3B73A

Crystal structure of the phih1 repressor-like protein from haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
NAMRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PhiH1 repressor-like protein
publication title Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui.
rcsb
source organism Haloarcula marismortui atcc 43049
total genus 28
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3b73A00
3WU1B 5LBQA 1PP8F 3FM5A 3GLXA 4IRGA 1XGNA 2QBYA 4M71A 1I1SA 3F23A 4HF2A 4BQAA 2L02A 3J81Z 3MAJA 4GXOA 4A12A 2P7VB 5L3EA 1P4AA 4M73A 1FSEA 4RGUA 5K5OA 5F64A 2DPUA 3MWMA 2O0YA 3DF8A 1RIOH 4U0WA 2RVCA 3DP7A 5JHUA 4BH9A 1ON2A 3CO7C 5ILUA 4AIKA 4WXHA 1RI7A 1FP1D 1G3TA 1TBXA 4HZFA 4CYDA 2OZUA 4KN4X 5D8KB 4RB3C 3FXRA 4KA4A 1SAXA 5LHHA 2VBZA 4KIFA 3O3KA 4KFCA 1G3YA 1ONVA 2X4HA 4WX9A 3I53A 2W24A 4Y17A 3VODA 3F8NA 2IW5A 4ESBA 2P4WA 3K0LA 2A61A 3KLNA 4NB5A 2IA1A 3O6BB 1BI1A 1W7PD 2LKPA 4A5NA 5IT9Z 3NQOA 2ETHA 3WE2A 5CVIA 1FX7A 1G6NA 3RPQA 1R1UA 4OOIA 4HLYA 4YIIA 3BP8A 4CO8A 4HDUA 2FXAA 1A04A 1YTYA 1P6RA 4HF1A 5FD6A 2ZXJA 3KZZA 2ELHA 1QPMA 3QPHA 2HS5A 3ML6A 3IKTA 1LDDA 4ZYDA 4LMYA 2STTA 1T38A 4KIGA 3WG9A 5E1WA 2DAOA 4ENNA 5BMZA 2COMA 5DCFA 3BJOA 3KFWX 3E5XA 2WTEA 2HTJA 3QPTA 2NS0A 1KYZA 3V8LA 4U0VA 4G6DA 2P8TA 2H6CA 1MDMA 3J7AO 3E97A 2AXLA 1JXSA 1TQIA 3FHZA 4ZYHA 1TQPA 3MQ0A 4KMUX 4G7OF 2OD5A 3VOEA 1JE8A 4KUMA 3WTVC 4ZYEA 2PN6A 3ZMDA 5AIPA 1G3SA 2DTRA 1G3WA 4EJOA 3FZVA 2K27A 3R0JA 2C6YA 1MGTA 5E20A 4N0BA 3KP6A 2O6GE 1UCRA 3C18A 4BAYA 1HW2A 4RB0A 1XB4A 3ROUA 2XROA 4I98B 3TDUC 4ZZDA 3C3WA 4I0AA 3IC7A 4HQEA 3BJ6A 2A6EF 2P6TA 1P4XA 4G9YA 1BBYA 3S2WA 5H20A 4P9FA 4D0PA 3W6JB 1K7AA 1XGOA 2NYXA 2V6CA 4CXFA 5HLIA 2GXGA 2JPBA 1I1GA 1IZ1A 4IHSA 3IL2A 1BN5A 1D3YA 2L54A 4I02A 2WC2A 5EEGA 5DCMA 1EH7A 1KU2A 2XAJA 1YYVA 4XLPF 1U5TB 4F7ZA 3F21A 2ESHA 4RGXA 1JHHA 4M9SA 1IN6A 2D1VA 3H92A 3ELKA 2NRAC 3T5XA 1LJ9A 3W6KB 3I64A 4ESJA 4IHTA 1DUXC 2JRTA 1TTYA 2HWVA 1U78A 2L01A 4KT5C 3LQQA 5KVRA 2EA2A 4CICA 4OU0A 2VODA 3WTYC 2QLZA 1OPCA 3QRFF 4RB1A 4AIHA 5L3BA 1FBUA 6PAXA 3BPVA 3P9KA 3HHGA 1RUNA 1K78B 4DQ2A 5F6FA 1IXRC 5BPIA 2VC0A 3U2RA 4Q48A 3QU3A 3ZMVA 1FP2A 3OV8A 1ZGAA 4MQ9F 4QWQA 1J75A 2PLYA 3WGIA 2ZNYA 2E7XA 4HV5A 1XSVA 3REOA 2FOKA 2ISZA 1VTNC 1Z1DA 5JVTA 4NQWA 2JSCA 3DKWA 3CTAA 3ZN0A 4EGZA 5L3GA 3M8FA 5IT9K 2XHKA 3TO7A 3EQLF 5K5RA 2PBIA 3FX3A 1R36A 2VBWA 2VBXA 2UXNA 3GUDA 1XDUA 1J59A 1HQCA 3V7SA 2DPDA 1XCBA 2V1UA 2NAZA 2KJBA 3HRTA 1QBJA 3ZQ7A 3HSFA 1EH8A 1P4WA 2FF4A 2YU3A 3P7NA 3I58A 3CUQC 2EJRA 3I59B 1KU3A 1SFEA 2VC1A 4MQVA 3DV8A 3TQNA 1W5TA 4RGRA 1S7OA 1ZRFA 1UFMA 3ULQB 4ZH4F 2XVCA 5TRDA 1QNTA 2OBPA 2PQ8A 2PFBA 1F5TA 2FBHA 1FSHA 2FNAA 3N4MA 3IWZA 2G7HA 1T6SA 2MC3A 3ZN1A 4LG0B 1NHAA 2JT1A 1EV7A 4A0ZA 5FGMA 5BQTA 1QZYA 1R23A 1ZH5A 2ESNA 2ZJ2A 3Q5FA 2GZWA 3EDPA 4EJTA 3CUQB 4B8XA 4ETSA 3N97A 2QQBA 3Q9VA 1B4AA 2XUBA 4BXUA 4L5IA 2V1DA 1F1ZA 4YFKF 2CQKA 5DEQA 1FBQA 3E6CC 3E6DA 1FYKA 4P55A 4BHBA 1IUYA 4HX4A 3KP3A 2W57A 3E6MA 3VB2A 3WTUC 3KZYA 4HOBA 2R3SA 1MD0A 3T0YA 1HSTA 2K7LA 4AIJA 1U8RA 1ULYA 2MLGA 1Y0UA 3FXQA 3IRRA 3WTSC 1ZARA 1K79A 2P5LC 2V1XA 3J80Z 1BJAA 1ZRDA 2ZFWA 2H6BA 3JTGA 2MD5A 1Q1HA 5FD5A 3AAFA 2XAQA 4EM0B 3FXUA 4L9VA 1YS7A 1J2XA 1WI9A 5DDGA 2GWRA 4ESFA 2ISYA 2ZBKA 3WTZA 1XN7A 5D8LB 1FZPB 2R7DA 2W85A 3R4KA 1KYWA 2DQLA 4HAMA 4ENMA 4AD9A 4N9HA 3T1BA 4B09A 5LHGA 2XAGA 4OINF 5K5QA 2PEXA 1XGSA 4BHCA 1ZLKA 3G73A 1U5TA 3M7GA 4ZZLA 2HGCA 5D6EA 4ENKA 3HIFA 2J5PA 4IRHA 2EA4A 4KDPA 3WU0A 2UZKA 1U6GA 3WGGA 4WWCA 1R1TA 1YIOA 2DLLA 2QUFA 2O03A 4N9IA 4LFUA 4JQFA 3LAPA 2E1CA 1WKMA 3V8JA 2D45A 2E1NA 1O7LA 3T8TA 5JFRA 4EJVA 1W5SA 1FYMA 4K2EA 1WQ2A 2XASA 5LLQA 4S05A 1K78A 4GYGA 2A68F 3BOQA 4YFNF 5F1RA 1O3SA 2MH2A 1T39A 1J5YA 2Z5UA 2KJCA 5DUIA 4RAYA 3D5LA 1BI2A 2Y48A 3E5UA 4XBFA 4Q4ZF 5TJJA 2F2EA 3ERED 1OKRA 4S04A 3TKYA 3JSOA 1ZLJA 5DYMA 2M30A 5A2QK 4U0YA 1O7FA 5E17F 1O3RA 1RNLA 1TNSA 5J8CA 3H3ZA 5HLGA 4WXDA 5D5VB 3GX4X 2PG4A 1ZYRF 2IA2A 2EFWA 5E1XA 4IRIA 2YSRA 3SQNA 1IN8A 2ZKZA 4MHGA 4Z2YA 3TDZC 2ZCWA 1CF7A 2KKOA 5JR3A 2FEZA 4O6JA 3SZTA 3I59A 1LQ1A 1USSA 3F3XA 4I0BA 2MH9A 4EJUA 4M9ZA 3F8CA 1SD5A 5L3CA 3JAMZ 3HSEA 4EMSA 2CG4A 3CDHA 1R7JA 1R58A 1S3JA 1HW5A 1RZ4A 1ZG1A 2EV0A 2LF8A 3V8KA 1EH6A 5E8GA 5ILSA 4LG0A 3LQRA 2UXXA 3RIRA 2GA1A 4L0YB 1X3UA 4LK1F 4BNCA 2OAZA 1K6OA 4L9TA 3F6VA 1E2XA 4LD5A 1GVJA 2A3SA 3CUQA 2LF7A 3ABUA 1P2FA 1J7KA 3BDDA 2BYVE 4OIOF 1OYWA 3WE3A 3E5QA 4A0XA 3KP4A 5CVUA 2LDUA 1BIBA 3L9FA 4M74A 1YW7A 4HW0A 3DXJF 3ZMSA 1USTA 2OQRA 3EYYA 4P96A 4AWXB 3PQJA 5H6RA 5ED4A 5D5XB 4O5VA 1CGPA 2Y0MA 4TV7A 5LEKA 1GXPA 4O3MA 5ICGA 3WTWC 2WV0A 4UV8A 3GFJA 3DPTA 5ICCA 3F22A 4XLNF 2OZ6A 2M45A 5FFZA 1HW1A 2DU9A 2EWNA 3QU6A 3SFZA 4WF2A 2RQPA 5HS7A 2YX4A 2OQGA 2L4MA 2LNBA 1GXQA 4L9JA 3I5UA 2FMLA 3GZ6A 1LNWA 4ASNA 2A6HF 4RGSA 5D4SA 5H6QA 4XRFA 3I0TA 3I54A 3F72A 2EFOA 1MJBA 3I4PA 5K1YA 1YO5C 3COAC 2RNJA 3J81K 3ECOA 1IN7A 3HUGA 4LLGF 3CJNA 2YR2A 4I01A 4KN7X 1ON1A 1FC3A 2IRFG 3GW2A 3QP5A 3KETA 1SD6A 4PZJA 3K1MA 2CW0F 2IA0A 1MKMA 2ZO4A 4M6XA 2P6SA 4HV6A 2O8XA 4PGHA 4CZZA 2VT3A 2D1HA 4R1HA 1KU9A 3B02A 4NHJA 1LDJA 2QQ9A 3LA2A 5DV5A 1SD7A 2HR3A 4FT8A 1KQ0A 4G8XA 1V3FA 5HLHA 2VXZA 3BROA 3TOBA 5BS6A 1U2WA 2Y75A 2HQRA 4HDVA 2EFNA 1ZG3A 4FHTA 2KIFA 4HQMA 4CHUA 1KQ8A 5HDGA 2DBBA 2EFQA 4OIRF 4HX8A 1MJAA 3MCZA 5J8FA 1E17A 1IRFA 3LA7A 1V4RA 4Y15A 4UVBA 2M87A 4G7ZF 5AONA 4U7DA 4Q5SF 3GWZA 2IP2A 5CYVA 2HQNA 1XMKA 2K4JA 3RPUA 1RUOA 4G6QA 2DI3A 5CVJA 4R79A 1XDSA 2LSOA 4YG2F 4R8HA 4I09A 3M9AA 3HRSA 2Z9OA 3PFIA 1STZA 1SMTA 2EB7A 1O3QA 4WCGA 4LK0F 3GFMA 3CLOA 1H9GA 2HOEA 2O3FA 1YFHA 1R1VA 1R5GA 1KQ9A 4EVIA 2MBFA 4EGYA 1R00A 3RKYA 2CWEA 2FBIA 1TLHB 2GA2A 3I71A 3HSRA 1YW9A 2EK5A 1G4DA 3QOPA 4CDGA 1QGPA 1BI3A 2P7CB 1FYLA 1TW2A 2RV8A 2V79A 4LLNA 2CFXA 3TGNA 2XRNA 1YQAA 1D5VA 2EFPA 1S8NA 1BOAA 2VOPA 1WRJA 2Z33A 3GZ5A 3SHFA 1OYYA 3RYRA 5LGUA 2JZYA 2KIMA 3R6SA 3E3VA 1FOKA 2RGVA 3MZHA 2M8EA 2VT2A 1T98A 1B59A 2HEOA 5HS9A 2ZMEB 4OIQF 5FFXA 1TQMA 1UHMA 1TW3A 5D6FA 4PDKA 2XKOA 4LLLA 1AWCA 4L0ZB 3BPXA 1PP7U 1ZREA 2GAUA 3L09A 1FNNA 3RKXA 2GIVA 2QZ8A 5D4RA 1IRGA 1ODDA 4IF4A 5LRSA 2W25A 3VEPA 2Z99A 4FX0A 2FBKA 1J0RA 2Q2EA 3TOAA 4P9UA 1AOYA 3GO5A 1D8JA 2V9VA 5BPDA 2Q0OA 3IKVA 3IHUA 2G9WA 1L0OC 4EM2A 2EV6A 3LSTA 2KRFA 3LA3A 3MFKA 1S7AA 3RKWA 3H3UA 1QQIA 2QM3A 3BZ6A 1ZG5A 1H0MA 3O2PE 2VE8A 1T2KA 4IJAA 3R61A 5ICEA 1REPC 2CYYA 3K1PA 1Z9CA 1O57A 1KA8A 3FMSA 5LEJA 5LGTA 1PDNC 1SFUA 3HOTA 3HHHA 3CO6C 2ADUA 3Q9SA 3GFIA 2IVMA 5HDNA 1XCVA 2M5WA 5CVVA 3F6OA 3K9TA 1XSDA 3KEQA 4A6DA 3HTUA 5DD4A 2VBYA 5IT3A 2DFIA 2UWMA 3BY6A 4UUVA 1HBXG 4EJWA 3NRVA 1IN5A 1SMYF 2MA3A 2H09A 5FO5A 2M1BA 3FMQA 4XSXF 1XMAA 3C1DA 4U88A 3FMRA 4GO1A 4M72A 4OMYA 5ICFA 1LEBA 3KE2A 1L3LA 1OR7A 4LB5A 2FE3A 1S29A 3MEXA 1PUEE 2HTSA 3GEZA 1YG2A 3JSPA 3MZYA 3WGHA 1KGSA 2P5VA 1BC7C 1Z6TA 3V7CA 3DEUA 3C7JA 1B1BA 2HKXA 2YPRA 4IPAA 3K2ZA 4KICA 5E18F 3LAJA 4EM1A 2QQAA 4ZYGA 4KYWA 3EETA 3FWEA 2BV6A 3GVAA 3U1DA 2AS5F 4MGRA 1FBSA 3HRMA 1MZBA 2XAHA 1Z6RA 4HF0A 1UB9A 3ABTA 3HOSA 1B9NA 4UHTA 2DO7A 4UXNA 2JTVA 2K02A 2HZTA 1IXCA 3GF2A 2XKPA 4GCVA 3FF5A 1XSXA 5DD8A 3SXYA 3M8EA 4LGWA 2F5CA 3DQVC 1HKQA 3LWFA 2OA4A 1H9TA 2BE5F 1W4MA 5ILVA 4MEXF 2FQ3A 1FPQA 2J5OA 3TO9A 3ZPLA 1F9NA 5FLXZ 1XGMA 4WXCA 2PJPA 1R22A 2K86A 3QP6A 4CGZA 3P9CA 2IJLA 1FWZA 3RYPA 2H27A 3DPLC 5L3DA 2F5EA 3V7RA 4UV9A 4MTDA 4LB6B 3ZMTA 2F5DA 4PCQA 2XV4S 2QWWA 4QLCU 4L5JA 4P5OA 2ZMEA 2JPCA 1U5TC 1I5ZA 5HDKA 1P92A 2HYGD 3EYIA 2CGPA 5D5UB 3GFLA 5LRRA 1LB2A 1WSUA 2Q8KA 1IAWA 2ZNZA 2RDPA 2L4AA 2XAFA 2VONA 3P9IA 5KK1A 2HKOA 2HDCA 3BJAA 3J80K 3KLOA 4A0YA 2PMHA 4HYEA 1DPRA 1HXDA 3D0SA 2XGXA 4MTEA 3G3ZA 3NEUA 1W7PB 1FLIA 1HSJA 4G94A 5HS8A 4UVCA 3K1NA 4EV0A 3QAHA 1YS6A 2GQQA 2STWA 3ECHA 4UVAA 4A5MA 4FX4A 1T0FA 2WWYA 3WTTC 2FU4A 5J6XA 3R60A 4EQQA 3HYIA 2G7UA 5CJ9A 3E6BA 4M9XA 4WK8F 2NNNA 2R7FA 4BHPA 5BOXA 2XIGA 1GHCA 4A6EA 2QBYB 1IXSB 4G7HF 2RC4A 4I7HA 2OU2A 1DP7P 2DK5A 3RI4A 2A5YB 2VN2A 5FB2A 4Q47A 1JHFA 2KIUA 4KNYA 3F8BA 4L9NA 2BGCA 5E1ZB 1OYIA 2B0LA 4YFXF 1F4KA 1ZAOA 2VE9A 2O61A 5LGNA 3M1EA 5CLSA 3FM3A 4KMFA 2CSOA 3WODF 3ZMZA 1YLFA 4ENJA 1Z05A 1IN4A 2PI0A 4H0EA 2BBYA 3V4GA 2QYOA 3L2CA 3ZMUA 3T8RA 4Y13A 1LEAA 1S6LA 1SFXA 1BI0A 5AIQA 2F5FA 4GGGA 2DW4A 5CVRA 5A2QZ 1QO0D 4IVNA 3KP7A 3IWFA 1JGSA 4IXAA 4RS8A 1I27A 1Z7UA 4ON0A 4PGGA 2E7WA 5LHIA 3ZP5A 2D2WA 2FSWA 1HKSA 3ISPA 3HRUA 4E70A 1FY7A 2BEOA 1TNTA 1I6XA 3B73A 1DDNA 2DT5A 4UNOA 2FA5A 2DK8A 1CF7B 2DQRA 2Z3YA 2K4BA 1B6AA 2FMYA 4JK1X 3RTRA 3TO6A 3JW4A 2P5KA 3KP2A 2MLKA 2HFHA 5DUKA 3JAMK 1XD7A 1ZHFA 1IF1A 3KEOA 4LJZF 3HTSB 2ACJA 4RAZA 1QZZA 1LVAA 3F8MA 5JI6A 1SD4A 4HA8A 2L3DA 1ZGJA 2IT0A 1J9IA 1MDMB 3DFGA 3CUOA 5L3FA 3RJPA 5HVQC 3K69A 3L7WA 4HLXA 2FRHA 2RKHA 1YW8A 1HKTA 2CO5A 3OOPA 4DNCA 5FLXK 3GYHX 2NNYA 5EEHA 2GXBA 2H94A 1Z91A 1ZRCA 1B9MA 1WWXA 3R0AA 4GYIA 5ERIA 2FNPA 3BWGA 2W84A 4RB2C 1MJ9A 2EV5A 3F8FA 4U7BA 4MEYF 4YIFA 4L18B 4JBAA 1BC8C 2VOOA 3EUHA 4M6YA 5E8IA 4HX7A 1KU7A 3LFKA 3SZPA 3WTXC 3GXOA 1FT9A 1ZN2A 4OIPF 3IRQA 1C0WA 2HYFA 5D5WB 1LDKB 3JTHA 4OMZA 2A69F 2PMUA 1D8KA 2QVOA 2X0LA 1IW7F 3RDIA 2QENA 1OMIA 2YX7A 1BIAA 2TDXA 5HOOA 3PQKA 4A2UA 4MNUA 1W7PA 1O3TA 5DCMB 1UHWA 1BM9A 2A07F 3L00A 2IPQX 2RN7A 1DPUA 4BYYA 3U9GA 3KP5A 1U3EM 4XSZF 3VFZA 4KIBA 3KCCA 4HBLA 4I2OA 4AVPA 1R5HA
chains in the Genus database with same CATH superfamily
3S3MA 3WU1B 5LBQA 3K2AA 3HEFA 3FM5A 1PP8F 5JVGF 2VKEA 5H2FC 2X9DA 3GLXA 4IRGA 1XGNA 3A03A 4DGWB 4ITVA 3OR1C 2QBYA 4M71A 1I1SA 3F23A 5J1YA 4HF2A 1NK2P 5J3LA 4BQAA 4IZZA 2L02A 3CP2A 3H9JA 2AQEA 4E7IA 2VL8A 2K5CA 3FDYA 2KRHA 4F55A 1MSEC 2DA2A 3CQZJ 2R0QC 3J81Z 1TWAJ 3MAJA 1JUPA 2ZXIA 4GXOA 2P7VB 3V42A 4F52A 4CZCA 5L3EA 4A12A 1MNEA 1VQMI 5GAGJ 1WVRA 1P4AA 4M73A 1FSEA 4RGUA 5K5OA 5KNLA 5F64A 2DPUA 3MWMA 4DJAA 2O0YA 3DF8A 1RIOH 3LL7A 4XLHA 4E6KG 4MFEA 4U0WA 2RVCA 2MGQA 3DP7A 4BUPA 1D1BA 5JHUA 2CQQA 4BH9A 1ON2A 3CO7C 2ZFUA 5ILUA 4AIKA 4WXHA 1RI7A 4J19A 2L9VA 1FP1D 1G3TA 4XRSG 1TBXA 4II3A 4HZFA 4CYDA 4XOTA 4HPQA 2OZUA 4KN4X 4LOCA 5D8KB 2L0KA 4RB3C 2TCTA 3FXRA 4XNFA 3S32A 4BY7J 3OWTA 2R7RA 4KA4A 1P9QC 4Y3OA 2CUZA 2EIMH 2DA5A 1SAXA 5LHHA 1G8XA 2CS3A 2VBZA 2YUSA 4KIFA 3O3KA 1V54H 4FETA 4BBRJ 4KFCA 4QPOA 4AYBA 1G3YA 1ONVA 2X4HA 4WX9A 3I53A 2W24A 4Y17A 3KX2A 3VODA 3F8NA 5J4VA 4NQWB 1RKWA 2IW5A 4ESBA 1LUJB 3K4MA 2P4WA 3K0LA 2A61A 3FKJA 3KLNA 4NB5A 4RMNA 4DYRA 2IA1A 3O6BB 5F1JA 3OIQA 1BI1A 2LKPA 1W7PD 2A5WA 2DMQA 4A5NA 3JREA 3NQOA 2ETHA 3WE2A 5IT9Z 4ZTJA 3OS1A 1MMAA 2L7FP 1D0ZA 5J40A 3OYDA 4BDYA 5CVIA 1FX7A 2BHZA 1U0JA 2MW8A 1G6NA 2NOJB 3MZ8A 2JA7J 3RPQA 4BY1J 2P81A 3OYMA 1R1UA 4OOIA 1GV5A 2GBYA 4X6AJ 4HLYA 1Z67A 4YIIA 3VYSB 2BY1A 3BP8A 4CO8A 3RZDJ 3HL2A 4HDUA 2FXAA 4A3CJ 1Z7LA 1A04A 2BW3A 1YTYA 1P6RA 5F0CA 3TL4X 4HF1A 2R7VA 2EBIA 5GAEJ 5FD6A 2AXTC 3BTJA 2ZXJA 2ELHA 3KZZA 1QPMA 1WJCA 3QPHA 1SFKA 2HS5A 1T56A 3ML6A 3IKTA 1HDPA 1LDDA 4ZYDA 1X1PA 2QGUA 4XL9A 4LMYA 1MIJA 2STTA 1T38A 2Y0SA 4KIGA 3WG9A 3E1SA 2JJ7A 5C3EJ 5E1WA 2DAOA 2EQRA 1A31A 4ENNA 1IRXA 5BMZA 2W4SA 3GTKJ 3GBGA 3QWLA 3K6GA 5FLVA 3IH2A 5IYBJ 2COMA 5DCFA 2OCCH 3ASNH 3BJOA 3KFWX 3MKZA 2CV1A 4PJNA 4S0HB 3CC7I 3E5XA 3TW6A 5FKKA 1BR4A 1FOYA 2WTEA 5CKTA 2HTJA 1UELB 3OL4A 2FUG2 3QPTA 4XRMA 4PJLA 2NS0A 1KYZA 2DMUA 3V8LA 4BACA 4U0VA 2E2IJ 2NS7A 3I3LA 4G6DA 3HG9A 3S1MJ 2P8TA 3OSFA 2H6CA 1MDMA 3J7AO 2LFBA 1TP4A 3E97A 2AXLA 2UV1A 1JXSA 1APLC 1B72B 1Y39A 2CW7A 1RC9A 1TQIA 3QOEA 1JGGA 4IL6C 3FHZA 5GTHC 1OJLA 4ZYHA 1TQPA 3MQ0A 4KMUX 3S1RJ 2JA6J 1WGXA 3CCJI 2ZC2A 2OD5A 3VOEA 1JE8A 4G7OF 4KUMA 3WTVC 4FTHA 4ZYEA 2PN6A 3ZMDA 5AIPA 2XB0X 1G3SA 2ME0A 2DTRA 1G3WA 4EJOA 3FZVA 2K27A 3R0JA 4A3EJ 2C6YA 1MGTA 5E20A 4N0BA 1QRYA 5J1UA 1S72I 3KP6A 4E7JA 4M3FA 2O6GE 3A02A 4YEJA 3H0DA 2VB6A 4E4HA 1UCRA 3C18A 4BAYA 1TC3C 1EJ9A 1BW6A 1HW2A 2DDAA 4UB8C 4RB0A 4FCYA 1XB4A 1FIPA 1PJRA 3IUOA 3KYDB 3ROUA 2XROA 2F48A 4I98B 2DOAA 3E7LA 3TDUC 2FX0A 3H5RA 2OTLI 3SDGA 4ZZDA 3C3WA 3BCBA 4I0AA 3IC7A 4HQEA 1W36C 3RKQA 1FJLA 3BJ6A 2A6EF 3HOXJ 2Y30A 2P6TA 1P4XA 4G9YA 1BBYA 3S2WA 5H20A 4IOAF 1WHUA 2NVTJ 4P9FA 4HSRA 2HQ5A 4D0PA 3W6JB 1K7AA 1XGOA 1RR7A 2NYXA 2Q2EB 2V6CA 4CXFA 5HLIA 3M4OJ 2GXGA 2JPBA 3CMMA 1X3WB 1UG2A 3W2WA 2ID3A 1I1GA 5IP7J 2E2JJ 1IZ1A 4IHSA 3IL2A 1BN5A 2YS9A 1IUFA 1D3YA 3S3NA 2L54A 4YELA 3K4CA 4I02A 1WI3A 3JRAA 2WC2A 2V1NA 3I56I 1ZELA 3TW7A 3GTJJ 5EEGA 5DCMA 2FQ4A 4HNUA 1OCRH 1EH7A 1KU2A 2XAJA 2LH9A 3FXJA 1YYVA 3LSIA 4XLPF 1RRJA 1U5TB 3D5SC 1AA7A 1TT5B 4F7ZA 3F21A 2ESHA 2OV7A 4RGXA 1JHHA 4M9SA 1IN6A 2D1VA 3H92A 5JLXA 5FKOA 1ITYA 3ELKA 1OCZH 3H5NA 4GRIA 2NRAC 3T5XA 1LJ9A 2R7UA 1JUMA 3W6KB 4F3QA 1OR7C 2L9NA 3I64A 4ESJA 4IHTA 1DUXC 3FHNA 2JRTA 1TTYA 2HWVA 4CCJA 1U78A 2M7BA 1YOVB 2L01A 4KT5C 4EEFG 2QQ8A 3LQQA 2PMZA 5KVRA 2WADA 4IX7A 5C4XJ 2DFHA 2EA2A 4A93J 1R5ID 4CICA 3LSRA 4OU0A 5E79C 5GTIC 5C44J 2WAQN 2VODA 3WTYC 5EG0B 2QLZA 4JYKA 2Z1DA 3CCVI 1OPCA 3QRFF 4RB1A 4AIHA 5L3BA 1FBUA 6PAXA 3PJRA 2QCOA 3BPVA 3P9KA 3JRIA 3HHGA 1RUNA 1K78B 1IRZA 5EDNA 2VIXA 4DQ2A 5F6FA 1IXRC 1T08B 5BPIA 3TP0A 2BY3A 2VC0A 1YX3A 2GIZA 2KQRA 2JA2A 3HKZA 5GPCA 3U2RA 3M07A 5TISC 4Q48A 3QU3A 5HNFA 3QQAA 3ZMVA 2L9RA 4AC0A 3CMEI 4HRIA 1FP2A 5E3OA 1XX5A 3OV8A 2F5VA 5K7FA 1ZGAA 4MQ9F 2JVGA 4QWQA 2ZJRF 1J75A 2PLYA 3WGIA 2ZNYA 4UUSB 3K4JA 2E7XA 3PFYA 4XLFA 1U9OA 3GTQJ 4HV5A 5GAHJ 1XSVA 3REOA 2LY9A 5EZHA 3OYNA 1J09A 4D9JA 2FOKA 3H3VK 3MKYB 2ISZA 1VTNC 1Z1DA 5JVTA 5IOYA 4AM3A 3MMYB 4NQWA 3AKZA 3NARA 2JSCA 3DKWA 2LKXA 2VLAA 2DOFA 3CTAA 4PSWA 2JMWA 2M3AA 3ZN0A 4EGZA 5L3GA 2XF5A 3M8FA 5IT9K 2XHKA 2B9SA 3TO7A 3EQLF 5K5RA 2PBIA 2AHQA 3FX3A 5FRNA 2MC4A 2RREA 1R36A 2DA1A 2VBWA 2VBXA 5FLMJ 1SVMA 2R7WA 2UXNA 3GUDA 1XDUA 3PIOF 1J59A 1HQCA 4XKCA 3V7SA 2DPDA 4HNVA 4XRSA 1XCBA 3JRFA 1T33A 2DODA 2NAZA 5HNHA 1NH3A 2HOTA 2V1UA 2F4OB 2KJBA 3HRTA 1QBJA 3ZQ7A 2LR8A 3HSFA 1EH8A 1P4WA 2FF4A 2YU3A 3P7NA 3I58A 2RNGA 3CUQC 3M1CA 2EJRA 2K9QA 2KZVA 2CJJA 3I59B 5FKMA 1KU3A 1SFEA 3CJTB 2QKMB 1W1WE 2VUMJ 2VC1A 4MQVA 3S1QJ 1T8IA 2R7TA 3J7AY 2F4MB 3DKYA 1IV8A 3DV8A 1W5TA 4RGRA 1S7OA 3TQNA 1ZRFA 4JOMA 1I50J 1UFMA 5B1BH 3ULQB 4ZH4F 4XKVA 2XVCA 2R5ZA 1WZ2A 5TRDA 3IH4A 1QNTA 3H5AA 2OBPA 2PQ8A 2E60A 1HLVA 2VJ4A 1ZQ3P 2QA4I 2PFBA 2H8RA 3A2KA 3NWTA 1F5TA 2FBHA 3VPRA 1FSHA 2IAIA 3JRCA 1AHDP 2FNAA 1FOWA 1RKTA 3N4MA 1IGNA 4Y52J 1ETWA 3IWZA 2G7HA 1T6SA 2MC3A 2X85A 3HPGA 3HB9A 3ZN1A 4DOZA 4LG0B 1NHAA 4V19K 2JT1A 3GLLA 1QVTA 1EV7A 1O4XA 5IP6A 4A0ZA 3CMAI 3S16J 5FGMA 5BQTA 4RLFA 2X1EA 1QZYA 1R23A 1ZH5A 2ESNA 2ZJ2A 4C3JJ 1JTXA 3Q5FA 2VPRA 2GZWA 2W1OA 1DQUA 3EDPA 1D1AA 2V9PA 3VYUB 1R6RA 4B1RA 4EJTA 3CUQB 4B8XA 4ETSA 3LNQA 4B47A 1MSFC 1V5FA 3N97A 1VQ4I 2QQBA 3Q9VA 1RETA 4MLOA 2DJNA 2MYSA 1JT0A 1B4AA 1UZCA 2XUBA 4BXUA 4L5IA 2V1DA 4KITB 3K70D 1F1ZA 4YFKF 2KDOA 2CQKA 4IHYA 5DEQA 3I4NJ 4Y33A 1FBQA 1VI0A 4OWRB 4BJTA 3OYCA 3E6CC 1I3AA 3E6DA 2NVQJ 3GTLJ 3HZJA 1FYKA 2M4KA 1Y56A 2GOMA 2E19A 2M7AA 2KIQA 4P55A 3BR2A 4BHBA 3J7YJ 2FJ1A 4HX4A 1IUYA 3KP3A 3DTIA 3F0CA 2QSFX 2W57A 3E6MA 1SC7A 1D5YA 3VB2A 3WTUC 1K83J 2ECBA 2RAEA 4NNJA 2R93J 3KZYA 4HOBA 2R3SA 1MD0A 3T0YA 4A69C 5GPAA 1HSTA 1P7IA 4FISA 1QU3A 1F43A 3PIPF 3PSFA 1Y0NA 2ELJA 2K7LA 4P1WA 4AIJA 1U8RA 4B44A 5FROA 3AL0C 4RM2A 4BL0B 4E7ZA 2IXSA 1ULYA 2MLGA 5B5EC 1Y0UA 3FXQA 1VQ8I 1X4PA 3IRRA 3AG2H 3ZQIA 3WTSC 1ZARA 4XM3A 1K79A 1MMGA 1SVOA 2P5LC 2V1XA 3BG7A 3J80Z 1BJAA 3H36A 3GTOJ 2HU9A 1ZRDA 4DYCA 3J7ZI 2ZFWA 2H6BA 1OCTC 1S9HA 2MD5A 3JTGA 1Q1HA 5FD5A 3AAFA 1DGWY 2XAQA 4EM0B 3FXUA 1WJBA 4L9VA 1YS7A 1J2XA 1WI9A 5DDGA 2GWRA 3H1CA 2ME6A 4ESFA 3IAM2 1WPKA 3ONQA 2ISYA 2ZBKA 3HPHA 1X19A 5DTDA 3WTZA 2DN0A 1XN7A 5D8LB 4UUTA 1FZPB 2R7DA 2DMTA 2W85A 1KONA 2KMUA 3CDLA 3R4KA 3AG3H 5DM7F 3PUFA 4A3MJ 2CQXA 1KYWA 4RBOA 3P5JA 2DQLA 4HAMA 4ENMA 4AD9A 4N9HA 3T1BA 3A01B 4B09A 5LHGA 2XAGA 3PSIA 2WA0A 3MKLA 4OINF 5K5QA 2PEXA 1XGSA 3HOVJ 2IS2A 4BHCA 1ZLKA 3BR3A 3G73A 1U5TA 2DT7B 2JUGA 1FIAA 3M7GA 4ZZLA 2R92J 2CH0A 2HGCA 3AL0B 5D6EA 1H8AC 3S17J 5JHFA 4ENKA 3HIFA 2J5PA 4IRHA 2EA4A 3BR6A 4KDPA 3WU0A 2UZKA 4CSWA 1U6GA 3WGGA 4WWCA 1POGA 3HUGB 4UY8I 1R1TA 1YIOA 2DLLA 2X48A 3CP8A 2QUFA 2O03A 1ETKA 4N9IA 2ZJQF 1GUUA 4LFUA 4JQFA 3LAPA 1VQ7I 2E1CA 5J4YA 3W2AA 1E3OC 1WKMA 2BXYA 3V8JA 2D45A 4ZJZA 4DBQA 4FQGA 5KAIC 2E1NA 3ABKH 5IOZA 3QYFA 4XICA 1O7LA 3T8TA 5JFRA 1LFPA 3LOCA 4EJVA 1ETYA 1W5SA 1ZTRA 2VJIA 4D1QA 1FYMA 3Q0UA 2E5NA 4M3EA 4K2EA 1WQ2A 3OYBA 5EG0A 2XASA 5LLQA 3MKWB 1BR2A 1JKRC 4PFOA 5C4JJ 2VKDA 4S05A 1K78A 5EJCA 2M4GA 4RA2A 4GYGA 2A68F 3BOQA 4KISA 1JTYA 4YFNF 5F1RA 2GM4A 3IAS2 3PM1A 1O3SA 2MH2A 1T39A 2NVYJ 1J5YA 2VASA 4A3LJ 2Z5UA 2KJCA 5DUIA 4RAYA 1JUSA 1Z3YA 1BI2A 3D5LA 1JI8A 2Y48A 2BHYA 4J00A 2HPMA 3E5UA 4XBFA 4Q4ZF 5TJJA 2F2EA 3ERED 1OKRA 4S04A 4QPQA 3TKYA 4UUSA 3JSOA 3OIPA 1ZLJA 2LC2A 5DYMA 2M30A 5A2QK 1DU0A 4U0YA 1E3HA 1TWGJ 2JA5J 2KLOA 1N77A 2JN6A 1O7FA 1IV6A 5E17F 1O3RA 1RNLA 1TNSA 5J8CA 1ZR4A 3H3ZA 3OYJA 3DKXA 3LSHA 3HOUJ 1MBEA 1YRNB 3JCUC 5HLGA 2LK2A 4WXDA 3EPZA 1FTZA 2DTZA 5D5VB 2PG4A 3GX4X 2ICWG 1ZYRF 2IA2A 2EFWA 1QZEA 5E1XA 3LMMA 1UG0A 4B3XA 4IRIA 2YSRA 2H1KA 3SQNA 1IN8A 2ZKZA 3AG1H 4JX6A 4MHGA 4Z2YA 3TDZC 3C2GA 2ZCWA 4B4CA 1CF7A 2KKOA 5JR3A 2FEZA 3ZOBA 4O6JA 1IG7A 4LG3A 3OR2C 3SZTA 4XQFA 3I59A 1LQ1A 3BTCA 1USSA 3DBLB 2O5RA 3F3XA 4I0BA 3AG4H 4OAZA 2WY8Q 2MH9A 2K3PA 1BL0A 3K4KA 4XORA 3ZQCA 4EJUA 4M9ZA 3F8CA 1SD5A 5L3CA 3JAMZ 3HSEA 4G6TB 4EMSA 4FASD 2WBMA 3RCOA 2CG4A 4Y4RA 3CDHA 1R7JA 4XN0A 1A6IA 1R58A 4BKXA 4AYBN 1S3JA 2ZJPF 1HW5A 1RZ4A 2CUJA 1ZG1A 2EV0A 1MBJA 2LF8A 2JRMA 3ASOH 1EH6A 2BXZA 3K10A 3V8KA 3G71I 1YX5A 3Q0VA 5E8GA 4BGDA 3L2VA 3M3YJ 5ILSA 3SDBA 4C2TA 4LG0A 3CD6I 3LQRA 5E3MA 2UXXA 3RIRA 2GA1A 3U21A 1HCRA 3TMOA 4L0YB 1X3UA 4LK1F 2LTPA 4BNCA 1S7EA 2VKVA 2OAZA 1K6OA 3BTIA 1N78A 4L9TA 4F92B 3F6VA 1X58A 3S8PA 2KP6A 1E2XA 1MH4A 1IC8A 4LD5A 2E36A 9ANTA 1GVJA 1WJAA 4BDZA 3CUQA 2A3SA 2LF7A 3ABUA 1P2FA 2L7KA 2WAFA 1J7KA 3OYHA 3BDDA 2BYVE 3HGGA 4OIOF 3UNGC 2I8DA 3DPUA 1OYWA 3OIOA 3WE3A 3E5QA 4F93B 4A0XA 3KP4A 4MIMA 2X6YA 3WU2C 2ZSHB 1GLNA 4N4OB 5CVUA 4FE7A 3DCFA 2LDUA 4PUSA 1BIBA 3KYCB 3BC8A 3L9FA 3FBNB 4ZC3A 2Y0SN 4M74A 1YW7A 4HW0A 3DXJF 3BG3A 2CV0A 3ZMSA 1USTA 2OQRA 3EYYA 3OYEA 3OS0A 4BEHB 2DA7A 4P96A 4AWXB 2E1OA 3CCEI 2P0WA 4W1UA 4PFPA 4AUXA 1ENHA 2W48A 3PQJA 5H6RA 5ED4A 2M9HA 3CC4I 2VQLA 5D5XB 4HNTA 2Y9YA 3G1MA 2HVQA 4O5VA 1CGPA 2Y0MA 4RLQA 4TV7A 5LEKA 1GXPA 4QSHA 4O3MA 3JRDA 1JJ8C 4H4KC 5ICGA 4NDLA 3WTWC 4JX5A 2WV0A 4UV8A 4C2MJ 3GFJA 1WFXA 1I6HJ 1TWHJ 3DPTA 5ICCA 3CCSI 3F22A 2Q1ZB 2QKLB 2GLOA 4XLNF 1HC8A 3U1KA 2OZ6A 1D0XA 4M3GA 4ZYAA 2M45A 3E0JB 2BVMA 2UUZA 5FFZA 1HW1A 1WH7A 1ETOA 2DU9A 2EWNA 5GP9A 3H0GJ 2EILH 1BR1A 3QU6A 4ABZA 1A36A 1WH5A 3SFZA 4WF2A 2GXAA 2RQPA 5HS7A 2YX4A 2OQGA 2R7SA 2L4MA 2F6CA 2LNBA 1GXQA 3KYLA 4L9JA 2ECCA 3I5UA 3OYLA 2FMLA 2HXIA 1SVLA 2M0MA 3BR1A 3GZ6A 1LNWA 4ASNA 4C9YA 4IHXA 2A6HF 4RGSA 2EH3A 2LRDA 5H6QA 5D4SA 3W2VA 1YI2I 3A01A 3IP4B 5DM6F 4XRFA 3I0TA 3I54A 3S14J 4HSTA 3PNTA 3F72A 3OOUA 2EFOA 1MJBA 3I4PA 4V2GA 2ZB9A 5K1YA 1YO5C 3COAC 2RNJA 2K40A 3J81K 3HJEA 3ECOA 3CF2A 1IN7A 3HUGA 4D5FA 5LFAA 4LLGF 3GTGJ 4XONA 3CJNA 2YR2A 3K4BA 4I01A 4KN7X 1ON1A 4XK4A 5E3NA 1FC3A 3PO2J 3VYRB 2IRFG 1ERDA 2R5YB 3GW2A 2VI6A 3QP5A 2M2EA 3KETA 1SD6A 4PZJA 3K1MA 1EF4A 2CW0F 3CC2I 3TP3A 1S5LC 3EUAA 4DZJA 4D5CA 2IA0A 1MKMA 2XAUA 2BVLA 2ZO4A 4XOPA 1V5GA 1Y8RB 3HC7A 2P6SA 4M6XA 4HV6A 2O8XA 4I76A 4PGHA 4UB6C 4CZZA 2AO9A 2VT3A 3OMYA 2D1HA 4R1HA 1KU9A 2MSYA 3RQ4A 1X2NA 1G2HA 3B02A 1MNMC 1LDJA 4BQOA 4NHJA 2QQ9A 4ANJA 2E1MC 2L5QA 3LA2A 5DV5A 4M6VA 4NC6A 2WB1A 1SD7A 3Q0WA 2HR3A 4FT8A 2DT6A 1KQ0A 4G8XA 1SEUA 1V3FA 3OYAA 4HEA2 3A4CA 1Q1VA 2VXZA 4DBRA 3BROA 3TOBA 5BS6A 5HLHA 2VQHA 1U2WA 4IKFA 2Y75A 4GDFA 2HQRA 4HDVA 4JP0A 5EYRA 4BBSJ 1LFBA 2EFNA 3QPSA 1ZG3A 4FHTA 2KIFA 4HQMA 3M8JA 4CHUA 1KQ8A 2K9SA 4FE4A 5HDGA 2XDVA 2DBBA 3H9GA 2EFQA 4A3JJ 5CQEA 4OIRF 4HX8A 4XIDA 1MJAA 2DMPA 3MCZA 4BE1A 3JR9A 5J8FA 4BXXJ 1E17A 1IRFA 1OFCX 3LA7A 3KPHA 1V4RA 2AQFA 2L7ZA 2IS6A 4Y15A 4UVBA 2M87A 2PMZN 4G7ZF 1QHHD 2LVSA 4B43A 5AONA 4U7DA 2QEXI 4Q5SF 2EPFA 1YRNA 3GWZA 3WHCA 2LBFB 3ESWB 1WJFA 2IP2A 3Q3SA 5CYVA 2HQNA 1XMKA 1A5JA 2K4JA 3RPUA 1FOXA 2OJED 3PNYA 4G6QA 1RUOA 2E1MB 5E3LA 1I3QJ 1E0EA 2DI3A 5CVJA 3ZXSA 4R79A 3L2RA 1XDSA 1X3ZB 5EGOB 2LSOA 4YG2F 3FXKA 3KEYA 4R8HA 4I09A 3BLYA 3M9AA 3HRSA 2Z9OA 4XN3A 3PFIA 5B66C 1QHGA 3HKZN 2V7FA 1JKOC 1E3PA 3MN2A 1OISA 1STZA 1K4SA 1SMTA 4X0GA 1JKQC 2D5VA 2EB7A 1O3QA 2DDBA 1A35A 4WCGA 1MW7A 2ZMEC 1YE9A 4LK0F 3DEEA 3GFMA 3CLOA 3CCMI 1GDTA 1H9GA 4E7SA 2HOEA 2O3FA 4CA0A 3HOYJ 1YFHA 1R1VA 1R5GA 5IYDJ 1MBFA 1U8BA 3W6VA 3A0BC 1KQ9A 1BOBA 4EVIA 4IO9F 2MBFA 4EGYA 1R00A 3RKYA 2CWEA 2FBIA 2IBDA 3JRHA 1YIJI 2XSJC 3S1NJ 1TLHB 2HVSA 2GA2A 3I71A 4BU2A 3HSRA 1VQLI 1YW9A 2EK5A 1G4DA 3QOPA 4CDGA 5IYCJ 5KCMA 1YJ9I 3LFUA 2CQNA 1QGPA 2VJ5A 3VDXA 3BG6A 1BI3A 1G59A 1B72A 2P7CB 1FYLA 1TW2A 1N75A 1XMXA 2DMNA 2RV8A 2V79A 4LLNA 2CFXA 2X1DA 1HA8A 4HG2A 3TGNA 2XRNA 1YQAA 1D5VA 2HOAA 2KL4A 2EFPA 1S8NA 1W0TA 1BOAA 3N05A 1WRJA 2CFOA 3GZ5A 2MG4A 3SHFA 1OYYA 3RYRA 2Z33A 1AKHB 1T0FC 5LGUA 2H8WA 2JZYA 3MVPA 4XR6A 4A3BJ 2KIMA 2MFZA 3R6SA 2G0EA 4YRVA 3E3VA 1FOKA 2RGVA 2E35A 3MZHA 3FXLA 3FXOA 1MBKA 2M8EA 2VT2A 1T98A 3D1NI 1B59A 2HEOA 1B8IB 3ZRGA 4EATA 5HS9A 2ZMEB 4OIQF 5FFXA 1TQMA 3LSGA 1UHMA 1TW3A 3SZGA 5D6FA 4PDKA 2XKOA 4LLLA 2KRCA 4XLCA 5KHDA 1MBHA 2KHMA 4BEHA 3K4NA 1AWCA 1IDYA 4L0ZB 3BPXA 1PP7U 1ETVA 2K9MA 2GAUA 3L09A 3PNVA 1ZREA 3RPUD 5FKNA 1FNNA 1FMWA 2LY2A 3RKXA 2GIVA 2V6EA 2QZ8A 5D4RA 2CV2A 1IRGA 3CZ6A 1XS9A 1ODDA 4IF4A 5LRSA 2W25A 3VEPA 4A3FJ 2Z99A 4B3AA 2EINH 4FX0A 1I39A 2FBKA 1J0RA 2Q2EA 3GTMJ 3TOAA 2Z16A 4P9UA 1A6QA 3WHBA 1AOYA 2K9LA 2B7EA 3GO5A 1D8JA 1NG6A 2V9VA 2OTJI 5BPDA 1R9TJ 2WAEA 4XKWA 3FISA 5M5XJ 2X6OA 3SYTA 2DCEA 2Q0OA 3IKVA 3IHUA 4NC8A 2VPLA 2G9WA 1L0OC 4EM2A 2EV6A 3F9KA 2Y31A 2L9SA 3LSTA 2V26A 3CJQB 3S93A 2XRLA 5EEAA 2EZHA 2KRFA 3FKIJ 2IGMA 4II2A 2VQGA 1UAAA 4X1EA 2B63J 1LVKA 3CJRB 3LA3A 2XSDC 2XB5A 3MFKA 5EF6A 1S7AA 4C2UA 3RKWA 2R7XA 3H3UA 1QQIA 2QM3A 3BZ6A 1ZG5A 1H0MA 4E7HA 2HDDA 3O2PE 2KISA 5J1RA 3RQIA 2VE8A 1T2KA 4CCNA 1JT6A 3OSGA 1Z3XA 3B6AA 4IJAA 1PUFB 5TGTA 3R61A 5ICEA 1REPC 2CYYA 2CW8A 2DYRH 3K1PA 3CESA 3JRBA 1Z9CA 2X6WA 1GVDA 1O57A 2F4IA 1KA8A 3FMSA 2OCEA 3VYTB 1OCOH 5LEJA 5LGTA 1PDNC 1SFUA 3HOTA 2NXNB 3ERMA 3K70C 2XPUA 2VOPA 3HHHA 3CO6C 1ETXA 1HOMA 2ADUA 1IO2A 3Q9SA 3GFIA 2IVMA 4IQ4A 1Z21A 5CPRB 3DWLE 3HDDA 5HDNA 3AFHA 1XCVA 2M5WA 5CVVA 3F6OA 1MMSA 3ZCOA 3K9TA 1XSDA 3KEQA 4A6DA 3HTUA 2O7OA 4MO7A 5DD4A 2VBYA 3MD2A 2X51A 3LSPA 4IOCF 2R5YA 5IT3A 1VQOI 1HDDC 2DFIA 4RAFA 2UWMA 2IGNA 1LFUP 3BY6A 2DFFA 3VSLA 4UUVA 1HBXG 4EJWA 3NRVA 1IN5A 1SMYF 3S3OA 2MA3A 2H09A 1FTTA 1TWFJ 2VKHA 5FO5A 2EIJH 1ZR2A 2M1BA 3FMQA 3K7AJ 1RPWA 2NS8A 2X1CA 4C3IJ 3OL3A 4XSXF 3IH3A 5M3FJ 4RAGA 3WG7H 1XMAA 3C1DA 4U88A 3FMRA 2VJJA 5HLTA 4GO1A 4XMYA 4M72A 2HNHA 4OMYA 5ICFA 4M3BA 1LEBA 2CUFA 3KE2A 2L2OA 1Y8QB 1L3LA 2DA4A 1OR7A 4DIQA 2FE3A 4LB5A 1S29A 3MEXA 1PUEE 1VF9A 2HTSA 3GEZA 3GZNB 4CYCB 1TL8A 2VXDA 1YG2A 3L2UA 1PYVA 3BCAA 3JSPA 3RSNA 3MZYA 3WGHA 2PX9A 3FIWA 1KGSA 4PK4A 1CQTA 3GCMA 4BJ6C 4YIRX 2P5VA 1BC7C 1VQ6I 1Z6TA 1BW5A 3V7CA 3DEUA 3C7JA 1B1BA 4A3DJ 2HKXA 3I9V2 3HM5A 2E34A 3UKGA 2YPRA 4IPAA 3O8HA 5B1AH 3K2ZA 4KICA 4XLEA 5E18F 2MD0A 3LAJA 3BR5A 1VQPI 4BQNA 4EM1A 2QQAA 4ZYGA 1LE8B 4KYWA 3EETA 1UMQA 4CCKA 3FWEA 2BV6A 3GVAA 3U1DA 2AS5F 3JRGA 1SFOJ 4MGRA 4LIUA 1FBSA 2N8GA 3HRMA 1MZBA 2XAHA 1Z6RA 4HF0A 2LBFA 1UB9A 3ABTA 3HOSA 1BA5A 5JLWA 2I5UA 1T95A 1W36D 1X1CA 1B9NA 4UHTA 5K7ZA 2DA3A 4A3GJ 2DO7A 4UXNA 1U9NA 2OUMA 5EGOA 3CLQA 1Z77A 2JTVA 2XC7A 2K02A 3KIOA 3FXMA 1R49A 2R5ZB 2HZTA 1K61A 1IXCA 1LKXA 3GF2A 2XKPA 3C2BA 4GCVA 2R7OA 3DBRB 2DOEA 4IQJA 4PJ0C 1ORKA 4XKBA 1MBGA 3FF5A 1XSXA 2CQ7A 3EUHC 5DD8A 3SXYA 3M8EA 4BQQA 3OYGA 1X1BA 4LGWA 3OYKA 3ZQFA 4NBQA 2EZIA 2QF7A 4A3KJ 3A1YA 4N4NB 1R71A 5F0HA 2F5CA 3DQVC 1SAUA 1HKQA 3LWFA 2OA4A 2WY7Q 1H9TA 2BE5F 4DYQA 1W4MA 5ILVA 2H1LA 2Y69H 5M5YJ 4MEXF 2FQ3A 1FPQA 1RR8C 2CMPA 2J5OA 2M8GX 5KAFC 3B6CA 4I99C 4XLAA 2XF7A 3EUKL 3TO9A 3ZPLA 1F9NA 5FLXZ 1XGMA 2BY2A 2NVXJ 4WXCA 2PJPA 1R22A 2K86A 3QP6A 1GV2A 4CGZA 2K3FA 2XGDA 3P9CA 1TT0A 1X1AA 2IJLA 1FWZA 3RYPA 4G12A 2KPMA 2M34A 4W97A 2H27A 3BT9A 1EA3A 3DPLC 5L3DA 4D7MA 2F5EA 3V7RA 4UV9A 1AKHA 3QYBA 4MTDA 3QYEA 2EZKA 4LB6B 3ZMTA 2MABA 5LD2C 2F5DA 4PCQA 2GOXB 3HBLA 3CCYA 2XV4S 1YITI 1W5CC 2QWWA 3PUBA 4QLCU 3DU6A 3ZR8X 5F04A 4L5JA 4P5OA 1B8IA 2DYSH 2ZMEA 4ZTFA 3A0HC 1Y1VJ 2JPCA 1U5TC 1I5ZA 5HDKA 1P92A 2HYGD 3EYIA 2CGPA 5D5UB 3GFLA 1R4MB 3SEQA 5LRRA 1LB2A 1ZGWA 1WSUA 4Z6YA 5GADJ 2Q8KA 1IAWA 1V55H 1VQNI 1Y6IA 2JWTA 2ZNZA 2XPWA 3GMEA 2RDPA 2L4AA 1F36A 2JK3A 2XAFA 2KDZA 3CF5F 2VONA 3P9IA 5KK1A 1LPQA 2WAQA 3S2DJ 2HKOA 2HDCA 2HPIA 3BJAA 3J80K 3KLOA 4A0YA 1MMNA 2CUEA 2L7MP 2PMHA 3G1LA 4HYEA 2ID6A 4CCMA 2LKSA 1DPRA 1HXDA 3LSJA 3QPLA 3CCUI 4IHVA 1VQKI 3D0SA 2XGXA 4C30A 4MTEA 3G3ZA 3NAUA 3NEUA 2IS1A 3DU5A 1W7PB 3SEZA 5CQGA 1HSJA 4G94A 5HS8A 1YJWI 1FLIA 4UVCA 3CCRI 3K1NA 4EV0A 2R7QA 3QAHA 2LREA 1YS6A 2GQQA 4JX4A 4BE2A 2LG4A 2STWA 3ECHA 2X6XA 4UVAA 3VWBA 1P7JA 4A5MA 4FX4A 1T0FA 2FOWA 3S15J 2BZTA 2WWYA 4BJ5C 3WTTC 2FU4A 5J6XA 3R60A 4EQQA 3HYIA 1H89C 2PJRB 3H35A 1VQ9I 1MMDA 3HOWJ 2G7UA 2Z2SB 1AU7A 5CJ9A 3ZQQA 2OC6A 3E6BA 4M9XA 2ELKA 4WK8F 1QPIA 2NNNA 2R7FA 4AVZA 4BHPA 5BOXA 2XIGA 4IHWA 5B3SH 1GHCA 4A6EA 3IV5A 1KZHA 3SJMA 2QBYB 3DLAA 1IXSB 4G7HF 1BJZA 2RC4A 4I7HA 1ETQA 3RZOJ 3VSKA 2OU2A 1DP7P 2DK5A 3RI4A 2A5YB 2VN2A 5FB2A 1WJ5A 4Q47A 1PUFA 1JHFA 1TWCJ 4J01A 2KIUA 4KNYA 1VNDA 4NUBA 1Y1WJ 1OQYA 3BZKA 3F8BA 2K85A 4D7NA 1V5EA 4L9NA 2BGCA 2JSPA 1XC5A 2M0CA 5E1ZB 1OYIA 3DTKA 2IS4A 4A3IJ 2B0LA 2WV1A 4C3HJ 4YFXF 1F4KA 2I10A 1X1DA 1ZAOA 2COBA 2VE9A 2O61A 1OCPA 1HF0A 5LGNA 1R4NB 1EKEA 3M1EA 5FKLA 4BE0A 3C2HA 4I6ZA 5CLSA 3G4SI 3S2HJ 3FM3A 2Y9ZA 2BY0A 4U87A 5K7HA 2NOGA 4DW6A 4PJJA 4KMFA 2CSOA 3WODF 3ZMZA 1YLFA 2ZSIB 5F27A 5DS9A 2HXOA 4ZDPA 1Z05A 4ENJA 1ACIA 2KZGA 1WJDA 4OAYA 1MH3A 1IN4A 2PI0A 4H0EA 1NG7A 2JA8J 3BG5A 2BBYA 3OYFA 3V4GA 2A6TA 2QYOA 2LY1A 4CCLA 3L2CA 5IY5H 3ZMUA 2E2HJ 3T8RA 1WJEA 4Y13A 3BQZA 1ZKGA 2O9LA 1LEAA 2R7ZJ 2CRGA 1S6LA 1SFXA 4LITA 1BI0A 5AIQA 3G1OA 2F5FA 4GGGA 1GT0C 2DW4A 4MFDA 4CYCA 5CVRA 3BQYA 2E71A 3ZQGA 5A2QZ 2E5ZA 1QO0D 4IVNA 2A05A 3DTEA 3KP7A 3IWFA 4QIWN 1JGSA 4IXAA 3CCQI 2ZXHA 4RS8A 1I27A 1IJWC 5FJ8J 3L2WA 1Z7UA 3G6EI 4ON0A 2NVUB 4PGGA 3BR0A 1XPXA 2E7WA 2OF7A 2XGEA 3L2QA 5LHIA 3ZP5A 2D2WA 2FSWA 1HKSA 3ISPA 2O8KA 4BXFA 4CCOA 1NK3P 3HRUA 1MNDA 3DLLF 1LE8A 2BW3B 4E70A 1FY7A 2JQ7A 2BEOA 2LOOA 1TNTA 4GFBA 1I6XA 3B73A 1DDNA 2DT5A 5IP9J 4UNOA 2FA5A 5M5WJ 2DK8A 1QVUA 1CF7B 2DQRA 2Z3YA 1RESA 2K4BA 1YHQI 1YJNI 1JJ6C 2DJIA 2XF6A 1B6AA 2W00A 2HVRA 3H9QA 2FMYA 1XG1A 4JK1X 1ZK8A 3RTRA 3TO6A 3CCLI 2V4JC 3KZIC 3JW4A 2P5KA 1IDZA 3KP2A 2OPTA 2MLKA 2HFHA 5DUKA 5J47A 5F0FA 2WB1N 3JAMK 3PO3J 3OS2A 3NWSA 1XD7A 1ZHFA 1IF1A 3K4LA 3QODA 2FD5A 3KEOA 2K9NA 4LJZF 3ZQLA 2W7NA 3HTSB 4RDUA 3ABLH 1Z0XA 2EZLA 2LLKA 3CDIA 3O8GA 4QTRA 2ACJA 4RAZA 1FEXA 2HZDA 1QZZA 1LVAA 3F8MA 2LYCA 4AU7A 4NC7A 5JI6A 1SD4A 4HA8A 2L3DA 1SANA 5IPAA 3LSKA 1ZGJA 4KT6A 2IT0A 1J9IA 1MDMB 5M3MJ 3BTLA 1PVEA 3DFGA 2Y2ZA 2JUCA 3CUOA 4RM3A 2IEKA 5L3FA 3RJPA 5HVQC 3K69A 2YU9J 3TEDA 3L7WA 1DGRM 4HLXA 2FRHA 3PL8A 2RKHA 1YW8A 1HKTA 2CO5A 1W0UA 3DBHB 5FRMA 2LMDA 3I55I 3OOPA 4DNCA 5FLXK 3GYHX 3CMYA 4BS9A 2NNYA 5EEHA 1D0YA 2GXBA 2H94A 2W82A 1UHSA 1NTCA 4V2FA 1Z91A 1ZRCA 4LIVA 3DEWA 3HGYA 4E7LA 1B9MA 1WWXA 1N25A 3R0AA 4GYIA 5ERIA 1D1CA 2FNPA 2ZXWH 3BWGA 2W84A 2TRTA 1DU6A 4RB2C 4AIDA 1MJ9A 2IGOA 2EV5A 2DXIA 3ZQHA 3F8FA 4U7BA 4MEYF 4YIFA 4L18B 3BG9A 4JBAA 4L5EA 5HODA 3FK6A 4E7KA 1BC8C 2VOOA 5F08A 3EUHA 3HXLA 3X2QH 2KFDA 4M6YA 5E8IA 3GTPJ 4HX7A 1FMVA 1KU7A 2CU7A 2DFEA 3LFKA 1WCMJ 3SZPA 2QSGX 3WTXC 3GXOA 1FT9A 1ZN2A 4F91B 4OIPF 3IRQA 2R4GA 3ABMH 1C0WA 2HYFA 2HOSA 1VQ5I 2LP0A 5D5WB 2XPVA 3TBIA 1LDKB 3JTHA 3SFIA 4OMZA 2HYJA 3D5RC 2DA6A 5BNGA 2HI3A 1H88C 1UJ8A 4M3DA 4DZPA 2A69F 3W3CA 4ZDOA 4Y7NJ 3HOZJ 2PMUA 1QA6A 1D8KA 2LD5A 2QVOA 2X0LA 1IW7F 1OLTA 3I4MJ 3RDIA 3OYIA 1K4TA 2QENA 1OMIA 1K6YA 4B48A 2YX7A 4PSXA 1OCCH 3FBIB 1BIAA 2BOLA 1XTAA 2TDXA 4KJZA 5HOOA 3L1PA 3PQKA 4A2UA 4MNUA 1W7PA 2EIKH 1O3TA 4CH7A 3LSMA 2QSHX 5DCMB 1UHWA 1BM9A 2HQAA 2IGKA 2A07F 2V9KA 2KT0A 1X2MA 3L00A 3ZGKA 2IPQX 3OY9A 1X4OA 2RN7A 2HDWA 1DPUA 1TZLA 4BYYA 3U9GA 3KP5A 2JVHA 4IEJA 1U3EM 1JKPC 4XSZF 3G2BA 2XGCA 1M1EB 3VFZA 3BZCA 3FK7A 4KIBA 4PJMA 3KCCA 3UR3C 1DP3A 2PJRA 4HBLA 4I2OA 4AVPA 1R5HA 5EZGA 4ZDLA 2VQCA 1VZ0A 4CUGA 2RQQA 1VFCA
chains in the Genus database with same CATH topology
3WU1B 5LBQA 1PP8F 3FM5A 3GLXA 4IRGA 1XGNA 2QBYA 4M71A 1I1SA 3F23A 4HF2A 4BQAA 2L02A 3J81Z 3MAJA 4GXOA 4A12A 2P7VB 5L3EA 1P4AA 4M73A 1FSEA 4RGUA 5K5OA 5F64A 2DPUA 3MWMA 2O0YA 3DF8A 1RIOH 4U0WA 2RVCA 3DP7A 5JHUA 4BH9A 1ON2A 3CO7C 5ILUA 4AIKA 4WXHA 1RI7A 1FP1D 1G3TA 1TBXA 4HZFA 4CYDA 2OZUA 4KN4X 5D8KB 4RB3C 3FXRA 4KA4A 1SAXA 5LHHA 2VBZA 4KIFA 3O3KA 4KFCA 1G3YA 1ONVA 2X4HA 4WX9A 3I53A 2W24A 4Y17A 3VODA 3F8NA 2IW5A 4ESBA 2P4WA 3K0LA 2A61A 3KLNA 4NB5A 2IA1A 3O6BB 1BI1A 1W7PD 2LKPA 4A5NA 5IT9Z 3NQOA 2ETHA 3WE2A 5CVIA 1FX7A 1G6NA 3RPQA 1R1UA 4OOIA 4HLYA 4YIIA 3BP8A 4CO8A 4HDUA 2FXAA 1A04A 1YTYA 1P6RA 4HF1A 5FD6A 2ZXJA 3KZZA 2ELHA 1QPMA 3QPHA 2HS5A 3ML6A 3IKTA 1LDDA 4ZYDA 4LMYA 2STTA 1T38A 4KIGA 3WG9A 5E1WA 2DAOA 4ENNA 5BMZA 2COMA 5DCFA 3BJOA 3KFWX 3E5XA 2WTEA 2HTJA 3QPTA 2NS0A 1KYZA 3V8LA 4U0VA 4G6DA 2P8TA 2H6CA 1MDMA 3J7AO 3E97A 2AXLA 1JXSA 1TQIA 3FHZA 4ZYHA 1TQPA 3MQ0A 4KMUX 4G7OF 2OD5A 3VOEA 1JE8A 4KUMA 3WTVC 4ZYEA 2PN6A 3ZMDA 5AIPA 1G3SA 2DTRA 1G3WA 4EJOA 3FZVA 2K27A 3R0JA 2C6YA 1MGTA 5E20A 4N0BA 3KP6A 2O6GE 1UCRA 3C18A 4BAYA 1HW2A 4RB0A 1XB4A 3ROUA 2XROA 4I98B 3TDUC 4ZZDA 3C3WA 4I0AA 3IC7A 4HQEA 3BJ6A 2A6EF 2P6TA 1P4XA 4G9YA 1BBYA 3S2WA 5H20A 4P9FA 4D0PA 3W6JB 1K7AA 1XGOA 2NYXA 2V6CA 4CXFA 5HLIA 2GXGA 2JPBA 1I1GA 1IZ1A 4IHSA 3IL2A 1BN5A 1D3YA 2L54A 4I02A 2WC2A 5EEGA 5DCMA 1EH7A 1KU2A 2XAJA 1YYVA 4XLPF 1U5TB 4F7ZA 3F21A 2ESHA 4RGXA 1JHHA 4M9SA 1IN6A 2D1VA 3H92A 3ELKA 2NRAC 3T5XA 1LJ9A 3W6KB 3I64A 4ESJA 4IHTA 1DUXC 2JRTA 1TTYA 2HWVA 1U78A 2L01A 4KT5C 3LQQA 5KVRA 2EA2A 4CICA 4OU0A 2VODA 3WTYC 2QLZA 1OPCA 3QRFF 4RB1A 4AIHA 5L3BA 1FBUA 6PAXA 3BPVA 3P9KA 3HHGA 1RUNA 1K78B 4DQ2A 5F6FA 1IXRC 5BPIA 2VC0A 3U2RA 4Q48A 3QU3A 3ZMVA 1FP2A 3OV8A 1ZGAA 4MQ9F 4QWQA 1J75A 2PLYA 3WGIA 2ZNYA 2E7XA 4HV5A 1XSVA 3REOA 2FOKA 2ISZA 1VTNC 1Z1DA 5JVTA 4NQWA 2JSCA 3DKWA 3CTAA 3ZN0A 4EGZA 5L3GA 3M8FA 5IT9K 2XHKA 3TO7A 3EQLF 5K5RA 2PBIA 3FX3A 1R36A 2VBWA 2VBXA 2UXNA 3GUDA 1XDUA 1J59A 1HQCA 3V7SA 2DPDA 1XCBA 2V1UA 2NAZA 2KJBA 3HRTA 1QBJA 3ZQ7A 3HSFA 1EH8A 1P4WA 2FF4A 2YU3A 3P7NA 3I58A 3CUQC 2EJRA 3I59B 1KU3A 1SFEA 2VC1A 4MQVA 3DV8A 3TQNA 1W5TA 4RGRA 1S7OA 1ZRFA 1UFMA 3ULQB 4ZH4F 2XVCA 5TRDA 1QNTA 2OBPA 2PQ8A 2PFBA 1F5TA 2FBHA 1FSHA 2FNAA 3N4MA 3IWZA 2G7HA 1T6SA 2MC3A 3ZN1A 4LG0B 1NHAA 2JT1A 1EV7A 4A0ZA 5FGMA 5BQTA 1QZYA 1R23A 1ZH5A 2ESNA 2ZJ2A 3Q5FA 2GZWA 3EDPA 4EJTA 3CUQB 4B8XA 4ETSA 3N97A 2QQBA 3Q9VA 1B4AA 2XUBA 4BXUA 4L5IA 2V1DA 1F1ZA 4YFKF 2CQKA 5DEQA 1FBQA 3E6CC 3E6DA 1FYKA 4P55A 4BHBA 1IUYA 4HX4A 3KP3A 2W57A 3E6MA 3VB2A 3WTUC 3KZYA 4HOBA 2R3SA 1MD0A 3T0YA 1HSTA 2K7LA 4AIJA 1U8RA 1ULYA 2MLGA 1Y0UA 3FXQA 3IRRA 3WTSC 1ZARA 1K79A 2P5LC 2V1XA 3J80Z 1BJAA 1ZRDA 2ZFWA 2H6BA 3JTGA 2MD5A 1Q1HA 5FD5A 3AAFA 2XAQA 4EM0B 3FXUA 4L9VA 1YS7A 1J2XA 1WI9A 5DDGA 2GWRA 4ESFA 2ISYA 2ZBKA 3WTZA 1XN7A 5D8LB 1FZPB 2R7DA 2W85A 3R4KA 1KYWA 2DQLA 4HAMA 4ENMA 4AD9A 4N9HA 3T1BA 4B09A 5LHGA 2XAGA 4OINF 5K5QA 2PEXA 1XGSA 4BHCA 1ZLKA 3G73A 1U5TA 3M7GA 4ZZLA 2HGCA 5D6EA 4ENKA 3HIFA 2J5PA 4IRHA 2EA4A 4KDPA 3WU0A 2UZKA 1U6GA 3WGGA 4WWCA 1R1TA 1YIOA 2DLLA 2QUFA 2O03A 4N9IA 4LFUA 4JQFA 3LAPA 2E1CA 1WKMA 3V8JA 2D45A 2E1NA 1O7LA 3T8TA 5JFRA 4EJVA 1W5SA 1FYMA 4K2EA 1WQ2A 2XASA 5LLQA 4S05A 1K78A 4GYGA 2A68F 3BOQA 4YFNF 5F1RA 1O3SA 2MH2A 1T39A 1J5YA 2Z5UA 2KJCA 5DUIA 4RAYA 3D5LA 1BI2A 2Y48A 3E5UA 4XBFA 4Q4ZF 5TJJA 2F2EA 3ERED 1OKRA 4S04A 3TKYA 3JSOA 1ZLJA 5DYMA 2M30A 5A2QK 4U0YA 1O7FA 5E17F 1O3RA 1RNLA 1TNSA 5J8CA 3H3ZA 5HLGA 4WXDA 5D5VB 3GX4X 2PG4A 1ZYRF 2IA2A 2EFWA 5E1XA 4IRIA 2YSRA 3SQNA 1IN8A 2ZKZA 4MHGA 4Z2YA 3TDZC 2ZCWA 1CF7A 2KKOA 5JR3A 2FEZA 4O6JA 3SZTA 3I59A 1LQ1A 1USSA 3F3XA 4I0BA 2MH9A 4EJUA 4M9ZA 3F8CA 1SD5A 5L3CA 3JAMZ 3HSEA 4EMSA 2CG4A 3CDHA 1R7JA 1R58A 1S3JA 1HW5A 1RZ4A 1ZG1A 2EV0A 2LF8A 3V8KA 1EH6A 5E8GA 5ILSA 4LG0A 3LQRA 2UXXA 3RIRA 2GA1A 4L0YB 1X3UA 4LK1F 4BNCA 2OAZA 1K6OA 4L9TA 3F6VA 1E2XA 4LD5A 1GVJA 2A3SA 3CUQA 2LF7A 3ABUA 1P2FA 1J7KA 3BDDA 2BYVE 4OIOF 1OYWA 3WE3A 3E5QA 4A0XA 3KP4A 5CVUA 2LDUA 1BIBA 3L9FA 4M74A 1YW7A 4HW0A 3DXJF 3ZMSA 1USTA 2OQRA 3EYYA 4P96A 4AWXB 3PQJA 5H6RA 5ED4A 5D5XB 4O5VA 1CGPA 2Y0MA 4TV7A 5LEKA 1GXPA 4O3MA 5ICGA 3WTWC 2WV0A 4UV8A 3GFJA 3DPTA 5ICCA 3F22A 4XLNF 2OZ6A 2M45A 5FFZA 1HW1A 2DU9A 2EWNA 3QU6A 3SFZA 4WF2A 2RQPA 5HS7A 2YX4A 2OQGA 2L4MA 2LNBA 1GXQA 4L9JA 3I5UA 2FMLA 3GZ6A 1LNWA 4ASNA 2A6HF 4RGSA 5D4SA 5H6QA 4XRFA 3I0TA 3I54A 3F72A 2EFOA 1MJBA 3I4PA 5K1YA 1YO5C 3COAC 2RNJA 3J81K 3ECOA 1IN7A 3HUGA 4LLGF 3CJNA 2YR2A 4I01A 4KN7X 1ON1A 1FC3A 2IRFG 3GW2A 3QP5A 3KETA 1SD6A 4PZJA 3K1MA 2CW0F 2IA0A 1MKMA 2ZO4A 4M6XA 2P6SA 4HV6A 2O8XA 4PGHA 4CZZA 2VT3A 2D1HA 4R1HA 1KU9A 3B02A 4NHJA 1LDJA 2QQ9A 3LA2A 5DV5A 1SD7A 2HR3A 4FT8A 1KQ0A 4G8XA 1V3FA 5HLHA 2VXZA 3BROA 3TOBA 5BS6A 1U2WA 2Y75A 2HQRA 4HDVA 2EFNA 1ZG3A 4FHTA 2KIFA 4HQMA 4CHUA 1KQ8A 5HDGA 2DBBA 2EFQA 4OIRF 4HX8A 1MJAA 3MCZA 5J8FA 1E17A 1IRFA 3LA7A 1V4RA 4Y15A 4UVBA 2M87A 4G7ZF 5AONA 4U7DA 4Q5SF 3GWZA 2IP2A 5CYVA 2HQNA 1XMKA 2K4JA 3RPUA 1RUOA 4G6QA 2DI3A 5CVJA 4R79A 1XDSA 2LSOA 4YG2F 4R8HA 4I09A 3M9AA 3HRSA 2Z9OA 3PFIA 1STZA 1SMTA 2EB7A 1O3QA 4WCGA 4LK0F 3GFMA 3CLOA 1H9GA 2HOEA 2O3FA 1YFHA 1R1VA 1R5GA 1KQ9A 4EVIA 2MBFA 4EGYA 1R00A 3RKYA 2CWEA 2FBIA 1TLHB 2GA2A 3I71A 3HSRA 1YW9A 2EK5A 1G4DA 3QOPA 4CDGA 1QGPA 1BI3A 2P7CB 1FYLA 1TW2A 2RV8A 2V79A 4LLNA 2CFXA 3TGNA 2XRNA 1YQAA 1D5VA 2EFPA 1S8NA 1BOAA 2VOPA 1WRJA 2Z33A 3GZ5A 3SHFA 1OYYA 3RYRA 5LGUA 2JZYA 2KIMA 3R6SA 3E3VA 1FOKA 2RGVA 3MZHA 2M8EA 2VT2A 1T98A 1B59A 2HEOA 5HS9A 2ZMEB 4OIQF 5FFXA 1TQMA 1UHMA 1TW3A 5D6FA 4PDKA 2XKOA 4LLLA 1AWCA 4L0ZB 3BPXA 1PP7U 1ZREA 2GAUA 3L09A 1FNNA 3RKXA 2GIVA 2QZ8A 5D4RA 1IRGA 1ODDA 4IF4A 5LRSA 2W25A 3VEPA 2Z99A 4FX0A 2FBKA 1J0RA 2Q2EA 3TOAA 4P9UA 1AOYA 3GO5A 1D8JA 2V9VA 5BPDA 2Q0OA 3IKVA 3IHUA 2G9WA 1L0OC 4EM2A 2EV6A 3LSTA 2KRFA 3LA3A 3MFKA 1S7AA 3RKWA 3H3UA 1QQIA 2QM3A 3BZ6A 1ZG5A 1H0MA 3O2PE 2VE8A 1T2KA 4IJAA 3R61A 5ICEA 1REPC 2CYYA 3K1PA 1Z9CA 1O57A 1KA8A 3FMSA 5LEJA 5LGTA 1PDNC 1SFUA 3HOTA 3HHHA 3CO6C 2ADUA 3Q9SA 3GFIA 2IVMA 5HDNA 1XCVA 2M5WA 5CVVA 3F6OA 3K9TA 1XSDA 3KEQA 4A6DA 3HTUA 5DD4A 2VBYA 5IT3A 2DFIA 2UWMA 3BY6A 4UUVA 1HBXG 4EJWA 3NRVA 1IN5A 1SMYF 2MA3A 2H09A 5FO5A 2M1BA 3FMQA 4XSXF 1XMAA 3C1DA 4U88A 3FMRA 4GO1A 4M72A 4OMYA 5ICFA 1LEBA 3KE2A 1L3LA 1OR7A 4LB5A 2FE3A 1S29A 3MEXA 1PUEE 2HTSA 3GEZA 1YG2A 3JSPA 3MZYA 3WGHA 1KGSA 2P5VA 1BC7C 1Z6TA 3V7CA 3DEUA 3C7JA 1B1BA 2HKXA 2YPRA 4IPAA 3K2ZA 4KICA 5E18F 3LAJA 4EM1A 2QQAA 4ZYGA 4KYWA 3EETA 3FWEA 2BV6A 3GVAA 3U1DA 2AS5F 4MGRA 1FBSA 3HRMA 1MZBA 2XAHA 1Z6RA 4HF0A 1UB9A 3ABTA 3HOSA 1B9NA 4UHTA 2DO7A 4UXNA 2JTVA 2K02A 2HZTA 1IXCA 3GF2A 2XKPA 4GCVA 3FF5A 1XSXA 5DD8A 3SXYA 3M8EA 4LGWA 2F5CA 3DQVC 1HKQA 3LWFA 2OA4A 1H9TA 2BE5F 1W4MA 5ILVA 4MEXF 2FQ3A 1FPQA 2J5OA 3TO9A 3ZPLA 1F9NA 5FLXZ 1XGMA 4WXCA 2PJPA 1R22A 2K86A 3QP6A 4CGZA 3P9CA 2IJLA 1FWZA 3RYPA 2H27A 3DPLC 5L3DA 2F5EA 3V7RA 4UV9A 4MTDA 4LB6B 3ZMTA 2F5DA 4PCQA 2XV4S 2QWWA 4QLCU 4L5JA 4P5OA 2ZMEA 2JPCA 1U5TC 1I5ZA 5HDKA 1P92A 2HYGD 3EYIA 2CGPA 5D5UB 3GFLA 5LRRA 1LB2A 1WSUA 2Q8KA 1IAWA 2ZNZA 2RDPA 2L4AA 2XAFA 2VONA 3P9IA 5KK1A 2HKOA 2HDCA 3BJAA 3J80K 3KLOA 4A0YA 2PMHA 4HYEA 1DPRA 1HXDA 3D0SA 2XGXA 4MTEA 3G3ZA 3NEUA 1W7PB 1FLIA 1HSJA 4G94A 5HS8A 4UVCA 3K1NA 4EV0A 3QAHA 1YS6A 2GQQA 2STWA 3ECHA 4UVAA 4A5MA 4FX4A 1T0FA 2WWYA 3WTTC 2FU4A 5J6XA 3R60A 4EQQA 3HYIA 2G7UA 5CJ9A 3E6BA 4M9XA 4WK8F 2NNNA 2R7FA 4BHPA 5BOXA 2XIGA 1GHCA 4A6EA 2QBYB 1IXSB 4G7HF 2RC4A 4I7HA 2OU2A 1DP7P 2DK5A 3RI4A 2A5YB 2VN2A 5FB2A 4Q47A 1JHFA 2KIUA 4KNYA 3F8BA 4L9NA 2BGCA 5E1ZB 1OYIA 2B0LA 4YFXF 1F4KA 1ZAOA 2VE9A 2O61A 5LGNA 3M1EA 5CLSA 3FM3A 4KMFA 2CSOA 3WODF 3ZMZA 1YLFA 4ENJA 1Z05A 1IN4A 2PI0A 4H0EA 2BBYA 3V4GA 2QYOA 3L2CA 3ZMUA 3T8RA 4Y13A 1LEAA 1S6LA 1SFXA 1BI0A 5AIQA 2F5FA 4GGGA 2DW4A 5CVRA 5A2QZ 1QO0D 4IVNA 3KP7A 3IWFA 1JGSA 4IXAA 4RS8A 1I27A 1Z7UA 4ON0A 4PGGA 2E7WA 5LHIA 3ZP5A 2D2WA 2FSWA 1HKSA 3ISPA 3HRUA 4E70A 1FY7A 2BEOA 1TNTA 1I6XA 3B73A 1DDNA 2DT5A 4UNOA 2FA5A 2DK8A 1CF7B 2DQRA 2Z3YA 2K4BA 1B6AA 2FMYA 4JK1X 3RTRA 3TO6A 3JW4A 2P5KA 3KP2A 2MLKA 2HFHA 5DUKA 3JAMK 1XD7A 1ZHFA 1IF1A 3KEOA 4LJZF 3HTSB 2ACJA 4RAZA 1QZZA 1LVAA 3F8MA 5JI6A 1SD4A 4HA8A 2L3DA 1ZGJA 2IT0A 1J9IA 1MDMB 3DFGA 3CUOA 5L3FA 3RJPA 5HVQC 3K69A 3L7WA 4HLXA 2FRHA 2RKHA 1YW8A 1HKTA 2CO5A 3OOPA 4DNCA 5FLXK 3GYHX 2NNYA 5EEHA 2GXBA 2H94A 1Z91A 1ZRCA 1B9MA 1WWXA 3R0AA 4GYIA 5ERIA 2FNPA 3BWGA 2W84A 4RB2C 1MJ9A 2EV5A 3F8FA 4U7BA 4MEYF 4YIFA 4L18B 4JBAA 1BC8C 2VOOA 3EUHA 4M6YA 5E8IA 4HX7A 1KU7A 3LFKA 3SZPA 3WTXC 3GXOA 1FT9A 1ZN2A 4OIPF 3IRQA 1C0WA 2HYFA 5D5WB 1LDKB 3JTHA 4OMZA 2A69F 2PMUA 1D8KA 2QVOA 2X0LA 1IW7F 3RDIA 2QENA 1OMIA 2YX7A 1BIAA 2TDXA 5HOOA 3PQKA 4A2UA 4MNUA 1W7PA 1O3TA 5DCMB 1UHWA 1BM9A 2A07F 3L00A 2IPQX 2RN7A 1DPUA 4BYYA 3U9GA 3KP5A 1U3EM 4XSZF 3VFZA 4KIBA 3KCCA 4HBLA 4I2OA 4AVPA 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU1 B;  5LBQ A;  1PP8 F;  3FM5 A;  3GLX A;  4IRG A;  1XGN A;  2QBY A;  4M71 A;  1I1S A;  3F23 A;  4HF2 A;  4BQA A;  2L02 A;  3J81 Z;  3MAJ A;  4GXO A;  4A12 A;  2P7V B;  5L3E A;  1P4A A;  4M73 A;  1FSE A;  4RGU A;  5K5O A;  5F64 A;  2DPU A;  3MWM A;  2O0Y A;  3DF8 A;  1RIO H;  4U0W A;  2RVC A;  3DP7 A;  5JHU A;  4BH9 A;  1ON2 A;  3CO7 C;  5ILU A;  4AIK A;  4WXH A;  1RI7 A;  1FP1 D;  1G3T A;  1TBX A;  4HZF A;  4CYD A;  2OZU A;  4KN4 X;  5D8K B;  4RB3 C;  3FXR A;  4KA4 A;  1SAX A;  5LHH A;  2VBZ A;  4KIF A;  3O3K A;  4KFC A;  1G3Y A;  1ONV A;  2X4H A;  4WX9 A;  3I53 A;  2W24 A;  4Y17 A;  3VOD A;  3F8N A;  2IW5 A;  4ESB A;  2P4W A;  3K0L A;  2A61 A;  3KLN A;  4NB5 A;  2IA1 A;  3O6B B;  1BI1 A;  1W7P D;  2LKP A;  4A5N A;  5IT9 Z;  3NQO A;  2ETH A;  3WE2 A;  5CVI A;  1FX7 A;  1G6N A;  3RPQ A;  1R1U A;  4OOI A;  4HLY A;  4YII A;  3BP8 A;  4CO8 A;  4HDU A;  2FXA A;  1A04 A;  1YTY A;  1P6R A;  4HF1 A;  5FD6 A;  2ZXJ A;  3KZZ A;  2ELH A;  1QPM A;  3QPH A;  2HS5 A;  3ML6 A;  3IKT A;  1LDD A;  4ZYD A;  4LMY A;  2STT A;  1T38 A;  4KIG A;  3WG9 A;  5E1W A;  2DAO A;  4ENN A;  5BMZ A;  2COM A;  5DCF A;  3BJO A;  3KFW X;  3E5X A;  2WTE A;  2HTJ A;  3QPT A;  2NS0 A;  1KYZ A;  3V8L A;  4U0V A;  4G6D A;  2P8T A;  2H6C A;  1MDM A;  3J7A O;  3E97 A;  2AXL A;  1JXS A;  1TQI A;  3FHZ A;  4ZYH A;  1TQP A;  3MQ0 A;  4KMU X;  4G7O F;  2OD5 A;  3VOE A;  1JE8 A;  4KUM A;  3WTV C;  4ZYE A;  2PN6 A;  3ZMD A;  5AIP A;  1G3S A;  2DTR A;  1G3W A;  4EJO A;  3FZV A;  2K27 A;  3R0J A;  2C6Y A;  1MGT A;  5E20 A;  4N0B A;  3KP6 A;  2O6G E;  1UCR A;  3C18 A;  4BAY A;  1HW2 A;  4RB0 A;  1XB4 A;  3ROU A;  2XRO A;  4I98 B;  3TDU C;  4ZZD A;  3C3W A;  4I0A A;  3IC7 A;  4HQE A;  3BJ6 A;  2A6E F;  2P6T A;  1P4X A;  4G9Y A;  1BBY A;  3S2W A;  5H20 A;  4P9F A;  4D0P A;  3W6J B;  1K7A A;  1XGO A;  2NYX A;  2V6C A;  4CXF A;  5HLI A;  2GXG A;  2JPB A;  1I1G A;  1IZ1 A;  4IHS A;  3IL2 A;  1BN5 A;  1D3Y A;  2L54 A;  4I02 A;  2WC2 A;  5EEG A;  5DCM A;  1EH7 A;  1KU2 A;  2XAJ A;  1YYV A;  4XLP F;  1U5T B;  4F7Z A;  3F21 A;  2ESH A;  4RGX A;  1JHH A;  4M9S A;  1IN6 A;  2D1V A;  3H92 A;  3ELK A;  2NRA C;  3T5X A;  1LJ9 A;  3W6K B;  3I64 A;  4ESJ A;  4IHT A;  1DUX C;  2JRT A;  1TTY A;  2HWV A;  1U78 A;  2L01 A;  4KT5 C;  3LQQ A;  5KVR A;  2EA2 A;  4CIC A;  4OU0 A;  2VOD A;  3WTY C;  2QLZ A;  1OPC A;  3QRF F;  4RB1 A;  4AIH A;  5L3B A;  1FBU A;  6PAX A;  3BPV A;  3P9K A;  3HHG A;  1RUN A;  1K78 B;  4DQ2 A;  5F6F A;  1IXR C;  5BPI A;  2VC0 A;  3U2R A;  4Q48 A;  3QU3 A;  3ZMV A;  1FP2 A;  3OV8 A;  1ZGA A;  4MQ9 F;  4QWQ A;  1J75 A;  2PLY A;  3WGI A;  2ZNY A;  2E7X A;  4HV5 A;  1XSV A;  3REO A;  2FOK A;  2ISZ A;  1VTN C;  1Z1D A;  5JVT A;  4NQW A;  2JSC A;  3DKW A;  3CTA A;  3ZN0 A;  4EGZ A;  5L3G A;  3M8F A;  5IT9 K;  2XHK A;  3TO7 A;  3EQL F;  5K5R A;  2PBI A;  3FX3 A;  1R36 A;  2VBW A;  2VBX A;  2UXN A;  3GUD A;  1XDU A;  1J59 A;  1HQC A;  3V7S A;  2DPD A;  1XCB A;  2V1U A;  2NAZ A;  2KJB A;  3HRT A;  1QBJ A;  3ZQ7 A;  3HSF A;  1EH8 A;  1P4W A;  2FF4 A;  2YU3 A;  3P7N A;  3I58 A;  3CUQ C;  2EJR A;  3I59 B;  1KU3 A;  1SFE A;  2VC1 A;  4MQV A;  3DV8 A;  3TQN A;  1W5T A;  4RGR A;  1S7O A;  1ZRF A;  1UFM A;  3ULQ B;  4ZH4 F;  2XVC A;  5TRD A;  1QNT A;  2OBP A;  2PQ8 A;  2PFB A;  1F5T A;  2FBH A;  1FSH A;  2FNA A;  3N4M A;  3IWZ A;  2G7H A;  1T6S A;  2MC3 A;  3ZN1 A;  4LG0 B;  1NHA A;  2JT1 A;  1EV7 A;  4A0Z A;  5FGM A;  5BQT A;  1QZY A;  1R23 A;  1ZH5 A;  2ESN A;  2ZJ2 A;  3Q5F A;  2GZW A;  3EDP A;  4EJT A;  3CUQ B;  4B8X A;  4ETS A;  3N97 A;  2QQB A;  3Q9V A;  1B4A A;  2XUB A;  4BXU A;  4L5I A;  2V1D A;  1F1Z A;  4YFK F;  2CQK A;  5DEQ A;  1FBQ A;  3E6C C;  3E6D A;  1FYK A;  4P55 A;  4BHB A;  1IUY A;  4HX4 A;  3KP3 A;  2W57 A;  3E6M A;  3VB2 A;  3WTU C;  3KZY A;  4HOB A;  2R3S A;  1MD0 A;  3T0Y A;  1HST A;  2K7L A;  4AIJ A;  1U8R A;  1ULY A;  2MLG A;  1Y0U A;  3FXQ A;  3IRR A;  3WTS C;  1ZAR A;  1K79 A;  2P5L C;  2V1X A;  3J80 Z;  1BJA A;  1ZRD A;  2ZFW A;  2H6B A;  3JTG A;  2MD5 A;  1Q1H A;  5FD5 A;  3AAF A;  2XAQ A;  4EM0 B;  3FXU A;  4L9V A;  1YS7 A;  1J2X A;  1WI9 A;  5DDG A;  2GWR A;  4ESF A;  2ISY A;  2ZBK A;  3WTZ A;  1XN7 A;  5D8L B;  1FZP B;  2R7D A;  2W85 A;  3R4K A;  1KYW A;  2DQL A;  4HAM A;  4ENM A;  4AD9 A;  4N9H A;  3T1B A;  4B09 A;  5LHG A;  2XAG A;  4OIN F;  5K5Q A;  2PEX A;  1XGS A;  4BHC A;  1ZLK A;  3G73 A;  1U5T A;  3M7G A;  4ZZL A;  2HGC A;  5D6E A;  4ENK A;  3HIF A;  2J5P A;  4IRH A;  2EA4 A;  4KDP A;  3WU0 A;  2UZK A;  1U6G A;  3WGG A;  4WWC A;  1R1T A;  1YIO A;  2DLL A;  2QUF A;  2O03 A;  4N9I A;  4LFU A;  4JQF A;  3LAP A;  2E1C A;  1WKM A;  3V8J A;  2D45 A;  2E1N A;  1O7L A;  3T8T A;  5JFR A;  4EJV A;  1W5S A;  1FYM A;  4K2E A;  1WQ2 A;  2XAS A;  5LLQ A;  4S05 A;  1K78 A;  4GYG A;  2A68 F;  3BOQ A;  4YFN F;  5F1R A;  1O3S A;  2MH2 A;  1T39 A;  1J5Y A;  2Z5U A;  2KJC A;  5DUI A;  4RAY A;  3D5L A;  1BI2 A;  2Y48 A;  3E5U A;  4XBF A;  4Q4Z F;  5TJJ A;  2F2E A;  3ERE D;  1OKR A;  4S04 A;  3TKY A;  3JSO A;  1ZLJ A;  5DYM A;  2M30 A;  5A2Q K;  4U0Y A;  1O7F A;  5E17 F;  1O3R A;  1RNL A;  1TNS A;  5J8C A;  3H3Z A;  5HLG A;  4WXD A;  5D5V B;  3GX4 X;  2PG4 A;  1ZYR F;  2IA2 A;  2EFW A;  5E1X A;  4IRI A;  2YSR A;  3SQN A;  1IN8 A;  2ZKZ A;  4MHG A;  4Z2Y A;  3TDZ C;  2ZCW A;  1CF7 A;  2KKO A;  5JR3 A;  2FEZ A;  4O6J A;  3SZT A;  3I59 A;  1LQ1 A;  1USS A;  3F3X A;  4I0B A;  2MH9 A;  4EJU A;  4M9Z A;  3F8C A;  1SD5 A;  5L3C A;  3JAM Z;  3HSE A;  4EMS A;  2CG4 A;  3CDH A;  1R7J A;  1R58 A;  1S3J A;  1HW5 A;  1RZ4 A;  1ZG1 A;  2EV0 A;  2LF8 A;  3V8K A;  1EH6 A;  5E8G A;  5ILS A;  4LG0 A;  3LQR A;  2UXX A;  3RIR A;  2GA1 A;  4L0Y B;  1X3U A;  4LK1 F;  4BNC A;  2OAZ A;  1K6O A;  4L9T A;  3F6V A;  1E2X A;  4LD5 A;  1GVJ A;  2A3S A;  3CUQ A;  2LF7 A;  3ABU A;  1P2F A;  1J7K A;  3BDD A;  2BYV E;  4OIO F;  1OYW A;  3WE3 A;  3E5Q A;  4A0X A;  3KP4 A;  5CVU A;  2LDU A;  1BIB A;  3L9F A;  4M74 A;  1YW7 A;  4HW0 A;  3DXJ F;  3ZMS A;  1UST A;  2OQR A;  3EYY A;  4P96 A;  4AWX B;  3PQJ A;  5H6R A;  5ED4 A;  5D5X B;  4O5V A;  1CGP A;  2Y0M A;  4TV7 A;  5LEK A;  1GXP A;  4O3M A;  5ICG A;  3WTW C;  2WV0 A;  4UV8 A;  3GFJ A;  3DPT A;  5ICC A;  3F22 A;  4XLN F;  2OZ6 A;  2M45 A;  5FFZ A;  1HW1 A;  2DU9 A;  2EWN A;  3QU6 A;  3SFZ A;  4WF2 A;  2RQP A;  5HS7 A;  2YX4 A;  2OQG A;  2L4M A;  2LNB A;  1GXQ A;  4L9J A;  3I5U A;  2FML A;  3GZ6 A;  1LNW A;  4ASN A;  2A6H F;  4RGS A;  5D4S A;  5H6Q A;  4XRF A;  3I0T A;  3I54 A;  3F72 A;  2EFO A;  1MJB A;  3I4P A;  5K1Y A;  1YO5 C;  3COA C;  2RNJ A;  3J81 K;  3ECO A;  1IN7 A;  3HUG A;  4LLG F;  3CJN A;  2YR2 A;  4I01 A;  4KN7 X;  1ON1 A;  1FC3 A;  2IRF G;  3GW2 A;  3QP5 A;  3KET A;  1SD6 A;  4PZJ A;  3K1M A;  2CW0 F;  2IA0 A;  1MKM A;  2ZO4 A;  4M6X A;  2P6S A;  4HV6 A;  2O8X A;  4PGH A;  4CZZ A;  2VT3 A;  2D1H A;  4R1H A;  1KU9 A;  3B02 A;  4NHJ A;  1LDJ A;  2QQ9 A;  3LA2 A;  5DV5 A;  1SD7 A;  2HR3 A;  4FT8 A;  1KQ0 A;  4G8X A;  1V3F A;  5HLH A;  2VXZ A;  3BRO A;  3TOB A;  5BS6 A;  1U2W A;  2Y75 A;  2HQR A;  4HDV A;  2EFN A;  1ZG3 A;  4FHT A;  2KIF A;  4HQM A;  4CHU A;  1KQ8 A;  5HDG A;  2DBB A;  2EFQ A;  4OIR F;  4HX8 A;  1MJA A;  3MCZ A;  5J8F A;  1E17 A;  1IRF A;  3LA7 A;  1V4R A;  4Y15 A;  4UVB A;  2M87 A;  4G7Z F;  5AON A;  4U7D A;  4Q5S F;  3GWZ A;  2IP2 A;  5CYV A;  2HQN A;  1XMK A;  2K4J A;  3RPU A;  1RUO A;  4G6Q A;  2DI3 A;  5CVJ A;  4R79 A;  1XDS A;  2LSO A;  4YG2 F;  4R8H A;  4I09 A;  3M9A A;  3HRS A;  2Z9O A;  3PFI A;  1STZ A;  1SMT A;  2EB7 A;  1O3Q A;  4WCG A;  4LK0 F;  3GFM A;  3CLO A;  1H9G A;  2HOE A;  2O3F A;  1YFH A;  1R1V A;  1R5G A;  1KQ9 A;  4EVI A;  2MBF A;  4EGY A;  1R00 A;  3RKY A;  2CWE A;  2FBI A;  1TLH B;  2GA2 A;  3I71 A;  3HSR A;  1YW9 A;  2EK5 A;  1G4D A;  3QOP A;  4CDG A;  1QGP A;  1BI3 A;  2P7C B;  1FYL A;  1TW2 A;  2RV8 A;  2V79 A;  4LLN A;  2CFX A;  3TGN A;  2XRN A;  1YQA A;  1D5V A;  2EFP A;  1S8N A;  1BOA A;  2VOP A;  1WRJ A;  2Z33 A;  3GZ5 A;  3SHF A;  1OYY A;  3RYR A;  5LGU A;  2JZY A;  2KIM A;  3R6S A;  3E3V A;  1FOK A;  2RGV A;  3MZH A;  2M8E A;  2VT2 A;  1T98 A;  1B59 A;  2HEO A;  5HS9 A;  2ZME B;  4OIQ F;  5FFX A;  1TQM A;  1UHM A;  1TW3 A;  5D6F A;  4PDK A;  2XKO A;  4LLL A;  1AWC A;  4L0Z B;  3BPX A;  1PP7 U;  1ZRE A;  2GAU A;  3L09 A;  1FNN A;  3RKX A;  2GIV A;  2QZ8 A;  5D4R A;  1IRG A;  1ODD A;  4IF4 A;  5LRS A;  2W25 A;  3VEP A;  2Z99 A;  4FX0 A;  2FBK A;  1J0R A;  2Q2E A;  3TOA A;  4P9U A;  1AOY A;  3GO5 A;  1D8J A;  2V9V A;  5BPD A;  2Q0O A;  3IKV A;  3IHU A;  2G9W A;  1L0O C;  4EM2 A;  2EV6 A;  3LST A;  2KRF A;  3LA3 A;  3MFK A;  1S7A A;  3RKW A;  3H3U A;  1QQI A;  2QM3 A;  3BZ6 A;  1ZG5 A;  1H0M A;  3O2P E;  2VE8 A;  1T2K A;  4IJA A;  3R61 A;  5ICE A;  1REP C;  2CYY A;  3K1P A;  1Z9C A;  1O57 A;  1KA8 A;  3FMS A;  5LEJ A;  5LGT A;  1PDN C;  1SFU A;  3HOT A;  3HHH A;  3CO6 C;  2ADU A;  3Q9S A;  3GFI A;  2IVM A;  5HDN A;  1XCV A;  2M5W A;  5CVV A;  3F6O A;  3K9T A;  1XSD A;  3KEQ A;  4A6D A;  3HTU A;  5DD4 A;  2VBY A;  5IT3 A;  2DFI A;  2UWM A;  3BY6 A;  4UUV A;  1HBX G;  4EJW A;  3NRV A;  1IN5 A;  1SMY F;  2MA3 A;  2H09 A;  5FO5 A;  2M1B A;  3FMQ A;  4XSX F;  1XMA A;  3C1D A;  4U88 A;  3FMR A;  4GO1 A;  4M72 A;  4OMY A;  5ICF A;  1LEB A;  3KE2 A;  1L3L A;  1OR7 A;  4LB5 A;  2FE3 A;  1S29 A;  3MEX A;  1PUE E;  2HTS A;  3GEZ A;  1YG2 A;  3JSP A;  3MZY A;  3WGH A;  1KGS A;  2P5V A;  1BC7 C;  1Z6T A;  3V7C A;  3DEU A;  3C7J A;  1B1B A;  2HKX A;  2YPR A;  4IPA A;  3K2Z A;  4KIC A;  5E18 F;  3LAJ A;  4EM1 A;  2QQA A;  4ZYG A;  4KYW A;  3EET A;  3FWE A;  2BV6 A;  3GVA A;  3U1D A;  2AS5 F;  4MGR A;  1FBS A;  3HRM A;  1MZB A;  2XAH A;  1Z6R A;  4HF0 A;  1UB9 A;  3ABT A;  3HOS A;  1B9N A;  4UHT A;  2DO7 A;  4UXN A;  2JTV A;  2K02 A;  2HZT A;  1IXC A;  3GF2 A;  2XKP A;  4GCV A;  3FF5 A;  1XSX A;  5DD8 A;  3SXY A;  3M8E A;  4LGW A;  2F5C A;  3DQV C;  1HKQ A;  3LWF A;  2OA4 A;  1H9T A;  2BE5 F;  1W4M A;  5ILV A;  4MEX F;  2FQ3 A;  1FPQ A;  2J5O A;  3TO9 A;  3ZPL A;  1F9N A;  5FLX Z;  1XGM A;  4WXC A;  2PJP A;  1R22 A;  2K86 A;  3QP6 A;  4CGZ A;  3P9C A;  2IJL A;  1FWZ A;  3RYP A;  2H27 A;  3DPL C;  5L3D A;  2F5E A;  3V7R A;  4UV9 A;  4MTD A;  4LB6 B;  3ZMT A;  2F5D A;  4PCQ A;  2XV4 S;  2QWW A;  4QLC U;  4L5J A;  4P5O A;  2ZME A;  2JPC A;  1U5T C;  1I5Z A;  5HDK A;  1P92 A;  2HYG D;  3EYI A;  2CGP A;  5D5U B;  3GFL A;  5LRR A;  1LB2 A;  1WSU A;  2Q8K A;  1IAW A;  2ZNZ A;  2RDP A;  2L4A A;  2XAF A;  2VON A;  3P9I A;  5KK1 A;  2HKO A;  2HDC A;  3BJA A;  3J80 K;  3KLO A;  4A0Y A;  2PMH A;  4HYE A;  1DPR A;  1HXD A;  3D0S A;  2XGX A;  4MTE A;  3G3Z A;  3NEU A;  1W7P B;  1FLI A;  1HSJ A;  4G94 A;  5HS8 A;  4UVC A;  3K1N A;  4EV0 A;  3QAH A;  1YS6 A;  2GQQ A;  2STW A;  3ECH A;  4UVA A;  4A5M A;  4FX4 A;  1T0F A;  2WWY A;  3WTT C;  2FU4 A;  5J6X A;  3R60 A;  4EQQ A;  3HYI A;  2G7U A;  5CJ9 A;  3E6B A;  4M9X A;  4WK8 F;  2NNN A;  2R7F A;  4BHP A;  5BOX A;  2XIG A;  1GHC A;  4A6E A;  2QBY B;  1IXS B;  4G7H F;  2RC4 A;  4I7H A;  2OU2 A;  1DP7 P;  2DK5 A;  3RI4 A;  2A5Y B;  2VN2 A;  5FB2 A;  4Q47 A;  1JHF A;  2KIU A;  4KNY A;  3F8B A;  4L9N A;  2BGC A;  5E1Z B;  1OYI A;  2B0L A;  4YFX F;  1F4K A;  1ZAO A;  2VE9 A;  2O61 A;  5LGN A;  3M1E A;  5CLS A;  3FM3 A;  4KMF A;  2CSO A;  3WOD F;  3ZMZ A;  1YLF A;  4ENJ A;  1Z05 A;  1IN4 A;  2PI0 A;  4H0E A;  2BBY A;  3V4G A;  2QYO A;  3L2C A;  3ZMU A;  3T8R A;  4Y13 A;  1LEA A;  1S6L A;  1SFX A;  1BI0 A;  5AIQ A;  2F5F A;  4GGG A;  2DW4 A;  5CVR A;  5A2Q Z;  1QO0 D;  4IVN A;  3KP7 A;  3IWF A;  1JGS A;  4IXA A;  4RS8 A;  1I27 A;  1Z7U A;  4ON0 A;  4PGG A;  2E7W A;  5LHI A;  3ZP5 A;  2D2W A;  2FSW A;  1HKS A;  3ISP A;  3HRU A;  4E70 A;  1FY7 A;  2BEO A;  1TNT A;  1I6X A;  3B73 A;  1DDN A;  2DT5 A;  4UNO A;  2FA5 A;  2DK8 A;  1CF7 B;  2DQR A;  2Z3Y A;  2K4B A;  1B6A A;  2FMY A;  4JK1 X;  3RTR A;  3TO6 A;  3JW4 A;  2P5K A;  3KP2 A;  2MLK A;  2HFH A;  5DUK A;  3JAM K;  1XD7 A;  1ZHF A;  1IF1 A;  3KEO A;  4LJZ F;  3HTS B;  2ACJ A;  4RAZ A;  1QZZ A;  1LVA A;  3F8M A;  5JI6 A;  1SD4 A;  4HA8 A;  2L3D A;  1ZGJ A;  2IT0 A;  1J9I A;  1MDM B;  3DFG A;  3CUO A;  5L3F A;  3RJP A;  5HVQ C;  3K69 A;  3L7W A;  4HLX A;  2FRH A;  2RKH A;  1YW8 A;  1HKT A;  2CO5 A;  3OOP A;  4DNC A;  5FLX K;  3GYH X;  2NNY A;  5EEH A;  2GXB A;  2H94 A;  1Z91 A;  1ZRC A;  1B9M A;  1WWX A;  3R0A A;  4GYI A;  5ERI A;  2FNP A;  3BWG A;  2W84 A;  4RB2 C;  1MJ9 A;  2EV5 A;  3F8F A;  4U7B A;  4MEY F;  4YIF A;  4L18 B;  4JBA A;  1BC8 C;  2VOO A;  3EUH A;  4M6Y A;  5E8I A;  4HX7 A;  1KU7 A;  3LFK A;  3SZP A;  3WTX C;  3GXO A;  1FT9 A;  1ZN2 A;  4OIP F;  3IRQ A;  1C0W A;  2HYF A;  5D5W B;  1LDK B;  3JTH A;  4OMZ A;  2A69 F;  2PMU A;  1D8K A;  2QVO A;  2X0L A;  1IW7 F;  3RDI A;  2QEN A;  1OMI A;  2YX7 A;  1BIA A;  2TDX A;  5HOO A;  3PQK A;  4A2U A;  4MNU A;  1W7P A;  1O3T A;  5DCM B;  1UHW A;  1BM9 A;  2A07 F;  3L00 A;  2IPQ X;  2RN7 A;  1DPU A;  4BYY A;  3U9G A;  3KP5 A;  1U3E M;  4XSZ F;  3VFZ A;  4KIB A;  3KCC A;  4HBL A;  4I2O A;  4AVP A;  1R5H A; 
#chains in the Genus database with same CATH topology
 3S3M A;  3WU1 B;  5LBQ A;  3K2A A;  3HEF A;  3FM5 A;  1PP8 F;  5JVG F;  2VKE A;  5H2F C;  2X9D A;  3GLX A;  4IRG A;  1XGN A;  3A03 A;  4DGW B;  4ITV A;  3OR1 C;  2QBY A;  4M71 A;  1I1S A;  3F23 A;  5J1Y A;  4HF2 A;  1NK2 P;  5J3L A;  4BQA A;  4IZZ A;  2L02 A;  3CP2 A;  3H9J A;  2AQE A;  4E7I A;  2VL8 A;  2K5C A;  3FDY A;  2KRH A;  4F55 A;  1MSE C;  2DA2 A;  3CQZ J;  2R0Q C;  3J81 Z;  1TWA J;  3MAJ A;  1JUP A;  2ZXI A;  4GXO A;  2P7V B;  3V42 A;  4F52 A;  4CZC A;  5L3E A;  4A12 A;  1MNE A;  1VQM I;  5GAG J;  1WVR A;  1P4A A;  4M73 A;  1FSE A;  4RGU A;  5K5O A;  5KNL A;  5F64 A;  2DPU A;  3MWM A;  4DJA A;  2O0Y A;  3DF8 A;  1RIO H;  3LL7 A;  4XLH A;  4E6K G;  4MFE A;  4U0W A;  2RVC A;  2MGQ A;  3DP7 A;  4BUP A;  1D1B A;  5JHU A;  2CQQ A;  4BH9 A;  1ON2 A;  3CO7 C;  2ZFU A;  5ILU A;  4AIK A;  4WXH A;  1RI7 A;  4J19 A;  2L9V A;  1FP1 D;  1G3T A;  4XRS G;  1TBX A;  4II3 A;  4HZF A;  4CYD A;  4XOT A;  4HPQ A;  2OZU A;  4KN4 X;  4LOC A;  5D8K B;  2L0K A;  4RB3 C;  2TCT A;  3FXR A;  4XNF A;  3S32 A;  4BY7 J;  3OWT A;  2R7R A;  4KA4 A;  1P9Q C;  4Y3O A;  2CUZ A;  2EIM H;  2DA5 A;  1SAX A;  5LHH A;  1G8X A;  2CS3 A;  2VBZ A;  2YUS A;  4KIF A;  3O3K A;  1V54 H;  4FET A;  4BBR J;  4KFC A;  4QPO A;  4AYB A;  1G3Y A;  1ONV A;  2X4H A;  4WX9 A;  3I53 A;  2W24 A;  4Y17 A;  3KX2 A;  3VOD A;  3F8N A;  5J4V A;  4NQW B;  1RKW A;  2IW5 A;  4ESB A;  1LUJ B;  3K4M A;  2P4W A;  3K0L A;  2A61 A;  3FKJ A;  3KLN A;  4NB5 A;  4RMN A;  4DYR A;  2IA1 A;  3O6B B;  5F1J A;  3OIQ A;  1BI1 A;  2LKP A;  1W7P D;  2A5W A;  2DMQ A;  4A5N A;  3JRE A;  3NQO A;  2ETH A;  3WE2 A;  5IT9 Z;  4ZTJ A;  3OS1 A;  1MMA A;  2L7F P;  1D0Z A;  5J40 A;  3OYD A;  4BDY A;  5CVI A;  1FX7 A;  2BHZ A;  1U0J A;  2MW8 A;  1G6N A;  2NOJ B;  3MZ8 A;  2JA7 J;  3RPQ A;  4BY1 J;  2P81 A;  3OYM A;  1R1U A;  4OOI A;  1GV5 A;  2GBY A;  4X6A J;  4HLY A;  1Z67 A;  4YII A;  3VYS B;  2BY1 A;  3BP8 A;  4CO8 A;  3RZD J;  3HL2 A;  4HDU A;  2FXA A;  4A3C J;  1Z7L A;  1A04 A;  2BW3 A;  1YTY A;  1P6R A;  5F0C A;  3TL4 X;  4HF1 A;  2R7V A;  2EBI A;  5GAE J;  5FD6 A;  2AXT C;  3BTJ A;  2ZXJ A;  2ELH A;  3KZZ A;  1QPM A;  1WJC A;  3QPH A;  1SFK A;  2HS5 A;  1T56 A;  3ML6 A;  3IKT A;  1HDP A;  1LDD A;  4ZYD A;  1X1P A;  2QGU A;  4XL9 A;  4LMY A;  1MIJ A;  2STT A;  1T38 A;  2Y0S A;  4KIG A;  3WG9 A;  3E1S A;  2JJ7 A;  5C3E J;  5E1W A;  2DAO A;  2EQR A;  1A31 A;  4ENN A;  1IRX A;  5BMZ A;  2W4S A;  3GTK J;  3GBG A;  3QWL A;  3K6G A;  5FLV A;  3IH2 A;  5IYB J;  2COM A;  5DCF A;  2OCC H;  3ASN H;  3BJO A;  3KFW X;  3MKZ A;  2CV1 A;  4PJN A;  4S0H B;  3CC7 I;  3E5X A;  3TW6 A;  5FKK A;  1BR4 A;  1FOY A;  2WTE A;  5CKT A;  2HTJ A;  1UEL B;  3OL4 A;  2FUG 2;  3QPT A;  4XRM A;  4PJL A;  2NS0 A;  1KYZ A;  2DMU A;  3V8L A;  4BAC A;  4U0V A;  2E2I J;  2NS7 A;  3I3L A;  4G6D A;  3HG9 A;  3S1M J;  2P8T A;  3OSF A;  2H6C A;  1MDM A;  3J7A O;  2LFB A;  1TP4 A;  3E97 A;  2AXL A;  2UV1 A;  1JXS A;  1APL C;  1B72 B;  1Y39 A;  2CW7 A;  1RC9 A;  1TQI A;  3QOE A;  1JGG A;  4IL6 C;  3FHZ A;  5GTH C;  1OJL A;  4ZYH A;  1TQP A;  3MQ0 A;  4KMU X;  3S1R J;  2JA6 J;  1WGX A;  3CCJ I;  2ZC2 A;  2OD5 A;  3VOE A;  1JE8 A;  4G7O F;  4KUM A;  3WTV C;  4FTH A;  4ZYE A;  2PN6 A;  3ZMD A;  5AIP A;  2XB0 X;  1G3S A;  2ME0 A;  2DTR A;  1G3W A;  4EJO A;  3FZV A;  2K27 A;  3R0J A;  4A3E J;  2C6Y A;  1MGT A;  5E20 A;  4N0B A;  1QRY A;  5J1U A;  1S72 I;  3KP6 A;  4E7J A;  4M3F A;  2O6G E;  3A02 A;  4YEJ A;  3H0D A;  2VB6 A;  4E4H A;  1UCR A;  3C18 A;  4BAY A;  1TC3 C;  1EJ9 A;  1BW6 A;  1HW2 A;  2DDA A;  4UB8 C;  4RB0 A;  4FCY A;  1XB4 A;  1FIP A;  1PJR A;  3IUO A;  3KYD B;  3ROU A;  2XRO A;  2F48 A;  4I98 B;  2DOA A;  3E7L A;  3TDU C;  2FX0 A;  3H5R A;  2OTL I;  3SDG A;  4ZZD A;  3C3W A;  3BCB A;  4I0A A;  3IC7 A;  4HQE A;  1W36 C;  3RKQ A;  1FJL A;  3BJ6 A;  2A6E F;  3HOX J;  2Y30 A;  2P6T A;  1P4X A;  4G9Y A;  1BBY A;  3S2W A;  5H20 A;  4IOA F;  1WHU A;  2NVT J;  4P9F A;  4HSR A;  2HQ5 A;  4D0P A;  3W6J B;  1K7A A;  1XGO A;  1RR7 A;  2NYX A;  2Q2E B;  2V6C A;  4CXF A;  5HLI A;  3M4O J;  2GXG A;  2JPB A;  3CMM A;  1X3W B;  1UG2 A;  3W2W A;  2ID3 A;  1I1G A;  5IP7 J;  2E2J J;  1IZ1 A;  4IHS A;  3IL2 A;  1BN5 A;  2YS9 A;  1IUF A;  1D3Y A;  3S3N A;  2L54 A;  4YEL A;  3K4C A;  4I02 A;  1WI3 A;  3JRA A;  2WC2 A;  2V1N A;  3I56 I;  1ZEL A;  3TW7 A;  3GTJ J;  5EEG A;  5DCM A;  2FQ4 A;  4HNU A;  1OCR H;  1EH7 A;  1KU2 A;  2XAJ A;  2LH9 A;  3FXJ A;  1YYV A;  3LSI A;  4XLP F;  1RRJ A;  1U5T B;  3D5S C;  1AA7 A;  1TT5 B;  4F7Z A;  3F21 A;  2ESH A;  2OV7 A;  4RGX A;  1JHH A;  4M9S A;  1IN6 A;  2D1V A;  3H92 A;  5JLX A;  5FKO A;  1ITY A;  3ELK A;  1OCZ H;  3H5N A;  4GRI A;  2NRA C;  3T5X A;  1LJ9 A;  2R7U A;  1JUM A;  3W6K B;  4F3Q A;  1OR7 C;  2L9N A;  3I64 A;  4ESJ A;  4IHT A;  1DUX C;  3FHN A;  2JRT A;  1TTY A;  2HWV A;  4CCJ A;  1U78 A;  2M7B A;  1YOV B;  2L01 A;  4KT5 C;  4EEF G;  2QQ8 A;  3LQQ A;  2PMZ A;  5KVR A;  2WAD A;  4IX7 A;  5C4X J;  2DFH A;  2EA2 A;  4A93 J;  1R5I D;  4CIC A;  3LSR A;  4OU0 A;  5E79 C;  5GTI C;  5C44 J;  2WAQ N;  2VOD A;  3WTY C;  5EG0 B;  2QLZ A;  4JYK A;  2Z1D A;  3CCV I;  1OPC A;  3QRF F;  4RB1 A;  4AIH A;  5L3B A;  1FBU A;  6PAX A;  3PJR A;  2QCO A;  3BPV A;  3P9K A;  3JRI A;  3HHG A;  1RUN A;  1K78 B;  1IRZ A;  5EDN A;  2VIX A;  4DQ2 A;  5F6F A;  1IXR C;  1T08 B;  5BPI A;  3TP0 A;  2BY3 A;  2VC0 A;  1YX3 A;  2GIZ A;  2KQR A;  2JA2 A;  3HKZ A;  5GPC A;  3U2R A;  3M07 A;  5TIS C;  4Q48 A;  3QU3 A;  5HNF A;  3QQA A;  3ZMV A;  2L9R A;  4AC0 A;  3CME I;  4HRI A;  1FP2 A;  5E3O A;  1XX5 A;  3OV8 A;  2F5V A;  5K7F A;  1ZGA A;  4MQ9 F;  2JVG A;  4QWQ A;  2ZJR F;  1J75 A;  2PLY A;  3WGI A;  2ZNY A;  4UUS B;  3K4J A;  2E7X A;  3PFY A;  4XLF A;  1U9O A;  3GTQ J;  4HV5 A;  5GAH J;  1XSV A;  3REO A;  2LY9 A;  5EZH A;  3OYN A;  1J09 A;  4D9J A;  2FOK A;  3H3V K;  3MKY B;  2ISZ A;  1VTN C;  1Z1D A;  5JVT A;  5IOY A;  4AM3 A;  3MMY B;  4NQW A;  3AKZ A;  3NAR A;  2JSC A;  3DKW A;  2LKX A;  2VLA A;  2DOF A;  3CTA A;  4PSW A;  2JMW A;  2M3A A;  3ZN0 A;  4EGZ A;  5L3G A;  2XF5 A;  3M8F A;  5IT9 K;  2XHK A;  2B9S A;  3TO7 A;  3EQL F;  5K5R A;  2PBI A;  2AHQ A;  3FX3 A;  5FRN A;  2MC4 A;  2RRE A;  1R36 A;  2DA1 A;  2VBW A;  2VBX A;  5FLM J;  1SVM A;  2R7W A;  2UXN A;  3GUD A;  1XDU A;  3PIO F;  1J59 A;  1HQC A;  4XKC A;  3V7S A;  2DPD A;  4HNV A;  4XRS A;  1XCB A;  3JRF A;  1T33 A;  2DOD A;  2NAZ A;  5HNH A;  1NH3 A;  2HOT A;  2V1U A;  2F4O B;  2KJB A;  3HRT A;  1QBJ A;  3ZQ7 A;  2LR8 A;  3HSF A;  1EH8 A;  1P4W A;  2FF4 A;  2YU3 A;  3P7N A;  3I58 A;  2RNG A;  3CUQ C;  3M1C A;  2EJR A;  2K9Q A;  2KZV A;  2CJJ A;  3I59 B;  5FKM A;  1KU3 A;  1SFE A;  3CJT B;  2QKM B;  1W1W E;  2VUM J;  2VC1 A;  4MQV A;  3S1Q J;  1T8I A;  2R7T A;  3J7A Y;  2F4M B;  3DKY A;  1IV8 A;  3DV8 A;  1W5T A;  4RGR A;  1S7O A;  3TQN A;  1ZRF A;  4JOM A;  1I50 J;  1UFM A;  5B1B H;  3ULQ B;  4ZH4 F;  4XKV A;  2XVC A;  2R5Z A;  1WZ2 A;  5TRD A;  3IH4 A;  1QNT A;  3H5A A;  2OBP A;  2PQ8 A;  2E60 A;  1HLV A;  2VJ4 A;  1ZQ3 P;  2QA4 I;  2PFB A;  2H8R A;  3A2K A;  3NWT A;  1F5T A;  2FBH A;  3VPR A;  1FSH A;  2IAI A;  3JRC A;  1AHD P;  2FNA A;  1FOW A;  1RKT A;  3N4M A;  1IGN A;  4Y52 J;  1ETW A;  3IWZ A;  2G7H A;  1T6S A;  2MC3 A;  2X85 A;  3HPG A;  3HB9 A;  3ZN1 A;  4DOZ A;  4LG0 B;  1NHA A;  4V19 K;  2JT1 A;  3GLL A;  1QVT A;  1EV7 A;  1O4X A;  5IP6 A;  4A0Z A;  3CMA I;  3S16 J;  5FGM A;  5BQT A;  4RLF A;  2X1E A;  1QZY A;  1R23 A;  1ZH5 A;  2ESN A;  2ZJ2 A;  4C3J J;  1JTX A;  3Q5F A;  2VPR A;  2GZW A;  2W1O A;  1DQU A;  3EDP A;  1D1A A;  2V9P A;  3VYU B;  1R6R A;  4B1R A;  4EJT A;  3CUQ B;  4B8X A;  4ETS A;  3LNQ A;  4B47 A;  1MSF C;  1V5F A;  3N97 A;  1VQ4 I;  2QQB A;  3Q9V A;  1RET A;  4MLO A;  2DJN A;  2MYS A;  1JT0 A;  1B4A A;  1UZC A;  2XUB A;  4BXU A;  4L5I A;  2V1D A;  4KIT B;  3K70 D;  1F1Z A;  4YFK F;  2KDO A;  2CQK A;  4IHY A;  5DEQ A;  3I4N J;  4Y33 A;  1FBQ A;  1VI0 A;  4OWR B;  4BJT A;  3OYC A;  3E6C C;  1I3A A;  3E6D A;  2NVQ J;  3GTL J;  3HZJ A;  1FYK A;  2M4K A;  1Y56 A;  2GOM A;  2E19 A;  2M7A A;  2KIQ A;  4P55 A;  3BR2 A;  4BHB A;  3J7Y J;  2FJ1 A;  4HX4 A;  1IUY A;  3KP3 A;  3DTI A;  3F0C A;  2QSF X;  2W57 A;  3E6M A;  1SC7 A;  1D5Y A;  3VB2 A;  3WTU C;  1K83 J;  2ECB A;  2RAE A;  4NNJ A;  2R93 J;  3KZY A;  4HOB A;  2R3S A;  1MD0 A;  3T0Y A;  4A69 C;  5GPA A;  1HST A;  1P7I A;  4FIS A;  1QU3 A;  1F43 A;  3PIP F;  3PSF A;  1Y0N A;  2ELJ A;  2K7L A;  4P1W A;  4AIJ A;  1U8R A;  4B44 A;  5FRO A;  3AL0 C;  4RM2 A;  4BL0 B;  4E7Z A;  2IXS A;  1ULY A;  2MLG A;  5B5E C;  1Y0U A;  3FXQ A;  1VQ8 I;  1X4P A;  3IRR A;  3AG2 H;  3ZQI A;  3WTS C;  1ZAR A;  4XM3 A;  1K79 A;  1MMG A;  1SVO A;  2P5L C;  2V1X A;  3BG7 A;  3J80 Z;  1BJA A;  3H36 A;  3GTO J;  2HU9 A;  1ZRD A;  4DYC A;  3J7Z I;  2ZFW A;  2H6B A;  1OCT C;  1S9H A;  2MD5 A;  3JTG A;  1Q1H A;  5FD5 A;  3AAF A;  1DGW Y;  2XAQ A;  4EM0 B;  3FXU A;  1WJB A;  4L9V A;  1YS7 A;  1J2X A;  1WI9 A;  5DDG A;  2GWR A;  3H1C A;  2ME6 A;  4ESF A;  3IAM 2;  1WPK A;  3ONQ A;  2ISY A;  2ZBK A;  3HPH A;  1X19 A;  5DTD A;  3WTZ A;  2DN0 A;  1XN7 A;  5D8L B;  4UUT A;  1FZP B;  2R7D A;  2DMT A;  2W85 A;  1KON A;  2KMU A;  3CDL A;  3R4K A;  3AG3 H;  5DM7 F;  3PUF A;  4A3M J;  2CQX A;  1KYW A;  4RBO A;  3P5J A;  2DQL A;  4HAM A;  4ENM A;  4AD9 A;  4N9H A;  3T1B A;  3A01 B;  4B09 A;  5LHG A;  2XAG A;  3PSI A;  2WA0 A;  3MKL A;  4OIN F;  5K5Q A;  2PEX A;  1XGS A;  3HOV J;  2IS2 A;  4BHC A;  1ZLK A;  3BR3 A;  3G73 A;  1U5T A;  2DT7 B;  2JUG A;  1FIA A;  3M7G A;  4ZZL A;  2R92 J;  2CH0 A;  2HGC A;  3AL0 B;  5D6E A;  1H8A C;  3S17 J;  5JHF A;  4ENK A;  3HIF A;  2J5P A;  4IRH A;  2EA4 A;  3BR6 A;  4KDP A;  3WU0 A;  2UZK A;  4CSW A;  1U6G A;  3WGG A;  4WWC A;  1POG A;  3HUG B;  4UY8 I;  1R1T A;  1YIO A;  2DLL A;  2X48 A;  3CP8 A;  2QUF A;  2O03 A;  1ETK A;  4N9I A;  2ZJQ F;  1GUU A;  4LFU A;  4JQF A;  3LAP A;  1VQ7 I;  2E1C A;  5J4Y A;  3W2A A;  1E3O C;  1WKM A;  2BXY A;  3V8J A;  2D45 A;  4ZJZ A;  4DBQ A;  4FQG A;  5KAI C;  2E1N A;  3ABK H;  5IOZ A;  3QYF A;  4XIC A;  1O7L A;  3T8T A;  5JFR A;  1LFP A;  3LOC A;  4EJV A;  1ETY A;  1W5S A;  1ZTR A;  2VJI A;  4D1Q A;  1FYM A;  3Q0U A;  2E5N A;  4M3E A;  4K2E A;  1WQ2 A;  3OYB A;  5EG0 A;  2XAS A;  5LLQ A;  3MKW B;  1BR2 A;  1JKR C;  4PFO A;  5C4J J;  2VKD A;  4S05 A;  1K78 A;  5EJC A;  2M4G A;  4RA2 A;  4GYG A;  2A68 F;  3BOQ A;  4KIS A;  1JTY A;  4YFN F;  5F1R A;  2GM4 A;  3IAS 2;  3PM1 A;  1O3S A;  2MH2 A;  1T39 A;  2NVY J;  1J5Y A;  2VAS A;  4A3L J;  2Z5U A;  2KJC A;  5DUI A;  4RAY A;  1JUS A;  1Z3Y A;  1BI2 A;  3D5L A;  1JI8 A;  2Y48 A;  2BHY A;  4J00 A;  2HPM A;  3E5U A;  4XBF A;  4Q4Z F;  5TJJ A;  2F2E A;  3ERE D;  1OKR A;  4S04 A;  4QPQ A;  3TKY A;  4UUS A;  3JSO A;  3OIP A;  1ZLJ A;  2LC2 A;  5DYM A;  2M30 A;  5A2Q K;  1DU0 A;  4U0Y A;  1E3H A;  1TWG J;  2JA5 J;  2KLO A;  1N77 A;  2JN6 A;  1O7F A;  1IV6 A;  5E17 F;  1O3R A;  1RNL A;  1TNS A;  5J8C A;  1ZR4 A;  3H3Z A;  3OYJ A;  3DKX A;  3LSH A;  3HOU J;  1MBE A;  1YRN B;  3JCU C;  5HLG A;  2LK2 A;  4WXD A;  3EPZ A;  1FTZ A;  2DTZ A;  5D5V B;  2PG4 A;  3GX4 X;  2ICW G;  1ZYR F;  2IA2 A;  2EFW A;  1QZE A;  5E1X A;  3LMM A;  1UG0 A;  4B3X A;  4IRI A;  2YSR A;  2H1K A;  3SQN A;  1IN8 A;  2ZKZ A;  3AG1 H;  4JX6 A;  4MHG A;  4Z2Y A;  3TDZ C;  3C2G A;  2ZCW A;  4B4C A;  1CF7 A;  2KKO A;  5JR3 A;  2FEZ A;  3ZOB A;  4O6J A;  1IG7 A;  4LG3 A;  3OR2 C;  3SZT A;  4XQF A;  3I59 A;  1LQ1 A;  3BTC A;  1USS A;  3DBL B;  2O5R A;  3F3X A;  4I0B A;  3AG4 H;  4OAZ A;  2WY8 Q;  2MH9 A;  2K3P A;  1BL0 A;  3K4K A;  4XOR A;  3ZQC A;  4EJU A;  4M9Z A;  3F8C A;  1SD5 A;  5L3C A;  3JAM Z;  3HSE A;  4G6T B;  4EMS A;  4FAS D;  2WBM A;  3RCO A;  2CG4 A;  4Y4R A;  3CDH A;  1R7J A;  4XN0 A;  1A6I A;  1R58 A;  4BKX A;  4AYB N;  1S3J A;  2ZJP F;  1HW5 A;  1RZ4 A;  2CUJ A;  1ZG1 A;  2EV0 A;  1MBJ A;  2LF8 A;  2JRM A;  3ASO H;  1EH6 A;  2BXZ A;  3K10 A;  3V8K A;  3G71 I;  1YX5 A;  3Q0V A;  5E8G A;  4BGD A;  3L2V A;  3M3Y J;  5ILS A;  3SDB A;  4C2T A;  4LG0 A;  3CD6 I;  3LQR A;  5E3M A;  2UXX A;  3RIR A;  2GA1 A;  3U21 A;  1HCR A;  3TMO A;  4L0Y B;  1X3U A;  4LK1 F;  2LTP A;  4BNC A;  1S7E A;  2VKV A;  2OAZ A;  1K6O A;  3BTI A;  1N78 A;  4L9T A;  4F92 B;  3F6V A;  1X58 A;  3S8P A;  2KP6 A;  1E2X A;  1MH4 A;  1IC8 A;  4LD5 A;  2E36 A;  9ANT A;  1GVJ A;  1WJA A;  4BDZ A;  3CUQ A;  2A3S A;  2LF7 A;  3ABU A;  1P2F A;  2L7K A;  2WAF A;  1J7K A;  3OYH A;  3BDD A;  2BYV E;  3HGG A;  4OIO F;  3UNG C;  2I8D A;  3DPU A;  1OYW A;  3OIO A;  3WE3 A;  3E5Q A;  4F93 B;  4A0X A;  3KP4 A;  4MIM A;  2X6Y A;  3WU2 C;  2ZSH B;  1GLN A;  4N4O B;  5CVU A;  4FE7 A;  3DCF A;  2LDU A;  4PUS A;  1BIB A;  3KYC B;  3BC8 A;  3L9F A;  3FBN B;  4ZC3 A;  2Y0S N;  4M74 A;  1YW7 A;  4HW0 A;  3DXJ F;  3BG3 A;  2CV0 A;  3ZMS A;  1UST A;  2OQR A;  3EYY A;  3OYE A;  3OS0 A;  4BEH B;  2DA7 A;  4P96 A;  4AWX B;  2E1O A;  3CCE I;  2P0W A;  4W1U A;  4PFP A;  4AUX A;  1ENH A;  2W48 A;  3PQJ A;  5H6R A;  5ED4 A;  2M9H A;  3CC4 I;  2VQL A;  5D5X B;  4HNT A;  2Y9Y A;  3G1M A;  2HVQ A;  4O5V A;  1CGP A;  2Y0M A;  4RLQ A;  4TV7 A;  5LEK A;  1GXP A;  4QSH A;  4O3M A;  3JRD A;  1JJ8 C;  4H4K C;  5ICG A;  4NDL A;  3WTW C;  4JX5 A;  2WV0 A;  4UV8 A;  4C2M J;  3GFJ A;  1WFX A;  1I6H J;  1TWH J;  3DPT A;  5ICC A;  3CCS I;  3F22 A;  2Q1Z B;  2QKL B;  2GLO A;  4XLN F;  1HC8 A;  3U1K A;  2OZ6 A;  1D0X A;  4M3G A;  4ZYA A;  2M45 A;  3E0J B;  2BVM A;  2UUZ A;  5FFZ A;  1HW1 A;  1WH7 A;  1ETO A;  2DU9 A;  2EWN A;  5GP9 A;  3H0G J;  2EIL H;  1BR1 A;  3QU6 A;  4ABZ A;  1A36 A;  1WH5 A;  3SFZ A;  4WF2 A;  2GXA A;  2RQP A;  5HS7 A;  2YX4 A;  2OQG A;  2R7S A;  2L4M A;  2F6C A;  2LNB A;  1GXQ A;  3KYL A;  4L9J A;  2ECC A;  3I5U A;  3OYL A;  2FML A;  2HXI A;  1SVL A;  2M0M A;  3BR1 A;  3GZ6 A;  1LNW A;  4ASN A;  4C9Y A;  4IHX A;  2A6H F;  4RGS A;  2EH3 A;  2LRD A;  5H6Q A;  5D4S A;  3W2V A;  1YI2 I;  3A01 A;  3IP4 B;  5DM6 F;  4XRF A;  3I0T A;  3I54 A;  3S14 J;  4HST A;  3PNT A;  3F72 A;  3OOU A;  2EFO A;  1MJB A;  3I4P A;  4V2G A;  2ZB9 A;  5K1Y A;  1YO5 C;  3COA C;  2RNJ A;  2K40 A;  3J81 K;  3HJE A;  3ECO A;  3CF2 A;  1IN7 A;  3HUG A;  4D5F A;  5LFA A;  4LLG F;  3GTG J;  4XON A;  3CJN A;  2YR2 A;  3K4B A;  4I01 A;  4KN7 X;  1ON1 A;  4XK4 A;  5E3N A;  1FC3 A;  3PO2 J;  3VYR B;  2IRF G;  1ERD A;  2R5Y B;  3GW2 A;  2VI6 A;  3QP5 A;  2M2E A;  3KET A;  1SD6 A;  4PZJ A;  3K1M A;  1EF4 A;  2CW0 F;  3CC2 I;  3TP3 A;  1S5L C;  3EUA A;  4DZJ A;  4D5C A;  2IA0 A;  1MKM A;  2XAU A;  2BVL A;  2ZO4 A;  4XOP A;  1V5G A;  1Y8R B;  3HC7 A;  2P6S A;  4M6X A;  4HV6 A;  2O8X A;  4I76 A;  4PGH A;  4UB6 C;  4CZZ A;  2AO9 A;  2VT3 A;  3OMY A;  2D1H A;  4R1H A;  1KU9 A;  2MSY A;  3RQ4 A;  1X2N A;  1G2H A;  3B02 A;  1MNM C;  1LDJ A;  4BQO A;  4NHJ A;  2QQ9 A;  4ANJ A;  2E1M C;  2L5Q A;  3LA2 A;  5DV5 A;  4M6V A;  4NC6 A;  2WB1 A;  1SD7 A;  3Q0W A;  2HR3 A;  4FT8 A;  2DT6 A;  1KQ0 A;  4G8X A;  1SEU A;  1V3F A;  3OYA A;  4HEA 2;  3A4C A;  1Q1V A;  2VXZ A;  4DBR A;  3BRO A;  3TOB A;  5BS6 A;  5HLH A;  2VQH A;  1U2W A;  4IKF A;  2Y75 A;  4GDF A;  2HQR A;  4HDV A;  4JP0 A;  5EYR A;  4BBS J;  1LFB A;  2EFN A;  3QPS A;  1ZG3 A;  4FHT A;  2KIF A;  4HQM A;  3M8J A;  4CHU A;  1KQ8 A;  2K9S A;  4FE4 A;  5HDG A;  2XDV A;  2DBB A;  3H9G A;  2EFQ A;  4A3J J;  5CQE A;  4OIR F;  4HX8 A;  4XID A;  1MJA A;  2DMP A;  3MCZ A;  4BE1 A;  3JR9 A;  5J8F A;  4BXX J;  1E17 A;  1IRF A;  1OFC X;  3LA7 A;  3KPH A;  1V4R A;  2AQF A;  2L7Z A;  2IS6 A;  4Y15 A;  4UVB A;  2M87 A;  2PMZ N;  4G7Z F;  1QHH D;  2LVS A;  4B43 A;  5AON A;  4U7D A;  2QEX I;  4Q5S F;  2EPF A;  1YRN A;  3GWZ A;  3WHC A;  2LBF B;  3ESW B;  1WJF A;  2IP2 A;  3Q3S A;  5CYV A;  2HQN A;  1XMK A;  1A5J A;  2K4J A;  3RPU A;  1FOX A;  2OJE D;  3PNY A;  4G6Q A;  1RUO A;  2E1M B;  5E3L A;  1I3Q J;  1E0E A;  2DI3 A;  5CVJ A;  3ZXS A;  4R79 A;  3L2R A;  1XDS A;  1X3Z B;  5EGO B;  2LSO A;  4YG2 F;  3FXK A;  3KEY A;  4R8H A;  4I09 A;  3BLY A;  3M9A A;  3HRS A;  2Z9O A;  4XN3 A;  3PFI A;  5B66 C;  1QHG A;  3HKZ N;  2V7F A;  1JKO C;  1E3P A;  3MN2 A;  1OIS A;  1STZ A;  1K4S A;  1SMT A;  4X0G A;  1JKQ C;  2D5V A;  2EB7 A;  1O3Q A;  2DDB A;  1A35 A;  4WCG A;  1MW7 A;  2ZME C;  1YE9 A;  4LK0 F;  3DEE A;  3GFM A;  3CLO A;  3CCM I;  1GDT A;  1H9G A;  4E7S A;  2HOE A;  2O3F A;  4CA0 A;  3HOY J;  1YFH A;  1R1V A;  1R5G A;  5IYD J;  1MBF A;  1U8B A;  3W6V A;  3A0B C;  1KQ9 A;  1BOB A;  4EVI A;  4IO9 F;  2MBF A;  4EGY A;  1R00 A;  3RKY A;  2CWE A;  2FBI A;  2IBD A;  3JRH A;  1YIJ I;  2XSJ C;  3S1N J;  1TLH B;  2HVS A;  2GA2 A;  3I71 A;  4BU2 A;  3HSR A;  1VQL I;  1YW9 A;  2EK5 A;  1G4D A;  3QOP A;  4CDG A;  5IYC J;  5KCM A;  1YJ9 I;  3LFU A;  2CQN A;  1QGP A;  2VJ5 A;  3VDX A;  3BG6 A;  1BI3 A;  1G59 A;  1B72 A;  2P7C B;  1FYL A;  1TW2 A;  1N75 A;  1XMX A;  2DMN A;  2RV8 A;  2V79 A;  4LLN A;  2CFX A;  2X1D A;  1HA8 A;  4HG2 A;  3TGN A;  2XRN A;  1YQA A;  1D5V A;  2HOA A;  2KL4 A;  2EFP A;  1S8N A;  1W0T A;  1BOA A;  3N05 A;  1WRJ A;  2CFO A;  3GZ5 A;  2MG4 A;  3SHF A;  1OYY A;  3RYR A;  2Z33 A;  1AKH B;  1T0F C;  5LGU A;  2H8W A;  2JZY A;  3MVP A;  4XR6 A;  4A3B J;  2KIM A;  2MFZ A;  3R6S A;  2G0E A;  4YRV A;  3E3V A;  1FOK A;  2RGV A;  2E35 A;  3MZH A;  3FXL A;  3FXO A;  1MBK A;  2M8E A;  2VT2 A;  1T98 A;  3D1N I;  1B59 A;  2HEO A;  1B8I B;  3ZRG A;  4EAT A;  5HS9 A;  2ZME B;  4OIQ F;  5FFX A;  1TQM A;  3LSG A;  1UHM A;  1TW3 A;  3SZG A;  5D6F A;  4PDK A;  2XKO A;  4LLL A;  2KRC A;  4XLC A;  5KHD A;  1MBH A;  2KHM A;  4BEH A;  3K4N A;  1AWC A;  1IDY A;  4L0Z B;  3BPX A;  1PP7 U;  1ETV A;  2K9M A;  2GAU A;  3L09 A;  3PNV A;  1ZRE A;  3RPU D;  5FKN A;  1FNN A;  1FMW A;  2LY2 A;  3RKX A;  2GIV A;  2V6E A;  2QZ8 A;  5D4R A;  2CV2 A;  1IRG A;  3CZ6 A;  1XS9 A;  1ODD A;  4IF4 A;  5LRS A;  2W25 A;  3VEP A;  4A3F J;  2Z99 A;  4B3A A;  2EIN H;  4FX0 A;  1I39 A;  2FBK A;  1J0R A;  2Q2E A;  3GTM J;  3TOA A;  2Z16 A;  4P9U A;  1A6Q A;  3WHB A;  1AOY A;  2K9L A;  2B7E A;  3GO5 A;  1D8J A;  1NG6 A;  2V9V A;  2OTJ I;  5BPD A;  1R9T J;  2WAE A;  4XKW A;  3FIS A;  5M5X J;  2X6O A;  3SYT A;  2DCE A;  2Q0O A;  3IKV A;  3IHU A;  4NC8 A;  2VPL A;  2G9W A;  1L0O C;  4EM2 A;  2EV6 A;  3F9K A;  2Y31 A;  2L9S A;  3LST A;  2V26 A;  3CJQ B;  3S93 A;  2XRL A;  5EEA A;  2EZH A;  2KRF A;  3FKI J;  2IGM A;  4II2 A;  2VQG A;  1UAA A;  4X1E A;  2B63 J;  1LVK A;  3CJR B;  3LA3 A;  2XSD C;  2XB5 A;  3MFK A;  5EF6 A;  1S7A A;  4C2U A;  3RKW A;  2R7X A;  3H3U A;  1QQI A;  2QM3 A;  3BZ6 A;  1ZG5 A;  1H0M A;  4E7H A;  2HDD A;  3O2P E;  2KIS A;  5J1R A;  3RQI A;  2VE8 A;  1T2K A;  4CCN A;  1JT6 A;  3OSG A;  1Z3X A;  3B6A A;  4IJA A;  1PUF B;  5TGT A;  3R61 A;  5ICE A;  1REP C;  2CYY A;  2CW8 A;  2DYR H;  3K1P A;  3CES A;  3JRB A;  1Z9C A;  2X6W A;  1GVD A;  1O57 A;  2F4I A;  1KA8 A;  3FMS A;  2OCE A;  3VYT B;  1OCO H;  5LEJ A;  5LGT A;  1PDN C;  1SFU A;  3HOT A;  2NXN B;  3ERM A;  3K70 C;  2XPU A;  2VOP A;  3HHH A;  3CO6 C;  1ETX A;  1HOM A;  2ADU A;  1IO2 A;  3Q9S A;  3GFI A;  2IVM A;  4IQ4 A;  1Z21 A;  5CPR B;  3DWL E;  3HDD A;  5HDN A;  3AFH A;  1XCV A;  2M5W A;  5CVV A;  3F6O A;  1MMS A;  3ZCO A;  3K9T A;  1XSD A;  3KEQ A;  4A6D A;  3HTU A;  2O7O A;  4MO7 A;  5DD4 A;  2VBY A;  3MD2 A;  2X51 A;  3LSP A;  4IOC F;  2R5Y A;  5IT3 A;  1VQO I;  1HDD C;  2DFI A;  4RAF A;  2UWM A;  2IGN A;  1LFU P;  3BY6 A;  2DFF A;  3VSL A;  4UUV A;  1HBX G;  4EJW A;  3NRV A;  1IN5 A;  1SMY F;  3S3O A;  2MA3 A;  2H09 A;  1FTT A;  1TWF J;  2VKH A;  5FO5 A;  2EIJ H;  1ZR2 A;  2M1B A;  3FMQ A;  3K7A J;  1RPW A;  2NS8 A;  2X1C A;  4C3I J;  3OL3 A;  4XSX F;  3IH3 A;  5M3F J;  4RAG A;  3WG7 H;  1XMA A;  3C1D A;  4U88 A;  3FMR A;  2VJJ A;  5HLT A;  4GO1 A;  4XMY A;  4M72 A;  2HNH A;  4OMY A;  5ICF A;  4M3B A;  1LEB A;  2CUF A;  3KE2 A;  2L2O A;  1Y8Q B;  1L3L A;  2DA4 A;  1OR7 A;  4DIQ A;  2FE3 A;  4LB5 A;  1S29 A;  3MEX A;  1PUE E;  1VF9 A;  2HTS A;  3GEZ A;  3GZN B;  4CYC B;  1TL8 A;  2VXD A;  1YG2 A;  3L2U A;  1PYV A;  3BCA A;  3JSP A;  3RSN A;  3MZY A;  3WGH A;  2PX9 A;  3FIW A;  1KGS A;  4PK4 A;  1CQT A;  3GCM A;  4BJ6 C;  4YIR X;  2P5V A;  1BC7 C;  1VQ6 I;  1Z6T A;  1BW5 A;  3V7C A;  3DEU A;  3C7J A;  1B1B A;  4A3D J;  2HKX A;  3I9V 2;  3HM5 A;  2E34 A;  3UKG A;  2YPR A;  4IPA A;  3O8H A;  5B1A H;  3K2Z A;  4KIC A;  4XLE A;  5E18 F;  2MD0 A;  3LAJ A;  3BR5 A;  1VQP I;  4BQN A;  4EM1 A;  2QQA A;  4ZYG A;  1LE8 B;  4KYW A;  3EET A;  1UMQ A;  4CCK A;  3FWE A;  2BV6 A;  3GVA A;  3U1D A;  2AS5 F;  3JRG A;  1SFO J;  4MGR A;  4LIU A;  1FBS A;  2N8G A;  3HRM A;  1MZB A;  2XAH A;  1Z6R A;  4HF0 A;  2LBF A;  1UB9 A;  3ABT A;  3HOS A;  1BA5 A;  5JLW A;  2I5U A;  1T95 A;  1W36 D;  1X1C A;  1B9N A;  4UHT A;  5K7Z A;  2DA3 A;  4A3G J;  2DO7 A;  4UXN A;  1U9N A;  2OUM A;  5EGO A;  3CLQ A;  1Z77 A;  2JTV A;  2XC7 A;  2K02 A;  3KIO A;  3FXM A;  1R49 A;  2R5Z B;  2HZT A;  1K61 A;  1IXC A;  1LKX A;  3GF2 A;  2XKP A;  3C2B A;  4GCV A;  2R7O A;  3DBR B;  2DOE A;  4IQJ A;  4PJ0 C;  1ORK A;  4XKB A;  1MBG A;  3FF5 A;  1XSX A;  2CQ7 A;  3EUH C;  5DD8 A;  3SXY A;  3M8E A;  4BQQ A;  3OYG A;  1X1B A;  4LGW A;  3OYK A;  3ZQF A;  4NBQ A;  2EZI A;  2QF7 A;  4A3K J;  3A1Y A;  4N4N B;  1R71 A;  5F0H A;  2F5C A;  3DQV C;  1SAU A;  1HKQ A;  3LWF A;  2OA4 A;  2WY7 Q;  1H9T A;  2BE5 F;  4DYQ A;  1W4M A;  5ILV A;  2H1L A;  2Y69 H;  5M5Y J;  4MEX F;  2FQ3 A;  1FPQ A;  1RR8 C;  2CMP A;  2J5O A;  2M8G X;  5KAF C;  3B6C A;  4I99 C;  4XLA A;  2XF7 A;  3EUK L;  3TO9 A;  3ZPL A;  1F9N A;  5FLX Z;  1XGM A;  2BY2 A;  2NVX J;  4WXC A;  2PJP A;  1R22 A;  2K86 A;  3QP6 A;  1GV2 A;  4CGZ A;  2K3F A;  2XGD A;  3P9C A;  1TT0 A;  1X1A A;  2IJL A;  1FWZ A;  3RYP A;  4G12 A;  2KPM A;  2M34 A;  4W97 A;  2H27 A;  3BT9 A;  1EA3 A;  3DPL C;  5L3D A;  4D7M A;  2F5E A;  3V7R A;  4UV9 A;  1AKH A;  3QYB A;  4MTD A;  3QYE A;  2EZK A;  4LB6 B;  3ZMT A;  2MAB A;  5LD2 C;  2F5D A;  4PCQ A;  2GOX B;  3HBL A;  3CCY A;  2XV4 S;  1YIT I;  1W5C C;  2QWW A;  3PUB A;  4QLC U;  3DU6 A;  3ZR8 X;  5F04 A;  4L5J A;  4P5O A;  1B8I A;  2DYS H;  2ZME A;  4ZTF A;  3A0H C;  1Y1V J;  2JPC A;  1U5T C;  1I5Z A;  5HDK A;  1P92 A;  2HYG D;  3EYI A;  2CGP A;  5D5U B;  3GFL A;  1R4M B;  3SEQ A;  5LRR A;  1LB2 A;  1ZGW A;  1WSU A;  4Z6Y A;  5GAD J;  2Q8K A;  1IAW A;  1V55 H;  1VQN I;  1Y6I A;  2JWT A;  2ZNZ A;  2XPW A;  3GME A;  2RDP A;  2L4A A;  1F36 A;  2JK3 A;  2XAF A;  2KDZ A;  3CF5 F;  2VON A;  3P9I A;  5KK1 A;  1LPQ A;  2WAQ A;  3S2D J;  2HKO A;  2HDC A;  2HPI A;  3BJA A;  3J80 K;  3KLO A;  4A0Y A;  1MMN A;  2CUE A;  2L7M P;  2PMH A;  3G1L A;  4HYE A;  2ID6 A;  4CCM A;  2LKS A;  1DPR A;  1HXD A;  3LSJ A;  3QPL A;  3CCU I;  4IHV A;  1VQK I;  3D0S A;  2XGX A;  4C30 A;  4MTE A;  3G3Z A;  3NAU A;  3NEU A;  2IS1 A;  3DU5 A;  1W7P B;  3SEZ A;  5CQG A;  1HSJ A;  4G94 A;  5HS8 A;  1YJW I;  1FLI A;  4UVC A;  3CCR I;  3K1N A;  4EV0 A;  2R7Q A;  3QAH A;  2LRE A;  1YS6 A;  2GQQ A;  4JX4 A;  4BE2 A;  2LG4 A;  2STW A;  3ECH A;  2X6X A;  4UVA A;  3VWB A;  1P7J A;  4A5M A;  4FX4 A;  1T0F A;  2FOW A;  3S15 J;  2BZT A;  2WWY A;  4BJ5 C;  3WTT C;  2FU4 A;  5J6X A;  3R60 A;  4EQQ A;  3HYI A;  1H89 C;  2PJR B;  3H35 A;  1VQ9 I;  1MMD A;  3HOW J;  2G7U A;  2Z2S B;  1AU7 A;  5CJ9 A;  3ZQQ A;  2OC6 A;  3E6B A;  4M9X A;  2ELK A;  4WK8 F;  1QPI A;  2NNN A;  2R7F A;  4AVZ A;  4BHP A;  5BOX A;  2XIG A;  4IHW A;  5B3S H;  1GHC A;  4A6E A;  3IV5 A;  1KZH A;  3SJM A;  2QBY B;  3DLA A;  1IXS B;  4G7H F;  1BJZ A;  2RC4 A;  4I7H A;  1ETQ A;  3RZO J;  3VSK A;  2OU2 A;  1DP7 P;  2DK5 A;  3RI4 A;  2A5Y B;  2VN2 A;  5FB2 A;  1WJ5 A;  4Q47 A;  1PUF A;  1JHF A;  1TWC J;  4J01 A;  2KIU A;  4KNY A;  1VND A;  4NUB A;  1Y1W J;  1OQY A;  3BZK A;  3F8B A;  2K85 A;  4D7N A;  1V5E A;  4L9N A;  2BGC A;  2JSP A;  1XC5 A;  2M0C A;  5E1Z B;  1OYI A;  3DTK A;  2IS4 A;  4A3I J;  2B0L A;  2WV1 A;  4C3H J;  4YFX F;  1F4K A;  2I10 A;  1X1D A;  1ZAO A;  2COB A;  2VE9 A;  2O61 A;  1OCP A;  1HF0 A;  5LGN A;  1R4N B;  1EKE A;  3M1E A;  5FKL A;  4BE0 A;  3C2H A;  4I6Z A;  5CLS A;  3G4S I;  3S2H J;  3FM3 A;  2Y9Z A;  2BY0 A;  4U87 A;  5K7H A;  2NOG A;  4DW6 A;  4PJJ A;  4KMF A;  2CSO A;  3WOD F;  3ZMZ A;  1YLF A;  2ZSI B;  5F27 A;  5DS9 A;  2HXO A;  4ZDP A;  1Z05 A;  4ENJ A;  1ACI A;  2KZG A;  1WJD A;  4OAY A;  1MH3 A;  1IN4 A;  2PI0 A;  4H0E A;  1NG7 A;  2JA8 J;  3BG5 A;  2BBY A;  3OYF A;  3V4G A;  2A6T A;  2QYO A;  2LY1 A;  4CCL A;  3L2C A;  5IY5 H;  3ZMU A;  2E2H J;  3T8R A;  1WJE A;  4Y13 A;  3BQZ A;  1ZKG A;  2O9L A;  1LEA A;  2R7Z J;  2CRG A;  1S6L A;  1SFX A;  4LIT A;  1BI0 A;  5AIQ A;  3G1O A;  2F5F A;  4GGG A;  1GT0 C;  2DW4 A;  4MFD A;  4CYC A;  5CVR A;  3BQY A;  2E71 A;  3ZQG A;  5A2Q Z;  2E5Z A;  1QO0 D;  4IVN A;  2A05 A;  3DTE A;  3KP7 A;  3IWF A;  4QIW N;  1JGS A;  4IXA A;  3CCQ I;  2ZXH A;  4RS8 A;  1I27 A;  1IJW C;  5FJ8 J;  3L2W A;  1Z7U A;  3G6E I;  4ON0 A;  2NVU B;  4PGG A;  3BR0 A;  1XPX A;  2E7W A;  2OF7 A;  2XGE A;  3L2Q A;  5LHI A;  3ZP5 A;  2D2W A;  2FSW A;  1HKS A;  3ISP A;  2O8K A;  4BXF A;  4CCO A;  1NK3 P;  3HRU A;  1MND A;  3DLL F;  1LE8 A;  2BW3 B;  4E70 A;  1FY7 A;  2JQ7 A;  2BEO A;  2LOO A;  1TNT A;  4GFB A;  1I6X A;  3B73 A;  1DDN A;  2DT5 A;  5IP9 J;  4UNO A;  2FA5 A;  5M5W J;  2DK8 A;  1QVU A;  1CF7 B;  2DQR A;  2Z3Y A;  1RES A;  2K4B A;  1YHQ I;  1YJN I;  1JJ6 C;  2DJI A;  2XF6 A;  1B6A A;  2W00 A;  2HVR A;  3H9Q A;  2FMY A;  1XG1 A;  4JK1 X;  1ZK8 A;  3RTR A;  3TO6 A;  3CCL I;  2V4J C;  3KZI C;  3JW4 A;  2P5K A;  1IDZ A;  3KP2 A;  2OPT A;  2MLK A;  2HFH A;  5DUK A;  5J47 A;  5F0F A;  2WB1 N;  3JAM K;  3PO3 J;  3OS2 A;  3NWS A;  1XD7 A;  1ZHF A;  1IF1 A;  3K4L A;  3QOD A;  2FD5 A;  3KEO A;  2K9N A;  4LJZ F;  3ZQL A;  2W7N A;  3HTS B;  4RDU A;  3ABL H;  1Z0X A;  2EZL A;  2LLK A;  3CDI A;  3O8G A;  4QTR A;  2ACJ A;  4RAZ A;  1FEX A;  2HZD A;  1QZZ A;  1LVA A;  3F8M A;  2LYC A;  4AU7 A;  4NC7 A;  5JI6 A;  1SD4 A;  4HA8 A;  2L3D A;  1SAN A;  5IPA A;  3LSK A;  1ZGJ A;  4KT6 A;  2IT0 A;  1J9I A;  1MDM B;  5M3M J;  3BTL A;  1PVE A;  3DFG A;  2Y2Z A;  2JUC A;  3CUO A;  4RM3 A;  2IEK A;  5L3F A;  3RJP A;  5HVQ C;  3K69 A;  2YU9 J;  3TED A;  3L7W A;  1DGR M;  4HLX A;  2FRH A;  3PL8 A;  2RKH A;  1YW8 A;  1HKT A;  2CO5 A;  1W0U A;  3DBH B;  5FRM A;  2LMD A;  3I55 I;  3OOP A;  4DNC A;  5FLX K;  3GYH X;  3CMY A;  4BS9 A;  2NNY A;  5EEH A;  1D0Y A;  2GXB A;  2H94 A;  2W82 A;  1UHS A;  1NTC A;  4V2F A;  1Z91 A;  1ZRC A;  4LIV A;  3DEW A;  3HGY A;  4E7L A;  1B9M A;  1WWX A;  1N25 A;  3R0A A;  4GYI A;  5ERI A;  1D1C A;  2FNP A;  2ZXW H;  3BWG A;  2W84 A;  2TRT A;  1DU6 A;  4RB2 C;  4AID A;  1MJ9 A;  2IGO A;  2EV5 A;  2DXI A;  3ZQH A;  3F8F A;  4U7B A;  4MEY F;  4YIF A;  4L18 B;  3BG9 A;  4JBA A;  4L5E A;  5HOD A;  3FK6 A;  4E7K A;  1BC8 C;  2VOO A;  5F08 A;  3EUH A;  3HXL A;  3X2Q H;  2KFD A;  4M6Y A;  5E8I A;  3GTP J;  4HX7 A;  1FMV A;  1KU7 A;  2CU7 A;  2DFE A;  3LFK A;  1WCM J;  3SZP A;  2QSG X;  3WTX C;  3GXO A;  1FT9 A;  1ZN2 A;  4F91 B;  4OIP F;  3IRQ A;  2R4G A;  3ABM H;  1C0W A;  2HYF A;  2HOS A;  1VQ5 I;  2LP0 A;  5D5W B;  2XPV A;  3TBI A;  1LDK B;  3JTH A;  3SFI A;  4OMZ A;  2HYJ A;  3D5R C;  2DA6 A;  5BNG A;  2HI3 A;  1H88 C;  1UJ8 A;  4M3D A;  4DZP A;  2A69 F;  3W3C A;  4ZDO A;  4Y7N J;  3HOZ J;  2PMU A;  1QA6 A;  1D8K A;  2LD5 A;  2QVO A;  2X0L A;  1IW7 F;  1OLT A;  3I4M J;  3RDI A;  3OYI A;  1K4T A;  2QEN A;  1OMI A;  1K6Y A;  4B48 A;  2YX7 A;  4PSX A;  1OCC H;  3FBI B;  1BIA A;  2BOL A;  1XTA A;  2TDX A;  4KJZ A;  5HOO A;  3L1P A;  3PQK A;  4A2U A;  4MNU A;  1W7P A;  2EIK H;  1O3T A;  4CH7 A;  3LSM A;  2QSH X;  5DCM B;  1UHW A;  1BM9 A;  2HQA A;  2IGK A;  2A07 F;  2V9K A;  2KT0 A;  1X2M A;  3L00 A;  3ZGK A;  2IPQ X;  3OY9 A;  1X4O A;  2RN7 A;  2HDW A;  1DPU A;  1TZL A;  4BYY A;  3U9G A;  3KP5 A;  2JVH A;  4IEJ A;  1U3E M;  1JKP C;  4XSZ F;  3G2B A;  2XGC A;  1M1E B;  3VFZ A;  3BZC A;  3FK7 A;  4KIB A;  4PJM A;  3KCC A;  3UR3 C;  1DP3 A;  2PJR A;  4HBL A;  4I2O A;  4AVP A;  1R5H A;  5EZG A;  4ZDL A;  2VQC A;  1VZ0 A;  4CUG A;  2RQQ A;  1VFC A; 
#chains in the Genus database with same CATH homology
 3WU1 B;  5LBQ A;  1PP8 F;  3FM5 A;  3GLX A;  4IRG A;  1XGN A;  2QBY A;  4M71 A;  1I1S A;  3F23 A;  4HF2 A;  4BQA A;  2L02 A;  3J81 Z;  3MAJ A;  4GXO A;  4A12 A;  2P7V B;  5L3E A;  1P4A A;  4M73 A;  1FSE A;  4RGU A;  5K5O A;  5F64 A;  2DPU A;  3MWM A;  2O0Y A;  3DF8 A;  1RIO H;  4U0W A;  2RVC A;  3DP7 A;  5JHU A;  4BH9 A;  1ON2 A;  3CO7 C;  5ILU A;  4AIK A;  4WXH A;  1RI7 A;  1FP1 D;  1G3T A;  1TBX A;  4HZF A;  4CYD A;  2OZU A;  4KN4 X;  5D8K B;  4RB3 C;  3FXR A;  4KA4 A;  1SAX A;  5LHH A;  2VBZ A;  4KIF A;  3O3K A;  4KFC A;  1G3Y A;  1ONV A;  2X4H A;  4WX9 A;  3I53 A;  2W24 A;  4Y17 A;  3VOD A;  3F8N A;  2IW5 A;  4ESB A;  2P4W A;  3K0L A;  2A61 A;  3KLN A;  4NB5 A;  2IA1 A;  3O6B B;  1BI1 A;  1W7P D;  2LKP A;  4A5N A;  5IT9 Z;  3NQO A;  2ETH A;  3WE2 A;  5CVI A;  1FX7 A;  1G6N A;  3RPQ A;  1R1U A;  4OOI A;  4HLY A;  4YII A;  3BP8 A;  4CO8 A;  4HDU A;  2FXA A;  1A04 A;  1YTY A;  1P6R A;  4HF1 A;  5FD6 A;  2ZXJ A;  3KZZ A;  2ELH A;  1QPM A;  3QPH A;  2HS5 A;  3ML6 A;  3IKT A;  1LDD A;  4ZYD A;  4LMY A;  2STT A;  1T38 A;  4KIG A;  3WG9 A;  5E1W A;  2DAO A;  4ENN A;  5BMZ A;  2COM A;  5DCF A;  3BJO A;  3KFW X;  3E5X A;  2WTE A;  2HTJ A;  3QPT A;  2NS0 A;  1KYZ A;  3V8L A;  4U0V A;  4G6D A;  2P8T A;  2H6C A;  1MDM A;  3J7A O;  3E97 A;  2AXL A;  1JXS A;  1TQI A;  3FHZ A;  4ZYH A;  1TQP A;  3MQ0 A;  4KMU X;  4G7O F;  2OD5 A;  3VOE A;  1JE8 A;  4KUM A;  3WTV C;  4ZYE A;  2PN6 A;  3ZMD A;  5AIP A;  1G3S A;  2DTR A;  1G3W A;  4EJO A;  3FZV A;  2K27 A;  3R0J A;  2C6Y A;  1MGT A;  5E20 A;  4N0B A;  3KP6 A;  2O6G E;  1UCR A;  3C18 A;  4BAY A;  1HW2 A;  4RB0 A;  1XB4 A;  3ROU A;  2XRO A;  4I98 B;  3TDU C;  4ZZD A;  3C3W A;  4I0A A;  3IC7 A;  4HQE A;  3BJ6 A;  2A6E F;  2P6T A;  1P4X A;  4G9Y A;  1BBY A;  3S2W A;  5H20 A;  4P9F A;  4D0P A;  3W6J B;  1K7A A;  1XGO A;  2NYX A;  2V6C A;  4CXF A;  5HLI A;  2GXG A;  2JPB A;  1I1G A;  1IZ1 A;  4IHS A;  3IL2 A;  1BN5 A;  1D3Y A;  2L54 A;  4I02 A;  2WC2 A;  5EEG A;  5DCM A;  1EH7 A;  1KU2 A;  2XAJ A;  1YYV A;  4XLP F;  1U5T B;  4F7Z A;  3F21 A;  2ESH A;  4RGX A;  1JHH A;  4M9S A;  1IN6 A;  2D1V A;  3H92 A;  3ELK A;  2NRA C;  3T5X A;  1LJ9 A;  3W6K B;  3I64 A;  4ESJ A;  4IHT A;  1DUX C;  2JRT A;  1TTY A;  2HWV A;  1U78 A;  2L01 A;  4KT5 C;  3LQQ A;  5KVR A;  2EA2 A;  4CIC A;  4OU0 A;  2VOD A;  3WTY C;  2QLZ A;  1OPC A;  3QRF F;  4RB1 A;  4AIH A;  5L3B A;  1FBU A;  6PAX A;  3BPV A;  3P9K A;  3HHG A;  1RUN A;  1K78 B;  4DQ2 A;  5F6F A;  1IXR C;  5BPI A;  2VC0 A;  3U2R A;  4Q48 A;  3QU3 A;  3ZMV A;  1FP2 A;  3OV8 A;  1ZGA A;  4MQ9 F;  4QWQ A;  1J75 A;  2PLY A;  3WGI A;  2ZNY A;  2E7X A;  4HV5 A;  1XSV A;  3REO A;  2FOK A;  2ISZ A;  1VTN C;  1Z1D A;  5JVT A;  4NQW A;  2JSC A;  3DKW A;  3CTA A;  3ZN0 A;  4EGZ A;  5L3G A;  3M8F A;  5IT9 K;  2XHK A;  3TO7 A;  3EQL F;  5K5R A;  2PBI A;  3FX3 A;  1R36 A;  2VBW A;  2VBX A;  2UXN A;  3GUD A;  1XDU A;  1J59 A;  1HQC A;  3V7S A;  2DPD A;  1XCB A;  2V1U A;  2NAZ A;  2KJB A;  3HRT A;  1QBJ A;  3ZQ7 A;  3HSF A;  1EH8 A;  1P4W A;  2FF4 A;  2YU3 A;  3P7N A;  3I58 A;  3CUQ C;  2EJR A;  3I59 B;  1KU3 A;  1SFE A;  2VC1 A;  4MQV A;  3DV8 A;  3TQN A;  1W5T A;  4RGR A;  1S7O A;  1ZRF A;  1UFM A;  3ULQ B;  4ZH4 F;  2XVC A;  5TRD A;  1QNT A;  2OBP A;  2PQ8 A;  2PFB A;  1F5T A;  2FBH A;  1FSH A;  2FNA A;  3N4M A;  3IWZ A;  2G7H A;  1T6S A;  2MC3 A;  3ZN1 A;  4LG0 B;  1NHA A;  2JT1 A;  1EV7 A;  4A0Z A;  5FGM A;  5BQT A;  1QZY A;  1R23 A;  1ZH5 A;  2ESN A;  2ZJ2 A;  3Q5F A;  2GZW A;  3EDP A;  4EJT A;  3CUQ B;  4B8X A;  4ETS A;  3N97 A;  2QQB A;  3Q9V A;  1B4A A;  2XUB A;  4BXU A;  4L5I A;  2V1D A;  1F1Z A;  4YFK F;  2CQK A;  5DEQ A;  1FBQ A;  3E6C C;  3E6D A;  1FYK A;  4P55 A;  4BHB A;  1IUY A;  4HX4 A;  3KP3 A;  2W57 A;  3E6M A;  3VB2 A;  3WTU C;  3KZY A;  4HOB A;  2R3S A;  1MD0 A;  3T0Y A;  1HST A;  2K7L A;  4AIJ A;  1U8R A;  1ULY A;  2MLG A;  1Y0U A;  3FXQ A;  3IRR A;  3WTS C;  1ZAR A;  1K79 A;  2P5L C;  2V1X A;  3J80 Z;  1BJA A;  1ZRD A;  2ZFW A;  2H6B A;  3JTG A;  2MD5 A;  1Q1H A;  5FD5 A;  3AAF A;  2XAQ A;  4EM0 B;  3FXU A;  4L9V A;  1YS7 A;  1J2X A;  1WI9 A;  5DDG A;  2GWR A;  4ESF A;  2ISY A;  2ZBK A;  3WTZ A;  1XN7 A;  5D8L B;  1FZP B;  2R7D A;  2W85 A;  3R4K A;  1KYW A;  2DQL A;  4HAM A;  4ENM A;  4AD9 A;  4N9H A;  3T1B A;  4B09 A;  5LHG A;  2XAG A;  4OIN F;  5K5Q A;  2PEX A;  1XGS A;  4BHC A;  1ZLK A;  3G73 A;  1U5T A;  3M7G A;  4ZZL A;  2HGC A;  5D6E A;  4ENK A;  3HIF A;  2J5P A;  4IRH A;  2EA4 A;  4KDP A;  3WU0 A;  2UZK A;  1U6G A;  3WGG A;  4WWC A;  1R1T A;  1YIO A;  2DLL A;  2QUF A;  2O03 A;  4N9I A;  4LFU A;  4JQF A;  3LAP A;  2E1C A;  1WKM A;  3V8J A;  2D45 A;  2E1N A;  1O7L A;  3T8T A;  5JFR A;  4EJV A;  1W5S A;  1FYM A;  4K2E A;  1WQ2 A;  2XAS A;  5LLQ A;  4S05 A;  1K78 A;  4GYG A;  2A68 F;  3BOQ A;  4YFN F;  5F1R A;  1O3S A;  2MH2 A;  1T39 A;  1J5Y A;  2Z5U A;  2KJC A;  5DUI A;  4RAY A;  3D5L A;  1BI2 A;  2Y48 A;  3E5U A;  4XBF A;  4Q4Z F;  5TJJ A;  2F2E A;  3ERE D;  1OKR A;  4S04 A;  3TKY A;  3JSO A;  1ZLJ A;  5DYM A;  2M30 A;  5A2Q K;  4U0Y A;  1O7F A;  5E17 F;  1O3R A;  1RNL A;  1TNS A;  5J8C A;  3H3Z A;  5HLG A;  4WXD A;  5D5V B;  3GX4 X;  2PG4 A;  1ZYR F;  2IA2 A;  2EFW A;  5E1X A;  4IRI A;  2YSR A;  3SQN A;  1IN8 A;  2ZKZ A;  4MHG A;  4Z2Y A;  3TDZ C;  2ZCW A;  1CF7 A;  2KKO A;  5JR3 A;  2FEZ A;  4O6J A;  3SZT A;  3I59 A;  1LQ1 A;  1USS A;  3F3X A;  4I0B A;  2MH9 A;  4EJU A;  4M9Z A;  3F8C A;  1SD5 A;  5L3C A;  3JAM Z;  3HSE A;  4EMS A;  2CG4 A;  3CDH A;  1R7J A;  1R58 A;  1S3J A;  1HW5 A;  1RZ4 A;  1ZG1 A;  2EV0 A;  2LF8 A;  3V8K A;  1EH6 A;  5E8G A;  5ILS A;  4LG0 A;  3LQR A;  2UXX A;  3RIR A;  2GA1 A;  4L0Y B;  1X3U A;  4LK1 F;  4BNC A;  2OAZ A;  1K6O A;  4L9T A;  3F6V A;  1E2X A;  4LD5 A;  1GVJ A;  2A3S A;  3CUQ A;  2LF7 A;  3ABU A;  1P2F A;  1J7K A;  3BDD A;  2BYV E;  4OIO F;  1OYW A;  3WE3 A;  3E5Q A;  4A0X A;  3KP4 A;  5CVU A;  2LDU A;  1BIB A;  3L9F A;  4M74 A;  1YW7 A;  4HW0 A;  3DXJ F;  3ZMS A;  1UST A;  2OQR A;  3EYY A;  4P96 A;  4AWX B;  3PQJ A;  5H6R A;  5ED4 A;  5D5X B;  4O5V A;  1CGP A;  2Y0M A;  4TV7 A;  5LEK A;  1GXP A;  4O3M A;  5ICG A;  3WTW C;  2WV0 A;  4UV8 A;  3GFJ A;  3DPT A;  5ICC A;  3F22 A;  4XLN F;  2OZ6 A;  2M45 A;  5FFZ A;  1HW1 A;  2DU9 A;  2EWN A;  3QU6 A;  3SFZ A;  4WF2 A;  2RQP A;  5HS7 A;  2YX4 A;  2OQG A;  2L4M A;  2LNB A;  1GXQ A;  4L9J A;  3I5U A;  2FML A;  3GZ6 A;  1LNW A;  4ASN A;  2A6H F;  4RGS A;  5D4S A;  5H6Q A;  4XRF A;  3I0T A;  3I54 A;  3F72 A;  2EFO A;  1MJB A;  3I4P A;  5K1Y A;  1YO5 C;  3COA C;  2RNJ A;  3J81 K;  3ECO A;  1IN7 A;  3HUG A;  4LLG F;  3CJN A;  2YR2 A;  4I01 A;  4KN7 X;  1ON1 A;  1FC3 A;  2IRF G;  3GW2 A;  3QP5 A;  3KET A;  1SD6 A;  4PZJ A;  3K1M A;  2CW0 F;  2IA0 A;  1MKM A;  2ZO4 A;  4M6X A;  2P6S A;  4HV6 A;  2O8X A;  4PGH A;  4CZZ A;  2VT3 A;  2D1H A;  4R1H A;  1KU9 A;  3B02 A;  4NHJ A;  1LDJ A;  2QQ9 A;  3LA2 A;  5DV5 A;  1SD7 A;  2HR3 A;  4FT8 A;  1KQ0 A;  4G8X A;  1V3F A;  5HLH A;  2VXZ A;  3BRO A;  3TOB A;  5BS6 A;  1U2W A;  2Y75 A;  2HQR A;  4HDV A;  2EFN A;  1ZG3 A;  4FHT A;  2KIF A;  4HQM A;  4CHU A;  1KQ8 A;  5HDG A;  2DBB A;  2EFQ A;  4OIR F;  4HX8 A;  1MJA A;  3MCZ A;  5J8F A;  1E17 A;  1IRF A;  3LA7 A;  1V4R A;  4Y15 A;  4UVB A;  2M87 A;  4G7Z F;  5AON A;  4U7D A;  4Q5S F;  3GWZ A;  2IP2 A;  5CYV A;  2HQN A;  1XMK A;  2K4J A;  3RPU A;  1RUO A;  4G6Q A;  2DI3 A;  5CVJ A;  4R79 A;  1XDS A;  2LSO A;  4YG2 F;  4R8H A;  4I09 A;  3M9A A;  3HRS A;  2Z9O A;  3PFI A;  1STZ A;  1SMT A;  2EB7 A;  1O3Q A;  4WCG A;  4LK0 F;  3GFM A;  3CLO A;  1H9G A;  2HOE A;  2O3F A;  1YFH A;  1R1V A;  1R5G A;  1KQ9 A;  4EVI A;  2MBF A;  4EGY A;  1R00 A;  3RKY A;  2CWE A;  2FBI A;  1TLH B;  2GA2 A;  3I71 A;  3HSR A;  1YW9 A;  2EK5 A;  1G4D A;  3QOP A;  4CDG A;  1QGP A;  1BI3 A;  2P7C B;  1FYL A;  1TW2 A;  2RV8 A;  2V79 A;  4LLN A;  2CFX A;  3TGN A;  2XRN A;  1YQA A;  1D5V A;  2EFP A;  1S8N A;  1BOA A;  2VOP A;  1WRJ A;  2Z33 A;  3GZ5 A;  3SHF A;  1OYY A;  3RYR A;  5LGU A;  2JZY A;  2KIM A;  3R6S A;  3E3V A;  1FOK A;  2RGV A;  3MZH A;  2M8E A;  2VT2 A;  1T98 A;  1B59 A;  2HEO A;  5HS9 A;  2ZME B;  4OIQ F;  5FFX A;  1TQM A;  1UHM A;  1TW3 A;  5D6F A;  4PDK A;  2XKO A;  4LLL A;  1AWC A;  4L0Z B;  3BPX A;  1PP7 U;  1ZRE A;  2GAU A;  3L09 A;  1FNN A;  3RKX A;  2GIV A;  2QZ8 A;  5D4R A;  1IRG A;  1ODD A;  4IF4 A;  5LRS A;  2W25 A;  3VEP A;  2Z99 A;  4FX0 A;  2FBK A;  1J0R A;  2Q2E A;  3TOA A;  4P9U A;  1AOY A;  3GO5 A;  1D8J A;  2V9V A;  5BPD A;  2Q0O A;  3IKV A;  3IHU A;  2G9W A;  1L0O C;  4EM2 A;  2EV6 A;  3LST A;  2KRF A;  3LA3 A;  3MFK A;  1S7A A;  3RKW A;  3H3U A;  1QQI A;  2QM3 A;  3BZ6 A;  1ZG5 A;  1H0M A;  3O2P E;  2VE8 A;  1T2K A;  4IJA A;  3R61 A;  5ICE A;  1REP C;  2CYY A;  3K1P A;  1Z9C A;  1O57 A;  1KA8 A;  3FMS A;  5LEJ A;  5LGT A;  1PDN C;  1SFU A;  3HOT A;  3HHH A;  3CO6 C;  2ADU A;  3Q9S A;  3GFI A;  2IVM A;  5HDN A;  1XCV A;  2M5W A;  5CVV A;  3F6O A;  3K9T A;  1XSD A;  3KEQ A;  4A6D A;  3HTU A;  5DD4 A;  2VBY A;  5IT3 A;  2DFI A;  2UWM A;  3BY6 A;  4UUV A;  1HBX G;  4EJW A;  3NRV A;  1IN5 A;  1SMY F;  2MA3 A;  2H09 A;  5FO5 A;  2M1B A;  3FMQ A;  4XSX F;  1XMA A;  3C1D A;  4U88 A;  3FMR A;  4GO1 A;  4M72 A;  4OMY A;  5ICF A;  1LEB A;  3KE2 A;  1L3L A;  1OR7 A;  4LB5 A;  2FE3 A;  1S29 A;  3MEX A;  1PUE E;  2HTS A;  3GEZ A;  1YG2 A;  3JSP A;  3MZY A;  3WGH A;  1KGS A;  2P5V A;  1BC7 C;  1Z6T A;  3V7C A;  3DEU A;  3C7J A;  1B1B A;  2HKX A;  2YPR A;  4IPA A;  3K2Z A;  4KIC A;  5E18 F;  3LAJ A;  4EM1 A;  2QQA A;  4ZYG A;  4KYW A;  3EET A;  3FWE A;  2BV6 A;  3GVA A;  3U1D A;  2AS5 F;  4MGR A;  1FBS A;  3HRM A;  1MZB A;  2XAH A;  1Z6R A;  4HF0 A;  1UB9 A;  3ABT A;  3HOS A;  1B9N A;  4UHT A;  2DO7 A;  4UXN A;  2JTV A;  2K02 A;  2HZT A;  1IXC A;  3GF2 A;  2XKP A;  4GCV A;  3FF5 A;  1XSX A;  5DD8 A;  3SXY A;  3M8E A;  4LGW A;  2F5C A;  3DQV C;  1HKQ A;  3LWF A;  2OA4 A;  1H9T A;  2BE5 F;  1W4M A;  5ILV A;  4MEX F;  2FQ3 A;  1FPQ A;  2J5O A;  3TO9 A;  3ZPL A;  1F9N A;  5FLX Z;  1XGM A;  4WXC A;  2PJP A;  1R22 A;  2K86 A;  3QP6 A;  4CGZ A;  3P9C A;  2IJL A;  1FWZ A;  3RYP A;  2H27 A;  3DPL C;  5L3D A;  2F5E A;  3V7R A;  4UV9 A;  4MTD A;  4LB6 B;  3ZMT A;  2F5D A;  4PCQ A;  2XV4 S;  2QWW A;  4QLC U;  4L5J A;  4P5O A;  2ZME A;  2JPC A;  1U5T C;  1I5Z A;  5HDK A;  1P92 A;  2HYG D;  3EYI A;  2CGP A;  5D5U B;  3GFL A;  5LRR A;  1LB2 A;  1WSU A;  2Q8K A;  1IAW A;  2ZNZ A;  2RDP A;  2L4A A;  2XAF A;  2VON A;  3P9I A;  5KK1 A;  2HKO A;  2HDC A;  3BJA A;  3J80 K;  3KLO A;  4A0Y A;  2PMH A;  4HYE A;  1DPR A;  1HXD A;  3D0S A;  2XGX A;  4MTE A;  3G3Z A;  3NEU A;  1W7P B;  1FLI A;  1HSJ A;  4G94 A;  5HS8 A;  4UVC A;  3K1N A;  4EV0 A;  3QAH A;  1YS6 A;  2GQQ A;  2STW A;  3ECH A;  4UVA A;  4A5M A;  4FX4 A;  1T0F A;  2WWY A;  3WTT C;  2FU4 A;  5J6X A;  3R60 A;  4EQQ A;  3HYI A;  2G7U A;  5CJ9 A;  3E6B A;  4M9X A;  4WK8 F;  2NNN A;  2R7F A;  4BHP A;  5BOX A;  2XIG A;  1GHC A;  4A6E A;  2QBY B;  1IXS B;  4G7H F;  2RC4 A;  4I7H A;  2OU2 A;  1DP7 P;  2DK5 A;  3RI4 A;  2A5Y B;  2VN2 A;  5FB2 A;  4Q47 A;  1JHF A;  2KIU A;  4KNY A;  3F8B A;  4L9N A;  2BGC A;  5E1Z B;  1OYI A;  2B0L A;  4YFX F;  1F4K A;  1ZAO A;  2VE9 A;  2O61 A;  5LGN A;  3M1E A;  5CLS A;  3FM3 A;  4KMF A;  2CSO A;  3WOD F;  3ZMZ A;  1YLF A;  4ENJ A;  1Z05 A;  1IN4 A;  2PI0 A;  4H0E A;  2BBY A;  3V4G A;  2QYO A;  3L2C A;  3ZMU A;  3T8R A;  4Y13 A;  1LEA A;  1S6L A;  1SFX A;  1BI0 A;  5AIQ A;  2F5F A;  4GGG A;  2DW4 A;  5CVR A;  5A2Q Z;  1QO0 D;  4IVN A;  3KP7 A;  3IWF A;  1JGS A;  4IXA A;  4RS8 A;  1I27 A;  1Z7U A;  4ON0 A;  4PGG A;  2E7W A;  5LHI A;  3ZP5 A;  2D2W A;  2FSW A;  1HKS A;  3ISP A;  3HRU A;  4E70 A;  1FY7 A;  2BEO A;  1TNT A;  1I6X A;  3B73 A;  1DDN A;  2DT5 A;  4UNO A;  2FA5 A;  2DK8 A;  1CF7 B;  2DQR A;  2Z3Y A;  2K4B A;  1B6A A;  2FMY A;  4JK1 X;  3RTR A;  3TO6 A;  3JW4 A;  2P5K A;  3KP2 A;  2MLK A;  2HFH A;  5DUK A;  3JAM K;  1XD7 A;  1ZHF A;  1IF1 A;  3KEO A;  4LJZ F;  3HTS B;  2ACJ A;  4RAZ A;  1QZZ A;  1LVA A;  3F8M A;  5JI6 A;  1SD4 A;  4HA8 A;  2L3D A;  1ZGJ A;  2IT0 A;  1J9I A;  1MDM B;  3DFG A;  3CUO A;  5L3F A;  3RJP A;  5HVQ C;  3K69 A;  3L7W A;  4HLX A;  2FRH A;  2RKH A;  1YW8 A;  1HKT A;  2CO5 A;  3OOP A;  4DNC A;  5FLX K;  3GYH X;  2NNY A;  5EEH A;  2GXB A;  2H94 A;  1Z91 A;  1ZRC A;  1B9M A;  1WWX A;  3R0A A;  4GYI A;  5ERI A;  2FNP A;  3BWG A;  2W84 A;  4RB2 C;  1MJ9 A;  2EV5 A;  3F8F A;  4U7B A;  4MEY F;  4YIF A;  4L18 B;  4JBA A;  1BC8 C;  2VOO A;  3EUH A;  4M6Y A;  5E8I A;  4HX7 A;  1KU7 A;  3LFK A;  3SZP A;  3WTX C;  3GXO A;  1FT9 A;  1ZN2 A;  4OIP F;  3IRQ A;  1C0W A;  2HYF A;  5D5W B;  1LDK B;  3JTH A;  4OMZ A;  2A69 F;  2PMU A;  1D8K A;  2QVO A;  2X0L A;  1IW7 F;  3RDI A;  2QEN A;  1OMI A;  2YX7 A;  1BIA A;  2TDX A;  5HOO A;  3PQK A;  4A2U A;  4MNU A;  1W7P A;  1O3T A;  5DCM B;  1UHW A;  1BM9 A;  2A07 F;  3L00 A;  2IPQ X;  2RN7 A;  1DPU A;  4BYY A;  3U9G A;  3KP5 A;  1U3E M;  4XSZ F;  3VFZ A;  4KIB A;  3KCC A;  4HBL A;  4I2O A;  4AVP A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...