2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
b'MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSA3
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
2P6TA 1TNTA 2FF4A 3COAC 3GYHX 2XAQA 1Z7UA 2PN6A 3ERED 1XCBA 4M9XA 3ML6A 1IAWA 4UHTA 2XKPA 3BP8A 2J5PA 1WQ2A 5HLIA 2E7WA 2P5VA 1KU3A 1S7OA 3MZHA 1KU7A 2X4HA 5DYMA 2PI0A 1WRJA 5AIPA 2PMHA 1MGTA 4D0PA 2GXBA 5HDGA 4KFCA 2V1XA 5KK1A 4ZYGA 2FQ3A 2E1CA 2GZWA 3C1DA 1JE8A 1MDMB 1ZG3A 3E5XA 4GYIA 2EWNA 3TQNA 4B09A 5J6XA 1T0FA 2ZCWA 5FD6A 1OYYA 2UXNA 1KYZA 2H09A 2FBKA 3ISPA 4IRIA 2OAZA 4EJUA 4LLNA 2VBXA 4YFKF 2A5YB 1R00A 5ICGA 3GLXA 3TDUC 2ELHA 3DPTA 1HKQA 2BYVE 1EH8A 2YX4A 1XMAA 4WX9A 1TQPA 2FMLA 4N0BA 4F7ZA 1J9IA 3G3ZA 2CW0F 4BAYA 3ZP5A 1G4DA 1YQAA 2K4BA 3HHHA 1QGPA 2PJPA 2BBYA 1U6GA 3O6BB 2V6CA 3SZPA 1L0OC 2P5KA 3FXRA 5D8LB 5HLGA 3WTYC 2F2EA 2VBYA 4KMFA 4GXOA 3JTGA 2O0YA 4M74A 1QQIA 2RV8A 2IA2A 4DNCA 3DPLC 1FPQA 2JZYA 2LNBA 5FO5A 3GZ5A 1QBJA 4MTEA 3ZQ7A 2K27A 2XAJA 5F1RA 4BHCA 3EYYA 1OYWA 1YO5C 2HYFA 4IHTA 1D5VA 1SMYF 4NB5A 1C0WA 1IXCA 4A5MA 4ENMA 3VOEA 3LQRA 2LDUA 3SHFA 2FEZA 1B4AA 3CLOA 1DPUA 5JHUA 4EQQA 3RIRA 1F1ZA 2KIMA 3AAFA 2HQRA 1R23A 1ZAOA 4EMSA 2M5WA 5LLQA 4LG0A 1PUEE 1L3LA 5AONA 3H3ZA 5CVRA 2X0LA 4BHPA 3IC7A 3FX3A 4ZZLA 1I6XA 1TTYA 3F22A 4JBAA 3K1NA 1J59A 2EA2A 3KP6A 2FBIA 3QOPA 3LFKA 2Z5UA 4RB3C 2VONA 4IPAA 3HRTA 1GVJA 1V4RA 2A07F 2GA2A 2GIVA 2QQBA 2HEOA 4A0YA 5LEKA 3F8FA 2QWWA 2NNYA 3E3VA 3K1MA 1FT9A 5D6EA 3GFLA 3S2WA 3E6CC 2HR3A 2G7UA 4IRHA 2MH9A 2HOEA 3B73A 4HOBA 4LFUA 1YW7A 2O3FA 3M8EA 2Z99A 4KMUX 2RKHA 3Q9SA 1BOAA 4S04A 3HRUA 3HUGA 1LJ9A 3V7SA 3D5LA 3ZN0A 3HYIA 1H9TA 3DQVC 3E97A 1U3EM 3WODF 1XGNA 4U7DA 1JHFA 5EEHA 2OQGA 3E5UA 3FM3A 5DCMA 5ILUA 1FYMA 5JR3A 3FXQA 5DDGA 4FHTA 2H6CA 2EFNA 3WGGA 3BJ6A 4CHUA 4P9FA 3GFJA 1O3TA 1TW2A 3GZ6A 3RYPA 2VOOA 5LHHA 3EDPA 5DD4A 4G94A 4JQFA 5L3EA 3R60A 3K1PA 2RNJA 3DV8A 3JSOA 3DEUA 2FXAA 1GHCA 2VT3A 3LWFA 1IW7F 3U9GA 4MHGA 1I1GA 4LB6B 4KUMA 2VBWA 5DUIA 2FBHA 3O2PE 5CVUA 3FZVA 1ZLKA 2RGVA 4WF2A 3ZMDA 1FZPB 3RYRA 4WK8F 1GXQA 1KQ8A 1OPCA 2BE5F 2M87A 2HYGD 4LG0B 1DUXC 4MQ9F 5CVJA 5ERIA 3TO7A 2P7CB 3ELKA 2Y0MA 2QENA 5JI6A 3SZTA 4AIKA 4U0YA 1Z6RA 2XKOA 2DTRA 1H9GA 2Y75A 4U0VA 2ZO4A 3HIFA 4U88A 2F5CA 3R4KA 2F5FA 4YIFA 3IL2A 4KA4A 3HOSA 2IRFG 2WV0A 1LB2A 3FHZA 2UWMA 4L9TA 2V9VA 4E70A 2FE3A 2P8TA 3TDZC 4EJWA 1NHAA 3L7WA 4IRGA 4OMYA 2QYOA 4I0BA 3ROUA 3RDIA 2VN2A 1UCRA 5L3DA 4LLGF 3ABTA 3VEPA 1QPMA 3HRSA 2D45A 2CWEA 2XUBA 1O3QA 2XIGA 4GCVA 5E18F 3ABUA 1RI7A 2K7LA 3V7RA 2COMA 4YFXF 5D5VB 5IT3A 5DCMB 1HW2A 2PQ8A 1Z6TA 3KFWX 2RN7A 4HYEA 4IXAA 5J8FA 4ENNA 1EH7A 1WKMA 3M8FA 5LRSA 5HS9A 2XGXA 3B02A 3KP2A 1IN5A 4HX4A 1G3YA 3ECOA 4ON0A 4BXUA 4A12A 1B59A 3KZZA 3BJAA 2DW4A 5IT9Z 1XSXA 2EJRA 3HTUA 4RB0A 1G3WA 3F6OA 1WWXA 3L00A 2YSRA 4XSXF 5IT9K 5BPIA 4A2UA 2YU3A 5CYVA 3GFIA 5CVVA 5AIQA 4CICA 4XLPF 1HW5A 1QZYA 2OA4A 1SD4A 1J5YA 2QQAA 3ZMTA 3IWZA 4I0AA 2ISYA 1XN7A 5KVRA 1ZLJA 1P4AA 2V1DA 4EV0A 1SMTA 1A04A 1LDKB 1U5TC 1XGMA 3MFKA 4WXHA 3CUQA 2DT5A 4BH9A 2O8XA 4H0EA 3HSRA 1BI1A 2JPCA 3BPXA 5BQTA 2HZTA 1E17A 3RPUA 3L9FA 1ZRCA 1B9MA 3FXUA 4AIHA 4HDVA 1MJ9A 1JGSA 1T6SA 3KP3A 5D4SA 1QO0D 1R1VA 1JHHA 2KIUA 1B1BA 4M9ZA 3WTWC 2STTA 4CXFA 4EGYA 1S3JA 5BMZA 5D5WB 3F3XA 4G7OF 1SD7A 1UB9A 3H92A 4LLLA 5E8GA 2VXZA 4EVIA 1BI3A 4BYYA 1P4XA 3ZPLA 1W5SA 5D5UB 3V4GA 1O7FA 3QPTA 4I7HA 3WTXC 5LGTA 1ZRFA 2ADUA 2XASA 2OU2A 4XSZF 4L9NA 4HA8A 3FMQA 3TO6A 5EEGA 2DPUA 1DPRA 1KGSA 2GWRA 2H6BA 1OMIA 4MNUA 1HXDA 1U8RA 1BN5A 2EV0A 2D1HA 5ICFA 3DF8A 1Z1DA 4HX8A 2M30A 1ON1A 3GEZA 1XD7A 1CF7A 3BROA 4IVNA 1G3SA 1HKTA 3ZN1A 4HLYA 2ZXJA 4MGRA 3WTZA 2IP2A 2Z33A 1XGOA 5LEJA 1IXRC 3E6DA 1KU9A 3R0AA 3CJNA 1YLFA 1D8KA 1ZN2A 5L3GA 4G7HF 2L4MA 2P7VB 1YG2A 1I5ZA 4EJVA 2ZKZA 1IXSB 5LGUA 4BHBA 2VODA 2HTJA 4WXDA 1IN4A 2DI3A 1FP1D 2G7HA 3CUQB 3HRMA 4CYDA 1TBXA 1IN7A 3KLNA 1FBSA 4M9SA 2NYXA 1ZREA 2VE8A 3F8BA 1O3SA 3QRFF 2HQNA 5CJ9A 1KQ0A 1BIBA 2DPDA 2QM3A 1FSEA 3R61A 4ESFA 1R7JA 3KZYA 4ZYHA 4EM1A 4XBFA 3F72A 3TGNA 1PDNC 4Y13A 4GO1A 5F6FA 2HFHA 2EB7A 5HS7A 4P9UA 2K02A 1K6OA 3QP5A 5BOXA 2XVCA 3NQOA 1OKRA 3KP5A 2L54A 1TQIA 2MLKA 3GVAA 3HSFA 1FC3A 2CQKA 4YG2F 2B0LA 2ETHA 2HWVA 4PGGA 2ZJ2A 5D6FA 2FNAA 2ZNZA 1UHWA 5LRRA 1EH6A 3TOAA 2FMYA 3G73A 3GWZA 5E8IA 2E7XA 1S8NA 1B9NA 4EM0B 4RGRA 4I98B 1HSTA 4FX4A 2BEOA 1J2XA 3LA2A 1XCVA 2PG4A 2M8EA 2R7FA 2Y48A 4ESBA 4IHSA 3LSTA 4G9YA 3JSPA 1RIOH 1FLIA 2DO7A 4A0XA 3JAMZ 3EYIA 2VT2A 3U2RA 5L3BA 2IA0A 4G7ZF 3IRRA 4HBLA 3ZMZA 4Y17A 1R1UA 4HQMA 1CF7B 3JAMK 5JFRA 5L3FA 4WXCA 2P4WA 2GXGA 2OD5A 4L5JA 4LGWA 1BJAA 5CLSA 4Z2YA 3WTSC 1S29A 3M9AA 4LK1F 4P55A 2VBZA 4QLCU 1USSA 3E6BA 1T39A 4OIOF 2RQPA 2W24A 3I0TA 2HGCA 5FFZA 4PZJA 2L02A 4MQVA 5D5XB 1LDDA 4ZYDA 4PCQA 2ISZA 2ZBKA 1MD0A 2ZNYA 2F5EA 4KN7X 3VFZA 5H20A 5BS6A 3EQLF 2P6SA 2NRAC 4HAMA 3K9TA 2XROA 3W6KB 2RDPA 2EFQA 1HKSA 1KQ9A 1AWCA 2HKXA 3FM5A 1U5TB 4O5VA 3MZYA 3RJPA 3V7CA 2DAOA 4KIGA 3JW4A 4PGHA 4GYGA 2CFXA 1IF1A 3F21A 4EJTA 5BPDA 1K78A 4I2OA 3GO5A 4HF0A 3I53A 1ODDA 1YTYA 2DK5A 2E1NA 3NRVA 3WGHA 3GXOA 3GW2A 4M6XA 3RKYA 3L09A 2HTSA 1T38A 1G3TA 1ULYA 2DBBA 4U0WA 3I54A 2WWYA 3RPQA 3J80Z 3GX4X 2CO5A 2VC0A 1RUOA 1ZHFA 1U2WA 2MLGA 2XAFA 1XGSA 2A69F 5ILSA 5HVQC 3J80K 2RVCA 1P4WA 3E6MA 4CO8A 1I1SA 3J7AO 4MTDA 1ZGJA 2Z3YA 5F64A 1XSVA 3WTUC 2AS5F 2FRHA 3D0SA 1YS7A 1ZGAA 3CTAA 3BOQA 2L3DA 1S7AA 2K4JA 3TOBA 1W7PD 3I4PA 2VE9A 4JK1X 3C7JA 4RAYA 1O3RA 2EFWA 1KA8A 1TW3A 1LDJA 1X3UA 4O3MA 1MJAA 3V8JA 2XAHA 2JSCA 1MJBA 2QUFA 2HS5A 1T2KA 2KKOA 5LBQA 4I02A 3T1BA 2UZKA 3V8KA 2O61A 5HS8A 4ZZDA 5HDKA 4RB1A 4PDKA 2NS0A 2JRTA 2W57A 3OV8A 1H0MA 3F23A 5E1WA 3VB2A 2L01A 4EM2A 1P2FA 1W7PA 4UVAA 1CGPA 3IHUA 5K5QA 3MAJA 1SFEA 1REPC 5D4RA 3FF5A 1J7KA 4LMYA 2L4AA 4Q48A 4S05A 2ESHA 4KT5C 2CGPA 2LSOA 1LEBA 4HV5A 3H3UA 1K78B 4R1HA 3RKXA 3QU6A 3T8RA 1ZYRF 2OQRA 3TKYA 4M6YA 1OR7A 1UFMA 1V3FA 3KP4A 3EUHA 4UV8A 4A5NA 1F4KA 1VTNC 5K5RA 4R8HA 3M7GA 4BNCA 1BI2A 3I59A 2JPBA 2OZUA 1HQCA 5H6QA 2OBPA 1ONVA 1BIAA 4R79A 3T8TA 1HSJA 2FSWA 2IVMA 1LNWA 2W85A 3KEQA 4UXNA 2K86A 1RZ4A 3WE3A 1Y0UA 1P92A 2V79A 3IRQA 4RGSA 1HBXG 3LAPA 3JTHA 5L3CA 1W4MA 3EETA 5TJJA 2YX7A 3KP7A 1BM9A 4I01A 3F8CA 1MKMA 2EV5A 2WC2A 4L5IA 1Q1HA 1T98A 2IA1A 1BBYA 3QAHA 2DFIA 3VODA 2DK8A 4XRFA 4ASNA 1WI9A 3K69A 3FWEA 3DKWA 4KN4X 1LQ1A 2FOKA 1F9NA 4B8XA 4ZH4F 4AIJA 4I09A 2VOPA 5JVTA 2KJBA 2IT0A 2IW5A 3WTTC 1R58A 1D3YA 2JT1A 3GF2A 5DV5A 5K5OA 2IPQX 4NHJA 2ESNA 2HDCA 1RUNA 2A6HF 4KIFA 3SQNA 4KNYA 4HV6A 2P5LC 1USTA 1E2XA 1TQMA 4OOIA 4UUVA 3REOA 3U1DA 5ED4A 2GAUA 5HLHA 1ZG1A 3KCCA 1IN8A 4N9IA 1BC8C 4A6EA 3F6VA 1ZRDA 2EFPA 1W7PB 3SXYA 2XAGA 4OIPF 4Q47A 3LAJA 2A3SA 2STWA 4KICA 3FMRA 5H6RA 1FSHA 4MEYF 3HHGA 2BGCA 3IKTA 5E1ZB 2FU4A 2LF7A 3ZMSA 5LHIA 4EGZA 1DP7P 1FWZA 5ILVA 5E1XA 1SFUA 2A68F 2Q2EA 1U5TA 3HTSB 3MQ0A 1ZG5A 3KE2A 4U7BA 5HOOA 2PLYA 1ON2A 1YIOA 1TLHB 2Q8KA 4RGXA 2KIFA 2M45A 3I59B 1IZ1A 1MZBA 2LKPA 3F8MA 4Q5SF 3R6SA 1IN6A 2C6YA 2ZMEA 1JXSA 2ACJA 1B6AA 1J75A 4OMZA 2KJCA 5E17F 4OU0A 1W5TA 2O03A 1P6RA 4K2EA 3WU1B 4Y15A 2TDXA 1LVAA 4Q4ZF 1IUYA 2EK5A 2FA5A 4L0ZB 3CUOA 3GUDA 1O7LA 3GFMA 1R1TA 3KETA 4WWCA 2QLZA 5CVIA 1YW9A 2H94A 3CDHA 3SFZA 1FYKA 2W25A 1S6LA 3PFIA 3T5XA 4KDPA 3BPVA 1YYVA 2OZ6A 4LJZF 1AOYA 4ESJA 3BZ6A 4OIRF 1KYWA 4HF2A 4UNOA 3F8NA 2GA1A 1RNLA 4BQAA 4HW0A 5DEQA 6PAXA 3QPHA 4YIIA 3OOPA 1HW1A 1GXPA 1XMKA 4MEXF 5D8KB 4L18B 3KEOA 4AWXB 3E5QA 1R5GA 4L9JA 2H27A 2KRFA 5FGMA 1R22A 2ZFWA 1BC7C 2RC4A 3QU3A 1OYIA 1F5TA 3QP6A 4FX0A 3NEUA 2AXLA 4FT8A 3R0JA 2QBYA 4RGUA 3M1EA 1DDNA 1FBQA 2CYYA 3BDDA 1EV7A 2EV6A 5TRDA 1U78A 2DU9A 4NQWA 3P9KA 2LF8A 4OINF 4L9VA 2A6EF 2O6GE 3RTRA 2D1VA 3K2ZA 3V8LA 4N9HA 3ZMUA 1BI0A 1STZA 4LB5A 2PMUA 1XSDA 2J5OA 1FY7A 5FLXZ 3P9CA 1Z91A 4P96A 3DP7A 3CUQC 4L0YB 1ZARA 2V1UA 2NAZA 3Q9VA 4P5OA 4CZZA 5FLXK 2ZMEB 4ENJA 4KIBA 3PQKA 3CO6C 4A6DA 3N4MA 3I5UA 4UVCA 3Q5FA 3DXJF 5DCFA 4IF4A 5J8CA 1FOKA 4RS8A 1G6NA 2R7DA 1FNNA 4HQEA 4HX7A 1YS6A 2MD5A 4RAZA 1FX7A 5ICCA 1IRGA 5K1YA 2G9WA 1YFHA 5DD8A 1TNSA 4AVPA 4TV7A 4M71A 3WTVC 4O6JA 3WG9A 2CG4A 2MBFA 5FFXA 3ZMVA 3BJOA 3C3WA 2EFOA 3W6JB 4DQ2A 3RKWA 2XHKA 3P7NA 4LD5A 2IJLA 4G8XA 2EA4A 4AD9A 3CO7C 2W84A 3WE2A 5E20A 1K79A 1IRFA 4M72A 4LK0F 3MCZA 1PP7U 2JTVA 2Q0OA 2VC1A 3N97A 2M1BA 2NNNA 3IKVA 3FMSA 3K0LA 1QNTA 1R36A 1J0RA 5LHGA 3LA7A 5DUKA 3HSEA 3P9IA 1QZZA 2MH2A 1YW8A 1SD5A 3ULQB 1FYLA 1XDSA 1D8JA 2PFBA 1SD6A 1MDMA 1R5HA 2F5DA 4QWQA 3I71A 1UHMA 2QBYB 1O57A 4HLXA 4YFNF 1LEAA 4RB2C 3J81Z 2PBIA 3I58A 3BY6A 3HOTA 3L2CA 2QVOA 2YR2A 3MEXA 5FB2A 3LQQA 4OIQF 4A0ZA 4HDUA 3LA3A 3TO9A 3J81K 1SFXA 2GQQA 4KYWA 1I27A 4GGGA 3WU0A 1SAXA 3I64A 3BWGA 3RI4A 3T0YA 3O3KA 2PEXA 4CDGA 5HDNA 3MWMA 2UXXA 2QZ8A 1ZH5A 4ZYEA 5A2QZ 5ICEA 2Z9OA 1WSUA 2DLLA 1Z05A 4ETSA 4CGZA 2FNPA 1K7AA 4XLNF 1Z9CA 2CSOA 4UVBA 1FBUA 2WTEA 4UV9A 1KU2A 2MA3A 2XV4S 5A2QK 3C18A 2D2WA 2QQ9A 4HF1A 4HZFA 2MC3A 2HKOA 2DQRA 4G6DA 2A61A 4G6QA 4WCGA 1FP2A 3DFGA 3ECHA 3IWFA 5FD5A 3WGIA 4ENKA 5LGNA 4EJOA 4M73A 1XDUA 3PQJA 4IJAA 2R3SA 2XRNA 2YPRA 1PP8F 3KLOA 2BV6A 2DQLA 1XB4A
chains in the Genus database with same CATH superfamily
3SG0A 4DG8A 1VHWA 3CEPB 3KYDA 2IEDA 3T5DA 1Z7UA 4DZPA 1HFKA 1FFWA 3UKDA 5DK6A 2J9YB 4MKXA 4NCJA 4KN6A 3NEAA 4FI3C 1ZK4A 3WMRA 3PGKA 3TW7A 3L1HA 3Q7QA 3RARA 2LNDA 5CMLA 2V4UA 5JJ5A 3SC3A 2FWJA 3AFMA 5AIPA 2KHZA 2PMHA 1FVHA 3J7TA 4L9SA 5FBHA 3A6HA 2GXBA 2JHGA 3A7DA 5DXJA 2V1XA 2GZWA 3M8KA 2BW3A 1IY1A 3C1DA 2DU8A 3GA5A 2VHXA 4XVHA 2ZXEA 2VJMB 4QXRA 5EP1A 4IIBA 3RFCA 3C8HA 3SKYA 3KXPA 4KXFB 2NNWB 3CSSA 1AK9A 3CM0A 2JGKA 1A5ZA 2W2LA 5IBQA 1OILA 4OJKA 1DMSA 3SR0A 1CY6A 4FE3A 5EUMA 16PKA 1V7ZA 2H3EA 4HB2A 3C3CA 5AT1A 2M4GA 1AUOA 1L0OC 2WWGA 2DQYA 2XKAA 2Y0DA 3FUVA 3T4PA 4LOLA 3QLJA 3ZXXA 1F0KA 2X5OA 3BD8A 3UHFA 1CWUA 4J16A 9MHTA 2XODA 2H8KA 4BWFB 2J3EA 3FLMA 2D2FA 2DFFA 2H0AA 3JZMA 4EBFA 5I45A 5HQTA 5ERXA 2DQ4A 3V1NA 2JBWA 4I4NA 3ADCA 5FO5A 2XD9A 1G1MA 3D0KA 4DJAA 2ZBVA 3MCTA 2O2IA 4KXLA 3BTCA 1XZPA 1IXCA 1S7GA 5FL3A 3HB7A 5EWMB 4NYMQ 1GUDA 3L5OA 1Y0NA 1B4AA 1X6VA 3NOVA 4IKFA 1JJ8C 4GQBA 3VSKA 1E2LA 2JLXA 1CX9B 4ZI3A 2M5WA 1OX4A 1NK2P 1ONNA 4QFDA 3QXXA 2COBA 2FMHA 4N0QA 5EP3A 2MSLA 4HXGA 1C4XA 4BX8A 5DGXA 3RC9A 1J59A 1B14A 1UFQA 2GHRA 5LMZA 4RB3C 1HA3A 1LW7A 1W73A 4ND8B 1VLZA 3TJMA 5LU8A 3CD6I 2A07F 2FEKA 2HEOA 3F6BX 1R74A 4M87A 3A0BC 3K1MA 1BDJA 2FYTA 3HCFA 5EZHA 1T8PA 5C5IA 4OUDB 2O8NA 3NDPA 4P5DA 3LVRE 1NF9A 5AVQA 5J47A 3D6MA 3PHHA 4IF6A 3IXQA 4S04A 5IDYA 4ZEMA 2KQUA 1EG7A 4GP7A 4TUYF 1H9TA 4C7VA 1AU7A 5JADA 1AKWA 2L82A 1XGNA 3DEAA 5GTIC 4KZPA 2BZ1A 5DDGA 3QU2A 1P1HA 3UBTA 3RU7A 4GIBA 2IS6A 1EJ2A 4Q39A 4LWQA 5EXEA 3KE9A 4JIGA 3DE7X 2O8BA 4LY3A 4ZFNA 1YL6A 5A71A 4U2FA 2ECPA 3D3EA 5HS6A 2QJOA 1N8SA 5FEUA 5DD4A 3LBIA 2GYWA 2DX7A 4DWOA 2O3SA 3GTKJ 3I3OA 1UBKS 3UJAA 4RY2A 3UH1A 2WU4A 1O94C 3SVZA 2G63A 3UB4A 4WNYA 3LWFA 1JQAA 3H5VA 3RADC 2WFMA 4FFBB 1BVRA 2AC4A 3RAEC 1XZNA 2F67A 3KYJB 2QB5A 5LL6P 1WPXA 2X8JA 1UK9A 4RNDB 4O08A 5FT9A 1FFSA 3RANA 4E7PA 4D9BA 1NVTA 4AO7A 4CTMA 3E61A 2LPMA 4EQZA 4O1HA 2WB4A 3DL7A 4ZYZA 2G17A 1AQNA 5DYWA 2CJWB 8MHTA 1XEWX 3NORA 3GZTB 1VPEA 4UD2A 3OQIB 4P7BA 3CWQA 3K32A 1WPRA 4YT4A 3X3HA 1M1ZA 2GK7A 1TFUA 5JI3E 4CEJA 2E3JA 2VJIA 2DFPA 4L9TA 2P0YA 3AW8A 3TDZC 5IJ9A 3IH2A 3LKZA 3QUCA 2XTJA 5FV4A 5IAGA 4IZIA 4OMYA 1TMYA 4I0BA 5JI2E 3UMMA 2ZJOA 4E15A 3ROUA 4R6XA 2I7TA 5EYPB 5K7HA 4GMKA 5LP6A 3HUUA 3FTDA 2D2EA 1DDIA 3CEMA 3ABTA 4JQCA 2KI5A 3ZG6A 3T99A 1QPMA 1B8PA 2KLOA 2JCXA 3OT5A 1EAYA 4GCVA 2HU9A 1AF4A 2W6JD 1EX9A 3ZY4A 1CZOA 3AG3H 2J0UB 1UMDB 5EZGA 4L22A 1DI0A 5LMNB 2ZETA 2ZZMA 2X8WA 1RAIA 4EG1A 2X6WA 2P5YA 4HX4A 3BWYA 2J3DA 3U1TA 4C7XA 4G24A 2X8BA 5B7PA 4UPVA 3UPUA 4XVUA 2EJRA 3HTUA 2Z8YM 4YHHB 1HK7A 3TW8B 1NW4A 1WY5A 2Q5HA 3F7TA 2B5VA 2OVBA 5KPJA 5AIQA 4M3EA 5FBZA 2ZIXA 4QU5A 2OA4A 5ADUS 4ZDIA 4DLTA 4NC8A 3ME5A 5B4TA 1BO6A 1XN7A 2X9QA 3NIWA 3EIOA 4LF4B 4TROA 3RSSA 1GVHA 1H2WA 2VYND 4OYRA 2W0MA 3NRCA 1EK1A 4K40A 2LK2A 3M0EA 1BJKA 1SCDA 4F6LA 1QU2A 1DPGA 4EA7A 5GAHJ 2PYDA 1CY1A 3HDTA 3RJZA 4M8KA 4HN9A 2ZPAA 1XNGA 1N3IA 4RWEA 4P3NA 1RZUA 1WAMA 4G4GA 2WHPB 4LNUB 1C9EA 4BRUA 1FJGB 1O0BA 3WTWC 2STTA 3L0OA 4P3KA 1I39A 2JGDA 1FFEA 1IB0A 3I28A 4IDOA 3N0RA 2G06A 1ANKA 3QX9A 4EKNB 1ZCZA 2V7PA 1NJSA 4BO7A 1DJOA 3H2YA 5EXDA 5AJYA 2F59A 4ND2A 3V4GA 2RHRA 4E0BA 2YXBA 5H02A 2P9QA 1QIKA 3ORYA 5KOHA 3HRIA 4L9NA 4K9LA 1JQLB 5MGNA 4V2FA 4UUQA 2VL8A 1KAGA 5BYJA 3B9QA 1UPBA 4IWYA 1XXHA 3GLFB 5A3VA 4ALIA 2COKA 1QOZA 2R97A 1G21B 4U1RA 2ZVDA 3RIMA 4DMKA 2Y0EA 3W5CA 4AS2A 2F3RA 3ERMA 1OCPA 3SYNA 3UXHA 3WLKX 3CMCO 4BFWA 1XGOA 2ZSFA 3RSOA 4EYKA 4AWBA 3QPAA 1ETUA 4DJTA 2R6R1 2E7ZA 2UVPA 4JBGA 3ULKA 2P7VB 1VL5A 4EITA 2PMKA 1J0XO 3BN3A 2X0DA 1SU6A 4TQAA 1RWPA 1GV1A 4EJVA 2IITA 4M0CA 4HAUA 4DZZA 1TM3E 4INPA 3ADOA 2QN1A 4MYRA 3MWEB 4WD3A 1NBHA 3KSAC 2WSLA 5D6OA 5CJ9A 2C61A 3IVCA 3IO3A 1DU6A 4RADA 5IJAA 1K7CA 1MLDA 5ALYA 1YE3A 3WLEA 3EBLA 4N39A 3U3ZA 3NQOA 3I1IA 1Z26A 3KS9A 5F12A 4PTYA 2C9YA 2FMXA 5I4IA 2PYIA 4R54A 5CLIA 4LN1A 1KP3A 4FEAA 1O9HA 4YREA 2EZHA 1GU1A 2FMYA 3ZHUA 5E8IA 5CFPA 5I4KA 3WV4A 4X66B 1YHZA 2D0OB 2LIPA 4HB3A 2BM0A 2MR6A 2VUHB 4G0WA 1WOYA 1NFQA 1GQQA 1Z16A 1JFRA 3FIUA 3EXHC 2JFNA 1ZEMA 3WK9A 2FZCA 1EK5A 5DM1A 3LKDA 1QRSA 4JYCA 4PIVA 1FW8A 2F00A 2P79A 2PR7A 2DFKB 1U0BB 3PD1A 1OVGA 4DMUB 1HX7A 1JA1A 4JP1A 3JAMK 3LUGA 2EZ4A 3DMHA 9ABPA 2M8GX 4UBNA 3FYHA 4TV9B 1LSSA 1Q1VA 5AW8A 1VPWA 4UM9B 2EATA 1R8XA 1MBHA 3IQEA 5JE8A 2ID6A 2J6HA 4AF6A 2UU9B 2V9KA 1C8LA 4PCQA 2R0QC 3CO0S 1TUGA 3BREA 4BP3A 3QYPA 4PLYA 4EL0A 5D86A 1O89A 4L0CA 2NRAC 3SLKA 5FLVA 4C7OA 1RWNA 1HDGO 4G5GA 3OS1A 3Q7RA 4YRDA 2FGJA 1HRKA 3V6LA 3AR6A 5BR1A 4QFBA 2F8SA 5BUZA 1IATA 1W1UA 4LRWA 4NATA 4FZVA 1Y9EA 3F8TA 3KQTA 2PU5A 3AR8A 3CLKA 1PBNA 4QG3A 4HSTA 3W2HA 1W49A 4B35A 1R5OA 2P65A 2J7PD 1E2IA 3I3SR 3I6MA 4ZI7A 1JF8A 4ZVVA 3MEQA 3GXOA 2A2ZA 2FQ4A 2Q9CA 1WJCA 3GD5A 3NYIA 2NUTB 1VI0A 1Y8QA 4OIMA 1OMOA 2G4VA 3RPQA 1YCDA 3AUJB 4BQEA 1U2WA 3PC6A 4UULA 3QTBA 4O6VA 2PV7A 2XGDA 4HV4A 1HTTA 5EJFA 3V97A 1TZLA 3R2JA 4RCZA 4GNKA 5F52A 3K4LA 4FEGA 2VXDA 3AEQA 1IM2A 4CF6A 1KYXA 1RZRA 2YVUA 3UBMA 1W7PD 2QLMA 2RONA 3B13B 3N2GA 4YEDA 1MIHA 1B72A 1RQGA 3ZQUA 3EXEB 5HKKA 1PX2A 1AUPA 3LKBA 3OSGA 1OAOA 1U5BA 4X1YB 5HS8A 4B3SB 3QXGA 1NXVA 5KAPA 4O4HB 3DBLA 3FPBA 2UYOA 2CHEA 1Z15A 3WNVA 4UUBA 1Q7TA 4FD2A 3RVQA 3GLHB 4NBTA 3MOIA 4CQMB 1AQUA 4XYLA 1GYPA 3CJRA 1QF7A 3KBBA 3KKQA 3PJGA 3LCUA 1EH5A 2G1JA 1GFWA 1TWCJ 1XCGB 5F98A 2UZ4A 2J3HA 2R7WA 1YS1X 3LLVA 3HCDA 3ILVA 1H0RA 1NN0A 2NADA 1VTNC 3GJ7A 3HGYA 4G97A 4GXQA 4OHMA 4DIFA 1RP7A 4AVZA 5T4EA 1YAHA 3OIVA 4QT4A 2ISQA 5CUQA 2EFDB 4DJ5X 4U63A 3CDLA 1Y0UA 1QXSA 1HBXG 1O4XA 1S3GA 3H6GA 3F1LA 4HC4A 4RYLA 1E4EB 1VL8A 3GGGA 3PE3A 1FBNA 2CF6A 4IM7A 1D0YA 3CE6A 4PZZA 3O2QB 1Z68A 1R3DA 4NJEA 3H6HA 4F5EA 3QAHA 3W1EA 1T91A 4AZTA 2WVGA 4FEEA 4FISA 1JGGA 1X86B 3OIOA 2GRUA 2JEYA 3R40A 3OO0A 1U0NA 4QLOA 2LG4A 5BSTA 1I2BA 4CDRA 2RK4A 3KVRA 4ENUA 4ER5A 4AM3A 4V0QA 3UCEA 3TM4A 3BFXA 3QKRA 4XKBA 3R9KA 2YV2A 2ZRHA 4UD6A 5BW8A 2GAUA 2EL9A 2ZUWA 1ZITA 2GBGA 3EBPA 4E7OA 1XQ9A 3SXYA 2LC2A 3TTUA 1U7HA 3VOTA 4EF5A 4WT7A 1HE5A 1E3OC 1S5PA 2VCHA 1H3FA 3B3JA 4DA0A 4GSYA 4INZA 1ULSA 2AYYA 3DOCA 3TEFA 2DP4E 5FUWA 1G59A 2FVYA 3MINA 5L53A 1RPAA 4WASA 1U1DA 3CLUC 4IFTA 3QEMA 4RUKA 2V9ZA 2VCYA 3DMPA 2CUZA 1JT0A 3K0EA 1PJ4A 2ZB7A 4P3PA 4AN1A 2AT1A 2I2FA 1MTZA 3UK2A 5F4BA 4EPVA 3UPTA 1VIDA 1OLXB 2GDJA 3ZWPA 3W34A 3TSWA 4A0FA 4KFRA 4HDMB 5CAEA 4TYNA 2KJCA 4R7ZA 4UUSA 1Y5IA 1ZUD1 4JGIA 4XRRA 3D8HA 3D1LA 1X7XB 4YEJA 1LVAA 2IGMA 2FJPA 4L8YA 2BE7A 4KYTA 4P4NA 1EDZA 4LZOA 1ZD9A 5HWSA 4JYMA 4UHJA 1PV1A 1RKUA 4V3CA 3DR3A 5AVVA 5CVIA 4TWAA 3CDHA 4F71A 4QO7A 3CPHA 1YYVA 4HNHA 3ES9A 3G1LA 1F2DA 1FLVA 4BVAA 1G5HA 1P4RA 4JR0A 4YCSA 1Y7HA 1IZZA 2GJ9A 3QBEA 1XSEA 3IEUA 3LY8A 1XMKA 3PEWA 1YAJA 3DEZA 3GVCA 4L18B 3EUFA 4IJ5A 3AUUA 2V3CC 5DZSA 5F1OA 1DNPA 3QU3A 2NTVA 3K1AA 4MV7A 1DIBA 4WX2B 1R6BX 2X76A 2RH5A 3R0JA 3NAZA 4BCBA 1E5XA 4QOHA 4MWDA 1X7HA 1BKYA 1IRXA 4N6NA 1FS4A 1WVIA 1A2KC 3F6RA 1U9IA 2MSEB 1YRNB 4BJ5A 3ESQA 5EZYA 1JI0A 2CDAA 4YMLA 4PJMA 3VOSA 1TNDA 4BNDA 4WADA 4ZPXA 1JE0A 3BQYA 4RIFA 2EX0A 3ROPA 4PZEA 2RGDA 2Q3BA 1UK6A 5GY7A 1MRSA 3V46A 1S89A 5I7VA 2WNIA 2BP7A 4W9MC 4OAPA 3LRXA 1VIVA 2CFTA 2OBLA 2CXTA 2XQJA 2ZMEB 1X7DA 4QYIA 4X7PA 4ZREA 4A6DA 4D0LB 3JD3A 4P92A 3ZBTA 2ACVA 4YRKA 2QV0A 5DCFA 4C4ZA 3GLGE 1SN7A 1W8DA 2A86A 4JI1B 1ZR4A 4XD2A 1ZK0A 2DOAA 3MWFA 3WGYA 3CCYA 3ZK9A 4TV7A 4IIGA 3WKEA 3FHCB 3NC1C 1RTKA 5AK4A 4UHFA 5EZ6B 4FYKA 2YXEA 3I5AA 4Z0HO 4WA8A 3SJUA 1UM9A 4F4DA 2C8LA 3WKCA 1RYMA 4G8XA 4DLPA 4LRYA 2EA4A 7REQB 5IN5A 4Y6PA 4M72A 3TE6A 5I9BA 2O2SA 4EELA 3IKVA 5TMPA 5K0SA 2EZUA 1J1IA 1NXTA 2GEUA 4RIEA 4ZGBA 2MIIA 2OHHA 3BAZA 3EQ2A 3M4YA 3CLTD 5HF5A 5JNUA 2OTJI 5CGQB 4W5TA 3FHNA 2OG2A 1D8JA 4RTRA 4KQWA 2PFBA 1B2RA 1K98A 3OSUA 2PMDA 1UFKA 1DXQA 3D31A 4LSWA 4G0YA 2C5GA 5ARDA 2HOQA 3D5SC 2X5XA 4NC6A 4A0ZA 2P5UA 3A37A 3MPUA 1Y98A 2HO5A 3FBWA 1P5HA 3PQ3A 4AN0A 3F4LA 3H4VA 2W11A 1DKPA 4DIOA 1VHTA 1RXWA 2RHDA 3S5UA 4QOJA 4YDSA 3U3KA 4ND3A 3GJ4A 3ASZA 4KKXB 3C8ZA 1N5OX 1CRQA 1W9MA 2F9LA 5JYDA 1RT9A 5CT4A 2EKLA 2G0TA 4EATA 3KG2A 2XV4S 4Q9JA 2HCTA 4C0QC 3WV5A 4JVMA 4HZFA 1XTVA 3CVUA 3HBFA 1WP4A 1WZEA 4KOEC 3PKJA 3ECHA 4UDOA 4LJYA 1PW7A 5IC5A 3CBGA 1H9BA 3K9WA 4PIMA 3DB2A 5D84A 2X1HA 2XCTB 3DMDA 2PUFA 1J33A 1T4MA 3LLMA 1N2GA 1GG8A 1XQ1A 4GL4A 1C30A 2GHQA 1R6XA 3S44A 3ERED 4GFDA 1Y34E 2HGZA 1GARA 3ORHA 1E0AA 3E22A 4B0PA 3BP8A 2VRWA 3AUYA 4XFJA 1KU3A 1C4OA 2BGLA 1D2GA 3ZU3A 5DLYA 1R0KA 1ZYUA 1HDZA 1FFAA 3NCTA 2GS9A 2VUIB 3EC7A 1I7NA 2EC5A 3ZV7A 2WB1A 1JQEA 2QM7A 2KDOA 1IY8A 4F60A 3LHIA 4Z8XA 3K4PA 4BQNA 2HWUA 2C00A 2PS9A 3N1UA 3JTEA 3GROA 1Q6YA 1EVKA 4PSAA 3WGKA 3Q5EA 3M9LA 3I4FA 2YNMD 4EEKA 4F7ZA 2EP8A 2HTFA 3G3ZA 3FTPA 4A3JJ 2H4XA 1LD3A 1XXLA 4EGAA 1FU8A 1G4DA 2JFYA 3WLRA 1PUXA 2CQQA 4NNOA 3RK0A 1JPNA 2AR7A 1ILEA 1XN1A 1UJ6A 3O83A 4FNMA 1XD9A 4WTOA 3OLYA 1JW9B 3EF3A 3DAHA 4R2WA 2E2HJ 2HA0A 4P6VF 3GVHA 4F2WA 3V8RA 2DYSH 3DW1X 2IA2A 4DNCA 2PA0A 2V7EA 3UKGA 3LKVA 2DN0A 1OLSA 3TF5A 3GZ5A 3KJQA 1BVUA 3FCOA 4QUIA 2J4CA 3OIUA 4NB5A 1Z77A 1Z75A 2GR9A 3EAGA 1RBYA 5JNTA 2WA2A 3MTGA 4PWZA 4X6YA 3TL4X 3MLBA 4JP8A 1F1ZA 3DFFA 5HODA 1YR2A 1FDUA 1RXSA 3BRCA 3FE2A 4P08A 4NULA 1NSFA 3TOVA 1J25A 3E23A 2QSZA 3ASUA 4PSUA 4NE7A 4OOEA 3IPXA 2LH9A 3M2TA 2QXTA 1JH8A 2X0LA 3BULA 5CCBA 2DOKA 2QX6A 4DA4A 4PUSA 1ACIA 5C8YB 4BVEA 2FFAA 5FR1A 1U0GA 4XONA 4YYZA 2VZ9A 1P3Y1 2GIVA 3TIXB 2PUAA 5HJ7A 2GYUA 1H1TA 1KO1A 1WCYA 2IEYA 2IE8A 3E3VA 3DNMA 2V7XA 3BIJA 1C1DB 4PLVA 2YWGA 4NMHA 4ER3A 4ZV7A 3KZXA 5JU6A 3GGSA 3WKAA 2C83A 1NNSA 5LZ5A 2HXSA 2PMZN 4G01B 1S72I 2OQGA 3OYKA 3FOEC 4JHLA 2VDWB 1R0ZA 5JQGB 4PBRA 4MX8A 3JARA 5B4UA 2OO3A 3X0DA 4LPKA 2BC9A 5EUBA 3PD7A 2VJNA 3MJDA 3DWGA 5JNSA 1RXYA 2NU8B 3CW8X 2ZRCA 4M1OA 2I3ZA 3AHFA 4TYWA 4XB1A 1H2YA 2HY7A 4QL3A 4EHBA 2DUUA 3ONDA 3K1PA 3ABZA 3IHKA 221PA 1MIOA 1UXGA 3HP1A 3KXDA 3UGQA 4Y6RA 4RVDA 4MOWA 3KJZA 2CL0X 1VZ0A 1J5PA 1G3QA 1JDPA 4NABA 4MHGA 1KGDA 2XB9A 1Q20A 3KJXA 2VBWA 2L0KA 4H9GA 2E6UX 4PQRA 4DCSA 2DMUA 1OX6A 1IEVA 2ZCVA 2ATVA 1M8KA 5FJIA 2PD6A 4MYUA 5LKRA 1MNEA 4A0HA 1XNQB 2HOSA 4COOA 3CCJI 1X8KA 4GU5A 1NSYA 4U4AA 3MN2A 1ZNQO 5I4CA 2QA5A 3OCJA 4BFSA 3BWMA 1GPYA 4KWHA 4UNRA 1ADFA 1CNEA 2XXAA 4L2IA 3H9CA 3C5VA 3DKIA 4X41A 1F0YA 3S8EA 3AI1A 4YIFA 5K8UA 4KA4A 1FS5A 2IRFG 1TQHA 3FLAA 4GR5A 1T4CA 2J6CA 4MGKR 3LC2O 4OAZA 4G2NA 4EJWA 4ZCIA 1AUQA 1YDGA 2X0KA 1JUDA 4H6PA 3RYCB 4OXNA 1JA9A 2X2PA 4I81A 2NQ8A 5IKEA 1F8UA 2IIBA 1YB7A 3HUGB 4ZHQB 2XUBA 1BCRA 3PR1A 3RC8A 1GUYA 3WYAA 5D5VB 3JYQA 3GY0A 2PQ8A 3M9WA 5LRSA 4D6PA 4V1CA 3H8VA 5HKOA 2CV0A 5KX5B 3M1AA 3LX5A 2F3SA 4F11A 4NRDA 5CLFA 1U31A 3AIOA 2Y2VA 2ODAA 4R0NA 4A12A 4ZJUA 1SQFA 3DEJA 2C4HA 3L8GA 1Z6ZA 1QX4A 1UELB 3H13A 1UT8A 1PZXA 1N6NA 4N5IX 3R3HA 3L1VA 3VSAA 1EUCB 1XRQA 4ZT2A 3BH6A 3WRYC 3WX0A 1KFEB 4KLCA 1R3UA 3ZJVA 5EDNA 5CVVA 4CICA 2Z95A 4AMGA 4CI9A 5AVZA 1HW5A 2FWMX 2QV7A 2W6JA 4DLUA 2VH5R 3STYA 4IHWA 1J5YA 3N8KA 5TNXA 1JLHA 1JP7A 1OB2A 3EHDA 2IH5A 1ZX1A 1T6NA 3PWZA 1QJ4A 3H5TA 4YJFB 1GLGA 3MFKA 2H59A 1CEYA 2F7SA 2QTFA 4JEHA 3TXXA 4HQ0A 2DUNA 3BPXA 4D4IA 3IT0A 3IUBA 4FYMA 3D2BA 4OHOA 3CNQS 2LBFA 2J5BA 2Q1SA 3ZJUA 1OC2A 1E62A 3CC4I 4RKWA 4HTAA 1E79A 3B3FA 2CFIA 1ESCA 4AICA 1O5TA 5D5WB 3GUYA 4LSMA 4JOBA 1AHPA 1F2VA 1Q1NA 3JXEA 2YQ4A 3WGTA 1SOMA 5HRUA 1K6EA 1T3SA 2H9YA 2VYNA 2O0JA 2H2GA 1G2PA 5J43A 1P4XA 4NU5A 4KUGA 4DR5B 3JRGA 1YL5A 3QPTA 4XM1A 4WK2B 3SJAA 5E3NA 3OURA 4OD0A 5H3LA 2IUUA 3TTYA 3QVWA 4GMGA 4AK9A 3PNTA 4I50A 3ZQJA 3AHCA 2JI4A 1NM5A 4RX1A 3OUTA 1HT2E 3SQDA 4OLAA 1RFLA 3OJEA 2QKYA 1DTWA 5JC1A 4KC0A 2Q4RA 4QXQA 3L2QA 4UHHA 4Q9NA 1X42A 4YHBA 1ZIYA 1KL7A 4JLWA 4MKFA 4B0OA 1LLFA 5JATA 4MP6A 3ZHRA 4X63A 4BDTA 4FWTA 1QYCA 2IEBA 3N5CA 4EW1A 4BE2A 3QUAA 1YJAA 1IXRC 2KE5A 1XKTA 2VTBB 3USZA 4MYDA 4QQFA 2Z4SA 3LSRA 4PNEA 1F6BA 1QLJA 4FUTA 2GARA 1MNQA 1C7ZA 3LW7A 5HW0A 3PVZA 1LFAA 3NJ4A 1AXGA 2FZKA 2OORC 2NXNA 3CG0A 4CG2A 4W1UA 4N8SA 3KWFA 2AQIA 1UXKA 3ZNPA 2V1NA 3KQOA 5M04A 1JNYA 1JVNA 1JPVA 2V03A 1H4SA 3AEKB 2WFLA 1J4AA 2CL7X 4LNHA 2B8TA 2RKWA 1X7ZB 1OV6A 3DZ8A 3JQAD 3D8BA 4BNMA 3S27A 3PUJA 3FTCA 1MSEC 1Q16A 1QG6A 4I99C 3MSCA 2LDBA 3WL7A 4PGGA 3CQ9A 3OJCA 3IUEA 3KPJA 4PC1A 1BE0A 2WSBA 5EMHA 3RRYA 1RADA 3LK7A 1TZCA 1ULAA 3OZEA 1HDPA 3V4LA 4RZIA 1B9NA 4RGRA 2ZPTX 3S1QJ 3DAFA 2A9KA 5J4KA 2A88A 1TAHA 2XZTA 1WV0A 2CLEB 1EFPB 3NS7A 1L4BA 4PPGA 4D4MA 3H5AA 3ML1A 4UPEA 3R0IA 4ESBA 1UDAA 2C9ZA 2NUPA 2PRJA 4PTLA 4CWAA 2QRUA 3CC8A 3QXJA 2J33A 5C7OO 2ZT6A 3GPCA 4DRXA 4NJOA 5JLAA 5AESA 3WFIA 3U61B 3HOUJ 3HDQA 1E6UA 4KCGA 5BQOA 5JNWA 3H5WA 3KQKA 2G71A 2JAWA 4TWZA 1CU1A 1M34B 4BBZA 2XMCA 3EK2A 4AURA 3ER9A 2FCRA 3IRUA 4RGQA 4CKEB 1CF2O 1JVBA 4C4YA 2ORYA 4RSHA 1LJUA 2IGBA 4FB5A 2K40A 3DM9B 4MQVA 1XJWA 3SJZA 3IMFA 1XYVA 4WFJA 1S3IA 3TFWA 2ECCA 5HILA 3CJTA 4JLMA 2C0PA 2ERXA 5DSZA 4J7UA 1JMKC 3HP4A 1Y4ZA 1J49A 4H2DA 5B5EC 5LDGA 1HKSA 3EY9A 1W85B 5AQ1A 3EXIB 3NBXX 2YW9A 3NU1A 3S1LA 1UOPA 4E11A 4FYWA 4Q4AB 2ZUVA 3R7LA 2FKNA 5FA5A 4PGHA 1WEKA 3ZZTA 5C5DA 2H00A 5CFRA 4TX1A 5BRJA 5C5EA 1K68A 1QH1A 5DI9A 2P0EA 5AM3A 2DG2A 3A6ZA 1XTBA 3RVMA 1RI5A 3G8AA 4GX0A 4PCLA 3U9TA 1D5WA 1YTYA 3K0FB 4CKBA 2E1NA 4KPUA 3ER8A 4DCCA 4PG7A 5DM7F 1YIJI 5CLGA 3SC4A 1G3TA 3BR2A 1HETA 4HJXA 2QT9A 1DJMA 5AVSA 2H63A 3FNRA 1T4GA 2B9SA 1SVMA 3FGZA 4C21A 3FNFA 2ZBDA 2IQIA 2XAFA 1V3VA 2BPOA 3SSNA 2IFTA 3FPHA 1LPNA 2I2WA 5F51A 3TNJA 1AHHA 1I33A 2AIRA 4Y0AA 1G20A 1U2DA 2FRHA 3BT9A 2VHEA 1ZGAA 3ESBA 2G40A 3WYBA 1G3IA 3KKPA 1EE2A 2ZI9A 1IY9A 4IDPA 3H1AA 4GR4A 3CW9A 1OX5A 3Q6NA 4LI0A 2EFWA 2EF0A 2P30A 4O3MA 5JRZA 3O4IA 4QTRA 3BFVA 3G9UA 3QTLA 4KDEA 2KKOA 3GEDA 2GX6A 1XVAA 1O0SA 2IBSA 3AERA 3O8CA 3ESWB 2Z6AA 5CYOA 3UAZA 1JXMA 3RRMA 2IYUA 1ZVJA 3OICA 1Z7GA 1V8DA 4B6EA 2OXTA 3PIPF 3F23A 5ENDA 4JASB 2VRBA 3O7MA 1O0CA 3JVIA 5TARA 1W7PA 4MP3A 1YZTA 2ID8A 1ZVVA 3FWNA 3TP3A 5G1NA 2AX3A 3KTOA 4N0DA 1EB8A 1XTRA 1FSFA 4JUAA 5FOTA 1GRRA 3SF8A 4Q48A 4M0FA 2ICAA 4NYJQ 4MRMA 5CHYA 2Q46A 2QRZA 2B0CA 4E31A 3DOHA 1DKRA 1CQJA 4ZCQA 3OT1A 2IQ5A 4AG5A 5L3QB 1I4WA 4CTNA 4Q12A 2H1IA 4CYMA 1X1PA 2AC7A 3TTXA 2FI1A 2OZUA 5TSDA 3KLPX 3ETGA 1CS4C 2UDPA 7MHTA 3DEYX 5FNZA 3H2GA 2GEJA 3LM8A 3LX6A 1RXEA 1G8JA 4B43A 2VQEB 1NL3A 4F3CA 3L0SA 2VF8A 4L9AA 5AUQA 3H11A 2ZB3A 4CBVA 1A9XA 5L3CA 1U1GA 2L18A 3SOZA 3BXXA 4BY7J 3UMCA 1UBCA 1EHCA 2XTAA 5HDBB 4XLAA 4Q6BA 5CDSA 2DC1A 4QPDA 1KIMA 4BGVA 2O59A 4J2OA 3DCFA 3I4NJ 3U4DA 1WXEA 4C3JJ 4ASNA 3PDWA 2PFGA 3QUQA 4ZH4F 3TJRA 4E2FA 3S2HJ 5B53A 3BC8A 1U9NA 1IMOA 1TCBA 1VE5A 4DAOA 3AMVA 4QFCA 2IPQX 1E9CA 2GKSA 2IX9A 3K4CA 2JASA 4OLJA 5DI3B 3PIOF 3HZOA 4HV6A 4DREA 4B7CA 2M1ZA 1TIBA 1E2XA 4G67A 5G3YA 3DQZA 3OE7A 1KQPA 3ASNH 3FPCA 3RAFC 4KIJA 2YDYA 2B25A 4LOCA 1XPUA 5GADl 2M6KA 3THYB 1OZGA 3UNGC 3I9V2 2TS1A 4Q47A 3NWTA 1SD1A 3LAJA 2HOTA 5H6RA 3GZ4A 4OTZA 2BHSA 2TMDA 1GVNB 1JWLA 1E7QA 2C2ZA 3JU3A 2YIVX 4BKRA 2DA5A 3T6KA 4GP6A 4UZSA 1O4WA 3CF4G 2ZYVX 4IYRA 5HYVA 4NYMR 3U7EB 3QQPA 4X44A 5MF6A 1ORIA 3QZUA 3QELB 2Q8KA 3BTJA 2M45A 1LBQA 3I59B 5EI5A 1D1CA 3K9LA 3GA0A 1TEZA 2QVZX 3ONWA 1IN6A 5IKPA 2E2IJ 5JYCA 4HN4B 1SVSA 1DIHA 2EL7A 1A4UA 4EAAA 3GJYA 3LQKA 3WU1B 1EAMA 4B75A 1DMRA 2GCNA 4MS3B 1YBHA 3I4LA 1CR2A 3GJ6A 2QLNA 5HUHA 3R41A 5DULA 1CB7A 2JF0A 1YW9A 2H94A 1Z06A 3A4MA 2H31A 5FUBA 3WMWA 3GT7A 3NLLA 1MSFC 2HK9A 4RQAA 4LGMA 2A0FA 4YDHB 4BDYA 5F3DA 2GF9A 1G9SA 2CJXA 1ESZA 3SQLA 2H7XA 2OYCA 3X2QH 1NKVA 3P9NA 1G0OA 3TCXB 2IEIA 4KNVA 2IYWA 4EP1A 4R84A 5LLSA 3FOBA 5TX7A 4MUJA 1TYEB 4AWXB 1SVIA 4GKVA 2BTOA 3WYFA 2H27A 3VTFA 4BV3A 3VH1A 1KJIA 4NCIA 2YWFA 5LPNA 3OQBA 3FMIA 3PGLA 2JD0A 1T8SA 2OO5A 2VTVA 4M54A 3RH0A 1P2UA 1WSBA 1RM0A 2EV6A 5DYYA 5DHFA 3T5AA 3F3KA 3TQFA 1P9NA 1EZ1A 2VHVA 4ERXA 2D1VA 3B36A 4NLLA 4CCNA 4QNMA 5K9ZA 1L5FA 3ZMUA 1U63A 1BW5A 3JRCA 1I30A 1YK0A 4CF3A 4CRWB 4WQMA 3O0DA 3IDAA 5DO9A 3NTUA 1OFUX 2PFSA 1OT5A 2YHUA 3IAEA 3WKDA 4KRGA 2Q2EB 4LC0A 3HDHA 2P4EA 4I8DA 1Z91A 4QXPA 3CUQC 3IUPA 2D1YA 4R2KA 5B37A 2QUIA 4IDNA 3WI7A 3K9FC 2ZIWB 1RQRA 5AW6A 4YQEA 1M5TA 3A1CA 4PAQA 1WUJS 3I5UA 2GN9A 4K8OA 3DPSA 1XTQA 3OBIA 3PR3A 2QL9A 4B46A 3RUDA 3EDCA 2CDBA 2O2EA 3HV2A 4N82A 2MR5A 1R88A 1XC7A 4LJ9A 1GY8A 2AI1A 3NAMA 4RANA 3R0XA 1W34A 2GRJA 3KVVA 3EGXA 4OQEA 2CG4A 3L04A 3ZMVA 3BJOA 3DUWA 5DTQA 1M8JA 3OOHA 2AJ8A 1IOWA 2B1GA 4X54A 1NMZA 2QTVA 1D2RA 4G0ZA 1UWLA 3AIKA 2VN8A 3ZQCA 1UEXC 3DBHA 1QCDA 3FMPB 3QOXA 3ZZ0A 5BMVB 3HK2A 3Q0EA 5K8JB 3FMSA 1QIGA 1W59A 5EZQA 5TS2A 1R36A 5FOXA 3K1TA 2CDCA 4GI5A 1I7QB 4RHCA 3AR3A 4B6PA 1C50A 1FOYA 2A67A 1TTTA 1YACA 2YDXA 2PQMA 2CFOA 3GCDA 4ZJYA 1UODA 2A1TR 2Z8ZA 1SK9A 3IV5A 3OEWA 3AG5A 1ECJA 2YKGA 1UCFA 3A1TA 4OFWA 1GL7A 1Y3AA 3R0ZA 2JARA 2CL6X 1PGQA 1CUAA 2G5CA 5J5VA 2AR9A 3FFAA 4NZPA 3BQZA 3AESB 4EJSB 5E7JA 5HCUA 1N9GA 1T2AA 1MG5A 3BXOA 4Q3AA 4EF4A 2WINI 3UJ9A 4L4SA 4R9VA 4H16A 2HUNA 1WW3A 5SICE 1UPFA 3AUKA 3DD5A 1R71A 4PC6A 3W4JA 4BNKA 4UVBA 2NXJA 3OF3A 3GG9A 1CR4A 3WA6A 3EH2A 1BXRA 3EG9A 4OKNA 5EJ6A 2YYYA 1ZC3A 2QIPA 1D6NA 5L45A 2O8DA 4PFJA 5J58A 1EVLA 4EW3A 3DL4A 4QQ8A 2DYRH 3KWJA 2HFKA 2POQX 4C3HJ 4BMXA 4POAA 2G67A 3ZGYA 4EFKA 4EJOA 3LLSA 4UTRA 4MR7A 1NBME 3GT0A 3AL3A 2YFHA 2WWWA 4C7KA 1J06A 4FCYA 1TM7E 5TS3A 4GR9A 2GUGA 4HZUB 2ZPUA 2XKPA 1YZNA 3EGDB 4KMMA 2QTBA 4AU1A 3RVRA 2QW0X 4JMLA 5BW4A 4YMIA 4XWYA 1X7YB 2KRCA 3BG7A 5ALMA 3MZHA 5LWQA 5EF6A 3PI6A 3WWPA 2HJGA 5AXDA 4BBAA 1MGTA 3A6EA 2BMFA 1JPUA 3CF5F 1SPXA 4X5OA 4HJRA 2Y67A 5D3MA 2BBTA 3PEUA 2K3FA 2XEXA 2DMTA 1F06A 2UXNA 1WQ4A 5L3SA 1U3UA 3OPXA 5AVOA 4Q7KA 2DHQA 4C04A 2FBKA 2I99A 4BJTA 2FUG2 4YFKF 1APBA 2BYVE 1PNRA 3NOQA 2DR2A 1E1QD 2IL1A 5J2TB 1RKVA 1YZVA 1S2MA 2XGCA 5NLLA 1JUSA 2BY0A 4OB8A 3GTLJ 1T5TA 4XLCA 3ITEA 2GWHA 3A6KA 4PG4A 5IYZB 4ASUA 1T29A 3IAM2 3ZWQA 3FWZA 2C4UA 2FPIA 2O0YA 4B17A 3DTIA 1DDGA 1K5PA 4XWOA 5LQJA 4UDXX 5KQGA 1MEJA 1ZIXA 4KGVA 2B2XA 1PSWA 5JS2A 4M0PA 2JZYA 2J9FA 1EQ2A 4LY0A 1UDCA 2NUBA 4G9EA 5IDVA 5I51A 1WY7A 2GBFA 1GFZA 2Z8XA 5D00A 5GONF 2XDQB 2YNMA 2QJRA 4HSEA 5KVCA 3EC2A 1AHNA 4AZVA 2EARA 1NYTA 1L9XA 1KMIY 4FTWA 4EMUA 3F3YA 2AJDA 1JDUA 2IIPA 3VOEA 3LQRA 2FA9A 2QDKA 3H19A 2FEZA 2MDTA 4LRQA 3S3NA 4DLYA 3RTBA 4JC5A 3THSA 9ATCA 2HKIA 3Q0IA 2O8CB 3Q15C 1B8OA 3SAJA 1LQ2A 3SZUA 5G1PA 5IEJA 2IDMA 2FRXA 5C1IA 4UUAA 4M9QA 4HTFB 1ITZA 1XNJA 4Q9DA 4J91A 4KQFA 4YRTA 3IPLA 1FZQA 4PANA 4YECA 2J5XA 4WOPA 3RC7A 1Q44A 1FT9A 3BDIA 3P9ZA 3U9SA 2LP4Y 3JD4A 4UNPA 3RUPA 3F7OA 1XC5A 1N2CE 1BOAA 3KQWA 4LOIA 4TN1A 1QYRA 3V7SA 1UBLS 3WP1B 4QTXA 3QSGA 2IPLA 2ZTVA 3RIEA 3VO2A 3UO8B 2WM9B 4YTEA 4R1LA 5HGXA 3M8JA 3GAZA 1C1XA 2FQWA 1M1EB 2JUCA 4PCUA 3BJ6A 4M1MA 2P6RA 4IKOA 3ZIAD 2FJ1A 4B3CA 4TYYA 1EE9A 4MEAA 1EBBA 4U6NA 1PJQA 3PGXA 1XRMA 3BWEA 3R60A 3A9VA 1CNFA 3C1AA 3ZWVA 4GPZA 5LA6F 2HHLA 3DV8A 3IX7A 1RAHA 2UZ3A 1TK3A 1F48A 1VL1A 1WPQA 4BMNA 3BF8A 3DDSA 2YZKA 5DUIA 3WLIA 1DWQA 5REQB 3CR3C 4HBGA 4WF2A 2B7BA 2PH1A 3NGLA 5BQXA 2AXEA 1A5JA 4ADSG 2JSPA 3MBOA 2IYEA 2XUFA 5MN5A 2X14A 2H17A 3A9TA 3ZTWA 1R37A 4CPDA 1RI1A 1NOKA 4UNIA 5C53B 4ZTUB 2HUPA 3HKZN 5BV1A 2MMCA 4JJEA 2QTLA 4FHZA 2YIJA 2ZO4A 4U88A 2A1UB 2OGSA 2VHQA 4QEDA 1RABA 2RK3A 1UJ2A 3UHJA 4A69C 4QTUB 2UWMA 4U3JA 2YWHA 2BEVA 4DCMA 4PHHA 3I61A 4Q16A 1MB0A 1KEVA 1V8OA 5IPFA 3ETNA 1UK7A 3W3ZB 4AQYB 4UM5A 2ZS7A 4WCFA 3MKYB 2WBMA 1VCMA 3VEPA 1KI4A 4MITA 4HUQA 2BEWB 4OBBA 2FPRA 2CWEA 2ZIEA 5EIBC 1DZ3A 1H22A 2EV9A 2K7LA 2RI0A 1TYDE 2CBGA 3IAS6 1V37A 2AF3C 1OA0A 3ZDQA 5JXHA 4HYEA 3O1IC 2O8FA 1YR1A 2VJLA 4Z9FA 4TUYA 4JLNA 3ENQA 1TD1A 3GELA 2H1RA 4OYYA 4AJKA 2XUOA 2EINH 3FKSA 2Q1YA 1JWBB 4NECA 1XN4A 4MWZA 1ZGZA 3MLAA 1N3LA 2D5IA 5I7HA 4OLBA 4H08A 4TLEA 3EDQA 2KZVA 3AY6A 3PUFA 3CCQI 4V3BA 5TPWB 2YSRA 2G5TA 1VYHA 2AE2A 5COAA 4FU0A 3JWIA 2YU3A 3T15A 2QAGC 1ZJZA 4Z0TA 1J2JA 3JQEA 5HM6A 1JLLA 1WZNA 3ROKA 3QY9A 1RJ9A 1D5CA 1QPGA 1JR2A 5KVRA 1ZLJA 5A3RA 1OUMA 1U2PA 1Z13A 3HSRA 2GCOB 2HB6A 1K7XB 3NBAA 3DKPA 1EXWA 1L5GB 3VU9B 4EG8A 4G4SO 4BVKA 5CGZA 4BX0A 1MJ9A 3UT5A 5JAOA 3KP3A 1HV8A 1T25A 3S99A 5ER9A 3ITKA 1V43A 2IU4A 5EVCA 3NMUF 5JTUA 4KBGA 3AUTA 1CVLA 2GPTA 1W36D 1C14A 1JDZA 1IRZA 1QHNA 4LMPA 2I7DA 1E9DA 4DDWA 2WF7A 5IZCA 3HB4X 4HAIA 2VNIA 4EO4A 5I8WA 1YJ8A 4OHRA 4JL6A 2GZ1A 4B4KA 2JLRA 4YRIA 1JV2B 2C03A 1KBOA 3JZIA 2RI6A 1PVEA 2YV4A 4D4LA 1REQB 3M6WA 2PUDA 4MAFA 1G3MA 2DUMA 2EZTA 1O7FA 4LZJA 5LJIA 1JLMA 1MJHA 5FD8A 1C3VA 3K4KA 2IS4A 3HEBA 4WKCA 5KNBD 3SI7A 3L1JA 2BTQB 1J0EA 4N4OB 1IJBA 2X77A 2B7LA 1FL9A 1NQ5A 1TC1A 2CUEA 3GC6A 4GD3Q 2EV0A 1B8UA 3QX3A 2NIPA 5EN4A 4DB4A 1KI6B 1CF7A 5JY1A 1V16B 4CMGA 3QEAZ 5DLQC 4IOMA 2FRVA 2AUTA 2B3DA 2OBFA 3AEYA 2Q5OA 5J4HA 2Q0HA 2ZB2A 3L7DA 1B0AA 2L19A 3VPFA 3UJNA 3TQQA 3OM8A 4YP7A 1YLFA 5A0VA 2J5KA 3VGPA 4DJEC 4KH1A 4RD1A 3WZLA 5F77A 3FNBA 3ZE7A 4KFSA 4YR9A 4ZVRA 3T0IA 4DJJA 3PSIA 3IR5A 2P3LA 3KU4A 1D4AA 3AJ9A 3P7MA 4RSMA 5DRYA 2MHCA 2VHWA 2VE8A 3MD9A 1N5KA 2EQ5A 1U9OA 2J6IA 1D2NA 3FSEA 1GZDA 3I01A 4Y13A 2C57A 1NUQA 2PJDA 4ZO7A 3AOEA 2XCLA 5JJLA 1C9NA 2D1FA 1DTEA 1EWVA 3KP5A 1YMVA 5BSEA 2PEZA 4HAXA 4CM6A 1QVRA 1XU7A 2C5LA 2ZJ2A 2XPCA 4BX9A 1GV5A 1O96B 4E1AA 3F47A 4PO9A 3MRVA 4F97A 1EH6A 4YIRX 2QRMA 3DPIA 2FDXA 3DT6A 4MB2A 2BI4A 3A03A 3E9ZA 2BEOA 2IHTA 4WIAA 3RKUA 2JZNA 1XCVA 4K3UA 3ZLJA 2R7FA 3KR2A 4KNWA 4CMEA 2W4MA 3JQAA 3LSTA 3LG2A 3JSPA 3TO5A 1RIOH 4XWKA 1XDGA 3CVYA 4MHOA 1PUFA 5L3BA 2IA0A 2PRSA 4BQFA 3EUAA 4XJXA 4HQMA 3AGPA 1GG2A 5EZ5A 4FGJA 1KDRA 1WKBA 1TVEA 2CXSA 4ZAFA 3ICPA 5F1JA 5CPFA 3THOA 3CRZA 1FSZA 4MVJF 4W4TA 1I4EB 2PL9A 2PK3A 4ZMRA 3P5SA 1RM3A 2QQ8A 3T7KA 4DRZA 1T4BA 3RAGA 4WZBE 4Y2TA 4HOYA 1ZISA 4DM4A 3D9QX 2C9CA 4P53A 1EFAA 1AZTA 1PDOA 2MD0A 1E3HA 4P4SB 4R41A 3UAOA 1AWCA 4EQ6B 2ZB9A 3K2IA 3U44B 4H31A 3C0KA 3CRRA 4ZAYA 1X1RA 5LNK6 3ABSB 3BCAA 5EQDA 3NHSA 2OBMA 3BA6A 4GYGA 2MOKA 5B66C 2VWQA 1WZ2A 4G25A 2R7LA 2H5EA 1VYTA 5F5LA 3AY7A 3HXPA 1NJ1A 5K0ZA 3OYIA 3OZXA 2IZ0A 4U5XA 3M34A 4ZC8A 3CX4A 2O2GA 4FSDA 3X1WA 4PPFA 1XV5A 5HTKA 1HDRA 1G2IA 4MV6A 3VM6A 4DABA 3TWOA 2QTAA 4JLJA 1VP3A 2B99A 1QGYA 4FK8A 2G04A 2PBFA 2JRCA 1T9KA 4KITB 3MRSA 3E27A 1NKTA 3AEZA 4HQNA 2ZRDA 2WM2A 1S2OA 3J81A 3OTOB 1UQTA 1P4WA 3PKIA 5K4AA 2FPSA 3WJ7A 5AKHA 3LU1A 4FE4A 1UKCA 2JEOA 3ZVMA 2JJ2A 3VNAA 4GLFA 1FJHA 1ZY2A 1TP4A 2QL7A 1CHNA 3ECCA 4B6RA 4ENRA 1YJWI 4LZWA 3SNKA 1NUUA 1IBSA 3TRKA 4BTVA 4F8EA 3CQZJ 1DRKA 4RAYA 1B00A 3NT5A 5BN4B 1DAMA 3KOYA 3ECAA 3KD2A 2CHVA 3OLZA 4S2UA 1KO4A 3UJ8A 3V7YA 4R0MA 2XAHA 2UYCA 3ZJTA 4NBVA 4F2HA 2P41A 1RBMA 3ZW9A 4C6SA 3V8KA 1PWYE 3WMFA 4C5CA 1TADA 3CHYA 4Q18A 3JRFA 4UEOA 4XJVA 4AWAA 2XGEA 1R9MA 4XEUA 4ZA2A 4E7JA 1OF1A 3K0AB 1J2YA 1F3OA 5D7BA 4BWVA 1RVV1 1O8BA 4NF2A 1CFJA 1MDFA 4GQAA 1P60A 1SFKA 1D2EA 2AFIE 2E82A 1NUSA 5TQ2A 1XGKA 2GFIA 1Q17A 5KWJA 4GZ6A 1R12A 3K2EA 3R3VA 3QJGA 2VC2B 3GBPA 4MMXB 2CGPA 2LDXA 1KZGB 4UUMA 4MLDA 3PC7A 2VPRA 1VYUA 4X20A 1IPHA 3BD7A 2P3OA 2E4WA 3GFTA 3V3TA 4X9XA 1JHYA 5HIKA 1YS9A 3AKDA 4Q24A 1S9HA 1W52X 4TWRA 5DSXA 5JW6A 2I8AA 1MMFB 4LCBA 3MUOA 3GLRA 5YASA 3GDFA 1LVKA 2R5ZA 3MCUA 2TSYB 4HGPA 1HF0A 4GP9A 4RL4A 1V5WA 3MTJA 2BEUA 2JCSA 5FBLB 2CCJA 1DAHA 1QC5B 5GAGJ 2ZYGA 5TJJA 5BWLA 3EVTA 3F8CA 6CHYA 4IY1A 1CIJA 1T98A 1AU9A 5AKKA 2V6JA 1MP0A 2DFIA 5EVJA 3AEUA 5CQGA 2VL7A 2OCDA 1VZ2A 3N2KA 3OM1A 1QKJA 1N6PA 4E1BA 1Q95A 2ANCA 2OOSA 1JS1X 4JI6B 1SA0A 2C1ZA 3SLGA 2O8KA 1A5SB 3ONNA 4EZEA 5DBIA 1A8QA 4AIJA 3HNPA 3M83A 1Z82A 5JSZA 5JVTA 1W4ZA 2IW5A 1BZYA 3K9BA 1L7BA 2CZGA 2K7FA 2BTEA 1WXHA 2AJLI 2O7SA 3QW4B 2C2KA 1M6NA 3EPJA 3AL0B 4ID3A 2DR0A 4PQYA 1A96A 5A4KA 5TV2A 4XQEA 5HLHA 1K7SN 3PG5A 5IYDJ 4ZQEA 4XCVA 1ZI9A 2Q9UA 3B6AA 1SHTX 3IQDB 4CIBA 2ZFUA 2WAEA 3RSNA 2DTDA 2Y30A 1PJRA 4BMCA 3CH7A 2PUHA 2J1LA 1Z29A 1ZJ4A 1H94A 2FX3A 3MMXA 4NWIA 3RD5A 2BGCA 2JATA 4S1WA 5E0OA 4O4LF 5KQPA 4ALLA 4JT9A 2Y92A 3ED1A 1KK1A 5DM6F 2EDCA 3W5VA 2ZSIA 1DVRA 3OL3A 4YJHB 1X14A 2C78A 1I9CA 4JU9A 4RABA 1ID8A 1APLC 4Q5SF 3ZRGA 4IWNA 1JXSA 4EG3A 4XSGA 4CLRA 3E5MA 1P9RA 2Y9MB 1Z0AA 5B1EA 2F9FA 1NA5A 4X62B 1WH7A 4NMMA 1UIMA 2CHGA 4KZKA 1TUBB 2Q1WA 3C6ZA 2FA5A 4HDNA 4QU8A 3OIPA 1AXEA 4YJ3B 2Q4EA 4KKVA 3GUDA 4IUYA 4D82A 2I22A 3Q8MA 2WPDD 2NXEA 2P5SA 3H18A 1POXA 4M6WA 1PQPA 1O6GA 3IEVA 3VR1A 1S6LA 1YFZA 2ZUTA 3RASA 4MRVA 2M6LA 3IOBA 2HRCA 5TMBA 4DKXA 3DC7A 3MTBA 4V0LA 4A91A 2OCAA 3PUZA 3F8NA 2LWIA 5DEQA 3DEEA 3TEMA 2DWUA 3I9V1 4Q5IA 4OGKA 4N6OA 3GRYA 5JXIA 5D8KB 1BR4A 3IAHA 2XOKD 3AR4A 2ZXHA 4IX1A 2WRZA 4A6PA 4LOKA 3PXCX 2H3HA 1ODJA 3QVOA 1V9LA 2JK0A 3NM4A 1YR7A 2LP0A 4UBMA 5FUVA 4CMHA 1Z0JA 4PYMA 4IDFA 2I71A 1BQEA 2V6BA 5LQDA 4C0BA 3GJZA 3CWZA 2LKSA 3TG8A 2FPLA 1VFCA 1GTZA 5H4HA 1K75A 1DBIA 3R7FA 4OXYA 5FKLA 1WUIS 3SLRA 2BKEA 5IWAB 3WXMA 1XDWA 3WYCA 3TXAA 1QMGA 3L6BA 2V1UA 2YZGA 4II3A 2UYGA 2QKLB 1KS2A 1XZAA 1MMGA 2UAGA 4P7GA 5LFAA 3U0VA 4KYUA 3NBKA 5KWSA 2C5HA 4FFRA 4BE9A 2X85A 1KYYA 4HQEA 5EMNA 4TVKA 1YS6A 3DBRA 1RE0A 2BFOA 2WKPA 5EWJA 5DD8A 3ZWXA 3HTXA 5AW7A 3D7RA 1NDHA 3GCXA 2W37A 4JDUA 1PW5A 1KWKA 4U9HS 4DQ2A 4MS1A 3DBIA 2RI1A 2PX8A 3D6AA 3D0QA 1Z3YA 1KJJA 3STUA 3GBSA 4F2DA 4OB6A 4L51A 4M0KA 4Y1GA 3QFSA 3QY0A 1CJCA 3PM1A 2FWPA 2NNNA 5ELXA 2HK7A 4E14A 2JHAA 2C9DA 5DUKA 1ENYA 2WQZA 3OX3A 1Z0XA 3EIHA 3RYFB 1YW8A 3HY3A 1R27A 4YWJA 3ULQB 4U2CA 5HM8A 3UAYA 3S8YA 4LJ7A 4JUIA 1Z6AA 4GGPA 1YT5A 3RSGA 1OI7A 4QPNA 4BUCA 4C0LA 2QBYB 1IWBB 1ODIA 1WU7A 2GK3A 4ZOLB 4XKJA 3M1YA 1CQZA 1Q0TA 3TE7A 2G28A 2R1TA 2PBIA 4PSDA 3KL2A 2REQA 2QVOA 2DH5A 3PHGA 5SZKB 2YR2A 1QO7A 4Y9RA 4WZBB 3OJOA 4MQ6A 3PNQA 4OIQF 3E18A 4JAVC 3FCCA 4ZP1A 4RVUA 4HQ6A 1FIAA 2YVQA 1PCXA 3L8MA 3DLIA 3BWGA 2JNWA 4QPPA 3S1AB 3VU0A 1W93A 2I6SA 4ZMBA 2REXB 2QD4A 1M8GA 2PZBA 2F1RA 3RRXA 4GG1A 2SECE 5JARA 3W8FA 4W5OA 4BLQA 5FTWA 2GFQA 2VDOB 3QLUA 4EG4A 3GNLA 3JQCA 1U11A 1AMNA 1E7WA 4LS3A 4FKZA 2G6TA 2Z04A 3GLGB 4DQLA 3HKEA 3W1VA 3NDBB 3WGIA 4Y2YA 3PTAA 1C2TA 3VYVA 5CXXA 3HMKA 2V9PA 2NO4A 4Y6QA 1O7JA 1IDYA 4X92A 1DRVA 3E3OA 1L4EA 4LGVA 3PZBA 4K9NA 2CJPA 1U9YA 2YFYA 3ZU5A 2YWEA 2X0NA 3UVEA 3SXUB 3NHPA 5I7FA 1H3NA 1ICIA 4ZJPA 2P77A 4DNOA 1RESA 1PE0A 5TLSA 5KNBH 1JJVA 1Y7PA 5KWEA 2QY9A 4E46A 2E7WA 4BB6A 4X3CA 1FTYA 4ISBA 5C37A 2MG4A 4DYCA 3S7TA 2AKEA 3X2FA 1XAHA 621PA 4E7KA 2WWXA 2DEUA 5B5SA 1URPA 2VAPA 2VAVA 4L8FA 2ZS9A 1FRFS 1I2AA 1MOSA 1TT5B 3ISPA 5L6MB 4E5KA 5ICGA 4WAUA 1T9GS 5K3FA 8ADHA 1U90A 3OPYA 4PR0A 3VTAA 1OY1A 4MI1A 4FOLA 3PVSA 2NSYA 4YAOA 4AX8A 4QASA 3OYEA 4FDMA 1OWOA 2O5RA 1Y80A 4HFJA 4XIFA 4OLFA 4B2YA 1JQBA 3FUUA 2QSUA 3OA2A 2WJPA 4LF7B 1YVRA 3NV7A 3NTQA 2OYRA 1J00A 4IHKA 4C6HA 1O5IA 2ZAMA 3TKAA 2I8DA 3L2RA 4P5EA 2YJNA 2UXBB 1LLQA 1OZAA 2OLEA 3GJQA 4BX2A 1E1QA 3KQMA 2C96A 2FR0A 5IP7J 4B8WA 1YO5C 4F1KA 1D5VA 1NQXA 1SMYF 3C1OA 5HNKA 2FHPA 3E03A 2GH1A 1MRZA 4B7XA 1JR6A 2VDQB 1CG6A 2PXCA 4DR2B 2NVUA 5ESDA 1RR8C 5TPZD 1JQKA 2XGOA 1KQ3A 2C4TA 2QQGA 1IGNA 3OZDA 2PH3A 3ZDAA 1I6XA 3VNBA 3EDYA 1N2IA 4RF5A 1C7QA 1LWOA 5L3VA 3H9JA 4MO7A 4XI9A 3SNHA 2OGTA 1USIA 1P9WA 4HQLA 2FUG1 2I8CA 5MDHA 2AZ4A 4Y1EA 5DXAA 3JQ7B 3AUXA 1PD0A 2O8EA 3K71B 2GZAA 5KTSA 2VBGA 5CXSA 4GECA 5F0FA 3ICOA 2WAMA 1CJKC 7ABPA 3OC0A 3VR6D 5D5HA 3WWDA 3EZ6A 1IDN1 3IQWA 1I5EA 1UBJS 3LUBA 1FYXA 3OO1A 2HBZA 3IAM1 1NW6A 5FROA 3B8EA 3DDNA 4F5ZA 3QFTA 1WCIB 5FLKA 4AUKA 1U3EM 2C9MA 1E2QA 4PRYA 3QFHA 5D2CA 2ZBEA 4B32A 1WDTA 1JZSA 3OS0A 1U7DA 4XCQA 5K1ZA 3SDGA 3RVOA 5IUNC 2XGGA 5IDQA 5CEJA 2HU2A 1Y4UA 4XEHA 4IH1A 3NHRA 1GNPA 1HR0B 1PJZA 3ISTA 5L3EA 1NQOA 3A6LA 4INOA 1LNQA 1GRVA 10MHA 5IP5A 4AO8A 3I04M 5DW0A 5IJWA 2FXAA 3G71I 3G5LA 1IG3A 3MT9A 3C5HA 3QPWA 5FPPA 2PLRA 5J2UB 3DO8A 4EZBA 4RFSA 5K3SA 3TOCA 5FLYA 4D0SA 1VJGA 2W2XA 2GBLC 4ZRMA 5G4KA 5HTOA 4FDLA 4U7FA 5IX8A 3FSJX 1OU4A 5LMUB 3AVUA 3UJ6A 4AZWA 4C7MA 3WGOA 1RKXA 3PNPA 4JLUA 4UFNA 3W79A 4RO0A 3BA1A 3PUVA 1GL3A 3UTDA 3IMEA 4XWAA 2BWJA 4DV2B 4BVLA 4AIKA 4KBYA 4AP9A 1WHSB 2ID3A 3Q2KA 1BGXT 3T3NA 2O5VA 3L40A 3HIFA 4ZTBA 3R4KA 4BGDA 4MYSA 2VEDA 8LDHA 4WK0B 4YH1A 3OY9A 4Y2SA 2OCLA 5AO9A 3CMYA 1NRXA 2R7AA 2ZZKA 2GNAA 1O95D 2GM3A 4NK4A 5DBEX 5H82A 1BMQA 2V45A 3L4JA 4LLGF 1U3GA 3ZHYA 4CM4A 3HRSA 5JJIA 4PCAA 1O3QA 4RIGA 2QTMA 2XIGA 3B3AA 2J7PA 4UHDA 4XARA 3V7RA 3KHTA 4AZ3A 2VKHA 3FMVA 4AJ4A 3RUAA 1EH7A 4Z9BA 4IHJB 2O52A 3U80A 1XZHA 4US1R 1OXSC 4XGQA 1MA3A 1KH1A 1CUDA 1IN5A 4R2MA 2Q4BA 4AKEA 1OQYA 3P0FA 2HDOA 5C1BA 1R0XA 5TQ0B 5IT9Z 3B12A 1XSXA 2FEWB 4IQ4A 4UCFA 1KVTA 3ANNA 1TCVA 4WJZA 3G8YA 4JR1A 1ZZEA 2CUJA 2IKQA 3R77A 3IUNA 2GYYA 3IMGA 1EINA 3K4HA 3Q5GA 1NF8A 1SD4A 2JGRA 5K4HA 3PQCA 4I0AA 3C39A 1BA3A 1W96A 2VKDA 3NH6A 3O47A 2B9EA 4EV0A 1SMTA 1A97A 1J56A 4ZKDA 4YRCA 2G9RA 2Y6VA 5BQTA 2BH9A 4FGSA 3PWTA 2I3BA 3EWSA 2H2AA 3ZDXB 5CA1B 1T9HA 3FDZB 2ZKLA 4K88A 2ZMEC 1W5FA 1W4LA 3LDGA 3S32A 3IXLA 3O92A 1JHHA 4FD3A 2YHIB 3RBZA 1BW9B 4BEVA 2DVMA 2PUTA 3MT7A 1L7OA 5EYRA 3I45A 3PQ5A 2F55A 4GOXA 1HDDC 2H1VA 3OEED 2FW1A 4G12A 4C3ZA 1FUYB 2NVOA 2WAQN 4NCAA 1NQUA 4KDCA 4F91B 3ADKA 5A5GA 2B5WA 5AVUA 5D5UB 4Q3OA 2BKUA 2LBPA 3FTEA 2X9VA 1O6ZA 4LBZA 1J20A 1YE5A 4QDXA 3TRHA 4I7HA 4ABYA 5FP0A 3RE1A 1ZJYA 4MR8A 1U2TA 4H0FA 1X0XA 2CW8A 2XMSA 3W4KA 3BG9A 3D3QA 4UCWA 2FVXA 1IDZA 5EGOA 3HR7A 2VWGA 4FCTA 5JMWA 4MQLA 4E32A 3CA8A 4C3VA 2HNAA 1SU8A 2MINA 2PM8A 2CVHA 1HKTA 1YBAA 4EYQA 3EJWA 4COKA 4PLZA 1ICEA 1CKEA 4G07A 2IRWA 3NWJA 3RC3A 2Z33A 4B4CA 1N2EA 3CT6A 5FWYB 2OHJA 4L3WA 3WYGA 4Y7NJ 5KNBA 2CW5A 4JYAB 2QN8A 1HURA 2DULA 2ZKZA 4HDRB 3GQVA 1C3OB 1RJGA 4H15A 1EQUA 4O59O 1IN7A 3D3WA 1FBSA 2NUAA 3DV0B 3II6X 2HQNA 2H0QA 2FK8A 5CT9A 4IG9A 4PX3A 4PSXA 1C3LA 1BE1A 4Y6GB 2ZRLA 5G1OA 2EB7A 1NI4B 5TY0A 5AH0A 3ZZ1A 4G81A 2XVCA 1XEWY 3KEMA 1EB9A 3G5MA 1XZLA 4M7RA 3SZMA 1HE8B 4RD2A 4RKFA 5D6FA 3IB6A 3HU2A 2ZNZA 2CY0A 1U3TA 3ZWAA 2W93A 1LVGA 5EP4A 1B8NA 1QZ3A 4RKEA 2IXTA 5CK4A 4AMBA 4EFNA 4OBXA 3ND9A 4RM2A 2WJ3A 3KOZA 2M8EA 2BSAA 2MTBA 2Q6TA 4CE6A 2BMEA 1VE3A 2BM9A 3VDNB 2ZC2A 2F5VA 3EXAA 3E9QA 5L9AA 4MPRA 1FLIA 2VT2A 1RZVA 2I54A 1RRPA 2QRVA 1FNBA 2DB3A 3FMOB 4D7NA 4EJ0A 3A14A 1VQLI 4PEVA 3ZCSA 3C6BA 3M6XA 1G6OA 1BJAA 1F4PA 1NTRA 4YUXA 2GFHA 4I1UA 1P44A 1IVSA 1HF3A 2PL3A 4TLAA 3AL0C 1IG7A 3U7QA 3NDJA 4DPLA 3IBYA 1OFHA 4JJ6A 4P38A 5SY9A 3JALA 1M2GA 2CB0A 2CNKA 2CN1A 1P8AA 3DXXA 2HR1A 1RKWA 3T12A 3DONA 3KZMA 3O4VA 3CB4A 4QX6A 5IM5A 1VHLA 1QVVA 2WD7B 3CF4A 3Q7PA 3VFZA 4GVXA 2BGIA 4XPIB 2II6A 1NLUA 4IV8A 2GK6A 3K9TA 2Q1ZB 4OHUA 3NHBA 2EWWA 3JQPA 4BN4A 1MAAA 2ZWOA 2I9PA 3UV6A 3F90A 4C2TA 4URZR 3T5PA 1NQTA 2BE9A 1XRJA 1OTYA 1ETHA 1IF1A 3H5LA 4UBKA 2VG8A 3K73O 5H59A 3FXLA 5JFTA 4NENB 3T9EA 3JD2A 4ACAA 4PGAA 1E96A 1MJNA 4JH0A 4PYNA 3KB8A 3FWHA 4XIDA 1E2EA 2HEIA 3RKYA 3E9MA 5H68A 4V2GA 1IG0A 2EW2A 5JSYA 1UUFA 1WJAA 4IIYA 1D1QA 1KYQA 3J80Z 2CO5A 1Z5GA 4IUBS 5FOUA 1EM8A 3GHHA 4QVGA 4EEXA 1BN6A 1XWWA 3B38A 5KI6A 5CDFE 4MVJD 3FTQA 2ZVQX 1DJNA 3TRFA 1Z34A 3TX2A 2XCSB 4F52A 3EOZA 4I8IA 1EJ0A 4PLPA 1TCCA 3ZWCA 1M73E 2QAIA 4TMFA 3U7RA 4WINA 1E9SA 4NAUA 5K05A 3HKBA 1D0XA 1HSZA 3S2EA 2JSCA 1RAEA 1WMFA 3GQBB 2A9OA 1OH6A 3WLSA 4LITA 4F06A 4I3FA 1K97A 1SCIA 2QG4A 2YY7A 2RB4A 3OY2A 4O2BB 2V7WA 1RSZA 1H0MA 1QNLA 1Y3IA 2KBFA 4GH5A 1P2FA 1W0KD 1CGPA 5H3HA 3FJYA 1ISPA 3FTFA 1AB5A 4TL7A 4ZQIA 5BR7A 3FPFA 4Q1FA 2JGNA 3PO2J 4UHBA 2LREA 3F46A 6LDHA 4WACA 1I3AA 1XHLA 2ESHA 1G64A 1KFCB 2O07A 1AVTA 1F8FA 2QSYA 3E84A 4J29A 5KYXA 1X8XA 2B69A 3ACDA 2OQRA 5KTRA 2VNKA 4XR4A 1UFMA 3UG6A 3ODGA 4A8TA 2YICA 2GOMA 1N9KA 3P0EA 2H08A 2GJAA 2ZAGA 3TZLA 2FPUA 4Z3KA 5F4ZA 1PFKA 5L4NA 4N7BA 1HSJA 3LL4A 2JCVA 3KEQA 1J7JA 2ZBUA