3ZP5A

Crystal structure of the dna binding ets domain of the human protein fev in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords PROTEIN FEV
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zp5A00
1CGPA 4EJVA 4OIQF 1ODDA 3E6DA 3WE3A 4CYDA 4AD9A 3E5QA 5LEKA 1FSEA 4TV7A 2GQQA 3V8JA 3C18A 2CW0F 1FX7A 4EM2A 4U7DA 1O57A 3CUQB 2GZWA 5ICFA 1EH8A 2XUBA 2YU3A 3J7AO 1GVJA 5JFRA 2EFWA 2Y48A 4CGZA 1RUNA 2QVOA 3IHUA 3BDDA 2PN6A 1U3EM 5LRRA 1W7PB 1FBQA 3M7GA 1R1VA 2A6EF 3KLOA 3HTSB 1ULYA 2W57A 2BEOA 3PFIA 1KQ8A 1F5TA 2VBZA 2ZXJA 4IPAA 1XDSA 2VC0A 1BI2A 1DPUA 3ZMZA 4LK0F 3J81Z 3W6KB 1E2XA 1P4XA 3EQLF 4M71A 1T2KA 2DBBA 4KYWA 1V4RA 2Q2EA 1XCBA 2Z5UA 3CUQC 2E7WA 4L5JA 2FNAA 2MBFA 3ABTA 3H3ZA 1IN4A 3IL2A 1FLIA 1K6OA 5CVVA 2HS5A 1KQ9A 5LHIA 1TW2A 1UFMA 1XGOA 3E5XA 2MC3A 1SMYF 3KZZA 2AS5F 3KP3A 3QU3A 5BPIA 4BH9A 5D6EA 4RB0A 4I02A 4A6DA 4ZYHA 3J80K 1J9IA 2RKHA 2L4AA 5HDGA 3L2CA 3F6VA 1YG2A 3F8NA 4JBAA 5EEGA 3BWGA 3LSTA 4HX7A 1OYIA 5LHGA 2CYYA 3ISPA 2FXAA 3KE2A 2VOPA 2EWNA 1C0WA 3V4GA 3Q5FA 3VODA 3IWZA 2D1HA 2JT1A 1WI9A 2OBPA 3MAJA 1ZHFA 1J5YA 1TNTA 2IA2A 5L3DA 1LEBA 5L3FA 2NNYA 1XGSA 2M1BA 3ZMTA 5HDNA 2CFXA 1ZH5A 1ON2A 3HRUA 3HTUA 3GFIA 3LAPA 2BBYA 1FPQA 5E17F 3GFLA 1B9MA 3F8CA 2M30A 4A0YA 2CWEA 1D8KA 4MNUA 3GWZA 3DPTA 3ZPLA 2MA3A 4G6QA 4MHGA 3BJ6A 2JRTA 3P9KA 2H94A 3B73A 3WTWC 1XN7A 5LEJA 3ZN0A 3ZP5A 4UV8A 2ESHA 4GXOA 3G3ZA 1FY7A 4KN4X 2PEXA 5CJ9A 2KIFA 1HKQA 1T38A 2VBXA 3QPHA 1FZPB 3DEUA 1YIOA 4YFKF 1STZA 4LLNA 2XAHA 2YX7A 1BI1A 4CZZA 1KU7A 2OA4A 3TKYA 1P6RA 1CF7A 1B9NA 1BN5A 3F3XA 1AOYA 3SFZA 2F5CA 2XGXA 5DUIA 3IRRA 5CVIA 4PGGA 2P7CB 1W4MA 3Q9VA 2HTJA 1XGNA 2XASA 3EUHA 2MH2A 4HDUA 4HA8A 5BS6A 3FXRA 2IT0A 2PMUA 3REOA 2Z3YA 1B6AA 5F6FA 3TGNA 2ZO4A 1OKRA 3ZMUA 5ICEA 2HYGD 5HLIA 3ZN1A 1QBJA 2ELHA 2P8TA 4I7HA 3I64A 4A0XA 4U0YA 2UXXA 3FMQA 1ONVA 3WU1B 5F64A 2W25A 2X0LA 4ETSA 2V1XA 3I54A 1QZZA 1QGPA 4KT5C 1EV7A 4IRHA 2RQPA 4LLLA 3WGIA 3WU0A 3HRTA 2IA1A 4A6EA 1RIOH 4RGSA 5D6FA 4DNCA 2K7LA 2Z99A 2QUFA 5F1RA 1XDUA 5L3BA 5ILUA 2V9VA 3E6BA 4IXAA 1S6LA 5LHHA 4AVPA 4OIPF 4HDVA 3MEXA 1OYYA 1ZAOA 3FXQA 1S29A 4EM1A 1R23A 1Z91A 3QAHA 2BGCA 2P4WA 1I6XA 3GVAA 2FMLA 1WSUA 3VOEA 4HZFA 4BAYA 3DF8A 4N9IA 2FF4A 2J5OA 3TOBA 4M6XA 3BZ6A 4NB5A 2PJPA 4KN7X 5HVQC 2G9WA 2FBIA 3J81K 1CF7B 3QP6A 3QP5A 1IF1A 1TW3A 4LFUA 2DU9A 2QM3A 5ERIA 4U0WA 3ULQB 4OMZA 1HBXG 1OMIA 1IXRC 4M74A 5TRDA 4XBFA 4ZZDA 5K5OA 1ZG1A 3EETA 4LJZF 1X3UA 1F4KA 2L4MA 1HSTA 4KUMA 2YSRA 2BYVE 3DKWA 1RNLA 2H6CA 1Z1DA 4M73A 2DPUA 1LDDA 2YR2A 3V7SA 3R4KA 2MLGA 1KU3A 3V8KA 4I01A 4A12A 1TLHB 1Z6TA 5AIQA 1HQCA 1TQMA 4LGWA 1H9GA 2KIMA 1FBUA 3JSOA 4KMUX 3N97A 4G94A 4N0BA 2EK5A 4KIGA 3ZMSA 2QQAA 1MJAA 1W5SA 5E1WA 2ZFWA 1YS6A 4BYYA 2F5FA 4M9ZA 1KGSA 1F9NA 2E7XA 2DPDA 4LK1F 3CTAA 1WKMA 4M9XA 2E1NA 3D0SA 2DAOA 2BE5F 3U1DA 4HQEA 2O8XA 3HSFA 3TOAA 5DCMA 1ZGAA 1PUEE 2FE3A 4WXDA 1PP8F 5H6RA 2YPRA 4A2UA 3KP7A 4GGGA 5H6QA 2QWWA 4I0AA 5L3GA 2HR3A 3BJOA 3BOQA 5E8IA 2CGPA 4L9TA 1YW7A 5DCMB 4AIKA 1HXDA 3FHZA 1TNSA 3TDUC 3DFGA 3GFMA 1S8NA 4LLGF 3PQKA 1SD4A 4Y15A 4R1HA 2FA5A 1S3JA 2VBYA 4YIFA 2M8EA 2O6GE 4MQVA 5ICCA 2VOOA 1J0RA 3C1DA 4F7ZA 1YW8A 4U88A 3TO6A 1G6NA 1KQ0A 3P9CA 3F8BA 2ZKZA 4RB1A 3E3VA 3ZMVA 2R3SA 3BJAA 5E18F 5D4RA 3LWFA 3WGGA 3I59A 2VE8A 2IW5A 3GXOA 5HLGA 3MWMA 1MDMB 2A68F 2Y0MA 3RDIA 3VFZA 3JTHA 4FT8A 4L9VA 5HOOA 3LA2A 5DUKA 3T8RA 1OR7A 2PFBA 4XLPF 2GA2A 4IF4A 3NRVA 4G7ZF 4WWCA 5D5UB 4ASNA 4ZZLA 2IA0A 3M9AA 1LEAA 2L3DA 2EJRA 1K79A 3QOPA 5L3EA 1U78A 2FMYA 2LNBA 2VE9A 1QPMA 2PI0A 2M87A 4HOBA 3KCCA 5FLXZ 2IPQX 2OAZA 3I58A 4AIJA 1ZG5A 3O2PE 1MDMA 3BPVA 4UNOA 2FBKA 3NQOA 4GCVA 4WK8F 5DYMA 5D8LB 3JAMK 1JXSA 1GHCA 1FP1D 2V6CA 4P9FA 3GFJA 1T98A 2LF7A 2ZMEA 4HLYA 5HS9A 1RI7A 3FM3A 4O3MA 3LA3A 1QO0D 1B1BA 1W7PA 2WTEA 1R5HA 1XCVA 5EEHA 3HHGA 1DDNA 4O6JA 2EB7A 3WTXC 1RZ4A 1KYZA 1P4AA 3HRSA 1I1SA 1HW1A 2F2EA 1BOAA 1K78A 4NQWA 2RN7A 2XKOA 3CDHA 2DK5A 4FHTA 2PLYA 1V3FA 2JTVA 1R1TA 2A61A 1J59A 3RTRA 3KLNA 2DK8A 3S2WA 1J2XA 1R1UA 1I27A 2CSOA 2FNPA 1IZ1A 2K02A 4G7OF 5D5WB 4OU0A 2HEOA 1HW5A 1ZRDA 1JGSA 2LKPA 1IN5A 3N4MA 1OYWA 4EJWA 2D2WA 3JSPA 5TJJA 5AONA 1YS7A 2K27A 5J8CA 5FLXK 1TTYA 2QENA 3P7NA 1MGTA 3HUGA 5HDKA 1QNTA 4RS8A 2D45A 2TDXA 2XV4S 3DQVC 3G73A 2DW4A 2O0YA 3L09A 4QWQA 4IHSA 4RB3C 3HOSA 1I5ZA 2IVMA 1IRFA 2WV0A 5D5XB 3LQRA 1BI3A 1FSHA 2RNJA 4BHCA 5E1ZB 1U5TC 4BHBA 4HF0A 4ESFA 3GX4X 1LDKB 4OIRF 3CO7C 2ISYA 1IUYA 4YFNF 2RV8A 1XSDA 1B59A 5D4SA 1ZRCA 2BV6A 3WTVC 1FOKA 5K5QA 1P4WA 4A5MA 1XMKA 5LLQA 1R58A 2PMHA 3F23A 3L00A 2XAGA 2VODA 4EM0B 4MTEA 3TQNA 3SZTA 3GLXA 4GYIA 4HV5A 3M8FA 4LB5A 1ZN2A 1Z9CA 2MD5A 4HV6A 1YO5C 1FT9A 1RUOA 2QQBA 2K4BA 4OIOF 1JHHA 4HAMA 3U9GA 1U5TB 1ZLKA 3MZHA 3KP6A 1KU9A 2R7FA 3C3WA 5A2QZ 4KFCA 4WF2A 2COMA 4XLNF 2RDPA 2QQ9A 2PBIA 4HX4A 5IT9Z 4KNYA 4N9HA 2RGVA 3I0TA 4RB2C 2OU2A 1IN6A 2KIUA 3I5UA 1WWXA 4HLXA 2UXNA 3R60A 2L02A 5D8KB 1R7JA 2HKXA 2O03A 4XRFA 3HSEA 3GZ6A 1KU2A 3WTZA 3KEOA 1P2FA 3IKTA 5LGNA 2A5YB 2NAZA 5JHUA 4FX4A 1Y0UA 3IRQA 2A69F 2ACJA 1MJ9A 2VXZA 3ZMDA 3HIFA 4PCQA 3NEUA 5ED4A 1BM9A 1XGMA 1L3LA 2GIVA 1L0OC 3DPLC 3I59B 4G9YA 2RVCA 3GEZA 5HS8A 3VB2A 4ENJA 3I71A 2LSOA 4P9UA 5JVTA 4JK1X 4GYGA 3BY6A 4RGRA 4GO1A 4IHTA 3ELKA 3LA7A 5FD6A 2QBYB 1Q1HA 1GXQA 3WGHA 3WG9A 4LMYA 1OPCA 3GYHX 1IN8A 4BNCA 2EFNA 3IC7A 1W5TA 5H20A 4OINF 5ICGA 2X4HA 3D5LA 2OZUA 1DUXC 2GAUA 1IW7F 2XAQA 4Q47A 2A6HF 1D3YA 1UCRA 2CG4A 2HZTA 1IRGA 4M6YA 3T5XA 4K2EA 4WXHA 1FWZA 4HX8A 3FXUA 3JW4A 3M1EA 2XVCA 3COAC 2VONA 4OMYA 3FMSA 2E1CA 1D5VA 3ERED 1U8RA 3IKVA 1JHFA 2HGCA 4HBLA 2HOEA 4P96A 3CLOA 5DD8A 5DDGA 1T0FA 2OQGA 3ML6A 4LG0B 4CXFA 4Z2YA 1AWCA 1ZARA 1SD5A 5E20A 5J8FA 1BBYA 2F5EA 1D8JA 3TDZC 1PP7U 2J5PA 3LAJA 3KP4A 4WXCA 2MLKA 2V1UA 3CO6C 3QRFF 3KZYA 3B02A 3FMRA 3VEPA 2KJBA 1U6GA 1S7OA 1J75A 2C6YA 3RJPA 4MQ9F 4M72A 3T8TA 1YLFA 2DQLA 2A3SA 2QZ8A 2WWYA 4IRGA 3R0AA 1SAXA 4ON0A 3R0JA 3CUOA 5KVRA 2L54A 1Z05A 3PQJA 1G4DA 4Q5SF 3TO9A 2NRAC 1XB4A 1IXCA 4ESBA 5D5VB 1H9TA 2Z33A 1Z6RA 4MEYF 2L01A 3HRMA 2EV0A 1T6SA 4A5NA 2DT5A 1JE8A 2VBWA 1LJ9A 2H27A 3KP2A 1EH7A 3RPQA 3F21A 4ENNA 4EJTA 3HSRA 2QLZA 2FOKA 3L9FA 4L0ZB 3KP5A 1G3TA 3ECHA 3ABUA 3KETA 1BI0A 1BJAA 2VN2A 4PZJA 2FU4A 4CICA 4XSZF 4P55A 5ILVA 2FRHA 3F6OA 1YYVA 4L5IA 1SFXA 2MH9A 1SFEA 3GW2A 3FZVA 1O3TA 3KEQA 2EFPA 4MGRA 2EV6A 4ENKA 1R00A 2KJCA 5K5RA 3BPXA 2IP2A 2LF8A 1U2WA 1G3YA 1S7AA 3EDPA 3WTUC 1REPC 3MFKA 3W6JB 2NNNA 5LGTA 2H09A 2ETHA 1FNNA 2AXLA 4KMFA 1H0MA 3R6SA 3OV8A 3RKXA 3K1PA 1LQ1A 1HKTA 2ZNYA 3K69A 5J6XA 2DLLA 4EV0A 2K4JA 1ZREA 2IRFG 2P5VA 3C7JA 2P6SA 2EFOA 4PDKA 1BC7C 1VTNC 4MEXF 4YG2F 3WTTC 1IXSB 2EFQA 3ZQ7A 2D1VA 5CYVA 3CUQA 3FX3A 3P9IA 4EGYA 4I09A 4E70A 2P5LC 3FM5A 1MKMA 2K86A 4R8HA 3TO7A 4S05A 3F8MA 2ZBKA 3RYRA 3WE2A 5HLHA 4I2OA 4DQ2A 3QPTA 3I4PA 2GWRA 2M45A 4Y17A 5E8GA 6PAXA 3EYYA 2ZNZA 2PG4A 3MZYA 1LNWA 4U7BA 1ON1A 1O3RA 4NHJA 4QLCU 4MTDA 5FD5A 3K9TA 1O3SA 2G7UA 3K0LA 4L0YB 1LVAA 4G6DA 4O5VA 5JR3A 5FGMA 3IWFA 1U5TA 4UV9A 1EH6A 2P6TA 1TQIA 3K1NA 4BQAA 1A04A 1FP2A 2HQNA 2NS0A 5HS7A 3GF2A 2H6BA 4WX9A 3F8FA 3J80Z 4RGXA 2JSCA 1BC8C 3RIRA 2ZMEB 5DV5A 1DP7P 1R36A 1R22A 1B4AA 5CVRA 2PQ8A 3HYIA 5A2QK 2W84A 2XIGA 4KICA 3L7WA 3EYIA 2STWA 3RKYA 3K2ZA 1FC3A 2OQRA 4JQFA 4UHTA 1K78B 1HW2A 3WTYC 3F22A 4EJOA 3LQQA 5LGUA 5BOXA 1YW9A 2GA1A 5DD4A 1GXPA 4L9NA 3H3UA 3DV8A 2HYFA 3GO5A 1YQAA 3M8EA 5IT9K 1IAWA 4A0ZA 4CHUA 3RPUA 1ZGJA 1Z7UA 4EGZA 2KRFA 3FWEA 2CO5A 3I53A 2Q8KA 1TBXA 5CVJA 2DO7A 4FX0A 3T1BA 2DTRA 4XSXF 3JAMZ 2RC4A 1XD7A 1R5GA 1FYMA 2JPBA 4KIFA 2F5DA 2JPCA 2IJLA 1QZYA 1LDJA 4P5OA 5BQTA 2DQRA 3DP7A 2O61A 4B09A 1USSA 1FBSA 2M5WA 1SD6A 2ADUA 4LG0A 4IRIA 5DCFA 3FF5A 1MD0A 2ISZA 4YIIA 4M9SA 2B0LA 4H0EA 3V7CA 2XAFA 3H92A 1W7PD 2XRNA 2DI3A 2ESNA 3E6MA 4BXUA 2V1DA 3DXJF 4ZYEA 3Q9SA 1HKSA 2EA4A 4D0PA 1KA8A 2O3FA 3SHFA 2FQ3A 3WODF 3MQ0A 1UB9A 4ZH4F 3ROUA 2W85A 2LDUA 5E1XA 1USTA 2NYXA 2STTA 4KA4A 3SXYA 1YFHA 5FFZA 5LRSA 5AIPA 4LD5A 1YTYA 4AIHA 1ZG3A 2ZCWA 1FYLA 2HWVA 3E97A 2OZ6A 4PGHA 1G3WA 1BIAA 2HKOA 4B8XA 3V8LA 3HOTA 5FFXA 2HQRA 4CO8A 5DEQA 3O6BB 4YFXF 1SMTA 5JI6A 3MCZA 2YX4A 2Z9OA 1HSJA 3CJNA 5IT3A 3E6CC 2FEZA 3RYPA 3RKWA 4KIBA 1MJBA 1XSXA 2Q0OA 2G7HA 4EQQA 4LB6B 3O3KA 3SZPA 2EA2A 2P5KA 1UHWA 1O7FA 3SQNA 3U2RA 1PDNC 2P7VB 1J7KA 2UZKA 4ENMA 3QU6A 3E5UA 2WC2A 4L18B 1UHMA 1FYKA 2V79A 2DFIA 2OD5A 2VC1A 3KFWX 1KYWA 3GUDA 4IJAA 4RAYA 4BHPA 5FB2A 3HHHA 4UVAA 3K1MA 4HF2A 1MZBA 1LB2A 1WQ2A 4HYEA 4EVIA 1O3QA 3LFKA 5CLSA 2QYOA 4UXNA 2XROA 2R7DA 4UVCA 2A07F 2QBYA 4IVNA 4KDPA 1ZLJA 3V7RA 1T39A 4CDGA 4Q48A 4I0BA 2HTSA 4UVBA 2XAJA 2W24A 4ESJA 1P92A 5LBQA 1O7LA 1TQPA 2VT3A 2GXBA 5L3CA 3WTSC 3F72A 3BP8A 1BIBA 4ZYGA 1XSVA 3OOPA 5ILSA 4Q4ZF 4EMSA 1QQIA 4UUVA 1SD7A 5KK1A 2Y75A 4WCGA 1NHAA 2XKPA 1ZYRF 4L9JA 1DPRA 2JZYA 3JTGA 2HDCA 1WRJA 1I1GA 4RAZA 2FBHA 1SFUA 1ZRFA 4HQMA 4RGUA 5BMZA 5CVUA 2EV5A 3R61A 2XHKA 4AWXB 1E17A 3GZ5A 3RI4A 1K7AA 2FSWA 4HF1A 1G3SA 3ECOA 4HW0A 2ZJ2A 2HFHA 4R79A 1XMAA 3T0YA 4ZYDA 1F1ZA 2UWMA 4EJUA 2VT2A 4G7HF 5BPDA 2CQKA 3BROA 2GXGA 5K1YA 4Y13A 5FO5A 1IN7A 4S04A 4I98B 2KKOA 4G8XA 3AAFA 4OOIA 4U0VA
chains in the Genus database with same CATH superfamily
2XDVA 1CGPA 3H9GA 4EJVA 4OIQF 3M07A 1ODDA 2MSYA 2KLOA 3E6DA 3WE3A 1ZGWA 4CYDA 4AD9A 1TZLA 3E5QA 5LEKA 1FSEA 1AKHB 4TV7A 5E3NA 2GQQA 2ZJPF 2HYJA 3H3VK 2BVLA 3V8JA 3C18A 2CW0F 1FX7A 4CSWA 3CMMA 5DM6F 4EM2A 2QQ8A 4U7DA 1WGXA 1ITYA 1O57A 3CUQB 2GZWA 2DFHA 2BHYA 4XORA 2R7TA 5ICFA 2HVRA 2KFDA 2LRDA 5K7FA 1HF0A 3I4NJ 1EH8A 1LUJB 4FCYA 2XUBA 2YU3A 3J7AO 4W97A 1GVJA 4BUPA 5JFRA 5KAFC 2Y48A 2EFWA 2MGQA 4PSXA 1D0XA 1RUNA 4CGZA 3OY9A 1BA5A 2RNGA 2QVOA 3IHUA 3BDDA 3SFIA 2PN6A 1U3EM 4GFBA 5LRRA 3TBIA 1JT6A 1W7PB 1FBQA 3M7GA 2V1NA 1R1VA 2A6EF 3KLOA 3HTSB 4BACA 2KL4A 3W2VA 1ULYA 2W57A 2BEOA 3GTJJ 3PFIA 1KQ8A 1F5TA 2BY1A 2K40A 2VBZA 1R4MB 4B48A 2ZXJA 4IPAA 1XDSA 1Z77A 2VC0A 2M7AA 3B6AA 4FQGA 4AYBN 1BI2A 4A3FJ 2GM4A 4I6ZA 1DPUA 3ZMZA 2M0MA 4LK0F 3J81Z 3W6KB 1E2XA 1P4XA 5IYBJ 3EQLF 4M71A 1T2KA 4BS9A 5GAGJ 2DBBA 3OYHA 2CW8A 4KYWA 1V4RA 3EUKL 2Q2EA 1XCBA 2Z5UA 3CUQC 3EPZA 1R5ID 2R5ZA 3LSPA 2E7WA 4L5JA 2Y31A 2FNAA 5F0CA 2MBFA 3HOVJ 3ABTA 2R92J 4YRVA 3H3ZA 2HXOA 1IN4A 3IL2A 3OYIA 1FLIA 1K6OA 2V7FA 5CVVA 5J1UA 2HS5A 3HPGA 1KQ9A 3OL3A 3JRAA 3S3OA 5LHIA 1SFKA 1TW2A 1UZCA 2IEKA 3HKZA 2NVUB 1UFMA 1XGOA 3E5XA 1B72B 3X2QH 2MC3A 2DA4A 2GBYA 1SMYF 3KZZA 2AS5F 3KP3A 2KP6A 2VJIA 1Z3YA 2LYCA 3QU3A 3BG5A 2CV0A 2CQQA 4BH9A 5BPIA 5D6EA 5EGOA 2KIQA 2DT7B 4RB0A 3F0CA 4I02A 2QEXI 4J19A 1JKRC 4A6DA 1W36C 1VQLI 3CC4I 4ZYHA 3J80K 1J9IA 2DYRH 2DN0A 2BOLA 2NS7A 4BQNA 2RKHA 2L4AA 5HDGA 1X4OA 3L2CA 4ZJZA 2DMUA 3F6VA 1YG2A 3F8NA 3LSIA 2K9MA 4JBAA 4KITB 5EEGA 2EINH 3JRFA 3BWGA 3LSTA 4HX7A 2JA6J 9ANTA 1OYIA 5LHGA 2CYYA 3VYUB 3ISPA 2COBA 2FXAA 3KE2A 2VOPA 2EWNA 1C0WA 3V4GA 5JHFA 1E3OC 3Q5FA 2CV1A 4N4NB 3VODA 3IWZA 2D1HA 3TEDA 4BE0A 2JT1A 1WI9A 2OBPA 3MAJA 2BHZA 2JWTA 1ZHFA 1J5YA 2JJ7A 4Y52J 1TNTA 2IA2A 5L3DA 1LEBA 5L3FA 2NNYA 1XGSA 3VDXA 1TP4A 2M1BA 3ZMTA 1PUFB 2ICWG 3DLAA 3HJEA 5HDNA 2CFXA 4ZDLA 1ZH5A 1ON2A 3OYMA 1MBFA 2UUZA 3HRUA 3HTUA 3CDLA 3GFIA 3LAPA 2BBYA 1FPQA 2VI6A 2X1DA 5E17F 3GFLA 4F93B 1B9MA 1SVLA 3F8CA 2M30A 5CQEA 4A0YA 4C3IJ 1VF9A 3GTMJ 3S2HJ 2CWEA 2QGUA 3GLLA 3FXKA 1AKHA 1D8KA 4MNUA 3GWZA 4JYKA 3OSGA 3VWBA 3DPTA 3ZPLA 4NC6A 3ZQIA 1DGWY 5HNHA 1WH5A 2MA3A 4G6QA 2DA1A 3S32A 4M6VA 1G59A 4UUSB 4MHGA 1MSEC 3A2KA 3BJ6A 5EDNA 4DIQA 2JRTA 3P9KA 2H94A 2E19A 3B73A 3WTWC 1XN7A 5LEJA 2NXNB 5E3MA 3ZN0A 3OIPA 3ZP5A 1RR7A 4XRSG 4UV8A 2ESHA 1D5YA 1I3AA 2KQRA 4GXOA 2DMNA 3G3ZA 1FY7A 4KN4X 1BL0A 2PEXA 1A31A 2ZJQF 3LSHA 3WHCA 5CJ9A 4LIVA 2BY2A 2KIFA 2R7VA 1HKQA 4NQWB 2V9KA 2VJ5A 1T38A 2A6TA 2VBXA 3QPHA 1W0TA 1FZPB 3DEUA 1YIOA 4YFKF 1STZA 3G2BA 4LLNA 2VPLA 2XAHA 2YX7A 2XPUA 1BI1A 3FKIJ 1W36D 4XKWA 4CZZA 1KU7A 2OA4A 3TKYA 1T08B 5F0FA 1PUFA 1P6RA 3ZQHA 1CF7A 4GDFA 1B9NA 3PSIA 3K4KA 2DFEA 1BN5A 3F3XA 4XIDA 1AOYA 3SFZA 3TP3A 2F5CA 2XGXA 5DUIA 2E1MC 3IRRA 1XTAA 5CVIA 3LSRA 4PGGA 2LY9A 5C4XJ 1MMDA 1RKTA 3OWTA 2P7CB 3ZQCA 4F91B 3G1MA 1W4MA 3BR2A 3Q9VA 2F4OB 2HTJA 3KEYA 3JRDA 1XPXA 3AL0B 1X4PA 3OS2A 1XGNA 3K6GA 3J7YJ 2XASA 3GTQJ 3RKQA 1EKEA 2P0WA 2IBDA 1GLNA 2R93J 2CV2A 3G1LA 3EUHA 2MH2A 4HDUA 2HDWA 3NAUA 4HA8A 4IKFA 5BS6A 3FXRA 4B4CA 1YX5A 4LITA 2IT0A 2PMUA 3REOA 2Z3YA 5FRNA 1B6AA 5F6FA 5IY5H 1Y6IA 3TGNA 3A4CA 2ZO4A 1OKRA 3ZMUA 5ICEA 1OISA 2HYGD 4G6TB 5HLIA 3ZN1A 3CMAI 2CFOA 1QBJA 2XRLA 3BR3A 2F4IA 2ELHA 3HC7A 4B3AA 2P8TA 4I7HA 1B72A 3I64A 4A0XA 4U0YA 2UXXA 2RQQA 3FMQA 3QPSA 1ONVA 3WU1B 5F64A 2R7QA 2W25A 3H0DA 2X0LA 5EJCA 4ETSA 2V1XA 3I54A 3BZKA 1QZZA 1QGPA 4KT5C 1UMQA 1EV7A 4BE2A 4ITVA 4RBOA 4IRHA 2RQPA 4LLLA 3WGIA 3WU0A 3HRTA 2E1MB 4PJMA 2IA1A 4A6EA 1IJWC 3D5RC 1OCOH 1ZK8A 1RIOH 2JVHA 2MABA 2F4MB 2X48A 2ID3A 2DXIA 2FJ1A 3ZCOA 2Z16A 2WY8Q 4RGSA 5D6FA 4DNCA 2K7LA 2Z99A 5GAEJ 3AG3H 2QUFA 5F1RA 3U1KA 3V42A 3AL0C 5J1RA 2ZXHA 1XDUA 3HZJA 5L3BA 1TT0A 5ILUA 4IHXA 3GTLJ 2V9VA 3E6BA 4E7LA 3PO2J 1N75A 2QF7A 3DLLF 4IXAA 1S6LA 3HDDA 4PFOA 5LHHA 4XNFA 4J00A 1VQ8I 4AVPA 4OIPF 4HDVA 3MEXA 2X9DA 1OYYA 1ZAOA 3CDIA 3FXQA 1H8AC 2K5CA 3QPLA 2F48A 3S1RJ 2WAFA 2Y0SA 1S29A 3CF5F 4EM1A 5GPCA 1BW6A 3PSFA 1R23A 1Z91A 1WJ5A 2E5NA 3QAHA 2BGCA 2MD0A 4AYBA 2P4WA 3AAFA 1I6XA 3S16J 3GVAA 3JCUC 2FMLA 4BJ5C 1FOYA 1WSUA 1WZ2A 5FJ8J 1X1AA 3VOEA 4IQJA 4HZFA 4BAYA 5C4JJ 3DF8A 2WAQA 4N9IA 2CUEA 2FF4A 3H5AA 2J5OA 1S9HA 3JRCA 3TOBA 4AVZA 4M6XA 1X3WB 3BZ6A 5KCMA 4NB5A 2PJPA 4KN7X 3OS1A 5HVQC 3W2WA 2G9WA 2FBIA 3J81K 3FBNB 1CF7B 1EF4A 2DJNA 2VXDA 3QP6A 3QP5A 1IF1A 5TISC 1RKWA 1TW3A 4LFUA 1WCMJ 2MC4A 2DA2A 3SDGA 2DU9A 2QM3A 5ERIA 2VKDA 4U0WA 3ULQB 2M7BA 2XF7A 4OMZA 1HBXG 2NOJB 4XOPA 3EUAA 1OMIA 1IXRC 4M74A 1I39A 1E3PA 4E7ZA 3CCJI 5TRDA 4XBFA 4ZZDA 1EJ9A 1PJRA 5K5OA 1T95A 1ZG1A 3EETA 5F1JA 4LJZF 4N4OB 1X3UA 4MFDA 4PK4A 3BG9A 1F4KA 2L4MA 1HSTA 1YX3A 4KUMA 4B1RA 2YSRA 2BYVE 3DKWA 1RNLA 3CZ6A 1T33A 2H6CA 1Z1DA 4M73A 4D7NA 4FASD 2KT0A 3BR1A 1YI2I 2DPUA 5DS9A 1FTTA 1PVEA 1EA3A 3CJTB 1LDDA 1ENHA 2M9HA 2YR2A 4B43A 4CA0A 1VFCA 1VQKI 3V7SA 3R4KA 2MLGA 1KU3A 3V8KA 1JGGA 2OF7A 4I01A 3DEEA 3DEWA 1TLHB 1Z6TA 5AIQA 4M3GA 4A12A 1LPQA 1HQCA 1TQMA 4ZDOA 4LGWA 1H9GA 2CRGA 1FBUA 2KIMA 3FXLA 3JSOA 4KMUX 3N97A 1SANA 1VQPI 2R5ZB 4G94A 4N0BA 3A03A 2EK5A 3PIOF 4KIGA 3ZMSA 2QQAA 2DMPA 1GV5A 1MJAA 1MBEA 1W5SA 5E1WA 5HNFA 2ZFWA 4AU7A 1YS6A 4BYYA 2F5FA 4M9ZA 3PNVA 4BDZA 4DYCA 1KGSA 1F9NA 2E7XA 3S3NA 2DPDA 2WY7Q 2HZDA 4LK1F 3CTAA 3UNGC 1GV2A 1WKMA 3GBGA 4M9XA 2E1NA 3D0SA 2JA5J 2DAOA 3Q0UA 2BE5F 3U1DA 2VLAA 5HODA 1O4XA 4HQEA 2O8XA 4OAZA 1NG7A 3HSFA 2IGMA 2KMUA 3TOAA 5DCMA 1ZGAA 1R6RA 1PUEE 3RQIA 2L9SA 2XGDA 2FE3A 1ZR4A 4WXDA 1PP8F 3AFHA 5H6RA 2YPRA 4A2UA 4YELA 4CCNA 2PMZA 3KP7A 1KONA 4GGGA 3ASNH 4DZJA 1IDZA 5H6QA 2L2OA 2QWWA 3PFYA 4I0AA 3BLYA 5L3GA 2HR3A 3BJOA 4C30A 3BOQA 5FLVA 5E8IA 2QSGX 3E0JB 1IDYA 4L9TA 2CGPA 3HGYA 2W7NA 3H36A 1YW7A 2M34A 5DCMB 4AIKA 1HXDA 3BG7A 3FHZA 1TNSA 3TDUC 1XMXA 1Z0XA 3DFGA 2DDAA 4XN0A 3GFMA 3CCUI 2O7OA 2VKVA 2NVQJ 1S8NA 3PM1A 4LLGF 3PQKA 1K4SA 3ABLH 1R71A 1SD4A 1P7IA 2LVSA 4Y15A 2W48A 4R1HA 2FA5A 1S3JA 2L7MP 4UY8I 3S2DJ 2VBYA 4YIFA 2M8EA 2M8GX 1U8BA 2O6GE 4MQVA 5ICCA 2VOOA 1J0RA 3C1DA 4F7ZA 1YW8A 4U88A 1OJLA 4D7MA 4JP0A 3FKJA 3HM5A 3Q3SA 4NDLA 2KDZA 1KZHA 3TO6A 1LE8A 1G6NA 1KQ0A 3P9CA 3F8BA 3PUBA 4JX5A 2ZKZA 4RB1A 3E3VA 3ZMVA 4BXXJ 2R3SA 3BJAA 5E18F 1B8IA 1A35A 3BQYA 3FDYA 1SAUA 5D4RA 3LWFA 3WGGA 2XPWA 1NK3P 2XPVA 3I59A 2VE8A 2M0CA 2WB1A 3OYDA 2IW5A 3GXOA 5HLGA 3MWMA 1MDMB 4DOZA 1UELB 2A68F 2AHQA 4BEHB 2M3AA 2Y0MA 3RDIA 4PUSA 3VFZA 3KYLA 3JTHA 1JTXA 4FT8A 4L9VA 5HOOA 3LA2A 5DUKA 3T8RA 1OR7A 4FE4A 2V4JC 2PFBA 4A93J 1VZ0A 5CPRB 4XLPF 1BJZA 2GA2A 2CMPA 4IF4A 3W3CA 4M3BA 2WV1A 1JJ8C 3NRVA 1XC5A 1QU3A 4XLFA 4G7ZF 1YRNB 2NS8A 4WWCA 1HA8A 5BNGA 1F36A 2O5RA 2TRTA 5D5UB 3IH2A 4ASNA 3OYGA 1Z3XA 4Y7NJ 1IG7A 4ZZLA 2IA0A 3M9AA 3K4BA 1LEAA 3PJRA 3HOUJ 2L3DA 2EJRA 1K79A 4XK4A 3S17J 1MBHA 4QSHA 3QOPA 2R7WA 5L3EA 1U78A 3BTCA 2FMYA 1FOWA 2LNBA 4XLHA 4A69C 2WAQN 4A3LJ 1MH4A 3SYTA 4F92B 3OOUA 2VQGA 1A6IA 1W0UA 5M5WJ 1DGRM 2VE9A 1QPMA 4DBQA 2PI0A 2KZGA 2M87A 2R5YB 4HOBA 5EZGA 3KCCA 5FLXZ 2IPQX 3O8GA 2OAZA 3I58A 3CCYA 2LBFB 4AIJA 5GAHJ 5B5EC 1ZG5A 3O2PE 4PJLA 5HLTA 4ZC3A 4BKXA 1SEUA 1MDMA 3S14J 3BPVA 4X0GA 3BTLA 4UNOA 2FBKA 2XC7A 3NQOA 3UR3C 4GCVA 4LG3A 4WK8F 5DYMA 3CJRB 3MN2A 5D8LB 3JAMK 1JXSA 4E6KG 1GHCA 3MMYB 1FP1D 2V6CA 4P9FA 5GP9A 1R9TJ 3GFJA 1T98A 4RM3A 2LF7A 3IAS2 2ZMEA 4HLYA 5HS9A 1DU6A 1RI7A 3FM3A 4O3MA 2DOAA 2L9NA 3LA3A 2W1OA 1QO0D 1B1BA 1W7PA 2M2EA 2OTLI 5FKLA 2MFZA 5TGTA 2WTEA 1R5HA 1V5GA 1XCVA 2E2HJ 5EEHA 3OYNA 3HHGA 1DDNA 4IO9F 2WADA 4O6JA 2WB1N 4D9JA 5FLMJ 2EB7A 2ME6A 2YUSA 4Y33A 3WTXC 3VYRB 1RZ4A 1KYZA 1P4AA 3HRSA 1I1SA 3BR6A 3WU2C 4IZZA 1HW1A 2CW7A 3KYCB 4ZTFA 2F2EA 1BOAA 1K78A 4NQWA 1RRJA 2IS1A 4BJTA 1AU7A 3GTPJ 2RN7A 2XKOA 2OJED 4RLQA 3W6VA 3CDHA 4XONA 2BVMA 2DK5A 3IH4A 4E7JA 2LREA 4FHTA 2B7EA 2EQRA 3ZQFA 2PLYA 1V3FA 2KPMA 2JTVA 5F0HA 1R1TA 3MVPA 2NOGA 1R4NB 2A61A 2OCEA 3RTRA 2DT6A 1J59A 2VQHA 2ZSIB 1MBGA 4XMYA 3KLNA 3M4OJ 3JR9A 3K10A 2QA4I 4X6AJ 4B47A 2DK8A 5GPAA 3LMMA 3S2WA 1J2XA 1R1UA 3CMYA 1I27A 2CSOA 2XSJC 1UG2A 4GRIA 2FNPA 1IZ1A 2K02A 4G7OF 5D5WB 3ZOBA 4OU0A 2HPIA 2HEOA 3OSFA 1HW5A 4BDYA 1ZRDA 3DU6A 1MMNA 5B66C 1JGSA 2LKPA 3VYSB 5B1BH 1IN5A 3N4MA 4U87A 1GUUA 1OYWA 1X3ZB 3CCVI 5EYRA 4ZYAA 5JLXA 2D2WA 4EJWA 4QIWN 3JSPA 3D5SC 5TJJA 4HSRA 2Z1DA 5AONA 1YS7A 2K27A 5J8CA 5FLXK 1TTYA 2QENA 3OYEA 3P7NA 5C44J 3OYKA 1MGTA 4YIRX 3I9V2 4L5EA 3HUGA 4NBQA 1HDPA 5HDKA 2ZXWH 1QNTA 4RS8A 1S72I 4I99C 2OPTA 3G4SI 2D45A 2JN6A 2TDXA 2XV4S 3DQVC 3G73A 2DW4A 3MKYB 2O0YA 3L09A 3OYFA 4QWQA 3L2VA 4IHSA 4XM3A 4RB3C 3LOCA 3OYLA 4D5CA 4RAGA 2ECBA 3HOSA 1I5ZA 2IVMA 1SFOJ 1V54H 1IRFA 2WV0A 3NWTA 1MMSA 1Y56A 5D5XB 3P5JA 4HNUA 5J47A 1MNEA 3LQRA 1CQTA 1BI3A 1FSHA 2Y30A 4BXFA 2LBFA 2WBMA 3CC2I 3CP2A 2RNJA 4BHCA 3GCMA 5E1ZB 2DA5A 2ZJRF 1U5TC 2EZKA 4ZTJA 4BHBA 5DM7F 1X1BA 4HF0A 4ESFA 2LD5A 2IGNA 2X1EA 4JX4A 3OIOA 3GX4X 1LDKB 4XKBA 4OIRF 3CO7C 5KAIC 1WFXA 2ISYA 1IUYA 4FE7A 4YFNF 3CCMI 1GVDA 1VI0A 4XR6A 2RV8A 1XSDA 2DYSH 1B59A 3H35A 4XLCA 5D4SA 1ZRCA 3WG7H 4E7SA 2BV6A 2YS9A 3WTVC 1FOKA 4C3JJ 5K5QA 1TWHJ 2CU7A 1P4WA 4A5MA 1XMKA 2OV7A 5LLQA 1NTCA 3G1OA 5F04A 4RDUA 1R58A 2PMHA 3F23A 2Y2ZA 3L00A 2XAGA 4C2TA 2VODA 4EM0B 3E7LA 4MTEA 2R0QC 2DMQA 1BR1A 3TQNA 3SZTA 2V6EA 1LE8B 3VPRA 3A01B 3GLXA 3OYAA 4GYIA 4HV5A 3M8FA 4LB5A 1ZN2A 2E35A 5E79C 1W1WE 1Z9CA 2MD5A 4HV6A 1YO5C 1RPWA 1FT9A 3K4NA 3MD2A 4XKCA 2BW3A 2E5ZA 2LMDA 1RUOA 2V26A 1QPIA 5DTDA 3ONQA 2QQBA 2K4BA 3DTEA 4OIOF 1JHHA 4HAMA 3U9GA 5EGOB 1FIAA 1U5TB 5J4YA 3ERMA 1ZLKA 2GLOA 4DYQA 3MZHA 3J7AY 2I5UA 3KP6A 1KU9A 2R7UA 2R7FA 3C3WA 5A2QZ 4KFCA 2XGEA 4WF2A 2COMA 4XLNF 2LG4A 2RDPA 2QQ9A 2VIXA 3L2QA 4II3A 2PBIA 1K6YA 4HX4A 3CCSI 5IT9Z 4HEA2 4V2GA 3CMEI 4KNYA 4N9HA 1VQ5I 2RGVA 4QTRA 3I0TA 4RB2C 2OU2A 1IN6A 2KIUA 5K7HA 3I5UA 2DTZA 1WWXA 4HLXA 2UXNA 3R60A 4NC7A 2L02A 5D8KB 1R7JA 2HKXA 2GOMA 2LKSA 2O03A 4XRFA 4A3BJ 3QYFA 3HSEA 3GZ6A 1KU2A 3C2HA 3FK6A 3WTZA 3ZQGA 4XQFA 3KEOA 1UG0A 4LOCA 1P2FA 2VJ4A 4RLFA 3H0GJ 1X2NA 2BZTA 4V2FA 3IKTA 2HVSA 5LGNA 2A5YB 1ACIA 2NAZA 2IS2A 5JHUA 1Y8RB 3N05A 1E3HA 1IRXA 1P9QC 2N8GA 4XOTA 4FX4A 1Y0UA 2ELKA 2K9QA 3IRQA 2A69F 3A02A 2ACJA 1MJ9A 1Y39A 3S1NJ 2DCEA 2VXZA 3ZMDA 3HIFA 3QODA 4PCQA 3NEUA 5ED4A 2R4GA 3FHNA 4HNTA 2JVGA 3ASOH 4PJNA 1BM9A 1PYVA 1WJFA 1XGMA 1U9NA 2A5WA 1L3LA 4ZDPA 1JKOC 1X19A 3ESWB 4IOAF 2PX9A 2GIVA 3JREA 1L0OC 2VL8A 4II2A 1QZEA 1IV6A 5FKNA 3DPLC 3I59B 4G9YA 1ETXA 2RVCA 1RETA 3GEZA 4JX6A 5HS8A 5M3MJ 3VB2A 4ENJA 1FIPA 3F9KA 3CP8A 3I71A 5JVGF 3TP0A 2LSOA 4P9UA 5JVTA 4JK1X 4GYGA 3RPUD 3HOWJ 4V19K 3HPHA 4BY7J 2DODA 5JLWA 1YJWI 3BY6A 2UV1A 4RGRA 4GO1A 4IHTA 3ELKA 3PO3J 3LA7A 3D1NI 5FD6A 2QBYB 1Q1HA 4UB6C 3ZGKA 2M4KA 1GXQA 1IC8A 3WGHA 1VQMI 2R7SA 2XF6A 3WG9A 1NG6A 1S7EA 4IX7A 3HKZN 4LMYA 1JUSA 1OPCA 1JJ6C 3GYHX 3OIQA 4BQOA 1IN8A 3IH3A 4BNCA 3K2AA 1FMVA 2EFNA 3DKXA 3IC7A 2KHMA 2LTPA 2EZLA 2WA0A 3KYDB 4EATA 3AKZA 1W5TA 5H20A 3WHBA 1OQYA 4RAFA 3OS0A 1MNMC 1QRYA 1OCRH 4OINF 5ICGA 2X4HA 3KPHA 4BBSJ 3D5LA 2PJRA 3SJMA 2E71A 2OZUA 1DUXC 2GAUA 4BY1J 1IW7F 1MMAA 2XAQA 3QQAA 3CC7I 4Q47A 2A6HF 3BTJA 2K9NA 2K9SA 3L2WA 1D3YA 1UCRA 2ID6A 3DBRB 5CKTA 2CG4A 1WJBA 2HZTA 5B3SH 2JQ7A 1IRGA 4M6YA 1D0YA 3K4MA 4XLAA 3T5XA 4K2EA 4XN3A 1K4TA 5IOYA 2VQCA 4WXHA 1FWZA 2LC2A 4HX8A 3FXUA 3JW4A 3M1EA 3DCFA 4J01A 2XVCA 3L2RA 2P81A 3S15J 3COAC 2VONA 4OMYA 3FMSA 3CCRI 2E1CA 3K7AJ 1D5VA 2Z2SB 4CUGA 3ERED 2HOAA 1U8RA 2I10A 3IKVA 4D1QA 3S3MA 5KNLA 1Q1VA 2JA2A 1JHFA 2JMWA 2HGCA 4HBLA 2HOEA 4P96A 4CYCA 2K9LA 3CLOA 5DD8A 5DDGA 1T0FA 1APLC 3RZDJ 2OQGA 3ML6A 3GTOJ 4C2MJ 4LG0B 1SC7A 4ANJA 2G0EA 4CXFA 4Z2YA 1AWCA 2EBIA 1ZARA 1SD5A 5E20A 4KT6A 1TWGJ 5J8FA 1BBYA 2E34A 3LSKA 4G12A 2DDBA 2F5EA 5M5XJ 1D8JA 1DQUA 4PJJA 4BBRJ 3TDZC 1PP7U 1FEXA 2JA7J 2J5PA 3LAJA 3KP4A 4WXCA 2MLKA 2V1UA 1G2HA 3CLQA 2AO9A 3CO6C 3QRFF 3KZYA 2BXYA 1I6HJ 1AHDP 3B02A 1ETQA 3FMRA 3VEPA 2KJBA 1YRNA 1U6GA 1S7OA 1WH7A 2DA7A 1J75A 4M3FA 2C6YA 3RJPA 4MQ9F 4IOCF 2VQLA 4M72A 3OYCA 1BOBA 3T8TA 1YLFA 2DQLA 4KISA 4A3DJ 2DA6A 1F43A 2WAEA 2A3SA 3LNQA 5IOZA 2QZ8A 3ZQQA 2WWYA 4S0HB 4IRGA 3R0AA 4E7HA 1SAXA 4ON0A 2Y9YA 3R0JA 3CUOA 5KVRA 2L54A 4RMNA 1Z05A 3PQJA 2DFFA 1G4DA 4Q5SF 3TO9A 2NRAC 1XB4A 1IXCA 4ESBA 5D5VB 1H9TA 1JUMA 4BEHA 3H5NA 1POGA 2Z33A 1OFCX 1Z6RA 4MEYF 5K7ZA 1BR4A 3C2GA 5H2FC 1G8XA 4MO7A 2L01A 3VSKA 1X2MA 1ZQ3P 3HRMA 2EV0A 1T6SA 1JTYA 4A5NA 4IHYA 2DT5A 1GDTA 1A5JA 3H5RA 3HEFA 1JE8A 2VBWA 3GTKJ 1LJ9A 4E4HA 4BQQA 2H27A 3KP2A 3CESA 1EH7A 5M5YJ 3DBHB 1XS9A 3RPQA 3F21A 4ENNA 3W2AA 1LFUP 4PJ0C 5IYCJ 1RC9A 2ZFUA 4EJTA 2XB0X 3HSRA 3GZNB 2QLZA 5EF6A 3CCQI 2FOKA 3IP4B 3L9FA 4L0ZB 1TWFJ 3KP5A 1G3TA 2L0KA 3J7ZI 3ECHA 3ABUA 2LFBA 2DOEA 1V5EA 3KETA 3E1SA 1D1BA 1BI0A 2JUCA 1BJAA 1T8IA 2VN2A 3KIOA 4MLOA 3A1YA 4PZJA 2FU4A 4CICA 4XSZF 4P55A 5ILVA 2FRHA 3F6OA 4OWRB 4C9YA 1ETKA 3PIPF 1SVMA 1YYVA 4L5IA 1SFXA 4B44A 1GT0C 1K83J 2MH9A 1SFEA 4W1UA 3S1MJ 1JKQC 3NARA 3ZRGA 3U21A 3BR0A 3GW2A 1ZR2A 4NUBA 3FZVA 1O3TA 3KEQA 2EFPA 1TWCJ 4MGRA 4CH7A 1M1EB 2EV6A 4ENKA 3CCEI 3OMYA 1R00A 2KJCA 5K5RA 2CUJA 3BPXA 2IP2A 4M3DA 4MFEA 2X85A 1XG1A 3QYBA 2LF8A 1YHQI 1QHHD 1U2WA 1G3YA 2H1LA 5IYDJ 2LH9A 1S7AA 3EDPA 2LY2A 2CJJA 2QCOA 3WTUC 1MBJA 4IEJA 4XRSA 3NWSA 1REPC 4BL0B 4A3CJ 3MFKA 3Q0WA 3W6JB 4FETA 2LLKA 2CH0A 2E1OA 3LSJA 2HXIA 1J09A 2NNNA 5LGTA 1IRZA 2H09A 2ETHA 2X6OA 1FNNA 2NVXJ 2Q1ZB 2AXLA 1H88C 2Y69H 4KMFA 3PNYA 4CCLA 3HOZJ 1H0MA 3LL7A 3FXOA 3R6SA 1FTZA 2BXZA 3OV8A 1SVOA 3RKXA 4X1EA 3K1PA 1LQ1A 1HKTA 3IV5A 2ZNYA 3K69A 2EILH 5J1YA 2EIMH 5J6XA 4RA2A 2YU9J 2DLLA 4EV0A 2DOFA 1QHGA 2K4JA 4DZPA 1ZREA 2IRFG 2P5VA 3C7JA 2F6CA 2P6SA 2EFOA 4PDKA 1BC7C 1VTNC 2GIZA 4MEXF 3EUHC 4YG2F 1VQ9I 3DTKA 3WTTC 3PUFA 2R7RA 2IS4A 3FBIB 2PMZN 1IXSB 2ZC2A 3UKGA 2EFQA 5FROA 5F08A 3ZQ7A 3FISA 2D1VA 2VKEA 2IGOA 3GTGJ 4BU2A 5CYVA 3CUQA 3FX3A 3P9IA 3G6EI 4EGYA 4I09A 4E70A 2P5LC 2BW3B 3LFUA 2CS3A 3FM5A 2RREA 1MKMA 2K86A 4R8HA 2MYSA 3KZIC 3TO7A 2E2JJ 4S05A 5KHDA 2VJJA 3F8MA 2JA8J 2F5VA 2O9LA 3HG9A 2EIJH 2ZBKA 3RYRA 3WE2A 5HLHA 4I2OA 2LR8A 1X1PA 4DQ2A 1JI8A 1LFBA 1ZTRA 2GXAA 3QPTA 3I4PA 5FKKA 2E60A 2GWRA 2M45A 4Y17A 5E8GA 6PAXA 2CQNA 2Y0SN 3AG1H 3EYYA 4XKVA 2ZNZA 2XSDC 4DBRA 2PG4A 3MZYA 3BTIA 1LNWA 3I56I 1VQ7I 1WVRA 3H9QA 4U7BA 1ON1A 1D1AA 4F55A 3CD6I 4XL9A 2B63J 1IV8A 1O3RA 4HG2A 1VQ4I 4NHJA 4QLCU 4MTDA 5FD5A 3K9TA 1O3SA 2G7UA 3K0LA 4L0YB 2R5YA 4A3IJ 1YJNI 1A6QA 5EZHA 1OR7C 2BY3A 1LVAA 4G6DA 4O5VA 1OCZH 5FGMA 5JR3A 1X58A 3IWFA 1U5TA 5J3LA 4UV9A 2KZVA 3JRBA 1QVUA 1EH6A 2P6TA 3BG6A 5FKMA 1TQIA 1T56A 2HVQA 3K1NA 1A36A 2E2IJ 2K85A 4BQAA 4YEJA 1A04A 1W5CC 1FP2A 2HQNA 1LVKA 2NS0A 3GF2A 2H6BA 5HS7A 4WX9A 3F8FA 3J80Z 2FQ4A 4RGXA 2JSCA 3LSMA 3TL4X 3BR5A 4HPQA 1P7JA 2TCTA 2L7ZA 2XB5A 1BC8C 2AQFA 3S8PA 3RIRA 2ZMEB 5DV5A 1DP7P 1R36A 3DBLB 3K70D 1R22A 1VQNI 3RSNA 4AIDA 1B4AA 5CVRA 2PQ8A 1FJLA 2ZB9A 3HYIA 3SEZA 5A2QK 2W84A 2XIGA 3DTIA 3I4MJ 4KICA 1ORKA 3L7WA 2STWA 3EYIA 3SDBA 2ELJA 3RKYA 3M1CA 2HQ5A 1VNDA 2BY0A 3K2ZA 2HI3A 1FC3A 2OQRA 3MKLA 4JQFA 4UHTA 1K78B 1HW2A 2XAUA 3WTYC 3F22A 1N25A 4EJOA 3LQQA 5LGUA 5BOXA 1YW9A 2GA1A 2RAEA 5DD4A 1GXPA 1Y1WJ 4L9NA 2JK3A 1TC3C 5F27A 2X6YA 3H3UA 1Z21A 3DV8A 2HYFA 1R49A 3K4CA 3GO5A 2K3PA 2HNHA 3Q0VA 1YQAA 3QYEA 3O8HA 3S1QJ 5LD2C 3M8EA 5IT9K 1IAWA 4A0ZA 2D5VA 1WI3A 3CQZJ 2NVTJ 4CHUA 3RPUA 2R7ZJ 2OUMA 1ZGJA 4B3XA 3HOXJ 3MZ8A 4CCMA 3I3LA 1Z7UA 5GTHC 4EGZA 2KRFA 3FWEA 5GTIC 2CO5A 3I53A 3OL4A 2Q8KA 1TBXA 5IP7J 5CVJA 2DO7A 4HRIA 4FX0A 3T1BA 1DP3A 2DTRA 3VSLA 2ZMEC 4XSXF 3JAMZ 2FOWA 5J4VA 2RC4A 1XD7A 2Q2EB 1R5GA 1FYMA 2JPBA 4KIFA 2F5DA 2JPCA 2IJLA 1Y8QB 3DKYA 1HC8A 1QZYA 3AG4H 3S93A 3SEQA 4DYRA 1LDJA 4P5OA 1Z67A 5BQTA 3HB9A 2DQRA 3IAM2 4BE1A 3CF2A 3DP7A 2O61A 4B09A 5FRMA 2LOOA 2AXTC 2MW8A 2IS6A 1USSA 3QWLA 1FBSA 2M5WA 1SD6A 2ADUA 2R7OA 3FXJA 4LG0A 1D1CA 4E7KA 1UAAA 2OCCH 3BCBA 4IRIA 5DCFA 3FF5A 3A0BC 1RESA 3AG2H 3MKZA 5M3FJ 2KISA 4LIUA 4HNVA 5LFAA 1MD0A 2K3FA 1E0EA 2ISZA 4YIIA 4M9SA 2B0LA 3V7CA 4H0EA 2XAFA 3DPUA 5E3OA 3H92A 1W7PD 2XRNA 3HGGA 2DI3A 1V5FA 1MMGA 2ESNA 1ETVA 3E6MA 4F3QA 1VQ6I 3PNTA 2VASA 4BXUA 4ABZA 2V1DA 3DXJF 4BJ6C 1YE9A 4ZYEA 1MIJA 2XF5A 3Q9SA 4DGWB 1U0JA 4P1WA 1HKSA 2EA4A 3PL8A 4D0PA 1JKPC 1KA8A 4Z6YA 2O3FA 4IL6C 3SHFA 2L7KA 5J40A 2FQ3A 2KRHA 2CUZA 1HDDC 2JRMA 1K61A 3WODF 1I3QJ 3HXLA 4A3JJ 3MQ0A 1UB9A 4ZH4F 1NH3A 3ROUA 2W85A 3VYTB 4C2UA 2LDUA 3HUGB 5E1XA 1USTA 1ETOA 2NYXA 2STTA 4KA4A 3SXYA 1QA6A 1YFHA 5FFZA 2O8KA 2KDOA 2HDDA 5LRSA 1XX5A 3DU5A 5AIPA 5GADJ 4UUSA 2KRCA 4LD5A 1YTYA 2IAIA 1MNDA 4AIHA 1MW7A 1ZG3A 2ZCWA 4Y3OA 3CCLI 1WPKA 1FYLA 2HWVA 3E97A 2OZ6A 1YOVB 1G3WA 4PGHA 3CJQB 4PFPA 1BIAA 2HKOA 4B8XA 4XICA 2FD5A 3V8LA 1TL8A 3HOTA 5FFXA 2HQRA 4CO8A 3RCOA 5EEAA 1ZKGA 5DEQA 1N78A 3O6BB 4YFXF 1SMTA 5JI6A 1DU0A 2W00A 3MCZA 2EZIA 2FUG2 3FXMA 2LP0A 2YX4A 5CQGA 2Z9OA 3JRIA 1HSJA 3CJNA 3QOEA 1WJEA 1LKXA 1YIJI 5IT3A 3L2UA 3E6CC 1TT5B 2FEZA 2ME0A 3GMEA 2X6WA 1Y1VJ 3RYPA 4D5FA 3RKWA 2VB6A 3ZXSA 1WJCA 3HOYJ 1HCRA 5E3LA 1OCPA 3RQ4A 1YITI 4KIBA 1MJBA 3KX2A 1XSXA 4A3KJ 1WHUA 2Q0OA 3HL2A 2G7HA 4IQ4A 3OYJA 1WJAA 2X51A 1Y0NA 4EQQA 1OCCH 2L9VA 4LB6B 5IP6A 2A05A 3O3KA 3SZPA 2EA2A 2P5KA 1UHWA 1O7FA 3SQNA 3B6CA 3U2RA 3ZR8X 1PDNC 3RZOJ 2P7VB 1LFPA 1J7KA 1BR2A 2UZKA 2W4SA 4ENMA 3QU6A 4KJZA 3MKWB 4A3GJ 1ZELA 2L9RA 4DW6A 3E5UA 2WC2A 2H8RA 4L18B 2DMTA 1UHMA 4BGDA 4E7IA 4M3EA 2JUGA 1FYKA 2V79A 1NK2P 2EZHA 2DFIA 4UUTA 2HPMA 1V55H 4NNJA 4A3EJ 3ABKH 2V9PA 2OD5A 4FTHA 1MSFC 1T0FC 2X6XA 4EEFG 2VC1A 2XGCA 3KFWX 1KYWA 3HBLA 3A0HC 4AUXA 4PSWA 3GUDA 3OR1C 4IJAA 4RAYA 4BHPA 5FB2A 3HHHA 4UVAA 3K1MA 4HF2A 2HQAA 3H1CA 1MZBA 1LB2A 2CQXA 1WQ2A 3M3YJ 4IHWA 4HYEA 4EVIA 1WJDA 4CZCA 1RR8C 4QPQA 3DWLE 2GOXB 2L5QA 2HOTA 1O3QA 3LFKA 2JSPA 2L7FP 2OC6A 5CLSA 2NVYJ 2QYOA 4UXNA 1YJ9I 2XROA 1D0ZA 1X1CA 4HSTA 5B1AH 3K4JA 3I55I 3BC8A 1VQOI 3L1PA 2R7DA 3H9JA 2EIKH 4UVCA 4Y4RA 3ZQLA 1FOXA 3M8JA 2A07F 2IGKA 2QKLB 2QBYA 2X1CA 4CCOA 3BZCA 3OYBA 1X1DA 4IVNA 4KDPA 1OLTA 5EG0B 1ZLJA 4UB8C 3V7RA 1T39A 2EH3A 4CDGA 1BW5A 4Q48A 5IPAA 4I0BA 2IXSA 3LSGA 2ZSHB 2HTSA 2W82A 4UVBA 2XAJA 4I76A 3JRHA 4QPOA 2W24A 4ESJA 1UJ8A 1P92A 3IUOA 5LBQA 2OTJI 1O7LA 1TQPA 2M4GA 2VT3A 4XLEA 2GXBA 5L3CA 3WTSC 3F72A 3OR2C 4CYCB 1N77A 3BQZA 2ECCA 2VPRA 3BP8A 1BIBA 5FKOA 5EG0A 4ZYGA 1XSVA 3OOPA 1ETYA 5ILSA 4A3MJ 2VUMJ 1IGNA 4JOMA 3SZGA 4Q4ZF 1IUFA 4EMSA 1U9OA 1QQIA 4UUVA 2AQEA 1SD7A 5KK1A 3ABMH 3JRGA 2Y75A 2EPFA 2Y9ZA 4WCGA 2B9SA 1NHAA 2LY1A 2XKPA 1ZYRF 1FMWA 4H4KC 1ETWA 3G71I 1Z7LA 2E36A 4RM2A 4L9JA 1OCTC 1DPRA 2H1KA 4IHVA 2JZYA 3JTGA 2HDCA 1WRJA 1I1GA 4RAZA 1MH3A 4XRMA 1AA7A 2FBHA 4C3HJ 4CCJA 1SFUA 3FK7A 1ZRFA 2CUFA 4HQMA 2MG4A 4RGUA 5BMZA 4NC8A 5CVUA 1HOMA 3TMOA 1H89C 2EV5A 3R61A 2QKMB 2XHKA 1JUPA 3BG3A 4AWXB 5C3EJ 4DJAA 1E17A 2VKHA 3FIWA 3GZ5A 3RI4A 1K7AA 2HOSA 2FSWA 2LK2A 4HF1A 1G3SA 3ECOA 4HW0A 4MIMA 2PJRB 4AC0A 1IO2A 3K70C 2ZJ2A 1HLVA 2ZXIA 2HFHA 4R79A 3TW6A 1XMAA 1ERDA 3TW7A 2DA3A 3K4LA 3T0YA 4ZYDA 1F1ZA 2UWMA 3BT9A 1S5LC 1I50J 4EJUA 2VT2A 1B8IB 4G7HF 5BPDA 3C2BA 1TWAJ 2QSHX 2CQKA 1MBKA 4FISA 3BROA 2GXGA 2R7XA 2DJIA 2FX0A 4AM3A 5K1YA 2H8WA 1UHSA 4Y13A 5FO5A 2HU9A 4OAYA 3A01A 1IN7A 5IP9J 4F52A 2CQ7A 4S04A 3BCAA 2LKXA 4I98B 2KKOA 2QSFX 1JT0A 4CCKA 4G8XA 1QVTA 4OOIA 4U0VA 2I8DA
chains in the Genus database with same CATH topology
1CGPA 4EJVA 4OIQF 1ODDA 3E6DA 3WE3A 4CYDA 4AD9A 3E5QA 5LEKA 1FSEA 4TV7A 2GQQA 3V8JA 3C18A 2CW0F 1FX7A 4EM2A 4U7DA 1O57A 3CUQB 2GZWA 5ICFA 1EH8A 2XUBA 2YU3A 3J7AO 1GVJA 5JFRA 2EFWA 2Y48A 4CGZA 1RUNA 2QVOA 3IHUA 3BDDA 2PN6A 1U3EM 5LRRA 1W7PB 1FBQA 3M7GA 1R1VA 2A6EF 3KLOA 3HTSB 1ULYA 2W57A 2BEOA 3PFIA 1KQ8A 1F5TA 2VBZA 2ZXJA 4IPAA 1XDSA 2VC0A 1BI2A 1DPUA 3ZMZA 4LK0F 3J81Z 3W6KB 1E2XA 1P4XA 3EQLF 4M71A 1T2KA 2DBBA 4KYWA 1V4RA 2Q2EA 1XCBA 2Z5UA 3CUQC 2E7WA 4L5JA 2FNAA 2MBFA 3ABTA 3H3ZA 1IN4A 3IL2A 1FLIA 1K6OA 5CVVA 2HS5A 1KQ9A 5LHIA 1TW2A 1UFMA 1XGOA 3E5XA 2MC3A 1SMYF 3KZZA 2AS5F 3KP3A 3QU3A 5BPIA 4BH9A 5D6EA 4RB0A 4I02A 4A6DA 4ZYHA 3J80K 1J9IA 2RKHA 2L4AA 5HDGA 3L2CA 3F6VA 1YG2A 3F8NA 4JBAA 5EEGA 3BWGA 3LSTA 4HX7A 1OYIA 5LHGA 2CYYA 3ISPA 2FXAA 3KE2A 2VOPA 2EWNA 1C0WA 3V4GA 3Q5FA 3VODA 3IWZA 2D1HA 2JT1A 1WI9A 2OBPA 3MAJA 1ZHFA 1J5YA 1TNTA 2IA2A 5L3DA 1LEBA 5L3FA 2NNYA 1XGSA 2M1BA 3ZMTA 5HDNA 2CFXA 1ZH5A 1ON2A 3HRUA 3HTUA 3GFIA 3LAPA 2BBYA 1FPQA 5E17F 3GFLA 1B9MA 3F8CA 2M30A 4A0YA 2CWEA 1D8KA 4MNUA 3GWZA 3DPTA 3ZPLA 2MA3A 4G6QA 4MHGA 3BJ6A 2JRTA 3P9KA 2H94A 3B73A 3WTWC 1XN7A 5LEJA 3ZN0A 3ZP5A 4UV8A 2ESHA 4GXOA 3G3ZA 1FY7A 4KN4X 2PEXA 5CJ9A 2KIFA 1HKQA 1T38A 2VBXA 3QPHA 1FZPB 3DEUA 1YIOA 4YFKF 1STZA 4LLNA 2XAHA 2YX7A 1BI1A 4CZZA 1KU7A 2OA4A 3TKYA 1P6RA 1CF7A 1B9NA 1BN5A 3F3XA 1AOYA 3SFZA 2F5CA 2XGXA 5DUIA 3IRRA 5CVIA 4PGGA 2P7CB 1W4MA 3Q9VA 2HTJA 1XGNA 2XASA 3EUHA 2MH2A 4HDUA 4HA8A 5BS6A 3FXRA 2IT0A 2PMUA 3REOA 2Z3YA 1B6AA 5F6FA 3TGNA 2ZO4A 1OKRA 3ZMUA 5ICEA 2HYGD 5HLIA 3ZN1A 1QBJA 2ELHA 2P8TA 4I7HA 3I64A 4A0XA 4U0YA 2UXXA 3FMQA 1ONVA 3WU1B 5F64A 2W25A 2X0LA 4ETSA 2V1XA 3I54A 1QZZA 1QGPA 4KT5C 1EV7A 4IRHA 2RQPA 4LLLA 3WGIA 3WU0A 3HRTA 2IA1A 4A6EA 1RIOH 4RGSA 5D6FA 4DNCA 2K7LA 2Z99A 2QUFA 5F1RA 1XDUA 5L3BA 5ILUA 2V9VA 3E6BA 4IXAA 1S6LA 5LHHA 4AVPA 4OIPF 4HDVA 3MEXA 1OYYA 1ZAOA 3FXQA 1S29A 4EM1A 1R23A 1Z91A 3QAHA 2BGCA 2P4WA 1I6XA 3GVAA 2FMLA 1WSUA 3VOEA 4HZFA 4BAYA 3DF8A 4N9IA 2FF4A 2J5OA 3TOBA 4M6XA 3BZ6A 4NB5A 2PJPA 4KN7X 5HVQC 2G9WA 2FBIA 3J81K 1CF7B 3QP6A 3QP5A 1IF1A 1TW3A 4LFUA 2DU9A 2QM3A 5ERIA 4U0WA 3ULQB 4OMZA 1HBXG 1OMIA 1IXRC 4M74A 5TRDA 4XBFA 4ZZDA 5K5OA 1ZG1A 3EETA 4LJZF 1X3UA 1F4KA 2L4MA 1HSTA 4KUMA 2YSRA 2BYVE 3DKWA 1RNLA 2H6CA 1Z1DA 4M73A 2DPUA 1LDDA 2YR2A 3V7SA 3R4KA 2MLGA 1KU3A 3V8KA 4I01A 4A12A 1TLHB 1Z6TA 5AIQA 1HQCA 1TQMA 4LGWA 1H9GA 2KIMA 1FBUA 3JSOA 4KMUX 3N97A 4G94A 4N0BA 2EK5A 4KIGA 3ZMSA 2QQAA 1MJAA 1W5SA 5E1WA 2ZFWA 1YS6A 4BYYA 2F5FA 4M9ZA 1KGSA 1F9NA 2E7XA 2DPDA 4LK1F 3CTAA 1WKMA 4M9XA 2E1NA 3D0SA 2DAOA 2BE5F 3U1DA 4HQEA 2O8XA 3HSFA 3TOAA 5DCMA 1ZGAA 1PUEE 2FE3A 4WXDA 1PP8F 5H6RA 2YPRA 4A2UA 3KP7A 4GGGA 5H6QA 2QWWA 4I0AA 5L3GA 2HR3A 3BJOA 3BOQA 5E8IA 2CGPA 4L9TA 1YW7A 5DCMB 4AIKA 1HXDA 3FHZA 1TNSA 3TDUC 3DFGA 3GFMA 1S8NA 4LLGF 3PQKA 1SD4A 4Y15A 4R1HA 2FA5A 1S3JA 2VBYA 4YIFA 2M8EA 2O6GE 4MQVA 5ICCA 2VOOA 1J0RA 3C1DA 4F7ZA 1YW8A 4U88A 3TO6A 1G6NA 1KQ0A 3P9CA 3F8BA 2ZKZA 4RB1A 3E3VA 3ZMVA 2R3SA 3BJAA 5E18F 5D4RA 3LWFA 3WGGA 3I59A 2VE8A 2IW5A 3GXOA 5HLGA 3MWMA 1MDMB 2A68F 2Y0MA 3RDIA 3VFZA 3JTHA 4FT8A 4L9VA 5HOOA 3LA2A 5DUKA 3T8RA 1OR7A 2PFBA 4XLPF 2GA2A 4IF4A 3NRVA 4G7ZF 4WWCA 5D5UB 4ASNA 4ZZLA 2IA0A 3M9AA 1LEAA 2L3DA 2EJRA 1K79A 3QOPA 5L3EA 1U78A 2FMYA 2LNBA 2VE9A 1QPMA 2PI0A 2M87A 4HOBA 3KCCA 5FLXZ 2IPQX 2OAZA 3I58A 4AIJA 1ZG5A 3O2PE 1MDMA 3BPVA 4UNOA 2FBKA 3NQOA 4GCVA 4WK8F 5DYMA 5D8LB 3JAMK 1JXSA 1GHCA 1FP1D 2V6CA 4P9FA 3GFJA 1T98A 2LF7A 2ZMEA 4HLYA 5HS9A 1RI7A 3FM3A 4O3MA 3LA3A 1QO0D 1B1BA 1W7PA 2WTEA 1R5HA 1XCVA 5EEHA 3HHGA 1DDNA 4O6JA 2EB7A 3WTXC 1RZ4A 1KYZA 1P4AA 3HRSA 1I1SA 1HW1A 2F2EA 1BOAA 1K78A 4NQWA 2RN7A 2XKOA 3CDHA 2DK5A 4FHTA 2PLYA 1V3FA 2JTVA 1R1TA 2A61A 1J59A 3RTRA 3KLNA 2DK8A 3S2WA 1J2XA 1R1UA 1I27A 2CSOA 2FNPA 1IZ1A 2K02A 4G7OF 5D5WB 4OU0A 2HEOA 1HW5A 1ZRDA 1JGSA 2LKPA 1IN5A 3N4MA 1OYWA 4EJWA 2D2WA 3JSPA 5TJJA 5AONA 1YS7A 2K27A 5J8CA 5FLXK 1TTYA 2QENA 3P7NA 1MGTA 3HUGA 5HDKA 1QNTA 4RS8A 2D45A 2TDXA 2XV4S 3DQVC 3G73A 2DW4A 2O0YA 3L09A 4QWQA 4IHSA 4RB3C 3HOSA 1I5ZA 2IVMA 1IRFA 2WV0A 5D5XB 3LQRA 1BI3A 1FSHA 2RNJA 4BHCA 5E1ZB 1U5TC 4BHBA 4HF0A 4ESFA 3GX4X 1LDKB 4OIRF 3CO7C 2ISYA 1IUYA 4YFNF 2RV8A 1XSDA 1B59A 5D4SA 1ZRCA 2BV6A 3WTVC 1FOKA 5K5QA 1P4WA 4A5MA 1XMKA 5LLQA 1R58A 2PMHA 3F23A 3L00A 2XAGA 2VODA 4EM0B 4MTEA 3TQNA 3SZTA 3GLXA 4GYIA 4HV5A 3M8FA 4LB5A 1ZN2A 1Z9CA 2MD5A 4HV6A 1YO5C 1FT9A 1RUOA 2QQBA 2K4BA 4OIOF 1JHHA 4HAMA 3U9GA 1U5TB 1ZLKA 3MZHA 3KP6A 1KU9A 2R7FA 3C3WA 5A2QZ 4KFCA 4WF2A 2COMA 4XLNF 2RDPA 2QQ9A 2PBIA 4HX4A 5IT9Z 4KNYA 4N9HA 2RGVA 3I0TA 4RB2C 2OU2A 1IN6A 2KIUA 3I5UA 1WWXA 4HLXA 2UXNA 3R60A 2L02A 5D8KB 1R7JA 2HKXA 2O03A 4XRFA 3HSEA 3GZ6A 1KU2A 3WTZA 3KEOA 1P2FA 3IKTA 5LGNA 2A5YB 2NAZA 5JHUA 4FX4A 1Y0UA 3IRQA 2A69F 2ACJA 1MJ9A 2VXZA 3ZMDA 3HIFA 4PCQA 3NEUA 5ED4A 1BM9A 1XGMA 1L3LA 2GIVA 1L0OC 3DPLC 3I59B 4G9YA 2RVCA 3GEZA 5HS8A 3VB2A 4ENJA 3I71A 2LSOA 4P9UA 5JVTA 4JK1X 4GYGA 3BY6A 4RGRA 4GO1A 4IHTA 3ELKA 3LA7A 5FD6A 2QBYB 1Q1HA 1GXQA 3WGHA 3WG9A 4LMYA 1OPCA 3GYHX 1IN8A 4BNCA 2EFNA 3IC7A 1W5TA 5H20A 4OINF 5ICGA 2X4HA 3D5LA 2OZUA 1DUXC 2GAUA 1IW7F 2XAQA 4Q47A 2A6HF 1D3YA 1UCRA 2CG4A 2HZTA 1IRGA 4M6YA 3T5XA 4K2EA 4WXHA 1FWZA 4HX8A 3FXUA 3JW4A 3M1EA 2XVCA 3COAC 2VONA 4OMYA 3FMSA 2E1CA 1D5VA 3ERED 1U8RA 3IKVA 1JHFA 2HGCA 4HBLA 2HOEA 4P96A 3CLOA 5DD8A 5DDGA 1T0FA 2OQGA 3ML6A 4LG0B 4CXFA 4Z2YA 1AWCA 1ZARA 1SD5A 5E20A 5J8FA 1BBYA 2F5EA 1D8JA 3TDZC 1PP7U 2J5PA 3LAJA 3KP4A 4WXCA 2MLKA 2V1UA 3CO6C 3QRFF 3KZYA 3B02A 3FMRA 3VEPA 2KJBA 1U6GA 1S7OA 1J75A 2C6YA 3RJPA 4MQ9F 4M72A 3T8TA 1YLFA 2DQLA 2A3SA 2QZ8A 2WWYA 4IRGA 3R0AA 1SAXA 4ON0A 3R0JA 3CUOA 5KVRA 2L54A 1Z05A 3PQJA 1G4DA 4Q5SF 3TO9A 2NRAC 1XB4A 1IXCA 4ESBA 5D5VB 1H9TA 2Z33A 1Z6RA 4MEYF 2L01A 3HRMA 2EV0A 1T6SA 4A5NA 2DT5A 1JE8A 2VBWA 1LJ9A 2H27A 3KP2A 1EH7A 3RPQA 3F21A 4ENNA 4EJTA 3HSRA 2QLZA 2FOKA 3L9FA 4L0ZB 3KP5A 1G3TA 3ECHA 3ABUA 3KETA 1BI0A 1BJAA 2VN2A 4PZJA 2FU4A 4CICA 4XSZF 4P55A 5ILVA 2FRHA 3F6OA 1YYVA 4L5IA 1SFXA 2MH9A 1SFEA 3GW2A 3FZVA 1O3TA 3KEQA 2EFPA 4MGRA 2EV6A 4ENKA 1R00A 2KJCA 5K5RA 3BPXA 2IP2A 2LF8A 1U2WA 1G3YA 1S7AA 3EDPA 3WTUC 1REPC 3MFKA 3W6JB 2NNNA 5LGTA 2H09A 2ETHA 1FNNA 2AXLA 4KMFA 1H0MA 3R6SA 3OV8A 3RKXA 3K1PA 1LQ1A 1HKTA 2ZNYA 3K69A 5J6XA 2DLLA 4EV0A 2K4JA 1ZREA 2IRFG 2P5VA 3C7JA 2P6SA 2EFOA 4PDKA 1BC7C 1VTNC 4MEXF 4YG2F 3WTTC 1IXSB 2EFQA 3ZQ7A 2D1VA 5CYVA 3CUQA 3FX3A 3P9IA 4EGYA 4I09A 4E70A 2P5LC 3FM5A 1MKMA 2K86A 4R8HA 3TO7A 4S05A 3F8MA 2ZBKA 3RYRA 3WE2A 5HLHA 4I2OA 4DQ2A 3QPTA 3I4PA 2GWRA 2M45A 4Y17A 5E8GA 6PAXA 3EYYA 2ZNZA 2PG4A 3MZYA 1LNWA 4U7BA 1ON1A 1O3RA 4NHJA 4QLCU 4MTDA 5FD5A 3K9TA 1O3SA 2G7UA 3K0LA 4L0YB 1LVAA 4G6DA 4O5VA 5JR3A 5FGMA 3IWFA 1U5TA 4UV9A 1EH6A 2P6TA 1TQIA 3K1NA 4BQAA 1A04A 1FP2A 2HQNA 2NS0A 5HS7A 3GF2A 2H6BA 4WX9A 3F8FA 3J80Z 4RGXA 2JSCA 1BC8C 3RIRA 2ZMEB 5DV5A 1DP7P 1R36A 1R22A 1B4AA 5CVRA 2PQ8A 3HYIA 5A2QK 2W84A 2XIGA 4KICA 3L7WA 3EYIA 2STWA 3RKYA 3K2ZA 1FC3A 2OQRA 4JQFA 4UHTA 1K78B 1HW2A 3WTYC 3F22A 4EJOA 3LQQA 5LGUA 5BOXA 1YW9A 2GA1A 5DD4A 1GXPA 4L9NA 3H3UA 3DV8A 2HYFA 3GO5A 1YQAA 3M8EA 5IT9K 1IAWA 4A0ZA 4CHUA 3RPUA 1ZGJA 1Z7UA 4EGZA 2KRFA 3FWEA 2CO5A 3I53A 2Q8KA 1TBXA 5CVJA 2DO7A 4FX0A 3T1BA 2DTRA 4XSXF 3JAMZ 2RC4A 1XD7A 1R5GA 1FYMA 2JPBA 4KIFA 2F5DA 2JPCA 2IJLA 1QZYA 1LDJA 4P5OA 5BQTA 2DQRA 3DP7A 2O61A 4B09A 1USSA 1FBSA 2M5WA 1SD6A 2ADUA 4LG0A 4IRIA 5DCFA 3FF5A 1MD0A 2ISZA 4YIIA 4M9SA 2B0LA 4H0EA 3V7CA 2XAFA 3H92A 1W7PD 2XRNA 2DI3A 2ESNA 3E6MA 4BXUA 2V1DA 3DXJF 4ZYEA 3Q9SA 1HKSA 2EA4A 4D0PA 1KA8A 2O3FA 3SHFA 2FQ3A 3WODF 3MQ0A 1UB9A 4ZH4F 3ROUA 2W85A 2LDUA 5E1XA 1USTA 2NYXA 2STTA 4KA4A 3SXYA 1YFHA 5FFZA 5LRSA 5AIPA 4LD5A 1YTYA 4AIHA 1ZG3A 2ZCWA 1FYLA 2HWVA 3E97A 2OZ6A 4PGHA 1G3WA 1BIAA 2HKOA 4B8XA 3V8LA 3HOTA 5FFXA 2HQRA 4CO8A 5DEQA 3O6BB 4YFXF 1SMTA 5JI6A 3MCZA 2YX4A 2Z9OA 1HSJA 3CJNA 5IT3A 3E6CC 2FEZA 3RYPA 3RKWA 4KIBA 1MJBA 1XSXA 2Q0OA 2G7HA 4EQQA 4LB6B 3O3KA 3SZPA 2EA2A 2P5KA 1UHWA 1O7FA 3SQNA 3U2RA 1PDNC 2P7VB 1J7KA 2UZKA 4ENMA 3QU6A 3E5UA 2WC2A 4L18B 1UHMA 1FYKA 2V79A 2DFIA 2OD5A 2VC1A 3KFWX 1KYWA 3GUDA 4IJAA 4RAYA 4BHPA 5FB2A 3HHHA 4UVAA 3K1MA 4HF2A 1MZBA 1LB2A 1WQ2A 4HYEA 4EVIA 1O3QA 3LFKA 5CLSA 2QYOA 4UXNA 2XROA 2R7DA 4UVCA 2A07F 2QBYA 4IVNA 4KDPA 1ZLJA 3V7RA 1T39A 4CDGA 4Q48A 4I0BA 2HTSA 4UVBA 2XAJA 2W24A 4ESJA 1P92A 5LBQA 1O7LA 1TQPA 2VT3A 2GXBA 5L3CA 3WTSC 3F72A 3BP8A 1BIBA 4ZYGA 1XSVA 3OOPA 5ILSA 4Q4ZF 4EMSA 1QQIA 4UUVA 1SD7A 5KK1A 2Y75A 4WCGA 1NHAA 2XKPA 1ZYRF 4L9JA 1DPRA 2JZYA 3JTGA 2HDCA 1WRJA 1I1GA 4RAZA 2FBHA 1SFUA 1ZRFA 4HQMA 4RGUA 5BMZA 5CVUA 2EV5A 3R61A 2XHKA 4AWXB 1E17A 3GZ5A 3RI4A 1K7AA 2FSWA 4HF1A 1G3SA 3ECOA 4HW0A 2ZJ2A 2HFHA 4R79A 1XMAA 3T0YA 4ZYDA 1F1ZA 2UWMA 4EJUA 2VT2A 4G7HF 5BPDA 2CQKA 3BROA 2GXGA 5K1YA 4Y13A 5FO5A 1IN7A 4S04A 4I98B 2KKOA 4G8XA 3AAFA 4OOIA 4U0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGP A;  4EJV A;  4OIQ F;  1ODD A;  3E6D A;  3WE3 A;  4CYD A;  4AD9 A;  3E5Q A;  5LEK A;  1FSE A;  4TV7 A;  2GQQ A;  3V8J A;  3C18 A;  2CW0 F;  1FX7 A;  4EM2 A;  4U7D A;  1O57 A;  3CUQ B;  2GZW A;  5ICF A;  1EH8 A;  2XUB A;  2YU3 A;  3J7A O;  1GVJ A;  5JFR A;  2EFW A;  2Y48 A;  4CGZ A;  1RUN A;  2QVO A;  3IHU A;  3BDD A;  2PN6 A;  1U3E M;  5LRR A;  1W7P B;  1FBQ A;  3M7G A;  1R1V A;  2A6E F;  3KLO A;  3HTS B;  1ULY A;  2W57 A;  2BEO A;  3PFI A;  1KQ8 A;  1F5T A;  2VBZ A;  2ZXJ A;  4IPA A;  1XDS A;  2VC0 A;  1BI2 A;  1DPU A;  3ZMZ A;  4LK0 F;  3J81 Z;  3W6K B;  1E2X A;  1P4X A;  3EQL F;  4M71 A;  1T2K A;  2DBB A;  4KYW A;  1V4R A;  2Q2E A;  1XCB A;  2Z5U A;  3CUQ C;  2E7W A;  4L5J A;  2FNA A;  2MBF A;  3ABT A;  3H3Z A;  1IN4 A;  3IL2 A;  1FLI A;  1K6O A;  5CVV A;  2HS5 A;  1KQ9 A;  5LHI A;  1TW2 A;  1UFM A;  1XGO A;  3E5X A;  2MC3 A;  1SMY F;  3KZZ A;  2AS5 F;  3KP3 A;  3QU3 A;  5BPI A;  4BH9 A;  5D6E A;  4RB0 A;  4I02 A;  4A6D A;  4ZYH A;  3J80 K;  1J9I A;  2RKH A;  2L4A A;  5HDG A;  3L2C A;  3F6V A;  1YG2 A;  3F8N A;  4JBA A;  5EEG A;  3BWG A;  3LST A;  4HX7 A;  1OYI A;  5LHG A;  2CYY A;  3ISP A;  2FXA A;  3KE2 A;  2VOP A;  2EWN A;  1C0W A;  3V4G A;  3Q5F A;  3VOD A;  3IWZ A;  2D1H A;  2JT1 A;  1WI9 A;  2OBP A;  3MAJ A;  1ZHF A;  1J5Y A;  1TNT A;  2IA2 A;  5L3D A;  1LEB A;  5L3F A;  2NNY A;  1XGS A;  2M1B A;  3ZMT A;  5HDN A;  2CFX A;  1ZH5 A;  1ON2 A;  3HRU A;  3HTU A;  3GFI A;  3LAP A;  2BBY A;  1FPQ A;  5E17 F;  3GFL A;  1B9M A;  3F8C A;  2M30 A;  4A0Y A;  2CWE A;  1D8K A;  4MNU A;  3GWZ A;  3DPT A;  3ZPL A;  2MA3 A;  4G6Q A;  4MHG A;  3BJ6 A;  2JRT A;  3P9K A;  2H94 A;  3B73 A;  3WTW C;  1XN7 A;  5LEJ A;  3ZN0 A;  3ZP5 A;  4UV8 A;  2ESH A;  4GXO A;  3G3Z A;  1FY7 A;  4KN4 X;  2PEX A;  5CJ9 A;  2KIF A;  1HKQ A;  1T38 A;  2VBX A;  3QPH A;  1FZP B;  3DEU A;  1YIO A;  4YFK F;  1STZ A;  4LLN A;  2XAH A;  2YX7 A;  1BI1 A;  4CZZ A;  1KU7 A;  2OA4 A;  3TKY A;  1P6R A;  1CF7 A;  1B9N A;  1BN5 A;  3F3X A;  1AOY A;  3SFZ A;  2F5C A;  2XGX A;  5DUI A;  3IRR A;  5CVI A;  4PGG A;  2P7C B;  1W4M A;  3Q9V A;  2HTJ A;  1XGN A;  2XAS A;  3EUH A;  2MH2 A;  4HDU A;  4HA8 A;  5BS6 A;  3FXR A;  2IT0 A;  2PMU A;  3REO A;  2Z3Y A;  1B6A A;  5F6F A;  3TGN A;  2ZO4 A;  1OKR A;  3ZMU A;  5ICE A;  2HYG D;  5HLI A;  3ZN1 A;  1QBJ A;  2ELH A;  2P8T A;  4I7H A;  3I64 A;  4A0X A;  4U0Y A;  2UXX A;  3FMQ A;  1ONV A;  3WU1 B;  5F64 A;  2W25 A;  2X0L A;  4ETS A;  2V1X A;  3I54 A;  1QZZ A;  1QGP A;  4KT5 C;  1EV7 A;  4IRH A;  2RQP A;  4LLL A;  3WGI A;  3WU0 A;  3HRT A;  2IA1 A;  4A6E A;  1RIO H;  4RGS A;  5D6F A;  4DNC A;  2K7L A;  2Z99 A;  2QUF A;  5F1R A;  1XDU A;  5L3B A;  5ILU A;  2V9V A;  3E6B A;  4IXA A;  1S6L A;  5LHH A;  4AVP A;  4OIP F;  4HDV A;  3MEX A;  1OYY A;  1ZAO A;  3FXQ A;  1S29 A;  4EM1 A;  1R23 A;  1Z91 A;  3QAH A;  2BGC A;  2P4W A;  1I6X A;  3GVA A;  2FML A;  1WSU A;  3VOE A;  4HZF A;  4BAY A;  3DF8 A;  4N9I A;  2FF4 A;  2J5O A;  3TOB A;  4M6X A;  3BZ6 A;  4NB5 A;  2PJP A;  4KN7 X;  5HVQ C;  2G9W A;  2FBI A;  3J81 K;  1CF7 B;  3QP6 A;  3QP5 A;  1IF1 A;  1TW3 A;  4LFU A;  2DU9 A;  2QM3 A;  5ERI A;  4U0W A;  3ULQ B;  4OMZ A;  1HBX G;  1OMI A;  1IXR C;  4M74 A;  5TRD A;  4XBF A;  4ZZD A;  5K5O A;  1ZG1 A;  3EET A;  4LJZ F;  1X3U A;  1F4K A;  2L4M A;  1HST A;  4KUM A;  2YSR A;  2BYV E;  3DKW A;  1RNL A;  2H6C A;  1Z1D A;  4M73 A;  2DPU A;  1LDD A;  2YR2 A;  3V7S A;  3R4K A;  2MLG A;  1KU3 A;  3V8K A;  4I01 A;  4A12 A;  1TLH B;  1Z6T A;  5AIQ A;  1HQC A;  1TQM A;  4LGW A;  1H9G A;  2KIM A;  1FBU A;  3JSO A;  4KMU X;  3N97 A;  4G94 A;  4N0B A;  2EK5 A;  4KIG A;  3ZMS A;  2QQA A;  1MJA A;  1W5S A;  5E1W A;  2ZFW A;  1YS6 A;  4BYY A;  2F5F A;  4M9Z A;  1KGS A;  1F9N A;  2E7X A;  2DPD A;  4LK1 F;  3CTA A;  1WKM A;  4M9X A;  2E1N A;  3D0S A;  2DAO A;  2BE5 F;  3U1D A;  4HQE A;  2O8X A;  3HSF A;  3TOA A;  5DCM A;  1ZGA A;  1PUE E;  2FE3 A;  4WXD A;  1PP8 F;  5H6R A;  2YPR A;  4A2U A;  3KP7 A;  4GGG A;  5H6Q A;  2QWW A;  4I0A A;  5L3G A;  2HR3 A;  3BJO A;  3BOQ A;  5E8I A;  2CGP A;  4L9T A;  1YW7 A;  5DCM B;  4AIK A;  1HXD A;  3FHZ A;  1TNS A;  3TDU C;  3DFG A;  3GFM A;  1S8N A;  4LLG F;  3PQK A;  1SD4 A;  4Y15 A;  4R1H A;  2FA5 A;  1S3J A;  2VBY A;  4YIF A;  2M8E A;  2O6G E;  4MQV A;  5ICC A;  2VOO A;  1J0R A;  3C1D A;  4F7Z A;  1YW8 A;  4U88 A;  3TO6 A;  1G6N A;  1KQ0 A;  3P9C A;  3F8B A;  2ZKZ A;  4RB1 A;  3E3V A;  3ZMV A;  2R3S A;  3BJA A;  5E18 F;  5D4R A;  3LWF A;  3WGG A;  3I59 A;  2VE8 A;  2IW5 A;  3GXO A;  5HLG A;  3MWM A;  1MDM B;  2A68 F;  2Y0M A;  3RDI A;  3VFZ A;  3JTH A;  4FT8 A;  4L9V A;  5HOO A;  3LA2 A;  5DUK A;  3T8R A;  1OR7 A;  2PFB A;  4XLP F;  2GA2 A;  4IF4 A;  3NRV A;  4G7Z F;  4WWC A;  5D5U B;  4ASN A;  4ZZL A;  2IA0 A;  3M9A A;  1LEA A;  2L3D A;  2EJR A;  1K79 A;  3QOP A;  5L3E A;  1U78 A;  2FMY A;  2LNB A;  2VE9 A;  1QPM A;  2PI0 A;  2M87 A;  4HOB A;  3KCC A;  5FLX Z;  2IPQ X;  2OAZ A;  3I58 A;  4AIJ A;  1ZG5 A;  3O2P E;  1MDM A;  3BPV A;  4UNO A;  2FBK A;  3NQO A;  4GCV A;  4WK8 F;  5DYM A;  5D8L B;  3JAM K;  1JXS A;  1GHC A;  1FP1 D;  2V6C A;  4P9F A;  3GFJ A;  1T98 A;  2LF7 A;  2ZME A;  4HLY A;  5HS9 A;  1RI7 A;  3FM3 A;  4O3M A;  3LA3 A;  1QO0 D;  1B1B A;  1W7P A;  2WTE A;  1R5H A;  1XCV A;  5EEH A;  3HHG A;  1DDN A;  4O6J A;  2EB7 A;  3WTX C;  1RZ4 A;  1KYZ A;  1P4A A;  3HRS A;  1I1S A;  1HW1 A;  2F2E A;  1BOA A;  1K78 A;  4NQW A;  2RN7 A;  2XKO A;  3CDH A;  2DK5 A;  4FHT A;  2PLY A;  1V3F A;  2JTV A;  1R1T A;  2A61 A;  1J59 A;  3RTR A;  3KLN A;  2DK8 A;  3S2W A;  1J2X A;  1R1U A;  1I27 A;  2CSO A;  2FNP A;  1IZ1 A;  2K02 A;  4G7O F;  5D5W B;  4OU0 A;  2HEO A;  1HW5 A;  1ZRD A;  1JGS A;  2LKP A;  1IN5 A;  3N4M A;  1OYW A;  4EJW A;  2D2W A;  3JSP A;  5TJJ A;  5AON A;  1YS7 A;  2K27 A;  5J8C A;  5FLX K;  1TTY A;  2QEN A;  3P7N A;  1MGT A;  3HUG A;  5HDK A;  1QNT A;  4RS8 A;  2D45 A;  2TDX A;  2XV4 S;  3DQV C;  3G73 A;  2DW4 A;  2O0Y A;  3L09 A;  4QWQ A;  4IHS A;  4RB3 C;  3HOS A;  1I5Z A;  2IVM A;  1IRF A;  2WV0 A;  5D5X B;  3LQR A;  1BI3 A;  1FSH A;  2RNJ A;  4BHC A;  5E1Z B;  1U5T C;  4BHB A;  4HF0 A;  4ESF A;  3GX4 X;  1LDK B;  4OIR F;  3CO7 C;  2ISY A;  1IUY A;  4YFN F;  2RV8 A;  1XSD A;  1B59 A;  5D4S A;  1ZRC A;  2BV6 A;  3WTV C;  1FOK A;  5K5Q A;  1P4W A;  4A5M A;  1XMK A;  5LLQ A;  1R58 A;  2PMH A;  3F23 A;  3L00 A;  2XAG A;  2VOD A;  4EM0 B;  4MTE A;  3TQN A;  3SZT A;  3GLX A;  4GYI A;  4HV5 A;  3M8F A;  4LB5 A;  1ZN2 A;  1Z9C A;  2MD5 A;  4HV6 A;  1YO5 C;  1FT9 A;  1RUO A;  2QQB A;  2K4B A;  4OIO F;  1JHH A;  4HAM A;  3U9G A;  1U5T B;  1ZLK A;  3MZH A;  3KP6 A;  1KU9 A;  2R7F A;  3C3W A;  5A2Q Z;  4KFC A;  4WF2 A;  2COM A;  4XLN F;  2RDP A;  2QQ9 A;  2PBI A;  4HX4 A;  5IT9 Z;  4KNY A;  4N9H A;  2RGV A;  3I0T A;  4RB2 C;  2OU2 A;  1IN6 A;  2KIU A;  3I5U A;  1WWX A;  4HLX A;  2UXN A;  3R60 A;  2L02 A;  5D8K B;  1R7J A;  2HKX A;  2O03 A;  4XRF A;  3HSE A;  3GZ6 A;  1KU2 A;  3WTZ A;  3KEO A;  1P2F A;  3IKT A;  5LGN A;  2A5Y B;  2NAZ A;  5JHU A;  4FX4 A;  1Y0U A;  3IRQ A;  2A69 F;  2ACJ A;  1MJ9 A;  2VXZ A;  3ZMD A;  3HIF A;  4PCQ A;  3NEU A;  5ED4 A;  1BM9 A;  1XGM A;  1L3L A;  2GIV A;  1L0O C;  3DPL C;  3I59 B;  4G9Y A;  2RVC A;  3GEZ A;  5HS8 A;  3VB2 A;  4ENJ A;  3I71 A;  2LSO A;  4P9U A;  5JVT A;  4JK1 X;  4GYG A;  3BY6 A;  4RGR A;  4GO1 A;  4IHT A;  3ELK A;  3LA7 A;  5FD6 A;  2QBY B;  1Q1H A;  1GXQ A;  3WGH A;  3WG9 A;  4LMY A;  1OPC A;  3GYH X;  1IN8 A;  4BNC A;  2EFN A;  3IC7 A;  1W5T A;  5H20 A;  4OIN F;  5ICG A;  2X4H A;  3D5L A;  2OZU A;  1DUX C;  2GAU A;  1IW7 F;  2XAQ A;  4Q47 A;  2A6H F;  1D3Y A;  1UCR A;  2CG4 A;  2HZT A;  1IRG A;  4M6Y A;  3T5X A;  4K2E A;  4WXH A;  1FWZ A;  4HX8 A;  3FXU A;  3JW4 A;  3M1E A;  2XVC A;  3COA C;  2VON A;  4OMY A;  3FMS A;  2E1C A;  1D5V A;  3ERE D;  1U8R A;  3IKV A;  1JHF A;  2HGC A;  4HBL A;  2HOE A;  4P96 A;  3CLO A;  5DD8 A;  5DDG A;  1T0F A;  2OQG A;  3ML6 A;  4LG0 B;  4CXF A;  4Z2Y A;  1AWC A;  1ZAR A;  1SD5 A;  5E20 A;  5J8F A;  1BBY A;  2F5E A;  1D8J A;  3TDZ C;  1PP7 U;  2J5P A;  3LAJ A;  3KP4 A;  4WXC A;  2MLK A;  2V1U A;  3CO6 C;  3QRF F;  3KZY A;  3B02 A;  3FMR A;  3VEP A;  2KJB A;  1U6G A;  1S7O A;  1J75 A;  2C6Y A;  3RJP A;  4MQ9 F;  4M72 A;  3T8T A;  1YLF A;  2DQL A;  2A3S A;  2QZ8 A;  2WWY A;  4IRG A;  3R0A A;  1SAX A;  4ON0 A;  3R0J A;  3CUO A;  5KVR A;  2L54 A;  1Z05 A;  3PQJ A;  1G4D A;  4Q5S F;  3TO9 A;  2NRA C;  1XB4 A;  1IXC A;  4ESB A;  5D5V B;  1H9T A;  2Z33 A;  1Z6R A;  4MEY F;  2L01 A;  3HRM A;  2EV0 A;  1T6S A;  4A5N A;  2DT5 A;  1JE8 A;  2VBW A;  1LJ9 A;  2H27 A;  3KP2 A;  1EH7 A;  3RPQ A;  3F21 A;  4ENN A;  4EJT A;  3HSR A;  2QLZ A;  2FOK A;  3L9F A;  4L0Z B;  3KP5 A;  1G3T A;  3ECH A;  3ABU A;  3KET A;  1BI0 A;  1BJA A;  2VN2 A;  4PZJ A;  2FU4 A;  4CIC A;  4XSZ F;  4P55 A;  5ILV A;  2FRH A;  3F6O A;  1YYV A;  4L5I A;  1SFX A;  2MH9 A;  1SFE A;  3GW2 A;  3FZV A;  1O3T A;  3KEQ A;  2EFP A;  4MGR A;  2EV6 A;  4ENK A;  1R00 A;  2KJC A;  5K5R A;  3BPX A;  2IP2 A;  2LF8 A;  1U2W A;  1G3Y A;  1S7A A;  3EDP A;  3WTU C;  1REP C;  3MFK A;  3W6J B;  2NNN A;  5LGT A;  2H09 A;  2ETH A;  1FNN A;  2AXL A;  4KMF A;  1H0M A;  3R6S A;  3OV8 A;  3RKX A;  3K1P A;  1LQ1 A;  1HKT A;  2ZNY A;  3K69 A;  5J6X A;  2DLL A;  4EV0 A;  2K4J A;  1ZRE A;  2IRF G;  2P5V A;  3C7J A;  2P6S A;  2EFO A;  4PDK A;  1BC7 C;  1VTN C;  4MEX F;  4YG2 F;  3WTT C;  1IXS B;  2EFQ A;  3ZQ7 A;  2D1V A;  5CYV A;  3CUQ A;  3FX3 A;  3P9I A;  4EGY A;  4I09 A;  4E70 A;  2P5L C;  3FM5 A;  1MKM A;  2K86 A;  4R8H A;  3TO7 A;  4S05 A;  3F8M A;  2ZBK A;  3RYR A;  3WE2 A;  5HLH A;  4I2O A;  4DQ2 A;  3QPT A;  3I4P A;  2GWR A;  2M45 A;  4Y17 A;  5E8G A;  6PAX A;  3EYY A;  2ZNZ A;  2PG4 A;  3MZY A;  1LNW A;  4U7B A;  1ON1 A;  1O3R A;  4NHJ A;  4QLC U;  4MTD A;  5FD5 A;  3K9T A;  1O3S A;  2G7U A;  3K0L A;  4L0Y B;  1LVA A;  4G6D A;  4O5V A;  5JR3 A;  5FGM A;  3IWF A;  1U5T A;  4UV9 A;  1EH6 A;  2P6T A;  1TQI A;  3K1N A;  4BQA A;  1A04 A;  1FP2 A;  2HQN A;  2NS0 A;  5HS7 A;  3GF2 A;  2H6B A;  4WX9 A;  3F8F A;  3J80 Z;  4RGX A;  2JSC A;  1BC8 C;  3RIR A;  2ZME B;  5DV5 A;  1DP7 P;  1R36 A;  1R22 A;  1B4A A;  5CVR A;  2PQ8 A;  3HYI A;  5A2Q K;  2W84 A;  2XIG A;  4KIC A;  3L7W A;  3EYI A;  2STW A;  3RKY A;  3K2Z A;  1FC3 A;  2OQR A;  4JQF A;  4UHT A;  1K78 B;  1HW2 A;  3WTY C;  3F22 A;  4EJO A;  3LQQ A;  5LGU A;  5BOX A;  1YW9 A;  2GA1 A;  5DD4 A;  1GXP A;  4L9N A;  3H3U A;  3DV8 A;  2HYF A;  3GO5 A;  1YQA A;  3M8E A;  5IT9 K;  1IAW A;  4A0Z A;  4CHU A;  3RPU A;  1ZGJ A;  1Z7U A;  4EGZ A;  2KRF A;  3FWE A;  2CO5 A;  3I53 A;  2Q8K A;  1TBX A;  5CVJ A;  2DO7 A;  4FX0 A;  3T1B A;  2DTR A;  4XSX F;  3JAM Z;  2RC4 A;  1XD7 A;  1R5G A;  1FYM A;  2JPB A;  4KIF A;  2F5D A;  2JPC A;  2IJL A;  1QZY A;  1LDJ A;  4P5O A;  5BQT A;  2DQR A;  3DP7 A;  2O61 A;  4B09 A;  1USS A;  1FBS A;  2M5W A;  1SD6 A;  2ADU A;  4LG0 A;  4IRI A;  5DCF A;  3FF5 A;  1MD0 A;  2ISZ A;  4YII A;  4M9S A;  2B0L A;  4H0E A;  3V7C A;  2XAF A;  3H92 A;  1W7P D;  2XRN A;  2DI3 A;  2ESN A;  3E6M A;  4BXU A;  2V1D A;  3DXJ F;  4ZYE A;  3Q9S A;  1HKS A;  2EA4 A;  4D0P A;  1KA8 A;  2O3F A;  3SHF A;  2FQ3 A;  3WOD F;  3MQ0 A;  1UB9 A;  4ZH4 F;  3ROU A;  2W85 A;  2LDU A;  5E1X A;  1UST A;  2NYX A;  2STT A;  4KA4 A;  3SXY A;  1YFH A;  5FFZ A;  5LRS A;  5AIP A;  4LD5 A;  1YTY A;  4AIH A;  1ZG3 A;  2ZCW A;  1FYL A;  2HWV A;  3E97 A;  2OZ6 A;  4PGH A;  1G3W A;  1BIA A;  2HKO A;  4B8X A;  3V8L A;  3HOT A;  5FFX A;  2HQR A;  4CO8 A;  5DEQ A;  3O6B B;  4YFX F;  1SMT A;  5JI6 A;  3MCZ A;  2YX4 A;  2Z9O A;  1HSJ A;  3CJN A;  5IT3 A;  3E6C C;  2FEZ A;  3RYP A;  3RKW A;  4KIB A;  1MJB A;  1XSX A;  2Q0O A;  2G7H A;  4EQQ A;  4LB6 B;  3O3K A;  3SZP A;  2EA2 A;  2P5K A;  1UHW A;  1O7F A;  3SQN A;  3U2R A;  1PDN C;  2P7V B;  1J7K A;  2UZK A;  4ENM A;  3QU6 A;  3E5U A;  2WC2 A;  4L18 B;  1UHM A;  1FYK A;  2V79 A;  2DFI A;  2OD5 A;  2VC1 A;  3KFW X;  1KYW A;  3GUD A;  4IJA A;  4RAY A;  4BHP A;  5FB2 A;  3HHH A;  4UVA A;  3K1M A;  4HF2 A;  1MZB A;  1LB2 A;  1WQ2 A;  4HYE A;  4EVI A;  1O3Q A;  3LFK A;  5CLS A;  2QYO A;  4UXN A;  2XRO A;  2R7D A;  4UVC A;  2A07 F;  2QBY A;  4IVN A;  4KDP A;  1ZLJ A;  3V7R A;  1T39 A;  4CDG A;  4Q48 A;  4I0B A;  2HTS A;  4UVB A;  2XAJ A;  2W24 A;  4ESJ A;  1P92 A;  5LBQ A;  1O7L A;  1TQP A;  2VT3 A;  2GXB A;  5L3C A;  3WTS C;  3F72 A;  3BP8 A;  1BIB A;  4ZYG A;  1XSV A;  3OOP A;  5ILS A;  4Q4Z F;  4EMS A;  1QQI A;  4UUV A;  1SD7 A;  5KK1 A;  2Y75 A;  4WCG A;  1NHA A;  2XKP A;  1ZYR F;  4L9J A;  1DPR A;  2JZY A;  3JTG A;  2HDC A;  1WRJ A;  1I1G A;  4RAZ A;  2FBH A;  1SFU A;  1ZRF A;  4HQM A;  4RGU A;  5BMZ A;  5CVU A;  2EV5 A;  3R61 A;  2XHK A;  4AWX B;  1E17 A;  3GZ5 A;  3RI4 A;  1K7A A;  2FSW A;  4HF1 A;  1G3S A;  3ECO A;  4HW0 A;  2ZJ2 A;  2HFH A;  4R79 A;  1XMA A;  3T0Y A;  4ZYD A;  1F1Z A;  2UWM A;  4EJU A;  2VT2 A;  4G7H F;  5BPD A;  2CQK A;  3BRO A;  2GXG A;  5K1Y A;  4Y13 A;  5FO5 A;  1IN7 A;  4S04 A;  4I98 B;  2KKO A;  4G8X A;  3AAF A;  4OOI A;  4U0V A; 
#chains in the Genus database with same CATH topology
 2XDV A;  1CGP A;  3H9G A;  4EJV A;  4OIQ F;  3M07 A;  1ODD A;  2MSY A;  2KLO A;  3E6D A;  3WE3 A;  1ZGW A;  4CYD A;  4AD9 A;  1TZL A;  3E5Q A;  5LEK A;  1FSE A;  1AKH B;  4TV7 A;  5E3N A;  2GQQ A;  2ZJP F;  2HYJ A;  3H3V K;  2BVL A;  3V8J A;  3C18 A;  2CW0 F;  1FX7 A;  4CSW A;  3CMM A;  5DM6 F;  4EM2 A;  2QQ8 A;  4U7D A;  1WGX A;  1ITY A;  1O57 A;  3CUQ B;  2GZW A;  2DFH A;  2BHY A;  4XOR A;  2R7T A;  5ICF A;  2HVR A;  2KFD A;  2LRD A;  5K7F A;  1HF0 A;  3I4N J;  1EH8 A;  1LUJ B;  4FCY A;  2XUB A;  2YU3 A;  3J7A O;  4W97 A;  1GVJ A;  4BUP A;  5JFR A;  5KAF C;  2Y48 A;  2EFW A;  2MGQ A;  4PSX A;  1D0X A;  1RUN A;  4CGZ A;  3OY9 A;  1BA5 A;  2RNG A;  2QVO A;  3IHU A;  3BDD A;  3SFI A;  2PN6 A;  1U3E M;  4GFB A;  5LRR A;  3TBI A;  1JT6 A;  1W7P B;  1FBQ A;  3M7G A;  2V1N A;  1R1V A;  2A6E F;  3KLO A;  3HTS B;  4BAC A;  2KL4 A;  3W2V A;  1ULY A;  2W57 A;  2BEO A;  3GTJ J;  3PFI A;  1KQ8 A;  1F5T A;  2BY1 A;  2K40 A;  2VBZ A;  1R4M B;  4B48 A;  2ZXJ A;  4IPA A;  1XDS A;  1Z77 A;  2VC0 A;  2M7A A;  3B6A A;  4FQG A;  4AYB N;  1BI2 A;  4A3F J;  2GM4 A;  4I6Z A;  1DPU A;  3ZMZ A;  2M0M A;  4LK0 F;  3J81 Z;  3W6K B;  1E2X A;  1P4X A;  5IYB J;  3EQL F;  4M71 A;  1T2K A;  4BS9 A;  5GAG J;  2DBB A;  3OYH A;  2CW8 A;  4KYW A;  1V4R A;  3EUK L;  2Q2E A;  1XCB A;  2Z5U A;  3CUQ C;  3EPZ A;  1R5I D;  2R5Z A;  3LSP A;  2E7W A;  4L5J A;  2Y31 A;  2FNA A;  5F0C A;  2MBF A;  3HOV J;  3ABT A;  2R92 J;  4YRV A;  3H3Z A;  2HXO A;  1IN4 A;  3IL2 A;  3OYI A;  1FLI A;  1K6O A;  2V7F A;  5CVV A;  5J1U A;  2HS5 A;  3HPG A;  1KQ9 A;  3OL3 A;  3JRA A;  3S3O A;  5LHI A;  1SFK A;  1TW2 A;  1UZC A;  2IEK A;  3HKZ A;  2NVU B;  1UFM A;  1XGO A;  3E5X A;  1B72 B;  3X2Q H;  2MC3 A;  2DA4 A;  2GBY A;  1SMY F;  3KZZ A;  2AS5 F;  3KP3 A;  2KP6 A;  2VJI A;  1Z3Y A;  2LYC A;  3QU3 A;  3BG5 A;  2CV0 A;  2CQQ A;  4BH9 A;  5BPI A;  5D6E A;  5EGO A;  2KIQ A;  2DT7 B;  4RB0 A;  3F0C A;  4I02 A;  2QEX I;  4J19 A;  1JKR C;  4A6D A;  1W36 C;  1VQL I;  3CC4 I;  4ZYH A;  3J80 K;  1J9I A;  2DYR H;  2DN0 A;  2BOL A;  2NS7 A;  4BQN A;  2RKH A;  2L4A A;  5HDG A;  1X4O A;  3L2C A;  4ZJZ A;  2DMU A;  3F6V A;  1YG2 A;  3F8N A;  3LSI A;  2K9M A;  4JBA A;  4KIT B;  5EEG A;  2EIN H;  3JRF A;  3BWG A;  3LST A;  4HX7 A;  2JA6 J;  9ANT A;  1OYI A;  5LHG A;  2CYY A;  3VYU B;  3ISP A;  2COB A;  2FXA A;  3KE2 A;  2VOP A;  2EWN A;  1C0W A;  3V4G A;  5JHF A;  1E3O C;  3Q5F A;  2CV1 A;  4N4N B;  3VOD A;  3IWZ A;  2D1H A;  3TED A;  4BE0 A;  2JT1 A;  1WI9 A;  2OBP A;  3MAJ A;  2BHZ A;  2JWT A;  1ZHF A;  1J5Y A;  2JJ7 A;  4Y52 J;  1TNT A;  2IA2 A;  5L3D A;  1LEB A;  5L3F A;  2NNY A;  1XGS A;  3VDX A;  1TP4 A;  2M1B A;  3ZMT A;  1PUF B;  2ICW G;  3DLA A;  3HJE A;  5HDN A;  2CFX A;  4ZDL A;  1ZH5 A;  1ON2 A;  3OYM A;  1MBF A;  2UUZ A;  3HRU A;  3HTU A;  3CDL A;  3GFI A;  3LAP A;  2BBY A;  1FPQ A;  2VI6 A;  2X1D A;  5E17 F;  3GFL A;  4F93 B;  1B9M A;  1SVL A;  3F8C A;  2M30 A;  5CQE A;  4A0Y A;  4C3I J;  1VF9 A;  3GTM J;  3S2H J;  2CWE A;  2QGU A;  3GLL A;  3FXK A;  1AKH A;  1D8K A;  4MNU A;  3GWZ A;  4JYK A;  3OSG A;  3VWB A;  3DPT A;  3ZPL A;  4NC6 A;  3ZQI A;  1DGW Y;  5HNH A;  1WH5 A;  2MA3 A;  4G6Q A;  2DA1 A;  3S32 A;  4M6V A;  1G59 A;  4UUS B;  4MHG A;  1MSE C;  3A2K A;  3BJ6 A;  5EDN A;  4DIQ A;  2JRT A;  3P9K A;  2H94 A;  2E19 A;  3B73 A;  3WTW C;  1XN7 A;  5LEJ A;  2NXN B;  5E3M A;  3ZN0 A;  3OIP A;  3ZP5 A;  1RR7 A;  4XRS G;  4UV8 A;  2ESH A;  1D5Y A;  1I3A A;  2KQR A;  4GXO A;  2DMN A;  3G3Z A;  1FY7 A;  4KN4 X;  1BL0 A;  2PEX A;  1A31 A;  2ZJQ F;  3LSH A;  3WHC A;  5CJ9 A;  4LIV A;  2BY2 A;  2KIF A;  2R7V A;  1HKQ A;  4NQW B;  2V9K A;  2VJ5 A;  1T38 A;  2A6T A;  2VBX A;  3QPH A;  1W0T A;  1FZP B;  3DEU A;  1YIO A;  4YFK F;  1STZ A;  3G2B A;  4LLN A;  2VPL A;  2XAH A;  2YX7 A;  2XPU A;  1BI1 A;  3FKI J;  1W36 D;  4XKW A;  4CZZ A;  1KU7 A;  2OA4 A;  3TKY A;  1T08 B;  5F0F A;  1PUF A;  1P6R A;  3ZQH A;  1CF7 A;  4GDF A;  1B9N A;  3PSI A;  3K4K A;  2DFE A;  1BN5 A;  3F3X A;  4XID A;  1AOY A;  3SFZ A;  3TP3 A;  2F5C A;  2XGX A;  5DUI A;  2E1M C;  3IRR A;  1XTA A;  5CVI A;  3LSR A;  4PGG A;  2LY9 A;  5C4X J;  1MMD A;  1RKT A;  3OWT A;  2P7C B;  3ZQC A;  4F91 B;  3G1M A;  1W4M A;  3BR2 A;  3Q9V A;  2F4O B;  2HTJ A;  3KEY A;  3JRD A;  1XPX A;  3AL0 B;  1X4P A;  3OS2 A;  1XGN A;  3K6G A;  3J7Y J;  2XAS A;  3GTQ J;  3RKQ A;  1EKE A;  2P0W A;  2IBD A;  1GLN A;  2R93 J;  2CV2 A;  3G1L A;  3EUH A;  2MH2 A;  4HDU A;  2HDW A;  3NAU A;  4HA8 A;  4IKF A;  5BS6 A;  3FXR A;  4B4C A;  1YX5 A;  4LIT A;  2IT0 A;  2PMU A;  3REO A;  2Z3Y A;  5FRN A;  1B6A A;  5F6F A;  5IY5 H;  1Y6I A;  3TGN A;  3A4C A;  2ZO4 A;  1OKR A;  3ZMU A;  5ICE A;  1OIS A;  2HYG D;  4G6T B;  5HLI A;  3ZN1 A;  3CMA I;  2CFO A;  1QBJ A;  2XRL A;  3BR3 A;  2F4I A;  2ELH A;  3HC7 A;  4B3A A;  2P8T A;  4I7H A;  1B72 A;  3I64 A;  4A0X A;  4U0Y A;  2UXX A;  2RQQ A;  3FMQ A;  3QPS A;  1ONV A;  3WU1 B;  5F64 A;  2R7Q A;  2W25 A;  3H0D A;  2X0L A;  5EJC A;  4ETS A;  2V1X A;  3I54 A;  3BZK A;  1QZZ A;  1QGP A;  4KT5 C;  1UMQ A;  1EV7 A;  4BE2 A;  4ITV A;  4RBO A;  4IRH A;  2RQP A;  4LLL A;  3WGI A;  3WU0 A;  3HRT A;  2E1M B;  4PJM A;  2IA1 A;  4A6E A;  1IJW C;  3D5R C;  1OCO H;  1ZK8 A;  1RIO H;  2JVH A;  2MAB A;  2F4M B;  2X48 A;  2ID3 A;  2DXI A;  2FJ1 A;  3ZCO A;  2Z16 A;  2WY8 Q;  4RGS A;  5D6F A;  4DNC A;  2K7L A;  2Z99 A;  5GAE J;  3AG3 H;  2QUF A;  5F1R A;  3U1K A;  3V42 A;  3AL0 C;  5J1R A;  2ZXH A;  1XDU A;  3HZJ A;  5L3B A;  1TT0 A;  5ILU A;  4IHX A;  3GTL J;  2V9V A;  3E6B A;  4E7L A;  3PO2 J;  1N75 A;  2QF7 A;  3DLL F;  4IXA A;  1S6L A;  3HDD A;  4PFO A;  5LHH A;  4XNF A;  4J00 A;  1VQ8 I;  4AVP A;  4OIP F;  4HDV A;  3MEX A;  2X9D A;  1OYY A;  1ZAO A;  3CDI A;  3FXQ A;  1H8A C;  2K5C A;  3QPL A;  2F48 A;  3S1R J;  2WAF A;  2Y0S A;  1S29 A;  3CF5 F;  4EM1 A;  5GPC A;  1BW6 A;  3PSF A;  1R23 A;  1Z91 A;  1WJ5 A;  2E5N A;  3QAH A;  2BGC A;  2MD0 A;  4AYB A;  2P4W A;  3AAF A;  1I6X A;  3S16 J;  3GVA A;  3JCU C;  2FML A;  4BJ5 C;  1FOY A;  1WSU A;  1WZ2 A;  5FJ8 J;  1X1A A;  3VOE A;  4IQJ A;  4HZF A;  4BAY A;  5C4J J;  3DF8 A;  2WAQ A;  4N9I A;  2CUE A;  2FF4 A;  3H5A A;  2J5O A;  1S9H A;  3JRC A;  3TOB A;  4AVZ A;  4M6X A;  1X3W B;  3BZ6 A;  5KCM A;  4NB5 A;  2PJP A;  4KN7 X;  3OS1 A;  5HVQ C;  3W2W A;  2G9W A;  2FBI A;  3J81 K;  3FBN B;  1CF7 B;  1EF4 A;  2DJN A;  2VXD A;  3QP6 A;  3QP5 A;  1IF1 A;  5TIS C;  1RKW A;  1TW3 A;  4LFU A;  1WCM J;  2MC4 A;  2DA2 A;  3SDG A;  2DU9 A;  2QM3 A;  5ERI A;  2VKD A;  4U0W A;  3ULQ B;  2M7B A;  2XF7 A;  4OMZ A;  1HBX G;  2NOJ B;  4XOP A;  3EUA A;  1OMI A;  1IXR C;  4M74 A;  1I39 A;  1E3P A;  4E7Z A;  3CCJ I;  5TRD A;  4XBF A;  4ZZD A;  1EJ9 A;  1PJR A;  5K5O A;  1T95 A;  1ZG1 A;  3EET A;  5F1J A;  4LJZ F;  4N4O B;  1X3U A;  4MFD A;  4PK4 A;  3BG9 A;  1F4K A;  2L4M A;  1HST A;  1YX3 A;  4KUM A;  4B1R A;  2YSR A;  2BYV E;  3DKW A;  1RNL A;  3CZ6 A;  1T33 A;  2H6C A;  1Z1D A;  4M73 A;  4D7N A;  4FAS D;  2KT0 A;  3BR1 A;  1YI2 I;  2DPU A;  5DS9 A;  1FTT A;  1PVE A;  1EA3 A;  3CJT B;  1LDD A;  1ENH A;  2M9H A;  2YR2 A;  4B43 A;  4CA0 A;  1VFC A;  1VQK I;  3V7S A;  3R4K A;  2MLG A;  1KU3 A;  3V8K A;  1JGG A;  2OF7 A;  4I01 A;  3DEE A;  3DEW A;  1TLH B;  1Z6T A;  5AIQ A;  4M3G A;  4A12 A;  1LPQ A;  1HQC A;  1TQM A;  4ZDO A;  4LGW A;  1H9G A;  2CRG A;  1FBU A;  2KIM A;  3FXL A;  3JSO A;  4KMU X;  3N97 A;  1SAN A;  1VQP I;  2R5Z B;  4G94 A;  4N0B A;  3A03 A;  2EK5 A;  3PIO F;  4KIG A;  3ZMS A;  2QQA A;  2DMP A;  1GV5 A;  1MJA A;  1MBE A;  1W5S A;  5E1W A;  5HNF A;  2ZFW A;  4AU7 A;  1YS6 A;  4BYY A;  2F5F A;  4M9Z A;  3PNV A;  4BDZ A;  4DYC A;  1KGS A;  1F9N A;  2E7X A;  3S3N A;  2DPD A;  2WY7 Q;  2HZD A;  4LK1 F;  3CTA A;  3UNG C;  1GV2 A;  1WKM A;  3GBG A;  4M9X A;  2E1N A;  3D0S A;  2JA5 J;  2DAO A;  3Q0U A;  2BE5 F;  3U1D A;  2VLA A;  5HOD A;  1O4X A;  4HQE A;  2O8X A;  4OAZ A;  1NG7 A;  3HSF A;  2IGM A;  2KMU A;  3TOA A;  5DCM A;  1ZGA A;  1R6R A;  1PUE E;  3RQI A;  2L9S A;  2XGD A;  2FE3 A;  1ZR4 A;  4WXD A;  1PP8 F;  3AFH A;  5H6R A;  2YPR A;  4A2U A;  4YEL A;  4CCN A;  2PMZ A;  3KP7 A;  1KON A;  4GGG A;  3ASN H;  4DZJ A;  1IDZ A;  5H6Q A;  2L2O A;  2QWW A;  3PFY A;  4I0A A;  3BLY A;  5L3G A;  2HR3 A;  3BJO A;  4C30 A;  3BOQ A;  5FLV A;  5E8I A;  2QSG X;  3E0J B;  1IDY A;  4L9T A;  2CGP A;  3HGY A;  2W7N A;  3H36 A;  1YW7 A;  2M34 A;  5DCM B;  4AIK A;  1HXD A;  3BG7 A;  3FHZ A;  1TNS A;  3TDU C;  1XMX A;  1Z0X A;  3DFG A;  2DDA A;  4XN0 A;  3GFM A;  3CCU I;  2O7O A;  2VKV A;  2NVQ J;  1S8N A;  3PM1 A;  4LLG F;  3PQK A;  1K4S A;  3ABL H;  1R71 A;  1SD4 A;  1P7I A;  2LVS A;  4Y15 A;  2W48 A;  4R1H A;  2FA5 A;  1S3J A;  2L7M P;  4UY8 I;  3S2D J;  2VBY A;  4YIF A;  2M8E A;  2M8G X;  1U8B A;  2O6G E;  4MQV A;  5ICC A;  2VOO A;  1J0R A;  3C1D A;  4F7Z A;  1YW8 A;  4U88 A;  1OJL A;  4D7M A;  4JP0 A;  3FKJ A;  3HM5 A;  3Q3S A;  4NDL A;  2KDZ A;  1KZH A;  3TO6 A;  1LE8 A;  1G6N A;  1KQ0 A;  3P9C A;  3F8B A;  3PUB A;  4JX5 A;  2ZKZ A;  4RB1 A;  3E3V A;  3ZMV A;  4BXX J;  2R3S A;  3BJA A;  5E18 F;  1B8I A;  1A35 A;  3BQY A;  3FDY A;  1SAU A;  5D4R A;  3LWF A;  3WGG A;  2XPW A;  1NK3 P;  2XPV A;  3I59 A;  2VE8 A;  2M0C A;  2WB1 A;  3OYD A;  2IW5 A;  3GXO A;  5HLG A;  3MWM A;  1MDM B;  4DOZ A;  1UEL B;  2A68 F;  2AHQ A;  4BEH B;  2M3A A;  2Y0M A;  3RDI A;  4PUS A;  3VFZ A;  3KYL A;  3JTH A;  1JTX A;  4FT8 A;  4L9V A;  5HOO A;  3LA2 A;  5DUK A;  3T8R A;  1OR7 A;  4FE4 A;  2V4J C;  2PFB A;  4A93 J;  1VZ0 A;  5CPR B;  4XLP F;  1BJZ A;  2GA2 A;  2CMP A;  4IF4 A;  3W3C A;  4M3B A;  2WV1 A;  1JJ8 C;  3NRV A;  1XC5 A;  1QU3 A;  4XLF A;  4G7Z F;  1YRN B;  2NS8 A;  4WWC A;  1HA8 A;  5BNG A;  1F36 A;  2O5R A;  2TRT A;  5D5U B;  3IH2 A;  4ASN A;  3OYG A;  1Z3X A;  4Y7N J;  1IG7 A;  4ZZL A;  2IA0 A;  3M9A A;  3K4B A;  1LEA A;  3PJR A;  3HOU J;  2L3D A;  2EJR A;  1K79 A;  4XK4 A;  3S17 J;  1MBH A;  4QSH A;  3QOP A;  2R7W A;  5L3E A;  1U78 A;  3BTC A;  2FMY A;  1FOW A;  2LNB A;  4XLH A;  4A69 C;  2WAQ N;  4A3L J;  1MH4 A;  3SYT A;  4F92 B;  3OOU A;  2VQG A;  1A6I A;  1W0U A;  5M5W J;  1DGR M;  2VE9 A;  1QPM A;  4DBQ A;  2PI0 A;  2KZG A;  2M87 A;  2R5Y B;  4HOB A;  5EZG A;  3KCC A;  5FLX Z;  2IPQ X;  3O8G A;  2OAZ A;  3I58 A;  3CCY A;  2LBF B;  4AIJ A;  5GAH J;  5B5E C;  1ZG5 A;  3O2P E;  4PJL A;  5HLT A;  4ZC3 A;  4BKX A;  1SEU A;  1MDM A;  3S14 J;  3BPV A;  4X0G A;  3BTL A;  4UNO A;  2FBK A;  2XC7 A;  3NQO A;  3UR3 C;  4GCV A;  4LG3 A;  4WK8 F;  5DYM A;  3CJR B;  3MN2 A;  5D8L B;  3JAM K;  1JXS A;  4E6K G;  1GHC A;  3MMY B;  1FP1 D;  2V6C A;  4P9F A;  5GP9 A;  1R9T J;  3GFJ A;  1T98 A;  4RM3 A;  2LF7 A;  3IAS 2;  2ZME A;  4HLY A;  5HS9 A;  1DU6 A;  1RI7 A;  3FM3 A;  4O3M A;  2DOA A;  2L9N A;  3LA3 A;  2W1O A;  1QO0 D;  1B1B A;  1W7P A;  2M2E A;  2OTL I;  5FKL A;  2MFZ A;  5TGT A;  2WTE A;  1R5H A;  1V5G A;  1XCV A;  2E2H J;  5EEH A;  3OYN A;  3HHG A;  1DDN A;  4IO9 F;  2WAD A;  4O6J A;  2WB1 N;  4D9J A;  5FLM J;  2EB7 A;  2ME6 A;  2YUS A;  4Y33 A;  3WTX C;  3VYR B;  1RZ4 A;  1KYZ A;  1P4A A;  3HRS A;  1I1S A;  3BR6 A;  3WU2 C;  4IZZ A;  1HW1 A;  2CW7 A;  3KYC B;  4ZTF A;  2F2E A;  1BOA A;  1K78 A;  4NQW A;  1RRJ A;  2IS1 A;  4BJT A;  1AU7 A;  3GTP J;  2RN7 A;  2XKO A;  2OJE D;  4RLQ A;  3W6V A;  3CDH A;  4XON A;  2BVM A;  2DK5 A;  3IH4 A;  4E7J A;  2LRE A;  4FHT A;  2B7E A;  2EQR A;  3ZQF A;  2PLY A;  1V3F A;  2KPM A;  2JTV A;  5F0H A;  1R1T A;  3MVP A;  2NOG A;  1R4N B;  2A61 A;  2OCE A;  3RTR A;  2DT6 A;  1J59 A;  2VQH A;  2ZSI B;  1MBG A;  4XMY A;  3KLN A;  3M4O J;  3JR9 A;  3K10 A;  2QA4 I;  4X6A J;  4B47 A;  2DK8 A;  5GPA A;  3LMM A;  3S2W A;  1J2X A;  1R1U A;  3CMY A;  1I27 A;  2CSO A;  2XSJ C;  1UG2 A;  4GRI A;  2FNP A;  1IZ1 A;  2K02 A;  4G7O F;  5D5W B;  3ZOB A;  4OU0 A;  2HPI A;  2HEO A;  3OSF A;  1HW5 A;  4BDY A;  1ZRD A;  3DU6 A;  1MMN A;  5B66 C;  1JGS A;  2LKP A;  3VYS B;  5B1B H;  1IN5 A;  3N4M A;  4U87 A;  1GUU A;  1OYW A;  1X3Z B;  3CCV I;  5EYR A;  4ZYA A;  5JLX A;  2D2W A;  4EJW A;  4QIW N;  3JSP A;  3D5S C;  5TJJ A;  4HSR A;  2Z1D A;  5AON A;  1YS7 A;  2K27 A;  5J8C A;  5FLX K;  1TTY A;  2QEN A;  3OYE A;  3P7N A;  5C44 J;  3OYK A;  1MGT A;  4YIR X;  3I9V 2;  4L5E A;  3HUG A;  4NBQ A;  1HDP A;  5HDK A;  2ZXW H;  1QNT A;  4RS8 A;  1S72 I;  4I99 C;  2OPT A;  3G4S I;  2D45 A;  2JN6 A;  2TDX A;  2XV4 S;  3DQV C;  3G73 A;  2DW4 A;  3MKY B;  2O0Y A;  3L09 A;  3OYF A;  4QWQ A;  3L2V A;  4IHS A;  4XM3 A;  4RB3 C;  3LOC A;  3OYL A;  4D5C A;  4RAG A;  2ECB A;  3HOS A;  1I5Z A;  2IVM A;  1SFO J;  1V54 H;  1IRF A;  2WV0 A;  3NWT A;  1MMS A;  1Y56 A;  5D5X B;  3P5J A;  4HNU A;  5J47 A;  1MNE A;  3LQR A;  1CQT A;  1BI3 A;  1FSH A;  2Y30 A;  4BXF A;  2LBF A;  2WBM A;  3CC2 I;  3CP2 A;  2RNJ A;  4BHC A;  3GCM A;  5E1Z B;  2DA5 A;  2ZJR F;  1U5T C;  2EZK A;  4ZTJ A;  4BHB A;  5DM7 F;  1X1B A;  4HF0 A;  4ESF A;  2LD5 A;  2IGN A;  2X1E A;  4JX4 A;  3OIO A;  3GX4 X;  1LDK B;  4XKB A;  4OIR F;  3CO7 C;  5KAI C;  1WFX A;  2ISY A;  1IUY A;  4FE7 A;  4YFN F;  3CCM I;  1GVD A;  1VI0 A;  4XR6 A;  2RV8 A;  1XSD A;  2DYS H;  1B59 A;  3H35 A;  4XLC A;  5D4S A;  1ZRC A;  3WG7 H;  4E7S A;  2BV6 A;  2YS9 A;  3WTV C;  1FOK A;  4C3J J;  5K5Q A;  1TWH J;  2CU7 A;  1P4W A;  4A5M A;  1XMK A;  2OV7 A;  5LLQ A;  1NTC A;  3G1O A;  5F04 A;  4RDU A;  1R58 A;  2PMH A;  3F23 A;  2Y2Z A;  3L00 A;  2XAG A;  4C2T A;  2VOD A;  4EM0 B;  3E7L A;  4MTE A;  2R0Q C;  2DMQ A;  1BR1 A;  3TQN A;  3SZT A;  2V6E A;  1LE8 B;  3VPR A;  3A01 B;  3GLX A;  3OYA A;  4GYI A;  4HV5 A;  3M8F A;  4LB5 A;  1ZN2 A;  2E35 A;  5E79 C;  1W1W E;  1Z9C A;  2MD5 A;  4HV6 A;  1YO5 C;  1RPW A;  1FT9 A;  3K4N A;  3MD2 A;  4XKC A;  2BW3 A;  2E5Z A;  2LMD A;  1RUO A;  2V26 A;  1QPI A;  5DTD A;  3ONQ A;  2QQB A;  2K4B A;  3DTE A;  4OIO F;  1JHH A;  4HAM A;  3U9G A;  5EGO B;  1FIA A;  1U5T B;  5J4Y A;  3ERM A;  1ZLK A;  2GLO A;  4DYQ A;  3MZH A;  3J7A Y;  2I5U A;  3KP6 A;  1KU9 A;  2R7U A;  2R7F A;  3C3W A;  5A2Q Z;  4KFC A;  2XGE A;  4WF2 A;  2COM A;  4XLN F;  2LG4 A;  2RDP A;  2QQ9 A;  2VIX A;  3L2Q A;  4II3 A;  2PBI A;  1K6Y A;  4HX4 A;  3CCS I;  5IT9 Z;  4HEA 2;  4V2G A;  3CME I;  4KNY A;  4N9H A;  1VQ5 I;  2RGV A;  4QTR A;  3I0T A;  4RB2 C;  2OU2 A;  1IN6 A;  2KIU A;  5K7H A;  3I5U A;  2DTZ A;  1WWX A;  4HLX A;  2UXN A;  3R60 A;  4NC7 A;  2L02 A;  5D8K B;  1R7J A;  2HKX A;  2GOM A;  2LKS A;  2O03 A;  4XRF A;  4A3B J;  3QYF A;  3HSE A;  3GZ6 A;  1KU2 A;  3C2H A;  3FK6 A;  3WTZ A;  3ZQG A;  4XQF A;  3KEO A;  1UG0 A;  4LOC A;  1P2F A;  2VJ4 A;  4RLF A;  3H0G J;  1X2N A;  2BZT A;  4V2F A;  3IKT A;  2HVS A;  5LGN A;  2A5Y B;  1ACI A;  2NAZ A;  2IS2 A;  5JHU A;  1Y8R B;  3N05 A;  1E3H A;  1IRX A;  1P9Q C;  2N8G A;  4XOT A;  4FX4 A;  1Y0U A;  2ELK A;  2K9Q A;  3IRQ A;  2A69 F;  3A02 A;  2ACJ A;  1MJ9 A;  1Y39 A;  3S1N J;  2DCE A;  2VXZ A;  3ZMD A;  3HIF A;  3QOD A;  4PCQ A;  3NEU A;  5ED4 A;  2R4G A;  3FHN A;  4HNT A;  2JVG A;  3ASO H;  4PJN A;  1BM9 A;  1PYV A;  1WJF A;  1XGM A;  1U9N A;  2A5W A;  1L3L A;  4ZDP A;  1JKO C;  1X19 A;  3ESW B;  4IOA F;  2PX9 A;  2GIV A;  3JRE A;  1L0O C;  2VL8 A;  4II2 A;  1QZE A;  1IV6 A;  5FKN A;  3DPL C;  3I59 B;  4G9Y A;  1ETX A;  2RVC A;  1RET A;  3GEZ A;  4JX6 A;  5HS8 A;  5M3M J;  3VB2 A;  4ENJ A;  1FIP A;  3F9K A;  3CP8 A;  3I71 A;  5JVG F;  3TP0 A;  2LSO A;  4P9U A;  5JVT A;  4JK1 X;  4GYG A;  3RPU D;  3HOW J;  4V19 K;  3HPH A;  4BY7 J;  2DOD A;  5JLW A;  1YJW I;  3BY6 A;  2UV1 A;  4RGR A;  4GO1 A;  4IHT A;  3ELK A;  3PO3 J;  3LA7 A;  3D1N I;  5FD6 A;  2QBY B;  1Q1H A;  4UB6 C;  3ZGK A;  2M4K A;  1GXQ A;  1IC8 A;  3WGH A;  1VQM I;  2R7S A;  2XF6 A;  3WG9 A;  1NG6 A;  1S7E A;  4IX7 A;  3HKZ N;  4LMY A;  1JUS A;  1OPC A;  1JJ6 C;  3GYH X;  3OIQ A;  4BQO A;  1IN8 A;  3IH3 A;  4BNC A;  3K2A A;  1FMV A;  2EFN A;  3DKX A;  3IC7 A;  2KHM A;  2LTP A;  2EZL A;  2WA0 A;  3KYD B;  4EAT A;  3AKZ A;  1W5T A;  5H20 A;  3WHB A;  1OQY A;  4RAF A;  3OS0 A;  1MNM C;  1QRY A;  1OCR H;  4OIN F;  5ICG A;  2X4H A;  3KPH A;  4BBS J;  3D5L A;  2PJR A;  3SJM A;  2E71 A;  2OZU A;  1DUX C;  2GAU A;  4BY1 J;  1IW7 F;  1MMA A;  2XAQ A;  3QQA A;  3CC7 I;  4Q47 A;  2A6H F;  3BTJ A;  2K9N A;  2K9S A;  3L2W A;  1D3Y A;  1UCR A;  2ID6 A;  3DBR B;  5CKT A;  2CG4 A;  1WJB A;  2HZT A;  5B3S H;  2JQ7 A;  1IRG A;  4M6Y A;  1D0Y A;  3K4M A;  4XLA A;  3T5X A;  4K2E A;  4XN3 A;  1K4T A;  5IOY A;  2VQC A;  4WXH A;  1FWZ A;  2LC2 A;  4HX8 A;  3FXU A;  3JW4 A;  3M1E A;  3DCF A;  4J01 A;  2XVC A;  3L2R A;  2P81 A;  3S15 J;  3COA C;  2VON A;  4OMY A;  3FMS A;  3CCR I;  2E1C A;  3K7A J;  1D5V A;  2Z2S B;  4CUG A;  3ERE D;  2HOA A;  1U8R A;  2I10 A;  3IKV A;  4D1Q A;  3S3M A;  5KNL A;  1Q1V A;  2JA2 A;  1JHF A;  2JMW A;  2HGC A;  4HBL A;  2HOE A;  4P96 A;  4CYC A;  2K9L A;  3CLO A;  5DD8 A;  5DDG A;  1T0F A;  1APL C;  3RZD J;  2OQG A;  3ML6 A;  3GTO J;  4C2M J;  4LG0 B;  1SC7 A;  4ANJ A;  2G0E A;  4CXF A;  4Z2Y A;  1AWC A;  2EBI A;  1ZAR A;  1SD5 A;  5E20 A;  4KT6 A;  1TWG J;  5J8F A;  1BBY A;  2E34 A;  3LSK A;  4G12 A;  2DDB A;  2F5E A;  5M5X J;  1D8J A;  1DQU A;  4PJJ A;  4BBR J;  3TDZ C;  1PP7 U;  1FEX A;  2JA7 J;  2J5P A;  3LAJ A;  3KP4 A;  4WXC A;  2MLK A;  2V1U A;  1G2H A;  3CLQ A;  2AO9 A;  3CO6 C;  3QRF F;  3KZY A;  2BXY A;  1I6H J;  1AHD P;  3B02 A;  1ETQ A;  3FMR A;  3VEP A;  2KJB A;  1YRN A;  1U6G A;  1S7O A;  1WH7 A;  2DA7 A;  1J75 A;  4M3F A;  2C6Y A;  3RJP A;  4MQ9 F;  4IOC F;  2VQL A;  4M72 A;  3OYC A;  1BOB A;  3T8T A;  1YLF A;  2DQL A;  4KIS A;  4A3D J;  2DA6 A;  1F43 A;  2WAE A;  2A3S A;  3LNQ A;  5IOZ A;  2QZ8 A;  3ZQQ A;  2WWY A;  4S0H B;  4IRG A;  3R0A A;  4E7H A;  1SAX A;  4ON0 A;  2Y9Y A;  3R0J A;  3CUO A;  5KVR A;  2L54 A;  4RMN A;  1Z05 A;  3PQJ A;  2DFF A;  1G4D A;  4Q5S F;  3TO9 A;  2NRA C;  1XB4 A;  1IXC A;  4ESB A;  5D5V B;  1H9T A;  1JUM A;  4BEH A;  3H5N A;  1POG A;  2Z33 A;  1OFC X;  1Z6R A;  4MEY F;  5K7Z A;  1BR4 A;  3C2G A;  5H2F C;  1G8X A;  4MO7 A;  2L01 A;  3VSK A;  1X2M A;  1ZQ3 P;  3HRM A;  2EV0 A;  1T6S A;  1JTY A;  4A5N A;  4IHY A;  2DT5 A;  1GDT A;  1A5J A;  3H5R A;  3HEF A;  1JE8 A;  2VBW A;  3GTK J;  1LJ9 A;  4E4H A;  4BQQ A;  2H27 A;  3KP2 A;  3CES A;  1EH7 A;  5M5Y J;  3DBH B;  1XS9 A;  3RPQ A;  3F21 A;  4ENN A;  3W2A A;  1LFU P;  4PJ0 C;  5IYC J;  1RC9 A;  2ZFU A;  4EJT A;  2XB0 X;  3HSR A;  3GZN B;  2QLZ A;  5EF6 A;  3CCQ I;  2FOK A;  3IP4 B;  3L9F A;  4L0Z B;  1TWF J;  3KP5 A;  1G3T A;  2L0K A;  3J7Z I;  3ECH A;  3ABU A;  2LFB A;  2DOE A;  1V5E A;  3KET A;  3E1S A;  1D1B A;  1BI0 A;  2JUC A;  1BJA A;  1T8I A;  2VN2 A;  3KIO A;  4MLO A;  3A1Y A;  4PZJ A;  2FU4 A;  4CIC A;  4XSZ F;  4P55 A;  5ILV A;  2FRH A;  3F6O A;  4OWR B;  4C9Y A;  1ETK A;  3PIP F;  1SVM A;  1YYV A;  4L5I A;  1SFX A;  4B44 A;  1GT0 C;  1K83 J;  2MH9 A;  1SFE A;  4W1U A;  3S1M J;  1JKQ C;  3NAR A;  3ZRG A;  3U21 A;  3BR0 A;  3GW2 A;  1ZR2 A;  4NUB A;  3FZV A;  1O3T A;  3KEQ A;  2EFP A;  1TWC J;  4MGR A;  4CH7 A;  1M1E B;  2EV6 A;  4ENK A;  3CCE I;  3OMY A;  1R00 A;  2KJC A;  5K5R A;  2CUJ A;  3BPX A;  2IP2 A;  4M3D A;  4MFE A;  2X85 A;  1XG1 A;  3QYB A;  2LF8 A;  1YHQ I;  1QHH D;  1U2W A;  1G3Y A;  2H1L A;  5IYD J;  2LH9 A;  1S7A A;  3EDP A;  2LY2 A;  2CJJ A;  2QCO A;  3WTU C;  1MBJ A;  4IEJ A;  4XRS A;  3NWS A;  1REP C;  4BL0 B;  4A3C J;  3MFK A;  3Q0W A;  3W6J B;  4FET A;  2LLK A;  2CH0 A;  2E1O A;  3LSJ A;  2HXI A;  1J09 A;  2NNN A;  5LGT A;  1IRZ A;  2H09 A;  2ETH A;  2X6O A;  1FNN A;  2NVX J;  2Q1Z B;  2AXL A;  1H88 C;  2Y69 H;  4KMF A;  3PNY A;  4CCL A;  3HOZ J;  1H0M A;  3LL7 A;  3FXO A;  3R6S A;  1FTZ A;  2BXZ A;  3OV8 A;  1SVO A;  3RKX A;  4X1E A;  3K1P A;  1LQ1 A;  1HKT A;  3IV5 A;  2ZNY A;  3K69 A;  2EIL H;  5J1Y A;  2EIM H;  5J6X A;  4RA2 A;  2YU9 J;  2DLL A;  4EV0 A;  2DOF A;  1QHG A;  2K4J A;  4DZP A;  1ZRE A;  2IRF G;  2P5V A;  3C7J A;  2F6C A;  2P6S A;  2EFO A;  4PDK A;  1BC7 C;  1VTN C;  2GIZ A;  4MEX F;  3EUH C;  4YG2 F;  1VQ9 I;  3DTK A;  3WTT C;  3PUF A;  2R7R A;  2IS4 A;  3FBI B;  2PMZ N;  1IXS B;  2ZC2 A;  3UKG A;  2EFQ A;  5FRO A;  5F08 A;  3ZQ7 A;  3FIS A;  2D1V A;  2VKE A;  2IGO A;  3GTG J;  4BU2 A;  5CYV A;  3CUQ A;  3FX3 A;  3P9I A;  3G6E I;  4EGY A;  4I09 A;  4E70 A;  2P5L C;  2BW3 B;  3LFU A;  2CS3 A;  3FM5 A;  2RRE A;  1MKM A;  2K86 A;  4R8H A;  2MYS A;  3KZI C;  3TO7 A;  2E2J J;  4S05 A;  5KHD A;  2VJJ A;  3F8M A;  2JA8 J;  2F5V A;  2O9L A;  3HG9 A;  2EIJ H;  2ZBK A;  3RYR A;  3WE2 A;  5HLH A;  4I2O A;  2LR8 A;  1X1P A;  4DQ2 A;  1JI8 A;  1LFB A;  1ZTR A;  2GXA A;  3QPT A;  3I4P A;  5FKK A;  2E60 A;  2GWR A;  2M45 A;  4Y17 A;  5E8G A;  6PAX A;  2CQN A;  2Y0S N;  3AG1 H;  3EYY A;  4XKV A;  2ZNZ A;  2XSD C;  4DBR A;  2PG4 A;  3MZY A;  3BTI A;  1LNW A;  3I56 I;  1VQ7 I;  1WVR A;  3H9Q A;  4U7B A;  1ON1 A;  1D1A A;  4F55 A;  3CD6 I;  4XL9 A;  2B63 J;  1IV8 A;  1O3R A;  4HG2 A;  1VQ4 I;  4NHJ A;  4QLC U;  4MTD A;  5FD5 A;  3K9T A;  1O3S A;  2G7U A;  3K0L A;  4L0Y B;  2R5Y A;  4A3I J;  1YJN I;  1A6Q A;  5EZH A;  1OR7 C;  2BY3 A;  1LVA A;  4G6D A;  4O5V A;  1OCZ H;  5FGM A;  5JR3 A;  1X58 A;  3IWF A;  1U5T A;  5J3L A;  4UV9 A;  2KZV A;  3JRB A;  1QVU A;  1EH6 A;  2P6T A;  3BG6 A;  5FKM A;  1TQI A;  1T56 A;  2HVQ A;  3K1N A;  1A36 A;  2E2I J;  2K85 A;  4BQA A;  4YEJ A;  1A04 A;  1W5C C;  1FP2 A;  2HQN A;  1LVK A;  2NS0 A;  3GF2 A;  2H6B A;  5HS7 A;  4WX9 A;  3F8F A;  3J80 Z;  2FQ4 A;  4RGX A;  2JSC A;  3LSM A;  3TL4 X;  3BR5 A;  4HPQ A;  1P7J A;  2TCT A;  2L7Z A;  2XB5 A;  1BC8 C;  2AQF A;  3S8P A;  3RIR A;  2ZME B;  5DV5 A;  1DP7 P;  1R36 A;  3DBL B;  3K70 D;  1R22 A;  1VQN I;  3RSN A;  4AID A;  1B4A A;  5CVR A;  2PQ8 A;  1FJL A;  2ZB9 A;  3HYI A;  3SEZ A;  5A2Q K;  2W84 A;  2XIG A;  3DTI A;  3I4M J;  4KIC A;  1ORK A;  3L7W A;  2STW A;  3EYI A;  3SDB A;  2ELJ A;  3RKY A;  3M1C A;  2HQ5 A;  1VND A;  2BY0 A;  3K2Z A;  2HI3 A;  1FC3 A;  2OQR A;  3MKL A;  4JQF A;  4UHT A;  1K78 B;  1HW2 A;  2XAU A;  3WTY C;  3F22 A;  1N25 A;  4EJO A;  3LQQ A;  5LGU A;  5BOX A;  1YW9 A;  2GA1 A;  2RAE A;  5DD4 A;  1GXP A;  1Y1W J;  4L9N A;  2JK3 A;  1TC3 C;  5F27 A;  2X6Y A;  3H3U A;  1Z21 A;  3DV8 A;  2HYF A;  1R49 A;  3K4C A;  3GO5 A;  2K3P A;  2HNH A;  3Q0V A;  1YQA A;  3QYE A;  3O8H A;  3S1Q J;  5LD2 C;  3M8E A;  5IT9 K;  1IAW A;  4A0Z A;  2D5V A;  1WI3 A;  3CQZ J;  2NVT J;  4CHU A;  3RPU A;  2R7Z J;  2OUM A;  1ZGJ A;  4B3X A;  3HOX J;  3MZ8 A;  4CCM A;  3I3L A;  1Z7U A;  5GTH C;  4EGZ A;  2KRF A;  3FWE A;  5GTI C;  2CO5 A;  3I53 A;  3OL4 A;  2Q8K A;  1TBX A;  5IP7 J;  5CVJ A;  2DO7 A;  4HRI A;  4FX0 A;  3T1B A;  1DP3 A;  2DTR A;  3VSL A;  2ZME C;  4XSX F;  3JAM Z;  2FOW A;  5J4V A;  2RC4 A;  1XD7 A;  2Q2E B;  1R5G A;  1FYM A;  2JPB A;  4KIF A;  2F5D A;  2JPC A;  2IJL A;  1Y8Q B;  3DKY A;  1HC8 A;  1QZY A;  3AG4 H;  3S93 A;  3SEQ A;  4DYR A;  1LDJ A;  4P5O A;  1Z67 A;  5BQT A;  3HB9 A;  2DQR A;  3IAM 2;  4BE1 A;  3CF2 A;  3DP7 A;  2O61 A;  4B09 A;  5FRM A;  2LOO A;  2AXT C;  2MW8 A;  2IS6 A;  1USS A;  3QWL A;  1FBS A;  2M5W A;  1SD6 A;  2ADU A;  2R7O A;  3FXJ A;  4LG0 A;  1D1C A;  4E7K A;  1UAA A;  2OCC H;  3BCB A;  4IRI A;  5DCF A;  3FF5 A;  3A0B C;  1RES A;  3AG2 H;  3MKZ A;  5M3F J;  2KIS A;  4LIU A;  4HNV A;  5LFA A;  1MD0 A;  2K3F A;  1E0E A;  2ISZ A;  4YII A;  4M9S A;  2B0L A;  3V7C A;  4H0E A;  2XAF A;  3DPU A;  5E3O A;  3H92 A;  1W7P D;  2XRN A;  3HGG A;  2DI3 A;  1V5F A;  1MMG A;  2ESN A;  1ETV A;  3E6M A;  4F3Q A;  1VQ6 I;  3PNT A;  2VAS A;  4BXU A;  4ABZ A;  2V1D A;  3DXJ F;  4BJ6 C;  1YE9 A;  4ZYE A;  1MIJ A;  2XF5 A;  3Q9S A;  4DGW B;  1U0J A;  4P1W A;  1HKS A;  2EA4 A;  3PL8 A;  4D0P A;  1JKP C;  1KA8 A;  4Z6Y A;  2O3F A;  4IL6 C;  3SHF A;  2L7K A;  5J40 A;  2FQ3 A;  2KRH A;  2CUZ A;  1HDD C;  2JRM A;  1K61 A;  3WOD F;  1I3Q J;  3HXL A;  4A3J J;  3MQ0 A;  1UB9 A;  4ZH4 F;  1NH3 A;  3ROU A;  2W85 A;  3VYT B;  4C2U A;  2LDU A;  3HUG B;  5E1X A;  1UST A;  1ETO A;  2NYX A;  2STT A;  4KA4 A;  3SXY A;  1QA6 A;  1YFH A;  5FFZ A;  2O8K A;  2KDO A;  2HDD A;  5LRS A;  1XX5 A;  3DU5 A;  5AIP A;  5GAD J;  4UUS A;  2KRC A;  4LD5 A;  1YTY A;  2IAI A;  1MND A;  4AIH A;  1MW7 A;  1ZG3 A;  2ZCW A;  4Y3O A;  3CCL I;  1WPK A;  1FYL A;  2HWV A;  3E97 A;  2OZ6 A;  1YOV B;  1G3W A;  4PGH A;  3CJQ B;  4PFP A;  1BIA A;  2HKO A;  4B8X A;  4XIC A;  2FD5 A;  3V8L A;  1TL8 A;  3HOT A;  5FFX A;  2HQR A;  4CO8 A;  3RCO A;  5EEA A;  1ZKG A;  5DEQ A;  1N78 A;  3O6B B;  4YFX F;  1SMT A;  5JI6 A;  1DU0 A;  2W00 A;  3MCZ A;  2EZI A;  2FUG 2;  3FXM A;  2LP0 A;  2YX4 A;  5CQG A;  2Z9O A;  3JRI A;  1HSJ A;  3CJN A;  3QOE A;  1WJE A;  1LKX A;  1YIJ I;  5IT3 A;  3L2U A;  3E6C C;  1TT5 B;  2FEZ A;  2ME0 A;  3GME A;  2X6W A;  1Y1V J;  3RYP A;  4D5F A;  3RKW A;  2VB6 A;  3ZXS A;  1WJC A;  3HOY J;  1HCR A;  5E3L A;  1OCP A;  3RQ4 A;  1YIT I;  4KIB A;  1MJB A;  3KX2 A;  1XSX A;  4A3K J;  1WHU A;  2Q0O A;  3HL2 A;  2G7H A;  4IQ4 A;  3OYJ A;  1WJA A;  2X51 A;  1Y0N A;  4EQQ A;  1OCC H;  2L9V A;  4LB6 B;  5IP6 A;  2A05 A;  3O3K A;  3SZP A;  2EA2 A;  2P5K A;  1UHW A;  1O7F A;  3SQN A;  3B6C A;  3U2R A;  3ZR8 X;  1PDN C;  3RZO J;  2P7V B;  1LFP A;  1J7K A;  1BR2 A;  2UZK A;  2W4S A;  4ENM A;  3QU6 A;  4KJZ A;  3MKW B;  4A3G J;  1ZEL A;  2L9R A;  4DW6 A;  3E5U A;  2WC2 A;  2H8R A;  4L18 B;  2DMT A;  1UHM A;  4BGD A;  4E7I A;  4M3E A;  2JUG A;  1FYK A;  2V79 A;  1NK2 P;  2EZH A;  2DFI A;  4UUT A;  2HPM A;  1V55 H;  4NNJ A;  4A3E J;  3ABK H;  2V9P A;  2OD5 A;  4FTH A;  1MSF C;  1T0F C;  2X6X A;  4EEF G;  2VC1 A;  2XGC A;  3KFW X;  1KYW A;  3HBL A;  3A0H C;  4AUX A;  4PSW A;  3GUD A;  3OR1 C;  4IJA A;  4RAY A;  4BHP A;  5FB2 A;  3HHH A;  4UVA A;  3K1M A;  4HF2 A;  2HQA A;  3H1C A;  1MZB A;  1LB2 A;  2CQX A;  1WQ2 A;  3M3Y J;  4IHW A;  4HYE A;  4EVI A;  1WJD A;  4CZC A;  1RR8 C;  4QPQ A;  3DWL E;  2GOX B;  2L5Q A;  2HOT A;  1O3Q A;  3LFK A;  2JSP A;  2L7F P;  2OC6 A;  5CLS A;  2NVY J;  2QYO A;  4UXN A;  1YJ9 I;  2XRO A;  1D0Z A;  1X1C A;  4HST A;  5B1A H;  3K4J A;  3I55 I;  3BC8 A;  1VQO I;  3L1P A;  2R7D A;  3H9J A;  2EIK H;  4UVC A;  4Y4R A;  3ZQL A;  1FOX A;  3M8J A;  2A07 F;  2IGK A;  2QKL B;  2QBY A;  2X1C A;  4CCO A;  3BZC A;  3OYB A;  1X1D A;  4IVN A;  4KDP A;  1OLT A;  5EG0 B;  1ZLJ A;  4UB8 C;  3V7R A;  1T39 A;  2EH3 A;  4CDG A;  1BW5 A;  4Q48 A;  5IPA A;  4I0B A;  2IXS A;  3LSG A;  2ZSH B;  2HTS A;  2W82 A;  4UVB A;  2XAJ A;  4I76 A;  3JRH A;  4QPO A;  2W24 A;  4ESJ A;  1UJ8 A;  1P92 A;  3IUO A;  5LBQ A;  2OTJ I;  1O7L A;  1TQP A;  2M4G A;  2VT3 A;  4XLE A;  2GXB A;  5L3C A;  3WTS C;  3F72 A;  3OR2 C;  4CYC B;  1N77 A;  3BQZ A;  2ECC A;  2VPR A;  3BP8 A;  1BIB A;  5FKO A;  5EG0 A;  4ZYG A;  1XSV A;  3OOP A;  1ETY A;  5ILS A;  4A3M J;  2VUM J;  1IGN A;  4JOM A;  3SZG A;  4Q4Z F;  1IUF A;  4EMS A;  1U9O A;  1QQI A;  4UUV A;  2AQE A;  1SD7 A;  5KK1 A;  3ABM H;  3JRG A;  2Y75 A;  2EPF A;  2Y9Z A;  4WCG A;  2B9S A;  1NHA A;  2LY1 A;  2XKP A;  1ZYR F;  1FMW A;  4H4K C;  1ETW A;  3G71 I;  1Z7L A;  2E36 A;  4RM2 A;  4L9J A;  1OCT C;  1DPR A;  2H1K A;  4IHV A;  2JZY A;  3JTG A;  2HDC A;  1WRJ A;  1I1G A;  4RAZ A;  1MH3 A;  4XRM A;  1AA7 A;  2FBH A;  4C3H J;  4CCJ A;  1SFU A;  3FK7 A;  1ZRF A;  2CUF A;  4HQM A;  2MG4 A;  4RGU A;  5BMZ A;  4NC8 A;  5CVU A;  1HOM A;  3TMO A;  1H89 C;  2EV5 A;  3R61 A;  2QKM B;  2XHK A;  1JUP A;  3BG3 A;  4AWX B;  5C3E J;  4DJA A;  1E17 A;  2VKH A;  3FIW A;  3GZ5 A;  3RI4 A;  1K7A A;  2HOS A;  2FSW A;  2LK2 A;  4HF1 A;  1G3S A;  3ECO A;  4HW0 A;  4MIM A;  2PJR B;  4AC0 A;  1IO2 A;  3K70 C;  2ZJ2 A;  1HLV A;  2ZXI A;  2HFH A;  4R79 A;  3TW6 A;  1XMA A;  1ERD A;  3TW7 A;  2DA3 A;  3K4L A;  3T0Y A;  4ZYD A;  1F1Z A;  2UWM A;  3BT9 A;  1S5L C;  1I50 J;  4EJU A;  2VT2 A;  1B8I B;  4G7H F;  5BPD A;  3C2B A;  1TWA J;  2QSH X;  2CQK A;  1MBK A;  4FIS A;  3BRO A;  2GXG A;  2R7X A;  2DJI A;  2FX0 A;  4AM3 A;  5K1Y A;  2H8W A;  1UHS A;  4Y13 A;  5FO5 A;  2HU9 A;  4OAY A;  3A01 A;  1IN7 A;  5IP9 J;  4F52 A;  2CQ7 A;  4S04 A;  3BCA A;  2LKX A;  4I98 B;  2KKO A;  2QSF X;  1JT0 A;  4CCK A;  4G8X A;  1QVT A;  4OOI A;  4U0V A;  2I8D A; 
#chains in the Genus database with same CATH homology
 1CGP A;  4EJV A;  4OIQ F;  1ODD A;  3E6D A;  3WE3 A;  4CYD A;  4AD9 A;  3E5Q A;  5LEK A;  1FSE A;  4TV7 A;  2GQQ A;  3V8J A;  3C18 A;  2CW0 F;  1FX7 A;  4EM2 A;  4U7D A;  1O57 A;  3CUQ B;  2GZW A;  5ICF A;  1EH8 A;  2XUB A;  2YU3 A;  3J7A O;  1GVJ A;  5JFR A;  2EFW A;  2Y48 A;  4CGZ A;  1RUN A;  2QVO A;  3IHU A;  3BDD A;  2PN6 A;  1U3E M;  5LRR A;  1W7P B;  1FBQ A;  3M7G A;  1R1V A;  2A6E F;  3KLO A;  3HTS B;  1ULY A;  2W57 A;  2BEO A;  3PFI A;  1KQ8 A;  1F5T A;  2VBZ A;  2ZXJ A;  4IPA A;  1XDS A;  2VC0 A;  1BI2 A;  1DPU A;  3ZMZ A;  4LK0 F;  3J81 Z;  3W6K B;  1E2X A;  1P4X A;  3EQL F;  4M71 A;  1T2K A;  2DBB A;  4KYW A;  1V4R A;  2Q2E A;  1XCB A;  2Z5U A;  3CUQ C;  2E7W A;  4L5J A;  2FNA A;  2MBF A;  3ABT A;  3H3Z A;  1IN4 A;  3IL2 A;  1FLI A;  1K6O A;  5CVV A;  2HS5 A;  1KQ9 A;  5LHI A;  1TW2 A;  1UFM A;  1XGO A;  3E5X A;  2MC3 A;  1SMY F;  3KZZ A;  2AS5 F;  3KP3 A;  3QU3 A;  5BPI A;  4BH9 A;  5D6E A;  4RB0 A;  4I02 A;  4A6D A;  4ZYH A;  3J80 K;  1J9I A;  2RKH A;  2L4A A;  5HDG A;  3L2C A;  3F6V A;  1YG2 A;  3F8N A;  4JBA A;  5EEG A;  3BWG A;  3LST A;  4HX7 A;  1OYI A;  5LHG A;  2CYY A;  3ISP A;  2FXA A;  3KE2 A;  2VOP A;  2EWN A;  1C0W A;  3V4G A;  3Q5F A;  3VOD A;  3IWZ A;  2D1H A;  2JT1 A;  1WI9 A;  2OBP A;  3MAJ A;  1ZHF A;  1J5Y A;  1TNT A;  2IA2 A;  5L3D A;  1LEB A;  5L3F A;  2NNY A;  1XGS A;  2M1B A;  3ZMT A;  5HDN A;  2CFX A;  1ZH5 A;  1ON2 A;  3HRU A;  3HTU A;  3GFI A;  3LAP A;  2BBY A;  1FPQ A;  5E17 F;  3GFL A;  1B9M A;  3F8C A;  2M30 A;  4A0Y A;  2CWE A;  1D8K A;  4MNU A;  3GWZ A;  3DPT A;  3ZPL A;  2MA3 A;  4G6Q A;  4MHG A;  3BJ6 A;  2JRT A;  3P9K A;  2H94 A;  3B73 A;  3WTW C;  1XN7 A;  5LEJ A;  3ZN0 A;  3ZP5 A;  4UV8 A;  2ESH A;  4GXO A;  3G3Z A;  1FY7 A;  4KN4 X;  2PEX A;  5CJ9 A;  2KIF A;  1HKQ A;  1T38 A;  2VBX A;  3QPH A;  1FZP B;  3DEU A;  1YIO A;  4YFK F;  1STZ A;  4LLN A;  2XAH A;  2YX7 A;  1BI1 A;  4CZZ A;  1KU7 A;  2OA4 A;  3TKY A;  1P6R A;  1CF7 A;  1B9N A;  1BN5 A;  3F3X A;  1AOY A;  3SFZ A;  2F5C A;  2XGX A;  5DUI A;  3IRR A;  5CVI A;  4PGG A;  2P7C B;  1W4M A;  3Q9V A;  2HTJ A;  1XGN A;  2XAS A;  3EUH A;  2MH2 A;  4HDU A;  4HA8 A;  5BS6 A;  3FXR A;  2IT0 A;  2PMU A;  3REO A;  2Z3Y A;  1B6A A;  5F6F A;  3TGN A;  2ZO4 A;  1OKR A;  3ZMU A;  5ICE A;  2HYG D;  5HLI A;  3ZN1 A;  1QBJ A;  2ELH A;  2P8T A;  4I7H A;  3I64 A;  4A0X A;  4U0Y A;  2UXX A;  3FMQ A;  1ONV A;  3WU1 B;  5F64 A;  2W25 A;  2X0L A;  4ETS A;  2V1X A;  3I54 A;  1QZZ A;  1QGP A;  4KT5 C;  1EV7 A;  4IRH A;  2RQP A;  4LLL A;  3WGI A;  3WU0 A;  3HRT A;  2IA1 A;  4A6E A;  1RIO H;  4RGS A;  5D6F A;  4DNC A;  2K7L A;  2Z99 A;  2QUF A;  5F1R A;  1XDU A;  5L3B A;  5ILU A;  2V9V A;  3E6B A;  4IXA A;  1S6L A;  5LHH A;  4AVP A;  4OIP F;  4HDV A;  3MEX A;  1OYY A;  1ZAO A;  3FXQ A;  1S29 A;  4EM1 A;  1R23 A;  1Z91 A;  3QAH A;  2BGC A;  2P4W A;  1I6X A;  3GVA A;  2FML A;  1WSU A;  3VOE A;  4HZF A;  4BAY A;  3DF8 A;  4N9I A;  2FF4 A;  2J5O A;  3TOB A;  4M6X A;  3BZ6 A;  4NB5 A;  2PJP A;  4KN7 X;  5HVQ C;  2G9W A;  2FBI A;  3J81 K;  1CF7 B;  3QP6 A;  3QP5 A;  1IF1 A;  1TW3 A;  4LFU A;  2DU9 A;  2QM3 A;  5ERI A;  4U0W A;  3ULQ B;  4OMZ A;  1HBX G;  1OMI A;  1IXR C;  4M74 A;  5TRD A;  4XBF A;  4ZZD A;  5K5O A;  1ZG1 A;  3EET A;  4LJZ F;  1X3U A;  1F4K A;  2L4M A;  1HST A;  4KUM A;  2YSR A;  2BYV E;  3DKW A;  1RNL A;  2H6C A;  1Z1D A;  4M73 A;  2DPU A;  1LDD A;  2YR2 A;  3V7S A;  3R4K A;  2MLG A;  1KU3 A;  3V8K A;  4I01 A;  4A12 A;  1TLH B;  1Z6T A;  5AIQ A;  1HQC A;  1TQM A;  4LGW A;  1H9G A;  2KIM A;  1FBU A;  3JSO A;  4KMU X;  3N97 A;  4G94 A;  4N0B A;  2EK5 A;  4KIG A;  3ZMS A;  2QQA A;  1MJA A;  1W5S A;  5E1W A;  2ZFW A;  1YS6 A;  4BYY A;  2F5F A;  4M9Z A;  1KGS A;  1F9N A;  2E7X A;  2DPD A;  4LK1 F;  3CTA A;  1WKM A;  4M9X A;  2E1N A;  3D0S A;  2DAO A;  2BE5 F;  3U1D A;  4HQE A;  2O8X A;  3HSF A;  3TOA A;  5DCM A;  1ZGA A;  1PUE E;  2FE3 A;  4WXD A;  1PP8 F;  5H6R A;  2YPR A;  4A2U A;  3KP7 A;  4GGG A;  5H6Q A;  2QWW A;  4I0A A;  5L3G A;  2HR3 A;  3BJO A;  3BOQ A;  5E8I A;  2CGP A;  4L9T A;  1YW7 A;  5DCM B;  4AIK A;  1HXD A;  3FHZ A;  1TNS A;  3TDU C;  3DFG A;  3GFM A;  1S8N A;  4LLG F;  3PQK A;  1SD4 A;  4Y15 A;  4R1H A;  2FA5 A;  1S3J A;  2VBY A;  4YIF A;  2M8E A;  2O6G E;  4MQV A;  5ICC A;  2VOO A;  1J0R A;  3C1D A;  4F7Z A;  1YW8 A;  4U88 A;  3TO6 A;  1G6N A;  1KQ0 A;  3P9C A;  3F8B A;  2ZKZ A;  4RB1 A;  3E3V A;  3ZMV A;  2R3S A;  3BJA A;  5E18 F;  5D4R A;  3LWF A;  3WGG A;  3I59 A;  2VE8 A;  2IW5 A;  3GXO A;  5HLG A;  3MWM A;  1MDM B;  2A68 F;  2Y0M A;  3RDI A;  3VFZ A;  3JTH A;  4FT8 A;  4L9V A;  5HOO A;  3LA2 A;  5DUK A;  3T8R A;  1OR7 A;  2PFB A;  4XLP F;  2GA2 A;  4IF4 A;  3NRV A;  4G7Z F;  4WWC A;  5D5U B;  4ASN A;  4ZZL A;  2IA0 A;  3M9A A;  1LEA A;  2L3D A;  2EJR A;  1K79 A;  3QOP A;  5L3E A;  1U78 A;  2FMY A;  2LNB A;  2VE9 A;  1QPM A;  2PI0 A;  2M87 A;  4HOB A;  3KCC A;  5FLX Z;  2IPQ X;  2OAZ A;  3I58 A;  4AIJ A;  1ZG5 A;  3O2P E;  1MDM A;  3BPV A;  4UNO A;  2FBK A;  3NQO A;  4GCV A;  4WK8 F;  5DYM A;  5D8L B;  3JAM K;  1JXS A;  1GHC A;  1FP1 D;  2V6C A;  4P9F A;  3GFJ A;  1T98 A;  2LF7 A;  2ZME A;  4HLY A;  5HS9 A;  1RI7 A;  3FM3 A;  4O3M A;  3LA3 A;  1QO0 D;  1B1B A;  1W7P A;  2WTE A;  1R5H A;  1XCV A;  5EEH A;  3HHG A;  1DDN A;  4O6J A;  2EB7 A;  3WTX C;  1RZ4 A;  1KYZ A;  1P4A A;  3HRS A;  1I1S A;  1HW1 A;  2F2E A;  1BOA A;  1K78 A;  4NQW A;  2RN7 A;  2XKO A;  3CDH A;  2DK5 A;  4FHT A;  2PLY A;  1V3F A;  2JTV A;  1R1T A;  2A61 A;  1J59 A;  3RTR A;  3KLN A;  2DK8 A;  3S2W A;  1J2X A;  1R1U A;  1I27 A;  2CSO A;  2FNP A;  1IZ1 A;  2K02 A;  4G7O F;  5D5W B;  4OU0 A;  2HEO A;  1HW5 A;  1ZRD A;  1JGS A;  2LKP A;  1IN5 A;  3N4M A;  1OYW A;  4EJW A;  2D2W A;  3JSP A;  5TJJ A;  5AON A;  1YS7 A;  2K27 A;  5J8C A;  5FLX K;  1TTY A;  2QEN A;  3P7N A;  1MGT A;  3HUG A;  5HDK A;  1QNT A;  4RS8 A;  2D45 A;  2TDX A;  2XV4 S;  3DQV C;  3G73 A;  2DW4 A;  2O0Y A;  3L09 A;  4QWQ A;  4IHS A;  4RB3 C;  3HOS A;  1I5Z A;  2IVM A;  1IRF A;  2WV0 A;  5D5X B;  3LQR A;  1BI3 A;  1FSH A;  2RNJ A;  4BHC A;  5E1Z B;  1U5T C;  4BHB A;  4HF0 A;  4ESF A;  3GX4 X;  1LDK B;  4OIR F;  3CO7 C;  2ISY A;  1IUY A;  4YFN F;  2RV8 A;  1XSD A;  1B59 A;  5D4S A;  1ZRC A;  2BV6 A;  3WTV C;  1FOK A;  5K5Q A;  1P4W A;  4A5M A;  1XMK A;  5LLQ A;  1R58 A;  2PMH A;  3F23 A;  3L00 A;  2XAG A;  2VOD A;  4EM0 B;  4MTE A;  3TQN A;  3SZT A;  3GLX A;  4GYI A;  4HV5 A;  3M8F A;  4LB5 A;  1ZN2 A;  1Z9C A;  2MD5 A;  4HV6 A;  1YO5 C;  1FT9 A;  1RUO A;  2QQB A;  2K4B A;  4OIO F;  1JHH A;  4HAM A;  3U9G A;  1U5T B;  1ZLK A;  3MZH A;  3KP6 A;  1KU9 A;  2R7F A;  3C3W A;  5A2Q Z;  4KFC A;  4WF2 A;  2COM A;  4XLN F;  2RDP A;  2QQ9 A;  2PBI A;  4HX4 A;  5IT9 Z;  4KNY A;  4N9H A;  2RGV A;  3I0T A;  4RB2 C;  2OU2 A;  1IN6 A;  2KIU A;  3I5U A;  1WWX A;  4HLX A;  2UXN A;  3R60 A;  2L02 A;  5D8K B;  1R7J A;  2HKX A;  2O03 A;  4XRF A;  3HSE A;  3GZ6 A;  1KU2 A;  3WTZ A;  3KEO A;  1P2F A;  3IKT A;  5LGN A;  2A5Y B;  2NAZ A;  5JHU A;  4FX4 A;  1Y0U A;  3IRQ A;  2A69 F;  2ACJ A;  1MJ9 A;  2VXZ A;  3ZMD A;  3HIF A;  4PCQ A;  3NEU A;  5ED4 A;  1BM9 A;  1XGM A;  1L3L A;  2GIV A;  1L0O C;  3DPL C;  3I59 B;  4G9Y A;  2RVC A;  3GEZ A;  5HS8 A;  3VB2 A;  4ENJ A;  3I71 A;  2LSO A;  4P9U A;  5JVT A;  4JK1 X;  4GYG A;  3BY6 A;  4RGR A;  4GO1 A;  4IHT A;  3ELK A;  3LA7 A;  5FD6 A;  2QBY B;  1Q1H A;  1GXQ A;  3WGH A;  3WG9 A;  4LMY A;  1OPC A;  3GYH X;  1IN8 A;  4BNC A;  2EFN A;  3IC7 A;  1W5T A;  5H20 A;  4OIN F;  5ICG A;  2X4H A;  3D5L A;  2OZU A;  1DUX C;  2GAU A;  1IW7 F;  2XAQ A;  4Q47 A;  2A6H F;  1D3Y A;  1UCR A;  2CG4 A;  2HZT A;  1IRG A;  4M6Y A;  3T5X A;  4K2E A;  4WXH A;  1FWZ A;  4HX8 A;  3FXU A;  3JW4 A;  3M1E A;  2XVC A;  3COA C;  2VON A;  4OMY A;  3FMS A;  2E1C A;  1D5V A;  3ERE D;  1U8R A;  3IKV A;  1JHF A;  2HGC A;  4HBL A;  2HOE A;  4P96 A;  3CLO A;  5DD8 A;  5DDG A;  1T0F A;  2OQG A;  3ML6 A;  4LG0 B;  4CXF A;  4Z2Y A;  1AWC A;  1ZAR A;  1SD5 A;  5E20 A;  5J8F A;  1BBY A;  2F5E A;  1D8J A;  3TDZ C;  1PP7 U;  2J5P A;  3LAJ A;  3KP4 A;  4WXC A;  2MLK A;  2V1U A;  3CO6 C;  3QRF F;  3KZY A;  3B02 A;  3FMR A;  3VEP A;  2KJB A;  1U6G A;  1S7O A;  1J75 A;  2C6Y A;  3RJP A;  4MQ9 F;  4M72 A;  3T8T A;  1YLF A;  2DQL A;  2A3S A;  2QZ8 A;  2WWY A;  4IRG A;  3R0A A;  1SAX A;  4ON0 A;  3R0J A;  3CUO A;  5KVR A;  2L54 A;  1Z05 A;  3PQJ A;  1G4D A;  4Q5S F;  3TO9 A;  2NRA C;  1XB4 A;  1IXC A;  4ESB A;  5D5V B;  1H9T A;  2Z33 A;  1Z6R A;  4MEY F;  2L01 A;  3HRM A;  2EV0 A;  1T6S A;  4A5N A;  2DT5 A;  1JE8 A;  2VBW A;  1LJ9 A;  2H27 A;  3KP2 A;  1EH7 A;  3RPQ A;  3F21 A;  4ENN A;  4EJT A;  3HSR A;  2QLZ A;  2FOK A;  3L9F A;  4L0Z B;  3KP5 A;  1G3T A;  3ECH A;  3ABU A;  3KET A;  1BI0 A;  1BJA A;  2VN2 A;  4PZJ A;  2FU4 A;  4CIC A;  4XSZ F;  4P55 A;  5ILV A;  2FRH A;  3F6O A;  1YYV A;  4L5I A;  1SFX A;  2MH9 A;  1SFE A;  3GW2 A;  3FZV A;  1O3T A;  3KEQ A;  2EFP A;  4MGR A;  2EV6 A;  4ENK A;  1R00 A;  2KJC A;  5K5R A;  3BPX A;  2IP2 A;  2LF8 A;  1U2W A;  1G3Y A;  1S7A A;  3EDP A;  3WTU C;  1REP C;  3MFK A;  3W6J B;  2NNN A;  5LGT A;  2H09 A;  2ETH A;  1FNN A;  2AXL A;  4KMF A;  1H0M A;  3R6S A;  3OV8 A;  3RKX A;  3K1P A;  1LQ1 A;  1HKT A;  2ZNY A;  3K69 A;  5J6X A;  2DLL A;  4EV0 A;  2K4J A;  1ZRE A;  2IRF G;  2P5V A;  3C7J A;  2P6S A;  2EFO A;  4PDK A;  1BC7 C;  1VTN C;  4MEX F;  4YG2 F;  3WTT C;  1IXS B;  2EFQ A;  3ZQ7 A;  2D1V A;  5CYV A;  3CUQ A;  3FX3 A;  3P9I A;  4EGY A;  4I09 A;  4E70 A;  2P5L C;  3FM5 A;  1MKM A;  2K86 A;  4R8H A;  3TO7 A;  4S05 A;  3F8M A;  2ZBK A;  3RYR A;  3WE2 A;  5HLH A;  4I2O A;  4DQ2 A;  3QPT A;  3I4P A;  2GWR A;  2M45 A;  4Y17 A;  5E8G A;  6PAX A;  3EYY A;  2ZNZ A;  2PG4 A;  3MZY A;  1LNW A;  4U7B A;  1ON1 A;  1O3R A;  4NHJ A;  4QLC U;  4MTD A;  5FD5 A;  3K9T A;  1O3S A;  2G7U A;  3K0L A;  4L0Y B;  1LVA A;  4G6D A;  4O5V A;  5JR3 A;  5FGM A;  3IWF A;  1U5T A;  4UV9 A;  1EH6 A;  2P6T A;  1TQI A;  3K1N A;  4BQA A;  1A04 A;  1FP2 A;  2HQN A;  2NS0 A;  5HS7 A;  3GF2 A;  2H6B A;  4WX9 A;  3F8F A;  3J80 Z;  4RGX A;  2JSC A;  1BC8 C;  3RIR A;  2ZME B;  5DV5 A;  1DP7 P;  1R36 A;  1R22 A;  1B4A A;  5CVR A;  2PQ8 A;  3HYI A;  5A2Q K;  2W84 A;  2XIG A;  4KIC A;  3L7W A;  3EYI A;  2STW A;  3RKY A;  3K2Z A;  1FC3 A;  2OQR A;  4JQF A;  4UHT A;  1K78 B;  1HW2 A;  3WTY C;  3F22 A;  4EJO A;  3LQQ A;  5LGU A;  5BOX A;  1YW9 A;  2GA1 A;  5DD4 A;  1GXP A;  4L9N A;  3H3U A;  3DV8 A;  2HYF A;  3GO5 A;  1YQA A;  3M8E A;  5IT9 K;  1IAW A;  4A0Z A;  4CHU A;  3RPU A;  1ZGJ A;  1Z7U A;  4EGZ A;  2KRF A;  3FWE A;  2CO5 A;  3I53 A;  2Q8K A;  1TBX A;  5CVJ A;  2DO7 A;  4FX0 A;  3T1B A;  2DTR A;  4XSX F;  3JAM Z;  2RC4 A;  1XD7 A;  1R5G A;  1FYM A;  2JPB A;  4KIF A;  2F5D A;  2JPC A;  2IJL A;  1QZY A;  1LDJ A;  4P5O A;  5BQT A;  2DQR A;  3DP7 A;  2O61 A;  4B09 A;  1USS A;  1FBS A;  2M5W A;  1SD6 A;  2ADU A;  4LG0 A;  4IRI A;  5DCF A;  3FF5 A;  1MD0 A;  2ISZ A;  4YII A;  4M9S A;  2B0L A;  4H0E A;  3V7C A;  2XAF A;  3H92 A;  1W7P D;  2XRN A;  2DI3 A;  2ESN A;  3E6M A;  4BXU A;  2V1D A;  3DXJ F;  4ZYE A;  3Q9S A;  1HKS A;  2EA4 A;  4D0P A;  1KA8 A;  2O3F A;  3SHF A;  2FQ3 A;  3WOD F;  3MQ0 A;  1UB9 A;  4ZH4 F;  3ROU A;  2W85 A;  2LDU A;  5E1X A;  1UST A;  2NYX A;  2STT A;  4KA4 A;  3SXY A;  1YFH A;  5FFZ A;  5LRS A;  5AIP A;  4LD5 A;  1YTY A;  4AIH A;  1ZG3 A;  2ZCW A;  1FYL A;  2HWV A;  3E97 A;  2OZ6 A;  4PGH A;  1G3W A;  1BIA A;  2HKO A;  4B8X A;  3V8L A;  3HOT A;  5FFX A;  2HQR A;  4CO8 A;  5DEQ A;  3O6B B;  4YFX F;  1SMT A;  5JI6 A;  3MCZ A;  2YX4 A;  2Z9O A;  1HSJ A;  3CJN A;  5IT3 A;  3E6C C;  2FEZ A;  3RYP A;  3RKW A;  4KIB A;  1MJB A;  1XSX A;  2Q0O A;  2G7H A;  4EQQ A;  4LB6 B;  3O3K A;  3SZP A;  2EA2 A;  2P5K A;  1UHW A;  1O7F A;  3SQN A;  3U2R A;  1PDN C;  2P7V B;  1J7K A;  2UZK A;  4ENM A;  3QU6 A;  3E5U A;  2WC2 A;  4L18 B;  1UHM A;  1FYK A;  2V79 A;  2DFI A;  2OD5 A;  2VC1 A;  3KFW X;  1KYW A;  3GUD A;  4IJA A;  4RAY A;  4BHP A;  5FB2 A;  3HHH A;  4UVA A;  3K1M A;  4HF2 A;  1MZB A;  1LB2 A;  1WQ2 A;  4HYE A;  4EVI A;  1O3Q A;  3LFK A;  5CLS A;  2QYO A;  4UXN A;  2XRO A;  2R7D A;  4UVC A;  2A07 F;  2QBY A;  4IVN A;  4KDP A;  1ZLJ A;  3V7R A;  1T39 A;  4CDG A;  4Q48 A;  4I0B A;  2HTS A;  4UVB A;  2XAJ A;  2W24 A;  4ESJ A;  1P92 A;  5LBQ A;  1O7L A;  1TQP A;  2VT3 A;  2GXB A;  5L3C A;  3WTS C;  3F72 A;  3BP8 A;  1BIB A;  4ZYG A;  1XSV A;  3OOP A;  5ILS A;  4Q4Z F;  4EMS A;  1QQI A;  4UUV A;  1SD7 A;  5KK1 A;  2Y75 A;  4WCG A;  1NHA A;  2XKP A;  1ZYR F;  4L9J A;  1DPR A;  2JZY A;  3JTG A;  2HDC A;  1WRJ A;  1I1G A;  4RAZ A;  2FBH A;  1SFU A;  1ZRF A;  4HQM A;  4RGU A;  5BMZ A;  5CVU A;  2EV5 A;  3R61 A;  2XHK A;  4AWX B;  1E17 A;  3GZ5 A;  3RI4 A;  1K7A A;  2FSW A;  4HF1 A;  1G3S A;  3ECO A;  4HW0 A;  2ZJ2 A;  2HFH A;  4R79 A;  1XMA A;  3T0Y A;  4ZYD A;  1F1Z A;  2UWM A;  4EJU A;  2VT2 A;  4G7H F;  5BPD A;  2CQK A;  3BRO A;  2GXG A;  5K1Y A;  4Y13 A;  5FO5 A;  1IN7 A;  4S04 A;  4I98 B;  2KKO A;  4G8X A;  3AAF A;  4OOI A;  4U0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...