4P55A

Crystal structure of dna binding domain of k11 from kshv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
SEWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGRNRRERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTIYKGKMKLNRWIMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Viral IRF2-like protein
publication title crystal structure of DNA binding domain of K11 from KSHV
rcsb
source organism Human herpesvirus 8 type p
total genus 27
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p55A00
4EV0A 1JGSA 3MWMA 4G6QA 3J81K 1KQ0A 4Y15A 3F8FA 5JI6A 1S7AA 3R61A 4NHJA 2QBYB 5HDNA 3J7AO 1U6GA 4MGRA 2JSCA 4L9VA 3TOBA 1QNTA 4WK8F 3BROA 1KU7A 2H94A 3C7JA 1GXQA 4KT5C 4ZYEA 1FZPB 3HOSA 5E1ZB 3VODA 2H27A 2K4JA 4EJUA 1R5HA 2KJBA 1A04A 5E8GA 2QBYA 2ZJ2A 5FLXK 4A5NA 2VONA 1IW7F 3AAFA 1I1SA 2ZO4A 3JAMZ 4LLNA 4AWXB 4WXHA 2KJCA 2DQRA 3RKWA 2GA1A 1OYWA 5E8IA 2L01A 5J6XA 3E6DA 2DK8A 4P96A 5CLSA 1J7KA 2DQLA 4GYIA 3FXRA 2H6BA 1TW3A 4IJAA 2C6YA 2HGCA 1H9GA 4U88A 4G8XA 2L54A 4HLXA 3ZQ7A 3QU3A 4LLGF 2GZWA 2VE9A 4JK1X 4F7ZA 2F5FA 1IN6A 1P4XA 4LJZF 2STTA 3E3VA 1LEBA 1IN7A 5E17F 3ZPLA 1O3QA 2A68F 3VOEA 3O3KA 3BJAA 3U2RA 1BC7C 3WTVC 2G7HA 4EJOA 2KIMA 2V1UA 4OOIA 2EFOA 2IA2A 3FZVA 3D5LA 1G3YA 1F9NA 4ZYGA 4OIOF 1E17A 4A12A 5D8LB 1F5TA 3EQLF 5DCFA 4ENKA 2GAUA 4A6EA 1G3TA 3IRRA 1MDMA 1CGPA 2YSRA 3JSPA 3QU6A 3T0YA 5JVTA 1FYMA 3K1MA 5DUKA 3RTRA 2HQNA 1FX7A 3HSFA 1IN4A 3WE2A 3IKTA 1O3SA 3BZ6A 2V6CA 3J80Z 2XKOA 3KETA 1RUNA 1B1BA 1D3YA 1O57A 3R0JA 3WODF 4O3MA 1BOAA 3E97A 1SFEA 2FQ3A 4PDKA 5K5QA 2HZTA 5F6FA 2M8EA 1ZRCA 3WGHA 2EWNA 4A0YA 5L3GA 2FNPA 5DUIA 2CGPA 5A2QZ 4IXAA 5CVUA 3O6BB 4Q5SF 1ZGAA 1ZARA 2GA2A 1CF7B 3M8FA 4CHUA 5ICGA 1Z05A 1ZRFA 3LSTA 4KMUX 3I5UA 2OQRA 4CXFA 5H6QA 2IW5A 4K2EA 2JTVA 2VXZA 2LKPA 1HKSA 5ED4A 5FB2A 1F1ZA 1T39A 4EGYA 5LRRA 2FA5A 2IA1A 1YFHA 2DPDA 2XVCA 1CF7A 4WF2A 2BGCA 2VBWA 3KP4A 1H0MA 1LQ1A 3HTUA 2JPBA 2YX7A 3ZMSA 1XGMA 3M1EA 2XAQA 1LEAA 2IRFG 2XKPA 4FHTA 5BQTA 4ESJA 2OU2A 1G6NA 1TW2A 3BY6A 4MTEA 5D8KB 4U0YA 2ZXJA 1SMYF 3HYIA 4MQVA 3DEUA 5BPDA 1B6AA 2NNNA 2HS5A 2GIVA 1K6OA 3NRVA 3BPVA 4HA8A 4EJWA 3TGNA 5BS6A 1JXSA 1KA8A 1XSVA 2Y75A 1XCVA 4G6DA 4Q48A 4KIBA 3I53A 3ULQB 3EYYA 3V7CA 1SD6A 2ZMEB 1RNLA 2VOPA 3QPTA 3HIFA 1BI3A 3KLNA 4IVNA 1YQAA 4HAMA 4NQWA 3K2ZA 2J5PA 3IKVA 3TDUC 1PP8F 1HSTA 2BYVE 2CYYA 4BHPA 4FX4A 5J8CA 4OIQF 3D0SA 3K1NA 2STWA 4I09A 2P5LC 2NNYA 2PMHA 2VBZA 2K02A 2P6TA 3F6OA 2ETHA 1U78A 1LB2A 3QP5A 4ZZDA 3GFLA 1T0FA 2M87A 4LB5A 3J81Z 2ZMEA 5CJ9A 2VODA 2O3FA 5TJJA 5HLGA 2W84A 2D1VA 4BHBA 1IXRC 3IC7A 1P2FA 1J9IA 2MA3A 2UXXA 1FYKA 3F21A 2L02A 1E2XA 2CQKA 1G3WA 1XB4A 1YW9A 2OZ6A 4MQ9F 2P6SA 5ILVA 4M73A 3R6SA 2Y0MA 3SZPA 4R1HA 4HLYA 1MZBA 1TBXA 1XCBA 2YU3A 2DBBA 4LB6B 3ERED 2W85A 2RN7A 5KK1A 5FLXZ 2L4AA 3LQQA 2A3SA 3TO6A 5FFXA 4LD5A 4I7HA 2HFHA 3WU1B 4KIFA 3E5XA 2GQQA 2ZNYA 4WWCA 2MBFA 3L9FA 2O6GE 2LF8A 3BWGA 4IF4A 4HX7A 2FOKA 4RGRA 1Z6TA 5EEGA 5BMZA 1XMKA 4YFXF 3L7WA 4IHSA 5FD6A 3ELKA 1HKTA 1HKQA 3KZYA 1I1GA 1LJ9A 3HSEA 2A07F 2QWWA 2Q2EA 5FD5A 1IRGA 5CVRA 3PQKA 2M1BA 1ZRDA 3RYPA 4PGGA 1OYYA 1WI9A 1YO5C 2RDPA 3HRTA 2RGVA 3P9KA 2XHKA 4L0YB 3H3UA 4QLCU 1IN5A 4YIIA 2DAOA 1XMAA 4ENJA 2V9VA 5LGUA 4A5MA 1S6LA 3SQNA 2QQ9A 1XD7A 4M74A 2QQAA 2W25A 3OOPA 3WTZA 4MHGA 3H92A 1ONVA 3IWZA 3IHUA 3FHZA 4HV5A 1WSUA 1OKRA 3GZ5A 3T5XA 3DQVC 3I54A 2FEZA 3U1DA 4CGZA 4OINF 1XSDA 1TLHB 1STZA 3HSRA 4H0EA 1KYZA 1RIOH 4I02A 3WTSC 3MZYA 5FGMA 4CYDA 3ZN0A 4EQQA 1ZG5A 2MD5A 3O2PE 4L18B 4RGSA 2ESHA 2OBPA 2M45A 3GUDA 3RDIA 1BJAA 2R7FA 4RGUA 2HYFA 1SFUA 3PQJA 2KIFA 3F23A 2FMLA 2GWRA 3SXYA 2A5YB 3WE3A 4HF2A 3I64A 4L5JA 1KYWA 4A2UA 4E70A 3W6JB 3CO7C 3CLOA 5CVVA 3L09A 2VC0A 2PMUA 2P7CB 1RZ4A 1T6SA 3CUQA 4L9NA 1JHFA 3RPQA 3FM3A 1DP7P 4KDPA 3WTXC 4Q4ZF 1MKMA 2IT0A 3GVAA 1G3SA 1LNWA 3LWFA 1IAWA 1WKMA 3DPTA 3HOTA 1HW2A 2QZ8A 4HOBA 1JE8A 3V4GA 1B9MA 5J8FA 1SAXA 5LBQA 4L9TA 2OA4A 3E6MA 2WWYA 3GFMA 1W5TA 1EH6A 5IT3A 3GW2A 3CO6C 3N4MA 4RB3C 4XSZF 4G7ZF 2EFQA 2Z99A 3FF5A 5ICFA 4OIRF 4ZYHA 2JPCA 3TDZC 2DFIA 5K1YA 3QPHA 1MJ9A 2MH2A 1FT9A 1PUEE 2G9WA 2QYOA 2A61A 4AIHA 4YFNF 4DQ2A 1U3EM 2IA0A 3FMRA 1MJAA 2B0LA 1TQPA 4M9ZA 2PI0A 3ROUA 1WWXA 1O7LA 2DW4A 1R23A 4O6JA 1R5GA 3KE2A 4ENNA 4UUVA 1S29A 2CSOA 2UWMA 3RPUA 4KFCA 2OQGA 3SFZA 1TQMA 2XUBA 3ZN1A 3K9TA 5LLQA 4Q47A 4KN7X 2J5OA 3IWFA 2PFBA 3EUHA 4P55A 5IT9K 1R00A 2MC3A 4L5IA 4WXDA 2YX4A 3DV8A 2RKHA 4N9IA 4UXNA 1J0RA 1TNSA 3WU0A 4ON0A 1UCRA 5AIQA 4ZH4F 2GXBA 1XGNA 3KEOA 1NHAA 3C18A 4M71A 2LDUA 3TOAA 2XROA 4A0ZA 3B02A 1O3TA 2ZFWA 2H6CA 5HDKA 5F64A 2EFPA 4KUMA 3GFJA 4HX8A 2D45A 3V7RA 5L3BA 1EV7A 3FX3A 3CTAA 3WTWC 2VE8A 1AOYA 3P7NA 4U0VA 1FY7A 1XDUA 4M9SA 5LEJA 3PFIA 2COMA 3KP5A 3KP7A 3WTUC 1FBSA 1QGPA 4PCQA 5D5WB 1OPCA 5E1XA 1K78B 2UXNA 1YS6A 2R3SA 5LEKA 5HLHA 1W7PB 4HF1A 2NAZA 1Z91A 4LG0B 5CVJA 4N9HA 2HR3A 4ETSA 1P4AA 3KCCA 4KA4A 3HRSA 1LDKB 3N97A 1FP2A 3CDHA 4S04A 1IN8A 1FPQA 1QPMA 3ML6A 4I0BA 2LNBA 2EB7A 1YG2A 3I0TA 1D8KA 1I6XA 3LA2A 4P9UA 1ZHFA 1K78A 1FP1D 3HTSB 3CUOA 3F8BA 4PZJA 1ON1A 1U5TB 1W7PA 4LG0A 1BI2A 4Y13A 1J59A 4N0BA 4FT8A 5JFRA 1FYLA 5L3DA 2YR2A 2Z33A 3JTGA 1AWCA 5TRDA 3HRMA 1ZLKA 2IPQX 3WG9A 1KQ8A 2JT1A 4QWQA 4MNUA 2X4HA 3KP2A 5HS9A 4YG2F 3GF2A 2DU9A 2VN2A 1ZG1A 2QVOA 1U5TA 3Q9SA 4JBAA 2VT2A 2DO7A 4AIKA 2EA2A 4HW0A 4I2OA 3VFZA 3EDPA 4BNCA 2A6EF 2L4MA 2G7UA 2GXGA 2HTSA 2PN6A 4RS8A 2E7WA 4M9XA 3SZTA 3U9GA 5D4RA 5D4SA 2A6HF 2E1NA 4FX0A 4P5OA 4OIPF 5HLIA 2MH9A 3BJOA 4I0AA 4OMZA 4BAYA 1JHHA 5EEHA 3MCZA 5D5UB 1YS7A 3I59B 2DI3A 3GLXA 5E20A 2LSOA 1GHCA 3L2CA 3I4PA 2D1HA 2HDCA 4R79A 2WC2A 1Y0UA 2EA4A 3T1BA 3CUQC 1ZN2A 3QRFF 4CZZA 1ZAOA 1ON2A 3F72A 3R4KA 2EFNA 1O3RA 4DNCA 2WTEA 3I59A 3F22A 3K1PA 2ZCWA 4L9JA 2DTRA 1B59A 1Z7UA 2BEOA 4RAZA 1XDSA 2H09A 5L3FA 1ULYA 1QBJA 3ABUA 4LMYA 5LHIA 1LDDA 2FBIA 3ECOA 2E7XA 4ESBA 1K79A 4KNYA 4XRFA 4HX4A 2P5KA 4ZYDA 3I58A 1TTYA 2ADUA 1XN7A 3DF8A 1HW1A 1YW8A 1P6RA 6PAXA 4B09A 3I71A 2CO5A 1FBQA 2HKOA 3BDDA 3KLOA 3LAPA 1DPRA 2IP2A 1ZYRF 2ZBKA 2Z9OA 1KU2A 4CO8A 1PP7U 5L3CA 3RKYA 5DEQA 2W57A 3ECHA 3WTTC 2DT5A 2CG4A 1IRFA 5L3EA 5BOXA 5DYMA 4XLNF 4CDGA 1R7JA 1V3FA 5ILSA 3LAJA 2E1CA 4LFUA 4WXCA 2OAZA 3RIRA 2PQ8A 3OV8A 3F6VA 5DCMB 1UHMA 1U8RA 2O0YA 5IT9Z 3ABTA 3REOA 1Q1HA 1RUOA 2FXAA 4HQMA 2HTJA 4AD9A 3KZZA 4EMSA 2HEOA 2HQRA 1SD5A 4BXUA 1BM9A 4HBLA 4MEXF 1Z9CA 3KP3A 1HXDA 4IRHA 3LA7A 2HOEA 4IPAA 1G4DA 2K27A 2KRFA 3FMQA 2KKOA 2FF4A 4R8HA 3ZMVA 3GYHX 5ICEA 1X3UA 4G94A 5K5OA 1HBXG 3F3XA 5DCMA 1I5ZA 4XLPF 1HW5A 1C0WA 1DDNA 1IF1A 5HS7A 5ICCA 4TV7A 4O5VA 1XSXA 1L0OC 4I98B 4UV9A 1BC8C 3FXUA 1J75A 3C3WA 2V79A 1IXCA 5AIPA 3HRUA 4PGHA 3K69A 2CWEA 2FSWA 3ZMZA 1YW7A 3TQNA 1TNTA 4UV8A 3WGGA 5FFZA 2V1XA 4M6YA 2PG4A 5E1WA 2ZKZA 2EV6A 1ZGJA 2FMYA 1MJBA 2F5CA 1YTYA 1XGOA 4RB0A 4A0XA 1EH7A 4HYEA 3K0LA 3NQOA 1FLIA 3M8EA 1SD7A 1ZG3A 2FE3A 1REPC 1K7AA 3RKXA 5DV5A 4HQEA 1WRJA 2BV6A 1B9NA 4GYGA 3GEZA 1GXPA 3IRQA 2M30A 1QZYA 2AS5F 2VC1A 4AIJA 2RC4A 2Y48A 2FNAA 2FBKA 2ELHA 2Q8KA 1U2WA 4LK0F 2PJPA 3QAHA 2EV5A 3WTYC 1QQIA 1OR7A 1R58A 3ZMUA 4XSXF 4GCVA 3HUGA 1T98A 1OYIA 4KN4X 1IUYA 3DFGA 1U5TC 1T38A 3GFIA 1H9TA 4A6DA 3Q5FA 1QZZA 2O03A 1I27A 3BPXA 2EK5A 2TDXA 2FRHA 1RI7A 5LGNA 1ZREA 4HDUA 4MEYF 1T2KA 1LDJA 1MDMB 4GXOA 1R1VA 3KFWX 1PDNC 2XAFA 2VBXA 4S05A 3DXJF 5F1RA 2ESNA 3E5QA 3MQ0A 5DD8A 5ILUA 1DPUA 3R60A 2X0LA 1WQ2A 4RGXA 4UVAA 1FWZA 4HF0A 2D2WA 1BIBA 2MLGA 5D5XB 2RNJA 1EH8A 4Y17A 2W24A 3WGIA 1YIOA 4RAYA 2LF7A 4WX9A 4ZZLA 2O8XA 5AONA 3ZP5A 1SD4A 4G7OF 1KU3A 3C1DA 3GX4X 5FO5A 4KYWA 2DLLA 1R1TA 3FWEA 2A69F 1F4KA 1YYVA 5HS8A 3LA3A 3MZHA 4LGWA 5H6RA 1HSJA 3VB2A 5HVQC 2XAHA 4BH9A 1P4WA 1Z1DA 2BE5F 1BI0A 3GO5A 3Q9VA 1KQ9A 1FOKA 3V7SA 2HYGD 1L3LA 4M6XA 2PBIA 5CVIA 3RJPA 1S7OA 3JSOA 4YFKF 3R0AA 4GGGA 2UZKA 4LLLA 1D5VA 3LQRA 3E6CC 4EM2A 1W4MA 4KICA 3IL2A 2O61A 4NB5A 2DPUA 2M5WA 3DKWA 3MFKA 1FBUA 2QLZA 1HQCA 4D0PA 3ISPA 3TKYA 1ZLJA 2IJLA 1B4AA 3V8JA 5D5VB 1R1UA 5LHGA 4EGZA 3GWZA 1LVAA 5BPIA 4UVBA 4BHCA 3H3ZA 5LRSA 3M7GA 4UVCA 2RQPA 2Q0OA 3JAMK 2XGXA 4EM0B 5LHHA 3JTHA 3TO9A 2P5VA 2K7LA 4G9YA 2ZNZA 2CW0F 1FSEA 2XRNA 4HDVA 2F5DA 4UHTA 4M72A 1O7FA 2OZUA 1VTNC 3TO7A 3F8CA 3GXOA 2NS0A 1ZH5A 3DP7A 4I01A 1S8NA 2KIUA 4G7HF 2Z3YA 3G3ZA 1BI1A 2RV8A 4IRGA 3V8LA 3EYIA 2WV0A 4OU0A 1SMTA 4Z2YA 4AVPA 2QENA 3GZ6A 1FSHA 2QUFA 4EM1A 3FM5A 3B73A 1W5SA 2P8TA 2VBYA 2QQBA 4U7BA 1ODDA 5HOOA 1J2XA 5KVRA 3ZMDA 1FC3A 4ASNA 3BOQA 5CYVA 2VT3A 1UB9A 4HV6A 5D6FA 3RI4A 4RB1A 1DUXC 4YIFA 4EJTA 1MD0A 3J80K 1R36A 2ISZA 2NYXA 4OMYA 5ERIA 4RB2C 2K4BA 4WCGA 2XASA 3F8NA 4U7DA 2DK5A 1XGSA 3QOPA 4XBFA 3E5UA 3P9CA 4U0WA 1P92A 1W7PD 1OMIA 1FNNA 3VEPA 4GO1A 4JQFA 5A2QK 4KIGA 1YLFA 2XAGA 2V1DA 3NEUA 2XIGA 1KGSA 5DD4A 4LK1F 5JHUA 1USTA 4P9FA 3SHFA 2CFXA 5H20A 3T8RA 1V4RA 4HZFA 5D6EA 4UNOA 2F5EA 2IVMA 4BQAA 3W6KB 3HHHA 2OD5A 3T8TA 4KMFA 3HHGA 1Z6RA 4MTDA 2YPRA 3P9IA 5JR3A 5E18F 2FBHA 3COAC 2BBYA 1D8JA 3L00A 1BIAA 4ENMA 2ISYA 3FMSA 2PEXA 3BP8A 3LFKA 3G73A 3F8MA 4ESFA 2Z5UA 2PLYA 2R7DA 5LGTA 2P4WA 4L0ZB 5K5RA 2VOOA 1S3JA 3BJ6A 1TQIA 1KU9A 5HDGA 2FU4A 1R22A 1MGTA 1J5YA 2HKXA 4BYYA 2ACJA 3RYRA 3KP6A 2QM3A 3ZMTA 1IZ1A 2RVCA 2F2EA 2HWVA 2EJRA 4IRIA 2NRAC 1QO0D 2EFWA 2AXLA 2MLKA 3MEXA 3QP6A 5DDGA 2P7VB 2EV0A 2XAJA 3KEQA 1SFXA 3M9AA 1GVJA 3S2WA 4CICA 3DPLC 3E6BA 3JW4A 4EJVA 3FXQA 4EVIA 2K86A 1UHWA 3V8KA 2JZYA 3EETA 3CJNA 1USSA 1BBYA 4B8XA 1BN5A 3CUQB 2XV4S 2JRTA 2L3DA 1IXSB 1UFMA 4IHTA 3MAJA
chains in the Genus database with same CATH superfamily
4EV0A 1JGSA 1B8IB 2ELJA 3MWMA 3M07A 1APLC 4G6QA 2XB0X 1SVOA 3ZOBA 1YJNI 1Y8QB 4E7JA 3J81K 2JA7J 2Y30A 1KQ0A 4Y15A 2LY1A 3F8FA 2DMUA 2ZXWH 3VWBA 1G2HA 5JI6A 1W0TA 1YOVB 1S7AA 3R61A 4NHJA 2MGQA 4BJ6C 2QBYB 5HDNA 3ZQQA 4IEJA 1XPXA 3CCVI 3VSKA 3J7AO 1U6GA 1IJWC 1TWCJ 4PJLA 4MGRA 5EG0A 2JSCA 4L9VA 3TOBA 3CDIA 1QNTA 4WK8F 3FK6A 2DFFA 2CV2A 3BROA 1KU7A 2RNGA 1EJ9A 2H94A 1U9OA 1MBFA 5CQEA 3C7JA 4D1QA 1GXQA 3JCUC 4KT5C 1B8IA 1JJ6C 4ZYEA 3OR1C 1FZPB 2JQ7A 3HOSA 5E1ZB 3VODA 3H9GA 2K4JA 2H27A 3LSJA 3HM5A 2XGEA 3ZGKA 1TP4A 4EJUA 1OLTA 2Z1DA 1R5HA 2KJBA 1A04A 5IYBJ 3HOYJ 5E8GA 1VQLI 1R4MB 2QBYA 3JR9A 2R4GA 4PUSA 2ZJ2A 3DPUA 5FLXK 4A5NA 2VONA 1IW7F 3AAFA 2GIZA 2DXIA 1I1SA 2WA0A 3CDLA 4BU2A 2ZO4A 3JAMZ 1MBJA 4LLNA 3M8JA 3FXKA 4AWXB 4CCJA 3BR6A 4C2UA 4WXHA 3MKLA 2KJCA 2DQRA 2PMZN 3RKWA 2GA1A 1OYWA 5E8IA 2L01A 5J6XA 3OY9A 3E6DA 2DK8A 2ZB9A 4P96A 5CLSA 1J7KA 2DQLA 4PJJA 4GYIA 3FXRA 3PUFA 2H6BA 2R7XA 1N77A 1TW3A 4IJAA 2VKDA 2C6YA 2HGCA 2Z16A 1H9GA 4U88A 4G8XA 3IH4A 2L54A 4HLXA 3ZQ7A 3QU3A 4LLGF 1GT0C 3BR1A 2GZWA 2VE9A 4JK1X 4F7ZA 2F5FA 1FOXA 1IN6A 1P4XA 2Y0SA 4LJZF 2STTA 4G12A 3E3VA 1LEBA 1IN7A 3LSMA 5E17F 3SDBA 3ZPLA 1O3QA 2A68F 3VOEA 3O3KA 3BJAA 4XRSA 3U2RA 3A4CA 3WTVC 1BC7C 1YI2I 2YU9J 2G7HA 3PSFA 1ZKGA 4EJOA 1PUFB 5HODA 2FQ4A 3QQAA 2QSHX 1LE8B 2FJ1A 2KIMA 1X1CA 2V1UA 1UG0A 2EQRA 4OOIA 2EFOA 2IA2A 3FZVA 3D5LA 5FKOA 1G3YA 2MD0A 2LP0A 3WHBA 1F9NA 4DW6A 3H0GJ 4ZYGA 2XRLA 4OIOF 1E17A 4A12A 5D8LB 1F5TA 2X6YA 4M3GA 3EQLF 1A5JA 3J7AY 3S1NJ 1SVLA 3PNTA 2KRHA 4D5CA 5C4JJ 5DCFA 3HKZA 4ENKA 2GOMA 2GAUA 4A6EA 2WAFA 1OQYA 1G3TA 3IRRA 2BXZA 2JA2A 3CCUI 1W5CC 1MDMA 1CGPA 5B1BH 2YSRA 3JSPA 4DZJA 2E35A 3QU6A 3T0YA 5JVTA 2OPTA 1J09A 2Y31A 3K1MA 5DUKA 4CUGA 1FYMA 3RTRA 2HQNA 1FX7A 1ZELA 1JGGA 3HSFA 1OCZH 1IN4A 3WE2A 4F55A 3DTEA 4M3FA 3IKTA 1O3SA 2VJJA 3BZ6A 1U0JA 2V6CA 2L9NA 3J80Z 1NK3P 2XKOA 3CF2A 5IYDJ 3KETA 3OYEA 4CCLA 1VQ7I 1PUFA 4C3HJ 2AQEA 2WBMA 1RUNA 1B1BA 1D3YA 1O57A 1XS9A 1LE8A 2LVSA 3R0JA 3ASNH 3WODF 4O3MA 1BOAA 3E97A 1SFEA 4BXXJ 2FQ3A 4PDKA 5K5QA 2HZTA 5F6FA 2M8EA 5J3LA 1ZRCA 3S2HJ 3WGHA 4ZTFA 2EWNA 3CCMI 2E1OA 4A0YA 5L3GA 2FNPA 5DUIA 2DT7B 1WH7A 2CGPA 5A2QZ 4IXAA 5CVUA 2LY2A 2KRCA 3O6BB 3SFIA 4FASD 4EEFG 4A3KJ 4Q5SF 1ZGAA 2VQHA 2DOFA 2ZJRF 4DYQA 1DU6A 1ZARA 4QSHA 1A31A 2GA2A 1CF7B 3OWTA 3FBIB 3M8FA 2XC7A 4CHUA 2KQRA 5ICGA 1Z05A 1JUSA 4B47A 3LSTA 4XICA 1ZRFA 4KMUX 2HYJA 3I5UA 4A69C 1LKXA 2OQRA 4CXFA 3OYLA 5H6QA 4JP0A 4IOAF 2IW5A 3H9QA 5F0CA 3A0BC 2JUGA 4K2EA 3HOZJ 1K61A 2JTVA 2F4IA 1Q1VA 2VXZA 3GTGJ 3OS2A 5F0FA 4F92B 2LKPA 4AIDA 1HKSA 2WAQA 1QZEA 5ED4A 3OYNA 5FB2A 1LPQA 4IHYA 2JJ7A 1F1ZA 3RPUD 3J7YJ 1T39A 4EGYA 5LRRA 2FA5A 1JKRC 2IA1A 1YFHA 4C2TA 1A35A 2H1LA 1MMDA 1R4NB 3IAM2 5GP9A 3RQIA 2DPDA 3VPRA 1XMXA 2XVCA 1CF7A 3G1OA 4WF2A 3F0CA 2LOOA 2VBWA 2BGCA 4XM3A 2CFOA 5GTHC 1BW6A 2H8WA 2X48A 3I9V2 2OTLI 3KP4A 5B1AH 4ZDPA 1H0MA 2Y69H 5TISC 1JT0A 1YX3A 1LQ1A 2IS1A 2NS8A 3HTUA 3SEZA 4MFDA 2JPBA 1P9QC 2CUJA 2YX7A 3ZMSA 1XGMA 3M1EA 2XAQA 1LEAA 1I39A 1AU7A 1BW5A 3B6AA 1WGXA 3CCRI 3DEEA 3BQYA 1ZR4A 2IRFG 2XKPA 4FHTA 5LD2C 4XLCA 5BQTA 5DS9A 4ESJA 2OU2A 3S3MA 1G6NA 1TW2A 3PNYA 3W2WA 3BY6A 4MTEA 3W3CA 5D8KB 4U0YA 3M4OJ 1D0ZA 2ZXJA 1SMYF 3HYIA 1WJDA 4MQVA 4ZDOA 4NQWB 3DEUA 4II3A 5BPDA 1B6AA 4ZTJA 2NNNA 2HS5A 1QHGA 2GIVA 4J01A 1ZK8A 3OSGA 1K6OA 3NRVA 2M0MA 4N4OB 4MLOA 4C2MJ 3BPVA 4I6ZA 4HEA2 2JVGA 2NS7A 3VYTB 4HA8A 4BQQA 4EJWA 3TGNA 5BS6A 1JXSA 2BY1A 1KA8A 1XSVA 2Y75A 3OIQA 1XCVA 4G6DA 4Q48A 1R49A 4I99C 4KIBA 1O4XA 3H5RA 3I53A 3ULQB 3EYYA 2UV1A 1WCMJ 3W2AA 3V7CA 1SD6A 2ZMEB 1RNLA 2VOPA 3QPTA 3QWLA 3HIFA 1BI3A 1LVKA 3KLNA 2JSPA 4IVNA 1YQAA 2R7RA 5J47A 1JTYA 4HAMA 4NQWA 3A1YA 3K2ZA 3WG7H 2J5PA 4UUTA 3G6EI 3IKVA 2BY0A 4IQ4A 1WPKA 3TDUC 1PP8F 2XGDA 1HSTA 1V54H 2BYVE 4FQGA 2CYYA 4BHPA 4FX4A 3SYTA 3AG2H 5J8CA 2FUG2 4OIQF 5LFAA 2EZIA 3D0SA 3K1NA 1QPIA 3CJQB 2STWA 4I09A 2P5LC 2NNYA 2R93J 2PMHA 2VBZA 2X6OA 4XLHA 2K02A 2V9KA 2P6TA 4MFEA 2E34A 3F6OA 3G4SI 2ETHA 1U78A 1VQNI 1LB2A 1HDDC 3QP5A 1OCPA 1A36A 3E7LA 3WU2C 1SANA 4ZZDA 1LFUP 2ECCA 2IGMA 5F27A 3GFLA 1T0FA 2M87A 2EZKA 4LB5A 3J81Z 4FE4A 2ZMEA 2KZVA 5CJ9A 2VODA 2R7OA 4IX7A 2O3FA 4E7KA 5TJJA 1R71A 4XKWA 1SFKA 5HLGA 2W84A 2IAIA 2D1VA 2HOTA 4BHBA 1IXRC 3IC7A 1P2FA 1J9IA 2MA3A 2UXXA 1VQ9I 1FYKA 2E19A 2QCOA 2QF7A 1BR4A 1RKWA 2L9VA 4A3CJ 4F91B 3F21A 3L2UA 2L02A 4XRMA 1E2XA 1WJFA 4NC7A 5EDNA 1VQOI 2CQKA 2DA7A 2EINH 4JOMA 1G3WA 1XB4A 2NOGA 2VJ4A 1YW9A 2OZ6A 4MQ9F 2P6SA 5ILVA 2LKXA 4M73A 3R6SA 2L7FP 1GV2A 2Y0MA 3SZPA 4AU7A 4R1HA 1TL8A 3K70C 4HLYA 3TMOA 3JRHA 1MZBA 3BC8A 1TBXA 1XCBA 2YU3A 3HGGA 4A3IJ 2EIMH 3TL4X 1BR1A 2DBBA 2GM4A 1YRNB 4LB6B 1QVTA 3LSIA 3ERED 3A01B 2W85A 2FD5A 3A0HC 2RN7A 5KK1A 1MBKA 1SAUA 5J4YA 5FLXZ 2L4AA 1MMAA 2Q2EB 2A3SA 3LQQA 1X1PA 3TO6A 2JK3A 5FFXA 4LD5A 3QYEA 4I7HA 2HFHA 3HZJA 4KIFA 1Z77A 3WU1B 3E5XA 2AHQA 2GQQA 2ZNYA 4M3EA 4PFOA 2Y2ZA 2MBFA 3RSNA 4WWCA 2HDDA 3L9FA 1FTZA 3W6VA 3GCMA 4RAFA 3ABMH 4NDLA 4HRIA 2O6GE 2LF8A 2XF7A 3BWGA 4IF4A 4HX7A 2FOKA 4RGRA 1TWGJ 1W36C 1Z6TA 5EEGA 3OYJA 5BMZA 1XMKA 2LKSA 4YFXF 4GFBA 2M2EA 3NAUA 1VQPI 3K2AA 1YRNA 3L7WA 4IHSA 3A01A 5FD6A 3ELKA 1HKTA 3QPLA 1HKQA 3ABLH 1RPWA 3KZYA 1I1GA 1LJ9A 2LFBA 3G1MA 1V5FA 2XF5A 2G0EA 2CRGA 3HSEA 4A3LJ 5TGTA 2XSJC 2A07F 3ZXSA 2QWWA 2Q2EA 5FD5A 1IRGA 5CVRA 1S72I 2EPFA 3PQKA 5J40A 2XSDC 2M1BA 1ZRDA 5CPRB 3RYPA 4Y3OA 4ANJA 4PGGA 3OYMA 1OYYA 1WI9A 1YO5C 2PJRB 2RDPA 3HRTA 2B9SA 2RGVA 3P9KA 1ITYA 3LNQA 1GV5A 4NNJA 3IH2A 5CQGA 3DU5A 2IS6A 1Y39A 4A3EJ 3CJRB 2NVQJ 3LOCA 4QPOA 1OISA 2XHKA 1YIJI 5IP7J 1S5LC 4L0YB 3H3UA 3FK7A 4QLCU 1EKEA 3QOEA 1IN5A 4YIIA 2VKEA 2DAOA 1XMAA 3QPSA 4ENJA 1TWFJ 2MC4A 2V9VA 2JMWA 5LGUA 2ECBA 5GTIC 4A5MA 4BGDA 2W82A 4BDZA 1S6LA 3CZ6A 3SQNA 2QQ9A 5HNHA 1XD7A 4M74A 3CMYA 2QQAA 2ZSHB 4HG2A 2W25A 1A6IA 1MMGA 3OOPA 3WTZA 3K4NA 5FKMA 2ID6A 4MHGA 3H92A 3GTQJ 4ZJZA 1ONVA 3IWZA 2F4OB 3IHUA 3FHZA 2AQFA 4M6VA 5K7ZA 4HV5A 1WSUA 1OKRA 3GZ5A 3T5XA 2PJRA 3DQVC 1X4PA 3K4LA 3I54A 4IOCF 3BG7A 3S93A 2FEZA 3U1DA 2XPWA 2VKVA 4OINF 4CGZA 1XSDA 4C30A 3B6CA 1TLHB 5FKKA 1STZA 3HSRA 4H0EA 1KYZA 1RIOH 4I02A 4YRVA 1FMWA 3WTSC 4A3JJ 3MZYA 5FGMA 4CYDA 3ZN0A 4EQQA 1LFPA 1ZG5A 2MD5A 3O2PE 4L18B 3DU6A 3H5NA 2WY7Q 3K4JA 4RGSA 2ESHA 3Q0WA 2OBPA 1HF0A 2O5RA 2M45A 3GUDA 3RDIA 1BJAA 2MSYA 1IG7A 2BY2A 4FISA 2R7FA 4RGUA 2HYFA 1SFUA 1K6YA 3PQJA 3FXJA 2KIFA 3F23A 2FMLA 2GWRA 4PJ0C 3RCOA 5IP6A 3SXYA 2A5YB 4HNVA 1S7EA 3WE3A 4HF2A 1FIAA 3I64A 4L5JA 1KYWA 1K4TA 2DA3A 2QKLB 4A2UA 3L2VA 4E70A 3W6JB 3TBIA 4D7MA 2V7FA 3CO7C 3ZQFA 3CLOA 2ID3A 3NWTA 1EA3A 3L09A 3EPZA 5CVVA 2VC0A 2PMUA 4MIMA 5B5EC 3I55I 2P7CB 1GVDA 1RZ4A 3HL2A 4AYBA 1U8BA 1T6SA 4QTRA 3CUQA 4L9NA 1JHFA 2M4GA 2XAUA 3FM3A 3RPQA 1DP7P 2LY9A 3O8GA 3CC7I 5M5WJ 4KDPA 3WTXC 4Q4ZF 1MKMA 2IT0A 3GVAA 1G3SA 1POGA 1LNWA 3D5RC 3LWFA 1IAWA 1T95A 1V5GA 1WKMA 3DPTA 3HOTA 1X3ZB 1BL0A 1HW2A 2QZ8A 1NK2P 1UHSA 4HOBA 1JE8A 2R7ZJ 3V4GA 2CH0A 4AM3A 1B9MA 5J8FA 3HOWJ 1VQ5I 1SAXA 5LBQA 2V26A 4BQOA 4L9TA 4G6TB 2M0CA 2CMPA 4PJNA 2OA4A 3JRDA 1X1AA 3E6MA 3ZRGA 2WWYA 3GFMA 1W5TA 2QEXI 1QU3A 1TWAJ 2AO9A 5FJ8J 3HOXJ 1EH6A 3BR0A 1DGWY 2LBFB 4F3QA 5IT3A 1NTCA 3GW2A 1FMVA 2BHYA 3CO6C 5IOYA 3N4MA 1HLVA 1VQ6I 3OYIA 4RB3C 4XSZF 2W00A 2L7ZA 4G7ZF 2A5WA 3E0JB 2EFQA 1K4SA 2Z99A 3FF5A 1IV8A 1IGNA 4RM2A 4B3AA 5ICFA 3OYFA 4OIRF 4ZYHA 2JPCA 3LMMA 3TDZC 2KLOA 2DFIA 5K1YA 3QPHA 1MJ9A 3QYBA 1EF4A 2MH2A 4PSXA 4ZDLA 1ETKA 1FT9A 4LOCA 1PUEE 2B63J 2G9WA 1VNDA 4DBRA 4C3IJ 1X1DA 2QYOA 3LSRA 1MIJA 2A61A 4AIHA 4YFNF 4DQ2A 4LIUA 1U3EM 1UAAA 2IA0A 3HBLA 3AG1H 4BY1J 3FMRA 1MJAA 2B0LA 1TQPA 4M9ZA 2PI0A 4YIRX 1B72B 3ROUA 1WWXA 1O7LA 1AA7A 2DA1A 2DW4A 1N75A 1E3PA 1R23A 4O6JA 4CCKA 1R5GA 4E7IA 4FE7A 3KE2A 4ENNA 4UUVA 3KYCB 3LSPA 1S29A 2CSOA 2UWMA 1E3HA 1RRJA 4KISA 3RPUA 4KFCA 3A2KA 1TT0A 2OQGA 4XKCA 3SFZA 4AUXA 3KZIC 2R7UA 2A6TA 1TQMA 2DA6A 1AHDP 2XUBA 3ZN1A 3PM1A 3K9TA 3GTOJ 3KEYA 5LLQA 2VI6A 4Q47A 4KN7X 4A93J 2J5OA 1GUUA 5M5XJ 3IWFA 2PFBA 2O7OA 2BY3A 3EUHA 4P55A 4ZC3A 3ZQHA 4V19K 3AG3H 3CCQI 2R0QC 4IL6C 3UKGA 1DQUA 5IT9K 1MH3A 1R00A 2MC3A 4L5IA 4WXDA 2YX4A 3DV8A 1B72A 2RKHA 4N9IA 4UXNA 1J0RA 2ELKA 1TNSA 1P7JA 1T0FC 1V55H 3WU0A 4B1RA 4ON0A 3JREA 3AFHA 3MKWB 1UCRA 2ZMEC 2DYSH 4W97A 2F6CA 5AIQA 4ZH4F 3BTLA 2MW8A 1JKQC 2GXBA 1UG2A 3M1CA 1ACIA 1XGNA 4FCYA 3KEOA 4XORA 2WAEA 1NHAA 3C18A 4M71A 2B7EA 2OCCH 2LDUA 3HDDA 4BY7J 2LYCA 3DBHB 3TOAA 4UB6C 2VLAA 1CQTA 3K10A 2XROA 4A0ZA 2KDOA 1FIPA 2IBDA 3B02A 1O3TA 3ONQA 2K9NA 2ZFWA 2H6CA 3QODA 5HDKA 2X9DA 5F64A 2EFPA 4KUMA 3GFJA 3OYAA 4HX8A 3K70D 2D45A 3M3YJ 4DBQA 3V7RA 3CLQA 5L3BA 1EV7A 3FX3A 2HDWA 2KDZA 3CTAA 4ITVA 3WTWC 2VE8A 5F1JA 4HSRA 1AOYA 1TWHJ 3LL7A 3P7NA 4U0VA 3E1SA 1FY7A 2JWTA 1XDUA 3K6GA 4M9SA 1ETWA 5LEJA 1YHQI 3ASOH 4RLFA 3PFIA 2COMA 3KP5A 3KP7A 3WTUC 1VQKI 3U1KA 3L2WA 1FBSA 2VPLA 4XLEA 1QGPA 3OYGA 1VFCA 4XN3A 4PCQA 1X3WB 5HNFA 5D5WB 1Z3XA 3EUAA 1OPCA 5E1XA 1K78B 2UXNA 1YS6A 2F48A 2R3SA 5LEKA 1QA6A 2FOWA 5HLHA 2LD5A 2IS2A 1W7PB 4HF1A 2NAZA 1W36D 1Z91A 4LG0B 5CKTA 2EZHA 5CVJA 4N9HA 2RAEA 1VZ0A 2HR3A 4ETSA 1P4AA 3KCCA 2HPMA 4KA4A 2P0WA 2K9LA 3JRBA 1PYVA 1ZGWA 1OCRH 3HRSA 2V1NA 1LDKB 1JKOC 2QSFX 3N97A 1FP2A 1H8AC 2PMZA 3CDHA 4S04A 1IN8A 1FPQA 1QPMA 3ML6A 4RBOA 4I0BA 2LNBA 1A6QA 2EB7A 3CP8A 1YG2A 3I0TA 1D8KA 1I6XA 1JTXA 1DP3A 3LA2A 4P9UA 2M7BA 3OSFA 3BTIA 1I3AA 1ZHFA 1K78A 1FP1D 3CCEI 3HTSB 2KIQA 3CUOA 3F8BA 4ABZA 5IPAA 4PZJA 3X2QH 1ON1A 1U5TB 1W7PA 3K4MA 2EBIA 2IGOA 4LG0A 3BG9A 2KISA 3AL0B 2CQXA 1BI2A 1QHHD 4Y13A 1J59A 3CJTB 1UZCA 4N0BA 2K9SA 5GPAA 4FT8A 5JFRA 1FYLA 1XC5A 4CYCB 5L3DA 2YR2A 2Z33A 2BHZA 3JTGA 1AWCA 4E7ZA 4BUPA 1MNDA 5TRDA 2QKMB 3HRMA 1ZLKA 3RKQA 2IPQX 1K83J 2MABA 2MYSA 3LSGA 3WG9A 5M3FJ 1KQ8A 2JT1A 5EF6A 4QWQA 4MNUA 2H1KA 2CUFA 2OUMA 2X4HA 3ZCOA 3KP2A 3FXMA 5J1RA 1HA8A 4J00A 5HS9A 2UUZA 1WVRA 5DTDA 4YG2F 3KYDB 1X58A 3F9KA 3GF2A 3H0DA 2DU9A 1X2MA 2VN2A 5JVGF 2A05A 1HOMA 2ZXHA 3H1CA 5IP9J 4UY8I 4IHXA 1ZG1A 2QVOA 1U5TA 3Q9SA 2EH3A 4EATA 1UMQA 4JBAA 4CH7A 1RR8C 2V6EA 2VT2A 2KZGA 4CYCA 1SEUA 2DO7A 4RM3A 4AIKA 2EA2A 2W1OA 4HW0A 5E3NA 2DA4A 4I2OA 3CMAI 3K4CA 3A02A 3DBLB 4KT6A 4B3XA 3VFZA 4JX4A 3EDPA 4BNCA 5DM7F 2K9QA 2A6EF 2L4MA 1XG1A 2G7UA 2GXGA 2HTSA 2L9RA 1VQ4I 2PN6A 2HXOA 2E7WA 4RS8A 4M9XA 3SZTA 3U9GA 2XB5A 5D4RA 1OCCH 4BKXA 5D4SA 2A6HF 2E1NA 1XTAA 4FX0A 2Y9YA 3G2BA 4P5OA 4OIPF 3DBRB 4XKVA 3G71I 2NXNB 3OR2C 3S3OA 3IAS2 5HLIA 2MH9A 2EZLA 2OJED 3BJOA 4I0AA 5DM6F 1YITI 4OMZA 4BAYA 1E0EA 1JHHA 2WY8Q 4M3DA 2R7TA 1ETVA 5EEHA 3MCZA 2R92J 2JVHA 4LIVA 5D5UB 1YS7A 2M4KA 3I59B 2HOAA 2DI3A 3GLXA 3BR5A 4A3BJ 5E20A 2LSOA 1GHCA 3L2CA 3I4PA 2D1HA 4OAYA 5J4VA 2HDCA 3TP3A 4R79A 2HXIA 3HGYA 2WC2A 3S32A 1MSFC 4E7LA 5E79C 3ZR8X 1Y0UA 5EZGA 2EA4A 3T1BA 3SZGA 4XOTA 4Y52J 4P1WA 3GTJJ 3CUQC 1ZN2A 1MMSA 3QRFF 1Z7LA 3ZQLA 4CZZA 1ZAOA 4A3DJ 1ON2A 1FOWA 3MKZA 3F72A 3PJRA 4BEHB 3R4KA 2EFNA 4RLQA 1O3RA 3BT9A 4RAGA 1IC8A 4A3GJ 2DODA 3MKYB 1AKHB 1WFXA 1YE9A 2MFZA 4XIDA 4DNCA 3HOVJ 3AKZA 2WTEA 3I59A 1S9HA 3F22A 3K1PA 2ZCWA 5FKNA 4L9JA 4D5FA 3S17J 2DTRA 3OS1A 1B59A 1Z7UA 2BEOA 5EEAA 4RAZA 1XDSA 2H09A 5L3FA 1ULYA 2X6XA 2R5YB 1RETA 1QBJA 2OC6A 3ABUA 4LMYA 4AC0A 5LHIA 1LDDA 1T8IA 2LC2A 2IGKA 2FBIA 3ECOA 2CV1A 2E7XA 5FRMA 4ESBA 1MBHA 5F08A 1K79A 4GRIA 2DMNA 4KNYA 4XRFA 4HX4A 3SEQA 1T56A 2P5KA 4ZYDA 2XF6A 4BDYA 3I58A 2HVRA 3CC4I 1TTYA 1Y0NA 2L5QA 3DWLE 2ADUA 1XN7A 2K3PA 3DF8A 3HPGA 1AKHA 3K7AJ 1HW1A 1YW8A 1P6RA 4PSWA 6PAXA 4B09A 3GTKJ 3I71A 4FTHA 3ZQGA 4CCMA 1I50J 2CO5A 3S3NA 1YX5A 1Y8RB 1FBQA 2HKOA 2W4SA 3BDDA 2DDBA 1SC7A 2ZFUA 3KLOA 2DN0A 3LAPA 1DPRA 2EIJH 2IP2A 2ZJQF 1ZYRF 4BJ5C 2ZBKA 2R5YA 2Z9OA 1KU2A 4BQNA 4CO8A 3J7ZI 1PP7U 2L0KA 5L3CA 5F0HA 3L1PA 3RKYA 5DEQA 3VSLA 1KZHA 4F52A 2W57A 9ANTA 3C2BA 3NWSA 3ECHA 3WTTC 2DT5A 1WI3A 1IRFA 2CG4A 5L3EA 5BOXA 2XPVA 5DYMA 4XLNF 2BXYA 3PFYA 4CDGA 2OTJI 1R7JA 4HNUA 1JI8A 1V3FA 4PJMA 5ILSA 3LAJA 2E1CA 5EYRA 3MD2A 4LFUA 4WXCA 1H88C 2L9SA 2Z2SB 2OAZA 3EUHC 1G8XA 3RIRA 2PQ8A 3OV8A 5C4XJ 3OL4A 2VJ5A 2VB6A 3ESWB 3F6VA 4OWRB 5DCMB 1UHMA 4NC8A 1U8RA 1HCRA 2M8GX 2KHMA 2O0YA 5IT9Z 3ABTA 3REOA 1Q1HA 1RUOA 2QSGX 2FXAA 4HQMA 2RREA 2HTJA 4NC6A 2JA5J 4AD9A 3DKXA 2K3FA 3HEFA 3KZZA 2Y0SN 4E6KG 2WB1A 4EMSA 4JX6A 3LFUA 3OOUA 2HEOA 2HQRA 1WJEA 2X51A 2M9HA 1SD5A 4BXUA 1BM9A 2NVXJ 2Q1ZB 4HBLA 4MEXF 3HPHA 1Z9CA 1WJCA 3KP3A 1HXDA 5JHFA 4IRHA 2R7WA 3LA7A 3JRAA 2HOEA 2LREA 1T33A 4IPAA 2HQ5A 4E4HA 1G4DA 5KCMA 2K27A 2KRFA 3FMQA 2ZJPF 2JA6J 2KKOA 2FF4A 4R8HA 1D1CA 3ZMVA 3GYHX 4DZPA 3CC2I 5ICEA 1IO2A 2ZSIB 4XNFA 3V42A 1X3UA 4G94A 2VQLA 1IRZA 5K5OA 4M3BA 3I3LA 4B43A 4QIWN 1HBXG 3F3XA 5DCMA 1QRYA 2OCEA 3D1NI 3Q0UA 2GOXB 3FKIJ 1I5ZA 3BG6A 2VQCA 2R7QA 2DMPA 3HKZN 4F93B 4XLPF 1IDZA 1HW5A 5KAIC 2VL8A 4CSWA 1C0WA 3H3VK 1DDNA 1IF1A 5HS7A 5ICCA 2OF7A 1FTTA 2E1MB 2O8KA 1KONA 4TV7A 4O5VA 2R5ZB 1XSXA 1L0OC 4I98B 3GLLA 4UV9A 3VYUB 2E2JJ 2Y9ZA 1BC8C 3CP2A 3FXUA 1J75A 2PX9A 3FHNA 3C3WA 3I56I 2V79A 4IHVA 1ETXA 4I76A 3BLYA 1IXCA 5AIPA 1NH3A 3HRUA 4PGHA 2N8GA 2LR8A 3K69A 2ICWG 2CWEA 2FSWA 3ZMZA 1Y1WJ 1YW7A 1W1WE 3TQNA 2XDVA 2E71A 3GTPJ 1ETOA 3ZQIA 1TNTA 2HU9A 4JX5A 4UV8A 4E7HA 3WGGA 2HNHA 2IS4A 1OFCX 2F4MB 1F43A 5FFZA 2JRMA 4MO7A 2V1XA 4M6YA 2PG4A 3HC7A 5E1WA 2VASA 5H2FC 2ZKZA 3BCBA 2EV6A 1ZGJA 2FMYA 1RC9A 1MJBA 2F5CA 3GTMJ 1YTYA 1XGOA 2R5ZA 4RB0A 2CU7A 2LLKA 4NUBA 4XL9A 4A0XA 3EUKL 1EH7A 4C3JJ 4HYEA 2CQ7A 3K0LA 3NQOA 1FLIA 1VQMI 3M8EA 3KYLA 1SD7A 1ZG3A 2FE3A 4KJZA 3HUGB 1REPC 1VF9A 4YELA 2H8RA 2K9MA 5IOZA 3RKXA 2BW3B 1K7AA 1IUFA 5DV5A 3I4NJ 2ZXIA 3D5SC 1Z3YA 2CJJA 2HOSA 3K4KA 4HQEA 1WRJA 2BV6A 4N4NB 1B9NA 4GYGA 4BE1A 3GEZA 1GXPA 3IRQA 2M30A 1QZYA 4S0HB 2AS5F 1W0UA 2VC1A 3BR2A 4CA0A 4AIJA 1GDTA 2RC4A 2Y48A 2FNAA 2FBKA 5IY5H 2WAQN 2ELHA 1OCOH 2JA8J 1GLNA 2Q8KA 1U2WA 4X1EA 4LK0F 2PJPA 3PIOF 2I8DA 3VYRB 3CCYA 3QAHA 2EV5A 2CQNA 3PSIA 3WTYC 3IP4B 1QQIA 4CZCA 2VQGA 3NARA 1JT6A 1OR7A 1R58A 3DTKA 3ZMUA 4XSXF 3IUOA 3P5JA 4GCVA 3HUGA 3Q3SA 1T98A 1OYIA 4KN4X 4XKBA 1IUYA 2BW3A 2BVLA 5J1UA 4DOZA 3DFGA 1U5TC 2LBFA 1T38A 3GFIA 4XLFA 4X0GA 1H9TA 4A6DA 3Q5FA 1QZZA 1NG6A 3DTIA 3VDXA 3AL0C 2CS3A 2QQ8A 2O03A 1I27A 2E36A 3BPXA 2EK5A 1MH4A 1R6RA 2TDXA 2FRHA 1RI7A 1LUJB 2CV0A 3VYSB 3H9JA 5LGNA 1ZREA 4BBRJ 4HDUA 4MEYF 1T2KA 1FEXA 1LDJA 2DT6A 2VXDA 3BG3A 1MDMB 4GXOA 1R1VA 3KFWX 1PDNC 1WHUA 2XAFA 2YUSA 3CCJI 1Y56A 5J1YA 3CF5F 3TEDA 2VBXA 4S05A 3HOUJ 4IZZA 3DXJF 1BJZA 5F1RA 2ESNA 3E5QA 3MQ0A 5DD8A 5ILUA 1T08B 1DPUA 3R60A 4XQFA 2X0LA 1WQ2A 3C2HA 4RGXA 4Y33A 3S14J 4UVAA 1FWZA 4HF0A 2D2WA 1BIBA 2O9LA 2MLGA 2KT0A 5D5XB 4KITB 4A3MJ 2RNJA 2X6WA 4IKFA 5FLVA 1EH8A 3HXLA 3IV5A 4Y17A 2IGNA 5B66C 5K7FA 2COBA 2QA4I 2WV1A 4RA2A 2W24A 1VQ8I 3WGIA 2DA5A 4C9YA 3FDYA 1YIOA 1R9TJ 2L7KA 2V4JC 4RAYA 2LF7A 1QVUA 2V9PA 1ENHA 4WX9A 4ZZLA 2O8XA 1M1EB 5AONA 1TZLA 5KAFC 3ZP5A 1N25A 2DMTA 2DTZA 1SD4A 3JRIA 2BVMA 4G7OF 2ME0A 1KU3A 1BOBA 3C1DA 3GX4X 5FO5A 2VJIA 3RQ4A 2DLLA 1R1TA 3FWEA 3PNVA 4KYWA 5C44J 2A69F 1F4KA 4IO9F 1YYVA 5HS8A 3LA3A 5GAGJ 5KNLA 3MZHA 3SDGA 1U9NA 2GXAA 3DLAA 1UELB 4LGWA 5H6RA 1HSJA 3VB2A 5HVQC 3WHCA 2XAHA 1MBGA 2CW7A 4BH9A 1P4WA 1RKTA 1FOYA 2I10A 3HJEA 1Z1DA 1WZ2A 1ETQA 2BE5F 2JN6A 2M3AA 4UUSB 1BI0A 1MBEA 3GO5A 3Q9VA 1KQ9A 3CCLI 1FOKA 3V7SA 1SFOJ 3UNGC 2HVSA 3KIOA 2HI3A 2EIKH 2HYGD 1ZR2A 4M6XA 1L3LA 2BOLA 2PBIA 4ZYAA 5FROA 5FKLA 3N05A 1JUMA 5CVIA 2GBYA 3RJPA 1S7OA 3JSOA 2VUMJ 4Y4RA 4YFKF 1E3OC 3R0AA 4GGGA 4H4KC 2UZKA 2IXSA 4V2FA 3L2RA 1Z21A 4LLLA 1D5VA 3LQRA 3E6CC 5JLWA 2M7AA 2E2IJ 4EM2A 1ERDA 1W4MA 4KICA 4DYCA 3IL2A 2O61A 4NB5A 1X1BA 1PVEA 2DPUA 1BA5A 2M5WA 3DKWA 3MFKA 1FBUA 4UUSA 1I6HJ 1MMNA 3H35A 3IH3A 3U21A 4L5EA 2ME6A 2QLZA 1HQCA 4D0PA 1ORKA 2DJIA 1MW7A 3ISPA 3TKYA 2L2OA 2E2HJ 4BJTA 1IRXA 1X19A 1ZLJA 2IJLA 3S1QJ 1B4AA 3V8JA 2F5VA 3S16J 1JUPA 2DCEA 2LRDA 2W48A 5D5VB 1R1UA 5LHGA 4EGZA 3C2GA 1IV6A 3GWZA 3JRGA 1LVAA 2HPIA 4XRSG 5GADJ 5BPIA 4UVBA 4BHCA 3S1RJ 3H3ZA 5FLMJ 2KMUA 5LRSA 3M7GA 4UVCA 2EILH 3W2VA 2RQPA 4QPQA 1X4OA 4PK4A 2M34A 4XMYA 2Q0OA 2IEKA 3JAMK 3TW7A 2XGXA 1N78A 4EM0B 3DEWA 5LHHA 3DLLF 3JTHA 3TO9A 4E7SA 2FX0A 2P5VA 3ERMA 2KP6A 2K7LA 4G9YA 2ZNZA 2CW0F 1FSEA 2XRNA 4HDVA 2F5DA 3ABKH 4UHTA 4M72A 1MNEA 3MAJA 1O7FA 2OZUA 1VTNC 4Y7NJ 5KHDA 3TO7A 4XLAA 3F8CA 5IYCJ 4X6AJ 3BZKA 3GXOA 2NS0A 1ZH5A 1Z0XA 1D0YA 1IDYA 2L7MP 2OV7A 5M5YJ 2YS9A 3OYCA 3MN2A 3OYKA 3DP7A 1Y6IA 3Q0VA 5GPCA 4W1UA 2WADA 2X1EA 3RZDJ 4I01A 3H5AA 1DU0A 2DDAA 1S8NA 2KIUA 2CUZA 2LMDA 3CMMA 4G7HF 2Z3YA 4D7NA 3A03A 4GDFA 3G3ZA 3TW6A 3FXOA 1BI1A 2RV8A 5F04A 4IRGA 4NBQA 3OIPA 3V8LA 3EYIA 4XR6A 4A3FJ 2HQAA 2WV0A 1SMTA 3DCFA 4OU0A 4J19A 4Z2YA 4AVPA 2QENA 1MNMC 5K7HA 4XK4A 4JYKA 5EGOB 3GZ6A 1WJAA 4YEJA 1FSHA 3CQZJ 2QUFA 4HSTA 3BG5A 1D0XA 4B44A 4EM1A 3FM5A 3B73A 1W5SA 1RESA 2P8TA 1D1BA 4B4CA 2E5ZA 3JRFA 2K5CA 2VBYA 2QQBA 4U7BA 4DJAA 1LFBA 3HB9A 1ODDA 3GBGA 5HOOA 1J2XA 4RMNA 5KVRA 3ZMDA 2KFDA 1ZQ3P 2WB1N 1FC3A 4ASNA 4BE0A 3BOQA 5CYVA 2VT3A 4V2GA 1UB9A 5E3MA 4BL0B 4HV6A 5D6FA 1OJLA 3RI4A 1TT5B 2MG4A 4RB1A 2P81A 4YIFA 1DUXC 4EJTA 1MD0A 3J80K 1R36A 3FKJA 2NYXA 2ISZA 5ERIA 4OMYA 4RB2C 4BS9A 1TC3C 5EGOA 2RQQA 2K4BA 4WCGA 3S15J 3QYFA 2XASA 3F8NA 2NVYJ 3KPHA 4U7DA 2DK5A 1XGSA 5HLTA 3QOPA 3S1MJ 4XBFA 2DA2A 3E5UA 3L2QA 2XGCA 3P9CA 1WJ5A 1SVMA 4U0WA 1P92A 1W7PD 2E1MC 2W7NA 4RDUA 1OMIA 5FRNA 1V5EA 1X2NA 3GTLJ 4IQJA 1FNNA 3VEPA 3SJMA 5E3LA 5BNGA 3OS0A 4GO1A 4JQFA 3I4MJ 5A2QK 2GLOA 4KIGA 1YLFA 2XAGA 4D9JA 2E5NA 2V1DA 2NOJB 3NEUA 4BBSJ 2KPMA 2XIGA 1PJRA 1KGSA 2X1DA 3BR3A 5DD4A 1DGRM 4LK1F 5JHUA 1USTA 3HG9A 2CW8A 3KX2A 3BQZA 3PO2J 1VI0A 4OAZA 4CCNA 1HDPA 4P9FA 2NVTJ 2HZDA 3H36A 3SHFA 3CD6I 2CFXA 3CESA 1P7IA 4LG3A 1V4RA 5H20A 3T8RA 4HZFA 4AYBN 5D6EA 4BEHA 4UNOA 3FISA 2F5EA 1G59A 2QGUA 4DGWB 3OYBA 2IVMA 4BQAA 3W6KB 3BTJA 2CQQA 2OD5A 2CUEA 3HHHA 3T8TA 4KMFA 3HHGA 1Z6RA 3PL8A 1WJBA 1F36A 4MTDA 4DYRA 2DOEA 4UB8C 2YPRA 3BZCA 1I3QJ 3OIOA 3P9IA 5JR3A 5E18F 1OR7C 2FBHA 2X85A 3COAC 2BBYA 1D8JA 2XPUA 2DMQA 3L00A 1BR2A 1BIAA 4ENMA 2ISYA 3FMSA 2PEXA 3BP8A 2JUCA 4B48A 1WH5A 2TCTA 3LFKA 3CCSI 3G73A 3F8MA 4ESFA 2Z5UA 2PLYA 2VIXA 2X1CA 2R7DA 5LGTA 2P4WA 4XOPA 1HC8A 4DIQA 5K5RA 4L0ZB 1S3JA 2VOOA 3OYDA 3BJ6A 3CMEI 3ZQCA 1TQIA 3RZOJ 3GZNB 1KU9A 2LH9A 5HDGA 1JKPC 2LTPA 2D5VA 2FU4A 4BXFA 2VKHA 1R22A 1MGTA 1UJ8A 1Y1VJ 3O8HA 1J5YA 4PFPA 2HKXA 3LSKA 5GAEJ 1D5YA 2ZC2A 4BYYA 2ACJA 3RYRA 3DKYA 3KP6A 2QM3A 3LSHA 3OYHA 3ZMTA 4BE2A 1H89C 3PO3J 2HVQA 5GAHJ 2TRTA 1IZ1A 2RVCA 2F2EA 1YJ9I 1ZTRA 2DJNA 1R5ID 2HWVA 2EJRA 3S2DJ 5B3SH 2AXTC 3GMEA 1MSEC 1Z67A 1OCTC 4IRIA 2NRAC 4IHWA 4HPQA 3MZ8A 2LK2A 1QO0D 3AG4H 2EFWA 2AXLA 2DFHA 2I5UA 2MLKA 3MEXA 3QP6A 5C3EJ 2R7SA 5DDGA 2DOAA 4FETA 4AVZA 2P7VB 2K85A 2EV0A 2XAJA 1YJWI 2BZTA 3FBNB 3KEQA 3MVPA 4HNTA 3FXLA 5E3OA 5JLXA 1SFXA 3M9AA 2VPRA 1GVJA 4LITA 3S2WA 3FIWA 4XONA 4CICA 5EJCA 2LG4A 3DPLC 3E6BA 3MMYB 1D1AA 2DFEA 3JW4A 2DYRH 3PUBA 4EJVA 3OL3A 4Z6YA 3FXQA 4EVIA 3JRCA 1XX5A 3OMYA 5M3MJ 2R7VA 4XN0A 1JJ8C 4CCOA 5EZHA 2K86A 2NVUB 1UHWA 3V8KA 3G1LA 1RR7A 2K40A 3S8PA 2JZYA 3EETA 3UR3C 5EG0B 4II2A 3PIPF 3BCAA 3CJNA 1USSA 1BBYA 4B8XA 1ETYA 3BTCA 1BN5A 3CUQB 1NG7A 2XV4S 1FJLA 2JRTA 2L3DA 1IXSB 1UFMA 2E60A 4BACA 4U87A 4IHTA 3TP0A 3K4BA 2KL4A
chains in the Genus database with same CATH topology
4EV0A 1JGSA 3MWMA 4G6QA 3J81K 1KQ0A 4Y15A 3F8FA 5JI6A 1S7AA 3R61A 4NHJA 2QBYB 5HDNA 3J7AO 1U6GA 4MGRA 2JSCA 4L9VA 3TOBA 1QNTA 4WK8F 3BROA 1KU7A 2H94A 3C7JA 1GXQA 4KT5C 4ZYEA 1FZPB 3HOSA 5E1ZB 3VODA 2H27A 2K4JA 4EJUA 1R5HA 2KJBA 1A04A 5E8GA 2QBYA 2ZJ2A 5FLXK 4A5NA 2VONA 1IW7F 3AAFA 1I1SA 2ZO4A 3JAMZ 4LLNA 4AWXB 4WXHA 2KJCA 2DQRA 3RKWA 2GA1A 1OYWA 5E8IA 2L01A 5J6XA 3E6DA 2DK8A 4P96A 5CLSA 1J7KA 2DQLA 4GYIA 3FXRA 2H6BA 1TW3A 4IJAA 2C6YA 2HGCA 1H9GA 4U88A 4G8XA 2L54A 4HLXA 3ZQ7A 3QU3A 4LLGF 2GZWA 2VE9A 4JK1X 4F7ZA 2F5FA 1IN6A 1P4XA 4LJZF 2STTA 3E3VA 1LEBA 1IN7A 5E17F 3ZPLA 1O3QA 2A68F 3VOEA 3O3KA 3BJAA 3U2RA 1BC7C 3WTVC 2G7HA 4EJOA 2KIMA 2V1UA 4OOIA 2EFOA 2IA2A 3FZVA 3D5LA 1G3YA 1F9NA 4ZYGA 4OIOF 1E17A 4A12A 5D8LB 1F5TA 3EQLF 5DCFA 4ENKA 2GAUA 4A6EA 1G3TA 3IRRA 1MDMA 1CGPA 2YSRA 3JSPA 3QU6A 3T0YA 5JVTA 1FYMA 3K1MA 5DUKA 3RTRA 2HQNA 1FX7A 3HSFA 1IN4A 3WE2A 3IKTA 1O3SA 3BZ6A 2V6CA 3J80Z 2XKOA 3KETA 1RUNA 1B1BA 1D3YA 1O57A 3R0JA 3WODF 4O3MA 1BOAA 3E97A 1SFEA 2FQ3A 4PDKA 5K5QA 2HZTA 5F6FA 2M8EA 1ZRCA 3WGHA 2EWNA 4A0YA 5L3GA 2FNPA 5DUIA 2CGPA 5A2QZ 4IXAA 5CVUA 3O6BB 4Q5SF 1ZGAA 1ZARA 2GA2A 1CF7B 3M8FA 4CHUA 5ICGA 1Z05A 1ZRFA 3LSTA 4KMUX 3I5UA 2OQRA 4CXFA 5H6QA 2IW5A 4K2EA 2JTVA 2VXZA 2LKPA 1HKSA 5ED4A 5FB2A 1F1ZA 1T39A 4EGYA 5LRRA 2FA5A 2IA1A 1YFHA 2DPDA 2XVCA 1CF7A 4WF2A 2BGCA 2VBWA 3KP4A 1H0MA 1LQ1A 3HTUA 2JPBA 2YX7A 3ZMSA 1XGMA 3M1EA 2XAQA 1LEAA 2IRFG 2XKPA 4FHTA 5BQTA 4ESJA 2OU2A 1G6NA 1TW2A 3BY6A 4MTEA 5D8KB 4U0YA 2ZXJA 1SMYF 3HYIA 4MQVA 3DEUA 5BPDA 1B6AA 2NNNA 2HS5A 2GIVA 1K6OA 3NRVA 3BPVA 4HA8A 4EJWA 3TGNA 5BS6A 1JXSA 1KA8A 1XSVA 2Y75A 1XCVA 4G6DA 4Q48A 4KIBA 3I53A 3ULQB 3EYYA 3V7CA 1SD6A 2ZMEB 1RNLA 2VOPA 3QPTA 3HIFA 1BI3A 3KLNA 4IVNA 1YQAA 4HAMA 4NQWA 3K2ZA 2J5PA 3IKVA 3TDUC 1PP8F 1HSTA 2BYVE 2CYYA 4BHPA 4FX4A 5J8CA 4OIQF 3D0SA 3K1NA 2STWA 4I09A 2P5LC 2NNYA 2PMHA 2VBZA 2K02A 2P6TA 3F6OA 2ETHA 1U78A 1LB2A 3QP5A 4ZZDA 3GFLA 1T0FA 2M87A 4LB5A 3J81Z 2ZMEA 5CJ9A 2VODA 2O3FA 5TJJA 5HLGA 2W84A 2D1VA 4BHBA 1IXRC 3IC7A 1P2FA 1J9IA 2MA3A 2UXXA 1FYKA 3F21A 2L02A 1E2XA 2CQKA 1G3WA 1XB4A 1YW9A 2OZ6A 4MQ9F 2P6SA 5ILVA 4M73A 3R6SA 2Y0MA 3SZPA 4R1HA 4HLYA 1MZBA 1TBXA 1XCBA 2YU3A 2DBBA 4LB6B 3ERED 2W85A 2RN7A 5KK1A 5FLXZ 2L4AA 3LQQA 2A3SA 3TO6A 5FFXA 4LD5A 4I7HA 2HFHA 3WU1B 4KIFA 3E5XA 2GQQA 2ZNYA 4WWCA 2MBFA 3L9FA 2O6GE 2LF8A 3BWGA 4IF4A 4HX7A 2FOKA 4RGRA 1Z6TA 5EEGA 5BMZA 1XMKA 4YFXF 3L7WA 4IHSA 5FD6A 3ELKA 1HKTA 1HKQA 3KZYA 1I1GA 1LJ9A 3HSEA 2A07F 2QWWA 2Q2EA 5FD5A 1IRGA 5CVRA 3PQKA 2M1BA 1ZRDA 3RYPA 4PGGA 1OYYA 1WI9A 1YO5C 2RDPA 3HRTA 2RGVA 3P9KA 2XHKA 4L0YB 3H3UA 4QLCU 1IN5A 4YIIA 2DAOA 1XMAA 4ENJA 2V9VA 5LGUA 4A5MA 1S6LA 3SQNA 2QQ9A 1XD7A 4M74A 2QQAA 2W25A 3OOPA 3WTZA 4MHGA 3H92A 1ONVA 3IWZA 3IHUA 3FHZA 4HV5A 1WSUA 1OKRA 3GZ5A 3T5XA 3DQVC 3I54A 2FEZA 3U1DA 4CGZA 4OINF 1XSDA 1TLHB 1STZA 3HSRA 4H0EA 1KYZA 1RIOH 4I02A 3WTSC 3MZYA 5FGMA 4CYDA 3ZN0A 4EQQA 1ZG5A 2MD5A 3O2PE 4L18B 4RGSA 2ESHA 2OBPA 2M45A 3GUDA 3RDIA 1BJAA 2R7FA 4RGUA 2HYFA 1SFUA 3PQJA 2KIFA 3F23A 2FMLA 2GWRA 3SXYA 2A5YB 3WE3A 4HF2A 3I64A 4L5JA 1KYWA 4A2UA 4E70A 3W6JB 3CO7C 3CLOA 5CVVA 3L09A 2VC0A 2PMUA 2P7CB 1RZ4A 1T6SA 3CUQA 4L9NA 1JHFA 3RPQA 3FM3A 1DP7P 4KDPA 3WTXC 4Q4ZF 1MKMA 2IT0A 3GVAA 1G3SA 1LNWA 3LWFA 1IAWA 1WKMA 3DPTA 3HOTA 1HW2A 2QZ8A 4HOBA 1JE8A 3V4GA 1B9MA 5J8FA 1SAXA 5LBQA 4L9TA 2OA4A 3E6MA 2WWYA 3GFMA 1W5TA 1EH6A 5IT3A 3GW2A 3CO6C 3N4MA 4RB3C 4XSZF 4G7ZF 2EFQA 2Z99A 3FF5A 5ICFA 4OIRF 4ZYHA 2JPCA 3TDZC 2DFIA 5K1YA 3QPHA 1MJ9A 2MH2A 1FT9A 1PUEE 2G9WA 2QYOA 2A61A 4AIHA 4YFNF 4DQ2A 1U3EM 2IA0A 3FMRA 1MJAA 2B0LA 1TQPA 4M9ZA 2PI0A 3ROUA 1WWXA 1O7LA 2DW4A 1R23A 4O6JA 1R5GA 3KE2A 4ENNA 4UUVA 1S29A 2CSOA 2UWMA 3RPUA 4KFCA 2OQGA 3SFZA 1TQMA 2XUBA 3ZN1A 3K9TA 5LLQA 4Q47A 4KN7X 2J5OA 3IWFA 2PFBA 3EUHA 4P55A 5IT9K 1R00A 2MC3A 4L5IA 4WXDA 2YX4A 3DV8A 2RKHA 4N9IA 4UXNA 1J0RA 1TNSA 3WU0A 4ON0A 1UCRA 5AIQA 4ZH4F 2GXBA 1XGNA 3KEOA 1NHAA 3C18A 4M71A 2LDUA 3TOAA 2XROA 4A0ZA 3B02A 1O3TA 2ZFWA 2H6CA 5HDKA 5F64A 2EFPA 4KUMA 3GFJA 4HX8A 2D45A 3V7RA 5L3BA 1EV7A 3FX3A 3CTAA 3WTWC 2VE8A 1AOYA 3P7NA 4U0VA 1FY7A 1XDUA 4M9SA 5LEJA 3PFIA 2COMA 3KP5A 3KP7A 3WTUC 1FBSA 1QGPA 4PCQA 5D5WB 1OPCA 5E1XA 1K78B 2UXNA 1YS6A 2R3SA 5LEKA 5HLHA 1W7PB 4HF1A 2NAZA 1Z91A 4LG0B 5CVJA 4N9HA 2HR3A 4ETSA 1P4AA 3KCCA 4KA4A 3HRSA 1LDKB 3N97A 1FP2A 3CDHA 4S04A 1IN8A 1FPQA 1QPMA 3ML6A 4I0BA 2LNBA 2EB7A 1YG2A 3I0TA 1D8KA 1I6XA 3LA2A 4P9UA 1ZHFA 1K78A 1FP1D 3HTSB 3CUOA 3F8BA 4PZJA 1ON1A 1U5TB 1W7PA 4LG0A 1BI2A 4Y13A 1J59A 4N0BA 4FT8A 5JFRA 1FYLA 5L3DA 2YR2A 2Z33A 3JTGA 1AWCA 5TRDA 3HRMA 1ZLKA 2IPQX 3WG9A 1KQ8A 2JT1A 4QWQA 4MNUA 2X4HA 3KP2A 5HS9A 4YG2F 3GF2A 2DU9A 2VN2A 1ZG1A 2QVOA 1U5TA 3Q9SA 4JBAA 2VT2A 2DO7A 4AIKA 2EA2A 4HW0A 4I2OA 3VFZA 3EDPA 4BNCA 2A6EF 2L4MA 2G7UA 2GXGA 2HTSA 2PN6A 4RS8A 2E7WA 4M9XA 3SZTA 3U9GA 5D4RA 5D4SA 2A6HF 2E1NA 4FX0A 4P5OA 4OIPF 5HLIA 2MH9A 3BJOA 4I0AA 4OMZA 4BAYA 1JHHA 5EEHA 3MCZA 5D5UB 1YS7A 3I59B 2DI3A 3GLXA 5E20A 2LSOA 1GHCA 3L2CA 3I4PA 2D1HA 2HDCA 4R79A 2WC2A 1Y0UA 2EA4A 3T1BA 3CUQC 1ZN2A 3QRFF 4CZZA 1ZAOA 1ON2A 3F72A 3R4KA 2EFNA 1O3RA 4DNCA 2WTEA 3I59A 3F22A 3K1PA 2ZCWA 4L9JA 2DTRA 1B59A 1Z7UA 2BEOA 4RAZA 1XDSA 2H09A 5L3FA 1ULYA 1QBJA 3ABUA 4LMYA 5LHIA 1LDDA 2FBIA 3ECOA 2E7XA 4ESBA 1K79A 4KNYA 4XRFA 4HX4A 2P5KA 4ZYDA 3I58A 1TTYA 2ADUA 1XN7A 3DF8A 1HW1A 1YW8A 1P6RA 6PAXA 4B09A 3I71A 2CO5A 1FBQA 2HKOA 3BDDA 3KLOA 3LAPA 1DPRA 2IP2A 1ZYRF 2ZBKA 2Z9OA 1KU2A 4CO8A 1PP7U 5L3CA 3RKYA 5DEQA 2W57A 3ECHA 3WTTC 2DT5A 2CG4A 1IRFA 5L3EA 5BOXA 5DYMA 4XLNF 4CDGA 1R7JA 1V3FA 5ILSA 3LAJA 2E1CA 4LFUA 4WXCA 2OAZA 3RIRA 2PQ8A 3OV8A 3F6VA 5DCMB 1UHMA 1U8RA 2O0YA 5IT9Z 3ABTA 3REOA 1Q1HA 1RUOA 2FXAA 4HQMA 2HTJA 4AD9A 3KZZA 4EMSA 2HEOA 2HQRA 1SD5A 4BXUA 1BM9A 4HBLA 4MEXF 1Z9CA 3KP3A 1HXDA 4IRHA 3LA7A 2HOEA 4IPAA 1G4DA 2K27A 2KRFA 3FMQA 2KKOA 2FF4A 4R8HA 3ZMVA 3GYHX 5ICEA 1X3UA 4G94A 5K5OA 1HBXG 3F3XA 5DCMA 1I5ZA 4XLPF 1HW5A 1C0WA 1DDNA 1IF1A 5HS7A 5ICCA 4TV7A 4O5VA 1XSXA 1L0OC 4I98B 4UV9A 1BC8C 3FXUA 1J75A 3C3WA 2V79A 1IXCA 5AIPA 3HRUA 4PGHA 3K69A 2CWEA 2FSWA 3ZMZA 1YW7A 3TQNA 1TNTA 4UV8A 3WGGA 5FFZA 2V1XA 4M6YA 2PG4A 5E1WA 2ZKZA 2EV6A 1ZGJA 2FMYA 1MJBA 2F5CA 1YTYA 1XGOA 4RB0A 4A0XA 1EH7A 4HYEA 3K0LA 3NQOA 1FLIA 3M8EA 1SD7A 1ZG3A 2FE3A 1REPC 1K7AA 3RKXA 5DV5A 4HQEA 1WRJA 2BV6A 1B9NA 4GYGA 3GEZA 1GXPA 3IRQA 2M30A 1QZYA 2AS5F 2VC1A 4AIJA 2RC4A 2Y48A 2FNAA 2FBKA 2ELHA 2Q8KA 1U2WA 4LK0F 2PJPA 3QAHA 2EV5A 3WTYC 1QQIA 1OR7A 1R58A 3ZMUA 4XSXF 4GCVA 3HUGA 1T98A 1OYIA 4KN4X 1IUYA 3DFGA 1U5TC 1T38A 3GFIA 1H9TA 4A6DA 3Q5FA 1QZZA 2O03A 1I27A 3BPXA 2EK5A 2TDXA 2FRHA 1RI7A 5LGNA 1ZREA 4HDUA 4MEYF 1T2KA 1LDJA 1MDMB 4GXOA 1R1VA 3KFWX 1PDNC 2XAFA 2VBXA 4S05A 3DXJF 5F1RA 2ESNA 3E5QA 3MQ0A 5DD8A 5ILUA 1DPUA 3R60A 2X0LA 1WQ2A 4RGXA 4UVAA 1FWZA 4HF0A 2D2WA 1BIBA 2MLGA 5D5XB 2RNJA 1EH8A 4Y17A 2W24A 3WGIA 1YIOA 4RAYA 2LF7A 4WX9A 4ZZLA 2O8XA 5AONA 3ZP5A 1SD4A 4G7OF 1KU3A 3C1DA 3GX4X 5FO5A 4KYWA 2DLLA 1R1TA 3FWEA 2A69F 1F4KA 1YYVA 5HS8A 3LA3A 3MZHA 4LGWA 5H6RA 1HSJA 3VB2A 5HVQC 2XAHA 4BH9A 1P4WA 1Z1DA 2BE5F 1BI0A 3GO5A 3Q9VA 1KQ9A 1FOKA 3V7SA 2HYGD 1L3LA 4M6XA 2PBIA 5CVIA 3RJPA 1S7OA 3JSOA 4YFKF 3R0AA 4GGGA 2UZKA 4LLLA 1D5VA 3LQRA 3E6CC 4EM2A 1W4MA 4KICA 3IL2A 2O61A 4NB5A 2DPUA 2M5WA 3DKWA 3MFKA 1FBUA 2QLZA 1HQCA 4D0PA 3ISPA 3TKYA 1ZLJA 2IJLA 1B4AA 3V8JA 5D5VB 1R1UA 5LHGA 4EGZA 3GWZA 1LVAA 5BPIA 4UVBA 4BHCA 3H3ZA 5LRSA 3M7GA 4UVCA 2RQPA 2Q0OA 3JAMK 2XGXA 4EM0B 5LHHA 3JTHA 3TO9A 2P5VA 2K7LA 4G9YA 2ZNZA 2CW0F 1FSEA 2XRNA 4HDVA 2F5DA 4UHTA 4M72A 1O7FA 2OZUA 1VTNC 3TO7A 3F8CA 3GXOA 2NS0A 1ZH5A 3DP7A 4I01A 1S8NA 2KIUA 4G7HF 2Z3YA 3G3ZA 1BI1A 2RV8A 4IRGA 3V8LA 3EYIA 2WV0A 4OU0A 1SMTA 4Z2YA 4AVPA 2QENA 3GZ6A 1FSHA 2QUFA 4EM1A 3FM5A 3B73A 1W5SA 2P8TA 2VBYA 2QQBA 4U7BA 1ODDA 5HOOA 1J2XA 5KVRA 3ZMDA 1FC3A 4ASNA 3BOQA 5CYVA 2VT3A 1UB9A 4HV6A 5D6FA 3RI4A 4RB1A 1DUXC 4YIFA 4EJTA 1MD0A 3J80K 1R36A 2ISZA 2NYXA 4OMYA 5ERIA 4RB2C 2K4BA 4WCGA 2XASA 3F8NA 4U7DA 2DK5A 1XGSA 3QOPA 4XBFA 3E5UA 3P9CA 4U0WA 1P92A 1W7PD 1OMIA 1FNNA 3VEPA 4GO1A 4JQFA 5A2QK 4KIGA 1YLFA 2XAGA 2V1DA 3NEUA 2XIGA 1KGSA 5DD4A 4LK1F 5JHUA 1USTA 4P9FA 3SHFA 2CFXA 5H20A 3T8RA 1V4RA 4HZFA 5D6EA 4UNOA 2F5EA 2IVMA 4BQAA 3W6KB 3HHHA 2OD5A 3T8TA 4KMFA 3HHGA 1Z6RA 4MTDA 2YPRA 3P9IA 5JR3A 5E18F 2FBHA 3COAC 2BBYA 1D8JA 3L00A 1BIAA 4ENMA 2ISYA 3FMSA 2PEXA 3BP8A 3LFKA 3G73A 3F8MA 4ESFA 2Z5UA 2PLYA 2R7DA 5LGTA 2P4WA 4L0ZB 5K5RA 2VOOA 1S3JA 3BJ6A 1TQIA 1KU9A 5HDGA 2FU4A 1R22A 1MGTA 1J5YA 2HKXA 4BYYA 2ACJA 3RYRA 3KP6A 2QM3A 3ZMTA 1IZ1A 2RVCA 2F2EA 2HWVA 2EJRA 4IRIA 2NRAC 1QO0D 2EFWA 2AXLA 2MLKA 3MEXA 3QP6A 5DDGA 2P7VB 2EV0A 2XAJA 3KEQA 1SFXA 3M9AA 1GVJA 3S2WA 4CICA 3DPLC 3E6BA 3JW4A 4EJVA 3FXQA 4EVIA 2K86A 1UHWA 3V8KA 2JZYA 3EETA 3CJNA 1USSA 1BBYA 4B8XA 1BN5A 3CUQB 2XV4S 2JRTA 2L3DA 1IXSB 1UFMA 4IHTA 3MAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV0 A;  1JGS A;  3MWM A;  4G6Q A;  3J81 K;  1KQ0 A;  4Y15 A;  3F8F A;  5JI6 A;  1S7A A;  3R61 A;  4NHJ A;  2QBY B;  5HDN A;  3J7A O;  1U6G A;  4MGR A;  2JSC A;  4L9V A;  3TOB A;  1QNT A;  4WK8 F;  3BRO A;  1KU7 A;  2H94 A;  3C7J A;  1GXQ A;  4KT5 C;  4ZYE A;  1FZP B;  3HOS A;  5E1Z B;  3VOD A;  2H27 A;  2K4J A;  4EJU A;  1R5H A;  2KJB A;  1A04 A;  5E8G A;  2QBY A;  2ZJ2 A;  5FLX K;  4A5N A;  2VON A;  1IW7 F;  3AAF A;  1I1S A;  2ZO4 A;  3JAM Z;  4LLN A;  4AWX B;  4WXH A;  2KJC A;  2DQR A;  3RKW A;  2GA1 A;  1OYW A;  5E8I A;  2L01 A;  5J6X A;  3E6D A;  2DK8 A;  4P96 A;  5CLS A;  1J7K A;  2DQL A;  4GYI A;  3FXR A;  2H6B A;  1TW3 A;  4IJA A;  2C6Y A;  2HGC A;  1H9G A;  4U88 A;  4G8X A;  2L54 A;  4HLX A;  3ZQ7 A;  3QU3 A;  4LLG F;  2GZW A;  2VE9 A;  4JK1 X;  4F7Z A;  2F5F A;  1IN6 A;  1P4X A;  4LJZ F;  2STT A;  3E3V A;  1LEB A;  1IN7 A;  5E17 F;  3ZPL A;  1O3Q A;  2A68 F;  3VOE A;  3O3K A;  3BJA A;  3U2R A;  1BC7 C;  3WTV C;  2G7H A;  4EJO A;  2KIM A;  2V1U A;  4OOI A;  2EFO A;  2IA2 A;  3FZV A;  3D5L A;  1G3Y A;  1F9N A;  4ZYG A;  4OIO F;  1E17 A;  4A12 A;  5D8L B;  1F5T A;  3EQL F;  5DCF A;  4ENK A;  2GAU A;  4A6E A;  1G3T A;  3IRR A;  1MDM A;  1CGP A;  2YSR A;  3JSP A;  3QU6 A;  3T0Y A;  5JVT A;  1FYM A;  3K1M A;  5DUK A;  3RTR A;  2HQN A;  1FX7 A;  3HSF A;  1IN4 A;  3WE2 A;  3IKT A;  1O3S A;  3BZ6 A;  2V6C A;  3J80 Z;  2XKO A;  3KET A;  1RUN A;  1B1B A;  1D3Y A;  1O57 A;  3R0J A;  3WOD F;  4O3M A;  1BOA A;  3E97 A;  1SFE A;  2FQ3 A;  4PDK A;  5K5Q A;  2HZT A;  5F6F A;  2M8E A;  1ZRC A;  3WGH A;  2EWN A;  4A0Y A;  5L3G A;  2FNP A;  5DUI A;  2CGP A;  5A2Q Z;  4IXA A;  5CVU A;  3O6B B;  4Q5S F;  1ZGA A;  1ZAR A;  2GA2 A;  1CF7 B;  3M8F A;  4CHU A;  5ICG A;  1Z05 A;  1ZRF A;  3LST A;  4KMU X;  3I5U A;  2OQR A;  4CXF A;  5H6Q A;  2IW5 A;  4K2E A;  2JTV A;  2VXZ A;  2LKP A;  1HKS A;  5ED4 A;  5FB2 A;  1F1Z A;  1T39 A;  4EGY A;  5LRR A;  2FA5 A;  2IA1 A;  1YFH A;  2DPD A;  2XVC A;  1CF7 A;  4WF2 A;  2BGC A;  2VBW A;  3KP4 A;  1H0M A;  1LQ1 A;  3HTU A;  2JPB A;  2YX7 A;  3ZMS A;  1XGM A;  3M1E A;  2XAQ A;  1LEA A;  2IRF G;  2XKP A;  4FHT A;  5BQT A;  4ESJ A;  2OU2 A;  1G6N A;  1TW2 A;  3BY6 A;  4MTE A;  5D8K B;  4U0Y A;  2ZXJ A;  1SMY F;  3HYI A;  4MQV A;  3DEU A;  5BPD A;  1B6A A;  2NNN A;  2HS5 A;  2GIV A;  1K6O A;  3NRV A;  3BPV A;  4HA8 A;  4EJW A;  3TGN A;  5BS6 A;  1JXS A;  1KA8 A;  1XSV A;  2Y75 A;  1XCV A;  4G6D A;  4Q48 A;  4KIB A;  3I53 A;  3ULQ B;  3EYY A;  3V7C A;  1SD6 A;  2ZME B;  1RNL A;  2VOP A;  3QPT A;  3HIF A;  1BI3 A;  3KLN A;  4IVN A;  1YQA A;  4HAM A;  4NQW A;  3K2Z A;  2J5P A;  3IKV A;  3TDU C;  1PP8 F;  1HST A;  2BYV E;  2CYY A;  4BHP A;  4FX4 A;  5J8C A;  4OIQ F;  3D0S A;  3K1N A;  2STW A;  4I09 A;  2P5L C;  2NNY A;  2PMH A;  2VBZ A;  2K02 A;  2P6T A;  3F6O A;  2ETH A;  1U78 A;  1LB2 A;  3QP5 A;  4ZZD A;  3GFL A;  1T0F A;  2M87 A;  4LB5 A;  3J81 Z;  2ZME A;  5CJ9 A;  2VOD A;  2O3F A;  5TJJ A;  5HLG A;  2W84 A;  2D1V A;  4BHB A;  1IXR C;  3IC7 A;  1P2F A;  1J9I A;  2MA3 A;  2UXX A;  1FYK A;  3F21 A;  2L02 A;  1E2X A;  2CQK A;  1G3W A;  1XB4 A;  1YW9 A;  2OZ6 A;  4MQ9 F;  2P6S A;  5ILV A;  4M73 A;  3R6S A;  2Y0M A;  3SZP A;  4R1H A;  4HLY A;  1MZB A;  1TBX A;  1XCB A;  2YU3 A;  2DBB A;  4LB6 B;  3ERE D;  2W85 A;  2RN7 A;  5KK1 A;  5FLX Z;  2L4A A;  3LQQ A;  2A3S A;  3TO6 A;  5FFX A;  4LD5 A;  4I7H A;  2HFH A;  3WU1 B;  4KIF A;  3E5X A;  2GQQ A;  2ZNY A;  4WWC A;  2MBF A;  3L9F A;  2O6G E;  2LF8 A;  3BWG A;  4IF4 A;  4HX7 A;  2FOK A;  4RGR A;  1Z6T A;  5EEG A;  5BMZ A;  1XMK A;  4YFX F;  3L7W A;  4IHS A;  5FD6 A;  3ELK A;  1HKT A;  1HKQ A;  3KZY A;  1I1G A;  1LJ9 A;  3HSE A;  2A07 F;  2QWW A;  2Q2E A;  5FD5 A;  1IRG A;  5CVR A;  3PQK A;  2M1B A;  1ZRD A;  3RYP A;  4PGG A;  1OYY A;  1WI9 A;  1YO5 C;  2RDP A;  3HRT A;  2RGV A;  3P9K A;  2XHK A;  4L0Y B;  3H3U A;  4QLC U;  1IN5 A;  4YII A;  2DAO A;  1XMA A;  4ENJ A;  2V9V A;  5LGU A;  4A5M A;  1S6L A;  3SQN A;  2QQ9 A;  1XD7 A;  4M74 A;  2QQA A;  2W25 A;  3OOP A;  3WTZ A;  4MHG A;  3H92 A;  1ONV A;  3IWZ A;  3IHU A;  3FHZ A;  4HV5 A;  1WSU A;  1OKR A;  3GZ5 A;  3T5X A;  3DQV C;  3I54 A;  2FEZ A;  3U1D A;  4CGZ A;  4OIN F;  1XSD A;  1TLH B;  1STZ A;  3HSR A;  4H0E A;  1KYZ A;  1RIO H;  4I02 A;  3WTS C;  3MZY A;  5FGM A;  4CYD A;  3ZN0 A;  4EQQ A;  1ZG5 A;  2MD5 A;  3O2P E;  4L18 B;  4RGS A;  2ESH A;  2OBP A;  2M45 A;  3GUD A;  3RDI A;  1BJA A;  2R7F A;  4RGU A;  2HYF A;  1SFU A;  3PQJ A;  2KIF A;  3F23 A;  2FML A;  2GWR A;  3SXY A;  2A5Y B;  3WE3 A;  4HF2 A;  3I64 A;  4L5J A;  1KYW A;  4A2U A;  4E70 A;  3W6J B;  3CO7 C;  3CLO A;  5CVV A;  3L09 A;  2VC0 A;  2PMU A;  2P7C B;  1RZ4 A;  1T6S A;  3CUQ A;  4L9N A;  1JHF A;  3RPQ A;  3FM3 A;  1DP7 P;  4KDP A;  3WTX C;  4Q4Z F;  1MKM A;  2IT0 A;  3GVA A;  1G3S A;  1LNW A;  3LWF A;  1IAW A;  1WKM A;  3DPT A;  3HOT A;  1HW2 A;  2QZ8 A;  4HOB A;  1JE8 A;  3V4G A;  1B9M A;  5J8F A;  1SAX A;  5LBQ A;  4L9T A;  2OA4 A;  3E6M A;  2WWY A;  3GFM A;  1W5T A;  1EH6 A;  5IT3 A;  3GW2 A;  3CO6 C;  3N4M A;  4RB3 C;  4XSZ F;  4G7Z F;  2EFQ A;  2Z99 A;  3FF5 A;  5ICF A;  4OIR F;  4ZYH A;  2JPC A;  3TDZ C;  2DFI A;  5K1Y A;  3QPH A;  1MJ9 A;  2MH2 A;  1FT9 A;  1PUE E;  2G9W A;  2QYO A;  2A61 A;  4AIH A;  4YFN F;  4DQ2 A;  1U3E M;  2IA0 A;  3FMR A;  1MJA A;  2B0L A;  1TQP A;  4M9Z A;  2PI0 A;  3ROU A;  1WWX A;  1O7L A;  2DW4 A;  1R23 A;  4O6J A;  1R5G A;  3KE2 A;  4ENN A;  4UUV A;  1S29 A;  2CSO A;  2UWM A;  3RPU A;  4KFC A;  2OQG A;  3SFZ A;  1TQM A;  2XUB A;  3ZN1 A;  3K9T A;  5LLQ A;  4Q47 A;  4KN7 X;  2J5O A;  3IWF A;  2PFB A;  3EUH A;  4P55 A;  5IT9 K;  1R00 A;  2MC3 A;  4L5I A;  4WXD A;  2YX4 A;  3DV8 A;  2RKH A;  4N9I A;  4UXN A;  1J0R A;  1TNS A;  3WU0 A;  4ON0 A;  1UCR A;  5AIQ A;  4ZH4 F;  2GXB A;  1XGN A;  3KEO A;  1NHA A;  3C18 A;  4M71 A;  2LDU A;  3TOA A;  2XRO A;  4A0Z A;  3B02 A;  1O3T A;  2ZFW A;  2H6C A;  5HDK A;  5F64 A;  2EFP A;  4KUM A;  3GFJ A;  4HX8 A;  2D45 A;  3V7R A;  5L3B A;  1EV7 A;  3FX3 A;  3CTA A;  3WTW C;  2VE8 A;  1AOY A;  3P7N A;  4U0V A;  1FY7 A;  1XDU A;  4M9S A;  5LEJ A;  3PFI A;  2COM A;  3KP5 A;  3KP7 A;  3WTU C;  1FBS A;  1QGP A;  4PCQ A;  5D5W B;  1OPC A;  5E1X A;  1K78 B;  2UXN A;  1YS6 A;  2R3S A;  5LEK A;  5HLH A;  1W7P B;  4HF1 A;  2NAZ A;  1Z91 A;  4LG0 B;  5CVJ A;  4N9H A;  2HR3 A;  4ETS A;  1P4A A;  3KCC A;  4KA4 A;  3HRS A;  1LDK B;  3N97 A;  1FP2 A;  3CDH A;  4S04 A;  1IN8 A;  1FPQ A;  1QPM A;  3ML6 A;  4I0B A;  2LNB A;  2EB7 A;  1YG2 A;  3I0T A;  1D8K A;  1I6X A;  3LA2 A;  4P9U A;  1ZHF A;  1K78 A;  1FP1 D;  3HTS B;  3CUO A;  3F8B A;  4PZJ A;  1ON1 A;  1U5T B;  1W7P A;  4LG0 A;  1BI2 A;  4Y13 A;  1J59 A;  4N0B A;  4FT8 A;  5JFR A;  1FYL A;  5L3D A;  2YR2 A;  2Z33 A;  3JTG A;  1AWC A;  5TRD A;  3HRM A;  1ZLK A;  2IPQ X;  3WG9 A;  1KQ8 A;  2JT1 A;  4QWQ A;  4MNU A;  2X4H A;  3KP2 A;  5HS9 A;  4YG2 F;  3GF2 A;  2DU9 A;  2VN2 A;  1ZG1 A;  2QVO A;  1U5T A;  3Q9S A;  4JBA A;  2VT2 A;  2DO7 A;  4AIK A;  2EA2 A;  4HW0 A;  4I2O A;  3VFZ A;  3EDP A;  4BNC A;  2A6E F;  2L4M A;  2G7U A;  2GXG A;  2HTS A;  2PN6 A;  4RS8 A;  2E7W A;  4M9X A;  3SZT A;  3U9G A;  5D4R A;  5D4S A;  2A6H F;  2E1N A;  4FX0 A;  4P5O A;  4OIP F;  5HLI A;  2MH9 A;  3BJO A;  4I0A A;  4OMZ A;  4BAY A;  1JHH A;  5EEH A;  3MCZ A;  5D5U B;  1YS7 A;  3I59 B;  2DI3 A;  3GLX A;  5E20 A;  2LSO A;  1GHC A;  3L2C A;  3I4P A;  2D1H A;  2HDC A;  4R79 A;  2WC2 A;  1Y0U A;  2EA4 A;  3T1B A;  3CUQ C;  1ZN2 A;  3QRF F;  4CZZ A;  1ZAO A;  1ON2 A;  3F72 A;  3R4K A;  2EFN A;  1O3R A;  4DNC A;  2WTE A;  3I59 A;  3F22 A;  3K1P A;  2ZCW A;  4L9J A;  2DTR A;  1B59 A;  1Z7U A;  2BEO A;  4RAZ A;  1XDS A;  2H09 A;  5L3F A;  1ULY A;  1QBJ A;  3ABU A;  4LMY A;  5LHI A;  1LDD A;  2FBI A;  3ECO A;  2E7X A;  4ESB A;  1K79 A;  4KNY A;  4XRF A;  4HX4 A;  2P5K A;  4ZYD A;  3I58 A;  1TTY A;  2ADU A;  1XN7 A;  3DF8 A;  1HW1 A;  1YW8 A;  1P6R A;  6PAX A;  4B09 A;  3I71 A;  2CO5 A;  1FBQ A;  2HKO A;  3BDD A;  3KLO A;  3LAP A;  1DPR A;  2IP2 A;  1ZYR F;  2ZBK A;  2Z9O A;  1KU2 A;  4CO8 A;  1PP7 U;  5L3C A;  3RKY A;  5DEQ A;  2W57 A;  3ECH A;  3WTT C;  2DT5 A;  2CG4 A;  1IRF A;  5L3E A;  5BOX A;  5DYM A;  4XLN F;  4CDG A;  1R7J A;  1V3F A;  5ILS A;  3LAJ A;  2E1C A;  4LFU A;  4WXC A;  2OAZ A;  3RIR A;  2PQ8 A;  3OV8 A;  3F6V A;  5DCM B;  1UHM A;  1U8R A;  2O0Y A;  5IT9 Z;  3ABT A;  3REO A;  1Q1H A;  1RUO A;  2FXA A;  4HQM A;  2HTJ A;  4AD9 A;  3KZZ A;  4EMS A;  2HEO A;  2HQR A;  1SD5 A;  4BXU A;  1BM9 A;  4HBL A;  4MEX F;  1Z9C A;  3KP3 A;  1HXD A;  4IRH A;  3LA7 A;  2HOE A;  4IPA A;  1G4D A;  2K27 A;  2KRF A;  3FMQ A;  2KKO A;  2FF4 A;  4R8H A;  3ZMV A;  3GYH X;  5ICE A;  1X3U A;  4G94 A;  5K5O A;  1HBX G;  3F3X A;  5DCM A;  1I5Z A;  4XLP F;  1HW5 A;  1C0W A;  1DDN A;  1IF1 A;  5HS7 A;  5ICC A;  4TV7 A;  4O5V A;  1XSX A;  1L0O C;  4I98 B;  4UV9 A;  1BC8 C;  3FXU A;  1J75 A;  3C3W A;  2V79 A;  1IXC A;  5AIP A;  3HRU A;  4PGH A;  3K69 A;  2CWE A;  2FSW A;  3ZMZ A;  1YW7 A;  3TQN A;  1TNT A;  4UV8 A;  3WGG A;  5FFZ A;  2V1X A;  4M6Y A;  2PG4 A;  5E1W A;  2ZKZ A;  2EV6 A;  1ZGJ A;  2FMY A;  1MJB A;  2F5C A;  1YTY A;  1XGO A;  4RB0 A;  4A0X A;  1EH7 A;  4HYE A;  3K0L A;  3NQO A;  1FLI A;  3M8E A;  1SD7 A;  1ZG3 A;  2FE3 A;  1REP C;  1K7A A;  3RKX A;  5DV5 A;  4HQE A;  1WRJ A;  2BV6 A;  1B9N A;  4GYG A;  3GEZ A;  1GXP A;  3IRQ A;  2M30 A;  1QZY A;  2AS5 F;  2VC1 A;  4AIJ A;  2RC4 A;  2Y48 A;  2FNA A;  2FBK A;  2ELH A;  2Q8K A;  1U2W A;  4LK0 F;  2PJP A;  3QAH A;  2EV5 A;  3WTY C;  1QQI A;  1OR7 A;  1R58 A;  3ZMU A;  4XSX F;  4GCV A;  3HUG A;  1T98 A;  1OYI A;  4KN4 X;  1IUY A;  3DFG A;  1U5T C;  1T38 A;  3GFI A;  1H9T A;  4A6D A;  3Q5F A;  1QZZ A;  2O03 A;  1I27 A;  3BPX A;  2EK5 A;  2TDX A;  2FRH A;  1RI7 A;  5LGN A;  1ZRE A;  4HDU A;  4MEY F;  1T2K A;  1LDJ A;  1MDM B;  4GXO A;  1R1V A;  3KFW X;  1PDN C;  2XAF A;  2VBX A;  4S05 A;  3DXJ F;  5F1R A;  2ESN A;  3E5Q A;  3MQ0 A;  5DD8 A;  5ILU A;  1DPU A;  3R60 A;  2X0L A;  1WQ2 A;  4RGX A;  4UVA A;  1FWZ A;  4HF0 A;  2D2W A;  1BIB A;  2MLG A;  5D5X B;  2RNJ A;  1EH8 A;  4Y17 A;  2W24 A;  3WGI A;  1YIO A;  4RAY A;  2LF7 A;  4WX9 A;  4ZZL A;  2O8X A;  5AON A;  3ZP5 A;  1SD4 A;  4G7O F;  1KU3 A;  3C1D A;  3GX4 X;  5FO5 A;  4KYW A;  2DLL A;  1R1T A;  3FWE A;  2A69 F;  1F4K A;  1YYV A;  5HS8 A;  3LA3 A;  3MZH A;  4LGW A;  5H6R A;  1HSJ A;  3VB2 A;  5HVQ C;  2XAH A;  4BH9 A;  1P4W A;  1Z1D A;  2BE5 F;  1BI0 A;  3GO5 A;  3Q9V A;  1KQ9 A;  1FOK A;  3V7S A;  2HYG D;  1L3L A;  4M6X A;  2PBI A;  5CVI A;  3RJP A;  1S7O A;  3JSO A;  4YFK F;  3R0A A;  4GGG A;  2UZK A;  4LLL A;  1D5V A;  3LQR A;  3E6C C;  4EM2 A;  1W4M A;  4KIC A;  3IL2 A;  2O61 A;  4NB5 A;  2DPU A;  2M5W A;  3DKW A;  3MFK A;  1FBU A;  2QLZ A;  1HQC A;  4D0P A;  3ISP A;  3TKY A;  1ZLJ A;  2IJL A;  1B4A A;  3V8J A;  5D5V B;  1R1U A;  5LHG A;  4EGZ A;  3GWZ A;  1LVA A;  5BPI A;  4UVB A;  4BHC A;  3H3Z A;  5LRS A;  3M7G A;  4UVC A;  2RQP A;  2Q0O A;  3JAM K;  2XGX A;  4EM0 B;  5LHH A;  3JTH A;  3TO9 A;  2P5V A;  2K7L A;  4G9Y A;  2ZNZ A;  2CW0 F;  1FSE A;  2XRN A;  4HDV A;  2F5D A;  4UHT A;  4M72 A;  1O7F A;  2OZU A;  1VTN C;  3TO7 A;  3F8C A;  3GXO A;  2NS0 A;  1ZH5 A;  3DP7 A;  4I01 A;  1S8N A;  2KIU A;  4G7H F;  2Z3Y A;  3G3Z A;  1BI1 A;  2RV8 A;  4IRG A;  3V8L A;  3EYI A;  2WV0 A;  4OU0 A;  1SMT A;  4Z2Y A;  4AVP A;  2QEN A;  3GZ6 A;  1FSH A;  2QUF A;  4EM1 A;  3FM5 A;  3B73 A;  1W5S A;  2P8T A;  2VBY A;  2QQB A;  4U7B A;  1ODD A;  5HOO A;  1J2X A;  5KVR A;  3ZMD A;  1FC3 A;  4ASN A;  3BOQ A;  5CYV A;  2VT3 A;  1UB9 A;  4HV6 A;  5D6F A;  3RI4 A;  4RB1 A;  1DUX C;  4YIF A;  4EJT A;  1MD0 A;  3J80 K;  1R36 A;  2ISZ A;  2NYX A;  4OMY A;  5ERI A;  4RB2 C;  2K4B A;  4WCG A;  2XAS A;  3F8N A;  4U7D A;  2DK5 A;  1XGS A;  3QOP A;  4XBF A;  3E5U A;  3P9C A;  4U0W A;  1P92 A;  1W7P D;  1OMI A;  1FNN A;  3VEP A;  4GO1 A;  4JQF A;  5A2Q K;  4KIG A;  1YLF A;  2XAG A;  2V1D A;  3NEU A;  2XIG A;  1KGS A;  5DD4 A;  4LK1 F;  5JHU A;  1UST A;  4P9F A;  3SHF A;  2CFX A;  5H20 A;  3T8R A;  1V4R A;  4HZF A;  5D6E A;  4UNO A;  2F5E A;  2IVM A;  4BQA A;  3W6K B;  3HHH A;  2OD5 A;  3T8T A;  4KMF A;  3HHG A;  1Z6R A;  4MTD A;  2YPR A;  3P9I A;  5JR3 A;  5E18 F;  2FBH A;  3COA C;  2BBY A;  1D8J A;  3L00 A;  1BIA A;  4ENM A;  2ISY A;  3FMS A;  2PEX A;  3BP8 A;  3LFK A;  3G73 A;  3F8M A;  4ESF A;  2Z5U A;  2PLY A;  2R7D A;  5LGT A;  2P4W A;  4L0Z B;  5K5R A;  2VOO A;  1S3J A;  3BJ6 A;  1TQI A;  1KU9 A;  5HDG A;  2FU4 A;  1R22 A;  1MGT A;  1J5Y A;  2HKX A;  4BYY A;  2ACJ A;  3RYR A;  3KP6 A;  2QM3 A;  3ZMT A;  1IZ1 A;  2RVC A;  2F2E A;  2HWV A;  2EJR A;  4IRI A;  2NRA C;  1QO0 D;  2EFW A;  2AXL A;  2MLK A;  3MEX A;  3QP6 A;  5DDG A;  2P7V B;  2EV0 A;  2XAJ A;  3KEQ A;  1SFX A;  3M9A A;  1GVJ A;  3S2W A;  4CIC A;  3DPL C;  3E6B A;  3JW4 A;  4EJV A;  3FXQ A;  4EVI A;  2K86 A;  1UHW A;  3V8K A;  2JZY A;  3EET A;  3CJN A;  1USS A;  1BBY A;  4B8X A;  1BN5 A;  3CUQ B;  2XV4 S;  2JRT A;  2L3D A;  1IXS B;  1UFM A;  4IHT A;  3MAJ A; 
#chains in the Genus database with same CATH topology
 4EV0 A;  1JGS A;  1B8I B;  2ELJ A;  3MWM A;  3M07 A;  1APL C;  4G6Q A;  2XB0 X;  1SVO A;  3ZOB A;  1YJN I;  1Y8Q B;  4E7J A;  3J81 K;  2JA7 J;  2Y30 A;  1KQ0 A;  4Y15 A;  2LY1 A;  3F8F A;  2DMU A;  2ZXW H;  3VWB A;  1G2H A;  5JI6 A;  1W0T A;  1YOV B;  1S7A A;  3R61 A;  4NHJ A;  2MGQ A;  4BJ6 C;  2QBY B;  5HDN A;  3ZQQ A;  4IEJ A;  1XPX A;  3CCV I;  3VSK A;  3J7A O;  1U6G A;  1IJW C;  1TWC J;  4PJL A;  4MGR A;  5EG0 A;  2JSC A;  4L9V A;  3TOB A;  3CDI A;  1QNT A;  4WK8 F;  3FK6 A;  2DFF A;  2CV2 A;  3BRO A;  1KU7 A;  2RNG A;  1EJ9 A;  2H94 A;  1U9O A;  1MBF A;  5CQE A;  3C7J A;  4D1Q A;  1GXQ A;  3JCU C;  4KT5 C;  1B8I A;  1JJ6 C;  4ZYE A;  3OR1 C;  1FZP B;  2JQ7 A;  3HOS A;  5E1Z B;  3VOD A;  3H9G A;  2K4J A;  2H27 A;  3LSJ A;  3HM5 A;  2XGE A;  3ZGK A;  1TP4 A;  4EJU A;  1OLT A;  2Z1D A;  1R5H A;  2KJB A;  1A04 A;  5IYB J;  3HOY J;  5E8G A;  1VQL I;  1R4M B;  2QBY A;  3JR9 A;  2R4G A;  4PUS A;  2ZJ2 A;  3DPU A;  5FLX K;  4A5N A;  2VON A;  1IW7 F;  3AAF A;  2GIZ A;  2DXI A;  1I1S A;  2WA0 A;  3CDL A;  4BU2 A;  2ZO4 A;  3JAM Z;  1MBJ A;  4LLN A;  3M8J A;  3FXK A;  4AWX B;  4CCJ A;  3BR6 A;  4C2U A;  4WXH A;  3MKL A;  2KJC A;  2DQR A;  2PMZ N;  3RKW A;  2GA1 A;  1OYW A;  5E8I A;  2L01 A;  5J6X A;  3OY9 A;  3E6D A;  2DK8 A;  2ZB9 A;  4P96 A;  5CLS A;  1J7K A;  2DQL A;  4PJJ A;  4GYI A;  3FXR A;  3PUF A;  2H6B A;  2R7X A;  1N77 A;  1TW3 A;  4IJA A;  2VKD A;  2C6Y A;  2HGC A;  2Z16 A;  1H9G A;  4U88 A;  4G8X A;  3IH4 A;  2L54 A;  4HLX A;  3ZQ7 A;  3QU3 A;  4LLG F;  1GT0 C;  3BR1 A;  2GZW A;  2VE9 A;  4JK1 X;  4F7Z A;  2F5F A;  1FOX A;  1IN6 A;  1P4X A;  2Y0S A;  4LJZ F;  2STT A;  4G12 A;  3E3V A;  1LEB A;  1IN7 A;  3LSM A;  5E17 F;  3SDB A;  3ZPL A;  1O3Q A;  2A68 F;  3VOE A;  3O3K A;  3BJA A;  4XRS A;  3U2R A;  3A4C A;  3WTV C;  1BC7 C;  1YI2 I;  2YU9 J;  2G7H A;  3PSF A;  1ZKG A;  4EJO A;  1PUF B;  5HOD A;  2FQ4 A;  3QQA A;  2QSH X;  1LE8 B;  2FJ1 A;  2KIM A;  1X1C A;  2V1U A;  1UG0 A;  2EQR A;  4OOI A;  2EFO A;  2IA2 A;  3FZV A;  3D5L A;  5FKO A;  1G3Y A;  2MD0 A;  2LP0 A;  3WHB A;  1F9N A;  4DW6 A;  3H0G J;  4ZYG A;  2XRL A;  4OIO F;  1E17 A;  4A12 A;  5D8L B;  1F5T A;  2X6Y A;  4M3G A;  3EQL F;  1A5J A;  3J7A Y;  3S1N J;  1SVL A;  3PNT A;  2KRH A;  4D5C A;  5C4J J;  5DCF A;  3HKZ A;  4ENK A;  2GOM A;  2GAU A;  4A6E A;  2WAF A;  1OQY A;  1G3T A;  3IRR A;  2BXZ A;  2JA2 A;  3CCU I;  1W5C C;  1MDM A;  1CGP A;  5B1B H;  2YSR A;  3JSP A;  4DZJ A;  2E35 A;  3QU6 A;  3T0Y A;  5JVT A;  2OPT A;  1J09 A;  2Y31 A;  3K1M A;  5DUK A;  4CUG A;  1FYM A;  3RTR A;  2HQN A;  1FX7 A;  1ZEL A;  1JGG A;  3HSF A;  1OCZ H;  1IN4 A;  3WE2 A;  4F55 A;  3DTE A;  4M3F A;  3IKT A;  1O3S A;  2VJJ A;  3BZ6 A;  1U0J A;  2V6C A;  2L9N A;  3J80 Z;  1NK3 P;  2XKO A;  3CF2 A;  5IYD J;  3KET A;  3OYE A;  4CCL A;  1VQ7 I;  1PUF A;  4C3H J;  2AQE A;  2WBM A;  1RUN A;  1B1B A;  1D3Y A;  1O57 A;  1XS9 A;  1LE8 A;  2LVS A;  3R0J A;  3ASN H;  3WOD F;  4O3M A;  1BOA A;  3E97 A;  1SFE A;  4BXX J;  2FQ3 A;  4PDK A;  5K5Q A;  2HZT A;  5F6F A;  2M8E A;  5J3L A;  1ZRC A;  3S2H J;  3WGH A;  4ZTF A;  2EWN A;  3CCM I;  2E1O A;  4A0Y A;  5L3G A;  2FNP A;  5DUI A;  2DT7 B;  1WH7 A;  2CGP A;  5A2Q Z;  4IXA A;  5CVU A;  2LY2 A;  2KRC A;  3O6B B;  3SFI A;  4FAS D;  4EEF G;  4A3K J;  4Q5S F;  1ZGA A;  2VQH A;  2DOF A;  2ZJR F;  4DYQ A;  1DU6 A;  1ZAR A;  4QSH A;  1A31 A;  2GA2 A;  1CF7 B;  3OWT A;  3FBI B;  3M8F A;  2XC7 A;  4CHU A;  2KQR A;  5ICG A;  1Z05 A;  1JUS A;  4B47 A;  3LST A;  4XIC A;  1ZRF A;  4KMU X;  2HYJ A;  3I5U A;  4A69 C;  1LKX A;  2OQR A;  4CXF A;  3OYL A;  5H6Q A;  4JP0 A;  4IOA F;  2IW5 A;  3H9Q A;  5F0C A;  3A0B C;  2JUG A;  4K2E A;  3HOZ J;  1K61 A;  2JTV A;  2F4I A;  1Q1V A;  2VXZ A;  3GTG J;  3OS2 A;  5F0F A;  4F92 B;  2LKP A;  4AID A;  1HKS A;  2WAQ A;  1QZE A;  5ED4 A;  3OYN A;  5FB2 A;  1LPQ A;  4IHY A;  2JJ7 A;  1F1Z A;  3RPU D;  3J7Y J;  1T39 A;  4EGY A;  5LRR A;  2FA5 A;  1JKR C;  2IA1 A;  1YFH A;  4C2T A;  1A35 A;  2H1L A;  1MMD A;  1R4N B;  3IAM 2;  5GP9 A;  3RQI A;  2DPD A;  3VPR A;  1XMX A;  2XVC A;  1CF7 A;  3G1O A;  4WF2 A;  3F0C A;  2LOO A;  2VBW A;  2BGC A;  4XM3 A;  2CFO A;  5GTH C;  1BW6 A;  2H8W A;  2X48 A;  3I9V 2;  2OTL I;  3KP4 A;  5B1A H;  4ZDP A;  1H0M A;  2Y69 H;  5TIS C;  1JT0 A;  1YX3 A;  1LQ1 A;  2IS1 A;  2NS8 A;  3HTU A;  3SEZ A;  4MFD A;  2JPB A;  1P9Q C;  2CUJ A;  2YX7 A;  3ZMS A;  1XGM A;  3M1E A;  2XAQ A;  1LEA A;  1I39 A;  1AU7 A;  1BW5 A;  3B6A A;  1WGX A;  3CCR I;  3DEE A;  3BQY A;  1ZR4 A;  2IRF G;  2XKP A;  4FHT A;  5LD2 C;  4XLC A;  5BQT A;  5DS9 A;  4ESJ A;  2OU2 A;  3S3M A;  1G6N A;  1TW2 A;  3PNY A;  3W2W A;  3BY6 A;  4MTE A;  3W3C A;  5D8K B;  4U0Y A;  3M4O J;  1D0Z A;  2ZXJ A;  1SMY F;  3HYI A;  1WJD A;  4MQV A;  4ZDO A;  4NQW B;  3DEU A;  4II3 A;  5BPD A;  1B6A A;  4ZTJ A;  2NNN A;  2HS5 A;  1QHG A;  2GIV A;  4J01 A;  1ZK8 A;  3OSG A;  1K6O A;  3NRV A;  2M0M A;  4N4O B;  4MLO A;  4C2M J;  3BPV A;  4I6Z A;  4HEA 2;  2JVG A;  2NS7 A;  3VYT B;  4HA8 A;  4BQQ A;  4EJW A;  3TGN A;  5BS6 A;  1JXS A;  2BY1 A;  1KA8 A;  1XSV A;  2Y75 A;  3OIQ A;  1XCV A;  4G6D A;  4Q48 A;  1R49 A;  4I99 C;  4KIB A;  1O4X A;  3H5R A;  3I53 A;  3ULQ B;  3EYY A;  2UV1 A;  1WCM J;  3W2A A;  3V7C A;  1SD6 A;  2ZME B;  1RNL A;  2VOP A;  3QPT A;  3QWL A;  3HIF A;  1BI3 A;  1LVK A;  3KLN A;  2JSP A;  4IVN A;  1YQA A;  2R7R A;  5J47 A;  1JTY A;  4HAM A;  4NQW A;  3A1Y A;  3K2Z A;  3WG7 H;  2J5P A;  4UUT A;  3G6E I;  3IKV A;  2BY0 A;  4IQ4 A;  1WPK A;  3TDU C;  1PP8 F;  2XGD A;  1HST A;  1V54 H;  2BYV E;  4FQG A;  2CYY A;  4BHP A;  4FX4 A;  3SYT A;  3AG2 H;  5J8C A;  2FUG 2;  4OIQ F;  5LFA A;  2EZI A;  3D0S A;  3K1N A;  1QPI A;  3CJQ B;  2STW A;  4I09 A;  2P5L C;  2NNY A;  2R93 J;  2PMH A;  2VBZ A;  2X6O A;  4XLH A;  2K02 A;  2V9K A;  2P6T A;  4MFE A;  2E34 A;  3F6O A;  3G4S I;  2ETH A;  1U78 A;  1VQN I;  1LB2 A;  1HDD C;  3QP5 A;  1OCP A;  1A36 A;  3E7L A;  3WU2 C;  1SAN A;  4ZZD A;  1LFU P;  2ECC A;  2IGM A;  5F27 A;  3GFL A;  1T0F A;  2M87 A;  2EZK A;  4LB5 A;  3J81 Z;  4FE4 A;  2ZME A;  2KZV A;  5CJ9 A;  2VOD A;  2R7O A;  4IX7 A;  2O3F A;  4E7K A;  5TJJ A;  1R71 A;  4XKW A;  1SFK A;  5HLG A;  2W84 A;  2IAI A;  2D1V A;  2HOT A;  4BHB A;  1IXR C;  3IC7 A;  1P2F A;  1J9I A;  2MA3 A;  2UXX A;  1VQ9 I;  1FYK A;  2E19 A;  2QCO A;  2QF7 A;  1BR4 A;  1RKW A;  2L9V A;  4A3C J;  4F91 B;  3F21 A;  3L2U A;  2L02 A;  4XRM A;  1E2X A;  1WJF A;  4NC7 A;  5EDN A;  1VQO I;  2CQK A;  2DA7 A;  2EIN H;  4JOM A;  1G3W A;  1XB4 A;  2NOG A;  2VJ4 A;  1YW9 A;  2OZ6 A;  4MQ9 F;  2P6S A;  5ILV A;  2LKX A;  4M73 A;  3R6S A;  2L7F P;  1GV2 A;  2Y0M A;  3SZP A;  4AU7 A;  4R1H A;  1TL8 A;  3K70 C;  4HLY A;  3TMO A;  3JRH A;  1MZB A;  3BC8 A;  1TBX A;  1XCB A;  2YU3 A;  3HGG A;  4A3I J;  2EIM H;  3TL4 X;  1BR1 A;  2DBB A;  2GM4 A;  1YRN B;  4LB6 B;  1QVT A;  3LSI A;  3ERE D;  3A01 B;  2W85 A;  2FD5 A;  3A0H C;  2RN7 A;  5KK1 A;  1MBK A;  1SAU A;  5J4Y A;  5FLX Z;  2L4A A;  1MMA A;  2Q2E B;  2A3S A;  3LQQ A;  1X1P A;  3TO6 A;  2JK3 A;  5FFX A;  4LD5 A;  3QYE A;  4I7H A;  2HFH A;  3HZJ A;  4KIF A;  1Z77 A;  3WU1 B;  3E5X A;  2AHQ A;  2GQQ A;  2ZNY A;  4M3E A;  4PFO A;  2Y2Z A;  2MBF A;  3RSN A;  4WWC A;  2HDD A;  3L9F A;  1FTZ A;  3W6V A;  3GCM A;  4RAF A;  3ABM H;  4NDL A;  4HRI A;  2O6G E;  2LF8 A;  2XF7 A;  3BWG A;  4IF4 A;  4HX7 A;  2FOK A;  4RGR A;  1TWG J;  1W36 C;  1Z6T A;  5EEG A;  3OYJ A;  5BMZ A;  1XMK A;  2LKS A;  4YFX F;  4GFB A;  2M2E A;  3NAU A;  1VQP I;  3K2A A;  1YRN A;  3L7W A;  4IHS A;  3A01 A;  5FD6 A;  3ELK A;  1HKT A;  3QPL A;  1HKQ A;  3ABL H;  1RPW A;  3KZY A;  1I1G A;  1LJ9 A;  2LFB A;  3G1M A;  1V5F A;  2XF5 A;  2G0E A;  2CRG A;  3HSE A;  4A3L J;  5TGT A;  2XSJ C;  2A07 F;  3ZXS A;  2QWW A;  2Q2E A;  5FD5 A;  1IRG A;  5CVR A;  1S72 I;  2EPF A;  3PQK A;  5J40 A;  2XSD C;  2M1B A;  1ZRD A;  5CPR B;  3RYP A;  4Y3O A;  4ANJ A;  4PGG A;  3OYM A;  1OYY A;  1WI9 A;  1YO5 C;  2PJR B;  2RDP A;  3HRT A;  2B9S A;  2RGV A;  3P9K A;  1ITY A;  3LNQ A;  1GV5 A;  4NNJ A;  3IH2 A;  5CQG A;  3DU5 A;  2IS6 A;  1Y39 A;  4A3E J;  3CJR B;  2NVQ J;  3LOC A;  4QPO A;  1OIS A;  2XHK A;  1YIJ I;  5IP7 J;  1S5L C;  4L0Y B;  3H3U A;  3FK7 A;  4QLC U;  1EKE A;  3QOE A;  1IN5 A;  4YII A;  2VKE A;  2DAO A;  1XMA A;  3QPS A;  4ENJ A;  1TWF J;  2MC4 A;  2V9V A;  2JMW A;  5LGU A;  2ECB A;  5GTI C;  4A5M A;  4BGD A;  2W82 A;  4BDZ A;  1S6L A;  3CZ6 A;  3SQN A;  2QQ9 A;  5HNH A;  1XD7 A;  4M74 A;  3CMY A;  2QQA A;  2ZSH B;  4HG2 A;  2W25 A;  1A6I A;  1MMG A;  3OOP A;  3WTZ A;  3K4N A;  5FKM A;  2ID6 A;  4MHG A;  3H92 A;  3GTQ J;  4ZJZ A;  1ONV A;  3IWZ A;  2F4O B;  3IHU A;  3FHZ A;  2AQF A;  4M6V A;  5K7Z A;  4HV5 A;  1WSU A;  1OKR A;  3GZ5 A;  3T5X A;  2PJR A;  3DQV C;  1X4P A;  3K4L A;  3I54 A;  4IOC F;  3BG7 A;  3S93 A;  2FEZ A;  3U1D A;  2XPW A;  2VKV A;  4OIN F;  4CGZ A;  1XSD A;  4C30 A;  3B6C A;  1TLH B;  5FKK A;  1STZ A;  3HSR A;  4H0E A;  1KYZ A;  1RIO H;  4I02 A;  4YRV A;  1FMW A;  3WTS C;  4A3J J;  3MZY A;  5FGM A;  4CYD A;  3ZN0 A;  4EQQ A;  1LFP A;  1ZG5 A;  2MD5 A;  3O2P E;  4L18 B;  3DU6 A;  3H5N A;  2WY7 Q;  3K4J A;  4RGS A;  2ESH A;  3Q0W A;  2OBP A;  1HF0 A;  2O5R A;  2M45 A;  3GUD A;  3RDI A;  1BJA A;  2MSY A;  1IG7 A;  2BY2 A;  4FIS A;  2R7F A;  4RGU A;  2HYF A;  1SFU A;  1K6Y A;  3PQJ A;  3FXJ A;  2KIF A;  3F23 A;  2FML A;  2GWR A;  4PJ0 C;  3RCO A;  5IP6 A;  3SXY A;  2A5Y B;  4HNV A;  1S7E A;  3WE3 A;  4HF2 A;  1FIA A;  3I64 A;  4L5J A;  1KYW A;  1K4T A;  2DA3 A;  2QKL B;  4A2U A;  3L2V A;  4E70 A;  3W6J B;  3TBI A;  4D7M A;  2V7F A;  3CO7 C;  3ZQF A;  3CLO A;  2ID3 A;  3NWT A;  1EA3 A;  3L09 A;  3EPZ A;  5CVV A;  2VC0 A;  2PMU A;  4MIM A;  5B5E C;  3I55 I;  2P7C B;  1GVD A;  1RZ4 A;  3HL2 A;  4AYB A;  1U8B A;  1T6S A;  4QTR A;  3CUQ A;  4L9N A;  1JHF A;  2M4G A;  2XAU A;  3FM3 A;  3RPQ A;  1DP7 P;  2LY9 A;  3O8G A;  3CC7 I;  5M5W J;  4KDP A;  3WTX C;  4Q4Z F;  1MKM A;  2IT0 A;  3GVA A;  1G3S A;  1POG A;  1LNW A;  3D5R C;  3LWF A;  1IAW A;  1T95 A;  1V5G A;  1WKM A;  3DPT A;  3HOT A;  1X3Z B;  1BL0 A;  1HW2 A;  2QZ8 A;  1NK2 P;  1UHS A;  4HOB A;  1JE8 A;  2R7Z J;  3V4G A;  2CH0 A;  4AM3 A;  1B9M A;  5J8F A;  3HOW J;  1VQ5 I;  1SAX A;  5LBQ A;  2V26 A;  4BQO A;  4L9T A;  4G6T B;  2M0C A;  2CMP A;  4PJN A;  2OA4 A;  3JRD A;  1X1A A;  3E6M A;  3ZRG A;  2WWY A;  3GFM A;  1W5T A;  2QEX I;  1QU3 A;  1TWA J;  2AO9 A;  5FJ8 J;  3HOX J;  1EH6 A;  3BR0 A;  1DGW Y;  2LBF B;  4F3Q A;  5IT3 A;  1NTC A;  3GW2 A;  1FMV A;  2BHY A;  3CO6 C;  5IOY A;  3N4M A;  1HLV A;  1VQ6 I;  3OYI A;  4RB3 C;  4XSZ F;  2W00 A;  2L7Z A;  4G7Z F;  2A5W A;  3E0J B;  2EFQ A;  1K4S A;  2Z99 A;  3FF5 A;  1IV8 A;  1IGN A;  4RM2 A;  4B3A A;  5ICF A;  3OYF A;  4OIR F;  4ZYH A;  2JPC A;  3LMM A;  3TDZ C;  2KLO A;  2DFI A;  5K1Y A;  3QPH A;  1MJ9 A;  3QYB A;  1EF4 A;  2MH2 A;  4PSX A;  4ZDL A;  1ETK A;  1FT9 A;  4LOC A;  1PUE E;  2B63 J;  2G9W A;  1VND A;  4DBR A;  4C3I J;  1X1D A;  2QYO A;  3LSR A;  1MIJ A;  2A61 A;  4AIH A;  4YFN F;  4DQ2 A;  4LIU A;  1U3E M;  1UAA A;  2IA0 A;  3HBL A;  3AG1 H;  4BY1 J;  3FMR A;  1MJA A;  2B0L A;  1TQP A;  4M9Z A;  2PI0 A;  4YIR X;  1B72 B;  3ROU A;  1WWX A;  1O7L A;  1AA7 A;  2DA1 A;  2DW4 A;  1N75 A;  1E3P A;  1R23 A;  4O6J A;  4CCK A;  1R5G A;  4E7I A;  4FE7 A;  3KE2 A;  4ENN A;  4UUV A;  3KYC B;  3LSP A;  1S29 A;  2CSO A;  2UWM A;  1E3H A;  1RRJ A;  4KIS A;  3RPU A;  4KFC A;  3A2K A;  1TT0 A;  2OQG A;  4XKC A;  3SFZ A;  4AUX A;  3KZI C;  2R7U A;  2A6T A;  1TQM A;  2DA6 A;  1AHD P;  2XUB A;  3ZN1 A;  3PM1 A;  3K9T A;  3GTO J;  3KEY A;  5LLQ A;  2VI6 A;  4Q47 A;  4KN7 X;  4A93 J;  2J5O A;  1GUU A;  5M5X J;  3IWF A;  2PFB A;  2O7O A;  2BY3 A;  3EUH A;  4P55 A;  4ZC3 A;  3ZQH A;  4V19 K;  3AG3 H;  3CCQ I;  2R0Q C;  4IL6 C;  3UKG A;  1DQU A;  5IT9 K;  1MH3 A;  1R00 A;  2MC3 A;  4L5I A;  4WXD A;  2YX4 A;  3DV8 A;  1B72 A;  2RKH A;  4N9I A;  4UXN A;  1J0R A;  2ELK A;  1TNS A;  1P7J A;  1T0F C;  1V55 H;  3WU0 A;  4B1R A;  4ON0 A;  3JRE A;  3AFH A;  3MKW B;  1UCR A;  2ZME C;  2DYS H;  4W97 A;  2F6C A;  5AIQ A;  4ZH4 F;  3BTL A;  2MW8 A;  1JKQ C;  2GXB A;  1UG2 A;  3M1C A;  1ACI A;  1XGN A;  4FCY A;  3KEO A;  4XOR A;  2WAE A;  1NHA A;  3C18 A;  4M71 A;  2B7E A;  2OCC H;  2LDU A;  3HDD A;  4BY7 J;  2LYC A;  3DBH B;  3TOA A;  4UB6 C;  2VLA A;  1CQT A;  3K10 A;  2XRO A;  4A0Z A;  2KDO A;  1FIP A;  2IBD A;  3B02 A;  1O3T A;  3ONQ A;  2K9N A;  2ZFW A;  2H6C A;  3QOD A;  5HDK A;  2X9D A;  5F64 A;  2EFP A;  4KUM A;  3GFJ A;  3OYA A;  4HX8 A;  3K70 D;  2D45 A;  3M3Y J;  4DBQ A;  3V7R A;  3CLQ A;  5L3B A;  1EV7 A;  3FX3 A;  2HDW A;  2KDZ A;  3CTA A;  4ITV A;  3WTW C;  2VE8 A;  5F1J A;  4HSR A;  1AOY A;  1TWH J;  3LL7 A;  3P7N A;  4U0V A;  3E1S A;  1FY7 A;  2JWT A;  1XDU A;  3K6G A;  4M9S A;  1ETW A;  5LEJ A;  1YHQ I;  3ASO H;  4RLF A;  3PFI A;  2COM A;  3KP5 A;  3KP7 A;  3WTU C;  1VQK I;  3U1K A;  3L2W A;  1FBS A;  2VPL A;  4XLE A;  1QGP A;  3OYG A;  1VFC A;  4XN3 A;  4PCQ A;  1X3W B;  5HNF A;  5D5W B;  1Z3X A;  3EUA A;  1OPC A;  5E1X A;  1K78 B;  2UXN A;  1YS6 A;  2F48 A;  2R3S A;  5LEK A;  1QA6 A;  2FOW A;  5HLH A;  2LD5 A;  2IS2 A;  1W7P B;  4HF1 A;  2NAZ A;  1W36 D;  1Z91 A;  4LG0 B;  5CKT A;  2EZH A;  5CVJ A;  4N9H A;  2RAE A;  1VZ0 A;  2HR3 A;  4ETS A;  1P4A A;  3KCC A;  2HPM A;  4KA4 A;  2P0W A;  2K9L A;  3JRB A;  1PYV A;  1ZGW A;  1OCR H;  3HRS A;  2V1N A;  1LDK B;  1JKO C;  2QSF X;  3N97 A;  1FP2 A;  1H8A C;  2PMZ A;  3CDH A;  4S04 A;  1IN8 A;  1FPQ A;  1QPM A;  3ML6 A;  4RBO A;  4I0B A;  2LNB A;  1A6Q A;  2EB7 A;  3CP8 A;  1YG2 A;  3I0T A;  1D8K A;  1I6X A;  1JTX A;  1DP3 A;  3LA2 A;  4P9U A;  2M7B A;  3OSF A;  3BTI A;  1I3A A;  1ZHF A;  1K78 A;  1FP1 D;  3CCE I;  3HTS B;  2KIQ A;  3CUO A;  3F8B A;  4ABZ A;  5IPA A;  4PZJ A;  3X2Q H;  1ON1 A;  1U5T B;  1W7P A;  3K4M A;  2EBI A;  2IGO A;  4LG0 A;  3BG9 A;  2KIS A;  3AL0 B;  2CQX A;  1BI2 A;  1QHH D;  4Y13 A;  1J59 A;  3CJT B;  1UZC A;  4N0B A;  2K9S A;  5GPA A;  4FT8 A;  5JFR A;  1FYL A;  1XC5 A;  4CYC B;  5L3D A;  2YR2 A;  2Z33 A;  2BHZ A;  3JTG A;  1AWC A;  4E7Z A;  4BUP A;  1MND A;  5TRD A;  2QKM B;  3HRM A;  1ZLK A;  3RKQ A;  2IPQ X;  1K83 J;  2MAB A;  2MYS A;  3LSG A;  3WG9 A;  5M3F J;  1KQ8 A;  2JT1 A;  5EF6 A;  4QWQ A;  4MNU A;  2H1K A;  2CUF A;  2OUM A;  2X4H A;  3ZCO A;  3KP2 A;  3FXM A;  5J1R A;  1HA8 A;  4J00 A;  5HS9 A;  2UUZ A;  1WVR A;  5DTD A;  4YG2 F;  3KYD B;  1X58 A;  3F9K A;  3GF2 A;  3H0D A;  2DU9 A;  1X2M A;  2VN2 A;  5JVG F;  2A05 A;  1HOM A;  2ZXH A;  3H1C A;  5IP9 J;  4UY8 I;  4IHX A;  1ZG1 A;  2QVO A;  1U5T A;  3Q9S A;  2EH3 A;  4EAT A;  1UMQ A;  4JBA A;  4CH7 A;  1RR8 C;  2V6E A;  2VT2 A;  2KZG A;  4CYC A;  1SEU A;  2DO7 A;  4RM3 A;  4AIK A;  2EA2 A;  2W1O A;  4HW0 A;  5E3N A;  2DA4 A;  4I2O A;  3CMA I;  3K4C A;  3A02 A;  3DBL B;  4KT6 A;  4B3X A;  3VFZ A;  4JX4 A;  3EDP A;  4BNC A;  5DM7 F;  2K9Q A;  2A6E F;  2L4M A;  1XG1 A;  2G7U A;  2GXG A;  2HTS A;  2L9R A;  1VQ4 I;  2PN6 A;  2HXO A;  2E7W A;  4RS8 A;  4M9X A;  3SZT A;  3U9G A;  2XB5 A;  5D4R A;  1OCC H;  4BKX A;  5D4S A;  2A6H F;  2E1N A;  1XTA A;  4FX0 A;  2Y9Y A;  3G2B A;  4P5O A;  4OIP F;  3DBR B;  4XKV A;  3G71 I;  2NXN B;  3OR2 C;  3S3O A;  3IAS 2;  5HLI A;  2MH9 A;  2EZL A;  2OJE D;  3BJO A;  4I0A A;  5DM6 F;  1YIT I;  4OMZ A;  4BAY A;  1E0E A;  1JHH A;  2WY8 Q;  4M3D A;  2R7T A;  1ETV A;  5EEH A;  3MCZ A;  2R92 J;  2JVH A;  4LIV A;  5D5U B;  1YS7 A;  2M4K A;  3I59 B;  2HOA A;  2DI3 A;  3GLX A;  3BR5 A;  4A3B J;  5E20 A;  2LSO A;  1GHC A;  3L2C A;  3I4P A;  2D1H A;  4OAY A;  5J4V A;  2HDC A;  3TP3 A;  4R79 A;  2HXI A;  3HGY A;  2WC2 A;  3S32 A;  1MSF C;  4E7L A;  5E79 C;  3ZR8 X;  1Y0U A;  5EZG A;  2EA4 A;  3T1B A;  3SZG A;  4XOT A;  4Y52 J;  4P1W A;  3GTJ J;  3CUQ C;  1ZN2 A;  1MMS A;  3QRF F;  1Z7L A;  3ZQL A;  4CZZ A;  1ZAO A;  4A3D J;  1ON2 A;  1FOW A;  3MKZ A;  3F72 A;  3PJR A;  4BEH B;  3R4K A;  2EFN A;  4RLQ A;  1O3R A;  3BT9 A;  4RAG A;  1IC8 A;  4A3G J;  2DOD A;  3MKY B;  1AKH B;  1WFX A;  1YE9 A;  2MFZ A;  4XID A;  4DNC A;  3HOV J;  3AKZ A;  2WTE A;  3I59 A;  1S9H A;  3F22 A;  3K1P A;  2ZCW A;  5FKN A;  4L9J A;  4D5F A;  3S17 J;  2DTR A;  3OS1 A;  1B59 A;  1Z7U A;  2BEO A;  5EEA A;  4RAZ A;  1XDS A;  2H09 A;  5L3F A;  1ULY A;  2X6X A;  2R5Y B;  1RET A;  1QBJ A;  2OC6 A;  3ABU A;  4LMY A;  4AC0 A;  5LHI A;  1LDD A;  1T8I A;  2LC2 A;  2IGK A;  2FBI A;  3ECO A;  2CV1 A;  2E7X A;  5FRM A;  4ESB A;  1MBH A;  5F08 A;  1K79 A;  4GRI A;  2DMN A;  4KNY A;  4XRF A;  4HX4 A;  3SEQ A;  1T56 A;  2P5K A;  4ZYD A;  2XF6 A;  4BDY A;  3I58 A;  2HVR A;  3CC4 I;  1TTY A;  1Y0N A;  2L5Q A;  3DWL E;  2ADU A;  1XN7 A;  2K3P A;  3DF8 A;  3HPG A;  1AKH A;  3K7A J;  1HW1 A;  1YW8 A;  1P6R A;  4PSW A;  6PAX A;  4B09 A;  3GTK J;  3I71 A;  4FTH A;  3ZQG A;  4CCM A;  1I50 J;  2CO5 A;  3S3N A;  1YX5 A;  1Y8R B;  1FBQ A;  2HKO A;  2W4S A;  3BDD A;  2DDB A;  1SC7 A;  2ZFU A;  3KLO A;  2DN0 A;  3LAP A;  1DPR A;  2EIJ H;  2IP2 A;  2ZJQ F;  1ZYR F;  4BJ5 C;  2ZBK A;  2R5Y A;  2Z9O A;  1KU2 A;  4BQN A;  4CO8 A;  3J7Z I;  1PP7 U;  2L0K A;  5L3C A;  5F0H A;  3L1P A;  3RKY A;  5DEQ A;  3VSL A;  1KZH A;  4F52 A;  2W57 A;  9ANT A;  3C2B A;  3NWS A;  3ECH A;  3WTT C;  2DT5 A;  1WI3 A;  1IRF A;  2CG4 A;  5L3E A;  5BOX A;  2XPV A;  5DYM A;  4XLN F;  2BXY A;  3PFY A;  4CDG A;  2OTJ I;  1R7J A;  4HNU A;  1JI8 A;  1V3F A;  4PJM A;  5ILS A;  3LAJ A;  2E1C A;  5EYR A;  3MD2 A;  4LFU A;  4WXC A;  1H88 C;  2L9S A;  2Z2S B;  2OAZ A;  3EUH C;  1G8X A;  3RIR A;  2PQ8 A;  3OV8 A;  5C4X J;  3OL4 A;  2VJ5 A;  2VB6 A;  3ESW B;  3F6V A;  4OWR B;  5DCM B;  1UHM A;  4NC8 A;  1U8R A;  1HCR A;  2M8G X;  2KHM A;  2O0Y A;  5IT9 Z;  3ABT A;  3REO A;  1Q1H A;  1RUO A;  2QSG X;  2FXA A;  4HQM A;  2RRE A;  2HTJ A;  4NC6 A;  2JA5 J;  4AD9 A;  3DKX A;  2K3F A;  3HEF A;  3KZZ A;  2Y0S N;  4E6K G;  2WB1 A;  4EMS A;  4JX6 A;  3LFU A;  3OOU A;  2HEO A;  2HQR A;  1WJE A;  2X51 A;  2M9H A;  1SD5 A;  4BXU A;  1BM9 A;  2NVX J;  2Q1Z B;  4HBL A;  4MEX F;  3HPH A;  1Z9C A;  1WJC A;  3KP3 A;  1HXD A;  5JHF A;  4IRH A;  2R7W A;  3LA7 A;  3JRA A;  2HOE A;  2LRE A;  1T33 A;  4IPA A;  2HQ5 A;  4E4H A;  1G4D A;  5KCM A;  2K27 A;  2KRF A;  3FMQ A;  2ZJP F;  2JA6 J;  2KKO A;  2FF4 A;  4R8H A;  1D1C A;  3ZMV A;  3GYH X;  4DZP A;  3CC2 I;  5ICE A;  1IO2 A;  2ZSI B;  4XNF A;  3V42 A;  1X3U A;  4G94 A;  2VQL A;  1IRZ A;  5K5O A;  4M3B A;  3I3L A;  4B43 A;  4QIW N;  1HBX G;  3F3X A;  5DCM A;  1QRY A;  2OCE A;  3D1N I;  3Q0U A;  2GOX B;  3FKI J;  1I5Z A;  3BG6 A;  2VQC A;  2R7Q A;  2DMP A;  3HKZ N;  4F93 B;  4XLP F;  1IDZ A;  1HW5 A;  5KAI C;  2VL8 A;  4CSW A;  1C0W A;  3H3V K;  1DDN A;  1IF1 A;  5HS7 A;  5ICC A;  2OF7 A;  1FTT A;  2E1M B;  2O8K A;  1KON A;  4TV7 A;  4O5V A;  2R5Z B;  1XSX A;  1L0O C;  4I98 B;  3GLL A;  4UV9 A;  3VYU B;  2E2J J;  2Y9Z A;  1BC8 C;  3CP2 A;  3FXU A;  1J75 A;  2PX9 A;  3FHN A;  3C3W A;  3I56 I;  2V79 A;  4IHV A;  1ETX A;  4I76 A;  3BLY A;  1IXC A;  5AIP A;  1NH3 A;  3HRU A;  4PGH A;  2N8G A;  2LR8 A;  3K69 A;  2ICW G;  2CWE A;  2FSW A;  3ZMZ A;  1Y1W J;  1YW7 A;  1W1W E;  3TQN A;  2XDV A;  2E71 A;  3GTP J;  1ETO A;  3ZQI A;  1TNT A;  2HU9 A;  4JX5 A;  4UV8 A;  4E7H A;  3WGG A;  2HNH A;  2IS4 A;  1OFC X;  2F4M B;  1F43 A;  5FFZ A;  2JRM A;  4MO7 A;  2V1X A;  4M6Y A;  2PG4 A;  3HC7 A;  5E1W A;  2VAS A;  5H2F C;  2ZKZ A;  3BCB A;  2EV6 A;  1ZGJ A;  2FMY A;  1RC9 A;  1MJB A;  2F5C A;  3GTM J;  1YTY A;  1XGO A;  2R5Z A;  4RB0 A;  2CU7 A;  2LLK A;  4NUB A;  4XL9 A;  4A0X A;  3EUK L;  1EH7 A;  4C3J J;  4HYE A;  2CQ7 A;  3K0L A;  3NQO A;  1FLI A;  1VQM I;  3M8E A;  3KYL A;  1SD7 A;  1ZG3 A;  2FE3 A;  4KJZ A;  3HUG B;  1REP C;  1VF9 A;  4YEL A;  2H8R A;  2K9M A;  5IOZ A;  3RKX A;  2BW3 B;  1K7A A;  1IUF A;  5DV5 A;  3I4N J;  2ZXI A;  3D5S C;  1Z3Y A;  2CJJ A;  2HOS A;  3K4K A;  4HQE A;  1WRJ A;  2BV6 A;  4N4N B;  1B9N A;  4GYG A;  4BE1 A;  3GEZ A;  1GXP A;  3IRQ A;  2M30 A;  1QZY A;  4S0H B;  2AS5 F;  1W0U A;  2VC1 A;  3BR2 A;  4CA0 A;  4AIJ A;  1GDT A;  2RC4 A;  2Y48 A;  2FNA A;  2FBK A;  5IY5 H;  2WAQ N;  2ELH A;  1OCO H;  2JA8 J;  1GLN A;  2Q8K A;  1U2W A;  4X1E A;  4LK0 F;  2PJP A;  3PIO F;  2I8D A;  3VYR B;  3CCY A;  3QAH A;  2EV5 A;  2CQN A;  3PSI A;  3WTY C;  3IP4 B;  1QQI A;  4CZC A;  2VQG A;  3NAR A;  1JT6 A;  1OR7 A;  1R58 A;  3DTK A;  3ZMU A;  4XSX F;  3IUO A;  3P5J A;  4GCV A;  3HUG A;  3Q3S A;  1T98 A;  1OYI A;  4KN4 X;  4XKB A;  1IUY A;  2BW3 A;  2BVL A;  5J1U A;  4DOZ A;  3DFG A;  1U5T C;  2LBF A;  1T38 A;  3GFI A;  4XLF A;  4X0G A;  1H9T A;  4A6D A;  3Q5F A;  1QZZ A;  1NG6 A;  3DTI A;  3VDX A;  3AL0 C;  2CS3 A;  2QQ8 A;  2O03 A;  1I27 A;  2E36 A;  3BPX A;  2EK5 A;  1MH4 A;  1R6R A;  2TDX A;  2FRH A;  1RI7 A;  1LUJ B;  2CV0 A;  3VYS B;  3H9J A;  5LGN A;  1ZRE A;  4BBR J;  4HDU A;  4MEY F;  1T2K A;  1FEX A;  1LDJ A;  2DT6 A;  2VXD A;  3BG3 A;  1MDM B;  4GXO A;  1R1V A;  3KFW X;  1PDN C;  1WHU A;  2XAF A;  2YUS A;  3CCJ I;  1Y56 A;  5J1Y A;  3CF5 F;  3TED A;  2VBX A;  4S05 A;  3HOU J;  4IZZ A;  3DXJ F;  1BJZ A;  5F1R A;  2ESN A;  3E5Q A;  3MQ0 A;  5DD8 A;  5ILU A;  1T08 B;  1DPU A;  3R60 A;  4XQF A;  2X0L A;  1WQ2 A;  3C2H A;  4RGX A;  4Y33 A;  3S14 J;  4UVA A;  1FWZ A;  4HF0 A;  2D2W A;  1BIB A;  2O9L A;  2MLG A;  2KT0 A;  5D5X B;  4KIT B;  4A3M J;  2RNJ A;  2X6W A;  4IKF A;  5FLV A;  1EH8 A;  3HXL A;  3IV5 A;  4Y17 A;  2IGN A;  5B66 C;  5K7F A;  2COB A;  2QA4 I;  2WV1 A;  4RA2 A;  2W24 A;  1VQ8 I;  3WGI A;  2DA5 A;  4C9Y A;  3FDY A;  1YIO A;  1R9T J;  2L7K A;  2V4J C;  4RAY A;  2LF7 A;  1QVU A;  2V9P A;  1ENH A;  4WX9 A;  4ZZL A;  2O8X A;  1M1E B;  5AON A;  1TZL A;  5KAF C;  3ZP5 A;  1N25 A;  2DMT A;  2DTZ A;  1SD4 A;  3JRI A;  2BVM A;  4G7O F;  2ME0 A;  1KU3 A;  1BOB A;  3C1D A;  3GX4 X;  5FO5 A;  2VJI A;  3RQ4 A;  2DLL A;  1R1T A;  3FWE A;  3PNV A;  4KYW A;  5C44 J;  2A69 F;  1F4K A;  4IO9 F;  1YYV A;  5HS8 A;  3LA3 A;  5GAG J;  5KNL A;  3MZH A;  3SDG A;  1U9N A;  2GXA A;  3DLA A;  1UEL B;  4LGW A;  5H6R A;  1HSJ A;  3VB2 A;  5HVQ C;  3WHC A;  2XAH A;  1MBG A;  2CW7 A;  4BH9 A;  1P4W A;  1RKT A;  1FOY A;  2I10 A;  3HJE A;  1Z1D A;  1WZ2 A;  1ETQ A;  2BE5 F;  2JN6 A;  2M3A A;  4UUS B;  1BI0 A;  1MBE A;  3GO5 A;  3Q9V A;  1KQ9 A;  3CCL I;  1FOK A;  3V7S A;  1SFO J;  3UNG C;  2HVS A;  3KIO A;  2HI3 A;  2EIK H;  2HYG D;  1ZR2 A;  4M6X A;  1L3L A;  2BOL A;  2PBI A;  4ZYA A;  5FRO A;  5FKL A;  3N05 A;  1JUM A;  5CVI A;  2GBY A;  3RJP A;  1S7O A;  3JSO A;  2VUM J;  4Y4R A;  4YFK F;  1E3O C;  3R0A A;  4GGG A;  4H4K C;  2UZK A;  2IXS A;  4V2F A;  3L2R A;  1Z21 A;  4LLL A;  1D5V A;  3LQR A;  3E6C C;  5JLW A;  2M7A A;  2E2I J;  4EM2 A;  1ERD A;  1W4M A;  4KIC A;  4DYC A;  3IL2 A;  2O61 A;  4NB5 A;  1X1B A;  1PVE A;  2DPU A;  1BA5 A;  2M5W A;  3DKW A;  3MFK A;  1FBU A;  4UUS A;  1I6H J;  1MMN A;  3H35 A;  3IH3 A;  3U21 A;  4L5E A;  2ME6 A;  2QLZ A;  1HQC A;  4D0P A;  1ORK A;  2DJI A;  1MW7 A;  3ISP A;  3TKY A;  2L2O A;  2E2H J;  4BJT A;  1IRX A;  1X19 A;  1ZLJ A;  2IJL A;  3S1Q J;  1B4A A;  3V8J A;  2F5V A;  3S16 J;  1JUP A;  2DCE A;  2LRD A;  2W48 A;  5D5V B;  1R1U A;  5LHG A;  4EGZ A;  3C2G A;  1IV6 A;  3GWZ A;  3JRG A;  1LVA A;  2HPI A;  4XRS G;  5GAD J;  5BPI A;  4UVB A;  4BHC A;  3S1R J;  3H3Z A;  5FLM J;  2KMU A;  5LRS A;  3M7G A;  4UVC A;  2EIL H;  3W2V A;  2RQP A;  4QPQ A;  1X4O A;  4PK4 A;  2M34 A;  4XMY A;  2Q0O A;  2IEK A;  3JAM K;  3TW7 A;  2XGX A;  1N78 A;  4EM0 B;  3DEW A;  5LHH A;  3DLL F;  3JTH A;  3TO9 A;  4E7S A;  2FX0 A;  2P5V A;  3ERM A;  2KP6 A;  2K7L A;  4G9Y A;  2ZNZ A;  2CW0 F;  1FSE A;  2XRN A;  4HDV A;  2F5D A;  3ABK H;  4UHT A;  4M72 A;  1MNE A;  3MAJ A;  1O7F A;  2OZU A;  1VTN C;  4Y7N J;  5KHD A;  3TO7 A;  4XLA A;  3F8C A;  5IYC J;  4X6A J;  3BZK A;  3GXO A;  2NS0 A;  1ZH5 A;  1Z0X A;  1D0Y A;  1IDY A;  2L7M P;  2OV7 A;  5M5Y J;  2YS9 A;  3OYC A;  3MN2 A;  3OYK A;  3DP7 A;  1Y6I A;  3Q0V A;  5GPC A;  4W1U A;  2WAD A;  2X1E A;  3RZD J;  4I01 A;  3H5A A;  1DU0 A;  2DDA A;  1S8N A;  2KIU A;  2CUZ A;  2LMD A;  3CMM A;  4G7H F;  2Z3Y A;  4D7N A;  3A03 A;  4GDF A;  3G3Z A;  3TW6 A;  3FXO A;  1BI1 A;  2RV8 A;  5F04 A;  4IRG A;  4NBQ A;  3OIP A;  3V8L A;  3EYI A;  4XR6 A;  4A3F J;  2HQA A;  2WV0 A;  1SMT A;  3DCF A;  4OU0 A;  4J19 A;  4Z2Y A;  4AVP A;  2QEN A;  1MNM C;  5K7H A;  4XK4 A;  4JYK A;  5EGO B;  3GZ6 A;  1WJA A;  4YEJ A;  1FSH A;  3CQZ J;  2QUF A;  4HST A;  3BG5 A;  1D0X A;  4B44 A;  4EM1 A;  3FM5 A;  3B73 A;  1W5S A;  1RES A;  2P8T A;  1D1B A;  4B4C A;  2E5Z A;  3JRF A;  2K5C A;  2VBY A;  2QQB A;  4U7B A;  4DJA A;  1LFB A;  3HB9 A;  1ODD A;  3GBG A;  5HOO A;  1J2X A;  4RMN A;  5KVR A;  3ZMD A;  2KFD A;  1ZQ3 P;  2WB1 N;  1FC3 A;  4ASN A;  4BE0 A;  3BOQ A;  5CYV A;  2VT3 A;  4V2G A;  1UB9 A;  5E3M A;  4BL0 B;  4HV6 A;  5D6F A;  1OJL A;  3RI4 A;  1TT5 B;  2MG4 A;  4RB1 A;  2P81 A;  4YIF A;  1DUX C;  4EJT A;  1MD0 A;  3J80 K;  1R36 A;  3FKJ A;  2NYX A;  2ISZ A;  5ERI A;  4OMY A;  4RB2 C;  4BS9 A;  1TC3 C;  5EGO A;  2RQQ A;  2K4B A;  4WCG A;  3S15 J;  3QYF A;  2XAS A;  3F8N A;  2NVY J;  3KPH A;  4U7D A;  2DK5 A;  1XGS A;  5HLT A;  3QOP A;  3S1M J;  4XBF A;  2DA2 A;  3E5U A;  3L2Q A;  2XGC A;  3P9C A;  1WJ5 A;  1SVM A;  4U0W A;  1P92 A;  1W7P D;  2E1M C;  2W7N A;  4RDU A;  1OMI A;  5FRN A;  1V5E A;  1X2N A;  3GTL J;  4IQJ A;  1FNN A;  3VEP A;  3SJM A;  5E3L A;  5BNG A;  3OS0 A;  4GO1 A;  4JQF A;  3I4M J;  5A2Q K;  2GLO A;  4KIG A;  1YLF A;  2XAG A;  4D9J A;  2E5N A;  2V1D A;  2NOJ B;  3NEU A;  4BBS J;  2KPM A;  2XIG A;  1PJR A;  1KGS A;  2X1D A;  3BR3 A;  5DD4 A;  1DGR M;  4LK1 F;  5JHU A;  1UST A;  3HG9 A;  2CW8 A;  3KX2 A;  3BQZ A;  3PO2 J;  1VI0 A;  4OAZ A;  4CCN A;  1HDP A;  4P9F A;  2NVT J;  2HZD A;  3H36 A;  3SHF A;  3CD6 I;  2CFX A;  3CES A;  1P7I A;  4LG3 A;  1V4R A;  5H20 A;  3T8R A;  4HZF A;  4AYB N;  5D6E A;  4BEH A;  4UNO A;  3FIS A;  2F5E A;  1G59 A;  2QGU A;  4DGW B;  3OYB A;  2IVM A;  4BQA A;  3W6K B;  3BTJ A;  2CQQ A;  2OD5 A;  2CUE A;  3HHH A;  3T8T A;  4KMF A;  3HHG A;  1Z6R A;  3PL8 A;  1WJB A;  1F36 A;  4MTD A;  4DYR A;  2DOE A;  4UB8 C;  2YPR A;  3BZC A;  1I3Q J;  3OIO A;  3P9I A;  5JR3 A;  5E18 F;  1OR7 C;  2FBH A;  2X85 A;  3COA C;  2BBY A;  1D8J A;  2XPU A;  2DMQ A;  3L00 A;  1BR2 A;  1BIA A;  4ENM A;  2ISY A;  3FMS A;  2PEX A;  3BP8 A;  2JUC A;  4B48 A;  1WH5 A;  2TCT A;  3LFK A;  3CCS I;  3G73 A;  3F8M A;  4ESF A;  2Z5U A;  2PLY A;  2VIX A;  2X1C A;  2R7D A;  5LGT A;  2P4W A;  4XOP A;  1HC8 A;  4DIQ A;  5K5R A;  4L0Z B;  1S3J A;  2VOO A;  3OYD A;  3BJ6 A;  3CME I;  3ZQC A;  1TQI A;  3RZO J;  3GZN B;  1KU9 A;  2LH9 A;  5HDG A;  1JKP C;  2LTP A;  2D5V A;  2FU4 A;  4BXF A;  2VKH A;  1R22 A;  1MGT A;  1UJ8 A;  1Y1V J;  3O8H A;  1J5Y A;  4PFP A;  2HKX A;  3LSK A;  5GAE J;  1D5Y A;  2ZC2 A;  4BYY A;  2ACJ A;  3RYR A;  3DKY A;  3KP6 A;  2QM3 A;  3LSH A;  3OYH A;  3ZMT A;  4BE2 A;  1H89 C;  3PO3 J;  2HVQ A;  5GAH J;  2TRT A;  1IZ1 A;  2RVC A;  2F2E A;  1YJ9 I;  1ZTR A;  2DJN A;  1R5I D;  2HWV A;  2EJR A;  3S2D J;  5B3S H;  2AXT C;  3GME A;  1MSE C;  1Z67 A;  1OCT C;  4IRI A;  2NRA C;  4IHW A;  4HPQ A;  3MZ8 A;  2LK2 A;  1QO0 D;  3AG4 H;  2EFW A;  2AXL A;  2DFH A;  2I5U A;  2MLK A;  3MEX A;  3QP6 A;  5C3E J;  2R7S A;  5DDG A;  2DOA A;  4FET A;  4AVZ A;  2P7V B;  2K85 A;  2EV0 A;  2XAJ A;  1YJW I;  2BZT A;  3FBN B;  3KEQ A;  3MVP A;  4HNT A;  3FXL A;  5E3O A;  5JLX A;  1SFX A;  3M9A A;  2VPR A;  1GVJ A;  4LIT A;  3S2W A;  3FIW A;  4XON A;  4CIC A;  5EJC A;  2LG4 A;  3DPL C;  3E6B A;  3MMY B;  1D1A A;  2DFE A;  3JW4 A;  2DYR H;  3PUB A;  4EJV A;  3OL3 A;  4Z6Y A;  3FXQ A;  4EVI A;  3JRC A;  1XX5 A;  3OMY A;  5M3M J;  2R7V A;  4XN0 A;  1JJ8 C;  4CCO A;  5EZH A;  2K86 A;  2NVU B;  1UHW A;  3V8K A;  3G1L A;  1RR7 A;  2K40 A;  3S8P A;  2JZY A;  3EET A;  3UR3 C;  5EG0 B;  4II2 A;  3PIP F;  3BCA A;  3CJN A;  1USS A;  1BBY A;  4B8X A;  1ETY A;  3BTC A;  1BN5 A;  3CUQ B;  1NG7 A;  2XV4 S;  1FJL A;  2JRT A;  2L3D A;  1IXS B;  1UFM A;  2E60 A;  4BAC A;  4U87 A;  4IHT A;  3TP0 A;  3K4B A;  2KL4 A; 
#chains in the Genus database with same CATH homology
 4EV0 A;  1JGS A;  3MWM A;  4G6Q A;  3J81 K;  1KQ0 A;  4Y15 A;  3F8F A;  5JI6 A;  1S7A A;  3R61 A;  4NHJ A;  2QBY B;  5HDN A;  3J7A O;  1U6G A;  4MGR A;  2JSC A;  4L9V A;  3TOB A;  1QNT A;  4WK8 F;  3BRO A;  1KU7 A;  2H94 A;  3C7J A;  1GXQ A;  4KT5 C;  4ZYE A;  1FZP B;  3HOS A;  5E1Z B;  3VOD A;  2H27 A;  2K4J A;  4EJU A;  1R5H A;  2KJB A;  1A04 A;  5E8G A;  2QBY A;  2ZJ2 A;  5FLX K;  4A5N A;  2VON A;  1IW7 F;  3AAF A;  1I1S A;  2ZO4 A;  3JAM Z;  4LLN A;  4AWX B;  4WXH A;  2KJC A;  2DQR A;  3RKW A;  2GA1 A;  1OYW A;  5E8I A;  2L01 A;  5J6X A;  3E6D A;  2DK8 A;  4P96 A;  5CLS A;  1J7K A;  2DQL A;  4GYI A;  3FXR A;  2H6B A;  1TW3 A;  4IJA A;  2C6Y A;  2HGC A;  1H9G A;  4U88 A;  4G8X A;  2L54 A;  4HLX A;  3ZQ7 A;  3QU3 A;  4LLG F;  2GZW A;  2VE9 A;  4JK1 X;  4F7Z A;  2F5F A;  1IN6 A;  1P4X A;  4LJZ F;  2STT A;  3E3V A;  1LEB A;  1IN7 A;  5E17 F;  3ZPL A;  1O3Q A;  2A68 F;  3VOE A;  3O3K A;  3BJA A;  3U2R A;  1BC7 C;  3WTV C;  2G7H A;  4EJO A;  2KIM A;  2V1U A;  4OOI A;  2EFO A;  2IA2 A;  3FZV A;  3D5L A;  1G3Y A;  1F9N A;  4ZYG A;  4OIO F;  1E17 A;  4A12 A;  5D8L B;  1F5T A;  3EQL F;  5DCF A;  4ENK A;  2GAU A;  4A6E A;  1G3T A;  3IRR A;  1MDM A;  1CGP A;  2YSR A;  3JSP A;  3QU6 A;  3T0Y A;  5JVT A;  1FYM A;  3K1M A;  5DUK A;  3RTR A;  2HQN A;  1FX7 A;  3HSF A;  1IN4 A;  3WE2 A;  3IKT A;  1O3S A;  3BZ6 A;  2V6C A;  3J80 Z;  2XKO A;  3KET A;  1RUN A;  1B1B A;  1D3Y A;  1O57 A;  3R0J A;  3WOD F;  4O3M A;  1BOA A;  3E97 A;  1SFE A;  2FQ3 A;  4PDK A;  5K5Q A;  2HZT A;  5F6F A;  2M8E A;  1ZRC A;  3WGH A;  2EWN A;  4A0Y A;  5L3G A;  2FNP A;  5DUI A;  2CGP A;  5A2Q Z;  4IXA A;  5CVU A;  3O6B B;  4Q5S F;  1ZGA A;  1ZAR A;  2GA2 A;  1CF7 B;  3M8F A;  4CHU A;  5ICG A;  1Z05 A;  1ZRF A;  3LST A;  4KMU X;  3I5U A;  2OQR A;  4CXF A;  5H6Q A;  2IW5 A;  4K2E A;  2JTV A;  2VXZ A;  2LKP A;  1HKS A;  5ED4 A;  5FB2 A;  1F1Z A;  1T39 A;  4EGY A;  5LRR A;  2FA5 A;  2IA1 A;  1YFH A;  2DPD A;  2XVC A;  1CF7 A;  4WF2 A;  2BGC A;  2VBW A;  3KP4 A;  1H0M A;  1LQ1 A;  3HTU A;  2JPB A;  2YX7 A;  3ZMS A;  1XGM A;  3M1E A;  2XAQ A;  1LEA A;  2IRF G;  2XKP A;  4FHT A;  5BQT A;  4ESJ A;  2OU2 A;  1G6N A;  1TW2 A;  3BY6 A;  4MTE A;  5D8K B;  4U0Y A;  2ZXJ A;  1SMY F;  3HYI A;  4MQV A;  3DEU A;  5BPD A;  1B6A A;  2NNN A;  2HS5 A;  2GIV A;  1K6O A;  3NRV A;  3BPV A;  4HA8 A;  4EJW A;  3TGN A;  5BS6 A;  1JXS A;  1KA8 A;  1XSV A;  2Y75 A;  1XCV A;  4G6D A;  4Q48 A;  4KIB A;  3I53 A;  3ULQ B;  3EYY A;  3V7C A;  1SD6 A;  2ZME B;  1RNL A;  2VOP A;  3QPT A;  3HIF A;  1BI3 A;  3KLN A;  4IVN A;  1YQA A;  4HAM A;  4NQW A;  3K2Z A;  2J5P A;  3IKV A;  3TDU C;  1PP8 F;  1HST A;  2BYV E;  2CYY A;  4BHP A;  4FX4 A;  5J8C A;  4OIQ F;  3D0S A;  3K1N A;  2STW A;  4I09 A;  2P5L C;  2NNY A;  2PMH A;  2VBZ A;  2K02 A;  2P6T A;  3F6O A;  2ETH A;  1U78 A;  1LB2 A;  3QP5 A;  4ZZD A;  3GFL A;  1T0F A;  2M87 A;  4LB5 A;  3J81 Z;  2ZME A;  5CJ9 A;  2VOD A;  2O3F A;  5TJJ A;  5HLG A;  2W84 A;  2D1V A;  4BHB A;  1IXR C;  3IC7 A;  1P2F A;  1J9I A;  2MA3 A;  2UXX A;  1FYK A;  3F21 A;  2L02 A;  1E2X A;  2CQK A;  1G3W A;  1XB4 A;  1YW9 A;  2OZ6 A;  4MQ9 F;  2P6S A;  5ILV A;  4M73 A;  3R6S A;  2Y0M A;  3SZP A;  4R1H A;  4HLY A;  1MZB A;  1TBX A;  1XCB A;  2YU3 A;  2DBB A;  4LB6 B;  3ERE D;  2W85 A;  2RN7 A;  5KK1 A;  5FLX Z;  2L4A A;  3LQQ A;  2A3S A;  3TO6 A;  5FFX A;  4LD5 A;  4I7H A;  2HFH A;  3WU1 B;  4KIF A;  3E5X A;  2GQQ A;  2ZNY A;  4WWC A;  2MBF A;  3L9F A;  2O6G E;  2LF8 A;  3BWG A;  4IF4 A;  4HX7 A;  2FOK A;  4RGR A;  1Z6T A;  5EEG A;  5BMZ A;  1XMK A;  4YFX F;  3L7W A;  4IHS A;  5FD6 A;  3ELK A;  1HKT A;  1HKQ A;  3KZY A;  1I1G A;  1LJ9 A;  3HSE A;  2A07 F;  2QWW A;  2Q2E A;  5FD5 A;  1IRG A;  5CVR A;  3PQK A;  2M1B A;  1ZRD A;  3RYP A;  4PGG A;  1OYY A;  1WI9 A;  1YO5 C;  2RDP A;  3HRT A;  2RGV A;  3P9K A;  2XHK A;  4L0Y B;  3H3U A;  4QLC U;  1IN5 A;  4YII A;  2DAO A;  1XMA A;  4ENJ A;  2V9V A;  5LGU A;  4A5M A;  1S6L A;  3SQN A;  2QQ9 A;  1XD7 A;  4M74 A;  2QQA A;  2W25 A;  3OOP A;  3WTZ A;  4MHG A;  3H92 A;  1ONV A;  3IWZ A;  3IHU A;  3FHZ A;  4HV5 A;  1WSU A;  1OKR A;  3GZ5 A;  3T5X A;  3DQV C;  3I54 A;  2FEZ A;  3U1D A;  4CGZ A;  4OIN F;  1XSD A;  1TLH B;  1STZ A;  3HSR A;  4H0E A;  1KYZ A;  1RIO H;  4I02 A;  3WTS C;  3MZY A;  5FGM A;  4CYD A;  3ZN0 A;  4EQQ A;  1ZG5 A;  2MD5 A;  3O2P E;  4L18 B;  4RGS A;  2ESH A;  2OBP A;  2M45 A;  3GUD A;  3RDI A;  1BJA A;  2R7F A;  4RGU A;  2HYF A;  1SFU A;  3PQJ A;  2KIF A;  3F23 A;  2FML A;  2GWR A;  3SXY A;  2A5Y B;  3WE3 A;  4HF2 A;  3I64 A;  4L5J A;  1KYW A;  4A2U A;  4E70 A;  3W6J B;  3CO7 C;  3CLO A;  5CVV A;  3L09 A;  2VC0 A;  2PMU A;  2P7C B;  1RZ4 A;  1T6S A;  3CUQ A;  4L9N A;  1JHF A;  3RPQ A;  3FM3 A;  1DP7 P;  4KDP A;  3WTX C;  4Q4Z F;  1MKM A;  2IT0 A;  3GVA A;  1G3S A;  1LNW A;  3LWF A;  1IAW A;  1WKM A;  3DPT A;  3HOT A;  1HW2 A;  2QZ8 A;  4HOB A;  1JE8 A;  3V4G A;  1B9M A;  5J8F A;  1SAX A;  5LBQ A;  4L9T A;  2OA4 A;  3E6M A;  2WWY A;  3GFM A;  1W5T A;  1EH6 A;  5IT3 A;  3GW2 A;  3CO6 C;  3N4M A;  4RB3 C;  4XSZ F;  4G7Z F;  2EFQ A;  2Z99 A;  3FF5 A;  5ICF A;  4OIR F;  4ZYH A;  2JPC A;  3TDZ C;  2DFI A;  5K1Y A;  3QPH A;  1MJ9 A;  2MH2 A;  1FT9 A;  1PUE E;  2G9W A;  2QYO A;  2A61 A;  4AIH A;  4YFN F;  4DQ2 A;  1U3E M;  2IA0 A;  3FMR A;  1MJA A;  2B0L A;  1TQP A;  4M9Z A;  2PI0 A;  3ROU A;  1WWX A;  1O7L A;  2DW4 A;  1R23 A;  4O6J A;  1R5G A;  3KE2 A;  4ENN A;  4UUV A;  1S29 A;  2CSO A;  2UWM A;  3RPU A;  4KFC A;  2OQG A;  3SFZ A;  1TQM A;  2XUB A;  3ZN1 A;  3K9T A;  5LLQ A;  4Q47 A;  4KN7 X;  2J5O A;  3IWF A;  2PFB A;  3EUH A;  4P55 A;  5IT9 K;  1R00 A;  2MC3 A;  4L5I A;  4WXD A;  2YX4 A;  3DV8 A;  2RKH A;  4N9I A;  4UXN A;  1J0R A;  1TNS A;  3WU0 A;  4ON0 A;  1UCR A;  5AIQ A;  4ZH4 F;  2GXB A;  1XGN A;  3KEO A;  1NHA A;  3C18 A;  4M71 A;  2LDU A;  3TOA A;  2XRO A;  4A0Z A;  3B02 A;  1O3T A;  2ZFW A;  2H6C A;  5HDK A;  5F64 A;  2EFP A;  4KUM A;  3GFJ A;  4HX8 A;  2D45 A;  3V7R A;  5L3B A;  1EV7 A;  3FX3 A;  3CTA A;  3WTW C;  2VE8 A;  1AOY A;  3P7N A;  4U0V A;  1FY7 A;  1XDU A;  4M9S A;  5LEJ A;  3PFI A;  2COM A;  3KP5 A;  3KP7 A;  3WTU C;  1FBS A;  1QGP A;  4PCQ A;  5D5W B;  1OPC A;  5E1X A;  1K78 B;  2UXN A;  1YS6 A;  2R3S A;  5LEK A;  5HLH A;  1W7P B;  4HF1 A;  2NAZ A;  1Z91 A;  4LG0 B;  5CVJ A;  4N9H A;  2HR3 A;  4ETS A;  1P4A A;  3KCC A;  4KA4 A;  3HRS A;  1LDK B;  3N97 A;  1FP2 A;  3CDH A;  4S04 A;  1IN8 A;  1FPQ A;  1QPM A;  3ML6 A;  4I0B A;  2LNB A;  2EB7 A;  1YG2 A;  3I0T A;  1D8K A;  1I6X A;  3LA2 A;  4P9U A;  1ZHF A;  1K78 A;  1FP1 D;  3HTS B;  3CUO A;  3F8B A;  4PZJ A;  1ON1 A;  1U5T B;  1W7P A;  4LG0 A;  1BI2 A;  4Y13 A;  1J59 A;  4N0B A;  4FT8 A;  5JFR A;  1FYL A;  5L3D A;  2YR2 A;  2Z33 A;  3JTG A;  1AWC A;  5TRD A;  3HRM A;  1ZLK A;  2IPQ X;  3WG9 A;  1KQ8 A;  2JT1 A;  4QWQ A;  4MNU A;  2X4H A;  3KP2 A;  5HS9 A;  4YG2 F;  3GF2 A;  2DU9 A;  2VN2 A;  1ZG1 A;  2QVO A;  1U5T A;  3Q9S A;  4JBA A;  2VT2 A;  2DO7 A;  4AIK A;  2EA2 A;  4HW0 A;  4I2O A;  3VFZ A;  3EDP A;  4BNC A;  2A6E F;  2L4M A;  2G7U A;  2GXG A;  2HTS A;  2PN6 A;  4RS8 A;  2E7W A;  4M9X A;  3SZT A;  3U9G A;  5D4R A;  5D4S A;  2A6H F;  2E1N A;  4FX0 A;  4P5O A;  4OIP F;  5HLI A;  2MH9 A;  3BJO A;  4I0A A;  4OMZ A;  4BAY A;  1JHH A;  5EEH A;  3MCZ A;  5D5U B;  1YS7 A;  3I59 B;  2DI3 A;  3GLX A;  5E20 A;  2LSO A;  1GHC A;  3L2C A;  3I4P A;  2D1H A;  2HDC A;  4R79 A;  2WC2 A;  1Y0U A;  2EA4 A;  3T1B A;  3CUQ C;  1ZN2 A;  3QRF F;  4CZZ A;  1ZAO A;  1ON2 A;  3F72 A;  3R4K A;  2EFN A;  1O3R A;  4DNC A;  2WTE A;  3I59 A;  3F22 A;  3K1P A;  2ZCW A;  4L9J A;  2DTR A;  1B59 A;  1Z7U A;  2BEO A;  4RAZ A;  1XDS A;  2H09 A;  5L3F A;  1ULY A;  1QBJ A;  3ABU A;  4LMY A;  5LHI A;  1LDD A;  2FBI A;  3ECO A;  2E7X A;  4ESB A;  1K79 A;  4KNY A;  4XRF A;  4HX4 A;  2P5K A;  4ZYD A;  3I58 A;  1TTY A;  2ADU A;  1XN7 A;  3DF8 A;  1HW1 A;  1YW8 A;  1P6R A;  6PAX A;  4B09 A;  3I71 A;  2CO5 A;  1FBQ A;  2HKO A;  3BDD A;  3KLO A;  3LAP A;  1DPR A;  2IP2 A;  1ZYR F;  2ZBK A;  2Z9O A;  1KU2 A;  4CO8 A;  1PP7 U;  5L3C A;  3RKY A;  5DEQ A;  2W57 A;  3ECH A;  3WTT C;  2DT5 A;  2CG4 A;  1IRF A;  5L3E A;  5BOX A;  5DYM A;  4XLN F;  4CDG A;  1R7J A;  1V3F A;  5ILS A;  3LAJ A;  2E1C A;  4LFU A;  4WXC A;  2OAZ A;  3RIR A;  2PQ8 A;  3OV8 A;  3F6V A;  5DCM B;  1UHM A;  1U8R A;  2O0Y A;  5IT9 Z;  3ABT A;  3REO A;  1Q1H A;  1RUO A;  2FXA A;  4HQM A;  2HTJ A;  4AD9 A;  3KZZ A;  4EMS A;  2HEO A;  2HQR A;  1SD5 A;  4BXU A;  1BM9 A;  4HBL A;  4MEX F;  1Z9C A;  3KP3 A;  1HXD A;  4IRH A;  3LA7 A;  2HOE A;  4IPA A;  1G4D A;  2K27 A;  2KRF A;  3FMQ A;  2KKO A;  2FF4 A;  4R8H A;  3ZMV A;  3GYH X;  5ICE A;  1X3U A;  4G94 A;  5K5O A;  1HBX G;  3F3X A;  5DCM A;  1I5Z A;  4XLP F;  1HW5 A;  1C0W A;  1DDN A;  1IF1 A;  5HS7 A;  5ICC A;  4TV7 A;  4O5V A;  1XSX A;  1L0O C;  4I98 B;  4UV9 A;  1BC8 C;  3FXU A;  1J75 A;  3C3W A;  2V79 A;  1IXC A;  5AIP A;  3HRU A;  4PGH A;  3K69 A;  2CWE A;  2FSW A;  3ZMZ A;  1YW7 A;  3TQN A;  1TNT A;  4UV8 A;  3WGG A;  5FFZ A;  2V1X A;  4M6Y A;  2PG4 A;  5E1W A;  2ZKZ A;  2EV6 A;  1ZGJ A;  2FMY A;  1MJB A;  2F5C A;  1YTY A;  1XGO A;  4RB0 A;  4A0X A;  1EH7 A;  4HYE A;  3K0L A;  3NQO A;  1FLI A;  3M8E A;  1SD7 A;  1ZG3 A;  2FE3 A;  1REP C;  1K7A A;  3RKX A;  5DV5 A;  4HQE A;  1WRJ A;  2BV6 A;  1B9N A;  4GYG A;  3GEZ A;  1GXP A;  3IRQ A;  2M30 A;  1QZY A;  2AS5 F;  2VC1 A;  4AIJ A;  2RC4 A;  2Y48 A;  2FNA A;  2FBK A;  2ELH A;  2Q8K A;  1U2W A;  4LK0 F;  2PJP A;  3QAH A;  2EV5 A;  3WTY C;  1QQI A;  1OR7 A;  1R58 A;  3ZMU A;  4XSX F;  4GCV A;  3HUG A;  1T98 A;  1OYI A;  4KN4 X;  1IUY A;  3DFG A;  1U5T C;  1T38 A;  3GFI A;  1H9T A;  4A6D A;  3Q5F A;  1QZZ A;  2O03 A;  1I27 A;  3BPX A;  2EK5 A;  2TDX A;  2FRH A;  1RI7 A;  5LGN A;  1ZRE A;  4HDU A;  4MEY F;  1T2K A;  1LDJ A;  1MDM B;  4GXO A;  1R1V A;  3KFW X;  1PDN C;  2XAF A;  2VBX A;  4S05 A;  3DXJ F;  5F1R A;  2ESN A;  3E5Q A;  3MQ0 A;  5DD8 A;  5ILU A;  1DPU A;  3R60 A;  2X0L A;  1WQ2 A;  4RGX A;  4UVA A;  1FWZ A;  4HF0 A;  2D2W A;  1BIB A;  2MLG A;  5D5X B;  2RNJ A;  1EH8 A;  4Y17 A;  2W24 A;  3WGI A;  1YIO A;  4RAY A;  2LF7 A;  4WX9 A;  4ZZL A;  2O8X A;  5AON A;  3ZP5 A;  1SD4 A;  4G7O F;  1KU3 A;  3C1D A;  3GX4 X;  5FO5 A;  4KYW A;  2DLL A;  1R1T A;  3FWE A;  2A69 F;  1F4K A;  1YYV A;  5HS8 A;  3LA3 A;  3MZH A;  4LGW A;  5H6R A;  1HSJ A;  3VB2 A;  5HVQ C;  2XAH A;  4BH9 A;  1P4W A;  1Z1D A;  2BE5 F;  1BI0 A;  3GO5 A;  3Q9V A;  1KQ9 A;  1FOK A;  3V7S A;  2HYG D;  1L3L A;  4M6X A;  2PBI A;  5CVI A;  3RJP A;  1S7O A;  3JSO A;  4YFK F;  3R0A A;  4GGG A;  2UZK A;  4LLL A;  1D5V A;  3LQR A;  3E6C C;  4EM2 A;  1W4M A;  4KIC A;  3IL2 A;  2O61 A;  4NB5 A;  2DPU A;  2M5W A;  3DKW A;  3MFK A;  1FBU A;  2QLZ A;  1HQC A;  4D0P A;  3ISP A;  3TKY A;  1ZLJ A;  2IJL A;  1B4A A;  3V8J A;  5D5V B;  1R1U A;  5LHG A;  4EGZ A;  3GWZ A;  1LVA A;  5BPI A;  4UVB A;  4BHC A;  3H3Z A;  5LRS A;  3M7G A;  4UVC A;  2RQP A;  2Q0O A;  3JAM K;  2XGX A;  4EM0 B;  5LHH A;  3JTH A;  3TO9 A;  2P5V A;  2K7L A;  4G9Y A;  2ZNZ A;  2CW0 F;  1FSE A;  2XRN A;  4HDV A;  2F5D A;  4UHT A;  4M72 A;  1O7F A;  2OZU A;  1VTN C;  3TO7 A;  3F8C A;  3GXO A;  2NS0 A;  1ZH5 A;  3DP7 A;  4I01 A;  1S8N A;  2KIU A;  4G7H F;  2Z3Y A;  3G3Z A;  1BI1 A;  2RV8 A;  4IRG A;  3V8L A;  3EYI A;  2WV0 A;  4OU0 A;  1SMT A;  4Z2Y A;  4AVP A;  2QEN A;  3GZ6 A;  1FSH A;  2QUF A;  4EM1 A;  3FM5 A;  3B73 A;  1W5S A;  2P8T A;  2VBY A;  2QQB A;  4U7B A;  1ODD A;  5HOO A;  1J2X A;  5KVR A;  3ZMD A;  1FC3 A;  4ASN A;  3BOQ A;  5CYV A;  2VT3 A;  1UB9 A;  4HV6 A;  5D6F A;  3RI4 A;  4RB1 A;  1DUX C;  4YIF A;  4EJT A;  1MD0 A;  3J80 K;  1R36 A;  2ISZ A;  2NYX A;  4OMY A;  5ERI A;  4RB2 C;  2K4B A;  4WCG A;  2XAS A;  3F8N A;  4U7D A;  2DK5 A;  1XGS A;  3QOP A;  4XBF A;  3E5U A;  3P9C A;  4U0W A;  1P92 A;  1W7P D;  1OMI A;  1FNN A;  3VEP A;  4GO1 A;  4JQF A;  5A2Q K;  4KIG A;  1YLF A;  2XAG A;  2V1D A;  3NEU A;  2XIG A;  1KGS A;  5DD4 A;  4LK1 F;  5JHU A;  1UST A;  4P9F A;  3SHF A;  2CFX A;  5H20 A;  3T8R A;  1V4R A;  4HZF A;  5D6E A;  4UNO A;  2F5E A;  2IVM A;  4BQA A;  3W6K B;  3HHH A;  2OD5 A;  3T8T A;  4KMF A;  3HHG A;  1Z6R A;  4MTD A;  2YPR A;  3P9I A;  5JR3 A;  5E18 F;  2FBH A;  3COA C;  2BBY A;  1D8J A;  3L00 A;  1BIA A;  4ENM A;  2ISY A;  3FMS A;  2PEX A;  3BP8 A;  3LFK A;  3G73 A;  3F8M A;  4ESF A;  2Z5U A;  2PLY A;  2R7D A;  5LGT A;  2P4W A;  4L0Z B;  5K5R A;  2VOO A;  1S3J A;  3BJ6 A;  1TQI A;  1KU9 A;  5HDG A;  2FU4 A;  1R22 A;  1MGT A;  1J5Y A;  2HKX A;  4BYY A;  2ACJ A;  3RYR A;  3KP6 A;  2QM3 A;  3ZMT A;  1IZ1 A;  2RVC A;  2F2E A;  2HWV A;  2EJR A;  4IRI A;  2NRA C;  1QO0 D;  2EFW A;  2AXL A;  2MLK A;  3MEX A;  3QP6 A;  5DDG A;  2P7V B;  2EV0 A;  2XAJ A;  3KEQ A;  1SFX A;  3M9A A;  1GVJ A;  3S2W A;  4CIC A;  3DPL C;  3E6B A;  3JW4 A;  4EJV A;  3FXQ A;  4EVI A;  2K86 A;  1UHW A;  3V8K A;  2JZY A;  3EET A;  3CJN A;  1USS A;  1BBY A;  4B8X A;  1BN5 A;  3CUQ B;  2XV4 S;  2JRT A;  2L3D A;  1IXS B;  1UFM A;  4IHT A;  3MAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...