1K7AA

Ets-1(331-440)+ggag duplex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*GP*TP*GP*CP*CP*GP*GP*AP*GP*AP*TP*GP*T)-3')
publication title Structural studies of Ets-1/Pax5 complex formation on DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1k7aA00
2GXBA 3QP6A 5EEHA 2EK5A 3TKYA 3ZMVA 4P5OA 4Q4ZF 1WRJA 2HS5A 1FPQA 3KP4A 2VONA 4IHSA 5ILVA 2H94A 4L5IA 2FE3A 5FD6A 1XCBA 4A5NA 4LB5A 3WTUC 1ZG5A 3I64A 4U7DA 1RNLA 5E1WA 3RYRA 4RB2C 4A6DA 3P9IA 3HHGA 4MTDA 1IN8A 5E20A 4HQMA 1HSTA 3BPVA 4GYGA 3GLXA 2AXLA 1MGTA 4KT5C 3ML6A 3LA3A 1FY7A 4Y17A 5CVJA 1S29A 2FRHA 4A0YA 1R7JA 1XDSA 2OU2A 2XKPA 3TGNA 1OYYA 1CF7A 3E6BA 3SZPA 3LSTA 1BJAA 2FNPA 3RIRA 2IA1A 5ILUA 1ZLJA 1XD7A 5H20A 1W7PB 5BOXA 3F23A 4MEXF 3IWFA 3GEZA 1G3YA 2LF8A 2HWVA 3M8EA 4EJVA 3U1DA 3RJPA 2KRFA 5L3EA 4BYYA 4NB5A 4EM2A 4HV5A 3OOPA 1BC7C 3MAJA 3RPQA 5K5OA 3JSOA 1ONVA 2MD5A 4EJUA 2KIMA 2RC4A 1KU7A 1H9GA 5L3GA 5JR3A 1YIOA 4M72A 5JHUA 3Q9VA 2YX4A 1B59A 1HQCA 4M73A 2VC1A 2P6TA 3L00A 3WE3A 4IRHA 3CUOA 3JAMK 2IJLA 5FGMA 4ZYGA 1R1UA 1QPMA 1Z05A 4HZFA 4M9SA 3HRUA 1LNWA 1ZAOA 2P7CB 1FLIA 3IL2A 2R3SA 2GWRA 3F72A 4Y15A 4M9ZA 5J8CA 4BH9A 5A2QZ 4BHCA 4WF2A 4HLYA 2VXZA 4GCVA 2ZJ2A 1G3WA 4XSXF 4MTEA 4YIFA 2VODA 1XMAA 3GVAA 3FXRA 2KJCA 1KU3A 3FXUA 2JPBA 5KK1A 5IT9Z 3LAJA 1SD7A 2F5DA 2Z5UA 2EFOA 2NNNA 2PMHA 3TQNA 1EH6A 1F9NA 1HSJA 4IPAA 2VBWA 5HDNA 2ETHA 1BBYA 2DAOA 1XDUA 4GO1A 3ZN0A 3COAC 1R23A 5J6XA 3RI4A 4Q5SF 2XAFA 1U2WA 4A2UA 5L3DA 2A68F 1F4KA 2IT0A 4HDVA 2P5KA 2ZNYA 2P5LC 3S2WA 4EMSA 4U88A 2A69F 1IW7F 5D6FA 4KIGA 1J5YA 2STWA 2W84A 1KQ9A 1R22A 3P7NA 4DNCA 4L0YB 2XAJA 3QRFF 1RUOA 1BIBA 2DPUA 1EH7A 3D5LA 5CJ9A 1B4AA 4IRIA 2FQ3A 2CO5A 4EJOA 3CUQB 1BN5A 1XGOA 2PEXA 4YIIA 1X3UA 4E70A 1KA8A 3BOQA 2BE5F 5LGNA 3GX4X 1R1VA 1GVJA 1JE8A 1UB9A 2HQRA 4N0BA 1YS6A 5BPDA 2EB7A 1O3RA 2MC3A 1D5VA 2A6HF 3MQ0A 3F8NA 3H92A 3TO6A 1XSXA 4KUMA 1BIAA 4KMFA 1IN7A 3WTSC 1ZN2A 1YO5C 3QOPA 1G3TA 4JQFA 1U3EM 1XGNA 2JSCA 2PG4A 3W6JB 2RVCA 4HX4A 2G9WA 3ROUA 4WK8F 3ZMTA 3J80K 2H6BA 2XKOA 4RAZA 4YFNF 1QO0D 2E7WA 2PN6A 2RNJA 4OMZA 2F5EA 2IW5A 3GO5A 2QWWA 2A5YB 5DCMA 2EV6A 1BI0A 2Z9OA 2ZMEB 1QBJA 4L9VA 2UWMA 3WE2A 5JVTA 3R0AA 1HBXG 3VB2A 1FBUA 1WKMA 1ZARA 3U9GA 2HOEA 4ZYHA 4GGGA 1STZA 5HDGA 2VN2A 2FNAA 2CGPA 4EV0A 2H6CA 4G7OF 5D4RA 1U6GA 3M7GA 2ELHA 4NQWA 3ERED 5D8LB 4CO8A 1T39A 4HDUA 5HLIA 2QBYB 2QZ8A 3AAFA 3C18A 3GYHX 3LQQA 2OBPA 1W5TA 4QWQA 2E1NA 4WXCA 1LEBA 3I59A 3DP7A 3FMQA 1H0MA 3LFKA 3WTZA 2XAQA 1JGSA 2L01A 2HGCA 1SFXA 5H6QA 2KIUA 4CICA 3HSEA 3FMRA 5EEGA 4RGUA 3Q9SA 3QAHA 1LQ1A 3M1EA 1XCVA 5CVIA 2W85A 4P96A 2PI0A 4FX0A 4UV8A 2JT1A 5ICCA 3MWMA 3FZVA 1FP2A 3BDDA 3J81Z 2IVMA 1U5TB 5HS8A 3F6VA 1S8NA 3QP5A 2ZFWA 2DTRA 3RYPA 3DKWA 3KP3A 3ABTA 2EFPA 1MKMA 2NS0A 3RDIA 1KU2A 4AIJA 3JTHA 1LEAA 1TNSA 3R61A 1SD5A 1BM9A 4HV6A 3GFIA 4EJWA 1NHAA 4I0AA 4AD9A 3FHZA 2V1DA 1G4DA 2G7HA 4RB1A 2Y48A 4K2EA 4ASNA 4PDKA 4UUVA 1B9MA 3GW2A 5DV5A 3BZ6A 5D5XB 1P4XA 2PBIA 2QQAA 1IN6A 3E3VA 4HOBA 2Y75A 1IUYA 4HLXA 2XIGA 4G94A 4H0EA 2PJPA 5D5UB 3BJAA 4RS8A 1HXDA 4G9YA 2RGVA 5CVRA 2COMA 3DEUA 2B0LA 2PQ8A 1FP1D 3CUQC 4ETSA 3LA2A 5JFRA 1K78A 2KIFA 4UVBA 1F1ZA 4AIHA 1AOYA 3E6CC 2E7XA 2Z3YA 4OU0A 3V8LA 2FSWA 3KETA 2CQKA 3CO7C 1T98A 1J9IA 3WTVC 4LLNA 1FC3A 4HF2A 4L9TA 1MD0A 2Z33A 1DP7P 4L18B 1W7PD 4HF0A 1IRGA 4Z2YA 4RB0A 5ED4A 2ZBKA 1TQMA 4WWCA 3ELKA 2LDUA 4KFCA 5L3BA 5CVVA 2QVOA 4L9JA 3L7WA 2QLZA 3ULQB 4JK1X 2W57A 3U2RA 2J5PA 1OPCA 4O6JA 2NNYA 3IWZA 3KE2A 4BQAA 1J7KA 3KFWX 2ISZA 1DPUA 4R1HA 3O2PE 2VBYA 3HYIA 1ZHFA 3IKTA 1XN7A 4CYDA 1YYVA 3SXYA 4R8HA 2WV0A 1YFHA 3L9FA 4HX7A 3TOAA 3BY6A 1R5HA 3C3WA 4I01A 3TDZC 4ESFA 1SAXA 2R7DA 1B1BA 1CF7B 1GXPA 1IN4A 1UHWA 4M6YA 2EA4A 3O6BB 3PQJA 2IA2A 1TLHB 4CHUA 1QGPA 2FU4A 2OAZA 5E1ZB 1YW8A 5TRDA 3WTTC 2P4WA 4ESBA 2KKOA 2V9VA 2RDPA 4N9HA 1YQAA 1JHHA 5D5VB 3T0YA 2QENA 3KP5A 5FLXZ 2O61A 2Q2EA 3QPHA 5D5WB 1FBQA 3B02A 3E5XA 3QPTA 1W5SA 3GFJA 2DT5A 3WTYC 4L5JA 4OIOF 1D3YA 1FOKA 2O03A 1FBSA 2XVCA 2VC0A 2L4AA 4CDGA 1BI2A 3VOEA 1TW3A 1P92A 2MH2A 2ZKZA 1LDJA 1F5TA 2FXAA 1SMYF 2TDXA 5F1RA 4LG0A 1ODDA 4UHTA 1O3SA 3LA7A 4MEYF 4KN7X 3VFZA 2UZKA 1ZLKA 2W24A 4NHJA 5BPIA 1U5TC 3F21A 2ESHA 1RI7A 3F8CA 1V4RA 2GZWA 2GAUA 4RB3C 4QLCU 2P7VB 1SFEA 4RGXA 3ECOA 2YPRA 3RKXA 4ZZLA 3LQRA 3HRMA 4FT8A 3KLOA 1P4AA 1GHCA 5IT3A 3WGIA 2WTEA 3F22A 2DLLA 4G6QA 1ULYA 2MH9A 2QUFA 3OV8A 1EV7A 3HOTA 3L09A 2IP2A 2HTJA 4ZZDA 3WG9A 1HKTA 1T38A 4IVNA 3GZ6A 2VBXA 2YR2A 4GYIA 1ZG1A 1IZ1A 1CGPA 2PLYA 4CZZA 5ILSA 1FWZA 2IA0A 1WWXA 1IAWA 2CW0F 3FF5A 5LRSA 2M1BA 2OD5A 1O7LA 3DF8A 4OIPF 2DW4A 4HW0A 2EWNA 2XASA 1OYWA 4XBFA 2DQLA 3SQNA 4ENJA 4CXFA 1SMTA 4UVAA 2WC2A 1R5GA 2UXXA 1FZPB 3KP2A 4DQ2A 2K4JA 4IJAA 2FEZA 1FNNA 2PMUA 4ESJA 1YTYA 2NRAC 1ON1A 5LLQA 4OIRF 2K02A 4HBLA 3PFIA 4FHTA 2CSOA 2K27A 3CUQA 4BNCA 3ZMSA 4BAYA 2LSOA 3DPLC 4I7HA 2Z99A 1KU9A 4S05A 3GZ5A 2BGCA 4EGZA 2AS5F 3ISPA 1XSVA 2DPDA 3LAPA 4UVCA 4XRFA 4RAYA 5AIQA 4XLNF 1ZGJA 1ZYRF 3E6DA 1Y0UA 3IKVA 4HX8A 3I58A 4D0PA 4LLLA 2M8EA 2O6GE 4PGGA 2XROA 3FWEA 1O3TA 4YG2F 2L02A 4M74A 4A12A 3V4GA 1TW2A 1MDMB 2VOPA 1OR7A 4BXUA 3M9AA 3R4KA 4P55A 1KYZA 4KMUX 5LGUA 3HRSA 1LDKB 1WI9A 1J2XA 4I98B 4G7HF 3T8TA 2DU9A 1TBXA 3N4MA 3E5UA 3K9TA 5TJJA 2HYGD 2XRNA 3WGHA 1FT9A 3MZHA 4P9FA 3DPTA 4IRGA 2CG4A 4HQEA 2YU3A 3RKYA 4PZJA 2NAZA 3R0JA 2A3SA 5DCMB 3ZMUA 1D8KA 1USSA 6PAXA 5HOOA 1ZH5A 5LBQA 2DK8A 4G7ZF 3N97A 5LEKA 2IRFG 1JXSA 2RQPA 5DUKA 5BMZA 1ZRFA 4G8XA 4OOIA 3IHUA 5K5QA 4KIFA 3H3ZA 2DK5A 1FYLA 3WTWC 2R7FA 3J7AO 3V8KA 3K2ZA 3HOSA 5LEJA 1XMKA 2FBKA 5J8FA 1DDNA 2XAHA 5A2QK 4KN4X 4MNUA 1XB4A 3Q5FA 4FX4A 3R6SA 2EJRA 3EYIA 3KLNA 4LJZF 1I6XA 3RKWA 4U0VA 5E8IA 3F8BA 3F3XA 1I1GA 5IT9K 2CWEA 4GXOA 2V6CA 1P2FA 1AWCA 3FM3A 1B9NA 3GFLA 2HEOA 4HAMA 5L3FA 4A0XA 1FX7A 3VODA 2A61A 2EFNA 3M8FA 1FYMA 1U5TA 3BJOA 1Z6TA 2Q0OA 4L9NA 3RPUA 2PFBA 2NYXA 3JAMZ 5H6RA 1RZ4A 1O7FA 3NQOA 2VE8A 1R36A 1WSUA 3E5QA 3MZYA 1BOAA 4EQQA 1A04A 2RN7A 2GXGA 2P5VA 3CJNA 3VEPA 5LGTA 3CO6C 1TNTA 3ZN1A 1JHFA 3E6MA 1PUEE 4A0ZA 1E17A 3KZYA 3KZZA 5CVUA 1K79A 2D1VA 3MFKA 5CYVA 5DEQA 5FB2A 2F5CA 1J0RA 2JRTA 4OIQF 4KDPA 2V79A 2EV0A 4UNOA 3P9KA 4LD5A 3DXJF 5ICEA 4LMYA 3HIFA 2ACJA 3GWZA 3ECHA 2OQGA 1RIOH 3REOA 1YW7A 2X4HA 3IRQA 1UCRA 4ON0A 5JI6A 2XV4S 3I54A 4EM0B 4IHTA 2QM3A 4EM1A 2XGXA 3K1MA 1K78B 1P6RA 2E1CA 5DYMA 4BHPA 2XUBA 2LF7A 1HKQA 2ZO4A 3QU3A 4WXDA 5F64A 2STTA 1Z91A 4EJTA 4OMYA 3B73A 4ZYEA 2EA2A 3GFMA 3KP6A 3I0TA 4XSZF 5BS6A 2F2EA 1HW2A 3I5UA 2JTVA 5HS9A 1XSDA 1SFUA 1BI3A 3I53A 4S04A 3EDPA 1Z6RA 2UXNA 5FD5A 1O3QA 4N9IA 2J5OA 1REPC 3F8FA 1R1TA 3FX3A 1ZREA 2FMLA 5CLSA 3HRTA 3NEUA 3SFZA 2DI3A 3H3UA 4A6EA 4M71A 1O57A 2DQRA 4O3MA 2HR3A 3HHHA 4PCQA 1YW9A 1R58A 1ZG3A 1QNTA 3D0SA 4ZYDA 1W7PA 5DCFA 2EFQA 2ZCWA 1B6AA 5LHIA 2QQBA 2V1XA 2D1HA 3IC7A 4L0ZB 3KEQA 1S7OA 3J80Z 1S7AA 2L4MA 3KP7A 1LJ9A 1DUXC 2OQRA 1IF1A 4U0WA 2XAGA 1ON2A 2W25A 4HF1A 2D45A 3V8JA 1HW1A 3ZMDA 1PDNC 3LWFA 1LB2A 2HKOA 1UHMA 2CFXA 1VTNC 1G3SA 4Q48A 1TTYA 2BBYA 3BROA 4O5VA 3J81K 1BC8C 3NRVA 1LDDA 4IF4A 4KICA 2Q8KA 4KYWA 2KJBA 4LB6B 4LG0B 2HDCA 1C0WA 4A5MA 3K0LA 4JBAA 4Y13A 1ZRDA 1OMIA 2HQNA 2HTSA 2DO7A 2MLKA 3EYYA 2BV6A 1EH8A 2P6SA 3ZP5A 2O0YA 3P9CA 2QQ9A 1OKRA 3TO9A 1KQ0A 2HZTA 3FXQA 3F8MA 4WX9A 1R00A 3ZPLA 1I5ZA 4TV7A 3W6KB 2Y0MA 5AONA 1PP7U 2LNBA 4MGRA 3BJ6A 1Q1HA 5LRRA 3GXOA 3HUGA 1WQ2A 1KQ8A 3RTRA 3F6OA 5ICGA 3DFGA 3JW4A 3V7SA 4AIKA 2VT3A 2G7UA 2MLGA 4EGYA 5DDGA 5ICFA 2YX7A 1FSEA 3C7JA 2M5WA 4Q47A 4HA8A 2FBIA 4F7ZA 2K86A 1U8RA 1T2KA 4PGHA 1S3JA 4AVPA 2O8XA 3WU0A 1UFMA 4WCGA 3WU1B 1DPRA 3JSPA 2D2WA 2GIVA 1KGSA 4I09A 3HTUA 5KVRA 3ZMZA 3EUHA 3GUDA 5HDKA 1QQIA 1IXSB 3EETA 2C6YA 3CTAA 3SZTA 4ENMA 1TQIA 1HKSA 2MBFA 1SD6A 4B8XA 3BPXA 2YSRA 2P8TA 2FF4A 5E1XA 2EV5A 2DBBA 4B09A 4AWXB 4OINF 1D8JA 1J75A 2M87A 5E8GA 2FOKA 4LLGF 1MJAA 1S6LA 4ZH4F 1P4WA 5D6EA 2VOOA 1L0OC 5D4SA 2V1UA 2M30A 2A07F 1TQPA 3IRRA 1PP8F 1HW5A 2O3FA 3ABUA 1FSHA 1XGSA 1MDMA 3KCCA 2OZ6A 4BHBA 5BQTA 4M9XA 2WWYA 1T6SA 2JPCA 4ENKA 1YG2A 3FMSA 1ZRCA 3KEOA 2VBZA 5K5RA 1FYKA 4I0BA 3CLOA 3HTSB 1W4MA 2HYFA 1I1SA 3I4PA 2JZYA 5K1YA 3JTGA 3QU6A 3MEXA 5FLXK 2XHKA 3C1DA 3WTXC 4CGZA 3SHFA 2ESNA 3TO7A 2ZMEA 2IPQX 2H27A 3DV8A 5DD4A 1J59A 2EFWA 5D8KB 1L3LA 4I02A 2VE9A 3PQKA 2OZUA 1MJBA 1Z1DA 3TDUC 2FA5A 1I27A 2BYVE 2VT2A 4U0YA 4UV9A 4WXHA 2ISYA 1U78A 5E18F 2RV8A 4HYEA 1YS7A 2QBYA 4MHGA 4YFKF 2DFIA 2ADUA 1K6OA 5E17F 5L3CA 2BEOA 3WODF 3T1BA 3EQLF 3TOBA 1MJ9A 3R60A 3BP8A 3I59B 2MA3A 1ZGAA 2L54A 2X0LA 3I71A 2LKPA 1Z7UA 4LFUA 3V7RA 4LK0F 4I2OA 4ENNA 4LK1F 1QZYA 3T8RA 1K7AA 2A6EF 3HSRA 1KYWA 3GF2A 2K7LA 3L2CA 5DUIA 4MQ9F 1E2XA 5HLHA 2F5FA 2GQQA 1YLFA 1SD4A 5FO5A 2FMYA 3K69A 2M45A 5HLGA 2H09A 3V7CA 1T0FA 2RKHA 4RGSA 5AIPA 1H9TA 1RUNA 2FBHA 4YFXF 3G73A 4MQVA 2ZNZA 1IXRC 2HFHA 1USTA 4KA4A 5ERIA 3G3ZA 5HS7A 5LHGA 4M6XA 5F6FA 5DD8A 2GA1A 1Z9CA 3CDHA 3MCZA 3WGGA 4UXNA 1MZBA 1V3FA 1OYIA 3O3KA 2ZXJA 1GXQA 1G6NA 4U7BA 2K4BA 2GA2A 2OA4A 3ZQ7A 4G6DA 4KNYA 4IXAA 4EVIA 4LGWA 4P9UA 1IN5A 3BWGA 4XLPF 2HKXA 1IXCA 5FFXA 4KIBA 1XGMA 5HVQC 1BI1A 1QZZA 5LHHA 3K1NA 5FFZA 3E97A 1LVAA 2CYYA 2QYOA 3HSFA 4R79A 3DQVC 3FM5A 3K1PA 3T5XA 4RGRA 1IRFA 2L3DA
chains in the Genus database with same CATH superfamily
2GXBA 3QP6A 5EEHA 1FIPA 2EK5A 3BR2A 3TKYA 3ZMVA 4P5OA 4Q4ZF 4PJMA 4HNVA 4M3BA 1OISA 4A3EJ 5TISC 1WRJA 2HS5A 5E79C 2R7QA 3BCAA 1FPQA 4F91B 5FRNA 1HOMA 3KP4A 2VONA 3LSIA 4IHSA 5ILVA 2H94A 4L5IA 4M6VA 2K9SA 2FE3A 5FD6A 2GLOA 2R7WA 4V2GA 3QODA 1XCBA 4A5NA 3DPUA 2WAFA 4LB5A 3OOUA 3WTUC 1ZG5A 3I64A 4U7DA 1RNLA 5E1WA 1ZK8A 1UHSA 3RYRA 4RB2C 2QCOA 3NWTA 3DBLB 4A6DA 2BOLA 1MW7A 3HHGA 3P9IA 4MTDA 4ANJA 1IN8A 4XICA 5E20A 4HQMA 1HSTA 3BPVA 2ZJPF 4GYGA 4J19A 3GLXA 2IGKA 1NK3P 2AXLA 1MGTA 2VKDA 2DOEA 4C3HJ 4KT5C 3ML6A 3LA3A 1FY7A 1WPKA 2FX0A 4Y17A 3OYAA 4XR6A 5CVJA 3OWTA 1S29A 2FRHA 2EQRA 4A0YA 1K83J 1R7JA 3KX2A 1XDSA 2OU2A 2XKPA 3DLAA 2MD0A 2V6EA 1XC5A 5K7ZA 3TGNA 1F36A 4AYBA 1OYYA 1CF7A 3E6BA 3PFYA 3SZPA 2EZHA 3FISA 3LSTA 5K7FA 1A35A 1BJAA 2JUCA 1MBHA 1WVRA 2FNPA 3RIRA 1XG1A 2IA1A 5ILUA 5EF6A 2R93J 1ZLJA 1XD7A 4UY8I 5H20A 2IS4A 1W7PB 5BOXA 4A3IJ 4XM3A 3F23A 4MEXF 2WADA 3IWFA 3GEZA 1G3YA 2E2IJ 3HOYJ 2LF8A 2HWVA 4YIRX 1OCTC 3M8EA 4EJVA 1WZ2A 3U1DA 4MO7A 3BQZA 3RJPA 3A4CA 1TWAJ 2KRFA 5L3EA 4BYYA 2R4GA 4ABZA 2V26A 4NB5A 2TCTA 4EM2A 3GTJJ 1K4SA 1MBKA 4MLOA 4HV5A 3HKZA 3PL8A 2K3FA 3OOPA 1BC7C 1WJFA 3MAJA 3RPQA 5K5OA 3JSOA 4IO9F 1IG7A 1ONVA 1DQUA 2X9DA 4BDYA 2VLAA 2M8GX 2MD5A 4EJUA 5IP7J 3RKQA 3RSNA 2KIMA 5M5XJ 2RC4A 1KU7A 3ESWB 3A0HC 1H9GA 5EG0B 5L3GA 5JR3A 1YIOA 3FKJA 4QPOA 2AQEA 4IHWA 3ASNH 4M72A 1I3AA 4IKFA 2RQQA 5JHUA 3NARA 3Q9VA 2YX4A 1TWCJ 4MIMA 1B59A 1RKTA 1R4NB 1HQCA 3HDDA 4M73A 2VC1A 4BEHA 2P6TA 3ASOH 3L00A 3S17J 3WE3A 4J00A 4IRHA 3CUOA 1X19A 3G6EI 1WGXA 3JAMK 1FEXA 2IJLA 5FGMA 4ZYGA 1R1UA 2O9LA 4CCMA 3KIOA 1QPMA 1Z05A 3ZQFA 4HZFA 4CUGA 2R5YA 1UG2A 2VJJA 2CQXA 4M9SA 3HRUA 2DFFA 2LK2A 1LNWA 1ZAOA 2P7CB 3BQYA 3CQZJ 1MSFC 3IL2A 2R3SA 1FLIA 2GWRA 1I39A 3F72A 4Y15A 4E4HA 4M9ZA 5J8CA 4BH9A 5A2QZ 4BHCA 4WF2A 1Y0NA 4II3A 4HLYA 2VXZA 4GCVA 4BE0A 2ZJ2A 1G3WA 4XSXF 4MTEA 4FASD 4YIFA 2HU9A 2VODA 5B66C 3K6GA 1MMGA 4YELA 1XMAA 3GVAA 4C30A 4PJLA 1MSEC 3FXRA 5B1AH 3OYKA 2QA4I 5IPAA 2KJCA 1KU3A 3FXUA 2W1OA 2KFDA 3MKZA 2JPBA 5KK1A 1VQ7I 5IT9Z 3LAJA 1QRYA 3BT9A 1T33A 3CF5F 1SD7A 2F5DA 1JGGA 2Z5UA 1IRZA 5GPCA 4LG3A 4KITB 1K6YA 2DTZA 4BXXJ 2EFOA 2NNNA 5B1BH 2PMHA 3TQNA 1EH6A 1F9NA 1HSJA 4IPAA 2VBWA 5HDNA 2ETHA 2MC4A 1BBYA 1HDDC 3LNQA 2W00A 2DAOA 3U1KA 1DP3A 1XDUA 2CQNA 4L5EA 4GO1A 3ZN0A 2G0EA 3COAC 1Z67A 1BL0A 2IS6A 2Y2ZA 3JRFA 1R23A 4II2A 3IP4B 1ACIA 4UUSB 2MW8A 2WAQN 5J6XA 3RI4A 4Q5SF 1BJZA 2LC2A 3WG7H 2XAFA 1U2WA 3BLYA 1BW6A 4A2UA 5L3DA 2A68F 3SDGA 1F4KA 2M4GA 2IT0A 4HDVA 2P5KA 2ZNYA 2P5LC 1SVLA 3S2WA 2ID3A 3DU6A 1UJ8A 4EMSA 4U88A 1OJLA 3FIWA 2A69F 1IW7F 1X2NA 3DBHB 4KIGA 1P7IA 3BR1A 5D6FA 1J5YA 2HOSA 2VASA 4FISA 2STWA 2W84A 1KQ9A 1R22A 4Y33A 5J47A 1PUFA 3P7NA 4DNCA 4L0YB 2XAJA 3QRFF 2W7NA 1RUOA 1BIBA 3RQIA 1AA7A 1R4MB 1S72I 2DPUA 1EH7A 2DJNA 3D5LA 2R7XA 2TRTA 5CJ9A 1B4AA 4IRIA 2RREA 2FQ3A 2H8RA 1V5GA 2CO5A 5KCMA 1LE8A 3VPRA 2VQCA 4EJOA 2JMWA 3CUQB 2R7ZJ 1JJ8C 3OYCA 1BN5A 1XGOA 2PEXA 4YIIA 1YI2I 1X3UA 1OCPA 4E70A 3L2UA 2ZXIA 3H35A 1KA8A 3BOQA 3JCUC 2BE5F 3JR9A 5LGNA 2E2JJ 2CQQA 3GX4X 1R1VA 4A69C 1GVJA 1SC7A 2K9NA 3QPLA 2OTJI 2QKLB 2FUG2 2ELJA 2DOAA 3MN2A 1JE8A 2KZVA 4BBRJ 3ZQQA 3GCMA 1UB9A 2HQRA 1OFCX 3RZDJ 1BA5A 4N0BA 1YS6A 1ERDA 5BPDA 1TC3C 2EB7A 2Y9ZA 1O3RA 2MC3A 1HF0A 2GXAA 2BHYA 1D5VA 1IRXA 4CYCB 2A6HF 3MQ0A 4A3DJ 3F8NA 4LOCA 3C2GA 1APLC 1EJ9A 2DN0A 9ANTA 3H92A 3TO6A 1XSXA 2Y69H 1D1BA 1ETVA 4KUMA 1BIAA 2CW7A 5E3MA 3MVPA 4KMFA 1IN7A 2XPUA 4LITA 3WTSC 1ZN2A 1YO5C 3BR0A 3QOPA 1VZ0A 1G3TA 4PJ0C 1MMAA 4JQFA 4Y7NJ 3IH4A 4BU2A 1U3EM 1LFBA 1DGWY 1HA8A 1XGNA 2Z1DA 2JSCA 2PG4A 4GFBA 1IDZA 3W6JB 1IV6A 2RVCA 4QPQA 4HX4A 2G9WA 3ROUA 4WK8F 1S7EA 3ZMTA 1D0YA 3J80K 2H6BA 2XKOA 2XPWA 4RAZA 4DBQA 2QGUA 4YFNF 2M7AA 1QO0D 2E7WA 4IQJA 2PN6A 2RNJA 4OMZA 3TMOA 3IH2A 5J3LA 4PSXA 1T08B 2F5EA 1MNMC 2IW5A 4I6ZA 2NVYJ 1I6HJ 2CH0A 2QWWA 3GO5A 2A5YB 2KDZA 1MMNA 5DCMA 3K7AJ 1WFXA 3WHCA 2EV6A 3TEDA 1FTTA 1BI0A 4P1WA 3BZCA 5KAIC 4A93J 5IP9J 3FBIB 2Z9OA 3CP8A 3CLQA 2NVQJ 2ZMEB 3DKYA 1QBJA 1K61A 2E5ZA 1JJ6C 4L9VA 2UWMA 3WE2A 3QYEA 4Z6YA 4EATA 3EUKL 2JSPA 5FKNA 3R0AA 5JVTA 4XIDA 1HBXG 3HOVJ 1IC8A 3VB2A 1FBUA 3K4MA 1WKMA 1ZARA 3U9GA 1BR1A 2HOEA 2DYSH 3G1OA 3KYCB 3RPUD 2OC6A 1VF9A 2X6YA 2L0KA 4GGGA 4ZYHA 1STZA 3GTOJ 5HDGA 2VN2A 2FNAA 2CGPA 1D1AA 4EV0A 2H6CA 3K4KA 3BCBA 1WJDA 3A02A 4G7OF 5D4RA 2FQ4A 4JX5A 1U6GA 1RRJA 3E0JB 3M7GA 2ELHA 4NQWA 2NVXJ 4ZTJA 3ERED 4AIDA 5D8LB 4CO8A 1T39A 4HDUA 3QWLA 3CC4I 5HLIA 2QBYB 2QZ8A 5B5EC 2E36A 3AAFA 3C18A 5GAEJ 2ME6A 3GYHX 3LQQA 3K4BA 3D5SC 3PJRA 2OBPA 3UKGA 3A2KA 1Y8RB 2KQRA 1WCMJ 1W5TA 2PJRB 3GTLJ 4QWQA 3FXLA 2E1NA 2E35A 4PK4A 4WXCA 1LEBA 3I59A 3DP7A 4D7MA 4A3CJ 3H0DA 4M3FA 2XSDC 3FMQA 1H0MA 3BG3A 2WB1N 3LFKA 2IEKA 3WTZA 1W36D 3S1NJ 2XAQA 4G6TB 1DGRM 1JGSA 2L01A 1BW5A 2HGCA 1SFXA 3GMEA 5H6QA 2CUEA 2KIUA 4CICA 1CQTA 3HSEA 3FMRA 5EEGA 1NTCA 4CSWA 3S93A 3PUBA 4RGUA 3Q9SA 3M07A 3QAHA 5KAFC 1LQ1A 3M1EA 3DTIA 1XCVA 5CVIA 3S1MJ 3HB9A 2W85A 1B8IA 4P96A 2PI0A 2R0QC 4FX0A 4UV8A 5F1JA 2JT1A 5ICCA 4BE1A 3MWMA 4PJJA 3FZVA 1FP2A 3BDDA 2JVGA 1RETA 3LMMA 3J81Z 1GV2A 3TW7A 2IVMA 1TP4A 1U5TB 5HS8A 3F6VA 5BNGA 1RR8C 4J01A 1LFUP 1S8NA 3QP5A 1ZQ3P 2X1CA 3AFHA 2ZFWA 3JRAA 2E2HJ 2DTRA 3RYPA 2XDVA 3W2VA 3DKWA 2JA8J 4ZTFA 3KP3A 2V4JC 3ABTA 4F93B 2EFPA 1X1CA 1MKMA 2NS0A 3RDIA 3CCUI 1V55H 2HXOA 5EDNA 2DT6A 1KU2A 4AIJA 1H89C 3JTHA 1LEAA 4LIVA 2OF7A 1TNSA 3R61A 1UELB 1SD5A 1BM9A 4HV6A 3GFIA 2CV1A 1DU6A 4XOTA 1LPQA 5F04A 4EJWA 4FETA 1NHAA 4I0AA 2M2EA 4AD9A 2EIKH 2LD5A 3FHZA 3M8JA 5IOYA 2BVLA 2V1DA 1G4DA 2G7HA 3G2BA 4RB1A 2Y48A 4K2EA 4ASNA 2WBMA 2LTPA 1VNDA 4PDKA 4UUVA 2L7KA 4BJ5C 1B9MA 2KLOA 3GW2A 4DGWB 1OCZH 2BVMA 3MD2A 5DV5A 2UV1A 3OYHA 3BZ6A 3DBRB 3OYNA 5D5XB 3LSHA 1P4XA 3UR3C 2PBIA 2QQAA 2DCEA 1IN6A 3E3VA 1Z21A 2Y75A 4HOBA 1IUYA 5IOZA 4HLXA 3ONQA 4M3DA 3DCFA 2PMZA 2XIGA 4G94A 3O8HA 4BUPA 4H0EA 2PJPA 2X48A 5D5UB 1O4XA 1VQ9I 3OIOA 3BJAA 4RS8A 3S3NA 2V7FA 5LD2C 3I4NJ 1HXDA 4G9YA 4QIWN 1MNDA 1ETOA 2ME0A 3ZQHA 2RGVA 5CVRA 2CFOA 2COMA 1VFCA 3DEUA 2ECBA 2B0LA 2PQ8A 3CCSI 1FP1D 2X6XA 4PUSA 1U8BA 3QPSA 1IJWC 3CUQC 3I55I 5TGTA 4BGDA 4ETSA 3LA2A 4CZCA 5JFRA 1K78A 2KIFA 2R7OA 4UVBA 1F1ZA 4AIHA 1AOYA 2CS3A 3E6CC 5C4JJ 3Q0UA 2E7XA 2Z3YA 3LSPA 4RAGA 4OU0A 3V8LA 2FSWA 3KETA 2DMUA 2M0MA 3AG3H 1X3WB 2CQKA 2MSYA 3LL7A 3CO7C 1RESA 3PNYA 1T98A 1ZGWA 1J9IA 3WTVC 4LLNA 1FC3A 4CH7A 4D7NA 2KT0A 1EKEA 1YE9A 2I5UA 2HQ5A 4HF2A 4L9TA 1MD0A 2YS9A 2Z33A 1DP7P 4BQOA 4L18B 2EILH 3TW6A 2R5ZB 1W7PD 4HF0A 5E3NA 1YRNA 1IRGA 1Z7LA 1R49A 3CCQI 4Z2YA 3ZRGA 4M3GA 4XQFA 3GTMJ 4RB0A 5ED4A 5EZGA 3CJTB 3D5RC 2L9VA 2IGOA 2ZBKA 3MKWB 1TQMA 4WWCA 2RAEA 2JVHA 2WA0A 3ELKA 3VYSB 2JRMA 3M3YJ 2DA4A 2LDUA 2H8WA 3CCRI 2E71A 4KFCA 2IS1A 1OR7C 5L3BA 3G4SI 5CVVA 2QVOA 3IAS2 4L9JA 4ZDPA 3L7WA 1X4PA 2QLZA 4JK1X 3ULQB 2W57A 3U2RA 2OCCH 3FXKA 2J5PA 1OPCA 2V9KA 4O6JA 3OS1A 2NNYA 3IWZA 3KE2A 1OQYA 4RM2A 2V1NA 4C2TA 4BQAA 3TBIA 1J7KA 2M0CA 3KFWX 2FJ1A 5EZHA 2ISZA 1DPUA 4R1HA 1X3ZB 3O8GA 1G8XA 3O2PE 2VBYA 3HYIA 3AL0B 3GTGJ 4DYRA 1ZHFA 2P81A 1AKHA 3IKTA 2XB0X 1XN7A 1SANA 3A01A 3IV5A 4CYDA 1YYVA 3SXYA 1WH7A 4R8HA 2WV0A 1YFHA 3L9FA 4HX7A 3TOAA 3BY6A 1Q1VA 1R5HA 1WH5A 3CJRB 3C2BA 3C3WA 5IYCJ 4I01A 3TDZC 4ESFA 1TWHJ 1W0TA 1SAXA 2HQAA 3ABLH 2R7DA 1AU7A 3HBLA 2NOGA 1B1BA 1ETYA 3BTIA 2KRHA 1CF7B 2Y30A 1GXPA 1IN4A 1UHWA 4XLEA 4M6YA 2EA4A 3O6BB 3PQJA 2IA2A 1TLHB 2AQFA 4CHUA 1QGPA 3H1CA 2FU4A 4UB6C 4DIQA 2COBA 2EINH 1YHQI 2V9PA 3FKIJ 5FKKA 1ITYA 1ZKGA 2OAZA 5E1ZB 1YW8A 5TRDA 1K4TA 3WTTC 2P4WA 4E7KA 4ESBA 2KKOA 2R92J 2V9VA 2RDPA 4N9HA 3W2WA 1YQAA 1JHHA 4N4NB 5D5VB 3T0YA 3Q3SA 1DU0A 3BG6A 2QENA 2HZDA 3HPGA 2XGCA 3KP5A 5FLXZ 2O61A 2Q2EA 4BACA 2CRGA 3QPHA 5D5WB 1FBQA 5DS9A 3B02A 3E5XA 2QSHX 3QPTA 4JX4A 2HVQA 1W5SA 3GFJA 3HPHA 2DT5A 3WTYC 3S8PA 2BY1A 3CCEI 4L5JA 4PFOA 3L1PA 4OIOF 1D3YA 1NH3A 1FOKA 2EPFA 2O03A 1FBSA 2XVCA 2VC0A 1W0UA 3CESA 4BY1J 2DODA 1JT0A 2FOWA 2L4AA 5FRMA 4A3FJ 4CDGA 1B72A 1BI2A 3VOEA 1TW3A 1P92A 2MH2A 2ZKZA 1LDJA 3EUAA 2UUZA 4HPQA 1F5TA 2FXAA 3L2RA 2VKEA 1SMYF 2TDXA 3H36A 5F1RA 4LG0A 1ODDA 3LSGA 5M3MJ 4HSTA 2ZJQF 1X1PA 1JTXA 4UHTA 1O3SA 3LA7A 4MEYF 4KN7X 3VFZA 2UZKA 1ZLKA 2W24A 4NHJA 5BPIA 1U9NA 4IHVA 3CMEI 2QSFX 4ZJZA 2E1MC 1ZR4A 4BEHB 4OWRB 1U5TC 1MMSA 3F21A 2BY0A 2ESHA 2X1DA 1RI7A 4LIUA 3F8CA 4C9YA 1Y6IA 2E60A 4DBRA 3CD6I 1V4RA 3K4JA 2R5YB 2GZWA 2GAUA 4RB3C 4QLCU 2P7VB 1SFEA 4RGXA 5CPRB 3ECOA 2YPRA 3H5AA 3RKXA 4ZZLA 3LQRA 2KL4A 3EPZA 3DEWA 3HRMA 3HXLA 4B1RA 4FT8A 3K70D 1ZELA 3KLOA 1P4AA 2HVSA 2LH9A 2AXTC 4RAFA 3FBNB 4AUXA 2EIJH 3OYDA 2LY2A 1SAUA 1GHCA 5IT3A 3WGIA 2WTEA 4CCKA 4D9JA 3F22A 2DLLA 4G6QA 2MYSA 4XL9A 4QSHA 1ULYA 2MH9A 4XRMA 2QUFA 4H4KC 1M1EB 3OV8A 2QSGX 2R7RA 4DOZA 1EV7A 1WJCA 3L09A 3HOTA 3Q0WA 1RC9A 2VJIA 2IP2A 4CCLA 1W36C 2HTJA 4NUBA 1E3OC 2A05A 4ZZDA 3MZ8A 3WG9A 1HKTA 1T38A 1VQLI 5J4VA 4IVNA 3GZ6A 2VBXA 2YR2A 3HUGB 4GYIA 2QEXI 3K4LA 1ZG1A 1IZ1A 2HOAA 2BZTA 4D5FA 3VWBA 4BL0B 1CGPA 2PLYA 5C4XJ 5DTDA 3OR2C 4CZZA 5ILSA 4XLFA 5HLTA 1FWZA 2IA0A 1WWXA 3CDLA 1IAWA 3FXMA 2W82A 2CW0F 3LOCA 2K40A 3FF5A 5LRSA 5JVGF 2M1BA 1VQ5I 2OD5A 2ZSIB 3OY9A 5CKTA 1O7LA 3DF8A 1XMXA 4OIPF 2DW4A 4HW0A 2EWNA 2XASA 1OYWA 4XBFA 1RPWA 2DQLA 3SQNA 4ENJA 4CXFA 1SMTA 1HDPA 1JTYA 2BY2A 2EZKA 4UVAA 2O8KA 2W48A 2WC2A 1R5GA 3L2WA 1SFKA 1OCCH 2UXXA 1FZPB 3KP2A 4DQ2A 2K4JA 4IJAA 2FEZA 3RQ4A 5DM6F 2M3AA 2ZJRF 2DA6A 1A5JA 1FNNA 3S16J 2PMUA 4ESJA 1YTYA 2NRAC 1ON1A 5LLQA 3HEFA 4OIRF 2K02A 2XB5A 2R7TA 1X1AA 3L2VA 4HBLA 3PFIA 4YEJA 4FHTA 3HGYA 1KONA 2CSOA 2K27A 2X85A 3CUQA 4BNCA 1POGA 3OYFA 5HODA 3ZMSA 4BAYA 2LSOA 2VXDA 3DPLC 4I7HA 3CMMA 2Z99A 1KU9A 2X6OA 4S05A 4BJTA 1LE8B 2AHQA 3NAUA 3GZ5A 1VQPI 2BGCA 1P7JA 3RCOA 4EGZA 4IL6C 2AS5F 1XSVA 2XSJC 3ISPA 3HL2A 2JN6A 3K2AA 2DPDA 1ZTRA 3LAPA 2ZB9A 4E7ZA 4UVCA 3N05A 4XRFA 2JA7J 2BW3B 4RAYA 2DA3A 3I9V2 5AIQA 4XLNF 1ZGJA 2WAQA 4FQGA 1ZYRF 3E6DA 2LLKA 1Y0UA 2DJIA 3IKVA 5CQEA 4HX8A 3AG1H 2L7ZA 5J1YA 3I58A 4D0PA 3JRCA 1N77A 4LLLA 2Y0SN 4CYCA 2KRCA 2M8EA 2O6GE 1VQKI 4HNTA 4PGGA 2XROA 3S3OA 3FWEA 4B43A 2OJED 2BXYA 1O3TA 2A6TA 4YG2F 2L02A 4M74A 4A12A 1IV8A 1MBEA 3ZR8X 3V4GA 4A3GJ 1TW2A 4NC6A 1MDMB 2VOPA 1OR7A 1D0XA 1Z3XA 2CJJA 4BXUA 2L2OA 4NC7A 3M9AA 3R4KA 4XLCA 4P55A 1KYZA 2HYJA 4KMUX 5LGUA 3HRSA 2XF7A 3JRBA 2H1KA 2HDDA 1LDKB 4DYQA 1WI9A 1VQ6I 2NS8A 2CUZA 1J2XA 4I98B 3T8TA 4G7HF 3NWSA 3A03A 4NC8A 2DU9A 1YITI 3J7AY 1TBXA 1YX5A 4JOMA 4XN0A 3N4MA 3E5UA 3A1YA 3K9TA 5E3OA 5TJJA 4PFPA 2KPMA 3ZXSA 3G71I 2CU7A 2N8GA 2HYGD 2XRNA 1GLNA 3WGHA 4XN3A 1FT9A 3MZHA 1QVTA 4P9FA 1V5FA 3L2QA 3DPTA 1S5LC 4IRGA 4ZDOA 5EJCA 5FKMA 2CG4A 4HQEA 2YU3A 3RKYA 4B3AA 4PZJA 2VJ5A 2P0WA 2Q1ZB 1Z77A 2DXIA 2NAZA 4BQQA 3R0JA 2A3SA 5DCMB 3ZMUA 1D8KA 1USSA 2XC7A 6PAXA 5HOOA 3OIQA 1ZH5A 3MKLA 2DA7A 5LBQA 2DK8A 4G7ZF 3N97A 5LEKA 2JUGA 2VPRA 2IRFG 1AHDP 1JXSA 1SVMA 2RQPA 5DUKA 1LVKA 5BMZA 1JKPC 3ABMH 3H5RA 1ZRFA 4G8XA 2JQ7A 4RLFA 4OOIA 3IHUA 4F3QA 1T8IA 2CMPA 3ABKH 5K5QA 5JLWA 4KIFA 3H3ZA 2DK5A 3JRHA 1FYLA 4IOCF 3WTWC 2R7FA 2LYCA 3J7AO 3V8KA 3CP2A 4UB8C 1LKXA 3K2ZA 2CUFA 3HOSA 5LEJA 4XRSG 1XMKA 5F27A 1F43A 4XOPA 2FBKA 1VI0A 4NQWB 4E7JA 2ZXWH 5J8FA 3HGGA 1DDNA 1NG6A 1FOWA 2MG4A 3OYLA 2LBFA 2XAHA 2PJRA 2NVTJ 3JRIA 5A2QK 2X51A 3S14J 4KN4X 4MNUA 1XB4A 3Q5FA 3PIOF 5F08A 3TL4X 2KISA 4CA0A 2LR8A 4FX4A 3R6SA 3CMAI 2EJRA 5M3FJ 3EYIA 3ZQLA 2HNHA 1ORKA 4HRIA 3KLNA 3BG9A 3CC2I 1IDYA 1I6XA 4LJZF 3VYRB 3RKWA 4U0VA 1JI8A 5E8IA 3F8BA 4N4OB 4X6AJ 3F3XA 1TWGJ 4RDUA 1I1GA 5IT9K 3HOWJ 2CWEA 2M9HA 4GXOA 4ZC3A 3GBGA 2V6CA 1P2FA 1AWCA 4G12A 1OLTA 3FM3A 2BXZA 3CCYA 1B9NA 3GFLA 4XNFA 2HEOA 2Z16A 1J09A 4HAMA 5F0FA 5L3FA 4A0XA 4BQNA 1FX7A 3VODA 2A61A 2EFNA 3HG9A 2KMUA 3M8FA 1FYMA 1Y39A 2OTLI 1B8IB 1U5TA 2LY9A 2DA5A 3BJOA 1Z6TA 1MMDA 2Q0OA 4MFDA 2NVUB 4L9NA 3RPUA 2PFBA 5GAHJ 3MKYB 2NYXA 3JAMZ 5H6RA 2L7FP 1RZ4A 1O7FA 3NQOA 2VE8A 1R36A 1WSUA 3E5QA 3MZYA 1BOAA 4EQQA 1A04A 5K7HA 2RN7A 1JKRC 2HVRA 2GXGA 2K3PA 2P5VA 3GTQJ 1QA6A 3CJNA 3VEPA 5LGTA 3CO6C 1TNTA 3OL3A 3ZN1A 2L9NA 5F0HA 1JHFA 3E6MA 4RM3A 1PUEE 5J1RA 1E0EA 4A0ZA 2E5NA 1E17A 3KZYA 2DMTA 3KZZA 5CVUA 1K79A 2D1VA 3MFKA 5CYVA 2X1EA 5LFAA 4BS9A 5DEQA 3FDYA 4RMNA 5FB2A 3HOUJ 5EGOA 1QHGA 2F5CA 2WB1A 1J0RA 1X4OA 2JRTA 1YJWI 3IH3A 3QQAA 4OIQF 4UUTA 4I99C 4W97A 2NXNB 4B47A 4KDPA 3BTJA 2WAEA 1BR4A 3S15J 4F52A 2O7OA 2V79A 2LKSA 2EV0A 3PNTA 3K70C 4UNOA 3P9KA 3Q0VA 4LD5A 3H3VK 2B63J 3AKZA 3DXJF 1YJ9I 5ICEA 4LMYA 2CW8A 2LFBA 4E7LA 3HIFA 2ACJA 3E1SA 3GWZA 5FKOA 3EUHC 3PSIA 1LUJB 3ECHA 3VDXA 4Y3OA 2OQGA 4BDZA 1TT0A 4BE2A 1RIOH 1ETXA 3REOA 1YW7A 2X4HA 2WY8Q 3VYUB 5KNLA 2LVSA 2VQGA 3IRQA 1UCRA 2K9LA 1UZCA 4B44A 4A3BJ 4ON0A 2QKMB 3OYGA 5JI6A 2XV4S 3I54A 4EM0B 4IHTA 2QM3A 2LMDA 3FXJA 4IHYA 2DMPA 2LY1A 2K85A 3OR1C 1KZHA 4EM1A 4FTHA 3BTLA 4NNJA 2XGXA 3K1MA 4BY7J 5C44J 1K78B 2CV2A 4V2FA 1P6RA 3OS0A 2E1CA 2JA2A 2FD5A 1QHHD 5DYMA 4BHPA 2XUBA 2LF7A 4AYBN 1HKQA 4FE4A 2LREA 2ZO4A 3QU3A 3KYDB 4WXDA 1YIJI 5HNHA 4GDFA 2R5ZA 5F64A 2STTA 1Z91A 2ELKA 4EJTA 4OMYA 3B73A 4ZYEA 2VKHA 3W2AA 1GUUA 2EA2A 1XPXA 2OPTA 3GFMA 3IUOA 3I0TA 3KP6A 4XSZF 5BS6A 1YRNB 2F2EA 3I4MJ 3OYEA 2DDBA 1HW2A 3I5UA 2GM4A 2JTVA 5HS9A 5F0CA 1XSDA 1SFUA 2MGQA 1BI3A 2IAIA 1XTAA 4Y4RA 4GRIA 3I53A 3WHBA 4S04A 4XKWA 4MFEA 3EDPA 1VQ4I 1Z6RA 2UXNA 1MBJA 3G1LA 5FD5A 4A3JJ 1O3QA 2XGEA 4EEFG 3HKZN 1OCRH 3BG7A 2NS7A 5J1UA 4N9IA 2J5OA 1REPC 3F8FA 2HPIA 4IZZA 2ZXHA 1R1TA 2ZSHB 3FX3A 1N75A 1ZREA 3CJQB 2FMLA 5CLSA 4IX7A 3CZ6A 3HRTA 3NEUA 1W5CC 3SFZA 2DI3A 3H3UA 2O5RA 4A6EA 2EZIA 2DOFA 3DWLE 4M71A 1O57A 2DQRA 2HDWA 3FK7A 4O3MA 3S1RJ 2HR3A 1D5YA 4F55A 1PJRA 1JUMA 2VIXA 1Z0XA 3HHHA 1GVDA 1AKHB 4PCQA 3A01B 4D5CA 2ZMEC 3TP3A 1YW9A 4XKBA 2E19A 1Z3YA 1R58A 1ZG3A 1QNTA 3D0SA 4ZYDA 1R9TJ 1W7PA 5DCFA 1JKOC 2EFQA 2ZCWA 2K9MA 3C2HA 1B6AA 2WV1A 3SEZA 5LHIA 2AO9A 2LKXA 1MH4A 1A6IA 1SFOJ 1EF4A 2QQBA 2V1XA 5GTIC 1UG0A 2D1HA 3IC7A 2ZC2A 4L0ZB 3KEQA 1ZR2A 2OV7A 5IYDJ 2KDOA 2XGDA 1S7OA 2JA5J 3J80Z 4V19K 1S7AA 4B4CA 5EEAA 2L4MA 3KP7A 3QYFA 1LJ9A 3OMYA 1DUXC 3BR3A 2DA2A 1R5ID 3KPHA 2OQRA 1IF1A 4U0WA 3PSFA 2F4IA 2XAGA 3H9JA 1ON2A 1WJ5A 2W25A 2KIQA 2Q2EB 1E3PA 4HF1A 4X0GA 3H9GA 3SZGA 5EG0A 4AU7A 2D45A 2ZFUA 3V8JA 1HW1A 1P9QC 3ZMDA 1PDNC 3LWFA 3DTKA 5H2FC 3LFUA 1A6QA 5FJ8J 1LB2A 1PVEA 1LFPA 2HKOA 1UHMA 2CFXA 1VTNC 1G3SA 2I10A 4Q48A 4C3JJ 5HNFA 1B72B 1TTYA 2BBYA 3BROA 2EZLA 1EA3A 2DT7B 4O5VA 5J40A 3J81K 4XKVA 1BC8C 1FMVA 2Z2SB 3S32A 1FTZA 3NRVA 2JA6J 1LDDA 4IF4A 4KICA 2Q8KA 5FROA 4KYWA 3AG4H 1ETWA 4A3LJ 2GOXB 2KJBA 4A3MJ 4LB6B 3OYMA 4LG0B 2HDCA 1C0WA 4A5MA 5B3SH 1JUSA 3K0LA 4A3KJ 4JBAA 1ETQA 2YUSA 4BJ6C 3S2HJ 3J7ZI 4Y13A 2L7MP 2F4OB 4BKXA 1ZRDA 5E3LA 1OMIA 2HQNA 4CCOA 3BG5A 1Y8QB 3GLLA 2HTSA 2DO7A 1T0FC 2MLKA 4CCJA 3KYLA 4C2UA 3EYYA 1RKWA 3P5JA 2BV6A 1EH8A 2KP6A 2B7EA 2P6SA 3ZP5A 2O0YA 2K9QA 3P9CA 2QQ9A 2JWTA 3JRGA 1OKRA 3K4NA 4RLQA 4HNUA 3TO9A 1KQ0A 3DTEA 2HZTA 1A31A 3FXQA 3F8MA 2DFHA 2GOMA 4AC0A 4WX9A 1R00A 4DYCA 1JKQC 4BBSJ 3G1MA 3ZPLA 1I5ZA 4TV7A 1TZLA 1E3HA 2Y0MA 3W6KB 5AONA 3CMYA 2CUJA 4XRSA 2LNBA 4MGRA 1PP7U 3BJ6A 1Q1HA 5LRRA 2R7UA 2E1OA 3GXOA 4KISA 3RZOJ 2R7SA 3CCVI 3HOXJ 4HEA2 3GZNB 3OYIA 3HUGA 3QYBA 3J7YJ 2DYRH 1WQ2A 2XPVA 1KQ8A 3RTRA 3F6OA 4UUSA 5ICGA 1VQOI 2QQ8A 1UAAA 3DFGA 4FE7A 3JW4A 3V7SA 3H9QA 4AIKA 1VQ8I 2VT3A 3PUFA 1X2MA 2G7UA 4KJZA 2MLGA 4EGYA 1FIAA 5DDGA 5ICFA 2DA1A 2NOJB 3CDIA 1BOBA 2YX7A 3U21A 3HC7A 3VSKA 1FSEA 1RR7A 3C7JA 2M5WA 4D1QA 4I76A 4Q47A 4IEJA 4HA8A 2FBIA 4F7ZA 5J4YA 2K86A 3ZQGA 1U8RA 4KT6A 1T2KA 4E7IA 1ENHA 4PGHA 2F48A 1S3JA 2K5CA 3BR5A 3E7LA 1XS9A 3F9KA 4AVPA 2OCEA 2O8XA 3WU0A 1GV5A 1UFMA 1PUFB 4RBOA 4WCGA 1QPIA 2OUMA 3HJEA 3WU1B 1DPRA 3LSJA 3JSPA 2D2WA 2VL8A 3ZCOA 2GIVA 1KGSA 2VQHA 4I09A 3LSMA 3HTUA 5KVRA 4Y52J 3ZMZA 2BY3A 1N25A 3EUHA 3GUDA 5HDKA 2HPMA 1QQIA 2XAUA 1IXSB 1BR2A 4QTRA 3EETA 3D1NI 2C6YA 3CTAA 3SZTA 4ENMA 1TQIA 1HKSA 3GTKJ 2ID6A 3OYJA 2MBFA 1SD6A 1V54H 4ZYAA 1MH3A 4B8XA 4XONA 4AVZA 2VPLA 2KHMA 3BPXA 3QOEA 2I8DA 2P8TA 2FF4A 2YSRA 3F0CA 2L9RA 5E1XA 2M34A 5GPAA 1PYVA 2EV5A 1GDTA 2DBBA 4B09A 4AWXB 2IBDA 3V42A 4OINF 1D8JA 1MBGA 3LSRA 2BW3A 4IHXA 2DMNA 4F92B 1J75A 2M87A 2PX9A 3AG2H 4OAZA 5E8GA 2FOKA 4RA2A 2LG4A 1X58A 1HC8A 1WI3A 4LLGF 3SEQA 1MJAA 3ZQCA 2XF5A 3GTPJ 1S6LA 3H0GJ 4ZH4F 1P4WA 4ITVA 5D6EA 3FK6A 2VOOA 1L0OC 1QU3A 5D4SA 1WHUA 2V1UA 4JX6A 2M30A 1YX3A 2A07F 1TQPA 3AL0C 3IRRA 1PP8F 5DM7F 3OL4A 1HW5A 5IYBJ 1JT6A 2O3FA 3M1CA 3DEEA 3ABUA 1WJAA 2EBIA 1FSHA 3MMYB 5FLVA 1XGSA 1I50J 3OSFA 1YJNI 1MDMA 1D1CA 3KCCA 2OZ6A 2DDAA 4BHBA 2XRLA 3DU5A 5BQTA 1WJEA 3M4OJ 1MBFA 2E34A 4NBQA 4M9XA 2WWYA 1T6SA 2JPCA 1T56A 5GTHC 4ENKA 4E7HA 2H1LA 1YG2A 2GIZA 3FMSA 1HLVA 1TWFJ 2VJ4A 2IS2A 3SFIA 3KEOA 2VBZA 1ZRCA 2D5VA 5K5RA 1FYKA 4I0BA 3CLOA 3HTSB 3DLLF 1W4MA 1XX5A 2HYFA 4S0HB 1I1SA 1W1WE 3I4PA 2JJ7A 2JZYA 5K1YA 3JTGA 3QU6A 3W3CA 4DZJA 1R71A 4DZPA 3MEXA 2R7VA 5FLXK 3B6AA 4BXFA 3CCLI 2HI3A 3BTCA 2XHKA 3C1DA 4B48A 3WTXC 3ZGKA 4CGZA 3SHFA 2ESNA 3W6VA 3TO7A 2ZMEA 2IPQX 2H27A 3DV8A 5DD4A 5JHFA 5IY5H 2VUMJ 1J59A 2EFWA 5FKLA 5D8KB 1L3LA 2LRDA 4I02A 2VE9A 4PJNA 2VB6A 3PQKA 2OZUA 4C2MJ 1MJBA 2HXIA 2Y0SA 4ZDLA 3HM5A 3KZIC 1Z1DA 4XLAA 3TDUC 3IAM2 2LP0A 2ICWG 2FA5A 1I27A 3LSKA 5FLMJ 2BYVE 2VT2A 4U0YA 3OS2A 4UV9A 4WXHA 2ISYA 1U78A 1T95A 5E18F 4XLHA 2RV8A 4OAYA 3SDBA 1FMWA 4XK4A 1G59A 4HYEA 3FHNA 1YS7A 2QBYA 2L9SA 4MHGA 2IGMA 4YFKF 2Y31A 2DFIA 1R6RA 2ADUA 3FXOA 4B3XA 1HCRA 4IOAF 1K6OA 5E17F 5L3CA 3S1QJ 3HOZJ 2BEOA 4PSWA 3WODF 3T1BA 4CCNA 3EQLF 4DJAA 4HSRA 4NDLA 3TOBA 3JREA 3BC8A 1IGNA 1MJ9A 3R60A 3SYTA 1FOYA 3BP8A 2W4SA 2RNGA 1Y56A 4W1UA 3OIPA 2DFEA 3I59B 3WU2C 3JRDA 3CC7I 1X1BA 2MA3A 1ZGAA 2L54A 2X0LA 2LBFB 3I71A 2GBYA 1G2HA 1Y1VJ 2LKPA 1Z7UA 2MFZA 2Y9YA 4LFUA 3KEYA 3V7RA 3SJMA 3I56I 1IUFA 4LK0F 4XKCA 4I2OA 1MIJA 4C3IJ 2VKVA 3ZOBA 4ENNA 2CV0A 4LK1F 3S3MA 2PMZN 1VQMI 4IQ4A 1QZYA 2F4MB 3T8RA 1K7AA 2A6EF 2B9SA 3HSRA 1KYWA 1S9HA 1I3QJ 3GF2A 1H88C 2K7LA 3OSGA 2F5VA 4FCYA 4X1EA 1U9OA 5DUIA 3L2CA 4MQ9F 1E2XA 2EIMH 4M3EA 5HLHA 1SEUA 3TP0A 2F5FA 2GQQA 1YLFA 1SD4A 3OYBA 1VQNI 5FO5A 5CQGA 2FMYA 2MABA 2M45A 3A0BC 3K69A 2E1MB 3PM1A 5HLGA 2H09A 3V7CA 4JP0A 1T0FA 2RKHA 4RGSA 5AIPA 1H9TA 1FOXA 1RUNA 1SVOA 2FBHA 5M5YJ 4YFXF 1N78A 3G73A 2ECCA 4MQVA 3PO3J 2ZNZA 1IXRC 4XORA 2HFHA 1USTA 4KA4A 4DW6A 5ERIA 1V5EA 1YOVB 5KHDA 3G3ZA 2M7BA 4JYKA 3HZJA 1Y1WJ 5HS7A 5LHGA 3DKXA 4M6XA 5F6FA 5DD8A 2GA1A 1QVUA 1A36A 1Z9CA 3CDHA 1H8AC 1NG7A 1WJBA 5IP6A 3MCZA 2M4KA 3WGGA 4YRVA 4UXNA 1MZBA 2IGNA 1V3FA 3K4CA 1NK2P 1OYIA 3O3KA 3ERMA 3H5NA 2ZXJA 3BR6A 2L5QA 1GXQA 1OCOH 5EGOB 1G6NA 2WY7Q 3PIPF 4U7BA 2K4BA 4E6KG 2GA2A 2OA4A 3ZQ7A 1UMQA 4G6DA 5GP9A 4U87A 1TT5B 4KNYA 2HOTA 2EH3A 1QZEA 4IXAA 4EVIA 3CCMI 3VSLA 4HG2A 4LGWA 4P9UA 3BZKA 1IN5A 5EYRA 3BWGA 4XLPF 4E7SA 2HKXA 2XF6A 2A5WA 2KZGA 3PNVA 2JK3A 2X6WA 3CF2A 4AM3A 1IXCA 5FFXA 4KIBA 1XGMA 1JUPA 1BI1A 5HVQC 1QZZA 1FJLA 1GT0C 3PO2J 4XMYA 2BHZA 3ZQIA 5GAGJ 3K10A 3I3LA 5C3EJ 5JLXA 5LHHA 2YU9J 3UNGC 3K1NA 5FFZA 3E97A 3VYTB 1MNEA 1LVAA 5M5WJ 2CQ7A 3X2QH 3S2DJ 1TL8A 3B6CA 1ETKA 1IO2A 2F6CA 2VI6A 2DMQA 2CYYA 2IXSA 2QYOA 3HSFA 4R79A 3DQVC 3FM5A 1D0ZA 1X1DA 3CCJI 2VQLA 3K1PA 3T5XA 1U0JA 2LOOA 2QF7A 4RGRA 1IRFA 5GADJ 2L3DA
chains in the Genus database with same CATH topology
2GXBA 3QP6A 5EEHA 2EK5A 3TKYA 3ZMVA 4P5OA 4Q4ZF 1WRJA 2HS5A 1FPQA 3KP4A 2VONA 4IHSA 5ILVA 2H94A 4L5IA 2FE3A 5FD6A 1XCBA 4A5NA 4LB5A 3WTUC 1ZG5A 3I64A 4U7DA 1RNLA 5E1WA 3RYRA 4RB2C 4A6DA 3P9IA 3HHGA 4MTDA 1IN8A 5E20A 4HQMA 1HSTA 3BPVA 4GYGA 3GLXA 2AXLA 1MGTA 4KT5C 3ML6A 3LA3A 1FY7A 4Y17A 5CVJA 1S29A 2FRHA 4A0YA 1R7JA 1XDSA 2OU2A 2XKPA 3TGNA 1OYYA 1CF7A 3E6BA 3SZPA 3LSTA 1BJAA 2FNPA 3RIRA 2IA1A 5ILUA 1ZLJA 1XD7A 5H20A 1W7PB 5BOXA 3F23A 4MEXF 3IWFA 3GEZA 1G3YA 2LF8A 2HWVA 3M8EA 4EJVA 3U1DA 3RJPA 2KRFA 5L3EA 4BYYA 4NB5A 4EM2A 4HV5A 3OOPA 1BC7C 3MAJA 3RPQA 5K5OA 3JSOA 1ONVA 2MD5A 4EJUA 2KIMA 2RC4A 1KU7A 1H9GA 5L3GA 5JR3A 1YIOA 4M72A 5JHUA 3Q9VA 2YX4A 1B59A 1HQCA 4M73A 2VC1A 2P6TA 3L00A 3WE3A 4IRHA 3CUOA 3JAMK 2IJLA 5FGMA 4ZYGA 1R1UA 1QPMA 1Z05A 4HZFA 4M9SA 3HRUA 1LNWA 1ZAOA 2P7CB 1FLIA 3IL2A 2R3SA 2GWRA 3F72A 4Y15A 4M9ZA 5J8CA 4BH9A 5A2QZ 4BHCA 4WF2A 4HLYA 2VXZA 4GCVA 2ZJ2A 1G3WA 4XSXF 4MTEA 4YIFA 2VODA 1XMAA 3GVAA 3FXRA 2KJCA 1KU3A 3FXUA 2JPBA 5KK1A 5IT9Z 3LAJA 1SD7A 2F5DA 2Z5UA 2EFOA 2NNNA 2PMHA 3TQNA 1EH6A 1F9NA 1HSJA 4IPAA 2VBWA 5HDNA 2ETHA 1BBYA 2DAOA 1XDUA 4GO1A 3ZN0A 3COAC 1R23A 5J6XA 3RI4A 4Q5SF 2XAFA 1U2WA 4A2UA 5L3DA 2A68F 1F4KA 2IT0A 4HDVA 2P5KA 2ZNYA 2P5LC 3S2WA 4EMSA 4U88A 2A69F 1IW7F 5D6FA 4KIGA 1J5YA 2STWA 2W84A 1KQ9A 1R22A 3P7NA 4DNCA 4L0YB 2XAJA 3QRFF 1RUOA 1BIBA 2DPUA 1EH7A 3D5LA 5CJ9A 1B4AA 4IRIA 2FQ3A 2CO5A 4EJOA 3CUQB 1BN5A 1XGOA 2PEXA 4YIIA 1X3UA 4E70A 1KA8A 3BOQA 2BE5F 5LGNA 3GX4X 1R1VA 1GVJA 1JE8A 1UB9A 2HQRA 4N0BA 1YS6A 5BPDA 2EB7A 1O3RA 2MC3A 1D5VA 2A6HF 3MQ0A 3F8NA 3H92A 3TO6A 1XSXA 4KUMA 1BIAA 4KMFA 1IN7A 3WTSC 1ZN2A 1YO5C 3QOPA 1G3TA 4JQFA 1U3EM 1XGNA 2JSCA 2PG4A 3W6JB 2RVCA 4HX4A 2G9WA 3ROUA 4WK8F 3ZMTA 3J80K 2H6BA 2XKOA 4RAZA 4YFNF 1QO0D 2E7WA 2PN6A 2RNJA 4OMZA 2F5EA 2IW5A 3GO5A 2QWWA 2A5YB 5DCMA 2EV6A 1BI0A 2Z9OA 2ZMEB 1QBJA 4L9VA 2UWMA 3WE2A 5JVTA 3R0AA 1HBXG 3VB2A 1FBUA 1WKMA 1ZARA 3U9GA 2HOEA 4ZYHA 4GGGA 1STZA 5HDGA 2VN2A 2FNAA 2CGPA 4EV0A 2H6CA 4G7OF 5D4RA 1U6GA 3M7GA 2ELHA 4NQWA 3ERED 5D8LB 4CO8A 1T39A 4HDUA 5HLIA 2QBYB 2QZ8A 3AAFA 3C18A 3GYHX 3LQQA 2OBPA 1W5TA 4QWQA 2E1NA 4WXCA 1LEBA 3I59A 3DP7A 3FMQA 1H0MA 3LFKA 3WTZA 2XAQA 1JGSA 2L01A 2HGCA 1SFXA 5H6QA 2KIUA 4CICA 3HSEA 3FMRA 5EEGA 4RGUA 3Q9SA 3QAHA 1LQ1A 3M1EA 1XCVA 5CVIA 2W85A 4P96A 2PI0A 4FX0A 4UV8A 2JT1A 5ICCA 3MWMA 3FZVA 1FP2A 3BDDA 3J81Z 2IVMA 1U5TB 5HS8A 3F6VA 1S8NA 3QP5A 2ZFWA 2DTRA 3RYPA 3DKWA 3KP3A 3ABTA 2EFPA 1MKMA 2NS0A 3RDIA 1KU2A 4AIJA 3JTHA 1LEAA 1TNSA 3R61A 1SD5A 1BM9A 4HV6A 3GFIA 4EJWA 1NHAA 4I0AA 4AD9A 3FHZA 2V1DA 1G4DA 2G7HA 4RB1A 2Y48A 4K2EA 4ASNA 4PDKA 4UUVA 1B9MA 3GW2A 5DV5A 3BZ6A 5D5XB 1P4XA 2PBIA 2QQAA 1IN6A 3E3VA 4HOBA 2Y75A 1IUYA 4HLXA 2XIGA 4G94A 4H0EA 2PJPA 5D5UB 3BJAA 4RS8A 1HXDA 4G9YA 2RGVA 5CVRA 2COMA 3DEUA 2B0LA 2PQ8A 1FP1D 3CUQC 4ETSA 3LA2A 5JFRA 1K78A 2KIFA 4UVBA 1F1ZA 4AIHA 1AOYA 3E6CC 2E7XA 2Z3YA 4OU0A 3V8LA 2FSWA 3KETA 2CQKA 3CO7C 1T98A 1J9IA 3WTVC 4LLNA 1FC3A 4HF2A 4L9TA 1MD0A 2Z33A 1DP7P 4L18B 1W7PD 4HF0A 1IRGA 4Z2YA 4RB0A 5ED4A 2ZBKA 1TQMA 4WWCA 3ELKA 2LDUA 4KFCA 5L3BA 5CVVA 2QVOA 4L9JA 3L7WA 2QLZA 3ULQB 4JK1X 2W57A 3U2RA 2J5PA 1OPCA 4O6JA 2NNYA 3IWZA 3KE2A 4BQAA 1J7KA 3KFWX 2ISZA 1DPUA 4R1HA 3O2PE 2VBYA 3HYIA 1ZHFA 3IKTA 1XN7A 4CYDA 1YYVA 3SXYA 4R8HA 2WV0A 1YFHA 3L9FA 4HX7A 3TOAA 3BY6A 1R5HA 3C3WA 4I01A 3TDZC 4ESFA 1SAXA 2R7DA 1B1BA 1CF7B 1GXPA 1IN4A 1UHWA 4M6YA 2EA4A 3O6BB 3PQJA 2IA2A 1TLHB 4CHUA 1QGPA 2FU4A 2OAZA 5E1ZB 1YW8A 5TRDA 3WTTC 2P4WA 4ESBA 2KKOA 2V9VA 2RDPA 4N9HA 1YQAA 1JHHA 5D5VB 3T0YA 2QENA 3KP5A 5FLXZ 2O61A 2Q2EA 3QPHA 5D5WB 1FBQA 3B02A 3E5XA 3QPTA 1W5SA 3GFJA 2DT5A 3WTYC 4L5JA 4OIOF 1D3YA 1FOKA 2O03A 1FBSA 2XVCA 2VC0A 2L4AA 4CDGA 1BI2A 3VOEA 1TW3A 1P92A 2MH2A 2ZKZA 1LDJA 1F5TA 2FXAA 1SMYF 2TDXA 5F1RA 4LG0A 1ODDA 4UHTA 1O3SA 3LA7A 4MEYF 4KN7X 3VFZA 2UZKA 1ZLKA 2W24A 4NHJA 5BPIA 1U5TC 3F21A 2ESHA 1RI7A 3F8CA 1V4RA 2GZWA 2GAUA 4RB3C 4QLCU 2P7VB 1SFEA 4RGXA 3ECOA 2YPRA 3RKXA 4ZZLA 3LQRA 3HRMA 4FT8A 3KLOA 1P4AA 1GHCA 5IT3A 3WGIA 2WTEA 3F22A 2DLLA 4G6QA 1ULYA 2MH9A 2QUFA 3OV8A 1EV7A 3HOTA 3L09A 2IP2A 2HTJA 4ZZDA 3WG9A 1HKTA 1T38A 4IVNA 3GZ6A 2VBXA 2YR2A 4GYIA 1ZG1A 1IZ1A 1CGPA 2PLYA 4CZZA 5ILSA 1FWZA 2IA0A 1WWXA 1IAWA 2CW0F 3FF5A 5LRSA 2M1BA 2OD5A 1O7LA 3DF8A 4OIPF 2DW4A 4HW0A 2EWNA 2XASA 1OYWA 4XBFA 2DQLA 3SQNA 4ENJA 4CXFA 1SMTA 4UVAA 2WC2A 1R5GA 2UXXA 1FZPB 3KP2A 4DQ2A 2K4JA 4IJAA 2FEZA 1FNNA 2PMUA 4ESJA 1YTYA 2NRAC 1ON1A 5LLQA 4OIRF 2K02A 4HBLA 3PFIA 4FHTA 2CSOA 2K27A 3CUQA 4BNCA 3ZMSA 4BAYA 2LSOA 3DPLC 4I7HA 2Z99A 1KU9A 4S05A 3GZ5A 2BGCA 4EGZA 2AS5F 3ISPA 1XSVA 2DPDA 3LAPA 4UVCA 4XRFA 4RAYA 5AIQA 4XLNF 1ZGJA 1ZYRF 3E6DA 1Y0UA 3IKVA 4HX8A 3I58A 4D0PA 4LLLA 2M8EA 2O6GE 4PGGA 2XROA 3FWEA 1O3TA 4YG2F 2L02A 4M74A 4A12A 3V4GA 1TW2A 1MDMB 2VOPA 1OR7A 4BXUA 3M9AA 3R4KA 4P55A 1KYZA 4KMUX 5LGUA 3HRSA 1LDKB 1WI9A 1J2XA 4I98B 4G7HF 3T8TA 2DU9A 1TBXA 3N4MA 3E5UA 3K9TA 5TJJA 2HYGD 2XRNA 3WGHA 1FT9A 3MZHA 4P9FA 3DPTA 4IRGA 2CG4A 4HQEA 2YU3A 3RKYA 4PZJA 2NAZA 3R0JA 2A3SA 5DCMB 3ZMUA 1D8KA 1USSA 6PAXA 5HOOA 1ZH5A 5LBQA 2DK8A 4G7ZF 3N97A 5LEKA 2IRFG 1JXSA 2RQPA 5DUKA 5BMZA 1ZRFA 4G8XA 4OOIA 3IHUA 5K5QA 4KIFA 3H3ZA 2DK5A 1FYLA 3WTWC 2R7FA 3J7AO 3V8KA 3K2ZA 3HOSA 5LEJA 1XMKA 2FBKA 5J8FA 1DDNA 2XAHA 5A2QK 4KN4X 4MNUA 1XB4A 3Q5FA 4FX4A 3R6SA 2EJRA 3EYIA 3KLNA 4LJZF 1I6XA 3RKWA 4U0VA 5E8IA 3F8BA 3F3XA 1I1GA 5IT9K 2CWEA 4GXOA 2V6CA 1P2FA 1AWCA 3FM3A 1B9NA 3GFLA 2HEOA 4HAMA 5L3FA 4A0XA 1FX7A 3VODA 2A61A 2EFNA 3M8FA 1FYMA 1U5TA 3BJOA 1Z6TA 2Q0OA 4L9NA 3RPUA 2PFBA 2NYXA 3JAMZ 5H6RA 1RZ4A 1O7FA 3NQOA 2VE8A 1R36A 1WSUA 3E5QA 3MZYA 1BOAA 4EQQA 1A04A 2RN7A 2GXGA 2P5VA 3CJNA 3VEPA 5LGTA 3CO6C 1TNTA 3ZN1A 1JHFA 3E6MA 1PUEE 4A0ZA 1E17A 3KZYA 3KZZA 5CVUA 1K79A 2D1VA 3MFKA 5CYVA 5DEQA 5FB2A 2F5CA 1J0RA 2JRTA 4OIQF 4KDPA 2V79A 2EV0A 4UNOA 3P9KA 4LD5A 3DXJF 5ICEA 4LMYA 3HIFA 2ACJA 3GWZA 3ECHA 2OQGA 1RIOH 3REOA 1YW7A 2X4HA 3IRQA 1UCRA 4ON0A 5JI6A 2XV4S 3I54A 4EM0B 4IHTA 2QM3A 4EM1A 2XGXA 3K1MA 1K78B 1P6RA 2E1CA 5DYMA 4BHPA 2XUBA 2LF7A 1HKQA 2ZO4A 3QU3A 4WXDA 5F64A 2STTA 1Z91A 4EJTA 4OMYA 3B73A 4ZYEA 2EA2A 3GFMA 3KP6A 3I0TA 4XSZF 5BS6A 2F2EA 1HW2A 3I5UA 2JTVA 5HS9A 1XSDA 1SFUA 1BI3A 3I53A 4S04A 3EDPA 1Z6RA 2UXNA 5FD5A 1O3QA 4N9IA 2J5OA 1REPC 3F8FA 1R1TA 3FX3A 1ZREA 2FMLA 5CLSA 3HRTA 3NEUA 3SFZA 2DI3A 3H3UA 4A6EA 4M71A 1O57A 2DQRA 4O3MA 2HR3A 3HHHA 4PCQA 1YW9A 1R58A 1ZG3A 1QNTA 3D0SA 4ZYDA 1W7PA 5DCFA 2EFQA 2ZCWA 1B6AA 5LHIA 2QQBA 2V1XA 2D1HA 3IC7A 4L0ZB 3KEQA 1S7OA 3J80Z 1S7AA 2L4MA 3KP7A 1LJ9A 1DUXC 2OQRA 1IF1A 4U0WA 2XAGA 1ON2A 2W25A 4HF1A 2D45A 3V8JA 1HW1A 3ZMDA 1PDNC 3LWFA 1LB2A 2HKOA 1UHMA 2CFXA 1VTNC 1G3SA 4Q48A 1TTYA 2BBYA 3BROA 4O5VA 3J81K 1BC8C 3NRVA 1LDDA 4IF4A 4KICA 2Q8KA 4KYWA 2KJBA 4LB6B 4LG0B 2HDCA 1C0WA 4A5MA 3K0LA 4JBAA 4Y13A 1ZRDA 1OMIA 2HQNA 2HTSA 2DO7A 2MLKA 3EYYA 2BV6A 1EH8A 2P6SA 3ZP5A 2O0YA 3P9CA 2QQ9A 1OKRA 3TO9A 1KQ0A 2HZTA 3FXQA 3F8MA 4WX9A 1R00A 3ZPLA 1I5ZA 4TV7A 3W6KB 2Y0MA 5AONA 1PP7U 2LNBA 4MGRA 3BJ6A 1Q1HA 5LRRA 3GXOA 3HUGA 1WQ2A 1KQ8A 3RTRA 3F6OA 5ICGA 3DFGA 3JW4A 3V7SA 4AIKA 2VT3A 2G7UA 2MLGA 4EGYA 5DDGA 5ICFA 2YX7A 1FSEA 3C7JA 2M5WA 4Q47A 4HA8A 2FBIA 4F7ZA 2K86A 1U8RA 1T2KA 4PGHA 1S3JA 4AVPA 2O8XA 3WU0A 1UFMA 4WCGA 3WU1B 1DPRA 3JSPA 2D2WA 2GIVA 1KGSA 4I09A 3HTUA 5KVRA 3ZMZA 3EUHA 3GUDA 5HDKA 1QQIA 1IXSB 3EETA 2C6YA 3CTAA 3SZTA 4ENMA 1TQIA 1HKSA 2MBFA 1SD6A 4B8XA 3BPXA 2YSRA 2P8TA 2FF4A 5E1XA 2EV5A 2DBBA 4B09A 4AWXB 4OINF 1D8JA 1J75A 2M87A 5E8GA 2FOKA 4LLGF 1MJAA 1S6LA 4ZH4F 1P4WA 5D6EA 2VOOA 1L0OC 5D4SA 2V1UA 2M30A 2A07F 1TQPA 3IRRA 1PP8F 1HW5A 2O3FA 3ABUA 1FSHA 1XGSA 1MDMA 3KCCA 2OZ6A 4BHBA 5BQTA 4M9XA 2WWYA 1T6SA 2JPCA 4ENKA 1YG2A 3FMSA 1ZRCA 3KEOA 2VBZA 5K5RA 1FYKA 4I0BA 3CLOA 3HTSB 1W4MA 2HYFA 1I1SA 3I4PA 2JZYA 5K1YA 3JTGA 3QU6A 3MEXA 5FLXK 2XHKA 3C1DA 3WTXC 4CGZA 3SHFA 2ESNA 3TO7A 2ZMEA 2IPQX 2H27A 3DV8A 5DD4A 1J59A 2EFWA 5D8KB 1L3LA 4I02A 2VE9A 3PQKA 2OZUA 1MJBA 1Z1DA 3TDUC 2FA5A 1I27A 2BYVE 2VT2A 4U0YA 4UV9A 4WXHA 2ISYA 1U78A 5E18F 2RV8A 4HYEA 1YS7A 2QBYA 4MHGA 4YFKF 2DFIA 2ADUA 1K6OA 5E17F 5L3CA 2BEOA 3WODF 3T1BA 3EQLF 3TOBA 1MJ9A 3R60A 3BP8A 3I59B 2MA3A 1ZGAA 2L54A 2X0LA 3I71A 2LKPA 1Z7UA 4LFUA 3V7RA 4LK0F 4I2OA 4ENNA 4LK1F 1QZYA 3T8RA 1K7AA 2A6EF 3HSRA 1KYWA 3GF2A 2K7LA 3L2CA 5DUIA 4MQ9F 1E2XA 5HLHA 2F5FA 2GQQA 1YLFA 1SD4A 5FO5A 2FMYA 3K69A 2M45A 5HLGA 2H09A 3V7CA 1T0FA 2RKHA 4RGSA 5AIPA 1H9TA 1RUNA 2FBHA 4YFXF 3G73A 4MQVA 2ZNZA 1IXRC 2HFHA 1USTA 4KA4A 5ERIA 3G3ZA 5HS7A 5LHGA 4M6XA 5F6FA 5DD8A 2GA1A 1Z9CA 3CDHA 3MCZA 3WGGA 4UXNA 1MZBA 1V3FA 1OYIA 3O3KA 2ZXJA 1GXQA 1G6NA 4U7BA 2K4BA 2GA2A 2OA4A 3ZQ7A 4G6DA 4KNYA 4IXAA 4EVIA 4LGWA 4P9UA 1IN5A 3BWGA 4XLPF 2HKXA 1IXCA 5FFXA 4KIBA 1XGMA 5HVQC 1BI1A 1QZZA 5LHHA 3K1NA 5FFZA 3E97A 1LVAA 2CYYA 2QYOA 3HSFA 4R79A 3DQVC 3FM5A 3K1PA 3T5XA 4RGRA 1IRFA 2L3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GXB A;  3QP6 A;  5EEH A;  2EK5 A;  3TKY A;  3ZMV A;  4P5O A;  4Q4Z F;  1WRJ A;  2HS5 A;  1FPQ A;  3KP4 A;  2VON A;  4IHS A;  5ILV A;  2H94 A;  4L5I A;  2FE3 A;  5FD6 A;  1XCB A;  4A5N A;  4LB5 A;  3WTU C;  1ZG5 A;  3I64 A;  4U7D A;  1RNL A;  5E1W A;  3RYR A;  4RB2 C;  4A6D A;  3P9I A;  3HHG A;  4MTD A;  1IN8 A;  5E20 A;  4HQM A;  1HST A;  3BPV A;  4GYG A;  3GLX A;  2AXL A;  1MGT A;  4KT5 C;  3ML6 A;  3LA3 A;  1FY7 A;  4Y17 A;  5CVJ A;  1S29 A;  2FRH A;  4A0Y A;  1R7J A;  1XDS A;  2OU2 A;  2XKP A;  3TGN A;  1OYY A;  1CF7 A;  3E6B A;  3SZP A;  3LST A;  1BJA A;  2FNP A;  3RIR A;  2IA1 A;  5ILU A;  1ZLJ A;  1XD7 A;  5H20 A;  1W7P B;  5BOX A;  3F23 A;  4MEX F;  3IWF A;  3GEZ A;  1G3Y A;  2LF8 A;  2HWV A;  3M8E A;  4EJV A;  3U1D A;  3RJP A;  2KRF A;  5L3E A;  4BYY A;  4NB5 A;  4EM2 A;  4HV5 A;  3OOP A;  1BC7 C;  3MAJ A;  3RPQ A;  5K5O A;  3JSO A;  1ONV A;  2MD5 A;  4EJU A;  2KIM A;  2RC4 A;  1KU7 A;  1H9G A;  5L3G A;  5JR3 A;  1YIO A;  4M72 A;  5JHU A;  3Q9V A;  2YX4 A;  1B59 A;  1HQC A;  4M73 A;  2VC1 A;  2P6T A;  3L00 A;  3WE3 A;  4IRH A;  3CUO A;  3JAM K;  2IJL A;  5FGM A;  4ZYG A;  1R1U A;  1QPM A;  1Z05 A;  4HZF A;  4M9S A;  3HRU A;  1LNW A;  1ZAO A;  2P7C B;  1FLI A;  3IL2 A;  2R3S A;  2GWR A;  3F72 A;  4Y15 A;  4M9Z A;  5J8C A;  4BH9 A;  5A2Q Z;  4BHC A;  4WF2 A;  4HLY A;  2VXZ A;  4GCV A;  2ZJ2 A;  1G3W A;  4XSX F;  4MTE A;  4YIF A;  2VOD A;  1XMA A;  3GVA A;  3FXR A;  2KJC A;  1KU3 A;  3FXU A;  2JPB A;  5KK1 A;  5IT9 Z;  3LAJ A;  1SD7 A;  2F5D A;  2Z5U A;  2EFO A;  2NNN A;  2PMH A;  3TQN A;  1EH6 A;  1F9N A;  1HSJ A;  4IPA A;  2VBW A;  5HDN A;  2ETH A;  1BBY A;  2DAO A;  1XDU A;  4GO1 A;  3ZN0 A;  3COA C;  1R23 A;  5J6X A;  3RI4 A;  4Q5S F;  2XAF A;  1U2W A;  4A2U A;  5L3D A;  2A68 F;  1F4K A;  2IT0 A;  4HDV A;  2P5K A;  2ZNY A;  2P5L C;  3S2W A;  4EMS A;  4U88 A;  2A69 F;  1IW7 F;  5D6F A;  4KIG A;  1J5Y A;  2STW A;  2W84 A;  1KQ9 A;  1R22 A;  3P7N A;  4DNC A;  4L0Y B;  2XAJ A;  3QRF F;  1RUO A;  1BIB A;  2DPU A;  1EH7 A;  3D5L A;  5CJ9 A;  1B4A A;  4IRI A;  2FQ3 A;  2CO5 A;  4EJO A;  3CUQ B;  1BN5 A;  1XGO A;  2PEX A;  4YII A;  1X3U A;  4E70 A;  1KA8 A;  3BOQ A;  2BE5 F;  5LGN A;  3GX4 X;  1R1V A;  1GVJ A;  1JE8 A;  1UB9 A;  2HQR A;  4N0B A;  1YS6 A;  5BPD A;  2EB7 A;  1O3R A;  2MC3 A;  1D5V A;  2A6H F;  3MQ0 A;  3F8N A;  3H92 A;  3TO6 A;  1XSX A;  4KUM A;  1BIA A;  4KMF A;  1IN7 A;  3WTS C;  1ZN2 A;  1YO5 C;  3QOP A;  1G3T A;  4JQF A;  1U3E M;  1XGN A;  2JSC A;  2PG4 A;  3W6J B;  2RVC A;  4HX4 A;  2G9W A;  3ROU A;  4WK8 F;  3ZMT A;  3J80 K;  2H6B A;  2XKO A;  4RAZ A;  4YFN F;  1QO0 D;  2E7W A;  2PN6 A;  2RNJ A;  4OMZ A;  2F5E A;  2IW5 A;  3GO5 A;  2QWW A;  2A5Y B;  5DCM A;  2EV6 A;  1BI0 A;  2Z9O A;  2ZME B;  1QBJ A;  4L9V A;  2UWM A;  3WE2 A;  5JVT A;  3R0A A;  1HBX G;  3VB2 A;  1FBU A;  1WKM A;  1ZAR A;  3U9G A;  2HOE A;  4ZYH A;  4GGG A;  1STZ A;  5HDG A;  2VN2 A;  2FNA A;  2CGP A;  4EV0 A;  2H6C A;  4G7O F;  5D4R A;  1U6G A;  3M7G A;  2ELH A;  4NQW A;  3ERE D;  5D8L B;  4CO8 A;  1T39 A;  4HDU A;  5HLI A;  2QBY B;  2QZ8 A;  3AAF A;  3C18 A;  3GYH X;  3LQQ A;  2OBP A;  1W5T A;  4QWQ A;  2E1N A;  4WXC A;  1LEB A;  3I59 A;  3DP7 A;  3FMQ A;  1H0M A;  3LFK A;  3WTZ A;  2XAQ A;  1JGS A;  2L01 A;  2HGC A;  1SFX A;  5H6Q A;  2KIU A;  4CIC A;  3HSE A;  3FMR A;  5EEG A;  4RGU A;  3Q9S A;  3QAH A;  1LQ1 A;  3M1E A;  1XCV A;  5CVI A;  2W85 A;  4P96 A;  2PI0 A;  4FX0 A;  4UV8 A;  2JT1 A;  5ICC A;  3MWM A;  3FZV A;  1FP2 A;  3BDD A;  3J81 Z;  2IVM A;  1U5T B;  5HS8 A;  3F6V A;  1S8N A;  3QP5 A;  2ZFW A;  2DTR A;  3RYP A;  3DKW A;  3KP3 A;  3ABT A;  2EFP A;  1MKM A;  2NS0 A;  3RDI A;  1KU2 A;  4AIJ A;  3JTH A;  1LEA A;  1TNS A;  3R61 A;  1SD5 A;  1BM9 A;  4HV6 A;  3GFI A;  4EJW A;  1NHA A;  4I0A A;  4AD9 A;  3FHZ A;  2V1D A;  1G4D A;  2G7H A;  4RB1 A;  2Y48 A;  4K2E A;  4ASN A;  4PDK A;  4UUV A;  1B9M A;  3GW2 A;  5DV5 A;  3BZ6 A;  5D5X B;  1P4X A;  2PBI A;  2QQA A;  1IN6 A;  3E3V A;  4HOB A;  2Y75 A;  1IUY A;  4HLX A;  2XIG A;  4G94 A;  4H0E A;  2PJP A;  5D5U B;  3BJA A;  4RS8 A;  1HXD A;  4G9Y A;  2RGV A;  5CVR A;  2COM A;  3DEU A;  2B0L A;  2PQ8 A;  1FP1 D;  3CUQ C;  4ETS A;  3LA2 A;  5JFR A;  1K78 A;  2KIF A;  4UVB A;  1F1Z A;  4AIH A;  1AOY A;  3E6C C;  2E7X A;  2Z3Y A;  4OU0 A;  3V8L A;  2FSW A;  3KET A;  2CQK A;  3CO7 C;  1T98 A;  1J9I A;  3WTV C;  4LLN A;  1FC3 A;  4HF2 A;  4L9T A;  1MD0 A;  2Z33 A;  1DP7 P;  4L18 B;  1W7P D;  4HF0 A;  1IRG A;  4Z2Y A;  4RB0 A;  5ED4 A;  2ZBK A;  1TQM A;  4WWC A;  3ELK A;  2LDU A;  4KFC A;  5L3B A;  5CVV A;  2QVO A;  4L9J A;  3L7W A;  2QLZ A;  3ULQ B;  4JK1 X;  2W57 A;  3U2R A;  2J5P A;  1OPC A;  4O6J A;  2NNY A;  3IWZ A;  3KE2 A;  4BQA A;  1J7K A;  3KFW X;  2ISZ A;  1DPU A;  4R1H A;  3O2P E;  2VBY A;  3HYI A;  1ZHF A;  3IKT A;  1XN7 A;  4CYD A;  1YYV A;  3SXY A;  4R8H A;  2WV0 A;  1YFH A;  3L9F A;  4HX7 A;  3TOA A;  3BY6 A;  1R5H A;  3C3W A;  4I01 A;  3TDZ C;  4ESF A;  1SAX A;  2R7D A;  1B1B A;  1CF7 B;  1GXP A;  1IN4 A;  1UHW A;  4M6Y A;  2EA4 A;  3O6B B;  3PQJ A;  2IA2 A;  1TLH B;  4CHU A;  1QGP A;  2FU4 A;  2OAZ A;  5E1Z B;  1YW8 A;  5TRD A;  3WTT C;  2P4W A;  4ESB A;  2KKO A;  2V9V A;  2RDP A;  4N9H A;  1YQA A;  1JHH A;  5D5V B;  3T0Y A;  2QEN A;  3KP5 A;  5FLX Z;  2O61 A;  2Q2E A;  3QPH A;  5D5W B;  1FBQ A;  3B02 A;  3E5X A;  3QPT A;  1W5S A;  3GFJ A;  2DT5 A;  3WTY C;  4L5J A;  4OIO F;  1D3Y A;  1FOK A;  2O03 A;  1FBS A;  2XVC A;  2VC0 A;  2L4A A;  4CDG A;  1BI2 A;  3VOE A;  1TW3 A;  1P92 A;  2MH2 A;  2ZKZ A;  1LDJ A;  1F5T A;  2FXA A;  1SMY F;  2TDX A;  5F1R A;  4LG0 A;  1ODD A;  4UHT A;  1O3S A;  3LA7 A;  4MEY F;  4KN7 X;  3VFZ A;  2UZK A;  1ZLK A;  2W24 A;  4NHJ A;  5BPI A;  1U5T C;  3F21 A;  2ESH A;  1RI7 A;  3F8C A;  1V4R A;  2GZW A;  2GAU A;  4RB3 C;  4QLC U;  2P7V B;  1SFE A;  4RGX A;  3ECO A;  2YPR A;  3RKX A;  4ZZL A;  3LQR A;  3HRM A;  4FT8 A;  3KLO A;  1P4A A;  1GHC A;  5IT3 A;  3WGI A;  2WTE A;  3F22 A;  2DLL A;  4G6Q A;  1ULY A;  2MH9 A;  2QUF A;  3OV8 A;  1EV7 A;  3HOT A;  3L09 A;  2IP2 A;  2HTJ A;  4ZZD A;  3WG9 A;  1HKT A;  1T38 A;  4IVN A;  3GZ6 A;  2VBX A;  2YR2 A;  4GYI A;  1ZG1 A;  1IZ1 A;  1CGP A;  2PLY A;  4CZZ A;  5ILS A;  1FWZ A;  2IA0 A;  1WWX A;  1IAW A;  2CW0 F;  3FF5 A;  5LRS A;  2M1B A;  2OD5 A;  1O7L A;  3DF8 A;  4OIP F;  2DW4 A;  4HW0 A;  2EWN A;  2XAS A;  1OYW A;  4XBF A;  2DQL A;  3SQN A;  4ENJ A;  4CXF A;  1SMT A;  4UVA A;  2WC2 A;  1R5G A;  2UXX A;  1FZP B;  3KP2 A;  4DQ2 A;  2K4J A;  4IJA A;  2FEZ A;  1FNN A;  2PMU A;  4ESJ A;  1YTY A;  2NRA C;  1ON1 A;  5LLQ A;  4OIR F;  2K02 A;  4HBL A;  3PFI A;  4FHT A;  2CSO A;  2K27 A;  3CUQ A;  4BNC A;  3ZMS A;  4BAY A;  2LSO A;  3DPL C;  4I7H A;  2Z99 A;  1KU9 A;  4S05 A;  3GZ5 A;  2BGC A;  4EGZ A;  2AS5 F;  3ISP A;  1XSV A;  2DPD A;  3LAP A;  4UVC A;  4XRF A;  4RAY A;  5AIQ A;  4XLN F;  1ZGJ A;  1ZYR F;  3E6D A;  1Y0U A;  3IKV A;  4HX8 A;  3I58 A;  4D0P A;  4LLL A;  2M8E A;  2O6G E;  4PGG A;  2XRO A;  3FWE A;  1O3T A;  4YG2 F;  2L02 A;  4M74 A;  4A12 A;  3V4G A;  1TW2 A;  1MDM B;  2VOP A;  1OR7 A;  4BXU A;  3M9A A;  3R4K A;  4P55 A;  1KYZ A;  4KMU X;  5LGU A;  3HRS A;  1LDK B;  1WI9 A;  1J2X A;  4I98 B;  4G7H F;  3T8T A;  2DU9 A;  1TBX A;  3N4M A;  3E5U A;  3K9T A;  5TJJ A;  2HYG D;  2XRN A;  3WGH A;  1FT9 A;  3MZH A;  4P9F A;  3DPT A;  4IRG A;  2CG4 A;  4HQE A;  2YU3 A;  3RKY A;  4PZJ A;  2NAZ A;  3R0J A;  2A3S A;  5DCM B;  3ZMU A;  1D8K A;  1USS A;  6PAX A;  5HOO A;  1ZH5 A;  5LBQ A;  2DK8 A;  4G7Z F;  3N97 A;  5LEK A;  2IRF G;  1JXS A;  2RQP A;  5DUK A;  5BMZ A;  1ZRF A;  4G8X A;  4OOI A;  3IHU A;  5K5Q A;  4KIF A;  3H3Z A;  2DK5 A;  1FYL A;  3WTW C;  2R7F A;  3J7A O;  3V8K A;  3K2Z A;  3HOS A;  5LEJ A;  1XMK A;  2FBK A;  5J8F A;  1DDN A;  2XAH A;  5A2Q K;  4KN4 X;  4MNU A;  1XB4 A;  3Q5F A;  4FX4 A;  3R6S A;  2EJR A;  3EYI A;  3KLN A;  4LJZ F;  1I6X A;  3RKW A;  4U0V A;  5E8I A;  3F8B A;  3F3X A;  1I1G A;  5IT9 K;  2CWE A;  4GXO A;  2V6C A;  1P2F A;  1AWC A;  3FM3 A;  1B9N A;  3GFL A;  2HEO A;  4HAM A;  5L3F A;  4A0X A;  1FX7 A;  3VOD A;  2A61 A;  2EFN A;  3M8F A;  1FYM A;  1U5T A;  3BJO A;  1Z6T A;  2Q0O A;  4L9N A;  3RPU A;  2PFB A;  2NYX A;  3JAM Z;  5H6R A;  1RZ4 A;  1O7F A;  3NQO A;  2VE8 A;  1R36 A;  1WSU A;  3E5Q A;  3MZY A;  1BOA A;  4EQQ A;  1A04 A;  2RN7 A;  2GXG A;  2P5V A;  3CJN A;  3VEP A;  5LGT A;  3CO6 C;  1TNT A;  3ZN1 A;  1JHF A;  3E6M A;  1PUE E;  4A0Z A;  1E17 A;  3KZY A;  3KZZ A;  5CVU A;  1K79 A;  2D1V A;  3MFK A;  5CYV A;  5DEQ A;  5FB2 A;  2F5C A;  1J0R A;  2JRT A;  4OIQ F;  4KDP A;  2V79 A;  2EV0 A;  4UNO A;  3P9K A;  4LD5 A;  3DXJ F;  5ICE A;  4LMY A;  3HIF A;  2ACJ A;  3GWZ A;  3ECH A;  2OQG A;  1RIO H;  3REO A;  1YW7 A;  2X4H A;  3IRQ A;  1UCR A;  4ON0 A;  5JI6 A;  2XV4 S;  3I54 A;  4EM0 B;  4IHT A;  2QM3 A;  4EM1 A;  2XGX A;  3K1M A;  1K78 B;  1P6R A;  2E1C A;  5DYM A;  4BHP A;  2XUB A;  2LF7 A;  1HKQ A;  2ZO4 A;  3QU3 A;  4WXD A;  5F64 A;  2STT A;  1Z91 A;  4EJT A;  4OMY A;  3B73 A;  4ZYE A;  2EA2 A;  3GFM A;  3KP6 A;  3I0T A;  4XSZ F;  5BS6 A;  2F2E A;  1HW2 A;  3I5U A;  2JTV A;  5HS9 A;  1XSD A;  1SFU A;  1BI3 A;  3I53 A;  4S04 A;  3EDP A;  1Z6R A;  2UXN A;  5FD5 A;  1O3Q A;  4N9I A;  2J5O A;  1REP C;  3F8F A;  1R1T A;  3FX3 A;  1ZRE A;  2FML A;  5CLS A;  3HRT A;  3NEU A;  3SFZ A;  2DI3 A;  3H3U A;  4A6E A;  4M71 A;  1O57 A;  2DQR A;  4O3M A;  2HR3 A;  3HHH A;  4PCQ A;  1YW9 A;  1R58 A;  1ZG3 A;  1QNT A;  3D0S A;  4ZYD A;  1W7P A;  5DCF A;  2EFQ A;  2ZCW A;  1B6A A;  5LHI A;  2QQB A;  2V1X A;  2D1H A;  3IC7 A;  4L0Z B;  3KEQ A;  1S7O A;  3J80 Z;  1S7A A;  2L4M A;  3KP7 A;  1LJ9 A;  1DUX C;  2OQR A;  1IF1 A;  4U0W A;  2XAG A;  1ON2 A;  2W25 A;  4HF1 A;  2D45 A;  3V8J A;  1HW1 A;  3ZMD A;  1PDN C;  3LWF A;  1LB2 A;  2HKO A;  1UHM A;  2CFX A;  1VTN C;  1G3S A;  4Q48 A;  1TTY A;  2BBY A;  3BRO A;  4O5V A;  3J81 K;  1BC8 C;  3NRV A;  1LDD A;  4IF4 A;  4KIC A;  2Q8K A;  4KYW A;  2KJB A;  4LB6 B;  4LG0 B;  2HDC A;  1C0W A;  4A5M A;  3K0L A;  4JBA A;  4Y13 A;  1ZRD A;  1OMI A;  2HQN A;  2HTS A;  2DO7 A;  2MLK A;  3EYY A;  2BV6 A;  1EH8 A;  2P6S A;  3ZP5 A;  2O0Y A;  3P9C A;  2QQ9 A;  1OKR A;  3TO9 A;  1KQ0 A;  2HZT A;  3FXQ A;  3F8M A;  4WX9 A;  1R00 A;  3ZPL A;  1I5Z A;  4TV7 A;  3W6K B;  2Y0M A;  5AON A;  1PP7 U;  2LNB A;  4MGR A;  3BJ6 A;  1Q1H A;  5LRR A;  3GXO A;  3HUG A;  1WQ2 A;  1KQ8 A;  3RTR A;  3F6O A;  5ICG A;  3DFG A;  3JW4 A;  3V7S A;  4AIK A;  2VT3 A;  2G7U A;  2MLG A;  4EGY A;  5DDG A;  5ICF A;  2YX7 A;  1FSE A;  3C7J A;  2M5W A;  4Q47 A;  4HA8 A;  2FBI A;  4F7Z A;  2K86 A;  1U8R A;  1T2K A;  4PGH A;  1S3J A;  4AVP A;  2O8X A;  3WU0 A;  1UFM A;  4WCG A;  3WU1 B;  1DPR A;  3JSP A;  2D2W A;  2GIV A;  1KGS A;  4I09 A;  3HTU A;  5KVR A;  3ZMZ A;  3EUH A;  3GUD A;  5HDK A;  1QQI A;  1IXS B;  3EET A;  2C6Y A;  3CTA A;  3SZT A;  4ENM A;  1TQI A;  1HKS A;  2MBF A;  1SD6 A;  4B8X A;  3BPX A;  2YSR A;  2P8T A;  2FF4 A;  5E1X A;  2EV5 A;  2DBB A;  4B09 A;  4AWX B;  4OIN F;  1D8J A;  1J75 A;  2M87 A;  5E8G A;  2FOK A;  4LLG F;  1MJA A;  1S6L A;  4ZH4 F;  1P4W A;  5D6E A;  2VOO A;  1L0O C;  5D4S A;  2V1U A;  2M30 A;  2A07 F;  1TQP A;  3IRR A;  1PP8 F;  1HW5 A;  2O3F A;  3ABU A;  1FSH A;  1XGS A;  1MDM A;  3KCC A;  2OZ6 A;  4BHB A;  5BQT A;  4M9X A;  2WWY A;  1T6S A;  2JPC A;  4ENK A;  1YG2 A;  3FMS A;  1ZRC A;  3KEO A;  2VBZ A;  5K5R A;  1FYK A;  4I0B A;  3CLO A;  3HTS B;  1W4M A;  2HYF A;  1I1S A;  3I4P A;  2JZY A;  5K1Y A;  3JTG A;  3QU6 A;  3MEX A;  5FLX K;  2XHK A;  3C1D A;  3WTX C;  4CGZ A;  3SHF A;  2ESN A;  3TO7 A;  2ZME A;  2IPQ X;  2H27 A;  3DV8 A;  5DD4 A;  1J59 A;  2EFW A;  5D8K B;  1L3L A;  4I02 A;  2VE9 A;  3PQK A;  2OZU A;  1MJB A;  1Z1D A;  3TDU C;  2FA5 A;  1I27 A;  2BYV E;  2VT2 A;  4U0Y A;  4UV9 A;  4WXH A;  2ISY A;  1U78 A;  5E18 F;  2RV8 A;  4HYE A;  1YS7 A;  2QBY A;  4MHG A;  4YFK F;  2DFI A;  2ADU A;  1K6O A;  5E17 F;  5L3C A;  2BEO A;  3WOD F;  3T1B A;  3EQL F;  3TOB A;  1MJ9 A;  3R60 A;  3BP8 A;  3I59 B;  2MA3 A;  1ZGA A;  2L54 A;  2X0L A;  3I71 A;  2LKP A;  1Z7U A;  4LFU A;  3V7R A;  4LK0 F;  4I2O A;  4ENN A;  4LK1 F;  1QZY A;  3T8R A;  1K7A A;  2A6E F;  3HSR A;  1KYW A;  3GF2 A;  2K7L A;  3L2C A;  5DUI A;  4MQ9 F;  1E2X A;  5HLH A;  2F5F A;  2GQQ A;  1YLF A;  1SD4 A;  5FO5 A;  2FMY A;  3K69 A;  2M45 A;  5HLG A;  2H09 A;  3V7C A;  1T0F A;  2RKH A;  4RGS A;  5AIP A;  1H9T A;  1RUN A;  2FBH A;  4YFX F;  3G73 A;  4MQV A;  2ZNZ A;  1IXR C;  2HFH A;  1UST A;  4KA4 A;  5ERI A;  3G3Z A;  5HS7 A;  5LHG A;  4M6X A;  5F6F A;  5DD8 A;  2GA1 A;  1Z9C A;  3CDH A;  3MCZ A;  3WGG A;  4UXN A;  1MZB A;  1V3F A;  1OYI A;  3O3K A;  2ZXJ A;  1GXQ A;  1G6N A;  4U7B A;  2K4B A;  2GA2 A;  2OA4 A;  3ZQ7 A;  4G6D A;  4KNY A;  4IXA A;  4EVI A;  4LGW A;  4P9U A;  1IN5 A;  3BWG A;  4XLP F;  2HKX A;  1IXC A;  5FFX A;  4KIB A;  1XGM A;  5HVQ C;  1BI1 A;  1QZZ A;  5LHH A;  3K1N A;  5FFZ A;  3E97 A;  1LVA A;  2CYY A;  2QYO A;  3HSF A;  4R79 A;  3DQV C;  3FM5 A;  3K1P A;  3T5X A;  4RGR A;  1IRF A;  2L3D A; 
#chains in the Genus database with same CATH topology
 2GXB A;  3QP6 A;  5EEH A;  1FIP A;  2EK5 A;  3BR2 A;  3TKY A;  3ZMV A;  4P5O A;  4Q4Z F;  4PJM A;  4HNV A;  4M3B A;  1OIS A;  4A3E J;  5TIS C;  1WRJ A;  2HS5 A;  5E79 C;  2R7Q A;  3BCA A;  1FPQ A;  4F91 B;  5FRN A;  1HOM A;  3KP4 A;  2VON A;  3LSI A;  4IHS A;  5ILV A;  2H94 A;  4L5I A;  4M6V A;  2K9S A;  2FE3 A;  5FD6 A;  2GLO A;  2R7W A;  4V2G A;  3QOD A;  1XCB A;  4A5N A;  3DPU A;  2WAF A;  4LB5 A;  3OOU A;  3WTU C;  1ZG5 A;  3I64 A;  4U7D A;  1RNL A;  5E1W A;  1ZK8 A;  1UHS A;  3RYR A;  4RB2 C;  2QCO A;  3NWT A;  3DBL B;  4A6D A;  2BOL A;  1MW7 A;  3HHG A;  3P9I A;  4MTD A;  4ANJ A;  1IN8 A;  4XIC A;  5E20 A;  4HQM A;  1HST A;  3BPV A;  2ZJP F;  4GYG A;  4J19 A;  3GLX A;  2IGK A;  1NK3 P;  2AXL A;  1MGT A;  2VKD A;  2DOE A;  4C3H J;  4KT5 C;  3ML6 A;  3LA3 A;  1FY7 A;  1WPK A;  2FX0 A;  4Y17 A;  3OYA A;  4XR6 A;  5CVJ A;  3OWT A;  1S29 A;  2FRH A;  2EQR A;  4A0Y A;  1K83 J;  1R7J A;  3KX2 A;  1XDS A;  2OU2 A;  2XKP A;  3DLA A;  2MD0 A;  2V6E A;  1XC5 A;  5K7Z A;  3TGN A;  1F36 A;  4AYB A;  1OYY A;  1CF7 A;  3E6B A;  3PFY A;  3SZP A;  2EZH A;  3FIS A;  3LST A;  5K7F A;  1A35 A;  1BJA A;  2JUC A;  1MBH A;  1WVR A;  2FNP A;  3RIR A;  1XG1 A;  2IA1 A;  5ILU A;  5EF6 A;  2R93 J;  1ZLJ A;  1XD7 A;  4UY8 I;  5H20 A;  2IS4 A;  1W7P B;  5BOX A;  4A3I J;  4XM3 A;  3F23 A;  4MEX F;  2WAD A;  3IWF A;  3GEZ A;  1G3Y A;  2E2I J;  3HOY J;  2LF8 A;  2HWV A;  4YIR X;  1OCT C;  3M8E A;  4EJV A;  1WZ2 A;  3U1D A;  4MO7 A;  3BQZ A;  3RJP A;  3A4C A;  1TWA J;  2KRF A;  5L3E A;  4BYY A;  2R4G A;  4ABZ A;  2V26 A;  4NB5 A;  2TCT A;  4EM2 A;  3GTJ J;  1K4S A;  1MBK A;  4MLO A;  4HV5 A;  3HKZ A;  3PL8 A;  2K3F A;  3OOP A;  1BC7 C;  1WJF A;  3MAJ A;  3RPQ A;  5K5O A;  3JSO A;  4IO9 F;  1IG7 A;  1ONV A;  1DQU A;  2X9D A;  4BDY A;  2VLA A;  2M8G X;  2MD5 A;  4EJU A;  5IP7 J;  3RKQ A;  3RSN A;  2KIM A;  5M5X J;  2RC4 A;  1KU7 A;  3ESW B;  3A0H C;  1H9G A;  5EG0 B;  5L3G A;  5JR3 A;  1YIO A;  3FKJ A;  4QPO A;  2AQE A;  4IHW A;  3ASN H;  4M72 A;  1I3A A;  4IKF A;  2RQQ A;  5JHU A;  3NAR A;  3Q9V A;  2YX4 A;  1TWC J;  4MIM A;  1B59 A;  1RKT A;  1R4N B;  1HQC A;  3HDD A;  4M73 A;  2VC1 A;  4BEH A;  2P6T A;  3ASO H;  3L00 A;  3S17 J;  3WE3 A;  4J00 A;  4IRH A;  3CUO A;  1X19 A;  3G6E I;  1WGX A;  3JAM K;  1FEX A;  2IJL A;  5FGM A;  4ZYG A;  1R1U A;  2O9L A;  4CCM A;  3KIO A;  1QPM A;  1Z05 A;  3ZQF A;  4HZF A;  4CUG A;  2R5Y A;  1UG2 A;  2VJJ A;  2CQX A;  4M9S A;  3HRU A;  2DFF A;  2LK2 A;  1LNW A;  1ZAO A;  2P7C B;  3BQY A;  3CQZ J;  1MSF C;  3IL2 A;  2R3S A;  1FLI A;  2GWR A;  1I39 A;  3F72 A;  4Y15 A;  4E4H A;  4M9Z A;  5J8C A;  4BH9 A;  5A2Q Z;  4BHC A;  4WF2 A;  1Y0N A;  4II3 A;  4HLY A;  2VXZ A;  4GCV A;  4BE0 A;  2ZJ2 A;  1G3W A;  4XSX F;  4MTE A;  4FAS D;  4YIF A;  2HU9 A;  2VOD A;  5B66 C;  3K6G A;  1MMG A;  4YEL A;  1XMA A;  3GVA A;  4C30 A;  4PJL A;  1MSE C;  3FXR A;  5B1A H;  3OYK A;  2QA4 I;  5IPA A;  2KJC A;  1KU3 A;  3FXU A;  2W1O A;  2KFD A;  3MKZ A;  2JPB A;  5KK1 A;  1VQ7 I;  5IT9 Z;  3LAJ A;  1QRY A;  3BT9 A;  1T33 A;  3CF5 F;  1SD7 A;  2F5D A;  1JGG A;  2Z5U A;  1IRZ A;  5GPC A;  4LG3 A;  4KIT B;  1K6Y A;  2DTZ A;  4BXX J;  2EFO A;  2NNN A;  5B1B H;  2PMH A;  3TQN A;  1EH6 A;  1F9N A;  1HSJ A;  4IPA A;  2VBW A;  5HDN A;  2ETH A;  2MC4 A;  1BBY A;  1HDD C;  3LNQ A;  2W00 A;  2DAO A;  3U1K A;  1DP3 A;  1XDU A;  2CQN A;  4L5E A;  4GO1 A;  3ZN0 A;  2G0E A;  3COA C;  1Z67 A;  1BL0 A;  2IS6 A;  2Y2Z A;  3JRF A;  1R23 A;  4II2 A;  3IP4 B;  1ACI A;  4UUS B;  2MW8 A;  2WAQ N;  5J6X A;  3RI4 A;  4Q5S F;  1BJZ A;  2LC2 A;  3WG7 H;  2XAF A;  1U2W A;  3BLY A;  1BW6 A;  4A2U A;  5L3D A;  2A68 F;  3SDG A;  1F4K A;  2M4G A;  2IT0 A;  4HDV A;  2P5K A;  2ZNY A;  2P5L C;  1SVL A;  3S2W A;  2ID3 A;  3DU6 A;  1UJ8 A;  4EMS A;  4U88 A;  1OJL A;  3FIW A;  2A69 F;  1IW7 F;  1X2N A;  3DBH B;  4KIG A;  1P7I A;  3BR1 A;  5D6F A;  1J5Y A;  2HOS A;  2VAS A;  4FIS A;  2STW A;  2W84 A;  1KQ9 A;  1R22 A;  4Y33 A;  5J47 A;  1PUF A;  3P7N A;  4DNC A;  4L0Y B;  2XAJ A;  3QRF F;  2W7N A;  1RUO A;  1BIB A;  3RQI A;  1AA7 A;  1R4M B;  1S72 I;  2DPU A;  1EH7 A;  2DJN A;  3D5L A;  2R7X A;  2TRT A;  5CJ9 A;  1B4A A;  4IRI A;  2RRE A;  2FQ3 A;  2H8R A;  1V5G A;  2CO5 A;  5KCM A;  1LE8 A;  3VPR A;  2VQC A;  4EJO A;  2JMW A;  3CUQ B;  2R7Z J;  1JJ8 C;  3OYC A;  1BN5 A;  1XGO A;  2PEX A;  4YII A;  1YI2 I;  1X3U A;  1OCP A;  4E70 A;  3L2U A;  2ZXI A;  3H35 A;  1KA8 A;  3BOQ A;  3JCU C;  2BE5 F;  3JR9 A;  5LGN A;  2E2J J;  2CQQ A;  3GX4 X;  1R1V A;  4A69 C;  1GVJ A;  1SC7 A;  2K9N A;  3QPL A;  2OTJ I;  2QKL B;  2FUG 2;  2ELJ A;  2DOA A;  3MN2 A;  1JE8 A;  2KZV A;  4BBR J;  3ZQQ A;  3GCM A;  1UB9 A;  2HQR A;  1OFC X;  3RZD J;  1BA5 A;  4N0B A;  1YS6 A;  1ERD A;  5BPD A;  1TC3 C;  2EB7 A;  2Y9Z A;  1O3R A;  2MC3 A;  1HF0 A;  2GXA A;  2BHY A;  1D5V A;  1IRX A;  4CYC B;  2A6H F;  3MQ0 A;  4A3D J;  3F8N A;  4LOC A;  3C2G A;  1APL C;  1EJ9 A;  2DN0 A;  9ANT A;  3H92 A;  3TO6 A;  1XSX A;  2Y69 H;  1D1B A;  1ETV A;  4KUM A;  1BIA A;  2CW7 A;  5E3M A;  3MVP A;  4KMF A;  1IN7 A;  2XPU A;  4LIT A;  3WTS C;  1ZN2 A;  1YO5 C;  3BR0 A;  3QOP A;  1VZ0 A;  1G3T A;  4PJ0 C;  1MMA A;  4JQF A;  4Y7N J;  3IH4 A;  4BU2 A;  1U3E M;  1LFB A;  1DGW Y;  1HA8 A;  1XGN A;  2Z1D A;  2JSC A;  2PG4 A;  4GFB A;  1IDZ A;  3W6J B;  1IV6 A;  2RVC A;  4QPQ A;  4HX4 A;  2G9W A;  3ROU A;  4WK8 F;  1S7E A;  3ZMT A;  1D0Y A;  3J80 K;  2H6B A;  2XKO A;  2XPW A;  4RAZ A;  4DBQ A;  2QGU A;  4YFN F;  2M7A A;  1QO0 D;  2E7W A;  4IQJ A;  2PN6 A;  2RNJ A;  4OMZ A;  3TMO A;  3IH2 A;  5J3L A;  4PSX A;  1T08 B;  2F5E A;  1MNM C;  2IW5 A;  4I6Z A;  2NVY J;  1I6H J;  2CH0 A;  2QWW A;  3GO5 A;  2A5Y B;  2KDZ A;  1MMN A;  5DCM A;  3K7A J;  1WFX A;  3WHC A;  2EV6 A;  3TED A;  1FTT A;  1BI0 A;  4P1W A;  3BZC A;  5KAI C;  4A93 J;  5IP9 J;  3FBI B;  2Z9O A;  3CP8 A;  3CLQ A;  2NVQ J;  2ZME B;  3DKY A;  1QBJ A;  1K61 A;  2E5Z A;  1JJ6 C;  4L9V A;  2UWM A;  3WE2 A;  3QYE A;  4Z6Y A;  4EAT A;  3EUK L;  2JSP A;  5FKN A;  3R0A A;  5JVT A;  4XID A;  1HBX G;  3HOV J;  1IC8 A;  3VB2 A;  1FBU A;  3K4M A;  1WKM A;  1ZAR A;  3U9G A;  1BR1 A;  2HOE A;  2DYS H;  3G1O A;  3KYC B;  3RPU D;  2OC6 A;  1VF9 A;  2X6Y A;  2L0K A;  4GGG A;  4ZYH A;  1STZ A;  3GTO J;  5HDG A;  2VN2 A;  2FNA A;  2CGP A;  1D1A A;  4EV0 A;  2H6C A;  3K4K A;  3BCB A;  1WJD A;  3A02 A;  4G7O F;  5D4R A;  2FQ4 A;  4JX5 A;  1U6G A;  1RRJ A;  3E0J B;  3M7G A;  2ELH A;  4NQW A;  2NVX J;  4ZTJ A;  3ERE D;  4AID A;  5D8L B;  4CO8 A;  1T39 A;  4HDU A;  3QWL A;  3CC4 I;  5HLI A;  2QBY B;  2QZ8 A;  5B5E C;  2E36 A;  3AAF A;  3C18 A;  5GAE J;  2ME6 A;  3GYH X;  3LQQ A;  3K4B A;  3D5S C;  3PJR A;  2OBP A;  3UKG A;  3A2K A;  1Y8R B;  2KQR A;  1WCM J;  1W5T A;  2PJR B;  3GTL J;  4QWQ A;  3FXL A;  2E1N A;  2E35 A;  4PK4 A;  4WXC A;  1LEB A;  3I59 A;  3DP7 A;  4D7M A;  4A3C J;  3H0D A;  4M3F A;  2XSD C;  3FMQ A;  1H0M A;  3BG3 A;  2WB1 N;  3LFK A;  2IEK A;  3WTZ A;  1W36 D;  3S1N J;  2XAQ A;  4G6T B;  1DGR M;  1JGS A;  2L01 A;  1BW5 A;  2HGC A;  1SFX A;  3GME A;  5H6Q A;  2CUE A;  2KIU A;  4CIC A;  1CQT A;  3HSE A;  3FMR A;  5EEG A;  1NTC A;  4CSW A;  3S93 A;  3PUB A;  4RGU A;  3Q9S A;  3M07 A;  3QAH A;  5KAF C;  1LQ1 A;  3M1E A;  3DTI A;  1XCV A;  5CVI A;  3S1M J;  3HB9 A;  2W85 A;  1B8I A;  4P96 A;  2PI0 A;  2R0Q C;  4FX0 A;  4UV8 A;  5F1J A;  2JT1 A;  5ICC A;  4BE1 A;  3MWM A;  4PJJ A;  3FZV A;  1FP2 A;  3BDD A;  2JVG A;  1RET A;  3LMM A;  3J81 Z;  1GV2 A;  3TW7 A;  2IVM A;  1TP4 A;  1U5T B;  5HS8 A;  3F6V A;  5BNG A;  1RR8 C;  4J01 A;  1LFU P;  1S8N A;  3QP5 A;  1ZQ3 P;  2X1C A;  3AFH A;  2ZFW A;  3JRA A;  2E2H J;  2DTR A;  3RYP A;  2XDV A;  3W2V A;  3DKW A;  2JA8 J;  4ZTF A;  3KP3 A;  2V4J C;  3ABT A;  4F93 B;  2EFP A;  1X1C A;  1MKM A;  2NS0 A;  3RDI A;  3CCU I;  1V55 H;  2HXO A;  5EDN A;  2DT6 A;  1KU2 A;  4AIJ A;  1H89 C;  3JTH A;  1LEA A;  4LIV A;  2OF7 A;  1TNS A;  3R61 A;  1UEL B;  1SD5 A;  1BM9 A;  4HV6 A;  3GFI A;  2CV1 A;  1DU6 A;  4XOT A;  1LPQ A;  5F04 A;  4EJW A;  4FET A;  1NHA A;  4I0A A;  2M2E A;  4AD9 A;  2EIK H;  2LD5 A;  3FHZ A;  3M8J A;  5IOY A;  2BVL A;  2V1D A;  1G4D A;  2G7H A;  3G2B A;  4RB1 A;  2Y48 A;  4K2E A;  4ASN A;  2WBM A;  2LTP A;  1VND A;  4PDK A;  4UUV A;  2L7K A;  4BJ5 C;  1B9M A;  2KLO A;  3GW2 A;  4DGW B;  1OCZ H;  2BVM A;  3MD2 A;  5DV5 A;  2UV1 A;  3OYH A;  3BZ6 A;  3DBR B;  3OYN A;  5D5X B;  3LSH A;  1P4X A;  3UR3 C;  2PBI A;  2QQA A;  2DCE A;  1IN6 A;  3E3V A;  1Z21 A;  2Y75 A;  4HOB A;  1IUY A;  5IOZ A;  4HLX A;  3ONQ A;  4M3D A;  3DCF A;  2PMZ A;  2XIG A;  4G94 A;  3O8H A;  4BUP A;  4H0E A;  2PJP A;  2X48 A;  5D5U B;  1O4X A;  1VQ9 I;  3OIO A;  3BJA A;  4RS8 A;  3S3N A;  2V7F A;  5LD2 C;  3I4N J;  1HXD A;  4G9Y A;  4QIW N;  1MND A;  1ETO A;  2ME0 A;  3ZQH A;  2RGV A;  5CVR A;  2CFO A;  2COM A;  1VFC A;  3DEU A;  2ECB A;  2B0L A;  2PQ8 A;  3CCS I;  1FP1 D;  2X6X A;  4PUS A;  1U8B A;  3QPS A;  1IJW C;  3CUQ C;  3I55 I;  5TGT A;  4BGD A;  4ETS A;  3LA2 A;  4CZC A;  5JFR A;  1K78 A;  2KIF A;  2R7O A;  4UVB A;  1F1Z A;  4AIH A;  1AOY A;  2CS3 A;  3E6C C;  5C4J J;  3Q0U A;  2E7X A;  2Z3Y A;  3LSP A;  4RAG A;  4OU0 A;  3V8L A;  2FSW A;  3KET A;  2DMU A;  2M0M A;  3AG3 H;  1X3W B;  2CQK A;  2MSY A;  3LL7 A;  3CO7 C;  1RES A;  3PNY A;  1T98 A;  1ZGW A;  1J9I A;  3WTV C;  4LLN A;  1FC3 A;  4CH7 A;  4D7N A;  2KT0 A;  1EKE A;  1YE9 A;  2I5U A;  2HQ5 A;  4HF2 A;  4L9T A;  1MD0 A;  2YS9 A;  2Z33 A;  1DP7 P;  4BQO A;  4L18 B;  2EIL H;  3TW6 A;  2R5Z B;  1W7P D;  4HF0 A;  5E3N A;  1YRN A;  1IRG A;  1Z7L A;  1R49 A;  3CCQ I;  4Z2Y A;  3ZRG A;  4M3G A;  4XQF A;  3GTM J;  4RB0 A;  5ED4 A;  5EZG A;  3CJT B;  3D5R C;  2L9V A;  2IGO A;  2ZBK A;  3MKW B;  1TQM A;  4WWC A;  2RAE A;  2JVH A;  2WA0 A;  3ELK A;  3VYS B;  2JRM A;  3M3Y J;  2DA4 A;  2LDU A;  2H8W A;  3CCR I;  2E71 A;  4KFC A;  2IS1 A;  1OR7 C;  5L3B A;  3G4S I;  5CVV A;  2QVO A;  3IAS 2;  4L9J A;  4ZDP A;  3L7W A;  1X4P A;  2QLZ A;  4JK1 X;  3ULQ B;  2W57 A;  3U2R A;  2OCC H;  3FXK A;  2J5P A;  1OPC A;  2V9K A;  4O6J A;  3OS1 A;  2NNY A;  3IWZ A;  3KE2 A;  1OQY A;  4RM2 A;  2V1N A;  4C2T A;  4BQA A;  3TBI A;  1J7K A;  2M0C A;  3KFW X;  2FJ1 A;  5EZH A;  2ISZ A;  1DPU A;  4R1H A;  1X3Z B;  3O8G A;  1G8X A;  3O2P E;  2VBY A;  3HYI A;  3AL0 B;  3GTG J;  4DYR A;  1ZHF A;  2P81 A;  1AKH A;  3IKT A;  2XB0 X;  1XN7 A;  1SAN A;  3A01 A;  3IV5 A;  4CYD A;  1YYV A;  3SXY A;  1WH7 A;  4R8H A;  2WV0 A;  1YFH A;  3L9F A;  4HX7 A;  3TOA A;  3BY6 A;  1Q1V A;  1R5H A;  1WH5 A;  3CJR B;  3C2B A;  3C3W A;  5IYC J;  4I01 A;  3TDZ C;  4ESF A;  1TWH J;  1W0T A;  1SAX A;  2HQA A;  3ABL H;  2R7D A;  1AU7 A;  3HBL A;  2NOG A;  1B1B A;  1ETY A;  3BTI A;  2KRH A;  1CF7 B;  2Y30 A;  1GXP A;  1IN4 A;  1UHW A;  4XLE A;  4M6Y A;  2EA4 A;  3O6B B;  3PQJ A;  2IA2 A;  1TLH B;  2AQF A;  4CHU A;  1QGP A;  3H1C A;  2FU4 A;  4UB6 C;  4DIQ A;  2COB A;  2EIN H;  1YHQ I;  2V9P A;  3FKI J;  5FKK A;  1ITY A;  1ZKG A;  2OAZ A;  5E1Z B;  1YW8 A;  5TRD A;  1K4T A;  3WTT C;  2P4W A;  4E7K A;  4ESB A;  2KKO A;  2R92 J;  2V9V A;  2RDP A;  4N9H A;  3W2W A;  1YQA A;  1JHH A;  4N4N B;  5D5V B;  3T0Y A;  3Q3S A;  1DU0 A;  3BG6 A;  2QEN A;  2HZD A;  3HPG A;  2XGC A;  3KP5 A;  5FLX Z;  2O61 A;  2Q2E A;  4BAC A;  2CRG A;  3QPH A;  5D5W B;  1FBQ A;  5DS9 A;  3B02 A;  3E5X A;  2QSH X;  3QPT A;  4JX4 A;  2HVQ A;  1W5S A;  3GFJ A;  3HPH A;  2DT5 A;  3WTY C;  3S8P A;  2BY1 A;  3CCE I;  4L5J A;  4PFO A;  3L1P A;  4OIO F;  1D3Y A;  1NH3 A;  1FOK A;  2EPF A;  2O03 A;  1FBS A;  2XVC A;  2VC0 A;  1W0U A;  3CES A;  4BY1 J;  2DOD A;  1JT0 A;  2FOW A;  2L4A A;  5FRM A;  4A3F J;  4CDG A;  1B72 A;  1BI2 A;  3VOE A;  1TW3 A;  1P92 A;  2MH2 A;  2ZKZ A;  1LDJ A;  3EUA A;  2UUZ A;  4HPQ A;  1F5T A;  2FXA A;  3L2R A;  2VKE A;  1SMY F;  2TDX A;  3H36 A;  5F1R A;  4LG0 A;  1ODD A;  3LSG A;  5M3M J;  4HST A;  2ZJQ F;  1X1P A;  1JTX A;  4UHT A;  1O3S A;  3LA7 A;  4MEY F;  4KN7 X;  3VFZ A;  2UZK A;  1ZLK A;  2W24 A;  4NHJ A;  5BPI A;  1U9N A;  4IHV A;  3CME I;  2QSF X;  4ZJZ A;  2E1M C;  1ZR4 A;  4BEH B;  4OWR B;  1U5T C;  1MMS A;  3F21 A;  2BY0 A;  2ESH A;  2X1D A;  1RI7 A;  4LIU A;  3F8C A;  4C9Y A;  1Y6I A;  2E60 A;  4DBR A;  3CD6 I;  1V4R A;  3K4J A;  2R5Y B;  2GZW A;  2GAU A;  4RB3 C;  4QLC U;  2P7V B;  1SFE A;  4RGX A;  5CPR B;  3ECO A;  2YPR A;  3H5A A;  3RKX A;  4ZZL A;  3LQR A;  2KL4 A;  3EPZ A;  3DEW A;  3HRM A;  3HXL A;  4B1R A;  4FT8 A;  3K70 D;  1ZEL A;  3KLO A;  1P4A A;  2HVS A;  2LH9 A;  2AXT C;  4RAF A;  3FBN B;  4AUX A;  2EIJ H;  3OYD A;  2LY2 A;  1SAU A;  1GHC A;  5IT3 A;  3WGI A;  2WTE A;  4CCK A;  4D9J A;  3F22 A;  2DLL A;  4G6Q A;  2MYS A;  4XL9 A;  4QSH A;  1ULY A;  2MH9 A;  4XRM A;  2QUF A;  4H4K C;  1M1E B;  3OV8 A;  2QSG X;  2R7R A;  4DOZ A;  1EV7 A;  1WJC A;  3L09 A;  3HOT A;  3Q0W A;  1RC9 A;  2VJI A;  2IP2 A;  4CCL A;  1W36 C;  2HTJ A;  4NUB A;  1E3O C;  2A05 A;  4ZZD A;  3MZ8 A;  3WG9 A;  1HKT A;  1T38 A;  1VQL I;  5J4V A;  4IVN A;  3GZ6 A;  2VBX A;  2YR2 A;  3HUG B;  4GYI A;  2QEX I;  3K4L A;  1ZG1 A;  1IZ1 A;  2HOA A;  2BZT A;  4D5F A;  3VWB A;  4BL0 B;  1CGP A;  2PLY A;  5C4X J;  5DTD A;  3OR2 C;  4CZZ A;  5ILS A;  4XLF A;  5HLT A;  1FWZ A;  2IA0 A;  1WWX A;  3CDL A;  1IAW A;  3FXM A;  2W82 A;  2CW0 F;  3LOC A;  2K40 A;  3FF5 A;  5LRS A;  5JVG F;  2M1B A;  1VQ5 I;  2OD5 A;  2ZSI B;  3OY9 A;  5CKT A;  1O7L A;  3DF8 A;  1XMX A;  4OIP F;  2DW4 A;  4HW0 A;  2EWN A;  2XAS A;  1OYW A;  4XBF A;  1RPW A;  2DQL A;  3SQN A;  4ENJ A;  4CXF A;  1SMT A;  1HDP A;  1JTY A;  2BY2 A;  2EZK A;  4UVA A;  2O8K A;  2W48 A;  2WC2 A;  1R5G A;  3L2W A;  1SFK A;  1OCC H;  2UXX A;  1FZP B;  3KP2 A;  4DQ2 A;  2K4J A;  4IJA A;  2FEZ A;  3RQ4 A;  5DM6 F;  2M3A A;  2ZJR F;  2DA6 A;  1A5J A;  1FNN A;  3S16 J;  2PMU A;  4ESJ A;  1YTY A;  2NRA C;  1ON1 A;  5LLQ A;  3HEF A;  4OIR F;  2K02 A;  2XB5 A;  2R7T A;  1X1A A;  3L2V A;  4HBL A;  3PFI A;  4YEJ A;  4FHT A;  3HGY A;  1KON A;  2CSO A;  2K27 A;  2X85 A;  3CUQ A;  4BNC A;  1POG A;  3OYF A;  5HOD A;  3ZMS A;  4BAY A;  2LSO A;  2VXD A;  3DPL C;  4I7H A;  3CMM A;  2Z99 A;  1KU9 A;  2X6O A;  4S05 A;  4BJT A;  1LE8 B;  2AHQ A;  3NAU A;  3GZ5 A;  1VQP I;  2BGC A;  1P7J A;  3RCO A;  4EGZ A;  4IL6 C;  2AS5 F;  1XSV A;  2XSJ C;  3ISP A;  3HL2 A;  2JN6 A;  3K2A A;  2DPD A;  1ZTR A;  3LAP A;  2ZB9 A;  4E7Z A;  4UVC A;  3N05 A;  4XRF A;  2JA7 J;  2BW3 B;  4RAY A;  2DA3 A;  3I9V 2;  5AIQ A;  4XLN F;  1ZGJ A;  2WAQ A;  4FQG A;  1ZYR F;  3E6D A;  2LLK A;  1Y0U A;  2DJI A;  3IKV A;  5CQE A;  4HX8 A;  3AG1 H;  2L7Z A;  5J1Y A;  3I58 A;  4D0P A;  3JRC A;  1N77 A;  4LLL A;  2Y0S N;  4CYC A;  2KRC A;  2M8E A;  2O6G E;  1VQK I;  4HNT A;  4PGG A;  2XRO A;  3S3O A;  3FWE A;  4B43 A;  2OJE D;  2BXY A;  1O3T A;  2A6T A;  4YG2 F;  2L02 A;  4M74 A;  4A12 A;  1IV8 A;  1MBE A;  3ZR8 X;  3V4G A;  4A3G J;  1TW2 A;  4NC6 A;  1MDM B;  2VOP A;  1OR7 A;  1D0X A;  1Z3X A;  2CJJ A;  4BXU A;  2L2O A;  4NC7 A;  3M9A A;  3R4K A;  4XLC A;  4P55 A;  1KYZ A;  2HYJ A;  4KMU X;  5LGU A;  3HRS A;  2XF7 A;  3JRB A;  2H1K A;  2HDD A;  1LDK B;  4DYQ A;  1WI9 A;  1VQ6 I;  2NS8 A;  2CUZ A;  1J2X A;  4I98 B;  3T8T A;  4G7H F;  3NWS A;  3A03 A;  4NC8 A;  2DU9 A;  1YIT I;  3J7A Y;  1TBX A;  1YX5 A;  4JOM A;  4XN0 A;  3N4M A;  3E5U A;  3A1Y A;  3K9T A;  5E3O A;  5TJJ A;  4PFP A;  2KPM A;  3ZXS A;  3G71 I;  2CU7 A;  2N8G A;  2HYG D;  2XRN A;  1GLN A;  3WGH A;  4XN3 A;  1FT9 A;  3MZH A;  1QVT A;  4P9F A;  1V5F A;  3L2Q A;  3DPT A;  1S5L C;  4IRG A;  4ZDO A;  5EJC A;  5FKM A;  2CG4 A;  4HQE A;  2YU3 A;  3RKY A;  4B3A A;  4PZJ A;  2VJ5 A;  2P0W A;  2Q1Z B;  1Z77 A;  2DXI A;  2NAZ A;  4BQQ A;  3R0J A;  2A3S A;  5DCM B;  3ZMU A;  1D8K A;  1USS A;  2XC7 A;  6PAX A;  5HOO A;  3OIQ A;  1ZH5 A;  3MKL A;  2DA7 A;  5LBQ A;  2DK8 A;  4G7Z F;  3N97 A;  5LEK A;  2JUG A;  2VPR A;  2IRF G;  1AHD P;  1JXS A;  1SVM A;  2RQP A;  5DUK A;  1LVK A;  5BMZ A;  1JKP C;  3ABM H;  3H5R A;  1ZRF A;  4G8X A;  2JQ7 A;  4RLF A;  4OOI A;  3IHU A;  4F3Q A;  1T8I A;  2CMP A;  3ABK H;  5K5Q A;  5JLW A;  4KIF A;  3H3Z A;  2DK5 A;  3JRH A;  1FYL A;  4IOC F;  3WTW C;  2R7F A;  2LYC A;  3J7A O;  3V8K A;  3CP2 A;  4UB8 C;  1LKX A;  3K2Z A;  2CUF A;  3HOS A;  5LEJ A;  4XRS G;  1XMK A;  5F27 A;  1F43 A;  4XOP A;  2FBK A;  1VI0 A;  4NQW B;  4E7J A;  2ZXW H;  5J8F A;  3HGG A;  1DDN A;  1NG6 A;  1FOW A;  2MG4 A;  3OYL A;  2LBF A;  2XAH A;  2PJR A;  2NVT J;  3JRI A;  5A2Q K;  2X51 A;  3S14 J;  4KN4 X;  4MNU A;  1XB4 A;  3Q5F A;  3PIO F;  5F08 A;  3TL4 X;  2KIS A;  4CA0 A;  2LR8 A;  4FX4 A;  3R6S A;  3CMA I;  2EJR A;  5M3F J;  3EYI A;  3ZQL A;  2HNH A;  1ORK A;  4HRI A;  3KLN A;  3BG9 A;  3CC2 I;  1IDY A;  1I6X A;  4LJZ F;  3VYR B;  3RKW A;  4U0V A;  1JI8 A;  5E8I A;  3F8B A;  4N4O B;  4X6A J;  3F3X A;  1TWG J;  4RDU A;  1I1G A;  5IT9 K;  3HOW J;  2CWE A;  2M9H A;  4GXO A;  4ZC3 A;  3GBG A;  2V6C A;  1P2F A;  1AWC A;  4G12 A;  1OLT A;  3FM3 A;  2BXZ A;  3CCY A;  1B9N A;  3GFL A;  4XNF A;  2HEO A;  2Z16 A;  1J09 A;  4HAM A;  5F0F A;  5L3F A;  4A0X A;  4BQN A;  1FX7 A;  3VOD A;  2A61 A;  2EFN A;  3HG9 A;  2KMU A;  3M8F A;  1FYM A;  1Y39 A;  2OTL I;  1B8I B;  1U5T A;  2LY9 A;  2DA5 A;  3BJO A;  1Z6T A;  1MMD A;  2Q0O A;  4MFD A;  2NVU B;  4L9N A;  3RPU A;  2PFB A;  5GAH J;  3MKY B;  2NYX A;  3JAM Z;  5H6R A;  2L7F P;  1RZ4 A;  1O7F A;  3NQO A;  2VE8 A;  1R36 A;  1WSU A;  3E5Q A;  3MZY A;  1BOA A;  4EQQ A;  1A04 A;  5K7H A;  2RN7 A;  1JKR C;  2HVR A;  2GXG A;  2K3P A;  2P5V A;  3GTQ J;  1QA6 A;  3CJN A;  3VEP A;  5LGT A;  3CO6 C;  1TNT A;  3OL3 A;  3ZN1 A;  2L9N A;  5F0H A;  1JHF A;  3E6M A;  4RM3 A;  1PUE E;  5J1R A;  1E0E A;  4A0Z A;  2E5N A;  1E17 A;  3KZY A;  2DMT A;  3KZZ A;  5CVU A;  1K79 A;  2D1V A;  3MFK A;  5CYV A;  2X1E A;  5LFA A;  4BS9 A;  5DEQ A;  3FDY A;  4RMN A;  5FB2 A;  3HOU J;  5EGO A;  1QHG A;  2F5C A;  2WB1 A;  1J0R A;  1X4O A;  2JRT A;  1YJW I;  3IH3 A;  3QQA A;  4OIQ F;  4UUT A;  4I99 C;  4W97 A;  2NXN B;  4B47 A;  4KDP A;  3BTJ A;  2WAE A;  1BR4 A;  3S15 J;  4F52 A;  2O7O A;  2V79 A;  2LKS A;  2EV0 A;  3PNT A;  3K70 C;  4UNO A;  3P9K A;  3Q0V A;  4LD5 A;  3H3V K;  2B63 J;  3AKZ A;  3DXJ F;  1YJ9 I;  5ICE A;  4LMY A;  2CW8 A;  2LFB A;  4E7L A;  3HIF A;  2ACJ A;  3E1S A;  3GWZ A;  5FKO A;  3EUH C;  3PSI A;  1LUJ B;  3ECH A;  3VDX A;  4Y3O A;  2OQG A;  4BDZ A;  1TT0 A;  4BE2 A;  1RIO H;  1ETX A;  3REO A;  1YW7 A;  2X4H A;  2WY8 Q;  3VYU B;  5KNL A;  2LVS A;  2VQG A;  3IRQ A;  1UCR A;  2K9L A;  1UZC A;  4B44 A;  4A3B J;  4ON0 A;  2QKM B;  3OYG A;  5JI6 A;  2XV4 S;  3I54 A;  4EM0 B;  4IHT A;  2QM3 A;  2LMD A;  3FXJ A;  4IHY A;  2DMP A;  2LY1 A;  2K85 A;  3OR1 C;  1KZH A;  4EM1 A;  4FTH A;  3BTL A;  4NNJ A;  2XGX A;  3K1M A;  4BY7 J;  5C44 J;  1K78 B;  2CV2 A;  4V2F A;  1P6R A;  3OS0 A;  2E1C A;  2JA2 A;  2FD5 A;  1QHH D;  5DYM A;  4BHP A;  2XUB A;  2LF7 A;  4AYB N;  1HKQ A;  4FE4 A;  2LRE A;  2ZO4 A;  3QU3 A;  3KYD B;  4WXD A;  1YIJ I;  5HNH A;  4GDF A;  2R5Z A;  5F64 A;  2STT A;  1Z91 A;  2ELK A;  4EJT A;  4OMY A;  3B73 A;  4ZYE A;  2VKH A;  3W2A A;  1GUU A;  2EA2 A;  1XPX A;  2OPT A;  3GFM A;  3IUO A;  3I0T A;  3KP6 A;  4XSZ F;  5BS6 A;  1YRN B;  2F2E A;  3I4M J;  3OYE A;  2DDB A;  1HW2 A;  3I5U A;  2GM4 A;  2JTV A;  5HS9 A;  5F0C A;  1XSD A;  1SFU A;  2MGQ A;  1BI3 A;  2IAI A;  1XTA A;  4Y4R A;  4GRI A;  3I53 A;  3WHB A;  4S04 A;  4XKW A;  4MFE A;  3EDP A;  1VQ4 I;  1Z6R A;  2UXN A;  1MBJ A;  3G1L A;  5FD5 A;  4A3J J;  1O3Q A;  2XGE A;  4EEF G;  3HKZ N;  1OCR H;  3BG7 A;  2NS7 A;  5J1U A;  4N9I A;  2J5O A;  1REP C;  3F8F A;  2HPI A;  4IZZ A;  2ZXH A;  1R1T A;  2ZSH B;  3FX3 A;  1N75 A;  1ZRE A;  3CJQ B;  2FML A;  5CLS A;  4IX7 A;  3CZ6 A;  3HRT A;  3NEU A;  1W5C C;  3SFZ A;  2DI3 A;  3H3U A;  2O5R A;  4A6E A;  2EZI A;  2DOF A;  3DWL E;  4M71 A;  1O57 A;  2DQR A;  2HDW A;  3FK7 A;  4O3M A;  3S1R J;  2HR3 A;  1D5Y A;  4F55 A;  1PJR A;  1JUM A;  2VIX A;  1Z0X A;  3HHH A;  1GVD A;  1AKH B;  4PCQ A;  3A01 B;  4D5C A;  2ZME C;  3TP3 A;  1YW9 A;  4XKB A;  2E19 A;  1Z3Y A;  1R58 A;  1ZG3 A;  1QNT A;  3D0S A;  4ZYD A;  1R9T J;  1W7P A;  5DCF A;  1JKO C;  2EFQ A;  2ZCW A;  2K9M A;  3C2H A;  1B6A A;  2WV1 A;  3SEZ A;  5LHI A;  2AO9 A;  2LKX A;  1MH4 A;  1A6I A;  1SFO J;  1EF4 A;  2QQB A;  2V1X A;  5GTI C;  1UG0 A;  2D1H A;  3IC7 A;  2ZC2 A;  4L0Z B;  3KEQ A;  1ZR2 A;  2OV7 A;  5IYD J;  2KDO A;  2XGD A;  1S7O A;  2JA5 J;  3J80 Z;  4V19 K;  1S7A A;  4B4C A;  5EEA A;  2L4M A;  3KP7 A;  3QYF A;  1LJ9 A;  3OMY A;  1DUX C;  3BR3 A;  2DA2 A;  1R5I D;  3KPH A;  2OQR A;  1IF1 A;  4U0W A;  3PSF A;  2F4I A;  2XAG A;  3H9J A;  1ON2 A;  1WJ5 A;  2W25 A;  2KIQ A;  2Q2E B;  1E3P A;  4HF1 A;  4X0G A;  3H9G A;  3SZG A;  5EG0 A;  4AU7 A;  2D45 A;  2ZFU A;  3V8J A;  1HW1 A;  1P9Q C;  3ZMD A;  1PDN C;  3LWF A;  3DTK A;  5H2F C;  3LFU A;  1A6Q A;  5FJ8 J;  1LB2 A;  1PVE A;  1LFP A;  2HKO A;  1UHM A;  2CFX A;  1VTN C;  1G3S A;  2I10 A;  4Q48 A;  4C3J J;  5HNF A;  1B72 B;  1TTY A;  2BBY A;  3BRO A;  2EZL A;  1EA3 A;  2DT7 B;  4O5V A;  5J40 A;  3J81 K;  4XKV A;  1BC8 C;  1FMV A;  2Z2S B;  3S32 A;  1FTZ A;  3NRV A;  2JA6 J;  1LDD A;  4IF4 A;  4KIC A;  2Q8K A;  5FRO A;  4KYW A;  3AG4 H;  1ETW A;  4A3L J;  2GOX B;  2KJB A;  4A3M J;  4LB6 B;  3OYM A;  4LG0 B;  2HDC A;  1C0W A;  4A5M A;  5B3S H;  1JUS A;  3K0L A;  4A3K J;  4JBA A;  1ETQ A;  2YUS A;  4BJ6 C;  3S2H J;  3J7Z I;  4Y13 A;  2L7M P;  2F4O B;  4BKX A;  1ZRD A;  5E3L A;  1OMI A;  2HQN A;  4CCO A;  3BG5 A;  1Y8Q B;  3GLL A;  2HTS A;  2DO7 A;  1T0F C;  2MLK A;  4CCJ A;  3KYL A;  4C2U A;  3EYY A;  1RKW A;  3P5J A;  2BV6 A;  1EH8 A;  2KP6 A;  2B7E A;  2P6S A;  3ZP5 A;  2O0Y A;  2K9Q A;  3P9C A;  2QQ9 A;  2JWT A;  3JRG A;  1OKR A;  3K4N A;  4RLQ A;  4HNU A;  3TO9 A;  1KQ0 A;  3DTE A;  2HZT A;  1A31 A;  3FXQ A;  3F8M A;  2DFH A;  2GOM A;  4AC0 A;  4WX9 A;  1R00 A;  4DYC A;  1JKQ C;  4BBS J;  3G1M A;  3ZPL A;  1I5Z A;  4TV7 A;  1TZL A;  1E3H A;  2Y0M A;  3W6K B;  5AON A;  3CMY A;  2CUJ A;  4XRS A;  2LNB A;  4MGR A;  1PP7 U;  3BJ6 A;  1Q1H A;  5LRR A;  2R7U A;  2E1O A;  3GXO A;  4KIS A;  3RZO J;  2R7S A;  3CCV I;  3HOX J;  4HEA 2;  3GZN B;  3OYI A;  3HUG A;  3QYB A;  3J7Y J;  2DYR H;  1WQ2 A;  2XPV A;  1KQ8 A;  3RTR A;  3F6O A;  4UUS A;  5ICG A;  1VQO I;  2QQ8 A;  1UAA A;  3DFG A;  4FE7 A;  3JW4 A;  3V7S A;  3H9Q A;  4AIK A;  1VQ8 I;  2VT3 A;  3PUF A;  1X2M A;  2G7U A;  4KJZ A;  2MLG A;  4EGY A;  1FIA A;  5DDG A;  5ICF A;  2DA1 A;  2NOJ B;  3CDI A;  1BOB A;  2YX7 A;  3U21 A;  3HC7 A;  3VSK A;  1FSE A;  1RR7 A;  3C7J A;  2M5W A;  4D1Q A;  4I76 A;  4Q47 A;  4IEJ A;  4HA8 A;  2FBI A;  4F7Z A;  5J4Y A;  2K86 A;  3ZQG A;  1U8R A;  4KT6 A;  1T2K A;  4E7I A;  1ENH A;  4PGH A;  2F48 A;  1S3J A;  2K5C A;  3BR5 A;  3E7L A;  1XS9 A;  3F9K A;  4AVP A;  2OCE A;  2O8X A;  3WU0 A;  1GV5 A;  1UFM A;  1PUF B;  4RBO A;  4WCG A;  1QPI A;  2OUM A;  3HJE A;  3WU1 B;  1DPR A;  3LSJ A;  3JSP A;  2D2W A;  2VL8 A;  3ZCO A;  2GIV A;  1KGS A;  2VQH A;  4I09 A;  3LSM A;  3HTU A;  5KVR A;  4Y52 J;  3ZMZ A;  2BY3 A;  1N25 A;  3EUH A;  3GUD A;  5HDK A;  2HPM A;  1QQI A;  2XAU A;  1IXS B;  1BR2 A;  4QTR A;  3EET A;  3D1N I;  2C6Y A;  3CTA A;  3SZT A;  4ENM A;  1TQI A;  1HKS A;  3GTK J;  2ID6 A;  3OYJ A;  2MBF A;  1SD6 A;  1V54 H;  4ZYA A;  1MH3 A;  4B8X A;  4XON A;  4AVZ A;  2VPL A;  2KHM A;  3BPX A;  3QOE A;  2I8D A;  2P8T A;  2FF4 A;  2YSR A;  3F0C A;  2L9R A;  5E1X A;  2M34 A;  5GPA A;  1PYV A;  2EV5 A;  1GDT A;  2DBB A;  4B09 A;  4AWX B;  2IBD A;  3V42 A;  4OIN F;  1D8J A;  1MBG A;  3LSR A;  2BW3 A;  4IHX A;  2DMN A;  4F92 B;  1J75 A;  2M87 A;  2PX9 A;  3AG2 H;  4OAZ A;  5E8G A;  2FOK A;  4RA2 A;  2LG4 A;  1X58 A;  1HC8 A;  1WI3 A;  4LLG F;  3SEQ A;  1MJA A;  3ZQC A;  2XF5 A;  3GTP J;  1S6L A;  3H0G J;  4ZH4 F;  1P4W A;  4ITV A;  5D6E A;  3FK6 A;  2VOO A;  1L0O C;  1QU3 A;  5D4S A;  1WHU A;  2V1U A;  4JX6 A;  2M30 A;  1YX3 A;  2A07 F;  1TQP A;  3AL0 C;  3IRR A;  1PP8 F;  5DM7 F;  3OL4 A;  1HW5 A;  5IYB J;  1JT6 A;  2O3F A;  3M1C A;  3DEE A;  3ABU A;  1WJA A;  2EBI A;  1FSH A;  3MMY B;  5FLV A;  1XGS A;  1I50 J;  3OSF A;  1YJN I;  1MDM A;  1D1C A;  3KCC A;  2OZ6 A;  2DDA A;  4BHB A;  2XRL A;  3DU5 A;  5BQT A;  1WJE A;  3M4O J;  1MBF A;  2E34 A;  4NBQ A;  4M9X A;  2WWY A;  1T6S A;  2JPC A;  1T56 A;  5GTH C;  4ENK A;  4E7H A;  2H1L A;  1YG2 A;  2GIZ A;  3FMS A;  1HLV A;  1TWF J;  2VJ4 A;  2IS2 A;  3SFI A;  3KEO A;  2VBZ A;  1ZRC A;  2D5V A;  5K5R A;  1FYK A;  4I0B A;  3CLO A;  3HTS B;  3DLL F;  1W4M A;  1XX5 A;  2HYF A;  4S0H B;  1I1S A;  1W1W E;  3I4P A;  2JJ7 A;  2JZY A;  5K1Y A;  3JTG A;  3QU6 A;  3W3C A;  4DZJ A;  1R71 A;  4DZP A;  3MEX A;  2R7V A;  5FLX K;  3B6A A;  4BXF A;  3CCL I;  2HI3 A;  3BTC A;  2XHK A;  3C1D A;  4B48 A;  3WTX C;  3ZGK A;  4CGZ A;  3SHF A;  2ESN A;  3W6V A;  3TO7 A;  2ZME A;  2IPQ X;  2H27 A;  3DV8 A;  5DD4 A;  5JHF A;  5IY5 H;  2VUM J;  1J59 A;  2EFW A;  5FKL A;  5D8K B;  1L3L A;  2LRD A;  4I02 A;  2VE9 A;  4PJN A;  2VB6 A;  3PQK A;  2OZU A;  4C2M J;  1MJB A;  2HXI A;  2Y0S A;  4ZDL A;  3HM5 A;  3KZI C;  1Z1D A;  4XLA A;  3TDU C;  3IAM 2;  2LP0 A;  2ICW G;  2FA5 A;  1I27 A;  3LSK A;  5FLM J;  2BYV E;  2VT2 A;  4U0Y A;  3OS2 A;  4UV9 A;  4WXH A;  2ISY A;  1U78 A;  1T95 A;  5E18 F;  4XLH A;  2RV8 A;  4OAY A;  3SDB A;  1FMW A;  4XK4 A;  1G59 A;  4HYE A;  3FHN A;  1YS7 A;  2QBY A;  2L9S A;  4MHG A;  2IGM A;  4YFK F;  2Y31 A;  2DFI A;  1R6R A;  2ADU A;  3FXO A;  4B3X A;  1HCR A;  4IOA F;  1K6O A;  5E17 F;  5L3C A;  3S1Q J;  3HOZ J;  2BEO A;  4PSW A;  3WOD F;  3T1B A;  4CCN A;  3EQL F;  4DJA A;  4HSR A;  4NDL A;  3TOB A;  3JRE A;  3BC8 A;  1IGN A;  1MJ9 A;  3R60 A;  3SYT A;  1FOY A;  3BP8 A;  2W4S A;  2RNG A;  1Y56 A;  4W1U A;  3OIP A;  2DFE A;  3I59 B;  3WU2 C;  3JRD A;  3CC7 I;  1X1B A;  2MA3 A;  1ZGA A;  2L54 A;  2X0L A;  2LBF B;  3I71 A;  2GBY A;  1G2H A;  1Y1V J;  2LKP A;  1Z7U A;  2MFZ A;  2Y9Y A;  4LFU A;  3KEY A;  3V7R A;  3SJM A;  3I56 I;  1IUF A;  4LK0 F;  4XKC A;  4I2O A;  1MIJ A;  4C3I J;  2VKV A;  3ZOB A;  4ENN A;  2CV0 A;  4LK1 F;  3S3M A;  2PMZ N;  1VQM I;  4IQ4 A;  1QZY A;  2F4M B;  3T8R A;  1K7A A;  2A6E F;  2B9S A;  3HSR A;  1KYW A;  1S9H A;  1I3Q J;  3GF2 A;  1H88 C;  2K7L A;  3OSG A;  2F5V A;  4FCY A;  4X1E A;  1U9O A;  5DUI A;  3L2C A;  4MQ9 F;  1E2X A;  2EIM H;  4M3E A;  5HLH A;  1SEU A;  3TP0 A;  2F5F A;  2GQQ A;  1YLF A;  1SD4 A;  3OYB A;  1VQN I;  5FO5 A;  5CQG A;  2FMY A;  2MAB A;  2M45 A;  3A0B C;  3K69 A;  2E1M B;  3PM1 A;  5HLG A;  2H09 A;  3V7C A;  4JP0 A;  1T0F A;  2RKH A;  4RGS A;  5AIP A;  1H9T A;  1FOX A;  1RUN A;  1SVO A;  2FBH A;  5M5Y J;  4YFX F;  1N78 A;  3G73 A;  2ECC A;  4MQV A;  3PO3 J;  2ZNZ A;  1IXR C;  4XOR A;  2HFH A;  1UST A;  4KA4 A;  4DW6 A;  5ERI A;  1V5E A;  1YOV B;  5KHD A;  3G3Z A;  2M7B A;  4JYK A;  3HZJ A;  1Y1W J;  5HS7 A;  5LHG A;  3DKX A;  4M6X A;  5F6F A;  5DD8 A;  2GA1 A;  1QVU A;  1A36 A;  1Z9C A;  3CDH A;  1H8A C;  1NG7 A;  1WJB A;  5IP6 A;  3MCZ A;  2M4K A;  3WGG A;  4YRV A;  4UXN A;  1MZB A;  2IGN A;  1V3F A;  3K4C A;  1NK2 P;  1OYI A;  3O3K A;  3ERM A;  3H5N A;  2ZXJ A;  3BR6 A;  2L5Q A;  1GXQ A;  1OCO H;  5EGO B;  1G6N A;  2WY7 Q;  3PIP F;  4U7B A;  2K4B A;  4E6K G;  2GA2 A;  2OA4 A;  3ZQ7 A;  1UMQ A;  4G6D A;  5GP9 A;  4U87 A;  1TT5 B;  4KNY A;  2HOT A;  2EH3 A;  1QZE A;  4IXA A;  4EVI A;  3CCM I;  3VSL A;  4HG2 A;  4LGW A;  4P9U A;  3BZK A;  1IN5 A;  5EYR A;  3BWG A;  4XLP F;  4E7S A;  2HKX A;  2XF6 A;  2A5W A;  2KZG A;  3PNV A;  2JK3 A;  2X6W A;  3CF2 A;  4AM3 A;  1IXC A;  5FFX A;  4KIB A;  1XGM A;  1JUP A;  1BI1 A;  5HVQ C;  1QZZ A;  1FJL A;  1GT0 C;  3PO2 J;  4XMY A;  2BHZ A;  3ZQI A;  5GAG J;  3K10 A;  3I3L A;  5C3E J;  5JLX A;  5LHH A;  2YU9 J;  3UNG C;  3K1N A;  5FFZ A;  3E97 A;  3VYT B;  1MNE A;  1LVA A;  5M5W J;  2CQ7 A;  3X2Q H;  3S2D J;  1TL8 A;  3B6C A;  1ETK A;  1IO2 A;  2F6C A;  2VI6 A;  2DMQ A;  2CYY A;  2IXS A;  2QYO A;  3HSF A;  4R79 A;  3DQV C;  3FM5 A;  1D0Z A;  1X1D A;  3CCJ I;  2VQL A;  3K1P A;  3T5X A;  1U0J A;  2LOO A;  2QF7 A;  4RGR A;  1IRF A;  5GAD J;  2L3D A; 
#chains in the Genus database with same CATH homology
 2GXB A;  3QP6 A;  5EEH A;  2EK5 A;  3TKY A;  3ZMV A;  4P5O A;  4Q4Z F;  1WRJ A;  2HS5 A;  1FPQ A;  3KP4 A;  2VON A;  4IHS A;  5ILV A;  2H94 A;  4L5I A;  2FE3 A;  5FD6 A;  1XCB A;  4A5N A;  4LB5 A;  3WTU C;  1ZG5 A;  3I64 A;  4U7D A;  1RNL A;  5E1W A;  3RYR A;  4RB2 C;  4A6D A;  3P9I A;  3HHG A;  4MTD A;  1IN8 A;  5E20 A;  4HQM A;  1HST A;  3BPV A;  4GYG A;  3GLX A;  2AXL A;  1MGT A;  4KT5 C;  3ML6 A;  3LA3 A;  1FY7 A;  4Y17 A;  5CVJ A;  1S29 A;  2FRH A;  4A0Y A;  1R7J A;  1XDS A;  2OU2 A;  2XKP A;  3TGN A;  1OYY A;  1CF7 A;  3E6B A;  3SZP A;  3LST A;  1BJA A;  2FNP A;  3RIR A;  2IA1 A;  5ILU A;  1ZLJ A;  1XD7 A;  5H20 A;  1W7P B;  5BOX A;  3F23 A;  4MEX F;  3IWF A;  3GEZ A;  1G3Y A;  2LF8 A;  2HWV A;  3M8E A;  4EJV A;  3U1D A;  3RJP A;  2KRF A;  5L3E A;  4BYY A;  4NB5 A;  4EM2 A;  4HV5 A;  3OOP A;  1BC7 C;  3MAJ A;  3RPQ A;  5K5O A;  3JSO A;  1ONV A;  2MD5 A;  4EJU A;  2KIM A;  2RC4 A;  1KU7 A;  1H9G A;  5L3G A;  5JR3 A;  1YIO A;  4M72 A;  5JHU A;  3Q9V A;  2YX4 A;  1B59 A;  1HQC A;  4M73 A;  2VC1 A;  2P6T A;  3L00 A;  3WE3 A;  4IRH A;  3CUO A;  3JAM K;  2IJL A;  5FGM A;  4ZYG A;  1R1U A;  1QPM A;  1Z05 A;  4HZF A;  4M9S A;  3HRU A;  1LNW A;  1ZAO A;  2P7C B;  1FLI A;  3IL2 A;  2R3S A;  2GWR A;  3F72 A;  4Y15 A;  4M9Z A;  5J8C A;  4BH9 A;  5A2Q Z;  4BHC A;  4WF2 A;  4HLY A;  2VXZ A;  4GCV A;  2ZJ2 A;  1G3W A;  4XSX F;  4MTE A;  4YIF A;  2VOD A;  1XMA A;  3GVA A;  3FXR A;  2KJC A;  1KU3 A;  3FXU A;  2JPB A;  5KK1 A;  5IT9 Z;  3LAJ A;  1SD7 A;  2F5D A;  2Z5U A;  2EFO A;  2NNN A;  2PMH A;  3TQN A;  1EH6 A;  1F9N A;  1HSJ A;  4IPA A;  2VBW A;  5HDN A;  2ETH A;  1BBY A;  2DAO A;  1XDU A;  4GO1 A;  3ZN0 A;  3COA C;  1R23 A;  5J6X A;  3RI4 A;  4Q5S F;  2XAF A;  1U2W A;  4A2U A;  5L3D A;  2A68 F;  1F4K A;  2IT0 A;  4HDV A;  2P5K A;  2ZNY A;  2P5L C;  3S2W A;  4EMS A;  4U88 A;  2A69 F;  1IW7 F;  5D6F A;  4KIG A;  1J5Y A;  2STW A;  2W84 A;  1KQ9 A;  1R22 A;  3P7N A;  4DNC A;  4L0Y B;  2XAJ A;  3QRF F;  1RUO A;  1BIB A;  2DPU A;  1EH7 A;  3D5L A;  5CJ9 A;  1B4A A;  4IRI A;  2FQ3 A;  2CO5 A;  4EJO A;  3CUQ B;  1BN5 A;  1XGO A;  2PEX A;  4YII A;  1X3U A;  4E70 A;  1KA8 A;  3BOQ A;  2BE5 F;  5LGN A;  3GX4 X;  1R1V A;  1GVJ A;  1JE8 A;  1UB9 A;  2HQR A;  4N0B A;  1YS6 A;  5BPD A;  2EB7 A;  1O3R A;  2MC3 A;  1D5V A;  2A6H F;  3MQ0 A;  3F8N A;  3H92 A;  3TO6 A;  1XSX A;  4KUM A;  1BIA A;  4KMF A;  1IN7 A;  3WTS C;  1ZN2 A;  1YO5 C;  3QOP A;  1G3T A;  4JQF A;  1U3E M;  1XGN A;  2JSC A;  2PG4 A;  3W6J B;  2RVC A;  4HX4 A;  2G9W A;  3ROU A;  4WK8 F;  3ZMT A;  3J80 K;  2H6B A;  2XKO A;  4RAZ A;  4YFN F;  1QO0 D;  2E7W A;  2PN6 A;  2RNJ A;  4OMZ A;  2F5E A;  2IW5 A;  3GO5 A;  2QWW A;  2A5Y B;  5DCM A;  2EV6 A;  1BI0 A;  2Z9O A;  2ZME B;  1QBJ A;  4L9V A;  2UWM A;  3WE2 A;  5JVT A;  3R0A A;  1HBX G;  3VB2 A;  1FBU A;  1WKM A;  1ZAR A;  3U9G A;  2HOE A;  4ZYH A;  4GGG A;  1STZ A;  5HDG A;  2VN2 A;  2FNA A;  2CGP A;  4EV0 A;  2H6C A;  4G7O F;  5D4R A;  1U6G A;  3M7G A;  2ELH A;  4NQW A;  3ERE D;  5D8L B;  4CO8 A;  1T39 A;  4HDU A;  5HLI A;  2QBY B;  2QZ8 A;  3AAF A;  3C18 A;  3GYH X;  3LQQ A;  2OBP A;  1W5T A;  4QWQ A;  2E1N A;  4WXC A;  1LEB A;  3I59 A;  3DP7 A;  3FMQ A;  1H0M A;  3LFK A;  3WTZ A;  2XAQ A;  1JGS A;  2L01 A;  2HGC A;  1SFX A;  5H6Q A;  2KIU A;  4CIC A;  3HSE A;  3FMR A;  5EEG A;  4RGU A;  3Q9S A;  3QAH A;  1LQ1 A;  3M1E A;  1XCV A;  5CVI A;  2W85 A;  4P96 A;  2PI0 A;  4FX0 A;  4UV8 A;  2JT1 A;  5ICC A;  3MWM A;  3FZV A;  1FP2 A;  3BDD A;  3J81 Z;  2IVM A;  1U5T B;  5HS8 A;  3F6V A;  1S8N A;  3QP5 A;  2ZFW A;  2DTR A;  3RYP A;  3DKW A;  3KP3 A;  3ABT A;  2EFP A;  1MKM A;  2NS0 A;  3RDI A;  1KU2 A;  4AIJ A;  3JTH A;  1LEA A;  1TNS A;  3R61 A;  1SD5 A;  1BM9 A;  4HV6 A;  3GFI A;  4EJW A;  1NHA A;  4I0A A;  4AD9 A;  3FHZ A;  2V1D A;  1G4D A;  2G7H A;  4RB1 A;  2Y48 A;  4K2E A;  4ASN A;  4PDK A;  4UUV A;  1B9M A;  3GW2 A;  5DV5 A;  3BZ6 A;  5D5X B;  1P4X A;  2PBI A;  2QQA A;  1IN6 A;  3E3V A;  4HOB A;  2Y75 A;  1IUY A;  4HLX A;  2XIG A;  4G94 A;  4H0E A;  2PJP A;  5D5U B;  3BJA A;  4RS8 A;  1HXD A;  4G9Y A;  2RGV A;  5CVR A;  2COM A;  3DEU A;  2B0L A;  2PQ8 A;  1FP1 D;  3CUQ C;  4ETS A;  3LA2 A;  5JFR A;  1K78 A;  2KIF A;  4UVB A;  1F1Z A;  4AIH A;  1AOY A;  3E6C C;  2E7X A;  2Z3Y A;  4OU0 A;  3V8L A;  2FSW A;  3KET A;  2CQK A;  3CO7 C;  1T98 A;  1J9I A;  3WTV C;  4LLN A;  1FC3 A;  4HF2 A;  4L9T A;  1MD0 A;  2Z33 A;  1DP7 P;  4L18 B;  1W7P D;  4HF0 A;  1IRG A;  4Z2Y A;  4RB0 A;  5ED4 A;  2ZBK A;  1TQM A;  4WWC A;  3ELK A;  2LDU A;  4KFC A;  5L3B A;  5CVV A;  2QVO A;  4L9J A;  3L7W A;  2QLZ A;  3ULQ B;  4JK1 X;  2W57 A;  3U2R A;  2J5P A;  1OPC A;  4O6J A;  2NNY A;  3IWZ A;  3KE2 A;  4BQA A;  1J7K A;  3KFW X;  2ISZ A;  1DPU A;  4R1H A;  3O2P E;  2VBY A;  3HYI A;  1ZHF A;  3IKT A;  1XN7 A;  4CYD A;  1YYV A;  3SXY A;  4R8H A;  2WV0 A;  1YFH A;  3L9F A;  4HX7 A;  3TOA A;  3BY6 A;  1R5H A;  3C3W A;  4I01 A;  3TDZ C;  4ESF A;  1SAX A;  2R7D A;  1B1B A;  1CF7 B;  1GXP A;  1IN4 A;  1UHW A;  4M6Y A;  2EA4 A;  3O6B B;  3PQJ A;  2IA2 A;  1TLH B;  4CHU A;  1QGP A;  2FU4 A;  2OAZ A;  5E1Z B;  1YW8 A;  5TRD A;  3WTT C;  2P4W A;  4ESB A;  2KKO A;  2V9V A;  2RDP A;  4N9H A;  1YQA A;  1JHH A;  5D5V B;  3T0Y A;  2QEN A;  3KP5 A;  5FLX Z;  2O61 A;  2Q2E A;  3QPH A;  5D5W B;  1FBQ A;  3B02 A;  3E5X A;  3QPT A;  1W5S A;  3GFJ A;  2DT5 A;  3WTY C;  4L5J A;  4OIO F;  1D3Y A;  1FOK A;  2O03 A;  1FBS A;  2XVC A;  2VC0 A;  2L4A A;  4CDG A;  1BI2 A;  3VOE A;  1TW3 A;  1P92 A;  2MH2 A;  2ZKZ A;  1LDJ A;  1F5T A;  2FXA A;  1SMY F;  2TDX A;  5F1R A;  4LG0 A;  1ODD A;  4UHT A;  1O3S A;  3LA7 A;  4MEY F;  4KN7 X;  3VFZ A;  2UZK A;  1ZLK A;  2W24 A;  4NHJ A;  5BPI A;  1U5T C;  3F21 A;  2ESH A;  1RI7 A;  3F8C A;  1V4R A;  2GZW A;  2GAU A;  4RB3 C;  4QLC U;  2P7V B;  1SFE A;  4RGX A;  3ECO A;  2YPR A;  3RKX A;  4ZZL A;  3LQR A;  3HRM A;  4FT8 A;  3KLO A;  1P4A A;  1GHC A;  5IT3 A;  3WGI A;  2WTE A;  3F22 A;  2DLL A;  4G6Q A;  1ULY A;  2MH9 A;  2QUF A;  3OV8 A;  1EV7 A;  3HOT A;  3L09 A;  2IP2 A;  2HTJ A;  4ZZD A;  3WG9 A;  1HKT A;  1T38 A;  4IVN A;  3GZ6 A;  2VBX A;  2YR2 A;  4GYI A;  1ZG1 A;  1IZ1 A;  1CGP A;  2PLY A;  4CZZ A;  5ILS A;  1FWZ A;  2IA0 A;  1WWX A;  1IAW A;  2CW0 F;  3FF5 A;  5LRS A;  2M1B A;  2OD5 A;  1O7L A;  3DF8 A;  4OIP F;  2DW4 A;  4HW0 A;  2EWN A;  2XAS A;  1OYW A;  4XBF A;  2DQL A;  3SQN A;  4ENJ A;  4CXF A;  1SMT A;  4UVA A;  2WC2 A;  1R5G A;  2UXX A;  1FZP B;  3KP2 A;  4DQ2 A;  2K4J A;  4IJA A;  2FEZ A;  1FNN A;  2PMU A;  4ESJ A;  1YTY A;  2NRA C;  1ON1 A;  5LLQ A;  4OIR F;  2K02 A;  4HBL A;  3PFI A;  4FHT A;  2CSO A;  2K27 A;  3CUQ A;  4BNC A;  3ZMS A;  4BAY A;  2LSO A;  3DPL C;  4I7H A;  2Z99 A;  1KU9 A;  4S05 A;  3GZ5 A;  2BGC A;  4EGZ A;  2AS5 F;  3ISP A;  1XSV A;  2DPD A;  3LAP A;  4UVC A;  4XRF A;  4RAY A;  5AIQ A;  4XLN F;  1ZGJ A;  1ZYR F;  3E6D A;  1Y0U A;  3IKV A;  4HX8 A;  3I58 A;  4D0P A;  4LLL A;  2M8E A;  2O6G E;  4PGG A;  2XRO A;  3FWE A;  1O3T A;  4YG2 F;  2L02 A;  4M74 A;  4A12 A;  3V4G A;  1TW2 A;  1MDM B;  2VOP A;  1OR7 A;  4BXU A;  3M9A A;  3R4K A;  4P55 A;  1KYZ A;  4KMU X;  5LGU A;  3HRS A;  1LDK B;  1WI9 A;  1J2X A;  4I98 B;  4G7H F;  3T8T A;  2DU9 A;  1TBX A;  3N4M A;  3E5U A;  3K9T A;  5TJJ A;  2HYG D;  2XRN A;  3WGH A;  1FT9 A;  3MZH A;  4P9F A;  3DPT A;  4IRG A;  2CG4 A;  4HQE A;  2YU3 A;  3RKY A;  4PZJ A;  2NAZ A;  3R0J A;  2A3S A;  5DCM B;  3ZMU A;  1D8K A;  1USS A;  6PAX A;  5HOO A;  1ZH5 A;  5LBQ A;  2DK8 A;  4G7Z F;  3N97 A;  5LEK A;  2IRF G;  1JXS A;  2RQP A;  5DUK A;  5BMZ A;  1ZRF A;  4G8X A;  4OOI A;  3IHU A;  5K5Q A;  4KIF A;  3H3Z A;  2DK5 A;  1FYL A;  3WTW C;  2R7F A;  3J7A O;  3V8K A;  3K2Z A;  3HOS A;  5LEJ A;  1XMK A;  2FBK A;  5J8F A;  1DDN A;  2XAH A;  5A2Q K;  4KN4 X;  4MNU A;  1XB4 A;  3Q5F A;  4FX4 A;  3R6S A;  2EJR A;  3EYI A;  3KLN A;  4LJZ F;  1I6X A;  3RKW A;  4U0V A;  5E8I A;  3F8B A;  3F3X A;  1I1G A;  5IT9 K;  2CWE A;  4GXO A;  2V6C A;  1P2F A;  1AWC A;  3FM3 A;  1B9N A;  3GFL A;  2HEO A;  4HAM A;  5L3F A;  4A0X A;  1FX7 A;  3VOD A;  2A61 A;  2EFN A;  3M8F A;  1FYM A;  1U5T A;  3BJO A;  1Z6T A;  2Q0O A;  4L9N A;  3RPU A;  2PFB A;  2NYX A;  3JAM Z;  5H6R A;  1RZ4 A;  1O7F A;  3NQO A;  2VE8 A;  1R36 A;  1WSU A;  3E5Q A;  3MZY A;  1BOA A;  4EQQ A;  1A04 A;  2RN7 A;  2GXG A;  2P5V A;  3CJN A;  3VEP A;  5LGT A;  3CO6 C;  1TNT A;  3ZN1 A;  1JHF A;  3E6M A;  1PUE E;  4A0Z A;  1E17 A;  3KZY A;  3KZZ A;  5CVU A;  1K79 A;  2D1V A;  3MFK A;  5CYV A;  5DEQ A;  5FB2 A;  2F5C A;  1J0R A;  2JRT A;  4OIQ F;  4KDP A;  2V79 A;  2EV0 A;  4UNO A;  3P9K A;  4LD5 A;  3DXJ F;  5ICE A;  4LMY A;  3HIF A;  2ACJ A;  3GWZ A;  3ECH A;  2OQG A;  1RIO H;  3REO A;  1YW7 A;  2X4H A;  3IRQ A;  1UCR A;  4ON0 A;  5JI6 A;  2XV4 S;  3I54 A;  4EM0 B;  4IHT A;  2QM3 A;  4EM1 A;  2XGX A;  3K1M A;  1K78 B;  1P6R A;  2E1C A;  5DYM A;  4BHP A;  2XUB A;  2LF7 A;  1HKQ A;  2ZO4 A;  3QU3 A;  4WXD A;  5F64 A;  2STT A;  1Z91 A;  4EJT A;  4OMY A;  3B73 A;  4ZYE A;  2EA2 A;  3GFM A;  3KP6 A;  3I0T A;  4XSZ F;  5BS6 A;  2F2E A;  1HW2 A;  3I5U A;  2JTV A;  5HS9 A;  1XSD A;  1SFU A;  1BI3 A;  3I53 A;  4S04 A;  3EDP A;  1Z6R A;  2UXN A;  5FD5 A;  1O3Q A;  4N9I A;  2J5O A;  1REP C;  3F8F A;  1R1T A;  3FX3 A;  1ZRE A;  2FML A;  5CLS A;  3HRT A;  3NEU A;  3SFZ A;  2DI3 A;  3H3U A;  4A6E A;  4M71 A;  1O57 A;  2DQR A;  4O3M A;  2HR3 A;  3HHH A;  4PCQ A;  1YW9 A;  1R58 A;  1ZG3 A;  1QNT A;  3D0S A;  4ZYD A;  1W7P A;  5DCF A;  2EFQ A;  2ZCW A;  1B6A A;  5LHI A;  2QQB A;  2V1X A;  2D1H A;  3IC7 A;  4L0Z B;  3KEQ A;  1S7O A;  3J80 Z;  1S7A A;  2L4M A;  3KP7 A;  1LJ9 A;  1DUX C;  2OQR A;  1IF1 A;  4U0W A;  2XAG A;  1ON2 A;  2W25 A;  4HF1 A;  2D45 A;  3V8J A;  1HW1 A;  3ZMD A;  1PDN C;  3LWF A;  1LB2 A;  2HKO A;  1UHM A;  2CFX A;  1VTN C;  1G3S A;  4Q48 A;  1TTY A;  2BBY A;  3BRO A;  4O5V A;  3J81 K;  1BC8 C;  3NRV A;  1LDD A;  4IF4 A;  4KIC A;  2Q8K A;  4KYW A;  2KJB A;  4LB6 B;  4LG0 B;  2HDC A;  1C0W A;  4A5M A;  3K0L A;  4JBA A;  4Y13 A;  1ZRD A;  1OMI A;  2HQN A;  2HTS A;  2DO7 A;  2MLK A;  3EYY A;  2BV6 A;  1EH8 A;  2P6S A;  3ZP5 A;  2O0Y A;  3P9C A;  2QQ9 A;  1OKR A;  3TO9 A;  1KQ0 A;  2HZT A;  3FXQ A;  3F8M A;  4WX9 A;  1R00 A;  3ZPL A;  1I5Z A;  4TV7 A;  3W6K B;  2Y0M A;  5AON A;  1PP7 U;  2LNB A;  4MGR A;  3BJ6 A;  1Q1H A;  5LRR A;  3GXO A;  3HUG A;  1WQ2 A;  1KQ8 A;  3RTR A;  3F6O A;  5ICG A;  3DFG A;  3JW4 A;  3V7S A;  4AIK A;  2VT3 A;  2G7U A;  2MLG A;  4EGY A;  5DDG A;  5ICF A;  2YX7 A;  1FSE A;  3C7J A;  2M5W A;  4Q47 A;  4HA8 A;  2FBI A;  4F7Z A;  2K86 A;  1U8R A;  1T2K A;  4PGH A;  1S3J A;  4AVP A;  2O8X A;  3WU0 A;  1UFM A;  4WCG A;  3WU1 B;  1DPR A;  3JSP A;  2D2W A;  2GIV A;  1KGS A;  4I09 A;  3HTU A;  5KVR A;  3ZMZ A;  3EUH A;  3GUD A;  5HDK A;  1QQI A;  1IXS B;  3EET A;  2C6Y A;  3CTA A;  3SZT A;  4ENM A;  1TQI A;  1HKS A;  2MBF A;  1SD6 A;  4B8X A;  3BPX A;  2YSR A;  2P8T A;  2FF4 A;  5E1X A;  2EV5 A;  2DBB A;  4B09 A;  4AWX B;  4OIN F;  1D8J A;  1J75 A;  2M87 A;  5E8G A;  2FOK A;  4LLG F;  1MJA A;  1S6L A;  4ZH4 F;  1P4W A;  5D6E A;  2VOO A;  1L0O C;  5D4S A;  2V1U A;  2M30 A;  2A07 F;  1TQP A;  3IRR A;  1PP8 F;  1HW5 A;  2O3F A;  3ABU A;  1FSH A;  1XGS A;  1MDM A;  3KCC A;  2OZ6 A;  4BHB A;  5BQT A;  4M9X A;  2WWY A;  1T6S A;  2JPC A;  4ENK A;  1YG2 A;  3FMS A;  1ZRC A;  3KEO A;  2VBZ A;  5K5R A;  1FYK A;  4I0B A;  3CLO A;  3HTS B;  1W4M A;  2HYF A;  1I1S A;  3I4P A;  2JZY A;  5K1Y A;  3JTG A;  3QU6 A;  3MEX A;  5FLX K;  2XHK A;  3C1D A;  3WTX C;  4CGZ A;  3SHF A;  2ESN A;  3TO7 A;  2ZME A;  2IPQ X;  2H27 A;  3DV8 A;  5DD4 A;  1J59 A;  2EFW A;  5D8K B;  1L3L A;  4I02 A;  2VE9 A;  3PQK A;  2OZU A;  1MJB A;  1Z1D A;  3TDU C;  2FA5 A;  1I27 A;  2BYV E;  2VT2 A;  4U0Y A;  4UV9 A;  4WXH A;  2ISY A;  1U78 A;  5E18 F;  2RV8 A;  4HYE A;  1YS7 A;  2QBY A;  4MHG A;  4YFK F;  2DFI A;  2ADU A;  1K6O A;  5E17 F;  5L3C A;  2BEO A;  3WOD F;  3T1B A;  3EQL F;  3TOB A;  1MJ9 A;  3R60 A;  3BP8 A;  3I59 B;  2MA3 A;  1ZGA A;  2L54 A;  2X0L A;  3I71 A;  2LKP A;  1Z7U A;  4LFU A;  3V7R A;  4LK0 F;  4I2O A;  4ENN A;  4LK1 F;  1QZY A;  3T8R A;  1K7A A;  2A6E F;  3HSR A;  1KYW A;  3GF2 A;  2K7L A;  3L2C A;  5DUI A;  4MQ9 F;  1E2X A;  5HLH A;  2F5F A;  2GQQ A;  1YLF A;  1SD4 A;  5FO5 A;  2FMY A;  3K69 A;  2M45 A;  5HLG A;  2H09 A;  3V7C A;  1T0F A;  2RKH A;  4RGS A;  5AIP A;  1H9T A;  1RUN A;  2FBH A;  4YFX F;  3G73 A;  4MQV A;  2ZNZ A;  1IXR C;  2HFH A;  1UST A;  4KA4 A;  5ERI A;  3G3Z A;  5HS7 A;  5LHG A;  4M6X A;  5F6F A;  5DD8 A;  2GA1 A;  1Z9C A;  3CDH A;  3MCZ A;  3WGG A;  4UXN A;  1MZB A;  1V3F A;  1OYI A;  3O3K A;  2ZXJ A;  1GXQ A;  1G6N A;  4U7B A;  2K4B A;  2GA2 A;  2OA4 A;  3ZQ7 A;  4G6D A;  4KNY A;  4IXA A;  4EVI A;  4LGW A;  4P9U A;  1IN5 A;  3BWG A;  4XLP F;  2HKX A;  1IXC A;  5FFX A;  4KIB A;  1XGM A;  5HVQ C;  1BI1 A;  1QZZ A;  5LHH A;  3K1N A;  5FFZ A;  3E97 A;  1LVA A;  2CYY A;  2QYO A;  3HSF A;  4R79 A;  3DQV C;  3FM5 A;  3K1P A;  3T5X A;  4RGR A;  1IRF A;  2L3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...