2YU9J

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yu9J00
2DA3A 3HB9A 3ZQIA 2GLOA 4AYBN 4B4CA 3CDLA 5IP9J 3GTGJ 2DJNA 5IOYA 3HOZJ 1U9OA 4XIDA 1PUFA 3CMYA 2X6OA 2GBYA 2R5ZB 1ITYA 3G1OA 3M4OJ 2FX0A 2K9SA 3TEDA 4FTHA 2R5ZA 3ZQLA 5F0HA 3S1RJ 3BG3A 2L7MP 1FIAA 2ID3A 2R5YA 2CJJA 2N8GA 3QPLA 3G1MA 2DA1A 4B3AA 4C3IJ 4HNVA 4XRSA 1JT6A 4IHYA 5BNGA 2CUEA 1IDYA 2XPUA 4FE7A 2FD5A 4LOCA 4JX5A 3JREA 3W6VA 2EH3A 1MBJA 3OIOA 2X48A 5E3NA 4XICA 5FKNA 1YRNA 5FJ8J 4A3MJ 1BJZA 1WH5A 1BW6A 1TWHJ 3HGGA 5E3OA 5EGOB 4AC0A 5EDNA 3UKGA 1LE8A 1X2NA 3Q0UA 2CQXA 2EZHA 4MIMA 2XB0X 2WB1N 2COBA 1JUPA 2EZIA 2QCOA 1JUSA 3JRHA 3FIWA 5FKLA 1VF9A 1JGGA 5DTDA 3PO2J 2L7ZA 1HCRA 2Y31A 1TC3C 1A5JA 3WHBA 2ECBA 2M34A 2JA7J 3LSRA 1T56A 1GT0C 1VI0A 3VPRA 2WAQN 3OSGA 3HGYA 2DA6A 3G1LA 2XGEA 3HEFA 3LSJA 5F04A 4C3JJ 1B72A 4IHVA 5M3MJ 5DS9A 1GV2A 3JRBA 1WGXA 2LFBA 2LVSA 5GPCA 4M3GA 5F0FA 3GTQJ 1QRYA 3S16J 2K40A 1FTTA 1RKTA 4Y52J 5FKMA 4B1RA 1MH3A 2Y2ZA 1Q1VA 1AHDP 5J1RA 3GTKJ 2XRLA 4A3CJ 4GFBA 4JX6A 5J1UA 1A6IA 2EBIA 4L5EA 4D7NA 1ZKGA 4I76A 1HF0A 4BXXJ 1XC5A 4BBRJ 2I10A 1RESA 2VI6A 5EG0A 2JWTA 5K7FA 3SFIA 1K83J 3TP0A 1U8BA 5M3FJ 4FE4A 3SJMA 5EZGA 5EF6A 1JKQC 1JKRC 1ETYA 3C2BA 2R7ZJ 4UUSA 3HOVJ 1TWFJ 2LD5A 3JRAA 1JKOC 3I4NJ 2DMUA 5IOZA 2LK2A 2NS7A 5JLXA 1SFOJ 1ZGWA 3HOUJ 2CQQA 5C4XJ 5E3MA 5JLWA 2IBDA 1JT0A 1AKHA 3L1PA 1POGA 1ZTRA 3Q0VA 4IHXA 2XGCA 3LNQA 4BKXA 1PUFB 2FQ4A 1W0UA 1MSEC 1UMQA 5M5WJ 1CQTA 2ID6A 3BT9A 3S2HJ 2L0KA 2LTPA 3S15J 2O7OA 4JX4A 4G12A 3Q0WA 4A3DJ 1ZR2A 1H8AC 2JA5J 2AO9A 2R5YB 4W1UA 3IH2A 2Y9ZA 2YUSA 1RKWA 2R93J 2IAIA 3BG9A 5FLVA 5F27A 1HDDC 3BTJA 3JRGA 3S1QJ 2X9DA 1WCMJ 2TCTA 1I50J 2TRTA 5HODA 1I6HJ 5K7HA 4DYRA 5J3LA 4X6AJ 2H1KA 2JJ7A 3BTCA 1UHSA 1YRNB 1ETXA 4X1EA 4Y7NJ 1IRZA 3F0CA 4FCYA 1OCTC 5M5XJ 2QF7A 3DCFA 1LE8B 3S17J 3BR0A 1WPKA 2JN6A 2OPTA 1XS9A 3HOYJ 3S14J 4A3LJ 3CQZJ 4FISA 1RETA 1FJLA 3ZQFA 1OCPA 4M3EA 2NVYJ 1WI3A 3BQYA 3FK7A 3HBLA 4BY7J 1E3OC 1BA5A 4XRSG 4XK4A 1H88C 1Z0XA 3BTIA 2HXIA 3FK6A 1IG7A 4XRMA 4A93J 3ZOBA 3B6CA 4DYQA 3ZQCA 2O9LA 3IH3A 3K7AJ 4V2FA 1B72B 3PO3J 1ETOA 3RKQA 3WHCA 4MFEA 1QVTA 2NVQJ 4ABZA 3H0GJ 4M6VA 3H3VK 4MFDA 5IYCJ 2HOTA 5IYDJ 1D5YA 2K9QA 2R92J 4IEJA 4DYCA 3JRFA 3NARA 5C4JJ 2K9NA 4V2GA 2EZLA 5M5YJ 3GTMJ 5C3EJ 1BW5A 1MBEA 1B8IA 2IEKA 4A3GJ 4JYKA 2HYJA 5F0CA 4D5FA 4DW6A 2HXOA 3CCYA 1ENHA 2FJ1A 2LLKA 3BR1A 4CYCA 3OOUA 2CU7A 5EG0B 4W97A 4DZPA 4QIWN 1ETQA 2VPRA 3QPSA 3QQAA 1XG1A 4RDUA 1JJ6C 1BL0A 3A03A 3NAUA 1IDZA 5FLMJ 4UUSB 1S7EA 2O8KA 3DEWA 2MW8A 3S1MJ 3I4MJ 3HOXJ 4A3JJ 1TWGJ 2E2JJ 3BR5A 1SANA 3A02A 4EEFG 1K61A 4M3FA 1FIPA 2H8RA 3B6AA 1APLC 1AKHB 1MBGA 2OF7A 2D5VA 2LR8A 4A3FJ 2KDZA 3MKLA 1X58A 2JA6J 3A01A 4I6ZA 3TP3A 4A3KJ 1MBKA 1NK3P 3SDGA 2GM4A 4C2MJ 2RAEA 2AHQA 2EQRA 2JK3A 4D5CA 4S0HB 3BR2A 5IP6A 2MG4A 1GUUA 1JUMA 1JTXA 1HOMA 2DA5A 3BR6A 4DZJA 3IV5A 1T33A 5F1JA 2DA2A 1ZQ3P 4M3BA 3BTLA 1R9TJ 1DU6A 3LOCA 4RBOA 1ZK8A 3BR3A 2M0CA 3JRIA 1GV5A 5EZHA 2L7FP 2ME0A 2CUFA 1JJ8C 3E7LA 2HOSA 3M3YJ 1NK2P 2DTZA 1DU0A 1JTYA 2ELKA 1U9NA 1VNDA 1MSFC 3JRDA 4A3EJ 1ETVA 1GVDA 2P81A 1U78A 2NOGA 1F43A 1Y1WJ 2EZKA 2L9RA 2XB5A 3MVPA 1EF4A 2G0EA 3GBGA 1HLVA 4IHWA 1O4XA 2XPWA 5FKKA 3GTLJ 1JKPC 2DMPA 2Y9YA 2HOAA 3HM5A 1G2HA 1OJLA 2VUMJ 1P7IA 2E2IJ 2ZB9A 4UUTA 1HDPA 5EGOA 4QSHA 3GTJJ 2DA4A 2NVTJ 2HDDA 2YS9A 4M3DA 3IH4A 3FISA 1P7JA 3RZOJ 2LKXA 5GPAA 1IJWC 1GDTA 2HQ5A 3LSPA 1IC8A 1MNMC 2YU9J 5E3LA 1MH4A 4QTRA 3MN2A 3PM1A 5J1YA 2NS8A 2E1OA 4BY1J 1AU7A 4AUXA 3TW7A 2PMZN 1F36A 2B63J 5F08A 3RQIA 1B8IB 2HI3A 1MBHA 2CRGA 4D7MA 2DMQA 4BBSJ 2ECCA 5FKOA 3BG5A 3FKIJ 2VKVA 5IYBJ 4CYCB 2Y0SN 5C44J 2MGQA 1ETKA 2Y30A 1RR7A 9ANTA 1IUFA 5EYRA 2DN0A 2R0QC 1UG2A 2ME6A 1QVUA 1TWAJ 4MO7A 4MLOA 4J19A 4JP0A 2M2EA 2M9HA 2KT0A 5IPAA 2JMWA 3RZDJ 2WV1A 1IV6A 2DA7A 3BQZA 5IP7J 3GTPJ 3HOWJ 1OFCX 3TW6A 1W0TA 2JA8J 3S1NJ 5GP9A 3K2AA 5EEAA 1LFUP 3HDDA 2E2HJ 2LY9A 1IGNA 1FTZA 1I3QJ 1ZR4A 2LP0A 3OSFA 3LSGA 3Q3SA 1ORKA 1LFBA 1Z77A 4A3IJ 3A01B 1RPWA 3ZQHA 2MSYA 2XPVA 2NVXJ 1NTCA 2E19A 4A69C 3JR9A 3O8GA 4C3HJ 2W48A 2DMNA 3D1NI 4A3BJ 1Y1VJ 2M8GX 5K7ZA 1WH7A 3S2DJ 2DMTA 3JRCA 1FEXA 1H89C 3ZQGA 4NDLA 1QPIA 3GTOJ 2VKEA 3O8HA 2XGDA 2XSDC 1ETWA 3HKZN 1VFCA 1X2MA 1MBFA 1TWCJ
chains in the Genus database with same CATH superfamily
5FD5A 1GXPA 1KU7A 1P4WA 2LKSA 1VQ7I 4HNUA 2ISZA 2V79A 3ZQIA 4G6TB 3K0LA 3J7AO 4PFOA 5IOYA 4L0ZB 1TTYA 3HOZJ 1U9OA 3CCQI 3BC8A 3JCUC 3JAMZ 3CMYA 2R5ZB 3G1OA 2DYSH 5DCMA 2FX0A 3TEDA 3NRVA 4CCKA 2R5ZA 4ESJA 2KZVA 4EMSA 5F0HA 3WTSC 2DOFA 3QOPA 2JVHA 3BG3A 5DCFA 2L7MP 3ZMTA 1FIAA 2R5YA 4OIPF 4GRIA 1P6RA 4B3AA 4C3IJ 2B7EA 4A2UA 1JI8A 4EM1A 5E79C 3CDIA 3KP5A 4WCGA 3GLLA 4JX5A 2GIZA 4IF4A 1E3PA 5FKNA 2FNPA 3T8RA 1YS6A 3F21A 1WH5A 2YU3A 2M5WA 4XBFA 4F92B 4KITB 5J6XA 4CGZA 2O5RA 2ZXWH 5EDNA 3CUOA 3PFIA 1ZAOA 4AD9A 5ED4A 1X2NA 4R8HA 4KMUX 4MIMA 1K6YA 3LA7A 3V8LA 2WB1N 3BG7A 3GFJA 5LGTA 2QCOA 1XD7A 2JRTA 3IKVA 2LC2A 3B02A 2DTRA 2HQRA 4U0WA 2KFDA 4BH9A 3KETA 2P7CB 1VF9A 3WGIA 4I09A 5DTDA 4BAYA 3AG4H 2EFWA 3VEPA 4XM3A 3GZ5A 2A6HF 2EV6A 3W6JB 3BWGA 1A5JA 5DDGA 3PQJA 2JA7J 3LSRA 2ESNA 2CW8A 3K1NA 4XRFA 3ULQB 2MC4A 3HEFA 4IHVA 1WJCA 2ZJ2A 4C3JJ 2HPMA 4M73A 2BY2A 1BOAA 1Z3XA 3GO5A 4HF1A 4OMYA 4RLQA 2Q8KA 3T1BA 1N78A 4PSWA 2LVSA 3EETA 2E7WA 4HLYA 1OLTA 2X85A 4M3GA 1BM9A 3PSIA 3CDHA 3V7SA 4BE1A 2L7KA 3GTQJ 4HNTA 3FKJA 2LF8A 4Y17A 4LLGF 2E1MB 2DW4A 5FKMA 4CZZA 1R1UA 2GQQA 3H35A 5D6EA 3MEXA 1U8RA 1RUNA 3U2RA 2VKDA 4G7ZF 5K5OA 3GUDA 3FXQA 3GTKJ 2CYYA 3ZCOA 4UB6C 4L9JA 2RQQA 2HOEA 3KP6A 3HRMA 4ENMA 4LB5A 1HF0A 4LD5A 4BXXJ 2I10A 1HQCA 2AQFA 3EYIA 2JWTA 2LRDA 3DQVC 1FYMA 4G9YA 5M3FJ 1SFKA 5EZGA 2CV0A 1JKRC 1ETYA 3L09A 4MNUA 3KLNA 3LA2A 2R7ZJ 3M7GA 4AVZA 3KCCA 5LLQA 3GMEA 1VQ6I 1BOBA 2K4BA 3CCSI 5CVVA 4MEYF 2DMUA 5IOZA 2A6TA 3ROUA 1ZH5A 3HOUJ 4HF0A 1P2FA 5E3MA 1JT0A 1ZYRF 1POGA 1OR7C 1Z67A 2WY7Q 1YW9A 3Q0VA 2EFPA 4A6DA 4CXFA 4BKXA 1PUFB 1LDKB 1W0UA 4PJLA 3RQ4A 2FUG2 2ID6A 2DDAA 2F48A 1TQMA 4ZYAA 1E17A 1YQAA 4ASNA 4EGZA 3EQLF 4G12A 2QM3A 1ZR2A 1MZBA 3V4GA 1Y0UA 3EDPA 1H8AC 1WJAA 2AO9A 2M7BA 3IH2A 1Z6RA 3MFKA 2LG4A 2Y9ZA 2R93J 3BG9A 5FLVA 1ZGAA 1HDDC 2KRHA 2F4IA 4FQGA 3S1QJ 1TW3A 4BDYA 5HLTA 1WCMJ 1I50J 3OYCA 2TRTA 2HZTA 1KZHA 4BNCA 4IKFA 4ZTJA 1SAXA 2FRHA 1O3RA 4A0YA 2JQ7A 4ZJZA 3DTIA 4CUGA 3BY6A 1IRZA 3AL0B 3U1KA 3RSNA 4OAZA 5LGUA 5M5XJ 2JTVA 4DGWB 1QQIA 5HDKA 1WJDA 3ASOH 3F22A 3V8KA 1IXSB 2EV5A 2JN6A 5HOOA 1T39A 2VE9A 1IN4A 1R5ID 1KQ9A 3QPTA 2HS5A 1XS9A 1J5YA 1MMDA 3CQZJ 3VSKA 1FYKA 3TDZC 1DP7P 1FJLA 1ZRFA 1OCPA 1FYLA 4PCQA 1V5GA 3H9QA 4YFXF 2NVYJ 1WI3A 1FBUA 2EIKH 4GDFA 2XHKA 3BQYA 2L9SA 3HBLA 1E3OC 4CICA 2YX4A 3OR1C 4CSWA 2HEOA 1LFPA 1TQIA 4QPQA 3BTIA 4CHUA 1WJFA 1LQ1A 3DKWA 3CUQB 1MMNA 1ZARA 1XSXA 3C2HA 3ZQCA 1VQ5I 3CUQA 3IH3A 3VYSB 1FSHA 4V2FA 1U3EM 3L00A 2IJLA 5B66C 3WHCA 3Q9VA 4MFEA 1QHHD 4ABZA 2DCEA 3RPQA 3H3VK 5IYCJ 3H5RA 5ILVA 5H2FC 2VC1A 2KIMA 1MD0A 2R92J 1RRJA 3R6SA 1MDMB 4KNYA 1OPCA 3K4JA 5C4JJ 2MABA 1DGRM 4V2GA 4CCMA 1S6LA 2EZLA 5LD2C 2P6SA 1MBEA 2IEKA 5FLXZ 3PL8A 2QKMB 2XDVA 1EA3A 4IOAF 4EJTA 1I3AA 2XGXA 4Q5SF 2VT2A 3KP2A 1QZZA 2A69F 1ENHA 4A12A 3AFHA 2DAOA 3PQKA 3BG6A 3BR1A 5TGTA 5CVIA 3CP2A 2NYXA 1OQYA 2DPUA 1K78A 4W97A 3KYLA 4DZPA 1XGNA 4U7BA 4P9UA 4XLAA 3RCOA 5KNLA 2QKLB 3CMAI 5FLMJ 1B9MA 1FSEA 2KLOA 4Y15A 1LUJB 3GZ6A 3I4MJ 2E2JJ 1YOVB 3SDBA 3FXKA 4BE0A 1SANA 1QZYA 5J40A 4MTEA 4M3FA 2LDUA 1T95A 3SFZA 3BZ6A 1PP8F 1NH3A 4AIHA 3TDUC 2LBFB 4L18B 3A0BC 3ISPA 4PGGA 2K9LA 5AIPA 3QPHA 3L2CA 1IN5A 3MQ0A 4E7KA 2WV0A 2EPFA 1S8NA 3P9IA 3S3OA 3QAHA 5CPRB 4I6ZA 3TP3A 5CJ9A 1MBKA 4FT8A 2A6EF 1NK3P 1D0ZA 5KVRA 2YR2A 1FC3A 4C2MJ 2RAEA 2AHQA 2ZC2A 4H0EA 1ULYA 3AG3H 2JK3A 4ZYHA 1R71A 4DIQA 1G3YA 3JW4A 2MC3A 1GLNA 1GUUA 2ZBKA 1CF7A 1O7LA 2OC6A 3CC7I 2V6CA 2DA5A 3KFWX 4E7SA 4FHTA 2ZJRF 3IV5A 3Q5FA 4TV7A 3BTLA 4BQQA 1JHFA 4KA4A 1YFHA 1SVOA 1DU6A 5CKTA 4XKVA 3GFMA 3TQNA 1HW5A 2DT5A 1L3LA 2D1VA 1GV5A 3LSMA 2VIXA 3K69A 2E71A 3K9TA 3QP6A 2LY2A 3E7LA 4HX4A 3F23A 2ADUA 1JTYA 2ELKA 2MLKA 1MSFC 3QWLA 3EUAA 1MMGA 3CP8A 4WF2A 5J4VA 1F43A 2EZKA 3KYCB 3MVPA 1SFEA 3W2AA 3ZPLA 2F5FA 1YI2I 1O4XA 1U5TB 4U0YA 5E8GA 2DMPA 2Y9YA 3H5NA 1N25A 3IRRA 2VUMJ 2E2IJ 2FU4A 2JRMA 3IH4A 1P7JA 3RZOJ 1K4SA 5DUKA 2EK5A 3CJNA 2LKXA 2L02A 1IJWC 3BOQA 2BOLA 4RB0A 4IO9F 1GDTA 1IC8A 4HQEA 4BS9A 2R7OA 3GWZA 1D1AA 1XDUA 3MN2A 4I7HA 5H6RA 2CV2A 2QSHX 1USSA 4LGWA 2VQGA 3MZHA 4G6DA 4ITVA 5L3CA 3FMQA 3ELKA 4AUXA 3OYJA 3TW7A 2PMZN 1F36A 5F08A 1GVJA 2BY1A 3GVAA 1MBHA 4PUSA 3QYFA 2XAUA 3MZ8A 2DMQA 4C2UA 4HQMA 2MBFA 1D1CA 2ZSHB 3B73A 1X3WB 4OMZA 3RJPA 2RN7A 4BQNA 3F8MA 5L3EA 1T38A 2WC2A 3NWTA 3FKIJ 2CFOA 3K70C 4BEHA 2XASA 4GGGA 1J0RA 5B5EC 2QSFX 2Q2EA 5DD4A 3FXLA 2Z5UA 4KICA 3MKZA 3N05A 2M1BA 1OKRA 2R0QC 2HPIA 3P9CA 1UG2A 1BC8C 1CGPA 2JVGA 3FMSA 2ME6A 4RGRA 5LEJA 1REPC 1TWAJ 2V9VA 4LFUA 1IN7A 1EV7A 4PJMA 4J19A 4R1HA 3DBRB 1OMIA 2JPBA 2KT0A 2M9HA 4B44A 3IUOA 5IPAA 2JMWA 3CCMI 1K6OA 3IHUA 5DUIA 5IP7J 1U0JA 1UELB 4OU0A 3S1NJ 2JT1A 2VXZA 1TNTA 2BXZA 3QYBA 3DBHB 2O6GE 2E2HJ 2LY9A 3HDDA 3L2VA 4BHCA 1Z77A 3ZQHA 2MSYA 2XPVA 2NVXJ 4E7JA 2UXNA 1VQ9I 3HYIA 2VN2A 3O8GA 2LYCA 4EM2A 2DMNA 3D1NI 3SYTA 1FMVA 1WH7A 5K7ZA 1B1BA 2KISA 2V1NA 4LK1F 3ECHA 4L9VA 4NQWB 1ETWA 3HKZN 1X2MA 3BJ6A 2NNNA 2DA3A 1TWCJ 4B43A 4HLXA 3ERMA 4CCOA 5L3GA 3L2UA 4XLHA 3F8CA 4B4CA 3MMYB 4KMFA 3KEOA 2DJNA 3ZP5A 3HZJA 4XIDA 2X6OA 4A0ZA 1Y8QB 3JTGA 4FTHA 3ZQLA 1ZN2A 2HNHA 2K27A 3VB2A 3S1RJ 4KISA 1WFXA 2PMUA 4JOMA 1D0YA 1WWXA 2N8GA 2W24A 3QPLA 3G1MA 4XRSA 2E60A 1JT6A 3IWFA 2W85A 4IHYA 2IA1A 2XPUA 2ZSIB 1V3FA 3H3ZA 3TBIA 3UNGC 1D8KA 2H6CA 2EH3A 2LNBA 3HRTA 2X48A 4XICA 4GO1A 4HX7A 4X0GA 1R00A 2DO7A 4IQJA 1BW6A 3CLQA 1XX5A 1TWHJ 2E1CA 5EGOB 3GLXA 4BUPA 4IRIA 2P0WA 4U88A 1LE8A 5FD6A 4BDZA 1YIOA 5KHDA 4Q48A 5JR3A 3WG7H 4JBAA 1JUPA 2EZIA 4R79A 2VODA 4WX9A 2K86A 2ZXIA 2GIVA 2QBYA 4FASD 3JRHA 2MA3A 3A2KA 2KP6A 3CO7C 4XOTA 2V9PA 3GF2A 4UV9A 2EB7A 2OCCH 1HKSA 4XN0A 2VQLA 3HPHA 3CCLI 2KDOA 3PO2J 1HCRA 2EFOA 2VJ5A 1TC3C 3KZYA 3WHBA 4IX7A 2ECBA 4KFCA 5IT3A 1TQPA 5J8CA 4WK8F 3C7JA 2HKXA 2MD0A 3HGYA 4MEXF 1B72A 3PJRA 1TL8A 1U2WA 1I1GA 4RGSA 3CZ6A 2WAFA 2AS5F 3V42A 1GV2A 3H1CA 5HLGA 2R7RA 2LFBA 4BHBA 2DOEA 1W7PA 2E1MC 1UJ8A 1T0FA 4O5VA 4DOZA 1QRYA 4XKCA 4MGRA 3CCUI 3S16J 2A3SA 2QEXI 3LSKA 4BL0B 2RNGA 3G4SI 3AG2H 5K5QA 2A5WA 2XRLA 4A3CJ 4JX6A 1A6IA 1LEAA 2XC7A 2BVMA 3CO6C 2V9KA 3ZR8X 4D7NA 3G73A 3FWEA 2HZDA 1RESA 4RMNA 3QU3A 2NVUB 2EILH 5EG0A 3OYEA 2ISYA 3SFIA 1U8BA 3TP0A 1Y6IA 2LREA 2W82A 3SJMA 2X6XA 1HKQA 3E97A 4LLNA 1XN7A 3G6EI 1I5ZA 5FFXA 5HLIA 4YG2F 1XCVA 1XGMA 4ZYEA 3OYNA 1TWFJ 1NHAA 2LD5A 3KZZA 4A5NA 2NS7A 1LPQA 3HOTA 1SFOJ 5C4XJ 2EIJH 4E7ZA 2Z3YA 3D5RC 4F91B 2KPMA 1AKHA 3L1PA 2H94A 3ABUA 2VOPA 2HKOA 2GZWA 3LNQA 4DQ2A 4UV8A 4S04A 3P5JA 5M5WJ 2OU2A 5DCMB 2WA0A 4M6XA 2L0KA 2V1DA 2LTPA 2EIMH 4XOPA 2R7TA 4MQ9F 3K4BA 3SZPA 2M4KA 2R5YB 3GFLA 3H5AA 1S7AA 1W36D 4EM0B 5FGMA 2XAFA 4IVNA 1KYZA 2TCTA 1IUYA 1I6HJ 5GAEJ 3HSFA 3L7WA 3AL0C 3VSLA 4X6AJ 2QVOA 2JJ7A 2MH2A 5CVUA 4BJ5C 1ETXA 4X1EA 3MZYA 1Y8RB 4YRVA 5B3SH 3ZRGA 2NNYA 4UNOA 4FCYA 4XLFA 3AG1H 2QLZA 2F5VA 2BXYA 3E6BA 4G6QA 3DCFA 3S17J 1WPKA 1VQLI 1D8JA 4E70A 2FSWA 4RGXA 1RETA 2ZMEA 5DV5A 3ZMVA 3CCEI 2PMHA 2BY0A 3L2WA 4D1QA 2XSJC 2PI0A 2PN6A 2ESHA 1BR1A 4XLNF 5TJJA 2RQPA 1W7PD 3VWBA 4XRSG 3CUQC 4B3XA 3FK6A 5D8KB 2DPDA 2V7FA 5E17F 3B6CA 1R1VA 1MW7A 2X51A 2MFZA 2Y48A 5GAGJ 4UUVA 1IZ1A 1C0WA 5D8LB 2OBPA 2XIGA 2DT6A 3VYTB 3RKQA 3OS0A 1H9TA 2QA4I 1QVTA 2M0MA 3SXYA 3WGHA 1X1BA 2JZYA 4MFDA 2HOTA 4PJJA 5IYDJ 4EJVA 1IRXA 4ENJA 1R5HA 2WBMA 4DYCA 4ESFA 3KIOA 2CSOA 2GA2A 4CDGA 1FOXA 2CW0F 1I27A 1VQOI 3L2QA 4CA0A 4RAYA 3GTMJ 5C3EJ 1B8IA 2DOAA 1ZG3A 4BQOA 2VBZA 3OY9A 4A3GJ 3K4CA 1TNSA 4ESBA 4E7IA 2GWRA 1J9IA 5E20A 3CESA 2F4MB 2HXOA 3CCYA 1FBQA 4EGYA 2LLKA 1FLIA 4NC6A 4CYCA 2CU7A 2WADA 2O8XA 3QQAA 3V8JA 2OD5A 4HF2A 3A03A 3NAUA 1IDZA 3EYYA 1S7EA 5D4RA 3RKXA 4A6EA 2ZNYA 3S1MJ 3HOXJ 4A3JJ 3RKYA 3BR5A 3MWMA 3A02A 3CC2I 4OOIA 2YPRA 3WTVC 1K61A 4F52A 2F5EA 1ZG1A 4KIBA 2VJJA 3K4MA 3T5XA 1KA8A 2ZFWA 3M8EA 2V26A 2D5VA 2DLLA 4HV5A 4PZJA 2G7HA 4A3FJ 4XORA 3DTEA 4IHTA 4NHJA 4K2EA 4XNFA 2HYGD 3OOPA 4N9HA 3H92A 3KYDB 2M4GA 2O0YA 3DWLE 4M74A 2W7NA 1X58A 4EVIA 2DBBA 5DM7F 4IXAA 3A01A 3K4NA 3REOA 2GM4A 2EWNA 1BI3A 1MMSA 2L4AA 2EQRA 2GXGA 4E7LA 2BW3A 4S0HB 2CS3A 5IP6A 4IHSA 1JTXA 1YW7A 2Y0SA 4LG0A 4DBRA 2HFHA 1RC9A 4DZJA 2M45A 2L9NA 1DDNA 1FOKA 2FMLA 1T33A 5F1JA 2DA2A 5KAFC 2UWMA 3KX2A 4M3BA 3WU0A 4RB3C 1R9TJ 3WTXC 3ZGKA 5JVTA 2L01A 2MYSA 4F7ZA 1ZLKA 3WODF 4RBOA 3ZMZA 1MMAA 3BR3A 3WTZA 1IRGA 3JRIA 2CWEA 4HV6A 2L7FP 3MD2A 5EZHA 3F3XA 2CO5A 1V55H 2E5ZA 2X1CA 3I3LA 5E8IA 3M3YJ 1NK2P 2CH0A 3FXUA 1DU0A 1VNDA 4U7DA 2IS4A 2CFXA 1ETVA 2P81A 3M07A 1U5TC 2NOGA 2OZUA 3FX3A 4RAFA 3BROA 3WTTC 3DXJF 3LQRA 2OTJI 5J4YA 3FXRA 2G0EA 3GBGA 2IXSA 4NNJA 4BJTA 5FKKA 2KZGA 3WE2A 1KU3A 2W84A 4P1WA 2R7QA 4AIKA 3HM5A 4E7HA 1G2HA 1IRFA 1VZ0A 2IT0A 1F5TA 4I0BA 4UUTA 2OQGA 3GTJJ 1A36A 2LMDA 3FISA 3EPZA 2FBKA 2Q1ZB 4P96A 1W1WE 4HSTA 5GPAA 4WWCA 2HQ5A 3LSPA 1MNMC 1B9NA 1OYIA 1QNTA 4WXCA 2YU9J 5HVQC 1UHWA 4UVBA 4ENKA 2HVRA 4QTRA 1SD6A 2OAZA 1MJAA 3F8BA 5BQTA 4AYBA 3TL4X 5J1YA 5B1AH 2NS8A 1KQ0A 4GYIA 2R7UA 4BY1J 3ABMH 3R0AA 2R7WA 2H27A 3NEUA 4M71A 3RQIA 3J81Z 4XONA 2HR3A 4PJNA 1KU2A 1DGWY 1MNDA 1PUEE 4BBSJ 2ECCA 5FKOA 1SVMA 2R7FA 1LB2A 3WTYC 5TRDA 2FOWA 4B47A 4OINF 4I99C 3BG5A 3R0JA 2QQ8A 3A0HC 4XN3A 2VKVA 3HJEA 2OQRA 4MQVA 4YFNF 1L0OC 3FDYA 2V6EA 1K78B 5C44J 2MGQA 2HYFA 1RR7A 4RM2A 4RLFA 2R4GA 1IUFA 1O7FA 3QOEA 3S2WA 2NAZA 1UFMA 4PSXA 5CQGA 1QVUA 4GYGA 1KYWA 2PBIA 2IRFG 5BMZA 2X1EA 2M2EA 3IAM2 3P7NA 3CMMA 2DA7A 1S7OA 1UG0A 1MJ9A 3HOWJ 4HOBA 2JA8J 2FNAA 3E1SA 2L4MA 1LFUP 4KYWA 3PNTA 1SVLA 2FOKA 1I3QJ 1YJ9I 3HPGA 1ZR4A 3OYKA 2LP0A 1VQ8I 3LSGA 2QZ8A 3GW2A 4DNCA 4A3IJ 4JQFA 2DFHA 5F64A 1WRJA 2A68F 3GX4X 1FWZA 1X4OA 4OIRF 3ABLH 4CO8A 2W48A 2ELHA 4A3BJ 2DXIA 1HW1A 4LIUA 2ZJPF 2L9VA 2WAQA 3ZQGA 1H89C 1ON1A 4HRIA 1PYVA 2L2OA 2DODA 2XSDC 1CF7B 2QUFA 1BIBA 1EKEA 4QLCU 3ZN0A 2HGCA 5ICGA 3HTUA 2FXAA 4XSZF 3ZN1A 5H6QA 2GLOA 1TT5B 4G7HF 2F6CA 5IP9J 3C2GA 5E1ZB 3GTGJ 2LSOA 3LA3A 2PLYA 3PUBA 2QQBA 4LMYA 2GBYA 1ITYA 1Y39A 3HG9A 1VQ4I 4IPAA 4EJUA 2ZCWA 2ID3A 2M8EA 1J09A 3I53A 3JTHA 2BGCA 3S3MA 4HNVA 3OL4A 3E5UA 1X4PA 1RI7A 3KP4A 3CCJI 1ZELA 3E3VA 1USTA 5D6FA 2CUEA 1PDNC 3OS1A 1WZ2A 4HX8A 1IDYA 2CUZA 4FE7A 4OIQF 4XMYA 1P4AA 3TKYA 4F93B 2VJIA 1MBJA 3NWSA 3OIOA 1W36C 4G94A 1R22A 1Z7UA 1YRNA 1V5EA 1SFXA 3W6KB 5FJ8J 1BJZA 4ZTFA 2EJRA 1Z05A 3W3CA 3HGGA 4RA2A 5E3OA 4O6JA 3TMOA 4OWRB 3S8PA 4AC0A 2HU9A 3UKGA 2LY1A 3FBNB 3HHGA 2CQXA 4L9TA 2XB0X 2QYOA 3EUHA 2COBA 4QPOA 3WU1B 5HLHA 4MTDA 3WU2C 3LFUA 3AAFA 4IOCF 4KN4X 5FRMA 4RB1A 1G6NA 4CCJA 3FIWA 1XDSA 3ABKH 5FKLA 1SMTA 4UHTA 2K9MA 1JGGA 2F5DA 3DV8A 4Q47A 2WWYA 2BV6A 1Z21A 2L7ZA 3BLYA 2Y31A 3JSPA 4G7OF 1BIAA 4PFPA 1BN5A 2BZTA 3FXMA 2VJ4A 3OMYA 1GT0C 1T98A 1VI0A 2RNJA 2GA1A 3VPRA 4LK0F 3SEQA 3DU5A 5ILUA 1YHQI 1R49A 2UXXA 3LSJA 1HC8A 5M3MJ 4RB2C 4BEHB 1SMYF 1XGSA 2P6TA 4XKWA 2F2EA 3WG9A 2Q2EB 2KRFA 3JRBA 1WGXA 3BJAA 2DK8A 5GPCA 1TBXA 2OJED 2IGKA 2K3PA 5F0FA 2GXAA 3QP5A 2K40A 1MGTA 1RKTA 3KLOA 3CJRB 4B1RA 1MH3A 3RTRA 1OCZH 4YEJA 1AHDP 4RS8A 3KZIC 5J1RA 5D5VB 4DBQA 3I64A 5J1UA 3OL3A 2QQAA 4L5EA 4I02A 3I0TA 3HIFA 1ZKGA 1K79A 2W25A 2W57A 4IJAA 4I76A 3V7CA 1XC5A 4NC8A 1WVRA 1R5GA 2VI6A 2VT3A 2NRAC 1Y56A 4HZFA 5K7FA 2VQCA 4UB8C 4XLCA 1LVKA 4FE4A 2HQAA 3ZMUA 2F4OB 2P4WA 1JKQC 1RR8C 1S72I 3O3KA 3O2PE 5ICFA 2XUBA 4UUSA 4OAYA 4LIVA 3TO6A 2M87A 3DLAA 2NS0A 2ZKZA 2COMA 2IA0A 1ZGWA 2RREA 3OYGA 2A05A 2BEOA 3VYRB 1U6GA 1A35A 1R23A 4PJ0C 4GCVA 3I54A 2UZKA 1UHMA 1XPXA 1S9HA 2LF7A 3L2RA 3I59A 5ILSA 2P8TA 2K3FA 2FQ4A 3FXOA 1MSEC 1CQTA 1ZREA 4LG3A 1QO0D 5BPIA 1F1ZA 1N75A 1XMXA 4A3DJ 2OV7A 2AXLA 1DPRA 2JA5J 1RKWA 2RV8A 2IAIA 5F27A 3JRGA 3CC4I 3DLLF 2XVCA 3FM5A 3VDXA 3LWFA 2DT7B 5HS7A 5HODA 5K7HA 1LDJA 4DYRA 3COAC 1LKXA 1YIJI 2H1KA 3WTWC 1UHSA 2KHMA 3PIPF 3A4CA 1ONVA 2ZMEC 4HA8A 3BPXA 1IV8A 1OCTC 2HDWA 2QF7A 2I5UA 1KU9A 1LE8B 3BPVA 1X1PA 3TOBA 2OPTA 4Z2YA 1EJ9A 3S14J 3LSHA 1HW2A 3ZQFA 4BACA 4M3EA 1DP3A 3ASNH 2QBYB 1FY7A 2VASA 5AONA 4BY7J 2O61A 2Z99A 1BA5A 4XK4A 3S93A 4CCNA 1Z0XA 1H88C 1IG7A 2HXIA 2A07F 2L5QA 4ZC3A 2R7DA 3E0JB 1IXRC 1T2KA 4M72A 4DYQA 2XKPA 3TGNA 1ON2A 2O9LA 1G3WA 1B72B 4EJWA 2K85A 4E6KG 5LHGA 3CD6I 2EA4A 2IVMA 1FOWA 3IC7A 2NVQJ 4LJZF 2HVQA 1JE8A 3H0GJ 4M6VA 4ON0A 1W7PB 2PJRB 1SC7A 4M9ZA 1D5YA 4IEJA 4IRHA 2PJRA 1RIOH 1FP2A 3NARA 1HA8A 2P5KA 5CYVA 2CQNA 3HOSA 3ECOA 1SD5A 1WKMA 3PIOF 2VLAA 2FBIA 1V5FA 3HXLA 1S5LC 5ICEA 3FXJA 4L5JA 4JYKA 2HYJA 3OIQA 1PVEA 5KAIC 3I55I 1VTNC 3W2WA 1Z6TA 5F0CA 4XQFA 5E1XA 1GXQA 4D5FA 4DW6A 2BHYA 1Y0NA 2WY8Q 5HDGA 3SEZA 2FJ1A 4F55A 4CYDA 3J81K 3OOUA 2Z2SB 2HVSA 5EG0B 5D5XB 4QIWN 3OYLA 1ETQA 2VPRA 4LLLA 3QRFF 1A04A 2A5YB 3DBLB 1ZHFA 3QPSA 1XG1A 4RDUA 2BYVE 2H09A 3ZMDA 3DEWA 2MW8A 5J8FA 1TWGJ 2E7XA 2STWA 3C1DA 5IT9K 1W5TA 4UY8I 5KCMA 2M7AA 4ZDPA 1FIPA 1G3TA 1WQ2A 3B6AA 1AKHB 3OYFA 1F4KA 1I1SA 3HUGA 3DKXA 3J7ZI 3S3NA 1W5SA 5TISC 3H3UA 1A6QA 2KDZA 1QZEA 4JK1X 2JA6J 1ERDA 1IO2A 5GADJ 4A3KJ 3E5QA 2XAQA 2RKHA 2FQ3A 2P5LC 4LB6B 5HNFA 2XF7A 4Y3OA 2FEZA 3MCZA 4D5CA 1OYWA 3BR2A 1FT9A 2Z1DA 3OYAA 1VQMI 2D2WA 2MG4A 1JUMA 3OR2C 4BGDA 4XLEA 3K4KA 5LGNA 1Z3YA 5CVRA 2OA4A 2IGMA 4I98B 1JXSA 3Q9SA 1OCCH 1HXDA 1XCBA 4HDVA 1AWCA 2KMUA 5LHIA 3E5XA 3I5UA 3TO7A 2IPQX 2JUCA 1OCRH 1IAWA 4LITA 2QENA 4RM3A 4CCLA 1ZK8A 2KL4A 4D9JA 5LEKA 3U21A 3CMEI 2ME0A 3PFYA 4BE2A 2TDXA 2ZMEB 2DTZA 1BI1A 1R36A 3GXOA 3LMMA 4FETA 1ACIA 4A3EJ 4XSXF 2ZNZA 1U78A 1YJNI 1B59A 2VE8A 4D0PA 1Y1WJ 2CG4A 2XB5A 1RZ4A 1TP4A 1SD7A 2XAGA 3SQNA 1EF4A 4GXOA 4IHWA 2LKPA 4P55A 3FM3A 5BS6A 2XPWA 3GYHX 2XRNA 1VQNI 3GTLJ 1XSDA 5DYMA 1OJLA 2ZB9A 1HDPA 4I01A 4ZDOA 2KIFA 3KP3A 4NUBA 2BHZA 3T8TA 4M3DA 2HDDA 4BU2A 3OYBA 3K1MA 1G4DA 5K5RA 2CW7A 2K7LA 5HS9A 3H36A 1PJRA 1UAAA 1XTAA 5E3LA 3ZQ7A 1MH4A 3H9JA 3OS2A 2ACJA 1LEBA 1ZRCA 2E5NA 3PM1A 1HSTA 1YYVA 3R61A 2CQ7A 3K70D 3PUFA 1AU7A 4B09A 2V1XA 3I9V2 3KEQA 1B8IB 1VQKI 1QPMA 2GAUA 2CRGA 4D7MA 2DFEA 3RDIA 3K6GA 2QQ9A 4BHPA 1M1EB 2DI3A 2AXTC 1S3JA 2D1HA 2V4JC 3CF5F 4ENNA 1O3QA 4AM3A 5IYBJ 4FX0A 4CYCB 2Y0SN 2VPLA 3LFKA 1XGOA 1T6SA 1ETKA 1O3TA 5JHUA 2W4SA 4Y13A 2Y69H 3QU6A 3K10A 3IKTA 5EYRA 2FBHA 5A2QK 2DN0A 2DJIA 4HSRA 3SHFA 1QHGA 1WSUA 2FA5A 1HSJA 1FZPB 2PEXA 4MLOA 1R7JA 2RVCA 3RZDJ 2NXNB 3J80K 5H20A 1OFCX 1W0TA 2Z33A 2DQRA 2WB1A 5GP9A 1J75A 4NBQA 5B1BH 3VOEA 2KIQA 2H6BA 2L54A 4II2A 4EATA 5EEAA 3CTAA 2ZJQF 1HKTA 3F6OA 1FTZA 1IGNA 2DU9A 3Q3SA 3RYPA 1NG7A 3C18A 3G3ZA 3A01B 2JUGA 3R4KA 1XMKA 3CCVI 1R58A 2E19A 4A69C 4C3HJ 1QBJA 2IS6A 2R7VA 2IGOA 3QODA 2BW3B 3JRCA 2M3AA 1XSVA 2F5CA 3DPTA 1QPIA 2VKEA 3O8HA 4ZYDA 1IXCA 2XGDA 3F9KA 3AKZA 4J01A 3K4LA 4HDUA 2A61A 3EUKL 1VFCA 1MBFA 4LG0B 5LFAA 5HDNA 4XL9A 1YTYA 2FMYA 2IW5A 4ZYGA 1ZRDA 1V54H 3HB9A 1H0MA 4AYBN 1XB4A 4N4NB 2CGPA 3CDLA 3OV8A 1WJ5A 4FX4A 5FB2A 1PUFA 1VQPI 4U0VA 3L9FA 3M4OJ 1R4NB 2LOOA 2K9SA 3FHNA 3PSFA 5CLSA 2JPCA 1G3SA 2VXDA 3I71A 2FF4A 3M8FA 1YX3A 2P5VA 4ZZDA 1OCOH 2CJJA 1DUXC 4IL6C 2IGNA 3D5SC 2DA1A 5GAHJ 3DKYA 5BNGA 3M8JA 1P92A 3HHHA 3J7YJ 2FD5A 4LOCA 1NG6A 2PQ8A 4IQ4A 2KKOA 3JREA 3W6VA 1YO5C 3GEZA 4U87A 5E3NA 2Y75A 4A3MJ 2OTLI 3EUHC 1A31A 4XLPF 3HTSB 4YIFA 1W4MA 2K4JA 3ZXSA 2X0LA 1J59A 2WTEA 1FPQA 5J47A 1E0EA 3OWTA 3OYDA 2VB6A 3DFGA 3Q0UA 3ONQA 2HQNA 2EZHA 4ETSA 3I4PA 2CUJA 2RGVA 2XF5A 4AU7A 3RI4A 2EA2A 3DP7A 2PX9A 3U9GA 4HEA2 1JUSA 1IN8A 3QYEA 1QA6A 1WJEA 1WI9A 2EFQA 4G8XA 5E1WA 1MIJA 4WXHA 1BR2A 2Z9OA 2BY3A 1K7AA 1X1CA 3N4MA 4C30A 1X3ZB 2ZO4A 4ZZLA 2M34A 5ICCA 1T56A 1TZLA 2UV1A 5LBQA 3BCBA 2X6YA 2WAQN 3OSGA 3F8NA 3ERED 3NQOA 1ZG5A 1SD4A 4UVCA 3VYUB 2DA6A 3GFIA 3G1LA 2O03A 2XGEA 5F04A 2HDCA 2J5PA 4RGUA 2B0LA 5DS9A 2VKHA 3FHZA 5FFZA 2GXBA 5IT9Z 1QGPA 3WTUC 1LVAA 1MDMA 5FROA 4NC7A 4UVAA 1FTTA 4Y52J 3ZMSA 2JSCA 1FMWA 1Z1DA 2UUZA 2Y2ZA 1E2XA 2MH9A 1Q1VA 2B9SA 1EH7A 1FBSA 1FNNA 3D0SA 4GFBA 3BJOA 1KGSA 2EBIA 1F9NA 4B8XA 1X19A 1HBXG 4L9NA 3X2QH 4IRGA 4BBRJ 3DF8A 5HNHA 3P9KA 2MLGA 3G71I 1K83J 1P4XA 2DQLA 1STZA 3DEEA 5EF6A 3S32A 2I8DA 3UR3C 4KIFA 1G59A 3C2BA 5L3FA 5D4SA 4O3MA 3E6DA 1T8IA 3HOVJ 1JKOC 3JRAA 4KIGA 3I4NJ 4MHGA 1D5VA 1FX7A 4N9IA 2CMPA 2LK2A 5CVJA 3T0YA 5JLXA 2R3SA 2CQKA 3LSTA 2CQQA 4B48A 1N77A 5JVGF 4YIRX 5JLWA 2IBDA 3M1CA 1TLHB 5D5UB 2W1OA 4UXNA 1SAUA 1ZTRA 2LBFA 3I58A 3DEUA 4IHXA 2E36A 2KIUA 2XGCA 1RNLA 3SZGA 4YIIA 5HS8A 1UMQA 3U1DA 2QGUA 3BT9A 1OR7A 3S2HJ 4C9YA 3S15J 2O7OA 4JX4A 3BZKA 4N0BA 5LHHA 3OYMA 3Q0WA 4P9FA 3MAJA 5D5WB 1BI0A 4W1UA 4AIDA 2YUSA 4BQAA 4HG2A 4ZH4F 3BTJA 2KQRA 2DYRH 1SFUA 2X9DA 2VC0A 4P5OA 1BI2A 1XMAA 5J3LA 3CJTB 4L5IA 3BTCA 3LAJA 1YRNB 3KP7A 1MJBA 4Y7NJ 4M9XA 3F0CA 3ESWB 2OCEA 1V4RA 4H4KC 1MKMA 3MKYB 2M30A 2OZ6A 3IRQA 4BJ6C 2J5OA 3BR0A 4ZDLA 4BYYA 5GTHC 3CCRI 2ICWG 3HOYJ 4KDPA 4A3LJ 1BR4A 4FISA 3WE3A 3JAMK 5GTIC 2DFFA 1IW7F 4XKBA 3DTKA 4NB5A 3OYIA 5CQEA 2VBYA 3FK7A 5DM6F 4KT6A 5JHFA 2P7VB 1EH6A 2XAHA 5KK1A 3N97A 3K1PA 2L3DA 1I39A 1TW2A 4XRMA 1U5TA 4A93J 1BJAA 3ZOBA 3F6VA 2E1NA 2C6YA 2VL8A 4AWXB 3HRUA 3K7AJ 3PO3J 5A2QZ 1ETOA 3RPUA 1T0FC 3CF2A 5K1YA 4YELA 1D3YA 2HWVA 4CZCA 2YX7A 1ODDA 5EJCA 2K9QA 2IS1A 3F72A 1YG2A 2X6WA 3JRFA 3J80Z 5EEGA 1JHHA 2LH9A 1TT0A 2K9NA 2ZFUA 5AIQA 3M9AA 5M5YJ 1BW5A 1O57A 3CLOA 3VODA 2GOMA 1RUOA 2KJCA 4HBLA 3OYHA 4BXUA 2E35A 2X4HA 3OIPA 1YE9A 3TOAA 4A5MA 2FE3A 1S29A 4N4OB 4EJOA 1Z91A 3HRSA 5LRSA 3SZTA 1X1DA 3ABTA 1B6AA 2ZXHA 1GHCA 2DFIA 1JJ6C 1BL0A 4UUSB 2O8KA 3H0DA 1LDDA 2V1UA 3TO9A 2ZXJA 3PNYA 1AA7A 3HL2A 3G2BA 1B4AA 3HSEA 4EEFG 5F1RA 3C3WA 4PDKA 4M9SA 2H8RA 1APLC 1D1BA 2D45A 2DDBA 1FP1D 5ERIA 1MBGA 2OF7A 4XR6A 1X1AA 2IA2A 3VFZA 2LR8A 3I59B 3E6MA 4PK4A 1I6XA 2VONA 4J00A 1IF1A 1T08B 3GZNB 2YSRA 1EH8A 3MKLA 4C2TA 3HSRA 2PMZA 3KE2A 1ZLJA 3SDGA 1ZGJA 2XROA 1PP7U 4QWQA 3D5LA 4KUMA 1W5CC 4OIOF 1DPUA 1E3HA 1YS7A 5L3BA 2ETHA 4S05A 2XAJA 3FBIB 2G9WA 2WAEA 4EV0A 4HAMA 4NQWA 4KN7X 4I2OA 4PGHA 1HOMA 4Y33A 3M1EA 1LNWA 1O3SA 2RDPA 1D0XA 3BR6A 1YW8A 2EFNA 3BZCA 4RAGA 2R7SA 5EEHA 2H8WA 1ZQ3P 1DQUA 1QU3A 5DEQA 5JFRA 4IZZA 4Y4RA 3LOCA 4KT5C 2VBXA 1R4MB 3RYRA 3R60A 1X3UA 2M0CA 1JJ8C 2Z16A 3ML6A 2IP2A 1JGSA 2CUFA 4I0AA 5BPDA 2PG4A 2VOOA 1K4TA 2HOSA 2K5CA 4KJZA 2BBYA 2XV4S 3RPUD 3J7AY 1U9NA 1MNEA 5E18F 3JRDA 2Y0MA 1R1TA 1GVDA 3LSIA 2L9RA 1HLVA 1Z9CA 2BE5F 3I56I 2DK5A 2NOJB 2X1DA 1JKPC 3PNVA 2IS2A 1J2XA 2HOAA 1P7IA 4CH7A 5EGOA 2NVTJ 4HPQA 4QSHA 2DA4A 1WJBA 1R6RA 2YS9A 3DPLC 1AOYA 3BP8A 1H9GA 1UB9A 3ZQQA 3MKWB 3HKZA 3W2VA 3CJQB 3DU6A 2GOXB 3RIRA 1YJWI 1LJ9A 3K2ZA 1KONA 2QSGX 2STTA 2EV0A 2E1OA 4DJAA 4WXDA 2QWWA 5IY5H 1OYYA 2B63J 2HI3A 2MD5A 3FMRA 3H9GA 1SEUA 1KQ8A 4V19K 5BOXA 3V7RA 3KPHA 4YFKF 1Q1HA 4HYEA 4II3A 3HC7A 4F3QA 2H1LA 1FOYA 1J7KA 1WHUA 3LL7A 3BDDA 3LQQA 3FF5A 4RAZA 4HW0A 5L3DA 2AQEA 2Y30A 3F8FA 2JSPA 5JI6A 2CV1A 3IL2A 2XF6A 1UZCA 2JA2A 9ANTA 2W00A 2VQHA 5FRNA 2PFBA 2XKOA 4BXFA 4Z6YA 2K02A 4Q4ZF 6PAXA 4MO7A 3GCMA 4JP0A 2R7XA 1YLFA 4A0XA 4AIJA 2WV1A 1IV6A 2HTSA 3BQZA 3FZVA 3GTPJ 2O3FA 4EQQA 1BBYA 3TW6A 3HUGB 3K2AA 4M6YA 3IWZA 3KEYA 1IN6A 5FO5A 3O6BB 1G8XA 2PJPA 2RC4A 2VBWA 5FLXK 2BVLA 5DD8A 3LAPA 4ANJA 3OSFA 1YITI 3IAS2 1ORKA 3E6CC 1LFBA 5F6FA 3BCAA 2KRCA 1RPWA 2KJBA 2Q0OA 3A1YA 1Z7LA 2G7UA 3DPUA 4AVPA 2E34A 1NTCA 3JR9A 1BC7C 2HTJA 3JSOA 3IP4B 1Y1VJ 2M8GX 1UCRA 5LRRA 3S2DJ 1FEXA 2DMTA 2ELJA 2OUMA 3WGGA 3GTOJ 4L0YB 1OISA 3RKWA 4E4HA 4NDLA 1P9QC 2EINH 1YX5A
chains in the Genus database with same CATH topology
2DA3A 3HB9A 3ZQIA 2GLOA 4AYBN 4B4CA 3CDLA 5IP9J 3GTGJ 2DJNA 5IOYA 3HOZJ 1U9OA 4XIDA 1PUFA 3CMYA 2X6OA 2GBYA 2R5ZB 1ITYA 3G1OA 3M4OJ 2FX0A 2K9SA 3TEDA 4FTHA 2R5ZA 3ZQLA 5F0HA 3S1RJ 3BG3A 2L7MP 1FIAA 2ID3A 2R5YA 2CJJA 2N8GA 3QPLA 3G1MA 2DA1A 4B3AA 4C3IJ 4HNVA 4XRSA 1JT6A 4IHYA 5BNGA 2CUEA 1IDYA 2XPUA 4FE7A 2FD5A 4LOCA 4JX5A 3JREA 3W6VA 2EH3A 1MBJA 3OIOA 2X48A 5E3NA 4XICA 5FKNA 1YRNA 5FJ8J 4A3MJ 1BJZA 1WH5A 1BW6A 1TWHJ 3HGGA 5E3OA 5EGOB 4AC0A 5EDNA 3UKGA 1LE8A 1X2NA 3Q0UA 2CQXA 2EZHA 4MIMA 2XB0X 2WB1N 2COBA 1JUPA 2EZIA 2QCOA 1JUSA 3JRHA 3FIWA 5FKLA 1VF9A 1JGGA 5DTDA 3PO2J 2L7ZA 1HCRA 2Y31A 1TC3C 1A5JA 3WHBA 2ECBA 2M34A 2JA7J 3LSRA 1T56A 1GT0C 1VI0A 3VPRA 2WAQN 3OSGA 3HGYA 2DA6A 3G1LA 2XGEA 3HEFA 3LSJA 5F04A 4C3JJ 1B72A 4IHVA 5M3MJ 5DS9A 1GV2A 3JRBA 1WGXA 2LFBA 2LVSA 5GPCA 4M3GA 5F0FA 3GTQJ 1QRYA 3S16J 2K40A 1FTTA 1RKTA 4Y52J 5FKMA 4B1RA 1MH3A 2Y2ZA 1Q1VA 1AHDP 5J1RA 3GTKJ 2XRLA 4A3CJ 4GFBA 4JX6A 5J1UA 1A6IA 2EBIA 4L5EA 4D7NA 1ZKGA 4I76A 1HF0A 4BXXJ 1XC5A 4BBRJ 2I10A 1RESA 2VI6A 5EG0A 2JWTA 5K7FA 3SFIA 1K83J 3TP0A 1U8BA 5M3FJ 4FE4A 3SJMA 5EZGA 5EF6A 1JKQC 1JKRC 1ETYA 3C2BA 2R7ZJ 4UUSA 3HOVJ 1TWFJ 2LD5A 3JRAA 1JKOC 3I4NJ 2DMUA 5IOZA 2LK2A 2NS7A 5JLXA 1SFOJ 1ZGWA 3HOUJ 2CQQA 5C4XJ 5E3MA 5JLWA 2IBDA 1JT0A 1AKHA 3L1PA 1POGA 1ZTRA 3Q0VA 4IHXA 2XGCA 3LNQA 4BKXA 1PUFB 2FQ4A 1W0UA 1MSEC 1UMQA 5M5WJ 1CQTA 2ID6A 3BT9A 3S2HJ 2L0KA 2LTPA 3S15J 2O7OA 4JX4A 4G12A 3Q0WA 4A3DJ 1ZR2A 1H8AC 2JA5J 2AO9A 2R5YB 4W1UA 3IH2A 2Y9ZA 2YUSA 1RKWA 2R93J 2IAIA 3BG9A 5FLVA 5F27A 1HDDC 3BTJA 3JRGA 3S1QJ 2X9DA 1WCMJ 2TCTA 1I50J 2TRTA 5HODA 1I6HJ 5K7HA 4DYRA 5J3LA 4X6AJ 2H1KA 2JJ7A 3BTCA 1UHSA 1YRNB 1ETXA 4X1EA 4Y7NJ 1IRZA 3F0CA 4FCYA 1OCTC 5M5XJ 2QF7A 3DCFA 1LE8B 3S17J 3BR0A 1WPKA 2JN6A 2OPTA 1XS9A 3HOYJ 3S14J 4A3LJ 3CQZJ 4FISA 1RETA 1FJLA 3ZQFA 1OCPA 4M3EA 2NVYJ 1WI3A 3BQYA 3FK7A 3HBLA 4BY7J 1E3OC 1BA5A 4XRSG 4XK4A 1H88C 1Z0XA 3BTIA 2HXIA 3FK6A 1IG7A 4XRMA 4A93J 3ZOBA 3B6CA 4DYQA 3ZQCA 2O9LA 3IH3A 3K7AJ 4V2FA 1B72B 3PO3J 1ETOA 3RKQA 3WHCA 4MFEA 1QVTA 2NVQJ 4ABZA 3H0GJ 4M6VA 3H3VK 4MFDA 5IYCJ 2HOTA 5IYDJ 1D5YA 2K9QA 2R92J 4IEJA 4DYCA 3JRFA 3NARA 5C4JJ 2K9NA 4V2GA 2EZLA 5M5YJ 3GTMJ 5C3EJ 1BW5A 1MBEA 1B8IA 2IEKA 4A3GJ 4JYKA 2HYJA 5F0CA 4D5FA 4DW6A 2HXOA 3CCYA 1ENHA 2FJ1A 2LLKA 3BR1A 4CYCA 3OOUA 2CU7A 5EG0B 4W97A 4DZPA 4QIWN 1ETQA 2VPRA 3QPSA 3QQAA 1XG1A 4RDUA 1JJ6C 1BL0A 3A03A 3NAUA 1IDZA 5FLMJ 4UUSB 1S7EA 2O8KA 3DEWA 2MW8A 3S1MJ 3I4MJ 3HOXJ 4A3JJ 1TWGJ 2E2JJ 3BR5A 1SANA 3A02A 4EEFG 1K61A 4M3FA 1FIPA 2H8RA 3B6AA 1APLC 1AKHB 1MBGA 2OF7A 2D5VA 2LR8A 4A3FJ 2KDZA 3MKLA 1X58A 2JA6J 3A01A 4I6ZA 3TP3A 4A3KJ 1MBKA 1NK3P 3SDGA 2GM4A 4C2MJ 2RAEA 2AHQA 2EQRA 2JK3A 4D5CA 4S0HB 3BR2A 5IP6A 2MG4A 1GUUA 1JUMA 1JTXA 1HOMA 2DA5A 3BR6A 4DZJA 3IV5A 1T33A 5F1JA 2DA2A 1ZQ3P 4M3BA 3BTLA 1R9TJ 1DU6A 3LOCA 4RBOA 1ZK8A 3BR3A 2M0CA 3JRIA 1GV5A 5EZHA 2L7FP 2ME0A 2CUFA 1JJ8C 3E7LA 2HOSA 3M3YJ 1NK2P 2DTZA 1DU0A 1JTYA 2ELKA 1U9NA 1VNDA 1MSFC 3JRDA 4A3EJ 1ETVA 1GVDA 2P81A 1U78A 2NOGA 1F43A 1Y1WJ 2EZKA 2L9RA 2XB5A 3MVPA 1EF4A 2G0EA 3GBGA 1HLVA 4IHWA 1O4XA 2XPWA 5FKKA 3GTLJ 1JKPC 2DMPA 2Y9YA 2HOAA 3HM5A 1G2HA 1OJLA 2VUMJ 1P7IA 2E2IJ 2ZB9A 4UUTA 1HDPA 5EGOA 4QSHA 3GTJJ 2DA4A 2NVTJ 2HDDA 2YS9A 4M3DA 3IH4A 3FISA 1P7JA 3RZOJ 2LKXA 5GPAA 1IJWC 1GDTA 2HQ5A 3LSPA 1IC8A 1MNMC 2YU9J 5E3LA 1MH4A 4QTRA 3MN2A 3PM1A 5J1YA 2NS8A 2E1OA 4BY1J 1AU7A 4AUXA 3TW7A 2PMZN 1F36A 2B63J 5F08A 3RQIA 1B8IB 2HI3A 1MBHA 2CRGA 4D7MA 2DMQA 4BBSJ 2ECCA 5FKOA 3BG5A 3FKIJ 2VKVA 5IYBJ 4CYCB 2Y0SN 5C44J 2MGQA 1ETKA 2Y30A 1RR7A 9ANTA 1IUFA 5EYRA 2DN0A 2R0QC 1UG2A 2ME6A 1QVUA 1TWAJ 4MO7A 4MLOA 4J19A 4JP0A 2M2EA 2M9HA 2KT0A 5IPAA 2JMWA 3RZDJ 2WV1A 1IV6A 2DA7A 3BQZA 5IP7J 3GTPJ 3HOWJ 1OFCX 3TW6A 1W0TA 2JA8J 3S1NJ 5GP9A 3K2AA 5EEAA 1LFUP 3HDDA 2E2HJ 2LY9A 1IGNA 1FTZA 1I3QJ 1ZR4A 2LP0A 3OSFA 3LSGA 3Q3SA 1ORKA 1LFBA 1Z77A 4A3IJ 3A01B 1RPWA 3ZQHA 2MSYA 2XPVA 2NVXJ 1NTCA 2E19A 4A69C 3JR9A 3O8GA 4C3HJ 2W48A 2DMNA 3D1NI 4A3BJ 1Y1VJ 2M8GX 5K7ZA 1WH7A 3S2DJ 2DMTA 3JRCA 1FEXA 1H89C 3ZQGA 4NDLA 1QPIA 3GTOJ 2VKEA 3O8HA 2XGDA 2XSDC 1ETWA 3HKZN 1VFCA 1X2MA 1MBFA 1TWCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA3 A;  3HB9 A;  3ZQI A;  2GLO A;  4AYB N;  4B4C A;  3CDL A;  5IP9 J;  3GTG J;  2DJN A;  5IOY A;  3HOZ J;  1U9O A;  4XID A;  1PUF A;  3CMY A;  2X6O A;  2GBY A;  2R5Z B;  1ITY A;  3G1O A;  3M4O J;  2FX0 A;  2K9S A;  3TED A;  4FTH A;  2R5Z A;  3ZQL A;  5F0H A;  3S1R J;  3BG3 A;  2L7M P;  1FIA A;  2ID3 A;  2R5Y A;  2CJJ A;  2N8G A;  3QPL A;  3G1M A;  2DA1 A;  4B3A A;  4C3I J;  4HNV A;  4XRS A;  1JT6 A;  4IHY A;  5BNG A;  2CUE A;  1IDY A;  2XPU A;  4FE7 A;  2FD5 A;  4LOC A;  4JX5 A;  3JRE A;  3W6V A;  2EH3 A;  1MBJ A;  3OIO A;  2X48 A;  5E3N A;  4XIC A;  5FKN A;  1YRN A;  5FJ8 J;  4A3M J;  1BJZ A;  1WH5 A;  1BW6 A;  1TWH J;  3HGG A;  5E3O A;  5EGO B;  4AC0 A;  5EDN A;  3UKG A;  1LE8 A;  1X2N A;  3Q0U A;  2CQX A;  2EZH A;  4MIM A;  2XB0 X;  2WB1 N;  2COB A;  1JUP A;  2EZI A;  2QCO A;  1JUS A;  3JRH A;  3FIW A;  5FKL A;  1VF9 A;  1JGG A;  5DTD A;  3PO2 J;  2L7Z A;  1HCR A;  2Y31 A;  1TC3 C;  1A5J A;  3WHB A;  2ECB A;  2M34 A;  2JA7 J;  3LSR A;  1T56 A;  1GT0 C;  1VI0 A;  3VPR A;  2WAQ N;  3OSG A;  3HGY A;  2DA6 A;  3G1L A;  2XGE A;  3HEF A;  3LSJ A;  5F04 A;  4C3J J;  1B72 A;  4IHV A;  5M3M J;  5DS9 A;  1GV2 A;  3JRB A;  1WGX A;  2LFB A;  2LVS A;  5GPC A;  4M3G A;  5F0F A;  3GTQ J;  1QRY A;  3S16 J;  2K40 A;  1FTT A;  1RKT A;  4Y52 J;  5FKM A;  4B1R A;  1MH3 A;  2Y2Z A;  1Q1V A;  1AHD P;  5J1R A;  3GTK J;  2XRL A;  4A3C J;  4GFB A;  4JX6 A;  5J1U A;  1A6I A;  2EBI A;  4L5E A;  4D7N A;  1ZKG A;  4I76 A;  1HF0 A;  4BXX J;  1XC5 A;  4BBR J;  2I10 A;  1RES A;  2VI6 A;  5EG0 A;  2JWT A;  5K7F A;  3SFI A;  1K83 J;  3TP0 A;  1U8B A;  5M3F J;  4FE4 A;  3SJM A;  5EZG A;  5EF6 A;  1JKQ C;  1JKR C;  1ETY A;  3C2B A;  2R7Z J;  4UUS A;  3HOV J;  1TWF J;  2LD5 A;  3JRA A;  1JKO C;  3I4N J;  2DMU A;  5IOZ A;  2LK2 A;  2NS7 A;  5JLX A;  1SFO J;  1ZGW A;  3HOU J;  2CQQ A;  5C4X J;  5E3M A;  5JLW A;  2IBD A;  1JT0 A;  1AKH A;  3L1P A;  1POG A;  1ZTR A;  3Q0V A;  4IHX A;  2XGC A;  3LNQ A;  4BKX A;  1PUF B;  2FQ4 A;  1W0U A;  1MSE C;  1UMQ A;  5M5W J;  1CQT A;  2ID6 A;  3BT9 A;  3S2H J;  2L0K A;  2LTP A;  3S15 J;  2O7O A;  4JX4 A;  4G12 A;  3Q0W A;  4A3D J;  1ZR2 A;  1H8A C;  2JA5 J;  2AO9 A;  2R5Y B;  4W1U A;  3IH2 A;  2Y9Z A;  2YUS A;  1RKW A;  2R93 J;  2IAI A;  3BG9 A;  5FLV A;  5F27 A;  1HDD C;  3BTJ A;  3JRG A;  3S1Q J;  2X9D A;  1WCM J;  2TCT A;  1I50 J;  2TRT A;  5HOD A;  1I6H J;  5K7H A;  4DYR A;  5J3L A;  4X6A J;  2H1K A;  2JJ7 A;  3BTC A;  1UHS A;  1YRN B;  1ETX A;  4X1E A;  4Y7N J;  1IRZ A;  3F0C A;  4FCY A;  1OCT C;  5M5X J;  2QF7 A;  3DCF A;  1LE8 B;  3S17 J;  3BR0 A;  1WPK A;  2JN6 A;  2OPT A;  1XS9 A;  3HOY J;  3S14 J;  4A3L J;  3CQZ J;  4FIS A;  1RET A;  1FJL A;  3ZQF A;  1OCP A;  4M3E A;  2NVY J;  1WI3 A;  3BQY A;  3FK7 A;  3HBL A;  4BY7 J;  1E3O C;  1BA5 A;  4XRS G;  4XK4 A;  1H88 C;  1Z0X A;  3BTI A;  2HXI A;  3FK6 A;  1IG7 A;  4XRM A;  4A93 J;  3ZOB A;  3B6C A;  4DYQ A;  3ZQC A;  2O9L A;  3IH3 A;  3K7A J;  4V2F A;  1B72 B;  3PO3 J;  1ETO A;  3RKQ A;  3WHC A;  4MFE A;  1QVT A;  2NVQ J;  4ABZ A;  3H0G J;  4M6V A;  3H3V K;  4MFD A;  5IYC J;  2HOT A;  5IYD J;  1D5Y A;  2K9Q A;  2R92 J;  4IEJ A;  4DYC A;  3JRF A;  3NAR A;  5C4J J;  2K9N A;  4V2G A;  2EZL A;  5M5Y J;  3GTM J;  5C3E J;  1BW5 A;  1MBE A;  1B8I A;  2IEK A;  4A3G J;  4JYK A;  2HYJ A;  5F0C A;  4D5F A;  4DW6 A;  2HXO A;  3CCY A;  1ENH A;  2FJ1 A;  2LLK A;  3BR1 A;  4CYC A;  3OOU A;  2CU7 A;  5EG0 B;  4W97 A;  4DZP A;  4QIW N;  1ETQ A;  2VPR A;  3QPS A;  3QQA A;  1XG1 A;  4RDU A;  1JJ6 C;  1BL0 A;  3A03 A;  3NAU A;  1IDZ A;  5FLM J;  4UUS B;  1S7E A;  2O8K A;  3DEW A;  2MW8 A;  3S1M J;  3I4M J;  3HOX J;  4A3J J;  1TWG J;  2E2J J;  3BR5 A;  1SAN A;  3A02 A;  4EEF G;  1K61 A;  4M3F A;  1FIP A;  2H8R A;  3B6A A;  1APL C;  1AKH B;  1MBG A;  2OF7 A;  2D5V A;  2LR8 A;  4A3F J;  2KDZ A;  3MKL A;  1X58 A;  2JA6 J;  3A01 A;  4I6Z A;  3TP3 A;  4A3K J;  1MBK A;  1NK3 P;  3SDG A;  2GM4 A;  4C2M J;  2RAE A;  2AHQ A;  2EQR A;  2JK3 A;  4D5C A;  4S0H B;  3BR2 A;  5IP6 A;  2MG4 A;  1GUU A;  1JUM A;  1JTX A;  1HOM A;  2DA5 A;  3BR6 A;  4DZJ A;  3IV5 A;  1T33 A;  5F1J A;  2DA2 A;  1ZQ3 P;  4M3B A;  3BTL A;  1R9T J;  1DU6 A;  3LOC A;  4RBO A;  1ZK8 A;  3BR3 A;  2M0C A;  3JRI A;  1GV5 A;  5EZH A;  2L7F P;  2ME0 A;  2CUF A;  1JJ8 C;  3E7L A;  2HOS A;  3M3Y J;  1NK2 P;  2DTZ A;  1DU0 A;  1JTY A;  2ELK A;  1U9N A;  1VND A;  1MSF C;  3JRD A;  4A3E J;  1ETV A;  1GVD A;  2P81 A;  1U78 A;  2NOG A;  1F43 A;  1Y1W J;  2EZK A;  2L9R A;  2XB5 A;  3MVP A;  1EF4 A;  2G0E A;  3GBG A;  1HLV A;  4IHW A;  1O4X A;  2XPW A;  5FKK A;  3GTL J;  1JKP C;  2DMP A;  2Y9Y A;  2HOA A;  3HM5 A;  1G2H A;  1OJL A;  2VUM J;  1P7I A;  2E2I J;  2ZB9 A;  4UUT A;  1HDP A;  5EGO A;  4QSH A;  3GTJ J;  2DA4 A;  2NVT J;  2HDD A;  2YS9 A;  4M3D A;  3IH4 A;  3FIS A;  1P7J A;  3RZO J;  2LKX A;  5GPA A;  1IJW C;  1GDT A;  2HQ5 A;  3LSP A;  1IC8 A;  1MNM C;  2YU9 J;  5E3L A;  1MH4 A;  4QTR A;  3MN2 A;  3PM1 A;  5J1Y A;  2NS8 A;  2E1O A;  4BY1 J;  1AU7 A;  4AUX A;  3TW7 A;  2PMZ N;  1F36 A;  2B63 J;  5F08 A;  3RQI A;  1B8I B;  2HI3 A;  1MBH A;  2CRG A;  4D7M A;  2DMQ A;  4BBS J;  2ECC A;  5FKO A;  3BG5 A;  3FKI J;  2VKV A;  5IYB J;  4CYC B;  2Y0S N;  5C44 J;  2MGQ A;  1ETK A;  2Y30 A;  1RR7 A;  9ANT A;  1IUF A;  5EYR A;  2DN0 A;  2R0Q C;  1UG2 A;  2ME6 A;  1QVU A;  1TWA J;  4MO7 A;  4MLO A;  4J19 A;  4JP0 A;  2M2E A;  2M9H A;  2KT0 A;  5IPA A;  2JMW A;  3RZD J;  2WV1 A;  1IV6 A;  2DA7 A;  3BQZ A;  5IP7 J;  3GTP J;  3HOW J;  1OFC X;  3TW6 A;  1W0T A;  2JA8 J;  3S1N J;  5GP9 A;  3K2A A;  5EEA A;  1LFU P;  3HDD A;  2E2H J;  2LY9 A;  1IGN A;  1FTZ A;  1I3Q J;  1ZR4 A;  2LP0 A;  3OSF A;  3LSG A;  3Q3S A;  1ORK A;  1LFB A;  1Z77 A;  4A3I J;  3A01 B;  1RPW A;  3ZQH A;  2MSY A;  2XPV A;  2NVX J;  1NTC A;  2E19 A;  4A69 C;  3JR9 A;  3O8G A;  4C3H J;  2W48 A;  2DMN A;  3D1N I;  4A3B J;  1Y1V J;  2M8G X;  5K7Z A;  1WH7 A;  3S2D J;  2DMT A;  3JRC A;  1FEX A;  1H89 C;  3ZQG A;  4NDL A;  1QPI A;  3GTO J;  2VKE A;  3O8H A;  2XGD A;  2XSD C;  1ETW A;  3HKZ N;  1VFC A;  1X2M A;  1MBF A;  1TWC J; 
#chains in the Genus database with same CATH topology
 5FD5 A;  1GXP A;  1KU7 A;  1P4W A;  2LKS A;  1VQ7 I;  4HNU A;  2ISZ A;  2V79 A;  3ZQI A;  4G6T B;  3K0L A;  3J7A O;  4PFO A;  5IOY A;  4L0Z B;  1TTY A;  3HOZ J;  1U9O A;  3CCQ I;  3BC8 A;  3JCU C;  3JAM Z;  3CMY A;  2R5Z B;  3G1O A;  2DYS H;  5DCM A;  2FX0 A;  3TED A;  3NRV A;  4CCK A;  2R5Z A;  4ESJ A;  2KZV A;  4EMS A;  5F0H A;  3WTS C;  2DOF A;  3QOP A;  2JVH A;  3BG3 A;  5DCF A;  2L7M P;  3ZMT A;  1FIA A;  2R5Y A;  4OIP F;  4GRI A;  1P6R A;  4B3A A;  4C3I J;  2B7E A;  4A2U A;  1JI8 A;  4EM1 A;  5E79 C;  3CDI A;  3KP5 A;  4WCG A;  3GLL A;  4JX5 A;  2GIZ A;  4IF4 A;  1E3P A;  5FKN A;  2FNP A;  3T8R A;  1YS6 A;  3F21 A;  1WH5 A;  2YU3 A;  2M5W A;  4XBF A;  4F92 B;  4KIT B;  5J6X A;  4CGZ A;  2O5R A;  2ZXW H;  5EDN A;  3CUO A;  3PFI A;  1ZAO A;  4AD9 A;  5ED4 A;  1X2N A;  4R8H A;  4KMU X;  4MIM A;  1K6Y A;  3LA7 A;  3V8L A;  2WB1 N;  3BG7 A;  3GFJ A;  5LGT A;  2QCO A;  1XD7 A;  2JRT A;  3IKV A;  2LC2 A;  3B02 A;  2DTR A;  2HQR A;  4U0W A;  2KFD A;  4BH9 A;  3KET A;  2P7C B;  1VF9 A;  3WGI A;  4I09 A;  5DTD A;  4BAY A;  3AG4 H;  2EFW A;  3VEP A;  4XM3 A;  3GZ5 A;  2A6H F;  2EV6 A;  3W6J B;  3BWG A;  1A5J A;  5DDG A;  3PQJ A;  2JA7 J;  3LSR A;  2ESN A;  2CW8 A;  3K1N A;  4XRF A;  3ULQ B;  2MC4 A;  3HEF A;  4IHV A;  1WJC A;  2ZJ2 A;  4C3J J;  2HPM A;  4M73 A;  2BY2 A;  1BOA A;  1Z3X A;  3GO5 A;  4HF1 A;  4OMY A;  4RLQ A;  2Q8K A;  3T1B A;  1N78 A;  4PSW A;  2LVS A;  3EET A;  2E7W A;  4HLY A;  1OLT A;  2X85 A;  4M3G A;  1BM9 A;  3PSI A;  3CDH A;  3V7S A;  4BE1 A;  2L7K A;  3GTQ J;  4HNT A;  3FKJ A;  2LF8 A;  4Y17 A;  4LLG F;  2E1M B;  2DW4 A;  5FKM A;  4CZZ A;  1R1U A;  2GQQ A;  3H35 A;  5D6E A;  3MEX A;  1U8R A;  1RUN A;  3U2R A;  2VKD A;  4G7Z F;  5K5O A;  3GUD A;  3FXQ A;  3GTK J;  2CYY A;  3ZCO A;  4UB6 C;  4L9J A;  2RQQ A;  2HOE A;  3KP6 A;  3HRM A;  4ENM A;  4LB5 A;  1HF0 A;  4LD5 A;  4BXX J;  2I10 A;  1HQC A;  2AQF A;  3EYI A;  2JWT A;  2LRD A;  3DQV C;  1FYM A;  4G9Y A;  5M3F J;  1SFK A;  5EZG A;  2CV0 A;  1JKR C;  1ETY A;  3L09 A;  4MNU A;  3KLN A;  3LA2 A;  2R7Z J;  3M7G A;  4AVZ A;  3KCC A;  5LLQ A;  3GME A;  1VQ6 I;  1BOB A;  2K4B A;  3CCS I;  5CVV A;  4MEY F;  2DMU A;  5IOZ A;  2A6T A;  3ROU A;  1ZH5 A;  3HOU J;  4HF0 A;  1P2F A;  5E3M A;  1JT0 A;  1ZYR F;  1POG A;  1OR7 C;  1Z67 A;  2WY7 Q;  1YW9 A;  3Q0V A;  2EFP A;  4A6D A;  4CXF A;  4BKX A;  1PUF B;  1LDK B;  1W0U A;  4PJL A;  3RQ4 A;  2FUG 2;  2ID6 A;  2DDA A;  2F48 A;  1TQM A;  4ZYA A;  1E17 A;  1YQA A;  4ASN A;  4EGZ A;  3EQL F;  4G12 A;  2QM3 A;  1ZR2 A;  1MZB A;  3V4G A;  1Y0U A;  3EDP A;  1H8A C;  1WJA A;  2AO9 A;  2M7B A;  3IH2 A;  1Z6R A;  3MFK A;  2LG4 A;  2Y9Z A;  2R93 J;  3BG9 A;  5FLV A;  1ZGA A;  1HDD C;  2KRH A;  2F4I A;  4FQG A;  3S1Q J;  1TW3 A;  4BDY A;  5HLT A;  1WCM J;  1I50 J;  3OYC A;  2TRT A;  2HZT A;  1KZH A;  4BNC A;  4IKF A;  4ZTJ A;  1SAX A;  2FRH A;  1O3R A;  4A0Y A;  2JQ7 A;  4ZJZ A;  3DTI A;  4CUG A;  3BY6 A;  1IRZ A;  3AL0 B;  3U1K A;  3RSN A;  4OAZ A;  5LGU A;  5M5X J;  2JTV A;  4DGW B;  1QQI A;  5HDK A;  1WJD A;  3ASO H;  3F22 A;  3V8K A;  1IXS B;  2EV5 A;  2JN6 A;  5HOO A;  1T39 A;  2VE9 A;  1IN4 A;  1R5I D;  1KQ9 A;  3QPT A;  2HS5 A;  1XS9 A;  1J5Y A;  1MMD A;  3CQZ J;  3VSK A;  1FYK A;  3TDZ C;  1DP7 P;  1FJL A;  1ZRF A;  1OCP A;  1FYL A;  4PCQ A;  1V5G A;  3H9Q A;  4YFX F;  2NVY J;  1WI3 A;  1FBU A;  2EIK H;  4GDF A;  2XHK A;  3BQY A;  2L9S A;  3HBL A;  1E3O C;  4CIC A;  2YX4 A;  3OR1 C;  4CSW A;  2HEO A;  1LFP A;  1TQI A;  4QPQ A;  3BTI A;  4CHU A;  1WJF A;  1LQ1 A;  3DKW A;  3CUQ B;  1MMN A;  1ZAR A;  1XSX A;  3C2H A;  3ZQC A;  1VQ5 I;  3CUQ A;  3IH3 A;  3VYS B;  1FSH A;  4V2F A;  1U3E M;  3L00 A;  2IJL A;  5B66 C;  3WHC A;  3Q9V A;  4MFE A;  1QHH D;  4ABZ A;  2DCE A;  3RPQ A;  3H3V K;  5IYC J;  3H5R A;  5ILV A;  5H2F C;  2VC1 A;  2KIM A;  1MD0 A;  2R92 J;  1RRJ A;  3R6S A;  1MDM B;  4KNY A;  1OPC A;  3K4J A;  5C4J J;  2MAB A;  1DGR M;  4V2G A;  4CCM A;  1S6L A;  2EZL A;  5LD2 C;  2P6S A;  1MBE A;  2IEK A;  5FLX Z;  3PL8 A;  2QKM B;  2XDV A;  1EA3 A;  4IOA F;  4EJT A;  1I3A A;  2XGX A;  4Q5S F;  2VT2 A;  3KP2 A;  1QZZ A;  2A69 F;  1ENH A;  4A12 A;  3AFH A;  2DAO A;  3PQK A;  3BG6 A;  3BR1 A;  5TGT A;  5CVI A;  3CP2 A;  2NYX A;  1OQY A;  2DPU A;  1K78 A;  4W97 A;  3KYL A;  4DZP A;  1XGN A;  4U7B A;  4P9U A;  4XLA A;  3RCO A;  5KNL A;  2QKL B;  3CMA I;  5FLM J;  1B9M A;  1FSE A;  2KLO A;  4Y15 A;  1LUJ B;  3GZ6 A;  3I4M J;  2E2J J;  1YOV B;  3SDB A;  3FXK A;  4BE0 A;  1SAN A;  1QZY A;  5J40 A;  4MTE A;  4M3F A;  2LDU A;  1T95 A;  3SFZ A;  3BZ6 A;  1PP8 F;  1NH3 A;  4AIH A;  3TDU C;  2LBF B;  4L18 B;  3A0B C;  3ISP A;  4PGG A;  2K9L A;  5AIP A;  3QPH A;  3L2C A;  1IN5 A;  3MQ0 A;  4E7K A;  2WV0 A;  2EPF A;  1S8N A;  3P9I A;  3S3O A;  3QAH A;  5CPR B;  4I6Z A;  3TP3 A;  5CJ9 A;  1MBK A;  4FT8 A;  2A6E F;  1NK3 P;  1D0Z A;  5KVR A;  2YR2 A;  1FC3 A;  4C2M J;  2RAE A;  2AHQ A;  2ZC2 A;  4H0E A;  1ULY A;  3AG3 H;  2JK3 A;  4ZYH A;  1R71 A;  4DIQ A;  1G3Y A;  3JW4 A;  2MC3 A;  1GLN A;  1GUU A;  2ZBK A;  1CF7 A;  1O7L A;  2OC6 A;  3CC7 I;  2V6C A;  2DA5 A;  3KFW X;  4E7S A;  4FHT A;  2ZJR F;  3IV5 A;  3Q5F A;  4TV7 A;  3BTL A;  4BQQ A;  1JHF A;  4KA4 A;  1YFH A;  1SVO A;  1DU6 A;  5CKT A;  4XKV A;  3GFM A;  3TQN A;  1HW5 A;  2DT5 A;  1L3L A;  2D1V A;  1GV5 A;  3LSM A;  2VIX A;  3K69 A;  2E71 A;  3K9T A;  3QP6 A;  2LY2 A;  3E7L A;  4HX4 A;  3F23 A;  2ADU A;  1JTY A;  2ELK A;  2MLK A;  1MSF C;  3QWL A;  3EUA A;  1MMG A;  3CP8 A;  4WF2 A;  5J4V A;  1F43 A;  2EZK A;  3KYC B;  3MVP A;  1SFE A;  3W2A A;  3ZPL A;  2F5F A;  1YI2 I;  1O4X A;  1U5T B;  4U0Y A;  5E8G A;  2DMP A;  2Y9Y A;  3H5N A;  1N25 A;  3IRR A;  2VUM J;  2E2I J;  2FU4 A;  2JRM A;  3IH4 A;  1P7J A;  3RZO J;  1K4S A;  5DUK A;  2EK5 A;  3CJN A;  2LKX A;  2L02 A;  1IJW C;  3BOQ A;  2BOL A;  4RB0 A;  4IO9 F;  1GDT A;  1IC8 A;  4HQE A;  4BS9 A;  2R7O A;  3GWZ A;  1D1A A;  1XDU A;  3MN2 A;  4I7H A;  5H6R A;  2CV2 A;  2QSH X;  1USS A;  4LGW A;  2VQG A;  3MZH A;  4G6D A;  4ITV A;  5L3C A;  3FMQ A;  3ELK A;  4AUX A;  3OYJ A;  3TW7 A;  2PMZ N;  1F36 A;  5F08 A;  1GVJ A;  2BY1 A;  3GVA A;  1MBH A;  4PUS A;  3QYF A;  2XAU A;  3MZ8 A;  2DMQ A;  4C2U A;  4HQM A;  2MBF A;  1D1C A;  2ZSH B;  3B73 A;  1X3W B;  4OMZ A;  3RJP A;  2RN7 A;  4BQN A;  3F8M A;  5L3E A;  1T38 A;  2WC2 A;  3NWT A;  3FKI J;  2CFO A;  3K70 C;  4BEH A;  2XAS A;  4GGG A;  1J0R A;  5B5E C;  2QSF X;  2Q2E A;  5DD4 A;  3FXL A;  2Z5U A;  4KIC A;  3MKZ A;  3N05 A;  2M1B A;  1OKR A;  2R0Q C;  2HPI A;  3P9C A;  1UG2 A;  1BC8 C;  1CGP A;  2JVG A;  3FMS A;  2ME6 A;  4RGR A;  5LEJ A;  1REP C;  1TWA J;  2V9V A;  4LFU A;  1IN7 A;  1EV7 A;  4PJM A;  4J19 A;  4R1H A;  3DBR B;  1OMI A;  2JPB A;  2KT0 A;  2M9H A;  4B44 A;  3IUO A;  5IPA A;  2JMW A;  3CCM I;  1K6O A;  3IHU A;  5DUI A;  5IP7 J;  1U0J A;  1UEL B;  4OU0 A;  3S1N J;  2JT1 A;  2VXZ A;  1TNT A;  2BXZ A;  3QYB A;  3DBH B;  2O6G E;  2E2H J;  2LY9 A;  3HDD A;  3L2V A;  4BHC A;  1Z77 A;  3ZQH A;  2MSY A;  2XPV A;  2NVX J;  4E7J A;  2UXN A;  1VQ9 I;  3HYI A;  2VN2 A;  3O8G A;  2LYC A;  4EM2 A;  2DMN A;  3D1N I;  3SYT A;  1FMV A;  1WH7 A;  5K7Z A;  1B1B A;  2KIS A;  2V1N A;  4LK1 F;  3ECH A;  4L9V A;  4NQW B;  1ETW A;  3HKZ N;  1X2M A;  3BJ6 A;  2NNN A;  2DA3 A;  1TWC J;  4B43 A;  4HLX A;  3ERM A;  4CCO A;  5L3G A;  3L2U A;  4XLH A;  3F8C A;  4B4C A;  3MMY B;  4KMF A;  3KEO A;  2DJN A;  3ZP5 A;  3HZJ A;  4XID A;  2X6O A;  4A0Z A;  1Y8Q B;  3JTG A;  4FTH A;  3ZQL A;  1ZN2 A;  2HNH A;  2K27 A;  3VB2 A;  3S1R J;  4KIS A;  1WFX A;  2PMU A;  4JOM A;  1D0Y A;  1WWX A;  2N8G A;  2W24 A;  3QPL A;  3G1M A;  4XRS A;  2E60 A;  1JT6 A;  3IWF A;  2W85 A;  4IHY A;  2IA1 A;  2XPU A;  2ZSI B;  1V3F A;  3H3Z A;  3TBI A;  3UNG C;  1D8K A;  2H6C A;  2EH3 A;  2LNB A;  3HRT A;  2X48 A;  4XIC A;  4GO1 A;  4HX7 A;  4X0G A;  1R00 A;  2DO7 A;  4IQJ A;  1BW6 A;  3CLQ A;  1XX5 A;  1TWH J;  2E1C A;  5EGO B;  3GLX A;  4BUP A;  4IRI A;  2P0W A;  4U88 A;  1LE8 A;  5FD6 A;  4BDZ A;  1YIO A;  5KHD A;  4Q48 A;  5JR3 A;  3WG7 H;  4JBA A;  1JUP A;  2EZI A;  4R79 A;  2VOD A;  4WX9 A;  2K86 A;  2ZXI A;  2GIV A;  2QBY A;  4FAS D;  3JRH A;  2MA3 A;  3A2K A;  2KP6 A;  3CO7 C;  4XOT A;  2V9P A;  3GF2 A;  4UV9 A;  2EB7 A;  2OCC H;  1HKS A;  4XN0 A;  2VQL A;  3HPH A;  3CCL I;  2KDO A;  3PO2 J;  1HCR A;  2EFO A;  2VJ5 A;  1TC3 C;  3KZY A;  3WHB A;  4IX7 A;  2ECB A;  4KFC A;  5IT3 A;  1TQP A;  5J8C A;  4WK8 F;  3C7J A;  2HKX A;  2MD0 A;  3HGY A;  4MEX F;  1B72 A;  3PJR A;  1TL8 A;  1U2W A;  1I1G A;  4RGS A;  3CZ6 A;  2WAF A;  2AS5 F;  3V42 A;  1GV2 A;  3H1C A;  5HLG A;  2R7R A;  2LFB A;  4BHB A;  2DOE A;  1W7P A;  2E1M C;  1UJ8 A;  1T0F A;  4O5V A;  4DOZ A;  1QRY A;  4XKC A;  4MGR A;  3CCU I;  3S16 J;  2A3S A;  2QEX I;  3LSK A;  4BL0 B;  2RNG A;  3G4S I;  3AG2 H;  5K5Q A;  2A5W A;  2XRL A;  4A3C J;  4JX6 A;  1A6I A;  1LEA A;  2XC7 A;  2BVM A;  3CO6 C;  2V9K A;  3ZR8 X;  4D7N A;  3G73 A;  3FWE A;  2HZD A;  1RES A;  4RMN A;  3QU3 A;  2NVU B;  2EIL H;  5EG0 A;  3OYE A;  2ISY A;  3SFI A;  1U8B A;  3TP0 A;  1Y6I A;  2LRE A;  2W82 A;  3SJM A;  2X6X A;  1HKQ A;  3E97 A;  4LLN A;  1XN7 A;  3G6E I;  1I5Z A;  5FFX A;  5HLI A;  4YG2 F;  1XCV A;  1XGM A;  4ZYE A;  3OYN A;  1TWF J;  1NHA A;  2LD5 A;  3KZZ A;  4A5N A;  2NS7 A;  1LPQ A;  3HOT A;  1SFO J;  5C4X J;  2EIJ H;  4E7Z A;  2Z3Y A;  3D5R C;  4F91 B;  2KPM A;  1AKH A;  3L1P A;  2H94 A;  3ABU A;  2VOP A;  2HKO A;  2GZW A;  3LNQ A;  4DQ2 A;  4UV8 A;  4S04 A;  3P5J A;  5M5W J;  2OU2 A;  5DCM B;  2WA0 A;  4M6X A;  2L0K A;  2V1D A;  2LTP A;  2EIM H;  4XOP A;  2R7T A;  4MQ9 F;  3K4B A;  3SZP A;  2M4K A;  2R5Y B;  3GFL A;  3H5A A;  1S7A A;  1W36 D;  4EM0 B;  5FGM A;  2XAF A;  4IVN A;  1KYZ A;  2TCT A;  1IUY A;  1I6H J;  5GAE J;  3HSF A;  3L7W A;  3AL0 C;  3VSL A;  4X6A J;  2QVO A;  2JJ7 A;  2MH2 A;  5CVU A;  4BJ5 C;  1ETX A;  4X1E A;  3MZY A;  1Y8R B;  4YRV A;  5B3S H;  3ZRG A;  2NNY A;  4UNO A;  4FCY A;  4XLF A;  3AG1 H;  2QLZ A;  2F5V A;  2BXY A;  3E6B A;  4G6Q A;  3DCF A;  3S17 J;  1WPK A;  1VQL I;  1D8J A;  4E70 A;  2FSW A;  4RGX A;  1RET A;  2ZME A;  5DV5 A;  3ZMV A;  3CCE I;  2PMH A;  2BY0 A;  3L2W A;  4D1Q A;  2XSJ C;  2PI0 A;  2PN6 A;  2ESH A;  1BR1 A;  4XLN F;  5TJJ A;  2RQP A;  1W7P D;  3VWB A;  4XRS G;  3CUQ C;  4B3X A;  3FK6 A;  5D8K B;  2DPD A;  2V7F A;  5E17 F;  3B6C A;  1R1V A;  1MW7 A;  2X51 A;  2MFZ A;  2Y48 A;  5GAG J;  4UUV A;  1IZ1 A;  1C0W A;  5D8L B;  2OBP A;  2XIG A;  2DT6 A;  3VYT B;  3RKQ A;  3OS0 A;  1H9T A;  2QA4 I;  1QVT A;  2M0M A;  3SXY A;  3WGH A;  1X1B A;  2JZY A;  4MFD A;  2HOT A;  4PJJ A;  5IYD J;  4EJV A;  1IRX A;  4ENJ A;  1R5H A;  2WBM A;  4DYC A;  4ESF A;  3KIO A;  2CSO A;  2GA2 A;  4CDG A;  1FOX A;  2CW0 F;  1I27 A;  1VQO I;  3L2Q A;  4CA0 A;  4RAY A;  3GTM J;  5C3E J;  1B8I A;  2DOA A;  1ZG3 A;  4BQO A;  2VBZ A;  3OY9 A;  4A3G J;  3K4C A;  1TNS A;  4ESB A;  4E7I A;  2GWR A;  1J9I A;  5E20 A;  3CES A;  2F4M B;  2HXO A;  3CCY A;  1FBQ A;  4EGY A;  2LLK A;  1FLI A;  4NC6 A;  4CYC A;  2CU7 A;  2WAD A;  2O8X A;  3QQA A;  3V8J A;  2OD5 A;  4HF2 A;  3A03 A;  3NAU A;  1IDZ A;  3EYY A;  1S7E A;  5D4R A;  3RKX A;  4A6E A;  2ZNY A;  3S1M J;  3HOX J;  4A3J J;  3RKY A;  3BR5 A;  3MWM A;  3A02 A;  3CC2 I;  4OOI A;  2YPR A;  3WTV C;  1K61 A;  4F52 A;  2F5E A;  1ZG1 A;  4KIB A;  2VJJ A;  3K4M A;  3T5X A;  1KA8 A;  2ZFW A;  3M8E A;  2V26 A;  2D5V A;  2DLL A;  4HV5 A;  4PZJ A;  2G7H A;  4A3F J;  4XOR A;  3DTE A;  4IHT A;  4NHJ A;  4K2E A;  4XNF A;  2HYG D;  3OOP A;  4N9H A;  3H92 A;  3KYD B;  2M4G A;  2O0Y A;  3DWL E;  4M74 A;  2W7N A;  1X58 A;  4EVI A;  2DBB A;  5DM7 F;  4IXA A;  3A01 A;  3K4N A;  3REO A;  2GM4 A;  2EWN A;  1BI3 A;  1MMS A;  2L4A A;  2EQR A;  2GXG A;  4E7L A;  2BW3 A;  4S0H B;  2CS3 A;  5IP6 A;  4IHS A;  1JTX A;  1YW7 A;  2Y0S A;  4LG0 A;  4DBR A;  2HFH A;  1RC9 A;  4DZJ A;  2M45 A;  2L9N A;  1DDN A;  1FOK A;  2FML A;  1T33 A;  5F1J A;  2DA2 A;  5KAF C;  2UWM A;  3KX2 A;  4M3B A;  3WU0 A;  4RB3 C;  1R9T J;  3WTX C;  3ZGK A;  5JVT A;  2L01 A;  2MYS A;  4F7Z A;  1ZLK A;  3WOD F;  4RBO A;  3ZMZ A;  1MMA A;  3BR3 A;  3WTZ A;  1IRG A;  3JRI A;  2CWE A;  4HV6 A;  2L7F P;  3MD2 A;  5EZH A;  3F3X A;  2CO5 A;  1V55 H;  2E5Z A;  2X1C A;  3I3L A;  5E8I A;  3M3Y J;  1NK2 P;  2CH0 A;  3FXU A;  1DU0 A;  1VND A;  4U7D A;  2IS4 A;  2CFX A;  1ETV A;  2P81 A;  3M07 A;  1U5T C;  2NOG A;  2OZU A;  3FX3 A;  4RAF A;  3BRO A;  3WTT C;  3DXJ F;  3LQR A;  2OTJ I;  5J4Y A;  3FXR A;  2G0E A;  3GBG A;  2IXS A;  4NNJ A;  4BJT A;  5FKK A;  2KZG A;  3WE2 A;  1KU3 A;  2W84 A;  4P1W A;  2R7Q A;  4AIK A;  3HM5 A;  4E7H A;  1G2H A;  1IRF A;  1VZ0 A;  2IT0 A;  1F5T A;  4I0B A;  4UUT A;  2OQG A;  3GTJ J;  1A36 A;  2LMD A;  3FIS A;  3EPZ A;  2FBK A;  2Q1Z B;  4P96 A;  1W1W E;  4HST A;  5GPA A;  4WWC A;  2HQ5 A;  3LSP A;  1MNM C;  1B9N A;  1OYI A;  1QNT A;  4WXC A;  2YU9 J;  5HVQ C;  1UHW A;  4UVB A;  4ENK A;  2HVR A;  4QTR A;  1SD6 A;  2OAZ A;  1MJA A;  3F8B A;  5BQT A;  4AYB A;  3TL4 X;  5J1Y A;  5B1A H;  2NS8 A;  1KQ0 A;  4GYI A;  2R7U A;  4BY1 J;  3ABM H;  3R0A A;  2R7W A;  2H27 A;  3NEU A;  4M71 A;  3RQI A;  3J81 Z;  4XON A;  2HR3 A;  4PJN A;  1KU2 A;  1DGW Y;  1MND A;  1PUE E;  4BBS J;  2ECC A;  5FKO A;  1SVM A;  2R7F A;  1LB2 A;  3WTY C;  5TRD A;  2FOW A;  4B47 A;  4OIN F;  4I99 C;  3BG5 A;  3R0J A;  2QQ8 A;  3A0H C;  4XN3 A;  2VKV A;  3HJE A;  2OQR A;  4MQV A;  4YFN F;  1L0O C;  3FDY A;  2V6E A;  1K78 B;  5C44 J;  2MGQ A;  2HYF A;  1RR7 A;  4RM2 A;  4RLF A;  2R4G A;  1IUF A;  1O7F A;  3QOE A;  3S2W A;  2NAZ A;  1UFM A;  4PSX A;  5CQG A;  1QVU A;  4GYG A;  1KYW A;  2PBI A;  2IRF G;  5BMZ A;  2X1E A;  2M2E A;  3IAM 2;  3P7N A;  3CMM A;  2DA7 A;  1S7O A;  1UG0 A;  1MJ9 A;  3HOW J;  4HOB A;  2JA8 J;  2FNA A;  3E1S A;  2L4M A;  1LFU P;  4KYW A;  3PNT A;  1SVL A;  2FOK A;  1I3Q J;  1YJ9 I;  3HPG A;  1ZR4 A;  3OYK A;  2LP0 A;  1VQ8 I;  3LSG A;  2QZ8 A;  3GW2 A;  4DNC A;  4A3I J;  4JQF A;  2DFH A;  5F64 A;  1WRJ A;  2A68 F;  3GX4 X;  1FWZ A;  1X4O A;  4OIR F;  3ABL H;  4CO8 A;  2W48 A;  2ELH A;  4A3B J;  2DXI A;  1HW1 A;  4LIU A;  2ZJP F;  2L9V A;  2WAQ A;  3ZQG A;  1H89 C;  1ON1 A;  4HRI A;  1PYV A;  2L2O A;  2DOD A;  2XSD C;  1CF7 B;  2QUF A;  1BIB A;  1EKE A;  4QLC U;  3ZN0 A;  2HGC A;  5ICG A;  3HTU A;  2FXA A;  4XSZ F;  3ZN1 A;  5H6Q A;  2GLO A;  1TT5 B;  4G7H F;  2F6C A;  5IP9 J;  3C2G A;  5E1Z B;  3GTG J;  2LSO A;  3LA3 A;  2PLY A;  3PUB A;  2QQB A;  4LMY A;  2GBY A;  1ITY A;  1Y39 A;  3HG9 A;  1VQ4 I;  4IPA A;  4EJU A;  2ZCW A;  2ID3 A;  2M8E A;  1J09 A;  3I53 A;  3JTH A;  2BGC A;  3S3M A;  4HNV A;  3OL4 A;  3E5U A;  1X4P A;  1RI7 A;  3KP4 A;  3CCJ I;  1ZEL A;  3E3V A;  1UST A;  5D6F A;  2CUE A;  1PDN C;  3OS1 A;  1WZ2 A;  4HX8 A;  1IDY A;  2CUZ A;  4FE7 A;  4OIQ F;  4XMY A;  1P4A A;  3TKY A;  4F93 B;  2VJI A;  1MBJ A;  3NWS A;  3OIO A;  1W36 C;  4G94 A;  1R22 A;  1Z7U A;  1YRN A;  1V5E A;  1SFX A;  3W6K B;  5FJ8 J;  1BJZ A;  4ZTF A;  2EJR A;  1Z05 A;  3W3C A;  3HGG A;  4RA2 A;  5E3O A;  4O6J A;  3TMO A;  4OWR B;  3S8P A;  4AC0 A;  2HU9 A;  3UKG A;  2LY1 A;  3FBN B;  3HHG A;  2CQX A;  4L9T A;  2XB0 X;  2QYO A;  3EUH A;  2COB A;  4QPO A;  3WU1 B;  5HLH A;  4MTD A;  3WU2 C;  3LFU A;  3AAF A;  4IOC F;  4KN4 X;  5FRM A;  4RB1 A;  1G6N A;  4CCJ A;  3FIW A;  1XDS A;  3ABK H;  5FKL A;  1SMT A;  4UHT A;  2K9M A;  1JGG A;  2F5D A;  3DV8 A;  4Q47 A;  2WWY A;  2BV6 A;  1Z21 A;  2L7Z A;  3BLY A;  2Y31 A;  3JSP A;  4G7O F;  1BIA A;  4PFP A;  1BN5 A;  2BZT A;  3FXM A;  2VJ4 A;  3OMY A;  1GT0 C;  1T98 A;  1VI0 A;  2RNJ A;  2GA1 A;  3VPR A;  4LK0 F;  3SEQ A;  3DU5 A;  5ILU A;  1YHQ I;  1R49 A;  2UXX A;  3LSJ A;  1HC8 A;  5M3M J;  4RB2 C;  4BEH B;  1SMY F;  1XGS A;  2P6T A;  4XKW A;  2F2E A;  3WG9 A;  2Q2E B;  2KRF A;  3JRB A;  1WGX A;  3BJA A;  2DK8 A;  5GPC A;  1TBX A;  2OJE D;  2IGK A;  2K3P A;  5F0F A;  2GXA A;  3QP5 A;  2K40 A;  1MGT A;  1RKT A;  3KLO A;  3CJR B;  4B1R A;  1MH3 A;  3RTR A;  1OCZ H;  4YEJ A;  1AHD P;  4RS8 A;  3KZI C;  5J1R A;  5D5V B;  4DBQ A;  3I64 A;  5J1U A;  3OL3 A;  2QQA A;  4L5E A;  4I02 A;  3I0T A;  3HIF A;  1ZKG A;  1K79 A;  2W25 A;  2W57 A;  4IJA A;  4I76 A;  3V7C A;  1XC5 A;  4NC8 A;  1WVR A;  1R5G A;  2VI6 A;  2VT3 A;  2NRA C;  1Y56 A;  4HZF A;  5K7F A;  2VQC A;  4UB8 C;  4XLC A;  1LVK A;  4FE4 A;  2HQA A;  3ZMU A;  2F4O B;  2P4W A;  1JKQ C;  1RR8 C;  1S72 I;  3O3K A;  3O2P E;  5ICF A;  2XUB A;  4UUS A;  4OAY A;  4LIV A;  3TO6 A;  2M87 A;  3DLA A;  2NS0 A;  2ZKZ A;  2COM A;  2IA0 A;  1ZGW A;  2RRE A;  3OYG A;  2A05 A;  2BEO A;  3VYR B;  1U6G A;  1A35 A;  1R23 A;  4PJ0 C;  4GCV A;  3I54 A;  2UZK A;  1UHM A;  1XPX A;  1S9H A;  2LF7 A;  3L2R A;  3I59 A;  5ILS A;  2P8T A;  2K3F A;  2FQ4 A;  3FXO A;  1MSE C;  1CQT A;  1ZRE A;  4LG3 A;  1QO0 D;  5BPI A;  1F1Z A;  1N75 A;  1XMX A;  4A3D J;  2OV7 A;  2AXL A;  1DPR A;  2JA5 J;  1RKW A;  2RV8 A;  2IAI A;  5F27 A;  3JRG A;  3CC4 I;  3DLL F;  2XVC A;  3FM5 A;  3VDX A;  3LWF A;  2DT7 B;  5HS7 A;  5HOD A;  5K7H A;  1LDJ A;  4DYR A;  3COA C;  1LKX A;  1YIJ I;  2H1K A;  3WTW C;  1UHS A;  2KHM A;  3PIP F;  3A4C A;  1ONV A;  2ZME C;  4HA8 A;  3BPX A;  1IV8 A;  1OCT C;  2HDW A;  2QF7 A;  2I5U A;  1KU9 A;  1LE8 B;  3BPV A;  1X1P A;  3TOB A;  2OPT A;  4Z2Y A;  1EJ9 A;  3S14 J;  3LSH A;  1HW2 A;  3ZQF A;  4BAC A;  4M3E A;  1DP3 A;  3ASN H;  2QBY B;  1FY7 A;  2VAS A;  5AON A;  4BY7 J;  2O61 A;  2Z99 A;  1BA5 A;  4XK4 A;  3S93 A;  4CCN A;  1Z0X A;  1H88 C;  1IG7 A;  2HXI A;  2A07 F;  2L5Q A;  4ZC3 A;  2R7D A;  3E0J B;  1IXR C;  1T2K A;  4M72 A;  4DYQ A;  2XKP A;  3TGN A;  1ON2 A;  2O9L A;  1G3W A;  1B72 B;  4EJW A;  2K85 A;  4E6K G;  5LHG A;  3CD6 I;  2EA4 A;  2IVM A;  1FOW A;  3IC7 A;  2NVQ J;  4LJZ F;  2HVQ A;  1JE8 A;  3H0G J;  4M6V A;  4ON0 A;  1W7P B;  2PJR B;  1SC7 A;  4M9Z A;  1D5Y A;  4IEJ A;  4IRH A;  2PJR A;  1RIO H;  1FP2 A;  3NAR A;  1HA8 A;  2P5K A;  5CYV A;  2CQN A;  3HOS A;  3ECO A;  1SD5 A;  1WKM A;  3PIO F;  2VLA A;  2FBI A;  1V5F A;  3HXL A;  1S5L C;  5ICE A;  3FXJ A;  4L5J A;  4JYK A;  2HYJ A;  3OIQ A;  1PVE A;  5KAI C;  3I55 I;  1VTN C;  3W2W A;  1Z6T A;  5F0C A;  4XQF A;  5E1X A;  1GXQ A;  4D5F A;  4DW6 A;  2BHY A;  1Y0N A;  2WY8 Q;  5HDG A;  3SEZ A;  2FJ1 A;  4F55 A;  4CYD A;  3J81 K;  3OOU A;  2Z2S B;  2HVS A;  5EG0 B;  5D5X B;  4QIW N;  3OYL A;  1ETQ A;  2VPR A;  4LLL A;  3QRF F;  1A04 A;  2A5Y B;  3DBL B;  1ZHF A;  3QPS A;  1XG1 A;  4RDU A;  2BYV E;  2H09 A;  3ZMD A;  3DEW A;  2MW8 A;  5J8F A;  1TWG J;  2E7X A;  2STW A;  3C1D A;  5IT9 K;  1W5T A;  4UY8 I;  5KCM A;  2M7A A;  4ZDP A;  1FIP A;  1G3T A;  1WQ2 A;  3B6A A;  1AKH B;  3OYF A;  1F4K A;  1I1S A;  3HUG A;  3DKX A;  3J7Z I;  3S3N A;  1W5S A;  5TIS C;  3H3U A;  1A6Q A;  2KDZ A;  1QZE A;  4JK1 X;  2JA6 J;  1ERD A;  1IO2 A;  5GAD J;  4A3K J;  3E5Q A;  2XAQ A;  2RKH A;  2FQ3 A;  2P5L C;  4LB6 B;  5HNF A;  2XF7 A;  4Y3O A;  2FEZ A;  3MCZ A;  4D5C A;  1OYW A;  3BR2 A;  1FT9 A;  2Z1D A;  3OYA A;  1VQM I;  2D2W A;  2MG4 A;  1JUM A;  3OR2 C;  4BGD A;  4XLE A;  3K4K A;  5LGN A;  1Z3Y A;  5CVR A;  2OA4 A;  2IGM A;  4I98 B;  1JXS A;  3Q9S A;  1OCC H;  1HXD A;  1XCB A;  4HDV A;  1AWC A;  2KMU A;  5LHI A;  3E5X A;  3I5U A;  3TO7 A;  2IPQ X;  2JUC A;  1OCR H;  1IAW A;  4LIT A;  2QEN A;  4RM3 A;  4CCL A;  1ZK8 A;  2KL4 A;  4D9J A;  5LEK A;  3U21 A;  3CME I;  2ME0 A;  3PFY A;  4BE2 A;  2TDX A;  2ZME B;  2DTZ A;  1BI1 A;  1R36 A;  3GXO A;  3LMM A;  4FET A;  1ACI A;  4A3E J;  4XSX F;  2ZNZ A;  1U78 A;  1YJN I;  1B59 A;  2VE8 A;  4D0P A;  1Y1W J;  2CG4 A;  2XB5 A;  1RZ4 A;  1TP4 A;  1SD7 A;  2XAG A;  3SQN A;  1EF4 A;  4GXO A;  4IHW A;  2LKP A;  4P55 A;  3FM3 A;  5BS6 A;  2XPW A;  3GYH X;  2XRN A;  1VQN I;  3GTL J;  1XSD A;  5DYM A;  1OJL A;  2ZB9 A;  1HDP A;  4I01 A;  4ZDO A;  2KIF A;  3KP3 A;  4NUB A;  2BHZ A;  3T8T A;  4M3D A;  2HDD A;  4BU2 A;  3OYB A;  3K1M A;  1G4D A;  5K5R A;  2CW7 A;  2K7L A;  5HS9 A;  3H36 A;  1PJR A;  1UAA A;  1XTA A;  5E3L A;  3ZQ7 A;  1MH4 A;  3H9J A;  3OS2 A;  2ACJ A;  1LEB A;  1ZRC A;  2E5N A;  3PM1 A;  1HST A;  1YYV A;  3R61 A;  2CQ7 A;  3K70 D;  3PUF A;  1AU7 A;  4B09 A;  2V1X A;  3I9V 2;  3KEQ A;  1B8I B;  1VQK I;  1QPM A;  2GAU A;  2CRG A;  4D7M A;  2DFE A;  3RDI A;  3K6G A;  2QQ9 A;  4BHP A;  1M1E B;  2DI3 A;  2AXT C;  1S3J A;  2D1H A;  2V4J C;  3CF5 F;  4ENN A;  1O3Q A;  4AM3 A;  5IYB J;  4FX0 A;  4CYC B;  2Y0S N;  2VPL A;  3LFK A;  1XGO A;  1T6S A;  1ETK A;  1O3T A;  5JHU A;  2W4S A;  4Y13 A;  2Y69 H;  3QU6 A;  3K10 A;  3IKT A;  5EYR A;  2FBH A;  5A2Q K;  2DN0 A;  2DJI A;  4HSR A;  3SHF A;  1QHG A;  1WSU A;  2FA5 A;  1HSJ A;  1FZP B;  2PEX A;  4MLO A;  1R7J A;  2RVC A;  3RZD J;  2NXN B;  3J80 K;  5H20 A;  1OFC X;  1W0T A;  2Z33 A;  2DQR A;  2WB1 A;  5GP9 A;  1J75 A;  4NBQ A;  5B1B H;  3VOE A;  2KIQ A;  2H6B A;  2L54 A;  4II2 A;  4EAT A;  5EEA A;  3CTA A;  2ZJQ F;  1HKT A;  3F6O A;  1FTZ A;  1IGN A;  2DU9 A;  3Q3S A;  3RYP A;  1NG7 A;  3C18 A;  3G3Z A;  3A01 B;  2JUG A;  3R4K A;  1XMK A;  3CCV I;  1R58 A;  2E19 A;  4A69 C;  4C3H J;  1QBJ A;  2IS6 A;  2R7V A;  2IGO A;  3QOD A;  2BW3 B;  3JRC A;  2M3A A;  1XSV A;  2F5C A;  3DPT A;  1QPI A;  2VKE A;  3O8H A;  4ZYD A;  1IXC A;  2XGD A;  3F9K A;  3AKZ A;  4J01 A;  3K4L A;  4HDU A;  2A61 A;  3EUK L;  1VFC A;  1MBF A;  4LG0 B;  5LFA A;  5HDN A;  4XL9 A;  1YTY A;  2FMY A;  2IW5 A;  4ZYG A;  1ZRD A;  1V54 H;  3HB9 A;  1H0M A;  4AYB N;  1XB4 A;  4N4N B;  2CGP A;  3CDL A;  3OV8 A;  1WJ5 A;  4FX4 A;  5FB2 A;  1PUF A;  1VQP I;  4U0V A;  3L9F A;  3M4O J;  1R4N B;  2LOO A;  2K9S A;  3FHN A;  3PSF A;  5CLS A;  2JPC A;  1G3S A;  2VXD A;  3I71 A;  2FF4 A;  3M8F A;  1YX3 A;  2P5V A;  4ZZD A;  1OCO H;  2CJJ A;  1DUX C;  4IL6 C;  2IGN A;  3D5S C;  2DA1 A;  5GAH J;  3DKY A;  5BNG A;  3M8J A;  1P92 A;  3HHH A;  3J7Y J;  2FD5 A;  4LOC A;  1NG6 A;  2PQ8 A;  4IQ4 A;  2KKO A;  3JRE A;  3W6V A;  1YO5 C;  3GEZ A;  4U87 A;  5E3N A;  2Y75 A;  4A3M J;  2OTL I;  3EUH C;  1A31 A;  4XLP F;  3HTS B;  4YIF A;  1W4M A;  2K4J A;  3ZXS A;  2X0L A;  1J59 A;  2WTE A;  1FPQ A;  5J47 A;  1E0E A;  3OWT A;  3OYD A;  2VB6 A;  3DFG A;  3Q0U A;  3ONQ A;  2HQN A;  2EZH A;  4ETS A;  3I4P A;  2CUJ A;  2RGV A;  2XF5 A;  4AU7 A;  3RI4 A;  2EA2 A;  3DP7 A;  2PX9 A;  3U9G A;  4HEA 2;  1JUS A;  1IN8 A;  3QYE A;  1QA6 A;  1WJE A;  1WI9 A;  2EFQ A;  4G8X A;  5E1W A;  1MIJ A;  4WXH A;  1BR2 A;  2Z9O A;  2BY3 A;  1K7A A;  1X1C A;  3N4M A;  4C30 A;  1X3Z B;  2ZO4 A;  4ZZL A;  2M34 A;  5ICC A;  1T56 A;  1TZL A;  2UV1 A;  5LBQ A;  3BCB A;  2X6Y A;  2WAQ N;  3OSG A;  3F8N A;  3ERE D;  3NQO A;  1ZG5 A;  1SD4 A;  4UVC A;  3VYU B;  2DA6 A;  3GFI A;  3G1L A;  2O03 A;  2XGE A;  5F04 A;  2HDC A;  2J5P A;  4RGU A;  2B0L A;  5DS9 A;  2VKH A;  3FHZ A;  5FFZ A;  2GXB A;  5IT9 Z;  1QGP A;  3WTU C;  1LVA A;  1MDM A;  5FRO A;  4NC7 A;  4UVA A;  1FTT A;  4Y52 J;  3ZMS A;  2JSC A;  1FMW A;  1Z1D A;  2UUZ A;  2Y2Z A;  1E2X A;  2MH9 A;  1Q1V A;  2B9S A;  1EH7 A;  1FBS A;  1FNN A;  3D0S A;  4GFB A;  3BJO A;  1KGS A;  2EBI A;  1F9N A;  4B8X A;  1X19 A;  1HBX G;  4L9N A;  3X2Q H;  4IRG A;  4BBR J;  3DF8 A;  5HNH A;  3P9K A;  2MLG A;  3G71 I;  1K83 J;  1P4X A;  2DQL A;  1STZ A;  3DEE A;  5EF6 A;  3S32 A;  2I8D A;  3UR3 C;  4KIF A;  1G59 A;  3C2B A;  5L3F A;  5D4S A;  4O3M A;  3E6D A;  1T8I A;  3HOV J;  1JKO C;  3JRA A;  4KIG A;  3I4N J;  4MHG A;  1D5V A;  1FX7 A;  4N9I A;  2CMP A;  2LK2 A;  5CVJ A;  3T0Y A;  5JLX A;  2R3S A;  2CQK A;  3LST A;  2CQQ A;  4B48 A;  1N77 A;  5JVG F;  4YIR X;  5JLW A;  2IBD A;  3M1C A;  1TLH B;  5D5U B;  2W1O A;  4UXN A;  1SAU A;  1ZTR A;  2LBF A;  3I58 A;  3DEU A;  4IHX A;  2E36 A;  2KIU A;  2XGC A;  1RNL A;  3SZG A;  4YII A;  5HS8 A;  1UMQ A;  3U1D A;  2QGU A;  3BT9 A;  1OR7 A;  3S2H J;  4C9Y A;  3S15 J;  2O7O A;  4JX4 A;  3BZK A;  4N0B A;  5LHH A;  3OYM A;  3Q0W A;  4P9F A;  3MAJ A;  5D5W B;  1BI0 A;  4W1U A;  4AID A;  2YUS A;  4BQA A;  4HG2 A;  4ZH4 F;  3BTJ A;  2KQR A;  2DYR H;  1SFU A;  2X9D A;  2VC0 A;  4P5O A;  1BI2 A;  1XMA A;  5J3L A;  3CJT B;  4L5I A;  3BTC A;  3LAJ A;  1YRN B;  3KP7 A;  1MJB A;  4Y7N J;  4M9X A;  3F0C A;  3ESW B;  2OCE A;  1V4R A;  4H4K C;  1MKM A;  3MKY B;  2M30 A;  2OZ6 A;  3IRQ A;  4BJ6 C;  2J5O A;  3BR0 A;  4ZDL A;  4BYY A;  5GTH C;  3CCR I;  2ICW G;  3HOY J;  4KDP A;  4A3L J;  1BR4 A;  4FIS A;  3WE3 A;  3JAM K;  5GTI C;  2DFF A;  1IW7 F;  4XKB A;  3DTK A;  4NB5 A;  3OYI A;  5CQE A;  2VBY A;  3FK7 A;  5DM6 F;  4KT6 A;  5JHF A;  2P7V B;  1EH6 A;  2XAH A;  5KK1 A;  3N97 A;  3K1P A;  2L3D A;  1I39 A;  1TW2 A;  4XRM A;  1U5T A;  4A93 J;  1BJA A;  3ZOB A;  3F6V A;  2E1N A;  2C6Y A;  2VL8 A;  4AWX B;  3HRU A;  3K7A J;  3PO3 J;  5A2Q Z;  1ETO A;  3RPU A;  1T0F C;  3CF2 A;  5K1Y A;  4YEL A;  1D3Y A;  2HWV A;  4CZC A;  2YX7 A;  1ODD A;  5EJC A;  2K9Q A;  2IS1 A;  3F72 A;  1YG2 A;  2X6W A;  3JRF A;  3J80 Z;  5EEG A;  1JHH A;  2LH9 A;  1TT0 A;  2K9N A;  2ZFU A;  5AIQ A;  3M9A A;  5M5Y J;  1BW5 A;  1O57 A;  3CLO A;  3VOD A;  2GOM A;  1RUO A;  2KJC A;  4HBL A;  3OYH A;  4BXU A;  2E35 A;  2X4H A;  3OIP A;  1YE9 A;  3TOA A;  4A5M A;  2FE3 A;  1S29 A;  4N4O B;  4EJO A;  1Z91 A;  3HRS A;  5LRS A;  3SZT A;  1X1D A;  3ABT A;  1B6A A;  2ZXH A;  1GHC A;  2DFI A;  1JJ6 C;  1BL0 A;  4UUS B;  2O8K A;  3H0D A;  1LDD A;  2V1U A;  3TO9 A;  2ZXJ A;  3PNY A;  1AA7 A;  3HL2 A;  3G2B A;  1B4A A;  3HSE A;  4EEF G;  5F1R A;  3C3W A;  4PDK A;  4M9S A;  2H8R A;  1APL C;  1D1B A;  2D45 A;  2DDB A;  1FP1 D;  5ERI A;  1MBG A;  2OF7 A;  4XR6 A;  1X1A A;  2IA2 A;  3VFZ A;  2LR8 A;  3I59 B;  3E6M A;  4PK4 A;  1I6X A;  2VON A;  4J00 A;  1IF1 A;  1T08 B;  3GZN B;  2YSR A;  1EH8 A;  3MKL A;  4C2T A;  3HSR A;  2PMZ A;  3KE2 A;  1ZLJ A;  3SDG A;  1ZGJ A;  2XRO A;  1PP7 U;  4QWQ A;  3D5L A;  4KUM A;  1W5C C;  4OIO F;  1DPU A;  1E3H A;  1YS7 A;  5L3B A;  2ETH A;  4S05 A;  2XAJ A;  3FBI B;  2G9W A;  2WAE A;  4EV0 A;  4HAM A;  4NQW A;  4KN7 X;  4I2O A;  4PGH A;  1HOM A;  4Y33 A;  3M1E A;  1LNW A;  1O3S A;  2RDP A;  1D0X A;  3BR6 A;  1YW8 A;  2EFN A;  3BZC A;  4RAG A;  2R7S A;  5EEH A;  2H8W A;  1ZQ3 P;  1DQU A;  1QU3 A;  5DEQ A;  5JFR A;  4IZZ A;  4Y4R A;  3LOC A;  4KT5 C;  2VBX A;  1R4M B;  3RYR A;  3R60 A;  1X3U A;  2M0C A;  1JJ8 C;  2Z16 A;  3ML6 A;  2IP2 A;  1JGS A;  2CUF A;  4I0A A;  5BPD A;  2PG4 A;  2VOO A;  1K4T A;  2HOS A;  2K5C A;  4KJZ A;  2BBY A;  2XV4 S;  3RPU D;  3J7A Y;  1U9N A;  1MNE A;  5E18 F;  3JRD A;  2Y0M A;  1R1T A;  1GVD A;  3LSI A;  2L9R A;  1HLV A;  1Z9C A;  2BE5 F;  3I56 I;  2DK5 A;  2NOJ B;  2X1D A;  1JKP C;  3PNV A;  2IS2 A;  1J2X A;  2HOA A;  1P7I A;  4CH7 A;  5EGO A;  2NVT J;  4HPQ A;  4QSH A;  2DA4 A;  1WJB A;  1R6R A;  2YS9 A;  3DPL C;  1AOY A;  3BP8 A;  1H9G A;  1UB9 A;  3ZQQ A;  3MKW B;  3HKZ A;  3W2V A;  3CJQ B;  3DU6 A;  2GOX B;  3RIR A;  1YJW I;  1LJ9 A;  3K2Z A;  1KON A;  2QSG X;  2STT A;  2EV0 A;  2E1O A;  4DJA A;  4WXD A;  2QWW A;  5IY5 H;  1OYY A;  2B63 J;  2HI3 A;  2MD5 A;  3FMR A;  3H9G A;  1SEU A;  1KQ8 A;  4V19 K;  5BOX A;  3V7R A;  3KPH A;  4YFK F;  1Q1H A;  4HYE A;  4II3 A;  3HC7 A;  4F3Q A;  2H1L A;  1FOY A;  1J7K A;  1WHU A;  3LL7 A;  3BDD A;  3LQQ A;  3FF5 A;  4RAZ A;  4HW0 A;  5L3D A;  2AQE A;  2Y30 A;  3F8F A;  2JSP A;  5JI6 A;  2CV1 A;  3IL2 A;  2XF6 A;  1UZC A;  2JA2 A;  9ANT A;  2W00 A;  2VQH A;  5FRN A;  2PFB A;  2XKO A;  4BXF A;  4Z6Y A;  2K02 A;  4Q4Z F;  6PAX A;  4MO7 A;  3GCM A;  4JP0 A;  2R7X A;  1YLF A;  4A0X A;  4AIJ A;  2WV1 A;  1IV6 A;  2HTS A;  3BQZ A;  3FZV A;  3GTP J;  2O3F A;  4EQQ A;  1BBY A;  3TW6 A;  3HUG B;  3K2A A;  4M6Y A;  3IWZ A;  3KEY A;  1IN6 A;  5FO5 A;  3O6B B;  1G8X A;  2PJP A;  2RC4 A;  2VBW A;  5FLX K;  2BVL A;  5DD8 A;  3LAP A;  4ANJ A;  3OSF A;  1YIT I;  3IAS 2;  1ORK A;  3E6C C;  1LFB A;  5F6F A;  3BCA A;  2KRC A;  1RPW A;  2KJB A;  2Q0O A;  3A1Y A;  1Z7L A;  2G7U A;  3DPU A;  4AVP A;  2E34 A;  1NTC A;  3JR9 A;  1BC7 C;  2HTJ A;  3JSO A;  3IP4 B;  1Y1V J;  2M8G X;  1UCR A;  5LRR A;  3S2D J;  1FEX A;  2DMT A;  2ELJ A;  2OUM A;  3WGG A;  3GTO J;  4L0Y B;  1OIS A;  3RKW A;  4E4H A;  4NDL A;  1P9Q C;  2EIN H;  1YX5 A; 
#chains in the Genus database with same CATH homology
 2DA3 A;  3HB9 A;  3ZQI A;  2GLO A;  4AYB N;  4B4C A;  3CDL A;  5IP9 J;  3GTG J;  2DJN A;  5IOY A;  3HOZ J;  1U9O A;  4XID A;  1PUF A;  3CMY A;  2X6O A;  2GBY A;  2R5Z B;  1ITY A;  3G1O A;  3M4O J;  2FX0 A;  2K9S A;  3TED A;  4FTH A;  2R5Z A;  3ZQL A;  5F0H A;  3S1R J;  3BG3 A;  2L7M P;  1FIA A;  2ID3 A;  2R5Y A;  2CJJ A;  2N8G A;  3QPL A;  3G1M A;  2DA1 A;  4B3A A;  4C3I J;  4HNV A;  4XRS A;  1JT6 A;  4IHY A;  5BNG A;  2CUE A;  1IDY A;  2XPU A;  4FE7 A;  2FD5 A;  4LOC A;  4JX5 A;  3JRE A;  3W6V A;  2EH3 A;  1MBJ A;  3OIO A;  2X48 A;  5E3N A;  4XIC A;  5FKN A;  1YRN A;  5FJ8 J;  4A3M J;  1BJZ A;  1WH5 A;  1BW6 A;  1TWH J;  3HGG A;  5E3O A;  5EGO B;  4AC0 A;  5EDN A;  3UKG A;  1LE8 A;  1X2N A;  3Q0U A;  2CQX A;  2EZH A;  4MIM A;  2XB0 X;  2WB1 N;  2COB A;  1JUP A;  2EZI A;  2QCO A;  1JUS A;  3JRH A;  3FIW A;  5FKL A;  1VF9 A;  1JGG A;  5DTD A;  3PO2 J;  2L7Z A;  1HCR A;  2Y31 A;  1TC3 C;  1A5J A;  3WHB A;  2ECB A;  2M34 A;  2JA7 J;  3LSR A;  1T56 A;  1GT0 C;  1VI0 A;  3VPR A;  2WAQ N;  3OSG A;  3HGY A;  2DA6 A;  3G1L A;  2XGE A;  3HEF A;  3LSJ A;  5F04 A;  4C3J J;  1B72 A;  4IHV A;  5M3M J;  5DS9 A;  1GV2 A;  3JRB A;  1WGX A;  2LFB A;  2LVS A;  5GPC A;  4M3G A;  5F0F A;  3GTQ J;  1QRY A;  3S16 J;  2K40 A;  1FTT A;  1RKT A;  4Y52 J;  5FKM A;  4B1R A;  1MH3 A;  2Y2Z A;  1Q1V A;  1AHD P;  5J1R A;  3GTK J;  2XRL A;  4A3C J;  4GFB A;  4JX6 A;  5J1U A;  1A6I A;  2EBI A;  4L5E A;  4D7N A;  1ZKG A;  4I76 A;  1HF0 A;  4BXX J;  1XC5 A;  4BBR J;  2I10 A;  1RES A;  2VI6 A;  5EG0 A;  2JWT A;  5K7F A;  3SFI A;  1K83 J;  3TP0 A;  1U8B A;  5M3F J;  4FE4 A;  3SJM A;  5EZG A;  5EF6 A;  1JKQ C;  1JKR C;  1ETY A;  3C2B A;  2R7Z J;  4UUS A;  3HOV J;  1TWF J;  2LD5 A;  3JRA A;  1JKO C;  3I4N J;  2DMU A;  5IOZ A;  2LK2 A;  2NS7 A;  5JLX A;  1SFO J;  1ZGW A;  3HOU J;  2CQQ A;  5C4X J;  5E3M A;  5JLW A;  2IBD A;  1JT0 A;  1AKH A;  3L1P A;  1POG A;  1ZTR A;  3Q0V A;  4IHX A;  2XGC A;  3LNQ A;  4BKX A;  1PUF B;  2FQ4 A;  1W0U A;  1MSE C;  1UMQ A;  5M5W J;  1CQT A;  2ID6 A;  3BT9 A;  3S2H J;  2L0K A;  2LTP A;  3S15 J;  2O7O A;  4JX4 A;  4G12 A;  3Q0W A;  4A3D J;  1ZR2 A;  1H8A C;  2JA5 J;  2AO9 A;  2R5Y B;  4W1U A;  3IH2 A;  2Y9Z A;  2YUS A;  1RKW A;  2R93 J;  2IAI A;  3BG9 A;  5FLV A;  5F27 A;  1HDD C;  3BTJ A;  3JRG A;  3S1Q J;  2X9D A;  1WCM J;  2TCT A;  1I50 J;  2TRT A;  5HOD A;  1I6H J;  5K7H A;  4DYR A;  5J3L A;  4X6A J;  2H1K A;  2JJ7 A;  3BTC A;  1UHS A;  1YRN B;  1ETX A;  4X1E A;  4Y7N J;  1IRZ A;  3F0C A;  4FCY A;  1OCT C;  5M5X J;  2QF7 A;  3DCF A;  1LE8 B;  3S17 J;  3BR0 A;  1WPK A;  2JN6 A;  2OPT A;  1XS9 A;  3HOY J;  3S14 J;  4A3L J;  3CQZ J;  4FIS A;  1RET A;  1FJL A;  3ZQF A;  1OCP A;  4M3E A;  2NVY J;  1WI3 A;  3BQY A;  3FK7 A;  3HBL A;  4BY7 J;  1E3O C;  1BA5 A;  4XRS G;  4XK4 A;  1H88 C;  1Z0X A;  3BTI A;  2HXI A;  3FK6 A;  1IG7 A;  4XRM A;  4A93 J;  3ZOB A;  3B6C A;  4DYQ A;  3ZQC A;  2O9L A;  3IH3 A;  3K7A J;  4V2F A;  1B72 B;  3PO3 J;  1ETO A;  3RKQ A;  3WHC A;  4MFE A;  1QVT A;  2NVQ J;  4ABZ A;  3H0G J;  4M6V A;  3H3V K;  4MFD A;  5IYC J;  2HOT A;  5IYD J;  1D5Y A;  2K9Q A;  2R92 J;  4IEJ A;  4DYC A;  3JRF A;  3NAR A;  5C4J J;  2K9N A;  4V2G A;  2EZL A;  5M5Y J;  3GTM J;  5C3E J;  1BW5 A;  1MBE A;  1B8I A;  2IEK A;  4A3G J;  4JYK A;  2HYJ A;  5F0C A;  4D5F A;  4DW6 A;  2HXO A;  3CCY A;  1ENH A;  2FJ1 A;  2LLK A;  3BR1 A;  4CYC A;  3OOU A;  2CU7 A;  5EG0 B;  4W97 A;  4DZP A;  4QIW N;  1ETQ A;  2VPR A;  3QPS A;  3QQA A;  1XG1 A;  4RDU A;  1JJ6 C;  1BL0 A;  3A03 A;  3NAU A;  1IDZ A;  5FLM J;  4UUS B;  1S7E A;  2O8K A;  3DEW A;  2MW8 A;  3S1M J;  3I4M J;  3HOX J;  4A3J J;  1TWG J;  2E2J J;  3BR5 A;  1SAN A;  3A02 A;  4EEF G;  1K61 A;  4M3F A;  1FIP A;  2H8R A;  3B6A A;  1APL C;  1AKH B;  1MBG A;  2OF7 A;  2D5V A;  2LR8 A;  4A3F J;  2KDZ A;  3MKL A;  1X58 A;  2JA6 J;  3A01 A;  4I6Z A;  3TP3 A;  4A3K J;  1MBK A;  1NK3 P;  3SDG A;  2GM4 A;  4C2M J;  2RAE A;  2AHQ A;  2EQR A;  2JK3 A;  4D5C A;  4S0H B;  3BR2 A;  5IP6 A;  2MG4 A;  1GUU A;  1JUM A;  1JTX A;  1HOM A;  2DA5 A;  3BR6 A;  4DZJ A;  3IV5 A;  1T33 A;  5F1J A;  2DA2 A;  1ZQ3 P;  4M3B A;  3BTL A;  1R9T J;  1DU6 A;  3LOC A;  4RBO A;  1ZK8 A;  3BR3 A;  2M0C A;  3JRI A;  1GV5 A;  5EZH A;  2L7F P;  2ME0 A;  2CUF A;  1JJ8 C;  3E7L A;  2HOS A;  3M3Y J;  1NK2 P;  2DTZ A;  1DU0 A;  1JTY A;  2ELK A;  1U9N A;  1VND A;  1MSF C;  3JRD A;  4A3E J;  1ETV A;  1GVD A;  2P81 A;  1U78 A;  2NOG A;  1F43 A;  1Y1W J;  2EZK A;  2L9R A;  2XB5 A;  3MVP A;  1EF4 A;  2G0E A;  3GBG A;  1HLV A;  4IHW A;  1O4X A;  2XPW A;  5FKK A;  3GTL J;  1JKP C;  2DMP A;  2Y9Y A;  2HOA A;  3HM5 A;  1G2H A;  1OJL A;  2VUM J;  1P7I A;  2E2I J;  2ZB9 A;  4UUT A;  1HDP A;  5EGO A;  4QSH A;  3GTJ J;  2DA4 A;  2NVT J;  2HDD A;  2YS9 A;  4M3D A;  3IH4 A;  3FIS A;  1P7J A;  3RZO J;  2LKX A;  5GPA A;  1IJW C;  1GDT A;  2HQ5 A;  3LSP A;  1IC8 A;  1MNM C;  2YU9 J;  5E3L A;  1MH4 A;  4QTR A;  3MN2 A;  3PM1 A;  5J1Y A;  2NS8 A;  2E1O A;  4BY1 J;  1AU7 A;  4AUX A;  3TW7 A;  2PMZ N;  1F36 A;  2B63 J;  5F08 A;  3RQI A;  1B8I B;  2HI3 A;  1MBH A;  2CRG A;  4D7M A;  2DMQ A;  4BBS J;  2ECC A;  5FKO A;  3BG5 A;  3FKI J;  2VKV A;  5IYB J;  4CYC B;  2Y0S N;  5C44 J;  2MGQ A;  1ETK A;  2Y30 A;  1RR7 A;  9ANT A;  1IUF A;  5EYR A;  2DN0 A;  2R0Q C;  1UG2 A;  2ME6 A;  1QVU A;  1TWA J;  4MO7 A;  4MLO A;  4J19 A;  4JP0 A;  2M2E A;  2M9H A;  2KT0 A;  5IPA A;  2JMW A;  3RZD J;  2WV1 A;  1IV6 A;  2DA7 A;  3BQZ A;  5IP7 J;  3GTP J;  3HOW J;  1OFC X;  3TW6 A;  1W0T A;  2JA8 J;  3S1N J;  5GP9 A;  3K2A A;  5EEA A;  1LFU P;  3HDD A;  2E2H J;  2LY9 A;  1IGN A;  1FTZ A;  1I3Q J;  1ZR4 A;  2LP0 A;  3OSF A;  3LSG A;  3Q3S A;  1ORK A;  1LFB A;  1Z77 A;  4A3I J;  3A01 B;  1RPW A;  3ZQH A;  2MSY A;  2XPV A;  2NVX J;  1NTC A;  2E19 A;  4A69 C;  3JR9 A;  3O8G A;  4C3H J;  2W48 A;  2DMN A;  3D1N I;  4A3B J;  1Y1V J;  2M8G X;  5K7Z A;  1WH7 A;  3S2D J;  2DMT A;  3JRC A;  1FEX A;  1H89 C;  3ZQG A;  4NDL A;  1QPI A;  3GTO J;  2VKE A;  3O8H A;  2XGD A;  2XSD C;  1ETW A;  3HKZ N;  1VFC A;  1X2M A;  1MBF A;  1TWC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...