1XMAA

Structure of a transcriptional regulator from clostridium thermocellum cth-833
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
101
Chain Sequence
b'SDVIRGYVDTIILSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETKRRTYYRITPEGIKYYKQKCEEWELTKKVINKFVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulator
publication title Structure of a transcriptional regulator from Clostridium thermocellum Cth-833
rcsb
source organism Clostridium thermocellum
molecule tags Transcription
total genus 35
structure length 101
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xmaA00
2XKOA 1UB9A 1IN6A 2DO7A 4ZYDA 3T5XA 1Z7UA 3HSEA 3ELKA 4A5NA 1HSTA 3OV8A 3B73A 1FWZA 5D8LB 4KIFA 2QYOA 4RGRA 3HRSA 3IC7A 3TO7A 3L9FA 1FNNA 3D5LA 4ESJA 2L54A 1XDSA 2IA0A 3EYYA 3F6VA 1CF7B 3V8LA 3F22A 1YQAA 1HW5A 4BHPA 5LLQA 3RJPA 3JTHA 1ONVA 3L09A 1C0WA 2K4BA 3R4KA 2FXAA 3QU6A 3GFIA 2ACJA 2CO5A 2VBZA 1BI2A 3RIRA 3VEPA 4HQEA 4M74A 4HAMA 2CQKA 2QM3A 1FPQA 5DCFA 3CDHA 2UXNA 2FEZA 1LQ1A 1GVJA 5CVVA 1NHAA 4IPAA 3FMRA 4UV8A 4A6DA 4L5IA 1P92A 3ZPLA 2P5LC 4RB1A 2IT0A 4I0AA 1Y0UA 1B9NA 4HOBA 2J5PA 3MQ0A 3C7JA 4KN7X 3ZP5A 5L3EA 1PP8F 3WU1B 4LK1F 4BQAA 4LLLA 1TW3A 2ADUA 3F3XA 3RTRA 3QU3A 5ILSA 2G7UA 3ZN1A 3IRRA 2D1VA 4P9FA 1S3JA 1MZBA 2FOKA 1R00A 2IA2A 4ENNA 3KEQA 1EH6A 3GLXA 3D0SA 3G73A 2R7DA 1IN8A 5DUIA 1L0OC 4ZYEA 5LRSA 2KJBA 4Y17A 1O3SA 5HS7A 4RB2C 4UNOA 5DD4A 3LAJA 4ON0A 3DQVC 3MZYA 1T38A 1GHCA 1IN4A 1QZYA 3I53A 4AIKA 1BC8C 4LFUA 3U2RA 2G9WA 4HV5A 1G3SA 1P4AA 2MBFA 2EWNA 5JHUA 2F5DA 2HFHA 1KA8A 3GEZA 2FF4A 1YO5C 3RKWA 4EJTA 4R79A 4YFXF 3KP5A 2OD5A 1VTNC 2XUBA 2GXBA 2Q8KA 1OYYA 5CVJA 1ZAOA 5IT9K 4QLCU 4LG0B 4FHTA 5CLSA 3EUHA 2DBBA 3K1NA 2CSOA 3N4MA 2HWVA 2P4WA 2GA1A 3BY6A 3ABTA 2KIFA 2K7LA 5D6FA 3CJNA 2YR2A 1XCVA 2UZKA 1OYIA 4Q48A 4N9IA 3E97A 1R22A 1ZG1A 2RDPA 2O6GE 5DCMA 1ON2A 2XIGA 5K5QA 4UHTA 1BC7C 4B09A 2LKPA 1U6GA 3J80K 2D1HA 2L4MA 1K78B 2OZ6A 4HLYA 1B4AA 2STWA 2KKOA 3LWFA 3KZZA 3F72A 2EK5A 3E3VA 3FXQA 2A6EF 3M1EA 3BWGA 2H09A 5IT3A 2ZNZA 1T0FA 3FXRA 2A5YB 3GWZA 2STTA 4HZFA 4KFCA 3CUOA 3AAFA 4IVNA 3WTXC 2ESHA 2DLLA 5FFXA 1K79A 2OBPA 1FOKA 1RIOH 1W7PA 2L02A 4CDGA 2DAOA 2XV4S 1D3YA 1EV7A 1ZH5A 2FBKA 1FZPB 4G7ZF 2QQ9A 4L9JA 1B59A 3V8JA 1I1GA 5ICEA 2P8TA 4AVPA 3VFZA 2MH2A 2YX7A 5D5WB 1LDKB 2MLGA 5L3DA 4CO8A 3V8KA 3J81Z 1HW2A 3JAMK 3DPLC 4K2EA 3IHUA 4IRHA 4UVCA 2HOEA 4IHTA 2R7FA 5L3FA 4G7OF 5LEJA 4I02A 3K0LA 5HDGA 4U0VA 4CZZA 2VONA 5EEGA 3FM3A 4LB5A 3DV8A 4EJUA 3EYIA 4UVAA 3CUQC 2MA3A 3RPQA 3COAC 3M8EA 2V6CA 1H9GA 2K27A 3HHHA 1YW8A 2WTEA 3DPTA 1HKQA 2LDUA 4P5OA 3T0YA 3WTSC 2Q0OA 2A68F 2PG4A 1J2XA 2IVMA 4EJVA 1TTYA 1U2WA 3WODF 1Z9CA 3ZMDA 1IUYA 1YS6A 2E1NA 2H94A 2HGCA 1XN7A 3L7WA 4G8XA 1IXSB 2H27A 3C3WA 2HYFA 1W5SA 2EFQA 5FD5A 3WTUC 1D8JA 2BE5F 1DPUA 1S7OA 5D4RA 5K1YA 1HW1A 4U0WA 5BMZA 4A0XA 3FZVA 4UVBA 2DU9A 1ZN2A 2O61A 2COMA 5CVRA 2PMUA 4P55A 2CGPA 1YIOA 5D5VB 2DQRA 2KIUA 1QNTA 4HYEA 4HF0A 4BYYA 4MNUA 1KQ9A 4IRIA 2QLZA 1ON1A 1MJ9A 4I0BA 4Z2YA 2PMHA 3L2CA 2ZMEB 3ZQ7A 1KGSA 3P9KA 4L9TA 4L9NA 3NEUA 3VB2A 5JI6A 3R0JA 4Y15A 1YW7A 1FP1D 1TLHB 3GFJA 2VT2A 4I01A 1QQIA 1W5TA 2PQ8A 3U9GA 5E1XA 1L3LA 1O3RA 2VXZA 3E6BA 2DT5A 4GXOA 3TO6A 4KMFA 3C1DA 4KIGA 5E8IA 3SZPA 5F1RA 1Z05A 2ELHA 2F5CA 1QGPA 4EM1A 2J5OA 3CUQB 1USTA 3Q9VA 1ZG5A 4XBFA 3E6MA 1TQIA 2RC4A 5AIQA 2F5FA 4G6DA 2AXLA 3QOPA 1SD5A 2XAHA 3NQOA 4NQWA 3MWMA 1XD7A 4UV9A 4OIQF 1E2XA 1MD0A 2XAGA 2EB7A 4XLNF 1R5GA 2PBIA 5BPIA 2O0YA 3K1PA 3OOPA 2WC2A 5FB2A 5FGMA 2W24A 1XSXA 3HSRA 4M71A 4GCVA 1SMTA 3QP5A 4IF4A 5LBQA 3FXUA 2V1UA 1O3QA 1QPMA 4MGRA 3ZMSA 5HLHA 2Z99A 5K5RA 4A2UA 2Z9OA 2L01A 3WG9A 1ZARA 2UWMA 3TO9A 2XAQA 3I71A 5EEHA 3IKTA 2DK8A 5D8KB 2W57A 4I98B 3GYHX 3RYRA 3GZ6A 1E17A 5E1WA 3I54A 3GF2A 4HF1A 4U7BA 3FF5A 4WK8F 4IRGA 4O3MA 5JVTA 4HLXA 4EGYA 4KT5C 1REPC 2IJLA 1QO0D 2CYYA 4KN4X 1KQ8A 3R0AA 2HKXA 2EV6A 2FMLA 3KP2A 2HZTA 3SZTA 3DKWA 3IWZA 4M9SA 3REOA 3GXOA 3WGGA 2NS0A 3CLOA 3SXYA 3TKYA 5E8GA 1A04A 1LEBA 3I0TA 1BIAA 2Z5UA 2VBYA 3DEUA 2KIMA 4M6YA 5ED4A 1J7KA 4RGXA 1IRGA 2D45A 3KFWX 5A2QZ 1Q1HA 2ZFWA 3ABUA 1R1UA 3F8CA 2QBYA 2XROA 2ZNYA 1LNWA 2ZJ2A 3F6OA 2FU4A 1V4RA 2FBHA 3HTSB 2RV8A 1KU3A 2RGVA 3PQJA 4XLPF 4LLNA 2IA1A 4I2OA 3BROA 1XSDA 2EFOA 3WTZA 3ML6A 2DFIA 3ECHA 2FMYA 2AS5F 4NB5A 2L3DA 2FSWA 1R1TA 3H3UA 2ESNA 2Q2EA 3CO6C 3R61A 1MDMA 1UHMA 3HTUA 1F1ZA 4AD9A 2Z33A 3JTGA 2HQRA 1LVAA 3IKVA 2FQ3A 4OIOF 2BEOA 4LD5A 3GZ5A 5D6EA 1S29A 3I4PA 3DFGA 1G3TA 3C18A 3FX3A 4ETSA 1D8KA 2GIVA 1R58A 1YYVA 3LA3A 1B1BA 4DQ2A 4I09A 3WTTC 1OPCA 1IRFA 1T39A 1S8NA 2V79A 4LLGF 3KEOA 2EA2A 4HW0A 3FMSA 5BOXA 2CG4A 4IJAA 3Q5FA 4WXCA 4ASNA 1R7JA 5J8FA 2VODA 2QVOA 4CHUA 1IN5A 1I27A 2FNPA 3VODA 3L00A 2LF7A 4NHJA 2XHKA 1W7PD 1Z6TA 1H0MA 1O7FA 1XDUA 1DDNA 1XB4A 1ZLKA 1SD4A 5DYMA 2P7VB 1YS7A 1R5HA 3HRTA 3TGNA 1WRJA 2GA2A 3EETA 2OZUA 1P6RA 1LB2A 3W6JB 3V7CA 4UUVA 4U88A 5ILVA 5FLXK 1AOYA 4WXDA 2ZCWA 2RKHA 5CJ9A 3M8FA 1IAWA 3CTAA 1MJBA 2MLKA 1SFUA 2EFWA 3ZMZA 2M87A 3HRUA 2M8EA 1FP2A 2FRHA 5TJJA 4BHBA 3DF8A 3N97A 5DCMB 4WXHA 3SQNA 3TOAA 4EM0B 2UXXA 2YX4A 4WX9A 3WU0A 1SD7A 1JE8A 2JSCA 3BDDA 2NNYA 1T2KA 3TDUC 3WGHA 2RNJA 1U5TA 4BNCA 2C6YA 2JT1A 1OKRA 3I59A 1DUXC 4U0YA 1Z91A 4ENKA 1HKTA 1RZ4A 2Y75A 4RGUA 1MJAA 3MAJA 2HTSA 1BI1A 2Y0MA 4ENJA 1O7LA 3TOBA 1OYWA 2ETHA 2ZBKA 2K86A 4LK0F 1XGMA 3GW2A 2CFXA 4BH9A 2RN7A 3KE2A 5AIPA 1BOAA 2CWEA 2P6SA 1W7PB 2RVCA 3GX4X 4IXAA 1UCRA 1FBUA 1JXSA 3BP8A 5LGTA 2EV0A 1FBSA 2P7CB 2VE8A 4U7DA 3BPXA 2ZMEA 2IRFG 3LA2A 4M72A 3I58A 1B9MA 3KP7A 2ISYA 1HBXG 4AIJA 4N9HA 2DPUA 2KJCA 4S04A 1XCBA 1ODDA 5J6XA 2G7HA 2BV6A 3M9AA 5IT9Z 1Z6RA 2H6BA 1I5ZA 3I5UA 1F4KA 3T8TA 2E7XA 1HSJA 5CVUA 3VOEA 3WTWC 2PI0A 1K7AA 4ZZLA 4M9ZA 1WKMA 2HKOA 1FYKA 4R1HA 4YG2F 4ENMA 5D4SA 2DPDA 1LEAA 1F5TA 4IHSA 4GO1A 2XAFA 3HIFA 1ZGJA 1JHHA 4HA8A 5H20A 2GWRA 2B0LA 1SFXA 5HLGA 2M5WA 3BPVA 4A0YA 3J80Z 2ISZA 1KQ0A 3TQNA 1TW2A 2GAUA 4LJZF 4PZJA 4WWCA 2M45A 3QPHA 1HQCA 3K9TA 3RKYA 3ZMUA 1G3YA 2QQBA 4M73A 4DNCA 3ROUA 3JW4A 4Q4ZF 1IZ1A 4H0EA 4S05A 1WSUA 4OINF 1KU2A 2YU3A 2JZYA 1P2FA 1FC3A 4JBAA 2NYXA 5ICFA 3KETA 1IXCA 3O3KA 2HEOA 4AWXB 2O3FA 1STZA 4AIHA 1SFEA 3V7SA 1KU9A 4HDUA 2QUFA 2MC3A 4GYIA 3RYPA 2YPRA 4HX7A 2CW0F 5ICGA 1CF7A 2BYVE 4MQ9F 1R23A 4Q5SF 1AWCA 2E7WA 2FE3A 4CXFA 1RI7A 5HS9A 4YIFA 4O5VA 4EVIA 4GYGA 4YFNF 4LB6B 1BJAA 4XSXF 3PFIA 2Y48A 2PFBA 4FT8A 3P9CA 3LA7A 2EA4A 3JAMZ 3ULQB 3HHGA 2X0LA 2VOPA 1FY7A 4CYDA 4P96A 1LJ9A 3V4GA 1JHFA 4L5JA 2A07F 5ICCA 4ESBA 3E5UA 4I7HA 2XASA 3Q9SA 5DUKA 3HUGA 2A3SA 3BJ6A 2VC0A 3LQRA 4OU0A 4MEYF 1WWXA 3V7RA 4TV7A 2JRTA 2V1DA 1FT9A 3BZ6A 3GVAA 3LQQA 4F7ZA 2F5EA 3FM5A 2OQRA 4MTEA 4EMSA 4YFKF 3RI4A 4ESFA 2VT3A 1TNTA 1KYZA 1RUOA 5HOOA 1BBYA 2XAJA 3RDIA 5LHHA 1UHWA 5L3CA 3JSOA 5TRDA 2ZXJA 1J5YA 4FX4A 1YTYA 1EH8A 2QZ8A 2FNAA 1KU7A 4B8XA 4HBLA 4EQQA 6PAXA 4D0PA 5E18F 3E6DA 4ZYGA 2HYGD 2EFPA 5HS8A 5KVRA 4Q47A 1LDDA 4KDPA 3FHZA 3HOTA 1FYMA 1FBQA 5LHIA 3EDPA 5L3GA 3BJAA 2E1CA 1ZGAA 4GGGA 1WQ2A 3ERED 5HDNA 3WTVC 3QP6A 1CGPA 2DTRA 2GQQA 4ZZDA 1G4DA 3G3ZA 2HS5A 3HYIA 1PUEE 1QZZA 3KLOA 2LF8A 3PQKA 1Z1DA 3KLNA 4XSZF 3J81K 4BHCA 4PGGA 4CGZA 1PDNC 3K1MA 4JK1X 4LG0A 2VOOA 1O3TA 3IWFA 5LEKA 4HQMA 4KICA 2GZWA 4WCGA 4L0YB 2DK5A 5AONA 1USSA 4OOIA 1TQPA 2FA5A 5JFRA 1P4WA 3S2WA 4G94A 2XGXA 2JTVA 1SD6A 3LFKA 4G7HF 2NNNA 5FD6A 2OA4A 1KYWA 4L9VA 2PJPA 3HOSA 3GUDA 3DXJF 1ULYA 4UXNA 4A12A 4KUMA 4QWQA 1YFHA 1YLFA 1K78A 1W4MA 5E20A 3FWEA 2TDXA 3K69A 2RQPA 4YIIA 2NRAC 2DQLA 2EJRA 4HF2A 4O6JA 1BI0A 2XVCA 2K4JA 1ZRCA 5CVIA 2QBYB 2FBIA 3QPTA 1XMKA 5LGUA 4RB0A 1K6OA 1RUNA 4L0ZB 3U1DA 2M1BA 2HQNA 1J9IA 2VN2A 3MCZA 3NRVA 1YG2A 5JR3A 2O8XA 4P9UA 5BPDA 3O6BB 5FO5A 1LDJA 1T98A 1SAXA 2P6TA 2IP2A 2PEXA 1XGSA 3ECOA 2W25A 1MDMB 3I64A 4MQVA 4EJOA 2DW4A 1G3WA 4L18B 3B02A 4A6EA 1U5TC 3R6SA 3F8FA 1MGTA 2M30A 3WE2A 1O57A 1OR7A 2IPQX 2BBYA 2ZO4A 3ISPA 1IN7A 2HTJA 1ZHFA 1XGOA 3T1BA 2EV5A 4R8HA 3LAPA 1J75A 2OAZA 3FMQA 2V1XA 4HV6A 1SMYF 1UFMA 4EM2A 5LGNA 4Y13A 4OMZA 1ZREA 1J0RA 1IW7F 5HVQC 2VC1A 1TNSA 1ZRDA 1R36A 5E1ZB 1XGNA 1T6SA 2JPBA 2P5VA 5DD8A 1X3UA 4WF2A 4KNYA 5ILUA 3E5XA 4ZH4F 2PN6A 3ZN0A 3KZYA 2QQAA 1PP7U 2VBXA 2A69F 2QENA 1BM9A 5HDKA 1QBJA 5BQTA 2XRNA 3F23A 4LMYA 1FX7A 4M9XA 1B6AA 1V3FA 2QWWA 1BI3A 1FSHA 3W6KB 4KMUX 1TQMA 4EV0A 1OMIA 3KCCA 4JQFA 4OIRF 4M6XA 1H9TA 1HKSA 2W85A 3BJOA 2A61A 4FX0A 3T8RA 1TBXA 3E5QA 4MEXF 4RAYA 4G6QA 5ERIA 1BIBA 3CO7C 1G6NA 3P9IA 1I6XA 2XKPA 4PDKA 2R3SA 1GXPA 4RS8A 1MKMA 2YSRA 5D5XB 4BXUA 5H6QA 3GFMA 3HRMA 2ZKZA 2W84A 4XRFA 4E70A 2O03A 3MZHA 4EGZA 3WE3A 1U3EM 3J7AO 2HDCA 2A6HF 4MHGA 4KYWA 3H3ZA 5H6RA 3QAHA 3O2PE 5HLIA 1ZG3A 5F6FA 2GXGA 3GO5A 4CICA 3BOQA 4HX8A 1U5TB 3MFKA 3ZMVA 3KP4A 3F8NA 5DV5A 2IW5A 5L3BA 2DI3A 3M7GA 3I59B 5CYVA 3JSPA 1ZLJA 4ZYHA 2Z3YA 3SHFA 2LSOA 2VE9A 2P5KA 5D5UB 5LRRA 3TDZC 1FLIA 1BN5A 2H6CA 5DDGA 3RKXA 3MEXA 2F2EA 1YW9A 1P4XA 3SFZA 2KRFA 1S7AA 1J59A 2LNBA 1EH7A 4G9YA 3CUQA 4RAZA 3P7NA 1D5VA 4PGHA 1S6LA 5F64A 5KK1A 4KIBA 4MTDA 2WV0A 5A2QK 1F9NA 1I1SA 2MH9A 5E17F 1U78A 2VBWA 3IL2A 3K2ZA 1DP7P 2OQGA 2X4HA 1JGSA 5LHGA 2K02A 2PLYA 4OMYA 3E6CC 3F21A 4PCQA 4KA4A 1WI9A 5DEQA 1FSEA 5FLXZ 4N0BA 5FFZA 4A5MA 4RB3C 2HR3A 3EQLF 3F8BA 4HDVA 2BGCA 3H92A 1ZRFA 2NAZA 1XMAA 3F8MA 1U8RA 3RPUA 3ZMTA 3KP6A 1XSVA 4EJWA 1IXRC 4OIPF 3R60A 2EFNA 4RGSA 5BS6A 2L4AA 4LGWA 2WWYA 3KP3A 3GFLA 4BAYA 3DP7A 1DPRA 2D2WA 3QRFF 1HXDA 3HSFA 3WTYC 3IRQA 2V9VA 4A0ZA 1R1VA 4HX4A 2OU2A 1IF1A 1GXQA 3WGIA 1ZYRF 2MD5A 1RNLA 2JPCA 5J8CA 1FYLA 5K5OA 3LSTA
chains in the Genus database with same CATH superfamily
2XKOA 4PJLA 1UB9A 1IN6A 2DO7A 4ZYDA 3T5XA 1IJWC 1AA7A 2JVHA 4BL0B 1Z7UA 4F3QA 3HSEA 2AO9A 3ELKA 4A5NA 1HSTA 2VPRA 3OV8A 5M5YJ 3OYGA 3FBIB 1UAAA 3ZQQA 3B73A 2FD5A 1FWZA 5D8LB 5EDNA 3LSGA 2QYOA 4KIFA 4IHYA 4RGRA 3HRSA 3BC8A 2LY1A 3IC7A 4U87A 3TO7A 3HBLA 3L9FA 1FNNA 1XX5A 3D5LA 3OYCA 2PJRA 1MH4A 2CMPA 4ESJA 1F43A 1X3ZB 2JSPA 2L54A 1XDSA 2IA0A 3EYYA 3F6VA 1CF7B 3V8LA 2R5YA 3HOUJ 1IV8A 1GVDA 1APLC 3F22A 1JKRC 1YQAA 2WADA 1YJ9I 1HW5A 4BHPA 3AG2H 4ZC3A 5LLQA 1MW7A 3RJPA 4NDLA 3DKYA 4Y4RA 3JTHA 1ONVA 2QSHX 4XLFA 3L09A 1C0WA 5FKOA 2LLKA 2LR8A 2K4BA 1YE9A 1D5YA 4II3A 3R4KA 2FXAA 3QU6A 3ZRGA 3GFIA 2ACJA 2CO5A 2VLAA 3GMEA 2VBZA 1BI2A 3RIRA 3VEPA 4HQEA 4M74A 1WJCA 5EJCA 4HAMA 2CQKA 2QM3A 4BXXJ 1FPQA 5DCFA 1OCOH 2KPMA 3H9JA 3CDHA 4W1UA 2UXNA 3FISA 2FEZA 1LQ1A 1GVJA 1KZHA 3L2RA 5CVVA 1NHAA 4CCLA 4IPAA 3FMRA 3LSPA 4UV8A 3HUGB 4A6DA 4L5IA 3OS2A 1P92A 3ZPLA 4IKFA 1WJDA 2P5LC 4RB1A 1UHSA 1VQ8I 5FKKA 2IT0A 5J1UA 2B63J 4I0AA 1Y0UA 1B9NA 3GTMJ 4HOBA 2J5PA 1Z0XA 3MQ0A 3C7JA 4KN7X 3ZP5A 1SANA 5CKTA 1YRNB 5L3EA 1PP8F 3WU1B 5FRMA 4LK1F 4BQAA 4J00A 4LLLA 1RPWA 3BR0A 1TW3A 2ADUA 1H8AC 2F48A 3F3XA 3RTRA 1FOXA 2VJ4A 3H36A 3QU3A 4C3IJ 3HXLA 5ILSA 3LOCA 2G7UA 1Y6IA 3W2WA 3ZN1A 5DM7F 2RQQA 2LC2A 3IRRA 2D1VA 1ZELA 4BDZA 4P9FA 2CJJA 3GTQJ 2CQ7A 1S3JA 2KISA 3PNVA 1MZBA 2FOKA 5TISC 1R00A 2IA2A 4ENNA 3KEQA 2B7EA 2DFFA 3CD6I 1JUMA 1VQ6I 5F04A 1EH6A 3GLXA 3D0SA 3G73A 2IEKA 3DEWA 3RZOJ 5DTDA 2EQRA 2R7DA 1IN8A 5DUIA 1L0OC 4DYQA 4ZYEA 5LRSA 3EUKL 3BQZA 1X1PA 3B6AA 1N78A 3ZQIA 1IO2A 2KJBA 4Y17A 2WB1N 1O3SA 5HS7A 4RB2C 4UNOA 2LYCA 2LMDA 5DD4A 3LAJA 4ON0A 1RRJA 3DQVC 4HSRA 3MZYA 4G6TB 3LSHA 2CRGA 1T56A 4YRVA 1T38A 1GHCA 1IN4A 4NNJA 2JA8J 4LIVA 1OFCX 1QZYA 3I53A 4MIMA 2BY1A 4AIKA 2KL4A 2DDAA 4KITB 1BC8C 1F36A 2DMQA 4LFUA 3U2RA 3PO3J 2G9WA 4HV5A 2BVMA 1G3SA 4KJZA 1T8IA 2XF6A 1G2HA 1P4AA 2MBFA 4E7LA 4XNFA 2EWNA 5JHUA 5M5WJ 1VI0A 2F5DA 2HFHA 1KA8A 1WH5A 2FUG2 1H88C 1R9TJ 2E5NA 3GEZA 3U1KA 4B1RA 2FF4A 4PJNA 1YO5C 3QOEA 3RKWA 4EJTA 4R79A 4G12A 3GTOJ 4YFXF 3A1YA 3GTGJ 3KP5A 2OD5A 3BTIA 1MMNA 2PMZN 1VTNC 4ZDLA 4QIWN 2XUBA 2GXBA 4A69C 1VQ9I 2LBFA 2Q8KA 5TGTA 1OYYA 5CVJA 4ZTFA 3HZJA 2E1OA 1ZAOA 3HEFA 4QLCU 3SJMA 5IT9K 4IOAF 4M3GA 1RESA 5F08A 3RSNA 2HQ5A 5C44J 4LG0B 4FHTA 3A2KA 4B3AA 5CLSA 1BOBA 2XGDA 3EUHA 2DBBA 3O8HA 2L2OA 1MBKA 3K1NA 2CSOA 3OSGA 4HPQA 3PO2J 2CQQA 2LH9A 3N4MA 3Q0VA 2HWVA 2P4WA 2R5ZA 2GA1A 3QPLA 2YS9A 2OC6A 4XM3A 3BY6A 2NS8A 1FTTA 3ABTA 2KIFA 2K7LA 5D6FA 3CJNA 4FASD 2YR2A 1XCVA 1U0JA 5EZGA 2UZKA 1OYIA 4Q48A 4N9IA 1VQNI 3E97A 1R22A 2K3PA 3BCAA 1ZG1A 2RDPA 2O6GE 2KQRA 2JWTA 5DCMA 1ON2A 3H9GA 4HSTA 2XIGA 2Y31A 1ZKGA 1OCRH 5K5QA 5J4YA 1WCMJ 4UHTA 1BC7C 4B09A 2LKPA 1U6GA 3J80K 2D1HA 4Y52J 2B9SA 2L4MA 1K78B 2OV7A 4YELA 2OZ6A 2DODA 4HLYA 1B4AA 2STWA 2KKOA 1FEXA 2X9DA 5M3FJ 3OYBA 3BCBA 1TWAJ 3CJRB 3D5SC 3LWFA 1EKEA 3HJEA 3KZZA 2M9HA 3CCRI 1Z21A 3F72A 2EK5A 2L9SA 3E3VA 3FXQA 4A3EJ 3OYAA 2A6EF 2H8RA 4M3DA 3BG9A 3M1EA 3S3OA 3PFYA 1FIPA 4XKCA 4UUSA 3K4NA 1AU7A 3BWGA 3E7LA 2H09A 5IT3A 2ZNZA 5CQGA 1T0FA 3A0BC 1ITYA 3FXRA 2E71A 3CCYA 2A5YB 3GWZA 3KZIC 2STTA 4HZFA 3DCFA 4KFCA 1I6HJ 2DDBA 3CUOA 2WAEA 5IY5H 3ABLH 3I56I 3AAFA 4IVNA 2X1CA 5IP7J 2IS4A 1S7EA 3WTXC 2ESHA 2EZLA 2DLLA 5FFXA 1K79A 2OBPA 3CDIA 1MNMC 2PMZA 2ZMEC 1LKXA 1FOKA 1BL0A 4CSWA 2UUZA 5IYBJ 1RIOH 3ASNH 1VZ0A 1LUJB 1W7PA 5IP6A 2L02A 2QKMB 4CDGA 2DAOA 1HC8A 5J4VA 2XV4S 2M7AA 1D3YA 1EV7A 1ZH5A 2FBKA 1FZPB 4G7ZF 2QQ9A 4L9JA 1B59A 4XLAA 3V8JA 1D1BA 1I1GA 5ICEA 1HF0A 2DMPA 2P8TA 1LPQA 4AVPA 2GLOA 3VFZA 2MH2A 2YX7A 3CCLI 5D5WB 1LDKB 3AFHA 3GTJJ 2MLGA 1ERDA 4M3BA 1JT6A 4CCOA 4DIQA 5L3DA 2Y69H 2KIQA 3X2QH 4CO8A 3NWSA 3V8KA 3J81Z 3DEEA 2X51A 2DMTA 1HW2A 2CQNA 1QPIA 2VQCA 3JAMK 2L7KA 2R4GA 3DPLC 4K2EA 3IHUA 4IRHA 2CW8A 2HOEA 4UVCA 4IHTA 3ZQFA 3JR9A 2R7FA 5L3FA 4G7OF 4XRMA 2L7MP 3WU2C 4XL9A 3ERMA 5LEJA 4I02A 3K0LA 5HDGA 4U0VA 2A5WA 4CZZA 3S1MJ 1JJ8C 4E4HA 2VONA 3A0HC 5EEGA 3FM3A 3VYUB 4BBSJ 3L2WA 4LB5A 3LSKA 3C2BA 3DV8A 4EJUA 1SVOA 3MZ8A 3OMYA 1WI3A 1BJZA 2HXIA 3EYIA 4UVAA 3CUQC 2KFDA 4HRIA 2MA3A 3RPQA 3K4MA 3COAC 3M8EA 2MABA 2V6CA 3ZQHA 5IPAA 3GBGA 4V2GA 1H9GA 2Z1DA 1VNDA 2K27A 3HHHA 1YW8A 2W00A 2XF5A 3VYTB 2WTEA 2QGUA 2HU9A 3DPTA 1HKQA 2R7OA 2LDUA 4P5OA 3T0YA 3WTSC 2Q0OA 3LL7A 2A68F 2WY7Q 2PG4A 1Y0NA 2LOOA 1J2XA 1MH3A 2IVMA 4EJVA 1TTYA 1X58A 2HDWA 1U2WA 1SVMA 2KLOA 2L5QA 3WODF 3MKLA 1Z9CA 3ZMDA 3IAM2 1IUYA 1YS6A 1X1BA 3JRHA 1IDZA 4X0GA 2E1NA 2H94A 2HGCA 2HPIA 1X4OA 3BG5A 2M4GA 1XN7A 1MNEA 1ZTRA 2V6EA 3L7WA 2HOTA 4G8XA 1YI2I 2ID3A 1IXSB 2R7QA 2E2JJ 2H27A 3Q0WA 3C3WA 3K2AA 5FLMJ 1QA6A 2HYFA 3SDGA 1W5SA 2EFQA 3C2GA 5FD5A 3WTUC 5E3LA 1D8JA 2BE5F 1DPUA 1S7OA 5D4RA 1T95A 5K1YA 4XICA 4CYCA 1HW1A 4U0WA 5BMZA 2JJ7A 4A0XA 3S16J 3FZVA 4UVBA 3JRBA 3JRIA 2DU9A 1SVLA 1ZN2A 2O61A 2COMA 2DA2A 5CVRA 2KDZA 2PMUA 2CU7A 4P55A 4QPQA 2CGPA 1Y8QB 3WHCA 1YIOA 1U9NA 5D5VB 3DTKA 3GZNB 9ANTA 2DQRA 2KIUA 2DA1A 4JYKA 3W3CA 1QNTA 4HYEA 4HF0A 4BYYA 4MNUA 4J01A 1KQ9A 4IRIA 2QLZA 1YJWI 2XC7A 2DCEA 1ON1A 2ZXHA 3BLYA 1MJ9A 1MBFA 4I0BA 4EATA 4HG2A 3ZQGA 4Z2YA 4AU7A 2BW3B 2PMHA 4BJ5C 2JK3A 4RM3A 4RA2A 3L2CA 1YX5A 2ZMEB 3KPHA 1JJ6C 3RPUD 2IAIA 3FIWA 3C2HA 2DJIA 3OYMA 2HVRA 1AKHA 1MSFC 4LIUA 4XN3A 3ZQ7A 1KGSA 3DU6A 3P9KA 3H3VK 3BR2A 3HOWJ 2IS6A 4L9TA 4L9NA 3B6CA 4JX4A 3NEUA 2XSDC 4JX6A 3N05A 2ME6A 3VB2A 5JI6A 2BY0A 3R0JA 2WAQN 2V7FA 2BHZA 1X1AA 1YW7A 3BTCA 1FP1D 4Y15A 1TLHB 3QYFA 2JA5J 1HDPA 1JTYA 3OYIA 2COBA 1WFXA 2FX0A 2IBDA 2K9MA 2VT2A 3GFJA 4I01A 3FDYA 1IRXA 4DJAA 2OTLI 1QQIA 1VQKI 3FKJA 3W2VA 1W5TA 4NC8A 2PQ8A 3MKZA 4PFPA 1SC7A 3K4CA 3U9GA 3G6EI 1OCTC 2JA7J 5E1XA 1L3LA 1JKQC 2O8KA 1O3RA 1B72B 3BG3A 3HPGA 1IRZA 3K4BA 4ANJA 2VXZA 2I10A 3E6BA 2BXZA 2DT5A 2NVUB 4GXOA 1OLTA 3TO6A 4KMFA 5IOZA 4DYRA 2LTPA 3C1DA 4KIGA 3G1MA 1OISA 1U9OA 1Y1VJ 3K6GA 5E8IA 1UG2A 3SZPA 2N8GA 5F1RA 1Z05A 2ELHA 3SZGA 2EH3A 3J7AY 2F5CA 1QGPA 3BZKA 1HLVA 4EM1A 2VQHA 1DP3A 4Y33A 2J5OA 3CUQB 4ITVA 3G4SI 2HVSA 2HPMA 2VPLA 1USTA 3Q9VA 2LG4A 4C3HJ 1ZG5A 4XBFA 1UMQA 3E6MA 5J40A 1TQIA 4GRIA 1MIJA 2RC4A 5AIQA 2F5FA 2Y0SN 2AXLA 4G6DA 2ZSIB 3QOPA 1SD5A 2L9VA 2XAHA 3NQOA 4NQWA 2DXIA 5JLXA 2HOSA 3MWMA 3PSIA 1XD7A 4UV9A 2F4IA 1E2XA 4OIQF 1MD0A 1G8XA 4OAZA 2XAGA 1N75A 2EB7A 4XLNF 3VDXA 1R5GA 4DGWB 2PBIA 5EG0B 2VL8A 5BPIA 3VWBA 3S3MA 2O0YA 2JRMA 3K1PA 3OOPA 1E3OC 3QYBA 3AG3H 3JRGA 1X1CA 2DOEA 4XLHA 3ASOH 2WC2A 4F92B 3RKQA 3OYJA 1WJAA 2HQAA 3D5RC 5FB2A 3PUFA 2W24A 1XSXA 5FGMA 3HOVJ 3HSRA 4DZPA 4M71A 3ABKH 1D1AA 5GAEJ 2LVSA 2MSYA 3S93A 3ZR8X 4GCVA 2WAQA 1SMTA 3QP5A 3DBLB 2LK2A 4FE7A 4IF4A 5LBQA 3FXUA 3TL4X 4E7JA 1YRNA 1BA5A 2V1UA 1FMWA 1TC3C 5GPAA 1O3QA 1QPMA 2BHYA 4MGRA 3ZMSA 2LY9A 1LE8B 5HLHA 2Z99A 5K5RA 3DTIA 4ABZA 2OCCH 1W5CC 4QPOA 4A2UA 1W36C 2Z9OA 2L01A 3WG9A 1V55H 1UG0A 1ZARA 3DBHB 1W0TA 1P7JA 4HEA2 3TO9A 2D5VA 2UWMA 2XAQA 3I71A 5LFAA 5EEHA 5HLTA 3IKTA 2DK8A 1MBJA 2V4JC 2R7TA 5D8KB 2R7XA 2W57A 4M6VA 2KP6A 1EJ9A 2WA0A 3O8GA 4I98B 3VYSB 3M07A 3GYHX 2KT0A 1R49A 3RYRA 3GZ6A 1E17A 3A4CA 5E1WA 4DBRA 4UB6C 3AL0B 1JI8A 3I54A 2JMWA 3GF2A 1W36D 4HF1A 4U7BA 3FF5A 4WK8F 4IRGA 3MD2A 4O3MA 3IH4A 4LITA 5JVTA 4HLXA 4EGYA 4KT5C 1RKWA 4X6AJ 1REPC 2FOWA 2IJLA 1QO0D 1JGGA 2CYYA 4KN4X 2Y0SA 3KYCB 1KQ8A 3R0AA 2GM4A 2HKXA 3H1CA 3S15J 3JREA 4B48A 3GTLJ 2EV6A 2FMLA 3KP2A 2HZTA 3REOA 3DKWA 3IWZA 1Z3YA 4M9SA 4XLCA 3GXOA 3SZTA 3HKZA 4BUPA 3WGGA 4XR6A 2NS0A 3CLOA 4QSHA 1NG6A 3SXYA 3ZOBA 2BY3A 1TL8A 3ZQLA 3OOUA 3TKYA 3CP2A 5GAGJ 4IO9F 2LD5A 1X4PA 5JLWA 3L2QA 1YITI 5E8GA 2EZKA 2ZXWH 4CCKA 1K83J 1A04A 1LEBA 3I0TA 2PJRB 1BIAA 2Z5UA 2VBYA 3DEUA 1S9HA 2KIMA 3IV5A 4CCMA 1VQ4I 4M6YA 3K7AJ 5ED4A 2IS1A 3E1SA 2ZB9A 1J7KA 2R5YB 3ONQA 4LOCA 3OYNA 2M34A 2HXOA 3BR5A 4RGXA 1IRGA 3CJQB 3EUHC 2D45A 3KFWX 5A2QZ 3S1NJ 1ORKA 2NOGA 1Q1HA 2ZFWA 3ABUA 1R1UA 2R7RA 3F8CA 4C2UA 1LVKA 1D1CA 2QBYA 2RREA 2VKEA 2XROA 2ECBA 2ZNYA 1LNWA 2E2IJ 2ZJ2A 4RMNA 1PUFA 3F6OA 2FU4A 3OYHA 1V4RA 1TWFJ 2W1OA 2FBHA 3HTSB 2VJIA 2ELKA 2RV8A 4D5FA 1KU3A 3GTPJ 2RGVA 2XGEA 3PQJA 4XLPF 4LLNA 3MVPA 2IA1A 4I2OA 3BROA 3BT9A 1XSDA 2NXNB 2EFOA 3WTZA 2QSFX 3ML6A 2DFIA 4E7HA 3ECHA 2ELJA 2FMYA 2AS5F 4NB5A 3RQIA 2L3DA 2FSWA 1S72I 1ETXA 1R1TA 2R7UA 1MMGA 3H3UA 2IS2A 2ESNA 2Q2EA 3WHBA 5C4JJ 3CO6C 3FHNA 3R61A 4BE0A 1MDMA 1OR7C 1UHMA 5K7ZA 4AYBN 3HTUA 1F1ZA 4AD9A 3F9KA 3LSMA 5C3EJ 2Z33A 1IC8A 3G1OA 3JTGA 1K4TA 2HQRA 1WHUA 1LVAA 2I8DA 3IKVA 3FK7A 2FQ3A 3PNYA 3H0DA 4NUBA 4OIOF 2BEOA 2DT7B 3K10A 4LD5A 1R71A 4UY8I 3GZ5A 1TP4A 5D6EA 1T0FC 1S29A 1ETOA 4XMYA 3I4PA 3DFGA 2M7BA 3QYEA 1G3TA 2DA5A 1RC9A 2BY2A 1WPKA 4FISA 3IP4B 2K9LA 3C18A 4B3XA 3QODA 3FX3A 1RR8C 2V9PA 4ETSA 1OCZH 1D8KA 2GIVA 1D0YA 1R58A 1YYVA 4OAYA 2LKSA 3LA3A 4RLQA 1B1BA 2ZJPF 3OR1C 4DQ2A 4I09A 3FXKA 2IGNA 1OPCA 3WTTC 4ZDPA 1IRFA 1U8BA 2A05A 1T39A 1S8NA 2V79A 4LLGF 4BACA 2Y2ZA 2R7ZJ 2P0WA 4X1EA 3KEOA 4BJ6C 2E36A 3CLQA 2EA2A 2KZGA 4HW0A 5GADJ 3FMSA 2DT6A 5FROA 5BOXA 2X48A 2CG4A 3G1LA 2M0MA 4IJAA 3Q5FA 4WXCA 3HGYA 3DKXA 2Y30A 4RM2A 2R92J 4ASNA 4F55A 2XGCA 1R7JA 5J8FA 3CCMI 2WB1A 2VODA 2QVOA 4PJMA 4CHUA 1IN5A 1I27A 2FNPA 5EZHA 3VODA 3L00A 2CQXA 3HOXJ 5FRNA 4FCYA 2LF7A 4NHJA 4AUXA 2ZJQF 2XHKA 1RR7A 1Z67A 1MBHA 4BQQA 3TP0A 1W7PD 4IHWA 1Z6TA 4W97A 1H0MA 1WVRA 2Q1ZB 2LREA 1O7FA 1XDUA 4M3FA 4IEJA 1I3AA 3OIPA 1XB4A 1DDNA 1ZLKA 1HDDC 1SD4A 5DYMA 2GOMA 2P7VB 1YS7A 1HA8A 5DS9A 1R5HA 3HRTA 4CCJA 2BVLA 1XC5A 2E34A 3TGNA 1WRJA 2GA2A 3IAS2 3EETA 1X3WB 2OZUA 1P6RA 1LB2A 2O9LA 3W6JB 3V7CA 4UUVA 3W2AA 2LBFB 3SFIA 4U88A 5ILVA 2V26A 2KRHA 4Y7NJ 5IYCJ 4V19K 2CH0A 5FLXK 3KYDB 4V2FA 1AOYA 4WXDA 1DGWY 2OJED 3LMMA 4A3IJ 2ZCWA 3BZCA 1P9QC 2RKHA 2CUEA 4UB8C 2MC4A 5CJ9A 2AXTC 3M8FA 2VI6A 3CTAA 1IAWA 1ACIA 3MKWB 1MJBA 1Q1VA 3L2VA 2MLKA 1VQLI 2QSGX 2R5ZB 3MMYB 1GDTA 2VJJA 2EFWA 1SFUA 4HNUA 2FQ4A 1JKOC 3KYLA 3OYDA 3ZMZA 4BE1A 3CCEI 4D9JA 2M87A 3HRUA 5J1RA 2M8EA 3FXOA 1FP2A 2FRHA 3AG4H 4AC0A 2F4OB 1VF9A 5TJJA 3M4OJ 3CDLA 4BHBA 2HZDA 3DF8A 1HOMA 3N97A 5DCMB 5E3NA 3A01A 2WBMA 3NAUA 4WXHA 3SQNA 3OY9A 3TOAA 5B1AH 4EM0B 3S8PA 4M3EA 3JRAA 2UXXA 2YX4A 5KNLA 4WX9A 3WU0A 5B1BH 2W7NA 3CMEI 1SD7A 3RQ4A 2VKVA 2E5ZA 4MO7A 4PJJA 1JE8A 2OTJI 2JSCA 1N77A 1V5GA 3BDDA 4E6KG 3MKYB 2NNYA 3TDUC 3WGHA 1T2KA 2RNJA 1U5TA 3K70D 4BNCA 3CF2A 2C6YA 1Z77A 2JT1A 2WY8Q 3LSRA 3I4NJ 1Y39A 2TCTA 1OKRA 2QF7A 3I59A 1DUXC 4U0YA 1NK2P 1Z91A 4ENKA 1HKTA 3FXJA 1RZ4A 2Y75A 4RGUA 1MJAA 4BY7J 1MBEA 5GTHC 3MAJA 4A3DJ 2DA6A 2HTSA 1BI1A 2Y0MA 4ENJA 4BEHA 1O7LA 3H5AA 3TOBA 1OYWA 2DYSH 2ETHA 1D0XA 2ZBKA 2K86A 3I4MJ 4LK0F 2X1DA 3ZCOA 1MNDA 1XGMA 3GW2A 2CFXA 5F0FA 2DA3A 4BH9A 1XS9A 2RN7A 3KE2A 5AIPA 1BOAA 3PIOF 4CZCA 3CC7I 4A93J 2CWEA 3CQZJ 2P6SA 3G2BA 3JCUC 1W7PB 4A3LJ 2RVCA 3GX4X 1G59A 4FETA 4IXAA 1UCRA 5IYDJ 1FBUA 1JXSA 3BP8A 5LGTA 2EV0A 2NVQJ 1FBSA 2P7CB 1NG7A 2VE8A 4U7DA 1ETVA 3TMOA 3OR2C 3BPXA 2ZMEA 1T08B 3LA2A 2ZC2A 4D5CA 5J47A 2IRFG 2QCOA 4A3GJ 2R7SA 4M72A 1T33A 3I58A 1B8IA 3IUOA 1B9MA 1YIJI 5HNHA 3KP7A 3OS1A 2ISYA 5J3LA 1SFKA 4JX5A 4AIDA 1WGXA 1HBXG 2HVQA 4AIJA 5C4XJ 3JRCA 5F0CA 1DU0A 3CJTB 4DZJA 2LFBA 4N9HA 4BS9A 3BR6A 2DPUA 2KJCA 4S04A 1XCBA 1ODDA 4CH7A 5J6XA 4ZTJA 2G7HA 2BV6A 3M9AA 1H89C 4BQOA 5IT9Z 1Z6RA 2H6BA 1I5ZA 3I5UA 4J19A 2W82A 1F4KA 2V9KA 3T8TA 5HODA 2E7XA 1HSJA 3PNTA 5CVUA 5FKLA 3VOEA 3WTWC 4F91B 2PI0A 1K7AA 4ZZLA 2W4SA 2Y9YA 4M9ZA 2GOXB 2OF7A 1WKMA 2HKOA 3RCOA 1FYKA 2ZFUA 3LFUA 4R1HA 4YG2F 4ENMA 5D4SA 2DPDA 3SDBA 1LEAA 1S5LC 2ZXIA 1F5TA 4IHSA 4BGDA 3TBIA 4GO1A 1TZLA 1JKPC 2XAFA 3HIFA 1ZGJA 2MFZA 1JHHA 2LKXA 4HA8A 5H20A 2GWRA 1Y56A 2O5RA 2B0LA 1SFXA 5HLGA 2M5WA 1Y1WJ 3BPVA 1YHQI 3AL0C 1I3QJ 4A0YA 3J80Z 3Q3SA 2ISZA 1KQ0A 3TQNA 1ETWA 1TW2A 2GAUA 1QHGA 4LJZF 1OQYA 4PZJA 4C2TA 3OWTA 2EBIA 3J7YJ 2X6WA 5IP9J 4WWCA 3CCSI 2YU9J 3I9V2 2M45A 3QPHA 1MMAA 3K4JA 3HOZJ 1HQCA 1SAUA 4DYCA 3K9TA 2DA7A 2EZHA 3H0GJ 3U21A 3DTEA 4A3MJ 5KCMA 2VXDA 3RKYA 1GLNA 2M8GX 1G3YA 3ZMUA 2QQBA 4M73A 4DNCA 5EGOA 3ROUA 3JW4A 2O7OA 4Q4ZF 2DN0A 2GIZA 3FKIJ 4A3JJ 1IZ1A 4H0EA 4S05A 1WSUA 2W48A 4OINF 1KU2A 2YU3A 2JZYA 2AHQA 2KHMA 1P2FA 2VASA 1FC3A 4JBAA 1O4XA 3QQAA 2NYXA 1SEUA 3G71I 5ICFA 4CYCB 3KETA 1IXCA 2QKLB 1X2MA 3O3KA 3OL3A 1BR4A 2HEOA 1A36A 2TRTA 2O3FA 4AWXB 5IOYA 3ZGKA 1STZA 1PJRA 1SFEA 2NS7A 3V7SA 4AIHA 4BBRJ 1KU9A 5H2FC 2OPTA 4XK4A 1NTCA 4HDUA 2QUFA 1M1EB 2MC3A 3K4KA 4GYIA 3RYPA 1XMXA 2YPRA 1R6RA 4HX7A 2CW0F 4DW6A 3I3LA 5ICGA 1CF7A 3PUBA 2BYVE 1VQPI 1I50J 4MQ9F 2E19A 1R23A 4Q5SF 1AWCA 2E7WA 2FE3A 2DA4A 2AQEA 4CXFA 1UJ8A 1RI7A 2R7VA 5HS9A 4IX7A 4YIFA 4O5VA 2V1NA 2H1LA 1D0ZA 4EVIA 1K6YA 3Q0UA 1AHDP 1WZ2A 4GYGA 5E3MA 4YFNF 4LB6B 1BJAA 1POGA 4DBQA 4XSXF 1TWHJ 3PFIA 4PSXA 2X6XA 1Z3XA 4MFEA 2Y48A 1AKHB 3PSFA 5CPRB 5F27A 3TW7A 2PFBA 3M1CA 3MN2A 4FT8A 3P9CA 3LA7A 3J7ZI 2EA4A 2L9NA 3JAMZ 3ULQB 3HHGA 2X0LA 2VOPA 3JRDA 1FY7A 3ZXSA 1MMDA 4CYDA 1E0EA 2QA4I 4P96A 1LJ9A 3V4GA 1JHFA 4L5JA 1LFBA 2A07F 2KZVA 4ESBA 3E5UA 5ICCA 1GUUA 2ID6A 4I7HA 2XASA 3Q9SA 2DYRH 5DUKA 2MYSA 2NVXJ 3HUGA 2A3SA 1QVUA 2AQFA 3BJ6A 2VC0A 4XKVA 1TT5B 3LQRA 3PM1A 4XRSG 3HL2A 1PVEA 3GCMA 2BZTA 4OU0A 2UV1A 4XN0A 4MEYF 1WWXA 4I76A 3V7RA 4N4NB 4XLEA 4TV7A 2JRTA 5LD2C 2V1DA 4ZDOA 1FT9A 3BZ6A 3GVAA 4FE4A 2K3FA 4ZJZA 3UKGA 3LQQA 3S2HJ 4F7ZA 3KIOA 2F5EA 2DMUA 1W0UA 3FM5A 2OQRA 4MTEA 3OSFA 1QZEA 3CCQI 1IUFA 1J09A 4EMSA 3DU5A 4YFKF 4I6ZA 3RI4A 2G0EA 1NK3P 3S2DJ 5DM6F 4ESFA 2VT3A 1TNTA 4S0HB 4KT6A 1KYZA 1RUOA 5HOOA 3BTLA 1BBYA 5GP9A 2XAJA 3RDIA 4EEFG 5LHHA 3VPRA 2X85A 4NQWB 4P1WA 1UHWA 5L3CA 3JSOA 4AM3A 3A02A 4MLOA 1YX3A 5TRDA 4IL6C 2ZXJA 1J5YA 4FX4A 1YTYA 1EH8A 4C2MJ 2QZ8A 3QWLA 2FNAA 1KU7A 4B8XA 4HBLA 4EQQA 3NARA 6PAXA 4D0PA 4QTRA 2L9RA 5E18F 1R5ID 3V42A 3E6DA 4ZYGA 3QPSA 2HYGD 2EFPA 5HS8A 5KVRA 3H35A 4E7SA 4Q47A 1LDDA 4KDPA 3LSJA 3FHZA 3HOTA 3OYKA 1TWCJ 1DGRM 1WJFA 1FYMA 1FBQA 5LHIA 3EDPA 1X1DA 1NH3A 1FJLA 5L3GA 3BJAA 2E1CA 1ZGAA 3CF5F 4GGGA 1WQ2A 3ERED 5HDNA 3CESA 1WH7A 4UUTA 3WTVC 3QP6A 4FQGA 4PFOA 1CGPA 2DTRA 2GQQA 3TW6A 3BQYA 4ZZDA 1G4DA 2ECCA 2PX9A 3G3ZA 2HS5A 2X6OA 3HYIA 1A35A 4H4KC 1PUEE 1QZZA 3OIOA 3KLOA 2LF8A 3PQKA 1Z1DA 3KLNA 4XSZF 1FTZA 3J81K 4BHCA 1TT0A 5EF6A 4BDYA 1QU3A 4YIRX 4PGGA 2M2EA 4CGZA 1GV2A 1PDNC 3K1MA 4JK1X 3S32A 4LG0A 2VOOA 3DBRB 1XTAA 1O3TA 3IWFA 3LSIA 5LEKA 4HQMA 4KICA 2GZWA 1IV6A 4WCGA 4B47A 4L0YB 3UR3C 2LP0A 2DK5A 5AONA 3CC2I 4HNTA 2XAUA 2CW7A 1USSA 1HCRA 4OOIA 1JTXA 1TQPA 1YOVB 2K9SA 3S17J 3DWLE 2FA5A 3NWTA 3FBNB 5HNFA 5JFRA 1P4WA 3VYRB 3S2WA 4G94A 2XGXA 4LG3A 4ZYAA 2X1EA 2JTVA 1SD6A 3LFKA 4G7HF 3GTKJ 2DFEA 4PUSA 2NNNA 3HDDA 4I99C 5FD6A 4E7ZA 5J1YA 2OA4A 1X2NA 1KYWA 4L9VA 1VQ5I 2PJPA 1ETYA 3HOSA 2JQ7A 1WJBA 1LFPA 5B3SH 1VQ7I 3GUDA 3K4LA 3DXJF 1ULYA 4UXNA 1OCPA 5GTIC 4A12A 4KUMA 4QWQA 1YFHA 4BXFA 1YLFA 1V5FA 1K78A 1W4MA 1Y8RB 1OJLA 2XPVA 3FWEA 5E20A 1BR2A 2DMNA 1IG7A 3WG7H 2TDXA 3K69A 3ZQCA 2R7WA 2RQPA 4JP0A 2CUZA 2L7ZA 4YIIA 1ENHA 2NRAC 4NBQA 2XPUA 2DQLA 1KONA 3DPUA 3CMMA 2DJNA 2EJRA 2VUMJ 4HF2A 1E3PA 2EPFA 2KMUA 4O6JA 1BI0A 4NC6A 2EIJH 1VQMI 2K5CA 2XVCA 2K4JA 2ME0A 5CVIA 1ZRCA 4D7NA 2QBYB 2FBIA 3QPTA 1XMKA 5LGUA 2X6YA 4RB0A 2NVYJ 4AVZA 1K6OA 5FKNA 1RUNA 2HYJA 4L0ZB 1MSEC 3U1DA 1PUFB 4BJTA 1EA3A 2M1BA 2HQNA 4XONA 1J9IA 2VN2A 3BG6A 2HOAA 3MCZA 2EZIA 2QEXI 3NRVA 2M3AA 1YG2A 3BG7A 5JR3A 3W6VA 3OS0A 4FTHA 2O8XA 4P9UA 5BPDA 3O6BB 1PYVA 4HNVA 2CUFA 5FO5A 1A6IA 2IGMA 2VKHA 1LDJA 1T98A 1ZQ3P 4PJ0C 4BY1J 4PSWA 2P6TA 1SAXA 2JUCA 2IP2A 2KRCA 1QVTA 2PEXA 3TP3A 4A3KJ 2Q2EB 1E3HA 3HC7A 5F0HA 1BW6A 4B43A 3FXLA 1XGSA 3ECOA 2W25A 1MDMB 3D1NI 1R4MB 3I64A 4MQVA 4EJOA 1G3WA 2DW4A 3PIPF 4L18B 3B02A 4XORA 1U5TC 4A6EA 3LNQA 3R6SA 2I5UA 4RLFA 4BU2A 4XIDA 3F8FA 1MGTA 2M30A 3HG9A 1RETA 2E35A 3WE2A 1O57A 1OR7A 2IPQX 2BBYA 4AYBA 2ZO4A 4C30A 1WJEA 3ISPA 1IN7A 2HTJA 4IHVA 1ZHFA 1XGOA 3T1BA 3OL4A 2EV5A 4R8HA 3LAPA 1J75A 2OAZA 3CZ6A 3FMQA 2ZJRF 1JUPA 2V1XA 4HV6A 3CCUI 3EUAA 1SMYF 1UFMA 4EM2A 5LGNA 3OYLA 4Y13A 4OMZA 5KAIC 1ZREA 2Z16A 1J0RA 1IW7F 2JA6J 4IZZA 5HVQC 2VC1A 1TNSA 1ZRDA 1R36A 2VIXA 5E1ZB 1XGNA 1T6SA 4XRSA 2JPBA 1BW5A 2P5VA 5DD8A 1X3UA 2ZSHB 3FK6A 3CC4I 4A3CJ 4B44A 3K70C 5GAHJ 1EF4A 3CCVI 4WF2A 1FOWA 4KNYA 5ILUA 3E5XA 4BQNA 3L1PA 4Y3OA 2XPWA 5KHDA 4ZH4F 3E0JB 2PN6A 3ZN0A 4OWRB 4II2A 3KZYA 4A3BJ 2CFOA 2QQAA 1PP7U 3UNGC 2VBXA 2A69F 3S14J 2QENA 1BM9A 2JA2A 4RBOA 2JN6A 3SYTA 3OYFA 3S1RJ 2K9NA 3HM5A 5HDKA 4A3FJ 1QBJA 2IXSA 3H9QA 5BQTA 2XRNA 5K7HA 4L5EA 3F23A 3AKZA 4LMYA 1FX7A 5JVGF 4M9XA 5B5EC 1V5EA 1B6AA 2GBYA 1V3FA 2QWWA 1BI3A 2CV0A 1FSHA 1UELB 4UUSB 3KX2A 3W6KB 1FIAA 2ICWG 2DFHA 2K85A 5FJ8J 4KMUX 2DOFA 1TQMA 5KAFC 2EIKH 4EV0A 1OMIA 2XRLA 3KCCA 2RNGA 4JQFA 4OIRF 2MD0A 3I55I 3VSLA 4M6XA 5B66C 4BE2A 2VJ5A 1H9TA 4B4CA 1HKSA 2W85A 3BJOA 3S3NA 4KISA 4CCNA 2A61A 2L0KA 4FX0A 3T8RA 2MG4A 1YJNI 2LY2A 1TBXA 2MGQA 1IGNA 2XB5A 3E5QA 2JUGA 4MEXF 4XOPA 2BXYA 4RAYA 4G6QA 5ERIA 1BIBA 3CO7C 5F1JA 1G6NA 3P9IA 5JHFA 2P81A 1I6XA 1N25A 4YEJA 1FMVA 2XKPA 4PDKA 1CQTA 1MMSA 3JRFA 2R3SA 4MFDA 4IQ4A 3VSKA 1MBGA 1GXPA 1QRYA 2BW3A 4RS8A 1A31A 1MKMA 2YSRA 4RAFA 5D5XB 5H6QA 4BXUA 5M3MJ 3GFMA 1V54H 1VFCA 3HRMA 4XKBA 3OYEA 2EILH 2ZKZA 3M3YJ 2W84A 1A6QA 4XRFA 4Z6YA 4E70A 2O03A 1ETQA 3MZHA 4EGZA 2E1MC 3WE3A 1U3EM 3J7AO 2HDCA 2OUMA 3HPHA 2A6HF 4MHGA 3A01B 2F4MB 2R93J 4KYWA 3H3ZA 5H6RA 4D7MA 3QAHA 4E7KA 3HGGA 2VQGA 3O2PE 2M4KA 2XB0X 2NOJB 1R4NB 2RAEA 2LRDA 5HLIA 1ZG3A 5F6FA 2GXGA 3GO5A 4CICA 2IGKA 5EEAA 2Z2SB 3BOQA 4HX8A 1U5TB 3MFKA 3BR1A 1ETKA 3H5NA 3KEYA 3DLLF 3ZMVA 3KP4A 1W1WE 3F8NA 5DV5A 2IW5A 5L3BA 1UZCA 2NVTJ 2DI3A 3M7GA 2E2HJ 4GDFA 2CV2A 3I59B 2CS3A 1XG1A 5CYVA 3JSPA 1K4SA 1ZLJA 4ZYHA 2Z3YA 3SHFA 1Z7LA 1K61A 2LSOA 2VE9A 4JOMA 2P5KA 5D5UB 1B72A 5LRRA 5GPCA 3TDZC 1QHHD 1P7IA 1FLIA 2WV1A 1BN5A 2H6CA 3FXMA 4BEHB 1JUSA 5DDGA 3RKXA 3MEXA 2F2EA 2JVGA 2HDDA 1YW9A 3ABMH 3AG1H 5M5XJ 1P4XA 2QQ8A 3EPZA 2CUJA 3SFZA 3HOYJ 4IQJA 1DQUA 2KRFA 1S7AA 1J59A 4IHXA 2LNBA 1EH7A 2L7FP 4G9YA 3H5RA 3CUQA 2DTZA 3CMYA 4RAZA 3BR3A 3P7NA 4C9YA 3F0CA 1D5VA 3IH3A 4PGHA 2VB6A 1JT0A 2BOLA 2F5VA 2HNHA 1WJ5A 1ZR4A 3M8JA 1S6LA 5F64A 5KK1A 4KIBA 4MTDA 1IDYA 2WV0A 5A2QK 1F9NA 1I1SA 2MH9A 3DLAA 1GT0C 1B8IB 5E17F 3S1QJ 1U78A 3ESWB 5E79C 4E7IA 2VBWA 3SEZA 1DU6A 2FJ1A 3IL2A 3K2ZA 4DOZA 1DP7P 2OQGA 2XF7A 4XOTA 5K7FA 1X19A 2X4HA 1JGSA 1ZGWA 4RAGA 5LHGA 5EG0A 2K02A 2PLYA 4OMYA 4N4OB 2K9QA 3E6CC 3F21A 4PCQA 1LFUP 4KA4A 1WI9A 5DEQA 2A6TA 2IGOA 1FSEA 5FLXZ 2VQLA 1GV5A 3CMAI 2CV1A 4N0BA 5EYRA 3PL8A 5FFZA 4A5MA 4RB3C 4C3JJ 2HR3A 3EQLF 4CUGA 3F8BA 3PJRA 4NC7A 2M0CA 4CA0A 2DOAA 4HDVA 1I39A 2K40A 5BNGA 4F93B 3TEDA 2BGCA 5E3OA 1A5JA 3H92A 1RKTA 1ZRFA 2NAZA 1XMAA 2OCEA 2F6CA 3F8MA 1U8RA 3BTJA 5CQEA 3RPUA 2EINH 4PK4A 3ZMTA 1LE8A 4RDUA 1FOYA 1TWGJ 2EIMH 3KP6A 1XSVA 3L2UA 4EJWA 2H1KA 5FKMA 1IXRC 4OIPF 3R60A 2EFNA 2HI3A 4RGSA 2H8WA 2XSJC 1XPXA 4XKWA 2WAFA 5BS6A 2L4AA 4LGWA 2KDOA 2MW8A 2WWYA 4D1QA 3KP3A 3GFLA 4BAYA 3DP7A 1ZR2A 1DPRA 2XDVA 3SEQA 3P5JA 2R0QC 2D2WA 3OIQA 3QRFF 1SFOJ 1HXDA 4BKXA 2E60A 3HSFA 1BR1A 2Y9ZA 1OCCH 3WTYC 3IH2A 3IRQA 3RZDJ 5FLVA 2V9VA 3A03A 4A0ZA 1R1VA 4HX4A 2OU2A 2VKDA 1IF1A 2E1MB 1GXQA 1ZK8A 3HKZN 3WGIA 3CCJI 1VQOI 4IOCF 3GLLA 2YUSA 1ZYRF 4F52A 5EGOB 2MD5A 2GXAA 1RNLA 2JPCA 5J8CA 1FYLA 4GFBA 4XQFA 5K5OA 3CP8A 3HB9A 3LSTA
chains in the Genus database with same CATH topology
2XKOA 1UB9A 1IN6A 2DO7A 4ZYDA 3T5XA 1Z7UA 3HSEA 3ELKA 4A5NA 1HSTA 3OV8A 3B73A 1FWZA 5D8LB 4KIFA 2QYOA 4RGRA 3HRSA 3IC7A 3TO7A 3L9FA 1FNNA 3D5LA 4ESJA 2L54A 1XDSA 2IA0A 3EYYA 3F6VA 1CF7B 3V8LA 3F22A 1YQAA 1HW5A 4BHPA 5LLQA 3RJPA 3JTHA 1ONVA 3L09A 1C0WA 2K4BA 3R4KA 2FXAA 3QU6A 3GFIA 2ACJA 2CO5A 2VBZA 1BI2A 3RIRA 3VEPA 4HQEA 4M74A 4HAMA 2CQKA 2QM3A 1FPQA 5DCFA 3CDHA 2UXNA 2FEZA 1LQ1A 1GVJA 5CVVA 1NHAA 4IPAA 3FMRA 4UV8A 4A6DA 4L5IA 1P92A 3ZPLA 2P5LC 4RB1A 2IT0A 4I0AA 1Y0UA 1B9NA 4HOBA 2J5PA 3MQ0A 3C7JA 4KN7X 3ZP5A 5L3EA 1PP8F 3WU1B 4LK1F 4BQAA 4LLLA 1TW3A 2ADUA 3F3XA 3RTRA 3QU3A 5ILSA 2G7UA 3ZN1A 3IRRA 2D1VA 4P9FA 1S3JA 1MZBA 2FOKA 1R00A 2IA2A 4ENNA 3KEQA 1EH6A 3GLXA 3D0SA 3G73A 2R7DA 1IN8A 5DUIA 1L0OC 4ZYEA 5LRSA 2KJBA 4Y17A 1O3SA 5HS7A 4RB2C 4UNOA 5DD4A 3LAJA 4ON0A 3DQVC 3MZYA 1T38A 1GHCA 1IN4A 1QZYA 3I53A 4AIKA 1BC8C 4LFUA 3U2RA 2G9WA 4HV5A 1G3SA 1P4AA 2MBFA 2EWNA 5JHUA 2F5DA 2HFHA 1KA8A 3GEZA 2FF4A 1YO5C 3RKWA 4EJTA 4R79A 4YFXF 3KP5A 2OD5A 1VTNC 2XUBA 2GXBA 2Q8KA 1OYYA 5CVJA 1ZAOA 5IT9K 4QLCU 4LG0B 4FHTA 5CLSA 3EUHA 2DBBA 3K1NA 2CSOA 3N4MA 2HWVA 2P4WA 2GA1A 3BY6A 3ABTA 2KIFA 2K7LA 5D6FA 3CJNA 2YR2A 1XCVA 2UZKA 1OYIA 4Q48A 4N9IA 3E97A 1R22A 1ZG1A 2RDPA 2O6GE 5DCMA 1ON2A 2XIGA 5K5QA 4UHTA 1BC7C 4B09A 2LKPA 1U6GA 3J80K 2D1HA 2L4MA 1K78B 2OZ6A 4HLYA 1B4AA 2STWA 2KKOA 3LWFA 3KZZA 3F72A 2EK5A 3E3VA 3FXQA 2A6EF 3M1EA 3BWGA 2H09A 5IT3A 2ZNZA 1T0FA 3FXRA 2A5YB 3GWZA 2STTA 4HZFA 4KFCA 3CUOA 3AAFA 4IVNA 3WTXC 2ESHA 2DLLA 5FFXA 1K79A 2OBPA 1FOKA 1RIOH 1W7PA 2L02A 4CDGA 2DAOA 2XV4S 1D3YA 1EV7A 1ZH5A 2FBKA 1FZPB 4G7ZF 2QQ9A 4L9JA 1B59A 3V8JA 1I1GA 5ICEA 2P8TA 4AVPA 3VFZA 2MH2A 2YX7A 5D5WB 1LDKB 2MLGA 5L3DA 4CO8A 3V8KA 3J81Z 1HW2A 3JAMK 3DPLC 4K2EA 3IHUA 4IRHA 4UVCA 2HOEA 4IHTA 2R7FA 5L3FA 4G7OF 5LEJA 4I02A 3K0LA 5HDGA 4U0VA 4CZZA 2VONA 5EEGA 3FM3A 4LB5A 3DV8A 4EJUA 3EYIA 4UVAA 3CUQC 2MA3A 3RPQA 3COAC 3M8EA 2V6CA 1H9GA 2K27A 3HHHA 1YW8A 2WTEA 3DPTA 1HKQA 2LDUA 4P5OA 3T0YA 3WTSC 2Q0OA 2A68F 2PG4A 1J2XA 2IVMA 4EJVA 1TTYA 1U2WA 3WODF 1Z9CA 3ZMDA 1IUYA 1YS6A 2E1NA 2H94A 2HGCA 1XN7A 3L7WA 4G8XA 1IXSB 2H27A 3C3WA 2HYFA 1W5SA 2EFQA 5FD5A 3WTUC 1D8JA 2BE5F 1DPUA 1S7OA 5D4RA 5K1YA 1HW1A 4U0WA 5BMZA 4A0XA 3FZVA 4UVBA 2DU9A 1ZN2A 2O61A 2COMA 5CVRA 2PMUA 4P55A 2CGPA 1YIOA 5D5VB 2DQRA 2KIUA 1QNTA 4HYEA 4HF0A 4BYYA 4MNUA 1KQ9A 4IRIA 2QLZA 1ON1A 1MJ9A 4I0BA 4Z2YA 2PMHA 3L2CA 2ZMEB 3ZQ7A 1KGSA 3P9KA 4L9TA 4L9NA 3NEUA 3VB2A 5JI6A 3R0JA 4Y15A 1YW7A 1FP1D 1TLHB 3GFJA 2VT2A 4I01A 1QQIA 1W5TA 2PQ8A 3U9GA 5E1XA 1L3LA 1O3RA 2VXZA 3E6BA 2DT5A 4GXOA 3TO6A 4KMFA 3C1DA 4KIGA 5E8IA 3SZPA 5F1RA 1Z05A 2ELHA 2F5CA 1QGPA 4EM1A 2J5OA 3CUQB 1USTA 3Q9VA 1ZG5A 4XBFA 3E6MA 1TQIA 2RC4A 5AIQA 2F5FA 4G6DA 2AXLA 3QOPA 1SD5A 2XAHA 3NQOA 4NQWA 3MWMA 1XD7A 4UV9A 4OIQF 1E2XA 1MD0A 2XAGA 2EB7A 4XLNF 1R5GA 2PBIA 5BPIA 2O0YA 3K1PA 3OOPA 2WC2A 5FB2A 5FGMA 2W24A 1XSXA 3HSRA 4M71A 4GCVA 1SMTA 3QP5A 4IF4A 5LBQA 3FXUA 2V1UA 1O3QA 1QPMA 4MGRA 3ZMSA 5HLHA 2Z99A 5K5RA 4A2UA 2Z9OA 2L01A 3WG9A 1ZARA 2UWMA 3TO9A 2XAQA 3I71A 5EEHA 3IKTA 2DK8A 5D8KB 2W57A 4I98B 3GYHX 3RYRA 3GZ6A 1E17A 5E1WA 3I54A 3GF2A 4HF1A 4U7BA 3FF5A 4WK8F 4IRGA 4O3MA 5JVTA 4HLXA 4EGYA 4KT5C 1REPC 2IJLA 1QO0D 2CYYA 4KN4X 1KQ8A 3R0AA 2HKXA 2EV6A 2FMLA 3KP2A 2HZTA 3SZTA 3DKWA 3IWZA 4M9SA 3REOA 3GXOA 3WGGA 2NS0A 3CLOA 3SXYA 3TKYA 5E8GA 1A04A 1LEBA 3I0TA 1BIAA 2Z5UA 2VBYA 3DEUA 2KIMA 4M6YA 5ED4A 1J7KA 4RGXA 1IRGA 2D45A 3KFWX 5A2QZ 1Q1HA 2ZFWA 3ABUA 1R1UA 3F8CA 2QBYA 2XROA 2ZNYA 1LNWA 2ZJ2A 3F6OA 2FU4A 1V4RA 2FBHA 3HTSB 2RV8A 1KU3A 2RGVA 3PQJA 4XLPF 4LLNA 2IA1A 4I2OA 3BROA 1XSDA 2EFOA 3WTZA 3ML6A 2DFIA 3ECHA 2FMYA 2AS5F 4NB5A 2L3DA 2FSWA 1R1TA 3H3UA 2ESNA 2Q2EA 3CO6C 3R61A 1MDMA 1UHMA 3HTUA 1F1ZA 4AD9A 2Z33A 3JTGA 2HQRA 1LVAA 3IKVA 2FQ3A 4OIOF 2BEOA 4LD5A 3GZ5A 5D6EA 1S29A 3I4PA 3DFGA 1G3TA 3C18A 3FX3A 4ETSA 1D8KA 2GIVA 1R58A 1YYVA 3LA3A 1B1BA 4DQ2A 4I09A 3WTTC 1OPCA 1IRFA 1T39A 1S8NA 2V79A 4LLGF 3KEOA 2EA2A 4HW0A 3FMSA 5BOXA 2CG4A 4IJAA 3Q5FA 4WXCA 4ASNA 1R7JA 5J8FA 2VODA 2QVOA 4CHUA 1IN5A 1I27A 2FNPA 3VODA 3L00A 2LF7A 4NHJA 2XHKA 1W7PD 1Z6TA 1H0MA 1O7FA 1XDUA 1DDNA 1XB4A 1ZLKA 1SD4A 5DYMA 2P7VB 1YS7A 1R5HA 3HRTA 3TGNA 1WRJA 2GA2A 3EETA 2OZUA 1P6RA 1LB2A 3W6JB 3V7CA 4UUVA 4U88A 5ILVA 5FLXK 1AOYA 4WXDA 2ZCWA 2RKHA 5CJ9A 3M8FA 1IAWA 3CTAA 1MJBA 2MLKA 1SFUA 2EFWA 3ZMZA 2M87A 3HRUA 2M8EA 1FP2A 2FRHA 5TJJA 4BHBA 3DF8A 3N97A 5DCMB 4WXHA 3SQNA 3TOAA 4EM0B 2UXXA 2YX4A 4WX9A 3WU0A 1SD7A 1JE8A 2JSCA 3BDDA 2NNYA 1T2KA 3TDUC 3WGHA 2RNJA 1U5TA 4BNCA 2C6YA 2JT1A 1OKRA 3I59A 1DUXC 4U0YA 1Z91A 4ENKA 1HKTA 1RZ4A 2Y75A 4RGUA 1MJAA 3MAJA 2HTSA 1BI1A 2Y0MA 4ENJA 1O7LA 3TOBA 1OYWA 2ETHA 2ZBKA 2K86A 4LK0F 1XGMA 3GW2A 2CFXA 4BH9A 2RN7A 3KE2A 5AIPA 1BOAA 2CWEA 2P6SA 1W7PB 2RVCA 3GX4X 4IXAA 1UCRA 1FBUA 1JXSA 3BP8A 5LGTA 2EV0A 1FBSA 2P7CB 2VE8A 4U7DA 3BPXA 2ZMEA 2IRFG 3LA2A 4M72A 3I58A 1B9MA 3KP7A 2ISYA 1HBXG 4AIJA 4N9HA 2DPUA 2KJCA 4S04A 1XCBA 1ODDA 5J6XA 2G7HA 2BV6A 3M9AA 5IT9Z 1Z6RA 2H6BA 1I5ZA 3I5UA 1F4KA 3T8TA 2E7XA 1HSJA 5CVUA 3VOEA 3WTWC 2PI0A 1K7AA 4ZZLA 4M9ZA 1WKMA 2HKOA 1FYKA 4R1HA 4YG2F 4ENMA 5D4SA 2DPDA 1LEAA 1F5TA 4IHSA 4GO1A 2XAFA 3HIFA 1ZGJA 1JHHA 4HA8A 5H20A 2GWRA 2B0LA 1SFXA 5HLGA 2M5WA 3BPVA 4A0YA 3J80Z 2ISZA 1KQ0A 3TQNA 1TW2A 2GAUA 4LJZF 4PZJA 4WWCA 2M45A 3QPHA 1HQCA 3K9TA 3RKYA 3ZMUA 1G3YA 2QQBA 4M73A 4DNCA 3ROUA 3JW4A 4Q4ZF 1IZ1A 4H0EA 4S05A 1WSUA 4OINF 1KU2A 2YU3A 2JZYA 1P2FA 1FC3A 4JBAA 2NYXA 5ICFA 3KETA 1IXCA 3O3KA 2HEOA 4AWXB 2O3FA 1STZA 4AIHA 1SFEA 3V7SA 1KU9A 4HDUA 2QUFA 2MC3A 4GYIA 3RYPA 2YPRA 4HX7A 2CW0F 5ICGA 1CF7A 2BYVE 4MQ9F 1R23A 4Q5SF 1AWCA 2E7WA 2FE3A 4CXFA 1RI7A 5HS9A 4YIFA 4O5VA 4EVIA 4GYGA 4YFNF 4LB6B 1BJAA 4XSXF 3PFIA 2Y48A 2PFBA 4FT8A 3P9CA 3LA7A 2EA4A 3JAMZ 3ULQB 3HHGA 2X0LA 2VOPA 1FY7A 4CYDA 4P96A 1LJ9A 3V4GA 1JHFA 4L5JA 2A07F 5ICCA 4ESBA 3E5UA 4I7HA 2XASA 3Q9SA 5DUKA 3HUGA 2A3SA 3BJ6A 2VC0A 3LQRA 4OU0A 4MEYF 1WWXA 3V7RA 4TV7A 2JRTA 2V1DA 1FT9A 3BZ6A 3GVAA 3LQQA 4F7ZA 2F5EA 3FM5A 2OQRA 4MTEA 4EMSA 4YFKF 3RI4A 4ESFA 2VT3A 1TNTA 1KYZA 1RUOA 5HOOA 1BBYA 2XAJA 3RDIA 5LHHA 1UHWA 5L3CA 3JSOA 5TRDA 2ZXJA 1J5YA 4FX4A 1YTYA 1EH8A 2QZ8A 2FNAA 1KU7A 4B8XA 4HBLA 4EQQA 6PAXA 4D0PA 5E18F 3E6DA 4ZYGA 2HYGD 2EFPA 5HS8A 5KVRA 4Q47A 1LDDA 4KDPA 3FHZA 3HOTA 1FYMA 1FBQA 5LHIA 3EDPA 5L3GA 3BJAA 2E1CA 1ZGAA 4GGGA 1WQ2A 3ERED 5HDNA 3WTVC 3QP6A 1CGPA 2DTRA 2GQQA 4ZZDA 1G4DA 3G3ZA 2HS5A 3HYIA 1PUEE 1QZZA 3KLOA 2LF8A 3PQKA 1Z1DA 3KLNA 4XSZF 3J81K 4BHCA 4PGGA 4CGZA 1PDNC 3K1MA 4JK1X 4LG0A 2VOOA 1O3TA 3IWFA 5LEKA 4HQMA 4KICA 2GZWA 4WCGA 4L0YB 2DK5A 5AONA 1USSA 4OOIA 1TQPA 2FA5A 5JFRA 1P4WA 3S2WA 4G94A 2XGXA 2JTVA 1SD6A 3LFKA 4G7HF 2NNNA 5FD6A 2OA4A 1KYWA 4L9VA 2PJPA 3HOSA 3GUDA 3DXJF 1ULYA 4UXNA 4A12A 4KUMA 4QWQA 1YFHA 1YLFA 1K78A 1W4MA 5E20A 3FWEA 2TDXA 3K69A 2RQPA 4YIIA 2NRAC 2DQLA 2EJRA 4HF2A 4O6JA 1BI0A 2XVCA 2K4JA 1ZRCA 5CVIA 2QBYB 2FBIA 3QPTA 1XMKA 5LGUA 4RB0A 1K6OA 1RUNA 4L0ZB 3U1DA 2M1BA 2HQNA 1J9IA 2VN2A 3MCZA 3NRVA 1YG2A 5JR3A 2O8XA 4P9UA 5BPDA 3O6BB 5FO5A 1LDJA 1T98A 1SAXA 2P6TA 2IP2A 2PEXA 1XGSA 3ECOA 2W25A 1MDMB 3I64A 4MQVA 4EJOA 2DW4A 1G3WA 4L18B 3B02A 4A6EA 1U5TC 3R6SA 3F8FA 1MGTA 2M30A 3WE2A 1O57A 1OR7A 2IPQX 2BBYA 2ZO4A 3ISPA 1IN7A 2HTJA 1ZHFA 1XGOA 3T1BA 2EV5A 4R8HA 3LAPA 1J75A 2OAZA 3FMQA 2V1XA 4HV6A 1SMYF 1UFMA 4EM2A 5LGNA 4Y13A 4OMZA 1ZREA 1J0RA 1IW7F 5HVQC 2VC1A 1TNSA 1ZRDA 1R36A 5E1ZB 1XGNA 1T6SA 2JPBA 2P5VA 5DD8A 1X3UA 4WF2A 4KNYA 5ILUA 3E5XA 4ZH4F 2PN6A 3ZN0A 3KZYA 2QQAA 1PP7U 2VBXA 2A69F 2QENA 1BM9A 5HDKA 1QBJA 5BQTA 2XRNA 3F23A 4LMYA 1FX7A 4M9XA 1B6AA 1V3FA 2QWWA 1BI3A 1FSHA 3W6KB 4KMUX 1TQMA 4EV0A 1OMIA 3KCCA 4JQFA 4OIRF 4M6XA 1H9TA 1HKSA 2W85A 3BJOA 2A61A 4FX0A 3T8RA 1TBXA 3E5QA 4MEXF 4RAYA 4G6QA 5ERIA 1BIBA 3CO7C 1G6NA 3P9IA 1I6XA 2XKPA 4PDKA 2R3SA 1GXPA 4RS8A 1MKMA 2YSRA 5D5XB 4BXUA 5H6QA 3GFMA 3HRMA 2ZKZA 2W84A 4XRFA 4E70A 2O03A 3MZHA 4EGZA 3WE3A 1U3EM 3J7AO 2HDCA 2A6HF 4MHGA 4KYWA 3H3ZA 5H6RA 3QAHA 3O2PE 5HLIA 1ZG3A 5F6FA 2GXGA 3GO5A 4CICA 3BOQA 4HX8A 1U5TB 3MFKA 3ZMVA 3KP4A 3F8NA 5DV5A 2IW5A 5L3BA 2DI3A 3M7GA 3I59B 5CYVA 3JSPA 1ZLJA 4ZYHA 2Z3YA 3SHFA 2LSOA 2VE9A 2P5KA 5D5UB 5LRRA 3TDZC 1FLIA 1BN5A 2H6CA 5DDGA 3RKXA 3MEXA 2F2EA 1YW9A 1P4XA 3SFZA 2KRFA 1S7AA 1J59A 2LNBA 1EH7A 4G9YA 3CUQA 4RAZA 3P7NA 1D5VA 4PGHA 1S6LA 5F64A 5KK1A 4KIBA 4MTDA 2WV0A 5A2QK 1F9NA 1I1SA 2MH9A 5E17F 1U78A 2VBWA 3IL2A 3K2ZA 1DP7P 2OQGA 2X4HA 1JGSA 5LHGA 2K02A 2PLYA 4OMYA 3E6CC 3F21A 4PCQA 4KA4A 1WI9A 5DEQA 1FSEA 5FLXZ 4N0BA 5FFZA 4A5MA 4RB3C 2HR3A 3EQLF 3F8BA 4HDVA 2BGCA 3H92A 1ZRFA 2NAZA 1XMAA 3F8MA 1U8RA 3RPUA 3ZMTA 3KP6A 1XSVA 4EJWA 1IXRC 4OIPF 3R60A 2EFNA 4RGSA 5BS6A 2L4AA 4LGWA 2WWYA 3KP3A 3GFLA 4BAYA 3DP7A 1DPRA 2D2WA 3QRFF 1HXDA 3HSFA 3WTYC 3IRQA 2V9VA 4A0ZA 1R1VA 4HX4A 2OU2A 1IF1A 1GXQA 3WGIA 1ZYRF 2MD5A 1RNLA 2JPCA 5J8CA 1FYLA 5K5OA 3LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO A;  1UB9 A;  1IN6 A;  2DO7 A;  4ZYD A;  3T5X A;  1Z7U A;  3HSE A;  3ELK A;  4A5N A;  1HST A;  3OV8 A;  3B73 A;  1FWZ A;  5D8L B;  4KIF A;  2QYO A;  4RGR A;  3HRS A;  3IC7 A;  3TO7 A;  3L9F A;  1FNN A;  3D5L A;  4ESJ A;  2L54 A;  1XDS A;  2IA0 A;  3EYY A;  3F6V A;  1CF7 B;  3V8L A;  3F22 A;  1YQA A;  1HW5 A;  4BHP A;  5LLQ A;  3RJP A;  3JTH A;  1ONV A;  3L09 A;  1C0W A;  2K4B A;  3R4K A;  2FXA A;  3QU6 A;  3GFI A;  2ACJ A;  2CO5 A;  2VBZ A;  1BI2 A;  3RIR A;  3VEP A;  4HQE A;  4M74 A;  4HAM A;  2CQK A;  2QM3 A;  1FPQ A;  5DCF A;  3CDH A;  2UXN A;  2FEZ A;  1LQ1 A;  1GVJ A;  5CVV A;  1NHA A;  4IPA A;  3FMR A;  4UV8 A;  4A6D A;  4L5I A;  1P92 A;  3ZPL A;  2P5L C;  4RB1 A;  2IT0 A;  4I0A A;  1Y0U A;  1B9N A;  4HOB A;  2J5P A;  3MQ0 A;  3C7J A;  4KN7 X;  3ZP5 A;  5L3E A;  1PP8 F;  3WU1 B;  4LK1 F;  4BQA A;  4LLL A;  1TW3 A;  2ADU A;  3F3X A;  3RTR A;  3QU3 A;  5ILS A;  2G7U A;  3ZN1 A;  3IRR A;  2D1V A;  4P9F A;  1S3J A;  1MZB A;  2FOK A;  1R00 A;  2IA2 A;  4ENN A;  3KEQ A;  1EH6 A;  3GLX A;  3D0S A;  3G73 A;  2R7D A;  1IN8 A;  5DUI A;  1L0O C;  4ZYE A;  5LRS A;  2KJB A;  4Y17 A;  1O3S A;  5HS7 A;  4RB2 C;  4UNO A;  5DD4 A;  3LAJ A;  4ON0 A;  3DQV C;  3MZY A;  1T38 A;  1GHC A;  1IN4 A;  1QZY A;  3I53 A;  4AIK A;  1BC8 C;  4LFU A;  3U2R A;  2G9W A;  4HV5 A;  1G3S A;  1P4A A;  2MBF A;  2EWN A;  5JHU A;  2F5D A;  2HFH A;  1KA8 A;  3GEZ A;  2FF4 A;  1YO5 C;  3RKW A;  4EJT A;  4R79 A;  4YFX F;  3KP5 A;  2OD5 A;  1VTN C;  2XUB A;  2GXB A;  2Q8K A;  1OYY A;  5CVJ A;  1ZAO A;  5IT9 K;  4QLC U;  4LG0 B;  4FHT A;  5CLS A;  3EUH A;  2DBB A;  3K1N A;  2CSO A;  3N4M A;  2HWV A;  2P4W A;  2GA1 A;  3BY6 A;  3ABT A;  2KIF A;  2K7L A;  5D6F A;  3CJN A;  2YR2 A;  1XCV A;  2UZK A;  1OYI A;  4Q48 A;  4N9I A;  3E97 A;  1R22 A;  1ZG1 A;  2RDP A;  2O6G E;  5DCM A;  1ON2 A;  2XIG A;  5K5Q A;  4UHT A;  1BC7 C;  4B09 A;  2LKP A;  1U6G A;  3J80 K;  2D1H A;  2L4M A;  1K78 B;  2OZ6 A;  4HLY A;  1B4A A;  2STW A;  2KKO A;  3LWF A;  3KZZ A;  3F72 A;  2EK5 A;  3E3V A;  3FXQ A;  2A6E F;  3M1E A;  3BWG A;  2H09 A;  5IT3 A;  2ZNZ A;  1T0F A;  3FXR A;  2A5Y B;  3GWZ A;  2STT A;  4HZF A;  4KFC A;  3CUO A;  3AAF A;  4IVN A;  3WTX C;  2ESH A;  2DLL A;  5FFX A;  1K79 A;  2OBP A;  1FOK A;  1RIO H;  1W7P A;  2L02 A;  4CDG A;  2DAO A;  2XV4 S;  1D3Y A;  1EV7 A;  1ZH5 A;  2FBK A;  1FZP B;  4G7Z F;  2QQ9 A;  4L9J A;  1B59 A;  3V8J A;  1I1G A;  5ICE A;  2P8T A;  4AVP A;  3VFZ A;  2MH2 A;  2YX7 A;  5D5W B;  1LDK B;  2MLG A;  5L3D A;  4CO8 A;  3V8K A;  3J81 Z;  1HW2 A;  3JAM K;  3DPL C;  4K2E A;  3IHU A;  4IRH A;  4UVC A;  2HOE A;  4IHT A;  2R7F A;  5L3F A;  4G7O F;  5LEJ A;  4I02 A;  3K0L A;  5HDG A;  4U0V A;  4CZZ A;  2VON A;  5EEG A;  3FM3 A;  4LB5 A;  3DV8 A;  4EJU A;  3EYI A;  4UVA A;  3CUQ C;  2MA3 A;  3RPQ A;  3COA C;  3M8E A;  2V6C A;  1H9G A;  2K27 A;  3HHH A;  1YW8 A;  2WTE A;  3DPT A;  1HKQ A;  2LDU A;  4P5O A;  3T0Y A;  3WTS C;  2Q0O A;  2A68 F;  2PG4 A;  1J2X A;  2IVM A;  4EJV A;  1TTY A;  1U2W A;  3WOD F;  1Z9C A;  3ZMD A;  1IUY A;  1YS6 A;  2E1N A;  2H94 A;  2HGC A;  1XN7 A;  3L7W A;  4G8X A;  1IXS B;  2H27 A;  3C3W A;  2HYF A;  1W5S A;  2EFQ A;  5FD5 A;  3WTU C;  1D8J A;  2BE5 F;  1DPU A;  1S7O A;  5D4R A;  5K1Y A;  1HW1 A;  4U0W A;  5BMZ A;  4A0X A;  3FZV A;  4UVB A;  2DU9 A;  1ZN2 A;  2O61 A;  2COM A;  5CVR A;  2PMU A;  4P55 A;  2CGP A;  1YIO A;  5D5V B;  2DQR A;  2KIU A;  1QNT A;  4HYE A;  4HF0 A;  4BYY A;  4MNU A;  1KQ9 A;  4IRI A;  2QLZ A;  1ON1 A;  1MJ9 A;  4I0B A;  4Z2Y A;  2PMH A;  3L2C A;  2ZME B;  3ZQ7 A;  1KGS A;  3P9K A;  4L9T A;  4L9N A;  3NEU A;  3VB2 A;  5JI6 A;  3R0J A;  4Y15 A;  1YW7 A;  1FP1 D;  1TLH B;  3GFJ A;  2VT2 A;  4I01 A;  1QQI A;  1W5T A;  2PQ8 A;  3U9G A;  5E1X A;  1L3L A;  1O3R A;  2VXZ A;  3E6B A;  2DT5 A;  4GXO A;  3TO6 A;  4KMF A;  3C1D A;  4KIG A;  5E8I A;  3SZP A;  5F1R A;  1Z05 A;  2ELH A;  2F5C A;  1QGP A;  4EM1 A;  2J5O A;  3CUQ B;  1UST A;  3Q9V A;  1ZG5 A;  4XBF A;  3E6M A;  1TQI A;  2RC4 A;  5AIQ A;  2F5F A;  4G6D A;  2AXL A;  3QOP A;  1SD5 A;  2XAH A;  3NQO A;  4NQW A;  3MWM A;  1XD7 A;  4UV9 A;  4OIQ F;  1E2X A;  1MD0 A;  2XAG A;  2EB7 A;  4XLN F;  1R5G A;  2PBI A;  5BPI A;  2O0Y A;  3K1P A;  3OOP A;  2WC2 A;  5FB2 A;  5FGM A;  2W24 A;  1XSX A;  3HSR A;  4M71 A;  4GCV A;  1SMT A;  3QP5 A;  4IF4 A;  5LBQ A;  3FXU A;  2V1U A;  1O3Q A;  1QPM A;  4MGR A;  3ZMS A;  5HLH A;  2Z99 A;  5K5R A;  4A2U A;  2Z9O A;  2L01 A;  3WG9 A;  1ZAR A;  2UWM A;  3TO9 A;  2XAQ A;  3I71 A;  5EEH A;  3IKT A;  2DK8 A;  5D8K B;  2W57 A;  4I98 B;  3GYH X;  3RYR A;  3GZ6 A;  1E17 A;  5E1W A;  3I54 A;  3GF2 A;  4HF1 A;  4U7B A;  3FF5 A;  4WK8 F;  4IRG A;  4O3M A;  5JVT A;  4HLX A;  4EGY A;  4KT5 C;  1REP C;  2IJL A;  1QO0 D;  2CYY A;  4KN4 X;  1KQ8 A;  3R0A A;  2HKX A;  2EV6 A;  2FML A;  3KP2 A;  2HZT A;  3SZT A;  3DKW A;  3IWZ A;  4M9S A;  3REO A;  3GXO A;  3WGG A;  2NS0 A;  3CLO A;  3SXY A;  3TKY A;  5E8G A;  1A04 A;  1LEB A;  3I0T A;  1BIA A;  2Z5U A;  2VBY A;  3DEU A;  2KIM A;  4M6Y A;  5ED4 A;  1J7K A;  4RGX A;  1IRG A;  2D45 A;  3KFW X;  5A2Q Z;  1Q1H A;  2ZFW A;  3ABU A;  1R1U A;  3F8C A;  2QBY A;  2XRO A;  2ZNY A;  1LNW A;  2ZJ2 A;  3F6O A;  2FU4 A;  1V4R A;  2FBH A;  3HTS B;  2RV8 A;  1KU3 A;  2RGV A;  3PQJ A;  4XLP F;  4LLN A;  2IA1 A;  4I2O A;  3BRO A;  1XSD A;  2EFO A;  3WTZ A;  3ML6 A;  2DFI A;  3ECH A;  2FMY A;  2AS5 F;  4NB5 A;  2L3D A;  2FSW A;  1R1T A;  3H3U A;  2ESN A;  2Q2E A;  3CO6 C;  3R61 A;  1MDM A;  1UHM A;  3HTU A;  1F1Z A;  4AD9 A;  2Z33 A;  3JTG A;  2HQR A;  1LVA A;  3IKV A;  2FQ3 A;  4OIO F;  2BEO A;  4LD5 A;  3GZ5 A;  5D6E A;  1S29 A;  3I4P A;  3DFG A;  1G3T A;  3C18 A;  3FX3 A;  4ETS A;  1D8K A;  2GIV A;  1R58 A;  1YYV A;  3LA3 A;  1B1B A;  4DQ2 A;  4I09 A;  3WTT C;  1OPC A;  1IRF A;  1T39 A;  1S8N A;  2V79 A;  4LLG F;  3KEO A;  2EA2 A;  4HW0 A;  3FMS A;  5BOX A;  2CG4 A;  4IJA A;  3Q5F A;  4WXC A;  4ASN A;  1R7J A;  5J8F A;  2VOD A;  2QVO A;  4CHU A;  1IN5 A;  1I27 A;  2FNP A;  3VOD A;  3L00 A;  2LF7 A;  4NHJ A;  2XHK A;  1W7P D;  1Z6T A;  1H0M A;  1O7F A;  1XDU A;  1DDN A;  1XB4 A;  1ZLK A;  1SD4 A;  5DYM A;  2P7V B;  1YS7 A;  1R5H A;  3HRT A;  3TGN A;  1WRJ A;  2GA2 A;  3EET A;  2OZU A;  1P6R A;  1LB2 A;  3W6J B;  3V7C A;  4UUV A;  4U88 A;  5ILV A;  5FLX K;  1AOY A;  4WXD A;  2ZCW A;  2RKH A;  5CJ9 A;  3M8F A;  1IAW A;  3CTA A;  1MJB A;  2MLK A;  1SFU A;  2EFW A;  3ZMZ A;  2M87 A;  3HRU A;  2M8E A;  1FP2 A;  2FRH A;  5TJJ A;  4BHB A;  3DF8 A;  3N97 A;  5DCM B;  4WXH A;  3SQN A;  3TOA A;  4EM0 B;  2UXX A;  2YX4 A;  4WX9 A;  3WU0 A;  1SD7 A;  1JE8 A;  2JSC A;  3BDD A;  2NNY A;  1T2K A;  3TDU C;  3WGH A;  2RNJ A;  1U5T A;  4BNC A;  2C6Y A;  2JT1 A;  1OKR A;  3I59 A;  1DUX C;  4U0Y A;  1Z91 A;  4ENK A;  1HKT A;  1RZ4 A;  2Y75 A;  4RGU A;  1MJA A;  3MAJ A;  2HTS A;  1BI1 A;  2Y0M A;  4ENJ A;  1O7L A;  3TOB A;  1OYW A;  2ETH A;  2ZBK A;  2K86 A;  4LK0 F;  1XGM A;  3GW2 A;  2CFX A;  4BH9 A;  2RN7 A;  3KE2 A;  5AIP A;  1BOA A;  2CWE A;  2P6S A;  1W7P B;  2RVC A;  3GX4 X;  4IXA A;  1UCR A;  1FBU A;  1JXS A;  3BP8 A;  5LGT A;  2EV0 A;  1FBS A;  2P7C B;  2VE8 A;  4U7D A;  3BPX A;  2ZME A;  2IRF G;  3LA2 A;  4M72 A;  3I58 A;  1B9M A;  3KP7 A;  2ISY A;  1HBX G;  4AIJ A;  4N9H A;  2DPU A;  2KJC A;  4S04 A;  1XCB A;  1ODD A;  5J6X A;  2G7H A;  2BV6 A;  3M9A A;  5IT9 Z;  1Z6R A;  2H6B A;  1I5Z A;  3I5U A;  1F4K A;  3T8T A;  2E7X A;  1HSJ A;  5CVU A;  3VOE A;  3WTW C;  2PI0 A;  1K7A A;  4ZZL A;  4M9Z A;  1WKM A;  2HKO A;  1FYK A;  4R1H A;  4YG2 F;  4ENM A;  5D4S A;  2DPD A;  1LEA A;  1F5T A;  4IHS A;  4GO1 A;  2XAF A;  3HIF A;  1ZGJ A;  1JHH A;  4HA8 A;  5H20 A;  2GWR A;  2B0L A;  1SFX A;  5HLG A;  2M5W A;  3BPV A;  4A0Y A;  3J80 Z;  2ISZ A;  1KQ0 A;  3TQN A;  1TW2 A;  2GAU A;  4LJZ F;  4PZJ A;  4WWC A;  2M45 A;  3QPH A;  1HQC A;  3K9T A;  3RKY A;  3ZMU A;  1G3Y A;  2QQB A;  4M73 A;  4DNC A;  3ROU A;  3JW4 A;  4Q4Z F;  1IZ1 A;  4H0E A;  4S05 A;  1WSU A;  4OIN F;  1KU2 A;  2YU3 A;  2JZY A;  1P2F A;  1FC3 A;  4JBA A;  2NYX A;  5ICF A;  3KET A;  1IXC A;  3O3K A;  2HEO A;  4AWX B;  2O3F A;  1STZ A;  4AIH A;  1SFE A;  3V7S A;  1KU9 A;  4HDU A;  2QUF A;  2MC3 A;  4GYI A;  3RYP A;  2YPR A;  4HX7 A;  2CW0 F;  5ICG A;  1CF7 A;  2BYV E;  4MQ9 F;  1R23 A;  4Q5S F;  1AWC A;  2E7W A;  2FE3 A;  4CXF A;  1RI7 A;  5HS9 A;  4YIF A;  4O5V A;  4EVI A;  4GYG A;  4YFN F;  4LB6 B;  1BJA A;  4XSX F;  3PFI A;  2Y48 A;  2PFB A;  4FT8 A;  3P9C A;  3LA7 A;  2EA4 A;  3JAM Z;  3ULQ B;  3HHG A;  2X0L A;  2VOP A;  1FY7 A;  4CYD A;  4P96 A;  1LJ9 A;  3V4G A;  1JHF A;  4L5J A;  2A07 F;  5ICC A;  4ESB A;  3E5U A;  4I7H A;  2XAS A;  3Q9S A;  5DUK A;  3HUG A;  2A3S A;  3BJ6 A;  2VC0 A;  3LQR A;  4OU0 A;  4MEY F;  1WWX A;  3V7R A;  4TV7 A;  2JRT A;  2V1D A;  1FT9 A;  3BZ6 A;  3GVA A;  3LQQ A;  4F7Z A;  2F5E A;  3FM5 A;  2OQR A;  4MTE A;  4EMS A;  4YFK F;  3RI4 A;  4ESF A;  2VT3 A;  1TNT A;  1KYZ A;  1RUO A;  5HOO A;  1BBY A;  2XAJ A;  3RDI A;  5LHH A;  1UHW A;  5L3C A;  3JSO A;  5TRD A;  2ZXJ A;  1J5Y A;  4FX4 A;  1YTY A;  1EH8 A;  2QZ8 A;  2FNA A;  1KU7 A;  4B8X A;  4HBL A;  4EQQ A;  6PAX A;  4D0P A;  5E18 F;  3E6D A;  4ZYG A;  2HYG D;  2EFP A;  5HS8 A;  5KVR A;  4Q47 A;  1LDD A;  4KDP A;  3FHZ A;  3HOT A;  1FYM A;  1FBQ A;  5LHI A;  3EDP A;  5L3G A;  3BJA A;  2E1C A;  1ZGA A;  4GGG A;  1WQ2 A;  3ERE D;  5HDN A;  3WTV C;  3QP6 A;  1CGP A;  2DTR A;  2GQQ A;  4ZZD A;  1G4D A;  3G3Z A;  2HS5 A;  3HYI A;  1PUE E;  1QZZ A;  3KLO A;  2LF8 A;  3PQK A;  1Z1D A;  3KLN A;  4XSZ F;  3J81 K;  4BHC A;  4PGG A;  4CGZ A;  1PDN C;  3K1M A;  4JK1 X;  4LG0 A;  2VOO A;  1O3T A;  3IWF A;  5LEK A;  4HQM A;  4KIC A;  2GZW A;  4WCG A;  4L0Y B;  2DK5 A;  5AON A;  1USS A;  4OOI A;  1TQP A;  2FA5 A;  5JFR A;  1P4W A;  3S2W A;  4G94 A;  2XGX A;  2JTV A;  1SD6 A;  3LFK A;  4G7H F;  2NNN A;  5FD6 A;  2OA4 A;  1KYW A;  4L9V A;  2PJP A;  3HOS A;  3GUD A;  3DXJ F;  1ULY A;  4UXN A;  4A12 A;  4KUM A;  4QWQ A;  1YFH A;  1YLF A;  1K78 A;  1W4M A;  5E20 A;  3FWE A;  2TDX A;  3K69 A;  2RQP A;  4YII A;  2NRA C;  2DQL A;  2EJR A;  4HF2 A;  4O6J A;  1BI0 A;  2XVC A;  2K4J A;  1ZRC A;  5CVI A;  2QBY B;  2FBI A;  3QPT A;  1XMK A;  5LGU A;  4RB0 A;  1K6O A;  1RUN A;  4L0Z B;  3U1D A;  2M1B A;  2HQN A;  1J9I A;  2VN2 A;  3MCZ A;  3NRV A;  1YG2 A;  5JR3 A;  2O8X A;  4P9U A;  5BPD A;  3O6B B;  5FO5 A;  1LDJ A;  1T98 A;  1SAX A;  2P6T A;  2IP2 A;  2PEX A;  1XGS A;  3ECO A;  2W25 A;  1MDM B;  3I64 A;  4MQV A;  4EJO A;  2DW4 A;  1G3W A;  4L18 B;  3B02 A;  4A6E A;  1U5T C;  3R6S A;  3F8F A;  1MGT A;  2M30 A;  3WE2 A;  1O57 A;  1OR7 A;  2IPQ X;  2BBY A;  2ZO4 A;  3ISP A;  1IN7 A;  2HTJ A;  1ZHF A;  1XGO A;  3T1B A;  2EV5 A;  4R8H A;  3LAP A;  1J75 A;  2OAZ A;  3FMQ A;  2V1X A;  4HV6 A;  1SMY F;  1UFM A;  4EM2 A;  5LGN A;  4Y13 A;  4OMZ A;  1ZRE A;  1J0R A;  1IW7 F;  5HVQ C;  2VC1 A;  1TNS A;  1ZRD A;  1R36 A;  5E1Z B;  1XGN A;  1T6S A;  2JPB A;  2P5V A;  5DD8 A;  1X3U A;  4WF2 A;  4KNY A;  5ILU A;  3E5X A;  4ZH4 F;  2PN6 A;  3ZN0 A;  3KZY A;  2QQA A;  1PP7 U;  2VBX A;  2A69 F;  2QEN A;  1BM9 A;  5HDK A;  1QBJ A;  5BQT A;  2XRN A;  3F23 A;  4LMY A;  1FX7 A;  4M9X A;  1B6A A;  1V3F A;  2QWW A;  1BI3 A;  1FSH A;  3W6K B;  4KMU X;  1TQM A;  4EV0 A;  1OMI A;  3KCC A;  4JQF A;  4OIR F;  4M6X A;  1H9T A;  1HKS A;  2W85 A;  3BJO A;  2A61 A;  4FX0 A;  3T8R A;  1TBX A;  3E5Q A;  4MEX F;  4RAY A;  4G6Q A;  5ERI A;  1BIB A;  3CO7 C;  1G6N A;  3P9I A;  1I6X A;  2XKP A;  4PDK A;  2R3S A;  1GXP A;  4RS8 A;  1MKM A;  2YSR A;  5D5X B;  4BXU A;  5H6Q A;  3GFM A;  3HRM A;  2ZKZ A;  2W84 A;  4XRF A;  4E70 A;  2O03 A;  3MZH A;  4EGZ A;  3WE3 A;  1U3E M;  3J7A O;  2HDC A;  2A6H F;  4MHG A;  4KYW A;  3H3Z A;  5H6R A;  3QAH A;  3O2P E;  5HLI A;  1ZG3 A;  5F6F A;  2GXG A;  3GO5 A;  4CIC A;  3BOQ A;  4HX8 A;  1U5T B;  3MFK A;  3ZMV A;  3KP4 A;  3F8N A;  5DV5 A;  2IW5 A;  5L3B A;  2DI3 A;  3M7G A;  3I59 B;  5CYV A;  3JSP A;  1ZLJ A;  4ZYH A;  2Z3Y A;  3SHF A;  2LSO A;  2VE9 A;  2P5K A;  5D5U B;  5LRR A;  3TDZ C;  1FLI A;  1BN5 A;  2H6C A;  5DDG A;  3RKX A;  3MEX A;  2F2E A;  1YW9 A;  1P4X A;  3SFZ A;  2KRF A;  1S7A A;  1J59 A;  2LNB A;  1EH7 A;  4G9Y A;  3CUQ A;  4RAZ A;  3P7N A;  1D5V A;  4PGH A;  1S6L A;  5F64 A;  5KK1 A;  4KIB A;  4MTD A;  2WV0 A;  5A2Q K;  1F9N A;  1I1S A;  2MH9 A;  5E17 F;  1U78 A;  2VBW A;  3IL2 A;  3K2Z A;  1DP7 P;  2OQG A;  2X4H A;  1JGS A;  5LHG A;  2K02 A;  2PLY A;  4OMY A;  3E6C C;  3F21 A;  4PCQ A;  4KA4 A;  1WI9 A;  5DEQ A;  1FSE A;  5FLX Z;  4N0B A;  5FFZ A;  4A5M A;  4RB3 C;  2HR3 A;  3EQL F;  3F8B A;  4HDV A;  2BGC A;  3H92 A;  1ZRF A;  2NAZ A;  1XMA A;  3F8M A;  1U8R A;  3RPU A;  3ZMT A;  3KP6 A;  1XSV A;  4EJW A;  1IXR C;  4OIP F;  3R60 A;  2EFN A;  4RGS A;  5BS6 A;  2L4A A;  4LGW A;  2WWY A;  3KP3 A;  3GFL A;  4BAY A;  3DP7 A;  1DPR A;  2D2W A;  3QRF F;  1HXD A;  3HSF A;  3WTY C;  3IRQ A;  2V9V A;  4A0Z A;  1R1V A;  4HX4 A;  2OU2 A;  1IF1 A;  1GXQ A;  3WGI A;  1ZYR F;  2MD5 A;  1RNL A;  2JPC A;  5J8C A;  1FYL A;  5K5O A;  3LST A; 
#chains in the Genus database with same CATH topology
 2XKO A;  4PJL A;  1UB9 A;  1IN6 A;  2DO7 A;  4ZYD A;  3T5X A;  1IJW C;  1AA7 A;  2JVH A;  4BL0 B;  1Z7U A;  4F3Q A;  3HSE A;  2AO9 A;  3ELK A;  4A5N A;  1HST A;  2VPR A;  3OV8 A;  5M5Y J;  3OYG A;  3FBI B;  1UAA A;  3ZQQ A;  3B73 A;  2FD5 A;  1FWZ A;  5D8L B;  5EDN A;  3LSG A;  2QYO A;  4KIF A;  4IHY A;  4RGR A;  3HRS A;  3BC8 A;  2LY1 A;  3IC7 A;  4U87 A;  3TO7 A;  3HBL A;  3L9F A;  1FNN A;  1XX5 A;  3D5L A;  3OYC A;  2PJR A;  1MH4 A;  2CMP A;  4ESJ A;  1F43 A;  1X3Z B;  2JSP A;  2L54 A;  1XDS A;  2IA0 A;  3EYY A;  3F6V A;  1CF7 B;  3V8L A;  2R5Y A;  3HOU J;  1IV8 A;  1GVD A;  1APL C;  3F22 A;  1JKR C;  1YQA A;  2WAD A;  1YJ9 I;  1HW5 A;  4BHP A;  3AG2 H;  4ZC3 A;  5LLQ A;  1MW7 A;  3RJP A;  4NDL A;  3DKY A;  4Y4R A;  3JTH A;  1ONV A;  2QSH X;  4XLF A;  3L09 A;  1C0W A;  5FKO A;  2LLK A;  2LR8 A;  2K4B A;  1YE9 A;  1D5Y A;  4II3 A;  3R4K A;  2FXA A;  3QU6 A;  3ZRG A;  3GFI A;  2ACJ A;  2CO5 A;  2VLA A;  3GME A;  2VBZ A;  1BI2 A;  3RIR A;  3VEP A;  4HQE A;  4M74 A;  1WJC A;  5EJC A;  4HAM A;  2CQK A;  2QM3 A;  4BXX J;  1FPQ A;  5DCF A;  1OCO H;  2KPM A;  3H9J A;  3CDH A;  4W1U A;  2UXN A;  3FIS A;  2FEZ A;  1LQ1 A;  1GVJ A;  1KZH A;  3L2R A;  5CVV A;  1NHA A;  4CCL A;  4IPA A;  3FMR A;  3LSP A;  4UV8 A;  3HUG B;  4A6D A;  4L5I A;  3OS2 A;  1P92 A;  3ZPL A;  4IKF A;  1WJD A;  2P5L C;  4RB1 A;  1UHS A;  1VQ8 I;  5FKK A;  2IT0 A;  5J1U A;  2B63 J;  4I0A A;  1Y0U A;  1B9N A;  3GTM J;  4HOB A;  2J5P A;  1Z0X A;  3MQ0 A;  3C7J A;  4KN7 X;  3ZP5 A;  1SAN A;  5CKT A;  1YRN B;  5L3E A;  1PP8 F;  3WU1 B;  5FRM A;  4LK1 F;  4BQA A;  4J00 A;  4LLL A;  1RPW A;  3BR0 A;  1TW3 A;  2ADU A;  1H8A C;  2F48 A;  3F3X A;  3RTR A;  1FOX A;  2VJ4 A;  3H36 A;  3QU3 A;  4C3I J;  3HXL A;  5ILS A;  3LOC A;  2G7U A;  1Y6I A;  3W2W A;  3ZN1 A;  5DM7 F;  2RQQ A;  2LC2 A;  3IRR A;  2D1V A;  1ZEL A;  4BDZ A;  4P9F A;  2CJJ A;  3GTQ J;  2CQ7 A;  1S3J A;  2KIS A;  3PNV A;  1MZB A;  2FOK A;  5TIS C;  1R00 A;  2IA2 A;  4ENN A;  3KEQ A;  2B7E A;  2DFF A;  3CD6 I;  1JUM A;  1VQ6 I;  5F04 A;  1EH6 A;  3GLX A;  3D0S A;  3G73 A;  2IEK A;  3DEW A;  3RZO J;  5DTD A;  2EQR A;  2R7D A;  1IN8 A;  5DUI A;  1L0O C;  4DYQ A;  4ZYE A;  5LRS A;  3EUK L;  3BQZ A;  1X1P A;  3B6A A;  1N78 A;  3ZQI A;  1IO2 A;  2KJB A;  4Y17 A;  2WB1 N;  1O3S A;  5HS7 A;  4RB2 C;  4UNO A;  2LYC A;  2LMD A;  5DD4 A;  3LAJ A;  4ON0 A;  1RRJ A;  3DQV C;  4HSR A;  3MZY A;  4G6T B;  3LSH A;  2CRG A;  1T56 A;  4YRV A;  1T38 A;  1GHC A;  1IN4 A;  4NNJ A;  2JA8 J;  4LIV A;  1OFC X;  1QZY A;  3I53 A;  4MIM A;  2BY1 A;  4AIK A;  2KL4 A;  2DDA A;  4KIT B;  1BC8 C;  1F36 A;  2DMQ A;  4LFU A;  3U2R A;  3PO3 J;  2G9W A;  4HV5 A;  2BVM A;  1G3S A;  4KJZ A;  1T8I A;  2XF6 A;  1G2H A;  1P4A A;  2MBF A;  4E7L A;  4XNF A;  2EWN A;  5JHU A;  5M5W J;  1VI0 A;  2F5D A;  2HFH A;  1KA8 A;  1WH5 A;  2FUG 2;  1H88 C;  1R9T J;  2E5N A;  3GEZ A;  3U1K A;  4B1R A;  2FF4 A;  4PJN A;  1YO5 C;  3QOE A;  3RKW A;  4EJT A;  4R79 A;  4G12 A;  3GTO J;  4YFX F;  3A1Y A;  3GTG J;  3KP5 A;  2OD5 A;  3BTI A;  1MMN A;  2PMZ N;  1VTN C;  4ZDL A;  4QIW N;  2XUB A;  2GXB A;  4A69 C;  1VQ9 I;  2LBF A;  2Q8K A;  5TGT A;  1OYY A;  5CVJ A;  4ZTF A;  3HZJ A;  2E1O A;  1ZAO A;  3HEF A;  4QLC U;  3SJM A;  5IT9 K;  4IOA F;  4M3G A;  1RES A;  5F08 A;  3RSN A;  2HQ5 A;  5C44 J;  4LG0 B;  4FHT A;  3A2K A;  4B3A A;  5CLS A;  1BOB A;  2XGD A;  3EUH A;  2DBB A;  3O8H A;  2L2O A;  1MBK A;  3K1N A;  2CSO A;  3OSG A;  4HPQ A;  3PO2 J;  2CQQ A;  2LH9 A;  3N4M A;  3Q0V A;  2HWV A;  2P4W A;  2R5Z A;  2GA1 A;  3QPL A;  2YS9 A;  2OC6 A;  4XM3 A;  3BY6 A;  2NS8 A;  1FTT A;  3ABT A;  2KIF A;  2K7L A;  5D6F A;  3CJN A;  4FAS D;  2YR2 A;  1XCV A;  1U0J A;  5EZG A;  2UZK A;  1OYI A;  4Q48 A;  4N9I A;  1VQN I;  3E97 A;  1R22 A;  2K3P A;  3BCA A;  1ZG1 A;  2RDP A;  2O6G E;  2KQR A;  2JWT A;  5DCM A;  1ON2 A;  3H9G A;  4HST A;  2XIG A;  2Y31 A;  1ZKG A;  1OCR H;  5K5Q A;  5J4Y A;  1WCM J;  4UHT A;  1BC7 C;  4B09 A;  2LKP A;  1U6G A;  3J80 K;  2D1H A;  4Y52 J;  2B9S A;  2L4M A;  1K78 B;  2OV7 A;  4YEL A;  2OZ6 A;  2DOD A;  4HLY A;  1B4A A;  2STW A;  2KKO A;  1FEX A;  2X9D A;  5M3F J;  3OYB A;  3BCB A;  1TWA J;  3CJR B;  3D5S C;  3LWF A;  1EKE A;  3HJE A;  3KZZ A;  2M9H A;  3CCR I;  1Z21 A;  3F72 A;  2EK5 A;  2L9S A;  3E3V A;  3FXQ A;  4A3E J;  3OYA A;  2A6E F;  2H8R A;  4M3D A;  3BG9 A;  3M1E A;  3S3O A;  3PFY A;  1FIP A;  4XKC A;  4UUS A;  3K4N A;  1AU7 A;  3BWG A;  3E7L A;  2H09 A;  5IT3 A;  2ZNZ A;  5CQG A;  1T0F A;  3A0B C;  1ITY A;  3FXR A;  2E71 A;  3CCY A;  2A5Y B;  3GWZ A;  3KZI C;  2STT A;  4HZF A;  3DCF A;  4KFC A;  1I6H J;  2DDB A;  3CUO A;  2WAE A;  5IY5 H;  3ABL H;  3I56 I;  3AAF A;  4IVN A;  2X1C A;  5IP7 J;  2IS4 A;  1S7E A;  3WTX C;  2ESH A;  2EZL A;  2DLL A;  5FFX A;  1K79 A;  2OBP A;  3CDI A;  1MNM C;  2PMZ A;  2ZME C;  1LKX A;  1FOK A;  1BL0 A;  4CSW A;  2UUZ A;  5IYB J;  1RIO H;  3ASN H;  1VZ0 A;  1LUJ B;  1W7P A;  5IP6 A;  2L02 A;  2QKM B;  4CDG A;  2DAO A;  1HC8 A;  5J4V A;  2XV4 S;  2M7A A;  1D3Y A;  1EV7 A;  1ZH5 A;  2FBK A;  1FZP B;  4G7Z F;  2QQ9 A;  4L9J A;  1B59 A;  4XLA A;  3V8J A;  1D1B A;  1I1G A;  5ICE A;  1HF0 A;  2DMP A;  2P8T A;  1LPQ A;  4AVP A;  2GLO A;  3VFZ A;  2MH2 A;  2YX7 A;  3CCL I;  5D5W B;  1LDK B;  3AFH A;  3GTJ J;  2MLG A;  1ERD A;  4M3B A;  1JT6 A;  4CCO A;  4DIQ A;  5L3D A;  2Y69 H;  2KIQ A;  3X2Q H;  4CO8 A;  3NWS A;  3V8K A;  3J81 Z;  3DEE A;  2X51 A;  2DMT A;  1HW2 A;  2CQN A;  1QPI A;  2VQC A;  3JAM K;  2L7K A;  2R4G A;  3DPL C;  4K2E A;  3IHU A;  4IRH A;  2CW8 A;  2HOE A;  4UVC A;  4IHT A;  3ZQF A;  3JR9 A;  2R7F A;  5L3F A;  4G7O F;  4XRM A;  2L7M P;  3WU2 C;  4XL9 A;  3ERM A;  5LEJ A;  4I02 A;  3K0L A;  5HDG A;  4U0V A;  2A5W A;  4CZZ A;  3S1M J;  1JJ8 C;  4E4H A;  2VON A;  3A0H C;  5EEG A;  3FM3 A;  3VYU B;  4BBS J;  3L2W A;  4LB5 A;  3LSK A;  3C2B A;  3DV8 A;  4EJU A;  1SVO A;  3MZ8 A;  3OMY A;  1WI3 A;  1BJZ A;  2HXI A;  3EYI A;  4UVA A;  3CUQ C;  2KFD A;  4HRI A;  2MA3 A;  3RPQ A;  3K4M A;  3COA C;  3M8E A;  2MAB A;  2V6C A;  3ZQH A;  5IPA A;  3GBG A;  4V2G A;  1H9G A;  2Z1D A;  1VND A;  2K27 A;  3HHH A;  1YW8 A;  2W00 A;  2XF5 A;  3VYT B;  2WTE A;  2QGU A;  2HU9 A;  3DPT A;  1HKQ A;  2R7O A;  2LDU A;  4P5O A;  3T0Y A;  3WTS C;  2Q0O A;  3LL7 A;  2A68 F;  2WY7 Q;  2PG4 A;  1Y0N A;  2LOO A;  1J2X A;  1MH3 A;  2IVM A;  4EJV A;  1TTY A;  1X58 A;  2HDW A;  1U2W A;  1SVM A;  2KLO A;  2L5Q A;  3WOD F;  3MKL A;  1Z9C A;  3ZMD A;  3IAM 2;  1IUY A;  1YS6 A;  1X1B A;  3JRH A;  1IDZ A;  4X0G A;  2E1N A;  2H94 A;  2HGC A;  2HPI A;  1X4O A;  3BG5 A;  2M4G A;  1XN7 A;  1MNE A;  1ZTR A;  2V6E A;  3L7W A;  2HOT A;  4G8X A;  1YI2 I;  2ID3 A;  1IXS B;  2R7Q A;  2E2J J;  2H27 A;  3Q0W A;  3C3W A;  3K2A A;  5FLM J;  1QA6 A;  2HYF A;  3SDG A;  1W5S A;  2EFQ A;  3C2G A;  5FD5 A;  3WTU C;  5E3L A;  1D8J A;  2BE5 F;  1DPU A;  1S7O A;  5D4R A;  1T95 A;  5K1Y A;  4XIC A;  4CYC A;  1HW1 A;  4U0W A;  5BMZ A;  2JJ7 A;  4A0X A;  3S16 J;  3FZV A;  4UVB A;  3JRB A;  3JRI A;  2DU9 A;  1SVL A;  1ZN2 A;  2O61 A;  2COM A;  2DA2 A;  5CVR A;  2KDZ A;  2PMU A;  2CU7 A;  4P55 A;  4QPQ A;  2CGP A;  1Y8Q B;  3WHC A;  1YIO A;  1U9N A;  5D5V B;  3DTK A;  3GZN B;  9ANT A;  2DQR A;  2KIU A;  2DA1 A;  4JYK A;  3W3C A;  1QNT A;  4HYE A;  4HF0 A;  4BYY A;  4MNU A;  4J01 A;  1KQ9 A;  4IRI A;  2QLZ A;  1YJW I;  2XC7 A;  2DCE A;  1ON1 A;  2ZXH A;  3BLY A;  1MJ9 A;  1MBF A;  4I0B A;  4EAT A;  4HG2 A;  3ZQG A;  4Z2Y A;  4AU7 A;  2BW3 B;  2PMH A;  4BJ5 C;  2JK3 A;  4RM3 A;  4RA2 A;  3L2C A;  1YX5 A;  2ZME B;  3KPH A;  1JJ6 C;  3RPU D;  2IAI A;  3FIW A;  3C2H A;  2DJI A;  3OYM A;  2HVR A;  1AKH A;  1MSF C;  4LIU A;  4XN3 A;  3ZQ7 A;  1KGS A;  3DU6 A;  3P9K A;  3H3V K;  3BR2 A;  3HOW J;  2IS6 A;  4L9T A;  4L9N A;  3B6C A;  4JX4 A;  3NEU A;  2XSD C;  4JX6 A;  3N05 A;  2ME6 A;  3VB2 A;  5JI6 A;  2BY0 A;  3R0J A;  2WAQ N;  2V7F A;  2BHZ A;  1X1A A;  1YW7 A;  3BTC A;  1FP1 D;  4Y15 A;  1TLH B;  3QYF A;  2JA5 J;  1HDP A;  1JTY A;  3OYI A;  2COB A;  1WFX A;  2FX0 A;  2IBD A;  2K9M A;  2VT2 A;  3GFJ A;  4I01 A;  3FDY A;  1IRX A;  4DJA A;  2OTL I;  1QQI A;  1VQK I;  3FKJ A;  3W2V A;  1W5T A;  4NC8 A;  2PQ8 A;  3MKZ A;  4PFP A;  1SC7 A;  3K4C A;  3U9G A;  3G6E I;  1OCT C;  2JA7 J;  5E1X A;  1L3L A;  1JKQ C;  2O8K A;  1O3R A;  1B72 B;  3BG3 A;  3HPG A;  1IRZ A;  3K4B A;  4ANJ A;  2VXZ A;  2I10 A;  3E6B A;  2BXZ A;  2DT5 A;  2NVU B;  4GXO A;  1OLT A;  3TO6 A;  4KMF A;  5IOZ A;  4DYR A;  2LTP A;  3C1D A;  4KIG A;  3G1M A;  1OIS A;  1U9O A;  1Y1V J;  3K6G A;  5E8I A;  1UG2 A;  3SZP A;  2N8G A;  5F1R A;  1Z05 A;  2ELH A;  3SZG A;  2EH3 A;  3J7A Y;  2F5C A;  1QGP A;  3BZK A;  1HLV A;  4EM1 A;  2VQH A;  1DP3 A;  4Y33 A;  2J5O A;  3CUQ B;  4ITV A;  3G4S I;  2HVS A;  2HPM A;  2VPL A;  1UST A;  3Q9V A;  2LG4 A;  4C3H J;  1ZG5 A;  4XBF A;  1UMQ A;  3E6M A;  5J40 A;  1TQI A;  4GRI A;  1MIJ A;  2RC4 A;  5AIQ A;  2F5F A;  2Y0S N;  2AXL A;  4G6D A;  2ZSI B;  3QOP A;  1SD5 A;  2L9V A;  2XAH A;  3NQO A;  4NQW A;  2DXI A;  5JLX A;  2HOS A;  3MWM A;  3PSI A;  1XD7 A;  4UV9 A;  2F4I A;  1E2X A;  4OIQ F;  1MD0 A;  1G8X A;  4OAZ A;  2XAG A;  1N75 A;  2EB7 A;  4XLN F;  3VDX A;  1R5G A;  4DGW B;  2PBI A;  5EG0 B;  2VL8 A;  5BPI A;  3VWB A;  3S3M A;  2O0Y A;  2JRM A;  3K1P A;  3OOP A;  1E3O C;  3QYB A;  3AG3 H;  3JRG A;  1X1C A;  2DOE A;  4XLH A;  3ASO H;  2WC2 A;  4F92 B;  3RKQ A;  3OYJ A;  1WJA A;  2HQA A;  3D5R C;  5FB2 A;  3PUF A;  2W24 A;  1XSX A;  5FGM A;  3HOV J;  3HSR A;  4DZP A;  4M71 A;  3ABK H;  1D1A A;  5GAE J;  2LVS A;  2MSY A;  3S93 A;  3ZR8 X;  4GCV A;  2WAQ A;  1SMT A;  3QP5 A;  3DBL B;  2LK2 A;  4FE7 A;  4IF4 A;  5LBQ A;  3FXU A;  3TL4 X;  4E7J A;  1YRN A;  1BA5 A;  2V1U A;  1FMW A;  1TC3 C;  5GPA A;  1O3Q A;  1QPM A;  2BHY A;  4MGR A;  3ZMS A;  2LY9 A;  1LE8 B;  5HLH A;  2Z99 A;  5K5R A;  3DTI A;  4ABZ A;  2OCC H;  1W5C C;  4QPO A;  4A2U A;  1W36 C;  2Z9O A;  2L01 A;  3WG9 A;  1V55 H;  1UG0 A;  1ZAR A;  3DBH B;  1W0T A;  1P7J A;  4HEA 2;  3TO9 A;  2D5V A;  2UWM A;  2XAQ A;  3I71 A;  5LFA A;  5EEH A;  5HLT A;  3IKT A;  2DK8 A;  1MBJ A;  2V4J C;  2R7T A;  5D8K B;  2R7X A;  2W57 A;  4M6V A;  2KP6 A;  1EJ9 A;  2WA0 A;  3O8G A;  4I98 B;  3VYS B;  3M07 A;  3GYH X;  2KT0 A;  1R49 A;  3RYR A;  3GZ6 A;  1E17 A;  3A4C A;  5E1W A;  4DBR A;  4UB6 C;  3AL0 B;  1JI8 A;  3I54 A;  2JMW A;  3GF2 A;  1W36 D;  4HF1 A;  4U7B A;  3FF5 A;  4WK8 F;  4IRG A;  3MD2 A;  4O3M A;  3IH4 A;  4LIT A;  5JVT A;  4HLX A;  4EGY A;  4KT5 C;  1RKW A;  4X6A J;  1REP C;  2FOW A;  2IJL A;  1QO0 D;  1JGG A;  2CYY A;  4KN4 X;  2Y0S A;  3KYC B;  1KQ8 A;  3R0A A;  2GM4 A;  2HKX A;  3H1C A;  3S15 J;  3JRE A;  4B48 A;  3GTL J;  2EV6 A;  2FML A;  3KP2 A;  2HZT A;  3REO A;  3DKW A;  3IWZ A;  1Z3Y A;  4M9S A;  4XLC A;  3GXO A;  3SZT A;  3HKZ A;  4BUP A;  3WGG A;  4XR6 A;  2NS0 A;  3CLO A;  4QSH A;  1NG6 A;  3SXY A;  3ZOB A;  2BY3 A;  1TL8 A;  3ZQL A;  3OOU A;  3TKY A;  3CP2 A;  5GAG J;  4IO9 F;  2LD5 A;  1X4P A;  5JLW A;  3L2Q A;  1YIT I;  5E8G A;  2EZK A;  2ZXW H;  4CCK A;  1K83 J;  1A04 A;  1LEB A;  3I0T A;  2PJR B;  1BIA A;  2Z5U A;  2VBY A;  3DEU A;  1S9H A;  2KIM A;  3IV5 A;  4CCM A;  1VQ4 I;  4M6Y A;  3K7A J;  5ED4 A;  2IS1 A;  3E1S A;  2ZB9 A;  1J7K A;  2R5Y B;  3ONQ A;  4LOC A;  3OYN A;  2M34 A;  2HXO A;  3BR5 A;  4RGX A;  1IRG A;  3CJQ B;  3EUH C;  2D45 A;  3KFW X;  5A2Q Z;  3S1N J;  1ORK A;  2NOG A;  1Q1H A;  2ZFW A;  3ABU A;  1R1U A;  2R7R A;  3F8C A;  4C2U A;  1LVK A;  1D1C A;  2QBY A;  2RRE A;  2VKE A;  2XRO A;  2ECB A;  2ZNY A;  1LNW A;  2E2I J;  2ZJ2 A;  4RMN A;  1PUF A;  3F6O A;  2FU4 A;  3OYH A;  1V4R A;  1TWF J;  2W1O A;  2FBH A;  3HTS B;  2VJI A;  2ELK A;  2RV8 A;  4D5F A;  1KU3 A;  3GTP J;  2RGV A;  2XGE A;  3PQJ A;  4XLP F;  4LLN A;  3MVP A;  2IA1 A;  4I2O A;  3BRO A;  3BT9 A;  1XSD A;  2NXN B;  2EFO A;  3WTZ A;  2QSF X;  3ML6 A;  2DFI A;  4E7H A;  3ECH A;  2ELJ A;  2FMY A;  2AS5 F;  4NB5 A;  3RQI A;  2L3D A;  2FSW A;  1S72 I;  1ETX A;  1R1T A;  2R7U A;  1MMG A;  3H3U A;  2IS2 A;  2ESN A;  2Q2E A;  3WHB A;  5C4J J;  3CO6 C;  3FHN A;  3R61 A;  4BE0 A;  1MDM A;  1OR7 C;  1UHM A;  5K7Z A;  4AYB N;  3HTU A;  1F1Z A;  4AD9 A;  3F9K A;  3LSM A;  5C3E J;  2Z33 A;  1IC8 A;  3G1O A;  3JTG A;  1K4T A;  2HQR A;  1WHU A;  1LVA A;  2I8D A;  3IKV A;  3FK7 A;  2FQ3 A;  3PNY A;  3H0D A;  4NUB A;  4OIO F;  2BEO A;  2DT7 B;  3K10 A;  4LD5 A;  1R71 A;  4UY8 I;  3GZ5 A;  1TP4 A;  5D6E A;  1T0F C;  1S29 A;  1ETO A;  4XMY A;  3I4P A;  3DFG A;  2M7B A;  3QYE A;  1G3T A;  2DA5 A;  1RC9 A;  2BY2 A;  1WPK A;  4FIS A;  3IP4 B;  2K9L A;  3C18 A;  4B3X A;  3QOD A;  3FX3 A;  1RR8 C;  2V9P A;  4ETS A;  1OCZ H;  1D8K A;  2GIV A;  1D0Y A;  1R58 A;  1YYV A;  4OAY A;  2LKS A;  3LA3 A;  4RLQ A;  1B1B A;  2ZJP F;  3OR1 C;  4DQ2 A;  4I09 A;  3FXK A;  2IGN A;  1OPC A;  3WTT C;  4ZDP A;  1IRF A;  1U8B A;  2A05 A;  1T39 A;  1S8N A;  2V79 A;  4LLG F;  4BAC A;  2Y2Z A;  2R7Z J;  2P0W A;  4X1E A;  3KEO A;  4BJ6 C;  2E36 A;  3CLQ A;  2EA2 A;  2KZG A;  4HW0 A;  5GAD J;  3FMS A;  2DT6 A;  5FRO A;  5BOX A;  2X48 A;  2CG4 A;  3G1L A;  2M0M A;  4IJA A;  3Q5F A;  4WXC A;  3HGY A;  3DKX A;  2Y30 A;  4RM2 A;  2R92 J;  4ASN A;  4F55 A;  2XGC A;  1R7J A;  5J8F A;  3CCM I;  2WB1 A;  2VOD A;  2QVO A;  4PJM A;  4CHU A;  1IN5 A;  1I27 A;  2FNP A;  5EZH A;  3VOD A;  3L00 A;  2CQX A;  3HOX J;  5FRN A;  4FCY A;  2LF7 A;  4NHJ A;  4AUX A;  2ZJQ F;  2XHK A;  1RR7 A;  1Z67 A;  1MBH A;  4BQQ A;  3TP0 A;  1W7P D;  4IHW A;  1Z6T A;  4W97 A;  1H0M A;  1WVR A;  2Q1Z B;  2LRE A;  1O7F A;  1XDU A;  4M3F A;  4IEJ A;  1I3A A;  3OIP A;  1XB4 A;  1DDN A;  1ZLK A;  1HDD C;  1SD4 A;  5DYM A;  2GOM A;  2P7V B;  1YS7 A;  1HA8 A;  5DS9 A;  1R5H A;  3HRT A;  4CCJ A;  2BVL A;  1XC5 A;  2E34 A;  3TGN A;  1WRJ A;  2GA2 A;  3IAS 2;  3EET A;  1X3W B;  2OZU A;  1P6R A;  1LB2 A;  2O9L A;  3W6J B;  3V7C A;  4UUV A;  3W2A A;  2LBF B;  3SFI A;  4U88 A;  5ILV A;  2V26 A;  2KRH A;  4Y7N J;  5IYC J;  4V19 K;  2CH0 A;  5FLX K;  3KYD B;  4V2F A;  1AOY A;  4WXD A;  1DGW Y;  2OJE D;  3LMM A;  4A3I J;  2ZCW A;  3BZC A;  1P9Q C;  2RKH A;  2CUE A;  4UB8 C;  2MC4 A;  5CJ9 A;  2AXT C;  3M8F A;  2VI6 A;  3CTA A;  1IAW A;  1ACI A;  3MKW B;  1MJB A;  1Q1V A;  3L2V A;  2MLK A;  1VQL I;  2QSG X;  2R5Z B;  3MMY B;  1GDT A;  2VJJ A;  2EFW A;  1SFU A;  4HNU A;  2FQ4 A;  1JKO C;  3KYL A;  3OYD A;  3ZMZ A;  4BE1 A;  3CCE I;  4D9J A;  2M87 A;  3HRU A;  5J1R A;  2M8E A;  3FXO A;  1FP2 A;  2FRH A;  3AG4 H;  4AC0 A;  2F4O B;  1VF9 A;  5TJJ A;  3M4O J;  3CDL A;  4BHB A;  2HZD A;  3DF8 A;  1HOM A;  3N97 A;  5DCM B;  5E3N A;  3A01 A;  2WBM A;  3NAU A;  4WXH A;  3SQN A;  3OY9 A;  3TOA A;  5B1A H;  4EM0 B;  3S8P A;  4M3E A;  3JRA A;  2UXX A;  2YX4 A;  5KNL A;  4WX9 A;  3WU0 A;  5B1B H;  2W7N A;  3CME I;  1SD7 A;  3RQ4 A;  2VKV A;  2E5Z A;  4MO7 A;  4PJJ A;  1JE8 A;  2OTJ I;  2JSC A;  1N77 A;  1V5G A;  3BDD A;  4E6K G;  3MKY B;  2NNY A;  3TDU C;  3WGH A;  1T2K A;  2RNJ A;  1U5T A;  3K70 D;  4BNC A;  3CF2 A;  2C6Y A;  1Z77 A;  2JT1 A;  2WY8 Q;  3LSR A;  3I4N J;  1Y39 A;  2TCT A;  1OKR A;  2QF7 A;  3I59 A;  1DUX C;  4U0Y A;  1NK2 P;  1Z91 A;  4ENK A;  1HKT A;  3FXJ A;  1RZ4 A;  2Y75 A;  4RGU A;  1MJA A;  4BY7 J;  1MBE A;  5GTH C;  3MAJ A;  4A3D J;  2DA6 A;  2HTS A;  1BI1 A;  2Y0M A;  4ENJ A;  4BEH A;  1O7L A;  3H5A A;  3TOB A;  1OYW A;  2DYS H;  2ETH A;  1D0X A;  2ZBK A;  2K86 A;  3I4M J;  4LK0 F;  2X1D A;  3ZCO A;  1MND A;  1XGM A;  3GW2 A;  2CFX A;  5F0F A;  2DA3 A;  4BH9 A;  1XS9 A;  2RN7 A;  3KE2 A;  5AIP A;  1BOA A;  3PIO F;  4CZC A;  3CC7 I;  4A93 J;  2CWE A;  3CQZ J;  2P6S A;  3G2B A;  3JCU C;  1W7P B;  4A3L J;  2RVC A;  3GX4 X;  1G59 A;  4FET A;  4IXA A;  1UCR A;  5IYD J;  1FBU A;  1JXS A;  3BP8 A;  5LGT A;  2EV0 A;  2NVQ J;  1FBS A;  2P7C B;  1NG7 A;  2VE8 A;  4U7D A;  1ETV A;  3TMO A;  3OR2 C;  3BPX A;  2ZME A;  1T08 B;  3LA2 A;  2ZC2 A;  4D5C A;  5J47 A;  2IRF G;  2QCO A;  4A3G J;  2R7S A;  4M72 A;  1T33 A;  3I58 A;  1B8I A;  3IUO A;  1B9M A;  1YIJ I;  5HNH A;  3KP7 A;  3OS1 A;  2ISY A;  5J3L A;  1SFK A;  4JX5 A;  4AID A;  1WGX A;  1HBX G;  2HVQ A;  4AIJ A;  5C4X J;  3JRC A;  5F0C A;  1DU0 A;  3CJT B;  4DZJ A;  2LFB A;  4N9H A;  4BS9 A;  3BR6 A;  2DPU A;  2KJC A;  4S04 A;  1XCB A;  1ODD A;  4CH7 A;  5J6X A;  4ZTJ A;  2G7H A;  2BV6 A;  3M9A A;  1H89 C;  4BQO A;  5IT9 Z;  1Z6R A;  2H6B A;  1I5Z A;  3I5U A;  4J19 A;  2W82 A;  1F4K A;  2V9K A;  3T8T A;  5HOD A;  2E7X A;  1HSJ A;  3PNT A;  5CVU A;  5FKL A;  3VOE A;  3WTW C;  4F91 B;  2PI0 A;  1K7A A;  4ZZL A;  2W4S A;  2Y9Y A;  4M9Z A;  2GOX B;  2OF7 A;  1WKM A;  2HKO A;  3RCO A;  1FYK A;  2ZFU A;  3LFU A;  4R1H A;  4YG2 F;  4ENM A;  5D4S A;  2DPD A;  3SDB A;  1LEA A;  1S5L C;  2ZXI A;  1F5T A;  4IHS A;  4BGD A;  3TBI A;  4GO1 A;  1TZL A;  1JKP C;  2XAF A;  3HIF A;  1ZGJ A;  2MFZ A;  1JHH A;  2LKX A;  4HA8 A;  5H20 A;  2GWR A;  1Y56 A;  2O5R A;  2B0L A;  1SFX A;  5HLG A;  2M5W A;  1Y1W J;  3BPV A;  1YHQ I;  3AL0 C;  1I3Q J;  4A0Y A;  3J80 Z;  3Q3S A;  2ISZ A;  1KQ0 A;  3TQN A;  1ETW A;  1TW2 A;  2GAU A;  1QHG A;  4LJZ F;  1OQY A;  4PZJ A;  4C2T A;  3OWT A;  2EBI A;  3J7Y J;  2X6W A;  5IP9 J;  4WWC A;  3CCS I;  2YU9 J;  3I9V 2;  2M45 A;  3QPH A;  1MMA A;  3K4J A;  3HOZ J;  1HQC A;  1SAU A;  4DYC A;  3K9T A;  2DA7 A;  2EZH A;  3H0G J;  3U21 A;  3DTE A;  4A3M J;  5KCM A;  2VXD A;  3RKY A;  1GLN A;  2M8G X;  1G3Y A;  3ZMU A;  2QQB A;  4M73 A;  4DNC A;  5EGO A;  3ROU A;  3JW4 A;  2O7O A;  4Q4Z F;  2DN0 A;  2GIZ A;  3FKI J;  4A3J J;  1IZ1 A;  4H0E A;  4S05 A;  1WSU A;  2W48 A;  4OIN F;  1KU2 A;  2YU3 A;  2JZY A;  2AHQ A;  2KHM A;  1P2F A;  2VAS A;  1FC3 A;  4JBA A;  1O4X A;  3QQA A;  2NYX A;  1SEU A;  3G71 I;  5ICF A;  4CYC B;  3KET A;  1IXC A;  2QKL B;  1X2M A;  3O3K A;  3OL3 A;  1BR4 A;  2HEO A;  1A36 A;  2TRT A;  2O3F A;  4AWX B;  5IOY A;  3ZGK A;  1STZ A;  1PJR A;  1SFE A;  2NS7 A;  3V7S A;  4AIH A;  4BBR J;  1KU9 A;  5H2F C;  2OPT A;  4XK4 A;  1NTC A;  4HDU A;  2QUF A;  1M1E B;  2MC3 A;  3K4K A;  4GYI A;  3RYP A;  1XMX A;  2YPR A;  1R6R A;  4HX7 A;  2CW0 F;  4DW6 A;  3I3L A;  5ICG A;  1CF7 A;  3PUB A;  2BYV E;  1VQP I;  1I50 J;  4MQ9 F;  2E19 A;  1R23 A;  4Q5S F;  1AWC A;  2E7W A;  2FE3 A;  2DA4 A;  2AQE A;  4CXF A;  1UJ8 A;  1RI7 A;  2R7V A;  5HS9 A;  4IX7 A;  4YIF A;  4O5V A;  2V1N A;  2H1L A;  1D0Z A;  4EVI A;  1K6Y A;  3Q0U A;  1AHD P;  1WZ2 A;  4GYG A;  5E3M A;  4YFN F;  4LB6 B;  1BJA A;  1POG A;  4DBQ A;  4XSX F;  1TWH J;  3PFI A;  4PSX A;  2X6X A;  1Z3X A;  4MFE A;  2Y48 A;  1AKH B;  3PSF A;  5CPR B;  5F27 A;  3TW7 A;  2PFB A;  3M1C A;  3MN2 A;  4FT8 A;  3P9C A;  3LA7 A;  3J7Z I;  2EA4 A;  2L9N A;  3JAM Z;  3ULQ B;  3HHG A;  2X0L A;  2VOP A;  3JRD A;  1FY7 A;  3ZXS A;  1MMD A;  4CYD A;  1E0E A;  2QA4 I;  4P96 A;  1LJ9 A;  3V4G A;  1JHF A;  4L5J A;  1LFB A;  2A07 F;  2KZV A;  4ESB A;  3E5U A;  5ICC A;  1GUU A;  2ID6 A;  4I7H A;  2XAS A;  3Q9S A;  2DYR H;  5DUK A;  2MYS A;  2NVX J;  3HUG A;  2A3S A;  1QVU A;  2AQF A;  3BJ6 A;  2VC0 A;  4XKV A;  1TT5 B;  3LQR A;  3PM1 A;  4XRS G;  3HL2 A;  1PVE A;  3GCM A;  2BZT A;  4OU0 A;  2UV1 A;  4XN0 A;  4MEY F;  1WWX A;  4I76 A;  3V7R A;  4N4N B;  4XLE A;  4TV7 A;  2JRT A;  5LD2 C;  2V1D A;  4ZDO A;  1FT9 A;  3BZ6 A;  3GVA A;  4FE4 A;  2K3F A;  4ZJZ A;  3UKG A;  3LQQ A;  3S2H J;  4F7Z A;  3KIO A;  2F5E A;  2DMU A;  1W0U A;  3FM5 A;  2OQR A;  4MTE A;  3OSF A;  1QZE A;  3CCQ I;  1IUF A;  1J09 A;  4EMS A;  3DU5 A;  4YFK F;  4I6Z A;  3RI4 A;  2G0E A;  1NK3 P;  3S2D J;  5DM6 F;  4ESF A;  2VT3 A;  1TNT A;  4S0H B;  4KT6 A;  1KYZ A;  1RUO A;  5HOO A;  3BTL A;  1BBY A;  5GP9 A;  2XAJ A;  3RDI A;  4EEF G;  5LHH A;  3VPR A;  2X85 A;  4NQW B;  4P1W A;  1UHW A;  5L3C A;  3JSO A;  4AM3 A;  3A02 A;  4MLO A;  1YX3 A;  5TRD A;  4IL6 C;  2ZXJ A;  1J5Y A;  4FX4 A;  1YTY A;  1EH8 A;  4C2M J;  2QZ8 A;  3QWL A;  2FNA A;  1KU7 A;  4B8X A;  4HBL A;  4EQQ A;  3NAR A;  6PAX A;  4D0P A;  4QTR A;  2L9R A;  5E18 F;  1R5I D;  3V42 A;  3E6D A;  4ZYG A;  3QPS A;  2HYG D;  2EFP A;  5HS8 A;  5KVR A;  3H35 A;  4E7S A;  4Q47 A;  1LDD A;  4KDP A;  3LSJ A;  3FHZ A;  3HOT A;  3OYK A;  1TWC J;  1DGR M;  1WJF A;  1FYM A;  1FBQ A;  5LHI A;  3EDP A;  1X1D A;  1NH3 A;  1FJL A;  5L3G A;  3BJA A;  2E1C A;  1ZGA A;  3CF5 F;  4GGG A;  1WQ2 A;  3ERE D;  5HDN A;  3CES A;  1WH7 A;  4UUT A;  3WTV C;  3QP6 A;  4FQG A;  4PFO A;  1CGP A;  2DTR A;  2GQQ A;  3TW6 A;  3BQY A;  4ZZD A;  1G4D A;  2ECC A;  2PX9 A;  3G3Z A;  2HS5 A;  2X6O A;  3HYI A;  1A35 A;  4H4K C;  1PUE E;  1QZZ A;  3OIO A;  3KLO A;  2LF8 A;  3PQK A;  1Z1D A;  3KLN A;  4XSZ F;  1FTZ A;  3J81 K;  4BHC A;  1TT0 A;  5EF6 A;  4BDY A;  1QU3 A;  4YIR X;  4PGG A;  2M2E A;  4CGZ A;  1GV2 A;  1PDN C;  3K1M A;  4JK1 X;  3S32 A;  4LG0 A;  2VOO A;  3DBR B;  1XTA A;  1O3T A;  3IWF A;  3LSI A;  5LEK A;  4HQM A;  4KIC A;  2GZW A;  1IV6 A;  4WCG A;  4B47 A;  4L0Y B;  3UR3 C;  2LP0 A;  2DK5 A;  5AON A;  3CC2 I;  4HNT A;  2XAU A;  2CW7 A;  1USS A;  1HCR A;  4OOI A;  1JTX A;  1TQP A;  1YOV B;  2K9S A;  3S17 J;  3DWL E;  2FA5 A;  3NWT A;  3FBN B;  5HNF A;  5JFR A;  1P4W A;  3VYR B;  3S2W A;  4G94 A;  2XGX A;  4LG3 A;  4ZYA A;  2X1E A;  2JTV A;  1SD6 A;  3LFK A;  4G7H F;  3GTK J;  2DFE A;  4PUS A;  2NNN A;  3HDD A;  4I99 C;  5FD6 A;  4E7Z A;  5J1Y A;  2OA4 A;  1X2N A;  1KYW A;  4L9V A;  1VQ5 I;  2PJP A;  1ETY A;  3HOS A;  2JQ7 A;  1WJB A;  1LFP A;  5B3S H;  1VQ7 I;  3GUD A;  3K4L A;  3DXJ F;  1ULY A;  4UXN A;  1OCP A;  5GTI C;  4A12 A;  4KUM A;  4QWQ A;  1YFH A;  4BXF A;  1YLF A;  1V5F A;  1K78 A;  1W4M A;  1Y8R B;  1OJL A;  2XPV A;  3FWE A;  5E20 A;  1BR2 A;  2DMN A;  1IG7 A;  3WG7 H;  2TDX A;  3K69 A;  3ZQC A;  2R7W A;  2RQP A;  4JP0 A;  2CUZ A;  2L7Z A;  4YII A;  1ENH A;  2NRA C;  4NBQ A;  2XPU A;  2DQL A;  1KON A;  3DPU A;  3CMM A;  2DJN A;  2EJR A;  2VUM J;  4HF2 A;  1E3P A;  2EPF A;  2KMU A;  4O6J A;  1BI0 A;  4NC6 A;  2EIJ H;  1VQM I;  2K5C A;  2XVC A;  2K4J A;  2ME0 A;  5CVI A;  1ZRC A;  4D7N A;  2QBY B;  2FBI A;  3QPT A;  1XMK A;  5LGU A;  2X6Y A;  4RB0 A;  2NVY J;  4AVZ A;  1K6O A;  5FKN A;  1RUN A;  2HYJ A;  4L0Z B;  1MSE C;  3U1D A;  1PUF B;  4BJT A;  1EA3 A;  2M1B A;  2HQN A;  4XON A;  1J9I A;  2VN2 A;  3BG6 A;  2HOA A;  3MCZ A;  2EZI A;  2QEX I;  3NRV A;  2M3A A;  1YG2 A;  3BG7 A;  5JR3 A;  3W6V A;  3OS0 A;  4FTH A;  2O8X A;  4P9U A;  5BPD A;  3O6B B;  1PYV A;  4HNV A;  2CUF A;  5FO5 A;  1A6I A;  2IGM A;  2VKH A;  1LDJ A;  1T98 A;  1ZQ3 P;  4PJ0 C;  4BY1 J;  4PSW A;  2P6T A;  1SAX A;  2JUC A;  2IP2 A;  2KRC A;  1QVT A;  2PEX A;  3TP3 A;  4A3K J;  2Q2E B;  1E3H A;  3HC7 A;  5F0H A;  1BW6 A;  4B43 A;  3FXL A;  1XGS A;  3ECO A;  2W25 A;  1MDM B;  3D1N I;  1R4M B;  3I64 A;  4MQV A;  4EJO A;  1G3W A;  2DW4 A;  3PIP F;  4L18 B;  3B02 A;  4XOR A;  1U5T C;  4A6E A;  3LNQ A;  3R6S A;  2I5U A;  4RLF A;  4BU2 A;  4XID A;  3F8F A;  1MGT A;  2M30 A;  3HG9 A;  1RET A;  2E35 A;  3WE2 A;  1O57 A;  1OR7 A;  2IPQ X;  2BBY A;  4AYB A;  2ZO4 A;  4C30 A;  1WJE A;  3ISP A;  1IN7 A;  2HTJ A;  4IHV A;  1ZHF A;  1XGO A;  3T1B A;  3OL4 A;  2EV5 A;  4R8H A;  3LAP A;  1J75 A;  2OAZ A;  3CZ6 A;  3FMQ A;  2ZJR F;  1JUP A;  2V1X A;  4HV6 A;  3CCU I;  3EUA A;  1SMY F;  1UFM A;  4EM2 A;  5LGN A;  3OYL A;  4Y13 A;  4OMZ A;  5KAI C;  1ZRE A;  2Z16 A;  1J0R A;  1IW7 F;  2JA6 J;  4IZZ A;  5HVQ C;  2VC1 A;  1TNS A;  1ZRD A;  1R36 A;  2VIX A;  5E1Z B;  1XGN A;  1T6S A;  4XRS A;  2JPB A;  1BW5 A;  2P5V A;  5DD8 A;  1X3U A;  2ZSH B;  3FK6 A;  3CC4 I;  4A3C J;  4B44 A;  3K70 C;  5GAH J;  1EF4 A;  3CCV I;  4WF2 A;  1FOW A;  4KNY A;  5ILU A;  3E5X A;  4BQN A;  3L1P A;  4Y3O A;  2XPW A;  5KHD A;  4ZH4 F;  3E0J B;  2PN6 A;  3ZN0 A;  4OWR B;  4II2 A;  3KZY A;  4A3B J;  2CFO A;  2QQA A;  1PP7 U;  3UNG C;  2VBX A;  2A69 F;  3S14 J;  2QEN A;  1BM9 A;  2JA2 A;  4RBO A;  2JN6 A;  3SYT A;  3OYF A;  3S1R J;  2K9N A;  3HM5 A;  5HDK A;  4A3F J;  1QBJ A;  2IXS A;  3H9Q A;  5BQT A;  2XRN A;  5K7H A;  4L5E A;  3F23 A;  3AKZ A;  4LMY A;  1FX7 A;  5JVG F;  4M9X A;  5B5E C;  1V5E A;  1B6A A;  2GBY A;  1V3F A;  2QWW A;  1BI3 A;  2CV0 A;  1FSH A;  1UEL B;  4UUS B;  3KX2 A;  3W6K B;  1FIA A;  2ICW G;  2DFH A;  2K85 A;  5FJ8 J;  4KMU X;  2DOF A;  1TQM A;  5KAF C;  2EIK H;  4EV0 A;  1OMI A;  2XRL A;  3KCC A;  2RNG A;  4JQF A;  4OIR F;  2MD0 A;  3I55 I;  3VSL A;  4M6X A;  5B66 C;  4BE2 A;  2VJ5 A;  1H9T A;  4B4C A;  1HKS A;  2W85 A;  3BJO A;  3S3N A;  4KIS A;  4CCN A;  2A61 A;  2L0K A;  4FX0 A;  3T8R A;  2MG4 A;  1YJN I;  2LY2 A;  1TBX A;  2MGQ A;  1IGN A;  2XB5 A;  3E5Q A;  2JUG A;  4MEX F;  4XOP A;  2BXY A;  4RAY A;  4G6Q A;  5ERI A;  1BIB A;  3CO7 C;  5F1J A;  1G6N A;  3P9I A;  5JHF A;  2P81 A;  1I6X A;  1N25 A;  4YEJ A;  1FMV A;  2XKP A;  4PDK A;  1CQT A;  1MMS A;  3JRF A;  2R3S A;  4MFD A;  4IQ4 A;  3VSK A;  1MBG A;  1GXP A;  1QRY A;  2BW3 A;  4RS8 A;  1A31 A;  1MKM A;  2YSR A;  4RAF A;  5D5X B;  5H6Q A;  4BXU A;  5M3M J;  3GFM A;  1V54 H;  1VFC A;  3HRM A;  4XKB A;  3OYE A;  2EIL H;  2ZKZ A;  3M3Y J;  2W84 A;  1A6Q A;  4XRF A;  4Z6Y A;  4E70 A;  2O03 A;  1ETQ A;  3MZH A;  4EGZ A;  2E1M C;  3WE3 A;  1U3E M;  3J7A O;  2HDC A;  2OUM A;  3HPH A;  2A6H F;  4MHG A;  3A01 B;  2F4M B;  2R93 J;  4KYW A;  3H3Z A;  5H6R A;  4D7M A;  3QAH A;  4E7K A;  3HGG A;  2VQG A;  3O2P E;  2M4K A;  2XB0 X;  2NOJ B;  1R4N B;  2RAE A;  2LRD A;  5HLI A;  1ZG3 A;  5F6F A;  2GXG A;  3GO5 A;  4CIC A;  2IGK A;  5EEA A;  2Z2S B;  3BOQ A;  4HX8 A;  1U5T B;  3MFK A;  3BR1 A;  1ETK A;  3H5N A;  3KEY A;  3DLL F;  3ZMV A;  3KP4 A;  1W1W E;  3F8N A;  5DV5 A;  2IW5 A;  5L3B A;  1UZC A;  2NVT J;  2DI3 A;  3M7G A;  2E2H J;  4GDF A;  2CV2 A;  3I59 B;  2CS3 A;  1XG1 A;  5CYV A;  3JSP A;  1K4S A;  1ZLJ A;  4ZYH A;  2Z3Y A;  3SHF A;  1Z7L A;  1K61 A;  2LSO A;  2VE9 A;  4JOM A;  2P5K A;  5D5U B;  1B72 A;  5LRR A;  5GPC A;  3TDZ C;  1QHH D;  1P7I A;  1FLI A;  2WV1 A;  1BN5 A;  2H6C A;  3FXM A;  4BEH B;  1JUS A;  5DDG A;  3RKX A;  3MEX A;  2F2E A;  2JVG A;  2HDD A;  1YW9 A;  3ABM H;  3AG1 H;  5M5X J;  1P4X A;  2QQ8 A;  3EPZ A;  2CUJ A;  3SFZ A;  3HOY J;  4IQJ A;  1DQU A;  2KRF A;  1S7A A;  1J59 A;  4IHX A;  2LNB A;  1EH7 A;  2L7F P;  4G9Y A;  3H5R A;  3CUQ A;  2DTZ A;  3CMY A;  4RAZ A;  3BR3 A;  3P7N A;  4C9Y A;  3F0C A;  1D5V A;  3IH3 A;  4PGH A;  2VB6 A;  1JT0 A;  2BOL A;  2F5V A;  2HNH A;  1WJ5 A;  1ZR4 A;  3M8J A;  1S6L A;  5F64 A;  5KK1 A;  4KIB A;  4MTD A;  1IDY A;  2WV0 A;  5A2Q K;  1F9N A;  1I1S A;  2MH9 A;  3DLA A;  1GT0 C;  1B8I B;  5E17 F;  3S1Q J;  1U78 A;  3ESW B;  5E79 C;  4E7I A;  2VBW A;  3SEZ A;  1DU6 A;  2FJ1 A;  3IL2 A;  3K2Z A;  4DOZ A;  1DP7 P;  2OQG A;  2XF7 A;  4XOT A;  5K7F A;  1X19 A;  2X4H A;  1JGS A;  1ZGW A;  4RAG A;  5LHG A;  5EG0 A;  2K02 A;  2PLY A;  4OMY A;  4N4O B;  2K9Q A;  3E6C C;  3F21 A;  4PCQ A;  1LFU P;  4KA4 A;  1WI9 A;  5DEQ A;  2A6T A;  2IGO A;  1FSE A;  5FLX Z;  2VQL A;  1GV5 A;  3CMA I;  2CV1 A;  4N0B A;  5EYR A;  3PL8 A;  5FFZ A;  4A5M A;  4RB3 C;  4C3J J;  2HR3 A;  3EQL F;  4CUG A;  3F8B A;  3PJR A;  4NC7 A;  2M0C A;  4CA0 A;  2DOA A;  4HDV A;  1I39 A;  2K40 A;  5BNG A;  4F93 B;  3TED A;  2BGC A;  5E3O A;  1A5J A;  3H92 A;  1RKT A;  1ZRF A;  2NAZ A;  1XMA A;  2OCE A;  2F6C A;  3F8M A;  1U8R A;  3BTJ A;  5CQE A;  3RPU A;  2EIN H;  4PK4 A;  3ZMT A;  1LE8 A;  4RDU A;  1FOY A;  1TWG J;  2EIM H;  3KP6 A;  1XSV A;  3L2U A;  4EJW A;  2H1K A;  5FKM A;  1IXR C;  4OIP F;  3R60 A;  2EFN A;  2HI3 A;  4RGS A;  2H8W A;  2XSJ C;  1XPX A;  4XKW A;  2WAF A;  5BS6 A;  2L4A A;  4LGW A;  2KDO A;  2MW8 A;  2WWY A;  4D1Q A;  3KP3 A;  3GFL A;  4BAY A;  3DP7 A;  1ZR2 A;  1DPR A;  2XDV A;  3SEQ A;  3P5J A;  2R0Q C;  2D2W A;  3OIQ A;  3QRF F;  1SFO J;  1HXD A;  4BKX A;  2E60 A;  3HSF A;  1BR1 A;  2Y9Z A;  1OCC H;  3WTY C;  3IH2 A;  3IRQ A;  3RZD J;  5FLV A;  2V9V A;  3A03 A;  4A0Z A;  1R1V A;  4HX4 A;  2OU2 A;  2VKD A;  1IF1 A;  2E1M B;  1GXQ A;  1ZK8 A;  3HKZ N;  3WGI A;  3CCJ I;  1VQO I;  4IOC F;  3GLL A;  2YUS A;  1ZYR F;  4F52 A;  5EGO B;  2MD5 A;  2GXA A;  1RNL A;  2JPC A;  5J8C A;  1FYL A;  4GFB A;  4XQF A;  5K5O A;  3CP8 A;  3HB9 A;  3LST A; 
#chains in the Genus database with same CATH homology
 2XKO A;  1UB9 A;  1IN6 A;  2DO7 A;  4ZYD A;  3T5X A;  1Z7U A;  3HSE A;  3ELK A;  4A5N A;  1HST A;  3OV8 A;  3B73 A;  1FWZ A;  5D8L B;  4KIF A;  2QYO A;  4RGR A;  3HRS A;  3IC7 A;  3TO7 A;  3L9F A;  1FNN A;  3D5L A;  4ESJ A;  2L54 A;  1XDS A;  2IA0 A;  3EYY A;  3F6V A;  1CF7 B;  3V8L A;  3F22 A;  1YQA A;  1HW5 A;  4BHP A;  5LLQ A;  3RJP A;  3JTH A;  1ONV A;  3L09 A;  1C0W A;  2K4B A;  3R4K A;  2FXA A;  3QU6 A;  3GFI A;  2ACJ A;  2CO5 A;  2VBZ A;  1BI2 A;  3RIR A;  3VEP A;  4HQE A;  4M74 A;  4HAM A;  2CQK A;  2QM3 A;  1FPQ A;  5DCF A;  3CDH A;  2UXN A;  2FEZ A;  1LQ1 A;  1GVJ A;  5CVV A;  1NHA A;  4IPA A;  3FMR A;  4UV8 A;  4A6D A;  4L5I A;  1P92 A;  3ZPL A;  2P5L C;  4RB1 A;  2IT0 A;  4I0A A;  1Y0U A;  1B9N A;  4HOB A;  2J5P A;  3MQ0 A;  3C7J A;  4KN7 X;  3ZP5 A;  5L3E A;  1PP8 F;  3WU1 B;  4LK1 F;  4BQA A;  4LLL A;  1TW3 A;  2ADU A;  3F3X A;  3RTR A;  3QU3 A;  5ILS A;  2G7U A;  3ZN1 A;  3IRR A;  2D1V A;  4P9F A;  1S3J A;  1MZB A;  2FOK A;  1R00 A;  2IA2 A;  4ENN A;  3KEQ A;  1EH6 A;  3GLX A;  3D0S A;  3G73 A;  2R7D A;  1IN8 A;  5DUI A;  1L0O C;  4ZYE A;  5LRS A;  2KJB A;  4Y17 A;  1O3S A;  5HS7 A;  4RB2 C;  4UNO A;  5DD4 A;  3LAJ A;  4ON0 A;  3DQV C;  3MZY A;  1T38 A;  1GHC A;  1IN4 A;  1QZY A;  3I53 A;  4AIK A;  1BC8 C;  4LFU A;  3U2R A;  2G9W A;  4HV5 A;  1G3S A;  1P4A A;  2MBF A;  2EWN A;  5JHU A;  2F5D A;  2HFH A;  1KA8 A;  3GEZ A;  2FF4 A;  1YO5 C;  3RKW A;  4EJT A;  4R79 A;  4YFX F;  3KP5 A;  2OD5 A;  1VTN C;  2XUB A;  2GXB A;  2Q8K A;  1OYY A;  5CVJ A;  1ZAO A;  5IT9 K;  4QLC U;  4LG0 B;  4FHT A;  5CLS A;  3EUH A;  2DBB A;  3K1N A;  2CSO A;  3N4M A;  2HWV A;  2P4W A;  2GA1 A;  3BY6 A;  3ABT A;  2KIF A;  2K7L A;  5D6F A;  3CJN A;  2YR2 A;  1XCV A;  2UZK A;  1OYI A;  4Q48 A;  4N9I A;  3E97 A;  1R22 A;  1ZG1 A;  2RDP A;  2O6G E;  5DCM A;  1ON2 A;  2XIG A;  5K5Q A;  4UHT A;  1BC7 C;  4B09 A;  2LKP A;  1U6G A;  3J80 K;  2D1H A;  2L4M A;  1K78 B;  2OZ6 A;  4HLY A;  1B4A A;  2STW A;  2KKO A;  3LWF A;  3KZZ A;  3F72 A;  2EK5 A;  3E3V A;  3FXQ A;  2A6E F;  3M1E A;  3BWG A;  2H09 A;  5IT3 A;  2ZNZ A;  1T0F A;  3FXR A;  2A5Y B;  3GWZ A;  2STT A;  4HZF A;  4KFC A;  3CUO A;  3AAF A;  4IVN A;  3WTX C;  2ESH A;  2DLL A;  5FFX A;  1K79 A;  2OBP A;  1FOK A;  1RIO H;  1W7P A;  2L02 A;  4CDG A;  2DAO A;  2XV4 S;  1D3Y A;  1EV7 A;  1ZH5 A;  2FBK A;  1FZP B;  4G7Z F;  2QQ9 A;  4L9J A;  1B59 A;  3V8J A;  1I1G A;  5ICE A;  2P8T A;  4AVP A;  3VFZ A;  2MH2 A;  2YX7 A;  5D5W B;  1LDK B;  2MLG A;  5L3D A;  4CO8 A;  3V8K A;  3J81 Z;  1HW2 A;  3JAM K;  3DPL C;  4K2E A;  3IHU A;  4IRH A;  4UVC A;  2HOE A;  4IHT A;  2R7F A;  5L3F A;  4G7O F;  5LEJ A;  4I02 A;  3K0L A;  5HDG A;  4U0V A;  4CZZ A;  2VON A;  5EEG A;  3FM3 A;  4LB5 A;  3DV8 A;  4EJU A;  3EYI A;  4UVA A;  3CUQ C;  2MA3 A;  3RPQ A;  3COA C;  3M8E A;  2V6C A;  1H9G A;  2K27 A;  3HHH A;  1YW8 A;  2WTE A;  3DPT A;  1HKQ A;  2LDU A;  4P5O A;  3T0Y A;  3WTS C;  2Q0O A;  2A68 F;  2PG4 A;  1J2X A;  2IVM A;  4EJV A;  1TTY A;  1U2W A;  3WOD F;  1Z9C A;  3ZMD A;  1IUY A;  1YS6 A;  2E1N A;  2H94 A;  2HGC A;  1XN7 A;  3L7W A;  4G8X A;  1IXS B;  2H27 A;  3C3W A;  2HYF A;  1W5S A;  2EFQ A;  5FD5 A;  3WTU C;  1D8J A;  2BE5 F;  1DPU A;  1S7O A;  5D4R A;  5K1Y A;  1HW1 A;  4U0W A;  5BMZ A;  4A0X A;  3FZV A;  4UVB A;  2DU9 A;  1ZN2 A;  2O61 A;  2COM A;  5CVR A;  2PMU A;  4P55 A;  2CGP A;  1YIO A;  5D5V B;  2DQR A;  2KIU A;  1QNT A;  4HYE A;  4HF0 A;  4BYY A;  4MNU A;  1KQ9 A;  4IRI A;  2QLZ A;  1ON1 A;  1MJ9 A;  4I0B A;  4Z2Y A;  2PMH A;  3L2C A;  2ZME B;  3ZQ7 A;  1KGS A;  3P9K A;  4L9T A;  4L9N A;  3NEU A;  3VB2 A;  5JI6 A;  3R0J A;  4Y15 A;  1YW7 A;  1FP1 D;  1TLH B;  3GFJ A;  2VT2 A;  4I01 A;  1QQI A;  1W5T A;  2PQ8 A;  3U9G A;  5E1X A;  1L3L A;  1O3R A;  2VXZ A;  3E6B A;  2DT5 A;  4GXO A;  3TO6 A;  4KMF A;  3C1D A;  4KIG A;  5E8I A;  3SZP A;  5F1R A;  1Z05 A;  2ELH A;  2F5C A;  1QGP A;  4EM1 A;  2J5O A;  3CUQ B;  1UST A;  3Q9V A;  1ZG5 A;  4XBF A;  3E6M A;  1TQI A;  2RC4 A;  5AIQ A;  2F5F A;  4G6D A;  2AXL A;  3QOP A;  1SD5 A;  2XAH A;  3NQO A;  4NQW A;  3MWM A;  1XD7 A;  4UV9 A;  4OIQ F;  1E2X A;  1MD0 A;  2XAG A;  2EB7 A;  4XLN F;  1R5G A;  2PBI A;  5BPI A;  2O0Y A;  3K1P A;  3OOP A;  2WC2 A;  5FB2 A;  5FGM A;  2W24 A;  1XSX A;  3HSR A;  4M71 A;  4GCV A;  1SMT A;  3QP5 A;  4IF4 A;  5LBQ A;  3FXU A;  2V1U A;  1O3Q A;  1QPM A;  4MGR A;  3ZMS A;  5HLH A;  2Z99 A;  5K5R A;  4A2U A;  2Z9O A;  2L01 A;  3WG9 A;  1ZAR A;  2UWM A;  3TO9 A;  2XAQ A;  3I71 A;  5EEH A;  3IKT A;  2DK8 A;  5D8K B;  2W57 A;  4I98 B;  3GYH X;  3RYR A;  3GZ6 A;  1E17 A;  5E1W A;  3I54 A;  3GF2 A;  4HF1 A;  4U7B A;  3FF5 A;  4WK8 F;  4IRG A;  4O3M A;  5JVT A;  4HLX A;  4EGY A;  4KT5 C;  1REP C;  2IJL A;  1QO0 D;  2CYY A;  4KN4 X;  1KQ8 A;  3R0A A;  2HKX A;  2EV6 A;  2FML A;  3KP2 A;  2HZT A;  3SZT A;  3DKW A;  3IWZ A;  4M9S A;  3REO A;  3GXO A;  3WGG A;  2NS0 A;  3CLO A;  3SXY A;  3TKY A;  5E8G A;  1A04 A;  1LEB A;  3I0T A;  1BIA A;  2Z5U A;  2VBY A;  3DEU A;  2KIM A;  4M6Y A;  5ED4 A;  1J7K A;  4RGX A;  1IRG A;  2D45 A;  3KFW X;  5A2Q Z;  1Q1H A;  2ZFW A;  3ABU A;  1R1U A;  3F8C A;  2QBY A;  2XRO A;  2ZNY A;  1LNW A;  2ZJ2 A;  3F6O A;  2FU4 A;  1V4R A;  2FBH A;  3HTS B;  2RV8 A;  1KU3 A;  2RGV A;  3PQJ A;  4XLP F;  4LLN A;  2IA1 A;  4I2O A;  3BRO A;  1XSD A;  2EFO A;  3WTZ A;  3ML6 A;  2DFI A;  3ECH A;  2FMY A;  2AS5 F;  4NB5 A;  2L3D A;  2FSW A;  1R1T A;  3H3U A;  2ESN A;  2Q2E A;  3CO6 C;  3R61 A;  1MDM A;  1UHM A;  3HTU A;  1F1Z A;  4AD9 A;  2Z33 A;  3JTG A;  2HQR A;  1LVA A;  3IKV A;  2FQ3 A;  4OIO F;  2BEO A;  4LD5 A;  3GZ5 A;  5D6E A;  1S29 A;  3I4P A;  3DFG A;  1G3T A;  3C18 A;  3FX3 A;  4ETS A;  1D8K A;  2GIV A;  1R58 A;  1YYV A;  3LA3 A;  1B1B A;  4DQ2 A;  4I09 A;  3WTT C;  1OPC A;  1IRF A;  1T39 A;  1S8N A;  2V79 A;  4LLG F;  3KEO A;  2EA2 A;  4HW0 A;  3FMS A;  5BOX A;  2CG4 A;  4IJA A;  3Q5F A;  4WXC A;  4ASN A;  1R7J A;  5J8F A;  2VOD A;  2QVO A;  4CHU A;  1IN5 A;  1I27 A;  2FNP A;  3VOD A;  3L00 A;  2LF7 A;  4NHJ A;  2XHK A;  1W7P D;  1Z6T A;  1H0M A;  1O7F A;  1XDU A;  1DDN A;  1XB4 A;  1ZLK A;  1SD4 A;  5DYM A;  2P7V B;  1YS7 A;  1R5H A;  3HRT A;  3TGN A;  1WRJ A;  2GA2 A;  3EET A;  2OZU A;  1P6R A;  1LB2 A;  3W6J B;  3V7C A;  4UUV A;  4U88 A;  5ILV A;  5FLX K;  1AOY A;  4WXD A;  2ZCW A;  2RKH A;  5CJ9 A;  3M8F A;  1IAW A;  3CTA A;  1MJB A;  2MLK A;  1SFU A;  2EFW A;  3ZMZ A;  2M87 A;  3HRU A;  2M8E A;  1FP2 A;  2FRH A;  5TJJ A;  4BHB A;  3DF8 A;  3N97 A;  5DCM B;  4WXH A;  3SQN A;  3TOA A;  4EM0 B;  2UXX A;  2YX4 A;  4WX9 A;  3WU0 A;  1SD7 A;  1JE8 A;  2JSC A;  3BDD A;  2NNY A;  1T2K A;  3TDU C;  3WGH A;  2RNJ A;  1U5T A;  4BNC A;  2C6Y A;  2JT1 A;  1OKR A;  3I59 A;  1DUX C;  4U0Y A;  1Z91 A;  4ENK A;  1HKT A;  1RZ4 A;  2Y75 A;  4RGU A;  1MJA A;  3MAJ A;  2HTS A;  1BI1 A;  2Y0M A;  4ENJ A;  1O7L A;  3TOB A;  1OYW A;  2ETH A;  2ZBK A;  2K86 A;  4LK0 F;  1XGM A;  3GW2 A;  2CFX A;  4BH9 A;  2RN7 A;  3KE2 A;  5AIP A;  1BOA A;  2CWE A;  2P6S A;  1W7P B;  2RVC A;  3GX4 X;  4IXA A;  1UCR A;  1FBU A;  1JXS A;  3BP8 A;  5LGT A;  2EV0 A;  1FBS A;  2P7C B;  2VE8 A;  4U7D A;  3BPX A;  2ZME A;  2IRF G;  3LA2 A;  4M72 A;  3I58 A;  1B9M A;  3KP7 A;  2ISY A;  1HBX G;  4AIJ A;  4N9H A;  2DPU A;  2KJC A;  4S04 A;  1XCB A;  1ODD A;  5J6X A;  2G7H A;  2BV6 A;  3M9A A;  5IT9 Z;  1Z6R A;  2H6B A;  1I5Z A;  3I5U A;  1F4K A;  3T8T A;  2E7X A;  1HSJ A;  5CVU A;  3VOE A;  3WTW C;  2PI0 A;  1K7A A;  4ZZL A;  4M9Z A;  1WKM A;  2HKO A;  1FYK A;  4R1H A;  4YG2 F;  4ENM A;  5D4S A;  2DPD A;  1LEA A;  1F5T A;  4IHS A;  4GO1 A;  2XAF A;  3HIF A;  1ZGJ A;  1JHH A;  4HA8 A;  5H20 A;  2GWR A;  2B0L A;  1SFX A;  5HLG A;  2M5W A;  3BPV A;  4A0Y A;  3J80 Z;  2ISZ A;  1KQ0 A;  3TQN A;  1TW2 A;  2GAU A;  4LJZ F;  4PZJ A;  4WWC A;  2M45 A;  3QPH A;  1HQC A;  3K9T A;  3RKY A;  3ZMU A;  1G3Y A;  2QQB A;  4M73 A;  4DNC A;  3ROU A;  3JW4 A;  4Q4Z F;  1IZ1 A;  4H0E A;  4S05 A;  1WSU A;  4OIN F;  1KU2 A;  2YU3 A;  2JZY A;  1P2F A;  1FC3 A;  4JBA A;  2NYX A;  5ICF A;  3KET A;  1IXC A;  3O3K A;  2HEO A;  4AWX B;  2O3F A;  1STZ A;  4AIH A;  1SFE A;  3V7S A;  1KU9 A;  4HDU A;  2QUF A;  2MC3 A;  4GYI A;  3RYP A;  2YPR A;  4HX7 A;  2CW0 F;  5ICG A;  1CF7 A;  2BYV E;  4MQ9 F;  1R23 A;  4Q5S F;  1AWC A;  2E7W A;  2FE3 A;  4CXF A;  1RI7 A;  5HS9 A;  4YIF A;  4O5V A;  4EVI A;  4GYG A;  4YFN F;  4LB6 B;  1BJA A;  4XSX F;  3PFI A;  2Y48 A;  2PFB A;  4FT8 A;  3P9C A;  3LA7 A;  2EA4 A;  3JAM Z;  3ULQ B;  3HHG A;  2X0L A;  2VOP A;  1FY7 A;  4CYD A;  4P96 A;  1LJ9 A;  3V4G A;  1JHF A;  4L5J A;  2A07 F;  5ICC A;  4ESB A;  3E5U A;  4I7H A;  2XAS A;  3Q9S A;  5DUK A;  3HUG A;  2A3S A;  3BJ6 A;  2VC0 A;  3LQR A;  4OU0 A;  4MEY F;  1WWX A;  3V7R A;  4TV7 A;  2JRT A;  2V1D A;  1FT9 A;  3BZ6 A;  3GVA A;  3LQQ A;  4F7Z A;  2F5E A;  3FM5 A;  2OQR A;  4MTE A;  4EMS A;  4YFK F;  3RI4 A;  4ESF A;  2VT3 A;  1TNT A;  1KYZ A;  1RUO A;  5HOO A;  1BBY A;  2XAJ A;  3RDI A;  5LHH A;  1UHW A;  5L3C A;  3JSO A;  5TRD A;  2ZXJ A;  1J5Y A;  4FX4 A;  1YTY A;  1EH8 A;  2QZ8 A;  2FNA A;  1KU7 A;  4B8X A;  4HBL A;  4EQQ A;  6PAX A;  4D0P A;  5E18 F;  3E6D A;  4ZYG A;  2HYG D;  2EFP A;  5HS8 A;  5KVR A;  4Q47 A;  1LDD A;  4KDP A;  3FHZ A;  3HOT A;  1FYM A;  1FBQ A;  5LHI A;  3EDP A;  5L3G A;  3BJA A;  2E1C A;  1ZGA A;  4GGG A;  1WQ2 A;  3ERE D;  5HDN A;  3WTV C;  3QP6 A;  1CGP A;  2DTR A;  2GQQ A;  4ZZD A;  1G4D A;  3G3Z A;  2HS5 A;  3HYI A;  1PUE E;  1QZZ A;  3KLO A;  2LF8 A;  3PQK A;  1Z1D A;  3KLN A;  4XSZ F;  3J81 K;  4BHC A;  4PGG A;  4CGZ A;  1PDN C;  3K1M A;  4JK1 X;  4LG0 A;  2VOO A;  1O3T A;  3IWF A;  5LEK A;  4HQM A;  4KIC A;  2GZW A;  4WCG A;  4L0Y B;  2DK5 A;  5AON A;  1USS A;  4OOI A;  1TQP A;  2FA5 A;  5JFR A;  1P4W A;  3S2W A;  4G94 A;  2XGX A;  2JTV A;  1SD6 A;  3LFK A;  4G7H F;  2NNN A;  5FD6 A;  2OA4 A;  1KYW A;  4L9V A;  2PJP A;  3HOS A;  3GUD A;  3DXJ F;  1ULY A;  4UXN A;  4A12 A;  4KUM A;  4QWQ A;  1YFH A;  1YLF A;  1K78 A;  1W4M A;  5E20 A;  3FWE A;  2TDX A;  3K69 A;  2RQP A;  4YII A;  2NRA C;  2DQL A;  2EJR A;  4HF2 A;  4O6J A;  1BI0 A;  2XVC A;  2K4J A;  1ZRC A;  5CVI A;  2QBY B;  2FBI A;  3QPT A;  1XMK A;  5LGU A;  4RB0 A;  1K6O A;  1RUN A;  4L0Z B;  3U1D A;  2M1B A;  2HQN A;  1J9I A;  2VN2 A;  3MCZ A;  3NRV A;  1YG2 A;  5JR3 A;  2O8X A;  4P9U A;  5BPD A;  3O6B B;  5FO5 A;  1LDJ A;  1T98 A;  1SAX A;  2P6T A;  2IP2 A;  2PEX A;  1XGS A;  3ECO A;  2W25 A;  1MDM B;  3I64 A;  4MQV A;  4EJO A;  2DW4 A;  1G3W A;  4L18 B;  3B02 A;  4A6E A;  1U5T C;  3R6S A;  3F8F A;  1MGT A;  2M30 A;  3WE2 A;  1O57 A;  1OR7 A;  2IPQ X;  2BBY A;  2ZO4 A;  3ISP A;  1IN7 A;  2HTJ A;  1ZHF A;  1XGO A;  3T1B A;  2EV5 A;  4R8H A;  3LAP A;  1J75 A;  2OAZ A;  3FMQ A;  2V1X A;  4HV6 A;  1SMY F;  1UFM A;  4EM2 A;  5LGN A;  4Y13 A;  4OMZ A;  1ZRE A;  1J0R A;  1IW7 F;  5HVQ C;  2VC1 A;  1TNS A;  1ZRD A;  1R36 A;  5E1Z B;  1XGN A;  1T6S A;  2JPB A;  2P5V A;  5DD8 A;  1X3U A;  4WF2 A;  4KNY A;  5ILU A;  3E5X A;  4ZH4 F;  2PN6 A;  3ZN0 A;  3KZY A;  2QQA A;  1PP7 U;  2VBX A;  2A69 F;  2QEN A;  1BM9 A;  5HDK A;  1QBJ A;  5BQT A;  2XRN A;  3F23 A;  4LMY A;  1FX7 A;  4M9X A;  1B6A A;  1V3F A;  2QWW A;  1BI3 A;  1FSH A;  3W6K B;  4KMU X;  1TQM A;  4EV0 A;  1OMI A;  3KCC A;  4JQF A;  4OIR F;  4M6X A;  1H9T A;  1HKS A;  2W85 A;  3BJO A;  2A61 A;  4FX0 A;  3T8R A;  1TBX A;  3E5Q A;  4MEX F;  4RAY A;  4G6Q A;  5ERI A;  1BIB A;  3CO7 C;  1G6N A;  3P9I A;  1I6X A;  2XKP A;  4PDK A;  2R3S A;  1GXP A;  4RS8 A;  1MKM A;  2YSR A;  5D5X B;  4BXU A;  5H6Q A;  3GFM A;  3HRM A;  2ZKZ A;  2W84 A;  4XRF A;  4E70 A;  2O03 A;  3MZH A;  4EGZ A;  3WE3 A;  1U3E M;  3J7A O;  2HDC A;  2A6H F;  4MHG A;  4KYW A;  3H3Z A;  5H6R A;  3QAH A;  3O2P E;  5HLI A;  1ZG3 A;  5F6F A;  2GXG A;  3GO5 A;  4CIC A;  3BOQ A;  4HX8 A;  1U5T B;  3MFK A;  3ZMV A;  3KP4 A;  3F8N A;  5DV5 A;  2IW5 A;  5L3B A;  2DI3 A;  3M7G A;  3I59 B;  5CYV A;  3JSP A;  1ZLJ A;  4ZYH A;  2Z3Y A;  3SHF A;  2LSO A;  2VE9 A;  2P5K A;  5D5U B;  5LRR A;  3TDZ C;  1FLI A;  1BN5 A;  2H6C A;  5DDG A;  3RKX A;  3MEX A;  2F2E A;  1YW9 A;  1P4X A;  3SFZ A;  2KRF A;  1S7A A;  1J59 A;  2LNB A;  1EH7 A;  4G9Y A;  3CUQ A;  4RAZ A;  3P7N A;  1D5V A;  4PGH A;  1S6L A;  5F64 A;  5KK1 A;  4KIB A;  4MTD A;  2WV0 A;  5A2Q K;  1F9N A;  1I1S A;  2MH9 A;  5E17 F;  1U78 A;  2VBW A;  3IL2 A;  3K2Z A;  1DP7 P;  2OQG A;  2X4H A;  1JGS A;  5LHG A;  2K02 A;  2PLY A;  4OMY A;  3E6C C;  3F21 A;  4PCQ A;  4KA4 A;  1WI9 A;  5DEQ A;  1FSE A;  5FLX Z;  4N0B A;  5FFZ A;  4A5M A;  4RB3 C;  2HR3 A;  3EQL F;  3F8B A;  4HDV A;  2BGC A;  3H92 A;  1ZRF A;  2NAZ A;  1XMA A;  3F8M A;  1U8R A;  3RPU A;  3ZMT A;  3KP6 A;  1XSV A;  4EJW A;  1IXR C;  4OIP F;  3R60 A;  2EFN A;  4RGS A;  5BS6 A;  2L4A A;  4LGW A;  2WWY A;  3KP3 A;  3GFL A;  4BAY A;  3DP7 A;  1DPR A;  2D2W A;  3QRF F;  1HXD A;  3HSF A;  3WTY C;  3IRQ A;  2V9V A;  4A0Z A;  1R1V A;  4HX4 A;  2OU2 A;  1IF1 A;  1GXQ A;  3WGI A;  1ZYR F;  2MD5 A;  1RNL A;  2JPC A;  5J8C A;  1FYL A;  5K5O A;  3LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...