1XMAA

Structure of a transcriptional regulator from clostridium thermocellum cth-833
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
101
Chain Sequence
SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Predicted transcriptional regulator
publication title Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
rcsb
source organism Clostridium thermocellum
total genus 35
structure length 101
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xmaA00
1RZ4A 1G3YA 2XAQA 2OZUA 3FM5A 3E6DA 1R58A 3TDUC 3KP3A 4RGSA 4EQQA 3ZQ7A 3DP7A 3N97A 3I0TA 2VODA 3HRTA 5DUKA 5HS9A 4LD5A 4IF4A 1JGSA 2DU9A 5CJ9A 2DPDA 3HOTA 5DD8A 5KVRA 2FNAA 3EDPA 1XSVA 4HDVA 3T1BA 2D1VA 2G7UA 1MD0A 1XGNA 3SFZA 3BDDA 5A2QK 2BBYA 3LAJA 4ESJA 1TBXA 2E7XA 2MC3A 5K5OA 3CUQB 3I54A 1QQIA 1HW5A 2ESHA 3TOAA 2M87A 2UXXA 2VBXA 1UHMA 4Q48A 3VB2A 1R7JA 4MTDA 4ENNA 1KYZA 2OAZA 4A2UA 1KQ9A 1O7LA 1SD7A 1IXCA 2Z3YA 1T2KA 4A0XA 3WE2A 1OYYA 3COAC 3V8KA 5CVVA 2QVOA 3SQNA 1J7KA 4O3MA 1HKSA 2CWEA 4EV0A 4PGGA 2LF8A 3MCZA 4Y13A 3I59B 2RQPA 5F64A 4S04A 3F21A 3J7AO 3ROUA 4MTEA 1MDMA 1K6OA 1TW2A 4E70A 1XMKA 4EVIA 4YFKF 2NNYA 4PZJA 4KIGA 1P2FA 5BOXA 5L3GA 2YSRA 2XROA 1O3SA 2Q2EA 2PFBA 2WV0A 4WXDA 1ZN2A 1V4RA 2RVCA 1J0RA 4OOIA 1FLIA 5LHHA 3S2WA 4A5MA 3F72A 2ZKZA 1LEBA 1FSEA 4ENJA 2ACJA 1LJ9A 2DQLA 4WK8F 3MZHA 4IRHA 5K5RA 2BEOA 4HBLA 2NRAC 2CYYA 1RUNA 4DNCA 2CO5A 2DK5A 3SZPA 2KKOA 2HWVA 5J8FA 4I0BA 1OPCA 4L0YB 5FFXA 1I1SA 3BJ6A 2ZXJA 4Y15A 4LLLA 2JPCA 1Z6RA 2HKXA 4EMSA 2UZKA 1U3EM 1JHHA 3ISPA 4BHBA 1SAXA 3HSRA 3KZYA 1S7AA 2R7DA 2A69F 2DT5A 2PJPA 3WGIA 5ICEA 4KA4A 4ESFA 4M9ZA 4KFCA 1IN7A 3KLOA 3CUOA 3QAHA 2XASA 1YFHA 2RV8A 2W85A 5LLQA 2PMUA 3CUQA 2FRHA 1W5TA 5HS8A 2KIMA 5FD6A 2EK5A 2XKOA 4P5OA 1ZRCA 5DV5A 3GVAA 2Q0OA 2IP2A 1BN5A 2MLGA 1XGOA 4BNCA 1R1TA 1O3QA 4YFNF 2Z5UA 5HVQC 2FNPA 1KQ8A 3EQLF 3OV8A 1QGPA 1HQCA 5IT3A 4PCQA 4OIRF 1FZPB 1R1VA 1JHFA 2J5OA 3WTSC 2QQAA 5LGTA 2FF4A 1XD7A 4EJUA 3KP7A 3I59A 3Q9VA 4FX4A 3VOEA 2FOKA 3FXUA 3GFIA 3CO6C 2IA0A 5E1ZB 3ECHA 2JSCA 3BWGA 3RPQA 4LB5A 1ON2A 2RKHA 1B59A 1OKRA 5IT9Z 2HYGD 4RB2C 5CVJA 3GZ5A 4HOBA 4L0ZB 3WTXC 2HEOA 5DCFA 2YU3A 3D5LA 2KIFA 2CSOA 2ZO4A 2LDUA 1TQIA 3WTWC 1T6SA 3LA7A 3E5UA 4GGGA 4M6XA 1Z91A 2X4HA 2FA5A 2QBYB 3I5UA 4OIPF 4L9JA 4UNOA 3TO9A 4U0VA 2HR3A 2V9VA 2HDCA 3KP4A 1WSUA 4ZYEA 4HX7A 4RGUA 1F4KA 4KIFA 2W25A 2VBZA 2VXZA 3E5QA 1A04A 5BMZA 4KDPA 2PEXA 4M72A 1W7PD 4LK1F 2BE5F 2JTVA 5D6FA 3OOPA 3HTSB 1SFUA 4I01A 5H6RA 1OYWA 3JTGA 2HYFA 4UVCA 5A2QZ 3JSOA 1G4DA 4UVAA 3LA2A 3F8MA 2XAFA 2Y75A 2ETHA 3BPVA 3BP8A 1S6LA 2QENA 3FWEA 1MKMA 4UUVA 4UV8A 2K4JA 4U0WA 5E8IA 3ERED 5CVIA 3GYHX 3H92A 1ZG1A 1KU2A 2PN6A 2D1HA 3L9FA 3TGNA 2FE3A 3WG9A 1BM9A 2P4WA 4EGYA 5L3DA 2PI0A 1Z9CA 4OIOF 1D5VA 3TKYA 2Q8KA 2P5KA 3DQVC 1BBYA 2VT2A 3AAFA 1F5TA 1IF1A 4D0PA 2XIGA 1IUYA 1S3JA 2FU4A 4HW0A 5D8LB 3GEZA 4RB1A 1IN5A 1FY7A 5KK1A 2OA4A 1DDNA 4AWXB 2AS5F 2RGVA 1XGMA 2VN2A 1YG2A 1HBXG 4UXNA 2CW0F 2R3SA 4EJVA 3FMSA 3NRVA 4HV6A 2RNJA 3CJNA 2K27A 4HA8A 2Z9OA 3RKXA 3ZMTA 2XRNA 1U5TB 1Q1HA 3F22A 3GW2A 4ZZLA 1OYIA 3IL2A 1QNTA 4HF2A 2M45A 4LG0B 4I2OA 1R36A 4BYYA 1O57A 2YX7A 1F9NA 4KUMA 4I98B 5BPDA 5LHGA 1ZG5A 3WODF 2PQ8A 2EV5A 1EH6A 2Z33A 2QBYA 1ZREA 5JVTA 3U2RA 5F6FA 2K7LA 4RS8A 4N9IA 2ZCWA 4ENMA 2PMHA 2HS5A 2M5WA 4OU0A 1XN7A 4GYIA 1PDNC 3ULQB 4P9UA 1H9GA 1TQMA 4I7HA 5CVRA 5AIQA 3HSEA 1YLFA 1SD6A 2X0LA 2A6EF 2IJLA 3MAJA 4OMYA 4MGRA 1ON1A 4N0BA 3PQJA 5BS6A 2XVCA 2GQQA 3GFJA 4EJWA 2F2EA 1KU9A 2DFIA 2VBWA 2L4MA 3IRQA 1BIBA 2W84A 2DAOA 2A6HF 2FQ3A 5ICFA 3RKYA 4L9TA 3QU3A 2K86A 1ONVA 1RI7A 3R61A 5ILSA 2A3SA 3F8FA 1TW3A 1GXPA 4I0AA 2V1XA 3ABTA 1U8RA 3Q9SA 1G3WA 3EYIA 1IRGA 3K1MA 1XDSA 2VBYA 2M30A 2XV4S 3M1EA 1SMTA 1E2XA 2VONA 5L3FA 3R6SA 1HSJA 2O3FA 1LB2A 1LDJA 1TNSA 4FX0A 5HLGA 2A68F 3H3ZA 4KT5C 4K2EA 2GZWA 1W5SA 5JR3A 3I64A 3QPTA 4ON0A 3WTVC 2QYOA 2PG4A 4G7OF 2OD5A 4MNUA 5DYMA 3GLXA 4P55A 3PFIA 1K79A 4G6QA 3TQNA 1U5TA 4AIKA 3IKTA 1ZAOA 3P9IA 4M9SA 1GHCA 2MD5A 2CFXA 3N4MA 5LBQA 3L7WA 1DP7P 1ZYRF 5LRRA 5ICCA 1E17A 3BY6A 3F3XA 1REPC 1R1UA 1USSA 1TLHB 4LG0A 3RTRA 1FBQA 1BI1A 2J5PA 3HSFA 1T98A 3T8TA 4HQEA 4IRIA 1F1ZA 4R8HA 4QLCU 1ZGJA 2W57A 2A5YB 5L3CA 4YFXF 1RUOA 5TRDA 4I02A 1OMIA 4HZFA 4CZZA 3C3WA 1SMYF 2V1UA 4HAMA 3CDHA 1R00A 3DEUA 3GZ6A 4A5NA 1EH8A 1ULYA 2ESNA 1D8KA 3E6MA 4F7ZA 5LEJA 2FEZA 3IC7A 3SXYA 3WU1B 2OBPA 1IZ1A 1DPUA 1FYMA 3R60A 2EFQA 1KA8A 2EJRA 3B73A 4EJOA 2HTJA 4M71A 3V4GA 3HTUA 2LF7A 1NHAA 3ML6A 1CF7B 5D8KB 3F6VA 3BJAA 1B4AA 5H20A 4HLYA 2V1DA 2A61A 2VE8A 2DLLA 3F8BA 3BJOA 2JPBA 4FHTA 2VE9A 2IVMA 2Y0MA 5D5VB 3RPUA 1ZLKA 4HX4A 2IW5A 4IHSA 1IW7F 2GXGA 2O6GE 3C7JA 1X3UA 3HIFA 2FBHA 4UHTA 2QZ8A 4A6EA 3QP5A 3M8FA 2P5LC 1GXQA 4EM1A 4CXFA 1I6XA 3HHGA 2F5CA 2M8EA 3DPLC 2GIVA 2EA2A 2D45A 4G8XA 4GYGA 1B1BA 3K1NA 2E1NA 2YPRA 3FM3A 3WU0A 2DI3A 5K1YA 2VT3A 4HYEA 1IXRC 3H3UA 3KLNA 4O6JA 4RGRA 4HLXA 4KIBA 1FNNA 1IAWA 2OQRA 3WGHA 1D8JA 4IVNA 5JI6A 2DW4A 5HS7A 4QWQA 5LHIA 2EV6A 4ASNA 1C0WA 1YIOA 5E8GA 3LA3A 2ELHA 2YR2A 3ZMDA 3VFZA 1OR7A 1WRJA 3MWMA 2KIUA 4RB3C 1U2WA 3M8EA 1FWZA 1W7PB 3MZYA 2NYXA 1BIAA 1G3TA 1FYLA 2L01A 5DUIA 2YX4A 4EM0B 1SFXA 2EFOA 3HUGA 4A0YA 3K1PA 4IRGA 4IXAA 1ZRDA 2NS0A 5J8CA 3Q5FA 2FBIA 4GO1A 2K02A 2UWMA 4LK0F 1MJ9A 2EV0A 1CF7A 5ED4A 4CDGA 1XSXA 4EM2A 1H0MA 5L3EA 2FXAA 3FHZA 4Z2YA 1EV7A 2COMA 1HW1A 3GFMA 2TDXA 4M9XA 1V3FA 2V6CA 1XDUA 3V8LA 2B0LA 4OINF 3C18A 1T0FA 3KCCA 2QWWA 1FBUA 2BYVE 3IWFA 3I53A 4KN7X 4L9VA 2L4AA 4L9NA 2UXNA 2HOEA 2XHKA 2IRFG 5AIPA 4XRFA 2RDPA 4CICA 1XCBA 3ZN1A 2OU2A 2MH9A 1K78B 4DQ2A 3L09A 3KP5A 4ESBA 1UB9A 5EEHA 4GXOA 1L3LA 4CYDA 4Y17A 4A6DA 2QUFA 2DK8A 4HF1A 5D4SA 4YIFA 4UV9A 4MQVA 3RKWA 3JTHA 4O5VA 3EETA 3IWZA 5ILUA 1J75A 2F5FA 2HZTA 3GUDA 3DF8A 4U7DA 1G6NA 1KYWA 3L2CA 1UFMA 2MH2A 1STZA 1HXDA 2H09A 2IT0A 3ELKA 1BOAA 1Z05A 3BROA 3BZ6A 4WXHA 1W7PA 4S05A 2HGCA 5L3BA 4M73A 1LNWA 2M1BA 1P6RA 1RIOH 4MEYF 1B9NA 1TNTA 3CUQC 1XSDA 3WGGA 4ZZDA 1EH7A 2IPQX 2ZJ2A 2DBBA 4BHCA 3EUHA 2O8XA 4L5IA 3JW4A 4Q47A 1AWCA 1KU3A 5ILVA 3F8CA 4LGWA 1USTA 1SD4A 2O61A 2H6BA 3VODA 3KEQA 3HRUA 3HYIA 2G7HA 1H9TA 3QRFF 2STWA 4CHUA 1P4AA 2LKPA 3FF5A 1FP1D 4KYWA 1ODDA 3M7GA 1R22A 5K5QA 4AIJA 3KETA 1J9IA 1PUEE 1QO0D 2VC0A 5LGUA 2OQGA 3GWZA 3ZN0A 1HKTA 2EFWA 1ZG3A 2DTRA 3C1DA 4TV7A 3WTYC 4RGXA 4EGZA 2DPUA 1J2XA 2KJBA 1GVJA 3JAMK 3B02A 3LQQA 5D5XB 3QPHA 1FYKA 2BGCA 1S29A 3ABUA 4IJAA 3GO5A 1K78A 5E1XA 1XMAA 2L02A 4NB5A 5EEGA 2L54A 3MQ0A 2STTA 5BQTA 1KQ0A 1FT9A 3O6BB 3J81K 4LB6B 3IHUA 2ZBKA 1WWXA 3I4PA 2FMLA 4CGZA 3QOPA 1ZGAA 3R0AA 4U7BA 1IN6A 3D0SA 2H94A 4LMYA 5JHUA 1FSHA 5J6XA 3KEOA 4BHPA 4U0YA 2P8TA 2GA2A 1MGTA 5F1RA 3U9GA 2QQBA 4AVPA 4M74A 1Z6TA 3HHHA 5JFRA 1BJAA 4WCGA 2P6TA 4JBAA 4MHGA 4G9YA 5CYVA 3RYPA 2HFHA 4GCVA 1K7AA 2O0YA 3U1DA 5FB2A 1KGSA 5E18F 2LSOA 3TOBA 5FGMA 3MEXA 4LLNA 2WTEA 3NEUA 2HTSA 4RAZA 1YO5C 3E3VA 5DDGA 4NHJA 2P6SA 5FLXK 2EB7A 2D2WA 3I58A 3RIRA 1O3RA 2EFNA 2FSWA 1O3TA 1W4MA 2HQRA 2ZNYA 2R7FA 5HDNA 3K2ZA 2QM3A 3KP2A 5CLSA 3WE3A 1XB4A 3SZTA 3F23A 3KP6A 1SD5A 3RI4A 2P7CB 2ZFWA 4XLNF 3ZP5A 4L18B 3WTUC 3ZMSA 3DFGA 2P5VA 4WXCA 5DD4A 1R23A 4P9FA 1HW2A 4XSZF 4I09A 1WI9A 3KFWX 1XGSA 4KICA 3RYRA 4HF0A 1YYVA 1O7FA 2NNNA 3ECOA 4ZYHA 1DUXC 3WTZA 2CGPA 4HV5A 4Q5SF 1WQ2A 1ZH5A 4MEXF 5E17F 3M9AA 2RN7A 2LNBA 4ZYGA 4RB0A 4JK1X 3MFKA 4BH9A 1MJBA 1P4WA 4LFUA 4UVBA 3FZVA 2DO7A 4WX9A 1T39A 1T38A 4P96A 4OMZA 2P7VB 2VOPA 5HOOA 1YW9A 4G94A 5H6QA 3L00A 1YTYA 3J80K 2WC2A 1B9MA 4BXUA 3TO7A 3DV8A 2EA4A 4WF2A 3QP6A 2ISZA 2ZMEB 4R1HA 5E1WA 3T0YA 2VOOA 1YS7A 2G9WA 4HDUA 5DCMB 4WWCA 4AD9A 1TTYA 3CTAA 1LVAA 2K4BA 4MQ9F 1R5HA 5HLHA 4OIQF 3HOSA 1YS6A 4IPAA 6PAXA 4Q4ZF 2DQRA 1U6GA 3IRRA 2ZNZA 2VC1A 4KNYA 2XAJA 3CO7C 1HKQA 3R0JA 4KMUX 3KZZA 2Y48A 3K9TA 2PLYA 1PP7U 5TJJA 2JRTA 1QBJA 3F8NA 1FP2A 2GA1A 3F6OA 2ADUA 3SHFA 1I5ZA 4A0ZA 4BAYA 4LJZF 4L5JA 4PDKA 3TO6A 3REOA 1ZARA 3O2PE 1P92A 3LWFA 2NAZA 1LQ1A 3WTTC 5D4RA 1YW8A 1ZHFA 2HKOA 1DPRA 5HDKA 1UHWA 5AONA 3K0LA 3JAMZ 2CQKA 5D6EA 1QZYA 3R4KA 3W6KB 1J5YA 5BPIA 2H6CA 4G7HF 1I1GA 3QU6A 3O3KA 1S8NA 1U5TC 4B09A 1B6AA 1ZLJA 4RAYA 1LDDA 3LFKA 1FPQA 2GAUA 3KE2A 4G6DA 2MBFA 4BQAA 3FXRA 3JSPA 3J81Z 4IHTA 3PQKA 1VTNC 2XGXA 4G7ZF 1IXSB 1BC7C 4XBFA 1FOKA 1J59A 1P4XA 2OZ6A 1D3YA 3GF2A 1BI2A 2XAGA 5FO5A 2FBKA 1FC3A 4PGHA 2XKPA 2V79A 2KJCA 2RC4A 2XUBA 5D5UB 4A12A 1LDKB 1UCRA 3RJPA 4JQFA 3HRMA 1Z1DA 4M6YA 1AOYA 2QLZA 1BC8C 3G73A 5LRSA 4FT8A 1YW7A 1JXSA 4N9HA 3T5XA 3V7SA 1WKMA 1L0OC 2ZMEA 4U88A 1MZBA 2WWYA 1ZRFA 1IN8A 1IRFA 2Z99A 2PBIA 2EFPA 2HQNA 1RNLA 5DCMA 3VEPA 4ZYDA 3K69A 1FBSA 1Y0UA 4KMFA 3P9CA 4KN4X 3G3ZA 2ISYA 3GXOA 5DEQA 2FMYA 2AXLA 2BV6A 5FLXZ 1KU7A 5HDGA 2O03A 3E6CC 3P9KA 4XSXF 5HLIA 4AIHA 1TQPA 3E5XA 3ZPLA 1BI3A 5FD5A 4H0EA 2MLKA 5CVUA 1QPMA 2H27A 2JZYA 4YG2F 2KRFA 3FMQA 2L3DA 2E7WA 1Z7UA 3T8RA 3V8JA 2EWNA 3HRSA 2F5EA 3V7RA 1FX7A 1U78A 4LLGF 2GWRA 2E1CA 3LAPA 4EJTA 3IKVA 3DKWA 3P7NA 1S7OA 5FFZA 1QZZA 3CLOA 1LEAA 1G3SA 4B8XA 1IN4A 5ERIA 2C6YA 3ZMZA 5D5WB 3FXQA 2IA2A 5ICGA 4ZH4F 2W24A 5LEKA 3GFLA 2IA1A 1SFEA 4HQMA 1YQAA 4NQWA 2XAHA 4XLPF 1MDMB 3GX4X 3EYYA 3V7CA 3RDIA 4CO8A 1I27A 1PP8F 4ENKA 2CG4A 4R79A 3J80Z 3E97A 1MJAA 3FX3A 1JE8A 4HX8A 3W6JB 4ETSA 1XCVA 1CGPA 3BPXA 3BOQA 2A07F 2GXBA 3ZMUA 5E20A 3DPTA 2JT1A 3DXJF 2F5DA 3LSTA 3E6BA 3FMRA 5IT9K 3ZMVA 1HSTA 3NQOA 3I71A 3TDZC 4YIIA 2QQ9A 3LQRA 1R5GA 5LGNA 2MA3A 1BI0A
chains in the Genus database with same CATH superfamily
1RZ4A 1G3YA 2XAQA 2CV1A 4PSWA 2WY7Q 2OZUA 3FM5A 2E19A 4B3XA 3LNQA 1BR1A 3E6DA 5HNFA 3A03A 3K2AA 3V42A 1R58A 3TDUC 3KP3A 4U87A 4RGSA 5K7FA 4XKBA 4EQQA 2QA4I 1TT5B 1TZLA 2K85A 3K4MA 1SVOA 3ZQ7A 2VKDA 3DP7A 3N97A 3I0TA 2VODA 3HRTA 5DUKA 3L2VA 5HS9A 4LD5A 3DTKA 3HPGA 3OS1A 4IF4A 1JGSA 2AO9A 2DDAA 4V2GA 2DU9A 1UMQA 5CJ9A 1V5EA 2DPDA 3HOTA 3I4MJ 5DD8A 5KVRA 5H2FC 1RR8C 2FNAA 1ERDA 3EDPA 1XSVA 4HDVA 1YE9A 3T1BA 1S9HA 4W1UA 2D1VA 2F4MB 2G7UA 4BU2A 1MD0A 1GUUA 1XGNA 2KPMA 3SFZA 3BDDA 4DZJA 1T33A 5CKTA 1T0FC 2JUGA 4AVZA 3VSLA 2X1DA 3FBIB 5A2QK 2BBYA 3LAJA 2GIZA 4ESJA 2OPTA 3W2WA 1M1EB 1TBXA 4I76A 2E7XA 2MC3A 1KZHA 1E0EA 1MBFA 5K5OA 3CUQB 3S1RJ 2ID3A 3I54A 2MC4A 1QQIA 1RRJA 3GTPJ 4A93J 1HW5A 2LD5A 2ESHA 3LSPA 2ECBA 3TOAA 2M87A 2UXXA 2VBXA 3AKZA 1UHMA 4Q48A 3VB2A 1R7JA 2IS4A 2KFDA 4MTDA 4ENNA 1KYZA 2OAZA 1YJNI 2NVQJ 2W7NA 1MMGA 4A2UA 1KQ9A 1O7LA 4P1WA 1APLC 1SD7A 1IXCA 2Z3YA 1T2KA 4A0XA 3WE2A 1VQ5I 1OYYA 3COAC 4BEHB 4Y4RA 2WV1A 3V8KA 3HG9A 3RPUD 5CVVA 2LKSA 2QVOA 5FKMA 5EF6A 2X48A 3RKQA 3SQNA 2XPWA 1J7KA 3A1YA 3OS0A 1HKSA 2JA2A 3HJEA 2CWEA 4O3MA 4EV0A 4PGGA 4OWRB 2LF8A 3MCZA 3SDGA 4MFEA 4XIDA 4Y13A 4LIUA 3I59B 2RQPA 5F64A 4S04A 3F21A 3J7AO 1PUFA 2Y30A 1FOWA 3ROUA 4C2UA 3F0CA 4MTEA 1MDMA 2H1LA 2ME0A 1K6OA 1TW2A 3NWSA 4E70A 1XMKA 2K9LA 3CDLA 4EVIA 1Y6IA 4YFKF 2NNYA 4PZJA 4M3BA 4KIGA 1PYVA 1P2FA 4LOCA 5BOXA 3JRHA 3IV5A 1PVEA 5L3GA 1LE8A 2YSRA 2XROA 2MSYA 1O3SA 2Q2EA 4DYCA 2DMPA 2E2JJ 2PFBA 3OYAA 1LFPA 2I5UA 1QVTA 2WV0A 4WXDA 2B7EA 3H5RA 2XRLA 2EPFA 2VL8A 4F91B 4A3FJ 1ZN2A 1V4RA 2RVCA 2Z16A 5IOZA 1J0RA 2DFHA 3OR2C 4OOIA 1N78A 5LHHA 1FLIA 3S2WA 2VI6A 4A5MA 3SEZA 3F72A 2IBDA 3OIPA 2XF7A 2ZKZA 3ZQCA 3S32A 1ZR2A 4BE0A 1LEBA 2BXYA 1TWHJ 2E36A 1W1WE 2EILH 3OR1C 4QPOA 4FE4A 1FSEA 1D0YA 1WPKA 4ENJA 2ACJA 1LJ9A 2DQLA 1I3AA 3EUKL 3J7ZI 4WK8F 2DCEA 3M4OJ 2R5ZB 3MZHA 2KRCA 2BW3A 3S3OA 4JX4A 1Y8RB 1FMWA 3A0BC 4IRHA 5K5RA 2NVTJ 1FTTA 2BEOA 2NVXJ 3ZQLA 2LK2A 4HBLA 2NRAC 2CYYA 3B6AA 2L7ZA 1RUNA 1YOVB 1QHHD 3IH3A 3DKXA 3LSKA 4DNCA 1A6IA 2CO5A 2CUZA 3EUHC 2DK5A 5FKOA 3SZPA 1SEUA 2KKOA 2HWVA 5J8FA 2GLOA 3N05A 2Y31A 1OPCA 3PUFA 2L0KA 4I0BA 5FFXA 4L0YB 1BA5A 1I1SA 1I50J 5J40A 2R5YB 3BJ6A 2ZXJA 4Y15A 4F55A 1RR7A 4C2TA 2JA8J 2EIKH 3FKIJ 4LLLA 3PIOF 2IXSA 1Z6RA 2JPCA 2HKXA 3CMEI 3DU5A 4EMSA 3D1NI 2UZKA 1U3EM 1JHHA 3ISPA 2DFEA 3JR9A 2O9LA 4BHBA 1SAXA 1LPQA 3H0DA 3HSRA 3KZYA 1LFUP 1S7AA 2R7DA 1XPXA 3J7YJ 1X19A 2DT7B 3K7AJ 4GRIA 1IV8A 1O4XA 1MNMC 2WAQA 2A69F 2DT5A 2PJPA 2HZDA 3E7LA 1FJLA 4LITA 3K70D 4MIMA 3WGIA 1FOXA 5ICEA 4KA4A 4ESFA 4M9ZA 4HG2A 3ZRGA 1TWAJ 4KFCA 1IN7A 3KLOA 3CUOA 3CESA 3QAHA 2XASA 2KDZA 2X6WA 1YFHA 2PMZA 3HM5A 2RV8A 1N25A 2W85A 3K4CA 5LLQA 2PMUA 4A3IJ 3CUQA 2FRHA 1W5TA 5HS8A 1PJRA 2KIMA 5FD6A 2EK5A 2XKOA 4P5OA 2UUZA 1ZRCA 5DV5A 3GVAA 1VQ8I 3PNVA 4C3HJ 2Q0OA 1HOMA 2IP2A 1BN5A 2MLGA 1UAAA 1XGOA 3IAM2 3JRIA 3H36A 4BNCA 3DKYA 1R1TA 2Y9ZA 1O3QA 4YFNF 2Z5UA 4A3LJ 5HVQC 3ABMH 1YRNB 2FNPA 1KQ8A 3EQLF 3LSMA 4PJMA 3OV8A 2HQ5A 4CCNA 1QGPA 2QSHX 1HQCA 3ZXSA 4F93B 5IT3A 4PCQA 4OIRF 1FZPB 1R1VA 2ICWG 1JHFA 2J5OA 3WTSC 1DP3A 2QQAA 2VB6A 1IUFA 5LGTA 2FF4A 2RQQA 1VZ0A 1XD7A 4D7NA 3C2GA 4EJUA 3KP7A 4BQQA 3I59A 2P81A 5KNLA 1QA6A 5C4XJ 3Q9VA 4FX4A 2IAIA 3VOEA 2FOKA 3FXUA 2RREA 3GFIA 5FRMA 3AG4H 3CO6C 3FISA 4E7JA 4E4HA 2IA0A 2L7MP 5E1ZB 2ZFUA 1BOBA 2KLOA 4AC0A 3ECHA 2JSCA 1JUSA 1R49A 2XAUA 3BWGA 1WJDA 2KZVA 4DBRA 2BY2A 4CCMA 3HC7A 4BJ6C 1WI3A 3RPQA 3ZQIA 4LB5A 1ON2A 2RKHA 3VSKA 1B59A 1OKRA 5IT9Z 2VKVA 1WJCA 3TEDA 4D9JA 2HYGD 3H9JA 4EATA 4RB2C 4DZPA 2L7FP 2DFFA 5CVJA 3ZQQA 2HNHA 3GZ5A 1JKOC 4HOBA 4L0ZB 3W3CA 2CQ7A 3OYEA 3WTXC 4DYRA 2HEOA 5DCFA 4B4CA 2YU3A 3D5LA 4YRVA 4IOCF 2KIFA 4AM3A 2CSOA 4QSHA 2ZO4A 2LDUA 2CFOA 2M7AA 1TQIA 3PSIA 2A6TA 1T6SA 4D5FA 3WTWC 3LA7A 3E5UA 4GGGA 4JP0A 4M6XA 3S8PA 1Z91A 5FJ8J 3M3YJ 2X4HA 2FA5A 2R5ZA 2QBYB 3I5UA 4BXFA 2NS8A 2VQCA 4OIPF 2QKMB 4L9JA 5KHDA 1JT0A 4UNOA 3TO9A 3VPRA 4W97A 2AQEA 2JRMA 4U0VA 5JLWA 2HR3A 5EGOA 1NK3P 4NBQA 2HPMA 3QPSA 2V9VA 2HDCA 2KT0A 3FBNB 3KP4A 2OTLI 2OCCH 2R93J 1WSUA 5HLTA 4ZYEA 2HVSA 3H5AA 3G6EI 1MW7A 4HX7A 4RGUA 1F4KA 3IH2A 4KIFA 2IGKA 2W25A 2VBZA 2VXZA 3E5QA 1A04A 5IP7J 3LSHA 5BMZA 4KDPA 4KISA 4I6ZA 2PEXA 2R5YA 4M72A 1W7PD 3TP3A 2DN0A 4LK1F 2WBMA 2DOFA 3ABKH 2BE5F 4CCOA 2JTVA 5D6FA 4ABZA 3OOPA 3HTSB 3HBLA 2E71A 3KYCB 1SFUA 2YU9J 1K4TA 5FRNA 4I01A 5H6RA 1HDPA 2WB1N 1OYWA 3JTGA 2HYFA 4UVCA 1MBKA 4YIRX 3TP0A 1Z21A 3QWLA 5A2QZ 5HODA 3JSOA 3BG9A 1V5FA 4UVAA 1G4DA 3LA2A 3F8MA 1HF0A 4BE1A 2G0EA 2XAFA 1GDTA 2Y75A 4XKCA 2ETHA 2CH0A 3CMYA 2OTJI 3BPVA 3BP8A 3ABLH 5K7HA 1S6LA 1DU6A 1VFCA 2QENA 1MBGA 5GTIC 5GTHC 3FWEA 1MKMA 2LR8A 4UUVA 4UV8A 2K4JA 4U0WA 5CQGA 5E8IA 3ERED 5CVIA 3GYHX 3QOEA 4XL9A 3FK6A 3H92A 1ZG1A 4Z6YA 4LG3A 1KU2A 2PN6A 4RAGA 1ETQA 1WJFA 2D1HA 3L9FA 3TGNA 5EG0B 1JKPC 2FE3A 1F43A 1ETWA 3WG9A 5IYCJ 1R4NB 1BM9A 2P4WA 1Z7LA 4EGYA 5L3DA 2PI0A 1Z9CA 2FOWA 2BY0A 4AUXA 1VNDA 4OIOF 3H1CA 4ZJZA 1D5VA 1UJ8A 5J4VA 5DM6F 2K9MA 1Z0XA 4YEJA 5FLVA 3A2KA 2O5RA 4BQOA 3TKYA 2H1KA 3CCMI 2Q8KA 3LSJA 2P5KA 3BZCA 3DQVC 1BBYA 3K4NA 2VT2A 5GAEJ 1YRNA 3AAFA 1F5TA 1IF1A 2XGCA 4D0PA 2W48A 2XIGA 3O8GA 1IUYA 1S3JA 1GV2A 4B1RA 5IP6A 2FU4A 2L9NA 3HGGA 3D5RC 4HW0A 3C2BA 5D8LB 4HEA2 3GEZA 2DA4A 2CQQA 1ORKA 4XICA 4RB1A 1IN5A 1FY7A 1JGGA 2QEXI 3KX2A 5KK1A 2E5NA 2OA4A 1DDNA 1OCTC 4AWXB 2AS5F 2COBA 2RGVA 2JA5J 1XGMA 1DQUA 2VN2A 1YG2A 1HBXG 1XG1A 3S93A 1IRXA 3CJQB 4UXNA 2CW0F 2R3SA 5M3MJ 4BKXA 2YS9A 4CYCB 3EUAA 4EJVA 4NC6A 3FMSA 4PFOA 3NRVA 2XF5A 4HV6A 2PX9A 1JUMA 2RNJA 4PFPA 3ZQGA 1XX5A 2DA7A 1JKRC 3CJNA 3CP8A 2K27A 4HA8A 2Z9OA 3RKXA 3ZMTA 3DBLB 1V54H 2XRNA 1SFOJ 1U5TB 3IUOA 1Q1HA 2KQRA 3C2HA 3F22A 3H0GJ 4XN3A 3HKZA 4KJZA 2IS2A 3JRFA 2EQRA 3GW2A 4ZZLA 1OYIA 2XB5A 3IL2A 2ELJA 1QNTA 2LG4A 2LBFB 2LH9A 2DMUA 4HF2A 1JJ6C 3GTGJ 2M45A 3BTCA 4LG0B 4I2OA 3S2HJ 2X6YA 1R36A 2Z2SB 4RA2A 1BW6A 2EZHA 4BYYA 1O57A 2YX7A 1F9NA 2DA3A 4KUMA 4I98B 3JRBA 4MFDA 3MKZA 5B5EC 5J1RA 1YI2I 5BPDA 5LHGA 2HVRA 3CC4I 3S1QJ 1ZG5A 3WODF 2PQ8A 2EV5A 1EH6A 2Z33A 2QBYA 3HOVJ 1ETVA 1ZREA 5FKNA 5JVTA 1T8IA 3U2RA 5F6FA 2K7LA 4RS8A 3HZJA 2OF7A 4N9IA 3SEQA 3FDYA 2ZCWA 1P9QC 5GAGJ 2M34A 4ENMA 2PMHA 3BR2A 2H8RA 2LOOA 2HS5A 2M5WA 4L5EA 4OU0A 4FE7A 1XN7A 4GYIA 4UY8I 1D1CA 1SAUA 1PDNC 1UG2A 3ULQB 4P9UA 4XOTA 1H9GA 1TQMA 3KIOA 2AHQA 5F27A 4I7HA 3WG7H 5CVRA 3DU6A 1XTAA 2LY1A 5AIQA 3HSEA 2DYRH 2FQ4A 1YLFA 4BQNA 1SD6A 4HSRA 2XGEA 2X0LA 5IOYA 1K61A 2A6EF 2IJLA 2Y9YA 3CLQA 3MAJA 1A31A 2LREA 4OMYA 3ERMA 4MGRA 1MIJA 1AA7A 1OJLA 1ON1A 4N0BA 3PQJA 3H5NA 2ZXHA 5BS6A 2XVCA 2GQQA 4IQJA 4J00A 2DA1A 2DYSH 3GFJA 4EJWA 2BVMA 2V4JC 2F2EA 3BR1A 1KU9A 2DFIA 4HNVA 3S15J 2VBWA 2L4MA 1BR4A 2KRHA 3IRQA 1BIBA 4E7ZA 2W84A 2DAOA 2VKEA 2A6HF 2FQ3A 5C4JJ 5ICFA 3RKYA 3L2RA 4L9TA 4KITB 4BUPA 3QU3A 2XPVA 2K86A 3IP4B 4LIVA 3PM1A 3K70C 1ONVA 3BG6A 3DEEA 1RI7A 3ONQA 4QTRA 2EBIA 3R61A 5ILSA 5EG0A 2A3SA 3F8FA 1TW3A 2JWTA 5FROA 1GXPA 5IP9J 4I0AA 1H88C 2V1XA 3ABTA 2GM4A 2NVUB 1U8RA 3Q9SA 1G3WA 3EYIA 2HYJA 1IRGA 1BR2A 3K1MA 1HDDC 1EF4A 3OIQA 2DMTA 2Y0SA 1XDSA 3A01B 3ZGKA 2ECCA 2VBYA 5C3EJ 2M30A 2E1MC 2XV4S 3M1EA 1SMTA 4X0GA 3GTKJ 1E2XA 1NH3A 2VONA 5L3FA 1RC9A 1XMXA 1HSJA 2VXDA 3R6SA 2O3FA 1LB2A 3K6GA 1LDJA 4E7HA 1TNSA 4FX0A 4ITVA 1OCRH 5HLGA 2KMUA 2A68F 3H3ZA 4KT5C 2F5VA 2VQLA 2VKHA 4K2EA 2GZWA 1W5SA 4ZDOA 1EJ9A 5JR3A 3PSFA 3I64A 3QPTA 1ZQ3P 4ON0A 5KAIC 1Y39A 5J4YA 5GPCA 1X1BA 3WTVC 1IG7A 2OV7A 1DGRM 2QYOA 2PG4A 5K7ZA 2ZSHB 5EDNA 4CYCA 4A3EJ 4G7OF 3OYDA 4IL6C 2OD5A 3ASOH 2NOGA 3Q0VA 4MNUA 5DYMA 1HA8A 3GLXA 2DOEA 4P55A 3PFIA 3BR0A 1MNEA 1K79A 4BBSJ 3BG3A 2X1EA 4G6QA 4NC7A 1TWCJ 4JX5A 3PUBA 3CCSI 3TQNA 2ZMEC 1U5TA 3BR5A 4AIKA 3IKTA 1ZAOA 3P9IA 4M9SA 1A36A 2MD5A 2CFXA 3N4MA 1GHCA 1MSFC 5LBQA 4CH7A 3L7WA 1H8AC 1DP7P 1ZYRF 1U0JA 5LRRA 5ICCA 1UG0A 3BY6A 2LBFA 3ESWB 1E17A 1D1AA 2UV1A 3F3XA 3CDIA 1REPC 1R1UA 1USSA 1TLHB 2KP6A 4LG0A 3RTRA 2X51A 2LVSA 5J47A 1FBQA 4UUSA 1FOYA 4MO7A 1XC5A 1EKEA 4CCJA 1BI1A 2J5PA 3HSFA 1T98A 4ZYAA 3T8TA 4HQEA 4IRIA 3OS2A 4Y33A 5KAFC 1F1ZA 2BXZA 2M8GX 4R8HA 4QLCU 1ZGJA 2W57A 2A5YB 2X85A 5L3CA 3DCFA 3K4BA 4YFXF 1LVKA 4E7SA 4PJJA 4FETA 2KL4A 3SFIA 1RUOA 4I99C 2F6CA 5TRDA 5F0HA 4I02A 1OMIA 2ME6A 4HZFA 2R7VA 3FK7A 4CZZA 3C3WA 1SMYF 2K3FA 3X2QH 2V1UA 4HAMA 2JSPA 3CDHA 1R00A 3DEUA 3GZ6A 4A5NA 4RAFA 1EH8A 1ULYA 1LKXA 3NARA 2ESNA 3MN2A 1D8KA 4XKWA 2CRGA 2DDBA 3E6MA 4YELA 4F7ZA 5LEJA 2FEZA 3IC7A 3SXYA 3CCLI 2F4IA 3WU1B 2OBPA 1IZ1A 1DPUA 1FYMA 3R60A 2EFQA 2VJJA 3HXLA 2LY2A 1BJZA 3HUGB 3OOUA 2D5VA 1KA8A 3TW7A 2EJRA 4OAZA 5EGOB 3B73A 4EJOA 2HTJA 3CJTB 1X4OA 4M71A 2V26A 3V4GA 3HTUA 2LF7A 1NHAA 3LSRA 5BNGA 3ZQFA 2E1OA 4IHYA 2ZXIA 1YJ9I 3SJMA 3ML6A 2ID6A 2OJED 2R4GA 1CF7B 1YX3A 5D8KB 3F6VA 2JQ7A 3BJAA 2HVQA 2CU7A 1TP4A 1B4AA 3K4KA 4KT6A 3Q0UA 5H20A 1Y56A 1LFBA 4BY7J 4CCLA 4HLYA 1VF9A 2V1DA 2A61A 2W00A 2CV2A 2VE8A 1UZCA 1X2MA 1QHGA 2DLLA 4DOZA 3A01A 4M6VA 3F8BA 2LFBA 3S2DJ 2P0WA 3BJOA 2JPBA 3I9V2 2X6XA 1QZEA 4FHTA 1NTCA 2VE9A 2IVMA 1Z77A 2Y0MA 5D5VB 1XS9A 3RPUA 5B1BH 1S72I 5EEAA 4A3BJ 2VQHA 5E3LA 4DYQA 1ZLKA 3HDDA 2LRDA 4HX4A 2FUG2 2IW5A 4IHSA 3KZIC 1IW7F 2GXGA 2O6GE 3C7JA 1X3UA 3HIFA 4S0HB 2FBHA 1QRYA 3QQAA 4UHTA 2A5WA 4ZC3A 5HNHA 2DTZA 3HB9A 4PJLA 2QZ8A 2EH3A 4A6EA 3QP5A 1Y8QB 3M8FA 2P5LC 1GXQA 1IGNA 4EM1A 2V9KA 4CXFA 1K4SA 1I6XA 3HHGA 2F5CA 1WJ5A 2M8EA 3DPLC 2GIVA 4AYBA 2JN6A 2L7KA 3BQZA 2EA2A 1MH4A 2RAEA 2D45A 4G8XA 4GYGA 1B1BA 1OCPA 3K1NA 2E1NA 5EZGA 2YPRA 3CCUI 5CPRB 3CCYA 2XSJC 3NAUA 4X1EA 2Q1ZB 3FM3A 3MVPA 2CUJA 1SFKA 9ANTA 1ITYA 1D0ZA 3UNGC 4E6KG 1WGXA 3WU0A 2DI3A 4EEFG 5K1YA 2VT3A 4B48A 4HYEA 1IXRC 1X58A 3H3UA 3KLNA 4O6JA 4XK4A 4RGRA 3HPHA 1W5CC 4HLXA 4B47A 4KIBA 1FNNA 2RNGA 4FTHA 1IAWA 1Y0NA 2OQRA 3WGHA 1D8JA 2TRTA 4IVNA 4ZDLA 2XF6A 4DW6A 5JI6A 3UKGA 2DW4A 2Y69H 3K10A 2E34A 1T95A 3P5JA 5HS7A 4QWQA 4ANJA 2XC7A 3W2VA 5LHIA 2EV6A 4ASNA 1C0WA 4UB6C 1YIOA 5E8GA 3LA3A 2ELHA 3GCMA 1G2HA 2YR2A 2DOAA 5J1UA 4PJ0C 4D1QA 3ZMDA 3AG2H 3VFZA 2KZGA 1OR7A 1WRJA 3PL8A 3MWMA 1E3PA 2K40A 2KIUA 2VJ5A 4RB3C 1KONA 1U2WA 3BR3A 1FWZA 1W7PB 3M8EA 3MZYA 2NYXA 3OL4A 3DTEA 2VJIA 3FHNA 4IO9F 1BIAA 1QPIA 3TL4X 1X1PA 1G3TA 1JUPA 4JX6A 1POGA 1FYLA 4IHXA 2L01A 1X2NA 2ZJPF 1I3QJ 5DUIA 4M3GA 4FISA 2YX4A 1VQ4I 2HDWA 2V6EA 3J7AY 4EM0B 1IRZA 4E7IA 1WZ2A 2MW8A 1NG7A 2E60A 1IO2A 1SFXA 3VWBA 2JUCA 2EFOA 4XM3A 3HUGA 4A0YA 3CC7I 3K1PA 4BGDA 4IRGA 4IXAA 2JMWA 2DJNA 4GDFA 1ZRDA 4JOMA 2ELKA 5FLMJ 2NS0A 5J8CA 3Q5FA 2FBIA 2CJJA 3FXMA 2HOSA 1SVMA 2K02A 4GO1A 2UWMA 4DBQA 4LK0F 1MJ9A 4AIDA 1BL0A 3OIOA 2IS6A 2EV0A 1BW5A 3FKJA 2CQXA 1CF7A 5ED4A 3KEYA 4CDGA 1XSXA 1A35A 4EM2A 1H0MA 3MD2A 2LTPA 5L3EA 2FXAA 3RSNA 3FHZA 4Z2YA 3WHCA 1EV7A 3BC8A 1YITI 2COMA 3AG1H 1HW1A 3I55I 3GFMA 1T56A 2TDXA 4M9XA 3TBIA 1SANA 1V3FA 2KDOA 2V6CA 3VYRB 4A69C 5B66C 1HCRA 2HDDA 3AL0C 1V5GA 1XDUA 1UELB 1IC8A 4XORA 3V8LA 1WFXA 4C3IJ 3S1NJ 2B0LA 2R7WA 4OINF 3KYLA 4XLCA 3C18A 1T0FA 1B72B 1ETKA 4ZDPA 3KCCA 2QWWA 1FBUA 1VQNI 2BYVE 3G4SI 2LC2A 1NK2P 1IV6A 3IWFA 3I53A 1U9NA 4XKVA 5F08A 4KN7X 4L9VA 3UR3C 2L4AA 4L9NA 2UXNA 3SDBA 1YJWI 2VQGA 2HOEA 1AKHB 2XHKA 4CCKA 2ZJQF 2DMQA 1HLVA 2IRFG 2PMZN 3I4NJ 5AIPA 3RQIA 4XRFA 2RDPA 4CICA 1MMDA 2W4SA 1XCBA 2QKLB 2OU2A 2QF7A 2MH9A 3ZN1A 2V1NA 4XNFA 3W6VA 1K78B 3U1KA 1VQLI 4DQ2A 3L09A 3KP5A 4ESBA 1UB9A 4HPQA 2M0CA 3HOXJ 2CV0A 4M3DA 2MYSA 1VQ9I 4M3FA 1OLTA 4GXOA 5EEHA 1L3LA 4CYDA 4Y17A 4A6DA 2JVHA 3CZ6A 3I56I 2QUFA 2DK8A 3JRDA 2L9VA 3S14J 4HF1A 5D4SA 4YIFA 2CW8A 1OCCH 4UV9A 2E2IJ 4MQVA 3RKWA 3CMAI 3JTHA 4QPQA 2EZLA 3KPHA 4O5VA 3EETA 3IWZA 5ILUA 1J75A 3HEFA 3OYGA 2F5FA 3SZGA 2HZTA 1Y1VJ 3GUDA 5GAHJ 3DF8A 4U7DA 1G6NA 4V2FA 1W0TA 4A3JJ 1KYWA 3L2CA 1UFMA 1JJ8C 3EPZA 2MH2A 1STZA 3ZOBA 1MBJA 1HXDA 2H09A 2IT0A 1ZELA 2W1OA 2CQNA 3ELKA 2QSGX 2JA6J 1BOAA 1Z05A 1OCZH 2VASA 2N8GA 3BROA 2R7TA 3DEWA 2BVLA 1QVUA 2L9RA 2EINH 4GFBA 3BZ6A 1VQKI 3AG3H 2WA0A 4WXHA 5E79C 1W7PA 4S05A 1GV5A 2JJ7A 2HGCA 5L3BA 4M73A 1MBHA 2R7ZJ 1LNWA 2M1BA 1P6RA 3OYIA 3ZR8X 1YX5A 5TISC 1RIOH 4II2A 2LY9A 2FX0A 4MEYF 1B9NA 4J01A 1TNTA 3CUQC 5J1YA 2KISA 4UUSB 1XSDA 3S16J 3GTJJ 3DLLF 2LYCA 4C9YA 3WGGA 4ZZDA 5FKLA 1EH7A 2IPQX 2OUMA 1AHDP 2ZJ2A 3PO2J 2DBBA 4BHCA 3EUHA 2O8XA 2CUFA 4XONA 5GPAA 1B8IA 4L5IA 4XLHA 3JW4A 4BDYA 2BZTA 2M9HA 3F9KA 4Q47A 1AWCA 1KU3A 1Z3YA 3BZKA 5ILVA 3K4LA 3F8CA 1W36C 4LGWA 1USTA 1SD4A 2DJIA 2O61A 2H6BA 3VODA 3KEQA 1FTZA 4N4NB 3HRUA 2YUSA 3HYIA 4DGWB 2WAEA 2WADA 3MMYB 2GXAA 2G7HA 1H9TA 3QRFF 2STWA 4CHUA 4D5CA 1P4AA 2LKPA 3QYFA 3FF5A 1FP1D 4OAYA 4KYWA 1ODDA 3Q3SA 3M7GA 2BOLA 3VYSB 2VJ4A 1R22A 4F3QA 5K5QA 4AIJA 1TT0A 3KETA 1J9IA 1PUEE 1QO0D 2VC0A 3LSIA 3CCQI 5LGUA 4JYKA 2OQGA 3GWZA 1NG6A 1H89C 3ZN0A 1B72A 3VDXA 4BJ5C 3AFHA 1HKTA 2MD0A 2GBYA 4NDLA 1VQPI 2EFWA 4XN0A 1ZG3A 2DTRA 3C1DA 3FXKA 4TV7A 4B43A 3WTYC 4RGXA 3HOZJ 3S17J 4EGZA 1W0UA 4DIQA 2MG4A 2DPUA 1J2XA 2KJBA 3HGYA 3CF5F 1ZTRA 1AKHA 1GVJA 3JAMK 1D0XA 3B02A 3LQQA 1JKQC 4NUBA 3QPLA 3OYFA 4IZZA 1I6HJ 3BTIA 2DT6A 5D5XB 2LMDA 1DGWY 3QPHA 1FYKA 2BGCA 3QODA 1S29A 3ABUA 4IJAA 2XDVA 3BTLA 1FIPA 1X3WB 3G1OA 3GO5A 1XMAA 5E1XA 4CZCA 1N77A 1K78A 2L02A 4NB5A 5EEGA 2L54A 3TW6A 3MQ0A 2STTA 5BQTA 1KQ0A 1FT9A 3S3NA 3O6BB 3J81K 4LB6B 1OFCX 1RESA 3IHUA 2M4GA 3PNYA 3CD6I 3GMEA 3GTMJ 2ZBKA 4CSWA 1WWXA 1RPWA 3I4PA 1SC7A 2FMLA 4CGZA 5C44J 1SVLA 2X1CA 3HOYJ 4BJTA 3QOPA 1X4PA 1ZGAA 2V9PA 2XPUA 1GVDA 3R0AA 3WU2C 4U7BA 4BBRJ 1IN6A 3D0SA 2H94A 4LMYA 5JHUA 5F04A 5B3SH 4BY1J 1FSHA 2AXTC 4M3EA 3KEOA 5J6XA 4BHPA 4IKFA 3A4CA 2B63J 3W2AA 4U0YA 2P8TA 2GA2A 1MGTA 1I39A 5F1RA 3U9GA 2QQBA 4AVPA 2LP0A 4M74A 3E1SA 4XRSA 3SYTA 1R9TJ 4XQFA 1Z6TA 3HHHA 1ZKGA 5JFRA 1BJAA 1JTYA 4WCGA 5M5YJ 2P6TA 4JBAA 4MHGA 4D7MA 4G9YA 5CYVA 3RYPA 2HFHA 4C2MJ 2OCEA 1IDZA 3JCUC 4FASD 4GCVA 3OSFA 1K7AA 2O0YA 2L2OA 2M2EA 3HKZN 2JK3A 1T08B 3U1DA 2VIXA 2K9SA 5FB2A 1KGSA 3JREA 5E18F 2LSOA 1X1DA 3HOUJ 3TOBA 4XLEA 5FGMA 3RZOJ 3OYHA 3TMOA 5LD2C 1YHQI 3MEXA 2IGMA 1MMSA 3L2UA 4F52A 1FIAA 4J19A 4LLNA 1VQ7I 2WTEA 2IEKA 2I8DA 3NEUA 2HTSA 4RAZA 2HQAA 3H9GA 1YO5C 3OYJA 3E3VA 1FEXA 5DDGA 4NHJA 3BR6A 3CQZJ 2P6SA 2JVGA 3PIPF 5FLXK 2EB7A 2E2HJ 2D2WA 3I58A 1LUJB 3RIRA 1V55H 1O3RA 2EFNA 2OC6A 2FSWA 3BT9A 2BHZA 3DBHB 1O3TA 1W4MA 2HQRA 3L2QA 2ZNYA 2R7FA 5HDNA 3K2ZA 2QM3A 3KP2A 5CLSA 3WE3A 4BL0B 2I10A 3FXLA 1XB4A 3KYDB 3DWLE 3ZCOA 3SZTA 3F23A 2F48A 3KP6A 2XSDC 2K5CA 1OQYA 1SD5A 3RI4A 2P7CB 3DBRB 3G2BA 3GZNB 3VYTB 2ZFWA 3MKLA 4XLNF 1WJEA 3ZP5A 4L18B 3WTUC 4X6AJ 3ZMSA 1RKWA 3DFGA 2HI3A 2P5VA 3MKWB 4WXCA 5DD4A 1R23A 4P9FA 1HW2A 4XSZF 4I09A 1WI9A 3KFWX 3M1CA 1ACIA 1XGSA 1ZR4A 4KICA 2HOTA 1OISA 3H35A 3OWTA 3RYRA 3G1MA 4HF0A 1YYVA 2ZB9A 1W36D 1RKTA 2DXIA 3S3MA 1O7FA 1Z3XA 2NNNA 3ECOA 4ZYHA 3L2WA 1DUXC 5EZHA 3CCEI 3WTZA 2CGPA 4HV5A 4Q5SF 5DM7F 1WQ2A 1ZH5A 4MEXF 2NS7A 2BHYA 5E17F 1D1BA 5IYDJ 2E1MB 3GTLJ 2FD5A 3M9AA 2RN7A 2LNBA 1Z67A 4XLAA 4ZYGA 4RB0A 2M7BA 4JK1X 2GOMA 4XRMA 4CA0A 2Y0SN 3MFKA 4BH9A 2E5ZA 1MJBA 1P4WA 4LFUA 3OSGA 2IGNA 2DA6A 4UVBA 2LKXA 3OYCA 2PJRB 4RMNA 5M3FJ 3CCJI 2NOJB 3Q0WA 4V19K 3FZVA 3BQYA 3OYMA 3FXJA 2DO7A 4UB8C 4WX9A 1T39A 1T38A 3BCAA 4P96A 1U9OA 2EIMH 4XLFA 3CF2A 4OMZA 2P7VB 2VOPA 3D5SC 4IHWA 5HOOA 2O8KA 1YW9A 1R71A 2IS1A 4G94A 3PJRA 3O8HA 3A0HC 2M3AA 2K9NA 5H6QA 4RBOA 1R6RA 3G1LA 5F0CA 2WB1A 3L00A 2M0MA 1YTYA 4XRSG 3J80K 2WC2A 1S7EA 2B9SA 1JTXA 1DU0A 1B9MA 2HPIA 4BXUA 2LLKA 2R7UA 3TO7A 2CMPA 3DLAA 3DV8A 2EA4A 1WJAA 3CCVI 1VQMI 1U8BA 3LFUA 4WF2A 2NXNB 3QP6A 2ISZA 4A3GJ 3L1PA 2MGQA 2ZMEB 2GOXB 4B44A 3CJRB 4R1HA 3JRCA 4ZTJA 5E1WA 3T0YA 2BY1A 5IY5H 3DTIA 2R92J 3HL2A 2VOOA 2O7OA 4MLOA 1YS7A 2L5QA 2CUEA 4IOAF 2G9WA 4HDUA 5JVGF 1N75A 5DCMB 4WWCA 4AD9A 1TTYA 2JA7J 2MABA 4PJNA 3U21A 3CTAA 1LVAA 1ETYA 2K4BA 4MQ9F 1R5HA 5HLHA 3CCRI 1JT6A 4HSTA 4G6TB 3HOSA 4OIQF 1YS6A 2X9DA 4IPAA 2R7QA 4Q4ZF 6PAXA 2DA5A 2KHMA 3QYBA 2DQRA 1U6GA 3IRRA 4E7KA 5DS9A 2ZNZA 1A5JA 1IDYA 2VC1A 4KNYA 2XAJA 3CO7C 2W82A 3B6CA 1HKQA 2WY8Q 3R0JA 1HC8A 2HOAA 4KMUX 2Z1DA 3KZZA 4BDZA 1GT0C 2Y48A 3K9TA 4BEHA 2PLYA 1PP7U 5TJJA 3RQ4A 2JRTA 2K3PA 2R7XA 1QBJA 3F8NA 4IX7A 1FP2A 2GA1A 3F6OA 2ADUA 3OYBA 3JRGA 3DPUA 3SHFA 1I5ZA 4A0ZA 4BAYA 4C3JJ 1OCOH 4IEJA 4L5JA 2H8WA 4LJZF 4PDKA 3TO6A 3REOA 1TL8A 1ZARA 3O2PE 1P92A 3LWFA 5E3NA 5E3OA 4BXXJ 4IHVA 2NAZA 4Y7NJ 1LQ1A 3WTTC 4AU7A 1Y1WJ 3PNTA 5D4RA 1YW8A 3BG7A 1ZHFA 5GP9A 4BS9A 2HKOA 1DPRA 4UUTA 5HDKA 3CMMA 1UHWA 1X1CA 5AONA 2DA2A 5E3MA 4C30A 3K0LA 3JAMZ 2BY3A 2CQKA 5D6EA 1QZYA 3R4KA 3W6KB 1J5YA 5BPIA 2H6CA 2TCTA 4RLFA 4G7HF 1J09A 1I1GA 3GLLA 5M5WJ 4NC8A 3QU6A 3O3KA 2V7FA 1S8NA 1U5TC 4B09A 1B6AA 5F0FA 4ZTFA 1Q1VA 1ZLJA 1B8IB 4RAYA 1MSEC 1LDDA 3LFKA 1FPQA 2GAUA 3KE2A 4FCYA 4G6DA 2MBFA 4BQAA 4IQ4A 3I3LA 1ETXA 1WVRA 3FXRA 4NQWB 3J81Z 3JSPA 4E7LA 4IHTA 3PQKA 4FQGA 1VTNC 3E0JB 1AU7A 2XGXA 4G7ZF 1IXSB 1BC7C 4XBFA 1FOKA 3RCOA 3BCBA 1J59A 1P4XA 3FXOA 2OZ6A 1MNDA 3PFYA 3H9QA 1RETA 3VYUB 3A02A 1D3YA 1E3OC 1R5ID 3GBGA 1TC3C 3RZDJ 3GF2A 5EJCA 1MMNA 1BI2A 3BG5A 1VQ6I 5IPAA 2PJRA 4HRIA 4A3KJ 2XAGA 3QYEA 5FO5A 2MFZA 2FBKA 1FC3A 2NVYJ 4Y3OA 4BACA 4PGHA 2XKPA 5DTDA 2XGDA 1JI8A 2L9SA 2V79A 2HXIA 2KJCA 2R0QC 2RC4A 2XUBA 5D5UB 1R4MB 4HNTA 2WAQN 1LDKB 1UCRA 3RJPA 4A12A 4JQFA 1MMAA 1GLNA 3HRMA 1Z1DA 4M6YA 5J3LA 1AOYA 2QLZA 4PUSA 4II3A 1BC8C 4XMYA 3G73A 5JLXA 2DMNA 1WH7A 4FT8A 1YW7A 5LRSA 1TWGJ 1JXSA 4N9HA 3T5XA 4HNUA 3ZQHA 4AYBN 3V7SA 1WKMA 1L0OC 2ZMEA 4U88A 5TGTA 1MZBA 2WWYA 1ZRFA 1WHUA 1IN8A 1IRFA 4DJAA 2QCOA 2VPRA 2Z99A 4CUGA 4N4OB 2PBIA 1S5LC 2EFPA 2HQNA 2QQ8A 2F4OB 1RNLA 4RM3A 2A05A 5DCMA 3G71I 3HOWJ 2QGUA 3VEPA 4XOPA 3S1MJ 1WH5A 2XB0X 2E35A 4ZYDA 3K69A 1FBSA 4A3MJ 1Y0UA 1IJWC 1ENHA 1G59A 4KMFA 3P9CA 4KN4X 3G3ZA 1P7IA 2ISYA 3GXOA 5DEQA 3CC2I 2EIJH 2FMYA 4BE2A 2AXLA 2R7RA 2BV6A 2CW7A 4G12A 5FLXZ 2ZSIB 1KU7A 3OL3A 5HDGA 3OYKA 2O03A 1MBEA 3E6CC 3P9KA 1E3HA 4XSXF 2IGOA 3M07A 5HLIA 4AIHA 1TQPA 1A6QA 3E5XA 1ZGWA 3ZPLA 1CQTA 1BI3A 5FD5A 3WHBA 2M4KA 4H0EA 2MLKA 2FJ1A 4RLQA 4F92B 5CVUA 2X6OA 1FMVA 1P7JA 1QPMA 2H27A 2JZYA 4YG2F 4A3DJ 3JRAA 3H3VK 2KRFA 3FMQA 1EA3A 3OYLA 2L3DA 1WJBA 2ZC2A 3FIWA 2E7WA 5IYBJ 1Z7UA 3MZ8A 3OYNA 2K9QA 3T8RA 3V8JA 1K83J 2EWNA 3HRSA 2F5EA 1X3ZB 1F36A 3V7RA 1FX7A 1G8XA 2Y2ZA 5JHFA 1U78A 4LLGF 3GTOJ 2GWRA 2E1CA 3LAPA 5F1JA 4Y52J 4EJTA 3LOCA 4A3CJ 5M5XJ 3BTJA 1WCMJ 4XR6A 3IKVA 3GTQJ 1TWFJ 3DKWA 2EZKA 3P7NA 1S7OA 3IAS2 3LMMA 2DODA 5KCMA 5FFZA 2KIQA 1QZZA 3CLOA 1LEAA 3ASNH 4B3AA 1G3SA 5FKKA 1YIJI 4B8XA 1IN4A 5ERIA 1VI0A 1MH3A 2C6YA 3ZMZA 5D5WB 3FXQA 1VQOI 2IA2A 4QIWN 5ICGA 4ZH4F 2CS3A 2W24A 3BLYA 5LEKA 3GFLA 2IA1A 1SFEA 4HQMA 1YQAA 4NQWA 2XAHA 3LL7A 2ZJRF 1PUFB 2ZXWH 1UHSA 4XLPF 3MKYB 1MDMB 3M8JA 3GX4X 4NNJA 3EYYA 3V7CA 3RDIA 5EYRA 4CO8A 3AL0B 1I27A 1PP8F 4RM2A 1X1AA 3K4JA 4ENKA 2VUMJ 2CG4A 2HXOA 4R79A 3NWTA 3J80Z 2VPLA 2WAFA 5GADJ 3E97A 2EZIA 1ZK8A 1MJAA 3FX3A 2HU9A 2AQFA 4HX8A 1JE8A 1LE8B 3W6JB 2Q2EB 4ETSA 1XCVA 1CGPA 3BPXA 3PO3J 3BOQA 1OR7C 2A07F 2GXBA 3ZMUA 5E20A 1D5YA 2VLAA 5CQEA 5B1AH 3DPTA 1K6YA 4PSXA 2JT1A 3DXJF 2F5DA 3LSTA 4RDUA 3E6BA 3FMRA 5IT9K 4PK4A 3ZMVA 3OMYA 1HSTA 3NQOA 3I71A 3TDZC 3CP2A 4YIIA 2QQ9A 2R7OA 2QSFX 3LSGA 4H4KC 1ETOA 1R5GA 2BW3B 3LQRA 3OY9A 2R7SA 5LGNA 1QU3A 3IH4A 2MA3A 1BI0A 5LFAA
chains in the Genus database with same CATH topology
1RZ4A 1G3YA 2XAQA 2OZUA 3FM5A 3E6DA 1R58A 3TDUC 3KP3A 4RGSA 4EQQA 3ZQ7A 3DP7A 3N97A 3I0TA 2VODA 3HRTA 5DUKA 5HS9A 4LD5A 4IF4A 1JGSA 2DU9A 5CJ9A 2DPDA 3HOTA 5DD8A 5KVRA 2FNAA 3EDPA 1XSVA 4HDVA 3T1BA 2D1VA 2G7UA 1MD0A 1XGNA 3SFZA 3BDDA 5A2QK 2BBYA 3LAJA 4ESJA 1TBXA 2E7XA 2MC3A 5K5OA 3CUQB 3I54A 1QQIA 1HW5A 2ESHA 3TOAA 2M87A 2UXXA 2VBXA 1UHMA 4Q48A 3VB2A 1R7JA 4MTDA 4ENNA 1KYZA 2OAZA 4A2UA 1KQ9A 1O7LA 1SD7A 1IXCA 2Z3YA 1T2KA 4A0XA 3WE2A 1OYYA 3COAC 3V8KA 5CVVA 2QVOA 3SQNA 1J7KA 4O3MA 1HKSA 2CWEA 4EV0A 4PGGA 2LF8A 3MCZA 4Y13A 3I59B 2RQPA 5F64A 4S04A 3F21A 3J7AO 3ROUA 4MTEA 1MDMA 1K6OA 1TW2A 4E70A 1XMKA 4EVIA 4YFKF 2NNYA 4PZJA 4KIGA 1P2FA 5BOXA 5L3GA 2YSRA 2XROA 1O3SA 2Q2EA 2PFBA 2WV0A 4WXDA 1ZN2A 1V4RA 2RVCA 1J0RA 4OOIA 1FLIA 5LHHA 3S2WA 4A5MA 3F72A 2ZKZA 1LEBA 1FSEA 4ENJA 2ACJA 1LJ9A 2DQLA 4WK8F 3MZHA 4IRHA 5K5RA 2BEOA 4HBLA 2NRAC 2CYYA 1RUNA 4DNCA 2CO5A 2DK5A 3SZPA 2KKOA 2HWVA 5J8FA 4I0BA 1OPCA 4L0YB 5FFXA 1I1SA 3BJ6A 2ZXJA 4Y15A 4LLLA 2JPCA 1Z6RA 2HKXA 4EMSA 2UZKA 1U3EM 1JHHA 3ISPA 4BHBA 1SAXA 3HSRA 3KZYA 1S7AA 2R7DA 2A69F 2DT5A 2PJPA 3WGIA 5ICEA 4KA4A 4ESFA 4M9ZA 4KFCA 1IN7A 3KLOA 3CUOA 3QAHA 2XASA 1YFHA 2RV8A 2W85A 5LLQA 2PMUA 3CUQA 2FRHA 1W5TA 5HS8A 2KIMA 5FD6A 2EK5A 2XKOA 4P5OA 1ZRCA 5DV5A 3GVAA 2Q0OA 2IP2A 1BN5A 2MLGA 1XGOA 4BNCA 1R1TA 1O3QA 4YFNF 2Z5UA 5HVQC 2FNPA 1KQ8A 3EQLF 3OV8A 1QGPA 1HQCA 5IT3A 4PCQA 4OIRF 1FZPB 1R1VA 1JHFA 2J5OA 3WTSC 2QQAA 5LGTA 2FF4A 1XD7A 4EJUA 3KP7A 3I59A 3Q9VA 4FX4A 3VOEA 2FOKA 3FXUA 3GFIA 3CO6C 2IA0A 5E1ZB 3ECHA 2JSCA 3BWGA 3RPQA 4LB5A 1ON2A 2RKHA 1B59A 1OKRA 5IT9Z 2HYGD 4RB2C 5CVJA 3GZ5A 4HOBA 4L0ZB 3WTXC 2HEOA 5DCFA 2YU3A 3D5LA 2KIFA 2CSOA 2ZO4A 2LDUA 1TQIA 3WTWC 1T6SA 3LA7A 3E5UA 4GGGA 4M6XA 1Z91A 2X4HA 2FA5A 2QBYB 3I5UA 4OIPF 4L9JA 4UNOA 3TO9A 4U0VA 2HR3A 2V9VA 2HDCA 3KP4A 1WSUA 4ZYEA 4HX7A 4RGUA 1F4KA 4KIFA 2W25A 2VBZA 2VXZA 3E5QA 1A04A 5BMZA 4KDPA 2PEXA 4M72A 1W7PD 4LK1F 2BE5F 2JTVA 5D6FA 3OOPA 3HTSB 1SFUA 4I01A 5H6RA 1OYWA 3JTGA 2HYFA 4UVCA 5A2QZ 3JSOA 1G4DA 4UVAA 3LA2A 3F8MA 2XAFA 2Y75A 2ETHA 3BPVA 3BP8A 1S6LA 2QENA 3FWEA 1MKMA 4UUVA 4UV8A 2K4JA 4U0WA 5E8IA 3ERED 5CVIA 3GYHX 3H92A 1ZG1A 1KU2A 2PN6A 2D1HA 3L9FA 3TGNA 2FE3A 3WG9A 1BM9A 2P4WA 4EGYA 5L3DA 2PI0A 1Z9CA 4OIOF 1D5VA 3TKYA 2Q8KA 2P5KA 3DQVC 1BBYA 2VT2A 3AAFA 1F5TA 1IF1A 4D0PA 2XIGA 1IUYA 1S3JA 2FU4A 4HW0A 5D8LB 3GEZA 4RB1A 1IN5A 1FY7A 5KK1A 2OA4A 1DDNA 4AWXB 2AS5F 2RGVA 1XGMA 2VN2A 1YG2A 1HBXG 4UXNA 2CW0F 2R3SA 4EJVA 3FMSA 3NRVA 4HV6A 2RNJA 3CJNA 2K27A 4HA8A 2Z9OA 3RKXA 3ZMTA 2XRNA 1U5TB 1Q1HA 3F22A 3GW2A 4ZZLA 1OYIA 3IL2A 1QNTA 4HF2A 2M45A 4LG0B 4I2OA 1R36A 4BYYA 1O57A 2YX7A 1F9NA 4KUMA 4I98B 5BPDA 5LHGA 1ZG5A 3WODF 2PQ8A 2EV5A 1EH6A 2Z33A 2QBYA 1ZREA 5JVTA 3U2RA 5F6FA 2K7LA 4RS8A 4N9IA 2ZCWA 4ENMA 2PMHA 2HS5A 2M5WA 4OU0A 1XN7A 4GYIA 1PDNC 3ULQB 4P9UA 1H9GA 1TQMA 4I7HA 5CVRA 5AIQA 3HSEA 1YLFA 1SD6A 2X0LA 2A6EF 2IJLA 3MAJA 4OMYA 4MGRA 1ON1A 4N0BA 3PQJA 5BS6A 2XVCA 2GQQA 3GFJA 4EJWA 2F2EA 1KU9A 2DFIA 2VBWA 2L4MA 3IRQA 1BIBA 2W84A 2DAOA 2A6HF 2FQ3A 5ICFA 3RKYA 4L9TA 3QU3A 2K86A 1ONVA 1RI7A 3R61A 5ILSA 2A3SA 3F8FA 1TW3A 1GXPA 4I0AA 2V1XA 3ABTA 1U8RA 3Q9SA 1G3WA 3EYIA 1IRGA 3K1MA 1XDSA 2VBYA 2M30A 2XV4S 3M1EA 1SMTA 1E2XA 2VONA 5L3FA 3R6SA 1HSJA 2O3FA 1LB2A 1LDJA 1TNSA 4FX0A 5HLGA 2A68F 3H3ZA 4KT5C 4K2EA 2GZWA 1W5SA 5JR3A 3I64A 3QPTA 4ON0A 3WTVC 2QYOA 2PG4A 4G7OF 2OD5A 4MNUA 5DYMA 3GLXA 4P55A 3PFIA 1K79A 4G6QA 3TQNA 1U5TA 4AIKA 3IKTA 1ZAOA 3P9IA 4M9SA 1GHCA 2MD5A 2CFXA 3N4MA 5LBQA 3L7WA 1DP7P 1ZYRF 5LRRA 5ICCA 1E17A 3BY6A 3F3XA 1REPC 1R1UA 1USSA 1TLHB 4LG0A 3RTRA 1FBQA 1BI1A 2J5PA 3HSFA 1T98A 3T8TA 4HQEA 4IRIA 1F1ZA 4R8HA 4QLCU 1ZGJA 2W57A 2A5YB 5L3CA 4YFXF 1RUOA 5TRDA 4I02A 1OMIA 4HZFA 4CZZA 3C3WA 1SMYF 2V1UA 4HAMA 3CDHA 1R00A 3DEUA 3GZ6A 4A5NA 1EH8A 1ULYA 2ESNA 1D8KA 3E6MA 4F7ZA 5LEJA 2FEZA 3IC7A 3SXYA 3WU1B 2OBPA 1IZ1A 1DPUA 1FYMA 3R60A 2EFQA 1KA8A 2EJRA 3B73A 4EJOA 2HTJA 4M71A 3V4GA 3HTUA 2LF7A 1NHAA 3ML6A 1CF7B 5D8KB 3F6VA 3BJAA 1B4AA 5H20A 4HLYA 2V1DA 2A61A 2VE8A 2DLLA 3F8BA 3BJOA 2JPBA 4FHTA 2VE9A 2IVMA 2Y0MA 5D5VB 3RPUA 1ZLKA 4HX4A 2IW5A 4IHSA 1IW7F 2GXGA 2O6GE 3C7JA 1X3UA 3HIFA 2FBHA 4UHTA 2QZ8A 4A6EA 3QP5A 3M8FA 2P5LC 1GXQA 4EM1A 4CXFA 1I6XA 3HHGA 2F5CA 2M8EA 3DPLC 2GIVA 2EA2A 2D45A 4G8XA 4GYGA 1B1BA 3K1NA 2E1NA 2YPRA 3FM3A 3WU0A 2DI3A 5K1YA 2VT3A 4HYEA 1IXRC 3H3UA 3KLNA 4O6JA 4RGRA 4HLXA 4KIBA 1FNNA 1IAWA 2OQRA 3WGHA 1D8JA 4IVNA 5JI6A 2DW4A 5HS7A 4QWQA 5LHIA 2EV6A 4ASNA 1C0WA 1YIOA 5E8GA 3LA3A 2ELHA 2YR2A 3ZMDA 3VFZA 1OR7A 1WRJA 3MWMA 2KIUA 4RB3C 1U2WA 3M8EA 1FWZA 1W7PB 3MZYA 2NYXA 1BIAA 1G3TA 1FYLA 2L01A 5DUIA 2YX4A 4EM0B 1SFXA 2EFOA 3HUGA 4A0YA 3K1PA 4IRGA 4IXAA 1ZRDA 2NS0A 5J8CA 3Q5FA 2FBIA 4GO1A 2K02A 2UWMA 4LK0F 1MJ9A 2EV0A 1CF7A 5ED4A 4CDGA 1XSXA 4EM2A 1H0MA 5L3EA 2FXAA 3FHZA 4Z2YA 1EV7A 2COMA 1HW1A 3GFMA 2TDXA 4M9XA 1V3FA 2V6CA 1XDUA 3V8LA 2B0LA 4OINF 3C18A 1T0FA 3KCCA 2QWWA 1FBUA 2BYVE 3IWFA 3I53A 4KN7X 4L9VA 2L4AA 4L9NA 2UXNA 2HOEA 2XHKA 2IRFG 5AIPA 4XRFA 2RDPA 4CICA 1XCBA 3ZN1A 2OU2A 2MH9A 1K78B 4DQ2A 3L09A 3KP5A 4ESBA 1UB9A 5EEHA 4GXOA 1L3LA 4CYDA 4Y17A 4A6DA 2QUFA 2DK8A 4HF1A 5D4SA 4YIFA 4UV9A 4MQVA 3RKWA 3JTHA 4O5VA 3EETA 3IWZA 5ILUA 1J75A 2F5FA 2HZTA 3GUDA 3DF8A 4U7DA 1G6NA 1KYWA 3L2CA 1UFMA 2MH2A 1STZA 1HXDA 2H09A 2IT0A 3ELKA 1BOAA 1Z05A 3BROA 3BZ6A 4WXHA 1W7PA 4S05A 2HGCA 5L3BA 4M73A 1LNWA 2M1BA 1P6RA 1RIOH 4MEYF 1B9NA 1TNTA 3CUQC 1XSDA 3WGGA 4ZZDA 1EH7A 2IPQX 2ZJ2A 2DBBA 4BHCA 3EUHA 2O8XA 4L5IA 3JW4A 4Q47A 1AWCA 1KU3A 5ILVA 3F8CA 4LGWA 1USTA 1SD4A 2O61A 2H6BA 3VODA 3KEQA 3HRUA 3HYIA 2G7HA 1H9TA 3QRFF 2STWA 4CHUA 1P4AA 2LKPA 3FF5A 1FP1D 4KYWA 1ODDA 3M7GA 1R22A 5K5QA 4AIJA 3KETA 1J9IA 1PUEE 1QO0D 2VC0A 5LGUA 2OQGA 3GWZA 3ZN0A 1HKTA 2EFWA 1ZG3A 2DTRA 3C1DA 4TV7A 3WTYC 4RGXA 4EGZA 2DPUA 1J2XA 2KJBA 1GVJA 3JAMK 3B02A 3LQQA 5D5XB 3QPHA 1FYKA 2BGCA 1S29A 3ABUA 4IJAA 3GO5A 1K78A 5E1XA 1XMAA 2L02A 4NB5A 5EEGA 2L54A 3MQ0A 2STTA 5BQTA 1KQ0A 1FT9A 3O6BB 3J81K 4LB6B 3IHUA 2ZBKA 1WWXA 3I4PA 2FMLA 4CGZA 3QOPA 1ZGAA 3R0AA 4U7BA 1IN6A 3D0SA 2H94A 4LMYA 5JHUA 1FSHA 5J6XA 3KEOA 4BHPA 4U0YA 2P8TA 2GA2A 1MGTA 5F1RA 3U9GA 2QQBA 4AVPA 4M74A 1Z6TA 3HHHA 5JFRA 1BJAA 4WCGA 2P6TA 4JBAA 4MHGA 4G9YA 5CYVA 3RYPA 2HFHA 4GCVA 1K7AA 2O0YA 3U1DA 5FB2A 1KGSA 5E18F 2LSOA 3TOBA 5FGMA 3MEXA 4LLNA 2WTEA 3NEUA 2HTSA 4RAZA 1YO5C 3E3VA 5DDGA 4NHJA 2P6SA 5FLXK 2EB7A 2D2WA 3I58A 3RIRA 1O3RA 2EFNA 2FSWA 1O3TA 1W4MA 2HQRA 2ZNYA 2R7FA 5HDNA 3K2ZA 2QM3A 3KP2A 5CLSA 3WE3A 1XB4A 3SZTA 3F23A 3KP6A 1SD5A 3RI4A 2P7CB 2ZFWA 4XLNF 3ZP5A 4L18B 3WTUC 3ZMSA 3DFGA 2P5VA 4WXCA 5DD4A 1R23A 4P9FA 1HW2A 4XSZF 4I09A 1WI9A 3KFWX 1XGSA 4KICA 3RYRA 4HF0A 1YYVA 1O7FA 2NNNA 3ECOA 4ZYHA 1DUXC 3WTZA 2CGPA 4HV5A 4Q5SF 1WQ2A 1ZH5A 4MEXF 5E17F 3M9AA 2RN7A 2LNBA 4ZYGA 4RB0A 4JK1X 3MFKA 4BH9A 1MJBA 1P4WA 4LFUA 4UVBA 3FZVA 2DO7A 4WX9A 1T39A 1T38A 4P96A 4OMZA 2P7VB 2VOPA 5HOOA 1YW9A 4G94A 5H6QA 3L00A 1YTYA 3J80K 2WC2A 1B9MA 4BXUA 3TO7A 3DV8A 2EA4A 4WF2A 3QP6A 2ISZA 2ZMEB 4R1HA 5E1WA 3T0YA 2VOOA 1YS7A 2G9WA 4HDUA 5DCMB 4WWCA 4AD9A 1TTYA 3CTAA 1LVAA 2K4BA 4MQ9F 1R5HA 5HLHA 4OIQF 3HOSA 1YS6A 4IPAA 6PAXA 4Q4ZF 2DQRA 1U6GA 3IRRA 2ZNZA 2VC1A 4KNYA 2XAJA 3CO7C 1HKQA 3R0JA 4KMUX 3KZZA 2Y48A 3K9TA 2PLYA 1PP7U 5TJJA 2JRTA 1QBJA 3F8NA 1FP2A 2GA1A 3F6OA 2ADUA 3SHFA 1I5ZA 4A0ZA 4BAYA 4LJZF 4L5JA 4PDKA 3TO6A 3REOA 1ZARA 3O2PE 1P92A 3LWFA 2NAZA 1LQ1A 3WTTC 5D4RA 1YW8A 1ZHFA 2HKOA 1DPRA 5HDKA 1UHWA 5AONA 3K0LA 3JAMZ 2CQKA 5D6EA 1QZYA 3R4KA 3W6KB 1J5YA 5BPIA 2H6CA 4G7HF 1I1GA 3QU6A 3O3KA 1S8NA 1U5TC 4B09A 1B6AA 1ZLJA 4RAYA 1LDDA 3LFKA 1FPQA 2GAUA 3KE2A 4G6DA 2MBFA 4BQAA 3FXRA 3JSPA 3J81Z 4IHTA 3PQKA 1VTNC 2XGXA 4G7ZF 1IXSB 1BC7C 4XBFA 1FOKA 1J59A 1P4XA 2OZ6A 1D3YA 3GF2A 1BI2A 2XAGA 5FO5A 2FBKA 1FC3A 4PGHA 2XKPA 2V79A 2KJCA 2RC4A 2XUBA 5D5UB 4A12A 1LDKB 1UCRA 3RJPA 4JQFA 3HRMA 1Z1DA 4M6YA 1AOYA 2QLZA 1BC8C 3G73A 5LRSA 4FT8A 1YW7A 1JXSA 4N9HA 3T5XA 3V7SA 1WKMA 1L0OC 2ZMEA 4U88A 1MZBA 2WWYA 1ZRFA 1IN8A 1IRFA 2Z99A 2PBIA 2EFPA 2HQNA 1RNLA 5DCMA 3VEPA 4ZYDA 3K69A 1FBSA 1Y0UA 4KMFA 3P9CA 4KN4X 3G3ZA 2ISYA 3GXOA 5DEQA 2FMYA 2AXLA 2BV6A 5FLXZ 1KU7A 5HDGA 2O03A 3E6CC 3P9KA 4XSXF 5HLIA 4AIHA 1TQPA 3E5XA 3ZPLA 1BI3A 5FD5A 4H0EA 2MLKA 5CVUA 1QPMA 2H27A 2JZYA 4YG2F 2KRFA 3FMQA 2L3DA 2E7WA 1Z7UA 3T8RA 3V8JA 2EWNA 3HRSA 2F5EA 3V7RA 1FX7A 1U78A 4LLGF 2GWRA 2E1CA 3LAPA 4EJTA 3IKVA 3DKWA 3P7NA 1S7OA 5FFZA 1QZZA 3CLOA 1LEAA 1G3SA 4B8XA 1IN4A 5ERIA 2C6YA 3ZMZA 5D5WB 3FXQA 2IA2A 5ICGA 4ZH4F 2W24A 5LEKA 3GFLA 2IA1A 1SFEA 4HQMA 1YQAA 4NQWA 2XAHA 4XLPF 1MDMB 3GX4X 3EYYA 3V7CA 3RDIA 4CO8A 1I27A 1PP8F 4ENKA 2CG4A 4R79A 3J80Z 3E97A 1MJAA 3FX3A 1JE8A 4HX8A 3W6JB 4ETSA 1XCVA 1CGPA 3BPXA 3BOQA 2A07F 2GXBA 3ZMUA 5E20A 3DPTA 2JT1A 3DXJF 2F5DA 3LSTA 3E6BA 3FMRA 5IT9K 3ZMVA 1HSTA 3NQOA 3I71A 3TDZC 4YIIA 2QQ9A 3LQRA 1R5GA 5LGNA 2MA3A 1BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RZ4 A;  1G3Y A;  2XAQ A;  2OZU A;  3FM5 A;  3E6D A;  1R58 A;  3TDU C;  3KP3 A;  4RGS A;  4EQQ A;  3ZQ7 A;  3DP7 A;  3N97 A;  3I0T A;  2VOD A;  3HRT A;  5DUK A;  5HS9 A;  4LD5 A;  4IF4 A;  1JGS A;  2DU9 A;  5CJ9 A;  2DPD A;  3HOT A;  5DD8 A;  5KVR A;  2FNA A;  3EDP A;  1XSV A;  4HDV A;  3T1B A;  2D1V A;  2G7U A;  1MD0 A;  1XGN A;  3SFZ A;  3BDD A;  5A2Q K;  2BBY A;  3LAJ A;  4ESJ A;  1TBX A;  2E7X A;  2MC3 A;  5K5O A;  3CUQ B;  3I54 A;  1QQI A;  1HW5 A;  2ESH A;  3TOA A;  2M87 A;  2UXX A;  2VBX A;  1UHM A;  4Q48 A;  3VB2 A;  1R7J A;  4MTD A;  4ENN A;  1KYZ A;  2OAZ A;  4A2U A;  1KQ9 A;  1O7L A;  1SD7 A;  1IXC A;  2Z3Y A;  1T2K A;  4A0X A;  3WE2 A;  1OYY A;  3COA C;  3V8K A;  5CVV A;  2QVO A;  3SQN A;  1J7K A;  4O3M A;  1HKS A;  2CWE A;  4EV0 A;  4PGG A;  2LF8 A;  3MCZ A;  4Y13 A;  3I59 B;  2RQP A;  5F64 A;  4S04 A;  3F21 A;  3J7A O;  3ROU A;  4MTE A;  1MDM A;  1K6O A;  1TW2 A;  4E70 A;  1XMK A;  4EVI A;  4YFK F;  2NNY A;  4PZJ A;  4KIG A;  1P2F A;  5BOX A;  5L3G A;  2YSR A;  2XRO A;  1O3S A;  2Q2E A;  2PFB A;  2WV0 A;  4WXD A;  1ZN2 A;  1V4R A;  2RVC A;  1J0R A;  4OOI A;  1FLI A;  5LHH A;  3S2W A;  4A5M A;  3F72 A;  2ZKZ A;  1LEB A;  1FSE A;  4ENJ A;  2ACJ A;  1LJ9 A;  2DQL A;  4WK8 F;  3MZH A;  4IRH A;  5K5R A;  2BEO A;  4HBL A;  2NRA C;  2CYY A;  1RUN A;  4DNC A;  2CO5 A;  2DK5 A;  3SZP A;  2KKO A;  2HWV A;  5J8F A;  4I0B A;  1OPC A;  4L0Y B;  5FFX A;  1I1S A;  3BJ6 A;  2ZXJ A;  4Y15 A;  4LLL A;  2JPC A;  1Z6R A;  2HKX A;  4EMS A;  2UZK A;  1U3E M;  1JHH A;  3ISP A;  4BHB A;  1SAX A;  3HSR A;  3KZY A;  1S7A A;  2R7D A;  2A69 F;  2DT5 A;  2PJP A;  3WGI A;  5ICE A;  4KA4 A;  4ESF A;  4M9Z A;  4KFC A;  1IN7 A;  3KLO A;  3CUO A;  3QAH A;  2XAS A;  1YFH A;  2RV8 A;  2W85 A;  5LLQ A;  2PMU A;  3CUQ A;  2FRH A;  1W5T A;  5HS8 A;  2KIM A;  5FD6 A;  2EK5 A;  2XKO A;  4P5O A;  1ZRC A;  5DV5 A;  3GVA A;  2Q0O A;  2IP2 A;  1BN5 A;  2MLG A;  1XGO A;  4BNC A;  1R1T A;  1O3Q A;  4YFN F;  2Z5U A;  5HVQ C;  2FNP A;  1KQ8 A;  3EQL F;  3OV8 A;  1QGP A;  1HQC A;  5IT3 A;  4PCQ A;  4OIR F;  1FZP B;  1R1V A;  1JHF A;  2J5O A;  3WTS C;  2QQA A;  5LGT A;  2FF4 A;  1XD7 A;  4EJU A;  3KP7 A;  3I59 A;  3Q9V A;  4FX4 A;  3VOE A;  2FOK A;  3FXU A;  3GFI A;  3CO6 C;  2IA0 A;  5E1Z B;  3ECH A;  2JSC A;  3BWG A;  3RPQ A;  4LB5 A;  1ON2 A;  2RKH A;  1B59 A;  1OKR A;  5IT9 Z;  2HYG D;  4RB2 C;  5CVJ A;  3GZ5 A;  4HOB A;  4L0Z B;  3WTX C;  2HEO A;  5DCF A;  2YU3 A;  3D5L A;  2KIF A;  2CSO A;  2ZO4 A;  2LDU A;  1TQI A;  3WTW C;  1T6S A;  3LA7 A;  3E5U A;  4GGG A;  4M6X A;  1Z91 A;  2X4H A;  2FA5 A;  2QBY B;  3I5U A;  4OIP F;  4L9J A;  4UNO A;  3TO9 A;  4U0V A;  2HR3 A;  2V9V A;  2HDC A;  3KP4 A;  1WSU A;  4ZYE A;  4HX7 A;  4RGU A;  1F4K A;  4KIF A;  2W25 A;  2VBZ A;  2VXZ A;  3E5Q A;  1A04 A;  5BMZ A;  4KDP A;  2PEX A;  4M72 A;  1W7P D;  4LK1 F;  2BE5 F;  2JTV A;  5D6F A;  3OOP A;  3HTS B;  1SFU A;  4I01 A;  5H6R A;  1OYW A;  3JTG A;  2HYF A;  4UVC A;  5A2Q Z;  3JSO A;  1G4D A;  4UVA A;  3LA2 A;  3F8M A;  2XAF A;  2Y75 A;  2ETH A;  3BPV A;  3BP8 A;  1S6L A;  2QEN A;  3FWE A;  1MKM A;  4UUV A;  4UV8 A;  2K4J A;  4U0W A;  5E8I A;  3ERE D;  5CVI A;  3GYH X;  3H92 A;  1ZG1 A;  1KU2 A;  2PN6 A;  2D1H A;  3L9F A;  3TGN A;  2FE3 A;  3WG9 A;  1BM9 A;  2P4W A;  4EGY A;  5L3D A;  2PI0 A;  1Z9C A;  4OIO F;  1D5V A;  3TKY A;  2Q8K A;  2P5K A;  3DQV C;  1BBY A;  2VT2 A;  3AAF A;  1F5T A;  1IF1 A;  4D0P A;  2XIG A;  1IUY A;  1S3J A;  2FU4 A;  4HW0 A;  5D8L B;  3GEZ A;  4RB1 A;  1IN5 A;  1FY7 A;  5KK1 A;  2OA4 A;  1DDN A;  4AWX B;  2AS5 F;  2RGV A;  1XGM A;  2VN2 A;  1YG2 A;  1HBX G;  4UXN A;  2CW0 F;  2R3S A;  4EJV A;  3FMS A;  3NRV A;  4HV6 A;  2RNJ A;  3CJN A;  2K27 A;  4HA8 A;  2Z9O A;  3RKX A;  3ZMT A;  2XRN A;  1U5T B;  1Q1H A;  3F22 A;  3GW2 A;  4ZZL A;  1OYI A;  3IL2 A;  1QNT A;  4HF2 A;  2M45 A;  4LG0 B;  4I2O A;  1R36 A;  4BYY A;  1O57 A;  2YX7 A;  1F9N A;  4KUM A;  4I98 B;  5BPD A;  5LHG A;  1ZG5 A;  3WOD F;  2PQ8 A;  2EV5 A;  1EH6 A;  2Z33 A;  2QBY A;  1ZRE A;  5JVT A;  3U2R A;  5F6F A;  2K7L A;  4RS8 A;  4N9I A;  2ZCW A;  4ENM A;  2PMH A;  2HS5 A;  2M5W A;  4OU0 A;  1XN7 A;  4GYI A;  1PDN C;  3ULQ B;  4P9U A;  1H9G A;  1TQM A;  4I7H A;  5CVR A;  5AIQ A;  3HSE A;  1YLF A;  1SD6 A;  2X0L A;  2A6E F;  2IJL A;  3MAJ A;  4OMY A;  4MGR A;  1ON1 A;  4N0B A;  3PQJ A;  5BS6 A;  2XVC A;  2GQQ A;  3GFJ A;  4EJW A;  2F2E A;  1KU9 A;  2DFI A;  2VBW A;  2L4M A;  3IRQ A;  1BIB A;  2W84 A;  2DAO A;  2A6H F;  2FQ3 A;  5ICF A;  3RKY A;  4L9T A;  3QU3 A;  2K86 A;  1ONV A;  1RI7 A;  3R61 A;  5ILS A;  2A3S A;  3F8F A;  1TW3 A;  1GXP A;  4I0A A;  2V1X A;  3ABT A;  1U8R A;  3Q9S A;  1G3W A;  3EYI A;  1IRG A;  3K1M A;  1XDS A;  2VBY A;  2M30 A;  2XV4 S;  3M1E A;  1SMT A;  1E2X A;  2VON A;  5L3F A;  3R6S A;  1HSJ A;  2O3F A;  1LB2 A;  1LDJ A;  1TNS A;  4FX0 A;  5HLG A;  2A68 F;  3H3Z A;  4KT5 C;  4K2E A;  2GZW A;  1W5S A;  5JR3 A;  3I64 A;  3QPT A;  4ON0 A;  3WTV C;  2QYO A;  2PG4 A;  4G7O F;  2OD5 A;  4MNU A;  5DYM A;  3GLX A;  4P55 A;  3PFI A;  1K79 A;  4G6Q A;  3TQN A;  1U5T A;  4AIK A;  3IKT A;  1ZAO A;  3P9I A;  4M9S A;  1GHC A;  2MD5 A;  2CFX A;  3N4M A;  5LBQ A;  3L7W A;  1DP7 P;  1ZYR F;  5LRR A;  5ICC A;  1E17 A;  3BY6 A;  3F3X A;  1REP C;  1R1U A;  1USS A;  1TLH B;  4LG0 A;  3RTR A;  1FBQ A;  1BI1 A;  2J5P A;  3HSF A;  1T98 A;  3T8T A;  4HQE A;  4IRI A;  1F1Z A;  4R8H A;  4QLC U;  1ZGJ A;  2W57 A;  2A5Y B;  5L3C A;  4YFX F;  1RUO A;  5TRD A;  4I02 A;  1OMI A;  4HZF A;  4CZZ A;  3C3W A;  1SMY F;  2V1U A;  4HAM A;  3CDH A;  1R00 A;  3DEU A;  3GZ6 A;  4A5N A;  1EH8 A;  1ULY A;  2ESN A;  1D8K A;  3E6M A;  4F7Z A;  5LEJ A;  2FEZ A;  3IC7 A;  3SXY A;  3WU1 B;  2OBP A;  1IZ1 A;  1DPU A;  1FYM A;  3R60 A;  2EFQ A;  1KA8 A;  2EJR A;  3B73 A;  4EJO A;  2HTJ A;  4M71 A;  3V4G A;  3HTU A;  2LF7 A;  1NHA A;  3ML6 A;  1CF7 B;  5D8K B;  3F6V A;  3BJA A;  1B4A A;  5H20 A;  4HLY A;  2V1D A;  2A61 A;  2VE8 A;  2DLL A;  3F8B A;  3BJO A;  2JPB A;  4FHT A;  2VE9 A;  2IVM A;  2Y0M A;  5D5V B;  3RPU A;  1ZLK A;  4HX4 A;  2IW5 A;  4IHS A;  1IW7 F;  2GXG A;  2O6G E;  3C7J A;  1X3U A;  3HIF A;  2FBH A;  4UHT A;  2QZ8 A;  4A6E A;  3QP5 A;  3M8F A;  2P5L C;  1GXQ A;  4EM1 A;  4CXF A;  1I6X A;  3HHG A;  2F5C A;  2M8E A;  3DPL C;  2GIV A;  2EA2 A;  2D45 A;  4G8X A;  4GYG A;  1B1B A;  3K1N A;  2E1N A;  2YPR A;  3FM3 A;  3WU0 A;  2DI3 A;  5K1Y A;  2VT3 A;  4HYE A;  1IXR C;  3H3U A;  3KLN A;  4O6J A;  4RGR A;  4HLX A;  4KIB A;  1FNN A;  1IAW A;  2OQR A;  3WGH A;  1D8J A;  4IVN A;  5JI6 A;  2DW4 A;  5HS7 A;  4QWQ A;  5LHI A;  2EV6 A;  4ASN A;  1C0W A;  1YIO A;  5E8G A;  3LA3 A;  2ELH A;  2YR2 A;  3ZMD A;  3VFZ A;  1OR7 A;  1WRJ A;  3MWM A;  2KIU A;  4RB3 C;  1U2W A;  3M8E A;  1FWZ A;  1W7P B;  3MZY A;  2NYX A;  1BIA A;  1G3T A;  1FYL A;  2L01 A;  5DUI A;  2YX4 A;  4EM0 B;  1SFX A;  2EFO A;  3HUG A;  4A0Y A;  3K1P A;  4IRG A;  4IXA A;  1ZRD A;  2NS0 A;  5J8C A;  3Q5F A;  2FBI A;  4GO1 A;  2K02 A;  2UWM A;  4LK0 F;  1MJ9 A;  2EV0 A;  1CF7 A;  5ED4 A;  4CDG A;  1XSX A;  4EM2 A;  1H0M A;  5L3E A;  2FXA A;  3FHZ A;  4Z2Y A;  1EV7 A;  2COM A;  1HW1 A;  3GFM A;  2TDX A;  4M9X A;  1V3F A;  2V6C A;  1XDU A;  3V8L A;  2B0L A;  4OIN F;  3C18 A;  1T0F A;  3KCC A;  2QWW A;  1FBU A;  2BYV E;  3IWF A;  3I53 A;  4KN7 X;  4L9V A;  2L4A A;  4L9N A;  2UXN A;  2HOE A;  2XHK A;  2IRF G;  5AIP A;  4XRF A;  2RDP A;  4CIC A;  1XCB A;  3ZN1 A;  2OU2 A;  2MH9 A;  1K78 B;  4DQ2 A;  3L09 A;  3KP5 A;  4ESB A;  1UB9 A;  5EEH A;  4GXO A;  1L3L A;  4CYD A;  4Y17 A;  4A6D A;  2QUF A;  2DK8 A;  4HF1 A;  5D4S A;  4YIF A;  4UV9 A;  4MQV A;  3RKW A;  3JTH A;  4O5V A;  3EET A;  3IWZ A;  5ILU A;  1J75 A;  2F5F A;  2HZT A;  3GUD A;  3DF8 A;  4U7D A;  1G6N A;  1KYW A;  3L2C A;  1UFM A;  2MH2 A;  1STZ A;  1HXD A;  2H09 A;  2IT0 A;  3ELK A;  1BOA A;  1Z05 A;  3BRO A;  3BZ6 A;  4WXH A;  1W7P A;  4S05 A;  2HGC A;  5L3B A;  4M73 A;  1LNW A;  2M1B A;  1P6R A;  1RIO H;  4MEY F;  1B9N A;  1TNT A;  3CUQ C;  1XSD A;  3WGG A;  4ZZD A;  1EH7 A;  2IPQ X;  2ZJ2 A;  2DBB A;  4BHC A;  3EUH A;  2O8X A;  4L5I A;  3JW4 A;  4Q47 A;  1AWC A;  1KU3 A;  5ILV A;  3F8C A;  4LGW A;  1UST A;  1SD4 A;  2O61 A;  2H6B A;  3VOD A;  3KEQ A;  3HRU A;  3HYI A;  2G7H A;  1H9T A;  3QRF F;  2STW A;  4CHU A;  1P4A A;  2LKP A;  3FF5 A;  1FP1 D;  4KYW A;  1ODD A;  3M7G A;  1R22 A;  5K5Q A;  4AIJ A;  3KET A;  1J9I A;  1PUE E;  1QO0 D;  2VC0 A;  5LGU A;  2OQG A;  3GWZ A;  3ZN0 A;  1HKT A;  2EFW A;  1ZG3 A;  2DTR A;  3C1D A;  4TV7 A;  3WTY C;  4RGX A;  4EGZ A;  2DPU A;  1J2X A;  2KJB A;  1GVJ A;  3JAM K;  3B02 A;  3LQQ A;  5D5X B;  3QPH A;  1FYK A;  2BGC A;  1S29 A;  3ABU A;  4IJA A;  3GO5 A;  1K78 A;  5E1X A;  1XMA A;  2L02 A;  4NB5 A;  5EEG A;  2L54 A;  3MQ0 A;  2STT A;  5BQT A;  1KQ0 A;  1FT9 A;  3O6B B;  3J81 K;  4LB6 B;  3IHU A;  2ZBK A;  1WWX A;  3I4P A;  2FML A;  4CGZ A;  3QOP A;  1ZGA A;  3R0A A;  4U7B A;  1IN6 A;  3D0S A;  2H94 A;  4LMY A;  5JHU A;  1FSH A;  5J6X A;  3KEO A;  4BHP A;  4U0Y A;  2P8T A;  2GA2 A;  1MGT A;  5F1R A;  3U9G A;  2QQB A;  4AVP A;  4M74 A;  1Z6T A;  3HHH A;  5JFR A;  1BJA A;  4WCG A;  2P6T A;  4JBA A;  4MHG A;  4G9Y A;  5CYV A;  3RYP A;  2HFH A;  4GCV A;  1K7A A;  2O0Y A;  3U1D A;  5FB2 A;  1KGS A;  5E18 F;  2LSO A;  3TOB A;  5FGM A;  3MEX A;  4LLN A;  2WTE A;  3NEU A;  2HTS A;  4RAZ A;  1YO5 C;  3E3V A;  5DDG A;  4NHJ A;  2P6S A;  5FLX K;  2EB7 A;  2D2W A;  3I58 A;  3RIR A;  1O3R A;  2EFN A;  2FSW A;  1O3T A;  1W4M A;  2HQR A;  2ZNY A;  2R7F A;  5HDN A;  3K2Z A;  2QM3 A;  3KP2 A;  5CLS A;  3WE3 A;  1XB4 A;  3SZT A;  3F23 A;  3KP6 A;  1SD5 A;  3RI4 A;  2P7C B;  2ZFW A;  4XLN F;  3ZP5 A;  4L18 B;  3WTU C;  3ZMS A;  3DFG A;  2P5V A;  4WXC A;  5DD4 A;  1R23 A;  4P9F A;  1HW2 A;  4XSZ F;  4I09 A;  1WI9 A;  3KFW X;  1XGS A;  4KIC A;  3RYR A;  4HF0 A;  1YYV A;  1O7F A;  2NNN A;  3ECO A;  4ZYH A;  1DUX C;  3WTZ A;  2CGP A;  4HV5 A;  4Q5S F;  1WQ2 A;  1ZH5 A;  4MEX F;  5E17 F;  3M9A A;  2RN7 A;  2LNB A;  4ZYG A;  4RB0 A;  4JK1 X;  3MFK A;  4BH9 A;  1MJB A;  1P4W A;  4LFU A;  4UVB A;  3FZV A;  2DO7 A;  4WX9 A;  1T39 A;  1T38 A;  4P96 A;  4OMZ A;  2P7V B;  2VOP A;  5HOO A;  1YW9 A;  4G94 A;  5H6Q A;  3L00 A;  1YTY A;  3J80 K;  2WC2 A;  1B9M A;  4BXU A;  3TO7 A;  3DV8 A;  2EA4 A;  4WF2 A;  3QP6 A;  2ISZ A;  2ZME B;  4R1H A;  5E1W A;  3T0Y A;  2VOO A;  1YS7 A;  2G9W A;  4HDU A;  5DCM B;  4WWC A;  4AD9 A;  1TTY A;  3CTA A;  1LVA A;  2K4B A;  4MQ9 F;  1R5H A;  5HLH A;  4OIQ F;  3HOS A;  1YS6 A;  4IPA A;  6PAX A;  4Q4Z F;  2DQR A;  1U6G A;  3IRR A;  2ZNZ A;  2VC1 A;  4KNY A;  2XAJ A;  3CO7 C;  1HKQ A;  3R0J A;  4KMU X;  3KZZ A;  2Y48 A;  3K9T A;  2PLY A;  1PP7 U;  5TJJ A;  2JRT A;  1QBJ A;  3F8N A;  1FP2 A;  2GA1 A;  3F6O A;  2ADU A;  3SHF A;  1I5Z A;  4A0Z A;  4BAY A;  4LJZ F;  4L5J A;  4PDK A;  3TO6 A;  3REO A;  1ZAR A;  3O2P E;  1P92 A;  3LWF A;  2NAZ A;  1LQ1 A;  3WTT C;  5D4R A;  1YW8 A;  1ZHF A;  2HKO A;  1DPR A;  5HDK A;  1UHW A;  5AON A;  3K0L A;  3JAM Z;  2CQK A;  5D6E A;  1QZY A;  3R4K A;  3W6K B;  1J5Y A;  5BPI A;  2H6C A;  4G7H F;  1I1G A;  3QU6 A;  3O3K A;  1S8N A;  1U5T C;  4B09 A;  1B6A A;  1ZLJ A;  4RAY A;  1LDD A;  3LFK A;  1FPQ A;  2GAU A;  3KE2 A;  4G6D A;  2MBF A;  4BQA A;  3FXR A;  3JSP A;  3J81 Z;  4IHT A;  3PQK A;  1VTN C;  2XGX A;  4G7Z F;  1IXS B;  1BC7 C;  4XBF A;  1FOK A;  1J59 A;  1P4X A;  2OZ6 A;  1D3Y A;  3GF2 A;  1BI2 A;  2XAG A;  5FO5 A;  2FBK A;  1FC3 A;  4PGH A;  2XKP A;  2V79 A;  2KJC A;  2RC4 A;  2XUB A;  5D5U B;  4A12 A;  1LDK B;  1UCR A;  3RJP A;  4JQF A;  3HRM A;  1Z1D A;  4M6Y A;  1AOY A;  2QLZ A;  1BC8 C;  3G73 A;  5LRS A;  4FT8 A;  1YW7 A;  1JXS A;  4N9H A;  3T5X A;  3V7S A;  1WKM A;  1L0O C;  2ZME A;  4U88 A;  1MZB A;  2WWY A;  1ZRF A;  1IN8 A;  1IRF A;  2Z99 A;  2PBI A;  2EFP A;  2HQN A;  1RNL A;  5DCM A;  3VEP A;  4ZYD A;  3K69 A;  1FBS A;  1Y0U A;  4KMF A;  3P9C A;  4KN4 X;  3G3Z A;  2ISY A;  3GXO A;  5DEQ A;  2FMY A;  2AXL A;  2BV6 A;  5FLX Z;  1KU7 A;  5HDG A;  2O03 A;  3E6C C;  3P9K A;  4XSX F;  5HLI A;  4AIH A;  1TQP A;  3E5X A;  3ZPL A;  1BI3 A;  5FD5 A;  4H0E A;  2MLK A;  5CVU A;  1QPM A;  2H27 A;  2JZY A;  4YG2 F;  2KRF A;  3FMQ A;  2L3D A;  2E7W A;  1Z7U A;  3T8R A;  3V8J A;  2EWN A;  3HRS A;  2F5E A;  3V7R A;  1FX7 A;  1U78 A;  4LLG F;  2GWR A;  2E1C A;  3LAP A;  4EJT A;  3IKV A;  3DKW A;  3P7N A;  1S7O A;  5FFZ A;  1QZZ A;  3CLO A;  1LEA A;  1G3S A;  4B8X A;  1IN4 A;  5ERI A;  2C6Y A;  3ZMZ A;  5D5W B;  3FXQ A;  2IA2 A;  5ICG A;  4ZH4 F;  2W24 A;  5LEK A;  3GFL A;  2IA1 A;  1SFE A;  4HQM A;  1YQA A;  4NQW A;  2XAH A;  4XLP F;  1MDM B;  3GX4 X;  3EYY A;  3V7C A;  3RDI A;  4CO8 A;  1I27 A;  1PP8 F;  4ENK A;  2CG4 A;  4R79 A;  3J80 Z;  3E97 A;  1MJA A;  3FX3 A;  1JE8 A;  4HX8 A;  3W6J B;  4ETS A;  1XCV A;  1CGP A;  3BPX A;  3BOQ A;  2A07 F;  2GXB A;  3ZMU A;  5E20 A;  3DPT A;  2JT1 A;  3DXJ F;  2F5D A;  3LST A;  3E6B A;  3FMR A;  5IT9 K;  3ZMV A;  1HST A;  3NQO A;  3I71 A;  3TDZ C;  4YII A;  2QQ9 A;  3LQR A;  1R5G A;  5LGN A;  2MA3 A;  1BI0 A; 
#chains in the Genus database with same CATH topology
 1RZ4 A;  1G3Y A;  2XAQ A;  2CV1 A;  4PSW A;  2WY7 Q;  2OZU A;  3FM5 A;  2E19 A;  4B3X A;  3LNQ A;  1BR1 A;  3E6D A;  5HNF A;  3A03 A;  3K2A A;  3V42 A;  1R58 A;  3TDU C;  3KP3 A;  4U87 A;  4RGS A;  5K7F A;  4XKB A;  4EQQ A;  2QA4 I;  1TT5 B;  1TZL A;  2K85 A;  3K4M A;  1SVO A;  3ZQ7 A;  2VKD A;  3DP7 A;  3N97 A;  3I0T A;  2VOD A;  3HRT A;  5DUK A;  3L2V A;  5HS9 A;  4LD5 A;  3DTK A;  3HPG A;  3OS1 A;  4IF4 A;  1JGS A;  2AO9 A;  2DDA A;  4V2G A;  2DU9 A;  1UMQ A;  5CJ9 A;  1V5E A;  2DPD A;  3HOT A;  3I4M J;  5DD8 A;  5KVR A;  5H2F C;  1RR8 C;  2FNA A;  1ERD A;  3EDP A;  1XSV A;  4HDV A;  1YE9 A;  3T1B A;  1S9H A;  4W1U A;  2D1V A;  2F4M B;  2G7U A;  4BU2 A;  1MD0 A;  1GUU A;  1XGN A;  2KPM A;  3SFZ A;  3BDD A;  4DZJ A;  1T33 A;  5CKT A;  1T0F C;  2JUG A;  4AVZ A;  3VSL A;  2X1D A;  3FBI B;  5A2Q K;  2BBY A;  3LAJ A;  2GIZ A;  4ESJ A;  2OPT A;  3W2W A;  1M1E B;  1TBX A;  4I76 A;  2E7X A;  2MC3 A;  1KZH A;  1E0E A;  1MBF A;  5K5O A;  3CUQ B;  3S1R J;  2ID3 A;  3I54 A;  2MC4 A;  1QQI A;  1RRJ A;  3GTP J;  4A93 J;  1HW5 A;  2LD5 A;  2ESH A;  3LSP A;  2ECB A;  3TOA A;  2M87 A;  2UXX A;  2VBX A;  3AKZ A;  1UHM A;  4Q48 A;  3VB2 A;  1R7J A;  2IS4 A;  2KFD A;  4MTD A;  4ENN A;  1KYZ A;  2OAZ A;  1YJN I;  2NVQ J;  2W7N A;  1MMG A;  4A2U A;  1KQ9 A;  1O7L A;  4P1W A;  1APL C;  1SD7 A;  1IXC A;  2Z3Y A;  1T2K A;  4A0X A;  3WE2 A;  1VQ5 I;  1OYY A;  3COA C;  4BEH B;  4Y4R A;  2WV1 A;  3V8K A;  3HG9 A;  3RPU D;  5CVV A;  2LKS A;  2QVO A;  5FKM A;  5EF6 A;  2X48 A;  3RKQ A;  3SQN A;  2XPW A;  1J7K A;  3A1Y A;  3OS0 A;  1HKS A;  2JA2 A;  3HJE A;  2CWE A;  4O3M A;  4EV0 A;  4PGG A;  4OWR B;  2LF8 A;  3MCZ A;  3SDG A;  4MFE A;  4XID A;  4Y13 A;  4LIU A;  3I59 B;  2RQP A;  5F64 A;  4S04 A;  3F21 A;  3J7A O;  1PUF A;  2Y30 A;  1FOW A;  3ROU A;  4C2U A;  3F0C A;  4MTE A;  1MDM A;  2H1L A;  2ME0 A;  1K6O A;  1TW2 A;  3NWS A;  4E70 A;  1XMK A;  2K9L A;  3CDL A;  4EVI A;  1Y6I A;  4YFK F;  2NNY A;  4PZJ A;  4M3B A;  4KIG A;  1PYV A;  1P2F A;  4LOC A;  5BOX A;  3JRH A;  3IV5 A;  1PVE A;  5L3G A;  1LE8 A;  2YSR A;  2XRO A;  2MSY A;  1O3S A;  2Q2E A;  4DYC A;  2DMP A;  2E2J J;  2PFB A;  3OYA A;  1LFP A;  2I5U A;  1QVT A;  2WV0 A;  4WXD A;  2B7E A;  3H5R A;  2XRL A;  2EPF A;  2VL8 A;  4F91 B;  4A3F J;  1ZN2 A;  1V4R A;  2RVC A;  2Z16 A;  5IOZ A;  1J0R A;  2DFH A;  3OR2 C;  4OOI A;  1N78 A;  5LHH A;  1FLI A;  3S2W A;  2VI6 A;  4A5M A;  3SEZ A;  3F72 A;  2IBD A;  3OIP A;  2XF7 A;  2ZKZ A;  3ZQC A;  3S32 A;  1ZR2 A;  4BE0 A;  1LEB A;  2BXY A;  1TWH J;  2E36 A;  1W1W E;  2EIL H;  3OR1 C;  4QPO A;  4FE4 A;  1FSE A;  1D0Y A;  1WPK A;  4ENJ A;  2ACJ A;  1LJ9 A;  2DQL A;  1I3A A;  3EUK L;  3J7Z I;  4WK8 F;  2DCE A;  3M4O J;  2R5Z B;  3MZH A;  2KRC A;  2BW3 A;  3S3O A;  4JX4 A;  1Y8R B;  1FMW A;  3A0B C;  4IRH A;  5K5R A;  2NVT J;  1FTT A;  2BEO A;  2NVX J;  3ZQL A;  2LK2 A;  4HBL A;  2NRA C;  2CYY A;  3B6A A;  2L7Z A;  1RUN A;  1YOV B;  1QHH D;  3IH3 A;  3DKX A;  3LSK A;  4DNC A;  1A6I A;  2CO5 A;  2CUZ A;  3EUH C;  2DK5 A;  5FKO A;  3SZP A;  1SEU A;  2KKO A;  2HWV A;  5J8F A;  2GLO A;  3N05 A;  2Y31 A;  1OPC A;  3PUF A;  2L0K A;  4I0B A;  5FFX A;  4L0Y B;  1BA5 A;  1I1S A;  1I50 J;  5J40 A;  2R5Y B;  3BJ6 A;  2ZXJ A;  4Y15 A;  4F55 A;  1RR7 A;  4C2T A;  2JA8 J;  2EIK H;  3FKI J;  4LLL A;  3PIO F;  2IXS A;  1Z6R A;  2JPC A;  2HKX A;  3CME I;  3DU5 A;  4EMS A;  3D1N I;  2UZK A;  1U3E M;  1JHH A;  3ISP A;  2DFE A;  3JR9 A;  2O9L A;  4BHB A;  1SAX A;  1LPQ A;  3H0D A;  3HSR A;  3KZY A;  1LFU P;  1S7A A;  2R7D A;  1XPX A;  3J7Y J;  1X19 A;  2DT7 B;  3K7A J;  4GRI A;  1IV8 A;  1O4X A;  1MNM C;  2WAQ A;  2A69 F;  2DT5 A;  2PJP A;  2HZD A;  3E7L A;  1FJL A;  4LIT A;  3K70 D;  4MIM A;  3WGI A;  1FOX A;  5ICE A;  4KA4 A;  4ESF A;  4M9Z A;  4HG2 A;  3ZRG A;  1TWA J;  4KFC A;  1IN7 A;  3KLO A;  3CUO A;  3CES A;  3QAH A;  2XAS A;  2KDZ A;  2X6W A;  1YFH A;  2PMZ A;  3HM5 A;  2RV8 A;  1N25 A;  2W85 A;  3K4C A;  5LLQ A;  2PMU A;  4A3I J;  3CUQ A;  2FRH A;  1W5T A;  5HS8 A;  1PJR A;  2KIM A;  5FD6 A;  2EK5 A;  2XKO A;  4P5O A;  2UUZ A;  1ZRC A;  5DV5 A;  3GVA A;  1VQ8 I;  3PNV A;  4C3H J;  2Q0O A;  1HOM A;  2IP2 A;  1BN5 A;  2MLG A;  1UAA A;  1XGO A;  3IAM 2;  3JRI A;  3H36 A;  4BNC A;  3DKY A;  1R1T A;  2Y9Z A;  1O3Q A;  4YFN F;  2Z5U A;  4A3L J;  5HVQ C;  3ABM H;  1YRN B;  2FNP A;  1KQ8 A;  3EQL F;  3LSM A;  4PJM A;  3OV8 A;  2HQ5 A;  4CCN A;  1QGP A;  2QSH X;  1HQC A;  3ZXS A;  4F93 B;  5IT3 A;  4PCQ A;  4OIR F;  1FZP B;  1R1V A;  2ICW G;  1JHF A;  2J5O A;  3WTS C;  1DP3 A;  2QQA A;  2VB6 A;  1IUF A;  5LGT A;  2FF4 A;  2RQQ A;  1VZ0 A;  1XD7 A;  4D7N A;  3C2G A;  4EJU A;  3KP7 A;  4BQQ A;  3I59 A;  2P81 A;  5KNL A;  1QA6 A;  5C4X J;  3Q9V A;  4FX4 A;  2IAI A;  3VOE A;  2FOK A;  3FXU A;  2RRE A;  3GFI A;  5FRM A;  3AG4 H;  3CO6 C;  3FIS A;  4E7J A;  4E4H A;  2IA0 A;  2L7M P;  5E1Z B;  2ZFU A;  1BOB A;  2KLO A;  4AC0 A;  3ECH A;  2JSC A;  1JUS A;  1R49 A;  2XAU A;  3BWG A;  1WJD A;  2KZV A;  4DBR A;  2BY2 A;  4CCM A;  3HC7 A;  4BJ6 C;  1WI3 A;  3RPQ A;  3ZQI A;  4LB5 A;  1ON2 A;  2RKH A;  3VSK A;  1B59 A;  1OKR A;  5IT9 Z;  2VKV A;  1WJC A;  3TED A;  4D9J A;  2HYG D;  3H9J A;  4EAT A;  4RB2 C;  4DZP A;  2L7F P;  2DFF A;  5CVJ A;  3ZQQ A;  2HNH A;  3GZ5 A;  1JKO C;  4HOB A;  4L0Z B;  3W3C A;  2CQ7 A;  3OYE A;  3WTX C;  4DYR A;  2HEO A;  5DCF A;  4B4C A;  2YU3 A;  3D5L A;  4YRV A;  4IOC F;  2KIF A;  4AM3 A;  2CSO A;  4QSH A;  2ZO4 A;  2LDU A;  2CFO A;  2M7A A;  1TQI A;  3PSI A;  2A6T A;  1T6S A;  4D5F A;  3WTW C;  3LA7 A;  3E5U A;  4GGG A;  4JP0 A;  4M6X A;  3S8P A;  1Z91 A;  5FJ8 J;  3M3Y J;  2X4H A;  2FA5 A;  2R5Z A;  2QBY B;  3I5U A;  4BXF A;  2NS8 A;  2VQC A;  4OIP F;  2QKM B;  4L9J A;  5KHD A;  1JT0 A;  4UNO A;  3TO9 A;  3VPR A;  4W97 A;  2AQE A;  2JRM A;  4U0V A;  5JLW A;  2HR3 A;  5EGO A;  1NK3 P;  4NBQ A;  2HPM A;  3QPS A;  2V9V A;  2HDC A;  2KT0 A;  3FBN B;  3KP4 A;  2OTL I;  2OCC H;  2R93 J;  1WSU A;  5HLT A;  4ZYE A;  2HVS A;  3H5A A;  3G6E I;  1MW7 A;  4HX7 A;  4RGU A;  1F4K A;  3IH2 A;  4KIF A;  2IGK A;  2W25 A;  2VBZ A;  2VXZ A;  3E5Q A;  1A04 A;  5IP7 J;  3LSH A;  5BMZ A;  4KDP A;  4KIS A;  4I6Z A;  2PEX A;  2R5Y A;  4M72 A;  1W7P D;  3TP3 A;  2DN0 A;  4LK1 F;  2WBM A;  2DOF A;  3ABK H;  2BE5 F;  4CCO A;  2JTV A;  5D6F A;  4ABZ A;  3OOP A;  3HTS B;  3HBL A;  2E71 A;  3KYC B;  1SFU A;  2YU9 J;  1K4T A;  5FRN A;  4I01 A;  5H6R A;  1HDP A;  2WB1 N;  1OYW A;  3JTG A;  2HYF A;  4UVC A;  1MBK A;  4YIR X;  3TP0 A;  1Z21 A;  3QWL A;  5A2Q Z;  5HOD A;  3JSO A;  3BG9 A;  1V5F A;  4UVA A;  1G4D A;  3LA2 A;  3F8M A;  1HF0 A;  4BE1 A;  2G0E A;  2XAF A;  1GDT A;  2Y75 A;  4XKC A;  2ETH A;  2CH0 A;  3CMY A;  2OTJ I;  3BPV A;  3BP8 A;  3ABL H;  5K7H A;  1S6L A;  1DU6 A;  1VFC A;  2QEN A;  1MBG A;  5GTI C;  5GTH C;  3FWE A;  1MKM A;  2LR8 A;  4UUV A;  4UV8 A;  2K4J A;  4U0W A;  5CQG A;  5E8I A;  3ERE D;  5CVI A;  3GYH X;  3QOE A;  4XL9 A;  3FK6 A;  3H92 A;  1ZG1 A;  4Z6Y A;  4LG3 A;  1KU2 A;  2PN6 A;  4RAG A;  1ETQ A;  1WJF A;  2D1H A;  3L9F A;  3TGN A;  5EG0 B;  1JKP C;  2FE3 A;  1F43 A;  1ETW A;  3WG9 A;  5IYC J;  1R4N B;  1BM9 A;  2P4W A;  1Z7L A;  4EGY A;  5L3D A;  2PI0 A;  1Z9C A;  2FOW A;  2BY0 A;  4AUX A;  1VND A;  4OIO F;  3H1C A;  4ZJZ A;  1D5V A;  1UJ8 A;  5J4V A;  5DM6 F;  2K9M A;  1Z0X A;  4YEJ A;  5FLV A;  3A2K A;  2O5R A;  4BQO A;  3TKY A;  2H1K A;  3CCM I;  2Q8K A;  3LSJ A;  2P5K A;  3BZC A;  3DQV C;  1BBY A;  3K4N A;  2VT2 A;  5GAE J;  1YRN A;  3AAF A;  1F5T A;  1IF1 A;  2XGC A;  4D0P A;  2W48 A;  2XIG A;  3O8G A;  1IUY A;  1S3J A;  1GV2 A;  4B1R A;  5IP6 A;  2FU4 A;  2L9N A;  3HGG A;  3D5R C;  4HW0 A;  3C2B A;  5D8L B;  4HEA 2;  3GEZ A;  2DA4 A;  2CQQ A;  1ORK A;  4XIC A;  4RB1 A;  1IN5 A;  1FY7 A;  1JGG A;  2QEX I;  3KX2 A;  5KK1 A;  2E5N A;  2OA4 A;  1DDN A;  1OCT C;  4AWX B;  2AS5 F;  2COB A;  2RGV A;  2JA5 J;  1XGM A;  1DQU A;  2VN2 A;  1YG2 A;  1HBX G;  1XG1 A;  3S93 A;  1IRX A;  3CJQ B;  4UXN A;  2CW0 F;  2R3S A;  5M3M J;  4BKX A;  2YS9 A;  4CYC B;  3EUA A;  4EJV A;  4NC6 A;  3FMS A;  4PFO A;  3NRV A;  2XF5 A;  4HV6 A;  2PX9 A;  1JUM A;  2RNJ A;  4PFP A;  3ZQG A;  1XX5 A;  2DA7 A;  1JKR C;  3CJN A;  3CP8 A;  2K27 A;  4HA8 A;  2Z9O A;  3RKX A;  3ZMT A;  3DBL B;  1V54 H;  2XRN A;  1SFO J;  1U5T B;  3IUO A;  1Q1H A;  2KQR A;  3C2H A;  3F22 A;  3H0G J;  4XN3 A;  3HKZ A;  4KJZ A;  2IS2 A;  3JRF A;  2EQR A;  3GW2 A;  4ZZL A;  1OYI A;  2XB5 A;  3IL2 A;  2ELJ A;  1QNT A;  2LG4 A;  2LBF B;  2LH9 A;  2DMU A;  4HF2 A;  1JJ6 C;  3GTG J;  2M45 A;  3BTC A;  4LG0 B;  4I2O A;  3S2H J;  2X6Y A;  1R36 A;  2Z2S B;  4RA2 A;  1BW6 A;  2EZH A;  4BYY A;  1O57 A;  2YX7 A;  1F9N A;  2DA3 A;  4KUM A;  4I98 B;  3JRB A;  4MFD A;  3MKZ A;  5B5E C;  5J1R A;  1YI2 I;  5BPD A;  5LHG A;  2HVR A;  3CC4 I;  3S1Q J;  1ZG5 A;  3WOD F;  2PQ8 A;  2EV5 A;  1EH6 A;  2Z33 A;  2QBY A;  3HOV J;  1ETV A;  1ZRE A;  5FKN A;  5JVT A;  1T8I A;  3U2R A;  5F6F A;  2K7L A;  4RS8 A;  3HZJ A;  2OF7 A;  4N9I A;  3SEQ A;  3FDY A;  2ZCW A;  1P9Q C;  5GAG J;  2M34 A;  4ENM A;  2PMH A;  3BR2 A;  2H8R A;  2LOO A;  2HS5 A;  2M5W A;  4L5E A;  4OU0 A;  4FE7 A;  1XN7 A;  4GYI A;  4UY8 I;  1D1C A;  1SAU A;  1PDN C;  1UG2 A;  3ULQ B;  4P9U A;  4XOT A;  1H9G A;  1TQM A;  3KIO A;  2AHQ A;  5F27 A;  4I7H A;  3WG7 H;  5CVR A;  3DU6 A;  1XTA A;  2LY1 A;  5AIQ A;  3HSE A;  2DYR H;  2FQ4 A;  1YLF A;  4BQN A;  1SD6 A;  4HSR A;  2XGE A;  2X0L A;  5IOY A;  1K61 A;  2A6E F;  2IJL A;  2Y9Y A;  3CLQ A;  3MAJ A;  1A31 A;  2LRE A;  4OMY A;  3ERM A;  4MGR A;  1MIJ A;  1AA7 A;  1OJL A;  1ON1 A;  4N0B A;  3PQJ A;  3H5N A;  2ZXH A;  5BS6 A;  2XVC A;  2GQQ A;  4IQJ A;  4J00 A;  2DA1 A;  2DYS H;  3GFJ A;  4EJW A;  2BVM A;  2V4J C;  2F2E A;  3BR1 A;  1KU9 A;  2DFI A;  4HNV A;  3S15 J;  2VBW A;  2L4M A;  1BR4 A;  2KRH A;  3IRQ A;  1BIB A;  4E7Z A;  2W84 A;  2DAO A;  2VKE A;  2A6H F;  2FQ3 A;  5C4J J;  5ICF A;  3RKY A;  3L2R A;  4L9T A;  4KIT B;  4BUP A;  3QU3 A;  2XPV A;  2K86 A;  3IP4 B;  4LIV A;  3PM1 A;  3K70 C;  1ONV A;  3BG6 A;  3DEE A;  1RI7 A;  3ONQ A;  4QTR A;  2EBI A;  3R61 A;  5ILS A;  5EG0 A;  2A3S A;  3F8F A;  1TW3 A;  2JWT A;  5FRO A;  1GXP A;  5IP9 J;  4I0A A;  1H88 C;  2V1X A;  3ABT A;  2GM4 A;  2NVU B;  1U8R A;  3Q9S A;  1G3W A;  3EYI A;  2HYJ A;  1IRG A;  1BR2 A;  3K1M A;  1HDD C;  1EF4 A;  3OIQ A;  2DMT A;  2Y0S A;  1XDS A;  3A01 B;  3ZGK A;  2ECC A;  2VBY A;  5C3E J;  2M30 A;  2E1M C;  2XV4 S;  3M1E A;  1SMT A;  4X0G A;  3GTK J;  1E2X A;  1NH3 A;  2VON A;  5L3F A;  1RC9 A;  1XMX A;  1HSJ A;  2VXD A;  3R6S A;  2O3F A;  1LB2 A;  3K6G A;  1LDJ A;  4E7H A;  1TNS A;  4FX0 A;  4ITV A;  1OCR H;  5HLG A;  2KMU A;  2A68 F;  3H3Z A;  4KT5 C;  2F5V A;  2VQL A;  2VKH A;  4K2E A;  2GZW A;  1W5S A;  4ZDO A;  1EJ9 A;  5JR3 A;  3PSF A;  3I64 A;  3QPT A;  1ZQ3 P;  4ON0 A;  5KAI C;  1Y39 A;  5J4Y A;  5GPC A;  1X1B A;  3WTV C;  1IG7 A;  2OV7 A;  1DGR M;  2QYO A;  2PG4 A;  5K7Z A;  2ZSH B;  5EDN A;  4CYC A;  4A3E J;  4G7O F;  3OYD A;  4IL6 C;  2OD5 A;  3ASO H;  2NOG A;  3Q0V A;  4MNU A;  5DYM A;  1HA8 A;  3GLX A;  2DOE A;  4P55 A;  3PFI A;  3BR0 A;  1MNE A;  1K79 A;  4BBS J;  3BG3 A;  2X1E A;  4G6Q A;  4NC7 A;  1TWC J;  4JX5 A;  3PUB A;  3CCS I;  3TQN A;  2ZME C;  1U5T A;  3BR5 A;  4AIK A;  3IKT A;  1ZAO A;  3P9I A;  4M9S A;  1A36 A;  2MD5 A;  2CFX A;  3N4M A;  1GHC A;  1MSF C;  5LBQ A;  4CH7 A;  3L7W A;  1H8A C;  1DP7 P;  1ZYR F;  1U0J A;  5LRR A;  5ICC A;  1UG0 A;  3BY6 A;  2LBF A;  3ESW B;  1E17 A;  1D1A A;  2UV1 A;  3F3X A;  3CDI A;  1REP C;  1R1U A;  1USS A;  1TLH B;  2KP6 A;  4LG0 A;  3RTR A;  2X51 A;  2LVS A;  5J47 A;  1FBQ A;  4UUS A;  1FOY A;  4MO7 A;  1XC5 A;  1EKE A;  4CCJ A;  1BI1 A;  2J5P A;  3HSF A;  1T98 A;  4ZYA A;  3T8T A;  4HQE A;  4IRI A;  3OS2 A;  4Y33 A;  5KAF C;  1F1Z A;  2BXZ A;  2M8G X;  4R8H A;  4QLC U;  1ZGJ A;  2W57 A;  2A5Y B;  2X85 A;  5L3C A;  3DCF A;  3K4B A;  4YFX F;  1LVK A;  4E7S A;  4PJJ A;  4FET A;  2KL4 A;  3SFI A;  1RUO A;  4I99 C;  2F6C A;  5TRD A;  5F0H A;  4I02 A;  1OMI A;  2ME6 A;  4HZF A;  2R7V A;  3FK7 A;  4CZZ A;  3C3W A;  1SMY F;  2K3F A;  3X2Q H;  2V1U A;  4HAM A;  2JSP A;  3CDH A;  1R00 A;  3DEU A;  3GZ6 A;  4A5N A;  4RAF A;  1EH8 A;  1ULY A;  1LKX A;  3NAR A;  2ESN A;  3MN2 A;  1D8K A;  4XKW A;  2CRG A;  2DDB A;  3E6M A;  4YEL A;  4F7Z A;  5LEJ A;  2FEZ A;  3IC7 A;  3SXY A;  3CCL I;  2F4I A;  3WU1 B;  2OBP A;  1IZ1 A;  1DPU A;  1FYM A;  3R60 A;  2EFQ A;  2VJJ A;  3HXL A;  2LY2 A;  1BJZ A;  3HUG B;  3OOU A;  2D5V A;  1KA8 A;  3TW7 A;  2EJR A;  4OAZ A;  5EGO B;  3B73 A;  4EJO A;  2HTJ A;  3CJT B;  1X4O A;  4M71 A;  2V26 A;  3V4G A;  3HTU A;  2LF7 A;  1NHA A;  3LSR A;  5BNG A;  3ZQF A;  2E1O A;  4IHY A;  2ZXI A;  1YJ9 I;  3SJM A;  3ML6 A;  2ID6 A;  2OJE D;  2R4G A;  1CF7 B;  1YX3 A;  5D8K B;  3F6V A;  2JQ7 A;  3BJA A;  2HVQ A;  2CU7 A;  1TP4 A;  1B4A A;  3K4K A;  4KT6 A;  3Q0U A;  5H20 A;  1Y56 A;  1LFB A;  4BY7 J;  4CCL A;  4HLY A;  1VF9 A;  2V1D A;  2A61 A;  2W00 A;  2CV2 A;  2VE8 A;  1UZC A;  1X2M A;  1QHG A;  2DLL A;  4DOZ A;  3A01 A;  4M6V A;  3F8B A;  2LFB A;  3S2D J;  2P0W A;  3BJO A;  2JPB A;  3I9V 2;  2X6X A;  1QZE A;  4FHT A;  1NTC A;  2VE9 A;  2IVM A;  1Z77 A;  2Y0M A;  5D5V B;  1XS9 A;  3RPU A;  5B1B H;  1S72 I;  5EEA A;  4A3B J;  2VQH A;  5E3L A;  4DYQ A;  1ZLK A;  3HDD A;  2LRD A;  4HX4 A;  2FUG 2;  2IW5 A;  4IHS A;  3KZI C;  1IW7 F;  2GXG A;  2O6G E;  3C7J A;  1X3U A;  3HIF A;  4S0H B;  2FBH A;  1QRY A;  3QQA A;  4UHT A;  2A5W A;  4ZC3 A;  5HNH A;  2DTZ A;  3HB9 A;  4PJL A;  2QZ8 A;  2EH3 A;  4A6E A;  3QP5 A;  1Y8Q B;  3M8F A;  2P5L C;  1GXQ A;  1IGN A;  4EM1 A;  2V9K A;  4CXF A;  1K4S A;  1I6X A;  3HHG A;  2F5C A;  1WJ5 A;  2M8E A;  3DPL C;  2GIV A;  4AYB A;  2JN6 A;  2L7K A;  3BQZ A;  2EA2 A;  1MH4 A;  2RAE A;  2D45 A;  4G8X A;  4GYG A;  1B1B A;  1OCP A;  3K1N A;  2E1N A;  5EZG A;  2YPR A;  3CCU I;  5CPR B;  3CCY A;  2XSJ C;  3NAU A;  4X1E A;  2Q1Z B;  3FM3 A;  3MVP A;  2CUJ A;  1SFK A;  9ANT A;  1ITY A;  1D0Z A;  3UNG C;  4E6K G;  1WGX A;  3WU0 A;  2DI3 A;  4EEF G;  5K1Y A;  2VT3 A;  4B48 A;  4HYE A;  1IXR C;  1X58 A;  3H3U A;  3KLN A;  4O6J A;  4XK4 A;  4RGR A;  3HPH A;  1W5C C;  4HLX A;  4B47 A;  4KIB A;  1FNN A;  2RNG A;  4FTH A;  1IAW A;  1Y0N A;  2OQR A;  3WGH A;  1D8J A;  2TRT A;  4IVN A;  4ZDL A;  2XF6 A;  4DW6 A;  5JI6 A;  3UKG A;  2DW4 A;  2Y69 H;  3K10 A;  2E34 A;  1T95 A;  3P5J A;  5HS7 A;  4QWQ A;  4ANJ A;  2XC7 A;  3W2V A;  5LHI A;  2EV6 A;  4ASN A;  1C0W A;  4UB6 C;  1YIO A;  5E8G A;  3LA3 A;  2ELH A;  3GCM A;  1G2H A;  2YR2 A;  2DOA A;  5J1U A;  4PJ0 C;  4D1Q A;  3ZMD A;  3AG2 H;  3VFZ A;  2KZG A;  1OR7 A;  1WRJ A;  3PL8 A;  3MWM A;  1E3P A;  2K40 A;  2KIU A;  2VJ5 A;  4RB3 C;  1KON A;  1U2W A;  3BR3 A;  1FWZ A;  1W7P B;  3M8E A;  3MZY A;  2NYX A;  3OL4 A;  3DTE A;  2VJI A;  3FHN A;  4IO9 F;  1BIA A;  1QPI A;  3TL4 X;  1X1P A;  1G3T A;  1JUP A;  4JX6 A;  1POG A;  1FYL A;  4IHX A;  2L01 A;  1X2N A;  2ZJP F;  1I3Q J;  5DUI A;  4M3G A;  4FIS A;  2YX4 A;  1VQ4 I;  2HDW A;  2V6E A;  3J7A Y;  4EM0 B;  1IRZ A;  4E7I A;  1WZ2 A;  2MW8 A;  1NG7 A;  2E60 A;  1IO2 A;  1SFX A;  3VWB A;  2JUC A;  2EFO A;  4XM3 A;  3HUG A;  4A0Y A;  3CC7 I;  3K1P A;  4BGD A;  4IRG A;  4IXA A;  2JMW A;  2DJN A;  4GDF A;  1ZRD A;  4JOM A;  2ELK A;  5FLM J;  2NS0 A;  5J8C A;  3Q5F A;  2FBI A;  2CJJ A;  3FXM A;  2HOS A;  1SVM A;  2K02 A;  4GO1 A;  2UWM A;  4DBQ A;  4LK0 F;  1MJ9 A;  4AID A;  1BL0 A;  3OIO A;  2IS6 A;  2EV0 A;  1BW5 A;  3FKJ A;  2CQX A;  1CF7 A;  5ED4 A;  3KEY A;  4CDG A;  1XSX A;  1A35 A;  4EM2 A;  1H0M A;  3MD2 A;  2LTP A;  5L3E A;  2FXA A;  3RSN A;  3FHZ A;  4Z2Y A;  3WHC A;  1EV7 A;  3BC8 A;  1YIT I;  2COM A;  3AG1 H;  1HW1 A;  3I55 I;  3GFM A;  1T56 A;  2TDX A;  4M9X A;  3TBI A;  1SAN A;  1V3F A;  2KDO A;  2V6C A;  3VYR B;  4A69 C;  5B66 C;  1HCR A;  2HDD A;  3AL0 C;  1V5G A;  1XDU A;  1UEL B;  1IC8 A;  4XOR A;  3V8L A;  1WFX A;  4C3I J;  3S1N J;  2B0L A;  2R7W A;  4OIN F;  3KYL A;  4XLC A;  3C18 A;  1T0F A;  1B72 B;  1ETK A;  4ZDP A;  3KCC A;  2QWW A;  1FBU A;  1VQN I;  2BYV E;  3G4S I;  2LC2 A;  1NK2 P;  1IV6 A;  3IWF A;  3I53 A;  1U9N A;  4XKV A;  5F08 A;  4KN7 X;  4L9V A;  3UR3 C;  2L4A A;  4L9N A;  2UXN A;  3SDB A;  1YJW I;  2VQG A;  2HOE A;  1AKH B;  2XHK A;  4CCK A;  2ZJQ F;  2DMQ A;  1HLV A;  2IRF G;  2PMZ N;  3I4N J;  5AIP A;  3RQI A;  4XRF A;  2RDP A;  4CIC A;  1MMD A;  2W4S A;  1XCB A;  2QKL B;  2OU2 A;  2QF7 A;  2MH9 A;  3ZN1 A;  2V1N A;  4XNF A;  3W6V A;  1K78 B;  3U1K A;  1VQL I;  4DQ2 A;  3L09 A;  3KP5 A;  4ESB A;  1UB9 A;  4HPQ A;  2M0C A;  3HOX J;  2CV0 A;  4M3D A;  2MYS A;  1VQ9 I;  4M3F A;  1OLT A;  4GXO A;  5EEH A;  1L3L A;  4CYD A;  4Y17 A;  4A6D A;  2JVH A;  3CZ6 A;  3I56 I;  2QUF A;  2DK8 A;  3JRD A;  2L9V A;  3S14 J;  4HF1 A;  5D4S A;  4YIF A;  2CW8 A;  1OCC H;  4UV9 A;  2E2I J;  4MQV A;  3RKW A;  3CMA I;  3JTH A;  4QPQ A;  2EZL A;  3KPH A;  4O5V A;  3EET A;  3IWZ A;  5ILU A;  1J75 A;  3HEF A;  3OYG A;  2F5F A;  3SZG A;  2HZT A;  1Y1V J;  3GUD A;  5GAH J;  3DF8 A;  4U7D A;  1G6N A;  4V2F A;  1W0T A;  4A3J J;  1KYW A;  3L2C A;  1UFM A;  1JJ8 C;  3EPZ A;  2MH2 A;  1STZ A;  3ZOB A;  1MBJ A;  1HXD A;  2H09 A;  2IT0 A;  1ZEL A;  2W1O A;  2CQN A;  3ELK A;  2QSG X;  2JA6 J;  1BOA A;  1Z05 A;  1OCZ H;  2VAS A;  2N8G A;  3BRO A;  2R7T A;  3DEW A;  2BVL A;  1QVU A;  2L9R A;  2EIN H;  4GFB A;  3BZ6 A;  1VQK I;  3AG3 H;  2WA0 A;  4WXH A;  5E79 C;  1W7P A;  4S05 A;  1GV5 A;  2JJ7 A;  2HGC A;  5L3B A;  4M73 A;  1MBH A;  2R7Z J;  1LNW A;  2M1B A;  1P6R A;  3OYI A;  3ZR8 X;  1YX5 A;  5TIS C;  1RIO H;  4II2 A;  2LY9 A;  2FX0 A;  4MEY F;  1B9N A;  4J01 A;  1TNT A;  3CUQ C;  5J1Y A;  2KIS A;  4UUS B;  1XSD A;  3S16 J;  3GTJ J;  3DLL F;  2LYC A;  4C9Y A;  3WGG A;  4ZZD A;  5FKL A;  1EH7 A;  2IPQ X;  2OUM A;  1AHD P;  2ZJ2 A;  3PO2 J;  2DBB A;  4BHC A;  3EUH A;  2O8X A;  2CUF A;  4XON A;  5GPA A;  1B8I A;  4L5I A;  4XLH A;  3JW4 A;  4BDY A;  2BZT A;  2M9H A;  3F9K A;  4Q47 A;  1AWC A;  1KU3 A;  1Z3Y A;  3BZK A;  5ILV A;  3K4L A;  3F8C A;  1W36 C;  4LGW A;  1UST A;  1SD4 A;  2DJI A;  2O61 A;  2H6B A;  3VOD A;  3KEQ A;  1FTZ A;  4N4N B;  3HRU A;  2YUS A;  3HYI A;  4DGW B;  2WAE A;  2WAD A;  3MMY B;  2GXA A;  2G7H A;  1H9T A;  3QRF F;  2STW A;  4CHU A;  4D5C A;  1P4A A;  2LKP A;  3QYF A;  3FF5 A;  1FP1 D;  4OAY A;  4KYW A;  1ODD A;  3Q3S A;  3M7G A;  2BOL A;  3VYS B;  2VJ4 A;  1R22 A;  4F3Q A;  5K5Q A;  4AIJ A;  1TT0 A;  3KET A;  1J9I A;  1PUE E;  1QO0 D;  2VC0 A;  3LSI A;  3CCQ I;  5LGU A;  4JYK A;  2OQG A;  3GWZ A;  1NG6 A;  1H89 C;  3ZN0 A;  1B72 A;  3VDX A;  4BJ5 C;  3AFH A;  1HKT A;  2MD0 A;  2GBY A;  4NDL A;  1VQP I;  2EFW A;  4XN0 A;  1ZG3 A;  2DTR A;  3C1D A;  3FXK A;  4TV7 A;  4B43 A;  3WTY C;  4RGX A;  3HOZ J;  3S17 J;  4EGZ A;  1W0U A;  4DIQ A;  2MG4 A;  2DPU A;  1J2X A;  2KJB A;  3HGY A;  3CF5 F;  1ZTR A;  1AKH A;  1GVJ A;  3JAM K;  1D0X A;  3B02 A;  3LQQ A;  1JKQ C;  4NUB A;  3QPL A;  3OYF A;  4IZZ A;  1I6H J;  3BTI A;  2DT6 A;  5D5X B;  2LMD A;  1DGW Y;  3QPH A;  1FYK A;  2BGC A;  3QOD A;  1S29 A;  3ABU A;  4IJA A;  2XDV A;  3BTL A;  1FIP A;  1X3W B;  3G1O A;  3GO5 A;  1XMA A;  5E1X A;  4CZC A;  1N77 A;  1K78 A;  2L02 A;  4NB5 A;  5EEG A;  2L54 A;  3TW6 A;  3MQ0 A;  2STT A;  5BQT A;  1KQ0 A;  1FT9 A;  3S3N A;  3O6B B;  3J81 K;  4LB6 B;  1OFC X;  1RES A;  3IHU A;  2M4G A;  3PNY A;  3CD6 I;  3GME A;  3GTM J;  2ZBK A;  4CSW A;  1WWX A;  1RPW A;  3I4P A;  1SC7 A;  2FML A;  4CGZ A;  5C44 J;  1SVL A;  2X1C A;  3HOY J;  4BJT A;  3QOP A;  1X4P A;  1ZGA A;  2V9P A;  2XPU A;  1GVD A;  3R0A A;  3WU2 C;  4U7B A;  4BBR J;  1IN6 A;  3D0S A;  2H94 A;  4LMY A;  5JHU A;  5F04 A;  5B3S H;  4BY1 J;  1FSH A;  2AXT C;  4M3E A;  3KEO A;  5J6X A;  4BHP A;  4IKF A;  3A4C A;  2B63 J;  3W2A A;  4U0Y A;  2P8T A;  2GA2 A;  1MGT A;  1I39 A;  5F1R A;  3U9G A;  2QQB A;  4AVP A;  2LP0 A;  4M74 A;  3E1S A;  4XRS A;  3SYT A;  1R9T J;  4XQF A;  1Z6T A;  3HHH A;  1ZKG A;  5JFR A;  1BJA A;  1JTY A;  4WCG A;  5M5Y J;  2P6T A;  4JBA A;  4MHG A;  4D7M A;  4G9Y A;  5CYV A;  3RYP A;  2HFH A;  4C2M J;  2OCE A;  1IDZ A;  3JCU C;  4FAS D;  4GCV A;  3OSF A;  1K7A A;  2O0Y A;  2L2O A;  2M2E A;  3HKZ N;  2JK3 A;  1T08 B;  3U1D A;  2VIX A;  2K9S A;  5FB2 A;  1KGS A;  3JRE A;  5E18 F;  2LSO A;  1X1D A;  3HOU J;  3TOB A;  4XLE A;  5FGM A;  3RZO J;  3OYH A;  3TMO A;  5LD2 C;  1YHQ I;  3MEX A;  2IGM A;  1MMS A;  3L2U A;  4F52 A;  1FIA A;  4J19 A;  4LLN A;  1VQ7 I;  2WTE A;  2IEK A;  2I8D A;  3NEU A;  2HTS A;  4RAZ A;  2HQA A;  3H9G A;  1YO5 C;  3OYJ A;  3E3V A;  1FEX A;  5DDG A;  4NHJ A;  3BR6 A;  3CQZ J;  2P6S A;  2JVG A;  3PIP F;  5FLX K;  2EB7 A;  2E2H J;  2D2W A;  3I58 A;  1LUJ B;  3RIR A;  1V55 H;  1O3R A;  2EFN A;  2OC6 A;  2FSW A;  3BT9 A;  2BHZ A;  3DBH B;  1O3T A;  1W4M A;  2HQR A;  3L2Q A;  2ZNY A;  2R7F A;  5HDN A;  3K2Z A;  2QM3 A;  3KP2 A;  5CLS A;  3WE3 A;  4BL0 B;  2I10 A;  3FXL A;  1XB4 A;  3KYD B;  3DWL E;  3ZCO A;  3SZT A;  3F23 A;  2F48 A;  3KP6 A;  2XSD C;  2K5C A;  1OQY A;  1SD5 A;  3RI4 A;  2P7C B;  3DBR B;  3G2B A;  3GZN B;  3VYT B;  2ZFW A;  3MKL A;  4XLN F;  1WJE A;  3ZP5 A;  4L18 B;  3WTU C;  4X6A J;  3ZMS A;  1RKW A;  3DFG A;  2HI3 A;  2P5V A;  3MKW B;  4WXC A;  5DD4 A;  1R23 A;  4P9F A;  1HW2 A;  4XSZ F;  4I09 A;  1WI9 A;  3KFW X;  3M1C A;  1ACI A;  1XGS A;  1ZR4 A;  4KIC A;  2HOT A;  1OIS A;  3H35 A;  3OWT A;  3RYR A;  3G1M A;  4HF0 A;  1YYV A;  2ZB9 A;  1W36 D;  1RKT A;  2DXI A;  3S3M A;  1O7F A;  1Z3X A;  2NNN A;  3ECO A;  4ZYH A;  3L2W A;  1DUX C;  5EZH A;  3CCE I;  3WTZ A;  2CGP A;  4HV5 A;  4Q5S F;  5DM7 F;  1WQ2 A;  1ZH5 A;  4MEX F;  2NS7 A;  2BHY A;  5E17 F;  1D1B A;  5IYD J;  2E1M B;  3GTL J;  2FD5 A;  3M9A A;  2RN7 A;  2LNB A;  1Z67 A;  4XLA A;  4ZYG A;  4RB0 A;  2M7B A;  4JK1 X;  2GOM A;  4XRM A;  4CA0 A;  2Y0S N;  3MFK A;  4BH9 A;  2E5Z A;  1MJB A;  1P4W A;  4LFU A;  3OSG A;  2IGN A;  2DA6 A;  4UVB A;  2LKX A;  3OYC A;  2PJR B;  4RMN A;  5M3F J;  3CCJ I;  2NOJ B;  3Q0W A;  4V19 K;  3FZV A;  3BQY A;  3OYM A;  3FXJ A;  2DO7 A;  4UB8 C;  4WX9 A;  1T39 A;  1T38 A;  3BCA A;  4P96 A;  1U9O A;  2EIM H;  4XLF A;  3CF2 A;  4OMZ A;  2P7V B;  2VOP A;  3D5S C;  4IHW A;  5HOO A;  2O8K A;  1YW9 A;  1R71 A;  2IS1 A;  4G94 A;  3PJR A;  3O8H A;  3A0H C;  2M3A A;  2K9N A;  5H6Q A;  4RBO A;  1R6R A;  3G1L A;  5F0C A;  2WB1 A;  3L00 A;  2M0M A;  1YTY A;  4XRS G;  3J80 K;  2WC2 A;  1S7E A;  2B9S A;  1JTX A;  1DU0 A;  1B9M A;  2HPI A;  4BXU A;  2LLK A;  2R7U A;  3TO7 A;  2CMP A;  3DLA A;  3DV8 A;  2EA4 A;  1WJA A;  3CCV I;  1VQM I;  1U8B A;  3LFU A;  4WF2 A;  2NXN B;  3QP6 A;  2ISZ A;  4A3G J;  3L1P A;  2MGQ A;  2ZME B;  2GOX B;  4B44 A;  3CJR B;  4R1H A;  3JRC A;  4ZTJ A;  5E1W A;  3T0Y A;  2BY1 A;  5IY5 H;  3DTI A;  2R92 J;  3HL2 A;  2VOO A;  2O7O A;  4MLO A;  1YS7 A;  2L5Q A;  2CUE A;  4IOA F;  2G9W A;  4HDU A;  5JVG F;  1N75 A;  5DCM B;  4WWC A;  4AD9 A;  1TTY A;  2JA7 J;  2MAB A;  4PJN A;  3U21 A;  3CTA A;  1LVA A;  1ETY A;  2K4B A;  4MQ9 F;  1R5H A;  5HLH A;  3CCR I;  1JT6 A;  4HST A;  4G6T B;  3HOS A;  4OIQ F;  1YS6 A;  2X9D A;  4IPA A;  2R7Q A;  4Q4Z F;  6PAX A;  2DA5 A;  2KHM A;  3QYB A;  2DQR A;  1U6G A;  3IRR A;  4E7K A;  5DS9 A;  2ZNZ A;  1A5J A;  1IDY A;  2VC1 A;  4KNY A;  2XAJ A;  3CO7 C;  2W82 A;  3B6C A;  1HKQ A;  2WY8 Q;  3R0J A;  1HC8 A;  2HOA A;  4KMU X;  2Z1D A;  3KZZ A;  4BDZ A;  1GT0 C;  2Y48 A;  3K9T A;  4BEH A;  2PLY A;  1PP7 U;  5TJJ A;  3RQ4 A;  2JRT A;  2K3P A;  2R7X A;  1QBJ A;  3F8N A;  4IX7 A;  1FP2 A;  2GA1 A;  3F6O A;  2ADU A;  3OYB A;  3JRG A;  3DPU A;  3SHF A;  1I5Z A;  4A0Z A;  4BAY A;  4C3J J;  1OCO H;  4IEJ A;  4L5J A;  2H8W A;  4LJZ F;  4PDK A;  3TO6 A;  3REO A;  1TL8 A;  1ZAR A;  3O2P E;  1P92 A;  3LWF A;  5E3N A;  5E3O A;  4BXX J;  4IHV A;  2NAZ A;  4Y7N J;  1LQ1 A;  3WTT C;  4AU7 A;  1Y1W J;  3PNT A;  5D4R A;  1YW8 A;  3BG7 A;  1ZHF A;  5GP9 A;  4BS9 A;  2HKO A;  1DPR A;  4UUT A;  5HDK A;  3CMM A;  1UHW A;  1X1C A;  5AON A;  2DA2 A;  5E3M A;  4C30 A;  3K0L A;  3JAM Z;  2BY3 A;  2CQK A;  5D6E A;  1QZY A;  3R4K A;  3W6K B;  1J5Y A;  5BPI A;  2H6C A;  2TCT A;  4RLF A;  4G7H F;  1J09 A;  1I1G A;  3GLL A;  5M5W J;  4NC8 A;  3QU6 A;  3O3K A;  2V7F A;  1S8N A;  1U5T C;  4B09 A;  1B6A A;  5F0F A;  4ZTF A;  1Q1V A;  1ZLJ A;  1B8I B;  4RAY A;  1MSE C;  1LDD A;  3LFK A;  1FPQ A;  2GAU A;  3KE2 A;  4FCY A;  4G6D A;  2MBF A;  4BQA A;  4IQ4 A;  3I3L A;  1ETX A;  1WVR A;  3FXR A;  4NQW B;  3J81 Z;  3JSP A;  4E7L A;  4IHT A;  3PQK A;  4FQG A;  1VTN C;  3E0J B;  1AU7 A;  2XGX A;  4G7Z F;  1IXS B;  1BC7 C;  4XBF A;  1FOK A;  3RCO A;  3BCB A;  1J59 A;  1P4X A;  3FXO A;  2OZ6 A;  1MND A;  3PFY A;  3H9Q A;  1RET A;  3VYU B;  3A02 A;  1D3Y A;  1E3O C;  1R5I D;  3GBG A;  1TC3 C;  3RZD J;  3GF2 A;  5EJC A;  1MMN A;  1BI2 A;  3BG5 A;  1VQ6 I;  5IPA A;  2PJR A;  4HRI A;  4A3K J;  2XAG A;  3QYE A;  5FO5 A;  2MFZ A;  2FBK A;  1FC3 A;  2NVY J;  4Y3O A;  4BAC A;  4PGH A;  2XKP A;  5DTD A;  2XGD A;  1JI8 A;  2L9S A;  2V79 A;  2HXI A;  2KJC A;  2R0Q C;  2RC4 A;  2XUB A;  5D5U B;  1R4M B;  4HNT A;  2WAQ N;  1LDK B;  1UCR A;  3RJP A;  4A12 A;  4JQF A;  1MMA A;  1GLN A;  3HRM A;  1Z1D A;  4M6Y A;  5J3L A;  1AOY A;  2QLZ A;  4PUS A;  4II3 A;  1BC8 C;  4XMY A;  3G73 A;  5JLX A;  2DMN A;  1WH7 A;  4FT8 A;  1YW7 A;  5LRS A;  1TWG J;  1JXS A;  4N9H A;  3T5X A;  4HNU A;  3ZQH A;  4AYB N;  3V7S A;  1WKM A;  1L0O C;  2ZME A;  4U88 A;  5TGT A;  1MZB A;  2WWY A;  1ZRF A;  1WHU A;  1IN8 A;  1IRF A;  4DJA A;  2QCO A;  2VPR A;  2Z99 A;  4CUG A;  4N4O B;  2PBI A;  1S5L C;  2EFP A;  2HQN A;  2QQ8 A;  2F4O B;  1RNL A;  4RM3 A;  2A05 A;  5DCM A;  3G71 I;  3HOW J;  2QGU A;  3VEP A;  4XOP A;  3S1M J;  1WH5 A;  2XB0 X;  2E35 A;  4ZYD A;  3K69 A;  1FBS A;  4A3M J;  1Y0U A;  1IJW C;  1ENH A;  1G59 A;  4KMF A;  3P9C A;  4KN4 X;  3G3Z A;  1P7I A;  2ISY A;  3GXO A;  5DEQ A;  3CC2 I;  2EIJ H;  2FMY A;  4BE2 A;  2AXL A;  2R7R A;  2BV6 A;  2CW7 A;  4G12 A;  5FLX Z;  2ZSI B;  1KU7 A;  3OL3 A;  5HDG A;  3OYK A;  2O03 A;  1MBE A;  3E6C C;  3P9K A;  1E3H A;  4XSX F;  2IGO A;  3M07 A;  5HLI A;  4AIH A;  1TQP A;  1A6Q A;  3E5X A;  1ZGW A;  3ZPL A;  1CQT A;  1BI3 A;  5FD5 A;  3WHB A;  2M4K A;  4H0E A;  2MLK A;  2FJ1 A;  4RLQ A;  4F92 B;  5CVU A;  2X6O A;  1FMV A;  1P7J A;  1QPM A;  2H27 A;  2JZY A;  4YG2 F;  4A3D J;  3JRA A;  3H3V K;  2KRF A;  3FMQ A;  1EA3 A;  3OYL A;  2L3D A;  1WJB A;  2ZC2 A;  3FIW A;  2E7W A;  5IYB J;  1Z7U A;  3MZ8 A;  3OYN A;  2K9Q A;  3T8R A;  3V8J A;  1K83 J;  2EWN A;  3HRS A;  2F5E A;  1X3Z B;  1F36 A;  3V7R A;  1FX7 A;  1G8X A;  2Y2Z A;  5JHF A;  1U78 A;  4LLG F;  3GTO J;  2GWR A;  2E1C A;  3LAP A;  5F1J A;  4Y52 J;  4EJT A;  3LOC A;  4A3C J;  5M5X J;  3BTJ A;  1WCM J;  4XR6 A;  3IKV A;  3GTQ J;  1TWF J;  3DKW A;  2EZK A;  3P7N A;  1S7O A;  3IAS 2;  3LMM A;  2DOD A;  5KCM A;  5FFZ A;  2KIQ A;  1QZZ A;  3CLO A;  1LEA A;  3ASN H;  4B3A A;  1G3S A;  5FKK A;  1YIJ I;  4B8X A;  1IN4 A;  5ERI A;  1VI0 A;  1MH3 A;  2C6Y A;  3ZMZ A;  5D5W B;  3FXQ A;  1VQO I;  2IA2 A;  4QIW N;  5ICG A;  4ZH4 F;  2CS3 A;  2W24 A;  3BLY A;  5LEK A;  3GFL A;  2IA1 A;  1SFE A;  4HQM A;  1YQA A;  4NQW A;  2XAH A;  3LL7 A;  2ZJR F;  1PUF B;  2ZXW H;  1UHS A;  4XLP F;  3MKY B;  1MDM B;  3M8J A;  3GX4 X;  4NNJ A;  3EYY A;  3V7C A;  3RDI A;  5EYR A;  4CO8 A;  3AL0 B;  1I27 A;  1PP8 F;  4RM2 A;  1X1A A;  3K4J A;  4ENK A;  2VUM J;  2CG4 A;  2HXO A;  4R79 A;  3NWT A;  3J80 Z;  2VPL A;  2WAF A;  5GAD J;  3E97 A;  2EZI A;  1ZK8 A;  1MJA A;  3FX3 A;  2HU9 A;  2AQF A;  4HX8 A;  1JE8 A;  1LE8 B;  3W6J B;  2Q2E B;  4ETS A;  1XCV A;  1CGP A;  3BPX A;  3PO3 J;  3BOQ A;  1OR7 C;  2A07 F;  2GXB A;  3ZMU A;  5E20 A;  1D5Y A;  2VLA A;  5CQE A;  5B1A H;  3DPT A;  1K6Y A;  4PSX A;  2JT1 A;  3DXJ F;  2F5D A;  3LST A;  4RDU A;  3E6B A;  3FMR A;  5IT9 K;  4PK4 A;  3ZMV A;  3OMY A;  1HST A;  3NQO A;  3I71 A;  3TDZ C;  3CP2 A;  4YII A;  2QQ9 A;  2R7O A;  2QSF X;  3LSG A;  4H4K C;  1ETO A;  1R5G A;  2BW3 B;  3LQR A;  3OY9 A;  2R7S A;  5LGN A;  1QU3 A;  3IH4 A;  2MA3 A;  1BI0 A;  5LFA A; 
#chains in the Genus database with same CATH homology
 1RZ4 A;  1G3Y A;  2XAQ A;  2OZU A;  3FM5 A;  3E6D A;  1R58 A;  3TDU C;  3KP3 A;  4RGS A;  4EQQ A;  3ZQ7 A;  3DP7 A;  3N97 A;  3I0T A;  2VOD A;  3HRT A;  5DUK A;  5HS9 A;  4LD5 A;  4IF4 A;  1JGS A;  2DU9 A;  5CJ9 A;  2DPD A;  3HOT A;  5DD8 A;  5KVR A;  2FNA A;  3EDP A;  1XSV A;  4HDV A;  3T1B A;  2D1V A;  2G7U A;  1MD0 A;  1XGN A;  3SFZ A;  3BDD A;  5A2Q K;  2BBY A;  3LAJ A;  4ESJ A;  1TBX A;  2E7X A;  2MC3 A;  5K5O A;  3CUQ B;  3I54 A;  1QQI A;  1HW5 A;  2ESH A;  3TOA A;  2M87 A;  2UXX A;  2VBX A;  1UHM A;  4Q48 A;  3VB2 A;  1R7J A;  4MTD A;  4ENN A;  1KYZ A;  2OAZ A;  4A2U A;  1KQ9 A;  1O7L A;  1SD7 A;  1IXC A;  2Z3Y A;  1T2K A;  4A0X A;  3WE2 A;  1OYY A;  3COA C;  3V8K A;  5CVV A;  2QVO A;  3SQN A;  1J7K A;  4O3M A;  1HKS A;  2CWE A;  4EV0 A;  4PGG A;  2LF8 A;  3MCZ A;  4Y13 A;  3I59 B;  2RQP A;  5F64 A;  4S04 A;  3F21 A;  3J7A O;  3ROU A;  4MTE A;  1MDM A;  1K6O A;  1TW2 A;  4E70 A;  1XMK A;  4EVI A;  4YFK F;  2NNY A;  4PZJ A;  4KIG A;  1P2F A;  5BOX A;  5L3G A;  2YSR A;  2XRO A;  1O3S A;  2Q2E A;  2PFB A;  2WV0 A;  4WXD A;  1ZN2 A;  1V4R A;  2RVC A;  1J0R A;  4OOI A;  1FLI A;  5LHH A;  3S2W A;  4A5M A;  3F72 A;  2ZKZ A;  1LEB A;  1FSE A;  4ENJ A;  2ACJ A;  1LJ9 A;  2DQL A;  4WK8 F;  3MZH A;  4IRH A;  5K5R A;  2BEO A;  4HBL A;  2NRA C;  2CYY A;  1RUN A;  4DNC A;  2CO5 A;  2DK5 A;  3SZP A;  2KKO A;  2HWV A;  5J8F A;  4I0B A;  1OPC A;  4L0Y B;  5FFX A;  1I1S A;  3BJ6 A;  2ZXJ A;  4Y15 A;  4LLL A;  2JPC A;  1Z6R A;  2HKX A;  4EMS A;  2UZK A;  1U3E M;  1JHH A;  3ISP A;  4BHB A;  1SAX A;  3HSR A;  3KZY A;  1S7A A;  2R7D A;  2A69 F;  2DT5 A;  2PJP A;  3WGI A;  5ICE A;  4KA4 A;  4ESF A;  4M9Z A;  4KFC A;  1IN7 A;  3KLO A;  3CUO A;  3QAH A;  2XAS A;  1YFH A;  2RV8 A;  2W85 A;  5LLQ A;  2PMU A;  3CUQ A;  2FRH A;  1W5T A;  5HS8 A;  2KIM A;  5FD6 A;  2EK5 A;  2XKO A;  4P5O A;  1ZRC A;  5DV5 A;  3GVA A;  2Q0O A;  2IP2 A;  1BN5 A;  2MLG A;  1XGO A;  4BNC A;  1R1T A;  1O3Q A;  4YFN F;  2Z5U A;  5HVQ C;  2FNP A;  1KQ8 A;  3EQL F;  3OV8 A;  1QGP A;  1HQC A;  5IT3 A;  4PCQ A;  4OIR F;  1FZP B;  1R1V A;  1JHF A;  2J5O A;  3WTS C;  2QQA A;  5LGT A;  2FF4 A;  1XD7 A;  4EJU A;  3KP7 A;  3I59 A;  3Q9V A;  4FX4 A;  3VOE A;  2FOK A;  3FXU A;  3GFI A;  3CO6 C;  2IA0 A;  5E1Z B;  3ECH A;  2JSC A;  3BWG A;  3RPQ A;  4LB5 A;  1ON2 A;  2RKH A;  1B59 A;  1OKR A;  5IT9 Z;  2HYG D;  4RB2 C;  5CVJ A;  3GZ5 A;  4HOB A;  4L0Z B;  3WTX C;  2HEO A;  5DCF A;  2YU3 A;  3D5L A;  2KIF A;  2CSO A;  2ZO4 A;  2LDU A;  1TQI A;  3WTW C;  1T6S A;  3LA7 A;  3E5U A;  4GGG A;  4M6X A;  1Z91 A;  2X4H A;  2FA5 A;  2QBY B;  3I5U A;  4OIP F;  4L9J A;  4UNO A;  3TO9 A;  4U0V A;  2HR3 A;  2V9V A;  2HDC A;  3KP4 A;  1WSU A;  4ZYE A;  4HX7 A;  4RGU A;  1F4K A;  4KIF A;  2W25 A;  2VBZ A;  2VXZ A;  3E5Q A;  1A04 A;  5BMZ A;  4KDP A;  2PEX A;  4M72 A;  1W7P D;  4LK1 F;  2BE5 F;  2JTV A;  5D6F A;  3OOP A;  3HTS B;  1SFU A;  4I01 A;  5H6R A;  1OYW A;  3JTG A;  2HYF A;  4UVC A;  5A2Q Z;  3JSO A;  1G4D A;  4UVA A;  3LA2 A;  3F8M A;  2XAF A;  2Y75 A;  2ETH A;  3BPV A;  3BP8 A;  1S6L A;  2QEN A;  3FWE A;  1MKM A;  4UUV A;  4UV8 A;  2K4J A;  4U0W A;  5E8I A;  3ERE D;  5CVI A;  3GYH X;  3H92 A;  1ZG1 A;  1KU2 A;  2PN6 A;  2D1H A;  3L9F A;  3TGN A;  2FE3 A;  3WG9 A;  1BM9 A;  2P4W A;  4EGY A;  5L3D A;  2PI0 A;  1Z9C A;  4OIO F;  1D5V A;  3TKY A;  2Q8K A;  2P5K A;  3DQV C;  1BBY A;  2VT2 A;  3AAF A;  1F5T A;  1IF1 A;  4D0P A;  2XIG A;  1IUY A;  1S3J A;  2FU4 A;  4HW0 A;  5D8L B;  3GEZ A;  4RB1 A;  1IN5 A;  1FY7 A;  5KK1 A;  2OA4 A;  1DDN A;  4AWX B;  2AS5 F;  2RGV A;  1XGM A;  2VN2 A;  1YG2 A;  1HBX G;  4UXN A;  2CW0 F;  2R3S A;  4EJV A;  3FMS A;  3NRV A;  4HV6 A;  2RNJ A;  3CJN A;  2K27 A;  4HA8 A;  2Z9O A;  3RKX A;  3ZMT A;  2XRN A;  1U5T B;  1Q1H A;  3F22 A;  3GW2 A;  4ZZL A;  1OYI A;  3IL2 A;  1QNT A;  4HF2 A;  2M45 A;  4LG0 B;  4I2O A;  1R36 A;  4BYY A;  1O57 A;  2YX7 A;  1F9N A;  4KUM A;  4I98 B;  5BPD A;  5LHG A;  1ZG5 A;  3WOD F;  2PQ8 A;  2EV5 A;  1EH6 A;  2Z33 A;  2QBY A;  1ZRE A;  5JVT A;  3U2R A;  5F6F A;  2K7L A;  4RS8 A;  4N9I A;  2ZCW A;  4ENM A;  2PMH A;  2HS5 A;  2M5W A;  4OU0 A;  1XN7 A;  4GYI A;  1PDN C;  3ULQ B;  4P9U A;  1H9G A;  1TQM A;  4I7H A;  5CVR A;  5AIQ A;  3HSE A;  1YLF A;  1SD6 A;  2X0L A;  2A6E F;  2IJL A;  3MAJ A;  4OMY A;  4MGR A;  1ON1 A;  4N0B A;  3PQJ A;  5BS6 A;  2XVC A;  2GQQ A;  3GFJ A;  4EJW A;  2F2E A;  1KU9 A;  2DFI A;  2VBW A;  2L4M A;  3IRQ A;  1BIB A;  2W84 A;  2DAO A;  2A6H F;  2FQ3 A;  5ICF A;  3RKY A;  4L9T A;  3QU3 A;  2K86 A;  1ONV A;  1RI7 A;  3R61 A;  5ILS A;  2A3S A;  3F8F A;  1TW3 A;  1GXP A;  4I0A A;  2V1X A;  3ABT A;  1U8R A;  3Q9S A;  1G3W A;  3EYI A;  1IRG A;  3K1M A;  1XDS A;  2VBY A;  2M30 A;  2XV4 S;  3M1E A;  1SMT A;  1E2X A;  2VON A;  5L3F A;  3R6S A;  1HSJ A;  2O3F A;  1LB2 A;  1LDJ A;  1TNS A;  4FX0 A;  5HLG A;  2A68 F;  3H3Z A;  4KT5 C;  4K2E A;  2GZW A;  1W5S A;  5JR3 A;  3I64 A;  3QPT A;  4ON0 A;  3WTV C;  2QYO A;  2PG4 A;  4G7O F;  2OD5 A;  4MNU A;  5DYM A;  3GLX A;  4P55 A;  3PFI A;  1K79 A;  4G6Q A;  3TQN A;  1U5T A;  4AIK A;  3IKT A;  1ZAO A;  3P9I A;  4M9S A;  1GHC A;  2MD5 A;  2CFX A;  3N4M A;  5LBQ A;  3L7W A;  1DP7 P;  1ZYR F;  5LRR A;  5ICC A;  1E17 A;  3BY6 A;  3F3X A;  1REP C;  1R1U A;  1USS A;  1TLH B;  4LG0 A;  3RTR A;  1FBQ A;  1BI1 A;  2J5P A;  3HSF A;  1T98 A;  3T8T A;  4HQE A;  4IRI A;  1F1Z A;  4R8H A;  4QLC U;  1ZGJ A;  2W57 A;  2A5Y B;  5L3C A;  4YFX F;  1RUO A;  5TRD A;  4I02 A;  1OMI A;  4HZF A;  4CZZ A;  3C3W A;  1SMY F;  2V1U A;  4HAM A;  3CDH A;  1R00 A;  3DEU A;  3GZ6 A;  4A5N A;  1EH8 A;  1ULY A;  2ESN A;  1D8K A;  3E6M A;  4F7Z A;  5LEJ A;  2FEZ A;  3IC7 A;  3SXY A;  3WU1 B;  2OBP A;  1IZ1 A;  1DPU A;  1FYM A;  3R60 A;  2EFQ A;  1KA8 A;  2EJR A;  3B73 A;  4EJO A;  2HTJ A;  4M71 A;  3V4G A;  3HTU A;  2LF7 A;  1NHA A;  3ML6 A;  1CF7 B;  5D8K B;  3F6V A;  3BJA A;  1B4A A;  5H20 A;  4HLY A;  2V1D A;  2A61 A;  2VE8 A;  2DLL A;  3F8B A;  3BJO A;  2JPB A;  4FHT A;  2VE9 A;  2IVM A;  2Y0M A;  5D5V B;  3RPU A;  1ZLK A;  4HX4 A;  2IW5 A;  4IHS A;  1IW7 F;  2GXG A;  2O6G E;  3C7J A;  1X3U A;  3HIF A;  2FBH A;  4UHT A;  2QZ8 A;  4A6E A;  3QP5 A;  3M8F A;  2P5L C;  1GXQ A;  4EM1 A;  4CXF A;  1I6X A;  3HHG A;  2F5C A;  2M8E A;  3DPL C;  2GIV A;  2EA2 A;  2D45 A;  4G8X A;  4GYG A;  1B1B A;  3K1N A;  2E1N A;  2YPR A;  3FM3 A;  3WU0 A;  2DI3 A;  5K1Y A;  2VT3 A;  4HYE A;  1IXR C;  3H3U A;  3KLN A;  4O6J A;  4RGR A;  4HLX A;  4KIB A;  1FNN A;  1IAW A;  2OQR A;  3WGH A;  1D8J A;  4IVN A;  5JI6 A;  2DW4 A;  5HS7 A;  4QWQ A;  5LHI A;  2EV6 A;  4ASN A;  1C0W A;  1YIO A;  5E8G A;  3LA3 A;  2ELH A;  2YR2 A;  3ZMD A;  3VFZ A;  1OR7 A;  1WRJ A;  3MWM A;  2KIU A;  4RB3 C;  1U2W A;  3M8E A;  1FWZ A;  1W7P B;  3MZY A;  2NYX A;  1BIA A;  1G3T A;  1FYL A;  2L01 A;  5DUI A;  2YX4 A;  4EM0 B;  1SFX A;  2EFO A;  3HUG A;  4A0Y A;  3K1P A;  4IRG A;  4IXA A;  1ZRD A;  2NS0 A;  5J8C A;  3Q5F A;  2FBI A;  4GO1 A;  2K02 A;  2UWM A;  4LK0 F;  1MJ9 A;  2EV0 A;  1CF7 A;  5ED4 A;  4CDG A;  1XSX A;  4EM2 A;  1H0M A;  5L3E A;  2FXA A;  3FHZ A;  4Z2Y A;  1EV7 A;  2COM A;  1HW1 A;  3GFM A;  2TDX A;  4M9X A;  1V3F A;  2V6C A;  1XDU A;  3V8L A;  2B0L A;  4OIN F;  3C18 A;  1T0F A;  3KCC A;  2QWW A;  1FBU A;  2BYV E;  3IWF A;  3I53 A;  4KN7 X;  4L9V A;  2L4A A;  4L9N A;  2UXN A;  2HOE A;  2XHK A;  2IRF G;  5AIP A;  4XRF A;  2RDP A;  4CIC A;  1XCB A;  3ZN1 A;  2OU2 A;  2MH9 A;  1K78 B;  4DQ2 A;  3L09 A;  3KP5 A;  4ESB A;  1UB9 A;  5EEH A;  4GXO A;  1L3L A;  4CYD A;  4Y17 A;  4A6D A;  2QUF A;  2DK8 A;  4HF1 A;  5D4S A;  4YIF A;  4UV9 A;  4MQV A;  3RKW A;  3JTH A;  4O5V A;  3EET A;  3IWZ A;  5ILU A;  1J75 A;  2F5F A;  2HZT A;  3GUD A;  3DF8 A;  4U7D A;  1G6N A;  1KYW A;  3L2C A;  1UFM A;  2MH2 A;  1STZ A;  1HXD A;  2H09 A;  2IT0 A;  3ELK A;  1BOA A;  1Z05 A;  3BRO A;  3BZ6 A;  4WXH A;  1W7P A;  4S05 A;  2HGC A;  5L3B A;  4M73 A;  1LNW A;  2M1B A;  1P6R A;  1RIO H;  4MEY F;  1B9N A;  1TNT A;  3CUQ C;  1XSD A;  3WGG A;  4ZZD A;  1EH7 A;  2IPQ X;  2ZJ2 A;  2DBB A;  4BHC A;  3EUH A;  2O8X A;  4L5I A;  3JW4 A;  4Q47 A;  1AWC A;  1KU3 A;  5ILV A;  3F8C A;  4LGW A;  1UST A;  1SD4 A;  2O61 A;  2H6B A;  3VOD A;  3KEQ A;  3HRU A;  3HYI A;  2G7H A;  1H9T A;  3QRF F;  2STW A;  4CHU A;  1P4A A;  2LKP A;  3FF5 A;  1FP1 D;  4KYW A;  1ODD A;  3M7G A;  1R22 A;  5K5Q A;  4AIJ A;  3KET A;  1J9I A;  1PUE E;  1QO0 D;  2VC0 A;  5LGU A;  2OQG A;  3GWZ A;  3ZN0 A;  1HKT A;  2EFW A;  1ZG3 A;  2DTR A;  3C1D A;  4TV7 A;  3WTY C;  4RGX A;  4EGZ A;  2DPU A;  1J2X A;  2KJB A;  1GVJ A;  3JAM K;  3B02 A;  3LQQ A;  5D5X B;  3QPH A;  1FYK A;  2BGC A;  1S29 A;  3ABU A;  4IJA A;  3GO5 A;  1K78 A;  5E1X A;  1XMA A;  2L02 A;  4NB5 A;  5EEG A;  2L54 A;  3MQ0 A;  2STT A;  5BQT A;  1KQ0 A;  1FT9 A;  3O6B B;  3J81 K;  4LB6 B;  3IHU A;  2ZBK A;  1WWX A;  3I4P A;  2FML A;  4CGZ A;  3QOP A;  1ZGA A;  3R0A A;  4U7B A;  1IN6 A;  3D0S A;  2H94 A;  4LMY A;  5JHU A;  1FSH A;  5J6X A;  3KEO A;  4BHP A;  4U0Y A;  2P8T A;  2GA2 A;  1MGT A;  5F1R A;  3U9G A;  2QQB A;  4AVP A;  4M74 A;  1Z6T A;  3HHH A;  5JFR A;  1BJA A;  4WCG A;  2P6T A;  4JBA A;  4MHG A;  4G9Y A;  5CYV A;  3RYP A;  2HFH A;  4GCV A;  1K7A A;  2O0Y A;  3U1D A;  5FB2 A;  1KGS A;  5E18 F;  2LSO A;  3TOB A;  5FGM A;  3MEX A;  4LLN A;  2WTE A;  3NEU A;  2HTS A;  4RAZ A;  1YO5 C;  3E3V A;  5DDG A;  4NHJ A;  2P6S A;  5FLX K;  2EB7 A;  2D2W A;  3I58 A;  3RIR A;  1O3R A;  2EFN A;  2FSW A;  1O3T A;  1W4M A;  2HQR A;  2ZNY A;  2R7F A;  5HDN A;  3K2Z A;  2QM3 A;  3KP2 A;  5CLS A;  3WE3 A;  1XB4 A;  3SZT A;  3F23 A;  3KP6 A;  1SD5 A;  3RI4 A;  2P7C B;  2ZFW A;  4XLN F;  3ZP5 A;  4L18 B;  3WTU C;  3ZMS A;  3DFG A;  2P5V A;  4WXC A;  5DD4 A;  1R23 A;  4P9F A;  1HW2 A;  4XSZ F;  4I09 A;  1WI9 A;  3KFW X;  1XGS A;  4KIC A;  3RYR A;  4HF0 A;  1YYV A;  1O7F A;  2NNN A;  3ECO A;  4ZYH A;  1DUX C;  3WTZ A;  2CGP A;  4HV5 A;  4Q5S F;  1WQ2 A;  1ZH5 A;  4MEX F;  5E17 F;  3M9A A;  2RN7 A;  2LNB A;  4ZYG A;  4RB0 A;  4JK1 X;  3MFK A;  4BH9 A;  1MJB A;  1P4W A;  4LFU A;  4UVB A;  3FZV A;  2DO7 A;  4WX9 A;  1T39 A;  1T38 A;  4P96 A;  4OMZ A;  2P7V B;  2VOP A;  5HOO A;  1YW9 A;  4G94 A;  5H6Q A;  3L00 A;  1YTY A;  3J80 K;  2WC2 A;  1B9M A;  4BXU A;  3TO7 A;  3DV8 A;  2EA4 A;  4WF2 A;  3QP6 A;  2ISZ A;  2ZME B;  4R1H A;  5E1W A;  3T0Y A;  2VOO A;  1YS7 A;  2G9W A;  4HDU A;  5DCM B;  4WWC A;  4AD9 A;  1TTY A;  3CTA A;  1LVA A;  2K4B A;  4MQ9 F;  1R5H A;  5HLH A;  4OIQ F;  3HOS A;  1YS6 A;  4IPA A;  6PAX A;  4Q4Z F;  2DQR A;  1U6G A;  3IRR A;  2ZNZ A;  2VC1 A;  4KNY A;  2XAJ A;  3CO7 C;  1HKQ A;  3R0J A;  4KMU X;  3KZZ A;  2Y48 A;  3K9T A;  2PLY A;  1PP7 U;  5TJJ A;  2JRT A;  1QBJ A;  3F8N A;  1FP2 A;  2GA1 A;  3F6O A;  2ADU A;  3SHF A;  1I5Z A;  4A0Z A;  4BAY A;  4LJZ F;  4L5J A;  4PDK A;  3TO6 A;  3REO A;  1ZAR A;  3O2P E;  1P92 A;  3LWF A;  2NAZ A;  1LQ1 A;  3WTT C;  5D4R A;  1YW8 A;  1ZHF A;  2HKO A;  1DPR A;  5HDK A;  1UHW A;  5AON A;  3K0L A;  3JAM Z;  2CQK A;  5D6E A;  1QZY A;  3R4K A;  3W6K B;  1J5Y A;  5BPI A;  2H6C A;  4G7H F;  1I1G A;  3QU6 A;  3O3K A;  1S8N A;  1U5T C;  4B09 A;  1B6A A;  1ZLJ A;  4RAY A;  1LDD A;  3LFK A;  1FPQ A;  2GAU A;  3KE2 A;  4G6D A;  2MBF A;  4BQA A;  3FXR A;  3JSP A;  3J81 Z;  4IHT A;  3PQK A;  1VTN C;  2XGX A;  4G7Z F;  1IXS B;  1BC7 C;  4XBF A;  1FOK A;  1J59 A;  1P4X A;  2OZ6 A;  1D3Y A;  3GF2 A;  1BI2 A;  2XAG A;  5FO5 A;  2FBK A;  1FC3 A;  4PGH A;  2XKP A;  2V79 A;  2KJC A;  2RC4 A;  2XUB A;  5D5U B;  4A12 A;  1LDK B;  1UCR A;  3RJP A;  4JQF A;  3HRM A;  1Z1D A;  4M6Y A;  1AOY A;  2QLZ A;  1BC8 C;  3G73 A;  5LRS A;  4FT8 A;  1YW7 A;  1JXS A;  4N9H A;  3T5X A;  3V7S A;  1WKM A;  1L0O C;  2ZME A;  4U88 A;  1MZB A;  2WWY A;  1ZRF A;  1IN8 A;  1IRF A;  2Z99 A;  2PBI A;  2EFP A;  2HQN A;  1RNL A;  5DCM A;  3VEP A;  4ZYD A;  3K69 A;  1FBS A;  1Y0U A;  4KMF A;  3P9C A;  4KN4 X;  3G3Z A;  2ISY A;  3GXO A;  5DEQ A;  2FMY A;  2AXL A;  2BV6 A;  5FLX Z;  1KU7 A;  5HDG A;  2O03 A;  3E6C C;  3P9K A;  4XSX F;  5HLI A;  4AIH A;  1TQP A;  3E5X A;  3ZPL A;  1BI3 A;  5FD5 A;  4H0E A;  2MLK A;  5CVU A;  1QPM A;  2H27 A;  2JZY A;  4YG2 F;  2KRF A;  3FMQ A;  2L3D A;  2E7W A;  1Z7U A;  3T8R A;  3V8J A;  2EWN A;  3HRS A;  2F5E A;  3V7R A;  1FX7 A;  1U78 A;  4LLG F;  2GWR A;  2E1C A;  3LAP A;  4EJT A;  3IKV A;  3DKW A;  3P7N A;  1S7O A;  5FFZ A;  1QZZ A;  3CLO A;  1LEA A;  1G3S A;  4B8X A;  1IN4 A;  5ERI A;  2C6Y A;  3ZMZ A;  5D5W B;  3FXQ A;  2IA2 A;  5ICG A;  4ZH4 F;  2W24 A;  5LEK A;  3GFL A;  2IA1 A;  1SFE A;  4HQM A;  1YQA A;  4NQW A;  2XAH A;  4XLP F;  1MDM B;  3GX4 X;  3EYY A;  3V7C A;  3RDI A;  4CO8 A;  1I27 A;  1PP8 F;  4ENK A;  2CG4 A;  4R79 A;  3J80 Z;  3E97 A;  1MJA A;  3FX3 A;  1JE8 A;  4HX8 A;  3W6J B;  4ETS A;  1XCV A;  1CGP A;  3BPX A;  3BOQ A;  2A07 F;  2GXB A;  3ZMU A;  5E20 A;  3DPT A;  2JT1 A;  3DXJ F;  2F5D A;  3LST A;  3E6B A;  3FMR A;  5IT9 K;  3ZMV A;  1HST A;  3NQO A;  3I71 A;  3TDZ C;  4YII A;  2QQ9 A;  3LQR A;  1R5G A;  5LGN A;  2MA3 A;  1BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...