2WTEA

The structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Crispr-Associated Protein Csa3 Provides Insight Into the Regulation of the Crispr/Cas System.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
molecule keywords CSA3
total genus 67
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2wteA02
3.40.50.11700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wteA01
4PGHA 4A5MA 2F5DA 4N9IA 5J6XA 1IXCA 4FT8A 1LDJA 2HQRA 4D0PA 2RQPA 2UZKA 4PZJA 5BMZA 5L3FA 1STZA 1YQAA 4M9ZA 2IA1A 4XLNF 5ICFA 3E6DA 3S2WA 3F23A 2F5FA 5BQTA 4PDKA 2E1CA 3WG9A 3WTVC 1ZGJA 1Z7UA 3SXYA 2IA0A 2LKPA 2H09A 4EM0B 2R3SA 5D5XB 2KJCA 2D1VA 3BJ6A 2QZ8A 4WXDA 4I0AA 2XASA 4HF2A 4PCQA 1T0FA 2Z33A 1CF7B 1REPC 5ICCA 2VODA 5K5OA 2MC3A 4XSXF 1P4AA 4AWXB 3QPHA 4XLPF 2Z99A 4BHBA 2M8EA 2V6CA 2QENA 2QM3A 2CW0F 2FQ3A 2W25A 5DD8A 4M73A 1XCBA 2IRFG 5L3BA 3M8FA 2HFHA 2P6SA 4LLLA 2YU3A 2OD5A 1YO5C 1Q1HA 4I98B 4HQEA 3T5XA 1RNLA 4OINF 4KDPA 4HW0A 4GYIA 1HW1A 3GEZA 2L3DA 1T38A 3ZP5A 3R0JA 1XN7A 1FT9A 1OYIA 3H92A 5E1WA 2HDCA 4UXNA 3F6OA 1SMTA 3HOTA 1QQIA 3WTSC 5CVIA 4H0EA 3TGNA 4ZYDA 4P9FA 4EM1A 3WE2A 3HTSB 5CVUA 3V8LA 4LG0A 3GZ6A 1BC8C 1IN6A 1JHHA 4LMYA 3QRFF 1LVAA 1HSJA 5LRRA 3MWMA 2D1HA 3QAHA 3GW2A 2IW5A 4G7OF 1G3SA 3KP4A 4L9TA 1J5YA 2O6GE 1MKMA 3LFKA 4I02A 3O6BB 3U2RA 1PDNC 4AIKA 4BXUA 4FX4A 5BOXA 4RB1A 1BBYA 2VC0A 2M87A 5LLQA 4AD9A 4IJAA 1QBJA 2PQ8A 4CGZA 3HUGA 2A3SA 4S05A 5D5WB 4OU0A 4RAYA 5DUIA 5H6QA 3D0SA 3RKXA 3GYHX 2MH2A 3IWFA 1UFMA 4YFNF 2XAHA 3M8EA 4GGGA 1IN4A 3B73A 3RJPA 3WTYC 1Z05A 1QZYA 3KE2A 3KP6A 1K6OA 3KZZA 1GXPA 1FP1D 3ZQ7A 2XROA 2RC4A 4AVPA 1QZZA 1MDMB 2KIMA 4A6DA 3COAC 3BZ6A 4U0VA 2EA4A 1E17A 2CSOA 5AIPA 3QU6A 1U5TC 4HV6A 1HQCA 1QNTA 1XB4A 2W85A 1O7LA 3I53A 1PP8F 2E7WA 4L0YB 2A5YB 3TO6A 5HS8A 4I2OA 3M9AA 3W6KB 3HRSA 4YFKF 4HX7A 2QVOA 3PQKA 1T6SA 1G3YA 4MNUA 3MEXA 5LGUA 3BPVA 2RV8A 1XD7A 3H3UA 1W5TA 2O61A 3EUHA 3WTUC 2GA1A 3HTUA 4WXHA 1WSUA 1YW8A 5CVRA 1SFEA 1MJBA 5CVVA 1HW5A 1YW9A 1O3QA 1ZN2A 1FBUA 3RIRA 3LA7A 4L5IA 1D8KA 2B0LA 5HLGA 4IRIA 1YIOA 2ZJ2A 5DDGA 3EYYA 2QBYA 4XSZF 2ESNA 4RGUA 1TQMA 5J8FA 3QP5A 5LGNA 1T98A 3ZMDA 3KETA 4A12A 2MBFA 3QP6A 3RKYA 4HOBA 3GO5A 3C18A 3EQLF 3V7RA 5D8KB 2H6CA 5E20A 1IAWA 3GVAA 2OZ6A 1U6GA 1V4RA 3DPTA 2EFNA 4L5JA 2IP2A 4M9SA 4DQ2A 5DEQA 4KNYA 2PJPA 2HTSA 1OPCA 2COMA 5FD5A 5TJJA 3JAMZ 1BI1A 2IVMA 2Y48A 2PI0A 4IHSA 1B6AA 5A2QK 1FBSA 2MA3A 1Z91A 5KVRA 1L0OC 2NNYA 3DXJF 3LQQA 4HDUA 3RYRA 1U8RA 4M74A 3CTAA 1HW2A 4IPAA 2D45A 3PQJA 2NNNA 1MDMA 1FYLA 2DK5A 3ZPLA 2IPQX 2RKHA 3KFWX 4MQVA 2BYVE 1KU7A 3AAFA 3ISPA 1BM9A 2JRTA 3CUQC 2QQ9A 3ROUA 4ZH4F 1O3TA 1LEAA 3WTWC 1O57A 4RGSA 3LSTA 1YS7A 2QLZA 4GXOA 1XGOA 3J81K 4I7HA 2BE5F 1ZYRF 5D4SA 4HYEA 3IC7A 1SD4A 2L54A 2VE9A 3U1DA 4HA8A 1ZAOA 3VB2A 3WGGA 2MLKA 5F6FA 1H9TA 3ELKA 2E7XA 3VOEA 1TNSA 4Y13A 1B4AA 2RVCA 5K5RA 1DPUA 1PP7U 1O3RA 4G9YA 3WTXC 5E17F 4HV5A 4B8XA 1FYKA 4R8HA 4ENNA 1R36A 2EK5A 2Z3YA 5FLXK 1R23A 3ABUA 3KP5A 3GFJA 2YR2A 3I5UA 3HRUA 3JW4A 4WK8F 3GWZA 1MJAA 2HS5A 2K02A 2VN2A 5CLSA 2GAUA 3HSEA 1V3FA 4EGZA 2BEOA 2QQAA 2HQNA 2FBHA 3IL2A 4KYWA 5HDGA 4EMSA 5HDKA 4U0WA 4LJZF 5JI6A 3M7GA 3ECHA 3E5QA 2EFQA 3BJOA 3L2CA 3NQOA 3MZHA 2K4BA 2FRHA 2P6TA 2Z5UA 4OIRF 2NS0A 1R1TA 1XSXA 3FMSA 2ESHA 4HX8A 4ON0A 2QBYB 3KEOA 3KLOA 5E1XA 5J8CA 4A0XA 1A04A 2M45A 3FHZA 3P9KA 5D5UB 5TRDA 4CYDA 1ZRDA 4CZZA 4L0ZB 3ZN1A 1P2FA 1GHCA 2LF7A 2STWA 2DI3A 2HYGD 4HX4A 2PG4A 4IVNA 4KIGA 4G6DA 3T8TA 1BIAA 1D5VA 3T0YA 2P5LC 3GZ5A 1ZLJA 2P5VA 2HEOA 3LA3A 4RGRA 2FBKA 5LHGA 4L18B 4IF4A 4Z2YA 3F8BA 4UUVA 1ZRCA 4EJVA 1WWXA 3E6MA 3E6CC 4RS8A 2P8TA 3RTRA 2O03A 1YS6A 1BI2A 3BDDA 1FPQA 5FD6A 4KIBA 3DEUA 1B1BA 2W24A 1KA8A 5JFRA 3ML6A 5ICGA 2FNAA 3U9GA 5ERIA 4S04A 5K5QA 2P7CB 1SAXA 1IXRC 3K1MA 3SZPA 5D6FA 1EH7A 3V7CA 5HDNA 3LAPA 4B09A 5HOOA 1KQ9A 1T39A 5ILVA 4IRGA 4LB5A 1R58A 3WODF 4FX0A 3WU1B 3BJAA 1K78A 5E18F 1OR7A 1ZG3A 4EVIA 4KT5C 1G3TA 3BOQA 2M30A 3E5UA 4G94A 4WX9A 5AIQA 2XAFA 1XDUA 2BGCA 4LK0F 4AIJA 2EV6A 4M71A 3FMRA 2HYFA 5HLIA 4P9UA 1S7OA 3FXUA 1SD5A 4LD5A 2VONA 2VT3A 4L9VA 3TDUC 1F1ZA 2M1BA 5IT3A 2DO7A 2LNBA 2WTEA 6PAXA 1F4KA 2F5EA 1ODDA 4O5VA 2GZWA 2VE8A 2EWNA 4HBLA 3DP7A 2NAZA 4XBFA 3V4GA 2H94A 4LLNA 2EV0A 3O3KA 1JHFA 3R6SA 2ZNYA 4UVBA 2VBXA 4ZZLA 4U88A 1IZ1A 1IN8A 4NHJA 1BC7C 3R0AA 3TOAA 3F3XA 2K27A 3V8KA 4EJOA 2D2WA 2EV5A 4A0ZA 3ERED 5JVTA 2MD5A 4HLYA 1XMKA 1RUNA 5L3GA 2DLLA 5IT9K 1P4WA 1EH6A 3Q5FA 2DAOA 2OQRA 2VBYA 2HR3A 4IHTA 3IWZA 1D8JA 3HRMA 3TQNA 4Q47A 4QWQA 5FGMA 1R1UA 3KP2A 1B9NA 4BHCA 3RPUA 3K9TA 4A6EA 1QGPA 4MTDA 3BP8A 3QPTA 3NEUA 1FLIA 1FYMA 4MGRA 1ZHFA 2ELHA 4EV0A 1ON1A 4UHTA 5LHHA 4RB2C 1B9MA 5EEHA 3FF5A 1P4XA 4UVAA 3HRTA 4WXCA 3CO7C 1EV7A 1RZ4A 1ON2A 2OZUA 3ZMSA 3P9CA 1FSEA 2XAJA 2PEXA 3F6VA 2OA4A 1DDNA 3HOSA 2JPCA 4O3MA 1U5TB 3JAMK 3FXRA 2PLYA 5JR3A 3OOPA 3CDHA 4BH9A 5HVQC 1CF7A 5FFXA 4OMZA 1XSDA 2G7HA 2QYOA 2L4MA 4DNCA 2K86A 2F2EA 2NRAC 5E1ZB 4CDGA 4E70A 4A5NA 2NYXA 5L3EA 3WTZA 3JSOA 4O6JA 5DD4A 3GF2A 5CYVA 2DW4A 3ECOA 1EH8A 4IRHA 1KGSA 3CUQA 5H20A 4AIHA 3IKTA 2XKOA 1RI7A 2DFIA 3K1PA 1KU9A 1YG2A 1I1SA 1BIBA 1KU3A 1ONVA 2XV4S 4YIFA 3J81Z 3IRRA 1Y0UA 1SFXA 5ED4A 1U2WA 3FMQA 2JTVA 1HBXG 4HAMA 2MH9A 1FSHA 1XDSA 4BYYA 3KZYA 1Z6TA 3MZYA 2FE3A 4ENJA 5LEJA 1UCRA 2HKOA 3FXQA 4KFCA 4UNOA 1HKTA 1LDKB 3QOPA 2P5KA 3C3WA 3BROA 1TLHB 1R5HA 1S7AA 1J59A 4Y15A 2EJRA 2DPUA 1TQPA 1MJ9A 1HKSA 2JT1A 2PFBA 2O3FA 3LQRA 4HQMA 2K7LA 4ESBA 1FP2A 2WWYA 4G8XA 2ZMEB 2M5WA 2CQKA 2V1UA 1XGSA 3F8NA 5DCMA 4MHGA 1LB2A 2A6HF 4I01A 4YFXF 4L9JA 1Z1DA 3DV8A 1TW2A 4HZFA 4CO8A 5ILSA 3REOA 1R5GA 1CGPA 1USSA 4KMFA 1SMYF 2RNJA 4JK1X 4I0BA 3H3ZA 3W6JB 4NQWA 4BNCA 5DV5A 1F5TA 1ZG1A 3VFZA 1P92A 3HHGA 1TBXA 1MZBA 3C1DA 1O3SA 3TO9A 1IRFA 2A61A 3I59A 1YLFA 3G73A 4JBAA 4ZYGA 2G7UA 3K69A 4MEYF 1H0MA 2ETHA 2VBZA 2Q8KA 3RDIA 3GFLA 2IT0A 1YW7A 3E6BA 1J75A 5DUKA 3ABTA 4M72A 1HXDA 3Q9SA 4LG0B 2LF8A 3RKWA 5FO5A 3EYIA 3BWGA 4N9HA 1J2XA 3WTTC 3ZMUA 2HGCA 1DUXC 4EM2A 3SZTA 2EFPA 3O2PE 1S8NA 3IRQA 1P6RA 2ZXJA 3RYPA 1W7PD 4HLXA 4KUMA 2RN7A 3GUDA 1R1VA 5CVJA 4N0BA 4YG2F 2FMLA 1T2KA 2XRNA 4GCVA 1FY7A 5HLHA 1KYZA 2GWRA 3RI4A 4EJWA 3MFKA 1R7JA 4TV7A 3ZMVA 3GFIA 2L4AA 2H27A 2WC2A 2K4JA 5H6RA 2CGPA 2QWWA 3SHFA 3DFGA 4ESFA 2DU9A 1JGSA 2L02A 1LDDA 3EETA 1KQ0A 3L00A 1USTA 4M6YA 5KK1A 2W84A 4ESJA 1VTNC 3MCZA 2GIVA 5DCMB 1E2XA 1LEBA 1C0WA 2F5CA 1UHWA 3RPQA 3D5LA 1MGTA 3C7JA 3HYIA 1SD6A 1IXSB 2EFWA 4P5OA 1WKMA 1YYVA 5JHUA 3LAJA 4Q48A 3SQNA 1ZLKA 4JQFA 1FWZA 2XAQA 1S6LA 2MLGA 3F8CA 1H9GA 3HSFA 5ILUA 3J80K 3I54A 1R00A 2EFOA 3MQ0A 5FFZA 2AXLA 1J7KA 2XGXA 2OBPA 5D4RA 1Z9CA 2CWEA 3IKVA 2VXZA 3CO6C 3I4PA 2X4HA 2JSCA 4MQ9F 4G7HF 1RUOA 3I64A 4LLGF 2ZMEA 1FX7A 2BBYA 3PFIA 4ENKA 1F9NA 3L7WA 2RGVA 2KJBA 1I6XA 4M6XA 2P7VB 1W7PB 3TDZC 1TQIA 1B59A 3R4KA 5D6EA 5D5VB 3WE3A 2DT5A 3TOBA 4ZZDA 3KEQA 4Q5SF 3TO7A 3J80Z 1UHMA 2R7FA 3FM5A 2BV6A 2FU4A 1IW7F 2V9VA 3I59B 3I0TA 3G3ZA 4HDVA 2V1XA 1FBQA 2FF4A 2XVCA 4KICA 1JXSA 5DCFA 1K79A 2GXGA 3F21A 4ASNA 2V79A 4EJUA 2HTJA 4BHPA 1KQ8A 4EGYA 3M1EA 1FZPB 2ISYA 2DQRA 3I71A 3L09A 2OAZA 2GXBA 2Y75A 1S3JA 1IRGA 4LK1F 4LGWA 4FHTA 1TW3A 4M9XA 3L9FA 2X0LA 3KLNA 3WGHA 4R1HA 4RAZA 2IA2A 1ZG5A 2LSOA 4PGGA 4KN4X 4WWCA 4I09A 2E1NA 2O0YA 3GX4X 3T8RA 2LDUA 2Q2EA 1I1GA 5ICEA 4WCGA 5BS6A 4KN7X 1XMAA 3P9IA 3Q9VA 1BI0A 1ULYA 3N4MA 4OMYA 1W4MA 4QLCU 3SFZA 5E8IA 5LRSA 4OOIA 3FZVA 3N97A 1W5SA 3BPXA 2PMUA 5FB2A 2C6YA 4EQQA 4A2UA 2A07F 2HZTA 5BPIA 2DQLA 2IJLA 4NB5A 1OYYA 3E3VA 1XSVA 2FXAA 2A69F 3V8JA 3LWFA 1FNNA 4XRFA 3HIFA 2PBIA 5A2QZ 2CYYA 4KIFA 5IT9Z 3F8FA 1J0RA 2HOEA 3ZMTA 4CHUA 4P55A 1ZH5A 4OIQF 2KRFA 1HSTA 1SFUA 1K7AA 2HKXA 5D8LB 2J5PA 4P96A 2XUBA 2ZNZA 5L3DA 3ZN0A 3LA2A 2FSWA 5K1YA 3OV8A 5DYMA 2VOOA 3E5XA 2J5OA 1ZGAA 1DPRA 1IF1A 2VC1A 3I58A 1U5TA 3CUOA 1BOAA 2ADUA 3JTGA 2OQGA 4ETSA 1JE8A 1DP7P 1IN7A 4U7DA 3JTHA 4BQAA 2PMHA 1FOKA 2GA2A 1WQ2A 2KIUA 2FA5A 4YIIA 3R61A 4HF1A 1UB9A 3GLXA 1KU2A 2FBIA 1OMIA 2OU2A 3DPLC 1XGMA 2HWVA 1Z6RA 5CJ9A 2QUFA 3K0LA 4ENMA 4MTEA 3JSPA 3V7SA 2P4WA 5LBQA 4OIPF 3GXOA 5LEKA 1ZREA 2CFXA 3K2ZA 1YFHA 1BN5A 2Q0OA 1AWCA 2DK8A 3F8MA 3KP3A 2V1DA 3CLOA 3HHHA 1G4DA 3VODA 2A68F 4GO1A 4F7ZA 1U3EM 1FC3A 2DBBA 4KA4A 4RB0A 4BAYA 1R22A 2GQQA 2KKOA 1O7FA 2Z9OA 1YTYA 4A0YA 4Y17A 2ISZA 5FLXZ 2FEZA 5BPDA 1TTYA 1ZRFA 1PUEE 3ZMZA 4IXAA 4R79A 2G9WA 1BJAA 2VBWA 3MAJA 4HF0A 4MEXF 3TKYA 3GFMA 2W57A 2DPDA 4CICA 1I27A 2ZKZA 2XHKA 2YPRA 3E97A 2EB7A 1AOYA 1TNTA 4G7ZF 3EDPA 4G6QA 2YX4A 4WF2A 2VOPA 2DTRA 4K2EA 4UV9A 3CJNA 2JPBA 3FM3A 3NRVA 1RIOH 4LB6B 2CO5A 2Y0MA 1LQ1A 2FOKA 2QQBA 1S29A 2XIGA 2ACJA 1G6NA 1U78A 1OKRA 2A6EF 4CXFA 1L3LA 5LHIA 3J7AO 4LFUA 3WGIA 4L9NA 3VEPA 4U7BA 3ULQB 4RB3C 2YSRA 3F22A 3FWEA 4Q4ZF 5LGTA 2UWMA 2ZBKA 2O8XA 2KIFA 3K1NA 3F72A 2XKPA 4RGXA 1K78B 5F64A 1NHAA 3P7NA 2YX7A 5L3CA 1IN5A 2ZO4A 1X3UA 2FNPA 1WRJA 3DF8A 2FMYA 5EEGA 1IUYA 1WI9A 5HS9A 1I5ZA 2CG4A 2ZCWA 3B02A 2AS5F 1G3WA 3HSRA 1GXQA 2WV0A 3T1BA 4U0YA 1SD7A 3DQVC 1MD0A 5F1RA 3KCCA 5E8GA 3DKWA 3QU3A 2RDPA 1D3YA 1ZARA 4ZYHA 1KYWA 2R7DA 2L01A 3R60A 4EJTA 4UVCA 1LJ9A 1LNWA 2VT2A 3KP7A 3WU0A 1BI3A 1J9IA 3IHUA 1XCVA 4OIOF 1HKQA 2XAGA 5HS7A 1W7PA 3CUQB 1OYWA 4ZYEA 5AONA 3FX3A 2TDXA 1QO0D 2UXNA 1XGNA 2JZYA 2PN6A 4KMUX 4GYGA 2H6BA 2STTA 2UXXA 1GVJA 2EA2A 3BY6A 2ZFWA 1QPMA 4UV8A
chains in the Genus database with same CATH superfamily
2ZS9A 3UGTA 2VPQA 2CNOA 5B55A 4A5MA 4UNRA 4XDGA 1EPUA 5C4MA 4CSWA 1VSUA 2WZCA 4CF7A 2ZUFA 1I0LA 4N9IA 3WMFA 2XAUA 3DV0A 1E9BA 4JBIA 3X2FA 3GELA 3QPBA 5NLLA 1XQVA 4LKRA 3O8CA 4PLZA 1ZA2A 1U04A 3BDAA 4WK6A 4YO8A 3UMSA 3V6LA 4PCVA 1DNPA 1ZVQA 3T35A 2NS8A 3CNEA 3FOFC 1EK5A 3NTOA 4FT8A 2YTZA 5I7OA 4JBYA 4J3JA 1XZJA 3RC9A 1R8JA 3R6DA 3OAAA 1OBVA 1ETXA 2J87A 3RSLA 2EEPA 2ZM5A 3BHNA 3RTAA 4AF6A 1SMKA 2HO4A 5T7BA 1D04A 2FB9A 3LZCA 3J7TA 1U3GA 5JCJD 1CK4A 4RMIA 1GFWA 1UEIA 4XCQA 5DTJA 3V4LA 1NTCA 3QTBA 1V8ZA 4E12A 1DX6A 4WX2B 4FOLA 3N5CA 1PNVA 4ENQA 1CRLA 5CAEA 5JPCA 1JHDA 2OB1A 3DOIA 4EG4A 4D9FA 3VZDA 3RHTA 4H1HA 3JYLA 4MCAA 5KPJA 1UK7A 2FJ0A 3DEJA 3KB6A 4FR0A 4KGDA 4BNKA 1VKOA 3D5QA 1GDTA 3DD1A 4EWLA 4XLNF 2EH3A 2I4OA 5DLQC 1HURA 4HDOB 1W0KA 3RAEC 5EE9A 4BBRJ 1Z36A 2J1LA 3V3TA 5F51A 2CRGA 3BCBA 4WK2B 2QB5A 4ZOAA 4J6EA 5DCYA 5IVKA 5DB4A 1E3HA 1D1TA 2E1CA 4HWKA 2G1JA 1RXVA 1B15A 2O20A 3NXKA 2JGEA 4KQ1A 3WTVC 3FPHA 4NEHB 4TLBA 5IT0A 4A8PA 3E9RA 4LHXA 2ZATA 3GLGB 2NUAB 4WTOA 1BROA 3CF4A 5KNCA 5TE9A 5A4DA 2R6HA 1Z7UA 2ZRMA 3CV3A 3R3VA 5B53A 3ESDA 4C4TA 2CXQA 3FSRA 2PIDA 1Q0RA 4XSHA 4BHTA 4AAYA 4H60A 4ZPJA 5KSZA 2H09A 3B1FA 4P0QB 5E9QA 2VNSA 5BOSB 2O2XA 2VQDA 4W5HA 1IG7A 3MRVA 1MBZA 2OHGA 1M2NA 2UAGA 2JLSA 3B1JA 1DXQA 1N6LA 4HB3A 3A6FA 1L4BA 4LDQA 1L7MA 1NSYA 3LYAA 1Q7GA 2F1OA 2HPMA 3REQA 2CUTA 2M6LA 3WZLA 1NU8A 3B13B 1QVRA 1W0TA 1WXEA 4DL9A 5BSVA 4XKWA 2CVQA 4XRGA 5IANA 3MA0A 4D25A 4YRVA 1H2XA 3G85A 4G6TB 1TMKA 3ZU6A 2F64A 4MR7B 3LT2A 5JWRA 4ALLA 3F9KA 1EKEA 1YR7A 3KE8A 5GJVC 1QIIA 2P11A 3ZR4B 1MG5A 5LFAA 1MHTA 4FHDA 5K3SA 1YO6A 2QZ8A 5CA1A 1SB9A 4BU1A 1E2PA 4Q7MB 1VJ5A 3EUAA 4H27A 1HWYA 3IS3A 4WXDA 4EQ6B 4I0AA 1SXPA 3HDDA 4LKOA 4IG4A 4W1QA 3D0OA 4PLCA 4RZSA 3RYFB 1YULA 1ZESA 5H02A 3PQDA 2BZTA 1GUUA 4A2WA 2OD7A 5ITZA 1NJ6A 5ITVA 2A94A 5KB3A 3NH6A 5JTTA 4RJ2A 2RIRA 2J9YB 3NP9A 4GOND 4MV5A 1WQ1R 1L5MA 3DJFA 2FJPA 3F46A 4MUXA 1GA4A 1TNDA 3GIDA 1B72A 2WD7B 5THKA 1IMJA 3U80A 2JLWA 4QBKA 4XSXF 1A31A 1T8TA 1B0UA 3AR7A 3HJGA 4AJ4A 4EKEA 5DM0A 4K1LA 3EZLA 3ZDEA 4JJ6A 5FO0A 3QPHA 3O4GA 4CLDA 3TW6A 1KJJA 4MZDA 2W8BB 4PONA 1BQ4A 2HCRA 2PH5A 3KJNA 4GGOA 2C1ZA 4ABYA 2Z99A 3PUWA 1PFKA 3BRCA 3R6TA 2EV9A 4OYLA 3OCXA 4EHFA 3HU5A 3IPCA 4EM6A 3W8EA 4DSOA 2LYCA 1VKNA 3L7IA 4F2PA 5FNZA 4OB7A 3OYCA 4DFDA 1ZVJA 3HMKA 4O59O 2ZVQX 4NY1A 4KSCA 2QENA 3MMSA 3Q8XB 2WHEA 4WL0A 4Z1MA 1NM5C 4UPEA 2C7QA 3C4QA 5C2JB 1XU9A 1WXGA 3BZCA 1WWKA 2V4ZA 1U3CA 2FQ3A 3LPMA 4EF5A 1LSUA 2JATA 3O4FA 2ZIXA 1LZKA 3U1BA 4BMDA 3ZXSA 4MJXA 3WWCA 4LBZA 4Q7EA 1SVMA 5DD8A 2C42A 1LPPA 2N47A 3QZUA 3PPYA 4UAVA 2IRFG 2Y0SN 1JFFA 2WJ3A 4DLPA 4EYOA 5L3BA 5I51A 2JLUA 2P0WA 3A31A 3BR6A 2PX5A 2PVSA 1KIAA 3PTAA 3FAZA 4JITA 1JPVA 2RB5A 3KLBA 4DLVA 4YUZA 1ISIA 2ACVA 3FCSB 4NOLA 3TMKA 5IT4A 2PT6A 3PX3A 1Q20A 4BBAA 2QL5A 3G3EA 1YJNI 1ODFA 3LSKA 3HTXA 3UOWA 4GAEA 5TGTA 1QOZA 1KXJA 3DZKA 8MHTA 1RNLA 4OINF 4CUZA 3CCJI 4KDPA 4E7SA 1QDEA 2GETA 4OQMA 3EHDA 1VC2A 4MPRA 5FP0A 5TISC 1AKTA 1DBWA 1RESA 3MKZA 4P32A 5KNBH 3GEZA 4PSXA 1K68A 2YC4C 3BWYA 3RJMA 2L3DA 2FPIA 1BGXT 1JWAB 3I76A 5H81A 3HXLA 4EBFA 2IOFA 5B58T 2HL6A 2ZAGA 3IAM1 1E5LA 3QFHA 5KNCD 5KBYA 3ZP5A 3R0JA 1P6QA 3LMKA 4HAUA 4WOJA 3CUVA 1FT9A 5DNUA 1ETOA 3JRWA 1PL0A 1IV8A 3OZVA 2PR2A 4K9DA 4UD2A 1OYIA 4F3NA 1W7AA 1UPUA 2DJNA 2PX8A 4LPKA 4EA6A 3KEYA 1A5SB 1G7TA 4Y2YA 4UXNA 3ZW8A 1X7XB 5PNTA 1EI9A 2RAFA 3RH0A 1OWNA 2P9EA 4BB9A 4UUSA 1S3GA 4D8VA 4DLBA 4ZCTA 4BJ6A 2P2SA 2ZYDA 3AFMA 5DGXA 4CKCA 1G7RA 1I13A 2QMUA 5DHPA 1OYOA 2O7QA 5H3LA 3BJMA 3NOVA 3ASOH 1G5PA 2Z09A 2Q3FA 2E4YA 3K35A 3O9MA 1EDEA 4B3MB 3CWQA 1LJ8A 5HKOA 2HT6A 2R4UA 2JLQA 4PZ9A 1MF7A 4G5YA 1QV9A 3EXFA 4A93J 1LPAB 4UM7A 3W1VA 3LL4A 4LGVA 1CF4A 1IXKA 1XCLA 2ODBA 3HTSB 1LBIA 1WCWA 4JHXA 4N7JA 4TTIA 4YP9A 3TW8B 5CVUA 3V8LA 4CYCB 1R9GA 2MYSA 3NDIA 1N3YA 3AOEC 1N7GA 1F0KA 4G0YA 4Y6PA 4IKEA 3P71T 5IDQA 3WL3A 1RYMA 1KZHA 3N58A 5JAOA 3QFFA 3EN0A 4BBZA 1HNXB 2C77A 3NALA 1GEGA 2FFQA 2GN0A 3B3FA 2G80A 4F5YA 4C1BA 4OFXA 1HSJA 1I4OA 3PUYA 1XK7A 4YJ2F 1E4YA 1PK8A 4IIJB 1WZIA 2F6CA 3TLMA 4NU0A 1XQWA 3FRJA 2FSHA 3QJ5A 4V02A 1EKXA 3MWMA 3M3YJ 2BEJA 3MEQA 4GX2A 2C0QA 4OB8A 3X1XA 3VKGA 4IS2A 2ORWA 2WIJA 4M7PA 4GYYA 3FCEA 2D1HA 2J6IA 3H2JA 3FTCA 3ISVA 4QBIA 1K63A 3JU3A 4ZIRA 3ORRA 3T0IA 2IHUA 4KOAA 3MG9A 1Y9JA 4HQOA 4PN3A 2Y69H 2F3UA 3GFVA 3KHSA 3V8BA 4PG7A 1G3SA 5EE3A 1A88A 2Q1YA 3D3KA 3G7NA 2W6OA 4PYLA 3FNQA 3VDQA 1KJYA 2HU7A 3PNPA 5J4KA 4UNPA 1FMFA 3ZK7A 2XYVA 4N4NB 1NVFA 4ZU1X 5GP9A 1C9NA 2FPRA 1I7PA 2WKQA 4QO7A 2MR6A 2XGCA 2WTMA 2X23A 1XSEA 4BMPB 4KGXA 1MGPA 1TC3C 1ZNQO 3HO1A 1BBYA 4QBGB 3SS7X 1HG1A 1WY5A 1YR3A 4IDQA 5HFNA 3WBJA 3IAEA 1F1JA 3FLBA 1ZINA 4L74A 5AJVB 4X66B 2P90A 1UBTS 2MIIA 3K9LA 4OHOA 5EOVA 4AD9A 1YHQI 2H1WA 1S2IA 5DM70 3WYFA 1Q7EA 1KI7A 5I9IA 5FI0B 5H82A 2ID3A 2J0UB 3TIGA 5LIRA 3Q9NA 3KZKA 4LECA 3VNUA 3NATA 1R6AA 3V1LA 4KDRA 5AHXA 1W35A 2PWZA 2TECE 4CGZA 1Z0AA 2IEYA 3K09C 3KKOA 4LJ9A 1UZCA 2BTQA 1R88A 1X3LA 3S44A 3ZLUA 4DQDA 1CDEA 4RADA 3FKIJ 1GPAA 4F8YA 4UMVA 4G1UC 4EK9A 4J7UA 4OU0A 1V8FA 4Z7OB 3UT5B 4EP1A 2OPBA 3NYWA 1UDXA 5DKFA 1AQJA 1QP7A 2GM9A 1Z08A 3MJVA 5FUQA 1YITI 3CC4I 1E5VA 3IHTA 2I67A 4O33A 4YTEA 5ULLA 3WYEA 5KOJA 1LSJA 3TTWA 5L45A 1HORA 1UFMA 3N2IA 4OXNA 4RDHA 2O8DB 2XAHA 2WJAA 3AH8A 1NVUQ 4G9GA 3M8EA 3Q6NA 4GGGA 2WSBA 4NC9A 1FTQA 5EIWA 3UOGA 2IH2A 2FRXA 4YVFA 3F6RA 2VP3A 3B73A 1FTSA 2J09A 3WK4A 3WQBA 5F9HA 3D3NA 4G37A 1HZJA 4HPQA 1ISMA 3CGWA 3EUHC 2CEAA 3II6X 3PNQA 3TL2A 3G5MA 4XSGA 5K99A 2HUPA 3WJ7A 5KYUB 2PMZN 3VNBA 1CY4A 1R4ZA 3KE2A 4TUYF 3UCXA 3C3XA 3OESA 4NICA 1QMPA 4NULA 1FDWA 2L0KA 2BKXA 2FE4A 3CR3C 4G26A 1K6OA 2PE5A 2P27A 5DGHA 3NXSA 3CCEI 2C8VA 2CLLB 3Q3SA 1C1DB 1O03A 1U63A 4BV3A 1YQ9A 3H5RA 3ENNA 3UAOA 4B3SB 4MCHA 4P4TA 3ILYA 1MZPA 1C8BA 1M1EB 2PBLA 3VR2D 3PJEA 4V0MA 2EOAA 4TLEA 3EDQA 1KJ9A 3COAC 1Y3FE 4GWGA 4F5DA 4V2UA 1GM5A 1Y3AA 5JDCC 2GNPA 1NQWA 3CLTD 4KQ6A 2EA4A 1E17A 2NYVA 2WILA 3MS7A 5C1IA 4EHIA 3MKWB 5AIPA 3CCQI 5M5XJ 2AHOA 3LL7A 3WQRA 1U5TC 5A0VA 1UQRA 2Z4SA 2DFPA 4QYIB 1SBQA 1HQCA 4KXVA 4XQFA 2BCJQ 1T1IA 2GKGA 1QNTA 2JA1A 2W2KB 1DMRA 1XEWX 3PB3A 4BX3A 1UZLA 2I4NA 3IR7A 2GNAA 3MKYB 1O7LA 1EDBA 2IE0A 1ES9A 1OT3A 2IY7A 4QU5A 5HCUA 8ATCA 3ZE6A 4YCNA 3M3PA 2HB6A 3TO6A 1E7QA 3GX1A 1F17A 3KCNA 4TXLA 3V48A 4YJGB 1EU1A 3L4KA 2Q7XA 4HSEA 3GAFA 3HUGB 3Q8KA 1OZFA 1C3XA 3T94A 3O82A 1Q1EA 1UKZA 3L0DA 4KIWA 1NNI1 4JYMA 1BE8A 3NKVA 1E20A 5A71A 2X0FA 1G21B 5CLQA 1F8UA 3BCHA 1TUBB 3KJIA 4XLTA 3W6KB 1RPAA 3HRSA 4YFKF 1MUUA 2B7BA 2QVOA 2WUEA 1P5HA 3FPSA 2MTBA 3MC1A 1NJ1A 1A5TA 4R0NA 3ACDA 2PUBA 4LXIA 1T6SA 3RTEA 1PJZA 1FMJA 2GCGA 1XLWA 4XLHA 4DBQA 3CF2A 2YFYA 2YS7A 3RUDA 4DG9A 3A05A 2E1RA 4ND3A 3NOOA 2HHAA 4PIPA 1AGYA 2EZ8A 3SBEA 1NW6A 1PS9A 1NTRA 2OMKA 4FDMA 2K9QA 2WIDA 4UBJA 5CQGA 1FJHA 1XEXB 2XZPA 5HQ3B 1ZFNA 2I5UA 3I34X 1Y0NA 2ECQA 1U8EA 1SAYA 4JBGA 2LREA 1BFKA 2E2WA 3FOEC 3HTUA 2JZNA 4N1AA 5IK2A 5CDSA 3N75A 4WXHA 1WSUA 4FW9A 1NG9A 1MV8A 3A11A 3P5JA 1NN0A 2GCNA 3JRIA 1N5LA 2MWMA 3KOZA 3QVXA 2W42A 1SUEA 3WLMA 1M2OA 4YYEA 3QEAZ 1AD2A 1E2DA 2PT9A 1QQBA 4CQLB 4I1IA 5AVWA 5EWLB 5IY5H 5CVRA 1TZCA 2EBUA 2W4SA 2MSDB 3AESA 4IIJA 4O3FA 2BGWA 1TJ5A 1UBEA 1Z5UA 3W9UA 3M70A 4WFKA 3WI7A 1RTTA 2P2LA 1YW9A 1XPXA 1O6GA 4FUTA 4XDZA 3TMAA 3RIRA 2QN6A 2C7VA 2WKSA 3DFFA 3IEPA 1P4HA 1YMUA 4RULA 3BG7A 1THGA 3CLRC 3GLFE 1D09A 1D8KA 4HOYA 3G0IA 4LWZA 4OI2A 1O97D 3OYMA 1FIPA 1T24A 1EMDA 1VZ2A 1OF1A 2F3TA 3FB1A 2QXTA 3ZV6A 1AA9A 3PEYA 3W3CA 1JG1A 1FOWA 1UT8A 1NP7A 4IRIA 1SHTX 3AINA 3FOCA 4QTZA 1FA9A 2YOGA 3FWYA 4RA6A 1X4PA 2ZJ2A 2ONZA 1R9NA 2Z2KA 5DDGA 3K8QA 4OHMA 4AIRA 1ICEA 3D6NB 1XALA 2EX4A 5ALHA 4IEEA 3CLRD 3EYYA 5BSWA 3RYHA 4XCXA 4C01A 4PINA 1KWKA 1DAEA 3KP1A 2ESNA 1UDRA 2QMHA 5K09A 4IO0A 1UJ8A 1G3UA 3AR4A 3R9WA 4I6ZA 5AVRA 5GADl 4UOQA 2VTBA 1FQKA 1TQMA 4RVHA 3CC8A 2EGGA 3A7DA 1JA0A 3FMVA 5CJ2A 1UMCA 3U09A 4FOOA 3KETA 3UKOA 5I48A 3K2BA 4Y7CA 1O96B 1IZ0A 3OYBA 3K0CC 5DT2A 3MKLA 2IPLA 2R751 3LYUA 4Q3AA 4QOEA 3ZW7A 3FZEA 1FS4A 5AW2A 5K0ZA 3GO5A 3C18A 4NK5A 2H7VA 3ZHXA 5D8KB 1M8FA 4C0LA 2JUGA 3WA7A 1EIWA 3QYEA 3F97A 3PGA1 3U44B 3KPJA 3GVAA 4HGYA 5F98A 5A3JA 3S2GA 3FBIB 3VBEA 1ESZA 1U6GA 3AF0A 4ZDKA 1FXUA 4ZHSA 1V4RA 4BYMA 3DPTA 2D1SA 4FN5A 4O8ZA 4OMDA 1ZCAA 1G9TA 1SQGA 3VU1A 2EFNA 1DAIA 3PUJA 1FVFA 3OZDA 1JFRA 2NWQA 3QLEA 1RHQA 3TRHA 4M9SA 5MN5A 3AHGA 3QBDA 4A36A 2ZCVA 4RX1A 4F9TA 4EUFA 3GBSA 3EY9A 3HABA 4UEJA 3WX0A 2IH5A 2HOAA 3JQAB 2OHOA 2YN2A 4R16A 1BI1A 2IVMA 2Y48A 4X20B 5IWAB 2NQ2C 2IF0A 1B6AA 4C3HJ 4IHSA 1FF9A 1L7RA 5A2QK 4Q4CA 2XXAA 2OFOA 1FBSA 4N3AA 3FXJA 1G60A 2REXB 4HQLA 1EA5A 2XUIA 3MLBA 5EWLA 1EFHA 1AS3A 2Z16A 3TIXB 2K9SA 1RXIA 3DE0X 2NNYA 3RIMA 1XJCA 2RMKA 3DVSX 3RVLA 4L4ZA 1I9GA 3A9UA 5DNCA 3SE7A 1AKRA 4HDUA 2VP2A 3THWB 4DWJA 1PFVA 3PHGA 3QFSA 1FIAA 3ZWVA 4RTQA 4LQLA 1JDVA 2V6FA 4UXHA 1H4QA 1XDZA 1U9YA 4M1EA 5EMHA 3HCAA 5IAEA 2JJ2D 3HO8A 4K9MA 3ZWDA 1LY1A 3ACCA 5IM5A 1HW2A 2N1BA 3AL3A 2IFTA 3GMIA 2FPOA 3WSVA 2B4RO 1KEEA 2NMVA 3OCUA 2FPPA 2HRBA 3K6SA 3AI3A 2Y0CA 4IHJB 4NBRA 3KT6A 1ZI8A 2CL0X 3JRGA 1E1QA 2VRBA 2UUZA 1MDMA 1GG2A 1WB4A 3MWDA 3TL6A 3VJMA 5K8JB 2AYZA 1URPA 4H15A 4TTSA 4B17A 1RMQA 4LJYA 2PA0A 1FFEA 1KZ1A 4WKOA 3TYXA 4WBNF 2IYFA 1YQWA 1CZKA 3UO8B 3PCXA 2CYCA 2BYVE 3LPCA 4JUAA 4WZBA 4R9SA 1TM7E 1K75A 1P0MA 4GP6A 2VJOA 2IXFA 5I4BA 3CUQC 3LZDA 5AJZA 2C84A 5FKOA 5GM1A 2QQ9A 1YJAA 4D74A 3HHEA 4P5PA 4E0BA 1QQ7A 4BX8A 5IC4A 2D7DA 2DA5A 1G6Q1 1SBHA 2RKBA 1N3LA 1GU0A 2XMRA 2DQYA 3OSUA 2IBTA 5AK0A 1RRGA 4MLDA 4KC0A 1OFTA 1ZK3A 1N9ZA 2V6BA 1VHLA 2P5TB 1QRAA 1C3LA 1ZOLA 3A3OA 2OKCA 3AXSA 4XLCA 3EVEA 3KQWA 3TGWA 4ZZIA 5GV8A 2AFIB 2JGRA 4N12A 2IEZA 3LGXA 1MEOA 1VYUA 1Z68A 2DM6A 1X1CA 4IW3B 1QONA 2QV7A 3AVQA 3AERB 1NY6A 4GMHA 3ZC3A 5HM6A 3QUBA 4W82A 1MTZA 2ZB9A 2YX1A 2B7LA 3B9QA 4BL5A 1YS7A 3CCYA 3J81K 2VKTA 1P75A 4IXMA 4BLUA 2AW5A 3UN1A 1I3NA 3DBHA 2Q5QA 4FJ1A 1Z0XA 1MCZA 1PG5A 3TWOA 3UCEA 3VUEA 1A5JA 1YS4A 4W8OA 4PJJA 2BLNA 2BFFB 3A2LA 2ZQZA 1YQUA 3FIJA 5HIJA 4QKQA 5L9AA 4HSTA 1VQ9I 1VIYA 2PXCA 2V7BA 1AUOA 1JNXX 1X7WB 3CFYA 4A3GJ 3FCOA 4PYKA 2PXAA 2X2FA 2YV5A 4IP0A 4YCMA 2BGUA 4OY3A 5EQTA 3OL3A 5KWJA 2X8JB 4TKUA 3IC7A 4MO7A 2XKJE 1QORA 4QYMA 5CKTA 4DNFA 3GEHA 3QSGA 1SD4A 3DOEA 3ZXXA 5IU6A 2DTZA 3G71I 2WJPA 4RTSA 4J0HA 1RPZA 1MHPA 1GHTA 4RV9A 3DH0A 4Q4AB 4XXHA 5DDIP 1YVDA 2V1NA 1MEEA 1QUFA 3IMKA 5CD1A 2BW3A 1SKUA 2QV0A 3VB2A 1V4NA 3A6EA 2IDJA 2W83A 3AZPA 2XNSA 2ACEA 1I32A 1U1DA 2HPZA 3H1BA 4QXAA 2BSAA 4A10A 1DX9A 4D96A 4NARA 1QVZA 2Q4EA 3R4VA 2PLWA 4TL8A 3U60B 2XUHA 3UANA 3IUOA 4N39A 5HJ7A 3ZEAA 4JLJA 1W5EA 5ELLA 1MJFA 1T35A 2VHYA 5CX1A 3A6GA 5AUQA 1Q2XA 3WKAA 3S93A 4HLQB 4CT4B 1ACJA 2YXPX 5J1TB 3EPRA 4Y13A 4YDHB 1B4AA 1YBFA 4Q12A 1QRRA 4HNQA 3ESZA 1VGQA 1RXSA 1IQPA 1FNCA 1S9DA 4JU8A 2M6RA 4ALJA 2I03A 4FB4A 1O3RA 2QXYA 2QDKA 2GDJA 3SHQA 4CF6A 2WK1A 1MJGM 5T6BA 1BS2A 1E7MA 2BUCA 3GR6A 4D79A 1WSAA 1U1IA 4B8XA 5D87A 4E5KA 2K2QB 1GKIA 2EDAA 4QQNA 4BLSA 4C1NA 1ZRMA 4G5FA 1MVNA 3TVYA 2VDNB 4R8HA 1NBMA 1L4MA 2BMWA 2HTEA 1QNLA 3CBQA 3R6LA 4MYUA 4WEQA 3RLIA 4YRBA 5SYMA 4KSBA 3J7AY 3ABUA 1DKLA 2X0KA 3LUBA 2NVQJ 4X3CA 3KX2A 1YJXA 3MFQA 4MKGA 4YMWA 1UBMS 2YR2A 1I7NA 1I80A 1X80A 2RHOA 4KP7A 4PO1A 3C6ZA 1RQPA 4X3PA 1XCPA 2GTPA 5HF6A 4JUBA 5LXTF 1N2CA 2Z56A 1ESMA 1VHQA 1VECA 1NRXA 3F5FA 1BH6A 1Q1BA 4IVPA 2H2WA 4KPUA 1G2OA 5F0HA 3I45A 4Q4HB 1MJAA 1DC4A 4YP5A 3DEKA 5FI1B 1NDQA 4RIGA 3REGA 2ORYA 1NNUA 1II8B 3RTGA 5CLSA 1EWTA 1Y3HA 2GJKA 3TZBA 3EPPA 1T0BA 5IKOA 3MT7A 1H2AS 1ND5A 4B5KA 1T95A 4U9UA 3U5TA 2FV8A 3HSEA 1Q1ZA 2ECFA 1R4MB 1EUDA 4QICA 1GPUA 5JJBA 3OQHA 3H35A 3ZBPA 5A04A 3X1ZA 2HQNA 3M2PA 4X7MA 3X2EA 4PC1A 4RY2A 2QGUA 2XGDA 4JJKA 2PMEA 4EG8A 4TKVA 1FLVA 2N9UA 4DZJA 4W1UA 2II6A 4MFDA 1YX3A 2ZI9A 4FMDF 5KVAA 4J2OA 4YRAA 1GRVA 2QM8A 2VEDA 3GP5A 5K01A 4FT4A 2CHGA 1G9XA 1NFRA 3GJ4A 4FYIA 5DULA 1Z3XA 2ZRCA 4WKPA 1WKCA 4D1YA 5BT8A 2F7SA 1TO6A 2G9UA 2XX3A 3ECHA 5AI0A 3PR3A 5FV4A 3H75A 3LUFA 2WSLA 2EFQA 5AQEA 3R3XA 4TSFD 1V11B 5AVKA 3NQOA 1P60A 1IDN1 4HN4B 4Y9TA 2ZRQA 5FBQB 3Q7TA 4CFYA 4D9GA 4UE3S 1L7QA 3N87A 2K4BA 4AKIA 1W0KD 1A8SA 1MH4A 1NUUA 4NZZA 1SA0A 4R40A 1CUYA 1KFBB 2QRVA 2ZVJA 1AS0A 2DCEA 3C24A 5AKYA 5CAEB 2R8OA 2R7KA 4Z9FA 4AWBA 4YBRA 1DDGA 2NS0A 2CWDA 4GOOD 4ALIA 4DQ0A 2PX2A 1L5VA 4G3XA 2CVPA 2YZMA 3OE7A 3IP1A 3FMSA 2ESHA 5AH0A 3ZVMA 5AO9A 3IEMA 2RHLA 2CT8A 2FFBA 1MX9A 2HJRA 3MD0A 4LE0A 4X63A 1N8TA 3KEOA 1QZUA 1QQAA 2WM8A 4PGMA 4F8JA 2VHCA 1PN3A 2C2GA 3WG7H 4QT0A 3ZLJA 1G5FA 3FHZA 3KT3A 2J3DA 3P9KA 3L4BC 2I8CA 2EC5A 2R6GA 3LX8A 4S1TA 1TU4A 3KQNA 4EG0A 3N28A 1G4UR 2V6MA 3GROA 5ENZA 5TV2A 3FHOA 2O2HA 3JWPA 3RVBA 2A9PA 2NPIA 3EBOA 3C4VA 3FX2A 3KDAA 3LT0A 3GZTB 3HY4A 2M4GA 2WE8A 1C14A 3LXUX 2Q21A 1WSDA 2XB5A 1H3NA 4CZZA 2IGNA 1XL0A 4F6LA 5F1JA 3FWNA 5JO0A 1RKVA 4K46A 3STVA 1ULSA 4R8MA 1MRZA 2KFDA 2WADA 3EDOA 4EJ0A 1REQB 1TEHA 3HDQA 4PTLA 1CNMA 4QT4A 1TZKA 1CVIA 1GGVA 3BTCA 1FW8A 2JHFA 1I30A 4TYNA 3VR4H 5C32A 2DI3A 2HYGD 2NOJB 1SU7A 4GX0A 4KO2S 5AW9A 3Q8MA 1QYDA 2JJ7A 4ZODA 1E79A 4D56A 2Q1ZB 3I9LA 1F2TA 4RLQA 1YFZA 2ATIA 3FH0A 3IUJA 3MGKA 4J1TC 4UTXA 3L8GA 3GZ5A 1N6HA 2I2XB 1CVRA 3IH4A 1BA3A 2BHZA 2JHPA 1ECJA 1WJCA 3B89A 3TSZA 1PR0A 2ZIVB 3UZUA 3CLQA 1RHMA 1GUBA 2FQQA 2JARA 5T4BA 4AS1A 4K86A 3ZKWA 1M8PA 2E37A 1XQ6A 2R97A 3MWLA 3OZGA 3GYGA 1MA0A 4KE6A 5CURA 1N7IA 4ENTA 1TJ4A 3FMIA 1YAJA 4NDLA 3OEWA 1W96A 3BTIA 3PEVA 3H2SA 3LZ6A 4MW9A 1YA8A 5LHGA 1NLUA 1UXHA 1DQUA 1I2CA 3V2IA 2L9NA 1H2RS 1MKYA 3FSJX 5DH9A 4G9EA 4ZVMA 3BR5A 1X94A 5FOUA 5JQGF 1OWLA 1H2ZA 4MS1A 4TKZA 3I1FA 4HK4A 1BMFD 1F8XA 1LI7A 2I4TA 2AF3C 5AI8A 5DWDA 3WDSA 3FM9A 1P1FA 4UUVA 1X9GA 4BB6A 4KL8S 4Y33A 1M5UA 1VRWA 1EX7A 2GD2A 3KQTA 3E6CC 3GARA 4P58A 2IWHA 4RTMA 4RS8A 4M9CA 2P8TA 2QVGA 4IZZA 2J5KA 4MPDA 5HMLA 1P74A 1WE2A 4ILEA 1T0FC 2MFZA 1P8JA 4DIMA 3GF4A 4HS9A 5K3CA 1KY2A 1ODKA 2HU8A 1ZJJA 3DEUA 4ZEXA 4EYQA 3WP1B 1QH1A 2VNIA 4I5EA 4HLNA 3RT7A 3PG5A 4J1NA 4PE5B 4C7BA 4JAVC 1J25A 1JPJA 1ZVMA 1NMXA 3UAVA 3UAYA 3VAAA 1RQXA 2KQUA 1NI5A 2XB6A 5IKMA 3I3SR 2HFKA 2O4CA 2R8PA 3M1LA 3R0QA 1YXMA 4F56A 3HXMA 3S2SA 4Y0AA 1HL3A 1UM8A 5K5QA 2C92A 4HY3A 3Q0WA 3L2RA 3PRYA 3K0BA 4N5DA 3OR2C 3H4MA 4Q0MA 4UBIA 3V1YA 4B79A 3CVYA 1QLHA 2NP7A 2CXRA 3A4MA 1QH8A 4KMRA 3KB2A 4UTRA 5KTOA 1EH7A 1X2MA 4PG5A 3LAPA 4P81A 3FBTA 4YMGA 3A32A 4A4DA 3UHJA 1Y9ZA 1L6RA 4IGFA 4QECA 4EYGA 4B6QA 1WCIA 1T39A 2JAHA 1T3LA 4OP2A 1C4WA 2O52A 3VZQA 4XKBA 1U2DA 2A3NA 2ZUDA 4AP5A 2EW8A 1V4BA 4J75A 3A3YA 1SGWA 3GN2A 3K1YA 4W7SA 3BQYA 3ROZA 3CLSC 2BHYA 1K78A 4BNZA 2NVYJ 2WFMA 1JIQA 4KMOA 2VZLA 5JD4A 1XA3A 3GFRA 4PLGA 4TQGA 3VDNB 4EUHA 2NO7A 1I7SB 4B0PA 2NUTA 1OR7A 4QPJC 5TPWB 3U7GA 1ZG3A 2NACA 3PXAA 4BKPA 2IDZA 4F2WA 2I54A 2WT8A 1MB3A 5FFNA 4E6KG 1G3TA 3U3ZA 2GN9A 3S8YA 1EFKA 3BOQA 3ZV7A 2QD3A 1Z5OA 3Q98A 4LYAA 5C1DA 5EZGA 1EAYA 5CGQB 3SQXA 4CL8A 4YJFA 3G9TA 1M2FA 3ABQB 2WSSD 5DTIA 5GZ1A 2JAPA 4V2GA 1XGKA 2M0MA 2E3JA 3KHTA 4QELA 4ZEWA 3UWPA 4JA0A 2I8DA 3KVRA 1AXEA 4LK0F 2AI2A 4P9NA 4N8SA 4AO7A 4F06A 3UPTA 1TU0A 3PNTA 1NPDA 1MD9A 5KCMA 1MNQA 4TKLA 5JBIA 3ISTA 4K6OA 3NTXA 3D31A 4M3GA 1CVLA 4RZ3A 5C8XA 3TOCA 2HXSA 2WHYA 3WTCA 2HWUA 5D86A 3HVKA 4RTNA 3NO4A 2QLFA 4K03A 3QG5A 2BC9A 2BKLA 4L9VA 1ZQ1A 1ELOA 3IAS1 2CYAA 1F1ZA 2VK1A 3L8FA 4YCDA 3WL7A 3W5BA 4J90A 2KE5A 2DO7A 3PFWO 3EPHA 1J49A 3I8SA 4L9SA 2LNBA 4ENUA 1NP3A 4XL9A 4XORA 1RRPA 3HXPA 1SPBS 4F52A 2IPAB 2EJCA 1KOJA 3AB8A 3NJ4A 3S2FA 1B3BA 2WTEA 3ORHA 4X5OA 3ZLVA 1LLFA 3OJLA 1ODDA 1CU1A 2ZDGA 4Y1GA 4NZOA 1YOBA 2C59A 4Y98A 3ZHBA 1GV5A 1U0GA 2VEOA 4IJVA 3ZWPA 3LC1O 4A91A 1T6BY 4F86A 2BSQA 3KFLA 4BY9E 3S1MJ 1ZAYA 3SYTA 1A8UA 2DX7A 4ZKEA 4HXEB 1E2EA 2NAZA 3I52A 4IRUB 4RK4A 2E87A 2GB4A 3UWSA 4C7OB 4NHEA 4HNGA 1Y4UA 2FOIA 2FMHA 3ABLH 1J24A 4NC7A 3HJEA 2NXNA 2JFGA 3FCAA 2D1RA 1JYEA 4DBLC 3OA0A 4NV3A 1OTYA 5EZYA 2FSUA 4UHEA 2YNMA 2JAUA 5K51A 3DOOA 4ARAA 1TPZA 1NUTA 2OV4A 1UBKS 3WWDA 1KZ4A 2C5GA 2VN8A 3CNHA 3ZZ0A 3I2HA 4PPYA 1SC3A 1WQ4A 2ZRPA 4LXHA 2V7EA 1MBEA 1AKMA 3OY2A 4RIFA 2H52A 4FFWA 3RK1A 4O4HF 3ESYA 1HDOA 2VBXA 1ZCFA 3JALA 1GG8A 3PHLA 3CX6A 3DCJA 3IAHA 1IZ1A 3PUZA 4HXFB 2CMPA 2V0NA 3J7ZI 3VPSA 4LXGA 5KQMA 1UT6A 1UMQA 2Q3MA 1NW9B 1S3FA 1UMBA 2VIXA 2QJRA 2XUZA 3EUFA 2BXYA 2VDPB 4Z4CA 3G1WA 5HODA 3ZWCA 3H7AA 3F3XA 4D8YA 3SOZA 1SUFA 3JVIA 4FJ0A 2CD9A 3ZK9A 1PR6A 5I4CA 5AKZA 5JSFA 1BVUA 2H9AA 3B1YA 2WDPA 1E69A 3RS5A 1Z5PA 4ZO4A 4IINA 2FQXA 3WLSA 2IPXA 2AXQA 2C2YA 5AKLA 4PYJA 3FUCA 1PS8A 4KQJA 4Y18A 4YJKA 5L3GA 1LFUP 1MB2A 2ODPA 1C7IA 2ZPAA 3NHUA 3UUFA 4AYBN 5I01A 2OL4A 2R2GA 4AIDA 1R16A 3M6WA 3GRZA 4HR7A 3QVSA 3LRTA 4OQNA 3AM5A 1D2CA 5DSTA 2R6ZA 5G3ZA 3SXPA 5KYXA 3L18A 1EH6A 4ZT2A 2FUKA 2F48A 2OQRA 2AC4A 2PH3A 3HDGA 2HR3A 4MIOA 1UJ5A 4IHTA 3QXJA 2NGRA 1YJWI 1OYVA 1MX3A 4NZ9A 1IOZA 1V3QE 4KRXA 1QIMA 2ZJZA 3DWIA 1EJ6A 1Z6XA 1T6YA 2F8MA 3VR4A 3WAKA 1WNTA 2B0CA 3T3DA 3JQ6A 1MEJA 4P4LA 4YONB 1G20A 1VL6A 2M98A 2O3RA 4Q47A 2PZKA 3OM8A 3OPYA 4Q19A 2A0XA 1M66A 5M3BA 2DBVO 3RVQA 5K0TA 3SXUA 3KP2A 2FZVA 2I76A 5BQ3A 1OXVA 1QE3A 2H2IA 1J39A 1OI4A 2PSEA 2XMCA 1I0IA 2FEAA 4LQDA 4RY9A 5DE3A 2JG3A 4YQYA 3L6RA 5E9WA 3LFHA 4BLTA 1T3TA 2WAAA 2FQWA 2RGRA 5T8KC 3JQ9A 1T6ZA 1DKUA 3I32A 3BP8A 1VMDA 3QPTA 3M3HA 4QPNA 2ICWG 1ISFA 2WF8A 3CC7I 1DWPA 3F3MA 3T4XA 2OFFA 1NX6A 1TWAJ 3PXEA 1MVLA 4RF4A 3ZVRA 2J8ZA 3RZOJ 2GLTA 3KXKA 3VGJA 1Z74A 2ENUA 2P68A 4HGNA 2QDXA 3IP7A 1EFUA 4MGRA 2KM1A 2IZ1A 1XP5A 2DJ5A 3BHIA 4L22A 2Q45A 5IARA 3R7WA 4LJRA 1TMGE 3N7UA 1M83A 1CJBA 2HXGA 4WNIA 1R9JA 3A1UA 1CEQA 1ON1A 3M1YA 1D9ZA 1E1RA 2P9HA 2QW1A 2JFVA 2ZYTX 3E3LA 3L0SA 2G5TA 3AUYA 1Y81A 4RB2C 1OU4A 2OECA 3B6MA 3KXIA 4NPAA 2HSWA 5EEHA 3DVLA 1PZNA 2OZVA 3BRWD 5FUXA 5CFQA 5KJ1A 4A2QA 4ALKA 4XX0A 4U7PB 1YKFA 1JAHA 4ZGGA 1HYQA 1VIAA 5CEFA 1EV7A 3IH2A 4UTOA 5JRDS 2D13A 3PNLA 1MO5A 1Z33A 3ZI0A 2OZUA 2PX9A 1P7WA 3I2YX 3Q5GA 3EVFA 5JE8A 3TB6A 1FSEA 1KAMA 4FOPA 1JQDA 3P1JA 4AU7A 1GO2A 2BH9A 2X58A 2CDAA 4LJ5A 1NA5A 2FCRA 2V59A 3PITA 1N1GA 1I0ZA 4KBYA 5AHWA 1K3TA 1UANA 1XTKA 5E7IA 4AP6A 4CU2A 3NHRA 1LDNA 1MBHA 2IS1A 4NOMA 2HV8A 2OHIA 4Z2AA 1W36C 2H4JA 4O3MA 3JAMK 5IHXA 2FWMX 1LTHR 3GDGA 1XA4A 3OFVA 4F4DA 1QB8A 5HVQC 4HYTA 5LD2C 1CF7A 5AHRA 1W73A 3B7PA 3X2SA 1N2EA 3COVA 2H00A 2LY1A 1I8TA 2VH1A 5CIWA 4M0LA 1M75A 3MS4A 3O31A 1J90A 2VHUA 5CLGA 3L9XA 1L9XA 2G7HA 1WDKA 3GC6A 4DNCA 2K86A 3LQYA 3OLQA 4MRNA 4MI6A 1UINA 3EVZA 4GLOA 4QBHA 1OLTA 1RMTA 3V1UA 4Z3KA 4BE4A 3JWHA 3FYTA 1R9MA 2HA6A 4S12A 1R0ZA 2IRWA 2WIGA 5IAAA 1V11A 4GOLD 4YREA 1JEQA 6ABPA 3K0HA 1YONA 2ZE6A 2O5CA 3EXAA 4K9SA 4CDGA 3K96A 3R5KA 3E70C 2YJGA 4F3CA 3G9XA 4BQQA 1OAKA 1KYQA 1UEXC 4WCFB 4A5NA 2KQRA 1PWZA 1J23A 4LRQA 3UV3A 5JATA 4MIYA 2I6QA 1BNCA 2QMQA 3WGOA 4BRZA 2CVFA 1T29A 1DKOA 2FA9A 2BKAA 2NOAA 2Q3JA 2P1ZA 3F3YA 3N8KA 3UJPA 3S2UA 1TWGJ 3IKJA 5IJZA 3C70A 1LRLA 2J4DA 1RR8C 5DI3B 3OBIA 3LKBA 2C5AA 2FWJA 4EGFA 2XIQA 3EIWA 4P2GA 3QU5A 2QUHA 3ECOA 4S24A 3OYFA 3CUYA 2X4LA 1KEUA 3AWDA 4XVHA 4C03A 5M3MJ 1BS9A 2V9CA 1FYXA 4YALA 3OF2A 5REQB 4ZTJA 1ULUA 5JAZA 3CUQA 1RP1A 2IC5A 5ALXA 3LUPA 1R74A 2Y93A 4HS4A 4TV8A 4EO7A 1VGRA 3HJAA 3IKTA 4JSRA 2CDBA 3C8HA 4WOPA 3C1UA 3ND8A 3BD8A 3LFUA 2UZ1A 4PYQA 2OCDA 1XF1A 1DZ3A 4XK4A 5E2BA 1V1RB 4F6RB 3TTSA 3HKEA 1C3OB 4JUFA 1K6JA 4RAOA 1LB1B 1EZ1A 4CCKA 1KU3A 1I1SA 1IEQA 3LF1A 3NHZA 2E85A 2KBFA 2AFHA 2QUZA 4QDTA 2OK7A 1LRKA 3HEAA 4G65A 1TT0A 4YIFA 2AJDA 4DZRA 4F21A 3GRYA 4URXR 3IDFA 3ZQFA 3K4JA 3ETLA 1JE0A 3IRRA 1MO2A 1NVDA 2QQFA 1Q1GA 5IOZA 2OCAA 2RGDA 3D6AA 4LTMA 3O1HB 3Q0EA 5FULA 2QGZA 2YW2A 1SFXA 4FFOA 4LQCA 4B3FX 3OY9A 2ONCA 2CNLA 4LF5B 1THZA 1H0KA 3ND5A 4W4TA 4OHKA 1HBXG 4NX2A 4D4HA 2GARA 3PHJA 4JI6B 5GIOE 5HUQA 5DM6F 4BO7A 3PSAA 4HAMA 2LCQA 2Q7DA 2X0DA 5JJ5A 2QKLB 2I2AA 4GKVA 2NVUB 3WO1A 1NDHA 4RH0A 4LF7B 4K0KB 4Q4HA 1XDSA 3GJYA 4H1TA 3L0OA 3KZYA 1Z0ZA 2PAFA 2G8NA 2ZPUA 1JIJA 4AU1A 3ST7A 4Z9AA 2HQSA 1ZSVA 2FZ4A 2WAMA 3GJQA 1L9KA 3KR1A 3L84A 4HZUA 2F3QA 3T9DA 1MDFA 4UREA 1AHNA 4RETA 4BNJA 1C1YA 2ZIGA 4HB0A 3H1CA 1VQ8I 1SU4A 1OZ0A 3AV0B 5ALOA 4AECA 1NF2A 2ONYA 2R93J 1PDOA 4EZIA 3FXQA 2IYUA 1ZCJA 3IT0A 3QVWA 1P7ZA 4RM2A 2BMVA 2FW0A 2C5BA 3TOXA 5KYNA 2CVOA 3ZV3A 1RZVA 3QWAA 4FT2A 2FSGA 2C3OA 3G2LA 5D7BA 4IR7A 3QOPA 3LSJA 3RBXA 3C3WA 1U90A 2AG8A 2IA5A 3MWYW 1W29A 2HREA 3QM1A 4WGFA 3D5RC 4AKEA 2MD0A 1JHRA 1NTOA 3B3AA 3HZZA 4PX5A 4QTXA 4Y6LA 5BQOA 1U0FA 3PC4A 4BP3A 4CQMA 4E30A 1USVA 5DOZA 2ZANA 4LVCA 4ZZ3A 2CBGA 1T36B 1EGAA 5IN5A 3GOQA 4KR7A 2D2FA 1W30A 2HJHA 4D4MA 5LZ8A 3G1LA 3CN7A 1DFHA 1RQ2A 3D6HA 1VM6A 3G2JA 3LYHA 1EE1A 3CWCA 4I5DA 5FYDA 1Z17A 1C4KA 2QNBA 4LMAA 2PKRA 1K08A 2F4IA 3R24A 3WFJA 3R8XA 3M8JA 1JE1A 1MJ9A 2O8DA 2BISA 1R4NB 1QCYA 1JKRC 2Z08A 4NEGA 2CV0A 1WUIS 2VLAA 2ZCUA 2IZ6A 4UMFA 3LQRA 4HQMA 4L3OA 4BVBA 1RYNA 2ZIAA 3D8BA 1PTJA 1AU9A 3KT0A 2A2ZA 4HQ6A 4TSKA 1FP2A 2LWIA 2WWYA 4RO0A 4G8XA 2XPVA 3VNQA 4AROA 3BWEA 4B85A 4CEJA 2O9LA 1ONPA 3GP3A 2CQKA 2O2GA 1K2VN 3CH7A 3G5LA 4HPXB 4R8VA 3C39A 3OJOA 3HOYJ 3RE1A 3VKUA 1U2EA 2X6XA 2X77A 3F8NA 3DC7A 4QJ5A 5K3BA 2PZBA 5IAOA 4EY8A 2JAOA 1LVGA 3HVJA 4MA0A 1LB2A 2N75A 2A6HF 1RI5A 5K8IA 4CKZA 1ZK8A 3WFIA 2PUCA 1U0OC 1GPBA 3C3KA 5CJJA 1N75A 3AM1A 2BTQB 2OENG 1U2ZA 3PQ5A 5D8DA 3DV8A 2BF4A 3O75A 5C46F 2NVTJ 1E3JA 1JRLA 4G86A 4MWBA 3M4JA 2W1OA 3KB8A 4O4IF 1REQA 4N47A 3WO0A 1RS0A 5ILSA 1R5GA 3KIOA 4HVLA 1CGPA 1GKLA 1VIVA 3AJ8A 4FS8A 3KQOA 4XWGA 4KMFA 3QE0A 4RVFA 4BEHA 2BJVA 3QBVA 4KQ9A 1MXHA 3PTLA 4JK1X 5KNBD 3S70A 5D51S 4IHKA 1CZRA 2ZKLA 3E5HA 4PC3A 3A1WA 1HDRA 5K0GA 3FB4A 1IUOA 1MC8A 3N0TA 4UJ3A 5CGZA 1BDHA 2X5KO 3O6VA 4KREA 1Z0DA 5J1UA 4WHMA 2VOJA 4Y9UA 3BD7A 1NYLA 1NVVR 4N7BA 5DV5A 3CCSI 4AN1A 4Q9JA 4HEA2 1F5TA 1ZG1A 3W77A 3U3DA 5DHAA 1K9VF 2BFBB 5TMBA 4YRDA 1P92A 5JJCA 5E3IA 1TBXA 2IT1A 1T13A 2GF9A 2AHRA 3C1DA 1HT2E 4CLRA 2H1RA 5INTA 4NBTA 3D6TB 3RWOA 4YEJA 5JZMA 5EXPA 3D6JA 4JSTA 2OQ2A 4WXPA 4X93A 3ENWA 4ENPA 1QK3A 3IDOA 1M73E 3DCFA 3P2MA 4BVJA 4DMFA 4TZ6A 4EEFG 2PWYA 1I39A 4MAFA 1P0PA 3STTA 1DO0A 2ZDQA 3QWBA 4LCJA 1XLTA 3PFGA 1NASA 4B6FA 1E5DA 3A6HA 2P81A 1FTNA 1RJFA 2Z2ZA 3RKUA 3T95A 4PG4A 2G7UA 4I81A 1T4BA 3HKBB 3K69A 2FG5A 4PYIA 2O48X 3IO3A 4DEYA 1H0MA 2XUJA 3IQIX 5HCIA 1N2ZA 1PP4A 5LQNA 2ECKA 4LDZA 3GVIA 2VXYA 3PD0A 3R3WA 1KAHA 2ADMA 2JK0A 3RU3A 1DFIA 2OSVA 3GNTA 2BCEA 2X9QA 4BOYA 2FR8C 3Q9UA 1V6SA 4HDCA 1V95A 1SO8A 1JJ7A 4JB2A 1U9IA 5EZYB 3MT8A 2RH9B 1A69A 3L6BA 1E6EA 1UBJS 3D5TA 3HXTA 4RPHA 2ZUTA 2PBRA 4EVRA 1OFIA 4RK7A 3OIOA 5SY4A 5IJWA 2WKRA 4DR7B 5K5EA 1PGJA 4E4YA 1XXHB 4O2RA 1KNQA 1DMSA 4KPEC 2V65A 2CQ7A 1NKTA 2HY7A 3C87A 3MWJA 4MKIA 2FUG6 4QWWA 4UFNA 3GLQA 5FO5A 4E4HA 3BG6A 2K9MA 3CJQB 3BWGA 1BXKA 3KEMA 5CBPB 1YUMA 3RWMB 2YN0A 3MRSA 4JROA 3ORFA 2HOQA 3WBKA 4CXMA 1YFJA 1PQYA 2FRDA 1H8EA 1XZNA 3HFRA 2IHKA 4GPD1 2NZYA 3AVTA 1E3TA 1YT5A 1V8BA 4XB1A 3HVRA 3H19A 4W8HA 5CIYA 4XH9B 3HDTA 2V7FA 1JDBB 1I4EB 1EP1B 1V0JA 2SHKA 3DM9B 2Z5VA 4KX5A 1S8NA 1D4AA 3FHTA 4B6SA 2PUFA 4H1VA 4RQUA 1VTKA 3N7AA 2QY9A 4NG5A 1F8GA 1UXJA 3E9QA 3RYPA 2CEKA 3E23A 5FWYB 4X90A 2ZXHA 1W7PD 4PZDA 2GGSA 3WLHA 3SX0A 1G5RA 4D0GA 3T5AA 1CG6A 2EERA 1NVTA 2HAEA 3EFEA 4FEYA 3SEAA 2ZSEA 3GUDA 4AKSA 2QCOA 2QRLA 3KLMX 4Z7NB 4DGQA 2XF2A 5JEDA 1CZNA 1T8PA 2JBWA 4N0BA 4JQYA 1KI4A 3H13A 3WQSB 1V7CA 3DG9A 1C9JA 5TQ2B 3W6PA 2FPSA 4WN9B 3PENA 3CU5A 1N0HA 3R4CA 2H48A 1G8SA 1KYZA 1J2JA 4PZUA 3D1LA 3QW4B 4IO9F 4TKVB 4X61A 1SHJA 3NGXA 3DVAB 3F6PA 3AR2A 2HO5A 1RRMA 3S1SA 4QARA 3H2HA 4HAOA 2XB0X 1D6NA 3NIFB 4UZFA 4D26A 1LLCA 3C3JA 4FIDA 1BFUA 3KCQA 4NZNA 5FRDA 1R7JA 2W6IA 2XR1A 2X3FA 3GCZA 2JCVA 5H6RA 1E0SA 1M6EX 2ZU0C 2CGPA 2XOXA 3HOUJ 4WBNB 1M5RA 4OBXA 1VJGA 1QB7A 1X7DA 2Z3ZA 4NBNA 5DK4A 1EXDA 2QI9F 5CXUA 5MFZA 1LH0A 3GRRA 3O1LA 4OLJA 5KTKA 4IY1A 4OAYA 1YI2I 1SFRA 4ESFA 1MG0A 3IPAA 4QAQA 3V1KA 3WIEA 2F8SA 3GQBA 5FKJA 3T99A 2B4KA 2L02A 3QMVA 4ZO9A 1ZN9A 5AXDA 1JR3E 4U7GA 1KQ0A 4DLWA 3L00A 2WM9B 5A5VA 5BWCA 1ESCA 3MM4A 1BOFA 1XKXA 1USTA 2Z8XA 5BSFA 4U9IS 3WV5A 2RAEA 2HRZA 2XA1A 4BQEA 1CIJA 2QZ9A 2R1TB 4MVXA 5B2FA 1QH9A 3WR5A 5G3YA 3W1WA 3DXZA 4UDYX 5KU1A 2WWVD 3QMWA 1BJZA 1BVYF 2I1LA 3HYNA 4K9LA 1FP6A 2J0SA 4DTCA 2BGRA 1L5KA 1ZHOA 3I72A 2YKGA 4CR6A 5ADHA 1WGXA 2DLNA 2J6CA 3H9CA 3HMQA 3SLKA 1AQ6A 2CHVA 3MCZA 1OH5A 4B3TB 2DQ4A 1C30B 2D8MA 2I6UA 3NUQA 4UDOA 4DA8A 4NYJR 4ZVLA 2A57A 1LEBA 4LVUA 1R5ID 2XD9A 3JXEA 1Z67A 1NU6A 4ZI5A 2Z9BA 1B42A 1UXIA 3VNRA 3PRKE 3RPQA 1OBHA 1FLAA 4KLRA 4C4ZA 4I6JA 5JWOA 4OQ4A 3D3EA 2XLBA 2C9OA 1SXGA 3DE6X 4RKEA 4PXYA 1IXSB 3D4NA 2EFWA 3RG8A 3NTUA 1YYVA 1AXGA 1A9QA 3BHJA 3AHJA 3UMRA 4AM3A 4M2LA 4YELA 5A4JA 5BYAA 2PS9A 1CJKC 5TIIA 2FSSA 1T0IA 2WYHA 3A6JA 5BOSA 3QKIA 4BEWA 2BFAA 5FTJA 1W52X 3OT5A 1PJRA 5AW3A 4LCBA 3RIEA 4KFUA 2XPWA 4LC1A 1JDNA 2OXFA 4M3BA 1RXEA 1ZLKA 2QUKA 4RE6A 2LKXA 2H1KA 3WYAA 3OT1B 2H9YA 3EMVA 4TSFA 3RRMA 3REQB 2EYUA 4CV3A 1FWZA 2XAQA 4IWXA 3T5GA 2JPDA 1WQ3A 1T1RA 4DT1B 2ZSBA 1BEUB 3BKWA 3D3QA 4MYTA 4US1R 3TEFA 1E9EA 1GZ6A 2I3GA 2Y76A 1C0KA 1NURA 2RG1A 2F1HA 4RBOA 1EWQA 3D8SA 1G8PA 3OEYA 1Y9EA 4FFMA 4KO8A 4DIFA 2BD0A 3AVVA 2QMEA 1O5OA 3TZLA 2MINB 1YJCA 1OZGA 1EK0A 2ZK7A 3H42B 3N5KA 1FMVA 4JOCA 4QQRA 3T9AA 4DRXA 5K0EA 5LLDA 3L8ZA 1BRTA 1KMHA 4U8HA 3WGVA 1Q3KA 2CS3A 5IFKA 2BI8A 3Q3HA 4TT3A 1RWVA 4RAGA 4JGBA 5IAGA 1ULTA 2QG6A 2XI4A 4UM5A 4ZJYA 3C3BA 3LWDA 2O8EB 2A58A 2E4VA 1JG7A 3JD2A 2BUBA 1NG7A 1TF7A 4X3OA 4L85A 4UFOA 4YCSA 2V4UA 2DBZA 3RG2A 3EFOB 3S8EA 2VXZA 1UJ2A 4N6OA 3CO6C 2K3PA 2A9VA 4CF5A 1NUSA 5FL7A 1DIRA 2EHDA 1W5AA 1VLQA 3CEJA 3EXIA 3QF4B 4MWGA 2DHQA 2XH8A 1DXOA 4IFBA 5CM9C 5BXYA 2AN5A 3GPDG 2VBCA 1WXXA 3TAHA 1VGVA 1I4WA 3DWGA 3EG9A 4GIBA 1GNPA 1M2JA 2ZW9A 3VKHA 3FDXA 2L82A 3U1VA 5BV1A 1LJUA 4MQ9F 4Y2UA 1O4XA 2EFGA 3BD9A 2R4GA 2EQBA 1X70A 1N1EA 2QPTA 3D6UA 3MWEB 1Y6RA 4CUGA 1ARZA 1TCCA 1TOAA 3NEYA 3OOJA 4IIBA 4R9NA 4UNSA 4EZBA 3UB4A 4KDCA 4XW2A 4KLNA 1GDHA 3PBKA 2M34A 1QG4A 2NU7A 2PO5A 1EFRD 4O02B 3WDLA 2IU3A 3JQPA 3CJQA 3KDSE 4P7BA 3DU5A 1C1HA 5BO5A 3GA5A 3TW4A 3BMXA 1TYEB 4OI0A 3LDAA 3C16C 4XB2A 4CQJA 1XKTA 2PMWB 4W7HA 2YWDA 3OS1A 4M3FA 3HHPA 4K87A 2XY4A 4C20A 4ENKA 2ZWIA 3EHEA 3HB7A 4Q1BA 3L01A 3R7AA 2IVFA 4KISA 3BCSA 2X15A 2NAPA 2QUJA 4PX3A 5ESWA 2AZMA 5M2QA 2P5UA 1BHJA 1F0NA 1OFGA 2VP5A 2YUTA 3P26A 3QENA 4D8WA 2XW6A 3TDZC 1SURA 4I3FA 4RFLA 3WK6A 3GT7A 4BFVA 1PJAA 1EF4A 2AGVA 1DWOA 1AX9A 1GL9B 4L15A 3WWZA 2NN3C 3GN1A 2G8LA 4AMBA 1TC1A 1KZYC 4A3DJ 1X92A 1TF2A 1YRAA 2D0DA 3IUYA 2V74B 3MQFA 5EJIA 5DTRA 1L3CA 3HCDA 2Z6UA 3R4KA 1K7XB 4H0CA 4YRPA 1Y1TA 1UPCA 4E6EA 2DT5A 3V8RA 2VYNA 3E9ZA 5JVDF 1RYZA 5EKDA 1UHSA 1XTUA 5AVOA 4BVKA 4F4CA 4LYEA 3JAWA 1DL5A 1UHMA 1T0JB 4IV5A 2Y92A 4P31A 3P9YA 3M6AA 4IYRA 4PX9A 4OHBA 1XPOA 4DCJA 4FNMA 4TWJA 2J3IA 5EKXA 1ZOOA 1MW8X 1X80B 4H31A 5ALFA 1QBGA 4H4CA 3I59B 1IWOA 3SE0A 4BNDA 1X13A 4RVUA 5L6LB 1ZD5A 1YJBA 4W99A 5CDHA 2NTNA 2R47A 3IVAA 1ZD2P 4D02A 1EWRA 4F3RA 2O8BB 1FBQA 1JLLA 2YCBA 2FF4A 5A06A 1P4GA 1RJ9B 4KR6A 3OYIA 1VYHA 3O4JA 4MWEA 2VC2B 5AUNB 2OBMA 5JDIC 4LQ4A 5DCFA 1K79A 1A1SA 1QRYA 3A4VA 3HCFA 2GQ0A 2HJSA 4ASNA 4X1KA 2V79A 1GQYA 2QW8A 1T5SA 4AMGA 2Z83A 3IR6A 5ISMA 4B9EA 4BQFA 4MKXA 2XCQA 3BSFA 3LIPA 3M1EA 3TZQA 1FZPB 1RFLA 4C6SA 3NBUA 2VPXA 3H3VK 1YQXA 1GAQA 3Q0TA 4MW6A 5I5GA 2ZAOA 1PLJA 1ZUWA 3L09A 1LF5A 1V6AA 2GXBA 3F98A 4AJ2A 2O23A 3A04A 3DZGA 1S3JA 3E9DA 3G79A 3K16A 3S1RJ 4MXDA 1FYEA 1Y7IA 2YC2C 3AR6A 2HHLA 4FZJA 4UCFA 4RK5A 4LGWA 1U80A 5KAPA 5FHQA 2XSJC 4D7MA 1IATA 4CGYA 4NBUA 1QIFA 3L1IA 1UG0A 4M9XA 4J0DA 2PGIA 4AICA 1UJCA 3BXEA 2X0LA 2TMGA 4FMPA 4LNUA 4WA8A 1EP2B 4NG4A 2NQTA 4R1HA 1DBRA 2IA2A 4NPCA 3SI7A 3VTKA 4B7AA 3E9NA 3GJSA 1ZG5A 3Q40A 1LBQA 4JC5A 3DUFB 2LSOA 2WVJA 2Y99A 5DT9A 1XPRA 1KOLA 2V8BA 4KN4X 1F0PA 3SYNA 4EPWA 4AKHA 1U8BA 4QUBA 1B14A 4LS3A 4AJ9A 4D4LA 1Z63A 2VKVA 4EJ2A 1WD7A 3P4XA 4CDNA 3VH2A 3RO7A 2E1MC 3CVWA 3T1YB 3HXQA 1TTTA 1EBBA 4URHA 5BNTA 2LDUA 1RWWA 2Q2EA 3W6VA 1ADGA 2QX6A 3CNQS 5ICEA 3QGMA 4PV7A 5CDTA 1E3WA 3PWKA 1A4XA 4BBSJ 2TMYA 2WF7A 2H7YA 1YQTA 4JYAB 4KN7X 4FGSA 4C4PA 2OO3A 2RK6A 5BMOA 5CCEA 2XMGA 5AK3A 2AQFA 2W82A 1R6BX 3PQ7A 4G4IA 4ONEA 2AR7A 2WMNB 2XT6A 4M99A 5DI9A 3ZJTA 4M0DA 3L2QA 1A8HA 3D2AA 3EZFA 3W5IA 3E2PA 2QAJA 3RUPA 4ER3A 5CG2A 4QLCU 5BOVA 4BN4A 4CF4A 1M1YA 3HYRA 3OPQA 1IBRA 4JZKA 3BGIA 1ADFA 2A59A 2OGUA 4HMQA 4OHZA 5CEEA 1W5FA 1SCJA 2IPMA 5LRSA 4QPZA 1P1IA 2KYRA 3ROMA 3ZU2A 1XTVA 4C0JA 4HFNA 7ADHA 3FZVA 2J9GA 3QE9Y 4LISA 2VOEA 1D8TA 3BWVA 3KZXA 1JMYA 2EKDA 2H3EA 3B85A 3LA6A 5JLAA 3HSSA 4Z9BA 2OM6A 1MMFB 2JFXA 3EQ7A 3BPXA 4FFRA 4E4TA 2YYAA 2O8EA 1ZRNA 3Q7EA 1D8AA 1OLXA 3RVJA 4C2BA 2C6YA 1YR1A 2VSQA 4N4OB 1UPAA 2OCIA 2XGMA 1KO5A 1MENA 1SBYA 5CXSA 1E4EB 2C61A 2VWGA 1Z82A 5BPIA 1N2XA 2DQLA 2IJLA 2EFDB 2G0NA 1VFCA 4FKBA 2GKSA 1EA3A 3N9IA 4I8IA 2WD8A 4IILA 4YRNA 4CETA 3RYCB 1A76A 4DUYB 3SF8B 1XVTA 3PFBA 3RVKA 4MCJA 4L8LA 4RMGA 4NBVA 3VM6A 1XSVA 4UU7A 3SAJA 4EY6A 4MRMB 4IUYA 1OIXA 2QSUA 1VI2A 2IYEA 3V8JA 4D9JA 1WUTA 3AP2A 4GOXA 3L8EA 4BJ1A 1FNNA 4B43A 1GUYA 4CM6A 3PLAE 3D6MA 1RW4A 4NCXA 4DV4B 5DGDA 5KYWB 3FNHA 4HQNA 4OUKX 5AJUA 2PBIA 3B6KA 2CYYA 3W3AH 4KQHA 2JL1A 2D4AA 3K15A 2HWWA 2JI7A 3F8FA 3CSUA 1HDIA 3QPVA 1AUQA 2ZTVA 1Z4PX 3CEHA 3VH1A 4M1MA 3TQCA 5BSKA 2A9RA 3KQUA 3ZMTA 2G06A 3FNGA 3GH1A 3CF5F 1EJ0A 1D2EA 4YP6A 2KRFA 2VCYA 3O47A 3MGCA 4R69A 3V4VB 4RGBA 1MSEC 3D7RA 2G71A 2GN6A 1GZVA 2V45A 2BJWA 2C7PA 2FD5A 1WD5A 1XDGA 2HJWA 2ZYRA 4CPDA 2BEUB 2C5SA 3TW7A 2H1VA 1NXTA 2C4KA 5E4JA 3WB9A 1RZRD 1JJBA 4QFDA 4D9MA 2BY2A 2A4MA 1F9AA 5BQPA 3WISA 3DMDA 5ALGA 3H2YA 1VMAA 2GNOA 3RADC 4CMCA 3RC2A 3GCXA 5K1YA 1SCNE 4XM1A 2HHHB 5FLMJ 3H5NA 3GTPJ 1NLZA 4M0FA 1TCUA 1WO8A 1KMCA 2J7PD 3A3KA 4DG8A 2I65A 4F85A 3TNDA 1WU7A 2Q9CA 3KQVA 4J07A 5FTWA 4ZCQA 1XTPA 4UKDA 1K7YA 4A3SA 4C4XA 3ULKA 5EWMA 1BJRE 1DUIA 5DASA 1TA9A 3P9ZA 1F6BA 2QZJA 1DDIA 2O3UA 4I14A 4G1FA 4YJ3B 5DSXA 3VDMA 4YRIA 2DPXA 4JI8B 1VLMA 1X86B 3CMMA 3GRAA 3SBDA 2QGFA 2IYLD 2VB6A 1ZH8A 5LYJB 2EZLA 5BWNA 1W47A 3PT5A 2UYHA 2H0AA 4BL0B 1U5TA 4RPKA 4I2NA 3RODA 4BGEA 1GQ2A 4XUDA 3FE2A 3URKA 2ADUA 4XWWA 4TZ0A 2MINA 4NFLA 1CNEA 3JTGA 4BNLA 2GEUA 1U0NA 1JKXA 1ULHA 1Q12A 1Z22A 4J7XA 4KWTA 1RKBA 4NCNA 3SKVA 5IJXA 5AW4A 5L7YA 4MWZA 4XWYA 2FG6C 3CONA 3I04M 4U7DA 3M34A 2NU9B 4ENRA 2VAWA 4BQAA 1J21A 1Q7TA 2PMHA 3M5PA 1IWPB 3E82A 5EMKA 3DE4X 4DIDA 2VUUA 3FDFA 1RJEA 2DT6A 4BXFA 2H59A 1JLLB 1MQ9A 4H2DA 4B7ZA 4DEXA 3QXGA 3UJNA 7ABPA 3KQPA 2ZS8A 4TS1A 2PXHA 3MGGA 2GYUA 2GJ9A 3VYRB 2W0MA 3LT5A 1H2WA 3IEVA 4ZVNA 3O2JA 4MVJF 4BWVA 3OQJA 1XWIA 1DKRA 2EZHA 2AKYA 2XWJI 1U0SY 2IS6A 3B1WA 3MIIA 4NYMQ 2V3WA 4BMZA 4E5YA 4FNGA 4YJFB 4C5AA 3STHA 2OU2A 1OMIA 3Q8WA 4CG1A 4BLRA 1Z6RA 5CJ9A 1B41A 4C0AC 2F4OB 1ILEA 1Z56C 2F8LA 2WV1A 1IE3A 1T4GA 3G88A 3QTTA 1W8DA 1ZZGA 2CXOA 3JSPA 2P4WA 4OIPF 3RYIB 1WP4A 2NU7B 5DCWA 4MGHA 4B3CA 3GXOA 5LEKA 2QHXA 4WCFC 1Z18A 1QVAA 4DC9A 3SJMA 2J67A 3LG2A 4B6PA 4E7PA 1ECFA 1ZREA 1E60A 3E81A 4KN9S 1P39A 3ZGXA 4Y2QA 1QHNA 2CFXA 1U2PA 4WKGA 1PR3A 3F6YA 3UJ3X 3QPSA 3MIZA 1T5LA 2CWWA 1BN5A 3M4OJ 2CJWA 2WAOA 1DZIA 1AWCA 2DK8A 4IYJA 1HXHA 3UB3A 3ZUGA 1EINA 1Z5WA 4EJSC 5F4BA 4LMPA 5EJ4A 2NXCA 4HQFA 4B34A 1FP7A 2JJQA 3WVNA 2JCGA 2UYQA 1R0WA 3CUUA 1P91A 3OX4A 4FNAA 2AMFA 1SN7A 1X7YA 2J3KA 5KINB 2GHRA 5KWIA 3VODA 2FF5A 2QIOA 4MUGA 4ZO7A 5EG5A 1JBEA 4IM7A 5JPDA 2DUWA 2QYHA 2PLFA 4DDHA 2DVMA 1U7XA 3JTMA 4YCJA 5CCBA 1R6RA 2QX7A 3H18A