2YU9J

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yu9J00
3Q0UA 1AKHA 1XS9A 3S14J 2Y31A 2P81A 4JP0A 2LVSA 4FE4A 1LE8B 1JKPC 3FISA 3HOZJ 3SFIA 5GP9A 1UHSA 4IHVA 1TWCJ 4I6ZA 1PUFA 1HF0A 2HOAA 4B3AA 2FD5A 4I76A 3WHCA 4BBRJ 1QVTA 1I6HJ 2HXOA 2CJJA 1ETQA 4JX6A 4X6AJ 9ANTA 1B8IB 2K40A 4M3DA 3S16J 2CQQA 1P7JA 2N8GA 1E3OC 2GM4A 1JKOC 1POGA 1BA5A 4A3CJ 1HDPA 3HKZN 2XGDA 3Q0WA 4M3EA 2JJ7A 2E2HJ 5J1RA 3IH2A 3S1QJ 3MN2A 4M6VA 3JRAA 1JKRC 2M8GX 2OF7A 5FKMA 1MBGA 3F0CA 3M4OJ 1OFCX 1JUPA 4UUSA 2MG4A 4W1UA 1WH7A 3RQIA 3CMYA 3PO3J 1VNDA 2DA7A 3LOCA 1APLC 1FJLA 1JGGA 1Z77A 1WI3A 4ABZA 1MBJA 4NDLA 3GTJJ 4A3MJ 1FTTA 4A3LJ 1MH3A 4BKXA 1HOMA 3HOWJ 2Y0SN 4EEFG 2D5VA 2ZB9A 2ELKA 5C4JJ 1RESA 3BR6A 4XRSA 5IPAA 4FCYA 2E2JJ 3QPLA 1QPIA 2E2IJ 5J1UA 3ZQCA 2FX0A 3W6VA 2R5YA 5IP6A 1JT0A 2IEKA 2ME6A 1X2NA 3JRGA 1FTZA 1ETOA 5IYDJ 4C3JJ 4IEJA 1U8BA 2HYJA 2DMTA 3ZQFA 1EF4A 5EF6A 4DZPA 3HOXJ 2HXIA 4V2FA 3C2BA 1XG1A 4XK4A 1YRNB 4A3GJ 2MGQA 3GBGA 4A3BJ 3JRHA 4BBSJ 2VKVA 1MBEA 1QVUA 3QQAA 1F43A 1MNMC 5F04A 5HODA 5EG0A 5FKLA 1ZR2A 4JX5A 5C3EJ 3E7LA 4Y52J 3OOUA 3HBLA 3BR5A 2H8RA 4CYCA 3DCFA 3MKLA 3A01B 4BY7J 2VKEA 2JK3A 1HDDC 4LOCA 1OJLA 5E3OA 1VFCA 1ETVA 3O8GA 1JTXA 2L7MP 2M9HA 3ZQHA 3GTQJ 3I4MJ 1X58A 5EGOB 1I50J 3G1LA 1UG2A 3BQYA 4A3JJ 3BTJA 1I3QJ 3BT9A 5M3FJ 2VPRA 3IV5A 1Z0XA 1JT6A 4FE7A 1ETKA 2EH3A 2R7ZJ 4XRSG 4AYBN 2EZLA 1B72B 1JTYA 4DYCA 2ECBA 1W0UA 4XICA 3RZOJ 2R93J 2DMQA 4A69C 2W48A 5IP7J 2XPWA 3S2DJ 1GV5A 1XC5A 5FKNA 2EBIA 2EQRA 3VPRA 3RZDJ 3LSGA 2R5ZA 3BR0A 5F0FA 2JA6J 3S1MJ 2JA8J 3BR2A 1JKQC 5IOYA 1W0TA 2JN6A 2FJ1A 3HDDA 5K7HA 1ZKGA 3TW6A 2IBDA 2X48A 4Y7NJ 3BTIA 5GPCA 4G12A 4DYQA 4MO7A 2LTPA 4UUTA 3BG9A 3BR3A 5K7ZA 2JWTA 5F1JA 4M3FA 5E3LA 1NTCA 2FQ4A 1LE8A 2TCTA 4QIWN 1Y1WJ 3OSGA 2DTZA 1RKTA 2CRGA 3CQZJ 3K2AA 2XRLA 2AHQA 2NVYJ 3H3VK 1P7IA 1VI0A 5M5XJ 2JMWA 4AUXA 4C2MJ 2VUMJ 1T56A 2Y2ZA 1B8IA 1MSEC 1FIAA 3JRDA 1HLVA 2DA6A 3LNQA 4J19A 5FKOA 2E19A 2NS7A 3L1PA 2LY9A 1GT0C 4W97A 1U9NA 2O9LA 1AHDP 4A3KJ 5EZHA 3TW7A 1IRZA 3H0GJ 2X9DA 2JA5J 2GBYA 1VF9A 1RPWA 2MW8A 2HOSA 1FEXA 2M2EA 4JX4A 4A3EJ 2LKXA 1ZK8A 3OIOA 1U9OA 4M3GA 2DA5A 3MVPA 2CUFA 3S1NJ 1LFUP 3HOUJ 1WH5A 2EZHA 4BY1J 3JRIA 4S0HB 5C44J 5DTDA 4FTHA 3TP0A 2DN0A 2R0QC 2L0KA 4A3FJ 2HI3A 3FIWA 1O4XA 2LLKA 1ETYA 3LSJA 1G2HA 3S1RJ 1ZTRA 5FLMJ 3JRFA 4CYCB 3HB9A 3ZQGA 4MFEA 1OCPA 3JRCA 3G1MA 2YU9J 3ZOBA 3SDGA 1JJ8C 1BJZA 1ETWA 5F0HA 2EZIA 5IYBJ 2QF7A 5JLWA 5M5YJ 3PO2J 2YUSA 2CQXA 3FK7A 1TWFJ 1S7EA 1Y1VJ 1ETXA 4MFDA 2COBA 5IOZA 3S15J 1K61A 4C3IJ 3O8HA 3I4NJ 2O8KA 1SFOJ 1RKWA 1YRNA 3GTMJ 1T33A 2WAQN 4D5CA 5K7FA 1GDTA 2M0CA 2KDZA 4A3DJ 1JUMA 2ECCA 4DYRA 1AKHB 2LD5A 1QRYA 4MLOA 1ITYA 3LSPA 2K9NA 5IYCJ 3UKGA 2M34A 2L7ZA 1IG7A 1IGNA 1BW5A 5E3NA 3A01A 4JYKA 3ZQIA 1HCRA 1MBHA 3D1NI 2LR8A 1A5JA 1PUFB 3S17J 3JR9A 1GVDA 1TWHJ 4X1EA 3B6CA 4QTRA 1WCMJ 2MSYA 2IAIA 3HM5A 4D5FA 3G1OA 1R9TJ 5F08A 1ORKA 3LSRA 3HEFA 2Y9YA 2WB1N 2K9QA 5FLVA 3WHBA 1CQTA 4A3IJ 3BR1A 1X2MA 5J1YA 4RBOA 2DA4A 2NVXJ 4GFBA 4XRMA 5FJ8J 3DEWA 1H89C 2DJNA 1Q1VA 1B72A 2KT0A 1JUSA 3FKIJ 1FIPA 2YS9A 3IH4A 3IH3A 1F36A 3OSFA 1MSFC 3Q3SA 4UUSB 4BXXJ 3K7AJ 5JLXA 3HGYA 3BG5A 2I10A 2ID6A 1NK3P 2L9RA 1A6IA 3HOYJ 5IP9J 3S2HJ 2DMNA 2XB0X 3CDLA 2AO9A 1TWGJ 1WGXA 1GV2A 1MBFA 3A03A 3HGGA 2Y9ZA 1BW6A 1UMQA 1ZGWA 5DS9A 1GUUA 3A02A 3PM1A 3JRBA 5F27A 5GPAA 2R5YB 3M3YJ 4QSHA 2NS8A 4M3BA 5E3MA 5FKKA 1MBKA 2JA7J 4IHXA 3CCYA 4AC0A 1ZQ3P 3NARA 3B6AA 2XPUA 4IHYA 2NVQJ 3NAUA 4D7NA 1NK2P 4RDUA 2GLOA 2LFBA 2L7FP 2OPTA 2VI6A 2Y30A 1IDZA 1IJWC 4V2GA 2HOTA 4DZJA 1IDYA 1U78A 4FISA 3TP3A 2WV1A 2HDDA 3BTLA 4XIDA 3BQZA 2XB5A 5EG0B 3RKQA 1K83J 2O7OA 2TRTA 5EYRA 2XGCA 1ZR4A 2HQ5A 2DA1A 5C4XJ 4A93J 5EDNA 2X6OA 2LP0A 1LFBA 2B63J 3ZQLA 5BNGA 3GTGJ 1RR7A 5M3MJ 5EEAA 2G0EA 4DW6A 3GTPJ 3BG3A 1OCTC 2CUEA 2XGEA 1RETA 2K9SA 2QCOA 1DU6A 3TEDA 5EZGA 3Q0VA 4IHWA 2PMZN 4B4CA 4HNVA 1AU7A 3JREA 5F0CA 2XPVA 2RAEA 3GTLJ 1IUFA 5M5WJ 1JJ6C 4L5EA 1TWAJ 2NVTJ 3BTCA 2XSDC 4D7MA 1TC3C 2R92J 1ENHA 2ME0A 3GTKJ 2DMPA 5J3LA 3HOVJ 3SJMA 1WPKA 3QPSA 4MIMA 2R5ZB 1H88C 2DA3A 1MH4A 3FK6A 4C3HJ 1IC8A 2NOGA 2CU7A 1SANA 2ID3A 2LK2A 1IV6A 5EGOA 1D5YA 2E1OA 1H8AC 2EZKA 2H1KA 1BL0A 1DU0A 3GTOJ 2DA2A 4B1RA 2DMUA
chains in the Genus database with same CATH superfamily
3Q0UA 1MDMB 4M72A 1DP3A 2XUBA 3HSRA 4CA0A 2F5DA 4M71A 1R71A 3BWGA 2LVSA 3L2VA 1LE8B 2E7XA 3HRTA 4ON0A 4P9UA 1UHSA 2Q0OA 1QO0D 2EWNA 1Z21A 4EJUA 3MWMA 4I76A 4BE0A 5K1YA 3U1DA 3WHCA 3M7GA 1I6HJ 2L5QA 1LDDA 3CJRB 3CLQA 4JX6A 1B8IB 2XRNA 5DD8A 2H6CA 3JTHA 4M3DA 2MLGA 3O2PE 4G6TB 2CQQA 2OV7A 2H94A 2N8GA 1FP2A 3K10A 2GM4A 4C9YA 1JKOC 1U5TC 3IKTA 3GFLA 5FFZA 2M4KA 2CH0A 2F5FA 3HKZN 2XAQA 1FOYA 1YX5A 2JJ7A 2E2HJ 3ZCOA 4CICA 3IH2A 3EETA 2UXXA 2GAUA 3W2WA 2DI3A 4HNTA 1VQOI 4E7HA 4V19K 4XQFA 1JUPA 1HW1A 1WJFA 3CMYA 4W1UA 1R36A 1WH7A 3V4GA 4ESFA 1LDJA 3IKVA 4CDGA 3WE3A 1B59A 1IRGA 1FJLA 4UNOA 2QGUA 2HU9A 4A6DA 1JGGA 5DCMA 4EATA 2HYFA 1KGSA 4HEA2 4A3LJ 1RUOA 3I56I 3HOWJ 3IC7A 1LKXA 3GLLA 2F6CA 1FMVA 5CPRB 4UVAA 2ZXIA 1AA7A 3BR6A 1LFPA 3K1MA 3M8FA 5IPAA 4G7HF 2P5LC 3BDDA 1QPIA 4LIUA 5J1UA 3ZQCA 3ASOH 1QZEA 3ZPLA 1LUJB 1GXPA 3W6VA 2R5YA 2QUFA 2QSHX 5TGTA 5ED4A 3I3LA 2HEOA 2EA4A 4BUPA 3WGIA 2CG4A 1TW2A 3CCSI 1OMIA 3OYDA 2EIMH 3BG7A 4IEJA 4G7OF 2MBFA 3S93A 1S29A 4YIFA 1NHAA 4B48A 2VKVA 5E8IA 1T95A 4A12A 2OA4A 4ZJZA 2JTVA 4OWRB 2VJJA 4BS9A 1OCZH 5EG0A 4EGYA 2CQNA 5KNLA 3HHGA 3CCUI 4NQWB 3ML6A 2QSGX 1EH6A 2V26A 1YS7A 1RNLA 3HBLA 2G7HA 3DCFA 4F93B 4CYCA 3AFHA 3MKLA 5J4YA 2E1MC 3L2CA 3A01B 2DU9A 2JK3A 3S8PA 3VEPA 1RZ4A 5L3DA 5E3OA 2KFDA 1FSHA 1XMAA 2JZYA 1J7KA 2D1HA 4JBAA 4MGRA 2GXGA 3Q5FA 5H2FC 1FBSA 3I4MJ 3M1CA 1X58A 3RKXA 4A3JJ 3BQYA 3K70C 2STTA 3QU6A 2MABA 3BTJA 2EFOA 2RVCA 2V1DA 5M3FJ 2VPRA 3RCOA 1ZREA 3IV5A 2HTSA 1Z0XA 1JT6A 2ZBKA 2M0MA 2EH3A 4HSTA 2EZLA 4EJTA 4DYCA 2ECBA 1UG0A 3AG2H 1BBYA 5TISC 2ZJRF 3DTEA 3DWLE 4U7BA 2W48A 2ADUA 2BW3B 2KJBA 2F2EA 2XPWA 4E4HA 2HQNA 4ZZDA 2K9MA 1IZ1A 3DFGA 1O57A 3QODA 4KT6A 3S2WA 4PGGA 3VPRA 4HDUA 3CC2I 3PSFA 3AL0B 2JA6J 5HLGA 3S1MJ 4XLHA 3E97A 3KPHA 3VSLA 5FLXZ 4P55A 3OIQA 2O8XA 2K9LA 3BJ6A 4AVZA 3BR2A 3HZJA 2X1DA 4UVBA 3ECOA 2QKLB 1G6NA 1X1BA 3F8NA 1VQMI 4NHJA 5IT9Z 1J09A 1WI9A 3E5XA 1YHQI 3ELKA 4PCQA 2VN2A 3P7NA 4MO7A 2LTPA 3BR3A 3LAJA 4CCMA 5FGMA 2JWTA 3HSFA 5DCFA 3CCQI 2FQ4A 2PMUA 4HLXA 1EH7A 2FU4A 3OYIA 2VJ4A 4XOPA 2RNGA 2DTZA 1RKTA 2CRGA 2PMHA 3CQZJ 3EQLF 3K2AA 4XMYA 4GRIA 3ZP5A 6PAXA 3GYHX 1W7PB 2AHQA 3DXJF 5JFRA 4Z2YA 4CH7A 1R00A 4U0YA 1MSEC 1YJ9I 1FIAA 4XKCA 3LWFA 2QQ9A 3J81K 3ROUA 3JRDA 2KIUA 5FKOA 2LKSA 2DFIA 1O7FA 3QP5A 1OCOH 3L1PA 5LD2C 2ZO4A 4F92B 1D3YA 1GT0C 4BACA 4LK0F 3JSPA 4LK1F 4PJJA 3GLXA 4IF4A 2GBYA 2A69F 3HHHA 4DJAA 4IZZA 4JX4A 2E7WA 3NQOA 5A2QZ 3F3XA 1PP7U 1R1VA 3OYMA 3OIOA 3OIPA 4CCNA 2ZFUA 3ZGKA 2DO7A 4Y3OA 2CUFA 4FASD 2H6BA 3Q9VA 3G2BA 1DGWY 2W24A 3LA2A 4BY1J 2DK5A 5CVVA 1ZLJA 1G8XA 2LNBA 3FF5A 3PUBA 2OBPA 2DN0A 3RPQA 4A3FJ 2LY2A 5LGNA 1O4XA 4IJAA 3M9AA 1YW9A 2L2OA 2KLOA 5HLTA 3U1KA 1ZTRA 2IGMA 3CF2A 3CLOA 1YLFA 3MMYB 1TQMA 5IT3A 5JR3A 1R1TA 4MFEA 4O5VA 4ZTFA 3I58A 3DKXA 1SFXA 2XAHA 4G8XA 2K27A 4PDKA 1PYVA 1R58A 2LREA 4FETA 1FLIA 1JJ8C 1BJZA 1ETWA 5F0HA 2EZIA 4R8HA 1G4DA 4YEJA 3OYNA 4OIOF 4PSWA 4E7LA 4ZTJA 1T38A 1K6OA 4HX7A 1E2XA 2BXYA 3J80K 2ICWG 2OTJI 1EA3A 5LGUA 1TW3A 2O8KA 4CYDA 5HS8A 1CF7B 1N77A 4D5CA 2M0CA 3DV8A 4BXUA 1JUMA 3FZVA 3B73A 3E6MA 1AWCA 5J8CA 4HA8A 5B5EC 3FXJA 4L9VA 1QRYA 2ZSIB 1ITYA 2E5NA 2MA3A 2K9NA 5KVRA 3I4PA 2L7ZA 1IG7A 2GA1A 3U21A 2RC4A 3HXLA 1HCRA 2W85A 4XNFA 2LR8A 1T8IA 5HS9A 1XGNA 4HZFA 4CZCA 1Q1HA 2BZTA 1T98A 4MQVA 4IKFA 5KCMA 3COAC 4QTRA 1F5TA 1W4MA 3DP7A 3GZNB 1BI1A 1R9TJ 4KIFA 4HX4A 2BBYA 1UHMA 1PP8F 1KYZA 3WHBA 4RAFA 1BC7C 1CQTA 5LLQA 4A3IJ 2JA2A 4RBOA 2DA4A 2DFHA 3G73A 3OOPA 1VQ8I 4OMYA 2I8DA 2QSFX 3BPXA 4MTDA 2F5VA 2X4HA 3K1PA 4XRMA 5ICFA 3WU1B 1S72I 1QHGA 2DQRA 2D1VA 5LGTA 4ZDLA 2DJNA 2KT0A 4L5JA 4B47A 4M9XA 3A0BC 3D5RC 1D1CA 3K7AJ 3JTGA 2F48A 2MLKA 4WCGA 2FA5A 2ZC2A 2ZXJA 3V8KA 4M9ZA 2KRFA 3BLYA 3HOYJ 3S3OA 2K85A 3RPUA 1HW5A 4G9YA 2MC4A 1D0ZA 5D5UB 1XPXA 3S2HJ 2X85A 2DMNA 3A0HC 4I98B 4AIKA 1BI2A 2KZVA 2XB0X 3CJNA 2XF5A 1P4AA 4DBQA 3IRQA 1W5CC 1I1GA 2DPUA 2NAZA 3QOPA 1XMXA 1PUEE 2EFPA 3EUHC 5GPAA 4KDPA 2VQHA 2KJCA 4QSHA 2XIGA 1K4SA 1MMGA 5FKKA 3CCYA 1G59A 3ABLH 5L3CA 3N4MA 1NK2P 2V4JC 1ON1A 4A0YA 4RGUA 3I64A 5FB2A 3QWLA 3AKZA 3A4CA 2LBFA 4V2GA 4CZZA 1IJWC 1U78A 4L9JA 2RREA 3TOBA 4HQEA 2XF7A 1P4WA 4XIDA 3BQZA 5HDKA 5KK1A 3M8JA 5HOOA 1V5GA 3WODF 1K83J 2O7OA 2Z33A 3DLAA 2M30A 5E1XA 2DA1A 3RDIA 2EJRA 3I54A 2X6OA 2FE3A 4KITB 3TBIA 5BNGA 5JHUA 3ULQB 5EEAA 4G94A 4IHTA 4DW6A 3GTPJ 3DBRB 1RUNA 1ON2A 4OMZA 4EJVA 2IPQX 5EZGA 4XKBA 2FBKA 4U88A 1T39A 1R5HA 2YR2A 3K4MA 4EJOA 3H5NA 2QBYB 1WJDA 4Z6YA 1HKSA 3PIOF 3RYPA 1TQPA 3GTLJ 3F22A 3MZHA 4L5EA 5HNFA 3R61A 3BTCA 1RC9A 2XAGA 1ENHA 1R7JA 3H5RA 2WB1A 2H1LA 3MZ8A 3SJMA 1R6RA 4N0BA 4LG3A 5ICGA 5L3GA 2P6TA 4PJNA 3HSEA 5BQTA 3VOEA 2IP2A 2DA3A 3PNTA 3HRMA 3FK6A 1V54H 2NOGA 2CU7A 2IGOA 1SANA 2ID3A 4BQOA 1SD6A 4ZH4F 1OKRA 5EGOA 3OV8A 2JQ7A 3ZMUA 3MAJA 3IL2A 1HSJA 2DQLA 5CJ9A 4XRFA 1U5TB 4B1RA 4OIQF 4EMSA 3BP8A 2K86A 2PI0A 4WF2A 1AKHA 2R7UA 2JSCA 3OL3A 2E60A 2VIXA 4JP0A 2A07F 2RN7A 4FE4A 2YX7A 4XLPF 4Y17A 5GP9A 1TQIA 2MH2A 4I6ZA 5ILSA 3HTSB 2HOAA 1B6AA 4B3AA 4LB6B 4A0XA 2BYVE 2OCCH 4PJLA 4BBRJ 2GQQA 2CJJA 1ETQA 3L00A 4X6AJ 4FHTA 1V55H 2PG4A 4LLNA 3H36A 3HPGA 4A3CJ 1HDPA 3TDZC 1KU3A 4J00A 2KRCA 2XDVA 1TL8A 1X4PA 3OS1A 5J1RA 2IS6A 1FBUA 1FMWA 2CW0F 3I9V2 4MHGA 3S1QJ 4I0BA 1A6QA 3JRAA 2M8GX 3ABUA 1O3RA 2OF7A 1D1BA 3F0CA 1JE8A 4DOZA 4PJ0C 3FXUA 2K7LA 3PFYA 2O6GE 3IAM2 1FOWA 2MG4A 3E6DA 2X1CA 3C7JA 1FZPB 5J4VA 3K0LA 1Y0UA 4F52A 1Z77A 4ABZA 2FNPA 3PQKA 3V7SA 1HOMA 2X6XA 2E35A 2Y0SN 5AIPA 2HR3A 4KA4A 2IA1A 5DUKA 5HVQC 1ZAOA 5J6XA 4XRSA 4IOCF 1YOVB 4JK1X 5DM7F 3MFKA 3QPLA 2XAJA 1EV7A 3V7RA 1K78B 3CDHA 3G3ZA 4ASNA 1GXQA 3L2WA 1JT0A 4ZC3A 2IEKA 2G7UA 3BCBA 3L7WA 1X2NA 4LLGF 3JRGA 2BHYA 3MCZA 1X3UA 1ERDA 3WTVC 5IYDJ 1W7PD 2DMTA 2HYJA 2VKHA 1JGSA 4LITA 3HOXJ 2MC3A 4V2FA 4E6KG 3C2BA 1XG1A 4XK4A 1YRNB 4A3GJ 1KU9A 3VYRB 2EIJH 1QVUA 1TLHB 2K3PA 1F43A 5F6FA 2Y48A 1MNMC 5HODA 4RB3C 4WXDA 3TOAA 1ZR2A 4O3MA 4L5IA 3OOUA 3BR5A 5CQEA 3CCMI 1IO2A 4LOCA 4L18B 1ETVA 4M6YA 1B9MA 1V5EA 1GLNA 3OYLA 1D0YA 1V4RA 4YIIA 1JTXA 2M9HA 3SYTA 4YIRX 3GTQJ 2M1BA 4ENJA 3CUOA 3E3VA 4EV0A 3EPZA 5JHFA 2V7FA 4L9TA 4UHTA 3HG9A 2P7CB 1I3QJ 1OYYA 3BT9A 2L4AA 5HLHA 2DTRA 3JW4A 2HVQA 4FE7A 1ETKA 3TDUC 2R7ZJ 4AYBN 4OAZA 4N4NB 1B72B 2IS4A 4XICA 1E3HA 2H27A 3SFZA 1R23A 1UFMA 5HNHA 3ZRGA 2DJIA 1Y56A 4A69C 3S2DJ 4Q4ZF 5GTIC 5BS6A 3A2KA 1YW7A 1MW7A 2PJPA 2COMA 3DLLF 1W5TA 3LFUA 1ZN2A 2AXLA 4YELA 1XN7A 3BR0A 5F0FA 3HKZA 2DLLA 1FX7A 2L4MA 3OYAA 3I0TA 1Y39A 3HL2A 2DOAA 3WG7H 2EFNA 4P96A 2CUZA 1JKQC 5IOYA 4KYWA 3QPTA 1MKMA 4NBQA 2JN6A 1Y6IA 1ODDA 3CP2A 1WVRA 3PQJA 1ZKGA 2IBDA 1QGPA 3HRSA 4D0PA 3Q9SA 1H9TA 4G12A 5CKTA 4DYQA 3W3CA 2HTJA 3LFKA 3HJEA 5K7ZA 1TT5B 2QM3A 3LA7A 5E3LA 4HF1A 3X2QH 3WTSC 3WTYC 5B1AH 1REPC 5JI6A 1LE8A 2CYYA 2TCTA 3L2UA 4EM0B 1Y1WJ 1MMNA 4C30A 4XSZF 4NNJA 1USSA 2XRLA 1L0OC 1Y8RB 3BZCA 5CYVA 4PFPA 3W6KB 4RB1A 3CMEI 1P7IA 2WV0A 3SEQA 1VI0A 2R7TA 2JMWA 4AUXA 5BMZA 2Y2ZA 4E7KA 1B8IA 4LG0B 4XL9A 1D8KA 1LDKB 3CD6I 4HW0A 1HLVA 2FOWA 3ISPA 5JVGF 2CV2A 3WGGA 2R7DA 2QWWA 4W97A 3OYGA 1R1UA 1X3WB 4I2OA 5ILVA 1T0FA 2ZKZA 1IRZA 2LF7A 5EZHA 2YSRA 3H0GJ 3TW7A 1VQ6I 4RLFA 1VF9A 1U0JA 1RPWA 2MW8A 3DQVC 3KZZA 1XTAA 2HOSA 2M2EA 2WAEA 4HV5A 1FYLA 2LKXA 2O61A 1IN8A 4M3GA 3V7CA 1TT0A 2CQKA 1FNNA 2P8TA 1JHFA 2PMZA 2R3SA 2JUCA 3J80Z 2Z9OA 1WWXA 3IWFA 1WH5A 2B0LA 3JRIA 4S0HB 2RGVA 2OD5A 3M07A 1VZ0A 3GEZA 3E1SA 4KN4X 5LEKA 2CMPA 3O6BB 1VQ5I 3U2RA 5EEGA 2R0QC 2L0KA 3BCAA 2HI3A 3FIWA 3HIFA 3KFWX 1EJ9A 3I59B 3H3ZA 1YFHA 2A05A 1LEBA 1ETYA 3LSJA 4BNCA 1B4AA 3GF2A 4ZYHA 3JRFA 5GAEJ 4CYCB 4K2EA 2WY8Q 5BPIA 2ACJA 3ZQGA 2VE9A 1LQ1A 3TL4X 4F55A 4Y33A 3G1MA 1IAWA 2PEXA 2QLZA 2DAOA 2YU9J 3ZOBA 1V3FA 3SDGA 4YG2F 4CUGA 2PJRB 2CFOA 4AU7A 1Z3XA 2VQLA 2CQXA 4UV9A 3OS0A 1FOXA 2DOEA 4KJZA 2HYGD 1M1EB 1ETXA 2OUMA 2COBA 4GGGA 4MFDA 1KZHA 3VWBA 3P9CA 3S15J 3I4NJ 1FPQA 3O8HA 2NNNA 1P4XA 2WAQN 4YFKF 5K7FA 2XV4S 4MEXF 1GDTA 4DYRA 4GYGA 2VODA 2XSJC 3DBLB 4MLOA 4RS8A 5ICCA 4S05A 2MD5A 2VBWA 4RM3A 4NQWA 1SFUA 3LSPA 5IYCJ 3CCRI 2M34A 3FMRA 1S8NA 5E3NA 1J5YA 2L01A 3A01A 4JYKA 3ZQIA 5B3SH 2P0WA 3DPLC 1A5JA 1PUFB 2O3FA 3RTRA 2VBXA 3D5SC 4BEHB 1UAAA 4ZZLA 1TWHJ 4EQQA 3FXOA 2LG4A 2V79A 4X1EA 2MSYA 2IAIA 4OINF 3JSOA 1Z9CA 5F08A 1XCVA 3LSRA 3OMYA 3WTTC 4LFUA 2Y9YA 5FLVA 1IF1A 5D4RA 3T1BA 1WRJA 1MD0A 5FO5A 5KHDA 3OYKA 5J1YA 2QYOA 4BJ6C 1J0RA 3W6JB 2NVXJ 3FM3A 3DEWA 5LRSA 3FKIJ 2VB6A 1FOKA 3IH4A 3IH3A 4S04A 3OYJA 2X6YA 2FQ3A 2Q2EB 2W00A 2L7KA 1W5SA 4ZDOA 4U7DA 1I3AA 4UUSB 4BXXJ 5JLXA 4IRGA 2DFEA 1YTYA 1IN4A 3K4NA 2LRDA 3D0SA 2OAZA 5D5VB 1YITI 2ID6A 4II3A 1KU7A 4KNYA 2L9RA 2PBIA 3S3MA 1A6IA 2RDPA 1P9QC 5IP9J 3DKWA 2HVSA 3WTWC 2GOMA 2FBHA 2JPBA 2GIZA 2M87A 5CVUA 1D8JA 1XGOA 5GAHJ 1MJBA 4GXOA 2ZJPF 1ZGWA 1BW6A 1UMQA 3CUQB 1XSVA 2W1OA 1GUUA 3PUFA 2UV1A 4HQMA 3PM1A 3NWTA 5FFXA 3OYHA 1OLTA 2C6YA 4PZJA 1R4MB 4M73A 3FXQA 1W36C 2OTLI 4M3BA 2E36A 3BC8A 1A36A 5E3MA 5LBQA 1MBKA 2DODA 1MJAA 2BXZA 4ESJA 1WJAA 4LB5A 4XONA 4RDUA 2GLOA 2GXAA 1U3EM 2VI6A 2ZMEB 4B43A 1J2XA 2ELHA 2F5EA 2R4GA 2P7VB 3QOEA 4X0GA 4HF0A 4N4OB 4FISA 3TP3A 1BR4A 1T0FC 3ZN1A 2X1EA 2HVRA 1X4OA 4OU0A 2YPRA 3MKZA 2LC2A 5L3BA 4FX4A 2DT6A 5H6RA 3GZ6A 4BHCA 2F4OB 5DD4A 3LQRA 1SVOA 2Q8KA 3TQNA 1U6GA 1UJ8A 5EDNA 1HXDA 5GADJ 2Z3YA 4ENMA 2A5WA 3ZQLA 2L02A 3FMSA 3I55I 1QZZA 3P9IA 3GTGJ 5M3MJ 2G0EA 1X1DA 2GA2A 1OCTC 1TNTA 3DKYA 2BY1A 1LPQA 2CUEA 2XGEA 4FQGA 4XN3A 2FBIA 2P5VA 2FOKA 3FBIB 3ONQA 3TEDA 3C1DA 3FWEA 3Q0VA 4NC6A 4IHWA 2ESNA 2HS5A 5F0CA 2XPVA 3F8BA 4XLNF 1IUFA 5D8KB 1JJ6C 4CSWA 2OQGA 3NRVA 1USTA 2VC1A 1GVJA 5FD6A 3JAMK 3GTKJ 5J3LA 2IGNA 2HDCA 2JRMA 1QU3A 3QPSA 3GFMA 1V5FA 3A1YA 4MIMA 2XGXA 4IXAA 4BGDA 2R5ZB 1H88C 2L3DA 2ZXWH 3V8JA 1FY7A 3BPVA 1MH4A 1OR7A 1RRJA 4C3HJ 4M74A 1BR1A 4B44A 1IC8A 3WU0A 2LK2A 1IV6A 1TBXA 1H8AC 2H1KA 4AIJA 1CF7A 3K70D 2GZWA 4XLAA 1BL0A 1X3ZB 1DU0A 2DA2A 1OISA 1I39A 3RSNA 5D4SA 3H92A 3SXYA 1XS9A 4ENNA 3AG1H 3R0JA 4MEYF 2A6TA 1Z67A 3CMAI 2BY2A 1IXRC 1JKPC 2IS1A 1DP7P 3CCVI 4IHVA 4BHBA 2F5CA 3ESWB 2DW4A 1HF0A 2CS3A 2FD5A 1Z7LA 1QVTA 2HXOA 2DXIA 3BJOA 1FSEA 2K40A 2RQPA 2KHMA 2EPFA 3S16J 3ABTA 1P7JA 5B66C 1E3OC 1WJCA 1POGA 1BA5A 2K4JA 3K69A 4RGXA 3CO6C 1ACIA 1R5ID 2WC2A 1LJ9A 3WU2C 5K5QA 2GXBA 3RI4A 2E71A 5FRMA 1ZARA 2M8EA 2OC6A 5J47A 3KETA 5ILUA 2L9VA 2V6EA 3MN2A 1YS6A 1HSTA 4G6DA 2EK5A 1JKRC 1WSUA 3R60A 3ZMTA 5FKMA 3C3WA 3OL4A 1ZELA 4XLFA 2M45A 1Y0NA 2Z99A 3M4OJ 2V9VA 1OFCX 2M7AA 3F6VA 4F7ZA 3ZQQA 2MH9A 4HF2A 4BL0B 3PO3J 1VNDA 2PX9A 2KDOA 3LOCA 2LDUA 1APLC 1ONVA 4UY8I 3ZXSA 2WY7Q 2ZXHA 4OOIA 3RKWA 4RA2A 3GTJJ 4A3MJ 2KMUA 2P4WA 1MH3A 3ZMVA 4BKXA 5IT9K 1S3JA 2MD0A 1BN5A 2ZB9A 2ELKA 3FXKA 1JI8A 2ZJ2A 3NEUA 3WE2A 2V1NA 4KFCA 2DPDA 2IS2A 4WWCA 3DEEA 2JRTA 3JCUC 2HKXA 4A6EA 3I71A 3WG9A 3ERMA 4Q47A 1Z7UA 1C0WA 3V42A 2IGKA 2BEOA 3KLNA 5IP6A 1A31A 3HTUA 3VODA 2PLYA 4ZYAA 2ME6A 3F6OA 2BOLA 1FTZA 4RAYA 2DK8A 1TP4A 4C3JJ 1U8BA 2J5PA 1XDUA 3RQ4A 1XSDA 1EF4A 2Z1DA 3ZR8X 1WKMA 4DZPA 2HXIA 3HUGA 3J7AY 3GBGA 4A3BJ 4A5NA 1SAXA 4PUSA 1IUYA 4XN0A 3BROA 4L0ZB 1BOAA 4CCLA 5FKLA 2HWVA 4Y52J 4R1HA 2QA4I 2H8RA 5E17F 4YFXF 4BY7J 4B3XA 5A2QK 2KIFA 1HDDC 3FDYA 4I09A 3VB2A 1SVMA 3K9TA 1UCRA 3SZPA 3FHNA 1WFXA 3LAPA 3F9KA 2L7MP 2F4MB 2WTEA 4HG2A 3ZQHA 4Y13A 3GW2A 5EGOB 4NC8A 1IV8A 3H0DA 4GDFA 2DYSH 1TZLA 3KP5A 2JVHA 3FMQA 2NOJB 3D5LA 2Y0MA 2QBYA 1ZRCA 4L0YB 2KQRA 4XRSG 1U8RA 4AIHA 4QLCU 1FP1D 2QEXI 3RZOJ 1MNDA 4XSXF 1JHHA 2DMQA 3K4JA 2R93J 4UB8C 3IUOA 4XORA 2M3AA 1GV5A 2D2WA 4PJMA 1E0EA 1XC5A 3KYDB 5FKNA 2EBIA 4BJ5C 2EQRA 3GZ5A 5JVTA 2HQRA 1OCRH 3OYBA 2JSPA 3CO7C 2DCEA 4RGSA 3E6BA 4GCVA 2VJIA 4BHPA 2CW8A 2VL8A 1VQNI 3ASNH 3K4BA 4NC7A 3P9KA 1W0TA 1KA8A 3HYIA 3L09A 3LA3A 3PIPF 2VXDA 3HOSA 3TW6A 2NXNB 4E7IA 3BTIA 1FYMA 1X1CA 5GPCA 5LRRA 2Y69H 3BG9A 4IPAA 1NTCA 1U2WA 3KP4A 4PK4A 1J59A 1DQUA 1QQIA 3KEOA 2FEZA 3PJRA 1VQPI 2VPLA 2LH9A 2BHZA 2D45A 3OSGA 1R4NB 2Y0SA 4BU2A 1VQLI 1KQ9A 2J5OA 3ECHA 2NVYJ 3VYTB 1R22A 5FD5A 1SFKA 3V8LA 4CGZA 4UXNA 2R7FA 1T56A 3H9JA 1B1BA 5AIQA 2UXNA 3DTKA 1MGTA 3KIOA 2DA6A 2W82A 3OWTA 3R0AA 3LNQA 4J19A 1UHWA 3U9GA 2NS7A 3EDPA 1K79A 1B9NA 4UV8A 1DPUA 4XBFA 1U9NA 2O9LA 2FF4A 5LFAA 4A3KJ 4BH9A 2X9DA 4ZYEA 2JA5J 2E5ZA 2KP6A 1HQCA 1WHUA 1Z1DA 2VOOA 2L54A 3VFZA 3LMMA 4A3EJ 1WJEA 1ZK8A 2EFQA 2LF8A 2LSOA 4DQ2A 1WQ2A 2E1MB 2DA5A 2HPIA 3IAS2 1F4KA 1MMDA 5TRDA 2CFXA 5HS7A 3S1NJ 2FXAA 2EZHA 2V6CA 5C44J 5DTDA 2YX4A 4N9HA 2VXZA 3T5XA 1XDSA 5F64A 4MTEA 3H9QA 3B02A 2LLKA 4D1QA 1G2HA 4NB5A 3S1RJ 3LSTA 4HX8A 1SC7A 2IJLA 3HB9A 4LMYA 4CXFA 3REOA 2XROA 1MMAA 4HPQA 4AD9A 3LSMA 4Q48A 4XLCA 2RNJA 2BV6A 5K5RA 3E6CC 2QF7A 2X6WA 5M5YJ 3W2VA 5JLWA 1J9IA 2YUSA 4RB2C 4PGHA 4AYBA 2W4SA 3BZ6A 3OYFA 1Y1VJ 5IOZA 3PNYA 2IVMA 4QPOA 1SFOJ 3PFIA 1YRNA 3UNGC 2K02A 1T33A 1LVKA 2CW7A 3KZYA 2KDZA 4A3DJ 2ECCA 1E17A 2W7NA 2LD5A 2DYRH 1WJBA 3J7YJ 4B8XA 2A6HF 2TDXA 2R7SA 3G4SI 1R5GA 4TV7A 1YI2I 2B9SA 4RM2A 2AQFA 2NYXA 1X1PA 4NUBA 2EV5A 4BYYA 2IXSA 1P92A 4RB0A 3S17J 3JR9A 3IHUA 2FSWA 1ZLKA 5D6EA 1WCMJ 4A0ZA 4RGRA 4D5FA 1ORKA 2M4GA 3HEFA 4WXHA 2EA2A 2UUZA 3E0JB 4WX9A 3J81Z 1X2MA 2OZUA 1S7OA 1FYKA 4E7ZA 4GFBA 3TGNA 4B09A 3MD2A 1H89C 1D1AA 3F21A 1B72A 3FHZA 1DDNA 2HGCA 1XMKA 2IT0A 1MDMA 3WTUC 2YS9A 2O0YA 3T8TA 2PQ8A 3VDXA 1HW2A 4EGZA 3OSFA 1MSFC 3CP8A 3EUAA 3Q3SA 4RAGA 2FRHA 5EEHA 2I10A 2X0LA 1MJ9A 4O6JA 1YQAA 2XASA 3J7ZI 2DT7B 5DCMB 1UZCA 1E3PA 1T6SA 1G3WA 1T08B 5CVRA 2A6EF 1PVEA 2AO9A 1ZG5A 1TWGJ 2HDWA 2VT2A 3A03A 1GV2A 1MBFA 2EV6A 3H3UA 3HGGA 1IRXA 4MQ9F 3A02A 5EJCA 5H20A 1UELB 5F27A 2R5YB 3M3YJ 3CCJI 4GO1A 2NS8A 4HOBA 1N25A 5D8LB 2QQ8A 4IHXA 1XGSA 3FX3A 4KN7X 4BJTA 4AC0A 1ZQ3P 1HC8A 4P1WA 2VONA 3B6AA 1KQ0A 1XB4A 1O3QA 4IHYA 2OZ6A 4D7NA 4BE1A 3OR1C 2M5WA 4ESBA 2LFBA 3RPUD 5E8GA 1OPCA 2K5CA 2PFBA 2ZCWA 3EUKL 5D6FA 4LG0A 1D5VA 4DIQA 3CESA 4CCJA 3OR2C 1IDYA 4DZJA 3CCLI 5KAIC 5E1ZB 3ERED 2WV1A 2XAUA 4CCKA 2XB5A 5EG0B 3OYEA 2DT5A 3MKYB 2TRTA 5EYRA 3JAMZ 4XOTA 4FT8A 1ZR4A 2HQ5A 2V9KA 1SD5A 2OJED 3RYRA 5C4XJ 1STZA 3EYIA 1QNTA 2ZFWA 2Z2SB 1LFBA 4KICA 4KIBA 2R7XA 3BG6A 2WAQA 1RR7A 2UWMA 4IVNA 3BG3A 2KPMA 2VKDA 3H35A 2K9SA 2EIKH 3C18A 1P6RA 5HLIA 2VE8A 2PMZN 4HNVA 3I59A 4DGWB 3JREA 4U0VA 4AIDA 1XGMA 3DF8A 4RAZA 3QPHA 3RKYA 1G3YA 1T2KA 1TWAJ 4JQFA 2NVTJ 2XSDC 1TC3C 2R92J 3KEQA 4YRVA 2DMPA 3HOVJ 4I99C 4HNUA 1WPKA 4ZYDA 2PJRA 2R7VA 3GUDA 4KT5C 3W2AA 4RLQA 3F23A 4UVCA 4IRHA 3ZQ7A 3L9FA 1O7LA 2ZJQF 3FXRA 1D5YA 3DPUA 2E1OA 3BZKA 2EZKA 5F1RA 3J7AO 1R49A 2V1UA 2EV0A 3CJTB 2L9SA 2DMUA 1YG2A 2JVGA 2VJ5A 4LIVA 3LSIA 3S14J 1ULYA 3ABKH 3EYYA 2Y31A 2P81A 1Z05A 2VBZA 3SEZA 1WJ5A 3ZMSA 2W84A 4PSXA 4WK8F 4XKVA 2NNYA 4OAYA 2BY0A 3FISA 3G71I 3SFIA 2RQQA 3HOZJ 2JT1A 2BW3A 3GX4X 3LSKA 3QYBA 1TWCJ 1PUFA 3H1CA 1TTYA 4BEHA 2R7WA 2R7OA 1I6XA 2AXTC 3MKWB 2XKPA 9ANTA 1Z6TA 4CHUA 1XSXA 2A5YB 4HYEA 3I53A 3L2RA 1OYWA 2VQCA 1Z3YA 4XR6A 1K4TA 1A04A 3F8MA 2JPCA 3SZGA 2HPMA 5DM6F 3BY6A 2XGDA 2H8WA 3Q0WA 4M3EA 1EH8A 1ZRDA 4II2A 2LY1A 2HOEA 5E20A 4M6VA 1YJWI 3VYSB 3FXMA 5B1BH 3QYEA 2KIQA 3QP6A 1MBGA 1XCBA 3EUHA 2Q2EA 3IRRA 3VSKA 3K6GA 4UUSA 4U87A 1UB9A 3DEUA 1W1WE 3RQIA 3UR3C 4MNUA 3HC7A 3CJQB 2JUGA 2DA7A 4IQJA 2BVLA 3E5UA 1W7PA 1WI3A 1MBJA 4NDLA 1FTTA 3TKYA 3CTAA 5CQGA 2IA0A 4ENKA 2XKOA 4EEFG 2D5VA 2BE5F 1F1ZA 2LYCA 5J8FA 5C4JJ 4G6QA 4HV6A 4PFOA 1YX3A 2ELJA 5D5XB 3CF5F 1RESA 2ISYA 1ZRFA 1RR8C 1O3TA 3CUQA 4FCYA 4EM2A 1LB2A 2E2JJ 3WGHA 4AVPA 3CC4I 2E2IJ 1CGPA 2HNHA 4BQAA 2FX0A 1MMSA 3DPTA 1SD7A 4FX0A 3FKJA 2FUG2 5DEQA 4IO9F 1VQ9I 4CO8A 3PSIA 4JOMA 3N97A 1QHHD 5HDGA 1G3TA 4LLLA 4YFNF 2OQRA 1QZYA 1S6LA 1NH3A 1ETOA 3GMEA 4DBRA 1OQYA 2IW5A 4L9NA 2Y75A 3BJAA 3ZQFA 2ZMEA 4HDVA 5BPDA 4Y15A 5EF6A 2EILH 1IXCA 2MGQA 3JRHA 4BBSJ 3TO6A 1MBEA 2E1NA 3H9GA 4I01A 1VQKI 3FBNB 3QQAA 1IN6A 2HZTA 5F04A 2GIVA 3M1EA 1PDNC 1VTNC 2BVMA 4HAMA 4JX5A 4EM1A 3E7LA 5C3EJ 4Q5SF 1S9HA 2GOXB 5E79C 4HSRA 3KE2A 2NRAC 1S5LC 2VKEA 1H0MA 1OJLA 4LD5A 4BQQA 3DBHB 1VFCA 5E1WA 3O8GA 2NVUB 4ITVA 1TNSA 4M9SA 1XX5A 5KAFC 3GWZA 4BE2A 1WZ2A 1I50J 3G1LA 1UG2A 3RJPA 4BXFA 3F8FA 1RI7A 2X51A 3LSHA 5DV5A 5DDGA 4R79A 1H9GA 5L3EA 2PN6A 3K4KA 2A68F 2VT3A 1HBXG 3C2HA 1JTYA 1K6YA 1BM9A 1W0UA 3ZN0A 2LKPA 3N05A 1XD7A 5IP7J 2STWA 3M8EA 2E34A 3RZDJ 4F91B 3LSGA 2R5ZA 1YE9A 3HOTA 2JA8J 4ANJA 1HKQA 2KZGA 5E18F 3OY9A 1BJAA 2VC0A 1QBJA 2FJ1A 3DTIA 1OCCH 3HDDA 5K7HA 2X48A 3ABMH 4Y7NJ 3K2ZA 1FWZA 1HKTA 1KONA 3I5UA 3PNVA 4UUTA 4A2UA 4XLEA 1Z6RA 4M3FA 4EVIA 5F1JA 5DUIA 4IRIA 1S7AA 4QIWN 1DPRA 2VOPA 4N9IA 5LEJA 3T0YA 3AL0C 3H3VK 4D9JA 2DFFA 2BY3A 5M5XJ 3ZMZA 3P5JA 2HKOA 4C2MJ 1X1AA 2VUMJ 3HRUA 5FLXK 1SD4A 1MNEA 2VQGA 2AQEA 1ZG1A 2LBFB 2FMLA 1BIBA 2E19A 1KQ8A 3IWZA 2OU2A 2LY9A 1AHDP 1SEUA 5BOXA 1SFEA 2R7RA 1NG6A 2G9WA 1FEXA 3QAHA 4XKWA 5DYMA 1I27A 2KISA 3AAFA 2BGCA 3K1NA 3KZIC 2CGPA 3KP7A 1U9OA 3AG3H 1AOYA 4KMUX 4ZYGA 4A5MA 3MVPA 5GAGJ 2OCEA 1W36D 2O03A 1LFUP 3HOUJ 3MZYA 4AWXB 1ZGAA 3VYUB 1Y8QB 3HUGB 2Q1ZB 4I02A 4FTHA 1MZBA 2A3SA 3TP0A 2P5KA 3OS2A 1YW8A 2B7EA 5CVJA 4UUVA 3CDIA 2DOFA 2WBMA 3CUQC 2KKOA 5FLMJ 3MEXA 5IY5H 1MIJA 3R6SA 3DU5A 4E7JA 1VQ4I 1OCPA 3JRCA 4QWQA 5FROA 3CCEI 1FC3A 3QYFA 2K3FA 4ETSA 5HDNA 3OYCA 1ZYRF 2XHKA 2MFZA 2UZKA 1DGRM 4Y4RA 3E5QA 2M7BA 5AONA 5IYBJ 3PO2J 3GFIA 5LHHA 4HBLA 2HZDA 2ZMEC 4IQ4A 3FK7A 1TWFJ 1S7EA 3AG4H 2L9NA 2R7QA 4DNCA 4KISA 1K61A 1SMYF 4C3IJ 1KU2A 1RKWA 2I5UA 3GTMJ 2KRHA 3NWSA 4LGWA 4XM3A 1VQ7I 2XAFA 3SQNA 4F3QA 3WTXC 1K7AA 1AKHB 1OYIA 3F72A 3UKGA 1O3SA 1SVLA 1G3SA 2EB7A 5ICEA 3GFJA 5GTHC 1DUXC 1IGNA 4C2UA 1BW5A 3GXOA 1YO5C 5H6QA 1MBHA 1ZG3A 1QPMA 2CWEA 2W57A 3D1NI 1N75A 3ZMDA 2ISZA 1FBQA 1GVDA 3B6CA 1OR7C 5D5WB 1X19A 3HM5A 3PL8A 4P5OA 2V1XA 3G1OA 3KP6A 3R4KA 2IA2A 2KIMA 2CUJA 2WB1N 2K9QA 3H5AA 3BR1A 3QU3A 2RV8A 3TO9A 3SHFA 1YJNI 2RKHA 5FJ8J 1U5TA 1Q1VA 1BI3A 2YU3A 1JUSA 2LOOA 1KYWA 3KLOA 1FIPA 1IXSB 2FMYA 2XVCA 3WTZA 1F36A 4GYIA 2CSOA 3KYLA 4ZDPA 2QQBA 4UB6C 2GWRA 4KIGA 5CVIA 3KX2A 2A61A 3HGYA 3BG5A 1YYVA 3FM5A 1NK3P 2E1CA 4G7ZF 2ZSHB 2CQ7A 2WADA 4IL6C 4I0AA 4P9FA 2EFWA 2XC7A 3GO5A 4BQNA 1P2FA 2F4IA 1D0XA 1I1SA 3CDLA 1YIJI 1ZGJA 1WGXA 2Y9ZA 2Z16A 2QQAA 2ESHA 5DS9A 3G6EI 4KMFA 2HFHA 4E7SA 4H0EA 4E70A 3JRBA 3S3NA 4IHSA 2K4BA 2AS5F 2VBYA 2FNAA 2CO5A 2CV0A 3LL7A 1RIOH 1L3LA 3HPHA 2JA7J 1BI0A 3S32A 2QVOA 3NARA 5K5OA 2XPUA 1PJRA 1BR2A 2NVQJ 3NAUA 1LEAA 3CZ6A 3KYCB 1NG7A 2L7FP 2OPTA 1HA8A 2Y30A 1JXSA 2ZNZA 1IDZA 3L2QA 3LQQA 1A35A 2HOTA 3IP4B 1ZHFA 5L3FA 2HDDA 3CC7I 1F9NA 3BTLA 4EJWA 5FRNA 3RKQA 4U0WA 1BOBA 2O5RA 2QKMB 3GVAA 3KCCA 4H4KC 1I5ZA 2XGCA 5LHGA 3F8CA 3CMMA 4BAYA 2LMDA 4A93J 2EINH 1SMTA 2LP0A 1LNWA 5J40A 1K78A 1BIAA 2B63J 3TO7A 3TMOA 2DDAA 2Z5UA 2VLAA 3DU6A 3C2GA 2NS0A 1ZH5A 2IRFG 1RETA 4M6XA 2QCOA 1DU6A 3KEYA 1J75A 4WXCA 4IX7A 2DBBA 2W25A 1IN5A 4C2TA 4B4CA 4LJZF 1IN7A 3SDBA 1AU7A 1GHCA 2VASA 1BC8C 3SZTA 2HQAA 2RAEA 4QPQA 4OIPF 2QENA 1FT9A 5M5WJ 4BDYA 2P6SA 2DDBA 4KUMA 2CV1A 4HLYA 4D7MA 2ME0A 2QZ8A 5TJJA 4HRIA 1IW7F 3FXLA 4OIRF 1EKEA 1N78A 3K4CA 5LHIA 1IRFA 2H09A 2XF6A 2MYSA 3KP3A 2WAFA 3T8RA 3K4LA 3MQ0A 4AM3A 2WWYA 1YIOA 2WA0A 3GCMA 2ZNYA 4RMNA 3BOQA 1Z91A 3O3KA 2ETHA 4IOAF 4I7HA 2KL4A 5ERIA 1SAUA 3RIRA 2V9PA 4CCOA 4BDZA 4J01A 3QRFF 5CLSA 3GTOJ 1LVAA 3KP2A 1QA6A
chains in the Genus database with same CATH topology
3Q0UA 1AKHA 1XS9A 3S14J 2Y31A 2P81A 4JP0A 2LVSA 4FE4A 1LE8B 1JKPC 3FISA 3HOZJ 3SFIA 5GP9A 1UHSA 4IHVA 1TWCJ 4I6ZA 1PUFA 1HF0A 2HOAA 4B3AA 2FD5A 4I76A 3WHCA 4BBRJ 1QVTA 1I6HJ 2HXOA 2CJJA 1ETQA 4JX6A 4X6AJ 9ANTA 1B8IB 2K40A 4M3DA 3S16J 2CQQA 1P7JA 2N8GA 1E3OC 2GM4A 1JKOC 1POGA 1BA5A 4A3CJ 1HDPA 3HKZN 2XGDA 3Q0WA 4M3EA 2JJ7A 2E2HJ 5J1RA 3IH2A 3S1QJ 3MN2A 4M6VA 3JRAA 1JKRC 2M8GX 2OF7A 5FKMA 1MBGA 3F0CA 3M4OJ 1OFCX 1JUPA 4UUSA 2MG4A 4W1UA 1WH7A 3RQIA 3CMYA 3PO3J 1VNDA 2DA7A 3LOCA 1APLC 1FJLA 1JGGA 1Z77A 1WI3A 4ABZA 1MBJA 4NDLA 3GTJJ 4A3MJ 1FTTA 4A3LJ 1MH3A 4BKXA 1HOMA 3HOWJ 2Y0SN 4EEFG 2D5VA 2ZB9A 2ELKA 5C4JJ 1RESA 3BR6A 4XRSA 5IPAA 4FCYA 2E2JJ 3QPLA 1QPIA 2E2IJ 5J1UA 3ZQCA 2FX0A 3W6VA 2R5YA 5IP6A 1JT0A 2IEKA 2ME6A 1X2NA 3JRGA 1FTZA 1ETOA 5IYDJ 4C3JJ 4IEJA 1U8BA 2HYJA 2DMTA 3ZQFA 1EF4A 5EF6A 4DZPA 3HOXJ 2HXIA 4V2FA 3C2BA 1XG1A 4XK4A 1YRNB 4A3GJ 2MGQA 3GBGA 4A3BJ 3JRHA 4BBSJ 2VKVA 1MBEA 1QVUA 3QQAA 1F43A 1MNMC 5F04A 5HODA 5EG0A 5FKLA 1ZR2A 4JX5A 5C3EJ 3E7LA 4Y52J 3OOUA 3HBLA 3BR5A 2H8RA 4CYCA 3DCFA 3MKLA 3A01B 4BY7J 2VKEA 2JK3A 1HDDC 4LOCA 1OJLA 5E3OA 1VFCA 1ETVA 3O8GA 1JTXA 2L7MP 2M9HA 3ZQHA 3GTQJ 3I4MJ 1X58A 5EGOB 1I50J 3G1LA 1UG2A 3BQYA 4A3JJ 3BTJA 1I3QJ 3BT9A 5M3FJ 2VPRA 3IV5A 1Z0XA 1JT6A 4FE7A 1ETKA 2EH3A 2R7ZJ 4XRSG 4AYBN 2EZLA 1B72B 1JTYA 4DYCA 2ECBA 1W0UA 4XICA 3RZOJ 2R93J 2DMQA 4A69C 2W48A 5IP7J 2XPWA 3S2DJ 1GV5A 1XC5A 5FKNA 2EBIA 2EQRA 3VPRA 3RZDJ 3LSGA 2R5ZA 3BR0A 5F0FA 2JA6J 3S1MJ 2JA8J 3BR2A 1JKQC 5IOYA 1W0TA 2JN6A 2FJ1A 3HDDA 5K7HA 1ZKGA 3TW6A 2IBDA 2X48A 4Y7NJ 3BTIA 5GPCA 4G12A 4DYQA 4MO7A 2LTPA 4UUTA 3BG9A 3BR3A 5K7ZA 2JWTA 5F1JA 4M3FA 5E3LA 1NTCA 2FQ4A 1LE8A 2TCTA 4QIWN 1Y1WJ 3OSGA 2DTZA 1RKTA 2CRGA 3CQZJ 3K2AA 2XRLA 2AHQA 2NVYJ 3H3VK 1P7IA 1VI0A 5M5XJ 2JMWA 4AUXA 4C2MJ 2VUMJ 1T56A 2Y2ZA 1B8IA 1MSEC 1FIAA 3JRDA 1HLVA 2DA6A 3LNQA 4J19A 5FKOA 2E19A 2NS7A 3L1PA 2LY9A 1GT0C 4W97A 1U9NA 2O9LA 1AHDP 4A3KJ 5EZHA 3TW7A 1IRZA 3H0GJ 2X9DA 2JA5J 2GBYA 1VF9A 1RPWA 2MW8A 2HOSA 1FEXA 2M2EA 4JX4A 4A3EJ 2LKXA 1ZK8A 3OIOA 1U9OA 4M3GA 2DA5A 3MVPA 2CUFA 3S1NJ 1LFUP 3HOUJ 1WH5A 2EZHA 4BY1J 3JRIA 4S0HB 5C44J 5DTDA 4FTHA 3TP0A 2DN0A 2R0QC 2L0KA 4A3FJ 2HI3A 3FIWA 1O4XA 2LLKA 1ETYA 3LSJA 1G2HA 3S1RJ 1ZTRA 5FLMJ 3JRFA 4CYCB 3HB9A 3ZQGA 4MFEA 1OCPA 3JRCA 3G1MA 2YU9J 3ZOBA 3SDGA 1JJ8C 1BJZA 1ETWA 5F0HA 2EZIA 5IYBJ 2QF7A 5JLWA 5M5YJ 3PO2J 2YUSA 2CQXA 3FK7A 1TWFJ 1S7EA 1Y1VJ 1ETXA 4MFDA 2COBA 5IOZA 3S15J 1K61A 4C3IJ 3O8HA 3I4NJ 2O8KA 1SFOJ 1RKWA 1YRNA 3GTMJ 1T33A 2WAQN 4D5CA 5K7FA 1GDTA 2M0CA 2KDZA 4A3DJ 1JUMA 2ECCA 4DYRA 1AKHB 2LD5A 1QRYA 4MLOA 1ITYA 3LSPA 2K9NA 5IYCJ 3UKGA 2M34A 2L7ZA 1IG7A 1IGNA 1BW5A 5E3NA 3A01A 4JYKA 3ZQIA 1HCRA 1MBHA 3D1NI 2LR8A 1A5JA 1PUFB 3S17J 3JR9A 1GVDA 1TWHJ 4X1EA 3B6CA 4QTRA 1WCMJ 2MSYA 2IAIA 3HM5A 4D5FA 3G1OA 1R9TJ 5F08A 1ORKA 3LSRA 3HEFA 2Y9YA 2WB1N 2K9QA 5FLVA 3WHBA 1CQTA 4A3IJ 3BR1A 1X2MA 5J1YA 4RBOA 2DA4A 2NVXJ 4GFBA 4XRMA 5FJ8J 3DEWA 1H89C 2DJNA 1Q1VA 1B72A 2KT0A 1JUSA 3FKIJ 1FIPA 2YS9A 3IH4A 3IH3A 1F36A 3OSFA 1MSFC 3Q3SA 4UUSB 4BXXJ 3K7AJ 5JLXA 3HGYA 3BG5A 2I10A 2ID6A 1NK3P 2L9RA 1A6IA 3HOYJ 5IP9J 3S2HJ 2DMNA 2XB0X 3CDLA 2AO9A 1TWGJ 1WGXA 1GV2A 1MBFA 3A03A 3HGGA 2Y9ZA 1BW6A 1UMQA 1ZGWA 5DS9A 1GUUA 3A02A 3PM1A 3JRBA 5F27A 5GPAA 2R5YB 3M3YJ 4QSHA 2NS8A 4M3BA 5E3MA 5FKKA 1MBKA 2JA7J 4IHXA 3CCYA 4AC0A 1ZQ3P 3NARA 3B6AA 2XPUA 4IHYA 2NVQJ 3NAUA 4D7NA 1NK2P 4RDUA 2GLOA 2LFBA 2L7FP 2OPTA 2VI6A 2Y30A 1IDZA 1IJWC 4V2GA 2HOTA 4DZJA 1IDYA 1U78A 4FISA 3TP3A 2WV1A 2HDDA 3BTLA 4XIDA 3BQZA 2XB5A 5EG0B 3RKQA 1K83J 2O7OA 2TRTA 5EYRA 2XGCA 1ZR4A 2HQ5A 2DA1A 5C4XJ 4A93J 5EDNA 2X6OA 2LP0A 1LFBA 2B63J 3ZQLA 5BNGA 3GTGJ 1RR7A 5M3MJ 5EEAA 2G0EA 4DW6A 3GTPJ 3BG3A 1OCTC 2CUEA 2XGEA 1RETA 2K9SA 2QCOA 1DU6A 3TEDA 5EZGA 3Q0VA 4IHWA 2PMZN 4B4CA 4HNVA 1AU7A 3JREA 5F0CA 2XPVA 2RAEA 3GTLJ 1IUFA 5M5WJ 1JJ6C 4L5EA 1TWAJ 2NVTJ 3BTCA 2XSDC 4D7MA 1TC3C 2R92J 1ENHA 2ME0A 3GTKJ 2DMPA 5J3LA 3HOVJ 3SJMA 1WPKA 3QPSA 4MIMA 2R5ZB 1H88C 2DA3A 1MH4A 3FK6A 4C3HJ 1IC8A 2NOGA 2CU7A 1SANA 2ID3A 2LK2A 1IV6A 5EGOA 1D5YA 2E1OA 1H8AC 2EZKA 2H1KA 1BL0A 1DU0A 3GTOJ 2DA2A 4B1RA 2DMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0U A;  1AKH A;  1XS9 A;  3S14 J;  2Y31 A;  2P81 A;  4JP0 A;  2LVS A;  4FE4 A;  1LE8 B;  1JKP C;  3FIS A;  3HOZ J;  3SFI A;  5GP9 A;  1UHS A;  4IHV A;  1TWC J;  4I6Z A;  1PUF A;  1HF0 A;  2HOA A;  4B3A A;  2FD5 A;  4I76 A;  3WHC A;  4BBR J;  1QVT A;  1I6H J;  2HXO A;  2CJJ A;  1ETQ A;  4JX6 A;  4X6A J;  9ANT A;  1B8I B;  2K40 A;  4M3D A;  3S16 J;  2CQQ A;  1P7J A;  2N8G A;  1E3O C;  2GM4 A;  1JKO C;  1POG A;  1BA5 A;  4A3C J;  1HDP A;  3HKZ N;  2XGD A;  3Q0W A;  4M3E A;  2JJ7 A;  2E2H J;  5J1R A;  3IH2 A;  3S1Q J;  3MN2 A;  4M6V A;  3JRA A;  1JKR C;  2M8G X;  2OF7 A;  5FKM A;  1MBG A;  3F0C A;  3M4O J;  1OFC X;  1JUP A;  4UUS A;  2MG4 A;  4W1U A;  1WH7 A;  3RQI A;  3CMY A;  3PO3 J;  1VND A;  2DA7 A;  3LOC A;  1APL C;  1FJL A;  1JGG A;  1Z77 A;  1WI3 A;  4ABZ A;  1MBJ A;  4NDL A;  3GTJ J;  4A3M J;  1FTT A;  4A3L J;  1MH3 A;  4BKX A;  1HOM A;  3HOW J;  2Y0S N;  4EEF G;  2D5V A;  2ZB9 A;  2ELK A;  5C4J J;  1RES A;  3BR6 A;  4XRS A;  5IPA A;  4FCY A;  2E2J J;  3QPL A;  1QPI A;  2E2I J;  5J1U A;  3ZQC A;  2FX0 A;  3W6V A;  2R5Y A;  5IP6 A;  1JT0 A;  2IEK A;  2ME6 A;  1X2N A;  3JRG A;  1FTZ A;  1ETO A;  5IYD J;  4C3J J;  4IEJ A;  1U8B A;  2HYJ A;  2DMT A;  3ZQF A;  1EF4 A;  5EF6 A;  4DZP A;  3HOX J;  2HXI A;  4V2F A;  3C2B A;  1XG1 A;  4XK4 A;  1YRN B;  4A3G J;  2MGQ A;  3GBG A;  4A3B J;  3JRH A;  4BBS J;  2VKV A;  1MBE A;  1QVU A;  3QQA A;  1F43 A;  1MNM C;  5F04 A;  5HOD A;  5EG0 A;  5FKL A;  1ZR2 A;  4JX5 A;  5C3E J;  3E7L A;  4Y52 J;  3OOU A;  3HBL A;  3BR5 A;  2H8R A;  4CYC A;  3DCF A;  3MKL A;  3A01 B;  4BY7 J;  2VKE A;  2JK3 A;  1HDD C;  4LOC A;  1OJL A;  5E3O A;  1VFC A;  1ETV A;  3O8G A;  1JTX A;  2L7M P;  2M9H A;  3ZQH A;  3GTQ J;  3I4M J;  1X58 A;  5EGO B;  1I50 J;  3G1L A;  1UG2 A;  3BQY A;  4A3J J;  3BTJ A;  1I3Q J;  3BT9 A;  5M3F J;  2VPR A;  3IV5 A;  1Z0X A;  1JT6 A;  4FE7 A;  1ETK A;  2EH3 A;  2R7Z J;  4XRS G;  4AYB N;  2EZL A;  1B72 B;  1JTY A;  4DYC A;  2ECB A;  1W0U A;  4XIC A;  3RZO J;  2R93 J;  2DMQ A;  4A69 C;  2W48 A;  5IP7 J;  2XPW A;  3S2D J;  1GV5 A;  1XC5 A;  5FKN A;  2EBI A;  2EQR A;  3VPR A;  3RZD J;  3LSG A;  2R5Z A;  3BR0 A;  5F0F A;  2JA6 J;  3S1M J;  2JA8 J;  3BR2 A;  1JKQ C;  5IOY A;  1W0T A;  2JN6 A;  2FJ1 A;  3HDD A;  5K7H A;  1ZKG A;  3TW6 A;  2IBD A;  2X48 A;  4Y7N J;  3BTI A;  5GPC A;  4G12 A;  4DYQ A;  4MO7 A;  2LTP A;  4UUT A;  3BG9 A;  3BR3 A;  5K7Z A;  2JWT A;  5F1J A;  4M3F A;  5E3L A;  1NTC A;  2FQ4 A;  1LE8 A;  2TCT A;  4QIW N;  1Y1W J;  3OSG A;  2DTZ A;  1RKT A;  2CRG A;  3CQZ J;  3K2A A;  2XRL A;  2AHQ A;  2NVY J;  3H3V K;  1P7I A;  1VI0 A;  5M5X J;  2JMW A;  4AUX A;  4C2M J;  2VUM J;  1T56 A;  2Y2Z A;  1B8I A;  1MSE C;  1FIA A;  3JRD A;  1HLV A;  2DA6 A;  3LNQ A;  4J19 A;  5FKO A;  2E19 A;  2NS7 A;  3L1P A;  2LY9 A;  1GT0 C;  4W97 A;  1U9N A;  2O9L A;  1AHD P;  4A3K J;  5EZH A;  3TW7 A;  1IRZ A;  3H0G J;  2X9D A;  2JA5 J;  2GBY A;  1VF9 A;  1RPW A;  2MW8 A;  2HOS A;  1FEX A;  2M2E A;  4JX4 A;  4A3E J;  2LKX A;  1ZK8 A;  3OIO A;  1U9O A;  4M3G A;  2DA5 A;  3MVP A;  2CUF A;  3S1N J;  1LFU P;  3HOU J;  1WH5 A;  2EZH A;  4BY1 J;  3JRI A;  4S0H B;  5C44 J;  5DTD A;  4FTH A;  3TP0 A;  2DN0 A;  2R0Q C;  2L0K A;  4A3F J;  2HI3 A;  3FIW A;  1O4X A;  2LLK A;  1ETY A;  3LSJ A;  1G2H A;  3S1R J;  1ZTR A;  5FLM J;  3JRF A;  4CYC B;  3HB9 A;  3ZQG A;  4MFE A;  1OCP A;  3JRC A;  3G1M A;  2YU9 J;  3ZOB A;  3SDG A;  1JJ8 C;  1BJZ A;  1ETW A;  5F0H A;  2EZI A;  5IYB J;  2QF7 A;  5JLW A;  5M5Y J;  3PO2 J;  2YUS A;  2CQX A;  3FK7 A;  1TWF J;  1S7E A;  1Y1V J;  1ETX A;  4MFD A;  2COB A;  5IOZ A;  3S15 J;  1K61 A;  4C3I J;  3O8H A;  3I4N J;  2O8K A;  1SFO J;  1RKW A;  1YRN A;  3GTM J;  1T33 A;  2WAQ N;  4D5C A;  5K7F A;  1GDT A;  2M0C A;  2KDZ A;  4A3D J;  1JUM A;  2ECC A;  4DYR A;  1AKH B;  2LD5 A;  1QRY A;  4MLO A;  1ITY A;  3LSP A;  2K9N A;  5IYC J;  3UKG A;  2M34 A;  2L7Z A;  1IG7 A;  1IGN A;  1BW5 A;  5E3N A;  3A01 A;  4JYK A;  3ZQI A;  1HCR A;  1MBH A;  3D1N I;  2LR8 A;  1A5J A;  1PUF B;  3S17 J;  3JR9 A;  1GVD A;  1TWH J;  4X1E A;  3B6C A;  4QTR A;  1WCM J;  2MSY A;  2IAI A;  3HM5 A;  4D5F A;  3G1O A;  1R9T J;  5F08 A;  1ORK A;  3LSR A;  3HEF A;  2Y9Y A;  2WB1 N;  2K9Q A;  5FLV A;  3WHB A;  1CQT A;  4A3I J;  3BR1 A;  1X2M A;  5J1Y A;  4RBO A;  2DA4 A;  2NVX J;  4GFB A;  4XRM A;  5FJ8 J;  3DEW A;  1H89 C;  2DJN A;  1Q1V A;  1B72 A;  2KT0 A;  1JUS A;  3FKI J;  1FIP A;  2YS9 A;  3IH4 A;  3IH3 A;  1F36 A;  3OSF A;  1MSF C;  3Q3S A;  4UUS B;  4BXX J;  3K7A J;  5JLX A;  3HGY A;  3BG5 A;  2I10 A;  2ID6 A;  1NK3 P;  2L9R A;  1A6I A;  3HOY J;  5IP9 J;  3S2H J;  2DMN A;  2XB0 X;  3CDL A;  2AO9 A;  1TWG J;  1WGX A;  1GV2 A;  1MBF A;  3A03 A;  3HGG A;  2Y9Z A;  1BW6 A;  1UMQ A;  1ZGW A;  5DS9 A;  1GUU A;  3A02 A;  3PM1 A;  3JRB A;  5F27 A;  5GPA A;  2R5Y B;  3M3Y J;  4QSH A;  2NS8 A;  4M3B A;  5E3M A;  5FKK A;  1MBK A;  2JA7 J;  4IHX A;  3CCY A;  4AC0 A;  1ZQ3 P;  3NAR A;  3B6A A;  2XPU A;  4IHY A;  2NVQ J;  3NAU A;  4D7N A;  1NK2 P;  4RDU A;  2GLO A;  2LFB A;  2L7F P;  2OPT A;  2VI6 A;  2Y30 A;  1IDZ A;  1IJW C;  4V2G A;  2HOT A;  4DZJ A;  1IDY A;  1U78 A;  4FIS A;  3TP3 A;  2WV1 A;  2HDD A;  3BTL A;  4XID A;  3BQZ A;  2XB5 A;  5EG0 B;  3RKQ A;  1K83 J;  2O7O A;  2TRT A;  5EYR A;  2XGC A;  1ZR4 A;  2HQ5 A;  2DA1 A;  5C4X J;  4A93 J;  5EDN A;  2X6O A;  2LP0 A;  1LFB A;  2B63 J;  3ZQL A;  5BNG A;  3GTG J;  1RR7 A;  5M3M J;  5EEA A;  2G0E A;  4DW6 A;  3GTP J;  3BG3 A;  1OCT C;  2CUE A;  2XGE A;  1RET A;  2K9S A;  2QCO A;  1DU6 A;  3TED A;  5EZG A;  3Q0V A;  4IHW A;  2PMZ N;  4B4C A;  4HNV A;  1AU7 A;  3JRE A;  5F0C A;  2XPV A;  2RAE A;  3GTL J;  1IUF A;  5M5W J;  1JJ6 C;  4L5E A;  1TWA J;  2NVT J;  3BTC A;  2XSD C;  4D7M A;  1TC3 C;  2R92 J;  1ENH A;  2ME0 A;  3GTK J;  2DMP A;  5J3L A;  3HOV J;  3SJM A;  1WPK A;  3QPS A;  4MIM A;  2R5Z B;  1H88 C;  2DA3 A;  1MH4 A;  3FK6 A;  4C3H J;  1IC8 A;  2NOG A;  2CU7 A;  1SAN A;  2ID3 A;  2LK2 A;  1IV6 A;  5EGO A;  1D5Y A;  2E1O A;  1H8A C;  2EZK A;  2H1K A;  1BL0 A;  1DU0 A;  3GTO J;  2DA2 A;  4B1R A;  2DMU A; 
#chains in the Genus database with same CATH topology
 3Q0U A;  1MDM B;  4M72 A;  1DP3 A;  2XUB A;  3HSR A;  4CA0 A;  2F5D A;  4M71 A;  1R71 A;  3BWG A;  2LVS A;  3L2V A;  1LE8 B;  2E7X A;  3HRT A;  4ON0 A;  4P9U A;  1UHS A;  2Q0O A;  1QO0 D;  2EWN A;  1Z21 A;  4EJU A;  3MWM A;  4I76 A;  4BE0 A;  5K1Y A;  3U1D A;  3WHC A;  3M7G A;  1I6H J;  2L5Q A;  1LDD A;  3CJR B;  3CLQ A;  4JX6 A;  1B8I B;  2XRN A;  5DD8 A;  2H6C A;  3JTH A;  4M3D A;  2MLG A;  3O2P E;  4G6T B;  2CQQ A;  2OV7 A;  2H94 A;  2N8G A;  1FP2 A;  3K10 A;  2GM4 A;  4C9Y A;  1JKO C;  1U5T C;  3IKT A;  3GFL A;  5FFZ A;  2M4K A;  2CH0 A;  2F5F A;  3HKZ N;  2XAQ A;  1FOY A;  1YX5 A;  2JJ7 A;  2E2H J;  3ZCO A;  4CIC A;  3IH2 A;  3EET A;  2UXX A;  2GAU A;  3W2W A;  2DI3 A;  4HNT A;  1VQO I;  4E7H A;  4V19 K;  4XQF A;  1JUP A;  1HW1 A;  1WJF A;  3CMY A;  4W1U A;  1R36 A;  1WH7 A;  3V4G A;  4ESF A;  1LDJ A;  3IKV A;  4CDG A;  3WE3 A;  1B59 A;  1IRG A;  1FJL A;  4UNO A;  2QGU A;  2HU9 A;  4A6D A;  1JGG A;  5DCM A;  4EAT A;  2HYF A;  1KGS A;  4HEA 2;  4A3L J;  1RUO A;  3I56 I;  3HOW J;  3IC7 A;  1LKX A;  3GLL A;  2F6C A;  1FMV A;  5CPR B;  4UVA A;  2ZXI A;  1AA7 A;  3BR6 A;  1LFP A;  3K1M A;  3M8F A;  5IPA A;  4G7H F;  2P5L C;  3BDD A;  1QPI A;  4LIU A;  5J1U A;  3ZQC A;  3ASO H;  1QZE A;  3ZPL A;  1LUJ B;  1GXP A;  3W6V A;  2R5Y A;  2QUF A;  2QSH X;  5TGT A;  5ED4 A;  3I3L A;  2HEO A;  2EA4 A;  4BUP A;  3WGI A;  2CG4 A;  1TW2 A;  3CCS I;  1OMI A;  3OYD A;  2EIM H;  3BG7 A;  4IEJ A;  4G7O F;  2MBF A;  3S93 A;  1S29 A;  4YIF A;  1NHA A;  4B48 A;  2VKV A;  5E8I A;  1T95 A;  4A12 A;  2OA4 A;  4ZJZ A;  2JTV A;  4OWR B;  2VJJ A;  4BS9 A;  1OCZ H;  5EG0 A;  4EGY A;  2CQN A;  5KNL A;  3HHG A;  3CCU I;  4NQW B;  3ML6 A;  2QSG X;  1EH6 A;  2V26 A;  1YS7 A;  1RNL A;  3HBL A;  2G7H A;  3DCF A;  4F93 B;  4CYC A;  3AFH A;  3MKL A;  5J4Y A;  2E1M C;  3L2C A;  3A01 B;  2DU9 A;  2JK3 A;  3S8P A;  3VEP A;  1RZ4 A;  5L3D A;  5E3O A;  2KFD A;  1FSH A;  1XMA A;  2JZY A;  1J7K A;  2D1H A;  4JBA A;  4MGR A;  2GXG A;  3Q5F A;  5H2F C;  1FBS A;  3I4M J;  3M1C A;  1X58 A;  3RKX A;  4A3J J;  3BQY A;  3K70 C;  2STT A;  3QU6 A;  2MAB A;  3BTJ A;  2EFO A;  2RVC A;  2V1D A;  5M3F J;  2VPR A;  3RCO A;  1ZRE A;  3IV5 A;  2HTS A;  1Z0X A;  1JT6 A;  2ZBK A;  2M0M A;  2EH3 A;  4HST A;  2EZL A;  4EJT A;  4DYC A;  2ECB A;  1UG0 A;  3AG2 H;  1BBY A;  5TIS C;  2ZJR F;  3DTE A;  3DWL E;  4U7B A;  2W48 A;  2ADU A;  2BW3 B;  2KJB A;  2F2E A;  2XPW A;  4E4H A;  2HQN A;  4ZZD A;  2K9M A;  1IZ1 A;  3DFG A;  1O57 A;  3QOD A;  4KT6 A;  3S2W A;  4PGG A;  3VPR A;  4HDU A;  3CC2 I;  3PSF A;  3AL0 B;  2JA6 J;  5HLG A;  3S1M J;  4XLH A;  3E97 A;  3KPH A;  3VSL A;  5FLX Z;  4P55 A;  3OIQ A;  2O8X A;  2K9L A;  3BJ6 A;  4AVZ A;  3BR2 A;  3HZJ A;  2X1D A;  4UVB A;  3ECO A;  2QKL B;  1G6N A;  1X1B A;  3F8N A;  1VQM I;  4NHJ A;  5IT9 Z;  1J09 A;  1WI9 A;  3E5X A;  1YHQ I;  3ELK A;  4PCQ A;  2VN2 A;  3P7N A;  4MO7 A;  2LTP A;  3BR3 A;  3LAJ A;  4CCM A;  5FGM A;  2JWT A;  3HSF A;  5DCF A;  3CCQ I;  2FQ4 A;  2PMU A;  4HLX A;  1EH7 A;  2FU4 A;  3OYI A;  2VJ4 A;  4XOP A;  2RNG A;  2DTZ A;  1RKT A;  2CRG A;  2PMH A;  3CQZ J;  3EQL F;  3K2A A;  4XMY A;  4GRI A;  3ZP5 A;  6PAX A;  3GYH X;  1W7P B;  2AHQ A;  3DXJ F;  5JFR A;  4Z2Y A;  4CH7 A;  1R00 A;  4U0Y A;  1MSE C;  1YJ9 I;  1FIA A;  4XKC A;  3LWF A;  2QQ9 A;  3J81 K;  3ROU A;  3JRD A;  2KIU A;  5FKO A;  2LKS A;  2DFI A;  1O7F A;  3QP5 A;  1OCO H;  3L1P A;  5LD2 C;  2ZO4 A;  4F92 B;  1D3Y A;  1GT0 C;  4BAC A;  4LK0 F;  3JSP A;  4LK1 F;  4PJJ A;  3GLX A;  4IF4 A;  2GBY A;  2A69 F;  3HHH A;  4DJA A;  4IZZ A;  4JX4 A;  2E7W A;  3NQO A;  5A2Q Z;  3F3X A;  1PP7 U;  1R1V A;  3OYM A;  3OIO A;  3OIP A;  4CCN A;  2ZFU A;  3ZGK A;  2DO7 A;  4Y3O A;  2CUF A;  4FAS D;  2H6B A;  3Q9V A;  3G2B A;  1DGW Y;  2W24 A;  3LA2 A;  4BY1 J;  2DK5 A;  5CVV A;  1ZLJ A;  1G8X A;  2LNB A;  3FF5 A;  3PUB A;  2OBP A;  2DN0 A;  3RPQ A;  4A3F J;  2LY2 A;  5LGN A;  1O4X A;  4IJA A;  3M9A A;  1YW9 A;  2L2O A;  2KLO A;  5HLT A;  3U1K A;  1ZTR A;  2IGM A;  3CF2 A;  3CLO A;  1YLF A;  3MMY B;  1TQM A;  5IT3 A;  5JR3 A;  1R1T A;  4MFE A;  4O5V A;  4ZTF A;  3I58 A;  3DKX A;  1SFX A;  2XAH A;  4G8X A;  2K27 A;  4PDK A;  1PYV A;  1R58 A;  2LRE A;  4FET A;  1FLI A;  1JJ8 C;  1BJZ A;  1ETW A;  5F0H A;  2EZI A;  4R8H A;  1G4D A;  4YEJ A;  3OYN A;  4OIO F;  4PSW A;  4E7L A;  4ZTJ A;  1T38 A;  1K6O A;  4HX7 A;  1E2X A;  2BXY A;  3J80 K;  2ICW G;  2OTJ I;  1EA3 A;  5LGU A;  1TW3 A;  2O8K A;  4CYD A;  5HS8 A;  1CF7 B;  1N77 A;  4D5C A;  2M0C A;  3DV8 A;  4BXU A;  1JUM A;  3FZV A;  3B73 A;  3E6M A;  1AWC A;  5J8C A;  4HA8 A;  5B5E C;  3FXJ A;  4L9V A;  1QRY A;  2ZSI B;  1ITY A;  2E5N A;  2MA3 A;  2K9N A;  5KVR A;  3I4P A;  2L7Z A;  1IG7 A;  2GA1 A;  3U21 A;  2RC4 A;  3HXL A;  1HCR A;  2W85 A;  4XNF A;  2LR8 A;  1T8I A;  5HS9 A;  1XGN A;  4HZF A;  4CZC A;  1Q1H A;  2BZT A;  1T98 A;  4MQV A;  4IKF A;  5KCM A;  3COA C;  4QTR A;  1F5T A;  1W4M A;  3DP7 A;  3GZN B;  1BI1 A;  1R9T J;  4KIF A;  4HX4 A;  2BBY A;  1UHM A;  1PP8 F;  1KYZ A;  3WHB A;  4RAF A;  1BC7 C;  1CQT A;  5LLQ A;  4A3I J;  2JA2 A;  4RBO A;  2DA4 A;  2DFH A;  3G73 A;  3OOP A;  1VQ8 I;  4OMY A;  2I8D A;  2QSF X;  3BPX A;  4MTD A;  2F5V A;  2X4H A;  3K1P A;  4XRM A;  5ICF A;  3WU1 B;  1S72 I;  1QHG A;  2DQR A;  2D1V A;  5LGT A;  4ZDL A;  2DJN A;  2KT0 A;  4L5J A;  4B47 A;  4M9X A;  3A0B C;  3D5R C;  1D1C A;  3K7A J;  3JTG A;  2F48 A;  2MLK A;  4WCG A;  2FA5 A;  2ZC2 A;  2ZXJ A;  3V8K A;  4M9Z A;  2KRF A;  3BLY A;  3HOY J;  3S3O A;  2K85 A;  3RPU A;  1HW5 A;  4G9Y A;  2MC4 A;  1D0Z A;  5D5U B;  1XPX A;  3S2H J;  2X85 A;  2DMN A;  3A0H C;  4I98 B;  4AIK A;  1BI2 A;  2KZV A;  2XB0 X;  3CJN A;  2XF5 A;  1P4A A;  4DBQ A;  3IRQ A;  1W5C C;  1I1G A;  2DPU A;  2NAZ A;  3QOP A;  1XMX A;  1PUE E;  2EFP A;  3EUH C;  5GPA A;  4KDP A;  2VQH A;  2KJC A;  4QSH A;  2XIG A;  1K4S A;  1MMG A;  5FKK A;  3CCY A;  1G59 A;  3ABL H;  5L3C A;  3N4M A;  1NK2 P;  2V4J C;  1ON1 A;  4A0Y A;  4RGU A;  3I64 A;  5FB2 A;  3QWL A;  3AKZ A;  3A4C A;  2LBF A;  4V2G A;  4CZZ A;  1IJW C;  1U78 A;  4L9J A;  2RRE A;  3TOB A;  4HQE A;  2XF7 A;  1P4W A;  4XID A;  3BQZ A;  5HDK A;  5KK1 A;  3M8J A;  5HOO A;  1V5G A;  3WOD F;  1K83 J;  2O7O A;  2Z33 A;  3DLA A;  2M30 A;  5E1X A;  2DA1 A;  3RDI A;  2EJR A;  3I54 A;  2X6O A;  2FE3 A;  4KIT B;  3TBI A;  5BNG A;  5JHU A;  3ULQ B;  5EEA A;  4G94 A;  4IHT A;  4DW6 A;  3GTP J;  3DBR B;  1RUN A;  1ON2 A;  4OMZ A;  4EJV A;  2IPQ X;  5EZG A;  4XKB A;  2FBK A;  4U88 A;  1T39 A;  1R5H A;  2YR2 A;  3K4M A;  4EJO A;  3H5N A;  2QBY B;  1WJD A;  4Z6Y A;  1HKS A;  3PIO F;  3RYP A;  1TQP A;  3GTL J;  3F22 A;  3MZH A;  4L5E A;  5HNF A;  3R61 A;  3BTC A;  1RC9 A;  2XAG A;  1ENH A;  1R7J A;  3H5R A;  2WB1 A;  2H1L A;  3MZ8 A;  3SJM A;  1R6R A;  4N0B A;  4LG3 A;  5ICG A;  5L3G A;  2P6T A;  4PJN A;  3HSE A;  5BQT A;  3VOE A;  2IP2 A;  2DA3 A;  3PNT A;  3HRM A;  3FK6 A;  1V54 H;  2NOG A;  2CU7 A;  2IGO A;  1SAN A;  2ID3 A;  4BQO A;  1SD6 A;  4ZH4 F;  1OKR A;  5EGO A;  3OV8 A;  2JQ7 A;  3ZMU A;  3MAJ A;  3IL2 A;  1HSJ A;  2DQL A;  5CJ9 A;  4XRF A;  1U5T B;  4B1R A;  4OIQ F;  4EMS A;  3BP8 A;  2K86 A;  2PI0 A;  4WF2 A;  1AKH A;  2R7U A;  2JSC A;  3OL3 A;  2E60 A;  2VIX A;  4JP0 A;  2A07 F;  2RN7 A;  4FE4 A;  2YX7 A;  4XLP F;  4Y17 A;  5GP9 A;  1TQI A;  2MH2 A;  4I6Z A;  5ILS A;  3HTS B;  2HOA A;  1B6A A;  4B3A A;  4LB6 B;  4A0X A;  2BYV E;  2OCC H;  4PJL A;  4BBR J;  2GQQ A;  2CJJ A;  1ETQ A;  3L00 A;  4X6A J;  4FHT A;  1V55 H;  2PG4 A;  4LLN A;  3H36 A;  3HPG A;  4A3C J;  1HDP A;  3TDZ C;  1KU3 A;  4J00 A;  2KRC A;  2XDV A;  1TL8 A;  1X4P A;  3OS1 A;  5J1R A;  2IS6 A;  1FBU A;  1FMW A;  2CW0 F;  3I9V 2;  4MHG A;  3S1Q J;  4I0B A;  1A6Q A;  3JRA A;  2M8G X;  3ABU A;  1O3R A;  2OF7 A;  1D1B A;  3F0C A;  1JE8 A;  4DOZ A;  4PJ0 C;  3FXU A;  2K7L A;  3PFY A;  2O6G E;  3IAM 2;  1FOW A;  2MG4 A;  3E6D A;  2X1C A;  3C7J A;  1FZP B;  5J4V A;  3K0L A;  1Y0U A;  4F52 A;  1Z77 A;  4ABZ A;  2FNP A;  3PQK A;  3V7S A;  1HOM A;  2X6X A;  2E35 A;  2Y0S N;  5AIP A;  2HR3 A;  4KA4 A;  2IA1 A;  5DUK A;  5HVQ C;  1ZAO A;  5J6X A;  4XRS A;  4IOC F;  1YOV B;  4JK1 X;  5DM7 F;  3MFK A;  3QPL A;  2XAJ A;  1EV7 A;  3V7R A;  1K78 B;  3CDH A;  3G3Z A;  4ASN A;  1GXQ A;  3L2W A;  1JT0 A;  4ZC3 A;  2IEK A;  2G7U A;  3BCB A;  3L7W A;  1X2N A;  4LLG F;  3JRG A;  2BHY A;  3MCZ A;  1X3U A;  1ERD A;  3WTV C;  5IYD J;  1W7P D;  2DMT A;  2HYJ A;  2VKH A;  1JGS A;  4LIT A;  3HOX J;  2MC3 A;  4V2F A;  4E6K G;  3C2B A;  1XG1 A;  4XK4 A;  1YRN B;  4A3G J;  1KU9 A;  3VYR B;  2EIJ H;  1QVU A;  1TLH B;  2K3P A;  1F43 A;  5F6F A;  2Y48 A;  1MNM C;  5HOD A;  4RB3 C;  4WXD A;  3TOA A;  1ZR2 A;  4O3M A;  4L5I A;  3OOU A;  3BR5 A;  5CQE A;  3CCM I;  1IO2 A;  4LOC A;  4L18 B;  1ETV A;  4M6Y A;  1B9M A;  1V5E A;  1GLN A;  3OYL A;  1D0Y A;  1V4R A;  4YII A;  1JTX A;  2M9H A;  3SYT A;  4YIR X;  3GTQ J;  2M1B A;  4ENJ A;  3CUO A;  3E3V A;  4EV0 A;  3EPZ A;  5JHF A;  2V7F A;  4L9T A;  4UHT A;  3HG9 A;  2P7C B;  1I3Q J;  1OYY A;  3BT9 A;  2L4A A;  5HLH A;  2DTR A;  3JW4 A;  2HVQ A;  4FE7 A;  1ETK A;  3TDU C;  2R7Z J;  4AYB N;  4OAZ A;  4N4N B;  1B72 B;  2IS4 A;  4XIC A;  1E3H A;  2H27 A;  3SFZ A;  1R23 A;  1UFM A;  5HNH A;  3ZRG A;  2DJI A;  1Y56 A;  4A69 C;  3S2D J;  4Q4Z F;  5GTI C;  5BS6 A;  3A2K A;  1YW7 A;  1MW7 A;  2PJP A;  2COM A;  3DLL F;  1W5T A;  3LFU A;  1ZN2 A;  2AXL A;  4YEL A;  1XN7 A;  3BR0 A;  5F0F A;  3HKZ A;  2DLL A;  1FX7 A;  2L4M A;  3OYA A;  3I0T A;  1Y39 A;  3HL2 A;  2DOA A;  3WG7 H;  2EFN A;  4P96 A;  2CUZ A;  1JKQ C;  5IOY A;  4KYW A;  3QPT A;  1MKM A;  4NBQ A;  2JN6 A;  1Y6I A;  1ODD A;  3CP2 A;  1WVR A;  3PQJ A;  1ZKG A;  2IBD A;  1QGP A;  3HRS A;  4D0P A;  3Q9S A;  1H9T A;  4G12 A;  5CKT A;  4DYQ A;  3W3C A;  2HTJ A;  3LFK A;  3HJE A;  5K7Z A;  1TT5 B;  2QM3 A;  3LA7 A;  5E3L A;  4HF1 A;  3X2Q H;  3WTS C;  3WTY C;  5B1A H;  1REP C;  5JI6 A;  1LE8 A;  2CYY A;  2TCT A;  3L2U A;  4EM0 B;  1Y1W J;  1MMN A;  4C30 A;  4XSZ F;  4NNJ A;  1USS A;  2XRL A;  1L0O C;  1Y8R B;  3BZC A;  5CYV A;  4PFP A;  3W6K B;  4RB1 A;  3CME I;  1P7I A;  2WV0 A;  3SEQ A;  1VI0 A;  2R7T A;  2JMW A;  4AUX A;  5BMZ A;  2Y2Z A;  4E7K A;  1B8I A;  4LG0 B;  4XL9 A;  1D8K A;  1LDK B;  3CD6 I;  4HW0 A;  1HLV A;  2FOW A;  3ISP A;  5JVG F;  2CV2 A;  3WGG A;  2R7D A;  2QWW A;  4W97 A;  3OYG A;  1R1U A;  1X3W B;  4I2O A;  5ILV A;  1T0F A;  2ZKZ A;  1IRZ A;  2LF7 A;  5EZH A;  2YSR A;  3H0G J;  3TW7 A;  1VQ6 I;  4RLF A;  1VF9 A;  1U0J A;  1RPW A;  2MW8 A;  3DQV C;  3KZZ A;  1XTA A;  2HOS A;  2M2E A;  2WAE A;  4HV5 A;  1FYL A;  2LKX A;  2O61 A;  1IN8 A;  4M3G A;  3V7C A;  1TT0 A;  2CQK A;  1FNN A;  2P8T A;  1JHF A;  2PMZ A;  2R3S A;  2JUC A;  3J80 Z;  2Z9O A;  1WWX A;  3IWF A;  1WH5 A;  2B0L A;  3JRI A;  4S0H B;  2RGV A;  2OD5 A;  3M07 A;  1VZ0 A;  3GEZ A;  3E1S A;  4KN4 X;  5LEK A;  2CMP A;  3O6B B;  1VQ5 I;  3U2R A;  5EEG A;  2R0Q C;  2L0K A;  3BCA A;  2HI3 A;  3FIW A;  3HIF A;  3KFW X;  1EJ9 A;  3I59 B;  3H3Z A;  1YFH A;  2A05 A;  1LEB A;  1ETY A;  3LSJ A;  4BNC A;  1B4A A;  3GF2 A;  4ZYH A;  3JRF A;  5GAE J;  4CYC B;  4K2E A;  2WY8 Q;  5BPI A;  2ACJ A;  3ZQG A;  2VE9 A;  1LQ1 A;  3TL4 X;  4F55 A;  4Y33 A;  3G1M A;  1IAW A;  2PEX A;  2QLZ A;  2DAO A;  2YU9 J;  3ZOB A;  1V3F A;  3SDG A;  4YG2 F;  4CUG A;  2PJR B;  2CFO A;  4AU7 A;  1Z3X A;  2VQL A;  2CQX A;  4UV9 A;  3OS0 A;  1FOX A;  2DOE A;  4KJZ A;  2HYG D;  1M1E B;  1ETX A;  2OUM A;  2COB A;  4GGG A;  4MFD A;  1KZH A;  3VWB A;  3P9C A;  3S15 J;  3I4N J;  1FPQ A;  3O8H A;  2NNN A;  1P4X A;  2WAQ N;  4YFK F;  5K7F A;  2XV4 S;  4MEX F;  1GDT A;  4DYR A;  4GYG A;  2VOD A;  2XSJ C;  3DBL B;  4MLO A;  4RS8 A;  5ICC A;  4S05 A;  2MD5 A;  2VBW A;  4RM3 A;  4NQW A;  1SFU A;  3LSP A;  5IYC J;  3CCR I;  2M34 A;  3FMR A;  1S8N A;  5E3N A;  1J5Y A;  2L01 A;  3A01 A;  4JYK A;  3ZQI A;  5B3S H;  2P0W A;  3DPL C;  1A5J A;  1PUF B;  2O3F A;  3RTR A;  2VBX A;  3D5S C;  4BEH B;  1UAA A;  4ZZL A;  1TWH J;  4EQQ A;  3FXO A;  2LG4 A;  2V79 A;  4X1E A;  2MSY A;  2IAI A;  4OIN F;  3JSO A;  1Z9C A;  5F08 A;  1XCV A;  3LSR A;  3OMY A;  3WTT C;  4LFU A;  2Y9Y A;  5FLV A;  1IF1 A;  5D4R A;  3T1B A;  1WRJ A;  1MD0 A;  5FO5 A;  5KHD A;  3OYK A;  5J1Y A;  2QYO A;  4BJ6 C;  1J0R A;  3W6J B;  2NVX J;  3FM3 A;  3DEW A;  5LRS A;  3FKI J;  2VB6 A;  1FOK A;  3IH4 A;  3IH3 A;  4S04 A;  3OYJ A;  2X6Y A;  2FQ3 A;  2Q2E B;  2W00 A;  2L7K A;  1W5S A;  4ZDO A;  4U7D A;  1I3A A;  4UUS B;  4BXX J;  5JLX A;  4IRG A;  2DFE A;  1YTY A;  1IN4 A;  3K4N A;  2LRD A;  3D0S A;  2OAZ A;  5D5V B;  1YIT I;  2ID6 A;  4II3 A;  1KU7 A;  4KNY A;  2L9R A;  2PBI A;  3S3M A;  1A6I A;  2RDP A;  1P9Q C;  5IP9 J;  3DKW A;  2HVS A;  3WTW C;  2GOM A;  2FBH A;  2JPB A;  2GIZ A;  2M87 A;  5CVU A;  1D8J A;  1XGO A;  5GAH J;  1MJB A;  4GXO A;  2ZJP F;  1ZGW A;  1BW6 A;  1UMQ A;  3CUQ B;  1XSV A;  2W1O A;  1GUU A;  3PUF A;  2UV1 A;  4HQM A;  3PM1 A;  3NWT A;  5FFX A;  3OYH A;  1OLT A;  2C6Y A;  4PZJ A;  1R4M B;  4M73 A;  3FXQ A;  1W36 C;  2OTL I;  4M3B A;  2E36 A;  3BC8 A;  1A36 A;  5E3M A;  5LBQ A;  1MBK A;  2DOD A;  1MJA A;  2BXZ A;  4ESJ A;  1WJA A;  4LB5 A;  4XON A;  4RDU A;  2GLO A;  2GXA A;  1U3E M;  2VI6 A;  2ZME B;  4B43 A;  1J2X A;  2ELH A;  2F5E A;  2R4G A;  2P7V B;  3QOE A;  4X0G A;  4HF0 A;  4N4O B;  4FIS A;  3TP3 A;  1BR4 A;  1T0F C;  3ZN1 A;  2X1E A;  2HVR A;  1X4O A;  4OU0 A;  2YPR A;  3MKZ A;  2LC2 A;  5L3B A;  4FX4 A;  2DT6 A;  5H6R A;  3GZ6 A;  4BHC A;  2F4O B;  5DD4 A;  3LQR A;  1SVO A;  2Q8K A;  3TQN A;  1U6G A;  1UJ8 A;  5EDN A;  1HXD A;  5GAD J;  2Z3Y A;  4ENM A;  2A5W A;  3ZQL A;  2L02 A;  3FMS A;  3I55 I;  1QZZ A;  3P9I A;  3GTG J;  5M3M J;  2G0E A;  1X1D A;  2GA2 A;  1OCT C;  1TNT A;  3DKY A;  2BY1 A;  1LPQ A;  2CUE A;  2XGE A;  4FQG A;  4XN3 A;  2FBI A;  2P5V A;  2FOK A;  3FBI B;  3ONQ A;  3TED A;  3C1D A;  3FWE A;  3Q0V A;  4NC6 A;  4IHW A;  2ESN A;  2HS5 A;  5F0C A;  2XPV A;  3F8B A;  4XLN F;  1IUF A;  5D8K B;  1JJ6 C;  4CSW A;  2OQG A;  3NRV A;  1UST A;  2VC1 A;  1GVJ A;  5FD6 A;  3JAM K;  3GTK J;  5J3L A;  2IGN A;  2HDC A;  2JRM A;  1QU3 A;  3QPS A;  3GFM A;  1V5F A;  3A1Y A;  4MIM A;  2XGX A;  4IXA A;  4BGD A;  2R5Z B;  1H88 C;  2L3D A;  2ZXW H;  3V8J A;  1FY7 A;  3BPV A;  1MH4 A;  1OR7 A;  1RRJ A;  4C3H J;  4M74 A;  1BR1 A;  4B44 A;  1IC8 A;  3WU0 A;  2LK2 A;  1IV6 A;  1TBX A;  1H8A C;  2H1K A;  4AIJ A;  1CF7 A;  3K70 D;  2GZW A;  4XLA A;  1BL0 A;  1X3Z B;  1DU0 A;  2DA2 A;  1OIS A;  1I39 A;  3RSN A;  5D4S A;  3H92 A;  3SXY A;  1XS9 A;  4ENN A;  3AG1 H;  3R0J A;  4MEY F;  2A6T A;  1Z67 A;  3CMA I;  2BY2 A;  1IXR C;  1JKP C;  2IS1 A;  1DP7 P;  3CCV I;  4IHV A;  4BHB A;  2F5C A;  3ESW B;  2DW4 A;  1HF0 A;  2CS3 A;  2FD5 A;  1Z7L A;  1QVT A;  2HXO A;  2DXI A;  3BJO A;  1FSE A;  2K40 A;  2RQP A;  2KHM A;  2EPF A;  3S16 J;  3ABT A;  1P7J A;  5B66 C;  1E3O C;  1WJC A;  1POG A;  1BA5 A;  2K4J A;  3K69 A;  4RGX A;  3CO6 C;  1ACI A;  1R5I D;  2WC2 A;  1LJ9 A;  3WU2 C;  5K5Q A;  2GXB A;  3RI4 A;  2E71 A;  5FRM A;  1ZAR A;  2M8E A;  2OC6 A;  5J47 A;  3KET A;  5ILU A;  2L9V A;  2V6E A;  3MN2 A;  1YS6 A;  1HST A;  4G6D A;  2EK5 A;  1JKR C;  1WSU A;  3R60 A;  3ZMT A;  5FKM A;  3C3W A;  3OL4 A;  1ZEL A;  4XLF A;  2M45 A;  1Y0N A;  2Z99 A;  3M4O J;  2V9V A;  1OFC X;  2M7A A;  3F6V A;  4F7Z A;  3ZQQ A;  2MH9 A;  4HF2 A;  4BL0 B;  3PO3 J;  1VND A;  2PX9 A;  2KDO A;  3LOC A;  2LDU A;  1APL C;  1ONV A;  4UY8 I;  3ZXS A;  2WY7 Q;  2ZXH A;  4OOI A;  3RKW A;  4RA2 A;  3GTJ J;  4A3M J;  2KMU A;  2P4W A;  1MH3 A;  3ZMV A;  4BKX A;  5IT9 K;  1S3J A;  2MD0 A;  1BN5 A;  2ZB9 A;  2ELK A;  3FXK A;  1JI8 A;  2ZJ2 A;  3NEU A;  3WE2 A;  2V1N A;  4KFC A;  2DPD A;  2IS2 A;  4WWC A;  3DEE A;  2JRT A;  3JCU C;  2HKX A;  4A6E A;  3I71 A;  3WG9 A;  3ERM A;  4Q47 A;  1Z7U A;  1C0W A;  3V42 A;  2IGK A;  2BEO A;  3KLN A;  5IP6 A;  1A31 A;  3HTU A;  3VOD A;  2PLY A;  4ZYA A;  2ME6 A;  3F6O A;  2BOL A;  1FTZ A;  4RAY A;  2DK8 A;  1TP4 A;  4C3J J;  1U8B A;  2J5P A;  1XDU A;  3RQ4 A;  1XSD A;  1EF4 A;  2Z1D A;  3ZR8 X;  1WKM A;  4DZP A;  2HXI A;  3HUG A;  3J7A Y;  3GBG A;  4A3B J;  4A5N A;  1SAX A;  4PUS A;  1IUY A;  4XN0 A;  3BRO A;  4L0Z B;  1BOA A;  4CCL A;  5FKL A;  2HWV A;  4Y52 J;  4R1H A;  2QA4 I;  2H8R A;  5E17 F;  4YFX F;  4BY7 J;  4B3X A;  5A2Q K;  2KIF A;  1HDD C;  3FDY A;  4I09 A;  3VB2 A;  1SVM A;  3K9T A;  1UCR A;  3SZP A;  3FHN A;  1WFX A;  3LAP A;  3F9K A;  2L7M P;  2F4M B;  2WTE A;  4HG2 A;  3ZQH A;  4Y13 A;  3GW2 A;  5EGO B;  4NC8 A;  1IV8 A;  3H0D A;  4GDF A;  2DYS H;  1TZL A;  3KP5 A;  2JVH A;  3FMQ A;  2NOJ B;  3D5L A;  2Y0M A;  2QBY A;  1ZRC A;  4L0Y B;  2KQR A;  4XRS G;  1U8R A;  4AIH A;  4QLC U;  1FP1 D;  2QEX I;  3RZO J;  1MND A;  4XSX F;  1JHH A;  2DMQ A;  3K4J A;  2R93 J;  4UB8 C;  3IUO A;  4XOR A;  2M3A A;  1GV5 A;  2D2W A;  4PJM A;  1E0E A;  1XC5 A;  3KYD B;  5FKN A;  2EBI A;  4BJ5 C;  2EQR A;  3GZ5 A;  5JVT A;  2HQR A;  1OCR H;  3OYB A;  2JSP A;  3CO7 C;  2DCE A;  4RGS A;  3E6B A;  4GCV A;  2VJI A;  4BHP A;  2CW8 A;  2VL8 A;  1VQN I;  3ASN H;  3K4B A;  4NC7 A;  3P9K A;  1W0T A;  1KA8 A;  3HYI A;  3L09 A;  3LA3 A;  3PIP F;  2VXD A;  3HOS A;  3TW6 A;  2NXN B;  4E7I A;  3BTI A;  1FYM A;  1X1C A;  5GPC A;  5LRR A;  2Y69 H;  3BG9 A;  4IPA A;  1NTC A;  1U2W A;  3KP4 A;  4PK4 A;  1J59 A;  1DQU A;  1QQI A;  3KEO A;  2FEZ A;  3PJR A;  1VQP I;  2VPL A;  2LH9 A;  2BHZ A;  2D45 A;  3OSG A;  1R4N B;  2Y0S A;  4BU2 A;  1VQL I;  1KQ9 A;  2J5O A;  3ECH A;  2NVY J;  3VYT B;  1R22 A;  5FD5 A;  1SFK A;  3V8L A;  4CGZ A;  4UXN A;  2R7F A;  1T56 A;  3H9J A;  1B1B A;  5AIQ A;  2UXN A;  3DTK A;  1MGT A;  3KIO A;  2DA6 A;  2W82 A;  3OWT A;  3R0A A;  3LNQ A;  4J19 A;  1UHW A;  3U9G A;  2NS7 A;  3EDP A;  1K79 A;  1B9N A;  4UV8 A;  1DPU A;  4XBF A;  1U9N A;  2O9L A;  2FF4 A;  5LFA A;  4A3K J;  4BH9 A;  2X9D A;  4ZYE A;  2JA5 J;  2E5Z A;  2KP6 A;  1HQC A;  1WHU A;  1Z1D A;  2VOO A;  2L54 A;  3VFZ A;  3LMM A;  4A3E J;  1WJE A;  1ZK8 A;  2EFQ A;  2LF8 A;  2LSO A;  4DQ2 A;  1WQ2 A;  2E1M B;  2DA5 A;  2HPI A;  3IAS 2;  1F4K A;  1MMD A;  5TRD A;  2CFX A;  5HS7 A;  3S1N J;  2FXA A;  2EZH A;  2V6C A;  5C44 J;  5DTD A;  2YX4 A;  4N9H A;  2VXZ A;  3T5X A;  1XDS A;  5F64 A;  4MTE A;  3H9Q A;  3B02 A;  2LLK A;  4D1Q A;  1G2H A;  4NB5 A;  3S1R J;  3LST A;  4HX8 A;  1SC7 A;  2IJL A;  3HB9 A;  4LMY A;  4CXF A;  3REO A;  2XRO A;  1MMA A;  4HPQ A;  4AD9 A;  3LSM A;  4Q48 A;  4XLC A;  2RNJ A;  2BV6 A;  5K5R A;  3E6C C;  2QF7 A;  2X6W A;  5M5Y J;  3W2V A;  5JLW A;  1J9I A;  2YUS A;  4RB2 C;  4PGH A;  4AYB A;  2W4S A;  3BZ6 A;  3OYF A;  1Y1V J;  5IOZ A;  3PNY A;  2IVM A;  4QPO A;  1SFO J;  3PFI A;  1YRN A;  3UNG C;  2K02 A;  1T33 A;  1LVK A;  2CW7 A;  3KZY A;  2KDZ A;  4A3D J;  2ECC A;  1E17 A;  2W7N A;  2LD5 A;  2DYR H;  1WJB A;  3J7Y J;  4B8X A;  2A6H F;  2TDX A;  2R7S A;  3G4S I;  1R5G A;  4TV7 A;  1YI2 I;  2B9S A;  4RM2 A;  2AQF A;  2NYX A;  1X1P A;  4NUB A;  2EV5 A;  4BYY A;  2IXS A;  1P92 A;  4RB0 A;  3S17 J;  3JR9 A;  3IHU A;  2FSW A;  1ZLK A;  5D6E A;  1WCM J;  4A0Z A;  4RGR A;  4D5F A;  1ORK A;  2M4G A;  3HEF A;  4WXH A;  2EA2 A;  2UUZ A;  3E0J B;  4WX9 A;  3J81 Z;  1X2M A;  2OZU A;  1S7O A;  1FYK A;  4E7Z A;  4GFB A;  3TGN A;  4B09 A;  3MD2 A;  1H89 C;  1D1A A;  3F21 A;  1B72 A;  3FHZ A;  1DDN A;  2HGC A;  1XMK A;  2IT0 A;  1MDM A;  3WTU C;  2YS9 A;  2O0Y A;  3T8T A;  2PQ8 A;  3VDX A;  1HW2 A;  4EGZ A;  3OSF A;  1MSF C;  3CP8 A;  3EUA A;  3Q3S A;  4RAG A;  2FRH A;  5EEH A;  2I10 A;  2X0L A;  1MJ9 A;  4O6J A;  1YQA A;  2XAS A;  3J7Z I;  2DT7 B;  5DCM B;  1UZC A;  1E3P A;  1T6S A;  1G3W A;  1T08 B;  5CVR A;  2A6E F;  1PVE A;  2AO9 A;  1ZG5 A;  1TWG J;  2HDW A;  2VT2 A;  3A03 A;  1GV2 A;  1MBF A;  2EV6 A;  3H3U A;  3HGG A;  1IRX A;  4MQ9 F;  3A02 A;  5EJC A;  5H20 A;  1UEL B;  5F27 A;  2R5Y B;  3M3Y J;  3CCJ I;  4GO1 A;  2NS8 A;  4HOB A;  1N25 A;  5D8L B;  2QQ8 A;  4IHX A;  1XGS A;  3FX3 A;  4KN7 X;  4BJT A;  4AC0 A;  1ZQ3 P;  1HC8 A;  4P1W A;  2VON A;  3B6A A;  1KQ0 A;  1XB4 A;  1O3Q A;  4IHY A;  2OZ6 A;  4D7N A;  4BE1 A;  3OR1 C;  2M5W A;  4ESB A;  2LFB A;  3RPU D;  5E8G A;  1OPC A;  2K5C A;  2PFB A;  2ZCW A;  3EUK L;  5D6F A;  4LG0 A;  1D5V A;  4DIQ A;  3CES A;  4CCJ A;  3OR2 C;  1IDY A;  4DZJ A;  3CCL I;  5KAI C;  5E1Z B;  3ERE D;  2WV1 A;  2XAU A;  4CCK A;  2XB5 A;  5EG0 B;  3OYE A;  2DT5 A;  3MKY B;  2TRT A;  5EYR A;  3JAM Z;  4XOT A;  4FT8 A;  1ZR4 A;  2HQ5 A;  2V9K A;  1SD5 A;  2OJE D;  3RYR A;  5C4X J;  1STZ A;  3EYI A;  1QNT A;  2ZFW A;  2Z2S B;  1LFB A;  4KIC A;  4KIB A;  2R7X A;  3BG6 A;  2WAQ A;  1RR7 A;  2UWM A;  4IVN A;  3BG3 A;  2KPM A;  2VKD A;  3H35 A;  2K9S A;  2EIK H;  3C18 A;  1P6R A;  5HLI A;  2VE8 A;  2PMZ N;  4HNV A;  3I59 A;  4DGW B;  3JRE A;  4U0V A;  4AID A;  1XGM A;  3DF8 A;  4RAZ A;  3QPH A;  3RKY A;  1G3Y A;  1T2K A;  1TWA J;  4JQF A;  2NVT J;  2XSD C;  1TC3 C;  2R92 J;  3KEQ A;  4YRV A;  2DMP A;  3HOV J;  4I99 C;  4HNU A;  1WPK A;  4ZYD A;  2PJR A;  2R7V A;  3GUD A;  4KT5 C;  3W2A A;  4RLQ A;  3F23 A;  4UVC A;  4IRH A;  3ZQ7 A;  3L9F A;  1O7L A;  2ZJQ F;  3FXR A;  1D5Y A;  3DPU A;  2E1O A;  3BZK A;  2EZK A;  5F1R A;  3J7A O;  1R49 A;  2V1U A;  2EV0 A;  3CJT B;  2L9S A;  2DMU A;  1YG2 A;  2JVG A;  2VJ5 A;  4LIV A;  3LSI A;  3S14 J;  1ULY A;  3ABK H;  3EYY A;  2Y31 A;  2P81 A;  1Z05 A;  2VBZ A;  3SEZ A;  1WJ5 A;  3ZMS A;  2W84 A;  4PSX A;  4WK8 F;  4XKV A;  2NNY A;  4OAY A;  2BY0 A;  3FIS A;  3G71 I;  3SFI A;  2RQQ A;  3HOZ J;  2JT1 A;  2BW3 A;  3GX4 X;  3LSK A;  3QYB A;  1TWC J;  1PUF A;  3H1C A;  1TTY A;  4BEH A;  2R7W A;  2R7O A;  1I6X A;  2AXT C;  3MKW B;  2XKP A;  9ANT A;  1Z6T A;  4CHU A;  1XSX A;  2A5Y B;  4HYE A;  3I53 A;  3L2R A;  1OYW A;  2VQC A;  1Z3Y A;  4XR6 A;  1K4T A;  1A04 A;  3F8M A;  2JPC A;  3SZG A;  2HPM A;  5DM6 F;  3BY6 A;  2XGD A;  2H8W A;  3Q0W A;  4M3E A;  1EH8 A;  1ZRD A;  4II2 A;  2LY1 A;  2HOE A;  5E20 A;  4M6V A;  1YJW I;  3VYS B;  3FXM A;  5B1B H;  3QYE A;  2KIQ A;  3QP6 A;  1MBG A;  1XCB A;  3EUH A;  2Q2E A;  3IRR A;  3VSK A;  3K6G A;  4UUS A;  4U87 A;  1UB9 A;  3DEU A;  1W1W E;  3RQI A;  3UR3 C;  4MNU A;  3HC7 A;  3CJQ B;  2JUG A;  2DA7 A;  4IQJ A;  2BVL A;  3E5U A;  1W7P A;  1WI3 A;  1MBJ A;  4NDL A;  1FTT A;  3TKY A;  3CTA A;  5CQG A;  2IA0 A;  4ENK A;  2XKO A;  4EEF G;  2D5V A;  2BE5 F;  1F1Z A;  2LYC A;  5J8F A;  5C4J J;  4G6Q A;  4HV6 A;  4PFO A;  1YX3 A;  2ELJ A;  5D5X B;  3CF5 F;  1RES A;  2ISY A;  1ZRF A;  1RR8 C;  1O3T A;  3CUQ A;  4FCY A;  4EM2 A;  1LB2 A;  2E2J J;  3WGH A;  4AVP A;  3CC4 I;  2E2I J;  1CGP A;  2HNH A;  4BQA A;  2FX0 A;  1MMS A;  3DPT A;  1SD7 A;  4FX0 A;  3FKJ A;  2FUG 2;  5DEQ A;  4IO9 F;  1VQ9 I;  4CO8 A;  3PSI A;  4JOM A;  3N97 A;  1QHH D;  5HDG A;  1G3T A;  4LLL A;  4YFN F;  2OQR A;  1QZY A;  1S6L A;  1NH3 A;  1ETO A;  3GME A;  4DBR A;  1OQY A;  2IW5 A;  4L9N A;  2Y75 A;  3BJA A;  3ZQF A;  2ZME A;  4HDV A;  5BPD A;  4Y15 A;  5EF6 A;  2EIL H;  1IXC A;  2MGQ A;  3JRH A;  4BBS J;  3TO6 A;  1MBE A;  2E1N A;  3H9G A;  4I01 A;  1VQK I;  3FBN B;  3QQA A;  1IN6 A;  2HZT A;  5F04 A;  2GIV A;  3M1E A;  1PDN C;  1VTN C;  2BVM A;  4HAM A;  4JX5 A;  4EM1 A;  3E7L A;  5C3E J;  4Q5S F;  1S9H A;  2GOX B;  5E79 C;  4HSR A;  3KE2 A;  2NRA C;  1S5L C;  2VKE A;  1H0M A;  1OJL A;  4LD5 A;  4BQQ A;  3DBH B;  1VFC A;  5E1W A;  3O8G A;  2NVU B;  4ITV A;  1TNS A;  4M9S A;  1XX5 A;  5KAF C;  3GWZ A;  4BE2 A;  1WZ2 A;  1I50 J;  3G1L A;  1UG2 A;  3RJP A;  4BXF A;  3F8F A;  1RI7 A;  2X51 A;  3LSH A;  5DV5 A;  5DDG A;  4R79 A;  1H9G A;  5L3E A;  2PN6 A;  3K4K A;  2A68 F;  2VT3 A;  1HBX G;  3C2H A;  1JTY A;  1K6Y A;  1BM9 A;  1W0U A;  3ZN0 A;  2LKP A;  3N05 A;  1XD7 A;  5IP7 J;  2STW A;  3M8E A;  2E34 A;  3RZD J;  4F91 B;  3LSG A;  2R5Z A;  1YE9 A;  3HOT A;  2JA8 J;  4ANJ A;  1HKQ A;  2KZG A;  5E18 F;  3OY9 A;  1BJA A;  2VC0 A;  1QBJ A;  2FJ1 A;  3DTI A;  1OCC H;  3HDD A;  5K7H A;  2X48 A;  3ABM H;  4Y7N J;  3K2Z A;  1FWZ A;  1HKT A;  1KON A;  3I5U A;  3PNV A;  4UUT A;  4A2U A;  4XLE A;  1Z6R A;  4M3F A;  4EVI A;  5F1J A;  5DUI A;  4IRI A;  1S7A A;  4QIW N;  1DPR A;  2VOP A;  4N9I A;  5LEJ A;  3T0Y A;  3AL0 C;  3H3V K;  4D9J A;  2DFF A;  2BY3 A;  5M5X J;  3ZMZ A;  3P5J A;  2HKO A;  4C2M J;  1X1A A;  2VUM J;  3HRU A;  5FLX K;  1SD4 A;  1MNE A;  2VQG A;  2AQE A;  1ZG1 A;  2LBF B;  2FML A;  1BIB A;  2E19 A;  1KQ8 A;  3IWZ A;  2OU2 A;  2LY9 A;  1AHD P;  1SEU A;  5BOX A;  1SFE A;  2R7R A;  1NG6 A;  2G9W A;  1FEX A;  3QAH A;  4XKW A;  5DYM A;  1I27 A;  2KIS A;  3AAF A;  2BGC A;  3K1N A;  3KZI C;  2CGP A;  3KP7 A;  1U9O A;  3AG3 H;  1AOY A;  4KMU X;  4ZYG A;  4A5M A;  3MVP A;  5GAG J;  2OCE A;  1W36 D;  2O03 A;  1LFU P;  3HOU J;  3MZY A;  4AWX B;  1ZGA A;  3VYU B;  1Y8Q B;  3HUG B;  2Q1Z B;  4I02 A;  4FTH A;  1MZB A;  2A3S A;  3TP0 A;  2P5K A;  3OS2 A;  1YW8 A;  2B7E A;  5CVJ A;  4UUV A;  3CDI A;  2DOF A;  2WBM A;  3CUQ C;  2KKO A;  5FLM J;  3MEX A;  5IY5 H;  1MIJ A;  3R6S A;  3DU5 A;  4E7J A;  1VQ4 I;  1OCP A;  3JRC A;  4QWQ A;  5FRO A;  3CCE I;  1FC3 A;  3QYF A;  2K3F A;  4ETS A;  5HDN A;  3OYC A;  1ZYR F;  2XHK A;  2MFZ A;  2UZK A;  1DGR M;  4Y4R A;  3E5Q A;  2M7B A;  5AON A;  5IYB J;  3PO2 J;  3GFI A;  5LHH A;  4HBL A;  2HZD A;  2ZME C;  4IQ4 A;  3FK7 A;  1TWF J;  1S7E A;  3AG4 H;  2L9N A;  2R7Q A;  4DNC A;  4KIS A;  1K61 A;  1SMY F;  4C3I J;  1KU2 A;  1RKW A;  2I5U A;  3GTM J;  2KRH A;  3NWS A;  4LGW A;  4XM3 A;  1VQ7 I;  2XAF A;  3SQN A;  4F3Q A;  3WTX C;  1K7A A;  1AKH B;  1OYI A;  3F72 A;  3UKG A;  1O3S A;  1SVL A;  1G3S A;  2EB7 A;  5ICE A;  3GFJ A;  5GTH C;  1DUX C;  1IGN A;  4C2U A;  1BW5 A;  3GXO A;  1YO5 C;  5H6Q A;  1MBH A;  1ZG3 A;  1QPM A;  2CWE A;  2W57 A;  3D1N I;  1N75 A;  3ZMD A;  2ISZ A;  1FBQ A;  1GVD A;  3B6C A;  1OR7 C;  5D5W B;  1X19 A;  3HM5 A;  3PL8 A;  4P5O A;  2V1X A;  3G1O A;  3KP6 A;  3R4K A;  2IA2 A;  2KIM A;  2CUJ A;  2WB1 N;  2K9Q A;  3H5A A;  3BR1 A;  3QU3 A;  2RV8 A;  3TO9 A;  3SHF A;  1YJN I;  2RKH A;  5FJ8 J;  1U5T A;  1Q1V A;  1BI3 A;  2YU3 A;  1JUS A;  2LOO A;  1KYW A;  3KLO A;  1FIP A;  1IXS B;  2FMY A;  2XVC A;  3WTZ A;  1F36 A;  4GYI A;  2CSO A;  3KYL A;  4ZDP A;  2QQB A;  4UB6 C;  2GWR A;  4KIG A;  5CVI A;  3KX2 A;  2A61 A;  3HGY A;  3BG5 A;  1YYV A;  3FM5 A;  1NK3 P;  2E1C A;  4G7Z F;  2ZSH B;  2CQ7 A;  2WAD A;  4IL6 C;  4I0A A;  4P9F A;  2EFW A;  2XC7 A;  3GO5 A;  4BQN A;  1P2F A;  2F4I A;  1D0X A;  1I1S A;  3CDL A;  1YIJ I;  1ZGJ A;  1WGX A;  2Y9Z A;  2Z16 A;  2QQA A;  2ESH A;  5DS9 A;  3G6E I;  4KMF A;  2HFH A;  4E7S A;  4H0E A;  4E70 A;  3JRB A;  3S3N A;  4IHS A;  2K4B A;  2AS5 F;  2VBY A;  2FNA A;  2CO5 A;  2CV0 A;  3LL7 A;  1RIO H;  1L3L A;  3HPH A;  2JA7 J;  1BI0 A;  3S32 A;  2QVO A;  3NAR A;  5K5O A;  2XPU A;  1PJR A;  1BR2 A;  2NVQ J;  3NAU A;  1LEA A;  3CZ6 A;  3KYC B;  1NG7 A;  2L7F P;  2OPT A;  1HA8 A;  2Y30 A;  1JXS A;  2ZNZ A;  1IDZ A;  3L2Q A;  3LQQ A;  1A35 A;  2HOT A;  3IP4 B;  1ZHF A;  5L3F A;  2HDD A;  3CC7 I;  1F9N A;  3BTL A;  4EJW A;  5FRN A;  3RKQ A;  4U0W A;  1BOB A;  2O5R A;  2QKM B;  3GVA A;  3KCC A;  4H4K C;  1I5Z A;  2XGC A;  5LHG A;  3F8C A;  3CMM A;  4BAY A;  2LMD A;  4A93 J;  2EIN H;  1SMT A;  2LP0 A;  1LNW A;  5J40 A;  1K78 A;  1BIA A;  2B63 J;  3TO7 A;  3TMO A;  2DDA A;  2Z5U A;  2VLA A;  3DU6 A;  3C2G A;  2NS0 A;  1ZH5 A;  2IRF G;  1RET A;  4M6X A;  2QCO A;  1DU6 A;  3KEY A;  1J75 A;  4WXC A;  4IX7 A;  2DBB A;  2W25 A;  1IN5 A;  4C2T A;  4B4C A;  4LJZ F;  1IN7 A;  3SDB A;  1AU7 A;  1GHC A;  2VAS A;  1BC8 C;  3SZT A;  2HQA A;  2RAE A;  4QPQ A;  4OIP F;  2QEN A;  1FT9 A;  5M5W J;  4BDY A;  2P6S A;  2DDB A;  4KUM A;  2CV1 A;  4HLY A;  4D7M A;  2ME0 A;  2QZ8 A;  5TJJ A;  4HRI A;  1IW7 F;  3FXL A;  4OIR F;  1EKE A;  1N78 A;  3K4C A;  5LHI A;  1IRF A;  2H09 A;  2XF6 A;  2MYS A;  3KP3 A;  2WAF A;  3T8R A;  3K4L A;  3MQ0 A;  4AM3 A;  2WWY A;  1YIO A;  2WA0 A;  3GCM A;  2ZNY A;  4RMN A;  3BOQ A;  1Z91 A;  3O3K A;  2ETH A;  4IOA F;  4I7H A;  2KL4 A;  5ERI A;  1SAU A;  3RIR A;  2V9P A;  4CCO A;  4BDZ A;  4J01 A;  3QRF F;  5CLS A;  3GTO J;  1LVA A;  3KP2 A;  1QA6 A; 
#chains in the Genus database with same CATH homology
 3Q0U A;  1AKH A;  1XS9 A;  3S14 J;  2Y31 A;  2P81 A;  4JP0 A;  2LVS A;  4FE4 A;  1LE8 B;  1JKP C;  3FIS A;  3HOZ J;  3SFI A;  5GP9 A;  1UHS A;  4IHV A;  1TWC J;  4I6Z A;  1PUF A;  1HF0 A;  2HOA A;  4B3A A;  2FD5 A;  4I76 A;  3WHC A;  4BBR J;  1QVT A;  1I6H J;  2HXO A;  2CJJ A;  1ETQ A;  4JX6 A;  4X6A J;  9ANT A;  1B8I B;  2K40 A;  4M3D A;  3S16 J;  2CQQ A;  1P7J A;  2N8G A;  1E3O C;  2GM4 A;  1JKO C;  1POG A;  1BA5 A;  4A3C J;  1HDP A;  3HKZ N;  2XGD A;  3Q0W A;  4M3E A;  2JJ7 A;  2E2H J;  5J1R A;  3IH2 A;  3S1Q J;  3MN2 A;  4M6V A;  3JRA A;  1JKR C;  2M8G X;  2OF7 A;  5FKM A;  1MBG A;  3F0C A;  3M4O J;  1OFC X;  1JUP A;  4UUS A;  2MG4 A;  4W1U A;  1WH7 A;  3RQI A;  3CMY A;  3PO3 J;  1VND A;  2DA7 A;  3LOC A;  1APL C;  1FJL A;  1JGG A;  1Z77 A;  1WI3 A;  4ABZ A;  1MBJ A;  4NDL A;  3GTJ J;  4A3M J;  1FTT A;  4A3L J;  1MH3 A;  4BKX A;  1HOM A;  3HOW J;  2Y0S N;  4EEF G;  2D5V A;  2ZB9 A;  2ELK A;  5C4J J;  1RES A;  3BR6 A;  4XRS A;  5IPA A;  4FCY A;  2E2J J;  3QPL A;  1QPI A;  2E2I J;  5J1U A;  3ZQC A;  2FX0 A;  3W6V A;  2R5Y A;  5IP6 A;  1JT0 A;  2IEK A;  2ME6 A;  1X2N A;  3JRG A;  1FTZ A;  1ETO A;  5IYD J;  4C3J J;  4IEJ A;  1U8B A;  2HYJ A;  2DMT A;  3ZQF A;  1EF4 A;  5EF6 A;  4DZP A;  3HOX J;  2HXI A;  4V2F A;  3C2B A;  1XG1 A;  4XK4 A;  1YRN B;  4A3G J;  2MGQ A;  3GBG A;  4A3B J;  3JRH A;  4BBS J;  2VKV A;  1MBE A;  1QVU A;  3QQA A;  1F43 A;  1MNM C;  5F04 A;  5HOD A;  5EG0 A;  5FKL A;  1ZR2 A;  4JX5 A;  5C3E J;  3E7L A;  4Y52 J;  3OOU A;  3HBL A;  3BR5 A;  2H8R A;  4CYC A;  3DCF A;  3MKL A;  3A01 B;  4BY7 J;  2VKE A;  2JK3 A;  1HDD C;  4LOC A;  1OJL A;  5E3O A;  1VFC A;  1ETV A;  3O8G A;  1JTX A;  2L7M P;  2M9H A;  3ZQH A;  3GTQ J;  3I4M J;  1X58 A;  5EGO B;  1I50 J;  3G1L A;  1UG2 A;  3BQY A;  4A3J J;  3BTJ A;  1I3Q J;  3BT9 A;  5M3F J;  2VPR A;  3IV5 A;  1Z0X A;  1JT6 A;  4FE7 A;  1ETK A;  2EH3 A;  2R7Z J;  4XRS G;  4AYB N;  2EZL A;  1B72 B;  1JTY A;  4DYC A;  2ECB A;  1W0U A;  4XIC A;  3RZO J;  2R93 J;  2DMQ A;  4A69 C;  2W48 A;  5IP7 J;  2XPW A;  3S2D J;  1GV5 A;  1XC5 A;  5FKN A;  2EBI A;  2EQR A;  3VPR A;  3RZD J;  3LSG A;  2R5Z A;  3BR0 A;  5F0F A;  2JA6 J;  3S1M J;  2JA8 J;  3BR2 A;  1JKQ C;  5IOY A;  1W0T A;  2JN6 A;  2FJ1 A;  3HDD A;  5K7H A;  1ZKG A;  3TW6 A;  2IBD A;  2X48 A;  4Y7N J;  3BTI A;  5GPC A;  4G12 A;  4DYQ A;  4MO7 A;  2LTP A;  4UUT A;  3BG9 A;  3BR3 A;  5K7Z A;  2JWT A;  5F1J A;  4M3F A;  5E3L A;  1NTC A;  2FQ4 A;  1LE8 A;  2TCT A;  4QIW N;  1Y1W J;  3OSG A;  2DTZ A;  1RKT A;  2CRG A;  3CQZ J;  3K2A A;  2XRL A;  2AHQ A;  2NVY J;  3H3V K;  1P7I A;  1VI0 A;  5M5X J;  2JMW A;  4AUX A;  4C2M J;  2VUM J;  1T56 A;  2Y2Z A;  1B8I A;  1MSE C;  1FIA A;  3JRD A;  1HLV A;  2DA6 A;  3LNQ A;  4J19 A;  5FKO A;  2E19 A;  2NS7 A;  3L1P A;  2LY9 A;  1GT0 C;  4W97 A;  1U9N A;  2O9L A;  1AHD P;  4A3K J;  5EZH A;  3TW7 A;  1IRZ A;  3H0G J;  2X9D A;  2JA5 J;  2GBY A;  1VF9 A;  1RPW A;  2MW8 A;  2HOS A;  1FEX A;  2M2E A;  4JX4 A;  4A3E J;  2LKX A;  1ZK8 A;  3OIO A;  1U9O A;  4M3G A;  2DA5 A;  3MVP A;  2CUF A;  3S1N J;  1LFU P;  3HOU J;  1WH5 A;  2EZH A;  4BY1 J;  3JRI A;  4S0H B;  5C44 J;  5DTD A;  4FTH A;  3TP0 A;  2DN0 A;  2R0Q C;  2L0K A;  4A3F J;  2HI3 A;  3FIW A;  1O4X A;  2LLK A;  1ETY A;  3LSJ A;  1G2H A;  3S1R J;  1ZTR A;  5FLM J;  3JRF A;  4CYC B;  3HB9 A;  3ZQG A;  4MFE A;  1OCP A;  3JRC A;  3G1M A;  2YU9 J;  3ZOB A;  3SDG A;  1JJ8 C;  1BJZ A;  1ETW A;  5F0H A;  2EZI A;  5IYB J;  2QF7 A;  5JLW A;  5M5Y J;  3PO2 J;  2YUS A;  2CQX A;  3FK7 A;  1TWF J;  1S7E A;  1Y1V J;  1ETX A;  4MFD A;  2COB A;  5IOZ A;  3S15 J;  1K61 A;  4C3I J;  3O8H A;  3I4N J;  2O8K A;  1SFO J;  1RKW A;  1YRN A;  3GTM J;  1T33 A;  2WAQ N;  4D5C A;  5K7F A;  1GDT A;  2M0C A;  2KDZ A;  4A3D J;  1JUM A;  2ECC A;  4DYR A;  1AKH B;  2LD5 A;  1QRY A;  4MLO A;  1ITY A;  3LSP A;  2K9N A;  5IYC J;  3UKG A;  2M34 A;  2L7Z A;  1IG7 A;  1IGN A;  1BW5 A;  5E3N A;  3A01 A;  4JYK A;  3ZQI A;  1HCR A;  1MBH A;  3D1N I;  2LR8 A;  1A5J A;  1PUF B;  3S17 J;  3JR9 A;  1GVD A;  1TWH J;  4X1E A;  3B6C A;  4QTR A;  1WCM J;  2MSY A;  2IAI A;  3HM5 A;  4D5F A;  3G1O A;  1R9T J;  5F08 A;  1ORK A;  3LSR A;  3HEF A;  2Y9Y A;  2WB1 N;  2K9Q A;  5FLV A;  3WHB A;  1CQT A;  4A3I J;  3BR1 A;  1X2M A;  5J1Y A;  4RBO A;  2DA4 A;  2NVX J;  4GFB A;  4XRM A;  5FJ8 J;  3DEW A;  1H89 C;  2DJN A;  1Q1V A;  1B72 A;  2KT0 A;  1JUS A;  3FKI J;  1FIP A;  2YS9 A;  3IH4 A;  3IH3 A;  1F36 A;  3OSF A;  1MSF C;  3Q3S A;  4UUS B;  4BXX J;  3K7A J;  5JLX A;  3HGY A;  3BG5 A;  2I10 A;  2ID6 A;  1NK3 P;  2L9R A;  1A6I A;  3HOY J;  5IP9 J;  3S2H J;  2DMN A;  2XB0 X;  3CDL A;  2AO9 A;  1TWG J;  1WGX A;  1GV2 A;  1MBF A;  3A03 A;  3HGG A;  2Y9Z A;  1BW6 A;  1UMQ A;  1ZGW A;  5DS9 A;  1GUU A;  3A02 A;  3PM1 A;  3JRB A;  5F27 A;  5GPA A;  2R5Y B;  3M3Y J;  4QSH A;  2NS8 A;  4M3B A;  5E3M A;  5FKK A;  1MBK A;  2JA7 J;  4IHX A;  3CCY A;  4AC0 A;  1ZQ3 P;  3NAR A;  3B6A A;  2XPU A;  4IHY A;  2NVQ J;  3NAU A;  4D7N A;  1NK2 P;  4RDU A;  2GLO A;  2LFB A;  2L7F P;  2OPT A;  2VI6 A;  2Y30 A;  1IDZ A;  1IJW C;  4V2G A;  2HOT A;  4DZJ A;  1IDY A;  1U78 A;  4FIS A;  3TP3 A;  2WV1 A;  2HDD A;  3BTL A;  4XID A;  3BQZ A;  2XB5 A;  5EG0 B;  3RKQ A;  1K83 J;  2O7O A;  2TRT A;  5EYR A;  2XGC A;  1ZR4 A;  2HQ5 A;  2DA1 A;  5C4X J;  4A93 J;  5EDN A;  2X6O A;  2LP0 A;  1LFB A;  2B63 J;  3ZQL A;  5BNG A;  3GTG J;  1RR7 A;  5M3M J;  5EEA A;  2G0E A;  4DW6 A;  3GTP J;  3BG3 A;  1OCT C;  2CUE A;  2XGE A;  1RET A;  2K9S A;  2QCO A;  1DU6 A;  3TED A;  5EZG A;  3Q0V A;  4IHW A;  2PMZ N;  4B4C A;  4HNV A;  1AU7 A;  3JRE A;  5F0C A;  2XPV A;  2RAE A;  3GTL J;  1IUF A;  5M5W J;  1JJ6 C;  4L5E A;  1TWA J;  2NVT J;  3BTC A;  2XSD C;  4D7M A;  1TC3 C;  2R92 J;  1ENH A;  2ME0 A;  3GTK J;  2DMP A;  5J3L A;  3HOV J;  3SJM A;  1WPK A;  3QPS A;  4MIM A;  2R5Z B;  1H88 C;  2DA3 A;  1MH4 A;  3FK6 A;  4C3H J;  1IC8 A;  2NOG A;  2CU7 A;  1SAN A;  2ID3 A;  2LK2 A;  1IV6 A;  5EGO A;  1D5Y A;  2E1O A;  1H8A C;  2EZK A;  2H1K A;  1BL0 A;  1DU0 A;  3GTO J;  2DA2 A;  4B1R A;  2DMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...