2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSA3
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
2DW4A 2XKPA 2H94A 3KP4A 5ICFA 5LGUA 2ESNA 1GXQA 5J8CA 4I02A 3WTZA 2DQRA 1JXSA 4MGRA 2JTVA 2DPDA 3H92A 3HOTA 3TOAA 4ZZDA 4EVIA 3LQRA 3LWFA 4KIBA 3V8JA 4WX9A 2JT1A 4CXFA 2ELHA 5FD6A 3F22A 1OMIA 1OPCA 1P4WA 3K0LA 5ICCA 3GLXA 4O3MA 4LLNA 3L09A 5HLGA 2WC2A 5DUIA 3WU1B 3EETA 4A0YA 1OYYA 2W85A 1R5HA 3N4MA 4YIFA 1ZYRF 5D5XB 3P9CA 3HRTA 3K69A 2VBYA 2L54A 2QVOA 1X3UA 5FGMA 1HSJA 2WWYA 1KQ9A 1LVAA 2LF7A 2OZUA 2W84A 5EEGA 1U5TB 5LLQA 5BPDA 1HW1A 5K5QA 4EGYA 3G3ZA 3VODA 2PJPA 1T39A 3RIRA 1YG2A 3J80K 3SZTA 1R22A 1HBXG 2XRNA 5DCFA 1D8KA 1MDMA 1BI0A 5CVUA 3QPTA 2QZ8A 1RI7A 5DCMA 1SFXA 4Q4ZF 2M45A 3JSOA 2DPUA 1UHMA 3ZMDA 4HF2A 1J0RA 3ROUA 1SMTA 1R5GA 3MZYA 2ZJ2A 3LA7A 4EMSA 2DI3A 3GZ6A 4M6XA 3HSRA 2IRFG 3JW4A 3WTXC 4L5JA 1BI3A 3SQNA 2Z9OA 4HDVA 4RS8A 4TV7A 4HX7A 1SAXA 3F3XA 1FWZA 3HIFA 1EH6A 3Q9VA 2GWRA 3AAFA 3I4PA 2CQKA 3WODF 3PFIA 4F7ZA 4IPAA 4AIKA 4YFKF 3ZN0A 1FNNA 4AVPA 4HX8A 4Y15A 2HDCA 5A2QK 2QBYB 3CO7C 1K6OA 1R00A 3DQVC 2E1CA 3DPLC 4HOBA 2V6CA 2KRFA 4M71A 3TQNA 3KE2A 4M9ZA 4HV5A 3O2PE 2EV0A 2E7WA 2HS5A 4A5MA 1BOAA 4FX0A 2X4HA 4YIIA 2VBWA 1GXPA 1RNLA 3E5UA 3W6JB 3R0JA 2VOOA 1XGMA 3D0SA 3B73A 3CLOA 3U1DA 2V1XA 3L00A 1HKQA 3KP2A 2ZMEB 2BBYA 3GFMA 1Z7UA 1STZA 4RB2C 5DD4A 2IVMA 1FP2A 2GIVA 2L4AA 3H3UA 1E2XA 4KDPA 1QPMA 3FMQA 4K2EA 3F8FA 5DYMA 3RKWA 3OOPA 2M5WA 1YW8A 2D2WA 2XV4S 1RUOA 1ZH5A 1UB9A 5LHHA 1WWXA 1ON2A 2V79A 3HRUA 2DAOA 4G8XA 4BHCA 5LGNA 2BV6A 1XDSA 4KN7X 1S3JA 2STTA 3GFJA 4WF2A 1IW7F 1J59A 2VC0A 2L02A 3BJ6A 4Y13A 1IXSB 2VN2A 1B9NA 2ISZA 5FLXZ 3KZYA 4IHSA 3IKVA 5E20A 5F6FA 4P5OA 3I59A 4I01A 4Q5SF 4Q48A 2NAZA 2VBXA 3ECHA 4N0BA 5D6FA 3ZP5A 4UNOA 2IPQX 3GX4X 4U0VA 2DK8A 4RGXA 2HYFA 4FX4A 2F5EA 4G7ZF 1LB2A 1BIBA 3TOBA 1CF7A 1UHWA 2J5OA 1LEBA 5HOOA 4JQFA 1U3EM 3MZHA 4L5IA 3DPTA 3O3KA 2HKXA 1JHFA 4HZFA 3KLOA 3KLNA 4BYYA 2H6CA 1R1TA 1H0MA 2EFWA 1J7KA 3P9IA 3FM3A 1KGSA 2R7DA 1O7FA 1IRGA 1W5TA 3ZMUA 2EK5A 3ZPLA 4GYIA 4LK1F 1XSDA 2ACJA 4OMYA 3QOPA 4KYWA 1U5TC 3JAMZ 2FEZA 1ZGAA 2Q2EA 1IN4A 2FA5A 2HTSA 4G7OF 5LRSA 1USTA 4G9YA 4U0WA 2L01A 3EDPA 1P4AA 3WTWC 1YTYA 2PFBA 3SFZA 4KMFA 1FP1D 4WXDA 1B9MA 5E8IA 3G73A 2A6HF 1XGOA 2OBPA 2CGPA 2MD5A 2A6EF 4OIQF 1F5TA 1IF1A 4ZYEA 1S6LA 2WTEA 5K1YA 1KYWA 1W7PB 4EJVA 5E1ZB 4IVNA 4B8XA 2H09A 2MLGA 1OKRA 3BPXA 1AWCA 1IN7A 3I0TA 1ZG1A 3GYHX 1ZG5A 2NYXA 3TO6A 1U6GA 5DEQA 2PEXA 3RJPA 4I0AA 1EH8A 1Z6RA 5E8GA 3DXJF 4KA4A 2RNJA 4HF0A 1HKSA 1L3LA 1JHHA 2F5CA 5CJ9A 2M87A 5BPIA 4GGGA 1TTYA 3S2WA 1KA8A 5ICEA 2GXGA 1IZ1A 1LNWA 3F21A 3T8RA 3MFKA 4XSZF 2PMHA 3SZPA 5FO5A 3L9FA 5L3DA 2V1UA 2BE5F 5AIQA 1YQAA 3U2RA 4ETSA 3E5QA 5CVJA 3GWZA 1Q1HA 5JVTA 5K5RA 1G4DA 2YU3A 2MA3A 4ENJA 2QENA 1ZRFA 3GEZA 3WGHA 4PGGA 2HZTA 4YG2F 1G3SA 2QLZA 1O57A 5HLHA 2FBIA 2PQ8A 4R1HA 2D45A 3VEPA 4RB3C 3BJOA 4CHUA 2K4JA 2NNNA 2P5KA 4NQWA 3HYIA 3GO5A 3KP3A 2UZKA 3T8TA 1UCRA 5EEHA 3M1EA 1TNTA 1T98A 3SHFA 2RKHA 1KU3A 1WSUA 2FOKA 4AWXB 3MCZA 3J80Z 4OMZA 1DPUA 1C0WA 4CYDA 1KU9A 5TJJA 4IF4A 3ERED 1J75A 2STWA 4S04A 2DLLA 1B59A 1J9IA 2ISYA 2YX7A 2OAZA 2KJBA 3FX3A 4G6DA 3L7WA 2G7HA 1P4XA 3LA2A 3MAJA 2XVCA 2FBHA 2EJRA 2L3DA 4U7DA 3TO7A 3ULQB 2NRAC 1BIAA 5FD5A 3E6CC 4ESFA 2XGXA 1K7AA 5D6EA 1FBQA 2PLYA 3E3VA 5AIPA 4I2OA 3BP8A 2VOPA 5A2QZ 2ZCWA 2DTRA 2PI0A 2QQAA 3JSPA 1QBJA 5K5OA 3K2ZA 2G7UA 3PQJA 1OYWA 5TRDA 3CUQB 4HDUA 3CUOA 2QM3A 3RKYA 4OINF 2F2EA 5LEJA 4EM0B 2YSRA 5JI6A 4KNYA 3KZZA 5LEKA 2D1HA 4UVBA 1T6SA 2M1BA 3BY6A 3WGGA 2UWMA 2MH9A 4XSXF 5IT9K 4CZZA 2M8EA 2Q8KA 2O03A 4CO8A 2KJCA 1T2KA 2CYYA 4M9SA 1KU2A 4IRGA 2FE3A 1FZPB 2P7VB 2LNBA 2FNPA 5ED4A 1DUXC 2LF8A 3V8KA 2KIMA 1GHCA 2CWEA 3WGIA 5DV5A 2W57A 1T0FA 3ML6A 1Z6TA 3T0YA 2QWWA 3BOQA 1EV7A 4ESBA 3RI4A 2CSOA 1PP7U 4GO1A 3BPVA 3Q9SA 1IXRC 1SD7A 2LDUA 1S7AA 1TQPA 2MC3A 2Q0OA 4YFNF 5CLSA 1B4AA 4LFUA 4A6EA 4EJWA 3K1NA 1CGPA 2EFPA 2HFHA 3RPUA 2E1NA 4M74A 4CICA 2FBKA 1SFEA 4N9IA 3CTAA 3ZN1A 3QP5A 5L3FA 1QZZA 3KEOA 4E70A 3HSFA 1PUEE 2RN7A 1YO5C 4FHTA 2EV5A 1SD5A 3DKWA 4IRHA 1LDJA 2FNAA 3R61A 3FHZA 5L3GA 4EJUA 1U5TA 4B09A 2EV6A 2XROA 3DF8A 2ZXJA 5HS9A 1W5SA 4EGZA 1DDNA 1O3QA 2F5DA 3CDHA 1YYVA 2PN6A 5D8KB 4L0YB 5LRRA 2VODA 1TQMA 3SXYA 3ZMZA 3MWMA 3R0AA 1ZRDA 3I64A 3ZQ7A 2DQLA 4EV0A 3R4KA 4KIGA 5J8FA 1BJAA 2KKOA 1IN5A 2NNYA 2QQ9A 2VE9A 1T38A 3KP6A 1JGSA 3E6BA 5HS8A 3I5UA 5ERIA 1PP8F 4GCVA 3C18A 3P9KA 4MEXF 2VXZA 2XIGA 2ZNYA 2ZKZA 1R7JA 4RAYA 2E7XA 3FF5A 4M73A 4UV9A 2QBYA 2LSOA 1QQIA 1MKMA 2J5PA 2XAHA 4CGZA 4A6DA 4M72A 3F8BA 5E18F 2TDXA 1WRJA 2OD5A 2JZYA 4ZZLA 4UV8A 3RDIA 3FMRA 2BEOA 1XMKA 2VC1A 1D8JA 4XRFA 3TDZC 5IT3A 3LSTA 1J2XA 5D5UB 3V8LA 1D5VA 1R23A 3K1MA 3C1DA 2V9VA 3M7GA 3V4GA 3COAC 2R3SA 2XHKA 2K02A 2OQGA 3KP7A 5ILUA 4WK8F 2ZMEA 3I54A 4KICA 5FFXA 3LAJA 1HQCA 4XLPF 3ABTA 1I1SA 1TW3A 1U8RA 2GA1A 2HR3A 3ECOA 3WE3A 4M6YA 4PCQA 2FSWA 2O8XA 4WWCA 3FXQA 4KN4X 1J5YA 4LD5A 4UUVA 1HKTA 4BHPA 2PBIA 3H3ZA 3O6BB 4LB5A 2CFXA 4P9FA 1LDDA 1R1VA 3RPQA 1USSA 1FT9A 2EFOA 1KQ0A 4P96A 4LG0B 6PAXA 3FXUA 4L18B 1FC3A 1F9NA 2ETHA 3QU6A 4LJZF 3HRSA 2MLKA 4HQEA 4U88A 2W25A 1BM9A 1ZAOA 2ADUA 2GA2A 4AIHA 2JSCA 1UFMA 1A04A 4HLYA 1S29A 2K4BA 3E97A 1VTNC 4EJTA 3V7SA 4G94A 3WU0A 3D5LA 4GYGA 3IC7A 4KT5C 4HLXA 3RYPA 1Z05A 1FY7A 1L0OC 1F4KA 5LHGA 4QWQA 5BQTA 3V7CA 3QAHA 1ZARA 2HKOA 2Z99A 4UVAA 3DEUA 5H6RA 5BS6A 3LFKA 3GW2A 1K78B 1F1ZA 2M30A 4AD9A 1TW2A 3TKYA 2X0LA 3T1BA 1XN7A 3E6DA 5JFRA 4U7BA 2ESHA 2KIFA 1ZRCA 5F1RA 4L9JA 2P5LC 4BH9A 1ZREA 4U0YA 1O3RA 4G7HF 1AOYA 1BN5A 1QZYA 2LKPA 3KEQA 3CO6C 1RIOH 4NHJA 1B6AA 1QGPA 5H20A 1SD6A 5F64A 3R60A 2A07F 1R36A 4IXAA 2XAQA 1HXDA 3ISPA 1FSEA 4RGSA 2K27A 2Y48A 4GXOA 1TBXA 4Y17A 4OOIA 1U78A 1E17A 3MEXA 5D4RA 2P8TA 1G6NA 2EFNA 1BI1A 3GZ5A 2CO5A 1W7PA 2R7FA 4UHTA 3WTVC 3FM5A 5IT9Z 1DPRA 1LEAA 4BAYA 3WTTC 4DQ2A 3GF2A 1Z9CA 4L0ZB 2RC4A 2EFQA 3IRRA 4ZYGA 2AS5F 1FX7A 2DBBA 5L3EA 1HW5A 1OYIA 1Y0UA 5L3CA 2DO7A 2OQRA 2CW0F 4HQMA 2G9WA 5KVRA 3VB2A 1MJ9A 4ESJA 5FB2A 4IRIA 1MGTA 2IA1A 1ZHFA 4UVCA 5CYVA 5ILSA 3WTYC 3QPHA 2Y0MA 5BMZA 4XBFA 1YIOA 2RGVA 3C7JA 3L2CA 2VT3A 3HTSB 3Q5FA 2FQ3A 3K1PA 4I0BA 3WTUC 2K7LA 3JTGA 5DDGA 1K79A 2JPBA 1GVJA 4HA8A 2GXBA 2MH2A 1RZ4A 3TO9A 4FT8A 1JE8A 2RV8A 1MDMB 3DP7A 4ZYHA 1KYZA 3WE2A 2BYVE 4QLCU 5DCMB 4HV6A 2L4MA 2A61A 2GQQA 3K9TA 3IL2A 3BWGA 4P55A 2COMA 3IKTA 3QRFF 4KUMA 4MQVA 5H6QA 5HVQC 3EYIA 1I27A 4OIPF 5DD8A 4EJOA 4LMYA 4MNUA 1R1UA 1PDNC 3GVAA 3F8CA 2MBFA 3E6MA 1Z91A 3JTHA 5BOXA 4R79A 3GFLA 2FU4A 4A0XA 4H0EA 4WXCA 1WKMA 5D5WB 2XAGA 3FXRA 5HDNA 4IHTA 1TLHB 2D1VA 1O3TA 3F23A 4OIRF 4CDGA 2ZNZA 1YFHA 4RAZA 1MZBA 3F6VA 1ZLKA 3VFZA 4RB1A 5ILVA 3M8FA 2W24A 2VBZA 1YS7A 3HRMA 1RUNA 4UXNA 1P92A 3J81K 3R6SA 4BHBA 4L9TA 1IRFA 2IJLA 3IRQA 4HAMA 1O7LA 1HW2A 5HDKA 5FFZA 2Z3YA 1FYKA 2C6YA 2HEOA 3RTRA 3F72A 4A2UA 3CUQA 2HGCA 1IAWA 4PZJA 1O3SA 5LBQA 1EH7A 1Z1DA 4MHGA 4EQQA 2H27A 4BNCA 1BI2A 5AONA 3ZMSA 1FBSA 3EUHA 1SMYF 3CJNA 3VOEA 4A0ZA 2H6BA 3M9AA 3TGNA 4L9NA 3QP6A 1YW9A 4EM2A 3C3WA 5E17F 4D0PA 2PG4A 2ZO4A 4ENNA 3ZMTA 3RKXA 3BZ6A 3GXOA 4P9UA 2P5VA 4HX4A 1BC7C 4ASNA 4I7HA 2HQRA 2QYOA 3PQKA 3I59B 3WTSC 3HOSA 2HOEA 3FWEA 3W6KB 3F6OA 1DP7P 2FXAA 2P6TA 1WQ2A 4YFXF 4MTEA 1S7OA 3DFGA 4KIFA 4LB6B 1FBUA 1ULYA 2HTJA 3ABUA 4RGRA 1IN8A 4Z2YA 4A12A 1XGNA 1XGSA 1MD0A 4KFCA 1TQIA 1FYLA 1CF7B 2AXLA 3T5XA 1U2WA 1P6RA 2DT5A 2P6SA 3KFWX 1XCVA 2ZBKA 3KETA 3EYYA 3FMSA 4BXUA 3TDUC 4EM1A 2B0LA 4JK1X 1XDUA 1W4MA 1ONVA 3HHGA 2GAUA 1IUYA 1XCBA 5LHIA 1D3YA 1H9TA 3FZVA 2KIUA 4KMUX 4M9XA 1XSVA 4MTDA 3F8NA 2RQPA 1TNSA 3HTUA 2OA4A 4XLNF 4ON0A 2DU9A 2DFIA 2Y75A 1KU7A 2BGCA 1ZLJA 2NS0A 3GFIA 3KCCA 1WI9A 5E1WA 4RB0A 1XMAA 1ODDA 3ELKA 2RDPA 3B02A 1IXCA 1QO0D 4G6QA 1QNTA 3GUDA 1FPQA 2DK5A 3DV8A 3M8EA 4LLLA 1FSHA 1G3TA 1I5ZA 1G3YA 1FLIA 3CUQC 1YLFA 2F5FA 3WG9A 4Q47A 3J7AO 5D8LB 2A69F 1ZGJA 2IT0A 1XD7A 4BQAA 1B1BA 1YW7A 3I71A 4PDKA 1ZG3A 2XAJA 1BBYA 2EA2A 3I53A 2QUFA 1NHAA 3LAPA 2O0YA 3RYRA 1OR7A 3P7NA 4LGWA 5J6XA 2YPRA 4HW0A 5DUKA 2Z33A 4DNCA 1HSTA 1V3FA 2IA2A 1ON1A 4O5VA 3OV8A 2RVCA 3N97A 3IWFA 4ENKA 2PMUA 3V7RA 1V4RA 2V1DA 1W7PD 3LQQA 4HYEA 1KQ8A 2FMLA 3NQOA 2FRHA 2GZWA 2EA4A 2XUBA 3I58A 2FMYA 4ZH4F 3LA3A 5E1XA 5HS7A 2EB7A 1R58A 2QQBA 4R8HA 5ICGA 5JR3A 4PGHA 2OU2A 5FLXK 2HWVA 2A68F 3MQ0A 1MJAA 4WCGA 4S05A 3HHHA 2YX4A 5LGTA 4ENMA 2FF4A 5KK1A 2K86A 2YR2A 5HDGA 2P7CB 2VONA 4MQ9F 3NRVA 2O3FA 2HQNA 4ZYDA 2XASA 4LK0F 4OIOF 3BDDA 4JBAA 4I98B 4LG0A 3IWZA 1I1GA 2Z5UA 3KP5A 3F8MA 5CVVA 2JRTA 3E5XA 2ZFWA 4MEYF 4RGUA 4L9VA 3NEUA 3REOA 2XAFA 1BC8C 2A5YB 2EWNA 2VE8A 4N9HA 1FOKA 2OZ6A 2UXNA 2JPCA 4IJAA 1SFUA 1ZN2A 1P2FA 5D4SA 2IA0A 3IHUA 5HLIA 1G3WA 4A5NA 1LQ1A 4HBLA 4WXHA 3HUGA 1I6XA 4I09A 1SD4A 2A3SA 1K78A 2VT2A 1YS6A 3JAMK 4HF1A 4O6JA 1H9GA 4LLGF 5L3BA 5JHUA 3BJAA 3BROA 1MJBA 1FYMA 4NB5A 2P4WA 2HYGD 2IW5A 3HSEA 2XKOA 5CVRA 1LJ9A 5D5VB 2WV0A 3QU3A 1REPC 2O6GE 3J81Z 2CG4A 4OU0A 1IN6A 1S8NA 1XB4A 3U9GA 4AIJA 2O61A 3ZMVA 1LDKB 2IP2A 1XSXA 2UXXA 3EQLF 5CVIA
chains in the Genus database with same CATH superfamily
2QN6A 5A04A 3FPHA 2H94A 2XRYA 4H7IA 2X48A 3TSWA 2I7TA 3OP1A 2ID3A 5LGUA 3D3WB 4WI1A 1JI8A 4RAOA 1R16A 2IU4A 1JXSA 3K6RA 1YBFA 5HIAA 2C8KA 2XUKA 2PSHA 1XE3A 1IJKA 3KB8A 3HR7A 4XIFA 2AE2A 2Q0HA 3HYTA 4LDRA 2QRHA 1YQEA 3KZIC 2NPOA 1DBSA 4AW9A 1MSEC 4OHZA 1LJLA 3DMFA 4EMTA 1KI7A 2GJ9A 2OM6A 3TNYA 3O8HA 2AFIB 4EMBA 3TLCA 1QG2A 3PPXA 2ZIFA 4DR4B 5FGMA 5P21A 5C81A 2WMYA 3JYOA 5M3BA 2PMZA 3EVFA 4ZOEA 1KYYA 5LD2B 1G2OA 4YO7A 4PUSA 4EGYA 2BTQB 2MSLA 4HQNA 3PJFA 3WHKA 1DKQA 1OU4A 2PJPA 4G9EA 4DIKA 1KFKB 3CF4A 2IWHA 1G9SA 2IYNA 5JROA 2QZ8A 1HA8A 2JARA 3D0QA 2DPUA 2O3TA 4DCMA 1IUOA 5JVDB 4IGAA 2GVNA 1CQJB 4RS4A 1C3VA 3A31A 2ZTVA 3GBPA 4YO8A 4ZK6A 3GZJA 2M34A 5C8XA 2M2EA 2AZ4A 4V39A 2UZAA 1A4IA 1VJDA 4ATNA 5ES4B 3FXOA 4P81A 2W6QA 4YUWA 5CM8B 1XCJA 2J08A 2NXJA 1R88A 5IM5A 1RKQA 2HDCA 1KH3A 1TC1A 4JEUA 1TUBB 4IJQA 1QTIA 3VNBA 4OHKA 3K1YA 3DDUA 4QEDA 4KMRA 3NNSA 5TC4A 2KQRA 5CFQA 4UTRA 1H6AA 3NBZC 1W4AA 2R6FA 2L19A 2KRFA 1ZU4A 1XZ8A 2WJ3A 3GBGA 2H1WA 4HJRA 3DM9B 4J00A 5K0LA 1LBQA 2GFHA 3L8ZA 4MS1A 1BCSA 1TPZA 3ML1A 2JLZA 3K09A 1F6BA 3UCEA 4FQ5A 1ZVJA 3RWMB 2V0CA 1RNLA 4B81A 3HM2A 4P7KA 2NGRA 4OB8A 1ECBA 4DBRA 2B9EA 4LOCA 3U1DA 4JHLA 4NYJR 2WKQA 3IP5A 4X8LA 3U6BA 1XTQA 3QOYA 3DONA 4Z2AA 4BP1A 4WT7A 3BG7A 1FY2A 3PC6A 4LI0A 5B1EA 3C43A 1QP7A 1T5TA 4JUBA 4ZCTA 1CUSA 2C82A 2YMMA 4MDYA 3DTTA 3KZVA 1I10A 4TVSA 4G5QA 4AG5A 1ZH5A 1WNFA 2BLNA 1CPYA 3TH5A 1LK7A 3Q5GA 3IXMA 4BHCA 5TLSA 1Z0AA 5FORA 1PNTA 4AZWA 1M8FA 4II3A 3GFJA 4WLUA 3RVBA 3EZLA 1ZX1A 3VVBA 1YS4A 1D6JA 2P2YA 2VN2A 2HH9A 4OMFG 2POCA 4EYKA 4JQOA 2FPWA 1KJYA 3IDSA 4KYTA 3G6WA 3DHYA 3BB4A 3DBRB 4K9DA 2B7CA 4ER0A 4I6GA 5GTHC 3AP3A 1N2GA 4YJFA 3ROQA 3O9VA 1OOEA 1WQ4A 5FLXA 1FYEA 1U2DC 3K70B 1G20E 2AIRA 4K81B 1RJ9B 1FOWA 3NBUA 3NT4A 1I4TD 5FLEX 4FFLA 4G24A 4M76B 1AQJA 4MYHA 2OD9A 4MK4A 2AOTA 2FX2A 5FI5A 1Y8RA 1MNAA 2ZKLA 5A71A 3DPTA 3O3KA 3RQIA 3PNBA 2ZRCA 2I2DA 2JCSA 5DLQC 1RHMA 3VYVA 1O96B 1UAGA 3UJPA 5M3MJ 3V34A 5IM4F 5B4UA 2ACJA 3QOPA 4QULA 1U5TC 1FNDA 3W5BA 4MKGA 1OH6A 4QICA 4N39A 4WUVA 2ZIAA 2Y1FA 4PCUA 2QV7A 1RE1A 5G1OA 4RIFA 5AK3A 2OG1A 4CSWA 4HZGA 2NVBA 1KSHA 2D2FA 4X6YA 3ED1A 4I4TA 4MVJD 3NEAA 4Q01A 1WCMJ 3WLNA 4B8XA 3OAAD 2BAGA 3TZBA 5HQJA 1LS6A 2B5VA 1AWCA 2Z6AA 2Q3DA 5FOVA 1KS9A 1M83A 4RVDA 3I2IA 4K03A 3GYHX 1HURA 3ZI0A 4U5XA 4QEZA 3G5TA 4LZNA 4DGQA 5ILQA 3F8SA 3DXJF 4KA4A 2X4LA 1P44A 1U99A 4D79A 4E5YA 4BO2A 5BNTA 5MF6A 2W4MA 3IIIA 2PX3A 1JMKC 4X6XA 4BUZA 1XQXA 3GLTA 4ZYXA 4I50A 1STOA 2RG7A 4MO7A 1XZJA 4E4HA 2O1WA 4ND2A 1AZWA 3PS9A 2ID6A 1K5DA 3IE0A 3NVDA 4ILEA 2Q1UA 1YQAA 5KYUB 2BDUA 1UDCA 3D8RA 5IJ9A 1RBZA 2Z8ZA 4PV7A 3BWBA 1F5NA 1E2NA 3H2HA 1QPBA 4INPA 4HAIA 4BWFB 3PU6A 3QLVC 1GSHA 1DFIA 3ZWQA 1JQKA 1T36A 1CRQA 2Y76A 4RD4A 1N9GA 3DL0A 1XQVA 2RB4A 3D1LA 4NQWA 2XY4A 3KB1A 1CF4A 4RKWA 3SZOA 2XPCA 3G02A 4GP7A 4B3IA 3CZQA 5L45A 1KU3A 3CCJI 4MW6A 2XAUA 3DYIA 3QELB 4FKMA 4HAYA 3WMFA 3G0DA 4AZ0A 2Z58A 4EYEA 1W88A 2R00A 4O2RA 1UMBB 2QW8A 4IHQA 5F51A 4WJLA 2ZRDA 4EA8A 3H5OA 3R0VA 3AM5A 4U2DA 2PMDA 2A35A 4XIGS 1BS1A 2BZ1A 2JIDA 5BV8A 2D0DA 4OGLA 4P4SB 2WNHA 3FYSA 2D2VA 1RWMA 2WWHA 4BMDA 3B6EA 4ARVA 1Y6IA 5J4HA 5B3KA 3HY3A 1W52X 2I8AA 1T0HB 1CLUA 2RHGB 4XORA 2G9RA 4NLLA 2VOPA 1RKBA 5BR1A 4X5OA 1M0TA 4KO4S 3UMYA 5CLFA 3PQJA 1F6WA 4C3IJ 4OINF 3IT2A 3FSGA 2AO9A 2YSRA 1TWHJ 3OSZA 2WD9A 3ZCVA 3GP8A 4ZQCB 2M8EA 5DRTA 3CUEF 3BK1A 4K46A 2XF5A 1D5WA 3GZ4A 3PXDA 1KARA 2OVFA 4C3JJ 2CK3D 2XYQA 2GBLA 4IKFA 5E1MA 4RH0A 3NWTA 4BZWA 4DLXA 3JQ8A 3BFJA 2G17A 1N2HA 1GHCA 3WGIA 3U7FB 4HCJA 5DV5A 4ISCA 1IM2A 3RI4A 2KYRA 5LP6A 1H4TA 2FW1A 2I29A 1AKYA 3R9WA 1AN0A 4XLAA 4F3RA 4LCEA 4D1YA 2C98A 5CLSA 4BWYA 1YDHA 4KTVE 5AJZA 3O2JA 1D8TA 3QSYA 4BIMA 2DLNA 2CHFA 1CGPA 1GKYA 3DZIA 1NHWA 1G8GA 4XUGB 1VG1A 2DWPA 2V1NA 1B1CA 3JQ9C 4E5PA 3HSFA 3HBLA 3RD5A 1GCGA 2G5TA 4ASUA 3A9UA 2Q6TA 4D96A 2HOTA 2E2HJ 1TQDA 1P72A 4D3XA 3RUCA 3RRYA 1JJ6C 3W90A 2HLDA 4ZV9A 3I5YA 16PKA 3PUYA 3AJ8A 3F90A 5DNWA 5KNLA 1XRRA 3M6UA 3MWMA 2A3RA 5SZJA 4GPTA 5GAJA 2IS6A 4S1PA 5BNFA 1OTXA 1OV4A 4LA4A 3GMIA 4KIGA 3D4PA 3EZ7A 3WYFA 1EYZA 2C03A 1ORVA 1T38A 3VVLA 1TDJA 2BR3A 3RJ9A 2JJQA 2OBMA 2BBSA 2BSQA 4IO9F 3WGNA 3D7LA 1PR2A 1SN7A 3HB7A 5GJVC 3PX2A 3A2KA 2XVZA 4EBBA 1Y63A 2R1UA 3DV2A 3B2EA 2WOJA 4Y7CA 4HAZA 3GYGA 2HDNB 1KZ9A 5ERYA 3PFHA 2XT6A 2JI8A 4JJ7A 3EC2A 2A9OA 5H82A 2QU7A 2Q2QA 1ZD3A 2E0IA 2W4SA 4PM4A 5EGOA 5KJ6A 1D8JA 1UT6A 2OCYC 1IV6A 1AA6A 4J43A 2O8NA 3PSAA 3V8LA 1K06A 3T8YA 3BCAA 1KAEA 2YHUA 1YRYE 1CRLA 3OFJA 4JS0A 1XNQB 2FPUA 4P5DA 2X1CA 2CSXA 1WXIA 2VUUA 4MW7A 1XN1A 1ZHHA 3FI9A 4C9YA 1GUUA 3DT6A 5KINB 1CXZA 1B6RA 2VLIA 4A6PA 2I3GA 1U9IA 3FBIB 4DWOA 1KK2A 4JQSA 1ETUA 5DN6D 2XE7A 2PBIA 4AC9A 4ZAYA 2J5QA 3H0GJ 5FHQA 5MHTA 2FPGB 3CCFA 3NHKA 4QUDA 3UQYS 4PJNA 3HEMA 5JAPA 1U7XA 3VSKA 3ZGZA 2CVZA 5I5GA 1LX6A 3S6JA 5GWXA 2JSCA 4PNHA 3ZDCA 4CKCA 1N8KA 3KVRA 5GV8A 3RS0A 5IAGA 5H3LA 5IT0A 4WBNA 3IQZA 2C5LA 4KT5C 1UT5A 5BSFA 1EXVA 4LYEA 4UXJA 4NY1A 3CLKA 4KMSA 1EJ6A 1YT5A 3PC3A 5AJYA 4QD3A 3JQRA 2IGTA 3EE6A 1L6IA 1G66A 2VKHA 4MI1A 2OCAA 5EIEA 4F04A 4Y52J 4M0UA 2A94A 3I6YA 4ARSA 1ZREA 1LCIA 1G8MA 3IHLA 1B42A 1QZYA 3AKEA 5B37A 2XZOA 4MLCA 4AL4A 2PT5A 1ZMRA 1KQNA 2Q5CA 3VDXA 2W83A 5CDSA 1ZK8A 1RQ2A 5BWMA 1NW6A 3AYXB 4E5VA 2BZTA 3UG7A 2CD7A 1JS1X 4AP6A 5JD6A 2FG7C 3HXTA 2HPZA 2JAWA 4Z3DA 3QPCA 8ABPA 5DBIA 2EEZA 2P8TA 3OCZA 3BMCA 4LFCB 3CZMA 5JSZA 4JL8A 1KO4A 1I51A 2H3EA 3PWSA 1KONA 4N54A 5IKXA 2J7PD 4M22A 5JCXA 1LEAA 1VBMA 5EXPA 3L2RA 3FJOA 1FUIA 1Y7HA 4UULA 5FTKA 4FWBA 2X5NA 4LHYA 3KPUA 4CUJA 4JNKA 3UUEA 2WFZA 3PYMA 1N2BA 2J9ZB 3I6ZA 1ZQ1A 4Y9SA 3LUAA 1NE7A 2Y0MA 5JQWA 4Q1VA 1MO4A 3NAMA 1F7UA 3J80A 4YAIA 4LGMA 2Z3WA 4DANA 5M34A 2IXGA 3G0BA 3F0TA 5COQA 2Y67A 4XGQA 3U3OA 4URFA 1UZMA 4PQEA 5DDGA 2YWRA 2C5EA 5DSXA 3DP7A 4ZYHA 1BO6A 4U7WA 3ZGKA 1SVLA 1IY1A 1XDBA 3MUOA 2EZHA 3RABA 1MW7A 2A61A 1KU0A 4PXYA 2LVSA 3LIPA 1KXJA 4KGZA 3MTJA 1YI1A 4KYIB 3K4JA 4KUMA 1CDEA 3DU5A 4QTZA 1X38A 2CN1A 5DD8A 3KHSA 3GJTA 2QDXA 4YRLA 5FUMA 2DWUA 1Z5OA 1PDNC 1GU1A 3RCBA 4PTZA 5GADl 3V8RA 2IP4A 2VF7A 4UMDA 3EZGA 3GIWA 4CMHA 1JJ7A 4MDEA 3QFCA 3ZTTA 3ETHA 3KKMA 4IHTA 1H66A 4BFZA 2RGXA 4ZI2A 1XYGA 3V4OA 5TGTA 2X8LA 3TTWA 2O6LA 3DE6X 2O9JA 4B34A 2J46A 4WZAB 2PYIA 2B3DA 1LUJB 3O1LA 1O0SA 4TWIA 1HEIA 3TTUA 4H7DA 4D3SA 2CXNA 4D9GA 2IYWA 5KTYA 2PKCA 3CNNA 3LF2A 3B5JA 4BS9A 1ZH2A 1E2GA 3MWDB 3OPQA 3I9V1 3K0FB 1OTHA 3ROTA 4TXLA 1XAHA 1G5QA 3AFNA 2XH8A 4KI0A 1EFVA 2KHZA 5HDKA 3CLVA 2DYKA 3FB4A 4A7PA 2Z4SA 1VTKA 4KI7A 4HYQA 1OFUA 1CZKA 4XRGA 4IUBS 3BRWA 1HEYA 4MMZB 5JAIA 3AM4A 1YFKA 2K2QB 4MO2A 1LPAB 1TC2A 1JFRA 2FLWA 5L4SA 5FEMA 3TB6A 4XRMA 1B2LA 5HGJA 2XPWA 3VZPA 3UAVA 2VYND 3VR6D 2BP7A 5TEWA 3ZX4A 1OBHA 4IY1A 3BF8A 2PG4A 4XL9A 1CYEA 1Z7GA 4PC2A 4MPJA 3SJAA 1JDSA 3GXOA 4AULA 5DHFA 5JHHB 3L2UA 2YV5A 1P9WA 2C5BA 3QBJA 3OTGA 3I5AA 4L95C 4DUPA 5KYXA 3WMEA 3CEJA 4YQFA 3L7KA 2VTEA 4XIIA 3OWOA 3VO2A 3EGCA 2CL7X 3GJQA 3V9PA 2NVXJ 4BLSA 4AYWA 3TR6A 2FXAA 2SNIE 4BVHA 3QWHA 1VC2A 3I2JA 3OYJA 2R0QC 1EQAA 1RMQA 3HB5X 4KXYA 3DFUA 4LQCA 1BVYF 2IBTA 5DV9A 3RRFA 1MTOA 1VCOA 1PYGA 4ZEMA 3DEHA 2GK4A 5FFMA 3L06A 1BX0A 2DM6A 5U9CA 4PO3X 2VNJA 1T8PA 1Q20A 5EOVA 8ADHA 1JAIA 3DBHA 4CDMA 3TMAA 3DTVD 4BXUA 3FKIJ 2FCRA 5DHTA 3LSHA 2RCYA 4KISA 3F78A 3T7SA 4OB6A 2R5YA 1M76A 1CG6A 4NEQA 4BMPB 1GV5A 4DCSA 3QEMA 2GI4A 1MXFA 4JGBA 1YH3A 5LOVF 5KNCA 4N8EA 4M9XA 2DR0A 3TLXA 1GN8A 1V4NA 4M7OA 2OA4A 2W2MA 3D5TA 1SA0A 2IZOA 3D6AA 2Y75A 4E88A 2GD1O 4O2AF 3ZWWA 2LC2A 4CH7A 4G6QA 3HJTA 4LE0A 4ONEA 3MCWA 3CF4G 1QK3A 5ER9A 1U5BA 4U63A 2GLOA 4NUBA 3HG7A 2F4IA 3QWLA 3LPLA 5BYAA 1D2MA 4ZK2A 2AN1A 3AUAA 1WU8A 4EEXA 2ZXHA 1BJRE 1IULA 3OQVA 2ZBFA 1US8A 1DIRA 1QH8B 4D41A 3EPZA 1KSGA 3DTNA 2AQIA 1SVUA 5D3MA 3UAWA 2PX2A 3PDIB 3RSOA 4D6PA 2BDEA 1W85B 2CHVA 3DFMA 3ZHQA 1AXGA 3LNCA 5C8YA 2GYVA 2HI0A 3FWYA 3OV8A 2ZAIA 3RAJA 1A9RA 5J1TB 3GL9A 4MRRA 1OT3A 2C7BA 5CT9A 1H5NA 3LIIA 1GPDG 1RAHA 3ZOKA 1XTZA 3I62A 2NSYA 4G8CA 4BMZA 1BCRA 1QKIA 1GYRA 1NPTO 3DL2A 1BU5A 4NMWA 3KVNA 3PEUA 1FU4A 5TS3A 2IPNA 3ITKA 4K5QA 3S2YA 1S0UA 1QO0A 3PD7A 3R9KA 4Z8XA 2HIMA 3BIFA 1M6VB 4DMHA 3O8GA 1MB0A 4ENSA 1AO0A 4ENMA 1CY6A 3KX2A 5L4LA 4XCVA 4NP6A 5HOQA 4Q1DA 1M72A 3NOXA 1P33A 1VIAA 3NHSA 1I1GA 2V6IA 5BUCA 3QP9A 1H22A 3UAZA 3OX3A 4C2UA 3H1CA 2ZB7A 4X0EA 2I1VB 1N92A 1C29B 1SVMA 2A5YB 121PA 1PQPA 1YQXA 4MLOA 2F43A 4RMIA 3UPDA 1TM4E 4PFOA 3I09A 1C3OA 2JCGA 1G3WA 4ZXPA 4AJPA 3SJUA 5KU1A 4I09A 3TP0A 1O94C 5KX5F 4MICA 4LYFA 3D2CA 2RKBA 4RA2A 2HU5A 4Q3AA 4GMXA 2VNHA 4NCJA 4NS1A 2P7IA 1QZTA 2QUHA 1S8NA 1XX6A 1P1IA 2O61A 1N7JA 3O8OA 3CJRB 4D0RA 2XKPA 2X7JA 1JSCA 4CM3A 2AEJA 1MD9A 5FRDA 4G89A 3H0CA 3CY6A 2Z2ZA 3QPUA 1QUFA 3A1YA 5JDIC 2LD4A 2OBLA 2Z0MA 3WTZA 2VYQA 5F27A 3FWPA 4LI3X 2YNMA 5LZ5A 3BSSA 1ZOIA 3B38A 4BNDA 3AO0B 3KP1A 4I76A 2WYIA 2QQ8A 1N0HA 5JSUA 1LLDA 1W0JD 4GUDA 4I66A 5DM4A 1Y8QB 3LPDA 3GTMJ 1A9TA 3PSIA 3D6TB 3GRVA 1M66A 5ADVA 1HMYA 2B25A 2J3QA 4BE1A 3DKIA 1AHDP 3TZQA 1MA0A 5GADJ 2FMTA 3KIOA 3AERA 5K2MA 1W29A 2BE7A 4QWWA 2MIIA 1HSJA 3BFKA 1L8QA 4DMKA 2J07A 1SOMA 1XA3A 1W0UA 1ZUHA 3GRUA 5EEGA 3EDYA 5BPDA 3QEBZ 4MR8A 1K98A 2JGRA 3VKVA 1EIZA 5M5BA 4K0RA 3QU2A 3W0LB 4YMUA 2PN1A 3LUKA 5JT1A 1KO8A 3G5UA 5AVYA 2LH9A 4MINA 5DCFA 2QRUA 1T9GS 4X1IB 1ADGA 4YP7A 2C9OA 4GU5A 5DCMA 2ZVDA 4IIJA 2M45A 3JSOA 1GADO 1BKDR 4B3FX 3IQHX 2JZCA 4L0QA 4TMWA 1W4CA 5D5PA 5FPHA 3ZUPA 4I1YA 4EIWA 3MZYA 4TS4A 3D0OA 4OI1A 2VLAA 3F3XA 4JYCA 1JTYA 1QH1B 2NXNB 4NCXA 3BERA 3CCEI 3RBAA 2R85A 1ZGHA 3IEIA 3CVVA 4Z3OA 2K9SA 3H11B 1X80A 4F7ZA 4FKBA 4EHBA 2GNPA 1WR8A 3QWIA 4BY1J 3U5TA 3JPYA 2HCBA 4NFSA 4CNQA 4LISA 1YXMA 4Y15A 1B0PA 3EXG2 5F5NA 1XLTA 5JTTA 3COYA 1OXKB 2OV7A 3L6BA 3OQPA 2H8RA 4U2FA 4B4DA 5AM0A 4ZDPA 1B3BA 1P77A 5KNBH 4DSOA 1FXSA 3QXJA 4HPWA 2QMHA 1FS4A 3B6IA 3MF4A 2VZ8A 3UJAA 5GVRA 3C39A 2LP0A 1K83J 3R3HA 1F06A 1VHLA 4LIPD 1VP3A 3IC5A 2XX3A 1GTG1 2G76A 3VYRB 1NI4A 2BUBA 1Z6PA 1I9GA 1X39A 1O8BA 2NADA 3N5CA 4NBNA 2I1QA 4KDPA 4W5RA 1QPMA 1K8RA 4CPDA 3A9CA 5DYMA 3ZE1B 3I01M 4BX3A 2DBQA 5HIMA 1OX4B 3I34X 1P62B 5ILOA 4FASD 1NC1A 2G7MC 2EJCA 2C88A 4V2GA 3KJFA 4Y6OA 3MEQA 1FSPA 4BXOA 4XH9B 1Z8DA 4AQ7A 3DXFA 4KN7X 1Q6YA 2FEAA 2QD4A 3QVOA 1Z3XA 2IHKA 4WPGA 1V1MA 4O4LB 4MV1A 2H54A 3C98A 1O95D 4J4BA 2PGNA 4BFVA 4EG4A 2OL4A 3QVWA 1S7GA 2LKSA 4EKIA 5DLPA 1XPRA 2GAIA 2P9EA 4BQOA 1NA5A 1ZNYA 1LI4A 1YITI 3JAWA 1MJFA 4US0R 3OT5A 1QPZA 3NOOA 4PGMA 3BL8A 3CNEA 3EUAA 5GQSA 2GLUA 1NURA 4DRYA 5B1YA 3U7RA 1JKQC 1CHDA 4A27A 4JBIA 2VDMB 2JAUA 1AU7A 1SUCA 5HOOA 1BWPA 1U3EM 4REQB 4L5IA 1T5BA 1QVVA 2WDZA 2CVOA 3WGQA 3NP7A 3UAOA 1IZ8A 1CS0B 4OQXA 1P5JA 4B3HA 4OHRA 2WLTA 5IMBA 2VPXA 2EFWA 4JA0A 4GL4A 2CL6X 3P9IA 4P53A 4V0SA 1IRGA 5JZVA 1K4YA 2XA2A 4C5BA 3NONA 4QPCA 2GK7A 1ZZEA 2XKJE 2FEZA 3GJ7A 4G7OF 1P4AA 2RH8A 3DM5A 3G6KA 2QR2A 3BD8A 2EIHA 2AOUA 1QIEA 1ZAKA 4QE3A 2IW1A 1XGOA 5E2BA 3G23A 2BHSA 3B13B 4LSWA 2AUNA 2ZE6A 2CEKA 2A0WA 4DQUA 3RKUA 1G3MA 1I4WA 2HDHA 4I3HA 1A1VA 2OAQ1 3VYSB 4RXUA 2YS7A 3SKVA 2XC7A 1ZG1A 2CDBA 1SRQA 5HODA 1VL2A 1Z6RA 3IA7A 5KJEA 1QMGA 4OQZA 4JB3A 2REBA 3BTOA 4GQAA 4RV5A 1JHHA 3UT6A 3JRIA 1E3WA 4KXNA 3D6UA 4JLOA 4UU8A 1CRPA 4AP9A 1JJIA 1KNXA 4Q9DA 2XUGA 1LLUA 5AKGA 4Y2PA 2I0FA 5LZ4A 2GXGA 3W9YA 1PL0A 5DNEA 1Z5NA 3MFKA 1P29A 2BEVB 4TOIA 2L9SA 3UMMA 3SYMA 2ZULA 4FOSA 1YZFA 4HMQA 4RYLA 4Z7JA 2VF4X 4GPIB 4DNOA 4KE8A 3MMSA 5EINA 5IASA 4NCBA 4QBHA 3WGHA 1D1AA 2QTNA 3EVEA 2PGOA 3VHXA 5FKMA 5FX2A 2E71A 2P5KA 3B52X 1GNQA 2XCUA 2JA5J 4UTVA 4JXZA 1FBNA 1E9AA 3G1WA 3ULKA 5HLTA 4BBAA 4GIBA 4FMBB 2FUNB 2Z4RA 3MCZA 4RPJA 3RRXA 4EECA 5FI3A 2ZREA 1Z7YA 2FSVA 3OWXA 2IKSA 1SCDA 4KUHA 3CD6I 4HUQB 1PR4A 3DUWA 3V32A 2JUCA 2KJBA 3A7EA 3DVSX 1FDSA 2ZSDA 4I4NA 1MBFA 3UJBA 1RWQA 2X2PA 4YAWA 1S01A 2ODBA 3BXHA 3E4CA 4U7DA 3G2IA 3CIFA 2VA8A 1UPTA 1BJZA 4Q9JA 2PLYA 4HFNA 1DHTA 4YJ3A 1PT9A 1X77A 1BHO1 3CVOA 2PUVA 4M53A 2O2DA 3FFAA 1Z7EA 1OILA 1D2HA 3A6HA 2OB2A 3AY3A 1MW9X 3TIVA 3KYDA 4F9FA 1E3OC 2C2WA 1Y3IA 3ON5A 4CA0A 5ALGA 4XGRA 1HDDC 3TZLA 3OPYB 1RIIA 4ERNA 4I1OA 2HD4A 1YZYA 3DE0X 2NVWA 1JDZA 1RXVA 5IPFA 1D7OA 1J07A 2WWXA 3WHLA 4AYBN 2BMWA 3THSA 1MMDA 3RYIA 3CQZJ 3T1QA 1A96A 2WKPA 1O6CA 3TL2A 3HMKA 3ROFA 5JYDA 2DY1A 2B0CA 2EG5A 2HLNA 3B1WA 3IHTA 1Z6TA 2D1TA 2CMGA 4GLOA 4BBZA 5GAGJ 4TLMB 3MSXA 4ZOLF 3UV3A 3AUKA 1B26A 2BWJA 5BMVB 4HX9A 2IC5A 4PZZA 3VNQA 3TINA 3KJZA 2XUPA 1ZUNB 5A3SA 4EJWA 2DB3A 3LOUA 3OQHA 4HN2A 4ARBA 2WFAA 4B74A 4P3YA 1N5MA 2Z8XA 1YRWA 3EPPA 1WPQA 3ZN1A 1Z38A 1RKWA 3LPAA 3RVDA 3GTQJ 3TJRA 3P1JA 5JFOA 4P4LA 3I04A 2Y92A 1M7BA 2P77A 3OE7A 5HIJA 3HKEB 3TFWA 1GTJ1 3PNMA 4K9OA 4JT2A 1KOGA 3DAFA 4GE3A 3GQVA 2XROA 1IEVA 3R4VA 1NN3A 4CEHB 4EGZA 3GB9A 4HVLA 2Y2VA 1PKEA 1IBSA 3PGLA 4NV3A 3E70C 1O94D 4RU1A 1PX0A 3ZU6A 1LNSA 3KOYA 3LHFA 2QU8A 4G4SO 3C14C 2HOAA 2I4LA 4YECA 1ONOA 1ZRDA 1T5OA 3S7ZA 2BM8A 3W79A 1T3ZA 2JFVA 1I7NA 3Q40A 4BN5A 4UARA 4AVYA 3DMYA 3ZS9A 3QUTA 2IBSA 2KKOA 5HFNA 4ND4A 1KQOA 1ULTA 2HFKA 2FZKA 3S5JA 5ERIA 2WM3A 1OSNA 2Z56A 1EU1A 1L6RA 3C18A 4MEXF 1R8QA 3FAKA 1XTUA 4Y67A 4L2IB 3PVZA 5F1KA 4Z9BA 2P91A 3ETEA 5U4XA 2J3LA 3FCYA 3H1EA 3HC7A 3V4VB 5CEJA 4F8JA 4IJMA 2HL6A 3AUUA 4PPQA 3QQAA 2DODA 1JU3A 2WY7Q 1XTPA 2ATVA 2PTGA 1GUZA 2NO7A 3LQFA 3DDSA 1J2XA 2PZAA 3GPIA 3SN6A 4U3JB 3C1DA 5EVJA 4CMEC 3TVTA 2DX7A 4G41A 3MGGA 1N2ZA 5KCMA 2WUWE 1N6IA 5HNHA 4RZ3A 2OO5A 1IIBA 2WAXA 3DUFA 2ZXWH 4LGCA 2C31A 1J24A 5J4YA 1RPWA 1NP7A 5CQEA 1I5RA 3JU3A 1TU4A 2J6BA 4R9RA 3ZH2A 4WFKA 2BDTA 4DDMA 1AIPA 2OT3B 5T3UA 2OK7A 3QFTA 1GCOA 3CEAA 1LRKA 2HYJA 4ALMA 2NO0A 4AFNA 3ZV4A 4QKQA 3R7WA 3WLQA 3U56A 4J4TA 3KYCA 3SP1A 4OIMA 2FWPA 4KWIA 3TWOA 2PZBA 3D3NA 2CW7A 4LDZA 3CX7A 3EXIB 3NC4A 4H7EA 3TCKA 2DA6A 1UFMA 4XEUA 2R7MA 2FF7A 3JRNA 3JZFA 4Q0MA 4ZCRA 4LQLA 5DZSA 5EE5B 4BQIA 2JBWA 4HLXA 3RYPA 3LGXA 3OS2A 1U90A 2X6RA 5LHGA 2VP3A 3QAHA 3UKGA 2DSTA 4Z53A 2B8NA 4F85A 3LG2A 1LTHR 1WV1A 1FYVA 4IBOA 3WYBA 1RZVA 4MVJF 4Z8YA 7REQB 3FOEC 3L7CA 3CN9A 3AHHA 3P71T 4JP0A 1J5EB 4CLEA 3KYBA 2ESHA 1YQ9A 2CWDA 4BEHB 4NZNA 4CF3A 4FMDB 4RDIA 1MPXA 1LRJA 2R8OA 1K86A 2C0PA 3EVGA 2DFVA 4WKGA 1YE8A 2XCSB 4MGZR 3W8NA 4LMBA 3K0EA 1FS6A 1YI2I 2EP5A 4YACA 1S2LA 4HQKA 1VZ2A 3A4VA 3UUGA 1R1DA 2VKTA 4MQFA 2WQ7A 1XLUA 3F5QA 4KPGA 2YZ2A 1JHVA 3D0RA 1OQYA 3IAEA 3H2GA 3CF5F 2OO7A 4YRPA 3ESQA 5D4RA 1PQWA 3ANSA 3OLQA 3H5LA 1ZRMA 4FT2A 4W63A 3BAZA 3LP5A 4UHTA 1VE5A 2P7HA 4POAA 1DPRA 1TJPB 1EVKA 4MO9A 2Q0SA 1M9NA 4OU5A 2RC4A 1RYFA 2DP4E 4KX5A 1L4KA 1XMIA 2AS5F 3FYUB 4R05A 1QR2A 3A0RB 3SM9A 3LO8A 2A5LA 3ZQIA 5DCWA 1L9KA 2XQJA 1EE9A 1TRHA 2P8JA 3AONB 3W5IA 3Q0WA 3VB2A 1MGTA 1ZHFA 1SQGA 2ZB8A 2X23A 3OR2C 1A69A 2PZMA 1PZXA 2WUFA 3L2CA 3M83A 4AECA 1FFGA 1MB3A 5BNZA 2JVHA 3PUBA 4OLJA 4R1SA 1R6VA 1IXYA 3EXHC 4KN6A 4K9KA 4OSOA 4PO9A 2FK7A 1G3QA 4K6CA 3NM5A 4UVIA 2HK7A 1RPTA 1UWCA 2VK1A 5BRJA 3STHA 4XARA 3P27A 2QE7A 2PH1A 3PLNA 1GXSB 1QIIA 3JD0A 1YL7A 4MWGA 1X15A 3EQ8A 1IMJA 1SKUA 3WK9A 5NLLA 4EJOA 4ZTZB 1LLCA 3B9PA 2YASA 1N2XA 4JY7A 3AQIA 1ULZA 4AWXA 3ZGXA 4G3XA 5ALZA 3ABMH 3OYHA 2QUKA 4HH4A 2W5UA 3AG6A 4IL5A 3TW7A 1GA4A 2XQIA 1WKMA 4NBLA 3W1EA 1FTYA 4MQUA 3T5TA 2D1VA 2QRQA 3OJCA 3SXUA 1Z63A 3RREA 2G5CA 3LQ2A 4Y9TA 1QM5A 2G77B 2QL5A 3JALA 1F8FA 2H4XA 5CXXA 1L8LA 3C45A 1XLVA 2CCKA 2BEUB 1KAGA 4ND6A 4B79A 4UXNA 3KQSA 3K92A 1I13A 4C1NA 1W36D 2HWYA 3LDGA 1OBCA 3USZA 5JMOA 1FDWA 3PF9A 3V1LA 1RI4A 3Q41A 2WVHA 1AX9A 2FPIA 3KT8A 3B1YA 1IO2A 4H0NA 1SUIA 4S24A 4UTZA 4F0JA 5CAEB 3CZ5A 1OLSA 4HWOA 4DCVA 2HTFA 4KHZA 1SEVA 4LJ6A 3L4SO 4C3OB 1XZHA 5HKOA 1XVLA 1XD2B 1M5RA 5DE3A 3P0JA 1WSAA 4JJIA 5FQOA 4G0ZA 2H6BA 4RD0A 1W46A 1QGUB 3U19A 3TGNA 1EINA 4LJ8A 2OZVA 2WDPA 4I8XA 4D0PA 4DUYB 2BFMA 1PS9A 4LRYA 2PX4A 3RV3A 5D5QA 2X4GA 2J8ZA 4XIYA 4F56A 2ONYA 3G5AA 3TRFA 3JQAA 4LKRA 1ZI9A 4ID3A 1HLFA 3T3DA 3LSPA 3LVFO 2V54A 2W11A 2XEXA 1T9DA 2BM9A 2VHEA 5GJWC 1YS9A 4IUYA 1Q2UA 2LBFB 3ISJA 1O6GA 1YFZA 3I59B 4XLCA 2WY2D 1E3MA 1W73A 2HHHB 3EWNA 2R8XA 2XW6A 2EG9A 2ZR0A 5IOZA 4PYRA 3H1BA 3L04A 1OVMA 4R51A 3ADOA 4IMRA 4ZXFA 5DHAA 2AYYA 4XJTA 3ZIAD 1CF7B 5HRCA 4BKQA 4EKEA 3UMFA 1O5IA 1FB5A 3HKBB 3R0IA 3ORHA 4E31A 3GH3A 4ZOBA 1SZCA 2VTBB 4R83A 3R5JA 2G9UA 3I2YX 1WRBA 1P1HA 4W9RA 3ZEAA 3LW8A 1XEFA 4HNHA 1TT7A 4CBVA 2WU4A 2NNLD 1OU0A 1QCYA 4E7KA 3H1PA 4PRKA 1TVKB 2LY2A 2J59A 4XUDA 4R6XA 4NC6A 3VC3A 4D9FA 2GN2A 1EZ4A 4OJMX 4RB0A 2RDPA 2UXDB 2ZJRF 4BTLA 3DLHA 4JLNA 4PXSA 3CVXA 1K27A 3LQ1A 1FSSA 2R7AA 4XSGA 3AG1H 3CNBA 4UFOA 2VDQB 2MWMA 5SV2A 2LW7A 3BHJA 4CM8A 2DUUA 4IJ6A 2GH1A 3OOWA 2A69F 3GJ3A 5LQKA 4ZZIA 2Q49A 1B1BA 1Y82A 1N5RA 4EH1A 2XAJA 2B34A 1TKAA 3LP8A 4BMVA 1G7TA 4NI5A 2QVGA 4YRJA 2C97A 1Z6QA 3BFPA 4V0MA 4MIKA 3AF3A 3W5CA 1UZLA 2PMUA 3HOUJ 4HYEA 3ZX5A 4N18A 2FRHA 2WWRA 4UNRA 5IK2A 2X5OA 2PMBA 2VHCA 1JR3E 3RLIA 4NBUA 5C0OE 4MVCA 3QXCA 2FOWA 1M67A 3U7QB 3DZGA 2DERA 3OL3A 3MCUA 3Q3IA 2I4OA 4AUKA 3IH3A 3BBLA 2ESRA 2OFOA 2PS3A 1I7DA 1J1UA 4YNBA 3NHLA 2VONA 4MQ9F 5G0VA 2FKNA 3F96A 3K3PA 1NJSA 2ZSJA 2Z30A 1AK9A 2Q5HA 3FTCA 4CUKA 1GG5A 4UEQA 4HLUA 4UDXX 2ZQ5A 4GBMA 2C92A 5ALJA 1JQ3A 2QMYA 2GCOB 1KVSA 2HV8A 5CEFA 5IM4A 1R4ZA 5K8VA 3COZA 3LKVA 1ERDA 2JA7J 1P0PA 1VFPA 1UMDB 4KKVA 1CB0A 1RPZA 1ZK3A 1OGYA 4CLRB 2XZPA 2QX6A 3ANXA 4DBLC 1RETA 1WJBA 1H8HA 4YUYA 1V8DA 1ENPA 1VJ0A 1QFYA 3TW0A 4KR0A 2G04A 2OGWA 3A4YA 1E8MA 5AICA 4LOLA 1ISRA 4KIUA 4J3FA 3ABQB 3JAMK 2CFTA 3K4QA 3FPKA 4O02B 5E6RB 3SLRA 4L4RA 3GCMA 1XZNA 1TO6A 2EBUA 4Q4JA 4NB5A 4P86A 2ORWA 3HSEA 2OPTA 3E5NA 3M49A 3WYGA 1K6XA 3QU3A 4E30A 2EZKA 4OA8A 2R5FA 1WPGA 3WGVA 3WWEA 4AMYA 3R0QA 1JILA 1E1MA 2XIJA 3OTOB 1X19A 4NENA 3B6MA 4B0PA 4CFZA 1A9YA 2HAEA 4JDPA 2PCJA 3TIFA 1TJYA 4F71A 4I99C 3V8EA 3DNFA 4IH9A 3O8NA 2RG1A 2KI5A 2XUHA 3IMKA 1D4OA 4UM7A 3TOAA 5HTOA 4H3VA 1N5IA 3QU7A 2E36A 2XE4A 4QG7A 1B7GO 3L7OA 4BCBA 3WQBA 3PQEA 2IEYA 1TCUA 3QKWA 3NRCA 4AU1A 4X7BA 2JCBA 2AXEA 3O8LA 3DL4A 1DUVG 4GX2A 2CNBA 1HSOA 4B71A 3AUTA 2O8CB 4IGFA 9ABPA 5EL0A 2VJMB 4Q3DA 2GCNA 3HN7A 3K5HA 1WP9A 3L7AA 1T35A 3EQ9A 1PJ4A 1MRZA 5FBZA 3P9CA 3TLGB 4NYJQ 4FS3A 1NNSA 1NM5C 3PFKA 3I12A 4NZPA 2BC9A 3HU5A 4G0WA 2O6HA 4Z1MD 3PDHA 4RADA 4Q9IA 1VYTA 4F1WA 1OPXA 2HNKA 4FUTA 1JSLA 4G63A 2HT6A 2GTIA 5ER6A 3QPTA 3PE6A 1JU9A 3M5PA 3TD9A 3RSGA 3ZMDA 3C7TA 3H9JA 1P4HA 4PHGA 4PNEA 4H3HB 4LCBA 4XDYA 1XRMA 4H7FA 4S0XA 3NDPA 1S7EA 5KYVA 4ADSG 4UMFA 4YVFA 5DGHA 4DCCA 5TMDA 3DEZA 3UYLA 5FI1B 5A6VA 3L0SA 1IM5A 1V54H 3HZZA 3FRJA 4BAZA 5A2QK 3BZKA 2H59A 3DMGA 3Q2IA 4QQKA 1XTVA 2R8PA 2ORED 4CM4B 4E21A 1PD0A 4I9UA 4KPUB 1P18A 2V7XA 3IP8A 1W5AA 1A5SB 5ITZA 4D4MA 3CVUA 1UMCB 2AEEA 1P80A 1FZQA 3E5UA 1VLVA 2WPDD 1R71A 1SUSA 3TS1A 1RAFA 1BMDA 2IOFK 4I9NA 4XIDA 1VJCA 5L7WA 4IYRA 2V65A 5K3EA 4IFIA 2VR1A 3GFMA 3ESDA 4QECA 1HQYE 1XHLA 3UMSA 2REXB 4CCOA 4HZIA 4F6RB 3U48A 5AHKA 4MV7A 4QYWA 1C9JA 5LMNB 3LCJA 4GWGA 4XWAA 3C1TA 4ZIRB 3VKGA 2Y9PB 4LFAB 2SKDA 2M5WA 2D2WA 4IFTA 5AR1A 1UB9A 3ZCQA 2IYAA 3DCYA 1GPUA 1TE2A 4D4JA 1Z82A 1KHTA 3HCCA 4XPIA 3K0HA 4MYRA 1HETA 3CUKA 4IRUB 5E6SA 4TVOA 2YC2C 4V3CA 4A1OA 1LQTA 3PI7A 1D07A 2XITA 4TRRA 1ZRSA 3HA2A 4BASA 4TM8A 2IY7A 1XALA 3FN4A 5IVIA 1JJ8C 3GX4X 4X84A 1ZOLA 4ETWA 2CNWA 1OHHD 1RXYA 4TRNA 4G7ZF 4AO7A 3N6RA 2DYSH 1DO0A 3UPUA 4MS4A 3E5HA 2MR6A 4I1SA 2FETA 4WZAE 5LQMA 3ZXIA 3OC0A 2Y1CA 3KLOA 1VF9A 3ECAA 2ZB9A 1R2QA 1MJNA 2JFOA 4RVOA 2W37A 3HBJA 2P6RA 2NPIA 1ZDMA 3ZMUA 1YDEA 3WL8A 2XQVA 4MKFA 1GLVA 4NCIA 4HRYA 1OAOA 4YQYA 3FOBA 1BVHA 5MGBA 5IKOA 2XTMA 3CEHA 2A6HF 1LBHA 4Q6BA 1RM0A 2MD5A 2VHZA 3VC1A 2H2GA 4QJ5A 1OIXA 4Y2UA 5A9RA 3AV0B 1NG6A 5E1ZB 3VU8A 4R0MA 1C9KA 1TWCJ 2WSSA 1J8QA 1QDUA 3ANTA 3I0TA 2F1RA 4UOZA 1KJWA 2PRKA 4CKBA 1A71A 3DCJA 4WY2A 4X1YB 3HA7A 5TRTA 5KMGA 3FGNA 5KREA 1OJ7A 5KAFC 1N4AA 5NULA 1RLIA 3C6KA 5ALFA 4DLZA 2WIFA 1OZGA 4KCGA 1TTYA 3GC6A 1WCYA 3L6OO 1NLMA 3X1JA 4EHFA 1JEQA 1IJEA 1WFXA 2A5WA 4A8TA 3DKYA 1VQ5I 4DIOA 1Z68A 4BFYA 3VSEA 1RI3A 1WS6A 4WN9A 4DRZA 4YAJA 3BGOS 2AR7A 2AR0A 3K9QO 1TL7C 3ASUA 1CP2A 1UF9A 4N8SA 1JKIA 2AG1A 1KEVA 4V1CB 3FGOA 4FEGA 1SC4A 2GEFA 4EY5A 4HDRB 1YRHA 3H83A 4X92A 3KP3A 3AEQA 2EDCA 2PPVA 1I6WA 2GZAA 4F91B 1JP7A 2BFDA 1IN1A 3TEJA 1KPIA 5TPWA 3UXYA 2WBLC 5EP3A 4QZVA 4IF4A 4NC7A 4JODA 3L8DA 4WXEA 3INNA 4OBEA 4BP3A 5BWNA 3DC7A 2CB0A 5AM4A 2O1SA 4RS3A 2M7AA 2O5EA 1SGWA 5C8VA 4L8LA 2O7QA 3SM3A 3FPFA 2BEWB 5JCJD 1AKMA 3VR4A 3S16J 1ODKA 3CLSC 5AH0A 4Y0NA 1M2VB 4A3SA 4BIIA 1COZA 4I08A 1X70A 3MOSA 4C6RA 1ZL2A 3GEHA 1KQFA 3NM4A 4JYKA 1JX6A 4DJJA 2FDCA 2CUKA 2YX1A 2OCDA 2ZCUA 1IBRA 2EX0A 4C6TA 4I7EA 1C2YA 2W2LD 1Z08A 3LP6A 3N07A 3E1GA 4UC0A 4OI0A 4PGAA 1U0GA 1SCUA 7ABPA 1J70A 2WJPA 5IUNC 3IEUA 3GLIA 3C6YA 2A1UA 1ARZA 2M1BA 3T5GA 3ETCA 1F1JA 1JHRA 4M1OA 2CV1A 4GT1A 4DIFA 3GFTA 3ND7A 5ADWA 4IOKA 3RUFA 3UGQA 2VJNA 1KSJA 1U3UA 5ED4A 2BL4A 1PFKA 2LF8A 4KJZA 3FKQA 3MMYB 4G6TB 3NBMA 4DJAA 4CF4A 4EJFA 4NV1A 3MWGA 5FXMA 1R9MA 4YA6A 1JHMA 1EVQA 2C5HA 3VOAA 3HDHA 1X1AA 1QHYA 3D8BA 3WXBA 4AZVA 1GSIA 4IMIB 3CRMA 4LFUA 1AK2A 3K4BA 721PA 2JJ7A 4CIBA 4E5MA 4BZZA 5TIIA 4PSXA 3OO0A 3VTFA 2O7RA 2RN7A 3DS8A 4FLEA 4LW8A 4D4LA 4X45A 2FNAA 3MZ8A 5KO2A 4AN1A 3TZKA 5BNWA 1LW6E 3ZQKA 3QEJA 2JBHA 3HCBA 1W5BA 1X14A 4HVTA 3TSCA 1E94E 1SUBA 1L5GB 1JQLB 5H59A 1ZJWA 3I30X 4DR7B 5EJIA 1X13A 3HKZA 3F9KA 4PAWA 1GEEA 2HIHA 2RGUA 3N5KA 2OENG 2NIPA 2DZDA 3EISA 3FSJX 1TQMA 3AR8A 3R0AA 3ZQ7A 4DXDA 2M98A 2XVMA 3N39C 1ZA1A 4EV0A 4XA8A 2PRYA 2PJUA 4JVOA 1L3BA 5I7OA 1E2DA 1SC7A 4DB4A 2R66A 3U7HB 4CMBA 2WJ6A 3A3KA 1GPMA 3DMDA 4YV1A 1U8UA 5EA2A 3KR9A 1W44A 4GE0A 4QFCA 3I5UA 2BGKA 2PUBA 1JJAA 5KSPA 3P9KA 4AJKA 1Y5NA 1YCHA 2V7PA 2YXPX 3RAGA 1GZ4A 4EFLA 2ZKZA 3TUZC 1PWEA 4UV9A 5FWNA 1IXZA 2N1MA 4CF5A 1HOMA 2YV1A 4CR8A 4EUNA 2GEVA 4N82A 1T5LA 1TJ5A 3NASA 1WSDA 4U2CA 4J7XA 2ZJ7A 1Q50A 3FETA 3DOJA 4HEA1 1T15A 3W77A 4UKDA 1NVVR 5KSWB 4L9SA 1D5VA 1U2PA 4C89A 1KI9A 4ZQEA 4INJA 3PEEA 1OBFO 1SBQA 5J3JA 3R5KA 3KYIB 1JIVA 1NW4A 3KP7A 4ABYA 4D02A 4TM7A 4CG3A 4DT1B 1Y6FA 4CQMD 1LU9A 1P5ZB 1R6TA 3GA0A 1SVKA 4A0GA 5ALUA 4FQ8A 2WWTA 3CG0A 5JDCA 3PHGA 4RJIA 4W8GA 5HCUA 2A92A 5M2QA 4BFSA 5EIAA 4KN4X 1GQ2A 2VDRB 2QLNA 3SXJA 4UUSB 2I78A 4JX9A 1LDDA 1J2JA 3CH6A 3DV0A 1ST3A 2X1VA 1OPRA 1FT9A 3T7DA 2XMQA 4MV0A 4NYIR 4ID9A 1PUJA 4WNCA 2FQXA 4TV8F 5JJLA 3A1VA 5CGZA 6PAXA 3UWMA 1O87A 1KERA 2E6UX 2O2ZA 4CCYA 1JFLA 4BRSA 4O4IB 1NDHA 1GY8A 2V8BA 2QJWA 3C6XA 4P4TA 2FP4B 1ZOOA 5LOVA 5C4XJ 3FCUB 2X6XA 3RRJA 1SCAA 3B1ZA 5CBPA 1OMOA 4CJXA 2WPNA 4XKCA 3SEZA 4K9PA 1CNMA 4ZEVA 4O2AA 3JYLA 3EUFA 1NQVA 2CLSA 2NZWA 4RM2A 4TKVB 4HDKB 3AHJA 5K09A 4JJFA 2UV1A 5LCXA 2HZDA 1BAPA 2YZGA 4TKUB 3F1KA 1YX3A 1FU7A 2P4QA 2IS1A 4PSDA 3VHQA 3ASNH 2XDQB 4HBGA 4EYSA 1AOYA 3UGKA 1BN5A 1PR5A 5KIAA 3F46A 2GHRA 2YCLA 4XSVA 3UMJA 3AVOA 1IC8A 1EJ2A 2PJDA 5IYBJ 1BR4A 3R3UA 4W6QA 5A5DA 3RK4A 4OREX 1OFUX 4PYNA 5HBGA 5E38A 3CG4A 3NC0C 2OD2A 3EUKL 3TOVA 4GXOA 4KREA 2B20A 2B4AA 1YRNA 1MJHA 2IH4A 4HXYA 2HCFA 2EFNA 3NALA 4A3KJ 2O8BA 2P79A 2R7FA 1P1CA 1LTKA 3PSHA 1OBVA 3R5HA 3FAZA 1KY5A 2RAPA 4L0ZB 1D1SA 3IRRA 4P7FA 5FWAA 4URHA 3PC8C 3I9LA 1UC9A 4E32A 4JBWA 2VHWA 2OQRA 2VH1A 3AEXA 4FNMA 5FB2A 4EHJA 1E6WA 4W5QA 3KG2A 2HMWA 1BXRA 1JYFA 4KT6A 3V2GA 2JJ1A 2FX3A 2DJIA 2Z09A 4JUIA 1LFAA 3Q5FA 3DOOA 3SOZA 2KPOA 4ARIA 3TEFA 2H7YA 2R7RA 3LI2A 4R40A 5K3BA 2VDJA 4L75A 3T1YB 3CHYA 3HZRA 3KR0A 3KUUA 1MDMB 3UTDA 3OHPA 1P9NA 1UPCA 4HQ6A 4ICIA 4EYQA 3FFTA 1PIWA 2QCOA 2GQQA 2XE6A 3GUYA 4FFMA 2H0RA 3DE7X 1HK7A 3NIGB 1VG8A 4MMYB 1E62A 5KX5A 5HVQC 4IZZA 3QKRB 5C35A 4DIUA 4CLXA 1NUTA 1H8AC 1PWYE 1HMPA 3UMVA 4EKGA 1COWA 3F2IA 2BBTA 3SPXA 2CEAA 1WZEA 4R54A 2KX7A 2X3UA 2ZANA 1VBFA 3FK6A 4M9UA 2M2IA 2BIFA 5AO9A 4FXOA 2B21A 2BHLA 1AN9A 4TLDA 3EFOB 3A27A 2GDZA 4BBSJ 4RB1A 5ILVA 5BQ3A 2RC6A 2JLWA 3MJTA 5TJ9A 4YPVA 4XMYA 3U49A 3D7KA 2O8EB 2RARA 1H4SA 4Q7QA 4JC0A 3JCZA 1L7QA 3TAHA 2HUNA 2L7KA 2PMKA 2UYYA 5ETJA 1HZZC 3QOFA 4FCCA 4CMIA 2PWPA 1NBMA 2H4YA 5ENVA 2PA3A 3L43A 2AQFA 1SFRA 4TLCA 5C1IA 1TFRA 1P3Y1 4GKVA 1DCTA 4Y6GB 5DNYB 3U7GA 1RP7A 3ZMSA 5DEIA 4BJ1A 1GU0A 3K6SB 2V7VA 1YIJI 4K7JA 3RZOJ 2VJJA 5J47A 3M9AA 4DLVA 4L9NA 1JBEA 3DYVA 3PQ3A 5AW4A 1YW9A 1QMPA 2GN9A 3ILHA 4H7HA 5CIQA 4IHJB 2QJOA 3DA8A 1ZSVA 4PLCA 4QXOA 2O2YA 3JQBA 4M8LA 4WTOA 2JA8J 3DT8A 3BGIA 3ZS8A 1MC8A 4Y1RA 2IK8A 4DWJA 3P2KA 4CIAA 4O1MA 1WF3A 4UE6A 3BA1A 4EUSA 5JFGA 3PNTA 3HOSA 3DDZX 4NU5A 1QOZA 3DPUA 1Z6XA 3ZWMA 1DPFA 3ZKAA 3FIWA 2FSSA 1M1XB 4MWDA 3H3FA 4ZOAA 2V5UA 5CLQA 2VQFB 4QRIA 2QSFX 4LXHA 5AI5A 1WCWA 4EA6A 1U2WA 1SM4A 2ZBKA 4IZIA 2OLJA 2PAAA 4MGHA 4NE2A 4RV9A 2H1OA 3QX3A 3EB9A 4WA8A 4QIWN 5D87A 5HKBA 3GG9A 2VQ3A 3IMCA 3SF0A 2Q99A 4WOKA 2Q2EB 2KIUA 4HLCA 5BSUA 3SDSA 1LPSA 1CDZA 2O2XA 3BG5A 3I76A 4F55A 3Q7PA 4BX0A 4DVJA 4EG5A 1AQNA 1YDFA 4JR2A 2FK8A 2XUJA 5IAKA 1T6NA 1QNTA 1PJCA 3F47A 2Z57A 2L82A 1F2UA 3T3GA 5A4AA 3CEPB 2DPXA 3PV0A 1ENYA 1WIWA 2LCIA 1ZGJA 2PGAA 4HDMA 1JUDA 2A0UA 1DQSA 1DIOB 4JLJA 1C1DA 3C16C 1I94B 5HM8A 2ATCA 3EF0A 3R75A 2IV7A 3EXFB 3IOBA 3LRTA 2NNWB 4LSMA 2AMVA 3E7DA 3LSIA 1KIAA 1JIKA 4DDHA 2RVCA 1D1TA 4UHHA 1YHNA 3NTVA 3FYCA 3KD3A 1BDJA 3VKFA 3HO8A 3EZFA 3LA3A 5HS7A 3YASA 2CLCX 1GZVA 1YVRA 4D56A 5ALEA 2BY0A 2W90A 4B43A 2R60A 3WC4A 2VAVA 1BDIA 2ZTMA 2HQ5A 3I4MJ 3A4LA 2GZ1A 2DFTA 3V4PB 4JJ8A 5H9VA 4BJTA 3MNFA 4LX0A 3OQIA 3JTMA 2ZI3A 1GPYA 3CP8A 1DKLA 5CX1A 2NM0A 4RK7A 4NPHA 2Q1TA 4N0EA 2ZVPX 1IONA 3F6BX 5I7FA 1SG9A 2ZI4A 2VAMA 2P7CB 4WGGA 1PR0A 1WETA 1OZFA 2QAGC 2WYOA 1JKMA 1Z25A 2R1ZA 1CE8A 2XCTB 2Q50A 4YASA 3R8XA 2E89A 4DGWB 4AU7A 4WLFA 5LB4A 1R15A 3I42A 3KEMA 3PKIA 4YBRA 2WAYA 1MCZA 4FINA 5E7QA 3U13A 1N5DA 1KBOA 5L3SA 4DRXB 2HQOA 2LWIA 5KPJA 4X93A 4IJUA 4IJAA 4FFNA 4K6KA 3QG5A 4BJ3A 3BXEA 3L46A 2RAVA 3WB1A 5F77A 3C3JA 3QXGA 1E6KA 5K0ZA 3QYPA 1TTPB 1PUFA 2VBIA 1YS1X 4M6WB 2B7EA 3IO3A 1UH5A 4BO1A 3WK5A 4HXEB 3GJZA 2JLVA 3W04A 2H07A 2VBCA 3D02A 1NSFA 5CB4F 4U9UA 2WV0A 2P9ZA 2BELA 4I19A 4LXXA 3DD5A 3ANYB 5EWJA 2CG4A 2ZSIA 1PV1A 1YJNI 5JWRA 5EY5B 2EVWX 1QJ4A 2UXXA 3GDWA 1CZRA 2ODAA 3ZZTA 5L40A 1TEZA 3SNHA 3KP4A 3QLEA 2PX5A 2WIKA 2ESNA 3AIKA 4N65A 3P9PA 3AR2A 2YIJA 4FOOA 3ADDA 2DPDA 2VRBA 1Z39A 1KVUA 4KQ9A 1M1NA 3ELBA 2A9QA 4D1QA 3RB8A 4LRTB 1Q0UA 4O4HB 3WB0A 3EC7A 3JVUA 4ZT2A 1PSDA 2JHPA 2FE1A 2R47A 2RKOA 3HOXJ 2PRZA 4GXQA 3K35A 4O1HA 3USES 5LB2A 2BVLA 2X76A 4E5SA 3NVMB 1GYQA 3L1VA 3N4MA 1SAYA 5REQB 1F38A 1BMTA 1Q91A 3TCXB 1D5CA 3WVNA 1QIDA 1RWXA 1DBQA 3RAPR 1ADYA 4WSOA 4BMSA 5GTDA 4INOA 3HLKA 1P7YA 5FDFA 4XIJA 3KL2A 2WIJA 2L7FP 2HT1A 2EILH 3E3MA 1BOBA 2VEDA 2NZXA 4IDNA 2OORA 2HXYA 4BNYA 3T35A 4DNQA 4E7PA 1BI0A 3TE7A 5HP4A 3AVXA 4ZO4A 3EQ7A 2H1LA 5IOYA 2HHAA 3IEMA 6GPBA 2JA2A 3FMFA 1JXMA 4QQNA 1ULBA 4AYTA 1EGHA 1JIJA 3MTQA 4JN6B 4RLSA 4TZKA 3DEEA 2PKEA 4JLPA 1RAIA 4LOAA 1IJWC 4NDLA 2NSDA 1R74A 1L4EA 5T4EA 4OXIA 3BMQA 4LZJA 1YVEI 1R4NB 2RJ3A 1QHHD 3KZXA 1P7JA 2OV3A 3WTCA 3FH0A 3SF8A 3AKDA 3HB4X 4B76A 2GFQA 2HF2A 4LC9A 2OQVA 1HLVA 2FQQA 1DGWY 4YJKA 1VKZA 2AJ8A 4N4OB 2W9XA 4YIIA 4ZOLA 1V9SA 5DHRA 2H06A 4Q82A 5B7QA 1Z7WA 4J0HA 4DQLA 2XCLA 2JLYA 3B9RA 4DBVO 3RHSA 1AO3A 4NAHA 4RB2C 3K1AB 3WNZA 1OB2A 4D5GA 2ZYDA 3I8SA 2GPTA 3NTRA 4CKEB 4C01A 4H1WA 2C7VA 5LDGA 4DN6A 2JLSA 1W30A 3OOPA 3RASA 2WFMA 2NYVA 3OJLA 4EUEA 4YI5A 2VB6A 3LSMA 2C3YA 2JH9A 4FQ7A 1NVMB 3T38A 1BHJA 1FP6A 1JHZA 1R0SA 1H23A 3QHAA 1JKFA 4GYJA 3UICA 1P17A 2VSYA 1EHIA 2UVPB 4ARZB 4MP6A 3T0IA 1M2OB 2B4QA 2BH9A 1DADA 2IRWA 4ZFNA 3C15C 3JAKB 4C07A 4RQBA 1JEYB 3PXEA 2VBXA 4KB5A 5JU6A 2BVNA 3C70A 2NUTA 2IPQX 1IZ7A 4OXKA 2GPBA 1EP9A 5EXEA 4DADA 2W6ZA 3KJQA 1J6UA 3TOBA 1DSSG 3OC6A 1GUFA 5JZBA 3JZMA 1TNDA 2GPWA 3OIDA 4H16A 5EFOA 4XQCA 5BN1A 3BE8A 5KJ1A 2JFZA 3PCXA 4KJXA 3ZVRA 5CVEA 4PX5A 2R4GA 2MW8A 5HF5A 3RHZA 1J7KA 3GEGA 1TIPA 1KGSA 1W5TA 3MQ4A 3TI9A 2QNIA 3UMBA 4RYDA 3CINA 5EQFA 2FWAA 3JAMZ 1M5TA 1ZGAA 1IN4A 1ZMBA 1WTCA 2ODEA 3BC8A 3CX8A 2QE6A 4X85A 3BC1A 1FP1D 1NY6A 2HBQA 1V95A 2BI7A 2FRDA 4ZEOA 1EE1A 1NJGA 4XQGA 3EARA 4GM0A 4JVNA 1IF1A 3HYNA 3GLLA 2XGJA 3KJXA 3GLKA 1U4NA 1W7PB 4DZPA 4IVNA 4MW9A 5E3IA 3RSSA 3I4CA 1C9EA 3VU9B 4C5CA 3UK1A 4LWOA 5BW6B 5TMPA 3VJMA 3H16A 1EZ1A 1YMUA 3RIYA 4H2DA 3RTEA 4RENA 4MVJI 4F7WA 3EDRA 5F5XA 3WGZA 4KPEC 2VPPA 5T67A 4GGGA 1VKJA 3A9SA 1NFQA 1ICEA 4DC1A 4IHKA 1CJTC 1OF1A 1F2TB 4N01A 3SZPA 3L9FA 2R5ZB 2BE5F 1SXPA 4MPPA 3GP5A 1B3RA 5GGXA 3E5QA 1TZBA 1PSWA 2XZTA 5FPKA 1Q44A 3TDMA 1JW9B 2ISSD 5B6PA 4JT9A 5AJXA 4ENJA 1ZXXA 5GONF 3GEZA 4YT8A 3SS7X 2CJJA 1MABB 1O57A 1DNPA 1WUJS 4M6VA 5LMZA 1AQYA 4QXAA 3EA5A 3G9QA 1WOMA 4RB3C 3BJOA 4XR4A 2K4JA 3S7TA 1Y1LA 3S8PA 1NJ8A 2VKVA 2A05A 4MVJA 1XCGB 1DBVO 3Q8KA 3HXPA 4DREA 3OAAA 2BGRA 4PJJA 5EEHA 4FZ5A 2JN6A 3DCNA 3SJZA 4R7TA 2JQ7A 2PUWA 3L0IB 4X44A 5CMLA 4LF6B 2EL9A 2PMCA 1X3WB 2JH8A 1JKRC 1VSUA 4Y7DA 3ZWXA 2ECKA 1KEEB 2P9QA 1PT7A 3GLFE 4AJ9A 4TTJA 5DMXA 4PQYA 2R7ZJ 2FH5B 3OLCX 3OESA 1Q3HA 4U2BA 3WOVA 1QU3A 2JDID 4LOKA 3MAJA 5IHXA 3DCFA 4D5CA 4FU0A 3ULQB 5J2TB 3RAFC 1EK6A 2CUEA 1Y1KE 3Q7EA 1C8KA 4L02A 4I2OA 5A2QZ 3QENA 2AZDA 2PI0A 4HPXB 2D1SA 5K5OA 1N6RA 3N8GA 3ABIA 4KXMA 1V96A 1T1GA 1EM8A 1U0SY 1C9DB 4FB5A 1A6QA 1YFLA 3PXBA 2QP9X 4N7RA 4WLOA 5JCOC 3CB2A 5IAJA 2HU9A 4L72A 3M2TA 2A8YA 1Q11A 4LEIA 4FZRA 5BT8A 5DKFA 1MU0A 3WXMA 4GZLA 4DC0A 3QF4B 3S3MA 3SHQA 2KIMA 2X86A 1UK9A 2JK0A 2QWWA 5BVGB 5DXJA 3L79A 4IOCF 1G41A 5BRNA 3SC6A 3UW1A 2J09A 2GRJA 5DTRA 3QYEA 1F14A 3CNQS 4WFJA 4C4ZA 3BTUA 1XMVA 4OP3A 4DOMA 3AR7A 2ISQA 1NZDA 3B1JA 2E87A 3T4UA 2E1NA 3T3HA 2I7XA 1VSVA 1EK2A 1RYHA 5KPDA 1SFEA 4MQMA 3GUUA 3QP5A 1QZZA 5DBEX 1ZELA 4TT3A 1VDMA 3S1NJ 1T3LA 2WFLB 3CNOA 1WE2A 3R61A 1R4MB 1YK1A 2WUVA 2R7UA 4MTLA 2J4CA 5AJTA 2COKA 2F5VA 3AP1A 4BRZA 5FNVB 4B7CA 5GPAA 2AOVA 1CVIA 2QXTA 2FOLA 2LG4A 3EFEA 1WCXA 3A9WA 2F5DA 3W5HA 1Z12A 4K3UA 3WGOA 2E55A 1P91A 2AKYA 3E9RA 4D8WA 1K8QA 4B8YA 4DA7A 2F8TA 1YAJA 3M4OJ 1WUYA 3TLYA 2DAPA 2QRVA 3FIJA 2IBDA 4OI2A 1R0ZA 5J8FA 5CDHA 4A3BJ 3AJRA 1WVIA 4WCFA 2HQSA 2P0AA 1OFIA 3KP6A 1HFEL 3L2VA 2GGSA 1T5DX 2OCPA 5K4GA 2JB9A 2WB1N 1GR0A 2ID7A 2NU9B 3P32A 1ZQ9A 2RHJA 5TPZA 1E6EA 3OYBA 4N4AA 3GTLJ 4C2MJ 1KYVA 4RXTA 2E7XA 5M04A 3FF5A 4TYPA 4B2PA 3AFOA 2EIKH 4G5XA 5K7SA 2UUCB 3I52A 4F4CA 2HK8A 4K8OA 4A0QA 3Q7TA 4TWBA 2Z6VA 2B35A 3SZ3A 2PEYA 1M0WA 1O9BA 5K01A 2WTMA 3H42B 2PZKA 1HF0A 4QX6A 4ZU6X 1XA0A 1MC4A 1NVWQ 1AKHB 4G09A 2UUOA 3RG8A 2ZRIA 4ITRC 3GLFB 1U8XX 2Y1EA 4IQ0A 1Y4SA 2ZMEA 3I54A 1ISIA 2WW8A 1SULA 3O90A 1WKVA 3PFYA 3U4IA 1M6YA 1CY1A 4EA7A 5T8KA 3ZWOA 4ENQA 2J9XB 1X7WB 2UZ1B 1GGMA 2DMUA 2C4KA 1IXKA 3ECOA 4DYVA 2JBAB 4RTQA 3MD0A 2RC5A 2BHTA 2ATIA 3FOAA 3D4OA 3LPNA 2I03A 3GVIA 1GPNA 1RPAA 4TXMA 3SS8A 5IRCD 4AIHA 1S8AA 3CZRA 3RG2A 1J25A 4NFLA 2H1CA 2GZDA 3FDIA 1DC4A 1MHPA 3BR6A 5A4FS 1A4XA 5JOQA 3GTJJ 1WO8A 3H1FA 5JVGF 3LUJA 4DLUA 2PUJA 4ETNA 3LBYA 2HSEA 4BMOB 5ALOA 1L4UA 4CUGA 3QVTA 3CLUC 1F0YA 1D3AA 2G82A 1V48A 2P5LC 1QX4A 1U7TA 3I72A 5A3RA 2E60A 4W7SA 2ZPAA 3OFVA 4X1KB 1FRNA 5KNDD 3HP4A 4RCYA 3Q10A 3GVXA 3KEQA 3NYIA 4NZ9A 4MKZA 4AY5A 3G2KA 4RC9A 4GVXA 3PHIA 4GNKA 3WYDA 3SIRA 3O7WA 4LXQA 5IH3A 4URYR 1Z26A 3N9IA 1ABFA 2Y48A 1T8SA 3QUBA 2AFHB 2JFNA 1PGOA 2UYHA 3GA7A 5IDWA 3PXGA 2PGLA 1NKSA 3MVEA 2V3WA 3L6RA 1II8B 1AMUA 1BI1A 3M4YA 1KTIA 1KI6B 3QUAA 1Z3CA 3H4TA 4A3GJ 2HO4A 2F3PA 3STXA 5DK6A 3GF2A 2QMUA 5FPTA 3PI6A 5BYKA 1FJGB 3H9GA 2FUKA 4N0DA 5EZ5A 2DT6A 1Y7TA 5EIBC 1IG3A 1FYXA 2DXIA 5IT9A 1G2HA 4RIIA 3IESA 4IRIA 1HT0A 4US2R 1F9AA 2RGVA 2MINA 2QTFA