1K7AA

Ets-1(331-440)+ggag duplex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*GP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 33
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k7aA00
2K4BA 4MHGA 1MD0A 2ZNYA 4LGWA 5ICFA 4I09A 5KK1A 5E8GA 2DPUA 2M30A 4UXNA 1O3SA 2EWNA 2XUBA 2ZMEA 3WTUC 1QBJA 2RNJA 1TNTA 4YIFA 4AIJA 2DO7A 4M71A 2FNPA 2XHKA 3CUOA 2P5VA 4A5MA 1BBYA 4UV9A 4KMFA 3BY6A 3I59A 3BPVA 1KGSA 4ENJA 3DFGA 2D2WA 1SMTA 4CO8A 3P9CA 3WGIA 4XSXF 1IZ1A 4LLLA 2CW0F 1XSXA 2XV4S 1K7AA 4ENNA 5HDKA 3GLXA 1FP2A 4L18B 5JFRA 4A6EA 2IT0A 1AOYA 4P55A 3TDZC 5LLQA 3KP4A 4AVPA 2YU3A 5DDGA 4OU0A 1ZRDA 2MLGA 3SZTA 3HOSA 4R1HA 1O7FA 2Y48A 2O0YA 2P5KA 2WTEA 2ZJ2A 3MZYA 4ZYGA 3M8FA 4PDKA 4MTEA 3K2ZA 3PQJA 4L9NA 4HAMA 1B9NA 1IF1A 1LDKB 2MLKA 1I1GA 5CVJA 2P6SA 4QLCU 1KU2A 4A5NA 1XMKA 1HW2A 5LRRA 3IHUA 2MD5A 3KP2A 3LAJA 4HV5A 2NNNA 1G3YA 3R0JA 2RDPA 1D3YA 2OQRA 3F8BA 4FX0A 4B09A 3EDPA 3TOAA 2VT2A 1BI2A 4RAYA 3RDIA 3TGNA 3KP7A 4KMUX 3WTTC 4BXUA 3LQRA 3JTHA 1P4AA 1FZPB 1GHCA 2CG4A 2F5DA 4FX4A 1T6SA 3Q9SA 2Z5UA 3I53A 5K5RA 4MQ9F 3F22A 2PJPA 2IW5A 1PUEE 1QZZA 4KNYA 1QO0D 4P5OA 4N9IA 3WODF 1LQ1A 1ZG3A 1G4DA 3M7GA 1Z9CA 4HF1A 3QP6A 3KE2A 5AIPA 3ECHA 3C18A 4KN7X 3V8KA 3DQVC 5CYVA 3MQ0A 3HTSB 5FD6A 3HUGA 4ZH4F 3L2CA 2ISZA 2H94A 1HXDA 1B9MA 4ZYHA 1H9GA 4Q5SF 4M72A 1FT9A 4HQEA 1U8RA 3RTRA 2BEOA 1HSJA 1EH8A 3CUQC 3GZ5A 4FHTA 4UVBA 3H92A 4BHBA 1B4AA 3FM5A 1HW1A 3JTGA 4CZZA 1R23A 2J5OA 1YTYA 1IRFA 4K2EA 1DUXC 2GIVA 2ZFWA 2EV5A 3U2RA 2K27A 3REOA 2NYXA 4IXAA 1T98A 2FEZA 5CJ9A 1SD6A 3F8MA 1KYZA 3FM3A 4M9XA 1ONVA 5HOOA 1TQMA 1JHHA 4HQMA 4N9HA 5BMZA 2J5PA 2PBIA 2JRTA 3LSTA 2QQ9A 3HIFA 2P5LC 5KVRA 2VOPA 4LK1F 1E2XA 2RC4A 1SD4A 1IN6A 1IUYA 3RPUA 5FFXA 3W6JB 1MDMA 6PAXA 3EYIA 1O57A 2BGCA 4MNUA 3L09A 3T0YA 3ZMUA 4EV0A 4XLNF 5LBQA 1PP8F 2M45A 2JSCA 1ZRCA 1YLFA 4KIBA 3GEZA 5H20A 3QPHA 2ETHA 3DPLC 2XIGA 4RGXA 2CYYA 1OR7A 3L00A 5TJJA 3IKVA 5ICCA 3GVAA 4RB1A 3P7NA 5DD4A 1K78B 1XN7A 4ON0A 5D4SA 3GFIA 2EB7A 1S6LA 2E7XA 1MJBA 1UFMA 3DKWA 4OMZA 4WX9A 1Z6TA 3QRFF 5FD5A 5ILVA 4U88A 2VOOA 3WTWC 3JAMZ 1TTYA 2JPCA 3JSPA 3BZ6A 2R7DA 1J7KA 1FP1D 3K1MA 1W5SA 4RB0A 2K86A 2LDUA 1KYWA 1G3TA 1W7PB 1JXSA 2F2EA 2OU2A 3PQKA 4JBAA 5F64A 5D5UB 2NAZA 4ESBA 3C7JA 4HLXA 1HSTA 5DYMA 3ULQB 3TO9A 2NS0A 4EMSA 1F9NA 5D5WB 2FMYA 5D4RA 2FE3A 3KZYA 4P96A 4U7BA 4MQVA 3IWZA 1XGMA 1RUOA 3HRTA 4I7HA 5L3CA 3L9FA 3E6BA 3K9TA 3H3ZA 1HKQA 5F1RA 1CF7B 1K78A 1IN5A 5DUKA 2W84A 3V7SA 3V7RA 4XLPF 1MJ9A 4NB5A 2Y75A 1ZLJA 1TW2A 2PFBA 3MWMA 3VOEA 1L0OC 3OV8A 2A3SA 1J75A 1OYWA 2PMUA 2V1DA 3F8CA 2W25A 2O3FA 4OIRF 1IW7F 3WTXC 2JPBA 3GZ6A 2O6GE 4HX8A 1W7PD 3E6CC 4IRIA 2DTRA 2EA2A 4PGGA 3GFLA 1W7PA 3F6VA 2YSRA 2ZKZA 1IRGA 3O6BB 1BM9A 2P8TA 3LAPA 1QQIA 4LK0F 4M6YA 2FU4A 4OIQF 3TOBA 3T1BA 4HX7A 3HHHA 2A07F 1FOKA 2M1BA 4BH9A 2ADUA 3V8LA 4M9ZA 3VODA 2FA5A 5D6EA 2MA3A 1JHFA 5HS8A 3J7AO 2ZCWA 1YW9A 5L3GA 3GWZA 2L54A 3DEUA 2RN7A 3I59B 1Y0UA 4YG2F 3HSFA 4OIOF 2HR3A 3TO7A 1CF7A 3EQLF 1KQ9A 2FXAA 3T5XA 1GXPA 1FBQA 1F4KA 5E1WA 1FSHA 1J59A 1GVJA 1YW7A 4YFNF 4ZZDA 3F8NA 3BOQA 4H0EA 2D45A 3E3VA 4M6XA 1FY7A 3W6KB 1G3SA 4EQQA 1R36A 2AXLA 1Z91A 4G9YA 4HYEA 4KN4X 2IJLA 3I54A 4Q4ZF 1XGOA 2DU9A 3PFIA 2HZTA 3R60A 1U78A 3FHZA 3F3XA 3GO5A 4P9FA 2WC2A 1SFXA 1H0MA 2MH2A 1K79A 4Y17A 4AIHA 1I27A 3WGGA 2XRNA 2F5CA 1ZGJA 1W5TA 2EA4A 2GA2A 1WQ2A 4KUMA 4GCVA 3LWFA 3HRSA 4O5VA 1J2XA 3NQOA 1YYVA 2KIFA 2OBPA 2W85A 1BOAA 2LF7A 5CVVA 2VONA 3C3WA 4G8XA 5CVIA 5FGMA 1REPC 4U7DA 5H6QA 3KP3A 1TBXA 1YQAA 1R7JA 4ENMA 3F21A 3GX4X 3ZP5A 4CGZA 1BIAA 2MC3A 1S7OA 3IRRA 3TQNA 2KKOA 2EK5A 4HBLA 1U5TB 2KRFA 3EYYA 1RIOH 3O3KA 5DCFA 4EM2A 2DLLA 5E8IA 4L0ZB 2HYGD 4F7ZA 4Z2YA 1SD5A 5LGUA 4LFUA 3HSEA 2CO5A 3N97A 3B73A 1S8NA 4LLGF 1KA8A 3KEQA 3T8RA 4GYGA 1XDUA 4G7HF 4QWQA 3QAHA 1ZG1A 1ZLKA 4OMYA 2QQBA 3U9GA 5ILSA 3RJPA 1XMAA 3F6OA 4KIFA 3FZVA 4YIIA 1Z6RA 2B0LA 2FRHA 5BPIA 4LB5A 5L3DA 1UB9A 3E97A 2YPRA 3QU3A 2FBIA 3HRMA 4EGZA 5LHHA 3RYRA 3LFKA 3IWFA 2V9VA 3C1DA 3ZQ7A 2XVCA 4HW0A 1MDMB 3LA7A 3T8TA 1OKRA 3SZPA 1U5TA 4LD5A 5JR3A 4IRGA 5J8FA 3M9AA 5DCMB 4M73A 4GXOA 2D1VA 3WGHA 2EFQA 1U6GA 1USSA 4EJTA 3LA3A 2PI0A 4G6DA 3BP8A 2IA2A 4CYDA 3GFMA 2PN6A 3GF2A 5E18F 4WXCA 1R1UA 4ESFA 5EEGA 4L0YB 2YR2A 1ODDA 5CVUA 3DXJF 3FWEA 4OOIA 2WWYA 1VTNC 2H6CA 5FLXK 1R1VA 1T38A 1LDJA 4YFKF 1IXSB 2PEXA 2DQLA 2E1CA 2VC0A 4R8HA 5D5VB 1HKTA 2HFHA 4NHJA 2EFPA 2A5YB 2KIMA 4G7OF 1YW8A 3BJOA 1QPMA 4LB6B 1V4RA 1Z1DA 5L3FA 2X0LA 5BOXA 4NQWA 1LNWA 5ICEA 4L5JA 1BIBA 4O6JA 3KEOA 3RPQA 3KETA 5HLHA 1PP7U 3R61A 1K6OA 3GXOA 3G3ZA 3K1PA 3FXQA 1I6XA 4ASNA 5DCMA 4RGSA 2QENA 4IVNA 1XD7A 1UHWA 5K5OA 3WU0A 2DT5A 1BN5A 3EETA 3VEPA 1R58A 1J9IA 2H27A 4KIGA 2VBWA 2IA0A 4PCQA 3M1EA 5EEHA 4I98B 3BROA 2KJBA 2ZO4A 3MCZA 4XBFA 2EFWA 3Q5FA 4A6DA 1BC8C 2UZKA 2P7CB 2GXGA 2K7LA 1XB4A 3V7CA 2A6HF 1L3LA 2CGPA 1TQIA 1MKMA 1OYIA 5AONA 4JK1X 4XRFA 3EUHA 1YFHA 3OOPA 2D1HA 1WSUA 1T39A 1F1ZA 1W4MA 4UVCA 1UHMA 2OZUA 5ICGA 4N0BA 2DBBA 4IF4A 5K5QA 3I58A 1ZYRF 2OAZA 4A0XA 2RV8A 4LJZF 4HDVA 4BYYA 3IKTA 2Q8KA 3KZZA 4IRHA 5FO5A 4EJUA 2Z9OA 1SFUA 1B59A 3SXYA 4BHCA 3CTAA 1AWCA 2A69F 5TRDA 1P4WA 2O61A 3IC7A 4I0AA 2R7FA 2QYOA 1JGSA 5A2QZ 2PLYA 3QOPA 3J81Z 1QGPA 2A6EF 2XAGA 4G94A 2VE8A 3SHFA 5BPDA 1DPRA 3G73A 1E17A 1EH7A 3J80K 3KLNA 1MGTA 4U0WA 2DW4A 3GYHX 1LDDA 3E5UA 2QM3A 1TLHB 5HS7A 2CFXA 4IHTA 3DP7A 2VT3A 3WE3A 4EJOA 4A0YA 5HVQC 1XCVA 5LRSA 3NEUA 3SQNA 2HQNA 3IRQA 4LLNA 3R6SA 3JSOA 5DD8A 3WTVC 4UHTA 2Z33A 4WXDA 1KU9A 1ON1A 2HDCA 1R1TA 2XAJA 5K1YA 4UUVA 1V3FA 1SMYF 3HYIA 1ZGAA 3O2PE 2EV6A 2HKXA 2XAHA 1T2KA 3CJNA 2IP2A 4LMYA 2GZWA 1TQPA 1BC7C 2F5EA 3R4KA 3RKYA 2XASA 1KQ8A 2EJRA 4HF0A 2L3DA 5L3EA 1ZREA 2E1NA 2NNYA 3AAFA 3RKWA 5E17F 3P9KA 3BJAA 4TV7A 2UWMA 2CWEA 3CO7C 2R3SA 1HKSA 1C0WA 1XCBA 2OA4A 1XGSA 5ERIA 4EM0B 3CO6C 2Z3YA 1FWZA 3ABUA 1HQCA 4CICA 5E1XA 3ROUA 2GAUA 3HHGA 3QU6A 1JE8A 4Y15A 1ZHFA 1WI9A 4Q48A 4CXFA 4HA8A 2ESNA 5HLIA 4AD9A 2P4WA 5JI6A 1ZG5A 2XKOA 2QLZA 5A2QK 2HGCA 4I02A 5JVTA 3J81K 1SD7A 2MH9A 1O3RA 4IJAA 5L3BA 1O7LA 1U5TC 2XKPA 3GW2A 2NRAC 2FNAA 1I1SA 5ILUA 2XGXA 1O3QA 1FX7A 1ULYA 1G3WA 4WWCA 4RS8A 4CHUA 4MGRA 1XSDA 1FNNA 4I2OA 2XROA 2DQRA 2M8EA 2HOEA 3TKYA 4PGHA 1BI0A 3TO6A 5LEJA 2EFNA 4BAYA 2HKOA 3V4GA 1J0RA 5LGNA 2STWA 2IVMA 4S04A 2VBXA 1B6AA 2OD5A 4MEYF 4R79A 4P9UA 4LG0B 3I5UA 1R00A 3ISPA 2XAQA 4O3MA 1YS6A 4A2UA 5LEKA 5FLXZ 4B8XA 4Y13A 5FFZA 2IPQX 1H9TA 1DP7P 2FBKA 3QP5A 3RIRA 3FXUA 5HLGA 3E6DA 4L9JA 1FYMA 3E6MA 1G6NA 1ZH5A 3ZMSA 3VB2A 2TDXA 2LNBA 1YO5C 1CGPA 4EVIA 1QZYA 1S7AA 5E1ZB 2JT1A 4EJWA 3F23A 1F5TA 2LSOA 2H09A 2RKHA 4G6QA 1ON2A 2L02A 4S05A 4MTDA 3FMQA 3B02A 4ZZLA 3KLOA 3HSRA 4HF2A 4UVAA 1EH6A 4OIPF 4ZYEA 5J6XA 4EJVA 5BQTA 4M9SA 4RB2C 3WG9A 2V6CA 4IPAA 2K02A 4LG0A 1J5YA 3DV8A 4BHPA 3K69A 2G9WA 3WTZA 2OZ6A 4D0PA 2DPDA 2RQPA 1PDNC 3L7WA 2M5WA 4KYWA 2DK5A 4DQ2A 2E7WA 2HEOA 2UXNA 3V8JA 2V79A 4IHSA 3VFZA 3CLOA 2FMLA 3DF8A 5IT9Z 4XSZF 4E70A 3S2WA 4UNOA 3MEXA 2IRFG 4KFCA 1SFEA 1BI1A 1RUNA 2GA1A 2ISYA 1U3EM 3HRUA 2QVOA 2ZNZA 4ENKA 2BV6A 1P2FA 1D8KA 3ZMZA 3FMSA 3FF5A 3U1DA 1LVAA 3JW4A 5D8LB 1IN8A 3ZMDA 5D8KB 4L9TA 2DI3A 4EM1A 3F72A 2QWWA 2HTJA 3NRVA 1ZRFA 2Q2EA 3KFWX 4KA4A 1IXRC 4L9VA 5DEQA 4GYIA 1TW3A 1LB2A 2VE9A 3ZMVA 3TDUC 2QBYB 4GGGA 1LEBA 4RGUA 1ZARA 4M74A 1YIOA 1O3TA 5E20A 3RYPA 3J80Z 1WWXA 1FYKA 4HZFA 1EV7A 2O03A 1IN7A 2L4AA 1MJAA 2VXZA 2COMA 1KU7A 4YFXF 2FF4A 2EFOA 1P92A 3I64A 4I0BA 2QUFA 3K0LA 3BWGA 4CDGA 2BE5F 5JHUA 3M8EA 3HTUA 2UXXA 1UCRA 1U2WA 4KT5C 3R0AA 2DAOA 2WV0A 3WTYC 3DPTA 1FPQA 4A12A 4RGRA 2L4MA 2P6TA 3ZMTA 4HDUA 5DV5A 3CUQB 2M87A 2P7VB 1SAXA 1FYLA 2HTSA 1BI3A 1RZ4A 2KIUA 3ERED 1FBSA 4UV8A 4WXHA 1R5HA 2PQ8A 1HBXG 4PZJA 5LHIA 1QNTA 3GUDA 3KP6A 3P9IA 2A61A 4RAZA 4WF2A 4U0YA 3KP5A 2H6BA 1FBUA 1OMIA 2QBYA 3BDDA 5IT9K 2HS5A 4AWXB 2O8XA 1X3UA 3F8FA 2FQ3A 1IXCA 1KQ0A 4RB3C 1XDSA 2KJCA 5CVRA 3E5QA 4AIKA 5D6FA 2PG4A 4OINF 2JZYA 1IN4A 2F5FA 3ZPLA 2V1XA 5HDGA 1WRJA 3N4MA 4HLYA 5DUIA 1WKMA 1OYYA 4MEXF 1MZBA 1XGNA 4ESJA 4JQFA 3QPTA 1A04A 2FOKA 2ZBKA 2VODA 1S29A 2STTA 3RKXA 1ZAOA 3SFZA 4L5IA 3I71A 2QZ8A 1I5ZA 1RNLA 2CSOA 5D5XB 2FBHA 3COAC 2QQAA 4HX4A 1BJAA 2GQQA 1DPUA 5ED4A 3I0TA 4WCGA 2VBYA 1R22A 3CUQA 2GWRA 1D8JA 2ZXJA 3CDHA 3HOTA 5F6FA 5HS9A 2OQGA 2Q0OA 4KICA 1Z05A 2Y0MA 1RI7A 1STZA 1Z7UA 1S3JA 2HWVA 1TNSA 3BPXA 3WU1B 1XSVA 4Q47A 3I4PA 1LJ9A 2HYFA 4G7ZF 1P6RA 1Q1HA 3WTSC 4WK8F 3LQQA 1ZN2A 2PMHA 4ETSA 3MFKA 4BNCA 1OPCA 3FMRA 4BQAA 2VBZA 1USTA 4ZYDA 2VC1A 3BJ6A 3MZHA 1GXQA 2A68F 4HV6A 1D5VA 5FB2A 2AS5F 1FC3A 1HW5A 4I01A 5LGTA 1FLIA 1T0FA 2LF8A 2GXBA 4KDPA 3RI4A 3K1NA 2ACJA 2RVCA 5CLSA 2ESHA 3ZN1A 3Q9VA 3E5XA 3WE2A 5H6RA 1LEAA 1IAWA 5LHGA 2L01A 3MAJA 1YG2A 1FSEA 5AIQA 2V1UA 2ZMEB 3LA2A 3D0SA 2BBYA 2ELHA 3D5LA 1YS7A 1DDNA 2CQKA 3FXRA 2DK8A 2XAFA 4GO1A 3ELKA 2Z99A 1P4XA 1R5GA 5IT3A 2MBFA 3H3UA 2VN2A 4HOBA 4DNCA 3IL2A 3FX3A 2JTVA 2YX4A 3GFJA 4A0ZA 2X4HA 2G7UA 5HDNA 3ECOA 2HQRA 1KU3A 3JAMK 2C6YA 3KCCA 2EV0A 2K4JA 2DFIA 2G7HA 2LKPA 4U0VA 2FSWA 1B1BA 5BS6A 4FT8A 2W24A 3ABTA 2W57A 4EGYA 2IA1A 2YX7A 2RGVA 2BYVE 3ZN0A 1NHAA 5J8CA 3ML6A
chains in the Genus database with same CATH superfamily
3FKIJ 2K4BA 1QVTA 1H88C 4MHGA 3VYRB 1MD0A 2ZNYA 4LGWA 2DA3A 4GDFA 1QPIA 2OPTA 5ICFA 4I09A 5KK1A 2DFEA 1X4PA 5FKKA 5E8GA 2EZKA 2DPUA 2M30A 4UXNA 1O3SA 3SEZA 2K9LA 3G2BA 3OOUA 2EWNA 2XUBA 2ZMEA 3WTUC 2BW3A 4XRMA 1QBJA 3O8HA 4CCJA 3MKLA 2VKEA 5HNHA 2RNJA 1TNTA 4YIFA 1X1PA 4AIJA 4CUGA 2DO7A 4M71A 3TBIA 2FNPA 1TT5B 2XHKA 3CUOA 4B44A 5B5EC 2P5VA 4A5MA 1BBYA 4PJ0C 4UV9A 2GBYA 4KMFA 3BY6A 3I59A 3KYCB 3BPVA 3HDDA 1KGSA 1BW5A 4ENJA 2X48A 3DFGA 2D2WA 4A3BJ 1SMTA 4QIWN 3PNYA 4CO8A 3P9CA 1LKXA 1UZCA 3WGIA 2OF7A 4XSXF 1PUFA 1IZ1A 4RLFA 3AL0C 4LLLA 2CW0F 4UB6C 1SVLA 1XSXA 2XV4S 5M5XJ 3GLLA 1K7AA 4ENNA 1MNEA 1SFOJ 1IJWC 1JUMA 2K85A 5HDKA 4I6ZA 1YI2I 3GLXA 1FP2A 1RETA 2JRMA 2H8RA 4L18B 4JOMA 5JFRA 4A6EA 2XPUA 3PNTA 4XL9A 2X1DA 2IT0A 1AOYA 3QOEA 4P55A 3TDZC 5LLQA 3KP4A 2BOLA 3CCLI 4IQ4A 4AVPA 2UUZA 3E1SA 2YU3A 3UKGA 5DDGA 1Z77A 4OU0A 2QKMB 1ZRDA 2MLGA 3SZTA 3GTLJ 2M34A 2V9PA 1HCRA 3ZQFA 4AYBN 3HOSA 4R1HA 4FTHA 2BXYA 1O7FA 2Y48A 3JRDA 2O0YA 2H1KA 3L2VA 5GAHJ 3PIOF 2P5KA 2WTEA 2ZJ2A 3MZYA 4ZYGA 2LD5A 1GDTA 4DIQA 3M8FA 4PDKA 3HUGB 1K6YA 3LSPA 4MTEA 4CCOA 2WB1N 3K2ZA 4B43A 2ME6A 3CCMI 3PQJA 4L9NA 4HAMA 1E3HA 2WY8Q 3OYJA 1B9NA 2WV1A 1IF1A 1LDKB 4M6VA 2MLKA 1I1GA 5CVJA 2P6SA 2E5NA 4QLCU 4XN3A 1KU2A 4A5NA 1X1BA 1XMKA 4ZYAA 3TEDA 2IS6A 1K4SA 1HW2A 1EA3A 5LRRA 3IHUA 2K9SA 2IXSA 2MD5A 1BW6A 2KRHA 3KP2A 1SAUA 2DJNA 3LAJA 2LG4A 4HV5A 2NNNA 2NVYJ 3ASOH 1G3YA 3R0JA 3UR3C 2RDPA 2WBMA 1IV6A 1D3YA 2OQRA 3F8BA 2DMQA 4FX0A 5M3FJ 4B09A 3EDPA 3TOAA 3HOUJ 2VT2A 2R7WA 2Y9ZA 1BI2A 4RAYA 3RDIA 3TGNA 3KP7A 4KMUX 3WTTC 1ETYA 2F4OB 4BXUA 3FHNA 1YJNI 1WJBA 3LQRA 3JTHA 1P4AA 3Q0VA 1FZPB 1GHCA 2CG4A 1V55H 2F5DA 1T6SA 4FX4A 1JKPC 3Q9SA 1YJWI 2Z5UA 2X6XA 3TP0A 3CJTB 2LFBA 3I53A 5F27A 2A5WA 5K5RA 2DOFA 3ZQQA 1POGA 4DW6A 4MQ9F 4XLFA 3F22A 2PJPA 3NWTA 4AVZA 2IW5A 1UG0A 3EUAA 4E7IA 1PUEE 3S1RJ 1QZZA 4KNYA 1QO0D 1E3OC 2V7FA 1D1CA 3FXLA 4P5OA 1DDNA 4RAGA 1WHUA 3H5RA 4N9IA 3BT9A 5FRMA 4BE1A 1MMAA 2KRCA 3WODF 3QYFA 2LR8A 1LQ1A 2KDOA 1ZG3A 1G4DA 4LIVA 3M7GA 4HEA2 1Z9CA 4HF1A 3QP6A 3KE2A 5AIPA 4DBRA 3ECHA 4UY8I 1DP3A 3JRBA 1WCMJ 3C18A 2CS3A 2EH3A 2CQQA 3DLLF 3CC4I 3HXLA 2R7SA 1JT6A 4KN7X 3AG1H 3V8KA 3DQVC 2HQAA 5CYVA 3MQ0A 1YHQI 4XK4A 3HTSB 5FD6A 2VUMJ 2LLKA 3HUGA 4ZH4F 3OYFA 3L2CA 2ISZA 2H94A 2Y31A 3KX2A 1HXDA 1MW7A 2VJIA 2E34A 1B9MA 1OFCX 4XM3A 4ZYHA 4E7SA 1H9GA 3IH2A 4JP0A 2ZXIA 4Q5SF 2FX0A 2Q1ZB 4M72A 1U8BA 4QTRA 1FT9A 2PMZA 4HQEA 4XN0A 3OYGA 2WAEA 1U8RA 3RTRA 2BEOA 4ZTFA 5EYRA 4MIMA 2E2JJ 3CCYA 2FUG2 5C3EJ 2DDBA 1HSJA 1EH8A 2K3FA 3DEEA 4A3EJ 3CUQC 3GZ5A 4FHTA 4UVBA 2JJ7A 2DMNA 4PK4A 3H92A 1MNMC 2X1CA 4BHBA 5KCMA 2BVMA 3IP4B 1B4AA 2VB6A 3FM5A 1HW1A 3JTGA 3RQIA 3CQZJ 1K83J 4CZZA 1VNDA 4D5FA 1R23A 3E7LA 2J5OA 1Z67A 1YTYA 1IRFA 4IQJA 3TP3A 4K2EA 3PL8A 2KZGA 1DUXC 2GIVA 3A0BC 2DOEA 2ZFWA 1KZHA 2EV5A 3U2RA 2K27A 3OS0A 4KJZA 3REOA 4J01A 2NYXA 4IXAA 3GTMJ 1S7EA 1T98A 2FEZA 3QPLA 5CJ9A 1SD6A 5E3NA 1B8IB 3F8MA 1KYZA 4CSWA 3ABLH 1Y8QB 3FM3A 4M9XA 3HPHA 1ONVA 2XSDC 4C2TA 5C4JJ 1LVKA 3CP8A 1UG2A 4B1RA 1JJ6C 5HOOA 1TQMA 1JHHA 5B1AH 4HQMA 1X1AA 4N9HA 5BMZA 3HOZJ 2J5PA 2PBIA 1DQUA 3HL2A 2JRTA 1MBGA 3LSTA 2QQ9A 3HIFA 2P5LC 5M5WJ 5KVRA 1IRZA 2VOPA 2LOOA 4LK1F 4BQOA 3RPUD 1E2XA 2RC4A 1SD4A 5EF6A 1IN6A 4JX6A 1MBKA 1IUYA 3RPUA 1WI3A 3MZ8A 3BQZA 1Y1WJ 3LOCA 4HSRA 4F3QA 5FFXA 3W6JB 2DFFA 5E3MA 3K4MA 1MDMA 3HZJA 6PAXA 3EYIA 1O57A 3VDXA 2BGCA 2A05A 4MNUA 2IBDA 1SANA 3L09A 3T0YA 2XGDA 3SYTA 5DM6F 2X6OA 3ZMUA 3J7YJ 4EV0A 4XLNF 5LBQA 1PP8F 2M45A 2JSCA 3L1PA 1ZRCA 1YLFA 3HM5A 4KIBA 3GEZA 3VWBA 4HG2A 4LOCA 4DJAA 5H20A 1FOXA 1MBHA 2OC6A 3DCFA 3H1CA 3H5AA 3QPHA 2E2HJ 3CJRB 2ETHA 4FETA 1ETVA 3DPLC 2XIGA 1ENHA 2XB5A 4G12A 2FD5A 3BQYA 2CUJA 1RESA 4RGXA 3RKQA 2CYYA 1VQ7I 4RM2A 2OTLI 1VFCA 3OL3A 2ECCA 1GV5A 1OR7A 4BDYA 1N75A 4ABZA 2I8DA 3FXJA 4JYKA 3L00A 5TJJA 3H0DA 3P5JA 4FE4A 3IKVA 2EBIA 5ICCA 1IUFA 3GVAA 4RB1A 3GTKJ 1ITYA 3K2AA 4DYCA 4OWRB 1B8IA 3P7NA 5DD4A 3S17J 2OV7A 2HI3A 3LL7A 1K78B 1XN7A 4ON0A 2QA4I 2ZSIB 3D5SC 4XLAA 3F0CA 5D4SA 3SZGA 3GFIA 3I9V2 1IRXA 2EB7A 1UMQA 1S6LA 2E7XA 1MJBA 1UFMA 3OS1A 1GUUA 3DKWA 3OYMA 4IO9F 4OMZA 5BNGA 2XF7A 4WX9A 4PSXA 4XRSG 1Z6TA 3QRFF 5FD5A 5ILVA 1I50J 4U88A 2JWTA 1YE9A 2VOOA 3WTWC 3JAMZ 1TTYA 1OCTC 2JPCA 3JSPA 4XMYA 3BZ6A 5GPAA 2R7DA 1J7KA 1FP1D 3K1MA 1T56A 1W5SA 2M0MA 4RB0A 2K86A 2CQNA 1KYWA 2LDUA 3QWLA 1G3TA 4IZZA 1BL0A 2JMWA 5K7ZA 1CQTA 4AM3A 1W7PB 1JXSA 2F2EA 4XKBA 2OU2A 3QYEA 3PQKA 4JBAA 3OYCA 4NC8A 5F64A 5JLXA 2CV0A 1TWAJ 4A3CJ 2VLAA 5D5UB 2D5VA 2B7EA 2NAZA 2KIQA 5F0HA 5C44J 1IGNA 4QPQA 4ESBA 3WU2C 3FBIB 3C7JA 4HLXA 1HSTA 5DYMA 1AHDP 1T95A 4XR6A 1ZK8A 1F43A 3HOYJ 3S2DJ 3H0GJ 3ULQB 4CCMA 2X6WA 3LNQA 3TO9A 2XGCA 2NS0A 3ESWB 3X2QH 4EMSA 1D1BA 1F9NA 2ZMEC 1VQ9I 5HLTA 2R7RA 5D5WB 2FMYA 4FISA 1LPQA 5D4RA 2FE3A 3KZYA 4P96A 2VJ4A 3CCVI 2R7TA 4U7BA 4MQVA 3IWZA 1XGMA 1RUOA 3HRTA 4I7HA 5L3CA 2VQGA 3L9FA 4A3IJ 1A35A 2V4JC 3BZCA 2BY3A 3E6BA 3K9TA 2IS4A 3H3ZA 4IEJA 1HKQA 5F1RA 3ZGKA 2QSHX 4E7ZA 1CF7B 1K78A 1IN5A 2DN0A 5DUKA 5FKLA 3TMOA 2K9QA 2EQRA 2W84A 2EZHA 2VKDA 3V7SA 3V7RA 3A01A 1VQNI 4XLPF 1MJ9A 4NB5A 2Y75A 1ZLJA 4DYQA 3HOVJ 1TW2A 2PFBA 2XF5A 3MWMA 3VOEA 1L0OC 1EKEA 3OV8A 2A3SA 3S16J 3DWLE 4X1EA 4ANJA 2W7NA 3K4LA 1J75A 1OYWA 2MFZA 2PMUA 2V1DA 3F8CA 2W25A 1MH4A 2O3FA 3OL4A 4U87A 4OIRF 3W2AA 1IW7F 5KNLA 3WTXC 4BJ6C 2R5YA 1ETQA 2JPBA 3GZ6A 3BG7A 3ZQIA 2O6GE 1JTXA 4HX8A 1W7PD 3E6CC 4IRIA 1KONA 2DTRA 3S8PA 2EA2A 4PGGA 5DM7F 3GFLA 1W7PA 2ZJPF 3F6VA 2YSRA 4A3GJ 2ZKZA 1IRGA 3O6BB 1SVMA 1SVOA 1BM9A 2P8TA 3HBLA 2NVQJ 3LAPA 1QQIA 4LK0F 1K61A 3BZKA 4M6YA 2FU4A 2HZDA 1MBJA 2BZTA 4PJMA 4OIQF 4F92B 5J4VA 3TOBA 3NWSA 3T1BA 2WY7Q 2R7VA 4HX7A 3HHHA 1YRNA 2A07F 1FOKA 2M1BA 4BH9A 2ADUA 1MNDA 3V8LA 4XONA 4M9ZA 3VODA 2FA5A 5D6EA 2MA3A 3DTIA 1JHFA 3A02A 4GRIA 5HS8A 2IAIA 3J7AO 2ZCWA 2M7BA 1YW9A 5L3GA 3GWZA 2L54A 2HVSA 3DEUA 1XMXA 2DJIA 4ITVA 3OYAA 2RN7A 4BQQA 1MSEC 3I59B 4IX7A 1FOWA 1Y0UA 4YG2F 3HSFA 3CF5F 4IHVA 4OIOF 2ELKA 5FKMA 5HNFA 2L7ZA 2HR3A 3TO7A 3FBNB 5E3OA 1CF7A 3EQLF 1KQ9A 2HVQA 3VYUB 3U21A 2FXAA 1Z3XA 3G6EI 1Y1VJ 3T5XA 1GXPA 1FBQA 1F4KA 2NVXJ 5E1WA 1FSHA 1J59A 1Y6IA 1GVJA 1YW7A 2MABA 4YFNF 3GTJJ 5CQGA 4YIRX 4ZZDA 3MN2A 2JUCA 2ECBA 5K7HA 4UUSB 3F8NA 2ID6A 3BOQA 3QYBA 3RSNA 4H0EA 3OYKA 2MSYA 2D45A 4KISA 3GBGA 4RLQA 3RQ4A 1OJLA 2NXNB 4QSHA 3E3VA 4M6XA 4BJ5C 1FY7A 2WAQN 2EINH 4D9JA 3N05A 3W6KB 1G3SA 4EQQA 4YELA 1YX3A 2DOAA 3K4JA 4HSTA 4E7JA 1R36A 1U0JA 1Z91A 2AXLA 1P7IA 1VZ0A 2LP0A 1JTYA 4G9YA 4HYEA 4KN4X 3LSRA 3I4MJ 2HOSA 2HYJA 2IJLA 3I54A 4Q4ZF 1XGOA 2DU9A 2JA2A 2X85A 3PFIA 4NBQA 2L7KA 2HZTA 4F52A 3R60A 1XPXA 1U78A 3GTQJ 4M3EA 3FHZA 2VJJA 2O9LA 1ETWA 2FJ1A 3GTPJ 1X2NA 4ZDLA 3F3XA 3GO5A 5C4XJ 4P9FA 3WHBA 2WC2A 1SFXA 3RCOA 3CCRI 4A3MJ 1H0MA 2MH2A 1K79A 4FE7A 4HNTA 1NG7A 4Y17A 4AIHA 1W36D 1I27A 3WGGA 1G8XA 2XRNA 1Y0NA 3A0HC 5FJ8J 2F5CA 5IPAA 3CZ6A 2ME0A 3OY9A 1ZGJA 1W0TA 1W5TA 2EA4A 1ETKA 5B3SH 5IYDJ 2GA2A 3RZDJ 4CA0A 4A3JJ 2Y2ZA 1WQ2A 4KUMA 4FASD 4GCVA 3LWFA 5IP6A 5LD2C 1MMNA 5EZHA 4M3DA 3HRSA 3K4KA 2QCOA 4O5VA 1J2XA 3NQOA 1YYVA 2VPLA 4JX5A 3DBRB 1WJDA 4MFEA 2KIFA 2OBPA 3K7AJ 1A31A 2VQLA 2BY2A 2W85A 3HKZN 1BOAA 2LF7A 5CVVA 2QF7A 2VONA 3C3WA 4OAYA 1VQOI 1R9TJ 2JA6J 2VQCA 4HPQA 2L9VA 4G8XA 4CCNA 4UUSA 3KIOA 1X58A 5CVIA 4C3HJ 3FXKA 2L7FP 3WG7H 4BBSJ 5FGMA 1REPC 4U7DA 2CUFA 4V2FA 3C2HA 3K70C 2HDDA 2HXOA 2HDWA 5H6QA 1ZQ3P 3M4OJ 4BJTA 1VQ6I 1X1CA 3KP3A 2F4MB 1TBXA 1YQAA 3H9QA 1R7JA 2ID3A 2R7QA 3F21A 3S32A 4ENMA 3IUOA 4ZDPA 2LMDA 5CKTA 4D1QA 2DTZA 3GX4X 2ZJRF 3LSMA 1HLVA 3ZP5A 4CGZA 1SFKA 1BIAA 1Y39A 2MC3A 1S7OA 3IRRA 3TQNA 3BCBA 1D0ZA 4CZCA 2KKOA 1MMSA 2EK5A 1W5CC 4HBLA 4BDZA 2KFDA 1U5TB 1X19A 3VPRA 2KRFA 3EYYA 1RIOH 3Q0UA 3O3KA 1Z0XA 5LFAA 2KT0A 4BXFA 3K4NA 1QHHD 5DCFA 3CMYA 2DDAA 2AHQA 1W0UA 4EM2A 1OQYA 2DLLA 5E8IA 4L0ZB 2JVGA 1YX5A 3OYIA 2HYGD 3CJQB 4F7ZA 4Z2YA 2DA5A 1SD5A 3BG5A 1K4TA 5LGUA 4LFUA 3HSEA 1NK2P 2NS7A 2CO5A 3N97A 1EJ9A 1OR7C 3B73A 3O8GA 1XG1A 1A6QA 1YITI 1S72I 3CDIA 1S8NA 4M3BA 1LFUP 4B3AA 3L2WA 4Y7NJ 1TWGJ 3FIWA 4LLGF 1KA8A 3KEQA 3S1NJ 3T8RA 4GYGA 1XDUA 2E60A 5GP9A 2XSJC 4G7HF 1JUPA 4QWQA 2CW8A 3BTCA 3QAHA 1ZG1A 1ZLKA 3E0JB 4OMYA 2AQEA 3HB9A 1V5GA 1SEUA 2QQBA 2XPVA 4NC6A 3U9GA 3DBLB 4BY1J 5ILSA 2CJJA 3GCMA 4BY7J 3RJPA 1XMAA 3F6OA 4XNFA 4KIFA 3FZVA 3MVPA 4RM3A 4YIIA 1Z6RA 2CRGA 2B0LA 2FRHA 5BPIA 4LB5A 4HNVA 5L3DA 1UB9A 1HC8A 3E97A 2YPRA 3QU3A 5J47A 3CCSI 2FBIA 3HRMA 4P1WA 4EGZA 5LHHA 1IO2A 3RYRA 4BXXJ 3PO2J 3LFKA 3IWFA 4GFBA 2V1NA 2JSPA 2V9VA 3C1DA 3ZQ7A 1MBEA 2XVCA 1R4NB 4NQWB 4A3FJ 1ACIA 2K9NA 2EIJH 4HW0A 2KLOA 1MDMB 3LA7A 4A93J 5EG0A 3T8TA 1OKRA 3SZPA 1U5TA 4LD5A 2K3PA 3G1MA 3ZQGA 2VASA 5JR3A 4IRGA 3IH4A 3CMEI 5J8FA 3M9AA 3ZXSA 4RA2A 5DCMB 4M73A 4GXOA 2D1VA 3WGHA 3DU5A 2HPMA 2A6TA 5IP9J 5IOYA 2EFQA 1U6GA 1USSA 4EJTA 3LA3A 2PI0A 1R71A 4G6DA 3JRCA 3BP8A 3FKJA 2E2IJ 2XPWA 2IA2A 4CYDA 3GFMA 1ZTRA 2PN6A 3GF2A 3HGGA 1HDPA 5E18F 1WH5A 4WXCA 3CDLA 1R1UA 4ESFA 5EEGA 3AG4H 4L0YB 2YR2A 3W3CA 2JUGA 5M5YJ 1ODDA 5CVUA 2CFOA 3DXJF 5J4YA 2ZFUA 3FWEA 4Y3OA 4OOIA 2WWYA 1VTNC 2H6CA 5FLXK 1R1VA 1T38A 4A3DJ 2KISA 1LDJA 4YFKF 3S14J 5IY5H 3ABKH 1IXSB 2VIXA 2PEXA 1SC7A 2DQLA 2LYCA 2E1CA 3MD2A 5J1UA 2VC0A 4R8HA 4BBRJ 4AU7A 5D5VB 1HKTA 3SFIA 1O4XA 1IDYA 2HFHA 2R7OA 1WGXA 4NHJA 1V54H 2ICWG 2EFPA 1RR8C 2VL8A 4UUTA 2A5YB 2KIMA 4G7OF 1YW8A 4ZTJA 3BJOA 1MH3A 1QPMA 1JT0A 4LB6B 2X9DA 1V4RA 1Z1DA 5L3FA 2HNHA 2X0LA 5BOXA 3WHCA 4NQWA 1LNWA 5ICEA 5KAFC 4L5JA 3ASNH 3NARA 1T0FC 2DT7B 3BLYA 1Q1VA 3BG6A 1BIBA 4O6JA 1UJ8A 3CCQI 3AG3H 3KEOA 1T8IA 2WAFA 3RPQA 4G6TB 4BUPA 1JKRC 3A2KA 3KETA 4MO7A 5HLHA 1PP7U 3R61A 1K6OA 3GXOA 1N25A 3G3ZA 3IH3A 3K1PA 5GPCA 1ZR2A 3FXQA 3K6GA 4AIDA 4C30A 1I6XA 4ASNA 2ZXHA 4AYBA 5DCMA 3DPUA 4RGSA 2W82A 2QENA 2E35A 4IVNA 1XD7A 2L9NA 2COBA 1UHWA 5K5OA 2LRDA 9ANTA 3JRHA 2JK3A 3WU0A 2DT5A 4RAFA 3G1LA 1NTCA 1BN5A 3EETA 2M0CA 3VEPA 1R58A 2KMUA 3DBHB 2I10A 2H27A 1J9IA 4KIGA 2WB1A 2OUMA 2VBWA 4OAZA 2IA0A 1W1WE 4PCQA 3M1EA 5EEHA 4I98B 3BROA 2KJBA 2ZO4A 2R5ZA 4EATA 3ZQHA 3MCZA 4XOPA 4XBFA 2EFWA 1APLC 3Q5FA 4A6DA 1BC8C 2UZKA 2P7CB 1U9NA 2CH0A 3LSJA 2MD0A 4PJNA 4Y4RA 2GXGA 2M8GX 2K7LA 2L0KA 1XB4A 1MMDA 3V7CA 2A6HF 1L3LA 2CGPA 1TQIA 2LH9A 4BU2A 1N77A 3M8JA 4D7NA 3A01B 1DGRM 1MKMA 3CCUI 1OYIA 1TL8A 5AONA 4JK1X 3ZCOA 4XRFA 3EUHA 1YFHA 1LE8A 1GLNA 3OOPA 2D1HA 1MSFC 2E36A 2NOGA 1WSUA 2NVTJ 1T39A 4RMNA 3BR3A 3C2GA 4J00A 5M3MJ 3SEQA 1F1ZA 3PUFA 1NK3P 2HXIA 1W4MA 2R5YB 4UVCA 1UHMA 3KPHA 2OZUA 2ZC2A 5ICGA 4N0BA 2DBBA 4IF4A 5K5QA 2BVLA 3I58A 1ZYRF 2OAZA 4IL6C 4A0XA 2M9HA 2RV8A 4LJZF 1BR1A 2R4GA 1I39A 4HDVA 4BYYA 3IKTA 1XS9A 5E79C 2EIMH 2Q8KA 3KZZA 4IRHA 5FO5A 3DTKA 1WJ5A 4EJUA 3CC2I 2Z9OA 3PSFA 1SFUA 1B59A 1OISA 3SXYA 4BHCA 2PJRB 3U1KA 4FQGA 5IYCJ 2LC2A 3ZOBA 1YRNB 1Y8RB 3I4NJ 3CLQA 3CTAA 3HPGA 4PJLA 3FXOA 1AWCA 3HGYA 2A69F 2K5CA 1T33A 5TRDA 1P4WA 2O61A 4XKWA 1NH3A 2E5ZA 3IC7A 4I0AA 1U9OA 2R7FA 2M2EA 2QYOA 2PX9A 3CF2A 3HEFA 5TGTA 1JGSA 5A2QZ 2PLYA 3QOPA 1X1DA 2EZLA 4MLOA 3J81Z 2ZJQF 1VQMI 1W36C 1YIJI 1QGPA 3AKZA 3NAUA 2A6EF 3MKWB 2XAGA 3VYTB 5GADJ 4A3LJ 2Y0SA 4G94A 2VE8A 3SHFA 5B1BH 4CH7A 2R0QC 5BPDA 1IDZA 1DPRA 3G73A 1E17A 1EH7A 1T08B 4BEHB 2IGMA 3J80K 3KLNA 1D0XA 4LG3A 4A69C 4Z6YA 1MGTA 2H1LA 4U0WA 2DW4A 1OCPA 2LREA 1WZ2A 3GYHX 1LDDA 3E5UA 3A1YA 4E4HA 2QM3A 1TLHB 5HS7A 2CFXA 1H8AC 3CC7I 4IHTA 3DP7A 2VT3A 3OYLA 3WE3A 4EJOA 3BR2A 4A0YA 3OMYA 5HVQC 1XCVA 5LRSA 1BA5A 3OIQA 1YJ9I 5DTDA 4E7HA 3NEUA 3SQNA 2HQNA 3K4CA 3J7AY 2XC7A 3MKZA 1JKOC 1FTTA 4NNJA 3IRQA 4XQFA 4LLNA 1VQLI 3R6SA 2DA2A 2LK2A 2WA0A 3JSOA 1QRYA 5DD8A 2RAEA 2ELJA 3WTVC 4UHTA 3G4SI 1P7JA 2Z33A 2N8GA 2F5VA 2MG4A 5FROA 4WXDA 1KU9A 1ON1A 4XLCA 2HDCA 1R1TA 2CUEA 2XAJA 3M3YJ 2DODA 5K1YA 4XOTA 2PJRA 4UUVA 2VJ5A 1V3FA 3FK6A 1SMYF 3HYIA 1N78A 3I56I 4XLEA 5EEAA 1ZGAA 3O2PE 2EV6A 2HKXA 4C2UA 2XAHA 2EIKH 1T2KA 5EDNA 1P9QC 3CJNA 2E1MB 4LIUA 2R7UA 3OSGA 1JGGA 2IP2A 4XRSA 2CQ7A 4LMYA 2L2OA 2GZWA 3F9KA 1TQPA 1BC7C 2F5EA 1JI8A 3R4KA 3RKYA 3S3MA 3QPSA 1Z21A 2O8KA 5CQEA 2XASA 1KQ8A 2EJRA 4IOCF 3EPZA 4HF0A 4M3FA 2L3DA 1XX5A 5B66C 3JRIA 2OTJI 3BTLA 4XORA 2V26A 4BEHA 4B48A 2BXZA 2Y30A 5L3EA 1ZREA 2E1NA 2NNYA 3AAFA 3RKWA 5E17F 3P9KA 3BJAA 4TV7A 3BC8A 4FCYA 5GTIC 2CWEA 2UWMA 3J7ZI 3CO7C 2AO9A 2R3SA 5IP7J 1HKSA 2QGUA 1C0WA 1XCBA 2OA4A 4ZDOA 1XGSA 5ERIA 2QKLB 2YS9A 4EM0B 4BQNA 2AXTC 4I76A 3CO6C 1B72B 1PYVA 2Z3YA 2OCEA 2MC4A 4XKVA 3ZQCA 1G59A 3S1QJ 3DU6A 2JA8J 1FWZA 4QPOA 5FLVA 3ABUA 2EZIA 4II2A 1HQCA 4CICA 4EEFG 4ZJZA 5E1XA 1OCCH 3ROUA 2GAUA 3HHGA 2TRTA 3QU6A 4N4OB 1JE8A 4MFDA 4Y15A 1ZHFA 1WI9A 1ZELA 4Q48A 2JVHA 1R4MB 4HA8A 4CXFA 2PMZN 2ESNA 3HC7A 2MGQA 5HLIA 4AD9A 2DMTA 2P4WA 5JI6A 1ZG5A 2XKOA 2GOMA 1UAAA 2AQFA 2IS2A 3LSGA 2QLZA 2HGCA 5A2QK 4I02A 5JVTA 1FEXA 3ZR8X 3J81K 1SD7A 2MH9A 1O3RA 4IJAA 1WPKA 4CYCB 5L3BA 1O7LA 1U5TC 2XKPA 3GW2A 4W1UA 2NRAC 2HVRA 5FRNA 2FNAA 1I1SA 2W1OA 5EGOB 2RQQA 3CMMA 5ILUA 1FIPA 2R93J 3JREA 2HU9A 2QSGX 5EJCA 2XGXA 1O3QA 1FX7A 1ULYA 4H4KC 1G3WA 3OYHA 2YU9J 3VSKA 4WWCA 4RS8A 4CHUA 4MGRA 5J40A 3IAM2 1XSDA 1FNNA 1H89C 4I2OA 2Z16A 4KITB 2XROA 2L9RA 4V2GA 3JRFA 2DQRA 2M8EA 1WJAA 2HOEA 2KHMA 3QODA 3TKYA 4C3JJ 3CCEI 4PGHA 2X1EA 1BI0A 3TO6A 4F93B 3DKXA 5LEJA 2EFNA 4BAYA 1WH7A 2HKOA 4S0HB 3TW7A 3V4GA 1J0RA 4NC7A 5LGNA 2STWA 1WJEA 2EPFA 2IVMA 2LTPA 4I99C 2OCCH 4S04A 4YRVA 2UV1A 2VBXA 1B6AA 3OYBA 2OD5A 4MEYF 4R79A 1IC8A 4P9UA 2R7ZJ 3BCAA 1HF0A 1XTAA 4LG0B 1FOYA 1B72A 3I5UA 1R00A 3ISPA 4N4NB 2F4IA 1A6IA 2KPMA 3W2VA 2XAQA 4O3MA 1YS6A 2RREA 4A2UA 5LEKA 3KYLA 3FDYA 2DYSH 4BGDA 1V5FA 3JCUC 2O7OA 5FLXZ 1WJCA 1D1AA 4D7MA 4B8XA 4Y13A 5FFZA 2IPQX 1QHGA 1H9TA 1ERDA 1TT0A 1ORKA 1DP7P 2FBKA 2MYSA 5FLMJ 3QP5A 2VI6A 3RIRA 1VQ8I 3FXUA 2IGOA 5HLGA 3E6DA 5EG0B 4C9YA 3G71I 4L9JA 2XDVA 1FYMA 1MIJA 3E6MA 1G6NA 4CYCA 1ZR4A 3ZMSA 2HOTA 3VB2A 1ZH5A 2TDXA 2LNBA 1YO5C 1CGPA 4EVIA 1QZYA 1S7AA 1IV8A 3PM1A 3L2QA 1AA7A 5E1ZB 2KQRA 2JT1A 1QU3A 4EJWA 3F23A 3UNGC 5EGOA 1F5TA 1E3PA 2JN6A 3B6CA 5F08A 2VQHA 2LSOA 2H09A 2RKHA 4G6QA 5KAIC 1ON2A 3BR5A 1D0YA 5DS9A 2L02A 3SDBA 4S05A 4MTDA 1WFXA 2VKHA 3FMQA 4F55A 3B02A 3S3NA 2NVUB 4ZZLA 3KLOA 1VQ4I 3HSRA 1ETXA 2QSFX 4HF2A 4UVAA 1EH6A 2E71A 4OIPF 4ZYEA 5J6XA 4EJVA 4II3A 2M3AA 5BQTA 3IAS2 4XLHA 3LSKA 4M9SA 4RB2C 1BR4A 3PFYA 3WG9A 1FJLA 3AL0B 2Q2EB 2M7AA 2V6CA 2K02A 4IPAA 3MKYB 3KYDB 3CESA 2LKSA 4LG0A 3ZRGA 1J5YA 2DA6A 2X51A 2F48A 1VI0A 3DV8A 5FKNA 3HOXJ 4NUBA 1R49A 4BHPA 5GAEJ 3K69A 2G0EA 3I3LA 4IHYA 1RR7A 2G9WA 3WTZA 2OZ6A 4D0PA 3JRAA 1RRJA 2X6YA 3EUHC 3S15J 2CW7A 2QQ8A 1S9HA 2DPDA 2RQPA 2DFHA 1PDNC 3L7WA 2P0WA 2M5WA 3M1CA 4KYWA 2DK5A 4DQ2A 3G1OA 3ABMH 1QVUA 2O5RA 2CV2A 2E1OA 2E7WA 3M07A 1OCRH 2HEOA 2UXNA 1F36A 1TWCJ 3V8JA 2V79A 4IHSA 3VFZA 3CMAI 1VQPI 3CLOA 4IOAF 2FMLA 1VF9A 2RNGA 1IG7A 5CPRB 3DF8A 5IT9Z 4XSZF 4E70A 2DMPA 3S2WA 4UNOA 2FOWA 5K7FA 3MEXA 2IRFG 2CV1A 3EUKL 1V5EA 4KFCA 1SFEA 1BI1A 1RUNA 2GA1A 4HRIA 2ISYA 1U3EM 2WAQA 3D5RC 3HRUA 1BR2A 1GT0C 2QVOA 4X6AJ 2GOXB 2ZNZA 4ENKA 2BV6A 4XKCA 1ZKGA 2DA1A 1P2FA 1D8KA 2XRLA 5E3LA 3FMSA 3ZMZA 3FF5A 3U1DA 1LVAA 4B47A 2Y0SN 3JW4A 5D8LB 1IN8A 3ZMDA 1DGWY 5D8KB 1EF4A 2R5ZB 4L9TA 4PSWA 2B63J 4C3IJ 3SJMA 4LITA 3OSFA 2DI3A 4E7LA 4AC0A 4EM1A 3GTGJ 3F72A 2QWWA 2CUZA 2HTJA 4F91B 3NRVA 1BJZA 4HNUA 5J1RA 1ZRFA 2Q2EA 3KFWX 4KA4A 1ZGWA 3GZNB 1IXRC 4L9VA 5DEQA 4PJJA 4DZJA 4DGWB 1RKWA 4GYIA 1TW3A 1LB2A 2V6EA 3LSIA 2VE9A 1R5ID 1FMVA 3ZMVA 3TDUC 4DYRA 1TC3C 2JA7J 2QBYB 2XGEA 4GGGA 1LEBA 4RGUA 2KL4A 1LE8B 1ZARA 4M74A 4KT6A 5GTHC 5TISC 1YIOA 1OCZH 3ONQA 1O3TA 5E20A 3RYPA 3K70D 4V19K 3J80Z 1WWXA 2HQ5A 1XC5A 1FYKA 3JRGA 4HZFA 2M4KA 3HKZA 1EV7A 2O03A 1IN7A 2ZXWH 2L4AA 1MJAA 3H9GA 2W00A 2VXZA 2COMA 1KU7A 4BACA 4YFXF 2FF4A 2EFOA 1P92A 3I64A 4I0BA 2QUFA 3PIPF 3DLAA 3OIPA 4CCLA 3L2UA 1UHSA 1Z7LA 3K0LA 3BWGA 2Y9YA 1D5YA 4CDGA 2R7XA 2BE5F 1JUSA 3OR1C 4PFPA 3HJEA 5JHUA 2W48A 3VSLA 2VXDA 3M8EA 1OLTA 3HTUA 2KZVA 2UXXA 2DXIA 2HPIA 1UCRA 1U2WA 2K40A 3BR1A 3TW6A 4KT5C 2KDZA 1WVRA 3R0AA 3VYSB 2DAOA 1MMGA 2VKVA 3I55I 2WV0A 1LFPA 2CU7A 3WTYC 3DPTA 1A5JA 1X3ZB 1FPQA 2BHYA 2MW8A 4A12A 1AKHB 4RGRA 2L4MA 1BOBA 2P6TA 2XB0X 1LUJB 3ZMTA 3FK7A 4HDUA 4IKFA 2LY9A 2OJED 3PO3J 5DV5A 3CUQB 2M87A 3CD6I 2P7VB 1SAXA 4BL0B 1DU0A 2CQXA 1FYLA 2HTSA 1X3WB 1BI3A 1ETOA 1RZ4A 2NS8A 4RBOA 2KIUA 1I3AA 2B9SA 2DCEA 4CCKA 2LVSA 5J3LA 1Y56A 3ERED 1FBSA 4UV8A 2IEKA 3H5NA 1R5HA 4WXHA 2PQ8A 1HBXG 4PZJA 5F0FA 5LHIA 1QNTA 3GUDA 3KP6A 5HODA 3V42A 3FXMA 5IYBJ 3P9IA 2A61A 2YUSA 4RAZA 4WF2A 4U0YA 3KP5A 1RC9A 2H6BA 1FBUA 1JJ8C 3OWTA 3A03A 1OMIA 3DEWA 2L7MP 2QBYA 3BDDA 5IT9K 4L5EA 3OYEA 3Q0WA 2HS5A 4AWXB 2BY1A 2O8XA 2IGKA 1X3UA 4BS9A 3F8FA 1I6HJ 2FQ3A 1IXCA 1KQ0A 1YOVB 1XDSA 4RB3C 1AU7A 2KJCA 5CVRA 3E5QA 4AIKA 5D6FA 2PG4A 3H3VK 2ZSHB 4OINF 2JZYA 4IHXA 1IN4A 2F5FA 3ZPLA 2V1XA 2DMUA 3AFHA 1WRJA 5HDGA 3N4MA 4HLYA 5H2FC 5DUIA 1WKMA 3S1MJ 1OYYA 5JHFA 1MZBA 4E7KA 3IV5A 4MEXF 1MBFA 1XGNA 4ESJA 4JQFA 3QPTA 1A04A 2FOKA 2ZBKA 4ZC3A 3D1NI 2VODA 1S29A 2STTA 3RKXA 1ZAOA 5GAGJ 3SFZA 4L5IA 3I71A 3ERMA 2QZ8A 1I5ZA 1RNLA 2CSOA 2QEXI 1PJRA 1PVEA 2DYRH 3OR2C 2Z1DA 5D5XB 2FBHA 3COAC 2QQAA 1A36A 1M1EB 3BTIA 2I5UA 4HX4A 2LY1A 1AKHA 1BJAA 2E1MC 2GQQA 2DA7A 1DPUA 3S3OA 5ED4A 1Z3YA 3I0TA 2NOJB 4WCGA 2ZB9A 3GTOJ 3S2HJ 2LKXA 2VBYA 4B3XA 1R22A 3CUQA 3SDGA 2GWRA 4Y52J 1D8JA 2HOAA 4DZPA 2ZXJA 3PUBA 5JVGF 1VQKI 2E19A 2W4SA 3HG9A 2DA4A 3CDHA 2BHZA 2LBFB 3HOTA 4DOZA 3Q3SA 5F6FA 3JR9A 5HS9A 2OQGA 4PUSA 4PFOA 2Q0OA 4KICA 1Z05A 4BE2A 2Y0MA 3LSHA 1STZA 1RI7A 1Z7UA 1S3JA 2HWVA 1TNSA 4E6KG 1WJFA 3BPXA 3WU1B 1QA6A 1XSVA 3LFUA 2P81A 4Q47A 1X4OA 1S5LC 3I4PA 4XICA 1LJ9A 1NG6A 2HYFA 2GIZA 3BG9A 4G7ZF 1P6RA 4JX4A 1Q1HA 2L5QA 3WTSC 4WK8F 1LFBA 4A3KJ 3LQQA 1FTZA 1ZN2A 2PMHA 4ETSA 3MFKA 4BNCA 1OPCA 3FMRA 2JQ7A 4BQAA 2VBZA 3BR0A 4B4CA 2Z2SB 1HDDC 1USTA 5IOZA 4ZYDA 2VC1A 3BJ6A 3MZHA 3FISA 2IS1A 4RDUA 3K4BA 2XAUA 1GXQA 2A68F 3PNVA 4HV6A 1D5VA 2GXAA 5FB2A 2AS5F 2F6CA 3BR6A 3OIOA 4NDLA 1FC3A 1FMWA 1HW5A 5FKOA 4I01A 4X0GA 3PJRA 5LGTA 1FLIA 1T0FA 2LF8A 1RKTA 2GXBA 4KDPA 3RI4A 2GM4A 2VPRA 1HOMA 3K1NA 1UELB 2RVCA 5CLSA 2ACJA 2GLOA 2ESHA 3ZN1A 3Q9VA 2TCTA 3GMEA 4UB8C 4C2MJ 3E5XA 3WE2A 5H6RA 1LEAA 4AUXA 1IAWA 5LHGA 3S93A 3OYNA 1VQ5I 1HA8A 3H9JA 2FQ4A 4YEJA 4D5CA 1R6RA 1E0EA 3AG2H 2L01A 3MAJA 1YG2A 1FSEA 3ZQLA 4Y33A 5AIQA 2M4GA 2V1UA 3MMYB 2ZMEB 3LA2A 2BW3B 2LBFA 3D0SA 3LMMA 3TL4X 2BBYA 3W2WA 2ELHA 3D5LA 1YS7A 2DT6A 2CQKA 2V9KA 3BTJA 2DK8A 2XAFA 3FXRA 4GO1A 2R92J 1G2HA 2BY0A 1I3QJ 2KP6A 3ELKA 2Z99A 1P4XA 4M3GA 1R5GA 2MBFA 3H3UA 2VN2A 5IT3A 3OS2A 3OYDA 4HOBA 1OCOH 5J1YA 4DNCA 3IL2A 3FX3A 4BKXA 3K10A 3KZIC 2CMPA 2JTVA 2H8WA 2YX4A 1PUFB 5KHDA 3KEYA 3GFJA 4A0ZA 2K9MA 2X4HA 4XIDA 2JA5J 3W6VA 2G7UA 3H35A 1X2MA 1TP4A 3H36A 4DBQA 5HDNA 3ECOA 2HQRA 1KU3A 1QZEA 3JAMK 1TZLA 3BG3A 2C6YA 5JLWA 3A4CA 3KCCA 3B6AA 2EV0A 1FIAA 1GVDA 2WADA 4IHWA 1DU6A 2K4JA 2XF6A 3DKYA 2DFIA 2IGNA 1J09A 5F1JA 3HOWJ 2L9SA 2G7HA 2LY2A 3QQAA 2LKPA 2Y69H 1TWFJ 4U0VA 1RPWA 2FSWA 2EILH 1GV2A 4W97A 5F0CA 1B1BA 4J19A 3RZOJ 5BS6A 3L2RA 4BE0A 5EZGA 4FT8A 2W24A 3ABTA 1TWHJ 1JKQC 5F04A 3DTEA 2W57A 4EGYA 2IA1A 3CP2A 3PSIA 2YX7A 3C2BA 3CCJI 2RGVA 2BYVE 3ZN0A 1NHAA 5J8CA 3ML6A
chains in the Genus database with same CATH topology
2K4BA 4MHGA 1MD0A 2ZNYA 4LGWA 5ICFA 4I09A 5KK1A 5E8GA 2DPUA 2M30A 4UXNA 1O3SA 2EWNA 2XUBA 2ZMEA 3WTUC 1QBJA 2RNJA 1TNTA 4YIFA 4AIJA 2DO7A 4M71A 2FNPA 2XHKA 3CUOA 2P5VA 4A5MA 1BBYA 4UV9A 4KMFA 3BY6A 3I59A 3BPVA 1KGSA 4ENJA 3DFGA 2D2WA 1SMTA 4CO8A 3P9CA 3WGIA 4XSXF 1IZ1A 4LLLA 2CW0F 1XSXA 2XV4S 1K7AA 4ENNA 5HDKA 3GLXA 1FP2A 4L18B 5JFRA 4A6EA 2IT0A 1AOYA 4P55A 3TDZC 5LLQA 3KP4A 4AVPA 2YU3A 5DDGA 4OU0A 1ZRDA 2MLGA 3SZTA 3HOSA 4R1HA 1O7FA 2Y48A 2O0YA 2P5KA 2WTEA 2ZJ2A 3MZYA 4ZYGA 3M8FA 4PDKA 4MTEA 3K2ZA 3PQJA 4L9NA 4HAMA 1B9NA 1IF1A 1LDKB 2MLKA 1I1GA 5CVJA 2P6SA 4QLCU 1KU2A 4A5NA 1XMKA 1HW2A 5LRRA 3IHUA 2MD5A 3KP2A 3LAJA 4HV5A 2NNNA 1G3YA 3R0JA 2RDPA 1D3YA 2OQRA 3F8BA 4FX0A 4B09A 3EDPA 3TOAA 2VT2A 1BI2A 4RAYA 3RDIA 3TGNA 3KP7A 4KMUX 3WTTC 4BXUA 3LQRA 3JTHA 1P4AA 1FZPB 1GHCA 2CG4A 2F5DA 4FX4A 1T6SA 3Q9SA 2Z5UA 3I53A 5K5RA 4MQ9F 3F22A 2PJPA 2IW5A 1PUEE 1QZZA 4KNYA 1QO0D 4P5OA 4N9IA 3WODF 1LQ1A 1ZG3A 1G4DA 3M7GA 1Z9CA 4HF1A 3QP6A 3KE2A 5AIPA 3ECHA 3C18A 4KN7X 3V8KA 3DQVC 5CYVA 3MQ0A 3HTSB 5FD6A 3HUGA 4ZH4F 3L2CA 2ISZA 2H94A 1HXDA 1B9MA 4ZYHA 1H9GA 4Q5SF 4M72A 1FT9A 4HQEA 1U8RA 3RTRA 2BEOA 1HSJA 1EH8A 3CUQC 3GZ5A 4FHTA 4UVBA 3H92A 4BHBA 1B4AA 3FM5A 1HW1A 3JTGA 4CZZA 1R23A 2J5OA 1YTYA 1IRFA 4K2EA 1DUXC 2GIVA 2ZFWA 2EV5A 3U2RA 2K27A 3REOA 2NYXA 4IXAA 1T98A 2FEZA 5CJ9A 1SD6A 3F8MA 1KYZA 3FM3A 4M9XA 1ONVA 5HOOA 1TQMA 1JHHA 4HQMA 4N9HA 5BMZA 2J5PA 2PBIA 2JRTA 3LSTA 2QQ9A 3HIFA 2P5LC 5KVRA 2VOPA 4LK1F 1E2XA 2RC4A 1SD4A 1IN6A 1IUYA 3RPUA 5FFXA 3W6JB 1MDMA 6PAXA 3EYIA 1O57A 2BGCA 4MNUA 3L09A 3T0YA 3ZMUA 4EV0A 4XLNF 5LBQA 1PP8F 2M45A 2JSCA 1ZRCA 1YLFA 4KIBA 3GEZA 5H20A 3QPHA 2ETHA 3DPLC 2XIGA 4RGXA 2CYYA 1OR7A 3L00A 5TJJA 3IKVA 5ICCA 3GVAA 4RB1A 3P7NA 5DD4A 1K78B 1XN7A 4ON0A 5D4SA 3GFIA 2EB7A 1S6LA 2E7XA 1MJBA 1UFMA 3DKWA 4OMZA 4WX9A 1Z6TA 3QRFF 5FD5A 5ILVA 4U88A 2VOOA 3WTWC 3JAMZ 1TTYA 2JPCA 3JSPA 3BZ6A 2R7DA 1J7KA 1FP1D 3K1MA 1W5SA 4RB0A 2K86A 2LDUA 1KYWA 1G3TA 1W7PB 1JXSA 2F2EA 2OU2A 3PQKA 4JBAA 5F64A 5D5UB 2NAZA 4ESBA 3C7JA 4HLXA 1HSTA 5DYMA 3ULQB 3TO9A 2NS0A 4EMSA 1F9NA 5D5WB 2FMYA 5D4RA 2FE3A 3KZYA 4P96A 4U7BA 4MQVA 3IWZA 1XGMA 1RUOA 3HRTA 4I7HA 5L3CA 3L9FA 3E6BA 3K9TA 3H3ZA 1HKQA 5F1RA 1CF7B 1K78A 1IN5A 5DUKA 2W84A 3V7SA 3V7RA 4XLPF 1MJ9A 4NB5A 2Y75A 1ZLJA 1TW2A 2PFBA 3MWMA 3VOEA 1L0OC 3OV8A 2A3SA 1J75A 1OYWA 2PMUA 2V1DA 3F8CA 2W25A 2O3FA 4OIRF 1IW7F 3WTXC 2JPBA 3GZ6A 2O6GE 4HX8A 1W7PD 3E6CC 4IRIA 2DTRA 2EA2A 4PGGA 3GFLA 1W7PA 3F6VA 2YSRA 2ZKZA 1IRGA 3O6BB 1BM9A 2P8TA 3LAPA 1QQIA 4LK0F 4M6YA 2FU4A 4OIQF 3TOBA 3T1BA 4HX7A 3HHHA 2A07F 1FOKA 2M1BA 4BH9A 2ADUA 3V8LA 4M9ZA 3VODA 2FA5A 5D6EA 2MA3A 1JHFA 5HS8A 3J7AO 2ZCWA 1YW9A 5L3GA 3GWZA 2L54A 3DEUA 2RN7A 3I59B 1Y0UA 4YG2F 3HSFA 4OIOF 2HR3A 3TO7A 1CF7A 3EQLF 1KQ9A 2FXAA 3T5XA 1GXPA 1FBQA 1F4KA 5E1WA 1FSHA 1J59A 1GVJA 1YW7A 4YFNF 4ZZDA 3F8NA 3BOQA 4H0EA 2D45A 3E3VA 4M6XA 1FY7A 3W6KB 1G3SA 4EQQA 1R36A 2AXLA 1Z91A 4G9YA 4HYEA 4KN4X 2IJLA 3I54A 4Q4ZF 1XGOA 2DU9A 3PFIA 2HZTA 3R60A 1U78A 3FHZA 3F3XA 3GO5A 4P9FA 2WC2A 1SFXA 1H0MA 2MH2A 1K79A 4Y17A 4AIHA 1I27A 3WGGA 2XRNA 2F5CA 1ZGJA 1W5TA 2EA4A 2GA2A 1WQ2A 4KUMA 4GCVA 3LWFA 3HRSA 4O5VA 1J2XA 3NQOA 1YYVA 2KIFA 2OBPA 2W85A 1BOAA 2LF7A 5CVVA 2VONA 3C3WA 4G8XA 5CVIA 5FGMA 1REPC 4U7DA 5H6QA 3KP3A 1TBXA 1YQAA 1R7JA 4ENMA 3F21A 3GX4X 3ZP5A 4CGZA 1BIAA 2MC3A 1S7OA 3IRRA 3TQNA 2KKOA 2EK5A 4HBLA 1U5TB 2KRFA 3EYYA 1RIOH 3O3KA 5DCFA 4EM2A 2DLLA 5E8IA 4L0ZB 2HYGD 4F7ZA 4Z2YA 1SD5A 5LGUA 4LFUA 3HSEA 2CO5A 3N97A 3B73A 1S8NA 4LLGF 1KA8A 3KEQA 3T8RA 4GYGA 1XDUA 4G7HF 4QWQA 3QAHA 1ZG1A 1ZLKA 4OMYA 2QQBA 3U9GA 5ILSA 3RJPA 1XMAA 3F6OA 4KIFA 3FZVA 4YIIA 1Z6RA 2B0LA 2FRHA 5BPIA 4LB5A 5L3DA 1UB9A 3E97A 2YPRA 3QU3A 2FBIA 3HRMA 4EGZA 5LHHA 3RYRA 3LFKA 3IWFA 2V9VA 3C1DA 3ZQ7A 2XVCA 4HW0A 1MDMB 3LA7A 3T8TA 1OKRA 3SZPA 1U5TA 4LD5A 5JR3A 4IRGA 5J8FA 3M9AA 5DCMB 4M73A 4GXOA 2D1VA 3WGHA 2EFQA 1U6GA 1USSA 4EJTA 3LA3A 2PI0A 4G6DA 3BP8A 2IA2A 4CYDA 3GFMA 2PN6A 3GF2A 5E18F 4WXCA 1R1UA 4ESFA 5EEGA 4L0YB 2YR2A 1ODDA 5CVUA 3DXJF 3FWEA 4OOIA 2WWYA 1VTNC 2H6CA 5FLXK 1R1VA 1T38A 1LDJA 4YFKF 1IXSB 2PEXA 2DQLA 2E1CA 2VC0A 4R8HA 5D5VB 1HKTA 2HFHA 4NHJA 2EFPA 2A5YB 2KIMA 4G7OF 1YW8A 3BJOA 1QPMA 4LB6B 1V4RA 1Z1DA 5L3FA 2X0LA 5BOXA 4NQWA 1LNWA 5ICEA 4L5JA 1BIBA 4O6JA 3KEOA 3RPQA 3KETA 5HLHA 1PP7U 3R61A 1K6OA 3GXOA 3G3ZA 3K1PA 3FXQA 1I6XA 4ASNA 5DCMA 4RGSA 2QENA 4IVNA 1XD7A 1UHWA 5K5OA 3WU0A 2DT5A 1BN5A 3EETA 3VEPA 1R58A 1J9IA 2H27A 4KIGA 2VBWA 2IA0A 4PCQA 3M1EA 5EEHA 4I98B 3BROA 2KJBA 2ZO4A 3MCZA 4XBFA 2EFWA 3Q5FA 4A6DA 1BC8C 2UZKA 2P7CB 2GXGA 2K7LA 1XB4A 3V7CA 2A6HF 1L3LA 2CGPA 1TQIA 1MKMA 1OYIA 5AONA 4JK1X 4XRFA 3EUHA 1YFHA 3OOPA 2D1HA 1WSUA 1T39A 1F1ZA 1W4MA 4UVCA 1UHMA 2OZUA 5ICGA 4N0BA 2DBBA 4IF4A 5K5QA 3I58A 1ZYRF 2OAZA 4A0XA 2RV8A 4LJZF 4HDVA 4BYYA 3IKTA 2Q8KA 3KZZA 4IRHA 5FO5A 4EJUA 2Z9OA 1SFUA 1B59A 3SXYA 4BHCA 3CTAA 1AWCA 2A69F 5TRDA 1P4WA 2O61A 3IC7A 4I0AA 2R7FA 2QYOA 1JGSA 5A2QZ 2PLYA 3QOPA 3J81Z 1QGPA 2A6EF 2XAGA 4G94A 2VE8A 3SHFA 5BPDA 1DPRA 3G73A 1E17A 1EH7A 3J80K 3KLNA 1MGTA 4U0WA 2DW4A 3GYHX 1LDDA 3E5UA 2QM3A 1TLHB 5HS7A 2CFXA 4IHTA 3DP7A 2VT3A 3WE3A 4EJOA 4A0YA 5HVQC 1XCVA 5LRSA 3NEUA 3SQNA 2HQNA 3IRQA 4LLNA 3R6SA 3JSOA 5DD8A 3WTVC 4UHTA 2Z33A 4WXDA 1KU9A 1ON1A 2HDCA 1R1TA 2XAJA 5K1YA 4UUVA 1V3FA 1SMYF 3HYIA 1ZGAA 3O2PE 2EV6A 2HKXA 2XAHA 1T2KA 3CJNA 2IP2A 4LMYA 2GZWA 1TQPA 1BC7C 2F5EA 3R4KA 3RKYA 2XASA 1KQ8A 2EJRA 4HF0A 2L3DA 5L3EA 1ZREA 2E1NA 2NNYA 3AAFA 3RKWA 5E17F 3P9KA 3BJAA 4TV7A 2UWMA 2CWEA 3CO7C 2R3SA 1HKSA 1C0WA 1XCBA 2OA4A 1XGSA 5ERIA 4EM0B 3CO6C 2Z3YA 1FWZA 3ABUA 1HQCA 4CICA 5E1XA 3ROUA 2GAUA 3HHGA 3QU6A 1JE8A 4Y15A 1ZHFA 1WI9A 4Q48A 4CXFA 4HA8A 2ESNA 5HLIA 4AD9A 2P4WA 5JI6A 1ZG5A 2XKOA 2QLZA 5A2QK 2HGCA 4I02A 5JVTA 3J81K 1SD7A 2MH9A 1O3RA 4IJAA 5L3BA 1O7LA 1U5TC 2XKPA 3GW2A 2NRAC 2FNAA 1I1SA 5ILUA 2XGXA 1O3QA 1FX7A 1ULYA 1G3WA 4WWCA 4RS8A 4CHUA 4MGRA 1XSDA 1FNNA 4I2OA 2XROA 2DQRA 2M8EA 2HOEA 3TKYA 4PGHA 1BI0A 3TO6A 5LEJA 2EFNA 4BAYA 2HKOA 3V4GA 1J0RA 5LGNA 2STWA 2IVMA 4S04A 2VBXA 1B6AA 2OD5A 4MEYF 4R79A 4P9UA 4LG0B 3I5UA 1R00A 3ISPA 2XAQA 4O3MA 1YS6A 4A2UA 5LEKA 5FLXZ 4B8XA 4Y13A 5FFZA 2IPQX 1H9TA 1DP7P 2FBKA 3QP5A 3RIRA 3FXUA 5HLGA 3E6DA 4L9JA 1FYMA 3E6MA 1G6NA 1ZH5A 3ZMSA 3VB2A 2TDXA 2LNBA 1YO5C 1CGPA 4EVIA 1QZYA 1S7AA 5E1ZB 2JT1A 4EJWA 3F23A 1F5TA 2LSOA 2H09A 2RKHA 4G6QA 1ON2A 2L02A 4S05A 4MTDA 3FMQA 3B02A 4ZZLA 3KLOA 3HSRA 4HF2A 4UVAA 1EH6A 4OIPF 4ZYEA 5J6XA 4EJVA 5BQTA 4M9SA 4RB2C 3WG9A 2V6CA 4IPAA 2K02A 4LG0A 1J5YA 3DV8A 4BHPA 3K69A 2G9WA 3WTZA 2OZ6A 4D0PA 2DPDA 2RQPA 1PDNC 3L7WA 2M5WA 4KYWA 2DK5A 4DQ2A 2E7WA 2HEOA 2UXNA 3V8JA 2V79A 4IHSA 3VFZA 3CLOA 2FMLA 3DF8A 5IT9Z 4XSZF 4E70A 3S2WA 4UNOA 3MEXA 2IRFG 4KFCA 1SFEA 1BI1A 1RUNA 2GA1A 2ISYA 1U3EM 3HRUA 2QVOA 2ZNZA 4ENKA 2BV6A 1P2FA 1D8KA 3ZMZA 3FMSA 3FF5A 3U1DA 1LVAA 3JW4A 5D8LB 1IN8A 3ZMDA 5D8KB 4L9TA 2DI3A 4EM1A 3F72A 2QWWA 2HTJA 3NRVA 1ZRFA 2Q2EA 3KFWX 4KA4A 1IXRC 4L9VA 5DEQA 4GYIA 1TW3A 1LB2A 2VE9A 3ZMVA 3TDUC 2QBYB 4GGGA 1LEBA 4RGUA 1ZARA 4M74A 1YIOA 1O3TA 5E20A 3RYPA 3J80Z 1WWXA 1FYKA 4HZFA 1EV7A 2O03A 1IN7A 2L4AA 1MJAA 2VXZA 2COMA 1KU7A 4YFXF 2FF4A 2EFOA 1P92A 3I64A 4I0BA 2QUFA 3K0LA 3BWGA 4CDGA 2BE5F 5JHUA 3M8EA 3HTUA 2UXXA 1UCRA 1U2WA 4KT5C 3R0AA 2DAOA 2WV0A 3WTYC 3DPTA 1FPQA 4A12A 4RGRA 2L4MA 2P6TA 3ZMTA 4HDUA 5DV5A 3CUQB 2M87A 2P7VB 1SAXA 1FYLA 2HTSA 1BI3A 1RZ4A 2KIUA 3ERED 1FBSA 4UV8A 4WXHA 1R5HA 2PQ8A 1HBXG 4PZJA 5LHIA 1QNTA 3GUDA 3KP6A 3P9IA 2A61A 4RAZA 4WF2A 4U0YA 3KP5A 2H6BA 1FBUA 1OMIA 2QBYA 3BDDA 5IT9K 2HS5A 4AWXB 2O8XA 1X3UA 3F8FA 2FQ3A 1IXCA 1KQ0A 4RB3C 1XDSA 2KJCA 5CVRA 3E5QA 4AIKA 5D6FA 2PG4A 4OINF 2JZYA 1IN4A 2F5FA 3ZPLA 2V1XA 5HDGA 1WRJA 3N4MA 4HLYA 5DUIA 1WKMA 1OYYA 4MEXF 1MZBA 1XGNA 4ESJA 4JQFA 3QPTA 1A04A 2FOKA 2ZBKA 2VODA 1S29A 2STTA 3RKXA 1ZAOA 3SFZA 4L5IA 3I71A 2QZ8A 1I5ZA 1RNLA 2CSOA 5D5XB 2FBHA 3COAC 2QQAA 4HX4A 1BJAA 2GQQA 1DPUA 5ED4A 3I0TA 4WCGA 2VBYA 1R22A 3CUQA 2GWRA 1D8JA 2ZXJA 3CDHA 3HOTA 5F6FA 5HS9A 2OQGA 2Q0OA 4KICA 1Z05A 2Y0MA 1RI7A 1STZA 1Z7UA 1S3JA 2HWVA 1TNSA 3BPXA 3WU1B 1XSVA 4Q47A 3I4PA 1LJ9A 2HYFA 4G7ZF 1P6RA 1Q1HA 3WTSC 4WK8F 3LQQA 1ZN2A 2PMHA 4ETSA 3MFKA 4BNCA 1OPCA 3FMRA 4BQAA 2VBZA 1USTA 4ZYDA 2VC1A 3BJ6A 3MZHA 1GXQA 2A68F 4HV6A 1D5VA 5FB2A 2AS5F 1FC3A 1HW5A 4I01A 5LGTA 1FLIA 1T0FA 2LF8A 2GXBA 4KDPA 3RI4A 3K1NA 2ACJA 2RVCA 5CLSA 2ESHA 3ZN1A 3Q9VA 3E5XA 3WE2A 5H6RA 1LEAA 1IAWA 5LHGA 2L01A 3MAJA 1YG2A 1FSEA 5AIQA 2V1UA 2ZMEB 3LA2A 3D0SA 2BBYA 2ELHA 3D5LA 1YS7A 1DDNA 2CQKA 3FXRA 2DK8A 2XAFA 4GO1A 3ELKA 2Z99A 1P4XA 1R5GA 5IT3A 2MBFA 3H3UA 2VN2A 4HOBA 4DNCA 3IL2A 3FX3A 2JTVA 2YX4A 3GFJA 4A0ZA 2X4HA 2G7UA 5HDNA 3ECOA 2HQRA 1KU3A 3JAMK 2C6YA 3KCCA 2EV0A 2K4JA 2DFIA 2G7HA 2LKPA 4U0VA 2FSWA 1B1BA 5BS6A 4FT8A 2W24A 3ABTA 2W57A 4EGYA 2IA1A 2YX7A 2RGVA 2BYVE 3ZN0A 1NHAA 5J8CA 3ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4B A;  4MHG A;  1MD0 A;  2ZNY A;  4LGW A;  5ICF A;  4I09 A;  5KK1 A;  5E8G A;  2DPU A;  2M30 A;  4UXN A;  1O3S A;  2EWN A;  2XUB A;  2ZME A;  3WTU C;  1QBJ A;  2RNJ A;  1TNT A;  4YIF A;  4AIJ A;  2DO7 A;  4M71 A;  2FNP A;  2XHK A;  3CUO A;  2P5V A;  4A5M A;  1BBY A;  4UV9 A;  4KMF A;  3BY6 A;  3I59 A;  3BPV A;  1KGS A;  4ENJ A;  3DFG A;  2D2W A;  1SMT A;  4CO8 A;  3P9C A;  3WGI A;  4XSX F;  1IZ1 A;  4LLL A;  2CW0 F;  1XSX A;  2XV4 S;  1K7A A;  4ENN A;  5HDK A;  3GLX A;  1FP2 A;  4L18 B;  5JFR A;  4A6E A;  2IT0 A;  1AOY A;  4P55 A;  3TDZ C;  5LLQ A;  3KP4 A;  4AVP A;  2YU3 A;  5DDG A;  4OU0 A;  1ZRD A;  2MLG A;  3SZT A;  3HOS A;  4R1H A;  1O7F A;  2Y48 A;  2O0Y A;  2P5K A;  2WTE A;  2ZJ2 A;  3MZY A;  4ZYG A;  3M8F A;  4PDK A;  4MTE A;  3K2Z A;  3PQJ A;  4L9N A;  4HAM A;  1B9N A;  1IF1 A;  1LDK B;  2MLK A;  1I1G A;  5CVJ A;  2P6S A;  4QLC U;  1KU2 A;  4A5N A;  1XMK A;  1HW2 A;  5LRR A;  3IHU A;  2MD5 A;  3KP2 A;  3LAJ A;  4HV5 A;  2NNN A;  1G3Y A;  3R0J A;  2RDP A;  1D3Y A;  2OQR A;  3F8B A;  4FX0 A;  4B09 A;  3EDP A;  3TOA A;  2VT2 A;  1BI2 A;  4RAY A;  3RDI A;  3TGN A;  3KP7 A;  4KMU X;  3WTT C;  4BXU A;  3LQR A;  3JTH A;  1P4A A;  1FZP B;  1GHC A;  2CG4 A;  2F5D A;  4FX4 A;  1T6S A;  3Q9S A;  2Z5U A;  3I53 A;  5K5R A;  4MQ9 F;  3F22 A;  2PJP A;  2IW5 A;  1PUE E;  1QZZ A;  4KNY A;  1QO0 D;  4P5O A;  4N9I A;  3WOD F;  1LQ1 A;  1ZG3 A;  1G4D A;  3M7G A;  1Z9C A;  4HF1 A;  3QP6 A;  3KE2 A;  5AIP A;  3ECH A;  3C18 A;  4KN7 X;  3V8K A;  3DQV C;  5CYV A;  3MQ0 A;  3HTS B;  5FD6 A;  3HUG A;  4ZH4 F;  3L2C A;  2ISZ A;  2H94 A;  1HXD A;  1B9M A;  4ZYH A;  1H9G A;  4Q5S F;  4M72 A;  1FT9 A;  4HQE A;  1U8R A;  3RTR A;  2BEO A;  1HSJ A;  1EH8 A;  3CUQ C;  3GZ5 A;  4FHT A;  4UVB A;  3H92 A;  4BHB A;  1B4A A;  3FM5 A;  1HW1 A;  3JTG A;  4CZZ A;  1R23 A;  2J5O A;  1YTY A;  1IRF A;  4K2E A;  1DUX C;  2GIV A;  2ZFW A;  2EV5 A;  3U2R A;  2K27 A;  3REO A;  2NYX A;  4IXA A;  1T98 A;  2FEZ A;  5CJ9 A;  1SD6 A;  3F8M A;  1KYZ A;  3FM3 A;  4M9X A;  1ONV A;  5HOO A;  1TQM A;  1JHH A;  4HQM A;  4N9H A;  5BMZ A;  2J5P A;  2PBI A;  2JRT A;  3LST A;  2QQ9 A;  3HIF A;  2P5L C;  5KVR A;  2VOP A;  4LK1 F;  1E2X A;  2RC4 A;  1SD4 A;  1IN6 A;  1IUY A;  3RPU A;  5FFX A;  3W6J B;  1MDM A;  6PAX A;  3EYI A;  1O57 A;  2BGC A;  4MNU A;  3L09 A;  3T0Y A;  3ZMU A;  4EV0 A;  4XLN F;  5LBQ A;  1PP8 F;  2M45 A;  2JSC A;  1ZRC A;  1YLF A;  4KIB A;  3GEZ A;  5H20 A;  3QPH A;  2ETH A;  3DPL C;  2XIG A;  4RGX A;  2CYY A;  1OR7 A;  3L00 A;  5TJJ A;  3IKV A;  5ICC A;  3GVA A;  4RB1 A;  3P7N A;  5DD4 A;  1K78 B;  1XN7 A;  4ON0 A;  5D4S A;  3GFI A;  2EB7 A;  1S6L A;  2E7X A;  1MJB A;  1UFM A;  3DKW A;  4OMZ A;  4WX9 A;  1Z6T A;  3QRF F;  5FD5 A;  5ILV A;  4U88 A;  2VOO A;  3WTW C;  3JAM Z;  1TTY A;  2JPC A;  3JSP A;  3BZ6 A;  2R7D A;  1J7K A;  1FP1 D;  3K1M A;  1W5S A;  4RB0 A;  2K86 A;  2LDU A;  1KYW A;  1G3T A;  1W7P B;  1JXS A;  2F2E A;  2OU2 A;  3PQK A;  4JBA A;  5F64 A;  5D5U B;  2NAZ A;  4ESB A;  3C7J A;  4HLX A;  1HST A;  5DYM A;  3ULQ B;  3TO9 A;  2NS0 A;  4EMS A;  1F9N A;  5D5W B;  2FMY A;  5D4R A;  2FE3 A;  3KZY A;  4P96 A;  4U7B A;  4MQV A;  3IWZ A;  1XGM A;  1RUO A;  3HRT A;  4I7H A;  5L3C A;  3L9F A;  3E6B A;  3K9T A;  3H3Z A;  1HKQ A;  5F1R A;  1CF7 B;  1K78 A;  1IN5 A;  5DUK A;  2W84 A;  3V7S A;  3V7R A;  4XLP F;  1MJ9 A;  4NB5 A;  2Y75 A;  1ZLJ A;  1TW2 A;  2PFB A;  3MWM A;  3VOE A;  1L0O C;  3OV8 A;  2A3S A;  1J75 A;  1OYW A;  2PMU A;  2V1D A;  3F8C A;  2W25 A;  2O3F A;  4OIR F;  1IW7 F;  3WTX C;  2JPB A;  3GZ6 A;  2O6G E;  4HX8 A;  1W7P D;  3E6C C;  4IRI A;  2DTR A;  2EA2 A;  4PGG A;  3GFL A;  1W7P A;  3F6V A;  2YSR A;  2ZKZ A;  1IRG A;  3O6B B;  1BM9 A;  2P8T A;  3LAP A;  1QQI A;  4LK0 F;  4M6Y A;  2FU4 A;  4OIQ F;  3TOB A;  3T1B A;  4HX7 A;  3HHH A;  2A07 F;  1FOK A;  2M1B A;  4BH9 A;  2ADU A;  3V8L A;  4M9Z A;  3VOD A;  2FA5 A;  5D6E A;  2MA3 A;  1JHF A;  5HS8 A;  3J7A O;  2ZCW A;  1YW9 A;  5L3G A;  3GWZ A;  2L54 A;  3DEU A;  2RN7 A;  3I59 B;  1Y0U A;  4YG2 F;  3HSF A;  4OIO F;  2HR3 A;  3TO7 A;  1CF7 A;  3EQL F;  1KQ9 A;  2FXA A;  3T5X A;  1GXP A;  1FBQ A;  1F4K A;  5E1W A;  1FSH A;  1J59 A;  1GVJ A;  1YW7 A;  4YFN F;  4ZZD A;  3F8N A;  3BOQ A;  4H0E A;  2D45 A;  3E3V A;  4M6X A;  1FY7 A;  3W6K B;  1G3S A;  4EQQ A;  1R36 A;  2AXL A;  1Z91 A;  4G9Y A;  4HYE A;  4KN4 X;  2IJL A;  3I54 A;  4Q4Z F;  1XGO A;  2DU9 A;  3PFI A;  2HZT A;  3R60 A;  1U78 A;  3FHZ A;  3F3X A;  3GO5 A;  4P9F A;  2WC2 A;  1SFX A;  1H0M A;  2MH2 A;  1K79 A;  4Y17 A;  4AIH A;  1I27 A;  3WGG A;  2XRN A;  2F5C A;  1ZGJ A;  1W5T A;  2EA4 A;  2GA2 A;  1WQ2 A;  4KUM A;  4GCV A;  3LWF A;  3HRS A;  4O5V A;  1J2X A;  3NQO A;  1YYV A;  2KIF A;  2OBP A;  2W85 A;  1BOA A;  2LF7 A;  5CVV A;  2VON A;  3C3W A;  4G8X A;  5CVI A;  5FGM A;  1REP C;  4U7D A;  5H6Q A;  3KP3 A;  1TBX A;  1YQA A;  1R7J A;  4ENM A;  3F21 A;  3GX4 X;  3ZP5 A;  4CGZ A;  1BIA A;  2MC3 A;  1S7O A;  3IRR A;  3TQN A;  2KKO A;  2EK5 A;  4HBL A;  1U5T B;  2KRF A;  3EYY A;  1RIO H;  3O3K A;  5DCF A;  4EM2 A;  2DLL A;  5E8I A;  4L0Z B;  2HYG D;  4F7Z A;  4Z2Y A;  1SD5 A;  5LGU A;  4LFU A;  3HSE A;  2CO5 A;  3N97 A;  3B73 A;  1S8N A;  4LLG F;  1KA8 A;  3KEQ A;  3T8R A;  4GYG A;  1XDU A;  4G7H F;  4QWQ A;  3QAH A;  1ZG1 A;  1ZLK A;  4OMY A;  2QQB A;  3U9G A;  5ILS A;  3RJP A;  1XMA A;  3F6O A;  4KIF A;  3FZV A;  4YII A;  1Z6R A;  2B0L A;  2FRH A;  5BPI A;  4LB5 A;  5L3D A;  1UB9 A;  3E97 A;  2YPR A;  3QU3 A;  2FBI A;  3HRM A;  4EGZ A;  5LHH A;  3RYR A;  3LFK A;  3IWF A;  2V9V A;  3C1D A;  3ZQ7 A;  2XVC A;  4HW0 A;  1MDM B;  3LA7 A;  3T8T A;  1OKR A;  3SZP A;  1U5T A;  4LD5 A;  5JR3 A;  4IRG A;  5J8F A;  3M9A A;  5DCM B;  4M73 A;  4GXO A;  2D1V A;  3WGH A;  2EFQ A;  1U6G A;  1USS A;  4EJT A;  3LA3 A;  2PI0 A;  4G6D A;  3BP8 A;  2IA2 A;  4CYD A;  3GFM A;  2PN6 A;  3GF2 A;  5E18 F;  4WXC A;  1R1U A;  4ESF A;  5EEG A;  4L0Y B;  2YR2 A;  1ODD A;  5CVU A;  3DXJ F;  3FWE A;  4OOI A;  2WWY A;  1VTN C;  2H6C A;  5FLX K;  1R1V A;  1T38 A;  1LDJ A;  4YFK F;  1IXS B;  2PEX A;  2DQL A;  2E1C A;  2VC0 A;  4R8H A;  5D5V B;  1HKT A;  2HFH A;  4NHJ A;  2EFP A;  2A5Y B;  2KIM A;  4G7O F;  1YW8 A;  3BJO A;  1QPM A;  4LB6 B;  1V4R A;  1Z1D A;  5L3F A;  2X0L A;  5BOX A;  4NQW A;  1LNW A;  5ICE A;  4L5J A;  1BIB A;  4O6J A;  3KEO A;  3RPQ A;  3KET A;  5HLH A;  1PP7 U;  3R61 A;  1K6O A;  3GXO A;  3G3Z A;  3K1P A;  3FXQ A;  1I6X A;  4ASN A;  5DCM A;  4RGS A;  2QEN A;  4IVN A;  1XD7 A;  1UHW A;  5K5O A;  3WU0 A;  2DT5 A;  1BN5 A;  3EET A;  3VEP A;  1R58 A;  1J9I A;  2H27 A;  4KIG A;  2VBW A;  2IA0 A;  4PCQ A;  3M1E A;  5EEH A;  4I98 B;  3BRO A;  2KJB A;  2ZO4 A;  3MCZ A;  4XBF A;  2EFW A;  3Q5F A;  4A6D A;  1BC8 C;  2UZK A;  2P7C B;  2GXG A;  2K7L A;  1XB4 A;  3V7C A;  2A6H F;  1L3L A;  2CGP A;  1TQI A;  1MKM A;  1OYI A;  5AON A;  4JK1 X;  4XRF A;  3EUH A;  1YFH A;  3OOP A;  2D1H A;  1WSU A;  1T39 A;  1F1Z A;  1W4M A;  4UVC A;  1UHM A;  2OZU A;  5ICG A;  4N0B A;  2DBB A;  4IF4 A;  5K5Q A;  3I58 A;  1ZYR F;  2OAZ A;  4A0X A;  2RV8 A;  4LJZ F;  4HDV A;  4BYY A;  3IKT A;  2Q8K A;  3KZZ A;  4IRH A;  5FO5 A;  4EJU A;  2Z9O A;  1SFU A;  1B59 A;  3SXY A;  4BHC A;  3CTA A;  1AWC A;  2A69 F;  5TRD A;  1P4W A;  2O61 A;  3IC7 A;  4I0A A;  2R7F A;  2QYO A;  1JGS A;  5A2Q Z;  2PLY A;  3QOP A;  3J81 Z;  1QGP A;  2A6E F;  2XAG A;  4G94 A;  2VE8 A;  3SHF A;  5BPD A;  1DPR A;  3G73 A;  1E17 A;  1EH7 A;  3J80 K;  3KLN A;  1MGT A;  4U0W A;  2DW4 A;  3GYH X;  1LDD A;  3E5U A;  2QM3 A;  1TLH B;  5HS7 A;  2CFX A;  4IHT A;  3DP7 A;  2VT3 A;  3WE3 A;  4EJO A;  4A0Y A;  5HVQ C;  1XCV A;  5LRS A;  3NEU A;  3SQN A;  2HQN A;  3IRQ A;  4LLN A;  3R6S A;  3JSO A;  5DD8 A;  3WTV C;  4UHT A;  2Z33 A;  4WXD A;  1KU9 A;  1ON1 A;  2HDC A;  1R1T A;  2XAJ A;  5K1Y A;  4UUV A;  1V3F A;  1SMY F;  3HYI A;  1ZGA A;  3O2P E;  2EV6 A;  2HKX A;  2XAH A;  1T2K A;  3CJN A;  2IP2 A;  4LMY A;  2GZW A;  1TQP A;  1BC7 C;  2F5E A;  3R4K A;  3RKY A;  2XAS A;  1KQ8 A;  2EJR A;  4HF0 A;  2L3D A;  5L3E A;  1ZRE A;  2E1N A;  2NNY A;  3AAF A;  3RKW A;  5E17 F;  3P9K A;  3BJA A;  4TV7 A;  2UWM A;  2CWE A;  3CO7 C;  2R3S A;  1HKS A;  1C0W A;  1XCB A;  2OA4 A;  1XGS A;  5ERI A;  4EM0 B;  3CO6 C;  2Z3Y A;  1FWZ A;  3ABU A;  1HQC A;  4CIC A;  5E1X A;  3ROU A;  2GAU A;  3HHG A;  3QU6 A;  1JE8 A;  4Y15 A;  1ZHF A;  1WI9 A;  4Q48 A;  4CXF A;  4HA8 A;  2ESN A;  5HLI A;  4AD9 A;  2P4W A;  5JI6 A;  1ZG5 A;  2XKO A;  2QLZ A;  5A2Q K;  2HGC A;  4I02 A;  5JVT A;  3J81 K;  1SD7 A;  2MH9 A;  1O3R A;  4IJA A;  5L3B A;  1O7L A;  1U5T C;  2XKP A;  3GW2 A;  2NRA C;  2FNA A;  1I1S A;  5ILU A;  2XGX A;  1O3Q A;  1FX7 A;  1ULY A;  1G3W A;  4WWC A;  4RS8 A;  4CHU A;  4MGR A;  1XSD A;  1FNN A;  4I2O A;  2XRO A;  2DQR A;  2M8E A;  2HOE A;  3TKY A;  4PGH A;  1BI0 A;  3TO6 A;  5LEJ A;  2EFN A;  4BAY A;  2HKO A;  3V4G A;  1J0R A;  5LGN A;  2STW A;  2IVM A;  4S04 A;  2VBX A;  1B6A A;  2OD5 A;  4MEY F;  4R79 A;  4P9U A;  4LG0 B;  3I5U A;  1R00 A;  3ISP A;  2XAQ A;  4O3M A;  1YS6 A;  4A2U A;  5LEK A;  5FLX Z;  4B8X A;  4Y13 A;  5FFZ A;  2IPQ X;  1H9T A;  1DP7 P;  2FBK A;  3QP5 A;  3RIR A;  3FXU A;  5HLG A;  3E6D A;  4L9J A;  1FYM A;  3E6M A;  1G6N A;  1ZH5 A;  3ZMS A;  3VB2 A;  2TDX A;  2LNB A;  1YO5 C;  1CGP A;  4EVI A;  1QZY A;  1S7A A;  5E1Z B;  2JT1 A;  4EJW A;  3F23 A;  1F5T A;  2LSO A;  2H09 A;  2RKH A;  4G6Q A;  1ON2 A;  2L02 A;  4S05 A;  4MTD A;  3FMQ A;  3B02 A;  4ZZL A;  3KLO A;  3HSR A;  4HF2 A;  4UVA A;  1EH6 A;  4OIP F;  4ZYE A;  5J6X A;  4EJV A;  5BQT A;  4M9S A;  4RB2 C;  3WG9 A;  2V6C A;  4IPA A;  2K02 A;  4LG0 A;  1J5Y A;  3DV8 A;  4BHP A;  3K69 A;  2G9W A;  3WTZ A;  2OZ6 A;  4D0P A;  2DPD A;  2RQP A;  1PDN C;  3L7W A;  2M5W A;  4KYW A;  2DK5 A;  4DQ2 A;  2E7W A;  2HEO A;  2UXN A;  3V8J A;  2V79 A;  4IHS A;  3VFZ A;  3CLO A;  2FML A;  3DF8 A;  5IT9 Z;  4XSZ F;  4E70 A;  3S2W A;  4UNO A;  3MEX A;  2IRF G;  4KFC A;  1SFE A;  1BI1 A;  1RUN A;  2GA1 A;  2ISY A;  1U3E M;  3HRU A;  2QVO A;  2ZNZ A;  4ENK A;  2BV6 A;  1P2F A;  1D8K A;  3ZMZ A;  3FMS A;  3FF5 A;  3U1D A;  1LVA A;  3JW4 A;  5D8L B;  1IN8 A;  3ZMD A;  5D8K B;  4L9T A;  2DI3 A;  4EM1 A;  3F72 A;  2QWW A;  2HTJ A;  3NRV A;  1ZRF A;  2Q2E A;  3KFW X;  4KA4 A;  1IXR C;  4L9V A;  5DEQ A;  4GYI A;  1TW3 A;  1LB2 A;  2VE9 A;  3ZMV A;  3TDU C;  2QBY B;  4GGG A;  1LEB A;  4RGU A;  1ZAR A;  4M74 A;  1YIO A;  1O3T A;  5E20 A;  3RYP A;  3J80 Z;  1WWX A;  1FYK A;  4HZF A;  1EV7 A;  2O03 A;  1IN7 A;  2L4A A;  1MJA A;  2VXZ A;  2COM A;  1KU7 A;  4YFX F;  2FF4 A;  2EFO A;  1P92 A;  3I64 A;  4I0B A;  2QUF A;  3K0L A;  3BWG A;  4CDG A;  2BE5 F;  5JHU A;  3M8E A;  3HTU A;  2UXX A;  1UCR A;  1U2W A;  4KT5 C;  3R0A A;  2DAO A;  2WV0 A;  3WTY C;  3DPT A;  1FPQ A;  4A12 A;  4RGR A;  2L4M A;  2P6T A;  3ZMT A;  4HDU A;  5DV5 A;  3CUQ B;  2M87 A;  2P7V B;  1SAX A;  1FYL A;  2HTS A;  1BI3 A;  1RZ4 A;  2KIU A;  3ERE D;  1FBS A;  4UV8 A;  4WXH A;  1R5H A;  2PQ8 A;  1HBX G;  4PZJ A;  5LHI A;  1QNT A;  3GUD A;  3KP6 A;  3P9I A;  2A61 A;  4RAZ A;  4WF2 A;  4U0Y A;  3KP5 A;  2H6B A;  1FBU A;  1OMI A;  2QBY A;  3BDD A;  5IT9 K;  2HS5 A;  4AWX B;  2O8X A;  1X3U A;  3F8F A;  2FQ3 A;  1IXC A;  1KQ0 A;  4RB3 C;  1XDS A;  2KJC A;  5CVR A;  3E5Q A;  4AIK A;  5D6F A;  2PG4 A;  4OIN F;  2JZY A;  1IN4 A;  2F5F A;  3ZPL A;  2V1X A;  5HDG A;  1WRJ A;  3N4M A;  4HLY A;  5DUI A;  1WKM A;  1OYY A;  4MEX F;  1MZB A;  1XGN A;  4ESJ A;  4JQF A;  3QPT A;  1A04 A;  2FOK A;  2ZBK A;  2VOD A;  1S29 A;  2STT A;  3RKX A;  1ZAO A;  3SFZ A;  4L5I A;  3I71 A;  2QZ8 A;  1I5Z A;  1RNL A;  2CSO A;  5D5X B;  2FBH A;  3COA C;  2QQA A;  4HX4 A;  1BJA A;  2GQQ A;  1DPU A;  5ED4 A;  3I0T A;  4WCG A;  2VBY A;  1R22 A;  3CUQ A;  2GWR A;  1D8J A;  2ZXJ A;  3CDH A;  3HOT A;  5F6F A;  5HS9 A;  2OQG A;  2Q0O A;  4KIC A;  1Z05 A;  2Y0M A;  1RI7 A;  1STZ A;  1Z7U A;  1S3J A;  2HWV A;  1TNS A;  3BPX A;  3WU1 B;  1XSV A;  4Q47 A;  3I4P A;  1LJ9 A;  2HYF A;  4G7Z F;  1P6R A;  1Q1H A;  3WTS C;  4WK8 F;  3LQQ A;  1ZN2 A;  2PMH A;  4ETS A;  3MFK A;  4BNC A;  1OPC A;  3FMR A;  4BQA A;  2VBZ A;  1UST A;  4ZYD A;  2VC1 A;  3BJ6 A;  3MZH A;  1GXQ A;  2A68 F;  4HV6 A;  1D5V A;  5FB2 A;  2AS5 F;  1FC3 A;  1HW5 A;  4I01 A;  5LGT A;  1FLI A;  1T0F A;  2LF8 A;  2GXB A;  4KDP A;  3RI4 A;  3K1N A;  2ACJ A;  2RVC A;  5CLS A;  2ESH A;  3ZN1 A;  3Q9V A;  3E5X A;  3WE2 A;  5H6R A;  1LEA A;  1IAW A;  5LHG A;  2L01 A;  3MAJ A;  1YG2 A;  1FSE A;  5AIQ A;  2V1U A;  2ZME B;  3LA2 A;  3D0S A;  2BBY A;  2ELH A;  3D5L A;  1YS7 A;  1DDN A;  2CQK A;  3FXR A;  2DK8 A;  2XAF A;  4GO1 A;  3ELK A;  2Z99 A;  1P4X A;  1R5G A;  5IT3 A;  2MBF A;  3H3U A;  2VN2 A;  4HOB A;  4DNC A;  3IL2 A;  3FX3 A;  2JTV A;  2YX4 A;  3GFJ A;  4A0Z A;  2X4H A;  2G7U A;  5HDN A;  3ECO A;  2HQR A;  1KU3 A;  3JAM K;  2C6Y A;  3KCC A;  2EV0 A;  2K4J A;  2DFI A;  2G7H A;  2LKP A;  4U0V A;  2FSW A;  1B1B A;  5BS6 A;  4FT8 A;  2W24 A;  3ABT A;  2W57 A;  4EGY A;  2IA1 A;  2YX7 A;  2RGV A;  2BYV E;  3ZN0 A;  1NHA A;  5J8C A;  3ML6 A; 
#chains in the Genus database with same CATH topology
 3FKI J;  2K4B A;  1QVT A;  1H88 C;  4MHG A;  3VYR B;  1MD0 A;  2ZNY A;  4LGW A;  2DA3 A;  4GDF A;  1QPI A;  2OPT A;  5ICF A;  4I09 A;  5KK1 A;  2DFE A;  1X4P A;  5FKK A;  5E8G A;  2EZK A;  2DPU A;  2M30 A;  4UXN A;  1O3S A;  3SEZ A;  2K9L A;  3G2B A;  3OOU A;  2EWN A;  2XUB A;  2ZME A;  3WTU C;  2BW3 A;  4XRM A;  1QBJ A;  3O8H A;  4CCJ A;  3MKL A;  2VKE A;  5HNH A;  2RNJ A;  1TNT A;  4YIF A;  1X1P A;  4AIJ A;  4CUG A;  2DO7 A;  4M71 A;  3TBI A;  2FNP A;  1TT5 B;  2XHK A;  3CUO A;  4B44 A;  5B5E C;  2P5V A;  4A5M A;  1BBY A;  4PJ0 C;  4UV9 A;  2GBY A;  4KMF A;  3BY6 A;  3I59 A;  3KYC B;  3BPV A;  3HDD A;  1KGS A;  1BW5 A;  4ENJ A;  2X48 A;  3DFG A;  2D2W A;  4A3B J;  1SMT A;  4QIW N;  3PNY A;  4CO8 A;  3P9C A;  1LKX A;  1UZC A;  3WGI A;  2OF7 A;  4XSX F;  1PUF A;  1IZ1 A;  4RLF A;  3AL0 C;  4LLL A;  2CW0 F;  4UB6 C;  1SVL A;  1XSX A;  2XV4 S;  5M5X J;  3GLL A;  1K7A A;  4ENN A;  1MNE A;  1SFO J;  1IJW C;  1JUM A;  2K85 A;  5HDK A;  4I6Z A;  1YI2 I;  3GLX A;  1FP2 A;  1RET A;  2JRM A;  2H8R A;  4L18 B;  4JOM A;  5JFR A;  4A6E A;  2XPU A;  3PNT A;  4XL9 A;  2X1D A;  2IT0 A;  1AOY A;  3QOE A;  4P55 A;  3TDZ C;  5LLQ A;  3KP4 A;  2BOL A;  3CCL I;  4IQ4 A;  4AVP A;  2UUZ A;  3E1S A;  2YU3 A;  3UKG A;  5DDG A;  1Z77 A;  4OU0 A;  2QKM B;  1ZRD A;  2MLG A;  3SZT A;  3GTL J;  2M34 A;  2V9P A;  1HCR A;  3ZQF A;  4AYB N;  3HOS A;  4R1H A;  4FTH A;  2BXY A;  1O7F A;  2Y48 A;  3JRD A;  2O0Y A;  2H1K A;  3L2V A;  5GAH J;  3PIO F;  2P5K A;  2WTE A;  2ZJ2 A;  3MZY A;  4ZYG A;  2LD5 A;  1GDT A;  4DIQ A;  3M8F A;  4PDK A;  3HUG B;  1K6Y A;  3LSP A;  4MTE A;  4CCO A;  2WB1 N;  3K2Z A;  4B43 A;  2ME6 A;  3CCM I;  3PQJ A;  4L9N A;  4HAM A;  1E3H A;  2WY8 Q;  3OYJ A;  1B9N A;  2WV1 A;  1IF1 A;  1LDK B;  4M6V A;  2MLK A;  1I1G A;  5CVJ A;  2P6S A;  2E5N A;  4QLC U;  4XN3 A;  1KU2 A;  4A5N A;  1X1B A;  1XMK A;  4ZYA A;  3TED A;  2IS6 A;  1K4S A;  1HW2 A;  1EA3 A;  5LRR A;  3IHU A;  2K9S A;  2IXS A;  2MD5 A;  1BW6 A;  2KRH A;  3KP2 A;  1SAU A;  2DJN A;  3LAJ A;  2LG4 A;  4HV5 A;  2NNN A;  2NVY J;  3ASO H;  1G3Y A;  3R0J A;  3UR3 C;  2RDP A;  2WBM A;  1IV6 A;  1D3Y A;  2OQR A;  3F8B A;  2DMQ A;  4FX0 A;  5M3F J;  4B09 A;  3EDP A;  3TOA A;  3HOU J;  2VT2 A;  2R7W A;  2Y9Z A;  1BI2 A;  4RAY A;  3RDI A;  3TGN A;  3KP7 A;  4KMU X;  3WTT C;  1ETY A;  2F4O B;  4BXU A;  3FHN A;  1YJN I;  1WJB A;  3LQR A;  3JTH A;  1P4A A;  3Q0V A;  1FZP B;  1GHC A;  2CG4 A;  1V55 H;  2F5D A;  1T6S A;  4FX4 A;  1JKP C;  3Q9S A;  1YJW I;  2Z5U A;  2X6X A;  3TP0 A;  3CJT B;  2LFB A;  3I53 A;  5F27 A;  2A5W A;  5K5R A;  2DOF A;  3ZQQ A;  1POG A;  4DW6 A;  4MQ9 F;  4XLF A;  3F22 A;  2PJP A;  3NWT A;  4AVZ A;  2IW5 A;  1UG0 A;  3EUA A;  4E7I A;  1PUE E;  3S1R J;  1QZZ A;  4KNY A;  1QO0 D;  1E3O C;  2V7F A;  1D1C A;  3FXL A;  4P5O A;  1DDN A;  4RAG A;  1WHU A;  3H5R A;  4N9I A;  3BT9 A;  5FRM A;  4BE1 A;  1MMA A;  2KRC A;  3WOD F;  3QYF A;  2LR8 A;  1LQ1 A;  2KDO A;  1ZG3 A;  1G4D A;  4LIV A;  3M7G A;  4HEA 2;  1Z9C A;  4HF1 A;  3QP6 A;  3KE2 A;  5AIP A;  4DBR A;  3ECH A;  4UY8 I;  1DP3 A;  3JRB A;  1WCM J;  3C18 A;  2CS3 A;  2EH3 A;  2CQQ A;  3DLL F;  3CC4 I;  3HXL A;  2R7S A;  1JT6 A;  4KN7 X;  3AG1 H;  3V8K A;  3DQV C;  2HQA A;  5CYV A;  3MQ0 A;  1YHQ I;  4XK4 A;  3HTS B;  5FD6 A;  2VUM J;  2LLK A;  3HUG A;  4ZH4 F;  3OYF A;  3L2C A;  2ISZ A;  2H94 A;  2Y31 A;  3KX2 A;  1HXD A;  1MW7 A;  2VJI A;  2E34 A;  1B9M A;  1OFC X;  4XM3 A;  4ZYH A;  4E7S A;  1H9G A;  3IH2 A;  4JP0 A;  2ZXI A;  4Q5S F;  2FX0 A;  2Q1Z B;  4M72 A;  1U8B A;  4QTR A;  1FT9 A;  2PMZ A;  4HQE A;  4XN0 A;  3OYG A;  2WAE A;  1U8R A;  3RTR A;  2BEO A;  4ZTF A;  5EYR A;  4MIM A;  2E2J J;  3CCY A;  2FUG 2;  5C3E J;  2DDB A;  1HSJ A;  1EH8 A;  2K3F A;  3DEE A;  4A3E J;  3CUQ C;  3GZ5 A;  4FHT A;  4UVB A;  2JJ7 A;  2DMN A;  4PK4 A;  3H92 A;  1MNM C;  2X1C A;  4BHB A;  5KCM A;  2BVM A;  3IP4 B;  1B4A A;  2VB6 A;  3FM5 A;  1HW1 A;  3JTG A;  3RQI A;  3CQZ J;  1K83 J;  4CZZ A;  1VND A;  4D5F A;  1R23 A;  3E7L A;  2J5O A;  1Z67 A;  1YTY A;  1IRF A;  4IQJ A;  3TP3 A;  4K2E A;  3PL8 A;  2KZG A;  1DUX C;  2GIV A;  3A0B C;  2DOE A;  2ZFW A;  1KZH A;  2EV5 A;  3U2R A;  2K27 A;  3OS0 A;  4KJZ A;  3REO A;  4J01 A;  2NYX A;  4IXA A;  3GTM J;  1S7E A;  1T98 A;  2FEZ A;  3QPL A;  5CJ9 A;  1SD6 A;  5E3N A;  1B8I B;  3F8M A;  1KYZ A;  4CSW A;  3ABL H;  1Y8Q B;  3FM3 A;  4M9X A;  3HPH A;  1ONV A;  2XSD C;  4C2T A;  5C4J J;  1LVK A;  3CP8 A;  1UG2 A;  4B1R A;  1JJ6 C;  5HOO A;  1TQM A;  1JHH A;  5B1A H;  4HQM A;  1X1A A;  4N9H A;  5BMZ A;  3HOZ J;  2J5P A;  2PBI A;  1DQU A;  3HL2 A;  2JRT A;  1MBG A;  3LST A;  2QQ9 A;  3HIF A;  2P5L C;  5M5W J;  5KVR A;  1IRZ A;  2VOP A;  2LOO A;  4LK1 F;  4BQO A;  3RPU D;  1E2X A;  2RC4 A;  1SD4 A;  5EF6 A;  1IN6 A;  4JX6 A;  1MBK A;  1IUY A;  3RPU A;  1WI3 A;  3MZ8 A;  3BQZ A;  1Y1W J;  3LOC A;  4HSR A;  4F3Q A;  5FFX A;  3W6J B;  2DFF A;  5E3M A;  3K4M A;  1MDM A;  3HZJ A;  6PAX A;  3EYI A;  1O57 A;  3VDX A;  2BGC A;  2A05 A;  4MNU A;  2IBD A;  1SAN A;  3L09 A;  3T0Y A;  2XGD A;  3SYT A;  5DM6 F;  2X6O A;  3ZMU A;  3J7Y J;  4EV0 A;  4XLN F;  5LBQ A;  1PP8 F;  2M45 A;  2JSC A;  3L1P A;  1ZRC A;  1YLF A;  3HM5 A;  4KIB A;  3GEZ A;  3VWB A;  4HG2 A;  4LOC A;  4DJA A;  5H20 A;  1FOX A;  1MBH A;  2OC6 A;  3DCF A;  3H1C A;  3H5A A;  3QPH A;  2E2H J;  3CJR B;  2ETH A;  4FET A;  1ETV A;  3DPL C;  2XIG A;  1ENH A;  2XB5 A;  4G12 A;  2FD5 A;  3BQY A;  2CUJ A;  1RES A;  4RGX A;  3RKQ A;  2CYY A;  1VQ7 I;  4RM2 A;  2OTL I;  1VFC A;  3OL3 A;  2ECC A;  1GV5 A;  1OR7 A;  4BDY A;  1N75 A;  4ABZ A;  2I8D A;  3FXJ A;  4JYK A;  3L00 A;  5TJJ A;  3H0D A;  3P5J A;  4FE4 A;  3IKV A;  2EBI A;  5ICC A;  1IUF A;  3GVA A;  4RB1 A;  3GTK J;  1ITY A;  3K2A A;  4DYC A;  4OWR B;  1B8I A;  3P7N A;  5DD4 A;  3S17 J;  2OV7 A;  2HI3 A;  3LL7 A;  1K78 B;  1XN7 A;  4ON0 A;  2QA4 I;  2ZSI B;  3D5S C;  4XLA A;  3F0C A;  5D4S A;  3SZG A;  3GFI A;  3I9V 2;  1IRX A;  2EB7 A;  1UMQ A;  1S6L A;  2E7X A;  1MJB A;  1UFM A;  3OS1 A;  1GUU A;  3DKW A;  3OYM A;  4IO9 F;  4OMZ A;  5BNG A;  2XF7 A;  4WX9 A;  4PSX A;  4XRS G;  1Z6T A;  3QRF F;  5FD5 A;  5ILV A;  1I50 J;  4U88 A;  2JWT A;  1YE9 A;  2VOO A;  3WTW C;  3JAM Z;  1TTY A;  1OCT C;  2JPC A;  3JSP A;  4XMY A;  3BZ6 A;  5GPA A;  2R7D A;  1J7K A;  1FP1 D;  3K1M A;  1T56 A;  1W5S A;  2M0M A;  4RB0 A;  2K86 A;  2CQN A;  1KYW A;  2LDU A;  3QWL A;  1G3T A;  4IZZ A;  1BL0 A;  2JMW A;  5K7Z A;  1CQT A;  4AM3 A;  1W7P B;  1JXS A;  2F2E A;  4XKB A;  2OU2 A;  3QYE A;  3PQK A;  4JBA A;  3OYC A;  4NC8 A;  5F64 A;  5JLX A;  2CV0 A;  1TWA J;  4A3C J;  2VLA A;  5D5U B;  2D5V A;  2B7E A;  2NAZ A;  2KIQ A;  5F0H A;  5C44 J;  1IGN A;  4QPQ A;  4ESB A;  3WU2 C;  3FBI B;  3C7J A;  4HLX A;  1HST A;  5DYM A;  1AHD P;  1T95 A;  4XR6 A;  1ZK8 A;  1F43 A;  3HOY J;  3S2D J;  3H0G J;  3ULQ B;  4CCM A;  2X6W A;  3LNQ A;  3TO9 A;  2XGC A;  2NS0 A;  3ESW B;  3X2Q H;  4EMS A;  1D1B A;  1F9N A;  2ZME C;  1VQ9 I;  5HLT A;  2R7R A;  5D5W B;  2FMY A;  4FIS A;  1LPQ A;  5D4R A;  2FE3 A;  3KZY A;  4P96 A;  2VJ4 A;  3CCV I;  2R7T A;  4U7B A;  4MQV A;  3IWZ A;  1XGM A;  1RUO A;  3HRT A;  4I7H A;  5L3C A;  2VQG A;  3L9F A;  4A3I J;  1A35 A;  2V4J C;  3BZC A;  2BY3 A;  3E6B A;  3K9T A;  2IS4 A;  3H3Z A;  4IEJ A;  1HKQ A;  5F1R A;  3ZGK A;  2QSH X;  4E7Z A;  1CF7 B;  1K78 A;  1IN5 A;  2DN0 A;  5DUK A;  5FKL A;  3TMO A;  2K9Q A;  2EQR A;  2W84 A;  2EZH A;  2VKD A;  3V7S A;  3V7R A;  3A01 A;  1VQN I;  4XLP F;  1MJ9 A;  4NB5 A;  2Y75 A;  1ZLJ A;  4DYQ A;  3HOV J;  1TW2 A;  2PFB A;  2XF5 A;  3MWM A;  3VOE A;  1L0O C;  1EKE A;  3OV8 A;  2A3S A;  3S16 J;  3DWL E;  4X1E A;  4ANJ A;  2W7N A;  3K4L A;  1J75 A;  1OYW A;  2MFZ A;  2PMU A;  2V1D A;  3F8C A;  2W25 A;  1MH4 A;  2O3F A;  3OL4 A;  4U87 A;  4OIR F;  3W2A A;  1IW7 F;  5KNL A;  3WTX C;  4BJ6 C;  2R5Y A;  1ETQ A;  2JPB A;  3GZ6 A;  3BG7 A;  3ZQI A;  2O6G E;  1JTX A;  4HX8 A;  1W7P D;  3E6C C;  4IRI A;  1KON A;  2DTR A;  3S8P A;  2EA2 A;  4PGG A;  5DM7 F;  3GFL A;  1W7P A;  2ZJP F;  3F6V A;  2YSR A;  4A3G J;  2ZKZ A;  1IRG A;  3O6B B;  1SVM A;  1SVO A;  1BM9 A;  2P8T A;  3HBL A;  2NVQ J;  3LAP A;  1QQI A;  4LK0 F;  1K61 A;  3BZK A;  4M6Y A;  2FU4 A;  2HZD A;  1MBJ A;  2BZT A;  4PJM A;  4OIQ F;  4F92 B;  5J4V A;  3TOB A;  3NWS A;  3T1B A;  2WY7 Q;  2R7V A;  4HX7 A;  3HHH A;  1YRN A;  2A07 F;  1FOK A;  2M1B A;  4BH9 A;  2ADU A;  1MND A;  3V8L A;  4XON A;  4M9Z A;  3VOD A;  2FA5 A;  5D6E A;  2MA3 A;  3DTI A;  1JHF A;  3A02 A;  4GRI A;  5HS8 A;  2IAI A;  3J7A O;  2ZCW A;  2M7B A;  1YW9 A;  5L3G A;  3GWZ A;  2L54 A;  2HVS A;  3DEU A;  1XMX A;  2DJI A;  4ITV A;  3OYA A;  2RN7 A;  4BQQ A;  1MSE C;  3I59 B;  4IX7 A;  1FOW A;  1Y0U A;  4YG2 F;  3HSF A;  3CF5 F;  4IHV A;  4OIO F;  2ELK A;  5FKM A;  5HNF A;  2L7Z A;  2HR3 A;  3TO7 A;  3FBN B;  5E3O A;  1CF7 A;  3EQL F;  1KQ9 A;  2HVQ A;  3VYU B;  3U21 A;  2FXA A;  1Z3X A;  3G6E I;  1Y1V J;  3T5X A;  1GXP A;  1FBQ A;  1F4K A;  2NVX J;  5E1W A;  1FSH A;  1J59 A;  1Y6I A;  1GVJ A;  1YW7 A;  2MAB A;  4YFN F;  3GTJ J;  5CQG A;  4YIR X;  4ZZD A;  3MN2 A;  2JUC A;  2ECB A;  5K7H A;  4UUS B;  3F8N A;  2ID6 A;  3BOQ A;  3QYB A;  3RSN A;  4H0E A;  3OYK A;  2MSY A;  2D45 A;  4KIS A;  3GBG A;  4RLQ A;  3RQ4 A;  1OJL A;  2NXN B;  4QSH A;  3E3V A;  4M6X A;  4BJ5 C;  1FY7 A;  2WAQ N;  2EIN H;  4D9J A;  3N05 A;  3W6K B;  1G3S A;  4EQQ A;  4YEL A;  1YX3 A;  2DOA A;  3K4J A;  4HST A;  4E7J A;  1R36 A;  1U0J A;  1Z91 A;  2AXL A;  1P7I A;  1VZ0 A;  2LP0 A;  1JTY A;  4G9Y A;  4HYE A;  4KN4 X;  3LSR A;  3I4M J;  2HOS A;  2HYJ A;  2IJL A;  3I54 A;  4Q4Z F;  1XGO A;  2DU9 A;  2JA2 A;  2X85 A;  3PFI A;  4NBQ A;  2L7K A;  2HZT A;  4F52 A;  3R60 A;  1XPX A;  1U78 A;  3GTQ J;  4M3E A;  3FHZ A;  2VJJ A;  2O9L A;  1ETW A;  2FJ1 A;  3GTP J;  1X2N A;  4ZDL A;  3F3X A;  3GO5 A;  5C4X J;  4P9F A;  3WHB A;  2WC2 A;  1SFX A;  3RCO A;  3CCR I;  4A3M J;  1H0M A;  2MH2 A;  1K79 A;  4FE7 A;  4HNT A;  1NG7 A;  4Y17 A;  4AIH A;  1W36 D;  1I27 A;  3WGG A;  1G8X A;  2XRN A;  1Y0N A;  3A0H C;  5FJ8 J;  2F5C A;  5IPA A;  3CZ6 A;  2ME0 A;  3OY9 A;  1ZGJ A;  1W0T A;  1W5T A;  2EA4 A;  1ETK A;  5B3S H;  5IYD J;  2GA2 A;  3RZD J;  4CA0 A;  4A3J J;  2Y2Z A;  1WQ2 A;  4KUM A;  4FAS D;  4GCV A;  3LWF A;  5IP6 A;  5LD2 C;  1MMN A;  5EZH A;  4M3D A;  3HRS A;  3K4K A;  2QCO A;  4O5V A;  1J2X A;  3NQO A;  1YYV A;  2VPL A;  4JX5 A;  3DBR B;  1WJD A;  4MFE A;  2KIF A;  2OBP A;  3K7A J;  1A31 A;  2VQL A;  2BY2 A;  2W85 A;  3HKZ N;  1BOA A;  2LF7 A;  5CVV A;  2QF7 A;  2VON A;  3C3W A;  4OAY A;  1VQO I;  1R9T J;  2JA6 J;  2VQC A;  4HPQ A;  2L9V A;  4G8X A;  4CCN A;  4UUS A;  3KIO A;  1X58 A;  5CVI A;  4C3H J;  3FXK A;  2L7F P;  3WG7 H;  4BBS J;  5FGM A;  1REP C;  4U7D A;  2CUF A;  4V2F A;  3C2H A;  3K70 C;  2HDD A;  2HXO A;  2HDW A;  5H6Q A;  1ZQ3 P;  3M4O J;  4BJT A;  1VQ6 I;  1X1C A;  3KP3 A;  2F4M B;  1TBX A;  1YQA A;  3H9Q A;  1R7J A;  2ID3 A;  2R7Q A;  3F21 A;  3S32 A;  4ENM A;  3IUO A;  4ZDP A;  2LMD A;  5CKT A;  4D1Q A;  2DTZ A;  3GX4 X;  2ZJR F;  3LSM A;  1HLV A;  3ZP5 A;  4CGZ A;  1SFK A;  1BIA A;  1Y39 A;  2MC3 A;  1S7O A;  3IRR A;  3TQN A;  3BCB A;  1D0Z A;  4CZC A;  2KKO A;  1MMS A;  2EK5 A;  1W5C C;  4HBL A;  4BDZ A;  2KFD A;  1U5T B;  1X19 A;  3VPR A;  2KRF A;  3EYY A;  1RIO H;  3Q0U A;  3O3K A;  1Z0X A;  5LFA A;  2KT0 A;  4BXF A;  3K4N A;  1QHH D;  5DCF A;  3CMY A;  2DDA A;  2AHQ A;  1W0U A;  4EM2 A;  1OQY A;  2DLL A;  5E8I A;  4L0Z B;  2JVG A;  1YX5 A;  3OYI A;  2HYG D;  3CJQ B;  4F7Z A;  4Z2Y A;  2DA5 A;  1SD5 A;  3BG5 A;  1K4T A;  5LGU A;  4LFU A;  3HSE A;  1NK2 P;  2NS7 A;  2CO5 A;  3N97 A;  1EJ9 A;  1OR7 C;  3B73 A;  3O8G A;  1XG1 A;  1A6Q A;  1YIT I;  1S72 I;  3CDI A;  1S8N A;  4M3B A;  1LFU P;  4B3A A;  3L2W A;  4Y7N J;  1TWG J;  3FIW A;  4LLG F;  1KA8 A;  3KEQ A;  3S1N J;  3T8R A;  4GYG A;  1XDU A;  2E60 A;  5GP9 A;  2XSJ C;  4G7H F;  1JUP A;  4QWQ A;  2CW8 A;  3BTC A;  3QAH A;  1ZG1 A;  1ZLK A;  3E0J B;  4OMY A;  2AQE A;  3HB9 A;  1V5G A;  1SEU A;  2QQB A;  2XPV A;  4NC6 A;  3U9G A;  3DBL B;  4BY1 J;  5ILS A;  2CJJ A;  3GCM A;  4BY7 J;  3RJP A;  1XMA A;  3F6O A;  4XNF A;  4KIF A;  3FZV A;  3MVP A;  4RM3 A;  4YII A;  1Z6R A;  2CRG A;  2B0L A;  2FRH A;  5BPI A;  4LB5 A;  4HNV A;  5L3D A;  1UB9 A;  1HC8 A;  3E97 A;  2YPR A;  3QU3 A;  5J47 A;  3CCS I;  2FBI A;  3HRM A;  4P1W A;  4EGZ A;  5LHH A;  1IO2 A;  3RYR A;  4BXX J;  3PO2 J;  3LFK A;  3IWF A;  4GFB A;  2V1N A;  2JSP A;  2V9V A;  3C1D A;  3ZQ7 A;  1MBE A;  2XVC A;  1R4N B;  4NQW B;  4A3F J;  1ACI A;  2K9N A;  2EIJ H;  4HW0 A;  2KLO A;  1MDM B;  3LA7 A;  4A93 J;  5EG0 A;  3T8T A;  1OKR A;  3SZP A;  1U5T A;  4LD5 A;  2K3P A;  3G1M A;  3ZQG A;  2VAS A;  5JR3 A;  4IRG A;  3IH4 A;  3CME I;  5J8F A;  3M9A A;  3ZXS A;  4RA2 A;  5DCM B;  4M73 A;  4GXO A;  2D1V A;  3WGH A;  3DU5 A;  2HPM A;  2A6T A;  5IP9 J;  5IOY A;  2EFQ A;  1U6G A;  1USS A;  4EJT A;  3LA3 A;  2PI0 A;  1R71 A;  4G6D A;  3JRC A;  3BP8 A;  3FKJ A;  2E2I J;  2XPW A;  2IA2 A;  4CYD A;  3GFM A;  1ZTR A;  2PN6 A;  3GF2 A;  3HGG A;  1HDP A;  5E18 F;  1WH5 A;  4WXC A;  3CDL A;  1R1U A;  4ESF A;  5EEG A;  3AG4 H;  4L0Y B;  2YR2 A;  3W3C A;  2JUG A;  5M5Y J;  1ODD A;  5CVU A;  2CFO A;  3DXJ F;  5J4Y A;  2ZFU A;  3FWE A;  4Y3O A;  4OOI A;  2WWY A;  1VTN C;  2H6C A;  5FLX K;  1R1V A;  1T38 A;  4A3D J;  2KIS A;  1LDJ A;  4YFK F;  3S14 J;  5IY5 H;  3ABK H;  1IXS B;  2VIX A;  2PEX A;  1SC7 A;  2DQL A;  2LYC A;  2E1C A;  3MD2 A;  5J1U A;  2VC0 A;  4R8H A;  4BBR J;  4AU7 A;  5D5V B;  1HKT A;  3SFI A;  1O4X A;  1IDY A;  2HFH A;  2R7O A;  1WGX A;  4NHJ A;  1V54 H;  2ICW G;  2EFP A;  1RR8 C;  2VL8 A;  4UUT A;  2A5Y B;  2KIM A;  4G7O F;  1YW8 A;  4ZTJ A;  3BJO A;  1MH3 A;  1QPM A;  1JT0 A;  4LB6 B;  2X9D A;  1V4R A;  1Z1D A;  5L3F A;  2HNH A;  2X0L A;  5BOX A;  3WHC A;  4NQW A;  1LNW A;  5ICE A;  5KAF C;  4L5J A;  3ASN H;  3NAR A;  1T0F C;  2DT7 B;  3BLY A;  1Q1V A;  3BG6 A;  1BIB A;  4O6J A;  1UJ8 A;  3CCQ I;  3AG3 H;  3KEO A;  1T8I A;  2WAF A;  3RPQ A;  4G6T B;  4BUP A;  1JKR C;  3A2K A;  3KET A;  4MO7 A;  5HLH A;  1PP7 U;  3R61 A;  1K6O A;  3GXO A;  1N25 A;  3G3Z A;  3IH3 A;  3K1P A;  5GPC A;  1ZR2 A;  3FXQ A;  3K6G A;  4AID A;  4C30 A;  1I6X A;  4ASN A;  2ZXH A;  4AYB A;  5DCM A;  3DPU A;  4RGS A;  2W82 A;  2QEN A;  2E35 A;  4IVN A;  1XD7 A;  2L9N A;  2COB A;  1UHW A;  5K5O A;  2LRD A;  9ANT A;  3JRH A;  2JK3 A;  3WU0 A;  2DT5 A;  4RAF A;  3G1L A;  1NTC A;  1BN5 A;  3EET A;  2M0C A;  3VEP A;  1R58 A;  2KMU A;  3DBH B;  2I10 A;  2H27 A;  1J9I A;  4KIG A;  2WB1 A;  2OUM A;  2VBW A;  4OAZ A;  2IA0 A;  1W1W E;  4PCQ A;  3M1E A;  5EEH A;  4I98 B;  3BRO A;  2KJB A;  2ZO4 A;  2R5Z A;  4EAT A;  3ZQH A;  3MCZ A;  4XOP A;  4XBF A;  2EFW A;  1APL C;  3Q5F A;  4A6D A;  1BC8 C;  2UZK A;  2P7C B;  1U9N A;  2CH0 A;  3LSJ A;  2MD0 A;  4PJN A;  4Y4R A;  2GXG A;  2M8G X;  2K7L A;  2L0K A;  1XB4 A;  1MMD A;  3V7C A;  2A6H F;  1L3L A;  2CGP A;  1TQI A;  2LH9 A;  4BU2 A;  1N77 A;  3M8J A;  4D7N A;  3A01 B;  1DGR M;  1MKM A;  3CCU I;  1OYI A;  1TL8 A;  5AON A;  4JK1 X;  3ZCO A;  4XRF A;  3EUH A;  1YFH A;  1LE8 A;  1GLN A;  3OOP A;  2D1H A;  1MSF C;  2E36 A;  2NOG A;  1WSU A;  2NVT J;  1T39 A;  4RMN A;  3BR3 A;  3C2G A;  4J00 A;  5M3M J;  3SEQ A;  1F1Z A;  3PUF A;  1NK3 P;  2HXI A;  1W4M A;  2R5Y B;  4UVC A;  1UHM A;  3KPH A;  2OZU A;  2ZC2 A;  5ICG A;  4N0B A;  2DBB A;  4IF4 A;  5K5Q A;  2BVL A;  3I58 A;  1ZYR F;  2OAZ A;  4IL6 C;  4A0X A;  2M9H A;  2RV8 A;  4LJZ F;  1BR1 A;  2R4G A;  1I39 A;  4HDV A;  4BYY A;  3IKT A;  1XS9 A;  5E79 C;  2EIM H;  2Q8K A;  3KZZ A;  4IRH A;  5FO5 A;  3DTK A;  1WJ5 A;  4EJU A;  3CC2 I;  2Z9O A;  3PSF A;  1SFU A;  1B59 A;  1OIS A;  3SXY A;  4BHC A;  2PJR B;  3U1K A;  4FQG A;  5IYC J;  2LC2 A;  3ZOB A;  1YRN B;  1Y8R B;  3I4N J;  3CLQ A;  3CTA A;  3HPG A;  4PJL A;  3FXO A;  1AWC A;  3HGY A;  2A69 F;  2K5C A;  1T33 A;  5TRD A;  1P4W A;  2O61 A;  4XKW A;  1NH3 A;  2E5Z A;  3IC7 A;  4I0A A;  1U9O A;  2R7F A;  2M2E A;  2QYO A;  2PX9 A;  3CF2 A;  3HEF A;  5TGT A;  1JGS A;  5A2Q Z;  2PLY A;  3QOP A;  1X1D A;  2EZL A;  4MLO A;  3J81 Z;  2ZJQ F;  1VQM I;  1W36 C;  1YIJ I;  1QGP A;  3AKZ A;  3NAU A;  2A6E F;  3MKW B;  2XAG A;  3VYT B;  5GAD J;  4A3L J;  2Y0S A;  4G94 A;  2VE8 A;  3SHF A;  5B1B H;  4CH7 A;  2R0Q C;  5BPD A;  1IDZ A;  1DPR A;  3G73 A;  1E17 A;  1EH7 A;  1T08 B;  4BEH B;  2IGM A;  3J80 K;  3KLN A;  1D0X A;  4LG3 A;  4A69 C;  4Z6Y A;  1MGT A;  2H1L A;  4U0W A;  2DW4 A;  1OCP A;  2LRE A;  1WZ2 A;  3GYH X;  1LDD A;  3E5U A;  3A1Y A;  4E4H A;  2QM3 A;  1TLH B;  5HS7 A;  2CFX A;  1H8A C;  3CC7 I;  4IHT A;  3DP7 A;  2VT3 A;  3OYL A;  3WE3 A;  4EJO A;  3BR2 A;  4A0Y A;  3OMY A;  5HVQ C;  1XCV A;  5LRS A;  1BA5 A;  3OIQ A;  1YJ9 I;  5DTD A;  4E7H A;  3NEU A;  3SQN A;  2HQN A;  3K4C A;  3J7A Y;  2XC7 A;  3MKZ A;  1JKO C;  1FTT A;  4NNJ A;  3IRQ A;  4XQF A;  4LLN A;  1VQL I;  3R6S A;  2DA2 A;  2LK2 A;  2WA0 A;  3JSO A;  1QRY A;  5DD8 A;  2RAE A;  2ELJ A;  3WTV C;  4UHT A;  3G4S I;  1P7J A;  2Z33 A;  2N8G A;  2F5V A;  2MG4 A;  5FRO A;  4WXD A;  1KU9 A;  1ON1 A;  4XLC A;  2HDC A;  1R1T A;  2CUE A;  2XAJ A;  3M3Y J;  2DOD A;  5K1Y A;  4XOT A;  2PJR A;  4UUV A;  2VJ5 A;  1V3F A;  3FK6 A;  1SMY F;  3HYI A;  1N78 A;  3I56 I;  4XLE A;  5EEA A;  1ZGA A;  3O2P E;  2EV6 A;  2HKX A;  4C2U A;  2XAH A;  2EIK H;  1T2K A;  5EDN A;  1P9Q C;  3CJN A;  2E1M B;  4LIU A;  2R7U A;  3OSG A;  1JGG A;  2IP2 A;  4XRS A;  2CQ7 A;  4LMY A;  2L2O A;  2GZW A;  3F9K A;  1TQP A;  1BC7 C;  2F5E A;  1JI8 A;  3R4K A;  3RKY A;  3S3M A;  3QPS A;  1Z21 A;  2O8K A;  5CQE A;  2XAS A;  1KQ8 A;  2EJR A;  4IOC F;  3EPZ A;  4HF0 A;  4M3F A;  2L3D A;  1XX5 A;  5B66 C;  3JRI A;  2OTJ I;  3BTL A;  4XOR A;  2V26 A;  4BEH A;  4B48 A;  2BXZ A;  2Y30 A;  5L3E A;  1ZRE A;  2E1N A;  2NNY A;  3AAF A;  3RKW A;  5E17 F;  3P9K A;  3BJA A;  4TV7 A;  3BC8 A;  4FCY A;  5GTI C;  2CWE A;  2UWM A;  3J7Z I;  3CO7 C;  2AO9 A;  2R3S A;  5IP7 J;  1HKS A;  2QGU A;  1C0W A;  1XCB A;  2OA4 A;  4ZDO A;  1XGS A;  5ERI A;  2QKL B;  2YS9 A;  4EM0 B;  4BQN A;  2AXT C;  4I76 A;  3CO6 C;  1B72 B;  1PYV A;  2Z3Y A;  2OCE A;  2MC4 A;  4XKV A;  3ZQC A;  1G59 A;  3S1Q J;  3DU6 A;  2JA8 J;  1FWZ A;  4QPO A;  5FLV A;  3ABU A;  2EZI A;  4II2 A;  1HQC A;  4CIC A;  4EEF G;  4ZJZ A;  5E1X A;  1OCC H;  3ROU A;  2GAU A;  3HHG A;  2TRT A;  3QU6 A;  4N4O B;  1JE8 A;  4MFD A;  4Y15 A;  1ZHF A;  1WI9 A;  1ZEL A;  4Q48 A;  2JVH A;  1R4M B;  4HA8 A;  4CXF A;  2PMZ N;  2ESN A;  3HC7 A;  2MGQ A;  5HLI A;  4AD9 A;  2DMT A;  2P4W A;  5JI6 A;  1ZG5 A;  2XKO A;  2GOM A;  1UAA A;  2AQF A;  2IS2 A;  3LSG A;  2QLZ A;  2HGC A;  5A2Q K;  4I02 A;  5JVT A;  1FEX A;  3ZR8 X;  3J81 K;  1SD7 A;  2MH9 A;  1O3R A;  4IJA A;  1WPK A;  4CYC B;  5L3B A;  1O7L A;  1U5T C;  2XKP A;  3GW2 A;  4W1U A;  2NRA C;  2HVR A;  5FRN A;  2FNA A;  1I1S A;  2W1O A;  5EGO B;  2RQQ A;  3CMM A;  5ILU A;  1FIP A;  2R93 J;  3JRE A;  2HU9 A;  2QSG X;  5EJC A;  2XGX A;  1O3Q A;  1FX7 A;  1ULY A;  4H4K C;  1G3W A;  3OYH A;  2YU9 J;  3VSK A;  4WWC A;  4RS8 A;  4CHU A;  4MGR A;  5J40 A;  3IAM 2;  1XSD A;  1FNN A;  1H89 C;  4I2O A;  2Z16 A;  4KIT B;  2XRO A;  2L9R A;  4V2G A;  3JRF A;  2DQR A;  2M8E A;  1WJA A;  2HOE A;  2KHM A;  3QOD A;  3TKY A;  4C3J J;  3CCE I;  4PGH A;  2X1E A;  1BI0 A;  3TO6 A;  4F93 B;  3DKX A;  5LEJ A;  2EFN A;  4BAY A;  1WH7 A;  2HKO A;  4S0H B;  3TW7 A;  3V4G A;  1J0R A;  4NC7 A;  5LGN A;  2STW A;  1WJE A;  2EPF A;  2IVM A;  2LTP A;  4I99 C;  2OCC H;  4S04 A;  4YRV A;  2UV1 A;  2VBX A;  1B6A A;  3OYB A;  2OD5 A;  4MEY F;  4R79 A;  1IC8 A;  4P9U A;  2R7Z J;  3BCA A;  1HF0 A;  1XTA A;  4LG0 B;  1FOY A;  1B72 A;  3I5U A;  1R00 A;  3ISP A;  4N4N B;  2F4I A;  1A6I A;  2KPM A;  3W2V A;  2XAQ A;  4O3M A;  1YS6 A;  2RRE A;  4A2U A;  5LEK A;  3KYL A;  3FDY A;  2DYS H;  4BGD A;  1V5F A;  3JCU C;  2O7O A;  5FLX Z;  1WJC A;  1D1A A;  4D7M A;  4B8X A;  4Y13 A;  5FFZ A;  2IPQ X;  1QHG A;  1H9T A;  1ERD A;  1TT0 A;  1ORK A;  1DP7 P;  2FBK A;  2MYS A;  5FLM J;  3QP5 A;  2VI6 A;  3RIR A;  1VQ8 I;  3FXU A;  2IGO A;  5HLG A;  3E6D A;  5EG0 B;  4C9Y A;  3G71 I;  4L9J A;  2XDV A;  1FYM A;  1MIJ A;  3E6M A;  1G6N A;  4CYC A;  1ZR4 A;  3ZMS A;  2HOT A;  3VB2 A;  1ZH5 A;  2TDX A;  2LNB A;  1YO5 C;  1CGP A;  4EVI A;  1QZY A;  1S7A A;  1IV8 A;  3PM1 A;  3L2Q A;  1AA7 A;  5E1Z B;  2KQR A;  2JT1 A;  1QU3 A;  4EJW A;  3F23 A;  3UNG C;  5EGO A;  1F5T A;  1E3P A;  2JN6 A;  3B6C A;  5F08 A;  2VQH A;  2LSO A;  2H09 A;  2RKH A;  4G6Q A;  5KAI C;  1ON2 A;  3BR5 A;  1D0Y A;  5DS9 A;  2L02 A;  3SDB A;  4S05 A;  4MTD A;  1WFX A;  2VKH A;  3FMQ A;  4F55 A;  3B02 A;  3S3N A;  2NVU B;  4ZZL A;  3KLO A;  1VQ4 I;  3HSR A;  1ETX A;  2QSF X;  4HF2 A;  4UVA A;  1EH6 A;  2E71 A;  4OIP F;  4ZYE A;  5J6X A;  4EJV A;  4II3 A;  2M3A A;  5BQT A;  3IAS 2;  4XLH A;  3LSK A;  4M9S A;  4RB2 C;  1BR4 A;  3PFY A;  3WG9 A;  1FJL A;  3AL0 B;  2Q2E B;  2M7A A;  2V6C A;  2K02 A;  4IPA A;  3MKY B;  3KYD B;  3CES A;  2LKS A;  4LG0 A;  3ZRG A;  1J5Y A;  2DA6 A;  2X51 A;  2F48 A;  1VI0 A;  3DV8 A;  5FKN A;  3HOX J;  4NUB A;  1R49 A;  4BHP A;  5GAE J;  3K69 A;  2G0E A;  3I3L A;  4IHY A;  1RR7 A;  2G9W A;  3WTZ A;  2OZ6 A;  4D0P A;  3JRA A;  1RRJ A;  2X6Y A;  3EUH C;  3S15 J;  2CW7 A;  2QQ8 A;  1S9H A;  2DPD A;  2RQP A;  2DFH A;  1PDN C;  3L7W A;  2P0W A;  2M5W A;  3M1C A;  4KYW A;  2DK5 A;  4DQ2 A;  3G1O A;  3ABM H;  1QVU A;  2O5R A;  2CV2 A;  2E1O A;  2E7W A;  3M07 A;  1OCR H;  2HEO A;  2UXN A;  1F36 A;  1TWC J;  3V8J A;  2V79 A;  4IHS A;  3VFZ A;  3CMA I;  1VQP I;  3CLO A;  4IOA F;  2FML A;  1VF9 A;  2RNG A;  1IG7 A;  5CPR B;  3DF8 A;  5IT9 Z;  4XSZ F;  4E70 A;  2DMP A;  3S2W A;  4UNO A;  2FOW A;  5K7F A;  3MEX A;  2IRF G;  2CV1 A;  3EUK L;  1V5E A;  4KFC A;  1SFE A;  1BI1 A;  1RUN A;  2GA1 A;  4HRI A;  2ISY A;  1U3E M;  2WAQ A;  3D5R C;  3HRU A;  1BR2 A;  1GT0 C;  2QVO A;  4X6A J;  2GOX B;  2ZNZ A;  4ENK A;  2BV6 A;  4XKC A;  1ZKG A;  2DA1 A;  1P2F A;  1D8K A;  2XRL A;  5E3L A;  3FMS A;  3ZMZ A;  3FF5 A;  3U1D A;  1LVA A;  4B47 A;  2Y0S N;  3JW4 A;  5D8L B;  1IN8 A;  3ZMD A;  1DGW Y;  5D8K B;  1EF4 A;  2R5Z B;  4L9T A;  4PSW A;  2B63 J;  4C3I J;  3SJM A;  4LIT A;  3OSF A;  2DI3 A;  4E7L A;  4AC0 A;  4EM1 A;  3GTG J;  3F72 A;  2QWW A;  2CUZ A;  2HTJ A;  4F91 B;  3NRV A;  1BJZ A;  4HNU A;  5J1R A;  1ZRF A;  2Q2E A;  3KFW X;  4KA4 A;  1ZGW A;  3GZN B;  1IXR C;  4L9V A;  5DEQ A;  4PJJ A;  4DZJ A;  4DGW B;  1RKW A;  4GYI A;  1TW3 A;  1LB2 A;  2V6E A;  3LSI A;  2VE9 A;  1R5I D;  1FMV A;  3ZMV A;  3TDU C;  4DYR A;  1TC3 C;  2JA7 J;  2QBY B;  2XGE A;  4GGG A;  1LEB A;  4RGU A;  2KL4 A;  1LE8 B;  1ZAR A;  4M74 A;  4KT6 A;  5GTH C;  5TIS C;  1YIO A;  1OCZ H;  3ONQ A;  1O3T A;  5E20 A;  3RYP A;  3K70 D;  4V19 K;  3J80 Z;  1WWX A;  2HQ5 A;  1XC5 A;  1FYK A;  3JRG A;  4HZF A;  2M4K A;  3HKZ A;  1EV7 A;  2O03 A;  1IN7 A;  2ZXW H;  2L4A A;  1MJA A;  3H9G A;  2W00 A;  2VXZ A;  2COM A;  1KU7 A;  4BAC A;  4YFX F;  2FF4 A;  2EFO A;  1P92 A;  3I64 A;  4I0B A;  2QUF A;  3PIP F;  3DLA A;  3OIP A;  4CCL A;  3L2U A;  1UHS A;  1Z7L A;  3K0L A;  3BWG A;  2Y9Y A;  1D5Y A;  4CDG A;  2R7X A;  2BE5 F;  1JUS A;  3OR1 C;  4PFP A;  3HJE A;  5JHU A;  2W48 A;  3VSL A;  2VXD A;  3M8E A;  1OLT A;  3HTU A;  2KZV A;  2UXX A;  2DXI A;  2HPI A;  1UCR A;  1U2W A;  2K40 A;  3BR1 A;  3TW6 A;  4KT5 C;  2KDZ A;  1WVR A;  3R0A A;  3VYS B;  2DAO A;  1MMG A;  2VKV A;  3I55 I;  2WV0 A;  1LFP A;  2CU7 A;  3WTY C;  3DPT A;  1A5J A;  1X3Z B;  1FPQ A;  2BHY A;  2MW8 A;  4A12 A;  1AKH B;  4RGR A;  2L4M A;  1BOB A;  2P6T A;  2XB0 X;  1LUJ B;  3ZMT A;  3FK7 A;  4HDU A;  4IKF A;  2LY9 A;  2OJE D;  3PO3 J;  5DV5 A;  3CUQ B;  2M87 A;  3CD6 I;  2P7V B;  1SAX A;  4BL0 B;  1DU0 A;  2CQX A;  1FYL A;  2HTS A;  1X3W B;  1BI3 A;  1ETO A;  1RZ4 A;  2NS8 A;  4RBO A;  2KIU A;  1I3A A;  2B9S A;  2DCE A;  4CCK A;  2LVS A;  5J3L A;  1Y56 A;  3ERE D;  1FBS A;  4UV8 A;  2IEK A;  3H5N A;  1R5H A;  4WXH A;  2PQ8 A;  1HBX G;  4PZJ A;  5F0F A;  5LHI A;  1QNT A;  3GUD A;  3KP6 A;  5HOD A;  3V42 A;  3FXM A;  5IYB J;  3P9I A;  2A61 A;  2YUS A;  4RAZ A;  4WF2 A;  4U0Y A;  3KP5 A;  1RC9 A;  2H6B A;  1FBU A;  1JJ8 C;  3OWT A;  3A03 A;  1OMI A;  3DEW A;  2L7M P;  2QBY A;  3BDD A;  5IT9 K;  4L5E A;  3OYE A;  3Q0W A;  2HS5 A;  4AWX B;  2BY1 A;  2O8X A;  2IGK A;  1X3U A;  4BS9 A;  3F8F A;  1I6H J;  2FQ3 A;  1IXC A;  1KQ0 A;  1YOV B;  1XDS A;  4RB3 C;  1AU7 A;  2KJC A;  5CVR A;  3E5Q A;  4AIK A;  5D6F A;  2PG4 A;  3H3V K;  2ZSH B;  4OIN F;  2JZY A;  4IHX A;  1IN4 A;  2F5F A;  3ZPL A;  2V1X A;  2DMU A;  3AFH A;  1WRJ A;  5HDG A;  3N4M A;  4HLY A;  5H2F C;  5DUI A;  1WKM A;  3S1M J;  1OYY A;  5JHF A;  1MZB A;  4E7K A;  3IV5 A;  4MEX F;  1MBF A;  1XGN A;  4ESJ A;  4JQF A;  3QPT A;  1A04 A;  2FOK A;  2ZBK A;  4ZC3 A;  3D1N I;  2VOD A;  1S29 A;  2STT A;  3RKX A;  1ZAO A;  5GAG J;  3SFZ A;  4L5I A;  3I71 A;  3ERM A;  2QZ8 A;  1I5Z A;  1RNL A;  2CSO A;  2QEX I;  1PJR A;  1PVE A;  2DYR H;  3OR2 C;  2Z1D A;  5D5X B;  2FBH A;  3COA C;  2QQA A;  1A36 A;  1M1E B;  3BTI A;  2I5U A;  4HX4 A;  2LY1 A;  1AKH A;  1BJA A;  2E1M C;  2GQQ A;  2DA7 A;  1DPU A;  3S3O A;  5ED4 A;  1Z3Y A;  3I0T A;  2NOJ B;  4WCG A;  2ZB9 A;  3GTO J;  3S2H J;  2LKX A;  2VBY A;  4B3X A;  1R22 A;  3CUQ A;  3SDG A;  2GWR A;  4Y52 J;  1D8J A;  2HOA A;  4DZP A;  2ZXJ A;  3PUB A;  5JVG F;  1VQK I;  2E19 A;  2W4S A;  3HG9 A;  2DA4 A;  3CDH A;  2BHZ A;  2LBF B;  3HOT A;  4DOZ A;  3Q3S A;  5F6F A;  3JR9 A;  5HS9 A;  2OQG A;  4PUS A;  4PFO A;  2Q0O A;  4KIC A;  1Z05 A;  4BE2 A;  2Y0M A;  3LSH A;  1STZ A;  1RI7 A;  1Z7U A;  1S3J A;  2HWV A;  1TNS A;  4E6K G;  1WJF A;  3BPX A;  3WU1 B;  1QA6 A;  1XSV A;  3LFU A;  2P81 A;  4Q47 A;  1X4O A;  1S5L C;  3I4P A;  4XIC A;  1LJ9 A;  1NG6 A;  2HYF A;  2GIZ A;  3BG9 A;  4G7Z F;  1P6R A;  4JX4 A;  1Q1H A;  2L5Q A;  3WTS C;  4WK8 F;  1LFB A;  4A3K J;  3LQQ A;  1FTZ A;  1ZN2 A;  2PMH A;  4ETS A;  3MFK A;  4BNC A;  1OPC A;  3FMR A;  2JQ7 A;  4BQA A;  2VBZ A;  3BR0 A;  4B4C A;  2Z2S B;  1HDD C;  1UST A;  5IOZ A;  4ZYD A;  2VC1 A;  3BJ6 A;  3MZH A;  3FIS A;  2IS1 A;  4RDU A;  3K4B A;  2XAU A;  1GXQ A;  2A68 F;  3PNV A;  4HV6 A;  1D5V A;  2GXA A;  5FB2 A;  2AS5 F;  2F6C A;  3BR6 A;  3OIO A;  4NDL A;  1FC3 A;  1FMW A;  1HW5 A;  5FKO A;  4I01 A;  4X0G A;  3PJR A;  5LGT A;  1FLI A;  1T0F A;  2LF8 A;  1RKT A;  2GXB A;  4KDP A;  3RI4 A;  2GM4 A;  2VPR A;  1HOM A;  3K1N A;  1UEL B;  2RVC A;  5CLS A;  2ACJ A;  2GLO A;  2ESH A;  3ZN1 A;  3Q9V A;  2TCT A;  3GME A;  4UB8 C;  4C2M J;  3E5X A;  3WE2 A;  5H6R A;  1LEA A;  4AUX A;  1IAW A;  5LHG A;  3S93 A;  3OYN A;  1VQ5 I;  1HA8 A;  3H9J A;  2FQ4 A;  4YEJ A;  4D5C A;  1R6R A;  1E0E A;  3AG2 H;  2L01 A;  3MAJ A;  1YG2 A;  1FSE A;  3ZQL A;  4Y33 A;  5AIQ A;  2M4G A;  2V1U A;  3MMY B;  2ZME B;  3LA2 A;  2BW3 B;  2LBF A;  3D0S A;  3LMM A;  3TL4 X;  2BBY A;  3W2W A;  2ELH A;  3D5L A;  1YS7 A;  2DT6 A;  2CQK A;  2V9K A;  3BTJ A;  2DK8 A;  2XAF A;  3FXR A;  4GO1 A;  2R92 J;  1G2H A;  2BY0 A;  1I3Q J;  2KP6 A;  3ELK A;  2Z99 A;  1P4X A;  4M3G A;  1R5G A;  2MBF A;  3H3U A;  2VN2 A;  5IT3 A;  3OS2 A;  3OYD A;  4HOB A;  1OCO H;  5J1Y A;  4DNC A;  3IL2 A;  3FX3 A;  4BKX A;  3K10 A;  3KZI C;  2CMP A;  2JTV A;  2H8W A;  2YX4 A;  1PUF B;  5KHD A;  3KEY A;  3GFJ A;  4A0Z A;  2K9M A;  2X4H A;  4XID A;  2JA5 J;  3W6V A;  2G7U A;  3H35 A;  1X2M A;  1TP4 A;  3H36 A;  4DBQ A;  5HDN A;  3ECO A;  2HQR A;  1KU3 A;  1QZE A;  3JAM K;  1TZL A;  3BG3 A;  2C6Y A;  5JLW A;  3A4C A;  3KCC A;  3B6A A;  2EV0 A;  1FIA A;  1GVD A;  2WAD A;  4IHW A;  1DU6 A;  2K4J A;  2XF6 A;  3DKY A;  2DFI A;  2IGN A;  1J09 A;  5F1J A;  3HOW J;  2L9S A;  2G7H A;  2LY2 A;  3QQA A;  2LKP A;  2Y69 H;  1TWF J;  4U0V A;  1RPW A;  2FSW A;  2EIL H;  1GV2 A;  4W97 A;  5F0C A;  1B1B A;  4J19 A;  3RZO J;  5BS6 A;  3L2R A;  4BE0 A;  5EZG A;  4FT8 A;  2W24 A;  3ABT A;  1TWH J;  1JKQ C;  5F04 A;  3DTE A;  2W57 A;  4EGY A;  2IA1 A;  3CP2 A;  3PSI A;  2YX7 A;  3C2B A;  3CCJ I;  2RGV A;  2BYV E;  3ZN0 A;  1NHA A;  5J8C A;  3ML6 A; 
#chains in the Genus database with same CATH homology
 2K4B A;  4MHG A;  1MD0 A;  2ZNY A;  4LGW A;  5ICF A;  4I09 A;  5KK1 A;  5E8G A;  2DPU A;  2M30 A;  4UXN A;  1O3S A;  2EWN A;  2XUB A;  2ZME A;  3WTU C;  1QBJ A;  2RNJ A;  1TNT A;  4YIF A;  4AIJ A;  2DO7 A;  4M71 A;  2FNP A;  2XHK A;  3CUO A;  2P5V A;  4A5M A;  1BBY A;  4UV9 A;  4KMF A;  3BY6 A;  3I59 A;  3BPV A;  1KGS A;  4ENJ A;  3DFG A;  2D2W A;  1SMT A;  4CO8 A;  3P9C A;  3WGI A;  4XSX F;  1IZ1 A;  4LLL A;  2CW0 F;  1XSX A;  2XV4 S;  1K7A A;  4ENN A;  5HDK A;  3GLX A;  1FP2 A;  4L18 B;  5JFR A;  4A6E A;  2IT0 A;  1AOY A;  4P55 A;  3TDZ C;  5LLQ A;  3KP4 A;  4AVP A;  2YU3 A;  5DDG A;  4OU0 A;  1ZRD A;  2MLG A;  3SZT A;  3HOS A;  4R1H A;  1O7F A;  2Y48 A;  2O0Y A;  2P5K A;  2WTE A;  2ZJ2 A;  3MZY A;  4ZYG A;  3M8F A;  4PDK A;  4MTE A;  3K2Z A;  3PQJ A;  4L9N A;  4HAM A;  1B9N A;  1IF1 A;  1LDK B;  2MLK A;  1I1G A;  5CVJ A;  2P6S A;  4QLC U;  1KU2 A;  4A5N A;  1XMK A;  1HW2 A;  5LRR A;  3IHU A;  2MD5 A;  3KP2 A;  3LAJ A;  4HV5 A;  2NNN A;  1G3Y A;  3R0J A;  2RDP A;  1D3Y A;  2OQR A;  3F8B A;  4FX0 A;  4B09 A;  3EDP A;  3TOA A;  2VT2 A;  1BI2 A;  4RAY A;  3RDI A;  3TGN A;  3KP7 A;  4KMU X;  3WTT C;  4BXU A;  3LQR A;  3JTH A;  1P4A A;  1FZP B;  1GHC A;  2CG4 A;  2F5D A;  4FX4 A;  1T6S A;  3Q9S A;  2Z5U A;  3I53 A;  5K5R A;  4MQ9 F;  3F22 A;  2PJP A;  2IW5 A;  1PUE E;  1QZZ A;  4KNY A;  1QO0 D;  4P5O A;  4N9I A;  3WOD F;  1LQ1 A;  1ZG3 A;  1G4D A;  3M7G A;  1Z9C A;  4HF1 A;  3QP6 A;  3KE2 A;  5AIP A;  3ECH A;  3C18 A;  4KN7 X;  3V8K A;  3DQV C;  5CYV A;  3MQ0 A;  3HTS B;  5FD6 A;  3HUG A;  4ZH4 F;  3L2C A;  2ISZ A;  2H94 A;  1HXD A;  1B9M A;  4ZYH A;  1H9G A;  4Q5S F;  4M72 A;  1FT9 A;  4HQE A;  1U8R A;  3RTR A;  2BEO A;  1HSJ A;  1EH8 A;  3CUQ C;  3GZ5 A;  4FHT A;  4UVB A;  3H92 A;  4BHB A;  1B4A A;  3FM5 A;  1HW1 A;  3JTG A;  4CZZ A;  1R23 A;  2J5O A;  1YTY A;  1IRF A;  4K2E A;  1DUX C;  2GIV A;  2ZFW A;  2EV5 A;  3U2R A;  2K27 A;  3REO A;  2NYX A;  4IXA A;  1T98 A;  2FEZ A;  5CJ9 A;  1SD6 A;  3F8M A;  1KYZ A;  3FM3 A;  4M9X A;  1ONV A;  5HOO A;  1TQM A;  1JHH A;  4HQM A;  4N9H A;  5BMZ A;  2J5P A;  2PBI A;  2JRT A;  3LST A;  2QQ9 A;  3HIF A;  2P5L C;  5KVR A;  2VOP A;  4LK1 F;  1E2X A;  2RC4 A;  1SD4 A;  1IN6 A;  1IUY A;  3RPU A;  5FFX A;  3W6J B;  1MDM A;  6PAX A;  3EYI A;  1O57 A;  2BGC A;  4MNU A;  3L09 A;  3T0Y A;  3ZMU A;  4EV0 A;  4XLN F;  5LBQ A;  1PP8 F;  2M45 A;  2JSC A;  1ZRC A;  1YLF A;  4KIB A;  3GEZ A;  5H20 A;  3QPH A;  2ETH A;  3DPL C;  2XIG A;  4RGX A;  2CYY A;  1OR7 A;  3L00 A;  5TJJ A;  3IKV A;  5ICC A;  3GVA A;  4RB1 A;  3P7N A;  5DD4 A;  1K78 B;  1XN7 A;  4ON0 A;  5D4S A;  3GFI A;  2EB7 A;  1S6L A;  2E7X A;  1MJB A;  1UFM A;  3DKW A;  4OMZ A;  4WX9 A;  1Z6T A;  3QRF F;  5FD5 A;  5ILV A;  4U88 A;  2VOO A;  3WTW C;  3JAM Z;  1TTY A;  2JPC A;  3JSP A;  3BZ6 A;  2R7D A;  1J7K A;  1FP1 D;  3K1M A;  1W5S A;  4RB0 A;  2K86 A;  2LDU A;  1KYW A;  1G3T A;  1W7P B;  1JXS A;  2F2E A;  2OU2 A;  3PQK A;  4JBA A;  5F64 A;  5D5U B;  2NAZ A;  4ESB A;  3C7J A;  4HLX A;  1HST A;  5DYM A;  3ULQ B;  3TO9 A;  2NS0 A;  4EMS A;  1F9N A;  5D5W B;  2FMY A;  5D4R A;  2FE3 A;  3KZY A;  4P96 A;  4U7B A;  4MQV A;  3IWZ A;  1XGM A;  1RUO A;  3HRT A;  4I7H A;  5L3C A;  3L9F A;  3E6B A;  3K9T A;  3H3Z A;  1HKQ A;  5F1R A;  1CF7 B;  1K78 A;  1IN5 A;  5DUK A;  2W84 A;  3V7S A;  3V7R A;  4XLP F;  1MJ9 A;  4NB5 A;  2Y75 A;  1ZLJ A;  1TW2 A;  2PFB A;  3MWM A;  3VOE A;  1L0O C;  3OV8 A;  2A3S A;  1J75 A;  1OYW A;  2PMU A;  2V1D A;  3F8C A;  2W25 A;  2O3F A;  4OIR F;  1IW7 F;  3WTX C;  2JPB A;  3GZ6 A;  2O6G E;  4HX8 A;  1W7P D;  3E6C C;  4IRI A;  2DTR A;  2EA2 A;  4PGG A;  3GFL A;  1W7P A;  3F6V A;  2YSR A;  2ZKZ A;  1IRG A;  3O6B B;  1BM9 A;  2P8T A;  3LAP A;  1QQI A;  4LK0 F;  4M6Y A;  2FU4 A;  4OIQ F;  3TOB A;  3T1B A;  4HX7 A;  3HHH A;  2A07 F;  1FOK A;  2M1B A;  4BH9 A;  2ADU A;  3V8L A;  4M9Z A;  3VOD A;  2FA5 A;  5D6E A;  2MA3 A;  1JHF A;  5HS8 A;  3J7A O;  2ZCW A;  1YW9 A;  5L3G A;  3GWZ A;  2L54 A;  3DEU A;  2RN7 A;  3I59 B;  1Y0U A;  4YG2 F;  3HSF A;  4OIO F;  2HR3 A;  3TO7 A;  1CF7 A;  3EQL F;  1KQ9 A;  2FXA A;  3T5X A;  1GXP A;  1FBQ A;  1F4K A;  5E1W A;  1FSH A;  1J59 A;  1GVJ A;  1YW7 A;  4YFN F;  4ZZD A;  3F8N A;  3BOQ A;  4H0E A;  2D45 A;  3E3V A;  4M6X A;  1FY7 A;  3W6K B;  1G3S A;  4EQQ A;  1R36 A;  2AXL A;  1Z91 A;  4G9Y A;  4HYE A;  4KN4 X;  2IJL A;  3I54 A;  4Q4Z F;  1XGO A;  2DU9 A;  3PFI A;  2HZT A;  3R60 A;  1U78 A;  3FHZ A;  3F3X A;  3GO5 A;  4P9F A;  2WC2 A;  1SFX A;  1H0M A;  2MH2 A;  1K79 A;  4Y17 A;  4AIH A;  1I27 A;  3WGG A;  2XRN A;  2F5C A;  1ZGJ A;  1W5T A;  2EA4 A;  2GA2 A;  1WQ2 A;  4KUM A;  4GCV A;  3LWF A;  3HRS A;  4O5V A;  1J2X A;  3NQO A;  1YYV A;  2KIF A;  2OBP A;  2W85 A;  1BOA A;  2LF7 A;  5CVV A;  2VON A;  3C3W A;  4G8X A;  5CVI A;  5FGM A;  1REP C;  4U7D A;  5H6Q A;  3KP3 A;  1TBX A;  1YQA A;  1R7J A;  4ENM A;  3F21 A;  3GX4 X;  3ZP5 A;  4CGZ A;  1BIA A;  2MC3 A;  1S7O A;  3IRR A;  3TQN A;  2KKO A;  2EK5 A;  4HBL A;  1U5T B;  2KRF A;  3EYY A;  1RIO H;  3O3K A;  5DCF A;  4EM2 A;  2DLL A;  5E8I A;  4L0Z B;  2HYG D;  4F7Z A;  4Z2Y A;  1SD5 A;  5LGU A;  4LFU A;  3HSE A;  2CO5 A;  3N97 A;  3B73 A;  1S8N A;  4LLG F;  1KA8 A;  3KEQ A;  3T8R A;  4GYG A;  1XDU A;  4G7H F;  4QWQ A;  3QAH A;  1ZG1 A;  1ZLK A;  4OMY A;  2QQB A;  3U9G A;  5ILS A;  3RJP A;  1XMA A;  3F6O A;  4KIF A;  3FZV A;  4YII A;  1Z6R A;  2B0L A;  2FRH A;  5BPI A;  4LB5 A;  5L3D A;  1UB9 A;  3E97 A;  2YPR A;  3QU3 A;  2FBI A;  3HRM A;  4EGZ A;  5LHH A;  3RYR A;  3LFK A;  3IWF A;  2V9V A;  3C1D A;  3ZQ7 A;  2XVC A;  4HW0 A;  1MDM B;  3LA7 A;  3T8T A;  1OKR A;  3SZP A;  1U5T A;  4LD5 A;  5JR3 A;  4IRG A;  5J8F A;  3M9A A;  5DCM B;  4M73 A;  4GXO A;  2D1V A;  3WGH A;  2EFQ A;  1U6G A;  1USS A;  4EJT A;  3LA3 A;  2PI0 A;  4G6D A;  3BP8 A;  2IA2 A;  4CYD A;  3GFM A;  2PN6 A;  3GF2 A;  5E18 F;  4WXC A;  1R1U A;  4ESF A;  5EEG A;  4L0Y B;  2YR2 A;  1ODD A;  5CVU A;  3DXJ F;  3FWE A;  4OOI A;  2WWY A;  1VTN C;  2H6C A;  5FLX K;  1R1V A;  1T38 A;  1LDJ A;  4YFK F;  1IXS B;  2PEX A;  2DQL A;  2E1C A;  2VC0 A;  4R8H A;  5D5V B;  1HKT A;  2HFH A;  4NHJ A;  2EFP A;  2A5Y B;  2KIM A;  4G7O F;  1YW8 A;  3BJO A;  1QPM A;  4LB6 B;  1V4R A;  1Z1D A;  5L3F A;  2X0L A;  5BOX A;  4NQW A;  1LNW A;  5ICE A;  4L5J A;  1BIB A;  4O6J A;  3KEO A;  3RPQ A;  3KET A;  5HLH A;  1PP7 U;  3R61 A;  1K6O A;  3GXO A;  3G3Z A;  3K1P A;  3FXQ A;  1I6X A;  4ASN A;  5DCM A;  4RGS A;  2QEN A;  4IVN A;  1XD7 A;  1UHW A;  5K5O A;  3WU0 A;  2DT5 A;  1BN5 A;  3EET A;  3VEP A;  1R58 A;  1J9I A;  2H27 A;  4KIG A;  2VBW A;  2IA0 A;  4PCQ A;  3M1E A;  5EEH A;  4I98 B;  3BRO A;  2KJB A;  2ZO4 A;  3MCZ A;  4XBF A;  2EFW A;  3Q5F A;  4A6D A;  1BC8 C;  2UZK A;  2P7C B;  2GXG A;  2K7L A;  1XB4 A;  3V7C A;  2A6H F;  1L3L A;  2CGP A;  1TQI A;  1MKM A;  1OYI A;  5AON A;  4JK1 X;  4XRF A;  3EUH A;  1YFH A;  3OOP A;  2D1H A;  1WSU A;  1T39 A;  1F1Z A;  1W4M A;  4UVC A;  1UHM A;  2OZU A;  5ICG A;  4N0B A;  2DBB A;  4IF4 A;  5K5Q A;  3I58 A;  1ZYR F;  2OAZ A;  4A0X A;  2RV8 A;  4LJZ F;  4HDV A;  4BYY A;  3IKT A;  2Q8K A;  3KZZ A;  4IRH A;  5FO5 A;  4EJU A;  2Z9O A;  1SFU A;  1B59 A;  3SXY A;  4BHC A;  3CTA A;  1AWC A;  2A69 F;  5TRD A;  1P4W A;  2O61 A;  3IC7 A;  4I0A A;  2R7F A;  2QYO A;  1JGS A;  5A2Q Z;  2PLY A;  3QOP A;  3J81 Z;  1QGP A;  2A6E F;  2XAG A;  4G94 A;  2VE8 A;  3SHF A;  5BPD A;  1DPR A;  3G73 A;  1E17 A;  1EH7 A;  3J80 K;  3KLN A;  1MGT A;  4U0W A;  2DW4 A;  3GYH X;  1LDD A;  3E5U A;  2QM3 A;  1TLH B;  5HS7 A;  2CFX A;  4IHT A;  3DP7 A;  2VT3 A;  3WE3 A;  4EJO A;  4A0Y A;  5HVQ C;  1XCV A;  5LRS A;  3NEU A;  3SQN A;  2HQN A;  3IRQ A;  4LLN A;  3R6S A;  3JSO A;  5DD8 A;  3WTV C;  4UHT A;  2Z33 A;  4WXD A;  1KU9 A;  1ON1 A;  2HDC A;  1R1T A;  2XAJ A;  5K1Y A;  4UUV A;  1V3F A;  1SMY F;  3HYI A;  1ZGA A;  3O2P E;  2EV6 A;  2HKX A;  2XAH A;  1T2K A;  3CJN A;  2IP2 A;  4LMY A;  2GZW A;  1TQP A;  1BC7 C;  2F5E A;  3R4K A;  3RKY A;  2XAS A;  1KQ8 A;  2EJR A;  4HF0 A;  2L3D A;  5L3E A;  1ZRE A;  2E1N A;  2NNY A;  3AAF A;  3RKW A;  5E17 F;  3P9K A;  3BJA A;  4TV7 A;  2UWM A;  2CWE A;  3CO7 C;  2R3S A;  1HKS A;  1C0W A;  1XCB A;  2OA4 A;  1XGS A;  5ERI A;  4EM0 B;  3CO6 C;  2Z3Y A;  1FWZ A;  3ABU A;  1HQC A;  4CIC A;  5E1X A;  3ROU A;  2GAU A;  3HHG A;  3QU6 A;  1JE8 A;  4Y15 A;  1ZHF A;  1WI9 A;  4Q48 A;  4CXF A;  4HA8 A;  2ESN A;  5HLI A;  4AD9 A;  2P4W A;  5JI6 A;  1ZG5 A;  2XKO A;  2QLZ A;  5A2Q K;  2HGC A;  4I02 A;  5JVT A;  3J81 K;  1SD7 A;  2MH9 A;  1O3R A;  4IJA A;  5L3B A;  1O7L A;  1U5T C;  2XKP A;  3GW2 A;  2NRA C;  2FNA A;  1I1S A;  5ILU A;  2XGX A;  1O3Q A;  1FX7 A;  1ULY A;  1G3W A;  4WWC A;  4RS8 A;  4CHU A;  4MGR A;  1XSD A;  1FNN A;  4I2O A;  2XRO A;  2DQR A;  2M8E A;  2HOE A;  3TKY A;  4PGH A;  1BI0 A;  3TO6 A;  5LEJ A;  2EFN A;  4BAY A;  2HKO A;  3V4G A;  1J0R A;  5LGN A;  2STW A;  2IVM A;  4S04 A;  2VBX A;  1B6A A;  2OD5 A;  4MEY F;  4R79 A;  4P9U A;  4LG0 B;  3I5U A;  1R00 A;  3ISP A;  2XAQ A;  4O3M A;  1YS6 A;  4A2U A;  5LEK A;  5FLX Z;  4B8X A;  4Y13 A;  5FFZ A;  2IPQ X;  1H9T A;  1DP7 P;  2FBK A;  3QP5 A;  3RIR A;  3FXU A;  5HLG A;  3E6D A;  4L9J A;  1FYM A;  3E6M A;  1G6N A;  1ZH5 A;  3ZMS A;  3VB2 A;  2TDX A;  2LNB A;  1YO5 C;  1CGP A;  4EVI A;  1QZY A;  1S7A A;  5E1Z B;  2JT1 A;  4EJW A;  3F23 A;  1F5T A;  2LSO A;  2H09 A;  2RKH A;  4G6Q A;  1ON2 A;  2L02 A;  4S05 A;  4MTD A;  3FMQ A;  3B02 A;  4ZZL A;  3KLO A;  3HSR A;  4HF2 A;  4UVA A;  1EH6 A;  4OIP F;  4ZYE A;  5J6X A;  4EJV A;  5BQT A;  4M9S A;  4RB2 C;  3WG9 A;  2V6C A;  4IPA A;  2K02 A;  4LG0 A;  1J5Y A;  3DV8 A;  4BHP A;  3K69 A;  2G9W A;  3WTZ A;  2OZ6 A;  4D0P A;  2DPD A;  2RQP A;  1PDN C;  3L7W A;  2M5W A;  4KYW A;  2DK5 A;  4DQ2 A;  2E7W A;  2HEO A;  2UXN A;  3V8J A;  2V79 A;  4IHS A;  3VFZ A;  3CLO A;  2FML A;  3DF8 A;  5IT9 Z;  4XSZ F;  4E70 A;  3S2W A;  4UNO A;  3MEX A;  2IRF G;  4KFC A;  1SFE A;  1BI1 A;  1RUN A;  2GA1 A;  2ISY A;  1U3E M;  3HRU A;  2QVO A;  2ZNZ A;  4ENK A;  2BV6 A;  1P2F A;  1D8K A;  3ZMZ A;  3FMS A;  3FF5 A;  3U1D A;  1LVA A;  3JW4 A;  5D8L B;  1IN8 A;  3ZMD A;  5D8K B;  4L9T A;  2DI3 A;  4EM1 A;  3F72 A;  2QWW A;  2HTJ A;  3NRV A;  1ZRF A;  2Q2E A;  3KFW X;  4KA4 A;  1IXR C;  4L9V A;  5DEQ A;  4GYI A;  1TW3 A;  1LB2 A;  2VE9 A;  3ZMV A;  3TDU C;  2QBY B;  4GGG A;  1LEB A;  4RGU A;  1ZAR A;  4M74 A;  1YIO A;  1O3T A;  5E20 A;  3RYP A;  3J80 Z;  1WWX A;  1FYK A;  4HZF A;  1EV7 A;  2O03 A;  1IN7 A;  2L4A A;  1MJA A;  2VXZ A;  2COM A;  1KU7 A;  4YFX F;  2FF4 A;  2EFO A;  1P92 A;  3I64 A;  4I0B A;  2QUF A;  3K0L A;  3BWG A;  4CDG A;  2BE5 F;  5JHU A;  3M8E A;  3HTU A;  2UXX A;  1UCR A;  1U2W A;  4KT5 C;  3R0A A;  2DAO A;  2WV0 A;  3WTY C;  3DPT A;  1FPQ A;  4A12 A;  4RGR A;  2L4M A;  2P6T A;  3ZMT A;  4HDU A;  5DV5 A;  3CUQ B;  2M87 A;  2P7V B;  1SAX A;  1FYL A;  2HTS A;  1BI3 A;  1RZ4 A;  2KIU A;  3ERE D;  1FBS A;  4UV8 A;  4WXH A;  1R5H A;  2PQ8 A;  1HBX G;  4PZJ A;  5LHI A;  1QNT A;  3GUD A;  3KP6 A;  3P9I A;  2A61 A;  4RAZ A;  4WF2 A;  4U0Y A;  3KP5 A;  2H6B A;  1FBU A;  1OMI A;  2QBY A;  3BDD A;  5IT9 K;  2HS5 A;  4AWX B;  2O8X A;  1X3U A;  3F8F A;  2FQ3 A;  1IXC A;  1KQ0 A;  4RB3 C;  1XDS A;  2KJC A;  5CVR A;  3E5Q A;  4AIK A;  5D6F A;  2PG4 A;  4OIN F;  2JZY A;  1IN4 A;  2F5F A;  3ZPL A;  2V1X A;  5HDG A;  1WRJ A;  3N4M A;  4HLY A;  5DUI A;  1WKM A;  1OYY A;  4MEX F;  1MZB A;  1XGN A;  4ESJ A;  4JQF A;  3QPT A;  1A04 A;  2FOK A;  2ZBK A;  2VOD A;  1S29 A;  2STT A;  3RKX A;  1ZAO A;  3SFZ A;  4L5I A;  3I71 A;  2QZ8 A;  1I5Z A;  1RNL A;  2CSO A;  5D5X B;  2FBH A;  3COA C;  2QQA A;  4HX4 A;  1BJA A;  2GQQ A;  1DPU A;  5ED4 A;  3I0T A;  4WCG A;  2VBY A;  1R22 A;  3CUQ A;  2GWR A;  1D8J A;  2ZXJ A;  3CDH A;  3HOT A;  5F6F A;  5HS9 A;  2OQG A;  2Q0O A;  4KIC A;  1Z05 A;  2Y0M A;  1RI7 A;  1STZ A;  1Z7U A;  1S3J A;  2HWV A;  1TNS A;  3BPX A;  3WU1 B;  1XSV A;  4Q47 A;  3I4P A;  1LJ9 A;  2HYF A;  4G7Z F;  1P6R A;  1Q1H A;  3WTS C;  4WK8 F;  3LQQ A;  1ZN2 A;  2PMH A;  4ETS A;  3MFK A;  4BNC A;  1OPC A;  3FMR A;  4BQA A;  2VBZ A;  1UST A;  4ZYD A;  2VC1 A;  3BJ6 A;  3MZH A;  1GXQ A;  2A68 F;  4HV6 A;  1D5V A;  5FB2 A;  2AS5 F;  1FC3 A;  1HW5 A;  4I01 A;  5LGT A;  1FLI A;  1T0F A;  2LF8 A;  2GXB A;  4KDP A;  3RI4 A;  3K1N A;  2ACJ A;  2RVC A;  5CLS A;  2ESH A;  3ZN1 A;  3Q9V A;  3E5X A;  3WE2 A;  5H6R A;  1LEA A;  1IAW A;  5LHG A;  2L01 A;  3MAJ A;  1YG2 A;  1FSE A;  5AIQ A;  2V1U A;  2ZME B;  3LA2 A;  3D0S A;  2BBY A;  2ELH A;  3D5L A;  1YS7 A;  1DDN A;  2CQK A;  3FXR A;  2DK8 A;  2XAF A;  4GO1 A;  3ELK A;  2Z99 A;  1P4X A;  1R5G A;  5IT3 A;  2MBF A;  3H3U A;  2VN2 A;  4HOB A;  4DNC A;  3IL2 A;  3FX3 A;  2JTV A;  2YX4 A;  3GFJ A;  4A0Z A;  2X4H A;  2G7U A;  5HDN A;  3ECO A;  2HQR A;  1KU3 A;  3JAM K;  2C6Y A;  3KCC A;  2EV0 A;  2K4J A;  2DFI A;  2G7H A;  2LKP A;  4U0V A;  2FSW A;  1B1B A;  5BS6 A;  4FT8 A;  2W24 A;  3ABT A;  2W57 A;  4EGY A;  2IA1 A;  2YX7 A;  2RGV A;  2BYV E;  3ZN0 A;  1NHA A;  5J8C A;  3ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...