1K7AA

Ets-1(331-440)+ggag duplex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*GP*AP*TP*GP*T)-3')
total genus 33
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k7aA00
5HS8A 4YFKF 2DLLA 1J0RA 3EUHA 1XDUA 4EJTA 5LHGA 2ZKZA 5H6RA 2EFPA 2DK8A 5HDKA 5JR3A 1USTA 4KICA 1FY7A 2D1HA 2MC3A 2WV0A 2HWVA 2XKOA 2WC2A 2RNJA 1KQ0A 1FSEA 2GWRA 3ZMTA 5LHIA 2FMYA 1ZREA 1E17A 2F5EA 2RQPA 2XASA 3CUQC 1F4KA 3LA3A 3L9FA 2OBPA 2L4AA 3GUDA 2DTRA 4RGSA 2GA1A 4WXCA 4MEXF 4L18B 4DNCA 1A04A 3HRSA 3T8TA 5E8GA 2K02A 4ZZLA 4BXUA 3MCZA 2MD5A 4MNUA 3TO6A 4Y13A 4YG2F 4ESBA 4L5IA 3QPHA 1LEAA 3J81Z 1QNTA 2XAFA 5D8KB 2EWNA 1UB9A 2ZMEB 5L3GA 2GXBA 2IPQX 2ADUA 1TBXA 2LF7A 4Q47A 1IN5A 2R7DA 3ISPA 4MTEA 3TDUC 2YU3A 4M71A 3S2WA 3V7RA 4A0YA 3RDIA 2D2WA 3ELKA 2VBWA 4B8XA 4B09A 1FYLA 2PEXA 3RYPA 4M72A 4G8XA 4G7ZF 1SD7A 3FMQA 1R1TA 2PG4A 2L01A 3HSFA 5AONA 2KIUA 4OOIA 1U5TB 5LGNA 5FLXZ 2Z3YA 4DQ2A 2DO7A 4UXNA 4LD5A 2KKOA 3QAHA 4LG0A 5ILVA 4AIHA 2P7VB 2RV8A 1ULYA 1FSHA 2L54A 1FLIA 1MJ9A 2EV5A 2XAHA 3E6CC 2HGCA 5D5UB 3BJ6A 3DQVC 2HS5A 1W7PB 1ZLJA 2P8TA 2ESHA 2VE8A 4ESJA 2HOEA 5LLQA 4ZH4F 2YX4A 3HIFA 2H6BA 2MH9A 4M6YA 2EJRA 2MH2A 3IKTA 3FXQA 4ENMA 4KA4A 2E1NA 3R4KA 3FXRA 3R0JA 1W5TA 1QZYA 2LKPA 2VXZA 3BPVA 1IN7A 4L0YB 2AXLA 2ZBKA 2O03A 3RYRA 3SFZA 3FXUA 1STZA 3QOPA 4G7HF 1HKQA 3F8CA 2ZMEA 4LK1F 3WGHA 3FM5A 1YLFA 3ZMDA 2H27A 2GQQA 5DEQA 1BI1A 1RUOA 5DDGA 1O3SA 3ZQ7A 1D5VA 1XGSA 4I09A 2ZFWA 3WU0A 2FA5A 1RUNA 1BJAA 1AOYA 1MZBA 3IKVA 4CYDA 1MD0A 5CJ9A 3M8EA 3KETA 1K79A 5JVTA 1XN7A 5D6FA 1MDMB 1C0WA 2L3DA 4IRHA 3B02A 4KUMA 2VC0A 2VOPA 5CVRA 3JSOA 2A61A 3F22A 2P5LC 4FHTA 1U78A 1KQ8A 2XAJA 5LEKA 3VB2A 5DCMB 3PFIA 4FX0A 2FU4A 3MZHA 1Z05A 3D5LA 1D8JA 3KEQA 1KU7A 3LSTA 4HDVA 4P9UA 4OMYA 1ZN2A 2YPRA 3TGNA 1Y0UA 2HKOA 1YS7A 4I01A 2P5VA 1ZAOA 1HQCA 2BEOA 5L3FA 2IRFG 4RB1A 4L9VA 1KGSA 1IN6A 2EFNA 1XDSA 3U9GA 4A6EA 1IUYA 1BI0A 1MJBA 3IHUA 1QQIA 3RTRA 4HBLA 3KP2A 3BROA 2OZUA 3HTUA 4LG0B 2QZ8A 3WTWC 1ON1A 3N4MA 2YR2A 1KQ9A 4CHUA 2VODA 1S8NA 5E8IA 1SD4A 3IC7A 2FRHA 4IHTA 5E18F 1TTYA 3M9AA 2HYFA 5KVRA 4N9HA 1TW3A 1OMIA 3R60A 1IF1A 3LQRA 2DPUA 3KP4A 1CF7A 5D6EA 4HDUA 3ULQB 4NHJA 3ROUA 3Q5FA 4KNYA 3WTUC 4OU0A 1XGNA 3GW2A 2PLYA 1X3UA 2QBYB 1T0FA 3BJOA 2XV4S 3KLOA 1HSJA 3FMRA 2DFIA 1MJAA 1YIOA 2QUFA 1EV7A 3DPTA 4ENJA 3IRRA 3WGGA 1B1BA 2DT5A 4MEYF 1LDJA 2TDXA 3GEZA 3JSPA 3CUQA 3GFMA 4KN4X 2A6HF 2R7FA 5KK1A 1IXRC 1FYMA 1U8RA 4GGGA 5AIQA 4M9ZA 2F5DA 3FHZA 1YS6A 1ZG5A 4I0AA 4L9TA 5BOXA 1IN8A 1K78B 4AIJA 2XHKA 4LLNA 1BIBA 1G3WA 3HHGA 1B9NA 4LB6B 1SD6A 5ILUA 3SZPA 3ZMUA 4HQMA 3L00A 5BPIA 3BPXA 3JTHA 2DI3A 3QRFF 2J5PA 1O3QA 5FFZA 4HF1A 1SFUA 2VONA 5D4RA 1U3EM 3SZTA 1EH6A 1ZH5A 4UHTA 3LWFA 3WTTC 2K4JA 5DCFA 1G4DA 1FBUA 3ECOA 3ERED 3WGIA 3KZZA 3ZN1A 4WK8F 4FX4A 1H9GA 4U7BA 3WTSC 1LNWA 2OAZA 3IWFA 2FQ3A 5ERIA 2QLZA 4M74A 3CDHA 3V8KA 2A5YB 2OQGA 4ESFA 4A5MA 4JQFA 1F1ZA 3HOSA 3R61A 1HKSA 3F6OA 1RIOH 3CO7C 2V1XA 2HTSA 2CYYA 1G3SA 4L5JA 4N0BA 1Z1DA 3L09A 3T5XA 4LFUA 2H6CA 2C6YA 3LAPA 2LSOA 3F8FA 4RAZA 5CVUA 2FEZA 1S29A 1R23A 2KJBA 1YW8A 2XKPA 1XGOA 1LDDA 5LHHA 2OQRA 4H0EA 2EFQA 3GXOA 3MAJA 3V4GA 2XIGA 1J5YA 1J75A 1U6GA 4G7OF 4MHGA 3LFKA 2ELHA 2BBYA 3GX4X 2Y48A 5ICGA 5HLHA 4UNOA 4HYEA 1R7JA 1QZZA 3GZ5A 4BAYA 4HV5A 4UVAA 3DPLC 1HW1A 1CGPA 5DD8A 2EV0A 1LB2A 1J2XA 2L4MA 3MQ0A 2XROA 4LGWA 2EA4A 4G9YA 1ZYRF 3G3ZA 4LMYA 4RB3C 5BS6A 3IL2A 2XUBA 4E70A 3LA2A 2MBFA 3QPTA 1R58A 4PGHA 1FZPB 3QP5A 1IW7F 2B0LA 5FLXK 4IRGA 2HQNA 5LRRA 3O3KA 4CDGA 1ZRDA 1YO5C 1XSXA 4LLGF 4XBFA 2DQLA 2M45A 3Q9SA 4RGUA 3HSEA 2XRNA 4KIBA 4TV7A 2JT1A 5DYMA 3CJNA 3I59B 1SFEA 5H20A 1IXCA 2JPBA 3ZN0A 1ZRFA 3W6KB 2K4BA 5TJJA 2XVCA 3GWZA 4KDPA 4NB5A 2VN2A 2D1VA 3JAMZ 2GA2A 5A2QZ 3MFKA 2HR3A 4HLYA 4RAYA 5ICCA 2EFOA 1ZLKA 2QBYA 4XRFA 3ZPLA 3RKYA 1AWCA 1IN4A 3T8RA 4YIFA 1V4RA 4HOBA 4I02A 4HLXA 3PQJA 3GF2A 1R00A 2ETHA 3ECHA 1L3LA 1BC7C 3M1EA 3ZMZA 4CICA 5BPDA 1PUEE 1EH8A 3WTVC 3ABUA 3M8FA 2CW0F 1XMAA 2XAGA 5K5RA 2COMA 2P5KA 2VE9A 3F3XA 2E1CA 2VBXA 3HRUA 2CO5A 2CWEA 2FXAA 2Q8KA 4Q5SF 1KYZA 1YYVA 2K7LA 1BIAA 3GO5A 2NAZA 3ZP5A 4KYWA 5L3CA 3E5QA 3MZYA 2Z9OA 3VODA 1HBXG 3N97A 1KA8A 5L3DA 5HOOA 2QQAA 2ISYA 3GFJA 2A69F 4K2EA 4S04A 4HV6A 4XLNF 1SAXA 3CLOA 2HZTA 3EETA 4PDKA 3KCCA 1CF7B 3O6BB 4N9IA 1QPMA 1GXQA 2O3FA 2ZNZA 1WSUA 2VBZA 2HYGD 5JFRA 1J7KA 1I1GA 3NQOA 2PI0A 4WXDA 2K27A 5DUKA 3I64A 2NRAC 1S7OA 5L3BA 1EH7A 2IA0A 3H92A 4MQ9F 1H9TA 4JBAA 1JGSA 4BQAA 5LGTA 4IXAA 4XSZF 4ETSA 2MLGA 3I59A 3VEPA 1I6XA 4U7DA 1R5GA 2A6EF 3F23A 2ZCWA 5EEHA 4Q4ZF 2IA2A 3E5XA 4MTDA 4Y15A 5E20A 3E6DA 2PMUA 3C7JA 5HS7A 3GFIA 3KZYA 4R1HA 3TQNA 4MGRA 5HDNA 1SMYF 3IRQA 4UUVA 2DU9A 2HKXA 2CQKA 3WTYC 1P6RA 1O7FA 4ENKA 4GO1A 1IAWA 3EYIA 4HZFA 2H09A 2ACJA 4EGZA 1BBYA 2G7HA 2O8XA 2CG4A 2HQRA 1WI9A 3RPQA 5E1ZB 1HW5A 2RDPA 4UV8A 2EA2A 3P9IA 2XAQA 2A68F 5BMZA 1IZ1A 5ICEA 4ZZDA 3NEUA 3RIRA 2STTA 2IW5A 3DFGA 3TKYA 1FP1D 2BE5F 1LEBA 5DUIA 1LQ1A 1MKMA 5CLSA 3D0SA 3K9TA 1HXDA 4OIPF 3KP6A 2JSCA 4EMSA 4LB5A 1KU9A 4KIFA 1KU2A 3BZ6A 3WE2A 1YQAA 2DPDA 4IPAA 1OYWA 1FNNA 1BM9A 4PGGA 1S6LA 2FE3A 2IJLA 5DCMA 5CVJA 1WKMA 5CVIA 1SD5A 1FBQA 1XB4A 2H94A 4M6XA 2PFBA 3T1BA 2PN6A 3COAC 3HHHA 2W85A 5E1WA 3ZMSA 1W4MA 4A0XA 3KE2A 3U2RA 4BHPA 2Y0MA 3DP7A 3GVAA 3U1DA 3H3UA 5FD6A 1ZG1A 3R0AA 2KIFA 2PQ8A 3V8LA 4RGRA 4WX9A 2PBIA 4O5VA 5CYVA 1YTYA 3FM3A 2A3SA 2CSOA 2IVMA 3WE3A 3J80K 3P9CA 1Z91A 3BP8A 1T6SA 1OYYA 1FPQA 3T0YA 3E3VA 1FX7A 3DEUA 4EM1A 1NHAA 4A2UA 5JI6A 4EVIA 4BNCA 1FT9A 1B9MA 4IF4A 1T38A 3FWEA 4G94A 1YFHA 3DF8A 2QENA 4RB2C 3E97A 5F6FA 3HRTA 4WXHA 1ZG3A 3RPUA 3KEOA 1QO0D 3EQLF 4PZJA 1T98A 2IT0A 3WTXC 4AIKA 1VTNC 1H0MA 1MGTA 2VOOA 1LJ9A 1TQPA 4EV0A 1DPRA 4KMUX 1WQ2A 4ENNA 1P4WA 1RNLA 5ILSA 1G3TA 3I0TA 4U0YA 4ON0A 4KMFA 2ZXJA 4I2OA 4CXFA 4L9JA 3BY6A 4R79A 3ML6A 1L0OC 1XMKA 2HTJA 4HF0A 3OV8A 5HLGA 2QVOA 4U0VA 3LA7A 5J8CA 1G3YA 1KYWA 1LVAA 4HA8A 3BOQA 2UZKA 3J81K 5LEJA 2BV6A 2ZJ2A 2V1UA 2JZYA 2P6SA 4HX8A 2E7XA 3H3ZA 3LAJA 1K7AA 3E6MA 4GXOA 2LF8A 3DXJF 1PP7U 3F8MA 2O0YA 5HDGA 2ZO4A 1UFMA 4Q48A 3WODF 3VOEA 2IP2A 3B73A 4HX4A 1B6AA 5FB2A 1ZGAA 3BJAA 2M8EA 1DPUA 1G6NA 2QYOA 4KIGA 2Q0OA 3KFWX 5JHUA 3I71A 4CGZA 2CGPA 4IJAA 2FBHA 3K1NA 3J80Z 1FOKA 2FBKA 1QBJA 2BGCA 4EQQA 4WCGA 3FF5A 5F64A 1J9IA 5TRDA 5IT9K 3RJPA 4P55A 3KP7A 3BDDA 1Z9CA 4OIOF 1O3TA 4YIIA 1GHCA 2JTVA 4QWQA 4XLPF 5CVVA 2JRTA 4O6JA 3AAFA 2K86A 1REPC 3REOA 3K0LA 4WWCA 2FNAA 1XGMA 4I0BA 4Z2YA 3J7AO 1FYKA 5ICFA 3C3WA 5LBQA 5D8LB 1ZARA 4M73A 4LK0F 1FP2A 2O6GE 2Z5UA 2STWA 4U0WA 2G9WA 3I58A 3FMSA 4I7HA 2HEOA 2GXGA 2M30A 1FC3A 3W6JB 1BI3A 1JXSA 2DQRA 2VT3A 3I4PA 4F7ZA 2EB7A 3K1PA 3DV8A 4ZYEA 4EJUA 3F72A 3FX3A 3C18A 3GYHX 4G6DA 2VT2A 4BH9A 1FWZA 1S3JA 5L3EA 3LQQA 1HW2A 3I5UA 4LLLA 5F1RA 4HAMA 1OR7A 2Z99A 3E6BA 5J8FA 5J6XA 3IWZA 4RS8A 3JTGA 4BHBA 1K6OA 2CFXA 1LDKB 3R6SA 2NS0A 3SQNA 1KU3A 1UHWA 1TQMA 2MLKA 4KN7X 5D5WB 4NQWA 4O3MA 5DD4A 2RC4A 1BN5A 1ON2A 2KRFA 5LGUA 5HVQC 1JE8A 4ZYGA 2QQ9A 4KT5C 5FD5A 3RKXA 1T39A 2E7WA 2UXNA 3HOTA 2FMLA 2XGXA 3HSRA 1DUXC 4EJWA 2DAOA 2RGVA 2QQBA 3QU3A 4MQVA 3M7GA 2IA1A 4IHSA 4A6DA 2QM3A 3SHFA 3BWGA 2O61A 1XSDA 3F8NA 2ISZA 1W7PA 2M87A 2FSWA 3I53A 1GXPA 3V7SA 2DBBA 6PAXA 5IT9Z 4ZYHA 4RGXA 2GIVA 4UVCA 3SXYA 3RKWA 2V79A 4EM0B 2G7UA 4LJZF 2ESNA 5K5QA 1D3YA 1B4AA 1OKRA 2LDUA 3HYIA 4EJVA 2ZNYA 1I27A 4OIRF 3ABTA 3F21A 3JW4A 2L02A 1SFXA 2V6CA 1GVJA 1BC8C 1S7AA 3PQKA 5K5OA 2QWWA 2FNPA 3EYYA 2P7CB 2UWMA 1P92A 1P4XA 4P5OA 1TQIA 2YX7A 5H6QA 1O57A 1TNTA 4D0PA 2VC1A 4G6QA 3P7NA 5A2QK 1Z6TA 2AS5F 3E5UA 1I1SA 1U2WA 4PCQA 1V3FA 4EM2A 4GCVA 3I54A 1DDNA 3F6VA 1P2FA 2RKHA 1XCVA 4A0ZA 5FFXA 4BHCA 2GAUA 2MA3A 1E2XA 1TW2A 2WWYA 4IVNA 3L7WA 3O2PE 1K78A 3K69A 3L2CA 2FBIA 4YFXF 2NNNA 2BYVE 4M9SA 1HKTA 4UVBA 2KJCA 2EV6A 4OIQF 2OA4A 1R5HA 5BQTA 2NNYA 2UXXA 2Z33A 2YSRA 5D5XB 1R36A 3ZMVA 4QLCU 3CTAA 4HW0A 3OOPA 1JHHA 4OMZA 4YFNF 2OD5A 4EGYA 2EFWA 3CUOA 1ZHFA 5ED4A 1WRJA 4U88A 2VBYA 4L0ZB 2X4HA 4S05A 3EDPA 3HRMA 1Z6RA 2JPCA 3K1MA 4HQEA 2W57A 1XCBA 4KFCA 4BYYA 1TNSA 3HTSB 1W7PD 1R22A 3WU1B 3TOAA 1O3RA 3VFZA 4M9XA 3GZ6A 3K2ZA 2F5CA 4CZZA 4JK1X 4CO8A 4RB0A 1ZRCA 1D8KA 1ZGJA 1BOAA 2RVCA 1DP7P 2WTEA 4UV9A 2FF4A 4EJOA 1F5TA 5E17F 2V9VA 1P4AA 1ONVA 4A12A 1HSTA 3KP3A 2DW4A 2R3SA 4IRIA 1J59A 2PMHA 4GYIA 1OPCA 2GZWA 4Y17A 1OYIA 1SMTA 1USSA 1YW9A 5LRSA 1IXSB 4A5NA 3CO6C 5EEGA 1RI7A 1PP8F 4ASNA 3FZVA 1QGPA 4AWXB 1IRGA 2EK5A 4XSXF 4L9NA 2W24A 3TDZC 4I98B 3V8JA 2HFHA 2FOKA 3F8BA 2NYXA 1UCRA 4FT8A 4HX7A 1PDNC 4AVPA 1Q1HA 3Q9VA 1IRFA 3WG9A 3GLXA 1YG2A 2A07F 1I5ZA 2M1BA 1Z7UA 3CUQB 2PJPA 2LNBA 3QU6A 5HLIA 1ODDA 1XD7A 1WWXA 4OINF 5HS9A 5FGMA 2F2EA 3KLNA 5K1YA 3NRVA 1TLHB 1U5TA 4P96A 2Y75A 2DK5A 4GYGA 1FBSA 3TO7A 1B59A 2F5FA 4P9FA 1U5TC 1JHFA 5AIPA 4WF2A 5FO5A 1XSVA 3WTZA 3C1DA 2W25A 1T2KA 1R1VA 3MWMA 2P6TA 2OU2A 2HDCA 4HF2A 1O7LA 3GFLA 1W5SA 3DKWA 2RN7A 1R1UA 2P4WA 3KP5A 1RZ4A 3JAMK 3V7CA 4ZYDA 1F9NA 5D4SA 2J5OA 3MEXA 5DV5A 2M5WA 5D5VB 2W84A 2Q2EA 3TOBA 3G73A 1UHMA 1YW7A 3HUGA 3P9KA 2X0LA 2D45A 2OZ6A 1BI2A 2V1DA 2KIMA 3TO9A 3QP6A 3RI4A 1MDMA 5E1XA 4R8HA 4AD9A 5IT3A
chains in the Genus database with same CATH superfamily
3S14J 3PNYA 5HS8A 3CCSI 4YFKF 2DLLA 1U8BA 1J0RA 3EUHA 4XKVA 1JKQC 2WB1N 4D7NA 5HODA 3M4OJ 1XDUA 4EJTA 5LHGA 2LY2A 3MMYB 2ZKZA 5H6RA 2EFPA 2DK8A 5HDKA 2KZGA 1OCOH 3S1QJ 2XB5A 4I99C 3KYLA 1YIJI 5JR3A 4NDLA 1R6RA 4RM2A 1USTA 4KICA 4HEA2 5KCMA 4C2MJ 1FY7A 2D1HA 2V9KA 3K7AJ 5M3MJ 2MC3A 4NBQA 2WV0A 2EPFA 5J47A 2HWVA 4XKWA 2XKOA 1BW5A 2WC2A 2RNJA 2XRLA 4JX6A 2CRGA 1KQ0A 1FSEA 3MKWB 2EINH 2GWRA 2HI3A 4FTHA 3ZMTA 1T33A 2CW8A 5LHIA 2FMYA 3VYRB 2JJ7A 3HC7A 4M6VA 5EG0B 1ZREA 3CESA 3CCMI 4RLQA 1E17A 5TGTA 3IH2A 3CMAI 4E7IA 1JT6A 2F5EA 2RQPA 2XASA 3CUQC 1F4KA 3LA3A 2EH3A 4CCOA 3L9FA 3D5SC 3IP4B 1ERDA 2OBPA 3ZR8X 1IV6A 1FTTA 1M1EB 1HF0A 2L4AA 3GUDA 2JA2A 2DTRA 2VPLA 3JRDA 1DQUA 3HGGA 4RGSA 4QTRA 3A01A 2GA1A 4WXCA 4MEXF 1PUFB 4L18B 4DOZA 2QSHX 2VIXA 4DNCA 1A04A 3HRSA 3T8TA 4E7HA 5E8GA 2K02A 3P5JA 2R7XA 4ZZLA 5IP6A 2MC4A 2KFDA 4BXUA 3AG4H 3MCZA 2MD5A 4MNUA 3TO6A 1P7JA 4Y13A 4YG2F 1I50J 2BY0A 2GOXB 2AQFA 2EIMH 2DA4A 4ESBA 4L5IA 3QPHA 2L2OA 3LL7A 1LEAA 3BR1A 3TBIA 3HG9A 3W2VA 3J81Z 1QNTA 2XAFA 5D8KB 2EWNA 1UB9A 2JMWA 2ZMEB 5L3GA 2GXBA 4CYCB 2IPQX 2ADUA 1TBXA 2LF7A 4Q47A 4A3CJ 1IN5A 2R7DA 3ISPA 3OWTA 4MTEA 3EUAA 3TDUC 2CQ7A 2W82A 3BZKA 2R7WA 3OIPA 2R7SA 3SZGA 2YU3A 2X6WA 4M71A 3S2WA 3V7RA 4A0YA 4GFBA 3OIOA 3RQIA 1VQ9I 3RDIA 2D2WA 4XIDA 2R7UA 3BR5A 4A3FJ 3BG7A 5E79C 3ELKA 2VBWA 3BR0A 2WAFA 3LSKA 4B8XA 2E2JJ 3RQ4A 4B09A 1UELB 1FYLA 2PEXA 5H2FC 3RYPA 4M72A 4G8XA 4G7ZF 1N75A 1SD7A 1XMXA 3S32A 1YHQI 3W2AA 4DGWB 3TP3A 3FMQA 1R1TA 2F6CA 2L01A 2PG4A 3HSFA 5AONA 1Y1WJ 1JKOC 1JJ8C 2KIUA 4OOIA 1OJLA 1U5TB 5LGNA 5FLXZ 2Z3YA 4DQ2A 2DO7A 3ABKH 4UXNA 4LD5A 2R4GA 4DYRA 2DN0A 2KKOA 3PSFA 3J7YJ 4A3KJ 2Z2SB 1R4NB 4C3HJ 3QAHA 1NK2P 3AFHA 1VQLI 4LG0A 3OYNA 5ILVA 4AIHA 2P7VB 3LSIA 2RV8A 1ULYA 1OFCX 1FSHA 2KIQA 1ACIA 2L54A 1FLIA 1MJ9A 1QHHD 5EGOA 3GZNB 2EV5A 2XAHA 3E6CC 1VZ0A 2HGCA 3S2HJ 3OOUA 4HSTA 5D5UB 3BJ6A 3S3MA 4FCYA 1TWFJ 3CZ6A 3DQVC 2HS5A 1W7PB 1RESA 2GBYA 2K9SA 1S7EA 1ZLJA 2OC6A 2P8TA 2ESHA 2W7NA 2VE8A 4ESJA 1VQKI 2HOEA 5LLQA 3H0GJ 4ZH4F 1X19A 3E1SA 1WJDA 2YX4A 3BTCA 3HIFA 2H6BA 5CKTA 3FISA 4A93J 2MH9A 3NAUA 4M6YA 2EJRA 4J00A 3HPGA 1UZCA 2MH2A 3IKTA 3FXQA 4XRSG 1Y1VJ 2OCCH 2BHZA 3QYFA 4ENMA 4KA4A 2E1NA 3R4KA 3FXRA 2VUMJ 2X85A 1MBGA 2DA7A 5EG0A 3R0JA 1EA3A 1W5TA 1QZYA 2LKPA 2MGQA 2VXZA 3BPVA 2XF7A 1IN7A 4L0YB 2AXLA 2ZBKA 2O03A 3BCAA 5J40A 3RYRA 3SFZA 3HKZA 1FEXA 3SDBA 3CC4I 3FXUA 2GOMA 4I6ZA 2IS2A 2DDAA 1YE9A 1STZA 3QOPA 4G7HF 1HKQA 3F8CA 2ZMEA 4KISA 4LK1F 1RKWA 3S8PA 3FM5A 3WGHA 1YLFA 3ZMDA 3H0DA 3DKXA 2H27A 5E3MA 1MBEA 2DDBA 2GQQA 5DEQA 3W3CA 1BI1A 1RUOA 5DDGA 1O3SA 4A3DJ 3ZQ7A 1D5VA 1B8IA 1XGSA 3CP2A 3GTPJ 2ELKA 3GTOJ 2VJJA 4I09A 3IH4A 1RRJA 1TT5B 2ZFWA 3WU0A 2FA5A 1RUNA 3OYKA 3OY9A 2E2IJ 1BJAA 3J7AY 1W36C 1AOYA 1MZBA 3IKVA 4CYDA 1MD0A 2Q1ZB 4XR6A 5CJ9A 3OR2C 3MN2A 1PUFA 3M8EA 3KETA 1K79A 1K83J 2EQRA 3D5RC 5JVTA 1R9TJ 3I4MJ 2E1MB 3VWBA 1XN7A 4NUBA 1X4PA 5D6FA 1MDMB 1C0WA 2QKLB 3BQYA 2L3DA 4IRHA 3B02A 4KUMA 2E34A 1ORKA 2VC0A 2VOPA 1R4MB 1DGRM 3S1MJ 5CVRA 5CQEA 1WJEA 3JSOA 1MW7A 2A61A 1MMDA 3F22A 2CV1A 2P5LC 2K9MA 1XC5A 2OTLI 4BU2A 2AHQA 3CQZJ 4X1EA 5M5XJ 3M07A 4FHTA 1U78A 1KQ8A 2HVRA 2XAJA 5LEKA 3VB2A 5DCMB 3I9V2 5EDNA 4ZYAA 2DJNA 3PFIA 4FX0A 3OS2A 2FU4A 4XLCA 4XLHA 3MZHA 3IUOA 1Z05A 4C3IJ 1X1AA 3D5LA 2X1CA 3AG3H 1OR7C 3A01B 4IEJA 3KEQA 1D8JA 1KU7A 3QYBA 3LSTA 2R5ZA 4HDVA 1EKEA 3PSIA 2V7FA 4P9UA 4OMYA 1ZN2A 2YPRA 2HXOA 2M0CA 3TGNA 3QYEA 1Y0UA 2HKOA 2DFFA 3LMMA 1YS7A 2WB1A 4I01A 4B47A 2P5VA 2BOLA 1ZAOA 1HQCA 2BEOA 4F3QA 5L3FA 1FMVA 2XGEA 3VDXA 2CMPA 2IRFG 2R5YB 5FROA 4RB1A 4L9VA 1KGSA 2R7QA 2LKSA 1IN6A 2EFNA 2ME0A 1XDSA 3K6GA 3U9GA 4DBRA 3V42A 2WAQN 1Z0XA 3DTEA 4XMYA 4A6EA 4KITB 1IUYA 1BI0A 1MJBA 2R7OA 1W36D 3IHUA 1QQIA 2CU7A 1I39A 4XM3A 3RTRA 1XPXA 5GPCA 1EF4A 2K3PA 4HBLA 2NXNB 3KP2A 3DWLE 3BROA 5JHFA 1UG0A 4IOCF 2ZC2A 2E71A 2OZUA 3HTUA 3JRGA 4LG0B 2DOAA 4A69C 2QSGX 2QZ8A 3WTWC 1ON1A 1SVOA 1Y39A 3N4MA 2IGKA 2Y9ZA 2YR2A 1KQ9A 2BXYA 4ZDLA 1S8NA 5E8IA 3CCVI 4CHUA 2VODA 1SD4A 3J7ZI 3IC7A 2FRHA 4BDYA 1FOXA 2F4IA 2V26A 1HA8A 4IHTA 1I6HJ 4BS9A 5E18F 1TTYA 1KONA 3M9AA 2HYFA 5KVRA 1IDZA 4N9HA 1E3OC 1TW3A 3VYTB 1V5GA 3TEDA 1OMIA 2L0KA 3R60A 1ITYA 1IF1A 2NS8A 3K4NA 3L2UA 3LQRA 2DPUA 3KIOA 3KEYA 3KP4A 1K4SA 1CF7A 3BG5A 2LBFB 4B4CA 5D6EA 2X9DA 3Q0WA 3ULQB 3OYHA 3LNQA 4HDUA 4NHJA 3H3VK 3ROUA 3Q5FA 4KNYA 3WTUC 3LOCA 4OU0A 3VPRA 1V55H 4HNUA 4XKCA 3DU5A 1Q1VA 1XGNA 3GW2A 2PLYA 5FKLA 1X3UA 4PFOA 3PO2J 3K10A 2ID3A 3CCUI 2QBYB 1D0XA 4LITA 1T0FA 3BJOA 2XV4S 3KLOA 1HSJA 3KX2A 1T8IA 3CLQA 4B3AA 1HLVA 4XICA 3FMRA 2DFIA 2KDZA 1MJAA 1UAAA 2FUG2 3ZQQA 1YIOA 2QUFA 3MKZA 1HC8A 2HNHA 1EV7A 3DPTA 1GVDA 4ENJA 4MIMA 1U9OA 5IY5H 3IRRA 3WGGA 1JUSA 4OWRB 1QU3A 1B1BA 2DT5A 4UUSB 1LDJA 2TDXA 4MEYF 3GEZA 4CCNA 3BT9A 1JKPC 5F0FA 5FKMA 3JSPA 3CUQA 3GFMA 1TWCJ 4KN4X 2A6HF 2R7FA 3H9JA 2ZXHA 5KK1A 1IXRC 1FYMA 1U8RA 4GGGA 3CF2A 3U1KA 5AIQA 4M9ZA 2F5DA 2COBA 2EZKA 4BDZA 3FHZA 1POGA 1YS6A 2BY1A 3K2AA 4JYKA 1ZG5A 4I0AA 4L9TA 3G4SI 1RKTA 5BOXA 1IN8A 1K78B 4AIJA 2VPRA 3A0HC 4JX5A 2XHKA 4LLNA 1BIBA 3LSMA 3S2DJ 3JRBA 2E5NA 1F36A 1G3WA 3HHGA 3I55I 2D5VA 4IQ4A 1B9NA 4LB6B 1G59A 1SD6A 5ILUA 3UNGC 3SZPA 4BXFA 2DJIA 2E36A 3ZMUA 2DMUA 2WY8Q 4HQMA 3S3OA 3L00A 5BPIA 4RM3A 3NARA 2V4JC 3BPXA 1SC7A 3JTHA 2DI3A 3QRFF 1VI0A 2J5PA 1MBKA 1O3QA 5FFZA 4HF1A 2Y0SN 1SFUA 2VONA 2NVQJ 5D4RA 1U3EM 2NOGA 2W00A 3SZTA 1EH6A 4BQOA 1ZH5A 4UHTA 3LWFA 4PJLA 3WTTC 2K4JA 5DCFA 4ZDPA 4JX4A 2DFEA 1G4DA 1FBUA 3ECOA 3ERED 3QPLA 2AXTC 1BR4A 3WGIA 3KZZA 4ZTJA 4D5FA 3ZN1A 4WK8F 4FX4A 2M34A 1H9GA 2KMUA 2EZLA 3BR6A 4U7BA 1LNWA 2OAZA 3WTSC 1VQ6I 5B3SH 3IWFA 3G71I 2FQ3A 1UJ8A 5ERIA 4QIWN 3OL3A 2QLZA 4Y33A 4CCKA 3PIPF 3ABMH 4M74A 1AKHA 4XONA 3DLLF 3CDHA 3V8KA 2A5YB 1VQNI 2LLKA 2OQGA 4ESFA 2VKDA 4A5MA 3E0JB 1B72B 2O5RA 4JQFA 1F1ZA 4U87A 3HOSA 5EZHA 3R61A 1HKSA 3PIOF 3F6OA 1RIOH 3S16J 3CO7C 2EILH 2ICWG 2V1XA 2HTSA 2CYYA 2QQ8A 1G3SA 1Z77A 4XLEA 2KT0A 4L5JA 4MLOA 5FLMJ 2JA6J 4N0BA 5M5YJ 1Z1DA 3L09A 2CUZA 3QWLA 4LFUA 3T5XA 5J4VA 2H6CA 2QKMB 1AHDP 1NH3A 3A4CA 2C6YA 2JWTA 3LAPA 2LSOA 3F8FA 4RAZA 5CVUA 2FEZA 3TW6A 1S29A 4YEJA 1R23A 2KJBA 1YW8A 4BUPA 2OV7A 2XKPA 1XGOA 1LDDA 1BOBA 1WJBA 3GLLA 5LHHA 2OQRA 3CMEI 1X3ZB 4BBRJ 2HDDA 5K7ZA 4H0EA 3ONQA 1FOYA 2EFQA 3GXOA 3MAJA 3V4GA 5IYCJ 2XIGA 1J5YA 3PUFA 4BGDA 1J75A 1U6GA 4G7OF 5C4XJ 4MHGA 3LFKA 2ELHA 3I4NJ 2BBYA 2WAQA 4E6KG 4AU7A 1BW6A 4FASD 3GX4X 3LSPA 5IYDJ 3OYJA 5CPRB 2Y48A 4W97A 5ICGA 3GTKJ 2LREA 3DKYA 5HLHA 4UNOA 3L1PA 4Z6YA 4HYEA 1R7JA 2L9RA 1QZZA 3OIQA 2FD5A 3GZ5A 4XKBA 3MD2A 4BJ6C 4BAYA 4HV5A 4BEHA 2YUSA 1QVTA 9ANTA 2JA5J 3IAM2 2E5ZA 2K3FA 1J09A 4UVAA 3DPLC 1HW1A 1CGPA 4XORA 5DD8A 5HLTA 2EV0A 1LB2A 4IHWA 1J2XA 2ZXIA 2L4MA 3MQ0A 2XROA 3AKZA 4LGWA 2EA4A 4G9YA 1ZYRF 3RZDJ 4A3LJ 4M3DA 2XGCA 2OJED 3G3ZA 4LMYA 5FKNA 2F5VA 5KAFC 2MG4A 2RREA 1IO2A 4RB3C 5BS6A 3IL2A 4RAFA 3BQZA 2XUBA 4IKFA 3HXLA 4E70A 1R71A 3CCJI 3S1RJ 3CD6I 3LA2A 2MBFA 3QPTA 2HPIA 3PNVA 3KZIC 4Y4RA 1X1BA 1R58A 3JRAA 4PGHA 1FZPB 5F27A 2X6OA 3QP5A 1IW7F 2B0LA 5FLXK 4XN3A 4IRGA 2BW3A 2KLOA 4XQFA 3SEQA 4QSHA 2HQNA 4JOMA 4D5CA 4E7KA 5LRRA 3FK6A 2MSYA 3O3KA 4CDGA 2CQNA 1ZRDA 2L9SA 5EJCA 1YO5C 5BNGA 3S17J 1XSXA 1XX5A 1RETA 4LLGF 2DQLA 4XBFA 3OYLA 2NVUB 2M45A 1X4OA 2HYJA 3C2GA 3Q9SA 3FXMA 4RGUA 3HSEA 2H1KA 3X2QH 2E1MC 2XRNA 2CUFA 4KIBA 1OLTA 4TV7A 2JT1A 1BA5A 3G1LA 2VKEA 5DYMA 2DA6A 3CJNA 1X1CA 1SFEA 3I59B 3KPHA 3M1CA 5H20A 1A31A 1IXCA 2VQLA 2JPBA 3ZN0A 1ZRFA 1VQ7I 3W6KB 2K4BA 5TJJA 2XVCA 2JVHA 4YRVA 3GWZA 4B48A 1TT0A 1JUPA 1ETXA 2JK3A 4NB5A 3UKGA 2VN2A 4KDPA 2D1VA 2O8KA 2M2EA 3JAMZ 2GA2A 4CA0A 5A2QZ 1W0TA 3MFKA 2HR3A 2B63J 4JP0A 4LG3A 3W2WA 4HLYA 4E7JA 4RAYA 4ZC3A 4MFEA 5B66C 5ICCA 5M5WJ 2EFOA 1SFOJ 5GAGJ 2W1OA 1ZLKA 2K40A 2KZVA 2R7ZJ 3HOUJ 3PL8A 2QBYA 1Y6IA 2LOOA 4IHXA 2A6TA 4A3IJ 2LK2A 2F4OB 4XRFA 3ZPLA 1IGNA 1MNMC 3RKYA 3AG1H 4CZCA 1AWCA 1IN4A 1WHUA 3T8RA 2VKVA 4UB8C 3OYDA 4YIFA 1V4RA 2DMPA 4HOBA 3FXOA 4I02A 2HZDA 4HLXA 1ETWA 3GTQJ 3OYCA 3PQJA 3GF2A 1R00A 2ETHA 5F1JA 1E3PA 1X58A 3ECHA 1L3LA 1BC7C 3M1EA 2KRHA 1ZKGA 3ZMZA 4CICA 5FKKA 5BPDA 1PUEE 1XTAA 4XOTA 1LUJB 1EH8A 2E19A 3WTVC 3ABUA 3M8FA 2CW0F 3K4BA 1XMAA 2XAGA 5K5RA 2COMA 2P5KA 5C3EJ 1I3QJ 3WHCA 3L2QA 2VE9A 3F3XA 4N4OB 2E1CA 2VL8A 2VBXA 3HRUA 2CO5A 1O4XA 2CWEA 1ENHA 2FXAA 2Q8KA 4F91B 4Q5SF 1KYZA 2LTPA 1YYVA 2K7LA 2IGNA 1BIAA 3GO5A 4Y52J 2NAZA 3ZP5A 4KYWA 5L3CA 5HNHA 1H89C 2CFOA 3AL0C 3E5QA 3MZYA 2Z9OA 3VODA 3JRCA 1HBXG 3N97A 1KA8A 5L3DA 2EZHA 2QQAA 5HOOA 1GV2A 2ISYA 3GFJA 3PM1A 2A69F 4K2EA 4S04A 3ZQIA 4HV6A 4XLNF 4DYCA 1SAXA 2WA0A 3CLOA 2HZTA 3DBLB 3EETA 2OUMA 4G12A 2IGMA 4E7ZA 4PDKA 3KCCA 1CF7B 4XLAA 2H1LA 3O6BB 4N9IA 1QPMA 2Z1DA 4IZZA 3GBGA 5M3FJ 3W6VA 3KYCB 3H1CA 1VQOI 3BTIA 1GXQA 4RA2A 2O3FA 2ZNZA 1WSUA 2VBZA 2HYGD 2LY1A 5JFRA 1VQMI 1J7KA 2BY2A 4ZJZA 1I1GA 3NQOA 4IL6C 3PJRA 2PI0A 4WXDA 2K27A 4H4KC 2LRDA 5DUKA 4UB6C 3L2VA 2ZJPF 4DW6A 3I64A 4UUSA 3ERMA 2NRAC 1S7OA 4C9YA 3I3LA 5GP9A 2HVSA 3QPSA 5L3BA 4E7LA 3CCEI 1GLNA 4DIQA 1B8IB 4LOCA 1EH7A 5B5EC 2IA0A 3FDYA 2M7AA 2VJIA 3H92A 1W5CC 1MSFC 4MQ9F 1H9TA 4FE7A 4JBAA 1JGSA 4BQAA 5LGTA 1SFKA 4IXAA 2M3AA 4XSZF 3OSFA 2MLGA 3I59A 3VEPA 4ETSA 2PMZN 2X48A 2OPTA 5C44J 1Z67A 1I6XA 4U7DA 1R5GA 2RAEA 3K70D 4IHVA 2A6EF 3F23A 3A03A 1LFBA 2ZCWA 2E60A 5EEHA 4Q4ZF 2IA2A 3E5XA 4MTDA 5IPAA 4XN0A 3OL4A 4Y15A 4BQQA 4D7MA 5E20A 3U21A 3CF5F 3E6DA 1K4TA 2EIKH 1VNDA 2PMUA 3C7JA 2DOFA 5HS7A 4FISA 3GFIA 2WBMA 3KZYA 1ETYA 4R1HA 3SYTA 4MGRA 1LVKA 3TQNA 5HDNA 1SMYF 3IRQA 4UUVA 2DYRH 1X1PA 2DU9A 3FKJA 1VQ4I 2HKXA 3G2BA 2CQKA 3WTYC 1P6RA 2X51A 1O7FA 4ENKA 4GO1A 1IAWA 3EYIA 1YRNA 4HZFA 1BJZA 2H09A 3OR1C 1WGXA 2ACJA 1WH7A 4EGZA 1BBYA 2G7HA 1MSEC 2O8XA 2X6YA 4ZDOA 2CG4A 2HQRA 4C30A 1WI9A 3RPQA 5E1ZB 4N4NB 3OS1A 1HW5A 2RDPA 4UV8A 2EA2A 3A1YA 3P9IA 2XAQA 2A68F 5BMZA 1IZ1A 4F93B 5B1AH 5ICEA 1ZQ3P 3RZOJ 4ZZDA 2XPUA 3NEUA 2MYSA 2DYSH 3RIRA 2STTA 2IW5A 2JQ7A 2XSJC 3DFGA 2LD5A 1I3AA 3TKYA 2QSFX 3OYGA 1FP1D 2BE5F 1LEBA 2CV2A 4W1UA 3CCYA 3OS0A 5EEAA 4J01A 5DUIA 4X6AJ 1LQ1A 3I56I 2KISA 3CC2I 1MKMA 5CLSA 3O8HA 4B1RA 3D0SA 3K9TA 4BY1J 3JR9A 1HXDA 2BXZA 4OIPF 1NG6A 2BY3A 2B9SA 3KP6A 2ZJRF 2FJ1A 2JSCA 3GTLJ 4EMSA 1JKRC 2BHYA 4LB5A 1KU9A 2DA1A 4KIFA 2JA7J 3Q0UA 5LFAA 1KU2A 3BZ6A 2F4MB 1D1BA 3WE2A 1R49A 1P7IA 1A6QA 1YQAA 2K9QA 3HKZN 2DPDA 4IPAA 1OYWA 2YU9J 4PJJA 1FNNA 1BM9A 5EYRA 5JLWA 4BE2A 4PGGA 1S6LA 2FE3A 2ME6A 3LSHA 1T95A 3S1NJ 3SFIA 4L5EA 5F0HA 4CH7A 2IJLA 3CDLA 2PX9A 4AM3A 5DCMA 5CVJA 1WKMA 3HM5A 5IYBJ 1RR8C 5CVIA 1SD5A 4YIRX 1Y0NA 1FBQA 1XB4A 3OYEA 1S9HA 2H94A 2KHMA 2PFBA 4M6XA 3T1BA 3TP0A 1FTZA 3BTLA 5GADJ 1MH4A 4PJMA 2PN6A 3COAC 1HDDC 4S0HB 3H35A 3HHHA 2W85A 2VKHA 2MFZA 2Y2ZA 5E1WA 3ZMSA 3IV5A 1W4MA 2A05A 2YS9A 2X1EA 2H8WA 4A0XA 3JCUC 3ZQGA 3KE2A 3M3YJ 3U2RA 3PFYA 4IO9F 3BCBA 1W1WE 4BHPA 2Y0MA 3DP7A 4DZPA 3GVAA 1LFPA 1WJAA 1WVRA 3U1DA 3H3UA 4GDFA 5FD6A 3R0AA 3L2RA 2KIFA 1ZG1A 2PQ8A 3V8LA 4RGRA 4WX9A 2PBIA 4O5VA 5CYVA 2XB0X 1YTYA 3FM3A 2A3SA 1S5LC 2CSOA 2IVMA 3KYDB 1YI2I 3WE3A 3K4JA 2DMQA 2Y0SA 1YITI 1A35A 2K9LA 2E1OA 2GM4A 3J80K 3P9CA 1Z91A 2MD0A 1N25A 2L9VA 3BP8A 2BVMA 1JI8A 1T6SA 1OYYA 3SJMA 4XK4A 1AU7A 3H36A 1FPQA 4AVZA 2XDVA 3T0YA 3E3VA 4DJAA 1FX7A 2P0WA 3DEUA 4EM1A 1NHAA 2FOWA 1ETQA 4A2UA 5JI6A 4EVIA 4BNCA 1FT9A 1B9MA 4E7SA 4IF4A 1ZGWA 1VF9A 1Z3YA 3LFUA 1T38A 3FWEA 4G94A 1YFHA 3DF8A 2QENA 4RB2C 3K4CA 1JTYA 3E97A 5F6FA 3HRTA 4WXHA 3RSNA 3IH3A 1ZG3A 2CH0A 1GDTA 5DS9A 3RPUA 3KEOA 3NWSA 1QO0D 1TWHJ 2LP0A 3EQLF 3RPUD 4CSWA 4PZJA 1T98A 3H5NA 2IT0A 3WTXC 3CJRB 2R5YA 4AIKA 1VTNC 1H0MA 1VQPI 4A3MJ 3SDGA 1MGTA 3ABLH 2VOOA 1LJ9A 1TQPA 4EV0A 1DPRA 2ECCA 4KMUX 3CCLI 1WQ2A 3OSGA 4ENNA 1P4WA 1RNLA 5ILSA 3K4KA 1G3TA 3I0TA 4U0YA 4ON0A 4KMFA 2ZXJA 3CJTB 4I2OA 4BE0A 4CXFA 2RNGA 2VJ5A 1ETVA 4L9JA 3BY6A 5E3LA 3A02A 3ML6A 4R79A 2ZJQF 1L0OC 1XMKA 2HTJA 4HF0A 1QHGA 1X2MA 2P81A 3OV8A 1G8XA 5HLGA 1A5JA 2QVOA 4NNJA 2LC2A 4U0VA 2KP6A 3LA7A 3B6CA 3TW7A 5IP7J 5J8CA 1G3YA 4FQGA 1KYWA 1LVAA 2W4SA 5J1YA 4HA8A 2NVYJ 3BOQA 2UZKA 2VLAA 2R0QC 2ZXWH 3SEZA 4RAGA 1GUUA 3J81K 3G1OA 2HOAA 1YRNB 2HOTA 5KHDA 5LEJA 2H8RA 2JN6A 2BV6A 2ZJ2A 2V1UA 5E3OA 1T08B 2JZYA 2W48A 2VI6A 4PJ0C 2P6SA 2AO9A 1IJWC 4HX8A 2LG4A 2E7XA 3DEWA 4V2FA 4A3EJ 3H3ZA 3LAJA 1K7AA 3E6MA 4II2A 2ZFUA 4II3A 3JRHA 3N05A 4GXOA 4BQNA 2LF8A 1Y56A 4AYBA 3BG6A 2MABA 3DXJF 1PP7U 3F8MA 3ASNH 4HRIA 2CS3A 4EATA 2O0YA 5HDGA 2ZO4A 3ZQCA 1UFMA 2FQ4A 5IOZA 4Q48A 3CMMA 1H8AC 3WODF 5F08A 3VOEA 2IP2A 2KRCA 3ZQHA 3B73A 2QGUA 3EUHC 2Q2EB 2VJ4A 4HX4A 1B6AA 1ZELA 2EBIA 5FB2A 1ZGAA 5B1BH 4XOPA 4V2GA 1X3WB 2PJRB 3BJAA 3CC7I 2M8EA 2NVTJ 4LIVA 4M3BA 1DPUA 1PJRA 2R93J 2L7ZA 1G6NA 1H88C 1PYVA 3GTGJ 2QYOA 4KIGA 2Q0OA 1ETKA 3KFWX 1OCRH 4BKXA 5JHUA 3HOZJ 3I71A 2ID6A 1T0FC 4CGZA 2CGPA 1U9NA 4IJAA 2FBHA 4BL0B 3K1NA 3J80Z 1FOKA 2FBKA 1QBJA 2BGCA 1N77A 4EQQA 1YX5A 5EF6A 3LSGA 4X0GA 1D5YA 2L9NA 3Q3SA 4HNVA 5GTHC 4WCGA 3FF5A 4M3FA 3HOYJ 3ZCOA 5IOYA 5IP9J 5F64A 1J9IA 5TRDA 4QPQA 5IT9K 1WJ5A 3RJPA 4P55A 3KP7A 3BDDA 1Z9CA 1O3TA 4OIOF 1SAUA 4YIIA 1GHCA 2JTVA 5J4YA 3K4LA 2M8GX 4QWQA 5CVVA 4XLPF 1V5EA 2JRTA 4O6JA 5F04A 3AAFA 2K86A 1REPC 1U0JA 1SVMA 3G1MA 2I5UA 1MMSA 3REOA 3S93A 3FBIB 3K0LA 4WWCA 2FNAA 4BY7J 3BTJA 1ZR4A 1XGMA 4I0BA 3HEFA 4Z2YA 3J7AO 1FYKA 3HUGB 5ICFA 3C3WA 5LBQA 1ETOA 2ZSIB 5D8LB 1ZARA 4M73A 4HSRA 4LK0F 5TISC 1FP2A 2O6GE 3S3NA 2Z5UA 2NS7A 3AG2H 2STWA 1X1DA 4U0WA 2LVSA 2G9WA 3I58A 3FMSA 4I7HA 2HEOA 2GXGA 1MIJA 2M30A 4RMNA 1FC3A 2L7MP 3W6JB 4C2TA 5HNFA 3CDIA 1BI3A 1WPKA 2MW8A 2K85A 1JXSA 2Z16A 4CCLA 4Y3OA 4P1WA 2DQRA 4ITVA 1WZ2A 4NC8A 1TWAJ 2FX0A 1TL8A 3MKYB 2HOSA 5EZGA 2VT3A 3I4PA 4F7ZA 5JLXA 2EB7A 1MH3A 3K1PA 2UV1A 3DV8A 3TL4X 3TMOA 4ZYEA 1UG2A 1K61A 1FMWA 1BR2A 3WHBA 4EJUA 4PFPA 3F72A 1QZEA 3L2WA 4PUSA 3FX3A 4NC6A 3C18A 3GYHX 4G6DA 2VT2A 4BH9A 2KPMA 1FWZA 1S3JA 2Y30A 5L3EA 3HL2A 1B72A 3LQQA 5CQGA 1LPQA 2F48A 1HW2A 1IG7A 3I5UA 2DT6A 4LLLA 1IRXA 2JRMA 4IX7A 5F1RA 3DPUA 4HAMA 2LFBA 1OR7A 1F43A 4CCJA 2Z99A 1IUFA 3E6BA 5J8FA 3VYUB 1OCTC 5J6XA 4BBSJ 2DA3A 3IWZA 3HOXJ 4RS8A 3JTGA 3VYSB 4BHBA 1K6OA 2ZSHB 2CFXA 1LDKB 2JSPA 3R6SA 2NS0A 1KU3A 3SQNA 1UHWA 1TQMA 2MLKA 4KN7X 2QA4I 3LSJA 5D5WB 4NQWA 4O3MA 1EJ9A 1QVUA 4MFDA 2EIJH 5DD4A 2RC4A 1BN5A 1ON2A 4AUXA 3DTIA 2Y9YA 2KRFA 5LGUA 4D9JA 5HVQC 2XAUA 1JE8A 3PO3J 4ZYGA 1YX3A 3VSKA 2QQ9A 4NC7A 4KT5C 4CCMA 2V6EA 3H9QA 4A3JJ 5FD5A 4QPOA 3RKXA 4F52A 2E7WA 1T39A 3E7LA 3BC8A 2UXNA 3HOTA 2FMLA 2XGXA 2PMZA 3HSRA 4HG2A 1DUXC 4EJWA 2CUEA 1IC8A 1VQ8I 2DAOA 3CMYA 2RGVA 3CCQI 5J1RA 2KDOA 2IS1A 3HZJA 2XC7A 1HCRA 2QQBA 2DA5A 2XF5A 3FKIJ 3QODA 3QU3A 4MQVA 2L7KA 4B3XA 3BR3A 3M7GA 2IA1A 4IHSA 4XLFA 2BVLA 4ANJA 4A6DA 2WY7Q 5FRNA 2QM3A 5FRMA 4D1QA 5DM7F 2BW3B 3SHFA 2HXIA 1Y8QB 2M0MA 2V1NA 4HPQA 3BWGA 2O61A 3HOWJ 1XSDA 3F8NA 1A6IA 2ISZA 3GMEA 2DCEA 3ZGKA 1W7PA 2M87A 3DBRB 2WADA 3MKLA 2FSWA 2R5ZB 1LFUP 3I53A 1GXPA 2M4GA 2XPWA 4FETA 3V7SA 1PVEA 5KAIC 1P9QC 2DBBA 6PAXA 1SVLA 4HNTA 4ZYHA 2CQXA 5IT9Z 4RGXA 1DU6A 2DT7B 2GIVA 3GCMA 4UVCA 5C4JJ 3WG7H 3FXJA 3FXKA 3SXYA 1QRYA 4G6TB 2M9HA 1LE8B 5F0CA 3RKWA 2V79A 4EM0B 3ZOBA 2G7UA 3MVPA 3DCFA 4LJZF 2HVQA 2ESNA 1MNEA 5K5QA 1D3YA 3B6AA 3Q0VA 1RR7A 1B4AA 1IDYA 1D0YA 1SANA 3G6EI 3PUBA 1NTCA 3DEEA 2A5WA 3M8JA 5J1UA 1OKRA 3LSRA 2LDUA 3HYIA 1JGGA 4EJVA 2R7VA 3K70C 2OCEA 2ZNYA 1I27A 3H9GA 1VFCA 3HOVJ 4UY8I 4OIRF 3ABTA 3F21A 1X2NA 3JW4A 1WCMJ 2L02A 1MMAA 1SFXA 2V6CA 4UUTA 2JA8J 4A3BJ 1GVJA 1BC8C 1S7AA 2TCTA 3PQKA 5K5OA 2QWWA 2FNPA 3EYYA 1RC9A 2P7CB 2UWMA 1P92A 1OCZH 1P4XA 2M7BA 3BG9A 4P5OA 3OMYA 4OAYA 4B43A 2CW7A 1Y8RB 1TQIA 4DYQA 2YX7A 2KL4A 1OCCH 1O57A 5H6QA 1JJ6C 1TNTA 1FIPA 2L7FP 2DMTA 3QOEA 3CP8A 5DTDA 4D0PA 4E4HA 3C2BA 2VC1A 3QQAA 3P7NA 4G6QA 5A2QK 1Z6TA 2AS5F 3E5UA 1I1SA 1U2WA 4PCQA 4RBOA 1V3FA 4F92B 2AQEA 1LKXA 4EM2A 2O9LA 1CQTA 4GCVA 3I54A 2E2HJ 1DDNA 3F6VA 3PNTA 3F9KA 4YELA 4OAZA 2WV1A 5J3LA 2HU9A 2HPMA 1P2FA 4XL9A 3DTKA 2RKHA 1XCVA 4A0ZA 1MBJA 3C2HA 1XS9A 2XSDC 5FFXA 2ZB9A 4BHCA 1MNDA 2GAUA 2GLOA 2MA3A 3FHNA 1MMNA 2M4KA 5JVGF 1E2XA 4LIUA 3OYFA 4I76A 1TW2A 2X1DA 2WWYA 2DOEA 4IVNA 3L7WA 4BJTA 1HOMA 2GIZA 1WH5A 2K5CA 2QF7A 3O2PE 3K4MA 1V54H 1K78A 4XRSA 1V5FA 4BACA 2VB6A 3K69A 3L2CA 2FBIA 4YFXF 2NNNA 2BYVE 1YJ9I 4M9SA 4BE1A 1HKTA 4UVBA 1OCPA 2IS4A 2WAEA 2KJCA 2NVXJ 2EV6A 4OIQF 2OA4A 1ZR2A 4AC0A 3NWTA 3AL0B 1R5HA 5BQTA 4Y7NJ 1MBHA 3BLYA 4PSWA 2NNYA 2UXXA 2VQHA 2LR8A 1BR1A 2QCOA 2Z33A 2YSRA 5D5XB 1R36A 3FXLA 3BZCA 1FJLA 1FIAA 3OYIA 3CCRI 4C2UA 3HB9A 1W0UA 3ZMVA 4XRMA 2VQGA 4QLCU 3CTAA 4HW0A 4CUGA 3OOPA 1JHHA 4OMZA 4YFNF 2OD5A 3WU2C 2LYCA 4EGYA 1A36A 2EFWA 3CUOA 1ZHFA 3JREA 2PJRA 5ED4A 3O8GA 1WRJA 4U88A 1GT0C 4M3GA 1E0EA 4BXXJ 4PSXA 3ZRGA 2JUCA 2VBYA 4EEFG 4L0ZB 3UR3C 4BEHB 2DA2A 1TC3C 2X4HA 4S05A 3EDPA 3HRMA 1Z6RA 2JPCA 3K1MA 4HQEA 2W57A 1DGWY 1XCBA 4KFCA 4BYYA 1TNSA 3HTSB 1W7PD 1R22A 4ABZA 3WU1B 3FK7A 2Y69H 2E35A 3EPZA 3TOAA 1O3RA 3VFZA 4M9XA 3GZ6A 3K2ZA 2F5CA 2IAIA 3HDDA 4CZZA 4JK1X 2JUGA 4CYCA 1OISA 4CO8A 4RB0A 1ZRCA 1D8KA 1APLC 1ZGJA 1BOAA 2RVCA 1DP7P 2WTEA 4UV9A 2FF4A 4EJOA 2RQQA 3D1NI 4NQWB 2V9VA 1F5TA 5E17F 3DBHB 1P4AA 1ONVA 1HDPA 4A12A 1HSTA 3KP3A 2DW4A 2R3SA 3EUKL 1J59A 4IRIA 2I8DA 1UMQA 2PMHA 2TRTA 1DP3A 3ESWB 4GYIA 4BJ5C 1OPCA 3S15J 4ZTFA 2GZWA 4Y17A 4IQJA 2R7TA 2G0EA 1OYIA 1SMTA 3OYBA 1USSA 1YW9A 4XNFA 1ZTRA 5LRSA 1IV8A 1IXSB 2JVGA 4FE4A 4A5NA 3CO6C 5EEGA 4IHYA 1RI7A 1PP8F 2CUJA 3BR2A 4ASNA 2CJJA 4B44A 4AIDA 2ELJA 2LKXA 1BL0A 2VQCA 3FZVA 1QGPA 4DBQA 3VSLA 2KQRA 3HJEA 1FOWA 4KJZA 4A3GJ 2Y31A 2X6XA 4AWXB 1IRGA 2GXAA 1VQ5I 1UHSA 2EK5A 4XSXF 4AYBN 1JUMA 4L9NA 5LD2C 2ZMEC 1WJCA 2W24A 3TDZC 1AKHB 1MMGA 4IOAF 4I98B 1IRZA 3JRFA 1WJFA 3V8JA 2HFHA 2FOKA 4J19A 3OYMA 1JTXA 4RDUA 1TWGJ 1QPIA 3F8BA 3ZQLA 3CJQB 2NYXA 1S72I 1UCRA 4FT8A 4HX7A 1PDNC 4AVPA 1Q1HA 2DXIA 5GTIC 1KZHA 1LE8A 3Q9VA 1IRFA 1AA7A 3WG9A 3GLXA 1YG2A 2IBDA 2IEKA 2A07F 1I5ZA 2M1BA 1Z7UA 1TZLA 3CUQB 3HGYA 2PJPA 2LNBA 1WFXA 1WI3A 2DTZA 2OF7A 3FBNB 3QU6A 5HLIA 4C3JJ 1ODDA 2L5QA 5EGOB 1XD7A 1WWXA 1D1CA 2LY9A 3HBLA 2HQAA 4OINF 3A2KA 3GTJJ 5HS9A 1D1AA 5FGMA 3IAS2 4RLFA 2F2EA 3KLNA 2DFHA 1SEUA 3JRIA 5K1YA 2CQQA 2NOJB 3ASOH 3NRVA 5FJ8J 1TLHB 1U5TA 4P96A 2IXSA 2Y75A 2BZTA 2DK5A 4GYGA 1FBSA 1Z21A 4V19K 1OQYA 3TO7A 4DZJA 1B59A 1RPWA 2UUZA 1ZK8A 5K7HA 2F5FA 2VASA 1YJNI 4PJNA 2QEXI 4P9FA 1JT0A 1QA6A 1U5TC 1JHFA 2XF6A 5AIPA 4WF2A 2CV0A 1Z7LA 3RCOA 3DLAA 3ZXSA 2HDWA 5FO5A 3HPHA 1XSVA 3WTZA 1E3HA 5GAHJ 3C1DA 2W25A 3H5RA 3OYAA 1T2KA 3BG3A 3ZQFA 1R1VA 3MWMA 1K6YA 4KT6A 4M3EA 2P6TA 1T56A 2XGDA 2IGOA 2B7EA 2OU2A 4MO7A 2R7RA 2HDCA 2LMDA 4HF2A 1XG1A 2DODA 1N78A 1O7LA 1YOVB 5DM6F 1DU0A 2K9NA 3GFLA 1NG7A 1W5SA 2DMNA 3DKWA 2RN7A 1G2HA 1R1UA 2P4WA 3KP5A 1RZ4A 4F55A 1NK3P 2O7OA 5GAEJ 2ECBA 3JAMK 2EZIA 5KNLA 2N8GA 2V9PA 3V7CA 4ZYDA 3H5AA 1D0ZA 2R92J 1F9NA 3FIWA 2I10A 5D4SA 2HQ5A 2J5OA 1YJWI 2OTJI 3A0BC 3DU6A 4PK4A 3MEXA 3GTMJ 5FLVA 1MBFA 5DV5A 2M5WA 2LH9A 5D5VB 2W84A 2Q2EA 3TOBA 3G73A 2IS6A 3F0CA 5K7FA 1UHMA 1YW7A 3HUGA 3MZ8A 3P9KA 1Z3XA 2X0LA 2D45A 2OZ6A 4GRIA 1GV5A 2LBFA 5FKOA 5GPAA 1BI2A 2V1DA 1R5ID 2KIMA 3TO9A 3QP6A 3RI4A 1MDMA 3RKQA 1TP4A 5E1XA 2VXDA 2XPVA 5E3NA 4R8HA 4AD9A 5IT3A
chains in the Genus database with same CATH topology
5HS8A 4YFKF 2DLLA 1J0RA 3EUHA 1XDUA 4EJTA 5LHGA 2ZKZA 5H6RA 2EFPA 2DK8A 5HDKA 5JR3A 1USTA 4KICA 1FY7A 2D1HA 2MC3A 2WV0A 2HWVA 2XKOA 2WC2A 2RNJA 1KQ0A 1FSEA 2GWRA 3ZMTA 5LHIA 2FMYA 1ZREA 1E17A 2F5EA 2RQPA 2XASA 3CUQC 1F4KA 3LA3A 3L9FA 2OBPA 2L4AA 3GUDA 2DTRA 4RGSA 2GA1A 4WXCA 4MEXF 4L18B 4DNCA 1A04A 3HRSA 3T8TA 5E8GA 2K02A 4ZZLA 4BXUA 3MCZA 2MD5A 4MNUA 3TO6A 4Y13A 4YG2F 4ESBA 4L5IA 3QPHA 1LEAA 3J81Z 1QNTA 2XAFA 5D8KB 2EWNA 1UB9A 2ZMEB 5L3GA 2GXBA 2IPQX 2ADUA 1TBXA 2LF7A 4Q47A 1IN5A 2R7DA 3ISPA 4MTEA 3TDUC 2YU3A 4M71A 3S2WA 3V7RA 4A0YA 3RDIA 2D2WA 3ELKA 2VBWA 4B8XA 4B09A 1FYLA 2PEXA 3RYPA 4M72A 4G8XA 4G7ZF 1SD7A 3FMQA 1R1TA 2PG4A 2L01A 3HSFA 5AONA 2KIUA 4OOIA 1U5TB 5LGNA 5FLXZ 2Z3YA 4DQ2A 2DO7A 4UXNA 4LD5A 2KKOA 3QAHA 4LG0A 5ILVA 4AIHA 2P7VB 2RV8A 1ULYA 1FSHA 2L54A 1FLIA 1MJ9A 2EV5A 2XAHA 3E6CC 2HGCA 5D5UB 3BJ6A 3DQVC 2HS5A 1W7PB 1ZLJA 2P8TA 2ESHA 2VE8A 4ESJA 2HOEA 5LLQA 4ZH4F 2YX4A 3HIFA 2H6BA 2MH9A 4M6YA 2EJRA 2MH2A 3IKTA 3FXQA 4ENMA 4KA4A 2E1NA 3R4KA 3FXRA 3R0JA 1W5TA 1QZYA 2LKPA 2VXZA 3BPVA 1IN7A 4L0YB 2AXLA 2ZBKA 2O03A 3RYRA 3SFZA 3FXUA 1STZA 3QOPA 4G7HF 1HKQA 3F8CA 2ZMEA 4LK1F 3WGHA 3FM5A 1YLFA 3ZMDA 2H27A 2GQQA 5DEQA 1BI1A 1RUOA 5DDGA 1O3SA 3ZQ7A 1D5VA 1XGSA 4I09A 2ZFWA 3WU0A 2FA5A 1RUNA 1BJAA 1AOYA 1MZBA 3IKVA 4CYDA 1MD0A 5CJ9A 3M8EA 3KETA 1K79A 5JVTA 1XN7A 5D6FA 1MDMB 1C0WA 2L3DA 4IRHA 3B02A 4KUMA 2VC0A 2VOPA 5CVRA 3JSOA 2A61A 3F22A 2P5LC 4FHTA 1U78A 1KQ8A 2XAJA 5LEKA 3VB2A 5DCMB 3PFIA 4FX0A 2FU4A 3MZHA 1Z05A 3D5LA 1D8JA 3KEQA 1KU7A 3LSTA 4HDVA 4P9UA 4OMYA 1ZN2A 2YPRA 3TGNA 1Y0UA 2HKOA 1YS7A 4I01A 2P5VA 1ZAOA 1HQCA 2BEOA 5L3FA 2IRFG 4RB1A 4L9VA 1KGSA 1IN6A 2EFNA 1XDSA 3U9GA 4A6EA 1IUYA 1BI0A 1MJBA 3IHUA 1QQIA 3RTRA 4HBLA 3KP2A 3BROA 2OZUA 3HTUA 4LG0B 2QZ8A 3WTWC 1ON1A 3N4MA 2YR2A 1KQ9A 4CHUA 2VODA 1S8NA 5E8IA 1SD4A 3IC7A 2FRHA 4IHTA 5E18F 1TTYA 3M9AA 2HYFA 5KVRA 4N9HA 1TW3A 1OMIA 3R60A 1IF1A 3LQRA 2DPUA 3KP4A 1CF7A 5D6EA 4HDUA 3ULQB 4NHJA 3ROUA 3Q5FA 4KNYA 3WTUC 4OU0A 1XGNA 3GW2A 2PLYA 1X3UA 2QBYB 1T0FA 3BJOA 2XV4S 3KLOA 1HSJA 3FMRA 2DFIA 1MJAA 1YIOA 2QUFA 1EV7A 3DPTA 4ENJA 3IRRA 3WGGA 1B1BA 2DT5A 4MEYF 1LDJA 2TDXA 3GEZA 3JSPA 3CUQA 3GFMA 4KN4X 2A6HF 2R7FA 5KK1A 1IXRC 1FYMA 1U8RA 4GGGA 5AIQA 4M9ZA 2F5DA 3FHZA 1YS6A 1ZG5A 4I0AA 4L9TA 5BOXA 1IN8A 1K78B 4AIJA 2XHKA 4LLNA 1BIBA 1G3WA 3HHGA 1B9NA 4LB6B 1SD6A 5ILUA 3SZPA 3ZMUA 4HQMA 3L00A 5BPIA 3BPXA 3JTHA 2DI3A 3QRFF 2J5PA 1O3QA 5FFZA 4HF1A 1SFUA 2VONA 5D4RA 1U3EM 3SZTA 1EH6A 1ZH5A 4UHTA 3LWFA 3WTTC 2K4JA 5DCFA 1G4DA 1FBUA 3ECOA 3ERED 3WGIA 3KZZA 3ZN1A 4WK8F 4FX4A 1H9GA 4U7BA 3WTSC 1LNWA 2OAZA 3IWFA 2FQ3A 5ERIA 2QLZA 4M74A 3CDHA 3V8KA 2A5YB 2OQGA 4ESFA 4A5MA 4JQFA 1F1ZA 3HOSA 3R61A 1HKSA 3F6OA 1RIOH 3CO7C 2V1XA 2HTSA 2CYYA 1G3SA 4L5JA 4N0BA 1Z1DA 3L09A 3T5XA 4LFUA 2H6CA 2C6YA 3LAPA 2LSOA 3F8FA 4RAZA 5CVUA 2FEZA 1S29A 1R23A 2KJBA 1YW8A 2XKPA 1XGOA 1LDDA 5LHHA 2OQRA 4H0EA 2EFQA 3GXOA 3MAJA 3V4GA 2XIGA 1J5YA 1J75A 1U6GA 4G7OF 4MHGA 3LFKA 2ELHA 2BBYA 3GX4X 2Y48A 5ICGA 5HLHA 4UNOA 4HYEA 1R7JA 1QZZA 3GZ5A 4BAYA 4HV5A 4UVAA 3DPLC 1HW1A 1CGPA 5DD8A 2EV0A 1LB2A 1J2XA 2L4MA 3MQ0A 2XROA 4LGWA 2EA4A 4G9YA 1ZYRF 3G3ZA 4LMYA 4RB3C 5BS6A 3IL2A 2XUBA 4E70A 3LA2A 2MBFA 3QPTA 1R58A 4PGHA 1FZPB 3QP5A 1IW7F 2B0LA 5FLXK 4IRGA 2HQNA 5LRRA 3O3KA 4CDGA 1ZRDA 1YO5C 1XSXA 4LLGF 4XBFA 2DQLA 2M45A 3Q9SA 4RGUA 3HSEA 2XRNA 4KIBA 4TV7A 2JT1A 5DYMA 3CJNA 3I59B 1SFEA 5H20A 1IXCA 2JPBA 3ZN0A 1ZRFA 3W6KB 2K4BA 5TJJA 2XVCA 3GWZA 4KDPA 4NB5A 2VN2A 2D1VA 3JAMZ 2GA2A 5A2QZ 3MFKA 2HR3A 4HLYA 4RAYA 5ICCA 2EFOA 1ZLKA 2QBYA 4XRFA 3ZPLA 3RKYA 1AWCA 1IN4A 3T8RA 4YIFA 1V4RA 4HOBA 4I02A 4HLXA 3PQJA 3GF2A 1R00A 2ETHA 3ECHA 1L3LA 1BC7C 3M1EA 3ZMZA 4CICA 5BPDA 1PUEE 1EH8A 3WTVC 3ABUA 3M8FA 2CW0F 1XMAA 2XAGA 5K5RA 2COMA 2P5KA 2VE9A 3F3XA 2E1CA 2VBXA 3HRUA 2CO5A 2CWEA 2FXAA 2Q8KA 4Q5SF 1KYZA 1YYVA 2K7LA 1BIAA 3GO5A 2NAZA 3ZP5A 4KYWA 5L3CA 3E5QA 3MZYA 2Z9OA 3VODA 1HBXG 3N97A 1KA8A 5L3DA 5HOOA 2QQAA 2ISYA 3GFJA 2A69F 4K2EA 4S04A 4HV6A 4XLNF 1SAXA 3CLOA 2HZTA 3EETA 4PDKA 3KCCA 1CF7B 3O6BB 4N9IA 1QPMA 1GXQA 2O3FA 2ZNZA 1WSUA 2VBZA 2HYGD 5JFRA 1J7KA 1I1GA 3NQOA 2PI0A 4WXDA 2K27A 5DUKA 3I64A 2NRAC 1S7OA 5L3BA 1EH7A 2IA0A 3H92A 4MQ9F 1H9TA 4JBAA 1JGSA 4BQAA 5LGTA 4IXAA 4XSZF 4ETSA 2MLGA 3I59A 3VEPA 1I6XA 4U7DA 1R5GA 2A6EF 3F23A 2ZCWA 5EEHA 4Q4ZF 2IA2A 3E5XA 4MTDA 4Y15A 5E20A 3E6DA 2PMUA 3C7JA 5HS7A 3GFIA 3KZYA 4R1HA 3TQNA 4MGRA 5HDNA 1SMYF 3IRQA 4UUVA 2DU9A 2HKXA 2CQKA 3WTYC 1P6RA 1O7FA 4ENKA 4GO1A 1IAWA 3EYIA 4HZFA 2H09A 2ACJA 4EGZA 1BBYA 2G7HA 2O8XA 2CG4A 2HQRA 1WI9A 3RPQA 5E1ZB 1HW5A 2RDPA 4UV8A 2EA2A 3P9IA 2XAQA 2A68F 5BMZA 1IZ1A 5ICEA 4ZZDA 3NEUA 3RIRA 2STTA 2IW5A 3DFGA 3TKYA 1FP1D 2BE5F 1LEBA 5DUIA 1LQ1A 1MKMA 5CLSA 3D0SA 3K9TA 1HXDA 4OIPF 3KP6A 2JSCA 4EMSA 4LB5A 1KU9A 4KIFA 1KU2A 3BZ6A 3WE2A 1YQAA 2DPDA 4IPAA 1OYWA 1FNNA 1BM9A 4PGGA 1S6LA 2FE3A 2IJLA 5DCMA 5CVJA 1WKMA 5CVIA 1SD5A 1FBQA 1XB4A 2H94A 4M6XA 2PFBA 3T1BA 2PN6A 3COAC 3HHHA 2W85A 5E1WA 3ZMSA 1W4MA 4A0XA 3KE2A 3U2RA 4BHPA 2Y0MA 3DP7A 3GVAA 3U1DA 3H3UA 5FD6A 1ZG1A 3R0AA 2KIFA 2PQ8A 3V8LA 4RGRA 4WX9A 2PBIA 4O5VA 5CYVA 1YTYA 3FM3A 2A3SA 2CSOA 2IVMA 3WE3A 3J80K 3P9CA 1Z91A 3BP8A 1T6SA 1OYYA 1FPQA 3T0YA 3E3VA 1FX7A 3DEUA 4EM1A 1NHAA 4A2UA 5JI6A 4EVIA 4BNCA 1FT9A 1B9MA 4IF4A 1T38A 3FWEA 4G94A 1YFHA 3DF8A 2QENA 4RB2C 3E97A 5F6FA 3HRTA 4WXHA 1ZG3A 3RPUA 3KEOA 1QO0D 3EQLF 4PZJA 1T98A 2IT0A 3WTXC 4AIKA 1VTNC 1H0MA 1MGTA 2VOOA 1LJ9A 1TQPA 4EV0A 1DPRA 4KMUX 1WQ2A 4ENNA 1P4WA 1RNLA 5ILSA 1G3TA 3I0TA 4U0YA 4ON0A 4KMFA 2ZXJA 4I2OA 4CXFA 4L9JA 3BY6A 4R79A 3ML6A 1L0OC 1XMKA 2HTJA 4HF0A 3OV8A 5HLGA 2QVOA 4U0VA 3LA7A 5J8CA 1G3YA 1KYWA 1LVAA 4HA8A 3BOQA 2UZKA 3J81K 5LEJA 2BV6A 2ZJ2A 2V1UA 2JZYA 2P6SA 4HX8A 2E7XA 3H3ZA 3LAJA 1K7AA 3E6MA 4GXOA 2LF8A 3DXJF 1PP7U 3F8MA 2O0YA 5HDGA 2ZO4A 1UFMA 4Q48A 3WODF 3VOEA 2IP2A 3B73A 4HX4A 1B6AA 5FB2A 1ZGAA 3BJAA 2M8EA 1DPUA 1G6NA 2QYOA 4KIGA 2Q0OA 3KFWX 5JHUA 3I71A 4CGZA 2CGPA 4IJAA 2FBHA 3K1NA 3J80Z 1FOKA 2FBKA 1QBJA 2BGCA 4EQQA 4WCGA 3FF5A 5F64A 1J9IA 5TRDA 5IT9K 3RJPA 4P55A 3KP7A 3BDDA 1Z9CA 4OIOF 1O3TA 4YIIA 1GHCA 2JTVA 4QWQA 4XLPF 5CVVA 2JRTA 4O6JA 3AAFA 2K86A 1REPC 3REOA 3K0LA 4WWCA 2FNAA 1XGMA 4I0BA 4Z2YA 3J7AO 1FYKA 5ICFA 3C3WA 5LBQA 5D8LB 1ZARA 4M73A 4LK0F 1FP2A 2O6GE 2Z5UA 2STWA 4U0WA 2G9WA 3I58A 3FMSA 4I7HA 2HEOA 2GXGA 2M30A 1FC3A 3W6JB 1BI3A 1JXSA 2DQRA 2VT3A 3I4PA 4F7ZA 2EB7A 3K1PA 3DV8A 4ZYEA 4EJUA 3F72A 3FX3A 3C18A 3GYHX 4G6DA 2VT2A 4BH9A 1FWZA 1S3JA 5L3EA 3LQQA 1HW2A 3I5UA 4LLLA 5F1RA 4HAMA 1OR7A 2Z99A 3E6BA 5J8FA 5J6XA 3IWZA 4RS8A 3JTGA 4BHBA 1K6OA 2CFXA 1LDKB 3R6SA 2NS0A 3SQNA 1KU3A 1UHWA 1TQMA 2MLKA 4KN7X 5D5WB 4NQWA 4O3MA 5DD4A 2RC4A 1BN5A 1ON2A 2KRFA 5LGUA 5HVQC 1JE8A 4ZYGA 2QQ9A 4KT5C 5FD5A 3RKXA 1T39A 2E7WA 2UXNA 3HOTA 2FMLA 2XGXA 3HSRA 1DUXC 4EJWA 2DAOA 2RGVA 2QQBA 3QU3A 4MQVA 3M7GA 2IA1A 4IHSA 4A6DA 2QM3A 3SHFA 3BWGA 2O61A 1XSDA 3F8NA 2ISZA 1W7PA 2M87A 2FSWA 3I53A 1GXPA 3V7SA 2DBBA 6PAXA 5IT9Z 4ZYHA 4RGXA 2GIVA 4UVCA 3SXYA 3RKWA 2V79A 4EM0B 2G7UA 4LJZF 2ESNA 5K5QA 1D3YA 1B4AA 1OKRA 2LDUA 3HYIA 4EJVA 2ZNYA 1I27A 4OIRF 3ABTA 3F21A 3JW4A 2L02A 1SFXA 2V6CA 1GVJA 1BC8C 1S7AA 3PQKA 5K5OA 2QWWA 2FNPA 3EYYA 2P7CB 2UWMA 1P92A 1P4XA 4P5OA 1TQIA 2YX7A 5H6QA 1O57A 1TNTA 4D0PA 2VC1A 4G6QA 3P7NA 5A2QK 1Z6TA 2AS5F 3E5UA 1I1SA 1U2WA 4PCQA 1V3FA 4EM2A 4GCVA 3I54A 1DDNA 3F6VA 1P2FA 2RKHA 1XCVA 4A0ZA 5FFXA 4BHCA 2GAUA 2MA3A 1E2XA 1TW2A 2WWYA 4IVNA 3L7WA 3O2PE 1K78A 3K69A 3L2CA 2FBIA 4YFXF 2NNNA 2BYVE 4M9SA 1HKTA 4UVBA 2KJCA 2EV6A 4OIQF 2OA4A 1R5HA 5BQTA 2NNYA 2UXXA 2Z33A 2YSRA 5D5XB 1R36A 3ZMVA 4QLCU 3CTAA 4HW0A 3OOPA 1JHHA 4OMZA 4YFNF 2OD5A 4EGYA 2EFWA 3CUOA 1ZHFA 5ED4A 1WRJA 4U88A 2VBYA 4L0ZB 2X4HA 4S05A 3EDPA 3HRMA 1Z6RA 2JPCA 3K1MA 4HQEA 2W57A 1XCBA 4KFCA 4BYYA 1TNSA 3HTSB 1W7PD 1R22A 3WU1B 3TOAA 1O3RA 3VFZA 4M9XA 3GZ6A 3K2ZA 2F5CA 4CZZA 4JK1X 4CO8A 4RB0A 1ZRCA 1D8KA 1ZGJA 1BOAA 2RVCA 1DP7P 2WTEA 4UV9A 2FF4A 4EJOA 1F5TA 5E17F 2V9VA 1P4AA 1ONVA 4A12A 1HSTA 3KP3A 2DW4A 2R3SA 4IRIA 1J59A 2PMHA 4GYIA 1OPCA 2GZWA 4Y17A 1OYIA 1SMTA 1USSA 1YW9A 5LRSA 1IXSB 4A5NA 3CO6C 5EEGA 1RI7A 1PP8F 4ASNA 3FZVA 1QGPA 4AWXB 1IRGA 2EK5A 4XSXF 4L9NA 2W24A 3TDZC 4I98B 3V8JA 2HFHA 2FOKA 3F8BA 2NYXA 1UCRA 4FT8A 4HX7A 1PDNC 4AVPA 1Q1HA 3Q9VA 1IRFA 3WG9A 3GLXA 1YG2A 2A07F 1I5ZA 2M1BA 1Z7UA 3CUQB 2PJPA 2LNBA 3QU6A 5HLIA 1ODDA 1XD7A 1WWXA 4OINF 5HS9A 5FGMA 2F2EA 3KLNA 5K1YA 3NRVA 1TLHB 1U5TA 4P96A 2Y75A 2DK5A 4GYGA 1FBSA 3TO7A 1B59A 2F5FA 4P9FA 1U5TC 1JHFA 5AIPA 4WF2A 5FO5A 1XSVA 3WTZA 3C1DA 2W25A 1T2KA 1R1VA 3MWMA 2P6TA 2OU2A 2HDCA 4HF2A 1O7LA 3GFLA 1W5SA 3DKWA 2RN7A 1R1UA 2P4WA 3KP5A 1RZ4A 3JAMK 3V7CA 4ZYDA 1F9NA 5D4SA 2J5OA 3MEXA 5DV5A 2M5WA 5D5VB 2W84A 2Q2EA 3TOBA 3G73A 1UHMA 1YW7A 3HUGA 3P9KA 2X0LA 2D45A 2OZ6A 1BI2A 2V1DA 2KIMA 3TO9A 3QP6A 3RI4A 1MDMA 5E1XA 4R8HA 4AD9A 5IT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS8 A;  4YFK F;  2DLL A;  1J0R A;  3EUH A;  1XDU A;  4EJT A;  5LHG A;  2ZKZ A;  5H6R A;  2EFP A;  2DK8 A;  5HDK A;  5JR3 A;  1UST A;  4KIC A;  1FY7 A;  2D1H A;  2MC3 A;  2WV0 A;  2HWV A;  2XKO A;  2WC2 A;  2RNJ A;  1KQ0 A;  1FSE A;  2GWR A;  3ZMT A;  5LHI A;  2FMY A;  1ZRE A;  1E17 A;  2F5E A;  2RQP A;  2XAS A;  3CUQ C;  1F4K A;  3LA3 A;  3L9F A;  2OBP A;  2L4A A;  3GUD A;  2DTR A;  4RGS A;  2GA1 A;  4WXC A;  4MEX F;  4L18 B;  4DNC A;  1A04 A;  3HRS A;  3T8T A;  5E8G A;  2K02 A;  4ZZL A;  4BXU A;  3MCZ A;  2MD5 A;  4MNU A;  3TO6 A;  4Y13 A;  4YG2 F;  4ESB A;  4L5I A;  3QPH A;  1LEA A;  3J81 Z;  1QNT A;  2XAF A;  5D8K B;  2EWN A;  1UB9 A;  2ZME B;  5L3G A;  2GXB A;  2IPQ X;  2ADU A;  1TBX A;  2LF7 A;  4Q47 A;  1IN5 A;  2R7D A;  3ISP A;  4MTE A;  3TDU C;  2YU3 A;  4M71 A;  3S2W A;  3V7R A;  4A0Y A;  3RDI A;  2D2W A;  3ELK A;  2VBW A;  4B8X A;  4B09 A;  1FYL A;  2PEX A;  3RYP A;  4M72 A;  4G8X A;  4G7Z F;  1SD7 A;  3FMQ A;  1R1T A;  2PG4 A;  2L01 A;  3HSF A;  5AON A;  2KIU A;  4OOI A;  1U5T B;  5LGN A;  5FLX Z;  2Z3Y A;  4DQ2 A;  2DO7 A;  4UXN A;  4LD5 A;  2KKO A;  3QAH A;  4LG0 A;  5ILV A;  4AIH A;  2P7V B;  2RV8 A;  1ULY A;  1FSH A;  2L54 A;  1FLI A;  1MJ9 A;  2EV5 A;  2XAH A;  3E6C C;  2HGC A;  5D5U B;  3BJ6 A;  3DQV C;  2HS5 A;  1W7P B;  1ZLJ A;  2P8T A;  2ESH A;  2VE8 A;  4ESJ A;  2HOE A;  5LLQ A;  4ZH4 F;  2YX4 A;  3HIF A;  2H6B A;  2MH9 A;  4M6Y A;  2EJR A;  2MH2 A;  3IKT A;  3FXQ A;  4ENM A;  4KA4 A;  2E1N A;  3R4K A;  3FXR A;  3R0J A;  1W5T A;  1QZY A;  2LKP A;  2VXZ A;  3BPV A;  1IN7 A;  4L0Y B;  2AXL A;  2ZBK A;  2O03 A;  3RYR A;  3SFZ A;  3FXU A;  1STZ A;  3QOP A;  4G7H F;  1HKQ A;  3F8C A;  2ZME A;  4LK1 F;  3WGH A;  3FM5 A;  1YLF A;  3ZMD A;  2H27 A;  2GQQ A;  5DEQ A;  1BI1 A;  1RUO A;  5DDG A;  1O3S A;  3ZQ7 A;  1D5V A;  1XGS A;  4I09 A;  2ZFW A;  3WU0 A;  2FA5 A;  1RUN A;  1BJA A;  1AOY A;  1MZB A;  3IKV A;  4CYD A;  1MD0 A;  5CJ9 A;  3M8E A;  3KET A;  1K79 A;  5JVT A;  1XN7 A;  5D6F A;  1MDM B;  1C0W A;  2L3D A;  4IRH A;  3B02 A;  4KUM A;  2VC0 A;  2VOP A;  5CVR A;  3JSO A;  2A61 A;  3F22 A;  2P5L C;  4FHT A;  1U78 A;  1KQ8 A;  2XAJ A;  5LEK A;  3VB2 A;  5DCM B;  3PFI A;  4FX0 A;  2FU4 A;  3MZH A;  1Z05 A;  3D5L A;  1D8J A;  3KEQ A;  1KU7 A;  3LST A;  4HDV A;  4P9U A;  4OMY A;  1ZN2 A;  2YPR A;  3TGN A;  1Y0U A;  2HKO A;  1YS7 A;  4I01 A;  2P5V A;  1ZAO A;  1HQC A;  2BEO A;  5L3F A;  2IRF G;  4RB1 A;  4L9V A;  1KGS A;  1IN6 A;  2EFN A;  1XDS A;  3U9G A;  4A6E A;  1IUY A;  1BI0 A;  1MJB A;  3IHU A;  1QQI A;  3RTR A;  4HBL A;  3KP2 A;  3BRO A;  2OZU A;  3HTU A;  4LG0 B;  2QZ8 A;  3WTW C;  1ON1 A;  3N4M A;  2YR2 A;  1KQ9 A;  4CHU A;  2VOD A;  1S8N A;  5E8I A;  1SD4 A;  3IC7 A;  2FRH A;  4IHT A;  5E18 F;  1TTY A;  3M9A A;  2HYF A;  5KVR A;  4N9H A;  1TW3 A;  1OMI A;  3R60 A;  1IF1 A;  3LQR A;  2DPU A;  3KP4 A;  1CF7 A;  5D6E A;  4HDU A;  3ULQ B;  4NHJ A;  3ROU A;  3Q5F A;  4KNY A;  3WTU C;  4OU0 A;  1XGN A;  3GW2 A;  2PLY A;  1X3U A;  2QBY B;  1T0F A;  3BJO A;  2XV4 S;  3KLO A;  1HSJ A;  3FMR A;  2DFI A;  1MJA A;  1YIO A;  2QUF A;  1EV7 A;  3DPT A;  4ENJ A;  3IRR A;  3WGG A;  1B1B A;  2DT5 A;  4MEY F;  1LDJ A;  2TDX A;  3GEZ A;  3JSP A;  3CUQ A;  3GFM A;  4KN4 X;  2A6H F;  2R7F A;  5KK1 A;  1IXR C;  1FYM A;  1U8R A;  4GGG A;  5AIQ A;  4M9Z A;  2F5D A;  3FHZ A;  1YS6 A;  1ZG5 A;  4I0A A;  4L9T A;  5BOX A;  1IN8 A;  1K78 B;  4AIJ A;  2XHK A;  4LLN A;  1BIB A;  1G3W A;  3HHG A;  1B9N A;  4LB6 B;  1SD6 A;  5ILU A;  3SZP A;  3ZMU A;  4HQM A;  3L00 A;  5BPI A;  3BPX A;  3JTH A;  2DI3 A;  3QRF F;  2J5P A;  1O3Q A;  5FFZ A;  4HF1 A;  1SFU A;  2VON A;  5D4R A;  1U3E M;  3SZT A;  1EH6 A;  1ZH5 A;  4UHT A;  3LWF A;  3WTT C;  2K4J A;  5DCF A;  1G4D A;  1FBU A;  3ECO A;  3ERE D;  3WGI A;  3KZZ A;  3ZN1 A;  4WK8 F;  4FX4 A;  1H9G A;  4U7B A;  3WTS C;  1LNW A;  2OAZ A;  3IWF A;  2FQ3 A;  5ERI A;  2QLZ A;  4M74 A;  3CDH A;  3V8K A;  2A5Y B;  2OQG A;  4ESF A;  4A5M A;  4JQF A;  1F1Z A;  3HOS A;  3R61 A;  1HKS A;  3F6O A;  1RIO H;  3CO7 C;  2V1X A;  2HTS A;  2CYY A;  1G3S A;  4L5J A;  4N0B A;  1Z1D A;  3L09 A;  3T5X A;  4LFU A;  2H6C A;  2C6Y A;  3LAP A;  2LSO A;  3F8F A;  4RAZ A;  5CVU A;  2FEZ A;  1S29 A;  1R23 A;  2KJB A;  1YW8 A;  2XKP A;  1XGO A;  1LDD A;  5LHH A;  2OQR A;  4H0E A;  2EFQ A;  3GXO A;  3MAJ A;  3V4G A;  2XIG A;  1J5Y A;  1J75 A;  1U6G A;  4G7O F;  4MHG A;  3LFK A;  2ELH A;  2BBY A;  3GX4 X;  2Y48 A;  5ICG A;  5HLH A;  4UNO A;  4HYE A;  1R7J A;  1QZZ A;  3GZ5 A;  4BAY A;  4HV5 A;  4UVA A;  3DPL C;  1HW1 A;  1CGP A;  5DD8 A;  2EV0 A;  1LB2 A;  1J2X A;  2L4M A;  3MQ0 A;  2XRO A;  4LGW A;  2EA4 A;  4G9Y A;  1ZYR F;  3G3Z A;  4LMY A;  4RB3 C;  5BS6 A;  3IL2 A;  2XUB A;  4E70 A;  3LA2 A;  2MBF A;  3QPT A;  1R58 A;  4PGH A;  1FZP B;  3QP5 A;  1IW7 F;  2B0L A;  5FLX K;  4IRG A;  2HQN A;  5LRR A;  3O3K A;  4CDG A;  1ZRD A;  1YO5 C;  1XSX A;  4LLG F;  4XBF A;  2DQL A;  2M45 A;  3Q9S A;  4RGU A;  3HSE A;  2XRN A;  4KIB A;  4TV7 A;  2JT1 A;  5DYM A;  3CJN A;  3I59 B;  1SFE A;  5H20 A;  1IXC A;  2JPB A;  3ZN0 A;  1ZRF A;  3W6K B;  2K4B A;  5TJJ A;  2XVC A;  3GWZ A;  4KDP A;  4NB5 A;  2VN2 A;  2D1V A;  3JAM Z;  2GA2 A;  5A2Q Z;  3MFK A;  2HR3 A;  4HLY A;  4RAY A;  5ICC A;  2EFO A;  1ZLK A;  2QBY A;  4XRF A;  3ZPL A;  3RKY A;  1AWC A;  1IN4 A;  3T8R A;  4YIF A;  1V4R A;  4HOB A;  4I02 A;  4HLX A;  3PQJ A;  3GF2 A;  1R00 A;  2ETH A;  3ECH A;  1L3L A;  1BC7 C;  3M1E A;  3ZMZ A;  4CIC A;  5BPD A;  1PUE E;  1EH8 A;  3WTV C;  3ABU A;  3M8F A;  2CW0 F;  1XMA A;  2XAG A;  5K5R A;  2COM A;  2P5K A;  2VE9 A;  3F3X A;  2E1C A;  2VBX A;  3HRU A;  2CO5 A;  2CWE A;  2FXA A;  2Q8K A;  4Q5S F;  1KYZ A;  1YYV A;  2K7L A;  1BIA A;  3GO5 A;  2NAZ A;  3ZP5 A;  4KYW A;  5L3C A;  3E5Q A;  3MZY A;  2Z9O A;  3VOD A;  1HBX G;  3N97 A;  1KA8 A;  5L3D A;  5HOO A;  2QQA A;  2ISY A;  3GFJ A;  2A69 F;  4K2E A;  4S04 A;  4HV6 A;  4XLN F;  1SAX A;  3CLO A;  2HZT A;  3EET A;  4PDK A;  3KCC A;  1CF7 B;  3O6B B;  4N9I A;  1QPM A;  1GXQ A;  2O3F A;  2ZNZ A;  1WSU A;  2VBZ A;  2HYG D;  5JFR A;  1J7K A;  1I1G A;  3NQO A;  2PI0 A;  4WXD A;  2K27 A;  5DUK A;  3I64 A;  2NRA C;  1S7O A;  5L3B A;  1EH7 A;  2IA0 A;  3H92 A;  4MQ9 F;  1H9T A;  4JBA A;  1JGS A;  4BQA A;  5LGT A;  4IXA A;  4XSZ F;  4ETS A;  2MLG A;  3I59 A;  3VEP A;  1I6X A;  4U7D A;  1R5G A;  2A6E F;  3F23 A;  2ZCW A;  5EEH A;  4Q4Z F;  2IA2 A;  3E5X A;  4MTD A;  4Y15 A;  5E20 A;  3E6D A;  2PMU A;  3C7J A;  5HS7 A;  3GFI A;  3KZY A;  4R1H A;  3TQN A;  4MGR A;  5HDN A;  1SMY F;  3IRQ A;  4UUV A;  2DU9 A;  2HKX A;  2CQK A;  3WTY C;  1P6R A;  1O7F A;  4ENK A;  4GO1 A;  1IAW A;  3EYI A;  4HZF A;  2H09 A;  2ACJ A;  4EGZ A;  1BBY A;  2G7H A;  2O8X A;  2CG4 A;  2HQR A;  1WI9 A;  3RPQ A;  5E1Z B;  1HW5 A;  2RDP A;  4UV8 A;  2EA2 A;  3P9I A;  2XAQ A;  2A68 F;  5BMZ A;  1IZ1 A;  5ICE A;  4ZZD A;  3NEU A;  3RIR A;  2STT A;  2IW5 A;  3DFG A;  3TKY A;  1FP1 D;  2BE5 F;  1LEB A;  5DUI A;  1LQ1 A;  1MKM A;  5CLS A;  3D0S A;  3K9T A;  1HXD A;  4OIP F;  3KP6 A;  2JSC A;  4EMS A;  4LB5 A;  1KU9 A;  4KIF A;  1KU2 A;  3BZ6 A;  3WE2 A;  1YQA A;  2DPD A;  4IPA A;  1OYW A;  1FNN A;  1BM9 A;  4PGG A;  1S6L A;  2FE3 A;  2IJL A;  5DCM A;  5CVJ A;  1WKM A;  5CVI A;  1SD5 A;  1FBQ A;  1XB4 A;  2H94 A;  4M6X A;  2PFB A;  3T1B A;  2PN6 A;  3COA C;  3HHH A;  2W85 A;  5E1W A;  3ZMS A;  1W4M A;  4A0X A;  3KE2 A;  3U2R A;  4BHP A;  2Y0M A;  3DP7 A;  3GVA A;  3U1D A;  3H3U A;  5FD6 A;  1ZG1 A;  3R0A A;  2KIF A;  2PQ8 A;  3V8L A;  4RGR A;  4WX9 A;  2PBI A;  4O5V A;  5CYV A;  1YTY A;  3FM3 A;  2A3S A;  2CSO A;  2IVM A;  3WE3 A;  3J80 K;  3P9C A;  1Z91 A;  3BP8 A;  1T6S A;  1OYY A;  1FPQ A;  3T0Y A;  3E3V A;  1FX7 A;  3DEU A;  4EM1 A;  1NHA A;  4A2U A;  5JI6 A;  4EVI A;  4BNC A;  1FT9 A;  1B9M A;  4IF4 A;  1T38 A;  3FWE A;  4G94 A;  1YFH A;  3DF8 A;  2QEN A;  4RB2 C;  3E97 A;  5F6F A;  3HRT A;  4WXH A;  1ZG3 A;  3RPU A;  3KEO A;  1QO0 D;  3EQL F;  4PZJ A;  1T98 A;  2IT0 A;  3WTX C;  4AIK A;  1VTN C;  1H0M A;  1MGT A;  2VOO A;  1LJ9 A;  1TQP A;  4EV0 A;  1DPR A;  4KMU X;  1WQ2 A;  4ENN A;  1P4W A;  1RNL A;  5ILS A;  1G3T A;  3I0T A;  4U0Y A;  4ON0 A;  4KMF A;  2ZXJ A;  4I2O A;  4CXF A;  4L9J A;  3BY6 A;  4R79 A;  3ML6 A;  1L0O C;  1XMK A;  2HTJ A;  4HF0 A;  3OV8 A;  5HLG A;  2QVO A;  4U0V A;  3LA7 A;  5J8C A;  1G3Y A;  1KYW A;  1LVA A;  4HA8 A;  3BOQ A;  2UZK A;  3J81 K;  5LEJ A;  2BV6 A;  2ZJ2 A;  2V1U A;  2JZY A;  2P6S A;  4HX8 A;  2E7X A;  3H3Z A;  3LAJ A;  1K7A A;  3E6M A;  4GXO A;  2LF8 A;  3DXJ F;  1PP7 U;  3F8M A;  2O0Y A;  5HDG A;  2ZO4 A;  1UFM A;  4Q48 A;  3WOD F;  3VOE A;  2IP2 A;  3B73 A;  4HX4 A;  1B6A A;  5FB2 A;  1ZGA A;  3BJA A;  2M8E A;  1DPU A;  1G6N A;  2QYO A;  4KIG A;  2Q0O A;  3KFW X;  5JHU A;  3I71 A;  4CGZ A;  2CGP A;  4IJA A;  2FBH A;  3K1N A;  3J80 Z;  1FOK A;  2FBK A;  1QBJ A;  2BGC A;  4EQQ A;  4WCG A;  3FF5 A;  5F64 A;  1J9I A;  5TRD A;  5IT9 K;  3RJP A;  4P55 A;  3KP7 A;  3BDD A;  1Z9C A;  4OIO F;  1O3T A;  4YII A;  1GHC A;  2JTV A;  4QWQ A;  4XLP F;  5CVV A;  2JRT A;  4O6J A;  3AAF A;  2K86 A;  1REP C;  3REO A;  3K0L A;  4WWC A;  2FNA A;  1XGM A;  4I0B A;  4Z2Y A;  3J7A O;  1FYK A;  5ICF A;  3C3W A;  5LBQ A;  5D8L B;  1ZAR A;  4M73 A;  4LK0 F;  1FP2 A;  2O6G E;  2Z5U A;  2STW A;  4U0W A;  2G9W A;  3I58 A;  3FMS A;  4I7H A;  2HEO A;  2GXG A;  2M30 A;  1FC3 A;  3W6J B;  1BI3 A;  1JXS A;  2DQR A;  2VT3 A;  3I4P A;  4F7Z A;  2EB7 A;  3K1P A;  3DV8 A;  4ZYE A;  4EJU A;  3F72 A;  3FX3 A;  3C18 A;  3GYH X;  4G6D A;  2VT2 A;  4BH9 A;  1FWZ A;  1S3J A;  5L3E A;  3LQQ A;  1HW2 A;  3I5U A;  4LLL A;  5F1R A;  4HAM A;  1OR7 A;  2Z99 A;  3E6B A;  5J8F A;  5J6X A;  3IWZ A;  4RS8 A;  3JTG A;  4BHB A;  1K6O A;  2CFX A;  1LDK B;  3R6S A;  2NS0 A;  3SQN A;  1KU3 A;  1UHW A;  1TQM A;  2MLK A;  4KN7 X;  5D5W B;  4NQW A;  4O3M A;  5DD4 A;  2RC4 A;  1BN5 A;  1ON2 A;  2KRF A;  5LGU A;  5HVQ C;  1JE8 A;  4ZYG A;  2QQ9 A;  4KT5 C;  5FD5 A;  3RKX A;  1T39 A;  2E7W A;  2UXN A;  3HOT A;  2FML A;  2XGX A;  3HSR A;  1DUX C;  4EJW A;  2DAO A;  2RGV A;  2QQB A;  3QU3 A;  4MQV A;  3M7G A;  2IA1 A;  4IHS A;  4A6D A;  2QM3 A;  3SHF A;  3BWG A;  2O61 A;  1XSD A;  3F8N A;  2ISZ A;  1W7P A;  2M87 A;  2FSW A;  3I53 A;  1GXP A;  3V7S A;  2DBB A;  6PAX A;  5IT9 Z;  4ZYH A;  4RGX A;  2GIV A;  4UVC A;  3SXY A;  3RKW A;  2V79 A;  4EM0 B;  2G7U A;  4LJZ F;  2ESN A;  5K5Q A;  1D3Y A;  1B4A A;  1OKR A;  2LDU A;  3HYI A;  4EJV A;  2ZNY A;  1I27 A;  4OIR F;  3ABT A;  3F21 A;  3JW4 A;  2L02 A;  1SFX A;  2V6C A;  1GVJ A;  1BC8 C;  1S7A A;  3PQK A;  5K5O A;  2QWW A;  2FNP A;  3EYY A;  2P7C B;  2UWM A;  1P92 A;  1P4X A;  4P5O A;  1TQI A;  2YX7 A;  5H6Q A;  1O57 A;  1TNT A;  4D0P A;  2VC1 A;  4G6Q A;  3P7N A;  5A2Q K;  1Z6T A;  2AS5 F;  3E5U A;  1I1S A;  1U2W A;  4PCQ A;  1V3F A;  4EM2 A;  4GCV A;  3I54 A;  1DDN A;  3F6V A;  1P2F A;  2RKH A;  1XCV A;  4A0Z A;  5FFX A;  4BHC A;  2GAU A;  2MA3 A;  1E2X A;  1TW2 A;  2WWY A;  4IVN A;  3L7W A;  3O2P E;  1K78 A;  3K69 A;  3L2C A;  2FBI A;  4YFX F;  2NNN A;  2BYV E;  4M9S A;  1HKT A;  4UVB A;  2KJC A;  2EV6 A;  4OIQ F;  2OA4 A;  1R5H A;  5BQT A;  2NNY A;  2UXX A;  2Z33 A;  2YSR A;  5D5X B;  1R36 A;  3ZMV A;  4QLC U;  3CTA A;  4HW0 A;  3OOP A;  1JHH A;  4OMZ A;  4YFN F;  2OD5 A;  4EGY A;  2EFW A;  3CUO A;  1ZHF A;  5ED4 A;  1WRJ A;  4U88 A;  2VBY A;  4L0Z B;  2X4H A;  4S05 A;  3EDP A;  3HRM A;  1Z6R A;  2JPC A;  3K1M A;  4HQE A;  2W57 A;  1XCB A;  4KFC A;  4BYY A;  1TNS A;  3HTS B;  1W7P D;  1R22 A;  3WU1 B;  3TOA A;  1O3R A;  3VFZ A;  4M9X A;  3GZ6 A;  3K2Z A;  2F5C A;  4CZZ A;  4JK1 X;  4CO8 A;  4RB0 A;  1ZRC A;  1D8K A;  1ZGJ A;  1BOA A;  2RVC A;  1DP7 P;  2WTE A;  4UV9 A;  2FF4 A;  4EJO A;  1F5T A;  5E17 F;  2V9V A;  1P4A A;  1ONV A;  4A12 A;  1HST A;  3KP3 A;  2DW4 A;  2R3S A;  4IRI A;  1J59 A;  2PMH A;  4GYI A;  1OPC A;  2GZW A;  4Y17 A;  1OYI A;  1SMT A;  1USS A;  1YW9 A;  5LRS A;  1IXS B;  4A5N A;  3CO6 C;  5EEG A;  1RI7 A;  1PP8 F;  4ASN A;  3FZV A;  1QGP A;  4AWX B;  1IRG A;  2EK5 A;  4XSX F;  4L9N A;  2W24 A;  3TDZ C;  4I98 B;  3V8J A;  2HFH A;  2FOK A;  3F8B A;  2NYX A;  1UCR A;  4FT8 A;  4HX7 A;  1PDN C;  4AVP A;  1Q1H A;  3Q9V A;  1IRF A;  3WG9 A;  3GLX A;  1YG2 A;  2A07 F;  1I5Z A;  2M1B A;  1Z7U A;  3CUQ B;  2PJP A;  2LNB A;  3QU6 A;  5HLI A;  1ODD A;  1XD7 A;  1WWX A;  4OIN F;  5HS9 A;  5FGM A;  2F2E A;  3KLN A;  5K1Y A;  3NRV A;  1TLH B;  1U5T A;  4P96 A;  2Y75 A;  2DK5 A;  4GYG A;  1FBS A;  3TO7 A;  1B59 A;  2F5F A;  4P9F A;  1U5T C;  1JHF A;  5AIP A;  4WF2 A;  5FO5 A;  1XSV A;  3WTZ A;  3C1D A;  2W25 A;  1T2K A;  1R1V A;  3MWM A;  2P6T A;  2OU2 A;  2HDC A;  4HF2 A;  1O7L A;  3GFL A;  1W5S A;  3DKW A;  2RN7 A;  1R1U A;  2P4W A;  3KP5 A;  1RZ4 A;  3JAM K;  3V7C A;  4ZYD A;  1F9N A;  5D4S A;  2J5O A;  3MEX A;  5DV5 A;  2M5W A;  5D5V B;  2W84 A;  2Q2E A;  3TOB A;  3G73 A;  1UHM A;  1YW7 A;  3HUG A;  3P9K A;  2X0L A;  2D45 A;  2OZ6 A;  1BI2 A;  2V1D A;  2KIM A;  3TO9 A;  3QP6 A;  3RI4 A;  1MDM A;  5E1X A;  4R8H A;  4AD9 A;  5IT3 A; 
#chains in the Genus database with same CATH topology
 3S14 J;  3PNY A;  5HS8 A;  3CCS I;  4YFK F;  2DLL A;  1U8B A;  1J0R A;  3EUH A;  4XKV A;  1JKQ C;  2WB1 N;  4D7N A;  5HOD A;  3M4O J;  1XDU A;  4EJT A;  5LHG A;  2LY2 A;  3MMY B;  2ZKZ A;  5H6R A;  2EFP A;  2DK8 A;  5HDK A;  2KZG A;  1OCO H;  3S1Q J;  2XB5 A;  4I99 C;  3KYL A;  1YIJ I;  5JR3 A;  4NDL A;  1R6R A;  4RM2 A;  1UST A;  4KIC A;  4HEA 2;  5KCM A;  4C2M J;  1FY7 A;  2D1H A;  2V9K A;  3K7A J;  5M3M J;  2MC3 A;  4NBQ A;  2WV0 A;  2EPF A;  5J47 A;  2HWV A;  4XKW A;  2XKO A;  1BW5 A;  2WC2 A;  2RNJ A;  2XRL A;  4JX6 A;  2CRG A;  1KQ0 A;  1FSE A;  3MKW B;  2EIN H;  2GWR A;  2HI3 A;  4FTH A;  3ZMT A;  1T33 A;  2CW8 A;  5LHI A;  2FMY A;  3VYR B;  2JJ7 A;  3HC7 A;  4M6V A;  5EG0 B;  1ZRE A;  3CES A;  3CCM I;  4RLQ A;  1E17 A;  5TGT A;  3IH2 A;  3CMA I;  4E7I A;  1JT6 A;  2F5E A;  2RQP A;  2XAS A;  3CUQ C;  1F4K A;  3LA3 A;  2EH3 A;  4CCO A;  3L9F A;  3D5S C;  3IP4 B;  1ERD A;  2OBP A;  3ZR8 X;  1IV6 A;  1FTT A;  1M1E B;  1HF0 A;  2L4A A;  3GUD A;  2JA2 A;  2DTR A;  2VPL A;  3JRD A;  1DQU A;  3HGG A;  4RGS A;  4QTR A;  3A01 A;  2GA1 A;  4WXC A;  4MEX F;  1PUF B;  4L18 B;  4DOZ A;  2QSH X;  2VIX A;  4DNC A;  1A04 A;  3HRS A;  3T8T A;  4E7H A;  5E8G A;  2K02 A;  3P5J A;  2R7X A;  4ZZL A;  5IP6 A;  2MC4 A;  2KFD A;  4BXU A;  3AG4 H;  3MCZ A;  2MD5 A;  4MNU A;  3TO6 A;  1P7J A;  4Y13 A;  4YG2 F;  1I50 J;  2BY0 A;  2GOX B;  2AQF A;  2EIM H;  2DA4 A;  4ESB A;  4L5I A;  3QPH A;  2L2O A;  3LL7 A;  1LEA A;  3BR1 A;  3TBI A;  3HG9 A;  3W2V A;  3J81 Z;  1QNT A;  2XAF A;  5D8K B;  2EWN A;  1UB9 A;  2JMW A;  2ZME B;  5L3G A;  2GXB A;  4CYC B;  2IPQ X;  2ADU A;  1TBX A;  2LF7 A;  4Q47 A;  4A3C J;  1IN5 A;  2R7D A;  3ISP A;  3OWT A;  4MTE A;  3EUA A;  3TDU C;  2CQ7 A;  2W82 A;  3BZK A;  2R7W A;  3OIP A;  2R7S A;  3SZG A;  2YU3 A;  2X6W A;  4M71 A;  3S2W A;  3V7R A;  4A0Y A;  4GFB A;  3OIO A;  3RQI A;  1VQ9 I;  3RDI A;  2D2W A;  4XID A;  2R7U A;  3BR5 A;  4A3F J;  3BG7 A;  5E79 C;  3ELK A;  2VBW A;  3BR0 A;  2WAF A;  3LSK A;  4B8X A;  2E2J J;  3RQ4 A;  4B09 A;  1UEL B;  1FYL A;  2PEX A;  5H2F C;  3RYP A;  4M72 A;  4G8X A;  4G7Z F;  1N75 A;  1SD7 A;  1XMX A;  3S32 A;  1YHQ I;  3W2A A;  4DGW B;  3TP3 A;  3FMQ A;  1R1T A;  2F6C A;  2L01 A;  2PG4 A;  3HSF A;  5AON A;  1Y1W J;  1JKO C;  1JJ8 C;  2KIU A;  4OOI A;  1OJL A;  1U5T B;  5LGN A;  5FLX Z;  2Z3Y A;  4DQ2 A;  2DO7 A;  3ABK H;  4UXN A;  4LD5 A;  2R4G A;  4DYR A;  2DN0 A;  2KKO A;  3PSF A;  3J7Y J;  4A3K J;  2Z2S B;  1R4N B;  4C3H J;  3QAH A;  1NK2 P;  3AFH A;  1VQL I;  4LG0 A;  3OYN A;  5ILV A;  4AIH A;  2P7V B;  3LSI A;  2RV8 A;  1ULY A;  1OFC X;  1FSH A;  2KIQ A;  1ACI A;  2L54 A;  1FLI A;  1MJ9 A;  1QHH D;  5EGO A;  3GZN B;  2EV5 A;  2XAH A;  3E6C C;  1VZ0 A;  2HGC A;  3S2H J;  3OOU A;  4HST A;  5D5U B;  3BJ6 A;  3S3M A;  4FCY A;  1TWF J;  3CZ6 A;  3DQV C;  2HS5 A;  1W7P B;  1RES A;  2GBY A;  2K9S A;  1S7E A;  1ZLJ A;  2OC6 A;  2P8T A;  2ESH A;  2W7N A;  2VE8 A;  4ESJ A;  1VQK I;  2HOE A;  5LLQ A;  3H0G J;  4ZH4 F;  1X19 A;  3E1S A;  1WJD A;  2YX4 A;  3BTC A;  3HIF A;  2H6B A;  5CKT A;  3FIS A;  4A93 J;  2MH9 A;  3NAU A;  4M6Y A;  2EJR A;  4J00 A;  3HPG A;  1UZC A;  2MH2 A;  3IKT A;  3FXQ A;  4XRS G;  1Y1V J;  2OCC H;  2BHZ A;  3QYF A;  4ENM A;  4KA4 A;  2E1N A;  3R4K A;  3FXR A;  2VUM J;  2X85 A;  1MBG A;  2DA7 A;  5EG0 A;  3R0J A;  1EA3 A;  1W5T A;  1QZY A;  2LKP A;  2MGQ A;  2VXZ A;  3BPV A;  2XF7 A;  1IN7 A;  4L0Y B;  2AXL A;  2ZBK A;  2O03 A;  3BCA A;  5J40 A;  3RYR A;  3SFZ A;  3HKZ A;  1FEX A;  3SDB A;  3CC4 I;  3FXU A;  2GOM A;  4I6Z A;  2IS2 A;  2DDA A;  1YE9 A;  1STZ A;  3QOP A;  4G7H F;  1HKQ A;  3F8C A;  2ZME A;  4KIS A;  4LK1 F;  1RKW A;  3S8P A;  3FM5 A;  3WGH A;  1YLF A;  3ZMD A;  3H0D A;  3DKX A;  2H27 A;  5E3M A;  1MBE A;  2DDB A;  2GQQ A;  5DEQ A;  3W3C A;  1BI1 A;  1RUO A;  5DDG A;  1O3S A;  4A3D J;  3ZQ7 A;  1D5V A;  1B8I A;  1XGS A;  3CP2 A;  3GTP J;  2ELK A;  3GTO J;  2VJJ A;  4I09 A;  3IH4 A;  1RRJ A;  1TT5 B;  2ZFW A;  3WU0 A;  2FA5 A;  1RUN A;  3OYK A;  3OY9 A;  2E2I J;  1BJA A;  3J7A Y;  1W36 C;  1AOY A;  1MZB A;  3IKV A;  4CYD A;  1MD0 A;  2Q1Z B;  4XR6 A;  5CJ9 A;  3OR2 C;  3MN2 A;  1PUF A;  3M8E A;  3KET A;  1K79 A;  1K83 J;  2EQR A;  3D5R C;  5JVT A;  1R9T J;  3I4M J;  2E1M B;  3VWB A;  1XN7 A;  4NUB A;  1X4P A;  5D6F A;  1MDM B;  1C0W A;  2QKL B;  3BQY A;  2L3D A;  4IRH A;  3B02 A;  4KUM A;  2E34 A;  1ORK A;  2VC0 A;  2VOP A;  1R4M B;  1DGR M;  3S1M J;  5CVR A;  5CQE A;  1WJE A;  3JSO A;  1MW7 A;  2A61 A;  1MMD A;  3F22 A;  2CV1 A;  2P5L C;  2K9M A;  1XC5 A;  2OTL I;  4BU2 A;  2AHQ A;  3CQZ J;  4X1E A;  5M5X J;  3M07 A;  4FHT A;  1U78 A;  1KQ8 A;  2HVR A;  2XAJ A;  5LEK A;  3VB2 A;  5DCM B;  3I9V 2;  5EDN A;  4ZYA A;  2DJN A;  3PFI A;  4FX0 A;  3OS2 A;  2FU4 A;  4XLC A;  4XLH A;  3MZH A;  3IUO A;  1Z05 A;  4C3I J;  1X1A A;  3D5L A;  2X1C A;  3AG3 H;  1OR7 C;  3A01 B;  4IEJ A;  3KEQ A;  1D8J A;  1KU7 A;  3QYB A;  3LST A;  2R5Z A;  4HDV A;  1EKE A;  3PSI A;  2V7F A;  4P9U A;  4OMY A;  1ZN2 A;  2YPR A;  2HXO A;  2M0C A;  3TGN A;  3QYE A;  1Y0U A;  2HKO A;  2DFF A;  3LMM A;  1YS7 A;  2WB1 A;  4I01 A;  4B47 A;  2P5V A;  2BOL A;  1ZAO A;  1HQC A;  2BEO A;  4F3Q A;  5L3F A;  1FMV A;  2XGE A;  3VDX A;  2CMP A;  2IRF G;  2R5Y B;  5FRO A;  4RB1 A;  4L9V A;  1KGS A;  2R7Q A;  2LKS A;  1IN6 A;  2EFN A;  2ME0 A;  1XDS A;  3K6G A;  3U9G A;  4DBR A;  3V42 A;  2WAQ N;  1Z0X A;  3DTE A;  4XMY A;  4A6E A;  4KIT B;  1IUY A;  1BI0 A;  1MJB A;  2R7O A;  1W36 D;  3IHU A;  1QQI A;  2CU7 A;  1I39 A;  4XM3 A;  3RTR A;  1XPX A;  5GPC A;  1EF4 A;  2K3P A;  4HBL A;  2NXN B;  3KP2 A;  3DWL E;  3BRO A;  5JHF A;  1UG0 A;  4IOC F;  2ZC2 A;  2E71 A;  2OZU A;  3HTU A;  3JRG A;  4LG0 B;  2DOA A;  4A69 C;  2QSG X;  2QZ8 A;  3WTW C;  1ON1 A;  1SVO A;  1Y39 A;  3N4M A;  2IGK A;  2Y9Z A;  2YR2 A;  1KQ9 A;  2BXY A;  4ZDL A;  1S8N A;  5E8I A;  3CCV I;  4CHU A;  2VOD A;  1SD4 A;  3J7Z I;  3IC7 A;  2FRH A;  4BDY A;  1FOX A;  2F4I A;  2V26 A;  1HA8 A;  4IHT A;  1I6H J;  4BS9 A;  5E18 F;  1TTY A;  1KON A;  3M9A A;  2HYF A;  5KVR A;  1IDZ A;  4N9H A;  1E3O C;  1TW3 A;  3VYT B;  1V5G A;  3TED A;  1OMI A;  2L0K A;  3R60 A;  1ITY A;  1IF1 A;  2NS8 A;  3K4N A;  3L2U A;  3LQR A;  2DPU A;  3KIO A;  3KEY A;  3KP4 A;  1K4S A;  1CF7 A;  3BG5 A;  2LBF B;  4B4C A;  5D6E A;  2X9D A;  3Q0W A;  3ULQ B;  3OYH A;  3LNQ A;  4HDU A;  4NHJ A;  3H3V K;  3ROU A;  3Q5F A;  4KNY A;  3WTU C;  3LOC A;  4OU0 A;  3VPR A;  1V55 H;  4HNU A;  4XKC A;  3DU5 A;  1Q1V A;  1XGN A;  3GW2 A;  2PLY A;  5FKL A;  1X3U A;  4PFO A;  3PO2 J;  3K10 A;  2ID3 A;  3CCU I;  2QBY B;  1D0X A;  4LIT A;  1T0F A;  3BJO A;  2XV4 S;  3KLO A;  1HSJ A;  3KX2 A;  1T8I A;  3CLQ A;  4B3A A;  1HLV A;  4XIC A;  3FMR A;  2DFI A;  2KDZ A;  1MJA A;  1UAA A;  2FUG 2;  3ZQQ A;  1YIO A;  2QUF A;  3MKZ A;  1HC8 A;  2HNH A;  1EV7 A;  3DPT A;  1GVD A;  4ENJ A;  4MIM A;  1U9O A;  5IY5 H;  3IRR A;  3WGG A;  1JUS A;  4OWR B;  1QU3 A;  1B1B A;  2DT5 A;  4UUS B;  1LDJ A;  2TDX A;  4MEY F;  3GEZ A;  4CCN A;  3BT9 A;  1JKP C;  5F0F A;  5FKM A;  3JSP A;  3CUQ A;  3GFM A;  1TWC J;  4KN4 X;  2A6H F;  2R7F A;  3H9J A;  2ZXH A;  5KK1 A;  1IXR C;  1FYM A;  1U8R A;  4GGG A;  3CF2 A;  3U1K A;  5AIQ A;  4M9Z A;  2F5D A;  2COB A;  2EZK A;  4BDZ A;  3FHZ A;  1POG A;  1YS6 A;  2BY1 A;  3K2A A;  4JYK A;  1ZG5 A;  4I0A A;  4L9T A;  3G4S I;  1RKT A;  5BOX A;  1IN8 A;  1K78 B;  4AIJ A;  2VPR A;  3A0H C;  4JX5 A;  2XHK A;  4LLN A;  1BIB A;  3LSM A;  3S2D J;  3JRB A;  2E5N A;  1F36 A;  1G3W A;  3HHG A;  3I55 I;  2D5V A;  4IQ4 A;  1B9N A;  4LB6 B;  1G59 A;  1SD6 A;  5ILU A;  3UNG C;  3SZP A;  4BXF A;  2DJI A;  2E36 A;  3ZMU A;  2DMU A;  2WY8 Q;  4HQM A;  3S3O A;  3L00 A;  5BPI A;  4RM3 A;  3NAR A;  2V4J C;  3BPX A;  1SC7 A;  3JTH A;  2DI3 A;  3QRF F;  1VI0 A;  2J5P A;  1MBK A;  1O3Q A;  5FFZ A;  4HF1 A;  2Y0S N;  1SFU A;  2VON A;  2NVQ J;  5D4R A;  1U3E M;  2NOG A;  2W00 A;  3SZT A;  1EH6 A;  4BQO A;  1ZH5 A;  4UHT A;  3LWF A;  4PJL A;  3WTT C;  2K4J A;  5DCF A;  4ZDP A;  4JX4 A;  2DFE A;  1G4D A;  1FBU A;  3ECO A;  3ERE D;  3QPL A;  2AXT C;  1BR4 A;  3WGI A;  3KZZ A;  4ZTJ A;  4D5F A;  3ZN1 A;  4WK8 F;  4FX4 A;  2M34 A;  1H9G A;  2KMU A;  2EZL A;  3BR6 A;  4U7B A;  1LNW A;  2OAZ A;  3WTS C;  1VQ6 I;  5B3S H;  3IWF A;  3G71 I;  2FQ3 A;  1UJ8 A;  5ERI A;  4QIW N;  3OL3 A;  2QLZ A;  4Y33 A;  4CCK A;  3PIP F;  3ABM H;  4M74 A;  1AKH A;  4XON A;  3DLL F;  3CDH A;  3V8K A;  2A5Y B;  1VQN I;  2LLK A;  2OQG A;  4ESF A;  2VKD A;  4A5M A;  3E0J B;  1B72 B;  2O5R A;  4JQF A;  1F1Z A;  4U87 A;  3HOS A;  5EZH A;  3R61 A;  1HKS A;  3PIO F;  3F6O A;  1RIO H;  3S16 J;  3CO7 C;  2EIL H;  2ICW G;  2V1X A;  2HTS A;  2CYY A;  2QQ8 A;  1G3S A;  1Z77 A;  4XLE A;  2KT0 A;  4L5J A;  4MLO A;  5FLM J;  2JA6 J;  4N0B A;  5M5Y J;  1Z1D A;  3L09 A;  2CUZ A;  3QWL A;  4LFU A;  3T5X A;  5J4V A;  2H6C A;  2QKM B;  1AHD P;  1NH3 A;  3A4C A;  2C6Y A;  2JWT A;  3LAP A;  2LSO A;  3F8F A;  4RAZ A;  5CVU A;  2FEZ A;  3TW6 A;  1S29 A;  4YEJ A;  1R23 A;  2KJB A;  1YW8 A;  4BUP A;  2OV7 A;  2XKP A;  1XGO A;  1LDD A;  1BOB A;  1WJB A;  3GLL A;  5LHH A;  2OQR A;  3CME I;  1X3Z B;  4BBR J;  2HDD A;  5K7Z A;  4H0E A;  3ONQ A;  1FOY A;  2EFQ A;  3GXO A;  3MAJ A;  3V4G A;  5IYC J;  2XIG A;  1J5Y A;  3PUF A;  4BGD A;  1J75 A;  1U6G A;  4G7O F;  5C4X J;  4MHG A;  3LFK A;  2ELH A;  3I4N J;  2BBY A;  2WAQ A;  4E6K G;  4AU7 A;  1BW6 A;  4FAS D;  3GX4 X;  3LSP A;  5IYD J;  3OYJ A;  5CPR B;  2Y48 A;  4W97 A;  5ICG A;  3GTK J;  2LRE A;  3DKY A;  5HLH A;  4UNO A;  3L1P A;  4Z6Y A;  4HYE A;  1R7J A;  2L9R A;  1QZZ A;  3OIQ A;  2FD5 A;  3GZ5 A;  4XKB A;  3MD2 A;  4BJ6 C;  4BAY A;  4HV5 A;  4BEH A;  2YUS A;  1QVT A;  9ANT A;  2JA5 J;  3IAM 2;  2E5Z A;  2K3F A;  1J09 A;  4UVA A;  3DPL C;  1HW1 A;  1CGP A;  4XOR A;  5DD8 A;  5HLT A;  2EV0 A;  1LB2 A;  4IHW A;  1J2X A;  2ZXI A;  2L4M A;  3MQ0 A;  2XRO A;  3AKZ A;  4LGW A;  2EA4 A;  4G9Y A;  1ZYR F;  3RZD J;  4A3L J;  4M3D A;  2XGC A;  2OJE D;  3G3Z A;  4LMY A;  5FKN A;  2F5V A;  5KAF C;  2MG4 A;  2RRE A;  1IO2 A;  4RB3 C;  5BS6 A;  3IL2 A;  4RAF A;  3BQZ A;  2XUB A;  4IKF A;  3HXL A;  4E70 A;  1R71 A;  3CCJ I;  3S1R J;  3CD6 I;  3LA2 A;  2MBF A;  3QPT A;  2HPI A;  3PNV A;  3KZI C;  4Y4R A;  1X1B A;  1R58 A;  3JRA A;  4PGH A;  1FZP B;  5F27 A;  2X6O A;  3QP5 A;  1IW7 F;  2B0L A;  5FLX K;  4XN3 A;  4IRG A;  2BW3 A;  2KLO A;  4XQF A;  3SEQ A;  4QSH A;  2HQN A;  4JOM A;  4D5C A;  4E7K A;  5LRR A;  3FK6 A;  2MSY A;  3O3K A;  4CDG A;  2CQN A;  1ZRD A;  2L9S A;  5EJC A;  1YO5 C;  5BNG A;  3S17 J;  1XSX A;  1XX5 A;  1RET A;  4LLG F;  2DQL A;  4XBF A;  3OYL A;  2NVU B;  2M45 A;  1X4O A;  2HYJ A;  3C2G A;  3Q9S A;  3FXM A;  4RGU A;  3HSE A;  2H1K A;  3X2Q H;  2E1M C;  2XRN A;  2CUF A;  4KIB A;  1OLT A;  4TV7 A;  2JT1 A;  1BA5 A;  3G1L A;  2VKE A;  5DYM A;  2DA6 A;  3CJN A;  1X1C A;  1SFE A;  3I59 B;  3KPH A;  3M1C A;  5H20 A;  1A31 A;  1IXC A;  2VQL A;  2JPB A;  3ZN0 A;  1ZRF A;  1VQ7 I;  3W6K B;  2K4B A;  5TJJ A;  2XVC A;  2JVH A;  4YRV A;  3GWZ A;  4B48 A;  1TT0 A;  1JUP A;  1ETX A;  2JK3 A;  4NB5 A;  3UKG A;  2VN2 A;  4KDP A;  2D1V A;  2O8K A;  2M2E A;  3JAM Z;  2GA2 A;  4CA0 A;  5A2Q Z;  1W0T A;  3MFK A;  2HR3 A;  2B63 J;  4JP0 A;  4LG3 A;  3W2W A;  4HLY A;  4E7J A;  4RAY A;  4ZC3 A;  4MFE A;  5B66 C;  5ICC A;  5M5W J;  2EFO A;  1SFO J;  5GAG J;  2W1O A;  1ZLK A;  2K40 A;  2KZV A;  2R7Z J;  3HOU J;  3PL8 A;  2QBY A;  1Y6I A;  2LOO A;  4IHX A;  2A6T A;  4A3I J;  2LK2 A;  2F4O B;  4XRF A;  3ZPL A;  1IGN A;  1MNM C;  3RKY A;  3AG1 H;  4CZC A;  1AWC A;  1IN4 A;  1WHU A;  3T8R A;  2VKV A;  4UB8 C;  3OYD A;  4YIF A;  1V4R A;  2DMP A;  4HOB A;  3FXO A;  4I02 A;  2HZD A;  4HLX A;  1ETW A;  3GTQ J;  3OYC A;  3PQJ A;  3GF2 A;  1R00 A;  2ETH A;  5F1J A;  1E3P A;  1X58 A;  3ECH A;  1L3L A;  1BC7 C;  3M1E A;  2KRH A;  1ZKG A;  3ZMZ A;  4CIC A;  5FKK A;  5BPD A;  1PUE E;  1XTA A;  4XOT A;  1LUJ B;  1EH8 A;  2E19 A;  3WTV C;  3ABU A;  3M8F A;  2CW0 F;  3K4B A;  1XMA A;  2XAG A;  5K5R A;  2COM A;  2P5K A;  5C3E J;  1I3Q J;  3WHC A;  3L2Q A;  2VE9 A;  3F3X A;  4N4O B;  2E1C A;  2VL8 A;  2VBX A;  3HRU A;  2CO5 A;  1O4X A;  2CWE A;  1ENH A;  2FXA A;  2Q8K A;  4F91 B;  4Q5S F;  1KYZ A;  2LTP A;  1YYV A;  2K7L A;  2IGN A;  1BIA A;  3GO5 A;  4Y52 J;  2NAZ A;  3ZP5 A;  4KYW A;  5L3C A;  5HNH A;  1H89 C;  2CFO A;  3AL0 C;  3E5Q A;  3MZY A;  2Z9O A;  3VOD A;  3JRC A;  1HBX G;  3N97 A;  1KA8 A;  5L3D A;  2EZH A;  2QQA A;  5HOO A;  1GV2 A;  2ISY A;  3GFJ A;  3PM1 A;  2A69 F;  4K2E A;  4S04 A;  3ZQI A;  4HV6 A;  4XLN F;  4DYC A;  1SAX A;  2WA0 A;  3CLO A;  2HZT A;  3DBL B;  3EET A;  2OUM A;  4G12 A;  2IGM A;  4E7Z A;  4PDK A;  3KCC A;  1CF7 B;  4XLA A;  2H1L A;  3O6B B;  4N9I A;  1QPM A;  2Z1D A;  4IZZ A;  3GBG A;  5M3F J;  3W6V A;  3KYC B;  3H1C A;  1VQO I;  3BTI A;  1GXQ A;  4RA2 A;  2O3F A;  2ZNZ A;  1WSU A;  2VBZ A;  2HYG D;  2LY1 A;  5JFR A;  1VQM I;  1J7K A;  2BY2 A;  4ZJZ A;  1I1G A;  3NQO A;  4IL6 C;  3PJR A;  2PI0 A;  4WXD A;  2K27 A;  4H4K C;  2LRD A;  5DUK A;  4UB6 C;  3L2V A;  2ZJP F;  4DW6 A;  3I64 A;  4UUS A;  3ERM A;  2NRA C;  1S7O A;  4C9Y A;  3I3L A;  5GP9 A;  2HVS A;  3QPS A;  5L3B A;  4E7L A;  3CCE I;  1GLN A;  4DIQ A;  1B8I B;  4LOC A;  1EH7 A;  5B5E C;  2IA0 A;  3FDY A;  2M7A A;  2VJI A;  3H92 A;  1W5C C;  1MSF C;  4MQ9 F;  1H9T A;  4FE7 A;  4JBA A;  1JGS A;  4BQA A;  5LGT A;  1SFK A;  4IXA A;  2M3A A;  4XSZ F;  3OSF A;  2MLG A;  3I59 A;  3VEP A;  4ETS A;  2PMZ N;  2X48 A;  2OPT A;  5C44 J;  1Z67 A;  1I6X A;  4U7D A;  1R5G A;  2RAE A;  3K70 D;  4IHV A;  2A6E F;  3F23 A;  3A03 A;  1LFB A;  2ZCW A;  2E60 A;  5EEH A;  4Q4Z F;  2IA2 A;  3E5X A;  4MTD A;  5IPA A;  4XN0 A;  3OL4 A;  4Y15 A;  4BQQ A;  4D7M A;  5E20 A;  3U21 A;  3CF5 F;  3E6D A;  1K4T A;  2EIK H;  1VND A;  2PMU A;  3C7J A;  2DOF A;  5HS7 A;  4FIS A;  3GFI A;  2WBM A;  3KZY A;  1ETY A;  4R1H A;  3SYT A;  4MGR A;  1LVK A;  3TQN A;  5HDN A;  1SMY F;  3IRQ A;  4UUV A;  2DYR H;  1X1P A;  2DU9 A;  3FKJ A;  1VQ4 I;  2HKX A;  3G2B A;  2CQK A;  3WTY C;  1P6R A;  2X51 A;  1O7F A;  4ENK A;  4GO1 A;  1IAW A;  3EYI A;  1YRN A;  4HZF A;  1BJZ A;  2H09 A;  3OR1 C;  1WGX A;  2ACJ A;  1WH7 A;  4EGZ A;  1BBY A;  2G7H A;  1MSE C;  2O8X A;  2X6Y A;  4ZDO A;  2CG4 A;  2HQR A;  4C30 A;  1WI9 A;  3RPQ A;  5E1Z B;  4N4N B;  3OS1 A;  1HW5 A;  2RDP A;  4UV8 A;  2EA2 A;  3A1Y A;  3P9I A;  2XAQ A;  2A68 F;  5BMZ A;  1IZ1 A;  4F93 B;  5B1A H;  5ICE A;  1ZQ3 P;  3RZO J;  4ZZD A;  2XPU A;  3NEU A;  2MYS A;  2DYS H;  3RIR A;  2STT A;  2IW5 A;  2JQ7 A;  2XSJ C;  3DFG A;  2LD5 A;  1I3A A;  3TKY A;  2QSF X;  3OYG A;  1FP1 D;  2BE5 F;  1LEB A;  2CV2 A;  4W1U A;  3CCY A;  3OS0 A;  5EEA A;  4J01 A;  5DUI A;  4X6A J;  1LQ1 A;  3I56 I;  2KIS A;  3CC2 I;  1MKM A;  5CLS A;  3O8H A;  4B1R A;  3D0S A;  3K9T A;  4BY1 J;  3JR9 A;  1HXD A;  2BXZ A;  4OIP F;  1NG6 A;  2BY3 A;  2B9S A;  3KP6 A;  2ZJR F;  2FJ1 A;  2JSC A;  3GTL J;  4EMS A;  1JKR C;  2BHY A;  4LB5 A;  1KU9 A;  2DA1 A;  4KIF A;  2JA7 J;  3Q0U A;  5LFA A;  1KU2 A;  3BZ6 A;  2F4M B;  1D1B A;  3WE2 A;  1R49 A;  1P7I A;  1A6Q A;  1YQA A;  2K9Q A;  3HKZ N;  2DPD A;  4IPA A;  1OYW A;  2YU9 J;  4PJJ A;  1FNN A;  1BM9 A;  5EYR A;  5JLW A;  4BE2 A;  4PGG A;  1S6L A;  2FE3 A;  2ME6 A;  3LSH A;  1T95 A;  3S1N J;  3SFI A;  4L5E A;  5F0H A;  4CH7 A;  2IJL A;  3CDL A;  2PX9 A;  4AM3 A;  5DCM A;  5CVJ A;  1WKM A;  3HM5 A;  5IYB J;  1RR8 C;  5CVI A;  1SD5 A;  4YIR X;  1Y0N A;  1FBQ A;  1XB4 A;  3OYE A;  1S9H A;  2H94 A;  2KHM A;  2PFB A;  4M6X A;  3T1B A;  3TP0 A;  1FTZ A;  3BTL A;  5GAD J;  1MH4 A;  4PJM A;  2PN6 A;  3COA C;  1HDD C;  4S0H B;  3H35 A;  3HHH A;  2W85 A;  2VKH A;  2MFZ A;  2Y2Z A;  5E1W A;  3ZMS A;  3IV5 A;  1W4M A;  2A05 A;  2YS9 A;  2X1E A;  2H8W A;  4A0X A;  3JCU C;  3ZQG A;  3KE2 A;  3M3Y J;  3U2R A;  3PFY A;  4IO9 F;  3BCB A;  1W1W E;  4BHP A;  2Y0M A;  3DP7 A;  4DZP A;  3GVA A;  1LFP A;  1WJA A;  1WVR A;  3U1D A;  3H3U A;  4GDF A;  5FD6 A;  3R0A A;  3L2R A;  2KIF A;  1ZG1 A;  2PQ8 A;  3V8L A;  4RGR A;  4WX9 A;  2PBI A;  4O5V A;  5CYV A;  2XB0 X;  1YTY A;  3FM3 A;  2A3S A;  1S5L C;  2CSO A;  2IVM A;  3KYD B;  1YI2 I;  3WE3 A;  3K4J A;  2DMQ A;  2Y0S A;  1YIT I;  1A35 A;  2K9L A;  2E1O A;  2GM4 A;  3J80 K;  3P9C A;  1Z91 A;  2MD0 A;  1N25 A;  2L9V A;  3BP8 A;  2BVM A;  1JI8 A;  1T6S A;  1OYY A;  3SJM A;  4XK4 A;  1AU7 A;  3H36 A;  1FPQ A;  4AVZ A;  2XDV A;  3T0Y A;  3E3V A;  4DJA A;  1FX7 A;  2P0W A;  3DEU A;  4EM1 A;  1NHA A;  2FOW A;  1ETQ A;  4A2U A;  5JI6 A;  4EVI A;  4BNC A;  1FT9 A;  1B9M A;  4E7S A;  4IF4 A;  1ZGW A;  1VF9 A;  1Z3Y A;  3LFU A;  1T38 A;  3FWE A;  4G94 A;  1YFH A;  3DF8 A;  2QEN A;  4RB2 C;  3K4C A;  1JTY A;  3E97 A;  5F6F A;  3HRT A;  4WXH A;  3RSN A;  3IH3 A;  1ZG3 A;  2CH0 A;  1GDT A;  5DS9 A;  3RPU A;  3KEO A;  3NWS A;  1QO0 D;  1TWH J;  2LP0 A;  3EQL F;  3RPU D;  4CSW A;  4PZJ A;  1T98 A;  3H5N A;  2IT0 A;  3WTX C;  3CJR B;  2R5Y A;  4AIK A;  1VTN C;  1H0M A;  1VQP I;  4A3M J;  3SDG A;  1MGT A;  3ABL H;  2VOO A;  1LJ9 A;  1TQP A;  4EV0 A;  1DPR A;  2ECC A;  4KMU X;  3CCL I;  1WQ2 A;  3OSG A;  4ENN A;  1P4W A;  1RNL A;  5ILS A;  3K4K A;  1G3T A;  3I0T A;  4U0Y A;  4ON0 A;  4KMF A;  2ZXJ A;  3CJT B;  4I2O A;  4BE0 A;  4CXF A;  2RNG A;  2VJ5 A;  1ETV A;  4L9J A;  3BY6 A;  5E3L A;  3A02 A;  3ML6 A;  4R79 A;  2ZJQ F;  1L0O C;  1XMK A;  2HTJ A;  4HF0 A;  1QHG A;  1X2M A;  2P81 A;  3OV8 A;  1G8X A;  5HLG A;  1A5J A;  2QVO A;  4NNJ A;  2LC2 A;  4U0V A;  2KP6 A;  3LA7 A;  3B6C A;  3TW7 A;  5IP7 J;  5J8C A;  1G3Y A;  4FQG A;  1KYW A;  1LVA A;  2W4S A;  5J1Y A;  4HA8 A;  2NVY J;  3BOQ A;  2UZK A;  2VLA A;  2R0Q C;  2ZXW H;  3SEZ A;  4RAG A;  1GUU A;  3J81 K;  3G1O A;  2HOA A;  1YRN B;  2HOT A;  5KHD A;  5LEJ A;  2H8R A;  2JN6 A;  2BV6 A;  2ZJ2 A;  2V1U A;  5E3O A;  1T08 B;  2JZY A;  2W48 A;  2VI6 A;  4PJ0 C;  2P6S A;  2AO9 A;  1IJW C;  4HX8 A;  2LG4 A;  2E7X A;  3DEW A;  4V2F A;  4A3E J;  3H3Z A;  3LAJ A;  1K7A A;  3E6M A;  4II2 A;  2ZFU A;  4II3 A;  3JRH A;  3N05 A;  4GXO A;  4BQN A;  2LF8 A;  1Y56 A;  4AYB A;  3BG6 A;  2MAB A;  3DXJ F;  1PP7 U;  3F8M A;  3ASN H;  4HRI A;  2CS3 A;  4EAT A;  2O0Y A;  5HDG A;  2ZO4 A;  3ZQC A;  1UFM A;  2FQ4 A;  5IOZ A;  4Q48 A;  3CMM A;  1H8A C;  3WOD F;  5F08 A;  3VOE A;  2IP2 A;  2KRC A;  3ZQH A;  3B73 A;  2QGU A;  3EUH C;  2Q2E B;  2VJ4 A;  4HX4 A;  1B6A A;  1ZEL A;  2EBI A;  5FB2 A;  1ZGA A;  5B1B H;  4XOP A;  4V2G A;  1X3W B;  2PJR B;  3BJA A;  3CC7 I;  2M8E A;  2NVT J;  4LIV A;  4M3B A;  1DPU A;  1PJR A;  2R93 J;  2L7Z A;  1G6N A;  1H88 C;  1PYV A;  3GTG J;  2QYO A;  4KIG A;  2Q0O A;  1ETK A;  3KFW X;  1OCR H;  4BKX A;  5JHU A;  3HOZ J;  3I71 A;  2ID6 A;  1T0F C;  4CGZ A;  2CGP A;  1U9N A;  4IJA A;  2FBH A;  4BL0 B;  3K1N A;  3J80 Z;  1FOK A;  2FBK A;  1QBJ A;  2BGC A;  1N77 A;  4EQQ A;  1YX5 A;  5EF6 A;  3LSG A;  4X0G A;  1D5Y A;  2L9N A;  3Q3S A;  4HNV A;  5GTH C;  4WCG A;  3FF5 A;  4M3F A;  3HOY J;  3ZCO A;  5IOY A;  5IP9 J;  5F64 A;  1J9I A;  5TRD A;  4QPQ A;  5IT9 K;  1WJ5 A;  3RJP A;  4P55 A;  3KP7 A;  3BDD A;  1Z9C A;  1O3T A;  4OIO F;  1SAU A;  4YII A;  1GHC A;  2JTV A;  5J4Y A;  3K4L A;  2M8G X;  4QWQ A;  5CVV A;  4XLP F;  1V5E A;  2JRT A;  4O6J A;  5F04 A;  3AAF A;  2K86 A;  1REP C;  1U0J A;  1SVM A;  3G1M A;  2I5U A;  1MMS A;  3REO A;  3S93 A;  3FBI B;  3K0L A;  4WWC A;  2FNA A;  4BY7 J;  3BTJ A;  1ZR4 A;  1XGM A;  4I0B A;  3HEF A;  4Z2Y A;  3J7A O;  1FYK A;  3HUG B;  5ICF A;  3C3W A;  5LBQ A;  1ETO A;  2ZSI B;  5D8L B;  1ZAR A;  4M73 A;  4HSR A;  4LK0 F;  5TIS C;  1FP2 A;  2O6G E;  3S3N A;  2Z5U A;  2NS7 A;  3AG2 H;  2STW A;  1X1D A;  4U0W A;  2LVS A;  2G9W A;  3I58 A;  3FMS A;  4I7H A;  2HEO A;  2GXG A;  1MIJ A;  2M30 A;  4RMN A;  1FC3 A;  2L7M P;  3W6J B;  4C2T A;  5HNF A;  3CDI A;  1BI3 A;  1WPK A;  2MW8 A;  2K85 A;  1JXS A;  2Z16 A;  4CCL A;  4Y3O A;  4P1W A;  2DQR A;  4ITV A;  1WZ2 A;  4NC8 A;  1TWA J;  2FX0 A;  1TL8 A;  3MKY B;  2HOS A;  5EZG A;  2VT3 A;  3I4P A;  4F7Z A;  5JLX A;  2EB7 A;  1MH3 A;  3K1P A;  2UV1 A;  3DV8 A;  3TL4 X;  3TMO A;  4ZYE A;  1UG2 A;  1K61 A;  1FMW A;  1BR2 A;  3WHB A;  4EJU A;  4PFP A;  3F72 A;  1QZE A;  3L2W A;  4PUS A;  3FX3 A;  4NC6 A;  3C18 A;  3GYH X;  4G6D A;  2VT2 A;  4BH9 A;  2KPM A;  1FWZ A;  1S3J A;  2Y30 A;  5L3E A;  3HL2 A;  1B72 A;  3LQQ A;  5CQG A;  1LPQ A;  2F48 A;  1HW2 A;  1IG7 A;  3I5U A;  2DT6 A;  4LLL A;  1IRX A;  2JRM A;  4IX7 A;  5F1R A;  3DPU A;  4HAM A;  2LFB A;  1OR7 A;  1F43 A;  4CCJ A;  2Z99 A;  1IUF A;  3E6B A;  5J8F A;  3VYU B;  1OCT C;  5J6X A;  4BBS J;  2DA3 A;  3IWZ A;  3HOX J;  4RS8 A;  3JTG A;  3VYS B;  4BHB A;  1K6O A;  2ZSH B;  2CFX A;  1LDK B;  2JSP A;  3R6S A;  2NS0 A;  1KU3 A;  3SQN A;  1UHW A;  1TQM A;  2MLK A;  4KN7 X;  2QA4 I;  3LSJ A;  5D5W B;  4NQW A;  4O3M A;  1EJ9 A;  1QVU A;  4MFD A;  2EIJ H;  5DD4 A;  2RC4 A;  1BN5 A;  1ON2 A;  4AUX A;  3DTI A;  2Y9Y A;  2KRF A;  5LGU A;  4D9J A;  5HVQ C;  2XAU A;  1JE8 A;  3PO3 J;  4ZYG A;  1YX3 A;  3VSK A;  2QQ9 A;  4NC7 A;  4KT5 C;  4CCM A;  2V6E A;  3H9Q A;  4A3J J;  5FD5 A;  4QPO A;  3RKX A;  4F52 A;  2E7W A;  1T39 A;  3E7L A;  3BC8 A;  2UXN A;  3HOT A;  2FML A;  2XGX A;  2PMZ A;  3HSR A;  4HG2 A;  1DUX C;  4EJW A;  2CUE A;  1IC8 A;  1VQ8 I;  2DAO A;  3CMY A;  2RGV A;  3CCQ I;  5J1R A;  2KDO A;  2IS1 A;  3HZJ A;  2XC7 A;  1HCR A;  2QQB A;  2DA5 A;  2XF5 A;  3FKI J;  3QOD A;  3QU3 A;  4MQV A;  2L7K A;  4B3X A;  3BR3 A;  3M7G A;  2IA1 A;  4IHS A;  4XLF A;  2BVL A;  4ANJ A;  4A6D A;  2WY7 Q;  5FRN A;  2QM3 A;  5FRM A;  4D1Q A;  5DM7 F;  2BW3 B;  3SHF A;  2HXI A;  1Y8Q B;  2M0M A;  2V1N A;  4HPQ A;  3BWG A;  2O61 A;  3HOW J;  1XSD A;  3F8N A;  1A6I A;  2ISZ A;  3GME A;  2DCE A;  3ZGK A;  1W7P A;  2M87 A;  3DBR B;  2WAD A;  3MKL A;  2FSW A;  2R5Z B;  1LFU P;  3I53 A;  1GXP A;  2M4G A;  2XPW A;  4FET A;  3V7S A;  1PVE A;  5KAI C;  1P9Q C;  2DBB A;  6PAX A;  1SVL A;  4HNT A;  4ZYH A;  2CQX A;  5IT9 Z;  4RGX A;  1DU6 A;  2DT7 B;  2GIV A;  3GCM A;  4UVC A;  5C4J J;  3WG7 H;  3FXJ A;  3FXK A;  3SXY A;  1QRY A;  4G6T B;  2M9H A;  1LE8 B;  5F0C A;  3RKW A;  2V79 A;  4EM0 B;  3ZOB A;  2G7U A;  3MVP A;  3DCF A;  4LJZ F;  2HVQ A;  2ESN A;  1MNE A;  5K5Q A;  1D3Y A;  3B6A A;  3Q0V A;  1RR7 A;  1B4A A;  1IDY A;  1D0Y A;  1SAN A;  3G6E I;  3PUB A;  1NTC A;  3DEE A;  2A5W A;  3M8J A;  5J1U A;  1OKR A;  3LSR A;  2LDU A;  3HYI A;  1JGG A;  4EJV A;  2R7V A;  3K70 C;  2OCE A;  2ZNY A;  1I27 A;  3H9G A;  1VFC A;  3HOV J;  4UY8 I;  4OIR F;  3ABT A;  3F21 A;  1X2N A;  3JW4 A;  1WCM J;  2L02 A;  1MMA A;  1SFX A;  2V6C A;  4UUT A;  2JA8 J;  4A3B J;  1GVJ A;  1BC8 C;  1S7A A;  2TCT A;  3PQK A;  5K5O A;  2QWW A;  2FNP A;  3EYY A;  1RC9 A;  2P7C B;  2UWM A;  1P92 A;  1OCZ H;  1P4X A;  2M7B A;  3BG9 A;  4P5O A;  3OMY A;  4OAY A;  4B43 A;  2CW7 A;  1Y8R B;  1TQI A;  4DYQ A;  2YX7 A;  2KL4 A;  1OCC H;  1O57 A;  5H6Q A;  1JJ6 C;  1TNT A;  1FIP A;  2L7F P;  2DMT A;  3QOE A;  3CP8 A;  5DTD A;  4D0P A;  4E4H A;  3C2B A;  2VC1 A;  3QQA A;  3P7N A;  4G6Q A;  5A2Q K;  1Z6T A;  2AS5 F;  3E5U A;  1I1S A;  1U2W A;  4PCQ A;  4RBO A;  1V3F A;  4F92 B;  2AQE A;  1LKX A;  4EM2 A;  2O9L A;  1CQT A;  4GCV A;  3I54 A;  2E2H J;  1DDN A;  3F6V A;  3PNT A;  3F9K A;  4YEL A;  4OAZ A;  2WV1 A;  5J3L A;  2HU9 A;  2HPM A;  1P2F A;  4XL9 A;  3DTK A;  2RKH A;  1XCV A;  4A0Z A;  1MBJ A;  3C2H A;  1XS9 A;  2XSD C;  5FFX A;  2ZB9 A;  4BHC A;  1MND A;  2GAU A;  2GLO A;  2MA3 A;  3FHN A;  1MMN A;  2M4K A;  5JVG F;  1E2X A;  4LIU A;  3OYF A;  4I76 A;  1TW2 A;  2X1D A;  2WWY A;  2DOE A;  4IVN A;  3L7W A;  4BJT A;  1HOM A;  2GIZ A;  1WH5 A;  2K5C A;  2QF7 A;  3O2P E;  3K4M A;  1V54 H;  1K78 A;  4XRS A;  1V5F A;  4BAC A;  2VB6 A;  3K69 A;  3L2C A;  2FBI A;  4YFX F;  2NNN A;  2BYV E;  1YJ9 I;  4M9S A;  4BE1 A;  1HKT A;  4UVB A;  1OCP A;  2IS4 A;  2WAE A;  2KJC A;  2NVX J;  2EV6 A;  4OIQ F;  2OA4 A;  1ZR2 A;  4AC0 A;  3NWT A;  3AL0 B;  1R5H A;  5BQT A;  4Y7N J;  1MBH A;  3BLY A;  4PSW A;  2NNY A;  2UXX A;  2VQH A;  2LR8 A;  1BR1 A;  2QCO A;  2Z33 A;  2YSR A;  5D5X B;  1R36 A;  3FXL A;  3BZC A;  1FJL A;  1FIA A;  3OYI A;  3CCR I;  4C2U A;  3HB9 A;  1W0U A;  3ZMV A;  4XRM A;  2VQG A;  4QLC U;  3CTA A;  4HW0 A;  4CUG A;  3OOP A;  1JHH A;  4OMZ A;  4YFN F;  2OD5 A;  3WU2 C;  2LYC A;  4EGY A;  1A36 A;  2EFW A;  3CUO A;  1ZHF A;  3JRE A;  2PJR A;  5ED4 A;  3O8G A;  1WRJ A;  4U88 A;  1GT0 C;  4M3G A;  1E0E A;  4BXX J;  4PSX A;  3ZRG A;  2JUC A;  2VBY A;  4EEF G;  4L0Z B;  3UR3 C;  4BEH B;  2DA2 A;  1TC3 C;  2X4H A;  4S05 A;  3EDP A;  3HRM A;  1Z6R A;  2JPC A;  3K1M A;  4HQE A;  2W57 A;  1DGW Y;  1XCB A;  4KFC A;  4BYY A;  1TNS A;  3HTS B;  1W7P D;  1R22 A;  4ABZ A;  3WU1 B;  3FK7 A;  2Y69 H;  2E35 A;  3EPZ A;  3TOA A;  1O3R A;  3VFZ A;  4M9X A;  3GZ6 A;  3K2Z A;  2F5C A;  2IAI A;  3HDD A;  4CZZ A;  4JK1 X;  2JUG A;  4CYC A;  1OIS A;  4CO8 A;  4RB0 A;  1ZRC A;  1D8K A;  1APL C;  1ZGJ A;  1BOA A;  2RVC A;  1DP7 P;  2WTE A;  4UV9 A;  2FF4 A;  4EJO A;  2RQQ A;  3D1N I;  4NQW B;  2V9V A;  1F5T A;  5E17 F;  3DBH B;  1P4A A;  1ONV A;  1HDP A;  4A12 A;  1HST A;  3KP3 A;  2DW4 A;  2R3S A;  3EUK L;  1J59 A;  4IRI A;  2I8D A;  1UMQ A;  2PMH A;  2TRT A;  1DP3 A;  3ESW B;  4GYI A;  4BJ5 C;  1OPC A;  3S15 J;  4ZTF A;  2GZW A;  4Y17 A;  4IQJ A;  2R7T A;  2G0E A;  1OYI A;  1SMT A;  3OYB A;  1USS A;  1YW9 A;  4XNF A;  1ZTR A;  5LRS A;  1IV8 A;  1IXS B;  2JVG A;  4FE4 A;  4A5N A;  3CO6 C;  5EEG A;  4IHY A;  1RI7 A;  1PP8 F;  2CUJ A;  3BR2 A;  4ASN A;  2CJJ A;  4B44 A;  4AID A;  2ELJ A;  2LKX A;  1BL0 A;  2VQC A;  3FZV A;  1QGP A;  4DBQ A;  3VSL A;  2KQR A;  3HJE A;  1FOW A;  4KJZ A;  4A3G J;  2Y31 A;  2X6X A;  4AWX B;  1IRG A;  2GXA A;  1VQ5 I;  1UHS A;  2EK5 A;  4XSX F;  4AYB N;  1JUM A;  4L9N A;  5LD2 C;  2ZME C;  1WJC A;  2W24 A;  3TDZ C;  1AKH B;  1MMG A;  4IOA F;  4I98 B;  1IRZ A;  3JRF A;  1WJF A;  3V8J A;  2HFH A;  2FOK A;  4J19 A;  3OYM A;  1JTX A;  4RDU A;  1TWG J;  1QPI A;  3F8B A;  3ZQL A;  3CJQ B;  2NYX A;  1S72 I;  1UCR A;  4FT8 A;  4HX7 A;  1PDN C;  4AVP A;  1Q1H A;  2DXI A;  5GTI C;  1KZH A;  1LE8 A;  3Q9V A;  1IRF A;  1AA7 A;  3WG9 A;  3GLX A;  1YG2 A;  2IBD A;  2IEK A;  2A07 F;  1I5Z A;  2M1B A;  1Z7U A;  1TZL A;  3CUQ B;  3HGY A;  2PJP A;  2LNB A;  1WFX A;  1WI3 A;  2DTZ A;  2OF7 A;  3FBN B;  3QU6 A;  5HLI A;  4C3J J;  1ODD A;  2L5Q A;  5EGO B;  1XD7 A;  1WWX A;  1D1C A;  2LY9 A;  3HBL A;  2HQA A;  4OIN F;  3A2K A;  3GTJ J;  5HS9 A;  1D1A A;  5FGM A;  3IAS 2;  4RLF A;  2F2E A;  3KLN A;  2DFH A;  1SEU A;  3JRI A;  5K1Y A;  2CQQ A;  2NOJ B;  3ASO H;  3NRV A;  5FJ8 J;  1TLH B;  1U5T A;  4P96 A;  2IXS A;  2Y75 A;  2BZT A;  2DK5 A;  4GYG A;  1FBS A;  1Z21 A;  4V19 K;  1OQY A;  3TO7 A;  4DZJ A;  1B59 A;  1RPW A;  2UUZ A;  1ZK8 A;  5K7H A;  2F5F A;  2VAS A;  1YJN I;  4PJN A;  2QEX I;  4P9F A;  1JT0 A;  1QA6 A;  1U5T C;  1JHF A;  2XF6 A;  5AIP A;  4WF2 A;  2CV0 A;  1Z7L A;  3RCO A;  3DLA A;  3ZXS A;  2HDW A;  5FO5 A;  3HPH A;  1XSV A;  3WTZ A;  1E3H A;  5GAH J;  3C1D A;  2W25 A;  3H5R A;  3OYA A;  1T2K A;  3BG3 A;  3ZQF A;  1R1V A;  3MWM A;  1K6Y A;  4KT6 A;  4M3E A;  2P6T A;  1T56 A;  2XGD A;  2IGO A;  2B7E A;  2OU2 A;  4MO7 A;  2R7R A;  2HDC A;  2LMD A;  4HF2 A;  1XG1 A;  2DOD A;  1N78 A;  1O7L A;  1YOV B;  5DM6 F;  1DU0 A;  2K9N A;  3GFL A;  1NG7 A;  1W5S A;  2DMN A;  3DKW A;  2RN7 A;  1G2H A;  1R1U A;  2P4W A;  3KP5 A;  1RZ4 A;  4F55 A;  1NK3 P;  2O7O A;  5GAE J;  2ECB A;  3JAM K;  2EZI A;  5KNL A;  2N8G A;  2V9P A;  3V7C A;  4ZYD A;  3H5A A;  1D0Z A;  2R92 J;  1F9N A;  3FIW A;  2I10 A;  5D4S A;  2HQ5 A;  2J5O A;  1YJW I;  2OTJ I;  3A0B C;  3DU6 A;  4PK4 A;  3MEX A;  3GTM J;  5FLV A;  1MBF A;  5DV5 A;  2M5W A;  2LH9 A;  5D5V B;  2W84 A;  2Q2E A;  3TOB A;  3G73 A;  2IS6 A;  3F0C A;  5K7F A;  1UHM A;  1YW7 A;  3HUG A;  3MZ8 A;  3P9K A;  1Z3X A;  2X0L A;  2D45 A;  2OZ6 A;  4GRI A;  1GV5 A;  2LBF A;  5FKO A;  5GPA A;  1BI2 A;  2V1D A;  1R5I D;  2KIM A;  3TO9 A;  3QP6 A;  3RI4 A;  1MDM A;  3RKQ A;  1TP4 A;  5E1X A;  2VXD A;  2XPV A;  5E3N A;  4R8H A;  4AD9 A;  5IT3 A; 
#chains in the Genus database with same CATH homology
 5HS8 A;  4YFK F;  2DLL A;  1J0R A;  3EUH A;  1XDU A;  4EJT A;  5LHG A;  2ZKZ A;  5H6R A;  2EFP A;  2DK8 A;  5HDK A;  5JR3 A;  1UST A;  4KIC A;  1FY7 A;  2D1H A;  2MC3 A;  2WV0 A;  2HWV A;  2XKO A;  2WC2 A;  2RNJ A;  1KQ0 A;  1FSE A;  2GWR A;  3ZMT A;  5LHI A;  2FMY A;  1ZRE A;  1E17 A;  2F5E A;  2RQP A;  2XAS A;  3CUQ C;  1F4K A;  3LA3 A;  3L9F A;  2OBP A;  2L4A A;  3GUD A;  2DTR A;  4RGS A;  2GA1 A;  4WXC A;  4MEX F;  4L18 B;  4DNC A;  1A04 A;  3HRS A;  3T8T A;  5E8G A;  2K02 A;  4ZZL A;  4BXU A;  3MCZ A;  2MD5 A;  4MNU A;  3TO6 A;  4Y13 A;  4YG2 F;  4ESB A;  4L5I A;  3QPH A;  1LEA A;  3J81 Z;  1QNT A;  2XAF A;  5D8K B;  2EWN A;  1UB9 A;  2ZME B;  5L3G A;  2GXB A;  2IPQ X;  2ADU A;  1TBX A;  2LF7 A;  4Q47 A;  1IN5 A;  2R7D A;  3ISP A;  4MTE A;  3TDU C;  2YU3 A;  4M71 A;  3S2W A;  3V7R A;  4A0Y A;  3RDI A;  2D2W A;  3ELK A;  2VBW A;  4B8X A;  4B09 A;  1FYL A;  2PEX A;  3RYP A;  4M72 A;  4G8X A;  4G7Z F;  1SD7 A;  3FMQ A;  1R1T A;  2PG4 A;  2L01 A;  3HSF A;  5AON A;  2KIU A;  4OOI A;  1U5T B;  5LGN A;  5FLX Z;  2Z3Y A;  4DQ2 A;  2DO7 A;  4UXN A;  4LD5 A;  2KKO A;  3QAH A;  4LG0 A;  5ILV A;  4AIH A;  2P7V B;  2RV8 A;  1ULY A;  1FSH A;  2L54 A;  1FLI A;  1MJ9 A;  2EV5 A;  2XAH A;  3E6C C;  2HGC A;  5D5U B;  3BJ6 A;  3DQV C;  2HS5 A;  1W7P B;  1ZLJ A;  2P8T A;  2ESH A;  2VE8 A;  4ESJ A;  2HOE A;  5LLQ A;  4ZH4 F;  2YX4 A;  3HIF A;  2H6B A;  2MH9 A;  4M6Y A;  2EJR A;  2MH2 A;  3IKT A;  3FXQ A;  4ENM A;  4KA4 A;  2E1N A;  3R4K A;  3FXR A;  3R0J A;  1W5T A;  1QZY A;  2LKP A;  2VXZ A;  3BPV A;  1IN7 A;  4L0Y B;  2AXL A;  2ZBK A;  2O03 A;  3RYR A;  3SFZ A;  3FXU A;  1STZ A;  3QOP A;  4G7H F;  1HKQ A;  3F8C A;  2ZME A;  4LK1 F;  3WGH A;  3FM5 A;  1YLF A;  3ZMD A;  2H27 A;  2GQQ A;  5DEQ A;  1BI1 A;  1RUO A;  5DDG A;  1O3S A;  3ZQ7 A;  1D5V A;  1XGS A;  4I09 A;  2ZFW A;  3WU0 A;  2FA5 A;  1RUN A;  1BJA A;  1AOY A;  1MZB A;  3IKV A;  4CYD A;  1MD0 A;  5CJ9 A;  3M8E A;  3KET A;  1K79 A;  5JVT A;  1XN7 A;  5D6F A;  1MDM B;  1C0W A;  2L3D A;  4IRH A;  3B02 A;  4KUM A;  2VC0 A;  2VOP A;  5CVR A;  3JSO A;  2A61 A;  3F22 A;  2P5L C;  4FHT A;  1U78 A;  1KQ8 A;  2XAJ A;  5LEK A;  3VB2 A;  5DCM B;  3PFI A;  4FX0 A;  2FU4 A;  3MZH A;  1Z05 A;  3D5L A;  1D8J A;  3KEQ A;  1KU7 A;  3LST A;  4HDV A;  4P9U A;  4OMY A;  1ZN2 A;  2YPR A;  3TGN A;  1Y0U A;  2HKO A;  1YS7 A;  4I01 A;  2P5V A;  1ZAO A;  1HQC A;  2BEO A;  5L3F A;  2IRF G;  4RB1 A;  4L9V A;  1KGS A;  1IN6 A;  2EFN A;  1XDS A;  3U9G A;  4A6E A;  1IUY A;  1BI0 A;  1MJB A;  3IHU A;  1QQI A;  3RTR A;  4HBL A;  3KP2 A;  3BRO A;  2OZU A;  3HTU A;  4LG0 B;  2QZ8 A;  3WTW C;  1ON1 A;  3N4M A;  2YR2 A;  1KQ9 A;  4CHU A;  2VOD A;  1S8N A;  5E8I A;  1SD4 A;  3IC7 A;  2FRH A;  4IHT A;  5E18 F;  1TTY A;  3M9A A;  2HYF A;  5KVR A;  4N9H A;  1TW3 A;  1OMI A;  3R60 A;  1IF1 A;  3LQR A;  2DPU A;  3KP4 A;  1CF7 A;  5D6E A;  4HDU A;  3ULQ B;  4NHJ A;  3ROU A;  3Q5F A;  4KNY A;  3WTU C;  4OU0 A;  1XGN A;  3GW2 A;  2PLY A;  1X3U A;  2QBY B;  1T0F A;  3BJO A;  2XV4 S;  3KLO A;  1HSJ A;  3FMR A;  2DFI A;  1MJA A;  1YIO A;  2QUF A;  1EV7 A;  3DPT A;  4ENJ A;  3IRR A;  3WGG A;  1B1B A;  2DT5 A;  4MEY F;  1LDJ A;  2TDX A;  3GEZ A;  3JSP A;  3CUQ A;  3GFM A;  4KN4 X;  2A6H F;  2R7F A;  5KK1 A;  1IXR C;  1FYM A;  1U8R A;  4GGG A;  5AIQ A;  4M9Z A;  2F5D A;  3FHZ A;  1YS6 A;  1ZG5 A;  4I0A A;  4L9T A;  5BOX A;  1IN8 A;  1K78 B;  4AIJ A;  2XHK A;  4LLN A;  1BIB A;  1G3W A;  3HHG A;  1B9N A;  4LB6 B;  1SD6 A;  5ILU A;  3SZP A;  3ZMU A;  4HQM A;  3L00 A;  5BPI A;  3BPX A;  3JTH A;  2DI3 A;  3QRF F;  2J5P A;  1O3Q A;  5FFZ A;  4HF1 A;  1SFU A;  2VON A;  5D4R A;  1U3E M;  3SZT A;  1EH6 A;  1ZH5 A;  4UHT A;  3LWF A;  3WTT C;  2K4J A;  5DCF A;  1G4D A;  1FBU A;  3ECO A;  3ERE D;  3WGI A;  3KZZ A;  3ZN1 A;  4WK8 F;  4FX4 A;  1H9G A;  4U7B A;  3WTS C;  1LNW A;  2OAZ A;  3IWF A;  2FQ3 A;  5ERI A;  2QLZ A;  4M74 A;  3CDH A;  3V8K A;  2A5Y B;  2OQG A;  4ESF A;  4A5M A;  4JQF A;  1F1Z A;  3HOS A;  3R61 A;  1HKS A;  3F6O A;  1RIO H;  3CO7 C;  2V1X A;  2HTS A;  2CYY A;  1G3S A;  4L5J A;  4N0B A;  1Z1D A;  3L09 A;  3T5X A;  4LFU A;  2H6C A;  2C6Y A;  3LAP A;  2LSO A;  3F8F A;  4RAZ A;  5CVU A;  2FEZ A;  1S29 A;  1R23 A;  2KJB A;  1YW8 A;  2XKP A;  1XGO A;  1LDD A;  5LHH A;  2OQR A;  4H0E A;  2EFQ A;  3GXO A;  3MAJ A;  3V4G A;  2XIG A;  1J5Y A;  1J75 A;  1U6G A;  4G7O F;  4MHG A;  3LFK A;  2ELH A;  2BBY A;  3GX4 X;  2Y48 A;  5ICG A;  5HLH A;  4UNO A;  4HYE A;  1R7J A;  1QZZ A;  3GZ5 A;  4BAY A;  4HV5 A;  4UVA A;  3DPL C;  1HW1 A;  1CGP A;  5DD8 A;  2EV0 A;  1LB2 A;  1J2X A;  2L4M A;  3MQ0 A;  2XRO A;  4LGW A;  2EA4 A;  4G9Y A;  1ZYR F;  3G3Z A;  4LMY A;  4RB3 C;  5BS6 A;  3IL2 A;  2XUB A;  4E70 A;  3LA2 A;  2MBF A;  3QPT A;  1R58 A;  4PGH A;  1FZP B;  3QP5 A;  1IW7 F;  2B0L A;  5FLX K;  4IRG A;  2HQN A;  5LRR A;  3O3K A;  4CDG A;  1ZRD A;  1YO5 C;  1XSX A;  4LLG F;  4XBF A;  2DQL A;  2M45 A;  3Q9S A;  4RGU A;  3HSE A;  2XRN A;  4KIB A;  4TV7 A;  2JT1 A;  5DYM A;  3CJN A;  3I59 B;  1SFE A;  5H20 A;  1IXC A;  2JPB A;  3ZN0 A;  1ZRF A;  3W6K B;  2K4B A;  5TJJ A;  2XVC A;  3GWZ A;  4KDP A;  4NB5 A;  2VN2 A;  2D1V A;  3JAM Z;  2GA2 A;  5A2Q Z;  3MFK A;  2HR3 A;  4HLY A;  4RAY A;  5ICC A;  2EFO A;  1ZLK A;  2QBY A;  4XRF A;  3ZPL A;  3RKY A;  1AWC A;  1IN4 A;  3T8R A;  4YIF A;  1V4R A;  4HOB A;  4I02 A;  4HLX A;  3PQJ A;  3GF2 A;  1R00 A;  2ETH A;  3ECH A;  1L3L A;  1BC7 C;  3M1E A;  3ZMZ A;  4CIC A;  5BPD A;  1PUE E;  1EH8 A;  3WTV C;  3ABU A;  3M8F A;  2CW0 F;  1XMA A;  2XAG A;  5K5R A;  2COM A;  2P5K A;  2VE9 A;  3F3X A;  2E1C A;  2VBX A;  3HRU A;  2CO5 A;  2CWE A;  2FXA A;  2Q8K A;  4Q5S F;  1KYZ A;  1YYV A;  2K7L A;  1BIA A;  3GO5 A;  2NAZ A;  3ZP5 A;  4KYW A;  5L3C A;  3E5Q A;  3MZY A;  2Z9O A;  3VOD A;  1HBX G;  3N97 A;  1KA8 A;  5L3D A;  5HOO A;  2QQA A;  2ISY A;  3GFJ A;  2A69 F;  4K2E A;  4S04 A;  4HV6 A;  4XLN F;  1SAX A;  3CLO A;  2HZT A;  3EET A;  4PDK A;  3KCC A;  1CF7 B;  3O6B B;  4N9I A;  1QPM A;  1GXQ A;  2O3F A;  2ZNZ A;  1WSU A;  2VBZ A;  2HYG D;  5JFR A;  1J7K A;  1I1G A;  3NQO A;  2PI0 A;  4WXD A;  2K27 A;  5DUK A;  3I64 A;  2NRA C;  1S7O A;  5L3B A;  1EH7 A;  2IA0 A;  3H92 A;  4MQ9 F;  1H9T A;  4JBA A;  1JGS A;  4BQA A;  5LGT A;  4IXA A;  4XSZ F;  4ETS A;  2MLG A;  3I59 A;  3VEP A;  1I6X A;  4U7D A;  1R5G A;  2A6E F;  3F23 A;  2ZCW A;  5EEH A;  4Q4Z F;  2IA2 A;  3E5X A;  4MTD A;  4Y15 A;  5E20 A;  3E6D A;  2PMU A;  3C7J A;  5HS7 A;  3GFI A;  3KZY A;  4R1H A;  3TQN A;  4MGR A;  5HDN A;  1SMY F;  3IRQ A;  4UUV A;  2DU9 A;  2HKX A;  2CQK A;  3WTY C;  1P6R A;  1O7F A;  4ENK A;  4GO1 A;  1IAW A;  3EYI A;  4HZF A;  2H09 A;  2ACJ A;  4EGZ A;  1BBY A;  2G7H A;  2O8X A;  2CG4 A;  2HQR A;  1WI9 A;  3RPQ A;  5E1Z B;  1HW5 A;  2RDP A;  4UV8 A;  2EA2 A;  3P9I A;  2XAQ A;  2A68 F;  5BMZ A;  1IZ1 A;  5ICE A;  4ZZD A;  3NEU A;  3RIR A;  2STT A;  2IW5 A;  3DFG A;  3TKY A;  1FP1 D;  2BE5 F;  1LEB A;  5DUI A;  1LQ1 A;  1MKM A;  5CLS A;  3D0S A;  3K9T A;  1HXD A;  4OIP F;  3KP6 A;  2JSC A;  4EMS A;  4LB5 A;  1KU9 A;  4KIF A;  1KU2 A;  3BZ6 A;  3WE2 A;  1YQA A;  2DPD A;  4IPA A;  1OYW A;  1FNN A;  1BM9 A;  4PGG A;  1S6L A;  2FE3 A;  2IJL A;  5DCM A;  5CVJ A;  1WKM A;  5CVI A;  1SD5 A;  1FBQ A;  1XB4 A;  2H94 A;  4M6X A;  2PFB A;  3T1B A;  2PN6 A;  3COA C;  3HHH A;  2W85 A;  5E1W A;  3ZMS A;  1W4M A;  4A0X A;  3KE2 A;  3U2R A;  4BHP A;  2Y0M A;  3DP7 A;  3GVA A;  3U1D A;  3H3U A;  5FD6 A;  1ZG1 A;  3R0A A;  2KIF A;  2PQ8 A;  3V8L A;  4RGR A;  4WX9 A;  2PBI A;  4O5V A;  5CYV A;  1YTY A;  3FM3 A;  2A3S A;  2CSO A;  2IVM A;  3WE3 A;  3J80 K;  3P9C A;  1Z91 A;  3BP8 A;  1T6S A;  1OYY A;  1FPQ A;  3T0Y A;  3E3V A;  1FX7 A;  3DEU A;  4EM1 A;  1NHA A;  4A2U A;  5JI6 A;  4EVI A;  4BNC A;  1FT9 A;  1B9M A;  4IF4 A;  1T38 A;  3FWE A;  4G94 A;  1YFH A;  3DF8 A;  2QEN A;  4RB2 C;  3E97 A;  5F6F A;  3HRT A;  4WXH A;  1ZG3 A;  3RPU A;  3KEO A;  1QO0 D;  3EQL F;  4PZJ A;  1T98 A;  2IT0 A;  3WTX C;  4AIK A;  1VTN C;  1H0M A;  1MGT A;  2VOO A;  1LJ9 A;  1TQP A;  4EV0 A;  1DPR A;  4KMU X;  1WQ2 A;  4ENN A;  1P4W A;  1RNL A;  5ILS A;  1G3T A;  3I0T A;  4U0Y A;  4ON0 A;  4KMF A;  2ZXJ A;  4I2O A;  4CXF A;  4L9J A;  3BY6 A;  4R79 A;  3ML6 A;  1L0O C;  1XMK A;  2HTJ A;  4HF0 A;  3OV8 A;  5HLG A;  2QVO A;  4U0V A;  3LA7 A;  5J8C A;  1G3Y A;  1KYW A;  1LVA A;  4HA8 A;  3BOQ A;  2UZK A;  3J81 K;  5LEJ A;  2BV6 A;  2ZJ2 A;  2V1U A;  2JZY A;  2P6S A;  4HX8 A;  2E7X A;  3H3Z A;  3LAJ A;  1K7A A;  3E6M A;  4GXO A;  2LF8 A;  3DXJ F;  1PP7 U;  3F8M A;  2O0Y A;  5HDG A;  2ZO4 A;  1UFM A;  4Q48 A;  3WOD F;  3VOE A;  2IP2 A;  3B73 A;  4HX4 A;  1B6A A;  5FB2 A;  1ZGA A;  3BJA A;  2M8E A;  1DPU A;  1G6N A;  2QYO A;  4KIG A;  2Q0O A;  3KFW X;  5JHU A;  3I71 A;  4CGZ A;  2CGP A;  4IJA A;  2FBH A;  3K1N A;  3J80 Z;  1FOK A;  2FBK A;  1QBJ A;  2BGC A;  4EQQ A;  4WCG A;  3FF5 A;  5F64 A;  1J9I A;  5TRD A;  5IT9 K;  3RJP A;  4P55 A;  3KP7 A;  3BDD A;  1Z9C A;  4OIO F;  1O3T A;  4YII A;  1GHC A;  2JTV A;  4QWQ A;  4XLP F;  5CVV A;  2JRT A;  4O6J A;  3AAF A;  2K86 A;  1REP C;  3REO A;  3K0L A;  4WWC A;  2FNA A;  1XGM A;  4I0B A;  4Z2Y A;  3J7A O;  1FYK A;  5ICF A;  3C3W A;  5LBQ A;  5D8L B;  1ZAR A;  4M73 A;  4LK0 F;  1FP2 A;  2O6G E;  2Z5U A;  2STW A;  4U0W A;  2G9W A;  3I58 A;  3FMS A;  4I7H A;  2HEO A;  2GXG A;  2M30 A;  1FC3 A;  3W6J B;  1BI3 A;  1JXS A;  2DQR A;  2VT3 A;  3I4P A;  4F7Z A;  2EB7 A;  3K1P A;  3DV8 A;  4ZYE A;  4EJU A;  3F72 A;  3FX3 A;  3C18 A;  3GYH X;  4G6D A;  2VT2 A;  4BH9 A;  1FWZ A;  1S3J A;  5L3E A;  3LQQ A;  1HW2 A;  3I5U A;  4LLL A;  5F1R A;  4HAM A;  1OR7 A;  2Z99 A;  3E6B A;  5J8F A;  5J6X A;  3IWZ A;  4RS8 A;  3JTG A;  4BHB A;  1K6O A;  2CFX A;  1LDK B;  3R6S A;  2NS0 A;  3SQN A;  1KU3 A;  1UHW A;  1TQM A;  2MLK A;  4KN7 X;  5D5W B;  4NQW A;  4O3M A;  5DD4 A;  2RC4 A;  1BN5 A;  1ON2 A;  2KRF A;  5LGU A;  5HVQ C;  1JE8 A;  4ZYG A;  2QQ9 A;  4KT5 C;  5FD5 A;  3RKX A;  1T39 A;  2E7W A;  2UXN A;  3HOT A;  2FML A;  2XGX A;  3HSR A;  1DUX C;  4EJW A;  2DAO A;  2RGV A;  2QQB A;  3QU3 A;  4MQV A;  3M7G A;  2IA1 A;  4IHS A;  4A6D A;  2QM3 A;  3SHF A;  3BWG A;  2O61 A;  1XSD A;  3F8N A;  2ISZ A;  1W7P A;  2M87 A;  2FSW A;  3I53 A;  1GXP A;  3V7S A;  2DBB A;  6PAX A;  5IT9 Z;  4ZYH A;  4RGX A;  2GIV A;  4UVC A;  3SXY A;  3RKW A;  2V79 A;  4EM0 B;  2G7U A;  4LJZ F;  2ESN A;  5K5Q A;  1D3Y A;  1B4A A;  1OKR A;  2LDU A;  3HYI A;  4EJV A;  2ZNY A;  1I27 A;  4OIR F;  3ABT A;  3F21 A;  3JW4 A;  2L02 A;  1SFX A;  2V6C A;  1GVJ A;  1BC8 C;  1S7A A;  3PQK A;  5K5O A;  2QWW A;  2FNP A;  3EYY A;  2P7C B;  2UWM A;  1P92 A;  1P4X A;  4P5O A;  1TQI A;  2YX7 A;  5H6Q A;  1O57 A;  1TNT A;  4D0P A;  2VC1 A;  4G6Q A;  3P7N A;  5A2Q K;  1Z6T A;  2AS5 F;  3E5U A;  1I1S A;  1U2W A;  4PCQ A;  1V3F A;  4EM2 A;  4GCV A;  3I54 A;  1DDN A;  3F6V A;  1P2F A;  2RKH A;  1XCV A;  4A0Z A;  5FFX A;  4BHC A;  2GAU A;  2MA3 A;  1E2X A;  1TW2 A;  2WWY A;  4IVN A;  3L7W A;  3O2P E;  1K78 A;  3K69 A;  3L2C A;  2FBI A;  4YFX F;  2NNN A;  2BYV E;  4M9S A;  1HKT A;  4UVB A;  2KJC A;  2EV6 A;  4OIQ F;  2OA4 A;  1R5H A;  5BQT A;  2NNY A;  2UXX A;  2Z33 A;  2YSR A;  5D5X B;  1R36 A;  3ZMV A;  4QLC U;  3CTA A;  4HW0 A;  3OOP A;  1JHH A;  4OMZ A;  4YFN F;  2OD5 A;  4EGY A;  2EFW A;  3CUO A;  1ZHF A;  5ED4 A;  1WRJ A;  4U88 A;  2VBY A;  4L0Z B;  2X4H A;  4S05 A;  3EDP A;  3HRM A;  1Z6R A;  2JPC A;  3K1M A;  4HQE A;  2W57 A;  1XCB A;  4KFC A;  4BYY A;  1TNS A;  3HTS B;  1W7P D;  1R22 A;  3WU1 B;  3TOA A;  1O3R A;  3VFZ A;  4M9X A;  3GZ6 A;  3K2Z A;  2F5C A;  4CZZ A;  4JK1 X;  4CO8 A;  4RB0 A;  1ZRC A;  1D8K A;  1ZGJ A;  1BOA A;  2RVC A;  1DP7 P;  2WTE A;  4UV9 A;  2FF4 A;  4EJO A;  1F5T A;  5E17 F;  2V9V A;  1P4A A;  1ONV A;  4A12 A;  1HST A;  3KP3 A;  2DW4 A;  2R3S A;  4IRI A;  1J59 A;  2PMH A;  4GYI A;  1OPC A;  2GZW A;  4Y17 A;  1OYI A;  1SMT A;  1USS A;  1YW9 A;  5LRS A;  1IXS B;  4A5N A;  3CO6 C;  5EEG A;  1RI7 A;  1PP8 F;  4ASN A;  3FZV A;  1QGP A;  4AWX B;  1IRG A;  2EK5 A;  4XSX F;  4L9N A;  2W24 A;  3TDZ C;  4I98 B;  3V8J A;  2HFH A;  2FOK A;  3F8B A;  2NYX A;  1UCR A;  4FT8 A;  4HX7 A;  1PDN C;  4AVP A;  1Q1H A;  3Q9V A;  1IRF A;  3WG9 A;  3GLX A;  1YG2 A;  2A07 F;  1I5Z A;  2M1B A;  1Z7U A;  3CUQ B;  2PJP A;  2LNB A;  3QU6 A;  5HLI A;  1ODD A;  1XD7 A;  1WWX A;  4OIN F;  5HS9 A;  5FGM A;  2F2E A;  3KLN A;  5K1Y A;  3NRV A;  1TLH B;  1U5T A;  4P96 A;  2Y75 A;  2DK5 A;  4GYG A;  1FBS A;  3TO7 A;  1B59 A;  2F5F A;  4P9F A;  1U5T C;  1JHF A;  5AIP A;  4WF2 A;  5FO5 A;  1XSV A;  3WTZ A;  3C1D A;  2W25 A;  1T2K A;  1R1V A;  3MWM A;  2P6T A;  2OU2 A;  2HDC A;  4HF2 A;  1O7L A;  3GFL A;  1W5S A;  3DKW A;  2RN7 A;  1R1U A;  2P4W A;  3KP5 A;  1RZ4 A;  3JAM K;  3V7C A;  4ZYD A;  1F9N A;  5D4S A;  2J5O A;  3MEX A;  5DV5 A;  2M5W A;  5D5V B;  2W84 A;  2Q2E A;  3TOB A;  3G73 A;  1UHM A;  1YW7 A;  3HUG A;  3P9K A;  2X0L A;  2D45 A;  2OZ6 A;  1BI2 A;  2V1D A;  2KIM A;  3TO9 A;  3QP6 A;  3RI4 A;  1MDM A;  5E1X A;  4R8H A;  4AD9 A;  5IT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...