1XMAA

Structure of a transcriptional regulator from clostridium thermocellum cth-833
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
101
Chain Sequence
SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
rcsb
source organism Clostridium thermocellum
molecule tags Transcription
molecule keywords Predicted transcriptional regulator
total genus 35
structure length 101
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xmaA00
1D3YA 2KIMA 4DQ2A 4G6DA 3T8TA 2L4MA 1IZ1A 3K69A 2HDCA 2G7HA 4KICA 4L0ZB 2DBBA 2FSWA 2EK5A 4A2UA 4ASNA 1MZBA 2H27A 2PBIA 3HSEA 5ED4A 1QBJA 3ZMUA 4A0XA 2XV4S 3NEUA 4IHSA 2XAFA 3S2WA 5H20A 4OIQF 4BYYA 5FFXA 1S6LA 3BP8A 2LSOA 3F72A 1I5ZA 1JE8A 1LJ9A 2VT3A 2DW4A 4JQFA 3RKYA 3E5UA 2EFQA 2XAHA 2MA3A 1Z05A 4M6YA 5ICCA 2QUFA 5L3FA 4OIRF 3BZ6A 3COAC 5BPDA 1WI9A 5JR3A 4PDKA 2OA4A 2VT2A 2P4WA 2BYVE 1U5TC 2QLZA 4D0PA 1JGSA 3E97A 4GYIA 3G73A 2GIVA 4AIKA 5E8GA 1KQ9A 4M72A 1DDNA 2A6EF 4EVIA 1DP7P 2V9VA 4A6DA 1FSEA 1OMIA 2W85A 4MHGA 1D8JA 2D45A 1MD0A 3WTTC 1J7KA 1KYWA 4HV5A 3IKVA 2P7CB 1BIAA 1O3TA 2LDUA 4PCQA 3DF8A 3SZTA 1R23A 2UWMA 2GWRA 4KMUX 4UV8A 3V7CA 2FMYA 4Q4ZF 1MJAA 2Y75A 1U6GA 3GFJA 4L9JA 2PQ8A 3RPUA 2FMLA 1HW5A 1WQ2A 4EMSA 4OMZA 3CUQB 5K5QA 4ENMA 4WX9A 2J5OA 5D5VB 5CLSA 2VONA 2NYXA 2LF7A 2QQ9A 5LHIA 3DFGA 1J2XA 3ABUA 1IXCA 4CXFA 4MQ9F 2H6CA 4EJWA 1DUXC 1IAWA 1QZYA 5HS8A 4B09A 1EH6A 1U2WA 3JAMZ 3E6CC 2TDXA 4OIPF 3M9AA 2CWEA 3BPXA 3DV8A 3KEOA 2EFPA 1IXRC 1TNSA 3BY6A 4U7DA 3FXRA 3V8JA 3GXOA 3F22A 1F9NA 2QQBA 2O8XA 3K2ZA 3EYYA 2MH2A 1IN8A 2P5KA 5FB2A 4MGRA 2CQKA 2XVCA 4M73A 2FEZA 4Q48A 3DKWA 1FSHA 2PJPA 4GO1A 4CICA 3QRFF 4RGRA 3ZMZA 1YTYA 2EWNA 1FYLA 1YW8A 3WGIA 3GLXA 1FBUA 4BNCA 3GFMA 2M45A 4XSZF 3IL2A 3BJOA 3WTWC 2Z33A 1GXQA 4HX7A 3DPLC 1Z6RA 4LLNA 5D8KB 1ZGJA 3O6BB 1SFEA 3MWMA 3R4KA 2KIFA 3HIFA 4GYGA 1IN6A 1RIOH 4EQQA 1SFUA 2DFIA 4LD5A 1SMYF 3KP6A 4GXOA 4Q5SF 3GYHX 3KLNA 3ABTA 2VC0A 3W6JB 2RDPA 4HF0A 3V4GA 1LQ1A 1U5TB 1ZN2A 3E5XA 1RUOA 1S7OA 3FHZA 2MC3A 1R58A 4JBAA 4LK1F 1K78B 1FWZA 3SQNA 4RAYA 4UV9A 2VODA 3B02A 2Q8KA 3F8MA 3GX4X 1XN7A 5JHUA 3H92A 4JK1X 1SD6A 3OV8A 1AOYA 3BDDA 3ELKA 4U0YA 4O6JA 1BM9A 1EH8A 2P5LC 3AAFA 1KU2A 3GZ5A 1BN5A 1SFXA 4N0BA 5E20A 3FZVA 3GFIA 3FX3A 2VOPA 1R7JA 5FFZA 4ESFA 5DD8A 1D5VA 4A5MA 2LNBA 1IN7A 4BHPA 2PMHA 4EM2A 5HOOA 1TQPA 1WKMA 3TQNA 4EJVA 2QZ8A 3E6MA 4QLCU 1Z7UA 2K7LA 5F6FA 4OIOF 3KP5A 3IC7A 5D5UB 3IRRA 1K6OA 2BGCA 3FXUA 1CGPA 1HXDA 5H6QA 2K86A 3GVAA 4CDGA 1O57A 2E7WA 5HDGA 4OINF 1V3FA 2F5EA 2O61A 1FNNA 3LA7A 3J80Z 1U78A 1XD7A 3N97A 2Q2EA 1XSDA 2FA5A 1BC8C 4AIHA 2RQPA 1XSVA 2UZKA 3KCCA 3LAJA 4I2OA 3QPTA 4BQAA 1IRFA 2DT5A 4HOBA 3ROUA 1B9NA 5JVTA 1G4DA 3K1NA 1O3SA 1O3QA 4TV7A 4WXCA 1Q1HA 5HS7A 1G3WA 3NRVA 3BOQA 1ZLJA 4FX4A 3VEPA 2WTEA 4L0YB 1R5GA 1MDMA 2R3SA 3LWFA 5HLHA 3GUDA 4RGUA 4IPAA 4L18B 2COMA 3V7RA 3CLOA 2HKOA 4KFCA 2H09A 3ZMSA 1T39A 4AVPA 4WXDA 3WODF 2EJRA 1GXPA 1H0MA 1REPC 4XSXF 4M71A 2EV6A 2EFNA 2PEXA 2STWA 2GZWA 4UHTA 4PZJA 2X4HA 1UHWA 3HSFA 2MLGA 1MKMA 5D6EA 1YO5C 2OAZA 4UUVA 3JSPA 3BPVA 4KA4A 5JI6A 5ICGA 1R36A 1HSJA 5D5XB 1XCBA 2EV5A 5FO5A 3QP5A 3J7AO 2A68F 1TW2A 3D5LA 1EV7A 1ZG3A 4IF4A 2MH9A 1R1UA 2EFWA 3LA3A 1KU3A 2IW5A 1BI0A 2AXLA 3HHHA 3U9GA 2OU2A 1ZRFA 4HLYA 5DUIA 4EGYA 1HSTA 2KIUA 4CYDA 2VC1A 2DK5A 3QP6A 2W25A 1Z1DA 2XKOA 5D8LB 3RTRA 4UVAA 2DQLA 4LLGF 2MLKA 1GHCA 5LHGA 3F21A 4IRGA 1STZA 4AD9A 3FWEA 2F2EA 5ILVA 4MEYF 4LMYA 3E5QA 4YIFA 1Z6TA 4UXNA 1PP7U 5L3GA 3M8EA 4QWQA 2RV8A 1W5TA 3K9TA 2W57A 5K5OA 5BQTA 1L0OC 5E1WA 1XDUA 3I59A 5J8CA 4CHUA 2M1BA 4AWXB 1E2XA 2J5PA 4I02A 1XCVA 5HDNA 1OKRA 3W6KB 4CZZA 2K02A 3GEZA 1GVJA 4IRHA 3DPTA 3P9IA 3V8LA 1P6RA 1IN5A 3C7JA 5JFRA 2O03A 2YR2A 1QZZA 1BI3A 3VB2A 4ENJA 1BJAA 4HX8A 2KRFA 3DP7A 2IPQX 1RI7A 4BH9A 1LB2A 2Z5UA 2L3DA 2V1DA 2IA2A 4EJOA 3ZPLA 3IHUA 3WTSC 1J0RA 3LSTA 3QU6A 4KDPA 4HDVA 3KZZA 1TLHB 1P92A 2YX4A 5D4SA 3WE3A 2VE9A 3BWGA 3F6VA 1HW2A 4G8XA 4KIGA 4IRIA 1TNTA 2CO5A 2D2WA 3SHFA 3KP2A 3TO9A 4RB1A 1LEAA 4L5JA 3TO7A 4LK0F 3I59B 1BI1A 3KP4A 4I0BA 2RKHA 4HX4A 1XDSA 1ZAOA 4LG0B 3OOPA 2GXGA 1P2FA 1USTA 4Z2YA 1L3LA 1XMAA 3MZYA 2NNNA 4LB6B 4ZYDA 4HBLA 2ISYA 5H6RA 3J80K 1ZYRF 2ESHA 1FY7A 4XBFA 1I1GA 2D1VA 1K7AA 4HV6A 3WGGA 5K5RA 3I64A 3ZQ7A 3LQQA 1V4RA 3U1DA 5IT3A 1W7PB 2O6GE 3I53A 3WU0A 2VE8A 4WF2A 4LGWA 2M5WA 1ZREA 4ZYGA 1OYWA 1VTNC 4OOIA 4I09A 5E1XA 5A2QZ 1B1BA 2ZNZA 1WWXA 5DD4A 1FC3A 3I5UA 3HSRA 1ULYA 4EM1A 1H9TA 5L3DA 5J8FA 1RNLA 2OZ6A 4YFNF 4MTEA 2QYOA 4P96A 1H9GA 1FP2A 5HS9A 1FZPB 1KA8A 3MEXA 3TGNA 4IVNA 4S05A 3FMSA 3L2CA 6PAXA 4HLXA 3K1MA 2GA2A 3HOSA 1K79A 3F6OA 4UNOA 2VN2A 3HTUA 1YS7A 2EB7A 2RC4A 1LEBA 2NRAC 1W7PA 1ZARA 4KIFA 4KUMA 5D5WB 2K4BA 4AIJA 3R6SA 3WTXC 1HKQA 1R1VA 2RGVA 2JZYA 2ELHA 4FX0A 1BIBA 3MCZA 1SMTA 2HZTA 5LBQA 4PGHA 1BBYA 3LAPA 3REOA 2CSOA 1MJBA 2BEOA 4LB5A 5DCMB 2QWWA 3FXQA 2BV6A 1YG2A 3NQOA 5LGTA 4WWCA 3L00A 1G3TA 4O3MA 3M8FA 4H0EA 5HVQC 1SD7A 1A04A 5LRSA 5LRRA 4HF1A 2DAOA 4RAZA 4KMFA 4HZFA 3SZPA 3TKYA 4R79A 1U3EM 4R1HA 4G6QA 1G3YA 2CGPA 1P4WA 3I0TA 3HRSA 5L3BA 4IXAA 5E17F 5CVRA 3KE2A 3R61A 2NAZA 3BROA 3RKWA 1KQ0A 2FBIA 2P5VA 4ZYEA 1FLIA 4GGGA 3IRQA 3MAJA 5HLGA 3KLOA 3ZP5A 4BXUA 2W84A 4U0WA 3R60A 1FYMA 2PI0A 4EJTA 1TW3A 3MQ0A 5FD6A 1KYZA 1S8NA 1YLFA 1S3JA 1B4AA 2B0LA 3WTYC 2YPRA 2QVOA 2ACJA 2DPDA 3KFWX 1R5HA 4YFXF 1CF7B 1S29A 3WU1B 5LLQA 1UHMA 1HBXG 5BS6A 2M8EA 4OMYA 4KT5C 2ZBKA 4A6EA 5DCMA 5FGMA 2H94A 1U5TA 2HEOA 1HKTA 5L3EA 2VBZA 3IWZA 1ZG1A 5E18F 2ZMEB 1KGSA 1RUNA 2IA0A 5CVVA 5LEJA 4KIBA 3JTHA 2IRFG 4ON0A 1FBQA 2L4AA 4P9FA 3GZ6A 1ODDA 3ZN0A 4HF2A 4HA8A 2CYYA 2G9WA 4O5VA 5E8IA 2DI3A 1F5TA 2A69F 3N4MA 2XUBA 1JHHA 2E1CA 2PN6A 4DNCA 2DQRA 2FU4A 1R1TA 1XGMA 5ICEA 1W5SA 4WK8F 3SFZA 3MFKA 2ZKZA 3QAHA 3SXYA 3I58A 3JW4A 2ESNA 4RB0A 1FP1D 3ZN1A 3C18A 2V6CA 1O3RA 2E7XA 1P4AA 3HYIA 2A6HF 3RJPA 4PGGA 5ERIA 2OBPA 1Y0UA 2A3SA 5A2QK 4MTDA 4BHBA 2CW0F 3I4PA 5IT9Z 1TBXA 2JPCA 3GFLA 4WXHA 4U88A 1ZH5A 1SD5A 2Y48A 3H3UA 4ZZLA 5ICFA 2RNJA 3TDUC 5LHHA 1LDJA 5AONA 2XAJA 3F8NA 3T0YA 2GQQA 2HS5A 4XRFA 3CUQA 1G3SA 3B73A 2F5DA 4I98B 3PQKA 2XRNA 3PQJA 5EEGA 3HTSB 5E1ZB 2HR3A 1QO0D 4IHTA 2K4JA 2F5CA 1B59A 1CF7A 1AWCA 2O3FA 3Q5FA 2PLYA 3ISPA 1OPCA 4FT8A 4U7BA 1FPQA 4ENKA 3RDIA 1OYYA 4UVCA 1YFHA 1J75A 5DEQA 1JHFA 4XLPF 2V1XA 2R7FA 3J81K 1SD4A 1XMKA 3O3KA 4RGSA 4M9SA 4KYWA 3M7GA 3KP3A 1I6XA 1E17A 4Y15A 1XSXA 2PFBA 3F8CA 4L9TA 1T2KA 4L9NA 2DPUA 1T6SA 4I01A 1DPRA 2P8TA 2HFHA 3G3ZA 1YW9A 2EA4A 2Z3YA 4HDUA 1T98A 4Y17A 3ERED 3HUGA 4KN7X 5TJJA 1UCRA 3LA2A 5ILSA 3MZHA 4EGZA 1Z91A 3VODA 2FNPA 4XLNF 1O7LA 3P7NA 5DV5A 3HRMA 2KKOA 2WC2A 2IVMA 3LQRA 2HKXA 4B8XA 2PMUA 3FF5A 2P6TA 1BI2A 2XGXA 4N9IA 2CFXA 5EEHA 3Q9SA 4YIIA 2ADUA 1K78A 2CG4A 2A61A 2RN7A 1PDNC 4U0VA 3F3XA 4GCVA 1MJ9A 4G9YA 2ZCWA 3P9KA 5BPIA 4LJZF 4I7HA 5TRDA 2FF4A 3DEUA 1ON1A 1BC7C 4MNUA 4A0YA 1YW7A 4YFKF 2E1NA 3BJAA 3V8KA 1USSA 2O0YA 4ZYHA 4WCGA 1J59A 1I1SA 2JRTA 2V79A 3CUQC 4MEXF 1J5YA 2QBYA 2OQRA 2FRHA 3ZMDA 2F5FA 2IT0A 1B6AA 1FBSA 1P4XA 2ZXJA 4G7HF 5J6XA 2HTJA 4E70A 4P55A 1QPMA 2JSCA 1T0FA 1IUYA 3E3VA 1HW1A 1BOAA 1UFMA 1RZ4A 1FT9A 3E6DA 3GWZA 1PP8F 5HLIA 1NHAA 4Y13A 5F1RA 3QPHA 3JSOA 3F8FA 5CVUA 2YSRA 4ENNA 2X0LA 2ZJ2A 3T8RA 4K2EA 1J9IA 3ECHA 3RI4A 1LDDA 4HQEA 4ESBA 1C0WA 3VOEA 5K1YA 2P6SA 3E6BA 2ISZA 4P9UA 2XAQA 2DK8A 2HTSA 3EYIA 3WG9A 2OD5A 3V7SA 3I54A 4ESJA 2LF8A 3KZYA 1D8KA 3EUHA 1F1ZA 3WTUC 4NB5A 1XGSA 1QNTA 2HYFA 3L09A 2EA2A 4N9HA 3I71A 1X3UA 2OZUA 2G7UA 4I0AA 1KU7A 4NHJA 1KQ8A 2Y0MA 4CO8A 3FM5A 1IW7F 1WRJA 2FQ3A 2C6YA 4M9XA 3DQVC 2GAUA 2FNAA 1KU9A 4L9VA 2XHKA 2VOOA 3KETA 1DPUA 1U8RA 1Z9CA 1YIOA 1LNWA 2HQNA 3R0JA 2HYGD 3F23A 2DU9A 1F4KA 3T1BA 3D0SA 2PG4A 2KJBA 5DYMA 2FOKA 5DCFA 5AIQA 2D1HA 2AS5F 1G6NA 1XGOA 4HAMA 1ZG5A 4YG2F 2V1UA 3HRUA 2FE3A 1R22A 1EH7A 2FXAA 3CO6C 2HWVA 4RB2C 3P9CA 5FLXK 4ZZDA 3C1DA 2EV0A 3RIRA 1O7FA 3K0LA 4MQVA 3LFKA 5AIPA 1B9MA 1FOKA 5FD5A 3ZMTA 2DTRA 3BJ6A 1R00A 1W7PD 1YYVA 1FYKA 1PUEE 3JAMK 3IWFA 2JPBA 4KNYA 2LKPA 2WWYA 2WV0A 1HKSA 3R0AA 5F64A 1TQMA 2ETHA 4M6XA 2R7DA 2XASA 1JXSA 4ZH4F 4NQWA 3CDHA 3TOAA 4CGZA 1IRGA 3HRTA 1OR7A 1ZRDA 1TQIA 4G7ZF 2HQRA 2UXNA 5CJ9A 1YS6A 1XB4A 1OYIA 2VXZA 4F7ZA 4KN4X 4RGXA 4LFUA 2EFOA 3FMRA 4LLLA 3EQLF 2GXBA 1ZLKA 1FX7A 4EJUA 3U2RA 5D6FA 2YU3A 4A0ZA 2VBXA 3GF2A 5L3CA 2P7VB 3HOTA 1TTYA 2QM3A 4P5OA 2L02A 2HGCA 3M1EA 2KJCA 2Q0OA 5IT9K 3CO7C 2K27A 1ONVA 2QENA 2QQAA 2M87A 4S04A 1ZHFA 2UXXA 3RKXA 4A12A 2W24A 2BE5F 3ECOA 2STTA 1W4MA 3WGHA 2JTVA 3Q9VA 5KVRA 3QOPA 4FHTA 1YQAA 5LGNA 1ON2A 2IJLA 4G94A 2XROA 3ML6A 1I27A 1SAXA 1IF1A 2M30A 1XGNA 2RVCA 1UB9A 2H6BA 3TOBA 5KK1A 3WTZA 1LDKB 4A5NA 2XAGA 5LEKA 2QBYB 2XIGA 3JTGA 5CYVA 5BOXA 3KP7A 1T38A 2L01A 4M9ZA 3RYRA 1HQCA 3K1PA 3FMQA 3L9FA 3RPQA 3O2PE 3ULQB 3J81Z 4BHCA 5BMZA 4G7OF 2NNYA 2ZMEA 2IA1A 2YX7A 4HYEA 2MBFA 5DUKA 3L7WA 3HHGA 2ZNYA 2Z99A 2ZO4A 1MDMB 1IXSB 4L5IA 3C3WA 3RYPA 4RB3C 2NS0A 2IP2A 3QU3A 1MGTA 4LG0A 3EDPA 2JT1A 4HW0A 4R8HA 2L54A 2OQGA 2DO7A 5CVIA 3WTVC 5DDGA 3WE2A 3VFZA 3CTAA 2A5YB 1QGPA 2GA1A 4HQMA 1IN4A 1ZGAA 3GW2A 2FBKA 5D4RA 3EETA 2XKPA 3ZMVA 5LGUA 3CJNA 3PFIA 4Q47A 4UVBA 4OU0A 3H3ZA 2HOEA 2ZFWA 4RS8A 1WSUA 2VBYA 1S7AA 2FBHA 3IKTA 2A07F 5ILUA 3DXJF 3TO6A 4EM0B 4IJAA 3FM3A 4EV0A 4BAYA 3T5XA 1QQIA 2BBYA 2MD5A 5HDKA 3KEQA 1ZRCA 2VBWA 5CVJA 2DLLA 3F8BA 3TDZC 5FLXZ 3CUOA 4M74A 2Z9OA 3GO5A 4ETSA 1LVAA
chains in the Genus database with same CATH superfamily
1OISA 2ID6A 1D3YA 2KIMA 4DQ2A 4HNTA 5BNGA 4G6DA 3T8TA 3A0HC 2L4MA 3HKZN 1IZ1A 2XAUA 3MZ8A 4B3XA 4ITVA 3K69A 2HDCA 3OYDA 3H5RA 2G7HA 2LR8A 2LKXA 3VSKA 4E7IA 4KICA 1GDTA 4L0ZB 2JA7J 5TGTA 2DBBA 2FSWA 4S0HB 2EK5A 4A2UA 2LY2A 4ASNA 2ZB9A 4PJNA 2WV1A 2OUMA 1MZBA 2L9RA 1SFOJ 2MD0A 2H27A 3ZOBA 5GP9A 3CCMI 4E7HA 3CDLA 1A36A 2PBIA 3HSEA 3X2QH 4OAYA 5ED4A 2XDVA 2P0WA 2CJJA 2FOWA 3ZMUA 1QBJA 4A0XA 4ZDPA 1A6QA 2XV4S 1F43A 2E1MB 3NEUA 4IHSA 2XAFA 3S2WA 5H20A 5EG0B 3HC7A 4OIQF 2X1EA 4BYYA 4XL9A 5FFXA 1RC9A 3BCBA 3OWTA 1S6LA 3BP8A 2HNHA 2LSOA 1JUPA 3F72A 2BY2A 3FDYA 1JT6A 2ELKA 1I5ZA 1JE8A 5F0FA 1LPQA 1LJ9A 5FKNA 2VT3A 2DW4A 2XB0X 4JQFA 1AKHA 3RKYA 3B6CA 3E5UA 2EFQA 2XAHA 3G2BA 2MA3A 1K4SA 1Z05A 4M6YA 5ICCA 5FJ8J 3HOXJ 3VDXA 2QUFA 3CCJI 3NWTA 2CV1A 4F55A 3MKLA 5L3FA 5H2FC 4OIRF 3BZ6A 1LFPA 1E3PA 3BR3A 3U1KA 3COAC 3IV5A 5BPDA 1KZHA 2K5CA 1OCZH 3PJRA 1WI9A 3CC4I 1WGXA 1SVMA 2Y2ZA 2XSDC 3WHBA 1U9OA 1F36A 5JR3A 3G1OA 4PDKA 1GV5A 3TBIA 3PM1A 2OA4A 2VT2A 2P4WA 2DA1A 3EUKL 4BXFA 2BYVE 2BVLA 5M3MJ 3K70D 1W0UA 1U5TC 2QLZA 5EYRA 4BY7J 2WAEA 3C2BA 5LD2C 4D0PA 1BR2A 1JGSA 3E97A 2DMTA 4GYIA 3G73A 3KIOA 2GLOA 2IS4A 2Y0SA 2GIVA 2GOMA 4AIKA 5E8GA 1KQ9A 2EIKH 2AO9A 3S1QJ 4RAGA 1ETKA 3PFYA 4M72A 4NUBA 1DDNA 2LC2A 9ANTA 2A6EF 1JKQC 2OCEA 4EVIA 1DP7P 1IO2A 2V9VA 2H8RA 4A6DA 1FSEA 1OMIA 2W85A 1MBEA 4MHGA 2LY9A 1D8JA 3DU5A 1MD0A 5EZGA 3WTTC 2D45A 1J7KA 3PO3J 1KYWA 3BR1A 1YIJI 2ZXWH 4HV5A 3IKVA 5K7FA 2P7CB 1BIAA 5GADJ 2L9VA 2XGDA 2LDUA 4PCQA 4DZJA 1O3TA 3DF8A 1H89C 3SZTA 1R23A 2M34A 2VJ5A 2CUZA 2UWMA 2GWRA 4UUTA 4KMUX 2HDWA 4UV8A 3V7CA 2IAIA 2FMYA 2HOAA 1MJAA 2CMPA 2Y75A 4XKCA 4Q4ZF 1PVEA 2HQAA 1U6GA 3GFJA 1ITYA 2KISA 4L9JA 2PQ8A 3RPUA 4DYCA 2FMLA 1VQ5I 1HW5A 1WQ2A 4EMSA 4OMZA 4A3KJ 3CUQB 5K5QA 5CQEA 3F9KA 5DM7F 4ENMA 3L1PA 2JUGA 1ETWA 1FIAA 3A4CA 4C9YA 4WX9A 1QU3A 2J5OA 5D5VB 5CLSA 2BOLA 2VONA 2NYXA 5DM6F 4AU7A 3CLQA 2LF7A 4CCMA 2DCEA 2QQ9A 5LHIA 3DFGA 1J2XA 3ABUA 3FKIJ 1IXCA 1NK2P 4CXFA 4MQ9F 2H6CA 4EJWA 1DUXC 1IAWA 1QZYA 1S5LC 5HS8A 4B09A 1EH6A 1U2WA 3JAMZ 3JRHA 2LK2A 2TDXA 3E6CC 4OIPF 3M9AA 2CWEA 3BPXA 3DV8A 1LFUP 2DMUA 3KEOA 1IXRC 1TNSA 2EFPA 3BY6A 4U7DA 3FXRA 1V5EA 2E60A 3JRGA 3MKZA 1WJFA 3V8JA 3ONQA 4JX5A 1SVLA 3GXOA 1F9NA 3F22A 3ESWB 2QQBA 1DU6A 2O8XA 3K2ZA 2DFHA 3EYYA 2MH2A 1IN8A 2P5KA 4RAFA 5FB2A 4MGRA 4BL0B 2JRMA 1D0YA 2CQKA 4E4HA 3VSLA 3BQYA 3Q0VA 2XVCA 3CZ6A 4M73A 3GBGA 2X1DA 2FEZA 2KDZA 3QODA 4Y33A 4Q48A 3DKWA 1Z67A 2YS9A 1FSHA 2PJPA 4GO1A 4CICA 1LE8A 1OJLA 3QRFF 4RGRA 1HDPA 5CPRB 1SEUA 3ZMZA 1YTYA 2EWNA 2AXTC 1FYLA 1BJZA 1DP3A 1YW8A 3WGIA 2QKLB 3GLXA 1FBUA 2MYSA 4BNCA 3UKGA 3GFMA 2M45A 2NVUB 4D5CA 4M3EA 3DBHB 4XN0A 2ID3A 4XSZF 1AA7A 2KL4A 2O9LA 5KAFC 1IJWC 2OC6A 1FOYA 3BJOA 3IL2A 4CCKA 3WTWC 4B4CA 2Z33A 2ZJQF 1GXQA 4HX7A 3DPLC 1VQ8I 5IYDJ 1Z6RA 5F27A 4LLNA 5D8KB 1ZGJA 3O6BB 1SFEA 3OYHA 3MWMA 2EZKA 2BW3A 3S16J 2DODA 2JMWA 3OS0A 3R4KA 2KIFA 3HIFA 2V9KA 2IBDA 1PYVA 4IEJA 3HOVJ 1T95A 1IN6A 4GYGA 1WHUA 1RIOH 4EQQA 2Q1ZB 1SFUA 2DFIA 2G0EA 4LD5A 1SMYF 4FASD 2PMZA 2HPIA 3KP6A 1TZLA 4GXOA 4Q5SF 3GYHX 3KLNA 2HVRA 1IDZA 4IHYA 3A01A 3HBLA 3ABTA 2VC0A 3GTOJ 4J19A 4BE1A 3JRCA 3W6JB 2RDPA 4HF0A 3V4GA 4NBQA 1LQ1A 2N8GA 1U5TB 1ZN2A 2Z16A 3E5XA 2NVYJ 2DJIA 3Q0UA 1RUOA 1S7OA 1IDYA 3FHZA 4ANJA 2JQ7A 2MC3A 3RKQA 4BBSJ 1R58A 2E34A 3AL0C 4JBAA 4LK1F 1K78B 1FWZA 3SQNA 3BQZA 4RAYA 4UV9A 2VODA 3B02A 1RETA 2BHYA 2Y0SN 3F8MA 2Q8KA 3GX4X 3CF5F 1XN7A 5JHUA 3H92A 4JK1X 1SD6A 1ERDA 3OV8A 1AOYA 3BDDA 3ELKA 4U0YA 1VNDA 4O6JA 1ETOA 1BM9A 1EH8A 4FQGA 5F1JA 2P5LC 3AAFA 1KU2A 1X1CA 3VWBA 3HOZJ 4BE0A 2K9SA 1OCPA 3GZ5A 2HVQA 2H1KA 1BN5A 1EJ9A 1OCTC 2R7OA 5EGOA 2XPVA 2EZIA 1SFXA 2DMPA 4N0BA 5E20A 3FZVA 2YUSA 4XN3A 2E1MC 1WFXA 2WB1N 3GFIA 2FD5A 3FX3A 3TP0A 3K4KA 2VOPA 1R7JA 5FFZA 1BOBA 2K3FA 3Q3SA 4UY8I 3HDDA 2E5NA 4ESFA 5DD8A 2W48A 3KX2A 1D5VA 5B1BH 4A5MA 2LNBA 1IN7A 4BHPA 2PMHA 2JK3A 3OS2A 1VQNI 4EM2A 5HOOA 5B5EC 1TQPA 4U87A 1WKMA 2QEXI 1W0TA 4QSHA 1HLVA 3TQNA 1TT5B 1A6IA 4EJVA 2QZ8A 3E6MA 4QLCU 2QSFX 1Z7UA 4X1EA 2K7LA 5F6FA 4OIOF 3KP5A 3IC7A 5D5UB 3QYFA 3IRRA 1K6OA 2BGCA 3OYIA 2IS6A 1YRNA 3FXUA 1CGPA 1HXDA 3I56I 5H6QA 3ABKH 2K86A 3OR1C 2EQRA 3GVAA 4FETA 2QSGX 4CDGA 1O57A 2E7WA 5HDGA 1K4TA 4OINF 2W1OA 5F04A 2ECBA 1V3FA 5HNHA 2F5EA 4MIMA 3WG7H 2O61A 1FNNA 4XOPA 2LP0A 3LA7A 3HL2A 3J80Z 1U78A 1GVDA 1XD7A 3N97A 5EEAA 1X1PA 2Q2EA 1XSDA 5FKKA 1ZKGA 3D5RC 2FA5A 4DIQA 1BC8C 4AIHA 2RQPA 1XSVA 2BXZA 2UZKA 3KCCA 2O5RA 4Y4RA 3LAJA 4I2OA 2DA3A 3QPTA 4BQAA 1IRFA 2DT5A 3CCLI 1JJ6C 3ABMH 4HOBA 3ROUA 4I76A 5KNLA 1DU0A 5FRMA 3G1LA 1B9NA 5JVTA 5IP6A 1G4DA 3K1NA 1O3SA 3KPHA 2R7VA 2BY3A 2XF7A 2M0CA 3CDIA 1O3QA 2A05A 4TV7A 4WXCA 1MNMC 4XKWA 1Q1HA 2PJRA 3HOWJ 5HS7A 1G3WA 2R7ZJ 3NRVA 3BOQA 1ZLJA 4FX4A 3VEPA 2WTEA 4PJJA 5J4YA 1V54H 3QYBA 1T08B 4L0YB 1R5GA 1MDMA 2R3SA 3FIWA 4BS9A 4OWRB 3LWFA 5HLHA 1WH7A 3GUDA 4RGUA 3F0CA 4IPAA 4HNVA 2COMA 4L18B 3AL0B 2LH9A 3V7RA 5JHFA 3U21A 3CLOA 2HKOA 3P5JA 4KFCA 2H09A 3ZQCA 1MBHA 3ZMSA 1U0JA 1T39A 2ECCA 2LY1A 4WXDA 4AVPA 5GAGJ 2EPFA 2MGQA 3WODF 3HPGA 2EJRA 1GXPA 1R71A 1H0MA 2BW3B 1REPC 5HLTA 4XSXF 4M71A 2EIJH 5B66C 4BJ6C 2K9LA 2VKEA 2EV6A 1TWHJ 2EFNA 2PEXA 1UAAA 1FOXA 2STWA 1MNDA 2GZWA 4UHTA 1I50J 1MBJA 3BTLA 1HCRA 1T8IA 4PZJA 2X4HA 1T33A 1UHWA 1DQUA 1Y6IA 3HSFA 1MSEC 2MLGA 1MKMA 5D6EA 1YO5C 2OAZA 2NVQJ 4UUVA 3JSPA 3BPVA 4PUSA 2DMNA 5JI6A 4KA4A 3K6GA 2HVSA 5ICGA 1MH3A 1R36A 1HSJA 4M3BA 3DBLB 5D5XB 1XCBA 2Y9ZA 3PIPF 4NNJA 2EV5A 1M1EB 5FO5A 3QP5A 1B8IA 3V42A 3J7AO 3S17J 2A68F 1TW2A 4C3JJ 4I6ZA 4A3MJ 3D5LA 1EV7A 2DA5A 1ZG3A 3PNTA 4IF4A 4AYBA 2MH9A 3OYKA 1V5GA 3DEWA 1R1UA 2EFWA 3LA3A 1KU3A 2JN6A 2IW5A 1BI0A 4NC6A 2AXLA 5GTIC 4XRSA 1S7EA 4C3IJ 1KONA 2AQFA 2OJED 3HHHA 3U9GA 2OU2A 1ZRFA 1WZ2A 1OFCX 3OIOA 4HLYA 5DUIA 2F48A 4EGYA 3ZQGA 4A93J 2ZFUA 4P1WA 3BR5A 1HSTA 4ZJZA 2PX9A 2KIUA 3S14J 4LITA 4CYDA 2VC1A 3J7YJ 2DK5A 2M3AA 1UELB 2XSJC 3HZJA 3QP6A 1X4PA 2W25A 4C2TA 1Z1DA 3M8JA 4KITB 1IGNA 1E3OC 2XKOA 5D8LB 2L9NA 3RTRA 4UVAA 2CUEA 3OYEA 3O8GA 2XF5A 2DQLA 1GV2A 2RREA 4LLGF 1EKEA 4II3A 1MW7A 2MLKA 5LHGA 1GHCA 4IKFA 2I10A 3F21A 4DOZA 2VI6A 4XICA 2OV7A 4MFDA 4V19K 4IRGA 1STZA 1TWFJ 4GRIA 4BU2A 3W3CA 4AD9A 3FWEA 5KHDA 2F2EA 4XORA 3OIQA 3NAUA 5ILVA 3LSPA 4MEYF 1VQ7I 4LMYA 1A35A 3E5QA 4YIFA 2MSYA 2TRTA 1Z6TA 3TL4X 4XRSG 3PIOF 4UXNA 1PP7U 4N4OB 5L3GA 3M8EA 4QWQA 2CQNA 2BZTA 2VQHA 2RV8A 1W5TA 3K9TA 5FKMA 3BG9A 3JCUC 2I5UA 2W57A 5K5OA 1WJDA 5BQTA 1W36C 4D9JA 1L0OC 5J1RA 3BT9A 5E1WA 1P7IA 1XDUA 2F4IA 3I59A 5J8CA 4BXXJ 1BW5A 4CHUA 2M1BA 4AWXB 1E2XA 2E2JJ 2J5PA 1JTXA 4I02A 5EJCA 4DJAA 1XCVA 5HDNA 1OKRA 3W6KB 4BBRJ 4QTRA 4CZZA 4EATA 1VQPI 3OL4A 1W5CC 1MMSA 2K02A 4YEJA 3GEZA 1GVJA 3S8PA 3CMEI 4IRHA 1BA5A 2DYSH 3DPTA 3P9IA 3V8LA 1P6RA 2KIQA 1IN5A 3C7JA 5JFRA 1X19A 2O03A 2YR2A 1QZZA 1BI3A 3VB2A 2JWTA 2OPTA 4ENJA 4XKBA 3H0DA 1BJAA 4HX8A 5J4VA 3ZQFA 3LSJA 4JX6A 1B8IB 2KRFA 4QPQA 3SEZA 5B3SH 3DP7A 2IPQX 4M3GA 1YRNB 1RI7A 4BH9A 4XLEA 2Z5UA 1LB2A 5M3FJ 2L3DA 2L7ZA 2V1DA 2IA2A 4EJOA 3ZPLA 2CUJA 3IHUA 3Q0WA 3WTSC 3AFHA 1J0RA 2VB6A 3LSTA 3QU6A 4KDPA 1V55H 1R4NB 1HDDC 4BUPA 2HOTA 4HDVA 3KZZA 4E7SA 1TLHB 3QWLA 4DGWB 1WPKA 1P92A 3SYTA 2YX4A 5D4SA 3WE3A 2VE9A 4PFOA 1MBFA 1N77A 1AU7A 3BWGA 1NK3P 1I39A 1MMAA 5LFAA 3QYEA 3S15J 3HB9A 5J1UA 3I4NJ 3OYNA 3F6VA 1HW2A 1W36D 4G8XA 4KIGA 4IRIA 1TNTA 1UHSA 2KHMA 2CO5A 1WH5A 2D2WA 3OOUA 3QPSA 3SHFA 3KP2A 3K4BA 1BR1A 2CQ7A 3TO9A 1FIPA 4RB1A 1YJWI 2OCCH 4BJ5C 4IZZA 5GTHC 3H35A 1Y56A 1LEAA 4L5JA 3TO7A 1X3ZB 4LK0F 3I59B 1BI1A 3KP4A 4I0BA 2RKHA 4HX4A 1A5JA 2F5VA 1XDSA 2I8DA 1ZAOA 4LG0B 3OOPA 3IH3A 2GXGA 1P2FA 1USTA 1SVOA 1D0XA 1E3HA 2LG4A 5F0CA 4NC8A 4Z2YA 4NC7A 1L3LA 1YITI 1XMAA 3MZYA 2NNNA 4LB6B 4ZYDA 2D5VA 4HBLA 2CQXA 5C3EJ 2ISYA 3PSFA 2KRCA 2KP6A 5H6RA 5C4XJ 1W1WE 2KMUA 3J80K 1ZYRF 2ESHA 2JSPA 2RQQA 2E2HJ 1FY7A 4XBFA 1I1GA 4MLOA 2NS7A 2D1VA 2VASA 1K7AA 3JRDA 4HV6A 3WGGA 5K5RA 3WHCA 3ZQIA 3I64A 4F93B 3ZQ7A 3LQQA 4B44A 1V4RA 3U1DA 3M4OJ 5IT3A 1ENHA 1W7PB 2WBMA 2O6GE 5TISC 2L9SA 1FEXA 4UB6C 3I53A 1LVKA 3WU0A 2VE8A 4WF2A 4LGWA 2M5WA 1ZREA 1Z77A 3K4CA 4ZYGA 1OYWA 1VTNC 4OOIA 5J47A 1LFBA 4I09A 4L5EA 3S3MA 5M5YJ 1FTTA 5IP7J 3H9JA 3MD2A 5JLWA 3MKWB 5E1XA 4W97A 5A2QZ 1XTAA 1B1BA 3TW6A 2ZNZA 2DT7B 1WWXA 4DYRA 5DD4A 1VQ4I 2NVTJ 1FC3A 3I5UA 1RR8C 3HSRA 3MKYB 1ULYA 4EM1A 2Y9YA 1H9TA 4N4NB 4UUSB 5L3DA 1IRZA 5J8FA 5GPCA 4YIRX 2R5ZA 1RNLA 2OZ6A 4YFNF 2A5WA 4E7ZA 4XIDA 4MTEA 2NS8A 3W6VA 3BLYA 1QRYA 2QYOA 4P96A 4A3GJ 1IRXA 3G71I 3H36A 3HEFA 1H9GA 3LSHA 1FP2A 4OAZA 4RDUA 2WA0A 5HS9A 4BDYA 1FZPB 1KA8A 2V1NA 3MEXA 4RM3A 1Y8RB 4PSWA 3TGNA 3AG2H 3OYMA 2XGEA 2LTPA 4BE2A 2KFDA 4IVNA 4S05A 2E5ZA 3FMSA 3RCOA 2K9MA 3PNVA 3L2CA 6PAXA 4HLXA 3K1MA 4F92B 2GA2A 2MW8A 3HOSA 1K79A 3F6OA 4UNOA 2VN2A 1DGRM 2OTLI 3DWLE 3SFIA 1RR7A 1YS7A 3HTUA 2EB7A 3M1CA 2RC4A 3RZDJ 1LEBA 2HPMA 2NRAC 2K9NA 1W7PA 1MMDA 1ZARA 3MN2A 4KIFA 4KUMA 5D5WB 3CMAI 2K4BA 4AIJA 3R6SA 3WTXC 3BTCA 3RPUD 3CC7I 1HKQA 1R1VA 2RGVA 4HRIA 2FUG2 4C3HJ 2JZYA 2R7XA 3K4NA 2ELHA 3FK6A 3LMMA 4FX0A 1BIBA 2BVMA 3MCZA 1SMTA 2HZTA 1Z3YA 2KRHA 3HKZA 3SDGA 5LBQA 4PGHA 1BBYA 3ZQQA 3LAPA 3L2WA 3REOA 2CSOA 3GTPJ 4ZDLA 1MJBA 2BEOA 4LB5A 1ETVA 1Z3XA 5DCMB 5FLMJ 3FXQA 2DMQA 2QWWA 2BV6A 1YG2A 3NQOA 4HPQA 5LGTA 4WWCA 2DN0A 1ZR4A 3L00A 3A02A 5IY5H 1G3TA 3E0JB 1POGA 4O3MA 3M8FA 3C2HA 4H0EA 2WADA 5HVQC 5F08A 3VYSB 4QIWN 1Z21A 4LIVA 1SD7A 4GDFA 1A04A 3O8HA 5LRSA 2BHZA 2VL8A 3FHNA 5FLVA 5IOYA 3S1MJ 5LRRA 4A3DJ 4HF1A 1OCRH 1Y1VJ 2RNGA 2DAOA 2XPUA 5K7ZA 1QA6A 4RAZA 4KMFA 4HZFA 3SZPA 3TKYA 4R79A 1U3EM 1VQ6I 3LSMA 4R1HA 3ASOH 1G2HA 3K4MA 4G6QA 4CH7A 1WJEA 2CUFA 4C2MJ 1G3YA 2CGPA 2VPLA 1P4WA 3I0TA 2Y31A 3HRSA 3QOEA 1UMQA 5L3BA 4IXAA 2M7BA 1LE8B 5E17F 1XG1A 5CVRA 3KE2A 4ZDOA 3R61A 2NAZA 2FX0A 4XQFA 5E3OA 3BROA 2H8WA 3RKWA 1Y0NA 1KQ0A 2NVXJ 2FBIA 2P5VA 4ZYEA 1FLIA 4ABZA 5CKTA 4IOCF 4GGGA 1MH4A 3IRQA 3MAJA 5HLGA 2CW8A 3KLOA 2ZJRF 2GXAA 3ZP5A 2LLKA 2W84A 4U0WA 1BW6A 4BXUA 3CC2I 3H1CA 1EF4A 2RAEA 3R60A 1FYMA 2PI0A 4EJTA 3H5AA 2X85A 2A6TA 3OYBA 3DLAA 3DKYA 3RQIA 4CCOA 3RZOJ 1JKRC 1ZELA 1TW3A 3MQ0A 5FD6A 3LOCA 1KYZA 5IPAA 1JKOC 1S8NA 5FROA 5EDNA 1YLFA 1IV8A 2XC7A 4Y3OA 3HGYA 3CF2A 1S3JA 2R5YA 1B72B 1B4AA 2B0LA 3WTYC 1YJNI 2YPRA 2QVOA 2ACJA 2DPDA 1WVRA 3KFWX 1MIJA 1R5HA 4YFXF 4ZC3A 4F3QA 1CF7B 2KLOA 1VQ9I 4KJZA 1S29A 3WU1B 1QHHD 4BKXA 4A3LJ 2F4OB 2L2OA 1UHMA 5LLQA 1HBXG 2CRGA 5BS6A 2JA2A 2M8EA 4OMYA 4YRVA 3DTKA 2X6YA 1HOMA 2V26A 4KT5C 2ZBKA 4A6EA 5DCMA 3DU6A 3VPRA 5FGMA 3D5SC 5HNFA 1X1AA 2H94A 2X6XA 1U5TA 2HEOA 1HKTA 1OCOH 5L3EA 3GTKJ 2VBZA 2AQEA 5CQGA 3FXJA 3IWZA 1ZG1A 5E18F 2ZMEB 4QPOA 4PSXA 2CQQA 3OL3A 1RKWA 3MMYB 4A3CJ 1KGSA 3HOYJ 1RUNA 2CU7A 2IA0A 2X6WA 5CVVA 5LEJA 4KIBA 4LG3A 3BG5A 4AM3A 2KPMA 3ZGKA 2W00A 1QPIA 2JVHA 3JTHA 2IRFG 4ON0A 1FBQA 2HZDA 2L4AA 4P9FA 2ZSHB 3GZ6A 2L5QA 1ODDA 1SFKA 3ZN0A 3TP3A 4HF2A 4HA8A 4XLAA 2VXDA 4XONA 2LOOA 1TWAJ 2CYYA 2X51A 2G9WA 4O5VA 5E8IA 4B43A 1ZQ3P 2DI3A 3OYAA 1F5TA 2A69F 3LSGA 3N4MA 2XUBA 3OIPA 1JHHA 1ZGWA 2E1CA 2Z2SB 2PN6A 2K3PA 4DNCA 3IH2A 2DQRA 2FU4A 4GFBA 3RSNA 1R1TA 4IL6C 1XGMA 3FISA 3CCUI 5ICEA 1W5SA 2NOGA 4WK8F 3SFZA 4Y52J 1IUFA 3MFKA 3ERMA 3KYDB 3PUFA 2ZKZA 2QF7A 3QAHA 3SXYA 1OR7C 3I58A 4B47A 3JW4A 4PJ0C 5KCMA 4H4KC 2B7EA 2ESNA 2WB1A 4RB0A 3OYJA 1FP1D 1X58A 1X3WB 3ZN1A 4A69C 2HQ5A 2COBA 2DT6A 3C18A 2V6CA 1O3RA 2VQCA 2KDOA 2R4GA 2E7XA 1P4AA 3K7AJ 3S93A 1SC7A 2EINH 3HYIA 2A6HF 4XLCA 2ME0A 1T56A 1K83J 3RJPA 4PGGA 2BY0A 3M07A 5ERIA 3J7ZI 5GAHJ 3S2DJ 2OBPA 1Y0UA 2A3SA 2L7KA 5A2QK 3CP2A 4MTDA 5JLXA 4BHBA 1RPWA 1ORKA 2CW0F 4Z6YA 3I4PA 4V2GA 2KQRA 2XB5A 4CSWA 5IT9Z 2F6CA 1TBXA 4DZPA 1X2MA 2JPCA 3GFLA 4CYCA 4WXHA 4U88A 1DGWY 4A3BJ 1ZH5A 1SD5A 2X48A 2Y48A 4DYQA 3H3UA 4ZZLA 2E19A 5ICFA 2LREA 1YX3A 2RNJA 3TDUC 1G8XA 5LHHA 1LDJA 5AONA 2XAJA 2VQLA 3F8NA 4BQOA 3WU2C 3T0YA 1XS9A 2GQQA 2HS5A 3ZCOA 3PNYA 2WY7Q 4XRFA 4HEA2 2PJRB 3CUQA 1G3SA 4DBQA 2WAFA 2CS3A 3EPZA 4W1UA 4D7MA 2R7WA 3H3VK 2TCTA 1ETQA 3B73A 3ZRGA 2F5DA 4I98B 3PQKA 2XRNA 2IEKA 3PQJA 5EEGA 3HTSB 2VPRA 2M8GX 5E1ZB 2M4GA 4NQWB 4IHWA 4AC0A 3CJTB 1JT0A 2HR3A 1QO0D 1QHGA 4IHTA 2K4JA 2F5CA 1ETXA 1B59A 1BL0A 1CF7A 1YE9A 4AIDA 1AWCA 2O8KA 2O3FA 3A1YA 3Q5FA 1ZR2A 4Y7NJ 2PLYA 3ISPA 3JRAA 1QVUA 1OPCA 4FT8A 4G6TB 4FTHA 4U7BA 3FK7A 1FPQA 4ENKA 3RDIA 1MSFC 3QQAA 1OYYA 1X1BA 4UVCA 1YFHA 1IV6A 2X1CA 1J75A 4UB8C 5DEQA 2Q2EB 1JHFA 4XLPF 2V1XA 2R7FA 3KEYA 3J81K 2EH3A 3E1SA 1SD4A 1XMKA 3O3KA 2AHQA 5IP9J 3OY9A 3OYFA 3AG4H 2M2EA 2VKVA 3OSGA 1QVTA 2B63J 3HXLA 4RGSA 4M9SA 4KYWA 2QKMB 3M7GA 2VIXA 3KP3A 1I6XA 1E17A 3K70C 4Y15A 1XSXA 2PFBA 3F8CA 1MBGA 4L9TA 4NDLA 1T2KA 4L9NA 2DPUA 1T6SA 4I01A 3E7LA 1WJCA 1DPRA 3SDBA 3W2VA 2P8TA 1XMXA 2HFHA 4XR6A 3G3ZA 3OSFA 2FQ4A 1YW9A 2M7AA 2CV2A 2EA4A 1V5FA 4A3JJ 1R4MB 2Z3YA 3G1MA 3VYUB 4HDUA 1T98A 2R92J 2HDDA 1WJBA 4Y17A 3ERED 3HUGA 4KN7X 5TJJA 1UCRA 1FJLA 3LA2A 5ILSA 3MZHA 4EGZA 5FKOA 2O7OA 1Z91A 3K2AA 2FNPA 4XLNF 3VODA 2VQGA 1O7LA 3P7NA 5DV5A 3HRMA 3SJMA 2KKOA 2WC2A 2IVMA 4BDZA 3LQRA 4IOAF 1GLNA 3FXOA 2HKXA 4B8XA 1E0EA 3DBRB 4D7NA 1UJ8A 2LVSA 4CCNA 2DYRH 5DS9A 2PMUA 2DJNA 3FF5A 2P6TA 1BI2A 5E3NA 1Y39A 2LRDA 1JUMA 2XGXA 4N9IA 2CFXA 5EEHA 3Q9SA 2ME6A 3W2AA 4YIIA 1PUFB 2XF6A 2ADUA 5EG0A 3PSIA 4DBRA 1IC8A 1K78A 2K9QA 5J40A 2IXSA 2CG4A 2A61A 2LFBA 4E6KG 4JOMA 2RN7A 4JP0A 1TL8A 1PDNC 3CP8A 3HGGA 4U0VA 3JR9A 3F3XA 3CCQI 4GCVA 4D1QA 1MJ9A 4G9YA 1LUJB 3GTLJ 3L2UA 2ZCWA 3A01B 3P9KA 5BPIA 1X2NA 4LJZF 4I7HA 5TRDA 3M3YJ 3CCVI 2FF4A 3DEUA 1ON1A 4JYKA 3CJRB 1D0ZA 1BC7C 4MNUA 1UZCA 1I6HJ 4A0YA 1XPXA 4D5FA 1YW7A 4YFKF 2E1NA 3BR6A 3BJAA 3B6AA 3V8KA 4ZYAA 1OCCH 3CCYA 2VLAA 2LYCA 1TT0A 1USSA 1D1BA 2EIMH 2O0YA 4ZYHA 4EEFG 4WCGA 1J59A 1I1SA 3L2QA 3H9QA 2JRTA 2V79A 2HXOA 4CYCB 3CUQC 4MEXF 1J5YA 2QBYA 4E7KA 2OQRA 4XOTA 5HODA 2R93J 4I99C 2FRHA 3DPUA 4B3AA 3ZMDA 2F5FA 3JRBA 1IG7A 2IT0A 3GLLA 1B6AA 1FBSA 3TMOA 1P4XA 2Y30A 3JRFA 1K6YA 2ZXJA 2ELJA 3CCEI 1GUUA 1SAUA 3H9GA 2L0KA 1NG7A 2K85A 2E35A 5J6XA 4G7HF 1TWCJ 3BTIA 3UR3C 2HTJA 4E70A 4P55A 1FTZA 2LBFB 1QPMA 3ZQLA 2JSCA 4F52A 2LD5A 1T0FA 3FBNB 2DXIA 1IUYA 3E3VA 1HW1A 2VJJA 4X0GA 4FISA 3NWSA 3BC8A 2DFFA 1VQLI 1BOAA 3LL7A 2R5ZB 1UFMA 4BQNA 3IAS2 2HU9A 1RZ4A 1FT9A 3E6DA 3GWZA 3PL8A 5HLIA 1PP8F 1NHAA 2L7FP 4Y13A 1U9NA 4XNFA 3ZQHA 3QPHA 5F1RA 3JSOA 2EILH 3DKXA 3DLLF 2QA4I 1Z0XA 3H5NA 1WCMJ 3F8FA 3AKZA 4XM3A 5CVUA 2WY8Q 1RESA 2YSRA 1NH3A 4ENNA 2X0LA 2ZJ2A 2BY1A 3G6EI 3ASNH 3CD6I 4J01A 3T8RA 4K2EA 3I55I 2PMZN 1J9IA 3ECHA 3RI4A 1LDDA 4XLHA 5GPAA 4ESBA 4HQEA 4C2UA 3BG7A 1C0WA 3VOEA 2LKSA 3CESA 5K1YA 2EZHA 2P6SA 3GMEA 3ZR8X 4BGDA 1VZ0A 3E6BA 3LFUA 2ISZA 1XX5A 4P9UA 2XAQA 2DK8A 2HTSA 1PJRA 3EYIA 3WG9A 2P81A 2JJ7A 2OD5A 2V9PA 3I3LA 1JJ8C 5M5XJ 5KAIC 5K7HA 3V7SA 3I54A 4ESJA 2LF8A 3KZYA 1D8KA 1MNEA 3EUHA 1F1ZA 3K10A 3N05A 3S1RJ 1U8BA 1G59A 4RA2A 3WTUC 4NB5A 3CMMA 1XGSA 2MABA 2Z1DA 4B1RA 1QNTA 2HYFA 3L09A 2EA2A 4N9HA 3CQZJ 3I71A 1R6RA 1WI3A 1X3UA 2OZUA 2V7FA 2G7UA 3D1NI 4I0AA 4J00A 4ZTFA 1KU7A 2M4KA 2ZC2A 4NHJA 4CA0A 2DA6A 5C44J 2B9SA 3TEDA 1KQ8A 4M3DA 2Y0MA 3GTMJ 4CO8A 4KT6A 1LKXA 4XK4A 3FM5A 1IW7F 1WRJA 2FQ3A 2QQ8A 3BG3A 2C6YA 4M9XA 3G4SI 2FJ1A 2QSHX 4PFPA 5M5WJ 3DQVC 2GAUA 2FNAA 1H8AC 1KU9A 1JI8A 4L9VA 2XHKA 3AG3H 2VOOA 3KETA 1R9TJ 2E71A 1DPUA 5EZHA 3BTJA 1U8RA 4A3EJ 1Z9CA 1YIOA 1LNWA 3HJEA 3GTGJ 4IX7A 2HQNA 1Y8QB 3R0JA 2HYGD 4A3FJ 3F23A 2DU9A 3BR2A 3S3NA 2WAQA 1F4KA 3T1BA 3SZGA 3D0SA 3BR0A 2PG4A 3BZCA 2KJBA 5DYMA 4MFEA 3PUBA 2FOKA 4JX4A 5AIQA 5DCFA 3IH4A 1D1AA 2D1HA 2AS5F 4CZCA 1GT0C 1SANA 1G6NA 1K61A 1XGOA 3DEEA 4HAMA 1ZG5A 3SEQA 2Y69H 3EUAA 4YG2F 1FMWA 3DTEA 2V1UA 3HRUA 2FE3A 3BCAA 2X9DA 5GAEJ 1JKPC 1R22A 3HUGB 3GTJJ 2M9HA 1EH7A 2FXAA 1MMGA 3CO6C 2HWVA 2ZXIA 4RB2C 1Q1VA 3C2GA 3P9CA 4RBOA 4LIUA 2DFEA 1BR4A 5E79C 3HM5A 5FLXK 4ZZDA 2XGCA 1X1DA 1YI2I 4KISA 1VQMI 2OF7A 3C1DA 2JA8J 2EV0A 3RIRA 1O7FA 3K0LA 4MQVA 1OLTA 3LFKA 1WJ5A 1B9MA 5AIPA 5FD5A 3ZMTA 1FOKA 2DTRA 1N25A 3BJ6A 1R00A 2IGNA 1W7PD 5FRNA 3K4JA 1YYVA 5F0HA 1FYKA 2LBFA 1AKHB 1PUEE 2ICWG 2KT0A 3JAMK 2UV1A 3DCFA 3IWFA 2JPBA 4KNYA 2LKPA 1OQYA 2WWYA 2WV0A 4RM2A 1HKSA 3R0AA 1WJAA 2MG4A 5F64A 4PJLA 3J7AY 4M3FA 3ABLH 3W2WA 4RLFA 1O4XA 1TQMA 4CUGA 1VFCA 1VQKI 2ETHA 4M6XA 2R7DA 3BG6A 3FKJA 1S72I 2EBIA 3FBIB 4E7JA 2DTZA 2XASA 3OYCA 1JXSA 2CW7A 4ZH4F 3JRIA 4NQWA 1TP4A 3S3OA 2IS2A 3CDHA 3GZNB 3TOAA 1ZTRA 4CGZA 3LSIA 1IRGA 3HRTA 3DTIA 1OR7A 1ZRDA 5B1AH 3L2VA 3I9V2 1VI0A 1TQIA 2HOSA 4G7ZF 2HQRA 2UXNA 5CJ9A 1YS6A 2GBYA 1XB4A 1OYIA 2VXZA 4F7ZA 4KN4X 4RGXA 2CH0A 2HXIA 4LFUA 2EFOA 3FMRA 4LLLA 3GTQJ 2HYJA 3EQLF 4HNUA 4ZTJA 2GIZA 4FE4A 2GXBA 1FX7A 4EJUA 1ZLKA 2ZJPF 3U2RA 5D6FA 2YU3A 2DDAA 4A0ZA 4IQ4A 2VBXA 4AUXA 3GF2A 2XRLA 4HSTA 5L3CA 2P7VB 3JREA 1TTYA 2CFOA 3HOTA 2JVGA 2QM3A 2IGKA 4DW6A 4IHVA 4P5OA 2L02A 2HGCA 1D1CA 3M1EA 1YHQI 2KJCA 1YX5A 4AYBN 2Q0OA 2VJIA 5IT9K 2IGMA 3CO7C 2K27A 1ONVA 2QENA 2QQAA 5FKLA 2BXYA 5EF6A 1R49A 1TC3C 2M87A 3IP4B 2F4MB 4S04A 3IUOA 4A3IJ 1ZHFA 2UXXA 2WAQN 3RKXA 4A12A 2W24A 2BE5F 5IYCJ 4BEHA 2UUZA 3ECOA 4HSRA 2STTA 4IHXA 1W4MA 3WGHA 2JTVA 1CQTA 3Q9VA 4UUSA 5KVRA 3QOPA 4FHTA 4HG2A 1YQAA 4F91B 2GM4A 5LGNA 2VUMJ 1ON2A 2IJLA 4G94A 2XROA 3ML6A 1I27A 1SAXA 1IF1A 3I4MJ 3CCSI 4BACA 2ZXHA 3FXLA 2M30A 4C30A 1XGNA 2GOXB 2RVCA 1UB9A 5IOZA 1I3QJ 2YU9J 2H6BA 4RLQA 3PO2J 4BY1J 1Y1WJ 3TOBA 2DOAA 2EZLA 2JA6J 3UNGC 5KK1A 5DTDA 1APLC 3WTZA 1LDKB 5E3LA 4LOCA 3OYLA 1MBKA 3NARA 4A5NA 2HI3A 2XAGA 3K4LA 4FCYA 2R7QA 5LEKA 1YOVB 2V4JC 4YELA 2QBYB 3A2KA 2VJ4A 2XIGA 1D5YA 2XPWA 2W7NA 1UG2A 4IQJA 3JTGA 3KYLA 5CYVA 5BOXA 3KP7A 1T38A 2L01A 4IO9F 4E7LA 3A03A 5JVGF 2QCOA 2R0QC 4M9ZA 2IS1A 3RYRA 1HC8A 3LNQA 1HQCA 2JUCA 2X6OA 3K1PA 4M6VA 1NG6A 1N75A 3FMQA 5J3LA 3L9FA 2MFZA 1P9QC 3ZXSA 3RPQA 3O2PE 3KZIC 3ULQB 3J81Z 1YJ9I 4BHCA 5BMZA 4G7OF 1QZEA 2NNYA 2DOFA 2ZMEA 2IA1A 1XC5A 2YX7A 2KZGA 4HYEA 2R7UA 2MBFA 5DUKA 2QGUA 3L7WA 3HHGA 2ZNYA 2E2IJ 2Z99A 2ZO4A 1MDMB 3CCRI 1IXSB 2IGOA 2H1LA 4L5IA 3S2HJ 2VKDA 3C3WA 3RYPA 1RRJA 3A0BC 4RB3C 2NS0A 2KZVA 1PUFA 2IP2A 3QU3A 4V2FA 1MGTA 4LG0A 4X6AJ 1NTCA 3QPLA 1MMNA 2R7TA 2W4SA 3EDPA 4XMYA 1FMVA 4AVZA 2JT1A 4HW0A 4R8HA 4CCJA 2L54A 4XLFA 3BZKA 2OQGA 4PK4A 1HF0A 2DA4A 1B72A 1Z7LA 2R5YB 2DO7A 3IAM2 5CVIA 3WTVC 1I3AA 5DDGA 4PJMA 3WE2A 3VFZA 4MO7A 1VQOI 3OMYA 1S9HA 3CTAA 2E1OA 3H0GJ 2A5YB 3FXKA 4BJTA 4BQQA 3S32A 1QGPA 2GA1A 4HQMA 5C4JJ 1IN4A 1ZGAA 4RMNA 1TWGJ 3GW2A 2FBKA 5D4RA 2OTJI 3EETA 2XKPA 1UG0A 3HG9A 1FOWA 2V6EA 2DOEA 1RKTA 3GCMA 3FXMA 3ZMVA 1ACIA 1T0FC 5LGUA 5J1YA 3LSRA 2MC4A 3CJNA 3PFIA 3L2RA 1JUSA 2R7RA 2LMDA 3TW7A 1X4OA 1A31A 4Q47A 4UVBA 4OU0A 3H3ZA 3OS1A 2HOEA 2DDBA 2M0MA 3S1NJ 1VF9A 2ZFWA 5IYBJ 4RS8A 4B48A 5E3MA 1WSUA 1EA3A 3VYTB 2VBYA 4XRMA 1S7AA 1R5ID 2JA5J 2FBHA 3IKTA 2A07F 5ILUA 2K40A 3DXJF 5EGOB 4XKVA 3TO6A 3OYGA 4G12A 4II2A 4EM0B 1P7JA 4IJAA 4BEHB 2DA2A 2E36A 2ZMEC 3FM3A 2ZSIB 4EV0A 4BAYA 2VKHA 3RQ4A 3CMYA 4CCLA 2NOJB 4FE7A 3T5XA 3LSKA 1QQIA 3MVPA 1N78A 2BBYA 2CV0A 2MD5A 5HDKA 1HA8A 2W82A 3OR2C 3AG1H 3KEQA 2DA7A 2NXNB 1ZRCA 3HOUJ 2VBWA 1AHDP 2L7MP 5CVJA 2DLLA 3HPHA 3VYRB 3F8BA 3TDZC 1JTYA 3CJQB 5FLXZ 3CUOA 1JGGA 1J09A 1ZK8A 3EUHC 1H88C 1ETYA 4M74A 2R7SA 3KYCB 2Z9OA 3GO5A 4ETSA 1LVAA
chains in the Genus database with same CATH topology
1D3YA 2KIMA 4DQ2A 4G6DA 3T8TA 2L4MA 1IZ1A 3K69A 2HDCA 2G7HA 4KICA 4L0ZB 2DBBA 2FSWA 2EK5A 4A2UA 4ASNA 1MZBA 2H27A 2PBIA 3HSEA 5ED4A 1QBJA 3ZMUA 4A0XA 2XV4S 3NEUA 4IHSA 2XAFA 3S2WA 5H20A 4OIQF 4BYYA 5FFXA 1S6LA 3BP8A 2LSOA 3F72A 1I5ZA 1JE8A 1LJ9A 2VT3A 2DW4A 4JQFA 3RKYA 3E5UA 2EFQA 2XAHA 2MA3A 1Z05A 4M6YA 5ICCA 2QUFA 5L3FA 4OIRF 3BZ6A 3COAC 5BPDA 1WI9A 5JR3A 4PDKA 2OA4A 2VT2A 2P4WA 2BYVE 1U5TC 2QLZA 4D0PA 1JGSA 3E97A 4GYIA 3G73A 2GIVA 4AIKA 5E8GA 1KQ9A 4M72A 1DDNA 2A6EF 4EVIA 1DP7P 2V9VA 4A6DA 1FSEA 1OMIA 2W85A 4MHGA 1D8JA 2D45A 1MD0A 3WTTC 1J7KA 1KYWA 4HV5A 3IKVA 2P7CB 1BIAA 1O3TA 2LDUA 4PCQA 3DF8A 3SZTA 1R23A 2UWMA 2GWRA 4KMUX 4UV8A 3V7CA 2FMYA 4Q4ZF 1MJAA 2Y75A 1U6GA 3GFJA 4L9JA 2PQ8A 3RPUA 2FMLA 1HW5A 1WQ2A 4EMSA 4OMZA 3CUQB 5K5QA 4ENMA 4WX9A 2J5OA 5D5VB 5CLSA 2VONA 2NYXA 2LF7A 2QQ9A 5LHIA 3DFGA 1J2XA 3ABUA 1IXCA 4CXFA 4MQ9F 2H6CA 4EJWA 1DUXC 1IAWA 1QZYA 5HS8A 4B09A 1EH6A 1U2WA 3JAMZ 3E6CC 2TDXA 4OIPF 3M9AA 2CWEA 3BPXA 3DV8A 3KEOA 2EFPA 1IXRC 1TNSA 3BY6A 4U7DA 3FXRA 3V8JA 3GXOA 3F22A 1F9NA 2QQBA 2O8XA 3K2ZA 3EYYA 2MH2A 1IN8A 2P5KA 5FB2A 4MGRA 2CQKA 2XVCA 4M73A 2FEZA 4Q48A 3DKWA 1FSHA 2PJPA 4GO1A 4CICA 3QRFF 4RGRA 3ZMZA 1YTYA 2EWNA 1FYLA 1YW8A 3WGIA 3GLXA 1FBUA 4BNCA 3GFMA 2M45A 4XSZF 3IL2A 3BJOA 3WTWC 2Z33A 1GXQA 4HX7A 3DPLC 1Z6RA 4LLNA 5D8KB 1ZGJA 3O6BB 1SFEA 3MWMA 3R4KA 2KIFA 3HIFA 4GYGA 1IN6A 1RIOH 4EQQA 1SFUA 2DFIA 4LD5A 1SMYF 3KP6A 4GXOA 4Q5SF 3GYHX 3KLNA 3ABTA 2VC0A 3W6JB 2RDPA 4HF0A 3V4GA 1LQ1A 1U5TB 1ZN2A 3E5XA 1RUOA 1S7OA 3FHZA 2MC3A 1R58A 4JBAA 4LK1F 1K78B 1FWZA 3SQNA 4RAYA 4UV9A 2VODA 3B02A 2Q8KA 3F8MA 3GX4X 1XN7A 5JHUA 3H92A 4JK1X 1SD6A 3OV8A 1AOYA 3BDDA 3ELKA 4U0YA 4O6JA 1BM9A 1EH8A 2P5LC 3AAFA 1KU2A 3GZ5A 1BN5A 1SFXA 4N0BA 5E20A 3FZVA 3GFIA 3FX3A 2VOPA 1R7JA 5FFZA 4ESFA 5DD8A 1D5VA 4A5MA 2LNBA 1IN7A 4BHPA 2PMHA 4EM2A 5HOOA 1TQPA 1WKMA 3TQNA 4EJVA 2QZ8A 3E6MA 4QLCU 1Z7UA 2K7LA 5F6FA 4OIOF 3KP5A 3IC7A 5D5UB 3IRRA 1K6OA 2BGCA 3FXUA 1CGPA 1HXDA 5H6QA 2K86A 3GVAA 4CDGA 1O57A 2E7WA 5HDGA 4OINF 1V3FA 2F5EA 2O61A 1FNNA 3LA7A 3J80Z 1U78A 1XD7A 3N97A 2Q2EA 1XSDA 2FA5A 1BC8C 4AIHA 2RQPA 1XSVA 2UZKA 3KCCA 3LAJA 4I2OA 3QPTA 4BQAA 1IRFA 2DT5A 4HOBA 3ROUA 1B9NA 5JVTA 1G4DA 3K1NA 1O3SA 1O3QA 4TV7A 4WXCA 1Q1HA 5HS7A 1G3WA 3NRVA 3BOQA 1ZLJA 4FX4A 3VEPA 2WTEA 4L0YB 1R5GA 1MDMA 2R3SA 3LWFA 5HLHA 3GUDA 4RGUA 4IPAA 4L18B 2COMA 3V7RA 3CLOA 2HKOA 4KFCA 2H09A 3ZMSA 1T39A 4AVPA 4WXDA 3WODF 2EJRA 1GXPA 1H0MA 1REPC 4XSXF 4M71A 2EV6A 2EFNA 2PEXA 2STWA 2GZWA 4UHTA 4PZJA 2X4HA 1UHWA 3HSFA 2MLGA 1MKMA 5D6EA 1YO5C 2OAZA 4UUVA 3JSPA 3BPVA 4KA4A 5JI6A 5ICGA 1R36A 1HSJA 5D5XB 1XCBA 2EV5A 5FO5A 3QP5A 3J7AO 2A68F 1TW2A 3D5LA 1EV7A 1ZG3A 4IF4A 2MH9A 1R1UA 2EFWA 3LA3A 1KU3A 2IW5A 1BI0A 2AXLA 3HHHA 3U9GA 2OU2A 1ZRFA 4HLYA 5DUIA 4EGYA 1HSTA 2KIUA 4CYDA 2VC1A 2DK5A 3QP6A 2W25A 1Z1DA 2XKOA 5D8LB 3RTRA 4UVAA 2DQLA 4LLGF 2MLKA 1GHCA 5LHGA 3F21A 4IRGA 1STZA 4AD9A 3FWEA 2F2EA 5ILVA 4MEYF 4LMYA 3E5QA 4YIFA 1Z6TA 4UXNA 1PP7U 5L3GA 3M8EA 4QWQA 2RV8A 1W5TA 3K9TA 2W57A 5K5OA 5BQTA 1L0OC 5E1WA 1XDUA 3I59A 5J8CA 4CHUA 2M1BA 4AWXB 1E2XA 2J5PA 4I02A 1XCVA 5HDNA 1OKRA 3W6KB 4CZZA 2K02A 3GEZA 1GVJA 4IRHA 3DPTA 3P9IA 3V8LA 1P6RA 1IN5A 3C7JA 5JFRA 2O03A 2YR2A 1QZZA 1BI3A 3VB2A 4ENJA 1BJAA 4HX8A 2KRFA 3DP7A 2IPQX 1RI7A 4BH9A 1LB2A 2Z5UA 2L3DA 2V1DA 2IA2A 4EJOA 3ZPLA 3IHUA 3WTSC 1J0RA 3LSTA 3QU6A 4KDPA 4HDVA 3KZZA 1TLHB 1P92A 2YX4A 5D4SA 3WE3A 2VE9A 3BWGA 3F6VA 1HW2A 4G8XA 4KIGA 4IRIA 1TNTA 2CO5A 2D2WA 3SHFA 3KP2A 3TO9A 4RB1A 1LEAA 4L5JA 3TO7A 4LK0F 3I59B 1BI1A 3KP4A 4I0BA 2RKHA 4HX4A 1XDSA 1ZAOA 4LG0B 3OOPA 2GXGA 1P2FA 1USTA 4Z2YA 1L3LA 1XMAA 3MZYA 2NNNA 4LB6B 4ZYDA 4HBLA 2ISYA 5H6RA 3J80K 1ZYRF 2ESHA 1FY7A 4XBFA 1I1GA 2D1VA 1K7AA 4HV6A 3WGGA 5K5RA 3I64A 3ZQ7A 3LQQA 1V4RA 3U1DA 5IT3A 1W7PB 2O6GE 3I53A 3WU0A 2VE8A 4WF2A 4LGWA 2M5WA 1ZREA 4ZYGA 1OYWA 1VTNC 4OOIA 4I09A 5E1XA 5A2QZ 1B1BA 2ZNZA 1WWXA 5DD4A 1FC3A 3I5UA 3HSRA 1ULYA 4EM1A 1H9TA 5L3DA 5J8FA 1RNLA 2OZ6A 4YFNF 4MTEA 2QYOA 4P96A 1H9GA 1FP2A 5HS9A 1FZPB 1KA8A 3MEXA 3TGNA 4IVNA 4S05A 3FMSA 3L2CA 6PAXA 4HLXA 3K1MA 2GA2A 3HOSA 1K79A 3F6OA 4UNOA 2VN2A 3HTUA 1YS7A 2EB7A 2RC4A 1LEBA 2NRAC 1W7PA 1ZARA 4KIFA 4KUMA 5D5WB 2K4BA 4AIJA 3R6SA 3WTXC 1HKQA 1R1VA 2RGVA 2JZYA 2ELHA 4FX0A 1BIBA 3MCZA 1SMTA 2HZTA 5LBQA 4PGHA 1BBYA 3LAPA 3REOA 2CSOA 1MJBA 2BEOA 4LB5A 5DCMB 2QWWA 3FXQA 2BV6A 1YG2A 3NQOA 5LGTA 4WWCA 3L00A 1G3TA 4O3MA 3M8FA 4H0EA 5HVQC 1SD7A 1A04A 5LRSA 5LRRA 4HF1A 2DAOA 4RAZA 4KMFA 4HZFA 3SZPA 3TKYA 4R79A 1U3EM 4R1HA 4G6QA 1G3YA 2CGPA 1P4WA 3I0TA 3HRSA 5L3BA 4IXAA 5E17F 5CVRA 3KE2A 3R61A 2NAZA 3BROA 3RKWA 1KQ0A 2FBIA 2P5VA 4ZYEA 1FLIA 4GGGA 3IRQA 3MAJA 5HLGA 3KLOA 3ZP5A 4BXUA 2W84A 4U0WA 3R60A 1FYMA 2PI0A 4EJTA 1TW3A 3MQ0A 5FD6A 1KYZA 1S8NA 1YLFA 1S3JA 1B4AA 2B0LA 3WTYC 2YPRA 2QVOA 2ACJA 2DPDA 3KFWX 1R5HA 4YFXF 1CF7B 1S29A 3WU1B 5LLQA 1UHMA 1HBXG 5BS6A 2M8EA 4OMYA 4KT5C 2ZBKA 4A6EA 5DCMA 5FGMA 2H94A 1U5TA 2HEOA 1HKTA 5L3EA 2VBZA 3IWZA 1ZG1A 5E18F 2ZMEB 1KGSA 1RUNA 2IA0A 5CVVA 5LEJA 4KIBA 3JTHA 2IRFG 4ON0A 1FBQA 2L4AA 4P9FA 3GZ6A 1ODDA 3ZN0A 4HF2A 4HA8A 2CYYA 2G9WA 4O5VA 5E8IA 2DI3A 1F5TA 2A69F 3N4MA 2XUBA 1JHHA 2E1CA 2PN6A 4DNCA 2DQRA 2FU4A 1R1TA 1XGMA 5ICEA 1W5SA 4WK8F 3SFZA 3MFKA 2ZKZA 3QAHA 3SXYA 3I58A 3JW4A 2ESNA 4RB0A 1FP1D 3ZN1A 3C18A 2V6CA 1O3RA 2E7XA 1P4AA 3HYIA 2A6HF 3RJPA 4PGGA 5ERIA 2OBPA 1Y0UA 2A3SA 5A2QK 4MTDA 4BHBA 2CW0F 3I4PA 5IT9Z 1TBXA 2JPCA 3GFLA 4WXHA 4U88A 1ZH5A 1SD5A 2Y48A 3H3UA 4ZZLA 5ICFA 2RNJA 3TDUC 5LHHA 1LDJA 5AONA 2XAJA 3F8NA 3T0YA 2GQQA 2HS5A 4XRFA 3CUQA 1G3SA 3B73A 2F5DA 4I98B 3PQKA 2XRNA 3PQJA 5EEGA 3HTSB 5E1ZB 2HR3A 1QO0D 4IHTA 2K4JA 2F5CA 1B59A 1CF7A 1AWCA 2O3FA 3Q5FA 2PLYA 3ISPA 1OPCA 4FT8A 4U7BA 1FPQA 4ENKA 3RDIA 1OYYA 4UVCA 1YFHA 1J75A 5DEQA 1JHFA 4XLPF 2V1XA 2R7FA 3J81K 1SD4A 1XMKA 3O3KA 4RGSA 4M9SA 4KYWA 3M7GA 3KP3A 1I6XA 1E17A 4Y15A 1XSXA 2PFBA 3F8CA 4L9TA 1T2KA 4L9NA 2DPUA 1T6SA 4I01A 1DPRA 2P8TA 2HFHA 3G3ZA 1YW9A 2EA4A 2Z3YA 4HDUA 1T98A 4Y17A 3ERED 3HUGA 4KN7X 5TJJA 1UCRA 3LA2A 5ILSA 3MZHA 4EGZA 1Z91A 3VODA 2FNPA 4XLNF 1O7LA 3P7NA 5DV5A 3HRMA 2KKOA 2WC2A 2IVMA 3LQRA 2HKXA 4B8XA 2PMUA 3FF5A 2P6TA 1BI2A 2XGXA 4N9IA 2CFXA 5EEHA 3Q9SA 4YIIA 2ADUA 1K78A 2CG4A 2A61A 2RN7A 1PDNC 4U0VA 3F3XA 4GCVA 1MJ9A 4G9YA 2ZCWA 3P9KA 5BPIA 4LJZF 4I7HA 5TRDA 2FF4A 3DEUA 1ON1A 1BC7C 4MNUA 4A0YA 1YW7A 4YFKF 2E1NA 3BJAA 3V8KA 1USSA 2O0YA 4ZYHA 4WCGA 1J59A 1I1SA 2JRTA 2V79A 3CUQC 4MEXF 1J5YA 2QBYA 2OQRA 2FRHA 3ZMDA 2F5FA 2IT0A 1B6AA 1FBSA 1P4XA 2ZXJA 4G7HF 5J6XA 2HTJA 4E70A 4P55A 1QPMA 2JSCA 1T0FA 1IUYA 3E3VA 1HW1A 1BOAA 1UFMA 1RZ4A 1FT9A 3E6DA 3GWZA 1PP8F 5HLIA 1NHAA 4Y13A 5F1RA 3QPHA 3JSOA 3F8FA 5CVUA 2YSRA 4ENNA 2X0LA 2ZJ2A 3T8RA 4K2EA 1J9IA 3ECHA 3RI4A 1LDDA 4HQEA 4ESBA 1C0WA 3VOEA 5K1YA 2P6SA 3E6BA 2ISZA 4P9UA 2XAQA 2DK8A 2HTSA 3EYIA 3WG9A 2OD5A 3V7SA 3I54A 4ESJA 2LF8A 3KZYA 1D8KA 3EUHA 1F1ZA 3WTUC 4NB5A 1XGSA 1QNTA 2HYFA 3L09A 2EA2A 4N9HA 3I71A 1X3UA 2OZUA 2G7UA 4I0AA 1KU7A 4NHJA 1KQ8A 2Y0MA 4CO8A 3FM5A 1IW7F 1WRJA 2FQ3A 2C6YA 4M9XA 3DQVC 2GAUA 2FNAA 1KU9A 4L9VA 2XHKA 2VOOA 3KETA 1DPUA 1U8RA 1Z9CA 1YIOA 1LNWA 2HQNA 3R0JA 2HYGD 3F23A 2DU9A 1F4KA 3T1BA 3D0SA 2PG4A 2KJBA 5DYMA 2FOKA 5DCFA 5AIQA 2D1HA 2AS5F 1G6NA 1XGOA 4HAMA 1ZG5A 4YG2F 2V1UA 3HRUA 2FE3A 1R22A 1EH7A 2FXAA 3CO6C 2HWVA 4RB2C 3P9CA 5FLXK 4ZZDA 3C1DA 2EV0A 3RIRA 1O7FA 3K0LA 4MQVA 3LFKA 5AIPA 1B9MA 1FOKA 5FD5A 3ZMTA 2DTRA 3BJ6A 1R00A 1W7PD 1YYVA 1FYKA 1PUEE 3JAMK 3IWFA 2JPBA 4KNYA 2LKPA 2WWYA 2WV0A 1HKSA 3R0AA 5F64A 1TQMA 2ETHA 4M6XA 2R7DA 2XASA 1JXSA 4ZH4F 4NQWA 3CDHA 3TOAA 4CGZA 1IRGA 3HRTA 1OR7A 1ZRDA 1TQIA 4G7ZF 2HQRA 2UXNA 5CJ9A 1YS6A 1XB4A 1OYIA 2VXZA 4F7ZA 4KN4X 4RGXA 4LFUA 2EFOA 3FMRA 4LLLA 3EQLF 2GXBA 1ZLKA 1FX7A 4EJUA 3U2RA 5D6FA 2YU3A 4A0ZA 2VBXA 3GF2A 5L3CA 2P7VB 3HOTA 1TTYA 2QM3A 4P5OA 2L02A 2HGCA 3M1EA 2KJCA 2Q0OA 5IT9K 3CO7C 2K27A 1ONVA 2QENA 2QQAA 2M87A 4S04A 1ZHFA 2UXXA 3RKXA 4A12A 2W24A 2BE5F 3ECOA 2STTA 1W4MA 3WGHA 2JTVA 3Q9VA 5KVRA 3QOPA 4FHTA 1YQAA 5LGNA 1ON2A 2IJLA 4G94A 2XROA 3ML6A 1I27A 1SAXA 1IF1A 2M30A 1XGNA 2RVCA 1UB9A 2H6BA 3TOBA 5KK1A 3WTZA 1LDKB 4A5NA 2XAGA 5LEKA 2QBYB 2XIGA 3JTGA 5CYVA 5BOXA 3KP7A 1T38A 2L01A 4M9ZA 3RYRA 1HQCA 3K1PA 3FMQA 3L9FA 3RPQA 3O2PE 3ULQB 3J81Z 4BHCA 5BMZA 4G7OF 2NNYA 2ZMEA 2IA1A 2YX7A 4HYEA 2MBFA 5DUKA 3L7WA 3HHGA 2ZNYA 2Z99A 2ZO4A 1MDMB 1IXSB 4L5IA 3C3WA 3RYPA 4RB3C 2NS0A 2IP2A 3QU3A 1MGTA 4LG0A 3EDPA 2JT1A 4HW0A 4R8HA 2L54A 2OQGA 2DO7A 5CVIA 3WTVC 5DDGA 3WE2A 3VFZA 3CTAA 2A5YB 1QGPA 2GA1A 4HQMA 1IN4A 1ZGAA 3GW2A 2FBKA 5D4RA 3EETA 2XKPA 3ZMVA 5LGUA 3CJNA 3PFIA 4Q47A 4UVBA 4OU0A 3H3ZA 2HOEA 2ZFWA 4RS8A 1WSUA 2VBYA 1S7AA 2FBHA 3IKTA 2A07F 5ILUA 3DXJF 3TO6A 4EM0B 4IJAA 3FM3A 4EV0A 4BAYA 3T5XA 1QQIA 2BBYA 2MD5A 5HDKA 3KEQA 1ZRCA 2VBWA 5CVJA 2DLLA 3F8BA 3TDZC 5FLXZ 3CUOA 4M74A 2Z9OA 3GO5A 4ETSA 1LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3Y A;  2KIM A;  4DQ2 A;  4G6D A;  3T8T A;  2L4M A;  1IZ1 A;  3K69 A;  2HDC A;  2G7H A;  4KIC A;  4L0Z B;  2DBB A;  2FSW A;  2EK5 A;  4A2U A;  4ASN A;  1MZB A;  2H27 A;  2PBI A;  3HSE A;  5ED4 A;  1QBJ A;  3ZMU A;  4A0X A;  2XV4 S;  3NEU A;  4IHS A;  2XAF A;  3S2W A;  5H20 A;  4OIQ F;  4BYY A;  5FFX A;  1S6L A;  3BP8 A;  2LSO A;  3F72 A;  1I5Z A;  1JE8 A;  1LJ9 A;  2VT3 A;  2DW4 A;  4JQF A;  3RKY A;  3E5U A;  2EFQ A;  2XAH A;  2MA3 A;  1Z05 A;  4M6Y A;  5ICC A;  2QUF A;  5L3F A;  4OIR F;  3BZ6 A;  3COA C;  5BPD A;  1WI9 A;  5JR3 A;  4PDK A;  2OA4 A;  2VT2 A;  2P4W A;  2BYV E;  1U5T C;  2QLZ A;  4D0P A;  1JGS A;  3E97 A;  4GYI A;  3G73 A;  2GIV A;  4AIK A;  5E8G A;  1KQ9 A;  4M72 A;  1DDN A;  2A6E F;  4EVI A;  1DP7 P;  2V9V A;  4A6D A;  1FSE A;  1OMI A;  2W85 A;  4MHG A;  1D8J A;  2D45 A;  1MD0 A;  3WTT C;  1J7K A;  1KYW A;  4HV5 A;  3IKV A;  2P7C B;  1BIA A;  1O3T A;  2LDU A;  4PCQ A;  3DF8 A;  3SZT A;  1R23 A;  2UWM A;  2GWR A;  4KMU X;  4UV8 A;  3V7C A;  2FMY A;  4Q4Z F;  1MJA A;  2Y75 A;  1U6G A;  3GFJ A;  4L9J A;  2PQ8 A;  3RPU A;  2FML A;  1HW5 A;  1WQ2 A;  4EMS A;  4OMZ A;  3CUQ B;  5K5Q A;  4ENM A;  4WX9 A;  2J5O A;  5D5V B;  5CLS A;  2VON A;  2NYX A;  2LF7 A;  2QQ9 A;  5LHI A;  3DFG A;  1J2X A;  3ABU A;  1IXC A;  4CXF A;  4MQ9 F;  2H6C A;  4EJW A;  1DUX C;  1IAW A;  1QZY A;  5HS8 A;  4B09 A;  1EH6 A;  1U2W A;  3JAM Z;  3E6C C;  2TDX A;  4OIP F;  3M9A A;  2CWE A;  3BPX A;  3DV8 A;  3KEO A;  2EFP A;  1IXR C;  1TNS A;  3BY6 A;  4U7D A;  3FXR A;  3V8J A;  3GXO A;  3F22 A;  1F9N A;  2QQB A;  2O8X A;  3K2Z A;  3EYY A;  2MH2 A;  1IN8 A;  2P5K A;  5FB2 A;  4MGR A;  2CQK A;  2XVC A;  4M73 A;  2FEZ A;  4Q48 A;  3DKW A;  1FSH A;  2PJP A;  4GO1 A;  4CIC A;  3QRF F;  4RGR A;  3ZMZ A;  1YTY A;  2EWN A;  1FYL A;  1YW8 A;  3WGI A;  3GLX A;  1FBU A;  4BNC A;  3GFM A;  2M45 A;  4XSZ F;  3IL2 A;  3BJO A;  3WTW C;  2Z33 A;  1GXQ A;  4HX7 A;  3DPL C;  1Z6R A;  4LLN A;  5D8K B;  1ZGJ A;  3O6B B;  1SFE A;  3MWM A;  3R4K A;  2KIF A;  3HIF A;  4GYG A;  1IN6 A;  1RIO H;  4EQQ A;  1SFU A;  2DFI A;  4LD5 A;  1SMY F;  3KP6 A;  4GXO A;  4Q5S F;  3GYH X;  3KLN A;  3ABT A;  2VC0 A;  3W6J B;  2RDP A;  4HF0 A;  3V4G A;  1LQ1 A;  1U5T B;  1ZN2 A;  3E5X A;  1RUO A;  1S7O A;  3FHZ A;  2MC3 A;  1R58 A;  4JBA A;  4LK1 F;  1K78 B;  1FWZ A;  3SQN A;  4RAY A;  4UV9 A;  2VOD A;  3B02 A;  2Q8K A;  3F8M A;  3GX4 X;  1XN7 A;  5JHU A;  3H92 A;  4JK1 X;  1SD6 A;  3OV8 A;  1AOY A;  3BDD A;  3ELK A;  4U0Y A;  4O6J A;  1BM9 A;  1EH8 A;  2P5L C;  3AAF A;  1KU2 A;  3GZ5 A;  1BN5 A;  1SFX A;  4N0B A;  5E20 A;  3FZV A;  3GFI A;  3FX3 A;  2VOP A;  1R7J A;  5FFZ A;  4ESF A;  5DD8 A;  1D5V A;  4A5M A;  2LNB A;  1IN7 A;  4BHP A;  2PMH A;  4EM2 A;  5HOO A;  1TQP A;  1WKM A;  3TQN A;  4EJV A;  2QZ8 A;  3E6M A;  4QLC U;  1Z7U A;  2K7L A;  5F6F A;  4OIO F;  3KP5 A;  3IC7 A;  5D5U B;  3IRR A;  1K6O A;  2BGC A;  3FXU A;  1CGP A;  1HXD A;  5H6Q A;  2K86 A;  3GVA A;  4CDG A;  1O57 A;  2E7W A;  5HDG A;  4OIN F;  1V3F A;  2F5E A;  2O61 A;  1FNN A;  3LA7 A;  3J80 Z;  1U78 A;  1XD7 A;  3N97 A;  2Q2E A;  1XSD A;  2FA5 A;  1BC8 C;  4AIH A;  2RQP A;  1XSV A;  2UZK A;  3KCC A;  3LAJ A;  4I2O A;  3QPT A;  4BQA A;  1IRF A;  2DT5 A;  4HOB A;  3ROU A;  1B9N A;  5JVT A;  1G4D A;  3K1N A;  1O3S A;  1O3Q A;  4TV7 A;  4WXC A;  1Q1H A;  5HS7 A;  1G3W A;  3NRV A;  3BOQ A;  1ZLJ A;  4FX4 A;  3VEP A;  2WTE A;  4L0Y B;  1R5G A;  1MDM A;  2R3S A;  3LWF A;  5HLH A;  3GUD A;  4RGU A;  4IPA A;  4L18 B;  2COM A;  3V7R A;  3CLO A;  2HKO A;  4KFC A;  2H09 A;  3ZMS A;  1T39 A;  4AVP A;  4WXD A;  3WOD F;  2EJR A;  1GXP A;  1H0M A;  1REP C;  4XSX F;  4M71 A;  2EV6 A;  2EFN A;  2PEX A;  2STW A;  2GZW A;  4UHT A;  4PZJ A;  2X4H A;  1UHW A;  3HSF A;  2MLG A;  1MKM A;  5D6E A;  1YO5 C;  2OAZ A;  4UUV A;  3JSP A;  3BPV A;  4KA4 A;  5JI6 A;  5ICG A;  1R36 A;  1HSJ A;  5D5X B;  1XCB A;  2EV5 A;  5FO5 A;  3QP5 A;  3J7A O;  2A68 F;  1TW2 A;  3D5L A;  1EV7 A;  1ZG3 A;  4IF4 A;  2MH9 A;  1R1U A;  2EFW A;  3LA3 A;  1KU3 A;  2IW5 A;  1BI0 A;  2AXL A;  3HHH A;  3U9G A;  2OU2 A;  1ZRF A;  4HLY A;  5DUI A;  4EGY A;  1HST A;  2KIU A;  4CYD A;  2VC1 A;  2DK5 A;  3QP6 A;  2W25 A;  1Z1D A;  2XKO A;  5D8L B;  3RTR A;  4UVA A;  2DQL A;  4LLG F;  2MLK A;  1GHC A;  5LHG A;  3F21 A;  4IRG A;  1STZ A;  4AD9 A;  3FWE A;  2F2E A;  5ILV A;  4MEY F;  4LMY A;  3E5Q A;  4YIF A;  1Z6T A;  4UXN A;  1PP7 U;  5L3G A;  3M8E A;  4QWQ A;  2RV8 A;  1W5T A;  3K9T A;  2W57 A;  5K5O A;  5BQT A;  1L0O C;  5E1W A;  1XDU A;  3I59 A;  5J8C A;  4CHU A;  2M1B A;  4AWX B;  1E2X A;  2J5P A;  4I02 A;  1XCV A;  5HDN A;  1OKR A;  3W6K B;  4CZZ A;  2K02 A;  3GEZ A;  1GVJ A;  4IRH A;  3DPT A;  3P9I A;  3V8L A;  1P6R A;  1IN5 A;  3C7J A;  5JFR A;  2O03 A;  2YR2 A;  1QZZ A;  1BI3 A;  3VB2 A;  4ENJ A;  1BJA A;  4HX8 A;  2KRF A;  3DP7 A;  2IPQ X;  1RI7 A;  4BH9 A;  1LB2 A;  2Z5U A;  2L3D A;  2V1D A;  2IA2 A;  4EJO A;  3ZPL A;  3IHU A;  3WTS C;  1J0R A;  3LST A;  3QU6 A;  4KDP A;  4HDV A;  3KZZ A;  1TLH B;  1P92 A;  2YX4 A;  5D4S A;  3WE3 A;  2VE9 A;  3BWG A;  3F6V A;  1HW2 A;  4G8X A;  4KIG A;  4IRI A;  1TNT A;  2CO5 A;  2D2W A;  3SHF A;  3KP2 A;  3TO9 A;  4RB1 A;  1LEA A;  4L5J A;  3TO7 A;  4LK0 F;  3I59 B;  1BI1 A;  3KP4 A;  4I0B A;  2RKH A;  4HX4 A;  1XDS A;  1ZAO A;  4LG0 B;  3OOP A;  2GXG A;  1P2F A;  1UST A;  4Z2Y A;  1L3L A;  1XMA A;  3MZY A;  2NNN A;  4LB6 B;  4ZYD A;  4HBL A;  2ISY A;  5H6R A;  3J80 K;  1ZYR F;  2ESH A;  1FY7 A;  4XBF A;  1I1G A;  2D1V A;  1K7A A;  4HV6 A;  3WGG A;  5K5R A;  3I64 A;  3ZQ7 A;  3LQQ A;  1V4R A;  3U1D A;  5IT3 A;  1W7P B;  2O6G E;  3I53 A;  3WU0 A;  2VE8 A;  4WF2 A;  4LGW A;  2M5W A;  1ZRE A;  4ZYG A;  1OYW A;  1VTN C;  4OOI A;  4I09 A;  5E1X A;  5A2Q Z;  1B1B A;  2ZNZ A;  1WWX A;  5DD4 A;  1FC3 A;  3I5U A;  3HSR A;  1ULY A;  4EM1 A;  1H9T A;  5L3D A;  5J8F A;  1RNL A;  2OZ6 A;  4YFN F;  4MTE A;  2QYO A;  4P96 A;  1H9G A;  1FP2 A;  5HS9 A;  1FZP B;  1KA8 A;  3MEX A;  3TGN A;  4IVN A;  4S05 A;  3FMS A;  3L2C A;  6PAX A;  4HLX A;  3K1M A;  2GA2 A;  3HOS A;  1K79 A;  3F6O A;  4UNO A;  2VN2 A;  3HTU A;  1YS7 A;  2EB7 A;  2RC4 A;  1LEB A;  2NRA C;  1W7P A;  1ZAR A;  4KIF A;  4KUM A;  5D5W B;  2K4B A;  4AIJ A;  3R6S A;  3WTX C;  1HKQ A;  1R1V A;  2RGV A;  2JZY A;  2ELH A;  4FX0 A;  1BIB A;  3MCZ A;  1SMT A;  2HZT A;  5LBQ A;  4PGH A;  1BBY A;  3LAP A;  3REO A;  2CSO A;  1MJB A;  2BEO A;  4LB5 A;  5DCM B;  2QWW A;  3FXQ A;  2BV6 A;  1YG2 A;  3NQO A;  5LGT A;  4WWC A;  3L00 A;  1G3T A;  4O3M A;  3M8F A;  4H0E A;  5HVQ C;  1SD7 A;  1A04 A;  5LRS A;  5LRR A;  4HF1 A;  2DAO A;  4RAZ A;  4KMF A;  4HZF A;  3SZP A;  3TKY A;  4R79 A;  1U3E M;  4R1H A;  4G6Q A;  1G3Y A;  2CGP A;  1P4W A;  3I0T A;  3HRS A;  5L3B A;  4IXA A;  5E17 F;  5CVR A;  3KE2 A;  3R61 A;  2NAZ A;  3BRO A;  3RKW A;  1KQ0 A;  2FBI A;  2P5V A;  4ZYE A;  1FLI A;  4GGG A;  3IRQ A;  3MAJ A;  5HLG A;  3KLO A;  3ZP5 A;  4BXU A;  2W84 A;  4U0W A;  3R60 A;  1FYM A;  2PI0 A;  4EJT A;  1TW3 A;  3MQ0 A;  5FD6 A;  1KYZ A;  1S8N A;  1YLF A;  1S3J A;  1B4A A;  2B0L A;  3WTY C;  2YPR A;  2QVO A;  2ACJ A;  2DPD A;  3KFW X;  1R5H A;  4YFX F;  1CF7 B;  1S29 A;  3WU1 B;  5LLQ A;  1UHM A;  1HBX G;  5BS6 A;  2M8E A;  4OMY A;  4KT5 C;  2ZBK A;  4A6E A;  5DCM A;  5FGM A;  2H94 A;  1U5T A;  2HEO A;  1HKT A;  5L3E A;  2VBZ A;  3IWZ A;  1ZG1 A;  5E18 F;  2ZME B;  1KGS A;  1RUN A;  2IA0 A;  5CVV A;  5LEJ A;  4KIB A;  3JTH A;  2IRF G;  4ON0 A;  1FBQ A;  2L4A A;  4P9F A;  3GZ6 A;  1ODD A;  3ZN0 A;  4HF2 A;  4HA8 A;  2CYY A;  2G9W A;  4O5V A;  5E8I A;  2DI3 A;  1F5T A;  2A69 F;  3N4M A;  2XUB A;  1JHH A;  2E1C A;  2PN6 A;  4DNC A;  2DQR A;  2FU4 A;  1R1T A;  1XGM A;  5ICE A;  1W5S A;  4WK8 F;  3SFZ A;  3MFK A;  2ZKZ A;  3QAH A;  3SXY A;  3I58 A;  3JW4 A;  2ESN A;  4RB0 A;  1FP1 D;  3ZN1 A;  3C18 A;  2V6C A;  1O3R A;  2E7X A;  1P4A A;  3HYI A;  2A6H F;  3RJP A;  4PGG A;  5ERI A;  2OBP A;  1Y0U A;  2A3S A;  5A2Q K;  4MTD A;  4BHB A;  2CW0 F;  3I4P A;  5IT9 Z;  1TBX A;  2JPC A;  3GFL A;  4WXH A;  4U88 A;  1ZH5 A;  1SD5 A;  2Y48 A;  3H3U A;  4ZZL A;  5ICF A;  2RNJ A;  3TDU C;  5LHH A;  1LDJ A;  5AON A;  2XAJ A;  3F8N A;  3T0Y A;  2GQQ A;  2HS5 A;  4XRF A;  3CUQ A;  1G3S A;  3B73 A;  2F5D A;  4I98 B;  3PQK A;  2XRN A;  3PQJ A;  5EEG A;  3HTS B;  5E1Z B;  2HR3 A;  1QO0 D;  4IHT A;  2K4J A;  2F5C A;  1B59 A;  1CF7 A;  1AWC A;  2O3F A;  3Q5F A;  2PLY A;  3ISP A;  1OPC A;  4FT8 A;  4U7B A;  1FPQ A;  4ENK A;  3RDI A;  1OYY A;  4UVC A;  1YFH A;  1J75 A;  5DEQ A;  1JHF A;  4XLP F;  2V1X A;  2R7F A;  3J81 K;  1SD4 A;  1XMK A;  3O3K A;  4RGS A;  4M9S A;  4KYW A;  3M7G A;  3KP3 A;  1I6X A;  1E17 A;  4Y15 A;  1XSX A;  2PFB A;  3F8C A;  4L9T A;  1T2K A;  4L9N A;  2DPU A;  1T6S A;  4I01 A;  1DPR A;  2P8T A;  2HFH A;  3G3Z A;  1YW9 A;  2EA4 A;  2Z3Y A;  4HDU A;  1T98 A;  4Y17 A;  3ERE D;  3HUG A;  4KN7 X;  5TJJ A;  1UCR A;  3LA2 A;  5ILS A;  3MZH A;  4EGZ A;  1Z91 A;  3VOD A;  2FNP A;  4XLN F;  1O7L A;  3P7N A;  5DV5 A;  3HRM A;  2KKO A;  2WC2 A;  2IVM A;  3LQR A;  2HKX A;  4B8X A;  2PMU A;  3FF5 A;  2P6T A;  1BI2 A;  2XGX A;  4N9I A;  2CFX A;  5EEH A;  3Q9S A;  4YII A;  2ADU A;  1K78 A;  2CG4 A;  2A61 A;  2RN7 A;  1PDN C;  4U0V A;  3F3X A;  4GCV A;  1MJ9 A;  4G9Y A;  2ZCW A;  3P9K A;  5BPI A;  4LJZ F;  4I7H A;  5TRD A;  2FF4 A;  3DEU A;  1ON1 A;  1BC7 C;  4MNU A;  4A0Y A;  1YW7 A;  4YFK F;  2E1N A;  3BJA A;  3V8K A;  1USS A;  2O0Y A;  4ZYH A;  4WCG A;  1J59 A;  1I1S A;  2JRT A;  2V79 A;  3CUQ C;  4MEX F;  1J5Y A;  2QBY A;  2OQR A;  2FRH A;  3ZMD A;  2F5F A;  2IT0 A;  1B6A A;  1FBS A;  1P4X A;  2ZXJ A;  4G7H F;  5J6X A;  2HTJ A;  4E70 A;  4P55 A;  1QPM A;  2JSC A;  1T0F A;  1IUY A;  3E3V A;  1HW1 A;  1BOA A;  1UFM A;  1RZ4 A;  1FT9 A;  3E6D A;  3GWZ A;  1PP8 F;  5HLI A;  1NHA A;  4Y13 A;  5F1R A;  3QPH A;  3JSO A;  3F8F A;  5CVU A;  2YSR A;  4ENN A;  2X0L A;  2ZJ2 A;  3T8R A;  4K2E A;  1J9I A;  3ECH A;  3RI4 A;  1LDD A;  4HQE A;  4ESB A;  1C0W A;  3VOE A;  5K1Y A;  2P6S A;  3E6B A;  2ISZ A;  4P9U A;  2XAQ A;  2DK8 A;  2HTS A;  3EYI A;  3WG9 A;  2OD5 A;  3V7S A;  3I54 A;  4ESJ A;  2LF8 A;  3KZY A;  1D8K A;  3EUH A;  1F1Z A;  3WTU C;  4NB5 A;  1XGS A;  1QNT A;  2HYF A;  3L09 A;  2EA2 A;  4N9H A;  3I71 A;  1X3U A;  2OZU A;  2G7U A;  4I0A A;  1KU7 A;  4NHJ A;  1KQ8 A;  2Y0M A;  4CO8 A;  3FM5 A;  1IW7 F;  1WRJ A;  2FQ3 A;  2C6Y A;  4M9X A;  3DQV C;  2GAU A;  2FNA A;  1KU9 A;  4L9V A;  2XHK A;  2VOO A;  3KET A;  1DPU A;  1U8R A;  1Z9C A;  1YIO A;  1LNW A;  2HQN A;  3R0J A;  2HYG D;  3F23 A;  2DU9 A;  1F4K A;  3T1B A;  3D0S A;  2PG4 A;  2KJB A;  5DYM A;  2FOK A;  5DCF A;  5AIQ A;  2D1H A;  2AS5 F;  1G6N A;  1XGO A;  4HAM A;  1ZG5 A;  4YG2 F;  2V1U A;  3HRU A;  2FE3 A;  1R22 A;  1EH7 A;  2FXA A;  3CO6 C;  2HWV A;  4RB2 C;  3P9C A;  5FLX K;  4ZZD A;  3C1D A;  2EV0 A;  3RIR A;  1O7F A;  3K0L A;  4MQV A;  3LFK A;  5AIP A;  1B9M A;  1FOK A;  5FD5 A;  3ZMT A;  2DTR A;  3BJ6 A;  1R00 A;  1W7P D;  1YYV A;  1FYK A;  1PUE E;  3JAM K;  3IWF A;  2JPB A;  4KNY A;  2LKP A;  2WWY A;  2WV0 A;  1HKS A;  3R0A A;  5F64 A;  1TQM A;  2ETH A;  4M6X A;  2R7D A;  2XAS A;  1JXS A;  4ZH4 F;  4NQW A;  3CDH A;  3TOA A;  4CGZ A;  1IRG A;  3HRT A;  1OR7 A;  1ZRD A;  1TQI A;  4G7Z F;  2HQR A;  2UXN A;  5CJ9 A;  1YS6 A;  1XB4 A;  1OYI A;  2VXZ A;  4F7Z A;  4KN4 X;  4RGX A;  4LFU A;  2EFO A;  3FMR A;  4LLL A;  3EQL F;  2GXB A;  1ZLK A;  1FX7 A;  4EJU A;  3U2R A;  5D6F A;  2YU3 A;  4A0Z A;  2VBX A;  3GF2 A;  5L3C A;  2P7V B;  3HOT A;  1TTY A;  2QM3 A;  4P5O A;  2L02 A;  2HGC A;  3M1E A;  2KJC A;  2Q0O A;  5IT9 K;  3CO7 C;  2K27 A;  1ONV A;  2QEN A;  2QQA A;  2M87 A;  4S04 A;  1ZHF A;  2UXX A;  3RKX A;  4A12 A;  2W24 A;  2BE5 F;  3ECO A;  2STT A;  1W4M A;  3WGH A;  2JTV A;  3Q9V A;  5KVR A;  3QOP A;  4FHT A;  1YQA A;  5LGN A;  1ON2 A;  2IJL A;  4G94 A;  2XRO A;  3ML6 A;  1I27 A;  1SAX A;  1IF1 A;  2M30 A;  1XGN A;  2RVC A;  1UB9 A;  2H6B A;  3TOB A;  5KK1 A;  3WTZ A;  1LDK B;  4A5N A;  2XAG A;  5LEK A;  2QBY B;  2XIG A;  3JTG A;  5CYV A;  5BOX A;  3KP7 A;  1T38 A;  2L01 A;  4M9Z A;  3RYR A;  1HQC A;  3K1P A;  3FMQ A;  3L9F A;  3RPQ A;  3O2P E;  3ULQ B;  3J81 Z;  4BHC A;  5BMZ A;  4G7O F;  2NNY A;  2ZME A;  2IA1 A;  2YX7 A;  4HYE A;  2MBF A;  5DUK A;  3L7W A;  3HHG A;  2ZNY A;  2Z99 A;  2ZO4 A;  1MDM B;  1IXS B;  4L5I A;  3C3W A;  3RYP A;  4RB3 C;  2NS0 A;  2IP2 A;  3QU3 A;  1MGT A;  4LG0 A;  3EDP A;  2JT1 A;  4HW0 A;  4R8H A;  2L54 A;  2OQG A;  2DO7 A;  5CVI A;  3WTV C;  5DDG A;  3WE2 A;  3VFZ A;  3CTA A;  2A5Y B;  1QGP A;  2GA1 A;  4HQM A;  1IN4 A;  1ZGA A;  3GW2 A;  2FBK A;  5D4R A;  3EET A;  2XKP A;  3ZMV A;  5LGU A;  3CJN A;  3PFI A;  4Q47 A;  4UVB A;  4OU0 A;  3H3Z A;  2HOE A;  2ZFW A;  4RS8 A;  1WSU A;  2VBY A;  1S7A A;  2FBH A;  3IKT A;  2A07 F;  5ILU A;  3DXJ F;  3TO6 A;  4EM0 B;  4IJA A;  3FM3 A;  4EV0 A;  4BAY A;  3T5X A;  1QQI A;  2BBY A;  2MD5 A;  5HDK A;  3KEQ A;  1ZRC A;  2VBW A;  5CVJ A;  2DLL A;  3F8B A;  3TDZ C;  5FLX Z;  3CUO A;  4M74 A;  2Z9O A;  3GO5 A;  4ETS A;  1LVA A; 
#chains in the Genus database with same CATH topology
 1OIS A;  2ID6 A;  1D3Y A;  2KIM A;  4DQ2 A;  4HNT A;  5BNG A;  4G6D A;  3T8T A;  3A0H C;  2L4M A;  3HKZ N;  1IZ1 A;  2XAU A;  3MZ8 A;  4B3X A;  4ITV A;  3K69 A;  2HDC A;  3OYD A;  3H5R A;  2G7H A;  2LR8 A;  2LKX A;  3VSK A;  4E7I A;  4KIC A;  1GDT A;  4L0Z B;  2JA7 J;  5TGT A;  2DBB A;  2FSW A;  4S0H B;  2EK5 A;  4A2U A;  2LY2 A;  4ASN A;  2ZB9 A;  4PJN A;  2WV1 A;  2OUM A;  1MZB A;  2L9R A;  1SFO J;  2MD0 A;  2H27 A;  3ZOB A;  5GP9 A;  3CCM I;  4E7H A;  3CDL A;  1A36 A;  2PBI A;  3HSE A;  3X2Q H;  4OAY A;  5ED4 A;  2XDV A;  2P0W A;  2CJJ A;  2FOW A;  3ZMU A;  1QBJ A;  4A0X A;  4ZDP A;  1A6Q A;  2XV4 S;  1F43 A;  2E1M B;  3NEU A;  4IHS A;  2XAF A;  3S2W A;  5H20 A;  5EG0 B;  3HC7 A;  4OIQ F;  2X1E A;  4BYY A;  4XL9 A;  5FFX A;  1RC9 A;  3BCB A;  3OWT A;  1S6L A;  3BP8 A;  2HNH A;  2LSO A;  1JUP A;  3F72 A;  2BY2 A;  3FDY A;  1JT6 A;  2ELK A;  1I5Z A;  1JE8 A;  5F0F A;  1LPQ A;  1LJ9 A;  5FKN A;  2VT3 A;  2DW4 A;  2XB0 X;  4JQF A;  1AKH A;  3RKY A;  3B6C A;  3E5U A;  2EFQ A;  2XAH A;  3G2B A;  2MA3 A;  1K4S A;  1Z05 A;  4M6Y A;  5ICC A;  5FJ8 J;  3HOX J;  3VDX A;  2QUF A;  3CCJ I;  3NWT A;  2CV1 A;  4F55 A;  3MKL A;  5L3F A;  5H2F C;  4OIR F;  3BZ6 A;  1LFP A;  1E3P A;  3BR3 A;  3U1K A;  3COA C;  3IV5 A;  5BPD A;  1KZH A;  2K5C A;  1OCZ H;  3PJR A;  1WI9 A;  3CC4 I;  1WGX A;  1SVM A;  2Y2Z A;  2XSD C;  3WHB A;  1U9O A;  1F36 A;  5JR3 A;  3G1O A;  4PDK A;  1GV5 A;  3TBI A;  3PM1 A;  2OA4 A;  2VT2 A;  2P4W A;  2DA1 A;  3EUK L;  4BXF A;  2BYV E;  2BVL A;  5M3M J;  3K70 D;  1W0U A;  1U5T C;  2QLZ A;  5EYR A;  4BY7 J;  2WAE A;  3C2B A;  5LD2 C;  4D0P A;  1BR2 A;  1JGS A;  3E97 A;  2DMT A;  4GYI A;  3G73 A;  3KIO A;  2GLO A;  2IS4 A;  2Y0S A;  2GIV A;  2GOM A;  4AIK A;  5E8G A;  1KQ9 A;  2EIK H;  2AO9 A;  3S1Q J;  4RAG A;  1ETK A;  3PFY A;  4M72 A;  4NUB A;  1DDN A;  2LC2 A;  9ANT A;  2A6E F;  1JKQ C;  2OCE A;  4EVI A;  1DP7 P;  1IO2 A;  2V9V A;  2H8R A;  4A6D A;  1FSE A;  1OMI A;  2W85 A;  1MBE A;  4MHG A;  2LY9 A;  1D8J A;  3DU5 A;  1MD0 A;  5EZG A;  3WTT C;  2D45 A;  1J7K A;  3PO3 J;  1KYW A;  3BR1 A;  1YIJ I;  2ZXW H;  4HV5 A;  3IKV A;  5K7F A;  2P7C B;  1BIA A;  5GAD J;  2L9V A;  2XGD A;  2LDU A;  4PCQ A;  4DZJ A;  1O3T A;  3DF8 A;  1H89 C;  3SZT A;  1R23 A;  2M34 A;  2VJ5 A;  2CUZ A;  2UWM A;  2GWR A;  4UUT A;  4KMU X;  2HDW A;  4UV8 A;  3V7C A;  2IAI A;  2FMY A;  2HOA A;  1MJA A;  2CMP A;  2Y75 A;  4XKC A;  4Q4Z F;  1PVE A;  2HQA A;  1U6G A;  3GFJ A;  1ITY A;  2KIS A;  4L9J A;  2PQ8 A;  3RPU A;  4DYC A;  2FML A;  1VQ5 I;  1HW5 A;  1WQ2 A;  4EMS A;  4OMZ A;  4A3K J;  3CUQ B;  5K5Q A;  5CQE A;  3F9K A;  5DM7 F;  4ENM A;  3L1P A;  2JUG A;  1ETW A;  1FIA A;  3A4C A;  4C9Y A;  4WX9 A;  1QU3 A;  2J5O A;  5D5V B;  5CLS A;  2BOL A;  2VON A;  2NYX A;  5DM6 F;  4AU7 A;  3CLQ A;  2LF7 A;  4CCM A;  2DCE A;  2QQ9 A;  5LHI A;  3DFG A;  1J2X A;  3ABU A;  3FKI J;  1IXC A;  1NK2 P;  4CXF A;  4MQ9 F;  2H6C A;  4EJW A;  1DUX C;  1IAW A;  1QZY A;  1S5L C;  5HS8 A;  4B09 A;  1EH6 A;  1U2W A;  3JAM Z;  3JRH A;  2LK2 A;  2TDX A;  3E6C C;  4OIP F;  3M9A A;  2CWE A;  3BPX A;  3DV8 A;  1LFU P;  2DMU A;  3KEO A;  1IXR C;  1TNS A;  2EFP A;  3BY6 A;  4U7D A;  3FXR A;  1V5E A;  2E60 A;  3JRG A;  3MKZ A;  1WJF A;  3V8J A;  3ONQ A;  4JX5 A;  1SVL A;  3GXO A;  1F9N A;  3F22 A;  3ESW B;  2QQB A;  1DU6 A;  2O8X A;  3K2Z A;  2DFH A;  3EYY A;  2MH2 A;  1IN8 A;  2P5K A;  4RAF A;  5FB2 A;  4MGR A;  4BL0 B;  2JRM A;  1D0Y A;  2CQK A;  4E4H A;  3VSL A;  3BQY A;  3Q0V A;  2XVC A;  3CZ6 A;  4M73 A;  3GBG A;  2X1D A;  2FEZ A;  2KDZ A;  3QOD A;  4Y33 A;  4Q48 A;  3DKW A;  1Z67 A;  2YS9 A;  1FSH A;  2PJP A;  4GO1 A;  4CIC A;  1LE8 A;  1OJL A;  3QRF F;  4RGR A;  1HDP A;  5CPR B;  1SEU A;  3ZMZ A;  1YTY A;  2EWN A;  2AXT C;  1FYL A;  1BJZ A;  1DP3 A;  1YW8 A;  3WGI A;  2QKL B;  3GLX A;  1FBU A;  2MYS A;  4BNC A;  3UKG A;  3GFM A;  2M45 A;  2NVU B;  4D5C A;  4M3E A;  3DBH B;  4XN0 A;  2ID3 A;  4XSZ F;  1AA7 A;  2KL4 A;  2O9L A;  5KAF C;  1IJW C;  2OC6 A;  1FOY A;  3BJO A;  3IL2 A;  4CCK A;  3WTW C;  4B4C A;  2Z33 A;  2ZJQ F;  1GXQ A;  4HX7 A;  3DPL C;  1VQ8 I;  5IYD J;  1Z6R A;  5F27 A;  4LLN A;  5D8K B;  1ZGJ A;  3O6B B;  1SFE A;  3OYH A;  3MWM A;  2EZK A;  2BW3 A;  3S16 J;  2DOD A;  2JMW A;  3OS0 A;  3R4K A;  2KIF A;  3HIF A;  2V9K A;  2IBD A;  1PYV A;  4IEJ A;  3HOV J;  1T95 A;  1IN6 A;  4GYG A;  1WHU A;  1RIO H;  4EQQ A;  2Q1Z B;  1SFU A;  2DFI A;  2G0E A;  4LD5 A;  1SMY F;  4FAS D;  2PMZ A;  2HPI A;  3KP6 A;  1TZL A;  4GXO A;  4Q5S F;  3GYH X;  3KLN A;  2HVR A;  1IDZ A;  4IHY A;  3A01 A;  3HBL A;  3ABT A;  2VC0 A;  3GTO J;  4J19 A;  4BE1 A;  3JRC A;  3W6J B;  2RDP A;  4HF0 A;  3V4G A;  4NBQ A;  1LQ1 A;  2N8G A;  1U5T B;  1ZN2 A;  2Z16 A;  3E5X A;  2NVY J;  2DJI A;  3Q0U A;  1RUO A;  1S7O A;  1IDY A;  3FHZ A;  4ANJ A;  2JQ7 A;  2MC3 A;  3RKQ A;  4BBS J;  1R58 A;  2E34 A;  3AL0 C;  4JBA A;  4LK1 F;  1K78 B;  1FWZ A;  3SQN A;  3BQZ A;  4RAY A;  4UV9 A;  2VOD A;  3B02 A;  1RET A;  2BHY A;  2Y0S N;  3F8M A;  2Q8K A;  3GX4 X;  3CF5 F;  1XN7 A;  5JHU A;  3H92 A;  4JK1 X;  1SD6 A;  1ERD A;  3OV8 A;  1AOY A;  3BDD A;  3ELK A;  4U0Y A;  1VND A;  4O6J A;  1ETO A;  1BM9 A;  1EH8 A;  4FQG A;  5F1J A;  2P5L C;  3AAF A;  1KU2 A;  1X1C A;  3VWB A;  3HOZ J;  4BE0 A;  2K9S A;  1OCP A;  3GZ5 A;  2HVQ A;  2H1K A;  1BN5 A;  1EJ9 A;  1OCT C;  2R7O A;  5EGO A;  2XPV A;  2EZI A;  1SFX A;  2DMP A;  4N0B A;  5E20 A;  3FZV A;  2YUS A;  4XN3 A;  2E1M C;  1WFX A;  2WB1 N;  3GFI A;  2FD5 A;  3FX3 A;  3TP0 A;  3K4K A;  2VOP A;  1R7J A;  5FFZ A;  1BOB A;  2K3F A;  3Q3S A;  4UY8 I;  3HDD A;  2E5N A;  4ESF A;  5DD8 A;  2W48 A;  3KX2 A;  1D5V A;  5B1B H;  4A5M A;  2LNB A;  1IN7 A;  4BHP A;  2PMH A;  2JK3 A;  3OS2 A;  1VQN I;  4EM2 A;  5HOO A;  5B5E C;  1TQP A;  4U87 A;  1WKM A;  2QEX I;  1W0T A;  4QSH A;  1HLV A;  3TQN A;  1TT5 B;  1A6I A;  4EJV A;  2QZ8 A;  3E6M A;  4QLC U;  2QSF X;  1Z7U A;  4X1E A;  2K7L A;  5F6F A;  4OIO F;  3KP5 A;  3IC7 A;  5D5U B;  3QYF A;  3IRR A;  1K6O A;  2BGC A;  3OYI A;  2IS6 A;  1YRN A;  3FXU A;  1CGP A;  1HXD A;  3I56 I;  5H6Q A;  3ABK H;  2K86 A;  3OR1 C;  2EQR A;  3GVA A;  4FET A;  2QSG X;  4CDG A;  1O57 A;  2E7W A;  5HDG A;  1K4T A;  4OIN F;  2W1O A;  5F04 A;  2ECB A;  1V3F A;  5HNH A;  2F5E A;  4MIM A;  3WG7 H;  2O61 A;  1FNN A;  4XOP A;  2LP0 A;  3LA7 A;  3HL2 A;  3J80 Z;  1U78 A;  1GVD A;  1XD7 A;  3N97 A;  5EEA A;  1X1P A;  2Q2E A;  1XSD A;  5FKK A;  1ZKG A;  3D5R C;  2FA5 A;  4DIQ A;  1BC8 C;  4AIH A;  2RQP A;  1XSV A;  2BXZ A;  2UZK A;  3KCC A;  2O5R A;  4Y4R A;  3LAJ A;  4I2O A;  2DA3 A;  3QPT A;  4BQA A;  1IRF A;  2DT5 A;  3CCL I;  1JJ6 C;  3ABM H;  4HOB A;  3ROU A;  4I76 A;  5KNL A;  1DU0 A;  5FRM A;  3G1L A;  1B9N A;  5JVT A;  5IP6 A;  1G4D A;  3K1N A;  1O3S A;  3KPH A;  2R7V A;  2BY3 A;  2XF7 A;  2M0C A;  3CDI A;  1O3Q A;  2A05 A;  4TV7 A;  4WXC A;  1MNM C;  4XKW A;  1Q1H A;  2PJR A;  3HOW J;  5HS7 A;  1G3W A;  2R7Z J;  3NRV A;  3BOQ A;  1ZLJ A;  4FX4 A;  3VEP A;  2WTE A;  4PJJ A;  5J4Y A;  1V54 H;  3QYB A;  1T08 B;  4L0Y B;  1R5G A;  1MDM A;  2R3S A;  3FIW A;  4BS9 A;  4OWR B;  3LWF A;  5HLH A;  1WH7 A;  3GUD A;  4RGU A;  3F0C A;  4IPA A;  4HNV A;  2COM A;  4L18 B;  3AL0 B;  2LH9 A;  3V7R A;  5JHF A;  3U21 A;  3CLO A;  2HKO A;  3P5J A;  4KFC A;  2H09 A;  3ZQC A;  1MBH A;  3ZMS A;  1U0J A;  1T39 A;  2ECC A;  2LY1 A;  4WXD A;  4AVP A;  5GAG J;  2EPF A;  2MGQ A;  3WOD F;  3HPG A;  2EJR A;  1GXP A;  1R71 A;  1H0M A;  2BW3 B;  1REP C;  5HLT A;  4XSX F;  4M71 A;  2EIJ H;  5B66 C;  4BJ6 C;  2K9L A;  2VKE A;  2EV6 A;  1TWH J;  2EFN A;  2PEX A;  1UAA A;  1FOX A;  2STW A;  1MND A;  2GZW A;  4UHT A;  1I50 J;  1MBJ A;  3BTL A;  1HCR A;  1T8I A;  4PZJ A;  2X4H A;  1T33 A;  1UHW A;  1DQU A;  1Y6I A;  3HSF A;  1MSE C;  2MLG A;  1MKM A;  5D6E A;  1YO5 C;  2OAZ A;  2NVQ J;  4UUV A;  3JSP A;  3BPV A;  4PUS A;  2DMN A;  5JI6 A;  4KA4 A;  3K6G A;  2HVS A;  5ICG A;  1MH3 A;  1R36 A;  1HSJ A;  4M3B A;  3DBL B;  5D5X B;  1XCB A;  2Y9Z A;  3PIP F;  4NNJ A;  2EV5 A;  1M1E B;  5FO5 A;  3QP5 A;  1B8I A;  3V42 A;  3J7A O;  3S17 J;  2A68 F;  1TW2 A;  4C3J J;  4I6Z A;  4A3M J;  3D5L A;  1EV7 A;  2DA5 A;  1ZG3 A;  3PNT A;  4IF4 A;  4AYB A;  2MH9 A;  3OYK A;  1V5G A;  3DEW A;  1R1U A;  2EFW A;  3LA3 A;  1KU3 A;  2JN6 A;  2IW5 A;  1BI0 A;  4NC6 A;  2AXL A;  5GTI C;  4XRS A;  1S7E A;  4C3I J;  1KON A;  2AQF A;  2OJE D;  3HHH A;  3U9G A;  2OU2 A;  1ZRF A;  1WZ2 A;  1OFC X;  3OIO A;  4HLY A;  5DUI A;  2F48 A;  4EGY A;  3ZQG A;  4A93 J;  2ZFU A;  4P1W A;  3BR5 A;  1HST A;  4ZJZ A;  2PX9 A;  2KIU A;  3S14 J;  4LIT A;  4CYD A;  2VC1 A;  3J7Y J;  2DK5 A;  2M3A A;  1UEL B;  2XSJ C;  3HZJ A;  3QP6 A;  1X4P A;  2W25 A;  4C2T A;  1Z1D A;  3M8J A;  4KIT B;  1IGN A;  1E3O C;  2XKO A;  5D8L B;  2L9N A;  3RTR A;  4UVA A;  2CUE A;  3OYE A;  3O8G A;  2XF5 A;  2DQL A;  1GV2 A;  2RRE A;  4LLG F;  1EKE A;  4II3 A;  1MW7 A;  2MLK A;  5LHG A;  1GHC A;  4IKF A;  2I10 A;  3F21 A;  4DOZ A;  2VI6 A;  4XIC A;  2OV7 A;  4MFD A;  4V19 K;  4IRG A;  1STZ A;  1TWF J;  4GRI A;  4BU2 A;  3W3C A;  4AD9 A;  3FWE A;  5KHD A;  2F2E A;  4XOR A;  3OIQ A;  3NAU A;  5ILV A;  3LSP A;  4MEY F;  1VQ7 I;  4LMY A;  1A35 A;  3E5Q A;  4YIF A;  2MSY A;  2TRT A;  1Z6T A;  3TL4 X;  4XRS G;  3PIO F;  4UXN A;  1PP7 U;  4N4O B;  5L3G A;  3M8E A;  4QWQ A;  2CQN A;  2BZT A;  2VQH A;  2RV8 A;  1W5T A;  3K9T A;  5FKM A;  3BG9 A;  3JCU C;  2I5U A;  2W57 A;  5K5O A;  1WJD A;  5BQT A;  1W36 C;  4D9J A;  1L0O C;  5J1R A;  3BT9 A;  5E1W A;  1P7I A;  1XDU A;  2F4I A;  3I59 A;  5J8C A;  4BXX J;  1BW5 A;  4CHU A;  2M1B A;  4AWX B;  1E2X A;  2E2J J;  2J5P A;  1JTX A;  4I02 A;  5EJC A;  4DJA A;  1XCV A;  5HDN A;  1OKR A;  3W6K B;  4BBR J;  4QTR A;  4CZZ A;  4EAT A;  1VQP I;  3OL4 A;  1W5C C;  1MMS A;  2K02 A;  4YEJ A;  3GEZ A;  1GVJ A;  3S8P A;  3CME I;  4IRH A;  1BA5 A;  2DYS H;  3DPT A;  3P9I A;  3V8L A;  1P6R A;  2KIQ A;  1IN5 A;  3C7J A;  5JFR A;  1X19 A;  2O03 A;  2YR2 A;  1QZZ A;  1BI3 A;  3VB2 A;  2JWT A;  2OPT A;  4ENJ A;  4XKB A;  3H0D A;  1BJA A;  4HX8 A;  5J4V A;  3ZQF A;  3LSJ A;  4JX6 A;  1B8I B;  2KRF A;  4QPQ A;  3SEZ A;  5B3S H;  3DP7 A;  2IPQ X;  4M3G A;  1YRN B;  1RI7 A;  4BH9 A;  4XLE A;  2Z5U A;  1LB2 A;  5M3F J;  2L3D A;  2L7Z A;  2V1D A;  2IA2 A;  4EJO A;  3ZPL A;  2CUJ A;  3IHU A;  3Q0W A;  3WTS C;  3AFH A;  1J0R A;  2VB6 A;  3LST A;  3QU6 A;  4KDP A;  1V55 H;  1R4N B;  1HDD C;  4BUP A;  2HOT A;  4HDV A;  3KZZ A;  4E7S A;  1TLH B;  3QWL A;  4DGW B;  1WPK A;  1P92 A;  3SYT A;  2YX4 A;  5D4S A;  3WE3 A;  2VE9 A;  4PFO A;  1MBF A;  1N77 A;  1AU7 A;  3BWG A;  1NK3 P;  1I39 A;  1MMA A;  5LFA A;  3QYE A;  3S15 J;  3HB9 A;  5J1U A;  3I4N J;  3OYN A;  3F6V A;  1HW2 A;  1W36 D;  4G8X A;  4KIG A;  4IRI A;  1TNT A;  1UHS A;  2KHM A;  2CO5 A;  1WH5 A;  2D2W A;  3OOU A;  3QPS A;  3SHF A;  3KP2 A;  3K4B A;  1BR1 A;  2CQ7 A;  3TO9 A;  1FIP A;  4RB1 A;  1YJW I;  2OCC H;  4BJ5 C;  4IZZ A;  5GTH C;  3H35 A;  1Y56 A;  1LEA A;  4L5J A;  3TO7 A;  1X3Z B;  4LK0 F;  3I59 B;  1BI1 A;  3KP4 A;  4I0B A;  2RKH A;  4HX4 A;  1A5J A;  2F5V A;  1XDS A;  2I8D A;  1ZAO A;  4LG0 B;  3OOP A;  3IH3 A;  2GXG A;  1P2F A;  1UST A;  1SVO A;  1D0X A;  1E3H A;  2LG4 A;  5F0C A;  4NC8 A;  4Z2Y A;  4NC7 A;  1L3L A;  1YIT I;  1XMA A;  3MZY A;  2NNN A;  4LB6 B;  4ZYD A;  2D5V A;  4HBL A;  2CQX A;  5C3E J;  2ISY A;  3PSF A;  2KRC A;  2KP6 A;  5H6R A;  5C4X J;  1W1W E;  2KMU A;  3J80 K;  1ZYR F;  2ESH A;  2JSP A;  2RQQ A;  2E2H J;  1FY7 A;  4XBF A;  1I1G A;  4MLO A;  2NS7 A;  2D1V A;  2VAS A;  1K7A A;  3JRD A;  4HV6 A;  3WGG A;  5K5R A;  3WHC A;  3ZQI A;  3I64 A;  4F93 B;  3ZQ7 A;  3LQQ A;  4B44 A;  1V4R A;  3U1D A;  3M4O J;  5IT3 A;  1ENH A;  1W7P B;  2WBM A;  2O6G E;  5TIS C;  2L9S A;  1FEX A;  4UB6 C;  3I53 A;  1LVK A;  3WU0 A;  2VE8 A;  4WF2 A;  4LGW A;  2M5W A;  1ZRE A;  1Z77 A;  3K4C A;  4ZYG A;  1OYW A;  1VTN C;  4OOI A;  5J47 A;  1LFB A;  4I09 A;  4L5E A;  3S3M A;  5M5Y J;  1FTT A;  5IP7 J;  3H9J A;  3MD2 A;  5JLW A;  3MKW B;  5E1X A;  4W97 A;  5A2Q Z;  1XTA A;  1B1B A;  3TW6 A;  2ZNZ A;  2DT7 B;  1WWX A;  4DYR A;  5DD4 A;  1VQ4 I;  2NVT J;  1FC3 A;  3I5U A;  1RR8 C;  3HSR A;  3MKY B;  1ULY A;  4EM1 A;  2Y9Y A;  1H9T A;  4N4N B;  4UUS B;  5L3D A;  1IRZ A;  5J8F A;  5GPC A;  4YIR X;  2R5Z A;  1RNL A;  2OZ6 A;  4YFN F;  2A5W A;  4E7Z A;  4XID A;  4MTE A;  2NS8 A;  3W6V A;  3BLY A;  1QRY A;  2QYO A;  4P96 A;  4A3G J;  1IRX A;  3G71 I;  3H36 A;  3HEF A;  1H9G A;  3LSH A;  1FP2 A;  4OAZ A;  4RDU A;  2WA0 A;  5HS9 A;  4BDY A;  1FZP B;  1KA8 A;  2V1N A;  3MEX A;  4RM3 A;  1Y8R B;  4PSW A;  3TGN A;  3AG2 H;  3OYM A;  2XGE A;  2LTP A;  4BE2 A;  2KFD A;  4IVN A;  4S05 A;  2E5Z A;  3FMS A;  3RCO A;  2K9M A;  3PNV A;  3L2C A;  6PAX A;  4HLX A;  3K1M A;  4F92 B;  2GA2 A;  2MW8 A;  3HOS A;  1K79 A;  3F6O A;  4UNO A;  2VN2 A;  1DGR M;  2OTL I;  3DWL E;  3SFI A;  1RR7 A;  1YS7 A;  3HTU A;  2EB7 A;  3M1C A;  2RC4 A;  3RZD J;  1LEB A;  2HPM A;  2NRA C;  2K9N A;  1W7P A;  1MMD A;  1ZAR A;  3MN2 A;  4KIF A;  4KUM A;  5D5W B;  3CMA I;  2K4B A;  4AIJ A;  3R6S A;  3WTX C;  3BTC A;  3RPU D;  3CC7 I;  1HKQ A;  1R1V A;  2RGV A;  4HRI A;  2FUG 2;  4C3H J;  2JZY A;  2R7X A;  3K4N A;  2ELH A;  3FK6 A;  3LMM A;  4FX0 A;  1BIB A;  2BVM A;  3MCZ A;  1SMT A;  2HZT A;  1Z3Y A;  2KRH A;  3HKZ A;  3SDG A;  5LBQ A;  4PGH A;  1BBY A;  3ZQQ A;  3LAP A;  3L2W A;  3REO A;  2CSO A;  3GTP J;  4ZDL A;  1MJB A;  2BEO A;  4LB5 A;  1ETV A;  1Z3X A;  5DCM B;  5FLM J;  3FXQ A;  2DMQ A;  2QWW A;  2BV6 A;  1YG2 A;  3NQO A;  4HPQ A;  5LGT A;  4WWC A;  2DN0 A;  1ZR4 A;  3L00 A;  3A02 A;  5IY5 H;  1G3T A;  3E0J B;  1POG A;  4O3M A;  3M8F A;  3C2H A;  4H0E A;  2WAD A;  5HVQ C;  5F08 A;  3VYS B;  4QIW N;  1Z21 A;  4LIV A;  1SD7 A;  4GDF A;  1A04 A;  3O8H A;  5LRS A;  2BHZ A;  2VL8 A;  3FHN A;  5FLV A;  5IOY A;  3S1M J;  5LRR A;  4A3D J;  4HF1 A;  1OCR H;  1Y1V J;  2RNG A;  2DAO A;  2XPU A;  5K7Z A;  1QA6 A;  4RAZ A;  4KMF A;  4HZF A;  3SZP A;  3TKY A;  4R79 A;  1U3E M;  1VQ6 I;  3LSM A;  4R1H A;  3ASO H;  1G2H A;  3K4M A;  4G6Q A;  4CH7 A;  1WJE A;  2CUF A;  4C2M J;  1G3Y A;  2CGP A;  2VPL A;  1P4W A;  3I0T A;  2Y31 A;  3HRS A;  3QOE A;  1UMQ A;  5L3B A;  4IXA A;  2M7B A;  1LE8 B;  5E17 F;  1XG1 A;  5CVR A;  3KE2 A;  4ZDO A;  3R61 A;  2NAZ A;  2FX0 A;  4XQF A;  5E3O A;  3BRO A;  2H8W A;  3RKW A;  1Y0N A;  1KQ0 A;  2NVX J;  2FBI A;  2P5V A;  4ZYE A;  1FLI A;  4ABZ A;  5CKT A;  4IOC F;  4GGG A;  1MH4 A;  3IRQ A;  3MAJ A;  5HLG A;  2CW8 A;  3KLO A;  2ZJR F;  2GXA A;  3ZP5 A;  2LLK A;  2W84 A;  4U0W A;  1BW6 A;  4BXU A;  3CC2 I;  3H1C A;  1EF4 A;  2RAE A;  3R60 A;  1FYM A;  2PI0 A;  4EJT A;  3H5A A;  2X85 A;  2A6T A;  3OYB A;  3DLA A;  3DKY A;  3RQI A;  4CCO A;  3RZO J;  1JKR C;  1ZEL A;  1TW3 A;  3MQ0 A;  5FD6 A;  3LOC A;  1KYZ A;  5IPA A;  1JKO C;  1S8N A;  5FRO A;  5EDN A;  1YLF A;  1IV8 A;  2XC7 A;  4Y3O A;  3HGY A;  3CF2 A;  1S3J A;  2R5Y A;  1B72 B;  1B4A A;  2B0L A;  3WTY C;  1YJN I;  2YPR A;  2QVO A;  2ACJ A;  2DPD A;  1WVR A;  3KFW X;  1MIJ A;  1R5H A;  4YFX F;  4ZC3 A;  4F3Q A;  1CF7 B;  2KLO A;  1VQ9 I;  4KJZ A;  1S29 A;  3WU1 B;  1QHH D;  4BKX A;  4A3L J;  2F4O B;  2L2O A;  1UHM A;  5LLQ A;  1HBX G;  2CRG A;  5BS6 A;  2JA2 A;  2M8E A;  4OMY A;  4YRV A;  3DTK A;  2X6Y A;  1HOM A;  2V26 A;  4KT5 C;  2ZBK A;  4A6E A;  5DCM A;  3DU6 A;  3VPR A;  5FGM A;  3D5S C;  5HNF A;  1X1A A;  2H94 A;  2X6X A;  1U5T A;  2HEO A;  1HKT A;  1OCO H;  5L3E A;  3GTK J;  2VBZ A;  2AQE A;  5CQG A;  3FXJ A;  3IWZ A;  1ZG1 A;  5E18 F;  2ZME B;  4QPO A;  4PSX A;  2CQQ A;  3OL3 A;  1RKW A;  3MMY B;  4A3C J;  1KGS A;  3HOY J;  1RUN A;  2CU7 A;  2IA0 A;  2X6W A;  5CVV A;  5LEJ A;  4KIB A;  4LG3 A;  3BG5 A;  4AM3 A;  2KPM A;  3ZGK A;  2W00 A;  1QPI A;  2JVH A;  3JTH A;  2IRF G;  4ON0 A;  1FBQ A;  2HZD A;  2L4A A;  4P9F A;  2ZSH B;  3GZ6 A;  2L5Q A;  1ODD A;  1SFK A;  3ZN0 A;  3TP3 A;  4HF2 A;  4HA8 A;  4XLA A;  2VXD A;  4XON A;  2LOO A;  1TWA J;  2CYY A;  2X51 A;  2G9W A;  4O5V A;  5E8I A;  4B43 A;  1ZQ3 P;  2DI3 A;  3OYA A;  1F5T A;  2A69 F;  3LSG A;  3N4M A;  2XUB A;  3OIP A;  1JHH A;  1ZGW A;  2E1C A;  2Z2S B;  2PN6 A;  2K3P A;  4DNC A;  3IH2 A;  2DQR A;  2FU4 A;  4GFB A;  3RSN A;  1R1T A;  4IL6 C;  1XGM A;  3FIS A;  3CCU I;  5ICE A;  1W5S A;  2NOG A;  4WK8 F;  3SFZ A;  4Y52 J;  1IUF A;  3MFK A;  3ERM A;  3KYD B;  3PUF A;  2ZKZ A;  2QF7 A;  3QAH A;  3SXY A;  1OR7 C;  3I58 A;  4B47 A;  3JW4 A;  4PJ0 C;  5KCM A;  4H4K C;  2B7E A;  2ESN A;  2WB1 A;  4RB0 A;  3OYJ A;  1FP1 D;  1X58 A;  1X3W B;  3ZN1 A;  4A69 C;  2HQ5 A;  2COB A;  2DT6 A;  3C18 A;  2V6C A;  1O3R A;  2VQC A;  2KDO A;  2R4G A;  2E7X A;  1P4A A;  3K7A J;  3S93 A;  1SC7 A;  2EIN H;  3HYI A;  2A6H F;  4XLC A;  2ME0 A;  1T56 A;  1K83 J;  3RJP A;  4PGG A;  2BY0 A;  3M07 A;  5ERI A;  3J7Z I;  5GAH J;  3S2D J;  2OBP A;  1Y0U A;  2A3S A;  2L7K A;  5A2Q K;  3CP2 A;  4MTD A;  5JLX A;  4BHB A;  1RPW A;  1ORK A;  2CW0 F;  4Z6Y A;  3I4P A;  4V2G A;  2KQR A;  2XB5 A;  4CSW A;  5IT9 Z;  2F6C A;  1TBX A;  4DZP A;  1X2M A;  2JPC A;  3GFL A;  4CYC A;  4WXH A;  4U88 A;  1DGW Y;  4A3B J;  1ZH5 A;  1SD5 A;  2X48 A;  2Y48 A;  4DYQ A;  3H3U A;  4ZZL A;  2E19 A;  5ICF A;  2LRE A;  1YX3 A;  2RNJ A;  3TDU C;  1G8X A;  5LHH A;  1LDJ A;  5AON A;  2XAJ A;  2VQL A;  3F8N A;  4BQO A;  3WU2 C;  3T0Y A;  1XS9 A;  2GQQ A;  2HS5 A;  3ZCO A;  3PNY A;  2WY7 Q;  4XRF A;  4HEA 2;  2PJR B;  3CUQ A;  1G3S A;  4DBQ A;  2WAF A;  2CS3 A;  3EPZ A;  4W1U A;  4D7M A;  2R7W A;  3H3V K;  2TCT A;  1ETQ A;  3B73 A;  3ZRG A;  2F5D A;  4I98 B;  3PQK A;  2XRN A;  2IEK A;  3PQJ A;  5EEG A;  3HTS B;  2VPR A;  2M8G X;  5E1Z B;  2M4G A;  4NQW B;  4IHW A;  4AC0 A;  3CJT B;  1JT0 A;  2HR3 A;  1QO0 D;  1QHG A;  4IHT A;  2K4J A;  2F5C A;  1ETX A;  1B59 A;  1BL0 A;  1CF7 A;  1YE9 A;  4AID A;  1AWC A;  2O8K A;  2O3F A;  3A1Y A;  3Q5F A;  1ZR2 A;  4Y7N J;  2PLY A;  3ISP A;  3JRA A;  1QVU A;  1OPC A;  4FT8 A;  4G6T B;  4FTH A;  4U7B A;  3FK7 A;  1FPQ A;  4ENK A;  3RDI A;  1MSF C;  3QQA A;  1OYY A;  1X1B A;  4UVC A;  1YFH A;  1IV6 A;  2X1C A;  1J75 A;  4UB8 C;  5DEQ A;  2Q2E B;  1JHF A;  4XLP F;  2V1X A;  2R7F A;  3KEY A;  3J81 K;  2EH3 A;  3E1S A;  1SD4 A;  1XMK A;  3O3K A;  2AHQ A;  5IP9 J;  3OY9 A;  3OYF A;  3AG4 H;  2M2E A;  2VKV A;  3OSG A;  1QVT A;  2B63 J;  3HXL A;  4RGS A;  4M9S A;  4KYW A;  2QKM B;  3M7G A;  2VIX A;  3KP3 A;  1I6X A;  1E17 A;  3K70 C;  4Y15 A;  1XSX A;  2PFB A;  3F8C A;  1MBG A;  4L9T A;  4NDL A;  1T2K A;  4L9N A;  2DPU A;  1T6S A;  4I01 A;  3E7L A;  1WJC A;  1DPR A;  3SDB A;  3W2V A;  2P8T A;  1XMX A;  2HFH A;  4XR6 A;  3G3Z A;  3OSF A;  2FQ4 A;  1YW9 A;  2M7A A;  2CV2 A;  2EA4 A;  1V5F A;  4A3J J;  1R4M B;  2Z3Y A;  3G1M A;  3VYU B;  4HDU A;  1T98 A;  2R92 J;  2HDD A;  1WJB A;  4Y17 A;  3ERE D;  3HUG A;  4KN7 X;  5TJJ A;  1UCR A;  1FJL A;  3LA2 A;  5ILS A;  3MZH A;  4EGZ A;  5FKO A;  2O7O A;  1Z91 A;  3K2A A;  2FNP A;  4XLN F;  3VOD A;  2VQG A;  1O7L A;  3P7N A;  5DV5 A;  3HRM A;  3SJM A;  2KKO A;  2WC2 A;  2IVM A;  4BDZ A;  3LQR A;  4IOA F;  1GLN A;  3FXO A;  2HKX A;  4B8X A;  1E0E A;  3DBR B;  4D7N A;  1UJ8 A;  2LVS A;  4CCN A;  2DYR H;  5DS9 A;  2PMU A;  2DJN A;  3FF5 A;  2P6T A;  1BI2 A;  5E3N A;  1Y39 A;  2LRD A;  1JUM A;  2XGX A;  4N9I A;  2CFX A;  5EEH A;  3Q9S A;  2ME6 A;  3W2A A;  4YII A;  1PUF B;  2XF6 A;  2ADU A;  5EG0 A;  3PSI A;  4DBR A;  1IC8 A;  1K78 A;  2K9Q A;  5J40 A;  2IXS A;  2CG4 A;  2A61 A;  2LFB A;  4E6K G;  4JOM A;  2RN7 A;  4JP0 A;  1TL8 A;  1PDN C;  3CP8 A;  3HGG A;  4U0V A;  3JR9 A;  3F3X A;  3CCQ I;  4GCV A;  4D1Q A;  1MJ9 A;  4G9Y A;  1LUJ B;  3GTL J;  3L2U A;  2ZCW A;  3A01 B;  3P9K A;  5BPI A;  1X2N A;  4LJZ F;  4I7H A;  5TRD A;  3M3Y J;  3CCV I;  2FF4 A;  3DEU A;  1ON1 A;  4JYK A;  3CJR B;  1D0Z A;  1BC7 C;  4MNU A;  1UZC A;  1I6H J;  4A0Y A;  1XPX A;  4D5F A;  1YW7 A;  4YFK F;  2E1N A;  3BR6 A;  3BJA A;  3B6A A;  3V8K A;  4ZYA A;  1OCC H;  3CCY A;  2VLA A;  2LYC A;  1TT0 A;  1USS A;  1D1B A;  2EIM H;  2O0Y A;  4ZYH A;  4EEF G;  4WCG A;  1J59 A;  1I1S A;  3L2Q A;  3H9Q A;  2JRT A;  2V79 A;  2HXO A;  4CYC B;  3CUQ C;  4MEX F;  1J5Y A;  2QBY A;  4E7K A;  2OQR A;  4XOT A;  5HOD A;  2R93 J;  4I99 C;  2FRH A;  3DPU A;  4B3A A;  3ZMD A;  2F5F A;  3JRB A;  1IG7 A;  2IT0 A;  3GLL A;  1B6A A;  1FBS A;  3TMO A;  1P4X A;  2Y30 A;  3JRF A;  1K6Y A;  2ZXJ A;  2ELJ A;  3CCE I;  1GUU A;  1SAU A;  3H9G A;  2L0K A;  1NG7 A;  2K85 A;  2E35 A;  5J6X A;  4G7H F;  1TWC J;  3BTI A;  3UR3 C;  2HTJ A;  4E70 A;  4P55 A;  1FTZ A;  2LBF B;  1QPM A;  3ZQL A;  2JSC A;  4F52 A;  2LD5 A;  1T0F A;  3FBN B;  2DXI A;  1IUY A;  3E3V A;  1HW1 A;  2VJJ A;  4X0G A;  4FIS A;  3NWS A;  3BC8 A;  2DFF A;  1VQL I;  1BOA A;  3LL7 A;  2R5Z B;  1UFM A;  4BQN A;  3IAS 2;  2HU9 A;  1RZ4 A;  1FT9 A;  3E6D A;  3GWZ A;  3PL8 A;  5HLI A;  1PP8 F;  1NHA A;  2L7F P;  4Y13 A;  1U9N A;  4XNF A;  3ZQH A;  3QPH A;  5F1R A;  3JSO A;  2EIL H;  3DKX A;  3DLL F;  2QA4 I;  1Z0X A;  3H5N A;  1WCM J;  3F8F A;  3AKZ A;  4XM3 A;  5CVU A;  2WY8 Q;  1RES A;  2YSR A;  1NH3 A;  4ENN A;  2X0L A;  2ZJ2 A;  2BY1 A;  3G6E I;  3ASN H;  3CD6 I;  4J01 A;  3T8R A;  4K2E A;  3I55 I;  2PMZ N;  1J9I A;  3ECH A;  3RI4 A;  1LDD A;  4XLH A;  5GPA A;  4ESB A;  4HQE A;  4C2U A;  3BG7 A;  1C0W A;  3VOE A;  2LKS A;  3CES A;  5K1Y A;  2EZH A;  2P6S A;  3GME A;  3ZR8 X;  4BGD A;  1VZ0 A;  3E6B A;  3LFU A;  2ISZ A;  1XX5 A;  4P9U A;  2XAQ A;  2DK8 A;  2HTS A;  1PJR A;  3EYI A;  3WG9 A;  2P81 A;  2JJ7 A;  2OD5 A;  2V9P A;  3I3L A;  1JJ8 C;  5M5X J;  5KAI C;  5K7H A;  3V7S A;  3I54 A;  4ESJ A;  2LF8 A;  3KZY A;  1D8K A;  1MNE A;  3EUH A;  1F1Z A;  3K10 A;  3N05 A;  3S1R J;  1U8B A;  1G59 A;  4RA2 A;  3WTU C;  4NB5 A;  3CMM A;  1XGS A;  2MAB A;  2Z1D A;  4B1R A;  1QNT A;  2HYF A;  3L09 A;  2EA2 A;  4N9H A;  3CQZ J;  3I71 A;  1R6R A;  1WI3 A;  1X3U A;  2OZU A;  2V7F A;  2G7U A;  3D1N I;  4I0A A;  4J00 A;  4ZTF A;  1KU7 A;  2M4K A;  2ZC2 A;  4NHJ A;  4CA0 A;  2DA6 A;  5C44 J;  2B9S A;  3TED A;  1KQ8 A;  4M3D A;  2Y0M A;  3GTM J;  4CO8 A;  4KT6 A;  1LKX A;  4XK4 A;  3FM5 A;  1IW7 F;  1WRJ A;  2FQ3 A;  2QQ8 A;  3BG3 A;  2C6Y A;  4M9X A;  3G4S I;  2FJ1 A;  2QSH X;  4PFP A;  5M5W J;  3DQV C;  2GAU A;  2FNA A;  1H8A C;  1KU9 A;  1JI8 A;  4L9V A;  2XHK A;  3AG3 H;  2VOO A;  3KET A;  1R9T J;  2E71 A;  1DPU A;  5EZH A;  3BTJ A;  1U8R A;  4A3E J;  1Z9C A;  1YIO A;  1LNW A;  3HJE A;  3GTG J;  4IX7 A;  2HQN A;  1Y8Q B;  3R0J A;  2HYG D;  4A3F J;  3F23 A;  2DU9 A;  3BR2 A;  3S3N A;  2WAQ A;  1F4K A;  3T1B A;  3SZG A;  3D0S A;  3BR0 A;  2PG4 A;  3BZC A;  2KJB A;  5DYM A;  4MFE A;  3PUB A;  2FOK A;  4JX4 A;  5AIQ A;  5DCF A;  3IH4 A;  1D1A A;  2D1H A;  2AS5 F;  4CZC A;  1GT0 C;  1SAN A;  1G6N A;  1K61 A;  1XGO A;  3DEE A;  4HAM A;  1ZG5 A;  3SEQ A;  2Y69 H;  3EUA A;  4YG2 F;  1FMW A;  3DTE A;  2V1U A;  3HRU A;  2FE3 A;  3BCA A;  2X9D A;  5GAE J;  1JKP C;  1R22 A;  3HUG B;  3GTJ J;  2M9H A;  1EH7 A;  2FXA A;  1MMG A;  3CO6 C;  2HWV A;  2ZXI A;  4RB2 C;  1Q1V A;  3C2G A;  3P9C A;  4RBO A;  4LIU A;  2DFE A;  1BR4 A;  5E79 C;  3HM5 A;  5FLX K;  4ZZD A;  2XGC A;  1X1D A;  1YI2 I;  4KIS A;  1VQM I;  2OF7 A;  3C1D A;  2JA8 J;  2EV0 A;  3RIR A;  1O7F A;  3K0L A;  4MQV A;  1OLT A;  3LFK A;  1WJ5 A;  1B9M A;  5AIP A;  5FD5 A;  3ZMT A;  1FOK A;  2DTR A;  1N25 A;  3BJ6 A;  1R00 A;  2IGN A;  1W7P D;  5FRN A;  3K4J A;  1YYV A;  5F0H A;  1FYK A;  2LBF A;  1AKH B;  1PUE E;  2ICW G;  2KT0 A;  3JAM K;  2UV1 A;  3DCF A;  3IWF A;  2JPB A;  4KNY A;  2LKP A;  1OQY A;  2WWY A;  2WV0 A;  4RM2 A;  1HKS A;  3R0A A;  1WJA A;  2MG4 A;  5F64 A;  4PJL A;  3J7A Y;  4M3F A;  3ABL H;  3W2W A;  4RLF A;  1O4X A;  1TQM A;  4CUG A;  1VFC A;  1VQK I;  2ETH A;  4M6X A;  2R7D A;  3BG6 A;  3FKJ A;  1S72 I;  2EBI A;  3FBI B;  4E7J A;  2DTZ A;  2XAS A;  3OYC A;  1JXS A;  2CW7 A;  4ZH4 F;  3JRI A;  4NQW A;  1TP4 A;  3S3O A;  2IS2 A;  3CDH A;  3GZN B;  3TOA A;  1ZTR A;  4CGZ A;  3LSI A;  1IRG A;  3HRT A;  3DTI A;  1OR7 A;  1ZRD A;  5B1A H;  3L2V A;  3I9V 2;  1VI0 A;  1TQI A;  2HOS A;  4G7Z F;  2HQR A;  2UXN A;  5CJ9 A;  1YS6 A;  2GBY A;  1XB4 A;  1OYI A;  2VXZ A;  4F7Z A;  4KN4 X;  4RGX A;  2CH0 A;  2HXI A;  4LFU A;  2EFO A;  3FMR A;  4LLL A;  3GTQ J;  2HYJ A;  3EQL F;  4HNU A;  4ZTJ A;  2GIZ A;  4FE4 A;  2GXB A;  1FX7 A;  4EJU A;  1ZLK A;  2ZJP F;  3U2R A;  5D6F A;  2YU3 A;  2DDA A;  4A0Z A;  4IQ4 A;  2VBX A;  4AUX A;  3GF2 A;  2XRL A;  4HST A;  5L3C A;  2P7V B;  3JRE A;  1TTY A;  2CFO A;  3HOT A;  2JVG A;  2QM3 A;  2IGK A;  4DW6 A;  4IHV A;  4P5O A;  2L02 A;  2HGC A;  1D1C A;  3M1E A;  1YHQ I;  2KJC A;  1YX5 A;  4AYB N;  2Q0O A;  2VJI A;  5IT9 K;  2IGM A;  3CO7 C;  2K27 A;  1ONV A;  2QEN A;  2QQA A;  5FKL A;  2BXY A;  5EF6 A;  1R49 A;  1TC3 C;  2M87 A;  3IP4 B;  2F4M B;  4S04 A;  3IUO A;  4A3I J;  1ZHF A;  2UXX A;  2WAQ N;  3RKX A;  4A12 A;  2W24 A;  2BE5 F;  5IYC J;  4BEH A;  2UUZ A;  3ECO A;  4HSR A;  2STT A;  4IHX A;  1W4M A;  3WGH A;  2JTV A;  1CQT A;  3Q9V A;  4UUS A;  5KVR A;  3QOP A;  4FHT A;  4HG2 A;  1YQA A;  4F91 B;  2GM4 A;  5LGN A;  2VUM J;  1ON2 A;  2IJL A;  4G94 A;  2XRO A;  3ML6 A;  1I27 A;  1SAX A;  1IF1 A;  3I4M J;  3CCS I;  4BAC A;  2ZXH A;  3FXL A;  2M30 A;  4C30 A;  1XGN A;  2GOX B;  2RVC A;  1UB9 A;  5IOZ A;  1I3Q J;  2YU9 J;  2H6B A;  4RLQ A;  3PO2 J;  4BY1 J;  1Y1W J;  3TOB A;  2DOA A;  2EZL A;  2JA6 J;  3UNG C;  5KK1 A;  5DTD A;  1APL C;  3WTZ A;  1LDK B;  5E3L A;  4LOC A;  3OYL A;  1MBK A;  3NAR A;  4A5N A;  2HI3 A;  2XAG A;  3K4L A;  4FCY A;  2R7Q A;  5LEK A;  1YOV B;  2V4J C;  4YEL A;  2QBY B;  3A2K A;  2VJ4 A;  2XIG A;  1D5Y A;  2XPW A;  2W7N A;  1UG2 A;  4IQJ A;  3JTG A;  3KYL A;  5CYV A;  5BOX A;  3KP7 A;  1T38 A;  2L01 A;  4IO9 F;  4E7L A;  3A03 A;  5JVG F;  2QCO A;  2R0Q C;  4M9Z A;  2IS1 A;  3RYR A;  1HC8 A;  3LNQ A;  1HQC A;  2JUC A;  2X6O A;  3K1P A;  4M6V A;  1NG6 A;  1N75 A;  3FMQ A;  5J3L A;  3L9F A;  2MFZ A;  1P9Q C;  3ZXS A;  3RPQ A;  3O2P E;  3KZI C;  3ULQ B;  3J81 Z;  1YJ9 I;  4BHC A;  5BMZ A;  4G7O F;  1QZE A;  2NNY A;  2DOF A;  2ZME A;  2IA1 A;  1XC5 A;  2YX7 A;  2KZG A;  4HYE A;  2R7U A;  2MBF A;  5DUK A;  2QGU A;  3L7W A;  3HHG A;  2ZNY A;  2E2I J;  2Z99 A;  2ZO4 A;  1MDM B;  3CCR I;  1IXS B;  2IGO A;  2H1L A;  4L5I A;  3S2H J;  2VKD A;  3C3W A;  3RYP A;  1RRJ A;  3A0B C;  4RB3 C;  2NS0 A;  2KZV A;  1PUF A;  2IP2 A;  3QU3 A;  4V2F A;  1MGT A;  4LG0 A;  4X6A J;  1NTC A;  3QPL A;  1MMN A;  2R7T A;  2W4S A;  3EDP A;  4XMY A;  1FMV A;  4AVZ A;  2JT1 A;  4HW0 A;  4R8H A;  4CCJ A;  2L54 A;  4XLF A;  3BZK A;  2OQG A;  4PK4 A;  1HF0 A;  2DA4 A;  1B72 A;  1Z7L A;  2R5Y B;  2DO7 A;  3IAM 2;  5CVI A;  3WTV C;  1I3A A;  5DDG A;  4PJM A;  3WE2 A;  3VFZ A;  4MO7 A;  1VQO I;  3OMY A;  1S9H A;  3CTA A;  2E1O A;  3H0G J;  2A5Y B;  3FXK A;  4BJT A;  4BQQ A;  3S32 A;  1QGP A;  2GA1 A;  4HQM A;  5C4J J;  1IN4 A;  1ZGA A;  4RMN A;  1TWG J;  3GW2 A;  2FBK A;  5D4R A;  2OTJ I;  3EET A;  2XKP A;  1UG0 A;  3HG9 A;  1FOW A;  2V6E A;  2DOE A;  1RKT A;  3GCM A;  3FXM A;  3ZMV A;  1ACI A;  1T0F C;  5LGU A;  5J1Y A;  3LSR A;  2MC4 A;  3CJN A;  3PFI A;  3L2R A;  1JUS A;  2R7R A;  2LMD A;  3TW7 A;  1X4O A;  1A31 A;  4Q47 A;  4UVB A;  4OU0 A;  3H3Z A;  3OS1 A;  2HOE A;  2DDB A;  2M0M A;  3S1N J;  1VF9 A;  2ZFW A;  5IYB J;  4RS8 A;  4B48 A;  5E3M A;  1WSU A;  1EA3 A;  3VYT B;  2VBY A;  4XRM A;  1S7A A;  1R5I D;  2JA5 J;  2FBH A;  3IKT A;  2A07 F;  5ILU A;  2K40 A;  3DXJ F;  5EGO B;  4XKV A;  3TO6 A;  3OYG A;  4G12 A;  4II2 A;  4EM0 B;  1P7J A;  4IJA A;  4BEH B;  2DA2 A;  2E36 A;  2ZME C;  3FM3 A;  2ZSI B;  4EV0 A;  4BAY A;  2VKH A;  3RQ4 A;  3CMY A;  4CCL A;  2NOJ B;  4FE7 A;  3T5X A;  3LSK A;  1QQI A;  3MVP A;  1N78 A;  2BBY A;  2CV0 A;  2MD5 A;  5HDK A;  1HA8 A;  2W82 A;  3OR2 C;  3AG1 H;  3KEQ A;  2DA7 A;  2NXN B;  1ZRC A;  3HOU J;  2VBW A;  1AHD P;  2L7M P;  5CVJ A;  2DLL A;  3HPH A;  3VYR B;  3F8B A;  3TDZ C;  1JTY A;  3CJQ B;  5FLX Z;  3CUO A;  1JGG A;  1J09 A;  1ZK8 A;  3EUH C;  1H88 C;  1ETY A;  4M74 A;  2R7S A;  3KYC B;  2Z9O A;  3GO5 A;  4ETS A;  1LVA A; 
#chains in the Genus database with same CATH homology
 1D3Y A;  2KIM A;  4DQ2 A;  4G6D A;  3T8T A;  2L4M A;  1IZ1 A;  3K69 A;  2HDC A;  2G7H A;  4KIC A;  4L0Z B;  2DBB A;  2FSW A;  2EK5 A;  4A2U A;  4ASN A;  1MZB A;  2H27 A;  2PBI A;  3HSE A;  5ED4 A;  1QBJ A;  3ZMU A;  4A0X A;  2XV4 S;  3NEU A;  4IHS A;  2XAF A;  3S2W A;  5H20 A;  4OIQ F;  4BYY A;  5FFX A;  1S6L A;  3BP8 A;  2LSO A;  3F72 A;  1I5Z A;  1JE8 A;  1LJ9 A;  2VT3 A;  2DW4 A;  4JQF A;  3RKY A;  3E5U A;  2EFQ A;  2XAH A;  2MA3 A;  1Z05 A;  4M6Y A;  5ICC A;  2QUF A;  5L3F A;  4OIR F;  3BZ6 A;  3COA C;  5BPD A;  1WI9 A;  5JR3 A;  4PDK A;  2OA4 A;  2VT2 A;  2P4W A;  2BYV E;  1U5T C;  2QLZ A;  4D0P A;  1JGS A;  3E97 A;  4GYI A;  3G73 A;  2GIV A;  4AIK A;  5E8G A;  1KQ9 A;  4M72 A;  1DDN A;  2A6E F;  4EVI A;  1DP7 P;  2V9V A;  4A6D A;  1FSE A;  1OMI A;  2W85 A;  4MHG A;  1D8J A;  2D45 A;  1MD0 A;  3WTT C;  1J7K A;  1KYW A;  4HV5 A;  3IKV A;  2P7C B;  1BIA A;  1O3T A;  2LDU A;  4PCQ A;  3DF8 A;  3SZT A;  1R23 A;  2UWM A;  2GWR A;  4KMU X;  4UV8 A;  3V7C A;  2FMY A;  4Q4Z F;  1MJA A;  2Y75 A;  1U6G A;  3GFJ A;  4L9J A;  2PQ8 A;  3RPU A;  2FML A;  1HW5 A;  1WQ2 A;  4EMS A;  4OMZ A;  3CUQ B;  5K5Q A;  4ENM A;  4WX9 A;  2J5O A;  5D5V B;  5CLS A;  2VON A;  2NYX A;  2LF7 A;  2QQ9 A;  5LHI A;  3DFG A;  1J2X A;  3ABU A;  1IXC A;  4CXF A;  4MQ9 F;  2H6C A;  4EJW A;  1DUX C;  1IAW A;  1QZY A;  5HS8 A;  4B09 A;  1EH6 A;  1U2W A;  3JAM Z;  3E6C C;  2TDX A;  4OIP F;  3M9A A;  2CWE A;  3BPX A;  3DV8 A;  3KEO A;  2EFP A;  1IXR C;  1TNS A;  3BY6 A;  4U7D A;  3FXR A;  3V8J A;  3GXO A;  3F22 A;  1F9N A;  2QQB A;  2O8X A;  3K2Z A;  3EYY A;  2MH2 A;  1IN8 A;  2P5K A;  5FB2 A;  4MGR A;  2CQK A;  2XVC A;  4M73 A;  2FEZ A;  4Q48 A;  3DKW A;  1FSH A;  2PJP A;  4GO1 A;  4CIC A;  3QRF F;  4RGR A;  3ZMZ A;  1YTY A;  2EWN A;  1FYL A;  1YW8 A;  3WGI A;  3GLX A;  1FBU A;  4BNC A;  3GFM A;  2M45 A;  4XSZ F;  3IL2 A;  3BJO A;  3WTW C;  2Z33 A;  1GXQ A;  4HX7 A;  3DPL C;  1Z6R A;  4LLN A;  5D8K B;  1ZGJ A;  3O6B B;  1SFE A;  3MWM A;  3R4K A;  2KIF A;  3HIF A;  4GYG A;  1IN6 A;  1RIO H;  4EQQ A;  1SFU A;  2DFI A;  4LD5 A;  1SMY F;  3KP6 A;  4GXO A;  4Q5S F;  3GYH X;  3KLN A;  3ABT A;  2VC0 A;  3W6J B;  2RDP A;  4HF0 A;  3V4G A;  1LQ1 A;  1U5T B;  1ZN2 A;  3E5X A;  1RUO A;  1S7O A;  3FHZ A;  2MC3 A;  1R58 A;  4JBA A;  4LK1 F;  1K78 B;  1FWZ A;  3SQN A;  4RAY A;  4UV9 A;  2VOD A;  3B02 A;  2Q8K A;  3F8M A;  3GX4 X;  1XN7 A;  5JHU A;  3H92 A;  4JK1 X;  1SD6 A;  3OV8 A;  1AOY A;  3BDD A;  3ELK A;  4U0Y A;  4O6J A;  1BM9 A;  1EH8 A;  2P5L C;  3AAF A;  1KU2 A;  3GZ5 A;  1BN5 A;  1SFX A;  4N0B A;  5E20 A;  3FZV A;  3GFI A;  3FX3 A;  2VOP A;  1R7J A;  5FFZ A;  4ESF A;  5DD8 A;  1D5V A;  4A5M A;  2LNB A;  1IN7 A;  4BHP A;  2PMH A;  4EM2 A;  5HOO A;  1TQP A;  1WKM A;  3TQN A;  4EJV A;  2QZ8 A;  3E6M A;  4QLC U;  1Z7U A;  2K7L A;  5F6F A;  4OIO F;  3KP5 A;  3IC7 A;  5D5U B;  3IRR A;  1K6O A;  2BGC A;  3FXU A;  1CGP A;  1HXD A;  5H6Q A;  2K86 A;  3GVA A;  4CDG A;  1O57 A;  2E7W A;  5HDG A;  4OIN F;  1V3F A;  2F5E A;  2O61 A;  1FNN A;  3LA7 A;  3J80 Z;  1U78 A;  1XD7 A;  3N97 A;  2Q2E A;  1XSD A;  2FA5 A;  1BC8 C;  4AIH A;  2RQP A;  1XSV A;  2UZK A;  3KCC A;  3LAJ A;  4I2O A;  3QPT A;  4BQA A;  1IRF A;  2DT5 A;  4HOB A;  3ROU A;  1B9N A;  5JVT A;  1G4D A;  3K1N A;  1O3S A;  1O3Q A;  4TV7 A;  4WXC A;  1Q1H A;  5HS7 A;  1G3W A;  3NRV A;  3BOQ A;  1ZLJ A;  4FX4 A;  3VEP A;  2WTE A;  4L0Y B;  1R5G A;  1MDM A;  2R3S A;  3LWF A;  5HLH A;  3GUD A;  4RGU A;  4IPA A;  4L18 B;  2COM A;  3V7R A;  3CLO A;  2HKO A;  4KFC A;  2H09 A;  3ZMS A;  1T39 A;  4AVP A;  4WXD A;  3WOD F;  2EJR A;  1GXP A;  1H0M A;  1REP C;  4XSX F;  4M71 A;  2EV6 A;  2EFN A;  2PEX A;  2STW A;  2GZW A;  4UHT A;  4PZJ A;  2X4H A;  1UHW A;  3HSF A;  2MLG A;  1MKM A;  5D6E A;  1YO5 C;  2OAZ A;  4UUV A;  3JSP A;  3BPV A;  4KA4 A;  5JI6 A;  5ICG A;  1R36 A;  1HSJ A;  5D5X B;  1XCB A;  2EV5 A;  5FO5 A;  3QP5 A;  3J7A O;  2A68 F;  1TW2 A;  3D5L A;  1EV7 A;  1ZG3 A;  4IF4 A;  2MH9 A;  1R1U A;  2EFW A;  3LA3 A;  1KU3 A;  2IW5 A;  1BI0 A;  2AXL A;  3HHH A;  3U9G A;  2OU2 A;  1ZRF A;  4HLY A;  5DUI A;  4EGY A;  1HST A;  2KIU A;  4CYD A;  2VC1 A;  2DK5 A;  3QP6 A;  2W25 A;  1Z1D A;  2XKO A;  5D8L B;  3RTR A;  4UVA A;  2DQL A;  4LLG F;  2MLK A;  1GHC A;  5LHG A;  3F21 A;  4IRG A;  1STZ A;  4AD9 A;  3FWE A;  2F2E A;  5ILV A;  4MEY F;  4LMY A;  3E5Q A;  4YIF A;  1Z6T A;  4UXN A;  1PP7 U;  5L3G A;  3M8E A;  4QWQ A;  2RV8 A;  1W5T A;  3K9T A;  2W57 A;  5K5O A;  5BQT A;  1L0O C;  5E1W A;  1XDU A;  3I59 A;  5J8C A;  4CHU A;  2M1B A;  4AWX B;  1E2X A;  2J5P A;  4I02 A;  1XCV A;  5HDN A;  1OKR A;  3W6K B;  4CZZ A;  2K02 A;  3GEZ A;  1GVJ A;  4IRH A;  3DPT A;  3P9I A;  3V8L A;  1P6R A;  1IN5 A;  3C7J A;  5JFR A;  2O03 A;  2YR2 A;  1QZZ A;  1BI3 A;  3VB2 A;  4ENJ A;  1BJA A;  4HX8 A;  2KRF A;  3DP7 A;  2IPQ X;  1RI7 A;  4BH9 A;  1LB2 A;  2Z5U A;  2L3D A;  2V1D A;  2IA2 A;  4EJO A;  3ZPL A;  3IHU A;  3WTS C;  1J0R A;  3LST A;  3QU6 A;  4KDP A;  4HDV A;  3KZZ A;  1TLH B;  1P92 A;  2YX4 A;  5D4S A;  3WE3 A;  2VE9 A;  3BWG A;  3F6V A;  1HW2 A;  4G8X A;  4KIG A;  4IRI A;  1TNT A;  2CO5 A;  2D2W A;  3SHF A;  3KP2 A;  3TO9 A;  4RB1 A;  1LEA A;  4L5J A;  3TO7 A;  4LK0 F;  3I59 B;  1BI1 A;  3KP4 A;  4I0B A;  2RKH A;  4HX4 A;  1XDS A;  1ZAO A;  4LG0 B;  3OOP A;  2GXG A;  1P2F A;  1UST A;  4Z2Y A;  1L3L A;  1XMA A;  3MZY A;  2NNN A;  4LB6 B;  4ZYD A;  4HBL A;  2ISY A;  5H6R A;  3J80 K;  1ZYR F;  2ESH A;  1FY7 A;  4XBF A;  1I1G A;  2D1V A;  1K7A A;  4HV6 A;  3WGG A;  5K5R A;  3I64 A;  3ZQ7 A;  3LQQ A;  1V4R A;  3U1D A;  5IT3 A;  1W7P B;  2O6G E;  3I53 A;  3WU0 A;  2VE8 A;  4WF2 A;  4LGW A;  2M5W A;  1ZRE A;  4ZYG A;  1OYW A;  1VTN C;  4OOI A;  4I09 A;  5E1X A;  5A2Q Z;  1B1B A;  2ZNZ A;  1WWX A;  5DD4 A;  1FC3 A;  3I5U A;  3HSR A;  1ULY A;  4EM1 A;  1H9T A;  5L3D A;  5J8F A;  1RNL A;  2OZ6 A;  4YFN F;  4MTE A;  2QYO A;  4P96 A;  1H9G A;  1FP2 A;  5HS9 A;  1FZP B;  1KA8 A;  3MEX A;  3TGN A;  4IVN A;  4S05 A;  3FMS A;  3L2C A;  6PAX A;  4HLX A;  3K1M A;  2GA2 A;  3HOS A;  1K79 A;  3F6O A;  4UNO A;  2VN2 A;  3HTU A;  1YS7 A;  2EB7 A;  2RC4 A;  1LEB A;  2NRA C;  1W7P A;  1ZAR A;  4KIF A;  4KUM A;  5D5W B;  2K4B A;  4AIJ A;  3R6S A;  3WTX C;  1HKQ A;  1R1V A;  2RGV A;  2JZY A;  2ELH A;  4FX0 A;  1BIB A;  3MCZ A;  1SMT A;  2HZT A;  5LBQ A;  4PGH A;  1BBY A;  3LAP A;  3REO A;  2CSO A;  1MJB A;  2BEO A;  4LB5 A;  5DCM B;  2QWW A;  3FXQ A;  2BV6 A;  1YG2 A;  3NQO A;  5LGT A;  4WWC A;  3L00 A;  1G3T A;  4O3M A;  3M8F A;  4H0E A;  5HVQ C;  1SD7 A;  1A04 A;  5LRS A;  5LRR A;  4HF1 A;  2DAO A;  4RAZ A;  4KMF A;  4HZF A;  3SZP A;  3TKY A;  4R79 A;  1U3E M;  4R1H A;  4G6Q A;  1G3Y A;  2CGP A;  1P4W A;  3I0T A;  3HRS A;  5L3B A;  4IXA A;  5E17 F;  5CVR A;  3KE2 A;  3R61 A;  2NAZ A;  3BRO A;  3RKW A;  1KQ0 A;  2FBI A;  2P5V A;  4ZYE A;  1FLI A;  4GGG A;  3IRQ A;  3MAJ A;  5HLG A;  3KLO A;  3ZP5 A;  4BXU A;  2W84 A;  4U0W A;  3R60 A;  1FYM A;  2PI0 A;  4EJT A;  1TW3 A;  3MQ0 A;  5FD6 A;  1KYZ A;  1S8N A;  1YLF A;  1S3J A;  1B4A A;  2B0L A;  3WTY C;  2YPR A;  2QVO A;  2ACJ A;  2DPD A;  3KFW X;  1R5H A;  4YFX F;  1CF7 B;  1S29 A;  3WU1 B;  5LLQ A;  1UHM A;  1HBX G;  5BS6 A;  2M8E A;  4OMY A;  4KT5 C;  2ZBK A;  4A6E A;  5DCM A;  5FGM A;  2H94 A;  1U5T A;  2HEO A;  1HKT A;  5L3E A;  2VBZ A;  3IWZ A;  1ZG1 A;  5E18 F;  2ZME B;  1KGS A;  1RUN A;  2IA0 A;  5CVV A;  5LEJ A;  4KIB A;  3JTH A;  2IRF G;  4ON0 A;  1FBQ A;  2L4A A;  4P9F A;  3GZ6 A;  1ODD A;  3ZN0 A;  4HF2 A;  4HA8 A;  2CYY A;  2G9W A;  4O5V A;  5E8I A;  2DI3 A;  1F5T A;  2A69 F;  3N4M A;  2XUB A;  1JHH A;  2E1C A;  2PN6 A;  4DNC A;  2DQR A;  2FU4 A;  1R1T A;  1XGM A;  5ICE A;  1W5S A;  4WK8 F;  3SFZ A;  3MFK A;  2ZKZ A;  3QAH A;  3SXY A;  3I58 A;  3JW4 A;  2ESN A;  4RB0 A;  1FP1 D;  3ZN1 A;  3C18 A;  2V6C A;  1O3R A;  2E7X A;  1P4A A;  3HYI A;  2A6H F;  3RJP A;  4PGG A;  5ERI A;  2OBP A;  1Y0U A;  2A3S A;  5A2Q K;  4MTD A;  4BHB A;  2CW0 F;  3I4P A;  5IT9 Z;  1TBX A;  2JPC A;  3GFL A;  4WXH A;  4U88 A;  1ZH5 A;  1SD5 A;  2Y48 A;  3H3U A;  4ZZL A;  5ICF A;  2RNJ A;  3TDU C;  5LHH A;  1LDJ A;  5AON A;  2XAJ A;  3F8N A;  3T0Y A;  2GQQ A;  2HS5 A;  4XRF A;  3CUQ A;  1G3S A;  3B73 A;  2F5D A;  4I98 B;  3PQK A;  2XRN A;  3PQJ A;  5EEG A;  3HTS B;  5E1Z B;  2HR3 A;  1QO0 D;  4IHT A;  2K4J A;  2F5C A;  1B59 A;  1CF7 A;  1AWC A;  2O3F A;  3Q5F A;  2PLY A;  3ISP A;  1OPC A;  4FT8 A;  4U7B A;  1FPQ A;  4ENK A;  3RDI A;  1OYY A;  4UVC A;  1YFH A;  1J75 A;  5DEQ A;  1JHF A;  4XLP F;  2V1X A;  2R7F A;  3J81 K;  1SD4 A;  1XMK A;  3O3K A;  4RGS A;  4M9S A;  4KYW A;  3M7G A;  3KP3 A;  1I6X A;  1E17 A;  4Y15 A;  1XSX A;  2PFB A;  3F8C A;  4L9T A;  1T2K A;  4L9N A;  2DPU A;  1T6S A;  4I01 A;  1DPR A;  2P8T A;  2HFH A;  3G3Z A;  1YW9 A;  2EA4 A;  2Z3Y A;  4HDU A;  1T98 A;  4Y17 A;  3ERE D;  3HUG A;  4KN7 X;  5TJJ A;  1UCR A;  3LA2 A;  5ILS A;  3MZH A;  4EGZ A;  1Z91 A;  3VOD A;  2FNP A;  4XLN F;  1O7L A;  3P7N A;  5DV5 A;  3HRM A;  2KKO A;  2WC2 A;  2IVM A;  3LQR A;  2HKX A;  4B8X A;  2PMU A;  3FF5 A;  2P6T A;  1BI2 A;  2XGX A;  4N9I A;  2CFX A;  5EEH A;  3Q9S A;  4YII A;  2ADU A;  1K78 A;  2CG4 A;  2A61 A;  2RN7 A;  1PDN C;  4U0V A;  3F3X A;  4GCV A;  1MJ9 A;  4G9Y A;  2ZCW A;  3P9K A;  5BPI A;  4LJZ F;  4I7H A;  5TRD A;  2FF4 A;  3DEU A;  1ON1 A;  1BC7 C;  4MNU A;  4A0Y A;  1YW7 A;  4YFK F;  2E1N A;  3BJA A;  3V8K A;  1USS A;  2O0Y A;  4ZYH A;  4WCG A;  1J59 A;  1I1S A;  2JRT A;  2V79 A;  3CUQ C;  4MEX F;  1J5Y A;  2QBY A;  2OQR A;  2FRH A;  3ZMD A;  2F5F A;  2IT0 A;  1B6A A;  1FBS A;  1P4X A;  2ZXJ A;  4G7H F;  5J6X A;  2HTJ A;  4E70 A;  4P55 A;  1QPM A;  2JSC A;  1T0F A;  1IUY A;  3E3V A;  1HW1 A;  1BOA A;  1UFM A;  1RZ4 A;  1FT9 A;  3E6D A;  3GWZ A;  1PP8 F;  5HLI A;  1NHA A;  4Y13 A;  5F1R A;  3QPH A;  3JSO A;  3F8F A;  5CVU A;  2YSR A;  4ENN A;  2X0L A;  2ZJ2 A;  3T8R A;  4K2E A;  1J9I A;  3ECH A;  3RI4 A;  1LDD A;  4HQE A;  4ESB A;  1C0W A;  3VOE A;  5K1Y A;  2P6S A;  3E6B A;  2ISZ A;  4P9U A;  2XAQ A;  2DK8 A;  2HTS A;  3EYI A;  3WG9 A;  2OD5 A;  3V7S A;  3I54 A;  4ESJ A;  2LF8 A;  3KZY A;  1D8K A;  3EUH A;  1F1Z A;  3WTU C;  4NB5 A;  1XGS A;  1QNT A;  2HYF A;  3L09 A;  2EA2 A;  4N9H A;  3I71 A;  1X3U A;  2OZU A;  2G7U A;  4I0A A;  1KU7 A;  4NHJ A;  1KQ8 A;  2Y0M A;  4CO8 A;  3FM5 A;  1IW7 F;  1WRJ A;  2FQ3 A;  2C6Y A;  4M9X A;  3DQV C;  2GAU A;  2FNA A;  1KU9 A;  4L9V A;  2XHK A;  2VOO A;  3KET A;  1DPU A;  1U8R A;  1Z9C A;  1YIO A;  1LNW A;  2HQN A;  3R0J A;  2HYG D;  3F23 A;  2DU9 A;  1F4K A;  3T1B A;  3D0S A;  2PG4 A;  2KJB A;  5DYM A;  2FOK A;  5DCF A;  5AIQ A;  2D1H A;  2AS5 F;  1G6N A;  1XGO A;  4HAM A;  1ZG5 A;  4YG2 F;  2V1U A;  3HRU A;  2FE3 A;  1R22 A;  1EH7 A;  2FXA A;  3CO6 C;  2HWV A;  4RB2 C;  3P9C A;  5FLX K;  4ZZD A;  3C1D A;  2EV0 A;  3RIR A;  1O7F A;  3K0L A;  4MQV A;  3LFK A;  5AIP A;  1B9M A;  1FOK A;  5FD5 A;  3ZMT A;  2DTR A;  3BJ6 A;  1R00 A;  1W7P D;  1YYV A;  1FYK A;  1PUE E;  3JAM K;  3IWF A;  2JPB A;  4KNY A;  2LKP A;  2WWY A;  2WV0 A;  1HKS A;  3R0A A;  5F64 A;  1TQM A;  2ETH A;  4M6X A;  2R7D A;  2XAS A;  1JXS A;  4ZH4 F;  4NQW A;  3CDH A;  3TOA A;  4CGZ A;  1IRG A;  3HRT A;  1OR7 A;  1ZRD A;  1TQI A;  4G7Z F;  2HQR A;  2UXN A;  5CJ9 A;  1YS6 A;  1XB4 A;  1OYI A;  2VXZ A;  4F7Z A;  4KN4 X;  4RGX A;  4LFU A;  2EFO A;  3FMR A;  4LLL A;  3EQL F;  2GXB A;  1ZLK A;  1FX7 A;  4EJU A;  3U2R A;  5D6F A;  2YU3 A;  4A0Z A;  2VBX A;  3GF2 A;  5L3C A;  2P7V B;  3HOT A;  1TTY A;  2QM3 A;  4P5O A;  2L02 A;  2HGC A;  3M1E A;  2KJC A;  2Q0O A;  5IT9 K;  3CO7 C;  2K27 A;  1ONV A;  2QEN A;  2QQA A;  2M87 A;  4S04 A;  1ZHF A;  2UXX A;  3RKX A;  4A12 A;  2W24 A;  2BE5 F;  3ECO A;  2STT A;  1W4M A;  3WGH A;  2JTV A;  3Q9V A;  5KVR A;  3QOP A;  4FHT A;  1YQA A;  5LGN A;  1ON2 A;  2IJL A;  4G94 A;  2XRO A;  3ML6 A;  1I27 A;  1SAX A;  1IF1 A;  2M30 A;  1XGN A;  2RVC A;  1UB9 A;  2H6B A;  3TOB A;  5KK1 A;  3WTZ A;  1LDK B;  4A5N A;  2XAG A;  5LEK A;  2QBY B;  2XIG A;  3JTG A;  5CYV A;  5BOX A;  3KP7 A;  1T38 A;  2L01 A;  4M9Z A;  3RYR A;  1HQC A;  3K1P A;  3FMQ A;  3L9F A;  3RPQ A;  3O2P E;  3ULQ B;  3J81 Z;  4BHC A;  5BMZ A;  4G7O F;  2NNY A;  2ZME A;  2IA1 A;  2YX7 A;  4HYE A;  2MBF A;  5DUK A;  3L7W A;  3HHG A;  2ZNY A;  2Z99 A;  2ZO4 A;  1MDM B;  1IXS B;  4L5I A;  3C3W A;  3RYP A;  4RB3 C;  2NS0 A;  2IP2 A;  3QU3 A;  1MGT A;  4LG0 A;  3EDP A;  2JT1 A;  4HW0 A;  4R8H A;  2L54 A;  2OQG A;  2DO7 A;  5CVI A;  3WTV C;  5DDG A;  3WE2 A;  3VFZ A;  3CTA A;  2A5Y B;  1QGP A;  2GA1 A;  4HQM A;  1IN4 A;  1ZGA A;  3GW2 A;  2FBK A;  5D4R A;  3EET A;  2XKP A;  3ZMV A;  5LGU A;  3CJN A;  3PFI A;  4Q47 A;  4UVB A;  4OU0 A;  3H3Z A;  2HOE A;  2ZFW A;  4RS8 A;  1WSU A;  2VBY A;  1S7A A;  2FBH A;  3IKT A;  2A07 F;  5ILU A;  3DXJ F;  3TO6 A;  4EM0 B;  4IJA A;  3FM3 A;  4EV0 A;  4BAY A;  3T5X A;  1QQI A;  2BBY A;  2MD5 A;  5HDK A;  3KEQ A;  1ZRC A;  2VBW A;  5CVJ A;  2DLL A;  3F8B A;  3TDZ C;  5FLX Z;  3CUO A;  4M74 A;  2Z9O A;  3GO5 A;  4ETS A;  1LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...