1XMAA

Structure of a transcriptional regulator from clostridium thermocellum cth-833
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
101
Chain Sequence
SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulator
publication title Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
rcsb
source organism Clostridium thermocellum
molecule tags Transcription
total genus 35
structure length 101
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xmaA00
1D8KA 3GFMA 5BPDA 1YO5C 2QZ8A 5H20A 5L3CA 1UHWA 5LRRA 2KRFA 4LGWA 4L5JA 1KYWA 1IN8A 2XKPA 5HLGA 2RV8A 1KQ8A 4BHBA 4HLYA 2ZXJA 4A0XA 2L3DA 4ESJA 1FSHA 3KP5A 3D0SA 2KJBA 4ESBA 4G6QA 1YQAA 2VOPA 2BV6A 3DF8A 2AXLA 2V1DA 3W6JB 3WTSC 1LVAA 1YW7A 3BWGA 1DPRA 1GHCA 3ERED 2EFQA 4OOIA 4A6DA 5D5UB 1LNWA 3SZPA 3KP4A 4E70A 2CGPA 1E17A 2J5OA 3IRRA 5H6QA 4DQ2A 2Z3YA 3HOTA 3E97A 2PG4A 3IC7A 2HYFA 2R7DA 2XAQA 4WX9A 1ZG1A 5LRSA 2Y48A 1R23A 3E3VA 4JK1X 4ETSA 3B02A 1Z1DA 4KICA 3OV8A 3V7CA 5HOOA 2K4JA 4EV0A 1U3EM 3N97A 2DAOA 3I0TA 4QLCU 2L54A 3WE3A 2J5PA 2V1XA 5E18F 2EA2A 1HXDA 3QP5A 1ZG3A 3I71A 4KIFA 5LHHA 1R1VA 4UVCA 3U9GA 4CZZA 4MTDA 4LLNA 2ETHA 4CDGA 1HSJA 3E5XA 5K5OA 1XD7A 4ZZLA 3L09A 3HUGA 3DPTA 2L02A 2LKPA 4IVNA 1RUOA 2O0YA 3T8TA 2FRHA 4EGYA 1DDNA 1I1GA 2OAZA 2QWWA 3R60A 1C0WA 2PEXA 4WCGA 3R61A 1ZAOA 5J6XA 1YW8A 1TLHB 1B59A 4LG0A 5E17F 1G3TA 5ICCA 2HTJA 3WGIA 2D45A 2XAJA 2FEZA 4LLGF 5D4RA 2EFPA 4UVBA 2UXNA 4LMYA 2DQLA 3WG9A 5HDNA 3CDHA 3BOQA 1E2XA 3FXRA 1YFHA 1SFUA 2QBYB 5JR3A 2EV0A 5DCFA 3WTUC 5CVRA 2PFBA 1ZRFA 4HYEA 1HKSA 1WKMA 4ZH4F 2OU2A 5ILVA 4P9FA 2DLLA 1F4KA 3ULQB 3FXUA 3T8RA 3LFKA 4IRIA 1XMKA 2YSRA 4G6DA 3CO6C 1R58A 2UZKA 4XBFA 3LWFA 2HOEA 2UXXA 4MTEA 4XLNF 5KVRA 4HQEA 1XSDA 1K6OA 2HEOA 4CGZA 3QU6A 4GO1A 2MLGA 3W6KB 2W24A 1J7KA 3TGNA 2O03A 1IN4A 1P2FA 4LK1F 5CVVA 4L18B 4UV9A 2F2EA 4PDKA 3MAJA 3ZPLA 2HTSA 3LSTA 1JE8A 4KN4X 1V3FA 3RJPA 3F8MA 1JGSA 4KIGA 4ZYEA 3F22A 3KP6A 1HW1A 1KYZA 4PGHA 3ECHA 1XN7A 3V7RA 3FF5A 4HX4A 1GXPA 2BBYA 1JXSA 4S04A 2ZMEA 1Z9CA 5ILSA 1OR7A 4CO8A 2HDCA 5FGMA 2BGCA 4AIJA 1XMAA 1ZGAA 4UV8A 3VEPA 3KETA 2R3SA 2UWMA 4EVIA 2W57A 4ZYDA 2A6EF 2ZNZA 3KLNA 4BHCA 1W4MA 2IA0A 3TDUC 3ECOA 3I59B 4QWQA 4XSZF 1IAWA 1WRJA 1ZREA 1TNTA 4RGXA 2WWYA 1IZ1A 3L9FA 5K1YA 4IHSA 4KDPA 1LEAA 1DUXC 2V79A 1HW5A 1WI9A 4UNOA 2KIFA 1BBYA 3J81Z 4KT5C 3VB2A 3HYIA 2DFIA 1RNLA 1WQ2A 2BE5F 3JSOA 1U5TB 5A2QK 3KCCA 3S2WA 3KP2A 2A07F 1I27A 1MKMA 3AAFA 1G6NA 1HSTA 4BAYA 3FHZA 4RB2C 1ZARA 4Q4ZF 3TDZC 1HW2A 1LDJA 5FO5A 2GA2A 3H3UA 3BJOA 3DXJF 1K78B 2MA3A 1YLFA 2G7UA 3ZMZA 3F8FA 2A69F 4OIPF 2W85A 1XGOA 4RAYA 2VBYA 3WGHA 2P6SA 3T5XA 2FU4A 1K78A 1FBSA 1OMIA 2EFWA 4ENKA 3GF2A 1FNNA 4U0WA 3RKYA 2VE8A 1O3QA 3JTHA 3QPTA 3MCZA 5DUIA 2X0LA 2RC4A 2ZJ2A 3MQ0A 2GXBA 1MJBA 1IUYA 1J5YA 2R7FA 4HV5A 1U5TC 2M45A 2MBFA 3ELKA 1F5TA 1Z05A 4U0VA 2QVOA 1SD5A 3QPHA 4H0EA 4UXNA 2FSWA 1BI1A 3E6CC 2G9WA 4CICA 5BOXA 1S29A 3ZMUA 4HF1A 3ISPA 5D6EA 4GYIA 1IW7F 3KEOA 2Z33A 2JTVA 4B09A 1W5TA 4UUVA 1DP7P 4MEYF 3BJ6A 5DDGA 3IKTA 2OA4A 4G7OF 3VODA 5F1RA 4A0ZA 1MDMB 3ABUA 3J80K 5DYMA 4HQMA 4Z2YA 4N9IA 2OQRA 4WXDA 1SD6A 4LD5A 3LAJA 1SAXA 3K0LA 4IF4A 3T0YA 4EQQA 1OPCA 2VBWA 4Y13A 4Y17A 5L3BA 2FXAA 5F6FA 3F72A 4RGSA 1RZ4A 2IVMA 2HYGD 5HDGA 3TO7A 1G3YA 3U1DA 1KQ9A 4L5IA 2KKOA 2D1VA 4A12A 1D8JA 4MGRA 1QZZA 2FNAA 1BM9A 4YIFA 5A2QZ 1ZYRF 4I02A 1IRFA 5E1WA 3E5QA 4YFKF 3FM5A 4RB0A 2IA2A 2EV5A 3RPUA 2BYVE 4L9VA 1WSUA 4I7HA 4EM1A 1R5HA 3BY6A 3MWMA 2XAFA 2JT1A 3RPQA 3GZ5A 3MZYA 5D8KB 3HIFA 1CF7B 2GAUA 1JHHA 4A2UA 3WTYC 2FQ3A 2WC2A 3CO7C 4YFNF 2NS0A 4U0YA 2E1NA 1G3WA 1BC7C 3O6BB 1LB2A 1V4RA 2O6GE 3EYIA 4K2EA 4AIKA 1BJAA 2DTRA 2CWEA 4F7ZA 2DK5A 3IWZA 2BEOA 2STTA 1KU3A 3FMSA 2XV4S 3GVAA 1RUNA 5BS6A 3CTAA 4HDVA 3P9CA 3GLXA 3C7JA 1G3SA 2WTEA 5DV5A 3V7SA 1B1BA 2RQPA 2QYOA 2AS5F 2IPQX 1ZG5A 3GFJA 1XGSA 2HQRA 3SHFA 3BPVA 1KU7A 2MH2A 4LLLA 2HR3A 2LSOA 2QQ9A 3J80Z 1QGPA 1ULYA 1ONVA 3NQOA 5D5WB 2O61A 2O3FA 3M7GA 1S7AA 3E6MA 5E1XA 3MEXA 2DU9A 2F5EA 2WV0A 4TV7A 3SXYA 4RAZA 1FY7A 2W84A 3QRFF 5J8CA 3GUDA 4KMUX 1GVJA 5BPIA 2XROA 2RNJA 1KU2A 2HS5A 2F5FA 3HHHA 3RDIA 3WTZA 3GFLA 1SFXA 3BROA 5CJ9A 3D5LA 3TO6A 5CLSA 4GXOA 2OBPA 5LHGA 2P8TA 4FT8A 4HW0A 2DPDA 1R7JA 2CQKA 3JAMK 1XB4A 3VOEA 5JI6A 1FC3A 1FOKA 3ZMTA 5LBQA 1EH7A 2PI0A 3KE2A 3G3ZA 4R8HA 3NEUA 3DKWA 1D5VA 5D5XB 2VXZA 4HX7A 3VFZA 3I58A 4M9XA 3J81K 2IP2A 2H09A 3EQLF 3QAHA 1OKRA 4M9ZA 4ESFA 3CUQB 1ODDA 4WWCA 3F23A 5AIQA 1Y0UA 2ADUA 3HOSA 1XGMA 4U7DA 2XGXA 1FYKA 4G9YA 2QBYA 3F6OA 4HV6A 2FF4A 3GEZA 3LA7A 2GQQA 1XCBA 3DP7A 1YYVA 2E7WA 5EEGA 2H94A 4M73A 1PDNC 2CYYA 3BP8A 3COAC 2PBIA 4Q5SF 4L9JA 5ILUA 2DW4A 1SD7A 4Q48A 1T39A 2EV6A 2LF8A 4RB1A 2DBBA 2P5VA 2P7VB 4IHTA 3R6SA 4M72A 3PFIA 1U2WA 2X4HA 4MHGA 2NRAC 2IRFG 4KA4A 5CVUA 1USSA 5HS9A 1BI2A 2GIVA 1T6SA 3JTGA 5HLHA 2YU3A 2PLYA 1O7FA 3I54A 1P4XA 3CUQC 5D4SA 3H3ZA 5DD4A 5FFXA 4KMFA 1YS7A 2OD5A 3RYRA 5BMZA 4S05A 4HOBA 1F1ZA 2Y0MA 1TNSA 3KZYA 4G7ZF 1VTNC 2IT0A 4YFXF 1K7AA 2VOOA 1LJ9A 1LDKB 5TJJA 1Z7UA 3JAMZ 3ML6A 1O3RA 2XRNA 1T0FA 3B73A 2FOKA 5FD5A 1STZA 3L7WA 2ISYA 3FM3A 3LA3A 1I6XA 1B9NA 1D3YA 2Z99A 4A5NA 1J9IA 1ZHFA 3F3XA 2W25A 2NNYA 2QM3A 2TDXA 1Z6RA 3GX4X 4ZZDA 1FPQA 1XSXA 1XCVA 3I59A 2F5CA 1FP1D 1TTYA 4ASNA 4EM0B 1X3UA 3O2PE 1MJAA 4HF2A 5FFZA 1L0OC 3P7NA 1YS6A 3R4KA 2VBXA 5DCMB 4IRHA 2L01A 3DV8A 1SD4A 2YX7A 1HBXG 2A5YB 4WK8F 4HAMA 3ZMVA 1HKTA 3TKYA 2B0LA 1IXSB 3Q5FA 1UCRA 1IN6A 1U5TA 2LDUA 5HVQC 1KQ0A 2P7CB 1NHAA 5AONA 4A5MA 4MEXF 2D2WA 2V9VA 3KP7A 2VC1A 5ICEA 5LEKA 3KZZA 3MZHA 1FT9A 2ZNYA 1R1TA 2VBZA 3GXOA 2ZFWA 3ZP5A 3WU1B 3EDPA 1ON2A 1W7PD 2KJCA 3O3KA 2HKXA 3K1MA 4IRGA 2P5KA 1O3SA 1J2XA 2M30A 5TRDA 4P5OA 4BH9A 3E6BA 3V8JA 4NB5A 3K9TA 4FHTA 4OMZA 1ZGJA 4JBAA 5DEQA 2VE9A 3SZTA 4OIQF 2PJPA 1MJ9A 2FE3A 4CYDA 1FYLA 3E5UA 3TQNA 3HSRA 3GFIA 4BNCA 1BC8C 1LDDA 3ABTA 4R1HA 4AIHA 4FX0A 4EJTA 4M9SA 2Q0OA 3IHUA 1BI0A 4M71A 3F8BA 1ZLKA 2O8XA 2VODA 1ON1A 3M1EA 4HF0A 3FX3A 3IRQA 1BIBA 3C18A 4XSXF 2H27A 4AVPA 3I64A 2XAGA 3Q9VA 1I5ZA 2OZ6A 4OIOF 1MDMA 1TQIA 2P4WA 4GGGA 4M74A 3WTXC 2HFHA 1BI3A 2MD5A 2PMUA 5BQTA 1T98A 1B6AA 3FMRA 1HQCA 5D6FA 3LQQA 3QOPA 1IXRC 3CUOA 1FX7A 2P5LC 1YIOA 3NRVA 2HWVA 1FWZA 4ENJA 2PMHA 3ZN1A 4LB6B 1R36A 1LQ1A 2EA4A 2GA1A 4EJUA 1H0MA 2ISZA 3RI4A 2JRTA 4P9UA 1ZH5A 4I0AA 2A68F 4FX4A 3IL2A 2E7XA 3HTSB 1P4AA 2COMA 2OQGA 2DK8A 1IRGA 4HLXA 4ENNA 2YX4A 2HQNA 5JHUA 1Q1HA 4HZFA 4MQVA 1FLIA 3RTRA 2XKOA 3WTTC 1K79A 3GWZA 2VT2A 5HDKA 3TOAA 1USTA 4KN7X 5E20A 1UHMA 2EFNA 4PCQA 1CF7A 4EJOA 1PP8F 3RKWA 1S8NA 1OYWA 5LLQA 5CVJA 4N9HA 3QP6A 3IKVA 4I01A 2Y75A 2XAHA 3BPXA 1J75A 4RGRA 3L2CA 2H6CA 1ZN2A 3I53A 1QZYA 3P9KA 3M8FA 1L3LA 2ZBKA 1R00A 2PN6A 1GXQA 4IPAA 2JPBA 4U7BA 3EYYA 4G7HF 1U8RA 2QQBA 4HX8A 4LB5A 2QLZA 3HSFA 1CGPA 2DPUA 2EFOA 5L3GA 1AOYA 1KGSA 3JW4A 2A3SA 2LNBA 3MFKA 4OIRF 1S7OA 1PP7U 2YPRA 4ZYHA 5CVIA 1RIOH 4I2OA 4GCVA 1SMTA 4P55A 5L3DA 2IA1A 1W7PB 4MQ9F 1OYYA 3WU0A 5E8IA 2FMYA 3HRMA 3WGGA 3WODF 2CW0F 5LHIA 4OMYA 3L00A 2A6HF 2XVCA 2HGCA 3GZ6A 4EJWA 4MNUA 5E1ZB 1YG2A 3HRTA 3F6VA 4HBLA 3U2RA 1W7PA 2K02A 1PUEE 1G4DA 1S6LA 2ZO4A 1R5GA 3H92A 5E8GA 3CJNA 2YR2A 5HS7A 3N4MA 4L9NA 4LFUA 2Z9OA 2ELHA 2EK5A 2KIUA 2M8EA 2XHKA 1EH8A 1XDSA 1F9NA 3I5UA 2VN2A 3C1DA 2QENA 1FBQA 3F8CA 3T1BA 4CXFA 1FBUA 1EH6A 2Q2EA 4LG0B 4IXAA 2IJLA 3DFGA 3KP3A 3EETA 3GO5A 4UHTA 4A6EA 1YTYA 1A04A 4OU0A 3ROUA 3WE2A 2DQRA 5LGNA 1QNTA 3K2ZA 2ESNA 3V8LA 4P96A 4ZYGA 3F21A 1QBJA 3IWFA 4WXCA 4L0ZB 1TBXA 2JSCA 2RDPA 2C6YA 3M9AA 2GWRA 5FD6A 5H6RA 2ESHA 5K5QA 2A61A 2K27A 1MGTA 3P9IA 1R1UA 2RN7A 2K86A 4RGUA 4IJAA 3HTUA 1J0RA 1TQMA 2V1UA 1T2KA 4KNYA 2RGVA 2E1CA 4NHJA 3HRSA 3RYPA 3HHGA 3CUQA 4G8XA 3EUHA 1I1SA 1O57A 5IT3A 2D1HA 3DEUA 4EMSA 3REOA 1O3TA 1T38A 4YIIA 3C3WA 4O3MA 2ZCWA 3GW2A 2PQ8A 4YG2F 4UVAA 5FB2A 1P4WA 5HLIA 2F5DA 4I09A 4PZJA 5KK1A 3KFWX 3JSPA 4L9TA 5ERIA 5ICGA 5J8FA 2QUFA 3LA2A 1QO0D 2FA5A 1KU9A 2IW5A 3PQJA 4OINF 2VONA 5FLXK 1Z6TA 4LJZF 1FSEA 1TW3A 4XLPF 5HS8A 2MH9A 5L3FA 2L4MA 2FBIA 2GXGA 4CHUA 1IN5A 2OZUA 2M5WA 2DT5A 2ZMEB 1P6RA 4M6YA 3G73A 4U88A 5EEHA 3ZMDA 1AWCA 4BXUA 2XASA 4D0PA 5F64A 4KYWA 3K69A 4G94A 1QQIA 4R79A 6PAXA 4RB3C 4I98B 1B4AA 5JFRA 4DNCA 1XDUA 5IT9K 2P6TA 4M6XA 4KIBA 3OOPA 1U78A 2EJRA 4BQAA 2KIMA 1TW2A 1QPMA 5ICFA 2JZYA 1ZRCA 4I0BA 4O5VA 1J59A 1REPC 3GYHX 3HSEA 2FNPA 4JQFA 3LAPA 5K5RA 4AD9A 2Q8KA 3I4PA 1BOAA 1XGNA 2CG4A 3ZMSA 2MC3A 2ZKZA 1FZPB 4L0YB 4LK0F 1P92A 2HZTA 5DCMA 4XRFA 2XIGA 2JPCA 3J7AO 2K4BA 4B8XA 3FXQA 1IF1A 2V6CA 1EV7A 1U6GA 1Z91A 2EB7A 1MZBA 3BJAA 3ZN0A 3ZQ7A 2DI3A 3R0JA 3BDDA 1JHFA 2M1BA 2MLKA 3FWEA 1UFMA 3SQNA 5L3EA 2L4AA 2NNNA 5AIPA 2G7HA 2K7LA 2RKHA 1IN7A 5FLXZ 1ZRDA 1FYMA 3K1PA 5JVTA 1TQPA 3WTVC 1O7LA 4AWXB 3DQVC 1KA8A 5D8LB 3M8EA 5DUKA 3FZVA 1SFEA 4KUMA 2VC0A 2Z5UA 4ENMA 1BIAA 3QU3A 2XUBA 4HA8A 4EJVA 2M87A 4N0BA 4O6JA 4WXHA 2RVCA 4BHPA 3FMQA 1MD0A 1OYIA 5LGUA 2QQAA 4HDUA 3V4GA 4A0YA 4PGGA 4EM2A 1W5SA 1S3JA 3E6DA 2VT3A 2CO5A 3F8NA 4NQWA 2FBKA 3BZ6A 5D5VB 3HRUA 3RIRA 2NYXA 2DO7A 2CFXA 2STWA 5IT9Z 1H9TA 5DD8A 3KEQA 2EWNA 3Q9SA 3LQRA 1SMYF 2FMLA 1ZLJA 2GZWA 3R0AA 4Y15A 1WWXA 5ED4A 2NAZA 2CSOA 3WTWC 3KLOA 1XSVA 2ACJA 4Q47A 4BYYA 1BN5A 2H6BA 1YW9A 1HKQA 2HKOA 5LEJA 4GYGA 1UB9A 4EGZA 1LEBA 3SFZA 5LGTA 3RKXA 1FP2A 3CLOA 1IXCA 3V8KA 1H9GA 3PQKA 4RS8A 3TOBA 4WF2A 4KFCA 1DPUA 3TO9A 1R22A 2LF7A 4ON0A 1RI7A 3DPLC 2FBHA 1B9MA 5CYVA 3K1NA
chains in the Genus database with same CATH superfamily
1D8KA 2I10A 2WA0A 1CQTA 3GFMA 3HL2A 5BPDA 1YO5C 1U0JA 2QZ8A 5H20A 5L3CA 1UHWA 5LRRA 2KRFA 1G8XA 3L2WA 4LGWA 4NNJA 4L5JA 4CYCA 1KYWA 2LVSA 3ASNH 1IN8A 2XKPA 5DM6F 5J1UA 5HLGA 2RV8A 1KQ8A 4BHBA 3MZ8A 4HLYA 2ZXJA 2QKMB 4A0XA 4CSWA 2L3DA 2DCEA 4ESJA 2BHZA 4KJZA 1FSHA 4IL6C 3KP5A 3D0SA 2KJBA 5C4JJ 4ESBA 2EPFA 1AHDP 2L2OA 3F0CA 4G6QA 1YQAA 1RESA 4D1QA 3DBHB 4IHWA 2ZFUA 2VOPA 1Z7LA 4BGDA 3L2UA 1I50J 3E7LA 3GTGJ 2BV6A 2DDAA 5FRMA 3WG7H 3DF8A 2AXLA 2V1DA 3W6JB 3WTSC 3OYCA 3CCQI 1LVAA 3RQIA 1E0EA 1YW7A 1ZR2A 1BR2A 3BWGA 3S8PA 2W1OA 1DPRA 2YS9A 2JUGA 1NK2P 1GHCA 2CUZA 3ERED 2BOLA 3K70D 2EFQA 1UAAA 4C9YA 4OOIA 2JQ7A 1BJZA 4A6DA 5D5UB 4FQGA 4FISA 1N77A 1LNWA 3SZPA 3KP4A 4I6ZA 2EZKA 4E7JA 4E70A 2CGPA 1ORKA 3ZQQA 1E17A 1QU3A 2J5OA 3IRRA 5H6QA 4DQ2A 3PFYA 2Z3YA 3HOTA 3E97A 2PG4A 3CF2A 3IC7A 2HYFA 3HG9A 2R7DA 5E79C 3MKWB 4I76A 1UELB 2XAQA 3MD2A 4WX9A 4RBOA 1ZG1A 3LSRA 4YELA 2CMPA 5LRSA 2YU9J 2COBA 1QHHD 2Y48A 1R23A 3E3VA 3HPHA 2DYSH 4JK1X 3PNTA 4ETSA 3B02A 1Z1DA 4KICA 4BUPA 4HNTA 3H0GJ 3OV8A 3V7CA 5HOOA 4A3JJ 4C2TA 2IBDA 2K4JA 2GXAA 1OCZH 4EV0A 1U3EM 3N97A 2DAOA 3I0TA 4QLCU 1IGNA 2R7RA 3HJEA 3BTIA 1K6YA 1WHUA 1P9QC 4QPQA 2X1DA 1PUFB 2L54A 3WE3A 2J5PA 5IP7J 1UG2A 2V1XA 4OAZA 5E18F 3OYJA 2EA2A 3OYNA 3RZDJ 4AM3A 3CMMA 1HXDA 1VF9A 1HLVA 3J7ZI 3L2VA 3FXMA 3QP5A 1ZG3A 2W82A 2XDVA 5FKOA 3I71A 4XR6A 4KIFA 3L2RA 3EUKL 1T33A 3SEZA 4DIQA 5LHHA 1R1VA 2P81A 4UVCA 3U9GA 4CZZA 4XKCA 4MTDA 3AFHA 3G2BA 1H89C 3FK7A 2VLAA 2L9SA 4LLNA 4D7MA 2ETHA 4CDGA 1HSJA 3E5XA 5K5OA 1XD7A 4ZZLA 2HDDA 3QPSA 5GAEJ 3L09A 3AG1H 3HUGA 3DPTA 4M3GA 2E71A 2L02A 2LKPA 1YJ9I 2KDOA 4IVNA 1RUOA 2KT0A 2O0YA 3T8TA 2FRHA 1SVOA 4EGYA 1DDNA 1I1GA 4BJ5C 2OAZA 2R5YA 2XAUA 3Q0VA 2CV1A 2QWWA 3R60A 1C0WA 1ENHA 2PEXA 2JUCA 4M3DA 4WCGA 3R61A 1ZAOA 2CQ7A 5J6XA 1R5ID 1YW8A 1TLHB 3TMOA 2VQCA 4UUTA 1B59A 4LG0A 5E17F 3HPGA 3JREA 1G3TA 1KONA 2LH9A 4DYRA 5ICCA 2HTJA 3WGIA 2D45A 1VFCA 3KEYA 2LFBA 4XRSG 2XAJA 2FEZA 4LLGF 4RM3A 1S72I 4PFOA 2L9VA 4XMYA 5D4RA 3PUBA 3Q0UA 4XLFA 4C3IJ 2EFPA 4UVBA 2UXNA 4LMYA 4MFEA 2DQLA 3WG9A 3S3MA 5HDNA 3MVPA 3CDHA 3FDYA 2JRMA 3BOQA 1Z67A 4JX6A 2DN0A 2F4OB 2DOEA 1K4TA 1B8IB 2HNHA 5B1AH 5CKTA 2DTZA 1YITI 2LLKA 1E2XA 3KZIC 1POGA 4GRIA 2R5ZA 3FXRA 3K4CA 3UKGA 2X85A 5EJCA 1YFHA 3Q0WA 4CUGA 1LE8A 2KDZA 1SFUA 2ZC2A 1QRYA 2R7QA 1VQ8I 2QBYB 5JR3A 4IHVA 2EV0A 5DCFA 3WTUC 5DTDA 4E7HA 5CVRA 2PFBA 1ZRFA 4HYEA 4N4NB 1HKSA 1YJNI 1WKMA 4ZH4F 2OU2A 5ILVA 4P9FA 3VYRB 1PYVA 2DLLA 2KLOA 2M0CA 3D5SC 1F4KA 3ULQB 3FXUA 2N8GA 3T8RA 3K6GA 3LFKA 4IRIA 2MSYA 3GTKJ 1ZKGA 1XMKA 2YSRA 4G6DA 4B47A 3CO6C 1R58A 4A3EJ 1Z3XA 4A3BJ 2UZKA 2JK3A 4XBFA 2VJ4A 3LWFA 2HOEA 3UR3C 1YRNA 2JN6A 2UXXA 4MTEA 4XLNF 3BQYA 2QGUA 4BDZA 4W97A 2O7OA 5KVRA 4HQEA 4BL0B 5J47A 1XSDA 3DEWA 4HG2A 1K6OA 2HEOA 3V42A 4CGZA 1J09A 3QU6A 4GO1A 2MLGA 3W6KB 2W24A 2PJRA 1J7KA 3TGNA 2LKXA 2O03A 4H4KC 2GIZA 1IN4A 1P2FA 4LK1F 1RR8C 3FBIB 5CVVA 4BQQA 4L18B 4UV9A 2F2EA 2HOTA 3IV5A 3CP8A 4PDKA 3LSKA 3CD6I 4AYBA 3LSPA 1YJWI 2DMUA 2DA4A 2ZJQF 2OJED 3PM1A 3MAJA 4F3QA 1JTXA 3ZPLA 2HTSA 3LSTA 1JE8A 4KN4X 1V3FA 3RJPA 3F8MA 1MBKA 1MBHA 2BXZA 2KL4A 5J1RA 4A3FJ 2M34A 1JGSA 4KIGA 4A93J 2GLOA 3PL8A 4DJAA 4ZYEA 3F22A 4CCKA 3NARA 2VB6A 3KP6A 4XLHA 3TP3A 3CJTB 4A3CJ 2HI3A 1HW1A 1KYZA 4PGHA 4HEA2 3ECHA 1XN7A 3PNYA 4BE0A 1P7IA 3FF5A 3V7RA 1VQMI 1X2MA 4HX4A 1GXPA 1UZCA 3K4MA 2BBYA 2QCOA 1JXSA 4S04A 2ZMEA 1Z9CA 5ILSA 2JA2A 1OR7A 4F93B 4CO8A 2DOAA 2HDCA 2NS8A 5FGMA 2BGCA 2GBYA 4AIJA 1XMAA 1ZGAA 2HZDA 3BTLA 2CQXA 3K4BA 4UV8A 2BXYA 3VEPA 3AKZA 3KETA 3TW6A 2R3SA 3ESWB 3VYTB 3FBNB 2UWMA 4NDLA 2BW3B 4P1WA 4EVIA 3I9V2 4BY7J 2W57A 3G71I 4RLQA 4ZYDA 4CCJA 5E3LA 5M3MJ 3VWBA 2JVHA 2A6EF 2L0KA 2ZNZA 1TWHJ 3KLNA 4BHCA 1W4MA 2R93J 2IA0A 3IH2A 3TDUC 3CZ6A 3ECOA 3I59B 4QWQA 4XSZF 1IAWA 1WRJA 2MW8A 3S3NA 4ZTFA 1ZREA 1TNTA 5KAFC 1IV8A 1R49A 4RGXA 2WWYA 3FISA 1IZ1A 3L9FA 5K1YA 4IHSA 4KDPA 1LEAA 4ANJA 3CDIA 4G6TB 2ZMEC 1BW6A 4BBSJ 4BU2A 1S9HA 1DUXC 3K70C 2V79A 1HW5A 1WI9A 4LOCA 4UNOA 1BA5A 2R7UA 2KIFA 5IYCJ 2DJNA 1BBYA 3J81Z 4KT5C 3VB2A 3HYIA 4L5EA 2PMZN 4CH7A 1IV6A 3CESA 2DFIA 1RNLA 1WQ2A 2OUMA 2VKHA 2BE5F 2TRTA 2LMDA 3JSOA 1A31A 1UHSA 1U5TB 3DWLE 2LREA 5A2QK 1WJBA 4XRSA 3KCCA 2HVSA 3W2AA 5FROA 3S2WA 4QSHA 3KP2A 2A07F 2HVQA 1I27A 1MKMA 1Z77A 1G6NA 1HSTA 4BAYA 3AAFA 3FHZA 3W2WA 3P5JA 4RB2C 4N4OB 1JT0A 1ZARA 5DS9A 1A6QA 2XB5A 4Q4ZF 3TDZC 2FUG2 1HW2A 4DW6A 3QWLA 4X6AJ 1LDJA 2VL8A 2JA7J 5FO5A 5H2FC 2GA2A 2XPVA 4BEHA 3H3UA 3BG5A 2DA3A 3BJOA 3H9QA 1W0TA 3CP2A 4HSRA 3IP4B 3DXJF 1K78B 2MA3A 4LITA 4XKWA 3PSIA 1YLFA 2G7UA 4XM3A 4EEFG 3OL3A 3G1LA 2R7SA 3ZMZA 2Z2SB 3HGGA 3OY9A 2CJJA 2KMUA 2A69F 3F8FA 2YUSA 4OIPF 2W85A 1XGOA 4J19A 3OYGA 3N05A 1GVDA 4RAYA 2VBYA 3WGHA 3SDBA 2DA5A 2P6SA 2KPMA 3BLYA 1NK3P 1XX5A 1P7JA 3T5XA 3TP0A 2V6EA 2FU4A 3NWSA 1K78A 1FBSA 1OMIA 2ELJA 2EFWA 4ENKA 4NBQA 3GF2A 2M4GA 1FNNA 4U0WA 3RKYA 2VE8A 1O3QA 3DKYA 3JTHA 3MCZA 3QPTA 2X0LA 2RC4A 2ZJ2A 5DUIA 5HNHA 1HDPA 3MQ0A 2GXBA 1MJBA 1IG7A 1IUYA 3TL4X 4XONA 2M7BA 4IQ4A 1J5YA 2ME0A 2R7FA 4HV5A 1U5TC 2M45A 2E5ZA 4II3A 2MBFA 3ELKA 1F5TA 3E0JB 1Z05A 4U0VA 2QVOA 2Y0SN 3I4NJ 3KPHA 1SD5A 3QPHA 5GTHC 3EUAA 4H0EA 4UXNA 2FSWA 1BI1A 3E6CC 2G9WA 4CICA 1FOYA 4CCNA 5BOXA 1S29A 5IP6A 3ZMUA 4HF1A 3MKZA 3ISPA 4NC8A 2KZVA 5D6EA 3W6VA 4FETA 4GYIA 3OYAA 1YI2I 1IW7F 1FTTA 1FOWA 3AL0B 3HOUJ 3KEOA 2EIMH 4A3GJ 2Z33A 2JTVA 3S93A 3WHBA 2EZHA 3BG9A 4B09A 1W5TA 4UUVA 1DP7P 2WY8Q 3VDXA 3S17J 2L7MP 4MEYF 3MKLA 3BJ6A 5DDGA 3IKTA 2QSHX 2OA4A 3DBLB 4CA0A 4G7OF 3VODA 5F1RA 4M3BA 4A0ZA 4HPQA 1W5CC 2JJ7A 1MDMB 3ABUA 3J80K 3CJRB 5DYMA 2WAQN 4HQMA 4Z2YA 4N9IA 1JJ8C 4BS9A 1VQ5I 1VQ4I 2OQRA 4WXDA 1SD6A 4LD5A 3LAJA 3AG3H 5EEAA 1SAXA 2F4IA 3K0LA 2FQ4A 4IF4A 1Y56A 3T0YA 3OSFA 3U21A 4EQQA 1OPCA 2VBWA 1TP4A 4Y13A 2K85A 2F48A 4Y17A 5L3BA 2FXAA 1FIAA 3NAUA 5F6FA 4E7ZA 3F72A 4DGWB 3BC8A 1EKEA 3A02A 3ZOBA 4RGSA 1RZ4A 1Y1VJ 2HYGD 2IVMA 5HDGA 3DLLF 3TO7A 1SVLA 1G3YA 3U1DA 1KQ9A 4L5IA 2KKOA 2RAEA 2HOAA 2D1VA 4A12A 1D8JA 4MGRA 2MD0A 3ZQGA 4RA2A 1QZZA 1WJAA 2FNAA 2F6CA 3OS0A 1BM9A 3I4MJ 4YIFA 3HDDA 5A2QZ 1ZYRF 4I02A 3I3LA 1IRFA 5E1WA 3E5QA 4E4HA 1QA6A 4YFKF 3FM5A 4RB0A 2IA2A 3ABMH 2EV5A 3RPUA 1H8AC 2BYVE 4L9VA 2R7TA 1BW5A 3S32A 3AL0C 1WSUA 4AYBN 2G0EA 5GAGJ 2OPTA 4I7HA 2E2IJ 2K40A 5EZGA 1GV2A 4EM1A 1R5HA 2F5VA 2H1LA 1RRJA 2EINH 5B5EC 3BY6A 5LFAA 2LBFB 3MWMA 2XAFA 3HOZJ 2R7OA 2JT1A 3VYUB 3RPQA 2QQ8A 4XKBA 2Y9YA 3GZ5A 2BHYA 3MZYA 5D8KB 2W4SA 3HIFA 2BY2A 1CF7B 1XC5A 4UB6C 1LFBA 2GAUA 1JHHA 4A2UA 3PO3J 3WTYC 2FQ3A 2WC2A 2V7FA 4E6KG 1D1CA 3CO7C 1T8IA 4YFNF 2NS0A 2WB1N 4ZC3A 1I3AA 3UNGC 4U0YA 2LYCA 2E1NA 2M4KA 1G3WA 4C2UA 1BC7C 3O6BB 1LB2A 1V4RA 2O6GE 3H1CA 2IEKA 3EYIA 4IEJA 4K2EA 1MH4A 1B72B 3Q3SA 4AIKA 2A5WA 1BJAA 2IS1A 4RLFA 2DTRA 4C2MJ 2CWEA 5BNGA 4F7ZA 2DK5A 3IWZA 3DEEA 2VJJA 4X1EA 2QF7A 2L7FP 5CQEA 4F91B 2BEOA 5HLTA 4CCMA 2STTA 2X9DA 1KU3A 1OQYA 2HPMA 3FMSA 2XV4S 1B72A 2MGQA 3GVAA 3PSFA 3H3VK 1RUNA 1ETQA 3IH3A 3KX2A 4IHYA 5BS6A 3CTAA 2IGMA 3JCUC 2NVTJ 2VI6A 3BCBA 4HDVA 2AHQA 3P9CA 3GLXA 3C7JA 1G3SA 4DZJA 2EILH 1TZLA 2WTEA 4Y4RA 5DV5A 1F43A 4NC6A 3V7SA 1B1BA 2RQPA 2QYOA 2AS5F 2IPQX 2PMZA 1ZG5A 3JRFA 2CV0A 3GFJA 2KHMA 3ZRGA 4NC7A 1TWCJ 1IRZA 1XGSA 1A6IA 3CJQB 2HQRA 3SHFA 2IS6A 3BPVA 4ZJZA 1KU7A 1HC8A 1QVTA 2HU9A 2LTPA 2MH2A 4LLLA 2HR3A 5J40A 3BR2A 4Y3OA 2LSOA 2QQ9A 3J80Z 1QGPA 1ULYA 4OWRB 1WI3A 1ONVA 2ID6A 2OC6A 3NQOA 5D5WB 2O61A 1F36A 3KYLA 2BY3A 1ETOA 2O3FA 5J1YA 3M7GA 3OOUA 2DXIA 4KISA 1S7AA 1ITYA 3E6MA 5E1XA 3MEXA 3SYTA 2NVYJ 5K7FA 2DU9A 1VQ6I 2F5EA 4F55A 2WV0A 4TV7A 4XK4A 3SXYA 4RAZA 1VQ9I 1RC9A 1FY7A 3NWTA 2W84A 5M5YJ 1PUFA 3QRFF 5J8CA 3GUDA 4KMUX 3OIQA 2MABA 1GVJA 5BPIA 4PJ0C 2CW7A 3CC7I 2XRLA 2RNJA 2XROA 1KU2A 2HS5A 2F5FA 1MIJA 3HHHA 3RDIA 3WTZA 3GFLA 1I39A 1SFXA 2CFOA 3QQAA 1TWFJ 2DMTA 3ZR8X 4IQJA 3BROA 5CJ9A 3D5LA 4XOPA 2QEXI 4II2A 3JRCA 2ELKA 1LFPA 2NOGA 3HGYA 3TO6A 5CLSA 5IY5H 2Q2EB 2VASA 3LSMA 4GXOA 1OISA 3S1QJ 4BY1J 2OBPA 1WJ5A 2BVLA 1YIJI 4MFDA 5LHGA 3QYFA 2ICWG 2MYSA 2P8TA 4FT8A 4HW0A 2DPDA 4U87A 4JP0A 1R7JA 1R9TJ 2CQKA 3HM5A 1RKWA 3JAMK 1XB4A 3ZCOA 1Z21A 2E35A 3VOEA 2Y0SA 3W2VA 5JI6A 5C44J 1FC3A 2K3FA 2R7XA 3JR9A 1FOKA 2E1OA 4ZDLA 3ZMTA 5LBQA 1EH7A 5E3MA 2PI0A 3KE2A 4XLAA 3G3ZA 4R8HA 3OYIA 2KRHA 4ZTJA 3NEUA 5FKMA 3BR0A 3DKWA 2HYJA 1D5VA 1K83J 2K9SA 3BZKA 1MMNA 5D5XB 4BDYA 3BR6A 2VXZA 3HKZN 5JLXA 3PIPF 4W1UA 2E5NA 4CCOA 4HX7A 3VFZA 3I58A 5FLVA 3S2DJ 2V9KA 4B3AA 4M9XA 3J81K 2IP2A 2ECBA 2H09A 3EQLF 2DFFA 4HRIA 2WAFA 2ZXWH 5F0HA 2E36A 3QAHA 1OKRA 4M9ZA 4ESFA 2WAQA 3DTEA 1W36D 2R7ZJ 3OR1C 1IC8A 3CUQB 1ODDA 1WJDA 1B8IA 4WWCA 1PVEA 3F23A 5AIQA 5C3EJ 1YX5A 1Y0UA 2ADUA 3HOSA 1VQNI 1XGMA 2I5UA 2WADA 4U7DA 2XGXA 2ZJPF 2Y2ZA 2O8KA 4QTRA 1MMAA 1FYKA 3C2BA 4G9YA 2XC7A 3A4CA 3F6OA 4HV6A 4Y7NJ 2QBYA 2FF4A 3GEZA 3LA7A 2JSPA 5F27A 2GQQA 1ZR4A 5KAIC 4IO9F 3FXLA 1MNEA 4BE2A 1XCBA 3DP7A 1YYVA 2E7WA 1X4OA 2F4MB 5EEGA 2H94A 2R4GA 4M73A 1PDNC 2CYYA 2L7KA 3BP8A 3COAC 2PBIA 4Q5SF 4L9JA 1MSEC 5ILUA 4MLOA 3OYBA 2DW4A 1JKQC 3VSKA 1MMSA 4FE7A 2JA8J 5DM7F 3M07A 1MBFA 1SD7A 4Q48A 1Z0XA 1T39A 2EV6A 2LF8A 4RB1A 1GV5A 2DBBA 3CF5F 3OYFA 3TEDA 5EF6A 2P5VA 1VQ7I 2P7VB 3BG6A 4IHTA 1OLTA 1SFKA 2X1EA 3R6SA 4M72A 3PFIA 1U2WA 2X4HA 3RKQA 4MHGA 2M3AA 2NRAC 2IRFG 4KA4A 5CVUA 1USSA 2HOSA 5HS9A 4AU7A 4BQNA 2IXSA 1BI2A 2GIVA 1V55H 1T6SA 3JTGA 1M1EB 5HLHA 5F08A 2YU3A 3H5AA 2PLYA 1O7FA 4DYCA 3DBRB 2L9NA 3I54A 3KYCB 1P4XA 3CUQC 3K10A 5D4SA 3H3ZA 3EUHC 4PJNA 3G1MA 5DD4A 5FFXA 4KMFA 2WB1A 1YS7A 3G1OA 2ZJRF 2OD5A 3B6CA 3RYRA 5BMZA 3OIPA 4B1RA 1QVUA 1WGXA 2DOFA 1E3PA 4S05A 4HOBA 5GTIC 2CH0A 1F1ZA 2Y0MA 4PJMA 2LY9A 1TNSA 3KZYA 2Z16A 4G7ZF 1VTNC 2GOXB 3BG3A 5IP9J 4YFXF 2IT0A 1K7AA 2VOOA 1LJ9A 2EZLA 1LDKB 1KZHA 4BJTA 2KQRA 3L1PA 5TJJA 1JKRC 1Z7UA 4M6VA 1JT6A 3CQZJ 4JOMA 3JAMZ 1U9OA 3ML6A 1O3RA 2LK2A 2E34A 4D5FA 2XRNA 1T0FA 2E60A 3BZCA 3B73A 5J3LA 3W3CA 2FOKA 4XOTA 5FD5A 1STZA 3L7WA 2ISYA 3RSNA 2AO9A 1HDDC 3JRAA 3FM3A 1MBGA 2CU7A 4V2GA 3LA3A 1I6XA 1B9NA 3LOCA 1D3YA 4XORA 4I99C 2Z99A 3WHCA 2RQQA 4A5NA 4UY8I 1J9IA 2XSDC 2BW3A 1Y0NA 1QZEA 1ZHFA 2R92J 3F3XA 2W25A 1LPQA 2NNYA 2QM3A 2TDXA 3IUOA 3LMMA 1ZQ3P 2VIXA 3CCYA 4BBRJ 1Z6RA 1IO2A 1ZTRA 2BY0A 2Y69H 3I55I 3GX4X 4ZZDA 1FPQA 2NVXJ 1XSXA 1XCVA 3I59A 2IAIA 3A0BC 2F5CA 1FP1D 1TTYA 2O5RA 4NUBA 5CQGA 4ASNA 4EM0B 2V4JC 1X3UA 2WAEA 3O2PE 1MJAA 4HF2A 5FJ8J 5IYDJ 5FFZA 1L0OC 1SVMA 3P7NA 1YS6A 3R4KA 2VBXA 5DCMB 2UUZA 5GPAA 4IRHA 2L01A 2MC4A 3DV8A 1SD4A 2YX7A 1HBXG 4CZCA 2A5YB 2EZIA 4WK8F 1ZELA 2LC2A 1T0FC 4HAMA 1OCPA 5F04A 3ZMVA 1HKTA 3TKYA 4DZPA 4CCLA 4FCYA 2B0LA 1IXSB 3Q5FA 1A5JA 1I3QJ 1UCRA 1ETWA 5EYRA 1IN6A 4IOAF 1U5TA 2LDUA 3OS2A 2OCEA 3LSIA 5HVQC 3EPZA 1KQ0A 1UJ8A 2P7CB 1FEXA 1E3HA 2OTJI 2IGNA 1NHAA 5AONA 4A5MA 2M8GX 1QPIA 4MEXF 3GLLA 3TW7A 2RNGA 2D2WA 2V9VA 1D0XA 3KP7A 1R4MB 2VC1A 2XF7A 3JRHA 5ICEA 1APLC 4QPOA 5LEKA 1IDZA 4D5CA 4RAGA 3RZOJ 3KZZA 2NS7A 3BG7A 3M4OJ 3MZHA 1FT9A 3OYHA 2WBMA 2ZNYA 3PUFA 1R1TA 2VBZA 2E2HJ 2X51A 3ZGKA 1WPKA 3GXOA 2ZFWA 1DP3A 3ZP5A 3OYLA 3WU1B 3EDPA 1ON2A 4OAYA 3JRDA 5IOZA 1RETA 1W7PD 2KJCA 3FXOA 3O3KA 1FJLA 2HKXA 3K1MA 4IRGA 2P5KA 1T56A 2AQEA 1J2XA 1NG6A 1O3SA 5JVGF 1WZ2A 2M30A 1IUFA 5TRDA 1VNDA 4P5OA 5IYBJ 4BH9A 3E6BA 3V8JA 1SC7A 3HC7A 2VQHA 4NB5A 3K9TA 4FHTA 4OMZA 1R6RA 1ZGJA 4JBAA 3ZQHA 3KYDB 1K4SA 5DEQA 2VE9A 1WJCA 2DT7B 2K9QA 3SZTA 3HKZA 2M0MA 5EGOB 4OIQF 2R7VA 2PJPA 3ZQCA 4AIDA 1MJ9A 2GOMA 2FE3A 1Y6IA 4CYDA 1D5YA 1FYLA 3E5UA 3SEQA 3TQNA 4NQWB 2KFDA 1DGRM 3HSRA 3GFIA 3CCVI 4BNCA 2A05A 1BC8C 3BR5A 1LDDA 4ZYAA 1N75A 5KNLA 5C4XJ 3ABTA 3BCAA 2XGCA 3FK6A 1NTCA 4R1HA 4AIHA 4FX0A 1AKHB 4EJTA 3K4KA 4M9SA 2Q0OA 2KIQA 1UMQA 3IHUA 1BI0A 4M71A 1MMDA 3F8BA 1ZLKA 2O8XA 4C3JJ 1ON1A 3M1EA 2VODA 3ZQLA 4HF0A 4RAFA 3FX3A 2AQFA 3IRQA 4EATA 1BIBA 3BTJA 3C18A 4XSXF 2FOWA 2H27A 4AVPA 2VKDA 3S1RJ 3I64A 1SANA 4BQOA 2XAGA 2XPWA 3ABKH 3Q9VA 4XL9A 2DDBA 1QHGA 3CC2I 1I5ZA 2VJ5A 2OZ6A 5M5XJ 4OIOF 1OFCX 1MDMA 3ZQFA 1TQIA 3AG2H 2P4WA 1XG1A 4GGGA 4M74A 3WTXC 4ABZA 2VKVA 2QSGX 2HFHA 3H0DA 1BI3A 1T08B 2MD5A 2PMUA 5BQTA 5FRNA 2HQAA 1W36C 3JRGA 1T98A 3F9KA 5M3FJ 1B6AA 3FMRA 1HQCA 2CQQA 3S15J 5D6FA 4FTHA 3LQQA 3QOPA 4HSTA 1IXRC 3CUOA 3GBGA 5JHFA 1FX7A 2P5LC 1YIOA 3NRVA 2HWVA 1FWZA 5JLWA 4JX4A 4ENJA 3U1KA 1K61A 2PMHA 3ZN1A 3MMYB 3RQ4A 4Y52J 3QOEA 4DBRA 4LB6B 1R36A 1MH3A 2CUJA 4A3LJ 1LQ1A 2HXIA 2EA4A 2GA1A 2L5QA 1TWAJ 3H9JA 2NVUB 1U9NA 3VSLA 4EJUA 3PIOF 1DQUA 2JMWA 1H0MA 5TISC 2ISZA 3RI4A 2JRTA 4P9UA 2E2JJ 3K2AA 1ZH5A 4I0AA 2A68F 3MN2A 4PJLA 4FX4A 4CYCB 3IL2A 2E7XA 1VQPI 4GFBA 3HTSB 3G6EI 1P4AA 2COMA 2OQGA 1XMXA 2EIJH 3CCEI 2DK8A 1IRGA 4HLXA 1NH3A 3VYSB 2B7EA 4ENNA 1ZGWA 1D0ZA 1W0UA 2CUEA 2YX4A 2HQNA 5JHUA 1Q1HA 2M7AA 2Y31A 4HZFA 4MQVA 3OYMA 1FLIA 1GT0C 3RTRA 4IKFA 2XKOA 2ZSIB 2LBFA 3WTTC 1K79A 1S5LC 3GWZA 2VT2A 2W48A 5HDKA 1JUPA 5F0CA 2DMPA 2VQGA 5B1BH 5F1JA 5GAHJ 3TOAA 1USTA 2CS3A 4KN7X 5E20A 3GMEA 4FASD 3S1MJ 1UHMA 2EFNA 2EBIA 2XB0X 5B3SH 4PCQA 1CF7A 4EJOA 2V1NA 1PP8F 1X1CA 1X3ZB 4S0HB 1JJ6C 3RKWA 1S8NA 2KP6A 1OYWA 5LLQA 5CVJA 2OF7A 4N9HA 3QP6A 3DU6A 3IKVA 4I01A 3JRBA 2HQ5A 2Y75A 3FHNA 2VQLA 2XAHA 3OYDA 1GUUA 3BPXA 1I6HJ 2EIKH 1J75A 4B48A 3GTOJ 2LKSA 2XPUA 4RGRA 3L2CA 2H6CA 1MSFC 3IAS2 1ZN2A 1X58A 5KCMA 3I53A 1QZYA 3WU2C 2L7ZA 3P9KA 3M8FA 3D5RC 4LIUA 3SZGA 1L3LA 2ZBKA 1R00A 2PN6A 1VQOI 1GXQA 1JGGA 4BKXA 2Z1DA 3O8HA 2Q1ZB 1N78A 1HF0A 4IPAA 2JPBA 2H8RA 3HOWJ 4U7BA 3TBIA 3EYYA 1OJLA 1ERDA 3LNQA 4G7HF 1U8RA 2QQBA 4HX8A 1OCOH 3GTPJ 1JTYA 4AVZA 4LB5A 3HBLA 3QYEA 2QLZA 1Q1VA 3HSFA 2DODA 1CGPA 4IHXA 1BR4A 3ABLH 1LFUP 2DPUA 2EFOA 2V9PA 4RMNA 3FXKA 5L3GA 1AOYA 1D1BA 1FMWA 2QA4I 3LSGA 2DA7A 1KGSA 3JW4A 2A3SA 2LNBA 4PFPA 2B63J 3MFKA 4OIRF 1S7OA 2FJ1A 4XQFA 3H9GA 3GTJJ 1PP7U 2YPRA 4ZYHA 2CV2A 2VKEA 5CVIA 3CMYA 1RIOH 4I2OA 4GCVA 1SMTA 1A36A 4P55A 5L3DA 1IDYA 4J01A 2IA1A 1W7PB 2AXTC 4MQ9F 1OYYA 4MO7A 3WU0A 3K4LA 5E8IA 2FMYA 1MNMC 3HRMA 1HOMA 3WGGA 3WODF 3BT9A 3A01B 2CW0F 5LHIA 4OMYA 2L9RA 3L00A 2A6HF 2XVCA 1EA3A 3M3YJ 2HGCA 3DLAA 3GZ6A 4EJWA 1AA7A 1YOVB 2ZB9A 4MNUA 5E1ZB 2V26A 3S3OA 1YG2A 4IOCF 2DA6A 3HRTA 3F6VA 4E7KA 4HBLA 2DMQA 3U2RA 1W7PA 2K02A 3IAM2 1PUEE 3S16J 4A3DJ 1ZK8A 1G4DA 1S6LA 3VPRA 1TL8A 1X3WB 1GLNA 2ZO4A 4XLEA 1R5GA 3H92A 5E8GA 1U8BA 3CJNA 2YR2A 3HUGB 5HS7A 3A01A 4L9NA 1MBJA 3N4MA 2X1CA 3H5NA 4LFUA 2Z9OA 2KISA 2ELHA 2EK5A 2KIUA 2M8EA 1OCTC 2XHKA 2IGKA 1EH8A 1XDSA 4AUXA 2R5YB 1F9NA 3DCFA 3I5UA 4M3FA 5GPCA 2VN2A 2VUMJ 3C1DA 4MIMA 1RR7A 2QENA 4XRMA 1FBQA 3AG4H 3F8CA 4Y33A 2NOJB 3T1BA 4CXFA 1FBUA 5M5WJ 3O8GA 3A0HC 1EH6A 2Q2EA 3C2HA 2CUFA 4LG0B 4IXAA 3K4JA 4ZDOA 2IJLA 4E7SA 1A35A 2H1KA 3CCRI 2FD5A 2ZSHB 3DFGA 3KP3A 3EETA 3GO5A 4UHTA 4A6EA 1YTYA 1A04A 4OU0A 3ROUA 4XICA 1PJRA 2B9SA 3WE2A 2DQRA 3FKJA 1ETKA 1SEUA 2DMNA 5LGNA 4XIDA 5IPAA 1QNTA 3K2ZA 2ESNA 3HOXJ 3V8LA 3OWTA 5GP9A 2JWTA 4JYKA 4P96A 4AC0A 1Y8RB 4ZYGA 3E1SA 3F21A 3CCUI 1Y1WJ 1QBJA 3DTKA 2R5ZB 3IWFA 4WXCA 3CMEI 1TBXA 4L0ZB 2JSCA 3ONQA 4A69C 5KHDA 1LE8B 2RDPA 2PX9A 2C6YA 4PUSA 3M9AA 4IZZA 4C3HJ 4ITVA 2GWRA 2HDWA 5FD6A 5H6RA 3LSHA 2ESHA 3CLQA 5K5QA 2A61A 2K27A 1MGTA 3LFUA 3M1CA 4A3KJ 2DA2A 2K9NA 3P9IA 3OMYA 1R1UA 1TT0A 2MG4A 2RN7A 2K86A 4RGUA 2P0WA 3HTUA 1J0RA 1TQMA 4IJAA 4LIVA 4E7LA 2JA6J 3GTLJ 1JI8A 1O4XA 2V1UA 3CMAI 1V54H 1T2KA 4KNYA 2RGVA 3DPUA 4HNVA 1YRNB 2E1CA 1EJ9A 1XPXA 4NHJA 3HRSA 4PSXA 3RYPA 2VPLA 3HHGA 3CUQA 5LD2C 4G8XA 3EUHA 1I1SA 3HB9A 4UB8C 1IJWC 1O57A 5IT3A 2D1HA 3QYBA 3DEUA 4EMSA 3REOA 1O3TA 1T38A 5K7ZA 4YIIA 3C3WA 2ZXIA 4O3MA 4F52A 1IRXA 1WH5A 2ZCWA 5TGTA 3GW2A 4X0GA 2PJRB 2PQ8A 4YG2F 4IX7A 3HXLA 4UVAA 4DBQA 5FB2A 3A2KA 4YEJA 1WJFA 2W00A 1P4WA 4B44A 2XGDA 1ACIA 2Y9ZA 5HLIA 2F5DA 4I09A 1BR1A 3C2GA 2LR8A 2X48A 4PZJA 5KK1A 3CCMI 2TCTA 1D0YA 3KFWX 3CC4I 3JSPA 3L2QA 4L9TA 2NVQJ 2DYRH 4C30A 5ERIA 2XF5A 3OYKA 5ICGA 2ID3A 5J8FA 2QUFA 3LA2A 1QO0D 2FA5A 2BY1A 1KU9A 2IW5A 3PQJA 4OINF 2VONA 9ANTA 3BR3A 1Z6TA 5FLXK 4LJZF 1FSEA 1SAUA 3GZNB 1TW3A 1DGWY 4XLPF 3OSGA 1AU7A 1VQLI 5HS8A 2MH9A 1Y39A 5L3FA 2L4MA 2K5CA 2FBIA 2GXGA 4DOZA 5EG0B 3CCSI 1TC3C 4UUSB 4M3EA 3CDLA 4CHUA 4KITB 2OTLI 3HOVJ 1IN5A 2OZUA 1HCRA 2IS4A 2M5WA 2O9LA 2QKLB 1H88C 2DT5A 3DTIA 2LY2A 2ZMEB 1P6RA 1X1DA 4M6YA 3KIOA 3HEFA 3G73A 4U88A 3RPUD 5EEHA 3ZMDA 4BJ6C 5FKNA 1AWCA 4BXUA 2XASA 4D0PA 1MNDA 5F64A 5EG0A 4KYWA 1X19A 4UUSA 3K69A 4G94A 1QQIA 1T95A 4R79A 3PJRA 3G4SI 1V5EA 6PAXA 4RB3C 3S1NJ 1WCMJ 1WH7A 3DU5A 3J7YJ 1JKPC 4I98B 4B4CA 3ZQIA 2NXNB 1B4AA 1XS9A 1R71A 2M9HA 5JFRA 4DNCA 1XDUA 2I8DA 3FXJA 3OR2C 5IT9K 2DA1A 2P6TA 3BQZA 2JVGA 1X1PA 4M6XA 4KIBA 3BTCA 3OOPA 3QPLA 2K9LA 1U78A 2EJRA 2IS2A 4BQAA 2KIMA 2ZXHA 3PO2J 2KZGA 3B6AA 1TT5B 3RCOA 3OS1A 1G2HA 1GDTA 5B66C 1TW2A 3QODA 3K4NA 1QPMA 5ICFA 1G59A 4BE1A 2JZYA 4Z6YA 1ZRCA 4I0BA 3S2HJ 4O5VA 1E3OC 1J59A 1REPC 1YX3A 3HSEA 2XF6A 3M8JA 4B3XA 2HPIA 3GYHX 2DFHA 1X1AA 2A6TA 2FNPA 4JQFA 3LAPA 4RDUA 1MMGA 5K5RA 5FKLA 1VZ0A 4AD9A 2Q8KA 5HNFA 3I4PA 2GM4A 1OR7C 1BOAA 2DFEA 1R4NB 1WVRA 1XGNA 4PSWA 3CCJI 2WY7Q 2CG4A 3ZMSA 2VPRA 2MC3A 3BR1A 3X2QH 4E7IA 4XLCA 2ZKZA 3SFIA 1FZPB 4L0YB 4LK0F 1X1BA 1P92A 2HZTA 1LVKA 5DCMA 4XRFA 2XIGA 4D9JA 2JPCA 3J7AO 2K4BA 2RREA 3K7AJ 2XGEA 4G12A 4BEHB 4B8XA 3FXQA 1IF1A 2V6CA 3OL4A 1EV7A 1U6GA 1Z91A 5E3OA 2EB7A 5FKKA 4V2FA 1ETVA 1MZBA 4BXXJ 3BJAA 1X4PA 2QSFX 3PNVA 2CQNA 3ZN0A 3ZXSA 3ZQ7A 3JRIA 2DI3A 3A03A 3R0JA 3GCMA 2R7WA 3BDDA 3GTQJ 1JHFA 2M1BA 4YRVA 2MLKA 2HXOA 3FWEA 1FOXA 4PK4A 3S14J 2KRCA 1UFMA 3SQNA 1FMVA 5L3EA 2E1MB 2L4AA 2UV1A 1BOBA 2NNNA 1VI0A 4BACA 5AIPA 2G7HA 2K7LA 2MFZA 2D5VA 5K7HA 2LG4A 4A3MJ 2VJIA 4XKVA 2OV7A 2RKHA 5J4YA 1IN7A 1LUJB 5FLXZ 1ZRDA 1N25A 1FYMA 1ETYA 1JUMA 3K1PA 5JVTA 1TQPA 1V5GA 3WTVC 1O7LA 4J00A 1ETXA 4XNFA 4AWXB 3DQVC 3LSJA 2OCCH 1KA8A 5D8LB 3M8EA 5DUKA 1V5FA 3FZVA 1SFEA 3OIOA 1DU6A 4KUMA 2LY1A 2VC0A 2X6YA 3SDGA 2Z5UA 4ENMA 4BXFA 1BIAA 2VXDA 2M2EA 5CPRB 3QU3A 2XUBA 4HA8A 4EJVA 3IH4A 2M87A 1NG7A 4N0BA 4O6JA 2EH3A 3H35A 4WXHA 5E3NA 2RVCA 4BHPA 3FMQA 1SFOJ 1W1WE 3ERMA 3DKXA 1MD0A 1OCCH 2ME6A 1YHQI 2DJIA 1OYIA 5LGUA 3GTMJ 2XSJC 2K9MA 2QQAA 1FTZA 4HDUA 3FKIJ 5J4VA 3V4GA 3FIWA 4A0YA 5EGOA 1XTAA 1Z3YA 4PGGA 2H8WA 5FLMJ 2LRDA 1W5SA 1S3JA 2LP0A 3E6DA 4EM2A 4F92B 2BZTA 2VT3A 1EF4A 2CO5A 1TWGJ 3F8NA 4ZDPA 4NQWA 2FBKA 3A1YA 2EQRA 3CCLI 4RM2A 4V19K 3BZ6A 3H5RA 5D5VB 2CW8A 2Y30A 3HRUA 1DU0A 4PJJA 3RIRA 2NYXA 1JUSA 2DO7A 2CFXA 3H36A 2STWA 2E1MC 5IT9Z 1H9TA 1AKHA 1OCRH 3KEQA 5DD8A 1MBEA 2IGOA 1YE9A 4QIWN 4JX5A 3MKYB 5IOYA 5EZHA 2EWNA 3Q9SA 3LQRA 4A3IJ 1SMYF 2FMLA 1RKTA 3OYEA 1D1AA 2R0QC 1ZLJA 1HA8A 2FX0A 2GZWA 3R0AA 5F0FA 4Y15A 4XN3A 4LG3A 1WWXA 1Y8QB 5ED4A 2NAZA 2CSOA 3WTWC 3HOYJ 1RPWA 3I56I 2DT6A 2X6WA 3KLOA 1XSVA 2ACJA 3LL7A 4Q47A 4BYYA 1LKXA 1BN5A 2H6BA 4HNUA 1YW9A 1HKQA 1FIPA 2HKOA 5LEJA 4GYGA 1S7EA 4XN0A 4B43A 1VQKI 2W7NA 2X6XA 1UB9A 4EGZA 5GADJ 1BL0A 2E19A 1LEBA 3SFZA 5LGTA 3J7AY 5EDNA 2BVMA 4KT6A 2CRGA 3RKXA 1WJEA 1FP2A 3CLOA 4GDFA 1IXCA 3HZJA 3SJMA 3V8KA 2LOOA 2X6OA 4DYQA 2HVRA 4YIRX 1H9GA 1X2NA 1JKOC 1MW7A 2JA5J 3PQKA 4RS8A 2ECCA 4WF2A 3TOBA 1WFXA 4KFCA 1DPUA 4FE4A 3TO9A 1R22A 2LF7A 2LD5A 4D7NA 4ON0A 1RI7A 3DPLC 2K3PA 2WV1A 3ASOH 2FBHA 1B9MA 5HODA 5CYVA 3D1NI 1UG0A 3K1NA
chains in the Genus database with same CATH topology
1D8KA 3GFMA 5BPDA 1YO5C 2QZ8A 5H20A 5L3CA 1UHWA 5LRRA 2KRFA 4LGWA 4L5JA 1KYWA 1IN8A 2XKPA 5HLGA 2RV8A 1KQ8A 4BHBA 4HLYA 2ZXJA 4A0XA 2L3DA 4ESJA 1FSHA 3KP5A 3D0SA 2KJBA 4ESBA 4G6QA 1YQAA 2VOPA 2BV6A 3DF8A 2AXLA 2V1DA 3W6JB 3WTSC 1LVAA 1YW7A 3BWGA 1DPRA 1GHCA 3ERED 2EFQA 4OOIA 4A6DA 5D5UB 1LNWA 3SZPA 3KP4A 4E70A 2CGPA 1E17A 2J5OA 3IRRA 5H6QA 4DQ2A 2Z3YA 3HOTA 3E97A 2PG4A 3IC7A 2HYFA 2R7DA 2XAQA 4WX9A 1ZG1A 5LRSA 2Y48A 1R23A 3E3VA 4JK1X 4ETSA 3B02A 1Z1DA 4KICA 3OV8A 3V7CA 5HOOA 2K4JA 4EV0A 1U3EM 3N97A 2DAOA 3I0TA 4QLCU 2L54A 3WE3A 2J5PA 2V1XA 5E18F 2EA2A 1HXDA 3QP5A 1ZG3A 3I71A 4KIFA 5LHHA 1R1VA 4UVCA 3U9GA 4CZZA 4MTDA 4LLNA 2ETHA 4CDGA 1HSJA 3E5XA 5K5OA 1XD7A 4ZZLA 3L09A 3HUGA 3DPTA 2L02A 2LKPA 4IVNA 1RUOA 2O0YA 3T8TA 2FRHA 4EGYA 1DDNA 1I1GA 2OAZA 2QWWA 3R60A 1C0WA 2PEXA 4WCGA 3R61A 1ZAOA 5J6XA 1YW8A 1TLHB 1B59A 4LG0A 5E17F 1G3TA 5ICCA 2HTJA 3WGIA 2D45A 2XAJA 2FEZA 4LLGF 5D4RA 2EFPA 4UVBA 2UXNA 4LMYA 2DQLA 3WG9A 5HDNA 3CDHA 3BOQA 1E2XA 3FXRA 1YFHA 1SFUA 2QBYB 5JR3A 2EV0A 5DCFA 3WTUC 5CVRA 2PFBA 1ZRFA 4HYEA 1HKSA 1WKMA 4ZH4F 2OU2A 5ILVA 4P9FA 2DLLA 1F4KA 3ULQB 3FXUA 3T8RA 3LFKA 4IRIA 1XMKA 2YSRA 4G6DA 3CO6C 1R58A 2UZKA 4XBFA 3LWFA 2HOEA 2UXXA 4MTEA 4XLNF 5KVRA 4HQEA 1XSDA 1K6OA 2HEOA 4CGZA 3QU6A 4GO1A 2MLGA 3W6KB 2W24A 1J7KA 3TGNA 2O03A 1IN4A 1P2FA 4LK1F 5CVVA 4L18B 4UV9A 2F2EA 4PDKA 3MAJA 3ZPLA 2HTSA 3LSTA 1JE8A 4KN4X 1V3FA 3RJPA 3F8MA 1JGSA 4KIGA 4ZYEA 3F22A 3KP6A 1HW1A 1KYZA 4PGHA 3ECHA 1XN7A 3V7RA 3FF5A 4HX4A 1GXPA 2BBYA 1JXSA 4S04A 2ZMEA 1Z9CA 5ILSA 1OR7A 4CO8A 2HDCA 5FGMA 2BGCA 4AIJA 1XMAA 1ZGAA 4UV8A 3VEPA 3KETA 2R3SA 2UWMA 4EVIA 2W57A 4ZYDA 2A6EF 2ZNZA 3KLNA 4BHCA 1W4MA 2IA0A 3TDUC 3ECOA 3I59B 4QWQA 4XSZF 1IAWA 1WRJA 1ZREA 1TNTA 4RGXA 2WWYA 1IZ1A 3L9FA 5K1YA 4IHSA 4KDPA 1LEAA 1DUXC 2V79A 1HW5A 1WI9A 4UNOA 2KIFA 1BBYA 3J81Z 4KT5C 3VB2A 3HYIA 2DFIA 1RNLA 1WQ2A 2BE5F 3JSOA 1U5TB 5A2QK 3KCCA 3S2WA 3KP2A 2A07F 1I27A 1MKMA 3AAFA 1G6NA 1HSTA 4BAYA 3FHZA 4RB2C 1ZARA 4Q4ZF 3TDZC 1HW2A 1LDJA 5FO5A 2GA2A 3H3UA 3BJOA 3DXJF 1K78B 2MA3A 1YLFA 2G7UA 3ZMZA 3F8FA 2A69F 4OIPF 2W85A 1XGOA 4RAYA 2VBYA 3WGHA 2P6SA 3T5XA 2FU4A 1K78A 1FBSA 1OMIA 2EFWA 4ENKA 3GF2A 1FNNA 4U0WA 3RKYA 2VE8A 1O3QA 3JTHA 3QPTA 3MCZA 5DUIA 2X0LA 2RC4A 2ZJ2A 3MQ0A 2GXBA 1MJBA 1IUYA 1J5YA 2R7FA 4HV5A 1U5TC 2M45A 2MBFA 3ELKA 1F5TA 1Z05A 4U0VA 2QVOA 1SD5A 3QPHA 4H0EA 4UXNA 2FSWA 1BI1A 3E6CC 2G9WA 4CICA 5BOXA 1S29A 3ZMUA 4HF1A 3ISPA 5D6EA 4GYIA 1IW7F 3KEOA 2Z33A 2JTVA 4B09A 1W5TA 4UUVA 1DP7P 4MEYF 3BJ6A 5DDGA 3IKTA 2OA4A 4G7OF 3VODA 5F1RA 4A0ZA 1MDMB 3ABUA 3J80K 5DYMA 4HQMA 4Z2YA 4N9IA 2OQRA 4WXDA 1SD6A 4LD5A 3LAJA 1SAXA 3K0LA 4IF4A 3T0YA 4EQQA 1OPCA 2VBWA 4Y13A 4Y17A 5L3BA 2FXAA 5F6FA 3F72A 4RGSA 1RZ4A 2IVMA 2HYGD 5HDGA 3TO7A 1G3YA 3U1DA 1KQ9A 4L5IA 2KKOA 2D1VA 4A12A 1D8JA 4MGRA 1QZZA 2FNAA 1BM9A 4YIFA 5A2QZ 1ZYRF 4I02A 1IRFA 5E1WA 3E5QA 4YFKF 3FM5A 4RB0A 2IA2A 2EV5A 3RPUA 2BYVE 4L9VA 1WSUA 4I7HA 4EM1A 1R5HA 3BY6A 3MWMA 2XAFA 2JT1A 3RPQA 3GZ5A 3MZYA 5D8KB 3HIFA 1CF7B 2GAUA 1JHHA 4A2UA 3WTYC 2FQ3A 2WC2A 3CO7C 4YFNF 2NS0A 4U0YA 2E1NA 1G3WA 1BC7C 3O6BB 1LB2A 1V4RA 2O6GE 3EYIA 4K2EA 4AIKA 1BJAA 2DTRA 2CWEA 4F7ZA 2DK5A 3IWZA 2BEOA 2STTA 1KU3A 3FMSA 2XV4S 3GVAA 1RUNA 5BS6A 3CTAA 4HDVA 3P9CA 3GLXA 3C7JA 1G3SA 2WTEA 5DV5A 3V7SA 1B1BA 2RQPA 2QYOA 2AS5F 2IPQX 1ZG5A 3GFJA 1XGSA 2HQRA 3SHFA 3BPVA 1KU7A 2MH2A 4LLLA 2HR3A 2LSOA 2QQ9A 3J80Z 1QGPA 1ULYA 1ONVA 3NQOA 5D5WB 2O61A 2O3FA 3M7GA 1S7AA 3E6MA 5E1XA 3MEXA 2DU9A 2F5EA 2WV0A 4TV7A 3SXYA 4RAZA 1FY7A 2W84A 3QRFF 5J8CA 3GUDA 4KMUX 1GVJA 5BPIA 2XROA 2RNJA 1KU2A 2HS5A 2F5FA 3HHHA 3RDIA 3WTZA 3GFLA 1SFXA 3BROA 5CJ9A 3D5LA 3TO6A 5CLSA 4GXOA 2OBPA 5LHGA 2P8TA 4FT8A 4HW0A 2DPDA 1R7JA 2CQKA 3JAMK 1XB4A 3VOEA 5JI6A 1FC3A 1FOKA 3ZMTA 5LBQA 1EH7A 2PI0A 3KE2A 3G3ZA 4R8HA 3NEUA 3DKWA 1D5VA 5D5XB 2VXZA 4HX7A 3VFZA 3I58A 4M9XA 3J81K 2IP2A 2H09A 3EQLF 3QAHA 1OKRA 4M9ZA 4ESFA 3CUQB 1ODDA 4WWCA 3F23A 5AIQA 1Y0UA 2ADUA 3HOSA 1XGMA 4U7DA 2XGXA 1FYKA 4G9YA 2QBYA 3F6OA 4HV6A 2FF4A 3GEZA 3LA7A 2GQQA 1XCBA 3DP7A 1YYVA 2E7WA 5EEGA 2H94A 4M73A 1PDNC 2CYYA 3BP8A 3COAC 2PBIA 4Q5SF 4L9JA 5ILUA 2DW4A 1SD7A 4Q48A 1T39A 2EV6A 2LF8A 4RB1A 2DBBA 2P5VA 2P7VB 4IHTA 3R6SA 4M72A 3PFIA 1U2WA 2X4HA 4MHGA 2NRAC 2IRFG 4KA4A 5CVUA 1USSA 5HS9A 1BI2A 2GIVA 1T6SA 3JTGA 5HLHA 2YU3A 2PLYA 1O7FA 3I54A 1P4XA 3CUQC 5D4SA 3H3ZA 5DD4A 5FFXA 4KMFA 1YS7A 2OD5A 3RYRA 5BMZA 4S05A 4HOBA 1F1ZA 2Y0MA 1TNSA 3KZYA 4G7ZF 1VTNC 2IT0A 4YFXF 1K7AA 2VOOA 1LJ9A 1LDKB 5TJJA 1Z7UA 3JAMZ 3ML6A 1O3RA 2XRNA 1T0FA 3B73A 2FOKA 5FD5A 1STZA 3L7WA 2ISYA 3FM3A 3LA3A 1I6XA 1B9NA 1D3YA 2Z99A 4A5NA 1J9IA 1ZHFA 3F3XA 2W25A 2NNYA 2QM3A 2TDXA 1Z6RA 3GX4X 4ZZDA 1FPQA 1XSXA 1XCVA 3I59A 2F5CA 1FP1D 1TTYA 4ASNA 4EM0B 1X3UA 3O2PE 1MJAA 4HF2A 5FFZA 1L0OC 3P7NA 1YS6A 3R4KA 2VBXA 5DCMB 4IRHA 2L01A 3DV8A 1SD4A 2YX7A 1HBXG 2A5YB 4WK8F 4HAMA 3ZMVA 1HKTA 3TKYA 2B0LA 1IXSB 3Q5FA 1UCRA 1IN6A 1U5TA 2LDUA 5HVQC 1KQ0A 2P7CB 1NHAA 5AONA 4A5MA 4MEXF 2D2WA 2V9VA 3KP7A 2VC1A 5ICEA 5LEKA 3KZZA 3MZHA 1FT9A 2ZNYA 1R1TA 2VBZA 3GXOA 2ZFWA 3ZP5A 3WU1B 3EDPA 1ON2A 1W7PD 2KJCA 3O3KA 2HKXA 3K1MA 4IRGA 2P5KA 1O3SA 1J2XA 2M30A 5TRDA 4P5OA 4BH9A 3E6BA 3V8JA 4NB5A 3K9TA 4FHTA 4OMZA 1ZGJA 4JBAA 5DEQA 2VE9A 3SZTA 4OIQF 2PJPA 1MJ9A 2FE3A 4CYDA 1FYLA 3E5UA 3TQNA 3HSRA 3GFIA 4BNCA 1BC8C 1LDDA 3ABTA 4R1HA 4AIHA 4FX0A 4EJTA 4M9SA 2Q0OA 3IHUA 1BI0A 4M71A 3F8BA 1ZLKA 2O8XA 2VODA 1ON1A 3M1EA 4HF0A 3FX3A 3IRQA 1BIBA 3C18A 4XSXF 2H27A 4AVPA 3I64A 2XAGA 3Q9VA 1I5ZA 2OZ6A 4OIOF 1MDMA 1TQIA 2P4WA 4GGGA 4M74A 3WTXC 2HFHA 1BI3A 2MD5A 2PMUA 5BQTA 1T98A 1B6AA 3FMRA 1HQCA 5D6FA 3LQQA 3QOPA 1IXRC 3CUOA 1FX7A 2P5LC 1YIOA 3NRVA 2HWVA 1FWZA 4ENJA 2PMHA 3ZN1A 4LB6B 1R36A 1LQ1A 2EA4A 2GA1A 4EJUA 1H0MA 2ISZA 3RI4A 2JRTA 4P9UA 1ZH5A 4I0AA 2A68F 4FX4A 3IL2A 2E7XA 3HTSB 1P4AA 2COMA 2OQGA 2DK8A 1IRGA 4HLXA 4ENNA 2YX4A 2HQNA 5JHUA 1Q1HA 4HZFA 4MQVA 1FLIA 3RTRA 2XKOA 3WTTC 1K79A 3GWZA 2VT2A 5HDKA 3TOAA 1USTA 4KN7X 5E20A 1UHMA 2EFNA 4PCQA 1CF7A 4EJOA 1PP8F 3RKWA 1S8NA 1OYWA 5LLQA 5CVJA 4N9HA 3QP6A 3IKVA 4I01A 2Y75A 2XAHA 3BPXA 1J75A 4RGRA 3L2CA 2H6CA 1ZN2A 3I53A 1QZYA 3P9KA 3M8FA 1L3LA 2ZBKA 1R00A 2PN6A 1GXQA 4IPAA 2JPBA 4U7BA 3EYYA 4G7HF 1U8RA 2QQBA 4HX8A 4LB5A 2QLZA 3HSFA 1CGPA 2DPUA 2EFOA 5L3GA 1AOYA 1KGSA 3JW4A 2A3SA 2LNBA 3MFKA 4OIRF 1S7OA 1PP7U 2YPRA 4ZYHA 5CVIA 1RIOH 4I2OA 4GCVA 1SMTA 4P55A 5L3DA 2IA1A 1W7PB 4MQ9F 1OYYA 3WU0A 5E8IA 2FMYA 3HRMA 3WGGA 3WODF 2CW0F 5LHIA 4OMYA 3L00A 2A6HF 2XVCA 2HGCA 3GZ6A 4EJWA 4MNUA 5E1ZB 1YG2A 3HRTA 3F6VA 4HBLA 3U2RA 1W7PA 2K02A 1PUEE 1G4DA 1S6LA 2ZO4A 1R5GA 3H92A 5E8GA 3CJNA 2YR2A 5HS7A 3N4MA 4L9NA 4LFUA 2Z9OA 2ELHA 2EK5A 2KIUA 2M8EA 2XHKA 1EH8A 1XDSA 1F9NA 3I5UA 2VN2A 3C1DA 2QENA 1FBQA 3F8CA 3T1BA 4CXFA 1FBUA 1EH6A 2Q2EA 4LG0B 4IXAA 2IJLA 3DFGA 3KP3A 3EETA 3GO5A 4UHTA 4A6EA 1YTYA 1A04A 4OU0A 3ROUA 3WE2A 2DQRA 5LGNA 1QNTA 3K2ZA 2ESNA 3V8LA 4P96A 4ZYGA 3F21A 1QBJA 3IWFA 4WXCA 4L0ZB 1TBXA 2JSCA 2RDPA 2C6YA 3M9AA 2GWRA 5FD6A 5H6RA 2ESHA 5K5QA 2A61A 2K27A 1MGTA 3P9IA 1R1UA 2RN7A 2K86A 4RGUA 4IJAA 3HTUA 1J0RA 1TQMA 2V1UA 1T2KA 4KNYA 2RGVA 2E1CA 4NHJA 3HRSA 3RYPA 3HHGA 3CUQA 4G8XA 3EUHA 1I1SA 1O57A 5IT3A 2D1HA 3DEUA 4EMSA 3REOA 1O3TA 1T38A 4YIIA 3C3WA 4O3MA 2ZCWA 3GW2A 2PQ8A 4YG2F 4UVAA 5FB2A 1P4WA 5HLIA 2F5DA 4I09A 4PZJA 5KK1A 3KFWX 3JSPA 4L9TA 5ERIA 5ICGA 5J8FA 2QUFA 3LA2A 1QO0D 2FA5A 1KU9A 2IW5A 3PQJA 4OINF 2VONA 5FLXK 1Z6TA 4LJZF 1FSEA 1TW3A 4XLPF 5HS8A 2MH9A 5L3FA 2L4MA 2FBIA 2GXGA 4CHUA 1IN5A 2OZUA 2M5WA 2DT5A 2ZMEB 1P6RA 4M6YA 3G73A 4U88A 5EEHA 3ZMDA 1AWCA 4BXUA 2XASA 4D0PA 5F64A 4KYWA 3K69A 4G94A 1QQIA 4R79A 6PAXA 4RB3C 4I98B 1B4AA 5JFRA 4DNCA 1XDUA 5IT9K 2P6TA 4M6XA 4KIBA 3OOPA 1U78A 2EJRA 4BQAA 2KIMA 1TW2A 1QPMA 5ICFA 2JZYA 1ZRCA 4I0BA 4O5VA 1J59A 1REPC 3GYHX 3HSEA 2FNPA 4JQFA 3LAPA 5K5RA 4AD9A 2Q8KA 3I4PA 1BOAA 1XGNA 2CG4A 3ZMSA 2MC3A 2ZKZA 1FZPB 4L0YB 4LK0F 1P92A 2HZTA 5DCMA 4XRFA 2XIGA 2JPCA 3J7AO 2K4BA 4B8XA 3FXQA 1IF1A 2V6CA 1EV7A 1U6GA 1Z91A 2EB7A 1MZBA 3BJAA 3ZN0A 3ZQ7A 2DI3A 3R0JA 3BDDA 1JHFA 2M1BA 2MLKA 3FWEA 1UFMA 3SQNA 5L3EA 2L4AA 2NNNA 5AIPA 2G7HA 2K7LA 2RKHA 1IN7A 5FLXZ 1ZRDA 1FYMA 3K1PA 5JVTA 1TQPA 3WTVC 1O7LA 4AWXB 3DQVC 1KA8A 5D8LB 3M8EA 5DUKA 3FZVA 1SFEA 4KUMA 2VC0A 2Z5UA 4ENMA 1BIAA 3QU3A 2XUBA 4HA8A 4EJVA 2M87A 4N0BA 4O6JA 4WXHA 2RVCA 4BHPA 3FMQA 1MD0A 1OYIA 5LGUA 2QQAA 4HDUA 3V4GA 4A0YA 4PGGA 4EM2A 1W5SA 1S3JA 3E6DA 2VT3A 2CO5A 3F8NA 4NQWA 2FBKA 3BZ6A 5D5VB 3HRUA 3RIRA 2NYXA 2DO7A 2CFXA 2STWA 5IT9Z 1H9TA 5DD8A 3KEQA 2EWNA 3Q9SA 3LQRA 1SMYF 2FMLA 1ZLJA 2GZWA 3R0AA 4Y15A 1WWXA 5ED4A 2NAZA 2CSOA 3WTWC 3KLOA 1XSVA 2ACJA 4Q47A 4BYYA 1BN5A 2H6BA 1YW9A 1HKQA 2HKOA 5LEJA 4GYGA 1UB9A 4EGZA 1LEBA 3SFZA 5LGTA 3RKXA 1FP2A 3CLOA 1IXCA 3V8KA 1H9GA 3PQKA 4RS8A 3TOBA 4WF2A 4KFCA 1DPUA 3TO9A 1R22A 2LF7A 4ON0A 1RI7A 3DPLC 2FBHA 1B9MA 5CYVA 3K1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8K A;  3GFM A;  5BPD A;  1YO5 C;  2QZ8 A;  5H20 A;  5L3C A;  1UHW A;  5LRR A;  2KRF A;  4LGW A;  4L5J A;  1KYW A;  1IN8 A;  2XKP A;  5HLG A;  2RV8 A;  1KQ8 A;  4BHB A;  4HLY A;  2ZXJ A;  4A0X A;  2L3D A;  4ESJ A;  1FSH A;  3KP5 A;  3D0S A;  2KJB A;  4ESB A;  4G6Q A;  1YQA A;  2VOP A;  2BV6 A;  3DF8 A;  2AXL A;  2V1D A;  3W6J B;  3WTS C;  1LVA A;  1YW7 A;  3BWG A;  1DPR A;  1GHC A;  3ERE D;  2EFQ A;  4OOI A;  4A6D A;  5D5U B;  1LNW A;  3SZP A;  3KP4 A;  4E70 A;  2CGP A;  1E17 A;  2J5O A;  3IRR A;  5H6Q A;  4DQ2 A;  2Z3Y A;  3HOT A;  3E97 A;  2PG4 A;  3IC7 A;  2HYF A;  2R7D A;  2XAQ A;  4WX9 A;  1ZG1 A;  5LRS A;  2Y48 A;  1R23 A;  3E3V A;  4JK1 X;  4ETS A;  3B02 A;  1Z1D A;  4KIC A;  3OV8 A;  3V7C A;  5HOO A;  2K4J A;  4EV0 A;  1U3E M;  3N97 A;  2DAO A;  3I0T A;  4QLC U;  2L54 A;  3WE3 A;  2J5P A;  2V1X A;  5E18 F;  2EA2 A;  1HXD A;  3QP5 A;  1ZG3 A;  3I71 A;  4KIF A;  5LHH A;  1R1V A;  4UVC A;  3U9G A;  4CZZ A;  4MTD A;  4LLN A;  2ETH A;  4CDG A;  1HSJ A;  3E5X A;  5K5O A;  1XD7 A;  4ZZL A;  3L09 A;  3HUG A;  3DPT A;  2L02 A;  2LKP A;  4IVN A;  1RUO A;  2O0Y A;  3T8T A;  2FRH A;  4EGY A;  1DDN A;  1I1G A;  2OAZ A;  2QWW A;  3R60 A;  1C0W A;  2PEX A;  4WCG A;  3R61 A;  1ZAO A;  5J6X A;  1YW8 A;  1TLH B;  1B59 A;  4LG0 A;  5E17 F;  1G3T A;  5ICC A;  2HTJ A;  3WGI A;  2D45 A;  2XAJ A;  2FEZ A;  4LLG F;  5D4R A;  2EFP A;  4UVB A;  2UXN A;  4LMY A;  2DQL A;  3WG9 A;  5HDN A;  3CDH A;  3BOQ A;  1E2X A;  3FXR A;  1YFH A;  1SFU A;  2QBY B;  5JR3 A;  2EV0 A;  5DCF A;  3WTU C;  5CVR A;  2PFB A;  1ZRF A;  4HYE A;  1HKS A;  1WKM A;  4ZH4 F;  2OU2 A;  5ILV A;  4P9F A;  2DLL A;  1F4K A;  3ULQ B;  3FXU A;  3T8R A;  3LFK A;  4IRI A;  1XMK A;  2YSR A;  4G6D A;  3CO6 C;  1R58 A;  2UZK A;  4XBF A;  3LWF A;  2HOE A;  2UXX A;  4MTE A;  4XLN F;  5KVR A;  4HQE A;  1XSD A;  1K6O A;  2HEO A;  4CGZ A;  3QU6 A;  4GO1 A;  2MLG A;  3W6K B;  2W24 A;  1J7K A;  3TGN A;  2O03 A;  1IN4 A;  1P2F A;  4LK1 F;  5CVV A;  4L18 B;  4UV9 A;  2F2E A;  4PDK A;  3MAJ A;  3ZPL A;  2HTS A;  3LST A;  1JE8 A;  4KN4 X;  1V3F A;  3RJP A;  3F8M A;  1JGS A;  4KIG A;  4ZYE A;  3F22 A;  3KP6 A;  1HW1 A;  1KYZ A;  4PGH A;  3ECH A;  1XN7 A;  3V7R A;  3FF5 A;  4HX4 A;  1GXP A;  2BBY A;  1JXS A;  4S04 A;  2ZME A;  1Z9C A;  5ILS A;  1OR7 A;  4CO8 A;  2HDC A;  5FGM A;  2BGC A;  4AIJ A;  1XMA A;  1ZGA A;  4UV8 A;  3VEP A;  3KET A;  2R3S A;  2UWM A;  4EVI A;  2W57 A;  4ZYD A;  2A6E F;  2ZNZ A;  3KLN A;  4BHC A;  1W4M A;  2IA0 A;  3TDU C;  3ECO A;  3I59 B;  4QWQ A;  4XSZ F;  1IAW A;  1WRJ A;  1ZRE A;  1TNT A;  4RGX A;  2WWY A;  1IZ1 A;  3L9F A;  5K1Y A;  4IHS A;  4KDP A;  1LEA A;  1DUX C;  2V79 A;  1HW5 A;  1WI9 A;  4UNO A;  2KIF A;  1BBY A;  3J81 Z;  4KT5 C;  3VB2 A;  3HYI A;  2DFI A;  1RNL A;  1WQ2 A;  2BE5 F;  3JSO A;  1U5T B;  5A2Q K;  3KCC A;  3S2W A;  3KP2 A;  2A07 F;  1I27 A;  1MKM A;  3AAF A;  1G6N A;  1HST A;  4BAY A;  3FHZ A;  4RB2 C;  1ZAR A;  4Q4Z F;  3TDZ C;  1HW2 A;  1LDJ A;  5FO5 A;  2GA2 A;  3H3U A;  3BJO A;  3DXJ F;  1K78 B;  2MA3 A;  1YLF A;  2G7U A;  3ZMZ A;  3F8F A;  2A69 F;  4OIP F;  2W85 A;  1XGO A;  4RAY A;  2VBY A;  3WGH A;  2P6S A;  3T5X A;  2FU4 A;  1K78 A;  1FBS A;  1OMI A;  2EFW A;  4ENK A;  3GF2 A;  1FNN A;  4U0W A;  3RKY A;  2VE8 A;  1O3Q A;  3JTH A;  3QPT A;  3MCZ A;  5DUI A;  2X0L A;  2RC4 A;  2ZJ2 A;  3MQ0 A;  2GXB A;  1MJB A;  1IUY A;  1J5Y A;  2R7F A;  4HV5 A;  1U5T C;  2M45 A;  2MBF A;  3ELK A;  1F5T A;  1Z05 A;  4U0V A;  2QVO A;  1SD5 A;  3QPH A;  4H0E A;  4UXN A;  2FSW A;  1BI1 A;  3E6C C;  2G9W A;  4CIC A;  5BOX A;  1S29 A;  3ZMU A;  4HF1 A;  3ISP A;  5D6E A;  4GYI A;  1IW7 F;  3KEO A;  2Z33 A;  2JTV A;  4B09 A;  1W5T A;  4UUV A;  1DP7 P;  4MEY F;  3BJ6 A;  5DDG A;  3IKT A;  2OA4 A;  4G7O F;  3VOD A;  5F1R A;  4A0Z A;  1MDM B;  3ABU A;  3J80 K;  5DYM A;  4HQM A;  4Z2Y A;  4N9I A;  2OQR A;  4WXD A;  1SD6 A;  4LD5 A;  3LAJ A;  1SAX A;  3K0L A;  4IF4 A;  3T0Y A;  4EQQ A;  1OPC A;  2VBW A;  4Y13 A;  4Y17 A;  5L3B A;  2FXA A;  5F6F A;  3F72 A;  4RGS A;  1RZ4 A;  2IVM A;  2HYG D;  5HDG A;  3TO7 A;  1G3Y A;  3U1D A;  1KQ9 A;  4L5I A;  2KKO A;  2D1V A;  4A12 A;  1D8J A;  4MGR A;  1QZZ A;  2FNA A;  1BM9 A;  4YIF A;  5A2Q Z;  1ZYR F;  4I02 A;  1IRF A;  5E1W A;  3E5Q A;  4YFK F;  3FM5 A;  4RB0 A;  2IA2 A;  2EV5 A;  3RPU A;  2BYV E;  4L9V A;  1WSU A;  4I7H A;  4EM1 A;  1R5H A;  3BY6 A;  3MWM A;  2XAF A;  2JT1 A;  3RPQ A;  3GZ5 A;  3MZY A;  5D8K B;  3HIF A;  1CF7 B;  2GAU A;  1JHH A;  4A2U A;  3WTY C;  2FQ3 A;  2WC2 A;  3CO7 C;  4YFN F;  2NS0 A;  4U0Y A;  2E1N A;  1G3W A;  1BC7 C;  3O6B B;  1LB2 A;  1V4R A;  2O6G E;  3EYI A;  4K2E A;  4AIK A;  1BJA A;  2DTR A;  2CWE A;  4F7Z A;  2DK5 A;  3IWZ A;  2BEO A;  2STT A;  1KU3 A;  3FMS A;  2XV4 S;  3GVA A;  1RUN A;  5BS6 A;  3CTA A;  4HDV A;  3P9C A;  3GLX A;  3C7J A;  1G3S A;  2WTE A;  5DV5 A;  3V7S A;  1B1B A;  2RQP A;  2QYO A;  2AS5 F;  2IPQ X;  1ZG5 A;  3GFJ A;  1XGS A;  2HQR A;  3SHF A;  3BPV A;  1KU7 A;  2MH2 A;  4LLL A;  2HR3 A;  2LSO A;  2QQ9 A;  3J80 Z;  1QGP A;  1ULY A;  1ONV A;  3NQO A;  5D5W B;  2O61 A;  2O3F A;  3M7G A;  1S7A A;  3E6M A;  5E1X A;  3MEX A;  2DU9 A;  2F5E A;  2WV0 A;  4TV7 A;  3SXY A;  4RAZ A;  1FY7 A;  2W84 A;  3QRF F;  5J8C A;  3GUD A;  4KMU X;  1GVJ A;  5BPI A;  2XRO A;  2RNJ A;  1KU2 A;  2HS5 A;  2F5F A;  3HHH A;  3RDI A;  3WTZ A;  3GFL A;  1SFX A;  3BRO A;  5CJ9 A;  3D5L A;  3TO6 A;  5CLS A;  4GXO A;  2OBP A;  5LHG A;  2P8T A;  4FT8 A;  4HW0 A;  2DPD A;  1R7J A;  2CQK A;  3JAM K;  1XB4 A;  3VOE A;  5JI6 A;  1FC3 A;  1FOK A;  3ZMT A;  5LBQ A;  1EH7 A;  2PI0 A;  3KE2 A;  3G3Z A;  4R8H A;  3NEU A;  3DKW A;  1D5V A;  5D5X B;  2VXZ A;  4HX7 A;  3VFZ A;  3I58 A;  4M9X A;  3J81 K;  2IP2 A;  2H09 A;  3EQL F;  3QAH A;  1OKR A;  4M9Z A;  4ESF A;  3CUQ B;  1ODD A;  4WWC A;  3F23 A;  5AIQ A;  1Y0U A;  2ADU A;  3HOS A;  1XGM A;  4U7D A;  2XGX A;  1FYK A;  4G9Y A;  2QBY A;  3F6O A;  4HV6 A;  2FF4 A;  3GEZ A;  3LA7 A;  2GQQ A;  1XCB A;  3DP7 A;  1YYV A;  2E7W A;  5EEG A;  2H94 A;  4M73 A;  1PDN C;  2CYY A;  3BP8 A;  3COA C;  2PBI A;  4Q5S F;  4L9J A;  5ILU A;  2DW4 A;  1SD7 A;  4Q48 A;  1T39 A;  2EV6 A;  2LF8 A;  4RB1 A;  2DBB A;  2P5V A;  2P7V B;  4IHT A;  3R6S A;  4M72 A;  3PFI A;  1U2W A;  2X4H A;  4MHG A;  2NRA C;  2IRF G;  4KA4 A;  5CVU A;  1USS A;  5HS9 A;  1BI2 A;  2GIV A;  1T6S A;  3JTG A;  5HLH A;  2YU3 A;  2PLY A;  1O7F A;  3I54 A;  1P4X A;  3CUQ C;  5D4S A;  3H3Z A;  5DD4 A;  5FFX A;  4KMF A;  1YS7 A;  2OD5 A;  3RYR A;  5BMZ A;  4S05 A;  4HOB A;  1F1Z A;  2Y0M A;  1TNS A;  3KZY A;  4G7Z F;  1VTN C;  2IT0 A;  4YFX F;  1K7A A;  2VOO A;  1LJ9 A;  1LDK B;  5TJJ A;  1Z7U A;  3JAM Z;  3ML6 A;  1O3R A;  2XRN A;  1T0F A;  3B73 A;  2FOK A;  5FD5 A;  1STZ A;  3L7W A;  2ISY A;  3FM3 A;  3LA3 A;  1I6X A;  1B9N A;  1D3Y A;  2Z99 A;  4A5N A;  1J9I A;  1ZHF A;  3F3X A;  2W25 A;  2NNY A;  2QM3 A;  2TDX A;  1Z6R A;  3GX4 X;  4ZZD A;  1FPQ A;  1XSX A;  1XCV A;  3I59 A;  2F5C A;  1FP1 D;  1TTY A;  4ASN A;  4EM0 B;  1X3U A;  3O2P E;  1MJA A;  4HF2 A;  5FFZ A;  1L0O C;  3P7N A;  1YS6 A;  3R4K A;  2VBX A;  5DCM B;  4IRH A;  2L01 A;  3DV8 A;  1SD4 A;  2YX7 A;  1HBX G;  2A5Y B;  4WK8 F;  4HAM A;  3ZMV A;  1HKT A;  3TKY A;  2B0L A;  1IXS B;  3Q5F A;  1UCR A;  1IN6 A;  1U5T A;  2LDU A;  5HVQ C;  1KQ0 A;  2P7C B;  1NHA A;  5AON A;  4A5M A;  4MEX F;  2D2W A;  2V9V A;  3KP7 A;  2VC1 A;  5ICE A;  5LEK A;  3KZZ A;  3MZH A;  1FT9 A;  2ZNY A;  1R1T A;  2VBZ A;  3GXO A;  2ZFW A;  3ZP5 A;  3WU1 B;  3EDP A;  1ON2 A;  1W7P D;  2KJC A;  3O3K A;  2HKX A;  3K1M A;  4IRG A;  2P5K A;  1O3S A;  1J2X A;  2M30 A;  5TRD A;  4P5O A;  4BH9 A;  3E6B A;  3V8J A;  4NB5 A;  3K9T A;  4FHT A;  4OMZ A;  1ZGJ A;  4JBA A;  5DEQ A;  2VE9 A;  3SZT A;  4OIQ F;  2PJP A;  1MJ9 A;  2FE3 A;  4CYD A;  1FYL A;  3E5U A;  3TQN A;  3HSR A;  3GFI A;  4BNC A;  1BC8 C;  1LDD A;  3ABT A;  4R1H A;  4AIH A;  4FX0 A;  4EJT A;  4M9S A;  2Q0O A;  3IHU A;  1BI0 A;  4M71 A;  3F8B A;  1ZLK A;  2O8X A;  2VOD A;  1ON1 A;  3M1E A;  4HF0 A;  3FX3 A;  3IRQ A;  1BIB A;  3C18 A;  4XSX F;  2H27 A;  4AVP A;  3I64 A;  2XAG A;  3Q9V A;  1I5Z A;  2OZ6 A;  4OIO F;  1MDM A;  1TQI A;  2P4W A;  4GGG A;  4M74 A;  3WTX C;  2HFH A;  1BI3 A;  2MD5 A;  2PMU A;  5BQT A;  1T98 A;  1B6A A;  3FMR A;  1HQC A;  5D6F A;  3LQQ A;  3QOP A;  1IXR C;  3CUO A;  1FX7 A;  2P5L C;  1YIO A;  3NRV A;  2HWV A;  1FWZ A;  4ENJ A;  2PMH A;  3ZN1 A;  4LB6 B;  1R36 A;  1LQ1 A;  2EA4 A;  2GA1 A;  4EJU A;  1H0M A;  2ISZ A;  3RI4 A;  2JRT A;  4P9U A;  1ZH5 A;  4I0A A;  2A68 F;  4FX4 A;  3IL2 A;  2E7X A;  3HTS B;  1P4A A;  2COM A;  2OQG A;  2DK8 A;  1IRG A;  4HLX A;  4ENN A;  2YX4 A;  2HQN A;  5JHU A;  1Q1H A;  4HZF A;  4MQV A;  1FLI A;  3RTR A;  2XKO A;  3WTT C;  1K79 A;  3GWZ A;  2VT2 A;  5HDK A;  3TOA A;  1UST A;  4KN7 X;  5E20 A;  1UHM A;  2EFN A;  4PCQ A;  1CF7 A;  4EJO A;  1PP8 F;  3RKW A;  1S8N A;  1OYW A;  5LLQ A;  5CVJ A;  4N9H A;  3QP6 A;  3IKV A;  4I01 A;  2Y75 A;  2XAH A;  3BPX A;  1J75 A;  4RGR A;  3L2C A;  2H6C A;  1ZN2 A;  3I53 A;  1QZY A;  3P9K A;  3M8F A;  1L3L A;  2ZBK A;  1R00 A;  2PN6 A;  1GXQ A;  4IPA A;  2JPB A;  4U7B A;  3EYY A;  4G7H F;  1U8R A;  2QQB A;  4HX8 A;  4LB5 A;  2QLZ A;  3HSF A;  1CGP A;  2DPU A;  2EFO A;  5L3G A;  1AOY A;  1KGS A;  3JW4 A;  2A3S A;  2LNB A;  3MFK A;  4OIR F;  1S7O A;  1PP7 U;  2YPR A;  4ZYH A;  5CVI A;  1RIO H;  4I2O A;  4GCV A;  1SMT A;  4P55 A;  5L3D A;  2IA1 A;  1W7P B;  4MQ9 F;  1OYY A;  3WU0 A;  5E8I A;  2FMY A;  3HRM A;  3WGG A;  3WOD F;  2CW0 F;  5LHI A;  4OMY A;  3L00 A;  2A6H F;  2XVC A;  2HGC A;  3GZ6 A;  4EJW A;  4MNU A;  5E1Z B;  1YG2 A;  3HRT A;  3F6V A;  4HBL A;  3U2R A;  1W7P A;  2K02 A;  1PUE E;  1G4D A;  1S6L A;  2ZO4 A;  1R5G A;  3H92 A;  5E8G A;  3CJN A;  2YR2 A;  5HS7 A;  3N4M A;  4L9N A;  4LFU A;  2Z9O A;  2ELH A;  2EK5 A;  2KIU A;  2M8E A;  2XHK A;  1EH8 A;  1XDS A;  1F9N A;  3I5U A;  2VN2 A;  3C1D A;  2QEN A;  1FBQ A;  3F8C A;  3T1B A;  4CXF A;  1FBU A;  1EH6 A;  2Q2E A;  4LG0 B;  4IXA A;  2IJL A;  3DFG A;  3KP3 A;  3EET A;  3GO5 A;  4UHT A;  4A6E A;  1YTY A;  1A04 A;  4OU0 A;  3ROU A;  3WE2 A;  2DQR A;  5LGN A;  1QNT A;  3K2Z A;  2ESN A;  3V8L A;  4P96 A;  4ZYG A;  3F21 A;  1QBJ A;  3IWF A;  4WXC A;  4L0Z B;  1TBX A;  2JSC A;  2RDP A;  2C6Y A;  3M9A A;  2GWR A;  5FD6 A;  5H6R A;  2ESH A;  5K5Q A;  2A61 A;  2K27 A;  1MGT A;  3P9I A;  1R1U A;  2RN7 A;  2K86 A;  4RGU A;  4IJA A;  3HTU A;  1J0R A;  1TQM A;  2V1U A;  1T2K A;  4KNY A;  2RGV A;  2E1C A;  4NHJ A;  3HRS A;  3RYP A;  3HHG A;  3CUQ A;  4G8X A;  3EUH A;  1I1S A;  1O57 A;  5IT3 A;  2D1H A;  3DEU A;  4EMS A;  3REO A;  1O3T A;  1T38 A;  4YII A;  3C3W A;  4O3M A;  2ZCW A;  3GW2 A;  2PQ8 A;  4YG2 F;  4UVA A;  5FB2 A;  1P4W A;  5HLI A;  2F5D A;  4I09 A;  4PZJ A;  5KK1 A;  3KFW X;  3JSP A;  4L9T A;  5ERI A;  5ICG A;  5J8F A;  2QUF A;  3LA2 A;  1QO0 D;  2FA5 A;  1KU9 A;  2IW5 A;  3PQJ A;  4OIN F;  2VON A;  5FLX K;  1Z6T A;  4LJZ F;  1FSE A;  1TW3 A;  4XLP F;  5HS8 A;  2MH9 A;  5L3F A;  2L4M A;  2FBI A;  2GXG A;  4CHU A;  1IN5 A;  2OZU A;  2M5W A;  2DT5 A;  2ZME B;  1P6R A;  4M6Y A;  3G73 A;  4U88 A;  5EEH A;  3ZMD A;  1AWC A;  4BXU A;  2XAS A;  4D0P A;  5F64 A;  4KYW A;  3K69 A;  4G94 A;  1QQI A;  4R79 A;  6PAX A;  4RB3 C;  4I98 B;  1B4A A;  5JFR A;  4DNC A;  1XDU A;  5IT9 K;  2P6T A;  4M6X A;  4KIB A;  3OOP A;  1U78 A;  2EJR A;  4BQA A;  2KIM A;  1TW2 A;  1QPM A;  5ICF A;  2JZY A;  1ZRC A;  4I0B A;  4O5V A;  1J59 A;  1REP C;  3GYH X;  3HSE A;  2FNP A;  4JQF A;  3LAP A;  5K5R A;  4AD9 A;  2Q8K A;  3I4P A;  1BOA A;  1XGN A;  2CG4 A;  3ZMS A;  2MC3 A;  2ZKZ A;  1FZP B;  4L0Y B;  4LK0 F;  1P92 A;  2HZT A;  5DCM A;  4XRF A;  2XIG A;  2JPC A;  3J7A O;  2K4B A;  4B8X A;  3FXQ A;  1IF1 A;  2V6C A;  1EV7 A;  1U6G A;  1Z91 A;  2EB7 A;  1MZB A;  3BJA A;  3ZN0 A;  3ZQ7 A;  2DI3 A;  3R0J A;  3BDD A;  1JHF A;  2M1B A;  2MLK A;  3FWE A;  1UFM A;  3SQN A;  5L3E A;  2L4A A;  2NNN A;  5AIP A;  2G7H A;  2K7L A;  2RKH A;  1IN7 A;  5FLX Z;  1ZRD A;  1FYM A;  3K1P A;  5JVT A;  1TQP A;  3WTV C;  1O7L A;  4AWX B;  3DQV C;  1KA8 A;  5D8L B;  3M8E A;  5DUK A;  3FZV A;  1SFE A;  4KUM A;  2VC0 A;  2Z5U A;  4ENM A;  1BIA A;  3QU3 A;  2XUB A;  4HA8 A;  4EJV A;  2M87 A;  4N0B A;  4O6J A;  4WXH A;  2RVC A;  4BHP A;  3FMQ A;  1MD0 A;  1OYI A;  5LGU A;  2QQA A;  4HDU A;  3V4G A;  4A0Y A;  4PGG A;  4EM2 A;  1W5S A;  1S3J A;  3E6D A;  2VT3 A;  2CO5 A;  3F8N A;  4NQW A;  2FBK A;  3BZ6 A;  5D5V B;  3HRU A;  3RIR A;  2NYX A;  2DO7 A;  2CFX A;  2STW A;  5IT9 Z;  1H9T A;  5DD8 A;  3KEQ A;  2EWN A;  3Q9S A;  3LQR A;  1SMY F;  2FML A;  1ZLJ A;  2GZW A;  3R0A A;  4Y15 A;  1WWX A;  5ED4 A;  2NAZ A;  2CSO A;  3WTW C;  3KLO A;  1XSV A;  2ACJ A;  4Q47 A;  4BYY A;  1BN5 A;  2H6B A;  1YW9 A;  1HKQ A;  2HKO A;  5LEJ A;  4GYG A;  1UB9 A;  4EGZ A;  1LEB A;  3SFZ A;  5LGT A;  3RKX A;  1FP2 A;  3CLO A;  1IXC A;  3V8K A;  1H9G A;  3PQK A;  4RS8 A;  3TOB A;  4WF2 A;  4KFC A;  1DPU A;  3TO9 A;  1R22 A;  2LF7 A;  4ON0 A;  1RI7 A;  3DPL C;  2FBH A;  1B9M A;  5CYV A;  3K1N A; 
#chains in the Genus database with same CATH topology
 1D8K A;  2I10 A;  2WA0 A;  1CQT A;  3GFM A;  3HL2 A;  5BPD A;  1YO5 C;  1U0J A;  2QZ8 A;  5H20 A;  5L3C A;  1UHW A;  5LRR A;  2KRF A;  1G8X A;  3L2W A;  4LGW A;  4NNJ A;  4L5J A;  4CYC A;  1KYW A;  2LVS A;  3ASN H;  1IN8 A;  2XKP A;  5DM6 F;  5J1U A;  5HLG A;  2RV8 A;  1KQ8 A;  4BHB A;  3MZ8 A;  4HLY A;  2ZXJ A;  2QKM B;  4A0X A;  4CSW A;  2L3D A;  2DCE A;  4ESJ A;  2BHZ A;  4KJZ A;  1FSH A;  4IL6 C;  3KP5 A;  3D0S A;  2KJB A;  5C4J J;  4ESB A;  2EPF A;  1AHD P;  2L2O A;  3F0C A;  4G6Q A;  1YQA A;  1RES A;  4D1Q A;  3DBH B;  4IHW A;  2ZFU A;  2VOP A;  1Z7L A;  4BGD A;  3L2U A;  1I50 J;  3E7L A;  3GTG J;  2BV6 A;  2DDA A;  5FRM A;  3WG7 H;  3DF8 A;  2AXL A;  2V1D A;  3W6J B;  3WTS C;  3OYC A;  3CCQ I;  1LVA A;  3RQI A;  1E0E A;  1YW7 A;  1ZR2 A;  1BR2 A;  3BWG A;  3S8P A;  2W1O A;  1DPR A;  2YS9 A;  2JUG A;  1NK2 P;  1GHC A;  2CUZ A;  3ERE D;  2BOL A;  3K70 D;  2EFQ A;  1UAA A;  4C9Y A;  4OOI A;  2JQ7 A;  1BJZ A;  4A6D A;  5D5U B;  4FQG A;  4FIS A;  1N77 A;  1LNW A;  3SZP A;  3KP4 A;  4I6Z A;  2EZK A;  4E7J A;  4E70 A;  2CGP A;  1ORK A;  3ZQQ A;  1E17 A;  1QU3 A;  2J5O A;  3IRR A;  5H6Q A;  4DQ2 A;  3PFY A;  2Z3Y A;  3HOT A;  3E97 A;  2PG4 A;  3CF2 A;  3IC7 A;  2HYF A;  3HG9 A;  2R7D A;  5E79 C;  3MKW B;  4I76 A;  1UEL B;  2XAQ A;  3MD2 A;  4WX9 A;  4RBO A;  1ZG1 A;  3LSR A;  4YEL A;  2CMP A;  5LRS A;  2YU9 J;  2COB A;  1QHH D;  2Y48 A;  1R23 A;  3E3V A;  3HPH A;  2DYS H;  4JK1 X;  3PNT A;  4ETS A;  3B02 A;  1Z1D A;  4KIC A;  4BUP A;  4HNT A;  3H0G J;  3OV8 A;  3V7C A;  5HOO A;  4A3J J;  4C2T A;  2IBD A;  2K4J A;  2GXA A;  1OCZ H;  4EV0 A;  1U3E M;  3N97 A;  2DAO A;  3I0T A;  4QLC U;  1IGN A;  2R7R A;  3HJE A;  3BTI A;  1K6Y A;  1WHU A;  1P9Q C;  4QPQ A;  2X1D A;  1PUF B;  2L54 A;  3WE3 A;  2J5P A;  5IP7 J;  1UG2 A;  2V1X A;  4OAZ A;  5E18 F;  3OYJ A;  2EA2 A;  3OYN A;  3RZD J;  4AM3 A;  3CMM A;  1HXD A;  1VF9 A;  1HLV A;  3J7Z I;  3L2V A;  3FXM A;  3QP5 A;  1ZG3 A;  2W82 A;  2XDV A;  5FKO A;  3I71 A;  4XR6 A;  4KIF A;  3L2R A;  3EUK L;  1T33 A;  3SEZ A;  4DIQ A;  5LHH A;  1R1V A;  2P81 A;  4UVC A;  3U9G A;  4CZZ A;  4XKC A;  4MTD A;  3AFH A;  3G2B A;  1H89 C;  3FK7 A;  2VLA A;  2L9S A;  4LLN A;  4D7M A;  2ETH A;  4CDG A;  1HSJ A;  3E5X A;  5K5O A;  1XD7 A;  4ZZL A;  2HDD A;  3QPS A;  5GAE J;  3L09 A;  3AG1 H;  3HUG A;  3DPT A;  4M3G A;  2E71 A;  2L02 A;  2LKP A;  1YJ9 I;  2KDO A;  4IVN A;  1RUO A;  2KT0 A;  2O0Y A;  3T8T A;  2FRH A;  1SVO A;  4EGY A;  1DDN A;  1I1G A;  4BJ5 C;  2OAZ A;  2R5Y A;  2XAU A;  3Q0V A;  2CV1 A;  2QWW A;  3R60 A;  1C0W A;  1ENH A;  2PEX A;  2JUC A;  4M3D A;  4WCG A;  3R61 A;  1ZAO A;  2CQ7 A;  5J6X A;  1R5I D;  1YW8 A;  1TLH B;  3TMO A;  2VQC A;  4UUT A;  1B59 A;  4LG0 A;  5E17 F;  3HPG A;  3JRE A;  1G3T A;  1KON A;  2LH9 A;  4DYR A;  5ICC A;  2HTJ A;  3WGI A;  2D45 A;  1VFC A;  3KEY A;  2LFB A;  4XRS G;  2XAJ A;  2FEZ A;  4LLG F;  4RM3 A;  1S72 I;  4PFO A;  2L9V A;  4XMY A;  5D4R A;  3PUB A;  3Q0U A;  4XLF A;  4C3I J;  2EFP A;  4UVB A;  2UXN A;  4LMY A;  4MFE A;  2DQL A;  3WG9 A;  3S3M A;  5HDN A;  3MVP A;  3CDH A;  3FDY A;  2JRM A;  3BOQ A;  1Z67 A;  4JX6 A;  2DN0 A;  2F4O B;  2DOE A;  1K4T A;  1B8I B;  2HNH A;  5B1A H;  5CKT A;  2DTZ A;  1YIT I;  2LLK A;  1E2X A;  3KZI C;  1POG A;  4GRI A;  2R5Z A;  3FXR A;  3K4C A;  3UKG A;  2X85 A;  5EJC A;  1YFH A;  3Q0W A;  4CUG A;  1LE8 A;  2KDZ A;  1SFU A;  2ZC2 A;  1QRY A;  2R7Q A;  1VQ8 I;  2QBY B;  5JR3 A;  4IHV A;  2EV0 A;  5DCF A;  3WTU C;  5DTD A;  4E7H A;  5CVR A;  2PFB A;  1ZRF A;  4HYE A;  4N4N B;  1HKS A;  1YJN I;  1WKM A;  4ZH4 F;  2OU2 A;  5ILV A;  4P9F A;  3VYR B;  1PYV A;  2DLL A;  2KLO A;  2M0C A;  3D5S C;  1F4K A;  3ULQ B;  3FXU A;  2N8G A;  3T8R A;  3K6G A;  3LFK A;  4IRI A;  2MSY A;  3GTK J;  1ZKG A;  1XMK A;  2YSR A;  4G6D A;  4B47 A;  3CO6 C;  1R58 A;  4A3E J;  1Z3X A;  4A3B J;  2UZK A;  2JK3 A;  4XBF A;  2VJ4 A;  3LWF A;  2HOE A;  3UR3 C;  1YRN A;  2JN6 A;  2UXX A;  4MTE A;  4XLN F;  3BQY A;  2QGU A;  4BDZ A;  4W97 A;  2O7O A;  5KVR A;  4HQE A;  4BL0 B;  5J47 A;  1XSD A;  3DEW A;  4HG2 A;  1K6O A;  2HEO A;  3V42 A;  4CGZ A;  1J09 A;  3QU6 A;  4GO1 A;  2MLG A;  3W6K B;  2W24 A;  2PJR A;  1J7K A;  3TGN A;  2LKX A;  2O03 A;  4H4K C;  2GIZ A;  1IN4 A;  1P2F A;  4LK1 F;  1RR8 C;  3FBI B;  5CVV A;  4BQQ A;  4L18 B;  4UV9 A;  2F2E A;  2HOT A;  3IV5 A;  3CP8 A;  4PDK A;  3LSK A;  3CD6 I;  4AYB A;  3LSP A;  1YJW I;  2DMU A;  2DA4 A;  2ZJQ F;  2OJE D;  3PM1 A;  3MAJ A;  4F3Q A;  1JTX A;  3ZPL A;  2HTS A;  3LST A;  1JE8 A;  4KN4 X;  1V3F A;  3RJP A;  3F8M A;  1MBK A;  1MBH A;  2BXZ A;  2KL4 A;  5J1R A;  4A3F J;  2M34 A;  1JGS A;  4KIG A;  4A93 J;  2GLO A;  3PL8 A;  4DJA A;  4ZYE A;  3F22 A;  4CCK A;  3NAR A;  2VB6 A;  3KP6 A;  4XLH A;  3TP3 A;  3CJT B;  4A3C J;  2HI3 A;  1HW1 A;  1KYZ A;  4PGH A;  4HEA 2;  3ECH A;  1XN7 A;  3PNY A;  4BE0 A;  1P7I A;  3FF5 A;  3V7R A;  1VQM I;  1X2M A;  4HX4 A;  1GXP A;  1UZC A;  3K4M A;  2BBY A;  2QCO A;  1JXS A;  4S04 A;  2ZME A;  1Z9C A;  5ILS A;  2JA2 A;  1OR7 A;  4F93 B;  4CO8 A;  2DOA A;  2HDC A;  2NS8 A;  5FGM A;  2BGC A;  2GBY A;  4AIJ A;  1XMA A;  1ZGA A;  2HZD A;  3BTL A;  2CQX A;  3K4B A;  4UV8 A;  2BXY A;  3VEP A;  3AKZ A;  3KET A;  3TW6 A;  2R3S A;  3ESW B;  3VYT B;  3FBN B;  2UWM A;  4NDL A;  2BW3 B;  4P1W A;  4EVI A;  3I9V 2;  4BY7 J;  2W57 A;  3G71 I;  4RLQ A;  4ZYD A;  4CCJ A;  5E3L A;  5M3M J;  3VWB A;  2JVH A;  2A6E F;  2L0K A;  2ZNZ A;  1TWH J;  3KLN A;  4BHC A;  1W4M A;  2R93 J;  2IA0 A;  3IH2 A;  3TDU C;  3CZ6 A;  3ECO A;  3I59 B;  4QWQ A;  4XSZ F;  1IAW A;  1WRJ A;  2MW8 A;  3S3N A;  4ZTF A;  1ZRE A;  1TNT A;  5KAF C;  1IV8 A;  1R49 A;  4RGX A;  2WWY A;  3FIS A;  1IZ1 A;  3L9F A;  5K1Y A;  4IHS A;  4KDP A;  1LEA A;  4ANJ A;  3CDI A;  4G6T B;  2ZME C;  1BW6 A;  4BBS J;  4BU2 A;  1S9H A;  1DUX C;  3K70 C;  2V79 A;  1HW5 A;  1WI9 A;  4LOC A;  4UNO A;  1BA5 A;  2R7U A;  2KIF A;  5IYC J;  2DJN A;  1BBY A;  3J81 Z;  4KT5 C;  3VB2 A;  3HYI A;  4L5E A;  2PMZ N;  4CH7 A;  1IV6 A;  3CES A;  2DFI A;  1RNL A;  1WQ2 A;  2OUM A;  2VKH A;  2BE5 F;  2TRT A;  2LMD A;  3JSO A;  1A31 A;  1UHS A;  1U5T B;  3DWL E;  2LRE A;  5A2Q K;  1WJB A;  4XRS A;  3KCC A;  2HVS A;  3W2A A;  5FRO A;  3S2W A;  4QSH A;  3KP2 A;  2A07 F;  2HVQ A;  1I27 A;  1MKM A;  1Z77 A;  1G6N A;  1HST A;  4BAY A;  3AAF A;  3FHZ A;  3W2W A;  3P5J A;  4RB2 C;  4N4O B;  1JT0 A;  1ZAR A;  5DS9 A;  1A6Q A;  2XB5 A;  4Q4Z F;  3TDZ C;  2FUG 2;  1HW2 A;  4DW6 A;  3QWL A;  4X6A J;  1LDJ A;  2VL8 A;  2JA7 J;  5FO5 A;  5H2F C;  2GA2 A;  2XPV A;  4BEH A;  3H3U A;  3BG5 A;  2DA3 A;  3BJO A;  3H9Q A;  1W0T A;  3CP2 A;  4HSR A;  3IP4 B;  3DXJ F;  1K78 B;  2MA3 A;  4LIT A;  4XKW A;  3PSI A;  1YLF A;  2G7U A;  4XM3 A;  4EEF G;  3OL3 A;  3G1L A;  2R7S A;  3ZMZ A;  2Z2S B;  3HGG A;  3OY9 A;  2CJJ A;  2KMU A;  2A69 F;  3F8F A;  2YUS A;  4OIP F;  2W85 A;  1XGO A;  4J19 A;  3OYG A;  3N05 A;  1GVD A;  4RAY A;  2VBY A;  3WGH A;  3SDB A;  2DA5 A;  2P6S A;  2KPM A;  3BLY A;  1NK3 P;  1XX5 A;  1P7J A;  3T5X A;  3TP0 A;  2V6E A;  2FU4 A;  3NWS A;  1K78 A;  1FBS A;  1OMI A;  2ELJ A;  2EFW A;  4ENK A;  4NBQ A;  3GF2 A;  2M4G A;  1FNN A;  4U0W A;  3RKY A;  2VE8 A;  1O3Q A;  3DKY A;  3JTH A;  3MCZ A;  3QPT A;  2X0L A;  2RC4 A;  2ZJ2 A;  5DUI A;  5HNH A;  1HDP A;  3MQ0 A;  2GXB A;  1MJB A;  1IG7 A;  1IUY A;  3TL4 X;  4XON A;  2M7B A;  4IQ4 A;  1J5Y A;  2ME0 A;  2R7F A;  4HV5 A;  1U5T C;  2M45 A;  2E5Z A;  4II3 A;  2MBF A;  3ELK A;  1F5T A;  3E0J B;  1Z05 A;  4U0V A;  2QVO A;  2Y0S N;  3I4N J;  3KPH A;  1SD5 A;  3QPH A;  5GTH C;  3EUA A;  4H0E A;  4UXN A;  2FSW A;  1BI1 A;  3E6C C;  2G9W A;  4CIC A;  1FOY A;  4CCN A;  5BOX A;  1S29 A;  5IP6 A;  3ZMU A;  4HF1 A;  3MKZ A;  3ISP A;  4NC8 A;  2KZV A;  5D6E A;  3W6V A;  4FET A;  4GYI A;  3OYA A;  1YI2 I;  1IW7 F;  1FTT A;  1FOW A;  3AL0 B;  3HOU J;  3KEO A;  2EIM H;  4A3G J;  2Z33 A;  2JTV A;  3S93 A;  3WHB A;  2EZH A;  3BG9 A;  4B09 A;  1W5T A;  4UUV A;  1DP7 P;  2WY8 Q;  3VDX A;  3S17 J;  2L7M P;  4MEY F;  3MKL A;  3BJ6 A;  5DDG A;  3IKT A;  2QSH X;  2OA4 A;  3DBL B;  4CA0 A;  4G7O F;  3VOD A;  5F1R A;  4M3B A;  4A0Z A;  4HPQ A;  1W5C C;  2JJ7 A;  1MDM B;  3ABU A;  3J80 K;  3CJR B;  5DYM A;  2WAQ N;  4HQM A;  4Z2Y A;  4N9I A;  1JJ8 C;  4BS9 A;  1VQ5 I;  1VQ4 I;  2OQR A;  4WXD A;  1SD6 A;  4LD5 A;  3LAJ A;  3AG3 H;  5EEA A;  1SAX A;  2F4I A;  3K0L A;  2FQ4 A;  4IF4 A;  1Y56 A;  3T0Y A;  3OSF A;  3U21 A;  4EQQ A;  1OPC A;  2VBW A;  1TP4 A;  4Y13 A;  2K85 A;  2F48 A;  4Y17 A;  5L3B A;  2FXA A;  1FIA A;  3NAU A;  5F6F A;  4E7Z A;  3F72 A;  4DGW B;  3BC8 A;  1EKE A;  3A02 A;  3ZOB A;  4RGS A;  1RZ4 A;  1Y1V J;  2HYG D;  2IVM A;  5HDG A;  3DLL F;  3TO7 A;  1SVL A;  1G3Y A;  3U1D A;  1KQ9 A;  4L5I A;  2KKO A;  2RAE A;  2HOA A;  2D1V A;  4A12 A;  1D8J A;  4MGR A;  2MD0 A;  3ZQG A;  4RA2 A;  1QZZ A;  1WJA A;  2FNA A;  2F6C A;  3OS0 A;  1BM9 A;  3I4M J;  4YIF A;  3HDD A;  5A2Q Z;  1ZYR F;  4I02 A;  3I3L A;  1IRF A;  5E1W A;  3E5Q A;  4E4H A;  1QA6 A;  4YFK F;  3FM5 A;  4RB0 A;  2IA2 A;  3ABM H;  2EV5 A;  3RPU A;  1H8A C;  2BYV E;  4L9V A;  2R7T A;  1BW5 A;  3S32 A;  3AL0 C;  1WSU A;  4AYB N;  2G0E A;  5GAG J;  2OPT A;  4I7H A;  2E2I J;  2K40 A;  5EZG A;  1GV2 A;  4EM1 A;  1R5H A;  2F5V A;  2H1L A;  1RRJ A;  2EIN H;  5B5E C;  3BY6 A;  5LFA A;  2LBF B;  3MWM A;  2XAF A;  3HOZ J;  2R7O A;  2JT1 A;  3VYU B;  3RPQ A;  2QQ8 A;  4XKB A;  2Y9Y A;  3GZ5 A;  2BHY A;  3MZY A;  5D8K B;  2W4S A;  3HIF A;  2BY2 A;  1CF7 B;  1XC5 A;  4UB6 C;  1LFB A;  2GAU A;  1JHH A;  4A2U A;  3PO3 J;  3WTY C;  2FQ3 A;  2WC2 A;  2V7F A;  4E6K G;  1D1C A;  3CO7 C;  1T8I A;  4YFN F;  2NS0 A;  2WB1 N;  4ZC3 A;  1I3A A;  3UNG C;  4U0Y A;  2LYC A;  2E1N A;  2M4K A;  1G3W A;  4C2U A;  1BC7 C;  3O6B B;  1LB2 A;  1V4R A;  2O6G E;  3H1C A;  2IEK A;  3EYI A;  4IEJ A;  4K2E A;  1MH4 A;  1B72 B;  3Q3S A;  4AIK A;  2A5W A;  1BJA A;  2IS1 A;  4RLF A;  2DTR A;  4C2M J;  2CWE A;  5BNG A;  4F7Z A;  2DK5 A;  3IWZ A;  3DEE A;  2VJJ A;  4X1E A;  2QF7 A;  2L7F P;  5CQE A;  4F91 B;  2BEO A;  5HLT A;  4CCM A;  2STT A;  2X9D A;  1KU3 A;  1OQY A;  2HPM A;  3FMS A;  2XV4 S;  1B72 A;  2MGQ A;  3GVA A;  3PSF A;  3H3V K;  1RUN A;  1ETQ A;  3IH3 A;  3KX2 A;  4IHY A;  5BS6 A;  3CTA A;  2IGM A;  3JCU C;  2NVT J;  2VI6 A;  3BCB A;  4HDV A;  2AHQ A;  3P9C A;  3GLX A;  3C7J A;  1G3S A;  4DZJ A;  2EIL H;  1TZL A;  2WTE A;  4Y4R A;  5DV5 A;  1F43 A;  4NC6 A;  3V7S A;  1B1B A;  2RQP A;  2QYO A;  2AS5 F;  2IPQ X;  2PMZ A;  1ZG5 A;  3JRF A;  2CV0 A;  3GFJ A;  2KHM A;  3ZRG A;  4NC7 A;  1TWC J;  1IRZ A;  1XGS A;  1A6I A;  3CJQ B;  2HQR A;  3SHF A;  2IS6 A;  3BPV A;  4ZJZ A;  1KU7 A;  1HC8 A;  1QVT A;  2HU9 A;  2LTP A;  2MH2 A;  4LLL A;  2HR3 A;  5J40 A;  3BR2 A;  4Y3O A;  2LSO A;  2QQ9 A;  3J80 Z;  1QGP A;  1ULY A;  4OWR B;  1WI3 A;  1ONV A;  2ID6 A;  2OC6 A;  3NQO A;  5D5W B;  2O61 A;  1F36 A;  3KYL A;  2BY3 A;  1ETO A;  2O3F A;  5J1Y A;  3M7G A;  3OOU A;  2DXI A;  4KIS A;  1S7A A;  1ITY A;  3E6M A;  5E1X A;  3MEX A;  3SYT A;  2NVY J;  5K7F A;  2DU9 A;  1VQ6 I;  2F5E A;  4F55 A;  2WV0 A;  4TV7 A;  4XK4 A;  3SXY A;  4RAZ A;  1VQ9 I;  1RC9 A;  1FY7 A;  3NWT A;  2W84 A;  5M5Y J;  1PUF A;  3QRF F;  5J8C A;  3GUD A;  4KMU X;  3OIQ A;  2MAB A;  1GVJ A;  5BPI A;  4PJ0 C;  2CW7 A;  3CC7 I;  2XRL A;  2RNJ A;  2XRO A;  1KU2 A;  2HS5 A;  2F5F A;  1MIJ A;  3HHH A;  3RDI A;  3WTZ A;  3GFL A;  1I39 A;  1SFX A;  2CFO A;  3QQA A;  1TWF J;  2DMT A;  3ZR8 X;  4IQJ A;  3BRO A;  5CJ9 A;  3D5L A;  4XOP A;  2QEX I;  4II2 A;  3JRC A;  2ELK A;  1LFP A;  2NOG A;  3HGY A;  3TO6 A;  5CLS A;  5IY5 H;  2Q2E B;  2VAS A;  3LSM A;  4GXO A;  1OIS A;  3S1Q J;  4BY1 J;  2OBP A;  1WJ5 A;  2BVL A;  1YIJ I;  4MFD A;  5LHG A;  3QYF A;  2ICW G;  2MYS A;  2P8T A;  4FT8 A;  4HW0 A;  2DPD A;  4U87 A;  4JP0 A;  1R7J A;  1R9T J;  2CQK A;  3HM5 A;  1RKW A;  3JAM K;  1XB4 A;  3ZCO A;  1Z21 A;  2E35 A;  3VOE A;  2Y0S A;  3W2V A;  5JI6 A;  5C44 J;  1FC3 A;  2K3F A;  2R7X A;  3JR9 A;  1FOK A;  2E1O A;  4ZDL A;  3ZMT A;  5LBQ A;  1EH7 A;  5E3M A;  2PI0 A;  3KE2 A;  4XLA A;  3G3Z A;  4R8H A;  3OYI A;  2KRH A;  4ZTJ A;  3NEU A;  5FKM A;  3BR0 A;  3DKW A;  2HYJ A;  1D5V A;  1K83 J;  2K9S A;  3BZK A;  1MMN A;  5D5X B;  4BDY A;  3BR6 A;  2VXZ A;  3HKZ N;  5JLX A;  3PIP F;  4W1U A;  2E5N A;  4CCO A;  4HX7 A;  3VFZ A;  3I58 A;  5FLV A;  3S2D J;  2V9K A;  4B3A A;  4M9X A;  3J81 K;  2IP2 A;  2ECB A;  2H09 A;  3EQL F;  2DFF A;  4HRI A;  2WAF A;  2ZXW H;  5F0H A;  2E36 A;  3QAH A;  1OKR A;  4M9Z A;  4ESF A;  2WAQ A;  3DTE A;  1W36 D;  2R7Z J;  3OR1 C;  1IC8 A;  3CUQ B;  1ODD A;  1WJD A;  1B8I A;  4WWC A;  1PVE A;  3F23 A;  5AIQ A;  5C3E J;  1YX5 A;  1Y0U A;  2ADU A;  3HOS A;  1VQN I;  1XGM A;  2I5U A;  2WAD A;  4U7D A;  2XGX A;  2ZJP F;  2Y2Z A;  2O8K A;  4QTR A;  1MMA A;  1FYK A;  3C2B A;  4G9Y A;  2XC7 A;  3A4C A;  3F6O A;  4HV6 A;  4Y7N J;  2QBY A;  2FF4 A;  3GEZ A;  3LA7 A;  2JSP A;  5F27 A;  2GQQ A;  1ZR4 A;  5KAI C;  4IO9 F;  3FXL A;  1MNE A;  4BE2 A;  1XCB A;  3DP7 A;  1YYV A;  2E7W A;  1X4O A;  2F4M B;  5EEG A;  2H94 A;  2R4G A;  4M73 A;  1PDN C;  2CYY A;  2L7K A;  3BP8 A;  3COA C;  2PBI A;  4Q5S F;  4L9J A;  1MSE C;  5ILU A;  4MLO A;  3OYB A;  2DW4 A;  1JKQ C;  3VSK A;  1MMS A;  4FE7 A;  2JA8 J;  5DM7 F;  3M07 A;  1MBF A;  1SD7 A;  4Q48 A;  1Z0X A;  1T39 A;  2EV6 A;  2LF8 A;  4RB1 A;  1GV5 A;  2DBB A;  3CF5 F;  3OYF A;  3TED A;  5EF6 A;  2P5V A;  1VQ7 I;  2P7V B;  3BG6 A;  4IHT A;  1OLT A;  1SFK A;  2X1E A;  3R6S A;  4M72 A;  3PFI A;  1U2W A;  2X4H A;  3RKQ A;  4MHG A;  2M3A A;  2NRA C;  2IRF G;  4KA4 A;  5CVU A;  1USS A;  2HOS A;  5HS9 A;  4AU7 A;  4BQN A;  2IXS A;  1BI2 A;  2GIV A;  1V55 H;  1T6S A;  3JTG A;  1M1E B;  5HLH A;  5F08 A;  2YU3 A;  3H5A A;  2PLY A;  1O7F A;  4DYC A;  3DBR B;  2L9N A;  3I54 A;  3KYC B;  1P4X A;  3CUQ C;  3K10 A;  5D4S A;  3H3Z A;  3EUH C;  4PJN A;  3G1M A;  5DD4 A;  5FFX A;  4KMF A;  2WB1 A;  1YS7 A;  3G1O A;  2ZJR F;  2OD5 A;  3B6C A;  3RYR A;  5BMZ A;  3OIP A;  4B1R A;  1QVU A;  1WGX A;  2DOF A;  1E3P A;  4S05 A;  4HOB A;  5GTI C;  2CH0 A;  1F1Z A;  2Y0M A;  4PJM A;  2LY9 A;  1TNS A;  3KZY A;  2Z16 A;  4G7Z F;  1VTN C;  2GOX B;  3BG3 A;  5IP9 J;  4YFX F;  2IT0 A;  1K7A A;  2VOO A;  1LJ9 A;  2EZL A;  1LDK B;  1KZH A;  4BJT A;  2KQR A;  3L1P A;  5TJJ A;  1JKR C;  1Z7U A;  4M6V A;  1JT6 A;  3CQZ J;  4JOM A;  3JAM Z;  1U9O A;  3ML6 A;  1O3R A;  2LK2 A;  2E34 A;  4D5F A;  2XRN A;  1T0F A;  2E60 A;  3BZC A;  3B73 A;  5J3L A;  3W3C A;  2FOK A;  4XOT A;  5FD5 A;  1STZ A;  3L7W A;  2ISY A;  3RSN A;  2AO9 A;  1HDD C;  3JRA A;  3FM3 A;  1MBG A;  2CU7 A;  4V2G A;  3LA3 A;  1I6X A;  1B9N A;  3LOC A;  1D3Y A;  4XOR A;  4I99 C;  2Z99 A;  3WHC A;  2RQQ A;  4A5N A;  4UY8 I;  1J9I A;  2XSD C;  2BW3 A;  1Y0N A;  1QZE A;  1ZHF A;  2R92 J;  3F3X A;  2W25 A;  1LPQ A;  2NNY A;  2QM3 A;  2TDX A;  3IUO A;  3LMM A;  1ZQ3 P;  2VIX A;  3CCY A;  4BBR J;  1Z6R A;  1IO2 A;  1ZTR A;  2BY0 A;  2Y69 H;  3I55 I;  3GX4 X;  4ZZD A;  1FPQ A;  2NVX J;  1XSX A;  1XCV A;  3I59 A;  2IAI A;  3A0B C;  2F5C A;  1FP1 D;  1TTY A;  2O5R A;  4NUB A;  5CQG A;  4ASN A;  4EM0 B;  2V4J C;  1X3U A;  2WAE A;  3O2P E;  1MJA A;  4HF2 A;  5FJ8 J;  5IYD J;  5FFZ A;  1L0O C;  1SVM A;  3P7N A;  1YS6 A;  3R4K A;  2VBX A;  5DCM B;  2UUZ A;  5GPA A;  4IRH A;  2L01 A;  2MC4 A;  3DV8 A;  1SD4 A;  2YX7 A;  1HBX G;  4CZC A;  2A5Y B;  2EZI A;  4WK8 F;  1ZEL A;  2LC2 A;  1T0F C;  4HAM A;  1OCP A;  5F04 A;  3ZMV A;  1HKT A;  3TKY A;  4DZP A;  4CCL A;  4FCY A;  2B0L A;  1IXS B;  3Q5F A;  1A5J A;  1I3Q J;  1UCR A;  1ETW A;  5EYR A;  1IN6 A;  4IOA F;  1U5T A;  2LDU A;  3OS2 A;  2OCE A;  3LSI A;  5HVQ C;  3EPZ A;  1KQ0 A;  1UJ8 A;  2P7C B;  1FEX A;  1E3H A;  2OTJ I;  2IGN A;  1NHA A;  5AON A;  4A5M A;  2M8G X;  1QPI A;  4MEX F;  3GLL A;  3TW7 A;  2RNG A;  2D2W A;  2V9V A;  1D0X A;  3KP7 A;  1R4M B;  2VC1 A;  2XF7 A;  3JRH A;  5ICE A;  1APL C;  4QPO A;  5LEK A;  1IDZ A;  4D5C A;  4RAG A;  3RZO J;  3KZZ A;  2NS7 A;  3BG7 A;  3M4O J;  3MZH A;  1FT9 A;  3OYH A;  2WBM A;  2ZNY A;  3PUF A;  1R1T A;  2VBZ A;  2E2H J;  2X51 A;  3ZGK A;  1WPK A;  3GXO A;  2ZFW A;  1DP3 A;  3ZP5 A;  3OYL A;  3WU1 B;  3EDP A;  1ON2 A;  4OAY A;  3JRD A;  5IOZ A;  1RET A;  1W7P D;  2KJC A;  3FXO A;  3O3K A;  1FJL A;  2HKX A;  3K1M A;  4IRG A;  2P5K A;  1T56 A;  2AQE A;  1J2X A;  1NG6 A;  1O3S A;  5JVG F;  1WZ2 A;  2M30 A;  1IUF A;  5TRD A;  1VND A;  4P5O A;  5IYB J;  4BH9 A;  3E6B A;  3V8J A;  1SC7 A;  3HC7 A;  2VQH A;  4NB5 A;  3K9T A;  4FHT A;  4OMZ A;  1R6R A;  1ZGJ A;  4JBA A;  3ZQH A;  3KYD B;  1K4S A;  5DEQ A;  2VE9 A;  1WJC A;  2DT7 B;  2K9Q A;  3SZT A;  3HKZ A;  2M0M A;  5EGO B;  4OIQ F;  2R7V A;  2PJP A;  3ZQC A;  4AID A;  1MJ9 A;  2GOM A;  2FE3 A;  1Y6I A;  4CYD A;  1D5Y A;  1FYL A;  3E5U A;  3SEQ A;  3TQN A;  4NQW B;  2KFD A;  1DGR M;  3HSR A;  3GFI A;  3CCV I;  4BNC A;  2A05 A;  1BC8 C;  3BR5 A;  1LDD A;  4ZYA A;  1N75 A;  5KNL A;  5C4X J;  3ABT A;  3BCA A;  2XGC A;  3FK6 A;  1NTC A;  4R1H A;  4AIH A;  4FX0 A;  1AKH B;  4EJT A;  3K4K A;  4M9S A;  2Q0O A;  2KIQ A;  1UMQ A;  3IHU A;  1BI0 A;  4M71 A;  1MMD A;  3F8B A;  1ZLK A;  2O8X A;  4C3J J;  1ON1 A;  3M1E A;  2VOD A;  3ZQL A;  4HF0 A;  4RAF A;  3FX3 A;  2AQF A;  3IRQ A;  4EAT A;  1BIB A;  3BTJ A;  3C18 A;  4XSX F;  2FOW A;  2H27 A;  4AVP A;  2VKD A;  3S1R J;  3I64 A;  1SAN A;  4BQO A;  2XAG A;  2XPW A;  3ABK H;  3Q9V A;  4XL9 A;  2DDB A;  1QHG A;  3CC2 I;  1I5Z A;  2VJ5 A;  2OZ6 A;  5M5X J;  4OIO F;  1OFC X;  1MDM A;  3ZQF A;  1TQI A;  3AG2 H;  2P4W A;  1XG1 A;  4GGG A;  4M74 A;  3WTX C;  4ABZ A;  2VKV A;  2QSG X;  2HFH A;  3H0D A;  1BI3 A;  1T08 B;  2MD5 A;  2PMU A;  5BQT A;  5FRN A;  2HQA A;  1W36 C;  3JRG A;  1T98 A;  3F9K A;  5M3F J;  1B6A A;  3FMR A;  1HQC A;  2CQQ A;  3S15 J;  5D6F A;  4FTH A;  3LQQ A;  3QOP A;  4HST A;  1IXR C;  3CUO A;  3GBG A;  5JHF A;  1FX7 A;  2P5L C;  1YIO A;  3NRV A;  2HWV A;  1FWZ A;  5JLW A;  4JX4 A;  4ENJ A;  3U1K A;  1K61 A;  2PMH A;  3ZN1 A;  3MMY B;  3RQ4 A;  4Y52 J;  3QOE A;  4DBR A;  4LB6 B;  1R36 A;  1MH3 A;  2CUJ A;  4A3L J;  1LQ1 A;  2HXI A;  2EA4 A;  2GA1 A;  2L5Q A;  1TWA J;  3H9J A;  2NVU B;  1U9N A;  3VSL A;  4EJU A;  3PIO F;  1DQU A;  2JMW A;  1H0M A;  5TIS C;  2ISZ A;  3RI4 A;  2JRT A;  4P9U A;  2E2J J;  3K2A A;  1ZH5 A;  4I0A A;  2A68 F;  3MN2 A;  4PJL A;  4FX4 A;  4CYC B;  3IL2 A;  2E7X A;  1VQP I;  4GFB A;  3HTS B;  3G6E I;  1P4A A;  2COM A;  2OQG A;  1XMX A;  2EIJ H;  3CCE I;  2DK8 A;  1IRG A;  4HLX A;  1NH3 A;  3VYS B;  2B7E A;  4ENN A;  1ZGW A;  1D0Z A;  1W0U A;  2CUE A;  2YX4 A;  2HQN A;  5JHU A;  1Q1H A;  2M7A A;  2Y31 A;  4HZF A;  4MQV A;  3OYM A;  1FLI A;  1GT0 C;  3RTR A;  4IKF A;  2XKO A;  2ZSI B;  2LBF A;  3WTT C;  1K79 A;  1S5L C;  3GWZ A;  2VT2 A;  2W48 A;  5HDK A;  1JUP A;  5F0C A;  2DMP A;  2VQG A;  5B1B H;  5F1J A;  5GAH J;  3TOA A;  1UST A;  2CS3 A;  4KN7 X;  5E20 A;  3GME A;  4FAS D;  3S1M J;  1UHM A;  2EFN A;  2EBI A;  2XB0 X;  5B3S H;  4PCQ A;  1CF7 A;  4EJO A;  2V1N A;  1PP8 F;  1X1C A;  1X3Z B;  4S0H B;  1JJ6 C;  3RKW A;  1S8N A;  2KP6 A;  1OYW A;  5LLQ A;  5CVJ A;  2OF7 A;  4N9H A;  3QP6 A;  3DU6 A;  3IKV A;  4I01 A;  3JRB A;  2HQ5 A;  2Y75 A;  3FHN A;  2VQL A;  2XAH A;  3OYD A;  1GUU A;  3BPX A;  1I6H J;  2EIK H;  1J75 A;  4B48 A;  3GTO J;  2LKS A;  2XPU A;  4RGR A;  3L2C A;  2H6C A;  1MSF C;  3IAS 2;  1ZN2 A;  1X58 A;  5KCM A;  3I53 A;  1QZY A;  3WU2 C;  2L7Z A;  3P9K A;  3M8F A;  3D5R C;  4LIU A;  3SZG A;  1L3L A;  2ZBK A;  1R00 A;  2PN6 A;  1VQO I;  1GXQ A;  1JGG A;  4BKX A;  2Z1D A;  3O8H A;  2Q1Z B;  1N78 A;  1HF0 A;  4IPA A;  2JPB A;  2H8R A;  3HOW J;  4U7B A;  3TBI A;  3EYY A;  1OJL A;  1ERD A;  3LNQ A;  4G7H F;  1U8R A;  2QQB A;  4HX8 A;  1OCO H;  3GTP J;  1JTY A;  4AVZ A;  4LB5 A;  3HBL A;  3QYE A;  2QLZ A;  1Q1V A;  3HSF A;  2DOD A;  1CGP A;  4IHX A;  1BR4 A;  3ABL H;  1LFU P;  2DPU A;  2EFO A;  2V9P A;  4RMN A;  3FXK A;  5L3G A;  1AOY A;  1D1B A;  1FMW A;  2QA4 I;  3LSG A;  2DA7 A;  1KGS A;  3JW4 A;  2A3S A;  2LNB A;  4PFP A;  2B63 J;  3MFK A;  4OIR F;  1S7O A;  2FJ1 A;  4XQF A;  3H9G A;  3GTJ J;  1PP7 U;  2YPR A;  4ZYH A;  2CV2 A;  2VKE A;  5CVI A;  3CMY A;  1RIO H;  4I2O A;  4GCV A;  1SMT A;  1A36 A;  4P55 A;  5L3D A;  1IDY A;  4J01 A;  2IA1 A;  1W7P B;  2AXT C;  4MQ9 F;  1OYY A;  4MO7 A;  3WU0 A;  3K4L A;  5E8I A;  2FMY A;  1MNM C;  3HRM A;  1HOM A;  3WGG A;  3WOD F;  3BT9 A;  3A01 B;  2CW0 F;  5LHI A;  4OMY A;  2L9R A;  3L00 A;  2A6H F;  2XVC A;  1EA3 A;  3M3Y J;  2HGC A;  3DLA A;  3GZ6 A;  4EJW A;  1AA7 A;  1YOV B;  2ZB9 A;  4MNU A;  5E1Z B;  2V26 A;  3S3O A;  1YG2 A;  4IOC F;  2DA6 A;  3HRT A;  3F6V A;  4E7K A;  4HBL A;  2DMQ A;  3U2R A;  1W7P A;  2K02 A;  3IAM 2;  1PUE E;  3S16 J;  4A3D J;  1ZK8 A;  1G4D A;  1S6L A;  3VPR A;  1TL8 A;  1X3W B;  1GLN A;  2ZO4 A;  4XLE A;  1R5G A;  3H92 A;  5E8G A;  1U8B A;  3CJN A;  2YR2 A;  3HUG B;  5HS7 A;  3A01 A;  4L9N A;  1MBJ A;  3N4M A;  2X1C A;  3H5N A;  4LFU A;  2Z9O A;  2KIS A;  2ELH A;  2EK5 A;  2KIU A;  2M8E A;  1OCT C;  2XHK A;  2IGK A;  1EH8 A;  1XDS A;  4AUX A;  2R5Y B;  1F9N A;  3DCF A;  3I5U A;  4M3F A;  5GPC A;  2VN2 A;  2VUM J;  3C1D A;  4MIM A;  1RR7 A;  2QEN A;  4XRM A;  1FBQ A;  3AG4 H;  3F8C A;  4Y33 A;  2NOJ B;  3T1B A;  4CXF A;  1FBU A;  5M5W J;  3O8G A;  3A0H C;  1EH6 A;  2Q2E A;  3C2H A;  2CUF A;  4LG0 B;  4IXA A;  3K4J A;  4ZDO A;  2IJL A;  4E7S A;  1A35 A;  2H1K A;  3CCR I;  2FD5 A;  2ZSH B;  3DFG A;  3KP3 A;  3EET A;  3GO5 A;  4UHT A;  4A6E A;  1YTY A;  1A04 A;  4OU0 A;  3ROU A;  4XIC A;  1PJR A;  2B9S A;  3WE2 A;  2DQR A;  3FKJ A;  1ETK A;  1SEU A;  2DMN A;  5LGN A;  4XID A;  5IPA A;  1QNT A;  3K2Z A;  2ESN A;  3HOX J;  3V8L A;  3OWT A;  5GP9 A;  2JWT A;  4JYK A;  4P96 A;  4AC0 A;  1Y8R B;  4ZYG A;  3E1S A;  3F21 A;  3CCU I;  1Y1W J;  1QBJ A;  3DTK A;  2R5Z B;  3IWF A;  4WXC A;  3CME I;  1TBX A;  4L0Z B;  2JSC A;  3ONQ A;  4A69 C;  5KHD A;  1LE8 B;  2RDP A;  2PX9 A;  2C6Y A;  4PUS A;  3M9A A;  4IZZ A;  4C3H J;  4ITV A;  2GWR A;  2HDW A;  5FD6 A;  5H6R A;  3LSH A;  2ESH A;  3CLQ A;  5K5Q A;  2A61 A;  2K27 A;  1MGT A;  3LFU A;  3M1C A;  4A3K J;  2DA2 A;  2K9N A;  3P9I A;  3OMY A;  1R1U A;  1TT0 A;  2MG4 A;  2RN7 A;  2K86 A;  4RGU A;  2P0W A;  3HTU A;  1J0R A;  1TQM A;  4IJA A;  4LIV A;  4E7L A;  2JA6 J;  3GTL J;  1JI8 A;  1O4X A;  2V1U A;  3CMA I;  1V54 H;  1T2K A;  4KNY A;  2RGV A;  3DPU A;  4HNV A;  1YRN B;  2E1C A;  1EJ9 A;  1XPX A;  4NHJ A;  3HRS A;  4PSX A;  3RYP A;  2VPL A;  3HHG A;  3CUQ A;  5LD2 C;  4G8X A;  3EUH A;  1I1S A;  3HB9 A;  4UB8 C;  1IJW C;  1O57 A;  5IT3 A;  2D1H A;  3QYB A;  3DEU A;  4EMS A;  3REO A;  1O3T A;  1T38 A;  5K7Z A;  4YII A;  3C3W A;  2ZXI A;  4O3M A;  4F52 A;  1IRX A;  1WH5 A;  2ZCW A;  5TGT A;  3GW2 A;  4X0G A;  2PJR B;  2PQ8 A;  4YG2 F;  4IX7 A;  3HXL A;  4UVA A;  4DBQ A;  5FB2 A;  3A2K A;  4YEJ A;  1WJF A;  2W00 A;  1P4W A;  4B44 A;  2XGD A;  1ACI A;  2Y9Z A;  5HLI A;  2F5D A;  4I09 A;  1BR1 A;  3C2G A;  2LR8 A;  2X48 A;  4PZJ A;  5KK1 A;  3CCM I;  2TCT A;  1D0Y A;  3KFW X;  3CC4 I;  3JSP A;  3L2Q A;  4L9T A;  2NVQ J;  2DYR H;  4C30 A;  5ERI A;  2XF5 A;  3OYK A;  5ICG A;  2ID3 A;  5J8F A;  2QUF A;  3LA2 A;  1QO0 D;  2FA5 A;  2BY1 A;  1KU9 A;  2IW5 A;  3PQJ A;  4OIN F;  2VON A;  9ANT A;  3BR3 A;  1Z6T A;  5FLX K;  4LJZ F;  1FSE A;  1SAU A;  3GZN B;  1TW3 A;  1DGW Y;  4XLP F;  3OSG A;  1AU7 A;  1VQL I;  5HS8 A;  2MH9 A;  1Y39 A;  5L3F A;  2L4M A;  2K5C A;  2FBI A;  2GXG A;  4DOZ A;  5EG0 B;  3CCS I;  1TC3 C;  4UUS B;  4M3E A;  3CDL A;  4CHU A;  4KIT B;  2OTL I;  3HOV J;  1IN5 A;  2OZU A;  1HCR A;  2IS4 A;  2M5W A;  2O9L A;  2QKL B;  1H88 C;  2DT5 A;  3DTI A;  2LY2 A;  2ZME B;  1P6R A;  1X1D A;  4M6Y A;  3KIO A;  3HEF A;  3G73 A;  4U88 A;  3RPU D;  5EEH A;  3ZMD A;  4BJ6 C;  5FKN A;  1AWC A;  4BXU A;  2XAS A;  4D0P A;  1MND A;  5F64 A;  5EG0 A;  4KYW A;  1X19 A;  4UUS A;  3K69 A;  4G94 A;  1QQI A;  1T95 A;  4R79 A;  3PJR A;  3G4S I;  1V5E A;  6PAX A;  4RB3 C;  3S1N J;  1WCM J;  1WH7 A;  3DU5 A;  3J7Y J;  1JKP C;  4I98 B;  4B4C A;  3ZQI A;  2NXN B;  1B4A A;  1XS9 A;  1R71 A;  2M9H A;  5JFR A;  4DNC A;  1XDU A;  2I8D A;  3FXJ A;  3OR2 C;  5IT9 K;  2DA1 A;  2P6T A;  3BQZ A;  2JVG A;  1X1P A;  4M6X A;  4KIB A;  3BTC A;  3OOP A;  3QPL A;  2K9L A;  1U78 A;  2EJR A;  2IS2 A;  4BQA A;  2KIM A;  2ZXH A;  3PO2 J;  2KZG A;  3B6A A;  1TT5 B;  3RCO A;  3OS1 A;  1G2H A;  1GDT A;  5B66 C;  1TW2 A;  3QOD A;  3K4N A;  1QPM A;  5ICF A;  1G59 A;  4BE1 A;  2JZY A;  4Z6Y A;  1ZRC A;  4I0B A;  3S2H J;  4O5V A;  1E3O C;  1J59 A;  1REP C;  1YX3 A;  3HSE A;  2XF6 A;  3M8J A;  4B3X A;  2HPI A;  3GYH X;  2DFH A;  1X1A A;  2A6T A;  2FNP A;  4JQF A;  3LAP A;  4RDU A;  1MMG A;  5K5R A;  5FKL A;  1VZ0 A;  4AD9 A;  2Q8K A;  5HNF A;  3I4P A;  2GM4 A;  1OR7 C;  1BOA A;  2DFE A;  1R4N B;  1WVR A;  1XGN A;  4PSW A;  3CCJ I;  2WY7 Q;  2CG4 A;  3ZMS A;  2VPR A;  2MC3 A;  3BR1 A;  3X2Q H;  4E7I A;  4XLC A;  2ZKZ A;  3SFI A;  1FZP B;  4L0Y B;  4LK0 F;  1X1B A;  1P92 A;  2HZT A;  1LVK A;  5DCM A;  4XRF A;  2XIG A;  4D9J A;  2JPC A;  3J7A O;  2K4B A;  2RRE A;  3K7A J;  2XGE A;  4G12 A;  4BEH B;  4B8X A;  3FXQ A;  1IF1 A;  2V6C A;  3OL4 A;  1EV7 A;  1U6G A;  1Z91 A;  5E3O A;  2EB7 A;  5FKK A;  4V2F A;  1ETV A;  1MZB A;  4BXX J;  3BJA A;  1X4P A;  2QSF X;  3PNV A;  2CQN A;  3ZN0 A;  3ZXS A;  3ZQ7 A;  3JRI A;  2DI3 A;  3A03 A;  3R0J A;  3GCM A;  2R7W A;  3BDD A;  3GTQ J;  1JHF A;  2M1B A;  4YRV A;  2MLK A;  2HXO A;  3FWE A;  1FOX A;  4PK4 A;  3S14 J;  2KRC A;  1UFM A;  3SQN A;  1FMV A;  5L3E A;  2E1M B;  2L4A A;  2UV1 A;  1BOB A;  2NNN A;  1VI0 A;  4BAC A;  5AIP A;  2G7H A;  2K7L A;  2MFZ A;  2D5V A;  5K7H A;  2LG4 A;  4A3M J;  2VJI A;  4XKV A;  2OV7 A;  2RKH A;  5J4Y A;  1IN7 A;  1LUJ B;  5FLX Z;  1ZRD A;  1N25 A;  1FYM A;  1ETY A;  1JUM A;  3K1P A;  5JVT A;  1TQP A;  1V5G A;  3WTV C;  1O7L A;  4J00 A;  1ETX A;  4XNF A;  4AWX B;  3DQV C;  3LSJ A;  2OCC H;  1KA8 A;  5D8L B;  3M8E A;  5DUK A;  1V5F A;  3FZV A;  1SFE A;  3OIO A;  1DU6 A;  4KUM A;  2LY1 A;  2VC0 A;  2X6Y A;  3SDG A;  2Z5U A;  4ENM A;  4BXF A;  1BIA A;  2VXD A;  2M2E A;  5CPR B;  3QU3 A;  2XUB A;  4HA8 A;  4EJV A;  3IH4 A;  2M87 A;  1NG7 A;  4N0B A;  4O6J A;  2EH3 A;  3H35 A;  4WXH A;  5E3N A;  2RVC A;  4BHP A;  3FMQ A;  1SFO J;  1W1W E;  3ERM A;  3DKX A;  1MD0 A;  1OCC H;  2ME6 A;  1YHQ I;  2DJI A;  1OYI A;  5LGU A;  3GTM J;  2XSJ C;  2K9M A;  2QQA A;  1FTZ A;  4HDU A;  3FKI J;  5J4V A;  3V4G A;  3FIW A;  4A0Y A;  5EGO A;  1XTA A;  1Z3Y A;  4PGG A;  2H8W A;  5FLM J;  2LRD A;  1W5S A;  1S3J A;  2LP0 A;  3E6D A;  4EM2 A;  4F92 B;  2BZT A;  2VT3 A;  1EF4 A;  2CO5 A;  1TWG J;  3F8N A;  4ZDP A;  4NQW A;  2FBK A;  3A1Y A;  2EQR A;  3CCL I;  4RM2 A;  4V19 K;  3BZ6 A;  3H5R A;  5D5V B;  2CW8 A;  2Y30 A;  3HRU A;  1DU0 A;  4PJJ A;  3RIR A;  2NYX A;  1JUS A;  2DO7 A;  2CFX A;  3H36 A;  2STW A;  2E1M C;  5IT9 Z;  1H9T A;  1AKH A;  1OCR H;  3KEQ A;  5DD8 A;  1MBE A;  2IGO A;  1YE9 A;  4QIW N;  4JX5 A;  3MKY B;  5IOY A;  5EZH A;  2EWN A;  3Q9S A;  3LQR A;  4A3I J;  1SMY F;  2FML A;  1RKT A;  3OYE A;  1D1A A;  2R0Q C;  1ZLJ A;  1HA8 A;  2FX0 A;  2GZW A;  3R0A A;  5F0F A;  4Y15 A;  4XN3 A;  4LG3 A;  1WWX A;  1Y8Q B;  5ED4 A;  2NAZ A;  2CSO A;  3WTW C;  3HOY J;  1RPW A;  3I56 I;  2DT6 A;  2X6W A;  3KLO A;  1XSV A;  2ACJ A;  3LL7 A;  4Q47 A;  4BYY A;  1LKX A;  1BN5 A;  2H6B A;  4HNU A;  1YW9 A;  1HKQ A;  1FIP A;  2HKO A;  5LEJ A;  4GYG A;  1S7E A;  4XN0 A;  4B43 A;  1VQK I;  2W7N A;  2X6X A;  1UB9 A;  4EGZ A;  5GAD J;  1BL0 A;  2E19 A;  1LEB A;  3SFZ A;  5LGT A;  3J7A Y;  5EDN A;  2BVM A;  4KT6 A;  2CRG A;  3RKX A;  1WJE A;  1FP2 A;  3CLO A;  4GDF A;  1IXC A;  3HZJ A;  3SJM A;  3V8K A;  2LOO A;  2X6O A;  4DYQ A;  2HVR A;  4YIR X;  1H9G A;  1X2N A;  1JKO C;  1MW7 A;  2JA5 J;  3PQK A;  4RS8 A;  2ECC A;  4WF2 A;  3TOB A;  1WFX A;  4KFC A;  1DPU A;  4FE4 A;  3TO9 A;  1R22 A;  2LF7 A;  2LD5 A;  4D7N A;  4ON0 A;  1RI7 A;  3DPL C;  2K3P A;  2WV1 A;  3ASO H;  2FBH A;  1B9M A;  5HOD A;  5CYV A;  3D1N I;  1UG0 A;  3K1N A; 
#chains in the Genus database with same CATH homology
 1D8K A;  3GFM A;  5BPD A;  1YO5 C;  2QZ8 A;  5H20 A;  5L3C A;  1UHW A;  5LRR A;  2KRF A;  4LGW A;  4L5J A;  1KYW A;  1IN8 A;  2XKP A;  5HLG A;  2RV8 A;  1KQ8 A;  4BHB A;  4HLY A;  2ZXJ A;  4A0X A;  2L3D A;  4ESJ A;  1FSH A;  3KP5 A;  3D0S A;  2KJB A;  4ESB A;  4G6Q A;  1YQA A;  2VOP A;  2BV6 A;  3DF8 A;  2AXL A;  2V1D A;  3W6J B;  3WTS C;  1LVA A;  1YW7 A;  3BWG A;  1DPR A;  1GHC A;  3ERE D;  2EFQ A;  4OOI A;  4A6D A;  5D5U B;  1LNW A;  3SZP A;  3KP4 A;  4E70 A;  2CGP A;  1E17 A;  2J5O A;  3IRR A;  5H6Q A;  4DQ2 A;  2Z3Y A;  3HOT A;  3E97 A;  2PG4 A;  3IC7 A;  2HYF A;  2R7D A;  2XAQ A;  4WX9 A;  1ZG1 A;  5LRS A;  2Y48 A;  1R23 A;  3E3V A;  4JK1 X;  4ETS A;  3B02 A;  1Z1D A;  4KIC A;  3OV8 A;  3V7C A;  5HOO A;  2K4J A;  4EV0 A;  1U3E M;  3N97 A;  2DAO A;  3I0T A;  4QLC U;  2L54 A;  3WE3 A;  2J5P A;  2V1X A;  5E18 F;  2EA2 A;  1HXD A;  3QP5 A;  1ZG3 A;  3I71 A;  4KIF A;  5LHH A;  1R1V A;  4UVC A;  3U9G A;  4CZZ A;  4MTD A;  4LLN A;  2ETH A;  4CDG A;  1HSJ A;  3E5X A;  5K5O A;  1XD7 A;  4ZZL A;  3L09 A;  3HUG A;  3DPT A;  2L02 A;  2LKP A;  4IVN A;  1RUO A;  2O0Y A;  3T8T A;  2FRH A;  4EGY A;  1DDN A;  1I1G A;  2OAZ A;  2QWW A;  3R60 A;  1C0W A;  2PEX A;  4WCG A;  3R61 A;  1ZAO A;  5J6X A;  1YW8 A;  1TLH B;  1B59 A;  4LG0 A;  5E17 F;  1G3T A;  5ICC A;  2HTJ A;  3WGI A;  2D45 A;  2XAJ A;  2FEZ A;  4LLG F;  5D4R A;  2EFP A;  4UVB A;  2UXN A;  4LMY A;  2DQL A;  3WG9 A;  5HDN A;  3CDH A;  3BOQ A;  1E2X A;  3FXR A;  1YFH A;  1SFU A;  2QBY B;  5JR3 A;  2EV0 A;  5DCF A;  3WTU C;  5CVR A;  2PFB A;  1ZRF A;  4HYE A;  1HKS A;  1WKM A;  4ZH4 F;  2OU2 A;  5ILV A;  4P9F A;  2DLL A;  1F4K A;  3ULQ B;  3FXU A;  3T8R A;  3LFK A;  4IRI A;  1XMK A;  2YSR A;  4G6D A;  3CO6 C;  1R58 A;  2UZK A;  4XBF A;  3LWF A;  2HOE A;  2UXX A;  4MTE A;  4XLN F;  5KVR A;  4HQE A;  1XSD A;  1K6O A;  2HEO A;  4CGZ A;  3QU6 A;  4GO1 A;  2MLG A;  3W6K B;  2W24 A;  1J7K A;  3TGN A;  2O03 A;  1IN4 A;  1P2F A;  4LK1 F;  5CVV A;  4L18 B;  4UV9 A;  2F2E A;  4PDK A;  3MAJ A;  3ZPL A;  2HTS A;  3LST A;  1JE8 A;  4KN4 X;  1V3F A;  3RJP A;  3F8M A;  1JGS A;  4KIG A;  4ZYE A;  3F22 A;  3KP6 A;  1HW1 A;  1KYZ A;  4PGH A;  3ECH A;  1XN7 A;  3V7R A;  3FF5 A;  4HX4 A;  1GXP A;  2BBY A;  1JXS A;  4S04 A;  2ZME A;  1Z9C A;  5ILS A;  1OR7 A;  4CO8 A;  2HDC A;  5FGM A;  2BGC A;  4AIJ A;  1XMA A;  1ZGA A;  4UV8 A;  3VEP A;  3KET A;  2R3S A;  2UWM A;  4EVI A;  2W57 A;  4ZYD A;  2A6E F;  2ZNZ A;  3KLN A;  4BHC A;  1W4M A;  2IA0 A;  3TDU C;  3ECO A;  3I59 B;  4QWQ A;  4XSZ F;  1IAW A;  1WRJ A;  1ZRE A;  1TNT A;  4RGX A;  2WWY A;  1IZ1 A;  3L9F A;  5K1Y A;  4IHS A;  4KDP A;  1LEA A;  1DUX C;  2V79 A;  1HW5 A;  1WI9 A;  4UNO A;  2KIF A;  1BBY A;  3J81 Z;  4KT5 C;  3VB2 A;  3HYI A;  2DFI A;  1RNL A;  1WQ2 A;  2BE5 F;  3JSO A;  1U5T B;  5A2Q K;  3KCC A;  3S2W A;  3KP2 A;  2A07 F;  1I27 A;  1MKM A;  3AAF A;  1G6N A;  1HST A;  4BAY A;  3FHZ A;  4RB2 C;  1ZAR A;  4Q4Z F;  3TDZ C;  1HW2 A;  1LDJ A;  5FO5 A;  2GA2 A;  3H3U A;  3BJO A;  3DXJ F;  1K78 B;  2MA3 A;  1YLF A;  2G7U A;  3ZMZ A;  3F8F A;  2A69 F;  4OIP F;  2W85 A;  1XGO A;  4RAY A;  2VBY A;  3WGH A;  2P6S A;  3T5X A;  2FU4 A;  1K78 A;  1FBS A;  1OMI A;  2EFW A;  4ENK A;  3GF2 A;  1FNN A;  4U0W A;  3RKY A;  2VE8 A;  1O3Q A;  3JTH A;  3QPT A;  3MCZ A;  5DUI A;  2X0L A;  2RC4 A;  2ZJ2 A;  3MQ0 A;  2GXB A;  1MJB A;  1IUY A;  1J5Y A;  2R7F A;  4HV5 A;  1U5T C;  2M45 A;  2MBF A;  3ELK A;  1F5T A;  1Z05 A;  4U0V A;  2QVO A;  1SD5 A;  3QPH A;  4H0E A;  4UXN A;  2FSW A;  1BI1 A;  3E6C C;  2G9W A;  4CIC A;  5BOX A;  1S29 A;  3ZMU A;  4HF1 A;  3ISP A;  5D6E A;  4GYI A;  1IW7 F;  3KEO A;  2Z33 A;  2JTV A;  4B09 A;  1W5T A;  4UUV A;  1DP7 P;  4MEY F;  3BJ6 A;  5DDG A;  3IKT A;  2OA4 A;  4G7O F;  3VOD A;  5F1R A;  4A0Z A;  1MDM B;  3ABU A;  3J80 K;  5DYM A;  4HQM A;  4Z2Y A;  4N9I A;  2OQR A;  4WXD A;  1SD6 A;  4LD5 A;  3LAJ A;  1SAX A;  3K0L A;  4IF4 A;  3T0Y A;  4EQQ A;  1OPC A;  2VBW A;  4Y13 A;  4Y17 A;  5L3B A;  2FXA A;  5F6F A;  3F72 A;  4RGS A;  1RZ4 A;  2IVM A;  2HYG D;  5HDG A;  3TO7 A;  1G3Y A;  3U1D A;  1KQ9 A;  4L5I A;  2KKO A;  2D1V A;  4A12 A;  1D8J A;  4MGR A;  1QZZ A;  2FNA A;  1BM9 A;  4YIF A;  5A2Q Z;  1ZYR F;  4I02 A;  1IRF A;  5E1W A;  3E5Q A;  4YFK F;  3FM5 A;  4RB0 A;  2IA2 A;  2EV5 A;  3RPU A;  2BYV E;  4L9V A;  1WSU A;  4I7H A;  4EM1 A;  1R5H A;  3BY6 A;  3MWM A;  2XAF A;  2JT1 A;  3RPQ A;  3GZ5 A;  3MZY A;  5D8K B;  3HIF A;  1CF7 B;  2GAU A;  1JHH A;  4A2U A;  3WTY C;  2FQ3 A;  2WC2 A;  3CO7 C;  4YFN F;  2NS0 A;  4U0Y A;  2E1N A;  1G3W A;  1BC7 C;  3O6B B;  1LB2 A;  1V4R A;  2O6G E;  3EYI A;  4K2E A;  4AIK A;  1BJA A;  2DTR A;  2CWE A;  4F7Z A;  2DK5 A;  3IWZ A;  2BEO A;  2STT A;  1KU3 A;  3FMS A;  2XV4 S;  3GVA A;  1RUN A;  5BS6 A;  3CTA A;  4HDV A;  3P9C A;  3GLX A;  3C7J A;  1G3S A;  2WTE A;  5DV5 A;  3V7S A;  1B1B A;  2RQP A;  2QYO A;  2AS5 F;  2IPQ X;  1ZG5 A;  3GFJ A;  1XGS A;  2HQR A;  3SHF A;  3BPV A;  1KU7 A;  2MH2 A;  4LLL A;  2HR3 A;  2LSO A;  2QQ9 A;  3J80 Z;  1QGP A;  1ULY A;  1ONV A;  3NQO A;  5D5W B;  2O61 A;  2O3F A;  3M7G A;  1S7A A;  3E6M A;  5E1X A;  3MEX A;  2DU9 A;  2F5E A;  2WV0 A;  4TV7 A;  3SXY A;  4RAZ A;  1FY7 A;  2W84 A;  3QRF F;  5J8C A;  3GUD A;  4KMU X;  1GVJ A;  5BPI A;  2XRO A;  2RNJ A;  1KU2 A;  2HS5 A;  2F5F A;  3HHH A;  3RDI A;  3WTZ A;  3GFL A;  1SFX A;  3BRO A;  5CJ9 A;  3D5L A;  3TO6 A;  5CLS A;  4GXO A;  2OBP A;  5LHG A;  2P8T A;  4FT8 A;  4HW0 A;  2DPD A;  1R7J A;  2CQK A;  3JAM K;  1XB4 A;  3VOE A;  5JI6 A;  1FC3 A;  1FOK A;  3ZMT A;  5LBQ A;  1EH7 A;  2PI0 A;  3KE2 A;  3G3Z A;  4R8H A;  3NEU A;  3DKW A;  1D5V A;  5D5X B;  2VXZ A;  4HX7 A;  3VFZ A;  3I58 A;  4M9X A;  3J81 K;  2IP2 A;  2H09 A;  3EQL F;  3QAH A;  1OKR A;  4M9Z A;  4ESF A;  3CUQ B;  1ODD A;  4WWC A;  3F23 A;  5AIQ A;  1Y0U A;  2ADU A;  3HOS A;  1XGM A;  4U7D A;  2XGX A;  1FYK A;  4G9Y A;  2QBY A;  3F6O A;  4HV6 A;  2FF4 A;  3GEZ A;  3LA7 A;  2GQQ A;  1XCB A;  3DP7 A;  1YYV A;  2E7W A;  5EEG A;  2H94 A;  4M73 A;  1PDN C;  2CYY A;  3BP8 A;  3COA C;  2PBI A;  4Q5S F;  4L9J A;  5ILU A;  2DW4 A;  1SD7 A;  4Q48 A;  1T39 A;  2EV6 A;  2LF8 A;  4RB1 A;  2DBB A;  2P5V A;  2P7V B;  4IHT A;  3R6S A;  4M72 A;  3PFI A;  1U2W A;  2X4H A;  4MHG A;  2NRA C;  2IRF G;  4KA4 A;  5CVU A;  1USS A;  5HS9 A;  1BI2 A;  2GIV A;  1T6S A;  3JTG A;  5HLH A;  2YU3 A;  2PLY A;  1O7F A;  3I54 A;  1P4X A;  3CUQ C;  5D4S A;  3H3Z A;  5DD4 A;  5FFX A;  4KMF A;  1YS7 A;  2OD5 A;  3RYR A;  5BMZ A;  4S05 A;  4HOB A;  1F1Z A;  2Y0M A;  1TNS A;  3KZY A;  4G7Z F;  1VTN C;  2IT0 A;  4YFX F;  1K7A A;  2VOO A;  1LJ9 A;  1LDK B;  5TJJ A;  1Z7U A;  3JAM Z;  3ML6 A;  1O3R A;  2XRN A;  1T0F A;  3B73 A;  2FOK A;  5FD5 A;  1STZ A;  3L7W A;  2ISY A;  3FM3 A;  3LA3 A;  1I6X A;  1B9N A;  1D3Y A;  2Z99 A;  4A5N A;  1J9I A;  1ZHF A;  3F3X A;  2W25 A;  2NNY A;  2QM3 A;  2TDX A;  1Z6R A;  3GX4 X;  4ZZD A;  1FPQ A;  1XSX A;  1XCV A;  3I59 A;  2F5C A;  1FP1 D;  1TTY A;  4ASN A;  4EM0 B;  1X3U A;  3O2P E;  1MJA A;  4HF2 A;  5FFZ A;  1L0O C;  3P7N A;  1YS6 A;  3R4K A;  2VBX A;  5DCM B;  4IRH A;  2L01 A;  3DV8 A;  1SD4 A;  2YX7 A;  1HBX G;  2A5Y B;  4WK8 F;  4HAM A;  3ZMV A;  1HKT A;  3TKY A;  2B0L A;  1IXS B;  3Q5F A;  1UCR A;  1IN6 A;  1U5T A;  2LDU A;  5HVQ C;  1KQ0 A;  2P7C B;  1NHA A;  5AON A;  4A5M A;  4MEX F;  2D2W A;  2V9V A;  3KP7 A;  2VC1 A;  5ICE A;  5LEK A;  3KZZ A;  3MZH A;  1FT9 A;  2ZNY A;  1R1T A;  2VBZ A;  3GXO A;  2ZFW A;  3ZP5 A;  3WU1 B;  3EDP A;  1ON2 A;  1W7P D;  2KJC A;  3O3K A;  2HKX A;  3K1M A;  4IRG A;  2P5K A;  1O3S A;  1J2X A;  2M30 A;  5TRD A;  4P5O A;  4BH9 A;  3E6B A;  3V8J A;  4NB5 A;  3K9T A;  4FHT A;  4OMZ A;  1ZGJ A;  4JBA A;  5DEQ A;  2VE9 A;  3SZT A;  4OIQ F;  2PJP A;  1MJ9 A;  2FE3 A;  4CYD A;  1FYL A;  3E5U A;  3TQN A;  3HSR A;  3GFI A;  4BNC A;  1BC8 C;  1LDD A;  3ABT A;  4R1H A;  4AIH A;  4FX0 A;  4EJT A;  4M9S A;  2Q0O A;  3IHU A;  1BI0 A;  4M71 A;  3F8B A;  1ZLK A;  2O8X A;  2VOD A;  1ON1 A;  3M1E A;  4HF0 A;  3FX3 A;  3IRQ A;  1BIB A;  3C18 A;  4XSX F;  2H27 A;  4AVP A;  3I64 A;  2XAG A;  3Q9V A;  1I5Z A;  2OZ6 A;  4OIO F;  1MDM A;  1TQI A;  2P4W A;  4GGG A;  4M74 A;  3WTX C;  2HFH A;  1BI3 A;  2MD5 A;  2PMU A;  5BQT A;  1T98 A;  1B6A A;  3FMR A;  1HQC A;  5D6F A;  3LQQ A;  3QOP A;  1IXR C;  3CUO A;  1FX7 A;  2P5L C;  1YIO A;  3NRV A;  2HWV A;  1FWZ A;  4ENJ A;  2PMH A;  3ZN1 A;  4LB6 B;  1R36 A;  1LQ1 A;  2EA4 A;  2GA1 A;  4EJU A;  1H0M A;  2ISZ A;  3RI4 A;  2JRT A;  4P9U A;  1ZH5 A;  4I0A A;  2A68 F;  4FX4 A;  3IL2 A;  2E7X A;  3HTS B;  1P4A A;  2COM A;  2OQG A;  2DK8 A;  1IRG A;  4HLX A;  4ENN A;  2YX4 A;  2HQN A;  5JHU A;  1Q1H A;  4HZF A;  4MQV A;  1FLI A;  3RTR A;  2XKO A;  3WTT C;  1K79 A;  3GWZ A;  2VT2 A;  5HDK A;  3TOA A;  1UST A;  4KN7 X;  5E20 A;  1UHM A;  2EFN A;  4PCQ A;  1CF7 A;  4EJO A;  1PP8 F;  3RKW A;  1S8N A;  1OYW A;  5LLQ A;  5CVJ A;  4N9H A;  3QP6 A;  3IKV A;  4I01 A;  2Y75 A;  2XAH A;  3BPX A;  1J75 A;  4RGR A;  3L2C A;  2H6C A;  1ZN2 A;  3I53 A;  1QZY A;  3P9K A;  3M8F A;  1L3L A;  2ZBK A;  1R00 A;  2PN6 A;  1GXQ A;  4IPA A;  2JPB A;  4U7B A;  3EYY A;  4G7H F;  1U8R A;  2QQB A;  4HX8 A;  4LB5 A;  2QLZ A;  3HSF A;  1CGP A;  2DPU A;  2EFO A;  5L3G A;  1AOY A;  1KGS A;  3JW4 A;  2A3S A;  2LNB A;  3MFK A;  4OIR F;  1S7O A;  1PP7 U;  2YPR A;  4ZYH A;  5CVI A;  1RIO H;  4I2O A;  4GCV A;  1SMT A;  4P55 A;  5L3D A;  2IA1 A;  1W7P B;  4MQ9 F;  1OYY A;  3WU0 A;  5E8I A;  2FMY A;  3HRM A;  3WGG A;  3WOD F;  2CW0 F;  5LHI A;  4OMY A;  3L00 A;  2A6H F;  2XVC A;  2HGC A;  3GZ6 A;  4EJW A;  4MNU A;  5E1Z B;  1YG2 A;  3HRT A;  3F6V A;  4HBL A;  3U2R A;  1W7P A;  2K02 A;  1PUE E;  1G4D A;  1S6L A;  2ZO4 A;  1R5G A;  3H92 A;  5E8G A;  3CJN A;  2YR2 A;  5HS7 A;  3N4M A;  4L9N A;  4LFU A;  2Z9O A;  2ELH A;  2EK5 A;  2KIU A;  2M8E A;  2XHK A;  1EH8 A;  1XDS A;  1F9N A;  3I5U A;  2VN2 A;  3C1D A;  2QEN A;  1FBQ A;  3F8C A;  3T1B A;  4CXF A;  1FBU A;  1EH6 A;  2Q2E A;  4LG0 B;  4IXA A;  2IJL A;  3DFG A;  3KP3 A;  3EET A;  3GO5 A;  4UHT A;  4A6E A;  1YTY A;  1A04 A;  4OU0 A;  3ROU A;  3WE2 A;  2DQR A;  5LGN A;  1QNT A;  3K2Z A;  2ESN A;  3V8L A;  4P96 A;  4ZYG A;  3F21 A;  1QBJ A;  3IWF A;  4WXC A;  4L0Z B;  1TBX A;  2JSC A;  2RDP A;  2C6Y A;  3M9A A;  2GWR A;  5FD6 A;  5H6R A;  2ESH A;  5K5Q A;  2A61 A;  2K27 A;  1MGT A;  3P9I A;  1R1U A;  2RN7 A;  2K86 A;  4RGU A;  4IJA A;  3HTU A;  1J0R A;  1TQM A;  2V1U A;  1T2K A;  4KNY A;  2RGV A;  2E1C A;  4NHJ A;  3HRS A;  3RYP A;  3HHG A;  3CUQ A;  4G8X A;  3EUH A;  1I1S A;  1O57 A;  5IT3 A;  2D1H A;  3DEU A;  4EMS A;  3REO A;  1O3T A;  1T38 A;  4YII A;  3C3W A;  4O3M A;  2ZCW A;  3GW2 A;  2PQ8 A;  4YG2 F;  4UVA A;  5FB2 A;  1P4W A;  5HLI A;  2F5D A;  4I09 A;  4PZJ A;  5KK1 A;  3KFW X;  3JSP A;  4L9T A;  5ERI A;  5ICG A;  5J8F A;  2QUF A;  3LA2 A;  1QO0 D;  2FA5 A;  1KU9 A;  2IW5 A;  3PQJ A;  4OIN F;  2VON A;  5FLX K;  1Z6T A;  4LJZ F;  1FSE A;  1TW3 A;  4XLP F;  5HS8 A;  2MH9 A;  5L3F A;  2L4M A;  2FBI A;  2GXG A;  4CHU A;  1IN5 A;  2OZU A;  2M5W A;  2DT5 A;  2ZME B;  1P6R A;  4M6Y A;  3G73 A;  4U88 A;  5EEH A;  3ZMD A;  1AWC A;  4BXU A;  2XAS A;  4D0P A;  5F64 A;  4KYW A;  3K69 A;  4G94 A;  1QQI A;  4R79 A;  6PAX A;  4RB3 C;  4I98 B;  1B4A A;  5JFR A;  4DNC A;  1XDU A;  5IT9 K;  2P6T A;  4M6X A;  4KIB A;  3OOP A;  1U78 A;  2EJR A;  4BQA A;  2KIM A;  1TW2 A;  1QPM A;  5ICF A;  2JZY A;  1ZRC A;  4I0B A;  4O5V A;  1J59 A;  1REP C;  3GYH X;  3HSE A;  2FNP A;  4JQF A;  3LAP A;  5K5R A;  4AD9 A;  2Q8K A;  3I4P A;  1BOA A;  1XGN A;  2CG4 A;  3ZMS A;  2MC3 A;  2ZKZ A;  1FZP B;  4L0Y B;  4LK0 F;  1P92 A;  2HZT A;  5DCM A;  4XRF A;  2XIG A;  2JPC A;  3J7A O;  2K4B A;  4B8X A;  3FXQ A;  1IF1 A;  2V6C A;  1EV7 A;  1U6G A;  1Z91 A;  2EB7 A;  1MZB A;  3BJA A;  3ZN0 A;  3ZQ7 A;  2DI3 A;  3R0J A;  3BDD A;  1JHF A;  2M1B A;  2MLK A;  3FWE A;  1UFM A;  3SQN A;  5L3E A;  2L4A A;  2NNN A;  5AIP A;  2G7H A;  2K7L A;  2RKH A;  1IN7 A;  5FLX Z;  1ZRD A;  1FYM A;  3K1P A;  5JVT A;  1TQP A;  3WTV C;  1O7L A;  4AWX B;  3DQV C;  1KA8 A;  5D8L B;  3M8E A;  5DUK A;  3FZV A;  1SFE A;  4KUM A;  2VC0 A;  2Z5U A;  4ENM A;  1BIA A;  3QU3 A;  2XUB A;  4HA8 A;  4EJV A;  2M87 A;  4N0B A;  4O6J A;  4WXH A;  2RVC A;  4BHP A;  3FMQ A;  1MD0 A;  1OYI A;  5LGU A;  2QQA A;  4HDU A;  3V4G A;  4A0Y A;  4PGG A;  4EM2 A;  1W5S A;  1S3J A;  3E6D A;  2VT3 A;  2CO5 A;  3F8N A;  4NQW A;  2FBK A;  3BZ6 A;  5D5V B;  3HRU A;  3RIR A;  2NYX A;  2DO7 A;  2CFX A;  2STW A;  5IT9 Z;  1H9T A;  5DD8 A;  3KEQ A;  2EWN A;  3Q9S A;  3LQR A;  1SMY F;  2FML A;  1ZLJ A;  2GZW A;  3R0A A;  4Y15 A;  1WWX A;  5ED4 A;  2NAZ A;  2CSO A;  3WTW C;  3KLO A;  1XSV A;  2ACJ A;  4Q47 A;  4BYY A;  1BN5 A;  2H6B A;  1YW9 A;  1HKQ A;  2HKO A;  5LEJ A;  4GYG A;  1UB9 A;  4EGZ A;  1LEB A;  3SFZ A;  5LGT A;  3RKX A;  1FP2 A;  3CLO A;  1IXC A;  3V8K A;  1H9G A;  3PQK A;  4RS8 A;  3TOB A;  4WF2 A;  4KFC A;  1DPU A;  3TO9 A;  1R22 A;  2LF7 A;  4ON0 A;  1RI7 A;  3DPL C;  2FBH A;  1B9M A;  5CYV A;  3K1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...