3B73A

Crystal structure of the phih1 repressor-like protein from haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'NAMRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhiH1 repressor-like protein
molecule tags Structural genomics, unknown function
source organism Haloarcula marismortui atcc 43049
publication title Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui.
rcsb
total genus 28
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3b73A00
3G73A 2XHKA 2UWMA 4MQ9F 2JT1A 2NNNA 1S3JA 2PN6A 1BBYA 3F3XA 5E18F 3ZMVA 3BDDA 1S8NA 4KIBA 2F2EA 2H6CA 3DFGA 5LBQA 4WCGA 2ELHA 3JSOA 3MEXA 1ZGJA 4BHCA 1F4KA 2IW5A 1JGSA 1Z91A 5ICFA 5LEKA 3WTZA 3RPUA 2RDPA 2R3SA 3IRRA 4EJVA 4HX7A 3U9GA 1U2WA 3BWGA 5LRRA 2Z3YA 3HOSA 1UCRA 5FFZA 4HOBA 1IN6A 3GVAA 3GW2A 2G9WA 4I7HA 5LRSA 1W7PD 2PG4A 4M72A 3O3KA 4NHJA 1R23A 2LF8A 3W6KB 5CVIA 4EJTA 4H0EA 3P9IA 2A5YB 4OINF 1J75A 1MJ9A 1OYYA 1UHMA 1ZAOA 4EM0B 4HBLA 3CLOA 3M8EA 5E8GA 2ADUA 2UZKA 2QZ8A 5ICCA 4IRHA 3TKYA 4QLCU 1G3YA 3DQVC 4OIQF 3WODF 4A6EA 4ENNA 3GFLA 4M74A 1YS6A 3FM3A 3I54A 4G6DA 4EGYA 4NB5A 1LB2A 3KP6A 2VE9A 3QRFF 4L5JA 3I59B 1YW7A 5E1ZB 3JTHA 1H9TA 1IN7A 3J7AO 2LNBA 4JBAA 1WI9A 1YLFA 5D4SA 4K2EA 3P9CA 2UXNA 3EQLF 3CO6C 5F6FA 2V9VA 1YS7A 2XAJA 2EFOA 4B09A 2OU2A 3P9KA 4Q4ZF 2EJRA 1YYVA 4OIRF 2ISZA 2JPBA 3KP5A 2CO5A 1T39A 2XKPA 4ETSA 2JTVA 1OMIA 3ZP5A 5LGUA 1TNSA 1IW7F 4CXFA 4AWXB 2Q2EA 2EV0A 1J2XA 4MNUA 4RB2C 5K5OA 2LSOA 2M30A 4UV8A 4BHPA 2J5OA 1EH7A 2Y48A 1HW2A 4RB3C 5A2QK 1TQMA 4L5IA 2XROA 1TLHB 2ZKZA 4P5OA 1O3TA 1BN5A 4AVPA 2X0LA 5DCFA 1V4RA 3LA2A 1KU7A 4MTDA 2Z99A 4CYDA 5AIPA 5TJJA 2YPRA 3WTWC 2FBIA 2GXBA 1IXSB 4BYYA 4BXUA 3Q5FA 3OOPA 5E20A 3MAJA 3HSFA 3I58A 2DPDA 3ZN1A 1AWCA 1B1BA 2VXZA 3QU6A 2D2WA 3KP2A 1WSUA 2AXLA 3TDZC 1OPCA 5D5WB 2ESHA 3EUHA 3WU0A 2GIVA 5LHGA 3DPLC 4KA4A 3J80Z 1RUOA 3IWZA 1U3EM 1CF7A 2Z5UA 3GZ6A 5ICEA 2P6TA 1OKRA 2EA4A 5J8FA 2LDUA 2DPUA 3CDHA 5LHHA 3E6CC 4M9XA 3FXQA 2MH2A 2Y75A 1ZH5A 2PEXA 3NEUA 2ZFWA 1ZG3A 4HLXA 4P9UA 2OZ6A 2G7HA 4Y17A 4ESJA 2CG4A 4ASNA 4EVIA 4RAZA 1XB4A 4HX4A 2H94A 4BQAA 5JI6A 2L54A 3KP7A 1A04A 3B73A 3M7GA 4KICA 4FT8A 5H20A 1SFEA 4LK1F 3QPTA 2NS0A 3KLNA 3TO6A 4GYIA 2K27A 3F8NA 3MQ0A 4XSZF 3LFKA 2DAOA 4R79A 1XGSA 4I09A 2F5EA 1PUEE 2XUBA 1I6XA 1KQ8A 2VBYA 1U5TB 1QQIA 3QP5A 4ZH4F 3R0AA 1R36A 2VONA 2DTRA 1TBXA 1KU9A 2LKPA 2W84A 3ABTA 3QP6A 1HSTA 2DW4A 2D1VA 1FP1D 3WTYC 2BBYA 3BJ6A 3C3WA 2CW0F 2K86A 1MDMA 2STWA 4XSXF 2KIFA 2R7FA 1IN5A 3DXJF 2M8EA 1J0RA 1G3TA 1XDUA 2OZUA 4UV9A 3HRMA 2GA1A 3KLOA 5FLXK 4A0XA 1FBSA 1UHWA 4LK0F 1IZ1A 1J9IA 1JE8A 2EV5A 4P9FA 5CVRA 1YIOA 2FE3A 4ZZLA 3HHGA 5CVJA 3MZHA 1BJAA 3C18A 4IXAA 3DP7A 5HDKA 2QBYB 1W5SA 1HKSA 1QPMA 4IHTA 4A12A 1G4DA 3NRVA 4MHGA 2DFIA 1O7LA 1W7PA 4O6JA 3L09A 5H6RA 2K02A 3HTUA 1XSDA 5HLGA 3SZTA 3COAC 2AS5F 2B0LA 5BMZA 2L01A 5IT9K 1B59A 4UVCA 4BHBA 4L9VA 3TOBA 4ZYDA 3K0LA 5F64A 3G3ZA 1LNWA 3F8MA 2OA4A 1MZBA 1H9GA 4NQWA 1J7KA 3E6BA 3RPQA 2DLLA 4I02A 4GO1A 2KJBA 3WTUC 3BP8A 3QAHA 2EFWA 2CGPA 1JHFA 2W25A 4LB5A 1ZRFA 1T0FA 4EMSA 4A6DA 5D8KB 2DO7A 2P5KA 3LQQA 2WC2A 4JK1X 5CVUA 2YSRA 4HDUA 1ZGAA 2TDXA 3ZN0A 4HV5A 3F8BA 1XN7A 1HSJA 4IF4A 1XCBA 2ACJA 5ED4A 2VBXA 1YW8A 3BPXA 1LJ9A 4N0BA 4WXCA 3V8JA 2ZBKA 2HQRA 1K78B 4OIPF 1T38A 2E1CA 4OMYA 4UHTA 1SD6A 4WX9A 1SMTA 1XD7A 2NNYA 1TW3A 2EV6A 5HLHA 2O03A 4UXNA 1EH6A 4AIHA 1L3LA 3FXRA 2A6HF 3LWFA 2ESNA 2CQKA 2DI3A 2KIUA 3RKXA 5JFRA 1IN4A 4YFNF 1U8RA 4A2UA 1UB9A 2QM3A 3ISPA 3VODA 4PGHA 5FB2A 4N9HA 2QWWA 2GAUA 1O3SA 3CUQA 4P55A 1AOYA 1I1SA 1BI0A 1XSXA 3CUQC 1KYWA 3ELKA 4KN4X 3L7WA 3RKYA 5BS6A 5ILVA 3R4KA 1Y0UA 3I4PA 3BROA 3I59A 3QOPA 1FC3A 3RYPA 2V1UA 2CSOA 4YFKF 4WK8F 1ZLJA 5BOXA 4L18B 3RI4A 4G9YA 1OYIA 2W85A 1TW2A 2IA2A 5DCMA 1K7AA 2FNAA 5D5XB 3L9FA 3J81Z 5L3GA 4HF1A 3E5XA 5D6FA 3ZMZA 4HX8A 1T2KA 5J8CA 2HR3A 4XRFA 3PFIA 4GYGA 2K4JA 4RGUA 2MA3A 2F5CA 1BM9A 2DBBA 3KCCA 5DD8A 1WWXA 2XAFA 5FD6A 1HXDA 2HYGD 3NQOA 2RV8A 2M1BA 5DCMB 3ZMDA 1U5TC 4ENKA 1IXCA 4ON0A 4I98B 4R8HA 4S05A 1ONVA 2DK5A 3R6SA 1B4AA 1FYKA 3L2CA 1R7JA 2BE5F 5AIQA 5DV5A 4IJAA 1HQCA 1LEAA 2O0YA 2OQRA 3J81K 2G7UA 3T8RA 4U7DA 5FD5A 3KEQA 2FOKA 4CZZA 1QGPA 3F8FA 1TTYA 2XAGA 2FU4A 5HOOA 1ZN2A 3V8LA 4YFXF 3F22A 3KP4A 4QWQA 2O61A 4G8XA 1KQ0A 2MD5A 5ERIA 1HW5A 1ZARA 2FSWA 5HS7A 4GXOA 4LLGF 3FF5A 3IC7A 4B8XA 3LSTA 3KE2A 3GZ5A 1MD0A 4O3MA 1LVAA 3FXUA 2OD5A 3IWFA 1BIAA 4Y15A 4Q5SF 2H09A 1F5TA 4EJUA 2ZXJA 1P4XA 2KIMA 4KDPA 2ZNYA 2DK8A 3E5QA 3WGHA 1RIOH 2VOOA 1SD7A 3VFZA 4CO8A 3BJAA 3IL2A 5DUKA 1DUXC 2XASA 1S7OA 4KIFA 1E17A 4YIFA 1LQ1A 3HTSB 1D5VA 2JSCA 3O2PE 2QUFA 3BJOA 1W7PB 4KUMA 2HYFA 3CUOA 4L9JA 5E17F 1G3WA 4GCVA 1C0WA 1FPQA 2E7XA 2IRFG 4EJOA 3GFMA 1W5TA 2STTA 2WWYA 1FWZA 1ODDA 2HTJA 4ZYHA 1Z05A 1O3RA 2PLYA 1B6AA 4CGZA 4G7OF 1ZRDA 3GUDA 4O5VA 4U7BA 3HRTA 4N9IA 3SZPA 2GA2A 2EK5A 4ZZDA 2KRFA 2DT5A 3RYRA 1FX7A 1KQ9A 1D8KA 1B9NA 1FYLA 5L3CA 3D5LA 4IHSA 1ZLKA 1QZZA 4CDGA 2M45A 5L3EA 4LFUA 3ZPLA 1VTNC 5K5QA 4A5NA 3T0YA 3V4GA 2EFPA 2RNJA 2D45A 4RB1A 1REPC 5FFXA 4MQVA 2XIGA 3TO7A 5LHIA 4KMFA 2P5LC 1YO5C 3GF2A 3LQRA 2HTSA 4RS8A 2VC0A 2O8XA 4HF0A 3JAMK 3WTVC 2EFNA 1MJAA 1RZ4A 3ROUA 2MH9A 1RNLA 2HEOA 4G6QA 2QQAA 5EEHA 2O3FA 4Q48A 3MWMA 1XDSA 4KFCA 2FBKA 4M73A 4BAYA 1HKQA 4A5MA 2OBPA 4Q47A 3I71A 1IAWA 1P4AA 3EYIA 2E1NA 1BC7C 3GWZA 5L3FA 4OU0A 4KYWA 5J6XA 4XLNF 3H92A 1STZA 1EV7A 4ENJA 4XBFA 1F1ZA 3L00A 1IXRC 2VT3A 3ECOA 3GEZA 3V7CA 4A0ZA 3C7JA 1KGSA 2HDCA 5A2QZ 2DQRA 1ON1A 3KEOA 3TDUC 3ERED 2QLZA 2WTEA 1R5GA 3S2WA 1U5TA 2Q0OA 2XRNA 2VC1A 4I01A 4LD5A 5ICGA 4GGGA 1R5HA 1O7FA 2RN7A 1FT9A 1USTA 3CJNA 1GVJA 3WTTC 3R60A 4IRGA 4YG2F 3Q9VA 1YTYA 1UFMA 2ISYA 2IT0A 3TO9A 2A6EF 4LG0A 1R22A 1FBUA 3T5XA 2L4MA 1FSEA 3ECHA 4IPAA 4Z2YA 2D1HA 2ZMEA 3WTXC 2P4WA 2LF7A 4FHTA 2P7CB 4G7HF 1DDNA 4IRIA 2VBWA 2QENA 3K69A 1FZPB 4HF2A 4M6XA 1R1TA 5LEJA 1FNNA 2CWEA 2J5PA 3KFWX 3KZZA 2E7WA 2FA5A 1FSHA 3ZMSA 2COMA 1ZHFA 3I5UA 3MZYA 3K1PA 2ZNZA 3T8TA 1ZREA 2IP2A 3E6DA 4EM1A 2Q8KA 3HYIA 3QU3A 1WQ2A 2JPCA 2NAZA 4EJWA 1FP2A 2O6GE 3IHUA 1QZYA 2F5DA 4AD9A 1YG2A 2MC3A 2GXGA 1ULYA 3CUQB 4BH9A 4L9TA 3CO7C 1U6GA 1SFXA 2YR2A 4M9ZA 1XSVA 3WU1B 5DUIA 5TRDA 2NRAC 3FMQA 2HFHA 1X3UA 2H6BA 1YFHA 3HRUA 4TV7A 2CFXA 4KT5C 4OOIA 1DPUA 5E1WA 1JHHA 1OR7A 3K1NA 3KZYA 3LA7A 4AIJA 2VE8A 1P92A 2L02A 3MFKA 1MKMA 3PQJA 4KMUX 4HQEA 4L9NA 4HW0A 2EA2A 2M5WA 4RAYA 3ZMTA 2L4AA 1B9MA 1LDDA 3GXOA 1D3YA 1JXSA 1HW1A 4M71A 2K4BA 1BI2A 4WF2A 1Z1DA 5DD4A 3F6VA 2EWNA 5K1YA 4HYEA 4LJZF 3F8CA 3P7NA 1LDJA 2BYVE 1SFUA 2XKOA 1YQAA 5ILUA 4EV0A 4HAMA 3DPTA 4U0VA 4FX0A 2QQBA 1DPRA 2PI0A 3JW4A 2HKOA 1SD5A 4WWCA 3TOAA 1O3QA 5BPIA 1KU3A 5DEQA 3AAFA 5HDGA 5D8LB 1CF7B 3E5UA 3LA3A 4UUVA 3ZMUA 2FNPA 1FYMA 1K78A 2Z33A 3H3ZA 2FMLA 4XLPF 1MGTA 4E70A 1V3FA 2IA1A 3IKTA 3N97A 1K79A 3MCZA 1XGNA 2MBFA 1RUNA 3LAPA 1R1UA 2P8TA 2P6SA 1CGPA 1IRGA 2YX7A 5L3BA 1BIBA 2W24A 3I64A 3WGIA 1FLIA 1USSA 3CTAA 4U88A 2PFBA 4UVAA 1H0MA 4PDKA 3VB2A 4KNYA 3REOA 5HVQC 3VOEA 2FEZA 5D4RA 4DQ2A 4CICA 2PMHA 1ZG1A 2CYYA 4HQMA 3SHFA 4Y13A 3C1DA 2BEOA 5FLXZ 2PQ8A 2WV0A 1E2XA 4LLLA 1P2FA 1FOKA 3F21A 2K7LA 2VT2A 1ON2A 3M8FA 2HKXA 1U78A 4HZFA 1RI7A 3HRSA 3JTGA 1GHCA 3FMRA 2A3SA 1QO0D 3JSPA 4KIGA 4MEXF 3TGNA 3R0JA 3U1DA 1J59A 3DF8A 4LLNA 1R58A 2HZTA 1TQIA 2HWVA 2BGCA 5LLQA 5CYVA 2A68F 5ILSA 2IJLA 2FF4A 2IPQX 3E3VA 3HOTA 4OMZA 1IN8A 4LG0B 2PBIA 4HV6A 2A69F 4LGWA 3W6JB 2JRTA 2ZO4A 2FQ3A 2HQNA 2FBHA 2HS5A 3EDPA 2XVCA 1G6NA 4U0YA 1WKMA 4PZJA 2V1XA 1S7AA 1T6SA 5BPDA 3LAJA 3SQNA 3K9TA 3FHZA 3HIFA 2Z9OA 2ZMEB 2M87A 1YW9A 3SFZA 3B02A 3T1BA 4ESFA 1BI1A 1KU2A 4I2OA 1F9NA 4BNCA 3D0SA 3Q9SA 3RKWA 3GX4X 3ZQ7A 1HBXG 2GQQA 1GXPA 4MGRA 1OYWA 1I27A 4FX4A 1PP8F 1KYZA 3DEUA 3FWEA 2XAHA 4U0WA 5IT9Z 3M9AA 2RKHA 1MDMB 5CJ9A 1IRFA 3E97A 2C6YA 4MTEA 3ABUA 3KETA 1XMAA 4I0AA 3HSEA 4EM2A 2V1DA 2YU3A 4IVNA 3QPHA 1S29A 5AONA 1J5YA 1FY7A 2ZJ2A 5D6EA 5E8IA 2V6CA 3F23A 3EYYA 5CVVA 1R00A 2QVOA 5JHUA 2P7VB 2DQLA 2NYXA 1BI3A 1XMKA 4PGGA 4DNCA 1Z9CA 2KKOA 5HS9A 4ZYGA 1DP7P 3K2ZA 1P4WA 2XAQA 3ULQB 2RGVA 4G94A 2P5VA 1I1GA 1HKTA 1SD4A 1PP7U 2W57A 4UVBA 5HS8A 5EEGA 3N4MA 1QBJA 2QYOA 3TQNA 5KVRA 2VBZA 3BZ6A 4HDVA 3M1EA 3I0TA 2EFQA 1TNTA 1IF1A 1KA8A 3E6MA 3OV8A 2XV4S 2GZWA 2FRHA 4RGRA 3I53A 4WXDA 1Z7UA 4KN7X 4EQQA 3V8KA 3H3UA 2MLKA 2KJCA 4EGZA 1G3SA 3SXYA 2QBYA 2L3DA 2OQGA 4P96A 2HGCA 2DU9A 3GO5A 4HA8A 4S04A 4R1HA 3IRQA 3BOQA 4YIIA 1NHAA 3DV8A 1BOAA 2VODA 6PAXA 1XCVA 1K6OA 3ML6A 1ZYRF 3BPVA 4ZYEA 3VEPA 4F7ZA 1LEBA 1QNTA 2ETHA 4A0YA 4CHUA 2RVCA 2VN2A 2OAZA 2RC4A 4HLYA 1FBQA 3DKWA 4M9SA 3J80K 3R61A 3RJPA 2JZYA 4RB0A 1L0OC 5HDNA 2UXXA 4M6YA 1LDKB 4MEYF 2YX4A 5L3DA 3BY6A 2XGXA 5JVTA 5K5RA 2VOPA 2Y0MA 4WXHA 2IVMA 5CLSA 3IKVA 1R1VA 3GFIA 3RTRA 4LMYA 1S6LA 2FMYA 1Z6TA 4PCQA 1BC8C 3K1MA 5BQTA 4RGSA 4G7ZF 2ZCWA 3F6OA 1TQPA 2R7DA 4L0YB 5LGNA 3RDIA 1MJBA 5F1RA 3KP3A 1Q1HA 4ENMA 3GYHX 3FZVA 5JR3A 1PDNC 1I5ZA 1IUYA 4JQFA 2X4HA 1SAXA 3GLXA 5D5VB 2F5FA 3F72A 5H6QA 1Z6RA 1D8JA 4L0ZB 4OIOF 1T98A 2EB7A 3WE2A 4D0PA 5E1XA 3GFJA 2A07F 2QQ9A 5KK1A 3FMSA 5DYMA 3HHHA 3O6BB 3WG9A 1WRJA 4RGXA 4I0BA 2PJPA 1EH8A 2FXAA 5FO5A 3WGGA 4LB6B 3WE3A 2GWRA 3WTSC 1W4MA 2H27A 3V7SA 5HLIA 4UNOA 4ESBA 3HUGA 5FGMA 3PQKA 2HOEA 1GXQA 5LGTA 1XGMA 3FM5A 5IT3A 3V7RA 1XGOA 3EETA 1ZRCA 2V79A 1SMYF 2MLGA 5DDGA 2PMUA 1O57A 1P6RA 2RQPA 3HSRA 3U2RA 2IA0A 1ZG5A 2BV6A 3JAMZ 3RIRA 2A61A 4AIKA 3FX3A 5D5UB
chains in the Genus database with same CATH superfamily
3G73A 3PM1A 2QKMB 2XHKA 2M34A 4XORA 4MQ9F 2YU9J 2UWMA 2JT1A 2NNNA 1S3JA 3BTLA 4PFOA 3H1CA 2PN6A 4PJLA 2X6WA 1BBYA 3F3XA 2M7AA 5E18F 3OYBA 4KT6A 3HEFA 1CQTA 4JX6A 3OL3A 4XN0A 3ZMVA 5DM6F 4JX4A 2LK2A 3FK7A 3BDDA 4PJ0C 1S8NA 3IP4B 4XKCA 1RPWA 4KIBA 2F2EA 2H6CA 5KNLA 2V7FA 1V55H 3DFGA 5LBQA 2CUZA 4WCGA 2ELHA 3JSOA 1D0ZA 3JRCA 3MEXA 1ZGJA 2W00A 1AHDP 4BHCA 3S2DJ 4FETA 1R49A 1BW6A 2CQNA 1F4KA 1QA6A 2IW5A 4IZZA 1UELB 1TWHJ 1JGSA 3OIOA 4ZDLA 1XMXA 1Z91A 3S1MJ 3CF2A 5ICFA 1W1WE 5LEKA 3WTZA 2E2JJ 2VPLA 1U9OA 3RPUA 3MKYB 3OYLA 2RDPA 1Y1WJ 2R3SA 3IRRA 4A3FJ 1I6HJ 4EJVA 2IGOA 2XGCA 3A4CA 4HX7A 2HI3A 2L9NA 4RAFA 3U9GA 1U2WA 1ETYA 3TP0A 3BWGA 5LRRA 4HSTA 2Z3YA 4BDZA 3HOSA 1UCRA 5FFZA 5FRNA 3E1SA 4HOBA 2IS2A 1IN6A 2BY3A 3GVAA 2DJNA 3GW2A 4IOAF 2G9WA 4I7HA 4M3GA 5LRSA 5EGOA 2HPMA 4C9YA 1W7PD 1ZTRA 3I9V2 4D5FA 2F6CA 3CC4I 2PG4A 4LG3A 4B44A 1IJWC 2DCEA 4M72A 3O3KA 2FUG2 4NHJA 1R23A 1ZGWA 1WPKA 2LF8A 3W6KB 5CVIA 4EJTA 1MH3A 1TT0A 1OCTC 2GXAA 4BUPA 1X19A 4UUSA 4FE4A 4H0EA 3P9IA 2E2IJ 1VQ6I 2A5YB 4XL9A 3SDGA 4OINF 1J75A 1MJ9A 1OYYA 3OR1C 1UHMA 1ZAOA 4EM0B 1YJNI 4C3JJ 4HSRA 1Z7LA 1YI2I 4HBLA 3CLOA 3M8EA 5E8GA 2ADUA 1QU3A 1ETQA 2UZKA 2EZIA 1ZR2A 1PUFB 2QZ8A 1VQMI 3BR1A 3C2HA 3V42A 4C3IJ 2EZLA 2EILH 2V26A 4IRHA 3TKYA 5ICCA 4QLCU 1G3YA 4L5EA 3DQVC 1JUPA 5DS9A 4Y7NJ 4OIQF 3WODF 4A6EA 4ENNA 3GFLA 4M74A 3ZQHA 1YS6A 3FM3A 3I54A 3CCVI 1X1CA 3BG9A 4UUTA 4G6DA 4BS9A 2F4MB 4EGYA 3MN2A 4XLHA 4NB5A 1LB2A 3KP6A 3CJTB 1X1BA 2VE9A 3CLQA 3QRFF 1W0UA 4L5JA 3I59B 1FOXA 1AKHA 1YW7A 5E1ZB 2CV2A 3JTHA 1OCRH 2FD5A 4AU7A 4X6AJ 4A3EJ 2EINH 1H9TA 1IN7A 3J7AO 2LNBA 4JBAA 2Q1ZB 1WI9A 1YLFA 3CCJI 5D4SA 1OQYA 5CPRB 3WU2C 4BJ6C 2E35A 4BY7J 4K2EA 3P9CA 2Q2EB 4V2GA 4AVZA 2FOWA 1OJLA 2UXNA 3EQLF 4M3EA 5C44J 5F6FA 3CO6C 2V9VA 1YS7A 4E6KG 1LE8B 2XAJA 2EFOA 4B09A 2OU2A 3P9KA 4D5CA 4Q4ZF 4Z6YA 1RRJA 2EJRA 2PMZA 1YYVA 4OIRF 4IOCF 4XM3A 2ISZA 1JUSA 3QYBA 3JRHA 2JPBA 4NQWB 2XF6A 2CO5A 3KP5A 1WGXA 1T39A 2XKPA 2LKXA 4ZTFA 4ETSA 5HODA 3DCFA 2JTVA 1OMIA 3ZP5A 1WHUA 5LGUA 1TNSA 3MD2A 1IW7F 3K4LA 1HDDC 3BR2A 3O8HA 4XR6A 3VSKA 4CXFA 3N05A 2F48A 4AWXB 2Q2EA 2EV0A 1J2XA 4MNUA 5K7FA 1X2MA 4DYQA 3HPGA 4JOMA 5JLWA 1Z21A 4RB2C 4A3DJ 5K5OA 2LSOA 2M30A 3DU5A 4UV8A 1GT0C 2LYCA 4BHPA 2J5OA 4DZJA 1EH7A 3ABMH 1ETXA 4IHYA 5HLTA 2LD5A 2Y48A 1HW2A 1IG7A 4RB3C 5A2QK 1JKPC 4MLOA 2OV7A 1TQMA 4L5IA 5GAHJ 2M9HA 4XONA 2XROA 2N8GA 1TLHB 1WJBA 2ZKZA 4P5OA 3PNTA 1VI0A 1O3TA 2PJRB 1BN5A 2R93J 3F9KA 2E19A 4AVPA 2X0LA 4OWRB 1VQNI 3HKZA 5DCFA 1V4RA 3BG6A 3LA2A 1KU7A 4MTDA 1OR7C 2JUGA 2Y9ZA 3DTIA 2Z99A 4CYDA 3K4MA 5AIPA 4FQGA 5TJJA 2YPRA 2DYRH 3HL2A 5EG0A 3WTWC 2FBIA 2GXBA 1IXSB 4BYYA 2ZSHB 4BEHB 4BXUA 4D9JA 3ZQFA 1TWCJ 5TGTA 3Q5FA 4KISA 3PFYA 1Y6IA 2IS1A 3OOPA 5E20A 3A01B 2P81A 3BR5A 2TCTA 4BE1A 1B72B 3MAJA 3HOZJ 3HSFA 1HOMA 3I58A 2DPDA 3G71I 3ZN1A 1AWCA 3PSIA 1W5CC 4LITA 1B1BA 4AUXA 2WAEA 2VXZA 2LRDA 3QU6A 3OS0A 1G2HA 2K3FA 2AQFA 2W1OA 3HOWJ 1OFCX 2D2WA 3TP3A 1Q1VA 3JRDA 3KP2A 1WSUA 2AXLA 3EUKL 3ERMA 1SVLA 2VXDA 3TDZC 2E1MC 3BR3A 3TW7A 3FDYA 3RCOA 2LKSA 1OPCA 5D5WB 3SYTA 2ESHA 4FE7A 3SEQA 2R5ZA 1MMSA 3EUHA 3WU0A 2GIVA 5LHGA 3DPLC 4KA4A 3J80Z 3W3CA 1RUOA 3O8GA 3IWZA 1B72A 1QHHD 1U3EM 2L2OA 1YJ9I 2NS7A 1CF7A 1D1BA 2Z5UA 3GZ6A 3H3VK 2NVUB 3RPUD 5ICEA 4BJTA 3HUGB 2CFOA 2P6TA 3OYJA 3JRBA 1OKRA 3WHCA 2L7FP 2EA4A 5J8FA 2LDUA 2VJ4A 2DPUA 3UNGC 5E3NA 3CDHA 5LHHA 3E6CC 3LSKA 1IDZA 3JR9A 4M9XA 3FXQA 3OYDA 2MH2A 1J09A 4CYCB 1P7IA 2Y75A 1ZH5A 2PEXA 2CV1A 3NEUA 1R9TJ 2DOEA 2VQHA 2ZFWA 3ZQIA 1ZG3A 1XTAA 3S1QJ 2KRCA 4HLXA 4P9UA 2OZ6A 2G7HA 4Y17A 5FKOA 4ESJA 2LBFA 4DW6A 2CG4A 4Y3OA 4ASNA 4EVIA 4PJMA 2L0KA 4MO7A 2DN0A 4RAZA 4CCNA 4DIQA 4D7NA 1XB4A 4HX4A 3H9QA 1ZK8A 2H94A 4XKVA 5JI6A 2L54A 4BQAA 4ZTJA 3KP7A 1A04A 3B73A 3DKYA 3H5AA 3M7GA 4KICA 4FT8A 1VQ7I 4XKBA 5H20A 2KLOA 4A3MJ 1SFEA 2BW3B 2DT6A 2ID3A 4LK1F 3QPTA 2NS0A 3E7LA 3DEWA 3KLNA 3TO6A 3QPLA 3AFHA 3OYEA 1JTYA 4GYIA 1TWGJ 2R7XA 2K27A 3F8NA 3MQ0A 4XSZF 4IHWA 3LFKA 2DAOA 3SJMA 4R79A 4XRMA 1XGSA 2BVLA 2D5VA 4I09A 3TBIA 2F5EA 1PUEE 2XUBA 1I6XA 3JRFA 1KQ8A 2VBYA 3I56I 4A3IJ 1U5TB 1QQIA 3QP5A 4ZH4F 4E7KA 2YS9A 3R0AA 2HOTA 1R36A 2VONA 2DTRA 1SFOJ 4RAGA 5KCMA 1TBXA 3W2VA 1KU9A 2LKPA 5LFAA 3OMYA 2OJED 1DU6A 2UV1A 2W84A 2JN6A 4BE0A 3DBRB 2XDVA 3ABTA 3QP6A 1HSTA 3AL0C 3H36A 2DW4A 2NOJB 2D1VA 3H9GA 1FP1D 4E7SA 3WTYC 2BBYA 4IKFA 3PIPF 2R4GA 3BJ6A 3C3WA 2CW0F 1O4XA 2K86A 3L2QA 1MDMA 2STWA 4XSXF 2KIFA 2R7FA 1IN5A 3OYAA 3DXJF 2M8EA 1J0RA 1G3TA 2HDDA 3MKLA 1XDUA 2OZUA 2Z16A 4XOTA 1M1EB 4IL6C 1JT6A 4XLCA 3NWSA 4UV9A 1G8XA 3HRMA 1MBEA 2GA1A 2WAQA 3KLOA 5IOYA 3K10A 4H4KC 5FLXK 4A0XA 1FBSA 2LY1A 1UHWA 5IPAA 1YITI 1JKOC 3CCLI 1VNDA 4LK0F 3HG9A 1X58A 2HU9A 4YEJA 1ENHA 2P0WA 1IZ1A 1J9IA 1JE8A 4UY8I 3ZQQA 2EV5A 4P9FA 1FTZA 5CVRA 1YIOA 2FE3A 5EG0B 4ZZLA 3HHGA 5CVJA 3MZHA 4DOZA 1BJAA 3C18A 4IXAA 3DP7A 1VQ9I 5GTIC 5HDKA 1VQ8I 2WV1A 2QBYB 1W5SA 3I55I 1HKSA 1QPMA 1PUFA 5F27A 2XB0X 1RKWA 3ABKH 2VASA 4A12A 3BG3A 4IEJA 3NRVA 1G4DA 3QOEA 4IHTA 3ABLH 3OY9A 2F4OB 4MHGA 2DFIA 1O7LA 1W7PA 2BXZA 4O6JA 3L09A 3S3OA 1WZ2A 2K40A 5H6RA 3VYUB 2K02A 3HTUA 1XSDA 5HLGA 2W82A 2I8DA 3SZTA 2H1LA 3COAC 1ETOA 4DBQA 2AS5F 3CDIA 5FRMA 2B0LA 5BMZA 2L01A 3L2VA 2IEKA 2VPRA 3DKXA 4CCOA 2XF7A 2H1KA 3LL7A 3CCRI 5IT9K 1B59A 4UVCA 4BHBA 1K6YA 3J7YJ 4L9VA 4C3HJ 4KJZA 3TOBA 4ZYDA 3K0LA 5F64A 3G3ZA 1LNWA 3CESA 4BBRJ 2VL8A 3F8MA 2OA4A 3BQZA 1R4MB 4A3LJ 2XPWA 1MZBA 4ZDOA 1FTTA 2L5QA 3DPUA 4E7HA 3EPZA 3S15J 3ZQLA 3LSIA 3CMYA 1H9GA 2MG4A 4NQWA 1J7KA 4U87A 3E6BA 3RPQA 2DLLA 4A3BJ 4I02A 4II2A 1WJ5A 5C3EJ 4IHVA 2H8WA 4GO1A 2ZXWH 5F0FA 4GFBA 5FLVA 2Y9YA 1MNDA 5GPCA 2CRGA 2KJBA 3WTUC 3PUFA 3PSFA 3BP8A 3QAHA 2EFWA 2CGPA 1JHFA 1T08B 2VQLA 2W25A 4LB5A 1ZRFA 1T0FA 4AYBN 4EMSA 1KZHA 4NBQA 4A6DA 5D8KB 4KITB 1V5FA 2DMNA 2DO7A 2P5KA 1E3HA 3LQQA 4HNVA 4DYRA 3S3MA 2VKDA 2WC2A 4JK1X 5CVUA 3ZOBA 2YSRA 5F04A 2DDBA 4FISA 3OYHA 1ZGAA 2XGDA 4HDUA 2TDXA 3ZN0A 4HV5A 4RLFA 3BTIA 3F8BA 1XN7A 3VPRA 1HSJA 4IF4A 1XCBA 1DU0A 2ACJA 4XLAA 5ED4A 2VBXA 4W97A 1K83J 1YW8A 3BPXA 1LJ9A 4N0BA 4WXCA 3V8JA 2ZBKA 2HQRA 4S0HB 4DJAA 1VF9A 1K78B 4OIPF 2FX0A 1T38A 2E1CA 4OMYA 4UHTA 3CC2I 2OUMA 1SD6A 4WX9A 2M8GX 2G0EA 1SMTA 5EJCA 1YRNA 2NXNB 2DOFA 1XD7A 2NNYA 3E0JB 1TW3A 1NH3A 2EV6A 5HLHA 2O03A 5E3MA 4UXNA 1EH6A 4AIHA 3FXRA 1L3LA 5M3MJ 2A6HF 2M4GA 2ESNA 3LWFA 5B1AH 3K70D 2CQKA 2DI3A 4NDLA 3TMOA 2LY9A 2KIUA 3RKXA 5JFRA 1IN4A 4YFNF 1U8RA 4A2UA 2XPUA 1UB9A 3RSNA 2QM3A 3ISPA 3VODA 4XRSG 4BQQA 4PGHA 3GBGA 2VJ5A 4XNFA 3B6CA 4CSWA 5FB2A 4N9HA 4Y52J 5CQGA 1YOVB 2QWWA 4D1QA 2GAUA 3DLLF 1O3SA 2JVGA 3WHBA 2X9DA 5GP9A 5J47A 1OCPA 1E3OC 3CUQA 4P55A 1H8AC 1AOYA 1YRNB 1R71A 1I1SA 1BI0A 1XSXA 3CUQC 5TISC 1LFPA 3D5RC 2W48A 2BY0A 1KYWA 3ELKA 4KN4X 2EBIA 3L7WA 3RKYA 2NOGA 5BS6A 3R4KA 5ILVA 1Y0UA 4RBOA 1W0TA 3I4PA 2NVYJ 3BROA 3I59A 2LMDA 1FC3A 3QOPA 3RYPA 2V1UA 3S2HJ 2CSOA 3OL4A 1RKTA 2MW8A 2ZXIA 4YFKF 3S3NA 4WK8F 1MMAA 1ZLJA 3HZJA 4E7JA 5BOXA 4L18B 4F55A 3RI4A 4G9YA 3K4NA 1OYIA 1HC8A 3J7AY 2W85A 3S14J 1TW2A 2BVMA 2IA2A 5DCMA 2R7WA 1FEXA 1P9QC 1K7AA 2R7TA 2FNAA 5D5XB 2ZJPF 3L9FA 2JA5J 3J81Z 1JT0A 3FISA 5L3GA 4HF1A 3S8PA 3E5XA 5D6FA 3ZMZA 2LVSA 4HX8A 1T2KA 5E3LA 5J8CA 5J1RA 2HR3A 2KDZA 4XRFA 3BT9A 3DWLE 3L2RA 3PFIA 4GYGA 3PO2J 2K4JA 1T56A 2WB1A 2MSYA 5BNGA 4XIDA 4RGUA 1XG1A 2MA3A 2F5CA 1BM9A 2DBBA 1TT5B 3KCCA 1QZEA 2CUFA 5DD8A 1WWXA 2BW3A 2CH0A 2XAFA 5FD6A 1HXDA 2HYGD 2LG4A 3NQOA 2RV8A 2M1BA 4A3JJ 5DCMB 3ZMDA 1U5TC 4ENKA 1P7JA 1IXCA 2K5CA 4ON0A 1X2NA 4I98B 1OCOH 4R8HA 1A6QA 4S05A 1ONVA 1S7EA 1FOWA 2DK5A 3DLAA 3R6SA 1B4AA 1FYKA 4BL0B 3L2CA 1R7JA 3OYKA 3SZGA 3I4NJ 2BE5F 3BG7A 1N75A 5AIQA 5DV5A 1QPIA 3HOUJ 4IJAA 4DYCA 2R0QC 1HQCA 2RREA 1LEAA 2O0YA 2V4JC 1TWAJ 2OQRA 2GOMA 2ICWG 3FBIB 4QSHA 4BU2A 3J81K 2G7UA 3T8RA 1IGNA 1DP3A 5FKNA 4U7DA 2HXOA 3QYEA 5FD5A 2K9QA 3KEQA 2FOKA 4CZZA 2VLAA 2E60A 3JCUC 1QGPA 4BE2A 3F8FA 3K4CA 1TTYA 2XAGA 5J1YA 1WH5A 1ZN2A 1POGA 2FU4A 2KL4A 3V8LA 4YFXF 5HOOA 3F22A 3KP4A 3M07A 4QWQA 3VSLA 5F1JA 1Y39A 2L7ZA 2O61A 4G8XA 4J19A 2HDWA 2M0CA 1KQ0A 2R7QA 3S1NJ 1F43A 1KONA 2MD5A 5ERIA 4A3KJ 5J4YA 4BQOA 3RKQA 3IAM2 1HW5A 1ZARA 2FSWA 5HS7A 4GXOA 4LLGF 3BR6A 3FF5A 3IC7A 4B8XA 3LSTA 4IX7A 3KE2A 3Q0VA 3GZ5A 2JA6J 1SFKA 4LIVA 1MD0A 4O3MA 1IO2A 1LVAA 2OD5A 3FXUA 3IWFA 1BIAA 2XRLA 2E1MB 3CP2A 4Y15A 4Q5SF 2H09A 3W2WA 1F5TA 4Y4RA 2Y0SN 4EJUA 2ZXJA 1P4XA 2KIMA 4KDPA 2LR8A 2ZNYA 2DK8A 3E5QA 3WGHA 2BHZA 1RIOH 4AYBA 3KZIC 4DGWB 3LSGA 3GTOJ 2HYJA 2VOOA 1SD7A 2DFFA 1GV5A 2UUZA 3VFZA 4CO8A 3BJAA 1OCZH 3IL2A 5DUKA 2XASA 1S7OA 4KIFA 1DUXC 1E17A 4YIFA 5GTHC 1LQ1A 1FJLA 3HTSB 1AU7A 2IBDA 1D5VA 3VDXA 2E71A 4XLEA 2JSCA 1Z3XA 2VB6A 3O2PE 2QUFA 4ZYAA 1MMDA 2B63J 2O5RA 1E3PA 4EATA 3BJOA 2DA4A 2MGQA 1W7PB 2MD0A 4KUMA 1ERDA 2HYFA 2JUCA 3CUOA 3LSHA 1N77A 4L9JA 5E17F 1G3WA 4UUSB 4GCVA 2WY7Q 4CH7A 1C0WA 4RDUA 1FPQA 3H35A 2E7XA 3CDLA 5IYCJ 2IRFG 4EJOA 3CCMI 5C4XJ 3GFMA 1W5TA 5EEAA 4OAYA 2E5NA 3QYFA 1K4SA 2XB5A 2XSJC 2STTA 2WWYA 3CCQI 1FWZA 1YJWI 1MMNA 1ODDA 2Y0SA 5C4JJ 2HTJA 3A0HC 4ZYHA 1Z05A 4ZC3A 3GTQJ 3ZQGA 1O3RA 2PLYA 2E1OA 1B6AA 2NVTJ 4BACA 4G6TB 3FIWA 4F92B 2KISA 4CGZA 4G7OF 4GDFA 1SC7A 1PYVA 3GUDA 1YHQI 1ZRDA 4O5VA 3QQAA 3BCBA 4U7BA 2R7ZJ 2V1NA 3HRTA 4N9IA 1LFUP 3K4BA 1QRYA 3SZPA 4BQNA 2GA2A 2EK5A 2HVQA 2Z1DA 3HPHA 2AQEA 4ZZDA 3I3LA 2KRFA 2DT5A 3RYRA 3JREA 1FX7A 2Y31A 4AIDA 1KQ9A 1GDTA 1D8KA 1B9NA 1FYLA 2CJJA 2IGMA 3D5LA 5L3CA 3S16J 4IQJA 2X48A 5JLXA 4IHSA 3K7AJ 3OYMA 1ZLKA 1QZZA 4CDGA 2M45A 2DMQA 1WJDA 3U21A 5L3EA 5F0HA 2O7OA 2M7BA 4LFUA 3ZPLA 4C2MJ 1VTNC 5K5QA 4A5NA 4XLFA 3KYDB 3T0YA 3V4GA 1F36A 2IGKA 2EFPA 2RNJA 5M3FJ 2D45A 2PMZN 4RB1A 1MBGA 1REPC 2OC6A 3HXLA 4MQVA 2XIGA 5FFXA 3TO7A 1BR1A 5LHIA 2ZJQF 4KMFA 5J4VA 2P5LC 4XN3A 4J01A 1YO5C 3GF2A 2DODA 3LQRA 2VJJA 3JRGA 1Z67A 2KQRA 4A93J 3ONQA 5M5YJ 2JWTA 2HTSA 4RS8A 2VC0A 2O8XA 4M3DA 2PX9A 1T95A 2K3PA 2WB1N 4HF0A 3JAMK 3Q0UA 3WTVC 2EFNA 1MJAA 4G12A 1RZ4A 3ROUA 2MH9A 1RNLA 4NC6A 1R5ID 1I50J 3L2UA 4BJ5C 2HEOA 4G6QA 3OSGA 2QQAA 3FXLA 2JJ7A 1NG6A 2XGEA 5EEHA 1JKRC 4RM2A 2O3FA 2VKHA 4Q48A 3MWMA 1XDSA 5FKKA 4KFCA 1UJ8A 2FBKA 4M73A 2X51A 4BAYA 2ELJA 1HKQA 4A5MA 1IC8A 1Y8RB 2OBPA 4Q47A 3I71A 1IAWA 1P4AA 3H5RA 3VYTB 2DDAA 4YRVA 3EYIA 2JRMA 2E1NA 4J00A 1BC7C 1EA3A 2TRTA 2EZHA 3GWZA 4RM3A 4OU0A 5GPAA 5L3FA 1IRXA 4KYWA 1JTXA 2E2HJ 5J6XA 4Y33A 1IDYA 4XLNF 4F3QA 1GVDA 3H92A 1STZA 1EV7A 4ENJA 3AL0B 3PNVA 4XBFA 1F1ZA 1FOYA 2JA7J 1XC5A 1LKXA 4F91B 1GV2A 2VUMJ 3MZ8A 1HCRA 3L00A 3A01A 1IXRC 2VT3A 2DFEA 4A3CJ 3ECOA 3GEZA 2MC4A 2JMWA 3V7CA 4A0ZA 1SEUA 1ZR4A 2O9LA 1SVMA 1LFBA 3IUOA 1UZCA 2ZXHA 1XX5A 3C7JA 1KGSA 2HDCA 4BXFA 5A2QZ 1X1AA 2DQRA 1ON1A 3CCYA 2IGNA 3KEOA 3TDUC 3LNQA 3ERED 4BDYA 1EF4A 2QLZA 2GOXB 2WTEA 3P5JA 1R5GA 2EZKA 3S2WA 1S5LC 5LD2C 2Y69H 3GTGJ 5HNHA 1U5TA 4QIWN 2L9SA 2Q0OA 4NNJA 2XRNA 3BZCA 2HZDA 4V19K 3LSJA 2VC1A 4I01A 4LD5A 5ICGA 4GGGA 1O7FA 1R5HA 2RN7A 4QTRA 3GTKJ 1FT9A 1GLNA 1USTA 2QF7A 3WG7H 1LPQA 4M6VA 3C2GA 3CJNA 1TZLA 3K4KA 4B3AA 2XPVA 3HC7A 4IHXA 1GVJA 4B4CA 5IYBJ 2X6YA 3BLYA 3WTTC 2NVQJ 2FQ4A 3R60A 5DM7F 2DOAA 2FJ1A 4DZPA 1V5GA 4IRGA 5GAGJ 4YG2F 3NAUA 4RMNA 3Q9VA 1YTYA 2KT0A 1UFMA 2ISYA 1HF0A 2IT0A 3TO9A 2A6EF 4LG0A 1R22A 1UHSA 1FBUA 3T5XA 2L4MA 2A5WA 1D1CA 1FSEA 3IH2A 3ECHA 2HXIA 3D1NI 1YE9A 2OTJI 4IPAA 2CW8A 2KPMA 4Z2YA 1DQUA 4XMYA 3S93A 1QVUA 3A1YA 2D1HA 3HGGA 2ZMEA 3WTXC 2P4WA 1JJ6C 5M5XJ 2LF7A 3KIOA 4FHTA 2P7CB 2CUEA 4G7HF 1DDNA 4IRIA 2VBWA 2QENA 3K69A 1FZPB 4HF2A 4M6XA 1R1TA 5LEJA 1BW5A 2X1CA 1FNNA 2CWEA 2J5PA 3KFWX 3KZZA 2E7WA 2FA5A 3OS1A 1FSHA 3ZMSA 3JRAA 2COMA 1ZHFA 3I5UA 3MZYA 5CKTA 5KAFC 1MMGA 3K1PA 3H5NA 1X3ZB 2ZNZA 3T8TA 2KZGA 1ZREA 2IP2A 2HNHA 3E6DA 4HPQA 4EM1A 2Q8KA 2R7VA 3HYIA 1XS9A 1A6IA 2GBYA 3QU3A 2GLOA 3AG4H 2QKLB 4CCLA 1WQ2A 2JPCA 2ZMEC 5J1UA 2NAZA 2CQQA 1MNEA 2R5YA 1Y8QB 3CP8A 4EJWA 1FP2A 2O6GE 4A69C 3L2WA 1RETA 3IHUA 1ZELA 1QZYA 2F5DA 1VQPI 1RR8C 4BY1J 4AD9A 1YG2A 5EYRA 2MC3A 2GXGA 1ULYA 3CUQB 4BH9A 1ETWA 2BZTA 4ABZA 2VIXA 4L9TA 3CO7C 1U6GA 3VYSB 1SFXA 2YR2A 4OAZA 4M9ZA 4PSWA 4LIUA 1MBHA 1XSVA 5KAIC 3WU1B 5DUIA 5TRDA 2NRAC 2HPIA 4E7IA 1R4NB 1WJAA 2X6OA 2QQ8A 3FMQA 5B5EC 2K9LA 3U1KA 4UB8C 1UAAA 2HFHA 1X3UA 3UR3C 2H6BA 4B43A 3A0BC 1YFHA 3HRUA 4TV7A 2KFDA 2CFXA 3GZNB 4KT5C 4OOIA 2DYSH 1DPUA 5H2FC 1VQ5I 5E1WA 1NK3P 3VYRB 4LOCA 1JHHA 1OR7A 3K1NA 3KZYA 1V54H 3LA7A 3DEEA 2NVXJ 4AIJA 1D0XA 1NG7A 2VE8A 1P92A 2IS6A 1RESA 2L02A 3IH3A 3MFKA 1LUJB 3OYNA 2LFBA 1E0EA 1MKMA 3PQJA 4KMUX 5JHFA 4B48A 4HQEA 4L9NA 1U0JA 4HW0A 2EA2A 4HNTA 2BY1A 2M4KA 3GTPJ 2M5WA 4RAYA 3CCEI 3ZMTA 2L4AA 4E7ZA 3H0GJ 2ELKA 1B9MA 1LDDA 3GXOA 1D3YA 2R5ZB 3FKIJ 1JXSA 1RR7A 1HW1A 4NUBA 3GLLA 4M71A 2QA4I 1AKHB 2K4BA 1BI2A 4WF2A 1SAUA 1Z1DA 5DD4A 3SDBA 2DA2A 3F6VA 3Q0WA 2EWNA 1D0YA 4HYEA 4LJZF 4ANJA 4FASD 5K1YA 1NK2P 5B1BH 3F8CA 3P7NA 4YELA 2I5UA 2KZVA 1LDJA 2F4IA 2BYVE 2X1EA 1SFUA 4AC0A 1APLC 2XKOA 1YQAA 2AO9A 4CCKA 1T0FC 5ILUA 4EV0A 4I99C 2A6TA 2E36A 4HAMA 3DPTA 3ZRGA 2CMPA 4U0VA 2MABA 2L7MP 4FX0A 2QQBA 2OTLI 1DPRA 2PI0A 3JW4A 1LVKA 2HKOA 5HNFA 1SD5A 3OSFA 4WWCA 3OOUA 2XC7A 1MSEC 4X1EA 3TOAA 2CQ7A 2Z2SB 1O3QA 1VQ4I 3A03A 5BPIA 4QPOA 1KU3A 5DEQA 3PIOF 3AAFA 2CV0A 5HDGA 3PJRA 2KRHA 4XK4A 5D8LB 1CF7B 4CUGA 4YIRX 3E5UA 1X1DA 3LA3A 2ZFUA 4UUVA 3K6GA 2V9KA 3ZMUA 2FNPA 1BA5A 2ECCA 2JQ7A 2QSGX 1YX3A 2W7NA 1FYMA 1K78A 3HB9A 2BY2A 3I4MJ 3H3ZA 2Z33A 2FMLA 4M3FA 1MGTA 4E70A 4XLPF 1IV6A 2R7UA 1V3FA 2JSPA 5J3LA 4ZDPA 2IA1A 5EGOB 3MKZA 3IKTA 3N97A 1K79A 4C2TA 3MCZA 3OYFA 1XGNA 2MBFA 1HDPA 2DA7A 3OWTA 5K7HA 1OLTA 3SFIA 1RUNA 2CQXA 5EZHA 3IAS2 3LAPA 1W36D 2ME6A 1R1UA 1TWFJ 2P8TA 2P6SA 1BR4A 2OF7A 1CGPA 3PO3J 1IRGA 2YX7A 1K61A 5L3BA 1BIBA 2WADA 4PFPA 2W24A 3I64A 1B8IA 3WGIA 2F5VA 1FLIA 1UMQA 1USSA 3CTAA 3TEDA 3K2AA 3CQZJ 4U88A 2PFBA 4UVAA 1H0MA 4PDKA 4CCMA 2HOSA 2EPFA 2QCOA 3VB2A 4KNYA 3REOA 3LOCA 3VOEA 5HVQC 2FEZA 2R7SA 5D4RA 1VZ0A 4BBSJ 4DQ2A 1MBJA 4CICA 3G6EI 4ITVA 3OYGA 2PMHA 3BCAA 2EQRA 3CJQB 1ZG1A 2CYYA 4QPQA 4HQMA 3SHFA 4Y13A 3C1DA 1ETVA 3FK6A 3CZ6A 1TC3C 5DTDA 2BEOA 3ASOH 5FLXZ 5M5WJ 2DMTA 3F0CA 2BHYA 5FJ8J 3DBHB 4PK4A 2PQ8A 1H89C 2WV0A 1E2XA 4LLLA 1P2FA 1H88C 3OIPA 1FOKA 2WA0A 3CJRB 3SEZA 3F21A 2NS8A 2VKVA 2K7LA 2DT7B 2HOAA 1EJ9A 2VT2A 2IAIA 4XICA 1ZKGA 1X4OA 1ON2A 3M8FA 2HKXA 1U78A 4HZFA 2EH3A 1RI7A 3HRSA 2RQQA 1VQLI 3JTGA 1GHCA 3FMRA 3GTJJ 4CZCA 4BGDA 5KHDA 2A3SA 1T8IA 1QO0D 1IRZA 3GCMA 3JSPA 5IP6A 4KIGA 4MEXF 3TGNA 2HVSA 4HRIA 3R0JA 3U1DA 1VFCA 3DF8A 1J59A 4MFDA 5FROA 2KDOA 3Q3SA 4LLNA 1R58A 3KEYA 2HZTA 1TQIA 2HWVA 2BGCA 5B66C 5LLQA 3OIQA 2DMUA 2LLKA 2Y2ZA 5CYVA 2A68F 5ILSA 2ECBA 1QVTA 2IJLA 1FMWA 3CC7I 2FF4A 3AG1H 5JVGF 2IPQX 3E3VA 2LBFB 1WFXA 3HOTA 4OMZA 1IN8A 3PL8A 5E79C 1IUFA 4LG0B 1UG2A 2K85A 3H9JA 1X4PA 1BL0A 4C2UA 2PBIA 1FMVA 4HV6A 2A69F 4HNUA 4ZJZA 2DA5A 2CW7A 1T33A 3KX2A 3ASNH 4II3A 4LGWA 4XRSA 2X1DA 2K9SA 2OPTA 2X85A 3W6JB 2JRTA 2ZO4A 2FQ3A 2HQNA 1MBFA 2FBHA 3CCUI 2HS5A 3EDPA 1EKEA 3C2BA 5K7ZA 2XVCA 3VWBA 1G6NA 4U0YA 1WKMA 2BOLA 4PZJA 2V1XA 1S7AA 3CMEI 1T6SA 2JA2A 1MSFC 5BPDA 3LAJA 4M3BA 3SQNA 4EEFG 3K9TA 3FHZA 2HQ5A 3NARA 3HIFA 2L9RA 5CQEA 2Z9OA 1FIAA 1WI3A 2ZMEB 2M87A 1YW9A 3SFZA 3B02A 3T1BA 1X3WB 2E34A 3G1MA 4ESFA 1BI1A 1KU2A 1AA7A 3CCSI 4I2OA 1F9NA 4BNCA 2YUSA 3G1LA 3RZDJ 3D0SA 3Q9SA 5FKLA 3RKWA 3GX4X 4DBRA 1V5EA 1ETKA 1W36C 1D5YA 3ZQ7A 2XSDC 1HBXG 2GQQA 4JX5A 1GXPA 3X2QH 4MGRA 4BKXA 1OYWA 1I27A 3LMMA 4FX4A 1KYZA 3DEUA 3FWEA 1PP8F 2XAHA 4U0WA 1HLVA 2VQGA 5IT9Z 3RQIA 3M9AA 2IS4A 3M1CA 2RKHA 3M8JA 1MDMB 5CJ9A 1IRFA 3E97A 2C6YA 4MTEA 3ZCOA 3ABUA 3KETA 3ZR8X 1OISA 1XMAA 4I0AA 2DXIA 3HSEA 4EM2A 2V1DA 3RZOJ 2YU3A 1DGWY 1MH4A 4IVNA 1NTCA 1G59A 3QPHA 4B1RA 4CA0A 1S29A 3A2KA 3ESWB 5IP9J 5AONA 2E5ZA 1J5YA 1FY7A 2ZJ2A 5D6EA 4B3XA 3K70C 5F0CA 3FHNA 5EF6A 1WVRA 5E8IA 2V6CA 3F23A 1TL8A 3EYYA 5CVVA 5FKMA 1JJ8C 1SVOA 2ZJRF 1ITYA 1B8IB 3EUAA 1R00A 1RC9A 2EIJH 2QVOA 5JHUA 5B3SH 3W2AA 2P7VB 2DQLA 2NYXA 3HOYJ 1BI3A 2HQAA 1XMKA 2DA3A 4PGGA 4DNCA 3QODA 2GM4A 1Z9CA 2EIMH 2KKOA 4IO9F 1MIJA 5HS9A 4ZYGA 4F93B 1JKQC 1WH7A 4AM3A 1DP7P 3K2ZA 1P4WA 1DGRM 2XAQA 3FXMA 3ULQB 2RGVA 4G94A 2P5VA 3TL4X 1I1GA 1HKTA 2I10A 1ZQ3P 1SD4A 2ZB9A 3BZKA 2BXYA 1U8BA 1PP7U 2W57A 4UVBA 1SANA 3DBLB 5HS8A 5EEGA 3N4MA 2XF5A 2L9VA 1QBJA 2QYOA 3TQNA 3PNYA 2Y30A 3LFUA 1I3QJ 5KVRA 2VBZA 3BZ6A 4HDVA 2H8RA 3M1EA 3I0TA 2EFQA 1TNTA 1IF1A 1U9NA 3BTJA 3J7ZI 1X1PA 3TW6A 4CYCA 1WCMJ 1KA8A 1K4TA 3E6MA 2ZC2A 2QSHX 3OV8A 2XV4S 3HDDA 2DMPA 1D1AA 4N4NB 2GZWA 3A02A 1A36A 1N78A 2FRHA 1S72I 4RGRA 3I53A 4WXDA 2KMUA 1Z7UA 4FTHA 4FCYA 4KN7X 3KYLA 1PJRA 4JP0A 4EQQA 3V8KA 3H3UA 4XKWA 2MLKA 2KJCA 2OCCH 2WAFA 1MBKA 4D7MA 4EGZA 1G3SA 2XAUA 3G1OA 2COBA 2DA6A 1N25A 2DJIA 3SXYA 4W1UA 4BXXJ 2QBYA 2L3DA 2OQGA 4P96A 2GIZA 2HGCA 3MKWB 2DU9A 2W4SA 3GO5A 4CCJA 4HA8A 1JUMA 4S04A 2MFZA 3M3YJ 2L7KA 2PJRA 3FKJA 3L1PA 4I6ZA 4R1HA 3IRQA 3HGYA 3BOQA 4YIIA 1NHAA 4E4HA 3ZXSA 3DV8A 1BOAA 3RQ4A 2VODA 3AKZA 1XCVA 6PAXA 1K6OA 4PUSA 3ML6A 1YX5A 1ACIA 2HVRA 1ZYRF 3BPVA 4C30A 4NC7A 2KIQA 3W6VA 4ZYEA 3VEPA 4F7ZA 1Z3YA 1LEBA 1QNTA 2M2EA 1TP4A 3HOVJ 1OCCH 2R92J 2ETHA 4A0YA 3OR2C 4CHUA 2ID6A 2M0MA 3LSMA 2RVCA 2VN2A 4V2FA 1BR2A 5GADJ 2CU7A 2R7RA 2OAZA 3MVPA 2RC4A 3LSRA 3JRIA 4HLYA 2QGUA 2VQCA 2OCEA 4IQ4A 2LC2A 1FBQA 3CMAI 2KP6A 3GTLJ 5IY5H 1VQOI 3MMYB 3DKWA 3K4JA 5J40A 5F08A 4M9SA 3S1RJ 2B9SA 4XQFA 3J80K 3R61A 3DTKA 3RJPA 4JYKA 4X0GA 4HEA2 2JVHA 1WJCA 1JGGA 2JZYA 4RB0A 1L0OC 2IXSA 5HDNA 2UXXA 4M6YA 3H0DA 1MNMC 1LDKB 4MEYF 1Z0XA 2YX4A 3BY6A 5L3DA 2XGXA 2QEXI 3B6AA 3BC8A 1R6RA 5JVTA 5K5RA 1Y1VJ 4MFEA 2VOPA 2K9NA 2Y0MA 1Y56A 4WXHA 3FXKA 2QSFX 2IVMA 5CLSA 3IKVA 2LH9A 3FXJA 2RAEA 3CMMA 2AXTC 4RLQA 2KHMA 5GAEJ 1WJEA 4N4OB 1R1VA 3BTCA 3GFIA 3RTRA 4LMYA 3KPHA 4XOPA 1S6LA 2FMYA 4UB6C 1Z6TA 1YIJI 2M3AA 2MYSA 2ZSIB 1ORKA 3HM5A 4PCQA 1BC8C 2K9MA 3K1MA 5BQTA 3GTMJ 2LY2A 4PJJA 1Y0NA 3QWLA 2VI6A 3OYIA 2AHQA 4RGSA 4G7ZF 2ZCWA 3F6OA 3ZGKA 3IH4A 1HA8A 1TQPA 1I39A 2B7EA 3CF5F 5EZGA 1IV8A 2JK3A 2R7DA 3S32A 4L0YB 5LGNA 2R7OA 3RDIA 5EDNA 1VQKI 1MJBA 5F1RA 1BOBA 3KP3A 1Q1HA 3GYHX 4ENMA 2DTZA 3FZVA 9ANTA 5JR3A 4B47A 2LTPA 1PDNC 4I76A 3NWTA 2LOOA 2O8KA 2V6EA 1I5ZA 1IUYA 3GMEA 4JQFA 3G4SI 1A5JA 2X4HA 3LSPA 1SAXA 1UG0A 5IOZA 2DFHA 2JA8J 2LP0A 1S9HA 2VKEA 3GLXA 4PJNA 5D5VB 2F5FA 3F72A 2EIKH 3HBLA 3HKZN 5H6QA 5IP7J 1Z6RA 1D8JA 3EUHC 2CS3A 4L0ZB 4OIOF 3M4OJ 2CUJA 3AG2H 1WJFA 2V9PA 1T98A 2EB7A 3WE2A 4D0PA 5E1XA 4BEHA 4MIMA 3GFJA 2A07F 2QQ9A 1I3AA 5KK1A 1XPXA 3FMSA 5DYMA 4PSXA 3S17J 3ZQCA 3G2BA 1GUUA 3FXOA 1MW7A 4HG2A 3HHHA 3O6BB 3UKGA 3WG9A 1WRJA 3QPSA 2X6XA 4RGXA 4I0BA 2PJPA 2WY8Q 4F52A 1EH8A 2FXAA 2WAQN 5FO5A 3OYCA 3IV5A 3BR0A 3WGGA 4LB6B 5E3OA 2VJIA 3HOXJ 3WE3A 3CD6I 5IYDJ 2GWRA 3WTSC 2R5YB 4P1WA 3OS2A 3DTEA 1BJZA 1W4MA 3HJEA 2ME0A 2H27A 1JI8A 4RA2A 3V7SA 5HLIA 1QHGA 3AG3H 4UNOA 3FBNB 1A31A 4ESBA 3HUGA 3PUBA 5FGMA 1FIPA 3PQKA 2DA1A 2HOEA 1GXQA 1LE8A 5LGTA 1XGMA 1PVEA 3FM5A 5IT3A 4A3GJ 3V7RA 2A05A 1XGOA 3EETA 2LREA 3BQYA 2V79A 1ZRCA 1SMYF 2MLGA 5DDGA 2PMUA 3DU6A 1O57A 1P6RA 2RQPA 2RNGA 3HSRA 3U2RA 2IA0A 4NC8A 3BG5A 1ZG5A 4GRIA 4E7LA 2BV6A 1Z77A 3JAMZ 3RIRA 2WBMA 2A61A 1A35A 4AIKA 3KYCB 3FX3A 5FLMJ 3D5SC 5D5UB
chains in the Genus database with same CATH topology
3G73A 2XHKA 2UWMA 4MQ9F 2JT1A 2NNNA 1S3JA 2PN6A 1BBYA 3F3XA 5E18F 3ZMVA 3BDDA 1S8NA 4KIBA 2F2EA 2H6CA 3DFGA 5LBQA 4WCGA 2ELHA 3JSOA 3MEXA 1ZGJA 4BHCA 1F4KA 2IW5A 1JGSA 1Z91A 5ICFA 5LEKA 3WTZA 3RPUA 2RDPA 2R3SA 3IRRA 4EJVA 4HX7A 3U9GA 1U2WA 3BWGA 5LRRA 2Z3YA 3HOSA 1UCRA 5FFZA 4HOBA 1IN6A 3GVAA 3GW2A 2G9WA 4I7HA 5LRSA 1W7PD 2PG4A 4M72A 3O3KA 4NHJA 1R23A 2LF8A 3W6KB 5CVIA 4EJTA 4H0EA 3P9IA 2A5YB 4OINF 1J75A 1MJ9A 1OYYA 1UHMA 1ZAOA 4EM0B 4HBLA 3CLOA 3M8EA 5E8GA 2ADUA 2UZKA 2QZ8A 5ICCA 4IRHA 3TKYA 4QLCU 1G3YA 3DQVC 4OIQF 3WODF 4A6EA 4ENNA 3GFLA 4M74A 1YS6A 3FM3A 3I54A 4G6DA 4EGYA 4NB5A 1LB2A 3KP6A 2VE9A 3QRFF 4L5JA 3I59B 1YW7A 5E1ZB 3JTHA 1H9TA 1IN7A 3J7AO 2LNBA 4JBAA 1WI9A 1YLFA 5D4SA 4K2EA 3P9CA 2UXNA 3EQLF 3CO6C 5F6FA 2V9VA 1YS7A 2XAJA 2EFOA 4B09A 2OU2A 3P9KA 4Q4ZF 2EJRA 1YYVA 4OIRF 2ISZA 2JPBA 3KP5A 2CO5A 1T39A 2XKPA 4ETSA 2JTVA 1OMIA 3ZP5A 5LGUA 1TNSA 1IW7F 4CXFA 4AWXB 2Q2EA 2EV0A 1J2XA 4MNUA 4RB2C 5K5OA 2LSOA 2M30A 4UV8A 4BHPA 2J5OA 1EH7A 2Y48A 1HW2A 4RB3C 5A2QK 1TQMA 4L5IA 2XROA 1TLHB 2ZKZA 4P5OA 1O3TA 1BN5A 4AVPA 2X0LA 5DCFA 1V4RA 3LA2A 1KU7A 4MTDA 2Z99A 4CYDA 5AIPA 5TJJA 2YPRA 3WTWC 2FBIA 2GXBA 1IXSB 4BYYA 4BXUA 3Q5FA 3OOPA 5E20A 3MAJA 3HSFA 3I58A 2DPDA 3ZN1A 1AWCA 1B1BA 2VXZA 3QU6A 2D2WA 3KP2A 1WSUA 2AXLA 3TDZC 1OPCA 5D5WB 2ESHA 3EUHA 3WU0A 2GIVA 5LHGA 3DPLC 4KA4A 3J80Z 1RUOA 3IWZA 1U3EM 1CF7A 2Z5UA 3GZ6A 5ICEA 2P6TA 1OKRA 2EA4A 5J8FA 2LDUA 2DPUA 3CDHA 5LHHA 3E6CC 4M9XA 3FXQA 2MH2A 2Y75A 1ZH5A 2PEXA 3NEUA 2ZFWA 1ZG3A 4HLXA 4P9UA 2OZ6A 2G7HA 4Y17A 4ESJA 2CG4A 4ASNA 4EVIA 4RAZA 1XB4A 4HX4A 2H94A 4BQAA 5JI6A 2L54A 3KP7A 1A04A 3B73A 3M7GA 4KICA 4FT8A 5H20A 1SFEA 4LK1F 3QPTA 2NS0A 3KLNA 3TO6A 4GYIA 2K27A 3F8NA 3MQ0A 4XSZF 3LFKA 2DAOA 4R79A 1XGSA 4I09A 2F5EA 1PUEE 2XUBA 1I6XA 1KQ8A 2VBYA 1U5TB 1QQIA 3QP5A 4ZH4F 3R0AA 1R36A 2VONA 2DTRA 1TBXA 1KU9A 2LKPA 2W84A 3ABTA 3QP6A 1HSTA 2DW4A 2D1VA 1FP1D 3WTYC 2BBYA 3BJ6A 3C3WA 2CW0F 2K86A 1MDMA 2STWA 4XSXF 2KIFA 2R7FA 1IN5A 3DXJF 2M8EA 1J0RA 1G3TA 1XDUA 2OZUA 4UV9A 3HRMA 2GA1A 3KLOA 5FLXK 4A0XA 1FBSA 1UHWA 4LK0F 1IZ1A 1J9IA 1JE8A 2EV5A 4P9FA 5CVRA 1YIOA 2FE3A 4ZZLA 3HHGA 5CVJA 3MZHA 1BJAA 3C18A 4IXAA 3DP7A 5HDKA 2QBYB 1W5SA 1HKSA 1QPMA 4IHTA 4A12A 1G4DA 3NRVA 4MHGA 2DFIA 1O7LA 1W7PA 4O6JA 3L09A 5H6RA 2K02A 3HTUA 1XSDA 5HLGA 3SZTA 3COAC 2AS5F 2B0LA 5BMZA 2L01A 5IT9K 1B59A 4UVCA 4BHBA 4L9VA 3TOBA 4ZYDA 3K0LA 5F64A 3G3ZA 1LNWA 3F8MA 2OA4A 1MZBA 1H9GA 4NQWA 1J7KA 3E6BA 3RPQA 2DLLA 4I02A 4GO1A 2KJBA 3WTUC 3BP8A 3QAHA 2EFWA 2CGPA 1JHFA 2W25A 4LB5A 1ZRFA 1T0FA 4EMSA 4A6DA 5D8KB 2DO7A 2P5KA 3LQQA 2WC2A 4JK1X 5CVUA 2YSRA 4HDUA 1ZGAA 2TDXA 3ZN0A 4HV5A 3F8BA 1XN7A 1HSJA 4IF4A 1XCBA 2ACJA 5ED4A 2VBXA 1YW8A 3BPXA 1LJ9A 4N0BA 4WXCA 3V8JA 2ZBKA 2HQRA 1K78B 4OIPF 1T38A 2E1CA 4OMYA 4UHTA 1SD6A 4WX9A 1SMTA 1XD7A 2NNYA 1TW3A 2EV6A 5HLHA 2O03A 4UXNA 1EH6A 4AIHA 1L3LA 3FXRA 2A6HF 3LWFA 2ESNA 2CQKA 2DI3A 2KIUA 3RKXA 5JFRA 1IN4A 4YFNF 1U8RA 4A2UA 1UB9A 2QM3A 3ISPA 3VODA 4PGHA 5FB2A 4N9HA 2QWWA 2GAUA 1O3SA 3CUQA 4P55A 1AOYA 1I1SA 1BI0A 1XSXA 3CUQC 1KYWA 3ELKA 4KN4X 3L7WA 3RKYA 5BS6A 5ILVA 3R4KA 1Y0UA 3I4PA 3BROA 3I59A 3QOPA 1FC3A 3RYPA 2V1UA 2CSOA 4YFKF 4WK8F 1ZLJA 5BOXA 4L18B 3RI4A 4G9YA 1OYIA 2W85A 1TW2A 2IA2A 5DCMA 1K7AA 2FNAA 5D5XB 3L9FA 3J81Z 5L3GA 4HF1A 3E5XA 5D6FA 3ZMZA 4HX8A 1T2KA 5J8CA 2HR3A 4XRFA 3PFIA 4GYGA 2K4JA 4RGUA 2MA3A 2F5CA 1BM9A 2DBBA 3KCCA 5DD8A 1WWXA 2XAFA 5FD6A 1HXDA 2HYGD 3NQOA 2RV8A 2M1BA 5DCMB 3ZMDA 1U5TC 4ENKA 1IXCA 4ON0A 4I98B 4R8HA 4S05A 1ONVA 2DK5A 3R6SA 1B4AA 1FYKA 3L2CA 1R7JA 2BE5F 5AIQA 5DV5A 4IJAA 1HQCA 1LEAA 2O0YA 2OQRA 3J81K 2G7UA 3T8RA 4U7DA 5FD5A 3KEQA 2FOKA 4CZZA 1QGPA 3F8FA 1TTYA 2XAGA 2FU4A 5HOOA 1ZN2A 3V8LA 4YFXF 3F22A 3KP4A 4QWQA 2O61A 4G8XA 1KQ0A 2MD5A 5ERIA 1HW5A 1ZARA 2FSWA 5HS7A 4GXOA 4LLGF 3FF5A 3IC7A 4B8XA 3LSTA 3KE2A 3GZ5A 1MD0A 4O3MA 1LVAA 3FXUA 2OD5A 3IWFA 1BIAA 4Y15A 4Q5SF 2H09A 1F5TA 4EJUA 2ZXJA 1P4XA 2KIMA 4KDPA 2ZNYA 2DK8A 3E5QA 3WGHA 1RIOH 2VOOA 1SD7A 3VFZA 4CO8A 3BJAA 3IL2A 5DUKA 1DUXC 2XASA 1S7OA 4KIFA 1E17A 4YIFA 1LQ1A 3HTSB 1D5VA 2JSCA 3O2PE 2QUFA 3BJOA 1W7PB 4KUMA 2HYFA 3CUOA 4L9JA 5E17F 1G3WA 4GCVA 1C0WA 1FPQA 2E7XA 2IRFG 4EJOA 3GFMA 1W5TA 2STTA 2WWYA 1FWZA 1ODDA 2HTJA 4ZYHA 1Z05A 1O3RA 2PLYA 1B6AA 4CGZA 4G7OF 1ZRDA 3GUDA 4O5VA 4U7BA 3HRTA 4N9IA 3SZPA 2GA2A 2EK5A 4ZZDA 2KRFA 2DT5A 3RYRA 1FX7A 1KQ9A 1D8KA 1B9NA 1FYLA 5L3CA 3D5LA 4IHSA 1ZLKA 1QZZA 4CDGA 2M45A 5L3EA 4LFUA 3ZPLA 1VTNC 5K5QA 4A5NA 3T0YA 3V4GA 2EFPA 2RNJA 2D45A 4RB1A 1REPC 5FFXA 4MQVA 2XIGA 3TO7A 5LHIA 4KMFA 2P5LC 1YO5C 3GF2A 3LQRA 2HTSA 4RS8A 2VC0A 2O8XA 4HF0A 3JAMK 3WTVC 2EFNA 1MJAA 1RZ4A 3ROUA 2MH9A 1RNLA 2HEOA 4G6QA 2QQAA 5EEHA 2O3FA 4Q48A 3MWMA 1XDSA 4KFCA 2FBKA 4M73A 4BAYA 1HKQA 4A5MA 2OBPA 4Q47A 3I71A 1IAWA 1P4AA 3EYIA 2E1NA 1BC7C 3GWZA 5L3FA 4OU0A 4KYWA 5J6XA 4XLNF 3H92A 1STZA 1EV7A 4ENJA 4XBFA 1F1ZA 3L00A 1IXRC 2VT3A 3ECOA 3GEZA 3V7CA 4A0ZA 3C7JA 1KGSA 2HDCA 5A2QZ 2DQRA 1ON1A 3KEOA 3TDUC 3ERED 2QLZA 2WTEA 1R5GA 3S2WA 1U5TA 2Q0OA 2XRNA 2VC1A 4I01A 4LD5A 5ICGA 4GGGA 1R5HA 1O7FA 2RN7A 1FT9A 1USTA 3CJNA 1GVJA 3WTTC 3R60A 4IRGA 4YG2F 3Q9VA 1YTYA 1UFMA 2ISYA 2IT0A 3TO9A 2A6EF 4LG0A 1R22A 1FBUA 3T5XA 2L4MA 1FSEA 3ECHA 4IPAA 4Z2YA 2D1HA 2ZMEA 3WTXC 2P4WA 2LF7A 4FHTA 2P7CB 4G7HF 1DDNA 4IRIA 2VBWA 2QENA 3K69A 1FZPB 4HF2A 4M6XA 1R1TA 5LEJA 1FNNA 2CWEA 2J5PA 3KFWX 3KZZA 2E7WA 2FA5A 1FSHA 3ZMSA 2COMA 1ZHFA 3I5UA 3MZYA 3K1PA 2ZNZA 3T8TA 1ZREA 2IP2A 3E6DA 4EM1A 2Q8KA 3HYIA 3QU3A 1WQ2A 2JPCA 2NAZA 4EJWA 1FP2A 2O6GE 3IHUA 1QZYA 2F5DA 4AD9A 1YG2A 2MC3A 2GXGA 1ULYA 3CUQB 4BH9A 4L9TA 3CO7C 1U6GA 1SFXA 2YR2A 4M9ZA 1XSVA 3WU1B 5DUIA 5TRDA 2NRAC 3FMQA 2HFHA 1X3UA 2H6BA 1YFHA 3HRUA 4TV7A 2CFXA 4KT5C 4OOIA 1DPUA 5E1WA 1JHHA 1OR7A 3K1NA 3KZYA 3LA7A 4AIJA 2VE8A 1P92A 2L02A 3MFKA 1MKMA 3PQJA 4KMUX 4HQEA 4L9NA 4HW0A 2EA2A 2M5WA 4RAYA 3ZMTA 2L4AA 1B9MA 1LDDA 3GXOA 1D3YA 1JXSA 1HW1A 4M71A 2K4BA 1BI2A 4WF2A 1Z1DA 5DD4A 3F6VA 2EWNA 5K1YA 4HYEA 4LJZF 3F8CA 3P7NA 1LDJA 2BYVE 1SFUA 2XKOA 1YQAA 5ILUA 4EV0A 4HAMA 3DPTA 4U0VA 4FX0A 2QQBA 1DPRA 2PI0A 3JW4A 2HKOA 1SD5A 4WWCA 3TOAA 1O3QA 5BPIA 1KU3A 5DEQA 3AAFA 5HDGA 5D8LB 1CF7B 3E5UA 3LA3A 4UUVA 3ZMUA 2FNPA 1FYMA 1K78A 2Z33A 3H3ZA 2FMLA 4XLPF 1MGTA 4E70A 1V3FA 2IA1A 3IKTA 3N97A 1K79A 3MCZA 1XGNA 2MBFA 1RUNA 3LAPA 1R1UA 2P8TA 2P6SA 1CGPA 1IRGA 2YX7A 5L3BA 1BIBA 2W24A 3I64A 3WGIA 1FLIA 1USSA 3CTAA 4U88A 2PFBA 4UVAA 1H0MA 4PDKA 3VB2A 4KNYA 3REOA 5HVQC 3VOEA 2FEZA 5D4RA 4DQ2A 4CICA 2PMHA 1ZG1A 2CYYA 4HQMA 3SHFA 4Y13A 3C1DA 2BEOA 5FLXZ 2PQ8A 2WV0A 1E2XA 4LLLA 1P2FA 1FOKA 3F21A 2K7LA 2VT2A 1ON2A 3M8FA 2HKXA 1U78A 4HZFA 1RI7A 3HRSA 3JTGA 1GHCA 3FMRA 2A3SA 1QO0D 3JSPA 4KIGA 4MEXF 3TGNA 3R0JA 3U1DA 1J59A 3DF8A 4LLNA 1R58A 2HZTA 1TQIA 2HWVA 2BGCA 5LLQA 5CYVA 2A68F 5ILSA 2IJLA 2FF4A 2IPQX 3E3VA 3HOTA 4OMZA 1IN8A 4LG0B 2PBIA 4HV6A 2A69F 4LGWA 3W6JB 2JRTA 2ZO4A 2FQ3A 2HQNA 2FBHA 2HS5A 3EDPA 2XVCA 1G6NA 4U0YA 1WKMA 4PZJA 2V1XA 1S7AA 1T6SA 5BPDA 3LAJA 3SQNA 3K9TA 3FHZA 3HIFA 2Z9OA 2ZMEB 2M87A 1YW9A 3SFZA 3B02A 3T1BA 4ESFA 1BI1A 1KU2A 4I2OA 1F9NA 4BNCA 3D0SA 3Q9SA 3RKWA 3GX4X 3ZQ7A 1HBXG 2GQQA 1GXPA 4MGRA 1OYWA 1I27A 4FX4A 1PP8F 1KYZA 3DEUA 3FWEA 2XAHA 4U0WA 5IT9Z 3M9AA 2RKHA 1MDMB 5CJ9A 1IRFA 3E97A 2C6YA 4MTEA 3ABUA 3KETA 1XMAA 4I0AA 3HSEA 4EM2A 2V1DA 2YU3A 4IVNA 3QPHA 1S29A 5AONA 1J5YA 1FY7A 2ZJ2A 5D6EA 5E8IA 2V6CA 3F23A 3EYYA 5CVVA 1R00A 2QVOA 5JHUA 2P7VB 2DQLA 2NYXA 1BI3A 1XMKA 4PGGA 4DNCA 1Z9CA 2KKOA 5HS9A 4ZYGA 1DP7P 3K2ZA 1P4WA 2XAQA 3ULQB 2RGVA 4G94A 2P5VA 1I1GA 1HKTA 1SD4A 1PP7U 2W57A 4UVBA 5HS8A 5EEGA 3N4MA 1QBJA 2QYOA 3TQNA 5KVRA 2VBZA 3BZ6A 4HDVA 3M1EA 3I0TA 2EFQA 1TNTA 1IF1A 1KA8A 3E6MA 3OV8A 2XV4S 2GZWA 2FRHA 4RGRA 3I53A 4WXDA 1Z7UA 4KN7X 4EQQA 3V8KA 3H3UA 2MLKA 2KJCA 4EGZA 1G3SA 3SXYA 2QBYA 2L3DA 2OQGA 4P96A 2HGCA 2DU9A 3GO5A 4HA8A 4S04A 4R1HA 3IRQA 3BOQA 4YIIA 1NHAA 3DV8A 1BOAA 2VODA 6PAXA 1XCVA 1K6OA 3ML6A 1ZYRF 3BPVA 4ZYEA 3VEPA 4F7ZA 1LEBA 1QNTA 2ETHA 4A0YA 4CHUA 2RVCA 2VN2A 2OAZA 2RC4A 4HLYA 1FBQA 3DKWA 4M9SA 3J80K 3R61A 3RJPA 2JZYA 4RB0A 1L0OC 5HDNA 2UXXA 4M6YA 1LDKB 4MEYF 2YX4A 5L3DA 3BY6A 2XGXA 5JVTA 5K5RA 2VOPA 2Y0MA 4WXHA 2IVMA 5CLSA 3IKVA 1R1VA 3GFIA 3RTRA 4LMYA 1S6LA 2FMYA 1Z6TA 4PCQA 1BC8C 3K1MA 5BQTA 4RGSA 4G7ZF 2ZCWA 3F6OA 1TQPA 2R7DA 4L0YB 5LGNA 3RDIA 1MJBA 5F1RA 3KP3A 1Q1HA 4ENMA 3GYHX 3FZVA 5JR3A 1PDNC 1I5ZA 1IUYA 4JQFA 2X4HA 1SAXA 3GLXA 5D5VB 2F5FA 3F72A 5H6QA 1Z6RA 1D8JA 4L0ZB 4OIOF 1T98A 2EB7A 3WE2A 4D0PA 5E1XA 3GFJA 2A07F 2QQ9A 5KK1A 3FMSA 5DYMA 3HHHA 3O6BB 3WG9A 1WRJA 4RGXA 4I0BA 2PJPA 1EH8A 2FXAA 5FO5A 3WGGA 4LB6B 3WE3A 2GWRA 3WTSC 1W4MA 2H27A 3V7SA 5HLIA 4UNOA 4ESBA 3HUGA 5FGMA 3PQKA 2HOEA 1GXQA 5LGTA 1XGMA 3FM5A 5IT3A 3V7RA 1XGOA 3EETA 1ZRCA 2V79A 1SMYF 2MLGA 5DDGA 2PMUA 1O57A 1P6RA 2RQPA 3HSRA 3U2RA 2IA0A 1ZG5A 2BV6A 3JAMZ 3RIRA 2A61A 4AIKA 3FX3A 5D5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G73 A;  2XHK A;  2UWM A;  4MQ9 F;  2JT1 A;  2NNN A;  1S3J A;  2PN6 A;  1BBY A;  3F3X A;  5E18 F;  3ZMV A;  3BDD A;  1S8N A;  4KIB A;  2F2E A;  2H6C A;  3DFG A;  5LBQ A;  4WCG A;  2ELH A;  3JSO A;  3MEX A;  1ZGJ A;  4BHC A;  1F4K A;  2IW5 A;  1JGS A;  1Z91 A;  5ICF A;  5LEK A;  3WTZ A;  3RPU A;  2RDP A;  2R3S A;  3IRR A;  4EJV A;  4HX7 A;  3U9G A;  1U2W A;  3BWG A;  5LRR A;  2Z3Y A;  3HOS A;  1UCR A;  5FFZ A;  4HOB A;  1IN6 A;  3GVA A;  3GW2 A;  2G9W A;  4I7H A;  5LRS A;  1W7P D;  2PG4 A;  4M72 A;  3O3K A;  4NHJ A;  1R23 A;  2LF8 A;  3W6K B;  5CVI A;  4EJT A;  4H0E A;  3P9I A;  2A5Y B;  4OIN F;  1J75 A;  1MJ9 A;  1OYY A;  1UHM A;  1ZAO A;  4EM0 B;  4HBL A;  3CLO A;  3M8E A;  5E8G A;  2ADU A;  2UZK A;  2QZ8 A;  5ICC A;  4IRH A;  3TKY A;  4QLC U;  1G3Y A;  3DQV C;  4OIQ F;  3WOD F;  4A6E A;  4ENN A;  3GFL A;  4M74 A;  1YS6 A;  3FM3 A;  3I54 A;  4G6D A;  4EGY A;  4NB5 A;  1LB2 A;  3KP6 A;  2VE9 A;  3QRF F;  4L5J A;  3I59 B;  1YW7 A;  5E1Z B;  3JTH A;  1H9T A;  1IN7 A;  3J7A O;  2LNB A;  4JBA A;  1WI9 A;  1YLF A;  5D4S A;  4K2E A;  3P9C A;  2UXN A;  3EQL F;  3CO6 C;  5F6F A;  2V9V A;  1YS7 A;  2XAJ A;  2EFO A;  4B09 A;  2OU2 A;  3P9K A;  4Q4Z F;  2EJR A;  1YYV A;  4OIR F;  2ISZ A;  2JPB A;  3KP5 A;  2CO5 A;  1T39 A;  2XKP A;  4ETS A;  2JTV A;  1OMI A;  3ZP5 A;  5LGU A;  1TNS A;  1IW7 F;  4CXF A;  4AWX B;  2Q2E A;  2EV0 A;  1J2X A;  4MNU A;  4RB2 C;  5K5O A;  2LSO A;  2M30 A;  4UV8 A;  4BHP A;  2J5O A;  1EH7 A;  2Y48 A;  1HW2 A;  4RB3 C;  5A2Q K;  1TQM A;  4L5I A;  2XRO A;  1TLH B;  2ZKZ A;  4P5O A;  1O3T A;  1BN5 A;  4AVP A;  2X0L A;  5DCF A;  1V4R A;  3LA2 A;  1KU7 A;  4MTD A;  2Z99 A;  4CYD A;  5AIP A;  5TJJ A;  2YPR A;  3WTW C;  2FBI A;  2GXB A;  1IXS B;  4BYY A;  4BXU A;  3Q5F A;  3OOP A;  5E20 A;  3MAJ A;  3HSF A;  3I58 A;  2DPD A;  3ZN1 A;  1AWC A;  1B1B A;  2VXZ A;  3QU6 A;  2D2W A;  3KP2 A;  1WSU A;  2AXL A;  3TDZ C;  1OPC A;  5D5W B;  2ESH A;  3EUH A;  3WU0 A;  2GIV A;  5LHG A;  3DPL C;  4KA4 A;  3J80 Z;  1RUO A;  3IWZ A;  1U3E M;  1CF7 A;  2Z5U A;  3GZ6 A;  5ICE A;  2P6T A;  1OKR A;  2EA4 A;  5J8F A;  2LDU A;  2DPU A;  3CDH A;  5LHH A;  3E6C C;  4M9X A;  3FXQ A;  2MH2 A;  2Y75 A;  1ZH5 A;  2PEX A;  3NEU A;  2ZFW A;  1ZG3 A;  4HLX A;  4P9U A;  2OZ6 A;  2G7H A;  4Y17 A;  4ESJ A;  2CG4 A;  4ASN A;  4EVI A;  4RAZ A;  1XB4 A;  4HX4 A;  2H94 A;  4BQA A;  5JI6 A;  2L54 A;  3KP7 A;  1A04 A;  3B73 A;  3M7G A;  4KIC A;  4FT8 A;  5H20 A;  1SFE A;  4LK1 F;  3QPT A;  2NS0 A;  3KLN A;  3TO6 A;  4GYI A;  2K27 A;  3F8N A;  3MQ0 A;  4XSZ F;  3LFK A;  2DAO A;  4R79 A;  1XGS A;  4I09 A;  2F5E A;  1PUE E;  2XUB A;  1I6X A;  1KQ8 A;  2VBY A;  1U5T B;  1QQI A;  3QP5 A;  4ZH4 F;  3R0A A;  1R36 A;  2VON A;  2DTR A;  1TBX A;  1KU9 A;  2LKP A;  2W84 A;  3ABT A;  3QP6 A;  1HST A;  2DW4 A;  2D1V A;  1FP1 D;  3WTY C;  2BBY A;  3BJ6 A;  3C3W A;  2CW0 F;  2K86 A;  1MDM A;  2STW A;  4XSX F;  2KIF A;  2R7F A;  1IN5 A;  3DXJ F;  2M8E A;  1J0R A;  1G3T A;  1XDU A;  2OZU A;  4UV9 A;  3HRM A;  2GA1 A;  3KLO A;  5FLX K;  4A0X A;  1FBS A;  1UHW A;  4LK0 F;  1IZ1 A;  1J9I A;  1JE8 A;  2EV5 A;  4P9F A;  5CVR A;  1YIO A;  2FE3 A;  4ZZL A;  3HHG A;  5CVJ A;  3MZH A;  1BJA A;  3C18 A;  4IXA A;  3DP7 A;  5HDK A;  2QBY B;  1W5S A;  1HKS A;  1QPM A;  4IHT A;  4A12 A;  1G4D A;  3NRV A;  4MHG A;  2DFI A;  1O7L A;  1W7P A;  4O6J A;  3L09 A;  5H6R A;  2K02 A;  3HTU A;  1XSD A;  5HLG A;  3SZT A;  3COA C;  2AS5 F;  2B0L A;  5BMZ A;  2L01 A;  5IT9 K;  1B59 A;  4UVC A;  4BHB A;  4L9V A;  3TOB A;  4ZYD A;  3K0L A;  5F64 A;  3G3Z A;  1LNW A;  3F8M A;  2OA4 A;  1MZB A;  1H9G A;  4NQW A;  1J7K A;  3E6B A;  3RPQ A;  2DLL A;  4I02 A;  4GO1 A;  2KJB A;  3WTU C;  3BP8 A;  3QAH A;  2EFW A;  2CGP A;  1JHF A;  2W25 A;  4LB5 A;  1ZRF A;  1T0F A;  4EMS A;  4A6D A;  5D8K B;  2DO7 A;  2P5K A;  3LQQ A;  2WC2 A;  4JK1 X;  5CVU A;  2YSR A;  4HDU A;  1ZGA A;  2TDX A;  3ZN0 A;  4HV5 A;  3F8B A;  1XN7 A;  1HSJ A;  4IF4 A;  1XCB A;  2ACJ A;  5ED4 A;  2VBX A;  1YW8 A;  3BPX A;  1LJ9 A;  4N0B A;  4WXC A;  3V8J A;  2ZBK A;  2HQR A;  1K78 B;  4OIP F;  1T38 A;  2E1C A;  4OMY A;  4UHT A;  1SD6 A;  4WX9 A;  1SMT A;  1XD7 A;  2NNY A;  1TW3 A;  2EV6 A;  5HLH A;  2O03 A;  4UXN A;  1EH6 A;  4AIH A;  1L3L A;  3FXR A;  2A6H F;  3LWF A;  2ESN A;  2CQK A;  2DI3 A;  2KIU A;  3RKX A;  5JFR A;  1IN4 A;  4YFN F;  1U8R A;  4A2U A;  1UB9 A;  2QM3 A;  3ISP A;  3VOD A;  4PGH A;  5FB2 A;  4N9H A;  2QWW A;  2GAU A;  1O3S A;  3CUQ A;  4P55 A;  1AOY A;  1I1S A;  1BI0 A;  1XSX A;  3CUQ C;  1KYW A;  3ELK A;  4KN4 X;  3L7W A;  3RKY A;  5BS6 A;  5ILV A;  3R4K A;  1Y0U A;  3I4P A;  3BRO A;  3I59 A;  3QOP A;  1FC3 A;  3RYP A;  2V1U A;  2CSO A;  4YFK F;  4WK8 F;  1ZLJ A;  5BOX A;  4L18 B;  3RI4 A;  4G9Y A;  1OYI A;  2W85 A;  1TW2 A;  2IA2 A;  5DCM A;  1K7A A;  2FNA A;  5D5X B;  3L9F A;  3J81 Z;  5L3G A;  4HF1 A;  3E5X A;  5D6F A;  3ZMZ A;  4HX8 A;  1T2K A;  5J8C A;  2HR3 A;  4XRF A;  3PFI A;  4GYG A;  2K4J A;  4RGU A;  2MA3 A;  2F5C A;  1BM9 A;  2DBB A;  3KCC A;  5DD8 A;  1WWX A;  2XAF A;  5FD6 A;  1HXD A;  2HYG D;  3NQO A;  2RV8 A;  2M1B A;  5DCM B;  3ZMD A;  1U5T C;  4ENK A;  1IXC A;  4ON0 A;  4I98 B;  4R8H A;  4S05 A;  1ONV A;  2DK5 A;  3R6S A;  1B4A A;  1FYK A;  3L2C A;  1R7J A;  2BE5 F;  5AIQ A;  5DV5 A;  4IJA A;  1HQC A;  1LEA A;  2O0Y A;  2OQR A;  3J81 K;  2G7U A;  3T8R A;  4U7D A;  5FD5 A;  3KEQ A;  2FOK A;  4CZZ A;  1QGP A;  3F8F A;  1TTY A;  2XAG A;  2FU4 A;  5HOO A;  1ZN2 A;  3V8L A;  4YFX F;  3F22 A;  3KP4 A;  4QWQ A;  2O61 A;  4G8X A;  1KQ0 A;  2MD5 A;  5ERI A;  1HW5 A;  1ZAR A;  2FSW A;  5HS7 A;  4GXO A;  4LLG F;  3FF5 A;  3IC7 A;  4B8X A;  3LST A;  3KE2 A;  3GZ5 A;  1MD0 A;  4O3M A;  1LVA A;  3FXU A;  2OD5 A;  3IWF A;  1BIA A;  4Y15 A;  4Q5S F;  2H09 A;  1F5T A;  4EJU A;  2ZXJ A;  1P4X A;  2KIM A;  4KDP A;  2ZNY A;  2DK8 A;  3E5Q A;  3WGH A;  1RIO H;  2VOO A;  1SD7 A;  3VFZ A;  4CO8 A;  3BJA A;  3IL2 A;  5DUK A;  1DUX C;  2XAS A;  1S7O A;  4KIF A;  1E17 A;  4YIF A;  1LQ1 A;  3HTS B;  1D5V A;  2JSC A;  3O2P E;  2QUF A;  3BJO A;  1W7P B;  4KUM A;  2HYF A;  3CUO A;  4L9J A;  5E17 F;  1G3W A;  4GCV A;  1C0W A;  1FPQ A;  2E7X A;  2IRF G;  4EJO A;  3GFM A;  1W5T A;  2STT A;  2WWY A;  1FWZ A;  1ODD A;  2HTJ A;  4ZYH A;  1Z05 A;  1O3R A;  2PLY A;  1B6A A;  4CGZ A;  4G7O F;  1ZRD A;  3GUD A;  4O5V A;  4U7B A;  3HRT A;  4N9I A;  3SZP A;  2GA2 A;  2EK5 A;  4ZZD A;  2KRF A;  2DT5 A;  3RYR A;  1FX7 A;  1KQ9 A;  1D8K A;  1B9N A;  1FYL A;  5L3C A;  3D5L A;  4IHS A;  1ZLK A;  1QZZ A;  4CDG A;  2M45 A;  5L3E A;  4LFU A;  3ZPL A;  1VTN C;  5K5Q A;  4A5N A;  3T0Y A;  3V4G A;  2EFP A;  2RNJ A;  2D45 A;  4RB1 A;  1REP C;  5FFX A;  4MQV A;  2XIG A;  3TO7 A;  5LHI A;  4KMF A;  2P5L C;  1YO5 C;  3GF2 A;  3LQR A;  2HTS A;  4RS8 A;  2VC0 A;  2O8X A;  4HF0 A;  3JAM K;  3WTV C;  2EFN A;  1MJA A;  1RZ4 A;  3ROU A;  2MH9 A;  1RNL A;  2HEO A;  4G6Q A;  2QQA A;  5EEH A;  2O3F A;  4Q48 A;  3MWM A;  1XDS A;  4KFC A;  2FBK A;  4M73 A;  4BAY A;  1HKQ A;  4A5M A;  2OBP A;  4Q47 A;  3I71 A;  1IAW A;  1P4A A;  3EYI A;  2E1N A;  1BC7 C;  3GWZ A;  5L3F A;  4OU0 A;  4KYW A;  5J6X A;  4XLN F;  3H92 A;  1STZ A;  1EV7 A;  4ENJ A;  4XBF A;  1F1Z A;  3L00 A;  1IXR C;  2VT3 A;  3ECO A;  3GEZ A;  3V7C A;  4A0Z A;  3C7J A;  1KGS A;  2HDC A;  5A2Q Z;  2DQR A;  1ON1 A;  3KEO A;  3TDU C;  3ERE D;  2QLZ A;  2WTE A;  1R5G A;  3S2W A;  1U5T A;  2Q0O A;  2XRN A;  2VC1 A;  4I01 A;  4LD5 A;  5ICG A;  4GGG A;  1R5H A;  1O7F A;  2RN7 A;  1FT9 A;  1UST A;  3CJN A;  1GVJ A;  3WTT C;  3R60 A;  4IRG A;  4YG2 F;  3Q9V A;  1YTY A;  1UFM A;  2ISY A;  2IT0 A;  3TO9 A;  2A6E F;  4LG0 A;  1R22 A;  1FBU A;  3T5X A;  2L4M A;  1FSE A;  3ECH A;  4IPA A;  4Z2Y A;  2D1H A;  2ZME A;  3WTX C;  2P4W A;  2LF7 A;  4FHT A;  2P7C B;  4G7H F;  1DDN A;  4IRI A;  2VBW A;  2QEN A;  3K69 A;  1FZP B;  4HF2 A;  4M6X A;  1R1T A;  5LEJ A;  1FNN A;  2CWE A;  2J5P A;  3KFW X;  3KZZ A;  2E7W A;  2FA5 A;  1FSH A;  3ZMS A;  2COM A;  1ZHF A;  3I5U A;  3MZY A;  3K1P A;  2ZNZ A;  3T8T A;  1ZRE A;  2IP2 A;  3E6D A;  4EM1 A;  2Q8K A;  3HYI A;  3QU3 A;  1WQ2 A;  2JPC A;  2NAZ A;  4EJW A;  1FP2 A;  2O6G E;  3IHU A;  1QZY A;  2F5D A;  4AD9 A;  1YG2 A;  2MC3 A;  2GXG A;  1ULY A;  3CUQ B;  4BH9 A;  4L9T A;  3CO7 C;  1U6G A;  1SFX A;  2YR2 A;  4M9Z A;  1XSV A;  3WU1 B;  5DUI A;  5TRD A;  2NRA C;  3FMQ A;  2HFH A;  1X3U A;  2H6B A;  1YFH A;  3HRU A;  4TV7 A;  2CFX A;  4KT5 C;  4OOI A;  1DPU A;  5E1W A;  1JHH A;  1OR7 A;  3K1N A;  3KZY A;  3LA7 A;  4AIJ A;  2VE8 A;  1P92 A;  2L02 A;  3MFK A;  1MKM A;  3PQJ A;  4KMU X;  4HQE A;  4L9N A;  4HW0 A;  2EA2 A;  2M5W A;  4RAY A;  3ZMT A;  2L4A A;  1B9M A;  1LDD A;  3GXO A;  1D3Y A;  1JXS A;  1HW1 A;  4M71 A;  2K4B A;  1BI2 A;  4WF2 A;  1Z1D A;  5DD4 A;  3F6V A;  2EWN A;  5K1Y A;  4HYE A;  4LJZ F;  3F8C A;  3P7N A;  1LDJ A;  2BYV E;  1SFU A;  2XKO A;  1YQA A;  5ILU A;  4EV0 A;  4HAM A;  3DPT A;  4U0V A;  4FX0 A;  2QQB A;  1DPR A;  2PI0 A;  3JW4 A;  2HKO A;  1SD5 A;  4WWC A;  3TOA A;  1O3Q A;  5BPI A;  1KU3 A;  5DEQ A;  3AAF A;  5HDG A;  5D8L B;  1CF7 B;  3E5U A;  3LA3 A;  4UUV A;  3ZMU A;  2FNP A;  1FYM A;  1K78 A;  2Z33 A;  3H3Z A;  2FML A;  4XLP F;  1MGT A;  4E70 A;  1V3F A;  2IA1 A;  3IKT A;  3N97 A;  1K79 A;  3MCZ A;  1XGN A;  2MBF A;  1RUN A;  3LAP A;  1R1U A;  2P8T A;  2P6S A;  1CGP A;  1IRG A;  2YX7 A;  5L3B A;  1BIB A;  2W24 A;  3I64 A;  3WGI A;  1FLI A;  1USS A;  3CTA A;  4U88 A;  2PFB A;  4UVA A;  1H0M A;  4PDK A;  3VB2 A;  4KNY A;  3REO A;  5HVQ C;  3VOE A;  2FEZ A;  5D4R A;  4DQ2 A;  4CIC A;  2PMH A;  1ZG1 A;  2CYY A;  4HQM A;  3SHF A;  4Y13 A;  3C1D A;  2BEO A;  5FLX Z;  2PQ8 A;  2WV0 A;  1E2X A;  4LLL A;  1P2F A;  1FOK A;  3F21 A;  2K7L A;  2VT2 A;  1ON2 A;  3M8F A;  2HKX A;  1U78 A;  4HZF A;  1RI7 A;  3HRS A;  3JTG A;  1GHC A;  3FMR A;  2A3S A;  1QO0 D;  3JSP A;  4KIG A;  4MEX F;  3TGN A;  3R0J A;  3U1D A;  1J59 A;  3DF8 A;  4LLN A;  1R58 A;  2HZT A;  1TQI A;  2HWV A;  2BGC A;  5LLQ A;  5CYV A;  2A68 F;  5ILS A;  2IJL A;  2FF4 A;  2IPQ X;  3E3V A;  3HOT A;  4OMZ A;  1IN8 A;  4LG0 B;  2PBI A;  4HV6 A;  2A69 F;  4LGW A;  3W6J B;  2JRT A;  2ZO4 A;  2FQ3 A;  2HQN A;  2FBH A;  2HS5 A;  3EDP A;  2XVC A;  1G6N A;  4U0Y A;  1WKM A;  4PZJ A;  2V1X A;  1S7A A;  1T6S A;  5BPD A;  3LAJ A;  3SQN A;  3K9T A;  3FHZ A;  3HIF A;  2Z9O A;  2ZME B;  2M87 A;  1YW9 A;  3SFZ A;  3B02 A;  3T1B A;  4ESF A;  1BI1 A;  1KU2 A;  4I2O A;  1F9N A;  4BNC A;  3D0S A;  3Q9S A;  3RKW A;  3GX4 X;  3ZQ7 A;  1HBX G;  2GQQ A;  1GXP A;  4MGR A;  1OYW A;  1I27 A;  4FX4 A;  1PP8 F;  1KYZ A;  3DEU A;  3FWE A;  2XAH A;  4U0W A;  5IT9 Z;  3M9A A;  2RKH A;  1MDM B;  5CJ9 A;  1IRF A;  3E97 A;  2C6Y A;  4MTE A;  3ABU A;  3KET A;  1XMA A;  4I0A A;  3HSE A;  4EM2 A;  2V1D A;  2YU3 A;  4IVN A;  3QPH A;  1S29 A;  5AON A;  1J5Y A;  1FY7 A;  2ZJ2 A;  5D6E A;  5E8I A;  2V6C A;  3F23 A;  3EYY A;  5CVV A;  1R00 A;  2QVO A;  5JHU A;  2P7V B;  2DQL A;  2NYX A;  1BI3 A;  1XMK A;  4PGG A;  4DNC A;  1Z9C A;  2KKO A;  5HS9 A;  4ZYG A;  1DP7 P;  3K2Z A;  1P4W A;  2XAQ A;  3ULQ B;  2RGV A;  4G94 A;  2P5V A;  1I1G A;  1HKT A;  1SD4 A;  1PP7 U;  2W57 A;  4UVB A;  5HS8 A;  5EEG A;  3N4M A;  1QBJ A;  2QYO A;  3TQN A;  5KVR A;  2VBZ A;  3BZ6 A;  4HDV A;  3M1E A;  3I0T A;  2EFQ A;  1TNT A;  1IF1 A;  1KA8 A;  3E6M A;  3OV8 A;  2XV4 S;  2GZW A;  2FRH A;  4RGR A;  3I53 A;  4WXD A;  1Z7U A;  4KN7 X;  4EQQ A;  3V8K A;  3H3U A;  2MLK A;  2KJC A;  4EGZ A;  1G3S A;  3SXY A;  2QBY A;  2L3D A;  2OQG A;  4P96 A;  2HGC A;  2DU9 A;  3GO5 A;  4HA8 A;  4S04 A;  4R1H A;  3IRQ A;  3BOQ A;  4YII A;  1NHA A;  3DV8 A;  1BOA A;  2VOD A;  6PAX A;  1XCV A;  1K6O A;  3ML6 A;  1ZYR F;  3BPV A;  4ZYE A;  3VEP A;  4F7Z A;  1LEB A;  1QNT A;  2ETH A;  4A0Y A;  4CHU A;  2RVC A;  2VN2 A;  2OAZ A;  2RC4 A;  4HLY A;  1FBQ A;  3DKW A;  4M9S A;  3J80 K;  3R61 A;  3RJP A;  2JZY A;  4RB0 A;  1L0O C;  5HDN A;  2UXX A;  4M6Y A;  1LDK B;  4MEY F;  2YX4 A;  5L3D A;  3BY6 A;  2XGX A;  5JVT A;  5K5R A;  2VOP A;  2Y0M A;  4WXH A;  2IVM A;  5CLS A;  3IKV A;  1R1V A;  3GFI A;  3RTR A;  4LMY A;  1S6L A;  2FMY A;  1Z6T A;  4PCQ A;  1BC8 C;  3K1M A;  5BQT A;  4RGS A;  4G7Z F;  2ZCW A;  3F6O A;  1TQP A;  2R7D A;  4L0Y B;  5LGN A;  3RDI A;  1MJB A;  5F1R A;  3KP3 A;  1Q1H A;  4ENM A;  3GYH X;  3FZV A;  5JR3 A;  1PDN C;  1I5Z A;  1IUY A;  4JQF A;  2X4H A;  1SAX A;  3GLX A;  5D5V B;  2F5F A;  3F72 A;  5H6Q A;  1Z6R A;  1D8J A;  4L0Z B;  4OIO F;  1T98 A;  2EB7 A;  3WE2 A;  4D0P A;  5E1X A;  3GFJ A;  2A07 F;  2QQ9 A;  5KK1 A;  3FMS A;  5DYM A;  3HHH A;  3O6B B;  3WG9 A;  1WRJ A;  4RGX A;  4I0B A;  2PJP A;  1EH8 A;  2FXA A;  5FO5 A;  3WGG A;  4LB6 B;  3WE3 A;  2GWR A;  3WTS C;  1W4M A;  2H27 A;  3V7S A;  5HLI A;  4UNO A;  4ESB A;  3HUG A;  5FGM A;  3PQK A;  2HOE A;  1GXQ A;  5LGT A;  1XGM A;  3FM5 A;  5IT3 A;  3V7R A;  1XGO A;  3EET A;  1ZRC A;  2V79 A;  1SMY F;  2MLG A;  5DDG A;  2PMU A;  1O57 A;  1P6R A;  2RQP A;  3HSR A;  3U2R A;  2IA0 A;  1ZG5 A;  2BV6 A;  3JAM Z;  3RIR A;  2A61 A;  4AIK A;  3FX3 A;  5D5U B; 
#chains in the Genus database with same CATH topology
 3G73 A;  3PM1 A;  2QKM B;  2XHK A;  2M34 A;  4XOR A;  4MQ9 F;  2YU9 J;  2UWM A;  2JT1 A;  2NNN A;  1S3J A;  3BTL A;  4PFO A;  3H1C A;  2PN6 A;  4PJL A;  2X6W A;  1BBY A;  3F3X A;  2M7A A;  5E18 F;  3OYB A;  4KT6 A;  3HEF A;  1CQT A;  4JX6 A;  3OL3 A;  4XN0 A;  3ZMV A;  5DM6 F;  4JX4 A;  2LK2 A;  3FK7 A;  3BDD A;  4PJ0 C;  1S8N A;  3IP4 B;  4XKC A;  1RPW A;  4KIB A;  2F2E A;  2H6C A;  5KNL A;  2V7F A;  1V55 H;  3DFG A;  5LBQ A;  2CUZ A;  4WCG A;  2ELH A;  3JSO A;  1D0Z A;  3JRC A;  3MEX A;  1ZGJ A;  2W00 A;  1AHD P;  4BHC A;  3S2D J;  4FET A;  1R49 A;  1BW6 A;  2CQN A;  1F4K A;  1QA6 A;  2IW5 A;  4IZZ A;  1UEL B;  1TWH J;  1JGS A;  3OIO A;  4ZDL A;  1XMX A;  1Z91 A;  3S1M J;  3CF2 A;  5ICF A;  1W1W E;  5LEK A;  3WTZ A;  2E2J J;  2VPL A;  1U9O A;  3RPU A;  3MKY B;  3OYL A;  2RDP A;  1Y1W J;  2R3S A;  3IRR A;  4A3F J;  1I6H J;  4EJV A;  2IGO A;  2XGC A;  3A4C A;  4HX7 A;  2HI3 A;  2L9N A;  4RAF A;  3U9G A;  1U2W A;  1ETY A;  3TP0 A;  3BWG A;  5LRR A;  4HST A;  2Z3Y A;  4BDZ A;  3HOS A;  1UCR A;  5FFZ A;  5FRN A;  3E1S A;  4HOB A;  2IS2 A;  1IN6 A;  2BY3 A;  3GVA A;  2DJN A;  3GW2 A;  4IOA F;  2G9W A;  4I7H A;  4M3G A;  5LRS A;  5EGO A;  2HPM A;  4C9Y A;  1W7P D;  1ZTR A;  3I9V 2;  4D5F A;  2F6C A;  3CC4 I;  2PG4 A;  4LG3 A;  4B44 A;  1IJW C;  2DCE A;  4M72 A;  3O3K A;  2FUG 2;  4NHJ A;  1R23 A;  1ZGW A;  1WPK A;  2LF8 A;  3W6K B;  5CVI A;  4EJT A;  1MH3 A;  1TT0 A;  1OCT C;  2GXA A;  4BUP A;  1X19 A;  4UUS A;  4FE4 A;  4H0E A;  3P9I A;  2E2I J;  1VQ6 I;  2A5Y B;  4XL9 A;  3SDG A;  4OIN F;  1J75 A;  1MJ9 A;  1OYY A;  3OR1 C;  1UHM A;  1ZAO A;  4EM0 B;  1YJN I;  4C3J J;  4HSR A;  1Z7L A;  1YI2 I;  4HBL A;  3CLO A;  3M8E A;  5E8G A;  2ADU A;  1QU3 A;  1ETQ A;  2UZK A;  2EZI A;  1ZR2 A;  1PUF B;  2QZ8 A;  1VQM I;  3BR1 A;  3C2H A;  3V42 A;  4C3I J;  2EZL A;  2EIL H;  2V26 A;  4IRH A;  3TKY A;  5ICC A;  4QLC U;  1G3Y A;  4L5E A;  3DQV C;  1JUP A;  5DS9 A;  4Y7N J;  4OIQ F;  3WOD F;  4A6E A;  4ENN A;  3GFL A;  4M74 A;  3ZQH A;  1YS6 A;  3FM3 A;  3I54 A;  3CCV I;  1X1C A;  3BG9 A;  4UUT A;  4G6D A;  4BS9 A;  2F4M B;  4EGY A;  3MN2 A;  4XLH A;  4NB5 A;  1LB2 A;  3KP6 A;  3CJT B;  1X1B A;  2VE9 A;  3CLQ A;  3QRF F;  1W0U A;  4L5J A;  3I59 B;  1FOX A;  1AKH A;  1YW7 A;  5E1Z B;  2CV2 A;  3JTH A;  1OCR H;  2FD5 A;  4AU7 A;  4X6A J;  4A3E J;  2EIN H;  1H9T A;  1IN7 A;  3J7A O;  2LNB A;  4JBA A;  2Q1Z B;  1WI9 A;  1YLF A;  3CCJ I;  5D4S A;  1OQY A;  5CPR B;  3WU2 C;  4BJ6 C;  2E35 A;  4BY7 J;  4K2E A;  3P9C A;  2Q2E B;  4V2G A;  4AVZ A;  2FOW A;  1OJL A;  2UXN A;  3EQL F;  4M3E A;  5C44 J;  5F6F A;  3CO6 C;  2V9V A;  1YS7 A;  4E6K G;  1LE8 B;  2XAJ A;  2EFO A;  4B09 A;  2OU2 A;  3P9K A;  4D5C A;  4Q4Z F;  4Z6Y A;  1RRJ A;  2EJR A;  2PMZ A;  1YYV A;  4OIR F;  4IOC F;  4XM3 A;  2ISZ A;  1JUS A;  3QYB A;  3JRH A;  2JPB A;  4NQW B;  2XF6 A;  2CO5 A;  3KP5 A;  1WGX A;  1T39 A;  2XKP A;  2LKX A;  4ZTF A;  4ETS A;  5HOD A;  3DCF A;  2JTV A;  1OMI A;  3ZP5 A;  1WHU A;  5LGU A;  1TNS A;  3MD2 A;  1IW7 F;  3K4L A;  1HDD C;  3BR2 A;  3O8H A;  4XR6 A;  3VSK A;  4CXF A;  3N05 A;  2F48 A;  4AWX B;  2Q2E A;  2EV0 A;  1J2X A;  4MNU A;  5K7F A;  1X2M A;  4DYQ A;  3HPG A;  4JOM A;  5JLW A;  1Z21 A;  4RB2 C;  4A3D J;  5K5O A;  2LSO A;  2M30 A;  3DU5 A;  4UV8 A;  1GT0 C;  2LYC A;  4BHP A;  2J5O A;  4DZJ A;  1EH7 A;  3ABM H;  1ETX A;  4IHY A;  5HLT A;  2LD5 A;  2Y48 A;  1HW2 A;  1IG7 A;  4RB3 C;  5A2Q K;  1JKP C;  4MLO A;  2OV7 A;  1TQM A;  4L5I A;  5GAH J;  2M9H A;  4XON A;  2XRO A;  2N8G A;  1TLH B;  1WJB A;  2ZKZ A;  4P5O A;  3PNT A;  1VI0 A;  1O3T A;  2PJR B;  1BN5 A;  2R93 J;  3F9K A;  2E19 A;  4AVP A;  2X0L A;  4OWR B;  1VQN I;  3HKZ A;  5DCF A;  1V4R A;  3BG6 A;  3LA2 A;  1KU7 A;  4MTD A;  1OR7 C;  2JUG A;  2Y9Z A;  3DTI A;  2Z99 A;  4CYD A;  3K4M A;  5AIP A;  4FQG A;  5TJJ A;  2YPR A;  2DYR H;  3HL2 A;  5EG0 A;  3WTW C;  2FBI A;  2GXB A;  1IXS B;  4BYY A;  2ZSH B;  4BEH B;  4BXU A;  4D9J A;  3ZQF A;  1TWC J;  5TGT A;  3Q5F A;  4KIS A;  3PFY A;  1Y6I A;  2IS1 A;  3OOP A;  5E20 A;  3A01 B;  2P81 A;  3BR5 A;  2TCT A;  4BE1 A;  1B72 B;  3MAJ A;  3HOZ J;  3HSF A;  1HOM A;  3I58 A;  2DPD A;  3G71 I;  3ZN1 A;  1AWC A;  3PSI A;  1W5C C;  4LIT A;  1B1B A;  4AUX A;  2WAE A;  2VXZ A;  2LRD A;  3QU6 A;  3OS0 A;  1G2H A;  2K3F A;  2AQF A;  2W1O A;  3HOW J;  1OFC X;  2D2W A;  3TP3 A;  1Q1V A;  3JRD A;  3KP2 A;  1WSU A;  2AXL A;  3EUK L;  3ERM A;  1SVL A;  2VXD A;  3TDZ C;  2E1M C;  3BR3 A;  3TW7 A;  3FDY A;  3RCO A;  2LKS A;  1OPC A;  5D5W B;  3SYT A;  2ESH A;  4FE7 A;  3SEQ A;  2R5Z A;  1MMS A;  3EUH A;  3WU0 A;  2GIV A;  5LHG A;  3DPL C;  4KA4 A;  3J80 Z;  3W3C A;  1RUO A;  3O8G A;  3IWZ A;  1B72 A;  1QHH D;  1U3E M;  2L2O A;  1YJ9 I;  2NS7 A;  1CF7 A;  1D1B A;  2Z5U A;  3GZ6 A;  3H3V K;  2NVU B;  3RPU D;  5ICE A;  4BJT A;  3HUG B;  2CFO A;  2P6T A;  3OYJ A;  3JRB A;  1OKR A;  3WHC A;  2L7F P;  2EA4 A;  5J8F A;  2LDU A;  2VJ4 A;  2DPU A;  3UNG C;  5E3N A;  3CDH A;  5LHH A;  3E6C C;  3LSK A;  1IDZ A;  3JR9 A;  4M9X A;  3FXQ A;  3OYD A;  2MH2 A;  1J09 A;  4CYC B;  1P7I A;  2Y75 A;  1ZH5 A;  2PEX A;  2CV1 A;  3NEU A;  1R9T J;  2DOE A;  2VQH A;  2ZFW A;  3ZQI A;  1ZG3 A;  1XTA A;  3S1Q J;  2KRC A;  4HLX A;  4P9U A;  2OZ6 A;  2G7H A;  4Y17 A;  5FKO A;  4ESJ A;  2LBF A;  4DW6 A;  2CG4 A;  4Y3O A;  4ASN A;  4EVI A;  4PJM A;  2L0K A;  4MO7 A;  2DN0 A;  4RAZ A;  4CCN A;  4DIQ A;  4D7N A;  1XB4 A;  4HX4 A;  3H9Q A;  1ZK8 A;  2H94 A;  4XKV A;  5JI6 A;  2L54 A;  4BQA A;  4ZTJ A;  3KP7 A;  1A04 A;  3B73 A;  3DKY A;  3H5A A;  3M7G A;  4KIC A;  4FT8 A;  1VQ7 I;  4XKB A;  5H20 A;  2KLO A;  4A3M J;  1SFE A;  2BW3 B;  2DT6 A;  2ID3 A;  4LK1 F;  3QPT A;  2NS0 A;  3E7L A;  3DEW A;  3KLN A;  3TO6 A;  3QPL A;  3AFH A;  3OYE A;  1JTY A;  4GYI A;  1TWG J;  2R7X A;  2K27 A;  3F8N A;  3MQ0 A;  4XSZ F;  4IHW A;  3LFK A;  2DAO A;  3SJM A;  4R79 A;  4XRM A;  1XGS A;  2BVL A;  2D5V A;  4I09 A;  3TBI A;  2F5E A;  1PUE E;  2XUB A;  1I6X A;  3JRF A;  1KQ8 A;  2VBY A;  3I56 I;  4A3I J;  1U5T B;  1QQI A;  3QP5 A;  4ZH4 F;  4E7K A;  2YS9 A;  3R0A A;  2HOT A;  1R36 A;  2VON A;  2DTR A;  1SFO J;  4RAG A;  5KCM A;  1TBX A;  3W2V A;  1KU9 A;  2LKP A;  5LFA A;  3OMY A;  2OJE D;  1DU6 A;  2UV1 A;  2W84 A;  2JN6 A;  4BE0 A;  3DBR B;  2XDV A;  3ABT A;  3QP6 A;  1HST A;  3AL0 C;  3H36 A;  2DW4 A;  2NOJ B;  2D1V A;  3H9G A;  1FP1 D;  4E7S A;  3WTY C;  2BBY A;  4IKF A;  3PIP F;  2R4G A;  3BJ6 A;  3C3W A;  2CW0 F;  1O4X A;  2K86 A;  3L2Q A;  1MDM A;  2STW A;  4XSX F;  2KIF A;  2R7F A;  1IN5 A;  3OYA A;  3DXJ F;  2M8E A;  1J0R A;  1G3T A;  2HDD A;  3MKL A;  1XDU A;  2OZU A;  2Z16 A;  4XOT A;  1M1E B;  4IL6 C;  1JT6 A;  4XLC A;  3NWS A;  4UV9 A;  1G8X A;  3HRM A;  1MBE A;  2GA1 A;  2WAQ A;  3KLO A;  5IOY A;  3K10 A;  4H4K C;  5FLX K;  4A0X A;  1FBS A;  2LY1 A;  1UHW A;  5IPA A;  1YIT I;  1JKO C;  3CCL I;  1VND A;  4LK0 F;  3HG9 A;  1X58 A;  2HU9 A;  4YEJ A;  1ENH A;  2P0W A;  1IZ1 A;  1J9I A;  1JE8 A;  4UY8 I;  3ZQQ A;  2EV5 A;  4P9F A;  1FTZ A;  5CVR A;  1YIO A;  2FE3 A;  5EG0 B;  4ZZL A;  3HHG A;  5CVJ A;  3MZH A;  4DOZ A;  1BJA A;  3C18 A;  4IXA A;  3DP7 A;  1VQ9 I;  5GTI C;  5HDK A;  1VQ8 I;  2WV1 A;  2QBY B;  1W5S A;  3I55 I;  1HKS A;  1QPM A;  1PUF A;  5F27 A;  2XB0 X;  1RKW A;  3ABK H;  2VAS A;  4A12 A;  3BG3 A;  4IEJ A;  3NRV A;  1G4D A;  3QOE A;  4IHT A;  3ABL H;  3OY9 A;  2F4O B;  4MHG A;  2DFI A;  1O7L A;  1W7P A;  2BXZ A;  4O6J A;  3L09 A;  3S3O A;  1WZ2 A;  2K40 A;  5H6R A;  3VYU B;  2K02 A;  3HTU A;  1XSD A;  5HLG A;  2W82 A;  2I8D A;  3SZT A;  2H1L A;  3COA C;  1ETO A;  4DBQ A;  2AS5 F;  3CDI A;  5FRM A;  2B0L A;  5BMZ A;  2L01 A;  3L2V A;  2IEK A;  2VPR A;  3DKX A;  4CCO A;  2XF7 A;  2H1K A;  3LL7 A;  3CCR I;  5IT9 K;  1B59 A;  4UVC A;  4BHB A;  1K6Y A;  3J7Y J;  4L9V A;  4C3H J;  4KJZ A;  3TOB A;  4ZYD A;  3K0L A;  5F64 A;  3G3Z A;  1LNW A;  3CES A;  4BBR J;  2VL8 A;  3F8M A;  2OA4 A;  3BQZ A;  1R4M B;  4A3L J;  2XPW A;  1MZB A;  4ZDO A;  1FTT A;  2L5Q A;  3DPU A;  4E7H A;  3EPZ A;  3S15 J;  3ZQL A;  3LSI A;  3CMY A;  1H9G A;  2MG4 A;  4NQW A;  1J7K A;  4U87 A;  3E6B A;  3RPQ A;  2DLL A;  4A3B J;  4I02 A;  4II2 A;  1WJ5 A;  5C3E J;  4IHV A;  2H8W A;  4GO1 A;  2ZXW H;  5F0F A;  4GFB A;  5FLV A;  2Y9Y A;  1MND A;  5GPC A;  2CRG A;  2KJB A;  3WTU C;  3PUF A;  3PSF A;  3BP8 A;  3QAH A;  2EFW A;  2CGP A;  1JHF A;  1T08 B;  2VQL A;  2W25 A;  4LB5 A;  1ZRF A;  1T0F A;  4AYB N;  4EMS A;  1KZH A;  4NBQ A;  4A6D A;  5D8K B;  4KIT B;  1V5F A;  2DMN A;  2DO7 A;  2P5K A;  1E3H A;  3LQQ A;  4HNV A;  4DYR A;  3S3M A;  2VKD A;  2WC2 A;  4JK1 X;  5CVU A;  3ZOB A;  2YSR A;  5F04 A;  2DDB A;  4FIS A;  3OYH A;  1ZGA A;  2XGD A;  4HDU A;  2TDX A;  3ZN0 A;  4HV5 A;  4RLF A;  3BTI A;  3F8B A;  1XN7 A;  3VPR A;  1HSJ A;  4IF4 A;  1XCB A;  1DU0 A;  2ACJ A;  4XLA A;  5ED4 A;  2VBX A;  4W97 A;  1K83 J;  1YW8 A;  3BPX A;  1LJ9 A;  4N0B A;  4WXC A;  3V8J A;  2ZBK A;  2HQR A;  4S0H B;  4DJA A;  1VF9 A;  1K78 B;  4OIP F;  2FX0 A;  1T38 A;  2E1C A;  4OMY A;  4UHT A;  3CC2 I;  2OUM A;  1SD6 A;  4WX9 A;  2M8G X;  2G0E A;  1SMT A;  5EJC A;  1YRN A;  2NXN B;  2DOF A;  1XD7 A;  2NNY A;  3E0J B;  1TW3 A;  1NH3 A;  2EV6 A;  5HLH A;  2O03 A;  5E3M A;  4UXN A;  1EH6 A;  4AIH A;  3FXR A;  1L3L A;  5M3M J;  2A6H F;  2M4G A;  2ESN A;  3LWF A;  5B1A H;  3K70 D;  2CQK A;  2DI3 A;  4NDL A;  3TMO A;  2LY9 A;  2KIU A;  3RKX A;  5JFR A;  1IN4 A;  4YFN F;  1U8R A;  4A2U A;  2XPU A;  1UB9 A;  3RSN A;  2QM3 A;  3ISP A;  3VOD A;  4XRS G;  4BQQ A;  4PGH A;  3GBG A;  2VJ5 A;  4XNF A;  3B6C A;  4CSW A;  5FB2 A;  4N9H A;  4Y52 J;  5CQG A;  1YOV B;  2QWW A;  4D1Q A;  2GAU A;  3DLL F;  1O3S A;  2JVG A;  3WHB A;  2X9D A;  5GP9 A;  5J47 A;  1OCP A;  1E3O C;  3CUQ A;  4P55 A;  1H8A C;  1AOY A;  1YRN B;  1R71 A;  1I1S A;  1BI0 A;  1XSX A;  3CUQ C;  5TIS C;  1LFP A;  3D5R C;  2W48 A;  2BY0 A;  1KYW A;  3ELK A;  4KN4 X;  2EBI A;  3L7W A;  3RKY A;  2NOG A;  5BS6 A;  3R4K A;  5ILV A;  1Y0U A;  4RBO A;  1W0T A;  3I4P A;  2NVY J;  3BRO A;  3I59 A;  2LMD A;  1FC3 A;  3QOP A;  3RYP A;  2V1U A;  3S2H J;  2CSO A;  3OL4 A;  1RKT A;  2MW8 A;  2ZXI A;  4YFK F;  3S3N A;  4WK8 F;  1MMA A;  1ZLJ A;  3HZJ A;  4E7J A;  5BOX A;  4L18 B;  4F55 A;  3RI4 A;  4G9Y A;  3K4N A;  1OYI A;  1HC8 A;  3J7A Y;  2W85 A;  3S14 J;  1TW2 A;  2BVM A;  2IA2 A;  5DCM A;  2R7W A;  1FEX A;  1P9Q C;  1K7A A;  2R7T A;  2FNA A;  5D5X B;  2ZJP F;  3L9F A;  2JA5 J;  3J81 Z;  1JT0 A;  3FIS A;  5L3G A;  4HF1 A;  3S8P A;  3E5X A;  5D6F A;  3ZMZ A;  2LVS A;  4HX8 A;  1T2K A;  5E3L A;  5J8C A;  5J1R A;  2HR3 A;  2KDZ A;  4XRF A;  3BT9 A;  3DWL E;  3L2R A;  3PFI A;  4GYG A;  3PO2 J;  2K4J A;  1T56 A;  2WB1 A;  2MSY A;  5BNG A;  4XID A;  4RGU A;  1XG1 A;  2MA3 A;  2F5C A;  1BM9 A;  2DBB A;  1TT5 B;  3KCC A;  1QZE A;  2CUF A;  5DD8 A;  1WWX A;  2BW3 A;  2CH0 A;  2XAF A;  5FD6 A;  1HXD A;  2HYG D;  2LG4 A;  3NQO A;  2RV8 A;  2M1B A;  4A3J J;  5DCM B;  3ZMD A;  1U5T C;  4ENK A;  1P7J A;  1IXC A;  2K5C A;  4ON0 A;  1X2N A;  4I98 B;  1OCO H;  4R8H A;  1A6Q A;  4S05 A;  1ONV A;  1S7E A;  1FOW A;  2DK5 A;  3DLA A;  3R6S A;  1B4A A;  1FYK A;  4BL0 B;  3L2C A;  1R7J A;  3OYK A;  3SZG A;  3I4N J;  2BE5 F;  3BG7 A;  1N75 A;  5AIQ A;  5DV5 A;  1QPI A;  3HOU J;  4IJA A;  4DYC A;  2R0Q C;  1HQC A;  2RRE A;  1LEA A;  2O0Y A;  2V4J C;  1TWA J;  2OQR A;  2GOM A;  2ICW G;  3FBI B;  4QSH A;  4BU2 A;  3J81 K;  2G7U A;  3T8R A;  1IGN A;  1DP3 A;  5FKN A;  4U7D A;  2HXO A;  3QYE A;  5FD5 A;  2K9Q A;  3KEQ A;  2FOK A;  4CZZ A;  2VLA A;  2E60 A;  3JCU C;  1QGP A;  4BE2 A;  3F8F A;  3K4C A;  1TTY A;  2XAG A;  5J1Y A;  1WH5 A;  1ZN2 A;  1POG A;  2FU4 A;  2KL4 A;  3V8L A;  4YFX F;  5HOO A;  3F22 A;  3KP4 A;  3M07 A;  4QWQ A;  3VSL A;  5F1J A;  1Y39 A;  2L7Z A;  2O61 A;  4G8X A;  4J19 A;  2HDW A;  2M0C A;  1KQ0 A;  2R7Q A;  3S1N J;  1F43 A;  1KON A;  2MD5 A;  5ERI A;  4A3K J;  5J4Y A;  4BQO A;  3RKQ A;  3IAM 2;  1HW5 A;  1ZAR A;  2FSW A;  5HS7 A;  4GXO A;  4LLG F;  3BR6 A;  3FF5 A;  3IC7 A;  4B8X A;  3LST A;  4IX7 A;  3KE2 A;  3Q0V A;  3GZ5 A;  2JA6 J;  1SFK A;  4LIV A;  1MD0 A;  4O3M A;  1IO2 A;  1LVA A;  2OD5 A;  3FXU A;  3IWF A;  1BIA A;  2XRL A;  2E1M B;  3CP2 A;  4Y15 A;  4Q5S F;  2H09 A;  3W2W A;  1F5T A;  4Y4R A;  2Y0S N;  4EJU A;  2ZXJ A;  1P4X A;  2KIM A;  4KDP A;  2LR8 A;  2ZNY A;  2DK8 A;  3E5Q A;  3WGH A;  2BHZ A;  1RIO H;  4AYB A;  3KZI C;  4DGW B;  3LSG A;  3GTO J;  2HYJ A;  2VOO A;  1SD7 A;  2DFF A;  1GV5 A;  2UUZ A;  3VFZ A;  4CO8 A;  3BJA A;  1OCZ H;  3IL2 A;  5DUK A;  2XAS A;  1S7O A;  4KIF A;  1DUX C;  1E17 A;  4YIF A;  5GTH C;  1LQ1 A;  1FJL A;  3HTS B;  1AU7 A;  2IBD A;  1D5V A;  3VDX A;  2E71 A;  4XLE A;  2JSC A;  1Z3X A;  2VB6 A;  3O2P E;  2QUF A;  4ZYA A;  1MMD A;  2B63 J;  2O5R A;  1E3P A;  4EAT A;  3BJO A;  2DA4 A;  2MGQ A;  1W7P B;  2MD0 A;  4KUM A;  1ERD A;  2HYF A;  2JUC A;  3CUO A;  3LSH A;  1N77 A;  4L9J A;  5E17 F;  1G3W A;  4UUS B;  4GCV A;  2WY7 Q;  4CH7 A;  1C0W A;  4RDU A;  1FPQ A;  3H35 A;  2E7X A;  3CDL A;  5IYC J;  2IRF G;  4EJO A;  3CCM I;  5C4X J;  3GFM A;  1W5T A;  5EEA A;  4OAY A;  2E5N A;  3QYF A;  1K4S A;  2XB5 A;  2XSJ C;  2STT A;  2WWY A;  3CCQ I;  1FWZ A;  1YJW I;  1MMN A;  1ODD A;  2Y0S A;  5C4J J;  2HTJ A;  3A0H C;  4ZYH A;  1Z05 A;  4ZC3 A;  3GTQ J;  3ZQG A;  1O3R A;  2PLY A;  2E1O A;  1B6A A;  2NVT J;  4BAC A;  4G6T B;  3FIW A;  4F92 B;  2KIS A;  4CGZ A;  4G7O F;  4GDF A;  1SC7 A;  1PYV A;  3GUD A;  1YHQ I;  1ZRD A;  4O5V A;  3QQA A;  3BCB A;  4U7B A;  2R7Z J;  2V1N A;  3HRT A;  4N9I A;  1LFU P;  3K4B A;  1QRY A;  3SZP A;  4BQN A;  2GA2 A;  2EK5 A;  2HVQ A;  2Z1D A;  3HPH A;  2AQE A;  4ZZD A;  3I3L A;  2KRF A;  2DT5 A;  3RYR A;  3JRE A;  1FX7 A;  2Y31 A;  4AID A;  1KQ9 A;  1GDT A;  1D8K A;  1B9N A;  1FYL A;  2CJJ A;  2IGM A;  3D5L A;  5L3C A;  3S16 J;  4IQJ A;  2X48 A;  5JLX A;  4IHS A;  3K7A J;  3OYM A;  1ZLK A;  1QZZ A;  4CDG A;  2M45 A;  2DMQ A;  1WJD A;  3U21 A;  5L3E A;  5F0H A;  2O7O A;  2M7B A;  4LFU A;  3ZPL A;  4C2M J;  1VTN C;  5K5Q A;  4A5N A;  4XLF A;  3KYD B;  3T0Y A;  3V4G A;  1F36 A;  2IGK A;  2EFP A;  2RNJ A;  5M3F J;  2D45 A;  2PMZ N;  4RB1 A;  1MBG A;  1REP C;  2OC6 A;  3HXL A;  4MQV A;  2XIG A;  5FFX A;  3TO7 A;  1BR1 A;  5LHI A;  2ZJQ F;  4KMF A;  5J4V A;  2P5L C;  4XN3 A;  4J01 A;  1YO5 C;  3GF2 A;  2DOD A;  3LQR A;  2VJJ A;  3JRG A;  1Z67 A;  2KQR A;  4A93 J;  3ONQ A;  5M5Y J;  2JWT A;  2HTS A;  4RS8 A;  2VC0 A;  2O8X A;  4M3D A;  2PX9 A;  1T95 A;  2K3P A;  2WB1 N;  4HF0 A;  3JAM K;  3Q0U A;  3WTV C;  2EFN A;  1MJA A;  4G12 A;  1RZ4 A;  3ROU A;  2MH9 A;  1RNL A;  4NC6 A;  1R5I D;  1I50 J;  3L2U A;  4BJ5 C;  2HEO A;  4G6Q A;  3OSG A;  2QQA A;  3FXL A;  2JJ7 A;  1NG6 A;  2XGE A;  5EEH A;  1JKR C;  4RM2 A;  2O3F A;  2VKH A;  4Q48 A;  3MWM A;  1XDS A;  5FKK A;  4KFC A;  1UJ8 A;  2FBK A;  4M73 A;  2X51 A;  4BAY A;  2ELJ A;  1HKQ A;  4A5M A;  1IC8 A;  1Y8R B;  2OBP A;  4Q47 A;  3I71 A;  1IAW A;  1P4A A;  3H5R A;  3VYT B;  2DDA A;  4YRV A;  3EYI A;  2JRM A;  2E1N A;  4J00 A;  1BC7 C;  1EA3 A;  2TRT A;  2EZH A;  3GWZ A;  4RM3 A;  4OU0 A;  5GPA A;  5L3F A;  1IRX A;  4KYW A;  1JTX A;  2E2H J;  5J6X A;  4Y33 A;  1IDY A;  4XLN F;  4F3Q A;  1GVD A;  3H92 A;  1STZ A;  1EV7 A;  4ENJ A;  3AL0 B;  3PNV A;  4XBF A;  1F1Z A;  1FOY A;  2JA7 J;  1XC5 A;  1LKX A;  4F91 B;  1GV2 A;  2VUM J;  3MZ8 A;  1HCR A;  3L00 A;  3A01 A;  1IXR C;  2VT3 A;  2DFE A;  4A3C J;  3ECO A;  3GEZ A;  2MC4 A;  2JMW A;  3V7C A;  4A0Z A;  1SEU A;  1ZR4 A;  2O9L A;  1SVM A;  1LFB A;  3IUO A;  1UZC A;  2ZXH A;  1XX5 A;  3C7J A;  1KGS A;  2HDC A;  4BXF A;  5A2Q Z;  1X1A A;  2DQR A;  1ON1 A;  3CCY A;  2IGN A;  3KEO A;  3TDU C;  3LNQ A;  3ERE D;  4BDY A;  1EF4 A;  2QLZ A;  2GOX B;  2WTE A;  3P5J A;  1R5G A;  2EZK A;  3S2W A;  1S5L C;  5LD2 C;  2Y69 H;  3GTG J;  5HNH A;  1U5T A;  4QIW N;  2L9S A;  2Q0O A;  4NNJ A;  2XRN A;  3BZC A;  2HZD A;  4V19 K;  3LSJ A;  2VC1 A;  4I01 A;  4LD5 A;  5ICG A;  4GGG A;  1O7F A;  1R5H A;  2RN7 A;  4QTR A;  3GTK J;  1FT9 A;  1GLN A;  1UST A;  2QF7 A;  3WG7 H;  1LPQ A;  4M6V A;  3C2G A;  3CJN A;  1TZL A;  3K4K A;  4B3A A;  2XPV A;  3HC7 A;  4IHX A;  1GVJ A;  4B4C A;  5IYB J;  2X6Y A;  3BLY A;  3WTT C;  2NVQ J;  2FQ4 A;  3R60 A;  5DM7 F;  2DOA A;  2FJ1 A;  4DZP A;  1V5G A;  4IRG A;  5GAG J;  4YG2 F;  3NAU A;  4RMN A;  3Q9V A;  1YTY A;  2KT0 A;  1UFM A;  2ISY A;  1HF0 A;  2IT0 A;  3TO9 A;  2A6E F;  4LG0 A;  1R22 A;  1UHS A;  1FBU A;  3T5X A;  2L4M A;  2A5W A;  1D1C A;  1FSE A;  3IH2 A;  3ECH A;  2HXI A;  3D1N I;  1YE9 A;  2OTJ I;  4IPA A;  2CW8 A;  2KPM A;  4Z2Y A;  1DQU A;  4XMY A;  3S93 A;  1QVU A;  3A1Y A;  2D1H A;  3HGG A;  2ZME A;  3WTX C;  2P4W A;  1JJ6 C;  5M5X J;  2LF7 A;  3KIO A;  4FHT A;  2P7C B;  2CUE A;  4G7H F;  1DDN A;  4IRI A;  2VBW A;  2QEN A;  3K69 A;  1FZP B;  4HF2 A;  4M6X A;  1R1T A;  5LEJ A;  1BW5 A;  2X1C A;  1FNN A;  2CWE A;  2J5P A;  3KFW X;  3KZZ A;  2E7W A;  2FA5 A;  3OS1 A;  1FSH A;  3ZMS A;  3JRA A;  2COM A;  1ZHF A;  3I5U A;  3MZY A;  5CKT A;  5KAF C;  1MMG A;  3K1P A;  3H5N A;  1X3Z B;  2ZNZ A;  3T8T A;  2KZG A;  1ZRE A;  2IP2 A;  2HNH A;  3E6D A;  4HPQ A;  4EM1 A;  2Q8K A;  2R7V A;  3HYI A;  1XS9 A;  1A6I A;  2GBY A;  3QU3 A;  2GLO A;  3AG4 H;  2QKL B;  4CCL A;  1WQ2 A;  2JPC A;  2ZME C;  5J1U A;  2NAZ A;  2CQQ A;  1MNE A;  2R5Y A;  1Y8Q B;  3CP8 A;  4EJW A;  1FP2 A;  2O6G E;  4A69 C;  3L2W A;  1RET A;  3IHU A;  1ZEL A;  1QZY A;  2F5D A;  1VQP I;  1RR8 C;  4BY1 J;  4AD9 A;  1YG2 A;  5EYR A;  2MC3 A;  2GXG A;  1ULY A;  3CUQ B;  4BH9 A;  1ETW A;  2BZT A;  4ABZ A;  2VIX A;  4L9T A;  3CO7 C;  1U6G A;  3VYS B;  1SFX A;  2YR2 A;  4OAZ A;  4M9Z A;  4PSW A;  4LIU A;  1MBH A;  1XSV A;  5KAI C;  3WU1 B;  5DUI A;  5TRD A;  2NRA C;  2HPI A;  4E7I A;  1R4N B;  1WJA A;  2X6O A;  2QQ8 A;  3FMQ A;  5B5E C;  2K9L A;  3U1K A;  4UB8 C;  1UAA A;  2HFH A;  1X3U A;  3UR3 C;  2H6B A;  4B43 A;  3A0B C;  1YFH A;  3HRU A;  4TV7 A;  2KFD A;  2CFX A;  3GZN B;  4KT5 C;  4OOI A;  2DYS H;  1DPU A;  5H2F C;  1VQ5 I;  5E1W A;  1NK3 P;  3VYR B;  4LOC A;  1JHH A;  1OR7 A;  3K1N A;  3KZY A;  1V54 H;  3LA7 A;  3DEE A;  2NVX J;  4AIJ A;  1D0X A;  1NG7 A;  2VE8 A;  1P92 A;  2IS6 A;  1RES A;  2L02 A;  3IH3 A;  3MFK A;  1LUJ B;  3OYN A;  2LFB A;  1E0E A;  1MKM A;  3PQJ A;  4KMU X;  5JHF A;  4B48 A;  4HQE A;  4L9N A;  1U0J A;  4HW0 A;  2EA2 A;  4HNT A;  2BY1 A;  2M4K A;  3GTP J;  2M5W A;  4RAY A;  3CCE I;  3ZMT A;  2L4A A;  4E7Z A;  3H0G J;  2ELK A;  1B9M A;  1LDD A;  3GXO A;  1D3Y A;  2R5Z B;  3FKI J;  1JXS A;  1RR7 A;  1HW1 A;  4NUB A;  3GLL A;  4M71 A;  2QA4 I;  1AKH B;  2K4B A;  1BI2 A;  4WF2 A;  1SAU A;  1Z1D A;  5DD4 A;  3SDB A;  2DA2 A;  3F6V A;  3Q0W A;  2EWN A;  1D0Y A;  4HYE A;  4LJZ F;  4ANJ A;  4FAS D;  5K1Y A;  1NK2 P;  5B1B H;  3F8C A;  3P7N A;  4YEL A;  2I5U A;  2KZV A;  1LDJ A;  2F4I A;  2BYV E;  2X1E A;  1SFU A;  4AC0 A;  1APL C;  2XKO A;  1YQA A;  2AO9 A;  4CCK A;  1T0F C;  5ILU A;  4EV0 A;  4I99 C;  2A6T A;  2E36 A;  4HAM A;  3DPT A;  3ZRG A;  2CMP A;  4U0V A;  2MAB A;  2L7M P;  4FX0 A;  2QQB A;  2OTL I;  1DPR A;  2PI0 A;  3JW4 A;  1LVK A;  2HKO A;  5HNF A;  1SD5 A;  3OSF A;  4WWC A;  3OOU A;  2XC7 A;  1MSE C;  4X1E A;  3TOA A;  2CQ7 A;  2Z2S B;  1O3Q A;  1VQ4 I;  3A03 A;  5BPI A;  4QPO A;  1KU3 A;  5DEQ A;  3PIO F;  3AAF A;  2CV0 A;  5HDG A;  3PJR A;  2KRH A;  4XK4 A;  5D8L B;  1CF7 B;  4CUG A;  4YIR X;  3E5U A;  1X1D A;  3LA3 A;  2ZFU A;  4UUV A;  3K6G A;  2V9K A;  3ZMU A;  2FNP A;  1BA5 A;  2ECC A;  2JQ7 A;  2QSG X;  1YX3 A;  2W7N A;  1FYM A;  1K78 A;  3HB9 A;  2BY2 A;  3I4M J;  3H3Z A;  2Z33 A;  2FML A;  4M3F A;  1MGT A;  4E70 A;  4XLP F;  1IV6 A;  2R7U A;  1V3F A;  2JSP A;  5J3L A;  4ZDP A;  2IA1 A;  5EGO B;  3MKZ A;  3IKT A;  3N97 A;  1K79 A;  4C2T A;  3MCZ A;  3OYF A;  1XGN A;  2MBF A;  1HDP A;  2DA7 A;  3OWT A;  5K7H A;  1OLT A;  3SFI A;  1RUN A;  2CQX A;  5EZH A;  3IAS 2;  3LAP A;  1W36 D;  2ME6 A;  1R1U A;  1TWF J;  2P8T A;  2P6S A;  1BR4 A;  2OF7 A;  1CGP A;  3PO3 J;  1IRG A;  2YX7 A;  1K61 A;  5L3B A;  1BIB A;  2WAD A;  4PFP A;  2W24 A;  3I64 A;  1B8I A;  3WGI A;  2F5V A;  1FLI A;  1UMQ A;  1USS A;  3CTA A;  3TED A;  3K2A A;  3CQZ J;  4U88 A;  2PFB A;  4UVA A;  1H0M A;  4PDK A;  4CCM A;  2HOS A;  2EPF A;  2QCO A;  3VB2 A;  4KNY A;  3REO A;  3LOC A;  3VOE A;  5HVQ C;  2FEZ A;  2R7S A;  5D4R A;  1VZ0 A;  4BBS J;  4DQ2 A;  1MBJ A;  4CIC A;  3G6E I;  4ITV A;  3OYG A;  2PMH A;  3BCA A;  2EQR A;  3CJQ B;  1ZG1 A;  2CYY A;  4QPQ A;  4HQM A;  3SHF A;  4Y13 A;  3C1D A;  1ETV A;  3FK6 A;  3CZ6 A;  1TC3 C;  5DTD A;  2BEO A;  3ASO H;  5FLX Z;  5M5W J;  2DMT A;  3F0C A;  2BHY A;  5FJ8 J;  3DBH B;  4PK4 A;  2PQ8 A;  1H89 C;  2WV0 A;  1E2X A;  4LLL A;  1P2F A;  1H88 C;  3OIP A;  1FOK A;  2WA0 A;  3CJR B;  3SEZ A;  3F21 A;  2NS8 A;  2VKV A;  2K7L A;  2DT7 B;  2HOA A;  1EJ9 A;  2VT2 A;  2IAI A;  4XIC A;  1ZKG A;  1X4O A;  1ON2 A;  3M8F A;  2HKX A;  1U78 A;  4HZF A;  2EH3 A;  1RI7 A;  3HRS A;  2RQQ A;  1VQL I;  3JTG A;  1GHC A;  3FMR A;  3GTJ J;  4CZC A;  4BGD A;  5KHD A;  2A3S A;  1T8I A;  1QO0 D;  1IRZ A;  3GCM A;  3JSP A;  5IP6 A;  4KIG A;  4MEX F;  3TGN A;  2HVS A;  4HRI A;  3R0J A;  3U1D A;  1VFC A;  3DF8 A;  1J59 A;  4MFD A;  5FRO A;  2KDO A;  3Q3S A;  4LLN A;  1R58 A;  3KEY A;  2HZT A;  1TQI A;  2HWV A;  2BGC A;  5B66 C;  5LLQ A;  3OIQ A;  2DMU A;  2LLK A;  2Y2Z A;  5CYV A;  2A68 F;  5ILS A;  2ECB A;  1QVT A;  2IJL A;  1FMW A;  3CC7 I;  2FF4 A;  3AG1 H;  5JVG F;  2IPQ X;  3E3V A;  2LBF B;  1WFX A;  3HOT A;  4OMZ A;  1IN8 A;  3PL8 A;  5E79 C;  1IUF A;  4LG0 B;  1UG2 A;  2K85 A;  3H9J A;  1X4P A;  1BL0 A;  4C2U A;  2PBI A;  1FMV A;  4HV6 A;  2A69 F;  4HNU A;  4ZJZ A;  2DA5 A;  2CW7 A;  1T33 A;  3KX2 A;  3ASN H;  4II3 A;  4LGW A;  4XRS A;  2X1D A;  2K9S A;  2OPT A;  2X85 A;  3W6J B;  2JRT A;  2ZO4 A;  2FQ3 A;  2HQN A;  1MBF A;  2FBH A;  3CCU I;  2HS5 A;  3EDP A;  1EKE A;  3C2B A;  5K7Z A;  2XVC A;  3VWB A;  1G6N A;  4U0Y A;  1WKM A;  2BOL A;  4PZJ A;  2V1X A;  1S7A A;  3CME I;  1T6S A;  2JA2 A;  1MSF C;  5BPD A;  3LAJ A;  4M3B A;  3SQN A;  4EEF G;  3K9T A;  3FHZ A;  2HQ5 A;  3NAR A;  3HIF A;  2L9R A;  5CQE A;  2Z9O A;  1FIA A;  1WI3 A;  2ZME B;  2M87 A;  1YW9 A;  3SFZ A;  3B02 A;  3T1B A;  1X3W B;  2E34 A;  3G1M A;  4ESF A;  1BI1 A;  1KU2 A;  1AA7 A;  3CCS I;  4I2O A;  1F9N A;  4BNC A;  2YUS A;  3G1L A;  3RZD J;  3D0S A;  3Q9S A;  5FKL A;  3RKW A;  3GX4 X;  4DBR A;  1V5E A;  1ETK A;  1W36 C;  1D5Y A;  3ZQ7 A;  2XSD C;  1HBX G;  2GQQ A;  4JX5 A;  1GXP A;  3X2Q H;  4MGR A;  4BKX A;  1OYW A;  1I27 A;  3LMM A;  4FX4 A;  1KYZ A;  3DEU A;  3FWE A;  1PP8 F;  2XAH A;  4U0W A;  1HLV A;  2VQG A;  5IT9 Z;  3RQI A;  3M9A A;  2IS4 A;  3M1C A;  2RKH A;  3M8J A;  1MDM B;  5CJ9 A;  1IRF A;  3E97 A;  2C6Y A;  4MTE A;  3ZCO A;  3ABU A;  3KET A;  3ZR8 X;  1OIS A;  1XMA A;  4I0A A;  2DXI A;  3HSE A;  4EM2 A;  2V1D A;  3RZO J;  2YU3 A;  1DGW Y;  1MH4 A;  4IVN A;  1NTC A;  1G59 A;  3QPH A;  4B1R A;  4CA0 A;  1S29 A;  3A2K A;  3ESW B;  5IP9 J;  5AON A;  2E5Z A;  1J5Y A;  1FY7 A;  2ZJ2 A;  5D6E A;  4B3X A;  3K70 C;  5F0C A;  3FHN A;  5EF6 A;  1WVR A;  5E8I A;  2V6C A;  3F23 A;  1TL8 A;  3EYY A;  5CVV A;  5FKM A;  1JJ8 C;  1SVO A;  2ZJR F;  1ITY A;  1B8I B;  3EUA A;  1R00 A;  1RC9 A;  2EIJ H;  2QVO A;  5JHU A;  5B3S H;  3W2A A;  2P7V B;  2DQL A;  2NYX A;  3HOY J;  1BI3 A;  2HQA A;  1XMK A;  2DA3 A;  4PGG A;  4DNC A;  3QOD A;  2GM4 A;  1Z9C A;  2EIM H;  2KKO A;  4IO9 F;  1MIJ A;  5HS9 A;  4ZYG A;  4F93 B;  1JKQ C;  1WH7 A;  4AM3 A;  1DP7 P;  3K2Z A;  1P4W A;  1DGR M;  2XAQ A;  3FXM A;  3ULQ B;  2RGV A;  4G94 A;  2P5V A;  3TL4 X;  1I1G A;  1HKT A;  2I10 A;  1ZQ3 P;  1SD4 A;  2ZB9 A;  3BZK A;  2BXY A;  1U8B A;  1PP7 U;  2W57 A;  4UVB A;  1SAN A;  3DBL B;  5HS8 A;  5EEG A;  3N4M A;  2XF5 A;  2L9V A;  1QBJ A;  2QYO A;  3TQN A;  3PNY A;  2Y30 A;  3LFU A;  1I3Q J;  5KVR A;  2VBZ A;  3BZ6 A;  4HDV A;  2H8R A;  3M1E A;  3I0T A;  2EFQ A;  1TNT A;  1IF1 A;  1U9N A;  3BTJ A;  3J7Z I;  1X1P A;  3TW6 A;  4CYC A;  1WCM J;  1KA8 A;  1K4T A;  3E6M A;  2ZC2 A;  2QSH X;  3OV8 A;  2XV4 S;  3HDD A;  2DMP A;  1D1A A;  4N4N B;  2GZW A;  3A02 A;  1A36 A;  1N78 A;  2FRH A;  1S72 I;  4RGR A;  3I53 A;  4WXD A;  2KMU A;  1Z7U A;  4FTH A;  4FCY A;  4KN7 X;  3KYL A;  1PJR A;  4JP0 A;  4EQQ A;  3V8K A;  3H3U A;  4XKW A;  2MLK A;  2KJC A;  2OCC H;  2WAF A;  1MBK A;  4D7M A;  4EGZ A;  1G3S A;  2XAU A;  3G1O A;  2COB A;  2DA6 A;  1N25 A;  2DJI A;  3SXY A;  4W1U A;  4BXX J;  2QBY A;  2L3D A;  2OQG A;  4P96 A;  2GIZ A;  2HGC A;  3MKW B;  2DU9 A;  2W4S A;  3GO5 A;  4CCJ A;  4HA8 A;  1JUM A;  4S04 A;  2MFZ A;  3M3Y J;  2L7K A;  2PJR A;  3FKJ A;  3L1P A;  4I6Z A;  4R1H A;  3IRQ A;  3HGY A;  3BOQ A;  4YII A;  1NHA A;  4E4H A;  3ZXS A;  3DV8 A;  1BOA A;  3RQ4 A;  2VOD A;  3AKZ A;  1XCV A;  6PAX A;  1K6O A;  4PUS A;  3ML6 A;  1YX5 A;  1ACI A;  2HVR A;  1ZYR F;  3BPV A;  4C30 A;  4NC7 A;  2KIQ A;  3W6V A;  4ZYE A;  3VEP A;  4F7Z A;  1Z3Y A;  1LEB A;  1QNT A;  2M2E A;  1TP4 A;  3HOV J;  1OCC H;  2R92 J;  2ETH A;  4A0Y A;  3OR2 C;  4CHU A;  2ID6 A;  2M0M A;  3LSM A;  2RVC A;  2VN2 A;  4V2F A;  1BR2 A;  5GAD J;  2CU7 A;  2R7R A;  2OAZ A;  3MVP A;  2RC4 A;  3LSR A;  3JRI A;  4HLY A;  2QGU A;  2VQC A;  2OCE A;  4IQ4 A;  2LC2 A;  1FBQ A;  3CMA I;  2KP6 A;  3GTL J;  5IY5 H;  1VQO I;  3MMY B;  3DKW A;  3K4J A;  5J40 A;  5F08 A;  4M9S A;  3S1R J;  2B9S A;  4XQF A;  3J80 K;  3R61 A;  3DTK A;  3RJP A;  4JYK A;  4X0G A;  4HEA 2;  2JVH A;  1WJC A;  1JGG A;  2JZY A;  4RB0 A;  1L0O C;  2IXS A;  5HDN A;  2UXX A;  4M6Y A;  3H0D A;  1MNM C;  1LDK B;  4MEY F;  1Z0X A;  2YX4 A;  3BY6 A;  5L3D A;  2XGX A;  2QEX I;  3B6A A;  3BC8 A;  1R6R A;  5JVT A;  5K5R A;  1Y1V J;  4MFE A;  2VOP A;  2K9N A;  2Y0M A;  1Y56 A;  4WXH A;  3FXK A;  2QSF X;  2IVM A;  5CLS A;  3IKV A;  2LH9 A;  3FXJ A;  2RAE A;  3CMM A;  2AXT C;  4RLQ A;  2KHM A;  5GAE J;  1WJE A;  4N4O B;  1R1V A;  3BTC A;  3GFI A;  3RTR A;  4LMY A;  3KPH A;  4XOP A;  1S6L A;  2FMY A;  4UB6 C;  1Z6T A;  1YIJ I;  2M3A A;  2MYS A;  2ZSI B;  1ORK A;  3HM5 A;  4PCQ A;  1BC8 C;  2K9M A;  3K1M A;  5BQT A;  3GTM J;  2LY2 A;  4PJJ A;  1Y0N A;  3QWL A;  2VI6 A;  3OYI A;  2AHQ A;  4RGS A;  4G7Z F;  2ZCW A;  3F6O A;  3ZGK A;  3IH4 A;  1HA8 A;  1TQP A;  1I39 A;  2B7E A;  3CF5 F;  5EZG A;  1IV8 A;  2JK3 A;  2R7D A;  3S32 A;  4L0Y B;  5LGN A;  2R7O A;  3RDI A;  5EDN A;  1VQK I;  1MJB A;  5F1R A;  1BOB A;  3KP3 A;  1Q1H A;  3GYH X;  4ENM A;  2DTZ A;  3FZV A;  9ANT A;  5JR3 A;  4B47 A;  2LTP A;  1PDN C;  4I76 A;  3NWT A;  2LOO A;  2O8K A;  2V6E A;  1I5Z A;  1IUY A;  3GME A;  4JQF A;  3G4S I;  1A5J A;  2X4H A;  3LSP A;  1SAX A;  1UG0 A;  5IOZ A;  2DFH A;  2JA8 J;  2LP0 A;  1S9H A;  2VKE A;  3GLX A;  4PJN A;  5D5V B;  2F5F A;  3F72 A;  2EIK H;  3HBL A;  3HKZ N;  5H6Q A;  5IP7 J;  1Z6R A;  1D8J A;  3EUH C;  2CS3 A;  4L0Z B;  4OIO F;  3M4O J;  2CUJ A;  3AG2 H;  1WJF A;  2V9P A;  1T98 A;  2EB7 A;  3WE2 A;  4D0P A;  5E1X A;  4BEH A;  4MIM A;  3GFJ A;  2A07 F;  2QQ9 A;  1I3A A;  5KK1 A;  1XPX A;  3FMS A;  5DYM A;  4PSX A;  3S17 J;  3ZQC A;  3G2B A;  1GUU A;  3FXO A;  1MW7 A;  4HG2 A;  3HHH A;  3O6B B;  3UKG A;  3WG9 A;  1WRJ A;  3QPS A;  2X6X A;  4RGX A;  4I0B A;  2PJP A;  2WY8 Q;  4F52 A;  1EH8 A;  2FXA A;  2WAQ N;  5FO5 A;  3OYC A;  3IV5 A;  3BR0 A;  3WGG A;  4LB6 B;  5E3O A;  2VJI A;  3HOX J;  3WE3 A;  3CD6 I;  5IYD J;  2GWR A;  3WTS C;  2R5Y B;  4P1W A;  3OS2 A;  3DTE A;  1BJZ A;  1W4M A;  3HJE A;  2ME0 A;  2H27 A;  1JI8 A;  4RA2 A;  3V7S A;  5HLI A;  1QHG A;  3AG3 H;  4UNO A;  3FBN B;  1A31 A;  4ESB A;  3HUG A;  3PUB A;  5FGM A;  1FIP A;  3PQK A;  2DA1 A;  2HOE A;  1GXQ A;  1LE8 A;  5LGT A;  1XGM A;  1PVE A;  3FM5 A;  5IT3 A;  4A3G J;  3V7R A;  2A05 A;  1XGO A;  3EET A;  2LRE A;  3BQY A;  2V79 A;  1ZRC A;  1SMY F;  2MLG A;  5DDG A;  2PMU A;  3DU6 A;  1O57 A;  1P6R A;  2RQP A;  2RNG A;  3HSR A;  3U2R A;  2IA0 A;  4NC8 A;  3BG5 A;  1ZG5 A;  4GRI A;  4E7L A;  2BV6 A;  1Z77 A;  3JAM Z;  3RIR A;  2WBM A;  2A61 A;  1A35 A;  4AIK A;  3KYC B;  3FX3 A;  5FLM J;  3D5S C;  5D5U B; 
#chains in the Genus database with same CATH homology
 3G73 A;  2XHK A;  2UWM A;  4MQ9 F;  2JT1 A;  2NNN A;  1S3J A;  2PN6 A;  1BBY A;  3F3X A;  5E18 F;  3ZMV A;  3BDD A;  1S8N A;  4KIB A;  2F2E A;  2H6C A;  3DFG A;  5LBQ A;  4WCG A;  2ELH A;  3JSO A;  3MEX A;  1ZGJ A;  4BHC A;  1F4K A;  2IW5 A;  1JGS A;  1Z91 A;  5ICF A;  5LEK A;  3WTZ A;  3RPU A;  2RDP A;  2R3S A;  3IRR A;  4EJV A;  4HX7 A;  3U9G A;  1U2W A;  3BWG A;  5LRR A;  2Z3Y A;  3HOS A;  1UCR A;  5FFZ A;  4HOB A;  1IN6 A;  3GVA A;  3GW2 A;  2G9W A;  4I7H A;  5LRS A;  1W7P D;  2PG4 A;  4M72 A;  3O3K A;  4NHJ A;  1R23 A;  2LF8 A;  3W6K B;  5CVI A;  4EJT A;  4H0E A;  3P9I A;  2A5Y B;  4OIN F;  1J75 A;  1MJ9 A;  1OYY A;  1UHM A;  1ZAO A;  4EM0 B;  4HBL A;  3CLO A;  3M8E A;  5E8G A;  2ADU A;  2UZK A;  2QZ8 A;  5ICC A;  4IRH A;  3TKY A;  4QLC U;  1G3Y A;  3DQV C;  4OIQ F;  3WOD F;  4A6E A;  4ENN A;  3GFL A;  4M74 A;  1YS6 A;  3FM3 A;  3I54 A;  4G6D A;  4EGY A;  4NB5 A;  1LB2 A;  3KP6 A;  2VE9 A;  3QRF F;  4L5J A;  3I59 B;  1YW7 A;  5E1Z B;  3JTH A;  1H9T A;  1IN7 A;  3J7A O;  2LNB A;  4JBA A;  1WI9 A;  1YLF A;  5D4S A;  4K2E A;  3P9C A;  2UXN A;  3EQL F;  3CO6 C;  5F6F A;  2V9V A;  1YS7 A;  2XAJ A;  2EFO A;  4B09 A;  2OU2 A;  3P9K A;  4Q4Z F;  2EJR A;  1YYV A;  4OIR F;  2ISZ A;  2JPB A;  3KP5 A;  2CO5 A;  1T39 A;  2XKP A;  4ETS A;  2JTV A;  1OMI A;  3ZP5 A;  5LGU A;  1TNS A;  1IW7 F;  4CXF A;  4AWX B;  2Q2E A;  2EV0 A;  1J2X A;  4MNU A;  4RB2 C;  5K5O A;  2LSO A;  2M30 A;  4UV8 A;  4BHP A;  2J5O A;  1EH7 A;  2Y48 A;  1HW2 A;  4RB3 C;  5A2Q K;  1TQM A;  4L5I A;  2XRO A;  1TLH B;  2ZKZ A;  4P5O A;  1O3T A;  1BN5 A;  4AVP A;  2X0L A;  5DCF A;  1V4R A;  3LA2 A;  1KU7 A;  4MTD A;  2Z99 A;  4CYD A;  5AIP A;  5TJJ A;  2YPR A;  3WTW C;  2FBI A;  2GXB A;  1IXS B;  4BYY A;  4BXU A;  3Q5F A;  3OOP A;  5E20 A;  3MAJ A;  3HSF A;  3I58 A;  2DPD A;  3ZN1 A;  1AWC A;  1B1B A;  2VXZ A;  3QU6 A;  2D2W A;  3KP2 A;  1WSU A;  2AXL A;  3TDZ C;  1OPC A;  5D5W B;  2ESH A;  3EUH A;  3WU0 A;  2GIV A;  5LHG A;  3DPL C;  4KA4 A;  3J80 Z;  1RUO A;  3IWZ A;  1U3E M;  1CF7 A;  2Z5U A;  3GZ6 A;  5ICE A;  2P6T A;  1OKR A;  2EA4 A;  5J8F A;  2LDU A;  2DPU A;  3CDH A;  5LHH A;  3E6C C;  4M9X A;  3FXQ A;  2MH2 A;  2Y75 A;  1ZH5 A;  2PEX A;  3NEU A;  2ZFW A;  1ZG3 A;  4HLX A;  4P9U A;  2OZ6 A;  2G7H A;  4Y17 A;  4ESJ A;  2CG4 A;  4ASN A;  4EVI A;  4RAZ A;  1XB4 A;  4HX4 A;  2H94 A;  4BQA A;  5JI6 A;  2L54 A;  3KP7 A;  1A04 A;  3B73 A;  3M7G A;  4KIC A;  4FT8 A;  5H20 A;  1SFE A;  4LK1 F;  3QPT A;  2NS0 A;  3KLN A;  3TO6 A;  4GYI A;  2K27 A;  3F8N A;  3MQ0 A;  4XSZ F;  3LFK A;  2DAO A;  4R79 A;  1XGS A;  4I09 A;  2F5E A;  1PUE E;  2XUB A;  1I6X A;  1KQ8 A;  2VBY A;  1U5T B;  1QQI A;  3QP5 A;  4ZH4 F;  3R0A A;  1R36 A;  2VON A;  2DTR A;  1TBX A;  1KU9 A;  2LKP A;  2W84 A;  3ABT A;  3QP6 A;  1HST A;  2DW4 A;  2D1V A;  1FP1 D;  3WTY C;  2BBY A;  3BJ6 A;  3C3W A;  2CW0 F;  2K86 A;  1MDM A;  2STW A;  4XSX F;  2KIF A;  2R7F A;  1IN5 A;  3DXJ F;  2M8E A;  1J0R A;  1G3T A;  1XDU A;  2OZU A;  4UV9 A;  3HRM A;  2GA1 A;  3KLO A;  5FLX K;  4A0X A;  1FBS A;  1UHW A;  4LK0 F;  1IZ1 A;  1J9I A;  1JE8 A;  2EV5 A;  4P9F A;  5CVR A;  1YIO A;  2FE3 A;  4ZZL A;  3HHG A;  5CVJ A;  3MZH A;  1BJA A;  3C18 A;  4IXA A;  3DP7 A;  5HDK A;  2QBY B;  1W5S A;  1HKS A;  1QPM A;  4IHT A;  4A12 A;  1G4D A;  3NRV A;  4MHG A;  2DFI A;  1O7L A;  1W7P A;  4O6J A;  3L09 A;  5H6R A;  2K02 A;  3HTU A;  1XSD A;  5HLG A;  3SZT A;  3COA C;  2AS5 F;  2B0L A;  5BMZ A;  2L01 A;  5IT9 K;  1B59 A;  4UVC A;  4BHB A;  4L9V A;  3TOB A;  4ZYD A;  3K0L A;  5F64 A;  3G3Z A;  1LNW A;  3F8M A;  2OA4 A;  1MZB A;  1H9G A;  4NQW A;  1J7K A;  3E6B A;  3RPQ A;  2DLL A;  4I02 A;  4GO1 A;  2KJB A;  3WTU C;  3BP8 A;  3QAH A;  2EFW A;  2CGP A;  1JHF A;  2W25 A;  4LB5 A;  1ZRF A;  1T0F A;  4EMS A;  4A6D A;  5D8K B;  2DO7 A;  2P5K A;  3LQQ A;  2WC2 A;  4JK1 X;  5CVU A;  2YSR A;  4HDU A;  1ZGA A;  2TDX A;  3ZN0 A;  4HV5 A;  3F8B A;  1XN7 A;  1HSJ A;  4IF4 A;  1XCB A;  2ACJ A;  5ED4 A;  2VBX A;  1YW8 A;  3BPX A;  1LJ9 A;  4N0B A;  4WXC A;  3V8J A;  2ZBK A;  2HQR A;  1K78 B;  4OIP F;  1T38 A;  2E1C A;  4OMY A;  4UHT A;  1SD6 A;  4WX9 A;  1SMT A;  1XD7 A;  2NNY A;  1TW3 A;  2EV6 A;  5HLH A;  2O03 A;  4UXN A;  1EH6 A;  4AIH A;  1L3L A;  3FXR A;  2A6H F;  3LWF A;  2ESN A;  2CQK A;  2DI3 A;  2KIU A;  3RKX A;  5JFR A;  1IN4 A;  4YFN F;  1U8R A;  4A2U A;  1UB9 A;  2QM3 A;  3ISP A;  3VOD A;  4PGH A;  5FB2 A;  4N9H A;  2QWW A;  2GAU A;  1O3S A;  3CUQ A;  4P55 A;  1AOY A;  1I1S A;  1BI0 A;  1XSX A;  3CUQ C;  1KYW A;  3ELK A;  4KN4 X;  3L7W A;  3RKY A;  5BS6 A;  5ILV A;  3R4K A;  1Y0U A;  3I4P A;  3BRO A;  3I59 A;  3QOP A;  1FC3 A;  3RYP A;  2V1U A;  2CSO A;  4YFK F;  4WK8 F;  1ZLJ A;  5BOX A;  4L18 B;  3RI4 A;  4G9Y A;  1OYI A;  2W85 A;  1TW2 A;  2IA2 A;  5DCM A;  1K7A A;  2FNA A;  5D5X B;  3L9F A;  3J81 Z;  5L3G A;  4HF1 A;  3E5X A;  5D6F A;  3ZMZ A;  4HX8 A;  1T2K A;  5J8C A;  2HR3 A;  4XRF A;  3PFI A;  4GYG A;  2K4J A;  4RGU A;  2MA3 A;  2F5C A;  1BM9 A;  2DBB A;  3KCC A;  5DD8 A;  1WWX A;  2XAF A;  5FD6 A;  1HXD A;  2HYG D;  3NQO A;  2RV8 A;  2M1B A;  5DCM B;  3ZMD A;  1U5T C;  4ENK A;  1IXC A;  4ON0 A;  4I98 B;  4R8H A;  4S05 A;  1ONV A;  2DK5 A;  3R6S A;  1B4A A;  1FYK A;  3L2C A;  1R7J A;  2BE5 F;  5AIQ A;  5DV5 A;  4IJA A;  1HQC A;  1LEA A;  2O0Y A;  2OQR A;  3J81 K;  2G7U A;  3T8R A;  4U7D A;  5FD5 A;  3KEQ A;  2FOK A;  4CZZ A;  1QGP A;  3F8F A;  1TTY A;  2XAG A;  2FU4 A;  5HOO A;  1ZN2 A;  3V8L A;  4YFX F;  3F22 A;  3KP4 A;  4QWQ A;  2O61 A;  4G8X A;  1KQ0 A;  2MD5 A;  5ERI A;  1HW5 A;  1ZAR A;  2FSW A;  5HS7 A;  4GXO A;  4LLG F;  3FF5 A;  3IC7 A;  4B8X A;  3LST A;  3KE2 A;  3GZ5 A;  1MD0 A;  4O3M A;  1LVA A;  3FXU A;  2OD5 A;  3IWF A;  1BIA A;  4Y15 A;  4Q5S F;  2H09 A;  1F5T A;  4EJU A;  2ZXJ A;  1P4X A;  2KIM A;  4KDP A;  2ZNY A;  2DK8 A;  3E5Q A;  3WGH A;  1RIO H;  2VOO A;  1SD7 A;  3VFZ A;  4CO8 A;  3BJA A;  3IL2 A;  5DUK A;  1DUX C;  2XAS A;  1S7O A;  4KIF A;  1E17 A;  4YIF A;  1LQ1 A;  3HTS B;  1D5V A;  2JSC A;  3O2P E;  2QUF A;  3BJO A;  1W7P B;  4KUM A;  2HYF A;  3CUO A;  4L9J A;  5E17 F;  1G3W A;  4GCV A;  1C0W A;  1FPQ A;  2E7X A;  2IRF G;  4EJO A;  3GFM A;  1W5T A;  2STT A;  2WWY A;  1FWZ A;  1ODD A;  2HTJ A;  4ZYH A;  1Z05 A;  1O3R A;  2PLY A;  1B6A A;  4CGZ A;  4G7O F;  1ZRD A;  3GUD A;  4O5V A;  4U7B A;  3HRT A;  4N9I A;  3SZP A;  2GA2 A;  2EK5 A;  4ZZD A;  2KRF A;  2DT5 A;  3RYR A;  1FX7 A;  1KQ9 A;  1D8K A;  1B9N A;  1FYL A;  5L3C A;  3D5L A;  4IHS A;  1ZLK A;  1QZZ A;  4CDG A;  2M45 A;  5L3E A;  4LFU A;  3ZPL A;  1VTN C;  5K5Q A;  4A5N A;  3T0Y A;  3V4G A;  2EFP A;  2RNJ A;  2D45 A;  4RB1 A;  1REP C;  5FFX A;  4MQV A;  2XIG A;  3TO7 A;  5LHI A;  4KMF A;  2P5L C;  1YO5 C;  3GF2 A;  3LQR A;  2HTS A;  4RS8 A;  2VC0 A;  2O8X A;  4HF0 A;  3JAM K;  3WTV C;  2EFN A;  1MJA A;  1RZ4 A;  3ROU A;  2MH9 A;  1RNL A;  2HEO A;  4G6Q A;  2QQA A;  5EEH A;  2O3F A;  4Q48 A;  3MWM A;  1XDS A;  4KFC A;  2FBK A;  4M73 A;  4BAY A;  1HKQ A;  4A5M A;  2OBP A;  4Q47 A;  3I71 A;  1IAW A;  1P4A A;  3EYI A;  2E1N A;  1BC7 C;  3GWZ A;  5L3F A;  4OU0 A;  4KYW A;  5J6X A;  4XLN F;  3H92 A;  1STZ A;  1EV7 A;  4ENJ A;  4XBF A;  1F1Z A;  3L00 A;  1IXR C;  2VT3 A;  3ECO A;  3GEZ A;  3V7C A;  4A0Z A;  3C7J A;  1KGS A;  2HDC A;  5A2Q Z;  2DQR A;  1ON1 A;  3KEO A;  3TDU C;  3ERE D;  2QLZ A;  2WTE A;  1R5G A;  3S2W A;  1U5T A;  2Q0O A;  2XRN A;  2VC1 A;  4I01 A;  4LD5 A;  5ICG A;  4GGG A;  1R5H A;  1O7F A;  2RN7 A;  1FT9 A;  1UST A;  3CJN A;  1GVJ A;  3WTT C;  3R60 A;  4IRG A;  4YG2 F;  3Q9V A;  1YTY A;  1UFM A;  2ISY A;  2IT0 A;  3TO9 A;  2A6E F;  4LG0 A;  1R22 A;  1FBU A;  3T5X A;  2L4M A;  1FSE A;  3ECH A;  4IPA A;  4Z2Y A;  2D1H A;  2ZME A;  3WTX C;  2P4W A;  2LF7 A;  4FHT A;  2P7C B;  4G7H F;  1DDN A;  4IRI A;  2VBW A;  2QEN A;  3K69 A;  1FZP B;  4HF2 A;  4M6X A;  1R1T A;  5LEJ A;  1FNN A;  2CWE A;  2J5P A;  3KFW X;  3KZZ A;  2E7W A;  2FA5 A;  1FSH A;  3ZMS A;  2COM A;  1ZHF A;  3I5U A;  3MZY A;  3K1P A;  2ZNZ A;  3T8T A;  1ZRE A;  2IP2 A;  3E6D A;  4EM1 A;  2Q8K A;  3HYI A;  3QU3 A;  1WQ2 A;  2JPC A;  2NAZ A;  4EJW A;  1FP2 A;  2O6G E;  3IHU A;  1QZY A;  2F5D A;  4AD9 A;  1YG2 A;  2MC3 A;  2GXG A;  1ULY A;  3CUQ B;  4BH9 A;  4L9T A;  3CO7 C;  1U6G A;  1SFX A;  2YR2 A;  4M9Z A;  1XSV A;  3WU1 B;  5DUI A;  5TRD A;  2NRA C;  3FMQ A;  2HFH A;  1X3U A;  2H6B A;  1YFH A;  3HRU A;  4TV7 A;  2CFX A;  4KT5 C;  4OOI A;  1DPU A;  5E1W A;  1JHH A;  1OR7 A;  3K1N A;  3KZY A;  3LA7 A;  4AIJ A;  2VE8 A;  1P92 A;  2L02 A;  3MFK A;  1MKM A;  3PQJ A;  4KMU X;  4HQE A;  4L9N A;  4HW0 A;  2EA2 A;  2M5W A;  4RAY A;  3ZMT A;  2L4A A;  1B9M A;  1LDD A;  3GXO A;  1D3Y A;  1JXS A;  1HW1 A;  4M71 A;  2K4B A;  1BI2 A;  4WF2 A;  1Z1D A;  5DD4 A;  3F6V A;  2EWN A;  5K1Y A;  4HYE A;  4LJZ F;  3F8C A;  3P7N A;  1LDJ A;  2BYV E;  1SFU A;  2XKO A;  1YQA A;  5ILU A;  4EV0 A;  4HAM A;  3DPT A;  4U0V A;  4FX0 A;  2QQB A;  1DPR A;  2PI0 A;  3JW4 A;  2HKO A;  1SD5 A;  4WWC A;  3TOA A;  1O3Q A;  5BPI A;  1KU3 A;  5DEQ A;  3AAF A;  5HDG A;  5D8L B;  1CF7 B;  3E5U A;  3LA3 A;  4UUV A;  3ZMU A;  2FNP A;  1FYM A;  1K78 A;  2Z33 A;  3H3Z A;  2FML A;  4XLP F;  1MGT A;  4E70 A;  1V3F A;  2IA1 A;  3IKT A;  3N97 A;  1K79 A;  3MCZ A;  1XGN A;  2MBF A;  1RUN A;  3LAP A;  1R1U A;  2P8T A;  2P6S A;  1CGP A;  1IRG A;  2YX7 A;  5L3B A;  1BIB A;  2W24 A;  3I64 A;  3WGI A;  1FLI A;  1USS A;  3CTA A;  4U88 A;  2PFB A;  4UVA A;  1H0M A;  4PDK A;  3VB2 A;  4KNY A;  3REO A;  5HVQ C;  3VOE A;  2FEZ A;  5D4R A;  4DQ2 A;  4CIC A;  2PMH A;  1ZG1 A;  2CYY A;  4HQM A;  3SHF A;  4Y13 A;  3C1D A;  2BEO A;  5FLX Z;  2PQ8 A;  2WV0 A;  1E2X A;  4LLL A;  1P2F A;  1FOK A;  3F21 A;  2K7L A;  2VT2 A;  1ON2 A;  3M8F A;  2HKX A;  1U78 A;  4HZF A;  1RI7 A;  3HRS A;  3JTG A;  1GHC A;  3FMR A;  2A3S A;  1QO0 D;  3JSP A;  4KIG A;  4MEX F;  3TGN A;  3R0J A;  3U1D A;  1J59 A;  3DF8 A;  4LLN A;  1R58 A;  2HZT A;  1TQI A;  2HWV A;  2BGC A;  5LLQ A;  5CYV A;  2A68 F;  5ILS A;  2IJL A;  2FF4 A;  2IPQ X;  3E3V A;  3HOT A;  4OMZ A;  1IN8 A;  4LG0 B;  2PBI A;  4HV6 A;  2A69 F;  4LGW A;  3W6J B;  2JRT A;  2ZO4 A;  2FQ3 A;  2HQN A;  2FBH A;  2HS5 A;  3EDP A;  2XVC A;  1G6N A;  4U0Y A;  1WKM A;  4PZJ A;  2V1X A;  1S7A A;  1T6S A;  5BPD A;  3LAJ A;  3SQN A;  3K9T A;  3FHZ A;  3HIF A;  2Z9O A;  2ZME B;  2M87 A;  1YW9 A;  3SFZ A;  3B02 A;  3T1B A;  4ESF A;  1BI1 A;  1KU2 A;  4I2O A;  1F9N A;  4BNC A;  3D0S A;  3Q9S A;  3RKW A;  3GX4 X;  3ZQ7 A;  1HBX G;  2GQQ A;  1GXP A;  4MGR A;  1OYW A;  1I27 A;  4FX4 A;  1PP8 F;  1KYZ A;  3DEU A;  3FWE A;  2XAH A;  4U0W A;  5IT9 Z;  3M9A A;  2RKH A;  1MDM B;  5CJ9 A;  1IRF A;  3E97 A;  2C6Y A;  4MTE A;  3ABU A;  3KET A;  1XMA A;  4I0A A;  3HSE A;  4EM2 A;  2V1D A;  2YU3 A;  4IVN A;  3QPH A;  1S29 A;  5AON A;  1J5Y A;  1FY7 A;  2ZJ2 A;  5D6E A;  5E8I A;  2V6C A;  3F23 A;  3EYY A;  5CVV A;  1R00 A;  2QVO A;  5JHU A;  2P7V B;  2DQL A;  2NYX A;  1BI3 A;  1XMK A;  4PGG A;  4DNC A;  1Z9C A;  2KKO A;  5HS9 A;  4ZYG A;  1DP7 P;  3K2Z A;  1P4W A;  2XAQ A;  3ULQ B;  2RGV A;  4G94 A;  2P5V A;  1I1G A;  1HKT A;  1SD4 A;  1PP7 U;  2W57 A;  4UVB A;  5HS8 A;  5EEG A;  3N4M A;  1QBJ A;  2QYO A;  3TQN A;  5KVR A;  2VBZ A;  3BZ6 A;  4HDV A;  3M1E A;  3I0T A;  2EFQ A;  1TNT A;  1IF1 A;  1KA8 A;  3E6M A;  3OV8 A;  2XV4 S;  2GZW A;  2FRH A;  4RGR A;  3I53 A;  4WXD A;  1Z7U A;  4KN7 X;  4EQQ A;  3V8K A;  3H3U A;  2MLK A;  2KJC A;  4EGZ A;  1G3S A;  3SXY A;  2QBY A;  2L3D A;  2OQG A;  4P96 A;  2HGC A;  2DU9 A;  3GO5 A;  4HA8 A;  4S04 A;  4R1H A;  3IRQ A;  3BOQ A;  4YII A;  1NHA A;  3DV8 A;  1BOA A;  2VOD A;  6PAX A;  1XCV A;  1K6O A;  3ML6 A;  1ZYR F;  3BPV A;  4ZYE A;  3VEP A;  4F7Z A;  1LEB A;  1QNT A;  2ETH A;  4A0Y A;  4CHU A;  2RVC A;  2VN2 A;  2OAZ A;  2RC4 A;  4HLY A;  1FBQ A;  3DKW A;  4M9S A;  3J80 K;  3R61 A;  3RJP A;  2JZY A;  4RB0 A;  1L0O C;  5HDN A;  2UXX A;  4M6Y A;  1LDK B;  4MEY F;  2YX4 A;  5L3D A;  3BY6 A;  2XGX A;  5JVT A;  5K5R A;  2VOP A;  2Y0M A;  4WXH A;  2IVM A;  5CLS A;  3IKV A;  1R1V A;  3GFI A;  3RTR A;  4LMY A;  1S6L A;  2FMY A;  1Z6T A;  4PCQ A;  1BC8 C;  3K1M A;  5BQT A;  4RGS A;  4G7Z F;  2ZCW A;  3F6O A;  1TQP A;  2R7D A;  4L0Y B;  5LGN A;  3RDI A;  1MJB A;  5F1R A;  3KP3 A;  1Q1H A;  4ENM A;  3GYH X;  3FZV A;  5JR3 A;  1PDN C;  1I5Z A;  1IUY A;  4JQF A;  2X4H A;  1SAX A;  3GLX A;  5D5V B;  2F5F A;  3F72 A;  5H6Q A;  1Z6R A;  1D8J A;  4L0Z B;  4OIO F;  1T98 A;  2EB7 A;  3WE2 A;  4D0P A;  5E1X A;  3GFJ A;  2A07 F;  2QQ9 A;  5KK1 A;  3FMS A;  5DYM A;  3HHH A;  3O6B B;  3WG9 A;  1WRJ A;  4RGX A;  4I0B A;  2PJP A;  1EH8 A;  2FXA A;  5FO5 A;  3WGG A;  4LB6 B;  3WE3 A;  2GWR A;  3WTS C;  1W4M A;  2H27 A;  3V7S A;  5HLI A;  4UNO A;  4ESB A;  3HUG A;  5FGM A;  3PQK A;  2HOE A;  1GXQ A;  5LGT A;  1XGM A;  3FM5 A;  5IT3 A;  3V7R A;  1XGO A;  3EET A;  1ZRC A;  2V79 A;  1SMY F;  2MLG A;  5DDG A;  2PMU A;  1O57 A;  1P6R A;  2RQP A;  3HSR A;  3U2R A;  2IA0 A;  1ZG5 A;  2BV6 A;  3JAM Z;  3RIR A;  2A61 A;  4AIK A;  3FX3 A;  5D5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...