2YU9J

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yu9J00
4XRSA 1IJWC 1RETA 1IDYA 3IH3A 4M3EA 1IG7A 4A3DJ 2ECCA 1RPWA 2HQ5A 2QF7A 3HB9A 1HDPA 3G1LA 2EH3A 1WH5A 5FKLA 3PO2J 2L7FP 2B63J 1NK3P 2RAEA 5GPCA 3HOZJ 4J19A 2AHQA 4W97A 2G0EA 2YUSA 3K2AA 2FX0A 1ORKA 2JMWA 1Y1WJ 3I4MJ 3GTLJ 2NOGA 1BL0A 2GLOA 3M3YJ 2GBYA 3GTMJ 2DJNA 1T56A 2XGCA 3LNQA 5C44J 1O4XA 1AKHA 2CJJA 2PMZN 3SFIA 1IUFA 1X2NA 1ZTRA 3RZDJ 4JX4A 4JX5A 4IEJA 2HDDA 3ZQCA 4B4CA 4A69C 4C3IJ 1QRYA 4XK4A 1MSEC 2EZLA 2L7ZA 1FIPA 3L1PA 5EZGA 2LY9A 5M5YJ 4BY7J 3BQZA 5F0FA 5E3MA 3GBGA 3DEWA 5E3OA 4CYCB 3S1NJ 2MGQA 5FKNA 2NVQJ 3GTQJ 3HOUJ 3VPRA 1WI3A 3OIOA 2EBIA 2HOAA 5IYBJ 2R5YB 2MSYA 2E2IJ 4C3HJ 2Y0SN 1ENHA 1IDZA 3G1MA 5IOZA 4JX6A 5M5WJ 1QVTA 2XB5A 3A01A 3BT9A 2P81A 2CRGA 3JRAA 2KDZA 5M3MJ 3BG3A 1MH4A 3ZOBA 2R5ZB 3S16J 3FIWA 5HODA 2W48A 5EGOB 3HKZN 1AKHB 2DMUA 1SFOJ 5IYCJ 2CQQA 4RDUA 2COBA 4C3JJ 3C2BA 1ZKGA 1X58A 2X9DA 3OSFA 1NTCA 1Z77A 1K83J 1BW6A 3MKLA 5JLWA 3GTGJ 1E3OC 1ZGWA 3JREA 1A6IA 5J1RA 2IAIA 1Y1VJ 2LVSA 3JRHA 1W0TA 3S2DJ 3BR6A 1P7IA 3QPSA 3S15J 3A02A 4QSHA 4AYBN 4BBRJ 1JKRC 3BTCA 2LLKA 3HOWJ 1ETKA 2XRLA 3BR1A 5EZHA 1WH7A 4XIDA 1G2HA 4MIMA 5E3NA 4I6ZA 1ETQA 4A3IJ 1AHDP 2Y9YA 3RQIA 1U9OA 2E1OA 4DYCA 1QPIA 1ITYA 1BW5A 1FEXA 3DCFA 1MBKA 3HOVJ 3A01B 4A3BJ 4XRSG 2HI3A 2N8GA 2O8KA 2NS7A 2WAQN 2FQ4A 1ETXA 4QTRA 1T33A 3OSGA 1HF0A 2XGEA 3JRGA 4A3KJ 4B1RA 2DMTA 1ETOA 4CYCA 2OF7A 4A3MJ 5FKOA 2DA3A 2R5YA 3CMYA 4HNVA 1JJ6C 4DYQA 4RBOA 4AUXA 1XC5A 5FKKA 2WV1A 5C3EJ 3PO3J 3GTKJ 1POGA 3BR5A 2ME6A 3GTPJ 1HLVA 1BA5A 2K9SA 2CUEA 2L7MP 3F0CA 3JRDA 2GM4A 5K7FA 3HEFA 1ETYA 4JYKA 5IP9J 2HXOA 4MO7A 2R5ZA 1JUMA 4A93J 1WGXA 5EGOA 3H3VK 1JKQC 4DZJA 4ABZA 5F04A 2HOSA 1JUSA 1JUPA 1TWHJ 2I10A 3HM5A 1CQTA 4L5EA 2XPUA 2ECBA 1GVDA 5FJ8J 1NK2P 5IOYA 2DA6A 5GP9A 1MNMC 3BR2A 4M3BA 3IV5A 2M2EA 2XGDA 4V2GA 2R93J 3Q3SA 3QPLA 2CUFA 5C4JJ 2FJ1A 3A03A 3FKIJ 1A5JA 3ZQLA 1JTYA 2JJ7A 1ETWA 3BR3A 2JA7J 3BR0A 1K61A 3NARA 4M3DA 3TP3A 4MFEA 1YRNA 2DMPA 4M3FA 2LK2A 3IH2A 2LFBA 2O7OA 4QIWN 1VNDA 5EDNA 3S1QJ 2ID6A 3JRIA 1D5YA 1RR7A 3I4NJ 2AO9A 3MVPA 5EG0A 4X6AJ 3LSJA 3HOYJ 2H1KA 1MBHA 3BQYA 4XICA 1OCTC 4GFBA 1TWAJ 3FISA 2JWTA 3FK6A 1UMQA 4AC0A 5F08A 5FKMA 1JTXA 4IHXA 2JA5J 2VKVA 1F43A 1B72A 2DN0A 3JRCA 5EF6A 4UUSA 3ZQFA 4A3JJ 3B6AA 2M0CA 5DTDA 1IGNA 1MBEA 2M9HA 2ZB9A 4BKXA 3Q0UA 1ZK8A 5F0CA 3CDLA 1Z0XA 3S2HJ 1MH3A 4FE4A 2DMQA 4M3GA 4XRMA 2LD5A 1GDTA 4BXXJ 1GV5A 1ZR2A 3LSRA 1ZQ3P 1P7JA 3BG5A 1JGGA 3LSPA 1HDDC 1YRNB 3D1NI 1TWCJ 1B8IA 5EYRA 1JT6A 2E2JJ 2H8RA 4A3CJ 4Y52J 3ZQHA 3S14J 1OJLA 2DA5A 5M3FJ 3OOUA 1JKOC 2E2HJ 5FLVA 4D5CA 5J3LA 1ETVA 2L0KA 2DMNA 1H8AC 3B6CA 5F1JA 5EG0B 4M6VA 3HDDA 3Q0VA 5J1YA 3TW6A 4A3LJ 1RESA 4D7MA 1U78A 9ANTA 3SDGA 4BBSJ 2DA1A 4G12A 1B72B 2XPVA 4EEFG 4D7NA 5K7HA 2LP0A 1JT0A 2R92J 4UUSB 1ZR4A 3S1RJ 2K40A 2M34A 2CU7A 5EEAA 4A3EJ 4DW6A 3TEDA 4NDLA 3QQAA 1FJLA 3HGYA 5GPAA 4A3FJ 2X48A 2IEKA 2K9QA 2L9RA 2JA8J 2OPTA 1SANA 2LKXA 3LSGA 2E19A 1AU7A 1UG2A 1LFBA 4A3GJ 2FD5A 2YS9A 1B8IB 2K9NA 4C2MJ 1DU6A 3PM1A 4X1EA 3IH4A 3WHCA 5F27A 1UHSA 1MBFA 1I6HJ 1TWFJ 1IC8A 2M8GX 4Y7NJ 2O9LA 2ID3A 4I76A 4IHWA 1EF4A 1RKTA 1FTZA 5C4XJ 4FCYA 2HYJA 3TP0A 1R9TJ 3ZQIA 3WHBA 1QVUA 2QCOA 4BY1J 1APLC 2XB0X 1DU0A 1FTTA 2D5VA 1MBGA 3M4OJ 3K7AJ 2YU9J 3O8GA 1VF9A 2DTZA 2MG4A 2JN6A 2DA4A 4IHVA 2R7ZJ 2Y2ZA 4S0HB 3HGGA 3S1MJ 1X2MA 2EZIA 1S7EA 2VI6A 4MFDA 1HCRA 2TCTA 2R0QC 5DS9A 1TWGJ 5K7ZA 1BJZA 1MSFC 1WPKA 3CQZJ 3ZQGA 1LFUP 1JKPC 2XPWA 4DZPA 1PUFA 4D5FA 2LR8A 5IP6A 2HOTA 5IPAA 1GUUA 1IV6A 1HOMA 3BG9A 4LOCA 5M5XJ 3BTLA 3E7LA 3CCYA 3O8HA 2VKEA 1VFCA 1I3QJ 4FE7A 5J1UA 1IRZA 1MBJA 4IHYA 2Y30A 3S17J 3MN2A 3W6VA 3GTJJ 1JJ8C 1I50J 1XS9A 4W1UA 2ELKA 5IYDJ 1FIAA 1LE8A 3JR9A 1H89C 3JRBA 1H88C 4FTHA 2MW8A 2NVYJ 3HBLA 1OFCX 2X6OA 3JRFA 2NS8A 1WCMJ 1Q1VA 2JK3A 4DYRA 2VUMJ 4B3AA 3H0GJ 2TRTA 4UUTA 2HXIA 3Q0WA 2EQRA 3RZOJ 1RKWA 2JA6J 2KT0A 1F36A 1XG1A 1U9NA 3NAUA 1GT0C 5E3LA 2NVXJ 2LTPA 2Y9ZA 3HOXJ 2EZKA 2VPRA 2IBDA 5BNGA 5F0HA 3FK7A 4FISA 3SJMA 1U8BA 1PUFB 2EZHA 2XSDC 1GV2A 3BTIA 2ME0A 3GTOJ 4V2FA 5FLMJ 5JLXA 1W0UA 3UKGA 3G1OA 2DA2A 1TC3C 5IP7J 2Y31A 2WB1N 4MLOA 4JP0A 3RKQA 1VI0A 1LE8B 3BTJA 3TW7A 2NVTJ 2CQXA 1OCPA 2DA7A 3LOCA
chains in the Genus database with same CATH superfamily
1R71A 1IDYA 4LB6B 2P4WA 4M3EA 4XKCA 1R36A 1T95A 2ECCA 1RPWA 4OIQF 1JE8A 4U87A 3WTTC 5J8FA 2FEZA 4YFXF 1N25A 3CCLI 4LGWA 1SFEA 5IT9Z 2L7FP 1IO2A 1NK3P 2KRFA 2RAEA 4I02A 5GPCA 2PMHA 2NYXA 5FFXA 4AYBA 3E3VA 4P96A 2AHQA 1JXSA 5F6FA 2YUSA 4V19K 2JPCA 1FZPB 3CC7I 4HOBA 2VB6A 4E7IA 1PJRA 2NOGA 5AONA 2W7NA 3O3KA 2JUCA 2RC4A 3LSKA 3K0LA 4A0ZA 2DJNA 2VBZA 2OQRA 3HOSA 1V4RA 3W3CA 3GLXA 2PMZN 3SFIA 1IW7F 1ZTRA 2F2EA 4JX4A 3RZDJ 3HTSB 5TJJA 2XROA 2M8EA 5EEHA 4A69C 2ACJA 2EZLA 4LIUA 1FIPA 4Z2YA 3HHGA 3RJPA 4UHTA 3U2RA 3FM3A 5B1AH 1BR2A 3OL4A 2JRTA 5M5YJ 5K5OA 2NAZA 5F0FA 3KLOA 2R4GA 2EJRA 1R1UA 3COAC 5E3OA 1HSTA 3S1NJ 2MBFA 3GTQJ 1BR1A 3VPRA 1WI3A 4HDUA 4KISA 3LSTA 3DF8A 4EJUA 2R7XA 3MWMA 3CCJI 3OYNA 5KAIC 2D45A 2XVCA 2HKXA 3G1MA 3ISPA 2R7VA 3EPZA 2XAJA 1X1CA 3CUOA 1UHMA 1CGPA 2DO7A 1X1DA 5FLXK 1UAAA 1VQNI 5D6EA 1OLTA 2CH0A 3ZOBA 4WXDA 3IKTA 3AFHA 2P5KA 3FIWA 3AAFA 2A5WA 5HODA 1FOWA 3CCQI 1DGWY 3LL7A 1AKHB 1SFOJ 1R1VA 2LF8A 3ZGKA 2QA4I 1G3TA 4GDFA 2CQQA 3ABMH 3OSFA 2X9DA 3HSRA 1Z77A 2G9WA 3GTGJ 3ASNH 3C2GA 1E3OC 1ZELA 4M71A 3JREA 4BJTA 4DIQA 3L2WA 3CMEI 1A6IA 4AVZA 2IAIA 1EKEA 2XASA 1KU9A 2LG4A 4A0XA 2R7WA 3QPSA 5HS8A 3A02A 4H4KC 2BV6A 3T1BA 4BBRJ 1HC8A 2YX4A 3BTCA 4BXFA 1R4MB 4RAZA 2CMPA 3IHUA 2K9MA 2L54A 3GZ6A 4L0YB 2LMDA 5E3NA 4H0EA 1EV7A 3CCRI 3K4MA 3VDXA 1AHDP 4J00A 2CQNA 1QPIA 1MBKA 4OIOF 2LBFB 3HHHA 3SDBA 5FRNA 3ERMA 3HOVJ 4HV5A 4A3BJ 4OAZA 2V1UA 4BHCA 2QBYB 4HX8A 2WAQN 3F8BA 2ZC2A 2XKOA 2FQ4A 3LA2A 3FXJA 3K1NA 1S29A 2QQ9A 4G94A 1I3AA 1IXRC 3RKWA 5ICCA 3W2VA 2RNGA 2OF7A 3ERED 5D4RA 4B43A 1BIBA 1IN6A 3QPTA 4WK8F 4HNVA 4L0ZB 3MEXA 5L3BA 1FT9A 2MC4A 4IVNA 4YFKF 4RBOA 1XC5A 4PSWA 1OQYA 2WV1A 4I98B 3R6SA 2A68F 3GTKJ 5FFZA 1POGA 3BR5A 3CJQB 3GTPJ 2MFZA 1HLVA 1BA5A 1S7AA 3JTHA 4II3A 3EETA 2P5VA 2L7MP 5JHUA 5LEJA 2QSFX 2NRAC 3ECOA 3P9CA 4JYKA 1R58A 3OV8A 4P9UA 1MNEA 3SZPA 4CCMA 4LITA 2PJRB 1WGXA 3QWLA 4WWCA 3H3VK 2MLKA 4CA0A 3IP4B 2F5EA 1H9TA 2ZNYA 1MJ9A 2DODA 2LY1A 2JVHA 1JUPA 2NXNB 5HLIA 2Q2EA 4YIRX 1CQTA 3M1CA 4XSXF 1OR7C 3DKXA 4J01A 1RIOH 1ERDA 1LVKA 2D2WA 2GZWA 5FJ8J 3DLAA 5IOYA 2DA6A 1NK2P 1BN5A 1YO5C 3D5RC 4EATA 2P7CB 1HA8A 1D0YA 1XCVA 2PEXA 4G7ZF 3QPLA 5ILSA 2YX7A 2X1CA 3DU6A 5C4JJ 3A03A 3OYFA 2EV6A 1MZBA 1ZAOA 1VQ4I 1A5JA 3ZQLA 1JTYA 2MC3A 1ETWA 3BR3A 3PQKA 3VYTB 3DTKA 2VC0A 4LK1F 3BZKA 1KQ0A 3ZN1A 4MFEA 2IVMA 3CUQC 1NH3A 4O3MA 5DUIA 4BQOA 2O7OA 1BI1A 5A2QZ 2MH9A 1VNDA 1VQMI 5TGTA 2W00A 3KEQA 3HRUA 3C1DA 2ID6A 3JRIA 4U88A 1YJ9I 2PBIA 1RR7A 3GVAA 4KT5C 3I4NJ 2EV5A 2OCCH 5EG0A 1SMYF 2WAFA 1IAWA 1BI0A 4FQGA 3BQYA 2IS1A 3ULQB 1TWAJ 3CF5F 4MGRA 3FK6A 1PVEA 4XORA 3RKXA 5F08A 4R1HA 5FKMA 1JTXA 1UELB 1GHCA 5HS7A 2QVOA 3QYFA 2W24A 2DN0A 3TBIA 2HPMA 3KYDB 4CZZA 3K4NA 2CV1A 4PJ0C 4MQVA 2EPFA 3N05A 4UUSA 4XR6A 3ZQFA 5DTDA 2GA2A 2ZB9A 4KITB 4AM3A 2LY2A 2E7WA 3EQLF 1EA3A 2IW5A 1CF7B 4IRIA 4XLAA 4XKVA 1Z0XA 1N77A 3DBHB 1Z9CA 3FZVA 3I53A 4FE4A 3ESWB 3V42A 2HZDA 3F23A 2FMLA 2MD0A 2IA0A 4KIBA 4P5OA 3WTSC 1PYVA 1YRNB 3D1NI 4Y52J 1LVAA 4A3CJ 1K4SA 4L9VA 2RGVA 1STZA 4U7BA 3K70C 5FLVA 4CZCA 2E2HJ 2VKHA 4FX0A 4BGDA 1W5SA 3CP2A 4HYEA 5J3LA 1VQ8I 4Y4RA 2DMNA 3F9KA 1KU7A 1S7OA 3T5XA 3HDDA 1IRXA 4EM1A 5J1YA 4B3XA 1FWZA 3TW6A 4A3LJ 3AL0B 1JHFA 2A6EF 4DBQA 2EIJH 4BBSJ 1B72B 1B4AA 4PJJA 3QYBA 4UVCA 4D7NA 1JT0A 2LP0A 4PDKA 3V8JA 1OKRA 3M07A 3S1RJ 1MMSA 2K40A 2CU7A 4A3EJ 4ZC3A 4PFPA 4DW6A 2K27A 5B1BH 2VXZA 3RKYA 2CFOA 2X48A 2L9RA 1OR7A 4RAFA 2DCEA 1GLNA 2FNAA 3BLYA 2OAZA 2LKXA 2XSJC 2H6BA 1HBXG 4BDYA 1UB9A 4M74A 1U2WA 2YS9A 1SD6A 1DU6A 2HYFA 3PM1A 4EM0B 1TTYA 4KMUX 3ZN0A 4IHSA 1I6HJ 3CUQA 3MZYA 2ZXJA 3I9V2 2LKSA 4LK0F 2KIUA 4UUVA 2CGPA 3FM5A 2HQRA 1SD5A 4FCYA 1W36C 2HYJA 1BOBA 3WHBA 2KL4A 1IXCA 2ETHA 5LHHA 3I0TA 3PL8A 2OCEA 1FBUA 4A12A 3PFIA 1CF7A 2LSOA 5BS6A 2D5VA 4EGYA 3H9JA 3FMRA 4CCOA 2VE8A 2DTZA 4C30A 1IN7A 2MG4A 2KIMA 3FHZA 1TT5B 1G3SA 2JN6A 3CDIA 1KU3A 1G3YA 4LMYA 2HZTA 2FE3A 3DLLF 1XD7A 1UZCA 2DOFA 3R0AA 4LG0A 3HL2A 5L3GA 2BZTA 2R0QC 3ZMTA 1KQ9A 5DD4A 4XBFA 3MAJA 5K7ZA 4LLNA 3HG9A 3WODF 2L9SA 3KEOA 3ZQGA 1LFUP 2A3SA 3CD6I 5KVRA 3E6BA 2YU3A 3CMMA 2F5VA 2E5ZA 3E7LA 3K4KA 4O5VA 1QA6A 4FE7A 5J1UA 1MBJA 1ZG3A 1K6OA 3MN2A 3W6VA 2H27A 2ELKA 1FIAA 4WXHA 2DK5A 1LKXA 4BU2A 5FD6A 4G6QA 4M9XA 1OFCX 5E20A 5LHIA 1HW1A 4L9TA 4M9SA 4ZYHA 3JRFA 5BOXA 3SZTA 1Q1VA 1TNSA 1YX3A 1TW3A 4II2A 4DYRA 3SQNA 3CCEI 2NNNA 3QU6A 3DPTA 5E1XA 4KT6A 2DI3A 1Z05A 3RZOJ 1RKWA 3VSKA 4MHGA 3K2ZA 2JA6J 4EJWA 5D8KB 4QWQA 2UV1A 3FBIB 5EEGA 4XLFA 2Y9ZA 5JI6A 2OTJI 3HOXJ 2EZKA 2E71A 5BNGA 5F0HA 1PUFB 3FK7A 4HX4A 3GO5A 2ZO4A 4UY8I 1WJEA 2ME0A 2FA5A 5ED4A 2KP6A 3BCAA 5CLSA 2EFWA 4IZZA 2F4IA 3VOEA 3TO6A 1XGNA 4BL0B 4DOZA 1ZLKA 2OQGA 2WB1N 5J6XA 4BNCA 2ISZA 1ON1A 3BJOA 1P6RA 2DFEA 3F8NA 5FLXZ 4PGGA 1OCPA 5B66C 4A5MA 3CJNA 2E34A 1RETA 3WGHA 1TZLA 3BZCA 3IH3A 3ZMUA 1IG7A 2A05A 1L0OC 2H09A 1YTYA 2DJIA 2HQ5A 2QF7A 4WF2A 1S72I 3A4CA 3PIOF 2MYSA 1WH5A 5K1YA 3PO2J 4LG3A 2BW3A 4HQEA 3HOZJ 2OA4A 4W97A 3HRMA 2RKHA 3EYYA 3OMYA 2DFFA 2QUFA 3QP5A 3F8FA 2FUG2 2KFDA 3NEUA 2JMWA 1A36A 3M8FA 4ZYAA 3M8EA 3KP5A 5ILVA 1GVJA 3PNVA 4I01A 2GLOA 3J81K 2GBYA 3AG4H 1O4XA 2EIMH 1I39A 1IUFA 2FF4A 2WAQA 3C2HA 1X2NA 4X0GA 4ENJA 2HDDA 4JX5A 1ZRDA 2OTLI 2K4JA 2K86A 4MNUA 4Y17A 1LJ9A 5K5QA 4RB3C 4C3IJ 1T2KA 3A0HC 2P7VB 4XK4A 3A0BC 1MSEC 4HRIA 1VTNC 3ZR8X 2DQRA 1T08B 4HPQA 2QSHX 1KGSA 2R3SA 5E3MA 1MMGA 3CLQA 1DP3A 2MGQA 3HSFA 5FKNA 2NVQJ 2I8DA 2EBIA 1MNDA 3DEUA 5B5EC 3K70D 5CVRA 5JHFA 4ASNA 4RMNA 2EB7A 2ZXIA 4P9FA 5HDNA 3BY6A 2Y0SN 4ZYDA 3T8RA 5IOZA 5M5WJ 1TT0A 4A6EA 3Q5FA 3A01A 3BT9A 2P81A 3DKWA 3JRAA 4RB1A 1U8RA 3BG3A 1RNLA 1DPUA 1JGSA 3M9AA 5TISC 2W48A 1V5EA 5EGOB 5HDGA 4OIRF 2DMUA 5K5RA 3Q9VA 1W1WE 4MEYF 2X85A 3ZQQA 5IYCJ 1SD4A 2COBA 2DOAA 1FX7A 3C2BA 1ZKGA 2IGNA 3K6GA 2IT0A 1X1AA 3G73A 3LAJA 3AG1H 1BW6A 5DM7F 2QZ8A 2GXAA 1RUOA 4OMYA 1N75A 2DT6A 1AWCA 1Y1VJ 3VWBA 3JRHA 2QM3A 3J80K 2BYVE 2HYGD 2V7FA 1P7IA 3DXJF 1E3HA 4FT8A 4QSHA 2Y69H 4M6YA 2EA2A 2EFOA 4XLNF 1J59A 1LDKB 2M5WA 1G8XA 2LLKA 1ETKA 3V8KA 2VODA 1R23A 1WH7A 3S93A 1G2HA 1B59A 2M4GA 2Z1DA 4MIMA 4CO8A 1ETQA 4CSWA 1TLHB 1U9OA 3OL3A 1O7LA 3JSOA 2PX9A 4DYCA 1ITYA 1BW5A 2JQ7A 1I1SA 2O8XA 3DCFA 2XF5A 1W36D 2EFQA 4N0BA 3TMOA 4XRSG 1VQ5I 2KKOA 2GXGA 2K5CA 3WU0A 2O8KA 2VKDA 3TQNA 2FNPA 2NS7A 2CQKA 2GXBA 4OWRB 1B1BA 3RI4A 3GW2A 3E6CC 2QQ8A 2IXSA 1ETXA 3LSIA 1KYZA 2P8TA 2M30A 3HPGA 1HF0A 2ELJA 2DBBA 2CV2A 4D1QA 2IS4A 2VJJA 2OJED 4BQAA 1HKSA 1BJAA 5DYMA 1UCRA 1WWXA 3K1PA 1D0XA 3MCZA 1M1EB 1JJ6C 4DYQA 4D0PA 5FKKA 5C3EJ 4IJAA 3F6VA 3JCUC 2CUEA 2ELHA 1TQPA 2KLOA 3S2WA 1SVOA 3HEFA 1WJCA 3AKZA 1P4AA 5IP9J 2FBIA 1MGTA 1DUXC 1JUMA 1J75A 4Q48A 5EGOA 2QQBA 1IN4A 5LGNA 1JKQC 2B0LA 4RGXA 5ICFA 4DZJA 4ABZA 1DGRM 3A2KA 5F04A 1Y0UA 1OCOH 3PNTA 2HOSA 1OCZH 1GXQA 1JUSA 2CS3A 3E5UA 3U1DA 3F8MA 4L5EA 2ECBA 4ZZDA 3ZRGA 2IRFG 1FPQA 4F93B 5HOOA 3HYIA 5J40A 4XKWA 4EMSA 3HUGA 1XGSA 2R93J 3JTGA 2DFIA 1FSEA 2CUFA 2LNBA 2FJ1A 1REPC 2Z99A 3H5AA 1MMDA 3CDHA 4QPOA 3RCOA 3H3UA 3TP3A 1GXPA 2DTRA 3P5JA 2FQ3A 3IH2A 3L00A 1VQKI 2Z9OA 4UV9A 3S32A 3V8LA 5EDNA 3FXOA 3F3XA 4IOCF 2DW4A 2K7LA 2VASA 3MZ8A 1FP2A 4F92B 3ZPLA 1PP8F 3DU5A 4XN3A 2H1KA 4ZDPA 1Z6RA 4N9HA 4IL6C 3RYRA 1OCTC 4GFBA 3FISA 2JWTA 2M1BA 1UMQA 2DFHA 2JSPA 2OBPA 2E7XA 1ZRCA 1C0WA 2VKVA 1S8NA 2VLAA 2Q2EB 2XHKA 3JRCA 1R5HA 3JSPA 2XKPA 3VODA 1KU2A 2M9HA 4CCLA 2O3FA 3OS0A 4G9YA 2Q8KA 1XSVA 3JW4A 3B73A 5CQEA 3J7AY 2WY7Q 5F0CA 2QWWA 3IRRA 3CDLA 3QAHA 2CYYA 3S2HJ 1MJBA 2DT7B 4M73A 4C2TA 3LQQA 1YQAA 2LD5A 1D3YA 4G7OF 4HF2A 3CCSI 3RPUD 2VJ4A 3HC7A 3LSRA 2UZKA 3P7NA 2HEOA 3ONQA 1HDDC 1IRFA 2OZ6A 3EUKL 1B8IA 2L2OA 2ZBKA 1J0RA 2LF7A 2CSOA 1OJLA 3LSMA 3VYUB 2JZYA 2DA5A 1HW2A 4HF0A 2Z2SB 3OOUA 1JKOC 4EJVA 1QPMA 2QKMB 3E5XA 3B6CA 5EG0B 4M6VA 3P9IA 5GTHC 4Y33A 5HNHA 1T98A 5L3CA 1YW9A 1PDNC 4D7MA 4E7SA 3H9QA 2VE9A 4ANJA 2F4OB 5DD8A 3SDGA 2OZUA 4S05A 2DA1A 2L02A 1XGOA 4G12A 2XPVA 1ON2A 1RZ4A 3V4GA 4UUSB 1ZR4A 1TNTA 4AIDA 1MJAA 3BJ6A 3TEDA 4EQQA 4I2OA 3K4LA 3CJTB 3OYCA 1BOAA 5GPAA 2RNJA 2IEKA 3J7ZI 2JA8J 4DJAA 3OYEA 1QZEA 1SANA 4LJZF 1H0MA 5F64A 4XSZF 3O6BB 4BEHA 3M8JA 3ROUA 4RB2C 2GA1A 2EILH 2FD5A 2K9NA 4GO1A 4X1EA 3WHCA 1FY7A 1ONVA 3LWFA 2DAOA 1IC8A 5E8GA 2QSGX 3CC4I 4Y7NJ 4O6JA 1DP7P 4I76A 1G3WA 5BPIA 3OS1A 4G8XA 4Q5SF 4EVIA 4EGZA 4Q4ZF 2QCOA 2X6WA 1J09A 5E79C 2OC6A 5D5WB 3I5UA 1HQCA 4E7KA 2WB1A 4PFOA 2IGMA 2CUJA 1X1BA 3N97A 1MMNA 1O57A 2TDXA 1TP4A 2V26A 3K7AJ 3V7RA 2R7OA 4U7DA 1VF9A 3OOPA 4XN0A 1B9MA 1XCBA 2DA4A 2R7ZJ 2EWNA 2PMUA 1YLFA 1ZGJA 2L9NA 3HGGA 4AIHA 3S1MJ 2M0MA 1S7EA 2VI6A 4B09A 4KJZA 1WJFA 1FSHA 2L5QA 1TWGJ 4BAYA 3KCCA 1BJZA 1MSFC 1X3ZB 2K9LA 1Y39A 3MFKA 1B9NA 3CQZJ 2VIXA 3E97A 2OU2A 3CUQB 3HTUA 3BP8A 3L2RA 4CCKA 2LOOA 5IP6A 5J4YA 5IPAA 4C2UA 3LFUA 4YIIA 2YR2A 3BTLA 3WTWC 3VEPA 1XDUA 4NQWA 3DBRB 4KYWA 2J5PA 1Z67A 2VPLA 1AA7A 2Y30A 2BHYA 4CGZA 4I99C 4YG2F 1FMWA 3MKWB 1JJ8C 4W1UA 4Q47A 4RLQA 3WTZA 4OAYA 1LE8A 3J81Z 2HDCA 3JR9A 1W7PA 3JRBA 1H88C 2DPDA 3GYHX 2NVYJ 3HBLA 4RAGA 1J2XA 1QBJA 1WCMJ 1ZRFA 5HNFA 2YPRA 3D5SC 4LD5A 3T8TA 4E7JA 1OCRH 1YFHA 3E5QA 5FGMA 4B3AA 2O5RA 2TRTA 4UUTA 3SEQA 4LG0B 2HGCA 2JRMA 1XDSA 5L3EA 2HXIA 2ZMEA 4NHJA 2EQRA 3GFMA 3UR3C 2P5LC 1O7FA 2CV0A 3G71I 1F36A 1WJ5A 3FX3A 1X4PA 5HLTA 3WTYC 2A61A 3NAUA 3OYHA 4IQJA 2QYOA 1W5TA 3RTRA 2VQLA 3SZGA 5GADJ 1BC7C 3FXLA 5CVUA 1U8BA 3SJMA 2XSDC 3BTIA 5JFRA 2Y0SA 4U0WA 2FOKA 4ESFA 4HLXA 4HLYA 3UKGA 1W0UA 2VBXA 2DA2A 1TC3C 2GIVA 4XOPA 4PGHA 3F6OA 3NWTA 4JP0A 4HF1A 3PFYA 2NVTJ 4HAMA 2R7FA 5E1ZB 4FHTA 2AQFA 4GRIA 2DA7A 1U6GA 4IKFA 3LFKA 4BH9A 2X1EA 2QEXI 3HOTA 1RUNA 4UXNA 4RM2A 1SVLA 3GXOA 4PSXA 2HQNA 3HB9A 3G1LA 2ICWG 1KONA 1NHAA 2XGXA 2GWRA 1T38A 4CHUA 2W85A 4MEXF 1HKQA 1ZG1A 1J9IA 5FKLA 2CW7A 3ZCOA 4IPAA 2Y48A 2GOXB 5E1WA 5FROA 4ZJZA 4IO9F 2IPQX 4OMZA 3N4MA 3DBLB 3K2AA 3J80Z 3NQOA 5JR3A 2BXZA 1JI8A 1K79A 3IAS2 1TQMA 3I4MJ 2PLYA 3DKYA 4JK1X 3JAMK 2B9SA 3OS2A 2L4AA 1BL0A 1F1ZA 5CYVA 2LYCA 2JTVA 1T56A 2XGCA 5C44J 2JPBA 1QO0D 4AIJA 4HW0A 4BHBA 2L3DA 2FOWA 4IEJA 3ZQCA 1Y8RB 1Z7UA 3EUHA 6PAXA 1OCCH 5D5XB 2WBMA 4CH7A 3CJRB 2W84A 5KNLA 2H8WA 3R60A 4G6DA 3L1PA 1XMKA 5EZGA 1QZYA 1ZGAA 3ABTA 2DU9A 3HIFA 3BQZA 4HX7A 1XX5A 3WGIA 1F9NA 1Z1DA 4UVBA 3GBGA 4XLCA 3TGNA 3I64A 3OIOA 5CVIA 2BW3B 3HZJA 5IYBJ 2R5YB 3ASOH 1SAXA 2KRHA 1LB2A 1BI2A 2F4MB 3HPHA 5HS9A 1ZHFA 3W6JB 4KIGA 2E2IJ 1UG0A 3IWZA 2OD5A 4C3HJ 1YIJI 3H0DA 4HBLA 1P4WA 1QVTA 2O03A 3DFGA 3OIQA 2CRGA 3IRQA 4BQNA 3TKYA 2IP2A 5AIQA 3GFJA 2DDAA 2PMZA 2X6XA 2R5ZB 2AXTC 4EJTA 1EH6A 3ABLH 1SMTA 5LGTA 1U0JA 3R61A 2V4JC 4BHPA 2KZVA 5CPRB 4DBRA 4RDUA 1XB4A 2XAGA 4BJ6C 3FHNA 3C3WA 3F22A 4ZDOA 2QENA 1WJDA 1NTCA 2VT3A 3ZXSA 3MKLA 3C7JA 2A69F 1ZGWA 2VOOA 1K78A 2LVSA 3S2DJ 1D0ZA 2NNYA 1JKRC 1YJWI 4UVAA 3HOWJ 1YW8A 2XRLA 2K02A 3BR1A 4XIDA 5JVGF 1BC8C 1Z21A 1FLIA 3FMQA 4I6ZA 1VQOI 3ZMZA 2VOPA 3QPHA 2LRDA 1WZ2A 4CXFA 4RAYA 2E1OA 3HSEA 3L2VA 5AIPA 3RSNA 3I3LA 5BPDA 3A01B 4GYIA 2JVGA 2X51A 2E1MC 3LSHA 2ZXHA 2LREA 2HI3A 3MD2A 4XKBA 5DCMA 1KZHA 3I59A 3GF2A 2IA1A 3M1EA 4CDGA 1T33A 3OSGA 3FF5A 1S9HA 5D5VB 2E1MB 1FC3A 3JRGA 2EV0A 1WHUA 1V3FA 2Z16A 3U1KA 3AG3H 3G2BA 4F52A 5HDKA 3RQ4A 2DMTA 4HSRA 4B1RA 2LC2A 5FKOA 3CO6C 4KFCA 1WI9A 4PJLA 2R5YA 3CMYA 4BXUA 4HZFA 3BDDA 1I5ZA 1OPCA 2VT2A 1KYWA 5LLQA 2ZCWA 2ME6A 2K9SA 2P6TA 2WV0A 4E4HA 4RM3A 3S3OA 3LA3A 2KMUA 3H3ZA 2XRNA 4JOMA 4MO7A 2KJCA 2R5ZA 4A93J 3W2WA 5LGUA 2KZGA 3BPVA 3DPLC 1R5ID 1VQLI 3R0JA 2VL8A 4OINF 5JVTA 2M87A 4FX4A 3KEYA 2M45A 1R4NB 5LBQA 2XAUA 5H6RA 5HVQC 5IY5H 1GVDA 3H5RA 4HG2A 4MTDA 3J7YJ 2IS2A 1MNMC 1YYVA 3BR2A 3GZ5A 4M3BA 4XOTA 3GCMA 3IV5A 2V6EA 2DYSH 2LDUA 3Q3SA 3GFIA 2IA2A 1QHGA 1XPXA 2K3PA 1U3EM 1MDMA 1HXDA 4CUGA 2XIGA 4JBAA 2DK8A 1K61A 3NARA 4M3DA 3IL2A 3L09A 4B8XA 3A1YA 4NNJA 2XAFA 4M3FA 2A6HF 2LK2A 2O6GE 2LFBA 1HW5A 5LHGA 2E35A 2D1HA 3S1QJ 1D5YA 2AO9A 2NS0A 1LQ1A 4AD9A 4HNUA 2X6YA 2OV7A 2HVRA 4X6AJ 3LSJA 3HOYJ 1MBHA 1V5FA 1IXSB 4TV7A 3LQRA 4CYDA 5EJCA 5KHDA 1XGMA 4L5JA 4JQFA 4QLCU 4IX7A 4IHXA 2JA5J 1EJ9A 1O3RA 3QRFF 4A3JJ 1IN8A 1OYIA 3DQVC 1X1PA 4M72A 1MBEA 2UUZA 3NWSA 4BKXA 3EYIA 1VZ0A 3Q0UA 1P92A 1ZK8A 3HUGB 2MABA 2W25A 3EUAA 3OYBA 2KJBA 1VQ6I 1FP1D 1ACIA 1HKTA 2STTA 1Y56A 4DQ2A 4I0BA 1MH3A 2DMQA 1RI7A 2X0LA 3VFZA 3WTVC 1GDTA 2Z33A 4BXXJ 2QLZA 1GV5A 2KISA 1NG6A 3L2QA 4ENMA 1R49A 1ZQ3P 1JGGA 4GGGA 4XMYA 3LSPA 2H8RA 1MMAA 1TWCJ 5EYRA 4ENKA 3MZHA 2R7QA 1BM9A 4BJ5C 3ZQHA 1B6AA 2HKOA 2Z5UA 2A6TA 5M3FJ 2VJIA 4IOAF 1EH8A 1YJNI 2FU4A 4D5CA 2HS5A 1ETVA 3FXRA 1H8AC 2RV8A 3BC8A 2X1DA 1ULYA 2W82A 1FOKA 1K4TA 3Q0VA 1Z91A 1YIOA 3OYAA 1YX5A 5D5UB 1TW2A 3CCMI 1RESA 3ZQ7A 9ANTA 2VJ5A 2ESNA 2DYRH 4I7HA 4EEFG 1A6QA 1AOYA 3L9FA 1XMXA 4I0AA 2M34A 2PQ8A 1XTAA 2VQHA 2GIZA 1V54H 3OYDA 3U21A 4A2UA 5DCFA 1W4MA 3DV8A 2HQAA 2BGCA 2K9QA 2QKLB 2V79A 3GLLA 2OPTA 2P0WA 2DDBA 2Z3YA 1ZN2A 2XF6A 4HQMA 3SYTA 2PJPA 3KP4A 3OIPA 2UWMA 3LSGA 2E19A 1AU7A 1UG2A 1H9GA 2EFNA 2PG4A 1LFBA 4A3GJ 3J7AO 2MLGA 4G7HF 2ZKZA 1RR8C 1XN7A 1B8IB 3EDPA 1RC9A 4C2MJ 4BE2A 4A6DA 3M7GA 4BDZA 2JA2A 3WTUC 3FXMA 5F27A 1UHSA 1MBFA 3E6MA 1TWFJ 2ZJRF 2M8GX 3KZZA 4UNOA 2E60A 1DPRA 4IHWA 2BBYA 2W57A 1X3UA 4XRFA 3WE2A 1RKTA 2R7RA 3I56I 1S6LA 1XSXA 4C9YA 2WADA 1FTZA 4EM2A 2V9KA 3TP0A 3ZQIA 4ETSA 2DXIA 4R79A 1QVUA 2ZJPF 4NC7A 4BY1J 1Q1HA 1FTTA 1DU0A 4BQQA 3G3ZA 2FSWA 2RN7A 4ZH4F 2XAHA 5IT3A 1X19A 3LA7A 4CCNA 1L3LA 3GEZA 3M4OJ 3D0SA 5GAEJ 3W2AA 4PZJA 4NC8A 2YU9J 2ZSHB 4CICA 4YFNF 2FMYA 3KFWX 5DV5A 3H35A 3TDUC 2BEOA 4BE1A 3GMEA 1PP7U 4F7ZA 2DPUA 4BEHB 4AWXB 1Z7LA 1VQPI 4F3QA 1HCRA 2MD5A 1O3SA 1WFXA 3OYMA 2XC7A 2HOEA 5DS9A 4LLGF 1SAUA 1WPKA 2V1NA 1LFPA 1SFKA 2HU9A 1IN5A 1OISA 2GAUA 4DZPA 1D1AA 4D5FA 3P9KA 2XF7A 1ZREA 3H1CA 2KRCA 2HOTA 1GUUA 1IV6A 1SFUA 4YIFA 3BG9A 2F5FA 5M5XJ 3F21A 5H20A 2BY0A 1VFCA 3O8HA 2VKEA 2D1VA 1FYMA 1IRZA 2R7DA 3GZNB 2LH9A 2R7UA 2UXXA 3I55I 3RYPA 3JAMZ 5IYDJ 1TBXA 4IF4A 1K7AA 1TL8A 1G4DA 2MW8A 2O0YA 4E7HA 1LEAA 3L2UA 2HVSA 4ITVA 4RB0A 2JK3A 3QOEA 4KUMA 3WGGA 1BR4A 3FXUA 2VUMJ 3K9TA 4E6KG 3H0GJ 1JHHA 3DEEA 4WXCA 4BUPA 3BJAA 3F72A 3QODA 4I09A 3Q0WA 4A0YA 1T0FC 1LDDA 2FBKA 4ZZLA 3HRSA 1ZG5A 1U9NA 4ESJA 1RRJA 1D1CA 2WAEA 2NVXJ 2LTPA 2KQRA 4RA2A 1FBQA 2VPRA 1USSA 2IBDA 4FISA 2EZHA 3B02A 3GTOJ 1WVRA 2EA4A 1V5GA 4V2FA 5ILUA 5D4SA 1K6YA 3KPHA 4RGUA 1VQ9I 2K3FA 5J8CA 1D8KA 4NQWB 5IP7J 2IGOA 3TDZC 4MLOA 1LE8B 2JUGA 3TW7A 2CQXA 1T6SA 2ZMEC 1ZYRF 1W7PB 3ZP5A 2FXAA 3LOCA 4XRSA 1YE9A 1IJWC 4Y3OA 4A3DJ 1F4KA 3LMMA 4FASD 3DTEA 2X4HA 4BE0A 1HDPA 2VBWA 4L5IA 2EH3A 2H6CA 2IJLA 1ZARA 4AU7A 3GWZA 2W1OA 4UB6C 1EH7A 2ZFWA 2ZMEB 3CP8A 3FXQA 2B63J 4N9IA 3K1MA 4NC6A 5DEQA 3BPXA 3HXLA 3IUOA 4J19A 5LRSA 4XONA 2G0EA 2GOMA 4IRHA 2V1XA 4PCQA 2FX0A 2H94A 1Z6TA 1ORKA 3KE2A 1Y1WJ 1MW7A 1FNNA 3GTLJ 1SC7A 2F5DA 3M3YJ 3PNYA 3GTMJ 2CG4A 2W4SA 3LNQA 2V9VA 5FD5A 1YOVB 5F1RA 1AKHA 2CJJA 5CQGA 2BOLA 4P55A 2HTJA 1WRJA 4B4CA 3V7CA 3KETA 3S3NA 2ZXWH 1XSDA 2AS5F 3SFZA 1QRYA 3IAM2 4XLPF 3OR2C 3X2QH 5L3FA 2L7ZA 2E5NA 2L7KA 3E1SA 3ELKA 3K4JA 1FBSA 2WWYA 2LY9A 4QPQA 4D9JA 2KPMA 4BY7J 4IHTA 2E1NA 3H92A 3DEWA 1FMVA 4CYCB 3CZ6A 3KYCB 3HOUJ 2HOAA 1HSJA 5BQTA 1QQIA 4K2EA 2E1CA 4ZDLA 1J5YA 1G6NA 4B48A 2WY8Q 4RLFA 2MSYA 1T0FA 1LPQA 3FKJA 5FO5A 2OUMA 1ENHA 4Y13A 2XV4S 2DLLA 1IDZA 4JX6A 3EUHC 2HVQA 2LBFA 2XB5A 4IRGA 1YITI 2KDZA 5M3MJ 1Z3XA 1MH4A 3C18A 3S16J 4ON0A 4MTEA 2ADUA 2QBYA 3HKZN 3Q9SA 3TOBA 1G59A 4KA4A 4CCJA 3S8PA 2V1DA 4XM3A 1R00A 4C3JJ 3MMYB 5ERIA 1YS7A 3KP2A 3V7SA 4WCGA 2O61A 1X58A 5CVVA 3H36A 5IT9K 3F8CA 1K83J 5JLWA 1T8IA 5H6QA 5J1RA 3H9GA 4YEJA 1W0TA 3BR6A 3S15J 4AYBN 3CMAI 1A04A 3D5LA 1MIJA 1W5CC 2HFHA 3OR1C 1WQ2A 1YI2I 3WTXC 5EZHA 4U0YA 2XDVA 5LD2C 4PUSA 2EIKH 1NG7A 3CLOA 4A3IJ 4EJOA 3U9GA 3CCUI 4U0VA 2Y9YA 3RQIA 3AL0C 2P6SA 1ZH5A 1FEXA 3BROA 3PSIA 3PJRA 2PJRA 4PJNA 2COMA 3HJEA 2HR3A 5HLHA 1J7KA 4E70A 5CKTA 2EINH 2BY3A 2K85A 2L01A 1IV8A 2N8GA 4IXAA 4KN7X 3ABUA 3KZIC 3WU1B 4IQ4A 1P9QC 2AQEA 1FOYA 1KA8A 2BHZA 2HDWA 4G6TB 4QTRA 2DQLA 4YRVA 3RIRA 2XGEA 2J5OA 3BOQA 3RDIA 4A3KJ 4Y15A 1ETOA 3E6DA 4CYCA 4A3MJ 2DA3A 4MQ9F 3I71A 3PQJA 4ZYGA 4S04A 4ZYEA 1K78B 3ZMSA 3QYEA 5ICGA 5D8LB 3PUFA 4AUXA 4HSTA 2WA0A 5KAFC 3PO3J 2GQQA 2Q1ZB 1X3WB 3BG6A 3ML6A 4XL9A 3GUDA 1UHWA 2RVCA 1R22A 3DWLE 2ZFUA 2V9PA 4WX9A 3L7WA 3F0CA 1I6XA 3JRDA 2GM4A 1LDJA 3FBNB 1UFMA 5K7FA 1ETYA 2KHMA 2HXOA 3KLNA 4PJMA 2ZNZA 3GX4X 2Y75A 5HLGA 3VYSB 2I5UA 5KK1A 5ICEA 3OYJA 3CCVI 1FOXA 1TWHJ 2I10A 1BIAA 1QHHD 3HM5A 3WG7H 5DCMB 1PUEE 3VB2A 2CW0F 2XPUA 3SHFA 3I59B 3K4BA 5GP9A 1QGPA 1SVMA 2M2EA 3FXKA 5LFAA 2XGDA 4V2GA 2R7TA 1O3QA 2VBYA 4F55A 2V6CA 3KP7A 3FKIJ 2CWEA 3PSFA 4E7ZA 2ZJQF 4GCVA 2JJ7A 2JA7J 4UV8A 3BR0A 3TL4X 4KICA 4ENNA 4DGWB 3QOPA 4N4NB 3PIPF 1YRNA 2DMPA 4KIFA 3QU3A 4QIWN 3CTAA 1MD0A 2PFBA 2M7AA 1P4XA 3MVPA 1OYYA 4XQFA 1S3JA 1W7PD 4XICA 3CF2A 1IUYA 1IZ1A 4KN4X 4AC0A 3OWTA 2QQAA 3FWEA 3OYGA 4OOIA 1F43A 3KIOA 1B72A 3WG9A 2VQCA 1Y8QB 4XLEA 5EF6A 4EV0A 2G7HA 1F5TA 3B6AA 2M0CA 1IGNA 5E18F 3OY9A 3SXYA 5GAGJ 1R1TA 1Y0NA 1USTA 2Q0OA 5D6FA 3W6KB 2PN6A 3BZ6A 3IC7A 5KCMA 1VQ7I 2BVMA 5CJ9A 1QZZA 5LRRA 2MA3A 4M3GA 4XRMA 5TRDA 2A07F 4UB8C 3R4KA 4XLHA 1WJAA 1MDMB 1ZR2A 2C6YA 3PUBA 5E8IA 1P7JA 3S3MA 5B3SH 3BG5A 3H5NA 3TOAA 2KIQA 2F48A 3G4SI 1IRGA 2E2JJ 1JT6A 2BXYA 1D8JA 5CVJA 3S14J 2HPIA 2M3AA 3RPQA 2IS6A 1XMAA 3MKYB 3K10A 4M6XA 1SEUA 2L0KA 4HEA2 5F1JA 3OYLA 2CO5A 1LUJB 1UJ8A 4BYYA 2XAQA 5J47A 1SFXA 3CESA 1LNWA 3ZMVA 1U78A 2ZSIB 2L4MA 2ESHA 5L3DA 2VQGA 1KQ8A 2DOEA 5BMZA 3T0YA 4RGSA 5K7HA 2R92J 2XUBA 4NUBA 1SD7A 1Z3YA 3VSLA 1D1BA 5EEAA 1A31A 3DTIA 4NB5A 4NDLA 3NRVA 4M9ZA 3DPUA 3QQAA 3UNGC 2PI0A 2EK5A 1FJLA 2STWA 2RQQA 3HGYA 5J4VA 4A3FJ 3AG2H 3K69A 1Y6IA 4ZTJA 2CQ7A 5A2QK 2ISYA 1WKMA 1T39A 1QU3A 1D5VA 3MKZA 3G6EI 5LEKA 1ZLJA 1WSUA 3CO7C 1I27A 4LFUA 4NBQA 2EFPA 2Y0MA 3IH4A 4KMFA 3DP7A 2HNHA 2F5CA 1O3TA 2ZJ2A 4E7LA 2O9LA 4YELA 2AXLA 3O2PE 2ID3A 4HNTA 3IWFA 4BACA 1EF4A 2CUZA 3WU2C 2KIFA 1A35A 1YG2A 5C4XJ 1E17A 1U5TC 4L9NA 4ZTFA 1R9TJ 3I4PA 2K4BA 5H2FC 4AVPA 2HTSA 4L9JA 1APLC 2XB0X 4RGRA 2M7BA 1YS6A 2RDPA 5DM6F 4F91B 4L18B 1BI3A 2JT1A 3MQ0A 4ESBA 4LB5A 2KDOA 3KZYA 5DDGA 1MBGA 1P2FA 2E36A 5DUKA 1U5TB 4N4OB 2VN2A 3O8GA 3IKVA 3QP6A 1WJBA 2FBHA 3WE3A 4IHVA 2G7UA 3ABKH 1E2XA 2Y2ZA 4OU0A 4P1WA 3REOA 4S0HB 4Z6YA 1X2MA 2EZIA 2FRHA 2IGKA 1S5LC 3KP6A 4HA8A 4MFDA 4KDPA 2VC1A 2TCTA 3FMSA 1MKMA 2BE5F 2WTEA 3I54A 4GYGA 1JKPC 2XPWA 2H1LA 4B47A 1N78A 1PUFA 3TO7A 1R5GA 2LR8A 4KNYA 1HOMA 4LOCA 4PK4A 4B44A 3CCYA 1I3QJ 3BCBA 3L2CA 1BBYA 4HV6A 4IHYA 1E0EA 3S17J 3K4CA 3GTJJ 5GTIC 3LAPA 1I50J 1XS9A 4HDVA 2L9VA 3CC2I 1OMIA 4XNFA 3FDYA 3KX2A 1H89C 5GAHJ 1IF1A 2CFXA 4FTHA 4LLLA 2NOJB 2JSCA 1DDNA 2X6OA 2CW8A 2F6CA 4GXOA 2LKPA 2NS8A 3KYLA 5E17F 2YSRA 2QGUA 1FYLA 4R8HA 4AIKA 3HRTA 3OYIA 1V55H 2UXNA 1ODDA 3BG7A 2HWVA 3E0JB 4A5NA 2DT5A 2RQPA 1E3PA 2KT0A 4LIVA 4RS8A 2BY1A 1XG1A 2M4KA 2A5YB 3OYKA 1QNTA 1GT0C 1R6RA 5E3LA 4BS9A 3GFLA 3KP3A 1R7JA 2NVUB 3SEZA 2BY2A 1YW7A 2B7EA 5FB2A 1GV2A 2VONA 1I1GA 3RPUA 1X4OA 4FETA 5FLMJ 5FRMA 5JLXA 2VXDA 3ECHA 3I58A 1FYKA 3G1OA 3BWGA 3VYRB 1DQUA 2MH2A 2Y31A 1LEBA 1YHQI 3ZMDA 3RKQA 2R7SA 1TQIA 1U5TA 1VI0A 3BTJA 3HKZA 2BVLA 2WC2A 4DNCA 1OYWA 2RREA 3TO9A 4OIPF
chains in the Genus database with same CATH topology
4XRSA 1IJWC 1RETA 1IDYA 3IH3A 4M3EA 1IG7A 4A3DJ 2ECCA 1RPWA 2HQ5A 2QF7A 3HB9A 1HDPA 3G1LA 2EH3A 1WH5A 5FKLA 3PO2J 2L7FP 2B63J 1NK3P 2RAEA 5GPCA 3HOZJ 4J19A 2AHQA 4W97A 2G0EA 2YUSA 3K2AA 2FX0A 1ORKA 2JMWA 1Y1WJ 3I4MJ 3GTLJ 2NOGA 1BL0A 2GLOA 3M3YJ 2GBYA 3GTMJ 2DJNA 1T56A 2XGCA 3LNQA 5C44J 1O4XA 1AKHA 2CJJA 2PMZN 3SFIA 1IUFA 1X2NA 1ZTRA 3RZDJ 4JX4A 4JX5A 4IEJA 2HDDA 3ZQCA 4B4CA 4A69C 4C3IJ 1QRYA 4XK4A 1MSEC 2EZLA 2L7ZA 1FIPA 3L1PA 5EZGA 2LY9A 5M5YJ 4BY7J 3BQZA 5F0FA 5E3MA 3GBGA 3DEWA 5E3OA 4CYCB 3S1NJ 2MGQA 5FKNA 2NVQJ 3GTQJ 3HOUJ 3VPRA 1WI3A 3OIOA 2EBIA 2HOAA 5IYBJ 2R5YB 2MSYA 2E2IJ 4C3HJ 2Y0SN 1ENHA 1IDZA 3G1MA 5IOZA 4JX6A 5M5WJ 1QVTA 2XB5A 3A01A 3BT9A 2P81A 2CRGA 3JRAA 2KDZA 5M3MJ 3BG3A 1MH4A 3ZOBA 2R5ZB 3S16J 3FIWA 5HODA 2W48A 5EGOB 3HKZN 1AKHB 2DMUA 1SFOJ 5IYCJ 2CQQA 4RDUA 2COBA 4C3JJ 3C2BA 1ZKGA 1X58A 2X9DA 3OSFA 1NTCA 1Z77A 1K83J 1BW6A 3MKLA 5JLWA 3GTGJ 1E3OC 1ZGWA 3JREA 1A6IA 5J1RA 2IAIA 1Y1VJ 2LVSA 3JRHA 1W0TA 3S2DJ 3BR6A 1P7IA 3QPSA 3S15J 3A02A 4QSHA 4AYBN 4BBRJ 1JKRC 3BTCA 2LLKA 3HOWJ 1ETKA 2XRLA 3BR1A 5EZHA 1WH7A 4XIDA 1G2HA 4MIMA 5E3NA 4I6ZA 1ETQA 4A3IJ 1AHDP 2Y9YA 3RQIA 1U9OA 2E1OA 4DYCA 1QPIA 1ITYA 1BW5A 1FEXA 3DCFA 1MBKA 3HOVJ 3A01B 4A3BJ 4XRSG 2HI3A 2N8GA 2O8KA 2NS7A 2WAQN 2FQ4A 1ETXA 4QTRA 1T33A 3OSGA 1HF0A 2XGEA 3JRGA 4A3KJ 4B1RA 2DMTA 1ETOA 4CYCA 2OF7A 4A3MJ 5FKOA 2DA3A 2R5YA 3CMYA 4HNVA 1JJ6C 4DYQA 4RBOA 4AUXA 1XC5A 5FKKA 2WV1A 5C3EJ 3PO3J 3GTKJ 1POGA 3BR5A 2ME6A 3GTPJ 1HLVA 1BA5A 2K9SA 2CUEA 2L7MP 3F0CA 3JRDA 2GM4A 5K7FA 3HEFA 1ETYA 4JYKA 5IP9J 2HXOA 4MO7A 2R5ZA 1JUMA 4A93J 1WGXA 5EGOA 3H3VK 1JKQC 4DZJA 4ABZA 5F04A 2HOSA 1JUSA 1JUPA 1TWHJ 2I10A 3HM5A 1CQTA 4L5EA 2XPUA 2ECBA 1GVDA 5FJ8J 1NK2P 5IOYA 2DA6A 5GP9A 1MNMC 3BR2A 4M3BA 3IV5A 2M2EA 2XGDA 4V2GA 2R93J 3Q3SA 3QPLA 2CUFA 5C4JJ 2FJ1A 3A03A 3FKIJ 1A5JA 3ZQLA 1JTYA 2JJ7A 1ETWA 3BR3A 2JA7J 3BR0A 1K61A 3NARA 4M3DA 3TP3A 4MFEA 1YRNA 2DMPA 4M3FA 2LK2A 3IH2A 2LFBA 2O7OA 4QIWN 1VNDA 5EDNA 3S1QJ 2ID6A 3JRIA 1D5YA 1RR7A 3I4NJ 2AO9A 3MVPA 5EG0A 4X6AJ 3LSJA 3HOYJ 2H1KA 1MBHA 3BQYA 4XICA 1OCTC 4GFBA 1TWAJ 3FISA 2JWTA 3FK6A 1UMQA 4AC0A 5F08A 5FKMA 1JTXA 4IHXA 2JA5J 2VKVA 1F43A 1B72A 2DN0A 3JRCA 5EF6A 4UUSA 3ZQFA 4A3JJ 3B6AA 2M0CA 5DTDA 1IGNA 1MBEA 2M9HA 2ZB9A 4BKXA 3Q0UA 1ZK8A 5F0CA 3CDLA 1Z0XA 3S2HJ 1MH3A 4FE4A 2DMQA 4M3GA 4XRMA 2LD5A 1GDTA 4BXXJ 1GV5A 1ZR2A 3LSRA 1ZQ3P 1P7JA 3BG5A 1JGGA 3LSPA 1HDDC 1YRNB 3D1NI 1TWCJ 1B8IA 5EYRA 1JT6A 2E2JJ 2H8RA 4A3CJ 4Y52J 3ZQHA 3S14J 1OJLA 2DA5A 5M3FJ 3OOUA 1JKOC 2E2HJ 5FLVA 4D5CA 5J3LA 1ETVA 2L0KA 2DMNA 1H8AC 3B6CA 5F1JA 5EG0B 4M6VA 3HDDA 3Q0VA 5J1YA 3TW6A 4A3LJ 1RESA 4D7MA 1U78A 9ANTA 3SDGA 4BBSJ 2DA1A 4G12A 1B72B 2XPVA 4EEFG 4D7NA 5K7HA 2LP0A 1JT0A 2R92J 4UUSB 1ZR4A 3S1RJ 2K40A 2M34A 2CU7A 5EEAA 4A3EJ 4DW6A 3TEDA 4NDLA 3QQAA 1FJLA 3HGYA 5GPAA 4A3FJ 2X48A 2IEKA 2K9QA 2L9RA 2JA8J 2OPTA 1SANA 2LKXA 3LSGA 2E19A 1AU7A 1UG2A 1LFBA 4A3GJ 2FD5A 2YS9A 1B8IB 2K9NA 4C2MJ 1DU6A 3PM1A 4X1EA 3IH4A 3WHCA 5F27A 1UHSA 1MBFA 1I6HJ 1TWFJ 1IC8A 2M8GX 4Y7NJ 2O9LA 2ID3A 4I76A 4IHWA 1EF4A 1RKTA 1FTZA 5C4XJ 4FCYA 2HYJA 3TP0A 1R9TJ 3ZQIA 3WHBA 1QVUA 2QCOA 4BY1J 1APLC 2XB0X 1DU0A 1FTTA 2D5VA 1MBGA 3M4OJ 3K7AJ 2YU9J 3O8GA 1VF9A 2DTZA 2MG4A 2JN6A 2DA4A 4IHVA 2R7ZJ 2Y2ZA 4S0HB 3HGGA 3S1MJ 1X2MA 2EZIA 1S7EA 2VI6A 4MFDA 1HCRA 2TCTA 2R0QC 5DS9A 1TWGJ 5K7ZA 1BJZA 1MSFC 1WPKA 3CQZJ 3ZQGA 1LFUP 1JKPC 2XPWA 4DZPA 1PUFA 4D5FA 2LR8A 5IP6A 2HOTA 5IPAA 1GUUA 1IV6A 1HOMA 3BG9A 4LOCA 5M5XJ 3BTLA 3E7LA 3CCYA 3O8HA 2VKEA 1VFCA 1I3QJ 4FE7A 5J1UA 1IRZA 1MBJA 4IHYA 2Y30A 3S17J 3MN2A 3W6VA 3GTJJ 1JJ8C 1I50J 1XS9A 4W1UA 2ELKA 5IYDJ 1FIAA 1LE8A 3JR9A 1H89C 3JRBA 1H88C 4FTHA 2MW8A 2NVYJ 3HBLA 1OFCX 2X6OA 3JRFA 2NS8A 1WCMJ 1Q1VA 2JK3A 4DYRA 2VUMJ 4B3AA 3H0GJ 2TRTA 4UUTA 2HXIA 3Q0WA 2EQRA 3RZOJ 1RKWA 2JA6J 2KT0A 1F36A 1XG1A 1U9NA 3NAUA 1GT0C 5E3LA 2NVXJ 2LTPA 2Y9ZA 3HOXJ 2EZKA 2VPRA 2IBDA 5BNGA 5F0HA 3FK7A 4FISA 3SJMA 1U8BA 1PUFB 2EZHA 2XSDC 1GV2A 3BTIA 2ME0A 3GTOJ 4V2FA 5FLMJ 5JLXA 1W0UA 3UKGA 3G1OA 2DA2A 1TC3C 5IP7J 2Y31A 2WB1N 4MLOA 4JP0A 3RKQA 1VI0A 1LE8B 3BTJA 3TW7A 2NVTJ 2CQXA 1OCPA 2DA7A 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS A;  1IJW C;  1RET A;  1IDY A;  3IH3 A;  4M3E A;  1IG7 A;  4A3D J;  2ECC A;  1RPW A;  2HQ5 A;  2QF7 A;  3HB9 A;  1HDP A;  3G1L A;  2EH3 A;  1WH5 A;  5FKL A;  3PO2 J;  2L7F P;  2B63 J;  1NK3 P;  2RAE A;  5GPC A;  3HOZ J;  4J19 A;  2AHQ A;  4W97 A;  2G0E A;  2YUS A;  3K2A A;  2FX0 A;  1ORK A;  2JMW A;  1Y1W J;  3I4M J;  3GTL J;  2NOG A;  1BL0 A;  2GLO A;  3M3Y J;  2GBY A;  3GTM J;  2DJN A;  1T56 A;  2XGC A;  3LNQ A;  5C44 J;  1O4X A;  1AKH A;  2CJJ A;  2PMZ N;  3SFI A;  1IUF A;  1X2N A;  1ZTR A;  3RZD J;  4JX4 A;  4JX5 A;  4IEJ A;  2HDD A;  3ZQC A;  4B4C A;  4A69 C;  4C3I J;  1QRY A;  4XK4 A;  1MSE C;  2EZL A;  2L7Z A;  1FIP A;  3L1P A;  5EZG A;  2LY9 A;  5M5Y J;  4BY7 J;  3BQZ A;  5F0F A;  5E3M A;  3GBG A;  3DEW A;  5E3O A;  4CYC B;  3S1N J;  2MGQ A;  5FKN A;  2NVQ J;  3GTQ J;  3HOU J;  3VPR A;  1WI3 A;  3OIO A;  2EBI A;  2HOA A;  5IYB J;  2R5Y B;  2MSY A;  2E2I J;  4C3H J;  2Y0S N;  1ENH A;  1IDZ A;  3G1M A;  5IOZ A;  4JX6 A;  5M5W J;  1QVT A;  2XB5 A;  3A01 A;  3BT9 A;  2P81 A;  2CRG A;  3JRA A;  2KDZ A;  5M3M J;  3BG3 A;  1MH4 A;  3ZOB A;  2R5Z B;  3S16 J;  3FIW A;  5HOD A;  2W48 A;  5EGO B;  3HKZ N;  1AKH B;  2DMU A;  1SFO J;  5IYC J;  2CQQ A;  4RDU A;  2COB A;  4C3J J;  3C2B A;  1ZKG A;  1X58 A;  2X9D A;  3OSF A;  1NTC A;  1Z77 A;  1K83 J;  1BW6 A;  3MKL A;  5JLW A;  3GTG J;  1E3O C;  1ZGW A;  3JRE A;  1A6I A;  5J1R A;  2IAI A;  1Y1V J;  2LVS A;  3JRH A;  1W0T A;  3S2D J;  3BR6 A;  1P7I A;  3QPS A;  3S15 J;  3A02 A;  4QSH A;  4AYB N;  4BBR J;  1JKR C;  3BTC A;  2LLK A;  3HOW J;  1ETK A;  2XRL A;  3BR1 A;  5EZH A;  1WH7 A;  4XID A;  1G2H A;  4MIM A;  5E3N A;  4I6Z A;  1ETQ A;  4A3I J;  1AHD P;  2Y9Y A;  3RQI A;  1U9O A;  2E1O A;  4DYC A;  1QPI A;  1ITY A;  1BW5 A;  1FEX A;  3DCF A;  1MBK A;  3HOV J;  3A01 B;  4A3B J;  4XRS G;  2HI3 A;  2N8G A;  2O8K A;  2NS7 A;  2WAQ N;  2FQ4 A;  1ETX A;  4QTR A;  1T33 A;  3OSG A;  1HF0 A;  2XGE A;  3JRG A;  4A3K J;  4B1R A;  2DMT A;  1ETO A;  4CYC A;  2OF7 A;  4A3M J;  5FKO A;  2DA3 A;  2R5Y A;  3CMY A;  4HNV A;  1JJ6 C;  4DYQ A;  4RBO A;  4AUX A;  1XC5 A;  5FKK A;  2WV1 A;  5C3E J;  3PO3 J;  3GTK J;  1POG A;  3BR5 A;  2ME6 A;  3GTP J;  1HLV A;  1BA5 A;  2K9S A;  2CUE A;  2L7M P;  3F0C A;  3JRD A;  2GM4 A;  5K7F A;  3HEF A;  1ETY A;  4JYK A;  5IP9 J;  2HXO A;  4MO7 A;  2R5Z A;  1JUM A;  4A93 J;  1WGX A;  5EGO A;  3H3V K;  1JKQ C;  4DZJ A;  4ABZ A;  5F04 A;  2HOS A;  1JUS A;  1JUP A;  1TWH J;  2I10 A;  3HM5 A;  1CQT A;  4L5E A;  2XPU A;  2ECB A;  1GVD A;  5FJ8 J;  1NK2 P;  5IOY A;  2DA6 A;  5GP9 A;  1MNM C;  3BR2 A;  4M3B A;  3IV5 A;  2M2E A;  2XGD A;  4V2G A;  2R93 J;  3Q3S A;  3QPL A;  2CUF A;  5C4J J;  2FJ1 A;  3A03 A;  3FKI J;  1A5J A;  3ZQL A;  1JTY A;  2JJ7 A;  1ETW A;  3BR3 A;  2JA7 J;  3BR0 A;  1K61 A;  3NAR A;  4M3D A;  3TP3 A;  4MFE A;  1YRN A;  2DMP A;  4M3F A;  2LK2 A;  3IH2 A;  2LFB A;  2O7O A;  4QIW N;  1VND A;  5EDN A;  3S1Q J;  2ID6 A;  3JRI A;  1D5Y A;  1RR7 A;  3I4N J;  2AO9 A;  3MVP A;  5EG0 A;  4X6A J;  3LSJ A;  3HOY J;  2H1K A;  1MBH A;  3BQY A;  4XIC A;  1OCT C;  4GFB A;  1TWA J;  3FIS A;  2JWT A;  3FK6 A;  1UMQ A;  4AC0 A;  5F08 A;  5FKM A;  1JTX A;  4IHX A;  2JA5 J;  2VKV A;  1F43 A;  1B72 A;  2DN0 A;  3JRC A;  5EF6 A;  4UUS A;  3ZQF A;  4A3J J;  3B6A A;  2M0C A;  5DTD A;  1IGN A;  1MBE A;  2M9H A;  2ZB9 A;  4BKX A;  3Q0U A;  1ZK8 A;  5F0C A;  3CDL A;  1Z0X A;  3S2H J;  1MH3 A;  4FE4 A;  2DMQ A;  4M3G A;  4XRM A;  2LD5 A;  1GDT A;  4BXX J;  1GV5 A;  1ZR2 A;  3LSR A;  1ZQ3 P;  1P7J A;  3BG5 A;  1JGG A;  3LSP A;  1HDD C;  1YRN B;  3D1N I;  1TWC J;  1B8I A;  5EYR A;  1JT6 A;  2E2J J;  2H8R A;  4A3C J;  4Y52 J;  3ZQH A;  3S14 J;  1OJL A;  2DA5 A;  5M3F J;  3OOU A;  1JKO C;  2E2H J;  5FLV A;  4D5C A;  5J3L A;  1ETV A;  2L0K A;  2DMN A;  1H8A C;  3B6C A;  5F1J A;  5EG0 B;  4M6V A;  3HDD A;  3Q0V A;  5J1Y A;  3TW6 A;  4A3L J;  1RES A;  4D7M A;  1U78 A;  9ANT A;  3SDG A;  4BBS J;  2DA1 A;  4G12 A;  1B72 B;  2XPV A;  4EEF G;  4D7N A;  5K7H A;  2LP0 A;  1JT0 A;  2R92 J;  4UUS B;  1ZR4 A;  3S1R J;  2K40 A;  2M34 A;  2CU7 A;  5EEA A;  4A3E J;  4DW6 A;  3TED A;  4NDL A;  3QQA A;  1FJL A;  3HGY A;  5GPA A;  4A3F J;  2X48 A;  2IEK A;  2K9Q A;  2L9R A;  2JA8 J;  2OPT A;  1SAN A;  2LKX A;  3LSG A;  2E19 A;  1AU7 A;  1UG2 A;  1LFB A;  4A3G J;  2FD5 A;  2YS9 A;  1B8I B;  2K9N A;  4C2M J;  1DU6 A;  3PM1 A;  4X1E A;  3IH4 A;  3WHC A;  5F27 A;  1UHS A;  1MBF A;  1I6H J;  1TWF J;  1IC8 A;  2M8G X;  4Y7N J;  2O9L A;  2ID3 A;  4I76 A;  4IHW A;  1EF4 A;  1RKT A;  1FTZ A;  5C4X J;  4FCY A;  2HYJ A;  3TP0 A;  1R9T J;  3ZQI A;  3WHB A;  1QVU A;  2QCO A;  4BY1 J;  1APL C;  2XB0 X;  1DU0 A;  1FTT A;  2D5V A;  1MBG A;  3M4O J;  3K7A J;  2YU9 J;  3O8G A;  1VF9 A;  2DTZ A;  2MG4 A;  2JN6 A;  2DA4 A;  4IHV A;  2R7Z J;  2Y2Z A;  4S0H B;  3HGG A;  3S1M J;  1X2M A;  2EZI A;  1S7E A;  2VI6 A;  4MFD A;  1HCR A;  2TCT A;  2R0Q C;  5DS9 A;  1TWG J;  5K7Z A;  1BJZ A;  1MSF C;  1WPK A;  3CQZ J;  3ZQG A;  1LFU P;  1JKP C;  2XPW A;  4DZP A;  1PUF A;  4D5F A;  2LR8 A;  5IP6 A;  2HOT A;  5IPA A;  1GUU A;  1IV6 A;  1HOM A;  3BG9 A;  4LOC A;  5M5X J;  3BTL A;  3E7L A;  3CCY A;  3O8H A;  2VKE A;  1VFC A;  1I3Q J;  4FE7 A;  5J1U A;  1IRZ A;  1MBJ A;  4IHY A;  2Y30 A;  3S17 J;  3MN2 A;  3W6V A;  3GTJ J;  1JJ8 C;  1I50 J;  1XS9 A;  4W1U A;  2ELK A;  5IYD J;  1FIA A;  1LE8 A;  3JR9 A;  1H89 C;  3JRB A;  1H88 C;  4FTH A;  2MW8 A;  2NVY J;  3HBL A;  1OFC X;  2X6O A;  3JRF A;  2NS8 A;  1WCM J;  1Q1V A;  2JK3 A;  4DYR A;  2VUM J;  4B3A A;  3H0G J;  2TRT A;  4UUT A;  2HXI A;  3Q0W A;  2EQR A;  3RZO J;  1RKW A;  2JA6 J;  2KT0 A;  1F36 A;  1XG1 A;  1U9N A;  3NAU A;  1GT0 C;  5E3L A;  2NVX J;  2LTP A;  2Y9Z A;  3HOX J;  2EZK A;  2VPR A;  2IBD A;  5BNG A;  5F0H A;  3FK7 A;  4FIS A;  3SJM A;  1U8B A;  1PUF B;  2EZH A;  2XSD C;  1GV2 A;  3BTI A;  2ME0 A;  3GTO J;  4V2F A;  5FLM J;  5JLX A;  1W0U A;  3UKG A;  3G1O A;  2DA2 A;  1TC3 C;  5IP7 J;  2Y31 A;  2WB1 N;  4MLO A;  4JP0 A;  3RKQ A;  1VI0 A;  1LE8 B;  3BTJ A;  3TW7 A;  2NVT J;  2CQX A;  1OCP A;  2DA7 A;  3LOC A; 
#chains in the Genus database with same CATH topology
 1R71 A;  1IDY A;  4LB6 B;  2P4W A;  4M3E A;  4XKC A;  1R36 A;  1T95 A;  2ECC A;  1RPW A;  4OIQ F;  1JE8 A;  4U87 A;  3WTT C;  5J8F A;  2FEZ A;  4YFX F;  1N25 A;  3CCL I;  4LGW A;  1SFE A;  5IT9 Z;  2L7F P;  1IO2 A;  1NK3 P;  2KRF A;  2RAE A;  4I02 A;  5GPC A;  2PMH A;  2NYX A;  5FFX A;  4AYB A;  3E3V A;  4P96 A;  2AHQ A;  1JXS A;  5F6F A;  2YUS A;  4V19 K;  2JPC A;  1FZP B;  3CC7 I;  4HOB A;  2VB6 A;  4E7I A;  1PJR A;  2NOG A;  5AON A;  2W7N A;  3O3K A;  2JUC A;  2RC4 A;  3LSK A;  3K0L A;  4A0Z A;  2DJN A;  2VBZ A;  2OQR A;  3HOS A;  1V4R A;  3W3C A;  3GLX A;  2PMZ N;  3SFI A;  1IW7 F;  1ZTR A;  2F2E A;  4JX4 A;  3RZD J;  3HTS B;  5TJJ A;  2XRO A;  2M8E A;  5EEH A;  4A69 C;  2ACJ A;  2EZL A;  4LIU A;  1FIP A;  4Z2Y A;  3HHG A;  3RJP A;  4UHT A;  3U2R A;  3FM3 A;  5B1A H;  1BR2 A;  3OL4 A;  2JRT A;  5M5Y J;  5K5O A;  2NAZ A;  5F0F A;  3KLO A;  2R4G A;  2EJR A;  1R1U A;  3COA C;  5E3O A;  1HST A;  3S1N J;  2MBF A;  3GTQ J;  1BR1 A;  3VPR A;  1WI3 A;  4HDU A;  4KIS A;  3LST A;  3DF8 A;  4EJU A;  2R7X A;  3MWM A;  3CCJ I;  3OYN A;  5KAI C;  2D45 A;  2XVC A;  2HKX A;  3G1M A;  3ISP A;  2R7V A;  3EPZ A;  2XAJ A;  1X1C A;  3CUO A;  1UHM A;  1CGP A;  2DO7 A;  1X1D A;  5FLX K;  1UAA A;  1VQN I;  5D6E A;  1OLT A;  2CH0 A;  3ZOB A;  4WXD A;  3IKT A;  3AFH A;  2P5K A;  3FIW A;  3AAF A;  2A5W A;  5HOD A;  1FOW A;  3CCQ I;  1DGW Y;  3LL7 A;  1AKH B;  1SFO J;  1R1V A;  2LF8 A;  3ZGK A;  2QA4 I;  1G3T A;  4GDF A;  2CQQ A;  3ABM H;  3OSF A;  2X9D A;  3HSR A;  1Z77 A;  2G9W A;  3GTG J;  3ASN H;  3C2G A;  1E3O C;  1ZEL A;  4M71 A;  3JRE A;  4BJT A;  4DIQ A;  3L2W A;  3CME I;  1A6I A;  4AVZ A;  2IAI A;  1EKE A;  2XAS A;  1KU9 A;  2LG4 A;  4A0X A;  2R7W A;  3QPS A;  5HS8 A;  3A02 A;  4H4K C;  2BV6 A;  3T1B A;  4BBR J;  1HC8 A;  2YX4 A;  3BTC A;  4BXF A;  1R4M B;  4RAZ A;  2CMP A;  3IHU A;  2K9M A;  2L54 A;  3GZ6 A;  4L0Y B;  2LMD A;  5E3N A;  4H0E A;  1EV7 A;  3CCR I;  3K4M A;  3VDX A;  1AHD P;  4J00 A;  2CQN A;  1QPI A;  1MBK A;  4OIO F;  2LBF B;  3HHH A;  3SDB A;  5FRN A;  3ERM A;  3HOV J;  4HV5 A;  4A3B J;  4OAZ A;  2V1U A;  4BHC A;  2QBY B;  4HX8 A;  2WAQ N;  3F8B A;  2ZC2 A;  2XKO A;  2FQ4 A;  3LA2 A;  3FXJ A;  3K1N A;  1S29 A;  2QQ9 A;  4G94 A;  1I3A A;  1IXR C;  3RKW A;  5ICC A;  3W2V A;  2RNG A;  2OF7 A;  3ERE D;  5D4R A;  4B43 A;  1BIB A;  1IN6 A;  3QPT A;  4WK8 F;  4HNV A;  4L0Z B;  3MEX A;  5L3B A;  1FT9 A;  2MC4 A;  4IVN A;  4YFK F;  4RBO A;  1XC5 A;  4PSW A;  1OQY A;  2WV1 A;  4I98 B;  3R6S A;  2A68 F;  3GTK J;  5FFZ A;  1POG A;  3BR5 A;  3CJQ B;  3GTP J;  2MFZ A;  1HLV A;  1BA5 A;  1S7A A;  3JTH A;  4II3 A;  3EET A;  2P5V A;  2L7M P;  5JHU A;  5LEJ A;  2QSF X;  2NRA C;  3ECO A;  3P9C A;  4JYK A;  1R58 A;  3OV8 A;  4P9U A;  1MNE A;  3SZP A;  4CCM A;  4LIT A;  2PJR B;  1WGX A;  3QWL A;  4WWC A;  3H3V K;  2MLK A;  4CA0 A;  3IP4 B;  2F5E A;  1H9T A;  2ZNY A;  1MJ9 A;  2DOD A;  2LY1 A;  2JVH A;  1JUP A;  2NXN B;  5HLI A;  2Q2E A;  4YIR X;  1CQT A;  3M1C A;  4XSX F;  1OR7 C;  3DKX A;  4J01 A;  1RIO H;  1ERD A;  1LVK A;  2D2W A;  2GZW A;  5FJ8 J;  3DLA A;  5IOY A;  2DA6 A;  1NK2 P;  1BN5 A;  1YO5 C;  3D5R C;  4EAT A;  2P7C B;  1HA8 A;  1D0Y A;  1XCV A;  2PEX A;  4G7Z F;  3QPL A;  5ILS A;  2YX7 A;  2X1C A;  3DU6 A;  5C4J J;  3A03 A;  3OYF A;  2EV6 A;  1MZB A;  1ZAO A;  1VQ4 I;  1A5J A;  3ZQL A;  1JTY A;  2MC3 A;  1ETW A;  3BR3 A;  3PQK A;  3VYT B;  3DTK A;  2VC0 A;  4LK1 F;  3BZK A;  1KQ0 A;  3ZN1 A;  4MFE A;  2IVM A;  3CUQ C;  1NH3 A;  4O3M A;  5DUI A;  4BQO A;  2O7O A;  1BI1 A;  5A2Q Z;  2MH9 A;  1VND A;  1VQM I;  5TGT A;  2W00 A;  3KEQ A;  3HRU A;  3C1D A;  2ID6 A;  3JRI A;  4U88 A;  1YJ9 I;  2PBI A;  1RR7 A;  3GVA A;  4KT5 C;  3I4N J;  2EV5 A;  2OCC H;  5EG0 A;  1SMY F;  2WAF A;  1IAW A;  1BI0 A;  4FQG A;  3BQY A;  2IS1 A;  3ULQ B;  1TWA J;  3CF5 F;  4MGR A;  3FK6 A;  1PVE A;  4XOR A;  3RKX A;  5F08 A;  4R1H A;  5FKM A;  1JTX A;  1UEL B;  1GHC A;  5HS7 A;  2QVO A;  3QYF A;  2W24 A;  2DN0 A;  3TBI A;  2HPM A;  3KYD B;  4CZZ A;  3K4N A;  2CV1 A;  4PJ0 C;  4MQV A;  2EPF A;  3N05 A;  4UUS A;  4XR6 A;  3ZQF A;  5DTD A;  2GA2 A;  2ZB9 A;  4KIT B;  4AM3 A;  2LY2 A;  2E7W A;  3EQL F;  1EA3 A;  2IW5 A;  1CF7 B;  4IRI A;  4XLA A;  4XKV A;  1Z0X A;  1N77 A;  3DBH B;  1Z9C A;  3FZV A;  3I53 A;  4FE4 A;  3ESW B;  3V42 A;  2HZD A;  3F23 A;  2FML A;  2MD0 A;  2IA0 A;  4KIB A;  4P5O A;  3WTS C;  1PYV A;  1YRN B;  3D1N I;  4Y52 J;  1LVA A;  4A3C J;  1K4S A;  4L9V A;  2RGV A;  1STZ A;  4U7B A;  3K70 C;  5FLV A;  4CZC A;  2E2H J;  2VKH A;  4FX0 A;  4BGD A;  1W5S A;  3CP2 A;  4HYE A;  5J3L A;  1VQ8 I;  4Y4R A;  2DMN A;  3F9K A;  1KU7 A;  1S7O A;  3T5X A;  3HDD A;  1IRX A;  4EM1 A;  5J1Y A;  4B3X A;  1FWZ A;  3TW6 A;  4A3L J;  3AL0 B;  1JHF A;  2A6E F;  4DBQ A;  2EIJ H;  4BBS J;  1B72 B;  1B4A A;  4PJJ A;  3QYB A;  4UVC A;  4D7N A;  1JT0 A;  2LP0 A;  4PDK A;  3V8J A;  1OKR A;  3M07 A;  3S1R J;  1MMS A;  2K40 A;  2CU7 A;  4A3E J;  4ZC3 A;  4PFP A;  4DW6 A;  2K27 A;  5B1B H;  2VXZ A;  3RKY A;  2CFO A;  2X48 A;  2L9R A;  1OR7 A;  4RAF A;  2DCE A;  1GLN A;  2FNA A;  3BLY A;  2OAZ A;  2LKX A;  2XSJ C;  2H6B A;  1HBX G;  4BDY A;  1UB9 A;  4M74 A;  1U2W A;  2YS9 A;  1SD6 A;  1DU6 A;  2HYF A;  3PM1 A;  4EM0 B;  1TTY A;  4KMU X;  3ZN0 A;  4IHS A;  1I6H J;  3CUQ A;  3MZY A;  2ZXJ A;  3I9V 2;  2LKS A;  4LK0 F;  2KIU A;  4UUV A;  2CGP A;  3FM5 A;  2HQR A;  1SD5 A;  4FCY A;  1W36 C;  2HYJ A;  1BOB A;  3WHB A;  2KL4 A;  1IXC A;  2ETH A;  5LHH A;  3I0T A;  3PL8 A;  2OCE A;  1FBU A;  4A12 A;  3PFI A;  1CF7 A;  2LSO A;  5BS6 A;  2D5V A;  4EGY A;  3H9J A;  3FMR A;  4CCO A;  2VE8 A;  2DTZ A;  4C30 A;  1IN7 A;  2MG4 A;  2KIM A;  3FHZ A;  1TT5 B;  1G3S A;  2JN6 A;  3CDI A;  1KU3 A;  1G3Y A;  4LMY A;  2HZT A;  2FE3 A;  3DLL F;  1XD7 A;  1UZC A;  2DOF A;  3R0A A;  4LG0 A;  3HL2 A;  5L3G A;  2BZT A;  2R0Q C;  3ZMT A;  1KQ9 A;  5DD4 A;  4XBF A;  3MAJ A;  5K7Z A;  4LLN A;  3HG9 A;  3WOD F;  2L9S A;  3KEO A;  3ZQG A;  1LFU P;  2A3S A;  3CD6 I;  5KVR A;  3E6B A;  2YU3 A;  3CMM A;  2F5V A;  2E5Z A;  3E7L A;  3K4K A;  4O5V A;  1QA6 A;  4FE7 A;  5J1U A;  1MBJ A;  1ZG3 A;  1K6O A;  3MN2 A;  3W6V A;  2H27 A;  2ELK A;  1FIA A;  4WXH A;  2DK5 A;  1LKX A;  4BU2 A;  5FD6 A;  4G6Q A;  4M9X A;  1OFC X;  5E20 A;  5LHI A;  1HW1 A;  4L9T A;  4M9S A;  4ZYH A;  3JRF A;  5BOX A;  3SZT A;  1Q1V A;  1TNS A;  1YX3 A;  1TW3 A;  4II2 A;  4DYR A;  3SQN A;  3CCE I;  2NNN A;  3QU6 A;  3DPT A;  5E1X A;  4KT6 A;  2DI3 A;  1Z05 A;  3RZO J;  1RKW A;  3VSK A;  4MHG A;  3K2Z A;  2JA6 J;  4EJW A;  5D8K B;  4QWQ A;  2UV1 A;  3FBI B;  5EEG A;  4XLF A;  2Y9Z A;  5JI6 A;  2OTJ I;  3HOX J;  2EZK A;  2E71 A;  5BNG A;  5F0H A;  1PUF B;  3FK7 A;  4HX4 A;  3GO5 A;  2ZO4 A;  4UY8 I;  1WJE A;  2ME0 A;  2FA5 A;  5ED4 A;  2KP6 A;  3BCA A;  5CLS A;  2EFW A;  4IZZ A;  2F4I A;  3VOE A;  3TO6 A;  1XGN A;  4BL0 B;  4DOZ A;  1ZLK A;  2OQG A;  2WB1 N;  5J6X A;  4BNC A;  2ISZ A;  1ON1 A;  3BJO A;  1P6R A;  2DFE A;  3F8N A;  5FLX Z;  4PGG A;  1OCP A;  5B66 C;  4A5M A;  3CJN A;  2E34 A;  1RET A;  3WGH A;  1TZL A;  3BZC A;  3IH3 A;  3ZMU A;  1IG7 A;  2A05 A;  1L0O C;  2H09 A;  1YTY A;  2DJI A;  2HQ5 A;  2QF7 A;  4WF2 A;  1S72 I;  3A4C A;  3PIO F;  2MYS A;  1WH5 A;  5K1Y A;  3PO2 J;  4LG3 A;  2BW3 A;  4HQE A;  3HOZ J;  2OA4 A;  4W97 A;  3HRM A;  2RKH A;  3EYY A;  3OMY A;  2DFF A;  2QUF A;  3QP5 A;  3F8F A;  2FUG 2;  2KFD A;  3NEU A;  2JMW A;  1A36 A;  3M8F A;  4ZYA A;  3M8E A;  3KP5 A;  5ILV A;  1GVJ A;  3PNV A;  4I01 A;  2GLO A;  3J81 K;  2GBY A;  3AG4 H;  1O4X A;  2EIM H;  1I39 A;  1IUF A;  2FF4 A;  2WAQ A;  3C2H A;  1X2N A;  4X0G A;  4ENJ A;  2HDD A;  4JX5 A;  1ZRD A;  2OTL I;  2K4J A;  2K86 A;  4MNU A;  4Y17 A;  1LJ9 A;  5K5Q A;  4RB3 C;  4C3I J;  1T2K A;  3A0H C;  2P7V B;  4XK4 A;  3A0B C;  1MSE C;  4HRI A;  1VTN C;  3ZR8 X;  2DQR A;  1T08 B;  4HPQ A;  2QSH X;  1KGS A;  2R3S A;  5E3M A;  1MMG A;  3CLQ A;  1DP3 A;  2MGQ A;  3HSF A;  5FKN A;  2NVQ J;  2I8D A;  2EBI A;  1MND A;  3DEU A;  5B5E C;  3K70 D;  5CVR A;  5JHF A;  4ASN A;  4RMN A;  2EB7 A;  2ZXI A;  4P9F A;  5HDN A;  3BY6 A;  2Y0S N;  4ZYD A;  3T8R A;  5IOZ A;  5M5W J;  1TT0 A;  4A6E A;  3Q5F A;  3A01 A;  3BT9 A;  2P81 A;  3DKW A;  3JRA A;  4RB1 A;  1U8R A;  3BG3 A;  1RNL A;  1DPU A;  1JGS A;  3M9A A;  5TIS C;  2W48 A;  1V5E A;  5EGO B;  5HDG A;  4OIR F;  2DMU A;  5K5R A;  3Q9V A;  1W1W E;  4MEY F;  2X85 A;  3ZQQ A;  5IYC J;  1SD4 A;  2COB A;  2DOA A;  1FX7 A;  3C2B A;  1ZKG A;  2IGN A;  3K6G A;  2IT0 A;  1X1A A;  3G73 A;  3LAJ A;  3AG1 H;  1BW6 A;  5DM7 F;  2QZ8 A;  2GXA A;  1RUO A;  4OMY A;  1N75 A;  2DT6 A;  1AWC A;  1Y1V J;  3VWB A;  3JRH A;  2QM3 A;  3J80 K;  2BYV E;  2HYG D;  2V7F A;  1P7I A;  3DXJ F;  1E3H A;  4FT8 A;  4QSH A;  2Y69 H;  4M6Y A;  2EA2 A;  2EFO A;  4XLN F;  1J59 A;  1LDK B;  2M5W A;  1G8X A;  2LLK A;  1ETK A;  3V8K A;  2VOD A;  1R23 A;  1WH7 A;  3S93 A;  1G2H A;  1B59 A;  2M4G A;  2Z1D A;  4MIM A;  4CO8 A;  1ETQ A;  4CSW A;  1TLH B;  1U9O A;  3OL3 A;  1O7L A;  3JSO A;  2PX9 A;  4DYC A;  1ITY A;  1BW5 A;  2JQ7 A;  1I1S A;  2O8X A;  3DCF A;  2XF5 A;  1W36 D;  2EFQ A;  4N0B A;  3TMO A;  4XRS G;  1VQ5 I;  2KKO A;  2GXG A;  2K5C A;  3WU0 A;  2O8K A;  2VKD A;  3TQN A;  2FNP A;  2NS7 A;  2CQK A;  2GXB A;  4OWR B;  1B1B A;  3RI4 A;  3GW2 A;  3E6C C;  2QQ8 A;  2IXS A;  1ETX A;  3LSI A;  1KYZ A;  2P8T A;  2M30 A;  3HPG A;  1HF0 A;  2ELJ A;  2DBB A;  2CV2 A;  4D1Q A;  2IS4 A;  2VJJ A;  2OJE D;  4BQA A;  1HKS A;  1BJA A;  5DYM A;  1UCR A;  1WWX A;  3K1P A;  1D0X A;  3MCZ A;  1M1E B;  1JJ6 C;  4DYQ A;  4D0P A;  5FKK A;  5C3E J;  4IJA A;  3F6V A;  3JCU C;  2CUE A;  2ELH A;  1TQP A;  2KLO A;  3S2W A;  1SVO A;  3HEF A;  1WJC A;  3AKZ A;  1P4A A;  5IP9 J;  2FBI A;  1MGT A;  1DUX C;  1JUM A;  1J75 A;  4Q48 A;  5EGO A;  2QQB A;  1IN4 A;  5LGN A;  1JKQ C;  2B0L A;  4RGX A;  5ICF A;  4DZJ A;  4ABZ A;  1DGR M;  3A2K A;  5F04 A;  1Y0U A;  1OCO H;  3PNT A;  2HOS A;  1OCZ H;  1GXQ A;  1JUS A;  2CS3 A;  3E5U A;  3U1D A;  3F8M A;  4L5E A;  2ECB A;  4ZZD A;  3ZRG A;  2IRF G;  1FPQ A;  4F93 B;  5HOO A;  3HYI A;  5J40 A;  4XKW A;  4EMS A;  3HUG A;  1XGS A;  2R93 J;  3JTG A;  2DFI A;  1FSE A;  2CUF A;  2LNB A;  2FJ1 A;  1REP C;  2Z99 A;  3H5A A;  1MMD A;  3CDH A;  4QPO A;  3RCO A;  3H3U A;  3TP3 A;  1GXP A;  2DTR A;  3P5J A;  2FQ3 A;  3IH2 A;  3L00 A;  1VQK I;  2Z9O A;  4UV9 A;  3S32 A;  3V8L A;  5EDN A;  3FXO A;  3F3X A;  4IOC F;  2DW4 A;  2K7L A;  2VAS A;  3MZ8 A;  1FP2 A;  4F92 B;  3ZPL A;  1PP8 F;  3DU5 A;  4XN3 A;  2H1K A;  4ZDP A;  1Z6R A;  4N9H A;  4IL6 C;  3RYR A;  1OCT C;  4GFB A;  3FIS A;  2JWT A;  2M1B A;  1UMQ A;  2DFH A;  2JSP A;  2OBP A;  2E7X A;  1ZRC A;  1C0W A;  2VKV A;  1S8N A;  2VLA A;  2Q2E B;  2XHK A;  3JRC A;  1R5H A;  3JSP A;  2XKP A;  3VOD A;  1KU2 A;  2M9H A;  4CCL A;  2O3F A;  3OS0 A;  4G9Y A;  2Q8K A;  1XSV A;  3JW4 A;  3B73 A;  5CQE A;  3J7A Y;  2WY7 Q;  5F0C A;  2QWW A;  3IRR A;  3CDL A;  3QAH A;  2CYY A;  3S2H J;  1MJB A;  2DT7 B;  4M73 A;  4C2T A;  3LQQ A;  1YQA A;  2LD5 A;  1D3Y A;  4G7O F;  4HF2 A;  3CCS I;  3RPU D;  2VJ4 A;  3HC7 A;  3LSR A;  2UZK A;  3P7N A;  2HEO A;  3ONQ A;  1HDD C;  1IRF A;  2OZ6 A;  3EUK L;  1B8I A;  2L2O A;  2ZBK A;  1J0R A;  2LF7 A;  2CSO A;  1OJL A;  3LSM A;  3VYU B;  2JZY A;  2DA5 A;  1HW2 A;  4HF0 A;  2Z2S B;  3OOU A;  1JKO C;  4EJV A;  1QPM A;  2QKM B;  3E5X A;  3B6C A;  5EG0 B;  4M6V A;  3P9I A;  5GTH C;  4Y33 A;  5HNH A;  1T98 A;  5L3C A;  1YW9 A;  1PDN C;  4D7M A;  4E7S A;  3H9Q A;  2VE9 A;  4ANJ A;  2F4O B;  5DD8 A;  3SDG A;  2OZU A;  4S05 A;  2DA1 A;  2L02 A;  1XGO A;  4G12 A;  2XPV A;  1ON2 A;  1RZ4 A;  3V4G A;  4UUS B;  1ZR4 A;  1TNT A;  4AID A;  1MJA A;  3BJ6 A;  3TED A;  4EQQ A;  4I2O A;  3K4L A;  3CJT B;  3OYC A;  1BOA A;  5GPA A;  2RNJ A;  2IEK A;  3J7Z I;  2JA8 J;  4DJA A;  3OYE A;  1QZE A;  1SAN A;  4LJZ F;  1H0M A;  5F64 A;  4XSZ F;  3O6B B;  4BEH A;  3M8J A;  3ROU A;  4RB2 C;  2GA1 A;  2EIL H;  2FD5 A;  2K9N A;  4GO1 A;  4X1E A;  3WHC A;  1FY7 A;  1ONV A;  3LWF A;  2DAO A;  1IC8 A;  5E8G A;  2QSG X;  3CC4 I;  4Y7N J;  4O6J A;  1DP7 P;  4I76 A;  1G3W A;  5BPI A;  3OS1 A;  4G8X A;  4Q5S F;  4EVI A;  4EGZ A;  4Q4Z F;  2QCO A;  2X6W A;  1J09 A;  5E79 C;  2OC6 A;  5D5W B;  3I5U A;  1HQC A;  4E7K A;  2WB1 A;  4PFO A;  2IGM A;  2CUJ A;  1X1B A;  3N97 A;  1MMN A;  1O57 A;  2TDX A;  1TP4 A;  2V26 A;  3K7A J;  3V7R A;  2R7O A;  4U7D A;  1VF9 A;  3OOP A;  4XN0 A;  1B9M A;  1XCB A;  2DA4 A;  2R7Z J;  2EWN A;  2PMU A;  1YLF A;  1ZGJ A;  2L9N A;  3HGG A;  4AIH A;  3S1M J;  2M0M A;  1S7E A;  2VI6 A;  4B09 A;  4KJZ A;  1WJF A;  1FSH A;  2L5Q A;  1TWG J;  4BAY A;  3KCC A;  1BJZ A;  1MSF C;  1X3Z B;  2K9L A;  1Y39 A;  3MFK A;  1B9N A;  3CQZ J;  2VIX A;  3E97 A;  2OU2 A;  3CUQ B;  3HTU A;  3BP8 A;  3L2R A;  4CCK A;  2LOO A;  5IP6 A;  5J4Y A;  5IPA A;  4C2U A;  3LFU A;  4YII A;  2YR2 A;  3BTL A;  3WTW C;  3VEP A;  1XDU A;  4NQW A;  3DBR B;  4KYW A;  2J5P A;  1Z67 A;  2VPL A;  1AA7 A;  2Y30 A;  2BHY A;  4CGZ A;  4I99 C;  4YG2 F;  1FMW A;  3MKW B;  1JJ8 C;  4W1U A;  4Q47 A;  4RLQ A;  3WTZ A;  4OAY A;  1LE8 A;  3J81 Z;  2HDC A;  3JR9 A;  1W7P A;  3JRB A;  1H88 C;  2DPD A;  3GYH X;  2NVY J;  3HBL A;  4RAG A;  1J2X A;  1QBJ A;  1WCM J;  1ZRF A;  5HNF A;  2YPR A;  3D5S C;  4LD5 A;  3T8T A;  4E7J A;  1OCR H;  1YFH A;  3E5Q A;  5FGM A;  4B3A A;  2O5R A;  2TRT A;  4UUT A;  3SEQ A;  4LG0 B;  2HGC A;  2JRM A;  1XDS A;  5L3E A;  2HXI A;  2ZME A;  4NHJ A;  2EQR A;  3GFM A;  3UR3 C;  2P5L C;  1O7F A;  2CV0 A;  3G71 I;  1F36 A;  1WJ5 A;  3FX3 A;  1X4P A;  5HLT A;  3WTY C;  2A61 A;  3NAU A;  3OYH A;  4IQJ A;  2QYO A;  1W5T A;  3RTR A;  2VQL A;  3SZG A;  5GAD J;  1BC7 C;  3FXL A;  5CVU A;  1U8B A;  3SJM A;  2XSD C;  3BTI A;  5JFR A;  2Y0S A;  4U0W A;  2FOK A;  4ESF A;  4HLX A;  4HLY A;  3UKG A;  1W0U A;  2VBX A;  2DA2 A;  1TC3 C;  2GIV A;  4XOP A;  4PGH A;  3F6O A;  3NWT A;  4JP0 A;  4HF1 A;  3PFY A;  2NVT J;  4HAM A;  2R7F A;  5E1Z B;  4FHT A;  2AQF A;  4GRI A;  2DA7 A;  1U6G A;  4IKF A;  3LFK A;  4BH9 A;  2X1E A;  2QEX I;  3HOT A;  1RUN A;  4UXN A;  4RM2 A;  1SVL A;  3GXO A;  4PSX A;  2HQN A;  3HB9 A;  3G1L A;  2ICW G;  1KON A;  1NHA A;  2XGX A;  2GWR A;  1T38 A;  4CHU A;  2W85 A;  4MEX F;  1HKQ A;  1ZG1 A;  1J9I A;  5FKL A;  2CW7 A;  3ZCO A;  4IPA A;  2Y48 A;  2GOX B;  5E1W A;  5FRO A;  4ZJZ A;  4IO9 F;  2IPQ X;  4OMZ A;  3N4M A;  3DBL B;  3K2A A;  3J80 Z;  3NQO A;  5JR3 A;  2BXZ A;  1JI8 A;  1K79 A;  3IAS 2;  1TQM A;  3I4M J;  2PLY A;  3DKY A;  4JK1 X;  3JAM K;  2B9S A;  3OS2 A;  2L4A A;  1BL0 A;  1F1Z A;  5CYV A;  2LYC A;  2JTV A;  1T56 A;  2XGC A;  5C44 J;  2JPB A;  1QO0 D;  4AIJ A;  4HW0 A;  4BHB A;  2L3D A;  2FOW A;  4IEJ A;  3ZQC A;  1Y8R B;  1Z7U A;  3EUH A;  6PAX A;  1OCC H;  5D5X B;  2WBM A;  4CH7 A;  3CJR B;  2W84 A;  5KNL A;  2H8W A;  3R60 A;  4G6D A;  3L1P A;  1XMK A;  5EZG A;  1QZY A;  1ZGA A;  3ABT A;  2DU9 A;  3HIF A;  3BQZ A;  4HX7 A;  1XX5 A;  3WGI A;  1F9N A;  1Z1D A;  4UVB A;  3GBG A;  4XLC A;  3TGN A;  3I64 A;  3OIO A;  5CVI A;  2BW3 B;  3HZJ A;  5IYB J;  2R5Y B;  3ASO H;  1SAX A;  2KRH A;  1LB2 A;  1BI2 A;  2F4M B;  3HPH A;  5HS9 A;  1ZHF A;  3W6J B;  4KIG A;  2E2I J;  1UG0 A;  3IWZ A;  2OD5 A;  4C3H J;  1YIJ I;  3H0D A;  4HBL A;  1P4W A;  1QVT A;  2O03 A;  3DFG A;  3OIQ A;  2CRG A;  3IRQ A;  4BQN A;  3TKY A;  2IP2 A;  5AIQ A;  3GFJ A;  2DDA A;  2PMZ A;  2X6X A;  2R5Z B;  2AXT C;  4EJT A;  1EH6 A;  3ABL H;  1SMT A;  5LGT A;  1U0J A;  3R61 A;  2V4J C;  4BHP A;  2KZV A;  5CPR B;  4DBR A;  4RDU A;  1XB4 A;  2XAG A;  4BJ6 C;  3FHN A;  3C3W A;  3F22 A;  4ZDO A;  2QEN A;  1WJD A;  1NTC A;  2VT3 A;  3ZXS A;  3MKL A;  3C7J A;  2A69 F;  1ZGW A;  2VOO A;  1K78 A;  2LVS A;  3S2D J;  1D0Z A;  2NNY A;  1JKR C;  1YJW I;  4UVA A;  3HOW J;  1YW8 A;  2XRL A;  2K02 A;  3BR1 A;  4XID A;  5JVG F;  1BC8 C;  1Z21 A;  1FLI A;  3FMQ A;  4I6Z A;  1VQO I;  3ZMZ A;  2VOP A;  3QPH A;  2LRD A;  1WZ2 A;  4CXF A;  4RAY A;  2E1O A;  3HSE A;  3L2V A;  5AIP A;  3RSN A;  3I3L A;  5BPD A;  3A01 B;  4GYI A;  2JVG A;  2X51 A;  2E1M C;  3LSH A;  2ZXH A;  2LRE A;  2HI3 A;  3MD2 A;  4XKB A;  5DCM A;  1KZH A;  3I59 A;  3GF2 A;  2IA1 A;  3M1E A;  4CDG A;  1T33 A;  3OSG A;  3FF5 A;  1S9H A;  5D5V B;  2E1M B;  1FC3 A;  3JRG A;  2EV0 A;  1WHU A;  1V3F A;  2Z16 A;  3U1K A;  3AG3 H;  3G2B A;  4F52 A;  5HDK A;  3RQ4 A;  2DMT A;  4HSR A;  4B1R A;  2LC2 A;  5FKO A;  3CO6 C;  4KFC A;  1WI9 A;  4PJL A;  2R5Y A;  3CMY A;  4BXU A;  4HZF A;  3BDD A;  1I5Z A;  1OPC A;  2VT2 A;  1KYW A;  5LLQ A;  2ZCW A;  2ME6 A;  2K9S A;  2P6T A;  2WV0 A;  4E4H A;  4RM3 A;  3S3O A;  3LA3 A;  2KMU A;  3H3Z A;  2XRN A;  4JOM A;  4MO7 A;  2KJC A;  2R5Z A;  4A93 J;  3W2W A;  5LGU A;  2KZG A;  3BPV A;  3DPL C;  1R5I D;  1VQL I;  3R0J A;  2VL8 A;  4OIN F;  5JVT A;  2M87 A;  4FX4 A;  3KEY A;  2M45 A;  1R4N B;  5LBQ A;  2XAU A;  5H6R A;  5HVQ C;  5IY5 H;  1GVD A;  3H5R A;  4HG2 A;  4MTD A;  3J7Y J;  2IS2 A;  1MNM C;  1YYV A;  3BR2 A;  3GZ5 A;  4M3B A;  4XOT A;  3GCM A;  3IV5 A;  2V6E A;  2DYS H;  2LDU A;  3Q3S A;  3GFI A;  2IA2 A;  1QHG A;  1XPX A;  2K3P A;  1U3E M;  1MDM A;  1HXD A;  4CUG A;  2XIG A;  4JBA A;  2DK8 A;  1K61 A;  3NAR A;  4M3D A;  3IL2 A;  3L09 A;  4B8X A;  3A1Y A;  4NNJ A;  2XAF A;  4M3F A;  2A6H F;  2LK2 A;  2O6G E;  2LFB A;  1HW5 A;  5LHG A;  2E35 A;  2D1H A;  3S1Q J;  1D5Y A;  2AO9 A;  2NS0 A;  1LQ1 A;  4AD9 A;  4HNU A;  2X6Y A;  2OV7 A;  2HVR A;  4X6A J;  3LSJ A;  3HOY J;  1MBH A;  1V5F A;  1IXS B;  4TV7 A;  3LQR A;  4CYD A;  5EJC A;  5KHD A;  1XGM A;  4L5J A;  4JQF A;  4QLC U;  4IX7 A;  4IHX A;  2JA5 J;  1EJ9 A;  1O3R A;  3QRF F;  4A3J J;  1IN8 A;  1OYI A;  3DQV C;  1X1P A;  4M72 A;  1MBE A;  2UUZ A;  3NWS A;  4BKX A;  3EYI A;  1VZ0 A;  3Q0U A;  1P92 A;  1ZK8 A;  3HUG B;  2MAB A;  2W25 A;  3EUA A;  3OYB A;  2KJB A;  1VQ6 I;  1FP1 D;  1ACI A;  1HKT A;  2STT A;  1Y56 A;  4DQ2 A;  4I0B A;  1MH3 A;  2DMQ A;  1RI7 A;  2X0L A;  3VFZ A;  3WTV C;  1GDT A;  2Z33 A;  4BXX J;  2QLZ A;  1GV5 A;  2KIS A;  1NG6 A;  3L2Q A;  4ENM A;  1R49 A;  1ZQ3 P;  1JGG A;  4GGG A;  4XMY A;  3LSP A;  2H8R A;  1MMA A;  1TWC J;  5EYR A;  4ENK A;  3MZH A;  2R7Q A;  1BM9 A;  4BJ5 C;  3ZQH A;  1B6A A;  2HKO A;  2Z5U A;  2A6T A;  5M3F J;  2VJI A;  4IOA F;  1EH8 A;  1YJN I;  2FU4 A;  4D5C A;  2HS5 A;  1ETV A;  3FXR A;  1H8A C;  2RV8 A;  3BC8 A;  2X1D A;  1ULY A;  2W82 A;  1FOK A;  1K4T A;  3Q0V A;  1Z91 A;  1YIO A;  3OYA A;  1YX5 A;  5D5U B;  1TW2 A;  3CCM I;  1RES A;  3ZQ7 A;  9ANT A;  2VJ5 A;  2ESN A;  2DYR H;  4I7H A;  4EEF G;  1A6Q A;  1AOY A;  3L9F A;  1XMX A;  4I0A A;  2M34 A;  2PQ8 A;  1XTA A;  2VQH A;  2GIZ A;  1V54 H;  3OYD A;  3U21 A;  4A2U A;  5DCF A;  1W4M A;  3DV8 A;  2HQA A;  2BGC A;  2K9Q A;  2QKL B;  2V79 A;  3GLL A;  2OPT A;  2P0W A;  2DDB A;  2Z3Y A;  1ZN2 A;  2XF6 A;  4HQM A;  3SYT A;  2PJP A;  3KP4 A;  3OIP A;  2UWM A;  3LSG A;  2E19 A;  1AU7 A;  1UG2 A;  1H9G A;  2EFN A;  2PG4 A;  1LFB A;  4A3G J;  3J7A O;  2MLG A;  4G7H F;  2ZKZ A;  1RR8 C;  1XN7 A;  1B8I B;  3EDP A;  1RC9 A;  4C2M J;  4BE2 A;  4A6D A;  3M7G A;  4BDZ A;  2JA2 A;  3WTU C;  3FXM A;  5F27 A;  1UHS A;  1MBF A;  3E6M A;  1TWF J;  2ZJR F;  2M8G X;  3KZZ A;  4UNO A;  2E60 A;  1DPR A;  4IHW A;  2BBY A;  2W57 A;  1X3U A;  4XRF A;  3WE2 A;  1RKT A;  2R7R A;  3I56 I;  1S6L A;  1XSX A;  4C9Y A;  2WAD A;  1FTZ A;  4EM2 A;  2V9K A;  3TP0 A;  3ZQI A;  4ETS A;  2DXI A;  4R79 A;  1QVU A;  2ZJP F;  4NC7 A;  4BY1 J;  1Q1H A;  1FTT A;  1DU0 A;  4BQQ A;  3G3Z A;  2FSW A;  2RN7 A;  4ZH4 F;  2XAH A;  5IT3 A;  1X19 A;  3LA7 A;  4CCN A;  1L3L A;  3GEZ A;  3M4O J;  3D0S A;  5GAE J;  3W2A A;  4PZJ A;  4NC8 A;  2YU9 J;  2ZSH B;  4CIC A;  4YFN F;  2FMY A;  3KFW X;  5DV5 A;  3H35 A;  3TDU C;  2BEO A;  4BE1 A;  3GME A;  1PP7 U;  4F7Z A;  2DPU A;  4BEH B;  4AWX B;  1Z7L A;  1VQP I;  4F3Q A;  1HCR A;  2MD5 A;  1O3S A;  1WFX A;  3OYM A;  2XC7 A;  2HOE A;  5DS9 A;  4LLG F;  1SAU A;  1WPK A;  2V1N A;  1LFP A;  1SFK A;  2HU9 A;  1IN5 A;  1OIS A;  2GAU A;  4DZP A;  1D1A A;  4D5F A;  3P9K A;  2XF7 A;  1ZRE A;  3H1C A;  2KRC A;  2HOT A;  1GUU A;  1IV6 A;  1SFU A;  4YIF A;  3BG9 A;  2F5F A;  5M5X J;  3F21 A;  5H20 A;  2BY0 A;  1VFC A;  3O8H A;  2VKE A;  2D1V A;  1FYM A;  1IRZ A;  2R7D A;  3GZN B;  2LH9 A;  2R7U A;  2UXX A;  3I55 I;  3RYP A;  3JAM Z;  5IYD J;  1TBX A;  4IF4 A;  1K7A A;  1TL8 A;  1G4D A;  2MW8 A;  2O0Y A;  4E7H A;  1LEA A;  3L2U A;  2HVS A;  4ITV A;  4RB0 A;  2JK3 A;  3QOE A;  4KUM A;  3WGG A;  1BR4 A;  3FXU A;  2VUM J;  3K9T A;  4E6K G;  3H0G J;  1JHH A;  3DEE A;  4WXC A;  4BUP A;  3BJA A;  3F72 A;  3QOD A;  4I09 A;  3Q0W A;  4A0Y A;  1T0F C;  1LDD A;  2FBK A;  4ZZL A;  3HRS A;  1ZG5 A;  1U9N A;  4ESJ A;  1RRJ A;  1D1C A;  2WAE A;  2NVX J;  2LTP A;  2KQR A;  4RA2 A;  1FBQ A;  2VPR A;  1USS A;  2IBD A;  4FIS A;  2EZH A;  3B02 A;  3GTO J;  1WVR A;  2EA4 A;  1V5G A;  4V2F A;  5ILU A;  5D4S A;  1K6Y A;  3KPH A;  4RGU A;  1VQ9 I;  2K3F A;  5J8C A;  1D8K A;  4NQW B;  5IP7 J;  2IGO A;  3TDZ C;  4MLO A;  1LE8 B;  2JUG A;  3TW7 A;  2CQX A;  1T6S A;  2ZME C;  1ZYR F;  1W7P B;  3ZP5 A;  2FXA A;  3LOC A;  4XRS A;  1YE9 A;  1IJW C;  4Y3O A;  4A3D J;  1F4K A;  3LMM A;  4FAS D;  3DTE A;  2X4H A;  4BE0 A;  1HDP A;  2VBW A;  4L5I A;  2EH3 A;  2H6C A;  2IJL A;  1ZAR A;  4AU7 A;  3GWZ A;  2W1O A;  4UB6 C;  1EH7 A;  2ZFW A;  2ZME B;  3CP8 A;  3FXQ A;  2B63 J;  4N9I A;  3K1M A;  4NC6 A;  5DEQ A;  3BPX A;  3HXL A;  3IUO A;  4J19 A;  5LRS A;  4XON A;  2G0E A;  2GOM A;  4IRH A;  2V1X A;  4PCQ A;  2FX0 A;  2H94 A;  1Z6T A;  1ORK A;  3KE2 A;  1Y1W J;  1MW7 A;  1FNN A;  3GTL J;  1SC7 A;  2F5D A;  3M3Y J;  3PNY A;  3GTM J;  2CG4 A;  2W4S A;  3LNQ A;  2V9V A;  5FD5 A;  1YOV B;  5F1R A;  1AKH A;  2CJJ A;  5CQG A;  2BOL A;  4P55 A;  2HTJ A;  1WRJ A;  4B4C A;  3V7C A;  3KET A;  3S3N A;  2ZXW H;  1XSD A;  2AS5 F;  3SFZ A;  1QRY A;  3IAM 2;  4XLP F;  3OR2 C;  3X2Q H;  5L3F A;  2L7Z A;  2E5N A;  2L7K A;  3E1S A;  3ELK A;  3K4J A;  1FBS A;  2WWY A;  2LY9 A;  4QPQ A;  4D9J A;  2KPM A;  4BY7 J;  4IHT A;  2E1N A;  3H92 A;  3DEW A;  1FMV A;  4CYC B;  3CZ6 A;  3KYC B;  3HOU J;  2HOA A;  1HSJ A;  5BQT A;  1QQI A;  4K2E A;  2E1C A;  4ZDL A;  1J5Y A;  1G6N A;  4B48 A;  2WY8 Q;  4RLF A;  2MSY A;  1T0F A;  1LPQ A;  3FKJ A;  5FO5 A;  2OUM A;  1ENH A;  4Y13 A;  2XV4 S;  2DLL A;  1IDZ A;  4JX6 A;  3EUH C;  2HVQ A;  2LBF A;  2XB5 A;  4IRG A;  1YIT I;  2KDZ A;  5M3M J;  1Z3X A;  1MH4 A;  3C18 A;  3S16 J;  4ON0 A;  4MTE A;  2ADU A;  2QBY A;  3HKZ N;  3Q9S A;  3TOB A;  1G59 A;  4KA4 A;  4CCJ A;  3S8P A;  2V1D A;  4XM3 A;  1R00 A;  4C3J J;  3MMY B;  5ERI A;  1YS7 A;  3KP2 A;  3V7S A;  4WCG A;  2O61 A;  1X58 A;  5CVV A;  3H36 A;  5IT9 K;  3F8C A;  1K83 J;  5JLW A;  1T8I A;  5H6Q A;  5J1R A;  3H9G A;  4YEJ A;  1W0T A;  3BR6 A;  3S15 J;  4AYB N;  3CMA I;  1A04 A;  3D5L A;  1MIJ A;  1W5C C;  2HFH A;  3OR1 C;  1WQ2 A;  1YI2 I;  3WTX C;  5EZH A;  4U0Y A;  2XDV A;  5LD2 C;  4PUS A;  2EIK H;  1NG7 A;  3CLO A;  4A3I J;  4EJO A;  3U9G A;  3CCU I;  4U0V A;  2Y9Y A;  3RQI A;  3AL0 C;  2P6S A;  1ZH5 A;  1FEX A;  3BRO A;  3PSI A;  3PJR A;  2PJR A;  4PJN A;  2COM A;  3HJE A;  2HR3 A;  5HLH A;  1J7K A;  4E70 A;  5CKT A;  2EIN H;  2BY3 A;  2K85 A;  2L01 A;  1IV8 A;  2N8G A;  4IXA A;  4KN7 X;  3ABU A;  3KZI C;  3WU1 B;  4IQ4 A;  1P9Q C;  2AQE A;  1FOY A;  1KA8 A;  2BHZ A;  2HDW A;  4G6T B;  4QTR A;  2DQL A;  4YRV A;  3RIR A;  2XGE A;  2J5O A;  3BOQ A;  3RDI A;  4A3K J;  4Y15 A;  1ETO A;  3E6D A;  4CYC A;  4A3M J;  2DA3 A;  4MQ9 F;  3I71 A;  3PQJ A;  4ZYG A;  4S04 A;  4ZYE A;  1K78 B;  3ZMS A;  3QYE A;  5ICG A;  5D8L B;  3PUF A;  4AUX A;  4HST A;  2WA0 A;  5KAF C;  3PO3 J;  2GQQ A;  2Q1Z B;  1X3W B;  3BG6 A;  3ML6 A;  4XL9 A;  3GUD A;  1UHW A;  2RVC A;  1R22 A;  3DWL E;  2ZFU A;  2V9P A;  4WX9 A;  3L7W A;  3F0C A;  1I6X A;  3JRD A;  2GM4 A;  1LDJ A;  3FBN B;  1UFM A;  5K7F A;  1ETY A;  2KHM A;  2HXO A;  3KLN A;  4PJM A;  2ZNZ A;  3GX4 X;  2Y75 A;  5HLG A;  3VYS B;  2I5U A;  5KK1 A;  5ICE A;  3OYJ A;  3CCV I;  1FOX A;  1TWH J;  2I10 A;  1BIA A;  1QHH D;  3HM5 A;  3WG7 H;  5DCM B;  1PUE E;  3VB2 A;  2CW0 F;  2XPU A;  3SHF A;  3I59 B;  3K4B A;  5GP9 A;  1QGP A;  1SVM A;  2M2E A;  3FXK A;  5LFA A;  2XGD A;  4V2G A;  2R7T A;  1O3Q A;  2VBY A;  4F55 A;  2V6C A;  3KP7 A;  3FKI J;  2CWE A;  3PSF A;  4E7Z A;  2ZJQ F;  4GCV A;  2JJ7 A;  2JA7 J;  4UV8 A;  3BR0 A;  3TL4 X;  4KIC A;  4ENN A;  4DGW B;  3QOP A;  4N4N B;  3PIP F;  1YRN A;  2DMP A;  4KIF A;  3QU3 A;  4QIW N;  3CTA A;  1MD0 A;  2PFB A;  2M7A A;  1P4X A;  3MVP A;  1OYY A;  4XQF A;  1S3J A;  1W7P D;  4XIC A;  3CF2 A;  1IUY A;  1IZ1 A;  4KN4 X;  4AC0 A;  3OWT A;  2QQA A;  3FWE A;  3OYG A;  4OOI A;  1F43 A;  3KIO A;  1B72 A;  3WG9 A;  2VQC A;  1Y8Q B;  4XLE A;  5EF6 A;  4EV0 A;  2G7H A;  1F5T A;  3B6A A;  2M0C A;  1IGN A;  5E18 F;  3OY9 A;  3SXY A;  5GAG J;  1R1T A;  1Y0N A;  1UST A;  2Q0O A;  5D6F A;  3W6K B;  2PN6 A;  3BZ6 A;  3IC7 A;  5KCM A;  1VQ7 I;  2BVM A;  5CJ9 A;  1QZZ A;  5LRR A;  2MA3 A;  4M3G A;  4XRM A;  5TRD A;  2A07 F;  4UB8 C;  3R4K A;  4XLH A;  1WJA A;  1MDM B;  1ZR2 A;  2C6Y A;  3PUB A;  5E8I A;  1P7J A;  3S3M A;  5B3S H;  3BG5 A;  3H5N A;  3TOA A;  2KIQ A;  2F48 A;  3G4S I;  1IRG A;  2E2J J;  1JT6 A;  2BXY A;  1D8J A;  5CVJ A;  3S14 J;  2HPI A;  2M3A A;  3RPQ A;  2IS6 A;  1XMA A;  3MKY B;  3K10 A;  4M6X A;  1SEU A;  2L0K A;  4HEA 2;  5F1J A;  3OYL A;  2CO5 A;  1LUJ B;  1UJ8 A;  4BYY A;  2XAQ A;  5J47 A;  1SFX A;  3CES A;  1LNW A;  3ZMV A;  1U78 A;  2ZSI B;  2L4M A;  2ESH A;  5L3D A;  2VQG A;  1KQ8 A;  2DOE A;  5BMZ A;  3T0Y A;  4RGS A;  5K7H A;  2R92 J;  2XUB A;  4NUB A;  1SD7 A;  1Z3Y A;  3VSL A;  1D1B A;  5EEA A;  1A31 A;  3DTI A;  4NB5 A;  4NDL A;  3NRV A;  4M9Z A;  3DPU A;  3QQA A;  3UNG C;  2PI0 A;  2EK5 A;  1FJL A;  2STW A;  2RQQ A;  3HGY A;  5J4V A;  4A3F J;  3AG2 H;  3K69 A;  1Y6I A;  4ZTJ A;  2CQ7 A;  5A2Q K;  2ISY A;  1WKM A;  1T39 A;  1QU3 A;  1D5V A;  3MKZ A;  3G6E I;  5LEK A;  1ZLJ A;  1WSU A;  3CO7 C;  1I27 A;  4LFU A;  4NBQ A;  2EFP A;  2Y0M A;  3IH4 A;  4KMF A;  3DP7 A;  2HNH A;  2F5C A;  1O3T A;  2ZJ2 A;  4E7L A;  2O9L A;  4YEL A;  2AXL A;  3O2P E;  2ID3 A;  4HNT A;  3IWF A;  4BAC A;  1EF4 A;  2CUZ A;  3WU2 C;  2KIF A;  1A35 A;  1YG2 A;  5C4X J;  1E17 A;  1U5T C;  4L9N A;  4ZTF A;  1R9T J;  3I4P A;  2K4B A;  5H2F C;  4AVP A;  2HTS A;  4L9J A;  1APL C;  2XB0 X;  4RGR A;  2M7B A;  1YS6 A;  2RDP A;  5DM6 F;  4F91 B;  4L18 B;  1BI3 A;  2JT1 A;  3MQ0 A;  4ESB A;  4LB5 A;  2KDO A;  3KZY A;  5DDG A;  1MBG A;  1P2F A;  2E36 A;  5DUK A;  1U5T B;  4N4O B;  2VN2 A;  3O8G A;  3IKV A;  3QP6 A;  1WJB A;  2FBH A;  3WE3 A;  4IHV A;  2G7U A;  3ABK H;  1E2X A;  2Y2Z A;  4OU0 A;  4P1W A;  3REO A;  4S0H B;  4Z6Y A;  1X2M A;  2EZI A;  2FRH A;  2IGK A;  1S5L C;  3KP6 A;  4HA8 A;  4MFD A;  4KDP A;  2VC1 A;  2TCT A;  3FMS A;  1MKM A;  2BE5 F;  2WTE A;  3I54 A;  4GYG A;  1JKP C;  2XPW A;  2H1L A;  4B47 A;  1N78 A;  1PUF A;  3TO7 A;  1R5G A;  2LR8 A;  4KNY A;  1HOM A;  4LOC A;  4PK4 A;  4B44 A;  3CCY A;  1I3Q J;  3BCB A;  3L2C A;  1BBY A;  4HV6 A;  4IHY A;  1E0E A;  3S17 J;  3K4C A;  3GTJ J;  5GTI C;  3LAP A;  1I50 J;  1XS9 A;  4HDV A;  2L9V A;  3CC2 I;  1OMI A;  4XNF A;  3FDY A;  3KX2 A;  1H89 C;  5GAH J;  1IF1 A;  2CFX A;  4FTH A;  4LLL A;  2NOJ B;  2JSC A;  1DDN A;  2X6O A;  2CW8 A;  2F6C A;  4GXO A;  2LKP A;  2NS8 A;  3KYL A;  5E17 F;  2YSR A;  2QGU A;  1FYL A;  4R8H A;  4AIK A;  3HRT A;  3OYI A;  1V55 H;  2UXN A;  1ODD A;  3BG7 A;  2HWV A;  3E0J B;  4A5N A;  2DT5 A;  2RQP A;  1E3P A;  2KT0 A;  4LIV A;  4RS8 A;  2BY1 A;  1XG1 A;  2M4K A;  2A5Y B;  3OYK A;  1QNT A;  1GT0 C;  1R6R A;  5E3L A;  4BS9 A;  3GFL A;  3KP3 A;  1R7J A;  2NVU B;  3SEZ A;  2BY2 A;  1YW7 A;  2B7E A;  5FB2 A;  1GV2 A;  2VON A;  1I1G A;  3RPU A;  1X4O A;  4FET A;  5FLM J;  5FRM A;  5JLX A;  2VXD A;  3ECH A;  3I58 A;  1FYK A;  3G1O A;  3BWG A;  3VYR B;  1DQU A;  2MH2 A;  2Y31 A;  1LEB A;  1YHQ I;  3ZMD A;  3RKQ A;  2R7S A;  1TQI A;  1U5T A;  1VI0 A;  3BTJ A;  3HKZ A;  2BVL A;  2WC2 A;  4DNC A;  1OYW A;  2RRE A;  3TO9 A;  4OIP F; 
#chains in the Genus database with same CATH homology
 4XRS A;  1IJW C;  1RET A;  1IDY A;  3IH3 A;  4M3E A;  1IG7 A;  4A3D J;  2ECC A;  1RPW A;  2HQ5 A;  2QF7 A;  3HB9 A;  1HDP A;  3G1L A;  2EH3 A;  1WH5 A;  5FKL A;  3PO2 J;  2L7F P;  2B63 J;  1NK3 P;  2RAE A;  5GPC A;  3HOZ J;  4J19 A;  2AHQ A;  4W97 A;  2G0E A;  2YUS A;  3K2A A;  2FX0 A;  1ORK A;  2JMW A;  1Y1W J;  3I4M J;  3GTL J;  2NOG A;  1BL0 A;  2GLO A;  3M3Y J;  2GBY A;  3GTM J;  2DJN A;  1T56 A;  2XGC A;  3LNQ A;  5C44 J;  1O4X A;  1AKH A;  2CJJ A;  2PMZ N;  3SFI A;  1IUF A;  1X2N A;  1ZTR A;  3RZD J;  4JX4 A;  4JX5 A;  4IEJ A;  2HDD A;  3ZQC A;  4B4C A;  4A69 C;  4C3I J;  1QRY A;  4XK4 A;  1MSE C;  2EZL A;  2L7Z A;  1FIP A;  3L1P A;  5EZG A;  2LY9 A;  5M5Y J;  4BY7 J;  3BQZ A;  5F0F A;  5E3M A;  3GBG A;  3DEW A;  5E3O A;  4CYC B;  3S1N J;  2MGQ A;  5FKN A;  2NVQ J;  3GTQ J;  3HOU J;  3VPR A;  1WI3 A;  3OIO A;  2EBI A;  2HOA A;  5IYB J;  2R5Y B;  2MSY A;  2E2I J;  4C3H J;  2Y0S N;  1ENH A;  1IDZ A;  3G1M A;  5IOZ A;  4JX6 A;  5M5W J;  1QVT A;  2XB5 A;  3A01 A;  3BT9 A;  2P81 A;  2CRG A;  3JRA A;  2KDZ A;  5M3M J;  3BG3 A;  1MH4 A;  3ZOB A;  2R5Z B;  3S16 J;  3FIW A;  5HOD A;  2W48 A;  5EGO B;  3HKZ N;  1AKH B;  2DMU A;  1SFO J;  5IYC J;  2CQQ A;  4RDU A;  2COB A;  4C3J J;  3C2B A;  1ZKG A;  1X58 A;  2X9D A;  3OSF A;  1NTC A;  1Z77 A;  1K83 J;  1BW6 A;  3MKL A;  5JLW A;  3GTG J;  1E3O C;  1ZGW A;  3JRE A;  1A6I A;  5J1R A;  2IAI A;  1Y1V J;  2LVS A;  3JRH A;  1W0T A;  3S2D J;  3BR6 A;  1P7I A;  3QPS A;  3S15 J;  3A02 A;  4QSH A;  4AYB N;  4BBR J;  1JKR C;  3BTC A;  2LLK A;  3HOW J;  1ETK A;  2XRL A;  3BR1 A;  5EZH A;  1WH7 A;  4XID A;  1G2H A;  4MIM A;  5E3N A;  4I6Z A;  1ETQ A;  4A3I J;  1AHD P;  2Y9Y A;  3RQI A;  1U9O A;  2E1O A;  4DYC A;  1QPI A;  1ITY A;  1BW5 A;  1FEX A;  3DCF A;  1MBK A;  3HOV J;  3A01 B;  4A3B J;  4XRS G;  2HI3 A;  2N8G A;  2O8K A;  2NS7 A;  2WAQ N;  2FQ4 A;  1ETX A;  4QTR A;  1T33 A;  3OSG A;  1HF0 A;  2XGE A;  3JRG A;  4A3K J;  4B1R A;  2DMT A;  1ETO A;  4CYC A;  2OF7 A;  4A3M J;  5FKO A;  2DA3 A;  2R5Y A;  3CMY A;  4HNV A;  1JJ6 C;  4DYQ A;  4RBO A;  4AUX A;  1XC5 A;  5FKK A;  2WV1 A;  5C3E J;  3PO3 J;  3GTK J;  1POG A;  3BR5 A;  2ME6 A;  3GTP J;  1HLV A;  1BA5 A;  2K9S A;  2CUE A;  2L7M P;  3F0C A;  3JRD A;  2GM4 A;  5K7F A;  3HEF A;  1ETY A;  4JYK A;  5IP9 J;  2HXO A;  4MO7 A;  2R5Z A;  1JUM A;  4A93 J;  1WGX A;  5EGO A;  3H3V K;  1JKQ C;  4DZJ A;  4ABZ A;  5F04 A;  2HOS A;  1JUS A;  1JUP A;  1TWH J;  2I10 A;  3HM5 A;  1CQT A;  4L5E A;  2XPU A;  2ECB A;  1GVD A;  5FJ8 J;  1NK2 P;  5IOY A;  2DA6 A;  5GP9 A;  1MNM C;  3BR2 A;  4M3B A;  3IV5 A;  2M2E A;  2XGD A;  4V2G A;  2R93 J;  3Q3S A;  3QPL A;  2CUF A;  5C4J J;  2FJ1 A;  3A03 A;  3FKI J;  1A5J A;  3ZQL A;  1JTY A;  2JJ7 A;  1ETW A;  3BR3 A;  2JA7 J;  3BR0 A;  1K61 A;  3NAR A;  4M3D A;  3TP3 A;  4MFE A;  1YRN A;  2DMP A;  4M3F A;  2LK2 A;  3IH2 A;  2LFB A;  2O7O A;  4QIW N;  1VND A;  5EDN A;  3S1Q J;  2ID6 A;  3JRI A;  1D5Y A;  1RR7 A;  3I4N J;  2AO9 A;  3MVP A;  5EG0 A;  4X6A J;  3LSJ A;  3HOY J;  2H1K A;  1MBH A;  3BQY A;  4XIC A;  1OCT C;  4GFB A;  1TWA J;  3FIS A;  2JWT A;  3FK6 A;  1UMQ A;  4AC0 A;  5F08 A;  5FKM A;  1JTX A;  4IHX A;  2JA5 J;  2VKV A;  1F43 A;  1B72 A;  2DN0 A;  3JRC A;  5EF6 A;  4UUS A;  3ZQF A;  4A3J J;  3B6A A;  2M0C A;  5DTD A;  1IGN A;  1MBE A;  2M9H A;  2ZB9 A;  4BKX A;  3Q0U A;  1ZK8 A;  5F0C A;  3CDL A;  1Z0X A;  3S2H J;  1MH3 A;  4FE4 A;  2DMQ A;  4M3G A;  4XRM A;  2LD5 A;  1GDT A;  4BXX J;  1GV5 A;  1ZR2 A;  3LSR A;  1ZQ3 P;  1P7J A;  3BG5 A;  1JGG A;  3LSP A;  1HDD C;  1YRN B;  3D1N I;  1TWC J;  1B8I A;  5EYR A;  1JT6 A;  2E2J J;  2H8R A;  4A3C J;  4Y52 J;  3ZQH A;  3S14 J;  1OJL A;  2DA5 A;  5M3F J;  3OOU A;  1JKO C;  2E2H J;  5FLV A;  4D5C A;  5J3L A;  1ETV A;  2L0K A;  2DMN A;  1H8A C;  3B6C A;  5F1J A;  5EG0 B;  4M6V A;  3HDD A;  3Q0V A;  5J1Y A;  3TW6 A;  4A3L J;  1RES A;  4D7M A;  1U78 A;  9ANT A;  3SDG A;  4BBS J;  2DA1 A;  4G12 A;  1B72 B;  2XPV A;  4EEF G;  4D7N A;  5K7H A;  2LP0 A;  1JT0 A;  2R92 J;  4UUS B;  1ZR4 A;  3S1R J;  2K40 A;  2M34 A;  2CU7 A;  5EEA A;  4A3E J;  4DW6 A;  3TED A;  4NDL A;  3QQA A;  1FJL A;  3HGY A;  5GPA A;  4A3F J;  2X48 A;  2IEK A;  2K9Q A;  2L9R A;  2JA8 J;  2OPT A;  1SAN A;  2LKX A;  3LSG A;  2E19 A;  1AU7 A;  1UG2 A;  1LFB A;  4A3G J;  2FD5 A;  2YS9 A;  1B8I B;  2K9N A;  4C2M J;  1DU6 A;  3PM1 A;  4X1E A;  3IH4 A;  3WHC A;  5F27 A;  1UHS A;  1MBF A;  1I6H J;  1TWF J;  1IC8 A;  2M8G X;  4Y7N J;  2O9L A;  2ID3 A;  4I76 A;  4IHW A;  1EF4 A;  1RKT A;  1FTZ A;  5C4X J;  4FCY A;  2HYJ A;  3TP0 A;  1R9T J;  3ZQI A;  3WHB A;  1QVU A;  2QCO A;  4BY1 J;  1APL C;  2XB0 X;  1DU0 A;  1FTT A;  2D5V A;  1MBG A;  3M4O J;  3K7A J;  2YU9 J;  3O8G A;  1VF9 A;  2DTZ A;  2MG4 A;  2JN6 A;  2DA4 A;  4IHV A;  2R7Z J;  2Y2Z A;  4S0H B;  3HGG A;  3S1M J;  1X2M A;  2EZI A;  1S7E A;  2VI6 A;  4MFD A;  1HCR A;  2TCT A;  2R0Q C;  5DS9 A;  1TWG J;  5K7Z A;  1BJZ A;  1MSF C;  1WPK A;  3CQZ J;  3ZQG A;  1LFU P;  1JKP C;  2XPW A;  4DZP A;  1PUF A;  4D5F A;  2LR8 A;  5IP6 A;  2HOT A;  5IPA A;  1GUU A;  1IV6 A;  1HOM A;  3BG9 A;  4LOC A;  5M5X J;  3BTL A;  3E7L A;  3CCY A;  3O8H A;  2VKE A;  1VFC A;  1I3Q J;  4FE7 A;  5J1U A;  1IRZ A;  1MBJ A;  4IHY A;  2Y30 A;  3S17 J;  3MN2 A;  3W6V A;  3GTJ J;  1JJ8 C;  1I50 J;  1XS9 A;  4W1U A;  2ELK A;  5IYD J;  1FIA A;  1LE8 A;  3JR9 A;  1H89 C;  3JRB A;  1H88 C;  4FTH A;  2MW8 A;  2NVY J;  3HBL A;  1OFC X;  2X6O A;  3JRF A;  2NS8 A;  1WCM J;  1Q1V A;  2JK3 A;  4DYR A;  2VUM J;  4B3A A;  3H0G J;  2TRT A;  4UUT A;  2HXI A;  3Q0W A;  2EQR A;  3RZO J;  1RKW A;  2JA6 J;  2KT0 A;  1F36 A;  1XG1 A;  1U9N A;  3NAU A;  1GT0 C;  5E3L A;  2NVX J;  2LTP A;  2Y9Z A;  3HOX J;  2EZK A;  2VPR A;  2IBD A;  5BNG A;  5F0H A;  3FK7 A;  4FIS A;  3SJM A;  1U8B A;  1PUF B;  2EZH A;  2XSD C;  1GV2 A;  3BTI A;  2ME0 A;  3GTO J;  4V2F A;  5FLM J;  5JLX A;  1W0U A;  3UKG A;  3G1O A;  2DA2 A;  1TC3 C;  5IP7 J;  2Y31 A;  2WB1 N;  4MLO A;  4JP0 A;  3RKQ A;  1VI0 A;  1LE8 B;  3BTJ A;  3TW7 A;  2NVT J;  2CQX A;  1OCP A;  2DA7 A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...