 1ZAOA 1EV7A 1H9TA 4AIJA 1RZ4A 3Q5FA 4BH9A 5DCMA 5HOOA 2A5YB 1JHFA 2C6YA 4PGHA 4RAZA 3EYIA 3WTYC 1JGSA 2G9WA 2RQPA 1FLIA 2A6EF 4KFCA 3HRUA 2BBYA 2EFPA 3PQKA 3P9IA 1MD0A 3IRRA 3E6MA 2UXXA 2HEOA 1QZYA 3RDIA 3ZMSA 1IF1A 5CVVA 3MQ0A 1UHWA 2NYXA 4MNUA 5F6FA 2DK8A 3L7WA 2WV0A 4HQEA 5CJ9A 1P6RA 4LK0F 2QENA 2FBHA 3ZMVA 1HBXG 4KNYA 1X3UA 3EDPA 4IXAA 1CF7A 1FBSA 3ULQB 3MAJA 3K69A 4OMZA 4GXOA 4U0WA 5ILUA 5L3FA 2VOPA 2FRHA 3QU6A 4G7HF 1EH7A 3S2WA 1Y0UA 4Q5SF 1MDMB 3U2RA 2FNPA 1FYMA 2L02A 2XASA 2K4BA 2OU2A 4A6DA 1ZG5A 3ERED 4O3MA 4ON0A 1IN7A 3FM5A 1QO0D 3LA7A 3WGHA 2KIUA 4M6XA 3LAPA 2XAHA 4S04A 4G7OF 1KU2A 4LGWA 1I5ZA 2HR3A 2LDUA 3FXQA 1FSHA 4ZZDA 4B09A 3GFIA 3N4MA 3FXRA 2VBZA 2JPBA 2LF7A 1AWCA 1J7KA 1G3SA 1CF7B 3F8FA 3FMRA 3ABUA 1XMKA 4AD9A 3REOA 1SD6A 2OBPA 1XGOA 4ESFA 1WSUA 3RYPA 1LEBA 2NNNA 2CQKA 4WCGA 1KU7A 3WG9A 2MLGA 3CLOA 2V1DA 5DDGA 2CWEA 1TQPA 4M72A 4BQAA 1T39A 3KEOA 4OIQF 4Q4ZF 1AOYA 3FHZA 2E7WA 2P7CB 2FXAA 3SHFA 1QPMA 3JTHA 4CZZA 4RB3C 3ZMTA 4OINF 1GXQA 1W7PA 3F6OA 3SZTA 1ULYA 1USTA 4KIFA 4A5MA 5E18F 1EH8A 4G7ZF 1NHAA 4KMFA 4MQ9F 3JSOA 4HX8A 1SMTA 3K1MA 3T0YA 2XAFA 4I7HA 2ZBKA 3L09A 1CGPA 4DQ2A 1DDNA 2F2EA 2RVCA 2B0LA 1ZG1A 2VE9A 4PZJA 2ZKZA 3F8CA 3F8BA 2VC1A 2K86A 4WK8F 1OYWA 5LHHA 3T8RA 3GVAA 1IN6A 4RB2C 2DPDA 1A04A 1TNTA 1C0WA 3K9TA 3HIFA 2PMHA 3HSEA 4HA8A 4CGZA 2PEXA 2BYVE 5BQTA 1W7PB 2KJBA 3O3KA 5LGTA 1STZA 2MBFA 5E1XA 3KZZA 4G9YA 1G4DA 2OZUA 3AAFA 2NRAC 5F1RA 4LLLA 2EJRA 4UNOA 4MTEA 2UZKA 3IHUA 4FT8A 3TO6A 3HUGA 3KP6A 3L2CA 3P9CA 2Q0OA 3MEXA 4A6EA 4EGZA 1Z05A 4XBFA 3DKWA 2A68F 4HF2A 3ZMUA 1T98A 4EJTA 4L9TA 3NRVA 1SD4A 1J59A 2HFHA 1WWXA 1YFHA 2A69F 1D8KA 3RKWA 1FY7A 1WKMA 4P9FA 3F21A 1DPRA 4ETSA 1S7OA 1D5VA 1XB4A 1FWZA 2PMUA 1YIOA 3KE2A 2QZ8A 2A61A 3H3UA 1W4MA 5HDKA 3JAMZ 2PJPA 2PG4A 1XCVA 4BYYA 2CFXA 4ASNA 2ZXJA 1U5TC 3HOSA 5D5UB 1T6SA 4CYDA 1BI2A 1ZH5A 1BIBA 1REPC 4EVIA 1J75A 4UHTA 3TDZC 3VB2A 4EM0B 2HGCA 2GAUA 4RB0A 2XAQA 4KT5C 1HXDA 2LKPA 5H6RA 2FU4A 4CO8A 4LMYA 5FD6A 4IHTA 2D1VA 3ABTA 3K1PA 4ENMA 4OMYA 3TDUC 1KQ8A 3J81Z 3R6SA 2JPCA 2W25A 4RGSA 2YR2A 2DI3A 2HDCA 2H6BA 5HDNA 2V1UA 5J8CA 4ESBA 5HLGA 1ZRFA 4LB5A 1TNSA 1B1BA 5AIQA 2L4AA 3E6BA 2PBIA 4I09A 2ZNZA 3GZ6A 1YS7A 4IRHA 4YFKF 1HKTA 1ZRCA 1L3LA 1YYVA 3LFKA 2A3SA 5K5RA 2L01A 5D6FA 2X4HA 1MGTA 4IPAA 1YTYA 5FO5A 1MZBA 4M74A 1FNNA 2HTSA 3IKTA 2Z99A 3WGIA 3HRMA 4LLGF 3RPQA 2IW5A 1R1UA 1XMAA 3FWEA 3CO7C 2F5CA 3V8LA 3RI4A 3ZP5A 1J5YA 4UV9A 3JSPA 2J5OA 1R5HA 4HF0A 5KK1A 1R1VA 3TO9A 5A2QK 4QWQA 3KLNA 3KFWX 5IT9Z 2VBWA 5DYMA 2XIGA 3R0AA 4R8HA 1KU3A 1XD7A 3HHHA 1ZARA 2QQ9A 5CVIA 4EQQA 3H92A 2UWMA 5H20A 3V8JA 2K4JA 1WQ2A 4Y15A 4P96A 4JQFA 1MJAA 1G3WA 2XAJA 2RGVA 4IHSA 4E70A 3KP5A 3CJNA 3GUDA 4IF4A 1QZZA 3QPHA 2FBKA 3E5UA 4YG2F 4NQWA 1IXCA 3R4KA 4R79A 1YW9A 4UV8A 3KLOA 3LWFA 3W6JB 1B59A 4XLPF 3WODF 5E1WA 1QBJA 2M30A 3V4GA 3KEQA 3EQLF 1KA8A 1IXRC 2P5KA 2DAOA 1D3YA 2IA0A 2HYFA 1UFMA 5EEGA 4HLXA 3FM3A 5DEQA 1FYKA 3F72A 2XROA 4P5OA 3W6KB 2WTEA 1Z7UA 5K5QA 2IA2A 2AXLA 4P55A 2V1XA 4A5NA 2ZJ2A 3E6DA 3DFGA 1B9NA 5E17F 3TO7A 2FA5A 1O57A 2HS5A 2XAGA 4D0PA 2FQ3A 5D5WB 3OV8A 1YW7A 4BHPA 1HQCA 1R5GA 2ZMEA 2OAZA 3WTZA 4DNCA 3E6CC 3GW2A 2L54A 2HKOA 4AIHA 1W7PD 3Q9SA 5HS9A 3GFJA 4KIBA 1JHHA 3FMSA 5DCMB 5BPIA 3E5QA 2M45A 1U6GA 1J0RA 2XRNA 1BC7C 4MQVA 1P4XA 2P5LC 2R7DA 4Q47A 3KP3A 4ZYGA 3KP7A 1B9MA 2GQQA 1LB2A 3ECOA 2PI0A 4L9JA 2P6SA 3WE2A 2YX4A 2FE3A 1F4KA 1KQ0A 1O7LA 3T5XA 1I1SA 4CDGA 1SAXA 3O2PE 2P8TA 3E3VA 3ZN0A 1RUOA 4G8XA 1D8JA 4KDPA 1YS6A 1SD5A 1XDSA 1HW5A 5TRDA 2F5FA 4WXHA 5JVTA 4IJAA 3JW4A 3L00A 2W84A 3TOAA 3VEPA 3I71A 3RYRA 3M1EA 1XDUA 1O3RA 3VFZA 4LK1F 3D0SA 4RS8A 1TQIA 1IUYA 3E97A 1HW2A 2XV4S 3ROUA 1L0OC 3GWZA 3K2ZA 1FP1D 4ENNA 5JFRA 2UXNA 3E5XA 1YLFA 1FT9A 2IPQX 1FZPB 3TKYA 2HQNA 4NHJA 2DTRA 3TOBA 4I2OA 3BROA 4O6JA 2FSWA 4RGUA 2FBIA 1SD7A 1XGSA 3ZN1A 1BIAA 2KRFA 3RTRA 2WWYA 1OKRA 2ADUA 2KJCA 3KP4A 4L9VA 3C3WA 2CGPA 2NNYA 2YSRA 4G6DA 1UCRA 1FPQA 1GHCA 5L3BA 3F3XA 1IRFA 2OZ6A 1ZG3A 1KYZA 3DV8A 4HDVA 4UVCA 1IN8A 3LA2A 4U88A 2OQGA 2ESHA 2P7VB 4OIPF 1XSXA 2ZO4A 2CO5A 5JHUA 4JBAA 1I1GA 2D45A 3HSFA 3WGGA 5FD5A 2O8XA 3LSTA 2DLLA 4YIFA 4WXCA 1U3EM 5CYVA 4OIOF 3BOQA 2GXBA 1FC3A 4ZYEA 2ZCWA 1LDKB 3DF8A 4L18B 3BDDA 3D5LA 4OIRF 2OD5A 3HRSA 2HOEA 1W5SA 3K0LA 1HSTA 1Q1HA 1KYWA 3M8FA 3GFLA 1SFUA 1U5TA 2JT1A 4MEXF 4OU0A 2EWNA 1R58A 2MC3A 1ZLJA 3WTUC 1FSEA 2DU9A 3WU0A 4A0XA 4I02A 1J9IA 3F22A 5D5XB 3V7RA 4A2UA 3EYYA 1BI0A 4OOIA 2H94A 3QOPA 4HV5A 2H27A 5D4RA 1Z91A 5ICCA 2COMA 4Y13A 1OR7A 2RC4A 2Y0MA 4QLCU 2FMYA 2Z9OA 4AVPA 4AWXB 3M9AA 1YW8A 2X0LA 3IWFA 2Q8KA 3OOPA 2P4WA 4L5IA 4RGXA 5LRSA 1BJAA 3L9FA 1UB9A 1LNWA 1IXSB 1F9NA 3B73A 1XSVA 3KP2A 2W24A 3TGNA 2Z3YA 4EJOA 2ETHA 1B6AA 3I53A 5E8GA 2MLKA 3COAC 3N97A 2YU3A 4YFNF 1LDDA 1H0MA 2WC2A 4RB1A 5FFXA 3HSRA 4KICA 5LGNA 4N0BA 1BN5A 4F7ZA 1S6LA 1HW1A 1XCBA 2RDPA 1V3FA 3IL2A 4FX0A 3GYHX 1S3JA 2STTA 3WTWC 3C1DA 3RPUA 2QM3A 4WWCA 5FFZA 3WE3A 2Q2EA 5IT3A 1VTNC 5JR3A 4KIGA 2EV6A 2XKOA 5DCFA 5LEJA 4Z2YA 1ZREA 3QPTA 4LD5A 4PCQA 4O5VA 3J80K 1KU9A 3MWMA 4HBLA 5BS6A 4TV7A 4LLNA 4S05A 2IRFG 2DFIA 1W5TA 4LFUA 4ESJA 2RNJA 1DP7P 3DEUA 3I64A 4PDKA 2XUBA 2NAZA 4U0VA 3BJ6A 3G73A 5HLIA 1T38A 2NS0A 2P6TA 1MJBA 1RNLA 2V9VA 2PFBA 2HQRA 1HSJA 1SMYF 1MKMA 2IT0A 3BPVA 2GXGA 1I6XA 3ZMZA 3ISPA 5L3EA 3BZ6A 4HYEA 4K2EA 4G94A 1IZ1A 2HKXA 5D4SA 5DD4A 2EB7A 5E20A 1V4RA 4Y17A 2A07F 3I58A 2GIVA 3ML6A 2QUFA 4MGRA 4KA4A 5E1ZB 6PAXA 3CUQA 5D8LB 3WTTC 4MEYF 3HYIA 4KMUX 5A2QZ 3QP6A 3BY6A 3M8EA 2EFNA 4EGYA 4I0BA 2IVMA 2ISYA 1YO5C 5L3DA 2LNBA 3IKVA 5CVUA 1R36A 1LQ1A 4R1HA 5FLXK 4XLNF 1ZLKA 2CYYA 2QQBA 4AIKA 1LEAA 3QRFF 2DBBA 5AONA 2G7UA 1HKSA 1QNTA 2RV8A 3EUHA 1KGSA 2XHKA 4WXDA 3RKYA 1Z6RA 4G6QA 2EK5A 3MCZA 5FGMA 4EJUA 4LJZF 5LBQA 1R1TA 1DPUA 3FMQA 3T1BA 3I0TA 4HX4A 3F23A 1OMIA 3SQNA 3WU1B 4RAYA 2FNAA 2K7LA 4YFXF 4ENKA 3CUQB 3CTAA 3F6VA 2CW0F 1G3TA 4FX4A 3PQJA 3R60A 4RGRA 4EV0A 2VODA 4XSZF 3NQOA 2V6CA 3O6BB 4HLYA 3P9KA 4M9ZA 1IN4A 3KETA 1BC8C 1RI7A 1ONVA 1O3QA 2O3FA 3RIRA 5HLHA 4HAMA 4P9UA 3T8TA 5JI6A 3MZHA 2R7FA 5J6XA 1R7JA 3ZPLA 3KCCA 1P4WA 5F64A 5J8FA 3F8MA 2IA1A 3QU3A 2QLZA 1K78A 5LEKA 5ICFA 3JTGA 3R0JA 2YX7A 2JSCA 1MDMA 1ODDA 2HZTA 1TBXA 2STWA 3I54A 2VONA 2ZNYA 4B8XA 5ERIA 3HOTA 5D8KB 3I4PA 4WF2A 1UHMA 5DV5A 4KN4X 1KQ9A 3RKXA 2EFQA 1IAWA 4M9SA 2VXZA 1GXPA 5LGUA 3ZMDA 1YG2A 5K1YA 2V79A 4LB6B 2G7HA 3VODA 5LRRA 3GFMA 2D2WA 1P4AA 4L0ZB 5K5OA 1FBUA 1R23A 2VC0A 4U7BA 4I01A 4A0ZA 3VOEA 2EA2A 3QP5A 5TJJA 1BM9A 2KIFA 1RUNA 1K78B 2XVCA 2MD5A 4PGGA 4M71A 2GWRA 2XGXA 3LAJA 3FXUA 3GF2A 2FF4A 4HDUA 3NEUA 5ILVA 1T0FA 3GO5A 4HF1A 3V7CA 5DUKA 2L4MA 1F1ZA 2ZMEB 1K6OA 2EFWA 3C18A 2DW4A 2FEZA 4JK1X 2EV0A 4GYGA 1PP8F 2D1HA 3BJOA 2ELHA 3DPLC 5D6EA 3ELKA 1ON2A 2Z33A 1S7AA 1G3YA 2P5VA 3V8KA 1TQMA 1TW3A 3CUOA 3GX4X 4MHGA 3SZPA 5BOXA 2F5EA 2CG4A 3FX3A 2XKPA 1PDNC 3BPXA 4L0YB 4GO1A 2M87A 2OQRA 4WX9A 1OPCA 4GGGA 1FOKA 2R3SA 1J2XA 1EH6A 2Y75A 5DUIA 1HKQA 2W85A 2O0YA 2RKHA 2ISZA 1BI1A 1QQIA 2O03A 2KKOA 1R00A 2BGCA 1IRGA 2VT2A 4EM1A 4N9IA 1PP7U 4IRIA 3FZVA 4IVNA 4GCVA 4HQMA 2DK5A 4ENJA 1Z1DA 3EETA 3R61A 4L5JA 1O7FA 4CHUA 4BHCA 1YQAA 4FHTA 5HS8A 3SXYA 1ZGAA 5ICGA 1FBQA 3U1DA 3F8NA 1K7AA 2EV5A 1LDJA 3J7AO 4H0EA 4M9XA 3HHGA 3Q9VA 2QWWA 1P92A 4HZFA 5LLQA 1U2WA 3K1NA 2QBYA 5H6QA 4CICA 1Z9CA 4EMSA 2F5DA 1LVAA 3CO6C 2HWVA 1E17A 1QGPA 2FMLA 2OA4A 1E2XA 3I5UA 1WI9A 3LQRA 4NB5A 2DPUA 3M7GA 2E7XA 5EEHA 5HDGA 4EM2A 4UUVA 2M8EA 2GZWA 4MTDA 1JE8A 4ZH4F 2PLYA 2EA4A 2O6GE 2VN2A 3H3ZA 5BPDA 2K27A 2ESNA 1RIOH 1WRJA 2MH9A 4UVBA 3BJAA 4EJWA 1IW7F 2BEOA 3B02A 1U5TB 4LG0A 2QBYB 1H9GA 5BMZA 2MH2A 1O3TA 2H09A 1SFXA 1K79A 3JAMK 3TQNA 2GA2A 2VT3A 3V7SA 1FX7A 2K02A 4HOBA 3G3ZA 2BE5F 1FP2A 5HVQC 2QVOA 5ED4A 1G6NA 2HYGD 2M5WA 2VBXA 3WTVC 4KUMA 2VOOA 4A12A 4GYIA 3GXOA 2TDXA 5CLSA 1TTYA 2RN7A 1P2FA 2VE8A 1DUXC 4KN7X 4I98B 1ON1A 3KZYA 4BXUA 1BOAA 4L9NA 3LQQA 4HV6A 1ZRDA 2M1BA 2PQ8A 3BWGA 1XSDA 1PUEE 4UVAA 1U8RA 2LSOA 3J81K 5L3CA 4U7DA 2E1NA 3J80Z 1GVJA 4LG0B 2QYOA 3IRQA 2LF8A 4XRFA 2CSOA 2DQLA 2BV6A 1F5TA 2GA1A 2A6HF 3HTSB 1BI3A 1T2KA 4M73A 3RJPA 4A0YA 5AIPA 3SFZA 4M6YA 1XGMA 1MJ9A 2DT5A 1O3SA 5L3GA 1USSA 3FF5A 4Q48A 4ZYHA 3WTXC 4IRGA 2HTJA 2PN6A 4XSXF 5E8IA 5ILSA 3ZQ7A 2EFOA 2JTVA 3QAHA 2JZYA 3CDHA 2ACJA 2JRTA 4BHBA 3P7NA 2IJLA 4I0AA 4HX7A 1TLHB 5KVRA 2QQAA 1BBYA 4EJVA 2Z5UA 3DP7A 2DQRA 1S8NA 5LHGA 1OYYA 3GLXA 1TW2A 2IP2A 4UXNA 5ICEA 3LA3A 4CXFA 3ECHA 3I59A 1FYLA 1U78A 2H6CA 3HTUA 4BAYA 5FLXZ 5IT9K 3WTSC 2VBYA 2KIMA 5CVJA 2AS5F 4ZYDA 2E1CA 1ZGJA 4BNCA 2MA3A 2O61A 3DQVC 3DXJF 2Y48A 3PFIA 3C7JA 3BP8A 3IC7A 3MZYA 2DO7A 1XN7A 2L3DA 3GZ5A 3DPTA 1B4AA 4ZZLA 5LHIA 5HS7A 2J5PA 1OYIA 4HW0A 3MFKA 2ZFWA 1ZYRF 1Z6TA 3GEZA 1XGNA 4U0YA 5DD8A 2FOKA 3U9GA 5D5VB 2W57A 3I59B 1ZN2A 4N9HA 1JXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ C;  2YPR A;  1ZHF A;  3HRT A;  4KYW A;  1LJ9 A;  4YII A;  5CVR A;  1R22 A;  1S29 A;  1I27 A;  1SFE A;  3IWZ A;  1IN5 A;  5FB2 A;  1ZAO A;  1EV7 A;  1H9T A;  4AIJ A;  1RZ4 A;  3Q5F A;  4BH9 A;  5DCM A;  5HOO A;  2A5Y B;  1JHF A;  2C6Y A;  4PGH A;  4RAZ A;  3EYI A;  3WTY C;  1JGS A;  2G9W A;  2RQP A;  1FLI A;  2A6E F;  4KFC A;  3HRU A;  2BBY A;  2EFP A;  3PQK A;  3P9I A;  1MD0 A;  3IRR A;  3E6M A;  2UXX A;  2HEO A;  1QZY A;  3RDI A;  3ZMS A;  1IF1 A;  5CVV A;  3MQ0 A;  1UHW A;  2NYX A;  4MNU A;  5F6F A;  2DK8 A;  3L7W A;  2WV0 A;  4HQE A;  5CJ9 A;  1P6R A;  4LK0 F;  2QEN A;  2FBH A;  3ZMV A;  1HBX G;  4KNY A;  1X3U A;  3EDP A;  4IXA A;  1CF7 A;  1FBS A;  3ULQ B;  3MAJ A;  3K69 A;  4OMZ A;  4GXO A;  4U0W A;  5ILU A;  5L3F A;  2VOP A;  2FRH A;  3QU6 A;  4G7H F;  1EH7 A;  3S2W A;  1Y0U A;  4Q5S F;  1MDM B;  3U2R A;  2FNP A;  1FYM A;  2L02 A;  2XAS A;  2K4B A;  2OU2 A;  4A6D A;  1ZG5 A;  3ERE D;  4O3M A;  4ON0 A;  1IN7 A;  3FM5 A;  1QO0 D;  3LA7 A;  3WGH A;  2KIU A;  4M6X A;  3LAP A;  2XAH A;  4S04 A;  4G7O F;  1KU2 A;  4LGW A;  1I5Z A;  2HR3 A;  2LDU A;  3FXQ A;  1FSH A;  4ZZD A;  4B09 A;  3GFI A;  3N4M A;  3FXR A;  2VBZ A;  2JPB A;  2LF7 A;  1AWC A;  1J7K A;  1G3S A;  1CF7 B;  3F8F A;  3FMR A;  3ABU A;  1XMK A;  4AD9 A;  3REO A;  1SD6 A;  2OBP A;  1XGO A;  4ESF A;  1WSU A;  3RYP A;  1LEB A;  2NNN A;  2CQK A;  4WCG A;  1KU7 A;  3WG9 A;  2MLG A;  3CLO A;  2V1D A;  5DDG A;  2CWE A;  1TQP A;  4M72 A;  4BQA A;  1T39 A;  3KEO A;  4OIQ F;  4Q4Z F;  1AOY A;  3FHZ A;  2E7W A;  2P7C B;  2FXA A;  3SHF A;  1QPM A;  3JTH A;  4CZZ A;  4RB3 C;  3ZMT A;  4OIN F;  1GXQ A;  1W7P A;  3F6O A;  3SZT A;  1ULY A;  1UST A;  4KIF A;  4A5M A;  5E18 F;  1EH8 A;  4G7Z F;  1NHA A;  4KMF A;  4MQ9 F;  3JSO A;  4HX8 A;  1SMT A;  3K1M A;  3T0Y A;  2XAF A;  4I7H A;  2ZBK A;  3L09 A;  1CGP A;  4DQ2 A;  1DDN A;  2F2E A;  2RVC A;  2B0L A;  1ZG1 A;  2VE9 A;  4PZJ A;  2ZKZ A;  3F8C A;  3F8B A;  2VC1 A;  2K86 A;  4WK8 F;  1OYW A;  5LHH A;  3T8R A;  3GVA A;  1IN6 A;  4RB2 C;  2DPD A;  1A04 A;  1TNT A;  1C0W A;  3K9T A;  3HIF A;  2PMH A;  3HSE A;  4HA8 A;  4CGZ A;  2PEX A;  2BYV E;  5BQT A;  1W7P B;  2KJB A;  3O3K A;  5LGT A;  1STZ A;  2MBF A;  5E1X A;  3KZZ A;  4G9Y A;  1G4D A;  2OZU A;  3AAF A;  2NRA C;  5F1R A;  4LLL A;  2EJR A;  4UNO A;  4MTE A;  2UZK A;  3IHU A;  4FT8 A;  3TO6 A;  3HUG A;  3KP6 A;  3L2C A;  3P9C A;  2Q0O A;  3MEX A;  4A6E A;  4EGZ A;  1Z05 A;  4XBF A;  3DKW A;  2A68 F;  4HF2 A;  3ZMU A;  1T98 A;  4EJT A;  4L9T A;  3NRV A;  1SD4 A;  1J59 A;  2HFH A;  1WWX A;  1YFH A;  2A69 F;  1D8K A;  3RKW A;  1FY7 A;  1WKM A;  4P9F A;  3F21 A;  1DPR A;  4ETS A;  1S7O A;  1D5V A;  1XB4 A;  1FWZ A;  2PMU A;  1YIO A;  3KE2 A;  2QZ8 A;  2A61 A;  3H3U A;  1W4M A;  5HDK A;  3JAM Z;  2PJP A;  2PG4 A;  1XCV A;  4BYY A;  2CFX A;  4ASN A;  2ZXJ A;  1U5T C;  3HOS A;  5D5U B;  1T6S A;  4CYD A;  1BI2 A;  1ZH5 A;  1BIB A;  1REP C;  4EVI A;  1J75 A;  4UHT A;  3TDZ C;  3VB2 A;  4EM0 B;  2HGC A;  2GAU A;  4RB0 A;  2XAQ A;  4KT5 C;  1HXD A;  2LKP A;  5H6R A;  2FU4 A;  4CO8 A;  4LMY A;  5FD6 A;  4IHT A;  2D1V A;  3ABT A;  3K1P A;  4ENM A;  4OMY A;  3TDU C;  1KQ8 A;  3J81 Z;  3R6S A;  2JPC A;  2W25 A;  4RGS A;  2YR2 A;  2DI3 A;  2HDC A;  2H6B A;  5HDN A;  2V1U A;  5J8C A;  4ESB A;  5HLG A;  1ZRF A;  4LB5 A;  1TNS A;  1B1B A;  5AIQ A;  2L4A A;  3E6B A;  2PBI A;  4I09 A;  2ZNZ A;  3GZ6 A;  1YS7 A;  4IRH A;  4YFK F;  1HKT A;  1ZRC A;  1L3L A;  1YYV A;  3LFK A;  2A3S A;  5K5R A;  2L01 A;  5D6F A;  2X4H A;  1MGT A;  4IPA A;  1YTY A;  5FO5 A;  1MZB A;  4M74 A;  1FNN A;  2HTS A;  3IKT A;  2Z99 A;  3WGI A;  3HRM A;  4LLG F;  3RPQ A;  2IW5 A;  1R1U A;  1XMA A;  3FWE A;  3CO7 C;  2F5C A;  3V8L A;  3RI4 A;  3ZP5 A;  1J5Y A;  4UV9 A;  3JSP A;  2J5O A;  1R5H A;  4HF0 A;  5KK1 A;  1R1V A;  3TO9 A;  5A2Q K;  4QWQ A;  3KLN A;  3KFW X;  5IT9 Z;  2VBW A;  5DYM A;  2XIG A;  3R0A A;  4R8H A;  1KU3 A;  1XD7 A;  3HHH A;  1ZAR A;  2QQ9 A;  5CVI A;  4EQQ A;  3H92 A;  2UWM A;  5H20 A;  3V8J A;  2K4J A;  1WQ2 A;  4Y15 A;  4P96 A;  4JQF A;  1MJA A;  1G3W A;  2XAJ A;  2RGV A;  4IHS A;  4E70 A;  3KP5 A;  3CJN A;  3GUD A;  4IF4 A;  1QZZ A;  3QPH A;  2FBK A;  3E5U A;  4YG2 F;  4NQW A;  1IXC A;  3R4K A;  4R79 A;  1YW9 A;  4UV8 A;  3KLO A;  3LWF A;  3W6J B;  1B59 A;  4XLP F;  3WOD F;  5E1W A;  1QBJ A;  2M30 A;  3V4G A;  3KEQ A;  3EQL F;  1KA8 A;  1IXR C;  2P5K A;  2DAO A;  1D3Y A;  2IA0 A;  2HYF A;  1UFM A;  5EEG A;  4HLX A;  3FM3 A;  5DEQ A;  1FYK A;  3F72 A;  2XRO A;  4P5O A;  3W6K B;  2WTE A;  1Z7U A;  5K5Q A;  2IA2 A;  2AXL A;  4P55 A;  2V1X A;  4A5N A;  2ZJ2 A;  3E6D A;  3DFG A;  1B9N A;  5E17 F;  3TO7 A;  2FA5 A;  1O57 A;  2HS5 A;  2XAG A;  4D0P A;  2FQ3 A;  5D5W B;  3OV8 A;  1YW7 A;  4BHP A;  1HQC A;  1R5G A;  2ZME A;  2OAZ A;  3WTZ A;  4DNC A;  3E6C C;  3GW2 A;  2L54 A;  2HKO A;  4AIH A;  1W7P D;  3Q9S A;  5HS9 A;  3GFJ A;  4KIB A;  1JHH A;  3FMS A;  5DCM B;  5BPI A;  3E5Q A;  2M45 A;  1U6G A;  1J0R A;  2XRN A;  1BC7 C;  4MQV A;  1P4X A;  2P5L C;  2R7D A;  4Q47 A;  3KP3 A;  4ZYG A;  3KP7 A;  1B9M A;  2GQQ A;  1LB2 A;  3ECO A;  2PI0 A;  4L9J A;  2P6S A;  3WE2 A;  2YX4 A;  2FE3 A;  1F4K A;  1KQ0 A;  1O7L A;  3T5X A;  1I1S A;  4CDG A;  1SAX A;  3O2P E;  2P8T A;  3E3V A;  3ZN0 A;  1RUO A;  4G8X A;  1D8J A;  4KDP A;  1YS6 A;  1SD5 A;  1XDS A;  1HW5 A;  5TRD A;  2F5F A;  4WXH A;  5JVT A;  4IJA A;  3JW4 A;  3L00 A;  2W84 A;  3TOA A;  3VEP A;  3I71 A;  3RYR A;  3M1E A;  1XDU A;  1O3R A;  3VFZ A;  4LK1 F;  3D0S A;  4RS8 A;  1TQI A;  1IUY A;  3E97 A;  1HW2 A;  2XV4 S;  3ROU A;  1L0O C;  3GWZ A;  3K2Z A;  1FP1 D;  4ENN A;  5JFR A;  2UXN A;  3E5X A;  1YLF A;  1FT9 A;  2IPQ X;  1FZP B;  3TKY A;  2HQN A;  4NHJ A;  2DTR A;  3TOB A;  4I2O A;  3BRO A;  4O6J A;  2FSW A;  4RGU A;  2FBI A;  1SD7 A;  1XGS A;  3ZN1 A;  1BIA A;  2KRF A;  3RTR A;  2WWY A;  1OKR A;  2ADU A;  2KJC A;  3KP4 A;  4L9V A;  3C3W A;  2CGP A;  2NNY A;  2YSR A;  4G6D A;  1UCR A;  1FPQ A;  1GHC A;  5L3B A;  3F3X A;  1IRF A;  2OZ6 A;  1ZG3 A;  1KYZ A;  3DV8 A;  4HDV A;  4UVC A;  1IN8 A;  3LA2 A;  4U88 A;  2OQG A;  2ESH A;  2P7V B;  4OIP F;  1XSX A;  2ZO4 A;  2CO5 A;  5JHU A;  4JBA A;  1I1G A;  2D45 A;  3HSF A;  3WGG A;  5FD5 A;  2O8X A;  3LST A;  2DLL A;  4YIF A;  4WXC A;  1U3E M;  5CYV A;  4OIO F;  3BOQ A;  2GXB A;  1FC3 A;  4ZYE A;  2ZCW A;  1LDK B;  3DF8 A;  4L18 B;  3BDD A;  3D5L A;  4OIR F;  2OD5 A;  3HRS A;  2HOE A;  1W5S A;  3K0L A;  1HST A;  1Q1H A;  1KYW A;  3M8F A;  3GFL A;  1SFU A;  1U5T A;  2JT1 A;  4MEX F;  4OU0 A;  2EWN A;  1R58 A;  2MC3 A;  1ZLJ A;  3WTU C;  1FSE A;  2DU9 A;  3WU0 A;  4A0X A;  4I02 A;  1J9I A;  3F22 A;  5D5X B;  3V7R A;  4A2U A;  3EYY A;  1BI0 A;  4OOI A;  2H94 A;  3QOP A;  4HV5 A;  2H27 A;  5D4R A;  1Z91 A;  5ICC A;  2COM A;  4Y13 A;  1OR7 A;  2RC4 A;  2Y0M A;  4QLC U;  2FMY A;  2Z9O A;  4AVP A;  4AWX B;  3M9A A;  1YW8 A;  2X0L A;  3IWF A;  2Q8K A;  3OOP A;  2P4W A;  4L5I A;  4RGX A;  5LRS A;  1BJA A;  3L9F A;  1UB9 A;  1LNW A;  1IXS B;  1F9N A;  3B73 A;  1XSV A;  3KP2 A;  2W24 A;  3TGN A;  2Z3Y A;  4EJO A;  2ETH A;  1B6A A;  3I53 A;  5E8G A;  2MLK A;  3COA C;  3N97 A;  2YU3 A;  4YFN F;  1LDD A;  1H0M A;  2WC2 A;  4RB1 A;  5FFX A;  3HSR A;  4KIC A;  5LGN A;  4N0B A;  1BN5 A;  4F7Z A;  1S6L A;  1HW1 A;  1XCB A;  2RDP A;  1V3F A;  3IL2 A;  4FX0 A;  3GYH X;  1S3J A;  2STT A;  3WTW C;  3C1D A;  3RPU A;  2QM3 A;  4WWC A;  5FFZ A;  3WE3 A;  2Q2E A;  5IT3 A;  1VTN C;  5JR3 A;  4KIG A;  2EV6 A;  2XKO A;  5DCF A;  5LEJ A;  4Z2Y A;  1ZRE A;  3QPT A;  4LD5 A;  4PCQ A;  4O5V A;  3J80 K;  1KU9 A;  3MWM A;  4HBL A;  5BS6 A;  4TV7 A;  4LLN A;  4S05 A;  2IRF G;  2DFI A;  1W5T A;  4LFU A;  4ESJ A;  2RNJ A;  1DP7 P;  3DEU A;  3I64 A;  4PDK A;  2XUB A;  2NAZ A;  4U0V A;  3BJ6 A;  3G73 A;  5HLI A;  1T38 A;  2NS0 A;  2P6T A;  1MJB A;  1RNL A;  2V9V A;  2PFB A;  2HQR A;  1HSJ A;  1SMY F;  1MKM A;  2IT0 A;  3BPV A;  2GXG A;  1I6X A;  3ZMZ A;  3ISP A;  5L3E A;  3BZ6 A;  4HYE A;  4K2E A;  4G94 A;  1IZ1 A;  2HKX A;  5D4S A;  5DD4 A;  2EB7 A;  5E20 A;  1V4R A;  4Y17 A;  2A07 F;  3I58 A;  2GIV A;  3ML6 A;  2QUF A;  4MGR A;  4KA4 A;  5E1Z B;  6PAX A;  3CUQ A;  5D8L B;  3WTT C;  4MEY F;  3HYI A;  4KMU X;  5A2Q Z;  3QP6 A;  3BY6 A;  3M8E A;  2EFN A;  4EGY A;  4I0B A;  2IVM A;  2ISY A;  1YO5 C;  5L3D A;  2LNB A;  3IKV A;  5CVU A;  1R36 A;  1LQ1 A;  4R1H A;  5FLX K;  4XLN F;  1ZLK A;  2CYY A;  2QQB A;  4AIK A;  1LEA A;  3QRF F;  2DBB A;  5AON A;  2G7U A;  1HKS A;  1QNT A;  2RV8 A;  3EUH A;  1KGS A;  2XHK A;  4WXD A;  3RKY A;  1Z6R A;  4G6Q A;  2EK5 A;  3MCZ A;  5FGM A;  4EJU A;  4LJZ F;  5LBQ A;  1R1T A;  1DPU A;  3FMQ A;  3T1B A;  3I0T A;  4HX4 A;  3F23 A;  1OMI A;  3SQN A;  3WU1 B;  4RAY A;  2FNA A;  2K7L A;  4YFX F;  4ENK A;  3CUQ B;  3CTA A;  3F6V A;  2CW0 F;  1G3T A;  4FX4 A;  3PQJ A;  3R60 A;  4RGR A;  4EV0 A;  2VOD A;  4XSZ F;  3NQO A;  2V6C A;  3O6B B;  4HLY A;  3P9K A;  4M9Z A;  1IN4 A;  3KET A;  1BC8 C;  1RI7 A;  1ONV A;  1O3Q A;  2O3F A;  3RIR A;  5HLH A;  4HAM A;  4P9U A;  3T8T A;  5JI6 A;  3MZH A;  2R7F A;  5J6X A;  1R7J A;  3ZPL A;  3KCC A;  1P4W A;  5F64 A;  5J8F A;  3F8M A;  2IA1 A;  3QU3 A;  2QLZ A;  1K78 A;  5LEK A;  5ICF A;  3JTG A;  3R0J A;  2YX7 A;  2JSC A;  1MDM A;  1ODD A;  2HZT A;  1TBX A;  2STW A;  3I54 A;  2VON A;  2ZNY A;  4B8X A;  5ERI A;  3HOT A;  5D8K B;  3I4P A;  4WF2 A;  1UHM A;  5DV5 A;  4KN4 X;  1KQ9 A;  3RKX A;  2EFQ A;  1IAW A;  4M9S A;  2VXZ A;  1GXP A;  5LGU A;  3ZMD A;  1YG2 A;  5K1Y A;  2V79 A;  4LB6 B;  2G7H A;  3VOD A;  5LRR A;  3GFM A;  2D2W A;  1P4A A;  4L0Z B;  5K5O A;  1FBU A;  1R23 A;  2VC0 A;  4U7B A;  4I01 A;  4A0Z A;  3VOE A;  2EA2 A;  3QP5 A;  5TJJ A;  1BM9 A;  2KIF A;  1RUN A;  1K78 B;  2XVC A;  2MD5 A;  4PGG A;  4M71 A;  2GWR A;  2XGX A;  3LAJ A;  3FXU A;  3GF2 A;  2FF4 A;  4HDU A;  3NEU A;  5ILV A;  1T0F A;  3GO5 A;  4HF1 A;  3V7C A;  5DUK A;  2L4M A;  1F1Z A;  2ZME B;  1K6O A;  2EFW A;  3C18 A;  2DW4 A;  2FEZ A;  4JK1 X;  2EV0 A;  4GYG A;  1PP8 F;  2D1H A;  3BJO A;  2ELH A;  3DPL C;  5D6E A;  3ELK A;  1ON2 A;  2Z33 A;  1S7A A;  1G3Y A;  2P5V A;  3V8K A;  1TQM A;  1TW3 A;  3CUO A;  3GX4 X;  4MHG A;  3SZP A;  5BOX A;  2F5E A;  2CG4 A;  3FX3 A;  2XKP A;  1PDN C;  3BPX A;  4L0Y B;  4GO1 A;  2M87 A;  2OQR A;  4WX9 A;  1OPC A;  4GGG A;  1FOK A;  2R3S A;  1J2X A;  1EH6 A;  2Y75 A;  5DUI A;  1HKQ A;  2W85 A;  2O0Y A;  2RKH A;  2ISZ A;  1BI1 A;  1QQI A;  2O03 A;  2KKO A;  1R00 A;  2BGC A;  1IRG A;  2VT2 A;  4EM1 A;  4N9I A;  1PP7 U;  4IRI A;  3FZV A;  4IVN A;  4GCV A;  4HQM A;  2DK5 A;  4ENJ A;  1Z1D A;  3EET A;  3R61 A;  4L5J A;  1O7F A;  4CHU A;  4BHC A;  1YQA A;  4FHT A;  5HS8 A;  3SXY A;  1ZGA A;  5ICG A;  1FBQ A;  3U1D A;  3F8N A;  1K7A A;  2EV5 A;  1LDJ A;  3J7A O;  4H0E A;  4M9X A;  3HHG A;  3Q9V A;  2QWW A;  1P92 A;  4HZF A;  5LLQ A;  1U2W A;  3K1N A;  2QBY A;  5H6Q A;  4CIC A;  1Z9C A;  4EMS A;  2F5D A;  1LVA A;  3CO6 C;  2HWV A;  1E17 A;  1QGP A;  2FML A;  2OA4 A;  1E2X A;  3I5U A;  1WI9 A;  3LQR A;  4NB5 A;  2DPU A;  3M7G A;  2E7X A;  5EEH A;  5HDG A;  4EM2 A;  4UUV A;  2M8E A;  2GZW A;  4MTD A;  1JE8 A;  4ZH4 F;  2PLY A;  2EA4 A;  2O6G E;  2VN2 A;  3H3Z A;  5BPD A;  2K27 A;  2ESN A;  1RIO H;  1WRJ A;  2MH9 A;  4UVB A;  3BJA A;  4EJW A;  1IW7 F;  2BEO A;  3B02 A;  1U5T B;  4LG0 A;  2QBY B;  1H9G A;  5BMZ A;  2MH2 A;  1O3T A;  2H09 A;  1SFX A;  1K79 A;  3JAM K;  3TQN A;  2GA2 A;  2VT3 A;  3V7S A;  1FX7 A;  2K02 A;  4HOB A;  3G3Z A;  2BE5 F;  1FP2 A;  5HVQ C;  2QVO A;  5ED4 A;  1G6N A;  2HYG D;  2M5W A;  2VBX A;  3WTV C;  4KUM A;  2VOO A;  4A12 A;  4GYI A;  3GXO A;  2TDX A;  5CLS A;  1TTY A;  2RN7 A;  1P2F A;  2VE8 A;  1DUX C;  4KN7 X;  4I98 B;  1ON1 A;  3KZY A;  4BXU A;  1BOA A;  4L9N A;  3LQQ A;  4HV6 A;  1ZRD A;  2M1B A;  2PQ8 A;  3BWG A;  1XSD A;  1PUE E;  4UVA A;  1U8R A;  2LSO A;  3J81 K;  5L3C A;  4U7D A;  2E1N A;  3J80 Z;  1GVJ A;  4LG0 B;  2QYO A;  3IRQ A;  2LF8 A;  4XRF A;  2CSO A;  2DQL A;  2BV6 A;  1F5T A;  2GA1 A;  2A6H F;  3HTS B;  1BI3 A;  1T2K A;  4M73 A;  3RJP A;  4A0Y A;  5AIP A;  3SFZ A;  4M6Y A;  1XGM A;  1MJ9 A;  2DT5 A;  1O3S A;  5L3G A;  1USS A;  3FF5 A;  4Q48 A;  4ZYH A;  3WTX C;  4IRG A;  2HTJ A;  2PN6 A;  4XSX F;  5E8I A;  5ILS A;  3ZQ7 A;  2EFO A;  2JTV A;  3QAH A;  2JZY A;  3CDH A;  2ACJ A;  2JRT A;  4BHB A;  3P7N A;  2IJL A;  4I0A A;  4HX7 A;  1TLH B;  5KVR A;  2QQA A;  1BBY A;  4EJV A;  2Z5U A;  3DP7 A;  2DQR A;  1S8N A;  5LHG A;  1OYY A;  3GLX A;  1TW2 A;  2IP2 A;  4UXN A;  5ICE A;  3LA3 A;  4CXF A;  3ECH A;  3I59 A;  1FYL A;  1U78 A;  2H6C A;  3HTU A;  4BAY A;  5FLX Z;  5IT9 K;  3WTS C;  2VBY A;  2KIM A;  5CVJ A;  2AS5 F;  4ZYD A;  2E1C A;  1ZGJ A;  4BNC A;  2MA3 A;  2O61 A;  3DQV C;  3DXJ F;  2Y48 A;  3PFI A;  3C7J A;  3BP8 A;  3IC7 A;  3MZY A;  2DO7 A;  1XN7 A;  2L3D A;  3GZ5 A;  3DPT A;  1B4A A;  4ZZL A;  5LHI A;  5HS7 A;  2J5P A;  1OYI A;  4HW0 A;  3MFK A;  2ZFW A;  1ZYR F;  1Z6T A;  3GEZ A;  1XGN A;  4U0Y A;  5DD8 A;  2FOK A;  3U9G A;  5D5V B;  2W57 A;  3I59 B;  1ZN2 A;  4N9H A;  1JXS A; 
#chains in the Genus database with same CATH topology
 3CUQ C;  1POG A;  2BW3 A;  2YPR A;  1ZHF A;  2W82 A;  3HRT A;  4KYW A;  2VQG A;  5FRO A;  1LJ9 A;  1G59 A;  4YII A;  3M8J A;  5CVR A;  4IX7 A;  2K85 A;  2DA3 A;  3DBR B;  1R22 A;  4HST A;  4XKW A;  1S29 A;  2WV1 A;  2GLO A;  1I27 A;  1SFE A;  3IWZ A;  5J40 A;  1IN5 A;  5FB2 A;  1ZAO A;  1EV7 A;  2R5Z B;  1H9T A;  5EEA A;  5HOD A;  1I3A A;  4AIJ A;  1MNE A;  1RZ4 A;  3FXO A;  2VJI A;  3Q5F A;  3G1M A;  4M3G A;  2F5V A;  3PO3 J;  5EZG A;  4BH9 A;  2QSF X;  2CV2 A;  5GAG J;  1IG7 A;  3CCQ I;  5DCM A;  3S14 J;  5HOO A;  4UY8 I;  2A5Y B;  1JHF A;  3KIO A;  2GM4 A;  2C6Y A;  4PGH A;  5J47 A;  4RAZ A;  2DA2 A;  3EYI A;  3WTY C;  4E7L A;  3NWS A;  2AQF A;  2KDO A;  3EUH C;  4HRI A;  4J19 A;  1JGS A;  2G9W A;  2RQP A;  3OS2 A;  1FLI A;  2A6E F;  4KFC A;  4E7K A;  3HRU A;  2BBY A;  2EFP A;  1A5J A;  4NC8 A;  5IYB J;  4A3C J;  1N78 A;  3K4M A;  3PQK A;  3P9I A;  1YJ9 I;  1MD0 A;  2MAB A;  3IRR A;  3JRF A;  5H2F C;  3E6M A;  2UXX A;  1IV6 A;  2M7B A;  2HEO A;  1QZY A;  3RDI A;  1WZ2 A;  1XG1 A;  4NNJ A;  1U0J A;  2ECC A;  4MFD A;  2JQ7 A;  3ZMS A;  1MIJ A;  1IF1 A;  5CVV A;  3MQ0 A;  1UHW A;  2NYX A;  2AQE A;  4MNU A;  5F6F A;  2DK8 A;  3HDD A;  3O8H A;  1X19 A;  1U9O A;  3L7W A;  1LFB A;  2WV0 A;  3MD2 A;  2DT6 A;  1OCZ H;  4HQE A;  3S3N A;  5CJ9 A;  1ACI A;  2XB5 A;  1ETY A;  1MW7 A;  1P6R A;  4LK0 F;  2QEN A;  1W5C C;  2XF7 A;  3PJR A;  2W1O A;  2FBH A;  1GT0 C;  4BXX J;  3M3Y J;  3ZMV A;  4DGW B;  2L7Z A;  4G6T B;  1HBX G;  2X6W A;  2GBY A;  3PUF A;  4KNY A;  1X3U A;  3EDP A;  4IXA A;  1CF7 A;  1FBS A;  3GTK J;  3ULQ B;  5KNL A;  5B3S H;  3MAJ A;  5JHF A;  3CC2 I;  3K69 A;  1YE9 A;  4OMZ A;  4GXO A;  2K3P A;  4U0W A;  5ILU A;  2DMQ A;  1MMG A;  5FKN A;  3OSF A;  2LLK A;  5L3F A;  1IRX A;  2VOP A;  4PJL A;  2FRH A;  3QU6 A;  4G7H F;  1D5Y A;  1ENH A;  1EH7 A;  3S2W A;  3OIO A;  3VYR B;  5EF6 A;  1Y0U A;  4M3F A;  1MDM B;  2LTP A;  4Q5S F;  3U2R A;  2DDA A;  2FNP A;  2NVT J;  1FYM A;  2L02 A;  2XAS A;  2K4B A;  2OU2 A;  5C3E J;  3LSM A;  4A6D A;  1R4M B;  4B3A A;  2ME0 A;  3FXM A;  1ZG5 A;  1I6H J;  3ERE D;  4A3G J;  2R7V A;  4XMY A;  4O3M A;  2LVS A;  3F9K A;  4ON0 A;  2ID3 A;  2LBF A;  2L9V A;  2DA6 A;  1IN7 A;  3FM5 A;  3TL4 X;  1LVK A;  1QO0 D;  3LA7 A;  3KX2 A;  2WY8 Q;  3WGH A;  2KIU A;  3MKL A;  4M6X A;  2K9S A;  3LAP A;  1PUF B;  2XAH A;  2DOE A;  4S04 A;  4G7O F;  1KU2 A;  3HC7 A;  4BXF A;  4LGW A;  1I5Z A;  2HR3 A;  2LDU A;  4X6A J;  3ONQ A;  3FXQ A;  1FSH A;  1P7J A;  1DGW Y;  2XPV A;  4ZZD A;  4B09 A;  2Y0S A;  3IH2 A;  3GFI A;  3N4M A;  2V1N A;  3FXR A;  2VBZ A;  2JPB A;  5IP9 J;  4E7H A;  2WAD A;  2V4J C;  2LF7 A;  1AWC A;  3PSI A;  1J7K A;  1G3S A;  1CF7 B;  3F8F A;  3FMR A;  4XL9 A;  3ABU A;  3GTO J;  1XMK A;  4AD9 A;  3REO A;  2YU9 J;  2JRM A;  5FKO A;  2NVU B;  2QKM B;  1SD6 A;  3QOD A;  2OBP A;  2VUM J;  2DFE A;  3OYF A;  4IO9 F;  3G4S I;  1VQ7 I;  3JRE A;  2HU9 A;  1XGO A;  4ESF A;  3L2W A;  4PFP A;  3SDB A;  1WSU A;  3RYP A;  3B6A A;  2BY3 A;  1LEB A;  2EIN H;  2NNN A;  2A5W A;  2CQK A;  4WCG A;  1KU7 A;  3WU2 C;  3HGG A;  1R49 A;  1N77 A;  3WG9 A;  2VQH A;  2MLG A;  4XQF A;  3JRG A;  3CLO A;  3OYN A;  2JA8 J;  2V1D A;  5DDG A;  2CWE A;  1TQP A;  3JRA A;  1QRY A;  4M72 A;  2FD5 A;  2ZC2 A;  1T39 A;  3FXL A;  3KEO A;  4BQA A;  1ZEL A;  2KPM A;  2Y30 A;  4OIQ F;  2ZXI A;  3K4K A;  4RM2 A;  4Q4Z F;  2LBF B;  2RRE A;  3FHZ A;  1AOY A;  1MND A;  2E7W A;  2P7C B;  2VIX A;  2FXA A;  3SHF A;  1QPM A;  3CP2 A;  4F55 A;  3BG5 A;  3JTH A;  4CZZ A;  4RB3 C;  4C2T A;  3SYT A;  1K83 J;  3ZMT A;  4OIN F;  1FJL A;  1GXQ A;  1W7P A;  3MVP A;  3F6O A;  3KYC B;  3SZT A;  3CC4 I;  1ULY A;  1UST A;  4KIF A;  2R7Q A;  4A5M A;  3BQY A;  4HG2 A;  2TRT A;  3W2W A;  5E18 F;  1EH8 A;  4G7Z F;  4DIQ A;  1NHA A;  3OL3 A;  1T0F C;  3TMO A;  4KMF A;  4RA2 A;  4C3H J;  4MQ9 F;  3JSO A;  4HX8 A;  1SMT A;  3K1M A;  2K9M A;  2DMN A;  1VQN I;  3T0Y A;  3ZQQ A;  2XAF A;  1WPK A;  4I7H A;  2ZBK A;  3L09 A;  1CGP A;  3HKZ A;  4BQN A;  3QQA A;  4DQ2 A;  1DDN A;  1YIT I;  1DQU A;  2F2E A;  4HNU A;  2RVC A;  5F1J A;  2B0L A;  3TED A;  1ZG1 A;  2VE9 A;  4PZJ A;  1BR4 A;  3H1C A;  4PJJ A;  4AVZ A;  2ZJQ F;  3CCM I;  3ZQL A;  1Z0X A;  2ZKZ A;  3F8C A;  2HQ5 A;  3F8B A;  4XR6 A;  2JA2 A;  2VC1 A;  1X58 A;  1QVT A;  2K86 A;  4WK8 F;  1OYW A;  1SFO J;  3GTJ J;  5LHH A;  3T8R A;  3GVA A;  4XN0 A;  1IN6 A;  2PMZ N;  1LFU P;  2OF7 A;  3RPU D;  3SEQ A;  4RB2 C;  2DPD A;  1A04 A;  1RR7 A;  4FIS A;  1TNT A;  5M5W J;  1C0W A;  3K9T A;  5GP9 A;  4XLH A;  3HIF A;  4XRS G;  2PMH A;  3HSE A;  1GV5 A;  3OYJ A;  4HA8 A;  2AHQ A;  4CGZ A;  2PEX A;  4P1W A;  1H88 C;  2BYV E;  1JKO C;  1FOY A;  4IZZ A;  5BQT A;  1W7P B;  2N8G A;  2KJB A;  3O3K A;  3BR0 A;  1STZ A;  3A0B C;  2FUG 2;  5LGT A;  1W0T A;  2MBF A;  3C2H A;  5E1X A;  3KZZ A;  2E2H J;  2ZJR F;  1IUF A;  4G9Y A;  3HBL A;  3FBI B;  1G4D A;  2OZU A;  3AAF A;  2HVS A;  3GTP J;  5KAI C;  2NRA C;  5F1R A;  4LLL A;  2EJR A;  4UNO A;  2M34 A;  5FKM A;  2RQQ A;  4MTE A;  2UZK A;  2Q1Z B;  3IHU A;  3DTK A;  2X51 A;  4FQG A;  4FT8 A;  1VF9 A;  2WAQ A;  3TO6 A;  2PJR A;  2HXI A;  4QSH A;  3HUG A;  2M7A A;  3PNV A;  1TP4 A;  3KP6 A;  3L2C A;  3NAU A;  3P9C A;  2G0E A;  4RBO A;  2Q0O A;  3MEX A;  2BY1 A;  1BR2 A;  1P9Q C;  1XPX A;  4A6E A;  3RQ4 A;  4EGZ A;  4CYC B;  3J7A Y;  1MMD A;  1Z05 A;  4M6V A;  4XBF A;  4E6K G;  3DKW A;  5IOZ A;  2A68 F;  4XOP A;  4CUG A;  4HF2 A;  3ZMU A;  2CUE A;  1T98 A;  4MO7 A;  1JKP C;  4BY1 J;  1TWG J;  4EJT A;  4L9T A;  5M5Y J;  3NRV A;  3OYI A;  1SD4 A;  3U1K A;  5F08 A;  1J59 A;  3OYA A;  4JOM A;  1Y8R B;  2HFH A;  2QGU A;  1WWX A;  4G12 A;  1YFH A;  2A69 F;  1D8K A;  2MGQ A;  3DU5 A;  3RKW A;  1FY7 A;  2EPF A;  2OJE D;  1WKM A;  2F6C A;  1SAN A;  3PSF A;  4P9F A;  3GTL J;  2EZL A;  4DYC A;  3F21 A;  4PJN A;  1DPR A;  1VFC A;  4ETS A;  5C44 J;  1S7O A;  3HXL A;  3L2V A;  1FOW A;  1D5V A;  1ZKG A;  2X6X A;  3VSL A;  1XB4 A;  2UUZ A;  3DBH B;  1FWZ A;  2MD0 A;  2PMU A;  1YIO A;  3KE2 A;  4ZJZ A;  3H5R A;  3E7L A;  4ABZ A;  2QZ8 A;  2A61 A;  3H3U A;  1W4M A;  5HDK A;  3I56 I;  3JAM Z;  2PJP A;  2HZD A;  2L5Q A;  4XLE A;  2PG4 A;  3G71 I;  1XCV A;  4BYY A;  2CFX A;  2WB1 A;  4ASN A;  5DM7 F;  2H8W A;  4M3D A;  2DXI A;  2R7R A;  1YX3 A;  1XS9 A;  2ZXJ A;  2IS6 A;  1U5T C;  3HOS A;  1MBE A;  2E1M B;  1T6S A;  5D5U B;  3HGY A;  2GIZ A;  4CYD A;  1BI2 A;  4DJA A;  1ZH5 A;  3DCF A;  1IV8 A;  2KLO A;  4RMN A;  1BIB A;  4JX6 A;  1N25 A;  1REP C;  4EVI A;  1Y0N A;  2E5N A;  2F4O B;  4UHT A;  3TDZ C;  2W7N A;  2QF7 A;  1J75 A;  3VB2 A;  4EM0 B;  2HGC A;  2KFD A;  2TCT A;  2GAU A;  4RB0 A;  2XAQ A;  4KT5 C;  1HXD A;  2LKP A;  1WGX A;  4B48 A;  5H6R A;  1NH3 A;  2FU4 A;  2KP6 A;  4CO8 A;  4LMY A;  3OSG A;  5FD6 A;  4IHT A;  2CV0 A;  2D1V A;  3ABT A;  2EIJ H;  3K1P A;  4ENM A;  4OMY A;  3TDU C;  3AKZ A;  5B1B H;  3K4C A;  1UAA A;  1KQ8 A;  3J81 Z;  3K70 D;  4CCN A;  4ZYA A;  4UB8 C;  5FLV A;  2OTJ I;  3S93 A;  4D9J A;  2WAF A;  3R6S A;  2JPC A;  2JK3 A;  2W25 A;  2YUS A;  4RGS A;  2YR2 A;  2O7O A;  3L2R A;  2DI3 A;  4UB6 C;  5GAE J;  1OR7 C;  1X1D A;  2VXD A;  3HJE A;  4HNV A;  2HDC A;  2H6B A;  5HDN A;  3L2U A;  2V1U A;  5J8C A;  4ESB A;  4A3J J;  2LD5 A;  5DTD A;  3QPS A;  5HLG A;  1ZRF A;  3AL0 B;  4LB5 A;  2VJ5 A;  1TNS A;  3DKY A;  1B1B A;  5AIQ A;  2L4A A;  4YEJ A;  3E6B A;  2PBI A;  4PJM A;  4AC0 A;  4I09 A;  2ZNZ A;  3GZ6 A;  5M3F J;  1YS7 A;  4II3 A;  4IRH A;  1ETW A;  1X1C A;  2Y2Z A;  3KPH A;  4BE1 A;  4YFK F;  3BR2 A;  1HKT A;  1X1B A;  1O4X A;  1ZRC A;  4AID A;  1VQ8 I;  3IH4 A;  3W2A A;  1DGR M;  1PVE A;  1L3L A;  2PX9 A;  2I5U A;  3CQZ J;  1YYV A;  3LFK A;  2A3S A;  3OS1 A;  2DFH A;  2KIQ A;  5B5E C;  5K5R A;  3JRC A;  5CPR B;  2L01 A;  3VYU B;  3Q0V A;  5IOY A;  5D6F A;  2X4H A;  1B72 A;  1MGT A;  4IPA A;  1YTY A;  5FO5 A;  3LMM A;  1MZB A;  4M74 A;  1V55 H;  1FNN A;  1V54 H;  2HTS A;  2IXS A;  2CUZ A;  4XKV A;  3GLL A;  2ELJ A;  2M2E A;  3IKT A;  4A3I J;  4NBQ A;  4FAS D;  2Z99 A;  1D1C A;  2DT7 B;  4CZC A;  3WGI A;  3HRM A;  4LLG F;  3RPQ A;  2IW5 A;  2XPW A;  1R1U A;  1XMA A;  3FWE A;  3FXK A;  3MN2 A;  5CKT A;  4XIC A;  3CO7 C;  1S9H A;  2F5C A;  3V8L A;  3CF5 F;  3RI4 A;  3ZP5 A;  2WAE A;  3CD6 I;  1J5Y A;  4UV9 A;  4XOR A;  5HNF A;  2J5O A;  1R5H A;  2VAS A;  3JSP A;  4HF0 A;  4IHV A;  4MFE A;  3QYE A;  5KK1 A;  1R1V A;  2KHM A;  2L9S A;  3TO9 A;  5A2Q K;  2NOJ B;  4QWQ A;  3KLN A;  3KFW X;  2OCC H;  4PSW A;  5J3L A;  5FJ8 J;  5IT9 Z;  4BU2 A;  3ZOB A;  3BG3 A;  4A69 C;  2VBW A;  5DYM A;  2XIG A;  3R0A A;  4R8H A;  1KU3 A;  1XD7 A;  4UUT A;  3JR9 A;  1YRN A;  3HHH A;  3OYC A;  1ZAR A;  4M3B A;  3K4N A;  1VI0 A;  2WY7 Q;  1QHH D;  2VJJ A;  4BBS J;  2QQ9 A;  2DJI A;  4D7M A;  5CVI A;  4B43 A;  5E3N A;  3HOY J;  4EQQ A;  3H92 A;  2UWM A;  2R93 J;  5H20 A;  3V8J A;  2K4J A;  1WQ2 A;  3UKG A;  4HEA 2;  4UUS B;  1YJW I;  4Y15 A;  2LG4 A;  4P96 A;  2R7U A;  4JQF A;  1MJA A;  4YRV A;  1G3W A;  3OOU A;  2LMD A;  2JA5 J;  2XAJ A;  2RGV A;  2H1L A;  1ORK A;  4IHS A;  2OPT A;  4E70 A;  2OCE A;  3KP5 A;  4ZTJ A;  4U87 A;  3CJN A;  3GUD A;  4C30 A;  4IF4 A;  2AO9 A;  1FMV A;  1QZZ A;  2FX0 A;  2XF6 A;  3QPH A;  3AG2 H;  4EEF G;  2FBK A;  2M3A A;  4IKF A;  3E5U A;  2W00 A;  4NDL A;  2OV7 A;  3RZO J;  1RPW A;  1Z7L A;  1IRZ A;  4YG2 F;  1T95 A;  4NQW A;  1U8B A;  4C3I J;  1IXC A;  3R4K A;  1VQ4 I;  4B47 A;  1LKX A;  2XGC A;  4R79 A;  1YW9 A;  2BOL A;  4UV8 A;  1MMA A;  3K7A J;  1MH4 A;  3A0H C;  3KLO A;  3LWF A;  3W6J B;  1UEL B;  4IQ4 A;  1B59 A;  4M3E A;  4XLP F;  2VLA A;  5FKL A;  3WOD F;  1R71 A;  3OYB A;  5E1W A;  1QBJ A;  2M30 A;  1YJN I;  1R9T J;  3V4G A;  1YRN B;  3S15 J;  3KEQ A;  1OQY A;  3EQL F;  1KA8 A;  1IXR C;  2P5K A;  1R6R A;  2DAO A;  1D3Y A;  4X0G A;  1RKW A;  2DTZ A;  3G2B A;  3CF2 A;  4B1R A;  3PM1 A;  4W97 A;  1WJB A;  2IA0 A;  2HYF A;  2KZV A;  1UFM A;  5EEG A;  1YIJ I;  4HLX A;  3FM3 A;  5J4V A;  5F0H A;  1X3Z B;  2FQ4 A;  3CCE I;  5DEQ A;  2CUJ A;  2LOO A;  1FYK A;  1AKH B;  3F72 A;  2XRO A;  4P5O A;  2MG4 A;  3W6K B;  2EH3 A;  2WTE A;  1Z7U A;  2A6T A;  5K5Q A;  3HOU J;  2IA2 A;  3K70 C;  2AXL A;  4P55 A;  2CQQ A;  2DYR H;  2V1X A;  4A5N A;  2R7O A;  2ZJ2 A;  3E6D A;  5EG0 A;  3DFG A;  1B9N A;  3VPR A;  1DU6 A;  3HEF A;  4NQW B;  1RRJ A;  3FK7 A;  4C2M J;  4IHX A;  5E17 F;  3TO7 A;  4XM3 A;  4PSX A;  1HF0 A;  2BW3 B;  2FA5 A;  1O57 A;  2Y9Y A;  2HS5 A;  2XAG A;  2FQ3 A;  3NWT A;  4D0P A;  2R7S A;  1FTT A;  4HPQ A;  5D5W B;  3OV8 A;  2B63 J;  1YW7 A;  3BC8 A;  4BHP A;  1HQC A;  1R5G A;  2NVQ J;  3OYL A;  2HDW A;  3QPL A;  3S8P A;  3SZG A;  3IV5 A;  2ZME A;  2DOD A;  2OAZ A;  2XRL A;  3S3M A;  1G8X A;  3WTZ A;  4BEH A;  4DNC A;  2JJ7 A;  4CSW A;  1YHQ I;  3E6C C;  1NK2 P;  5B1A H;  3GW2 A;  2L54 A;  2HKO A;  2X48 A;  4AIH A;  3ZGK A;  3J7Y J;  4ANJ A;  1W7P D;  3Q9S A;  5HS9 A;  5LFA A;  3FDY A;  4BAC A;  3GFJ A;  5IP7 J;  4KIB A;  4XNF A;  1JHH A;  3FMS A;  4CCM A;  1GDT A;  3DLA A;  5DCM B;  5BPI A;  3E5Q A;  2M45 A;  5M5X J;  1U6G A;  1J0R A;  4F52 A;  1MNM C;  2DA5 A;  2L9N A;  4AUX A;  2XRN A;  1X1P A;  1BC7 C;  2YS9 A;  4MQV A;  1P4X A;  4BGD A;  3OYE A;  2P5L C;  2R7D A;  4Q47 A;  2E35 A;  3KP3 A;  2X1D A;  4ZYG A;  3KP7 A;  2ZSI B;  4PK4 A;  1B9M A;  2GQQ A;  1LB2 A;  3ECO A;  3ASN H;  1ETV A;  2LKS A;  4L9J A;  2PI0 A;  2MFZ A;  3RQI A;  4CH7 A;  2P6S A;  5EG0 B;  3WE2 A;  3QYF A;  2YX4 A;  2FE3 A;  1F4K A;  1Y39 A;  2HVR A;  1KQ0 A;  1O7L A;  5F27 A;  3S2D J;  3T5X A;  1I1S A;  3BR6 A;  1BJZ A;  3MMY B;  2ZSH B;  4CDG A;  1SAX A;  3O2P E;  2P8T A;  3E3V A;  3ZN0 A;  3IAS 2;  1RUO A;  3K2A A;  4G8X A;  1MBK A;  2JSP A;  3O8G A;  4KDP A;  1T8I A;  4YIR X;  1D8J A;  1YS6 A;  3FKI J;  1SD5 A;  1LUJ B;  1HW5 A;  1XDS A;  5TRD A;  2F5F A;  4WXH A;  4MIM A;  5JVT A;  4H4K C;  4HSR A;  5LD2 C;  4IJA A;  3JW4 A;  3L00 A;  1YOV B;  2W84 A;  3TOA A;  3VEP A;  1Y8Q B;  3I71 A;  4BEH B;  1E3O C;  4J00 A;  3RYR A;  3M1E A;  2JUC A;  1WJE A;  1JUM A;  1XDU A;  1O3R A;  3VFZ A;  3BTL A;  4LK1 F;  4BDZ A;  3D0S A;  1A36 A;  4L5E A;  4RS8 A;  2LC2 A;  1TQI A;  1IUY A;  1IO2 A;  1U9N A;  3E97 A;  3DU6 A;  4F92 B;  2BXZ A;  1HW2 A;  3BTC A;  3H9J A;  2XV4 S;  3ROU A;  2V9K A;  1Z67 A;  3JRD A;  1L0O C;  4BY7 J;  3GWZ A;  3K2Z A;  1FP1 D;  2CS3 A;  4ENN A;  4JP0 A;  5JFR A;  2UXN A;  1R5I D;  3E5X A;  4Y33 A;  1YLF A;  3KZI C;  1R4N B;  5IY5 H;  1FT9 A;  2E60 A;  2IPQ X;  1FZP B;  3TKY A;  2HQN A;  5IYD J;  4NHJ A;  5JVG F;  1GV2 A;  2DTR A;  3LSI A;  2E1O A;  4DOZ A;  1V5E A;  3TOB A;  4I76 A;  4I2O A;  3BRO A;  2ICW G;  4O6J A;  1EF4 A;  1ZQ3 P;  2FSW A;  4RGU A;  2L2O A;  2FBI A;  1SD7 A;  2LY1 A;  1XGS A;  3ZN1 A;  4BUP A;  1BIA A;  2KRF A;  3RTR A;  2WWY A;  1WHU A;  1ZK8 A;  3OS0 A;  1OKR A;  2DMU A;  2ADU A;  2KJC A;  3KP4 A;  4E4H A;  2IGM A;  4L9V A;  3C3W A;  3HKZ N;  3X2Q H;  2RNG A;  2NNY A;  2CGP A;  2YSR A;  3OR2 C;  4G6D A;  2R5Y A;  1UCR A;  1HLV A;  1X1A A;  1FPQ A;  1GHC A;  5L3B A;  3F3X A;  1IRF A;  2OZ6 A;  4OWR B;  1ZG3 A;  3FIS A;  4XON A;  1KYZ A;  2CH0 A;  1JUS A;  3DV8 A;  2CRG A;  4HDV A;  4UVC A;  1IN8 A;  3LA2 A;  4U88 A;  2OQG A;  4CA0 A;  3CCJ I;  2ESH A;  2P7V B;  2K3F A;  4OIP F;  2DOF A;  2BVM A;  1HDP A;  3LFU A;  1XSX A;  3DWL E;  2ZO4 A;  1Q1V A;  2CO5 A;  1WJF A;  1IDZ A;  5JHU A;  4JBA A;  1I1G A;  1X2N A;  2HNH A;  3BG7 A;  3QOE A;  2D45 A;  3FK6 A;  2DFF A;  3HSF A;  3WGG A;  3TP3 A;  5EZH A;  3GTG J;  5FD5 A;  1IGN A;  2O8X A;  4E7I A;  3LST A;  2COB A;  2DLL A;  3TP0 A;  4YIF A;  4WXC A;  1U3E M;  5CYV A;  4JX5 A;  3BOQ A;  4OIO F;  3BCA A;  5FRN A;  3C2B A;  2LKX A;  2GXB A;  1VZ0 A;  1FC3 A;  2E71 A;  1K4T A;  1VQ5 I;  4J01 A;  2LYC A;  1EJ9 A;  1UG0 A;  1HC8 A;  4ZYE A;  3LNQ A;  2ZCW A;  1LDK B;  5GAD J;  4GRI A;  3OYD A;  1D0X A;  2WAQ N;  3DF8 A;  3BDD A;  4L18 B;  3D5L A;  2B7E A;  4OIR F;  2OD5 A;  1MBF A;  5M3M J;  3HRS A;  4RLQ A;  2Z16 A;  4AYB N;  2HOE A;  1W5S A;  2VL8 A;  3K0L A;  1JKQ C;  1HST A;  1Q1H A;  1KYW A;  3M8F A;  4CCJ A;  3JRI A;  3S1N J;  4CCK A;  1FIP A;  1YX5 A;  3GFL A;  2EIM H;  1SFU A;  4BQO A;  1U5T A;  2JT1 A;  1OIS A;  1IJW C;  4MEX F;  2EWN A;  4OU0 A;  4BE2 A;  1R58 A;  1A35 A;  1ZR2 A;  2R7W A;  2EIL H;  3MKZ A;  2MC3 A;  1ZLJ A;  3WTU C;  1T08 B;  1FSE A;  4F91 B;  2DU9 A;  4MLO A;  3CMM A;  3WU0 A;  3GZN B;  3SFI A;  2JN6 A;  2Z2S B;  3ZQH A;  4A0X A;  4CCL A;  5HNH A;  2L7F P;  4I02 A;  1LFP A;  1F43 A;  1DU0 A;  2V6E A;  4RM3 A;  1J9I A;  2DN0 A;  3F22 A;  5D5X B;  3B6C A;  3V7R A;  5K7Z A;  2CFO A;  3IAM 2;  4A2U A;  3EYY A;  1BI0 A;  4OOI A;  2R92 J;  5EJC A;  3DTE A;  2H94 A;  3QOP A;  4HV5 A;  3WHC A;  2DOA A;  2H27 A;  2Y31 A;  5EDN A;  1W1W E;  5D4R A;  3ASO H;  3H9G A;  1Z91 A;  5ICC A;  2COM A;  4Y13 A;  1OR7 A;  2RC4 A;  2Y0M A;  4QLC U;  1VQ6 I;  2FMY A;  2Z9O A;  4KIS A;  4AVP A;  2XSD C;  3H9Q A;  3ZQI A;  4AWX B;  3M9A A;  2V26 A;  1YW8 A;  1T56 A;  2X0L A;  3IWF A;  2Q8K A;  3OOP A;  3S32 A;  1LPQ A;  3IUO A;  2P4W A;  2R4G A;  4L5I A;  4RGX A;  2DMT A;  4LIU A;  2QA4 I;  5LRS A;  1BJA A;  4BS9 A;  4Z6Y A;  3L9F A;  4Y7N J;  1Z21 A;  1UB9 A;  2EQR A;  1LNW A;  1IXS B;  1FIA A;  1SEU A;  1F9N A;  2B9S A;  1CQT A;  3B73 A;  1XSV A;  1ZTR A;  3KP2 A;  3W3C A;  2W24 A;  3TGN A;  2Z3Y A;  4EJO A;  2ETH A;  2PJR B;  4Y4R A;  1B6A A;  3HUG B;  3I53 A;  5E8G A;  2MLK A;  3COA C;  3N97 A;  2YU3 A;  1HCR A;  2ZFU A;  4YFN F;  4IHW A;  1LDD A;  1NK3 P;  5EGO A;  1H0M A;  2WC2 A;  4RB1 A;  1Y1W J;  5FFX A;  1OCO H;  1QA6 A;  4BKX A;  3I4N J;  3HSR A;  4KIC A;  5LGN A;  2X85 A;  3CCR I;  4N0B A;  4A3L J;  1BN5 A;  1TC3 C;  5KCM A;  4F7Z A;  1S6L A;  1HW1 A;  2DJN A;  1VQP I;  1XCB A;  2RDP A;  3K4L A;  1X4P A;  1V3F A;  3IL2 A;  1BOB A;  4FX0 A;  3GYH X;  1S3J A;  2STT A;  3WTW C;  3C1D A;  3RPU A;  1JT0 A;  2E1M C;  1D0Z A;  2QM3 A;  4WWC A;  5FFZ A;  3WE3 A;  2Q2E A;  1QZE A;  3AG4 H;  3RZD J;  5IT3 A;  1VTN C;  2CMP A;  2P81 A;  2DA1 A;  5JR3 A;  1AU7 A;  4KIG A;  2EV6 A;  2JVH A;  3H0D A;  1ZR4 A;  2XKO A;  1E0E A;  4NC7 A;  1OLT A;  5DCF A;  4ZDO A;  5LEJ A;  1UHS A;  4Z2Y A;  1ZRE A;  3QPT A;  3BCB A;  4B3X A;  4GFB A;  3M4O J;  4LD5 A;  3CDL A;  4PCQ A;  5F0C A;  4O5V A;  3J80 K;  1BL0 A;  3K10 A;  1KU9 A;  3MWM A;  3S2H J;  4HBL A;  5BS6 A;  1XX5 A;  3PNY A;  3K4J A;  4TV7 A;  4BJT A;  1AHD P;  3DEW A;  4LLN A;  4S05 A;  2IRF G;  2E34 A;  2H8R A;  2DFI A;  5J4Y A;  3OIQ A;  3A02 A;  1W5T A;  4LFU A;  4D1Q A;  3LSP A;  2HXO A;  2RNJ A;  4ESJ A;  1DP7 P;  3DEU A;  3I64 A;  4PDK A;  2XUB A;  2NAZ A;  4U0V A;  5EGO B;  3BJ6 A;  3G73 A;  5HLI A;  4BJ6 C;  1T38 A;  1TWC J;  2NS0 A;  2P6T A;  1BW5 A;  1MJB A;  1RNL A;  1YI2 I;  2V9V A;  2PFB A;  2HQR A;  1HSJ A;  1F36 A;  1SMY F;  1VQK I;  1MKM A;  3AG1 H;  2VKV A;  3AL0 C;  2IT0 A;  2XC7 A;  3BPV A;  1WJA A;  2GXG A;  3BTI A;  5JLX A;  1I6X A;  3ZMZ A;  4E7S A;  3ISP A;  5L3E A;  1SFK A;  2L7K A;  5KAF C;  3OWT A;  3BZ6 A;  4HYE A;  4K2E A;  3S3O A;  4G94 A;  4QIW N;  1IZ1 A;  3G1O A;  2HKX A;  2IBD A;  5D4S A;  3DEE A;  5DD4 A;  2EB7 A;  2E2J J;  5E20 A;  1V4R A;  4Y17 A;  3AFH A;  2A07 F;  3I58 A;  3LSG A;  2FOW A;  2GIV A;  3ML6 A;  4RDU A;  2D5V A;  2QUF A;  4A3E J;  5GPA A;  4MGR A;  4KA4 A;  5E1Z B;  9ANT A;  6PAX A;  3CUQ A;  2R7Z J;  2KRH A;  3OY9 A;  2HPM A;  5D8L B;  3ZRG A;  4D5C A;  3G6E I;  3WTT C;  4FE4 A;  4MEY F;  3DPU A;  3HYI A;  4KMU X;  2HOT A;  2QQ8 A;  4Y52 J;  1A6Q A;  5A2Q Z;  3J7Z I;  4QPQ A;  3QP6 A;  3BY6 A;  3M8E A;  2EFN A;  4EGY A;  2L9R A;  4I0B A;  4ZDP A;  1VQ9 I;  2IVM A;  3HOW J;  2BY2 A;  2ISY A;  1JI8 A;  5JLW A;  2F4I A;  4IQJ A;  1JT6 A;  5F04 A;  2FJ1 A;  2LNB A;  5L3D A;  1YO5 C;  3GME A;  1B8I A;  2OTL I;  3IKV A;  5CVU A;  3H5N A;  1R36 A;  2IEK A;  1LQ1 A;  2I8D A;  3GCM A;  2IGO A;  4R1H A;  4E7J A;  3E1S A;  4YEL A;  5FLX K;  4XLN F;  2LRD A;  3VDX A;  3DKX A;  1ZLK A;  2CYY A;  2QQB A;  4XKC A;  1LEA A;  2ME6 A;  4AIK A;  3QRF F;  2DBB A;  1QVU A;  3LSH A;  5AON A;  4PFO A;  2G7U A;  1HKS A;  1QNT A;  1B72 B;  3CES A;  4N4O B;  2RV8 A;  2BHY A;  3EUH A;  3PIO F;  2MC4 A;  1KGS A;  2XHK A;  3VSK A;  3F0C A;  3FHN A;  4WXD A;  3RKY A;  1PJR A;  1Z6R A;  4G6Q A;  2MSY A;  2EK5 A;  3MCZ A;  1K4S A;  3GBG A;  5FGM A;  2M9H A;  4EJU A;  4LJZ F;  5LBQ A;  4A3M J;  1R1T A;  3I3L A;  2R5Z A;  1DPU A;  3FMQ A;  3T1B A;  3HL2 A;  2CQN A;  3I0T A;  2CUF A;  3CJT B;  4HX4 A;  1WJ5 A;  2JWT A;  3F23 A;  1ETO A;  3Q0U A;  1OMI A;  3SQN A;  3WU1 B;  4RAY A;  2FNA A;  1OCP A;  2KMU A;  2K7L A;  5C4J J;  2K9Q A;  3H36 A;  2MYS A;  4YFX F;  2W4S A;  4ENK A;  3CUQ B;  3CTA A;  3F6V A;  3ABM H;  2CW0 F;  5IYC J;  2QSH X;  3A4C A;  5GTH C;  2O8K A;  1G3T A;  1SVL A;  4FX4 A;  1OJL A;  3TW7 A;  3PQJ A;  3BTJ A;  1Z3Y A;  2M8G X;  1JTY A;  3R60 A;  4RGR A;  4EV0 A;  4A3F J;  2VOD A;  5IPA A;  2X6O A;  3OIP A;  3VYT B;  2QEX I;  1TL8 A;  1EA3 A;  4XSZ F;  3NQO A;  2KQR A;  2V6C A;  3O6B B;  4HLY A;  1B8I B;  3P9K A;  4M9Z A;  2NS7 A;  2HVQ A;  1IN4 A;  1K6Y A;  3M07 A;  3KET A;  1BC8 C;  1RI7 A;  1D0Y A;  1ONV A;  5GTI C;  2CW8 A;  1O3Q A;  3SJM A;  3FIW A;  2O3F A;  3RIR A;  2CV1 A;  4A93 J;  1WH5 A;  5GPC A;  5HLH A;  3NAR A;  4HAM A;  4P9U A;  3T8T A;  1LE8 A;  2KL4 A;  5JI6 A;  3MZH A;  1I3Q J;  2KIS A;  2R7F A;  5J6X A;  1R7J A;  3ZPL A;  4GDF A;  3ZQC A;  3HZJ A;  3KCC A;  3HOV J;  1P4W A;  2ECB A;  4KJZ A;  4IL6 C;  5F64 A;  1OCT C;  5J8F A;  3F8M A;  2IA1 A;  4BJ5 C;  3QU3 A;  4B44 A;  4BBR J;  4FTH A;  2QLZ A;  1K78 A;  1WJC A;  5LEK A;  5ICF A;  3JTG A;  3W6V A;  2NVY J;  3R0J A;  2EZH A;  2YX7 A;  2JSC A;  3BR3 A;  2VI6 A;  4IEJ A;  1I39 A;  2H1K A;  2LFB A;  1JUP A;  1MDM A;  1ODD A;  2HZT A;  4XLF A;  1TBX A;  2HOS A;  3I54 A;  2STW A;  2ZNY A;  2VON A;  3A2K A;  2BY0 A;  3WHB A;  3CDI A;  4B8X A;  4KIT B;  3WG7 H;  1S5L C;  4DW6 A;  5ERI A;  3VWB A;  4BQQ A;  3HOT A;  3A1Y A;  5D8K B;  2RAE A;  3I4P A;  1GLN A;  1X3W B;  3BG6 A;  4WF2 A;  1UHM A;  3K6G A;  3BR1 A;  4KN4 X;  5DV5 A;  1KQ9 A;  3RKX A;  2XGD A;  3CCL I;  1WFX A;  1UJ8 A;  3Q3S A;  3CJR B;  2EFQ A;  3G1L A;  4V19 K;  1IAW A;  4M9S A;  2VXZ A;  1TWH J;  1GXP A;  5LGU A;  5J1R A;  3ZMD A;  1YG2 A;  4W1U A;  2V79 A;  4LB6 B;  1QHG A;  5K1Y A;  1PUF A;  1D1B A;  4LG3 A;  2MW8 A;  2G7H A;  3VOD A;  1E3H A;  5LRR A;  3GFM A;  2IS4 A;  2R7X A;  2D2W A;  2R0Q C;  1ETK A;  1P4A A;  4C9Y A;  1LE8 B;  2LY2 A;  4L0Z B;  4IHY A;  2LK2 A;  2X6Y A;  3D5S C;  4RAG A;  5K5O A;  2JA6 J;  1SVO A;  1FBU A;  4XOT A;  1R23 A;  2VC0 A;  4U7B A;  3GTQ J;  4DYR A;  4I01 A;  4A0Z A;  1BW6 A;  3LL7 A;  3VOE A;  2EA2 A;  2F4M B;  3QP5 A;  3HPG A;  1BM9 A;  5TJJ A;  2KIF A;  1RUN A;  3BT9 A;  1K78 B;  3BQZ A;  2XVC A;  2ZXW H;  1WJD A;  5E3O A;  3CMY A;  3S1M J;  2MD5 A;  3H5A A;  5KHD A;  4PGG A;  1S7E A;  2BHZ A;  4M71 A;  3L1P A;  2GWR A;  2ID6 A;  4XLC A;  2Y0S N;  2W48 A;  2XGX A;  4XK4 A;  3LAJ A;  3FXU A;  3GF2 A;  1Y56 A;  2FF4 A;  3S17 J;  3PFY A;  4HDU A;  1OFC X;  2E5Z A;  3NEU A;  5ILV A;  4NUB A;  1T0F A;  4D7N A;  2BXY A;  4DZP A;  3GO5 A;  1VQO I;  4X1E A;  4HF1 A;  5IP6 A;  1W36 D;  1RR8 C;  1HDD C;  3L2Q A;  3V7C A;  1MMN A;  5DUK A;  2L4M A;  1F1Z A;  2DMP A;  2ZME B;  1K6O A;  3PIP F;  3C18 A;  2EFW A;  1QU3 A;  5J1U A;  2DW4 A;  2FEZ A;  2VKH A;  1VND A;  3MZ8 A;  3H0G J;  1XC5 A;  4JK1 X;  4AM3 A;  2EV0 A;  4GYG A;  3CME I;  1PP8 F;  2D1H A;  1UZC A;  3BJO A;  3CCY A;  2WBM A;  3E0J B;  4DBQ A;  4FCY A;  2ELH A;  3DPL C;  5D6E A;  3ELK A;  4LIT A;  1ON2 A;  2Z33 A;  1S7A A;  3OYH A;  1G3Y A;  2X9D A;  1MSF C;  4PJ0 C;  2LH9 A;  5C4X J;  2P5V A;  2ZME C;  3V8K A;  3BZK A;  5DS9 A;  1TQM A;  1TW3 A;  3CUO A;  4C3J J;  3GX4 X;  4EAT A;  4MHG A;  3SZP A;  1JGG A;  5BOX A;  3LSJ A;  2IS2 A;  5CQG A;  1GUU A;  1SAU A;  2F5E A;  2E2I J;  2CG4 A;  3FX3 A;  2XKP A;  1PDN C;  3BPX A;  3HM5 A;  4XN3 A;  3OYM A;  4IOC F;  2VPL A;  1AA7 A;  4L0Y B;  1WVR A;  4GO1 A;  2M87 A;  2UV1 A;  2OQR A;  4WX9 A;  1OPC A;  4GGG A;  2XF5 A;  5BNG A;  1ETX A;  3HOZ J;  1FOK A;  2VKD A;  2R3S A;  1J2X A;  1EH6 A;  2Y75 A;  2KZG A;  3CZ6 A;  4A3D J;  1HA8 A;  1KZH A;  5DUI A;  1HKQ A;  2W85 A;  3UNG C;  2O0Y A;  1V5F A;  2RKH A;  2ISZ A;  1BI1 A;  3S16 J;  2VKE A;  2DCE A;  3ZCO A;  1QQI A;  1BR1 A;  3HOX J;  2O03 A;  4PUS A;  2KKO A;  1FOX A;  2XPU A;  4I6Z A;  2K5C A;  1R00 A;  3BR5 A;  5K7F A;  2BGC A;  3PUB A;  1IRG A;  1Z77 A;  2VT2 A;  4EM1 A;  3OYG A;  2Y69 H;  4N9I A;  2KDZ A;  3CMA I;  4C2U A;  2CQX A;  3I9V 2;  4BL0 B;  1PP7 U;  4IRI A;  3EUA A;  1IDY A;  3FZV A;  2IS1 A;  4IVN A;  2JVG A;  4GCV A;  4HQM A;  2DK5 A;  2E36 A;  4ITV A;  4XRS A;  4ENJ A;  1Z1D A;  3EET A;  3R61 A;  4L5J A;  1O7F A;  4CHU A;  3KYL A;  2JUG A;  3I55 I;  4N4N B;  3CC7 I;  4BHC A;  3N05 A;  3RSN A;  1YQA A;  4FHT A;  3CP8 A;  5HS8 A;  1TWF J;  4CYC A;  1K61 A;  1X2M A;  3VYS B;  3SXY A;  1ZGA A;  1JTX A;  3OR1 C;  5ICG A;  1FBQ A;  3U1D A;  3MKW B;  3F8N A;  1K7A A;  3D1N I;  5DM6 F;  3Q0W A;  2EV5 A;  2GOM A;  3ZQG A;  1LDJ A;  3J7A O;  2EZK A;  4QPO A;  4H0E A;  4M9X A;  2R5Y B;  3HHG A;  1J09 A;  3Q9V A;  1H89 C;  2QWW A;  1P92 A;  4BE0 A;  1G2H A;  4HZF A;  5TGT A;  5LLQ A;  2EZI A;  2F48 A;  2M4K A;  1U2W A;  3K1N A;  2QBY A;  2XGE A;  5H6Q A;  1ZGW A;  2M0C A;  1MBJ A;  2VQL A;  3ZR8 X;  4LOC A;  4CIC A;  1Z9C A;  2VB6 A;  4EMS A;  2I10 A;  1UMQ A;  2F5D A;  1LVA A;  3CO6 C;  2HWV A;  4BDY A;  1E17 A;  2O5R A;  2PMZ A;  1QGP A;  2FML A;  4A3K J;  3U21 A;  2OA4 A;  1E2X A;  3LSK A;  3I5U A;  2HYJ A;  1WI9 A;  5EYR A;  2NS8 A;  4KT6 A;  2CW7 A;  3LQR A;  4B4C A;  4XID A;  2QKL B;  4NB5 A;  2DPU A;  2IGK A;  3W2V A;  3S1Q J;  4DBR A;  3EPZ A;  3M7G A;  1BA5 A;  5J1Y A;  2E7X A;  5EEH A;  2NXN B;  5CQE A;  5HDG A;  2KRC A;  3PO2 J;  3RCO A;  3KEY A;  4AYB A;  4EM2 A;  4UUV A;  1UG2 A;  2BVL A;  2EBI A;  1ITY A;  2M8E A;  2GZW A;  4MTD A;  3CLQ A;  2DYS H;  2K40 A;  1JE8 A;  4ZH4 F;  2PLY A;  4NC6 A;  3A01 A;  2EA4 A;  2HPI A;  2NOG A;  2O6G E;  3FKJ A;  1MH3 A;  1X4O A;  3ZQF A;  2VN2 A;  3H3Z A;  1D1A A;  2K27 A;  2WB1 N;  5BPD A;  1DP3 A;  2ESN A;  1RIO H;  3I4M J;  1WRJ A;  3EUK L;  2M0M A;  2LY9 A;  2JA7 J;  2MH9 A;  4UVB A;  3BJA A;  4EJW A;  3ABL H;  5K7H A;  2VPR A;  1IW7 F;  3QYB A;  4JX4 A;  3GTM J;  2BEO A;  3B02 A;  2NVX J;  1VQM I;  1OCC H;  1U5T B;  2CU7 A;  1FEX A;  1QPI A;  1W36 C;  4LG0 A;  2V7F A;  2QBY B;  1H9G A;  5BMZ A;  5E3L A;  2MH2 A;  1O3T A;  2QSG X;  2H09 A;  3CCU I;  1SFX A;  3FXJ A;  1NG7 A;  1K79 A;  3JAM K;  4FET A;  2GA2 A;  2VT3 A;  3TQN A;  3V7S A;  1FX7 A;  2K02 A;  2LP0 A;  4HOB A;  3G3Z A;  2BE5 F;  1FP2 A;  2L0K A;  5HVQ C;  3BLY A;  3FBN B;  2QVO A;  5ED4 A;  1G6N A;  2HYG D;  2M5W A;  2WA0 A;  2ZXH A;  2VBX A;  3UR3 C;  4DZJ A;  1Y1V J;  4DYQ A;  2IAI A;  4KUM A;  4OAZ A;  3WTV C;  4A12 A;  2VOO A;  4GYI A;  3GXO A;  2TDX A;  2V9P A;  1MBG A;  2VJ4 A;  2XDV A;  1TTY A;  2RN7 A;  5CLS A;  1P2F A;  2X1E A;  4OAY A;  2Z1D A;  3QWL A;  2VE8 A;  1T33 A;  3A01 B;  1DUX C;  4XRM A;  5E79 C;  4KN7 X;  4I98 B;  1ON1 A;  1P7I A;  3P5J A;  3KZY A;  4BXU A;  1BOA A;  4L9N A;  3PL8 A;  2XSJ C;  3LQQ A;  1M1E B;  1Z3X A;  3LOC A;  2K9N A;  4RAF A;  3CJQ B;  4HV6 A;  1ZRD A;  2M1B A;  1I50 J;  2XAU A;  2PQ8 A;  3BWG A;  1XSD A;  1H8A C;  4I99 C;  1PUE E;  4UVA A;  4XLA A;  2HQA A;  1U8R A;  2LSO A;  3J81 K;  5L3C A;  4V2G A;  4U7D A;  2E1N A;  4RLF A;  3J80 Z;  1GVJ A;  1TZL A;  2JMW A;  3K4B A;  4LG0 B;  2QYO A;  5F0F A;  3IRQ A;  2LF8 A;  4XRF A;  4A3B J;  2CSO A;  2DQL A;  2BV6 A;  4V2F A;  1F5T A;  2HDD A;  2GA1 A;  4D5F A;  5FLM J;  2A6H F;  3HTS B;  1XTA A;  2GXA A;  1GVD A;  1BI3 A;  1T2K A;  4M73 A;  3RJP A;  4A0Y A;  5AIP A;  3SFZ A;  4M6Y A;  2P0W A;  4HNT A;  2R7T A;  1MBH A;  1XGM A;  2ZJP F;  4FE7 A;  4II2 A;  1MJ9 A;  3DBL B;  2DT5 A;  3RKQ A;  1O3S A;  1JKR C;  1TWA J;  3H3V K;  3HB9 A;  5L3G A;  1USS A;  3FF5 A;  1TT0 A;  4Q48 A;  5TIS C;  1XMX A;  4ZYH A;  4Y3O A;  1MMS A;  5GAH J;  3KYD B;  3WTX C;  2BZT A;  2X1C A;  3LSR A;  1NTC A;  4ZTF A;  4IRG A;  3ESW B;  1MSE C;  2HTJ A;  3TW6 A;  3SEZ A;  3JRH A;  1S72 I;  4IOA F;  4ZC3 A;  2PN6 A;  2LR8 A;  1PYV A;  4XSX F;  5E8I A;  2Q2E B;  5ILS A;  1NG6 A;  3ZQ7 A;  2EFO A;  2JTV A;  3QAH A;  1VQL I;  5HLT A;  2HI3 A;  3AG3 H;  2DA7 A;  2JZY A;  3CDH A;  2QCO A;  2ACJ A;  3ERM A;  2JRT A;  4BHB A;  3P7N A;  4UUS A;  3IP4 B;  1TT5 B;  3CCV I;  3A03 A;  2VQC A;  2IJL A;  3ZXS A;  1APL C;  4I0A A;  1RKT A;  4HX7 A;  1TLH B;  3D5R C;  3HG9 A;  5KVR A;  1WI3 A;  2ELK A;  2QQA A;  4XKB A;  1BBY A;  1A31 A;  4EJV A;  2Z5U A;  3DP7 A;  2DQR A;  2OC6 A;  1ERD A;  1S8N A;  5LHG A;  1OYY A;  3DTI A;  3GLX A;  1TW2 A;  5E3M A;  3PNT A;  2AXT C;  2IP2 A;  3M1C A;  5FRM A;  3JCU C;  1FTZ A;  4UXN A;  4S0H B;  5ICE A;  3LA3 A;  4CXF A;  1ETQ A;  3ECH A;  3I59 A;  2IGN A;  3HPH A;  1Y6I A;  1FYL A;  1U78 A;  2H6C A;  3TBI A;  3HTU A;  4BAY A;  5FLX Z;  1RES A;  5IT9 K;  4JYK A;  2HOA A;  1KON A;  3WTS C;  2VBY A;  3MKY B;  1IC8 A;  2KIM A;  2GOX B;  1JJ8 C;  2EIK H;  3JRB A;  1A6I A;  5CVJ A;  2AS5 F;  4ZYD A;  2E1C A;  2LRE A;  1ZGJ A;  1SC7 A;  2M4G A;  4BNC A;  2A05 A;  2MA3 A;  2O61 A;  3OMY A;  3DQV C;  3DXJ F;  2Y48 A;  3PFI A;  2KT0 A;  3C7J A;  2E19 A;  1RC9 A;  3H35 A;  2K9L A;  3SDG A;  3BP8 A;  1OCR H;  1WCM J;  3IC7 A;  2O9L A;  3DLL F;  3MZY A;  2DO7 A;  3BZC A;  1XN7 A;  1W0U A;  2L3D A;  1WH7 A;  3ABK H;  3GZ5 A;  3DPT A;  1RET A;  1B4A A;  3V42 A;  4ZZL A;  1E3P A;  5LHI A;  5FKK A;  2ZB9 A;  1FMW A;  5HS7 A;  4LIV A;  4ZDL A;  1AKH A;  1N75 A;  1JJ6 C;  1HOM A;  2J5P A;  3CCS I;  4F93 B;  1OYI A;  3OYK A;  4HW0 A;  3MFK A;  2CJJ A;  2ZFW A;  3BG9 A;  1EKE A;  3C2G A;  2OUM A;  1ZYR F;  5B66 C;  1Z6T A;  4E7Z A;  4F3Q A;  4QTR A;  2XB0 X;  1V5G A;  2CQ7 A;  3GEZ A;  2Y9Z A;  1XGN A;  4U0Y A;  5DD8 A;  2DA4 A;  1SVM A;  2FOK A;  3U9G A;  5D5V B;  3S1R J;  4CCO A;  2W57 A;  3I59 B;  2DDB A;  3IH3 A;  1ZN2 A;  3OL4 A;  4N9H A;  1JXS A;  4AU7 A;  2L7M P; 
#chains in the Genus database with same CATH homology
 3CUQ C;  2YPR A;  1ZHF A;  3HRT A;  4KYW A;  1LJ9 A;  4YII A;  5CVR A;  1R22 A;  1S29 A;  1I27 A;  1SFE A;  3IWZ A;  1IN5 A;  5FB2 A;  1ZAO A;  1EV7 A;  1H9T A;  4AIJ A;  1RZ4 A;  3Q5F A;  4BH9 A;  5DCM A;  5HOO A;  2A5Y B;  1JHF A;  2C6Y A;  4PGH A;  4RAZ A;  3EYI A;  3WTY C;  1JGS A;  2G9W A;  2RQP A;  1FLI A;  2A6E F;  4KFC A;  3HRU A;  2BBY A;  2EFP A;  3PQK A;  3P9I A;  1MD0 A;  3IRR A;  3E6M A;  2UXX A;  2HEO A;  1QZY A;  3RDI A;  3ZMS A;  1IF1 A;  5CVV A;  3MQ0 A;  1UHW A;  2NYX A;  4MNU A;  5F6F A;  2DK8 A;  3L7W A;  2WV0 A;  4HQE A;  5CJ9 A;  1P6R A;  4LK0 F;  2QEN A;  2FBH A;  3ZMV A;  1HBX G;  4KNY A;  1X3U A;  3EDP A;  4IXA A;  1CF7 A;  1FBS A;  3ULQ B;  3MAJ A;  3K69 A;  4OMZ A;  4GXO A;  4U0W A;  5ILU A;  5L3F A;  2VOP A;  2FRH A;  3QU6 A;  4G7H F;  1EH7 A;  3S2W A;  1Y0U A;  4Q5S F;  1MDM B;  3U2R A;  2FNP A;  1FYM A;  2L02 A;  2XAS A;  2K4B A;  2OU2 A;  4A6D A;  1ZG5 A;  3ERE D;  4O3M A;  4ON0 A;  1IN7 A;  3FM5 A;  1QO0 D;  3LA7 A;  3WGH A;  2KIU A;  4M6X A;  3LAP A;  2XAH A;  4S04 A;  4G7O F;  1KU2 A;  4LGW A;  1I5Z A;  2HR3 A;  2LDU A;  3FXQ A;  1FSH A;  4ZZD A;  4B09 A;  3GFI A;  3N4M A;  3FXR A;  2VBZ A;  2JPB A;  2LF7 A;  1AWC A;  1J7K A;  1G3S A;  1CF7 B;  3F8F A;  3FMR A;  3ABU A;  1XMK A;  4AD9 A;  3REO A;  1SD6 A;  2OBP A;  1XGO A;  4ESF A;  1WSU A;  3RYP A;  1LEB A;  2NNN A;  2CQK A;  4WCG A;  1KU7 A;  3WG9 A;  2MLG A;  3CLO A;  2V1D A;  5DDG A;  2CWE A;  1TQP A;  4M72 A;  4BQA A;  1T39 A;  3KEO A;  4OIQ F;  4Q4Z F;  1AOY A;  3FHZ A;  2E7W A;  2P7C B;  2FXA A;  3SHF A;  1QPM A;  3JTH A;  4CZZ A;  4RB3 C;  3ZMT A;  4OIN F;  1GXQ A;  1W7P A;  3F6O A;  3SZT A;  1ULY A;  1UST A;  4KIF A;  4A5M A;  5E18 F;  1EH8 A;  4G7Z F;  1NHA A;  4KMF A;  4MQ9 F;  3JSO A;  4HX8 A;  1SMT A;  3K1M A;  3T0Y A;  2XAF A;  4I7H A;  2ZBK A;  3L09 A;  1CGP A;  4DQ2 A;  1DDN A;  2F2E A;  2RVC A;  2B0L A;  1ZG1 A;  2VE9 A;  4PZJ A;  2ZKZ A;  3F8C A;  3F8B A;  2VC1 A;  2K86 A;  4WK8 F;  1OYW A;  5LHH A;  3T8R A;  3GVA A;  1IN6 A;  4RB2 C;  2DPD A;  1A04 A;  1TNT A;  1C0W A;  3K9T A;  3HIF A;  2PMH A;  3HSE A;  4HA8 A;  4CGZ A;  2PEX A;  2BYV E;  5BQT A;  1W7P B;  2KJB A;  3O3K A;  5LGT A;  1STZ A;  2MBF A;  5E1X A;  3KZZ A;  4G9Y A;  1G4D A;  2OZU A;  3AAF A;  2NRA C;  5F1R A;  4LLL A;  2EJR A;  4UNO A;  4MTE A;  2UZK A;  3IHU A;  4FT8 A;  3TO6 A;  3HUG A;  3KP6 A;  3L2C A;  3P9C A;  2Q0O A;  3MEX A;  4A6E A;  4EGZ A;  1Z05 A;  4XBF A;  3DKW A;  2A68 F;  4HF2 A;  3ZMU A;  1T98 A;  4EJT A;  4L9T A;  3NRV A;  1SD4 A;  1J59 A;  2HFH A;  1WWX A;  1YFH A;  2A69 F;  1D8K A;  3RKW A;  1FY7 A;  1WKM A;  4P9F A;  3F21 A;  1DPR A;  4ETS A;  1S7O A;  1D5V A;  1XB4 A;  1FWZ A;  2PMU A;  1YIO A;  3KE2 A;  2QZ8 A;  2A61 A;  3H3U A;  1W4M A;  5HDK A;  3JAM Z;  2PJP A;  2PG4 A;  1XCV A;  4BYY A;  2CFX A;  4ASN A;  2ZXJ A;  1U5T C;  3HOS A;  5D5U B;  1T6S A;  4CYD A;  1BI2 A;  1ZH5 A;  1BIB A;  1REP C;  4EVI A;  1J75 A;  4UHT A;  3TDZ C;  3VB2 A;  4EM0 B;  2HGC A;  2GAU A;  4RB0 A;  2XAQ A;  4KT5 C;  1HXD A;  2LKP A;  5H6R A;  2FU4 A;  4CO8 A;  4LMY A;  5FD6 A;  4IHT A;  2D1V A;  3ABT A;  3K1P A;  4ENM A;  4OMY A;  3TDU C;  1KQ8 A;  3J81 Z;  3R6S A;  2JPC A;  2W25 A;  4RGS A;  2YR2 A;  2DI3 A;  2HDC A;  2H6B A;  5HDN A;  2V1U A;  5J8C A;  4ESB A;  5HLG A;  1ZRF A;  4LB5 A;  1TNS A;  1B1B A;  5AIQ A;  2L4A A;  3E6B A;  2PBI A;  4I09 A;  2ZNZ A;  3GZ6 A;  1YS7 A;  4IRH A;  4YFK F;  1HKT A;  1ZRC A;  1L3L A;  1YYV A;  3LFK A;  2A3S A;  5K5R A;  2L01 A;  5D6F A;  2X4H A;  1MGT A;  4IPA A;  1YTY A;  5FO5 A;  1MZB A;  4M74 A;  1FNN A;  2HTS A;  3IKT A;  2Z99 A;  3WGI A;  3HRM A;  4LLG F;  3RPQ A;  2IW5 A;  1R1U A;  1XMA A;  3FWE A;  3CO7 C;  2F5C A;  3V8L A;  3RI4 A;  3ZP5 A;  1J5Y A;  4UV9 A;  3JSP A;  2J5O A;  1R5H A;  4HF0 A;  5KK1 A;  1R1V A;  3TO9 A;  5A2Q K;  4QWQ A;  3KLN A;  3KFW X;  5IT9 Z;  2VBW A;  5DYM A;  2XIG A;  3R0A A;  4R8H A;  1KU3 A;  1XD7 A;  3HHH A;  1ZAR A;  2QQ9 A;  5CVI A;  4EQQ A;  3H92 A;  2UWM A;  5H20 A;  3V8J A;  2K4J A;  1WQ2 A;  4Y15 A;  4P96 A;  4JQF A;  1MJA A;  1G3W A;  2XAJ A;  2RGV A;  4IHS A;  4E70 A;  3KP5 A;  3CJN A;  3GUD A;  4IF4 A;  1QZZ A;  3QPH A;  2FBK A;  3E5U A;  4YG2 F;  4NQW A;  1IXC A;  3R4K A;  4R79 A;  1YW9 A;  4UV8 A;  3KLO A;  3LWF A;  3W6J B;  1B59 A;  4XLP F;  3WOD F;  5E1W A;  1QBJ A;  2M30 A;  3V4G A;  3KEQ A;  3EQL F;  1KA8 A;  1IXR C;  2P5K A;  2DAO A;  1D3Y A;  2IA0 A;  2HYF A;  1UFM A;  5EEG A;  4HLX A;  3FM3 A;  5DEQ A;  1FYK A;  3F72 A;  2XRO A;  4P5O A;  3W6K B;  2WTE A;  1Z7U A;  5K5Q A;  2IA2 A;  2AXL A;  4P55 A;  2V1X A;  4A5N A;  2ZJ2 A;  3E6D A;  3DFG A;  1B9N A;  5E17 F;  3TO7 A;  2FA5 A;  1O57 A;  2HS5 A;  2XAG A;  4D0P A;  2FQ3 A;  5D5W B;  3OV8 A;  1YW7 A;  4BHP A;  1HQC A;  1R5G A;  2ZME A;  2OAZ A;  3WTZ A;  4DNC A;  3E6C C;  3GW2 A;  2L54 A;  2HKO A;  4AIH A;  1W7P D;  3Q9S A;  5HS9 A;  3GFJ A;  4KIB A;  1JHH A;  3FMS A;  5DCM B;  5BPI A;  3E5Q A;  2M45 A;  1U6G A;  1J0R A;  2XRN A;  1BC7 C;  4MQV A;  1P4X A;  2P5L C;  2R7D A;  4Q47 A;  3KP3 A;  4ZYG A;  3KP7 A;  1B9M A;  2GQQ A;  1LB2 A;  3ECO A;  2PI0 A;  4L9J A;  2P6S A;  3WE2 A;  2YX4 A;  2FE3 A;  1F4K A;  1KQ0 A;  1O7L A;  3T5X A;  1I1S A;  4CDG A;  1SAX A;  3O2P E;  2P8T A;  3E3V A;  3ZN0 A;  1RUO A;  4G8X A;  1D8J A;  4KDP A;  1YS6 A;  1SD5 A;  1XDS A;  1HW5 A;  5TRD A;  2F5F A;  4WXH A;  5JVT A;  4IJA A;  3JW4 A;  3L00 A;  2W84 A;  3TOA A;  3VEP A;  3I71 A;  3RYR A;  3M1E A;  1XDU A;  1O3R A;  3VFZ A;  4LK1 F;  3D0S A;  4RS8 A;  1TQI A;  1IUY A;  3E97 A;  1HW2 A;  2XV4 S;  3ROU A;  1L0O C;  3GWZ A;  3K2Z A;  1FP1 D;  4ENN A;  5JFR A;  2UXN A;  3E5X A;  1YLF A;  1FT9 A;  2IPQ X;  1FZP B;  3TKY A;  2HQN A;  4NHJ A;  2DTR A;  3TOB A;  4I2O A;  3BRO A;  4O6J A;  2FSW A;  4RGU A;  2FBI A;  1SD7 A;  1XGS A;  3ZN1 A;  1BIA A;  2KRF A;  3RTR A;  2WWY A;  1OKR A;  2ADU A;  2KJC A;  3KP4 A;  4L9V A;  3C3W A;  2CGP A;  2NNY A;  2YSR A;  4G6D A;  1UCR A;  1FPQ A;  1GHC A;  5L3B A;  3F3X A;  1IRF A;  2OZ6 A;  1ZG3 A;  1KYZ A;  3DV8 A;  4HDV A;  4UVC A;  1IN8 A;  3LA2 A;  4U88 A;  2OQG A;  2ESH A;  2P7V B;  4OIP F;  1XSX A;  2ZO4 A;  2CO5 A;  5JHU A;  4JBA A;  1I1G A;  2D45 A;  3HSF A;  3WGG A;  5FD5 A;  2O8X A;  3LST A;  2DLL A;  4YIF A;  4WXC A;  1U3E M;  5CYV A;  4OIO F;  3BOQ A;  2GXB A;  1FC3 A;  4ZYE A;  2ZCW A;  1LDK B;  3DF8 A;  4L18 B;  3BDD A;  3D5L A;  4OIR F;  2OD5 A;  3HRS A;  2HOE A;  1W5S A;  3K0L A;  1HST A;  1Q1H A;  1KYW A;  3M8F A;  3GFL A;  1SFU A;  1U5T A;  2JT1 A;  4MEX F;  4OU0 A;  2EWN A;  1R58 A;  2MC3 A;  1ZLJ A;  3WTU C;  1FSE A;  2DU9 A;  3WU0 A;  4A0X A;  4I02 A;  1J9I A;  3F22 A;  5D5X B;  3V7R A;  4A2U A;  3EYY A;  1BI0 A;  4OOI A;  2H94 A;  3QOP A;  4HV5 A;  2H27 A;  5D4R A;  1Z91 A;  5ICC A;  2COM A;  4Y13 A;  1OR7 A;  2RC4 A;  2Y0M A;  4QLC U;  2FMY A;  2Z9O A;  4AVP A;  4AWX B;  3M9A A;  1YW8 A;  2X0L A;  3IWF A;  2Q8K A;  3OOP A;  2P4W A;  4L5I A;  4RGX A;  5LRS A;  1BJA A;  3L9F A;  1UB9 A;  1LNW A;  1IXS B;  1F9N A;  3B73 A;  1XSV A;  3KP2 A;  2W24 A;  3TGN A;  2Z3Y A;  4EJO A;  2ETH A;  1B6A A;  3I53 A;  5E8G A;  2MLK A;  3COA C;  3N97 A;  2YU3 A;  4YFN F;  1LDD A;  1H0M A;  2WC2 A;  4RB1 A;  5FFX A;  3HSR A;  4KIC A;  5LGN A;  4N0B A;  1BN5 A;  4F7Z A;  1S6L A;  1HW1 A;  1XCB A;  2RDP A;  1V3F A;  3IL2 A;  4FX0 A;  3GYH X;  1S3J A;  2STT A;  3WTW C;  3C1D A;  3RPU A;  2QM3 A;  4WWC A;  5FFZ A;  3WE3 A;  2Q2E A;  5IT3 A;  1VTN C;  5JR3 A;  4KIG A;  2EV6 A;  2XKO A;  5DCF A;  5LEJ A;  4Z2Y A;  1ZRE A;  3QPT A;  4LD5 A;  4PCQ A;  4O5V A;  3J80 K;  1KU9 A;  3MWM A;  4HBL A;  5BS6 A;  4TV7 A;  4LLN A;  4S05 A;  2IRF G;  2DFI A;  1W5T A;  4LFU A;  4ESJ A;  2RNJ A;  1DP7 P;  3DEU A;  3I64 A;  4PDK A;  2XUB A;  2NAZ A;  4U0V A;  3BJ6 A;  3G73 A;  5HLI A;  1T38 A;  2NS0 A;  2P6T A;  1MJB A;  1RNL A;  2V9V A;  2PFB A;  2HQR A;  1HSJ A;  1SMY F;  1MKM A;  2IT0 A;  3BPV A;  2GXG A;  1I6X A;  3ZMZ A;  3ISP A;  5L3E A;  3BZ6 A;  4HYE A;  4K2E A;  4G94 A;  1IZ1 A;  2HKX A;  5D4S A;  5DD4 A;  2EB7 A;  5E20 A;  1V4R A;  4Y17 A;  2A07 F;  3I58 A;  2GIV A;  3ML6 A;  2QUF A;  4MGR A;  4KA4 A;  5E1Z B;  6PAX A;  3CUQ A;  5D8L B;  3WTT C;  4MEY F;  3HYI A;  4KMU X;  5A2Q Z;  3QP6 A;  3BY6 A;  3M8E A;  2EFN A;  4EGY A;  4I0B A;  2IVM A;  2ISY A;  1YO5 C;  5L3D A;  2LNB A;  3IKV A;  5CVU A;  1R36 A;  1LQ1 A;  4R1H A;  5FLX K;  4XLN F;  1ZLK A;  2CYY A;  2QQB A;  4AIK A;  1LEA A;  3QRF F;  2DBB A;  5AON A;  2G7U A;  1HKS A;  1QNT A;  2RV8 A;  3EUH A;  1KGS A;  2XHK A;  4WXD A;  3RKY A;  1Z6R A;  4G6Q A;  2EK5 A;  3MCZ A;  5FGM A;  4EJU A;  4LJZ F;  5LBQ A;  1R1T A;  1DPU A;  3FMQ A;  3T1B A;  3I0T A;  4HX4 A;  3F23 A;  1OMI A;  3SQN A;  3WU1 B;  4RAY A;  2FNA A;  2K7L A;  4YFX F;  4ENK A;  3CUQ B;  3CTA A;  3F6V A;  2CW0 F;  1G3T A;  4FX4 A;  3PQJ A;  3R60 A;  4RGR A;  4EV0 A;  2VOD A;  4XSZ F;  3NQO A;  2V6C A;  3O6B B;  4HLY A;  3P9K A;  4M9Z A;  1IN4 A;  3KET A;  1BC8 C;  1RI7 A;  1ONV A;  1O3Q A;  2O3F A;  3RIR A;  5HLH A;  4HAM A;  4P9U A;  3T8T A;  5JI6 A;  3MZH A;  2R7F A;  5J6X A;  1R7J A;  3ZPL A;  3KCC A;  1P4W A;  5F64 A;  5J8F A;  3F8M A;  2IA1 A;  3QU3 A;  2QLZ A;  1K78 A;  5LEK A;  5ICF A;  3JTG A;  3R0J A;  2YX7 A;  2JSC A;  1MDM A;  1ODD A;  2HZT A;  1TBX A;  2STW A;  3I54 A;  2VON A;  2ZNY A;  4B8X A;  5ERI A;  3HOT A;  5D8K B;  3I4P A;  4WF2 A;  1UHM A;  5DV5 A;  4KN4 X;  1KQ9 A;  3RKX A;  2EFQ A;  1IAW A;  4M9S A;  2VXZ A;  1GXP A;  5LGU A;  3ZMD A;  1YG2 A;  5K1Y A;  2V79 A;  4LB6 B;  2G7H A;  3VOD A;  5LRR A;  3GFM A;  2D2W A;  1P4A A;  4L0Z B;  5K5O A;  1FBU A;  1R23 A;  2VC0 A;  4U7B A;  4I01 A;  4A0Z A;  3VOE A;  2EA2 A;  3QP5 A;  5TJJ A;  1BM9 A;  2KIF A;  1RUN A;  1K78 B;  2XVC A;  2MD5 A;  4PGG A;  4M71 A;  2GWR A;  2XGX A;  3LAJ A;  3FXU A;  3GF2 A;  2FF4 A;  4HDU A;  3NEU A;  5ILV A;  1T0F A;  3GO5 A;  4HF1 A;  3V7C A;  5DUK A;  2L4M A;  1F1Z A;  2ZME B;  1K6O A;  2EFW A;  3C18 A;  2DW4 A;  2FEZ A;  4JK1 X;  2EV0 A;  4GYG A;  1PP8 F;  2D1H A;  3BJO A;  2ELH A;  3DPL C;  5D6E A;  3ELK A;  1ON2 A;  2Z33 A;  1S7A A;  1G3Y A;  2P5V A;  3V8K A;  1TQM A;  1TW3 A;  3CUO A;  3GX4 X;  4MHG A;  3SZP A;  5BOX A;  2F5E A;  2CG4 A;  3FX3 A;  2XKP A;  1PDN C;  3BPX A;  4L0Y B;  4GO1 A;  2M87 A;  2OQR A;  4WX9 A;  1OPC A;  4GGG A;  1FOK A;  2R3S A;  1J2X A;  1EH6 A;  2Y75 A;  5DUI A;  1HKQ A;  2W85 A;  2O0Y A;  2RKH A;  2ISZ A;  1BI1 A;  1QQI A;  2O03 A;  2KKO A;  1R00 A;  2BGC A;  1IRG A;  2VT2 A;  4EM1 A;  4N9I A;  1PP7 U;  4IRI A;  3FZV A;  4IVN A;  4GCV A;  4HQM A;  2DK5 A;  4ENJ A;  1Z1D A;  3EET A;  3R61 A;  4L5J A;  1O7F A;  4CHU A;  4BHC A;  1YQA A;  4FHT A;  5HS8 A;  3SXY A;  1ZGA A;  5ICG A;  1FBQ A;  3U1D A;  3F8N A;  1K7A A;  2EV5 A;  1LDJ A;  3J7A O;  4H0E A;  4M9X A;  3HHG A;  3Q9V A;  2QWW A;  1P92 A;  4HZF A;  5LLQ A;  1U2W A;  3K1N A;  2QBY A;  5H6Q A;  4CIC A;  1Z9C A;  4EMS A;  2F5D A;  1LVA A;  3CO6 C;  2HWV A;  1E17 A;  1QGP A;  2FML A;  2OA4 A;  1E2X A;  3I5U A;  1WI9 A;  3LQR A;  4NB5 A;  2DPU A;  3M7G A;  2E7X A;  5EEH A;  5HDG A;  4EM2 A;  4UUV A;  2M8E A;  2GZW A;  4MTD A;  1JE8 A;  4ZH4 F;  2PLY A;  2EA4 A;  2O6G E;  2VN2 A;  3H3Z A;  5BPD A;  2K27 A;  2ESN A;  1RIO H;  1WRJ A;  2MH9 A;  4UVB A;  3BJA A;  4EJW A;  1IW7 F;  2BEO A;  3B02 A;  1U5T B;  4LG0 A;  2QBY B;  1H9G A;  5BMZ A;  2MH2 A;  1O3T A;  2H09 A;  1SFX A;  1K79 A;  3JAM K;  3TQN A;  2GA2 A;  2VT3 A;  3V7S A;  1FX7 A;  2K02 A;  4HOB A;  3G3Z A;  2BE5 F;  1FP2 A;  5HVQ C;  2QVO A;  5ED4 A;  1G6N A;  2HYG D;  2M5W A;  2VBX A;  3WTV C;  4KUM A;  2VOO A;  4A12 A;  4GYI A;  3GXO A;  2TDX A;  5CLS A;  1TTY A;  2RN7 A;  1P2F A;  2VE8 A;  1DUX C;  4KN7 X;  4I98 B;  1ON1 A;  3KZY A;  4BXU A;  1BOA A;  4L9N A;  3LQQ A;  4HV6 A;  1ZRD A;  2M1B A;  2PQ8 A;  3BWG A;  1XSD A;  1PUE E;  4UVA A;  1U8R A;  2LSO A;  3J81 K;  5L3C A;  4U7D A;  2E1N A;  3J80 Z;  1GVJ A;  4LG0 B;  2QYO A;  3IRQ A;  2LF8 A;  4XRF A;  2CSO A;  2DQL A;  2BV6 A;  1F5T A;  2GA1 A;  2A6H F;  3HTS B;  1BI3 A;  1T2K A;  4M73 A;  3RJP A;  4A0Y A;  5AIP A;  3SFZ A;  4M6Y A;  1XGM A;  1MJ9 A;  2DT5 A;  1O3S A;  5L3G A;  1USS A;  3FF5 A;  4Q48 A;  4ZYH A;  3WTX C;  4IRG A;  2HTJ A;  2PN6 A;  4XSX F;  5E8I A;  5ILS A;  3ZQ7 A;  2EFO A;  2JTV A;  3QAH A;  2JZY A;  3CDH A;  2ACJ A;  2JRT A;  4BHB A;  3P7N A;  2IJL A;  4I0A A;  4HX7 A;  1TLH B;  5KVR A;  2QQA A;  1BBY A;  4EJV A;  2Z5U A;  3DP7 A;  2DQR A;  1S8N A;  5LHG A;  1OYY A;  3GLX A;  1TW2 A;  2IP2 A;  4UXN A;  5ICE A;  3LA3 A;  4CXF A;  3ECH A;  3I59 A;  1FYL A;  1U78 A;  2H6C A;  3HTU A;  4BAY A;  5FLX Z;  5IT9 K;  3WTS C;  2VBY A;  2KIM A;  5CVJ A;  2AS5 F;  4ZYD A;  2E1C A;  1ZGJ A;  4BNC A;  2MA3 A;  2O61 A;  3DQV C;  3DXJ F;  2Y48 A;  3PFI A;  3C7J A;  3BP8 A;  3IC7 A;  3MZY A;  2DO7 A;  1XN7 A;  2L3D A;  3GZ5 A;  3DPT A;  1B4A A;  4ZZL A;  5LHI A;  5HS7 A;  2J5P A;  1OYI A;  4HW0 A;  3MFK A;  2ZFW A;  1ZYR F;  1Z6T A;  3GEZ A;  1XGN A;  4U0Y A;  5DD8 A;  2FOK A;  3U9G A;  5D5V B;  2W57 A;  3I59 B;  1ZN2 A;  4N9H A;  1JXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...