2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
molecule keywords CSA3
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
1QQIA 3J81Z 3FXRA 2GIVA 3L2CA 1IN6A 2NAZA 4KA4A 3ABUA 3GLXA 1S29A 1FYMA 2MA3A 4A0XA 1Y0UA 2GZWA 1TQPA 2XGXA 1SAXA 3DFGA 3RYRA 4L9TA 2ACJA 2HS5A 1MJAA 4MEXF 1MZBA 4NHJA 5BMZA 5ICFA 5IT9K 3C3WA 5H6RA 1U6GA 5HOOA 4KNYA 3ZMTA 2A61A 4MQVA 2G7UA 1BJAA 3HTSB 5BPIA 2XASA 1LVAA 2M8EA 2C6YA 1TQMA 1IXSB 2QVOA 4R8HA 1R00A 2PG4A 4A0YA 4FT8A 4ESJA 5K5OA 5BQTA 1B9MA 4EVIA 2FSWA 1T39A 4Y17A 1U78A 2VONA 3K1NA 3P9CA 3EUHA 1HW5A 4EQQA 4BAYA 3NRVA 4BH9A 2STWA 5FLXK 2HTSA 2Z99A 4G7HF 2RN7A 3LFKA 1QZYA 2RDPA 2GA1A 3VB2A 2DO7A 2UXNA 1ZGAA 2RQPA 3BOQA 4L0YB 3ULQB 4IVNA 2L4AA 3K9TA 3EYIA 2QQAA 1ZRCA 3TO9A 3PFIA 2K86A 4UNOA 1WKMA 1P92A 3ECOA 1S7OA 4IF4A 1LEAA 2O3FA 4ON0A 3I58A 1XSDA 4RB2C 4GXOA 4P96A 2V6CA 1SMTA 2Q8KA 1TW2A 2D1VA 3V7SA 2QLZA 2EFNA 3JSPA 3TOBA 2P4WA 3ECHA 5DCMB 5LGTA 1BC8C 2HDCA 4UV9A 1ZLKA 5DYMA 2QQBA 1IN5A 4H0EA 2B0LA 2OA4A 3FM5A 1ZHFA 1J0RA 3SFZA 5D6EA 2DLLA 1YW7A 1B4AA 5EEGA 5L3FA 1RUOA 2QUFA 1BBYA 3BJOA 3IC7A 1H9TA 3I5UA 1IW7F 2NYXA 4OMYA 3F22A 5HS9A 5E18F 2MBFA 2WC2A 3SXYA 1HKSA 2ELHA 2KIMA 4LK0F 1BI1A 3R0JA 2VBWA 3U1DA 2JZYA 1OYIA 4U0VA 1J9IA 4EM1A 2STTA 1B59A 2Y48A 3F6VA 4O3MA 2YX4A 1JHFA 1FSHA 1OR7A 4EGYA 1OPCA 1D8KA 4DQ2A 2PBIA 5BPDA 2EFQA 3ZMVA 1J7KA 2QYOA 1I5ZA 2NRAC 3JSOA 2M1BA 2K7LA 5L3GA 3LA3A 1O3SA 1XGMA 4OIPF 3EYYA 1DPRA 1KYZA 1YIOA 2GA2A 3QP6A 1ZG1A 3V8KA 1PDNC 4U0WA 4A0ZA 5ED4A 2EFPA 2A5YB 2FMYA 3RTRA 3J81K 4M9SA 3TDUC 3J80K 3H92A 3KFWX 1EH7A 2Z3YA 2MH9A 3BWGA 3TQNA 3HSEA 2XAFA 1XD7A 2MLKA 3R61A 2JT1A 2FXAA 3KZYA 5DCFA 1ULYA 4GO1A 2A07F 2IJLA 2DI3A 1E2XA 3RKWA 4U7DA 3KZZA 3HRSA 1G6NA 4KYWA 3WTYC 1IXCA 3QU6A 2VODA 3F72A 3K1PA 1KU9A 3T0YA 5JR3A 1DDNA 4KMUX 1XSVA 2DW4A 2CSOA 1AWCA 3F8FA 4S04A 3K2ZA 4UXNA 3L00A 2OZUA 5LRSA 4CDGA 1FBSA 1I27A 4QWQA 2DBBA 5D5WB 2BEOA 5DD8A 2KRFA 5JFRA 2K4JA 3I59B 3WE3A 1YW9A 5CVRA 2E1CA 1OMIA 1SFXA 1YQAA 4HX7A 2O0YA 1RNLA 5BOXA 4G6DA 2LF8A 2RKHA 5LHHA 4KIBA 2CW0F 2CO5A 2XKOA 4HZFA 2X4HA 4BHCA 1W4MA 4L9VA 2IT0A 3WTVC 2ZNZA 2GXGA 1WWXA 3C18A 3QP5A 1SFEA 4JQFA 4UVAA 2QBYB 2DTRA 4O6JA 3TGNA 4HX4A 4Q48A 3T1BA 1F1ZA 3F6OA 3P9KA 3SHFA 4ENNA 3VOEA 1KU7A 3BY6A 2J5PA 4HQMA 4RB0A 5CVJA 4B8XA 3TO6A 3H3ZA 4M74A 4M6XA 1FWZA 1JHHA 4HAMA 3CJNA 3CDHA 1V4RA 2DQRA 3DEUA 1ZYRF 2CG4A 1O7FA 1J5YA 4ZH4F 4JBAA 2IPQX 3NQOA 1HQCA 2XHKA 4RB1A 2FNPA 2HR3A 4IRHA 1STZA 1MJ9A 4ZYEA 5D8KB 3B02A 4OIRF 2V79A 4A5MA 3F8BA 2W25A 1SMYF 3ABTA 3K0LA 2G7HA 4NB5A 1EH6A 3WU1B 4EMSA 3REOA 3TDZC 3GUDA 5D5VB 2KJCA 4KN7X 3BP8A 1HXDA 3GFIA 1REPC 1C0WA 2XUBA 3Q5FA 1YS7A 1O57A 2DFIA 2OAZA 2Q2EA 1G3YA 3ZMSA 2ISZA 1JXSA 4RB3C 2VC0A 1BM9A 3RKXA 1BIBA 1DP7P 3FMQA 2WV0A 3JAMZ 3ELKA 3I64A 1XDSA 4RGXA 4I0AA 3K1MA 3ZP5A 1YG2A 3QU3A 1OYYA 1HKQA 3ROUA 5DV5A 3BPVA 1O7LA 1GXPA 2OD5A 1TNTA 1XMAA 5ILVA 2F5DA 1QO0D 2RNJA 3HYIA 4FX0A 1K6OA 3DKWA 4IHSA 3LA7A 2MD5A 4Y13A 5HLHA 3V4GA 1U2WA 1EH8A 2JTVA 3ZN1A 4ENMA 1KQ0A 2RGVA 2O8XA 3T8RA 3IRRA 1PP8F 1ON1A 4PZJA 1H0MA 2V9VA 1QGPA 5ILUA 4HF2A 2A69F 4KIGA 1TTYA 2EJRA 3VFZA 2Z5UA 1Z91A 3ZN0A 1KQ9A 1MD0A 4MTDA 1RIOH 4WK8F 4MEYF 2R7FA 2PI0A 4NQWA 3G3ZA 4P5OA 2E7XA 4KMFA 4YG2F 1CGPA 3I53A 4LD5A 3GO5A 2L02A 3GFLA 4E70A 2EB7A 1O3QA 3RI4A 4HF1A 1W7PA 1FLIA 2E1NA 4L5IA 2OQGA 1KYWA 2ETHA 1E17A 1FP1D 3CLOA 2VT3A 1Z7UA 5F6FA 3MZHA 4AIHA 2PEXA 1KA8A 4RGUA 4AWXB 5K5QA 1TBXA 2A6EF 1K78B 5CVIA 1XCVA 1FX7A 1IRFA 3E3VA 1R1VA 3SZPA 1SFUA 3BROA 1IN7A 4B09A 2K4BA 3FXQA 1S6LA 1S8NA 4YFXF 3E5QA 3E6BA 5HS7A 4PDKA 5HDNA 2P6SA 4OIOF 4G7OF 5LLQA 3KP6A 3RDIA 2IA2A 4N9IA 4XRFA 2K27A 1RI7A 4WXHA 3BZ6A 4XBFA 4UV8A 5FLXZ 2M87A 2UXXA 2OBPA 4I2OA 3BJAA 3DP7A 4IXAA 4IRIA 2EWNA 3R0AA 5FFZA 2JRTA 3I59A 3GX4X 1ZREA 2R7DA 3OV8A 1Z6TA 1R36A 1ZH5A 1ZG3A 3HHGA 2ZMEB 2P7VB 2FBKA 2YX7A 2NNNA 4HF0A 5J8FA 2W84A 1O3RA 2HYGD 2Z33A 2MH2A 3WGGA 1HKTA 2D45A 1F5TA 3Q9VA 3M1EA 5L3BA 1U5TB 1Q1HA 2HFHA 2BBYA 4S05A 4Q4ZF 2CQKA 1LDDA 4M9XA 1ZN2A 2W57A 1S3JA 4F7ZA 2ZKZA 3NEUA 1H9GA 2MLGA 4JK1X 3HHHA 3WTUC 2UZKA 5DUIA 3GWZA 4LG0A 3WTSC 4A6EA 2CWEA 2WTEA 2BE5F 5L3EA 2V1DA 3N97A 4AIKA 3TKYA 2XKPA 1O3TA 1L3LA 5J6XA 4ZYHA 2IA1A 1BI3A 3L7WA 4FHTA 1LDJA 2HQNA 4CO8A 4AIJA 3KCCA 3O2PE 5D4SA 1I1SA 1BIAA 2ZJ2A 2XAQA 1UCRA 5FB2A 3DPTA 1FYLA 4ENJA 1ONVA 3V7CA 2PN6A 3LAPA 5JHUA 1SD5A 1BI2A 2JPBA 3TOAA 5IT3A 4KDPA 2H6CA 2O61A 2ADUA 4HBLA 2VN2A 1KU3A 1ZAOA 3G73A 2PFBA 2CYYA 4P9UA 3J7AO 2D1HA 1FNNA 1ZLJA 3GW2A 3FMRA 2ESHA 1W7PD 1KU2A 1Z05A 1T38A 3TO7A 5AIPA 1IXRC 6PAXA 1XDUA 4GYIA 4LB6B 4PGHA 2XIGA 2FU4A 1KQ8A 2LDUA 4YIFA 3WTWC 3V8LA 4HV6A 3FXUA 3MAJA 2YSRA 3AAFA 2J5OA 4LB5A 3J80Z 1Z9CA 4M72A 2D2WA 2F5FA 2GAUA 5FGMA 4MQ9F 3WU0A 4GGGA 4AD9A 3QAHA 4LLNA 5JI6A 5BS6A 1MJBA 1WQ2A 1HBXG 3E5XA 2QENA 2W85A 5H20A 3JTHA 3FHZA 2GWRA 5F64A 2DPDA 3S2WA 3R4KA 2RV8A 4RGSA 3ZMZA 1USTA 1QNTA 1U3EM 2EV6A 3BJ6A 2EA2A 3MQ0A 2AS5F 3K69A 4UVCA 2HZTA 3LQRA 1IF1A 4EGZA 5LEKA 3P9IA 5ICCA 3I71A 2H09A 1G3WA 4CGZA 5FFXA 2BYVE 1CF7A 2L01A 4Y15A 3DXJF 1G4DA 3GEZA 2VE9A 4CXFA 1LB2A 2V1UA 4HDVA 2EV0A 4P55A 1TNSA 4I09A 3I0TA 1IAWA 3JAMK 4BXUA 4L9JA 1P4WA 3RKYA 4BYYA 4A6DA 5JVTA 3WTTC 3T5XA 4GCVA 4EM0B 1TLHB 4KT5C 5ICGA 5IT9Z 4EJWA 4U88A 1L0OC 2ZXJA 3FX3A 3H3UA 2W24A 2HQRA 2IRFG 2HKXA 3C1DA 1HW2A 1TW3A 2KKOA 4G6QA 4KUMA 1MDMA 3RPQA 1EV7A 2O03A 1YFHA 2DK5A 1ZRFA 1B6AA 1QPMA 1ZG5A 1QZZA 2VBZA 4L0ZB 3MZYA 2IVMA 4CZZA 5TJJA 3WODF 3O6BB 3RJPA 2M5WA 5L3CA 1FBQA 2EK5A 5KK1A 1R5HA 4WX9A 1MGTA 3WGHA 3WGIA 4ZYDA 1FC3A 2HTJA 2VBXA 2A6HF 4YFNF 1R22A 3BPXA 1ZRDA 3C7JA 3OOPA 4M71A 4N9HA 4EJUA 1J59A 5DCMA 3LWFA 4EM2A 3HUGA 1XMKA 1USSA 4GYGA 1HW1A 3GFMA 1IN4A 2FOKA 5HLIA 4Q47A 3GVAA 2CFXA 1I6XA 3U9GA 4ZZDA 3KP3A 1Z6RA 4FX4A 4L18B 2HOEA 1D5VA 4A12A 2H6BA 4YFKF 3KP4A 3HSFA 5LHIA 2PQ8A 2COMA 5AIQA 2QBYA 3HOSA 3GFJA 4G8XA 1F9NA 4PGGA 4OOIA 2QWWA 2VOOA 4L9NA 5ILSA 2XROA 3L09A 4ESFA 4LMYA 2VC1A 5DUKA 2ZFWA 3IWZA 2X0LA 4ZYGA 4N0BA 3CUOA 1R58A 2DK8A 3ML6A 3CUQA 3DV8A 1UHMA 5F1RA 4RAZA 4ENKA 5CVUA 1BN5A 2P5KA 4WF2A 4EJTA 2DU9A 3RYPA 3I4PA 1GXQA 4HW0A 2HWVA 1LDKB 1YLFA 2L4MA 3KP7A 3QPTA 3U2RA 3IL2A 4WCGA 3KETA 4LLLA 1YW8A 3T8TA 4LG0B 1T98A 4MHGA 3VEPA 2UWMA 3WG9A 1IZ1A 1WI9A 1XSXA 5HS8A 3V7RA 3V8JA 1Z1DA 2L54A 2XAGA 3HRMA 2QM3A 1YYVA 2JPCA 2FBHA 3LSTA 2KIUA 3LA2A 1R1UA 4XLPF 1B1BA 2M30A 1IN8A 2OZ6A 2GXBA 4OIQF 2CGPA 2OU2A 4LK1F 1MKMA 4D0PA 3IWFA 1NHAA 1T0FA 3RIRA 1FYKA 4O5VA 5FD6A 1D8JA 2KIFA 4HX8A 1WSUA 5K5RA 1U8RA 3PQKA 3E6MA 2F5EA 2HEOA 2LNBA 3R60A 5E17F 5E1WA 1X3UA 5E8IA 2LKPA 4EJVA 4IRGA 3N4MA 4G9YA 1SD4A 2M45A 1LQ1A 2QQ9A 1J2XA 4M9ZA 2ESNA 5LGUA 3E6DA 1FZPB 2F5CA 2DAOA 4UHTA 2YPRA 3HSRA 1DPUA 2V1XA 5ERIA 3HIFA 3E97A 5D8LB 2RC4A 1UHWA 2FEZA 3E5UA 4KFCA 2XV4S 2VOPA 3F8MA 3MWMA 2H27A 5D5XB 2EFWA 3FMSA 1FPQA 2TDXA 3LQQA 2DPUA 4WXCA 2XVCA 4XLNF 1R5GA 2Y75A 3O3KA 2FRHA 2JSCA 2FNAA 3QPHA 3RPUA 3HOTA 4HQEA 3KLOA 4MGRA 4HA8A 3IHUA 3HTUA 4DNCA 4CHUA 5ICEA 2YR2A 1XB4A 3FM3A 2VXZA 2FBIA 1XGOA 5HVQC 3IRQA 3M8EA 4ETSA 4MTEA 3MCZA 3DF8A 2OQRA 1KGSA 5A2QZ 1G3TA 2P6TA 2QZ8A 1FP2A 5E8GA 3QRFF 1W5TA 4Q5SF 4ZZLA 3ZMDA 1T6SA 5TRDA 3KEOA 4AVPA 2ISYA 2KJBA 2P5LC 4BHPA 4A5NA 1XGNA 2HKOA 1BI0A 3ZQ7A 4L5JA 2FMLA 2A3SA 4IJAA 3P7NA 2Y0MA 3JTGA 2FA5A 5DDGA 1LNWA 4KIFA 4I98B 5AONA 2H94A 4I7HA 2P8TA 5KVRA 4UVBA 1P2FA 3CTAA 4HOBA 5HDGA 2EV5A 3W6JB 2RVCA 2FE3A 1ZGJA 5CYVA 1WRJA 3GYHX 4G7ZF 4HLXA 1TQIA 1FT9A 3Q9SA 5CLSA 1LJ9A 4RGRA 4R1HA 2R3SA 2XRNA 4OU0A 1SD7A 2HYFA 2F2EA 5K1YA 1V3FA 4ASNA 2ZNYA 1K78A 2IA0A 1GVJA 3EDPA 3FWEA 1K79A 3BDDA 5L3DA 5EEHA 1FY7A 1YTYA 5D5UB 4HDUA 1FOKA 2MC3A 3E6CC 5CVVA 2P5VA 3HRUA 2BV6A 5J8CA 3GZ5A 1W7PB 5HLGA 3M7GA 2VBYA 1D3YA 3MEXA 3W6KB 3F8CA 1AOYA 1HSTA 4HV5A 2WWYA 2FQ3A 2IP2A 4U7BA 2NS0A 2VE8A 1T2KA 4KICA 1ZARA 1UB9A 4CYDA 2L3DA 4R79A 3M8FA 1I1GA 4XSZF 1GHCA 1P4AA 5CJ9A 1SD6A 1FBUA 1F4KA 1G3SA 2NNYA 1DUXC 4WXDA 4OINF 2P7CB 1XCBA 4P9FA 3KP2A 4UUVA 5D4RA 1K7AA 3CO7C 1RUNA 5E20A 2ZO4A 3GF2A 3ERED 3LAJA 4RAYA 4IHTA 1ON2A 2FF4A 3F23A 3DQVC 2HGCA 4I01A 2IW5A 4CICA 1J75A 5DEQA 1B9NA 5LBQA 1JGSA 3WE2A 4M6YA 1U5TA 3GXOA 4HLYA 2E7WA 3MFKA 5LRRA 2K02A 3IKTA 3PQJA 3EQLF 1LEBA 1PP7U 1CF7B 3CUQC 3L9FA 1IRGA 5E1XA 5DD4A 2XAHA 1ODDA 1XN7A 4RS8A 2AXLA 1P4XA 1YO5C 1MDMB 2BGCA 4BNCA 5D6FA 2A68F 1A04A 4LLGF 5A2QK 3WTXC 4G94A 2O6GE 3CUQB 2PMHA 2LSOA 1PUEE 4K2EA 3ZMUA 2ZMEA 3WTZA 4PCQA 1HSJA 5LGNA 4BQAA 5LEJA 5HDKA 2XAJA 3R6SA 1R7JA 1YS6A 5FO5A 5H6QA 3F21A 4LJZF 4XSXF 4I0BA 2ZBKA 4U0YA 1R1TA 1OYWA 3F8NA 3KE2A 2PLYA 2PJPA 3D0SA 4LFUA 1IUYA 1P6RA 2GQQA 1OKRA 3D5LA 3EETA 4QLCU 3VODA 1BOAA 1BC7C 4I02A 2DQLA 1VTNC 1UFMA 4WWCA 2G9WA 5E1ZB 4TV7A 3ISPA 1S7AA 4EJOA 4Z2YA 1QBJA 3ZPLA 4IPAA 4LGWA 3HRTA 4ESBA 3FF5A 3SQNA 1U5TC 2YU3A 5LHGA 3CO6C 1FSEA 3M9AA 3QOPA 5FD5A 4A2UA 4EV0A 2VT2A 1JE8A 2LF7A 3GZ6A 2Z9OA 1W5SA 2Q0OA 1R23A 3KLNA 3I54A 4MNUA 1RZ4A 3B73A 2DT5A 4YIIA 3FZVA 4OMZA 4M73A 3KP5A 2PMUA 2EA4A 2ZCWA 2EFOA 3F3XA 3DPLC 1XGSA 3JW4A 3COAC 4HYEA 4KN4X 4BHBA 3KEQA 3SZTA 3IKVA
chains in the Genus database with same CATH superfamily
3HA3A 2ZJYA 3J81Z 3ASZA 1SEPA 1K3TA 2VXYA 3BGIA 5EXEA 4E94A 3FXRA 3FJOA 5AICA 4DCGA 1OC4A 1PX2A 4RVFA 4ETWA 5FDFA 3ZV6A 2GUWA 1FW6A 1JLHA 1IN6A 2J7PD 2ZRDA 1N5OX 2BGLA 2FZVA 1Y6RA 4KW7A 2BM9A 2IWHA 3TL6A 3AIIA 3ABUA 3ZQHA 1E5VA 4DZPA 1XDZA 2H0RA 3CNLA 3IDAA 1D4FA 4J16A 4NZMA 3S6JA 2AKEA 1K4TA 1ANKA 1IJFA 1JAXA 3FKIJ 2DLNA 3HOVJ 1UDCA 4H1UA 4IIJF 4V0OA 4W9NA 4I0WB 3G82C 5FTWA 3E82A 3UT5A 4TLDA 3WXBA 3AG3H 2COUA 1R6DA 2DULA 5CNJA 2M7AA 4M6WB 3TMOA 3MVPA 2VK4A 2WMOB 4EFDA 1Y6GA 2XGXA 4WLVA 3B5IA 1L8LA 1RW4A 4FEYA 3Q0UA 4PS0A 1BS1A 4GSKA 4GYWA 1EFRD 1SG6A 3R3ZA 4RPLA 5FHRA 2FSVC 1RE1A 1T9CA 4DYRA 3BKXA 4QPQA 1JLRA 3GG9A 4PYOA 1VZ3A 1DXYA 2V7FA 1JEEA 3TRDA 4EITA 3BVPA 2IYOA 3NHAA 1W0KD 1FDWA 3KJHA 4I1VA 1NC3A 2HS5A 3OLYA 4MUHA 1QS0A 2RK6A 3W2FA 5BW5A 3G2PA 1YAJA 3FVTA 5K6TA 2GHIA 2GEJA 2HCBA 1C7RA 3R4CA 3AHEA 5BMZA 3IOEA 3PXBA 2PL5A 3IKMB 5ERXA 3THYB 3V8VA 5B12A 1QG0A 3TCNA 2V6FA 1KJWA 2H92A 1QE5A 3C3WA 2Q21A 1QHEA 4OVKA 2VAVA 2AEFA 2AOUB 1TZJA 4IHAA 3DBRB 3C2GA 2ATVA 3LUFA 2GZ2A 3ZQ4A 4BVLA 5JAUA 4FMPA 2NXNB 4Q05A 1CQPA 2R7QA 5ULLA 4B7AA 3CD6I 2NUAA 3DBOB 2IEKA 1GT0C 1IM8A 2DY0A 1OE0A 4I1SA 5FLYA 3ZE8A 5JNRA 2A61A 2GXUA 1OWMA 4C0SA 1YHQI 1T33A 2FMUA 4IXMA 3A3PA 5TJHA 4D8YA 3HTSB 4O33A 4JQCA 3LA8A 1R74A 2FLKA 3D5TA 4RVSA 1Y4AE 2A1TR 2ZBVA 1X3LA 3A37A 4PX3A 4XUCA 1GXSB 4BAZA 3ZHYA 3KPYA 1KARA 2YS6A 3AFNA 3MTJA 4MGHA 1U9IC 4FCVA 4F6LA 1A4IA 3PUHA 2JZNA 2HVRA 2DODA 2Z43A 2XB6A 2M34A 1TQ8A 4UM7A 2QT1A 3CTPA 4WCVA 3RSHA 5B1EA 4XM3A 5C5IA 5JEEA 1S2NA 2RHWA 4B83A 3PL1A 3GBVA 2Z1DA 3SDSA 3SS7X 4ZK2A 1YTUA 3GLQA 4HB4A 3VVBA 1TQMA 1IXSB 3L0CA 2EIKH 1YD7A 4QBTA 4AX4A 1F20A 4TSFD 4GLOA 1UJ6A 1IEQA 2C58A 3IP6A 1C3OA 2PG4A 4A0YA 4FT8A 1FVHA 1YRHA 2RHHA 3MHPA 4KJXA 2XKAA 3EYAA 4YLEA 1N5KA 5A5DA 3OESA 5K5OA 2IY9A 3CVJA 2CNDA 2BKVA 5EMJA 4EVIA 4JC5A 1W93A 1BWQA 1KQOA 3PRKE 4N3NA 4XEHA 3UB4A 1TA4A 4D96A 1E3LA 1U78A 1GGHA 3MTGA 3KZMA 5ES3A 1E6LA 1RRVA 2N1BA 2YFYA 4FQ5A 5HGJA 2XUDA 3UH1A 5C8ZA 3KJQA 3SAJA 2BXZA 4GF5A 3WRXA 3NRVA 1FVFA 3G17A 2RKOA 4JLAA 4XWYA 4BQNA 3D0QA 3VR0A 1RFGE 3TIIA 2NXNA 4UMEA 5F1KA 1B16A 1BHQ1 2OCYC 1XGKA 4I08A 4OOFA 2XWQA 5ALFA 2DERA 1LFBA 4JT2A 3FMGA 3NNNA 4NECA 3A9UA 4MP6A 4JK3A 3ICEA 3DYIA 4JX6A 1S89A 4F52A 1PQ4A 1F1BA 4HFRA 2XCTB 3BHJA 3LFKA 3IAUA 2FWIA 3EZ2A 3IAXA 4LTDA 5LYYA 3MJFA 1A9SA 1G60A 1XTIA 2VZ0A 1WXDA 1AQ6A 2ZT7A 3VSAA 3VB2A 2DO7A 1Z25A 2J31A 2XUQA 3KSRA 4ZICA 2I8AA 3VDXA 1YKFA 4BY7J 1E2FA 2CXSA 2FU5C 2HNBA 3BOQA 3C97A 4KPUA 3TSWA 1BC5A 3WHKA 1FDIA 1HG1A 1SG0A 4OXXA 1PV4A 3VO9A 5IASA 3QJGA 2ZXUA 4M3FA 3PITA 2O3JA 4L0YB 4G26A 5HK8A 5U1PA 5FBVB 3FI9A 5B1DA 2QX8A 4M6WA 3MW8A 4JI1B 1UG2A 8MHTA 3ZN2A 3VPXA 4CIXA 2NSJA 4KLNA 1KBQA 1NN0A 1OYVA 2V0CA 4D4LA 4H16A 4B3SB 4NAHA 1YHYA 1W25A 4YRBA 1SUDA 5E4YA 5I7EA 4DZRA 2QQ8A 4ZYWA 3HLTA 1C4KA 3PS9A 1WKMA 3VYTB 1P92A 4BJ6C 2HDNB 4BDZA 2OAP1 2P1RA 4WN9B 2JGMA 3PUFA 3GPIA 1MH9A 1O8CA 1ZGWA 1X14A 3QVVA 2LCFA 4FGZA 4IXTA 4TT8A 2IEBA 3O75A 4IJVA 4YDRA 4Z0PA 5T4EA 1IAVA 3V7WA 2W6IA 3T3IA 1UP6A 4EG0A 4ON0A 4MVJD 4BFYA 5IWAB 1S9HA 1BXGA 1VQOI 1X7ZA 1G19A 3IMKA 1VLQA 4GPTA 4RQUA 3V5NA 1ZJZA 2P9JA 2IOFK 4NYIQ 1TYDE 1J25A 4GXOA 1V8DA 2C95A 2X0NA 4AB1A 4D4JA 1N7JA 1U8EA 3D7RA 1UFRA 1WZEA 2VWQA 3OIQA 1U94A 4MR8A 2X22A 2V6CA 2BY3A 1FQJA 1KEPA 2PWPA 1DJPA 1FTNA 3C6BA 3HE3A 3K2BA 1SMTA 1Z0JA 2Q8KA 3WLMA 3ZD9A 1LTQA 1ZVQA 3L06A 3A01B 2BW3A 1VQ1A 1CY4A 4QU8A 5I7SA 4XD7A 2M2EA 3GQBA 2BEKA 3NEJA 3T7TA 3Q72A 1MHPA 1ML4A 3QF7A 4QG7A 5DOVA 1KQFA 3FKJA 3HG7A 2VTKA 1P5ZB 1M5RA 1U9OA 3JSPA 4NEGA 2UVPB 1KO1A 2X5OA 2BFEA 1Z77A 3C48A 3CF4A 3FPSA 4TS4A 2EF0A 1QMPA 1OIWA 2JD2A 3W9YA 3ZWQA 1BC8C 1N5LA 2C7VA 5F3RA 1OD6A 2JFNA 3VNBA 3ZI0A 1FZQA 2NZVG 4IWNA 4Z7JA 1NX6A 1WXIA 4N3CA 5ADWA 2QDKA 1ZESA 1O0BA 2O19A 2DLCX 1L5FA 1SVOA 3D4LA 2MDTA 3IH5A 2CBGA 3IUEA 4GP9A 1PQUA 2WIGA 4HDOB 4MWZA 2MJLA 2NXEA 2QQBA 5JS8A 3CEJA 1XTJA 2UZ0A 4PZLA 1Y1VJ 1FP6A 1BE6A 1FS6A 1L7OA 1QFJA 1AM4D 1IY1A 2EP8A 3CCCA 4HDRA 4M60A 1YHZA 2V3WA 3CO5A 3OHPA 3NDPA 3FTEA 3HYSA 2OA4A 4RHTA 3SP1A 3FB1A 4CJXA 2MW8A 3AOGA 3EIXA 1EA7A 4M76B 3BIFA 1E4EB 1ESEA 1J0RA 2DT6A 1SVKA 3PUKA 5ERYA 2O3QA 2DLLA 3FJ1A 3JARA 2BGGA 1DE0A 3NAMA 1WV1A 3WRXC 5FLXA 5E6SA 4QJ3A 4B8ZA 4DFDA 3L1UA 3V46A 4FISA 3JRGA 2WJZB 3BDAA 3JWEA 3L4JA 2D62A 2QG6A 3PNSA 1MB9A 1EQAA 4AP5A 3TLKA 1JXQA 3BQMB 5A5EA 4UAUA 2H07A 2DFPA 4IOAF 2R7KA 1LI7A 3R5XA 1H9TA 4UMVA 1VIDA 3NJ4A 5EE3A 1JEYB 3KXIA 3I5UA 1ZK8A 2FVYA 2J5RA 4S1WA 5F52A 1HLFA 4OMYA 4EA7A 5HUQA 4JA2A 5HS9A 1KFBB 1AV7A 3AQIA 2VQFB 4N4NB 2PUCA 4GP6A 2OXFA 2ARKA 1Q6ZA 1R4NB 3CCMI 3P8ZA 1SOWA 1MZPA 3HDJA 4QNNA 4RV9A 3W8DA 3SXYA 1HKSA 2FN4A 2OXRA 4QRIA 2BFEB 2RARA 2ELHA 4LEIA 1HMPA 1SHJA 2R25B 3FZGA 2P11A 4TLCA 3F7OA 1FMVA 2JJMA 1KR5A 3I5YA 3FGPA 2E1OA 3ABIA 5KCMA 5EL0A 4YI5A 2C77A 3UEOA 5JDIC 3G13A 1V39A 4WNIA 4REMA 3JSXA 3LF1A 1J2TA 2K5UA 4AP9A 4HSEA 4DQUA 5JYDA 5AKEA 3RCOA 4JT8A 1HSZA 2JLCA 4EG5A 4B3IA 1O95D 1DC5A 5J1YA 1FSHA 1OR7A 4D5FA 4HGZA 1RR6A 1W52X 3B6EA 3N6RA 2PVSA 4Y3OA 3S1NJ 4S1NA 2IZ7A 2C96A 4EGYA 1NWHA 1Y4ZA 4PGAA 3ZBQA 1W35A 2LOOA 3KD3A 1IJEA 2YIMA 2H1IA 1HBJA 1BVUA 1VLZA 3D6NB 3IUPA 3KL4A 3KXPA 4GI5A 2PBIA 4V38A 1JR4A 5KNDD 4EUKA 2DOEA 1GNQA 2WE8A 3NUZA 1CZHA 3O90A 3WNQA 2QRVA 3QLEA 3MINB 1DXOA 3ZMVA 1UADA 3AEYA 1J7KA 4ZIRA 1DAGA 1I51A 2X8JA 3BFKA 1Z0XA 3G0CA 3NLLA 3ORFA 1NLUA 2FDRA 4MS3A 1I5ZA 3BIWA 5CG2A 5EKTA 1PR5A 1RI5A 3BCBA 1KEWA 1OUMA 2QTLA 1IU9A 2XIQA 3VXKA 2QZZA 2D2EA 4KGVA 1H42A 3QWFA 5L3GA 3H3FA 1ZRSA 5KTKA 2PEYA 3MWKA 1O3SA 1XGMA 2OECA 5G53C 2ZIXB 1KYZA 4DMHA 1MW7A 1XTZA 2GCIA 1N1MA 2AQ8A 4CKCB 2HXYA 2WI8A 4L4ZA 3EGIA 3NBUA 2M3AA 2G8LA 2P5UA 5IW8A 1IATA 4JJAA 4W6ZA 2RKWA 5LMUB 1UFVA 3PQ4A 4EGQA 3ON5A 2O3TA 5G2OA 2VRCA 4TTJA 1XHFA 1U90A 3HDVA 3P94A 3WL5A 4EECA 3IUQA 1KIMA 2G0TA 1TKAA 3L4KA 1K5GA 2RI0A 5KVQA 3SSAA 1O6FA 3BTOA 4CU2A 5IXSA 4FYWA 1M8GA 3EZ9A 2L9VA 4KOAA 2P9GA 2DYRH 2XVXA 3Q98A 1Z56C 4PAWA 5G0WA 5AKHA 1I7SB 2Z56A 2IPXA 3KFWX 4OSEA 3H42B 3BCRA 4X6UA 5DYWA 3AHFA 2X5XA 3JZFA 2FRDA 3MS2A 2WKQA 3WLAA 2D5CA 2PX6A 2J0SA 4GFDA 2H08A 4N6NA 3JU3A 2ZIUB 1OFUX 1H4QA 1G20E 2XQJA 2NXCA 3ETJA 3OU6A 1UPAA 1MBKA 2W2LA 4RFSB 4HL6A 1XD7A 5E38A 4RF2A 1J56A 3Q7EA 4DMMA 1AUXA 1GNRA 1Y4SA 4OHPA 4C0JA 2COBA 3EUAA 2FGJA 2V8OA 3KBOA 3P0HA 5B4UA 5HM8A 1JDBC 4XORA 1ZCBA 1CUBA 3ZE1B 4OQYA 5DCFA 3GAZA 4BNWA 4GO1A 2A07F 3BQ9A 4MGEA 5M5BA 4Q4HA 3EPPA 3K70C 3ZNOA 3GA5A 2WUGA 2PKQO 3QVJA 3IDOA 4J6EA 4Q02A 3RVRA 1E2XA 2DI3A 3RBXA 3RSNA 1C0KA 1N1DA 3EIEA 4FFDA 4MQ4A 4XJTA 3OZSA 5C5EA 3V8PA 3B6AA 2IHBA 3KZZA 2VUHB 3EGWA 3RHFA 4HH3C 1CS0B 3L1KA 1JMVA 2V3CC 4EUSA 3BCAA 3K0KA 3A02A 4UCQA 2HLDD 1RRCA 4D98A 3ZTYA 4X7RA 2LGJA 3H0KA 3VOTA 3VTZA 1WJGA 4A0FA 4C6TB 3T1OA 1Z0AA 5TE9A 1CDZA 5BQFA 2ORIA 5I7HA 5DHAA 1QONA 2R6CA 3QJ5A 4PUSA 2OESA 3DXXA 3K1PA 3GN1A 4XWAA 4DWVA 3WIOA 2I99A 3HWSA 4WAUA 5IZCA 2H5JA 3RLFA 4A93J 4PZUA 2C00A 2IA5A 1ZD9A 3LE8A 4R2LA 2QZPA 2REBA 2CSOA 4PLZA 3CMAI 4ZP1A 3TBKA 5JS2A 2HU2A 2VQ6A 2XRMA 2IUFA 4J9UE 2C2HA 2LKCA 2VDOB 5D3MB 2ZI6A 3L1HA 4F4DA 1YRNA 2CW8A 2F4OB 3L00A 2OZUA 9ATCA 4J00A 4IMRA 4MQBA 1WNTA 3K9GA 4CDGA 4QAQA 1FBSA 1XNQB 1I27A 1RLOA 2VHTA 4X8OA 4W1PA 1WW8A 1NUUA 3KSZO 3MOGA 2DBBA 1PEYA 1WRBA 2HNKA 1QHFA 5H02A 5IKOA 5CDSA 4LGMA 1T5LA 3PUYA 2F48A 1QVZA 1RI3A 3GFGA 3G0GA 1MCZA 4GVLA 1PJSA 3TLZA 1QF9A 3M7IA 3ZIAD 5A6SA 2GJAA 1KJYA 1M6WA 2Q3EA 3BKWA 3I9JA 3P5BA 4FGSA 4AROA 5AW9A 4KWEA 4P7BA 4UM9B 3PO3J 2BR5A 1W7AA 2V6IA 1O0CA 4TKMA 5CFLA 1C30A 1TC1A 1F2TB 1TEXA 3MCWA 5F9FA 2PZAA 3LHDA 1AKEA 3NTXA 5JAQA 5CB4F 4EKNB 5FV4A 2M8GX 3OF5A 3WR5A 4Q9HA 1XZIA 5JAZA 3WGQA 1WDKA 3KTFA 4S0XA 3EWNA 4G41A 4NDLA 4G4GA 5K8UA 5EXDA 2OE2A 4F3CA 2BGTA 1GDHA 1LBQA 3IXLA 3TUIC 3V80A 2R8RA 3W6NA 4DMLA 2WB1A 2QG4A 2BMVA 2LIPA 3E7PA 1KI2A 2HLPA 3DFIA 1THGA 3MAGA 4TKVB 2C7GA 2CXUA 5C31A 4RULA 3NWOA 1AK9A 2BWJA 4WK6A 4GKKB 1IHDA 2EZTA 3MRXA 4L9VA 4EGCB 3WTVC 2TYSB 3O8RA 1X58A 1LFUP 3VKHA 2CHQA 3OD5A 4MW6A 1QXSA 5A4FS 5C8VA 5L6MB 4Y9UA 4IXWA 5AKGA 3C18A 1WWXA 5JJKA 4EBFA 3ILVA 4OX9B 3JAWB 3WGNA 4R01A 3M70A 3W5VA 5ADVA 4JQFA 1K2VN 2JHFA 2OC6A 3ST7A 1W36D 2ENWA 3R6LA 3VNUA 2NPIA 2ZW9A 3KUXA 1BIFA 5GP9A 1P7PA 4OFXA 1DKUA 1QOQB 4CMIA 4EOGA 1SKMA 3BH7A 5ILGA 3TZBA 4O6JA 3HP4A 4JT4A 1X3SA 1BO6A 3T7IA 3V2IA 1P0MA 4FCTA 2CLHB 4ZVRA 4ESHA 1KZ9A 5IT5A 3EGDA 5BSHA 1F6BA 2BEJA 2YN4A 5F4BA 1I0ZA 1L7NA 2OGTA 4Q48A 5BNGA 1LRKA 1ZW1A 3C15C 3RD5A 4F3KA 1EK5A 3VMFA 1VKRA 3AR9A 2FSFA 4FN4A 4ARCA 3Q3SA 1UOOA 1IOVA 4HAWA 3ROXA 1R4AA 1AD2A 4Y2UA 4KSBA 3VOEA 3EZYA 2CFSA 4GLBA 4ZCSA 4BE4A 2J5PA 5HFNA 2QVLA 2BPOA 1T3SA 1MBEA 5E3MA 4AG6A 2XMBA 4ZCPA 3KYLA 1IQRA 1YZKA 4W8GA 1H23A 3RNOA 4O4HF 4AJ9A 4LF9B 2GHQA 4O3FA 5KTOA 1A4UA 1XYYA 4CMGA 1JHHA 2QTWB 2IXEA 5BQ5A 3SKYA 3VISA 5I9IA 3CJNA 3PPXA 1T5SA 1XX6A 4HRVA 5AKIA 3BZCA 2YKGA 1OX4A 3GJXC 1N8TA 1V4RA 1NM5C 1UFQA 2DQRA 4MRMB 3DEUA 4N6OA 2NU8A 2VJDA 3F90A 1WETA 3KQHA 1KMNA 3R8FA 1OCRH 4ZH4F 5T57A 1PJBA 4UQOA 4BWFB 4Z4QA 1I2MA 1LEHA 2R6AA 3EGVA 3Q4GA 4B4UA 4IO9F 4IVQA 3QQAA 3PDJA 3NALA 3RWBA 4DIKA 4WZAA 2FNPA 4B6GA 4DEVA 4IRHA 4EL5A 4DCTA 3RFVA 4E7PA 4RJKA 1VL5A 3S93A 3O4VA 4HAZA 2PN1A 4IDCA 4CIWA 3GMSA 1FP4A 5D8KB 1SQFA 3HDDA 1ZN7A 2FP4A 4OIRF 1DRJA 1KAMA 1OV4A 1PRYA 2A14A 1V9LA 2IHVA 3FGOA 4D3XA 4D6YA 4OQZA 1Z0ZA 1D4ZA 2GAAA 4YRTA 4A5MA 4NC6A 3F8BA 4OQ4A 3OPMA 4CV2A 4B80A 5KHOC 2W25A 2HPIA 5L4NA 1G5RA 2B35A 1RJFA 1SMYF 4BJ5C 1ITYA 1L5OA 1V7CA 2G7HA 2OTCA 2ROQA 2VDNB 3E9CA 1EH6A 1B1AA 3AUJB 3ZWCA 5JV5A 5KNDA 5DBFA 3C3BA 4BNFA 4N47A 1WZUA 2WV9A 4AMYA 4DDUA 1ZOIA 3LO8A 4Z99A 3LWBA 5HDQA 2D5IA 1XEAA 3K71B 4EJ0A 1ZMXA 2PQ6A 2OLKA 2VJQA 3MJDA 3AH8A 1NVVR 3K73O 5JSZB 2EEZA 1H0KA 5BVHA 2ATCA 1W581 5AHKA 1NE7A 2F00A 3A05A 2ZYSA 1M7BA 3GK3A 4XASA 4BP8A 5D85A 4UARA 2PV0A 1KEUA 4TXNA 2BAGA 2E82A 2GN6A 2QTHA 2RAPA 3LP8A 1R0XA 3NVMB 4LHXA 2XX3A 4NBSA 1ZJJA 4UUNA 4EK9A 2O0MA 3T9CA 4O4HB 4JC8A 4KE7A 5C37A 5AJYA 1HSOA 3HN7A 2DMQA 1ETYA 3EAQA 4C0HA 4D74A 1Q5PA 3M3YJ 1C0WA 2FR8A 3PUVA 6PFKA 4QOJA 3HVHA 1YRBA 4GLJA 2XUBA 3QLVA 4ER7A 2R5YA 4OFBA 4ZVQA 3RUEA 4CEIB 4FYHA 4LX8A 3ZE6A 2DFIA 3U7QA 1HYGA 1NMSA 4M98A 2OAZA 3DXZA 2GR9A 3OFKA 3DMNA 2B94A 3SBDA 3CJQB 2R5ZB 1B00A 1DBVO 3BWMA 1EP2B 1BN6A 3I6BA 3EH2A 4RIIA 1GTMA 3T52A 5DM0A 3WDKA 4BATA 1EBUA 1XD9A 2OOSA 2IYTA 2GZAA 2CLCX 2PAFA 1HWYA 4RB3C 3TBIA 3ML1A 5JXGA 1ABFA 3RKXA 4Q66C 1RRFA 1Y9EA 4LC0A 4LZOA 5AM0A 5BRJA 2A05A 1WCYA 3WWEA 2WKRA 1NW6A 2XKBA 2C3MA 3AEQB 1JGGA 4MV8A 1XBTA 4UJ5A 2IL1A 2ZUCA 4EZBA 1UBCA 2XQGA 3ELKA 3I64A 1XDSA 3ESWB 1YQ9A 2A0WA 2FPGB 4NZOA 4P93A 4QRHA 4BUCA 2BI8A 5F1OA 4G2TA 4R2JA 2A5FA 4CMJA 4BNDA 3N39C 5REQB 3R7DA 3O3CA 4HDKA 3AG1H 5K3FB 3TXYA 3OBBA 5JCZA 3LI2A 2PZBA 4KYVA 4FSXA 3QUTA 4DCMA 3GPCA 4DSAA 1QCDA 2F7SA 4DMRA 5EJ8A 2WNHA 2ASVA 2GEKA 2ZIWB 4GUAA 7MHTA 1IHUA 2AE1A 4C7VA 1ESDA 4F8EA 3EMBA 1HE1C 3I4MJ 1A27A 3WA6A 2CLOB 1XRNA 1FTZA 5C46F 4YMGA 1UMCA 3VZCA 3CCFA 4C0LA 2OD5A 5BSGA 1CBUA 1ODLA 1T10A 1SXIA 2Y93A 5KQPA 5K7ZA 3OZFA 1JG3A 1JUPA 2OVBA 3JD2A 1ESMA 2RGCA 4IUYA 2QM0A 4DG9A 2AK2A 1E6CA 1GTL1 3DO8A 4RDHA 3O31A 3N59A 4XRRA 1ZC3A 2HIMA 2VPIA 3HYIA 1QQ5A 2A33A 2FPOA 3GQVA 1YACA 4FX0A 2XNSA 3L1JA 4NMLA 5DTRA 2ODNA 3LRTA 5HIAA 4IHSA 2HRQA 3B6MA 3JZIA 3GTJJ 4A4DA 4ZIRB 3LA7A 3DF7A 3A3YA 5JANA 1XRMA 2VPWA 3N74A 2MD5A 3R8CA 4Y13A 4DSTA 1U9YA 1OR8A 1R8JA 3MWJA 3K4NA 3O8HA 3ED5A 4C4YA 4PTYA 1NRIA 1ZAYA 1MX3A 2DEUA 4IDGA 3C8DA 3ABRB 3MJSA 2BE9A 1EUQA 1MT0A 1V35A 2VO1A 1U2WA 4DYQA 1EB9A 3GJ3A 3GZNA 3U39A 1LV8A 3K4PA 3HY6A 3QZUA 2Y6UA 5CA1A 3N76A 5F78A 1YJ5A 4ZYXA 1VCOA 4XDHA 1O6BA 5JRJA 1KQ0A 2NO4A 3WAJA 4U6NA 4R81A 3NC4A 4ZREA 2ZS9A 4IFBA 1L1QA 1EP3B 4Z7QB 2Z04A 2KDOA 3G2BA 5G1PA 4KO8A 2OBFA 1H0MA 2E71A 2QLJA 2WPDA 2V9VA 1HDRA 5ILUA 2XDYA 4N18A 4F93B 4JMPA 3UA4A 4L78A 1GD1O 4BMXA 3UJCA 4LIVA 1KETA 2PX3A 4WUTA 5GAHJ 2X3UA 2JLQA 2W2LD 4FKZA 1Q3HA 1NLYA 4OGLA 1TTYA 1ZUNB 1C2YA 3EVBA 4BX9A 4G5QA 2VPXA 5I9BA 5IYCJ 2I7CA 3K20A 3UTCA 4CIDA 3ZN0A 4E33A 3F49S 3KJEA 4RWZA 3IAM2 1U9CA 5DM4A 3S7TA 2R4QA 3PX3A 3UJNA 4MA4A 5ECYA 2GLUA 4PSCA 2HBYA 4NFSA 1Z45A 3T4EA 1VFNA 1E2MA 3WAGA 1QVUA 2GCGA 1FZTA 4HV4A 5F5NA 3RIEA 3W2EA 1HGXA 3TTVA 3GCZA 2H48A 4QATA 3DVLA 5HKAA 1DQSA 2QQEA 3BB3A 4TTVA 4PONA 4B3DA 1BE0A 5CPRB 2BJVA 3ILHA 2QW1A 3UXYA 4EHIA 4V0SA 3COSA 1EFCA 1NYQA 4Q4DA 2YJ3A 4ZI7A 3DFKA 3TP0A 2ZAMA 5FV7A 3K6SB 4YMUA 4TV9A 1K66A 3NV7A 5GVRA 5KYNA 1H1DA 4NI5A 4II2A 4OHYA 1ZH6A 5TGZA 5DNEA 2BXYA 1YCHA 1Y4UA 2JGFA 4GC9A 5ETJA 3DAOA 4IMIB 3AUFA 3E5HA 1CGPA 1LBIA 3HYLA 1UM9A 1CIPA 1XEFA 4LN1A 4F9FA 1CCWA 4LD5A 2CCGA 3PG5A 3ZD6A 1CTQA 3RGGA 4WLFA 2Y99A 1DAHA 3CJTB 3AR6A 3E22A 2L02A 3GFLA 1NTRA 2C8KA 4DCJA 1B3BA 3FBNB 3QKSB 4E70A 1J42A 1O3QA 1PNVA 1PX0A 3B2EA 4FN5A 3C24A 3KK0A 2P91A 5CLGA 4YJKA 5JUWA 4JDUA 2J3DA 3I23A 4JP0A 2BCJQ 2XVZA 4BIIA 1RXUA 1E9AA 3AM1A 4OI0A 1JSZA 4TXJA 4WKOA 4FFLA 3UVEA 2ISCA 4UB8C 5J4VA 3AC0A 1FP1D 1SUWA 4E4YA 1HA3A 4E51A 5LYJB 1G0NA 4AMBA 2M1XA 1EAMA 1GRRA 4P08A 5DSTA 1YFJA 3A0HC 5CPBA 4AVYA 1X8JA 2IYVA 2KHMA 3FR7A 2HZDA 4QGHA 5HTOA 3LQ2A 1KA8A 3BGWA 1PK9A 4GIBA 5IYBJ 3TI7A 1EXWA 3I5MA 4GP7A 2DFVA 1GDTA 3ZY3A 3U21A 4X1YA 1UT8A 1N2HA 5TRTA 3CZ6A 1TBXA 3TFQA 2B2CA 3Q15C 2A6EF 1K78B 1M6HA 3AJ8A 2VH5R 5CVIA 4KR0A 1YBHA 1XCVA 1AGRA 2C99A 4MRNA 1ST3A 4UAVA 1E3JA 5IZCC 4K6HA 1RLUA 3E3VA 4F4UA 3KJZA 3GLGE 3H9JA 3T06B 1SFUA 1TZMA 3F5QA 4UW9A 4E13A 3BR6A 5LDGA 5C5DA 1HTTA 1IN7A 5L4SA 3X1XA 3ISVA 1D2GA 1NVMB 2QRKA 3D81A 2QM7A 2C4WA 2O2SA 2Z4TA 3HU1A 4V0KA 3ND8A 5EWLB 3TSCA 5DNAA 4CPDA 2K4BA 2Y0SN 3I04M 3RUDA 1LI4A 1S6LA 5FR2A 4N4AA 3P2MA 3QXHA 5SYAA 4ER0A 1BX1A 3PB3A 2UUBB 2ECCA 1L8QA 3QYBA 5HDNA 3K92A 2W2VA 2A5JA 2ADMA 1VSBA 4QDKA 3FR8A 4KVAA 2JLBA 2XCOA 3MA0A 3RIGA 2GJ8A 2OYRA 2GN9A 4YMWA 4YECA 4N9IA 3AJEA 3FK7A 3IOBA 3K09C 1KJNA 2RHRA 2VK8A 4LI3X 4LI0A 4RA6B 4M1EA 4RCVA 2OORC 2XBUA 1L9KA 4WTOA 3M81A 3I9FA 2IGNA 3EXIB 5H59A 2OMKA 3TBFA 3WOHA 5F7OA 3DBLB 3H2HA 5FBKA 1D9XA 1X7XB 3BZ6A 3B1WA 5TPZD 3B9QA 4J0GA 5JJCA 2ENUA 3G1MA 4XBFA 1FJHA 4L22A 3TOVA 4QPJC 2OT3B 5F73A 1KEVA 3FNHA 4TL9A 4U2GA 4WCFB 1C0IA 5D5QA 4M1WA 3W1VA 4F4CA 1GPWB 3DCJA 4MS4A 4BPBA 4BCCA 4V24A 4HSTA 5B7PA 4UCXA 2HQ5A 1Z83A 1WJEA 4RQAA 2VXDA 3MZ0A 2C9MA 4P83A 4Q9KA 2I9PA 3GL9A 1R12A 5DMXA 3AR5A 4R8RA 1BYIA 2PT9A 5C4JJ 4QYMA 4YYEA 5KOIA 3IEVA 3DEHA 4RMNA 1NNSA 8ADHA 3PT9A 5K6RA 3OV8A 2ZSUA 2EH3A 4IX7A 4I5FA 1ZH5A 1MJGM 3SM3A 1N33B 2WMYA 2YXPX 1TCVA 3HHGA 1V3UA 3GPBA 2X6OA 1SKBA 3AEUB 4D4MA 5BSFA 5JSQA 3BXGA 4TYWA 3ZWOA 1OJ7A 5KC8A 3EDQA 3QYEA 2P7VB 1N2CB 1RWBA 2VKTA 1F3OA 2RGYA 3HRHA 1NBHA 3NXKA 3HHEA 1ES9A 4UUTA 2HQSA 3G2HA 2XGDA 2YX7A 1NVGA 2OGZA 3LT1A 1BU8A 4ZPJA 4N5DA 2YWBA 4M1TA 1Y8AA 1ZUD1 4UXJA 3GD7A 1W5AA 2W84A 3A9RA 4G1CA 4XLZA 2DWCA 5EIEA 1O3RA 4GX2A 4PC3A 3B3QA 1TP4A 3CB2A 2VQHA 3UHPA 3V7UA 3T3HA 5A62A 3WGGA 1LC3A 3VYSB 1E18A 1JXOA 1C2TA 1NG7A 1H2BA 1PVEA 1WMDA 3NBZC 3IB6A 3Q9VA 3H9EO 2I7VA 3RKRA 2LWIA 2XMZA 2BT4A 5AW1A 5L3BA 3ZIAA 1K2WA 3OYHA 3WB1A 3BXPA 4M8NE 5A06A 1Q1HA 4S05A 4Q4ZF 2BHSA 3OCYA 4HEA1 4ESVA 1TA9A 3W3AA 1SUPA 3BD9A 1OLUA 1KQPA 3DTVB 4IIHA 4DNFA 5J43A 1CQTA 2EEPA 4DS3A 5DIZA 1ZN2A 2FUG1 4HZIA 4MGIR 4BQEA 1HA8A 1AHIA 1WP4A 4IINA 1U3TA 2JQ7A 2FX5A 2JC3A 2TS1A 3NIGB 4HSGA 4CQMB 4BVHA 2ZKZA 3RZDJ 1KZGB 4Z1MD 4DM3A 3IQZA 1T36A 1KO8A 1H9GA 2MLGA 3CQ9A 3EZNA 4RDUA 3UHJA 2DRIA 3R3YA 4AFNA 1Z7WA 4HDSA 5FKOA 4C3OB 3WTUC 1BJTA 1UXOA 2J3EA 3HDYA 4QSMA 4FB5A 5I45A 3DBLA 1KJ8A 1I9GA 4P4LA 5CMLA 1X8XA 3K9QO 5AKZA 3EUKL 1QC5B 2O23A 3A3KA 4QTZA 2J59A 3TBHA 4LG0A 3EGOA 3VJKA 3D7NA 1GVNB 1GAEO 2AK3A 3LHSA 1QVAA 2QNRA 2G08A 3K30A 4IDPA 2WDZA 3P2JA 5L3EA 2V1DA 3T3GA 1XNHA 3N97A 5GJVC 5CTJA 5JXJA 2XKPA 3FHJA 2JATA 4A0QA 4GOLD 4C29A 1TT0A 4YRGA 5ER6A 3F5FA 3SPXA 5CU7A 4H4KC 4QO7A 4HWKA 5JHFA 4MDHA 4ZYHA 2IA1A 5AKKA 4IIDA 1EKEA 1F9AA 3L7WA 1EDZA 3E6AA 4EKYA 4MUYA 2HQNA 1PW5A 4NOMA 2CNNA 1VI5A 1EIWA 4X64B 2A4KA 5CT6A 1J0XO 3ZWAA 3KCCA 1VGQA 4TS3A 2W11A 3NJRA 5D4SA 4RFLA 3THRA 1RZRA 2JJ2A 3AXTA 2WZCA 1RWXA 4EVRA 2UZIR 5K3BA 3F6RA 1RETA 3OQ1A 4IICA 5FB2A 4ZVNA 3OCJA 4R54A 4X00A 3DPTA 2FLWA 3IP7A 1DPGA 2QN8A 5C35A 2XPCA 2RSLA 1M10A 2XSJC 4CEHB 4TQ9A 4U2FA 1FNCA 3LC2O 4X92A 4ENWA 1QIFA 3VNRA 3WZLA 3H6KA 4C2UA 2GTIA 2GBCA 4JOCA 2BONA 3V7CA 1L3IA 4OKIA 1MBZA 5TR9A 1NBIA 1YCFA 2BR4A 2GOXB 3OIWA 1AA9A 5AH0A 4B75A 3STHA 4YYZA 1E3QA 3UV3A 3WLJA 3FH0A 3PFHA 1XMQB 2OB2A 1OFTA 2ZI3A 2D59A 3WP0A 4WGFA 1JIUA 2A2ZA 4WBSA 2Q8PA 3E58A 3LX4A 5ISMA 3RASA 1TZLA 4OJYA 4F4JA 5JTTA 1DJMA 4LFBB 1G8KA 4D3ZA 2DUNA 3VU9A 4UBNA 2R8XA 1MW8X 3ZHSA 5IT4A 1JKXA 4IR7A 2FWMX 1OVGA 2E1MB 2ZJQF 4I1PA 2H6CA 4BUPA 1MDBA 5TT0A 4DVJA 3ONVA 3F8WA 3OIYA 4MVJG 1GR0A 1T9AA 1UM9B 4HBLA 2X58A 3DZ8A 3RI3A 1QF7A 4B84A 5HVNA 1ZAOA 1SVUA 4Q9NA 2RD2A 3BXFA 4YMSA 3SCZA 2J9GA 4F12A 3AM4A 3W04A 4P38A 4P9UA 1RBYA 4MVCA 1F43A 3J7AO 4CNQA 4JUIA 4DG5A 5E4FA 2VCEA 3U3KA 1NZFA 3LF2A 3BE4A 4OQMA 4M8SA 3T5DA 1FFYA 1UDBA 5CDTA 4QAJA 1JHQA 1W73A 2DFHA 3OF3A 2CXPA 3V3TA 5C44J 1YE3A 2F43A 4K6KA 2PV7A 5K8LA 2OK7A 1TEHA 3DLPX 1Z05A 1T38A 3CVWA 4RV5A 1IXRC 1E60A 2HSEA 4IHJF 4H6PA 2J67A 3OFVA 1E58A 3WY9A 5IN5A 2VJBA 2BFBB 1Z4PX 5AR1A 1QHNA 5EHNA 4LSZA 3BRWD 1NV9A 2CT8A 4EZEA 2EG5A 1CUIA 4I8IA 1M1NB 5IT9A 1XCLA 4YIFA 3WGZA 1Z6QA 2PMWB 2ZOSA 1TTQB 2J33A 3DS8A 4ILKA 4OMUA 3MWDA 4BO4A 1NMYA 4WIAA 1AQIA 3L2VA 1G38A 1M2OA 2B78A 2YSRA 1LF0A 1YRQA 1VMKA 4BDSA 5AKXA 3MWDB 4BLTA 4LF7B 3RS7A 2VJMB 3CCVI 4KWIA 3TSOA 4PK4A 2MINB 4JNCA 4RPHA 3C3KA 4LK2A 1JILA 5ALEA 2GAUA 3F6PA 3R5FA 1YMVA 2DGDA 3UJBA 2EFHB 4A2QA 5ARBA 5TIIA 2A3RA 2C5EA 4N7RA 1QTRA 3PFKA 2C7PA 1NV8A 1GSOA 1YDGA 1SO8A 1CYDA 1YQXA 2DCUA 2VNAA 2ZATA 5BS6A 4RACA 2OZKA 1Q57A 1UMDA 4C06A 1AOXA 1GUAA 1PSDA 4CEJB 4D9GA 2XKKA 2F1RA 3AIMA 3JYNA 4HGYA 4BGDA 3EXHA 3C3AA 4RO0A 3ETNA 4K6GA 3UMCA 1RQ7A 4HLUA 2BY1A 1M6YA 2EU8A 4LOHA 2I8DA 4DJ5X 3EEFA 3JTHA 2QYSA 3H4MA 5TGDA 3P5SA 4J90A 3OP1A 5L9AA 2GWRA 2Q7DA 5EG0A 4IIJB 3ACBA 5F64A 1OISA 3S2WA 4R3NA 5ALJA 4BJ5A 2JIQA 2QRJA 2GZHA 1G9XA 3UHAA 5LZ5A 3UAVA 5H83A 5LPNA 4EG8A 4NE9A 1G6KA 4O4LF 5BVGB 4NU5A 1NLMA 1U3EM 4DLPA 2QSYA 4ANJA 1Q83A 3NMUF 1P2VA 2ZVDA 4HNUA 3G6WA 4FX2A 2X0JA 3VPCA 1PQPA 3UKDA 4EEZA 1G20A 4OHKA 3N2GB 3CLTD 3G8AA 4JB3A 3IVAA 4C5AA 1A8PA 1NVWQ 3HDGA 1Y7IA 4GBMA 4HN4B 4D3FA 5IMBA 2BFWA 3BR2A 1DZ3A 1K92A 2GNOA 4HNAA 3ZEAA 4JI8B 4FDTA 3W6PA 5DPMA 1IF1A 2UVPA 2PKRA 2QUZA 2Y76A 2HL6A 3PVSA 4EGZA 2Z3VA 2A9VA 4FLEA 4EYEA 5KOHB 1YOVB 3I2GA 1WQ4A 3PDIA 2QD4A 3PEFA 2JB9A 3CCSI 1P45A 2X5NA 4ECAA 5AHWA 1CR1A 4MVJP 1X3WB 4HQRA 4IQ0A 4UVDA 5HEKA 1SOAA 5HFAA 3GLFE 1UWLA 3GV0A 4W8OA 2V6GA 3OQNA 2PYZA 5D1HA 1RKQA 3II6X 4POAA 5B64A 2TCTA 1PR1A 4QQFA 3UW3A 3DOCA 4CFYA 1WUIS 2CVZA 4DANA 2BYVE 1FFAA 1X7ZB 4Y15A 5LWQA 2XMRA 2B5OA 5INTA 1K8XB 3HJUA 3NBYC 3WKAA 4CKBA 1NC1A 1BR4A 3MWFA 2OCBA 1TPZA 1G4DA 1ZD5A 2AN9A 3GEZA 1HLVA 2C8LA 3I09A 2D1QA 4I4TB 3G8BA 1US8A 1NOKA 5E95A 3FM9A 3OZGA 4Q37A 4ND8A 2OC9A 3NASA 5FUVA 5JE8A 5KBYA 2HA5A 3H2JA 3O91A 4P55A 1O9HA 4BVBA 5LVAA 4V1CA 2KLOA 1X94A 2X4GA 2HT6A 3MKZA 1IAWA 2ODTX 4A6PA 1SVIA 1OIVA 5TMEA 4FHDA 4DY4A 1TB4A 1AXEA 3BQZA 4C7MA 2PZGA 1F3LA 4BXUA 1COWD 4L9JA 1ZW6A 2WKSA 4QE3A 3RWOA 3PHLA 3EEQA 1CY6A 5I4CA 4Z4IA 4H3HB 4ML3A 4NU6A 4ZMSA 4AKHA 1ISFA 4RHCA 3OTOB 1H85A 4CMCA 5FWXB 1TQDA 1JQDA 2IAIA 3DLCA 1MEJA 2BUAA 3IO5A 4ETMA 2V0NA 5IT9Z 3IR5A 1H2WA 3G68A 1HLDA 1FYWA 4DUZB 2YUTA 3A4IA 1L0OC 1JJIA 3FPKA 4Z1MA 3Q3CA 2JSPA 4J2TA 2IH2A 4G6ZA 1YHNA 2ZYVX 1OPXA 4ARVA 4PLWA 5L3SA 1TFUA 1RKTA 5K3EA 4ZT3A 5EERA 4I46A 5LP6B 4ITUA 3OF2A 3FYUB 4MJ3A 1HI9A 2X9VA 3H3UA 3ZTTA 2BYTA 1T0FC 1KHHA 2ZYHA 3VHLB 3HACA 2M4GA 4G4SO 1XMSA 3C41J 5GV7A 4PFSA 2W24A 4OP2A 5FP0A 3VHRA 4FUQA 3G4SI 1PJ2A 3FYTA 2AC7A 2JLAA 3TOZA 4BTLA 2HKXA 2C88A 4U7PB 3C1DA 2WHXA 3CKKA 3PXGA 1ZGGA 3CZ5A 4OHOA 4NMHA 1JJ7A 2I66A 2E55A 1IAQA 3FOCA 2E4XA 3ZPXA 2KKOA 4B45A 4EQ6B 1NOIA 3D3KA 4TLLB 3HM5A 4G6QA 1I6MA 3EVTA 4R7TA 5C0OE 1ZICA 2L9SA 3VVLA 3RPQA 1E94E 2IZZA 3WLSA 3SEQA 1U3DA 2V5AA 2JKYA 4QM7A 2OHJA 1XAJA 2FR8C 4H59A 4NUBA 3KUKA 1BZYA 2KMLA 2WD8A 2Z5VA 3A0UA 1ODCA 1WB5A 4XGKA 2LC2A 3PIPF 2OFWA 1JAIA 3HEBA 1H6DA 3FUVA 3KKNA 4UHFA 2XGEA 4W9NC 2F9MA 3NBKA 4JROA 2QI9C 5CIYA 2O5CA 3K8OE 1U4NA 2HMTA 4LISA 4CA0A 3E9MA 1V6AA 3C39A 4M7OA 3JPYA 4P2BA 4PIMA 4JIMA 2BFMA 3D8UA 2VBZA 4L0ZB 2FFBA 4FEAA 5KWJA 3MZYA 1OH5A 4CZZA 1I8TA 2Q2EB 1JTXA 4HWTA 2W4IA 5TJJA 4IOMA 5JJIA 1I1HA 3K15A 4AY4A 4W1QA 4IHWA 1KI8A 1Z8FA 3F2VA 3WODF 2QA5A 4PR3A 4JHLA 3T94A 1T34A 1DP4A 4IJQA 3I2IA 4JKYA 3V97A 4Y6QA 5L3CA 1IOLA 2A5LA 3HUGB 4QO8A 4XDGA 3ASVA 4I4TF 4H7JA 3EGXB 4H15A 5C1BA 5TLSA 1FB5A 1O95C 1R5HA 3FISA 4MOWA 3GTQJ 1EXNA 3GUUA 1EGAA 3KZNA 1MGTA 4FVTA 4O1IA 5AYVA 1KOJA 2WYWA 4ZYDA 3H18A 4O4JB 3VJMA 2DUWA 5TNXA 1YCDA 2X4IA 4MWSA 1VG9B 3SBXA 4A5OA 2JW5A 4CIAA 3EXEB 2PRYA 4QT4A 4YFNF 4K26A 2NO1A 5FA8A 2ZJ7A 1J9GA 3IAM6 1BW5A 1DIOB 1DX4A 1H0HA 1SBNE 3GCWA 1DRWA 5GPAA 1GSAA 1S01A 3FFXA 2B2NA 2ISSD 3OTIA 3BPXA 4MPDA 5J59A 5K45A 1XKTA 1F2UB 1ORVA 1IQ0A 3C7JA 2BSQA 2J1LA 3GJ8A 3T7JA 2BMWA 5CD9A 5KHAA 1U2QA 4YJ3A 2XWPA 4D0LB 2ZYTX 3KB6A 1H69A 3C3CA 4N9HA 2P8JA 2ZJRF 2WLTA 3L01A 3VPFA 4R1MA 2DTEA 3J7AC 3JWPA 3BJMA 3QE0A 4WOPA 5MGNA 1J59A 5DCMA 1P6XA 1DADA 2ZPAA 1TJPB 1HE5A 1WVRA 5H80A 3JQ8B 1UELB 5TY0A 5KQRA 3NP7A 4EM2A 1GO2A 5DRYA 1HDIA 3DEYX 3HUGA 5JNUA 1XMKA 1FU8A 3HO8A 3TIVA 5BN3A 3GMEA 2G88A 3FMVA 2ONKA 2WVAA 1U3CA 5AW5A 2VTBA 4MINA 2FOKA 3V6LA 4Q47A 4UUAA 2CFXA 1TQ6A 1L5GB 1ZVVA 2VXOA 2OD2A 1DG9A 2V3VA 3ASNH 3OIVA 4XEUA 4ZT5A 3D54D 1QB7A 1XKQA 4ZCQA 5KNCA 3DBIA 5LMCA 2CCJA 5AI5A 1J0AA 4ZZDA 3WSVA 4BEBA 3BSFA 4EEXA 1PDWA 3OA2A 1KVRA 1L5WA 4YDHB 1QP7A 4XYMA 4QL3A 1ZNWA 4FX4A 1ZD3A 2HJWA 2X13A 2WEKA 3SS9X 3VNQA 4BNZA 3S0JA 2C9BA 3ZR4B 2PMKA 4J49A 2O48X 3FLEA 4PTLA 5KYWB 3HXOA 2H6BA 4W5OA 2ODQA 5LFAA 3IUSA 4D0GA 3HSFA 2W4MA 4L7QA 3H5NA 3LBYA 4DLSA 5ELLA 3FWHA 5AIQA 3UMMA 2QBYA 2BFNA 3U7FB 4OUKX 4OGKA 4D4KA 3QU9A 4LZNA 4RZSA 4EPXA 4ZOAA 2BHRA 3EXEA 2GPJA 2X9DA 1IK6A 2W2XA 3ETEA 2HRDA 2IPAB 4IV5A 3GLGA 3DOJA 2KZGA 2FXIA 1Y7TA 4KC0A 3AU8A 1QYCA 5FFMA 1JZTA 3OMLA 2PUHA 4GMFA 4HEHA 5TQVA 2FSSA 4IPTA 3SOPA 1MC5A 4A0SA 4CHTA 1XCMA 2VOOA 1E1QA 2MFZA 3BRCA 4IGKA 3U31A 1RMYA 4OEHA 3RREA 2C78A 5SZIA 3FXKA 2WKWA 3HCDA 3I6ZA 3LGAA 4Q00A 4B3GA 1YJNI 3NWEA 2HMAA 5ALYA 5DUKA 2A1TS 4P35A 3VTAA 2WSSA 3IB3A 4WBNF 3KYIB 3GZ4A 1U1FA 1OW3B 3I6IA 5IH7A 4H08A 1JI8A 3G8CA 1GV5A 1WULS 2RH8A 4QGBA 3QPLA 4D9CA 3ICOA 1Q0TA 1YA6A 2R7WA 2OV7A 3HP1A 4RENA 3FAZA 1KSGA 2BMJA 3BMNA 3SYNA 4NOJA 5BMVF 5J47A 3HR7A 3GVPA 4DIBA 3GXBA 3LP6A 4FLMA 3DPUA 4J0CA 3D02A 3KOOA 1MH4A 5KEIA 3L4EA 3HA7A 3QYAA 3CW8X 5C8YF 4YIKA 3AP3A 7REQB 5HKKD 2BRUC 2PO5A 5F1RA 5IG2A 4H27A 5F4ZA 2X5JO 4EMUA 2RGNC 3WGOA 4FYPA 3OEYA 4PPQA 1KGDA 1T0JB 5KC9A 1SUSA 1T3GA 3TL2A 5MFZA 3U4AA 1AMNA 3PTAA 4WF2A 1JTEA 5DJ5A 2DU9A 3RYPA 3HG9A 1U8UA 1VBNA 2YY7A 3A4NA 4ALIA 4B1FA 3R44A 4A3DJ 2V58A 3U62A 8LDHA 4HRYA 3K7EA 5I7OA 2J0EA 4YJHA 4QPCA 1EAYA 2JGAA 5G3YA 4KGDA 4XGIA 4GM1A 3AM5A 4MAMA 1EG2A 2ZT5A 3AFOA 3OSFA 1B42A 2HWVA 4BLRA 2C98A 4CLDA 2VH2A 4E21A 3AHDA 1LDKB 4EG4A 4LKOA 1P2BA 2PKQP 3KELA 2W8BA 1IM5A 1P81A 1UQTA 3E1GA 3QPTA 3GJYA 3Q5GA 4GC5A 1IIBA 2C4HA 3A1TA 2WT9A 3GDFA 5KAMA 1BOOA 3TD6A 3QBEA 5TB5A 1V1RB 3CRVA 5L95A 2G83A 2PMZN 4K28A 1E9BA 1P4RA 1T98A 2QR3A 3RRJA 1GZ6A 1LLCA 1NFQA 2GOYA 4QJIA 5I01A 3V1MA 1AA6A 5JDCC 1AUPA 1RXVA 4M37A 2UWMA 3SC3A 4BJ1A 4HMPA 3CU5A 1NQTA 1U7ZA 2V9ZA 3LOUA 4J7UA 3OIUA 3HKZN 3RVOA 5HS8A 3IQWA 1YUMA 5BV0A 2O2XA 2BVNA 2IHYA 4PX2A 1OU4A 1LSOA 2ZI7A 1IONA 1E1YA 1YR6A 3FOAA 3I2YX 3JVIA 2XAGA 3HRMA 3TEDA 1GIAA 4G81A 2R8YA 1K8QA 3DZHA 5E2IA 3TX2A 1D7AA 4DA8A 3JCUC 4I2NA 4RM2A 1N3IA 4IHYA 1EUZA 1YYVA 2JPCA 2VDJA 1NONA 2FBHA 1G8JA 2KIUA 2P0YA 4FEGA 3A0RB 1ZONA 4HNAB 4NDAA 4RJIA 1A2OA 3RIXA 1PE0A 1B1BA 1SUIA 2M30A 3E9YA 2RGXA 3ZCTA 5HIKA 4YDQA 1MJGA 4E03A 1ODFA 1W75A 5DBGA 2G63A 2ZIXA 4X0GA 5A4AA 5HP4A 5C3EJ 2GXBA 3KE9A 2E21A 4PFQA 3OFNA 4C4XA 1EWRA 3HVKA 3RSCA 1PEDA 3T9FA 1S6YA 4GI1A 1E79A 3KLMX 1XCOA 3KOUA 4KTTE 2NV0A 3KSBC 1M72A 3E0QA 4NU8X 5FORA 5FROA 4XYLA 1MKMA 2R48A 4D0PA 5ALRA 2WTMA 4O4HA 4U5QA 3QHAA 3UQZA 5FADA 4P0QB 3O74A 1N6LA 2X42A 3E70C 1WWKA 3NORA 1Y7LA 4A03A 4Z3OA 5LBUA 1W46A 2P2NA 2UVQA 4GS5A 4PWZA 4NNPA 3OMXA 1QR2A 2XSDC 2RCYA 2GFQA 4GXNA 4I4TA 3X1YA 4GWKA 3TG2A 5JLWA 2LVBA 4M0UA 5LA6F 2G1PA 5B3JA 2GXSA 1NY5A 4LYHA 1M8KA 4XONA 4XFKA 4QULA 3WDLA 1NUTA 3M4JA 3PX7A 1SEUA 2KIFA 3WAKA 3RQSA 3KKQA 4WNAB 1MMSA 3SBOA 4LE2A 4BNLA 5DM60 2P9ZA 3BXHA 3LSRA 4LSWA 3BTUA 3IAHA 1RD4A 2RBEA 3JZAA 4WHMA 4FCYA 5K5EA 4JLUA 3PQKA 5E7MA 1L5NA 2FUEA 4JOQA 1T29A 5EGOB 4JP3A 3CINA 2O6HA 4KODA 1YI0A 4RADA 3SX2A 5D3ZA 3NH6A 3AR3A 1E6KA 2LNBA 3R60A 4B46A 3CRMA 4QQ8A 1MNQA 3E81A 3AOEA 2ZJ6A 4KI7A 4CG3A 3PUJA 4D44A 5KYUB 4UHJA 1RJ9A 3H5RA 1X3UA 1CUHA 2Y0DA 4FI3C 5E8IA 4GPEA 5C9ZA 2LKPA 3R0ZA 5L3QA 1HFWA 1Q74A 5KJ6A 4XIGS 2BBOA 3G9QA 4BVAA 4NX2A 3OQVA 4CVNA 3K0SA 2EERA 2QQ9A 2YV2A 4L74A 1T9ZA 4U6SA 2I55A 2ZUWA 5HPYB 2M7BA 1A5AB 4F45A 1JEYA 3OTHA 1GPMA 3LSGA 1E20A 2DCMA 3GDHA 3I01A 3TGWA 4YQYA 4TVKA 5LGUA 1M34B 3IBTA 4UTRA 2EP5A 2ETVA 4MYDA 1OAOA 1D03A 3JASB 1B93A 3JWIA 3I1YA 5HCNA 2DAOA 1ODSA 2HZ7A 3PQCA 4X1KA 4KQJA 2GX6A 3VC1A 4AZ3B 2L82A 3PEEA 4HVLA 5IS2A 1YVPA 1DPUA 1BVYF 3HIFA 1F5NA 1KVUA 2J3MA 1BH2A 1DINA 4IEFB 4CEJA 4K1LA 2CD9A 4IJ6A 3HDQA 2EBIA 3B3AA 3QOWA 4P7KA 1O6ZA 3E5UA 2R7SA 2EZHA 3OM1A 3ANNA 4KB5A 3RSSA 2JI9A 2IX3A 3G23A 1U3GA 1VXRA 2VP5A 2WZDA 3HCNA 3B1KA 4LXQA 4RORA 3TYXA 4F85A 5KREA 3MWMA 1GZ3A 5ITZB 1FQKA 1BDMA 2ZWOA 5D5XB 5J2TA 2CJJA 2HNHA 3FMSA 4FDUA 2YHUA 4UUSB 4YMIA 1FPQA 4NICA 3D4IA 3OS1A 2TDXA 3LQQA 2QMEA 2QL9A 4H31A 4LDAA 2ZI5A 4O4IA 4OJTA 3S8MA 4YR7A 4DRXB 4YRPA 4ERNA 1UPUA 3ERCA 2GILA 4GRAA 2HCTA 4KXQA 1WVMA 3BJIC 3IRVA 2W1OA 5EA2A 3IUOA 1ST2A 4BYGA 4Z49A 4Q9IA 2BELA 3HU3A 4KO3S 4XLNF 1BDBA 2Q6VA 5DHFA 3N8HA 4AM8A 2BGJA 1KKMA 3P0RA 3MKWB 4IS3A 2AOWA 1M1NA 4CV0A 1V16B 2NGRA 4LF6B 4CMIB 4FSDA 3A6DA 3NHKA 5FJJA 4LXHA 1NBMA 4Y33A 4NWIA 1ZJ4A 3FDFA 4AN0A 4QFBA 1EZ4A 3PQDA 5BUSA 4E7HA 5IEJA 3OQPA 2PL1A 2Q5FA 4N7BA 3W2VA 2FNAA 1USWA 1XAIA 1XR3A 3I73A 3AOEC 2IEDA 4C7OA 4F0JA 4ZDKA 2P9HA 2P9TA 1X9HA 5FJIA 3BGDA 2W42A 3ZLJA 3K4KA 3RPUA 1WDWB 4RHEA 2OZEA 3MWEA 4GSLA 3INYA 2OV8A 5HQ3B 3MTIA 4ES6A 5A1JA 3DEKA 3CRNA 1NASA 5FEMA 3LHIA 3RV3A 1HLGA 1P2DA 4HQEA 3BN3A 1F2VA 1N5MA 3KLOA 3R0XA 1Q0PA 2EWMA 2I67A 4QNRA 2XCIA 1BXKA 2ZRIA 3DZDA 3GGCA 3MLBA 1BAPA 3OHMA 1X3ZB 4KQMA 4LYJA 4EW2A 2QAGA 4QZVA 3AHGA 1OASA 1AQLA 1CT9A 1Y9JA 3T1TA 2QRNA 3DZKA 3H9UA 5ICEA 2DJ5A 4ZDLA 3LUPA 3R0QA 1JW9B 4BOYA 4LF4B 5ESDA 1N1GA 3LIIA 3ZDYB 1ISRA 4Q7LA 3PQ5A 3V8NA 2MG4A 1QZUA 3C3XA 4JP8A 4PG6A 4PV7A 1VCNA 2VKHA 3V9AA 3WIDA 1XO1A 2PS9A 1YO6A 1YQEA 4KPUB 4QUGA 5DTJA 3RDPA 3BD8A 2VXZA 4G9EA 2FBIA 3VKVA 3WKDA 5BN4B 4Y8VA 4EGFA 4D99A 2F1KA 2PX9A 1WMBA 2PSFA 4G4SP 4HP8A 1KEKA 1T8PA 3OZRA 4HGNA 3GLTA 2AQHA 4ETSA 5EE9A 2Q5JA 1FW8A 2JIBA 4BZWA 2ZEJA 1OPRA 4MTEA 1ECFA 3L84A 2XYHA 3AR8A 4BKPA 1QMGA 2VUTA 3LPAA 3EEYA 4X60A 4AP6A 1LS6A 2GD1O 3ZY5A 3DF8A 2WU0A 3MXOA 2CQ7A 1KGSA 5A2QZ 4IDNA 1G3TA 3IT3A 1NDHA 2AOTA 2JZCA 4O02B 1RYFA 2JI4A 2XGOA 3CT6A 2CE7A 3C74A 3PL8A 4LYAA 1LVHA 5GONA 5B7NA 3F9KA 3KXDA 3MJRA 3LOCA 3E9DA 1SPBS 1LDMA 3ITEA 1JTYA 5TRDA 2PLAA 1ZISA 2XCQA 2ZCUA 3H1BA 2QY9A 2WW8A 4H7FA 4PLFA 4AUKA 3P2EA 3MFYA 4JVMA 2KJBA 2P5LC 1ZWLA 1ACJA 2HMUA 1C1XB 2OC4A 4BHPA 2D0DA 1KFCB 4X63A 4NYJQ 2YHBA 1RAHA 3DDZX 3LNCA 1XGNA 4Q1DA 3WMFA 5HK9A 1E59A 3V4SA 1Q44A 5CT8A 4HXFB 4O8ZA 4E5YA 4A2WA 1KI9A 2ICWG 1ATIA 2RK3A 3ONFA 3BR3A 2CXTA 2FMLA 1HUQA 2DFDA 2OHGA 3AY3A 4EPWA 4HXGA 1NI5A 1XVTA 1ZUHA 3DE6X 3E8XA 7YASA 3M6MD 1RQRA 1U0TA 2DP4E 1FS5A 3AWDA 1GRCA 4TZTA 5FRDA 5SZJA 5IJ9B 1ID8A 3N1UA 3PQEA 2QD1A 3HI6A 1FMTA 4PLCA 4BO9A 3QELB 3T7EA 3TX6A 4EJMA 2FXVA 2KWIA 2I33A 3RJTA 3KR0A 3M34A 3R8XA 2QW0X 4X6AJ 1OLSA 2WG0A 1U5AA 1X0VA 3WL6A 1VLMA 1RM4A 2H06A 1B3RA 2W4QA 4LMBA 4XJVA 5EXXA 1JSCA 2JK3A 3GFQA 3GEIA 1U99A 2FA5A 1ESZA 3SGLA 3H11B 3K4CA 1FK8A 4F4HA 3AEKA 3B1XA 4I5DA 3I32A 4AU1A 3NETA 2CW7A 5ALTA 3BG3A 2FYTA 1U0FA 4YQEA 3LDAA 3ILSA 3OZ7A 3L6CA 4BMCA 2P8TA 3O4GA 1PTJA 2KPMA 5KVRA 4H6XA 2BJWA 3CX4A 4FP9A 4UVBA 4IAOA 4IKPA 1P2FA 3VH3A 3AF1A 1OAKA 1U5CA 2H5LA 3PPYA 4Z9FA 3C3JA 2EW1A 3N2IA 3AGQA 4HOBA 4ZAGA 2P6RA 3IT1A 2Y0SA 4G0WA 1X1AA 4YJ2A 1OY1A 2VJ5A 2EV5A 1JDBB 1ZU4A 2H85A 1MENA 2L2QA 2RVCA 2NZWA 3ESBA 1P19A 3EVGA 1E1LA 3HY3A 4TWBA 1ZGJA 2QMQA 3BB1A 4CCLA 3D3NA 2H8WA 3GYHX 3QMMA 2I8LA 4G7ZF 5EE0A 2H8RA 4DC9A 5IU6A 4DDKA 3O1LA 4HLXA 1TQIA 1ACLA 3DOHA 2I7DA 4Q1EA 1U1GA 4AZWA 1WI3A 4DZZA 3CXRA 3O9VA 4MKRA 5GTDA 1NR5A 1S8FA 4L15A 1AF7A 1H93A 1SQ6A 2VDKB 3BWXA 2ZRJA 3EMKA 1NJ2A 1DBSA 2BGUA 5E6RB 3RSFA 1LLQA 4QUBA 4FBLA 2HU5A 2M2IA 2R3SA 5EHGA 3UC9A 4MKZA 1U9ZA 5FKNA 4WLOA 2VHEA 1OOEA 2WAFA 3CCYA 2G0NA 2QE7A 2ZTUA 4FWBA 1EEHA 5AVWA 5B5EC 4DV2B 1SD7A 1OLTA 2ZRAA 3SYMA 2YWEA 4PHFA 4URHA 1DBPA 1J1ZA 2DHRA 1FLNA 3GW8A 2B3DA 1Z7LA 3MB5A 4RY0A 2OV4A 4TOIA 4X1OA 2PMEA 3VYWA 2XRFA 5K01A 2I76A 4AUXA 1DSSG 3OE4A 4ZVPA 1DARA 4I6ZA 3C2HA 1BL0A 3E7XA 4G5FA 4IJUA 1JHZA 4MYTA 4PLGA 5K2MA 1S2GA 3DQPA 1JZQA 2H18A 4F4FA 1Y0NA 4O2BF 3TOCA 3C1UA 3SSOA 2SECE 1OCCH 3D3EA 1AK1A 2IIBA 1D8AA 1K78A 4CKBB 3TGLA 4G2NA 1GNLA 1GVJA 2W6JD 3EDPA 2BZTA 3QEOA 4ZYVA 3K72B 2I1WA 4F6CA 1QRYA 4J03A 2HOSA 5BORA 1H3FA 4ND1A 2MSDB 3L6OO 4W1RA 2YWGA 3ZU2A 3UG6A 3G0OA 3BDDA 3GX1A 1DXHA 2PVPA 4ILEA 4EJFA 4Z51A 4TVSA 2PBRA 2F1JA 3Q7IA 3EEBA 4XJSA 1GA6A 5EIBC 4GUDA 1ZX1A 4E1VA 4DPMA 2VTEA 4IJKA 3SVZA 4K0KB 1QYDA 1GZ7A 2WNSA 1AZTA 2G9RA 3OFSA 3P96A 4A8JC 2MC3A 5CVVA 2MINA 5KNCD 3DDUA 5GOZA 4EUEA 4NJMB 5BUQA 2JJ7A 2XDVA 3QWAA 1K9SA 4RL4A 2UYCA 4IQ4A 2BV6A 1KEZA 2GK3A 4BX8A 1TVKB 2AQFA 1YU6A 1ILEA 2BEWA 3PJRA 3UWSA 2F1HA 2OCDA 1NFFA 2HYJA 1X1PA 2CNBA 3AY6A 4G65A 2BEUA 4NYMQ 2HDWA 2RI1A 3VPAA 1RC9A 2GRUA 1RHMA 1U02A 1T3TA 3PEUA 1UM8A 3QY0A 4US0R 2VBYA 1Z29A 3L4SO 5BRAA 1D3YA 3MFQA 2VSXA 3L6EA 4YRJA 1EVIA 5LOVB 3MEXA 1MBFA 2QGNA 4NJEB 3HXMA 3PBKA 3W6KB 5AW8A 1X9GA 2HGSA 3AVOA 4FFNA 3V8RA 1CP2A 1AS0A 1OLOA 3RVPA 2QRVB 2BTQB 1QIKA 2AD5A 4ZA2A 4IUDS 2AYZA 2FWBA 1OXBB 3OMYA 1CFJA 3U3OA 3C5HA 2WWYA 4FHGA 3RS3A 2FQ3A 2AXEA 3OM8A 2W4SA 3RYFA 3QNMA 4UTXA 2P2ZA 2PLFA 1ESNA 1KRHA 1UL1X 1XAHA 2AUMA 2C2GA 2CXRA 2PUTA 3P4XA 3R6GA 1YC2A 4DDHA 5HRCA 3O8DA 1RXCA 3D1VA 3JVUA 4CYDA 3CUWA 4IDEA 3L2UA 2O2EA 3GOQA 4WKPA 3X1WA 5HUJA 5JARA 3WBJA 1GQRA 4BX3A 2CHFA 4HDRB 3EPRA 2O14A 2E1PA 1LQUA 2ELJA 1YZLA 2YW9A 3PGLA 4RCZA 3ZHVA 3R7SA 1G1AA 2HMWA 3I72A 2PUAA 2JWTA 2HA3A 2VOJA 4NYMR 1W4LA 5CFNA 4EJ6A 5LZ9A 2A59A 3T9BA 1XEXB 1P4AA 1ATZA 1N2JA 3QITA 3SDGA 1LLFA 3KJNA 3L05A 3PPWA 3DEAA 2DWPA 2IHKA 3N6VA 2NZJA 1UZAA 1TVKA 1ZNQO 3HMKA 2M9HA 3T5BA 2H1SA 2VP3A 3REFA 4Z4GA 5HIIA 1R4NA 1PL7A 3OURA 5A7GA 3UGJA 4KK4A 4XLAA 1MAUA 3VU0A 4KTVE 1JKMA 1WH5A 3GDGA 4OINF 3L7JA 2YQ5A 3F5DA 4P22A 4UBOA 3KJIA 4RDCA 5C34B 1S4MA 3MJHA 1FNMA 2CK3D 4XIJA 3CUEF 4H1VA 2EARA 1W6UA 2G70A 1M8JA 3A6JA 5L7WA 3S44A 1F6DA 3G0DA 1SHKA 1Q1GA 3OOEA 3Q2IA 1XXLA 3QOYA 4PC7A 5F7JA 5BSWA 3FIUA 5AOCA 2VSOA 2ZWIA 1KI7A 4UZSA 1TKBA 3H8JA 4I6GA 4X6YA 2HTFA 4TROA 4UNSA 1JDUA 3HOYJ 2F4IA 1G8GA 1X39A 1YS9A 3EPKA 2Q46A 2EILH 3G7UA 1UXIA 2H4ZA 2AZMA 4C2AA 3AI1A 4KAAA 3QKIA 3FUUA 2DTDA 3L8MA 3IOMA 4MCHA