3B73A

Crystal structure of the phih1 repressor-like protein from haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'NAMRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhiH1 repressor-like protein
publication title Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui.
rcsb
source organism Haloarcula marismortui atcc 43049
molecule tags Structural genomics, unknown function
total genus 28
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3b73A00
1U78A 1UB9A 1B6AA 3KZYA 1C0WA 4RB3C 4G8XA 2XGXA 4WXDA 4S05A 1XD7A 2BV6A 3TDZC 3HSRA 3E5XA 3VFZA 1R22A 3HOTA 1P92A 1IW7F 4U0VA 2QUFA 2H09A 5HDKA 5ICFA 1FP2A 4GCVA 1YO5C 3FM5A 1ZARA 4A2UA 3F8NA 1KU2A 2VE8A 4ZYHA 2MLGA 5K5QA 2STWA 1P4WA 2H27A 3R61A 3JTHA 1KYZA 1H0MA 4B09A 1ZG3A 1R23A 2FBKA 2Z9OA 3AAFA 1SFEA 3FZVA 4A0XA 1U5TC 4ENKA 3WU0A 4LK0F 3TKYA 2LDUA 3DP7A 3GWZA 4EJOA 2LF8A 5LBQA 2G7UA 3GX4X 2CQKA 3OOPA 2W84A 4CO8A 2PBIA 5LEJA 4RGRA 2NYXA 3MEXA 4KMUX 3HSEA 1YQAA 3V7SA 4H0EA 4I01A 2MD5A 3GUDA 1MDMA 5ICGA 2OA4A 5JFRA 4I7HA 4G94A 1TTYA 3ERED 4O6JA 3SXYA 3DEUA 1LB2A 2RC4A 2ETHA 1SD6A 2A61A 1CGPA 1BI0A 1S3JA 1SFXA 3EDPA 3GZ6A 4P55A 2KKOA 2UZKA 2O6GE 3GFLA 4P5OA 3ROUA 3TO6A 2FNPA 3IRQA 3ULQB 1YW8A 1MD0A 2P5LC 1IXSB 4O3MA 2BYVE 3CUOA 2DBBA 5ERIA 1QBJA 1R1VA 4WCGA 1KU7A 5DCMB 4IRHA 1VTNC 4HLYA 2OZ6A 3CUQB 2O3FA 5D4SA 4OU0A 4EV0A 3WU1B 4A5MA 2FXAA 1STZA 2DTRA 5K1YA 1YW9A 4OOIA 4MTDA 1D5VA 3R6SA 4KMFA 5E1WA 3DFGA 2STTA 3P9KA 2HTSA 1IN5A 1IN8A 3WG9A 2ZCWA 4JQFA 1LDDA 4Q5SF 5ILUA 4Q4ZF 4HV5A 4RB1A 5BS6A 3WTXC 1KU3A 2ISZA 2GQQA 3ZMUA 2MH9A 5CYVA 5J8CA 5LLQA 4M71A 2GXBA 2PFBA 3ECOA 4NQWA 1O3SA 1RZ4A 4YFNF 4UVCA 5D6FA 3FX3A 1O3RA 1HW1A 3TQNA 4OIRF 2XVCA 4BAYA 2DK5A 1PDNC 2O03A 3KEOA 1I27A 1XGSA 5IT9K 4PZJA 3CUQC 4E70A 2ZMEB 1GVJA 5DUIA 3SHFA 1ULYA 3DV8A 2HOEA 4U88A 3MZHA 2O8XA 5F6FA 2V1XA 2CG4A 1YW7A 3I64A 4U7DA 3JTGA 1SAXA 3KETA 2D1HA 3E5UA 2K7LA 2D2WA 1J0RA 4L5JA 5IT9Z 3RI4A 4RGSA 3NRVA 4MNUA 3MFKA 4BXUA 4CHUA 1TW3A 3GXOA 2DT5A 3LAPA 4Y15A 2JPBA 2XUBA 2XASA 2GXGA 4L18B 1XN7A 3ZMSA 2XKOA 3QP5A 1IN6A 3GEZA 3BJ6A 5CVJA 3FMRA 1LEBA 2VXZA 3GVAA 1BN5A 4B8XA 1R36A 3WTSC 3HHGA 3KLOA 2OU2A 3C7JA 3V8LA 2X0LA 4HDVA 5ICEA 2R7FA 4N0BA 4LMYA 2L4MA 2HEOA 4WWCA 3F8MA 4AIJA 2A07F 1P2FA 2K4BA 1ZN2A 3BY6A 1ZHFA 1KU9A 2J5PA 2FEZA 3WE3A 3HTSB 1TNTA 2A68F 1G3SA 2F5FA 1R5GA 4HBLA 3RKWA 1MGTA 2XKPA 5E1XA 2OQRA 4IHSA 1XDUA 5FO5A 2M1BA 2O0YA 4ENJA 1OPCA 4IRGA 5AIPA 4ESBA 5ED4A 1JHHA 2K02A 5F1RA 2L3DA 2DO7A 1LNWA 3QU3A 1FSHA 3MZYA 2DFIA 2IP2A 4IF4A 1TNSA 3BPVA 5E8IA 2RGVA 2D45A 4OIQF 4LB5A 4U0WA 2UWMA 1XMAA 3E97A 4I02A 4R1HA 5BOXA 3BWGA 4M6YA 4CICA 4XLNF 1XSXA 2VC1A 2E1CA 2XROA 3C3WA 2WV0A 4HZFA 3I59B 1L3LA 2E1NA 5LRRA 2CW0F 2NAZA 3I71A 3EQLF 2HYFA 1AWCA 5ILVA 3RKYA 1U5TA 2QYOA 1AOYA 3S2WA 3GYHX 3LQRA 2PMUA 4A12A 1G3TA 1BOAA 4HF0A 1V4RA 5E17F 1HW5A 3LQQA 3WGHA 3H92A 1QO0D 3RYPA 2XRNA 1WQ2A 3GO5A 4HW0A 2M30A 4KIFA 1G6NA 1HQCA 4AIHA 3F8FA 5LHHA 3HUGA 1ZRDA 3CLOA 2MA3A 1OYWA 4QWQA 1W5SA 4XRFA 3LA2A 3G3ZA 3REOA 4LFUA 3FXRA 5FGMA 3T8RA 5EEGA 3DQVC 4N9IA 3HIFA 3P9IA 1BBYA 4XSZF 1BI2A 1Y0UA 3K1NA 1TBXA 1FSEA 3QAHA 5BPDA 4LLGF 1ODDA 1IF1A 1L0OC 4HA8A 1OYYA 5DV5A 4KYWA 2F5EA 3KP4A 1SD5A 2IT0A 3KP5A 1EH6A 1B4AA 3WTYC 4L9VA 5LRSA 1KGSA 1BI1A 3RJPA 4BNCA 1K78A 1LJ9A 1ZLJA 2CWEA 5LHGA 4G7OF 1RUOA 3BOQA 2OBPA 2W57A 4OMZA 1Z6TA 3WTWC 4KICA 3SQNA 2R7DA 2J5OA 3J80Z 4UNOA 2A69F 2EV6A 1KYWA 3WTTC 4LB6B 3F23A 2YX7A 1D8JA 2X4HA 3DKWA 2P6TA 1RNLA 5LEKA 4UXNA 2VONA 1EH8A 5L3GA 1DPUA 1XGOA 2OZUA 4EM2A 1BIAA 1WSUA 1S6LA 2HQNA 1R00A 1U8RA 2Y75A 2W24A 2A6EF 4BQAA 3QPHA 2IRFG 2WTEA 4JK1X 2Z33A 4MQ9F 1YS7A 4KIBA 5CLSA 4HLXA 2DU9A 2FF4A 3IWFA 4HDUA 4AIKA 2A5YB 3FXQA 4IHTA 3F8CA 5DCMA 4PDKA 4HX7A 3KCCA 3CUQA 3K69A 1TQIA 1T98A 5BPIA 4CXFA 4L9TA 2EJRA 5EEHA 5E18F 4I0BA 2R3SA 4M9ZA 3GFJA 1FP1D 4HX4A 3RIRA 1XCBA 2WWYA 2L4AA 5L3EA 3QPTA 3KP2A 1G3YA 2XAFA 1NHAA 3RYRA 2H94A 1S29A 4A0ZA 2ZBKA 5FD5A 1X3UA 2ZNYA 4LG0B 1YYVA 2QWWA 1K78B 2ESNA 3O3KA 4QLCU 1O3QA 4D0PA 5KK1A 1K7AA 5JVTA 1R58A 2ESHA 4YG2F 5CVRA 1YS6A 4ZYEA 2DPDA 3DXJF 5DD8A 2DW4A 1WKMA 1IZ1A 1JXSA 2HGCA 4WK8F 2ZMEA 4KUMA 2XIGA 3F6OA 1IAWA 1I5ZA 4Q48A 2OQGA 3R60A 4LLNA 3IKTA 2W25A 1KQ9A 4RAZA 2GA1A 6PAXA 1GXQA 2GWRA 1YFHA 4MHGA 3IHUA 4I98B 2B0LA 3I5UA 4EM0B 2M87A 3V4GA 5HVQC 3R0AA 2KIUA 2V1UA 1USTA 2VOPA 4U7BA 5HDNA 5HLGA 5H6QA 5DDGA 1B9MA 4L0ZB 1BC8C 2RQPA 2L54A 2QZ8A 4G9YA 2GIVA 5DUKA 1QZZA 4HOBA 4OINF 5D5UB 3W6KB 2YX4A 4KT5C 2HTJA 5KVRA 4GO1A 3CJNA 1MJ9A 3GZ5A 2ELHA 1XB4A 2F5DA 1GXPA 1DUXC 4O5VA 1HXDA 2QLZA 1BIBA 4M73A 1ZLKA 2MLKA 1J2XA 4GXOA 3SZPA 5D5WB 2YU3A 3Q9SA 1T2KA 1P6RA 1PP8F 3HOSA 2UXNA 3BROA 1O7FA 1I1GA 2FU4A 2P4WA 4RB0A 2ZFWA 1FYKA 2AS5F 3TO7A 2P6SA 3EETA 2OAZA 4KFCA 4AWXB 2VC0A 2D1VA 3EUHA 2JRTA 3CTAA 3M8EA 5LGNA 2DLLA 2YR2A 4ZZDA 2XAGA 1QQIA 4ZZLA 2LKPA 5ICCA 1YLFA 3DF8A 1T38A 4HF2A 4BHCA 1HW2A 4CZZA 2FBIA 2FSWA 1W4MA 3E3VA 3GFMA 3ZN0A 2RVCA 1DDNA 2HZTA 3KFWX 3I59A 4WF2A 4LD5A 3ZMTA 2VE9A 4P96A 4UVBA 4JBAA 1K6OA 2WC2A 2VBXA 5AONA 1IXCA 3F6VA 1WI9A 5DEQA 3QRFF 4EM1A 2COMA 3I54A 3RKXA 2EFPA 3Q5FA 4RB2C 2EV5A 4OIPF 3CDHA 4MQVA 1J9IA 1ZG1A 3C18A 2XAJA 2ZKZA 4U0YA 4KA4A 2Y0MA 2YPRA 1DPRA 5L3CA 2EWNA 2PEXA 4Z2YA 4ZYGA 3FHZA 3TOBA 2NNYA 3L9FA 1YTYA 5A2QK 1O7LA 3EYYA 3U2RA 2EFNA 1FC3A 3ZMDA 5HLIA 5JI6A 3IC7A 3HRSA 3WODF 3M7GA 4ENNA 1GHCA 1QZYA 1TQPA 5E8GA 5LGUA 1A04A 3ZPLA 1MKMA 2CFXA 5A2QZ 1F4KA 1ZRCA 4RGXA 1IRGA 1ON1A 3B73A 4M72A 2KIFA 4ASNA 3ECHA 1Z9CA 1USSA 1S7AA 1MZBA 1E17A 1Z91A 2F5CA 3T1BA 4HAMA 1BC7C 3IWZA 1T6SA 1WRJA 4G6QA 4FT8A 4A6DA 2VBZA 4FX4A 2M8EA 4EVIA 3O6BB 3ZMZA 1IN7A 3JSOA 5K5RA 3MWMA 1HBXG 5FFXA 3FXUA 4MGRA 3K9TA 1MJBA 3DPLC 3F72A 2KIMA 3F21A 2EA2A 2GA2A 4XSXF 2YSRA 1Q1HA 1BJAA 2KRFA 1XGMA 1TW2A 4ZH4F 1ZG5A 5FLXK 3DPTA 4Q47A 2VOOA 4LLLA 4A5NA 5FD6A 1B1BA 2FRHA 4I0AA 1SD7A 4Y17A 4WXCA 5FB2A 4ESFA 2O61A 3E6CC 5L3FA 4S04A 1FBUA 2EFWA 5BQTA 5FLXZ 2PI0A 4GYGA 3H3UA 3MQ0A 1D8KA 4HX8A 4ON0A 4G6DA 4EMSA 1U2WA 3E5QA 2EFQA 2JSCA 4HQMA 4PGGA 5ILSA 1HKQA 1H9GA 3T0YA 2QBYB 5LHIA 5CJ9A 4WX9A 1FBSA 4LG0A 4KN4X 3I4PA 2Y48A 1PP7U 3TOAA 4MTEA 3E6BA 3J80K 1REPC 1HKSA 4UUVA 4DQ2A 1IN4A 1LEAA 1I1SA 3WTUC 3SFZA 1QPMA 1FBQA 2GAUA 1ZREA 1G3WA 2RDPA 3F22A 3JW4A 3E6MA 3HRUA 5DYMA 3RTRA 2IJLA 5JR3A 2BEOA 3FWEA 4FHTA 4PGHA 2GZWA 1F9NA 3IRRA 2K4JA 1KA8A 5HS9A 5CVVA 3KLNA 1FYLA 2KJCA 1J75A 1FLIA 5L3BA 3B02A 4TV7A 4DNCA 4M74A 4EJTA 5CVIA 2RN7A 2FOKA 1YG2A 2XAQA 1KQ0A 4HF1A 3KZZA 2VODA 5D5XB 1D3YA 1OR7A 1XDSA 3GF2A 3KP6A 2NNNA 4KIGA 1W7PB 2PLYA 3EYIA 3F8BA 2JTVA 2LF7A 3D5LA 2JPCA 2ZO4A 2EK5A 3HRMA 3WE2A 2NRAC 1FX7A 4EJWA 2AXLA 4I2OA 4EQQA 1U3EM 1Z7UA 1P4AA 2V79A 3OV8A 4OIOF 3PQJA 4EGZA 3HRTA 2IPQX 4LK1F 2A6HF 2G7HA 2FMYA 3HSFA 4UVAA 2HKXA 3CO6C 3PFIA 1Z6RA 3ZN1A 4L0YB 3I58A 3LAJA 4L5IA 3E6DA 1XSDA 3C1DA 1R1UA 2EV0A 2P5VA 2QQBA 1J5YA 3HTUA 5IT3A 1LDJA 1OKRA 2FNAA 1UHWA 3P7NA 4L9NA 2P7VB 1RIOH 1FOKA 5H20A 3L09A 2DQLA 4P9UA 1FNNA 1SMYF 3COAC 3QP6A 3ABUA 4KDPA 1JHFA 5LGTA 2Z5UA 2XAHA 1CF7B 3H3ZA 2A3SA 2QVOA 2ZXJA 4GYIA 2KJBA 1W5TA 1FZPB 4IPAA 3VB2A 2ZJ2A 3GFIA 5J8FA 4CGZA 4P9FA 3QOPA 3WGIA 3VOEA 3BP8A 1ZGAA 1T39A 3QU6A 3NQOA 1FPQA 4OMYA 2BGCA 5D5VB 3K1MA 3RDIA 2V9VA 2NS0A 1IXRC 2HKOA 1ZYRF 5DCFA 1U6GA 2FBHA 3LA3A 3WTZA 4ETSA 3K1PA 2E7XA 4EJVA 3U1DA 4IJAA 3WGGA 3IL2A 1FYMA 4RAYA 3KE2A 4MEYF 5E20A 2VT2A 4FX0A 2V6CA 3L00A 4R79A 2DK8A 1O57A 4Y13A 5D4RA 2PG4A 2IA2A 2BBYA 2M45A 3BJOA 3GLXA 3R0JA 1FT9A 3RPQA 3VODA 4GGGA 3F3XA 4ENMA 1JE8A 5D8LB 4KN7X 4BH9A 3FMSA 2PJPA 1R1TA 2Q0OA 1EV7A 2ISYA 4ZYDA 2UXXA 2H6BA 2G9WA 4NHJA 1ZRFA 4IXAA 4LGWA 2Q2EA 2P5KA 2CSOA 1Z1DA 4IRIA 3SZTA 4K2EA 2Q8KA 3PQKA 5DD4A 1UCRA 3CO7C 4BYYA 3L2CA 5D8KB 1H9TA 2QQ9A 1XCVA 1O3TA 1MDMB 1QGPA 3BZ6A 3HYIA 1W7PD 2M5WA 4R8HA 3MAJA 1BM9A 3M1EA 2E7WA 3JAMK 2LNBA 3U9GA 2HYGD 2IVMA 1R7JA 3T8TA 3VEPA 2RKHA 1G4DA 2XHKA 3HHHA 2MC3A 2K86A 3ZP5A 3I53A 4XLPF 4YFXF 5FFZA 1SFUA 3LFKA 3ZMVA 2H6CA 1I6XA 3JAMZ 1MJAA 3TO9A 3BJAA 1B59A 4WXHA 4HYEA 1V3FA 2DI3A 2DPUA 2EFOA 4AVPA 3WTVC 5HLHA 1LVAA 4XBFA 1WWXA 1Z05A 2CYYA 3L7WA 3M9AA 2L01A 3LA7A 5HS7A 2IA0A 5J6XA 4HQEA 1J7KA 4RS8A 1SMTA 1TQMA 1UHMA 3N4MA 2VBWA 1HSTA 4EGYA 2JT1A 4LJZF 3I0TA 2DQRA 4I09A 3J81K 2PN6A 2QENA 5AIQA 2TDXA 3ISPA 5K5OA 2QBYA 1FY7A 1PUEE 2IA1A 5L3DA 4EJUA 3KEQA 2FQ3A 4L9JA 1YIOA 2RV8A 4M9XA 2P8TA 5E1ZB 3J81Z 5D6EA 4A6EA 3FF5A 1ZGJA 3LWFA 3V8JA 4UV8A 1LQ1A 2ACJA 3P9CA 1F5TA 1TLHB 2HWVA 4ESJA 4YFKF 3BPXA 1UFMA 2FA5A 4YIIA 2BE5F 1XGNA 2MH2A 1FWZA 2QM3A 3V7RA 2Z99A 3GW2A 4CYDA 4MEXF 1EH7A 3ELKA 1OMIA 4BHPA 1DP7P 4KNYA 2L02A 1LDKB 5CVUA 2MBFA 3TGNA 3TDUC 3RPUA 1IRFA 3K0LA 3ABTA 5H6RA 2HQRA 5JHUA 1KQ8A 2OD5A 2W85A 1ZAOA 1W7PA 4N9HA 1BI3A 2DAOA 1K79A 3J7AO 5HOOA 5TRDA 1JGSA 3IKVA 4UHTA 3M8FA 2F2EA 3FM3A 2HDCA 1IUYA 1R5HA 2EB7A 3KP3A 3KP7A 5BMZA 2EA4A 1ZH5A 4HV6A 3NEUA 1S8NA 4RGUA 1B9NA 2QQAA 3JSPA 2FMLA 2HS5A 3Q9VA 4UV9A 3T5XA 3G73A 2JZYA 5TJJA 3R4KA 1HKTA 2HFHA 2VBYA 4BHBA 4PCQA 3ZQ7A 3FMQA 4AD9A 4YIFA 3K2ZA 3V7CA 2P7CB 3MCZA 2RNJA 2VN2A 2ZNZA 4M9SA 4F7ZA 1S7OA 5HDGA 3ML6A 2PQ8A 1RI7A 2PMHA 5HS8A 1ONVA 1P4XA 1CF7A 2CGPA 3N97A 3O2PE 4IVNA 2C6YA 4CDGA 4G7HF 2LSOA 3BDDA 2HR3A 1ON2A 3W6JB 2CO5A 2XV4S 2IW5A 4M6XA 5F64A 1J59A 2FE3A 4A0YA 1RUNA 1XSVA 1T0FA 3V8KA 1HSJA 3D0SA 1XMKA 2V1DA 1F1ZA 1SD4A 1QNTA 1E2XA 2K27A 2VT3A 3LSTA 4NB5A 2Z3YA 1OYIA 4G7ZF 1U5TB 2ADUA
chains in the Genus database with same CATH superfamily
1U78A 1UB9A 2FQ4A 1B6AA 3VYUB 2ZSIB 3KZYA 5EGOB 1C0WA 4RB3C 1TC3C 1R71A 4G8XA 3FISA 2XGXA 4G6TB 4XORA 3CCYA 4IHYA 4WXDA 4A93J 4S05A 1XD7A 3BZKA 2HVRA 2BV6A 2X48A 3A1YA 3TDZC 1E3OC 3HSRA 1N75A 3E5XA 1MMAA 3VFZA 3M4OJ 1R22A 3HUGB 3HOTA 3BR1A 1P92A 1ZELA 4DBQA 1E0EA 1IW7F 4U0VA 1IRZA 2R5YA 2QUFA 4A3JJ 2H09A 2KISA 2HDWA 2Y31A 3UNGC 1QRYA 3TL4X 5HDKA 5ICFA 3HDDA 2JA7J 4BEHA 2R5ZB 1LVKA 1FP2A 4GCVA 1YO5C 3FM5A 1ETVA 1GV2A 1ZARA 4A2UA 2EIKH 3F8NA 1KU2A 4PSWA 2VE8A 4ZYHA 4F3QA 2MLGA 5K5QA 2STWA 2LLKA 1P4WA 2H27A 3R61A 3JTHA 1KYZA 3S14J 1H0MA 4B09A 3FIWA 1ZG3A 1R23A 2FBKA 2Z9OA 3AAFA 1SFEA 4BQQA 3FZVA 4A0XA 1U5TC 2FJ1A 1MH4A 2GBYA 2WADA 4BE0A 1H89C 4ENKA 5FRNA 3ZGKA 3CCEI 2Y69H 3WU0A 4G12A 4LK0F 2XGCA 3BT9A 2VLAA 2G0EA 2KPMA 3TKYA 4B4CA 2LDUA 4X0GA 3HOYJ 3DP7A 3GWZA 5C4XJ 4EJOA 1X2NA 2XPVA 1ZK8A 2LF8A 5LBQA 2G7UA 3GX4X 2CQKA 3H5NA 3ZOBA 3CP8A 2E35A 2W84A 3OOPA 4YELA 4CO8A 2A05A 2PBIA 2LY9A 2MGQA 5LEJA 4RGRA 2LYCA 4XN3A 2W7NA 4F55A 2NYXA 3MEXA 4KMUX 3RCOA 2OTJI 2DTZA 3HSEA 2K9QA 1YQAA 2M2EA 3HPHA 3KYLA 5B1AH 3V7SA 1FJLA 5IP7J 4H0EA 4I01A 2MD5A 3GUDA 1MDMA 5ICGA 2HOAA 2OA4A 3S1MJ 5JFRA 1Y39A 4I7HA 4G94A 5GAEJ 3DEEA 2D5VA 2EQRA 1A31A 1TTYA 4CCJA 1W36D 4E7IA 3H9QA 3ERED 2QKMB 4BE2A 4O6JA 2VQGA 4QPQA 3SXYA 3DEUA 2HPMA 4E7ZA 1LB2A 2RC4A 2ETHA 3CLQA 1SD6A 2A61A 1CGPA 4ABZA 1BI0A 5GPCA 3OR2C 1S3JA 1ETQA 1SFXA 3EDPA 2DXIA 3GZ6A 4P55A 2KKOA 2UZKA 3W6VA 3WG7H 1K4SA 2JMWA 2O6GE 3K70D 3GLLA 3GFLA 4P5OA 3ROUA 3TO6A 2H1KA 5FJ8J 2FNPA 3IRQA 3ULQB 1YW8A 1MD0A 2VKEA 4M6VA 3OYDA 2K85A 4DIQA 3CD6I 2P5LC 4HNVA 1IXSB 4O3MA 1PUFA 1GT0C 2BYVE 5GP9A 1JKRC 3CUOA 2DBBA 4BGDA 2LBFA 3OSFA 2F5VA 1ACIA 1G2HA 4LOCA 3B6CA 5ERIA 3MZ8A 1EF4A 3A01A 5GTHC 1QBJA 1ETYA 1R1VA 3I4MJ 3LSMA 3MKWB 3DTKA 4WCGA 3EPZA 2RQQA 1KU7A 3IAM2 5F04A 1BR2A 2K9NA 1D0XA 3F0CA 3OL4A 1UG2A 5DCMB 2NS8A 2E2HJ 1QPIA 2DT7B 2E5NA 4AIDA 4IRHA 1VTNC 2R7TA 1K83J 4HLYA 1HLVA 2OZ6A 3CUQB 2Z1DA 2O3FA 1CQTA 3DLAA 5D4SA 4CCLA 4OU0A 2ID6A 4EV0A 2HOSA 2BY0A 3WU1B 5GTIC 5M3FJ 4A5MA 3JRGA 1O4XA 1RESA 1WGXA 2DN0A 2BVLA 3CMYA 2FXAA 4E6KG 1STZA 2F6CA 2DTRA 5K1YA 2M8GX 1YW9A 2E19A 4OOIA 3HEFA 4MTDA 3R6SA 1D5VA 1TWCJ 2LVSA 4KMFA 5E1WA 1HDPA 3DFGA 1UG0A 3KYCB 2STTA 3P9KA 2HTSA 2MC4A 1IN5A 1IN8A 1PVEA 3WG9A 2R7RA 2ZCWA 3O8HA 4JQFA 1LDDA 4Q5SF 5ILUA 4Q4ZF 4HV5A 1RRJA 2JA8J 4RB1A 5BS6A 3WTXC 3OY9A 1KU3A 1B72B 2ISZA 2GQQA 1ZKGA 3ZMUA 5J4VA 2MH9A 5KAFC 4A69C 2VASA 5CYVA 5J8CA 4F92B 2LD5A 2PMZA 3LOCA 5LLQA 4M71A 4E7JA 2GXBA 2PFBA 5E79C 1QU3A 3ECOA 4NQWA 1O3SA 1RZ4A 4YFNF 5DM7F 2EINH 4RLFA 4UVCA 3D5RC 5D6FA 1ZGWA 1T33A 3FX3A 1VI0A 2DA2A 1O3RA 1HW1A 3TQNA 2HOTA 5B1BH 2R7OA 4LG3A 5CQGA 2NVTJ 2BHZA 4OIRF 4GFBA 2LFBA 2XVCA 4BAYA 2LRDA 2DK5A 2DODA 1PDNC 2O03A 4BQNA 2MSYA 3KEOA 1I27A 1XGSA 2XC7A 3PIOF 5IT9K 4PZJA 4XNFA 1FOXA 3CUQC 4E70A 2LREA 2ZMEB 3GBGA 4DOZA 1GVJA 5DUIA 3SHFA 4PJ0C 2OCCH 4XICA 1ULYA 3DV8A 2HOEA 4U88A 3MZHA 4CCNA 2L7ZA 2R7QA 2MG4A 3BR0A 2DDBA 1HF0A 2O8XA 5F6FA 3TW7A 2V1XA 2CG4A 1FMWA 1YW7A 3I64A 1M1EB 3AKZA 3OIQA 4U7DA 2DYRH 3JTGA 3KETA 2D1HA 1SAXA 3E5UA 5JLWA 2K7LA 3W2WA 2D2WA 1J0RA 4L5JA 5IT9Z 1SANA 3RI4A 4RGSA 3NRVA 4MNUA 2BW3A 3MFKA 4JP0A 2DYSH 4BXUA 4CHUA 4XR6A 1XC5A 4KT6A 5LD2C 1QHHD 3TP0A 1TW3A 3GXOA 3L2QA 3CCVI 2DT5A 2CQ7A 3LAPA 4Y15A 2JPBA 2XUBA 5IYBJ 2YU9J 2XASA 2GXGA 4RMNA 1D5YA 4L18B 1XN7A 3CDIA 1D1CA 3K4NA 3U21A 3S15J 3ZMSA 2XKOA 1H88C 3QP5A 1IN6A 1DGRM 5IOZA 2DA5A 3GEZA 4BJ5C 3HGYA 3BC8A 3BJ6A 5CVJA 3FMRA 4Y52J 1LEBA 2VXZA 1P9QC 1BN5A 3GVAA 4B8XA 1R36A 3WTSC 3HHGA 3KLOA 2OU2A 3C7JA 1MBEA 4NDLA 3V8LA 1WH5A 2X0LA 4XKWA 1DU6A 4HDVA 5ICEA 3PSFA 2EILH 5CKTA 2DDAA 2R7FA 3JRCA 1A35A 2OC6A 3CMEI 3IH3A 4N0BA 2ZMEC 4ZDLA 1XS9A 3GTPJ 4LMYA 3FK6A 2WY7Q 2L4MA 3CC4I 2HQAA 2HEOA 4WWCA 2ZB9A 2LMDA 3F8MA 2XF7A 4AIJA 3QOEA 3G1MA 2QEXI 3DKYA 2LY1A 1WJFA 2M4KA 2A07F 1P2FA 2K4BA 3QPSA 1ZN2A 3BY6A 2VQCA 2XSJC 4JOMA 1MSFC 1ZHFA 1X1DA 5GAHJ 3JRAA 2CV1A 1KU9A 2J5PA 2FEZA 2CUJA 4BY1J 3WE3A 5EEAA 3HTSB 2PX9A 1TNTA 1FOYA 1S72I 2A68F 1G3SA 2F5FA 1R5GA 2BY3A 4HBLA 3RKWA 1MGTA 2XKPA 5E1XA 5KHDA 2OQRA 2LR8A 4KITB 5HNFA 1HCRA 3CC7I 2XB0X 1XDUA 4IHSA 4ANJA 3S3NA 2CS3A 3HB9A 3PIPF 5FO5A 2M1BA 2OJED 2O0YA 4ENJA 1OPCA 4IRGA 5AIPA 3GTGJ 1BW6A 4ESBA 5ED4A 1JHHA 2VB6A 4PFOA 1WJ5A 2K02A 5F1RA 2HXIA 1D0YA 2L3DA 2DO7A 1LNWA 3KX2A 3ZQGA 3SDBA 1R4NB 4HG2A 3AL0B 1UZCA 3QU3A 4UY8I 1FSHA 3MZYA 2DFIA 2IP2A 2HU9A 2JUGA 4IF4A 1TNSA 1RPWA 4HNUA 2VPLA 2IEKA 3BPVA 5E8IA 2RGVA 2D45A 4B43A 5KCMA 4OIQF 4LB5A 3CCQI 2E71A 4MO7A 3OOUA 4U0WA 2UWMA 1XMAA 3E97A 4I02A 4XRSA 4R1HA 5BOXA 5JHFA 1Y8RB 3BWGA 4M6YA 4CICA 4XLNF 1XSXA 2VC1A 2E1CA 3HOZJ 2XSDC 2XROA 1R6RA 3C3WA 2HQ5A 3HOWJ 2WV0A 4CUGA 4HZFA 4A3IJ 3I59B 5IPAA 1L3LA 2E1NA 2KHMA 5LRRA 2CW0F 2NAZA 4C30A 3I71A 3EQLF 1B8IB 4XRSG 2HYFA 1XPXA 1AWCA 5ILVA 3H5RA 3RKYA 1MMNA 1U5TA 3K4LA 2QYOA 4EEFG 1AOYA 3S2WA 2L7KA 4P1WA 1FIAA 3CCSI 2LY2A 3GYHX 1YJNI 1ENHA 3ABLH 5EGOA 3LQRA 2PMUA 4A12A 2XRLA 5JLXA 1G3TA 3H0DA 1BOAA 4HF0A 1V4RA 5E17F 1HW5A 2QQ8A 5M3MJ 1V5GA 1KONA 3EUHC 3LQQA 3WGHA 3H92A 1QO0D 3RYPA 2XRNA 1T95A 4A3MJ 2E36A 3PUFA 2EPFA 1WQ2A 3GO5A 4HW0A 5TISC 2M30A 2W82A 1X19A 4KIFA 1OLTA 1G6NA 1HQCA 1JUPA 2KT0A 3OIPA 1K4TA 3AL0C 4AIHA 3F8FA 2VI6A 3HUGA 2ME0A 5LHHA 2L9RA 3CLOA 1ZRDA 3DTIA 2NVXJ 3LFUA 2ME6A 3SJMA 2MA3A 2P81A 4AYBA 1OYWA 4QWQA 2M34A 1W5SA 1DGWY 4XRFA 3LA2A 3G3ZA 3REOA 1VF9A 4LFUA 3FXRA 1U9NA 1UELB 5FGMA 5C3EJ 3QPLA 3T8RA 2R5ZA 4XIDA 5EEGA 2X1CA 3DQVC 4N9IA 3CCMI 2L7FP 2IBDA 3HIFA 4AUXA 3S3OA 3P9IA 1BBYA 3S93A 3S17J 4F52A 2Z2SB 4XSZF 1BI2A 3TMOA 1YITI 1Y0UA 3K1NA 5HLTA 1TBXA 1FSEA 1YE9A 3QAHA 4NC7A 4LLGF 5BPDA 1ODDA 3AG1H 1IF1A 1VQPI 1L0OC 4HA8A 1OYYA 5DV5A 2IGOA 4KYWA 3EUKL 1NG7A 2F5EA 1JTYA 3KP4A 1SD5A 1LKXA 2IT0A 5EZHA 3DU5A 3KP5A 1EH6A 1B4AA 4QTRA 3WTYC 5EZGA 4L9VA 2X1DA 3K7AJ 2Y9ZA 5LRSA 3G2BA 3CCRI 1KGSA 2AQEA 1BI1A 3RJPA 4DW6A 4BNCA 1D1BA 4NC6A 1K78A 3S1QJ 1MBHA 4BXXJ 1LJ9A 1RKWA 4BBRJ 4GDFA 1ZLJA 5GPAA 3GTJJ 3K70C 2CWEA 5LHGA 2WAFA 3QQAA 4G7OF 1YIJI 3BCAA 2KLOA 1RUOA 3WHBA 3BR3A 3BOQA 3S32A 2OBPA 2W57A 3M1CA 3H5AA 2KRHA 4OMZA 1TL8A 2MFZA 1Z6TA 1OCRH 5J3LA 1IRXA 5FKNA 3G71I 3WTWC 4KICA 3SQNA 2KL4A 3OS2A 2R7DA 1Z7LA 2J5OA 2X1EA 3M8JA 3BG3A 2KDOA 3J80Z 4J01A 2KMUA 2K40A 4UNOA 2A69F 4XK4A 2CQNA 2EV6A 1OQYA 1KYWA 3ESWB 3WTTC 4LB6B 3F23A 2YX7A 1D8JA 2X4HA 3ASNH 3DKWA 4IZZA 1NTCA 2A5WA 2P6TA 3PJRA 4BKXA 3CP2A 1RNLA 5LEKA 4UXNA 4V2GA 2VONA 2A6TA 1EH8A 5L3GA 1QZEA 1DPUA 1XGOA 2OZUA 4EM2A 1BIAA 3OYCA 1WSUA 4RBOA 2ID3A 3FXMA 3JCUC 3VYRB 1S6LA 2HQNA 1R00A 3OYHA 1U8RA 2QKLB 2Y75A 2W24A 2A6EF 3JRDA 4W1UA 4BQAA 4IL6C 3M07A 1JJ8C 3QPHA 4M3FA 1YRNB 2WTEA 2IRFG 2IS1A 4JK1X 2Z16A 2NVUB 2EZIA 2Z33A 2XAUA 4MQ9F 1YS7A 5M5YJ 3FK7A 1N78A 4NC8A 4KIBA 3HOXJ 2BOLA 4BU2A 3CC2I 5CLSA 3HBLA 1TP4A 4YEJA 3ZQHA 1A6IA 2LH9A 4HSRA 3OIOA 4HLXA 2DU9A 3S16J 1Z0XA 3K4KA 2OF7A 2FF4A 3IWFA 4HDUA 4AIKA 1KZHA 2A5YB 3FXQA 2Y0SA 1ZR4A 4IHTA 4XQFA 3F8CA 2DA1A 5DCMA 4PDKA 4B3AA 4HX7A 4CCKA 1QVTA 3KCCA 3CUQA 4BUPA 2CU7A 1TQIA 3K69A 1T98A 5BPIA 4CXFA 4L9TA 4ZC3A 3GMEA 2EJRA 3VDXA 1IGNA 5EEHA 3OL3A 5E18F 4I0BA 2R3SA 4M9ZA 3GFJA 5GADJ 1FP1D 1D0ZA 4HX4A 3RIRA 1XCBA 2WWYA 2L4AA 1X1BA 2P0WA 4M3EA 5J1RA 5L3EA 3QPTA 3HG9A 4CZCA 1JUSA 3KP2A 1G3YA 2XAFA 1JI8A 2VPRA 1NHAA 4XKBA 4E7KA 3RYRA 1BW5A 4E7LA 2H94A 1S29A 4A0ZA 1SVMA 2ZBKA 5FD5A 5LFAA 3RKQA 1X3UA 2ZNYA 2YUSA 1TT0A 4LG0B 2DJNA 1YYVA 2QWWA 1B72A 1K78B 1HDDC 1VQ9I 3RZDJ 2ESNA 2GIZA 3O3KA 4QLCU 1O3QA 4RDUA 3QWLA 3K4BA 2M7AA 4D0PA 5KK1A 4LITA 1K7AA 5JVTA 5IY5H 1R58A 3PUBA 2W1OA 2X6OA 1WJCA 2ESHA 3HC7A 5CVRA 4YG2F 1YS6A 4ZYEA 2DPDA 1W1WE 3A02A 3DXJF 5DD8A 3S1NJ 3M3YJ 2DW4A 3ZXSA 2O8KA 2K5CA 1WKMA 1IZ1A 1MNMC 2WBMA 1JXSA 1F36A 2HGCA 4WK8F 1DU0A 3ZQIA 3BZCA 3CF5F 4BXFA 2JA2A 2ZMEA 4KUMA 2ELJA 2DA3A 3JRHA 2XIGA 1HC8A 3F6OA 4BQOA 3TP3A 1IAWA 1I5ZA 2HXOA 4B44A 3H3VK 2H1LA 4Q48A 4DYRA 2OQGA 3R60A 2GOXB 4LLNA 3IKTA 2W25A 1KQ9A 4RAZA 2GA1A 6PAXA 4II2A 4A3FJ 2R92J 1GXQA 2IS2A 2GWRA 4XM3A 1YFHA 4XMYA 2GM4A 4DZJA 2CV0A 4MHGA 2LG4A 3NWSA 3J7ZI 5C44J 3WHCA 3IHUA 4I98B 2B0LA 2ZJRF 2JK3A 1MBFA 3I5UA 4EM0B 2M87A 5FKMA 3V4GA 4A3KJ 2VJ4A 4LIUA 2O5RA 3SYTA 2HVQA 3ZQLA 5HVQC 3R0AA 2KIUA 2LOOA 2V1UA 1USTA 3GTMJ 3OSGA 2VOPA 2DCEA 4U7BA 3A0BC 1TWHJ 5HDNA 3KPHA 5HLGA 1YX5A 2OPTA 5H6QA 3CJRB 5DDGA 1B9MA 2WAQA 3S1RJ 2ZXWH 4L0ZB 3HJEA 1BC8C 4Y3OA 2RQPA 4FETA 2L54A 2QZ8A 4G9YA 4I99C 4ITVA 5B66C 2GIVA 5DUKA 3BR5A 1QZZA 4UB8C 4HOBA 4OINF 5D5UB 3W6KB 2YX4A 2M0MA 4KT5C 2HTJA 5KVRA 3HL2A 4XL9A 4GO1A 2DOEA 3CJNA 4XLEA 2V9PA 1MJ9A 3GZ5A 1GVDA 2ELHA 1XB4A 2ECCA 2F5DA 4BDZA 1GXPA 1DUXC 1U0JA 1XTAA 3K4CA 4O5VA 3G1LA 1HXDA 3IV5A 2JUCA 2JA5J 5C4JJ 2QLZA 1BIBA 2PMZN 4M73A 2CUFA 2OUMA 1ZLKA 4D5FA 2MLKA 2YS9A 4BJ6C 2V7FA 3A03A 4U87A 2XF5A 1J2XA 4GXOA 3PNTA 3SZPA 2R4GA 5D5WB 2CV2A 2YU3A 3Q9SA 1T2KA 1P6RA 4F93B 2UV1A 1PP8F 3CJTB 1OR7C 3HOSA 2UXNA 1IV8A 3BROA 1O7FA 1I1GA 2DMPA 2FU4A 2P4WA 4B3XA 1TT5B 2V4JC 4RB0A 3PO2J 2FOWA 2ZFWA 1FYKA 3ZCOA 2AS5F 3TO7A 2P6SA 2DJIA 3EETA 2OAZA 2K9LA 4KFCA 4AWXB 5IP6A 2COBA 5M5XJ 1MIJA 2CW8A 3E0JB 5FRMA 2VC0A 2D1VA 2ZXHA 2M4GA 3BQZA 3EUHA 3BTLA 3FXKA 2ZSHB 5HODA 2VJJA 3HKZA 2JRTA 2NVQJ 4NBQA 3CTAA 3M8EA 5LGNA 2DLLA 2YR2A 3IUOA 4ZZDA 1R49A 1JT0A 1VQLI 2XAGA 1QQIA 4ZZLA 4IX7A 2LKPA 3SEQA 5ICCA 1JT6A 1Y1VJ 1YLFA 3DF8A 4HNTA 1T38A 4HF2A 2EIMH 4BHCA 1HW2A 3RPUD 3J7AY 4CZZA 5HNHA 2FBIA 2FSWA 1W4MA 3E3VA 4XLFA 1ETXA 2TRTA 3GFMA 1W0TA 1I50J 3BR2A 3ZN0A 2RVCA 1DDNA 2KDZA 4E7HA 2JQ7A 2NOJB 1X1PA 2HZTA 4UB6C 3KFWX 1MBGA 3ZRGA 3BTIA 3I59A 4WF2A 1BA5A 1NH3A 4ZTFA 3I9V2 3DLLF 5CPRB 1B8IA 5F1JA 4LD5A 2TCTA 3ZMTA 1UMQA 3ZR8X 4DBRA 2VE9A 1P7IA 3L2RA 4P96A 4Z6YA 1RKTA 1MNDA 2Y30A 1YI2I 4UVBA 4JBAA 1K6OA 3CCLI 2WC2A 2VBXA 3ZQCA 5AONA 3GTQJ 1I39A 3ABMH 1IXCA 1X3WB 1EKEA 3FXOA 1WH7A 1LE8B 3TBIA 3F6VA 4S0HB 5DS9A 1WI9A 4IKFA 5DEQA 3QRFF 4EM1A 2COMA 3I54A 1JKPC 4I6ZA 1T56A 4QIWN 3BTCA 1VQ4I 3RKXA 2EFPA 3Q5FA 2IGMA 4RB2C 4D5CA 2EV5A 1GUUA 2M9HA 4OIPF 1QA6A 1QVUA 1WZ2A 3CDHA 4MQVA 4KISA 3U1KA 1J9IA 1ZG1A 1YJ9I 4RA2A 2BVMA 5KAIC 3C18A 3GZNB 2XAJA 4QPOA 1BJZA 2ZKZA 4BL0B 4U0YA 4KA4A 4ZJZA 2Y0MA 2CW7A 2YPRA 1DPRA 5L3CA 2EWNA 2PEXA 4Z2YA 4ZYGA 3FHZA 1BL0A 4C2MJ 4N4OB 3CCUI 1EJ9A 2HZDA 4AVZA 3OWTA 3TOBA 1MSEC 4FE4A 3P5JA 2NNYA 1Z21A 3L9FA 2I10A 4ZDPA 1POGA 1YTYA 3DKXA 5K7ZA 2E60A 5A2QK 1O7LA 1WHUA 3DCFA 3H1CA 2VJ5A 4D9JA 3EYYA 4BDYA 2R7WA 3OR1C 3U2RA 2EFNA 1GLNA 1FC3A 3ZMDA 3D5SC 1IJWC 2M7BA 4Y33A 5HLIA 2OV7A 3B6AA 3OS1A 5JI6A 3IC7A 3HRSA 3WODF 3M7GA 4ENNA 1GHCA 1QZYA 1TQPA 5E8GA 4JX5A 5LGUA 1A04A 2JVHA 2X6YA 2Q2EB 3HPGA 1HA8A 3ZPLA 3NARA 1MKMA 2CFXA 5A2QZ 1F4KA 1FOWA 2BHYA 2WB1A 1ZRCA 1YX3A 4RGXA 1IRGA 3LSHA 1ON1A 3B73A 4M72A 2KIFA 1RETA 4ASNA 3ECHA 3SZGA 4B47A 1Z9CA 1USSA 4V2FA 4XLAA 1AU7A 2CRGA 1A36A 4A3BJ 2ZJQF 4RM3A 1S7AA 5FLMJ 1MZBA 2F4IA 3MN2A 1Z91A 1E17A 2F5CA 5GAGJ 3T1BA 2JSPA 4HAMA 1JUMA 3BG5A 1WJAA 5EDNA 1BC7C 1MMDA 1AA7A 4JX4A 3IWZA 4FASD 1NK3P 9ANTA 1T6SA 2LC2A 2DMUA 1WRJA 4G6QA 4FT8A 4A6DA 1R5ID 4C2TA 2VBZA 4FX4A 2M8EA 4EVIA 3BG7A 3O6BB 2VXDA 3ZMZA 3E7LA 2CJJA 3FBIB 1IN7A 4B48A 2QGUA 3JSOA 3VYSB 5K5RA 3MWMA 1HBXG 2R7ZJ 1BR4A 4XN0A 4L5EA 5FFXA 4DGWB 1DP3A 3FXUA 4MGRA 2Y9YA 2V26A 3DTEA 2VQHA 3K9TA 1MJBA 3LNQA 2I5UA 3DPLC 3OYLA 3VWBA 2QSGX 1UAAA 3F72A 2KIMA 3F21A 2EA2A 2GA2A 4XSXF 2YSRA 1YRNA 1Q1HA 2AQFA 1BJAA 2OCEA 2KRFA 1XGMA 4AYBN 3JRBA 2DFHA 1YHQI 1TW2A 5J40A 5DTDA 2E34A 4ZH4F 3KZIC 1ZG5A 2R7SA 5FLXK 2L0KA 3DPTA 3H0GJ 4Q47A 2VOOA 1TWFJ 4LLLA 4A5NA 3IH2A 3DBRB 5FD6A 1B1BA 2FRHA 4FQGA 4I0AA 4CYCB 1Z77A 4EATA 4BACA 1SD7A 4Y17A 5F08A 2DT6A 4WXCA 4BY7J 5FB2A 4ESFA 2O61A 3QODA 4DYCA 3AFHA 3E6CC 1OCTC 1X3ZB 5L3FA 2GLOA 4S04A 1FBUA 4UUTA 2EFWA 5BQTA 1MNEA 5FLXZ 5F0CA 2LTPA 2PI0A 1OISA 3BTJA 3DEWA 4GYGA 3H3UA 3MKLA 1UJ8A 2DOAA 3MQ0A 1U8BA 1D8KA 3I4NJ 3I56I 2GXAA 3W2VA 1SFKA 4HX8A 4ON0A 3FKJA 5IP9J 4MIMA 4G6DA 4EMSA 1U2WA 2B63J 4MLOA 3E5QA 2EFQA 4ZTJA 1Y1WJ 1WCMJ 2KQRA 1ZR2A 4LIVA 2JSCA 2NOGA 1LFBA 3FHNA 3K4JA 3HOVJ 2IS4A 3BCBA 4HQMA 4PGGA 4KJZA 5ILSA 1HKQA 1WJDA 1H9GA 4PFPA 3T0YA 2QBYB 5LHIA 1JTXA 3PM1A 5CJ9A 4PJNA 4WX9A 5KNLA 2R93J 2DFFA 1FBSA 4LG0A 4KN4X 4DJAA 3I4PA 2Y48A 2X51A 1PP7U 3JRIA 1SFOJ 3TOAA 3IP4B 4MTEA 3E6BA 3J80K 1REPC 1XX5A 1HKSA 4PJMA 4PJJA 4UUVA 4DQ2A 1IN4A 4CA0A 1LEAA 1R4MB 4E4HA 2V1NA 3WTUC 3SFZA 1QPMA 1I1SA 1FBQA 2ZFUA 2GAUA 2RNGA 2HYJA 4AM3A 4ZDOA 1ZREA 1G3WA 2RDPA 1V55H 3F22A 3JW4A 3E6MA 2DMNA 2E1OA 3HRUA 1VQ5I 5DYMA 5JVGF 2L5QA 1S5LC 4UUSB 5K7FA 3RTRA 1AKHB 2IJLA 3MKYB 4M3GA 2BY1A 4XOTA 5JR3A 2BEOA 3FWEA 4FHTA 2JWTA 4PGHA 2GZWA 4YRVA 1BR1A 1F9NA 3IRRA 1OCCH 1YOVB 2K4JA 1KA8A 2X6WA 5HS9A 2CQQA 5CVVA 3KLNA 1IO2A 1FYLA 2KJCA 1BOBA 1J75A 1FLIA 2L9NA 5L3BA 3GCMA 3B02A 3KEYA 4TV7A 1J09A 1VQ8I 3HOUJ 3KYDB 4DNCA 4M74A 4EJTA 5CVIA 4GRIA 2RN7A 4IQ4A 2AHQA 2EZLA 1YG2A 2FOKA 2XAQA 2N8GA 3G6EI 1KQ0A 4HF1A 3KZZA 2VODA 1FIPA 5D5XB 1D3YA 1OR7A 1XDSA 3GF2A 3KP6A 2NNNA 4KIGA 1W7PB 1WJEA 5F0HA 2L9SA 2Y0SN 2DMTA 2PLYA 3EYIA 3F8BA 2JTVA 5B5EC 2LF7A 3DBHB 3D5LA 4HSTA 2JPCA 2ZO4A 4A3LJ 1V54H 2EK5A 3HRMA 3AG2H 3WE2A 2NRAC 1FX7A 2ELKA 2CMPA 2LKSA 4W97A 4EJWA 2AXLA 4OAZA 4I2OA 4ZYAA 4EQQA 1U3EM 1Z7UA 2W4SA 1MBKA 2WAEA 1OFCX 4JYKA 1P4AA 2CUEA 2CQXA 2V79A 3OV8A 4D1QA 1LPQA 4OIOF 3PQJA 4FCYA 4PJLA 5E3LA 4EGZA 3HRTA 2IPQX 4LK1F 3OYKA 2A6HF 2G7HA 3H36A 2FMYA 3HSFA 4UVAA 1NK2P 2F48A 4C3JJ 2HKXA 3CO6C 1PYVA 3PFIA 4XONA 3VSLA 1Z6RA 1E3PA 3ZN1A 4L0YB 3I58A 2OTLI 2IGNA 4OAYA 4CH7A 4C2UA 3LAJA 2MW8A 1G59A 4IHXA 4OWRB 1SC7A 3OYJA 3A2KA 4L5IA 2FX0A 3E6DA 5F0FA 1XSDA 3C1DA 1FTZA 1R1UA 4C3IJ 1VQ7I 2EV0A 2P5VA 2QQBA 1J5YA 3HTUA 5IT3A 1LDJA 5DM6F 1X1AA 1OKRA 2FNAA 2QA4I 2VL8A 2R0QC 1UHWA 3P7NA 2WY8Q 2VJIA 1ERDA 4D7MA 4L9NA 3GTKJ 3PNYA 4NUBA 4IQJA 2P7VB 2DFEA 4D7NA 5H20A 1RIOH 1FOKA 1HOMA 1IDYA 3L09A 2DQLA 4P9UA 1FNNA 1SMYF 2XPWA 3COAC 1WI3A 3QP6A 3ABUA 4KDPA 1JHFA 5LGTA 2Z5UA 1E3HA 2XAHA 2M0CA 1CF7B 4H4KC 2HVSA 2Q1ZB 3H3ZA 3BQYA 3HM5A 2A3SA 1RR8C 2QVOA 2ZXJA 1PJRA 2MYSA 1X58A 4GYIA 1FTTA 2KJBA 1VZ0A 2CFOA 3OYIA 1W5TA 2RAEA 3DU6A 5J4YA 2PJRB 5IYDJ 2DA4A 5E3MA 1FZPB 4IPAA 3VB2A 2ZJ2A 5IYCJ 3GFIA 1IG7A 1SVLA 2VKDA 1V5EA 5J8FA 4CGZA 5EG0B 3JR9A 5M5WJ 2UUZA 2ZXIA 2ZJPF 4P9FA 3QOPA 1XG1A 1X4PA 3WGIA 4CCMA 4RM2A 5FKLA 3VOEA 3BP8A 3LSPA 1SAUA 1ZGAA 3CMAI 4HEA2 1T39A 3QU6A 3NQOA 5E3OA 2WAQN 1Y8QB 2KZGA 1FPQA 4OMYA 1FMVA 2NVYJ 2BGCA 5D5VB 3K1MA 2X85A 3LSJA 3RDIA 2V9VA 4X6AJ 2NS0A 4BJTA 1UHSA 1IXRC 4RAFA 1LE8A 3CF2A 2HKOA 1ZYRF 5DCFA 1U6GA 2BZTA 3UKGA 2FBHA 2EH3A 3LA3A 1V5FA 1Y0NA 3WTZA 3OMYA 4ETSA 3TW6A 3OYNA 3K1PA 2E7XA 3NAUA 4AC0A 4EJVA 3U1DA 4IJAA 3WGGA 2O7OA 3IL2A 1FYMA 4RAYA 3KE2A 1WVRA 3SDGA 4MEYF 5E20A 2VT2A 4FX0A 2V6CA 3L00A 4R79A 3L2WA 2R5YB 1N25A 2W00A 2DK8A 1O57A 4Y13A 5D4RA 2PG4A 3PL8A 2IA2A 4QSHA 4CSWA 4A3EJ 2BBYA 2WA0A 2M45A 3BJOA 4M3BA 4Y4RA 3GLXA 2K3FA 3R0JA 4BEHB 2QCOA 2X6XA 1FT9A 2AO9A 3RPQA 1T0FC 3VODA 4GGGA 1T08B 2RREA 2DA6A 2KZVA 2L9VA 5J1YA 3F3XA 4ENMA 4A3DJ 2KP6A 1JE8A 3H9GA 1SEUA 2WV1A 5D8LB 3CJQB 2AXTC 2HDDA 4KN7X 3ZQQA 4BH9A 1OCZH 3PO3J 3FMSA 2PJPA 1R1TA 1W5CC 2Q0OA 5EF6A 3JRFA 1H8AC 3BR6A 2K9MA 2LK2A 3HKZN 1LFUP 2R7UA 2KFDA 1EV7A 2ISYA 1VNDA 4ZYDA 2E5ZA 5IOYA 1ITYA 2UXXA 1ORKA 2H6BA 1ZQ3P 1R9TJ 3QYBA 4J00A 3UR3C 2G9WA 3CMMA 1WPKA 3LSGA 4NHJA 1IV6A 1ZRFA 4IXAA 4LGWA 2Q2EA 2P5KA 2CSOA 1Z1DA 3G1OA 3MVPA 4IRIA 3SZTA 2IS6A 4HRIA 1MMGA 4K2EA 2Q8KA 2JN6A 3QYFA 3Q0WA 3PQKA 5DD4A 1UCRA 3CO7C 5F27A 4BYYA 2ZC2A 3L2CA 2NXNB 5D8KB 4J19A 1H9TA 2QQ9A 1XCVA 1O3TA 4MFEA 4F91B 1MDMB 3W3CA 1QGPA 3BZ6A 3RSNA 1RC9A 3HYIA 1JGGA 4BS9A 1W7PD 1Y6IA 2M5WA 4R8HA 1Q1VA 1OJLA 1T8IA 1APLC 3MAJA 4XOPA 1BM9A 3M1EA 3LSIA 1MH3A 4PUSA 5J1UA 1OCOH 2E7WA 3BG6A 3JAMK 2LNBA 3U9GA 2HYGD 2IVMA 4X1EA 3RQ4A 3MKZA 4V19K 1R7JA 3MMYB 3OYGA 2VIXA 3T8TA 4BBSJ 3VEPA 2R7VA 2JA6J 3CZ6A 2NS7A 2RKHA 5EYRA 1G4DA 3RQIA 1IDZA 2XHKA 3HHHA 2MC3A 2K86A 3JREA 2MABA 3ZP5A 3I53A 3WU2C 2HPIA 4XLPF 3ONQA 4C3HJ 4YFXF 5FFZA 2F4MB 4B1RA 1SFUA 3LFKA 3ZMVA 1PUFB 2H6CA 1I6XA 2B7EA 3DWLE 5FKKA 3JAMZ 1MJAA 3TO9A 1A6QA 4IHVA 3BJAA 1B59A 2LBFB 3CCJI 2R7XA 4M3DA 3GTLJ 1X2MA 4WXHA 3S8PA 4YIRX 4HYEA 3L2UA 4IEJA 1V3FA 3A01B 2BY2A 1U9OA 4CYCA 2DI3A 2DPUA 3K4MA 3FDYA 2K3PA 1WFXA 2EFOA 4AVPA 3WTVC 2E2IJ 2HI3A 5HLHA 1JKOC 1LVAA 3QYEA 3DBLB 2JVGA 4XBFA 5J47A 1WWXA 1Z05A 2CYYA 3S3MA 3IH4A 1S9HA 2BXZA 3SEZA 1D1AA 3L7WA 3M9AA 1A5JA 2L01A 3LA7A 3FXLA 2IA0A 5HS7A 5J6XA 4HQEA 3GTOJ 4IOAF 1J7KA 2IAIA 2W48A 4RS8A 3TEDA 1SMTA 1Z3XA 4XLHA 1TQMA 1UHMA 3N4MA 2I8DA 2VBWA 5FKOA 1HSTA 4EGYA 2JT1A 3O8GA 4LJZF 3I0TA 2DQRA 4I09A 3J81K 1K6YA 2PN6A 2QENA 3Q0VA 5AIQA 5K7HA 2QSHX 4IO9F 2EZHA 3C2GA 1MMSA 2TDXA 3OYFA 1XMXA 2WB1N 2EBIA 3ISPA 1ZTRA 5K5OA 1JJ6C 2KIQA 1K61A 2QBYA 2IXSA 1FY7A 1MW7A 1PUEE 2IA1A 2LP0A 2V6EA 1X1CA 5L3DA 4EJUA 1G8XA 2XF6A 3KEQA 2E1MB 5TGTA 5FLVA 2H8RA 2VUMJ 3AG4H 2FQ3A 4L9JA 1S7EA 1YIOA 2RV8A 2P8TA 4M9XA 5E1ZB 1NG6A 3J81Z 1LUJB 3LL7A 5D6EA 2ECBA 2O9LA 4A6EA 3FF5A 4NQWB 4PSXA 1AHDP 2ICWG 1ZGJA 3LWFA 2DMQA 3V8JA 4UV8A 2VQLA 1LQ1A 4I76A 3VSKA 2ACJA 3P9CA 1P7JA 3DPUA 1F5TA 1TLHB 2HWVA 1X4OA 2XGDA 3FBNB 4YFKF 4ESJA 1VQOI 3BPXA 3HXLA 1OCPA 1UFMA 3K2AA 1TWGJ 2FA5A 1IUFA 3H35A 4DYQA 2L7MP 2FUG2 3EUAA 4YIIA 3K10A 2BE5F 4UUSA 1XGNA 2MH2A 3LMMA 3PSIA 1AKHA 1WJBA 1DQUA 1FWZA 2QM3A 2XB5A 3X2QH 2GOMA 1VQNI 3V7RA 2Z99A 3GW2A 1Z67A 3FKIJ 1I3AA 1SVOA 3LSKA 2KRCA 4CYDA 4MEXF 1EH7A 3ELKA 4E7SA 1OMIA 4XKCA 4RLQA 4BHPA 1DP7P 3Q0UA 4KNYA 2L02A 3W2AA 1I6HJ 3KIOA 3VPRA 4A3CJ 4HPQA 1LDKB 5CVUA 2MBFA 2JRMA 2Y2ZA 3TGNA 2B9SA 3TDUC 3F9KA 3IAS2 1VQ6I 3C2HA 3L1PA 3AG3H 1ETOA 1Z3YA 3K6GA 3RPUA 1IRFA 3K0LA 3ABTA 5H6RA 2HQRA 2BW3B 5JHUA 1KQ8A 1QHGA 3A0HC 2OD5A 3S2DJ 3S2HJ 3CESA 2W85A 1ZAOA 3MD2A 2E2JJ 1W7PA 2BXYA 4N9HA 3G4SI 1MBJA 4Y7NJ 3HZJA 1GDTA 2DOFA 1BI3A 2E1MC 2DAOA 4XKVA 1K79A 3J7AO 3ERMA 5HOOA 3V42A 3OYAA 5TRDA 2X9DA 1VQKI 1JGSA 3IKVA 4UHTA 3ASOH 3M8FA 2F2EA 2H8WA 4CCOA 3FM3A 2HDCA 3OYEA 3LSRA 1YJWI 4NNJA 1N77A 1IUYA 4AU7A 3CDLA 1ETKA 1R5HA 1TWAJ 2EZKA 1EA3A 5B3SH 2EB7A 3KP3A 2CH0A 3KP7A 5BMZA 2EA4A 4FISA 1ZH5A 5E3NA 3OYBA 4HV6A 3H9JA 3NEUA 1S8NA 4FE7A 5FROA 4RGUA 3L2VA 2JJ7A 1B9NA 2QQAA 2FMLA 2HS5A 3JSPA 4RAGA 3Q9VA 4UV9A 3OS0A 3T5XA 5CQEA 2V9KA 3G73A 2JZYA 3ZQFA 5TJJA 1F43A 3I55I 5EJCA 1TZLA 3R4KA 2QSFX 2XGEA 2VKHA 1HKTA 4XLCA 3BG9A 2HFHA 2VBYA 3C2BA 3HGGA 3ABKH 4BHBA 2K9SA 1W0UA 3SFIA 4PCQA 3ZQ7A 4XRMA 3J7YJ 3A4CA 3FMQA 3D1NI 3I3LA 4AD9A 2M3AA 4YIFA 3VYTB 4DZPA 3K2ZA 3V7CA 2LKXA 2F4OB 2P7CB 3MCZA 1Y56A 2RNJA 4IHWA 2L2OA 2VN2A 2ZNZA 1I3QJ 4M9SA 1W36C 4A3GJ 3N05A 1GV5A 1VQMI 4F7ZA 1S7OA 5HDGA 3ML6A 3E1SA 3PNVA 1LFPA 2PQ8A 1RI7A 2PMHA 5HS8A 5H2FC 4FTHA 1ONVA 1FEXA 1P4XA 1CF7A 4MFDA 4II3A 2CGPA 3N97A 2CUZA 3O2PE 4IVNA 2C6YA 4CDGA 4G7HF 4IOCF 2LSOA 3BDDA 2MD0A 2HR3A 1ON2A 3W6JB 2CO5A 2XV4S 4C9YA 2IW5A 4M6XA 5F64A 3Q3SA 1J59A 2PJRA 2FD5A 2FE3A 5BNGA 4A0YA 3OYMA 1VFCA 1RUNA 1IC8A 1XSVA 3CQZJ 1T0FA 3FXJA 2HNHA 4BE1A 2QF7A 2XPUA 3V8KA 4N4NB 1HSJA 1JKQC 3D0SA 1XMKA 5EG0A 3RZOJ 1RR7A 2V1DA 1F1ZA 3NWTA 2DA7A 2XDVA 1SD4A 1QNTA 3BLYA 1E2XA 2K27A 2VT3A 3LSTA 4NB5A 4PK4A 1ETWA 2Z3YA 1OYIA 4JX6A 4G7ZF 2VKVA 3PFYA 2EIJH 2IGKA 1U5TB 2ADUA
chains in the Genus database with same CATH topology
1U78A 1UB9A 1B6AA 3KZYA 1C0WA 4RB3C 4G8XA 2XGXA 4WXDA 4S05A 1XD7A 2BV6A 3TDZC 3HSRA 3E5XA 3VFZA 1R22A 3HOTA 1P92A 1IW7F 4U0VA 2QUFA 2H09A 5HDKA 5ICFA 1FP2A 4GCVA 1YO5C 3FM5A 1ZARA 4A2UA 3F8NA 1KU2A 2VE8A 4ZYHA 2MLGA 5K5QA 2STWA 1P4WA 2H27A 3R61A 3JTHA 1KYZA 1H0MA 4B09A 1ZG3A 1R23A 2FBKA 2Z9OA 3AAFA 1SFEA 3FZVA 4A0XA 1U5TC 4ENKA 3WU0A 4LK0F 3TKYA 2LDUA 3DP7A 3GWZA 4EJOA 2LF8A 5LBQA 2G7UA 3GX4X 2CQKA 3OOPA 2W84A 4CO8A 2PBIA 5LEJA 4RGRA 2NYXA 3MEXA 4KMUX 3HSEA 1YQAA 3V7SA 4H0EA 4I01A 2MD5A 3GUDA 1MDMA 5ICGA 2OA4A 5JFRA 4I7HA 4G94A 1TTYA 3ERED 4O6JA 3SXYA 3DEUA 1LB2A 2RC4A 2ETHA 1SD6A 2A61A 1CGPA 1BI0A 1S3JA 1SFXA 3EDPA 3GZ6A 4P55A 2KKOA 2UZKA 2O6GE 3GFLA 4P5OA 3ROUA 3TO6A 2FNPA 3IRQA 3ULQB 1YW8A 1MD0A 2P5LC 1IXSB 4O3MA 2BYVE 3CUOA 2DBBA 5ERIA 1QBJA 1R1VA 4WCGA 1KU7A 5DCMB 4IRHA 1VTNC 4HLYA 2OZ6A 3CUQB 2O3FA 5D4SA 4OU0A 4EV0A 3WU1B 4A5MA 2FXAA 1STZA 2DTRA 5K1YA 1YW9A 4OOIA 4MTDA 1D5VA 3R6SA 4KMFA 5E1WA 3DFGA 2STTA 3P9KA 2HTSA 1IN5A 1IN8A 3WG9A 2ZCWA 4JQFA 1LDDA 4Q5SF 5ILUA 4Q4ZF 4HV5A 4RB1A 5BS6A 3WTXC 1KU3A 2ISZA 2GQQA 3ZMUA 2MH9A 5CYVA 5J8CA 5LLQA 4M71A 2GXBA 2PFBA 3ECOA 4NQWA 1O3SA 1RZ4A 4YFNF 4UVCA 5D6FA 3FX3A 1O3RA 1HW1A 3TQNA 4OIRF 2XVCA 4BAYA 2DK5A 1PDNC 2O03A 3KEOA 1I27A 1XGSA 5IT9K 4PZJA 3CUQC 4E70A 2ZMEB 1GVJA 5DUIA 3SHFA 1ULYA 3DV8A 2HOEA 4U88A 3MZHA 2O8XA 5F6FA 2V1XA 2CG4A 1YW7A 3I64A 4U7DA 3JTGA 1SAXA 3KETA 2D1HA 3E5UA 2K7LA 2D2WA 1J0RA 4L5JA 5IT9Z 3RI4A 4RGSA 3NRVA 4MNUA 3MFKA 4BXUA 4CHUA 1TW3A 3GXOA 2DT5A 3LAPA 4Y15A 2JPBA 2XUBA 2XASA 2GXGA 4L18B 1XN7A 3ZMSA 2XKOA 3QP5A 1IN6A 3GEZA 3BJ6A 5CVJA 3FMRA 1LEBA 2VXZA 3GVAA 1BN5A 4B8XA 1R36A 3WTSC 3HHGA 3KLOA 2OU2A 3C7JA 3V8LA 2X0LA 4HDVA 5ICEA 2R7FA 4N0BA 4LMYA 2L4MA 2HEOA 4WWCA 3F8MA 4AIJA 2A07F 1P2FA 2K4BA 1ZN2A 3BY6A 1ZHFA 1KU9A 2J5PA 2FEZA 3WE3A 3HTSB 1TNTA 2A68F 1G3SA 2F5FA 1R5GA 4HBLA 3RKWA 1MGTA 2XKPA 5E1XA 2OQRA 4IHSA 1XDUA 5FO5A 2M1BA 2O0YA 4ENJA 1OPCA 4IRGA 5AIPA 4ESBA 5ED4A 1JHHA 2K02A 5F1RA 2L3DA 2DO7A 1LNWA 3QU3A 1FSHA 3MZYA 2DFIA 2IP2A 4IF4A 1TNSA 3BPVA 5E8IA 2RGVA 2D45A 4OIQF 4LB5A 4U0WA 2UWMA 1XMAA 3E97A 4I02A 4R1HA 5BOXA 3BWGA 4M6YA 4CICA 4XLNF 1XSXA 2VC1A 2E1CA 2XROA 3C3WA 2WV0A 4HZFA 3I59B 1L3LA 2E1NA 5LRRA 2CW0F 2NAZA 3I71A 3EQLF 2HYFA 1AWCA 5ILVA 3RKYA 1U5TA 2QYOA 1AOYA 3S2WA 3GYHX 3LQRA 2PMUA 4A12A 1G3TA 1BOAA 4HF0A 1V4RA 5E17F 1HW5A 3LQQA 3WGHA 3H92A 1QO0D 3RYPA 2XRNA 1WQ2A 3GO5A 4HW0A 2M30A 4KIFA 1G6NA 1HQCA 4AIHA 3F8FA 5LHHA 3HUGA 1ZRDA 3CLOA 2MA3A 1OYWA 4QWQA 1W5SA 4XRFA 3LA2A 3G3ZA 3REOA 4LFUA 3FXRA 5FGMA 3T8RA 5EEGA 3DQVC 4N9IA 3HIFA 3P9IA 1BBYA 4XSZF 1BI2A 1Y0UA 3K1NA 1TBXA 1FSEA 3QAHA 5BPDA 4LLGF 1ODDA 1IF1A 1L0OC 4HA8A 1OYYA 5DV5A 4KYWA 2F5EA 3KP4A 1SD5A 2IT0A 3KP5A 1EH6A 1B4AA 3WTYC 4L9VA 5LRSA 1KGSA 1BI1A 3RJPA 4BNCA 1K78A 1LJ9A 1ZLJA 2CWEA 5LHGA 4G7OF 1RUOA 3BOQA 2OBPA 2W57A 4OMZA 1Z6TA 3WTWC 4KICA 3SQNA 2R7DA 2J5OA 3J80Z 4UNOA 2A69F 2EV6A 1KYWA 3WTTC 4LB6B 3F23A 2YX7A 1D8JA 2X4HA 3DKWA 2P6TA 1RNLA 5LEKA 4UXNA 2VONA 1EH8A 5L3GA 1DPUA 1XGOA 2OZUA 4EM2A 1BIAA 1WSUA 1S6LA 2HQNA 1R00A 1U8RA 2Y75A 2W24A 2A6EF 4BQAA 3QPHA 2IRFG 2WTEA 4JK1X 2Z33A 4MQ9F 1YS7A 4KIBA 5CLSA 4HLXA 2DU9A 2FF4A 3IWFA 4HDUA 4AIKA 2A5YB 3FXQA 4IHTA 3F8CA 5DCMA 4PDKA 4HX7A 3KCCA 3CUQA 3K69A 1TQIA 1T98A 5BPIA 4CXFA 4L9TA 2EJRA 5EEHA 5E18F 4I0BA 2R3SA 4M9ZA 3GFJA 1FP1D 4HX4A 3RIRA 1XCBA 2WWYA 2L4AA 5L3EA 3QPTA 3KP2A 1G3YA 2XAFA 1NHAA 3RYRA 2H94A 1S29A 4A0ZA 2ZBKA 5FD5A 1X3UA 2ZNYA 4LG0B 1YYVA 2QWWA 1K78B 2ESNA 3O3KA 4QLCU 1O3QA 4D0PA 5KK1A 1K7AA 5JVTA 1R58A 2ESHA 4YG2F 5CVRA 1YS6A 4ZYEA 2DPDA 3DXJF 5DD8A 2DW4A 1WKMA 1IZ1A 1JXSA 2HGCA 4WK8F 2ZMEA 4KUMA 2XIGA 3F6OA 1IAWA 1I5ZA 4Q48A 2OQGA 3R60A 4LLNA 3IKTA 2W25A 1KQ9A 4RAZA 2GA1A 6PAXA 1GXQA 2GWRA 1YFHA 4MHGA 3IHUA 4I98B 2B0LA 3I5UA 4EM0B 2M87A 3V4GA 5HVQC 3R0AA 2KIUA 2V1UA 1USTA 2VOPA 4U7BA 5HDNA 5HLGA 5H6QA 5DDGA 1B9MA 4L0ZB 1BC8C 2RQPA 2L54A 2QZ8A 4G9YA 2GIVA 5DUKA 1QZZA 4HOBA 4OINF 5D5UB 3W6KB 2YX4A 4KT5C 2HTJA 5KVRA 4GO1A 3CJNA 1MJ9A 3GZ5A 2ELHA 1XB4A 2F5DA 1GXPA 1DUXC 4O5VA 1HXDA 2QLZA 1BIBA 4M73A 1ZLKA 2MLKA 1J2XA 4GXOA 3SZPA 5D5WB 2YU3A 3Q9SA 1T2KA 1P6RA 1PP8F 3HOSA 2UXNA 3BROA 1O7FA 1I1GA 2FU4A 2P4WA 4RB0A 2ZFWA 1FYKA 2AS5F 3TO7A 2P6SA 3EETA 2OAZA 4KFCA 4AWXB 2VC0A 2D1VA 3EUHA 2JRTA 3CTAA 3M8EA 5LGNA 2DLLA 2YR2A 4ZZDA 2XAGA 1QQIA 4ZZLA 2LKPA 5ICCA 1YLFA 3DF8A 1T38A 4HF2A 4BHCA 1HW2A 4CZZA 2FBIA 2FSWA 1W4MA 3E3VA 3GFMA 3ZN0A 2RVCA 1DDNA 2HZTA 3KFWX 3I59A 4WF2A 4LD5A 3ZMTA 2VE9A 4P96A 4UVBA 4JBAA 1K6OA 2WC2A 2VBXA 5AONA 1IXCA 3F6VA 1WI9A 5DEQA 3QRFF 4EM1A 2COMA 3I54A 3RKXA 2EFPA 3Q5FA 4RB2C 2EV5A 4OIPF 3CDHA 4MQVA 1J9IA 1ZG1A 3C18A 2XAJA 2ZKZA 4U0YA 4KA4A 2Y0MA 2YPRA 1DPRA 5L3CA 2EWNA 2PEXA 4Z2YA 4ZYGA 3FHZA 3TOBA 2NNYA 3L9FA 1YTYA 5A2QK 1O7LA 3EYYA 3U2RA 2EFNA 1FC3A 3ZMDA 5HLIA 5JI6A 3IC7A 3HRSA 3WODF 3M7GA 4ENNA 1GHCA 1QZYA 1TQPA 5E8GA 5LGUA 1A04A 3ZPLA 1MKMA 2CFXA 5A2QZ 1F4KA 1ZRCA 4RGXA 1IRGA 1ON1A 3B73A 4M72A 2KIFA 4ASNA 3ECHA 1Z9CA 1USSA 1S7AA 1MZBA 1E17A 1Z91A 2F5CA 3T1BA 4HAMA 1BC7C 3IWZA 1T6SA 1WRJA 4G6QA 4FT8A 4A6DA 2VBZA 4FX4A 2M8EA 4EVIA 3O6BB 3ZMZA 1IN7A 3JSOA 5K5RA 3MWMA 1HBXG 5FFXA 3FXUA 4MGRA 3K9TA 1MJBA 3DPLC 3F72A 2KIMA 3F21A 2EA2A 2GA2A 4XSXF 2YSRA 1Q1HA 1BJAA 2KRFA 1XGMA 1TW2A 4ZH4F 1ZG5A 5FLXK 3DPTA 4Q47A 2VOOA 4LLLA 4A5NA 5FD6A 1B1BA 2FRHA 4I0AA 1SD7A 4Y17A 4WXCA 5FB2A 4ESFA 2O61A 3E6CC 5L3FA 4S04A 1FBUA 2EFWA 5BQTA 5FLXZ 2PI0A 4GYGA 3H3UA 3MQ0A 1D8KA 4HX8A 4ON0A 4G6DA 4EMSA 1U2WA 3E5QA 2EFQA 2JSCA 4HQMA 4PGGA 5ILSA 1HKQA 1H9GA 3T0YA 2QBYB 5LHIA 5CJ9A 4WX9A 1FBSA 4LG0A 4KN4X 3I4PA 2Y48A 1PP7U 3TOAA 4MTEA 3E6BA 3J80K 1REPC 1HKSA 4UUVA 4DQ2A 1IN4A 1LEAA 1I1SA 3WTUC 3SFZA 1QPMA 1FBQA 2GAUA 1ZREA 1G3WA 2RDPA 3F22A 3JW4A 3E6MA 3HRUA 5DYMA 3RTRA 2IJLA 5JR3A 2BEOA 3FWEA 4FHTA 4PGHA 2GZWA 1F9NA 3IRRA 2K4JA 1KA8A 5HS9A 5CVVA 3KLNA 1FYLA 2KJCA 1J75A 1FLIA 5L3BA 3B02A 4TV7A 4DNCA 4M74A 4EJTA 5CVIA 2RN7A 2FOKA 1YG2A 2XAQA 1KQ0A 4HF1A 3KZZA 2VODA 5D5XB 1D3YA 1OR7A 1XDSA 3GF2A 3KP6A 2NNNA 4KIGA 1W7PB 2PLYA 3EYIA 3F8BA 2JTVA 2LF7A 3D5LA 2JPCA 2ZO4A 2EK5A 3HRMA 3WE2A 2NRAC 1FX7A 4EJWA 2AXLA 4I2OA 4EQQA 1U3EM 1Z7UA 1P4AA 2V79A 3OV8A 4OIOF 3PQJA 4EGZA 3HRTA 2IPQX 4LK1F 2A6HF 2G7HA 2FMYA 3HSFA 4UVAA 2HKXA 3CO6C 3PFIA 1Z6RA 3ZN1A 4L0YB 3I58A 3LAJA 4L5IA 3E6DA 1XSDA 3C1DA 1R1UA 2EV0A 2P5VA 2QQBA 1J5YA 3HTUA 5IT3A 1LDJA 1OKRA 2FNAA 1UHWA 3P7NA 4L9NA 2P7VB 1RIOH 1FOKA 5H20A 3L09A 2DQLA 4P9UA 1FNNA 1SMYF 3COAC 3QP6A 3ABUA 4KDPA 1JHFA 5LGTA 2Z5UA 2XAHA 1CF7B 3H3ZA 2A3SA 2QVOA 2ZXJA 4GYIA 2KJBA 1W5TA 1FZPB 4IPAA 3VB2A 2ZJ2A 3GFIA 5J8FA 4CGZA 4P9FA 3QOPA 3WGIA 3VOEA 3BP8A 1ZGAA 1T39A 3QU6A 3NQOA 1FPQA 4OMYA 2BGCA 5D5VB 3K1MA 3RDIA 2V9VA 2NS0A 1IXRC 2HKOA 1ZYRF 5DCFA 1U6GA 2FBHA 3LA3A 3WTZA 4ETSA 3K1PA 2E7XA 4EJVA 3U1DA 4IJAA 3WGGA 3IL2A 1FYMA 4RAYA 3KE2A 4MEYF 5E20A 2VT2A 4FX0A 2V6CA 3L00A 4R79A 2DK8A 1O57A 4Y13A 5D4RA 2PG4A 2IA2A 2BBYA 2M45A 3BJOA 3GLXA 3R0JA 1FT9A 3RPQA 3VODA 4GGGA 3F3XA 4ENMA 1JE8A 5D8LB 4KN7X 4BH9A 3FMSA 2PJPA 1R1TA 2Q0OA 1EV7A 2ISYA 4ZYDA 2UXXA 2H6BA 2G9WA 4NHJA 1ZRFA 4IXAA 4LGWA 2Q2EA 2P5KA 2CSOA 1Z1DA 4IRIA 3SZTA 4K2EA 2Q8KA 3PQKA 5DD4A 1UCRA 3CO7C 4BYYA 3L2CA 5D8KB 1H9TA 2QQ9A 1XCVA 1O3TA 1MDMB 1QGPA 3BZ6A 3HYIA 1W7PD 2M5WA 4R8HA 3MAJA 1BM9A 3M1EA 2E7WA 3JAMK 2LNBA 3U9GA 2HYGD 2IVMA 1R7JA 3T8TA 3VEPA 2RKHA 1G4DA 2XHKA 3HHHA 2MC3A 2K86A 3ZP5A 3I53A 4XLPF 4YFXF 5FFZA 1SFUA 3LFKA 3ZMVA 2H6CA 1I6XA 3JAMZ 1MJAA 3TO9A 3BJAA 1B59A 4WXHA 4HYEA 1V3FA 2DI3A 2DPUA 2EFOA 4AVPA 3WTVC 5HLHA 1LVAA 4XBFA 1WWXA 1Z05A 2CYYA 3L7WA 3M9AA 2L01A 3LA7A 5HS7A 2IA0A 5J6XA 4HQEA 1J7KA 4RS8A 1SMTA 1TQMA 1UHMA 3N4MA 2VBWA 1HSTA 4EGYA 2JT1A 4LJZF 3I0TA 2DQRA 4I09A 3J81K 2PN6A 2QENA 5AIQA 2TDXA 3ISPA 5K5OA 2QBYA 1FY7A 1PUEE 2IA1A 5L3DA 4EJUA 3KEQA 2FQ3A 4L9JA 1YIOA 2RV8A 4M9XA 2P8TA 5E1ZB 3J81Z 5D6EA 4A6EA 3FF5A 1ZGJA 3LWFA 3V8JA 4UV8A 1LQ1A 2ACJA 3P9CA 1F5TA 1TLHB 2HWVA 4ESJA 4YFKF 3BPXA 1UFMA 2FA5A 4YIIA 2BE5F 1XGNA 2MH2A 1FWZA 2QM3A 3V7RA 2Z99A 3GW2A 4CYDA 4MEXF 1EH7A 3ELKA 1OMIA 4BHPA 1DP7P 4KNYA 2L02A 1LDKB 5CVUA 2MBFA 3TGNA 3TDUC 3RPUA 1IRFA 3K0LA 3ABTA 5H6RA 2HQRA 5JHUA 1KQ8A 2OD5A 2W85A 1ZAOA 1W7PA 4N9HA 1BI3A 2DAOA 1K79A 3J7AO 5HOOA 5TRDA 1JGSA 3IKVA 4UHTA 3M8FA 2F2EA 3FM3A 2HDCA 1IUYA 1R5HA 2EB7A 3KP3A 3KP7A 5BMZA 2EA4A 1ZH5A 4HV6A 3NEUA 1S8NA 4RGUA 1B9NA 2QQAA 3JSPA 2FMLA 2HS5A 3Q9VA 4UV9A 3T5XA 3G73A 2JZYA 5TJJA 3R4KA 1HKTA 2HFHA 2VBYA 4BHBA 4PCQA 3ZQ7A 3FMQA 4AD9A 4YIFA 3K2ZA 3V7CA 2P7CB 3MCZA 2RNJA 2VN2A 2ZNZA 4M9SA 4F7ZA 1S7OA 5HDGA 3ML6A 2PQ8A 1RI7A 2PMHA 5HS8A 1ONVA 1P4XA 1CF7A 2CGPA 3N97A 3O2PE 4IVNA 2C6YA 4CDGA 4G7HF 2LSOA 3BDDA 2HR3A 1ON2A 3W6JB 2CO5A 2XV4S 2IW5A 4M6XA 5F64A 1J59A 2FE3A 4A0YA 1RUNA 1XSVA 1T0FA 3V8KA 1HSJA 3D0SA 1XMKA 2V1DA 1F1ZA 1SD4A 1QNTA 1E2XA 2K27A 2VT3A 3LSTA 4NB5A 2Z3YA 1OYIA 4G7ZF 1U5TB 2ADUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U78 A;  1UB9 A;  1B6A A;  3KZY A;  1C0W A;  4RB3 C;  4G8X A;  2XGX A;  4WXD A;  4S05 A;  1XD7 A;  2BV6 A;  3TDZ C;  3HSR A;  3E5X A;  3VFZ A;  1R22 A;  3HOT A;  1P92 A;  1IW7 F;  4U0V A;  2QUF A;  2H09 A;  5HDK A;  5ICF A;  1FP2 A;  4GCV A;  1YO5 C;  3FM5 A;  1ZAR A;  4A2U A;  3F8N A;  1KU2 A;  2VE8 A;  4ZYH A;  2MLG A;  5K5Q A;  2STW A;  1P4W A;  2H27 A;  3R61 A;  3JTH A;  1KYZ A;  1H0M A;  4B09 A;  1ZG3 A;  1R23 A;  2FBK A;  2Z9O A;  3AAF A;  1SFE A;  3FZV A;  4A0X A;  1U5T C;  4ENK A;  3WU0 A;  4LK0 F;  3TKY A;  2LDU A;  3DP7 A;  3GWZ A;  4EJO A;  2LF8 A;  5LBQ A;  2G7U A;  3GX4 X;  2CQK A;  3OOP A;  2W84 A;  4CO8 A;  2PBI A;  5LEJ A;  4RGR A;  2NYX A;  3MEX A;  4KMU X;  3HSE A;  1YQA A;  3V7S A;  4H0E A;  4I01 A;  2MD5 A;  3GUD A;  1MDM A;  5ICG A;  2OA4 A;  5JFR A;  4I7H A;  4G94 A;  1TTY A;  3ERE D;  4O6J A;  3SXY A;  3DEU A;  1LB2 A;  2RC4 A;  2ETH A;  1SD6 A;  2A61 A;  1CGP A;  1BI0 A;  1S3J A;  1SFX A;  3EDP A;  3GZ6 A;  4P55 A;  2KKO A;  2UZK A;  2O6G E;  3GFL A;  4P5O A;  3ROU A;  3TO6 A;  2FNP A;  3IRQ A;  3ULQ B;  1YW8 A;  1MD0 A;  2P5L C;  1IXS B;  4O3M A;  2BYV E;  3CUO A;  2DBB A;  5ERI A;  1QBJ A;  1R1V A;  4WCG A;  1KU7 A;  5DCM B;  4IRH A;  1VTN C;  4HLY A;  2OZ6 A;  3CUQ B;  2O3F A;  5D4S A;  4OU0 A;  4EV0 A;  3WU1 B;  4A5M A;  2FXA A;  1STZ A;  2DTR A;  5K1Y A;  1YW9 A;  4OOI A;  4MTD A;  1D5V A;  3R6S A;  4KMF A;  5E1W A;  3DFG A;  2STT A;  3P9K A;  2HTS A;  1IN5 A;  1IN8 A;  3WG9 A;  2ZCW A;  4JQF A;  1LDD A;  4Q5S F;  5ILU A;  4Q4Z F;  4HV5 A;  4RB1 A;  5BS6 A;  3WTX C;  1KU3 A;  2ISZ A;  2GQQ A;  3ZMU A;  2MH9 A;  5CYV A;  5J8C A;  5LLQ A;  4M71 A;  2GXB A;  2PFB A;  3ECO A;  4NQW A;  1O3S A;  1RZ4 A;  4YFN F;  4UVC A;  5D6F A;  3FX3 A;  1O3R A;  1HW1 A;  3TQN A;  4OIR F;  2XVC A;  4BAY A;  2DK5 A;  1PDN C;  2O03 A;  3KEO A;  1I27 A;  1XGS A;  5IT9 K;  4PZJ A;  3CUQ C;  4E70 A;  2ZME B;  1GVJ A;  5DUI A;  3SHF A;  1ULY A;  3DV8 A;  2HOE A;  4U88 A;  3MZH A;  2O8X A;  5F6F A;  2V1X A;  2CG4 A;  1YW7 A;  3I64 A;  4U7D A;  3JTG A;  1SAX A;  3KET A;  2D1H A;  3E5U A;  2K7L A;  2D2W A;  1J0R A;  4L5J A;  5IT9 Z;  3RI4 A;  4RGS A;  3NRV A;  4MNU A;  3MFK A;  4BXU A;  4CHU A;  1TW3 A;  3GXO A;  2DT5 A;  3LAP A;  4Y15 A;  2JPB A;  2XUB A;  2XAS A;  2GXG A;  4L18 B;  1XN7 A;  3ZMS A;  2XKO A;  3QP5 A;  1IN6 A;  3GEZ A;  3BJ6 A;  5CVJ A;  3FMR A;  1LEB A;  2VXZ A;  3GVA A;  1BN5 A;  4B8X A;  1R36 A;  3WTS C;  3HHG A;  3KLO A;  2OU2 A;  3C7J A;  3V8L A;  2X0L A;  4HDV A;  5ICE A;  2R7F A;  4N0B A;  4LMY A;  2L4M A;  2HEO A;  4WWC A;  3F8M A;  4AIJ A;  2A07 F;  1P2F A;  2K4B A;  1ZN2 A;  3BY6 A;  1ZHF A;  1KU9 A;  2J5P A;  2FEZ A;  3WE3 A;  3HTS B;  1TNT A;  2A68 F;  1G3S A;  2F5F A;  1R5G A;  4HBL A;  3RKW A;  1MGT A;  2XKP A;  5E1X A;  2OQR A;  4IHS A;  1XDU A;  5FO5 A;  2M1B A;  2O0Y A;  4ENJ A;  1OPC A;  4IRG A;  5AIP A;  4ESB A;  5ED4 A;  1JHH A;  2K02 A;  5F1R A;  2L3D A;  2DO7 A;  1LNW A;  3QU3 A;  1FSH A;  3MZY A;  2DFI A;  2IP2 A;  4IF4 A;  1TNS A;  3BPV A;  5E8I A;  2RGV A;  2D45 A;  4OIQ F;  4LB5 A;  4U0W A;  2UWM A;  1XMA A;  3E97 A;  4I02 A;  4R1H A;  5BOX A;  3BWG A;  4M6Y A;  4CIC A;  4XLN F;  1XSX A;  2VC1 A;  2E1C A;  2XRO A;  3C3W A;  2WV0 A;  4HZF A;  3I59 B;  1L3L A;  2E1N A;  5LRR A;  2CW0 F;  2NAZ A;  3I71 A;  3EQL F;  2HYF A;  1AWC A;  5ILV A;  3RKY A;  1U5T A;  2QYO A;  1AOY A;  3S2W A;  3GYH X;  3LQR A;  2PMU A;  4A12 A;  1G3T A;  1BOA A;  4HF0 A;  1V4R A;  5E17 F;  1HW5 A;  3LQQ A;  3WGH A;  3H92 A;  1QO0 D;  3RYP A;  2XRN A;  1WQ2 A;  3GO5 A;  4HW0 A;  2M30 A;  4KIF A;  1G6N A;  1HQC A;  4AIH A;  3F8F A;  5LHH A;  3HUG A;  1ZRD A;  3CLO A;  2MA3 A;  1OYW A;  4QWQ A;  1W5S A;  4XRF A;  3LA2 A;  3G3Z A;  3REO A;  4LFU A;  3FXR A;  5FGM A;  3T8R A;  5EEG A;  3DQV C;  4N9I A;  3HIF A;  3P9I A;  1BBY A;  4XSZ F;  1BI2 A;  1Y0U A;  3K1N A;  1TBX A;  1FSE A;  3QAH A;  5BPD A;  4LLG F;  1ODD A;  1IF1 A;  1L0O C;  4HA8 A;  1OYY A;  5DV5 A;  4KYW A;  2F5E A;  3KP4 A;  1SD5 A;  2IT0 A;  3KP5 A;  1EH6 A;  1B4A A;  3WTY C;  4L9V A;  5LRS A;  1KGS A;  1BI1 A;  3RJP A;  4BNC A;  1K78 A;  1LJ9 A;  1ZLJ A;  2CWE A;  5LHG A;  4G7O F;  1RUO A;  3BOQ A;  2OBP A;  2W57 A;  4OMZ A;  1Z6T A;  3WTW C;  4KIC A;  3SQN A;  2R7D A;  2J5O A;  3J80 Z;  4UNO A;  2A69 F;  2EV6 A;  1KYW A;  3WTT C;  4LB6 B;  3F23 A;  2YX7 A;  1D8J A;  2X4H A;  3DKW A;  2P6T A;  1RNL A;  5LEK A;  4UXN A;  2VON A;  1EH8 A;  5L3G A;  1DPU A;  1XGO A;  2OZU A;  4EM2 A;  1BIA A;  1WSU A;  1S6L A;  2HQN A;  1R00 A;  1U8R A;  2Y75 A;  2W24 A;  2A6E F;  4BQA A;  3QPH A;  2IRF G;  2WTE A;  4JK1 X;  2Z33 A;  4MQ9 F;  1YS7 A;  4KIB A;  5CLS A;  4HLX A;  2DU9 A;  2FF4 A;  3IWF A;  4HDU A;  4AIK A;  2A5Y B;  3FXQ A;  4IHT A;  3F8C A;  5DCM A;  4PDK A;  4HX7 A;  3KCC A;  3CUQ A;  3K69 A;  1TQI A;  1T98 A;  5BPI A;  4CXF A;  4L9T A;  2EJR A;  5EEH A;  5E18 F;  4I0B A;  2R3S A;  4M9Z A;  3GFJ A;  1FP1 D;  4HX4 A;  3RIR A;  1XCB A;  2WWY A;  2L4A A;  5L3E A;  3QPT A;  3KP2 A;  1G3Y A;  2XAF A;  1NHA A;  3RYR A;  2H94 A;  1S29 A;  4A0Z A;  2ZBK A;  5FD5 A;  1X3U A;  2ZNY A;  4LG0 B;  1YYV A;  2QWW A;  1K78 B;  2ESN A;  3O3K A;  4QLC U;  1O3Q A;  4D0P A;  5KK1 A;  1K7A A;  5JVT A;  1R58 A;  2ESH A;  4YG2 F;  5CVR A;  1YS6 A;  4ZYE A;  2DPD A;  3DXJ F;  5DD8 A;  2DW4 A;  1WKM A;  1IZ1 A;  1JXS A;  2HGC A;  4WK8 F;  2ZME A;  4KUM A;  2XIG A;  3F6O A;  1IAW A;  1I5Z A;  4Q48 A;  2OQG A;  3R60 A;  4LLN A;  3IKT A;  2W25 A;  1KQ9 A;  4RAZ A;  2GA1 A;  6PAX A;  1GXQ A;  2GWR A;  1YFH A;  4MHG A;  3IHU A;  4I98 B;  2B0L A;  3I5U A;  4EM0 B;  2M87 A;  3V4G A;  5HVQ C;  3R0A A;  2KIU A;  2V1U A;  1UST A;  2VOP A;  4U7B A;  5HDN A;  5HLG A;  5H6Q A;  5DDG A;  1B9M A;  4L0Z B;  1BC8 C;  2RQP A;  2L54 A;  2QZ8 A;  4G9Y A;  2GIV A;  5DUK A;  1QZZ A;  4HOB A;  4OIN F;  5D5U B;  3W6K B;  2YX4 A;  4KT5 C;  2HTJ A;  5KVR A;  4GO1 A;  3CJN A;  1MJ9 A;  3GZ5 A;  2ELH A;  1XB4 A;  2F5D A;  1GXP A;  1DUX C;  4O5V A;  1HXD A;  2QLZ A;  1BIB A;  4M73 A;  1ZLK A;  2MLK A;  1J2X A;  4GXO A;  3SZP A;  5D5W B;  2YU3 A;  3Q9S A;  1T2K A;  1P6R A;  1PP8 F;  3HOS A;  2UXN A;  3BRO A;  1O7F A;  1I1G A;  2FU4 A;  2P4W A;  4RB0 A;  2ZFW A;  1FYK A;  2AS5 F;  3TO7 A;  2P6S A;  3EET A;  2OAZ A;  4KFC A;  4AWX B;  2VC0 A;  2D1V A;  3EUH A;  2JRT A;  3CTA A;  3M8E A;  5LGN A;  2DLL A;  2YR2 A;  4ZZD A;  2XAG A;  1QQI A;  4ZZL A;  2LKP A;  5ICC A;  1YLF A;  3DF8 A;  1T38 A;  4HF2 A;  4BHC A;  1HW2 A;  4CZZ A;  2FBI A;  2FSW A;  1W4M A;  3E3V A;  3GFM A;  3ZN0 A;  2RVC A;  1DDN A;  2HZT A;  3KFW X;  3I59 A;  4WF2 A;  4LD5 A;  3ZMT A;  2VE9 A;  4P96 A;  4UVB A;  4JBA A;  1K6O A;  2WC2 A;  2VBX A;  5AON A;  1IXC A;  3F6V A;  1WI9 A;  5DEQ A;  3QRF F;  4EM1 A;  2COM A;  3I54 A;  3RKX A;  2EFP A;  3Q5F A;  4RB2 C;  2EV5 A;  4OIP F;  3CDH A;  4MQV A;  1J9I A;  1ZG1 A;  3C18 A;  2XAJ A;  2ZKZ A;  4U0Y A;  4KA4 A;  2Y0M A;  2YPR A;  1DPR A;  5L3C A;  2EWN A;  2PEX A;  4Z2Y A;  4ZYG A;  3FHZ A;  3TOB A;  2NNY A;  3L9F A;  1YTY A;  5A2Q K;  1O7L A;  3EYY A;  3U2R A;  2EFN A;  1FC3 A;  3ZMD A;  5HLI A;  5JI6 A;  3IC7 A;  3HRS A;  3WOD F;  3M7G A;  4ENN A;  1GHC A;  1QZY A;  1TQP A;  5E8G A;  5LGU A;  1A04 A;  3ZPL A;  1MKM A;  2CFX A;  5A2Q Z;  1F4K A;  1ZRC A;  4RGX A;  1IRG A;  1ON1 A;  3B73 A;  4M72 A;  2KIF A;  4ASN A;  3ECH A;  1Z9C A;  1USS A;  1S7A A;  1MZB A;  1E17 A;  1Z91 A;  2F5C A;  3T1B A;  4HAM A;  1BC7 C;  3IWZ A;  1T6S A;  1WRJ A;  4G6Q A;  4FT8 A;  4A6D A;  2VBZ A;  4FX4 A;  2M8E A;  4EVI A;  3O6B B;  3ZMZ A;  1IN7 A;  3JSO A;  5K5R A;  3MWM A;  1HBX G;  5FFX A;  3FXU A;  4MGR A;  3K9T A;  1MJB A;  3DPL C;  3F72 A;  2KIM A;  3F21 A;  2EA2 A;  2GA2 A;  4XSX F;  2YSR A;  1Q1H A;  1BJA A;  2KRF A;  1XGM A;  1TW2 A;  4ZH4 F;  1ZG5 A;  5FLX K;  3DPT A;  4Q47 A;  2VOO A;  4LLL A;  4A5N A;  5FD6 A;  1B1B A;  2FRH A;  4I0A A;  1SD7 A;  4Y17 A;  4WXC A;  5FB2 A;  4ESF A;  2O61 A;  3E6C C;  5L3F A;  4S04 A;  1FBU A;  2EFW A;  5BQT A;  5FLX Z;  2PI0 A;  4GYG A;  3H3U A;  3MQ0 A;  1D8K A;  4HX8 A;  4ON0 A;  4G6D A;  4EMS A;  1U2W A;  3E5Q A;  2EFQ A;  2JSC A;  4HQM A;  4PGG A;  5ILS A;  1HKQ A;  1H9G A;  3T0Y A;  2QBY B;  5LHI A;  5CJ9 A;  4WX9 A;  1FBS A;  4LG0 A;  4KN4 X;  3I4P A;  2Y48 A;  1PP7 U;  3TOA A;  4MTE A;  3E6B A;  3J80 K;  1REP C;  1HKS A;  4UUV A;  4DQ2 A;  1IN4 A;  1LEA A;  1I1S A;  3WTU C;  3SFZ A;  1QPM A;  1FBQ A;  2GAU A;  1ZRE A;  1G3W A;  2RDP A;  3F22 A;  3JW4 A;  3E6M A;  3HRU A;  5DYM A;  3RTR A;  2IJL A;  5JR3 A;  2BEO A;  3FWE A;  4FHT A;  4PGH A;  2GZW A;  1F9N A;  3IRR A;  2K4J A;  1KA8 A;  5HS9 A;  5CVV A;  3KLN A;  1FYL A;  2KJC A;  1J75 A;  1FLI A;  5L3B A;  3B02 A;  4TV7 A;  4DNC A;  4M74 A;  4EJT A;  5CVI A;  2RN7 A;  2FOK A;  1YG2 A;  2XAQ A;  1KQ0 A;  4HF1 A;  3KZZ A;  2VOD A;  5D5X B;  1D3Y A;  1OR7 A;  1XDS A;  3GF2 A;  3KP6 A;  2NNN A;  4KIG A;  1W7P B;  2PLY A;  3EYI A;  3F8B A;  2JTV A;  2LF7 A;  3D5L A;  2JPC A;  2ZO4 A;  2EK5 A;  3HRM A;  3WE2 A;  2NRA C;  1FX7 A;  4EJW A;  2AXL A;  4I2O A;  4EQQ A;  1U3E M;  1Z7U A;  1P4A A;  2V79 A;  3OV8 A;  4OIO F;  3PQJ A;  4EGZ A;  3HRT A;  2IPQ X;  4LK1 F;  2A6H F;  2G7H A;  2FMY A;  3HSF A;  4UVA A;  2HKX A;  3CO6 C;  3PFI A;  1Z6R A;  3ZN1 A;  4L0Y B;  3I58 A;  3LAJ A;  4L5I A;  3E6D A;  1XSD A;  3C1D A;  1R1U A;  2EV0 A;  2P5V A;  2QQB A;  1J5Y A;  3HTU A;  5IT3 A;  1LDJ A;  1OKR A;  2FNA A;  1UHW A;  3P7N A;  4L9N A;  2P7V B;  1RIO H;  1FOK A;  5H20 A;  3L09 A;  2DQL A;  4P9U A;  1FNN A;  1SMY F;  3COA C;  3QP6 A;  3ABU A;  4KDP A;  1JHF A;  5LGT A;  2Z5U A;  2XAH A;  1CF7 B;  3H3Z A;  2A3S A;  2QVO A;  2ZXJ A;  4GYI A;  2KJB A;  1W5T A;  1FZP B;  4IPA A;  3VB2 A;  2ZJ2 A;  3GFI A;  5J8F A;  4CGZ A;  4P9F A;  3QOP A;  3WGI A;  3VOE A;  3BP8 A;  1ZGA A;  1T39 A;  3QU6 A;  3NQO A;  1FPQ A;  4OMY A;  2BGC A;  5D5V B;  3K1M A;  3RDI A;  2V9V A;  2NS0 A;  1IXR C;  2HKO A;  1ZYR F;  5DCF A;  1U6G A;  2FBH A;  3LA3 A;  3WTZ A;  4ETS A;  3K1P A;  2E7X A;  4EJV A;  3U1D A;  4IJA A;  3WGG A;  3IL2 A;  1FYM A;  4RAY A;  3KE2 A;  4MEY F;  5E20 A;  2VT2 A;  4FX0 A;  2V6C A;  3L00 A;  4R79 A;  2DK8 A;  1O57 A;  4Y13 A;  5D4R A;  2PG4 A;  2IA2 A;  2BBY A;  2M45 A;  3BJO A;  3GLX A;  3R0J A;  1FT9 A;  3RPQ A;  3VOD A;  4GGG A;  3F3X A;  4ENM A;  1JE8 A;  5D8L B;  4KN7 X;  4BH9 A;  3FMS A;  2PJP A;  1R1T A;  2Q0O A;  1EV7 A;  2ISY A;  4ZYD A;  2UXX A;  2H6B A;  2G9W A;  4NHJ A;  1ZRF A;  4IXA A;  4LGW A;  2Q2E A;  2P5K A;  2CSO A;  1Z1D A;  4IRI A;  3SZT A;  4K2E A;  2Q8K A;  3PQK A;  5DD4 A;  1UCR A;  3CO7 C;  4BYY A;  3L2C A;  5D8K B;  1H9T A;  2QQ9 A;  1XCV A;  1O3T A;  1MDM B;  1QGP A;  3BZ6 A;  3HYI A;  1W7P D;  2M5W A;  4R8H A;  3MAJ A;  1BM9 A;  3M1E A;  2E7W A;  3JAM K;  2LNB A;  3U9G A;  2HYG D;  2IVM A;  1R7J A;  3T8T A;  3VEP A;  2RKH A;  1G4D A;  2XHK A;  3HHH A;  2MC3 A;  2K86 A;  3ZP5 A;  3I53 A;  4XLP F;  4YFX F;  5FFZ A;  1SFU A;  3LFK A;  3ZMV A;  2H6C A;  1I6X A;  3JAM Z;  1MJA A;  3TO9 A;  3BJA A;  1B59 A;  4WXH A;  4HYE A;  1V3F A;  2DI3 A;  2DPU A;  2EFO A;  4AVP A;  3WTV C;  5HLH A;  1LVA A;  4XBF A;  1WWX A;  1Z05 A;  2CYY A;  3L7W A;  3M9A A;  2L01 A;  3LA7 A;  5HS7 A;  2IA0 A;  5J6X A;  4HQE A;  1J7K A;  4RS8 A;  1SMT A;  1TQM A;  1UHM A;  3N4M A;  2VBW A;  1HST A;  4EGY A;  2JT1 A;  4LJZ F;  3I0T A;  2DQR A;  4I09 A;  3J81 K;  2PN6 A;  2QEN A;  5AIQ A;  2TDX A;  3ISP A;  5K5O A;  2QBY A;  1FY7 A;  1PUE E;  2IA1 A;  5L3D A;  4EJU A;  3KEQ A;  2FQ3 A;  4L9J A;  1YIO A;  2RV8 A;  4M9X A;  2P8T A;  5E1Z B;  3J81 Z;  5D6E A;  4A6E A;  3FF5 A;  1ZGJ A;  3LWF A;  3V8J A;  4UV8 A;  1LQ1 A;  2ACJ A;  3P9C A;  1F5T A;  1TLH B;  2HWV A;  4ESJ A;  4YFK F;  3BPX A;  1UFM A;  2FA5 A;  4YII A;  2BE5 F;  1XGN A;  2MH2 A;  1FWZ A;  2QM3 A;  3V7R A;  2Z99 A;  3GW2 A;  4CYD A;  4MEX F;  1EH7 A;  3ELK A;  1OMI A;  4BHP A;  1DP7 P;  4KNY A;  2L02 A;  1LDK B;  5CVU A;  2MBF A;  3TGN A;  3TDU C;  3RPU A;  1IRF A;  3K0L A;  3ABT A;  5H6R A;  2HQR A;  5JHU A;  1KQ8 A;  2OD5 A;  2W85 A;  1ZAO A;  1W7P A;  4N9H A;  1BI3 A;  2DAO A;  1K79 A;  3J7A O;  5HOO A;  5TRD A;  1JGS A;  3IKV A;  4UHT A;  3M8F A;  2F2E A;  3FM3 A;  2HDC A;  1IUY A;  1R5H A;  2EB7 A;  3KP3 A;  3KP7 A;  5BMZ A;  2EA4 A;  1ZH5 A;  4HV6 A;  3NEU A;  1S8N A;  4RGU A;  1B9N A;  2QQA A;  3JSP A;  2FML A;  2HS5 A;  3Q9V A;  4UV9 A;  3T5X A;  3G73 A;  2JZY A;  5TJJ A;  3R4K A;  1HKT A;  2HFH A;  2VBY A;  4BHB A;  4PCQ A;  3ZQ7 A;  3FMQ A;  4AD9 A;  4YIF A;  3K2Z A;  3V7C A;  2P7C B;  3MCZ A;  2RNJ A;  2VN2 A;  2ZNZ A;  4M9S A;  4F7Z A;  1S7O A;  5HDG A;  3ML6 A;  2PQ8 A;  1RI7 A;  2PMH A;  5HS8 A;  1ONV A;  1P4X A;  1CF7 A;  2CGP A;  3N97 A;  3O2P E;  4IVN A;  2C6Y A;  4CDG A;  4G7H F;  2LSO A;  3BDD A;  2HR3 A;  1ON2 A;  3W6J B;  2CO5 A;  2XV4 S;  2IW5 A;  4M6X A;  5F64 A;  1J59 A;  2FE3 A;  4A0Y A;  1RUN A;  1XSV A;  1T0F A;  3V8K A;  1HSJ A;  3D0S A;  1XMK A;  2V1D A;  1F1Z A;  1SD4 A;  1QNT A;  1E2X A;  2K27 A;  2VT3 A;  3LST A;  4NB5 A;  2Z3Y A;  1OYI A;  4G7Z F;  1U5T B;  2ADU A; 
#chains in the Genus database with same CATH topology
 1U78 A;  1UB9 A;  2FQ4 A;  1B6A A;  3VYU B;  2ZSI B;  3KZY A;  5EGO B;  1C0W A;  4RB3 C;  1TC3 C;  1R71 A;  4G8X A;  3FIS A;  2XGX A;  4G6T B;  4XOR A;  3CCY A;  4IHY A;  4WXD A;  4A93 J;  4S05 A;  1XD7 A;  3BZK A;  2HVR A;  2BV6 A;  2X48 A;  3A1Y A;  3TDZ C;  1E3O C;  3HSR A;  1N75 A;  3E5X A;  1MMA A;  3VFZ A;  3M4O J;  1R22 A;  3HUG B;  3HOT A;  3BR1 A;  1P92 A;  1ZEL A;  4DBQ A;  1E0E A;  1IW7 F;  4U0V A;  1IRZ A;  2R5Y A;  2QUF A;  4A3J J;  2H09 A;  2KIS A;  2HDW A;  2Y31 A;  3UNG C;  1QRY A;  3TL4 X;  5HDK A;  5ICF A;  3HDD A;  2JA7 J;  4BEH A;  2R5Z B;  1LVK A;  1FP2 A;  4GCV A;  1YO5 C;  3FM5 A;  1ETV A;  1GV2 A;  1ZAR A;  4A2U A;  2EIK H;  3F8N A;  1KU2 A;  4PSW A;  2VE8 A;  4ZYH A;  4F3Q A;  2MLG A;  5K5Q A;  2STW A;  2LLK A;  1P4W A;  2H27 A;  3R61 A;  3JTH A;  1KYZ A;  3S14 J;  1H0M A;  4B09 A;  3FIW A;  1ZG3 A;  1R23 A;  2FBK A;  2Z9O A;  3AAF A;  1SFE A;  4BQQ A;  3FZV A;  4A0X A;  1U5T C;  2FJ1 A;  1MH4 A;  2GBY A;  2WAD A;  4BE0 A;  1H89 C;  4ENK A;  5FRN A;  3ZGK A;  3CCE I;  2Y69 H;  3WU0 A;  4G12 A;  4LK0 F;  2XGC A;  3BT9 A;  2VLA A;  2G0E A;  2KPM A;  3TKY A;  4B4C A;  2LDU A;  4X0G A;  3HOY J;  3DP7 A;  3GWZ A;  5C4X J;  4EJO A;  1X2N A;  2XPV A;  1ZK8 A;  2LF8 A;  5LBQ A;  2G7U A;  3GX4 X;  2CQK A;  3H5N A;  3ZOB A;  3CP8 A;  2E35 A;  2W84 A;  3OOP A;  4YEL A;  4CO8 A;  2A05 A;  2PBI A;  2LY9 A;  2MGQ A;  5LEJ A;  4RGR A;  2LYC A;  4XN3 A;  2W7N A;  4F55 A;  2NYX A;  3MEX A;  4KMU X;  3RCO A;  2OTJ I;  2DTZ A;  3HSE A;  2K9Q A;  1YQA A;  2M2E A;  3HPH A;  3KYL A;  5B1A H;  3V7S A;  1FJL A;  5IP7 J;  4H0E A;  4I01 A;  2MD5 A;  3GUD A;  1MDM A;  5ICG A;  2HOA A;  2OA4 A;  3S1M J;  5JFR A;  1Y39 A;  4I7H A;  4G94 A;  5GAE J;  3DEE A;  2D5V A;  2EQR A;  1A31 A;  1TTY A;  4CCJ A;  1W36 D;  4E7I A;  3H9Q A;  3ERE D;  2QKM B;  4BE2 A;  4O6J A;  2VQG A;  4QPQ A;  3SXY A;  3DEU A;  2HPM A;  4E7Z A;  1LB2 A;  2RC4 A;  2ETH A;  3CLQ A;  1SD6 A;  2A61 A;  1CGP A;  4ABZ A;  1BI0 A;  5GPC A;  3OR2 C;  1S3J A;  1ETQ A;  1SFX A;  3EDP A;  2DXI A;  3GZ6 A;  4P55 A;  2KKO A;  2UZK A;  3W6V A;  3WG7 H;  1K4S A;  2JMW A;  2O6G E;  3K70 D;  3GLL A;  3GFL A;  4P5O A;  3ROU A;  3TO6 A;  2H1K A;  5FJ8 J;  2FNP A;  3IRQ A;  3ULQ B;  1YW8 A;  1MD0 A;  2VKE A;  4M6V A;  3OYD A;  2K85 A;  4DIQ A;  3CD6 I;  2P5L C;  4HNV A;  1IXS B;  4O3M A;  1PUF A;  1GT0 C;  2BYV E;  5GP9 A;  1JKR C;  3CUO A;  2DBB A;  4BGD A;  2LBF A;  3OSF A;  2F5V A;  1ACI A;  1G2H A;  4LOC A;  3B6C A;  5ERI A;  3MZ8 A;  1EF4 A;  3A01 A;  5GTH C;  1QBJ A;  1ETY A;  1R1V A;  3I4M J;  3LSM A;  3MKW B;  3DTK A;  4WCG A;  3EPZ A;  2RQQ A;  1KU7 A;  3IAM 2;  5F04 A;  1BR2 A;  2K9N A;  1D0X A;  3F0C A;  3OL4 A;  1UG2 A;  5DCM B;  2NS8 A;  2E2H J;  1QPI A;  2DT7 B;  2E5N A;  4AID A;  4IRH A;  1VTN C;  2R7T A;  1K83 J;  4HLY A;  1HLV A;  2OZ6 A;  3CUQ B;  2Z1D A;  2O3F A;  1CQT A;  3DLA A;  5D4S A;  4CCL A;  4OU0 A;  2ID6 A;  4EV0 A;  2HOS A;  2BY0 A;  3WU1 B;  5GTI C;  5M3F J;  4A5M A;  3JRG A;  1O4X A;  1RES A;  1WGX A;  2DN0 A;  2BVL A;  3CMY A;  2FXA A;  4E6K G;  1STZ A;  2F6C A;  2DTR A;  5K1Y A;  2M8G X;  1YW9 A;  2E19 A;  4OOI A;  3HEF A;  4MTD A;  3R6S A;  1D5V A;  1TWC J;  2LVS A;  4KMF A;  5E1W A;  1HDP A;  3DFG A;  1UG0 A;  3KYC B;  2STT A;  3P9K A;  2HTS A;  2MC4 A;  1IN5 A;  1IN8 A;  1PVE A;  3WG9 A;  2R7R A;  2ZCW A;  3O8H A;  4JQF A;  1LDD A;  4Q5S F;  5ILU A;  4Q4Z F;  4HV5 A;  1RRJ A;  2JA8 J;  4RB1 A;  5BS6 A;  3WTX C;  3OY9 A;  1KU3 A;  1B72 B;  2ISZ A;  2GQQ A;  1ZKG A;  3ZMU A;  5J4V A;  2MH9 A;  5KAF C;  4A69 C;  2VAS A;  5CYV A;  5J8C A;  4F92 B;  2LD5 A;  2PMZ A;  3LOC A;  5LLQ A;  4M71 A;  4E7J A;  2GXB A;  2PFB A;  5E79 C;  1QU3 A;  3ECO A;  4NQW A;  1O3S A;  1RZ4 A;  4YFN F;  5DM7 F;  2EIN H;  4RLF A;  4UVC A;  3D5R C;  5D6F A;  1ZGW A;  1T33 A;  3FX3 A;  1VI0 A;  2DA2 A;  1O3R A;  1HW1 A;  3TQN A;  2HOT A;  5B1B H;  2R7O A;  4LG3 A;  5CQG A;  2NVT J;  2BHZ A;  4OIR F;  4GFB A;  2LFB A;  2XVC A;  4BAY A;  2LRD A;  2DK5 A;  2DOD A;  1PDN C;  2O03 A;  4BQN A;  2MSY A;  3KEO A;  1I27 A;  1XGS A;  2XC7 A;  3PIO F;  5IT9 K;  4PZJ A;  4XNF A;  1FOX A;  3CUQ C;  4E70 A;  2LRE A;  2ZME B;  3GBG A;  4DOZ A;  1GVJ A;  5DUI A;  3SHF A;  4PJ0 C;  2OCC H;  4XIC A;  1ULY A;  3DV8 A;  2HOE A;  4U88 A;  3MZH A;  4CCN A;  2L7Z A;  2R7Q A;  2MG4 A;  3BR0 A;  2DDB A;  1HF0 A;  2O8X A;  5F6F A;  3TW7 A;  2V1X A;  2CG4 A;  1FMW A;  1YW7 A;  3I64 A;  1M1E B;  3AKZ A;  3OIQ A;  4U7D A;  2DYR H;  3JTG A;  3KET A;  2D1H A;  1SAX A;  3E5U A;  5JLW A;  2K7L A;  3W2W A;  2D2W A;  1J0R A;  4L5J A;  5IT9 Z;  1SAN A;  3RI4 A;  4RGS A;  3NRV A;  4MNU A;  2BW3 A;  3MFK A;  4JP0 A;  2DYS H;  4BXU A;  4CHU A;  4XR6 A;  1XC5 A;  4KT6 A;  5LD2 C;  1QHH D;  3TP0 A;  1TW3 A;  3GXO A;  3L2Q A;  3CCV I;  2DT5 A;  2CQ7 A;  3LAP A;  4Y15 A;  2JPB A;  2XUB A;  5IYB J;  2YU9 J;  2XAS A;  2GXG A;  4RMN A;  1D5Y A;  4L18 B;  1XN7 A;  3CDI A;  1D1C A;  3K4N A;  3U21 A;  3S15 J;  3ZMS A;  2XKO A;  1H88 C;  3QP5 A;  1IN6 A;  1DGR M;  5IOZ A;  2DA5 A;  3GEZ A;  4BJ5 C;  3HGY A;  3BC8 A;  3BJ6 A;  5CVJ A;  3FMR A;  4Y52 J;  1LEB A;  2VXZ A;  1P9Q C;  1BN5 A;  3GVA A;  4B8X A;  1R36 A;  3WTS C;  3HHG A;  3KLO A;  2OU2 A;  3C7J A;  1MBE A;  4NDL A;  3V8L A;  1WH5 A;  2X0L A;  4XKW A;  1DU6 A;  4HDV A;  5ICE A;  3PSF A;  2EIL H;  5CKT A;  2DDA A;  2R7F A;  3JRC A;  1A35 A;  2OC6 A;  3CME I;  3IH3 A;  4N0B A;  2ZME C;  4ZDL A;  1XS9 A;  3GTP J;  4LMY A;  3FK6 A;  2WY7 Q;  2L4M A;  3CC4 I;  2HQA A;  2HEO A;  4WWC A;  2ZB9 A;  2LMD A;  3F8M A;  2XF7 A;  4AIJ A;  3QOE A;  3G1M A;  2QEX I;  3DKY A;  2LY1 A;  1WJF A;  2M4K A;  2A07 F;  1P2F A;  2K4B A;  3QPS A;  1ZN2 A;  3BY6 A;  2VQC A;  2XSJ C;  4JOM A;  1MSF C;  1ZHF A;  1X1D A;  5GAH J;  3JRA A;  2CV1 A;  1KU9 A;  2J5P A;  2FEZ A;  2CUJ A;  4BY1 J;  3WE3 A;  5EEA A;  3HTS B;  2PX9 A;  1TNT A;  1FOY A;  1S72 I;  2A68 F;  1G3S A;  2F5F A;  1R5G A;  2BY3 A;  4HBL A;  3RKW A;  1MGT A;  2XKP A;  5E1X A;  5KHD A;  2OQR A;  2LR8 A;  4KIT B;  5HNF A;  1HCR A;  3CC7 I;  2XB0 X;  1XDU A;  4IHS A;  4ANJ A;  3S3N A;  2CS3 A;  3HB9 A;  3PIP F;  5FO5 A;  2M1B A;  2OJE D;  2O0Y A;  4ENJ A;  1OPC A;  4IRG A;  5AIP A;  3GTG J;  1BW6 A;  4ESB A;  5ED4 A;  1JHH A;  2VB6 A;  4PFO A;  1WJ5 A;  2K02 A;  5F1R A;  2HXI A;  1D0Y A;  2L3D A;  2DO7 A;  1LNW A;  3KX2 A;  3ZQG A;  3SDB A;  1R4N B;  4HG2 A;  3AL0 B;  1UZC A;  3QU3 A;  4UY8 I;  1FSH A;  3MZY A;  2DFI A;  2IP2 A;  2HU9 A;  2JUG A;  4IF4 A;  1TNS A;  1RPW A;  4HNU A;  2VPL A;  2IEK A;  3BPV A;  5E8I A;  2RGV A;  2D45 A;  4B43 A;  5KCM A;  4OIQ F;  4LB5 A;  3CCQ I;  2E71 A;  4MO7 A;  3OOU A;  4U0W A;  2UWM A;  1XMA A;  3E97 A;  4I02 A;  4XRS A;  4R1H A;  5BOX A;  5JHF A;  1Y8R B;  3BWG A;  4M6Y A;  4CIC A;  4XLN F;  1XSX A;  2VC1 A;  2E1C A;  3HOZ J;  2XSD C;  2XRO A;  1R6R A;  3C3W A;  2HQ5 A;  3HOW J;  2WV0 A;  4CUG A;  4HZF A;  4A3I J;  3I59 B;  5IPA A;  1L3L A;  2E1N A;  2KHM A;  5LRR A;  2CW0 F;  2NAZ A;  4C30 A;  3I71 A;  3EQL F;  1B8I B;  4XRS G;  2HYF A;  1XPX A;  1AWC A;  5ILV A;  3H5R A;  3RKY A;  1MMN A;  1U5T A;  3K4L A;  2QYO A;  4EEF G;  1AOY A;  3S2W A;  2L7K A;  4P1W A;  1FIA A;  3CCS I;  2LY2 A;  3GYH X;  1YJN I;  1ENH A;  3ABL H;  5EGO A;  3LQR A;  2PMU A;  4A12 A;  2XRL A;  5JLX A;  1G3T A;  3H0D A;  1BOA A;  4HF0 A;  1V4R A;  5E17 F;  1HW5 A;  2QQ8 A;  5M3M J;  1V5G A;  1KON A;  3EUH C;  3LQQ A;  3WGH A;  3H92 A;  1QO0 D;  3RYP A;  2XRN A;  1T95 A;  4A3M J;  2E36 A;  3PUF A;  2EPF A;  1WQ2 A;  3GO5 A;  4HW0 A;  5TIS C;  2M30 A;  2W82 A;  1X19 A;  4KIF A;  1OLT A;  1G6N A;  1HQC A;  1JUP A;  2KT0 A;  3OIP A;  1K4T A;  3AL0 C;  4AIH A;  3F8F A;  2VI6 A;  3HUG A;  2ME0 A;  5LHH A;  2L9R A;  3CLO A;  1ZRD A;  3DTI A;  2NVX J;  3LFU A;  2ME6 A;  3SJM A;  2MA3 A;  2P81 A;  4AYB A;  1OYW A;  4QWQ A;  2M34 A;  1W5S A;  1DGW Y;  4XRF A;  3LA2 A;  3G3Z A;  3REO A;  1VF9 A;  4LFU A;  3FXR A;  1U9N A;  1UEL B;  5FGM A;  5C3E J;  3QPL A;  3T8R A;  2R5Z A;  4XID A;  5EEG A;  2X1C A;  3DQV C;  4N9I A;  3CCM I;  2L7F P;  2IBD A;  3HIF A;  4AUX A;  3S3O A;  3P9I A;  1BBY A;  3S93 A;  3S17 J;  4F52 A;  2Z2S B;  4XSZ F;  1BI2 A;  3TMO A;  1YIT I;  1Y0U A;  3K1N A;  5HLT A;  1TBX A;  1FSE A;  1YE9 A;  3QAH A;  4NC7 A;  4LLG F;  5BPD A;  1ODD A;  3AG1 H;  1IF1 A;  1VQP I;  1L0O C;  4HA8 A;  1OYY A;  5DV5 A;  2IGO A;  4KYW A;  3EUK L;  1NG7 A;  2F5E A;  1JTY A;  3KP4 A;  1SD5 A;  1LKX A;  2IT0 A;  5EZH A;  3DU5 A;  3KP5 A;  1EH6 A;  1B4A A;  4QTR A;  3WTY C;  5EZG A;  4L9V A;  2X1D A;  3K7A J;  2Y9Z A;  5LRS A;  3G2B A;  3CCR I;  1KGS A;  2AQE A;  1BI1 A;  3RJP A;  4DW6 A;  4BNC A;  1D1B A;  4NC6 A;  1K78 A;  3S1Q J;  1MBH A;  4BXX J;  1LJ9 A;  1RKW A;  4BBR J;  4GDF A;  1ZLJ A;  5GPA A;  3GTJ J;  3K70 C;  2CWE A;  5LHG A;  2WAF A;  3QQA A;  4G7O F;  1YIJ I;  3BCA A;  2KLO A;  1RUO A;  3WHB A;  3BR3 A;  3BOQ A;  3S32 A;  2OBP A;  2W57 A;  3M1C A;  3H5A A;  2KRH A;  4OMZ A;  1TL8 A;  2MFZ A;  1Z6T A;  1OCR H;  5J3L A;  1IRX A;  5FKN A;  3G71 I;  3WTW C;  4KIC A;  3SQN A;  2KL4 A;  3OS2 A;  2R7D A;  1Z7L A;  2J5O A;  2X1E A;  3M8J A;  3BG3 A;  2KDO A;  3J80 Z;  4J01 A;  2KMU A;  2K40 A;  4UNO A;  2A69 F;  4XK4 A;  2CQN A;  2EV6 A;  1OQY A;  1KYW A;  3ESW B;  3WTT C;  4LB6 B;  3F23 A;  2YX7 A;  1D8J A;  2X4H A;  3ASN H;  3DKW A;  4IZZ A;  1NTC A;  2A5W A;  2P6T A;  3PJR A;  4BKX A;  3CP2 A;  1RNL A;  5LEK A;  4UXN A;  4V2G A;  2VON A;  2A6T A;  1EH8 A;  5L3G A;  1QZE A;  1DPU A;  1XGO A;  2OZU A;  4EM2 A;  1BIA A;  3OYC A;  1WSU A;  4RBO A;  2ID3 A;  3FXM A;  3JCU C;  3VYR B;  1S6L A;  2HQN A;  1R00 A;  3OYH A;  1U8R A;  2QKL B;  2Y75 A;  2W24 A;  2A6E F;  3JRD A;  4W1U A;  4BQA A;  4IL6 C;  3M07 A;  1JJ8 C;  3QPH A;  4M3F A;  1YRN B;  2WTE A;  2IRF G;  2IS1 A;  4JK1 X;  2Z16 A;  2NVU B;  2EZI A;  2Z33 A;  2XAU A;  4MQ9 F;  1YS7 A;  5M5Y J;  3FK7 A;  1N78 A;  4NC8 A;  4KIB A;  3HOX J;  2BOL A;  4BU2 A;  3CC2 I;  5CLS A;  3HBL A;  1TP4 A;  4YEJ A;  3ZQH A;  1A6I A;  2LH9 A;  4HSR A;  3OIO A;  4HLX A;  2DU9 A;  3S16 J;  1Z0X A;  3K4K A;  2OF7 A;  2FF4 A;  3IWF A;  4HDU A;  4AIK A;  1KZH A;  2A5Y B;  3FXQ A;  2Y0S A;  1ZR4 A;  4IHT A;  4XQF A;  3F8C A;  2DA1 A;  5DCM A;  4PDK A;  4B3A A;  4HX7 A;  4CCK A;  1QVT A;  3KCC A;  3CUQ A;  4BUP A;  2CU7 A;  1TQI A;  3K69 A;  1T98 A;  5BPI A;  4CXF A;  4L9T A;  4ZC3 A;  3GME A;  2EJR A;  3VDX A;  1IGN A;  5EEH A;  3OL3 A;  5E18 F;  4I0B A;  2R3S A;  4M9Z A;  3GFJ A;  5GAD J;  1FP1 D;  1D0Z A;  4HX4 A;  3RIR A;  1XCB A;  2WWY A;  2L4A A;  1X1B A;  2P0W A;  4M3E A;  5J1R A;  5L3E A;  3QPT A;  3HG9 A;  4CZC A;  1JUS A;  3KP2 A;  1G3Y A;  2XAF A;  1JI8 A;  2VPR A;  1NHA A;  4XKB A;  4E7K A;  3RYR A;  1BW5 A;  4E7L A;  2H94 A;  1S29 A;  4A0Z A;  1SVM A;  2ZBK A;  5FD5 A;  5LFA A;  3RKQ A;  1X3U A;  2ZNY A;  2YUS A;  1TT0 A;  4LG0 B;  2DJN A;  1YYV A;  2QWW A;  1B72 A;  1K78 B;  1HDD C;  1VQ9 I;  3RZD J;  2ESN A;  2GIZ A;  3O3K A;  4QLC U;  1O3Q A;  4RDU A;  3QWL A;  3K4B A;  2M7A A;  4D0P A;  5KK1 A;  4LIT A;  1K7A A;  5JVT A;  5IY5 H;  1R58 A;  3PUB A;  2W1O A;  2X6O A;  1WJC A;  2ESH A;  3HC7 A;  5CVR A;  4YG2 F;  1YS6 A;  4ZYE A;  2DPD A;  1W1W E;  3A02 A;  3DXJ F;  5DD8 A;  3S1N J;  3M3Y J;  2DW4 A;  3ZXS A;  2O8K A;  2K5C A;  1WKM A;  1IZ1 A;  1MNM C;  2WBM A;  1JXS A;  1F36 A;  2HGC A;  4WK8 F;  1DU0 A;  3ZQI A;  3BZC A;  3CF5 F;  4BXF A;  2JA2 A;  2ZME A;  4KUM A;  2ELJ A;  2DA3 A;  3JRH A;  2XIG A;  1HC8 A;  3F6O A;  4BQO A;  3TP3 A;  1IAW A;  1I5Z A;  2HXO A;  4B44 A;  3H3V K;  2H1L A;  4Q48 A;  4DYR A;  2OQG A;  3R60 A;  2GOX B;  4LLN A;  3IKT A;  2W25 A;  1KQ9 A;  4RAZ A;  2GA1 A;  6PAX A;  4II2 A;  4A3F J;  2R92 J;  1GXQ A;  2IS2 A;  2GWR A;  4XM3 A;  1YFH A;  4XMY A;  2GM4 A;  4DZJ A;  2CV0 A;  4MHG A;  2LG4 A;  3NWS A;  3J7Z I;  5C44 J;  3WHC A;  3IHU A;  4I98 B;  2B0L A;  2ZJR F;  2JK3 A;  1MBF A;  3I5U A;  4EM0 B;  2M87 A;  5FKM A;  3V4G A;  4A3K J;  2VJ4 A;  4LIU A;  2O5R A;  3SYT A;  2HVQ A;  3ZQL A;  5HVQ C;  3R0A A;  2KIU A;  2LOO A;  2V1U A;  1UST A;  3GTM J;  3OSG A;  2VOP A;  2DCE A;  4U7B A;  3A0B C;  1TWH J;  5HDN A;  3KPH A;  5HLG A;  1YX5 A;  2OPT A;  5H6Q A;  3CJR B;  5DDG A;  1B9M A;  2WAQ A;  3S1R J;  2ZXW H;  4L0Z B;  3HJE A;  1BC8 C;  4Y3O A;  2RQP A;  4FET A;  2L54 A;  2QZ8 A;  4G9Y A;  4I99 C;  4ITV A;  5B66 C;  2GIV A;  5DUK A;  3BR5 A;  1QZZ A;  4UB8 C;  4HOB A;  4OIN F;  5D5U B;  3W6K B;  2YX4 A;  2M0M A;  4KT5 C;  2HTJ A;  5KVR A;  3HL2 A;  4XL9 A;  4GO1 A;  2DOE A;  3CJN A;  4XLE A;  2V9P A;  1MJ9 A;  3GZ5 A;  1GVD A;  2ELH A;  1XB4 A;  2ECC A;  2F5D A;  4BDZ A;  1GXP A;  1DUX C;  1U0J A;  1XTA A;  3K4C A;  4O5V A;  3G1L A;  1HXD A;  3IV5 A;  2JUC A;  2JA5 J;  5C4J J;  2QLZ A;  1BIB A;  2PMZ N;  4M73 A;  2CUF A;  2OUM A;  1ZLK A;  4D5F A;  2MLK A;  2YS9 A;  4BJ6 C;  2V7F A;  3A03 A;  4U87 A;  2XF5 A;  1J2X A;  4GXO A;  3PNT A;  3SZP A;  2R4G A;  5D5W B;  2CV2 A;  2YU3 A;  3Q9S A;  1T2K A;  1P6R A;  4F93 B;  2UV1 A;  1PP8 F;  3CJT B;  1OR7 C;  3HOS A;  2UXN A;  1IV8 A;  3BRO A;  1O7F A;  1I1G A;  2DMP A;  2FU4 A;  2P4W A;  4B3X A;  1TT5 B;  2V4J C;  4RB0 A;  3PO2 J;  2FOW A;  2ZFW A;  1FYK A;  3ZCO A;  2AS5 F;  3TO7 A;  2P6S A;  2DJI A;  3EET A;  2OAZ A;  2K9L A;  4KFC A;  4AWX B;  5IP6 A;  2COB A;  5M5X J;  1MIJ A;  2CW8 A;  3E0J B;  5FRM A;  2VC0 A;  2D1V A;  2ZXH A;  2M4G A;  3BQZ A;  3EUH A;  3BTL A;  3FXK A;  2ZSH B;  5HOD A;  2VJJ A;  3HKZ A;  2JRT A;  2NVQ J;  4NBQ A;  3CTA A;  3M8E A;  5LGN A;  2DLL A;  2YR2 A;  3IUO A;  4ZZD A;  1R49 A;  1JT0 A;  1VQL I;  2XAG A;  1QQI A;  4ZZL A;  4IX7 A;  2LKP A;  3SEQ A;  5ICC A;  1JT6 A;  1Y1V J;  1YLF A;  3DF8 A;  4HNT A;  1T38 A;  4HF2 A;  2EIM H;  4BHC A;  1HW2 A;  3RPU D;  3J7A Y;  4CZZ A;  5HNH A;  2FBI A;  2FSW A;  1W4M A;  3E3V A;  4XLF A;  1ETX A;  2TRT A;  3GFM A;  1W0T A;  1I50 J;  3BR2 A;  3ZN0 A;  2RVC A;  1DDN A;  2KDZ A;  4E7H A;  2JQ7 A;  2NOJ B;  1X1P A;  2HZT A;  4UB6 C;  3KFW X;  1MBG A;  3ZRG A;  3BTI A;  3I59 A;  4WF2 A;  1BA5 A;  1NH3 A;  4ZTF A;  3I9V 2;  3DLL F;  5CPR B;  1B8I A;  5F1J A;  4LD5 A;  2TCT A;  3ZMT A;  1UMQ A;  3ZR8 X;  4DBR A;  2VE9 A;  1P7I A;  3L2R A;  4P96 A;  4Z6Y A;  1RKT A;  1MND A;  2Y30 A;  1YI2 I;  4UVB A;  4JBA A;  1K6O A;  3CCL I;  2WC2 A;  2VBX A;  3ZQC A;  5AON A;  3GTQ J;  1I39 A;  3ABM H;  1IXC A;  1X3W B;  1EKE A;  3FXO A;  1WH7 A;  1LE8 B;  3TBI A;  3F6V A;  4S0H B;  5DS9 A;  1WI9 A;  4IKF A;  5DEQ A;  3QRF F;  4EM1 A;  2COM A;  3I54 A;  1JKP C;  4I6Z A;  1T56 A;  4QIW N;  3BTC A;  1VQ4 I;  3RKX A;  2EFP A;  3Q5F A;  2IGM A;  4RB2 C;  4D5C A;  2EV5 A;  1GUU A;  2M9H A;  4OIP F;  1QA6 A;  1QVU A;  1WZ2 A;  3CDH A;  4MQV A;  4KIS A;  3U1K A;  1J9I A;  1ZG1 A;  1YJ9 I;  4RA2 A;  2BVM A;  5KAI C;  3C18 A;  3GZN B;  2XAJ A;  4QPO A;  1BJZ A;  2ZKZ A;  4BL0 B;  4U0Y A;  4KA4 A;  4ZJZ A;  2Y0M A;  2CW7 A;  2YPR A;  1DPR A;  5L3C A;  2EWN A;  2PEX A;  4Z2Y A;  4ZYG A;  3FHZ A;  1BL0 A;  4C2M J;  4N4O B;  3CCU I;  1EJ9 A;  2HZD A;  4AVZ A;  3OWT A;  3TOB A;  1MSE C;  4FE4 A;  3P5J A;  2NNY A;  1Z21 A;  3L9F A;  2I10 A;  4ZDP A;  1POG A;  1YTY A;  3DKX A;  5K7Z A;  2E60 A;  5A2Q K;  1O7L A;  1WHU A;  3DCF A;  3H1C A;  2VJ5 A;  4D9J A;  3EYY A;  4BDY A;  2R7W A;  3OR1 C;  3U2R A;  2EFN A;  1GLN A;  1FC3 A;  3ZMD A;  3D5S C;  1IJW C;  2M7B A;  4Y33 A;  5HLI A;  2OV7 A;  3B6A A;  3OS1 A;  5JI6 A;  3IC7 A;  3HRS A;  3WOD F;  3M7G A;  4ENN A;  1GHC A;  1QZY A;  1TQP A;  5E8G A;  4JX5 A;  5LGU A;  1A04 A;  2JVH A;  2X6Y A;  2Q2E B;  3HPG A;  1HA8 A;  3ZPL A;  3NAR A;  1MKM A;  2CFX A;  5A2Q Z;  1F4K A;  1FOW A;  2BHY A;  2WB1 A;  1ZRC A;  1YX3 A;  4RGX A;  1IRG A;  3LSH A;  1ON1 A;  3B73 A;  4M72 A;  2KIF A;  1RET A;  4ASN A;  3ECH A;  3SZG A;  4B47 A;  1Z9C A;  1USS A;  4V2F A;  4XLA A;  1AU7 A;  2CRG A;  1A36 A;  4A3B J;  2ZJQ F;  4RM3 A;  1S7A A;  5FLM J;  1MZB A;  2F4I A;  3MN2 A;  1Z91 A;  1E17 A;  2F5C A;  5GAG J;  3T1B A;  2JSP A;  4HAM A;  1JUM A;  3BG5 A;  1WJA A;  5EDN A;  1BC7 C;  1MMD A;  1AA7 A;  4JX4 A;  3IWZ A;  4FAS D;  1NK3 P;  9ANT A;  1T6S A;  2LC2 A;  2DMU A;  1WRJ A;  4G6Q A;  4FT8 A;  4A6D A;  1R5I D;  4C2T A;  2VBZ A;  4FX4 A;  2M8E A;  4EVI A;  3BG7 A;  3O6B B;  2VXD A;  3ZMZ A;  3E7L A;  2CJJ A;  3FBI B;  1IN7 A;  4B48 A;  2QGU A;  3JSO A;  3VYS B;  5K5R A;  3MWM A;  1HBX G;  2R7Z J;  1BR4 A;  4XN0 A;  4L5E A;  5FFX A;  4DGW B;  1DP3 A;  3FXU A;  4MGR A;  2Y9Y A;  2V26 A;  3DTE A;  2VQH A;  3K9T A;  1MJB A;  3LNQ A;  2I5U A;  3DPL C;  3OYL A;  3VWB A;  2QSG X;  1UAA A;  3F72 A;  2KIM A;  3F21 A;  2EA2 A;  2GA2 A;  4XSX F;  2YSR A;  1YRN A;  1Q1H A;  2AQF A;  1BJA A;  2OCE A;  2KRF A;  1XGM A;  4AYB N;  3JRB A;  2DFH A;  1YHQ I;  1TW2 A;  5J40 A;  5DTD A;  2E34 A;  4ZH4 F;  3KZI C;  1ZG5 A;  2R7S A;  5FLX K;  2L0K A;  3DPT A;  3H0G J;  4Q47 A;  2VOO A;  1TWF J;  4LLL A;  4A5N A;  3IH2 A;  3DBR B;  5FD6 A;  1B1B A;  2FRH A;  4FQG A;  4I0A A;  4CYC B;  1Z77 A;  4EAT A;  4BAC A;  1SD7 A;  4Y17 A;  5F08 A;  2DT6 A;  4WXC A;  4BY7 J;  5FB2 A;  4ESF A;  2O61 A;  3QOD A;  4DYC A;  3AFH A;  3E6C C;  1OCT C;  1X3Z B;  5L3F A;  2GLO A;  4S04 A;  1FBU A;  4UUT A;  2EFW A;  5BQT A;  1MNE A;  5FLX Z;  5F0C A;  2LTP A;  2PI0 A;  1OIS A;  3BTJ A;  3DEW A;  4GYG A;  3H3U A;  3MKL A;  1UJ8 A;  2DOA A;  3MQ0 A;  1U8B A;  1D8K A;  3I4N J;  3I56 I;  2GXA A;  3W2V A;  1SFK A;  4HX8 A;  4ON0 A;  3FKJ A;  5IP9 J;  4MIM A;  4G6D A;  4EMS A;  1U2W A;  2B63 J;  4MLO A;  3E5Q A;  2EFQ A;  4ZTJ A;  1Y1W J;  1WCM J;  2KQR A;  1ZR2 A;  4LIV A;  2JSC A;  2NOG A;  1LFB A;  3FHN A;  3K4J A;  3HOV J;  2IS4 A;  3BCB A;  4HQM A;  4PGG A;  4KJZ A;  5ILS A;  1HKQ A;  1WJD A;  1H9G A;  4PFP A;  3T0Y A;  2QBY B;  5LHI A;  1JTX A;  3PM1 A;  5CJ9 A;  4PJN A;  4WX9 A;  5KNL A;  2R93 J;  2DFF A;  1FBS A;  4LG0 A;  4KN4 X;  4DJA A;  3I4P A;  2Y48 A;  2X51 A;  1PP7 U;  3JRI A;  1SFO J;  3TOA A;  3IP4 B;  4MTE A;  3E6B A;  3J80 K;  1REP C;  1XX5 A;  1HKS A;  4PJM A;  4PJJ A;  4UUV A;  4DQ2 A;  1IN4 A;  4CA0 A;  1LEA A;  1R4M B;  4E4H A;  2V1N A;  3WTU C;  3SFZ A;  1QPM A;  1I1S A;  1FBQ A;  2ZFU A;  2GAU A;  2RNG A;  2HYJ A;  4AM3 A;  4ZDO A;  1ZRE A;  1G3W A;  2RDP A;  1V55 H;  3F22 A;  3JW4 A;  3E6M A;  2DMN A;  2E1O A;  3HRU A;  1VQ5 I;  5DYM A;  5JVG F;  2L5Q A;  1S5L C;  4UUS B;  5K7F A;  3RTR A;  1AKH B;  2IJL A;  3MKY B;  4M3G A;  2BY1 A;  4XOT A;  5JR3 A;  2BEO A;  3FWE A;  4FHT A;  2JWT A;  4PGH A;  2GZW A;  4YRV A;  1BR1 A;  1F9N A;  3IRR A;  1OCC H;  1YOV B;  2K4J A;  1KA8 A;  2X6W A;  5HS9 A;  2CQQ A;  5CVV A;  3KLN A;  1IO2 A;  1FYL A;  2KJC A;  1BOB A;  1J75 A;  1FLI A;  2L9N A;  5L3B A;  3GCM A;  3B02 A;  3KEY A;  4TV7 A;  1J09 A;  1VQ8 I;  3HOU J;  3KYD B;  4DNC A;  4M74 A;  4EJT A;  5CVI A;  4GRI A;  2RN7 A;  4IQ4 A;  2AHQ A;  2EZL A;  1YG2 A;  2FOK A;  2XAQ A;  2N8G A;  3G6E I;  1KQ0 A;  4HF1 A;  3KZZ A;  2VOD A;  1FIP A;  5D5X B;  1D3Y A;  1OR7 A;  1XDS A;  3GF2 A;  3KP6 A;  2NNN A;  4KIG A;  1W7P B;  1WJE A;  5F0H A;  2L9S A;  2Y0S N;  2DMT A;  2PLY A;  3EYI A;  3F8B A;  2JTV A;  5B5E C;  2LF7 A;  3DBH B;  3D5L A;  4HST A;  2JPC A;  2ZO4 A;  4A3L J;  1V54 H;  2EK5 A;  3HRM A;  3AG2 H;  3WE2 A;  2NRA C;  1FX7 A;  2ELK A;  2CMP A;  2LKS A;  4W97 A;  4EJW A;  2AXL A;  4OAZ A;  4I2O A;  4ZYA A;  4EQQ A;  1U3E M;  1Z7U A;  2W4S A;  1MBK A;  2WAE A;  1OFC X;  4JYK A;  1P4A A;  2CUE A;  2CQX A;  2V79 A;  3OV8 A;  4D1Q A;  1LPQ A;  4OIO F;  3PQJ A;  4FCY A;  4PJL A;  5E3L A;  4EGZ A;  3HRT A;  2IPQ X;  4LK1 F;  3OYK A;  2A6H F;  2G7H A;  3H36 A;  2FMY A;  3HSF A;  4UVA A;  1NK2 P;  2F48 A;  4C3J J;  2HKX A;  3CO6 C;  1PYV A;  3PFI A;  4XON A;  3VSL A;  1Z6R A;  1E3P A;  3ZN1 A;  4L0Y B;  3I58 A;  2OTL I;  2IGN A;  4OAY A;  4CH7 A;  4C2U A;  3LAJ A;  2MW8 A;  1G59 A;  4IHX A;  4OWR B;  1SC7 A;  3OYJ A;  3A2K A;  4L5I A;  2FX0 A;  3E6D A;  5F0F A;  1XSD A;  3C1D A;  1FTZ A;  1R1U A;  4C3I J;  1VQ7 I;  2EV0 A;  2P5V A;  2QQB A;  1J5Y A;  3HTU A;  5IT3 A;  1LDJ A;  5DM6 F;  1X1A A;  1OKR A;  2FNA A;  2QA4 I;  2VL8 A;  2R0Q C;  1UHW A;  3P7N A;  2WY8 Q;  2VJI A;  1ERD A;  4D7M A;  4L9N A;  3GTK J;  3PNY A;  4NUB A;  4IQJ A;  2P7V B;  2DFE A;  4D7N A;  5H20 A;  1RIO H;  1FOK A;  1HOM A;  1IDY A;  3L09 A;  2DQL A;  4P9U A;  1FNN A;  1SMY F;  2XPW A;  3COA C;  1WI3 A;  3QP6 A;  3ABU A;  4KDP A;  1JHF A;  5LGT A;  2Z5U A;  1E3H A;  2XAH A;  2M0C A;  1CF7 B;  4H4K C;  2HVS A;  2Q1Z B;  3H3Z A;  3BQY A;  3HM5 A;  2A3S A;  1RR8 C;  2QVO A;  2ZXJ A;  1PJR A;  2MYS A;  1X58 A;  4GYI A;  1FTT A;  2KJB A;  1VZ0 A;  2CFO A;  3OYI A;  1W5T A;  2RAE A;  3DU6 A;  5J4Y A;  2PJR B;  5IYD J;  2DA4 A;  5E3M A;  1FZP B;  4IPA A;  3VB2 A;  2ZJ2 A;  5IYC J;  3GFI A;  1IG7 A;  1SVL A;  2VKD A;  1V5E A;  5J8F A;  4CGZ A;  5EG0 B;  3JR9 A;  5M5W J;  2UUZ A;  2ZXI A;  2ZJP F;  4P9F A;  3QOP A;  1XG1 A;  1X4P A;  3WGI A;  4CCM A;  4RM2 A;  5FKL A;  3VOE A;  3BP8 A;  3LSP A;  1SAU A;  1ZGA A;  3CMA I;  4HEA 2;  1T39 A;  3QU6 A;  3NQO A;  5E3O A;  2WAQ N;  1Y8Q B;  2KZG A;  1FPQ A;  4OMY A;  1FMV A;  2NVY J;  2BGC A;  5D5V B;  3K1M A;  2X85 A;  3LSJ A;  3RDI A;  2V9V A;  4X6A J;  2NS0 A;  4BJT A;  1UHS A;  1IXR C;  4RAF A;  1LE8 A;  3CF2 A;  2HKO A;  1ZYR F;  5DCF A;  1U6G A;  2BZT A;  3UKG A;  2FBH A;  2EH3 A;  3LA3 A;  1V5F A;  1Y0N A;  3WTZ A;  3OMY A;  4ETS A;  3TW6 A;  3OYN A;  3K1P A;  2E7X A;  3NAU A;  4AC0 A;  4EJV A;  3U1D A;  4IJA A;  3WGG A;  2O7O A;  3IL2 A;  1FYM A;  4RAY A;  3KE2 A;  1WVR A;  3SDG A;  4MEY F;  5E20 A;  2VT2 A;  4FX0 A;  2V6C A;  3L00 A;  4R79 A;  3L2W A;  2R5Y B;  1N25 A;  2W00 A;  2DK8 A;  1O57 A;  4Y13 A;  5D4R A;  2PG4 A;  3PL8 A;  2IA2 A;  4QSH A;  4CSW A;  4A3E J;  2BBY A;  2WA0 A;  2M45 A;  3BJO A;  4M3B A;  4Y4R A;  3GLX A;  2K3F A;  3R0J A;  4BEH B;  2QCO A;  2X6X A;  1FT9 A;  2AO9 A;  3RPQ A;  1T0F C;  3VOD A;  4GGG A;  1T08 B;  2RRE A;  2DA6 A;  2KZV A;  2L9V A;  5J1Y A;  3F3X A;  4ENM A;  4A3D J;  2KP6 A;  1JE8 A;  3H9G A;  1SEU A;  2WV1 A;  5D8L B;  3CJQ B;  2AXT C;  2HDD A;  4KN7 X;  3ZQQ A;  4BH9 A;  1OCZ H;  3PO3 J;  3FMS A;  2PJP A;  1R1T A;  1W5C C;  2Q0O A;  5EF6 A;  3JRF A;  1H8A C;  3BR6 A;  2K9M A;  2LK2 A;  3HKZ N;  1LFU P;  2R7U A;  2KFD A;  1EV7 A;  2ISY A;  1VND A;  4ZYD A;  2E5Z A;  5IOY A;  1ITY A;  2UXX A;  1ORK A;  2H6B A;  1ZQ3 P;  1R9T J;  3QYB A;  4J00 A;  3UR3 C;  2G9W A;  3CMM A;  1WPK A;  3LSG A;  4NHJ A;  1IV6 A;  1ZRF A;  4IXA A;  4LGW A;  2Q2E A;  2P5K A;  2CSO A;  1Z1D A;  3G1O A;  3MVP A;  4IRI A;  3SZT A;  2IS6 A;  4HRI A;  1MMG A;  4K2E A;  2Q8K A;  2JN6 A;  3QYF A;  3Q0W A;  3PQK A;  5DD4 A;  1UCR A;  3CO7 C;  5F27 A;  4BYY A;  2ZC2 A;  3L2C A;  2NXN B;  5D8K B;  4J19 A;  1H9T A;  2QQ9 A;  1XCV A;  1O3T A;  4MFE A;  4F91 B;  1MDM B;  3W3C A;  1QGP A;  3BZ6 A;  3RSN A;  1RC9 A;  3HYI A;  1JGG A;  4BS9 A;  1W7P D;  1Y6I A;  2M5W A;  4R8H A;  1Q1V A;  1OJL A;  1T8I A;  1APL C;  3MAJ A;  4XOP A;  1BM9 A;  3M1E A;  3LSI A;  1MH3 A;  4PUS A;  5J1U A;  1OCO H;  2E7W A;  3BG6 A;  3JAM K;  2LNB A;  3U9G A;  2HYG D;  2IVM A;  4X1E A;  3RQ4 A;  3MKZ A;  4V19 K;  1R7J A;  3MMY B;  3OYG A;  2VIX A;  3T8T A;  4BBS J;  3VEP A;  2R7V A;  2JA6 J;  3CZ6 A;  2NS7 A;  2RKH A;  5EYR A;  1G4D A;  3RQI A;  1IDZ A;  2XHK A;  3HHH A;  2MC3 A;  2K86 A;  3JRE A;  2MAB A;  3ZP5 A;  3I53 A;  3WU2 C;  2HPI A;  4XLP F;  3ONQ A;  4C3H J;  4YFX F;  5FFZ A;  2F4M B;  4B1R A;  1SFU A;  3LFK A;  3ZMV A;  1PUF B;  2H6C A;  1I6X A;  2B7E A;  3DWL E;  5FKK A;  3JAM Z;  1MJA A;  3TO9 A;  1A6Q A;  4IHV A;  3BJA A;  1B59 A;  2LBF B;  3CCJ I;  2R7X A;  4M3D A;  3GTL J;  1X2M A;  4WXH A;  3S8P A;  4YIR X;  4HYE A;  3L2U A;  4IEJ A;  1V3F A;  3A01 B;  2BY2 A;  1U9O A;  4CYC A;  2DI3 A;  2DPU A;  3K4M A;  3FDY A;  2K3P A;  1WFX A;  2EFO A;  4AVP A;  3WTV C;  2E2I J;  2HI3 A;  5HLH A;  1JKO C;  1LVA A;  3QYE A;  3DBL B;  2JVG A;  4XBF A;  5J47 A;  1WWX A;  1Z05 A;  2CYY A;  3S3M A;  3IH4 A;  1S9H A;  2BXZ A;  3SEZ A;  1D1A A;  3L7W A;  3M9A A;  1A5J A;  2L01 A;  3LA7 A;  3FXL A;  2IA0 A;  5HS7 A;  5J6X A;  4HQE A;  3GTO J;  4IOA F;  1J7K A;  2IAI A;  2W48 A;  4RS8 A;  3TED A;  1SMT A;  1Z3X A;  4XLH A;  1TQM A;  1UHM A;  3N4M A;  2I8D A;  2VBW A;  5FKO A;  1HST A;  4EGY A;  2JT1 A;  3O8G A;  4LJZ F;  3I0T A;  2DQR A;  4I09 A;  3J81 K;  1K6Y A;  2PN6 A;  2QEN A;  3Q0V A;  5AIQ A;  5K7H A;  2QSH X;  4IO9 F;  2EZH A;  3C2G A;  1MMS A;  2TDX A;  3OYF A;  1XMX A;  2WB1 N;  2EBI A;  3ISP A;  1ZTR A;  5K5O A;  1JJ6 C;  2KIQ A;  1K61 A;  2QBY A;  2IXS A;  1FY7 A;  1MW7 A;  1PUE E;  2IA1 A;  2LP0 A;  2V6E A;  1X1C A;  5L3D A;  4EJU A;  1G8X A;  2XF6 A;  3KEQ A;  2E1M B;  5TGT A;  5FLV A;  2H8R A;  2VUM J;  3AG4 H;  2FQ3 A;  4L9J A;  1S7E A;  1YIO A;  2RV8 A;  2P8T A;  4M9X A;  5E1Z B;  1NG6 A;  3J81 Z;  1LUJ B;  3LL7 A;  5D6E A;  2ECB A;  2O9L A;  4A6E A;  3FF5 A;  4NQW B;  4PSX A;  1AHD P;  2ICW G;  1ZGJ A;  3LWF A;  2DMQ A;  3V8J A;  4UV8 A;  2VQL A;  1LQ1 A;  4I76 A;  3VSK A;  2ACJ A;  3P9C A;  1P7J A;  3DPU A;  1F5T A;  1TLH B;  2HWV A;  1X4O A;  2XGD A;  3FBN B;  4YFK F;  4ESJ A;  1VQO I;  3BPX A;  3HXL A;  1OCP A;  1UFM A;  3K2A A;  1TWG J;  2FA5 A;  1IUF A;  3H35 A;  4DYQ A;  2L7M P;  2FUG 2;  3EUA A;  4YII A;  3K10 A;  2BE5 F;  4UUS A;  1XGN A;  2MH2 A;  3LMM A;  3PSI A;  1AKH A;  1WJB A;  1DQU A;  1FWZ A;  2QM3 A;  2XB5 A;  3X2Q H;  2GOM A;  1VQN I;  3V7R A;  2Z99 A;  3GW2 A;  1Z67 A;  3FKI J;  1I3A A;  1SVO A;  3LSK A;  2KRC A;  4CYD A;  4MEX F;  1EH7 A;  3ELK A;  4E7S A;  1OMI A;  4XKC A;  4RLQ A;  4BHP A;  1DP7 P;  3Q0U A;  4KNY A;  2L02 A;  3W2A A;  1I6H J;  3KIO A;  3VPR A;  4A3C J;  4HPQ A;  1LDK B;  5CVU A;  2MBF A;  2JRM A;  2Y2Z A;  3TGN A;  2B9S A;  3TDU C;  3F9K A;  3IAS 2;  1VQ6 I;  3C2H A;  3L1P A;  3AG3 H;  1ETO A;  1Z3Y A;  3K6G A;  3RPU A;  1IRF A;  3K0L A;  3ABT A;  5H6R A;  2HQR A;  2BW3 B;  5JHU A;  1KQ8 A;  1QHG A;  3A0H C;  2OD5 A;  3S2D J;  3S2H J;  3CES A;  2W85 A;  1ZAO A;  3MD2 A;  2E2J J;  1W7P A;  2BXY A;  4N9H A;  3G4S I;  1MBJ A;  4Y7N J;  3HZJ A;  1GDT A;  2DOF A;  1BI3 A;  2E1M C;  2DAO A;  4XKV A;  1K79 A;  3J7A O;  3ERM A;  5HOO A;  3V42 A;  3OYA A;  5TRD A;  2X9D A;  1VQK I;  1JGS A;  3IKV A;  4UHT A;  3ASO H;  3M8F A;  2F2E A;  2H8W A;  4CCO A;  3FM3 A;  2HDC A;  3OYE A;  3LSR A;  1YJW I;  4NNJ A;  1N77 A;  1IUY A;  4AU7 A;  3CDL A;  1ETK A;  1R5H A;  1TWA J;  2EZK A;  1EA3 A;  5B3S H;  2EB7 A;  3KP3 A;  2CH0 A;  3KP7 A;  5BMZ A;  2EA4 A;  4FIS A;  1ZH5 A;  5E3N A;  3OYB A;  4HV6 A;  3H9J A;  3NEU A;  1S8N A;  4FE7 A;  5FRO A;  4RGU A;  3L2V A;  2JJ7 A;  1B9N A;  2QQA A;  2FML A;  2HS5 A;  3JSP A;  4RAG A;  3Q9V A;  4UV9 A;  3OS0 A;  3T5X A;  5CQE A;  2V9K A;  3G73 A;  2JZY A;  3ZQF A;  5TJJ A;  1F43 A;  3I55 I;  5EJC A;  1TZL A;  3R4K A;  2QSF X;  2XGE A;  2VKH A;  1HKT A;  4XLC A;  3BG9 A;  2HFH A;  2VBY A;  3C2B A;  3HGG A;  3ABK H;  4BHB A;  2K9S A;  1W0U A;  3SFI A;  4PCQ A;  3ZQ7 A;  4XRM A;  3J7Y J;  3A4C A;  3FMQ A;  3D1N I;  3I3L A;  4AD9 A;  2M3A A;  4YIF A;  3VYT B;  4DZP A;  3K2Z A;  3V7C A;  2LKX A;  2F4O B;  2P7C B;  3MCZ A;  1Y56 A;  2RNJ A;  4IHW A;  2L2O A;  2VN2 A;  2ZNZ A;  1I3Q J;  4M9S A;  1W36 C;  4A3G J;  3N05 A;  1GV5 A;  1VQM I;  4F7Z A;  1S7O A;  5HDG A;  3ML6 A;  3E1S A;  3PNV A;  1LFP A;  2PQ8 A;  1RI7 A;  2PMH A;  5HS8 A;  5H2F C;  4FTH A;  1ONV A;  1FEX A;  1P4X A;  1CF7 A;  4MFD A;  4II3 A;  2CGP A;  3N97 A;  2CUZ A;  3O2P E;  4IVN A;  2C6Y A;  4CDG A;  4G7H F;  4IOC F;  2LSO A;  3BDD A;  2MD0 A;  2HR3 A;  1ON2 A;  3W6J B;  2CO5 A;  2XV4 S;  4C9Y A;  2IW5 A;  4M6X A;  5F64 A;  3Q3S A;  1J59 A;  2PJR A;  2FD5 A;  2FE3 A;  5BNG A;  4A0Y A;  3OYM A;  1VFC A;  1RUN A;  1IC8 A;  1XSV A;  3CQZ J;  1T0F A;  3FXJ A;  2HNH A;  4BE1 A;  2QF7 A;  2XPU A;  3V8K A;  4N4N B;  1HSJ A;  1JKQ C;  3D0S A;  1XMK A;  5EG0 A;  3RZO J;  1RR7 A;  2V1D A;  1F1Z A;  3NWT A;  2DA7 A;  2XDV A;  1SD4 A;  1QNT A;  3BLY A;  1E2X A;  2K27 A;  2VT3 A;  3LST A;  4NB5 A;  4PK4 A;  1ETW A;  2Z3Y A;  1OYI A;  4JX6 A;  4G7Z F;  2VKV A;  3PFY A;  2EIJ H;  2IGK A;  1U5T B;  2ADU A; 
#chains in the Genus database with same CATH homology
 1U78 A;  1UB9 A;  1B6A A;  3KZY A;  1C0W A;  4RB3 C;  4G8X A;  2XGX A;  4WXD A;  4S05 A;  1XD7 A;  2BV6 A;  3TDZ C;  3HSR A;  3E5X A;  3VFZ A;  1R22 A;  3HOT A;  1P92 A;  1IW7 F;  4U0V A;  2QUF A;  2H09 A;  5HDK A;  5ICF A;  1FP2 A;  4GCV A;  1YO5 C;  3FM5 A;  1ZAR A;  4A2U A;  3F8N A;  1KU2 A;  2VE8 A;  4ZYH A;  2MLG A;  5K5Q A;  2STW A;  1P4W A;  2H27 A;  3R61 A;  3JTH A;  1KYZ A;  1H0M A;  4B09 A;  1ZG3 A;  1R23 A;  2FBK A;  2Z9O A;  3AAF A;  1SFE A;  3FZV A;  4A0X A;  1U5T C;  4ENK A;  3WU0 A;  4LK0 F;  3TKY A;  2LDU A;  3DP7 A;  3GWZ A;  4EJO A;  2LF8 A;  5LBQ A;  2G7U A;  3GX4 X;  2CQK A;  3OOP A;  2W84 A;  4CO8 A;  2PBI A;  5LEJ A;  4RGR A;  2NYX A;  3MEX A;  4KMU X;  3HSE A;  1YQA A;  3V7S A;  4H0E A;  4I01 A;  2MD5 A;  3GUD A;  1MDM A;  5ICG A;  2OA4 A;  5JFR A;  4I7H A;  4G94 A;  1TTY A;  3ERE D;  4O6J A;  3SXY A;  3DEU A;  1LB2 A;  2RC4 A;  2ETH A;  1SD6 A;  2A61 A;  1CGP A;  1BI0 A;  1S3J A;  1SFX A;  3EDP A;  3GZ6 A;  4P55 A;  2KKO A;  2UZK A;  2O6G E;  3GFL A;  4P5O A;  3ROU A;  3TO6 A;  2FNP A;  3IRQ A;  3ULQ B;  1YW8 A;  1MD0 A;  2P5L C;  1IXS B;  4O3M A;  2BYV E;  3CUO A;  2DBB A;  5ERI A;  1QBJ A;  1R1V A;  4WCG A;  1KU7 A;  5DCM B;  4IRH A;  1VTN C;  4HLY A;  2OZ6 A;  3CUQ B;  2O3F A;  5D4S A;  4OU0 A;  4EV0 A;  3WU1 B;  4A5M A;  2FXA A;  1STZ A;  2DTR A;  5K1Y A;  1YW9 A;  4OOI A;  4MTD A;  1D5V A;  3R6S A;  4KMF A;  5E1W A;  3DFG A;  2STT A;  3P9K A;  2HTS A;  1IN5 A;  1IN8 A;  3WG9 A;  2ZCW A;  4JQF A;  1LDD A;  4Q5S F;  5ILU A;  4Q4Z F;  4HV5 A;  4RB1 A;  5BS6 A;  3WTX C;  1KU3 A;  2ISZ A;  2GQQ A;  3ZMU A;  2MH9 A;  5CYV A;  5J8C A;  5LLQ A;  4M71 A;  2GXB A;  2PFB A;  3ECO A;  4NQW A;  1O3S A;  1RZ4 A;  4YFN F;  4UVC A;  5D6F A;  3FX3 A;  1O3R A;  1HW1 A;  3TQN A;  4OIR F;  2XVC A;  4BAY A;  2DK5 A;  1PDN C;  2O03 A;  3KEO A;  1I27 A;  1XGS A;  5IT9 K;  4PZJ A;  3CUQ C;  4E70 A;  2ZME B;  1GVJ A;  5DUI A;  3SHF A;  1ULY A;  3DV8 A;  2HOE A;  4U88 A;  3MZH A;  2O8X A;  5F6F A;  2V1X A;  2CG4 A;  1YW7 A;  3I64 A;  4U7D A;  3JTG A;  1SAX A;  3KET A;  2D1H A;  3E5U A;  2K7L A;  2D2W A;  1J0R A;  4L5J A;  5IT9 Z;  3RI4 A;  4RGS A;  3NRV A;  4MNU A;  3MFK A;  4BXU A;  4CHU A;  1TW3 A;  3GXO A;  2DT5 A;  3LAP A;  4Y15 A;  2JPB A;  2XUB A;  2XAS A;  2GXG A;  4L18 B;  1XN7 A;  3ZMS A;  2XKO A;  3QP5 A;  1IN6 A;  3GEZ A;  3BJ6 A;  5CVJ A;  3FMR A;  1LEB A;  2VXZ A;  3GVA A;  1BN5 A;  4B8X A;  1R36 A;  3WTS C;  3HHG A;  3KLO A;  2OU2 A;  3C7J A;  3V8L A;  2X0L A;  4HDV A;  5ICE A;  2R7F A;  4N0B A;  4LMY A;  2L4M A;  2HEO A;  4WWC A;  3F8M A;  4AIJ A;  2A07 F;  1P2F A;  2K4B A;  1ZN2 A;  3BY6 A;  1ZHF A;  1KU9 A;  2J5P A;  2FEZ A;  3WE3 A;  3HTS B;  1TNT A;  2A68 F;  1G3S A;  2F5F A;  1R5G A;  4HBL A;  3RKW A;  1MGT A;  2XKP A;  5E1X A;  2OQR A;  4IHS A;  1XDU A;  5FO5 A;  2M1B A;  2O0Y A;  4ENJ A;  1OPC A;  4IRG A;  5AIP A;  4ESB A;  5ED4 A;  1JHH A;  2K02 A;  5F1R A;  2L3D A;  2DO7 A;  1LNW A;  3QU3 A;  1FSH A;  3MZY A;  2DFI A;  2IP2 A;  4IF4 A;  1TNS A;  3BPV A;  5E8I A;  2RGV A;  2D45 A;  4OIQ F;  4LB5 A;  4U0W A;  2UWM A;  1XMA A;  3E97 A;  4I02 A;  4R1H A;  5BOX A;  3BWG A;  4M6Y A;  4CIC A;  4XLN F;  1XSX A;  2VC1 A;  2E1C A;  2XRO A;  3C3W A;  2WV0 A;  4HZF A;  3I59 B;  1L3L A;  2E1N A;  5LRR A;  2CW0 F;  2NAZ A;  3I71 A;  3EQL F;  2HYF A;  1AWC A;  5ILV A;  3RKY A;  1U5T A;  2QYO A;  1AOY A;  3S2W A;  3GYH X;  3LQR A;  2PMU A;  4A12 A;  1G3T A;  1BOA A;  4HF0 A;  1V4R A;  5E17 F;  1HW5 A;  3LQQ A;  3WGH A;  3H92 A;  1QO0 D;  3RYP A;  2XRN A;  1WQ2 A;  3GO5 A;  4HW0 A;  2M30 A;  4KIF A;  1G6N A;  1HQC A;  4AIH A;  3F8F A;  5LHH A;  3HUG A;  1ZRD A;  3CLO A;  2MA3 A;  1OYW A;  4QWQ A;  1W5S A;  4XRF A;  3LA2 A;  3G3Z A;  3REO A;  4LFU A;  3FXR A;  5FGM A;  3T8R A;  5EEG A;  3DQV C;  4N9I A;  3HIF A;  3P9I A;  1BBY A;  4XSZ F;  1BI2 A;  1Y0U A;  3K1N A;  1TBX A;  1FSE A;  3QAH A;  5BPD A;  4LLG F;  1ODD A;  1IF1 A;  1L0O C;  4HA8 A;  1OYY A;  5DV5 A;  4KYW A;  2F5E A;  3KP4 A;  1SD5 A;  2IT0 A;  3KP5 A;  1EH6 A;  1B4A A;  3WTY C;  4L9V A;  5LRS A;  1KGS A;  1BI1 A;  3RJP A;  4BNC A;  1K78 A;  1LJ9 A;  1ZLJ A;  2CWE A;  5LHG A;  4G7O F;  1RUO A;  3BOQ A;  2OBP A;  2W57 A;  4OMZ A;  1Z6T A;  3WTW C;  4KIC A;  3SQN A;  2R7D A;  2J5O A;  3J80 Z;  4UNO A;  2A69 F;  2EV6 A;  1KYW A;  3WTT C;  4LB6 B;  3F23 A;  2YX7 A;  1D8J A;  2X4H A;  3DKW A;  2P6T A;  1RNL A;  5LEK A;  4UXN A;  2VON A;  1EH8 A;  5L3G A;  1DPU A;  1XGO A;  2OZU A;  4EM2 A;  1BIA A;  1WSU A;  1S6L A;  2HQN A;  1R00 A;  1U8R A;  2Y75 A;  2W24 A;  2A6E F;  4BQA A;  3QPH A;  2IRF G;  2WTE A;  4JK1 X;  2Z33 A;  4MQ9 F;  1YS7 A;  4KIB A;  5CLS A;  4HLX A;  2DU9 A;  2FF4 A;  3IWF A;  4HDU A;  4AIK A;  2A5Y B;  3FXQ A;  4IHT A;  3F8C A;  5DCM A;  4PDK A;  4HX7 A;  3KCC A;  3CUQ A;  3K69 A;  1TQI A;  1T98 A;  5BPI A;  4CXF A;  4L9T A;  2EJR A;  5EEH A;  5E18 F;  4I0B A;  2R3S A;  4M9Z A;  3GFJ A;  1FP1 D;  4HX4 A;  3RIR A;  1XCB A;  2WWY A;  2L4A A;  5L3E A;  3QPT A;  3KP2 A;  1G3Y A;  2XAF A;  1NHA A;  3RYR A;  2H94 A;  1S29 A;  4A0Z A;  2ZBK A;  5FD5 A;  1X3U A;  2ZNY A;  4LG0 B;  1YYV A;  2QWW A;  1K78 B;  2ESN A;  3O3K A;  4QLC U;  1O3Q A;  4D0P A;  5KK1 A;  1K7A A;  5JVT A;  1R58 A;  2ESH A;  4YG2 F;  5CVR A;  1YS6 A;  4ZYE A;  2DPD A;  3DXJ F;  5DD8 A;  2DW4 A;  1WKM A;  1IZ1 A;  1JXS A;  2HGC A;  4WK8 F;  2ZME A;  4KUM A;  2XIG A;  3F6O A;  1IAW A;  1I5Z A;  4Q48 A;  2OQG A;  3R60 A;  4LLN A;  3IKT A;  2W25 A;  1KQ9 A;  4RAZ A;  2GA1 A;  6PAX A;  1GXQ A;  2GWR A;  1YFH A;  4MHG A;  3IHU A;  4I98 B;  2B0L A;  3I5U A;  4EM0 B;  2M87 A;  3V4G A;  5HVQ C;  3R0A A;  2KIU A;  2V1U A;  1UST A;  2VOP A;  4U7B A;  5HDN A;  5HLG A;  5H6Q A;  5DDG A;  1B9M A;  4L0Z B;  1BC8 C;  2RQP A;  2L54 A;  2QZ8 A;  4G9Y A;  2GIV A;  5DUK A;  1QZZ A;  4HOB A;  4OIN F;  5D5U B;  3W6K B;  2YX4 A;  4KT5 C;  2HTJ A;  5KVR A;  4GO1 A;  3CJN A;  1MJ9 A;  3GZ5 A;  2ELH A;  1XB4 A;  2F5D A;  1GXP A;  1DUX C;  4O5V A;  1HXD A;  2QLZ A;  1BIB A;  4M73 A;  1ZLK A;  2MLK A;  1J2X A;  4GXO A;  3SZP A;  5D5W B;  2YU3 A;  3Q9S A;  1T2K A;  1P6R A;  1PP8 F;  3HOS A;  2UXN A;  3BRO A;  1O7F A;  1I1G A;  2FU4 A;  2P4W A;  4RB0 A;  2ZFW A;  1FYK A;  2AS5 F;  3TO7 A;  2P6S A;  3EET A;  2OAZ A;  4KFC A;  4AWX B;  2VC0 A;  2D1V A;  3EUH A;  2JRT A;  3CTA A;  3M8E A;  5LGN A;  2DLL A;  2YR2 A;  4ZZD A;  2XAG A;  1QQI A;  4ZZL A;  2LKP A;  5ICC A;  1YLF A;  3DF8 A;  1T38 A;  4HF2 A;  4BHC A;  1HW2 A;  4CZZ A;  2FBI A;  2FSW A;  1W4M A;  3E3V A;  3GFM A;  3ZN0 A;  2RVC A;  1DDN A;  2HZT A;  3KFW X;  3I59 A;  4WF2 A;  4LD5 A;  3ZMT A;  2VE9 A;  4P96 A;  4UVB A;  4JBA A;  1K6O A;  2WC2 A;  2VBX A;  5AON A;  1IXC A;  3F6V A;  1WI9 A;  5DEQ A;  3QRF F;  4EM1 A;  2COM A;  3I54 A;  3RKX A;  2EFP A;  3Q5F A;  4RB2 C;  2EV5 A;  4OIP F;  3CDH A;  4MQV A;  1J9I A;  1ZG1 A;  3C18 A;  2XAJ A;  2ZKZ A;  4U0Y A;  4KA4 A;  2Y0M A;  2YPR A;  1DPR A;  5L3C A;  2EWN A;  2PEX A;  4Z2Y A;  4ZYG A;  3FHZ A;  3TOB A;  2NNY A;  3L9F A;  1YTY A;  5A2Q K;  1O7L A;  3EYY A;  3U2R A;  2EFN A;  1FC3 A;  3ZMD A;  5HLI A;  5JI6 A;  3IC7 A;  3HRS A;  3WOD F;  3M7G A;  4ENN A;  1GHC A;  1QZY A;  1TQP A;  5E8G A;  5LGU A;  1A04 A;  3ZPL A;  1MKM A;  2CFX A;  5A2Q Z;  1F4K A;  1ZRC A;  4RGX A;  1IRG A;  1ON1 A;  3B73 A;  4M72 A;  2KIF A;  4ASN A;  3ECH A;  1Z9C A;  1USS A;  1S7A A;  1MZB A;  1E17 A;  1Z91 A;  2F5C A;  3T1B A;  4HAM A;  1BC7 C;  3IWZ A;  1T6S A;  1WRJ A;  4G6Q A;  4FT8 A;  4A6D A;  2VBZ A;  4FX4 A;  2M8E A;  4EVI A;  3O6B B;  3ZMZ A;  1IN7 A;  3JSO A;  5K5R A;  3MWM A;  1HBX G;  5FFX A;  3FXU A;  4MGR A;  3K9T A;  1MJB A;  3DPL C;  3F72 A;  2KIM A;  3F21 A;  2EA2 A;  2GA2 A;  4XSX F;  2YSR A;  1Q1H A;  1BJA A;  2KRF A;  1XGM A;  1TW2 A;  4ZH4 F;  1ZG5 A;  5FLX K;  3DPT A;  4Q47 A;  2VOO A;  4LLL A;  4A5N A;  5FD6 A;  1B1B A;  2FRH A;  4I0A A;  1SD7 A;  4Y17 A;  4WXC A;  5FB2 A;  4ESF A;  2O61 A;  3E6C C;  5L3F A;  4S04 A;  1FBU A;  2EFW A;  5BQT A;  5FLX Z;  2PI0 A;  4GYG A;  3H3U A;  3MQ0 A;  1D8K A;  4HX8 A;  4ON0 A;  4G6D A;  4EMS A;  1U2W A;  3E5Q A;  2EFQ A;  2JSC A;  4HQM A;  4PGG A;  5ILS A;  1HKQ A;  1H9G A;  3T0Y A;  2QBY B;  5LHI A;  5CJ9 A;  4WX9 A;  1FBS A;  4LG0 A;  4KN4 X;  3I4P A;  2Y48 A;  1PP7 U;  3TOA A;  4MTE A;  3E6B A;  3J80 K;  1REP C;  1HKS A;  4UUV A;  4DQ2 A;  1IN4 A;  1LEA A;  1I1S A;  3WTU C;  3SFZ A;  1QPM A;  1FBQ A;  2GAU A;  1ZRE A;  1G3W A;  2RDP A;  3F22 A;  3JW4 A;  3E6M A;  3HRU A;  5DYM A;  3RTR A;  2IJL A;  5JR3 A;  2BEO A;  3FWE A;  4FHT A;  4PGH A;  2GZW A;  1F9N A;  3IRR A;  2K4J A;  1KA8 A;  5HS9 A;  5CVV A;  3KLN A;  1FYL A;  2KJC A;  1J75 A;  1FLI A;  5L3B A;  3B02 A;  4TV7 A;  4DNC A;  4M74 A;  4EJT A;  5CVI A;  2RN7 A;  2FOK A;  1YG2 A;  2XAQ A;  1KQ0 A;  4HF1 A;  3KZZ A;  2VOD A;  5D5X B;  1D3Y A;  1OR7 A;  1XDS A;  3GF2 A;  3KP6 A;  2NNN A;  4KIG A;  1W7P B;  2PLY A;  3EYI A;  3F8B A;  2JTV A;  2LF7 A;  3D5L A;  2JPC A;  2ZO4 A;  2EK5 A;  3HRM A;  3WE2 A;  2NRA C;  1FX7 A;  4EJW A;  2AXL A;  4I2O A;  4EQQ A;  1U3E M;  1Z7U A;  1P4A A;  2V79 A;  3OV8 A;  4OIO F;  3PQJ A;  4EGZ A;  3HRT A;  2IPQ X;  4LK1 F;  2A6H F;  2G7H A;  2FMY A;  3HSF A;  4UVA A;  2HKX A;  3CO6 C;  3PFI A;  1Z6R A;  3ZN1 A;  4L0Y B;  3I58 A;  3LAJ A;  4L5I A;  3E6D A;  1XSD A;  3C1D A;  1R1U A;  2EV0 A;  2P5V A;  2QQB A;  1J5Y A;  3HTU A;  5IT3 A;  1LDJ A;  1OKR A;  2FNA A;  1UHW A;  3P7N A;  4L9N A;  2P7V B;  1RIO H;  1FOK A;  5H20 A;  3L09 A;  2DQL A;  4P9U A;  1FNN A;  1SMY F;  3COA C;  3QP6 A;  3ABU A;  4KDP A;  1JHF A;  5LGT A;  2Z5U A;  2XAH A;  1CF7 B;  3H3Z A;  2A3S A;  2QVO A;  2ZXJ A;  4GYI A;  2KJB A;  1W5T A;  1FZP B;  4IPA A;  3VB2 A;  2ZJ2 A;  3GFI A;  5J8F A;  4CGZ A;  4P9F A;  3QOP A;  3WGI A;  3VOE A;  3BP8 A;  1ZGA A;  1T39 A;  3QU6 A;  3NQO A;  1FPQ A;  4OMY A;  2BGC A;  5D5V B;  3K1M A;  3RDI A;  2V9V A;  2NS0 A;  1IXR C;  2HKO A;  1ZYR F;  5DCF A;  1U6G A;  2FBH A;  3LA3 A;  3WTZ A;  4ETS A;  3K1P A;  2E7X A;  4EJV A;  3U1D A;  4IJA A;  3WGG A;  3IL2 A;  1FYM A;  4RAY A;  3KE2 A;  4MEY F;  5E20 A;  2VT2 A;  4FX0 A;  2V6C A;  3L00 A;  4R79 A;  2DK8 A;  1O57 A;  4Y13 A;  5D4R A;  2PG4 A;  2IA2 A;  2BBY A;  2M45 A;  3BJO A;  3GLX A;  3R0J A;  1FT9 A;  3RPQ A;  3VOD A;  4GGG A;  3F3X A;  4ENM A;  1JE8 A;  5D8L B;  4KN7 X;  4BH9 A;  3FMS A;  2PJP A;  1R1T A;  2Q0O A;  1EV7 A;  2ISY A;  4ZYD A;  2UXX A;  2H6B A;  2G9W A;  4NHJ A;  1ZRF A;  4IXA A;  4LGW A;  2Q2E A;  2P5K A;  2CSO A;  1Z1D A;  4IRI A;  3SZT A;  4K2E A;  2Q8K A;  3PQK A;  5DD4 A;  1UCR A;  3CO7 C;  4BYY A;  3L2C A;  5D8K B;  1H9T A;  2QQ9 A;  1XCV A;  1O3T A;  1MDM B;  1QGP A;  3BZ6 A;  3HYI A;  1W7P D;  2M5W A;  4R8H A;  3MAJ A;  1BM9 A;  3M1E A;  2E7W A;  3JAM K;  2LNB A;  3U9G A;  2HYG D;  2IVM A;  1R7J A;  3T8T A;  3VEP A;  2RKH A;  1G4D A;  2XHK A;  3HHH A;  2MC3 A;  2K86 A;  3ZP5 A;  3I53 A;  4XLP F;  4YFX F;  5FFZ A;  1SFU A;  3LFK A;  3ZMV A;  2H6C A;  1I6X A;  3JAM Z;  1MJA A;  3TO9 A;  3BJA A;  1B59 A;  4WXH A;  4HYE A;  1V3F A;  2DI3 A;  2DPU A;  2EFO A;  4AVP A;  3WTV C;  5HLH A;  1LVA A;  4XBF A;  1WWX A;  1Z05 A;  2CYY A;  3L7W A;  3M9A A;  2L01 A;  3LA7 A;  5HS7 A;  2IA0 A;  5J6X A;  4HQE A;  1J7K A;  4RS8 A;  1SMT A;  1TQM A;  1UHM A;  3N4M A;  2VBW A;  1HST A;  4EGY A;  2JT1 A;  4LJZ F;  3I0T A;  2DQR A;  4I09 A;  3J81 K;  2PN6 A;  2QEN A;  5AIQ A;  2TDX A;  3ISP A;  5K5O A;  2QBY A;  1FY7 A;  1PUE E;  2IA1 A;  5L3D A;  4EJU A;  3KEQ A;  2FQ3 A;  4L9J A;  1YIO A;  2RV8 A;  4M9X A;  2P8T A;  5E1Z B;  3J81 Z;  5D6E A;  4A6E A;  3FF5 A;  1ZGJ A;  3LWF A;  3V8J A;  4UV8 A;  1LQ1 A;  2ACJ A;  3P9C A;  1F5T A;  1TLH B;  2HWV A;  4ESJ A;  4YFK F;  3BPX A;  1UFM A;  2FA5 A;  4YII A;  2BE5 F;  1XGN A;  2MH2 A;  1FWZ A;  2QM3 A;  3V7R A;  2Z99 A;  3GW2 A;  4CYD A;  4MEX F;  1EH7 A;  3ELK A;  1OMI A;  4BHP A;  1DP7 P;  4KNY A;  2L02 A;  1LDK B;  5CVU A;  2MBF A;  3TGN A;  3TDU C;  3RPU A;  1IRF A;  3K0L A;  3ABT A;  5H6R A;  2HQR A;  5JHU A;  1KQ8 A;  2OD5 A;  2W85 A;  1ZAO A;  1W7P A;  4N9H A;  1BI3 A;  2DAO A;  1K79 A;  3J7A O;  5HOO A;  5TRD A;  1JGS A;  3IKV A;  4UHT A;  3M8F A;  2F2E A;  3FM3 A;  2HDC A;  1IUY A;  1R5H A;  2EB7 A;  3KP3 A;  3KP7 A;  5BMZ A;  2EA4 A;  1ZH5 A;  4HV6 A;  3NEU A;  1S8N A;  4RGU A;  1B9N A;  2QQA A;  3JSP A;  2FML A;  2HS5 A;  3Q9V A;  4UV9 A;  3T5X A;  3G73 A;  2JZY A;  5TJJ A;  3R4K A;  1HKT A;  2HFH A;  2VBY A;  4BHB A;  4PCQ A;  3ZQ7 A;  3FMQ A;  4AD9 A;  4YIF A;  3K2Z A;  3V7C A;  2P7C B;  3MCZ A;  2RNJ A;  2VN2 A;  2ZNZ A;  4M9S A;  4F7Z A;  1S7O A;  5HDG A;  3ML6 A;  2PQ8 A;  1RI7 A;  2PMH A;  5HS8 A;  1ONV A;  1P4X A;  1CF7 A;  2CGP A;  3N97 A;  3O2P E;  4IVN A;  2C6Y A;  4CDG A;  4G7H F;  2LSO A;  3BDD A;  2HR3 A;  1ON2 A;  3W6J B;  2CO5 A;  2XV4 S;  2IW5 A;  4M6X A;  5F64 A;  1J59 A;  2FE3 A;  4A0Y A;  1RUN A;  1XSV A;  1T0F A;  3V8K A;  1HSJ A;  3D0S A;  1XMK A;  2V1D A;  1F1Z A;  1SD4 A;  1QNT A;  1E2X A;  2K27 A;  2VT3 A;  3LST A;  4NB5 A;  2Z3Y A;  1OYI A;  4G7Z F;  1U5T B;  2ADU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...