4P55A

Crystal structure of dna binding domain of k11 from kshv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
SEWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGRNRRERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTIYKGKMKLNRWIMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Viral IRF2-like protein
publication title crystal structure of DNA binding domain of K11 from KSHV
rcsb
source organism Human herpesvirus 8 type p
molecule tags Dna binding protein
total genus 27
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4p55A00
1FSEA 4WF2A 3LAPA 1BOAA 2Q0OA 2P4WA 1ZG5A 4YIFA 5LBQA 4ZYDA 1J59A 4CDGA 1OPCA 2XASA 4I2OA 5DD8A 1EH7A 3HRTA 4HLXA 1TTYA 1LNWA 4EVIA 3H92A 3F3XA 3KP4A 4L9VA 2QYOA 2EJRA 5HS9A 4PZJA 4CZZA 3HRMA 5ICGA 2KKOA 1SD6A 3IKTA 4GCVA 3FMRA 1K79A 3F8FA 3HUGA 2FQ3A 4EQQA 3RKWA 4XLNF 2OZUA 4OU0A 4ZYGA 4UV8A 1I27A 2FMLA 2XIGA 1H9GA 5HDGA 2W57A 3HSRA 1ON2A 3NRVA 1OKRA 1P4AA 3G3ZA 3QU3A 4A5MA 1L3LA 2HFHA 3BOQA 1TW3A 1QBJA 5FD5A 3LQQA 5HVQC 3L2CA 4MQVA 5L3CA 3WGHA 2A6HF 2DU9A 5FB2A 4ZH4F 1OYIA 4R1HA 2VBWA 4JBAA 4FHTA 2FMYA 1G4DA 2L01A 3RPUA 2FRHA 4RGSA 1Q1HA 2FEZA 4DQ2A 3ZQ7A 1J2XA 3ELKA 1KU9A 3DPTA 4FX0A 4U7BA 1FPQA 2RGVA 1W5SA 1D8JA 1T6SA 5DD4A 2K4JA 3J80Z 1ZRDA 4I09A 2EV0A 5DCMB 3ECHA 4ENKA 5E8GA 2LKPA 3KZYA 1FC3A 1Z91A 1HXDA 1FBUA 2R7DA 1HKQA 2WV0A 1ON1A 2D1HA 2H27A 4KMFA 2ZFWA 2E1CA 4HF2A 3I54A 4M72A 4L0ZB 1B6AA 2JPCA 1XSVA 4OOIA 3GYHX 2PQ8A 3F8MA 1W4MA 1KU3A 2MH9A 3QOPA 4LK0F 2UXXA 5L3GA 1AOYA 2YX4A 4L5IA 1Z9CA 3TOAA 4L9TA 3M8EA 1IXSB 2NRAC 1S29A 5LHGA 4Y17A 3H3ZA 1S6LA 2L54A 2Z9OA 4U88A 3DKWA 2GXGA 3IC7A 2A68F 2IRFG 1ZH5A 4P96A 2IA1A 4RS8A 2Z3YA 3HYIA 3HOSA 1E17A 4CHUA 1HW5A 2KRFA 2RV8A 5CVRA 3K0LA 4ENMA 2QLZA 3WTYC 3E3VA 3T8RA 1FY7A 4QWQA 1FBSA 3TO7A 3ZN1A 5LEJA 1F5TA 3TKYA 1T98A 3TDUC 3N97A 2ZMEB 3KEOA 3QP5A 2HEOA 1JHHA 1OR7A 2RC4A 2KIFA 1QGPA 4EJVA 3VOEA 1XCVA 1LDKB 1ONVA 2DK8A 1MJ9A 4I0BA 2BEOA 3CJNA 4G9YA 4D0PA 2DQLA 3DV8A 1K6OA 2P5VA 1QPMA 4UUVA 5LEKA 1K7AA 1HSJA 4G8XA 2F5DA 1SAXA 3IRQA 4L9NA 2EWNA 4OMYA 2YR2A 2OA4A 5D5UB 1IF1A 2ETHA 3JTHA 3RIRA 4HV6A 4Q4ZF 3CUQB 2ELHA 1G3TA 4S05A 2XGXA 1IN6A 3ECOA 4M6YA 4R79A 4L18B 4M74A 2RDPA 2H6BA 3V7RA 2DQRA 1D3YA 2ISZA 4A0YA 2UXNA 3GO5A 2DPUA 1XGOA 4EM2A 1DPRA 1H0MA 2PEXA 5D5WB 3MZHA 1G3SA 2Z33A 1O3RA 3TOBA 3K1PA 3L9FA 2HZTA 4RB0A 1OMIA 3FHZA 5CVUA 4PGGA 4U0WA 1U2WA 1BI3A 2V1XA 4KIFA 1FBQA 1I1SA 1O57A 2ZJ2A 3COAC 5FLXK 4K2EA 2IPQX 3O6BB 4HYEA 3SXYA 4OIPF 1XMAA 4OIOF 1MKMA 2HKOA 4RGRA 3QRFF 2HYFA 2XKOA 3TDZC 4HDVA 3K9TA 4ZYHA 1TQIA 4U0YA 3MQ0A 1BC7C 1S7OA 2W24A 4PCQA 1E2XA 4ENNA 5L3DA 3V8LA 5LRRA 3WGGA 3R60A 5D6FA 1KU7A 4YG2F 1SFXA 2P6SA 3OOPA 4IRHA 5E17F 2EFQA 3I59B 5KVRA 3WU1B 4HBLA 2IA2A 4AWXB 3WTSC 3LA2A 2QVOA 4BAYA 3PQJA 4HF1A 5BOXA 5DUKA 2QWWA 2WC2A 1IRFA 1R1VA 2XAHA 1F9NA 2W84A 2F2EA 1V3FA 1SD5A 2M30A 4EV0A 1BIBA 2ESNA 4H0EA 1KA8A 2STTA 3J81K 5J8FA 1ULYA 3EDPA 4Q5SF 1FYLA 2LNBA 4I0AA 3BDDA 2LF8A 2E7WA 2HYGD 3IWFA 5AONA 3U2RA 2L4MA 1T39A 3ERED 2NNYA 5ICCA 2GA1A 2PFBA 3ML6A 4R8HA 2VBZA 1ZG3A 3BPVA 1Y0UA 1YW9A 3WE3A 3SZPA 2P7VB 4WCGA 4M9ZA 4LFUA 3F22A 4L9JA 4BNCA 3LFKA 3CO6C 4CGZA 3JSOA 2MBFA 1TNSA 5JFRA 3M9AA 2M1BA 1MGTA 2RNJA 2GXBA 4EM0B 4IRIA 3TQNA 3E97A 3J7AO 4RB1A 2WWYA 4AIKA 1YFHA 2MA3A 3JW4A 1YLFA 5K5QA 3I0TA 5HOOA 2AXLA 2DK5A 3JAMK 3IKVA 1ZGAA 3JAMZ 3SHFA 1QO0D 3DFGA 1YYVA 5IT3A 3VODA 4M73A 3KCCA 3ZPLA 3ZMSA 1NHAA 3ZMVA 4O3MA 4MEXF 2K4BA 4OMZA 5TJJA 1USSA 2JSCA 3CUOA 2IT0A 3CO7C 4G7HF 2XHKA 3F23A 3QAHA 4KFCA 2ESHA 2ZXJA 4I02A 1PDNC 2VOPA 2EFWA 2D1VA 4KIGA 3AAFA 1ZAOA 2MLGA 2IP2A 5FGMA 1J0RA 2NAZA 3BWGA 1ZGJA 4RGXA 3FM3A 3M1EA 1USTA 1J5YA 2XKPA 1FP1D 1GXPA 3F72A 1HKSA 3MZYA 5DCMA 3KLNA 1R5HA 1GVJA 4N9HA 1FYMA 1DUXC 2O6GE 2RQPA 3KE2A 2IW5A 3EETA 1UB9A 2VT2A 3QP6A 1I6XA 2JRTA 4P9FA 4IXAA 5F6FA 5KK1A 1PP8F 1HSTA 3GWZA 3RYPA 4KUMA 1B1BA 1OYWA 1HQCA 5D4SA 4WK8F 1U5TB 3E6MA 3ABUA 1TNTA 2XRNA 3K1NA 3P9IA 5D8LB 1LEAA 2LF7A 1XB4A 3ZP5A 1Z7UA 1UCRA 1LDDA 2P8TA 1HW2A 2UZKA 2B0LA 2PI0A 2CGPA 2IJLA 2DI3A 3GZ5A 4LD5A 3HTUA 3LA7A 2FBHA 3ZMTA 4MHGA 4LMYA 1KQ9A 4Z2YA 3KP7A 4NHJA 1P6RA 3KETA 5F64A 4HQEA 1J7KA 1YS7A 1TQMA 3K1MA 4DNCA 2K86A 1GXQA 5CYVA 3DF8A 3REOA 3W6JB 4EMSA 1B4AA 3HHHA 5ICEA 3BY6A 1XCBA 6PAXA 2BYVE 3KEQA 2DAOA 4AVPA 2DBBA 3OV8A 2Z5UA 1QZYA 1JHFA 3ZMUA 4HX7A 1FWZA 4LK1F 3I4PA 3Q9VA 2ZMEA 4UV9A 4KNYA 1SMTA 2X0LA 2ISYA 1EH6A 2W25A 2M8EA 2V79A 5LHIA 2O3FA 1RI7A 2STWA 3V7CA 4WX9A 5K1YA 5JI6A 1BM9A 3FWEA 3KP3A 2A5YB 3U1DA 3V8JA 3BZ6A 3ZMZA 3H3UA 5HLHA 2ZBKA 5H6RA 2VC1A 4I98B 3EQLF 1XSDA 3KP6A 3CUQA 4RAZA 5HS8A 4TV7A 5FFZA 4IPAA 2OD5A 4GGGA 4KN7X 4O6JA 5H20A 5J8CA 3HIFA 3LSTA 3V8KA 1XDSA 4KYWA 4UNOA 4EGYA 2VOOA 1FSHA 3FF5A 5EEGA 2ZKZA 4U7DA 2YSRA 4LB6B 1U5TC 4MTDA 3MAJA 2EA4A 2RVCA 2XV4S 1SMYF 2DW4A 1P2FA 2MD5A 1S8NA 3FMQA 3K69A 1LJ9A 2OZ6A 3BJ6A 1FX7A 4BQAA 2PBIA 5FO5A 2KIMA 3MFKA 1U3EM 1DP7P 2HOEA 2O8XA 1WKMA 4IJAA 3U9GA 2G7HA 2EV6A 2HQRA 3GUDA 4N9IA 1LEBA 2A6EF 2JPBA 1MD0A 1UHMA 5DDGA 4HX4A 2D2WA 2LDUA 2CFXA 2Q2EA 1O3SA 2OQRA 3VFZA 3VEPA 1YW7A 2HTSA 5JR3A 3O3KA 4KN4X 3I59A 2XVCA 4HX8A 4L5JA 5EEHA 3RYRA 2VBYA 2M87A 4A12A 1WI9A 4AIHA 4XLPF 3C1DA 2CG4A 5AIQA 1TQPA 2QQAA 1WQ2A 1IW7F 2EFOA 5L3FA 1U8RA 1LVAA 4ESBA 1VTNC 2PLYA 1Z6TA 2RN7A 4OIRF 5FLXZ 1KQ8A 3F8BA 2XAJA 4U0VA 2HR3A 1R5GA 1GHCA 3MCZA 1HBXG 4JK1X 3I64A 3GFMA 1P4WA 3FXUA 3GW2A 1ZRCA 3LWFA 2V1UA 1H9TA 2P7CB 1LQ1A 4JQFA 3RKXA 3I71A 3T1BA 2DLLA 4HQMA 3V7SA 2QM3A 2CWEA 4EJOA 2HS5A 5AIPA 1YW8A 2D45A 1O3TA 1IN8A 4RB3C 3O2PE 2CYYA 1R1TA 3MEXA 4ZZLA 4HDUA 3GXOA 3TGNA 2YU3A 4BXUA 3F6VA 3SFZA 1F1ZA 1JGSA 1RNLA 1YO5C 2NYXA 2K7LA 1ZLKA 5CJ9A 4KIBA 1R36A 3WTTC 2CO5A 3I53A 3FM5A 1J75A 1DPUA 2LSOA 3FXQA 5CLSA 3J81Z 4RGUA 1XD7A 1W7PD 5ILVA 2X4HA 2XUBA 3RI4A 4HOBA 3CUQC 5E1WA 5K5OA 4UVCA 4A0ZA 2V6CA 4KT5C 2VODA 4WXCA 2H94A 1W5TA 4CYDA 2RKHA 2VC0A 1C0WA 4LG0B 1O7LA 3ISPA 4M6XA 2HGCA 3HHGA 2EA2A 1ZLJA 3QU6A 1SFUA 3R0AA 5BQTA 2K02A 3LAJA 2MC3A 5HDKA 5IT9K 3WODF 5IT9Z 2HWVA 2H6CA 4UVBA 2ZNZA 1QQIA 3S2WA 2M5WA 3FZVA 2A69F 3IWZA 3HSFA 4ETSA 2NNNA 3F8NA 1FOKA 2KJBA 1SD7A 2P5KA 3GF2A 3EUHA 1R23A 1R00A 4YFNF 1ZREA 5A2QK 2HTJA 4MEYF 3DP7A 1UFMA 4RAYA 2DT5A 2QQ9A 1BJAA 4I7HA 1HW1A 1ZG1A 2KJCA 2CSOA 5JHUA 1S3JA 3K2ZA 4UHTA 1MJBA 2FNPA 1W7PA 4YIIA 3JTGA 2OBPA 3TO9A 1D8KA 3PQKA 4UXNA 4A0XA 2BV6A 4OINF 1LB2A 1G3WA 2P5LC 3RJPA 4EJUA 2BGCA 2VONA 4ESJA 1U5TA 3ULQB 1J9IA 3W6KB 1I1GA 4LGWA 3L7WA 2GZWA 1F4KA 3EYYA 3KZZA 5E1XA 1V4RA 2FXAA 1XMKA 4A5NA 3T8TA 5FD6A 1HKTA 2J5PA 3IL2A 4GYIA 5E8IA 1X3UA 2HKXA 2L3DA 3P9CA 3GFLA 3M8FA 3F8CA 3BP8A 3EYIA 3R61A 2DTRA 1AWCA 1I5ZA 4IVNA 1MZBA 2Y0MA 1W7PB 2BBYA 2BE5F 4G6DA 4ENJA 2QBYB 3B02A 2E7XA 5D6EA 1STZA 4L0YB 4PDKA 3C18A 1RUNA 4MNUA 2FU4A 5HS7A 3I5UA 5D4RA 2NS0A 1WRJA 2EK5A 3ABTA 5DEQA 3WTUC 3Q5FA 4ZYEA 2ZNYA 4M9XA 3T5XA 1PP7U 4EM1A 4M9SA 2XAQA 3DPLC 3RTRA 2K27A 1KU2A 1EH8A 1T0FA 1MJAA 5E1ZB 4NQWA 3CTAA 2G9WA 2AS5F 1YIOA 4LJZF 3ZN0A 3BJOA 4WXHA 1OYYA 4XSXF 1ZN2A 5BMZA 1FNNA 3HTSB 2ZCWA 2EB7A 4LLLA 4UVAA 1U78A 4I01A 5ED4A 1R7JA 3FX3A 2COMA 2GWRA 1BN5A 1XN7A 2W85A 3J80K 2EFPA 4EGZA 5LGTA 1IN7A 2VE8A 1TW2A 4A6DA 5CVVA 2Y75A 3HSEA 1REPC 3BROA 4ESFA 3KFWX 2P6TA 4XBFA 2QQBA 2DFIA 1CF7A 4HW0A 2VN2A 2F5FA 2O03A 4Q47A 1G6NA 5D5XB 3R0JA 3G73A 3GFJA 1EV7A 1FLIA 1YQAA 2GQQA 3E6CC 2PJPA 1QZZA 2PG4A 4Q48A 3IRRA 1KQ0A 4LLGF 2PMUA 1YG2A 2Z99A 2ACJA 4KICA 1JXSA 2H09A 5E18F 2A3SA 1QNTA 3D0SA 3E5QA 1B9NA 3E6DA 5CVJA 3GVAA 2OU2A 3HOTA 1ODDA 3WTXC 4CICA 4BHBA 1DDNA 4BH9A 4M71A 1JE8A 3ZMDA 4MTEA 2O61A 4NB5A 5ICFA 2MLKA 3C3WA 2WTEA 2PMHA 2UWMA 4P5OA 4LB5A 1U6GA 1FP2A 2IVMA 1CGPA 5HLGA 4EJTA 3P9KA 3CLOA 2XROA 2E1NA 1CF7B 3LQRA 4MGRA 2L02A 5LLQA 1G3YA 5LRSA 4WWCA 3F6OA 1WSUA 3WE2A 1ZYRF 2TDXA 5J6XA 1S7AA 3ROUA 1B59A 1TLHB 5DYMA 2ADUA 3R4KA 1B9MA 4GO1A 3FMSA 4WXDA 4QLCU 2V1DA 1MDMA 2VT3A 4Y15A 2YPRA 5DCFA 3NQOA 3TO6A 5HDNA 4LLNA 2GIVA 5JVTA 3CDHA 2O0YA 3WG9A 3D5LA 1BBYA 3HRUA 4BHPA 4XSZF 1D5VA 3IHUA 1Z1DA 3DEUA 1FZPB 4S04A 5BPDA 4Y13A 3MWMA 2L4AA 3F21A 1BIAA 4KDPA 1WWXA 3C7JA 2VXZA 2Y48A 2CW0F 1TBXA 4AD9A 2F5CA 3V4GA 2FE3A 1IXRC 2JT1A 1XGNA 3GLXA 2M45A 3KLOA 1YS6A 3DXJF 5HLIA 1IZ1A 1ZRFA 3GEZA 3NEUA 1IAWA 4IHTA 2OQGA 1IN5A 4FX4A 2C6YA 2FOKA 1T38A 4IHSA 5DUIA 1XSXA 5LGNA 1IXCA 1MDMB 3SQNA 5H6QA 4ZZDA 4G6QA 4YFKF 3R6SA 1YTYA 5FFXA 1UHWA 1XGSA 2HDCA 3E5XA 1ZARA 3Q9SA 4ASNA 4IRGA 2FSWA 1ZHFA 1RUOA 2QUFA 3FXRA 2IA0A 4ON0A 5ERIA 2J5OA 3L00A 1RIOH 4LG0A 5LGUA 4RB2C 3WTWC 4P55A 3QPTA 5K5RA 3VB2A 2CQKA 1BI2A 3SZTA 1SFEA 1P92A 4HAMA 1A04A 4F7ZA 1RZ4A 1BI1A 1FYKA 1Z6RA 1L0OC 1KYWA 2A07F 3B73A 4AIJA 3BJAA 1K78A 2YX7A 3RKYA 5ILUA 1SD4A 2QENA 3KP5A 3QPHA 2F5EA 4A6EA 3GX4X 2R3SA 1BC8C 4O5VA 5CVIA 4CO8A 4EJWA 1IUYA 3WGIA 4HV5A 4G94A 3E5UA 2DO7A 1XGMA 4PGHA 2FF4A 2JZYA 2VE9A 5D5VB 1P4XA 2GAUA 4P9UA 4MQ9F 4YFXF 3N4MA 2V9VA 2JTVA 5E20A 3JSPA 4HF0A 4XRFA 2A61A 4HZFA 1IRGA 3I58A 2ZO4A 3GFIA 2R7FA 4HLYA 5LHHA 4KMUX 5BS6A 2DPDA 1R22A 1FT9A 3L09A 5BPIA 3LA3A 2VBXA 4FT8A 1KGSA 2FNAA 2EFNA 5L3BA 1R58A 2QZ8A 2XAGA 3GZ6A 2KIUA 2OAZA 3PFIA 4CXFA 3WU0A 1K78B 5F1RA 3WTVC 3HRSA 4B8XA 2FBKA 1LDJA 1R1UA 1T2KA 5DV5A 2Q8KA 4BYYA 3RDIA 2XAFA 2GA2A 4G7OF 4OIQF 1IN4A 3M7GA 3KP2A 2HQNA 2MH2A 1KYZA 4A2UA 4HA8A 1BI0A 4GXOA 4B09A 1XDUA 4G7ZF 1O7FA 3E6BA 1O3QA 5A2QZ 2FBIA 2G7UA 4KA4A 2FA5A 4IF4A 3BPXA 4E70A 5L3EA 2EV5A 3RPQA 5ILSA 3T0YA 4GYGA 5TRDA 1Z05A 1PUEE 2QBYA 3WTZA 3DQVC 2PN6A 4BHCA 3P7NA 4N0BA 5D8KB
chains in the Genus database with same CATH superfamily
1FSEA 4WF2A 3W2WA 3Q0WA 3LAPA 1BOAA 2VXDA 2R7UA 2E60A 1WGXA 2XGEA 2Q0OA 1OCOH 2P4WA 1ZG5A 4YIFA 5LBQA 4ZYDA 1J59A 4CDGA 2F5VA 4BBRJ 2DJIA 3LSJA 2MSYA 4NBQA 5GAGJ 1OPCA 1VQ5I 2XASA 4W1UA 4Y52J 4F91B 2QSHX 4I2OA 5DD8A 2XGDA 1EH7A 1FOXA 2L9VA 1PVEA 3HRTA 2V6EA 3PSIA 4HLXA 3RPUD 1JKOC 2BY1A 1TTYA 4DYQA 1W5CC 1LNWA 4JX6A 1DU6A 2VQGA 4EVIA 3H92A 2KZGA 3F3XA 3KP4A 2QYOA 4L9VA 2K85A 2EJRA 5HS9A 2JJ7A 4A3FJ 4PZJA 4CZZA 1ERDA 4JYKA 5EZHA 1ETYA 3HRMA 2E19A 5ICGA 1ETQA 2KKOA 2KT0A 3NWTA 3LSIA 4XRSG 4D7NA 2P81A 1SD6A 4XKVA 4GCVA 3IKTA 1MSEC 1D0ZA 2BZTA 2DA2A 3DTKA 1JTYA 2R7TA 3FMRA 1K79A 4RMNA 2E5ZA 1Z3YA 3F8FA 3HUGA 3ABMH 2FQ3A 4A3BJ 4S0HB 2WY7Q 3DEEA 4EATA 3FXMA 3RKWA 4EQQA 4XLNF 3JRCA 2OZUA 2LH9A 4OU0A 4UY8I 4ZYGA 4UV8A 4ZDLA 2OC6A 1I27A 3RQ4A 1MNMC 2FMLA 2XIGA 2FOWA 3HOUJ 1H9GA 4L5EA 5HDGA 2V9PA 2W57A 3HSRA 1ON2A 1N77A 3JRAA 3NRVA 3H3VK 1OKRA 2VIXA 1P4AA 3G3ZA 3G1MA 5H2FC 3QU3A 2VKDA 3OSGA 2Y9ZA 4A5MA 1XX5A 1L3LA 2DOAA 3K70D 2HFHA 3BOQA 1TW3A 1QBJA 3BG5A 1TWCJ 5FD5A 2CUJA 1T33A 3LQQA 1FIAA 1B8IB 1JKPC 5HVQC 3HGGA 3PSFA 5FRMA 3L2CA 4MQVA 4PJMA 5K7HA 2HOSA 4YELA 4E7LA 2GIZA 1Q1VA 5L3CA 3WGHA 1X58A 2A6HF 2L7FP 2DU9A 2NVQJ 5FB2A 3VYRB 3TP0A 1V54H 2Y2ZA 4ZH4F 3GTPJ 3E7LA 1HCRA 1OYIA 1D1BA 2VBWA 4JBAA 4R1HA 4FHTA 2FMYA 3A0BC 3L2VA 2L01A 2OUMA 1G4DA 3RPUA 2KDZA 2JA8J 2FRHA 2XDVA 1UMQA 3OY9A 4RGSA 1Q1HA 2FEZA 3OYNA 4DQ2A 2RAEA 2QA4I 3ZQ7A 1J2XA 3K10A 3ELKA 1KU9A 3ABKH 5KCMA 3DPTA 4FX0A 3I9V2 2HI3A 5IOZA 4U7BA 1FPQA 2RGVA 2V4JC 3S3OA 2BY3A 3FBNB 2L2OA 2HU9A 1OCRH 4XIDA 1W5SA 3I56I 1D8JA 2DA5A 3RZOJ 2EIKH 1YX5A 1T6SA 3CJRB 3PFYA 5DD4A 5IP6A 4Y7NJ 2K4JA 3J80Z 1ZRDA 4I09A 1LKXA 2EV0A 3ZQFA 3Q0UA 3FK7A 5DCMB 3ECHA 5F0HA 4ENKA 4E7HA 1ZK8A 5E8GA 3WU2C 2LKPA 2O7OA 1FC3A 3A1YA 3KZYA 1Z91A 3K4BA 1HXDA 5EZGA 5B1AH 3TL4X 2W48A 1FBUA 4C9YA 2R7SA 1QZEA 3CMYA 4A3GJ 2R7DA 2QKMB 1HKQA 3J7YJ 2WV0A 3CCEI 5EYRA 1ON1A 2K9SA 4F92B 2D1HA 2H27A 4KMFA 5IYBJ 2LYCA 2MFZA 2ZFWA 4C2UA 1WJDA 2K9NA 2E1CA 4HF2A 2R5YB 2IBDA 4AIDA 2Y30A 2L5QA 3I54A 4M72A 3ZGKA 2HVSA 3S16J 4ZJZA 4L0ZB 5KAFC 2HDDA 4XICA 4E7IA 1B6AA 2CJJA 5JLWA 2TRTA 4IHWA 4ZTFA 3OYKA 2JPCA 1XSVA 4OOIA 4RBOA 2IS2A 1F36A 1RKTA 3GYHX 2PQ8A 1DQUA 2KRHA 3F8MA 1W4MA 3KPHA 1KU3A 2MH9A 3QOPA 4LK0F 5E79C 2UXXA 4XLHA 2WADA 5L3GA 5C4JJ 2YX4A 2CV0A 1AOYA 4L5IA 4D1QA 2R7WA 1Z9CA 1LFUP 1FIPA 1VQNI 2CQQA 2X6XA 3TOAA 4L9TA 3FBIB 4DBQA 2FUG2 3M8EA 1Z7LA 1OFCX 3GTMJ 1WI3A 1IXSB 2NRAC 1BJZA 1S29A 1RR8C 5LHGA 4LITA 1V55H 4Y17A 3H3ZA 1S6LA 2L54A 3A4CA 4FETA 3CCSI 4U88A 2Z9OA 2LKSA 2XAUA 3PNYA 3DKWA 2M0MA 2GXGA 2IXSA 4BE1A 3IC7A 2A68F 4BACA 1RKWA 2IRFG 1ZH5A 2EBIA 3H9JA 3GCMA 4P96A 2IA1A 2Z1DA 2DN0A 4RS8A 3AG3H 2Z3YA 1IRZA 3HYIA 2HPMA 3HOSA 5F04A 1MMGA 1E17A 4CHUA 3CJQB 2CMPA 3DCFA 1HW5A 4DW6A 2KRFA 4Y33A 2RV8A 5CVRA 3K0LA 4ENMA 3FDYA 4BQQA 1SVLA 2QLZA 4E7SA 3FXJA 2HVQA 3E3VA 3WTYC 3T8RA 3HPGA 5GAHJ 1FY7A 4QWQA 2BOLA 1FBSA 3TO7A 3DKYA 1IRXA 3ZN1A 5LEJA 1F5TA 3TKYA 1T98A 3TDUC 3N97A 2ZMEB 4KJZA 4ZDPA 3KEOA 3QP5A 4E6KG 2HEOA 2W4SA 3IP4B 3VPRA 4A93J 1JHHA 1OR7A 2RC4A 2KIFA 1QGPA 2F4OB 4D9JA 3BC8A 4EJVA 3HDDA 2HYJA 3KZIC 3VOEA 1XCVA 2ECCA 1LDKB 1ONVA 2VPLA 3FXKA 2DK8A 2EILH 1MJ9A 3DPUA 4I0BA 2BEOA 3CJNA 3K4JA 4G9YA 1LFPA 1U8BA 4D0PA 1SC7A 2DQLA 3AG4H 3DV8A 5M5XJ 1K6OA 5GPCA 1JI8A 3HZJA 2V7FA 2P5VA 1QPMA 4UUVA 5LEKA 1K7AA 2CUFA 1HSJA 4HG2A 1MMDA 2HOTA 4G8XA 2F5DA 1SAXA 3IRQA 2DA1A 4L9NA 2EWNA 4OMYA 2YR2A 3L2RA 2OA4A 2JQ7A 5D5UB 1UG0A 2VKHA 2ETHA 3JTHA 4XN0A 1IF1A 3RIRA 4YRVA 1FEXA 4HV6A 4Q4ZF 3CUQB 3HGYA 3LNQA 2ELHA 1G3TA 4BJ6C 4S05A 2XGXA 1IN6A 3ECOA 4M6YA 1AKHA 1S72I 4R79A 4L18B 4UB8C 1I3QJ 2QKLB 3P5JA 2VJ5A 3HOXJ 4M74A 1ETKA 2BVMA 2RDPA 2L9SA 3OIPA 2H6BA 1I3AA 3V7RA 4LIVA 2VJ4A 3QYBA 1UELB 2DQRA 1D3YA 2ISZA 2I8DA 2VL8A 4A0YA 2UXNA 3G1LA 3GO5A 1XGOA 4EM2A 2DPUA 1DPRA 1H0MA 2PEXA 4DGWB 5D5WB 2F4IA 4NUBA 3MZHA 1G3SA 4V19K 2Z33A 1WCMJ 5C3EJ 1O3RA 1N25A 2ID6A 1GVDA 2LY2A 4C2TA 3SDGA 5IOYA 4PFOA 3TOBA 2DA6A 2R7XA 1OLTA 2BW3A 2XF6A 3K1PA 3KIOA 2RNGA 3L9FA 2HZTA 4RB0A 1OMIA 3FHZA 5CVUA 4PGGA 4U0WA 1U2WA 1BI3A 1X19A 4E7KA 2Y69H 2V1XA 4KIFA 4XKCA 3V42A 4M3DA 3CCYA 5J3LA 2E1MB 5EF6A 2F4MB 3ZQCA 1FBQA 3OL3A 1WZ2A 3I4MJ 1LVKA 3G4SI 1I1SA 1O57A 3MKZA 2ZJ2A 3COAC 5FLXK 4K2EA 1MBGA 5IP9J 2ZC2A 2IPQX 3O6BB 3QYEA 4HYEA 3SXYA 5J1RA 4OIPF 2PX9A 2X6YA 1XMAA 2R7OA 3UNGC 4OIOF 3OOUA 1MKMA 1RR7A 3BR0A 2HKOA 4RGRA 3QRFF 3M1CA 2HYFA 1RESA 2DMPA 1R9TJ 2XKOA 3K2AA 3TDZC 4HDVA 2MYSA 3K9TA 1MMSA 2LK2A 2DTZA 1VF9A 4ZYHA 1TQIA 2ICWG 2A05A 2K3PA 4U0YA 3MQ0A 1BC7C 4A3MJ 1S7OA 2W24A 1SAUA 1WJFA 4PCQA 3W2AA 1ZGWA 2OTLI 2JWTA 1E2XA 4ENNA 1AKHB 3CESA 5L3DA 3V8LA 5LRRA 3WGGA 3CC4I 3R60A 3S14J 1QVUA 3HM5A 3RQIA 1X4OA 2M7BA 4LIUA 5D6FA 1KU7A 4YG2F 1SFXA 3LOCA 4I6ZA 2P6SA 3OOPA 2R7ZJ 1WFXA 4IRHA 5E17F 3SEZA 5E3LA 1JGGA 2EFQA 3OWTA 2ZMEC 3I59B 2E2IJ 5KVRA 4IHXA 2ME0A 3WU1B 4HBLA 1DU0A 2IA2A 4AWXB 3WTSC 3OYCA 1HDDC 3LA2A 2QVOA 4BAYA 3EUAA 3MKYB 3HC7A 3PQJA 3QPLA 4HF1A 5BOXA 5DUKA 2B7EA 3PIOF 4HEA2 2QWWA 2WC2A 1IRFA 1R1VA 2M2EA 2XAHA 3ZXSA 1F9NA 2HQAA 2W84A 1I39A 2F2EA 1V3FA 3BR6A 2DT6A 1SD5A 3OYGA 3L1PA 2VQHA 2LBFB 2M30A 1MBHA 4PSXA 4EV0A 1BIBA 2G0EA 2ELJA 2ESNA 2QQ8A 2LTPA 4H0EA 1KA8A 2QEXI 2WV1A 2HOAA 2STTA 1YOVB 3J81K 5J8FA 2IGNA 5EG0A 4QTRA 5B3SH 2BXZA 1XG1A 4XLAA 3ZQQA 1ULYA 1U0JA 3EDPA 4Q5SF 1FYLA 3LMMA 1VZ0A 2LNBA 4PUSA 4DYCA 4I0AA 2XC7A 3BDDA 2EINH 1O4XA 3K4LA 2LF8A 1X1PA 2E7WA 4RLQA 1FMVA 2HYGD 2X85A 3IWFA 3LSPA 5IYDJ 5AONA 3U2RA 2R7QA 2L4MA 1T39A 3ERED 2NNYA 4OWRB 5ICCA 1MMNA 1Z67A 2GA1A 2PFBA 2Y0SA 3ML6A 4R8HA 1ETVA 2VBZA 4B3AA 3NWSA 1ZG3A 3BPVA 3CCLI 1W0TA 4YIRX 1Y0UA 3BR1A 1YW9A 2CRGA 4A3CJ 3WE3A 3SZPA 2P7VB 1AHDP 4WCGA 4M9ZA 4LFUA 3F22A 1TC3C 4L9JA 3QOEA 1BW6A 1A6IA 3PO3J 4IQJA 4BNCA 3LFKA 3LSGA 3CO6C 1JUSA 4CGZA 3JSOA 2MBFA 1TNSA 3CCRI 5JFRA 4XLEA 3M9AA 1OR7C 2M1BA 1LE8B 1LUJB 2VUMJ 1EJ9A 1A35A 1MGTA 3E0JB 2RNJA 3HKZA 2GXBA 3L2UA 4EM0B 2DXIA 3GTJJ 1JT6A 4IRIA 3TQNA 2E1MC 4BE2A 3E97A 1XC5A 4RB1A 3J7AO 1FOYA 2WWYA 4AIKA 1YFHA 2MA3A 2XF7A 3OS2A 3JW4A 1WH5A 4IQ4A 1YLFA 3MN2A 3OS0A 5K5QA 1R6RA 3I0TA 5HOOA 2AXLA 2DK5A 3JAMK 3IKVA 3IV5A 1ZGAA 3JAMZ 3SHFA 1QO0D 3DFGA 5DM6F 5EG0B 1YYVA 5IT3A 3EUKL 3VODA 4M73A 5CQGA 3ZR8X 3KCCA 2LOOA 1OJLA 3ZMSA 3ZPLA 1NHAA 3ZCOA 3ZMVA 5GADJ 3CCQI 1T56A 4O3MA 1FTTA 4MEXF 1V5GA 2CUEA 3H9QA 1VQ9I 2LD5A 2K4BA 1K4SA 1B8IA 3S1QJ 3QQAA 3X2QH 1GUUA 3G1OA 4OMZA 5TJJA 1USSA 2JSCA 3S1NJ 1ZR2A 1RC9A 3KX2A 2DYSH 3CUOA 2IT0A 1BR2A 4CCOA 1B72B 1K61A 1Y1VJ 2R0QC 1Y1WJ 4CCLA 1QPIA 3CO7C 1ZQ3P 2MGQA 4G7HF 2XHKA 3F23A 3QAHA 3QODA 4KFCA 2ESHA 2ZXJA 2Y0SN 3K4CA 4ANJA 3IH4A 4I02A 1PDNC 1YRNA 2VOPA 2ELKA 5M5YJ 3DU6A 2KFDA 2EFWA 2MABA 2D1VA 2K5CA 4KIGA 2D5VA 3AAFA 1AA7A 2V1NA 2W1OA 3VWBA 3GLLA 1ZAOA 4U87A 3MD2A 4MFEA 2MLGA 2IP2A 5FGMA 2LVSA 1J0RA 4RA2A 1UAAA 2NAZA 3BWGA 1Z0XA 1ZGJA 4RGXA 4A3IJ 2ECBA 2LP0A 3FM3A 3M1EA 4BXFA 1S9HA 2GOMA 1USTA 2JN6A 4XLCA 1J5YA 2XKPA 1FP1D 1GXPA 3F72A 1HKSA 3GMEA 3HKZN 2BXYA 1WJ5A 3W2VA 3MZYA 5DCMA 4GDFA 3KLNA 5F27A 3BR2A 1R5HA 2EH3A 1GVJA 4N9HA 1FYMA 1DUXC 2O6GE 2RQPA 1HA8A 3KE2A 1MH4A 2IW5A 2KQRA 2XPWA 2NS8A 2EPFA 3TW7A 3EETA 4XNFA 1UB9A 1NG7A 2VT2A 3QP6A 3DLLF 1I6XA 2JRTA 4P9FA 1ACIA 4IXAA 5F6FA 4BDZA 5KK1A 4M6VA 4C3IJ 1PP8F 3OYJA 1Y0NA 1RETA 2DOEA 1SANA 3ABLH 2L9RA 1HSTA 2IGKA 3CQZJ 3GWZA 1TP4A 3RYPA 4KUMA 4NDLA 4XRMA 2UV1A 1JUPA 1A6QA 4JP0A 3BTJA 2N8GA 4BS9A 2R5YA 3S3NA 1B1BA 1X4PA 1OYWA 1IDZA 1HQCA 1WJAA 3H0GJ 2LC2A 4RM3A 3S8PA 3SEQA 5D4SA 1WJCA 4WK8F 1U5TB 1YRNB 2PJRB 3KEYA 4IHVA 3FHNA 3E6MA 3L2QA 3ABUA 2X1DA 1VQ6I 3VDXA 2ZFUA 3A01A 2WAEA 1TNTA 2XRNA 3HOVJ 3K1NA 4HNTA 3P9IA 3ONQA 5D8LB 1KZHA 1LEAA 4XM3A 2LF7A 4YEJA 1XB4A 4X0GA 3ZP5A 2VQLA 5GPAA 2V26A 4GRIA 1Z7UA 1FTZA 2LFBA 4FTHA 1UZCA 1YI2I 1ETOA 2KLOA 3BCAA 1UCRA 3KYLA 4Y3OA 2IS4A 2ZJPF 1LDDA 2P8TA 1HW2A 4UUTA 4IX7A 2EZKA 2UZKA 5EGOA 2B0LA 2PI0A 2CGPA 2IJLA 2DI3A 3GZ5A 4LD5A 3HTUA 3LA7A 2FBHA 2KZVA 3DU5A 3ZMTA 2DDAA 4MHGA 4LMYA 1KQ9A 4Z2YA 3KP7A 4NHJA 4MO7A 1P6RA 3KETA 5F64A 4HQEA 4IHYA 1J7KA 2CFOA 1YS7A 1SVMA 3OYLA 1TQMA 3K1MA 2ZXIA 4DNCA 3LSRA 2EZHA 2K40A 1E3PA 2K86A 2E2JJ 1GXQA 5CYVA 3DF8A 1MSFC 3REOA 3W6JB 4EMSA 1HLVA 4BEHA 1B4AA 3HHHA 5ICEA 3BY6A 4D7MA 1XCBA 6PAXA 2BYVE 3DKXA 3OR2C 4C30A 3KEQA 2NVUB 2CS3A 2DAOA 5J1YA 4AVPA 2DBBA 3OV8A 3GTQJ 2VJIA 1D0XA 2Z5UA 4A3EJ 1TZLA 1QZYA 1JHFA 2Q1ZB 3ZMUA 1NH3A 4HX7A 1FWZA 4LK1F 3S2HJ 3I4PA 1P9QC 1UG2A 3GBGA 1VQMI 3Q9VA 2ZMEA 3OIQA 4UV9A 4B48A 1S7EA 4DIQA 2ZB9A 4KNYA 1SMTA 2X0LA 2ISYA 3A01B 2WB1A 1EH6A 2M8GX 2OPTA 2EQRA 3C2BA 4XOTA 2W25A 2M8EA 2JA7J 1YIJI 1S5LC 2LRDA 4F52A 2DFEA 4F3QA 2V79A 1X2NA 4NQWB 3ZQHA 5LHIA 2O3FA 1RI7A 1W36C 2STWA 1PJRA 4Z6YA 3V7CA 4E4HA 5K1YA 4WX9A 5JI6A 1BM9A 3Q3SA 3FWEA 1BA5A 3A0HC 3KP3A 3CMAI 1H8AC 2A5YB 3Q0VA 5EGOB 1YJ9I 3EUHC 4GFBA 2JA6J 3U1DA 3V8JA 3BZ6A 4NC6A 3ZMZA 3H3UA 3OYDA 4CH7A 1IV8A 5HLHA 1K83J 2ZBKA 5H6RA 4DOZA 4FQGA 2VC1A 4I98B 2DA3A 2FX0A 3EQLF 2B9SA 1XSDA 3KP6A 3FKIJ 4I76A 3CUQA 4RAZA 1H88C 5HS8A 4TV7A 5FFZA 5BNGA 1GLNA 4KT6A 2OCEA 4IPAA 4DBRA 3K4KA 3BZCA 3SJMA 3MKWB 2OD5A 4BEHB 4A3KJ 4GGGA 5FLMJ 4KN7X 4O6JA 5H20A 2IEKA 5J8CA 3HIFA 3LSTA 3V8KA 2MC4A 1TWHJ 1XDSA 4KYWA 4UNOA 4EGYA 4IO9F 2VOOA 3BTIA 2KMUA 2OF7A 1FSHA 4BGDA 3FF5A 5EEGA 1D1AA 2ZKZA 5DM7F 1Z3XA 4U7DA 2YSRA 4LB6B 1U5TC 5DTDA 4MTDA 4FCYA 4A69C 4W97A 2AQEA 2DOFA 4XKBA 5B5EC 5TGTA 4A3LJ 3MAJA 1Y6IA 5IP7J 2K3FA 3FXOA 2CV2A 2EA4A 2JUCA 3CMMA 1SFKA 4PJ0C 2RVCA 2R5ZA 3HB9A 2XV4S 1VQPI 1SMYF 4ABZA 2DW4A 1P2FA 2MD5A 1S8NA 3FMQA 4ZC3A 3VYTB 1LFBA 3MZ8A 3JR9A 2WB1N 3AL0B 1T8IA 3K69A 1LJ9A 2OZ6A 3BJ6A 2R7VA 1FX7A 1AU7A 4LOCA 2M34A 2QCOA 4BQAA 3G6EI 1IG7A 2PBIA 3OYAA 5FO5A 3CCUI 2KIMA 1G59A 4RLFA 4ZYAA 4PK4A 1LPQA 3MFKA 1U3EM 1A36A 1TT0A 1DP7P 2E71A 2HOEA 2LY9A 2O8XA 4G12A 4DJAA 1WKMA 1KONA 3I3LA 3JRDA 3DBHB 4II3A 4IJAA 3U9GA 2G7HA 2EV6A 3W6VA 1F43A 2KISA 1X3ZB 2HQRA 3GUDA 2P0WA 4N9IA 4F55A 1LEBA 2A6EF 2JPBA 1MD0A 3GTKJ 3CF2A 1UHMA 4HX4A 5DDGA 2COBA 2D2WA 2LDUA 2LG4A 2NOJB 2CFXA 1V5EA 2DT7B 2I10A 4ZTJA 2Q2EA 1O3SA 2OQRA 3VFZA 2JA5J 2BVLA 4JX5A 3HBLA 3VEPA 1YW7A 2HTSA 2ME6A 5JR3A 1ETXA 2M0CA 3O3KA 3S1MJ 1RPWA 4KN4X 3I59A 2HNHA 2XVCA 4HX8A 4L5JA 5EEHA 3RYRA 4DZPA 5E3NA 2VBYA 2M87A 2DFHA 4A12A 1WI9A 4AIHA 4XLPF 2ZSIB 2Z2SB 2DMQA 3M3YJ 3C1DA 2CG4A 2EZIA 3BR3A 5AIQA 1TQPA 4B47A 2QQAA 2R5ZB 1I50J 1YHQI 4V2GA 4AYBA 4RAFA 1WQ2A 1IW7F 2VQCA 2EFOA 2X9DA 5L3FA 1U8RA 1LVAA 1R4MB 1I6HJ 4ESBA 1VTNC 2PLYA 1Z6TA 3G71I 1MBJA 2VKVA 2RN7A 4OIRF 2LBFA 3PL8A 4NC7A 5FLXZ 1X1CA 4PJNA 1JJ8C 3F8BA 1KQ8A 2XAJA 4PJLA 4U0VA 1X1DA 4IOCF 2HR3A 4XOPA 2OTJI 1R5GA 3PUBA 1GHCA 4QPOA 3MCZA 1TT5B 1HBXG 4JK1X 3I64A 3GFMA 1P4WA 3FXUA 3GW2A 1ZRCA 3H0DA 3PNVA 3LWFA 3ZRGA 3BG6A 4B43A 3BG9A 5B66C 2V1UA 3AG2H 1H9TA 2P7CB 3DBLB 1LQ1A 4C3HJ 4I99C 4JQFA 3RKXA 2DYRH 3I71A 3T1BA 2DLLA 1XS9A 4HQMA 1FOWA 4M3EA 3V7SA 2NOGA 2BY2A 3OMYA 3TW6A 2QM3A 2CWEA 4EJOA 2HS5A 5AIPA 1YW8A 2A6TA 2D45A 2VKEA 2Q2EB 4XL9A 3OYHA 1O3TA 1IN8A 4RB3C 3O2PE 2ZJQF 2CYYA 1HC8A 1R1TA 2LR8A 3MEXA 4D5CA 2XPUA 5EDNA 4ZZLA 4HDUA 3J7AY 2Y9YA 2NXNB 3GXOA 3TGNA 1IC8A 1QHGA 1X1AA 2AXTC 2YU3A 4JOMA 3WHBA 3BTLA 1HDPA 4BXUA 1W36D 1U9NA 2BY0A 3F6VA 3SFZA 4RDUA 1LE8A 1F1ZA 5GTHC 2R92J 1BL0A 1JGSA 1APLC 1RNLA 1YO5C 5C4XJ 1QVTA 4UB6C 3BT9A 2NYXA 4NC8A 1NK3P 2KRCA 2K7LA 3K4MA 1ZLKA 3AL0C 2EIJH 5CJ9A 1W0UA 4KIBA 3PIPF 1R36A 2OV7A 4F93B 3WTTC 2NVTJ 2CO5A 3I53A 1BR1A 1T95A 4AYBN 3FM5A 3CMEI 1J75A 1DPUA 4XORA 1VQ4I 2LSOA 3FXQA 1IDYA 5CLSA 2DA4A 3H35A 3WHCA 3J81Z 4RGUA 4CUGA 4OAZA 1ZKGA 1XD7A 1W7PD 5ILVA 2X4HA 2HXIA 3CC2I 1R4NB 5FLVA 2XUBA 3RI4A 4QPQA 1J09A 1JTXA 4HOBA 3CUQC 5E1WA 5K5OA 4UVCA 4A0ZA 3BTCA 2V6CA 4KT5C 4B1RA 2VODA 5IYCJ 4WXCA 2H94A 2O5RA 1W5TA 3IAS2 1D1CA 4CYDA 5J4YA 3PNTA 5KAIC 3CF5F 2RKHA 2VC0A 4PFPA 2HXOA 1B72A 1C0WA 5D8KB 4LG0B 3CP2A 4FE7A 1T08B 2ZJRF 1O7LA 2K9MA 2X51A 3ISPA 5B1BH 1R49A 4M6XA 2HGCA 3HHGA 2EA2A 1ZLJA 2M3AA 3QU6A 1SFUA 3R0AA 1JKQC 5BQTA 1A31A 2K02A 2LY1A 3LAJA 1VQKI 2JA2A 2MC3A 4FE4A 5HDKA 5IT9K 3WODF 2XRLA 5IT9Z 2HWVA 2DJNA 2H6CA 2JMWA 4UVBA 5E3MA 2ZNZA 1QQIA 3S2WA 4IZZA 4UUSB 1QU3A 2M5WA 3FZVA 3AKZA 3BCBA 4IOAF 2MW8A 2EZLA 1XMXA 2A69F 3IWZA 4BY7J 2DDBA 4BU2A 3G2BA 3B6AA 2WY8Q 3HSFA 2IS1A 4ETSA 2NNNA 2M7AA 3F8NA 1FOKA 3OSFA 3CC7I 3LL7A 1N78A 3MVPA 2KJBA 1SD7A 2X1EA 5JLXA 2P5KA 3I55I 2LLKA 3GF2A 3EUHA 3PUFA 5GP9A 4CYCA 1R23A 1R00A 5J4VA 4YFNF 3IH3A 3ESWB 1ZREA 5A2QK 3D1NI 4XQFA 2HTJA 4MEYF 3DEWA 1UFMA 3DP7A 4RAYA 4B3XA 2DT5A 2QQ9A 2WAFA 1BJAA 2XB5A 4I7HA 1HW1A 3HOYJ 1ZG1A 2KJCA 2BHYA 2CSOA 3SFIA 5JHUA 1S3JA 1G8XA 3K2ZA 3KYCB 4UHTA 1MJBA 2BHZA 2FNPA 1W7PA 4YIIA 3JTGA 1V5FA 3HXLA 2OBPA 3TO9A 3FIWA 5F1JA 3FK6A 1D8KA 3PQKA 4UXNA 4A0XA 2W00A 2BV6A 4OINF 2X48A 1LB2A 1ORKA 1ZTRA 4HSRA 3GTOJ 1G3WA 2P5LC 3RKQA 1K4TA 2CQNA 3RJPA 4EJUA 2BGCA 2VONA 4ESJA 3CZ6A 1MIJA 1VQOI 4V2FA 3RZDJ 1U5TA 1WVRA 2PJRA 3ULQB 1J9IA 3W6KB 1I1GA 2WA0A 4LGWA 3L7WA 3A02A 2GZWA 1F4KA 3EYYA 2L7MP 3KZZA 3O8GA 2OCCH 5E1XA 3HOZJ 1SEUA 3HPHA 1V4RA 2IAIA 1R71A 2FXAA 1XMKA 1U9OA 2M9HA 4A5NA 1PYVA 3ASNH 2XPVA 2IGOA 1MH3A 3T8TA 5FD6A 1HKTA 2NS7A 2J5PA 3IL2A 4GYIA 2R7RA 5E8IA 2HDWA 2DMNA 1X3UA 2HKXA 2L3DA 4CYCB 1YX3A 1MBEA 3DTIA 5M5WJ 2B63J 4BJ5C 2VPRA 3H5RA 3P9CA 3GFLA 3M8FA 2JVGA 3F8CA 3BP8A 4JX4A 1WJBA 3LSKA 1OQYA 2E1OA 3EYIA 3R61A 2DTRA 1AWCA 1I5ZA 4IVNA 3TMOA 1MZBA 3H5AA 2Y0MA 2GLOA 1W7PB 4Y4RA 2JRMA 2X6OA 2FD5A 2BBYA 2BE5F 4G6DA 5FJ8J 1OCPA 4ENJA 3B02A 4RM2A 2E7XA 2H1KA 2QBYB 1BW5A 1G2HA 5D6EA 5F0FA 2CW8A 1STZA 4L0YB 4PDKA 3C18A 1RUNA 5JHFA 2YS9A 3S3MA 4XN3A 1ZELA 1W1WE 2CV1A 5FROA 1WJEA 3ZOBA 4MNUA 2FU4A 5HS7A 3I5UA 5D4RA 4CCNA 1EA3A 4CCJA 2NS0A 3IUOA 4HNUA 4BKXA 1WRJA 2EK5A 2L7KA 1IO2A 3ABTA 3FXLA 5DEQA 4B4CA 3WTUC 3Q5FA 4ZYEA 2ZNYA 4M9XA 2GXAA 1UJ8A 3T5XA 2L9NA 1PP7U 4EM1A 4M9SA 1IUFA 4P1WA 3M07A 1YJNI 3UKGA 4XMYA 2XAQA 3DPLC 5FKMA 1XTAA 2VASA 3RTRA 2K27A 1TL8A 2V9KA 1KU2A 1EH8A 1T0FA 2FJ1A 1MJAA 5E1ZB 4NQWA 3CTAA 1BR4A 3CCVI 3A03A 4KISA 2G9WA 1EF4A 3BG7A 2AS5F 1YIOA 4LJZF 3B6CA 3ZN0A 3BR5A 4C2MJ 3BJOA 3HJEA 1Y56A 4WXHA 2HQ5A 1OYYA 3DWLE 4XSXF 2JK3A 4CCMA 1ZN2A 5BMZA 1FNNA 3HTSB 2R93J 2ZCWA 3HUGB 3ERMA 2EB7A 3CCJI 3ZQLA 4LLLA 4UVAA 3CJTB 1A5JA 2Z16A 1U78A 4I01A 1P7JA 5ED4A 1WHUA 1R7JA 2AHQA 2COMA 3FX3A 2CW7A 2E2HJ 2GWRA 1BN5A 1XN7A 2W85A 3N05A 5HNFA 3J80K 2UUZA 2EFPA 2GBYA 2XF5A 3BLYA 5FRNA 3I4NJ 4NNJA 4EGZA 3CD6I 1MBKA 5LGTA 2W7NA 2GM4A 1IN7A 1D5YA 2GOXB 2NVXJ 1CQTA 2VE8A 1TW2A 4A6DA 1YJWI 5CVVA 2Y75A 2QGUA 3HSEA 1REPC 1VQLI 3BROA 5M3MJ 4HRIA 4ESFA 3KFWX 4C3JJ 4B44A 4X6AJ 2P6TA 2VI6A 3JRFA 1TWAJ 4XBFA 3TP3A 2QQBA 2DFIA 1CF7A 2QF7A 4HW0A 3W3CA 2VN2A 3PM1A 5KHDA 1MBFA 2F5FA 2O03A 1MNEA 4Q47A 1G6NA 5D5XB 3R0JA 3IH2A 3U21A 3LSHA 3OYEA 3G73A 1SFOJ 3GFJA 2E35A 1EV7A 4MFDA 2DCEA 1FLIA 1YQAA 1ETWA 2Y31A 4BE0A 2QSGX 1P7IA 1OISA 2GQQA 3E6CC 2CH0A 2PJPA 4DZJA 5FKLA 1MNDA 2I5UA 4BY1J 2ID3A 1QZZA 3OL4A 2PG4A 4Q48A 3IRRA 2AQFA 4J19A 3GTLJ 1KQ0A 4LLGF 4A3DJ 2PMUA 1YG2A 2Z99A 3PO2J 2ACJA 4KICA 1JXSA 4AM3A 2RREA 2H09A 3KYDB 5E18F 2A3SA 4PSWA 1QNTA 3D0SA 3E5QA 1B9NA 2XSJC 2E5NA 3E6DA 4M3FA 2X1CA 3VSLA 2VB6A 5CVJA 1OCCH 3GVAA 2DMTA 4LG3A 2OU2A 3LFUA 3ZQGA 3CLQA 2R4GA 3HOTA 4DYRA 1JKRC 1ODDA 1YE9A 1Z77A 4BUPA 1TWGJ 3WTXC 4CICA 2AO9A 5HLTA 4BHBA 1DDNA 4BH9A 3K6GA 4M71A 1JE8A 3ZMDA 3WG7H 1VQ7I 4MTEA 2O61A 4NB5A 5ICFA 2MLKA 3C3WA 1NG6A 2WTEA 3LSMA 2PMHA 2F6CA 2UWMA 4P5OA 4BQNA 2CUZA 1U6GA 5IPAA 4LB5A 3NAUA 1FP2A 2IVMA 3L2WA 1CGPA 3D5RC 5HLGA 5EJCA 4EJTA 2KP6A 1XPXA 4RAGA 1EKEA 3P9KA 3CLOA 1OCTC 2XGCA 2DMUA 2XROA 2E1NA 1CF7B 2LMDA 3LQRA 4MGRA 2L02A 3H1CA 5LLQA 1G3YA 5LRSA 2CQXA 3F6OA 4WWCA 2KHMA 4AUXA 1WSUA 4BQOA 2W82A 1ZYRF 3U1KA 3WE2A 3OYBA 2TDXA 3S17J 1OCZH 1Z21A 5J6XA 1S7AA 3ROUA 2XB0X 1GV5A 1B59A 5F08A 1TLHB 5DYMA 2ADUA 3R4KA 1QRYA 3FKJA 1FJLA 3BG3A 1B9MA 1DP3A 4GO1A 3NARA 3H5NA 1QHHD 3FMSA 4WXDA 4CA0A 1K6YA 3S15J 4QLCU 2V1DA 3BZKA 1MDMA 1X3WB 2PMZA 4ZDOA 2VT3A 4HPQA 3JRIA 3S2DJ 4Y15A 9ANTA 2YPRA 4QIWN 5DCFA 3NQOA 3TO6A 5HDNA 3S32A 5E3OA 3F0CA 3OYIA 3CCMI 1ZR4A 4LLNA 2GIVA 3J7ZI 5JVTA 3CDHA 2O0YA 3WG9A 1TWFJ 5K7ZA 1N75A 3OR1C 3D5LA 3QPSA 1BBYA 3HRUA 4BHPA 5M3FJ 2DA7A 2HPIA 5K7FA 3SZGA 1NTCA 4XSZF 4HSTA 2TCTA 5KNLA 1D5VA 1QA6A 3IHUA 4XLFA 1Z1DA 3DEUA 3ZQIA 1SVOA 1FZPB 4E7JA 4S04A 3HOWJ 5BPDA 4Y13A 1E3HA 4BL0B 2E36A 3MWMA 2L4AA 3F21A 1BIAA 2EIMH 4KDPA 2HVRA 1WWXA 3C7JA 2O8KA 2VXZA 1YITI 4N4NB 3OYFA 2Y48A 4J01A 2CW0F 1TBXA 4AD9A 2F5CA 3V4GA 3OIOA 5LD2C 1ITYA 4PJJA 5HODA 2FE3A 1IXRC 2JT1A 2NVYJ 1WPKA 3MMYB 1MMAA 4BHCA 1XGNA 1JUMA 5J40A 3GLXA 2VLAA 2CQ7A 2M45A 4BJTA 3KLOA 1YS6A 3DXJF 5HLIA 1IZ1A 4EEFG 1ZRFA 1R5ID 1WH7A 3GEZA 3NEUA 2H8RA 1IAWA 4IHTA 2OQGA 4XKWA 5J1UA 4FASD 1IN5A 1T0FC 4FX4A 2C6YA 2XSDC 2KIQA 2FOKA 2H8WA 4CCKA 1HOMA 3JRHA 1T38A 4IHSA 3TBIA 3SDBA 5DUIA 1XSXA 2LREA 5LGNA 4G6TB 3HG9A 1IXCA 1MDMB 3SQNA 3S93A 5H6QA 2H1LA 1RRJA 4ZZDA 5CQEA 4G6QA 1Y8RB 4YFKF 2OJED 3R6SA 1YTYA 2CU7A 5FFXA 3M8JA 1UHWA 1XGSA 5CPRB 2HDCA 2X6WA 4II2A 3E5XA 2KL4A 4X1EA 1ZARA 3Q9SA 4ASNA 4IRGA 2PMZN 2FSWA 2YU9J 2L7ZA 4J00A 1ZHFA 2K9LA 1RUOA 2QUFA 3FXRA 4IEJA 4XR6A 2IA0A 2MG4A 3RCOA 2O9LA 4ON0A 1Y39A 3JCUC 5ERIA 1VQ8I 2E34A 2J5OA 3L00A 3F9KA 1RIOH 4LG0A 5LGUA 4RB2C 3WTWC 2WAQA 4P55A 4XONA 3QPTA 5K5RA 3VB2A 3K7AJ 3BQZA 2CQKA 1BI2A 3DTEA 3VSKA 3SZTA 1SFEA 1P92A 4HAMA 2HZDA 2IS6A 2MD0A 1A04A 4F7ZA 1DGRM 2RQQA 1RZ4A 1BI1A 3K70C 4M3GA 1Z6RA 1FYKA 1L0OC 3BQYA 5DS9A 1KYWA 4M3BA 2K9QA 3CDIA 2A07F 3B73A 4CSWA 4AIJA 1ENHA 3BJAA 1K78A 4UUSA 2KPMA 2YX7A 4A3JJ 1E3OC 3RKYA 5ILUA 1SD4A 5GTIC 5C44J 2QENA 3KP5A 4D5FA 1H89C 5FKNA 4IKFA 3QPHA 3UR3C 4XK4A 3C2HA 1GV2A 3M4OJ 4BBSJ 5JVGF 2F5EA 5CKTA 4A6EA 3GX4X 1X2MA 4H4KC 2R3SA 5LFAA 1BC8C 3HL2A 4O5VA 5CVIA 5FKKA 1IV6A 2BW3B 4AU7A 4CO8A 4EJWA 1IUYA 1VI0A 3WGIA 4HV5A 4G94A 3E5UA 2DO7A 1XGMA 4OAYA 4PGHA 3SYTA 2FF4A 3JREA 2JZYA 2VE9A 4E7ZA 3RSNA 1NK2P 3EPZA 5D5VB 5TISC 5IY5H 1P4XA 2ZSHB 2GAUA 4P9UA 4MQ9F 3K4NA 4YFXF 3N4MA 3OYMA 1GDTA 1JJ6C 2V9VA 2JTVA 5E20A 3JSPA 3JRBA 4HF0A 4XRFA 4MLOA 3OS1A 1PUFA 1Y8QB 1MW7A 2A61A 4AVZA 4HZFA 1VFCA 1IRGA 3I58A 1M1EB 2M4KA 3DLAA 4IL6C 2ZO4A 3GFIA 1DGWY 2R7FA 4HLYA 5LHHA 2FQ4A 4KMUX 5BS6A 4CZCA 2LKXA 2DPDA 5FKOA 1VNDA 1R22A 1FT9A 3L09A 5BPIA 3FISA 3LA3A 2VBXA 1GT0C 3GTGJ 4FT8A 1KGSA 2FNAA 2EFNA 3PJRA 3ASOH 2DFFA 2M4GA 2A5WA 2QSFX 5L3BA 3IAM2 3GZNB 1E0EA 1R58A 2WAQN 2QZ8A 3VYSB 5F0CA 3A2KA 3H9GA 4QSHA 2XAGA 3GZ6A 3DBRB 3CDLA 2JSPA 2F48A 2KIUA 4BDYA 2OAZA 3C2GA 3PFIA 4N4OB 2IGMA 4CXFA 3HEFA 3WU0A 4KITB 1K78B 2ZXHA 5F1RA 3WTVC 3VYUB 3HRSA 4B8XA 2FBKA 1LDJA 3MKLA 1R1UA 1T2KA 2L0KA 5DV5A 2Q8KA 3JRGA 4BYYA 3RDIA 2XAFA 2GA2A 5HNHA 2DODA 5J47A 1IGNA 4BXXJ 3TEDA 4G7OF 1BOBA 2YUSA 3AFHA 4OIQF 1IN4A 3M7GA 3KP2A 3O8HA 1POGA 2HQNA 3CP8A 2MH2A 1JT0A 2WBMA 1KYZA 4A2UA 4HNVA 2JVHA 1D0YA 4HA8A 1BI0A 4GXOA 4AC0A 4B09A 3QYFA 1XDUA 4G7ZF 1O7FA 3AG1H 3E6BA 1O3QA 1FMWA 5GAEJ 2FBIA 5A2QZ 2G7UA 4KA4A 3E1SA 4ITVA 2FA5A 4IF4A 1HF0A 2VJJA 3BPXA 4E70A 5L3EA 1IJWC 5EEAA 1PUFB 2EV5A 3QWLA 3S1RJ 1UHSA 3RPQA 5ILSA 2JUGA 2KDOA 3T0YA 4FISA 1X1BA 3D5SC 3H36A 1Z05A 4GYGA 4XRSA 5TRDA 1PUEE 3WTZA 3DQVC 2QBYA 2PN6A 3P7NA 4N0BA 4MIMA 2ZXWH
chains in the Genus database with same CATH topology
1FSEA 4WF2A 3LAPA 1BOAA 2Q0OA 2P4WA 1ZG5A 4YIFA 5LBQA 4ZYDA 1J59A 4CDGA 1OPCA 2XASA 4I2OA 5DD8A 1EH7A 3HRTA 4HLXA 1TTYA 1LNWA 4EVIA 3H92A 3F3XA 3KP4A 4L9VA 2QYOA 2EJRA 5HS9A 4PZJA 4CZZA 3HRMA 5ICGA 2KKOA 1SD6A 3IKTA 4GCVA 3FMRA 1K79A 3F8FA 3HUGA 2FQ3A 4EQQA 3RKWA 4XLNF 2OZUA 4OU0A 4ZYGA 4UV8A 1I27A 2FMLA 2XIGA 1H9GA 5HDGA 2W57A 3HSRA 1ON2A 3NRVA 1OKRA 1P4AA 3G3ZA 3QU3A 4A5MA 1L3LA 2HFHA 3BOQA 1TW3A 1QBJA 5FD5A 3LQQA 5HVQC 3L2CA 4MQVA 5L3CA 3WGHA 2A6HF 2DU9A 5FB2A 4ZH4F 1OYIA 4R1HA 2VBWA 4JBAA 4FHTA 2FMYA 1G4DA 2L01A 3RPUA 2FRHA 4RGSA 1Q1HA 2FEZA 4DQ2A 3ZQ7A 1J2XA 3ELKA 1KU9A 3DPTA 4FX0A 4U7BA 1FPQA 2RGVA 1W5SA 1D8JA 1T6SA 5DD4A 2K4JA 3J80Z 1ZRDA 4I09A 2EV0A 5DCMB 3ECHA 4ENKA 5E8GA 2LKPA 3KZYA 1FC3A 1Z91A 1HXDA 1FBUA 2R7DA 1HKQA 2WV0A 1ON1A 2D1HA 2H27A 4KMFA 2ZFWA 2E1CA 4HF2A 3I54A 4M72A 4L0ZB 1B6AA 2JPCA 1XSVA 4OOIA 3GYHX 2PQ8A 3F8MA 1W4MA 1KU3A 2MH9A 3QOPA 4LK0F 2UXXA 5L3GA 1AOYA 2YX4A 4L5IA 1Z9CA 3TOAA 4L9TA 3M8EA 1IXSB 2NRAC 1S29A 5LHGA 4Y17A 3H3ZA 1S6LA 2L54A 2Z9OA 4U88A 3DKWA 2GXGA 3IC7A 2A68F 2IRFG 1ZH5A 4P96A 2IA1A 4RS8A 2Z3YA 3HYIA 3HOSA 1E17A 4CHUA 1HW5A 2KRFA 2RV8A 5CVRA 3K0LA 4ENMA 2QLZA 3WTYC 3E3VA 3T8RA 1FY7A 4QWQA 1FBSA 3TO7A 3ZN1A 5LEJA 1F5TA 3TKYA 1T98A 3TDUC 3N97A 2ZMEB 3KEOA 3QP5A 2HEOA 1JHHA 1OR7A 2RC4A 2KIFA 1QGPA 4EJVA 3VOEA 1XCVA 1LDKB 1ONVA 2DK8A 1MJ9A 4I0BA 2BEOA 3CJNA 4G9YA 4D0PA 2DQLA 3DV8A 1K6OA 2P5VA 1QPMA 4UUVA 5LEKA 1K7AA 1HSJA 4G8XA 2F5DA 1SAXA 3IRQA 4L9NA 2EWNA 4OMYA 2YR2A 2OA4A 5D5UB 1IF1A 2ETHA 3JTHA 3RIRA 4HV6A 4Q4ZF 3CUQB 2ELHA 1G3TA 4S05A 2XGXA 1IN6A 3ECOA 4M6YA 4R79A 4L18B 4M74A 2RDPA 2H6BA 3V7RA 2DQRA 1D3YA 2ISZA 4A0YA 2UXNA 3GO5A 2DPUA 1XGOA 4EM2A 1DPRA 1H0MA 2PEXA 5D5WB 3MZHA 1G3SA 2Z33A 1O3RA 3TOBA 3K1PA 3L9FA 2HZTA 4RB0A 1OMIA 3FHZA 5CVUA 4PGGA 4U0WA 1U2WA 1BI3A 2V1XA 4KIFA 1FBQA 1I1SA 1O57A 2ZJ2A 3COAC 5FLXK 4K2EA 2IPQX 3O6BB 4HYEA 3SXYA 4OIPF 1XMAA 4OIOF 1MKMA 2HKOA 4RGRA 3QRFF 2HYFA 2XKOA 3TDZC 4HDVA 3K9TA 4ZYHA 1TQIA 4U0YA 3MQ0A 1BC7C 1S7OA 2W24A 4PCQA 1E2XA 4ENNA 5L3DA 3V8LA 5LRRA 3WGGA 3R60A 5D6FA 1KU7A 4YG2F 1SFXA 2P6SA 3OOPA 4IRHA 5E17F 2EFQA 3I59B 5KVRA 3WU1B 4HBLA 2IA2A 4AWXB 3WTSC 3LA2A 2QVOA 4BAYA 3PQJA 4HF1A 5BOXA 5DUKA 2QWWA 2WC2A 1IRFA 1R1VA 2XAHA 1F9NA 2W84A 2F2EA 1V3FA 1SD5A 2M30A 4EV0A 1BIBA 2ESNA 4H0EA 1KA8A 2STTA 3J81K 5J8FA 1ULYA 3EDPA 4Q5SF 1FYLA 2LNBA 4I0AA 3BDDA 2LF8A 2E7WA 2HYGD 3IWFA 5AONA 3U2RA 2L4MA 1T39A 3ERED 2NNYA 5ICCA 2GA1A 2PFBA 3ML6A 4R8HA 2VBZA 1ZG3A 3BPVA 1Y0UA 1YW9A 3WE3A 3SZPA 2P7VB 4WCGA 4M9ZA 4LFUA 3F22A 4L9JA 4BNCA 3LFKA 3CO6C 4CGZA 3JSOA 2MBFA 1TNSA 5JFRA 3M9AA 2M1BA 1MGTA 2RNJA 2GXBA 4EM0B 4IRIA 3TQNA 3E97A 3J7AO 4RB1A 2WWYA 4AIKA 1YFHA 2MA3A 3JW4A 1YLFA 5K5QA 3I0TA 5HOOA 2AXLA 2DK5A 3JAMK 3IKVA 1ZGAA 3JAMZ 3SHFA 1QO0D 3DFGA 1YYVA 5IT3A 3VODA 4M73A 3KCCA 3ZPLA 3ZMSA 1NHAA 3ZMVA 4O3MA 4MEXF 2K4BA 4OMZA 5TJJA 1USSA 2JSCA 3CUOA 2IT0A 3CO7C 4G7HF 2XHKA 3F23A 3QAHA 4KFCA 2ESHA 2ZXJA 4I02A 1PDNC 2VOPA 2EFWA 2D1VA 4KIGA 3AAFA 1ZAOA 2MLGA 2IP2A 5FGMA 1J0RA 2NAZA 3BWGA 1ZGJA 4RGXA 3FM3A 3M1EA 1USTA 1J5YA 2XKPA 1FP1D 1GXPA 3F72A 1HKSA 3MZYA 5DCMA 3KLNA 1R5HA 1GVJA 4N9HA 1FYMA 1DUXC 2O6GE 2RQPA 3KE2A 2IW5A 3EETA 1UB9A 2VT2A 3QP6A 1I6XA 2JRTA 4P9FA 4IXAA 5F6FA 5KK1A 1PP8F 1HSTA 3GWZA 3RYPA 4KUMA 1B1BA 1OYWA 1HQCA 5D4SA 4WK8F 1U5TB 3E6MA 3ABUA 1TNTA 2XRNA 3K1NA 3P9IA 5D8LB 1LEAA 2LF7A 1XB4A 3ZP5A 1Z7UA 1UCRA 1LDDA 2P8TA 1HW2A 2UZKA 2B0LA 2PI0A 2CGPA 2IJLA 2DI3A 3GZ5A 4LD5A 3HTUA 3LA7A 2FBHA 3ZMTA 4MHGA 4LMYA 1KQ9A 4Z2YA 3KP7A 4NHJA 1P6RA 3KETA 5F64A 4HQEA 1J7KA 1YS7A 1TQMA 3K1MA 4DNCA 2K86A 1GXQA 5CYVA 3DF8A 3REOA 3W6JB 4EMSA 1B4AA 3HHHA 5ICEA 3BY6A 1XCBA 6PAXA 2BYVE 3KEQA 2DAOA 4AVPA 2DBBA 3OV8A 2Z5UA 1QZYA 1JHFA 3ZMUA 4HX7A 1FWZA 4LK1F 3I4PA 3Q9VA 2ZMEA 4UV9A 4KNYA 1SMTA 2X0LA 2ISYA 1EH6A 2W25A 2M8EA 2V79A 5LHIA 2O3FA 1RI7A 2STWA 3V7CA 4WX9A 5K1YA 5JI6A 1BM9A 3FWEA 3KP3A 2A5YB 3U1DA 3V8JA 3BZ6A 3ZMZA 3H3UA 5HLHA 2ZBKA 5H6RA 2VC1A 4I98B 3EQLF 1XSDA 3KP6A 3CUQA 4RAZA 5HS8A 4TV7A 5FFZA 4IPAA 2OD5A 4GGGA 4KN7X 4O6JA 5H20A 5J8CA 3HIFA 3LSTA 3V8KA 1XDSA 4KYWA 4UNOA 4EGYA 2VOOA 1FSHA 3FF5A 5EEGA 2ZKZA 4U7DA 2YSRA 4LB6B 1U5TC 4MTDA 3MAJA 2EA4A 2RVCA 2XV4S 1SMYF 2DW4A 1P2FA 2MD5A 1S8NA 3FMQA 3K69A 1LJ9A 2OZ6A 3BJ6A 1FX7A 4BQAA 2PBIA 5FO5A 2KIMA 3MFKA 1U3EM 1DP7P 2HOEA 2O8XA 1WKMA 4IJAA 3U9GA 2G7HA 2EV6A 2HQRA 3GUDA 4N9IA 1LEBA 2A6EF 2JPBA 1MD0A 1UHMA 5DDGA 4HX4A 2D2WA 2LDUA 2CFXA 2Q2EA 1O3SA 2OQRA 3VFZA 3VEPA 1YW7A 2HTSA 5JR3A 3O3KA 4KN4X 3I59A 2XVCA 4HX8A 4L5JA 5EEHA 3RYRA 2VBYA 2M87A 4A12A 1WI9A 4AIHA 4XLPF 3C1DA 2CG4A 5AIQA 1TQPA 2QQAA 1WQ2A 1IW7F 2EFOA 5L3FA 1U8RA 1LVAA 4ESBA 1VTNC 2PLYA 1Z6TA 2RN7A 4OIRF 5FLXZ 1KQ8A 3F8BA 2XAJA 4U0VA 2HR3A 1R5GA 1GHCA 3MCZA 1HBXG 4JK1X 3I64A 3GFMA 1P4WA 3FXUA 3GW2A 1ZRCA 3LWFA 2V1UA 1H9TA 2P7CB 1LQ1A 4JQFA 3RKXA 3I71A 3T1BA 2DLLA 4HQMA 3V7SA 2QM3A 2CWEA 4EJOA 2HS5A 5AIPA 1YW8A 2D45A 1O3TA 1IN8A 4RB3C 3O2PE 2CYYA 1R1TA 3MEXA 4ZZLA 4HDUA 3GXOA 3TGNA 2YU3A 4BXUA 3F6VA 3SFZA 1F1ZA 1JGSA 1RNLA 1YO5C 2NYXA 2K7LA 1ZLKA 5CJ9A 4KIBA 1R36A 3WTTC 2CO5A 3I53A 3FM5A 1J75A 1DPUA 2LSOA 3FXQA 5CLSA 3J81Z 4RGUA 1XD7A 1W7PD 5ILVA 2X4HA 2XUBA 3RI4A 4HOBA 3CUQC 5E1WA 5K5OA 4UVCA 4A0ZA 2V6CA 4KT5C 2VODA 4WXCA 2H94A 1W5TA 4CYDA 2RKHA 2VC0A 1C0WA 4LG0B 1O7LA 3ISPA 4M6XA 2HGCA 3HHGA 2EA2A 1ZLJA 3QU6A 1SFUA 3R0AA 5BQTA 2K02A 3LAJA 2MC3A 5HDKA 5IT9K 3WODF 5IT9Z 2HWVA 2H6CA 4UVBA 2ZNZA 1QQIA 3S2WA 2M5WA 3FZVA 2A69F 3IWZA 3HSFA 4ETSA 2NNNA 3F8NA 1FOKA 2KJBA 1SD7A 2P5KA 3GF2A 3EUHA 1R23A 1R00A 4YFNF 1ZREA 5A2QK 2HTJA 4MEYF 3DP7A 1UFMA 4RAYA 2DT5A 2QQ9A 1BJAA 4I7HA 1HW1A 1ZG1A 2KJCA 2CSOA 5JHUA 1S3JA 3K2ZA 4UHTA 1MJBA 2FNPA 1W7PA 4YIIA 3JTGA 2OBPA 3TO9A 1D8KA 3PQKA 4UXNA 4A0XA 2BV6A 4OINF 1LB2A 1G3WA 2P5LC 3RJPA 4EJUA 2BGCA 2VONA 4ESJA 1U5TA 3ULQB 1J9IA 3W6KB 1I1GA 4LGWA 3L7WA 2GZWA 1F4KA 3EYYA 3KZZA 5E1XA 1V4RA 2FXAA 1XMKA 4A5NA 3T8TA 5FD6A 1HKTA 2J5PA 3IL2A 4GYIA 5E8IA 1X3UA 2HKXA 2L3DA 3P9CA 3GFLA 3M8FA 3F8CA 3BP8A 3EYIA 3R61A 2DTRA 1AWCA 1I5ZA 4IVNA 1MZBA 2Y0MA 1W7PB 2BBYA 2BE5F 4G6DA 4ENJA 2QBYB 3B02A 2E7XA 5D6EA 1STZA 4L0YB 4PDKA 3C18A 1RUNA 4MNUA 2FU4A 5HS7A 3I5UA 5D4RA 2NS0A 1WRJA 2EK5A 3ABTA 5DEQA 3WTUC 3Q5FA 4ZYEA 2ZNYA 4M9XA 3T5XA 1PP7U 4EM1A 4M9SA 2XAQA 3DPLC 3RTRA 2K27A 1KU2A 1EH8A 1T0FA 1MJAA 5E1ZB 4NQWA 3CTAA 2G9WA 2AS5F 1YIOA 4LJZF 3ZN0A 3BJOA 4WXHA 1OYYA 4XSXF 1ZN2A 5BMZA 1FNNA 3HTSB 2ZCWA 2EB7A 4LLLA 4UVAA 1U78A 4I01A 5ED4A 1R7JA 3FX3A 2COMA 2GWRA 1BN5A 1XN7A 2W85A 3J80K 2EFPA 4EGZA 5LGTA 1IN7A 2VE8A 1TW2A 4A6DA 5CVVA 2Y75A 3HSEA 1REPC 3BROA 4ESFA 3KFWX 2P6TA 4XBFA 2QQBA 2DFIA 1CF7A 4HW0A 2VN2A 2F5FA 2O03A 4Q47A 1G6NA 5D5XB 3R0JA 3G73A 3GFJA 1EV7A 1FLIA 1YQAA 2GQQA 3E6CC 2PJPA 1QZZA 2PG4A 4Q48A 3IRRA 1KQ0A 4LLGF 2PMUA 1YG2A 2Z99A 2ACJA 4KICA 1JXSA 2H09A 5E18F 2A3SA 1QNTA 3D0SA 3E5QA 1B9NA 3E6DA 5CVJA 3GVAA 2OU2A 3HOTA 1ODDA 3WTXC 4CICA 4BHBA 1DDNA 4BH9A 4M71A 1JE8A 3ZMDA 4MTEA 2O61A 4NB5A 5ICFA 2MLKA 3C3WA 2WTEA 2PMHA 2UWMA 4P5OA 4LB5A 1U6GA 1FP2A 2IVMA 1CGPA 5HLGA 4EJTA 3P9KA 3CLOA 2XROA 2E1NA 1CF7B 3LQRA 4MGRA 2L02A 5LLQA 1G3YA 5LRSA 4WWCA 3F6OA 1WSUA 3WE2A 1ZYRF 2TDXA 5J6XA 1S7AA 3ROUA 1B59A 1TLHB 5DYMA 2ADUA 3R4KA 1B9MA 4GO1A 3FMSA 4WXDA 4QLCU 2V1DA 1MDMA 2VT3A 4Y15A 2YPRA 5DCFA 3NQOA 3TO6A 5HDNA 4LLNA 2GIVA 5JVTA 3CDHA 2O0YA 3WG9A 3D5LA 1BBYA 3HRUA 4BHPA 4XSZF 1D5VA 3IHUA 1Z1DA 3DEUA 1FZPB 4S04A 5BPDA 4Y13A 3MWMA 2L4AA 3F21A 1BIAA 4KDPA 1WWXA 3C7JA 2VXZA 2Y48A 2CW0F 1TBXA 4AD9A 2F5CA 3V4GA 2FE3A 1IXRC 2JT1A 1XGNA 3GLXA 2M45A 3KLOA 1YS6A 3DXJF 5HLIA 1IZ1A 1ZRFA 3GEZA 3NEUA 1IAWA 4IHTA 2OQGA 1IN5A 4FX4A 2C6YA 2FOKA 1T38A 4IHSA 5DUIA 1XSXA 5LGNA 1IXCA 1MDMB 3SQNA 5H6QA 4ZZDA 4G6QA 4YFKF 3R6SA 1YTYA 5FFXA 1UHWA 1XGSA 2HDCA 3E5XA 1ZARA 3Q9SA 4ASNA 4IRGA 2FSWA 1ZHFA 1RUOA 2QUFA 3FXRA 2IA0A 4ON0A 5ERIA 2J5OA 3L00A 1RIOH 4LG0A 5LGUA 4RB2C 3WTWC 4P55A 3QPTA 5K5RA 3VB2A 2CQKA 1BI2A 3SZTA 1SFEA 1P92A 4HAMA 1A04A 4F7ZA 1RZ4A 1BI1A 1FYKA 1Z6RA 1L0OC 1KYWA 2A07F 3B73A 4AIJA 3BJAA 1K78A 2YX7A 3RKYA 5ILUA 1SD4A 2QENA 3KP5A 3QPHA 2F5EA 4A6EA 3GX4X 2R3SA 1BC8C 4O5VA 5CVIA 4CO8A 4EJWA 1IUYA 3WGIA 4HV5A 4G94A 3E5UA 2DO7A 1XGMA 4PGHA 2FF4A 2JZYA 2VE9A 5D5VB 1P4XA 2GAUA 4P9UA 4MQ9F 4YFXF 3N4MA 2V9VA 2JTVA 5E20A 3JSPA 4HF0A 4XRFA 2A61A 4HZFA 1IRGA 3I58A 2ZO4A 3GFIA 2R7FA 4HLYA 5LHHA 4KMUX 5BS6A 2DPDA 1R22A 1FT9A 3L09A 5BPIA 3LA3A 2VBXA 4FT8A 1KGSA 2FNAA 2EFNA 5L3BA 1R58A 2QZ8A 2XAGA 3GZ6A 2KIUA 2OAZA 3PFIA 4CXFA 3WU0A 1K78B 5F1RA 3WTVC 3HRSA 4B8XA 2FBKA 1LDJA 1R1UA 1T2KA 5DV5A 2Q8KA 4BYYA 3RDIA 2XAFA 2GA2A 4G7OF 4OIQF 1IN4A 3M7GA 3KP2A 2HQNA 2MH2A 1KYZA 4A2UA 4HA8A 1BI0A 4GXOA 4B09A 1XDUA 4G7ZF 1O7FA 3E6BA 1O3QA 5A2QZ 2FBIA 2G7UA 4KA4A 2FA5A 4IF4A 3BPXA 4E70A 5L3EA 2EV5A 3RPQA 5ILSA 3T0YA 4GYGA 5TRDA 1Z05A 1PUEE 2QBYA 3WTZA 3DQVC 2PN6A 4BHCA 3P7NA 4N0BA 5D8KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSE A;  4WF2 A;  3LAP A;  1BOA A;  2Q0O A;  2P4W A;  1ZG5 A;  4YIF A;  5LBQ A;  4ZYD A;  1J59 A;  4CDG A;  1OPC A;  2XAS A;  4I2O A;  5DD8 A;  1EH7 A;  3HRT A;  4HLX A;  1TTY A;  1LNW A;  4EVI A;  3H92 A;  3F3X A;  3KP4 A;  4L9V A;  2QYO A;  2EJR A;  5HS9 A;  4PZJ A;  4CZZ A;  3HRM A;  5ICG A;  2KKO A;  1SD6 A;  3IKT A;  4GCV A;  3FMR A;  1K79 A;  3F8F A;  3HUG A;  2FQ3 A;  4EQQ A;  3RKW A;  4XLN F;  2OZU A;  4OU0 A;  4ZYG A;  4UV8 A;  1I27 A;  2FML A;  2XIG A;  1H9G A;  5HDG A;  2W57 A;  3HSR A;  1ON2 A;  3NRV A;  1OKR A;  1P4A A;  3G3Z A;  3QU3 A;  4A5M A;  1L3L A;  2HFH A;  3BOQ A;  1TW3 A;  1QBJ A;  5FD5 A;  3LQQ A;  5HVQ C;  3L2C A;  4MQV A;  5L3C A;  3WGH A;  2A6H F;  2DU9 A;  5FB2 A;  4ZH4 F;  1OYI A;  4R1H A;  2VBW A;  4JBA A;  4FHT A;  2FMY A;  1G4D A;  2L01 A;  3RPU A;  2FRH A;  4RGS A;  1Q1H A;  2FEZ A;  4DQ2 A;  3ZQ7 A;  1J2X A;  3ELK A;  1KU9 A;  3DPT A;  4FX0 A;  4U7B A;  1FPQ A;  2RGV A;  1W5S A;  1D8J A;  1T6S A;  5DD4 A;  2K4J A;  3J80 Z;  1ZRD A;  4I09 A;  2EV0 A;  5DCM B;  3ECH A;  4ENK A;  5E8G A;  2LKP A;  3KZY A;  1FC3 A;  1Z91 A;  1HXD A;  1FBU A;  2R7D A;  1HKQ A;  2WV0 A;  1ON1 A;  2D1H A;  2H27 A;  4KMF A;  2ZFW A;  2E1C A;  4HF2 A;  3I54 A;  4M72 A;  4L0Z B;  1B6A A;  2JPC A;  1XSV A;  4OOI A;  3GYH X;  2PQ8 A;  3F8M A;  1W4M A;  1KU3 A;  2MH9 A;  3QOP A;  4LK0 F;  2UXX A;  5L3G A;  1AOY A;  2YX4 A;  4L5I A;  1Z9C A;  3TOA A;  4L9T A;  3M8E A;  1IXS B;  2NRA C;  1S29 A;  5LHG A;  4Y17 A;  3H3Z A;  1S6L A;  2L54 A;  2Z9O A;  4U88 A;  3DKW A;  2GXG A;  3IC7 A;  2A68 F;  2IRF G;  1ZH5 A;  4P96 A;  2IA1 A;  4RS8 A;  2Z3Y A;  3HYI A;  3HOS A;  1E17 A;  4CHU A;  1HW5 A;  2KRF A;  2RV8 A;  5CVR A;  3K0L A;  4ENM A;  2QLZ A;  3WTY C;  3E3V A;  3T8R A;  1FY7 A;  4QWQ A;  1FBS A;  3TO7 A;  3ZN1 A;  5LEJ A;  1F5T A;  3TKY A;  1T98 A;  3TDU C;  3N97 A;  2ZME B;  3KEO A;  3QP5 A;  2HEO A;  1JHH A;  1OR7 A;  2RC4 A;  2KIF A;  1QGP A;  4EJV A;  3VOE A;  1XCV A;  1LDK B;  1ONV A;  2DK8 A;  1MJ9 A;  4I0B A;  2BEO A;  3CJN A;  4G9Y A;  4D0P A;  2DQL A;  3DV8 A;  1K6O A;  2P5V A;  1QPM A;  4UUV A;  5LEK A;  1K7A A;  1HSJ A;  4G8X A;  2F5D A;  1SAX A;  3IRQ A;  4L9N A;  2EWN A;  4OMY A;  2YR2 A;  2OA4 A;  5D5U B;  1IF1 A;  2ETH A;  3JTH A;  3RIR A;  4HV6 A;  4Q4Z F;  3CUQ B;  2ELH A;  1G3T A;  4S05 A;  2XGX A;  1IN6 A;  3ECO A;  4M6Y A;  4R79 A;  4L18 B;  4M74 A;  2RDP A;  2H6B A;  3V7R A;  2DQR A;  1D3Y A;  2ISZ A;  4A0Y A;  2UXN A;  3GO5 A;  2DPU A;  1XGO A;  4EM2 A;  1DPR A;  1H0M A;  2PEX A;  5D5W B;  3MZH A;  1G3S A;  2Z33 A;  1O3R A;  3TOB A;  3K1P A;  3L9F A;  2HZT A;  4RB0 A;  1OMI A;  3FHZ A;  5CVU A;  4PGG A;  4U0W A;  1U2W A;  1BI3 A;  2V1X A;  4KIF A;  1FBQ A;  1I1S A;  1O57 A;  2ZJ2 A;  3COA C;  5FLX K;  4K2E A;  2IPQ X;  3O6B B;  4HYE A;  3SXY A;  4OIP F;  1XMA A;  4OIO F;  1MKM A;  2HKO A;  4RGR A;  3QRF F;  2HYF A;  2XKO A;  3TDZ C;  4HDV A;  3K9T A;  4ZYH A;  1TQI A;  4U0Y A;  3MQ0 A;  1BC7 C;  1S7O A;  2W24 A;  4PCQ A;  1E2X A;  4ENN A;  5L3D A;  3V8L A;  5LRR A;  3WGG A;  3R60 A;  5D6F A;  1KU7 A;  4YG2 F;  1SFX A;  2P6S A;  3OOP A;  4IRH A;  5E17 F;  2EFQ A;  3I59 B;  5KVR A;  3WU1 B;  4HBL A;  2IA2 A;  4AWX B;  3WTS C;  3LA2 A;  2QVO A;  4BAY A;  3PQJ A;  4HF1 A;  5BOX A;  5DUK A;  2QWW A;  2WC2 A;  1IRF A;  1R1V A;  2XAH A;  1F9N A;  2W84 A;  2F2E A;  1V3F A;  1SD5 A;  2M30 A;  4EV0 A;  1BIB A;  2ESN A;  4H0E A;  1KA8 A;  2STT A;  3J81 K;  5J8F A;  1ULY A;  3EDP A;  4Q5S F;  1FYL A;  2LNB A;  4I0A A;  3BDD A;  2LF8 A;  2E7W A;  2HYG D;  3IWF A;  5AON A;  3U2R A;  2L4M A;  1T39 A;  3ERE D;  2NNY A;  5ICC A;  2GA1 A;  2PFB A;  3ML6 A;  4R8H A;  2VBZ A;  1ZG3 A;  3BPV A;  1Y0U A;  1YW9 A;  3WE3 A;  3SZP A;  2P7V B;  4WCG A;  4M9Z A;  4LFU A;  3F22 A;  4L9J A;  4BNC A;  3LFK A;  3CO6 C;  4CGZ A;  3JSO A;  2MBF A;  1TNS A;  5JFR A;  3M9A A;  2M1B A;  1MGT A;  2RNJ A;  2GXB A;  4EM0 B;  4IRI A;  3TQN A;  3E97 A;  3J7A O;  4RB1 A;  2WWY A;  4AIK A;  1YFH A;  2MA3 A;  3JW4 A;  1YLF A;  5K5Q A;  3I0T A;  5HOO A;  2AXL A;  2DK5 A;  3JAM K;  3IKV A;  1ZGA A;  3JAM Z;  3SHF A;  1QO0 D;  3DFG A;  1YYV A;  5IT3 A;  3VOD A;  4M73 A;  3KCC A;  3ZPL A;  3ZMS A;  1NHA A;  3ZMV A;  4O3M A;  4MEX F;  2K4B A;  4OMZ A;  5TJJ A;  1USS A;  2JSC A;  3CUO A;  2IT0 A;  3CO7 C;  4G7H F;  2XHK A;  3F23 A;  3QAH A;  4KFC A;  2ESH A;  2ZXJ A;  4I02 A;  1PDN C;  2VOP A;  2EFW A;  2D1V A;  4KIG A;  3AAF A;  1ZAO A;  2MLG A;  2IP2 A;  5FGM A;  1J0R A;  2NAZ A;  3BWG A;  1ZGJ A;  4RGX A;  3FM3 A;  3M1E A;  1UST A;  1J5Y A;  2XKP A;  1FP1 D;  1GXP A;  3F72 A;  1HKS A;  3MZY A;  5DCM A;  3KLN A;  1R5H A;  1GVJ A;  4N9H A;  1FYM A;  1DUX C;  2O6G E;  2RQP A;  3KE2 A;  2IW5 A;  3EET A;  1UB9 A;  2VT2 A;  3QP6 A;  1I6X A;  2JRT A;  4P9F A;  4IXA A;  5F6F A;  5KK1 A;  1PP8 F;  1HST A;  3GWZ A;  3RYP A;  4KUM A;  1B1B A;  1OYW A;  1HQC A;  5D4S A;  4WK8 F;  1U5T B;  3E6M A;  3ABU A;  1TNT A;  2XRN A;  3K1N A;  3P9I A;  5D8L B;  1LEA A;  2LF7 A;  1XB4 A;  3ZP5 A;  1Z7U A;  1UCR A;  1LDD A;  2P8T A;  1HW2 A;  2UZK A;  2B0L A;  2PI0 A;  2CGP A;  2IJL A;  2DI3 A;  3GZ5 A;  4LD5 A;  3HTU A;  3LA7 A;  2FBH A;  3ZMT A;  4MHG A;  4LMY A;  1KQ9 A;  4Z2Y A;  3KP7 A;  4NHJ A;  1P6R A;  3KET A;  5F64 A;  4HQE A;  1J7K A;  1YS7 A;  1TQM A;  3K1M A;  4DNC A;  2K86 A;  1GXQ A;  5CYV A;  3DF8 A;  3REO A;  3W6J B;  4EMS A;  1B4A A;  3HHH A;  5ICE A;  3BY6 A;  1XCB A;  6PAX A;  2BYV E;  3KEQ A;  2DAO A;  4AVP A;  2DBB A;  3OV8 A;  2Z5U A;  1QZY A;  1JHF A;  3ZMU A;  4HX7 A;  1FWZ A;  4LK1 F;  3I4P A;  3Q9V A;  2ZME A;  4UV9 A;  4KNY A;  1SMT A;  2X0L A;  2ISY A;  1EH6 A;  2W25 A;  2M8E A;  2V79 A;  5LHI A;  2O3F A;  1RI7 A;  2STW A;  3V7C A;  4WX9 A;  5K1Y A;  5JI6 A;  1BM9 A;  3FWE A;  3KP3 A;  2A5Y B;  3U1D A;  3V8J A;  3BZ6 A;  3ZMZ A;  3H3U A;  5HLH A;  2ZBK A;  5H6R A;  2VC1 A;  4I98 B;  3EQL F;  1XSD A;  3KP6 A;  3CUQ A;  4RAZ A;  5HS8 A;  4TV7 A;  5FFZ A;  4IPA A;  2OD5 A;  4GGG A;  4KN7 X;  4O6J A;  5H20 A;  5J8C A;  3HIF A;  3LST A;  3V8K A;  1XDS A;  4KYW A;  4UNO A;  4EGY A;  2VOO A;  1FSH A;  3FF5 A;  5EEG A;  2ZKZ A;  4U7D A;  2YSR A;  4LB6 B;  1U5T C;  4MTD A;  3MAJ A;  2EA4 A;  2RVC A;  2XV4 S;  1SMY F;  2DW4 A;  1P2F A;  2MD5 A;  1S8N A;  3FMQ A;  3K69 A;  1LJ9 A;  2OZ6 A;  3BJ6 A;  1FX7 A;  4BQA A;  2PBI A;  5FO5 A;  2KIM A;  3MFK A;  1U3E M;  1DP7 P;  2HOE A;  2O8X A;  1WKM A;  4IJA A;  3U9G A;  2G7H A;  2EV6 A;  2HQR A;  3GUD A;  4N9I A;  1LEB A;  2A6E F;  2JPB A;  1MD0 A;  1UHM A;  5DDG A;  4HX4 A;  2D2W A;  2LDU A;  2CFX A;  2Q2E A;  1O3S A;  2OQR A;  3VFZ A;  3VEP A;  1YW7 A;  2HTS A;  5JR3 A;  3O3K A;  4KN4 X;  3I59 A;  2XVC A;  4HX8 A;  4L5J A;  5EEH A;  3RYR A;  2VBY A;  2M87 A;  4A12 A;  1WI9 A;  4AIH A;  4XLP F;  3C1D A;  2CG4 A;  5AIQ A;  1TQP A;  2QQA A;  1WQ2 A;  1IW7 F;  2EFO A;  5L3F A;  1U8R A;  1LVA A;  4ESB A;  1VTN C;  2PLY A;  1Z6T A;  2RN7 A;  4OIR F;  5FLX Z;  1KQ8 A;  3F8B A;  2XAJ A;  4U0V A;  2HR3 A;  1R5G A;  1GHC A;  3MCZ A;  1HBX G;  4JK1 X;  3I64 A;  3GFM A;  1P4W A;  3FXU A;  3GW2 A;  1ZRC A;  3LWF A;  2V1U A;  1H9T A;  2P7C B;  1LQ1 A;  4JQF A;  3RKX A;  3I71 A;  3T1B A;  2DLL A;  4HQM A;  3V7S A;  2QM3 A;  2CWE A;  4EJO A;  2HS5 A;  5AIP A;  1YW8 A;  2D45 A;  1O3T A;  1IN8 A;  4RB3 C;  3O2P E;  2CYY A;  1R1T A;  3MEX A;  4ZZL A;  4HDU A;  3GXO A;  3TGN A;  2YU3 A;  4BXU A;  3F6V A;  3SFZ A;  1F1Z A;  1JGS A;  1RNL A;  1YO5 C;  2NYX A;  2K7L A;  1ZLK A;  5CJ9 A;  4KIB A;  1R36 A;  3WTT C;  2CO5 A;  3I53 A;  3FM5 A;  1J75 A;  1DPU A;  2LSO A;  3FXQ A;  5CLS A;  3J81 Z;  4RGU A;  1XD7 A;  1W7P D;  5ILV A;  2X4H A;  2XUB A;  3RI4 A;  4HOB A;  3CUQ C;  5E1W A;  5K5O A;  4UVC A;  4A0Z A;  2V6C A;  4KT5 C;  2VOD A;  4WXC A;  2H94 A;  1W5T A;  4CYD A;  2RKH A;  2VC0 A;  1C0W A;  4LG0 B;  1O7L A;  3ISP A;  4M6X A;  2HGC A;  3HHG A;  2EA2 A;  1ZLJ A;  3QU6 A;  1SFU A;  3R0A A;  5BQT A;  2K02 A;  3LAJ A;  2MC3 A;  5HDK A;  5IT9 K;  3WOD F;  5IT9 Z;  2HWV A;  2H6C A;  4UVB A;  2ZNZ A;  1QQI A;  3S2W A;  2M5W A;  3FZV A;  2A69 F;  3IWZ A;  3HSF A;  4ETS A;  2NNN A;  3F8N A;  1FOK A;  2KJB A;  1SD7 A;  2P5K A;  3GF2 A;  3EUH A;  1R23 A;  1R00 A;  4YFN F;  1ZRE A;  5A2Q K;  2HTJ A;  4MEY F;  3DP7 A;  1UFM A;  4RAY A;  2DT5 A;  2QQ9 A;  1BJA A;  4I7H A;  1HW1 A;  1ZG1 A;  2KJC A;  2CSO A;  5JHU A;  1S3J A;  3K2Z A;  4UHT A;  1MJB A;  2FNP A;  1W7P A;  4YII A;  3JTG A;  2OBP A;  3TO9 A;  1D8K A;  3PQK A;  4UXN A;  4A0X A;  2BV6 A;  4OIN F;  1LB2 A;  1G3W A;  2P5L C;  3RJP A;  4EJU A;  2BGC A;  2VON A;  4ESJ A;  1U5T A;  3ULQ B;  1J9I A;  3W6K B;  1I1G A;  4LGW A;  3L7W A;  2GZW A;  1F4K A;  3EYY A;  3KZZ A;  5E1X A;  1V4R A;  2FXA A;  1XMK A;  4A5N A;  3T8T A;  5FD6 A;  1HKT A;  2J5P A;  3IL2 A;  4GYI A;  5E8I A;  1X3U A;  2HKX A;  2L3D A;  3P9C A;  3GFL A;  3M8F A;  3F8C A;  3BP8 A;  3EYI A;  3R61 A;  2DTR A;  1AWC A;  1I5Z A;  4IVN A;  1MZB A;  2Y0M A;  1W7P B;  2BBY A;  2BE5 F;  4G6D A;  4ENJ A;  2QBY B;  3B02 A;  2E7X A;  5D6E A;  1STZ A;  4L0Y B;  4PDK A;  3C18 A;  1RUN A;  4MNU A;  2FU4 A;  5HS7 A;  3I5U A;  5D4R A;  2NS0 A;  1WRJ A;  2EK5 A;  3ABT A;  5DEQ A;  3WTU C;  3Q5F A;  4ZYE A;  2ZNY A;  4M9X A;  3T5X A;  1PP7 U;  4EM1 A;  4M9S A;  2XAQ A;  3DPL C;  3RTR A;  2K27 A;  1KU2 A;  1EH8 A;  1T0F A;  1MJA A;  5E1Z B;  4NQW A;  3CTA A;  2G9W A;  2AS5 F;  1YIO A;  4LJZ F;  3ZN0 A;  3BJO A;  4WXH A;  1OYY A;  4XSX F;  1ZN2 A;  5BMZ A;  1FNN A;  3HTS B;  2ZCW A;  2EB7 A;  4LLL A;  4UVA A;  1U78 A;  4I01 A;  5ED4 A;  1R7J A;  3FX3 A;  2COM A;  2GWR A;  1BN5 A;  1XN7 A;  2W85 A;  3J80 K;  2EFP A;  4EGZ A;  5LGT A;  1IN7 A;  2VE8 A;  1TW2 A;  4A6D A;  5CVV A;  2Y75 A;  3HSE A;  1REP C;  3BRO A;  4ESF A;  3KFW X;  2P6T A;  4XBF A;  2QQB A;  2DFI A;  1CF7 A;  4HW0 A;  2VN2 A;  2F5F A;  2O03 A;  4Q47 A;  1G6N A;  5D5X B;  3R0J A;  3G73 A;  3GFJ A;  1EV7 A;  1FLI A;  1YQA A;  2GQQ A;  3E6C C;  2PJP A;  1QZZ A;  2PG4 A;  4Q48 A;  3IRR A;  1KQ0 A;  4LLG F;  2PMU A;  1YG2 A;  2Z99 A;  2ACJ A;  4KIC A;  1JXS A;  2H09 A;  5E18 F;  2A3S A;  1QNT A;  3D0S A;  3E5Q A;  1B9N A;  3E6D A;  5CVJ A;  3GVA A;  2OU2 A;  3HOT A;  1ODD A;  3WTX C;  4CIC A;  4BHB A;  1DDN A;  4BH9 A;  4M71 A;  1JE8 A;  3ZMD A;  4MTE A;  2O61 A;  4NB5 A;  5ICF A;  2MLK A;  3C3W A;  2WTE A;  2PMH A;  2UWM A;  4P5O A;  4LB5 A;  1U6G A;  1FP2 A;  2IVM A;  1CGP A;  5HLG A;  4EJT A;  3P9K A;  3CLO A;  2XRO A;  2E1N A;  1CF7 B;  3LQR A;  4MGR A;  2L02 A;  5LLQ A;  1G3Y A;  5LRS A;  4WWC A;  3F6O A;  1WSU A;  3WE2 A;  1ZYR F;  2TDX A;  5J6X A;  1S7A A;  3ROU A;  1B59 A;  1TLH B;  5DYM A;  2ADU A;  3R4K A;  1B9M A;  4GO1 A;  3FMS A;  4WXD A;  4QLC U;  2V1D A;  1MDM A;  2VT3 A;  4Y15 A;  2YPR A;  5DCF A;  3NQO A;  3TO6 A;  5HDN A;  4LLN A;  2GIV A;  5JVT A;  3CDH A;  2O0Y A;  3WG9 A;  3D5L A;  1BBY A;  3HRU A;  4BHP A;  4XSZ F;  1D5V A;  3IHU A;  1Z1D A;  3DEU A;  1FZP B;  4S04 A;  5BPD A;  4Y13 A;  3MWM A;  2L4A A;  3F21 A;  1BIA A;  4KDP A;  1WWX A;  3C7J A;  2VXZ A;  2Y48 A;  2CW0 F;  1TBX A;  4AD9 A;  2F5C A;  3V4G A;  2FE3 A;  1IXR C;  2JT1 A;  1XGN A;  3GLX A;  2M45 A;  3KLO A;  1YS6 A;  3DXJ F;  5HLI A;  1IZ1 A;  1ZRF A;  3GEZ A;  3NEU A;  1IAW A;  4IHT A;  2OQG A;  1IN5 A;  4FX4 A;  2C6Y A;  2FOK A;  1T38 A;  4IHS A;  5DUI A;  1XSX A;  5LGN A;  1IXC A;  1MDM B;  3SQN A;  5H6Q A;  4ZZD A;  4G6Q A;  4YFK F;  3R6S A;  1YTY A;  5FFX A;  1UHW A;  1XGS A;  2HDC A;  3E5X A;  1ZAR A;  3Q9S A;  4ASN A;  4IRG A;  2FSW A;  1ZHF A;  1RUO A;  2QUF A;  3FXR A;  2IA0 A;  4ON0 A;  5ERI A;  2J5O A;  3L00 A;  1RIO H;  4LG0 A;  5LGU A;  4RB2 C;  3WTW C;  4P55 A;  3QPT A;  5K5R A;  3VB2 A;  2CQK A;  1BI2 A;  3SZT A;  1SFE A;  1P92 A;  4HAM A;  1A04 A;  4F7Z A;  1RZ4 A;  1BI1 A;  1FYK A;  1Z6R A;  1L0O C;  1KYW A;  2A07 F;  3B73 A;  4AIJ A;  3BJA A;  1K78 A;  2YX7 A;  3RKY A;  5ILU A;  1SD4 A;  2QEN A;  3KP5 A;  3QPH A;  2F5E A;  4A6E A;  3GX4 X;  2R3S A;  1BC8 C;  4O5V A;  5CVI A;  4CO8 A;  4EJW A;  1IUY A;  3WGI A;  4HV5 A;  4G94 A;  3E5U A;  2DO7 A;  1XGM A;  4PGH A;  2FF4 A;  2JZY A;  2VE9 A;  5D5V B;  1P4X A;  2GAU A;  4P9U A;  4MQ9 F;  4YFX F;  3N4M A;  2V9V A;  2JTV A;  5E20 A;  3JSP A;  4HF0 A;  4XRF A;  2A61 A;  4HZF A;  1IRG A;  3I58 A;  2ZO4 A;  3GFI A;  2R7F A;  4HLY A;  5LHH A;  4KMU X;  5BS6 A;  2DPD A;  1R22 A;  1FT9 A;  3L09 A;  5BPI A;  3LA3 A;  2VBX A;  4FT8 A;  1KGS A;  2FNA A;  2EFN A;  5L3B A;  1R58 A;  2QZ8 A;  2XAG A;  3GZ6 A;  2KIU A;  2OAZ A;  3PFI A;  4CXF A;  3WU0 A;  1K78 B;  5F1R A;  3WTV C;  3HRS A;  4B8X A;  2FBK A;  1LDJ A;  1R1U A;  1T2K A;  5DV5 A;  2Q8K A;  4BYY A;  3RDI A;  2XAF A;  2GA2 A;  4G7O F;  4OIQ F;  1IN4 A;  3M7G A;  3KP2 A;  2HQN A;  2MH2 A;  1KYZ A;  4A2U A;  4HA8 A;  1BI0 A;  4GXO A;  4B09 A;  1XDU A;  4G7Z F;  1O7F A;  3E6B A;  1O3Q A;  5A2Q Z;  2FBI A;  2G7U A;  4KA4 A;  2FA5 A;  4IF4 A;  3BPX A;  4E70 A;  5L3E A;  2EV5 A;  3RPQ A;  5ILS A;  3T0Y A;  4GYG A;  5TRD A;  1Z05 A;  1PUE E;  2QBY A;  3WTZ A;  3DQV C;  2PN6 A;  4BHC A;  3P7N A;  4N0B A;  5D8K B; 
#chains in the Genus database with same CATH topology
 1FSE A;  4WF2 A;  3W2W A;  3Q0W A;  3LAP A;  1BOA A;  2VXD A;  2R7U A;  2E60 A;  1WGX A;  2XGE A;  2Q0O A;  1OCO H;  2P4W A;  1ZG5 A;  4YIF A;  5LBQ A;  4ZYD A;  1J59 A;  4CDG A;  2F5V A;  4BBR J;  2DJI A;  3LSJ A;  2MSY A;  4NBQ A;  5GAG J;  1OPC A;  1VQ5 I;  2XAS A;  4W1U A;  4Y52 J;  4F91 B;  2QSH X;  4I2O A;  5DD8 A;  2XGD A;  1EH7 A;  1FOX A;  2L9V A;  1PVE A;  3HRT A;  2V6E A;  3PSI A;  4HLX A;  3RPU D;  1JKO C;  2BY1 A;  1TTY A;  4DYQ A;  1W5C C;  1LNW A;  4JX6 A;  1DU6 A;  2VQG A;  4EVI A;  3H92 A;  2KZG A;  3F3X A;  3KP4 A;  2QYO A;  4L9V A;  2K85 A;  2EJR A;  5HS9 A;  2JJ7 A;  4A3F J;  4PZJ A;  4CZZ A;  1ERD A;  4JYK A;  5EZH A;  1ETY A;  3HRM A;  2E19 A;  5ICG A;  1ETQ A;  2KKO A;  2KT0 A;  3NWT A;  3LSI A;  4XRS G;  4D7N A;  2P81 A;  1SD6 A;  4XKV A;  4GCV A;  3IKT A;  1MSE C;  1D0Z A;  2BZT A;  2DA2 A;  3DTK A;  1JTY A;  2R7T A;  3FMR A;  1K79 A;  4RMN A;  2E5Z A;  1Z3Y A;  3F8F A;  3HUG A;  3ABM H;  2FQ3 A;  4A3B J;  4S0H B;  2WY7 Q;  3DEE A;  4EAT A;  3FXM A;  3RKW A;  4EQQ A;  4XLN F;  3JRC A;  2OZU A;  2LH9 A;  4OU0 A;  4UY8 I;  4ZYG A;  4UV8 A;  4ZDL A;  2OC6 A;  1I27 A;  3RQ4 A;  1MNM C;  2FML A;  2XIG A;  2FOW A;  3HOU J;  1H9G A;  4L5E A;  5HDG A;  2V9P A;  2W57 A;  3HSR A;  1ON2 A;  1N77 A;  3JRA A;  3NRV A;  3H3V K;  1OKR A;  2VIX A;  1P4A A;  3G3Z A;  3G1M A;  5H2F C;  3QU3 A;  2VKD A;  3OSG A;  2Y9Z A;  4A5M A;  1XX5 A;  1L3L A;  2DOA A;  3K70 D;  2HFH A;  3BOQ A;  1TW3 A;  1QBJ A;  3BG5 A;  1TWC J;  5FD5 A;  2CUJ A;  1T33 A;  3LQQ A;  1FIA A;  1B8I B;  1JKP C;  5HVQ C;  3HGG A;  3PSF A;  5FRM A;  3L2C A;  4MQV A;  4PJM A;  5K7H A;  2HOS A;  4YEL A;  4E7L A;  2GIZ A;  1Q1V A;  5L3C A;  3WGH A;  1X58 A;  2A6H F;  2L7F P;  2DU9 A;  2NVQ J;  5FB2 A;  3VYR B;  3TP0 A;  1V54 H;  2Y2Z A;  4ZH4 F;  3GTP J;  3E7L A;  1HCR A;  1OYI A;  1D1B A;  2VBW A;  4JBA A;  4R1H A;  4FHT A;  2FMY A;  3A0B C;  3L2V A;  2L01 A;  2OUM A;  1G4D A;  3RPU A;  2KDZ A;  2JA8 J;  2FRH A;  2XDV A;  1UMQ A;  3OY9 A;  4RGS A;  1Q1H A;  2FEZ A;  3OYN A;  4DQ2 A;  2RAE A;  2QA4 I;  3ZQ7 A;  1J2X A;  3K10 A;  3ELK A;  1KU9 A;  3ABK H;  5KCM A;  3DPT A;  4FX0 A;  3I9V 2;  2HI3 A;  5IOZ A;  4U7B A;  1FPQ A;  2RGV A;  2V4J C;  3S3O A;  2BY3 A;  3FBN B;  2L2O A;  2HU9 A;  1OCR H;  4XID A;  1W5S A;  3I56 I;  1D8J A;  2DA5 A;  3RZO J;  2EIK H;  1YX5 A;  1T6S A;  3CJR B;  3PFY A;  5DD4 A;  5IP6 A;  4Y7N J;  2K4J A;  3J80 Z;  1ZRD A;  4I09 A;  1LKX A;  2EV0 A;  3ZQF A;  3Q0U A;  3FK7 A;  5DCM B;  3ECH A;  5F0H A;  4ENK A;  4E7H A;  1ZK8 A;  5E8G A;  3WU2 C;  2LKP A;  2O7O A;  1FC3 A;  3A1Y A;  3KZY A;  1Z91 A;  3K4B A;  1HXD A;  5EZG A;  5B1A H;  3TL4 X;  2W48 A;  1FBU A;  4C9Y A;  2R7S A;  1QZE A;  3CMY A;  4A3G J;  2R7D A;  2QKM B;  1HKQ A;  3J7Y J;  2WV0 A;  3CCE I;  5EYR A;  1ON1 A;  2K9S A;  4F92 B;  2D1H A;  2H27 A;  4KMF A;  5IYB J;  2LYC A;  2MFZ A;  2ZFW A;  4C2U A;  1WJD A;  2K9N A;  2E1C A;  4HF2 A;  2R5Y B;  2IBD A;  4AID A;  2Y30 A;  2L5Q A;  3I54 A;  4M72 A;  3ZGK A;  2HVS A;  3S16 J;  4ZJZ A;  4L0Z B;  5KAF C;  2HDD A;  4XIC A;  4E7I A;  1B6A A;  2CJJ A;  5JLW A;  2TRT A;  4IHW A;  4ZTF A;  3OYK A;  2JPC A;  1XSV A;  4OOI A;  4RBO A;  2IS2 A;  1F36 A;  1RKT A;  3GYH X;  2PQ8 A;  1DQU A;  2KRH A;  3F8M A;  1W4M A;  3KPH A;  1KU3 A;  2MH9 A;  3QOP A;  4LK0 F;  5E79 C;  2UXX A;  4XLH A;  2WAD A;  5L3G A;  5C4J J;  2YX4 A;  2CV0 A;  1AOY A;  4L5I A;  4D1Q A;  2R7W A;  1Z9C A;  1LFU P;  1FIP A;  1VQN I;  2CQQ A;  2X6X A;  3TOA A;  4L9T A;  3FBI B;  4DBQ A;  2FUG 2;  3M8E A;  1Z7L A;  1OFC X;  3GTM J;  1WI3 A;  1IXS B;  2NRA C;  1BJZ A;  1S29 A;  1RR8 C;  5LHG A;  4LIT A;  1V55 H;  4Y17 A;  3H3Z A;  1S6L A;  2L54 A;  3A4C A;  4FET A;  3CCS I;  4U88 A;  2Z9O A;  2LKS A;  2XAU A;  3PNY A;  3DKW A;  2M0M A;  2GXG A;  2IXS A;  4BE1 A;  3IC7 A;  2A68 F;  4BAC A;  1RKW A;  2IRF G;  1ZH5 A;  2EBI A;  3H9J A;  3GCM A;  4P96 A;  2IA1 A;  2Z1D A;  2DN0 A;  4RS8 A;  3AG3 H;  2Z3Y A;  1IRZ A;  3HYI A;  2HPM A;  3HOS A;  5F04 A;  1MMG A;  1E17 A;  4CHU A;  3CJQ B;  2CMP A;  3DCF A;  1HW5 A;  4DW6 A;  2KRF A;  4Y33 A;  2RV8 A;  5CVR A;  3K0L A;  4ENM A;  3FDY A;  4BQQ A;  1SVL A;  2QLZ A;  4E7S A;  3FXJ A;  2HVQ A;  3E3V A;  3WTY C;  3T8R A;  3HPG A;  5GAH J;  1FY7 A;  4QWQ A;  2BOL A;  1FBS A;  3TO7 A;  3DKY A;  1IRX A;  3ZN1 A;  5LEJ A;  1F5T A;  3TKY A;  1T98 A;  3TDU C;  3N97 A;  2ZME B;  4KJZ A;  4ZDP A;  3KEO A;  3QP5 A;  4E6K G;  2HEO A;  2W4S A;  3IP4 B;  3VPR A;  4A93 J;  1JHH A;  1OR7 A;  2RC4 A;  2KIF A;  1QGP A;  2F4O B;  4D9J A;  3BC8 A;  4EJV A;  3HDD A;  2HYJ A;  3KZI C;  3VOE A;  1XCV A;  2ECC A;  1LDK B;  1ONV A;  2VPL A;  3FXK A;  2DK8 A;  2EIL H;  1MJ9 A;  3DPU A;  4I0B A;  2BEO A;  3CJN A;  3K4J A;  4G9Y A;  1LFP A;  1U8B A;  4D0P A;  1SC7 A;  2DQL A;  3AG4 H;  3DV8 A;  5M5X J;  1K6O A;  5GPC A;  1JI8 A;  3HZJ A;  2V7F A;  2P5V A;  1QPM A;  4UUV A;  5LEK A;  1K7A A;  2CUF A;  1HSJ A;  4HG2 A;  1MMD A;  2HOT A;  4G8X A;  2F5D A;  1SAX A;  3IRQ A;  2DA1 A;  4L9N A;  2EWN A;  4OMY A;  2YR2 A;  3L2R A;  2OA4 A;  2JQ7 A;  5D5U B;  1UG0 A;  2VKH A;  2ETH A;  3JTH A;  4XN0 A;  1IF1 A;  3RIR A;  4YRV A;  1FEX A;  4HV6 A;  4Q4Z F;  3CUQ B;  3HGY A;  3LNQ A;  2ELH A;  1G3T A;  4BJ6 C;  4S05 A;  2XGX A;  1IN6 A;  3ECO A;  4M6Y A;  1AKH A;  1S72 I;  4R79 A;  4L18 B;  4UB8 C;  1I3Q J;  2QKL B;  3P5J A;  2VJ5 A;  3HOX J;  4M74 A;  1ETK A;  2BVM A;  2RDP A;  2L9S A;  3OIP A;  2H6B A;  1I3A A;  3V7R A;  4LIV A;  2VJ4 A;  3QYB A;  1UEL B;  2DQR A;  1D3Y A;  2ISZ A;  2I8D A;  2VL8 A;  4A0Y A;  2UXN A;  3G1L A;  3GO5 A;  1XGO A;  4EM2 A;  2DPU A;  1DPR A;  1H0M A;  2PEX A;  4DGW B;  5D5W B;  2F4I A;  4NUB A;  3MZH A;  1G3S A;  4V19 K;  2Z33 A;  1WCM J;  5C3E J;  1O3R A;  1N25 A;  2ID6 A;  1GVD A;  2LY2 A;  4C2T A;  3SDG A;  5IOY A;  4PFO A;  3TOB A;  2DA6 A;  2R7X A;  1OLT A;  2BW3 A;  2XF6 A;  3K1P A;  3KIO A;  2RNG A;  3L9F A;  2HZT A;  4RB0 A;  1OMI A;  3FHZ A;  5CVU A;  4PGG A;  4U0W A;  1U2W A;  1BI3 A;  1X19 A;  4E7K A;  2Y69 H;  2V1X A;  4KIF A;  4XKC A;  3V42 A;  4M3D A;  3CCY A;  5J3L A;  2E1M B;  5EF6 A;  2F4M B;  3ZQC A;  1FBQ A;  3OL3 A;  1WZ2 A;  3I4M J;  1LVK A;  3G4S I;  1I1S A;  1O57 A;  3MKZ A;  2ZJ2 A;  3COA C;  5FLX K;  4K2E A;  1MBG A;  5IP9 J;  2ZC2 A;  2IPQ X;  3O6B B;  3QYE A;  4HYE A;  3SXY A;  5J1R A;  4OIP F;  2PX9 A;  2X6Y A;  1XMA A;  2R7O A;  3UNG C;  4OIO F;  3OOU A;  1MKM A;  1RR7 A;  3BR0 A;  2HKO A;  4RGR A;  3QRF F;  3M1C A;  2HYF A;  1RES A;  2DMP A;  1R9T J;  2XKO A;  3K2A A;  3TDZ C;  4HDV A;  2MYS A;  3K9T A;  1MMS A;  2LK2 A;  2DTZ A;  1VF9 A;  4ZYH A;  1TQI A;  2ICW G;  2A05 A;  2K3P A;  4U0Y A;  3MQ0 A;  1BC7 C;  4A3M J;  1S7O A;  2W24 A;  1SAU A;  1WJF A;  4PCQ A;  3W2A A;  1ZGW A;  2OTL I;  2JWT A;  1E2X A;  4ENN A;  1AKH B;  3CES A;  5L3D A;  3V8L A;  5LRR A;  3WGG A;  3CC4 I;  3R60 A;  3S14 J;  1QVU A;  3HM5 A;  3RQI A;  1X4O A;  2M7B A;  4LIU A;  5D6F A;  1KU7 A;  4YG2 F;  1SFX A;  3LOC A;  4I6Z A;  2P6S A;  3OOP A;  2R7Z J;  1WFX A;  4IRH A;  5E17 F;  3SEZ A;  5E3L A;  1JGG A;  2EFQ A;  3OWT A;  2ZME C;  3I59 B;  2E2I J;  5KVR A;  4IHX A;  2ME0 A;  3WU1 B;  4HBL A;  1DU0 A;  2IA2 A;  4AWX B;  3WTS C;  3OYC A;  1HDD C;  3LA2 A;  2QVO A;  4BAY A;  3EUA A;  3MKY B;  3HC7 A;  3PQJ A;  3QPL A;  4HF1 A;  5BOX A;  5DUK A;  2B7E A;  3PIO F;  4HEA 2;  2QWW A;  2WC2 A;  1IRF A;  1R1V A;  2M2E A;  2XAH A;  3ZXS A;  1F9N A;  2HQA A;  2W84 A;  1I39 A;  2F2E A;  1V3F A;  3BR6 A;  2DT6 A;  1SD5 A;  3OYG A;  3L1P A;  2VQH A;  2LBF B;  2M30 A;  1MBH A;  4PSX A;  4EV0 A;  1BIB A;  2G0E A;  2ELJ A;  2ESN A;  2QQ8 A;  2LTP A;  4H0E A;  1KA8 A;  2QEX I;  2WV1 A;  2HOA A;  2STT A;  1YOV B;  3J81 K;  5J8F A;  2IGN A;  5EG0 A;  4QTR A;  5B3S H;  2BXZ A;  1XG1 A;  4XLA A;  3ZQQ A;  1ULY A;  1U0J A;  3EDP A;  4Q5S F;  1FYL A;  3LMM A;  1VZ0 A;  2LNB A;  4PUS A;  4DYC A;  4I0A A;  2XC7 A;  3BDD A;  2EIN H;  1O4X A;  3K4L A;  2LF8 A;  1X1P A;  2E7W A;  4RLQ A;  1FMV A;  2HYG D;  2X85 A;  3IWF A;  3LSP A;  5IYD J;  5AON A;  3U2R A;  2R7Q A;  2L4M A;  1T39 A;  3ERE D;  2NNY A;  4OWR B;  5ICC A;  1MMN A;  1Z67 A;  2GA1 A;  2PFB A;  2Y0S A;  3ML6 A;  4R8H A;  1ETV A;  2VBZ A;  4B3A A;  3NWS A;  1ZG3 A;  3BPV A;  3CCL I;  1W0T A;  4YIR X;  1Y0U A;  3BR1 A;  1YW9 A;  2CRG A;  4A3C J;  3WE3 A;  3SZP A;  2P7V B;  1AHD P;  4WCG A;  4M9Z A;  4LFU A;  3F22 A;  1TC3 C;  4L9J A;  3QOE A;  1BW6 A;  1A6I A;  3PO3 J;  4IQJ A;  4BNC A;  3LFK A;  3LSG A;  3CO6 C;  1JUS A;  4CGZ A;  3JSO A;  2MBF A;  1TNS A;  3CCR I;  5JFR A;  4XLE A;  3M9A A;  1OR7 C;  2M1B A;  1LE8 B;  1LUJ B;  2VUM J;  1EJ9 A;  1A35 A;  1MGT A;  3E0J B;  2RNJ A;  3HKZ A;  2GXB A;  3L2U A;  4EM0 B;  2DXI A;  3GTJ J;  1JT6 A;  4IRI A;  3TQN A;  2E1M C;  4BE2 A;  3E97 A;  1XC5 A;  4RB1 A;  3J7A O;  1FOY A;  2WWY A;  4AIK A;  1YFH A;  2MA3 A;  2XF7 A;  3OS2 A;  3JW4 A;  1WH5 A;  4IQ4 A;  1YLF A;  3MN2 A;  3OS0 A;  5K5Q A;  1R6R A;  3I0T A;  5HOO A;  2AXL A;  2DK5 A;  3JAM K;  3IKV A;  3IV5 A;  1ZGA A;  3JAM Z;  3SHF A;  1QO0 D;  3DFG A;  5DM6 F;  5EG0 B;  1YYV A;  5IT3 A;  3EUK L;  3VOD A;  4M73 A;  5CQG A;  3ZR8 X;  3KCC A;  2LOO A;  1OJL A;  3ZMS A;  3ZPL A;  1NHA A;  3ZCO A;  3ZMV A;  5GAD J;  3CCQ I;  1T56 A;  4O3M A;  1FTT A;  4MEX F;  1V5G A;  2CUE A;  3H9Q A;  1VQ9 I;  2LD5 A;  2K4B A;  1K4S A;  1B8I A;  3S1Q J;  3QQA A;  3X2Q H;  1GUU A;  3G1O A;  4OMZ A;  5TJJ A;  1USS A;  2JSC A;  3S1N J;  1ZR2 A;  1RC9 A;  3KX2 A;  2DYS H;  3CUO A;  2IT0 A;  1BR2 A;  4CCO A;  1B72 B;  1K61 A;  1Y1V J;  2R0Q C;  1Y1W J;  4CCL A;  1QPI A;  3CO7 C;  1ZQ3 P;  2MGQ A;  4G7H F;  2XHK A;  3F23 A;  3QAH A;  3QOD A;  4KFC A;  2ESH A;  2ZXJ A;  2Y0S N;  3K4C A;  4ANJ A;  3IH4 A;  4I02 A;  1PDN C;  1YRN A;  2VOP A;  2ELK A;  5M5Y J;  3DU6 A;  2KFD A;  2EFW A;  2MAB A;  2D1V A;  2K5C A;  4KIG A;  2D5V A;  3AAF A;  1AA7 A;  2V1N A;  2W1O A;  3VWB A;  3GLL A;  1ZAO A;  4U87 A;  3MD2 A;  4MFE A;  2MLG A;  2IP2 A;  5FGM A;  2LVS A;  1J0R A;  4RA2 A;  1UAA A;  2NAZ A;  3BWG A;  1Z0X A;  1ZGJ A;  4RGX A;  4A3I J;  2ECB A;  2LP0 A;  3FM3 A;  3M1E A;  4BXF A;  1S9H A;  2GOM A;  1UST A;  2JN6 A;  4XLC A;  1J5Y A;  2XKP A;  1FP1 D;  1GXP A;  3F72 A;  1HKS A;  3GME A;  3HKZ N;  2BXY A;  1WJ5 A;  3W2V A;  3MZY A;  5DCM A;  4GDF A;  3KLN A;  5F27 A;  3BR2 A;  1R5H A;  2EH3 A;  1GVJ A;  4N9H A;  1FYM A;  1DUX C;  2O6G E;  2RQP A;  1HA8 A;  3KE2 A;  1MH4 A;  2IW5 A;  2KQR A;  2XPW A;  2NS8 A;  2EPF A;  3TW7 A;  3EET A;  4XNF A;  1UB9 A;  1NG7 A;  2VT2 A;  3QP6 A;  3DLL F;  1I6X A;  2JRT A;  4P9F A;  1ACI A;  4IXA A;  5F6F A;  4BDZ A;  5KK1 A;  4M6V A;  4C3I J;  1PP8 F;  3OYJ A;  1Y0N A;  1RET A;  2DOE A;  1SAN A;  3ABL H;  2L9R A;  1HST A;  2IGK A;  3CQZ J;  3GWZ A;  1TP4 A;  3RYP A;  4KUM A;  4NDL A;  4XRM A;  2UV1 A;  1JUP A;  1A6Q A;  4JP0 A;  3BTJ A;  2N8G A;  4BS9 A;  2R5Y A;  3S3N A;  1B1B A;  1X4P A;  1OYW A;  1IDZ A;  1HQC A;  1WJA A;  3H0G J;  2LC2 A;  4RM3 A;  3S8P A;  3SEQ A;  5D4S A;  1WJC A;  4WK8 F;  1U5T B;  1YRN B;  2PJR B;  3KEY A;  4IHV A;  3FHN A;  3E6M A;  3L2Q A;  3ABU A;  2X1D A;  1VQ6 I;  3VDX A;  2ZFU A;  3A01 A;  2WAE A;  1TNT A;  2XRN A;  3HOV J;  3K1N A;  4HNT A;  3P9I A;  3ONQ A;  5D8L B;  1KZH A;  1LEA A;  4XM3 A;  2LF7 A;  4YEJ A;  1XB4 A;  4X0G A;  3ZP5 A;  2VQL A;  5GPA A;  2V26 A;  4GRI A;  1Z7U A;  1FTZ A;  2LFB A;  4FTH A;  1UZC A;  1YI2 I;  1ETO A;  2KLO A;  3BCA A;  1UCR A;  3KYL A;  4Y3O A;  2IS4 A;  2ZJP F;  1LDD A;  2P8T A;  1HW2 A;  4UUT A;  4IX7 A;  2EZK A;  2UZK A;  5EGO A;  2B0L A;  2PI0 A;  2CGP A;  2IJL A;  2DI3 A;  3GZ5 A;  4LD5 A;  3HTU A;  3LA7 A;  2FBH A;  2KZV A;  3DU5 A;  3ZMT A;  2DDA A;  4MHG A;  4LMY A;  1KQ9 A;  4Z2Y A;  3KP7 A;  4NHJ A;  4MO7 A;  1P6R A;  3KET A;  5F64 A;  4HQE A;  4IHY A;  1J7K A;  2CFO A;  1YS7 A;  1SVM A;  3OYL A;  1TQM A;  3K1M A;  2ZXI A;  4DNC A;  3LSR A;  2EZH A;  2K40 A;  1E3P A;  2K86 A;  2E2J J;  1GXQ A;  5CYV A;  3DF8 A;  1MSF C;  3REO A;  3W6J B;  4EMS A;  1HLV A;  4BEH A;  1B4A A;  3HHH A;  5ICE A;  3BY6 A;  4D7M A;  1XCB A;  6PAX A;  2BYV E;  3DKX A;  3OR2 C;  4C30 A;  3KEQ A;  2NVU B;  2CS3 A;  2DAO A;  5J1Y A;  4AVP A;  2DBB A;  3OV8 A;  3GTQ J;  2VJI A;  1D0X A;  2Z5U A;  4A3E J;  1TZL A;  1QZY A;  1JHF A;  2Q1Z B;  3ZMU A;  1NH3 A;  4HX7 A;  1FWZ A;  4LK1 F;  3S2H J;  3I4P A;  1P9Q C;  1UG2 A;  3GBG A;  1VQM I;  3Q9V A;  2ZME A;  3OIQ A;  4UV9 A;  4B48 A;  1S7E A;  4DIQ A;  2ZB9 A;  4KNY A;  1SMT A;  2X0L A;  2ISY A;  3A01 B;  2WB1 A;  1EH6 A;  2M8G X;  2OPT A;  2EQR A;  3C2B A;  4XOT A;  2W25 A;  2M8E A;  2JA7 J;  1YIJ I;  1S5L C;  2LRD A;  4F52 A;  2DFE A;  4F3Q A;  2V79 A;  1X2N A;  4NQW B;  3ZQH A;  5LHI A;  2O3F A;  1RI7 A;  1W36 C;  2STW A;  1PJR A;  4Z6Y A;  3V7C A;  4E4H A;  5K1Y A;  4WX9 A;  5JI6 A;  1BM9 A;  3Q3S A;  3FWE A;  1BA5 A;  3A0H C;  3KP3 A;  3CMA I;  1H8A C;  2A5Y B;  3Q0V A;  5EGO B;  1YJ9 I;  3EUH C;  4GFB A;  2JA6 J;  3U1D A;  3V8J A;  3BZ6 A;  4NC6 A;  3ZMZ A;  3H3U A;  3OYD A;  4CH7 A;  1IV8 A;  5HLH A;  1K83 J;  2ZBK A;  5H6R A;  4DOZ A;  4FQG A;  2VC1 A;  4I98 B;  2DA3 A;  2FX0 A;  3EQL F;  2B9S A;  1XSD A;  3KP6 A;  3FKI J;  4I76 A;  3CUQ A;  4RAZ A;  1H88 C;  5HS8 A;  4TV7 A;  5FFZ A;  5BNG A;  1GLN A;  4KT6 A;  2OCE A;  4IPA A;  4DBR A;  3K4K A;  3BZC A;  3SJM A;  3MKW B;  2OD5 A;  4BEH B;  4A3K J;  4GGG A;  5FLM J;  4KN7 X;  4O6J A;  5H20 A;  2IEK A;  5J8C A;  3HIF A;  3LST A;  3V8K A;  2MC4 A;  1TWH J;  1XDS A;  4KYW A;  4UNO A;  4EGY A;  4IO9 F;  2VOO A;  3BTI A;  2KMU A;  2OF7 A;  1FSH A;  4BGD A;  3FF5 A;  5EEG A;  1D1A A;  2ZKZ A;  5DM7 F;  1Z3X A;  4U7D A;  2YSR A;  4LB6 B;  1U5T C;  5DTD A;  4MTD A;  4FCY A;  4A69 C;  4W97 A;  2AQE A;  2DOF A;  4XKB A;  5B5E C;  5TGT A;  4A3L J;  3MAJ A;  1Y6I A;  5IP7 J;  2K3F A;  3FXO A;  2CV2 A;  2EA4 A;  2JUC A;  3CMM A;  1SFK A;  4PJ0 C;  2RVC A;  2R5Z A;  3HB9 A;  2XV4 S;  1VQP I;  1SMY F;  4ABZ A;  2DW4 A;  1P2F A;  2MD5 A;  1S8N A;  3FMQ A;  4ZC3 A;  3VYT B;  1LFB A;  3MZ8 A;  3JR9 A;  2WB1 N;  3AL0 B;  1T8I A;  3K69 A;  1LJ9 A;  2OZ6 A;  3BJ6 A;  2R7V A;  1FX7 A;  1AU7 A;  4LOC A;  2M34 A;  2QCO A;  4BQA A;  3G6E I;  1IG7 A;  2PBI A;  3OYA A;  5FO5 A;  3CCU I;  2KIM A;  1G59 A;  4RLF A;  4ZYA A;  4PK4 A;  1LPQ A;  3MFK A;  1U3E M;  1A36 A;  1TT0 A;  1DP7 P;  2E71 A;  2HOE A;  2LY9 A;  2O8X A;  4G12 A;  4DJA A;  1WKM A;  1KON A;  3I3L A;  3JRD A;  3DBH B;  4II3 A;  4IJA A;  3U9G A;  2G7H A;  2EV6 A;  3W6V A;  1F43 A;  2KIS A;  1X3Z B;  2HQR A;  3GUD A;  2P0W A;  4N9I A;  4F55 A;  1LEB A;  2A6E F;  2JPB A;  1MD0 A;  3GTK J;  3CF2 A;  1UHM A;  4HX4 A;  5DDG A;  2COB A;  2D2W A;  2LDU A;  2LG4 A;  2NOJ B;  2CFX A;  1V5E A;  2DT7 B;  2I10 A;  4ZTJ A;  2Q2E A;  1O3S A;  2OQR A;  3VFZ A;  2JA5 J;  2BVL A;  4JX5 A;  3HBL A;  3VEP A;  1YW7 A;  2HTS A;  2ME6 A;  5JR3 A;  1ETX A;  2M0C A;  3O3K A;  3S1M J;  1RPW A;  4KN4 X;  3I59 A;  2HNH A;  2XVC A;  4HX8 A;  4L5J A;  5EEH A;  3RYR A;  4DZP A;  5E3N A;  2VBY A;  2M87 A;  2DFH A;  4A12 A;  1WI9 A;  4AIH A;  4XLP F;  2ZSI B;  2Z2S B;  2DMQ A;  3M3Y J;  3C1D A;  2CG4 A;  2EZI A;  3BR3 A;  5AIQ A;  1TQP A;  4B47 A;  2QQA A;  2R5Z B;  1I50 J;  1YHQ I;  4V2G A;  4AYB A;  4RAF A;  1WQ2 A;  1IW7 F;  2VQC A;  2EFO A;  2X9D A;  5L3F A;  1U8R A;  1LVA A;  1R4M B;  1I6H J;  4ESB A;  1VTN C;  2PLY A;  1Z6T A;  3G71 I;  1MBJ A;  2VKV A;  2RN7 A;  4OIR F;  2LBF A;  3PL8 A;  4NC7 A;  5FLX Z;  1X1C A;  4PJN A;  1JJ8 C;  3F8B A;  1KQ8 A;  2XAJ A;  4PJL A;  4U0V A;  1X1D A;  4IOC F;  2HR3 A;  4XOP A;  2OTJ I;  1R5G A;  3PUB A;  1GHC A;  4QPO A;  3MCZ A;  1TT5 B;  1HBX G;  4JK1 X;  3I64 A;  3GFM A;  1P4W A;  3FXU A;  3GW2 A;  1ZRC A;  3H0D A;  3PNV A;  3LWF A;  3ZRG A;  3BG6 A;  4B43 A;  3BG9 A;  5B66 C;  2V1U A;  3AG2 H;  1H9T A;  2P7C B;  3DBL B;  1LQ1 A;  4C3H J;  4I99 C;  4JQF A;  3RKX A;  2DYR H;  3I71 A;  3T1B A;  2DLL A;  1XS9 A;  4HQM A;  1FOW A;  4M3E A;  3V7S A;  2NOG A;  2BY2 A;  3OMY A;  3TW6 A;  2QM3 A;  2CWE A;  4EJO A;  2HS5 A;  5AIP A;  1YW8 A;  2A6T A;  2D45 A;  2VKE A;  2Q2E B;  4XL9 A;  3OYH A;  1O3T A;  1IN8 A;  4RB3 C;  3O2P E;  2ZJQ F;  2CYY A;  1HC8 A;  1R1T A;  2LR8 A;  3MEX A;  4D5C A;  2XPU A;  5EDN A;  4ZZL A;  4HDU A;  3J7A Y;  2Y9Y A;  2NXN B;  3GXO A;  3TGN A;  1IC8 A;  1QHG A;  1X1A A;  2AXT C;  2YU3 A;  4JOM A;  3WHB A;  3BTL A;  1HDP A;  4BXU A;  1W36 D;  1U9N A;  2BY0 A;  3F6V A;  3SFZ A;  4RDU A;  1LE8 A;  1F1Z A;  5GTH C;  2R92 J;  1BL0 A;  1JGS A;  1APL C;  1RNL A;  1YO5 C;  5C4X J;  1QVT A;  4UB6 C;  3BT9 A;  2NYX A;  4NC8 A;  1NK3 P;  2KRC A;  2K7L A;  3K4M A;  1ZLK A;  3AL0 C;  2EIJ H;  5CJ9 A;  1W0U A;  4KIB A;  3PIP F;  1R36 A;  2OV7 A;  4F93 B;  3WTT C;  2NVT J;  2CO5 A;  3I53 A;  1BR1 A;  1T95 A;  4AYB N;  3FM5 A;  3CME I;  1J75 A;  1DPU A;  4XOR A;  1VQ4 I;  2LSO A;  3FXQ A;  1IDY A;  5CLS A;  2DA4 A;  3H35 A;  3WHC A;  3J81 Z;  4RGU A;  4CUG A;  4OAZ A;  1ZKG A;  1XD7 A;  1W7P D;  5ILV A;  2X4H A;  2HXI A;  3CC2 I;  1R4N B;  5FLV A;  2XUB A;  3RI4 A;  4QPQ A;  1J09 A;  1JTX A;  4HOB A;  3CUQ C;  5E1W A;  5K5O A;  4UVC A;  4A0Z A;  3BTC A;  2V6C A;  4KT5 C;  4B1R A;  2VOD A;  5IYC J;  4WXC A;  2H94 A;  2O5R A;  1W5T A;  3IAS 2;  1D1C A;  4CYD A;  5J4Y A;  3PNT A;  5KAI C;  3CF5 F;  2RKH A;  2VC0 A;  4PFP A;  2HXO A;  1B72 A;  1C0W A;  5D8K B;  4LG0 B;  3CP2 A;  4FE7 A;  1T08 B;  2ZJR F;  1O7L A;  2K9M A;  2X51 A;  3ISP A;  5B1B H;  1R49 A;  4M6X A;  2HGC A;  3HHG A;  2EA2 A;  1ZLJ A;  2M3A A;  3QU6 A;  1SFU A;  3R0A A;  1JKQ C;  5BQT A;  1A31 A;  2K02 A;  2LY1 A;  3LAJ A;  1VQK I;  2JA2 A;  2MC3 A;  4FE4 A;  5HDK A;  5IT9 K;  3WOD F;  2XRL A;  5IT9 Z;  2HWV A;  2DJN A;  2H6C A;  2JMW A;  4UVB A;  5E3M A;  2ZNZ A;  1QQI A;  3S2W A;  4IZZ A;  4UUS B;  1QU3 A;  2M5W A;  3FZV A;  3AKZ A;  3BCB A;  4IOA F;  2MW8 A;  2EZL A;  1XMX A;  2A69 F;  3IWZ A;  4BY7 J;  2DDB A;  4BU2 A;  3G2B A;  3B6A A;  2WY8 Q;  3HSF A;  2IS1 A;  4ETS A;  2NNN A;  2M7A A;  3F8N A;  1FOK A;  3OSF A;  3CC7 I;  3LL7 A;  1N78 A;  3MVP A;  2KJB A;  1SD7 A;  2X1E A;  5JLX A;  2P5K A;  3I55 I;  2LLK A;  3GF2 A;  3EUH A;  3PUF A;  5GP9 A;  4CYC A;  1R23 A;  1R00 A;  5J4V A;  4YFN F;  3IH3 A;  3ESW B;  1ZRE A;  5A2Q K;  3D1N I;  4XQF A;  2HTJ A;  4MEY F;  3DEW A;  1UFM A;  3DP7 A;  4RAY A;  4B3X A;  2DT5 A;  2QQ9 A;  2WAF A;  1BJA A;  2XB5 A;  4I7H A;  1HW1 A;  3HOY J;  1ZG1 A;  2KJC A;  2BHY A;  2CSO A;  3SFI A;  5JHU A;  1S3J A;  1G8X A;  3K2Z A;  3KYC B;  4UHT A;  1MJB A;  2BHZ A;  2FNP A;  1W7P A;  4YII A;  3JTG A;  1V5F A;  3HXL A;  2OBP A;  3TO9 A;  3FIW A;  5F1J A;  3FK6 A;  1D8K A;  3PQK A;  4UXN A;  4A0X A;  2W00 A;  2BV6 A;  4OIN F;  2X48 A;  1LB2 A;  1ORK A;  1ZTR A;  4HSR A;  3GTO J;  1G3W A;  2P5L C;  3RKQ A;  1K4T A;  2CQN A;  3RJP A;  4EJU A;  2BGC A;  2VON A;  4ESJ A;  3CZ6 A;  1MIJ A;  1VQO I;  4V2F A;  3RZD J;  1U5T A;  1WVR A;  2PJR A;  3ULQ B;  1J9I A;  3W6K B;  1I1G A;  2WA0 A;  4LGW A;  3L7W A;  3A02 A;  2GZW A;  1F4K A;  3EYY A;  2L7M P;  3KZZ A;  3O8G A;  2OCC H;  5E1X A;  3HOZ J;  1SEU A;  3HPH A;  1V4R A;  2IAI A;  1R71 A;  2FXA A;  1XMK A;  1U9O A;  2M9H A;  4A5N A;  1PYV A;  3ASN H;  2XPV A;  2IGO A;  1MH3 A;  3T8T A;  5FD6 A;  1HKT A;  2NS7 A;  2J5P A;  3IL2 A;  4GYI A;  2R7R A;  5E8I A;  2HDW A;  2DMN A;  1X3U A;  2HKX A;  2L3D A;  4CYC B;  1YX3 A;  1MBE A;  3DTI A;  5M5W J;  2B63 J;  4BJ5 C;  2VPR A;  3H5R A;  3P9C A;  3GFL A;  3M8F A;  2JVG A;  3F8C A;  3BP8 A;  4JX4 A;  1WJB A;  3LSK A;  1OQY A;  2E1O A;  3EYI A;  3R61 A;  2DTR A;  1AWC A;  1I5Z A;  4IVN A;  3TMO A;  1MZB A;  3H5A A;  2Y0M A;  2GLO A;  1W7P B;  4Y4R A;  2JRM A;  2X6O A;  2FD5 A;  2BBY A;  2BE5 F;  4G6D A;  5FJ8 J;  1OCP A;  4ENJ A;  3B02 A;  4RM2 A;  2E7X A;  2H1K A;  2QBY B;  1BW5 A;  1G2H A;  5D6E A;  5F0F A;  2CW8 A;  1STZ A;  4L0Y B;  4PDK A;  3C18 A;  1RUN A;  5JHF A;  2YS9 A;  3S3M A;  4XN3 A;  1ZEL A;  1W1W E;  2CV1 A;  5FRO A;  1WJE A;  3ZOB A;  4MNU A;  2FU4 A;  5HS7 A;  3I5U A;  5D4R A;  4CCN A;  1EA3 A;  4CCJ A;  2NS0 A;  3IUO A;  4HNU A;  4BKX A;  1WRJ A;  2EK5 A;  2L7K A;  1IO2 A;  3ABT A;  3FXL A;  5DEQ A;  4B4C A;  3WTU C;  3Q5F A;  4ZYE A;  2ZNY A;  4M9X A;  2GXA A;  1UJ8 A;  3T5X A;  2L9N A;  1PP7 U;  4EM1 A;  4M9S A;  1IUF A;  4P1W A;  3M07 A;  1YJN I;  3UKG A;  4XMY A;  2XAQ A;  3DPL C;  5FKM A;  1XTA A;  2VAS A;  3RTR A;  2K27 A;  1TL8 A;  2V9K A;  1KU2 A;  1EH8 A;  1T0F A;  2FJ1 A;  1MJA A;  5E1Z B;  4NQW A;  3CTA A;  1BR4 A;  3CCV I;  3A03 A;  4KIS A;  2G9W A;  1EF4 A;  3BG7 A;  2AS5 F;  1YIO A;  4LJZ F;  3B6C A;  3ZN0 A;  3BR5 A;  4C2M J;  3BJO A;  3HJE A;  1Y56 A;  4WXH A;  2HQ5 A;  1OYY A;  3DWL E;  4XSX F;  2JK3 A;  4CCM A;  1ZN2 A;  5BMZ A;  1FNN A;  3HTS B;  2R93 J;  2ZCW A;  3HUG B;  3ERM A;  2EB7 A;  3CCJ I;  3ZQL A;  4LLL A;  4UVA A;  3CJT B;  1A5J A;  2Z16 A;  1U78 A;  4I01 A;  1P7J A;  5ED4 A;  1WHU A;  1R7J A;  2AHQ A;  2COM A;  3FX3 A;  2CW7 A;  2E2H J;  2GWR A;  1BN5 A;  1XN7 A;  2W85 A;  3N05 A;  5HNF A;  3J80 K;  2UUZ A;  2EFP A;  2GBY A;  2XF5 A;  3BLY A;  5FRN A;  3I4N J;  4NNJ A;  4EGZ A;  3CD6 I;  1MBK A;  5LGT A;  2W7N A;  2GM4 A;  1IN7 A;  1D5Y A;  2GOX B;  2NVX J;  1CQT A;  2VE8 A;  1TW2 A;  4A6D A;  1YJW I;  5CVV A;  2Y75 A;  2QGU A;  3HSE A;  1REP C;  1VQL I;  3BRO A;  5M3M J;  4HRI A;  4ESF A;  3KFW X;  4C3J J;  4B44 A;  4X6A J;  2P6T A;  2VI6 A;  3JRF A;  1TWA J;  4XBF A;  3TP3 A;  2QQB A;  2DFI A;  1CF7 A;  2QF7 A;  4HW0 A;  3W3C A;  2VN2 A;  3PM1 A;  5KHD A;  1MBF A;  2F5F A;  2O03 A;  1MNE A;  4Q47 A;  1G6N A;  5D5X B;  3R0J A;  3IH2 A;  3U21 A;  3LSH A;  3OYE A;  3G73 A;  1SFO J;  3GFJ A;  2E35 A;  1EV7 A;  4MFD A;  2DCE A;  1FLI A;  1YQA A;  1ETW A;  2Y31 A;  4BE0 A;  2QSG X;  1P7I A;  1OIS A;  2GQQ A;  3E6C C;  2CH0 A;  2PJP A;  4DZJ A;  5FKL A;  1MND A;  2I5U A;  4BY1 J;  2ID3 A;  1QZZ A;  3OL4 A;  2PG4 A;  4Q48 A;  3IRR A;  2AQF A;  4J19 A;  3GTL J;  1KQ0 A;  4LLG F;  4A3D J;  2PMU A;  1YG2 A;  2Z99 A;  3PO2 J;  2ACJ A;  4KIC A;  1JXS A;  4AM3 A;  2RRE A;  2H09 A;  3KYD B;  5E18 F;  2A3S A;  4PSW A;  1QNT A;  3D0S A;  3E5Q A;  1B9N A;  2XSJ C;  2E5N A;  3E6D A;  4M3F A;  2X1C A;  3VSL A;  2VB6 A;  5CVJ A;  1OCC H;  3GVA A;  2DMT A;  4LG3 A;  2OU2 A;  3LFU A;  3ZQG A;  3CLQ A;  2R4G A;  3HOT A;  4DYR A;  1JKR C;  1ODD A;  1YE9 A;  1Z77 A;  4BUP A;  1TWG J;  3WTX C;  4CIC A;  2AO9 A;  5HLT A;  4BHB A;  1DDN A;  4BH9 A;  3K6G A;  4M71 A;  1JE8 A;  3ZMD A;  3WG7 H;  1VQ7 I;  4MTE A;  2O61 A;  4NB5 A;  5ICF A;  2MLK A;  3C3W A;  1NG6 A;  2WTE A;  3LSM A;  2PMH A;  2F6C A;  2UWM A;  4P5O A;  4BQN A;  2CUZ A;  1U6G A;  5IPA A;  4LB5 A;  3NAU A;  1FP2 A;  2IVM A;  3L2W A;  1CGP A;  3D5R C;  5HLG A;  5EJC A;  4EJT A;  2KP6 A;  1XPX A;  4RAG A;  1EKE A;  3P9K A;  3CLO A;  1OCT C;  2XGC A;  2DMU A;  2XRO A;  2E1N A;  1CF7 B;  2LMD A;  3LQR A;  4MGR A;  2L02 A;  3H1C A;  5LLQ A;  1G3Y A;  5LRS A;  2CQX A;  3F6O A;  4WWC A;  2KHM A;  4AUX A;  1WSU A;  4BQO A;  2W82 A;  1ZYR F;  3U1K A;  3WE2 A;  3OYB A;  2TDX A;  3S17 J;  1OCZ H;  1Z21 A;  5J6X A;  1S7A A;  3ROU A;  2XB0 X;  1GV5 A;  1B59 A;  5F08 A;  1TLH B;  5DYM A;  2ADU A;  3R4K A;  1QRY A;  3FKJ A;  1FJL A;  3BG3 A;  1B9M A;  1DP3 A;  4GO1 A;  3NAR A;  3H5N A;  1QHH D;  3FMS A;  4WXD A;  4CA0 A;  1K6Y A;  3S15 J;  4QLC U;  2V1D A;  3BZK A;  1MDM A;  1X3W B;  2PMZ A;  4ZDO A;  2VT3 A;  4HPQ A;  3JRI A;  3S2D J;  4Y15 A;  9ANT A;  2YPR A;  4QIW N;  5DCF A;  3NQO A;  3TO6 A;  5HDN A;  3S32 A;  5E3O A;  3F0C A;  3OYI A;  3CCM I;  1ZR4 A;  4LLN A;  2GIV A;  3J7Z I;  5JVT A;  3CDH A;  2O0Y A;  3WG9 A;  1TWF J;  5K7Z A;  1N75 A;  3OR1 C;  3D5L A;  3QPS A;  1BBY A;  3HRU A;  4BHP A;  5M3F J;  2DA7 A;  2HPI A;  5K7F A;  3SZG A;  1NTC A;  4XSZ F;  4HST A;  2TCT A;  5KNL A;  1D5V A;  1QA6 A;  3IHU A;  4XLF A;  1Z1D A;  3DEU A;  3ZQI A;  1SVO A;  1FZP B;  4E7J A;  4S04 A;  3HOW J;  5BPD A;  4Y13 A;  1E3H A;  4BL0 B;  2E36 A;  3MWM A;  2L4A A;  3F21 A;  1BIA A;  2EIM H;  4KDP A;  2HVR A;  1WWX A;  3C7J A;  2O8K A;  2VXZ A;  1YIT I;  4N4N B;  3OYF A;  2Y48 A;  4J01 A;  2CW0 F;  1TBX A;  4AD9 A;  2F5C A;  3V4G A;  3OIO A;  5LD2 C;  1ITY A;  4PJJ A;  5HOD A;  2FE3 A;  1IXR C;  2JT1 A;  2NVY J;  1WPK A;  3MMY B;  1MMA A;  4BHC A;  1XGN A;  1JUM A;  5J40 A;  3GLX A;  2VLA A;  2CQ7 A;  2M45 A;  4BJT A;  3KLO A;  1YS6 A;  3DXJ F;  5HLI A;  1IZ1 A;  4EEF G;  1ZRF A;  1R5I D;  1WH7 A;  3GEZ A;  3NEU A;  2H8R A;  1IAW A;  4IHT A;  2OQG A;  4XKW A;  5J1U A;  4FAS D;  1IN5 A;  1T0F C;  4FX4 A;  2C6Y A;  2XSD C;  2KIQ A;  2FOK A;  2H8W A;  4CCK A;  1HOM A;  3JRH A;  1T38 A;  4IHS A;  3TBI A;  3SDB A;  5DUI A;  1XSX A;  2LRE A;  5LGN A;  4G6T B;  3HG9 A;  1IXC A;  1MDM B;  3SQN A;  3S93 A;  5H6Q A;  2H1L A;  1RRJ A;  4ZZD A;  5CQE A;  4G6Q A;  1Y8R B;  4YFK F;  2OJE D;  3R6S A;  1YTY A;  2CU7 A;  5FFX A;  3M8J A;  1UHW A;  1XGS A;  5CPR B;  2HDC A;  2X6W A;  4II2 A;  3E5X A;  2KL4 A;  4X1E A;  1ZAR A;  3Q9S A;  4ASN A;  4IRG A;  2PMZ N;  2FSW A;  2YU9 J;  2L7Z A;  4J00 A;  1ZHF A;  2K9L A;  1RUO A;  2QUF A;  3FXR A;  4IEJ A;  4XR6 A;  2IA0 A;  2MG4 A;  3RCO A;  2O9L A;  4ON0 A;  1Y39 A;  3JCU C;  5ERI A;  1VQ8 I;  2E34 A;  2J5O A;  3L00 A;  3F9K A;  1RIO H;  4LG0 A;  5LGU A;  4RB2 C;  3WTW C;  2WAQ A;  4P55 A;  4XON A;  3QPT A;  5K5R A;  3VB2 A;  3K7A J;  3BQZ A;  2CQK A;  1BI2 A;  3DTE A;  3VSK A;  3SZT A;  1SFE A;  1P92 A;  4HAM A;  2HZD A;  2IS6 A;  2MD0 A;  1A04 A;  4F7Z A;  1DGR M;  2RQQ A;  1RZ4 A;  1BI1 A;  3K70 C;  4M3G A;  1Z6R A;  1FYK A;  1L0O C;  3BQY A;  5DS9 A;  1KYW A;  4M3B A;  2K9Q A;  3CDI A;  2A07 F;  3B73 A;  4CSW A;  4AIJ A;  1ENH A;  3BJA A;  1K78 A;  4UUS A;  2KPM A;  2YX7 A;  4A3J J;  1E3O C;  3RKY A;  5ILU A;  1SD4 A;  5GTI C;  5C44 J;  2QEN A;  3KP5 A;  4D5F A;  1H89 C;  5FKN A;  4IKF A;  3QPH A;  3UR3 C;  4XK4 A;  3C2H A;  1GV2 A;  3M4O J;  4BBS J;  5JVG F;  2F5E A;  5CKT A;  4A6E A;  3GX4 X;  1X2M A;  4H4K C;  2R3S A;  5LFA A;  1BC8 C;  3HL2 A;  4O5V A;  5CVI A;  5FKK A;  1IV6 A;  2BW3 B;  4AU7 A;  4CO8 A;  4EJW A;  1IUY A;  1VI0 A;  3WGI A;  4HV5 A;  4G94 A;  3E5U A;  2DO7 A;  1XGM A;  4OAY A;  4PGH A;  3SYT A;  2FF4 A;  3JRE A;  2JZY A;  2VE9 A;  4E7Z A;  3RSN A;  1NK2 P;  3EPZ A;  5D5V B;  5TIS C;  5IY5 H;  1P4X A;  2ZSH B;  2GAU A;  4P9U A;  4MQ9 F;  3K4N A;  4YFX F;  3N4M A;  3OYM A;  1GDT A;  1JJ6 C;  2V9V A;  2JTV A;  5E20 A;  3JSP A;  3JRB A;  4HF0 A;  4XRF A;  4MLO A;  3OS1 A;  1PUF A;  1Y8Q B;  1MW7 A;  2A61 A;  4AVZ A;  4HZF A;  1VFC A;  1IRG A;  3I58 A;  1M1E B;  2M4K A;  3DLA A;  4IL6 C;  2ZO4 A;  3GFI A;  1DGW Y;  2R7F A;  4HLY A;  5LHH A;  2FQ4 A;  4KMU X;  5BS6 A;  4CZC A;  2LKX A;  2DPD A;  5FKO A;  1VND A;  1R22 A;  1FT9 A;  3L09 A;  5BPI A;  3FIS A;  3LA3 A;  2VBX A;  1GT0 C;  3GTG J;  4FT8 A;  1KGS A;  2FNA A;  2EFN A;  3PJR A;  3ASO H;  2DFF A;  2M4G A;  2A5W A;  2QSF X;  5L3B A;  3IAM 2;  3GZN B;  1E0E A;  1R58 A;  2WAQ N;  2QZ8 A;  3VYS B;  5F0C A;  3A2K A;  3H9G A;  4QSH A;  2XAG A;  3GZ6 A;  3DBR B;  3CDL A;  2JSP A;  2F48 A;  2KIU A;  4BDY A;  2OAZ A;  3C2G A;  3PFI A;  4N4O B;  2IGM A;  4CXF A;  3HEF A;  3WU0 A;  4KIT B;  1K78 B;  2ZXH A;  5F1R A;  3WTV C;  3VYU B;  3HRS A;  4B8X A;  2FBK A;  1LDJ A;  3MKL A;  1R1U A;  1T2K A;  2L0K A;  5DV5 A;  2Q8K A;  3JRG A;  4BYY A;  3RDI A;  2XAF A;  2GA2 A;  5HNH A;  2DOD A;  5J47 A;  1IGN A;  4BXX J;  3TED A;  4G7O F;  1BOB A;  2YUS A;  3AFH A;  4OIQ F;  1IN4 A;  3M7G A;  3KP2 A;  3O8H A;  1POG A;  2HQN A;  3CP8 A;  2MH2 A;  1JT0 A;  2WBM A;  1KYZ A;  4A2U A;  4HNV A;  2JVH A;  1D0Y A;  4HA8 A;  1BI0 A;  4GXO A;  4AC0 A;  4B09 A;  3QYF A;  1XDU A;  4G7Z F;  1O7F A;  3AG1 H;  3E6B A;  1O3Q A;  1FMW A;  5GAE J;  2FBI A;  5A2Q Z;  2G7U A;  4KA4 A;  3E1S A;  4ITV A;  2FA5 A;  4IF4 A;  1HF0 A;  2VJJ A;  3BPX A;  4E70 A;  5L3E A;  1IJW C;  5EEA A;  1PUF B;  2EV5 A;  3QWL A;  3S1R J;  1UHS A;  3RPQ A;  5ILS A;  2JUG A;  2KDO A;  3T0Y A;  4FIS A;  1X1B A;  3D5S C;  3H36 A;  1Z05 A;  4GYG A;  4XRS A;  5TRD A;  1PUE E;  3WTZ A;  3DQV C;  2QBY A;  2PN6 A;  3P7N A;  4N0B A;  4MIM A;  2ZXW H; 
#chains in the Genus database with same CATH homology
 1FSE A;  4WF2 A;  3LAP A;  1BOA A;  2Q0O A;  2P4W A;  1ZG5 A;  4YIF A;  5LBQ A;  4ZYD A;  1J59 A;  4CDG A;  1OPC A;  2XAS A;  4I2O A;  5DD8 A;  1EH7 A;  3HRT A;  4HLX A;  1TTY A;  1LNW A;  4EVI A;  3H92 A;  3F3X A;  3KP4 A;  4L9V A;  2QYO A;  2EJR A;  5HS9 A;  4PZJ A;  4CZZ A;  3HRM A;  5ICG A;  2KKO A;  1SD6 A;  3IKT A;  4GCV A;  3FMR A;  1K79 A;  3F8F A;  3HUG A;  2FQ3 A;  4EQQ A;  3RKW A;  4XLN F;  2OZU A;  4OU0 A;  4ZYG A;  4UV8 A;  1I27 A;  2FML A;  2XIG A;  1H9G A;  5HDG A;  2W57 A;  3HSR A;  1ON2 A;  3NRV A;  1OKR A;  1P4A A;  3G3Z A;  3QU3 A;  4A5M A;  1L3L A;  2HFH A;  3BOQ A;  1TW3 A;  1QBJ A;  5FD5 A;  3LQQ A;  5HVQ C;  3L2C A;  4MQV A;  5L3C A;  3WGH A;  2A6H F;  2DU9 A;  5FB2 A;  4ZH4 F;  1OYI A;  4R1H A;  2VBW A;  4JBA A;  4FHT A;  2FMY A;  1G4D A;  2L01 A;  3RPU A;  2FRH A;  4RGS A;  1Q1H A;  2FEZ A;  4DQ2 A;  3ZQ7 A;  1J2X A;  3ELK A;  1KU9 A;  3DPT A;  4FX0 A;  4U7B A;  1FPQ A;  2RGV A;  1W5S A;  1D8J A;  1T6S A;  5DD4 A;  2K4J A;  3J80 Z;  1ZRD A;  4I09 A;  2EV0 A;  5DCM B;  3ECH A;  4ENK A;  5E8G A;  2LKP A;  3KZY A;  1FC3 A;  1Z91 A;  1HXD A;  1FBU A;  2R7D A;  1HKQ A;  2WV0 A;  1ON1 A;  2D1H A;  2H27 A;  4KMF A;  2ZFW A;  2E1C A;  4HF2 A;  3I54 A;  4M72 A;  4L0Z B;  1B6A A;  2JPC A;  1XSV A;  4OOI A;  3GYH X;  2PQ8 A;  3F8M A;  1W4M A;  1KU3 A;  2MH9 A;  3QOP A;  4LK0 F;  2UXX A;  5L3G A;  1AOY A;  2YX4 A;  4L5I A;  1Z9C A;  3TOA A;  4L9T A;  3M8E A;  1IXS B;  2NRA C;  1S29 A;  5LHG A;  4Y17 A;  3H3Z A;  1S6L A;  2L54 A;  2Z9O A;  4U88 A;  3DKW A;  2GXG A;  3IC7 A;  2A68 F;  2IRF G;  1ZH5 A;  4P96 A;  2IA1 A;  4RS8 A;  2Z3Y A;  3HYI A;  3HOS A;  1E17 A;  4CHU A;  1HW5 A;  2KRF A;  2RV8 A;  5CVR A;  3K0L A;  4ENM A;  2QLZ A;  3WTY C;  3E3V A;  3T8R A;  1FY7 A;  4QWQ A;  1FBS A;  3TO7 A;  3ZN1 A;  5LEJ A;  1F5T A;  3TKY A;  1T98 A;  3TDU C;  3N97 A;  2ZME B;  3KEO A;  3QP5 A;  2HEO A;  1JHH A;  1OR7 A;  2RC4 A;  2KIF A;  1QGP A;  4EJV A;  3VOE A;  1XCV A;  1LDK B;  1ONV A;  2DK8 A;  1MJ9 A;  4I0B A;  2BEO A;  3CJN A;  4G9Y A;  4D0P A;  2DQL A;  3DV8 A;  1K6O A;  2P5V A;  1QPM A;  4UUV A;  5LEK A;  1K7A A;  1HSJ A;  4G8X A;  2F5D A;  1SAX A;  3IRQ A;  4L9N A;  2EWN A;  4OMY A;  2YR2 A;  2OA4 A;  5D5U B;  1IF1 A;  2ETH A;  3JTH A;  3RIR A;  4HV6 A;  4Q4Z F;  3CUQ B;  2ELH A;  1G3T A;  4S05 A;  2XGX A;  1IN6 A;  3ECO A;  4M6Y A;  4R79 A;  4L18 B;  4M74 A;  2RDP A;  2H6B A;  3V7R A;  2DQR A;  1D3Y A;  2ISZ A;  4A0Y A;  2UXN A;  3GO5 A;  2DPU A;  1XGO A;  4EM2 A;  1DPR A;  1H0M A;  2PEX A;  5D5W B;  3MZH A;  1G3S A;  2Z33 A;  1O3R A;  3TOB A;  3K1P A;  3L9F A;  2HZT A;  4RB0 A;  1OMI A;  3FHZ A;  5CVU A;  4PGG A;  4U0W A;  1U2W A;  1BI3 A;  2V1X A;  4KIF A;  1FBQ A;  1I1S A;  1O57 A;  2ZJ2 A;  3COA C;  5FLX K;  4K2E A;  2IPQ X;  3O6B B;  4HYE A;  3SXY A;  4OIP F;  1XMA A;  4OIO F;  1MKM A;  2HKO A;  4RGR A;  3QRF F;  2HYF A;  2XKO A;  3TDZ C;  4HDV A;  3K9T A;  4ZYH A;  1TQI A;  4U0Y A;  3MQ0 A;  1BC7 C;  1S7O A;  2W24 A;  4PCQ A;  1E2X A;  4ENN A;  5L3D A;  3V8L A;  5LRR A;  3WGG A;  3R60 A;  5D6F A;  1KU7 A;  4YG2 F;  1SFX A;  2P6S A;  3OOP A;  4IRH A;  5E17 F;  2EFQ A;  3I59 B;  5KVR A;  3WU1 B;  4HBL A;  2IA2 A;  4AWX B;  3WTS C;  3LA2 A;  2QVO A;  4BAY A;  3PQJ A;  4HF1 A;  5BOX A;  5DUK A;  2QWW A;  2WC2 A;  1IRF A;  1R1V A;  2XAH A;  1F9N A;  2W84 A;  2F2E A;  1V3F A;  1SD5 A;  2M30 A;  4EV0 A;  1BIB A;  2ESN A;  4H0E A;  1KA8 A;  2STT A;  3J81 K;  5J8F A;  1ULY A;  3EDP A;  4Q5S F;  1FYL A;  2LNB A;  4I0A A;  3BDD A;  2LF8 A;  2E7W A;  2HYG D;  3IWF A;  5AON A;  3U2R A;  2L4M A;  1T39 A;  3ERE D;  2NNY A;  5ICC A;  2GA1 A;  2PFB A;  3ML6 A;  4R8H A;  2VBZ A;  1ZG3 A;  3BPV A;  1Y0U A;  1YW9 A;  3WE3 A;  3SZP A;  2P7V B;  4WCG A;  4M9Z A;  4LFU A;  3F22 A;  4L9J A;  4BNC A;  3LFK A;  3CO6 C;  4CGZ A;  3JSO A;  2MBF A;  1TNS A;  5JFR A;  3M9A A;  2M1B A;  1MGT A;  2RNJ A;  2GXB A;  4EM0 B;  4IRI A;  3TQN A;  3E97 A;  3J7A O;  4RB1 A;  2WWY A;  4AIK A;  1YFH A;  2MA3 A;  3JW4 A;  1YLF A;  5K5Q A;  3I0T A;  5HOO A;  2AXL A;  2DK5 A;  3JAM K;  3IKV A;  1ZGA A;  3JAM Z;  3SHF A;  1QO0 D;  3DFG A;  1YYV A;  5IT3 A;  3VOD A;  4M73 A;  3KCC A;  3ZPL A;  3ZMS A;  1NHA A;  3ZMV A;  4O3M A;  4MEX F;  2K4B A;  4OMZ A;  5TJJ A;  1USS A;  2JSC A;  3CUO A;  2IT0 A;  3CO7 C;  4G7H F;  2XHK A;  3F23 A;  3QAH A;  4KFC A;  2ESH A;  2ZXJ A;  4I02 A;  1PDN C;  2VOP A;  2EFW A;  2D1V A;  4KIG A;  3AAF A;  1ZAO A;  2MLG A;  2IP2 A;  5FGM A;  1J0R A;  2NAZ A;  3BWG A;  1ZGJ A;  4RGX A;  3FM3 A;  3M1E A;  1UST A;  1J5Y A;  2XKP A;  1FP1 D;  1GXP A;  3F72 A;  1HKS A;  3MZY A;  5DCM A;  3KLN A;  1R5H A;  1GVJ A;  4N9H A;  1FYM A;  1DUX C;  2O6G E;  2RQP A;  3KE2 A;  2IW5 A;  3EET A;  1UB9 A;  2VT2 A;  3QP6 A;  1I6X A;  2JRT A;  4P9F A;  4IXA A;  5F6F A;  5KK1 A;  1PP8 F;  1HST A;  3GWZ A;  3RYP A;  4KUM A;  1B1B A;  1OYW A;  1HQC A;  5D4S A;  4WK8 F;  1U5T B;  3E6M A;  3ABU A;  1TNT A;  2XRN A;  3K1N A;  3P9I A;  5D8L B;  1LEA A;  2LF7 A;  1XB4 A;  3ZP5 A;  1Z7U A;  1UCR A;  1LDD A;  2P8T A;  1HW2 A;  2UZK A;  2B0L A;  2PI0 A;  2CGP A;  2IJL A;  2DI3 A;  3GZ5 A;  4LD5 A;  3HTU A;  3LA7 A;  2FBH A;  3ZMT A;  4MHG A;  4LMY A;  1KQ9 A;  4Z2Y A;  3KP7 A;  4NHJ A;  1P6R A;  3KET A;  5F64 A;  4HQE A;  1J7K A;  1YS7 A;  1TQM A;  3K1M A;  4DNC A;  2K86 A;  1GXQ A;  5CYV A;  3DF8 A;  3REO A;  3W6J B;  4EMS A;  1B4A A;  3HHH A;  5ICE A;  3BY6 A;  1XCB A;  6PAX A;  2BYV E;  3KEQ A;  2DAO A;  4AVP A;  2DBB A;  3OV8 A;  2Z5U A;  1QZY A;  1JHF A;  3ZMU A;  4HX7 A;  1FWZ A;  4LK1 F;  3I4P A;  3Q9V A;  2ZME A;  4UV9 A;  4KNY A;  1SMT A;  2X0L A;  2ISY A;  1EH6 A;  2W25 A;  2M8E A;  2V79 A;  5LHI A;  2O3F A;  1RI7 A;  2STW A;  3V7C A;  4WX9 A;  5K1Y A;  5JI6 A;  1BM9 A;  3FWE A;  3KP3 A;  2A5Y B;  3U1D A;  3V8J A;  3BZ6 A;  3ZMZ A;  3H3U A;  5HLH A;  2ZBK A;  5H6R A;  2VC1 A;  4I98 B;  3EQL F;  1XSD A;  3KP6 A;  3CUQ A;  4RAZ A;  5HS8 A;  4TV7 A;  5FFZ A;  4IPA A;  2OD5 A;  4GGG A;  4KN7 X;  4O6J A;  5H20 A;  5J8C A;  3HIF A;  3LST A;  3V8K A;  1XDS A;  4KYW A;  4UNO A;  4EGY A;  2VOO A;  1FSH A;  3FF5 A;  5EEG A;  2ZKZ A;  4U7D A;  2YSR A;  4LB6 B;  1U5T C;  4MTD A;  3MAJ A;  2EA4 A;  2RVC A;  2XV4 S;  1SMY F;  2DW4 A;  1P2F A;  2MD5 A;  1S8N A;  3FMQ A;  3K69 A;  1LJ9 A;  2OZ6 A;  3BJ6 A;  1FX7 A;  4BQA A;  2PBI A;  5FO5 A;  2KIM A;  3MFK A;  1U3E M;  1DP7 P;  2HOE A;  2O8X A;  1WKM A;  4IJA A;  3U9G A;  2G7H A;  2EV6 A;  2HQR A;  3GUD A;  4N9I A;  1LEB A;  2A6E F;  2JPB A;  1MD0 A;  1UHM A;  5DDG A;  4HX4 A;  2D2W A;  2LDU A;  2CFX A;  2Q2E A;  1O3S A;  2OQR A;  3VFZ A;  3VEP A;  1YW7 A;  2HTS A;  5JR3 A;  3O3K A;  4KN4 X;  3I59 A;  2XVC A;  4HX8 A;  4L5J A;  5EEH A;  3RYR A;  2VBY A;  2M87 A;  4A12 A;  1WI9 A;  4AIH A;  4XLP F;  3C1D A;  2CG4 A;  5AIQ A;  1TQP A;  2QQA A;  1WQ2 A;  1IW7 F;  2EFO A;  5L3F A;  1U8R A;  1LVA A;  4ESB A;  1VTN C;  2PLY A;  1Z6T A;  2RN7 A;  4OIR F;  5FLX Z;  1KQ8 A;  3F8B A;  2XAJ A;  4U0V A;  2HR3 A;  1R5G A;  1GHC A;  3MCZ A;  1HBX G;  4JK1 X;  3I64 A;  3GFM A;  1P4W A;  3FXU A;  3GW2 A;  1ZRC A;  3LWF A;  2V1U A;  1H9T A;  2P7C B;  1LQ1 A;  4JQF A;  3RKX A;  3I71 A;  3T1B A;  2DLL A;  4HQM A;  3V7S A;  2QM3 A;  2CWE A;  4EJO A;  2HS5 A;  5AIP A;  1YW8 A;  2D45 A;  1O3T A;  1IN8 A;  4RB3 C;  3O2P E;  2CYY A;  1R1T A;  3MEX A;  4ZZL A;  4HDU A;  3GXO A;  3TGN A;  2YU3 A;  4BXU A;  3F6V A;  3SFZ A;  1F1Z A;  1JGS A;  1RNL A;  1YO5 C;  2NYX A;  2K7L A;  1ZLK A;  5CJ9 A;  4KIB A;  1R36 A;  3WTT C;  2CO5 A;  3I53 A;  3FM5 A;  1J75 A;  1DPU A;  2LSO A;  3FXQ A;  5CLS A;  3J81 Z;  4RGU A;  1XD7 A;  1W7P D;  5ILV A;  2X4H A;  2XUB A;  3RI4 A;  4HOB A;  3CUQ C;  5E1W A;  5K5O A;  4UVC A;  4A0Z A;  2V6C A;  4KT5 C;  2VOD A;  4WXC A;  2H94 A;  1W5T A;  4CYD A;  2RKH A;  2VC0 A;  1C0W A;  4LG0 B;  1O7L A;  3ISP A;  4M6X A;  2HGC A;  3HHG A;  2EA2 A;  1ZLJ A;  3QU6 A;  1SFU A;  3R0A A;  5BQT A;  2K02 A;  3LAJ A;  2MC3 A;  5HDK A;  5IT9 K;  3WOD F;  5IT9 Z;  2HWV A;  2H6C A;  4UVB A;  2ZNZ A;  1QQI A;  3S2W A;  2M5W A;  3FZV A;  2A69 F;  3IWZ A;  3HSF A;  4ETS A;  2NNN A;  3F8N A;  1FOK A;  2KJB A;  1SD7 A;  2P5K A;  3GF2 A;  3EUH A;  1R23 A;  1R00 A;  4YFN F;  1ZRE A;  5A2Q K;  2HTJ A;  4MEY F;  3DP7 A;  1UFM A;  4RAY A;  2DT5 A;  2QQ9 A;  1BJA A;  4I7H A;  1HW1 A;  1ZG1 A;  2KJC A;  2CSO A;  5JHU A;  1S3J A;  3K2Z A;  4UHT A;  1MJB A;  2FNP A;  1W7P A;  4YII A;  3JTG A;  2OBP A;  3TO9 A;  1D8K A;  3PQK A;  4UXN A;  4A0X A;  2BV6 A;  4OIN F;  1LB2 A;  1G3W A;  2P5L C;  3RJP A;  4EJU A;  2BGC A;  2VON A;  4ESJ A;  1U5T A;  3ULQ B;  1J9I A;  3W6K B;  1I1G A;  4LGW A;  3L7W A;  2GZW A;  1F4K A;  3EYY A;  3KZZ A;  5E1X A;  1V4R A;  2FXA A;  1XMK A;  4A5N A;  3T8T A;  5FD6 A;  1HKT A;  2J5P A;  3IL2 A;  4GYI A;  5E8I A;  1X3U A;  2HKX A;  2L3D A;  3P9C A;  3GFL A;  3M8F A;  3F8C A;  3BP8 A;  3EYI A;  3R61 A;  2DTR A;  1AWC A;  1I5Z A;  4IVN A;  1MZB A;  2Y0M A;  1W7P B;  2BBY A;  2BE5 F;  4G6D A;  4ENJ A;  2QBY B;  3B02 A;  2E7X A;  5D6E A;  1STZ A;  4L0Y B;  4PDK A;  3C18 A;  1RUN A;  4MNU A;  2FU4 A;  5HS7 A;  3I5U A;  5D4R A;  2NS0 A;  1WRJ A;  2EK5 A;  3ABT A;  5DEQ A;  3WTU C;  3Q5F A;  4ZYE A;  2ZNY A;  4M9X A;  3T5X A;  1PP7 U;  4EM1 A;  4M9S A;  2XAQ A;  3DPL C;  3RTR A;  2K27 A;  1KU2 A;  1EH8 A;  1T0F A;  1MJA A;  5E1Z B;  4NQW A;  3CTA A;  2G9W A;  2AS5 F;  1YIO A;  4LJZ F;  3ZN0 A;  3BJO A;  4WXH A;  1OYY A;  4XSX F;  1ZN2 A;  5BMZ A;  1FNN A;  3HTS B;  2ZCW A;  2EB7 A;  4LLL A;  4UVA A;  1U78 A;  4I01 A;  5ED4 A;  1R7J A;  3FX3 A;  2COM A;  2GWR A;  1BN5 A;  1XN7 A;  2W85 A;  3J80 K;  2EFP A;  4EGZ A;  5LGT A;  1IN7 A;  2VE8 A;  1TW2 A;  4A6D A;  5CVV A;  2Y75 A;  3HSE A;  1REP C;  3BRO A;  4ESF A;  3KFW X;  2P6T A;  4XBF A;  2QQB A;  2DFI A;  1CF7 A;  4HW0 A;  2VN2 A;  2F5F A;  2O03 A;  4Q47 A;  1G6N A;  5D5X B;  3R0J A;  3G73 A;  3GFJ A;  1EV7 A;  1FLI A;  1YQA A;  2GQQ A;  3E6C C;  2PJP A;  1QZZ A;  2PG4 A;  4Q48 A;  3IRR A;  1KQ0 A;  4LLG F;  2PMU A;  1YG2 A;  2Z99 A;  2ACJ A;  4KIC A;  1JXS A;  2H09 A;  5E18 F;  2A3S A;  1QNT A;  3D0S A;  3E5Q A;  1B9N A;  3E6D A;  5CVJ A;  3GVA A;  2OU2 A;  3HOT A;  1ODD A;  3WTX C;  4CIC A;  4BHB A;  1DDN A;  4BH9 A;  4M71 A;  1JE8 A;  3ZMD A;  4MTE A;  2O61 A;  4NB5 A;  5ICF A;  2MLK A;  3C3W A;  2WTE A;  2PMH A;  2UWM A;  4P5O A;  4LB5 A;  1U6G A;  1FP2 A;  2IVM A;  1CGP A;  5HLG A;  4EJT A;  3P9K A;  3CLO A;  2XRO A;  2E1N A;  1CF7 B;  3LQR A;  4MGR A;  2L02 A;  5LLQ A;  1G3Y A;  5LRS A;  4WWC A;  3F6O A;  1WSU A;  3WE2 A;  1ZYR F;  2TDX A;  5J6X A;  1S7A A;  3ROU A;  1B59 A;  1TLH B;  5DYM A;  2ADU A;  3R4K A;  1B9M A;  4GO1 A;  3FMS A;  4WXD A;  4QLC U;  2V1D A;  1MDM A;  2VT3 A;  4Y15 A;  2YPR A;  5DCF A;  3NQO A;  3TO6 A;  5HDN A;  4LLN A;  2GIV A;  5JVT A;  3CDH A;  2O0Y A;  3WG9 A;  3D5L A;  1BBY A;  3HRU A;  4BHP A;  4XSZ F;  1D5V A;  3IHU A;  1Z1D A;  3DEU A;  1FZP B;  4S04 A;  5BPD A;  4Y13 A;  3MWM A;  2L4A A;  3F21 A;  1BIA A;  4KDP A;  1WWX A;  3C7J A;  2VXZ A;  2Y48 A;  2CW0 F;  1TBX A;  4AD9 A;  2F5C A;  3V4G A;  2FE3 A;  1IXR C;  2JT1 A;  1XGN A;  3GLX A;  2M45 A;  3KLO A;  1YS6 A;  3DXJ F;  5HLI A;  1IZ1 A;  1ZRF A;  3GEZ A;  3NEU A;  1IAW A;  4IHT A;  2OQG A;  1IN5 A;  4FX4 A;  2C6Y A;  2FOK A;  1T38 A;  4IHS A;  5DUI A;  1XSX A;  5LGN A;  1IXC A;  1MDM B;  3SQN A;  5H6Q A;  4ZZD A;  4G6Q A;  4YFK F;  3R6S A;  1YTY A;  5FFX A;  1UHW A;  1XGS A;  2HDC A;  3E5X A;  1ZAR A;  3Q9S A;  4ASN A;  4IRG A;  2FSW A;  1ZHF A;  1RUO A;  2QUF A;  3FXR A;  2IA0 A;  4ON0 A;  5ERI A;  2J5O A;  3L00 A;  1RIO H;  4LG0 A;  5LGU A;  4RB2 C;  3WTW C;  4P55 A;  3QPT A;  5K5R A;  3VB2 A;  2CQK A;  1BI2 A;  3SZT A;  1SFE A;  1P92 A;  4HAM A;  1A04 A;  4F7Z A;  1RZ4 A;  1BI1 A;  1FYK A;  1Z6R A;  1L0O C;  1KYW A;  2A07 F;  3B73 A;  4AIJ A;  3BJA A;  1K78 A;  2YX7 A;  3RKY A;  5ILU A;  1SD4 A;  2QEN A;  3KP5 A;  3QPH A;  2F5E A;  4A6E A;  3GX4 X;  2R3S A;  1BC8 C;  4O5V A;  5CVI A;  4CO8 A;  4EJW A;  1IUY A;  3WGI A;  4HV5 A;  4G94 A;  3E5U A;  2DO7 A;  1XGM A;  4PGH A;  2FF4 A;  2JZY A;  2VE9 A;  5D5V B;  1P4X A;  2GAU A;  4P9U A;  4MQ9 F;  4YFX F;  3N4M A;  2V9V A;  2JTV A;  5E20 A;  3JSP A;  4HF0 A;  4XRF A;  2A61 A;  4HZF A;  1IRG A;  3I58 A;  2ZO4 A;  3GFI A;  2R7F A;  4HLY A;  5LHH A;  4KMU X;  5BS6 A;  2DPD A;  1R22 A;  1FT9 A;  3L09 A;  5BPI A;  3LA3 A;  2VBX A;  4FT8 A;  1KGS A;  2FNA A;  2EFN A;  5L3B A;  1R58 A;  2QZ8 A;  2XAG A;  3GZ6 A;  2KIU A;  2OAZ A;  3PFI A;  4CXF A;  3WU0 A;  1K78 B;  5F1R A;  3WTV C;  3HRS A;  4B8X A;  2FBK A;  1LDJ A;  1R1U A;  1T2K A;  5DV5 A;  2Q8K A;  4BYY A;  3RDI A;  2XAF A;  2GA2 A;  4G7O F;  4OIQ F;  1IN4 A;  3M7G A;  3KP2 A;  2HQN A;  2MH2 A;  1KYZ A;  4A2U A;  4HA8 A;  1BI0 A;  4GXO A;  4B09 A;  1XDU A;  4G7Z F;  1O7F A;  3E6B A;  1O3Q A;  5A2Q Z;  2FBI A;  2G7U A;  4KA4 A;  2FA5 A;  4IF4 A;  3BPX A;  4E70 A;  5L3E A;  2EV5 A;  3RPQ A;  5ILS A;  3T0Y A;  4GYG A;  5TRD A;  1Z05 A;  1PUE E;  2QBY A;  3WTZ A;  3DQV C;  2PN6 A;  4BHC A;  3P7N A;  4N0B A;  5D8K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...