2YU9J

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yu9J00
3BT9A 3TP0A 1BL0A 5E3LA 4FTHA 3HKZN 4M3DA 2M9HA 1IGNA 3LSRA 2QF7A 4A3LJ 1RETA 2R5ZB 1BA5A 4CYCB 2ID3A 2XRLA 1JTXA 5DTDA 5IYDJ 1JUPA 1WPKA 5C3EJ 2H1KA 1PUFB 2JMWA 1NK2P 4A3IJ 2WB1N 5FLMJ 1POGA 2HXOA 3OOUA 2DA5A 3Q3SA 1SFOJ 1WGXA 1MNMC 1O4XA 2R0QC 3S17J 1WH5A 1YRNB 2I10A 2XGCA 2M2EA 1Y1WJ 2AO9A 4UUSA 4XRMA 3H3VK 3TW7A 1HOMA 1P7IA 2O8KA 1HDPA 2LK2A 4A3GJ 1B8IA 4GFBA 2Y30A 3RQIA 4B3AA 2MG4A 4A69C 2E2IJ 4RDUA 1GDTA 2Y0SN 2XGEA 1IUFA 1ENHA 1E3OC 4QTRA 2CUFA 1WH7A 3FIWA 4M3EA 5IP6A 1VNDA 3IH2A 3B6CA 2DMNA 3K2AA 1JKRC 4IHVA 5J1YA 1B8IB 4BKXA 2LKXA 5M3FJ 1TC3C 2NVXJ 3S1RJ 3ZOBA 4L5EA 1ETWA 2YUSA 1ETXA 2O9LA 1X58A 1CQTA 2X9DA 3HGGA 3ZQCA 1JJ6C 1MH4A 5BNGA 1EF4A 3PO2J 1T56A 3M4OJ 1LFBA 1ZQ3P 5FKKA 1LE8A 5M5XJ 1RKTA 2L7ZA 4C3JJ 2HQ5A 1AU7A 4RBOA 1W0TA 1P7JA 1BW6A 3GTKJ 2GBYA 3BTLA 4I76A 4XICA 4X6AJ 2ID6A 3A02A 2OF7A 4BY1J 1ETQA 2E1OA 3HOXJ 4X1EA 1U9NA 4Y52J 3O8HA 2L0KA 5IYCJ 3A03A 3OIOA 2DA7A 2Y9YA 3JRIA 3VPRA 1TWHJ 4FE7A 2ECBA 2HOAA 2JA5J 1BJZA 4BBRJ 4EEFG 2MGQA 2GLOA 4LOCA 3BTCA 5EZGA 3ZQGA 1IV6A 2HYJA 2M34A 2DMQA 2FJ1A 2E2JJ 2DN0A 2R5YB 2X6OA 4W1UA 2JA7J 4QSHA 5EGOA 3CMYA 4NDLA 3LSPA 3BR2A 4DYQA 1MBFA 5HODA 3W6VA 2IAIA 5FKOA 2R93J 4C2MJ 2M0CA 4DZJA 2R5YA 2L7FP 3JRCA 1ETKA 1A5JA 4FCYA 5JLXA 2W48A 1K61A 3CQZJ 3BTJA 3JR9A 4A3KJ 1JKOC 4A3EJ 2NVQJ 1IRZA 2CRGA 2E2HJ 2HOTA 3LOCA 1FIPA 3PM1A 2QCOA 1DU6A 2EZLA 4B1RA 1VI0A 3BR0A 3JRGA 3GTOJ 4J19A 5F1JA 2ECCA 2Y31A 5K7ZA 3QQAA 5F08A 1MBHA 5EDNA 4JX6A 1QRYA 3LSGA 4HNVA 3JRHA 1ZR2A 5C44J 2HOSA 4CYCA 3ZQLA 2DA6A 2XPWA 4BBSJ 2AHQA 5EEAA 1UHSA 1X2MA 4B4CA 2Y2ZA 5EG0B 2RAEA 2FX0A 1RESA 1JJ8C 1X2NA 5GPCA 3JRDA 5J1UA 2XGDA 1IDYA 3IH3A 1ETYA 2CJJA 4XK4A 4JYKA 1OFCX 1YRNA 3G1LA 4FE4A 4UUSB 1QPIA 2VUMJ 2M8GX 2VI6A 3BQYA 2K9QA 3TEDA 3QPSA 1ETVA 1UG2A 5K7FA 1OCTC 3S2DJ 1FTZA 2X48A 1VF9A 4JP0A 4UUTA 3CCYA 1GUUA 1AKHA 5FKNA 3DEWA 1JT6A 1F36A 1APLC 3FISA 4A3FJ 4DW6A 1Q1VA 5K7HA 4C3HJ 1JKPC 1JUSA 2EZIA 3L1PA 9ANTA 2B63J 3LNQA 3Q0UA 1W0UA 2NS7A 2DTZA 2FD5A 4M3GA 5IPAA 3Q0VA 4MFEA 3G1MA 1ZKGA 2XPUA 1MBEA 3HOVJ 3S15J 2JN6A 3S2HJ 3H0GJ 3HOWJ 1ORKA 2GM4A 1FIAA 4DZPA 2LFBA 2HDDA 3S1MJ 3OSGA 3IH4A 4D7MA 3FK7A 2DMTA 3GTGJ 5C4XJ 4AC0A 4BY7J 3E7LA 1I50J 3DCFA 2LTPA 1JTYA 1MBGA 3QPLA 1T33A 1Y1VJ 3GTLJ 1NTCA 1QVTA 1TWCJ 1GVDA 1AHDP 1MBKA 3MKLA 1Z77A 3S1QJ 3I4NJ 3LSJA 1JUMA 4XIDA 2CQQA 1R9TJ 2XB0X 3FKIJ 3M3YJ 1XG1A 4IHYA 1I6HJ 1OCPA 5EYRA 1U9OA 5IOYA 2EZKA 4A3JJ 3F0CA 4MLOA 2EQRA 2IEKA 4Y7NJ 1WI3A 3S16J 3ZQHA 4A3CJ 2D5VA 1GV5A 2TRTA 2NVTJ 1RPWA 3I4MJ 2HXIA 2MW8A 1NK3P 2ME6A 5FKMA 5EGOB 5FKLA 1B72A 1ZK8A 5E3MA 5GP9A 4AUXA 5GPAA 1U78A 3BG9A 3Q0WA 3JRFA 3HB9A 1IC8A 5EF6A 1K83J 4D5CA 5IYBJ 2YS9A 3SJMA 3JREA 1JKQC 2R92J 2G0EA 3SDGA 2H8RA 1HF0A 2EH3A 2LD5A 4M3FA 1XC5A 2E19A 3D1NI 2DMPA 5F0FA 1H89C 3RZOJ 3BR3A 3NARA 3ZQIA 1TWAJ 5JLWA 5IP7J 5E3OA 2IBDA 4V2GA 5EZHA 2OPTA 3MN2A 1SANA 2LP0A 3S1NJ 3BR6A 2VPRA 2O7OA 1GT0C 2JJ7A 3G1OA 5FLVA 4G12A 4AYBN 4A93J 1MSEC 4QIWN 5EG0A 5F04A 2CQXA 3UKGA 2JA6J 2JWTA 2JK3A 2TCTA 5M3MJ 3GTMJ 3RZDJ 2DA3A 2LY9A 1RKWA 4DYRA 4MO7A 2NVYJ 4ABZA 1IJWC 1H88C 3HBLA 3JRAA 1MH3A 4C3IJ 1OJLA 1XS9A 3RKQA 3ZQFA 4D7NA 1ETOA 2EZHA 4MFDA 2K9NA 2LLKA 1AKHB 3WHCA 2XB5A 1HLVA 2L9RA 5F0HA 3MVPA 1H8AC 3CDLA 3HOYJ 5F27A 3HOZJ 5IOZA 1FTTA 3WHBA 2WV1A 4M3BA 2DMUA 4M6VA 1TWFJ 2DJNA 3IV5A 5C4JJ 1QVUA 2YU9J 1MBJA 4XRSA 1LE8B 4A3DJ 5FJ8J 3S14J 2EBIA 2KDZA 1F43A 2K9SA 3C2BA 3GBGA 3GTQJ 3BR5A 1HDDC 2JA8J 2XPVA 3HGYA 2COBA 4A3BJ 1WCMJ 3GTPJ 3JRBA 4I6ZA 3BQZA 2DA2A 1S7EA 2ELKA 2VKEA 4JX5A 5J1RA 1RR7A 2MSYA 2N8GA 1UMQA 5IP9J 3GTJJ 4FISA 1LFUP 2DA4A 3HDDA 4JX4A 4IHWA 1GV2A 2HI3A 2NS8A 2R7ZJ 5M5WJ 3K7AJ 2CUEA 4V2FA 2FQ4A 1U8BA 3OSFA 4DYCA 3HEFA 2P81A 2KT0A 3BTIA 1FJLA 2PMZN 2ME0A 4XRSG 1D5YA 1HCRA 5M5YJ 5J3LA 1DU0A 2NOGA 3HOUJ 1BW5A 2WAQN 1ITYA 1JT0A 2L7MP 3TP3A 4S0HB 1ZGWA 4IHXA 5DS9A 2CU7A 3BG3A 2LR8A 3BG5A 1A6IA 1VFCA 3TW6A 1B72B 3SFIA 1I3QJ 4IEJA 2LVSA 1ZR4A 3PO3J 3A01B 4D5FA 4W97A 1MSFC 1G2HA 3O8GA 3HM5A 1IG7A 1FEXA 2ZB9A 4A3MJ 3NAUA 3B6AA 3BR1A 2XSDC 1TWGJ 2VKVA 5F0CA 1ZTRA 2Y9ZA 2DA1A 3A01A 3FK6A 2R5ZA 2K40A 5E3NA 4MIMA 1IDZA 1JGGA 1PUFA 4BXXJ 1Z0XA
chains in the Genus database with same CATH superfamily
4RGXA 4F55A 3LSMA 4FTHA 3HKZN 4WCGA 4M3DA 1I1GA 2MFZA 4L9NA 2QF7A 1BA5A 5GAGJ 4CYCB 2XRLA 1JTXA 3SXYA 1DP7P 1JUPA 2JPCA 2JMWA 1NK2P 4A3IJ 4C2UA 5FLMJ 1ZG5A 2LREA 3V42A 1POGA 2QUFA 2DA5A 3DU6A 3CMAI 3B02A 3CLOA 1D1CA 2YPRA 2BHYA 2FBHA 1LUJB 1IN4A 2BW3B 3BZ6A 4KMUX 5ED4A 4J00A 1YRNB 2J5PA 3ZR8X 3H36A 4XRMA 2V1UA 3F23A 2DFFA 1YITI 3ZN0A 2K3PA 4UVAA 1HDPA 1B8IA 4GFBA 2A61A 5FLXK 1QHHD 2MG4A 2K02A 2Y0SN 3Q9SA 2XGEA 2NS0A 4QTRA 3U21A 2KP6A 1FP2A 4E6KG 5HDGA 2PX9A 1BI1A 2ESHA 1BJAA 3K2AA 4BKXA 5JFRA 2H6BA 3FXJA 2NVXJ 3ZOBA 3E5UA 3P5JA 3IRRA 4NHJA 4RGRA 1WJEA 2O9LA 1ETXA 1DDNA 4BJTA 1JJ6C 1VTNC 1V4RA 3QP6A 3PO2J 1EF4A 5DEQA 4RGUA 4M74A 1ZQ3P 5FKKA 4LJZF 1RKTA 4C3JJ 5EJCA 3J81Z 2DPDA 2CQ7A 4I76A 1BIBA 3WG7H 5CLSA 1BI2A 3KP2A 2OF7A 3LQQA 5D8LB 4BY1J 2EIKH 3HJEA 5B1BH 1USSA 2PG4A 2CV2A 3O2PE 4OIRF 4RAGA 3H1CA 3OIPA 4BGDA 3HTSB 2ZCWA 2F48A 2BY1A 4IRHA 4A6DA 3V8KA 2A6HF 3E3VA 5DUKA 1R00A 4ZTFA 1V55H 4U88A 2HOAA 4BBRJ 3I56I 3WU1B 4LOCA 2RNJA 3A1YA 3U9GA 1PJRA 4UNOA 2HYJA 1WRJA 2E2JJ 2DN0A 1JI8A 2R5YB 2X6OA 3DKWA 2ADUA 3VSLA 4HF1A 2PN6A 1DGWY 4W1UA 5L3CA 1T39A 4QSHA 2RQQA 5D5VB 4LG0A 1GLNA 2L5QA 2LC2A 2KL4A 1OYIA 2ZNYA 3G3ZA 2W82A 3MQ0A 3W6VA 2IAIA 4WK8F 1YW8A 4F52A 2B9SA 2VODA 2M0CA 2FNPA 4DZJA 1IXRC 2L7FP 1HKQA 3MKYB 2VQGA 2J5OA 2HZDA 2L4MA 4FCYA 2W48A 3R0JA 1K61A 5AIPA 2DK8A 1FC3A 1T0FA 3BTJA 2GQQA 2Q0OA 3QU3A 3QYFA 3WGHA 4A3KJ 4YIIA 2NVQJ 2XAHA 1MIJA 3RYPA 1O3TA 2CFXA 4BE0A 3WTTC 1JHHA 4AM3A 5JR3A 3QWLA 3EYIA 4HA8A 4LIVA 3H5AA 2RN7A 1O7FA 3BR0A 4D1QA 3DEEA 3KCCA 2IGOA 3OOPA 1YE9A 5F1RA 2WB1A 5K7ZA 3QQAA 2GAUA 4HLYA 1MBHA 4JX6A 1Y39A 2A6EF 1JE8A 1IAWA 4IF4A 3ZCOA 2Z3YA 3GVAA 3PSIA 2K3FA 3BPVA 4HQMA 2DA6A 4JQFA 2OCEA 4KN7X 3PJRA 4BQQA 1UFMA 5EG0B 1QGPA 1X2NA 2ZJPF 5GPCA 4HSRA 5J1UA 4EM1A 1TW3A 1T0FC 1YG2A 2F4OB 3TKYA 5HLTA 2E36A 4JYKA 3K4NA 4Q5SF 2BE5F 2EA4A 1S3JA 2XAGA 2VUMJ 3ASNH 1U5TC 2M8GX 3BQYA 4P5OA 1VZ0A 4IQ4A 2EFWA 1UG2A 4BXUA 3S2DJ 2VQHA 5DCFA 3GO5A 1F9NA 4UUTA 3CCYA 2Z33A 1GUUA 5L3GA 2JSCA 3KFWX 2O3FA 3ZPLA 1IRFA 3PIPF 1JT6A 3RPUA 4AU7A 4L9JA 4KA4A 3RI4A 4A3FJ 1K79A 4DW6A 1T95A 2HR3A 1S5LC 4LK1F 5K7HA 1XGMA 3L1PA 2B63J 4KJZA 4G6QA 4RA2A 3W2VA 3S3MA 2CSOA 2VL8A 1D8JA 4M3GA 5IPAA 2QSHX 3ERED 1J2XA 2XPUA 2PI0A 3H0GJ 4E4HA 2R7UA 3HOWJ 3DBHB 3HUGB 1FX7A 2LFBA 2HDDA 3HXLA 3FK7A 4RLFA 2HQAA 1HC8A 2Y48A 4AC0A 3OYBA 4BXFA 1XCVA 1R5HA 2OQGA 4Y33A 1WVRA 1MDMB 2AXLA 4M73A 1M1EB 3GTLJ 3ULQB 1TWCJ 2V1DA 4ESFA 2CMPA 3KP7A 5HLHA 4PJJA 3LSJA 1KU7A 1JUMA 4CCLA 3CMMA 2CQQA 1R58A 1S8NA 1TQIA 3FZVA 1XG1A 2F4MB 2X6YA 2LRDA 2DOAA 2KFDA 5EYRA 1X4PA 3KZYA 1XB4A 2A68F 3F0CA 3I54A 5LHGA 4RLQA 1SAUA 2KRHA 3S16J 3MZYA 5ILVA 3F8MA 2D5VA 3BG6A 4XSZF 4E7IA 1GV5A 4IO9F 4GRIA 1MW7A 1X3ZB 3KZZA 2E71A 1BBYA 1J7KA 1D1AA 4EJVA 1QA6A 2VB6A 5FKMA 2ISZA 3OYLA 2G7HA 1ZK8A 4UB6C 3L9FA 1YHQI 5GPAA 1YTYA 3M1CA 4HDVA 4E70A 4XKCA 1D0XA 2LH9A 4GDFA 1YLFA 4ZDOA 1B1BA 1IC8A 5CVJA 4XN3A 1PYVA 4F93B 4BE2A 1K83J 2XRNA 4D5CA 4U0YA 2VXZA 3OL4A 1ZRCA 3SJMA 4FQGA 1S29A 1HF0A 3W2WA 4ENMA 1MMSA 2LKPA 1J0RA 2Q2EA 2DDAA 3ABMH 2DMPA 5F0FA 2P5VA 4BYYA 1H89C 1YJNI 3RZOJ 2OZ6A 3WU2C 4XLPF 3BR3A 3GXOA 3NARA 4P96A 1TWAJ 2RV8A 3V7RA 2CUZA 3LSTA 5EZHA 2KISA 3DTEA 4CYDA 2WV0A 1SANA 1OYWA 4HZFA 2QKLB 2A69F 2NNYA 2HVRA 1ZH5A 3BCBA 3OL3A 4XRFA 2WAEA 4OIOF 2QSGX 1ZG3A 2KZVA 1T2KA 4XLCA 3W6KB 1IO2A 4XN0A 2ZC2A 2EINH 1TQMA 3R6SA 3GTMJ 2M45A 5HLIA 2E7WA 5H2FC 1CF7A 3BROA 4KNYA 3SZPA 1X1BA 2D2WA 2L7KA 4ZDPA 1XS9A 5B5EC 4UB8C 2G9WA 4HV6A 4MNUA 1SFEA 1XN7A 4MFDA 2QENA 5HS9A 3CUQA 1LFPA 3TQNA 3V7SA 3WHCA 2XB5A 2H6CA 5F0HA 2OQRA 3HOYJ 5IOZA 3EQLF 3WG9A 2CW0F 2WAFA 1P9QC 3L00A 5E20A 4M6VA 4B3XA 3QYBA 3RQ4A 4PSWA 1VQ8I 3TO7A 3V4GA 2GXGA 4PFPA 5K1YA 3DLAA 3S14J 2JVHA 4KMFA 2K9SA 2HWVA 2Y75A 3K9TA 3ELKA 3LAJA 3P9IA 3GBGA 1SD5A 1RNLA 2HDCA 4ON0A 3HGYA 3KYDB 4A2UA 4EGYA 3L2VA 5KAIC 1KQ0A 5CPRB 4I6ZA 3BQZA 3RJPA 3J7AY 2DA2A 2STWA 1FBQA 2FSWA 3PFYA 2H94A 2FRHA 1O3QA 2EB7A 3E1SA 2MSYA 4MGRA 2KIQA 3PUFA 4L9TA 1YJ9I 2VPLA 4HYEA 4PZJA 3OYHA 1UHMA 1TT0A 2KPMA 4JX4A 3KEQA 1Z7LA 1FYLA 4G6TB 3DF8A 2R7ZJ 2UV1A 2KIMA 3TGNA 3I4PA 3RPUD 2UXNA 2KMUA 4CZZA 4RB2C 3WTWC 3DPUA 4BQAA 2YSRA 3BTIA 4AVPA 2JUCA 1HCRA 2FA5A 4R1HA 1K4TA 4DBRA 3TOAA 2ZSIB 4G9YA 3CD6I 1W7PB 4NC7A 3HOTA 3MZ8A 2FEZA 1KA8A 3VYRB 4BJ6C 1XDUA 4CCKA 1JT0A 3TP3A 5A2QZ 3DQVC 4B44A 3LA7A 4RAFA 3BG3A 2ESNA 3BG5A 1A6IA 5HVQC 1VFCA 1XCBA 5E8GA 2LG4A 3KEOA 4GYIA 4A6EA 1RUOA 3A01B 1MMGA 3KIOA 1X1CA 1A04A 2TDXA 3TOBA 3WTZA 1PUEE 3PIOF 1G2HA 2K7LA 1D8KA 4JBAA 4O6JA 1EKEA 2NAZA 4LLLA 3IRQA 1W36C 2ZB9A 4KT5C 3FXUA 2DPUA 1G3WA 2VKVA 5B3SH 4HX7A 1SC7A 2R5ZA 2BOLA 3QODA 1L3LA 3GFLA 3AFHA 3WU0A 2QSFX 1ZLJA 1JGGA 4LB6B 3HRMA 5J8CA 1JHFA 2OBPA 1FMVA 3BT9A 1DPRA 3TP0A 2HVQA 2HOEA 1E2XA 4EVIA 2DCEA 4C2TA 1IGNA 3LSRA 2LNBA 1RETA 2ID3A 2DT5A 1YIOA 2XAFA 1BR4A 1ODDA 2DI3A 2F4IA 1ZREA 2BXYA 3C18A 1PUFB 2PJRB 2W25A 4GGGA 4I0AA 1XDSA 1FZPB 2HXOA 2ZKZA 3OOUA 3R60A 4CSWA 5J4YA 4CDGA 1V5EA 4Q4ZF 2VJ4A 3HSEA 3S17J 1YYVA 3FXQA 2QQ9A 2VC0A 1FNNA 2DFIA 4FX0A 2M2EA 1Y1WJ 2AO9A 1YX5A 1RIOH 1IXSB 3FMSA 2DDBA 4KIGA 5L3FA 2LK2A 3CJTB 4CCMA 3HPGA 3CZ6A 2R7RA 4A3GJ 2Y30A 1Z1DA 3K4CA 1N25A 3VYTB 4A69C 4DJAA 1GDTA 4NB5A 2K85A 1IUFA 3BOQA 2XAJA 1WH7A 4GO1A 3T8RA 4JOMA 5IP6A 1OCZH 1IXCA 1SFKA 1VNDA 1Y8RB 2LMDA 3EUHC 1LB2A 2R7XA 5BPIA 3LA3A 2L3DA 5F64A 4M9XA 4IHVA 1B8IB 5HNHA 1TC3C 3A0HC 2M30A 5BPDA 5LHHA 1X58A 3OYGA 1DQUA 1QNTA 3ERMA 1I1SA 1MH4A 4I0BA 1U2WA 5CVIA 2Z99A 1P92A 1Y8QB 3VSKA 1SMTA 3DP7A 3J81K 1LE8A 2BZTA 3C2HA 3K6GA 1AU7A 3CC7I 3CCSI 3GTKJ 4XKBA 3JSOA 2ID6A 2KQRA 2F5EA 2VQCA 2BYVE 2CV0A 3W2AA 1HW1A 5GTIC 1GHCA 5DDGA 3QU6A 2LBFB 2CG4A 4L9VA 4U7BA 3KEYA 1MNEA 1X19A 1U9NA 2XF6A 3H5RA 3O8HA 3KP5A 2L0KA 2WBMA 3A03A 1SMYF 3OIOA 3I53A 4XSXF 2DA7A 1ZAOA 4UXNA 4RB1A 5ICFA 3O3KA 4IOCF 1SVLA 5L3BA 2DT6A 2LKSA 2ZJ2A 4FE7A 3F9KA 2ECBA 1SFXA 4IJAA 5IT3A 1J75A 2H8WA 1S7AA 4XR6A 4M9SA 5FLXZ 2F5FA 3WTYC 3ZQGA 2E1MB 3FMRA 2XGXA 2EK5A 5F6FA 2M34A 5H20A 1T6SA 2FU4A 4XLHA 1V5FA 1IN6A 5EEGA 4HG2A 3KLNA 2JA7J 1HBXG 2Z9OA 4UV9A 2GOXB 3LQRA 4DYQA 4HW0A 5HODA 1I27A 1Q1HA 3W3CA 2D45A 2R93J 4C2MJ 1EA3A 2PMUA 2QLZA 2R5YA 4GYGA 2QYOA 2XDVA 1FSEA 1KYWA 6PAXA 5JLXA 4ENJA 1IRGA 3GUDA 2VASA 1JXSA 1BC8C 2L01A 4A3EJ 3K4KA 1TW2A 2VOPA 3MMYB 4RS8A 3H0DA 1EV7A 1OR7C 1FIPA 3E5XA 2Q8KA 2QCOA 2R7VA 4B1RA 1A35A 2M3AA 1H9TA 4LG3A 3M8FA 3L2UA 4J19A 3GTOJ 1LDDA 2ECCA 2MD0A 1TLHB 3VWBA 3OYMA 4QPOA 5EDNA 5J40A 1KGSA 3QOPA 2VT3A 3K69A 4B48A 4HNVA 3OYCA 5E1XA 1B59A 5C44J 3CUOA 3ZQLA 3J80K 3JW4A 5FO5A 2E34A 4BUPA 1UHSA 3RPQA 4B4CA 5DUIA 1ULYA 2FX0A 2A07F 3O6BB 2MYSA 3JRDA 5E79C 1W1WE 2XGDA 3GMEA 3IH3A 3NWSA 4HEA2 3DBLB 3OYNA 2IT0A 4UUSB 1QPIA 2YR2A 5LD2C 2E7XA 2IW5A 2I5UA 4U0WA 5ILSA 1HSTA 1SD4A 3QPSA 1ETVA 1OCTC 4XKWA 2X48A 3H35A 2P0WA 1SVMA 1R22A 1ZN2A 3CUQB 3HSRA 1T38A 1R4NB 2VKHA 4IZZA 1KU2A 3BWGA 1MJ9A 4L18B 4RB0A 4M6XA 3VFZA 3DWLE 2VT2A 3ZMUA 2FMLA 2X1EA 3JTHA 1HKTA 2M1BA 4RM3A 5K5OA 1FBUA 1XTAA 1QZYA 3OYFA 4Z6YA 5H6RA 3H5NA 3CCVI 4HX8A 2JPBA 3Q0VA 4MFEA 4ESJA 1MBEA 2IGKA 2JN6A 1LQ1A 4ZYDA 3ZMVA 1FIAA 4HSTA 3S1MJ 2MD5A 4O5VA 3IH4A 1I39A 1A31A 1ZGJA 2DMTA 4UVCA 4I09A 5C4XJ 4TV7A 4CUGA 1I50J 2LF7A 4I7HA 3DCFA 3MKWB 5CJ9A 4XMYA 4Z2YA 1JTYA 3NQOA 3MEXA 1MBGA 4PK4A 3HUGA 4WXDA 1NTCA 2HDWA 2DO7A 2ZO4A 1Z77A 3C7JA 3V8JA 2P5LC 4YFNF 2LYCA 4HAMA 1ZLKA 5LEJA 1IRXA 1YI2I 3CUQC 1ZARA 3MZHA 2KJCA 3IHUA 4A3JJ 2R3SA 3M7GA 1SD6A 2IEKA 1WI3A 3CESA 2E5NA 3ZQHA 1W7PA 2VOOA 2KRCA 1G59A 2E35A 2TRTA 3PUBA 1G3TA 1N78A 5DCMA 2MW8A 2VN2A 5CVVA 4IOAF 3TO9A 2EIJH 3F6VA 5EGOB 5FKLA 5GP9A 4AUXA 5B1AH 2CQNA 4CA0A 1YQAA 1I5ZA 3BG9A 1S9HA 1VQLI 5E18F 3H92A 3FHZA 1ZHFA 2GZWA 3HB9A 5EF6A 4DBQA 2IA2A 2YS9A 3LA2A 5CKTA 3H3UA 1D5VA 4XONA 3RSNA 2H8RA 3ESWB 1OPCA 5FFXA 4IHTA 3CCMI 1N75A 1ON2A 2DJIA 2HZTA 1QZZA 3CDHA 3GEZA 2L9SA 3LSIA 5FFZA 2QZ8A 3I0TA 2XKOA 4HLXA 2GIZA 4FHTA 5E1ZB 3IWZA 3WE2A 1V3FA 4PJLA 2OA4A 1PP8F 2IA1A 4AVZA 4MEYF 3OR1C 5HNFA 1PDNC 3K4MA 4C9YA 5B66C 2WA0A 3MN2A 2LP0A 4EMSA 4P9FA 3BR6A 3H9QA 3OYEA 3TBIA 4NC8A 2O7OA 1ONVA 2JJ7A 2EFPA 3G1OA 2ELHA 3EETA 4A93J 1MSEC 5F04A 3AG1H 3S3NA 1RC9A 5LGNA 1XX5A 2JK3A 1FLIA 5HLGA 4BQOA 3AG3H 5M3MJ 5DM7F 3NRVA 2O6GE 4RB3C 2C6YA 4MO7A 2V79A 3IC7A 2CW8A 3QRFF 3J80Z 2ZJRF 5TGTA 3GFIA 3ZMSA 3GWZA 3DXJF 2B7EA 3WTSC 2HGCA 1LNWA 4EJUA 5LBQA 1YIJI 3K2ZA 1AA7A 4FT8A 3S8PA 3MVPA 3CDLA 2CO5A 2Z2SB 1WJBA 1FTTA 1K78A 1KONA 2WV1A 4ANJA 4D0PA 1WJAA 5C4JJ 1IV8A 4BEHB 4ZYEA 2YX7A 4K2EA 4XM3A 4XRSA 5FJ8J 2KJBA 1LE8B 2XC7A 2EBIA 2KDZA 1F43A 3ASOH 3HRUA 4YEJA 4PCQA 2EWNA 1ZGAA 3GTQJ 1P4XA 1HDDC 4AIJA 5FRMA 2NNNA 3H3ZA 2XPVA 2BEOA 3R61A 1D0ZA 2LSOA 2XF5A 3GTPJ 3JRBA 3T8TA 5LGTA 1O57A 2ELKA 2ELJA 2K86A 2DAOA 4UHTA 1L0OC 2HEOA 2COMA 1FT9A 5GTHC 3GTJJ 2E5ZA 1LFUP 2V9KA 2DA4A 1Y0NA 4BDYA 3RKYA 4F91B 3Q9VA 5M5WJ 4KN4X 2K4BA 4V2FA 3COAC 2MLKA 2FQ4A 2JTVA 3OSFA 3FKJA 4G6DA 4DYCA 1TNSA 3K70C 5IY5H 4YG2F 4UVBA 2KT0A 3I58A 3CO7C 4XRSG 3BJOA 1DUXC 5J3LA 1DU0A 1ZRFA 2NOGA 3HOUJ 4CH7A 2WAQN 1XSXA 4IPAA 3W6JB 4S0HB 5FB2A 4IHXA 4IHSA 3D5RC 3HYIA 4F3QA 4CO8A 5A2QK 3BP8A 5LFAA 2R7DA 5KCMA 1B72B 1BM9A 1D3YA 1X1PA 1G3SA 1I3QJ 3S32A 4IEJA 1ZR4A 1J9IA 3WTUC 4IVNA 2VBWA 1OCOH 4OWRB 3HOSA 3K4LA 3JAMK 1OQYA 1P6RA 4PJNA 1R71A 4Y17A 3GX4X 4KT6A 2PQ8A 3LFUA 4LLNA 2RVCA 1IN7A 1W5CC 3BR1A 3B6AA 3NAUA 2V1XA 5CYVA 5BQTA 3LSHA 5DM6F 1G4DA 3VOEA 1ZTRA 2Y9ZA 1K4SA 4QWQA 3A01A 4BACA 1REPC 3FK6A 1IN8A 2K40A 3SQNA 3BJAA 3RCOA 3SDBA 5LLQA 3HSFA 1T98A 2FF4A 4HV5A 4IL6C 5LEKA 3JCUC 4RM2A 1WJ5A 2M87A 3VYUB 4BXXJ 4KDPA 2HKOA 3QPTA 2YU3A 2F5DA 4I98B 2UXXA 5E3LA 2W7NA 4L5IA 2M9HA 2VE9A 2GXAA 3WGGA 2R5ZB 3H9JA 1VQKI 5DTDA 2A5YB 2PJPA 1K6OA 1WPKA 1XPXA 1K7AA 1LDKB 2WB1N 4LD5A 3C1DA 2QEXI 3Q3SA 5BMZA 1SFOJ 1VQ4I 1TT5B 2HTJA 2BY3A 1MNMC 2HVSA 3ECHA 2V6EA 2R4GA 3EYYA 3F8FA 4B43A 1IZ1A 4UUSA 2AQEA 4NUBA 3H3VK 2PJRA 3TW7A 1HOMA 4B47A 1P7IA 4D9JA 1IF1A 1RR8C 4WXHA 1XMKA 2EV5A 4RDUA 2CUJA 2VKDA 1ENHA 1E3OC 3HKZA 4M3EA 2BVLA 2HPIA 2QQBA 3IH2A 1R23A 3B6CA 2DMNA 5D5WB 1EH6A 3A4CA 1JKRC 1OLTA 5J1YA 3CCUI 2OCCH 3OYJA 3CP2A 2LKXA 4EV0A 3TDUC 5M3FJ 3S1RJ 2WADA 4L5EA 1ETWA 4FETA 1Z7UA 3K70D 2ZNZA 2YUSA 4U0VA 2FOWA 5JHUA 1GXQA 3ZQCA 1BIAA 2HQRA 2X1DA 2DYRH 5LRSA 1T56A 2ZBKA 3M4OJ 1LFBA 2PEXA 2W24A 1IUYA 5M5XJ 2GXBA 4XLFA 2HQ5A 4RBOA 1W0TA 1ACIA 2GOMA 1U5TB 4AIDA 4XICA 4X6AJ 2QKMB 3CP8A 1OMIA 1YFHA 2KIUA 3JTGA 3GFMA 3KP3A 1B9NA 2G7UA 2ACJA 2JZYA 1LEAA 2GIVA 1LVAA 1ETQA 2E1OA 3HOXJ 1WQ2A 3DBRB 4X1EA 1FSHA 1WJCA 1OKRA 1WJDA 5IYCJ 2QGUA 3EDPA 3G6EI 2BY2A 2PMZA 4E7HA 1FOKA 4MQVA 3JRIA 2WTEA 5J8FA 1VQ6I 3TO6A 2L4AA 5E1WA 1YW7A 4N9IA 5HDNA 2LBFA 2L9NA 4JK1X 4BHCA 2JA5J 1BJZA 3ML6A 3M9AA 2FE3A 3LL7A 4BDZA 3BTCA 2GLOA 4M71A 1LKXA 1JGSA 1FOWA 2KKOA 1LVKA 4WXCA 2FBKA 3FDYA 3N4MA 3K4JA 2FJ1A 4LMYA 3VODA 5DCMB 2R7WA 1SFUA 4BJ5C 2NYXA 3BZCA 2XIGA 5EGOA 4A12A 3CMYA 1WSUA 3CDIA 2DYSH 1G8XA 1YOVB 1AWCA 3F72A 3IAM2 2LOOA 2HPMA 2OV7A 3BR2A 4IXAA 2EFQA 1MBFA 1HW2A 1T8IA 3ROUA 3I59B 2HTSA 4P55A 5J4VA 3EPZA 2O5RA 1KYZA 1USTA 4XKVA 1J59A 1RRJA 1ZYRF 5ERIA 2Y0SA 2X4HA 1ETKA 2BXZA 4NC6A 1BOAA 4KITB 3JR9A 2L02A 1JKOC 3REOA 1IRZA 1I6XA 3UNGC 2P6SA 2E2HJ 1YW9A 4XL9A 2JT1A 1Z3XA 1HSJA 3PM1A 1MNDA 2W57A 2EZLA 3U1KA 1VI0A 2FOKA 2HQNA 3DLLF 2CV1A 1X1DA 3JRGA 3RYRA 5KNLA 4IKFA 5F1JA 3X2QH 2Y31A 3C3WA 2HNHA 2X6WA 5F08A 1FBSA 1TP4A 1UG0A 3LSGA 4OOIA 3KETA 1J09A 1R6RA 5TJJA 1W36D 2XF7A 1MD0A 1Z05A 2M5WA 4ZDLA 2AHQA 1UCRA 1H0MA 1A6QA 2KZGA 3RDIA 1X2MA 4L5JA 2F2EA 1FWZA 3IKVA 2ZXIA 1JJ8C 2Z5UA 2WC2A 2PMHA 1TZLA 3K1MA 1MJAA 2FBIA 1ETYA 4XK4A 2BHZA 2EV6A 2ZSHB 4P1WA 4LLGF 4FE4A 4AYBA 3HL2A 1Z21A 4Y4RA 4N4NB 3TEDA 4KIBA 5K7FA 1FTZA 1U0JA 2MH2A 3H9GA 1UZCA 3ISPA 3AL0C 4L0ZB 2IA0A 1D0YA 2OU2A 3F3XA 4OINF 2OUMA 5FKNA 3U2RA 1F36A 2Q1ZB 2VONA 3FISA 1F1ZA 4ZYHA 4YFXF 3ONQA 5LGUA 3M8JA 4BHBA 1S72I 1JUSA 3LNQA 1TBXA 1WWXA 3Q0UA 2QBYA 3L2CA 2KIFA 2NS7A 1QO0D 2FD5A 3G1MA 3HOVJ 3E6BA 3S15J 3PL8A 3S2HJ 1WFXA 1YS7A 4HNUA 2P8TA 2MC4A 4PFOA 3FWEA 3GZ5A 2GM4A 3I5UA 1KQ9A 3LMMA 4C30A 4D7MA 2NVUB 5CQGA 2FXAA 3J7YJ 3CO6C 4BY7J 2GA2A 3E7LA 1RI7A 1XGSA 3QYEA 4BU2A 2CH0A 2LTPA 2VJ5A 2V4JC 3CC2I 2EILH 1T08B 2QM3A 1FOXA 2VJIA 1T33A 3F8NA 2E1MC 4KICA 4KUMA 2R7QA 3ZQ7A 1Y1VJ 2OC6A 1NH3A 1QVTA 3M8EA 3S1QJ 3I4NJ 3S93A 1YX3A 4CZCA 4XIDA 3D5SC 2XB0X 3BCAA 1R9TJ 3FKIJ 2Y0MA 3BJ6A 1I6HJ 1UJ8A 1IN5A 1U9OA 5IOYA 2EZKA 1X3WB 2QA4I 2AQFA 1FPQA 3FXLA 2EQRA 1V5GA 3QOEA 1PVEA 1MKMA 4R8HA 3G71I 4BS9A 2NVTJ 2VBYA 3I4MJ 2HXIA 4ZZLA 1R4MB 1XMXA 2ME6A 1B72A 3PNYA 3ZN1A 3WE3A 1MZBA 3M1EA 2Z16A 1U78A 1EH7A 4KFCA 3JRFA 4ETSA 3V7CA 4EATA 5IYBJ 4U7DA 1JKQC 3CLQA 3LAPA 2JVGA 4NNJA 1FOYA 2IRFG 3GLLA 3S2WA 1R1VA 2E19A 4Y15A 4OAZA 5FGMA 3D1NI 4EGZA 2OAZA 4ZC3A 4KIFA 1MGTA 3OMYA 5KAFC 4O3MA 2M8EA 3IAS2 5JLWA 3WGIA 5IP7J 1F5TA 5E3OA 1TQPA 4V2GA 3MFKA 2F5VA 1H9GA 2OD5A 4ZYAA 5L3EA 2F5CA 2FMYA 3I9V2 2YX4A 3S1NJ 1A36A 1W5TA 3L09A 3TMOA 3N97A 3FXMA 2VPRA 1U8RA 2O0YA 5FLVA 2MLGA 4G12A 2H09A 4ZJZA 1FYKA 2P7CB 3LWFA 2IP2A 4DIQA 2CQXA 3CJQB 2JA6J 4S05A 1GXPA 1TL8A 2TCTA 4XNFA 3CCEI 3E5QA 5TISC 2V1NA 1QU3A 3DPTA 1RKWA 4DYRA 4ABZA 1IJWC 3PNVA 3K1NA 5GAEJ 1MH3A 4C3IJ 3ZMTA 1I3AA 4HPQA 3RKQA 4E7LA 3ZQFA 4DGWB 3FXRA 2GWRA 4P9UA 4EJWA 1AKHB 2K9NA 2LLKA 3KLOA 3QAHA 3CCJI 1LJ9A 4ENKA 2DOFA 2VQLA 4ITVA 2JRMA 1EH8A 1KU3A 2X85A 5F27A 2ZXHA 5J47A 2NRAC 3JSPA 3OWTA 4H0EA 2VBXA 3FXKA 5E8IA 5HS7A 2BY0A 4M3BA 4AIKA 3HHHA 1TWFJ 2DJNA 3AG4H 3DTIA 3IV5A 3Q5FA 2DQLA 2YU9J 3ZGKA 3SEZA 3CCQI 3OR2C 2BVMA 2FUG2 3C2BA 3VB2A 2O8XA 3CF5F 4M6YA 2HFHA 1U5TA 2K9MA 1K78B 4XOTA 3GCMA 2VE8A 3FHNA 4NQWB 1HQCA 4II3A 1ON1A 4UV8A 2DTRA 3MKZA 3HC7A 1FY7A 2DOEA 5EEHA 2RDPA 4BEHA 3J7ZI 2CW7A 3KP4A 3OS2A 4ESBA 4JX5A 1RR7A 1V54H 3NWTA 1QQIA 2DFEA 3OV8A 1VQOI 4QLCU 1UMQA 4A5NA 2M4KA 5IP9J 4YFKF 4FISA 3FBNB 4OMZA 5D6FA 1TNTA 4IHWA 3I3LA 2NS8A 2WY7Q 2ZMEA 3K7AJ 3D0SA 1BN5A 2DQRA 4RGSA 1B4AA 2CUEA 2D1VA 3SFZA 1CGPA 1U8BA 5LRRA 3HEFA 5FRNA 4ZZDA 2P81A 5H6QA 4CHUA 3PQJA 1D5YA 2OTLI 2KDOA 4ZTJA 1WJFA 2M4GA 3I64A 3IKTA 4DNCA 3V8LA 2H27A 1BW5A 3SEQA 4UY8I 1R1TA 1ITYA 2IS4A 4XLNF 1MMNA 1WHUA 1ZGWA 1RUNA 3I71A 4GXOA 5BOXA 2UWMA 4FX4A 3E6DA 4E7JA 2LR8A 2JQ7A 2LF8A 3IP4B 3BPXA 5CVRA 4QPQA 2LY1A 2XAUA 2P5KA 3SFIA 3SYTA 2EIMH 3PO3J 1OR7A 1MSFC 2IGNA 4MQ9F 1UAAA 1U6GA 3HM5A 1DPUA 3TDZC 3VYSB 1IG7A 1FEXA 4A3MJ 4S04A 2GA1A 3JAMZ 2LDUA 1SVOA 2VIXA 3LFKA 4I02A 5BS6A 2XSDC 1R7JA 2ZFUA 2UUZA 2AS5F 3T0YA 1OYYA 2RNGA 3G4SI 2CYYA 5D8KB 4MIMA 2K9LA 1IDZA 4EM0B 3KZIC 4XBFA 1Z0XA 2RQPA 1Z6TA 5E17F 3BG7A 4J01A 4E7KA 1BL0A 2V7FA 3LSKA 4EM2A 2Y69H 4HX4A 2E60A 3OY9A 2VLAA 2BW3A 4A3LJ 3OYKA 2UZKA 4F7ZA 3K4BA 1CF7B 2F6CA 5J6XA 5IYDJ 5C3EJ 2H1KA 1XGOA 2XHKA 4OU0A 4DQ2A 1VQNI 3T5XA 4BAYA 2A5WA 4MTDA 1WGXA 4Y13A 5D5XB 3FBIB 4A5MA 1O4XA 3DFGA 2R0QC 1MMDA 2K27A 2LY2A 1WH5A 2IS2A 3ECOA 1B9MA 2I10A 2XGCA 4YIFA 1O3RA 3ZP5A 3HG9A 1VQPI 2WY8Q 1E0EA 3SHFA 2O8KA 5AONA 2RREA 3RQIA 3KPHA 4B3AA 5ICCA 2E2IJ 3GFJA 4LK0F 2I8DA 3T1BA 4WX9A 2JRTA 2CUFA 2L2OA 2QQ8A 4AWXB 3FIWA 3C2GA 1KU9A 3F21A 3MD2A 2QBYB 3U1DA 3F8BA 4OIQF 1CQTA 2X9DA 3HGGA 1BR2A 3SZGA 5BNGA 4HOBA 3ZXSA 5DV5A 5IT9K 1NG6A 1MJBA 3CJNA 3WTVC 3ABKH 1HA8A 2L7ZA 3KP6A 1P7JA 1BW6A 4EQQA 4IX7A 2GBYA 2PLYA 3BTLA 3OS1A 3EUKL 3A02A 1SAXA 1VQ5I 2V26A 3HHGA 5ICEA 1S6LA 4FASD 4N4OB 3BZKA 1NG7A 2OZUA 3K1PA 4Y52J 4A0ZA 1Z91A 3ZQQA 3DTKA 1MMAA 4EJTA 2Y9YA 3WODF 4V19K 2QQAA 4G8XA 3VPRA 5HDKA 1TWHJ 1FP1D 3PQKA 1WKMA 1QZEA 3AL0B 4ZYGA 4N9HA 4G7OF 2WWYA 2L54A 4EEFG 2MGQA 3ZMZA 2EJRA 5EZGA 4OIPF 5IT9Z 5JHFA 2O61A 2VBZA 3HTUA 1IV6A 4PGGA 3DV8A 4WF2A 1DGRM 2DMQA 3L7WA 3TL4X 3E6CC 1R5GA 4IQJA 4IRGA 2EA2A 1BC7C 2JA2A 2MH9A 4NDLA 3LSPA 1SEUA 3G73A 2R7FA 4RAZA 2X1CA 4YELA 5FKOA 5FD5A 3SZTA 5K5QA 3FM3A 3IWFA 3JRCA 1A5JA 5D6EA 4EJOA 3FF5A 3CQZJ 3FXOA 2VJJA 2P6TA 3I59A 2CRGA 2ISYA 2K5CA 2EPFA 4HRIA 2HOTA 3LOCA 1UB9A 1DU6A 2H1LA 3BLYA 2DBBA 4ASNA 1BI0A 4PDKA 2K4JA 5GAHJ 2IPQX 4L0YB 2V6CA 3P9KA 3EUAA 3RTRA 1QRYA 3JRHA 1XD7A 1ZR2A 4U87A 4PUSA 2HOSA 3CC4I 1QHGA 3DEUA 3N05A 4CYCA 1UHWA 3G2BA 2XPWA 3PFIA 4AD9A 2ZJQF 2CGPA 2KHMA 4BBSJ 5EEAA 4PGHA 2MABA 2Y2ZA 2RAEA 4KISA 3R4KA 1RESA 5D4RA 1Z9CA 1F4KA 4YRVA 4XORA 1Z67A 1IDYA 3KE2A 4BQNA 2CJJA 3VDXA 1OFCX 4E7ZA 3R0AA 1YRNA 2X51A 3G1LA 1Z6RA 4Y3OA 1BOBA 4Q47A 1YS6A 2HS5A 2KLOA 2VI6A 3ZRGA 2K9QA 1U3EM 4HDUA 2DODA 4PSXA 3ZMDA 1VF9A 2RC4A 4JP0A 4PJMA 3IL2A 1OISA 4F92B 1GVJA 1X1AA 3P9CA 1AKHA 4CCNA 4I99C 4LFUA 1G3YA 3KYLA 3CMEI 4XLEA 3DEWA 5D4SA 1R49A 1APLC 1BI3A 2MBFA 1Q1VA 2BBYA 2VXDA 5DD8A 3A0BC 1AOYA 1JKPC 4C3HJ 3K10A 2EZIA 2D1HA 9ANTA 3A2KA 1B6AA 4BE1A 5JVTA 1W0UA 3F6OA 1E3PA 2DTZA 3BY6A 4H4KC 2XUBA 3ABTA 1ZKGA 2DXIA 1ZRDA 4I01A 1ORKA 2NOJB 2XVCA 3AG2H 1FYMA 2ETHA 2EV0A 4DZPA 4NQWA 3L2QA 1WZ2A 3OSGA 3E97A 5KHDA 2ZXJA 3GTGJ 1BR1A 3E6MA 3OS0A 1R1UA 1FMWA 3B73A 4X0GA 3MWMA 4B09A 3MCZA 2JUGA 3QPLA 3EUHA 5CVUA 3IUOA 2QWWA 3GLXA 2M7BA 3BDDA 1EJ9A 1GVDA 4UUVA 1AHDP 1MBKA 3MKLA 2ZMEB 3OYDA 2DFHA 2EFOA 1K6YA 1XSVA 3M3YJ 3CJRB 4IHYA 1SD7A 1OCPA 3DKYA 4ENNA 4CICA 4MLOA 1W7PD 5HS8A 2DU9A 4Y7NJ 1QPMA 3AAFA 4A3CJ 1XGNA 3WTXC 4XLAA 1QBJA 1VQ9I 1UELB 1RPWA 1ERDA 2W1OA 1NK3P 2CWEA 1RZ4A 3MAJA 2IJLA 5DYMA 4LG0B 5E3MA 4MTEA 3GZNB 1VQMI 2DLLA 4CGZA 4A0XA 2L9VA 3Q0WA 1G6NA 1DP3A 5ILUA 2VC1A 3S3OA 1C0WA 1KZHA 1Z3YA 2W84A 3NEUA 5JVGF 2M0MA 3JREA 2R92J 2G0EA 3SDGA 2STTA 2E1CA 2EH3A 4BNCA 1W5SA 3CF2A 3KYCB 1IW7F 2LD5A 1E17A 1O7LA 4M3FA 1VQ7I 1XC5A 3FX3A 2A6TA 4I2OA 2W85A 3QP5A 4XQFA 3J7AO 3PSFA 4MEXF 3ZQIA 1X3UA 1OCRH 3F8CA 2IS1A 1Y0UA 2BGCA 2IBDA 2OTJI 2HU9A 3CTAA 2R7SA 3L2RA 3VEPA 2RKHA 4RAYA 3CCLI 2OPTA 3GW2A 2ZFWA 2OJED 4RMNA 4YIRX 1YJWI 1D1BA 1GT0C 4CCJA 2P4WA 1O3SA 5K5RA 3HRTA 2QVOA 4HF0A 4AYBN 3HRSA 3HIFA 2O03A 4G7ZF 1STZA 2WAQA 4Q48A 4II2A 4QIWN 5HOOA 5EG0A 3CCRI 2V9VA 2HYFA 3UKGA 2JWTA 4AIHA 4B8XA 1P2FA 2IVMA 4GCVA 1R36A 3FM5A 5KK1A 3RZDJ 2ZXWH 2DA3A 2XKPA 2LY9A 2W00A 3GF2A 4ZH4F 2NVYJ 1H88C 3HBLA 3JRAA 1NHAA 1OJLA 4M9ZA 2XASA 3FMQA 4HF2A 2M7AA 3HPHA 2HYGD 4D7NA 1ETOA 2EZHA 3RIRA 5KVRA 5ICGA 1LPQA 4DOZA 3DU5A 4LITA 3AKZA 3P7NA 1HLVA 2L9RA 4G94A 1H8AC 2IGMA 5LHIA 2HKXA 4OAYA 4A0YA 3HOZJ 2FQ3A 3RKWA 2CS3A 2ZMEC 3E0JB 4KYWA 3WHBA 1P4WA 5JI6A 3L2WA 2DMUA 1E3HA 2XV4S 1QVUA 3DPLC 3UR3C 1MBJA 4A3DJ 4BL0B 4HQEA 2DK5A 4HNTA 2X6XA 2B0LA 3BR5A 2JA8J 4CXFA 2COBA 5L3DA 4A3BJ 1WCMJ 2BV6A 2X0LA 5FROA 2MC3A 1S7OA 1S7EA 4LB5A 3GZ6A 2R7OA 2VKEA 5J1RA 3QPHA 2MA3A 2N8GA 5AIQA 1MDMA 1N77A 1HXDA 5D5UB 2RGVA 4IRIA 3RKXA 3HDDA 2KRFA 1J5YA 4XOPA 3I55I 3GYHX 3ABLH 3F22A 1GV2A 1LDJA 2HI3A 2CQKA 1OCCH 3OYAA 1W4MA 2W4SA 2CFOA 1KQ8A 3PNTA 4E7SA 2A3SA 4CCOA 2XSJC 1PP7U 4LGWA 1X4OA 3KX2A 5TRDA 1P4AA 1FJLA 5FD6A 2PMZN 2ME0A 4NBQA 4MHGA 2IXSA 5M5YJ 4PJ0C 4M72A 1ZELA 2IS6A 1ZG1A 3M07A 2ICWG 2P7VB 1YO5C 3OYIA 1Y56A 2L7MP 4N0BA 1WI9A 2E1NA 1Y6IA 1XMAA 4HBLA 5DS9A 2CU7A 4WWCA 3TW6A 1R5ID 4BHPA 3ABUA 2FNAA 3HZJA 5GADJ 2LVSA 2JSPA 4G7HF 4D5FA 4W97A 4OMYA 3O8GA 2XROA 2NXNB 2PBIA 5DD4A 1XSDA 3OIQA 2AXTC 5CQEA 2DT7B 1TWGJ 5F0CA 1LEBA 2DA1A 4BH9A 2A05A 5E3NA 2Q2EB 2DW4A 2EFNA 1HW5A 3BC8A 3K0LA 1HKSA 4R79A 2Z1DA 2PFBA 2R7TA 3D5LA 2XAQA 3DKXA 4LIUA 2V9PA 1PUFA 1TTYA
chains in the Genus database with same CATH topology
3BT9A 3TP0A 1BL0A 5E3LA 4FTHA 3HKZN 4M3DA 2M9HA 1IGNA 3LSRA 2QF7A 4A3LJ 1RETA 2R5ZB 1BA5A 4CYCB 2ID3A 2XRLA 1JTXA 5DTDA 5IYDJ 1JUPA 1WPKA 5C3EJ 2H1KA 1PUFB 2JMWA 1NK2P 4A3IJ 2WB1N 5FLMJ 1POGA 2HXOA 3OOUA 2DA5A 3Q3SA 1SFOJ 1WGXA 1MNMC 1O4XA 2R0QC 3S17J 1WH5A 1YRNB 2I10A 2XGCA 2M2EA 1Y1WJ 2AO9A 4UUSA 4XRMA 3H3VK 3TW7A 1HOMA 1P7IA 2O8KA 1HDPA 2LK2A 4A3GJ 1B8IA 4GFBA 2Y30A 3RQIA 4B3AA 2MG4A 4A69C 2E2IJ 4RDUA 1GDTA 2Y0SN 2XGEA 1IUFA 1ENHA 1E3OC 4QTRA 2CUFA 1WH7A 3FIWA 4M3EA 5IP6A 1VNDA 3IH2A 3B6CA 2DMNA 3K2AA 1JKRC 4IHVA 5J1YA 1B8IB 4BKXA 2LKXA 5M3FJ 1TC3C 2NVXJ 3S1RJ 3ZOBA 4L5EA 1ETWA 2YUSA 1ETXA 2O9LA 1X58A 1CQTA 2X9DA 3HGGA 3ZQCA 1JJ6C 1MH4A 5BNGA 1EF4A 3PO2J 1T56A 3M4OJ 1LFBA 1ZQ3P 5FKKA 1LE8A 5M5XJ 1RKTA 2L7ZA 4C3JJ 2HQ5A 1AU7A 4RBOA 1W0TA 1P7JA 1BW6A 3GTKJ 2GBYA 3BTLA 4I76A 4XICA 4X6AJ 2ID6A 3A02A 2OF7A 4BY1J 1ETQA 2E1OA 3HOXJ 4X1EA 1U9NA 4Y52J 3O8HA 2L0KA 5IYCJ 3A03A 3OIOA 2DA7A 2Y9YA 3JRIA 3VPRA 1TWHJ 4FE7A 2ECBA 2HOAA 2JA5J 1BJZA 4BBRJ 4EEFG 2MGQA 2GLOA 4LOCA 3BTCA 5EZGA 3ZQGA 1IV6A 2HYJA 2M34A 2DMQA 2FJ1A 2E2JJ 2DN0A 2R5YB 2X6OA 4W1UA 2JA7J 4QSHA 5EGOA 3CMYA 4NDLA 3LSPA 3BR2A 4DYQA 1MBFA 5HODA 3W6VA 2IAIA 5FKOA 2R93J 4C2MJ 2M0CA 4DZJA 2R5YA 2L7FP 3JRCA 1ETKA 1A5JA 4FCYA 5JLXA 2W48A 1K61A 3CQZJ 3BTJA 3JR9A 4A3KJ 1JKOC 4A3EJ 2NVQJ 1IRZA 2CRGA 2E2HJ 2HOTA 3LOCA 1FIPA 3PM1A 2QCOA 1DU6A 2EZLA 4B1RA 1VI0A 3BR0A 3JRGA 3GTOJ 4J19A 5F1JA 2ECCA 2Y31A 5K7ZA 3QQAA 5F08A 1MBHA 5EDNA 4JX6A 1QRYA 3LSGA 4HNVA 3JRHA 1ZR2A 5C44J 2HOSA 4CYCA 3ZQLA 2DA6A 2XPWA 4BBSJ 2AHQA 5EEAA 1UHSA 1X2MA 4B4CA 2Y2ZA 5EG0B 2RAEA 2FX0A 1RESA 1JJ8C 1X2NA 5GPCA 3JRDA 5J1UA 2XGDA 1IDYA 3IH3A 1ETYA 2CJJA 4XK4A 4JYKA 1OFCX 1YRNA 3G1LA 4FE4A 4UUSB 1QPIA 2VUMJ 2M8GX 2VI6A 3BQYA 2K9QA 3TEDA 3QPSA 1ETVA 1UG2A 5K7FA 1OCTC 3S2DJ 1FTZA 2X48A 1VF9A 4JP0A 4UUTA 3CCYA 1GUUA 1AKHA 5FKNA 3DEWA 1JT6A 1F36A 1APLC 3FISA 4A3FJ 4DW6A 1Q1VA 5K7HA 4C3HJ 1JKPC 1JUSA 2EZIA 3L1PA 9ANTA 2B63J 3LNQA 3Q0UA 1W0UA 2NS7A 2DTZA 2FD5A 4M3GA 5IPAA 3Q0VA 4MFEA 3G1MA 1ZKGA 2XPUA 1MBEA 3HOVJ 3S15J 2JN6A 3S2HJ 3H0GJ 3HOWJ 1ORKA 2GM4A 1FIAA 4DZPA 2LFBA 2HDDA 3S1MJ 3OSGA 3IH4A 4D7MA 3FK7A 2DMTA 3GTGJ 5C4XJ 4AC0A 4BY7J 3E7LA 1I50J 3DCFA 2LTPA 1JTYA 1MBGA 3QPLA 1T33A 1Y1VJ 3GTLJ 1NTCA 1QVTA 1TWCJ 1GVDA 1AHDP 1MBKA 3MKLA 1Z77A 3S1QJ 3I4NJ 3LSJA 1JUMA 4XIDA 2CQQA 1R9TJ 2XB0X 3FKIJ 3M3YJ 1XG1A 4IHYA 1I6HJ 1OCPA 5EYRA 1U9OA 5IOYA 2EZKA 4A3JJ 3F0CA 4MLOA 2EQRA 2IEKA 4Y7NJ 1WI3A 3S16J 3ZQHA 4A3CJ 2D5VA 1GV5A 2TRTA 2NVTJ 1RPWA 3I4MJ 2HXIA 2MW8A 1NK3P 2ME6A 5FKMA 5EGOB 5FKLA 1B72A 1ZK8A 5E3MA 5GP9A 4AUXA 5GPAA 1U78A 3BG9A 3Q0WA 3JRFA 3HB9A 1IC8A 5EF6A 1K83J 4D5CA 5IYBJ 2YS9A 3SJMA 3JREA 1JKQC 2R92J 2G0EA 3SDGA 2H8RA 1HF0A 2EH3A 2LD5A 4M3FA 1XC5A 2E19A 3D1NI 2DMPA 5F0FA 1H89C 3RZOJ 3BR3A 3NARA 3ZQIA 1TWAJ 5JLWA 5IP7J 5E3OA 2IBDA 4V2GA 5EZHA 2OPTA 3MN2A 1SANA 2LP0A 3S1NJ 3BR6A 2VPRA 2O7OA 1GT0C 2JJ7A 3G1OA 5FLVA 4G12A 4AYBN 4A93J 1MSEC 4QIWN 5EG0A 5F04A 2CQXA 3UKGA 2JA6J 2JWTA 2JK3A 2TCTA 5M3MJ 3GTMJ 3RZDJ 2DA3A 2LY9A 1RKWA 4DYRA 4MO7A 2NVYJ 4ABZA 1IJWC 1H88C 3HBLA 3JRAA 1MH3A 4C3IJ 1OJLA 1XS9A 3RKQA 3ZQFA 4D7NA 1ETOA 2EZHA 4MFDA 2K9NA 2LLKA 1AKHB 3WHCA 2XB5A 1HLVA 2L9RA 5F0HA 3MVPA 1H8AC 3CDLA 3HOYJ 5F27A 3HOZJ 5IOZA 1FTTA 3WHBA 2WV1A 4M3BA 2DMUA 4M6VA 1TWFJ 2DJNA 3IV5A 5C4JJ 1QVUA 2YU9J 1MBJA 4XRSA 1LE8B 4A3DJ 5FJ8J 3S14J 2EBIA 2KDZA 1F43A 2K9SA 3C2BA 3GBGA 3GTQJ 3BR5A 1HDDC 2JA8J 2XPVA 3HGYA 2COBA 4A3BJ 1WCMJ 3GTPJ 3JRBA 4I6ZA 3BQZA 2DA2A 1S7EA 2ELKA 2VKEA 4JX5A 5J1RA 1RR7A 2MSYA 2N8GA 1UMQA 5IP9J 3GTJJ 4FISA 1LFUP 2DA4A 3HDDA 4JX4A 4IHWA 1GV2A 2HI3A 2NS8A 2R7ZJ 5M5WJ 3K7AJ 2CUEA 4V2FA 2FQ4A 1U8BA 3OSFA 4DYCA 3HEFA 2P81A 2KT0A 3BTIA 1FJLA 2PMZN 2ME0A 4XRSG 1D5YA 1HCRA 5M5YJ 5J3LA 1DU0A 2NOGA 3HOUJ 1BW5A 2WAQN 1ITYA 1JT0A 2L7MP 3TP3A 4S0HB 1ZGWA 4IHXA 5DS9A 2CU7A 3BG3A 2LR8A 3BG5A 1A6IA 1VFCA 3TW6A 1B72B 3SFIA 1I3QJ 4IEJA 2LVSA 1ZR4A 3PO3J 3A01B 4D5FA 4W97A 1MSFC 1G2HA 3O8GA 3HM5A 1IG7A 1FEXA 2ZB9A 4A3MJ 3NAUA 3B6AA 3BR1A 2XSDC 1TWGJ 2VKVA 5F0CA 1ZTRA 2Y9ZA 2DA1A 3A01A 3FK6A 2R5ZA 2K40A 5E3NA 4MIMA 1IDZA 1JGGA 1PUFA 4BXXJ 1Z0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT9 A;  3TP0 A;  1BL0 A;  5E3L A;  4FTH A;  3HKZ N;  4M3D A;  2M9H A;  1IGN A;  3LSR A;  2QF7 A;  4A3L J;  1RET A;  2R5Z B;  1BA5 A;  4CYC B;  2ID3 A;  2XRL A;  1JTX A;  5DTD A;  5IYD J;  1JUP A;  1WPK A;  5C3E J;  2H1K A;  1PUF B;  2JMW A;  1NK2 P;  4A3I J;  2WB1 N;  5FLM J;  1POG A;  2HXO A;  3OOU A;  2DA5 A;  3Q3S A;  1SFO J;  1WGX A;  1MNM C;  1O4X A;  2R0Q C;  3S17 J;  1WH5 A;  1YRN B;  2I10 A;  2XGC A;  2M2E A;  1Y1W J;  2AO9 A;  4UUS A;  4XRM A;  3H3V K;  3TW7 A;  1HOM A;  1P7I A;  2O8K A;  1HDP A;  2LK2 A;  4A3G J;  1B8I A;  4GFB A;  2Y30 A;  3RQI A;  4B3A A;  2MG4 A;  4A69 C;  2E2I J;  4RDU A;  1GDT A;  2Y0S N;  2XGE A;  1IUF A;  1ENH A;  1E3O C;  4QTR A;  2CUF A;  1WH7 A;  3FIW A;  4M3E A;  5IP6 A;  1VND A;  3IH2 A;  3B6C A;  2DMN A;  3K2A A;  1JKR C;  4IHV A;  5J1Y A;  1B8I B;  4BKX A;  2LKX A;  5M3F J;  1TC3 C;  2NVX J;  3S1R J;  3ZOB A;  4L5E A;  1ETW A;  2YUS A;  1ETX A;  2O9L A;  1X58 A;  1CQT A;  2X9D A;  3HGG A;  3ZQC A;  1JJ6 C;  1MH4 A;  5BNG A;  1EF4 A;  3PO2 J;  1T56 A;  3M4O J;  1LFB A;  1ZQ3 P;  5FKK A;  1LE8 A;  5M5X J;  1RKT A;  2L7Z A;  4C3J J;  2HQ5 A;  1AU7 A;  4RBO A;  1W0T A;  1P7J A;  1BW6 A;  3GTK J;  2GBY A;  3BTL A;  4I76 A;  4XIC A;  4X6A J;  2ID6 A;  3A02 A;  2OF7 A;  4BY1 J;  1ETQ A;  2E1O A;  3HOX J;  4X1E A;  1U9N A;  4Y52 J;  3O8H A;  2L0K A;  5IYC J;  3A03 A;  3OIO A;  2DA7 A;  2Y9Y A;  3JRI A;  3VPR A;  1TWH J;  4FE7 A;  2ECB A;  2HOA A;  2JA5 J;  1BJZ A;  4BBR J;  4EEF G;  2MGQ A;  2GLO A;  4LOC A;  3BTC A;  5EZG A;  3ZQG A;  1IV6 A;  2HYJ A;  2M34 A;  2DMQ A;  2FJ1 A;  2E2J J;  2DN0 A;  2R5Y B;  2X6O A;  4W1U A;  2JA7 J;  4QSH A;  5EGO A;  3CMY A;  4NDL A;  3LSP A;  3BR2 A;  4DYQ A;  1MBF A;  5HOD A;  3W6V A;  2IAI A;  5FKO A;  2R93 J;  4C2M J;  2M0C A;  4DZJ A;  2R5Y A;  2L7F P;  3JRC A;  1ETK A;  1A5J A;  4FCY A;  5JLX A;  2W48 A;  1K61 A;  3CQZ J;  3BTJ A;  3JR9 A;  4A3K J;  1JKO C;  4A3E J;  2NVQ J;  1IRZ A;  2CRG A;  2E2H J;  2HOT A;  3LOC A;  1FIP A;  3PM1 A;  2QCO A;  1DU6 A;  2EZL A;  4B1R A;  1VI0 A;  3BR0 A;  3JRG A;  3GTO J;  4J19 A;  5F1J A;  2ECC A;  2Y31 A;  5K7Z A;  3QQA A;  5F08 A;  1MBH A;  5EDN A;  4JX6 A;  1QRY A;  3LSG A;  4HNV A;  3JRH A;  1ZR2 A;  5C44 J;  2HOS A;  4CYC A;  3ZQL A;  2DA6 A;  2XPW A;  4BBS J;  2AHQ A;  5EEA A;  1UHS A;  1X2M A;  4B4C A;  2Y2Z A;  5EG0 B;  2RAE A;  2FX0 A;  1RES A;  1JJ8 C;  1X2N A;  5GPC A;  3JRD A;  5J1U A;  2XGD A;  1IDY A;  3IH3 A;  1ETY A;  2CJJ A;  4XK4 A;  4JYK A;  1OFC X;  1YRN A;  3G1L A;  4FE4 A;  4UUS B;  1QPI A;  2VUM J;  2M8G X;  2VI6 A;  3BQY A;  2K9Q A;  3TED A;  3QPS A;  1ETV A;  1UG2 A;  5K7F A;  1OCT C;  3S2D J;  1FTZ A;  2X48 A;  1VF9 A;  4JP0 A;  4UUT A;  3CCY A;  1GUU A;  1AKH A;  5FKN A;  3DEW A;  1JT6 A;  1F36 A;  1APL C;  3FIS A;  4A3F J;  4DW6 A;  1Q1V A;  5K7H A;  4C3H J;  1JKP C;  1JUS A;  2EZI A;  3L1P A;  9ANT A;  2B63 J;  3LNQ A;  3Q0U A;  1W0U A;  2NS7 A;  2DTZ A;  2FD5 A;  4M3G A;  5IPA A;  3Q0V A;  4MFE A;  3G1M A;  1ZKG A;  2XPU A;  1MBE A;  3HOV J;  3S15 J;  2JN6 A;  3S2H J;  3H0G J;  3HOW J;  1ORK A;  2GM4 A;  1FIA A;  4DZP A;  2LFB A;  2HDD A;  3S1M J;  3OSG A;  3IH4 A;  4D7M A;  3FK7 A;  2DMT A;  3GTG J;  5C4X J;  4AC0 A;  4BY7 J;  3E7L A;  1I50 J;  3DCF A;  2LTP A;  1JTY A;  1MBG A;  3QPL A;  1T33 A;  1Y1V J;  3GTL J;  1NTC A;  1QVT A;  1TWC J;  1GVD A;  1AHD P;  1MBK A;  3MKL A;  1Z77 A;  3S1Q J;  3I4N J;  3LSJ A;  1JUM A;  4XID A;  2CQQ A;  1R9T J;  2XB0 X;  3FKI J;  3M3Y J;  1XG1 A;  4IHY A;  1I6H J;  1OCP A;  5EYR A;  1U9O A;  5IOY A;  2EZK A;  4A3J J;  3F0C A;  4MLO A;  2EQR A;  2IEK A;  4Y7N J;  1WI3 A;  3S16 J;  3ZQH A;  4A3C J;  2D5V A;  1GV5 A;  2TRT A;  2NVT J;  1RPW A;  3I4M J;  2HXI A;  2MW8 A;  1NK3 P;  2ME6 A;  5FKM A;  5EGO B;  5FKL A;  1B72 A;  1ZK8 A;  5E3M A;  5GP9 A;  4AUX A;  5GPA A;  1U78 A;  3BG9 A;  3Q0W A;  3JRF A;  3HB9 A;  1IC8 A;  5EF6 A;  1K83 J;  4D5C A;  5IYB J;  2YS9 A;  3SJM A;  3JRE A;  1JKQ C;  2R92 J;  2G0E A;  3SDG A;  2H8R A;  1HF0 A;  2EH3 A;  2LD5 A;  4M3F A;  1XC5 A;  2E19 A;  3D1N I;  2DMP A;  5F0F A;  1H89 C;  3RZO J;  3BR3 A;  3NAR A;  3ZQI A;  1TWA J;  5JLW A;  5IP7 J;  5E3O A;  2IBD A;  4V2G A;  5EZH A;  2OPT A;  3MN2 A;  1SAN A;  2LP0 A;  3S1N J;  3BR6 A;  2VPR A;  2O7O A;  1GT0 C;  2JJ7 A;  3G1O A;  5FLV A;  4G12 A;  4AYB N;  4A93 J;  1MSE C;  4QIW N;  5EG0 A;  5F04 A;  2CQX A;  3UKG A;  2JA6 J;  2JWT A;  2JK3 A;  2TCT A;  5M3M J;  3GTM J;  3RZD J;  2DA3 A;  2LY9 A;  1RKW A;  4DYR A;  4MO7 A;  2NVY J;  4ABZ A;  1IJW C;  1H88 C;  3HBL A;  3JRA A;  1MH3 A;  4C3I J;  1OJL A;  1XS9 A;  3RKQ A;  3ZQF A;  4D7N A;  1ETO A;  2EZH A;  4MFD A;  2K9N A;  2LLK A;  1AKH B;  3WHC A;  2XB5 A;  1HLV A;  2L9R A;  5F0H A;  3MVP A;  1H8A C;  3CDL A;  3HOY J;  5F27 A;  3HOZ J;  5IOZ A;  1FTT A;  3WHB A;  2WV1 A;  4M3B A;  2DMU A;  4M6V A;  1TWF J;  2DJN A;  3IV5 A;  5C4J J;  1QVU A;  2YU9 J;  1MBJ A;  4XRS A;  1LE8 B;  4A3D J;  5FJ8 J;  3S14 J;  2EBI A;  2KDZ A;  1F43 A;  2K9S A;  3C2B A;  3GBG A;  3GTQ J;  3BR5 A;  1HDD C;  2JA8 J;  2XPV A;  3HGY A;  2COB A;  4A3B J;  1WCM J;  3GTP J;  3JRB A;  4I6Z A;  3BQZ A;  2DA2 A;  1S7E A;  2ELK A;  2VKE A;  4JX5 A;  5J1R A;  1RR7 A;  2MSY A;  2N8G A;  1UMQ A;  5IP9 J;  3GTJ J;  4FIS A;  1LFU P;  2DA4 A;  3HDD A;  4JX4 A;  4IHW A;  1GV2 A;  2HI3 A;  2NS8 A;  2R7Z J;  5M5W J;  3K7A J;  2CUE A;  4V2F A;  2FQ4 A;  1U8B A;  3OSF A;  4DYC A;  3HEF A;  2P81 A;  2KT0 A;  3BTI A;  1FJL A;  2PMZ N;  2ME0 A;  4XRS G;  1D5Y A;  1HCR A;  5M5Y J;  5J3L A;  1DU0 A;  2NOG A;  3HOU J;  1BW5 A;  2WAQ N;  1ITY A;  1JT0 A;  2L7M P;  3TP3 A;  4S0H B;  1ZGW A;  4IHX A;  5DS9 A;  2CU7 A;  3BG3 A;  2LR8 A;  3BG5 A;  1A6I A;  1VFC A;  3TW6 A;  1B72 B;  3SFI A;  1I3Q J;  4IEJ A;  2LVS A;  1ZR4 A;  3PO3 J;  3A01 B;  4D5F A;  4W97 A;  1MSF C;  1G2H A;  3O8G A;  3HM5 A;  1IG7 A;  1FEX A;  2ZB9 A;  4A3M J;  3NAU A;  3B6A A;  3BR1 A;  2XSD C;  1TWG J;  2VKV A;  5F0C A;  1ZTR A;  2Y9Z A;  2DA1 A;  3A01 A;  3FK6 A;  2R5Z A;  2K40 A;  5E3N A;  4MIM A;  1IDZ A;  1JGG A;  1PUF A;  4BXX J;  1Z0X A; 
#chains in the Genus database with same CATH topology
 4RGX A;  4F55 A;  3LSM A;  4FTH A;  3HKZ N;  4WCG A;  4M3D A;  1I1G A;  2MFZ A;  4L9N A;  2QF7 A;  1BA5 A;  5GAG J;  4CYC B;  2XRL A;  1JTX A;  3SXY A;  1DP7 P;  1JUP A;  2JPC A;  2JMW A;  1NK2 P;  4A3I J;  4C2U A;  5FLM J;  1ZG5 A;  2LRE A;  3V42 A;  1POG A;  2QUF A;  2DA5 A;  3DU6 A;  3CMA I;  3B02 A;  3CLO A;  1D1C A;  2YPR A;  2BHY A;  2FBH A;  1LUJ B;  1IN4 A;  2BW3 B;  3BZ6 A;  4KMU X;  5ED4 A;  4J00 A;  1YRN B;  2J5P A;  3ZR8 X;  3H36 A;  4XRM A;  2V1U A;  3F23 A;  2DFF A;  1YIT I;  3ZN0 A;  2K3P A;  4UVA A;  1HDP A;  1B8I A;  4GFB A;  2A61 A;  5FLX K;  1QHH D;  2MG4 A;  2K02 A;  2Y0S N;  3Q9S A;  2XGE A;  2NS0 A;  4QTR A;  3U21 A;  2KP6 A;  1FP2 A;  4E6K G;  5HDG A;  2PX9 A;  1BI1 A;  2ESH A;  1BJA A;  3K2A A;  4BKX A;  5JFR A;  2H6B A;  3FXJ A;  2NVX J;  3ZOB A;  3E5U A;  3P5J A;  3IRR A;  4NHJ A;  4RGR A;  1WJE A;  2O9L A;  1ETX A;  1DDN A;  4BJT A;  1JJ6 C;  1VTN C;  1V4R A;  3QP6 A;  3PO2 J;  1EF4 A;  5DEQ A;  4RGU A;  4M74 A;  1ZQ3 P;  5FKK A;  4LJZ F;  1RKT A;  4C3J J;  5EJC A;  3J81 Z;  2DPD A;  2CQ7 A;  4I76 A;  1BIB A;  3WG7 H;  5CLS A;  1BI2 A;  3KP2 A;  2OF7 A;  3LQQ A;  5D8L B;  4BY1 J;  2EIK H;  3HJE A;  5B1B H;  1USS A;  2PG4 A;  2CV2 A;  3O2P E;  4OIR F;  4RAG A;  3H1C A;  3OIP A;  4BGD A;  3HTS B;  2ZCW A;  2F48 A;  2BY1 A;  4IRH A;  4A6D A;  3V8K A;  2A6H F;  3E3V A;  5DUK A;  1R00 A;  4ZTF A;  1V55 H;  4U88 A;  2HOA A;  4BBR J;  3I56 I;  3WU1 B;  4LOC A;  2RNJ A;  3A1Y A;  3U9G A;  1PJR A;  4UNO A;  2HYJ A;  1WRJ A;  2E2J J;  2DN0 A;  1JI8 A;  2R5Y B;  2X6O A;  3DKW A;  2ADU A;  3VSL A;  4HF1 A;  2PN6 A;  1DGW Y;  4W1U A;  5L3C A;  1T39 A;  4QSH A;  2RQQ A;  5D5V B;  4LG0 A;  1GLN A;  2L5Q A;  2LC2 A;  2KL4 A;  1OYI A;  2ZNY A;  3G3Z A;  2W82 A;  3MQ0 A;  3W6V A;  2IAI A;  4WK8 F;  1YW8 A;  4F52 A;  2B9S A;  2VOD A;  2M0C A;  2FNP A;  4DZJ A;  1IXR C;  2L7F P;  1HKQ A;  3MKY B;  2VQG A;  2J5O A;  2HZD A;  2L4M A;  4FCY A;  2W48 A;  3R0J A;  1K61 A;  5AIP A;  2DK8 A;  1FC3 A;  1T0F A;  3BTJ A;  2GQQ A;  2Q0O A;  3QU3 A;  3QYF A;  3WGH A;  4A3K J;  4YII A;  2NVQ J;  2XAH A;  1MIJ A;  3RYP A;  1O3T A;  2CFX A;  4BE0 A;  3WTT C;  1JHH A;  4AM3 A;  5JR3 A;  3QWL A;  3EYI A;  4HA8 A;  4LIV A;  3H5A A;  2RN7 A;  1O7F A;  3BR0 A;  4D1Q A;  3DEE A;  3KCC A;  2IGO A;  3OOP A;  1YE9 A;  5F1R A;  2WB1 A;  5K7Z A;  3QQA A;  2GAU A;  4HLY A;  1MBH A;  4JX6 A;  1Y39 A;  2A6E F;  1JE8 A;  1IAW A;  4IF4 A;  3ZCO A;  2Z3Y A;  3GVA A;  3PSI A;  2K3F A;  3BPV A;  4HQM A;  2DA6 A;  4JQF A;  2OCE A;  4KN7 X;  3PJR A;  4BQQ A;  1UFM A;  5EG0 B;  1QGP A;  1X2N A;  2ZJP F;  5GPC A;  4HSR A;  5J1U A;  4EM1 A;  1TW3 A;  1T0F C;  1YG2 A;  2F4O B;  3TKY A;  5HLT A;  2E36 A;  4JYK A;  3K4N A;  4Q5S F;  2BE5 F;  2EA4 A;  1S3J A;  2XAG A;  2VUM J;  3ASN H;  1U5T C;  2M8G X;  3BQY A;  4P5O A;  1VZ0 A;  4IQ4 A;  2EFW A;  1UG2 A;  4BXU A;  3S2D J;  2VQH A;  5DCF A;  3GO5 A;  1F9N A;  4UUT A;  3CCY A;  2Z33 A;  1GUU A;  5L3G A;  2JSC A;  3KFW X;  2O3F A;  3ZPL A;  1IRF A;  3PIP F;  1JT6 A;  3RPU A;  4AU7 A;  4L9J A;  4KA4 A;  3RI4 A;  4A3F J;  1K79 A;  4DW6 A;  1T95 A;  2HR3 A;  1S5L C;  4LK1 F;  5K7H A;  1XGM A;  3L1P A;  2B63 J;  4KJZ A;  4G6Q A;  4RA2 A;  3W2V A;  3S3M A;  2CSO A;  2VL8 A;  1D8J A;  4M3G A;  5IPA A;  2QSH X;  3ERE D;  1J2X A;  2XPU A;  2PI0 A;  3H0G J;  4E4H A;  2R7U A;  3HOW J;  3DBH B;  3HUG B;  1FX7 A;  2LFB A;  2HDD A;  3HXL A;  3FK7 A;  4RLF A;  2HQA A;  1HC8 A;  2Y48 A;  4AC0 A;  3OYB A;  4BXF A;  1XCV A;  1R5H A;  2OQG A;  4Y33 A;  1WVR A;  1MDM B;  2AXL A;  4M73 A;  1M1E B;  3GTL J;  3ULQ B;  1TWC J;  2V1D A;  4ESF A;  2CMP A;  3KP7 A;  5HLH A;  4PJJ A;  3LSJ A;  1KU7 A;  1JUM A;  4CCL A;  3CMM A;  2CQQ A;  1R58 A;  1S8N A;  1TQI A;  3FZV A;  1XG1 A;  2F4M B;  2X6Y A;  2LRD A;  2DOA A;  2KFD A;  5EYR A;  1X4P A;  3KZY A;  1XB4 A;  2A68 F;  3F0C A;  3I54 A;  5LHG A;  4RLQ A;  1SAU A;  2KRH A;  3S16 J;  3MZY A;  5ILV A;  3F8M A;  2D5V A;  3BG6 A;  4XSZ F;  4E7I A;  1GV5 A;  4IO9 F;  4GRI A;  1MW7 A;  1X3Z B;  3KZZ A;  2E71 A;  1BBY A;  1J7K A;  1D1A A;  4EJV A;  1QA6 A;  2VB6 A;  5FKM A;  2ISZ A;  3OYL A;  2G7H A;  1ZK8 A;  4UB6 C;  3L9F A;  1YHQ I;  5GPA A;  1YTY A;  3M1C A;  4HDV A;  4E70 A;  4XKC A;  1D0X A;  2LH9 A;  4GDF A;  1YLF A;  4ZDO A;  1B1B A;  1IC8 A;  5CVJ A;  4XN3 A;  1PYV A;  4F93 B;  4BE2 A;  1K83 J;  2XRN A;  4D5C A;  4U0Y A;  2VXZ A;  3OL4 A;  1ZRC A;  3SJM A;  4FQG A;  1S29 A;  1HF0 A;  3W2W A;  4ENM A;  1MMS A;  2LKP A;  1J0R A;  2Q2E A;  2DDA A;  3ABM H;  2DMP A;  5F0F A;  2P5V A;  4BYY A;  1H89 C;  1YJN I;  3RZO J;  2OZ6 A;  3WU2 C;  4XLP F;  3BR3 A;  3GXO A;  3NAR A;  4P96 A;  1TWA J;  2RV8 A;  3V7R A;  2CUZ A;  3LST A;  5EZH A;  2KIS A;  3DTE A;  4CYD A;  2WV0 A;  1SAN A;  1OYW A;  4HZF A;  2QKL B;  2A69 F;  2NNY A;  2HVR A;  1ZH5 A;  3BCB A;  3OL3 A;  4XRF A;  2WAE A;  4OIO F;  2QSG X;  1ZG3 A;  2KZV A;  1T2K A;  4XLC A;  3W6K B;  1IO2 A;  4XN0 A;  2ZC2 A;  2EIN H;  1TQM A;  3R6S A;  3GTM J;  2M45 A;  5HLI A;  2E7W A;  5H2F C;  1CF7 A;  3BRO A;  4KNY A;  3SZP A;  1X1B A;  2D2W A;  2L7K A;  4ZDP A;  1XS9 A;  5B5E C;  4UB8 C;  2G9W A;  4HV6 A;  4MNU A;  1SFE A;  1XN7 A;  4MFD A;  2QEN A;  5HS9 A;  3CUQ A;  1LFP A;  3TQN A;  3V7S A;  3WHC A;  2XB5 A;  2H6C A;  5F0H A;  2OQR A;  3HOY J;  5IOZ A;  3EQL F;  3WG9 A;  2CW0 F;  2WAF A;  1P9Q C;  3L00 A;  5E20 A;  4M6V A;  4B3X A;  3QYB A;  3RQ4 A;  4PSW A;  1VQ8 I;  3TO7 A;  3V4G A;  2GXG A;  4PFP A;  5K1Y A;  3DLA A;  3S14 J;  2JVH A;  4KMF A;  2K9S A;  2HWV A;  2Y75 A;  3K9T A;  3ELK A;  3LAJ A;  3P9I A;  3GBG A;  1SD5 A;  1RNL A;  2HDC A;  4ON0 A;  3HGY A;  3KYD B;  4A2U A;  4EGY A;  3L2V A;  5KAI C;  1KQ0 A;  5CPR B;  4I6Z A;  3BQZ A;  3RJP A;  3J7A Y;  2DA2 A;  2STW A;  1FBQ A;  2FSW A;  3PFY A;  2H94 A;  2FRH A;  1O3Q A;  2EB7 A;  3E1S A;  2MSY A;  4MGR A;  2KIQ A;  3PUF A;  4L9T A;  1YJ9 I;  2VPL A;  4HYE A;  4PZJ A;  3OYH A;  1UHM A;  1TT0 A;  2KPM A;  4JX4 A;  3KEQ A;  1Z7L A;  1FYL A;  4G6T B;  3DF8 A;  2R7Z J;  2UV1 A;  2KIM A;  3TGN A;  3I4P A;  3RPU D;  2UXN A;  2KMU A;  4CZZ A;  4RB2 C;  3WTW C;  3DPU A;  4BQA A;  2YSR A;  3BTI A;  4AVP A;  2JUC A;  1HCR A;  2FA5 A;  4R1H A;  1K4T A;  4DBR A;  3TOA A;  2ZSI B;  4G9Y A;  3CD6 I;  1W7P B;  4NC7 A;  3HOT A;  3MZ8 A;  2FEZ A;  1KA8 A;  3VYR B;  4BJ6 C;  1XDU A;  4CCK A;  1JT0 A;  3TP3 A;  5A2Q Z;  3DQV C;  4B44 A;  3LA7 A;  4RAF A;  3BG3 A;  2ESN A;  3BG5 A;  1A6I A;  5HVQ C;  1VFC A;  1XCB A;  5E8G A;  2LG4 A;  3KEO A;  4GYI A;  4A6E A;  1RUO A;  3A01 B;  1MMG A;  3KIO A;  1X1C A;  1A04 A;  2TDX A;  3TOB A;  3WTZ A;  1PUE E;  3PIO F;  1G2H A;  2K7L A;  1D8K A;  4JBA A;  4O6J A;  1EKE A;  2NAZ A;  4LLL A;  3IRQ A;  1W36 C;  2ZB9 A;  4KT5 C;  3FXU A;  2DPU A;  1G3W A;  2VKV A;  5B3S H;  4HX7 A;  1SC7 A;  2R5Z A;  2BOL A;  3QOD A;  1L3L A;  3GFL A;  3AFH A;  3WU0 A;  2QSF X;  1ZLJ A;  1JGG A;  4LB6 B;  3HRM A;  5J8C A;  1JHF A;  2OBP A;  1FMV A;  3BT9 A;  1DPR A;  3TP0 A;  2HVQ A;  2HOE A;  1E2X A;  4EVI A;  2DCE A;  4C2T A;  1IGN A;  3LSR A;  2LNB A;  1RET A;  2ID3 A;  2DT5 A;  1YIO A;  2XAF A;  1BR4 A;  1ODD A;  2DI3 A;  2F4I A;  1ZRE A;  2BXY A;  3C18 A;  1PUF B;  2PJR B;  2W25 A;  4GGG A;  4I0A A;  1XDS A;  1FZP B;  2HXO A;  2ZKZ A;  3OOU A;  3R60 A;  4CSW A;  5J4Y A;  4CDG A;  1V5E A;  4Q4Z F;  2VJ4 A;  3HSE A;  3S17 J;  1YYV A;  3FXQ A;  2QQ9 A;  2VC0 A;  1FNN A;  2DFI A;  4FX0 A;  2M2E A;  1Y1W J;  2AO9 A;  1YX5 A;  1RIO H;  1IXS B;  3FMS A;  2DDB A;  4KIG A;  5L3F A;  2LK2 A;  3CJT B;  4CCM A;  3HPG A;  3CZ6 A;  2R7R A;  4A3G J;  2Y30 A;  1Z1D A;  3K4C A;  1N25 A;  3VYT B;  4A69 C;  4DJA A;  1GDT A;  4NB5 A;  2K85 A;  1IUF A;  3BOQ A;  2XAJ A;  1WH7 A;  4GO1 A;  3T8R A;  4JOM A;  5IP6 A;  1OCZ H;  1IXC A;  1SFK A;  1VND A;  1Y8R B;  2LMD A;  3EUH C;  1LB2 A;  2R7X A;  5BPI A;  3LA3 A;  2L3D A;  5F64 A;  4M9X A;  4IHV A;  1B8I B;  5HNH A;  1TC3 C;  3A0H C;  2M30 A;  5BPD A;  5LHH A;  1X58 A;  3OYG A;  1DQU A;  1QNT A;  3ERM A;  1I1S A;  1MH4 A;  4I0B A;  1U2W A;  5CVI A;  2Z99 A;  1P92 A;  1Y8Q B;  3VSK A;  1SMT A;  3DP7 A;  3J81 K;  1LE8 A;  2BZT A;  3C2H A;  3K6G A;  1AU7 A;  3CC7 I;  3CCS I;  3GTK J;  4XKB A;  3JSO A;  2ID6 A;  2KQR A;  2F5E A;  2VQC A;  2BYV E;  2CV0 A;  3W2A A;  1HW1 A;  5GTI C;  1GHC A;  5DDG A;  3QU6 A;  2LBF B;  2CG4 A;  4L9V A;  4U7B A;  3KEY A;  1MNE A;  1X19 A;  1U9N A;  2XF6 A;  3H5R A;  3O8H A;  3KP5 A;  2L0K A;  2WBM A;  3A03 A;  1SMY F;  3OIO A;  3I53 A;  4XSX F;  2DA7 A;  1ZAO A;  4UXN A;  4RB1 A;  5ICF A;  3O3K A;  4IOC F;  1SVL A;  5L3B A;  2DT6 A;  2LKS A;  2ZJ2 A;  4FE7 A;  3F9K A;  2ECB A;  1SFX A;  4IJA A;  5IT3 A;  1J75 A;  2H8W A;  1S7A A;  4XR6 A;  4M9S A;  5FLX Z;  2F5F A;  3WTY C;  3ZQG A;  2E1M B;  3FMR A;  2XGX A;  2EK5 A;  5F6F A;  2M34 A;  5H20 A;  1T6S A;  2FU4 A;  4XLH A;  1V5F A;  1IN6 A;  5EEG A;  4HG2 A;  3KLN A;  2JA7 J;  1HBX G;  2Z9O A;  4UV9 A;  2GOX B;  3LQR A;  4DYQ A;  4HW0 A;  5HOD A;  1I27 A;  1Q1H A;  3W3C A;  2D45 A;  2R93 J;  4C2M J;  1EA3 A;  2PMU A;  2QLZ A;  2R5Y A;  4GYG A;  2QYO A;  2XDV A;  1FSE A;  1KYW A;  6PAX A;  5JLX A;  4ENJ A;  1IRG A;  3GUD A;  2VAS A;  1JXS A;  1BC8 C;  2L01 A;  4A3E J;  3K4K A;  1TW2 A;  2VOP A;  3MMY B;  4RS8 A;  3H0D A;  1EV7 A;  1OR7 C;  1FIP A;  3E5X A;  2Q8K A;  2QCO A;  2R7V A;  4B1R A;  1A35 A;  2M3A A;  1H9T A;  4LG3 A;  3M8F A;  3L2U A;  4J19 A;  3GTO J;  1LDD A;  2ECC A;  2MD0 A;  1TLH B;  3VWB A;  3OYM A;  4QPO A;  5EDN A;  5J40 A;  1KGS A;  3QOP A;  2VT3 A;  3K69 A;  4B48 A;  4HNV A;  3OYC A;  5E1X A;  1B59 A;  5C44 J;  3CUO A;  3ZQL A;  3J80 K;  3JW4 A;  5FO5 A;  2E34 A;  4BUP A;  1UHS A;  3RPQ A;  4B4C A;  5DUI A;  1ULY A;  2FX0 A;  2A07 F;  3O6B B;  2MYS A;  3JRD A;  5E79 C;  1W1W E;  2XGD A;  3GME A;  3IH3 A;  3NWS A;  4HEA 2;  3DBL B;  3OYN A;  2IT0 A;  4UUS B;  1QPI A;  2YR2 A;  5LD2 C;  2E7X A;  2IW5 A;  2I5U A;  4U0W A;  5ILS A;  1HST A;  1SD4 A;  3QPS A;  1ETV A;  1OCT C;  4XKW A;  2X48 A;  3H35 A;  2P0W A;  1SVM A;  1R22 A;  1ZN2 A;  3CUQ B;  3HSR A;  1T38 A;  1R4N B;  2VKH A;  4IZZ A;  1KU2 A;  3BWG A;  1MJ9 A;  4L18 B;  4RB0 A;  4M6X A;  3VFZ A;  3DWL E;  2VT2 A;  3ZMU A;  2FML A;  2X1E A;  3JTH A;  1HKT A;  2M1B A;  4RM3 A;  5K5O A;  1FBU A;  1XTA A;  1QZY A;  3OYF A;  4Z6Y A;  5H6R A;  3H5N A;  3CCV I;  4HX8 A;  2JPB A;  3Q0V A;  4MFE A;  4ESJ A;  1MBE A;  2IGK A;  2JN6 A;  1LQ1 A;  4ZYD A;  3ZMV A;  1FIA A;  4HST A;  3S1M J;  2MD5 A;  4O5V A;  3IH4 A;  1I39 A;  1A31 A;  1ZGJ A;  2DMT A;  4UVC A;  4I09 A;  5C4X J;  4TV7 A;  4CUG A;  1I50 J;  2LF7 A;  4I7H A;  3DCF A;  3MKW B;  5CJ9 A;  4XMY A;  4Z2Y A;  1JTY A;  3NQO A;  3MEX A;  1MBG A;  4PK4 A;  3HUG A;  4WXD A;  1NTC A;  2HDW A;  2DO7 A;  2ZO4 A;  1Z77 A;  3C7J A;  3V8J A;  2P5L C;  4YFN F;  2LYC A;  4HAM A;  1ZLK A;  5LEJ A;  1IRX A;  1YI2 I;  3CUQ C;  1ZAR A;  3MZH A;  2KJC A;  3IHU A;  4A3J J;  2R3S A;  3M7G A;  1SD6 A;  2IEK A;  1WI3 A;  3CES A;  2E5N A;  3ZQH A;  1W7P A;  2VOO A;  2KRC A;  1G59 A;  2E35 A;  2TRT A;  3PUB A;  1G3T A;  1N78 A;  5DCM A;  2MW8 A;  2VN2 A;  5CVV A;  4IOA F;  3TO9 A;  2EIJ H;  3F6V A;  5EGO B;  5FKL A;  5GP9 A;  4AUX A;  5B1A H;  2CQN A;  4CA0 A;  1YQA A;  1I5Z A;  3BG9 A;  1S9H A;  1VQL I;  5E18 F;  3H92 A;  3FHZ A;  1ZHF A;  2GZW A;  3HB9 A;  5EF6 A;  4DBQ A;  2IA2 A;  2YS9 A;  3LA2 A;  5CKT A;  3H3U A;  1D5V A;  4XON A;  3RSN A;  2H8R A;  3ESW B;  1OPC A;  5FFX A;  4IHT A;  3CCM I;  1N75 A;  1ON2 A;  2DJI A;  2HZT A;  1QZZ A;  3CDH A;  3GEZ A;  2L9S A;  3LSI A;  5FFZ A;  2QZ8 A;  3I0T A;  2XKO A;  4HLX A;  2GIZ A;  4FHT A;  5E1Z B;  3IWZ A;  3WE2 A;  1V3F A;  4PJL A;  2OA4 A;  1PP8 F;  2IA1 A;  4AVZ A;  4MEY F;  3OR1 C;  5HNF A;  1PDN C;  3K4M A;  4C9Y A;  5B66 C;  2WA0 A;  3MN2 A;  2LP0 A;  4EMS A;  4P9F A;  3BR6 A;  3H9Q A;  3OYE A;  3TBI A;  4NC8 A;  2O7O A;  1ONV A;  2JJ7 A;  2EFP A;  3G1O A;  2ELH A;  3EET A;  4A93 J;  1MSE C;  5F04 A;  3AG1 H;  3S3N A;  1RC9 A;  5LGN A;  1XX5 A;  2JK3 A;  1FLI A;  5HLG A;  4BQO A;  3AG3 H;  5M3M J;  5DM7 F;  3NRV A;  2O6G E;  4RB3 C;  2C6Y A;  4MO7 A;  2V79 A;  3IC7 A;  2CW8 A;  3QRF F;  3J80 Z;  2ZJR F;  5TGT A;  3GFI A;  3ZMS A;  3GWZ A;  3DXJ F;  2B7E A;  3WTS C;  2HGC A;  1LNW A;  4EJU A;  5LBQ A;  1YIJ I;  3K2Z A;  1AA7 A;  4FT8 A;  3S8P A;  3MVP A;  3CDL A;  2CO5 A;  2Z2S B;  1WJB A;  1FTT A;  1K78 A;  1KON A;  2WV1 A;  4ANJ A;  4D0P A;  1WJA A;  5C4J J;  1IV8 A;  4BEH B;  4ZYE A;  2YX7 A;  4K2E A;  4XM3 A;  4XRS A;  5FJ8 J;  2KJB A;  1LE8 B;  2XC7 A;  2EBI A;  2KDZ A;  1F43 A;  3ASO H;  3HRU A;  4YEJ A;  4PCQ A;  2EWN A;  1ZGA A;  3GTQ J;  1P4X A;  1HDD C;  4AIJ A;  5FRM A;  2NNN A;  3H3Z A;  2XPV A;  2BEO A;  3R61 A;  1D0Z A;  2LSO A;  2XF5 A;  3GTP J;  3JRB A;  3T8T A;  5LGT A;  1O57 A;  2ELK A;  2ELJ A;  2K86 A;  2DAO A;  4UHT A;  1L0O C;  2HEO A;  2COM A;  1FT9 A;  5GTH C;  3GTJ J;  2E5Z A;  1LFU P;  2V9K A;  2DA4 A;  1Y0N A;  4BDY A;  3RKY A;  4F91 B;  3Q9V A;  5M5W J;  4KN4 X;  2K4B A;  4V2F A;  3COA C;  2MLK A;  2FQ4 A;  2JTV A;  3OSF A;  3FKJ A;  4G6D A;  4DYC A;  1TNS A;  3K70 C;  5IY5 H;  4YG2 F;  4UVB A;  2KT0 A;  3I58 A;  3CO7 C;  4XRS G;  3BJO A;  1DUX C;  5J3L A;  1DU0 A;  1ZRF A;  2NOG A;  3HOU J;  4CH7 A;  2WAQ N;  1XSX A;  4IPA A;  3W6J B;  4S0H B;  5FB2 A;  4IHX A;  4IHS A;  3D5R C;  3HYI A;  4F3Q A;  4CO8 A;  5A2Q K;  3BP8 A;  5LFA A;  2R7D A;  5KCM A;  1B72 B;  1BM9 A;  1D3Y A;  1X1P A;  1G3S A;  1I3Q J;  3S32 A;  4IEJ A;  1ZR4 A;  1J9I A;  3WTU C;  4IVN A;  2VBW A;  1OCO H;  4OWR B;  3HOS A;  3K4L A;  3JAM K;  1OQY A;  1P6R A;  4PJN A;  1R71 A;  4Y17 A;  3GX4 X;  4KT6 A;  2PQ8 A;  3LFU A;  4LLN A;  2RVC A;  1IN7 A;  1W5C C;  3BR1 A;  3B6A A;  3NAU A;  2V1X A;  5CYV A;  5BQT A;  3LSH A;  5DM6 F;  1G4D A;  3VOE A;  1ZTR A;  2Y9Z A;  1K4S A;  4QWQ A;  3A01 A;  4BAC A;  1REP C;  3FK6 A;  1IN8 A;  2K40 A;  3SQN A;  3BJA A;  3RCO A;  3SDB A;  5LLQ A;  3HSF A;  1T98 A;  2FF4 A;  4HV5 A;  4IL6 C;  5LEK A;  3JCU C;  4RM2 A;  1WJ5 A;  2M87 A;  3VYU B;  4BXX J;  4KDP A;  2HKO A;  3QPT A;  2YU3 A;  2F5D A;  4I98 B;  2UXX A;  5E3L A;  2W7N A;  4L5I A;  2M9H A;  2VE9 A;  2GXA A;  3WGG A;  2R5Z B;  3H9J A;  1VQK I;  5DTD A;  2A5Y B;  2PJP A;  1K6O A;  1WPK A;  1XPX A;  1K7A A;  1LDK B;  2WB1 N;  4LD5 A;  3C1D A;  2QEX I;  3Q3S A;  5BMZ A;  1SFO J;  1VQ4 I;  1TT5 B;  2HTJ A;  2BY3 A;  1MNM C;  2HVS A;  3ECH A;  2V6E A;  2R4G A;  3EYY A;  3F8F A;  4B43 A;  1IZ1 A;  4UUS A;  2AQE A;  4NUB A;  3H3V K;  2PJR A;  3TW7 A;  1HOM A;  4B47 A;  1P7I A;  4D9J A;  1IF1 A;  1RR8 C;  4WXH A;  1XMK A;  2EV5 A;  4RDU A;  2CUJ A;  2VKD A;  1ENH A;  1E3O C;  3HKZ A;  4M3E A;  2BVL A;  2HPI A;  2QQB A;  3IH2 A;  1R23 A;  3B6C A;  2DMN A;  5D5W B;  1EH6 A;  3A4C A;  1JKR C;  1OLT A;  5J1Y A;  3CCU I;  2OCC H;  3OYJ A;  3CP2 A;  2LKX A;  4EV0 A;  3TDU C;  5M3F J;  3S1R J;  2WAD A;  4L5E A;  1ETW A;  4FET A;  1Z7U A;  3K70 D;  2ZNZ A;  2YUS A;  4U0V A;  2FOW A;  5JHU A;  1GXQ A;  3ZQC A;  1BIA A;  2HQR A;  2X1D A;  2DYR H;  5LRS A;  1T56 A;  2ZBK A;  3M4O J;  1LFB A;  2PEX A;  2W24 A;  1IUY A;  5M5X J;  2GXB A;  4XLF A;  2HQ5 A;  4RBO A;  1W0T A;  1ACI A;  2GOM A;  1U5T B;  4AID A;  4XIC A;  4X6A J;  2QKM B;  3CP8 A;  1OMI A;  1YFH A;  2KIU A;  3JTG A;  3GFM A;  3KP3 A;  1B9N A;  2G7U A;  2ACJ A;  2JZY A;  1LEA A;  2GIV A;  1LVA A;  1ETQ A;  2E1O A;  3HOX J;  1WQ2 A;  3DBR B;  4X1E A;  1FSH A;  1WJC A;  1OKR A;  1WJD A;  5IYC J;  2QGU A;  3EDP A;  3G6E I;  2BY2 A;  2PMZ A;  4E7H A;  1FOK A;  4MQV A;  3JRI A;  2WTE A;  5J8F A;  1VQ6 I;  3TO6 A;  2L4A A;  5E1W A;  1YW7 A;  4N9I A;  5HDN A;  2LBF A;  2L9N A;  4JK1 X;  4BHC A;  2JA5 J;  1BJZ A;  3ML6 A;  3M9A A;  2FE3 A;  3LL7 A;  4BDZ A;  3BTC A;  2GLO A;  4M71 A;  1LKX A;  1JGS A;  1FOW A;  2KKO A;  1LVK A;  4WXC A;  2FBK A;  3FDY A;  3N4M A;  3K4J A;  2FJ1 A;  4LMY A;  3VOD A;  5DCM B;  2R7W A;  1SFU A;  4BJ5 C;  2NYX A;  3BZC A;  2XIG A;  5EGO A;  4A12 A;  3CMY A;  1WSU A;  3CDI A;  2DYS H;  1G8X A;  1YOV B;  1AWC A;  3F72 A;  3IAM 2;  2LOO A;  2HPM A;  2OV7 A;  3BR2 A;  4IXA A;  2EFQ A;  1MBF A;  1HW2 A;  1T8I A;  3ROU A;  3I59 B;  2HTS A;  4P55 A;  5J4V A;  3EPZ A;  2O5R A;  1KYZ A;  1UST A;  4XKV A;  1J59 A;  1RRJ A;  1ZYR F;  5ERI A;  2Y0S A;  2X4H A;  1ETK A;  2BXZ A;  4NC6 A;  1BOA A;  4KIT B;  3JR9 A;  2L02 A;  1JKO C;  3REO A;  1IRZ A;  1I6X A;  3UNG C;  2P6S A;  2E2H J;  1YW9 A;  4XL9 A;  2JT1 A;  1Z3X A;  1HSJ A;  3PM1 A;  1MND A;  2W57 A;  2EZL A;  3U1K A;  1VI0 A;  2FOK A;  2HQN A;  3DLL F;  2CV1 A;  1X1D A;  3JRG A;  3RYR A;  5KNL A;  4IKF A;  5F1J A;  3X2Q H;  2Y31 A;  3C3W A;  2HNH A;  2X6W A;  5F08 A;  1FBS A;  1TP4 A;  1UG0 A;  3LSG A;  4OOI A;  3KET A;  1J09 A;  1R6R A;  5TJJ A;  1W36 D;  2XF7 A;  1MD0 A;  1Z05 A;  2M5W A;  4ZDL A;  2AHQ A;  1UCR A;  1H0M A;  1A6Q A;  2KZG A;  3RDI A;  1X2M A;  4L5J A;  2F2E A;  1FWZ A;  3IKV A;  2ZXI A;  1JJ8 C;  2Z5U A;  2WC2 A;  2PMH A;  1TZL A;  3K1M A;  1MJA A;  2FBI A;  1ETY A;  4XK4 A;  2BHZ A;  2EV6 A;  2ZSH B;  4P1W A;  4LLG F;  4FE4 A;  4AYB A;  3HL2 A;  1Z21 A;  4Y4R A;  4N4N B;  3TED A;  4KIB A;  5K7F A;  1FTZ A;  1U0J A;  2MH2 A;  3H9G A;  1UZC A;  3ISP A;  3AL0 C;  4L0Z B;  2IA0 A;  1D0Y A;  2OU2 A;  3F3X A;  4OIN F;  2OUM A;  5FKN A;  3U2R A;  1F36 A;  2Q1Z B;  2VON A;  3FIS A;  1F1Z A;  4ZYH A;  4YFX F;  3ONQ A;  5LGU A;  3M8J A;  4BHB A;  1S72 I;  1JUS A;  3LNQ A;  1TBX A;  1WWX A;  3Q0U A;  2QBY A;  3L2C A;  2KIF A;  2NS7 A;  1QO0 D;  2FD5 A;  3G1M A;  3HOV J;  3E6B A;  3S15 J;  3PL8 A;  3S2H J;  1WFX A;  1YS7 A;  4HNU A;  2P8T A;  2MC4 A;  4PFO A;  3FWE A;  3GZ5 A;  2GM4 A;  3I5U A;  1KQ9 A;  3LMM A;  4C30 A;  4D7M A;  2NVU B;  5CQG A;  2FXA A;  3J7Y J;  3CO6 C;  4BY7 J;  2GA2 A;  3E7L A;  1RI7 A;  1XGS A;  3QYE A;  4BU2 A;  2CH0 A;  2LTP A;  2VJ5 A;  2V4J C;  3CC2 I;  2EIL H;  1T08 B;  2QM3 A;  1FOX A;  2VJI A;  1T33 A;  3F8N A;  2E1M C;  4KIC A;  4KUM A;  2R7Q A;  3ZQ7 A;  1Y1V J;  2OC6 A;  1NH3 A;  1QVT A;  3M8E A;  3S1Q J;  3I4N J;  3S93 A;  1YX3 A;  4CZC A;  4XID A;  3D5S C;  2XB0 X;  3BCA A;  1R9T J;  3FKI J;  2Y0M A;  3BJ6 A;  1I6H J;  1UJ8 A;  1IN5 A;  1U9O A;  5IOY A;  2EZK A;  1X3W B;  2QA4 I;  2AQF A;  1FPQ A;  3FXL A;  2EQR A;  1V5G A;  3QOE A;  1PVE A;  1MKM A;  4R8H A;  3G71 I;  4BS9 A;  2NVT J;  2VBY A;  3I4M J;  2HXI A;  4ZZL A;  1R4M B;  1XMX A;  2ME6 A;  1B72 A;  3PNY A;  3ZN1 A;  3WE3 A;  1MZB A;  3M1E A;  2Z16 A;  1U78 A;  1EH7 A;  4KFC A;  3JRF A;  4ETS A;  3V7C A;  4EAT A;  5IYB J;  4U7D A;  1JKQ C;  3CLQ A;  3LAP A;  2JVG A;  4NNJ A;  1FOY A;  2IRF G;  3GLL A;  3S2W A;  1R1V A;  2E19 A;  4Y15 A;  4OAZ A;  5FGM A;  3D1N I;  4EGZ A;  2OAZ A;  4ZC3 A;  4KIF A;  1MGT A;  3OMY A;  5KAF C;  4O3M A;  2M8E A;  3IAS 2;  5JLW A;  3WGI A;  5IP7 J;  1F5T A;  5E3O A;  1TQP A;  4V2G A;  3MFK A;  2F5V A;  1H9G A;  2OD5 A;  4ZYA A;  5L3E A;  2F5C A;  2FMY A;  3I9V 2;  2YX4 A;  3S1N J;  1A36 A;  1W5T A;  3L09 A;  3TMO A;  3N97 A;  3FXM A;  2VPR A;  1U8R A;  2O0Y A;  5FLV A;  2MLG A;  4G12 A;  2H09 A;  4ZJZ A;  1FYK A;  2P7C B;  3LWF A;  2IP2 A;  4DIQ A;  2CQX A;  3CJQ B;  2JA6 J;  4S05 A;  1GXP A;  1TL8 A;  2TCT A;  4XNF A;  3CCE I;  3E5Q A;  5TIS C;  2V1N A;  1QU3 A;  3DPT A;  1RKW A;  4DYR A;  4ABZ A;  1IJW C;  3PNV A;  3K1N A;  5GAE J;  1MH3 A;  4C3I J;  3ZMT A;  1I3A A;  4HPQ A;  3RKQ A;  4E7L A;  3ZQF A;  4DGW B;  3FXR A;  2GWR A;  4P9U A;  4EJW A;  1AKH B;  2K9N A;  2LLK A;  3KLO A;  3QAH A;  3CCJ I;  1LJ9 A;  4ENK A;  2DOF A;  2VQL A;  4ITV A;  2JRM A;  1EH8 A;  1KU3 A;  2X85 A;  5F27 A;  2ZXH A;  5J47 A;  2NRA C;  3JSP A;  3OWT A;  4H0E A;  2VBX A;  3FXK A;  5E8I A;  5HS7 A;  2BY0 A;  4M3B A;  4AIK A;  3HHH A;  1TWF J;  2DJN A;  3AG4 H;  3DTI A;  3IV5 A;  3Q5F A;  2DQL A;  2YU9 J;  3ZGK A;  3SEZ A;  3CCQ I;  3OR2 C;  2BVM A;  2FUG 2;  3C2B A;  3VB2 A;  2O8X A;  3CF5 F;  4M6Y A;  2HFH A;  1U5T A;  2K9M A;  1K78 B;  4XOT A;  3GCM A;  2VE8 A;  3FHN A;  4NQW B;  1HQC A;  4II3 A;  1ON1 A;  4UV8 A;  2DTR A;  3MKZ A;  3HC7 A;  1FY7 A;  2DOE A;  5EEH A;  2RDP A;  4BEH A;  3J7Z I;  2CW7 A;  3KP4 A;  3OS2 A;  4ESB A;  4JX5 A;  1RR7 A;  1V54 H;  3NWT A;  1QQI A;  2DFE A;  3OV8 A;  1VQO I;  4QLC U;  1UMQ A;  4A5N A;  2M4K A;  5IP9 J;  4YFK F;  4FIS A;  3FBN B;  4OMZ A;  5D6F A;  1TNT A;  4IHW A;  3I3L A;  2NS8 A;  2WY7 Q;  2ZME A;  3K7A J;  3D0S A;  1BN5 A;  2DQR A;  4RGS A;  1B4A A;  2CUE A;  2D1V A;  3SFZ A;  1CGP A;  1U8B A;  5LRR A;  3HEF A;  5FRN A;  4ZZD A;  2P81 A;  5H6Q A;  4CHU A;  3PQJ A;  1D5Y A;  2OTL I;  2KDO A;  4ZTJ A;  1WJF A;  2M4G A;  3I64 A;  3IKT A;  4DNC A;  3V8L A;  2H27 A;  1BW5 A;  3SEQ A;  4UY8 I;  1R1T A;  1ITY A;  2IS4 A;  4XLN F;  1MMN A;  1WHU A;  1ZGW A;  1RUN A;  3I71 A;  4GXO A;  5BOX A;  2UWM A;  4FX4 A;  3E6D A;  4E7J A;  2LR8 A;  2JQ7 A;  2LF8 A;  3IP4 B;  3BPX A;  5CVR A;  4QPQ A;  2LY1 A;  2XAU A;  2P5K A;  3SFI A;  3SYT A;  2EIM H;  3PO3 J;  1OR7 A;  1MSF C;  2IGN A;  4MQ9 F;  1UAA A;  1U6G A;  3HM5 A;  1DPU A;  3TDZ C;  3VYS B;  1IG7 A;  1FEX A;  4A3M J;  4S04 A;  2GA1 A;  3JAM Z;  2LDU A;  1SVO A;  2VIX A;  3LFK A;  4I02 A;  5BS6 A;  2XSD C;  1R7J A;  2ZFU A;  2UUZ A;  2AS5 F;  3T0Y A;  1OYY A;  2RNG A;  3G4S I;  2CYY A;  5D8K B;  4MIM A;  2K9L A;  1IDZ A;  4EM0 B;  3KZI C;  4XBF A;  1Z0X A;  2RQP A;  1Z6T A;  5E17 F;  3BG7 A;  4J01 A;  4E7K A;  1BL0 A;  2V7F A;  3LSK A;  4EM2 A;  2Y69 H;  4HX4 A;  2E60 A;  3OY9 A;  2VLA A;  2BW3 A;  4A3L J;  3OYK A;  2UZK A;  4F7Z A;  3K4B A;  1CF7 B;  2F6C A;  5J6X A;  5IYD J;  5C3E J;  2H1K A;  1XGO A;  2XHK A;  4OU0 A;  4DQ2 A;  1VQN I;  3T5X A;  4BAY A;  2A5W A;  4MTD A;  1WGX A;  4Y13 A;  5D5X B;  3FBI B;  4A5M A;  1O4X A;  3DFG A;  2R0Q C;  1MMD A;  2K27 A;  2LY2 A;  1WH5 A;  2IS2 A;  3ECO A;  1B9M A;  2I10 A;  2XGC A;  4YIF A;  1O3R A;  3ZP5 A;  3HG9 A;  1VQP I;  2WY8 Q;  1E0E A;  3SHF A;  2O8K A;  5AON A;  2RRE A;  3RQI A;  3KPH A;  4B3A A;  5ICC A;  2E2I J;  3GFJ A;  4LK0 F;  2I8D A;  3T1B A;  4WX9 A;  2JRT A;  2CUF A;  2L2O A;  2QQ8 A;  4AWX B;  3FIW A;  3C2G A;  1KU9 A;  3F21 A;  3MD2 A;  2QBY B;  3U1D A;  3F8B A;  4OIQ F;  1CQT A;  2X9D A;  3HGG A;  1BR2 A;  3SZG A;  5BNG A;  4HOB A;  3ZXS A;  5DV5 A;  5IT9 K;  1NG6 A;  1MJB A;  3CJN A;  3WTV C;  3ABK H;  1HA8 A;  2L7Z A;  3KP6 A;  1P7J A;  1BW6 A;  4EQQ A;  4IX7 A;  2GBY A;  2PLY A;  3BTL A;  3OS1 A;  3EUK L;  3A02 A;  1SAX A;  1VQ5 I;  2V26 A;  3HHG A;  5ICE A;  1S6L A;  4FAS D;  4N4O B;  3BZK A;  1NG7 A;  2OZU A;  3K1P A;  4Y52 J;  4A0Z A;  1Z91 A;  3ZQQ A;  3DTK A;  1MMA A;  4EJT A;  2Y9Y A;  3WOD F;  4V19 K;  2QQA A;  4G8X A;  3VPR A;  5HDK A;  1TWH J;  1FP1 D;  3PQK A;  1WKM A;  1QZE A;  3AL0 B;  4ZYG A;  4N9H A;  4G7O F;  2WWY A;  2L54 A;  4EEF G;  2MGQ A;  3ZMZ A;  2EJR A;  5EZG A;  4OIP F;  5IT9 Z;  5JHF A;  2O61 A;  2VBZ A;  3HTU A;  1IV6 A;  4PGG A;  3DV8 A;  4WF2 A;  1DGR M;  2DMQ A;  3L7W A;  3TL4 X;  3E6C C;  1R5G A;  4IQJ A;  4IRG A;  2EA2 A;  1BC7 C;  2JA2 A;  2MH9 A;  4NDL A;  3LSP A;  1SEU A;  3G73 A;  2R7F A;  4RAZ A;  2X1C A;  4YEL A;  5FKO A;  5FD5 A;  3SZT A;  5K5Q A;  3FM3 A;  3IWF A;  3JRC A;  1A5J A;  5D6E A;  4EJO A;  3FF5 A;  3CQZ J;  3FXO A;  2VJJ A;  2P6T A;  3I59 A;  2CRG A;  2ISY A;  2K5C A;  2EPF A;  4HRI A;  2HOT A;  3LOC A;  1UB9 A;  1DU6 A;  2H1L A;  3BLY A;  2DBB A;  4ASN A;  1BI0 A;  4PDK A;  2K4J A;  5GAH J;  2IPQ X;  4L0Y B;  2V6C A;  3P9K A;  3EUA A;  3RTR A;  1QRY A;  3JRH A;  1XD7 A;  1ZR2 A;  4U87 A;  4PUS A;  2HOS A;  3CC4 I;  1QHG A;  3DEU A;  3N05 A;  4CYC A;  1UHW A;  3G2B A;  2XPW A;  3PFI A;  4AD9 A;  2ZJQ F;  2CGP A;  2KHM A;  4BBS J;  5EEA A;  4PGH A;  2MAB A;  2Y2Z A;  2RAE A;  4KIS A;  3R4K A;  1RES A;  5D4R A;  1Z9C A;  1F4K A;  4YRV A;  4XOR A;  1Z67 A;  1IDY A;  3KE2 A;  4BQN A;  2CJJ A;  3VDX A;  1OFC X;  4E7Z A;  3R0A A;  1YRN A;  2X51 A;  3G1L A;  1Z6R A;  4Y3O A;  1BOB A;  4Q47 A;  1YS6 A;  2HS5 A;  2KLO A;  2VI6 A;  3ZRG A;  2K9Q A;  1U3E M;  4HDU A;  2DOD A;  4PSX A;  3ZMD A;  1VF9 A;  2RC4 A;  4JP0 A;  4PJM A;  3IL2 A;  1OIS A;  4F92 B;  1GVJ A;  1X1A A;  3P9C A;  1AKH A;  4CCN A;  4I99 C;  4LFU A;  1G3Y A;  3KYL A;  3CME I;  4XLE A;  3DEW A;  5D4S A;  1R49 A;  1APL C;  1BI3 A;  2MBF A;  1Q1V A;  2BBY A;  2VXD A;  5DD8 A;  3A0B C;  1AOY A;  1JKP C;  4C3H J;  3K10 A;  2EZI A;  2D1H A;  9ANT A;  3A2K A;  1B6A A;  4BE1 A;  5JVT A;  1W0U A;  3F6O A;  1E3P A;  2DTZ A;  3BY6 A;  4H4K C;  2XUB A;  3ABT A;  1ZKG A;  2DXI A;  1ZRD A;  4I01 A;  1ORK A;  2NOJ B;  2XVC A;  3AG2 H;  1FYM A;  2ETH A;  2EV0 A;  4DZP A;  4NQW A;  3L2Q A;  1WZ2 A;  3OSG A;  3E97 A;  5KHD A;  2ZXJ A;  3GTG J;  1BR1 A;  3E6M A;  3OS0 A;  1R1U A;  1FMW A;  3B73 A;  4X0G A;  3MWM A;  4B09 A;  3MCZ A;  2JUG A;  3QPL A;  3EUH A;  5CVU A;  3IUO A;  2QWW A;  3GLX A;  2M7B A;  3BDD A;  1EJ9 A;  1GVD A;  4UUV A;  1AHD P;  1MBK A;  3MKL A;  2ZME B;  3OYD A;  2DFH A;  2EFO A;  1K6Y A;  1XSV A;  3M3Y J;  3CJR B;  4IHY A;  1SD7 A;  1OCP A;  3DKY A;  4ENN A;  4CIC A;  4MLO A;  1W7P D;  5HS8 A;  2DU9 A;  4Y7N J;  1QPM A;  3AAF A;  4A3C J;  1XGN A;  3WTX C;  4XLA A;  1QBJ A;  1VQ9 I;  1UEL B;  1RPW A;  1ERD A;  2W1O A;  1NK3 P;  2CWE A;  1RZ4 A;  3MAJ A;  2IJL A;  5DYM A;  4LG0 B;  5E3M A;  4MTE A;  3GZN B;  1VQM I;  2DLL A;  4CGZ A;  4A0X A;  2L9V A;  3Q0W A;  1G6N A;  1DP3 A;  5ILU A;  2VC1 A;  3S3O A;  1C0W A;  1KZH A;  1Z3Y A;  2W84 A;  3NEU A;  5JVG F;  2M0M A;  3JRE A;  2R92 J;  2G0E A;  3SDG A;  2STT A;  2E1C A;  2EH3 A;  4BNC A;  1W5S A;  3CF2 A;  3KYC B;  1IW7 F;  2LD5 A;  1E17 A;  1O7L A;  4M3F A;  1VQ7 I;  1XC5 A;  3FX3 A;  2A6T A;  4I2O A;  2W85 A;  3QP5 A;  4XQF A;  3J7A O;  3PSF A;  4MEX F;  3ZQI A;  1X3U A;  1OCR H;  3F8C A;  2IS1 A;  1Y0U A;  2BGC A;  2IBD A;  2OTJ I;  2HU9 A;  3CTA A;  2R7S A;  3L2R A;  3VEP A;  2RKH A;  4RAY A;  3CCL I;  2OPT A;  3GW2 A;  2ZFW A;  2OJE D;  4RMN A;  4YIR X;  1YJW I;  1D1B A;  1GT0 C;  4CCJ A;  2P4W A;  1O3S A;  5K5R A;  3HRT A;  2QVO A;  4HF0 A;  4AYB N;  3HRS A;  3HIF A;  2O03 A;  4G7Z F;  1STZ A;  2WAQ A;  4Q48 A;  4II2 A;  4QIW N;  5HOO A;  5EG0 A;  3CCR I;  2V9V A;  2HYF A;  3UKG A;  2JWT A;  4AIH A;  4B8X A;  1P2F A;  2IVM A;  4GCV A;  1R36 A;  3FM5 A;  5KK1 A;  3RZD J;  2ZXW H;  2DA3 A;  2XKP A;  2LY9 A;  2W00 A;  3GF2 A;  4ZH4 F;  2NVY J;  1H88 C;  3HBL A;  3JRA A;  1NHA A;  1OJL A;  4M9Z A;  2XAS A;  3FMQ A;  4HF2 A;  2M7A A;  3HPH A;  2HYG D;  4D7N A;  1ETO A;  2EZH A;  3RIR A;  5KVR A;  5ICG A;  1LPQ A;  4DOZ A;  3DU5 A;  4LIT A;  3AKZ A;  3P7N A;  1HLV A;  2L9R A;  4G94 A;  1H8A C;  2IGM A;  5LHI A;  2HKX A;  4OAY A;  4A0Y A;  3HOZ J;  2FQ3 A;  3RKW A;  2CS3 A;  2ZME C;  3E0J B;  4KYW A;  3WHB A;  1P4W A;  5JI6 A;  3L2W A;  2DMU A;  1E3H A;  2XV4 S;  1QVU A;  3DPL C;  3UR3 C;  1MBJ A;  4A3D J;  4BL0 B;  4HQE A;  2DK5 A;  4HNT A;  2X6X A;  2B0L A;  3BR5 A;  2JA8 J;  4CXF A;  2COB A;  5L3D A;  4A3B J;  1WCM J;  2BV6 A;  2X0L A;  5FRO A;  2MC3 A;  1S7O A;  1S7E A;  4LB5 A;  3GZ6 A;  2R7O A;  2VKE A;  5J1R A;  3QPH A;  2MA3 A;  2N8G A;  5AIQ A;  1MDM A;  1N77 A;  1HXD A;  5D5U B;  2RGV A;  4IRI A;  3RKX A;  3HDD A;  2KRF A;  1J5Y A;  4XOP A;  3I55 I;  3GYH X;  3ABL H;  3F22 A;  1GV2 A;  1LDJ A;  2HI3 A;  2CQK A;  1OCC H;  3OYA A;  1W4M A;  2W4S A;  2CFO A;  1KQ8 A;  3PNT A;  4E7S A;  2A3S A;  4CCO A;  2XSJ C;  1PP7 U;  4LGW A;  1X4O A;  3KX2 A;  5TRD A;  1P4A A;  1FJL A;  5FD6 A;  2PMZ N;  2ME0 A;  4NBQ A;  4MHG A;  2IXS A;  5M5Y J;  4PJ0 C;  4M72 A;  1ZEL A;  2IS6 A;  1ZG1 A;  3M07 A;  2ICW G;  2P7V B;  1YO5 C;  3OYI A;  1Y56 A;  2L7M P;  4N0B A;  1WI9 A;  2E1N A;  1Y6I A;  1XMA A;  4HBL A;  5DS9 A;  2CU7 A;  4WWC A;  3TW6 A;  1R5I D;  4BHP A;  3ABU A;  2FNA A;  3HZJ A;  5GAD J;  2LVS A;  2JSP A;  4G7H F;  4D5F A;  4W97 A;  4OMY A;  3O8G A;  2XRO A;  2NXN B;  2PBI A;  5DD4 A;  1XSD A;  3OIQ A;  2AXT C;  5CQE A;  2DT7 B;  1TWG J;  5F0C A;  1LEB A;  2DA1 A;  4BH9 A;  2A05 A;  5E3N A;  2Q2E B;  2DW4 A;  2EFN A;  1HW5 A;  3BC8 A;  3K0L A;  1HKS A;  4R79 A;  2Z1D A;  2PFB A;  2R7T A;  3D5L A;  2XAQ A;  3DKX A;  4LIU A;  2V9P A;  1PUF A;  1TTY A; 
#chains in the Genus database with same CATH homology
 3BT9 A;  3TP0 A;  1BL0 A;  5E3L A;  4FTH A;  3HKZ N;  4M3D A;  2M9H A;  1IGN A;  3LSR A;  2QF7 A;  4A3L J;  1RET A;  2R5Z B;  1BA5 A;  4CYC B;  2ID3 A;  2XRL A;  1JTX A;  5DTD A;  5IYD J;  1JUP A;  1WPK A;  5C3E J;  2H1K A;  1PUF B;  2JMW A;  1NK2 P;  4A3I J;  2WB1 N;  5FLM J;  1POG A;  2HXO A;  3OOU A;  2DA5 A;  3Q3S A;  1SFO J;  1WGX A;  1MNM C;  1O4X A;  2R0Q C;  3S17 J;  1WH5 A;  1YRN B;  2I10 A;  2XGC A;  2M2E A;  1Y1W J;  2AO9 A;  4UUS A;  4XRM A;  3H3V K;  3TW7 A;  1HOM A;  1P7I A;  2O8K A;  1HDP A;  2LK2 A;  4A3G J;  1B8I A;  4GFB A;  2Y30 A;  3RQI A;  4B3A A;  2MG4 A;  4A69 C;  2E2I J;  4RDU A;  1GDT A;  2Y0S N;  2XGE A;  1IUF A;  1ENH A;  1E3O C;  4QTR A;  2CUF A;  1WH7 A;  3FIW A;  4M3E A;  5IP6 A;  1VND A;  3IH2 A;  3B6C A;  2DMN A;  3K2A A;  1JKR C;  4IHV A;  5J1Y A;  1B8I B;  4BKX A;  2LKX A;  5M3F J;  1TC3 C;  2NVX J;  3S1R J;  3ZOB A;  4L5E A;  1ETW A;  2YUS A;  1ETX A;  2O9L A;  1X58 A;  1CQT A;  2X9D A;  3HGG A;  3ZQC A;  1JJ6 C;  1MH4 A;  5BNG A;  1EF4 A;  3PO2 J;  1T56 A;  3M4O J;  1LFB A;  1ZQ3 P;  5FKK A;  1LE8 A;  5M5X J;  1RKT A;  2L7Z A;  4C3J J;  2HQ5 A;  1AU7 A;  4RBO A;  1W0T A;  1P7J A;  1BW6 A;  3GTK J;  2GBY A;  3BTL A;  4I76 A;  4XIC A;  4X6A J;  2ID6 A;  3A02 A;  2OF7 A;  4BY1 J;  1ETQ A;  2E1O A;  3HOX J;  4X1E A;  1U9N A;  4Y52 J;  3O8H A;  2L0K A;  5IYC J;  3A03 A;  3OIO A;  2DA7 A;  2Y9Y A;  3JRI A;  3VPR A;  1TWH J;  4FE7 A;  2ECB A;  2HOA A;  2JA5 J;  1BJZ A;  4BBR J;  4EEF G;  2MGQ A;  2GLO A;  4LOC A;  3BTC A;  5EZG A;  3ZQG A;  1IV6 A;  2HYJ A;  2M34 A;  2DMQ A;  2FJ1 A;  2E2J J;  2DN0 A;  2R5Y B;  2X6O A;  4W1U A;  2JA7 J;  4QSH A;  5EGO A;  3CMY A;  4NDL A;  3LSP A;  3BR2 A;  4DYQ A;  1MBF A;  5HOD A;  3W6V A;  2IAI A;  5FKO A;  2R93 J;  4C2M J;  2M0C A;  4DZJ A;  2R5Y A;  2L7F P;  3JRC A;  1ETK A;  1A5J A;  4FCY A;  5JLX A;  2W48 A;  1K61 A;  3CQZ J;  3BTJ A;  3JR9 A;  4A3K J;  1JKO C;  4A3E J;  2NVQ J;  1IRZ A;  2CRG A;  2E2H J;  2HOT A;  3LOC A;  1FIP A;  3PM1 A;  2QCO A;  1DU6 A;  2EZL A;  4B1R A;  1VI0 A;  3BR0 A;  3JRG A;  3GTO J;  4J19 A;  5F1J A;  2ECC A;  2Y31 A;  5K7Z A;  3QQA A;  5F08 A;  1MBH A;  5EDN A;  4JX6 A;  1QRY A;  3LSG A;  4HNV A;  3JRH A;  1ZR2 A;  5C44 J;  2HOS A;  4CYC A;  3ZQL A;  2DA6 A;  2XPW A;  4BBS J;  2AHQ A;  5EEA A;  1UHS A;  1X2M A;  4B4C A;  2Y2Z A;  5EG0 B;  2RAE A;  2FX0 A;  1RES A;  1JJ8 C;  1X2N A;  5GPC A;  3JRD A;  5J1U A;  2XGD A;  1IDY A;  3IH3 A;  1ETY A;  2CJJ A;  4XK4 A;  4JYK A;  1OFC X;  1YRN A;  3G1L A;  4FE4 A;  4UUS B;  1QPI A;  2VUM J;  2M8G X;  2VI6 A;  3BQY A;  2K9Q A;  3TED A;  3QPS A;  1ETV A;  1UG2 A;  5K7F A;  1OCT C;  3S2D J;  1FTZ A;  2X48 A;  1VF9 A;  4JP0 A;  4UUT A;  3CCY A;  1GUU A;  1AKH A;  5FKN A;  3DEW A;  1JT6 A;  1F36 A;  1APL C;  3FIS A;  4A3F J;  4DW6 A;  1Q1V A;  5K7H A;  4C3H J;  1JKP C;  1JUS A;  2EZI A;  3L1P A;  9ANT A;  2B63 J;  3LNQ A;  3Q0U A;  1W0U A;  2NS7 A;  2DTZ A;  2FD5 A;  4M3G A;  5IPA A;  3Q0V A;  4MFE A;  3G1M A;  1ZKG A;  2XPU A;  1MBE A;  3HOV J;  3S15 J;  2JN6 A;  3S2H J;  3H0G J;  3HOW J;  1ORK A;  2GM4 A;  1FIA A;  4DZP A;  2LFB A;  2HDD A;  3S1M J;  3OSG A;  3IH4 A;  4D7M A;  3FK7 A;  2DMT A;  3GTG J;  5C4X J;  4AC0 A;  4BY7 J;  3E7L A;  1I50 J;  3DCF A;  2LTP A;  1JTY A;  1MBG A;  3QPL A;  1T33 A;  1Y1V J;  3GTL J;  1NTC A;  1QVT A;  1TWC J;  1GVD A;  1AHD P;  1MBK A;  3MKL A;  1Z77 A;  3S1Q J;  3I4N J;  3LSJ A;  1JUM A;  4XID A;  2CQQ A;  1R9T J;  2XB0 X;  3FKI J;  3M3Y J;  1XG1 A;  4IHY A;  1I6H J;  1OCP A;  5EYR A;  1U9O A;  5IOY A;  2EZK A;  4A3J J;  3F0C A;  4MLO A;  2EQR A;  2IEK A;  4Y7N J;  1WI3 A;  3S16 J;  3ZQH A;  4A3C J;  2D5V A;  1GV5 A;  2TRT A;  2NVT J;  1RPW A;  3I4M J;  2HXI A;  2MW8 A;  1NK3 P;  2ME6 A;  5FKM A;  5EGO B;  5FKL A;  1B72 A;  1ZK8 A;  5E3M A;  5GP9 A;  4AUX A;  5GPA A;  1U78 A;  3BG9 A;  3Q0W A;  3JRF A;  3HB9 A;  1IC8 A;  5EF6 A;  1K83 J;  4D5C A;  5IYB J;  2YS9 A;  3SJM A;  3JRE A;  1JKQ C;  2R92 J;  2G0E A;  3SDG A;  2H8R A;  1HF0 A;  2EH3 A;  2LD5 A;  4M3F A;  1XC5 A;  2E19 A;  3D1N I;  2DMP A;  5F0F A;  1H89 C;  3RZO J;  3BR3 A;  3NAR A;  3ZQI A;  1TWA J;  5JLW A;  5IP7 J;  5E3O A;  2IBD A;  4V2G A;  5EZH A;  2OPT A;  3MN2 A;  1SAN A;  2LP0 A;  3S1N J;  3BR6 A;  2VPR A;  2O7O A;  1GT0 C;  2JJ7 A;  3G1O A;  5FLV A;  4G12 A;  4AYB N;  4A93 J;  1MSE C;  4QIW N;  5EG0 A;  5F04 A;  2CQX A;  3UKG A;  2JA6 J;  2JWT A;  2JK3 A;  2TCT A;  5M3M J;  3GTM J;  3RZD J;  2DA3 A;  2LY9 A;  1RKW A;  4DYR A;  4MO7 A;  2NVY J;  4ABZ A;  1IJW C;  1H88 C;  3HBL A;  3JRA A;  1MH3 A;  4C3I J;  1OJL A;  1XS9 A;  3RKQ A;  3ZQF A;  4D7N A;  1ETO A;  2EZH A;  4MFD A;  2K9N A;  2LLK A;  1AKH B;  3WHC A;  2XB5 A;  1HLV A;  2L9R A;  5F0H A;  3MVP A;  1H8A C;  3CDL A;  3HOY J;  5F27 A;  3HOZ J;  5IOZ A;  1FTT A;  3WHB A;  2WV1 A;  4M3B A;  2DMU A;  4M6V A;  1TWF J;  2DJN A;  3IV5 A;  5C4J J;  1QVU A;  2YU9 J;  1MBJ A;  4XRS A;  1LE8 B;  4A3D J;  5FJ8 J;  3S14 J;  2EBI A;  2KDZ A;  1F43 A;  2K9S A;  3C2B A;  3GBG A;  3GTQ J;  3BR5 A;  1HDD C;  2JA8 J;  2XPV A;  3HGY A;  2COB A;  4A3B J;  1WCM J;  3GTP J;  3JRB A;  4I6Z A;  3BQZ A;  2DA2 A;  1S7E A;  2ELK A;  2VKE A;  4JX5 A;  5J1R A;  1RR7 A;  2MSY A;  2N8G A;  1UMQ A;  5IP9 J;  3GTJ J;  4FIS A;  1LFU P;  2DA4 A;  3HDD A;  4JX4 A;  4IHW A;  1GV2 A;  2HI3 A;  2NS8 A;  2R7Z J;  5M5W J;  3K7A J;  2CUE A;  4V2F A;  2FQ4 A;  1U8B A;  3OSF A;  4DYC A;  3HEF A;  2P81 A;  2KT0 A;  3BTI A;  1FJL A;  2PMZ N;  2ME0 A;  4XRS G;  1D5Y A;  1HCR A;  5M5Y J;  5J3L A;  1DU0 A;  2NOG A;  3HOU J;  1BW5 A;  2WAQ N;  1ITY A;  1JT0 A;  2L7M P;  3TP3 A;  4S0H B;  1ZGW A;  4IHX A;  5DS9 A;  2CU7 A;  3BG3 A;  2LR8 A;  3BG5 A;  1A6I A;  1VFC A;  3TW6 A;  1B72 B;  3SFI A;  1I3Q J;  4IEJ A;  2LVS A;  1ZR4 A;  3PO3 J;  3A01 B;  4D5F A;  4W97 A;  1MSF C;  1G2H A;  3O8G A;  3HM5 A;  1IG7 A;  1FEX A;  2ZB9 A;  4A3M J;  3NAU A;  3B6A A;  3BR1 A;  2XSD C;  1TWG J;  2VKV A;  5F0C A;  1ZTR A;  2Y9Z A;  2DA1 A;  3A01 A;  3FK6 A;  2R5Z A;  2K40 A;  5E3N A;  4MIM A;  1IDZ A;  1JGG A;  1PUF A;  4BXX J;  1Z0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...