3B73A

Crystal structure of the phih1 repressor-like protein from haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
NAMRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhiH1 repressor-like protein
publication title Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui.
rcsb
source organism Haloarcula marismortui atcc 43049
molecule tags Structural genomics, unknown function
total genus 28
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3b73A00
4Y17A 3GLXA 3FMQA 2MH2A 1U5TA 3I4PA 1OPCA 2EWNA 4ASNA 4RGSA 2CG4A 1IN6A 1O7LA 3J80Z 4UHTA 2FE3A 2KIUA 2XRNA 4WXDA 3ZMTA 4R1HA 1FWZA 1S3JA 3VB2A 4CXFA 1XGSA 1ZGAA 3QU6A 3LA7A 3LA3A 2JTVA 2IP2A 4P9UA 4L0ZB 1IN8A 1STZA 4BQAA 2K27A 5E20A 3V8LA 4WWCA 3FXUA 4CZZA 2EV6A 1SD4A 1KQ9A 2OZ6A 1ULYA 3E3VA 2P8TA 3IWZA 3H3ZA 1L0OC 1YLFA 3HOSA 3CO7C 1YIOA 3GW2A 4HOBA 3DQVC 2QBYA 2W85A 1ZARA 1MJAA 2O0YA 2LSOA 1AOYA 2EFNA 4GCVA 1LDJA 3Q5FA 4YFKF 4IPAA 5D4SA 1A04A 1R23A 4BXUA 2H94A 2FNPA 2L4MA 1MJBA 2LF7A 5JR3A 3IKVA 3QRFF 4A12A 4UVCA 5H6QA 1DUXC 1S8NA 5E1XA 3DV8A 3GZ5A 5J8CA 4R79A 4AIHA 1JE8A 1IZ1A 1CF7A 4Q47A 5FFZA 1IXSB 2F5EA 1TW3A 4IF4A 1UCRA 2BYVE 1TLHB 5FO5A 3GYHX 4B8XA 3KCCA 4M71A 3S2WA 1XMKA 1Q1HA 3SXYA 1T39A 1HXDA 5D6EA 4ZYEA 4PCQA 4LLLA 2DT5A 3QP5A 1J75A 5AIQA 3ULQB 2QWWA 3F6OA 3CTAA 5F6FA 2FU4A 4RAZA 3JW4A 3WTVC 4O6JA 2Y0MA 3L2CA 3U9GA 4LK1F 1QBJA 3WTXC 4HX8A 4N9IA 2Q2EA 2RC4A 1ON1A 2E7WA 4GYIA 2VT3A 3WGHA 1D8JA 3BWGA 3QAHA 4L9NA 1KQ0A 4LJZF 4KIGA 4YG2F 1MZBA 3ZN1A 2WC2A 4EJUA 1K6OA 3W6KB 2H27A 2VXZA 2EV0A 3AAFA 1V3FA 1XSXA 3I71A 4UV9A 1VTNC 4M9SA 4L5IA 1LEAA 2EFWA 4GXOA 2MC3A 3K1PA 3KLNA 1LNWA 3N4MA 3KE2A 4EJTA 1XSDA 4EV0A 2EV5A 3V7SA 1SFEA 4P96A 3FMRA 3L9FA 4OIOF 5K5QA 1MKMA 2G9WA 5TRDA 4H0EA 1FYKA 2IT0A 4EM2A 1IAWA 3BZ6A 1FC3A 2P5LC 4RGXA 1Z6TA 4S04A 1USTA 4G7ZF 4GO1A 5TJJA 3R0AA 3QP6A 4MEYF 4ZYDA 3F8MA 2ZNZA 4G8XA 1WSUA 2L02A 1ZLJA 2DAOA 5LHHA 3GO5A 2NAZA 1XGOA 5J8FA 2AXLA 4G6QA 2WV0A 2HEOA 5F64A 1FYMA 3TO7A 5DDGA 3GEZA 1R7JA 4Q4ZF 4P55A 5BS6A 3CUQC 4B09A 1YO5C 5HLHA 1P4XA 3SZTA 1JGSA 4MHGA 1I27A 4BHCA 1BBYA 2VE9A 2RQPA 3O3KA 2OBPA 2ZFWA 4IRGA 2ZMEB 3RKYA 3T5XA 5IT9K 2X0LA 2ZNYA 2D2WA 2HTSA 1J5YA 4A2UA 4LGWA 4ENKA 4MQ9F 1JHFA 2RN7A 4A5NA 5BQTA 1KQ8A 3EQLF 1G3SA 1LVAA 1XN7A 2ZKZA 1IRGA 4BAYA 3E97A 4KUMA 3ABTA 1GHCA 1S29A 1XGMA 2VONA 4I01A 3SZPA 2MBFA 1YQAA 4OOIA 2CW0F 3REOA 3F72A 2NRAC 3WODF 1FSEA 1U2WA 4NQWA 2LF8A 2OQRA 5ILSA 5JI6A 4E70A 1TQPA 5HDGA 3F3XA 5L3EA 4KN4X 1WWXA 1R1TA 3B73A 4I0AA 1MDMA 4L18B 1T6SA 5KVRA 2VBZA 4ZZDA 1HBXG 3P9KA 3R4KA 5DCMB 1EH8A 2UXNA 2ZJ2A 3QU3A 4PGHA 3I53A 2XUBA 2DQRA 5EEHA 3T8TA 2BBYA 3MZYA 3ELKA 3D5LA 1IN5A 2KIFA 2LDUA 5H20A 4K2EA 3GUDA 4PZJA 3IRQA 5DEQA 1BOAA 5A2QZ 3D0SA 3NRVA 1ZG1A 2YR2A 3ZMZA 2J5OA 3K1NA 4AD9A 4A6DA 2QLZA 3R6SA 5FGMA 3JAMZ 1R5HA 2BE5F 2RDPA 2HYFA 4LFUA 2P7VB 4GGGA 4PDKA 3GFLA 2V1XA 4EJOA 5LHIA 2Q8KA 2PG4A 2F2EA 3SQNA 3Q9VA 5ICCA 4RB2C 3V7RA 2ELHA 1D8KA 2IW5A 1REPC 2OQGA 4EGZA 1IXCA 2IA1A 5K5OA 2PMUA 5ED4A 2XROA 1EV7A 1HKQA 2WTEA 2VC1A 2XKPA 3ERED 1OYIA 1XB4A 4Q48A 2O3FA 3L09A 2NNYA 4O3MA 2DK5A 1P6RA 3WE3A 3ABUA 1YG2A 3CDHA 2FA5A 3F8NA 1FLIA 2LNBA 3LQQA 2CO5A 4LK0F 1H9GA 2JPCA 1T98A 1B1BA 1BI0A 1ZH5A 1O3QA 1YS7A 4JBAA 3TQNA 2ISYA 1KYZA 2W24A 1V4RA 2KIMA 4AVPA 3EUHA 4EM0B 5DUIA 1ZLKA 2DPUA 4A6EA 2GXBA 2XAHA 3FF5A 4R8HA 4PGGA 1XD7A 2Y48A 2PMHA 1FOKA 4HDVA 1XMAA 1RNLA 3IRRA 5LEKA 1YFHA 5AIPA 1T2KA 4NHJA 4G94A 1JXSA 1BJAA 3U2RA 5BMZA 1NHAA 4HV5A 2JSCA 2K4BA 4I09A 2CGPA 3RKXA 3WG9A 4U88A 1B9MA 3I59A 1SFUA 4RB0A 5CVVA 1DPRA 3CUQB 2K7LA 4HZFA 4L0YB 4IRIA 3RIRA 4JQFA 3FZVA 2YPRA 4UNOA 1P92A 1E17A 1FSHA 2YSRA 1SD5A 2R3SA 5LRRA 2P7CB 4I2OA 5D5XB 5CVJA 1UHMA 4ZYHA 4HX4A 5FFXA 4MTDA 5JHUA 4YFNF 2XAFA 1HSJA 5FLXK 1BI2A 4DNCA 2FRHA 2IA2A 2IRFG 2FF4A 4FX0A 1XCVA 5E1ZB 1BI3A 4UVAA 3BPVA 1YW9A 3K0LA 4AWXB 1F9NA 2XVCA 1X3UA 1U5TC 2LKPA 2RKHA 3T0YA 1ZAOA 3J81K 2DFIA 4L5JA 3MZHA 2Z33A 1RI7A 4XLPF 4LG0B 3K1MA 3N97A 1HSTA 4KIFA 2FMLA 2EA4A 2G7UA 2P5VA 2L54A 2XGXA 3F23A 3DEUA 5AONA 2CWEA 3W6JB 5LLQA 2HKXA 2IA0A 4U0YA 3DPTA 5BOXA 3KFWX 3K2ZA 4Z2YA 1I1GA 1BM9A 2O03A 1K78B 2A68F 2UXXA 1Z6RA 5KK1A 1K79A 5HLIA 2M45A 5CVUA 3O2PE 1DPUA 2PFBA 1USSA 1TNTA 5BPDA 5E17F 1ZRFA 3CO6C 1WI9A 5E1WA 2GQQA 1G3YA 2PN6A 2B0LA 3WGGA 4CDGA 2EK5A 4WCGA 3SFZA 2JZYA 3BJ6A 3H3UA 3ECOA 3MWMA 3CUQA 2HZTA 5CYVA 2K86A 2OD5A 3LFKA 2MA3A 4OIQF 1RZ4A 3E5XA 2MLKA 4S05A 4ESBA 1J59A 4CO8A 1T38A 4HAMA 1Z05A 2RNJA 4ON0A 3LAJA 4M9ZA 3L00A 1MJ9A 3RJPA 5HOOA 4A0XA 3WU1B 3RYRA 3TDUC 2QVOA 2PJPA 4P9FA 2IJLA 3HRUA 1R22A 1ZYRF 4RB1A 1FZPB 2Q0OA 2V6CA 2VOOA 3HYIA 1OMIA 2YU3A 5D6FA 2VE8A 4U7DA 2FOKA 3T8RA 1HKTA 4HF0A 3P9IA 2CQKA 4IVNA 4HW0A 5FD6A 1O3RA 2A6HF 4HLXA 4I7HA 4D0PA 5DD8A 1FYLA 2A3SA 1YW7A 3O6BB 3HTUA 1IN7A 2W84A 1WKMA 1KU2A 2BV6A 2QUFA 4A0ZA 3E5UA 2J5PA 1KA8A 3LAPA 1F5TA 1BIBA 2EFOA 4XSXF 4M6YA 3ZMSA 1B4AA 3DXJF 3QPTA 3TOBA 2H6CA 4YIFA 1BC8C 4BH9A 2A07F 1G4DA 2KKOA 2R7DA 2DTRA 3CJNA 1XDUA 5ERIA 3EYYA 1FX7A 5ICGA 1XDSA 3R0JA 2MD5A 4FX4A 3BOQA 3BJOA 4Y15A 3ZMUA 1OR7A 1TBXA 3PQJA 1J0RA 1H0MA 4MTEA 4ENNA 2RGVA 1B59A 3G73A 3GF2A 1OKRA 4UVBA 3BDDA 2DW4A 1LQ1A 1YS6A 2H09A 2MH9A 2Z99A 1ODDA 3F6VA 4OIRF 4KNYA 2M30A 2XAQA 3J7AO 3MCZA 5L3DA 3TO9A 2EFQA 1W5SA 3VODA 2QQ9A 2HGCA 4LMYA 1HW2A 1G3TA 4P5OA 2OAZA 2VBYA 5LGNA 5DUKA 3GXOA 5ILUA 5D5UB 3IC7A 1ON2A 3PQKA 1FY7A 1FBSA 3FXQA 1U5TB 4U0WA 3ZP5A 2ACJA 2KJCA 2ZBKA 4AIKA 1QQIA 5LGUA 2GA2A 1XSVA 3IKTA 2O61A 2XIGA 3R60A 1GXPA 1BN5A 5ILVA 1SMYF 1SMTA 4WX9A 3KP7A 3RPUA 4HX7A 3GVAA 2QYOA 2V79A 4WK8F 4M73A 2VBWA 5BPIA 1H9TA 3C3WA 3FM5A 3B02A 1R1UA 5DCFA 4HYEA 3F8FA 3RKWA 2M87A 2V9VA 5E8IA 3GX4X 3HHHA 2HTJA 2A69F 2H6BA 5CLSA 4XLNF 3JTHA 2L4AA 3OV8A 2TDXA 3V7CA 1FT9A 3C1DA 5J6XA 4L9VA 2RV8A 2FSWA 2DU9A 2K4JA 5LEJA 3WTTC 4UUVA 2GZWA 2GAUA 2A5YB 2ESNA 1G6NA 3QOPA 3R61A 4CGZA 2AS5F 3TGNA 2W57A 1U78A 2QBYB 4KN7X 4KIBA 1FP2A 4HBLA 3JSOA 3BY6A 2FBHA 4XRFA 4XSZF 3V8KA 2IPQX 1RUNA 3F21A 3LSTA 4IHTA 4MNUA 2JRTA 4ENMA 4OMYA 4YIIA 5JFRA 3H92A 3WTSC 3GWZA 3DKWA 3FXRA 4EJWA 1TW2A 1OYWA 3FX3A 1OYYA 2ZMEA 1S6LA 4OU0A 3M8EA 2PLYA 4M74A 4I0BA 2QENA 4MGRA 1QNTA 2M8EA 4YFXF 1TTYA 3BP8A 1K7AA 4ESJA 5ICEA 3F22A 4KMUX 1I6XA 3VOEA 4BHPA 4EGYA 5HLGA 1SAXA 3HIFA 3KP2A 2HQNA 1HKSA 2MLGA 4BNCA 2O8XA 4XBFA 2YX4A 1PP7U 3F8CA 5IT9Z 2VN2A 1ZRDA 2R7FA 1CGPA 3IWFA 3I54A 1ZHFA 3DP7A 1YTYA 4MQVA 2HFHA 2QQBA 5LGTA 2D1VA 2F5CA 4QWQA 2P6SA 1PDNC 3DPLC 1ZREA 2Z9OA 4KFCA 3GZ6A 1FNNA 5F1RA 4HQMA 3COAC 1EH6A 5HDNA 3PFIA 4LB6B 3I5UA 4A5MA 3LWFA 5DCMA 1J9IA 2Z3YA 2PEXA 3K69A 2RVCA 2C6YA 3KEQA 1W4MA 3OOPA 5LRSA 1R00A 1QPMA 4KICA 4WXHA 2CYYA 2DLLA 1TNSA 4QLCU 1TQIA 3G3ZA 5D8KB 1HW1A 1ZN2A 1Z7UA 4NB5A 4FT8A 3GFJA 2FBKA 4KMFA 5HS9A 4L9TA 4LLNA 3C18A 1G3WA 3E5QA 3FMSA 3SHFA 2HR3A 1R5GA 3MAJA 3NEUA 5H6RA 2YX7A 4U7BA 1TQMA 1F1ZA 1ZG3A 3T1BA 4BHBA 4N9HA 5FD5A 1LJ9A 2DK8A 2FQ3A 1J7KA 2M5WA 2V1UA 2PBIA 4RGUA 1P2FA 1L3LA 3WTUC 4I02A 3TOAA 3KP6A 2XAGA 1R36A 1LEBA 3KETA 5D8LB 1SD6A 3ZMDA 2STTA 1MGTA 2XHKA 1IRFA 1KU7A 3RYPA 4G7OF 2PQ8A 3E6DA 5DYMA 2EB7A 1W5TA 5JVTA 4ZZLA 1KGSA 2WWYA 2K02A 3C7JA 2X4HA 3MFKA 1R58A 1SFXA 2HKOA 1GXQA 3HSFA 2IVMA 4ETSA 3VEPA 4UXNA 1WQ2A 3RPQA 1ZGJA 4M72A 3F8BA 3HHGA 3HSEA 2DBBA 4KA4A 3V4GA 2NNNA 4UV8A 2O6GE 3EYIA 5HS7A 2VOPA 4F7ZA 2EJRA 3FM3A 2Z5UA 5L3BA 4GYGA 2ZXJA 3GFIA 2JPBA 4IRHA 4G6DA 5K1YA 3MEXA 4CHUA 2COMA 1I1SA 4RAYA 2EA2A 4FHTA 2XASA 3HTSB 4A0YA 2HYGD 4O5VA 5IT3A 2HDCA 5CVIA 2UZKA 2M1BA 2FBIA 1KU9A 4OINF 4EQQA 2D1HA 1PP8F 4TV7A 5L3FA 1Z9CA 1EH7A 1KU3A 2PI0A 3I0TA 1ONVA 1BC7C 3TDZC 4DQ2A 4N0BA 1DP7P 2DPDA 2CSOA 3M7GA 3MQ0A 4CICA 1S7AA 2Y75A 2NS0A 1FBUA 2ADUA 2VODA 3HRTA 4HLYA 4EMSA 2FEZA 3ROUA 4KT5C 1AWCA 4Q5SF 1DDNA 2E1CA 1MDMB 5D4RA 4G7HF 3M9AA 1FP1D 2HS5A 2DI3A 3HRMA 4IJAA 1R1VA 5A2QK 3WU0A 1J2XA 5D5WB 5HDKA 1YW8A 5HVQC 1C0WA 3EDPA 2STWA 3JAMK 2G7HA 1T0FA 3WE2A 5CVRA 5FLXZ 1W7PB 4RB3C 2XKOA 5FB2A 2HOEA 3ZN0A 2OZUA 2QQAA 2E1NA 4LG0A 2DQLA 4EVIA 5E8GA 3KZZA 2A6EF 1ZG5A 2VC0A 3HSRA 4JK1X 4RGRA 5ICFA 2HWVA 2F5DA 2FMYA 3BPXA 1HW5A 3KP5A 3NQOA 3J81Z 4HV6A 4M9XA 3RTRA 3M8FA 1K78A 4CYDA 3EETA 5DV5A 3IL2A 2V1DA 4I98B 2L3DA 1IF1A 2OA4A 3ZQ7A 2A61A 2CFXA 1XCBA 1SD7A 3KLOA 1B9NA 1BIAA 1LDDA 2ZCWA 3IHUA 5L3CA 1JHHA 6PAXA 2L01A 4WF2A 2EFPA 3HRSA 3E6MA 1U6GA 3WTWC 2KJBA 2NYXA 1ZRCA 2XV4S 3BJAA 3RDIA 3Q9SA 1I5ZA 1W7PD 1IW7F 4G9YA 3J80K 1LDKB 3ZMVA 2BGCA 1Y0UA 1QZYA 3DF8A 1GVJA 1QO0D 3FWEA 3M1EA 4WXCA 2GIVA 3P9CA 5K5RA 2JT1A 1XGNA 3K9TA 1FPQA 1S7OA 3U1DA 1KYWA 2FXAA 2UWMA 1WRJA 4KDPA 2QM3A 2QZ8A 2OU2A 2BEOA 3FHZA 3KP4A 1P4AA 4RS8A 2ESHA 4IHSA 1LB2A 3VFZA 4ZYGA 3BROA 3TO6A 2ETHA 5L3GA 2HQRA 3TKYA 3CLOA 3KP3A 1Z91A 5E18F 2ISZA 1O57A 3L7WA 4HF1A 1BI1A 2DO7A 3WTYC 3KZYA 5CJ9A 3E6CC 4M6XA 1PUEE 1YYVA 2W25A 3I59B 4OIPF 4EJVA 1U8RA 1O3TA 4HDUA 4EM1A 4ZH4F 4BYYA 3ML6A 1FBQA 3LQRA 4ENJA 4LD5A 1W7PA 1QZZA 1B6AA 3WGIA 3I58A 2GA1A 4Y13A 1UHWA 4AIJA 1P4WA 3E6BA 1IN4A 1Z1DA 2XAJA 3JTGA 2D45A 4HA8A 3CUOA 4KYWA 3HUGA 3DFGA 3GFMA 2VT2A 1IXRC 4L9JA 1UB9A 3ISPA 2P5KA 1D3YA 3P7NA 1IUYA 3ECHA 1D5VA 5DD4A 4MEXF 1O7FA 2KRFA 3WTZA 5HS8A 1QGPA 5D5VB 4U0VA 2P6TA 1F4KA 5LHGA 3V8JA 4HQEA 4OMZA 2P4WA 1RIOH 4IXAA 2VBXA 3HOTA 4LLGF 3LA2A 2E7XA 3ZPLA 3KEOA 2FNAA 1UFMA 1U3EM 1O3SA 2GWRA 2F5FA 4HF2A 1CF7B 3RI4A 1E2XA 3I64A 4ESFA 1RUOA 3JSPA 4LB5A 1MD0A 3QPHA 5LBQA 2ZO4A 1HQCA 2GXGA 5EEGA
chains in the Genus database with same CATH superfamily
4Y17A 2KHMA 3GLXA 3FMQA 2HDDA 2MH2A 1U5TA 3FHNA 3I4PA 3HKZA 1OPCA 4XKCA 3TW6A 1SVOA 1XTAA 2EWNA 4Y33A 1YITI 4ASNA 5J1YA 4RGSA 2CG4A 1PVEA 1JJ6C 1IN6A 1O7LA 5IPAA 3OYBA 3J80Z 5B1BH 3F0CA 3HOVJ 4UHTA 2FE3A 2KIUA 4A3BJ 2XRNA 4XLFA 2IGOA 4WXDA 2ID3A 3ZMTA 4R1HA 3BC8A 5IYDJ 4W1UA 2LP0A 3JR9A 2D5VA 1FWZA 1E3HA 2I10A 2XF7A 2DMTA 5GPAA 1S3JA 3VB2A 1WFXA 1IV8A 1D1AA 2LC2A 1XGSA 4CXFA 1ZGAA 3QU6A 5EZGA 3LA7A 4DW6A 5E3NA 2LFBA 3LA3A 1WJCA 2JTVA 2IP2A 4P9UA 2ZJPF 1LFBA 4L0ZB 3AKZA 1ZTRA 1IN8A 1HDDC 3FKJA 1STZA 2I5UA 3H0GJ 4B48A 4BQAA 2K27A 5E20A 3V8LA 1V5GA 4WWCA 3FXUA 1JKOC 4CZZA 2HZDA 2EV6A 1MH4A 1SD4A 1ITYA 2R7ZJ 1KQ9A 2OZ6A 1ZGWA 3OIOA 1UAAA 1RKTA 2OV7A 1ULYA 4ZYAA 3PUBA 4AYBA 5EYRA 3CDIA 2M4KA 3E3VA 2P8TA 3G1OA 3H5AA 3IWZA 2NVYJ 3H3ZA 1L0OC 3CP8A 1YLFA 3DWLE 5IOZA 3HOSA 5FJ8J 2E34A 2HQAA 3CO7C 1YIOA 3GW2A 1T95A 4IHWA 3X2QH 2OCEA 1OCRH 2X1EA 4HOBA 3DQVC 2HQ5A 2QBYA 1MBEA 2ZMEC 2HOTA 2W85A 3Q0UA 1ZARA 5HLTA 3JRAA 2EIMH 2VQLA 4FE7A 1MJAA 4F52A 3H36A 2O0YA 2LSOA 2CW7A 2CQ7A 1AOYA 1SFOJ 2EFNA 2DYSH 1JJ8C 4Y7NJ 1GLNA 4GCVA 1LDJA 3FXOA 5FKMA 4AVZA 4YFKF 3Q5FA 4IPAA 3LSKA 2CV0A 5D4SA 4BXFA 1IG7A 2B63J 1BR1A 3VYUB 3BLYA 1A04A 4J19A 1TZLA 2GOXB 2BY0A 1R23A 4BXUA 2ELKA 2H94A 2FNPA 2XPUA 2L4MA 2OCCH 1MJBA 2JJ7A 1RR8C 2M0CA 3ASNH 3BG7A 4DGWB 1XPXA 2AQEA 2LF7A 5JR3A 2DOEA 3IKVA 4CCKA 3HDDA 1BR2A 1VQOI 4E7ZA 3QRFF 1VQ7I 3EUKL 4A12A 1TC3C 2IGMA 4UVCA 2R7OA 5H6QA 4HNTA 1DUXC 1UG2A 3OS0A 3I3LA 1S8NA 1YX3A 1R6RA 1X58A 4C3IJ 1TWGJ 2ZSIB 3VYTB 1IO2A 2MG4A 2BXZA 5E1XA 3L1PA 3DV8A 4GDFA 3GZ5A 2KDZA 4C2UA 2Y30A 2PMZN 5J8CA 4R79A 3FDYA 4AIHA 4KITB 1ETWA 4MFEA 1JE8A 1IZ1A 4PSWA 3L2VA 1CF7A 3I4MJ 1I3QJ 2B7EA 3MKYB 1HCRA 3OYLA 5EGOA 5J3LA 3CJQB 4HSTA 4Q47A 1A6IA 1BA5A 3KYDB 5FFZA 1IXSB 4D9JA 5K7ZA 2F5EA 3W3CA 1TW3A 2HYJA 4IF4A 3ZQHA 2KRHA 1UCRA 2BYVE 1JTXA 1TLHB 5FO5A 3GYHX 1WHUA 4B8XA 4W97A 3KCCA 4D5CA 2HVQA 1LFPA 4M71A 3S15J 3S2WA 3OIPA 1XMKA 1FMWA 1Q1HA 3SXYA 1T39A 1HXDA 5D6EA 1NK2P 3ZQQA 5EDNA 4ZYEA 4PCQA 4LLLA 4XKVA 2DT5A 3GTQJ 3QP5A 4C3HJ 1FIPA 3I55I 2OPTA 1J75A 2DA4A 1B8IB 5AIQA 3ULQB 2QWWA 2QGUA 4Y52J 4JOMA 3KPHA 3F6OA 3CTAA 5F6FA 1JT0A 2FU4A 4RAZA 4XKBA 2L9VA 3CCUI 3JW4A 2WAFA 2IBDA 2W00A 3WTVC 4DBQA 4O6JA 1NG6A 2R93J 2Y0MA 3L2CA 2DDAA 2KZGA 3W2AA 2CV2A 3U9GA 2ZB9A 4LK1F 1A6QA 1QBJA 3WTXC 4HX8A 3BG6A 4N9IA 2Q2EA 3BT9A 2M2EA 2RC4A 2E19A 4BEHB 1LKXA 1ON1A 1CQTA 4B43A 2E7WA 4GYIA 2VT3A 3NAUA 3WGHA 2E71A 1D8JA 4IOAF 1HC8A 3BWGA 3QAHA 1JUSA 3A03A 2ELJA 4L9NA 4XKWA 3UNGC 2FOWA 3VSLA 1KQ0A 4LJZF 4KIGA 4YG2F 2CQXA 1GVDA 3IAS2 3PIOF 1MZBA 2KISA 3ZN1A 2WC2A 2R5YA 1ORKA 4EJUA 1K6OA 3W6KB 3EPZA 2H27A 2VXZA 5IOYA 2EV0A 3D5SC 3AAFA 5EEAA 1V3FA 1XSXA 3I71A 3BTIA 4UV9A 3ZOBA 4IZZA 1VTNC 2DA7A 2XPVA 1A31A 4M9SA 3OIQA 1S5LC 2K3PA 3M1CA 4L5IA 1LEAA 2EZKA 3OOUA 2EFWA 4UUSB 4GXOA 2MC3A 3HM5A 3JRBA 2QQ8A 1PJRA 2ZC2A 3K1PA 3KLNA 1LNWA 3N4MA 3KE2A 4EJTA 1XSDA 2JSPA 4F92B 3S3OA 2Y2ZA 3EUAA 2Y9YA 4EV0A 2EV5A 3V7SA 1SFEA 2XGDA 1OFCX 4BE1A 1K6YA 3IUOA 4HSRA 3HC7A 2LG4A 4P96A 2M4GA 3FMRA 3L9FA 4OIOF 5K5QA 1MKMA 2G9WA 5F27A 1W36D 2NOGA 1X1BA 1X19A 3QPLA 4H0EA 5TRDA 1FYKA 1WCMJ 2IT0A 4EM2A 1IAWA 3BZ6A 1FC3A 4Y4RA 4DZPA 2P5LC 4RGXA 1Z6TA 4NBQA 2KDOA 3O8GA 4S04A 1FOYA 1USTA 4G7ZF 4GO1A 1LFUP 2W1OA 3U1KA 5TJJA 3R0AA 3QP6A 4MEYF 4F55A 2VJIA 2R5ZB 4ZYDA 3F8MA 2ZNZA 4G8XA 1WSUA 4C3JJ 2L02A 1IC8A 1ZLJA 2DAOA 4EEFG 5LHHA 3GO5A 1LPQA 2NAZA 1XGOA 2VQGA 2E35A 4HEA2 5DS9A 1RR7A 5J8FA 4RBOA 2LD5A 2AXLA 4G6QA 1Y8RB 2WV0A 2HEOA 5C4XJ 3RZOJ 1JTYA 3PUFA 5F64A 1FYMA 3TO7A 4II2A 4YELA 5DDGA 4A3LJ 2F6CA 3CQZJ 4G6TB 2LBFB 3GEZA 1R7JA 4Q4ZF 2JWTA 3H3VK 4P55A 5BS6A 3CUQC 4N4OB 2HPIA 3U21A 2VKEA 4B09A 3G2BA 1YO5C 5HLHA 4NUBA 3BZKA 3M8JA 2R7RA 2RQQA 1P4XA 4PK4A 2P81A 2QSGX 2PMZA 3SZTA 1JGSA 4MHGA 1G8XA 1YRNA 1I27A 4BHCA 2ZXHA 1BBYA 2VE9A 2RQPA 4E4HA 1Z67A 3O3KA 3ABMH 4MFDA 3Q0WA 1O4XA 2OBPA 2ZFWA 5JLXA 3CC7I 4IRGA 4ITVA 4XRSA 2ZMEB 3RKYA 3T5XA 5IT9K 4A3JJ 3DKYA 2VJ4A 2X0LA 2ZNYA 4AIDA 3TL4X 1U8BA 3JRDA 1BL0A 2D2WA 2HTSA 1J5YA 4A2UA 4LGWA 4ENKA 4MQ9F 1JHFA 3J7AY 2RN7A 4A5NA 5BQTA 1AKHB 3QYEA 1KQ8A 2R7WA 2DFHA 3EQLF 1G3SA 1LVAA 3MKWB 2K9SA 1XN7A 1A35A 2ZKZA 5M5WJ 1IRGA 3BG9A 4BAYA 3LMMA 5DTDA 3E97A 4KUMA 3ABTA 1GHCA 4PJMA 3PM1A 1S29A 1XGMA 2W48A 1SFKA 3IH3A 2VONA 4CCOA 4I01A 2ID6A 3SZPA 2MBFA 3GTMJ 1YQAA 4OOIA 2CW0F 3REOA 3F72A 1VI0A 2K9NA 2NRAC 3WODF 1FSEA 1U2WA 4HG2A 1VQ5I 4NQWA 2LF8A 2OQRA 5ILSA 1Y6IA 5JI6A 3FXLA 4E70A 1H8AC 1TQPA 1T0FC 1OLTA 3DTKA 5HDGA 2MW8A 1FTTA 3LNQA 3F3XA 4JX5A 5L3EA 2CUZA 4KN4X 1WWXA 5HNHA 1R1TA 2CUJA 3B73A 1WPKA 4I0AA 3RCOA 1VQ4I 4LITA 4A69C 3A4CA 1MDMA 4L18B 1T6SA 3BR6A 1K4SA 3MD2A 5KVRA 2JA8J 3AL0C 2VB6A 2BW3B 5JHFA 2LRDA 5E79C 1VNDA 2VBZA 4ZZDA 1HBXG 3GTJJ 3P9KA 1X4PA 3R4KA 5DCMB 1V5FA 3S16J 1EH8A 2XSJC 3S14J 4BJTA 2E2JJ 4JP0A 2UXNA 3LSHA 5CQEA 5KAIC 2ZJ2A 3QU3A 3CCEI 4PGHA 3I53A 4PFOA 2XUBA 2DQRA 5EEHA 4II3A 3T8TA 2UUZA 2K9QA 3OYKA 1S7EA 5EF6A 4ZC3A 1M1EB 2BBYA 2DFEA 3MZYA 2CH0A 3ELKA 2AXTC 1JUPA 3D5LA 2QA4I 1IN5A 2KIFA 2LDUA 1OISA 5H20A 4K2EA 3GUDA 2HVSA 4PZJA 2JA2A 3IRQA 1N77A 5DEQA 1BOAA 5A2QZ 3D0SA 3NRVA 2VKDA 1ZG1A 2YR2A 2IGNA 3ZMZA 3IV5A 2J5OA 4NC6A 3ZQLA 2KZVA 2QSFX 3D5RC 2V4JC 3K1NA 1TWAJ 4AD9A 4A6DA 2HDWA 1EA3A 2QLZA 3R6SA 4BS9A 4XOPA 2MYSA 5FGMA 2QKLB 2Z16A 3JAMZ 2LVSA 4XLCA 1R5HA 4RMNA 2BE5F 2RDPA 2HYFA 4LFUA 3ZRGA 2P7VB 4GGGA 2GBYA 1VQLI 4PDKA 3PO3J 3GFLA 5B3SH 2V1XA 1WJBA 4B1RA 4EJOA 5LHIA 4M3GA 2Q8KA 1F36A 3AG3H 2PG4A 1BW5A 2F2EA 3SQNA 1S72I 2XB5A 4V2FA 3HPHA 3Q9VA 5KCMA 5ICCA 3C2BA 4RB2C 3SEQA 2LY2A 2CFOA 4CYCA 2XC7A 1DU0A 1MMAA 3V7RA 2DCEA 3QOEA 5F08A 3PIPF 2ELHA 1D8KA 3PNTA 2IW5A 5F0FA 1REPC 3BQZA 1DGRM 2OQGA 3PNYA 4EGZA 1IXCA 2IA1A 2JA7J 1HF0A 3LL7A 4E7HA 5K5OA 2PMUA 5J1RA 1JKPC 5ED4A 2CUFA 2XROA 2FUG2 3HOYJ 1EV7A 1HKQA 1ETOA 5FKOA 1MBFA 3OYIA 3FXJA 2WTEA 2VC1A 2W82A 2XKPA 1TT0A 3ERED 1OYIA 3G4SI 1XB4A 3MMYB 4Q48A 2O3FA 2VIXA 3L09A 3I4NJ 2BHYA 2NNYA 4O3MA 1NTCA 2DK5A 1P6RA 3WE3A 5IY5H 1PYVA 2BVLA 3ABUA 2ZJRF 5GP9A 3K4KA 1YG2A 2KIQA 4DOZA 2H1KA 3CDHA 1I50J 2FA5A 3F8NA 1G59A 1FLIA 1HDPA 2LNBA 3LQQA 2CO5A 3OYCA 4LK0F 2L0KA 1H9GA 2WAEA 4XOTA 1SANA 4BXXJ 3DKXA 1UMQA 2JPCA 1T98A 1B1BA 1BI0A 2KPMA 3CP2A 1ZH5A 1O3QA 2DOFA 2KT0A 5J40A 1YS7A 2BOLA 3KZIC 4JBAA 2ISYA 3TQNA 2VPRA 1KYZA 2W24A 1V4RA 3QYBA 3K70D 5F0CA 2KIMA 4AVPA 2R7QA 4DJAA 3ASOH 3EUHA 4EM0B 5DUIA 3GTOJ 1LVKA 4QPOA 5F04A 3BG3A 5F0HA 5M3FJ 2XF6A 1ZLKA 3JRGA 3IH4A 3VDXA 4A6EA 2DPUA 4C30A 1ETQA 2GXBA 2XAHA 3FF5A 4AUXA 2DDBA 4R8HA 4XM3A 4PGGA 1FTZA 1XD7A 2Y48A 2PMHA 2HI3A 3L2WA 1FOKA 1S9HA 2P0WA 2K9LA 2DJNA 4HDVA 1XMAA 3H0DA 1RNLA 3IRRA 1VQ6I 4MO7A 3H9QA 3VYSB 5LEKA 1YFHA 5AIPA 1MBJA 1T2KA 4NHJA 1LE8B 2QKMB 2BW3A 4G94A 1JXSA 2WY7Q 3BQYA 1YIJI 1BJAA 1LUJB 3U2RA 5BMZA 1NHAA 4HV5A 3S3NA 2JSCA 2X6XA 3C2HA 2K4BA 4I09A 2CGPA 3RKXA 3WG9A 4U88A 3IH2A 4HPQA 1B9MA 3I59A 1SFUA 4RB0A 5CVVA 1DPRA 3CUQB 2UV1A 2K7LA 4HZFA 4L0YB 4IRIA 3S1RJ 3RIRA 1XG1A 4BJ5C 1P7IA 2JVHA 5B66C 2IS4A 2KQRA 4JQFA 2DA6A 2HOAA 2YPRA 3FZVA 4UNOA 3VPRA 2R92J 1P92A 3BR1A 1E17A 1FSHA 2CV1A 4XICA 2YSRA 4A3MJ 1F43A 5HODA 1SD5A 2ZFUA 4J01A 2R3SA 2IAIA 1G2HA 5LRRA 2P7CB 2KMUA 1OCCH 1Y1WJ 5KNLA 4I2OA 5D5XB 1P7JA 2HXOA 5CVJA 1UHMA 4ZYHA 4CH7A 3KEYA 4XRSG 4HX4A 3A0HC 5FFXA 3OL3A 3FXKA 2DYRH 2E1OA 3OSFA 3FKIJ 2X6WA 2V7FA 4MTDA 4N4NB 5JHUA 2I8DA 4YFNF 2XAFA 1HSJA 5FLXK 2IS2A 3LSJA 1BI2A 1WJ5A 1R49A 2IGKA 4DNCA 4BDZA 2FRHA 1WI3A 2IA2A 4AC0A 2IRFG 2FF4A 4P1WA 1ETXA 4I6ZA 3HPGA 2X1CA 4FX0A 4PFPA 2F4OB 4RAGA 5GTIC 2JA5J 1XCVA 5E1ZB 1BI3A 4UVAA 3BPVA 4CZCA 2VQHA 1YW9A 2VI6A 3K0LA 4AWXB 5F1JA 1F9NA 1R4MB 1E3PA 2XVCA 4RLQA 3OY9A 4HNUA 2BY3A 1X3UA 1U5TC 2LKPA 2RKHA 4G12A 3OYNA 3T0YA 3E0JB 2E60A 4X1EA 2ECBA 1ZAOA 1ETYA 3J81K 2DFIA 2X85A 3NWSA 4L5JA 4QPQA 3MZHA 5M5YJ 1RI7A 4GRIA 2Z33A 1YJ9I 4S0HB 4XLPF 2QSHX 1KONA 4LG0B 3K1MA 5GAGJ 3N97A 1HSTA 3AL0B 4KIFA 2FMLA 4CCMA 2EA4A 2G7UA 2P5VA 2L54A 1OCZH 2XGXA 2WAQA 3ABLH 3F23A 3QWLA 1N78A 3DEUA 5AONA 2CWEA 5GTHC 3W6JB 2E2HJ 5LLQA 2HKXA 2IA0A 2VKVA 4L5EA 4U0YA 1Y39A 5GPCA 3DPTA 4NC7A 1GUUA 5M5XJ 5BOXA 1ACIA 3BR2A 2L5QA 3KFWX 3K2ZA 4Z2YA 3QYFA 1I1GA 3OYEA 1BM9A 2O03A 3JREA 1K78B 2CQQA 1WJFA 2A68F 3CCYA 1FMVA 1Z3XA 2A5WA 1MBKA 2UXXA 3HGGA 1Z6RA 3S32A 5KK1A 2B9SA 1K79A 2X9DA 1MNMC 4PJNA 4I76A 4IOCF 4BY1J 1OCOH 1P9QC 3MZ8A 5HLIA 1D0YA 2M45A 5CVUA 3O2PE 5EJCA 3FXMA 1DPUA 1QVUA 2PFBA 1USSA 4JX4A 3WHCA 2AQFA 3VYRB 4D7NA 2GXAA 1TNTA 2VASA 2E5NA 2XSDC 2OTJI 1X1PA 1HLVA 1WH7A 4V19K 4XMYA 5BPDA 5E17F 3PSFA 1ZRFA 3HGYA 3CO6C 1WI9A 5E1WA 5JVGF 2GQQA 1G3YA 1TWCJ 2EZHA 2PN6A 4CA0A 2B0LA 4KJZA 1A5JA 3WGGA 1VQKI 4CDGA 1AHDP 2EK5A 4WCGA 1R4NB 5FROA 2FD5A 3SFZA 3MKLA 2JZYA 3GZNB 3FBNB 3BJ6A 3H3UA 3ECOA 2ICWG 1Y0NA 3MWMA 5E3MA 3CUQA 3A01B 2HZTA 5CYVA 4BBRJ 2K86A 2OD5A 3LFKA 5K7HA 2MA3A 5HNFA 1RZ4A 3E5XA 4OIQF 1N25A 3TBIA 2H8RA 2MLKA 4XN3A 4LOCA 3BR0A 4IX7A 2BVMA 4S05A 3LFUA 1MNEA 4ESBA 1J59A 5CQGA 4CO8A 2LLKA 1T38A 2HVRA 1W1WE 3GMEA 4HAMA 2TCTA 1Z05A 3LSRA 4YRVA 2RNJA 4ON0A 1Z7LA 2XB0X 3LAJA 2XDVA 4M9ZA 3H9JA 4IEJA 4ZTFA 1MBGA 1MJ9A 1MMNA 1V55H 2DFFA 2XAUA 3L00A 3RJPA 4A0XA 5HOOA 3CDLA 3WU1B 3RYRA 3MKZA 3TP3A 3TDUC 1GT0C 2QVOA 4BKXA 2PJPA 4P9FA 3ONQA 1JT6A 2IJLA 3HRUA 4PJLA 1R22A 4YIRX 1ZYRF 4RA2A 4V2GA 4RB1A 1FZPB 1MMGA 2Q0OA 1T56A 2V6CA 1YE9A 5IYBJ 3CCMI 2VOOA 3HYIA 1QHHD 1OMIA 3K4MA 2YU3A 1W0TA 3CMMA 2MFZA 5D6FA 2VE8A 2MABA 3N05A 4U7DA 3GTPJ 2FOKA 3T8RA 1HKTA 4HF0A 5EZHA 3P9IA 3CF5F 4XLHA 2CQKA 3ABKH 4HW0A 4IVNA 5FD6A 1O3RA 2A6HF 3DTEA 2COBA 4HLXA 4I7HA 4D0PA 5DD8A 3UKGA 3E1SA 4F93B 1FYLA 4UUTA 5CKTA 2A3SA 1YW7A 3O6BB 3HTUA 1IV6A 1IN7A 3CC2I 2W84A 3FK7A 1ZK8A 1WKMA 3VSKA 1KU2A 2BV6A 2YUSA 2NVTJ 4E6KG 2QUFA 4A0ZA 1QZEA 5EG0B 3HOXJ 2VXDA 4ZDOA 3E5UA 2J5PA 5LFAA 1KA8A 3DEEA 3LAPA 1F5TA 1BIBA 2EFOA 2OUMA 4M6YA 4XSXF 2AO9A 2O9LA 3ZMSA 1B4AA 3DXJF 4CCJA 3QPTA 4BQOA 3S1MJ 2H8WA 3TOBA 2H6CA 1WJEA 2M9HA 4BH9A 2DA2A 3KX2A 4YIFA 1BC8C 3BCBA 3L2RA 1D1CA 2A07F 4E7LA 1G4DA 2KKOA 2R7DA 5KAFC 1ENHA 2DTRA 3CJNA 1XDUA 4RLFA 5ERIA 3DLLF 5FRMA 3EYYA 1FX7A 3A2KA 5ICGA 4A3KJ 1XDSA 3H5NA 1UZCA 3R0JA 4IL6C 2MD5A 1IDZA 3AG2H 3RPUD 4FX4A 3BOQA 3BJOA 4Y15A 2EZLA 3LSGA 3ZMUA 1DP3A 4UB6C 1OR7A 1XX5A 4XRMA 1TBXA 2DA1A 4DBRA 3PQJA 4CUGA 3OYMA 1J0RA 3C2GA 1H0MA 3HOUJ 4MTEA 4ENNA 2RGVA 1B59A 1D0ZA 3G73A 3GF2A 1OKRA 2M8GX 4UVBA 3BDDA 3DLAA 4PJJA 1MIJA 2DW4A 3K4CA 3PNVA 1LQ1A 3CZ6A 1U9OA 2DMQA 3OMYA 3TMOA 1YS6A 4E7IA 2W4SA 2H09A 2MH9A 2Z99A 5E3OA 1ODDA 3F6VA 2XF5A 4OIRF 2EH3A 1IDYA 3QPSA 2M30A 4KNYA 1TT5B 2XAQA 3J7AO 3MCZA 2WADA 5L3DA 3TO9A 3OSGA 2EFQA 1W5SA 3JCUC 3VODA 1B8IA 3K10A 1B72B 4FISA 2QQ9A 1FJLA 2HGCA 2V6EA 1UHSA 1PUFB 4IHYA 4LMYA 2FX0A 2DA5A 1HW2A 1G3TA 4P5OA 1NG7A 2OAZA 5B5EC 2VBYA 1Z21A 4QIWN 3RSNA 2L7MP 2ZSHB 3K4LA 2VJ5A 3SYTA 3CLQA 5LGNA 3HEFA 5DUKA 3GXOA 5ILUA 5D5UB 3IC7A 1ON2A 4BBSJ 3PQKA 1FY7A 3GTLJ 4BEHA 4BU2A 1FBSA 3FXQA 3A01A 2XGEA 4UB8C 1U5TB 2F4MB 4U0WA 3ZP5A 2ACJA 2KJCA 5IP6A 2ZBKA 4AIKA 1QQIA 2IS1A 2EPFA 5LGUA 1WJDA 2GA2A 1XSVA 3IKTA 2O61A 2XIGA 2F48A 3GLLA 3R60A 3P5JA 1GXPA 1BN5A 5ILVA 1SMYF 1SMTA 3JRHA 4WX9A 1QA6A 3KP7A 3RPUA 4HX7A 3GVAA 5DM6F 2HXIA 2QYOA 2V79A 4WK8F 3H1CA 4M73A 1VF9A 4XQFA 1Y8QB 2VBWA 5BPIA 2LKXA 2L9SA 1FOXA 3HZJA 2K3FA 2BXYA 4BQNA 1H9TA 3C3WA 3FM5A 3B02A 1R1UA 3BTJA 4HYEA 5DCFA 2KL4A 3F8FA 1AA7A 3RKWA 2LY9A 2M87A 2V9VA 3LSIA 2BZTA 4IHXA 5K7FA 5E8IA 4UUSA 3GX4X 3HHHA 2K40A 2HTJA 2A69F 5IP7J 4E7KA 2H6BA 5CLSA 4XLNF 2Z2SB 3JTHA 2VPLA 2L4AA 3OV8A 2M7BA 2TDXA 3Q3SA 1Z77A 4BY7J 3V7CA 4B44A 1TL8A 1JI8A 1FT9A 3OYJA 2JUGA 1RPWA 3C1DA 5J6XA 3AFHA 3O8HA 4DYQA 5J4YA 3W6VA 4L9VA 3BR5A 3CJTB 2RV8A 4XL9A 2FSWA 4E7JA 2DU9A 2K4JA 5FKLA 5LEJA 3WTTC 4UUVA 2GZWA 4BQQA 2GAUA 3FBIB 2A5YB 5H2FC 4ANJA 2ESNA 1G6NA 2JRMA 3QOPA 3R61A 4CGZA 2AS5F 1HA8A 2HNHA 3TGNA 2W57A 2R5ZA 1U78A 2QBYB 4KN7X 1D0XA 4I99C 4KIBA 1FP2A 4HBLA 3FK6A 3SDGA 4QSHA 2PJRB 3GBGA 2M7AA 3JSOA 3BY6A 1MW7A 5C3EJ 1FEXA 2VL8A 2FBHA 4XRFA 4XSZF 3V8KA 2FJ1A 5GADJ 1YJNI 3M4OJ 2IPQX 2X48A 1RETA 2CUEA 1RUNA 3BZCA 3H9GA 3F21A 2CS3A 3LSTA 1W36C 2RAEA 2ME6A 2LBFA 1AU7A 1QPIA 4IHTA 1VQNI 4MLOA 2DODA 5TGTA 4MNUA 1BOBA 2JRTA 4ENMA 1IJWC 4OMYA 4YIIA 1X2NA 5JFRA 1HOMA 2BY1A 3H92A 4QTRA 3WTSC 3GTGJ 3S17J 3GWZA 4MIMA 3DKWA 3FXRA 4XN0A 4EJWA 1TW2A 1OYWA 3S93A 4ZJZA 3G71I 2ME0A 3HB9A 3FX3A 2VQCA 1OYYA 2ZMEA 4FQGA 1XS9A 1K61A 1S6LA 1T08B 4OU0A 3M8EA 2PLYA 4M74A 2JQ7A 3DCFA 3HL2A 4I0BA 4IKFA 2QENA 4MGRA 1GV2A 3CMAI 2HU9A 3KYCB 1QNTA 2M8EA 3F9KA 4LIUA 4YFXF 1TTYA 3BP8A 1K7AA 4ESJA 2XRLA 5ICEA 1K4TA 3F22A 4KMUX 5DM7F 1AKHA 1I6XA 3DU5A 2NS8A 2LK2A 3VOEA 3BCAA 3M3YJ 4BHPA 1B72A 4EGYA 5HLGA 1SAXA 3HIFA 3KP2A 2HQNA 1HKSA 1FIAA 2MLGA 4BNCA 2O8XA 2XGCA 2DJIA 2M3AA 4XBFA 4D7MA 2YX4A 3DBRB 3F8CA 1PP7U 5IT9Z 2VN2A 1ZRDA 2R7FA 1Q1VA 5EGOB 2R7VA 1QHGA 1CGPA 3IWFA 1SEUA 1TP4A 3I54A 1X3ZB 1ZHFA 3DP7A 2M34A 4F91B 3AG1H 3GCMA 1YTYA 4MQVA 3M07A 2HFHA 2QQBA 1Y56A 2TRTA 2ZXWH 5LGTA 1RESA 2D1VA 2F5CA 4QWQA 3ZQFA 4A3FJ 2P6SA 1PDNC 3DPLC 3K7AJ 3Q0VA 1ZREA 2Z9OA 4KFCA 3GZ6A 3DEWA 1FNNA 1Y1VJ 1ETVA 2WBMA 2DMPA 1W0UA 5F1RA 2LR8A 2YS9A 1Z0XA 4HQMA 4Y3OA 3COAC 1EH6A 3OR2C 5HDNA 4X0GA 3PFIA 2O8KA 4LB6B 5CPRB 4XLEA 3MVPA 3I5UA 4XIDA 4A5MA 3B6AA 3LWFA 2MGQA 3PL8A 5GAEJ 5DCMA 1J9IA 2Y69H 2Z3YA 2PEXA 3K69A 3S8PA 2RVCA 2C6YA 1FOWA 3KEQA 1W4MA 3OOPA 5J47A 5LRSA 1R00A 1QPMA 1UJ8A 2NXNB 4KICA 2CYYA 1DQUA 4PUSA 4WXHA 2DLLA 2JVGA 2LH9A 3BTCA 3BTLA 1TNSA 4QLCU 1TQIA 2K9MA 3G3ZA 5D8KB 3SDBA 3I56I 1HW1A 1ZN2A 1Z7UA 1POGA 4NB5A 3RQIA 2R7TA 3L2UA 4FT8A 3GFJA 5JLWA 1W5CC 2FBKA 4KMFA 5HS9A 2CMPA 4L9TA 3ZQCA 4LLNA 1X2MA 2Q2EB 1VQPI 1KZHA 1X1AA 3C18A 1G3WA 3E5QA 2DA3A 3FMSA 3SHFA 2HR3A 1R5GA 3CMEI 3I9V2 3PSIA 3MAJA 3NEUA 5C44J 3IAM2 5H6RA 2YX7A 2JUCA 4U7BA 1TQMA 1F1ZA 3OYGA 2LTPA 1JKQC 1ZG3A 3T1BA 2RREA 4BHBA 4N9HA 1XC5A 2CRGA 1MBHA 3K6GA 2R5YB 5FD5A 1JKRC 1LJ9A 3K4NA 4KISA 2DK8A 3CF2A 2FQ3A 1J7KA 2M5WA 2V1UA 1WZ2A 2PJRA 2PBIA 4RGUA 1P2FA 1L3LA 2FQ4A 3WTUC 3JRIA 4I02A 5GAHJ 1R71A 3TOAA 3KP6A 2JMWA 2XAGA 4BE0A 1WVRA 2IS6A 1R36A 1LEBA 3ZR8X 3KETA 5D8LB 1SD6A 1UELB 5E3LA 3KIOA 3ZMDA 2STTA 1MGTA 2EILH 2XHKA 1IRFA 1KU7A 2LYCA 1TWHJ 1QU3A 3RYPA 4D1QA 3S2HJ 4G7OF 2PQ8A 4ZDPA 3RZDJ 3E6DA 4NDLA 5DYMA 2EB7A 1W5TA 5JVTA 4ZZLA 3OYDA 2E5ZA 1KGSA 2WWYA 2K02A 3EUHC 1WGXA 1I6HJ 1APLC 3H35A 2NVUB 1ZR2A 2KRCA 1ZKGA 3C7JA 2JK3A 2A05A 2X4HA 3MFKA 1R58A 3HOZJ 4OWRB 5TISC 2L7FP 3SJMA 1SFXA 2HKOA 1GXQA 3HSFA 1ETKA 2IVMA 1RRJA 4ETSA 3VEPA 4UXNA 1WQ2A 3RPQA 2R4GA 2L7KA 2R7SA 1ZGJA 4M72A 3F8BA 3OYHA 3HHGA 3HSEA 4B47A 2DBBA 2WB1N 4KA4A 2WV1A 2GLOA 4NNJA 3V4GA 2NNNA 3D1NI 4OAYA 4DYCA 2MD0A 3W2VA 4UV8A 2V26A 5KHDA 2O6GE 3EYIA 5HS7A 4X6AJ 4M3DA 2VOPA 2L9RA 2A6TA 3DU6A 4F7ZA 1U9NA 2EJRA 3FM3A 2Z5UA 1BW6A 3HXLA 3E7LA 2YU9J 2OF7A 2L9NA 4E7SA 5L3BA 4A3CJ 4GYGA 1VFCA 3RKQA 1MMSA 2KFDA 2ZXJA 3GFIA 2JPBA 4NC8A 3S1NJ 4IRHA 4IQJA 3ERMA 4XLAA 4G6DA 2NS7A 5K1YA 1IUFA 1YRNB 3MEXA 2NOJB 4CHUA 2COMA 2VJJA 1I1SA 4RAFA 4RAYA 3SZGA 2EA2A 1I3AA 2QCOA 4FHTA 4BGDA 1YHQI 3FIWA 4XK4A 1V5EA 2EZIA 1OCTC 2V9KA 2XASA 3ZCOA 3HTSB 2VKHA 3HJEA 4A0YA 2HYGD 1MSEC 2JN6A 4O5VA 5IT3A 1LE8A 5LD2C 2HDCA 3CCVI 5CVIA 1RC9A 2V9PA 2CQNA 3K70C 4LG3A 2M1BA 4JX6A 2UZKA 3H5RA 4FETA 2FBIA 1KU9A 4OINF 4EQQA 2D1HA 1PP8F 4TV7A 5L3FA 1Z9CA 1EH7A 1KU3A 4ABZA 2PI0A 3SFIA 3LOCA 5FKNA 4A3EJ 3I0TA 2W7NA 2V1NA 1ONVA 1R9TJ 1NH3A 1BC7C 3TDZC 3WU2C 4DQ2A 2XPWA 4N0BA 1DP7P 2DPDA 2CSOA 3OS2A 3HOWJ 3M7GA 5BNGA 1MSFC 3MQ0A 4CICA 2RNGA 1S7AA 2Y75A 2NS0A 4ZTJA 1FBUA 2ADUA 4NQWB 2VODA 3HRTA 4Z6YA 4HLYA 4EMSA 4U87A 4XONA 1SVMA 2FEZA 3TP0A 3ROUA 5IYCJ 4KT5C 4BDYA 1AWCA 3VWBA 4Q5SF 1DDNA 3K4JA 3IP4B 2E1CA 3OYFA 1YX5A 3CCRI 2E1MC 2DT7B 1TWFJ 1MDMB 5D4RA 4G7HF 3M9AA 1FP1D 2HS5A 3OR1C 1H89C 2DI3A 3HRMA 2F4IA 3OL4A 3DBHB 4A93J 2MC4A 4IJAA 1X1CA 2CJJA 1R1VA 2PX9A 2Y0SN 5A2QK 3WU0A 3K2AA 1J2XA 2OTLI 5D5WB 1T33A 5HDKA 3CMYA 4XR6A 3KYLA 1YW8A 2EBIA 2N8GA 5HVQC 4M6VA 3G1LA 3QQAA 1C0WA 3EDPA 3K4BA 3CESA 2STWA 4AM3A 3PJRA 1IGNA 3JAMK 2G7HA 1T0FA 3WE2A 5CVRA 5FLXZ 1I39A 3CCJI 1W7PB 4RB3C 2XKOA 3A1YA 5FB2A 4CCNA 4HNVA 2QF7A 2HOEA 3ZN0A 3CCSI 1SAUA 3NARA 1V54H 4C9YA 2OZUA 1DGWY 4IQ4A 2QQAA 4CCLA 3G1MA 5J1UA 3DPUA 5M3MJ 2E1NA 4LG0A 2DQLA 1EF4A 4EVIA 5E8GA 4FASD 3A02A 4RM3A 1D5YA 3KZZA 2A6EF 3HG9A 4FTHA 1ZG5A 2VC0A 2JA6J 1H88C 3HSRA 4JK1X 1NK3P 4RGRA 2O7OA 4M3BA 2AHQA 3HUGB 5ICFA 1SC7A 2HWVA 2HOSA 2F5DA 2FMYA 4B4CA 1XMXA 3BPXA 2LKSA 1HW5A 3KP5A 3NQOA 3J7ZI 1GDTA 3J81Z 4HV6A 3DTIA 4M9XA 4OAZA 3RTRA 3M8FA 2WA0A 1K78A 2LOOA 4CYDA 4KT6A 1J09A 3EETA 1ERDA 2DMNA 3PFYA 5DV5A 3JRCA 2EIKH 3IL2A 2GM4A 2V1DA 4I98B 2L3DA 1X1DA 4CYCB 1IF1A 2DTZA 2OA4A 3ZQ7A 2A61A 2CFXA 1XCBA 2DN0A 4IO9F 1YI2I 1SD7A 1OQYA 2WB1A 3KLOA 3BR3A 3CC4I 1B9NA 1BIAA 2BHZA 3HBLA 1LDDA 3A0BC 4D5FA 2ZCWA 9ANTA 3NWTA 3IHUA 5L3CA 1JHHA 4J00A 6PAXA 2IEKA 2L01A 4WF2A 3B6CA 1X3WB 4ZDLA 2EFPA 3HRSA 3E6MA 3J7YJ 1U6GA 4M3EA 3WTWC 2KJBA 4BL0B 4AU7A 1DU6A 2NYXA 3S1QJ 3WG7H 3CCQI 2MSYA 1ZRCA 3HKZN 2XV4S 3AG4H 3WHBA 3BJAA 3RDIA 3Q9SA 3OS1A 2Q1ZB 1I5ZA 2Z1DA 2DMUA 1W7PD 1IW7F 4G9YA 2E2IJ 3J80K 1LDKB 3ZMVA 4H4KC 4C2MJ 1YOVB 1UG0A 3G6EI 2BGCA 2IXSA 1WH5A 3ZQIA 1VZ0A 4EATA 1GV5A 2G0EA 1Y0UA 1QZYA 1JGGA 3DF8A 1GVJA 1QO0D 2CU7A 3DBLB 3FWEA 3M1EA 4WXCA 2LREA 2OJED 3QODA 2GIVA 3P9CA 4YEJA 4DZJA 2NVQJ 5K5RA 4FCYA 2JT1A 1XGNA 2E36A 4B3XA 2KLOA 3K9TA 4LIVA 1FPQA 1S7OA 3U1DA 1KYWA 2FXAA 2UWMA 1U0JA 1WRJA 4KDPA 2QM3A 2KP6A 2OU2A 2QZ8A 2Y31A 2BEOA 3FHZA 2NVXJ 3KP4A 1P4AA 3S3MA 1MH3A 4RS8A 5FLMJ 1OJLA 2HPMA 2ESHA 2X6YA 3V42A 4IHSA 1LB2A 2EQRA 3VFZA 5IP9J 5FKKA 4ZYGA 3BROA 3TO6A 2ETHA 5L3GA 2HQRA 2VUMJ 2X6OA 3TKYA 4A3GJ 3CLOA 4AYBN 2X1DA 1QRYA 3KP3A 1Z91A 2ZJQF 1EJ9A 3RQ4A 3TW7A 5E18F 1BJZA 1K83J 2ISZA 1O57A 3L7WA 4HF1A 1BI1A 1ZELA 2DO7A 2WY8Q 3WTYC 3KZYA 5CJ9A 3E6CC 2OC6A 4M6XA 2R7XA 1JUMA 1PUEE 1YYVA 2W25A 3I59B 1MNDA 4OIPF 3W2WA 4EJVA 1Z3YA 4GFBA 1U8RA 1O3TA 1A36A 4HDUA 4UY8I 2DT6A 4EM1A 3FISA 4ZH4F 4BYYA 2R7UA 3ML6A 1FBQA 3LQRA 4ENJA 1IRZA 5B1AH 1WJAA 1OR7C 4LD5A 1W7PA 1QZZA 2Y0SA 1B6AA 1IRXA 3WGIA 5EG0A 3I58A 1N75A 2GA1A 3ZXSA 1VQ8I 4C2TA 2ECCA 4PJ0C 4Y13A 3TEDA 1UHWA 4AIJA 1P4WA 3E6BA 3ESWB 4DIQA 3CD6I 1IN4A 2M0MA 3OYAA 2BY2A 1E3OC 3LSPA 1Z1DA 2XAJA 4F3QA 3JTGA 1VQMI 2D45A 4M3FA 4HA8A 1E0EA 3CUOA 4KYWA 2QEXI 3HUGA 3DFGA 2R0QC 1VQ9I 1OCPA 2DOAA 3GFMA 1MMDA 4CSWA 2VT2A 1IXRC 4L9JA 3LSMA 4A3IJ 4RM2A 3PO2J 3GTKJ 2EIJH 1YJWI 1UB9A 2O5RA 3ISPA 2P5KA 3ZGKA 1D3YA 4IHVA 3P7NA 1IUYA 3ECHA 1D5VA 5DD4A 1T8IA 4MEXF 1O7FA 2VLAA 2K85A 2KRFA 5C4JJ 5FRNA 3UR3C 3MN2A 3WTZA 5HS8A 1RKWA 2GOMA 1QGPA 1R5ID 1QVTA 2WAQN 1BR4A 5D5VB 4U0VA 2P6TA 1F4KA 4BE2A 5LHGA 2X51A 4BJ6C 3V8JA 4HQEA 4A3DJ 4RDUA 4OMZA 2P4WA 2LY1A 2ZXIA 4JYKA 1SVLA 4FE4A 1RIOH 2E1MB 4IXAA 4BACA 2VBXA 3HOTA 1D1BA 2L2OA 4LLGF 4PSXA 5FLVA 3CJRB 5J4VA 3LA2A 4HRIA 2CW8A 1EKEA 3JRFA 2E7XA 4B3AA 3ZPLA 3KEOA 2FNAA 2LMDA 2L7ZA 1UFMA 2K5CA 1U3EM 1PUFA 1O3SA 2GWRA 4XNFA 2F5FA 4HF2A 1CF7B 2GIZA 3RI4A 3ZQGA 2Y9ZA 4BUPA 3OWTA 1E2XA 3I64A 4ESFA 1RUOA 3JSPA 2F5VA 3BG5A 4LB5A 3CCLI 1MD0A 3QPHA 1ZQ3P 3SEZA 4DYRA 2EINH 1ZR4A 5LBQA 2ZO4A 3S2DJ 3L2QA 1HQCA 2GXGA 1X4OA 5EEGA 2H1LA 4XORA 2DXIA
chains in the Genus database with same CATH topology
4Y17A 3GLXA 3FMQA 2MH2A 1U5TA 3I4PA 1OPCA 2EWNA 4ASNA 4RGSA 2CG4A 1IN6A 1O7LA 3J80Z 4UHTA 2FE3A 2KIUA 2XRNA 4WXDA 3ZMTA 4R1HA 1FWZA 1S3JA 3VB2A 4CXFA 1XGSA 1ZGAA 3QU6A 3LA7A 3LA3A 2JTVA 2IP2A 4P9UA 4L0ZB 1IN8A 1STZA 4BQAA 2K27A 5E20A 3V8LA 4WWCA 3FXUA 4CZZA 2EV6A 1SD4A 1KQ9A 2OZ6A 1ULYA 3E3VA 2P8TA 3IWZA 3H3ZA 1L0OC 1YLFA 3HOSA 3CO7C 1YIOA 3GW2A 4HOBA 3DQVC 2QBYA 2W85A 1ZARA 1MJAA 2O0YA 2LSOA 1AOYA 2EFNA 4GCVA 1LDJA 3Q5FA 4YFKF 4IPAA 5D4SA 1A04A 1R23A 4BXUA 2H94A 2FNPA 2L4MA 1MJBA 2LF7A 5JR3A 3IKVA 3QRFF 4A12A 4UVCA 5H6QA 1DUXC 1S8NA 5E1XA 3DV8A 3GZ5A 5J8CA 4R79A 4AIHA 1JE8A 1IZ1A 1CF7A 4Q47A 5FFZA 1IXSB 2F5EA 1TW3A 4IF4A 1UCRA 2BYVE 1TLHB 5FO5A 3GYHX 4B8XA 3KCCA 4M71A 3S2WA 1XMKA 1Q1HA 3SXYA 1T39A 1HXDA 5D6EA 4ZYEA 4PCQA 4LLLA 2DT5A 3QP5A 1J75A 5AIQA 3ULQB 2QWWA 3F6OA 3CTAA 5F6FA 2FU4A 4RAZA 3JW4A 3WTVC 4O6JA 2Y0MA 3L2CA 3U9GA 4LK1F 1QBJA 3WTXC 4HX8A 4N9IA 2Q2EA 2RC4A 1ON1A 2E7WA 4GYIA 2VT3A 3WGHA 1D8JA 3BWGA 3QAHA 4L9NA 1KQ0A 4LJZF 4KIGA 4YG2F 1MZBA 3ZN1A 2WC2A 4EJUA 1K6OA 3W6KB 2H27A 2VXZA 2EV0A 3AAFA 1V3FA 1XSXA 3I71A 4UV9A 1VTNC 4M9SA 4L5IA 1LEAA 2EFWA 4GXOA 2MC3A 3K1PA 3KLNA 1LNWA 3N4MA 3KE2A 4EJTA 1XSDA 4EV0A 2EV5A 3V7SA 1SFEA 4P96A 3FMRA 3L9FA 4OIOF 5K5QA 1MKMA 2G9WA 5TRDA 4H0EA 1FYKA 2IT0A 4EM2A 1IAWA 3BZ6A 1FC3A 2P5LC 4RGXA 1Z6TA 4S04A 1USTA 4G7ZF 4GO1A 5TJJA 3R0AA 3QP6A 4MEYF 4ZYDA 3F8MA 2ZNZA 4G8XA 1WSUA 2L02A 1ZLJA 2DAOA 5LHHA 3GO5A 2NAZA 1XGOA 5J8FA 2AXLA 4G6QA 2WV0A 2HEOA 5F64A 1FYMA 3TO7A 5DDGA 3GEZA 1R7JA 4Q4ZF 4P55A 5BS6A 3CUQC 4B09A 1YO5C 5HLHA 1P4XA 3SZTA 1JGSA 4MHGA 1I27A 4BHCA 1BBYA 2VE9A 2RQPA 3O3KA 2OBPA 2ZFWA 4IRGA 2ZMEB 3RKYA 3T5XA 5IT9K 2X0LA 2ZNYA 2D2WA 2HTSA 1J5YA 4A2UA 4LGWA 4ENKA 4MQ9F 1JHFA 2RN7A 4A5NA 5BQTA 1KQ8A 3EQLF 1G3SA 1LVAA 1XN7A 2ZKZA 1IRGA 4BAYA 3E97A 4KUMA 3ABTA 1GHCA 1S29A 1XGMA 2VONA 4I01A 3SZPA 2MBFA 1YQAA 4OOIA 2CW0F 3REOA 3F72A 2NRAC 3WODF 1FSEA 1U2WA 4NQWA 2LF8A 2OQRA 5ILSA 5JI6A 4E70A 1TQPA 5HDGA 3F3XA 5L3EA 4KN4X 1WWXA 1R1TA 3B73A 4I0AA 1MDMA 4L18B 1T6SA 5KVRA 2VBZA 4ZZDA 1HBXG 3P9KA 3R4KA 5DCMB 1EH8A 2UXNA 2ZJ2A 3QU3A 4PGHA 3I53A 2XUBA 2DQRA 5EEHA 3T8TA 2BBYA 3MZYA 3ELKA 3D5LA 1IN5A 2KIFA 2LDUA 5H20A 4K2EA 3GUDA 4PZJA 3IRQA 5DEQA 1BOAA 5A2QZ 3D0SA 3NRVA 1ZG1A 2YR2A 3ZMZA 2J5OA 3K1NA 4AD9A 4A6DA 2QLZA 3R6SA 5FGMA 3JAMZ 1R5HA 2BE5F 2RDPA 2HYFA 4LFUA 2P7VB 4GGGA 4PDKA 3GFLA 2V1XA 4EJOA 5LHIA 2Q8KA 2PG4A 2F2EA 3SQNA 3Q9VA 5ICCA 4RB2C 3V7RA 2ELHA 1D8KA 2IW5A 1REPC 2OQGA 4EGZA 1IXCA 2IA1A 5K5OA 2PMUA 5ED4A 2XROA 1EV7A 1HKQA 2WTEA 2VC1A 2XKPA 3ERED 1OYIA 1XB4A 4Q48A 2O3FA 3L09A 2NNYA 4O3MA 2DK5A 1P6RA 3WE3A 3ABUA 1YG2A 3CDHA 2FA5A 3F8NA 1FLIA 2LNBA 3LQQA 2CO5A 4LK0F 1H9GA 2JPCA 1T98A 1B1BA 1BI0A 1ZH5A 1O3QA 1YS7A 4JBAA 3TQNA 2ISYA 1KYZA 2W24A 1V4RA 2KIMA 4AVPA 3EUHA 4EM0B 5DUIA 1ZLKA 2DPUA 4A6EA 2GXBA 2XAHA 3FF5A 4R8HA 4PGGA 1XD7A 2Y48A 2PMHA 1FOKA 4HDVA 1XMAA 1RNLA 3IRRA 5LEKA 1YFHA 5AIPA 1T2KA 4NHJA 4G94A 1JXSA 1BJAA 3U2RA 5BMZA 1NHAA 4HV5A 2JSCA 2K4BA 4I09A 2CGPA 3RKXA 3WG9A 4U88A 1B9MA 3I59A 1SFUA 4RB0A 5CVVA 1DPRA 3CUQB 2K7LA 4HZFA 4L0YB 4IRIA 3RIRA 4JQFA 3FZVA 2YPRA 4UNOA 1P92A 1E17A 1FSHA 2YSRA 1SD5A 2R3SA 5LRRA 2P7CB 4I2OA 5D5XB 5CVJA 1UHMA 4ZYHA 4HX4A 5FFXA 4MTDA 5JHUA 4YFNF 2XAFA 1HSJA 5FLXK 1BI2A 4DNCA 2FRHA 2IA2A 2IRFG 2FF4A 4FX0A 1XCVA 5E1ZB 1BI3A 4UVAA 3BPVA 1YW9A 3K0LA 4AWXB 1F9NA 2XVCA 1X3UA 1U5TC 2LKPA 2RKHA 3T0YA 1ZAOA 3J81K 2DFIA 4L5JA 3MZHA 2Z33A 1RI7A 4XLPF 4LG0B 3K1MA 3N97A 1HSTA 4KIFA 2FMLA 2EA4A 2G7UA 2P5VA 2L54A 2XGXA 3F23A 3DEUA 5AONA 2CWEA 3W6JB 5LLQA 2HKXA 2IA0A 4U0YA 3DPTA 5BOXA 3KFWX 3K2ZA 4Z2YA 1I1GA 1BM9A 2O03A 1K78B 2A68F 2UXXA 1Z6RA 5KK1A 1K79A 5HLIA 2M45A 5CVUA 3O2PE 1DPUA 2PFBA 1USSA 1TNTA 5BPDA 5E17F 1ZRFA 3CO6C 1WI9A 5E1WA 2GQQA 1G3YA 2PN6A 2B0LA 3WGGA 4CDGA 2EK5A 4WCGA 3SFZA 2JZYA 3BJ6A 3H3UA 3ECOA 3MWMA 3CUQA 2HZTA 5CYVA 2K86A 2OD5A 3LFKA 2MA3A 4OIQF 1RZ4A 3E5XA 2MLKA 4S05A 4ESBA 1J59A 4CO8A 1T38A 4HAMA 1Z05A 2RNJA 4ON0A 3LAJA 4M9ZA 3L00A 1MJ9A 3RJPA 5HOOA 4A0XA 3WU1B 3RYRA 3TDUC 2QVOA 2PJPA 4P9FA 2IJLA 3HRUA 1R22A 1ZYRF 4RB1A 1FZPB 2Q0OA 2V6CA 2VOOA 3HYIA 1OMIA 2YU3A 5D6FA 2VE8A 4U7DA 2FOKA 3T8RA 1HKTA 4HF0A 3P9IA 2CQKA 4IVNA 4HW0A 5FD6A 1O3RA 2A6HF 4HLXA 4I7HA 4D0PA 5DD8A 1FYLA 2A3SA 1YW7A 3O6BB 3HTUA 1IN7A 2W84A 1WKMA 1KU2A 2BV6A 2QUFA 4A0ZA 3E5UA 2J5PA 1KA8A 3LAPA 1F5TA 1BIBA 2EFOA 4XSXF 4M6YA 3ZMSA 1B4AA 3DXJF 3QPTA 3TOBA 2H6CA 4YIFA 1BC8C 4BH9A 2A07F 1G4DA 2KKOA 2R7DA 2DTRA 3CJNA 1XDUA 5ERIA 3EYYA 1FX7A 5ICGA 1XDSA 3R0JA 2MD5A 4FX4A 3BOQA 3BJOA 4Y15A 3ZMUA 1OR7A 1TBXA 3PQJA 1J0RA 1H0MA 4MTEA 4ENNA 2RGVA 1B59A 3G73A 3GF2A 1OKRA 4UVBA 3BDDA 2DW4A 1LQ1A 1YS6A 2H09A 2MH9A 2Z99A 1ODDA 3F6VA 4OIRF 4KNYA 2M30A 2XAQA 3J7AO 3MCZA 5L3DA 3TO9A 2EFQA 1W5SA 3VODA 2QQ9A 2HGCA 4LMYA 1HW2A 1G3TA 4P5OA 2OAZA 2VBYA 5LGNA 5DUKA 3GXOA 5ILUA 5D5UB 3IC7A 1ON2A 3PQKA 1FY7A 1FBSA 3FXQA 1U5TB 4U0WA 3ZP5A 2ACJA 2KJCA 2ZBKA 4AIKA 1QQIA 5LGUA 2GA2A 1XSVA 3IKTA 2O61A 2XIGA 3R60A 1GXPA 1BN5A 5ILVA 1SMYF 1SMTA 4WX9A 3KP7A 3RPUA 4HX7A 3GVAA 2QYOA 2V79A 4WK8F 4M73A 2VBWA 5BPIA 1H9TA 3C3WA 3FM5A 3B02A 1R1UA 5DCFA 4HYEA 3F8FA 3RKWA 2M87A 2V9VA 5E8IA 3GX4X 3HHHA 2HTJA 2A69F 2H6BA 5CLSA 4XLNF 3JTHA 2L4AA 3OV8A 2TDXA 3V7CA 1FT9A 3C1DA 5J6XA 4L9VA 2RV8A 2FSWA 2DU9A 2K4JA 5LEJA 3WTTC 4UUVA 2GZWA 2GAUA 2A5YB 2ESNA 1G6NA 3QOPA 3R61A 4CGZA 2AS5F 3TGNA 2W57A 1U78A 2QBYB 4KN7X 4KIBA 1FP2A 4HBLA 3JSOA 3BY6A 2FBHA 4XRFA 4XSZF 3V8KA 2IPQX 1RUNA 3F21A 3LSTA 4IHTA 4MNUA 2JRTA 4ENMA 4OMYA 4YIIA 5JFRA 3H92A 3WTSC 3GWZA 3DKWA 3FXRA 4EJWA 1TW2A 1OYWA 3FX3A 1OYYA 2ZMEA 1S6LA 4OU0A 3M8EA 2PLYA 4M74A 4I0BA 2QENA 4MGRA 1QNTA 2M8EA 4YFXF 1TTYA 3BP8A 1K7AA 4ESJA 5ICEA 3F22A 4KMUX 1I6XA 3VOEA 4BHPA 4EGYA 5HLGA 1SAXA 3HIFA 3KP2A 2HQNA 1HKSA 2MLGA 4BNCA 2O8XA 4XBFA 2YX4A 1PP7U 3F8CA 5IT9Z 2VN2A 1ZRDA 2R7FA 1CGPA 3IWFA 3I54A 1ZHFA 3DP7A 1YTYA 4MQVA 2HFHA 2QQBA 5LGTA 2D1VA 2F5CA 4QWQA 2P6SA 1PDNC 3DPLC 1ZREA 2Z9OA 4KFCA 3GZ6A 1FNNA 5F1RA 4HQMA 3COAC 1EH6A 5HDNA 3PFIA 4LB6B 3I5UA 4A5MA 3LWFA 5DCMA 1J9IA 2Z3YA 2PEXA 3K69A 2RVCA 2C6YA 3KEQA 1W4MA 3OOPA 5LRSA 1R00A 1QPMA 4KICA 4WXHA 2CYYA 2DLLA 1TNSA 4QLCU 1TQIA 3G3ZA 5D8KB 1HW1A 1ZN2A 1Z7UA 4NB5A 4FT8A 3GFJA 2FBKA 4KMFA 5HS9A 4L9TA 4LLNA 3C18A 1G3WA 3E5QA 3FMSA 3SHFA 2HR3A 1R5GA 3MAJA 3NEUA 5H6RA 2YX7A 4U7BA 1TQMA 1F1ZA 1ZG3A 3T1BA 4BHBA 4N9HA 5FD5A 1LJ9A 2DK8A 2FQ3A 1J7KA 2M5WA 2V1UA 2PBIA 4RGUA 1P2FA 1L3LA 3WTUC 4I02A 3TOAA 3KP6A 2XAGA 1R36A 1LEBA 3KETA 5D8LB 1SD6A 3ZMDA 2STTA 1MGTA 2XHKA 1IRFA 1KU7A 3RYPA 4G7OF 2PQ8A 3E6DA 5DYMA 2EB7A 1W5TA 5JVTA 4ZZLA 1KGSA 2WWYA 2K02A 3C7JA 2X4HA 3MFKA 1R58A 1SFXA 2HKOA 1GXQA 3HSFA 2IVMA 4ETSA 3VEPA 4UXNA 1WQ2A 3RPQA 1ZGJA 4M72A 3F8BA 3HHGA 3HSEA 2DBBA 4KA4A 3V4GA 2NNNA 4UV8A 2O6GE 3EYIA 5HS7A 2VOPA 4F7ZA 2EJRA 3FM3A 2Z5UA 5L3BA 4GYGA 2ZXJA 3GFIA 2JPBA 4IRHA 4G6DA 5K1YA 3MEXA 4CHUA 2COMA 1I1SA 4RAYA 2EA2A 4FHTA 2XASA 3HTSB 4A0YA 2HYGD 4O5VA 5IT3A 2HDCA 5CVIA 2UZKA 2M1BA 2FBIA 1KU9A 4OINF 4EQQA 2D1HA 1PP8F 4TV7A 5L3FA 1Z9CA 1EH7A 1KU3A 2PI0A 3I0TA 1ONVA 1BC7C 3TDZC 4DQ2A 4N0BA 1DP7P 2DPDA 2CSOA 3M7GA 3MQ0A 4CICA 1S7AA 2Y75A 2NS0A 1FBUA 2ADUA 2VODA 3HRTA 4HLYA 4EMSA 2FEZA 3ROUA 4KT5C 1AWCA 4Q5SF 1DDNA 2E1CA 1MDMB 5D4RA 4G7HF 3M9AA 1FP1D 2HS5A 2DI3A 3HRMA 4IJAA 1R1VA 5A2QK 3WU0A 1J2XA 5D5WB 5HDKA 1YW8A 5HVQC 1C0WA 3EDPA 2STWA 3JAMK 2G7HA 1T0FA 3WE2A 5CVRA 5FLXZ 1W7PB 4RB3C 2XKOA 5FB2A 2HOEA 3ZN0A 2OZUA 2QQAA 2E1NA 4LG0A 2DQLA 4EVIA 5E8GA 3KZZA 2A6EF 1ZG5A 2VC0A 3HSRA 4JK1X 4RGRA 5ICFA 2HWVA 2F5DA 2FMYA 3BPXA 1HW5A 3KP5A 3NQOA 3J81Z 4HV6A 4M9XA 3RTRA 3M8FA 1K78A 4CYDA 3EETA 5DV5A 3IL2A 2V1DA 4I98B 2L3DA 1IF1A 2OA4A 3ZQ7A 2A61A 2CFXA 1XCBA 1SD7A 3KLOA 1B9NA 1BIAA 1LDDA 2ZCWA 3IHUA 5L3CA 1JHHA 6PAXA 2L01A 4WF2A 2EFPA 3HRSA 3E6MA 1U6GA 3WTWC 2KJBA 2NYXA 1ZRCA 2XV4S 3BJAA 3RDIA 3Q9SA 1I5ZA 1W7PD 1IW7F 4G9YA 3J80K 1LDKB 3ZMVA 2BGCA 1Y0UA 1QZYA 3DF8A 1GVJA 1QO0D 3FWEA 3M1EA 4WXCA 2GIVA 3P9CA 5K5RA 2JT1A 1XGNA 3K9TA 1FPQA 1S7OA 3U1DA 1KYWA 2FXAA 2UWMA 1WRJA 4KDPA 2QM3A 2QZ8A 2OU2A 2BEOA 3FHZA 3KP4A 1P4AA 4RS8A 2ESHA 4IHSA 1LB2A 3VFZA 4ZYGA 3BROA 3TO6A 2ETHA 5L3GA 2HQRA 3TKYA 3CLOA 3KP3A 1Z91A 5E18F 2ISZA 1O57A 3L7WA 4HF1A 1BI1A 2DO7A 3WTYC 3KZYA 5CJ9A 3E6CC 4M6XA 1PUEE 1YYVA 2W25A 3I59B 4OIPF 4EJVA 1U8RA 1O3TA 4HDUA 4EM1A 4ZH4F 4BYYA 3ML6A 1FBQA 3LQRA 4ENJA 4LD5A 1W7PA 1QZZA 1B6AA 3WGIA 3I58A 2GA1A 4Y13A 1UHWA 4AIJA 1P4WA 3E6BA 1IN4A 1Z1DA 2XAJA 3JTGA 2D45A 4HA8A 3CUOA 4KYWA 3HUGA 3DFGA 3GFMA 2VT2A 1IXRC 4L9JA 1UB9A 3ISPA 2P5KA 1D3YA 3P7NA 1IUYA 3ECHA 1D5VA 5DD4A 4MEXF 1O7FA 2KRFA 3WTZA 5HS8A 1QGPA 5D5VB 4U0VA 2P6TA 1F4KA 5LHGA 3V8JA 4HQEA 4OMZA 2P4WA 1RIOH 4IXAA 2VBXA 3HOTA 4LLGF 3LA2A 2E7XA 3ZPLA 3KEOA 2FNAA 1UFMA 1U3EM 1O3SA 2GWRA 2F5FA 4HF2A 1CF7B 3RI4A 1E2XA 3I64A 4ESFA 1RUOA 3JSPA 4LB5A 1MD0A 3QPHA 5LBQA 2ZO4A 1HQCA 2GXGA 5EEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  3GLX A;  3FMQ A;  2MH2 A;  1U5T A;  3I4P A;  1OPC A;  2EWN A;  4ASN A;  4RGS A;  2CG4 A;  1IN6 A;  1O7L A;  3J80 Z;  4UHT A;  2FE3 A;  2KIU A;  2XRN A;  4WXD A;  3ZMT A;  4R1H A;  1FWZ A;  1S3J A;  3VB2 A;  4CXF A;  1XGS A;  1ZGA A;  3QU6 A;  3LA7 A;  3LA3 A;  2JTV A;  2IP2 A;  4P9U A;  4L0Z B;  1IN8 A;  1STZ A;  4BQA A;  2K27 A;  5E20 A;  3V8L A;  4WWC A;  3FXU A;  4CZZ A;  2EV6 A;  1SD4 A;  1KQ9 A;  2OZ6 A;  1ULY A;  3E3V A;  2P8T A;  3IWZ A;  3H3Z A;  1L0O C;  1YLF A;  3HOS A;  3CO7 C;  1YIO A;  3GW2 A;  4HOB A;  3DQV C;  2QBY A;  2W85 A;  1ZAR A;  1MJA A;  2O0Y A;  2LSO A;  1AOY A;  2EFN A;  4GCV A;  1LDJ A;  3Q5F A;  4YFK F;  4IPA A;  5D4S A;  1A04 A;  1R23 A;  4BXU A;  2H94 A;  2FNP A;  2L4M A;  1MJB A;  2LF7 A;  5JR3 A;  3IKV A;  3QRF F;  4A12 A;  4UVC A;  5H6Q A;  1DUX C;  1S8N A;  5E1X A;  3DV8 A;  3GZ5 A;  5J8C A;  4R79 A;  4AIH A;  1JE8 A;  1IZ1 A;  1CF7 A;  4Q47 A;  5FFZ A;  1IXS B;  2F5E A;  1TW3 A;  4IF4 A;  1UCR A;  2BYV E;  1TLH B;  5FO5 A;  3GYH X;  4B8X A;  3KCC A;  4M71 A;  3S2W A;  1XMK A;  1Q1H A;  3SXY A;  1T39 A;  1HXD A;  5D6E A;  4ZYE A;  4PCQ A;  4LLL A;  2DT5 A;  3QP5 A;  1J75 A;  5AIQ A;  3ULQ B;  2QWW A;  3F6O A;  3CTA A;  5F6F A;  2FU4 A;  4RAZ A;  3JW4 A;  3WTV C;  4O6J A;  2Y0M A;  3L2C A;  3U9G A;  4LK1 F;  1QBJ A;  3WTX C;  4HX8 A;  4N9I A;  2Q2E A;  2RC4 A;  1ON1 A;  2E7W A;  4GYI A;  2VT3 A;  3WGH A;  1D8J A;  3BWG A;  3QAH A;  4L9N A;  1KQ0 A;  4LJZ F;  4KIG A;  4YG2 F;  1MZB A;  3ZN1 A;  2WC2 A;  4EJU A;  1K6O A;  3W6K B;  2H27 A;  2VXZ A;  2EV0 A;  3AAF A;  1V3F A;  1XSX A;  3I71 A;  4UV9 A;  1VTN C;  4M9S A;  4L5I A;  1LEA A;  2EFW A;  4GXO A;  2MC3 A;  3K1P A;  3KLN A;  1LNW A;  3N4M A;  3KE2 A;  4EJT A;  1XSD A;  4EV0 A;  2EV5 A;  3V7S A;  1SFE A;  4P96 A;  3FMR A;  3L9F A;  4OIO F;  5K5Q A;  1MKM A;  2G9W A;  5TRD A;  4H0E A;  1FYK A;  2IT0 A;  4EM2 A;  1IAW A;  3BZ6 A;  1FC3 A;  2P5L C;  4RGX A;  1Z6T A;  4S04 A;  1UST A;  4G7Z F;  4GO1 A;  5TJJ A;  3R0A A;  3QP6 A;  4MEY F;  4ZYD A;  3F8M A;  2ZNZ A;  4G8X A;  1WSU A;  2L02 A;  1ZLJ A;  2DAO A;  5LHH A;  3GO5 A;  2NAZ A;  1XGO A;  5J8F A;  2AXL A;  4G6Q A;  2WV0 A;  2HEO A;  5F64 A;  1FYM A;  3TO7 A;  5DDG A;  3GEZ A;  1R7J A;  4Q4Z F;  4P55 A;  5BS6 A;  3CUQ C;  4B09 A;  1YO5 C;  5HLH A;  1P4X A;  3SZT A;  1JGS A;  4MHG A;  1I27 A;  4BHC A;  1BBY A;  2VE9 A;  2RQP A;  3O3K A;  2OBP A;  2ZFW A;  4IRG A;  2ZME B;  3RKY A;  3T5X A;  5IT9 K;  2X0L A;  2ZNY A;  2D2W A;  2HTS A;  1J5Y A;  4A2U A;  4LGW A;  4ENK A;  4MQ9 F;  1JHF A;  2RN7 A;  4A5N A;  5BQT A;  1KQ8 A;  3EQL F;  1G3S A;  1LVA A;  1XN7 A;  2ZKZ A;  1IRG A;  4BAY A;  3E97 A;  4KUM A;  3ABT A;  1GHC A;  1S29 A;  1XGM A;  2VON A;  4I01 A;  3SZP A;  2MBF A;  1YQA A;  4OOI A;  2CW0 F;  3REO A;  3F72 A;  2NRA C;  3WOD F;  1FSE A;  1U2W A;  4NQW A;  2LF8 A;  2OQR A;  5ILS A;  5JI6 A;  4E70 A;  1TQP A;  5HDG A;  3F3X A;  5L3E A;  4KN4 X;  1WWX A;  1R1T A;  3B73 A;  4I0A A;  1MDM A;  4L18 B;  1T6S A;  5KVR A;  2VBZ A;  4ZZD A;  1HBX G;  3P9K A;  3R4K A;  5DCM B;  1EH8 A;  2UXN A;  2ZJ2 A;  3QU3 A;  4PGH A;  3I53 A;  2XUB A;  2DQR A;  5EEH A;  3T8T A;  2BBY A;  3MZY A;  3ELK A;  3D5L A;  1IN5 A;  2KIF A;  2LDU A;  5H20 A;  4K2E A;  3GUD A;  4PZJ A;  3IRQ A;  5DEQ A;  1BOA A;  5A2Q Z;  3D0S A;  3NRV A;  1ZG1 A;  2YR2 A;  3ZMZ A;  2J5O A;  3K1N A;  4AD9 A;  4A6D A;  2QLZ A;  3R6S A;  5FGM A;  3JAM Z;  1R5H A;  2BE5 F;  2RDP A;  2HYF A;  4LFU A;  2P7V B;  4GGG A;  4PDK A;  3GFL A;  2V1X A;  4EJO A;  5LHI A;  2Q8K A;  2PG4 A;  2F2E A;  3SQN A;  3Q9V A;  5ICC A;  4RB2 C;  3V7R A;  2ELH A;  1D8K A;  2IW5 A;  1REP C;  2OQG A;  4EGZ A;  1IXC A;  2IA1 A;  5K5O A;  2PMU A;  5ED4 A;  2XRO A;  1EV7 A;  1HKQ A;  2WTE A;  2VC1 A;  2XKP A;  3ERE D;  1OYI A;  1XB4 A;  4Q48 A;  2O3F A;  3L09 A;  2NNY A;  4O3M A;  2DK5 A;  1P6R A;  3WE3 A;  3ABU A;  1YG2 A;  3CDH A;  2FA5 A;  3F8N A;  1FLI A;  2LNB A;  3LQQ A;  2CO5 A;  4LK0 F;  1H9G A;  2JPC A;  1T98 A;  1B1B A;  1BI0 A;  1ZH5 A;  1O3Q A;  1YS7 A;  4JBA A;  3TQN A;  2ISY A;  1KYZ A;  2W24 A;  1V4R A;  2KIM A;  4AVP A;  3EUH A;  4EM0 B;  5DUI A;  1ZLK A;  2DPU A;  4A6E A;  2GXB A;  2XAH A;  3FF5 A;  4R8H A;  4PGG A;  1XD7 A;  2Y48 A;  2PMH A;  1FOK A;  4HDV A;  1XMA A;  1RNL A;  3IRR A;  5LEK A;  1YFH A;  5AIP A;  1T2K A;  4NHJ A;  4G94 A;  1JXS A;  1BJA A;  3U2R A;  5BMZ A;  1NHA A;  4HV5 A;  2JSC A;  2K4B A;  4I09 A;  2CGP A;  3RKX A;  3WG9 A;  4U88 A;  1B9M A;  3I59 A;  1SFU A;  4RB0 A;  5CVV A;  1DPR A;  3CUQ B;  2K7L A;  4HZF A;  4L0Y B;  4IRI A;  3RIR A;  4JQF A;  3FZV A;  2YPR A;  4UNO A;  1P92 A;  1E17 A;  1FSH A;  2YSR A;  1SD5 A;  2R3S A;  5LRR A;  2P7C B;  4I2O A;  5D5X B;  5CVJ A;  1UHM A;  4ZYH A;  4HX4 A;  5FFX A;  4MTD A;  5JHU A;  4YFN F;  2XAF A;  1HSJ A;  5FLX K;  1BI2 A;  4DNC A;  2FRH A;  2IA2 A;  2IRF G;  2FF4 A;  4FX0 A;  1XCV A;  5E1Z B;  1BI3 A;  4UVA A;  3BPV A;  1YW9 A;  3K0L A;  4AWX B;  1F9N A;  2XVC A;  1X3U A;  1U5T C;  2LKP A;  2RKH A;  3T0Y A;  1ZAO A;  3J81 K;  2DFI A;  4L5J A;  3MZH A;  2Z33 A;  1RI7 A;  4XLP F;  4LG0 B;  3K1M A;  3N97 A;  1HST A;  4KIF A;  2FML A;  2EA4 A;  2G7U A;  2P5V A;  2L54 A;  2XGX A;  3F23 A;  3DEU A;  5AON A;  2CWE A;  3W6J B;  5LLQ A;  2HKX A;  2IA0 A;  4U0Y A;  3DPT A;  5BOX A;  3KFW X;  3K2Z A;  4Z2Y A;  1I1G A;  1BM9 A;  2O03 A;  1K78 B;  2A68 F;  2UXX A;  1Z6R A;  5KK1 A;  1K79 A;  5HLI A;  2M45 A;  5CVU A;  3O2P E;  1DPU A;  2PFB A;  1USS A;  1TNT A;  5BPD A;  5E17 F;  1ZRF A;  3CO6 C;  1WI9 A;  5E1W A;  2GQQ A;  1G3Y A;  2PN6 A;  2B0L A;  3WGG A;  4CDG A;  2EK5 A;  4WCG A;  3SFZ A;  2JZY A;  3BJ6 A;  3H3U A;  3ECO A;  3MWM A;  3CUQ A;  2HZT A;  5CYV A;  2K86 A;  2OD5 A;  3LFK A;  2MA3 A;  4OIQ F;  1RZ4 A;  3E5X A;  2MLK A;  4S05 A;  4ESB A;  1J59 A;  4CO8 A;  1T38 A;  4HAM A;  1Z05 A;  2RNJ A;  4ON0 A;  3LAJ A;  4M9Z A;  3L00 A;  1MJ9 A;  3RJP A;  5HOO A;  4A0X A;  3WU1 B;  3RYR A;  3TDU C;  2QVO A;  2PJP A;  4P9F A;  2IJL A;  3HRU A;  1R22 A;  1ZYR F;  4RB1 A;  1FZP B;  2Q0O A;  2V6C A;  2VOO A;  3HYI A;  1OMI A;  2YU3 A;  5D6F A;  2VE8 A;  4U7D A;  2FOK A;  3T8R A;  1HKT A;  4HF0 A;  3P9I A;  2CQK A;  4IVN A;  4HW0 A;  5FD6 A;  1O3R A;  2A6H F;  4HLX A;  4I7H A;  4D0P A;  5DD8 A;  1FYL A;  2A3S A;  1YW7 A;  3O6B B;  3HTU A;  1IN7 A;  2W84 A;  1WKM A;  1KU2 A;  2BV6 A;  2QUF A;  4A0Z A;  3E5U A;  2J5P A;  1KA8 A;  3LAP A;  1F5T A;  1BIB A;  2EFO A;  4XSX F;  4M6Y A;  3ZMS A;  1B4A A;  3DXJ F;  3QPT A;  3TOB A;  2H6C A;  4YIF A;  1BC8 C;  4BH9 A;  2A07 F;  1G4D A;  2KKO A;  2R7D A;  2DTR A;  3CJN A;  1XDU A;  5ERI A;  3EYY A;  1FX7 A;  5ICG A;  1XDS A;  3R0J A;  2MD5 A;  4FX4 A;  3BOQ A;  3BJO A;  4Y15 A;  3ZMU A;  1OR7 A;  1TBX A;  3PQJ A;  1J0R A;  1H0M A;  4MTE A;  4ENN A;  2RGV A;  1B59 A;  3G73 A;  3GF2 A;  1OKR A;  4UVB A;  3BDD A;  2DW4 A;  1LQ1 A;  1YS6 A;  2H09 A;  2MH9 A;  2Z99 A;  1ODD A;  3F6V A;  4OIR F;  4KNY A;  2M30 A;  2XAQ A;  3J7A O;  3MCZ A;  5L3D A;  3TO9 A;  2EFQ A;  1W5S A;  3VOD A;  2QQ9 A;  2HGC A;  4LMY A;  1HW2 A;  1G3T A;  4P5O A;  2OAZ A;  2VBY A;  5LGN A;  5DUK A;  3GXO A;  5ILU A;  5D5U B;  3IC7 A;  1ON2 A;  3PQK A;  1FY7 A;  1FBS A;  3FXQ A;  1U5T B;  4U0W A;  3ZP5 A;  2ACJ A;  2KJC A;  2ZBK A;  4AIK A;  1QQI A;  5LGU A;  2GA2 A;  1XSV A;  3IKT A;  2O61 A;  2XIG A;  3R60 A;  1GXP A;  1BN5 A;  5ILV A;  1SMY F;  1SMT A;  4WX9 A;  3KP7 A;  3RPU A;  4HX7 A;  3GVA A;  2QYO A;  2V79 A;  4WK8 F;  4M73 A;  2VBW A;  5BPI A;  1H9T A;  3C3W A;  3FM5 A;  3B02 A;  1R1U A;  5DCF A;  4HYE A;  3F8F A;  3RKW A;  2M87 A;  2V9V A;  5E8I A;  3GX4 X;  3HHH A;  2HTJ A;  2A69 F;  2H6B A;  5CLS A;  4XLN F;  3JTH A;  2L4A A;  3OV8 A;  2TDX A;  3V7C A;  1FT9 A;  3C1D A;  5J6X A;  4L9V A;  2RV8 A;  2FSW A;  2DU9 A;  2K4J A;  5LEJ A;  3WTT C;  4UUV A;  2GZW A;  2GAU A;  2A5Y B;  2ESN A;  1G6N A;  3QOP A;  3R61 A;  4CGZ A;  2AS5 F;  3TGN A;  2W57 A;  1U78 A;  2QBY B;  4KN7 X;  4KIB A;  1FP2 A;  4HBL A;  3JSO A;  3BY6 A;  2FBH A;  4XRF A;  4XSZ F;  3V8K A;  2IPQ X;  1RUN A;  3F21 A;  3LST A;  4IHT A;  4MNU A;  2JRT A;  4ENM A;  4OMY A;  4YII A;  5JFR A;  3H92 A;  3WTS C;  3GWZ A;  3DKW A;  3FXR A;  4EJW A;  1TW2 A;  1OYW A;  3FX3 A;  1OYY A;  2ZME A;  1S6L A;  4OU0 A;  3M8E A;  2PLY A;  4M74 A;  4I0B A;  2QEN A;  4MGR A;  1QNT A;  2M8E A;  4YFX F;  1TTY A;  3BP8 A;  1K7A A;  4ESJ A;  5ICE A;  3F22 A;  4KMU X;  1I6X A;  3VOE A;  4BHP A;  4EGY A;  5HLG A;  1SAX A;  3HIF A;  3KP2 A;  2HQN A;  1HKS A;  2MLG A;  4BNC A;  2O8X A;  4XBF A;  2YX4 A;  1PP7 U;  3F8C A;  5IT9 Z;  2VN2 A;  1ZRD A;  2R7F A;  1CGP A;  3IWF A;  3I54 A;  1ZHF A;  3DP7 A;  1YTY A;  4MQV A;  2HFH A;  2QQB A;  5LGT A;  2D1V A;  2F5C A;  4QWQ A;  2P6S A;  1PDN C;  3DPL C;  1ZRE A;  2Z9O A;  4KFC A;  3GZ6 A;  1FNN A;  5F1R A;  4HQM A;  3COA C;  1EH6 A;  5HDN A;  3PFI A;  4LB6 B;  3I5U A;  4A5M A;  3LWF A;  5DCM A;  1J9I A;  2Z3Y A;  2PEX A;  3K69 A;  2RVC A;  2C6Y A;  3KEQ A;  1W4M A;  3OOP A;  5LRS A;  1R00 A;  1QPM A;  4KIC A;  4WXH A;  2CYY A;  2DLL A;  1TNS A;  4QLC U;  1TQI A;  3G3Z A;  5D8K B;  1HW1 A;  1ZN2 A;  1Z7U A;  4NB5 A;  4FT8 A;  3GFJ A;  2FBK A;  4KMF A;  5HS9 A;  4L9T A;  4LLN A;  3C18 A;  1G3W A;  3E5Q A;  3FMS A;  3SHF A;  2HR3 A;  1R5G A;  3MAJ A;  3NEU A;  5H6R A;  2YX7 A;  4U7B A;  1TQM A;  1F1Z A;  1ZG3 A;  3T1B A;  4BHB A;  4N9H A;  5FD5 A;  1LJ9 A;  2DK8 A;  2FQ3 A;  1J7K A;  2M5W A;  2V1U A;  2PBI A;  4RGU A;  1P2F A;  1L3L A;  3WTU C;  4I02 A;  3TOA A;  3KP6 A;  2XAG A;  1R36 A;  1LEB A;  3KET A;  5D8L B;  1SD6 A;  3ZMD A;  2STT A;  1MGT A;  2XHK A;  1IRF A;  1KU7 A;  3RYP A;  4G7O F;  2PQ8 A;  3E6D A;  5DYM A;  2EB7 A;  1W5T A;  5JVT A;  4ZZL A;  1KGS A;  2WWY A;  2K02 A;  3C7J A;  2X4H A;  3MFK A;  1R58 A;  1SFX A;  2HKO A;  1GXQ A;  3HSF A;  2IVM A;  4ETS A;  3VEP A;  4UXN A;  1WQ2 A;  3RPQ A;  1ZGJ A;  4M72 A;  3F8B A;  3HHG A;  3HSE A;  2DBB A;  4KA4 A;  3V4G A;  2NNN A;  4UV8 A;  2O6G E;  3EYI A;  5HS7 A;  2VOP A;  4F7Z A;  2EJR A;  3FM3 A;  2Z5U A;  5L3B A;  4GYG A;  2ZXJ A;  3GFI A;  2JPB A;  4IRH A;  4G6D A;  5K1Y A;  3MEX A;  4CHU A;  2COM A;  1I1S A;  4RAY A;  2EA2 A;  4FHT A;  2XAS A;  3HTS B;  4A0Y A;  2HYG D;  4O5V A;  5IT3 A;  2HDC A;  5CVI A;  2UZK A;  2M1B A;  2FBI A;  1KU9 A;  4OIN F;  4EQQ A;  2D1H A;  1PP8 F;  4TV7 A;  5L3F A;  1Z9C A;  1EH7 A;  1KU3 A;  2PI0 A;  3I0T A;  1ONV A;  1BC7 C;  3TDZ C;  4DQ2 A;  4N0B A;  1DP7 P;  2DPD A;  2CSO A;  3M7G A;  3MQ0 A;  4CIC A;  1S7A A;  2Y75 A;  2NS0 A;  1FBU A;  2ADU A;  2VOD A;  3HRT A;  4HLY A;  4EMS A;  2FEZ A;  3ROU A;  4KT5 C;  1AWC A;  4Q5S F;  1DDN A;  2E1C A;  1MDM B;  5D4R A;  4G7H F;  3M9A A;  1FP1 D;  2HS5 A;  2DI3 A;  3HRM A;  4IJA A;  1R1V A;  5A2Q K;  3WU0 A;  1J2X A;  5D5W B;  5HDK A;  1YW8 A;  5HVQ C;  1C0W A;  3EDP A;  2STW A;  3JAM K;  2G7H A;  1T0F A;  3WE2 A;  5CVR A;  5FLX Z;  1W7P B;  4RB3 C;  2XKO A;  5FB2 A;  2HOE A;  3ZN0 A;  2OZU A;  2QQA A;  2E1N A;  4LG0 A;  2DQL A;  4EVI A;  5E8G A;  3KZZ A;  2A6E F;  1ZG5 A;  2VC0 A;  3HSR A;  4JK1 X;  4RGR A;  5ICF A;  2HWV A;  2F5D A;  2FMY A;  3BPX A;  1HW5 A;  3KP5 A;  3NQO A;  3J81 Z;  4HV6 A;  4M9X A;  3RTR A;  3M8F A;  1K78 A;  4CYD A;  3EET A;  5DV5 A;  3IL2 A;  2V1D A;  4I98 B;  2L3D A;  1IF1 A;  2OA4 A;  3ZQ7 A;  2A61 A;  2CFX A;  1XCB A;  1SD7 A;  3KLO A;  1B9N A;  1BIA A;  1LDD A;  2ZCW A;  3IHU A;  5L3C A;  1JHH A;  6PAX A;  2L01 A;  4WF2 A;  2EFP A;  3HRS A;  3E6M A;  1U6G A;  3WTW C;  2KJB A;  2NYX A;  1ZRC A;  2XV4 S;  3BJA A;  3RDI A;  3Q9S A;  1I5Z A;  1W7P D;  1IW7 F;  4G9Y A;  3J80 K;  1LDK B;  3ZMV A;  2BGC A;  1Y0U A;  1QZY A;  3DF8 A;  1GVJ A;  1QO0 D;  3FWE A;  3M1E A;  4WXC A;  2GIV A;  3P9C A;  5K5R A;  2JT1 A;  1XGN A;  3K9T A;  1FPQ A;  1S7O A;  3U1D A;  1KYW A;  2FXA A;  2UWM A;  1WRJ A;  4KDP A;  2QM3 A;  2QZ8 A;  2OU2 A;  2BEO A;  3FHZ A;  3KP4 A;  1P4A A;  4RS8 A;  2ESH A;  4IHS A;  1LB2 A;  3VFZ A;  4ZYG A;  3BRO A;  3TO6 A;  2ETH A;  5L3G A;  2HQR A;  3TKY A;  3CLO A;  3KP3 A;  1Z91 A;  5E18 F;  2ISZ A;  1O57 A;  3L7W A;  4HF1 A;  1BI1 A;  2DO7 A;  3WTY C;  3KZY A;  5CJ9 A;  3E6C C;  4M6X A;  1PUE E;  1YYV A;  2W25 A;  3I59 B;  4OIP F;  4EJV A;  1U8R A;  1O3T A;  4HDU A;  4EM1 A;  4ZH4 F;  4BYY A;  3ML6 A;  1FBQ A;  3LQR A;  4ENJ A;  4LD5 A;  1W7P A;  1QZZ A;  1B6A A;  3WGI A;  3I58 A;  2GA1 A;  4Y13 A;  1UHW A;  4AIJ A;  1P4W A;  3E6B A;  1IN4 A;  1Z1D A;  2XAJ A;  3JTG A;  2D45 A;  4HA8 A;  3CUO A;  4KYW A;  3HUG A;  3DFG A;  3GFM A;  2VT2 A;  1IXR C;  4L9J A;  1UB9 A;  3ISP A;  2P5K A;  1D3Y A;  3P7N A;  1IUY A;  3ECH A;  1D5V A;  5DD4 A;  4MEX F;  1O7F A;  2KRF A;  3WTZ A;  5HS8 A;  1QGP A;  5D5V B;  4U0V A;  2P6T A;  1F4K A;  5LHG A;  3V8J A;  4HQE A;  4OMZ A;  2P4W A;  1RIO H;  4IXA A;  2VBX A;  3HOT A;  4LLG F;  3LA2 A;  2E7X A;  3ZPL A;  3KEO A;  2FNA A;  1UFM A;  1U3E M;  1O3S A;  2GWR A;  2F5F A;  4HF2 A;  1CF7 B;  3RI4 A;  1E2X A;  3I64 A;  4ESF A;  1RUO A;  3JSP A;  4LB5 A;  1MD0 A;  3QPH A;  5LBQ A;  2ZO4 A;  1HQC A;  2GXG A;  5EEG A; 
#chains in the Genus database with same CATH topology
 4Y17 A;  2KHM A;  3GLX A;  3FMQ A;  2HDD A;  2MH2 A;  1U5T A;  3FHN A;  3I4P A;  3HKZ A;  1OPC A;  4XKC A;  3TW6 A;  1SVO A;  1XTA A;  2EWN A;  4Y33 A;  1YIT I;  4ASN A;  5J1Y A;  4RGS A;  2CG4 A;  1PVE A;  1JJ6 C;  1IN6 A;  1O7L A;  5IPA A;  3OYB A;  3J80 Z;  5B1B H;  3F0C A;  3HOV J;  4UHT A;  2FE3 A;  2KIU A;  4A3B J;  2XRN A;  4XLF A;  2IGO A;  4WXD A;  2ID3 A;  3ZMT A;  4R1H A;  3BC8 A;  5IYD J;  4W1U A;  2LP0 A;  3JR9 A;  2D5V A;  1FWZ A;  1E3H A;  2I10 A;  2XF7 A;  2DMT A;  5GPA A;  1S3J A;  3VB2 A;  1WFX A;  1IV8 A;  1D1A A;  2LC2 A;  1XGS A;  4CXF A;  1ZGA A;  3QU6 A;  5EZG A;  3LA7 A;  4DW6 A;  5E3N A;  2LFB A;  3LA3 A;  1WJC A;  2JTV A;  2IP2 A;  4P9U A;  2ZJP F;  1LFB A;  4L0Z B;  3AKZ A;  1ZTR A;  1IN8 A;  1HDD C;  3FKJ A;  1STZ A;  2I5U A;  3H0G J;  4B48 A;  4BQA A;  2K27 A;  5E20 A;  3V8L A;  1V5G A;  4WWC A;  3FXU A;  1JKO C;  4CZZ A;  2HZD A;  2EV6 A;  1MH4 A;  1SD4 A;  1ITY A;  2R7Z J;  1KQ9 A;  2OZ6 A;  1ZGW A;  3OIO A;  1UAA A;  1RKT A;  2OV7 A;  1ULY A;  4ZYA A;  3PUB A;  4AYB A;  5EYR A;  3CDI A;  2M4K A;  3E3V A;  2P8T A;  3G1O A;  3H5A A;  3IWZ A;  2NVY J;  3H3Z A;  1L0O C;  3CP8 A;  1YLF A;  3DWL E;  5IOZ A;  3HOS A;  5FJ8 J;  2E34 A;  2HQA A;  3CO7 C;  1YIO A;  3GW2 A;  1T95 A;  4IHW A;  3X2Q H;  2OCE A;  1OCR H;  2X1E A;  4HOB A;  3DQV C;  2HQ5 A;  2QBY A;  1MBE A;  2ZME C;  2HOT A;  2W85 A;  3Q0U A;  1ZAR A;  5HLT A;  3JRA A;  2EIM H;  2VQL A;  4FE7 A;  1MJA A;  4F52 A;  3H36 A;  2O0Y A;  2LSO A;  2CW7 A;  2CQ7 A;  1AOY A;  1SFO J;  2EFN A;  2DYS H;  1JJ8 C;  4Y7N J;  1GLN A;  4GCV A;  1LDJ A;  3FXO A;  5FKM A;  4AVZ A;  4YFK F;  3Q5F A;  4IPA A;  3LSK A;  2CV0 A;  5D4S A;  4BXF A;  1IG7 A;  2B63 J;  1BR1 A;  3VYU B;  3BLY A;  1A04 A;  4J19 A;  1TZL A;  2GOX B;  2BY0 A;  1R23 A;  4BXU A;  2ELK A;  2H94 A;  2FNP A;  2XPU A;  2L4M A;  2OCC H;  1MJB A;  2JJ7 A;  1RR8 C;  2M0C A;  3ASN H;  3BG7 A;  4DGW B;  1XPX A;  2AQE A;  2LF7 A;  5JR3 A;  2DOE A;  3IKV A;  4CCK A;  3HDD A;  1BR2 A;  1VQO I;  4E7Z A;  3QRF F;  1VQ7 I;  3EUK L;  4A12 A;  1TC3 C;  2IGM A;  4UVC A;  2R7O A;  5H6Q A;  4HNT A;  1DUX C;  1UG2 A;  3OS0 A;  3I3L A;  1S8N A;  1YX3 A;  1R6R A;  1X58 A;  4C3I J;  1TWG J;  2ZSI B;  3VYT B;  1IO2 A;  2MG4 A;  2BXZ A;  5E1X A;  3L1P A;  3DV8 A;  4GDF A;  3GZ5 A;  2KDZ A;  4C2U A;  2Y30 A;  2PMZ N;  5J8C A;  4R79 A;  3FDY A;  4AIH A;  4KIT B;  1ETW A;  4MFE A;  1JE8 A;  1IZ1 A;  4PSW A;  3L2V A;  1CF7 A;  3I4M J;  1I3Q J;  2B7E A;  3MKY B;  1HCR A;  3OYL A;  5EGO A;  5J3L A;  3CJQ B;  4HST A;  4Q47 A;  1A6I A;  1BA5 A;  3KYD B;  5FFZ A;  1IXS B;  4D9J A;  5K7Z A;  2F5E A;  3W3C A;  1TW3 A;  2HYJ A;  4IF4 A;  3ZQH A;  2KRH A;  1UCR A;  2BYV E;  1JTX A;  1TLH B;  5FO5 A;  3GYH X;  1WHU A;  4B8X A;  4W97 A;  3KCC A;  4D5C A;  2HVQ A;  1LFP A;  4M71 A;  3S15 J;  3S2W A;  3OIP A;  1XMK A;  1FMW A;  1Q1H A;  3SXY A;  1T39 A;  1HXD A;  5D6E A;  1NK2 P;  3ZQQ A;  5EDN A;  4ZYE A;  4PCQ A;  4LLL A;  4XKV A;  2DT5 A;  3GTQ J;  3QP5 A;  4C3H J;  1FIP A;  3I55 I;  2OPT A;  1J75 A;  2DA4 A;  1B8I B;  5AIQ A;  3ULQ B;  2QWW A;  2QGU A;  4Y52 J;  4JOM A;  3KPH A;  3F6O A;  3CTA A;  5F6F A;  1JT0 A;  2FU4 A;  4RAZ A;  4XKB A;  2L9V A;  3CCU I;  3JW4 A;  2WAF A;  2IBD A;  2W00 A;  3WTV C;  4DBQ A;  4O6J A;  1NG6 A;  2R93 J;  2Y0M A;  3L2C A;  2DDA A;  2KZG A;  3W2A A;  2CV2 A;  3U9G A;  2ZB9 A;  4LK1 F;  1A6Q A;  1QBJ A;  3WTX C;  4HX8 A;  3BG6 A;  4N9I A;  2Q2E A;  3BT9 A;  2M2E A;  2RC4 A;  2E19 A;  4BEH B;  1LKX A;  1ON1 A;  1CQT A;  4B43 A;  2E7W A;  4GYI A;  2VT3 A;  3NAU A;  3WGH A;  2E71 A;  1D8J A;  4IOA F;  1HC8 A;  3BWG A;  3QAH A;  1JUS A;  3A03 A;  2ELJ A;  4L9N A;  4XKW A;  3UNG C;  2FOW A;  3VSL A;  1KQ0 A;  4LJZ F;  4KIG A;  4YG2 F;  2CQX A;  1GVD A;  3IAS 2;  3PIO F;  1MZB A;  2KIS A;  3ZN1 A;  2WC2 A;  2R5Y A;  1ORK A;  4EJU A;  1K6O A;  3W6K B;  3EPZ A;  2H27 A;  2VXZ A;  5IOY A;  2EV0 A;  3D5S C;  3AAF A;  5EEA A;  1V3F A;  1XSX A;  3I71 A;  3BTI A;  4UV9 A;  3ZOB A;  4IZZ A;  1VTN C;  2DA7 A;  2XPV A;  1A31 A;  4M9S A;  3OIQ A;  1S5L C;  2K3P A;  3M1C A;  4L5I A;  1LEA A;  2EZK A;  3OOU A;  2EFW A;  4UUS B;  4GXO A;  2MC3 A;  3HM5 A;  3JRB A;  2QQ8 A;  1PJR A;  2ZC2 A;  3K1P A;  3KLN A;  1LNW A;  3N4M A;  3KE2 A;  4EJT A;  1XSD A;  2JSP A;  4F92 B;  3S3O A;  2Y2Z A;  3EUA A;  2Y9Y A;  4EV0 A;  2EV5 A;  3V7S A;  1SFE A;  2XGD A;  1OFC X;  4BE1 A;  1K6Y A;  3IUO A;  4HSR A;  3HC7 A;  2LG4 A;  4P96 A;  2M4G A;  3FMR A;  3L9F A;  4OIO F;  5K5Q A;  1MKM A;  2G9W A;  5F27 A;  1W36 D;  2NOG A;  1X1B A;  1X19 A;  3QPL A;  4H0E A;  5TRD A;  1FYK A;  1WCM J;  2IT0 A;  4EM2 A;  1IAW A;  3BZ6 A;  1FC3 A;  4Y4R A;  4DZP A;  2P5L C;  4RGX A;  1Z6T A;  4NBQ A;  2KDO A;  3O8G A;  4S04 A;  1FOY A;  1UST A;  4G7Z F;  4GO1 A;  1LFU P;  2W1O A;  3U1K A;  5TJJ A;  3R0A A;  3QP6 A;  4MEY F;  4F55 A;  2VJI A;  2R5Z B;  4ZYD A;  3F8M A;  2ZNZ A;  4G8X A;  1WSU A;  4C3J J;  2L02 A;  1IC8 A;  1ZLJ A;  2DAO A;  4EEF G;  5LHH A;  3GO5 A;  1LPQ A;  2NAZ A;  1XGO A;  2VQG A;  2E35 A;  4HEA 2;  5DS9 A;  1RR7 A;  5J8F A;  4RBO A;  2LD5 A;  2AXL A;  4G6Q A;  1Y8R B;  2WV0 A;  2HEO A;  5C4X J;  3RZO J;  1JTY A;  3PUF A;  5F64 A;  1FYM A;  3TO7 A;  4II2 A;  4YEL A;  5DDG A;  4A3L J;  2F6C A;  3CQZ J;  4G6T B;  2LBF B;  3GEZ A;  1R7J A;  4Q4Z F;  2JWT A;  3H3V K;  4P55 A;  5BS6 A;  3CUQ C;  4N4O B;  2HPI A;  3U21 A;  2VKE A;  4B09 A;  3G2B A;  1YO5 C;  5HLH A;  4NUB A;  3BZK A;  3M8J A;  2R7R A;  2RQQ A;  1P4X A;  4PK4 A;  2P81 A;  2QSG X;  2PMZ A;  3SZT A;  1JGS A;  4MHG A;  1G8X A;  1YRN A;  1I27 A;  4BHC A;  2ZXH A;  1BBY A;  2VE9 A;  2RQP A;  4E4H A;  1Z67 A;  3O3K A;  3ABM H;  4MFD A;  3Q0W A;  1O4X A;  2OBP A;  2ZFW A;  5JLX A;  3CC7 I;  4IRG A;  4ITV A;  4XRS A;  2ZME B;  3RKY A;  3T5X A;  5IT9 K;  4A3J J;  3DKY A;  2VJ4 A;  2X0L A;  2ZNY A;  4AID A;  3TL4 X;  1U8B A;  3JRD A;  1BL0 A;  2D2W A;  2HTS A;  1J5Y A;  4A2U A;  4LGW A;  4ENK A;  4MQ9 F;  1JHF A;  3J7A Y;  2RN7 A;  4A5N A;  5BQT A;  1AKH B;  3QYE A;  1KQ8 A;  2R7W A;  2DFH A;  3EQL F;  1G3S A;  1LVA A;  3MKW B;  2K9S A;  1XN7 A;  1A35 A;  2ZKZ A;  5M5W J;  1IRG A;  3BG9 A;  4BAY A;  3LMM A;  5DTD A;  3E97 A;  4KUM A;  3ABT A;  1GHC A;  4PJM A;  3PM1 A;  1S29 A;  1XGM A;  2W48 A;  1SFK A;  3IH3 A;  2VON A;  4CCO A;  4I01 A;  2ID6 A;  3SZP A;  2MBF A;  3GTM J;  1YQA A;  4OOI A;  2CW0 F;  3REO A;  3F72 A;  1VI0 A;  2K9N A;  2NRA C;  3WOD F;  1FSE A;  1U2W A;  4HG2 A;  1VQ5 I;  4NQW A;  2LF8 A;  2OQR A;  5ILS A;  1Y6I A;  5JI6 A;  3FXL A;  4E70 A;  1H8A C;  1TQP A;  1T0F C;  1OLT A;  3DTK A;  5HDG A;  2MW8 A;  1FTT A;  3LNQ A;  3F3X A;  4JX5 A;  5L3E A;  2CUZ A;  4KN4 X;  1WWX A;  5HNH A;  1R1T A;  2CUJ A;  3B73 A;  1WPK A;  4I0A A;  3RCO A;  1VQ4 I;  4LIT A;  4A69 C;  3A4C A;  1MDM A;  4L18 B;  1T6S A;  3BR6 A;  1K4S A;  3MD2 A;  5KVR A;  2JA8 J;  3AL0 C;  2VB6 A;  2BW3 B;  5JHF A;  2LRD A;  5E79 C;  1VND A;  2VBZ A;  4ZZD A;  1HBX G;  3GTJ J;  3P9K A;  1X4P A;  3R4K A;  5DCM B;  1V5F A;  3S16 J;  1EH8 A;  2XSJ C;  3S14 J;  4BJT A;  2E2J J;  4JP0 A;  2UXN A;  3LSH A;  5CQE A;  5KAI C;  2ZJ2 A;  3QU3 A;  3CCE I;  4PGH A;  3I53 A;  4PFO A;  2XUB A;  2DQR A;  5EEH A;  4II3 A;  3T8T A;  2UUZ A;  2K9Q A;  3OYK A;  1S7E A;  5EF6 A;  4ZC3 A;  1M1E B;  2BBY A;  2DFE A;  3MZY A;  2CH0 A;  3ELK A;  2AXT C;  1JUP A;  3D5L A;  2QA4 I;  1IN5 A;  2KIF A;  2LDU A;  1OIS A;  5H20 A;  4K2E A;  3GUD A;  2HVS A;  4PZJ A;  2JA2 A;  3IRQ A;  1N77 A;  5DEQ A;  1BOA A;  5A2Q Z;  3D0S A;  3NRV A;  2VKD A;  1ZG1 A;  2YR2 A;  2IGN A;  3ZMZ A;  3IV5 A;  2J5O A;  4NC6 A;  3ZQL A;  2KZV A;  2QSF X;  3D5R C;  2V4J C;  3K1N A;  1TWA J;  4AD9 A;  4A6D A;  2HDW A;  1EA3 A;  2QLZ A;  3R6S A;  4BS9 A;  4XOP A;  2MYS A;  5FGM A;  2QKL B;  2Z16 A;  3JAM Z;  2LVS A;  4XLC A;  1R5H A;  4RMN A;  2BE5 F;  2RDP A;  2HYF A;  4LFU A;  3ZRG A;  2P7V B;  4GGG A;  2GBY A;  1VQL I;  4PDK A;  3PO3 J;  3GFL A;  5B3S H;  2V1X A;  1WJB A;  4B1R A;  4EJO A;  5LHI A;  4M3G A;  2Q8K A;  1F36 A;  3AG3 H;  2PG4 A;  1BW5 A;  2F2E A;  3SQN A;  1S72 I;  2XB5 A;  4V2F A;  3HPH A;  3Q9V A;  5KCM A;  5ICC A;  3C2B A;  4RB2 C;  3SEQ A;  2LY2 A;  2CFO A;  4CYC A;  2XC7 A;  1DU0 A;  1MMA A;  3V7R A;  2DCE A;  3QOE A;  5F08 A;  3PIP F;  2ELH A;  1D8K A;  3PNT A;  2IW5 A;  5F0F A;  1REP C;  3BQZ A;  1DGR M;  2OQG A;  3PNY A;  4EGZ A;  1IXC A;  2IA1 A;  2JA7 J;  1HF0 A;  3LL7 A;  4E7H A;  5K5O A;  2PMU A;  5J1R A;  1JKP C;  5ED4 A;  2CUF A;  2XRO A;  2FUG 2;  3HOY J;  1EV7 A;  1HKQ A;  1ETO A;  5FKO A;  1MBF A;  3OYI A;  3FXJ A;  2WTE A;  2VC1 A;  2W82 A;  2XKP A;  1TT0 A;  3ERE D;  1OYI A;  3G4S I;  1XB4 A;  3MMY B;  4Q48 A;  2O3F A;  2VIX A;  3L09 A;  3I4N J;  2BHY A;  2NNY A;  4O3M A;  1NTC A;  2DK5 A;  1P6R A;  3WE3 A;  5IY5 H;  1PYV A;  2BVL A;  3ABU A;  2ZJR F;  5GP9 A;  3K4K A;  1YG2 A;  2KIQ A;  4DOZ A;  2H1K A;  3CDH A;  1I50 J;  2FA5 A;  3F8N A;  1G59 A;  1FLI A;  1HDP A;  2LNB A;  3LQQ A;  2CO5 A;  3OYC A;  4LK0 F;  2L0K A;  1H9G A;  2WAE A;  4XOT A;  1SAN A;  4BXX J;  3DKX A;  1UMQ A;  2JPC A;  1T98 A;  1B1B A;  1BI0 A;  2KPM A;  3CP2 A;  1ZH5 A;  1O3Q A;  2DOF A;  2KT0 A;  5J40 A;  1YS7 A;  2BOL A;  3KZI C;  4JBA A;  2ISY A;  3TQN A;  2VPR A;  1KYZ A;  2W24 A;  1V4R A;  3QYB A;  3K70 D;  5F0C A;  2KIM A;  4AVP A;  2R7Q A;  4DJA A;  3ASO H;  3EUH A;  4EM0 B;  5DUI A;  3GTO J;  1LVK A;  4QPO A;  5F04 A;  3BG3 A;  5F0H A;  5M3F J;  2XF6 A;  1ZLK A;  3JRG A;  3IH4 A;  3VDX A;  4A6E A;  2DPU A;  4C30 A;  1ETQ A;  2GXB A;  2XAH A;  3FF5 A;  4AUX A;  2DDB A;  4R8H A;  4XM3 A;  4PGG A;  1FTZ A;  1XD7 A;  2Y48 A;  2PMH A;  2HI3 A;  3L2W A;  1FOK A;  1S9H A;  2P0W A;  2K9L A;  2DJN A;  4HDV A;  1XMA A;  3H0D A;  1RNL A;  3IRR A;  1VQ6 I;  4MO7 A;  3H9Q A;  3VYS B;  5LEK A;  1YFH A;  5AIP A;  1MBJ A;  1T2K A;  4NHJ A;  1LE8 B;  2QKM B;  2BW3 A;  4G94 A;  1JXS A;  2WY7 Q;  3BQY A;  1YIJ I;  1BJA A;  1LUJ B;  3U2R A;  5BMZ A;  1NHA A;  4HV5 A;  3S3N A;  2JSC A;  2X6X A;  3C2H A;  2K4B A;  4I09 A;  2CGP A;  3RKX A;  3WG9 A;  4U88 A;  3IH2 A;  4HPQ A;  1B9M A;  3I59 A;  1SFU A;  4RB0 A;  5CVV A;  1DPR A;  3CUQ B;  2UV1 A;  2K7L A;  4HZF A;  4L0Y B;  4IRI A;  3S1R J;  3RIR A;  1XG1 A;  4BJ5 C;  1P7I A;  2JVH A;  5B66 C;  2IS4 A;  2KQR A;  4JQF A;  2DA6 A;  2HOA A;  2YPR A;  3FZV A;  4UNO A;  3VPR A;  2R92 J;  1P92 A;  3BR1 A;  1E17 A;  1FSH A;  2CV1 A;  4XIC A;  2YSR A;  4A3M J;  1F43 A;  5HOD A;  1SD5 A;  2ZFU A;  4J01 A;  2R3S A;  2IAI A;  1G2H A;  5LRR A;  2P7C B;  2KMU A;  1OCC H;  1Y1W J;  5KNL A;  4I2O A;  5D5X B;  1P7J A;  2HXO A;  5CVJ A;  1UHM A;  4ZYH A;  4CH7 A;  3KEY A;  4XRS G;  4HX4 A;  3A0H C;  5FFX A;  3OL3 A;  3FXK A;  2DYR H;  2E1O A;  3OSF A;  3FKI J;  2X6W A;  2V7F A;  4MTD A;  4N4N B;  5JHU A;  2I8D A;  4YFN F;  2XAF A;  1HSJ A;  5FLX K;  2IS2 A;  3LSJ A;  1BI2 A;  1WJ5 A;  1R49 A;  2IGK A;  4DNC A;  4BDZ A;  2FRH A;  1WI3 A;  2IA2 A;  4AC0 A;  2IRF G;  2FF4 A;  4P1W A;  1ETX A;  4I6Z A;  3HPG A;  2X1C A;  4FX0 A;  4PFP A;  2F4O B;  4RAG A;  5GTI C;  2JA5 J;  1XCV A;  5E1Z B;  1BI3 A;  4UVA A;  3BPV A;  4CZC A;  2VQH A;  1YW9 A;  2VI6 A;  3K0L A;  4AWX B;  5F1J A;  1F9N A;  1R4M B;  1E3P A;  2XVC A;  4RLQ A;  3OY9 A;  4HNU A;  2BY3 A;  1X3U A;  1U5T C;  2LKP A;  2RKH A;  4G12 A;  3OYN A;  3T0Y A;  3E0J B;  2E60 A;  4X1E A;  2ECB A;  1ZAO A;  1ETY A;  3J81 K;  2DFI A;  2X85 A;  3NWS A;  4L5J A;  4QPQ A;  3MZH A;  5M5Y J;  1RI7 A;  4GRI A;  2Z33 A;  1YJ9 I;  4S0H B;  4XLP F;  2QSH X;  1KON A;  4LG0 B;  3K1M A;  5GAG J;  3N97 A;  1HST A;  3AL0 B;  4KIF A;  2FML A;  4CCM A;  2EA4 A;  2G7U A;  2P5V A;  2L54 A;  1OCZ H;  2XGX A;  2WAQ A;  3ABL H;  3F23 A;  3QWL A;  1N78 A;  3DEU A;  5AON A;  2CWE A;  5GTH C;  3W6J B;  2E2H J;  5LLQ A;  2HKX A;  2IA0 A;  2VKV A;  4L5E A;  4U0Y A;  1Y39 A;  5GPC A;  3DPT A;  4NC7 A;  1GUU A;  5M5X J;  5BOX A;  1ACI A;  3BR2 A;  2L5Q A;  3KFW X;  3K2Z A;  4Z2Y A;  3QYF A;  1I1G A;  3OYE A;  1BM9 A;  2O03 A;  3JRE A;  1K78 B;  2CQQ A;  1WJF A;  2A68 F;  3CCY A;  1FMV A;  1Z3X A;  2A5W A;  1MBK A;  2UXX A;  3HGG A;  1Z6R A;  3S32 A;  5KK1 A;  2B9S A;  1K79 A;  2X9D A;  1MNM C;  4PJN A;  4I76 A;  4IOC F;  4BY1 J;  1OCO H;  1P9Q C;  3MZ8 A;  5HLI A;  1D0Y A;  2M45 A;  5CVU A;  3O2P E;  5EJC A;  3FXM A;  1DPU A;  1QVU A;  2PFB A;  1USS A;  4JX4 A;  3WHC A;  2AQF A;  3VYR B;  4D7N A;  2GXA A;  1TNT A;  2VAS A;  2E5N A;  2XSD C;  2OTJ I;  1X1P A;  1HLV A;  1WH7 A;  4V19 K;  4XMY A;  5BPD A;  5E17 F;  3PSF A;  1ZRF A;  3HGY A;  3CO6 C;  1WI9 A;  5E1W A;  5JVG F;  2GQQ A;  1G3Y A;  1TWC J;  2EZH A;  2PN6 A;  4CA0 A;  2B0L A;  4KJZ A;  1A5J A;  3WGG A;  1VQK I;  4CDG A;  1AHD P;  2EK5 A;  4WCG A;  1R4N B;  5FRO A;  2FD5 A;  3SFZ A;  3MKL A;  2JZY A;  3GZN B;  3FBN B;  3BJ6 A;  3H3U A;  3ECO A;  2ICW G;  1Y0N A;  3MWM A;  5E3M A;  3CUQ A;  3A01 B;  2HZT A;  5CYV A;  4BBR J;  2K86 A;  2OD5 A;  3LFK A;  5K7H A;  2MA3 A;  5HNF A;  1RZ4 A;  3E5X A;  4OIQ F;  1N25 A;  3TBI A;  2H8R A;  2MLK A;  4XN3 A;  4LOC A;  3BR0 A;  4IX7 A;  2BVM A;  4S05 A;  3LFU A;  1MNE A;  4ESB A;  1J59 A;  5CQG A;  4CO8 A;  2LLK A;  1T38 A;  2HVR A;  1W1W E;  3GME A;  4HAM A;  2TCT A;  1Z05 A;  3LSR A;  4YRV A;  2RNJ A;  4ON0 A;  1Z7L A;  2XB0 X;  3LAJ A;  2XDV A;  4M9Z A;  3H9J A;  4IEJ A;  4ZTF A;  1MBG A;  1MJ9 A;  1MMN A;  1V55 H;  2DFF A;  2XAU A;  3L00 A;  3RJP A;  4A0X A;  5HOO A;  3CDL A;  3WU1 B;  3RYR A;  3MKZ A;  3TP3 A;  3TDU C;  1GT0 C;  2QVO A;  4BKX A;  2PJP A;  4P9F A;  3ONQ A;  1JT6 A;  2IJL A;  3HRU A;  4PJL A;  1R22 A;  4YIR X;  1ZYR F;  4RA2 A;  4V2G A;  4RB1 A;  1FZP B;  1MMG A;  2Q0O A;  1T56 A;  2V6C A;  1YE9 A;  5IYB J;  3CCM I;  2VOO A;  3HYI A;  1QHH D;  1OMI A;  3K4M A;  2YU3 A;  1W0T A;  3CMM A;  2MFZ A;  5D6F A;  2VE8 A;  2MAB A;  3N05 A;  4U7D A;  3GTP J;  2FOK A;  3T8R A;  1HKT A;  4HF0 A;  5EZH A;  3P9I A;  3CF5 F;  4XLH A;  2CQK A;  3ABK H;  4HW0 A;  4IVN A;  5FD6 A;  1O3R A;  2A6H F;  3DTE A;  2COB A;  4HLX A;  4I7H A;  4D0P A;  5DD8 A;  3UKG A;  3E1S A;  4F93 B;  1FYL A;  4UUT A;  5CKT A;  2A3S A;  1YW7 A;  3O6B B;  3HTU A;  1IV6 A;  1IN7 A;  3CC2 I;  2W84 A;  3FK7 A;  1ZK8 A;  1WKM A;  3VSK A;  1KU2 A;  2BV6 A;  2YUS A;  2NVT J;  4E6K G;  2QUF A;  4A0Z A;  1QZE A;  5EG0 B;  3HOX J;  2VXD A;  4ZDO A;  3E5U A;  2J5P A;  5LFA A;  1KA8 A;  3DEE A;  3LAP A;  1F5T A;  1BIB A;  2EFO A;  2OUM A;  4M6Y A;  4XSX F;  2AO9 A;  2O9L A;  3ZMS A;  1B4A A;  3DXJ F;  4CCJ A;  3QPT A;  4BQO A;  3S1M J;  2H8W A;  3TOB A;  2H6C A;  1WJE A;  2M9H A;  4BH9 A;  2DA2 A;  3KX2 A;  4YIF A;  1BC8 C;  3BCB A;  3L2R A;  1D1C A;  2A07 F;  4E7L A;  1G4D A;  2KKO A;  2R7D A;  5KAF C;  1ENH A;  2DTR A;  3CJN A;  1XDU A;  4RLF A;  5ERI A;  3DLL F;  5FRM A;  3EYY A;  1FX7 A;  3A2K A;  5ICG A;  4A3K J;  1XDS A;  3H5N A;  1UZC A;  3R0J A;  4IL6 C;  2MD5 A;  1IDZ A;  3AG2 H;  3RPU D;  4FX4 A;  3BOQ A;  3BJO A;  4Y15 A;  2EZL A;  3LSG A;  3ZMU A;  1DP3 A;  4UB6 C;  1OR7 A;  1XX5 A;  4XRM A;  1TBX A;  2DA1 A;  4DBR A;  3PQJ A;  4CUG A;  3OYM A;  1J0R A;  3C2G A;  1H0M A;  3HOU J;  4MTE A;  4ENN A;  2RGV A;  1B59 A;  1D0Z A;  3G73 A;  3GF2 A;  1OKR A;  2M8G X;  4UVB A;  3BDD A;  3DLA A;  4PJJ A;  1MIJ A;  2DW4 A;  3K4C A;  3PNV A;  1LQ1 A;  3CZ6 A;  1U9O A;  2DMQ A;  3OMY A;  3TMO A;  1YS6 A;  4E7I A;  2W4S A;  2H09 A;  2MH9 A;  2Z99 A;  5E3O A;  1ODD A;  3F6V A;  2XF5 A;  4OIR F;  2EH3 A;  1IDY A;  3QPS A;  2M30 A;  4KNY A;  1TT5 B;  2XAQ A;  3J7A O;  3MCZ A;  2WAD A;  5L3D A;  3TO9 A;  3OSG A;  2EFQ A;  1W5S A;  3JCU C;  3VOD A;  1B8I A;  3K10 A;  1B72 B;  4FIS A;  2QQ9 A;  1FJL A;  2HGC A;  2V6E A;  1UHS A;  1PUF B;  4IHY A;  4LMY A;  2FX0 A;  2DA5 A;  1HW2 A;  1G3T A;  4P5O A;  1NG7 A;  2OAZ A;  5B5E C;  2VBY A;  1Z21 A;  4QIW N;  3RSN A;  2L7M P;  2ZSH B;  3K4L A;  2VJ5 A;  3SYT A;  3CLQ A;  5LGN A;  3HEF A;  5DUK A;  3GXO A;  5ILU A;  5D5U B;  3IC7 A;  1ON2 A;  4BBS J;  3PQK A;  1FY7 A;  3GTL J;  4BEH A;  4BU2 A;  1FBS A;  3FXQ A;  3A01 A;  2XGE A;  4UB8 C;  1U5T B;  2F4M B;  4U0W A;  3ZP5 A;  2ACJ A;  2KJC A;  5IP6 A;  2ZBK A;  4AIK A;  1QQI A;  2IS1 A;  2EPF A;  5LGU A;  1WJD A;  2GA2 A;  1XSV A;  3IKT A;  2O61 A;  2XIG A;  2F48 A;  3GLL A;  3R60 A;  3P5J A;  1GXP A;  1BN5 A;  5ILV A;  1SMY F;  1SMT A;  3JRH A;  4WX9 A;  1QA6 A;  3KP7 A;  3RPU A;  4HX7 A;  3GVA A;  5DM6 F;  2HXI A;  2QYO A;  2V79 A;  4WK8 F;  3H1C A;  4M73 A;  1VF9 A;  4XQF A;  1Y8Q B;  2VBW A;  5BPI A;  2LKX A;  2L9S A;  1FOX A;  3HZJ A;  2K3F A;  2BXY A;  4BQN A;  1H9T A;  3C3W A;  3FM5 A;  3B02 A;  1R1U A;  3BTJ A;  4HYE A;  5DCF A;  2KL4 A;  3F8F A;  1AA7 A;  3RKW A;  2LY9 A;  2M87 A;  2V9V A;  3LSI A;  2BZT A;  4IHX A;  5K7F A;  5E8I A;  4UUS A;  3GX4 X;  3HHH A;  2K40 A;  2HTJ A;  2A69 F;  5IP7 J;  4E7K A;  2H6B A;  5CLS A;  4XLN F;  2Z2S B;  3JTH A;  2VPL A;  2L4A A;  3OV8 A;  2M7B A;  2TDX A;  3Q3S A;  1Z77 A;  4BY7 J;  3V7C A;  4B44 A;  1TL8 A;  1JI8 A;  1FT9 A;  3OYJ A;  2JUG A;  1RPW A;  3C1D A;  5J6X A;  3AFH A;  3O8H A;  4DYQ A;  5J4Y A;  3W6V A;  4L9V A;  3BR5 A;  3CJT B;  2RV8 A;  4XL9 A;  2FSW A;  4E7J A;  2DU9 A;  2K4J A;  5FKL A;  5LEJ A;  3WTT C;  4UUV A;  2GZW A;  4BQQ A;  2GAU A;  3FBI B;  2A5Y B;  5H2F C;  4ANJ A;  2ESN A;  1G6N A;  2JRM A;  3QOP A;  3R61 A;  4CGZ A;  2AS5 F;  1HA8 A;  2HNH A;  3TGN A;  2W57 A;  2R5Z A;  1U78 A;  2QBY B;  4KN7 X;  1D0X A;  4I99 C;  4KIB A;  1FP2 A;  4HBL A;  3FK6 A;  3SDG A;  4QSH A;  2PJR B;  3GBG A;  2M7A A;  3JSO A;  3BY6 A;  1MW7 A;  5C3E J;  1FEX A;  2VL8 A;  2FBH A;  4XRF A;  4XSZ F;  3V8K A;  2FJ1 A;  5GAD J;  1YJN I;  3M4O J;  2IPQ X;  2X48 A;  1RET A;  2CUE A;  1RUN A;  3BZC A;  3H9G A;  3F21 A;  2CS3 A;  3LST A;  1W36 C;  2RAE A;  2ME6 A;  2LBF A;  1AU7 A;  1QPI A;  4IHT A;  1VQN I;  4MLO A;  2DOD A;  5TGT A;  4MNU A;  1BOB A;  2JRT A;  4ENM A;  1IJW C;  4OMY A;  4YII A;  1X2N A;  5JFR A;  1HOM A;  2BY1 A;  3H92 A;  4QTR A;  3WTS C;  3GTG J;  3S17 J;  3GWZ A;  4MIM A;  3DKW A;  3FXR A;  4XN0 A;  4EJW A;  1TW2 A;  1OYW A;  3S93 A;  4ZJZ A;  3G71 I;  2ME0 A;  3HB9 A;  3FX3 A;  2VQC A;  1OYY A;  2ZME A;  4FQG A;  1XS9 A;  1K61 A;  1S6L A;  1T08 B;  4OU0 A;  3M8E A;  2PLY A;  4M74 A;  2JQ7 A;  3DCF A;  3HL2 A;  4I0B A;  4IKF A;  2QEN A;  4MGR A;  1GV2 A;  3CMA I;  2HU9 A;  3KYC B;  1QNT A;  2M8E A;  3F9K A;  4LIU A;  4YFX F;  1TTY A;  3BP8 A;  1K7A A;  4ESJ A;  2XRL A;  5ICE A;  1K4T A;  3F22 A;  4KMU X;  5DM7 F;  1AKH A;  1I6X A;  3DU5 A;  2NS8 A;  2LK2 A;  3VOE A;  3BCA A;  3M3Y J;  4BHP A;  1B72 A;  4EGY A;  5HLG A;  1SAX A;  3HIF A;  3KP2 A;  2HQN A;  1HKS A;  1FIA A;  2MLG A;  4BNC A;  2O8X A;  2XGC A;  2DJI A;  2M3A A;  4XBF A;  4D7M A;  2YX4 A;  3DBR B;  3F8C A;  1PP7 U;  5IT9 Z;  2VN2 A;  1ZRD A;  2R7F A;  1Q1V A;  5EGO B;  2R7V A;  1QHG A;  1CGP A;  3IWF A;  1SEU A;  1TP4 A;  3I54 A;  1X3Z B;  1ZHF A;  3DP7 A;  2M34 A;  4F91 B;  3AG1 H;  3GCM A;  1YTY A;  4MQV A;  3M07 A;  2HFH A;  2QQB A;  1Y56 A;  2TRT A;  2ZXW H;  5LGT A;  1RES A;  2D1V A;  2F5C A;  4QWQ A;  3ZQF A;  4A3F J;  2P6S A;  1PDN C;  3DPL C;  3K7A J;  3Q0V A;  1ZRE A;  2Z9O A;  4KFC A;  3GZ6 A;  3DEW A;  1FNN A;  1Y1V J;  1ETV A;  2WBM A;  2DMP A;  1W0U A;  5F1R A;  2LR8 A;  2YS9 A;  1Z0X A;  4HQM A;  4Y3O A;  3COA C;  1EH6 A;  3OR2 C;  5HDN A;  4X0G A;  3PFI A;  2O8K A;  4LB6 B;  5CPR B;  4XLE A;  3MVP A;  3I5U A;  4XID A;  4A5M A;  3B6A A;  3LWF A;  2MGQ A;  3PL8 A;  5GAE J;  5DCM A;  1J9I A;  2Y69 H;  2Z3Y A;  2PEX A;  3K69 A;  3S8P A;  2RVC A;  2C6Y A;  1FOW A;  3KEQ A;  1W4M A;  3OOP A;  5J47 A;  5LRS A;  1R00 A;  1QPM A;  1UJ8 A;  2NXN B;  4KIC A;  2CYY A;  1DQU A;  4PUS A;  4WXH A;  2DLL A;  2JVG A;  2LH9 A;  3BTC A;  3BTL A;  1TNS A;  4QLC U;  1TQI A;  2K9M A;  3G3Z A;  5D8K B;  3SDB A;  3I56 I;  1HW1 A;  1ZN2 A;  1Z7U A;  1POG A;  4NB5 A;  3RQI A;  2R7T A;  3L2U A;  4FT8 A;  3GFJ A;  5JLW A;  1W5C C;  2FBK A;  4KMF A;  5HS9 A;  2CMP A;  4L9T A;  3ZQC A;  4LLN A;  1X2M A;  2Q2E B;  1VQP I;  1KZH A;  1X1A A;  3C18 A;  1G3W A;  3E5Q A;  2DA3 A;  3FMS A;  3SHF A;  2HR3 A;  1R5G A;  3CME I;  3I9V 2;  3PSI A;  3MAJ A;  3NEU A;  5C44 J;  3IAM 2;  5H6R A;  2YX7 A;  2JUC A;  4U7B A;  1TQM A;  1F1Z A;  3OYG A;  2LTP A;  1JKQ C;  1ZG3 A;  3T1B A;  2RRE A;  4BHB A;  4N9H A;  1XC5 A;  2CRG A;  1MBH A;  3K6G A;  2R5Y B;  5FD5 A;  1JKR C;  1LJ9 A;  3K4N A;  4KIS A;  2DK8 A;  3CF2 A;  2FQ3 A;  1J7K A;  2M5W A;  2V1U A;  1WZ2 A;  2PJR A;  2PBI A;  4RGU A;  1P2F A;  1L3L A;  2FQ4 A;  3WTU C;  3JRI A;  4I02 A;  5GAH J;  1R71 A;  3TOA A;  3KP6 A;  2JMW A;  2XAG A;  4BE0 A;  1WVR A;  2IS6 A;  1R36 A;  1LEB A;  3ZR8 X;  3KET A;  5D8L B;  1SD6 A;  1UEL B;  5E3L A;  3KIO A;  3ZMD A;  2STT A;  1MGT A;  2EIL H;  2XHK A;  1IRF A;  1KU7 A;  2LYC A;  1TWH J;  1QU3 A;  3RYP A;  4D1Q A;  3S2H J;  4G7O F;  2PQ8 A;  4ZDP A;  3RZD J;  3E6D A;  4NDL A;  5DYM A;  2EB7 A;  1W5T A;  5JVT A;  4ZZL A;  3OYD A;  2E5Z A;  1KGS A;  2WWY A;  2K02 A;  3EUH C;  1WGX A;  1I6H J;  1APL C;  3H35 A;  2NVU B;  1ZR2 A;  2KRC A;  1ZKG A;  3C7J A;  2JK3 A;  2A05 A;  2X4H A;  3MFK A;  1R58 A;  3HOZ J;  4OWR B;  5TIS C;  2L7F P;  3SJM A;  1SFX A;  2HKO A;  1GXQ A;  3HSF A;  1ETK A;  2IVM A;  1RRJ A;  4ETS A;  3VEP A;  4UXN A;  1WQ2 A;  3RPQ A;  2R4G A;  2L7K A;  2R7S A;  1ZGJ A;  4M72 A;  3F8B A;  3OYH A;  3HHG A;  3HSE A;  4B47 A;  2DBB A;  2WB1 N;  4KA4 A;  2WV1 A;  2GLO A;  4NNJ A;  3V4G A;  2NNN A;  3D1N I;  4OAY A;  4DYC A;  2MD0 A;  3W2V A;  4UV8 A;  2V26 A;  5KHD A;  2O6G E;  3EYI A;  5HS7 A;  4X6A J;  4M3D A;  2VOP A;  2L9R A;  2A6T A;  3DU6 A;  4F7Z A;  1U9N A;  2EJR A;  3FM3 A;  2Z5U A;  1BW6 A;  3HXL A;  3E7L A;  2YU9 J;  2OF7 A;  2L9N A;  4E7S A;  5L3B A;  4A3C J;  4GYG A;  1VFC A;  3RKQ A;  1MMS A;  2KFD A;  2ZXJ A;  3GFI A;  2JPB A;  4NC8 A;  3S1N J;  4IRH A;  4IQJ A;  3ERM A;  4XLA A;  4G6D A;  2NS7 A;  5K1Y A;  1IUF A;  1YRN B;  3MEX A;  2NOJ B;  4CHU A;  2COM A;  2VJJ A;  1I1S A;  4RAF A;  4RAY A;  3SZG A;  2EA2 A;  1I3A A;  2QCO A;  4FHT A;  4BGD A;  1YHQ I;  3FIW A;  4XK4 A;  1V5E A;  2EZI A;  1OCT C;  2V9K A;  2XAS A;  3ZCO A;  3HTS B;  2VKH A;  3HJE A;  4A0Y A;  2HYG D;  1MSE C;  2JN6 A;  4O5V A;  5IT3 A;  1LE8 A;  5LD2 C;  2HDC A;  3CCV I;  5CVI A;  1RC9 A;  2V9P A;  2CQN A;  3K70 C;  4LG3 A;  2M1B A;  4JX6 A;  2UZK A;  3H5R A;  4FET A;  2FBI A;  1KU9 A;  4OIN F;  4EQQ A;  2D1H A;  1PP8 F;  4TV7 A;  5L3F A;  1Z9C A;  1EH7 A;  1KU3 A;  4ABZ A;  2PI0 A;  3SFI A;  3LOC A;  5FKN A;  4A3E J;  3I0T A;  2W7N A;  2V1N A;  1ONV A;  1R9T J;  1NH3 A;  1BC7 C;  3TDZ C;  3WU2 C;  4DQ2 A;  2XPW A;  4N0B A;  1DP7 P;  2DPD A;  2CSO A;  3OS2 A;  3HOW J;  3M7G A;  5BNG A;  1MSF C;  3MQ0 A;  4CIC A;  2RNG A;  1S7A A;  2Y75 A;  2NS0 A;  4ZTJ A;  1FBU A;  2ADU A;  4NQW B;  2VOD A;  3HRT A;  4Z6Y A;  4HLY A;  4EMS A;  4U87 A;  4XON A;  1SVM A;  2FEZ A;  3TP0 A;  3ROU A;  5IYC J;  4KT5 C;  4BDY A;  1AWC A;  3VWB A;  4Q5S F;  1DDN A;  3K4J A;  3IP4 B;  2E1C A;  3OYF A;  1YX5 A;  3CCR I;  2E1M C;  2DT7 B;  1TWF J;  1MDM B;  5D4R A;  4G7H F;  3M9A A;  1FP1 D;  2HS5 A;  3OR1 C;  1H89 C;  2DI3 A;  3HRM A;  2F4I A;  3OL4 A;  3DBH B;  4A93 J;  2MC4 A;  4IJA A;  1X1C A;  2CJJ A;  1R1V A;  2PX9 A;  2Y0S N;  5A2Q K;  3WU0 A;  3K2A A;  1J2X A;  2OTL I;  5D5W B;  1T33 A;  5HDK A;  3CMY A;  4XR6 A;  3KYL A;  1YW8 A;  2EBI A;  2N8G A;  5HVQ C;  4M6V A;  3G1L A;  3QQA A;  1C0W A;  3EDP A;  3K4B A;  3CES A;  2STW A;  4AM3 A;  3PJR A;  1IGN A;  3JAM K;  2G7H A;  1T0F A;  3WE2 A;  5CVR A;  5FLX Z;  1I39 A;  3CCJ I;  1W7P B;  4RB3 C;  2XKO A;  3A1Y A;  5FB2 A;  4CCN A;  4HNV A;  2QF7 A;  2HOE A;  3ZN0 A;  3CCS I;  1SAU A;  3NAR A;  1V54 H;  4C9Y A;  2OZU A;  1DGW Y;  4IQ4 A;  2QQA A;  4CCL A;  3G1M A;  5J1U A;  3DPU A;  5M3M J;  2E1N A;  4LG0 A;  2DQL A;  1EF4 A;  4EVI A;  5E8G A;  4FAS D;  3A02 A;  4RM3 A;  1D5Y A;  3KZZ A;  2A6E F;  3HG9 A;  4FTH A;  1ZG5 A;  2VC0 A;  2JA6 J;  1H88 C;  3HSR A;  4JK1 X;  1NK3 P;  4RGR A;  2O7O A;  4M3B A;  2AHQ A;  3HUG B;  5ICF A;  1SC7 A;  2HWV A;  2HOS A;  2F5D A;  2FMY A;  4B4C A;  1XMX A;  3BPX A;  2LKS A;  1HW5 A;  3KP5 A;  3NQO A;  3J7Z I;  1GDT A;  3J81 Z;  4HV6 A;  3DTI A;  4M9X A;  4OAZ A;  3RTR A;  3M8F A;  2WA0 A;  1K78 A;  2LOO A;  4CYD A;  4KT6 A;  1J09 A;  3EET A;  1ERD A;  2DMN A;  3PFY A;  5DV5 A;  3JRC A;  2EIK H;  3IL2 A;  2GM4 A;  2V1D A;  4I98 B;  2L3D A;  1X1D A;  4CYC B;  1IF1 A;  2DTZ A;  2OA4 A;  3ZQ7 A;  2A61 A;  2CFX A;  1XCB A;  2DN0 A;  4IO9 F;  1YI2 I;  1SD7 A;  1OQY A;  2WB1 A;  3KLO A;  3BR3 A;  3CC4 I;  1B9N A;  1BIA A;  2BHZ A;  3HBL A;  1LDD A;  3A0B C;  4D5F A;  2ZCW A;  9ANT A;  3NWT A;  3IHU A;  5L3C A;  1JHH A;  4J00 A;  6PAX A;  2IEK A;  2L01 A;  4WF2 A;  3B6C A;  1X3W B;  4ZDL A;  2EFP A;  3HRS A;  3E6M A;  3J7Y J;  1U6G A;  4M3E A;  3WTW C;  2KJB A;  4BL0 B;  4AU7 A;  1DU6 A;  2NYX A;  3S1Q J;  3WG7 H;  3CCQ I;  2MSY A;  1ZRC A;  3HKZ N;  2XV4 S;  3AG4 H;  3WHB A;  3BJA A;  3RDI A;  3Q9S A;  3OS1 A;  2Q1Z B;  1I5Z A;  2Z1D A;  2DMU A;  1W7P D;  1IW7 F;  4G9Y A;  2E2I J;  3J80 K;  1LDK B;  3ZMV A;  4H4K C;  4C2M J;  1YOV B;  1UG0 A;  3G6E I;  2BGC A;  2IXS A;  1WH5 A;  3ZQI A;  1VZ0 A;  4EAT A;  1GV5 A;  2G0E A;  1Y0U A;  1QZY A;  1JGG A;  3DF8 A;  1GVJ A;  1QO0 D;  2CU7 A;  3DBL B;  3FWE A;  3M1E A;  4WXC A;  2LRE A;  2OJE D;  3QOD A;  2GIV A;  3P9C A;  4YEJ A;  4DZJ A;  2NVQ J;  5K5R A;  4FCY A;  2JT1 A;  1XGN A;  2E36 A;  4B3X A;  2KLO A;  3K9T A;  4LIV A;  1FPQ A;  1S7O A;  3U1D A;  1KYW A;  2FXA A;  2UWM A;  1U0J A;  1WRJ A;  4KDP A;  2QM3 A;  2KP6 A;  2OU2 A;  2QZ8 A;  2Y31 A;  2BEO A;  3FHZ A;  2NVX J;  3KP4 A;  1P4A A;  3S3M A;  1MH3 A;  4RS8 A;  5FLM J;  1OJL A;  2HPM A;  2ESH A;  2X6Y A;  3V42 A;  4IHS A;  1LB2 A;  2EQR A;  3VFZ A;  5IP9 J;  5FKK A;  4ZYG A;  3BRO A;  3TO6 A;  2ETH A;  5L3G A;  2HQR A;  2VUM J;  2X6O A;  3TKY A;  4A3G J;  3CLO A;  4AYB N;  2X1D A;  1QRY A;  3KP3 A;  1Z91 A;  2ZJQ F;  1EJ9 A;  3RQ4 A;  3TW7 A;  5E18 F;  1BJZ A;  1K83 J;  2ISZ A;  1O57 A;  3L7W A;  4HF1 A;  1BI1 A;  1ZEL A;  2DO7 A;  2WY8 Q;  3WTY C;  3KZY A;  5CJ9 A;  3E6C C;  2OC6 A;  4M6X A;  2R7X A;  1JUM A;  1PUE E;  1YYV A;  2W25 A;  3I59 B;  1MND A;  4OIP F;  3W2W A;  4EJV A;  1Z3Y A;  4GFB A;  1U8R A;  1O3T A;  1A36 A;  4HDU A;  4UY8 I;  2DT6 A;  4EM1 A;  3FIS A;  4ZH4 F;  4BYY A;  2R7U A;  3ML6 A;  1FBQ A;  3LQR A;  4ENJ A;  1IRZ A;  5B1A H;  1WJA A;  1OR7 C;  4LD5 A;  1W7P A;  1QZZ A;  2Y0S A;  1B6A A;  1IRX A;  3WGI A;  5EG0 A;  3I58 A;  1N75 A;  2GA1 A;  3ZXS A;  1VQ8 I;  4C2T A;  2ECC A;  4PJ0 C;  4Y13 A;  3TED A;  1UHW A;  4AIJ A;  1P4W A;  3E6B A;  3ESW B;  4DIQ A;  3CD6 I;  1IN4 A;  2M0M A;  3OYA A;  2BY2 A;  1E3O C;  3LSP A;  1Z1D A;  2XAJ A;  4F3Q A;  3JTG A;  1VQM I;  2D45 A;  4M3F A;  4HA8 A;  1E0E A;  3CUO A;  4KYW A;  2QEX I;  3HUG A;  3DFG A;  2R0Q C;  1VQ9 I;  1OCP A;  2DOA A;  3GFM A;  1MMD A;  4CSW A;  2VT2 A;  1IXR C;  4L9J A;  3LSM A;  4A3I J;  4RM2 A;  3PO2 J;  3GTK J;  2EIJ H;  1YJW I;  1UB9 A;  2O5R A;  3ISP A;  2P5K A;  3ZGK A;  1D3Y A;  4IHV A;  3P7N A;  1IUY A;  3ECH A;  1D5V A;  5DD4 A;  1T8I A;  4MEX F;  1O7F A;  2VLA A;  2K85 A;  2KRF A;  5C4J J;  5FRN A;  3UR3 C;  3MN2 A;  3WTZ A;  5HS8 A;  1RKW A;  2GOM A;  1QGP A;  1R5I D;  1QVT A;  2WAQ N;  1BR4 A;  5D5V B;  4U0V A;  2P6T A;  1F4K A;  4BE2 A;  5LHG A;  2X51 A;  4BJ6 C;  3V8J A;  4HQE A;  4A3D J;  4RDU A;  4OMZ A;  2P4W A;  2LY1 A;  2ZXI A;  4JYK A;  1SVL A;  4FE4 A;  1RIO H;  2E1M B;  4IXA A;  4BAC A;  2VBX A;  3HOT A;  1D1B A;  2L2O A;  4LLG F;  4PSX A;  5FLV A;  3CJR B;  5J4V A;  3LA2 A;  4HRI A;  2CW8 A;  1EKE A;  3JRF A;  2E7X A;  4B3A A;  3ZPL A;  3KEO A;  2FNA A;  2LMD A;  2L7Z A;  1UFM A;  2K5C A;  1U3E M;  1PUF A;  1O3S A;  2GWR A;  4XNF A;  2F5F A;  4HF2 A;  1CF7 B;  2GIZ A;  3RI4 A;  3ZQG A;  2Y9Z A;  4BUP A;  3OWT A;  1E2X A;  3I64 A;  4ESF A;  1RUO A;  3JSP A;  2F5V A;  3BG5 A;  4LB5 A;  3CCL I;  1MD0 A;  3QPH A;  1ZQ3 P;  3SEZ A;  4DYR A;  2EIN H;  1ZR4 A;  5LBQ A;  2ZO4 A;  3S2D J;  3L2Q A;  1HQC A;  2GXG A;  1X4O A;  5EEG A;  2H1L A;  4XOR A;  2DXI A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  3GLX A;  3FMQ A;  2MH2 A;  1U5T A;  3I4P A;  1OPC A;  2EWN A;  4ASN A;  4RGS A;  2CG4 A;  1IN6 A;  1O7L A;  3J80 Z;  4UHT A;  2FE3 A;  2KIU A;  2XRN A;  4WXD A;  3ZMT A;  4R1H A;  1FWZ A;  1S3J A;  3VB2 A;  4CXF A;  1XGS A;  1ZGA A;  3QU6 A;  3LA7 A;  3LA3 A;  2JTV A;  2IP2 A;  4P9U A;  4L0Z B;  1IN8 A;  1STZ A;  4BQA A;  2K27 A;  5E20 A;  3V8L A;  4WWC A;  3FXU A;  4CZZ A;  2EV6 A;  1SD4 A;  1KQ9 A;  2OZ6 A;  1ULY A;  3E3V A;  2P8T A;  3IWZ A;  3H3Z A;  1L0O C;  1YLF A;  3HOS A;  3CO7 C;  1YIO A;  3GW2 A;  4HOB A;  3DQV C;  2QBY A;  2W85 A;  1ZAR A;  1MJA A;  2O0Y A;  2LSO A;  1AOY A;  2EFN A;  4GCV A;  1LDJ A;  3Q5F A;  4YFK F;  4IPA A;  5D4S A;  1A04 A;  1R23 A;  4BXU A;  2H94 A;  2FNP A;  2L4M A;  1MJB A;  2LF7 A;  5JR3 A;  3IKV A;  3QRF F;  4A12 A;  4UVC A;  5H6Q A;  1DUX C;  1S8N A;  5E1X A;  3DV8 A;  3GZ5 A;  5J8C A;  4R79 A;  4AIH A;  1JE8 A;  1IZ1 A;  1CF7 A;  4Q47 A;  5FFZ A;  1IXS B;  2F5E A;  1TW3 A;  4IF4 A;  1UCR A;  2BYV E;  1TLH B;  5FO5 A;  3GYH X;  4B8X A;  3KCC A;  4M71 A;  3S2W A;  1XMK A;  1Q1H A;  3SXY A;  1T39 A;  1HXD A;  5D6E A;  4ZYE A;  4PCQ A;  4LLL A;  2DT5 A;  3QP5 A;  1J75 A;  5AIQ A;  3ULQ B;  2QWW A;  3F6O A;  3CTA A;  5F6F A;  2FU4 A;  4RAZ A;  3JW4 A;  3WTV C;  4O6J A;  2Y0M A;  3L2C A;  3U9G A;  4LK1 F;  1QBJ A;  3WTX C;  4HX8 A;  4N9I A;  2Q2E A;  2RC4 A;  1ON1 A;  2E7W A;  4GYI A;  2VT3 A;  3WGH A;  1D8J A;  3BWG A;  3QAH A;  4L9N A;  1KQ0 A;  4LJZ F;  4KIG A;  4YG2 F;  1MZB A;  3ZN1 A;  2WC2 A;  4EJU A;  1K6O A;  3W6K B;  2H27 A;  2VXZ A;  2EV0 A;  3AAF A;  1V3F A;  1XSX A;  3I71 A;  4UV9 A;  1VTN C;  4M9S A;  4L5I A;  1LEA A;  2EFW A;  4GXO A;  2MC3 A;  3K1P A;  3KLN A;  1LNW A;  3N4M A;  3KE2 A;  4EJT A;  1XSD A;  4EV0 A;  2EV5 A;  3V7S A;  1SFE A;  4P96 A;  3FMR A;  3L9F A;  4OIO F;  5K5Q A;  1MKM A;  2G9W A;  5TRD A;  4H0E A;  1FYK A;  2IT0 A;  4EM2 A;  1IAW A;  3BZ6 A;  1FC3 A;  2P5L C;  4RGX A;  1Z6T A;  4S04 A;  1UST A;  4G7Z F;  4GO1 A;  5TJJ A;  3R0A A;  3QP6 A;  4MEY F;  4ZYD A;  3F8M A;  2ZNZ A;  4G8X A;  1WSU A;  2L02 A;  1ZLJ A;  2DAO A;  5LHH A;  3GO5 A;  2NAZ A;  1XGO A;  5J8F A;  2AXL A;  4G6Q A;  2WV0 A;  2HEO A;  5F64 A;  1FYM A;  3TO7 A;  5DDG A;  3GEZ A;  1R7J A;  4Q4Z F;  4P55 A;  5BS6 A;  3CUQ C;  4B09 A;  1YO5 C;  5HLH A;  1P4X A;  3SZT A;  1JGS A;  4MHG A;  1I27 A;  4BHC A;  1BBY A;  2VE9 A;  2RQP A;  3O3K A;  2OBP A;  2ZFW A;  4IRG A;  2ZME B;  3RKY A;  3T5X A;  5IT9 K;  2X0L A;  2ZNY A;  2D2W A;  2HTS A;  1J5Y A;  4A2U A;  4LGW A;  4ENK A;  4MQ9 F;  1JHF A;  2RN7 A;  4A5N A;  5BQT A;  1KQ8 A;  3EQL F;  1G3S A;  1LVA A;  1XN7 A;  2ZKZ A;  1IRG A;  4BAY A;  3E97 A;  4KUM A;  3ABT A;  1GHC A;  1S29 A;  1XGM A;  2VON A;  4I01 A;  3SZP A;  2MBF A;  1YQA A;  4OOI A;  2CW0 F;  3REO A;  3F72 A;  2NRA C;  3WOD F;  1FSE A;  1U2W A;  4NQW A;  2LF8 A;  2OQR A;  5ILS A;  5JI6 A;  4E70 A;  1TQP A;  5HDG A;  3F3X A;  5L3E A;  4KN4 X;  1WWX A;  1R1T A;  3B73 A;  4I0A A;  1MDM A;  4L18 B;  1T6S A;  5KVR A;  2VBZ A;  4ZZD A;  1HBX G;  3P9K A;  3R4K A;  5DCM B;  1EH8 A;  2UXN A;  2ZJ2 A;  3QU3 A;  4PGH A;  3I53 A;  2XUB A;  2DQR A;  5EEH A;  3T8T A;  2BBY A;  3MZY A;  3ELK A;  3D5L A;  1IN5 A;  2KIF A;  2LDU A;  5H20 A;  4K2E A;  3GUD A;  4PZJ A;  3IRQ A;  5DEQ A;  1BOA A;  5A2Q Z;  3D0S A;  3NRV A;  1ZG1 A;  2YR2 A;  3ZMZ A;  2J5O A;  3K1N A;  4AD9 A;  4A6D A;  2QLZ A;  3R6S A;  5FGM A;  3JAM Z;  1R5H A;  2BE5 F;  2RDP A;  2HYF A;  4LFU A;  2P7V B;  4GGG A;  4PDK A;  3GFL A;  2V1X A;  4EJO A;  5LHI A;  2Q8K A;  2PG4 A;  2F2E A;  3SQN A;  3Q9V A;  5ICC A;  4RB2 C;  3V7R A;  2ELH A;  1D8K A;  2IW5 A;  1REP C;  2OQG A;  4EGZ A;  1IXC A;  2IA1 A;  5K5O A;  2PMU A;  5ED4 A;  2XRO A;  1EV7 A;  1HKQ A;  2WTE A;  2VC1 A;  2XKP A;  3ERE D;  1OYI A;  1XB4 A;  4Q48 A;  2O3F A;  3L09 A;  2NNY A;  4O3M A;  2DK5 A;  1P6R A;  3WE3 A;  3ABU A;  1YG2 A;  3CDH A;  2FA5 A;  3F8N A;  1FLI A;  2LNB A;  3LQQ A;  2CO5 A;  4LK0 F;  1H9G A;  2JPC A;  1T98 A;  1B1B A;  1BI0 A;  1ZH5 A;  1O3Q A;  1YS7 A;  4JBA A;  3TQN A;  2ISY A;  1KYZ A;  2W24 A;  1V4R A;  2KIM A;  4AVP A;  3EUH A;  4EM0 B;  5DUI A;  1ZLK A;  2DPU A;  4A6E A;  2GXB A;  2XAH A;  3FF5 A;  4R8H A;  4PGG A;  1XD7 A;  2Y48 A;  2PMH A;  1FOK A;  4HDV A;  1XMA A;  1RNL A;  3IRR A;  5LEK A;  1YFH A;  5AIP A;  1T2K A;  4NHJ A;  4G94 A;  1JXS A;  1BJA A;  3U2R A;  5BMZ A;  1NHA A;  4HV5 A;  2JSC A;  2K4B A;  4I09 A;  2CGP A;  3RKX A;  3WG9 A;  4U88 A;  1B9M A;  3I59 A;  1SFU A;  4RB0 A;  5CVV A;  1DPR A;  3CUQ B;  2K7L A;  4HZF A;  4L0Y B;  4IRI A;  3RIR A;  4JQF A;  3FZV A;  2YPR A;  4UNO A;  1P92 A;  1E17 A;  1FSH A;  2YSR A;  1SD5 A;  2R3S A;  5LRR A;  2P7C B;  4I2O A;  5D5X B;  5CVJ A;  1UHM A;  4ZYH A;  4HX4 A;  5FFX A;  4MTD A;  5JHU A;  4YFN F;  2XAF A;  1HSJ A;  5FLX K;  1BI2 A;  4DNC A;  2FRH A;  2IA2 A;  2IRF G;  2FF4 A;  4FX0 A;  1XCV A;  5E1Z B;  1BI3 A;  4UVA A;  3BPV A;  1YW9 A;  3K0L A;  4AWX B;  1F9N A;  2XVC A;  1X3U A;  1U5T C;  2LKP A;  2RKH A;  3T0Y A;  1ZAO A;  3J81 K;  2DFI A;  4L5J A;  3MZH A;  2Z33 A;  1RI7 A;  4XLP F;  4LG0 B;  3K1M A;  3N97 A;  1HST A;  4KIF A;  2FML A;  2EA4 A;  2G7U A;  2P5V A;  2L54 A;  2XGX A;  3F23 A;  3DEU A;  5AON A;  2CWE A;  3W6J B;  5LLQ A;  2HKX A;  2IA0 A;  4U0Y A;  3DPT A;  5BOX A;  3KFW X;  3K2Z A;  4Z2Y A;  1I1G A;  1BM9 A;  2O03 A;  1K78 B;  2A68 F;  2UXX A;  1Z6R A;  5KK1 A;  1K79 A;  5HLI A;  2M45 A;  5CVU A;  3O2P E;  1DPU A;  2PFB A;  1USS A;  1TNT A;  5BPD A;  5E17 F;  1ZRF A;  3CO6 C;  1WI9 A;  5E1W A;  2GQQ A;  1G3Y A;  2PN6 A;  2B0L A;  3WGG A;  4CDG A;  2EK5 A;  4WCG A;  3SFZ A;  2JZY A;  3BJ6 A;  3H3U A;  3ECO A;  3MWM A;  3CUQ A;  2HZT A;  5CYV A;  2K86 A;  2OD5 A;  3LFK A;  2MA3 A;  4OIQ F;  1RZ4 A;  3E5X A;  2MLK A;  4S05 A;  4ESB A;  1J59 A;  4CO8 A;  1T38 A;  4HAM A;  1Z05 A;  2RNJ A;  4ON0 A;  3LAJ A;  4M9Z A;  3L00 A;  1MJ9 A;  3RJP A;  5HOO A;  4A0X A;  3WU1 B;  3RYR A;  3TDU C;  2QVO A;  2PJP A;  4P9F A;  2IJL A;  3HRU A;  1R22 A;  1ZYR F;  4RB1 A;  1FZP B;  2Q0O A;  2V6C A;  2VOO A;  3HYI A;  1OMI A;  2YU3 A;  5D6F A;  2VE8 A;  4U7D A;  2FOK A;  3T8R A;  1HKT A;  4HF0 A;  3P9I A;  2CQK A;  4IVN A;  4HW0 A;  5FD6 A;  1O3R A;  2A6H F;  4HLX A;  4I7H A;  4D0P A;  5DD8 A;  1FYL A;  2A3S A;  1YW7 A;  3O6B B;  3HTU A;  1IN7 A;  2W84 A;  1WKM A;  1KU2 A;  2BV6 A;  2QUF A;  4A0Z A;  3E5U A;  2J5P A;  1KA8 A;  3LAP A;  1F5T A;  1BIB A;  2EFO A;  4XSX F;  4M6Y A;  3ZMS A;  1B4A A;  3DXJ F;  3QPT A;  3TOB A;  2H6C A;  4YIF A;  1BC8 C;  4BH9 A;  2A07 F;  1G4D A;  2KKO A;  2R7D A;  2DTR A;  3CJN A;  1XDU A;  5ERI A;  3EYY A;  1FX7 A;  5ICG A;  1XDS A;  3R0J A;  2MD5 A;  4FX4 A;  3BOQ A;  3BJO A;  4Y15 A;  3ZMU A;  1OR7 A;  1TBX A;  3PQJ A;  1J0R A;  1H0M A;  4MTE A;  4ENN A;  2RGV A;  1B59 A;  3G73 A;  3GF2 A;  1OKR A;  4UVB A;  3BDD A;  2DW4 A;  1LQ1 A;  1YS6 A;  2H09 A;  2MH9 A;  2Z99 A;  1ODD A;  3F6V A;  4OIR F;  4KNY A;  2M30 A;  2XAQ A;  3J7A O;  3MCZ A;  5L3D A;  3TO9 A;  2EFQ A;  1W5S A;  3VOD A;  2QQ9 A;  2HGC A;  4LMY A;  1HW2 A;  1G3T A;  4P5O A;  2OAZ A;  2VBY A;  5LGN A;  5DUK A;  3GXO A;  5ILU A;  5D5U B;  3IC7 A;  1ON2 A;  3PQK A;  1FY7 A;  1FBS A;  3FXQ A;  1U5T B;  4U0W A;  3ZP5 A;  2ACJ A;  2KJC A;  2ZBK A;  4AIK A;  1QQI A;  5LGU A;  2GA2 A;  1XSV A;  3IKT A;  2O61 A;  2XIG A;  3R60 A;  1GXP A;  1BN5 A;  5ILV A;  1SMY F;  1SMT A;  4WX9 A;  3KP7 A;  3RPU A;  4HX7 A;  3GVA A;  2QYO A;  2V79 A;  4WK8 F;  4M73 A;  2VBW A;  5BPI A;  1H9T A;  3C3W A;  3FM5 A;  3B02 A;  1R1U A;  5DCF A;  4HYE A;  3F8F A;  3RKW A;  2M87 A;  2V9V A;  5E8I A;  3GX4 X;  3HHH A;  2HTJ A;  2A69 F;  2H6B A;  5CLS A;  4XLN F;  3JTH A;  2L4A A;  3OV8 A;  2TDX A;  3V7C A;  1FT9 A;  3C1D A;  5J6X A;  4L9V A;  2RV8 A;  2FSW A;  2DU9 A;  2K4J A;  5LEJ A;  3WTT C;  4UUV A;  2GZW A;  2GAU A;  2A5Y B;  2ESN A;  1G6N A;  3QOP A;  3R61 A;  4CGZ A;  2AS5 F;  3TGN A;  2W57 A;  1U78 A;  2QBY B;  4KN7 X;  4KIB A;  1FP2 A;  4HBL A;  3JSO A;  3BY6 A;  2FBH A;  4XRF A;  4XSZ F;  3V8K A;  2IPQ X;  1RUN A;  3F21 A;  3LST A;  4IHT A;  4MNU A;  2JRT A;  4ENM A;  4OMY A;  4YII A;  5JFR A;  3H92 A;  3WTS C;  3GWZ A;  3DKW A;  3FXR A;  4EJW A;  1TW2 A;  1OYW A;  3FX3 A;  1OYY A;  2ZME A;  1S6L A;  4OU0 A;  3M8E A;  2PLY A;  4M74 A;  4I0B A;  2QEN A;  4MGR A;  1QNT A;  2M8E A;  4YFX F;  1TTY A;  3BP8 A;  1K7A A;  4ESJ A;  5ICE A;  3F22 A;  4KMU X;  1I6X A;  3VOE A;  4BHP A;  4EGY A;  5HLG A;  1SAX A;  3HIF A;  3KP2 A;  2HQN A;  1HKS A;  2MLG A;  4BNC A;  2O8X A;  4XBF A;  2YX4 A;  1PP7 U;  3F8C A;  5IT9 Z;  2VN2 A;  1ZRD A;  2R7F A;  1CGP A;  3IWF A;  3I54 A;  1ZHF A;  3DP7 A;  1YTY A;  4MQV A;  2HFH A;  2QQB A;  5LGT A;  2D1V A;  2F5C A;  4QWQ A;  2P6S A;  1PDN C;  3DPL C;  1ZRE A;  2Z9O A;  4KFC A;  3GZ6 A;  1FNN A;  5F1R A;  4HQM A;  3COA C;  1EH6 A;  5HDN A;  3PFI A;  4LB6 B;  3I5U A;  4A5M A;  3LWF A;  5DCM A;  1J9I A;  2Z3Y A;  2PEX A;  3K69 A;  2RVC A;  2C6Y A;  3KEQ A;  1W4M A;  3OOP A;  5LRS A;  1R00 A;  1QPM A;  4KIC A;  4WXH A;  2CYY A;  2DLL A;  1TNS A;  4QLC U;  1TQI A;  3G3Z A;  5D8K B;  1HW1 A;  1ZN2 A;  1Z7U A;  4NB5 A;  4FT8 A;  3GFJ A;  2FBK A;  4KMF A;  5HS9 A;  4L9T A;  4LLN A;  3C18 A;  1G3W A;  3E5Q A;  3FMS A;  3SHF A;  2HR3 A;  1R5G A;  3MAJ A;  3NEU A;  5H6R A;  2YX7 A;  4U7B A;  1TQM A;  1F1Z A;  1ZG3 A;  3T1B A;  4BHB A;  4N9H A;  5FD5 A;  1LJ9 A;  2DK8 A;  2FQ3 A;  1J7K A;  2M5W A;  2V1U A;  2PBI A;  4RGU A;  1P2F A;  1L3L A;  3WTU C;  4I02 A;  3TOA A;  3KP6 A;  2XAG A;  1R36 A;  1LEB A;  3KET A;  5D8L B;  1SD6 A;  3ZMD A;  2STT A;  1MGT A;  2XHK A;  1IRF A;  1KU7 A;  3RYP A;  4G7O F;  2PQ8 A;  3E6D A;  5DYM A;  2EB7 A;  1W5T A;  5JVT A;  4ZZL A;  1KGS A;  2WWY A;  2K02 A;  3C7J A;  2X4H A;  3MFK A;  1R58 A;  1SFX A;  2HKO A;  1GXQ A;  3HSF A;  2IVM A;  4ETS A;  3VEP A;  4UXN A;  1WQ2 A;  3RPQ A;  1ZGJ A;  4M72 A;  3F8B A;  3HHG A;  3HSE A;  2DBB A;  4KA4 A;  3V4G A;  2NNN A;  4UV8 A;  2O6G E;  3EYI A;  5HS7 A;  2VOP A;  4F7Z A;  2EJR A;  3FM3 A;  2Z5U A;  5L3B A;  4GYG A;  2ZXJ A;  3GFI A;  2JPB A;  4IRH A;  4G6D A;  5K1Y A;  3MEX A;  4CHU A;  2COM A;  1I1S A;  4RAY A;  2EA2 A;  4FHT A;  2XAS A;  3HTS B;  4A0Y A;  2HYG D;  4O5V A;  5IT3 A;  2HDC A;  5CVI A;  2UZK A;  2M1B A;  2FBI A;  1KU9 A;  4OIN F;  4EQQ A;  2D1H A;  1PP8 F;  4TV7 A;  5L3F A;  1Z9C A;  1EH7 A;  1KU3 A;  2PI0 A;  3I0T A;  1ONV A;  1BC7 C;  3TDZ C;  4DQ2 A;  4N0B A;  1DP7 P;  2DPD A;  2CSO A;  3M7G A;  3MQ0 A;  4CIC A;  1S7A A;  2Y75 A;  2NS0 A;  1FBU A;  2ADU A;  2VOD A;  3HRT A;  4HLY A;  4EMS A;  2FEZ A;  3ROU A;  4KT5 C;  1AWC A;  4Q5S F;  1DDN A;  2E1C A;  1MDM B;  5D4R A;  4G7H F;  3M9A A;  1FP1 D;  2HS5 A;  2DI3 A;  3HRM A;  4IJA A;  1R1V A;  5A2Q K;  3WU0 A;  1J2X A;  5D5W B;  5HDK A;  1YW8 A;  5HVQ C;  1C0W A;  3EDP A;  2STW A;  3JAM K;  2G7H A;  1T0F A;  3WE2 A;  5CVR A;  5FLX Z;  1W7P B;  4RB3 C;  2XKO A;  5FB2 A;  2HOE A;  3ZN0 A;  2OZU A;  2QQA A;  2E1N A;  4LG0 A;  2DQL A;  4EVI A;  5E8G A;  3KZZ A;  2A6E F;  1ZG5 A;  2VC0 A;  3HSR A;  4JK1 X;  4RGR A;  5ICF A;  2HWV A;  2F5D A;  2FMY A;  3BPX A;  1HW5 A;  3KP5 A;  3NQO A;  3J81 Z;  4HV6 A;  4M9X A;  3RTR A;  3M8F A;  1K78 A;  4CYD A;  3EET A;  5DV5 A;  3IL2 A;  2V1D A;  4I98 B;  2L3D A;  1IF1 A;  2OA4 A;  3ZQ7 A;  2A61 A;  2CFX A;  1XCB A;  1SD7 A;  3KLO A;  1B9N A;  1BIA A;  1LDD A;  2ZCW A;  3IHU A;  5L3C A;  1JHH A;  6PAX A;  2L01 A;  4WF2 A;  2EFP A;  3HRS A;  3E6M A;  1U6G A;  3WTW C;  2KJB A;  2NYX A;  1ZRC A;  2XV4 S;  3BJA A;  3RDI A;  3Q9S A;  1I5Z A;  1W7P D;  1IW7 F;  4G9Y A;  3J80 K;  1LDK B;  3ZMV A;  2BGC A;  1Y0U A;  1QZY A;  3DF8 A;  1GVJ A;  1QO0 D;  3FWE A;  3M1E A;  4WXC A;  2GIV A;  3P9C A;  5K5R A;  2JT1 A;  1XGN A;  3K9T A;  1FPQ A;  1S7O A;  3U1D A;  1KYW A;  2FXA A;  2UWM A;  1WRJ A;  4KDP A;  2QM3 A;  2QZ8 A;  2OU2 A;  2BEO A;  3FHZ A;  3KP4 A;  1P4A A;  4RS8 A;  2ESH A;  4IHS A;  1LB2 A;  3VFZ A;  4ZYG A;  3BRO A;  3TO6 A;  2ETH A;  5L3G A;  2HQR A;  3TKY A;  3CLO A;  3KP3 A;  1Z91 A;  5E18 F;  2ISZ A;  1O57 A;  3L7W A;  4HF1 A;  1BI1 A;  2DO7 A;  3WTY C;  3KZY A;  5CJ9 A;  3E6C C;  4M6X A;  1PUE E;  1YYV A;  2W25 A;  3I59 B;  4OIP F;  4EJV A;  1U8R A;  1O3T A;  4HDU A;  4EM1 A;  4ZH4 F;  4BYY A;  3ML6 A;  1FBQ A;  3LQR A;  4ENJ A;  4LD5 A;  1W7P A;  1QZZ A;  1B6A A;  3WGI A;  3I58 A;  2GA1 A;  4Y13 A;  1UHW A;  4AIJ A;  1P4W A;  3E6B A;  1IN4 A;  1Z1D A;  2XAJ A;  3JTG A;  2D45 A;  4HA8 A;  3CUO A;  4KYW A;  3HUG A;  3DFG A;  3GFM A;  2VT2 A;  1IXR C;  4L9J A;  1UB9 A;  3ISP A;  2P5K A;  1D3Y A;  3P7N A;  1IUY A;  3ECH A;  1D5V A;  5DD4 A;  4MEX F;  1O7F A;  2KRF A;  3WTZ A;  5HS8 A;  1QGP A;  5D5V B;  4U0V A;  2P6T A;  1F4K A;  5LHG A;  3V8J A;  4HQE A;  4OMZ A;  2P4W A;  1RIO H;  4IXA A;  2VBX A;  3HOT A;  4LLG F;  3LA2 A;  2E7X A;  3ZPL A;  3KEO A;  2FNA A;  1UFM A;  1U3E M;  1O3S A;  2GWR A;  2F5F A;  4HF2 A;  1CF7 B;  3RI4 A;  1E2X A;  3I64 A;  4ESF A;  1RUO A;  3JSP A;  4LB5 A;  1MD0 A;  3QPH A;  5LBQ A;  2ZO4 A;  1HQC A;  2GXG A;  5EEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...