2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSA3
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
3RIRA 1R1VA 3KP4A 3BJAA 2VODA 1ZARA 4CZZA 1B6AA 2H27A 3MWMA 5AIPA 3QAHA 2L02A 2ZBKA 5FB2A 3JAMZ 1VTNC 2PJPA 2VXZA 4A6DA 4HW0A 2XGXA 2RVCA 3N4MA 2VBWA 3HSEA 1HBXG 3V7CA 2Y75A 5E1XA 2D45A 3L9FA 1DUXC 2HWVA 3MAJA 4L18B 4LJZF 1ZH5A 1G6NA 1FSHA 2VBXA 3I71A 4RB3C 1YLFA 2IA0A 3DFGA 3REOA 2ZMEA 1FYMA 1MZBA 1RI7A 5HDKA 2GWRA 2XAQA 3KLNA 2EFOA 4EJTA 5L3GA 1KYZA 2XAHA 3HHHA 4AD9A 1Y0UA 2OAZA 1CF7B 5D6EA 1P2FA 2K7LA 5LHHA 1S8NA 4RGSA 2GA1A 4HF1A 5D5VB 4YIFA 3ZPLA 3DXJF 4A0ZA 2DTRA 4LLGF 5E8GA 3WODF 2BEOA 4ENKA 4XBFA 3C3WA 1XDUA 2Q8KA 4MTDA 2ZXJA 1U3EM 1EH6A 4KICA 5LGTA 1O7LA 4RB1A 2YR2A 5H6RA 3E6BA 2NYXA 4ASNA 2RC4A 5HLGA 1H0MA 2DO7A 2OQRA 5JI6A 2A3SA 3EETA 2EV0A 3LA3A 5FO5A 3BJ6A 4GXOA 1S7OA 3VODA 4OMZA 2EFWA 2FXAA 2GAUA 2GQQA 2IT0A 4QLCU 2Y0MA 1XB4A 1SMTA 4I2OA 4MNUA 1QQIA 4KN4X 3VFZA 5LRSA 2MC3A 3C7JA 2BYVE 4UXNA 3WTXC 3DKWA 1XMAA 2PQ8A 4LK1F 1UB9A 3PFIA 2QQAA 3J81Z 3FM3A 3MZHA 1XSDA 3F8CA 2CG4A 1YW8A 3CTAA 3F23A 3K1PA 1QZZA 4EVIA 4G7HF 4IVNA 3QU3A 4ZYEA 3IRQA 4HQEA 1IRGA 2M8EA 5BS6A 1FWZA 4WCGA 3D0SA 1ZLJA 2P5KA 3QP6A 3KEOA 4YFKF 2LDUA 1LQ1A 1ON2A 2FOKA 2VOOA 3BDDA 3HTSB 1RNLA 3KEQA 2ISYA 3PQKA 2EK5A 1T39A 1XD7A 4XSXF 1JHFA 4OINF 2RN7A 5DYMA 3B73A 4L9JA 5FD6A 3T0YA 1YTYA 1J2XA 3ECHA 5L3DA 4KN7X 3LSTA 2DI3A 3SFZA 1IN7A 3MQ0A 1ZAOA 1I1GA 3FWEA 4HYEA 1C0WA 3V7SA 2XV4S 5FD5A 1ONVA 4ZH4F 4CICA 1FP1D 1DP7P 2TDXA 2L4MA 2K4BA 3F8FA 2DBBA 2PMHA 2Q2EA 3OV8A 4H0EA 4LFUA 4EMSA 4G8XA 5BQTA 4L9NA 2P7CB 3D5LA 3KP7A 1LB2A 1YW7A 3FF5A 3C1DA 4AIHA 3Q9VA 4LG0B 3TOBA 2OZUA 3W6JB 1BI3A 4RB0A 1BC7C 4JBAA 1OYIA 3FX3A 2EA2A 3O6BB 2E1NA 1FZPB 5ERIA 3E5UA 4IHSA 1B9NA 1ON1A 3OOPA 2V1UA 3WTYC 2GZWA 1SD4A 5A2QK 4CXFA 4HX7A 2XIGA 1LDKB 1V4RA 4DQ2A 1I6XA 1XGSA 2A68F 3F8MA 1R00A 1FNNA 3CUQC 4MTEA 4Z2YA 2JTVA 4BNCA 3BOQA 5JHUA 2VBZA 4WX9A 4I0AA 1G3YA 3L2CA 1KU7A 1DPUA 1L3LA 2EA4A 3JW4A 4I98B 4HDVA 2OQGA 1U78A 2QUFA 3ZMSA 4CDGA 4R79A 2XVCA 3EYYA 3S2WA 1V3FA 3BP8A 3NQOA 3E5QA 3ZMTA 2A6EF 1A04A 3WTZA 1G4DA 1IAWA 4HZFA 1OR7A 2STTA 3G3ZA 5LHGA 3ZMZA 1JHHA 2PBIA 1HKTA 3CDHA 3VB2A 2VT2A 4WXCA 2DQRA 4UV8A 4RGUA 3TKYA 1QNTA 3B02A 1IUYA 2EWNA 4L9TA 2HR3A 5J8CA 2ZFWA 1W5TA 1T98A 3TDZC 2XROA 4LLLA 3E6MA 3GZ5A 3HOTA 1WI9A 2CGPA 1KGSA 3WE3A 3WU1B 5J6XA 4RAYA 4BAYA 3TQNA 1ZRCA 2RQPA 1REPC 3R61A 2VC1A 3KP2A 5FGMA 3T8TA 1R36A 1D8KA 2A07F 3BPXA 5JVTA 2ZMEB 4S05A 4A12A 3HSFA 4LD5A 4IPAA 4AWXB 1XGOA 3ZN0A 1FC3A 2IJLA 4KFCA 2D1VA 2FF4A 3GW2A 3HRSA 4F7ZA 1U2WA 5D8LB 2VE9A 1Z6TA 3P9CA 5DD8A 5K5QA 1CGPA 1GHCA 5CVRA 3GXOA 3KFWX 1KU3A 2Z33A 4QWQA 2HOEA 2MBFA 3LA2A 3T8RA 4FX4A 2F5CA 3FMQA 2ZO4A 2FE3A 4M9XA 1FSEA 5E1WA 3IKTA 3N97A 2QZ8A 4RB2C 2CSOA 4RGXA 3T5XA 1J9IA 2VE8A 2QYOA 3LQQA 1TQIA 4ZYGA 4O6JA 3RKYA 5HS7A 5D8KB 1O3SA 4PGGA 2ISZA 1ZGJA 3LFKA 2O0YA 1KQ0A 1E2XA 2K4JA 4HBLA 2Z99A 2XRNA 3RYRA 2L01A 2L4AA 1YS7A 2M87A 5ED4A 1YYVA 3F72A 3V8KA 3WE2A 3TO9A 3TO7A 2DU9A 1R1TA 2OD5A 1FY7A 4YIIA 4HF2A 2MH9A 2DT5A 3KP5A 5FFXA 4G7ZF 2FA5A 5ILUA 1G3WA 2FBIA 3BPVA 3I59B 3G73A 2HYFA 4MEYF 2EB7A 2XAFA 2M45A 1P4XA 3ZMVA 3AAFA 5LGUA 2CWEA 1FX7A 4FX0A 1STZA 4LB5A 2V6CA 3DPLC 3JSPA 3EQLF 4M71A 4Q48A 1WQ2A 3HHGA 3HOSA 1USTA 4XLPF 3CO6C 5BPIA 3QP5A 3LAJA 1HW2A 3CJNA 4BHPA 3HRMA 2JPCA 1LJ9A 1R7JA 1Z7UA 3R0JA 4M6XA 2ESHA 2AS5F 2VN2A 3K69A 4ZZLA 2FU4A 3E3VA 4U0YA 3GFJA 5LBQA 5HOOA 2UXNA 2AXLA 5ICCA 1BI1A 2HQNA 3GO5A 3NRVA 3IWZA 3WTTC 2XKPA 5E1ZB 1X3UA 3I58A 1MD0A 4MQVA 1KU9A 5TJJA 4BQAA 5DCMA 1ZRFA 1IN6A 5ICFA 3DF8A 2Z5UA 1T2KA 1ZLKA 1YFHA 3WGHA 4A2UA 1FBUA 3ROUA 3BWGA 5HDGA 1D3YA 3LQRA 2DAOA 3U1DA 4EM2A 1R58A 2QWWA 4O5VA 1YG2A 4P55A 1MJ9A 1S3JA 1Q1HA 3O2PE 5F1RA 1L0OC 3GUDA 5L3BA 4KIGA 1IW7F 4Q47A 1LEAA 5ICGA 4NQWA 4HAMA 1XSXA 1TTYA 3ERED 4GGGA 3VEPA 3EUHA 4BH9A 1PUEE 3KZZA 3IHUA 3BJOA 2NAZA 4AIJA 3HRTA 4R8HA 3E97A 5BOXA 2QBYA 3J81K 4WK8F 4U7BA 2ACJA 3FXRA 4Y17A 2ZJ2A 1WWXA 2HQRA 1BI0A 1OYWA 3DQVC 2B0LA 1F1ZA 5K5OA 2P7VB 3M7GA 3I59A 1GVJA 1HW1A 4A0XA 2R7FA 3MEXA 4U7DA 3EDPA 1H9GA 4UNOA 4EGYA 4IHTA 1MDMB 4KIFA 3RJPA 1MGTA 2YPRA 2PLYA 5IT3A 3JSOA 4HLXA 3ECOA 4Y15A 5TRDA 2IPQX 4N0BA 3SZPA 4PCQA 3FHZA 5E18F 1O57A 3GYHX 2NNYA 1WKMA 1BOAA 3K2ZA 4LLNA 4ETSA 2DQLA 2W84A 1BIAA 2EFPA 4P9UA 2ELHA 2J5PA 5BMZA 3IL2A 3KETA 1LDJA 4E70A 3F6OA 2YX7A 1W4MA 4BHCA 4ON0A 5D5WB 2RKHA 1J59A 4NB5A 5DCFA 5D4SA 5HS9A 1P4AA 1U6GA 1R1UA 3EYIA 2FSWA 3J7AO 4EV0A 3KLOA 1BJAA 1BM9A 2YSRA 2F5EA 4M72A 3E6DA 3IC7A 3RPQA 4KA4A 5L3CA 2HDCA 4G94A 2VT3A 3R0AA 3NEUA 4HDUA 3FMSA 3RKXA 2PEXA 4Q4ZF 5CJ9A 1U8RA 1I5ZA 4EJUA 3TO6A 2HGCA 3ZMDA 2LF8A 3ABUA 3Q9SA 3DPTA 3J80Z 3GX4X 3IKVA 2HS5A 1KA8A 2O8XA 2MLKA 3U2RA 4IF4A 2RGVA 1QO0D 3CUQB 3QU6A 2D1HA 2O6GE 3I5UA 1YW9A 3IWFA 4EJOA 2X4HA 3GFLA 2X0LA 1XCVA 1UHMA 4KNYA 2Q0OA 2P4WA 1MDMA 3V8JA 3LAPA 3Q5FA 5CVJA 2EFNA 3RKWA 1KQ8A 3WTSC 4U0WA 1TBXA 4ESJA 2NRAC 3LWFA 2DW4A 2KRFA 2Z3YA 3QPTA 3ZP5A 4U88A 1Z05A 4EM1A 2M30A 2ZCWA 2NNNA 2CQKA 2OZ6A 4L0YB 2DK5A 5LGNA 2RDPA 3E5XA 1HW5A 3E6CC 2YX4A 4KT5C 1ZG3A 5ICEA 2ZNYA 1O3TA 3HRUA 1HSJA 1USSA 4BHBA 4BXUA 4KDPA 2P5VA 2BGCA 2IA1A 2HTJA 1FP2A 2PN6A 2BBYA 2CFXA 1FBSA 4EM0B 1J7KA 1B9MA 1P92A 3ISPA 1I27A 4HX8A 3MFKA 2W25A 3I0TA 3M1EA 2E7WA 5DUKA 1TW2A 4N9IA 3GLXA 4I7HA 1FYLA 2V1DA 3H92A 5FLXK 3CUOA 4G9YA 3FXUA 3U9GA 1U5TB 1IZ1A 2HKXA 1T0FA 5IT9Z 2XAGA 5ILVA 5DCMB 1ZREA 2J5OA 1ZG5A 2F2EA 2MA3A 1XCBA 2FRHA 3K1NA 1Z1DA 1J75A 4AIKA 1YQAA 1ZHFA 4OOIA 2VBYA 3ULQB 4CO8A 4MHGA 3R6SA 2JT1A 3M8FA 2MD5A 3CUQA 1HKQA 3KE2A 5CLSA 3FXQA 3ELKA 3R60A 2JRTA 3F21A 4I09A 3C18A 3TDUC 3SZTA 2EV6A 3IRRA 4UVCA 3WGGA 5JR3A 2A69F 2F5FA 2STWA 3BROA 1O7FA 4RGRA 1F5TA 4M73A 1WSUA 1LVAA 3VOEA 3DEUA 1B59A 1QPMA 4P9FA 1BC8C 1IN8A 2QBYB 4CYDA 4UHTA 4N9HA 5D4RA 3HUGA 3JAMK 2P6SA 4OMYA 1ODDA 1F9NA 2E7XA 4LGWA 1G3SA 1AOYA 2ETHA 2DLLA 1HQCA 3M8EA 5DUIA 2KIUA 2QENA 5KVRA 4CHUA 3KP6A 2H09A 3QOPA 1KQ9A 2QLZA 5D5XB 1R5GA 3WTUC 1FOKA 2CO5A 4KMFA 3GWZA 2WC2A 4IJAA 2UZKA 2FBKA 1S6LA 2QQ9A 4JK1X 2OA4A 3TGNA 4IRHA 5E17F 3COAC 4IRGA 2LF7A 1BBYA 1ZGAA 3CLOA 4K2EA 5D6FA 1R23A 4B8XA 2IP2A 2MH2A 4TV7A 4FHTA 4UVAA 2RNJA 3M9AA 5L3FA 1RZ4A 5AIQA 2O61A 2HTSA 4M6YA 1U5TA 2CW0F 4D0PA 2HYGD 1BIBA 1TNTA 2ZKZA 1R5HA 1SFEA 4M9ZA 4G6QA 1MKMA 3P7NA 2DFIA 3L7WA 3O3KA 1UHWA 3H3ZA 1Z6RA 2P5LC 3DP7A 6PAXA 3K9TA 4GO1A 4A6EA 4PZJA 3RTRA 2K02A 3FZVA 4HX4A 3ZQ7A 1AWCA 4ZZDA 3WTVC 4PDKA 1D8JA 1LDDA 1NHAA 3WTWC 3RYPA 4EJWA 4A5NA 1JE8A 3KZYA 3TOAA 4LK0F 3SQNA 3QPHA 3FMRA 4XLNF 1K7AA 3MCZA 4HV6A 3ZN1A 1IXCA 3SHFA 4L5IA 4LB6B 4A5MA 4G6DA 5LEJA 4EQQA 3KCCA 2LNBA 3T1BA 1DDNA 5F6FA 3RI4A 1XMKA 2DPDA 1J5YA 2XASA 2OBPA 2LSOA 4MQ9F 5HVQC 2QM3A 3GVAA 3L09A 4LMYA 1QZYA 1BI2A 4AVPA 4O3MA 1UCRA 2FNPA 4HQMA 5FFZA 2H6CA 2GIVA 1XN7A 2A6HF 4KIBA 1K78B 2FEZA 5CVUA 3FM5A 3BY6A 4WF2A 3QRFF 3P9KA 1XDSA 1BN5A 5AONA 1P6RA 3K0LA 3WG9A 3SXYA 1Z9CA 3RDIA 4ESFA 2JZYA 4WXDA 1IF1A 5J8FA 4EJVA 5JFRA 4KYWA 5F64A 4RAZA 1YO5C 2R3SA 4NHJA 2QQBA 1ZN2A 2G7HA 2JSCA 4GYIA 1FLIA 1LEBA 4IRIA 1EV7A 1IN4A 3I54A 5E20A 1SD5A 1HSTA 1LNWA 2M5WA 1PP8F 1OMIA 1RIOH 4OIRF 2IVMA 2XHKA 2DPUA 2HZTA 2OU2A 4HLYA 2GXBA 4HV5A 5LEKA 1IRFA 5BPDA 2QVOA 3F22A 4PGHA 1OKRA 1S7AA 2H94A 2D2WA 2UWMA 1B4AA 2YU3A 1QGPA 5DV5A 3HTUA 2BV6A 2BE5F 4UV9A 2GA2A 2FMYA 5LHIA 1XSVA 4M74A 3J80K 1O3QA 2A5YB 1CF7A 4KUMA 1OPCA 2FQ3A 4GCVA 4ESBA 2L3DA 5HDNA 4ZYDA 2WV0A 3GZ6A 3I4PA 3H3UA 2KIMA 2HEOA 2E1CA 3F3XA 5EEHA 2O03A 1XGNA 4OU0A 4I0BA 2H6BA 2PI0A 1ZRDA 2Y48A 2ADUA 3WGIA 1XGMA 5EEGA 1O3RA 1K79A 2G9WA 4OIOF 4RS8A 2VONA 4B09A 2XAJA 3HYIA 4KMUX 4P5OA 1E17A 2FMLA 2WWYA 4BYYA 1TQMA 4P96A 2PFBA 2F5DA 3ZMUA 3F8BA 4YG2F 1S29A 3GEZA 2ZNZA 1TW3A 1H9TA 2IW5A 5HLIA 2MLGA 4M9SA 4YFNF 1PP7U 2VOPA 1IXSB 4L0ZB 4L5JA 2P8TA 5H20A 1GXPA 1K78A 4OIPF 2FNAA 1PDNC 2PMUA 1T6SA 4WXHA 3W6KB 3V8LA 1SMYF 5K1YA 2EV5A 3LA7A 4MGRA 1Z91A 1RUOA 4CGZA 2JPBA 4IXAA 3CO7C 4WWCA 3K1MA 4MEXF 3JTHA 4HA8A 4UVBA 1SD7A 1W7PB 3PQJA 4Q5SF 1OYYA 2IRFG 3HIFA 2R7DA 3DV8A 4XRFA 3V4GA 3GF2A 2P6TA 1UFMA 5DDGA 1EH8A 5A2QZ 5K5RA 2KIFA 2K86A 1IN5A 2G7UA 1I1SA 3L00A 3MZYA 2V79A 2KJCA 1MJBA 1FBQA 2DK8A 5IT9K 5H6QA 1ZYRF 1W7PD 5D5UB 2L54A 1YIOA 2COMA 1ZG1A 1KYWA 2KKOA 5CVIA 1ULYA 2PG4A 3V7RA 3KP3A 1HXDA 2GXGA 4I02A 1B1BA 2W57A 2V1XA 3ABTA 2EJRA 2A61A 2RV8A 2UXXA 5HLHA 5DEQA 2FBHA 4ENJA 3ML6A 4OIQF 5CYVA 3R4KA 4DNCA 1W5SA 3RPUA 1T38A 2LKPA 4HF0A 4S04A 2XUBA 3GFMA 3HSRA 5E8IA 1WRJA 1F4KA 1HKSA 4YFXF 2ESNA 1TLHB 4G7OF 5CVVA 3F8NA 5HS8A 2XKOA 2HFHA 4R1HA 1R22A 5DD4A 2W85A 1JGSA 2EFQA 4XSZF 4HOBA 2K27A 2KJBA 2HKOA 4L9VA 1JXSA 5FLXZ 3I64A 4LG0A 5LLQA 2W24A 2C6YA 1U5TC 2WTEA 5KK1A 4U0VA 1RUNA 1DPRA 1FPQA 4FT8A 1EH7A 1YS6A 5L3EA 1SFXA 1D5VA 4JQFA 1G3TA 5ILSA 4ZYHA 2CYYA 3I53A 2IA2A 4Y13A 1SAXA 1J0RA 4I01A 3JTGA 1FYKA 1GXQA 1TNSA 1SFUA 4A0YA 2M1BA 2O3FA 1W7PA 1IXRC 3F6VA 4ENNA 2NS0A 4ENMA 2V9VA 1FT9A 1K6OA 1P4WA 2Z9OA 5LRRA 1MJAA 3BZ6A 1KU2A 1SD6A 3WU0A 2VC0A 3P9IA 3GFIA 4UUVA 4EGZA 1QBJA 4GYGA 1TQPA
chains in the Genus database with same CATH superfamily
1W0CA 1J49A 4BZWA 1MH9A 1ZKDA 3TE6A 3QAHA 3D8RA 4JX9A 3HCAA 4PLWA 3BERA 2MFZA 2BE9A 3RG8A 1MBKA 5BY2A 2AEJA 1FA9A 3N4MA 5G4KB 2ZC2A 2DBQA 4IJQA 2OORC 4RLQA 1RHRA 4MYRA 3OYIA 2HWVA 5HZHA 3WL3A 4ENSA 3FLEA 5E1OA 1D6SA 1DARA 3K32A 5FOVA 3DFGA 2AOVA 2DUMA 2LY2A 4JOSA 1YVRA 4JI1B 4LN1A 3GRRA 1LBIA 1N5RA 3CD6I 4IILA 4DJAA 4G1MB 1MG5A 1RKBA 5D6EA 4RHYA 4UDNA 5HWSA 4BXOA 4Y3OA 5LU8A 2K7LA 1BWRA 1NYTA 2YICA 1LEHA 4HWGA 1P3Y1 3MFQA 4CKEB 3G79A 3NP9A 3NV9A 3GP5A 2ACWA 1F8UA 4X7PA 1KP3A 1M6NA 2GLOA 2GBGA 4ENKA 4ZXFA 2WKSA 5LMZA 3E3NA 1YL7A 2QQ5A 2YC4C 1B72B 4KLZA 4UMDA 1CB7A 1R9TJ 2CHQA 8GPBA 3MWFA 1JYFA 3ETHA 3R7WB 5LP6A 4FD2A 2IZ5A 2EV0A 2B20A 4WEOA 4YRRA 3BJ6A 1XCGB 4DMGA 3M6FA 4MVJE 4DT1A 4FWTA 1YRLA 1BW6A 1PG0A 5CLJA 3AVYA 2D1YA 4TKVA 2FQWA 3PIPF 1EQ2A 5EWMB 3VOSA 3AI3A 3C3YA 3FMGA 2J59A 3O4RA 4I1RA 5DNYB 1DWOA 4JR2A 3KYDB 5HKKD 4IQ4A 5JWOA 3DKWA 3WHCA 3PGXA 4N6OA 3QLVA 1ODIA 3IJEB 3IP8A 2ENWA 3WFZA 1SCBA 1P1JA 1W0KD 5HFJA 4MWEA 5IHPA 3BZUA 3ISVA 1Y1KE 4GZ6A 2E87A 3O92A 3D0SA 2DF8A 3E9CA 5CPRB 5LB2A 3VU9B 4BEJA 4YFKF 2WM8A 3BDDA 3H2GA 1OXXK 4YACA 3OT1A 5IZCA 3IHKA 1O6FA 4DKJA 1JHFA 4GP7A 1Z0FA 1R6UA 3ASVA 4HEA6 4YQZA 3EASA 4GQIA 1DB3A 5KKCA 1D1BA 1I4OA 5AOCA 1PFVA 3I76A 3ES9A 4JUAA 3KUUA 3AKCA 4GQBA 3LSRA 3GTMJ 4TV9F 2R5ZB 3FWEA 1PW5A 3PIOF 2HBZA 3ZD6A 1I51A 1ONVA 2VRWA 1T3LA 2L4MA 4DLKA 3HM9A 2UV8A 3OV8A 3ILVA 2OTCA 3VO9A 5CA1A 4FGKA 4KQ2A 4LCBA 2VQ3A 4PSKA 2IPOA 3D5LA 4N0EA 1PFYA 4C22A 2JFQA 1OH7A 4BJTA 4WLFA 5ITZB 1HDPA 3V33A 1GL7A 2ZOSA 4FS8A 5DS9A 1D5WA 1WCMJ 4HNQA 1FB5A 3OC0A 4RORA 1EQUA 2J3DA 3ZHUA 1GQOA 4GI5A 1RAFA 1TAUA 1OZHA 5BSVA 4Y6RA 3CUSA 1PR6A 5HUQA 1CHNA 1SNYA 3CCFA 4D0RA 1O94A 2JLRA 3E9ZA 1E89A 3R2JA 4WGGA 2VDRB 2OOSA 3QWFA 4C5AA 3IT1A 2ZB4A 3LIIA 4F5YA 4I08A 3D8TA 1P3DA 1UF9A 1Z25A 2F1HA 1Z4NA 2H54A 4YRBA 4RKEA 4D5FA 3W6VA 3NQOA 1SVWA 4ND8A 2YXBA 4YRZA 1YJBA 3OUUA 2MINB 4OU4A 3OQPA 3AHEA 5ES4B 2AK2A 2N1BA 1OA0A 3A70A 4E5KA 1LI5A 4DLXA 1JDSA 2WKPA 2ATEA 4RD2A 3S1QJ 3T0FA 2PYDA 1AS2A 1VI5A 1SU8A 4D2IA 2X3FA 4GHWA 4AKSA 5HS6A 2D06A 1ZRCA 1O97C 4KLNA 1AKUA 5HQJA 3A9CA 2WF5A 1XVTA 3AIIA 4AWXB 5IYZA 3W6NA 1RETA 4W5QA 2JKYA 2C5LA 1ZOOA 3A1VA 2BN4A 1MJHA 1W5EA 4EWLA 5CVRA 4EKIA 3LQKA 4ZAXA 2HQSA 1M6EX 4I2VA 3QKTA 1N4DA 5KTNA 1WW8A 4I81A 3SZOA 1ETYA 1FQWA 3M1IA 3MG9A 3F67A 3KYJB 3BWMA 1W2WB 2PKYX 4I1YA 1GNVA 4LV6A 1YITI 1N1DA 3VBCA 4INOA 1W6RA 1V1MA 4OFBA 4TUYF 2QYOA 3D6JA 2W6JA 1HFKA 4AUEA 3ZQKA 4P0QB 3ZV3A 4PGGA 4FBGA 1CQTA 2VH5R 1VBFA 3ZIAA 4WCDA 4DR4B 3I8OA 3PNSA 1C2TA 3W2FA 2LG4A 1T5HX 2NWQA 5K9ZA 5DK6A 5LN1A 1VCHA 3CW9A 5F23A 1OX5A 3HJEA 5K0ZA 3C8MA 3LUDA 2V6CA 2ZI3A 3NUGA 1U3FA 1ACIA 1TRKA 4YWHA 4XLPF 3QP5A 1T6NA 5ETJA 3UJCA 1J2TA 4URFA 2E5WA 3DPSA 4RZ3A 4EQZA 2XCUA 3ERCA 3U4AA 2PZMA 4ZZLA 2M6KA 3GEEA 3E3VA 1BKYA 3GFJA 4AYWA 2C4KA 3PSHA 3NU1A 4LV8B 3K6KA 2J3KA 3SYRA 2YWGA 1ZFNA 4IYRA 1ZUNB 1T2KA 2JLYA 2OV8A 1U63A 3V1MA 1C8LA 3ZBUA 4MJXA 3GT7A 3PX2A 3BWGA 3DE6X 4HTAA 2DAOA 3KWFA 5LJIA 3BR2A 2X4IA 2VJJA 2FSUA 1MW7A 4PSDA 1JJ7A 4D8VA 3GLUA 2AMJA 2Y2UA 3ZNNA 2QRVA 1KQFA 3IQEA 1PR4A 3AUSA 1Z3YA 4HAMA 4G81A 4GGGA 3DGEC 4MVJA 1HOMA 1UKZA 3C3XA 5IT9A 3IHUA 1I0LA 1D0YA 4F92B 2H4FA 3SIWA 1PLJA 2XXAA 1JVBA 3DQPA 3RM3A 1YQ9A 3Q1LA 4TSFA 2GJ4A 4PFJA 2HQRA 4MV1A 2Q7DA 1EX6A 1HY3A 1JEDA 3WNCA 3EIQA 1HDCA 1AV6A 1X70A 3C6MA 1N9GA 4P92A 4G0NA 4P35A 2DPXA 3I61A 4S24A 1RC9A 4B3AA 3ORSA 2PLYA 5CFPA 2IOHA 5K0NA 3S44A 5DTDA 4BFXA 3UM9A 3R4VA 4MRMB 4CN8A 2Z1MA 4UQLA 3BR1A 3S99A 4OQNA 4A73A 2CDRA 3ZTYA 1VJCA 1G9TA 4G09A 1HZZC 3CNLA 3KL2A 1MT3A 2FPUA 3O1LA 3X44A 4G0ZA 5WRFA 1UT6A 2W84A 1BIAA 3LQ2A 1MXFA 4OATA 4UBOA 3U21A 1F2VA 4E70A 3O7MA 3EDOA 4WZZA 1P0IA 1J20A 4R8LA 3K6SB 5IULC 8ATCA 3EIXA 4HDRB 2PH1A 4N4OB 4M72A 1R3DA 3LCCA 2VT3A 1YD7A 4D92A 3GP8A 3HUDA 1Q0QA 3IPRA 4UNRA 4IOLA 3STXA 4MKGA 3GMSA 4I9FA 1Z3IX 2CLOB 1D2RA 4Q4ZF 3A28A 4EZIA 4ON9A 3NHLA 3GQBA 4ZWNA 2ZTSA 4EJUA 2QX4A 1HDXA 3U44A 4OTZA 2R6AA 1H4QA 3AEUA 3IKVA 1YL5A 3H2JA 4MUKA 2ZXUA 4IDBA 3ZHOA 4JBLA 2ZBFA 1ZX1A 3P9PA 4B3SB 1JDBB 3N5CA 1ONBA 3G9ZA 3BXOA 5K0JA 3UY4A 2KMLA 4HX9A 4UD6A 2WNIA 2ISCA 1BRTA 3L0OA 1K8QA 3TNFA 3OYHA 1PVEA 3OYMA 3B6EA 4Z5XA 4IH4A 3U7HB 4NDLA 3MQFA 1JLLA 3H18A 3R76A 1E6MA 3LWFA 4AN1A 3F8TA 4UUNA 2ODQA 3A9WA 4X41A 4F3NA 1PI3A 5MFZA 4NJMA 5FULA 4M7OA 5I4IA 2XT6A 4WXMA 3L0ZA 3MGAA 2BZ1A 2XSZA 3HVHA 4YT2A 1GTVA 1QKJA 3QA9A 4A10A 4B6JA 2HIGA 4C2BA 3BK7A 5K09A 3HHPA 1CUBA 2D5VA 4QPPA 1FP6A 1T8WA 1HKUA 4ZU1X 4BXUA 3KE8A 4S0XA 2P5VA 4TS9A 4EBBA 5K8TA 3Q10A 1PNTA 1V95A 5GPAA 1Y9DA 4UCWA 3IIIA 4OSEA 1P92A 4RM3A 1EF4A 1NFRA 3G8CA 4C7XA 4CQMB 3L7KA 4X95A 4U2CA 5KX5A 3UOWA 3WGYA 2HR1A 5FYDA 1C1HA 2ZBUA 1QO0A 1JLKA 1NM5A 1DPGA 1OREA 2ZRDA 4JS0A 4CW7A 3WADA 2R751 4E94A 2I7TA 4TLBA 5KDDA 2FRHA 4BBPA 3FKJA 4CQMD 1W34A 3ESDA 3ULQB 2NU9A 1GU1A 2OV3A 1CJUC 1X1PA 4CF6A 4MV5A 3SZMA 3OEED 1OIVA 1WJEA 5KUTA 3DWLE 4MVJI 3ROEA 3Q0IA 1PJLA 1IXZA 4N0MA 4XM0A 3ONWA 1JEYB 2X1MA 4RV5A 1BJRE 3SZTA 3NOOA 3BJRA 2FMIA 1OH6A 2PX2A 2R7AA 4F72A 4Y2QA 3TVTA 4FYKA 2STWA 4UUQA 3OIGA 1Z29A 4GIBA 5B4VA 2QEXI 2YMLA 5AMXA 3D59A 4ZREA 2ZYIA 2QE7D 2RARA 1H6AA 1DQPA 4UHTA 2QMEA 1GGVA 5EKTA 1EUDB 1DGQA 3PC7A 1OKKD 2F5VA 3QE4A 1AOYA 4IHKA 1KZ4A 4ARSA 2R5YB 4NCAA 3PT9A 5DUIA 1CJTC 4KEAA 1JHPA 4XI9A 4LDNA 4IDCA 2Z08A 2XMPA 4WFKA 1U5BB 2WBMA 2IV2X 2XNDD 3IE0A 5BV1A 1KQ9A 1EDBA 1AKEA 1F0YA 4MA5A 4B82A 3ZG6A 1ZGWA 4UUOA 3FBWA 3FPGA 3BS4A 4NH4A 4ZOQI 3LWZA 1ZH2A 5KNBH 2KRHA 1I3CA 5CNIA 1S6LA 4LGVA 2IHTA 2ZSFA 4L5AA 1M66A 4F7DA 3ZCTA 4BJ5A 2V03A 2JFWA 5DBEX 1GCAA 3FX2A 2VDUE 1KZ7B 4L6IA 4MUJA 3D54D 3EEIA 5CFLA 1XZFA 4N12A 1KEZA 1GPWB 4BNVA 5KNCH 2R00A 2G4LA 1J42A 3ZW8A 5CH5A 1SFEA 3EDQA 4M9ZA 2DFIA 4XUEA 4AK9A 2OTLI 2H00A 3VBEA 1YVEI 4UTPA 5E6SB 5HX7A 2IS2A 1PNOA 1Z2EA 5JAOA 1TWFJ 3IGFA 1GKIA 4R8VA 3T9BA 3BFKA 3SP1A 2QJTA 4BP1A 2XCSB 3ROMA 2NUAA 1VPTA 4PYOA 2HB6A 1VQLI 3AM4A 1LW6E 3ABKH 1K4MA 4L72A 1EA5A 5E6RB 4KMRA 1LS1A 3BR6A 4E7PA 1I0IA 4PYQA 5F6FA 5K8UA 3HN7A 1P0QA 1WMFA 1QS0A 1E3IA 5LYJB 1B6RA 3OKFA 3DNMA 4YXWD 1S8OA 2EXXA 2EL7A 2QMQA 3SEZA 1UCRA 1Q0TA 4HQMA 3PGLA 1YZNA 2BGMA 1NVAA 1OUMA 4LV5B 2Y0CA 4WCFA 3A3PA 3IUMA 2I6FA 3AHIA 3TI7A 4MP8A 1C3XA 1V9CA 2ZCVA 4P1ZA 1K68A 1Z8DA 4BO1A 1DWQA 3STYA 1USVA 1UDCA 1ETWA 4EJVA 1RFGE 3DEYX 4YJDA 4ZIRB 3QMMA 1D03A 4RFSB 1TAQA 2G7HA 5BNWA 5DM7F 3W04A 2H5JA 5FUWA 3A0RB 4YRMA 1BVHA 1XIVA 3ESAA 2FF7A 1RJWA 4F2DA 3KKOA 2JB9A 4LUCA 3WLMA 3HJUA 4MRVA 2QUHA 3IQXA 3T5TA 3OFNA 4DV1B 3ZH2A 4Z0NA 4FR2A 4A3DJ 4CMEC 1Z9BA 4JWTA 1QF6A 3TH5A 3TECE 2DSTA 3O2NA 3SE7A 2QROA 3EPPA 2BV6A 1TEXA 3R41A 4I99A 4JLDA 2W82A 4RVCA 4MEAA 2CLMB 3FR7A 2W2MA 1DKOA 1IPFA 4ZALA 3Q8LA 4D9BA 2AEMA 1M0SA 4YJ2B 2WK1A 4V0LA 3BTIA 3EIOA 4EW3A 4CR8A 2QEQA 1TU3A 3GZ6A 2DQ4A 2XI4A 3I4PA 3X1XA 4H2DA 3GFOA 4LDZA 4XEHA 4XOIA 4I0BA 3MYYA 1MJFA 5H80A 3UH0A 1ZD4A 4PS0A 1FFXB 3TNLA 2YVUA 3W2GA 4PONA 2XVYA 2E9SA 2VS1A 3TK1A 4P5OA 5JLAA 2CXOA 2Z98A 5FTKA 4JBIA 2WUDA 4OFZA 2F5DA 2JA7J 4CIWA 4UEKA 4TVSA 3CPHA 1H9TA 3IFSA 5HLIA 1G8PA 3RTBA 4RYDA 3CF2A 1JFVA 3PFWO 2KMUA 1M2OA 3CESA 3OZBA 2WABA 3RLIA 4L8WB 3MT0A 5G0TA 2R7NA 5GAEJ 1G8JA 3HWWA 1LNSA 3KFVA 1NP6A 1XJQA 4KX5A 3V8NA 3F0TA 4PQYA 2CK3D 3N2KA 1SFKA 3O8BA 4UVBA 1KL7A 2ZXFA 3IELA 4V1CI 5DGTA 521PA 2BVLA 1P31A 3P5JA 3HRHA 1TA0A 2HXYA 2UXDB 2O1WA 1U80A 2WSYB 5CX4A 4NMHA 5AVVA 3L06A 5DBOA 2CVPA 1T6BY 1UADA 3QTBA 5FJIA 3IJRA 2E35A 4ZEMA 2HK9A 2WVHA 1IN5A 3N39C 2DK8A 3RRYA 3WWZA 5H6QA 1KQOA 1RMTA 4HBGA 1E7WA 2X41A 3O38A 4AS1A 2FPIA 1ZG1A 3BK1A 5CG1A 3ZE2B 4FOTA 3A1DA 5CVIA 2QUAA 2HBRA 4EG8A 4PCAA 5KTPA 2V1XA 4MPTA 4Q00A 2J3HA 4MWSA 2UVPB 5JG7A 5TPZD 5HLHA 4L9RA 1O5IA 1ZIYA 4TZ0A 2OO7A 3MJRA 5KTRA 3E7DA 4RXUA 4P80A 2QRUA 1SUDA 1ZM9A 3BN3A 1DIGA 3JQCA 1KTIA 5DGIA 2NV0A 2OLKA 2VXCA 4RVNA 2GZDA 1QHIA 1W4CA 4IWXA 2ZSAA 3HRIA 3CO5A 2E4YA 5LB4A 1B2RA 3KUDA 5LLQA 1B41A 1UBUS 1K5GA 1G2HA 1HC8A 4F45A 3FSJX 4F9EA 3AKZA 1XHEA 3GA0A 1XRSB 1K7SN 1XRPA 3OKPA 3I5YA 4D4JA 4ZYHA 3IB3A 2BEUB 2HA6A 3W06A 3TXAA 5LFAA 3O95A 5LDDC 2FFQA 1L4MA 4Q4HB 2AW5A 4JOCA 5TIIA 1S2DA 3PEUA 2C99A 4BNLA 4F2PA 3RWBA 1PW7A 4MQFB 4B1FA 1Y1LA 2OP0A 3FPKA 4I55F 4IIVA 4ETMA 1YBVA 2P2NA 1THMA 3DCNA 2WU8A 4MYHA 3VNAA 1AURA 3STHA 4UVDA 4GF5A 1NBIA 2O6LA 1DAEA 3TCNA 1AV7A 3PYXA 5C8XA 13PKA 2VODA 1R5NA 2DFTA 3L01A 2A92A 4OHRA 2QU7A 3DEIA 3JALA 1P6XA 1YIJI 1TZMA 2Y75A 3V6LA 3OOHA 2D45A 2C2BA 4OMUA 1QYCA 4LX0A 1QQ7A 2QP3A 2IVFA 3OU6A 4HV4A 5FLEX 5CYFA 5IC4A 4C3ZA 2V6EA 1OA1A 2CL7X 1NDHA 4ZN6A 4OL9A 2OZLB 1PT5A 3FZNA 3TW8B 2LIPA 4O1MA 1PG5A 2GA1A 3PUHA 4RLFA 3IULA 5DLQC 4CCJA 2VDWB 5B5SA 3IB6A 1Z08A 3KZOA 3AZOA 3IQHX 1K4SA 4O4LB 1MFZA 1P73A 1FXUA 4KICA 3I05A 5H6RA 1C3LA 1FLAA 1H66A 4D9GA 5BNTA 1NVUQ 1VHDA 4NZPA 2A3SA 3CRRA 3TLZA 4L3OA 1AUOA 2I2FA 1UM9B 3HCRA 2VBIA 3BWVA 4FSXA 3P9YA 1YFZA 5BR7A 4PGMA 2JD0A 4MI9A 2I8CA 3GDGA 5K7SA 5IH7A 3A6KA 2IS4A 4G0YA 2J7PA 4IOMA 2W6PA 1LZLA 1WBBA 3HZZA 3AR3A 3SVLA 3PEEA 5AVQA 1U0TA 1U0EA 1S3IA 2YJZA 4QBFA 1KK1A 1QIHA 3VPSA 2HF7A 3B2NA 2IZZA 1YRAA 2R1VB 3BQYA 2GUGA 4LAFA 4HGQA 5HIAA 4Q15A 4H60A 4XR6A 3KTOA 4JLOA 1CQJB 4CKBA 4D44A 2H2WA 4BXXJ 4MRAA 4ZAZA 3TTWA 2QIOA 5LQCA 3HV2A 3W5HA 3KSDO 4YDQA 1SVSA 2AQIA 2QRKA 3QU3A 1OVGA 1ISGA 4GRAA 1IOZA 1YWGO 1WP9A 3N0WA 4RVOA 3G68A 1WV1A 3O47A 4NC6A 2VASA 2K85A 1YQWA 5FTLA 3KSZO 2AQKA 4DV3B 3CLVA 2GK3A 3WL6A 5JAMA 3L0PA 3CXRA 3KR0A 3TLCA 2C5AA 1T2CA 1JEOA 3ECHA 5KQGA 1T36B 2Z6AA 4WLNA 2DI3A 4JUDX 4YRQA 4FGLA 5F73A 1FJLA 1CR1A 4HYEA 5ICSA 1UMQA 2VBGA 1E2IA 4E5NA 1LWOA 1WZCA 3BMOA 4IGEA 1VNDA 3OPXA 5CBPA 1LJLA 1VL0A 1GNLA 1CHDA 4GI1A 4OOEA 5HIIA 2XWPA 4M1QA 5HBGA 1OFCX 3OU7A 1ZHHA 1W25A 4KFRA 4RK0A 1QF9A 4D9NA 2QP4A 2PL3A 3RVRA 5EQDA 2OQ2A 2W2KB 3NTQA 4MDHA 3S27A 4DE5A 1PU2A 6Q21A 4MUMA 2QN2A 3UAYA 3G7NA 4BEHA 2PMZN 4AZWA 4NS4A 3THYB 3GRAA 4OREX 3GPBA 1WMEA 2RHBA 3OZAA 2WILA 6CHYA 2ZXIA 3U09A 3WJ7A 3IT2A 2JTVA 1KOFA 3BFVA 4QOSA 3PJFA 5BR8B 1NF2A 1BFUA 2HFJA 1FP4B 1PUJA 1W1UA 1E3LA 1VJ1A 2BEVB 3I4FA 3EYYA 4PR3A 5D87A 3BP8A 1Q1AA 2YQ5A 1BG6A 3P2EA 2GZSA 5KYWA 2UDPA 3TPZA 1L5YA 5BQOA 2DQRA 2GTHA 2ASVA 3IAXA 4RGUA 1SVNA 4JYZA 3OS2A 5J8CA 3LMMA 2X5OA 3T7JA 3TDZC 2AHRA 3TZQA 1H4TA 1KGSA 5TMDA 2QWXA 4E5PA 5EVJA 4BACA 3I9JA 4FEAA 2EF1A 4DREA 4BVJA 1L5RA 1B8NA 2WDZA 2F9LA 3UWDA 5JALA 1ETUA 2ZMEB 3DEJA 5LCXA 3SVZA 4P4SA 3ZE6A 2B35A 3D4PA 4W5TA 4UREA 3Q8XB 1G291 5H59A 1CTQA 3SSMA 1QIEA 5HRUA 1E3JA 2C2XA 1IOWA 4HQNA 1MZVA 1QSGA 1EVYA 2ZUBA 3C7CB 2W8BB 4EG7A 1W4AA 5K03A 3IOEA 4MYTA 3CUUA 4L8FA 3UB4A 2AOXA 2FE3A 1Q3TA 3N97A 3ODPA 2B1IA 3K2BA 4V02A 2GM9A 1AUXA 1C3VA 1WV0A 4HDMB 3LFKA 2LC2A 5DE3A 3PFNA 1VPWA 2WE8A 2QL5A 1NNSA 2ZJQF 3Q7RA 3A1YA 2CLIB 2YJ6A 2QNBA 3MJCA 3GZ4A 5JI3E 1HFEL 4IIJF 4NUBA 1X0VA 1DEAA 1X80A 3UANA 3EQ8A 4YIIA 2A5JA 4KN9S 3MWDA 4YT5A 5TMPA 1G3IA 2FA5A 1AQLA 4AZ0A 2NO4A 3ITEA 4MMXB 3R7NA 3AF5A 4JLNA 4XIYA 4CM4A 1M2GA 5E0OA 2XMBA 4J3JA 4ER3A 2MR6A 4JT8A 3J7TA 1P1FA 2IQIA 3NJ4A 5KJFA 3A0BC 3L7YA 4Q48A 4O3FA 1FOWA 2GXSA 1QP7A 3KOXA 3QY9A 4HUJA 1NK3P 5D6NA 1EK1A 1E2BA 1G17A 3DA8A 4X24A 3OQJA 4D3DA 3CY6A 1JE0A 1OAAA 5AI6A 2PNJA 4XQFA 4QJ3A 2IGBA 2W58A 2IEAA 2O0JA 3WK4A 1QCDA 5JSKA 1K6IA 1ZLKA 3LX6A 3DMDA 5CTAA 2YJ5A 4BB0A 2B4YA 2QQ0A 1RYDA 4QZVA 3QNUA 4JI0B 4NBWA 3ZS9A 3PUZA 1G42A 2WJ4A 4BV2A 1H0KA 2Y1DA 2DOKA 1ISIA 3RREA 1RPWA 1DJLA 3DR3A 2Y27A 1RI5A 5ALNA 3CGGA 2OR3A 2P3SA 5L3SA 2D5LA 1JKFA 3I0ZA 2XB8A 4W8OA 2WZBA 5EUBA 1QGYA 4BH9A 3K6JA 4BZQA 1NLFA 2HTFA 2P81A 1N32B 4ZOLA 1FUUA 1OH5A 1T34A 2XQJA 4B44A 2HRBA 3BK2A 3LRPA 1SHZA 2F1RA 3TFOA 3PD1A 4YROA 4WK8F 1DAKA 3BSSA 2C58A 4HEA1 4RLHA 3WRYC 2D3TA 5BN4B 2CSXA 1EHCA 1F1ZA 2E48A 1JIXA 1BYIA 1JNXX 2G6BA 2OHOA 2OORA 4QOJA 2VHWA 3Q8KA 2JK3A 2DFVA 2PKQP 5BW5A 2D0OB 2NZJA 1MDMB 2FPSA 2WWXA 1SQFA 2X6WA 3TW7A 1P2TA 4ZQGA 1MD9A 3SPXA 2XGMA 3ZHCA 2P6NA 5EKDA 3LFTA 4Q9LA 3JRXA 2CEAA 1H9AA 2MSLA 1E4EB 4EYEA 1J2JA 1LJ8A 1DVRA 1SBQA 4BNZA 2XKBA 5KS2A 3FYCA 4F1KA 1DV2A 3W6ZA 3QU4A 3HUUA 3SS8A 1JJFA 3K2ZA 4N40A 1F3OA 5G0VA 3I2HA 2DQLA 1O8BA 3ONFA 4WNAB 1KZYC 2GXAA 1PWYE 4RPIA 3WQQA 1TX4B 2XE6A 2FV8A 3SNHA 5ESWA 1KI3A 4PTLA 1E5TA 4YCCA 4DA0A 4I50F 3A4NA 1A7JA 2QN6A 4CCWA 4DCVA 2ZRAA 3DTVB 5LNK6 1P4AA 4DV7B 2NUTB 4DQXA 3PNYA 5B1IA 3VOAA 1I50J 3IRUA 2P2LA 4JJIA 5JQGB 2HF8A 2GPNA 4RF3A 1A8PA 1LD3A 5D5QA 1XNRB 2OK8A 2DJNA 1FL9A 5DHFA 3R5KA 3DTVD 4FYPA 4RTMA 1P6UA 1DKQA 4PFKA 3W4JA 2KISA 1KAOA 2YQ4A 4CMBA 1FRVA 3TW0A 3Q0WA 3CH4B 4MRSA 4QG3A 5F7OA 1UJBA 1V47A 2VUHB 1RRJA 4JUCA 1OXMA 4KQ1A 2ZSHA 2GCPA 2R7QA 4K86A 3QU6A 3CWQA 3RS4A 1U8EA 2QNRA 3DE7X 3F7TA 3DDZX 4DLTA 4QOIA 4HHEA 2Z4TA 2FFRA 3P5SA 1VMAA 2XUDA 2LW7A 1MMFB 3C5EA 3V4RA 4KWIA 2DWPA 4DWWA 1EE1A 3SKYA 3WHBA 1R5JA 5CXQA 4LOCA 5CVJA 4II3A 1RXEA 1TKBA 3LUKA 4PZUA 1TBXA 3B85A 1JNYA 2O8DA 4D5CA 1WDMA 3EUWA 1A9XA 1HLVA 4DNXA 2WPNA 4PGFA 4EM1A 3FBTA 1L7EA 1TGVA 2E2HJ 1X1AA 1KJ8A 3OZCA 5KQPA 3LWBA 2XJ4A 3ZK7A 3JCUC 2A86A 2L82A 3CLRC 1I9GA 4MHOA 3ZBQA 5IKXA 4IIGA 1SZCA 3C4JA 1GPDG 3R5TA 5IKEA 3MHTA 2FPGA 2X1EA 5E3HA 3HL4A 1USSA 3ITDA 5FLYA 1QB8A 2ES4A 4IKFA 3KQHA 2Y1LA 3VPFA 1B9MA 1DWUA 2GK4A 2GAOA 4MROA 5J59A 2LKXA 4P9NA 2W25A 3IOCA 3ULKA 4K1XA 3K0AA 4OA8A 3TRIA 5LPNA 3FXMA 2CJPA 1ADFA 4I7HA 4XICA 3UJBA 3FXUA 2OE2A 4EW6A 5GJWC 3JWEA 2KW5A 4YI3A 2C5HA 1TO6A 1Z0DA 1I1HA 5K4AA 1Q92A 1EIZA 3GRKA 1WMDA 1EH5A 3A04A 2BFDA 1A27A 1TM4E 2GRJA 2O23A 3KKLA 4MO7A 3NAUA 4ZANA 3VKFA 2QB5A 1NI5A 4IXMA 1DI0A 2QJWA 4EHNA 2PX5A 3FW1A 4MPPA 3H7AA 4FNOA 3PIRA 2CUEA 2JN6A 1FQOA 3JWHA 1RTKA 3PV0A 1QHHD 4PZCA 5GJVC 1K8YB 2FWNA 5J9FA 1JKJA 4BLOA 5ALGA 5GQSA 4MRRA 3E2MA 4PV7A 2YIVX 5FQNA 4BASA 2AK3A 3IDZA 4KO3S 3AEQA 2P2ZA 1BU5A 1GZSA 5KTMA 1LPAB 1KMIY 1T91A 4K6OA 2VNIA 4OXNA 1QLJA 2X9VA 1ESZA 3QOPA 2EQBA 4CIVA 3HI4A 3CKKA 2VJAA 3AR8A 2NSJA 2CL5A 3ENKA 3NKVA 5DSZA 2C4MA 5P8WA 3HCDA 2FD5A 1G16A 1RWBA 4G1BA 2J30A 2ZW9A 2XAUA 4TZKA 4I19A 3GQVA 4Y9UA 3AEYA 4R2JA 2H2IA 3GLVA 2IKSA 4B8XA 1TMGE 1JUPA 1LBHA 2NQ2C 2EKBA 1XB2A 3AM5A 5CJ2A 1WM1A 2JLCA 2SHKA 5F2EA 3C1AA 4ODIA 2JGJA 2QVZX 2ZR9A 3B8HA 1OTYA 4JB3A 5A2QA 3K20A 1KBZA 3D7LA 3T9FA 3O3KA 1ECPA 1JDPA 3LHKA 4GGPA 1N5DA 3AVUA 3K9TA 3BC1A 1YZUA 1YMVA 2G5TA 3GVCA 3CWCA 4ZJPA 2VBFA 3FKQA 2JA1A 4DUZB 3RRJA 2DECA 5IT4A 3T5MA 1YQEA 4EO9A 5JBIA 1LUAA 3SQNA 4QECA 5DLYA 2Q1SA 1Q20A 3CWZA 1E6EA 2ZUDA 3H8WA 1WUTA 3OLCX 2YINC 2HGZA 1VMEA 2CXUA 4P5PA 4KXUA 4EHLA 2GD2A 1GDDA 1PFGA 1TNDA 5EIEA 3T1BA 4K6CA 4BPRA 2NTEA 4J2TA 4CEJB 3GVAA 4AURA 2I6UA 4W8HA 1DV1A 4O3MA 1UT5A 2H2GA 1LS6A 3UMRA 4X1OA 4CFYA 3SLKA 3V8PA 2X9LA 2A6HF 1AXGA 3BXFA 2PX0A 2JGDB 2R93J 1GPUA 3BY6A 1LLFA 4QDKA 3T3EA 1BN5A 2OQIA 1TUEA 2GO1A 2D2FA 2QTFA 3PQ4A 5AO9A 4EP1A 3OL3A 5HK9A 4Q1DA 2NN3C 4X97A 4EJ2A 4YV1A 3ZU3A 2IXDA 3AILA 4IIYA 4G5OA 5B3AA 1ULBA 5FHRA 3S14J 1GWNA 4X7MA 1VLHA 3KD3A 2FEOA 1ZUHA 3OUZA 4DCPA 5HVNA 3FDJA 2UAGA 1WCV1 1LNWA 4HQ0A 4FFBA 1NSFA 4C4AA 3D0QA 4ZYXA 3AJAA 2OCYC 1EKEA 2E4WA 4BZXA 3OBBA 1XF1A 3CCUI 4AXXA 3AW9A 2ZCUA 1OLSB 5JAUA 4HLYA 3AESB 1CUGA 3VYSB 4PJLA 1ISFA 1OKRA 2UUCB 1NQOA 1B4AA 2Q1TA 1FJ2A 2WTBA 4MUXA 5LXTB 2X6RA 3LT0A 1TI7A 2X8AA 2VZEA 3VJRA 3L1HA 3GEGA 3GLRA 3T3GA 2Q9CA 3VX3A 1S9DA 2JCSA 2H7XA 4RVFA 5AW7A 5LUAA 1GTMA 1IQ0A 2XD4A 2ADOA 2D8AA 4GP6A 3VZQA 4M89A 3RIYA 2CD7A 4PPGA 3GLSA 3QEKA 3DVAA 3PUYA 3ZHRA 4U7PB 3E3OA 1IL0A 4EH1A 4DRYA 5DM60 3MJ4A 2FDCA 4DUYB 2WWTA 4MQBA 1E58A 3HYNA 4IZIA 4PTYA 1F5SA 2R2AA 3TLEA 2EZ8A 4J0IA 5TT1A 2WINI 1F36A 3Q0UA 2CNOA 3BA6A 3DU5A 2YCBA 2YWRA 2A67A 3EXIA 5HYVA 4E6PA 3GY0A 4AWAA 2P5SA 1HZZA 1E1QA 1PZMA 4MDFA 4E3ZA 1GAEO 4EB6A 3BWCA 1KFJB 3L4EA 2GA8A 4XWAA 9ABPA 1KDZA 4Z4EA 1J99A 3BE6A 5E3OA 1LNQA 3VAAA 3GJTA 4A3MJ 3WJ2A 1EX1A 1MPXA 1SD7A 4NC7A 2NVWA 3VZCA 3W0LB 3AHHA 5HF5A 5B1EA 3BSWA 3KDAA 3ETNA 2ATCA 3DV8A 4CFZA 2UYGA 5BRAA 4R9NA 4P5DA 1P2UA 2OK7A 3BCRA 1N0IA 1Z39A 2EVWX 2ZE6A 1U9JA 1S2NA 1MJBA 5IT9K 2WAEA 2ECCA 4OQMA 4RANA 4Q3CA 4XASA 4FSHA 1XPXA 2BEKA 1DC6A 1WXDA 3WFIA 4A2CA 1BFDA 3CSSA 1I7QB 4I66A 3O94A 3J81A 2R66A 2HN9A 1XQ1A 2VUUA 1YIAA 4D4GA 4EQ6B 2EL9A 2XUQA 2GXGA 3CUKA 2V3CC 2X5NA 3LT5A 2C9YA 2QTRA 2EJRA 1PDVA 4OJYA 1YVUA 4PIPA 4HGYA 4J2HA 3ML6A 1VE3A 5CYVA 4YLEA 3V7YA 2ACVA 3RPUA 1JIUA 3IO3A 4B3MB 4M1TA 1SVIA 2RH4A 1C7EA 2VCEA 2XNHA 3GT4A 1GCOA 5EIXA 5HS8A 5DYGA 2PUGA 1HLGA 2B37A 2IFTA 1R22A 1LX6A 3CMYA 2DH5A 3IE1A 1W5BA 4B7CA 3TCXB 4S2UA 3L2UA 3KSUA 4O4IF 2FOXA 1PFQA 5A71A 1WCIA 2KIQA 3LYHA 5ADWA 4P7GA 1O77A 3KDPA 2FZ4A 3IMFA 1VA5A 3KL4A 4MW6A 4INPA 4KVZA 3HKBB 3QWHA 3T34A 5IJ0A 2Q2OA 4U8GA 3PO3J 2IA2A 2X8BA 1GEEA 3RUEA 1IDYA 2O1SA 2H2FA 4QJ4A 2JARA 3B48A 5EWLB 3H5OA 4X1YB 3QV2A 3PGJA 3TLGB 3LVQE 4TWRA 2QRHA 1DO8A 2M1BA 2HEIA 4F60A 3TTXA 5A0TA 1W7PA 3GEMA 2W83A 4AJ1A 2PGLA 2P78A 2BW3B 2AUMA 1NONA 5DI3B 4RLSA 2JI6A 1WW2A 2VP3A 1MJAA 2HDHA 3JAKB 5C44J 1YE3A 1KOJA 1C50A 4WN9A 1GKLA 4DV4B 3WU0A 1G1AA 5H1YA 1Q50A 3A31A 4JV5B 1Y7HA 4IYJA 3EWIA 2R84A 3E2IA 4H6WA 1BHSA 4Y9RA 4OKIA 3ZLVA 3JAMZ 3FTPA 2VYQA 3THOA 4A6DA 3FR8A 3J7AC 4U87A 5ENVA 4I4TB 4PLYA 4J1QA 3TQIA 3SLGA 5HNKA 5JD3A 3NRBA 1ZITA 1GHTA 1U2EA 1DUXC 5HJ5A 2ZYDA 1GG5A 3H4MA 2DODA 3A2KA 4QEKA 1VHLA 2WFZA 4ZRNA 1BAPA 2PX9A 4UBIA 4QQ8A 1XWFA 2CNDA 2A94A 3BFJA 4AVZA 4WUVA 4QU5A 4OM8A 2PRSA 1PWZA 4UUMA 4N3AA 1OBCA 5EGNA 3GLFE 1QHSA 4B3BA 4O02B 1XZ8A 2CUKA 2R4QA 1T1RA 5ALXA 4LLGF 1ZUIA 4EF4A 1HQKA 4RTJA 1XDUA 4ALNA 2IYFA 4RA2A 5JMPA 2RAVA 3V32A 4Q0MA 4H7IA 2XEDA 4WT7A 4Q4AB 4R7GA 1F9AA 1JAHA 3EFEA 1L7VC 4AIIA 3CIOA 4F4HA 4CV3A 3LA3A 2UZIR 3V7UA 2OFWA 3UNXA 2OXEA 4RSRA 3HSYA 4O0MA 3UGQA 3BMCA 1LVHA 1JI8A 1KMNA 3QKRA 3E48A 4CV0A 1PF7E 2X14A 1X6VA 2XMCA 4ARAA 2CHFA 4FBLA 5FIUA 4PAMA 1QZXA 4GOXA 2D5IA 1CV2A 4KN4X 4EATA 2ZXEA 4M0MA 3C6XA 2MC3A 2BYVE 1MOPA 3QOFA 4QYWA 3MHPA 5C1DA 5EJ7A 4CEHB 3KOWA 2FLWA 1KK0A 2WFAA 3ONVA 5FORA 1X9HA 3TQFA 5FOWA 1RYYA 2QQAA 1CEXA 1DT3A 2AN4A 3MZHA 9ATCA 4UZEA 4G8JA 5C80A 1JPVA 2HK7A 3FPSA 4YRJA 4E5YA 3FBGA 3S8YA 1UZCA 3R6GA 1Z3CA 1T8TA 4ZYEA 1IBCA 4EMTA 1C3EA 2FR8C 1EX9A 3I45A 1LQ2A 3TXXA 2Q29A 2ZI5A 1NLZA 2CLEB 1SKBA 3VPHA 4DR1B 4JN6B 1JEEA 3IPYA 2KWIA 4TTSA 3JWGA 1XEXB 3AP3A 3CX7A 2CZCA 2PLRA 2WYHA 2WQZA 2YOGA 2WIKA 2BBOA 3TMAA 3ZU4A 5DRYA 1I4DD 4OBBA 3OC6A 4RBOA 3I1YA 1Z5NA 3S28A 1B8UA 4LNAA 4RH1A 1JHQA 2EBFX 5FI3A 1T5LA 3RSNA 1POGA 2WJZB 5GADl 4TMFA 4Q7KA 3R4CA 1JQ3A 3F8FA 1LF0A 1V1RB 2G63A 3C15C 5ADUS 3DM5A 4LFUA 2ZWIA 1H2WA 2F3QA 3FBIB 5IP9J 1ZK2A 2XB2A 1OC2A 1QRTA 2P7CB 1OWMA 3TEFA 4HGOA 3OZGA 5IS2A 4F93B 5K8VA 2AQFA 1R88A 2A1UB 3D6VA 2I87A 3A37A 1YV9A 3H8JA 3K31A 1C30A 1A9YA 4QUKA 3Q98A 4KYVA 4PGAA 5D84A 1OYIA 2H85A 1X14A 4E33A 3OJWA 5JIBA 5ERIA 5C8DA 2D7JA 1WTAA 4P31A 3FFAA 3HXQA 5CXXA 1QKKA 4JAVC 5LYYA 4EY4A 3S81A 1FTTA 4B4WA 1CT9A 5TQVA 3ZDEA 4CMEA 4DA6A 5EXDA 3GTGJ 3OTQA 1XGSA 1ANKA 1SIBE 2G82A 4CU5A 5BT9A 3CLTD 1AA6A 1I7PA 2O8BA 2VTKA 5DTRA 3M6AA 1WHSA 4TN1A 4R6XA 4I5EA 3RV4A 5M04A 5KTSA 1FSZA 2D54A 2XCOA 3M7IA 1KETA 3RHTA 2RAEA 4U6QA 4E5VA 4R1PA 3AV0B 4OJQA 1ISPA 1S7EA 2PGDA 2ZUSA 2HXGA 4JVNA 3I0NA 2P0EA 4MIEA 1OV4A 1L4BA 2WE7A 4C0WA 3G2HA 4RNDB 4DQLA 3WYBA 2ZSEA 4P3KA 3Q3IA 3VAYA 3TKYA 2P7HA 3SF0A 1LU9A 1NKTA 3VKGA 4BGDA 1W5TA 3V1UA 4LLLA 3QBTA 3BCUA 3RAPR 5HQTA 1NK2P 4YGYA 2VL8A 1IPHA 3WU1B 4RAYA 4BAYA 2H1LA 1DQSA 2CXRA 1I4LD 3QELA 4AY6A 4HWPA 2JAWA 1FU8A 4DFDA 1ULTA 4DR2B 2G8NA 5C32A 2FF4A 1AHNA 3GPIA 3U7IA 4IEJA 2ZRIA 3OZRA 1X2MA 1Z6TA 4XUDA 3CM0A 1T2EA 2EEZA 5AD1A 4WFQA 4IINA 5CLHA 2GN8A 2F5CA 3R9XB 3FMQA 2UZ1B 3TRKA 3IQGX 1Z47A 1D8TA 4RB2C 4BFVA 1NLYA 1YQQA 2N0SA 4RVUA 3DBLA 4F9TA 3OYFA 4OIMA 3T1NA 5ALLA 1QC5B 4MGYR 3KG2A 2IP1A 4ISBA 2WI8A 3K8ZA 2BMDA 1GQYA 1PX0A 1KQ0A 5THKA 2ON6A 1Q57A 1IGNA 3SAJA 3RYRA 5B1SA 2M87A 1FTYA 5AOBA 1E59A 2WSSD 2JAPA 4N39A 2DU9A 4B6RA 2WYWA 2NXEA 1HA3A 1C8KA 1XQVA 4MIOA 3BULA 2QD5A 3AEKB 4ZVTA 1SCKA 3T7AA 5JAHA 4BTEA 1V4NA 1GTJ1 4DXAA 3PNMA 4HUTA 6REQB 3NW9A 1N2OA 3QFCA 3EQLF 4M71A 2W2LA 2EYQA 4DIDA 1T1GA 2GMWA 4Q4DA 1FMCA 4Q1CA 5HPYB 2R7SA 4AJOA 1ODTC 2WSLA 3ZHYA 4OG2A 5GV8A 4YO8A 3OYGA 5HOOA 3ED1A 1HNNA 1P1HA 4RGVA 4NH0A 4URUR 3GO5A 3RVJA 1YZ3A 3QE0A 3EDRA 3GLFA 4B2LA 4J75A 1JA0A 5KOHB 4OSOA 1USGA 1Y3FE 3TI9A 1T9ZA 4BQSA 4CUGA 1Y3AA 3FIWA 5JO0A 4KC0A 2ZSIB 4YALA 2Q1ZB 2VQCA 2JW5A 1Q83A 5L45A 2P35A 5KHOC 4CG1A 2ZE7A 3OQOA 1LW7A 5LLSA 1R58A 3RUHA 1SFOJ 1L0OC 3MVEA 1JTFA 3QVWA 2OBFA 5J63A 5A7FA 3NP7A 5EJGA 4HH3C 3D7RA 3ZGKA 1WS6A 1IBRA 1RYEA 2V54A 4XE5A 2A1IA 2CGEA 3N2YA 1OX6A 1YGYA 1OCRH 4PHCA 3KPJA 2R7TA 1GV1A 5K3FB 1GDTA 1UG2A 1QXSA 4JMLA 2GEFA 4F8JA 5A06A 1YZYA 3MUNA 2ODBA 5CMLA 2VJMA 4ZPJA 5ALEA 5IARA 1GVJA 3SBEA 4CTJA 2VF5X 4LSMA 2R7FA 2PK3A 4D9JA 5IPAA 1EM6A 1M1YA 2FOWA 2D5AA 2DVMA 2YPRA 1J0XO 4I36A 4K87A 4ZAGA 3IE2A 1VKZA 4JVOA 4L75A 4E7OA 1FFHA 2I65A 4OI0A 2GR9A 1H0RA 2IPQX 2Q21A 2H8RA 4QIWN 5KAFC 2RGAA 1ZTRA 2YYYA 1Z4JA 4M4SA 4WACA 2X9QA 4BBJA 1X39A 2HW8A 1VQMI 4AQYB 1DP3A 4AZTA 5B1YA 3PQCA 2HMUA 4LDJA 4KLCA 4BHCA 5D5WB 1DZIA 3HXPA 3QTTA 5CVDA 5LIPA 3BD7A 3ZQHA 1MC1A 3IUQA 3T95A 2FSGA 3RVPA 2QRNA 8MHTA 3L41A 1CY6A 1WUKS 2VK2A 4BIMA 4ZQIA 2ETXA 1M3SA 1JQAA 1FF9A 4XX0B 4UEQA 3IQFA 4FILA 2YYSA 4HFMA 1U8RA 3JRDA 3SMQA 2LF8A 3ZY3A 4XB2A 3Q9SA 1S9HA 2M4KA 4L2IB 2JJ1A 1JEAA 5ALFA 3DB1A 3AYXB 3DKIA 4IR7A 4B81A 1GUZA 2Z2SB 5JC1A 2D1HA 1ZA1A 2O6GE 1BCRA 1AQ6A 2BISA 2CDCA 2QD1A 4FINA 3K10A 4W7SA 4DMMA 2DQZA 1RQRA 1VXOA 3GROA 3OFKA 4MWBA 1E32A 2Q0OA 1RHKA 4N3BA 4W5HA 3IP9A 2JLAA 3S7TA 3CR7A 3PRHA 4TMTA 4JI8B 3IBTA 3ZYCA 1KQ8A 3REFA 2ZJ3A 3H0CA 2Q49A 3GP3A 3ZOKA 3A9VA 2WMDA 2IHNA 2JD1A 2YHAA 3A9UA 3QF4B 2IU3A 1E6UA 4X6XA 3NARA 2ELKA 3SQOA 3NTUA 4Q7QA 2C31A 1ODJA 1ZGBA 2O8KA 5LGNA 2O3JA 4EHKA 5L3QB 4J0KA 1Y5LA 4RDUA 4Y2PA 1KDTA 4KR0A 4DM3A 4LG3A 2WJVA 2R1ZA 1KWKA 3KB6A 5C8ZA 4BHBA 2B7CA 3LDGA 4MQEB 4OVKA 1E1MA 2R6GA 3UPUA 1LDYA 1X7WB 1EUZA 4CA0A 4Q9NA 1VKNA 3FWZA 3LMKA 1DEHA 4LXYA 1QBKC 3SM9A 1MKYA 3RT1A 1DJPA 4RMJA 3L7AA 4ZT6A 1YT5A 1VLVA 3P71T 3AEXA 1BWSA 1U9IC 1IOLA 5GVSA 2P91A 1IG0A 3QX3A 1L4FA 2XCRB 1QP4A 3HGQA 3SJMA 3CCRI 5GOZA 3UFXB 1X38A 2P9YA 4JR0A 1Z5OA 3GEIA 1Z1DA 3C3PA 1E8MA 4M7RA 2ZWAA 1TPZA 1SXGA 4AG3A 1TL8A 4U7FA 2ZWPA 4A2PA 1CY2A 4L07A 2C0QA 2ST1A 2WBLC 2OZKA 3BH0A 3M6VA 4BQQA 5F12A 5LQMA 1PNQA 4O4HA 4I09A 4OHFA 1MHPA 2Z2JA 1EFPA 2K40A 1JHRA 1HSOA 4J29A 3B7PA 2D3WA 5KNLA 3F6RA 3NC0C 1PSWA 1IEQA 4C4TA 4HBZA 3QUAA 1O7FA 1U1DA 3TP3A 3BXXA 4LOKA 4U02A 3NQ41 4BCBA 4F3KA 5BVHA 1W0JD 3VI3B 3OA0A 2QBYB 3EUEA 1O58A 5D4RA 3OZDA 2PJRB 3WA7A 4KGDA 3C87A 1I14A 1JAZA 2PS0A 2DMRA 2GBCA 4UKDA 5JRDS 1Y98A 3M8EA 2BRUA 3SGLA 2NTNA 5JXGA 5KVRA 5IJWA 5AJVB 3H0DA 4A92A 5CU7A 2J9GA 4GMKA 3JVDA 3CBQA 3X1ZA 1MAWA 4MKHA 3LK6A 4M60A 1LFPA 1U0FA 1UC8A 3S2ZA 3UAOA 4JLVA 3K9WA 2QDKA 3JRIA 4MRNA 4W9NC 1SR8A 5CFNA 1FYWA 1YI2I 1XS9A 3EMBA 4UUAA 1NW6A 4OHVA 1OFHA 2L7FP 2MH2A 2VRNA 3WGOA 1ZM7A 1KJQA 4BQNA 1RZ4A 2HJHA 2V3VA 3F4BA 4E1AA 2HTSA 3A02A 2CE7A 2CW0F 4QUEA 4QFCA 1FX0A 1IIRA 4DLRA 2VJ4A 2WICA 5K05A 4CMJA 1ODKA 5J58A 5GONF 2LMDA 3WLIA 3FSEA 1SJ9A 3DE3X 3AFOA 5BNFA 4KVFA 1PQWA 3GFVA 4X8OA 4D4KA 4HX4A 3UG7A 2MT9A 2QLBA 2QSUA 3WTVC 1TCAA 4PPNA 2C5EA 3RS5A 3GPCA 3U3MA 2L7KA 3MCVA 4A5NA 3GWGA 4P6VF 4WK2B 3KZYA 1TZJA 5AWFC 5FPPA 4A8JC 4XLNF 4F8EA 4DCJA 4JBXA 3N2LA 4MFDA 3CP2A 4L5IA 1N5KA 3A4YA 1KP9A 5KBYA 2IV3A 3I09A 5LEJA 1ISSA 2IHVA 3EOAI 2DLDA 1VIMA 4DMFA 3ICQB 4WBNA 3GBPA 3M3HA 2RREA 5LZ5A 5CDFE 3KUKA 5TY0A 3VNBA 1XD2A 1DBRA 1XTRA 1CS0A 4UTXA 4I3GA 4Q6BA 2WD7A 2E4AA 3H9UA 2GIVA 3ONNA 1K78B 3I2GA 2ZK7A 1XPJA 4CDMA 4PHTA 4UNSA 3CR3C 1BN6A 3T3HA 2NZWA 3PQFA 1F38A 2AI1A 1YXMA 3BT9A 1JF8A 1L5ZA 4G86A 5DGXA 4E22A 2FUNB 4NOMA 4NXMB 4K6FA 4UNIA 1Z7YA 1GARA 4DEVA 2BZ0A 1E2PA 2PUAA 2BHLA 3B6MA 1RQ2A 2IU4A 3DZHA 1U8YA 2WF7A 3E9RA 1E99A 2NW6A 4QODA 1PK8A 4GE0A 2X1HA 3O9VA 5FNVA 1POWA 4KPYA 4N9QA 1V71A 5ALWA 1E3TA 3DOCA 4RQBA 3E0QA 1GN8A 4P98A 1IRFA 5BPDA 2O06A 1B2LA 2F67A 2VPXA 2R85A 3NDJA 3I52A 1KH1A 2BFCB 4WI1A 4PAQA 1DEXA 2B1QA 3DZ8A 2JZOA 1GGMA 1RPZA 5JOQA 1YJ9I 3E3LA 5HDNA 3TX2A 4YP6A 1GPYA 4JXJA 3AJDA 5THXA 2HEOA 4RMGA 1PJTA 5A4JA 2JIPA 3QU2A 3BE4A 3VU0A 3WRYA 3A05A 3UFBA 2FVXA 1GGEA 3HEAA 3L6CA 1WRBA 2HEGA 5EEGA 1Z3XA 4BQRA 2BT4A 4OIOF 4DRZA 3JQBC 4OO3A 2GHRA 3UPTA 1X8XA 3IP6A 1TEZA 1TQMA 4K3UA 2F62A 3W5IA 1YBAA 4YG2F 3OLZA 3AVTA 2ZNZA 5DSXA 1TT5B 4YFNF 4PC1A 1JQLB 5ARDA 4RPGA 2VOPA 2WHPA 4KAXA 3EFHA 4G0UA 5HDQA 1KMHB 2PS9A 3OIYA 3WB2A 5DM70 1YE5A 4J76A 4J1NA 4KSYA 2PSSA 2IYXA 3IP1A 3VPDA 5BSGA 1K8ZB 3H9GA 3MMYB 3AXSA 5DULA 5JLXA 1LPBB 2OCKA 4DCGA 5LKAA 4QLBA 3HNOA 5JYEA 4QC2A 4DNQA 1CRLA 4HT3B 4Z6KA 3HC7A 1ES9A 4IMPA 1TJNA 3FVQA 1AG9A 4PN7A 1WKCA 1E98A 3KTDA 4LYEA 2NADA 5H4GA 4C0BA 4O2RA 3K0KA 3KXPA 1NBOA 1CYDA 1NVEA 5H68A 1ZZGA 1HQDA 5G53C 4LZAA 3GLLA 1QX3A 1V41E 2CLCX 4ZOBA 2QG6A 4LIPD 4GKJB 1TOAA 4BATA 3LPNA 4JIMA 3H5LA 5JVDA 4PCVA 3RYHB 3ROKA 4IO9F 2Q45A 4D0SA 3GJRA 2A5DA 2BRUC 1ODCA 3ZOZA 3N8IA 4X0GA 1XZKA 1M2HA 2JIRA 3WGVA 3VO8A 4K0KB 5ELXA 3B8EA 1RKTA 5DNWA 1SCJA 1WJFA 4QDZA 5C8VA 1KO5A 1VIYA 3JQ8B 4QU9A 1SC4A 1PV4A 3UWOA 1VE7A 4NENB 4C6RA 1WSAA 4HD8A 4KFTA 4S04A 4NJEA 4K9QA 4IGKA 1NI3A 4NI5A 4K9LA 1CRZA 5IDQA 1SCUA 3FD8A 3EUFA 4P22A 3UKJA 4NPHA 1QO9A 2FUEA 3T4XA 4QOGA 2IYEA 2Q5EA 3ZS8A 4KREA 2CVQA 1MR3F 4HOBA 4ZKDA 1IBKB 1ZJ4A 4CCYB 1CZRA 5INTA 2W4QA 4Q66C 2RONA 1L2TA 2BY2A 1O95C 3OQ6A 1HURA 3AERA 1UZLA 1V11A 2X0RA 3MMXA 3WB0A 2WJPA 1P8JA 2JFFA 4ZI7A 3RC8A 1SAXA 4K8RB 5KDOA 5A6VA 1OGIA 2NXCA 3W2EA 5H9WA 1FYVA 1ZMBA 2MW8A 4QGSA 3BMXA 1SWVA 1A2OA 3F6VA 3WSTA 4FS3A 3KEMA 1KIAA 2LKCA 2V7QA 1S5LC 1MO3A 2JVGA 2NO9A 4K9RA 2N1MA 2AZTA 4MI3A 5CDUA 3CH5A 3IQWA 5BMOA 1BE1A 3GFIA 4ESVA 1QTIA 1NHGA 4EA8A 3PHBE 3AJ8A 1Y34E 2UZ0A 2A9RA 1RMQA 2V9CA 4IX7A 4HWTA 5TRTA 5E79C 3QPCA 1B6AA 3ADOA 5AIPA 2KHZA 4KW7A 1AZWA 3PBKA 2O7NA 3B9BA 3K4MA 4Q3OA 3D3QA 5GP1A 1TVKB 4LRXA 1X86B 3BZKA 3COSA 2QSHX 1NRXA 4J0GA 1JFFB 3EPKA 4DGSA 3UCFA 1L4UA 3HYLA 1RQXA 5GZ1A 1IJBA 1HLFA 4XLCA 4D3YA 3QG5A 3IJ5A 1A5TA 3B9PA 2H18A 3RGGA 3ZJ4A 1U8FO 1K97A 2ZZMA 1GNRA 1EBFA 3SY8A 1XVUA 1RI7A 2GWRA 2X86A 2XAQA 2NVBA 3FMIA 1Y0UA 4GLBA 4GD3Q 1P2FA 4RCYA 4Y2VA 4LXXA 2J3QA 5HM6A 1TEHA 1I7LA 2XMDA 1MUUA 3BPSA 1DHTA 2A5LA 3T7TA 1IN1A 2WZDA 4BP3A 3VPCA 1ZEJA 2AF3C 3LUJA 3TDKA 3RJ9A 3E61A 2OV4A 3X2EA 5CDFA 3A6JA 1D2MA 5CHEA 3E6BA 4AYBA 2V4UA 2XHEA 5L6MB 1CLUA 5EJ2A 5FO5A 2LWIA 2JA8J 3A1TA 3GLKA 4HTFA 3GZJA 4MW2A 3UICA 5HGJA 3RVMA 4MLOA 2BEWB 3IP3A 2J45A 3JQDA 2Y68A 3SDSA 4A6XA 3ZR8X 2VWQA 5KVQA 1Y3CE 1XVIA 4CM3A 2IL1A 5I8WA 4N8EA 4A23A 4R01A 4UXNA 1GRCA 2FFJA 3QLJA 1XMAA 1EDZA 4OXXA 4HPWA 2IEIA 2WP0A 4HFRA 4IGAA 1MMGA 3JQGB 1WR8A 4CTNA 3F23A 4LXGA 3MMSA 4JGIA 3H2KA 2L9VA 1WULS 2AKAB 2IY8A 5C4XJ 5E6UB 1IUNA 4QYTA 3HVKA 4YAOA 1UKBA 2CHVA 3HJHA 2P5KA 3VR3D 1PG2A 1ZWKA 2DGDA 3EW7A 3OYDA 2R79A 4RQAA 2VOOA 2H5IA 2ISYA 1QYVA 4F4CA 4GSKA 1T39A 1TYCA 2DKFA 5L7TA 1I4EB 3CT4A 4K9DA 4JLUA 1FQKA 2KL4A 1KHHA 1KYQA 1QTQA 3ODGA 5FR1A 3RS0A 2YVLA 4UW9A 1GZ5A 4MV6A 1I3MA 2XC7A 2Q3HA 1VP3A 3T15A 1UJ5A 3JASA 1DGRM 2FJUA 1FP1D 4WWHA 3EXFB 1DP7P 2TDXA 2W90A 2FI1A 5HJEA 3JSAA 4UFOA 4MEBA 3PDJA 3PGA1 1O0BA 1PBNA 3ID6C 3ST7A 4GM1A 1OR8A 1YW7A 4YUWA 1HL3A 2XXBA 2CC2A 4OLJA 1ZELA 1DIOB 3GMIA 2AYYA 1BI3A 1K86A 2J08A 4CGYA 4H31A 3ED5A 4I1VA 1XZIA 1X1SA 5F7XA 4QSMA 5I9NA 3LBAA 1VG0B 1FOYA 2GBYA 1VLLA 2J48A 3AB8A 3D8BA 4TLLB 3QWAA 5A2QK 4G41A 5L4LA 2XIGA 4FB4A 1GLVA 3CEHA 5G1OA 3FWHA 2QSGX 3G88A 1ZONA 1CNMA 3CUQC 3FRJA 5JHUA 5IG2A 1W9MA 3CCMI 2VTDA 4YRTA 1DBIA 1L3LA 2NQTA 2QUFA 3ZMSA 1UKCA 5FAKA 1T9KA 1RE0A 5LOVB 5FX2A 1EJ6A 4HZUA 2F1KA 4AQDA 4D9IA 4YP0A 1W19A 3EUKL 1JQDA 1J0BA 5AI4A 4RABA 3C4QA 5PGMA 3CDHA 2XECA 3ZQ6A 3DULA 1CJVC 5GOTA 5C34B 3TNYA 3RSCA 5FCDA 1VBKA 3TLKA 3Q3CA 1PL0A 4NWIA 1U3WA 4BBAA 2BP7B 1PEAA 1TPYA 4ZDIA 4PG6A 1NL3A 3BMQB 3RARA 5C5EA 3BB1A 3N75A 2COKA 2ZPAA 2BE7A 1E3DA 4Y2HA 1O7JA 2GPJA 5TPWB 3HSFA 5ALJA 5IKMA 2OGUA 2FSPA 2LUOA 1ACLA 3QXGA 3LOCA 2IJLA 3NYIA 2A58A 1QHHB 1OROA 5D8LB 3O1HB 1K6EA 1SG0A 5CCEA 4MLPA 2OCXA 1E6KA 3E2PA 1MN6A 1DBWA 5CT9A 1NULA 4TTPA 4EUHA 1U7ZA 2GOYA 3BTJA 3TOSA 2C4NA 3G2NA 4FX4A 4WDRA 5KYVA 2PD4A 2X4GA 4Y1RA 3COZA 3UXYA 1O5OA 4Y0NA 1IMJA 1SCAA 2PT9A 4WVFA 1RWNA 2QJFA 4RD3A 4Q03A 2IGNA 5IW8A 1TQIA 5L9AA 2YR0A 1J97A 1ONOA 1LBSA 3QVGA 3B9QA 4PK4A 4YV0A 5C1OA 2V7WA 3IAAA 5EHNA 1PJSA 3ILXA 4F38A 2OAP1 1TLLA 3ICVA 4GKVA 3SC6A 5CT4A 1ZGGA 5K20A 3V8KA 3ZW9A 1DKLA 3ZNQA 3CF0A 5A4DA 1GIAA 1VP9A 5FFXA 3BPVA 3BD9A 1B8PA 5HE9A 3TWOA 1NV9A 2F90A 3AF3A 3GNSA 4G24A 1W8DA 3JSPA 3PDIB 4LPKA 3L7NA 5BQ5A 5DNCA 4I3HA 2ZR7A 2PCJA 3U0VA 1IIBA 4UE6A 1HW2A 3W5UA 4QREA 2ZR0A 1E2NA 4LHXA 1ZWLA 4EI9A 1L1EA 3PLRA 3UH1A 4AULA 4IHYA 3QKIA 3OL4A 2KLOA 2DOEA 2CLKB 5I6DA 3FTQA 4XB1A 2O3UA 4K40A 3TOXA 3D6NB 1M33A 1I3NA 1FNSA 3KQVA 2JKZA 1E1YA 4HS4A 2R65A 3GD5A 2GH1A 5BMVA 2WJ3A 3O26A 4NZZA 3LUCA 1W44A 4EPWA 1G38A 1IQUA 1F17A 3EVFA 3DF8A 3UMGA 2Z5UA 1MC8A 2RHLA 5A62A 2VXBA 4F91B 1MNDA 1JR3A 1NU6A 3F5DA 4XGIA 3L6DA 5IXYA 1NVMB 4M9CA 1E9SA 3PD0A 1MJ9A 1HSZA 5G1PA 1NRWA 1V8FA 2C42A 5FUQA 3WYGA 4U9IS 4KIGA 4YDHB 3TOZA 3HBFA 3IUNA 1DSSG 5JZMA 2BMEA 1K6XA 3PC6A 3K3PA 3RWOA 5K7HA 1DEOA 2P4EA 1TJ5A 2LP4Y 4CM5A 2X5JO 4DDTA 3BJOA 1K3FA 1CFJA 4H7EA 2VI5A 2ZR8A 3HRTA 3KKZA 4MICA 3NH6A 2QUKA 1D2GA 1GV0A 3J81K 3MJHA 4Y7DA 2AR9A 1WWXA 1JMVA 3LDUA 4X91A 3PT5A 3I3LA 1KO8A 3NBQA 3DQVC 3SE0A 4MZXA 5K5OA 1B4DA 4AY4A 1A69A 3EXG1 4QYIB 5M29A 4CYCB 3TR6A 1A50B 3EDPA 1SBYA 5TS3A 1KO4A 1YZTA 2VQ6A 1SCQA 4CI0B 3IV6A 1E5XA 4YAWA 3WDKA 1JI0A 3GRCA 1MDFA 1MU0A 2R96A 1ZJ6A 3KAKA 4AF8A 5J5AA 4PCQA 3FHZA 2XB0X 3V1LA 2Q5OA 2P9EA 1BU8A 1A4UA 1BOAA 5LYJF 1MIJA 2H9AA 2YXDA 2HQAA 1JTYA 2OMEA 3HJTA 2EW2A 1ORDA 2HXIA 3W05A 3JU3A 2BHTA 2A2ZA 3AO0B 1TIPA 4YNBA 4XN3A 1RYBA 4DLBA 3OICA 2FWMX 2VAPA 4O4JA 1BVYF 4QGBA 1ESMA 5GTHC 3P4XA 4NE9A 3CH6A 1QANA 2R7WA 3GJQA 5HQ3B 2NTVA 4G94A 3FFXA 1IHOA 4YB8A 4NBSA 4RD1A 3T61A 1G21B 1E94E 3EHEA 1HKHA 1OBVA 3R0AA 1DQNA 3LSHA 5DN6A 1U2DC 2HOQA 3P5BA 3PB3A 4ZVUA 2AJTA 5G40A 5GJBA 2SBTA 2VYVA 2JGRA 2GZ3A 2PEXA 3QPAA 1GQRA 5CJ9A 2Q3CA 4NF2A 2ONYA 1GA4A 1KOLA 4C6TB 1YUNA 1LDGA 5LA6A 3WHPA 1MB4A 2QG4A 4BKRA 5CEEA 1FRQA 2ZB2A 4CHGA 1O87A 3SC3A 4DC9A 3VTZA 1DAOA 2MLKA 3U2RA 2AEEA 1TE2A 3J81k 4BBRJ 4A36A 4GYYA 3CZRA 3LV8A 1VQ6I 3PF8A 5T6BA 2PRKA 4P2GA 2KQRA 4PLCA 1E79A 4YJ2F 4V38A 3EXEB 3X2SA 2X23A 1X58A 4PC7A 1LXCA 2VBCA 1W76A 2FR8A 3LAPA 5EG5A 5EPOA 1QFJA 2QRGA 3HSSA 3TPFA 1PP4A 4M55A 4QX6A 3OZEA 3RKWA 3GUZA 2PGXA 3V4OA 2G04A 1II8A 4EFNA 1AX9A 3Q0VA 3Q40A 1UDWA 4FYJA 3HY3A 3HKEB 1ID8A 1I4WA 2DA5A 1P45A 1FDOA 3UOAB 4PNPA 3C74A 1RPAA 3BEOA 4NNOA 3LE8A 3CZ5A 3Q9NA 3DHWC 3ACBA 3R6WA 4MR9A 1O3TA 3HRUA 1NVBA 5E7IA 4BNWA 3E35A 1NRJB 4DGQA 5BURA 1GT6A 3FA2A 1I1OA 3NXSA 3COPA 4BVHA 2PN6A 3F7OA 1G3RA 2AHOA 3UW1A 5CT8A 2GVZC 4BB9A 1CULC 4EM0B 5DHAA 3OZVA 1BW9A 4C21A 4V2GA 4DYHA 2EIMH 1FQJA 3QV1A 1UEJA 3NETA 2UU9B 4RCVA 1IUOA 2RHWA 2IT1A 3ASOH 4Z9BA 4UFPA 1FMFA 4MPJA 3TRDA 2KZVA 4NABA 1H3NA 3U9GA 3BHIA 3VA7A 4FVTA 4PZYA 2X9NA 2XAGA 2I4RA 1PFUA 3KPWA 2J5OA 1BRMA 3WYFA 3HCCA 4HB3A 3V4SA 3UJAA 1Y1RA 2K87A 4EMUA 4H7HA 3OEHA 4FLMA 1ZI6A 2QSYA 1XPOA 2VTBA 1E77A 4DUPA 2EZ9A 4XOTA 3KR9A 5B58T 1HKQA 1W5AA 4QASA 5A3VA 4KHZA 4J00A 5TLSA 2NVUB 3OP1A 5HILA 4XIJA 1C7IA 2QA4I 1JTVA 3OZSA 2OHXA 3BOSA 4NQWB 2XD9A 4UTVA 3UV3A 3O2JA 5JR3A 5DXJA 1KDVA 3NHFA 1PL6A 3AZPA 4G4SO 4H1WA 2E2JJ 3KQMA 3ME5A