2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords CSA3
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
5CJ9A 3B02A 1FSEA 1I27A 4KA4A 2P8TA 1D3YA 1PUEE 2VOOA 1L0OC 2P5KA 2DI3A 2M87A 4GGGA 2G7HA 3ZN1A 4WF2A 3WE2A 1B9MA 3O3KA 4BHPA 3BP8A 1IXRC 5ICEA 1FT9A 3E6BA 3ZMUA 4PCQA 2Y48A 4M71A 1TW3A 5JR3A 1QGPA 1GXPA 1MJBA 4KN7X 4WK8F 3RYPA 1SFEA 3FM3A 5JFRA 1E2XA 1FP1D 1O57A 1CF7B 2H94A 1J5YA 3R0JA 1BC7C 1ZGAA 2IA2A 4N0BA 2Z3YA 3L2CA 4RGRA 2YR2A 5FFZA 2V9VA 3WTTC 1Q1HA 2HQRA 3F3XA 4M9XA 2KIMA 2F5FA 4I7HA 2GWRA 4HZFA 4HX4A 1HW5A 4KIFA 1ULYA 3ELKA 4L9NA 3ZP5A 5LRRA 1WWXA 1AOYA 3PQKA 5F64A 2OQRA 4BNCA 3HHGA 3ZN0A 3LSTA 4XLNF 2PG4A 4KIBA 3LWFA 3ABUA 2L54A 5L3DA 3RKWA 5IT3A 3TKYA 2DPDA 3WGIA 3IKVA 3GF2A 3HOTA 5H20A 2FNAA 5J6XA 3FWEA 3LAJA 1YS6A 1RZ4A 2MBFA 1RIOH 3MFKA 3ZMDA 1A04A 2GA1A 2KKOA 1FBQA 4GYGA 1HSJA 4XSXF 4HYEA 1O7LA 1FWZA 4H0EA 4L9VA 4LK0F 2TDXA 2OAZA 2VOPA 2VBYA 2EWNA 1SD6A 1Z1DA 3BPVA 4U0VA 2A3SA 1L3LA 2HEOA 2H27A 1FC3A 1FY7A 5L3GA 2ZMEA 3E97A 2Q2EA 3WTXC 3BOQA 3GX4X 2BGCA 3O6BB 4MGRA 1JHHA 2HYGD 4ZYGA 2UXNA 1HSTA 2PEXA 3E6CC 3F8BA 2HWVA 2RKHA 3F8FA 2DK5A 4YFNF 2FA5A 2A07F 5D4RA 4HX8A 1RUOA 1FPQA 1QNTA 2P5VA 4MEXF 4PGGA 2Z99A 4EJOA 1WKMA 3F72A 1FP2A 3LA7A 3IWZA 2E1NA 3ZMSA 2VT3A 2F2EA 1TNSA 3HRTA 2ZNYA 2VBZA 1MDMB 5HVQC 1KGSA 4HV5A 1FSHA 5FD6A 1R36A 4Y17A 1D5VA 3IL2A 3CJNA 5KVRA 2CWEA 3HTSB 1TQPA 5E8IA 4OIOF 5D5VB 1MGTA 5A2QZ 4EMSA 1MJ9A 2HZTA 1O3QA 1D8JA 2D1HA 2VN2A 3GFMA 3FX3A 4PZJA 3H92A 2LDUA 5JI6A 1DDNA 5LGTA 4ESJA 4N9IA 3I54A 4R8HA 4HBLA 2GAUA 4XSZF 2IA1A 3ISPA 4MEYF 1XSXA 2HYFA 2RQPA 2GXGA 4I0BA 2CG4A 3ZMZA 2WWYA 1U5TC 3I59A 2DT5A 2ZNZA 3MZHA 2DQLA 1FX7A 1EH6A 5DUIA 2EA4A 3QP5A 2O0YA 1H0MA 3D5LA 4M74A 3NEUA 2QQBA 2XKOA 3RKYA 2IVMA 3IRRA 1BIBA 4UNOA 1TW2A 2V1UA 2MLGA 3JTGA 4CXFA 2OU2A 1R1TA 4IJAA 2IP2A 2IW5A 2XVCA 4OINF 2Q0OA 5K5OA 4BH9A 3RJPA 3RI4A 3CUOA 3WTWC 3GFIA 1J7KA 3I58A 5DV5A 3V4GA 3KE2A 1S8NA 3ABTA 3U9GA 2BV6A 2NRAC 1TQIA 5FB2A 3R4KA 3SZPA 4MTDA 2ESHA 3OV8A 2IPQX 4OU0A 4YG2F 1I1SA 4M6YA 5H6RA 4CYDA 3GWZA 3WGHA 3T5XA 4PGHA 3CLOA 1OPCA 3HSFA 1K79A 2D2WA 3DV8A 3CTAA 2QYOA 3ROUA 1AWCA 3PQJA 1DPRA 3BPXA 1NHAA 1JGSA 1USTA 1Z9CA 4I01A 3LA3A 4A6DA 1IF1A 1YTYA 2GIVA 1UHWA 1R1UA 3LQQA 4FT8A 3HUGA 2CSOA 2AS5F 4LG0B 4CO8A 4KDPA 1R22A 2CW0F 2OZ6A 2E7XA 2K02A 3G3ZA 3FM5A 3DPLC 4NB5A 2Y75A 3GUDA 4HDUA 5K5QA 3DEUA 3I0TA 5HS8A 5AIPA 3Q9VA 4I02A 4CICA 4Q4ZF 1YW7A 4IVNA 3L00A 2VE9A 1MJAA 3FMQA 2DTRA 3M8FA 2DW4A 1S29A 2QZ8A 1B6AA 3I64A 4A5MA 3K1MA 4LLNA 4M73A 3J80Z 5FLXZ 2WC2A 4KFCA 1LDDA 3RIRA 1XGSA 3RPQA 1BM9A 2Y0MA 4EM2A 1TBXA 4AVPA 4MHGA 3WTSC 3COAC 1U78A 3C1DA 4UUVA 4QWQA 2XAGA 5D5WB 3K69A 2A68F 3F21A 2IJLA 4UV8A 5FD5A 2FEZA 2A61A 3Q5FA 2RVCA 3NRVA 3QRFF 1YS7A 1YIOA 2RDPA 4ASNA 3CUQA 2L4AA 4EJVA 2QBYB 2JSCA 5K1YA 4AIKA 4ZH4F 4WCGA 4ENNA 1U6GA 4RS8A 5ED4A 3BROA 3HRMA 3SQNA 2O61A 3H3ZA 2V1XA 3D0SA 1R5GA 5DD4A 1KQ0A 2FF4A 1FOKA 2W84A 2P5LC 3JSOA 2ZJ2A 1XB4A 4HAMA 2NNNA 4QLCU 4ENJA 3LFKA 4L18B 2WTEA 3P9IA 2W25A 1LJ9A 1J2XA 3RYRA 3K1PA 1J75A 2JPCA 5FO5A 4ESBA 3J81K 3LQRA 3GZ6A 2XAJA 2VONA 2XIGA 2VE8A 2GZWA 1OYWA 1IW7F 3HSEA 2WV0A 3GLXA 2EJRA 4M6XA 1YFHA 1ZG5A 1K6OA 1U5TA 2GQQA 3E5XA 1R5HA 1UFMA 4P5OA 2RN7A 1O3SA 3HHHA 4HF1A 2YX7A 2ZCWA 1XGNA 1TLHB 5K5RA 1XMAA 5LRSA 5ILVA 2K4BA 1IAWA 1KU2A 3HRUA 1W4MA 4CZZA 2Z33A 4HLXA 1RUNA 2DK8A 2RNJA 1FBUA 4I2OA 3P9KA 5CLSA 2M45A 3WG9A 2JRTA 2LKPA 1IXSB 1SD4A 4IRHA 1OYYA 1LEAA 2DQRA 1R1VA 3M7GA 2FMYA 1P4AA 5AIQA 4A0XA 1ZAOA 4EM1A 4M9SA 1EV7A 2K7LA 3KLNA 1P4XA 2DO7A 3S2WA 3RTRA 1W7PA 3DF8A 3TO6A 1ZG1A 4IHTA 3VFZA 1XMKA 4E70A 4Y15A 2ESNA 3DXJF 4G94A 2BBYA 2ZMEB 1QO0D 2J5OA 5L3CA 4O6JA 1BN5A 1ZLJA 4L5JA 5HDNA 4MNUA 1S7AA 2W85A 4AIHA 4A12A 1LVAA 3KZYA 4OIRF 4RAZA 2Z5UA 4K2EA 2QVOA 2STWA 4JK1X 1IN5A 1BI0A 1TNTA 4KN4X 5LEJA 2P4WA 2QQAA 4OMYA 1ZH5A 2XAFA 3KP7A 3SFZA 4PDKA 3V7CA 4RB1A 4P9UA 2F5CA 3P7NA 2VT2A 4WXCA 2KRFA 1Z6TA 3ZQ7A 3HIFA 1SMTA 2K4JA 1LEBA 3GW2A 3F23A 2ETHA 1T0FA 1G4DA 2XASA 1P92A 2ELHA 2EV0A 4A6EA 1VTNC 5CVUA 3C3WA 5DYMA 4HA8A 3E5UA 1UCRA 2YX4A 2XAHA 2VC1A 4RAYA 2Z9OA 2M30A 1KU7A 1FYLA 3O2PE 5CYVA 4HLYA 2E1CA 2XGXA 4U7BA 2LSOA 4UVAA 2FU4A 2ZO4A 3TOBA 4HF0A 2HR3A 3I59B 5HLIA 4S05A 2PFBA 4JBAA 4S04A 2OA4A 1O3RA 3CUQC 4Z2YA 1C0WA 3WGGA 1ZN2A 4BAYA 2FRHA 4KUMA 2G7UA 2FBKA 1R7JA 5IT9K 1G3WA 1XSDA 1S6LA 4BHCA 4BXUA 4XLPF 4FX4A 4HV6A 3QU6A 4LK1F 2V79A 2FOKA 2P6TA 4OOIA 1K7AA 2MLKA 2EFPA 3KP3A 4KMFA 5CVVA 1YQAA 1YO5C 4NQWA 3DPTA 4L0YB 1T6SA 2R7FA 2RGVA 4EM0B 1KQ9A 4DNCA 3E6DA 5BQTA 1F4KA 1G3YA 1ZLKA 3GEZA 4GYIA 3DKWA 3T8RA 1Y0UA 3MQ0A 2H6CA 1H9GA 5HS7A 5JVTA 1R58A 4ESFA 1PP8F 1K78A 1ZYRF 1I1GA 4HQEA 4I98B 2A6EF 4L9TA 1F9NA 3T0YA 2K27A 5LGNA 3BZ6A 3ECHA 2CO5A 4ZYHA 3QPTA 3WTUC 2H6BA 3FZVA 3WE3A 2PBIA 1P4WA 1U8RA 2MD5A 2XAQA 2QLZA 4HX7A 2D1VA 1TQMA 4OMZA 2JT1A 4F7ZA 2IRFG 3F8MA 3SZTA 3IHUA 3V7RA 2AXLA 5DCMA 5A2QK 2RV8A 1Z05A 2HQNA 2CYYA 4HOBA 3T8TA 2OZUA 3FMRA 3JTHA 3R6SA 3TO7A 3KEOA 2OQGA 5D5XB 2PN6A 2HDCA 2ISYA 3C18A 1XGMA 2KIFA 3W6KB 4O5VA 2X4HA 3KP5A 4M72A 3ZMTA 1OKRA 2EV6A 1ZHFA 3NQOA 4KT5C 2DLLA 2PMHA 3GYHX 4IRIA 1FBSA 2JTVA 4YIIA 4D0PA 2ZFWA 3FHZA 4IRGA 4A2UA 1F1ZA 1UB9A 3U1DA 1ZRCA 3DFGA 4WX9A 3CUQB 4UVCA 3KP6A 1XGOA 2KJCA 1YW9A 1HKSA 3MWMA 5BPIA 4U7DA 3TQNA 4JQFA 5DCFA 2MH9A 5D8LB 3SXYA 2EK5A 2R3SA 3QU3A 3ECOA 3FF5A 3F8NA 4LB5A 5D6FA 1BBYA 2HTJA 1H9TA 3JSPA 1IRFA 2ACJA 1IXCA 3J81Z 5ICGA 1GVJA 3MEXA 1OR7A 3I4PA 1PDNC 1B1BA 2A69F 2DFIA 1DUXC 3BWGA 5LGUA 2G9WA 5E18F 2NNYA 1U5TB 3VOEA 1O7FA 5LHGA 2HOEA 5ICFA 1G6NA 2PQ8A 4G7OF 3E3VA 1IRGA 4FX0A 3VODA 5D5UB 4KNYA 2VBWA 2M1BA 2STTA 5F1RA 5BOXA 3HTUA 3REOA 3FXRA 3KFWX 4U88A 3L09A 2YSRA 3GFJA 1Z6RA 3KP4A 3R60A 3RDIA 2QQ9A 3RKXA 4G8XA 3GXOA 1HXDA 5J8CA 4RGUA 1YLFA 2OD5A 2MC3A 4LB6B 3K9TA 2C6YA 3HSRA 4UHTA 2FMLA 5L3BA 2UXXA 3ZPLA 3BY6A 2HKXA 1HKTA 4HF2A 1W7PB 5HLGA 1IN8A 3E6MA 2QM3A 3J80K 2JZYA 5FLXK 1HW2A 3CO6C 3ERED 3C7JA 1LQ1A 3FMSA 3J7AO 2LNBA 2D45A 1MD0A 2EA2A 5ILUA 4G9YA 2P7VB 2A6HF 3W6JB 3M8EA 2VODA 4IF4A 5J8FA 4YIFA 2GA2A 1ONVA 3TDUC 4MQVA 2FSWA 4EGYA 1ZARA 4RB0A 3QAHA 5F6FA 5LHHA 4CHUA 4EV0A 5DUKA 2NYXA 3FXQA 2ZKZA 1I5ZA 1QBJA 1RNLA 2L01A 2YPRA 1IN6A 3HRSA 1KU9A 3QOPA 2BYVE 1TTYA 3BJAA 1B4AA 1HKQA 1WSUA 3KLOA 4EQQA 3GFLA 3MZYA 4XRFA 3TO9A 3ULQB 4I0AA 3N4MA 4AD9A 3R0AA 2R7DA 1ODDA 4LLLA 2XV4S 3IC7A 2QENA 3WODF 2EFQA 3JAMK 4IXAA 1X3UA 1T39A 1QPMA 4YFXF 4KYWA 1O3TA 4WWCA 3MAJA 5D4SA 3HOSA 3K2ZA 4TV7A 5BS6A 1DP7P 2FQ3A 5L3FA 2L3DA 2PJPA 1ON1A 5H6QA 2DPUA 3LA2A 3OOPA 3MCZA 2XRNA 3VB2A 3B73A 3DQVC 4Q47A 2E7WA 5DD8A 3JW4A 4ZYDA 1WQ2A 4LLGF 5IT9Z 4RGSA 3GZ5A 1STZA 4UXNA 1ZRFA 4ENKA 2K86A 2BEOA 1SFXA 3EQLF 2O8XA 1LDKB 1CF7A 3BJ6A 1REPC 1IZ1A 4MTEA 1R23A 4XBFA 5HS9A 2CFXA 4HW0A 3V8JA 5DDGA 2OBPA 3EDPA 3TGNA 3QPHA 5D8KB 2KIUA 4G6QA 5LBQA 3N97A 4OIPF 1U3EM 1Z91A 3KEQA 3H3UA 2VC0A 1YW8A 1JE8A 4G6DA 3IRQA 1FNNA 1KU3A 5LLQA 1B9NA 2O03A 3WTVC 2HTSA 2BE5F 3WU1B 2EB7A 2KJBA 3WU0A 2FE3A 3K1NA 3L7WA 1B59A 3BJOA 3EYIA 1G3TA 1K78B 1V4RA 2F5EA 3SHFA 2J5PA 4IPAA 4OIQF 5ERIA 4ZZDA 4O3MA 2CQKA 1QZZA 2UWMA 1IUYA 2A5YB 3M9AA 2O6GE 1KYZA 2PI0A 1UHMA 4AIJA 1W7PD 1P6RA 4ETSA 4LD5A 4L0ZB 2M8EA 3ZMVA 2F5DA 1CGPA 1YG2A 1SAXA 2IT0A 1DPUA 1USSA 3T1BA 1BJAA 5E1ZB 1GXQA 5E8GA 5ICCA 2M5WA 1T98A 1SFUA 2FXAA 2FNPA 1OMIA 3F6VA 4M9ZA 5FGMA 1HBXG 3BDDA 3F8CA 3KCCA 1RI7A 5DCMB 5HDGA 1IN7A 1J59A 3EETA 1WI9A 2DBBA 4CDGA 4L9JA 1Z7UA 4L5IA 4P55A 2ZXJA 1XDUA 3V8LA 3F6OA 3ML6A 2X0LA 3TOAA 2GXBA 1V3FA 5KK1A 2EFWA 3CO7C 4KIGA 5DEQA 3Q9SA 4A0ZA 1W5SA 4G7HF 1KYWA 4LJZF 1MDMA 3KETA 3VEPA 4BHBA 3M1EA 3IKTA 2XUBA 1P2FA 3L9FA 5BPDA 1OYIA 3GO5A 4DQ2A 1XD7A 4LGWA 1I6XA 2W57A 4GCVA 1U2WA 5EEHA 3WTYC 2L02A 3P9CA 1J9IA 4CGZA 2L4MA 2HS5A 1E17A 1JXSA 1MKMA 1LB2A 1SD7A 2EFOA 2EV5A 5L3EA 4EJUA 3AAFA 3U2RA 1XN7A 4NHJA 5E1XA 5BMZA 3R61A 3I71A 2ADUA 3V8KA 2VXZA 1QQIA 2V6CA 4BQAA 2HGCA 4GO1A 5HOOA 2UZKA 1JHFA 1XSVA 1T38A 5LEKA 4YFKF 2V1DA 3HYIA 4UVBA 1XCBA 1SD5A 3WTZA 3KZZA 3G73A 2QWWA 3EYYA 4KICA 4P96A 5LHIA 1LNWA 1EH7A 1S7OA 4N9HA 4AWXB 3RPUA 4A5NA 1J0RA 1D8KA 3KP2A 1BIAA 2HFHA 4B09A 1ZREA 2PMUA 1FYKA 4U0YA 2HKOA 4HQMA 1FLIA 5AONA 1BC8C 1KQ8A 5TJJA 4Y13A 4FHTA 4BYYA 1BOAA 4LMYA 5E17F 1FZPB 1S3JA 2DAOA 5HDKA 4I09A 2VBXA 2P7CB 4WXHA 4B8XA 2XKPA 5HLHA 2IA0A 4EGZA 4A0YA 1W5TA 4R1HA 1BI2A 5E1WA 1R00A 6PAXA 5CVRA 2COMA 1BI1A 1XDSA 4Q48A 4GXOA 1G3SA 2NS0A 3K0LA 3F22A 4RGXA 4KMUX 1HQCA 5CVJA 4IHSA 2MH2A 2ISZA 4ZYEA 3FXUA 1ZRDA 4LG0A 2O3FA 3I53A 4Q5SF 3TDZC 1F5TA 3DP7A 5D6EA 3I5UA 2NAZA 1T2KA 1HW1A 5EEGA 1SMYF 2DU9A 2W24A 3E5QA 3V7SA 4HDVA 5ILSA 1KA8A 4MQ9F 5TRDA 4U0WA 4EVIA 4RB2C 2YU3A 3EUHA 5FFXA 4UV9A 4ZZLA 1FYMA 2PLYA 5CVIA 4ON0A 1PP7U 4R79A 2XROA 2B0LA 2LF7A 1EH8A 2RC4A 3GVAA 2FBIA 2P6SA 1QZYA 3PFIA 1GHCA 2EFNA 1YYVA 1MZBA 2Q8KA 2QUFA 3IWFA 4G7ZF 4ENMA 1BI3A 2FBHA 5E20A 4EJWA 1IN4A 2ZBKA 4WXDA 3QP6A 2H09A 3JAMZ 1XCVA 3LAPA 2JPBA 1ON2A 1ZGJA 1WRJA 5JHUA 2XHKA 1LDJA 2CGPA 2LF8A 1ZG3A 3CDHA 4RB3C 4LFUA 4EJTA 4P9FA 2QBYA 2MA3A
chains in the Genus database with same CATH superfamily
1ZK2A 4M1TA 4AF7A 2C1XA 1K8ZB 2ZQ5A 3HUFA 1RC8A 4RKYA 1AUQA 4RHFA 1JQLB 2WOJA 4BHPA 1KDYA 3FWZA 1KVQA 2FPUA 3VV3A 5ICEA 3EWAA 2NLOA 4PCQA 2I54A 3JQ8A 4LXIA 2JANA 5YASA 5DYYA 4G97A 3I1JA 2DDBA 3EF1A 3K4LA 4GP7A 3A9WA 3MC1A 2VT7A 3NWOA 4DG5A 1U7TA 4QGBA 4C7OA 1U02A 1E2XA 3BE4A 3WKCA 3LP8A 1IZZA 3H7AA 2IYOA 4R84A 2XOKD 5FFZA 3I9V1 1KA9H 1RC0A 3EA4A 2I10A 2A9QA 1ULYA 2BFEB 5GVRA 1P9WA 4QXPA 4IS2A 2OQRA 3GCZA 4LDQA 1XP5A 4ZZ0A 1PV1A 4PX5A 5CTAA 5AUQA 3L7OA 3RO7A 4JEIA 3L82B 4NSNA 4YS6A 5TQ2A 4MRVA 3QEKA 1RR7A 1OSNA 3F46A 4EM6A 2O7SA 1PJ4A 2VDJA 1M8GA 5DBEX 3KKNA 1HSJA 4A03A 2IS6A 4Z9XA 1S9HA 1XZFA 4I19A 1ZW1A 3PNOA 4YTEA 1KI6A 1JKJA 3O2QB 4L9VA 4WKOA 3PR2B 3PWTA 3OWTA 3OF5A 1K4YA 3QLUA 2YUTA 2F1HA 1PYGA 5CUQA 2OCLA 4ZO8A 1A9XB 5FQNA 4CTNA 8LDHA 4L0CA 3LPMA 3O6BB 1TWAJ 2MYNA 4PS1A 4IJMA 3VFDA 1H42A 1VZ2A 2FCRA 4TWAA 2FUCA 5IG2A 5FLMJ 4D9GA 3C3YA 2W00A 2WF6A 4PWYA 1IUFA 1FLVA 1FPQA 1Q1VA 1QNTA 1XA0A 3DNPA 1LDEA 5JFOA 4TQGA 4PGGA 3UKOA 1NI4B 1T2CA 4DQ0A 1EFUA 2VQHA 4Q9AA 1IHOA 2DR3A 4H3SA 5DSXA 4RVCA 2QAJA 1T8PA 2R5YB 3PHJA 5LMZA 4XLZA 4B9EA 1II0A 2OFOA 3TVTA 2WU1A 3JVDA 2XPVA 4BFYA 1U3WA 4R31A 4MUGA 2EKPA 1ZH0A 5KVRA 2OORA 1C7QA 1PR4A 1GL9B 4ZAGA 3OE7A 1MJ9A 4MVJA 3HZRA 5AW3A 5A4AA 1HE5A 3TLGA 2VJBA 4ED9A 3HDJA 4P7GA 2FAXA 2VCEA 1J5XA 2GZ2A 4BY9E 5T6MA 1IC6A 3FFTA 3RAFC 1NRJB 4CIAA 3CX7A 3JRBA 2DYSH 5E6UB 4EZBA 3BXPA 1CXZA 3BWMA 1DG1G 3LCCA 1V8DA 2C2BA 4KODA 2X3UA 4FFWA 5LLTA 1GPKA 1I2AA 2GLXA 1SZDA 3D43A 4IICA 1H0MA 2NSJA 2ZCVA 1Y1PA 1NY5A 2ODTX 2E0IA 2VHYA 5TGDA 4L7QA 1ACIA 1NSFA 2AHRA 3QLJA 1Y1WJ 3E0JB 3FR7A 1Z7EA 2MLGA 4Z0NA 1U1IA 4Y2XA 3TSOA 3H1TA 1PZNA 5DT9A 1TU3A 4P7BA 3A11A 5FPPA 3E22B 4Q6BA 2LREA 1LS6A 3G9ZA 1S8NA 1JUMA 4JUCA 1X19A 1R66A 2WIFA 4IUBS 4N6GA 4CKBA 2JFWA 4MEAA 3SZPA 4DYDA 4Q01A 1RPJA 1MVOA 1LRLA 4C4TA 4IG4A 4OU0A 4A0FA 3FBWA 3IBTA 4FASD 3KWFA 3TP0A 2CEAA 1TT5A 3JYOA 3IQZA 4WKBA 1Z0FA 5A5EA 1CUBA 4XM3A 4F2GA 2CFTA 3RIMA 3STTA 1DPRA 1SCUA 1H2WA 1NIPA 3WRXA 3CLRD 5JNWA 1XTRA 4MP8A 3D6UA 1OUMA 3TNFA 2J31A 4XARA 1PTJC 4D1QA 4EB3A 1M5TA 1U1CA 2RG7A 4CNBA 2DTDA 4BY1J 3WL3A 3IAM1 2P2NA 5IAGA 2A6PA 3CO5A 3FI0A 1N5KA 2IHBA 3V46A 5JYEA 2RBKA 2QORA 5SYAA 2VYVA 1OZGA 2K02A 2H16A 2P5SA 3AETA 2YWHA 3EXHA 4FGKA 3HZHA 2G71A 1WW3A 2G9UA 1QCZA 1JIXA 1RWQA 5AIPA 1R3DA 4WBXC 4KO4S 4I02A 2CZCA 1Z2EA 1EWKA 2W5UA 2GPSA 3HVUA 4H4KC 1U3TA 2IITA 5EKUA 3K1MA 3N8KA 3SJAA 2HF7A 3HY3A 1UBSB 2HMSA 4DV6B 4JSYA 1LDDA 4OLHA 3UIEA 2XB5A 1ATZA 3C1DA 4R81A 1ACMA 3ADOA 3AJAA 4IEJA 2WY8Q 2FQ4A 5J3JA 3H6HA 1L4KA 3GPIA 2B82A 3M6LA 3L2UA 3O8OA 3EYAA 3QRFF 2VTEA 5KTTA 1EAYA 1FNDA 2QKLB 3RABA 1JIJA 1KYTA 2CDNA 2LY9A 3LUPA 1JPNA 3TTSA 3HBFA 2X0NA 4O0LA 1YIJI 4YVFA 4EOGA 1GFSA 3SP1A 2NU9A 4MNTA 4H7DA 2DFDA 3MWGA 4OU5A 2HXOA 1XQWA 3EC7A 2K7FA 5ITWA 1G7CA 2O0MA 3K2AA 2GJKA 2FPSA 1P7VA 2GN4A 4L51A 1B16A 1BGXT 1RKUA 2PR7A 2P2DA 3K1PA 3QPVA 3PIRA 1K4SA 1Z4LA 3CT4A 1ZZGA 1RRMA 1FX0B 5T3YA 3HKBB 3ZGYA 3RS3A 5JEEA 3S70A 1MH4A 4RHCA 2B30A 1ZG5A 5K09A 1KDTA 1K6OA 2W82A 1NN0A 3A4YA 4BNJA 2DQYA 1O3SA 4IKOA 4Y30A 1EG2A 5EINA 3SMQA 3OFND 3TCNA 2LP0A 3OYHA 2ZUWA 3R4CA 1RWNA 3BRWD 3ZUPA 2B7LA 3DOJA 1F0YA 4F8EA 1EK6A 1IQ0A 2PWPA 1Z6QA 1FBUA 1O97C 2PKXA 4QLAA 1HC8A 1ZRSA 4RJKA 3NRCA 1MO6A 1FLAA 5IXSA 4NCAA 2GTPA 3GZ4A 2AKYA 3WNVA 3PWSA 3QVJA 4FZ5A 2JDIA 4EM1A 4NZMA 1IDZA 1M67A 3DFZA 1IPEA 1U2DA 4S1VA 4F84A 1DC4A 2Z04A 1DWPA 2C2WA 2O1EA 2ODNA 3DF8A 1OE0A 3UA3A 2H2IA 1ZR2A 4Y15A 4OTZA 1G16A 5J58A 3OTIA 4XGRA 2ZMEB 4UAJA 3FHTA 3ZRGA 3VMFA 2WWGA 5JCZA 1BN5A 4IAOA 4Z9YA 2BZ1A 1N0IA 4MNUA 4EUFA 3W90A 5FRNA 4EPTA 3ZDCA 1Y42X 2L19A 1E2QA 3OS0A 1NBAA 3OZCA 3X2EA 2RH4A 2W8ZA 5JIBA 1W19A 2CVOA 4WD3A 3KP7A 1SBZA 3V7CA 3V9AA 1HTWA 3O47A 5IP5A 1L8OA 2Z9CA 1EVKA 1KIMA 3KP1A 1QH9A 2ZDQA 3CHYA 2NWQA 2WJZB 4DDHA 6CHYA 4IW3B 4GRDA 4O8CA 2P67A 2V3WA 1ILEA 3N0XA 1JXAA 3GLHE 2ZJ3A 3LYLA 3T4EA 2H31A 1TM5E 2DOKA 4AN0A 3SLGA 1K5DA 2NPIA 3DB1A 5CVUA 2ZI6A 1D1PA 3R20A 5AWFC 3PI7A 1OFUA 2WIBA 5HR5A 4MRPA 1K4KA 1HE3A 3FBTA 4RAYA 1N0VC 5EE5B 4EDHA 4TM7A 4GVLA 3K35A 3FXJA 3NC1C 1JAZA 3AHFA 2R7XA 1C0IA 4M0PA 5AH0A 2CF5A 2PT6A 5ALXA 3QNMA 4RVNA 4R8KA 2ZULA 1CW2B 3PPIA 4FYMA 9LDBA 3UK2A 1VQNI 4JC4A 1GU7A 2OBLA 3ZV4A 1P7WA 4IUCS 1XRMA 1O54A 1DVRA 2ETVA 2V79A 3RKQA 5JROA 4HEQA 1GVDA 3L7LA 5EIFA 1P5RA 3I3SR 1YASA 3K6SA 2C54A 2EFPA 4YP1A 1RE0A 5JW6A 3RSHA 4Y9UA 3TD9A 4UCWA 5IOZA 4YX9A 1U0FA 2P79A 1KQ9A 2PTGA 1DTWB 1WVRA 4UULA 5BQTA 4M2LA 2HPAA 3CWQA 4JA0A 2JAPA 5CAEA 3IEIA 1EK1A 1L7EA 2RK4A 3I9FA 4IIVA 3STUA 2DHEA 3DOCA 2XVXA 1Y5LA 1R0LA 2NYAA 2K27A 4OY3A 3DUFB 3RSQA 4MGIR 3AL0B 1Y1TA 1ZK4A 5A6SB 2GDJA 2GOMA 1H94A 5DM0A 1O4WA 3FDJA 1OAAA 4OQPA 3AERB 1XMSA 2GFHA 2R5NA 4DLRA 2OYSA 4GYKA 2QMUA 1ORIA 3B8EA 3VO9A 2M2IA 3BWEA 1DDIA 5L3QA 2AFIB 3ZI4A 3B52X 2JLBA 2VPWA 4IH4A 2J30A 4G56A 3T8TA 1Q5PA 4DR1B 1ANKA 5KJ6A 1A4XA 3CDLA 2PJRB 3KBOA 3C18A 2Z6AA 5ECWA 3GCGA 4BU2A 1UODA 1FBTA 1PWXA 2K9NA 4UU0A 2WAYA 3QWHA 1NG6A 5BV7A 1FRFS 2X4HA 4ZA2A 2H1WA 3ZQLA 4FDLA 1OKRA 3HOXJ 1P0IA 4HSGA 4RA9A 3GD5A 3ZD7A 3IAFA 2PA3A 2PMHA 2EHDA 4CJXA 1OY1A 3WGVA 3L41A 4J1TC 2EAUA 4P3XA 4LG1A 4XW2A 3QFTA 2A5GA 4RGBA 1IM8A 4IH1A 3QTTA 1EBFA 2E35A 1BW5A 2CKDA 4REQB 4YRJA 1XGOA 4EW2A 4GI7A 1YW9A 1P45A 3WRYA 2Q29A 1JLKA 1YR6A 2XAAA 4W1QA 2MR5A 3CUVA 1I4EB 1IMJA 4EATA 1PT5A 1PL7A 2XB0X 3B6EA 2C29D 3ZHTA 1WUJS 2P77A 3WHCA 1HGXA 1RCTE 1BXRB 3M9WA 2ZE6A 2DMPA 2PS3A 4EJ2A 1NLZA 4E7OA 2HBQA 2H1IA 5JUWA 1DXHA 2WT8A 4BXXJ 3H3JA 5D1NA 3M6IA 4GDMA 1WDTA 2VPRA 4PIVA 1I3MA 4O2AF 3T7AA 1L5KA 4LNUB 2VRCD 3ZWXA 3WWOA 4IM7A 4L8LA 1SELA 4QPZA 1Z2OX 4D02A 2DWOA 2QR5A 1Z63A 5AJVB 4IXDA 3VZDA 2XKBA 3L7YA 1HXDA 2H51A 2XE7A 4EMTA 3DGEC 4X1IA 3TZQA 5DOVA 1Z4KA 1NXTA 2PV0A 4UHTA 1SCKA 1ETOA 1F8GA 2JHFA 3ZWWA 5HX7A 5FPQA 2HKXA 2YXEA 2ZKLA 3VU9A 5H2FC 4OHZA 5FLXK 3SC3A 4HC4A 1LQ1A 4DPMA 3DMDA 3V1NA 5KNDD 2L0KA 2XE6A 1J22A 2J0QA 3SDSA 3ZG6A 3JR3A 1IEQA 2QN7A 1XTVA 1THGA 1JJ7A 5JLJA 4NULA 4MQVA 4P54A 4J75A 2FVYA 5LQCA 3U3XA 4MS4A 4CKEB 4PJMA 4I1SA 3AZOA 2P9ZA 4I7EA 4RB0A 4I9FA 5DGHA 3EPLA 2WTAA 1E3WB 1DT3A 1G8XA 3QTBA 3LW7A 1I94B 1SBTA 5AJTA 3D7RA 3HKCA 3H7IA 1LBTA 4BCCA 5JD5A 2VDLB 3KT8A 3AVQA 4A3CJ 4ZO4A 4YMSA 3BB1A 2ES4A 2CUFA 3KLOA 1D6NA 1R9NA 3TEMA 5C51B 3DW3X 3B53X 4PXSA 3R0AA 2CFRA 5K0GA 1XNRB 1J39A 1H9AA 1PNTA 2QENA 3DLBA 4FK8A 2RGXA 4C5BA 3ZHSA 4IXAA 3A37A 2DC1A 1EVEA 2B9VA 2XEXA 3F96A 4WSOA 4HDSB 2HPVA 2NVOA 1EMDA 3KX2A 2EZTA 4JJKA 3CUUA 3HG7A 4PZYA 4BWFB 2G25A 1FJGB 4YCSA 5MN5A 1ISHA 4KYUA 2RAPA 5FQOA 1B1AA 3WXMA 4QYXA 4AYWA 2ZJ4A 4CCYA 5GP9A 3TW8B 1E7YA 2IXSA 5J59A 2PLWA 3PNSA 2XMDA 5IT9Z 4F5DA 3MMNA 3GZ5A 3TB6A 3K7AJ 3OQVA 3CC7I 5G0SA 1XVLA 3AW9A 4UNSA 1REPC 2HRCA 4HQKA 1SVSA 1TL8A 1P0PA 2GAOA 4EEZA 1GQRA 2QT1A 4F4JA 2BHZA 2D5CA 4C0BA 2Q1TA 3BZCA 1M75A 1GYPA 3FWHA 4RPHA 3NNNA 1ILWA 2FX5A 4HN2A 2ZIUB 4CTMA 3DEHA 5LP1A 3LSMA 3L4KA 4DIOA 3K1NA 5LNK6 2I29A 5BUSA 4O08A 5BSEA 1JJ8C 1DTEA 4M7WA 1IQUA 1KEPA 2CJJA 1T15A 4OXNA 3ZQUA 3T1HB 1ZNZA 4DLYA 2PZGA 1T5DX 4EB0A 4KTVE 3H0CA 1NZJA 3RJ5A 5JFGA 4UZEA 3SIXA 3WK8A 5J43A 2R1VA 3H9BA 1W29A 3MJSA 4L0ZB 4TWJA 4XWWA 2F5DA 2ORED 3YASA 2JD1A 1QVWA 4BUJA 2P91A 1WB6A 4ENUA 3EIQA 1HORA 2FZCA 4DDWA 4QYIB 4RH0A 1TJ3A 4BO9A 3NHMA 1KETA 5TMDA 4G5YA 3CX3A 2J07A 3QUAA 2Q2VA 4YAGA 1Q0PA 4GWLA 2D0DA 2IH4A 2DBBA 5C4JJ 4L9JA 3HCDA 5C4MA 1I3AA 1VQLI 2PM8A 1QH0A 3DVRX 1G2HA 4WOPA 3T15A 1EFLA 1JU4A 3TCXB 3A28A 4FD3A 4DNXA 2VPXA 1CHDA 1NW5A 3T0GA 3SXJA 4CW7A 2RC6A 2CWDA 5EXXA 1BJTA 3Q9SA 3GJ5A 2OA0A 1ZOIA 4KXQA 4IDOA 4PZLA 3CLQA 3OSZA 3DZJA 3OZGA 4QOGA 2QUJA 1YQWA 1HYBA 4FEAA 1QH1A 3L1PA 4PCLA 4DMCA 1OYIA 1NM5A 2M34A 2DYRH 4J9UE 4WDQA 3P1JA 4WGGA 1SCAA 5DBIA 4TS4A 3U7QA 4DNPA 1V48A 4YCJA 1BHJA 4EY6A 3P2EA 1KL7A 3S2IA 1USKA 1KQOA 2I2AA 1E7RA 3EWIA 4EA6A 4AJ1A 3JQBC 4R71A 1QB8A 2CE2X 3R8XA 3H99A 5HJ2A 2NXNB 1BD3A 2G5TA 3U4QB 2VLAA 3NWJA 1QQIA 2VDVE 3O3MB 2F1JA 4GO1A 1WSWA 4UTRA 2IYUA 1L4HA 2HN9A 3OY2A 3MTBA 3P27A 2BDEA 4P96A 1SWVA 4YRAA 4LF6B 1QGOA 4AWXB 3I92A 1F2VA 2ODQA 3L02A 2X4IA 4R2LA 2ZYGA 3GA0A 4JQYA 2JFUA 2O2HA 2C04A 1UBHS 3M5CA 1USUA 1KORA 1GUYA 3ENNA 3O7WA 1F2TA 2HKOA 2GYUA 5DS9A 3W77A 2BFOA 4ZCTA 2I3BA 3R3YA 5KWSA 5KQLA 3PO2J 3VU1A 4PXYA 2YTZA 4XYLA 3NOXA 1ZQ9A 1BOAA 4IJWA 2YNMA 3JWPA 4UM9D 1HMPA 3CJQA 4KRXA 1P3Y1 4XOIA 2VBXA 2GQ0A 2XXAA 4M3FA 1XMPA 4O4LB 2KLOA 4YC7A 4ZKEA 4FWIB 3SJBA 4N3GA 1W5TA 4R1HA 3TINA 1FXSA 4IGFA 3PXEA 4O2AB 5FH9A 2CSXA 2VAWA 2O5RA 4Q9NA 1DB3A 2AO9A 3U48A 5K0SA 3DE0X 1NHGA 4MP3A 4OMDA 4LG0A 1UK6A 4DBQA 2VXOA 1QTIA 1N6RA 3CLRC 3QOWA 1U5BA 5JDIC 2NAZA 4LY3A 4OHUA 1A8QA 1UT8A 3W3ZB 1KSJA 3R6WA 2I71A 1K7EB 3Q41A 2Z1MA 1T95A 3IV9A 2K40A 3OQJA 5BMVA 3BMCA 2HXYA 1N7IA 4WCFA 5CA0F 3VNBA 2IE8A 4M7RA 3QBDA 4HVCA 2PXXA 4MUEA 3EDYA 3E5MA 4ND8B 3AQIA 3RW9A 2PUBA 5CIQA 3WGOA 4J16A 3GBVA 2CC2A 2IH2A 1A7KA 1XCVA 1DXYA 5CRIA 1OYVA 3MUEA 4DBLE 1WRJA 3EXAA 1BWSA 3EUFA 1LDJA 1R0BA 1SEUA 1A4IA 2C4VA 4B7AA 3ZI7A 5AM1A 2WIAA 3D3QA 3OEYA 3S28A 4EI8A 1B0ZA 2HU7A 1E18A 5E0KB 1L0OC 2H8WA 1HDDC 1GFWA 3K6JA 4E1AA 1QCYA 5EZGA 3TXXA 3EJ6A 3CPHA 5CGZA 1B9MA 1FU4A 3CXRA 3TLAA 4ESOA 1JB1A 1YC2A 2P1RA 3E5NA 2B5WA 1FYVA 2OKCA 5AXDA 4IDDA 3Q5GA 3WFIA 4NF2A 4FYWA 3J7TA 4XI9A 5IVKA 2FZVA 1C1DA 3FPKA 4AJHA 4UBOA 1H4QA 4DBZA 5TQ0A 1GRQA 4YROA 1ZGAA 2IA2A 2BZ0A 1UOEA 3RSCA 4IKEA 1JDSA 5L53A 3WTTC 2BJWA 2HJWA 2OE2A 4FYHA 4LHSA 3ND9A 4UPDA 6REQA 4RZUA 1E2IA 2GWRA 4F0JA 4HX4A 3BTVA 1E1CB 3EPHA 1WJAA 5ICMA 1E4YA 1PGOA 5IN5A 3ZN0A 1UAGA 2Q46A 1E4VA 4EY7A 3A4MA 3NKFA 2C9CA 3BH6A 5DTIA 3RKWA 1Y89A 2JRCA 1WM1A 2ME0A 1ZO8A 2UVPA 3KPHA 5CX1A 2BFBA 2OOKA 4IOAF 4WNAA 1R4MA 1RIOH 2NUAA 2ZUVA 1A04A 2JF0A 1U28C 4CMJA 1I7NA 5GZ6A 1N5LA 4II2A 1JNXX 4Y6GB 5KYKA 3JQFA 3PQ4A 2FMKA 3SYRA 3HJFA 2OAZA 3K9WA 3MJEA 5J47A 4A0SA 1M2FA 3IVMA 4UUSB 5C8YF 3ZU5A 5L6LB 1NJ2A 2DMRA 3U56A 1LDNA 2JKYA 2HEOA 1YIDA 4ZJYA 5JMTA 4KRGA 4V2FA 1TCUA 121PA 3I1FA 4MUAA 1UK9A 3TTVA 4CTKA 1Z0DA 3OD5A 3R7SA 1PR2A 1NZFA 1BW9B 1YFLA 1JH9A 2ZSFA 2H63A 4FFRA 5F5XA 4HT3B 2XWSA 1OB2A 4NCIA 2GKOA 1LI4A 2OILA 4E5PA 3I2YX 3EHEA 4HX8A 3IQHX 4YPVA 2QTLA 5KNCD 4MEXF 4DY6A 5BPHA 2CL6X 4OI2A 1YGPA 3PUKA 4B3HA 3ZQCA 4FBGA 3LA7A 2QV0A 2ZSIA 2CHEA 2OM6A 4LTMA 3RSZA 3U09A 1X39A 2R7SA 1AK2A 4ZD6A 2AFHE 5FO1A 2VSXA 2VHUA 1WY5A 4JNCA 4UBNA 2NYVA 2PT7A 5EJ4A 5C9ZA 1RJ9A 4CG3A 4ZC3A 5ALOA 3IELA 3IH3A 3LPLA 2ZXIA 3BZUA 4MLPA 4FSDA 4DZJA 4LJKA 4LJYA 4QLBA 4G8BA 4M83A 1PFKA 4PM4A 2LDUA 1ZD1A 3B1KA 4RANA 5D5HA 2FUNB 2QVZX 4XSZF 3RSOA 4RZIA 3CLUD 2IA1A 2GOXB 1P4SA 2DBYA 3SEZA 1JU9A 2DHDA 2HW8A 4NBUA 5IS2A 3TE7A 3EGEA 1U5TC 4A10A 4QJ5A 3HNRA 1DCKA 2VZ9A 1ETVA 3LT5A 3FDZB 4R9VA 4BL5A 5DI3A 3QP5A 4JI6B 3D5LA 3JQ9C 5DW3A 1J7JA 4HGZA 4CMAA 2YHAA 3OY7A 4I2VA 2HLPA 2O8FA 4E7SA 2Z2KA 1TKRA 4NYIQ 4G0QA 4GHWA 4E14A 1M2HA 5HFAA 1QYIA 2F3UA 1RPWA 4BLPA 1JZTA 3OQHA 5G1NA 3D81A 3JTGA 3SYNA 2SCUA 5D3KA 4OINF 3ICPA 4GOKA 1NN1A 3JYHA 3BTJA 1JSRA 5IAEA 5IP7J 3GFIA 2Y1EA 3Q40A 4O3FA 1EUDA 4P36A 3EIHA 3KUKA 4XWTA 1XZNA 1VBFA 2CLMB 4I1OA 2Y1KA 5K3BA 3U9GA 5EMHA 4RMGA 1L5RA 1C9MA 1NPTO 3UVEA 1TQIA 4EPXA 4JBGA 3IIMA 2WTNA 2FF7A 2FG6C 4L4ZA 1NXWA 4X66B 3IUJA 5CH5A 2EIMH 5C1PA 3UKGA 4UUOA 1WZUA 1R0XA 1YAJA 4ETWA 4RM2A 1R3UA 3HDHA 4NDAA 4CQMB 1TYZA 3ENQA 4BLWA 4FT8A 5MN6A 3EEQA 1BJKA 2Q7XA 1CX9B 3LNTA 2AEFA 5U9CA 2OL4A 3MWDB 2XPCA 3UJPA 1I4OA 2WPDA 3B1XA 1FOXA 3K9GA 4MYCA 3MSXA 2A9FA 3GBSA 3VHXB 3T9CA 4BACA 2F3PA 3CUEF 3ZGOA 3DEAA 5BOVA 1BQ4A 3AMVA 1E63A 4W8OA 2VG8A 2EP8A 3V00A 2ZW9A 2BFWA 1ZGWA 4EPWA 2J9ZB 4L9SA 1CRPA 2PCJA 3THRA 3TZEA 1RKWA 3OURA 2HI3A 1T1RA 4Y2GA 5E3MA 4M73A 1DZ3A 1FFWA 5CU7A 2WHRA 4BX3A 3F7OA 5I51A 3RPQA 4MMZB 2I9KA 4KGXA 2DEUA 4ZKDA 2ZI5A 5IT4A 2ZIAA 3Q15C 4HD8A 1IHPA 2JATA 2DGDA 4Q4HB 2C3YA 4MVJE 4PRLA 2R8RA 4BRZA 2XAGA 2OBXA 1Q15A 2A68F 2E82A 2M3AA 2FPPA 1M6HA 3NAMA 2FPIA 2GHRA 4PICA 4CEIB 3VYRB 2RDPA 1DKRA 5EIBD 4TMVA 3EFOA 2QBYB 4RH1A 2Q28A 4ENRA 4A23A 3SYMA 5IKEA 3H5NA 4ZTFA 4MB6A 4ENNA 4N9WA 3H2SA 1D2MA 2K3PA 3OHPA 1W4LA 4PJJA 2V1XA 4MQ6A 3A1DA 4ZVKA 4JKOA 3W9BA 2HQBA 2Y0PA 4L8WB 2AJDA 2YJNA 2F8MA 2ZC2A 3P9IA 5E7IA 4Q7JB 3TLEA 4NQRA 4C2BA 1UC9A 2HA3A 3G23A 3COJA 3CIOA 3DZGA 2AZMA 1KEEA 1R0RE 4RDHA 1X4OA 1U7HA 1WCIA 3FPEA 4RDIA 4PRZA 2QNIA 1CY2A 3H11B 5KX5B 2GBYA 1SUWA 4QOSA 3GFRA 4BJHB 2QUKA 3GF4A 1UKYA 2QRQA 1P5ZB 1YJQA 3RRZA 3NCTA 2HPZA 2Z08A 2X41A 4P0PB 4UXJA 1A77A 3IDSA 4D25A 3SOZA 4UE3S 1OASA 1K1EA 2GBLC 2WNHA 5ALTA 4HVLA 3QG5A 3ZZTA 2OK7A 1UZCA 4A3FJ 3ZDFA 1BS2A 3QH4A 1SD4A 1YK1A 3L8DA 4CNQA 3ABZA 3B3AA 2G88A 4FOOA 3V4ZA 3MPUA 4LIUA 3KQPA 4OQLA 1UJ5A 3VKGA 3WAJA 4A0XA 2BKVA 5CYOA 4FJ1A 1CS0A 3WIBA 4L8FA 5JNTA 4BLTA 3O95A 1OWLA 2BP7A 1PF7E 4AKHA 1EPUA 2CUKA 4IHAA 2OV4A 3GJSA 2GRJA 2B2CA 1ZWLA 1OZ0A 2RJOA 3LHSA 1KRWA 3ZWKA 4NCJA 1GR0A 4LJLA 3THWB 3MINA 2BMWA 1OLUB 4MV9A 1ZN8A 4OMYA 3B7WA 1JG2A 3H3XA 1BFKA 3SFZA 1HDCA 4PDKA 3OIDA 1JJFA 1D1QA 3A58B 3WZ2A 3UHAA 3GG2A 1BE8A 1Z6TA 3NBZC 3RVKA 3V8PA 3HU3A 3V4VB 1GQQA 4KACA 4R2MA 3MCTA 2PQ2A 4XIFA 5TEWA 3GCXA 2J09A 3PCXA 1T0FA 4YLGA 4E31A 1ODIA 2DUUA 4FDAA 5I5GA 1FYDA 3L9WA 3NS7A 5C8DA 5EPOA 3DV9A 4AI6A 4GE0A 4HLUA 4YFYA 1NVTA 1XX6A 2QLNA 3HVRA 1I4DD 3FUWA 4BP3A 4NDLA 4BE2A 3FPHA 4KO8A 4JASB 4E94A 1FYFA 4ECAA 2MU1A 4DOZA 4HLYA 2AT1A 1ZIYA 1RIFA 3RS9A 4O33A 3INNA 3TOCA 3KYIB 4B3FX 2JH9A 1KDOA 1BCSB 1YCGA 3DE4X 3DBHA 5DTQA 2NYRA 4F04A 4YUAA 4UARA 3CBQA 2SHKA 2D06A 1MJGM 4PRYA 2Q21A 1ZN2A 1CUWA 2IS1A 2DSTA 4WOBA 4YAKA 4BTVA 5ETJA 4FE4A 4FI3F 3D1VA 3DA8A 5F27A 3WGNA 4TZKA 2HV8A 3AG3H 4Y2UA 4NZZA 3KPYA 2NTYC 1RWOA 1T4DA 1X7WB 4C3HJ 1QZEA 2PZLA 4DUGA 3UHOA 3B2EA 3PA6A 1W6RA 1Y82A 3S16J 2J08A 4ID3A 3E9DA 2XJ4A 1BXKA 4LHEA 3VU8A 1EHYA 1H8ED 5T41A 1XX5A 4I98B 1XMQB 3M33A 2AVNA 3UV7A 1VOTA 4AKEA 1OXMA 3WLFA 2C2ZA 5H1YA 3VTFA 1XF9A 4R9RA 5LUAA 2H6BA 2ZYIA 1DKLA 4BJTA 3HH8A 1M0SA 1MIOA 1DEXA 4BNDB 2P62A 2W93A 1T9GS 4MMXB 2QAGB 2PU7A 4TMKA 3S2HJ 2I5UA 1I5EA 1I4LD 2GCPA 2DFFA 3HYRA 2HQNA 2JRMA 1JQ5A 5IU6A 2OZUA 1R5ID 3HCOA 5ALQA 1AXRA 2W4SA 1UBJS 4PQYA 1NT4A 1GYQA 2PFGA 3ESAA 4MR9A 4GW3A 2UVDA 3UAWA 5FI0B 3LBHA 3MTIA 2AOUB 2VA8A 4ARCA 2JA8J 2AUMA 1XEFA 3L1JA 2IHZA 1Y6ZA 4YMLA 1FQKA 4NU6A 4AY5A 4DJAA 3UNGC 3EIXA 4HPWA 1EM8A 3MKZA 4ZFNA 2YUIA 3KAQA 1VE1A 4ZOEA 3CA8A 3P2KA 1R0CA 4JX8A 1EE9A 4U7DA 4GX1A 2WSIA 1D04A 3ICWA 4YONB 5KCZA 1LVUA 1P2TA 1X13A 3TP3A 3H36A 2Z6VA 1WUKS 5AUOB 1W6UA 2B8JA 1Y6RA 3GEMA 3H5RA 4K9SA 2HOQA 2RDMA 3WGZA 3ZX5A 2BVNA 3TGWA 1OR7A 5E4YA 4I5GA 1Z4QA 2JLRA 1ZESA 4EJSC 3JZAA 3USZA 3ROEA 2WMYA 1RQPA 3FMPB 5LGUA 2VAPA 1JFFA 1KTIA 1KDVA 3G89A 3WAGA 2V7EA 5JCXA 4N3CA 4N8DA 3KWLA 2PZ8A 3O8LA 1G6NA 1VQOI 5J1TB 2BFCA 1C1YA 3RG8A 2FZEA 3FSJX 3EW7A 4G0OA 4JL6A 4U88A 4ARIA 3H0DA 1X2NA 2OFPA 1G8AA 2XQIA 3GOQA 3DTVD 3IEXA 3CRVA 5BT8A 1C9KA 4Y9DA 1DKPA 1DQNA 2R84A 3LBNA 4UTNA 2GA8A 3NOVA 1VIMA 4X00A 2FP4A 2NQ8A 5DK6A 5HS4A 1LLFA 3GLUA 1Q0QA 4ZI7A 1T1JA 2C6YA 4ANFA 3OLVA 3R3VA 5JECA 1JFSA 4MGZR 3THXB 3DMFA 2YY7A 3RT7A 5LU8A 2FK8A 9GPBA 2B8TA 2IAIA 3E6MA 3MFYA 1IY8A 4E2XA 4HAXA 5KTKA 1B8NA 2QG9A 1YRQA 5IYZA 1IBRA 3E5RA 4YIFA 2FSWA 5K3DA 3Q3HA 1MQ9A 1ESCA 3S1AB 3GQBA 2K9QA 2W6MA 3WV4A 1E9SA 2ISSD 2OG2A 2Y1WA 2Q2WA 3W2EA 1IN6A 1VG9B 1ZJZA 3RLFA 1H0RA 5IY5H 2ERCA 4KCGA 4ER3A 2IT1A 3KHSA 5I8ZA 2WQ6A 2R7MA 3R6TA 3TO9A 1KU6A 1R4ZA 2A5FA 3WP0A 5FUQA 3G0IA 4OGFA 5L3VA 2B0JA 4H1TA 3BMNA 3M5PA 2Z8YM 1L7OA 1G3QA 4H1VA 4CIXA 2EFQA 4O2BA 3WL4A 4GPBA 1N6PA 4NYJR 1FDTA 1ZM4A 3U60B 1XHEA 4ENQA 1QYXA 4MTCA 3TG2A 3AC0A 2V7XA 1QBKC 1CTQA 2XKJE 1PQPA 3JX9A 2HT6A 3DE7X 4NE9A 3DQQA 1D1TA 3MNFA 2XCQA 1Q74A 3K3PA 4OLAA 1FTZA 2JI4A 4PC6A 4US0R 2BAGA 1MEEA 4LJ8A 3UM9A 4UU7A 3D4IA 3FYCA 1QRYA 4UHCA 3BT9A 2POQX 3O82A 1UOQA 1V4VA 2G7MC 1AQUA 4QQFA 2IW3A 1WKVA 3G1UA 3T1YB 1YX5A 3ZQGA 4IHYA 3IBSA 4BKOA 3OLQA 1NKSA 1CNMA 4MHOA 3PHCA 1Y3AA 3NEJA 2VKVA 4OIPF 4EY8A 3IRUA 1WDMA 3DMYA 1Z45A 1IXYA 2QP4A 5IK2D 1PJQA 4YJ3F 2E2WA 1FNNA 1UKEA 1WU7A 1Z8FA 1UFVA 4GECA 3DVAB 1N5DA 1X1DA 1TP4A 1ZC3A 4EP1A 1U0SY 3LAWA 1QAOA 1QHHB 3RRFA 4HDMA 1V5WA 2A9JA 5FWYA 2C9YA 5IJAA 1K75A 1YBVA 5IXYA 4I4LA 1RW4A 4TXHA 3RBVA 4LD5A 1SVMA 5C1BA 4M6VA 1HL3A 5H7XA 2P81A 4GR9A 5E1ZB 1YB5A 2H08A 4UXIA 3DDWA 2ZOSA 2EIJH 4NE7A 2QTTA 1HDGO 4IX9A 1ZR4A 1J90A 2EDAA 1OGIA 2ZAGA 1HBXG 3AY7A 3DONA 3F8CA 5B1YA 1DQUA 4R4JA 5BN5A 2O2DA 2LWIA 2EERA 3BR2A 2EW1A 3HKEB 4HQ6A 4HWSA 1T1GA 3SWWA 3FWNA 2JLSA 5IJ9B 3OZIA 1SZJG 1F14A 2C3PA 4P53A 1GTMA 2YFYA 4CBVA 1P7PA 1T8WA 5GIOE 3R9XB 3PR3A 3IOYA 3UPUA 4F5YA 4GWKA 3OPYA 1X1QA 1W5SA 4KK4A 4AX8A 4RFSB 2WY2D 2L42A 4NL4H 4DREA 1MDMA 4DR4B 5EFZA 1T0PA 5COAA 5JSZB 4PPNA 2QIPA 4LC9A 4UY8I 1RJWA 3USCS 1XLTC 3PUJA 4D26A 2XMPA 3CX6A 5HRUA 5J1RA 5KBYA 1IQPA 1XD7A 4LGWA 3HXKA 5KHOC 4GLOA 1U2WA 4NEQA 3BB4A 4EI7A 3T5MA 1MV5A 2HS5A 3CN7A 1S01A 4PG7A 3ADPA 3H3VK 2WF9A 1NXPA 3BTOA 4X6AJ 2GZRA 4B7XA 3M3DA 2W6PA 5JJIA 4RHXA 3IGFA 4EYOA 3A6JA 3DFIA 3BRSA 3F2IA 1U0NA 2VP0A 4Q3DA 3ZGLA 1FJ2A 5C4IA 3N2KB 1T38A 3CLUC 4PO1A 1XZQA 4JP1A 2HHCA 1FIAA 1Q0LA 3HUDA 1F0PA 1UPAA 3EYYA 1HEUA 2BFPA 4M3EA 3LOUA 1A8HA 1TF2A 1GCGA 3RC7A 4V0OA 3RHSA 3KKOA 1C2YA 1FLNA 1H0SA 4D6XA 2DPYA 2A86A 1NXOA 5IPAA 3LFUA 2LKDA 3NHLA 3C41J 1ML3A 1SHTX 2IPLA 2WP0A 1S3JA 1EEHA 2JJ7A 4BFLA 1Z47A 4DMLA 2Y1CA 4D8YA 2C5EA 2RMKA 2P2LA 1J0BA 2DDAA 1GNQA 5A5DA 1Q0SA 5SYMA 3TGPA 1Y4SA 2J46A 1UBNA 1GAXA 1FFAA 4G9EA 3BDAA 1FZQA 3R7WB 2I6TA 1XZGA 4QBKA 5AJYA 4RGXA 4H08A 3S2ZA 1TAHA 1P9QC 5CVJA 3Q6IA 4V1CA 2O3RA 1DC3A 2VJCA 3WDSA 3HCPA 4TKLA 3BE6A 3L7AA 4K05A 5K3SA 4O63O 3I5UA 1T2KA 5AJWA 3HO6A 1H4VB 1YJ9I 1IBKB 1NN5A 3ICQB 1TAUA 2VWQA 1W73A 2LY2A 4HDKB 1KA8A 4BQQA 2OR3A 4TSFD 5EJ5A 1S3FA 4EVIA 3GPLA 4ZYTA 1B72A 1TYDE 3G5UA 3ZZMA 2EJTA 4K40A 3CMYA 4L15A 4Z4CA 5B3JA 4XWOA 2E6KA 4AK9A 5U1PA 3F67A 2YJGA 1JT6A 2FEXA 1QOZA 4E13A 3O1HB 3ZDYB 2Q8PA 5ADUS 3L8MA 3A6FA 4MUKA 3AFHA 1VA5A 2OAQ1 3OFSA 3FW1A 4GLLA 1JWBB 1K63A 4BTEA 2QD3A 4TWBA 1IFXA 1Z0IA 3DLIA 3HZZA 5JSYA 2BKAA 4F9FA 3B5EA 1BXGB 1YACA 4BJ5A 1XG1A 3GRVA 3HNPA 3M5WA 3HL4A 1CY4A 3MWEA 3E9CA 4OVKA 4NC9A 1JR6A 1MO4A 1JG6A 4HO1X 4ND3A 4ES6A 1GQYA 3QOEA 3LD9A 1YMQA 2BI7A 1VRVA 1FT9A 5EIBC 4YV7A 5ILGA 4NZOA 1XVVA 5U4XA 2HOTA 2XNSA 1SXJD 1GXSA 3ETCA 5FTNA 1MJBA 1RDFA 5FUVA 3FYSA 5TGZA 4RMNA 3HOWJ 2H94A 5T4FA 1TIKA 5EUMA 3ASUA 4F4HA 3RUDA 4OQEA 1GZVA 2YN4A 3GB9A 3L2CA 2FPOA 3HXLA 4RBNA 3ESWB 3FGZA 1PNRA 2WY7Q 4R40A 4ZRDA 3MLBA 1LV7A 4PNHA 2PKEA 3NTLA 5DNEA 3OYJA 5AI5A 5F0CA 5J5VA 5MHTA 1C30B 1IE3A 2BE9A 5EZYA 2CB0A 5CCXA 3U4HA 3MGBA 4PX2A 3FYUA 3X1XA 3IKVA 2QVLA 3GF2A 5FLXA 1ZA2A 4UTOA 1RXVA 3FCXA 1JI3A 1NJ5A 4E7PA 4ZWNA 2MBFA 2KKOA 4W1UA 2RKBA 1JHUA 2HMAA 1PLJA 1P9LA 1YCHA 1XZJA 1DG3A 5KVVA 2NVYJ 5L3ZA 2ID6A 2WJHA 4YJ3B 3AONB 5INTA 5JQWA 1LPBB 4GKBA 2ZBEA 4G23A 4PIPA 4ZDOA 4UHEA 5KWJA 2WJVA 3X1ZA 4Y2HA 1FY7A 3ESCA 5IZCC 2CS3A 1UL1X 4BE1A 2A9RA 1K6EA 4PSUA 3D7KA 3CH4B 2W83A 3D3EA 1IG7A 4KDCA 3GZNB 4Y6LA 1TTTA 3KPWA 4J19A 4X1YA 3F8FA 4D5GA 4G0XA 1WF3A 3V34A 5HZHA 1ZU4A 1YI2I 3KLMX 1ISPA 2Z99A 5HQ3A 2WSLA 3HOUJ 3UMSA 2GM3A 4IRMA 3PUVA 1KP9A 1NVWQ 3OL4A 1HOXA 5J4YA 4G4IA 2VRWA 3IPXA 1RJFA 4A9AA 4RXMA 1FSHA 2CYBA 1D5VA 2XWPA 1LDMA 1GKKA 3AL2A 3S1LA 4EB8A 1ZBDA 1AV7A 2R5ZB 4WFQA 3VKWA 2RGBA 2KB0A 3FX3A 5F35A 2HVSA 2CUJA 4XJVA 3ETJA 1CZLA 2II6A 1AQJA 2Z43A 1Q12A 3NP7A 1X8LA 4YDSA 4FYVA 2G82A 3ZW9A 3OICA 1VQ7I 3UUWA 1M1NA 3CQ9A 1VA4A 2Q4TA 3KYDB 4HNSA 1FXUA 2BDUA 1Z8NA 1Z6YA 1U99A 2H1SA 3I59A 1TZBA 4N0MA 4H3VA 1X7ZA 3QY9A 2Y2UA 5DBFA 2BD0A 5C34B 3JWJA 1EXNA 2CHFA 1P8JA 2EX1A 1TW2A 2IGMA 1ECCA 2I03A 4DPKA 3AJDA 3OQNA 1GG8A 4OHYA 3VX3A 4JBLA 1JWLA 3OM1A 1C7JA 4K6FA 1NW3A 3AIOA 3AFNA 1G4HA 4JYCA 4N8EA 3FLAA 1UMQA 4ZCLA 3EQ7A 4FX2A 4OKSA 1ZN7A 4FIZA 1EAMA 4NLLA 5EC8A 2COBA 2V6MA 2EHJA 1FU7A 5KYUA 4ZZIA 2Y6VA 3CTAA 3QG1A 4TN1A 4MQEB 1IAQA 3N7TA 4S1NA 2OGSA 3BQNB 4G8CA 4HDNA 4KDRA 1UHWA 4PANA 1O3YA 4C3VA 3DEIA 2W42A 2BELA 3ZOZA 1Y4UA 1G20A 1SZPA 2JGKA 3CD6I 3RT1A 2MSLA 2W43A 1U7UA 4LVOA 2POCA 3VTKA 2ELJA 4XJTA 1PK9A 4LXUA 2HYJA 4WW0A 4WBNA 1RHRA 2J0VA 1TECE 4NB5A 3CY6A 3R7AA 3ECAA 4HKTA 4UHFA 4R2JA 4FR0A 3B5JA 3Q9VA 5JSQA 3H1BA 2B8EA 1IMOA 1U0TA 5JDCC 4XUGB 1MJAA 3N0WA 4RJIA 5TS2A 3FVTA 2DOAA 4A5MA 2DWQA 3DH0A 4YDQA 1AKHB 1PGJA 3HQ4O 5CG1A 3LUDA 3C39A 1TUIA 3RIRA 1EINA 5ESXA 1UXGA 1X7HA 4DEXA 1QPGA 1ZH2A 1JEAA 2ZBDA 1P0QA 4TQAA 2ZRIA 1U9CA 4PZ0A 2EBHX 1H2RS 1YF3A 2YIMA 1MC4A 4U7TB 5A9SA 2LW7A 3G5TA 3EXIA 4O4LF 3UW3A 2NUTA 1HDZA 4KGDA 2P9QA 4ASNA 2AX3A 3U1KA 2I8LA 3TAUA 1YO6A 3W6NA 5F3WB 1KEVA 3WBJA 2C2XA 2ZTLA 3L1VA 3B9PA 4LRTB 2R8ZA 3FXLA 2WAXA 1S02A 3S8MA 1N8KA 1F1JA 5JAPA 3K20A 2HA4A 2C78A 4FYXA 4A2QA 2W84A 3JSOA 2W6IA 4IILA 4TL7A 2Z4SA 3QXCA 3ZE6A 1F2UA 3A27A 5HMMA 5K3FB 1FSFA 2CL0X 3V3KA 4BV3A 4E51A 4B3AA 2HLDA 3GG9A 2HC9A 3GRYA 1JHRA 4D9HA 2OB1A 2LNDA 2XBMA 1ZEJA 5EI5A 4NC8A 4KFRA 2JLYA 3W2AA 1XUOA 4IMIB 4RABA 4NMHA 3C5WP 4D3XA 4DB4A 3TOVA 3HHHA 4HF1A 3DMTC 2XC7A 1MVNA 1V41E 1K7YA 3DDSA 4GXRA 5TY0A 4KWCA 3DW1X 4AECA 5IULC 3LXUX 1WG8A 1OOEA 4HEA1 1PJAA 3CG4A 4LGCA 4NPCA 3N70A 4YR7A 1ZH4A 3WYDA 2PZAA 3IHLA 3HWWA 1S2MA 4UAGA 3PIIA 1ORHA 4HQ0A 2RB4A 2VP4A 3JZDA 2WAMA 5I3ZA 4CF4A 2MW8A 1CRWG 1TKBA 2KQUA 4RKFA 4V02A 4I55A 4TTJA 4PCAA 1JALA 3OC6A 3U5ZB 3H19A 2F3TA 5IMSA 1ZTRA 1VL6A 4OAYA 5B1EA 2G1KA 2E2IJ 3U37A 1IY2A 3P5BA 3S2WA 1QG4A 1AGPA 1NBIA 4ARBA 3ID6C 1VKZA 2WDPA 4M98A 1QO0D 5E3NA 3L0DA 3LYAA 1MMNA 3OCYA 3NLLA 5AQ1A 1US8A 2W85A 2NQTA 1LSJA 1PTJA 3SXUA 2MG4A 1OA1A 5CFZA 3TTUA 4YUXA 4N6NA 4KN4X 1JDNA 3NALA 1OISA 3MGGA 2ACVA 2BR5A 2FHSA 2KRFA 2DE0X 3UOWA 1EZZA 1NOIA 3IUPA 3AV3A 5AVOA 2QMYA 1C3EA 2HK8A 2UYQA 3C14C 4YB8A 3F23A 3A1CA 3HMQA 3LGXA 1ECBA 4AURA 4HLCA 2HLHA 4MR8B 1D1CA 1C7ZA 2FWBA 4YV0A 1TM7E 3B8HA 2QRJA 4LRQA 2J9XB 2BGKA 2JFXA 2UUOA 1DG9A 4IVQA 3RV4A 3L06A 4G5RA 2ME6A 2MYTA 3IO5A 1E9RA 4HNHA 5KYXB 3HA3A 2LSOA 3W5UA 4GZMA 3G7NA 2C97A 4C43A 3QK7A 3QVKA 4EAQA 3VNUA 3LP5A 4U6SA 2X22A 4N5HX 2VF5X 1Z82A 3AVTA 2BEVB 4N1AA 1LU9A 5EIXA 3ZDEA 1HDEA 1KKMA 5ITZB 2OSVA 4GL4A 4LMAA 2JA5J 3MEQA 2B2NA 3ROPA 4BXUA 1RQ2A 3GEEA 3Q8MA 6GPBA 2FOLA 3AR3A 1EQAA 2YBEA 4NPAA 2P6TA 5BR8B 2C4TA 1BOBA 3CT6A 3BQ9A 5G02A 3ZDRA 1T4GA 3SQOA 4D74A 2KMLA 1X1AA 4N5LA 2QPLA 4M1QA 3GEIA 2RG1A 2BFFA 4EVRA 2VO1A 5BWCA 1GGJA 1VIAA 1G1AA 2J59A 4ABZA 4NG4A 4OP3A 2C61A 2KFDA 1U4OA 3FXKA 3EGVA 3DC2A 5B7GA 1OLTA 5KKAA 3LUFA 3MOSA 5LGNA 1I5OA 4KXMA 3BZ6A 3TI7A 2FMXA 3ZJVA 2JJ1D 2J4DA 4YECA 3C8MA 4D81A 3TIXB 2REBA 2NUBA 3IOEA 3Q85A 4KR2A 3FKIJ 4RY0A 1MTOA 3WXBA 4QSMA 1TVMA 2BUCA 4IV5A 4Z4HA 1TQMA 5LD2B 4KWIA 1KOFA 3D5SC 4NBTA 4DOMA 2QUAA 5JCJA 3E3AA 4BMNA 4DARA 4PZUA 2R8XA 3P8ZA 1Z0JA 2XYGA 1EZ4A 2FUG6 4UBKA 4IKPA 2ZUFA 3MJHA 2PXCA 1NZDA 1H8HA 2EBWA 4OUDA 5CDUA 5JATA 3HYNA 4D9BA 2RGAA 3A9UA 2ZFWA 3FHZA 4G1MB 4QDJA 1UB9A 3RBAA 4PW0A 3U1DA 4AWBA 2XIJA 3U9LA 3PDIB 3UANA 2UU9B 2IIPA 4MV3A 1FK8A 4EYKA 2JA6J 4GFBA 3TQNA 4QU0A 2B1JA 1CLEA 2EK5A 2BSQA 1Q2UA 4AVYA 3ECOA 1E7QA 1ENPA 4HCJA 3KE8A 1LLDA 4FQ5A 1BJZA 3QF4A 3I4PA 1UC4B 1IBSA 4DQUA 3NPMA 2NVXJ 4BZQA 4IHXA 2EW8A 3VX4A 3OWOA 4MQUA 3G9XA 4AJ9A 1NOJA 2XE8A 4PZ9A 1EP2B 4HL6A 5HHTA 3LDFA 1PGPA 2NNYA 1ITYA 1PJTA 2IA5A 4MS1B 4X7RA 4ZMBA 2CV1A 4GBMA 4OQQA 4RSMA 4OK3A 3PDUA 1ETQA 5FLVA 3TEJA 3TI9A 1NC1A 3F7TA 4IRUB 3F49S 3JYPA 3T3OA 2STTA 1LPMA 4XQGA 3V4PB 1UMBB 3AFGA 3PRYA 2CLCX 5F4ZA 5KYYB 3U13A 1LI7A 1JJVA 1XTIA 4LXHA 4X20A 2CDBA 4AQYB 4M89A 5AKJA 3I4NJ 4LB6B 1G8FA 3TX2A 1N5IA 3OFVA 3Q0UA 5CX4A 8MHTA 3R5FA 4XVHA 5BWOA 3ZPLA 4FHGA 1I7PA 1EDOA 2A35A 3EC1A 3QELB 2ZT8A 2BY2A 4AS1A 2Q4RA 1XWFA 5LL6P 2FFRA 1HW2A 3G8BA 3BSWA 4AULA 5A7FA 1EDZA 3STVA 4C9YA 5JS1A 3RCOA 3D9QX 1QA6A 2F17A 2YYYA 4RL4A 2WU8A 1FOYA 4UUBA 3JD4A 2XW6A 4EB6B 5LHHA 3LSGA 4EV0A 4BBSJ 3EJWA 4G1FA 4LXYA 3COWA 4Y67A 5EWJA 3K4QA 1TU0A 4J6FA 4J03A 1QO9A 4QZVA 5KX5F 2ZRPA 2C2HA 1TTYA 3FRIA 2W48A 3CPJB 3UWDA 1GGEA 1RYEA 1LVHA 1LE8B 4DZZA 4UVEA 3DYIA 4BDTA 4EQQA 3PC8A 4DVJA 3ETHA 1PVEA 1BDHA 5L40A 1TIPA 4EENA 2G4CA 2QQEA 1II8A 5KOJB 3LQKA 4DM3A 4UNRA 4RYDA 1AV6A 2BSAA 3HDVA 4BCDA 1T39A 2VKTA 2WIDA 2HDWA 1C14A 3O8HA 4DTIA 3W5AA 1B42A 1WCYA 3K2ZA 2CNWD 3G0GA 4J1TA 1MJHA 2PX0A 2YHSA 4V3BA 1U0BB 1YR2A 3L1IA 3S29A 1A9QA 4DCNA 1AS3A 2YWCA 2ZJOA 4ID9A 2G9RA 4ZPXA 3OCJA 3ER9A 3UK0A 1FSGA 1EJ9A 4IY1A 4CYCB 5HZGA 4OL0A 3TIIA 2I66A 2K86A 4CCJA 3KHKA 2ZAYA 5K01A 3JTEA 2VF2A 1IZ1A 1FS4A 5AI6A 3RDPA 3JQAA 1SXJC 2P9YA 3F78A 4G24A 2OCGA 2R48A 4RGQA 3ITDA 4HWKA 1HTBA 2G72A 3O4GA 4QC2A 1KJIA 3TD6A 2CJYA 2BMAA 1FLDA 2H1HA 4KNVA 2WLTA 3EQ6A 3MTJA 5AIAA 1L2TA 2X1CA 4FMCF 4EF5A 1F6WA 1LBIA 3KT0A 2P35A 1Q11A 2XWJI 3WMXA 4QEZA 2KJBA 1D1BA 2PWYA 1YTLA 4LYGA 1JE0A 3CRQA 2XZOA 4DHWA 3OYEA 2PMBA 1F20A 4ZZDA 1JL3A 1RMQA 4B74A 1IUYA 2A5YB 3W5CA 4HMOA 4KWEA 4YJGB 2SKCA 4F12A 2R5WA 4ZVOA 3JD1A 1YFKA 1GNLA 2JQ7A 2N9UA 1AZSC 1DPUA 1KIAA 1DBVO 3LUGA 1KVRA 4BGUA 5ICCA 2D59A 1M0EA 4E12A 4QU8A 2OHHA 3SEFA 4BFSA 3K0HA 4BO1A 3E9QA 3NIGB 2G6BA 1RI7A 1XWIA 5J2UA 4D97A 3NAQA 2G07A 3EETA 1NF2A 4DV2B 3NDJA 4QHYA 4TZ6A 3KQOA 5FI5A 3WK6A 3TOAA 4W82A 3A1SA 2O8EA 1ZD2P 3REQA 1CD5A 3G5MA 3RC9A 1YVDA 2VDWB 3N05A 1R4AA 4JI0B 3THOA 5M5YJ 3WYEA 4OLFA 1B8IA 4AT1A 5K0FA 5JU6A 5TIIA 4H9GA 4GCVA 1CJUC 2K7ZA 3F5MA 1PSWA 2F4MB 1U0GA 1BTOA 4FNOA 3KEFA 1QU2A 5F1JA 2EV5A 2ZI7A 3IPRA 4FUTA 7REQB 4JJ8A 5BMZA 2EU8A 4QGFA 2V9ZA 4WI1A 4RY2A 2J0UA 5LYJA 3R61A 1G59A 3NH6A 2AB0A 2VK1A 4CCLA 1PLKA 1XFAA 3KZNA 4X61A 2VTVA 2HZ7A 1CUEA 3F6YA 3M6FA 1VRCA 4UB6C 1ABEA 1E1QD 1LTHR 2D2XA 1ORDA 4BNWA 1X8JA 4O29A 4OMFG 3TSCA 3UT5B 1D6SA 4U3JA 2EL9A 4AQDA 1PUFB 3NYRA 5LHIA 1T56A 3ZY4A 1AQ6A 3ORHA 4Y4RA 3WIOA 4QBFA 3OVMA 2YZ2A 3IT2A 1Q0UA 3RK0A 4ITVA 2HJVA 1MGOA 1AF7A 4DRYA 4YHBA 3UT0A 3IJPA 1KQ8A 2ZAIA 4B83A 4F7DA 2GKSA 3TZ6A 4ARSA 1RAEA 4XASA 1D5CA 4KJXA 1U2SA 3EY9A 1IIRA 4LJ7A 1NP3A 1IJWC 1OIWA 4BVJA 2D0IA 4B8XA 3ZJ4A 3CN9A 4KI7A 4A0YA 2L17A 2VYFA 1X0XA 3I5MA 2V8OA 3CSDA 3H1FA 3VTZA 5FULA 6PAXA 1FQOA 2XOKA 4H16A 3KOXA 4HQRA 1E9VA 5FT9A 3NJ4A 4LOIA 3F22A 4E6KG 1A5AB 3EHDA 3PX3A 1D2GA 4URUR 1JG4A 3L6OO 3FSEA 4CM9D 2DPMA 5HXAA 4EVSA 5DLEA 2O6HA 2CWWA 1J0DA 1HA3A 1NXVA 2DMUA 3KE9A 1WI3A 2ZSDA 4UCXA 1E9EA 3C0KA 5E4JA 2JL1A 3Q5EA 4PJLA 4PN3A 3J7ZI 2AKAB 2NVUA 4EQ6B 2LCQA 1SY7A 1J1ZA 2DBRA 4F1KA 1ZD4A 1MZBA 4I1YA 4ENSA 4FPXA 4WZZA 3TXYA 3PL8A 2Q8KA 3I56I 4XPZA 4GOMD 2PSHA 5HYVA 4YFVA 1PKXA 3ZE8A 3LRPA 4FKMA 3VH2A 3BT7A 3OQMA 2ZWMA 3NEAA 1APBA 3TGLA 3LOCA 2B7BA 5E9WA 3CDHA 4YXWA 3T7DA 3D2CA 3M89A 4LFUA 3R0XA 1S1CA 5FTLA 1QYVA 4KXVA 5BN3B 5HUJA 5GAHJ 4CMEC 2IBTA 3GJ8A 4DYCA 1ZMRA 2A57A 2DFTA 2G7HA 4JUAA 2Y30A 5DV9A 4M8IA 1Q1QA 1JKFA 5EWMB 1FRQA 2W58A 2VOEA 3GT7A 4M71A 4OA5A 1G42A 2B7EA 2IV2X 2GNPA 4GOOD 2F4NA 3D4LA 4BUPA 3JQBA 4MYHA 4WT7A 2C9OA 3LCMA 2XNDD 4EFLA 3SU8A 3JRWA 4B4DA 1QHIA 5BSVA 2I8CA 3SFTA 2CMHA 3QBVA 3EZNA 5BYBA 3JAWB 1Q1HA 4U7WA 2GXSA 2KIMA 4I7HA 4YRGA 3A4CA 4PLCA 3PJRA 2BWJA 4MR7B 2JCSA 4HQLA 1AOYA 5AK3A 2R7RA 4DCOA 5M5WJ 2ET6A 3AVXA 3NIWA 2HYDA 2V3VA 1OBFO 4AL4A 2JEOA 3JASB 4QTXA 4M54A 2DPDA 1B8VA 4INPA 1K06A 5JWOA 3E9ZA 5DZSA 4BBJA 3SHOA 4XLFA 4M49A 3SIRA 1X1EA 5JZMA 4D80A 1LV8A 2J9FB 2C5AA 2O7NA 1F6BA 3R5TA 4JB8A 5H4HA 1SK9A 2IU3A 1ZK8A 2HWUA 5B37A 4OSEA 4KPFC 2D1SA 4XYGA 1OX4B 2P4HX 4FMCB 1NXXA 5F73A 1G17A 3PNMA 2C9ZA 3FPLA 3MQ4A 1TK9A 2HCRA 3UICA 2JA2A 4NICA 1FDVA 1E2PA 4OV6B 4Z2AA 5CXUA 2IIBA 2X0IA 4C7VA 3JWIA 3FNHA 4CT5A 2OK8A 4Q5IA 3GN1A 1G21A 1EDBA 3HP4A 1Y8ZA 3B20A 3C2BA 2CUNA 3EF3A 4ASUA 5FXMA 3LKZA 1QUFA 4H31A 2HGZA 1P80A 4OKNA 4HDQB 2GJAA 5BSMA 2JWTA 2ZNYA 2ZRJA 2CBXA 3DGFC 4BO3A 4K9DA 5F1KA 3PFHA 3KLBA 3RWBA 3HDTA 1G66A 1JQJC 5D5VB 3RVQA 4N0DA 3LVBA 4LOCA 1RHKA 3ZGXA 4N9IA 3HVHA 3WKAA 4OLBA 4FZ3A 3AEQA 1PVVA 1ZA1A 2C4NA 2XNKA 2YFKA 3QHAA 1QUEA 1GU0A 3IA7A 1AGYA 3UW1A 3Q4GA 1CP2A 3B36A 2RQPA 2R47A 3KB6A 1N5RA 3RUCA 4XGQA 5K0JA 2DT5A 1T9DA 5IF9A 3AR4A 3G8DA 2O1XA 1IJEA 1DS6A 3TSAA 2ZI9A 3UHPA 4JODA 2ZE8A 2WE8A 4F86A 2Y9MB 1YJXA 1EJ2A 3FUTA 4TKUA 4QIHA 1SQ6A 3HFRA 3SX0A 1OILA 4G4GA 4AIIA 1PFVA 4HSRA 2IZ0A 1GCAA 4JXXA 3SM9A 1KVTA 2V03A 3HUUA 3NBYC 4U5QA 1VHJA 1NK2P 1JKMA 4MZDA 3PUYA 1QH8A 4R9SA 4CQNA 3D8HA 4CMIA 2RGUA 4LQLA 1K0FA 1SM4A 5H5JA 4L4RA 2DA7A 1QIJA 1UC5B 2Y2VA 1OHHD 4ALNA 3I73A 4DMRA 2EFHB 5H6RA 1U4NA 4P80A 1MQ8B 4WCVA 1ESZA 4S1WA 3OE5A 1N75A 4ZVPA 1WB5A 1TAQA 2FZKA 3R7NA 1JZQA 4Z99A 4A6DA 1T3TA 1HO3A 2RHTA 4IDHA 1KO8A 5C31A 2R6CA 5TV2A 2JLUA 3SFVA 2QP3A 1N34B 4CO8A 3AKEA 2G36A 3F1KA 2VDOB 2ATCA 1PJ8A 3BRWA 4KQFA 2H2HA 3SBOA 1R74A 3LG2A 3ROKA 4R0NA 1UP7A 3DO6A 4K9RA 4DQLA 5CT8A 4R1UA 1Y81A 2QS9A 3HJHA 2NOJB 1RRVA 2L9RA 3PRKE 3L00A 1YHYA 5AW7A 3DMGA 1W85B 4B4VA 2CF6A 3HCEA 1WPKA 3CCSI 4B3TB 2ST1A 3DKKA 2LVBA 2XYRA 3JRIA 1X4PA 3F3YA 1BM9A 1NULA 5A4MS 1TBXA 4B3JA 1G6Q1 1FP4A 4FR5A 3ORRA 5DM60 2GZHA 2MC4A 3NWSA 2VC2B 1GGMA 2JFFA 1TZCA 4YQEA 5D5WB 2YMQA 1B3BA 2PSDA 3JRDA 4UUAA 3D8BA 1STOA 4E2WA 2HMWA 3RH0A 4FWBA 2ZXEA 4BX9A 1NX6A 3NRVA 3KD3A 4EHJA 3N3BC 5CM9C 1YS7A 4HXEB 3WMRA 3GCMA 1VJ0A 2ZR8A 4QQRA 2L4AA 4EJVA 1NBHA 3WB2A 3ETGA 4RS8A 2I5PO 4D3DA 3NUZA 1YSCA 3CPEA 1XP8A 1EG7A 1KQ0A 2DHCA 1SKBA 4QQNA 2MT9A 2UZ1A 4QLCU 4ENJA 2WDZA 1V3QE 1LJ9A 4BX0A 2X8JB 4N3AA 4KFSA 3A9SA 5J1YA 5BQOA 4ESBA 4IMJB 1TWCJ 3SN6A 1R9JA 3DT8A 2XPWA 2E1PA 4JR2A 3GFTA 3HSEA 3EVBA 4DLPA 4M6XA 2WT9A 3F97A 2X9QA 1U5TA 3THSA 2D2VA 1E1RA 1BYUA 1KBQA 1O77A 3CP8A 3OIPA 3WMEA 4BJ6C 4BXOB 1XGNA 2WNIA 1NQUA 5DI9A 1JVSA 1ZGCA 3TTTA 4TMZA 1USVA 3IRVA 1AH2A 1J1UA 4XKCA 2ZRGA 2Q9CA 1E98A 1YVEI 3FVVA 1PW7A 1NLUA 2R1ZA 3R3JA 1KR2A 2WD9A 4DL9A 1PW5A 1N9GB 5DN9A 4YWJA 4LX0A 2GERA 4BDYA 4KE9A 1RMTA 2ZJPF 3B13B 1MFPA 2ZJYA 4D9KA 2QLTA 3SHQA 4DLZA 3M7GA 1G20E 4FMPA 1K6MA 2C8VA 3QY0A 2ZYUX 3R9KA 4OCZA 3IDAA 1IGNA 4ZICA 1FDUA 5FNZA 3M3HA 4EELA 2D13A 2W2TA 3K4KA 1GQOA 4LXXA 5SZJA 2VJJA 4KXLA 2DPHA 4L5JA 2D2FA 3KZYA 4OIRF 2QPAA 3D8SA 1MNQA 5JXWA 4MHTA 4YRMA 1BE6A 3INGA 4L72A 4BEBA 1VL8A 4W6QA 5DBGA 2JAWA 1V37A 1BCRA 1T6YA 1LEBA 2ETHA 3W5VA 1JIVA 1TFUA 2H1FA 5L45A 1Z7LA 4JT9A 3B82A 4U1RA 1VG8A 2W2LD 1SVOA 4B8ZA 5JVDA 5LXTA 2OQIA 3EN0A 3AUTA 4GRIA 1QQTA 3VKFA 4KLZA 1QSGA 4AO7A 2XAHA 1GADO 5CYFA 5G2OA 4MUYA 2GAJA 1J2RA 1CE8A 3TOBA 2LFBA 1Z5ZA 2GXUA 4DA7A 3VYSB 4K8RB 1I7QB 1Z38A 4OWRB 5ERYA 2NZVG 3BD7A 3AW8A 3SHTA 2Z5FA 5HGXA 1WZNA 1RRJA 4UVGA 4H0CA 2BGIA 2FBKA 2C4HA 2PY6A 2GN8A 2X9GA 2GZAA 4NJEB 3V42A 4J2OA 2B9EA 4L5BA 2Q5IA 1LUJB 3EQ8A 2PBFA 2A5LA 3C7KA 2E4VA 2G9NA 3CCJI 4MV5A 2WUWE 3R0ZA 4X8MA 1T6SA 2Y77A 3GLKA 3ZQKA 4RD4A 2F9LA 3S8YA 1E8DA 1CRZA 4E07A 1F4KA 2FUEA 4LBWA 3H9GA 4N5MA 4Q0MA 5GOZA 4DZPA 1MG5A 4Y9SA 4DV0B 3GLFA 3R9IA 3H9EO 4AM8A 1GVHA 1PP8F 4PVCA 4B73A 5B12A 2QZZA 3F5SA 1OXUA 2GBLA 3V8QA 2YXLA 2AWOA 3ECHA 2Y1DA 4OJMX 3F8SA 2XKAA 1HLPA 4JGBA 4GGMX 2F62A 4N47A 1RS0A 3RB8A 3RYCB 1JA1A 2OV7A 5TC4A 5BOSB 4KHZA 3OMXA 1CR4A 4KE7A 3ZHRA 3IHUA 1AM4D 4KQ9A 3VDNB 1S7EA 2DM6A 3F1LA 4GEGA 1HT0A 3NVKI 3T8YA 3R6SA 2EGHA 3E58A 1A95A 1OW3B 3BF8A 3KKPA 4OXRA 3SZ3A 4C7JA 2OXCA 3GRPA 5LP6C 2V98A 3L7JA 3KQMA 3IR7A 2JI8A 3KP5A 2BMVA 2ZBQA 5FCDA 1AGRA 4ENPA 3D2AA 4H77A 3PJGA 1Z5OA 2A1TR 5AXCA 3B7GA 2RBEA 3CNOA 4HDRB 3T34A 3CCYA 1T4CA 1WP9A 3FUUA 3OP1A 3V8BA 3GLHB 3HU5A 3DZCA 1GPH1 5I7EA 2KJCA 1FNCA 3RRYA 2O06A 5CDGA 2R7WA 4HXYA 1XD2B 1MR3F 1U8TA 2PL9A 4A92A 2RK3A 1BBYA 1QFSA 4EEKA 1POGA 1ZGGA 1E7SA 4Z3KA 2ZIFA 1GTZA 2OXEA 3L4SO 1EHIA 2CXXA 2PL5A 3A70A 3OKAA 1Y8CA