4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
4TV7A 1EH8A 1HBXG 5C9ZA 3BJ6A 1UB9A 4MGRA 3DMFA 1OYIA 3F3XA 3PLAE 1XJ5A 2KIUA 4DF3A 3LX6A 1K79A 4BAYA 2R3SA 1V3FA 4BH9A 4LG0B 3E23A 1DUSA 5BXYA 2DI3A 2LKPA 2V1DA 1ZGJA 3PQKA 4EQQA 4M9XA 5F2OA 3EVFA 5D5VB 3JTGA 3LQQA 3BJOA 2M1BA 3VFZA 2L4MA 1YZ3A 2ZWAA 3A27A 2PN6A 3SMQA 4BHBA 3VB2A 3GRUA 3DLIA 4IF4A 1R00A 5H6RA 2C7RA 4XLNF 1EG2A 4PYNA 5K0CA 3WTSC 2IW5A 2EK5A 1WKMA 2Y1WA 3M4XA 4CXMA 3FTDA 4XUCA 3B89A 2AN5A 4AD9A 2FF4A 3Q9VA 1E2XA 2P4WA 3ABUA 1LEBA 3D2LA 3I4PA 1HW5A 1J5YA 1R18A 2AOUA 1FY7A 1NV9A 3GIWA 2ESHA 4IV8A 1ORHA 3FPEA 2BM8A 4E30A 4HGZA 4NHJA 3GCZA 1KP9A 5E8RA 1P4AA 3E5QA 4G7HF 2W84A 2OA4A 5ILSA 5D6EA 3WGHA 4O3MA 4ZYHA 5DXAA 2CGPA 4Y13A 2STTA 4ENMA 2ZO4A 1J75A 4KN7X 2H09A 1G3WA 2AS5F 4PYLA 3PTAA 1KPGA 3Q5FA 3WU0A 5HVQC 4ER7A 4YIFA 1V4RA 2NS0A 3MHTA 5EOVA 3ROUA 3LCCA 3ECHA 4LK1F 3GRRA 2AOUB 3R6TA 3MQ2A 5DCMA 4KVZA 5EGSA 5GOZA 2XKOA 1HKQA 1QZZA 2IFTA 4IV0A 3DEUA 3FZGA 1YUBA 2GAFA 4BNCA 1B9NA 1WWXA 3KLNA 5BPDA 2WWYA 4RGRA 1JSXA 2F5DA 1XSDA 3SHFA 5LEKA 2IA1A 2AZTA 2F5CA 1BC8C 3OZSA 2LF7A 1YLFA 4A0ZA 3K1MA 5LHGA 1WRJA 4OIQF 4FX4A 1LDKB 3UJAA 3RPUA 3I5UA 4G7ZF 2NP6A 2PVCA 4HAMA 3RYPA 3ZN1A 2D2WA 3C1DA 4A5MA 4CWAA 2FMLA 2G7UA 3GFIA 4P9FA 2EFJA 4R6WA 2Z9OA 4AX8A 1O9HA 5M5BA 4QQNA 3PS9A 3GU3A 3THRA 1G60A 1S7OA 1DL5A 3F8BA 4V0QA 3EETA 2K02A 1IAWA 3T5XA 3V7CA 3BZ6A 1MHTA 1P1BA 1YB2A 4R8HA 2QQBA 1VLMA 4QVGA 2H6CA 3OCJA 4G94A 4ZH4F 2R6ZA 5LBQA 4PDKA 2QZ8A 2Q0OA 2M30A 4CKCA 2PX4A 3HHHA 5AIPA 4WX9A 1BN5A 1R8YA 3MAGA 3T7TA 1JQ3A 1G55A 1N7JA 2KIMA 2MLKA 2IDJA 3L00A 3JSOA 1BBYA 5LSAA 3JAMK 4DCGA 2HWKA 2MC3A 2OU2A 1RI3A 1UFMA 1ZAOA 2AVDA 1T39A 1L3BA 3J80K 3BPXA 1XCVA 1XMKA 4OMZA 2QENA 2P8TA 3IYLW 5J6XA 1SFEA 4U7PB 3LSTA 2ZKZA 5K0JA 3LGAA 3NJRA 3WGIA 2B25A 3AAFA 2O57A 3NEUA 5EEHA 2XVAA 1SUIA 4P55A 4RTQA 4PYOA 4GQBA 1ULYA 3M6XA 4LB5A 3GRZA 2W24A 2ZSUA 3GJYA 5HFJA 3P9IA 2FK7A 3WTUC 1F9NA 1L3LA 3DF8A 5EEGA 3GYHX 3DKWA 4HH4A 3WSTA 1JE8A 3X0DA 5AONA 3FF5A 3ER8A 1ZRDA 2HTSA 3OE4A 3E6MA 3ECOA 2E7WA 2IIPA 2PBIA 2A69F 2O8XA 5D5UB 2Y1XA 1K78B 2Z6UA 5LQRA 5T64A 5DUKA 3LBFA 4PZJA 2DPMA 3K0LA 4FS8A 1P91A 4BHPA 1TPYA 2E1NA 1FSHA 1IUYA 3LECA 3DH0A 4L0YB 2VN2A 5E8JA 3FHZA 5K0BA 5BS6A 5HZMA 1PP7U 1B59A 2XGXA 4MNUA 3CUQC 1SD5A 2HS5A 4ON0A 2QRVA 3KLOA 3GXOA 3ERED 4RWZA 5H6QA 4Y30A 3DPTA 5HIIA 3H2BA 3SSOA 1U5TB 4ENJA 4IHSA 1O3TA 4OMYA 4KNYA 2D45A 2XAGA 1TW3A 3SXJA 4HOBA 2UXXA 1UFKA 1K78A 3I0TA 3QOPA 3JWIA 3SGLA 4OOIA 1FT9A 4KYWA 2O3FA 5E1BA 5EHGA 2GQQA 6PAXA 3KQSA 1UHWA 3CJNA 3HRSA 5LQUA 1MJ9A 2F5FA 1SKMA 3F23A 5JI6A 3B3GA 4O5VA 5DV5A 4G8XA 1XXLA 3R24A 2JTVA 4RTJA 2D1HA 3A7DA 2MD5A 1EH7A 2AS0A 1EJ6A 2XYVA 3GEZA 2FPOA 2PI0A 4A6EA 1QAQA 3OU7A 2IPQX 4XCXA 4UV9A 1R5GA 4UOEA 1YW8A 5LGUA 4DA4A 1OPCA 1D2GA 1BKYA 5K5QA 3HP7A 4AIJA 3ORHA 3MTEA 1VE3A 1W7PB 1TTYA 4RTSA 2VBZA 5KVAA 4EGYA 2PT9A 2J5OA 4E31A 4I0AA 3V97A 2WC2A 1DPUA 3HCEA 3R0JA 5DDGA 3FRHA 1OR7A 3WTYC 3R6SA 2ZVJA 5KYGA 4QQKA 1HW1A 5CD1A 3KZZA 3V8KA 2ZIFA 2OBFA 4P7KA 3TGNA 2P5KA 4DNCA 1XB4A 3PVCA 3ELDA 3OFJA 4IWNA 3PFHA 3ABTA 1HW2A 3G89A 4E2YA 3HIFA 5EZSA 3SXYA 1NW3A 3BWMA 3KU1A 2L3DA 2VDWA 1FP1D 2BZGA 3HYIA 1VPTA 3L2CA 3LHDA 4AUKA 3KCCA 4RAYA 4WVLA 1OYWA 2XIGA 3GW2A 4QLCU 4QDJA 2ONYA 4WWCA 5EPEA 3ML6A 2EV6A 4G6QA 1QQIA 4L9VA 4Z2YA 4P7JA 5CVRA 3DTNA 3J80Z 4C07A 5BMZA 3LA3A 2M87A 3BY6A 5G02A 1ZG3A 3K9TA 3K2ZA 3KP6A 5LRRA 3ZMUA 3HRMA 1ON2A 3DQVC 5FTWA 2CWEA 4RB1A 1FBUA 5LHIA 2FXAA 2QQ9A 1XGNA 4FSXA 5MHTA 3ZP5A 4HTFB 3EVGA 5L3GA 1Q1HA 4PGHA 4XUEA 2ZJ2A 3NDIA 2C7QA 1G3SA 2GB4A 1IF1A 4RB0A 3RPQA 2Z99A 2LD4A 5ERIA 1INLA 4FZVA 3HUGA 3C7JA 1Y8CA 5A2QZ 1UIRA 1RI5A 2FU4A 5L3EA 5CVEA 2ZFWA 3MB5A 2QBYA 4OQDA 3C6KA 2YX7A 5EZQA 3FX3A 3IC7A 1W7PD 3JTHA 3EMDA 5LQCA 3DR5A 5DXJA 5LRSA 2NRAC 2YQZA 2H6BA 2GAUA 2XVMA 1FOKA 2CSOA 1AF7A 2P5VA 5DCFA 4CZZA 3G7UA 1YYVA 5D8KB 1SFUA 3G2QA 3GWZA 4N9HA 3P97A 5JVTA 1OYYA 4HYEA 2CWWA 4MTDA 2OB2A 5GP1A 1M0EA 4EQZA 4L9JA 3U1DA 4Y2HA 3REOA 3A4TA 5T67A 2UWMA 3CUQA 1T38A 1NV8A 3OPNA 4LWOA 4H0NA 2K7LA 2PJDA 4EM0B 3P9KA 5IT3A 4MHTA 1R74A 2KIFA 3C0KA 3FUTA 3EPPA 4M73A 3ELUA 4FX0A 1X1CA 3T7SA 2VC0A 1FYKA 3A7EA 3SR4A 3BGVA 4UNOA 4E2WA 2GPYA 2A5YB 5E1XA 4R1HA 3KR0A 1TBXA 1RI4A 3UFBA 4KDPA 1DCTA 5LEJA 1PRYA 3COAC 3KPVA 4LWPA 4LD5A 4UXNA 2OB1A 3HOSA 4KMFA 2HTEA 1OKRA 4X1OA 2ZMEB 1LDDA 5TJJA 1SMYF 3HSEA 3F6OA 4ESFA 5HOQA 5K01A 2QRVB 2OBPA 1YZHA 3FXUA 4P7FA 4IXAA 4S05A 2VT3A 4ZYDA 5JUWA 3UBTA 1YG2A 1J59A 1I5ZA 3CC8A 1KQ8A 1KQ0A 5ICCA 1XDUA 1JHFA 5CCBA 3FUWA 4QWQA 4YFNF 1FX7A 4M74A 1BC7C 2UXNA 3J7AO 3GDHA 5FFZA 2DULA 1D2CA 1U78A 4HX8A 4BLWA 3BZBA 3UA4A 5GWXA 1C0WA 2JPBA 5FQNA 5DPMA 4ENNA 3RW9A 2XAJA 2V7EA 1BI3A 4IHTA 2ZWVA 4KICA 2CO5A 3KP5A 1QBJA 2FSWA 2AVNA 4U7TB 3AY0A 2OQGA 3GF2A 4YMGA 3HOTA 3GO5A 1WSUA 3BWCA 4G9YA 5D1NA 2P7VB 3M6WA 4LG0A 1WXXA 3FRIA 1K6OA 4GOMD 2ZIEA 3B73A 4CYDA 2EJUA 2H11A 3NDJA 2GXGA 4B17A 3FPHA 1XDZA 3R0QA 3I54A 3MFKA 2P35A 4HF1A 3WODF 3WG9A 3HCAA 3K0BA 4RSRA 5FA5A 2Q2EA 3KP2A 2KKOA 3JWHA 2Z3YA 3GRVA 5DYMA 2OQRA 1XCJA 1N2XA 3IWZA 1KYWA 1ZRFA 3BT7A 4IRGA 4BQAA 2AOXA 2C7OA 1HKTA 3RKXA 4A12A 5HIMA 4Q5SF 4DCMA 2PG4A 3U9GA 3SFZA 4FT2A 4HV5A 1WY7A 3KPWA 2NYXA 2CG4A 1LB2A 1AOYA 3RODA 2ACJA 1U5TA 4E70A 4ZZLA 3E3VA 3KETA 2O6GE 3DFGA 3M33A 5BPIA 4ER6A 3ISPA 3EVZA 3HSFA 1QYRA 3DLCA 3KR9A 1XD7A 5AIQA 1P1CA 2GA1A 5F6FA 2PY6A 1SD6A 1O3QA 2ZZKA 5L3CA 5H20A 3J81Z 5BW4A 2PMUA 3BWYA 2XAFA 2Y75A 3PQJA 2O0LA 2O0YA 5EVJA 3L9FA 3EEYA 2FRXA 1U6GA 3FMQA 5DUIA 4CGZA 1ON1A 2FRHA 2PLYA 3U2RA 4ER0A 1PP8F 3KPJA 2ZZMA 4LK0F 3F22A 2VXZA 4I7HA 2DQRA 1EIZA 4PWYA 3L09A 2P8JA 5DTQA 2HDCA 3B7PA 4DKJA 3E97A 1Z6TA 4PYQA 4PIMA 5E2BA 5KQSA 4PINA 4HLYA 2PX2A 4O29A 3H3UA 3MAJA 1QGPA 5A2QK 1RNLA 3JW4A 5JFRA 2FK8A 2JJQA 2P5LC 3P2EA 1YFJA 3P2KA 3G3ZA 4AWXB 3BKWA 3TMAA 2BR3A 2YXEA 2GLUA 2PLWA 4CDGA 3QP6A 4RTLA 5T6BA 2VOOA 3HCCA 4M36A 4HTFA 3OE5A 3P9CA 2GH1A 2ZBPA 2HYFA 4HZFA 4HLXA 2P40A 2CW0F 5F2NA 4RTKA 3BWGA 4CTJA 2LNBA 2IT0A 1Z91A 4C03A 2LF8A 4BY9E 1OMIA 1TQMA 2VBWA 3WTWC 5HEKA 3HCBA 4L7VA 2HKOA 1SVUA 4PGGA 1M6YA 1YS6A 5GINE 5FLXK 2CFXA 4B09A 3HRTA 3EQLF 3O2PE 5D8LB 4RAZA 3KQWA 2STWA 2EX4A 1IXKA 1KU2A 2R7FA 4LFUA 3EDPA 4M6YA 1KU9A 3KP4A 1TQPA 1PDNC 2QWWA 3BGDA 3I59B 2BH2A 1VP3A 2OZUA 1QANA 3GUDA 1XTPA 1D5VA 3I9FA 3EYYA 3TDUC 5TRDA 4LG1A 2K4JA 3EVCA 2P41A 4PYIA 3GZ5A 2XUBA 3G8BA 3M1EA 1R23A 3DP7A 2QBYB 2ELHA 3I71A 1REPC 3WU1B 2O61A 4R05A 4YUVA 3AXTA 1NT2A 3FPGA 2D1VA 1G4DA 2ADMA 1EJ0A 5E1MA 4E2XA 5BW5A 1RJDA 3JSPA 2MBFA 1WI9A 2H00A 4RTPA 3RJPA 3F8CA 3HEMA 2GA9A 2V9VA 3KQVA 3NWEA 1G6NA 3SVZA 2NAZA 4GO1A 2V6CA 3V4GA 5ILUA 2Z6AA 5CVUA 1TQIA 4P9UA 1O3SA 1TNSA 3CCFA 1Z6RA 2QM3A 2TDXA 4AIHA 2P6SA 1Z1DA 2BR4A 2ZXJA 4HF0A 2X4HA 4RVHA 2OO3A 4D0PA 5DEQA 5HOOA 4XSXF 4HRAA 5E8GA 3OFKA 3LDUA 1W5SA 3P2IA 5LLQA 4ISCA 3EGIA 2IA0A 1W5TA 1BIAA 3B3JA 1P6RA 4OBWA 3TM5A 2UYCA 2FBHA 2K27A 2YPRA 5E17F 3LAPA 3IL2A 1O7LA 3V8VA 1FZPB 2DK8A 3O6BB 2PWPA 3TO7A 4OBXA 1SAXA 3PFIA 3CVOA 3FZVA 2EV0A 2JPCA 1U5TC 5K03A 1DDNA 5EMJA 1T43A 1IW7F 1O3RA 5E8IA 4CKBA 3EYIA 4FP9A 4BP1A 3FUUA 4R8RA 1SUSA 1R1TA 3WE3A 1KXZA 5BQTA 4R79A 1IN8A 2XV4S 5HLIA 3JWJA 1MGTA 1AWCA 5D6FA 3P9NA 3GRYA 1X3UA 1VQ1A 2K86A 4BHCA 3MZYA 2I9KA 2W85A 3JWGA 4I01A 5DM4A 3CKKA 3IWFA 1XCBA 3LPMA 1ODDA 1ZARA 4S04A 2OPBA 4RB3C 5FGMA 1I1NA 5EKUA 1DPRA 3HA7A 2N47A 3LKZA 3M7GA 3F21A 2XYRA 2BGCA 2KJCA 2KJBA 1FSEA 1ZG5A 3E5UA 4MQ9F 3F4KA 1D8JA 2HOEA 1JR4A 2HEOA 1AV6A 2COMA 4EJOA 2PSSA 2OD5A 3WTZA 1BJAA 4KIFA 1U8RA 3LDGA 5DRTA 2EV5A 3BROA 2PFBA 4C08A 5J8CA 2F2EA 3R60A 1B9MA 5IT9Z 1RI7A 2EJRA 2VP3A 5DX1A 4CXFA 3SZPA 1NW5A 1IXRC 2IBTA 3HM2A 2G70A 2VDVE 4XBFA 4FGZA 1VTNC 1USSA 4RB2C 2P3QA 4MTEA 4GF5A 5DX0A 3KFWX 4HC4A 3TM4A 3FTEA 5B1SA 1MD0A 4GYGA 4WK8F 1WQ2A 3UJ9A 5DX8A 2BYVE 4KIBA 4PCQA 4EJUA 4LGWA 1O7FA 3UWPA 3U81A 2FA5A 5E18F 3W6JB 2YXDA 5K09A 1OR8A 3BUSA 3F8FA 3V8LA 3UJ6A 2DAOA 2PGXA 1U2ZA 1R7JA 4EKIA 2O03A 4KDCA 3QU3A 4IRHA 2C6YA 2BM9A 3HCDA 4ATNA 1KPIA 3N4MA 3AXSA 5FHQA 1S7AA 1VBFA 2E7XA 4POOA 1I1GA 3H92A 4LJZF 5FCDA 3RDIA 2L4AA 3ZMDA 3G73A 3DV8A 2UYQA 3EVDA 3RIEA 3M70A 3O31A 4MQVA 2G8NA 3TOAA 1JG1A 2V1XA 1XGMA 2M45A 4RTMA 3PFGA 1RJGA 5E1DA 2HNKA 4CHUA 2F8LA 2NXCA 1I9GA 1JG4A 3SQNA 2ZNZA 3K1PA 5C0OE 3VC1A 3D0SA 2HYGD 4Q4ZF 5U4XA 1RZ4A 1SD4A 3RYRA 3KR2A 3UJBA 2IGTA 2XAQA 2PV0A 4RGSA 2XYQA 1YW9A 3E6BA 2ZULA 5E9JA 1XMAA 4MHGA 2CL5A 4XSZF 10MHA 3RTRA 4YV2A 4EM2A 1RJFA 2PBFA 3VYWA 2PXXA 2GA2A 2H27A 5DRYA 4HQMA 1I6XA 2YSRA 3S2WA 3FMRA 5BP7A 2ETHA 4ER3A 2ISZA 4M38A 3OU6A 4EM1A 1D2HA 4ASNA 3TRKA 4RVFA 5F1RA 4P96A 4M6XA 4GOOD 2HMYB 4PYKA 1Z05A 4OIPF 1FBSA 3HVIA 2HFHA 2UZKA 1H9GA 3TKYA 2G1PA 2A6HF 3ELWA 2QLZA 2VC1A 2Y48A 2HR3A 5L3FA 3MGGA 4YUWA 3W6KB 1NBIA 1FNNA 2PT6A 2BV6A 3UJ8A 5FLXZ 3DXJF 1L0OC 1J9IA 3KQQA 2FCAA 3BKXA 2IDKA 4XUDA 1J7KA 1O57A 2FNAA 3ZMTA 1WZNA 2EA2A 5K8VA 3MEXA 2E1CA 3G2OA 4U7BA 1ZGAA 1DP7P 4PNEA 4Q47A 1IXCA 2M5WA 2Z5UA 3ELYA 3KQTA 2QE6A 3SSMA 4GCVA 3ME5A 1T6SA 4HDVA 4RVGA 3CUQB 1HXDA 4M7RA 3G5TA 1UWVA 1MDMA 4C4AA 3QOWA 2MH9A 4KRGA 4L5JA 2A6EF 1JHHA 5J8FA 4KUMA 1FC3A 5E1WA 2B9EA 4KIGA 2DTRA 2WTEA 3GFMA 1K7AA 3E6CC 5DSXA 1HMYA 1ORIA 5L3BA 2L01A 2PXAA 1VP9A 3RKYA 2OZVA 4Q48A 1EH6A 3EVBA 3CJRA 1UCRA 4PIPA 2EFPA 2G9WA 1H9TA 1ZRCA 3GZ6A 3LL7A 4O6JA 3I64A 5CYVA 4I98B 1ZN2A 3P71T 4A6DA 4IRIA 4HG2A 2JRTA 1J0RA 4JQFA 2O05A 1RJEA 2EFWA 2OAZA 3TQNA 4RTRA 2RNJA 3C18A 3PX3A 2ESRA 3T1BA 4WCGA 3CDHA 2VBYA 4XRFA 4I0BA 1NW6A 2AR0A 3KPYA 1S3JA 1QO0D 1BI2A 3UJCA 3ERCA 1JQEA 1TLHB 3F72A 3T7RA 2JHPA 3TOBA 2UYHA 1MJFA 1D8KA 5DWQA 3TO6A 3EGVA 5HDKA 5LQJA 3FPJA 2AOTA 3HA3A 3V7SA 3CJQA 4YG2F 1GVJA 4UUVA 2WA2A 1FLIA 4F7ZA 3O3KA 2XKPA 1P39A 5EMLA 2WV0A 5FHRA 2NXJA 5F2KA 3L7WA 4HV6A 3QP5A 1YFHA 2ZBRA 4PYJA 1LEAA 4JBAA 4QTTB 1F5TA 2DBBA 3G8AA 3I58A 1FP2A 3OU2A 4GC5A 5K0LA 1F4KA 3ZMSA 1T2KA 5K0FA 4FHTA 2YR0A 5HDNA 3T0YA 3QPHA 2RDPA 2AN3A 4ZYEA 5CM2Z 2OYRA 4M71A 2RQPA 3LFKA 2ZCJA 4QVKA 3B3FA 4AVPA 2I6GA 3JAMZ 2B78A 4H0EA 5HS7A 3FUVA 3LKDA 1KA8A 3C3PA 1B42A 4KN4X 3VODA 3TDZC 3IHUA 2P7HA 5FWAA 4F86A 4HDUA 1XGSA 1GXPA 1JTEA 4ZZDA 2P7CB 3PX2A 3EMBA 3E05A 3CO6C 4LLNA 5EMMA 3WTTC 5EIWA 3FM3A 2JHAA 4NB5A 3LWFA 1JG2A 4OINF 4BP3A 1ZHFA 3KKZA 3UJDA 2M8EA 3LCVB 4RTNA 5D5WB 1Q0SA 3GNLA 5CUQA 1PJZA 2IBSA 2ERCA 1FYLA 1R22A 3G5LA 5E20A 2LSOA 1IZ1A 2MA3A 3QPTA 1WXWA 3SM3A 1NHAA 2B3TA 2IH5A 2L02A 2GZWA 1UHMA 1SG9A 2VODA 3K1NA 1X19A 1Z7UA 4I09A 4I02A 2EA4A 4I2OA 1XVAA 1HSTA 3VEPA 4L0ZB 4L9NA 5FUBA 1G8AA 3P7NA 3IRRA 4IVNA 1MKMA 4GGGA 3S68A 1MZBA 3PT9A 3QU6A 4U0WA 2ZTHA 1USTA 3ANXA 2ZFUA 2PXCA 3DOUA 2AOWA 1QPMA 4M9SA 2O07A 2RN7A 2ZW9A 4AZVA 1TNTA 1CF7A 3RI4A 2OZ6A 2JH8A 3WTXC 4BYYA 2YX4A 3SZTA 2XBMA 2NNWB 4ENKA 2QUFA 1HQCA 5DD4A 1L1EA 3ZN0A 3NTVA 1G3YA 2NXNA 1IRFA 4Y15A 2ZMEA 2HR1A 5EQJB 3NW9A 3F6VA 5D1HA 4ER5A 3BXOA 1XSXA 5FB2A 5JHUA 2WA1A 4G56A 3QAHA 5CVIA 2IVMA 2DLLA 2KRFA 5EMKA 2HZTA 3QRFF 1JSZA 3HTSB 3MERA 4KWCA 4X41A 4MWZA 1O9GA 4GYIA 2AXLA 4U0YA 1Q0TA 5GM1A 2GXBA 4RX1A 4AIKA 1VL5A 1FPQA 2ZZNA 2EWNA 2E5WA 1BIBA 1KU3A 3R4KA 3KP3A 4L18B 2L54A 5BOXA 2Z6QA 2DW4A 3ULQB 4EJWA 4PCLA 4RS8A 2B0LA 3TO9A 4WXHA 1NBHA 3DPLC 3KE2A 3N97A 1L3IA 1YTYA 3FTFA 1L9KA 3WTVC 3H3ZA 4CICA 2VE9A 3LA2A 2FNPA 1BOOA 3TOSA 4HF2A 4DZRA 4AZWA 4X63A 4EKGA 5LGNA 5HLGA 3E6DA 2FOKA 1I4WA 2A3SA 5CJ9A 2G71A 2Q41A 2PWYA 2P7IA 3OZRA 2VZ9A 1D3YA 2EG5A 2YTZA 5KVRA 3CO7C 4EJTA 2W57A 5CVDA 3IHTA 1P4XA 3BDDA 1I27A 2VE8A 2ADUA 2Q8KA 1ZREA 1R8XA 3AWIA 3GO4A 1T98A 4NQWA 2MLGA 2BR5A 3HVHA 3TLJA 4P58A 2VS1A 2Z33A 2HWVA 3MCZA 3BGIA 1WS6A 3V7RA 1FWZA 4RV9A 2PX5A 4PONA 3KPUA 3M8FA 5FO5A 4A5NA 3DXXA 3IV6A 1YS7A 3FYCA 4GEKA 1F1ZA 5ERGB 2BE5F 1RI2A 3B5IA 3SX0A 1JG3A 2Y0MA 2YR2A 3TPZA 3DXYA 5CLSA 1MDMB 3ELKA 3TR6A 1X1BA 1H0MA 2K4MA 4RYLA 2ZBKA 1XDSA 5GM2A 3MCTA 1ZLKA 2IP2A 5DTRA 5K5OA 1YIOA 4FR0A 2CKDA 1EAMA 5K0NA 3TFWA 2YVLA 3EVAA 1H1DA 2V1UA 2HGCA 2P1DA 4R8SA 3E7PA 4C04A 2IPXA 2RGVA 3BPVA 2H1RA 5CCXA 1FYMA 4OIOF 8MHTA 3CGGA 2VT2A 1RUNA 1FBQA 2IA2A 3WE2A 2O06A 3SSNA 1ZKDA 3KQYA 5DT2A 3C6MA 1IN7A 3ZMVA 3MWMA 1DUXC 2FMYA 4HSGA 5DD8A 3GLXA 4A0XA 2H94A 3M6VA 5HIJA 4OA8A 1LQ1A 5HIKA 5GIOE 4KFCA 3IKVA 1SFXA 1F3LA 1NW8A 3CTAA 1P2FA 3ZPLA 2QYOA 4HX4A 2DU9A 5L3DA 4GC9A 2GIVA 4M72A 2P3LA 1XGOA 1W7PA 3CLOA 2AOTB 2HKXA 3FUXA 3NRVA 2VONA 4LECA 4JK1X 3DULA 5IKMA 2IH4A 3CJTA 1GXQA 1AQIA 2VBXA 2QVOA 1NKVA 5DLYA 3UJ7A 4K2EA 3EVEA 3K6RA 2UYOA 5H02A 3Q9SA 3B02A 3KEOA 3NVMB 4GOND 2P3OA 1RI1A 1IM8A 3DUWA 4YV1A 4IJAA 2VOPA 2NXEA 2JG3A 5E1OA 1RIOH 3G2MA 4X61A 2YU3A 5LQKA 1XSVA 1IN6A 2FBKA 1B1BA 2UZ4A 3QOXA 2PEXA 1CGPA 2EFNA 3CUOA 4OQEA 3OV8A 4IKPA 1EV7A 1G6Q1 4CKEA 3NQOA 4U0VA 5D4SA 4EVIA 4GOLD 2ZLBA 5HILA 5HS9A 4G7OF 2G72A 3LBYA 2GWRA 1PUEE 1NW7A 1QZYA 2CMHA 4QPPA 1STZA 1CF7B 1HNNA 2CMGA 1LVAA 4PYMA 3T0IA 1FJXA 3R3HA 5ICGA 1IN5A 2BBYA 2DO7A 4C06A 3HNRA 4ESJA 4U88A 5CVJA 4RGUA 1YQAA 1IXSB 1LJ9A 4YFKF 1S29A 4U7DA 2VDUE 2JZYA 1ZYRF 3M6UA 2EJTA 1YO5C 1R36A 5FA8A 3GFLA 1S8NA 2AN4A 3LQRA 2A61A 5D4RA 1MJBA 3G88A 3PB3A 5KS2A 1F38A 1JQDA 5K05A 4EV0A 2I62A 3VOEA 4MQ4A 5CIYA 4ESBA 1KHHA 1HKSA 4WXCA 3D5LA 2FYTA 1N7IA 4KDRA 4KMUX 3DMGA 2HQRA 3HVKA 1X1AA 4BLUA 3HA5A 4DMGA 1MJAA 2ORED 4FT8A 4Y17A 1S6LA 4DQ2A 2DPUA 3QV2A 1R1VA 2ISYA 2MH2A 3MZHA 4CO8A 4ZTBA 4MEXF 3OZTA 4GUAA 2HTJA 4N9IA 4UVCA 1XCLA 4HQEA 5LR6A 1ZH5A 2FE3A 1ZG1A 4YV0A 2QQAA 2CQKA 1R6AA 5EG5A 1ONVA 5IT9K 1A04A 2PJPA 1G8SA 3Q87B 3O7WA 4DQ0A 4HA8A 4LLLA 2ZNYA 2XHKA 5CVVA 3TQSA 4C05A 5DM1A 1KR5A 1BOAA 3KZYA 4OX9Y 2NNNA 2IH2A 3BOQA 4YUYA 3RKWA 2DFIA 3A25A 4OA5A 1KQ9A 2J5PA 3FTCA 2I7CA 2XRNA 3FXRA 2PKWA 2RV8A 2V79A 5DTMA 4WF2A 1RUOA 2ZIGA 2DQLA 4L5IA 4UVAA 3UZUA 3GGDA 4A0YA 2ZBQA 4LLGF 5JR3A 1FBNA 5HLHA 2EFOA 2OKCA 5EIFA 1R1UA 4E32A 1VIDA 2A14A 1G38A 1SQFA 4HW0A 3P8ZA 1KYZA 3FPFA 3V8JA 4QPNA 3THSA 2RVCA 5LQAA 1BM9A 1SQGA 1KGSA 5HS8A 2NNYA 4GXOA 5E9WA 1Y0UA 3KR1A 5E2AA 5DM0A 1BHJA 1U3EM 4YFXF 3ZMZA 1Z3CA 5LGTA 1JXSA 3EGEA 2V74B 2XAHA 9MHTA 3O4FA 1AQJA 1R5HA 4QDKA 4YUZA 1TW2A 4RTOA 3KP7A 3C3WA 3ER9A 5FD6A 2P6TA 5DSTA 3KHKA 4F85A 4YUXA 4YMHA 2XROA 4A2UA 2X0LA 2RKHA 4M9ZA 3T8RA 3MQ0A 5EKXA 3ID6C 4MTLA 2R7DA 3I59A 4NECA 1QAOA 1BC5A 3LA7A 3L8DA 1P4WA 5DM2A 1WG8A 1IN4A 1BI0A 2DK5A 2F5EA 1P92A 2JT1A 1R58A 4P7GA 4HX7A 3EUHA 2FBIA 1BI1A 1IY9A 1SMTA 4K6MA 4BLVA 3HVJA 3LDFA 4YIIA 5K0GA 4ETSA 2A68F 3DXZA 3HHGA 3WGGA 1X1DA 2PX8A 3FMSA 2EB7A 2FEZA 3CBGA 2CYYA 3R61A 4IPAA 1V39A 3EEOA 4AZSA 5IH3A 4MEYF 5DCMB 1LNWA 2K4BA 1G3TA 4JXJA 4B8XA 3KQMA 4DM3A 2NYUA 5C1IA 5ICEA 2YX1A 1I1SA 2B2CA 3UA3A 2PMHA 1KU7A 2IRFG 4RGXA 4KT5C 4UV8A 3GFJA 5F64A 5K0EA 1KIAA 3DMHA 1J2XA 3G2PA 4X60A 2JSCA 1GHCA 5D5XB 4FT4A 3RIRA 2YUIA 4LB6B 4MIKA 2ZCWA 5E1ZB 1ZLJA 4EK9A 2ESNA 3A26A 4HBLA 3F8MA 3KEQA 4EMSA 4UVBA 4L9TA 1Z9CA 1XN7A 3FYDA 5ILVA 5ED4A 5FULA 1B6AA 3FM5A 4WXDA 2NP7A 3VSEA 2QY6A 3E5XA 2A07F 3GVAA 3BWBA 4RVDA 5EHIA 5FFXA 5GIPE 3IKTA 3GX4X 4G6DA 1YF3A 2ONZA 3R0AA 2HQNA 1U2WA 2KW5A 2AOVA 1B4AA 2G7HA 3BP8A 1JTFA 4OU0A 4FSDA 1YW7A 3HSRA 4LMYA 3K69A 4BXUA 1O54A 3HRUA 3FXQA 3F8NA 1NE2A 4R6XA 2LDUA 3FWEA 4KW7A 3R9XB 2XVCA 3M9AA 4XLPF 5FADA 4EJVA 3C3YA 5LQNA 3NMUF 4GBED 5P8WA 3IEIA 5FWDA 3MTIA 3TKAA 5HDGA 3E8SA 1JGSA 1KPHA 3HTXA 3BJAA 2HV9A 4P5OA 4EGZA 3NWBA 5FQOA 4ZYGA 2BEOA 2W25A 4M37A 2PQ8A 2OY0A 3T8TA 4UHTA 3KQPA 3KQOA 1LDJA 4KA4A 5E9QA 1EQAA 3NVKI 5KK1A 4E33A 1IRGA 3IRQA 5ICFA 3HTUA 2WK1A 2DPDA 3OOPA 4N0BA 3I53A 1SD7A 5K1YA 4E2ZA 1T0FA 4HGYA 2GS9A 5EC8A 2C7PA 2EFQA 3J81K 1ZQ9A 3HCFA 5KQRA 1M6EX 2DT5A 2XASA 3LAJA 3AJDA 1L3CA 4F84A 1W4MA 3Q7EA 2RC4A 5LHHA 1E17A 4QTUB 2JH9A 1QAMA 3LCUA 4AZTA 3ZQ7A 4V0RA 2JHCA 2YXLA 1HSJA 5K5RA 7MHTA 4OIRF 1QNTA 2FQ3A 5FD5A 2IJLA 3M8EA 2OXTA 3VC2A 2FHPA 4CTKA 1YFLA 4PCAA
chains in the Genus database with same CATH superfamily
4I9UA 1TA4A 3EHDA 2HK7A 5CB4F 2XNHA 3GFGA 3NHWA 4O5AA 1LPAB 2QJTA 3IIKA 2F43A 2A78A 3IR5A 5KYYA 3NHKA 2WIBA 3BJ6A 3D2BA 4JLNA 2H4XA 4YJFB 3W5UA 2QTFA 4I46A 1D8AA 3T5TA 4I50F 1R0CA 3F3XA 1T5TA 2WZDA 3ESAA 5DLPA 3KZVA 3I01A 1MR3F 3N9IA 5EJ8A 3OP4A 4QDOA 3AUSA 4DF3A 1SA0B 4KC0A 3UQYS 1JP7A 3IO3A 3EK2A 2XC7A 3OSUA 4MP8A 1BHO1 1THGA 1TK9A 1YJNI 1E4VA 2R3SA 4BH9A 5BR4A 3IBFA 4BX8A 3T1TA 3PC7A 3NWTA 3E23A 5AJZA 2OM2A 4EMBA 1MJGA 1O6FA 5GJBA 2J3DA 1W36B 3ZGZA 3CE9A 2UVDA 4MW2A 5C1PA 3RC7A 5MF6A 4Y2TA 1XTTA 1OI3A 3BM5A 5D5VB 3EVFA 1HDIA 5I7WA 3BJOA 3LBNA 3LHFA 4HAZA 3IO5A 1PR9A 4GWKA 3AB8A 4O29A 4Y0AA 4BO8A 4FM9A 1LK7A 2J9FB 2ZWAA 4M87A 4PLGA 3RHZA 1Z21A 5HF6A 2PN6A 2QVBA 4LYJA 4NQZA 4CUGA 1DGWY 3WBFA 4CLHA 5FBVB 3E7FA 1OX5A 1A82A 2VATA 3H13A 4RIEA 2Q1XA 4BL5A 5KYTA 1U2DA 3GDFA 5ABPA 4Y7NJ 1OIVA 4ZVOA 4Y18A 4MJ3A 3FHTA 3QELA 3L05A 1JLLA 1EG2A 9GPBA 1BCRA 1QHEA 3IERA 2NTEA 1G6KA 4FKMA 5K0CA 2FAXA 1NQAO 3JU3A 1WNTA 2XWSA 2IW5A 2Y1WA 3M4XA 2NV2B 4MVJE 1M8JA 3NHJA 4I5FA 1OHHD 2QLMA 3L7AA 4PX9A 5CA1A 1FQJA 4WK6A 1TWAJ 1CJBA 1G59A 1TGYA 2AN5A 3MJDA 2FF4A 2C4MA 4HEA6 2OE2A 3MUOA 1TQ6A 1WQ4A 2JD0A 1CUZA 4HX5A 4JT9A 1E2XA 4MI3A 4DANA 4DLAA 2P4WA 1LEBA 1GM5A 3HJFA 3D2LA 3DG9A 3IS3A 1Q1GA 1U8CB 2B8EA 4WRRA 4YAIA 2ZE7A 1PP4A 3NHZA 4AG5A 4BL0B 3NATA 5BWNA 4JCCA 3EZFA 3OYEA 3PKIA 3I2HA 4ZAGA 4CH7A 1R4MB 2WHPB 1LRJA 2FGKA 3K4PA 2R87A 4C2MJ 1P7YA 4OJMX 1YA6A 1NV9A 1Q0QA 1B3RA 2ESHA 3QA9A 4JOSA 1USGA 2IYTA 3QMMA 4B7CA 2RGGA 4ECAA 1ADJA 1JZSA 3NBQA 4DLPA 1BYUA 1NOJA 4NZNA 2IHVA 3ED1A 3VHQA 3VO9A 5M29A 3HB9A 3B36A 3FSGD 3QPBA 1HQDA 3NHUA 2GTHA 3KYJB 4HGZA 2XZDA 2WBMA 4XR4A 1XZLA 4MH0R 3RG8A 3K9NA 1XGKA 2FZVA 3E5QA 1B6SA 3H3XA 5KTYA 4G7HF 3D4BA 4TWAA 3CY6A 5CA1F 1A6IA 5D6EA 3WGHA 4E7SA 3CLUD 4BX9A 4D82A 1R27A 4RDHA 3WX0A 3WGMA 5KYWB 3SJBA 2RKOA 2RK6A 3VR5A 2JVGA 2R85A 3TMYA 2Z5GA 4ENMA 4IHJF 2UXDB 1P6UA 1NA5A 5F1YA 4KBGA 5JS2A 4ASUA 4JYPA 4KMRA 1FRVA 3H2HA 1ODLA 2H09A 2E4YA 4PYLA 4C7BA 2GOXB 5TISC 1KPGA 3BGSA 2IGMA 5HVQC 3CF6R 1GDHA 2AN1A 3R9KA 1X39A 4DCNA 2GM9A 3C5EA 4YR7A 4YIFA 4RD3A 4FE3A 1VL6A 5B6PA 2NS0A 5GONF 4CI9A 2C97A 2CBZA 3OJOA 1Q0LA 4V03A 3ERMA 5EOVA 3EH1A 2XPUA 1IDYA 1U7DA 3PR2B 2AOUB 2BOLA 3MQ2A 5DCMA 1SKUA 3LC0A 5EGSA 2XKOA 4M3BA 4Q1DA 1HKQA 1C9YA 1JXQA 4JX4A 2M32A 3EFOA 4MA5A 1MOQA 1ORRA 3GJZA 3LHKA 3GLFB 5CBPA 4BNCA 4NBRA 3IP1A 1JA1A 2QZZA 3EOZA 1B9NA 4TTVA 1R3DA 2RHTA 4EFMA 2CDCA 1V7PC 1CUUA 1CHNA 2XNKA 3FIUA 4RGRA 4TYMA 2F5DA 3W9SA 4EECA 1L4EA 1XSDA 3WBBA 1OASA 4JELA 1EUYA 3RYIB 3H1EA 4ZYTA 2IEIA 4NH4A 1IOLA 5K7HA 3PL5A 4LF6B 4F3TA 1CIPA 1QHHB 1DKPA 1WJGA 2HQ1A 1ZK8A 4ZALA 3CHYA 2DM6A 4ZQGA 2ZT8A 2FR0A 1BJTA 2EV9A 2QRNA 1BC8C 2AWNA 3OZSA 1FMFA 3OYHA 3SDBA 3JAWA 5HVNA 2DBZA 3K53A 4L5AA 1B2LA 4YP9A 4JQOA 1GR0A 4GZMA 2ZJBA 3NUGA 1ISJA 4G4SP 4ZYAA 2PRYA 3QOYA 1LDKB 3ZOZA 1JEOA 2WY7Q 3D3WA 4UHKA 3LNQA 3I5UA 2BMWA 5AKGA 3VOAA 3FWKA 1JMVA 2N75A 2NNLD 3OF3A 1QUFA 2JFOA 5L3SA 1F0KA 2CMKA 3CNNA 4MRVA 1AE1A 4A5MA 3WMGA 4G1CA 2FXVA 1KJQA 4X95A 1R0YA 2Z9OA 4D1QA 1CETA 1OZ0A 3JD2A 1L4LA 2QX6A 1E7MA 1XCGB 1V3UA 3GU3A 4J43A 4R9NA 5ALJA 3UB3A 4DCVA 1M73E 4YI5A 5C4XJ 3CUUA 1P1RA 4PJ0C 3E3AA 4JBLA 4QYSA 5JZOA 1I2MA 3DWGA 4LFBB 3V7CA 2Q2VA 3DGFC 3I6ZA 1M76A 4N5NA 2XE7A 4UHCA 4CMBA 2QPLA 2QDXA 1Y3FE 2BTQB 2QQBA 3PGXA 1IRXA 4QVGA 3UFXB 3CF5F 1FQOA 3OCJA 3E7WA 4H1UA 4WA7A 3TW7A 4G94A 2QYHA 5KPJA 3U3RA 1TCVA 3L7DA 3E9MA 3HB4X 4JUAA 3R2JA 4CKCB 5LUAA 1RXVA 4QTRA 5IOZA 3UJNA 2FOIA 4MYSA 1PUJA 4KSCA 4AYXA 3DZKA 2CGEA 2Q0OA 4I6JA 5B1HA 3W5JA 5EXTA 1QRSA 3U2QA 1QZUA 1P4RA 1R5NA 3HHHA 2ZYUX 3V1YA 1E3LA 2JAOA 2A84A 3CCVI 3JZIA 1QRAA 2VRBA 2IX3A 5DTDA 3GLGE 4LA4A 1DFIA 1JQ3A 1OTHA 5F27A 1X15A 3F4LA 4ND4A 4NU6A 2MLKA 2QX8A 3VYSB 1KR2A 1VKRA 3D6VA 5LXTF 3L00A 1RQ7A 4JEHA 5D7BA 2QV0A 3JSOA 3F67A 5LSAA 3JAMK 2W82A 1D2RA 1TU4A 3JQQA 2JARA 3OO0A 1FOEB 5DI3A 4DCGA 4CEJA 3JAKA 1E6UA 3N0TA 3ND8A 3TNDA 4BZXA 2PUFA 5IN4A 3AHDA 5HCNA 1PG0A 1E6EA 1WSBA 5K3FB 3TE7A 1XCVA 1CJCA 1XMKA 2DDBA 2JCYA 4QXOA 3WISA 4IFBA 4U9IS 3DT6A 3G8BA 4NZZA 1Z2CA 3MJSA 5J6XA 2QQ5A 2Z16A 1RYHA 5HBGA 2FE4A 5J63A 3VZQA 1OIXA 1LWNA 2GQ0A 1KWKA 4KRFA 2BISA 2EW8A 2Z4RA 3ADPA 5AVKA 3K5WA 2GN8A 4NZ9A 1GJRA 4QAQA 1V55H 2ETVA 2X5JO 4BNMA 1YJQA 3NJRA 3ZU5A 3GT0A 3GUCA 4MICA 3WKAA 1NC1A 3O73A 1L8LA 4QOHA 4ZQCB 3UGJA 2MR5A 4Z6YA 2EXXA 3CUWA 1FU4A 3FOBA 5AJVB 2ZB3A 3LD9A 2IV3A 1UMDA 4WKGA 1GUBA 4P55A 3CGWA 4RTQA 4IYRA 2JIPA 4CCWA 1ZGCA 1CBUA 5REQB 1NJGA 3M6XA 3F1LA 1HZZA 1ZCFA 3GRZA 2ZSUA 1Z3YA 1MPTA 4HFNA 4D5EA 4TLAA 1W581 2A7QA 3NU1A 1L3LA 5HKOA 4ZXFA 1T3SA 1EWQA 5EEGA 4L73A 3HB1A 4KDEA 3GYHX 1W5BA 1VCNA 2R8PA 3IRUA 3DKWA 4DLRA 4MRSA 2X0KA 1GQYA 3H0KA 4IHWA 3UEOA 4HQ6A 5AONA 2W2LA 3W4KA 5LYJA 4GVXA 1P6QA 2G9QA 4G8JA 3LSMA 2J3KA 3STUA 3IULA 1YGYA 5H59A 2QNIA 1JU4A 1LPSA 1Z36A 3WB0A 2HXOA 1JAYA 1GGMA 3GOHA 3DGEC 1T8PA 3MGKA 3Q5GA 1S1CA 3MT8A 1L5WA 5K0ZA 3UC9A 1JNXX 2WTMA 4YTEA 2Z6UA 2OAEA 1THZA 3PGMA 2AG0A 2OCBA 4OLFA 4DLXA 3U61B 4J01A 1XKQA 2GYWA 3O4GA 3PXCX 4KRXA 3SIXA 3DZBA 5KJ1A 1XELA 1ZOIA 4CF4A 4XFJA 4F7DA 1FIAA 5ILQA 2JHGA 1N9ZA 4Q6WA 2R7AA 3AH8A 2P79A 3K0LA 2WA0A 1Y6IA 3B9RA 3HCNA 4MR9B 5CDGA 5CD9A 5JYCA 1ID8A 1MOPA 2JC3A 1U8BA 1TPYA 2E1NA 2COKA 4ZOAA 5CFLA 1Z2PX 3WFIA 1FSHA 1N0VC 1OC2A 2C5SA 3NHFA 1LC3A 4US0R 2VN2A 4DBQA 2RAVA 4EI8A 3SJZA 5BS6A 1I39A 4C3JJ 2AW5A 2ODQA 1SIWA 1OLSB 1RXWA 1FYVA 1QKKA 1G3MA 4B3DA 1DC8A 2Z9BA 4RHEA 5BNTA 4XWWA 1RPZA 3CCMI 3TOZA 4Y7CA 1L5VA 5KSOA 2HS5A 4ON0A 3R6DA 1U2SA 2QQ8A 2DWQA 5FPKA 3ERED 4RWZA 4N0EA 5H6QA 1M3SA 4ZYWA 3A36A 5G1OA 2XWJI 4JLOA 4XIJA 4JP2A 3QVKA 1QQTA 2FFJA 3H2BA 2YJ6A 2FSHA 5H1YA 3G9UA 1JKRC 4DARA 3BD7A 2DWOA 4IHSA 3SQLA 1KJWA 2BUBA 4KNYA 2D45A 5EXXA 1CJMA 3L5KA 1JJBA 3F5DA 3WLEA 1CEEA 4PHFA 1ZUIA 1BDHA 1QGOA 1CPYA 2IEDA 4BCCA 4GI7A 1ONBA 1C4OA 3I0TA 1Z7WA 4KGZA 1Y6GA 2DUMA 2PWZA 4R69A 3VR4D 1FXWA 1UJ4A 2VOEA 4LHSA 4G8CA 2O3FA 3HM5A 2VPRA 1VSTA 3DKKA 2HL6A 3NNNA 5BVHB 2JBAB 1XMIA 1T2EA 3TEJA 3NYWA 1A35A 2YYAA 1QP7A 2HO4A 2BWJA 3H0DA 4FU0A 4UMEA 5DBFA 3H84A 3PJEA 2E0IA 3DOIA 2Q1UA 2GQQA 4ZTUB 1KMHA 1ZM2A 2ELJA 1UHWA 1LNQA 3HRSA 1JVBA 4BBRJ 3GNSA 4U0JA 3PPXA 2P4HX 4W9NA 1SXQA 3HJNA 1JHQA 3ZYZA 1EF4A 4O5VA 2QSUA 1YS4A 3A4NA 4GNRA 3MZ8A 4ESOA 3HOVJ 2M2EA 3I9JA 4PTLA 1TMGE 1T91A 1V26A 3DDHA 1BJZA 2D1HA 1LFPA 2HC9A 1YR3A 3KJIA 3MB8A 2MD5A 1C0EA 4HEQA 4KI0A 4EY3A 2WABA 2BELA 4P08A 2PMCA 4RQBA 4IDPA 1NWHA 1QAQA 3OU7A 2NVQJ 4PHTA 5FL7D 1Z6ZA 4A3MJ 1NLZA 2F62A 5TJ9A 4UV9A 5HMLA 3UMGA 5EJ5A 2K9LA 5LGUA 4WLEA 3TUJC 2R97A 4FSHA 4MO7A 3DQPA 3I5MA 4KLCA 5I7FA 4HVAA 1USUA 1OOEA 4QGBA 4ZK6A 4A82A 5K5QA 1E66A 3HP7A 4AIJA 5H83A 4XIDA 3FF1A 2WUWE 3GVCA 3MTEA 4N6GA 2E4ZA 1TTYA 4KQGA 1WA5A 2ZYAA 4MRAA 4XK4A 1MNMC 2PT9A 4FYXA 2IYXA 4AUMA 2XQFA 4Q93A 4U2FA 4XYLA 5K6AA 2ZBGA 3GDWA 1ILEA 3ZI0A 5LM3A 4I0AA 3D4OA 2PL1A 3V97A 4RAFA 2DA3A 2WC2A 1JJ8C 3R3JA 3SZOA 3R0JA 4YDRA 3NRBA 1OR7A 3ONQA 1E8MA 1UBOS 2V4JC 4AN0A 3CDLA 1I3MA 2WU3A 2ZETA 1ADBA 2VDRB 5L8VA 3F97A 5C3MA 4JI6B 4AU1A 3V8KA 2M6RA 2ZBFA 4A1OA 1CS0A 4MI6A 3VH3A 3TGNA 1SVNA 2ID4A 3KVOA 3NOVA 4GYYA 3L1IA 1JQ5A 2FLWA 1M8FA 3LUFA 4NNPA 1GGVA 1HW2A 5FX2A 3DDWA 3OFNA 2PUCA 4LJRA 4LDQA 3L2UA 2RB5A 3TVYA 2QIPA 4WBNF 4G0PA 3N2LA 5JNTA 1PJ8A 1RYMA 1T9DA 4NR0A 3DZGA 4CM9A 5HUQA 1KKLA 3MD9A 1XNHA 2BZGA 2PKQO 4FDMA 4I1SA 4NPCA 5F4ZA 4ZYUA 1P3JA 4AUKA 1ENPA 1PQUA 1RP1A 2R25B 1HLFA 2VJLA 4JAVC 3UAOA 3CLQA 4OYLA 5ES3A 1ISSA 3GW2A 1PEAA 4LRQA 2ONYA 2MGQA 2D1FA 1OVMA 2EV6A 3B6CA 1K27A 2FWMX 3BK2A 1YGPA 3ZE6A 1K08A 4L8FA 1GNTA 5GJVC 4Q9HA 4P7JA 5DHPA 3GCGA 3J80Z 4P4SA 4TPKA 1ZWLA 1VDZA 2OXEA 1JHMA 2X0NA 2Y6UA 3DVRX 2XUPA 4ML3A 5KHOC 1X7HA 3K6JA 1PO7A 1C30A 1ZG3A 3K9TA 3KP6A 2HWWA 1WVRA 5E95A 3UCEA 6GPBA 3ZQ4A 1QDLB 4P2BA 3QF4B 3MT9A 4PX2A 5DF1A 4DG9A 4UTVA 5FTWA 1IWOA 4ALKA 3NHLA 1F20A 1H0HA 1AIPA 3NJ4A 5CR9A 5TVGA 5LHIA 2BBWA 2QQ9A 1KEZA 4FSXA 3B2EA 5MHTA 2EZTA 4GOKA 3PZBA 3OZBA 5L3GA 1JHRA 1FUEA 3LJKA 3PQ8A 1Q1HA 4PGHA 1I1HA 1U04A 2BI7A 4ZU1X 4OI1A 3RT7A 3A4MA 2H5IA 4RK7A 3UANA 2W58A 1Y42X 2C7QA 2DPHA 4MEAA 1G8XA 1MJGM 2DHRA 3ONDA 3WK5A 3ABOB 4HYQA 4D56A 1AMNA 2X6WA 3BCRA 4OGWA 4B3CA 3IPRA 3NP7A 4FZVA 4K1XA 2FSUA 2EWVA 1A4UA 2NQTA 3C7JA 1Y8CA 4BMNA 4ZZ2A 3GLKA 5H9VA 5A2QZ 1UIRA 4QDTA 1FW6A 3L2VA 2UUOA 4EJSA 1AXEA 3NKVA 2HPVA 1PEYA 2MMGA 2OZEA 3ETLA 2PGJA 5ECGC 2ZFWA 3MB5A 3Q6IA 1RW4A 2BE7A 2V8BA 3C1AA 3WRWA 4BO3A 4CG0A 1ML4A 4NBSA 5U9CA 3L0BA 3FX3A 4JR2A 5LQDA 2UZAA 4DDWA 5TQ2A 3K0SA 1A8IA 2GAIA 4OK6A 2YQZA 3HFGA 5B7PA 2WJ3A 1P73A 1VIAA 3P0IA 2GAUA 3O93A 4EY4A 2CSOA 1DJNA 1ESCA 1SC1A 3KD3A 5AJTA 1Z18A 2G67A 5JAOA 3PUBA 4OM7A 1F8XA 1ST3A 3CR3C 5D8KB 1VRVA 2COBA 5MN4A 3G2QA 3GWZA 4N9HA 1L4FA 2F3TA 2VA8A 3GFPA 3KDSE 4KHZA 3W6ZA 3ABIA 2KRCA 5LP6A 5GP1A 4HYEA 4MTDA 2ZIXB 1WXDA 1GWNA 2WVAA 3M1AA 2RAEA 3W1VA 1NI4B 2JI4A 4R5MA 4FR5A 3ZVRA 1BFKA 3RAFC 1P7JA 3AF4A 1OTYA 4KX3A 5AUPB 2XSDC 1G5PA 1VIYA 3VOSA 1UBCA 1NV8A 1T0BA 4GU5A 1U02A 3EYAA 4LWOA 3ZR4B 1SUDA 5JLXA 1WOMA 4O02B 3SC6A 2HJ9A 4Y2XA 2GEUA 2PJDA 3DM5A 1S8FA 4MWCA 2WVGA 4L72A 2HK6A 4UTOA 1CDZA 3LRPA 3P9KA 2IEAA 1Z6GA 4QNRA 4MCIA 2Q0HA 4TMXA 3AP1A 4ZJYA 3D1JA 4MHTA 2NO4A 3NTQA 4MUYA 3V42A 4YRFA 4CKWA 2JZCA 4H6PA 4IS3A 1BX0A 3FUTA 4Q05A 3L7YA 3AG4H 3NNSA 4JVMA 3MWLA 4MCHA 1H4QA 4JYAB 4KUHA 3C8ZA 1JYEA 2OCPA 2V9PA 3K10A 2YBEA 3LT1A 4F1JA 4E4HA 2I91A 2AJ8A 3DNMA 1ID1A 4W1RA 5IVIA 1BHSA 1Q21A 1R16A 2XDAA 3SR4A 4M1TA 1MO2A 4N0MA 5K7FA 4DMLA 2A5YB 2I34A 5ELMA 1LW6E 5E1XA 2A1TR 4G5FA 4ESHA 3TRJA 1P2UA 3CVXA 4ESVA 1TBXA 1QFJA 3UFBA 3FPSA 2AFIE 3V32A 3DTVD 5L3ZA 3IAS6 3COAC 1EHIA 4PLHA 4BDSA 4LD5A 1M2JA 2ANBA 5T4FA 3HOSA 3WGNA 2ZRCA 1OKRA 1M34B 2PFSA 3NTRA 1YBFA 1JQAA 1OU4A 2PZFA 1WKCA 1D07A 1KI7A 3F6OA 1AS2A 2DTEA 2GFIA 4BE1A 2GJ8A 2FPPB 2HOQA 2X4DA 3BH6A 3DS8A 4LISA 3C45A 1WUTA 4ND7A 5HOQA 2A33A 2OBPA 4Q1BA 1T0IA 3E3OA 1FMTA 2BFCB 2CE2X 2Q4OA 2CFTA 1RMTA 3PUKA 2NVYJ 5AI6A 4YRDA 3CWCA 1NLYA 2IPNA 2VPQA 3HZRA 4S05A 1WHSA 1TT0A 1A9YA 1WAMA 2QYSA 2OA0A 3UMYA 1LX7A 3DEKA 3OBIA 2V6EA 4LEIA 2PFKA 4BASA 4OKNA 5JUWA 2HZBA 3WGQA 3UBTA 1YG2A 2WB1A 3QSGA 1Z39A 1LC0A 4QODA 5ICCA 1IZYA 1XDUA 1SM4A 4EX7A 1C14A 1UKAA 2E9SA 3EQ8A 1P9OA 1V35A 3LY9A 1DEOA 4QWQA 1PZEA 3FUWA 4PZYA 4BV2A 3NEJA 4ZKDA 1KRWA 2UXNA 2YICA 2BHLA 4PHHA 2QN3A 2MDTA 3F7TA 4OQZA 3NHYA 2CYCA 1KMCA 4UEWA 3E1SA 4NONA 3B82A 3BZBA 3UA4A 5TB5A 3TJZA 4EH1A 5JVDB 1AQJA 1M6NA 2F6CA 4ENNA 4QPOA 3GTMJ 4TS1A 3RW9A 2V7EA 4LKRA 1YZTA 3T7EA 1B6GA 1NY6A 1BI3A 4IHTA 1ND6A 1OU0A 1UJ2A 4KKVA 4WASA 1HDOA 5KKAA 4YUZA 4IVPA 5K4HA 2GCOA 4QXMA 3OESA 3S8PA 1Y6FA 1YDMA 4HEJA 5A03A 5CDUA 3OS1A 1XYVA 4OYRA 5AXCA 2DFFA 2NXNB 3I8XA 2V7BA 3U1TA 3CLHA 3NLLA 3L3BA 5JXIA 3AY0A 1MVLA 3OJ0A 2PQ0A 5FT9A 1JILA 3L6RA 3ZIAD 1SC6A 3RT9A 1TADA 4CDRA 4AK9A 4LG0A 3FRIA 1E4EA 4YA6A 2IQ5A 4IEIA 3OMWA 2ENUA 4G01B 1JEJA 4YMIA 3SDGA 1CQIB 5F21A 4XIIA 3CCYA 4AIDA 1U9OA 3OOHA 5IC5A 2RI1A 1H6CA 2A9PA 1T0JB 3NDJA 4OTZA 4PC1A 4LJ4A 1SR8A 4ZC8A 3LOUA 1J20A 4NBNA 3RPEA 3Q0EA 1CQIA 1HORA 2REQA 3QFRA 4IG4A 1WD5A 4IXTA 1XD8A 4M98A 1RRVA 3FCAA 4UXIA 1UMCA 4ZVPA 5DM6F 3MPOA 4I0WB 4ZMRA 2PUGA 2XDVA 4V2UA 2WWXA 3DL4A 3FKSA 2VHEA 5HE9A 4DDMA 2QU8A 3RUAA 1E2UA 1QIEA 3WNDA 2J0EA 3CA8A 5K3AA 4C3VA 4JI7B 3OM0A 3K0BA 1LB1B 2C9ZA 4EL0A 3VJRA 1MQAA 3EOAI 4G67A 1S2MA 4MUMA 3CQ9A 1I3CA 3BMQB 1IEWA 4OL0A 2KKOA 4AO6A 5I3ZA 2EHDA 3KIOA 3GRVA 3TTWA 1D1AA 4NZPA 3RYCB 1YS1X 4ZCTA 2A0WA 1VLLA 2AWOA 4LXGA 1M67A 2NYRA 5KMGB 4RS3A 3IWZA 3TLGA 2OVFA 1KDRA 3PQ2A 4PSUA 2XGGA 3V7FA 1YACA 1CQJA 3DO8A 4HN4B 3WR5A 1HI9A 2PLFA 2Q50A 3F8WA 1L4MA 3OS0A 1I2DA 4BFYA 3E9EA 1XQYA 3BIWA 4I4IA 4JBIA 4TM8A 4N40A 1UPTA 2PG4A 1LVUA 4ZT2A 3RRFA 3RVRA 1CB7A 3SFZA 1NBWB 2AKAB 2CBGA 2PTGA 1WVMA 3C3BA 4FT2A 4RDCA 4HV5A 1M33A 1Z2OX 2J5BA 2YZMA 5C8YF 4MV4A 5JBIA 2CG4A 1G21E 5F77A 3ZLBA 4EHFA 3REQA 1AOYA 1N8SA 4NX2A 4OK5A 1G3QA 1RBZA 1TOAA 1TZBA 2R7TA 2WF5A 4MJXA 1C0IA 4C76A 3ZW8A 1QGUB 3KETA 2I6FA 2KDOA 1C8LA 1VYHA 2ZVQX 3CX6A 1DCFA 3KKQA 4P8RA 5AVSA 4FOSA 3RFVA 4QDZA 2V54A 3M33A 1UK7A 4J94A 5BPIA 1N2GA 4JBYA 2OSVA 1ZVJA 3ISPA 1MV5A 4ER6A 5IXJA 4W8HA 3I9MA 3HSFA 4KK3A 4F4UA 1XTZA 3DLCA 2C4VA 2H1FA 3ZHVA 5BWLA 4GDMA 2IAIA 1NURA 2HLHA 2GA1A 2PO5A 5IC6A 3RCBA 5FFFA 1V5GA 5K99A 1Y9EA 5AK3A 3L40A 3UK2A 4PM4A 1SD6A 1O3QA 2PBLA 3I45A 1UBHS 1EWTA 2O2SA 2Q9BA 3KKMA 4LXTA 2H57A 4AT1A 1QK5A 1PL7A 4W1PA 1JT0A 2XAFA 1MA3A 4QVIA 2IBSA 3AG3H 4MDEA 2O0YA 1ZIYA 3QYBA 2IPMA 1ZJYA 3EEYA 3AY7A 1EFKA 1T9CA 2RG7A 3PHBE 3QKSB 4KLAA 4NIMA 3RABA 1PCXA 2V65A 3A9VA 3ENQA 1SNYA 5FPTA 4MYUA 1MV8A 5FUXA 1RLUA 1ON1A 3NPAA 2X6RA 4IFIA 4E6KG 4PX3A 3FGZA 4QXPA 1EVQA 1OTXA 1QFMA 2JIBA 4FFWA 1PP8F 4D0RA 3IAAA 5G0VA 5EAIA 2I3AA 3D0QA 2ELKA 4BKPA 3WTBA 2A8YA 3EEQA 4OO3A 4RSMA 3TLMA 4JOQA 4DMUB 4I7HA 2DQRA 2VQGA 4YVFA 2AG1A 3WLJA 1RRFA 5D6NA 1K7CA 4RE6A 1EK6A 1E9AA 3AINA 3WWPA 1GNVA 1GZUA 2XUIA 3HA2A 4M4SA 2NQ8A 4EPXA 1DAMA 4QBTA 4QELA 4C1BA 2EL9A 2NV6A 3G9QA 3PNLA 2F90A 4LJAA 1GZ4A 3ZWMA 1E1LA 4DKJA 3UGTA 2YNMC 1YT5A 4UC0A 1LFDB 4QHSA 4PIMA 1U7XA 2BKVA 4LQCA 4HLYA 2P9ZA 4NRDA 2X19A 1V1RA 1Y7TA 2FJ1A 4Q6BA 3TTSA 1QGPA 4CKBB 3JW4A 2XF6A 1R6XA 3WYGA 3N74A 3P2EA 2O7OA 1Q20A 3P2KA 3U44B 1C3JA 5I4IA 3EIFA 5AI4A 2ZTSA 3MTQA 3UOGA 1MH9A 1Q0PA 2C95A 3P0FA 3TMAA 3OCYA 2BR3A 1YJ5A 2DFNA 2YXEA 2Q8QA 2HWUA 3H4MA 4CDGA 4YJ3B 2LP4Y 4GT1A 2H5EA 3VZCA 4LIPD 2G8LA 5ITWA 3K9QO 4HTFA 3KJEA 4RD1A 2YFYA 3SNKA 1IY8A 2D3WA 2H1KA 2ZUBA 3IUMA 4F5YA 2NOJB 4HZFA 4HXGA 3I0ZA 2VTDA 3NANA 4HLXA 4RK0A 4XJTA 5B3AA 2P40A 1UBGA 4AJLA 3QUTA 2EJWA 2FPIA 1QV9A 4JLSA 4LJ6A 2P6NA 3CZ6A 5DBGA 2EFYA 2FSVA 1DIHA 3SYKA 2L17A 5SZKB 1BQEA 3F6YA 3OIYA 3BIJA 3VR1A 1QHXA 4WN9B 2ECKA 1YS6A 5J5VA 2ICWG 4HAWA 3S0JA 5CDFA 4Q00A 5E3LA 3VU3A 2QUIA 4B3BA 5EXDA 4KN5A 1SUEA 4RPHA 4YH1A 1G66A 5K8IA 1T5DX 1ORTA 3O2PE 4E7OA 3EGOA 3TUIC 5FRMA 2QLFA 3BK7A 3QUBA 2STWA 1XVUA 2EX4A 4HZUB 2W42A 1KU2A 1JUSA 2R7FA 1QYXA 1AV7A 1AZTA 1PL0A 1QWSA 2JS7A 2Y4OA 2R7VA 3Q7PA 3EDPA 1TXGA 4LSZA 1PDNC 3WQQA 1AB6A 1NPYA 1E7SA 2GERA 2W6ZA 2IC5A 3JVUA 1CVIA 2A4MA 1NASA 4Q15A 3RBAA 3HI6A 5UKDA 4HB2A 2OZUA 4HLCA 4D5FA 3UAWA 4D26A 3N2KA 5EYPB 3GUDA 4HVCA 2XYHA 3EIWA 3I9FA 3ZWBA 4KO2S 3A37A 3FCOA 3GJ8A 1G3UA 1ZGHA 3ENZA 1P3Y1 3P0EA 1G6HA 1Q91A 3EJ6A 3OTIA 4FHZA 5G1NA 4WBNB 2Z8XA 1DIGA 3VKHA 1YRQA 2QY9A 3G23A 4PXAA 5ALGA 2HMAA 4M0KA 1PVVA 3BIFA 4AY2A 3FXAA 5FKOA 4QRHA 4WERA 2M6KA 2WHEA 2QUKA 1W4RA 2IUUA 1VYVA 4NYMQ 1R6RA 3G0BA 2G9VA 1REPC 1J8MF 3WU1B 2O61A 1F5SA 1T3ZA 1TVMA 1ZCAA 4YUVA 4KXNA 1ZJ4A 4DJ5X 1YA8A 3R4CA 3IVGA 2VJJA 2VWPA 2ADMA 2YIMA 5FORA 5E1MA 5BW5A 1G42A 1V5FA 3JSPA 2MBFA 1PJAA 1RJDA 3GLRA 2ZROA 3V3TA 3AG6A 1V6SA 3F8CA 2G7MC 2Z1MA 3G0OA 1RLOA 1T5BA 4FQ5A 4DG8A 1C81A 3BDAA 2V9VA 1UEJA 2Q27A 1K6EA 3F7MA 5HYVA 4RJJA 2HA5A 3OFVA 4V3BA 1FQWA 3HKZA 4JROA 1LI4A 3FKJA 1EEHA 4BEHA 1I1QB 2EIHA 3R3ZA 3VHXA 1V8FA 2KHZA 1XYYA 1QJ4A 4LIUA 4GOXA 1NQUA 2O7NA 2YV2A 3GGCA 4B6OA 4BMDA 1TQIA 1RQRA 2VP2A 5CNKA 3HH8A 3STYA 4W5HA 4D0GA 4ZMSA 4F5ZA 5AVTA 1UCFA 4RF5A 1Z6RA 2QM3A 2Y0SA 2QRZA 4YQYA 2Q4BA 2O2JA 1R6UA 4H7HA 3X2QH 5CX4A 1NM5A 1YVEI 4CMEC 5JQGA 5GPCA 5J4HA 2CY0A 3F3MA 2POQX 3ZHXA 3BJMA 5AVZA 3OSFA 3S2GA 4LYAA 4TTIA 5IABA 1CYEA 3D3WB 3COVA 2FQXA 3UKGA 1AUVA 1XZKA 2POCA 3S7ZA 4O4HB 1UXKA 5E8GA 1YSCA 3GP3A 3CB2A 5FI0B 3UHAA 2ID9A 1OR7C 1ECLA 3EY4A 4O8CA 1AHHA 1IOVA 1RHMA 2ZUCA 4O4IA 3ZNPA 1I7PA 1D7OA 1Z0SA 1W5TA 2F8MA 4MTCA 1S8OA 3TM5A 4A3BJ 3NP9A 1ZSNA 1JALA 3I6YA 2FBHA 5AFSA 3P0HA 4QKQA 1HTBA 3WWOA 5JBQA 5EG0A 5EPOA 3AVWA 1PGQA 3ROZA 4XMYA 4CMJA 1LU9A 2NV0A 1HG1A 1HRDA 3P9PA 3SZGA 4LZNA 1XEAA 1NMEA 4BUPA 1YOBA 2PWPA 3Q1KA 4OJKA 3TO7A 2RAUA 5CK5A 1PK9A 3L0YA 1H42A 4ZCIA 4WY5A 4CEIA 3SYMA 1II9A 1VMKA 3OYFA 2XSZA 2VJMB 4KO1S 2BXZA 2R96A 4NJMB 3BULA 1M1NB 2AXTC 3ZCSA 4BN0A 4Q4JA 2RHHA 3ZGXA 3CKLA 5EMJA 2LG4A 3DOCA 1O3RA 2FB9A 5HFNA 1Z2DA 3EYIA 1MQ8B 2L42A 3KS9A 2BMVA 4DS3A 4HVLA 4FP9A 1DHTA 1YV9A 4ND8A 4HEHA 4WLFA 3FUUA 4ZKEA 4MQLA 3U1VA 4AJOA 4AWXA 4D98A 5IUNC 3ZVKA 4YELA 1SUSA 1KXZA 3A3NA 3L92A 3ABRB 1L5FA 4C78A 1DB3A 3CH6A 1KQGA 3NTOA 4R79A 2RGAA 5I8PA 2JI9A 3LYHA 2R84A 4R81A 4J19A 3RKQA 1Z2EA 2LDBA 2XV4S 1GNPA 1XROA 1Q3TA 4H3HB 5IN5A 3V4LA 4Q1FA 1SPBS 4XGIA 2Q62A 3IXLA 3P9NA 4NU8X 4LYHA 1RXEA 3OCZA 1X3UA 3AF2A 1VQ1A 5DHQA 3DHWC 4BV8A 1NNUA 5BR7A 4LZLA 1FZTA 4E09A 3LUAA 4E14A 2IGNA 4WT7A 2ZRAA 1ISMA 3K1AB 3RF7A 1J1IA 4I5GA 3WTCA 1IDOA 1EBFA 5K8JB 5LL6P 1P5ZB 4KQMA 3LA8A 2HOSA 1PTJA 3USZA 3IWFA 4ENTA 2AR9A 4TZ0A 3JRFA 1XJCA 4PPFA 2VB6A 3J7ZI 2IX9A 1GPKA 3AVQA 4FJ2A 2Z2XA 5JAPA 5JJKA 3UXEA 4RB3C 3NNDA 1QVWA 5E3NA 3CZ9A 5EKUA 2QMQA 5AVWA 4X20A 2CLLB 3HA7A 3KXKA 4X7BA 4Z51A 4ON9A 3TZBA 1UQUA 2I67A 5DMHA 4JI5B 3UMSA 3M7GA 4BTEA 4EF4A 5A6SB 2PJRB 2DUNA 2VT6A 3JYHA 3S5UA 1JR6A 2X6XA 2VHTA 2J7PD 2HVQA 4DWJA 4IDGA 1WDMA 3GRFA 4BGIA 4MQ9F 5EJCA 1QIJA 5ECWA 2NSYA 3O94A 5IJ9A 2R6FA 1EB8A 1D8JA 1MRNA 2HA7A 1VGVA 1CVLA 1CFZA 1JR4A 1LUJB 1U4OA 4QBHA 4U3JA 4YJGB 521PA 2COMA 3DCYA 4LTDA 3WDSA 2ZJ0A 1JI8A 2FU5C 2JFWA 3A05A 1Y98A 4IZ6A 4OK3A 3GEDA 3UT5B 2QRMA 4KOAA 3B6JA 1IDZA 4KBFA 4LC1A 1U99A 2B61A 3DQZA 3GP5A 3R7BA 2BC9A 1R49A 3NHPA 2Y9YA 4XOTA 3VGPA 4CCAA 3VNVA 3DVLA 1YRNB 2W90A 1AKHA 1DVRA 1RHQA 4C08A 1Q16A 3FDZA 1SG6A 5AUQA 4AL4A 1ARZA 1QFXA 2GJ9A 3PDHA 5JAZA 3HHEA 1RI7A 2EJRA 4ISBA 1MAUA 4RVSA 3ZHQA 1JHOA 3T3GA 4MQMA 4CXFA 3IAS2 2CS3A 1NW5A 4WWHA 5FOXA 1SU8A 5L7WA 1EH5A 3HM2A 5KIAA 1EESA 4IOMA 4BN4A 2JLCA 3FDYA 2FX3A 5JLJA 3AF6A 1MLDA 2G9ZA 3KTFA 2XI4A 3TNYA 1MB9A 4RM2A 2BXYA 4RB2C 3G6KA 4XAQA 2P3QA 4RZXA 2G1JA 1H2EA 1CD5A 1UBTS 4JJIA 3EGCA 3RAGA 2PQ2A 1XRSB 1JHYA 5I5GA 3FTEA 3VTAA 1TC1A 3BH0A 5B1SA 1KE2A 3DWIA 2I22A 1ETHA 5DW3A 1USIA 1SIUA 2GZSA 4FJ1A 4A3EJ 2XY4A 2XVYA 5ENDA 3S27A 3UJ9A 4LGWA 4IOAF 4IKOA 3EEIA 4Z8XA 2I2BA 4C6HA 2B69A 4UUTA 2FA5A 4UAGA 3ZX4A 1P61B 3LK7A 2A9FA 2PAFA 3L6DA 3SICE 5GJCA 3RYFB 3ANMA 3S2DJ 1E2EA 3V8LA 1MG5A 1OXTA 3BUSA 2PGXA 3DV2A 3KHUA 4FYHA 5CM9C 4QNMA 5HXAA 4CT5A 1W4CA 3Q7TA 1RWBA 3EXEA 1ZNQO 2D00A 4W1UA 2CF6A 4MROA 5HR5A 2D54A 4MV6A 1ANKA 1V3VA 4L4XA 3ONWA 4LF9B 1XD2B 2BVNA 3FBNB 1L5MA 2E2WA 3C7TA 3CX8A 3P2JA 4ZEMA 3JYLA 4ATNA 3ZDXB 1GIAA 1KPIA 3WLQA 3AXSA 5FRNA 1VLVA 1VBFA 3GPBA 1RCTE 1T3LA 1VG8A 2X6TA 2XB6A 4LHZA 4AS3A 4DTIA 1UP6A 4XWKA 2D7JA 2QX9A 3J7AY 1T2DA 3RDIA 3L0CA 2L4AA 3JQ8B 4L7QA 4U7FA 5D3QA 3O2SB 3VTKA 4AP5A 4L3VA 4EYQA 1SJ9A 1VJRA 3H83A 3OYBA 2DTZA 1I0LA 4PS0A 2DKOA 5P21A 2J46A 2XKAA 3QQPA 1WX1A 2AD1A 3OWHA 5EWLA 4ZFNA 1JG1A 3WA6A 5A4KA 2ZCUA 1J90A 1R6DA 4RTMA 3PFGA 3SEQA 1VXOA 4FOTA 5E1DA 4CHUA 2NXCA 3S2FA 3F8SA 3X1MA 2GXQA 4CM6A 2JD2A 3DOFA 2CEAA 1L1QA 1JNYA 2KRHA 3OFND 1PK7A 2XSJC 3PENA 3M6IA 3LX4A 3OIPA 4NZYA 4WBXC 3UCFA 3RS4A 3ZXXA 5JAHA 3VSKA 3HOWJ 3D0SA 1T9GR 4DA0A 9ABPA 1AZSC 5IW8A 5C53B 2H2IA 2IOYA 3JQPA 2O8EA 1A36A 1GZHB 1Y89A 4CMGA 3U7JA 1S3SA 2VXBA 1OXVA 3RYRA 1MG0A 3AEXA 4R16A 2GXAA 1FTYA 2XAQA 2EKZA 5DEIA 5FFMA 2VJNA 2YWFA 4ZO9A 2W2XA 4FUTA 5JSZA 4RGSA 3PNVA 1G8PA 1Z0UA 5JAQA 3V4FA 4ZU3A 1YW9A 1UINA 1FK8A 1GR1A 2H7XA 2G25A 4HVTA 2P3SA 5LZ8A 5EE5B 3AKYA 1NFFA 1P4SA 1FOWA 4UFOA 5F52A 3RTRA 1R0BA 10MHA 1II0A 2NX2A 4OQPA 2CXNA 2II6A 4CR6A 3R3VA 2QLTA 4IINA 1T9KA 1HRKA 2PXXA 1W76A 2H2DA 4UNRA 4B3GA 1NP7A 3S2WA 1MW8X 5BN4A 3FMRA 4GKBA 4I50B 5BP7A 1E3EA 3ESWB 1VQ7I 2ETHA 1Z2AA 3IIIA 2SHKA 1VMDA 2ZJPF 3PBKA 3HJAA 5KQPA 2VJ4A 3LSRA 4D4IA 4Q4JB 2COEA 4G4GA 4LQDA 3KKPA 3IH5A 4W8GA 3LUJA 5JC8A 3N58A 4JKIA 4H3SA 3U19A 3LVRE 4HDNB 2IJGX 5CVCA 1L7BA 1Y1PA 2VF2A 4M6XA 4NDLA 2J09A 3L18A 4NV1A 2GT1A 3OD1A 4UUMA 5DLDA 4Y67A 1EYZA 3O4JA 2DCUA 4KB5A 3G1LA 1F8YA 1VI5A 3ISVA 3LQ1A 1IBCA 1NC3A 1U5AA 4F97A 5KQGA 4Q3DA 4L8WB 4EZBA 1ZNZA 2OO5A 2DHCA 3G17A 2H5JA 2C61A 3BE6A 4CL2A 3L7JA 1E7QA 3PCXA 4YMLA 4CUKA 5K7SA 2X3UA 4AB1A 4B6FA 3KTOA 4C0LA 4WJLA 4BNIA 3ZD9A 5L3FA 3C24A 3I2GA 2WU0A 3G8YA 5D5HA 1JQBA 2PKXA 3W6KB 3PO3J 3H1AA 4EDHA 3PC4A 1DBVO 3ODGA 4MGIR 2FUNB 2BV6A 4UE3S 3TK1A 2Y1OA 4YEJA 5J1YA 1L0OC 1J9IA 2X1MA 4TWRA 1UP4A 2KWIA 2XMBA 3AP3A 3B3QA 2WOOA 2PR7A 3D7NA 4KR2A 4UHJA 1Q2XA 4KVGA 1SO8A 5HWSA 2FNAA 1F51E 1PR2A 4XGKA 1U0JA 2EA2A 1PFUA 1V1JA 2BGUA 3K6GA 2JBAA 3LBAA 1EFVB 1NFRA 3OLYA 4WDRA 3BWEA 3R5JA 1QB7A 4TTAA 3P19A 1HLDA 2EW2A 3CCLI 1RMYA 1V2HE 2Z5UA 2VA9A 1A2KC 2XA9A 2YV4A 3KK0A 2CDAA 3LUCA 5FLEX 4BMPB 3KQTA 4UTNA 4Y1FA 2QE6A 5JD3A 2X9DA 1TQ8A 3ME5A 1QIIA 4UM9B 3L0IB 4PJNA 1J25A 5I9SA 1IK6A 3DPUA 2FPKA 2W7TA 3L4BC 4M7RA 3TWOA 3BMNB 3LSYA 1YKFA 1TC2A 5EESA 1C80A 2O8NA 4C4AA 3HGGA 2XTMA 1NG1A 4L5JA 1DUVG 2A6EF 2RC5A 3SFTA 1J8FA 1JHHA 4GFBA 1RCFA 2B3DA 2C9CA 3IT2A 4FDUA 4R0NA 3U7QB 4KIGA 5GTHC 1HFEL 2VPIA 2WF9A 1EHYA 2CUKA 1A8UA 3EXHB 2IGBA 3KSRA 1K7AA 3LQFA 4KZKA 3E6CC 3I73A 1NDUA 3S3MA 5CGQB 2QN7A 2HN9A 2GGSA 5L3BA 2L01A 4FGJA 1H93A 3DEAA 2B63J 1B41A 3H87A 1KO8A 1E6MA 5AKHA 3BZKA 3UGKA 5AJWA 2QK4A 1I24A 3KKKA 3OYNA 2OZVA 1WBDA 3UYLA 3GPCA 3NHRA 2XMCA 1KH3A 3ZCQA 3QVJA 4I5IA 2HU5A 4CR7A 1RWVA 3HXPA 2EFPA 2G9WA 1JQKA 3EDRA 4KIJA 3TRHA 1DAOA 4EY6A 5U1PA 3KEMA 1H2ZA 3W8FA 3VYVA 1BZYA 1G5HA 2LVSA 3WK4A 1J4AA 3TPCA 3A4VA 3EXIB 2UUAB 3VUFA 5EF6A 4I98B 1DKQA 1YOVA 2I6SA 1BEZA 2Q2NA 3HKEB 4MMXB 5F5LA 2RGRA 1YX3A 1N5DA 1MABB 1JDUA 3K0EA 4Z0HO 4HG2A 2UZ0A 4C0WA 1F6DA 4DR2B 1TAQA 3HJBA 4JQFA 2O05A 1RJEA 3PEVA 2OAZA 1Z5ZA 4GSKA 2CJWB 1RRPA 3HCPA 1BR2A 2PYIA 3D3QA 4RTRA 2PUTA 5FBWB 3PX3A 1E61A 3EA0A 1JLHA 2RGWA 4WHMA 4R2KA 4WCGA 1H66A 1VL8A 1V8PA 1G8KA 4WLOA 3ROKA 1NW6A 3OEEA 1CR6A 2I65A 3AQ4A 2ZXEA 1GKYA 1S3JA 4XKVA 2ZSBA 4MUGA 4U7WA 4QUAA 3QKWA 5A4IS 1RBQA 3T3PB 4IDBA 1NJ5A 1TLHB 3F72A 1NQOA 3TOBA 4BNHA 4CU5A 3VV2A 1Q6ZA 3DPSA 3I9OA 1JFTA 5G2OA 2HIHA 1QC5B 4YAOA 4ZDOA 2EARA 1KGDA 4DR7B 1TAGA 1S89A 3QUCA 3ZZMA 2GKSA 3EXAA 2L7FP 1ZK4A 1Z8DA 3CZQA 4FCCA 1C9NA 3FPJA 5F78A 4BNWA 2NM0A 2PH3A 2DAPA 3CJQA 3HA3A 4UCWA 5JG7A 3FHNA 1T35A 4JI3B 3QG5A 1A5BB 3PNTA 1Z38A 2WA2A 3EGDB 4YDHB 4JLBA 5DK6A 3DMNA 2XKPA 1A96A 1P39A 2Q1SA 3LFHA 4P3NA 5KPDA 1XPUA 3QYEA 5CX1A 4KR6A 4G1UC 5FHRA 3WHBA 5F2KA 2AZXA 3PC2A 1JJAA 4FASD 3L7WA 4PFPA 3QP5A 1CUYA 1ZOPA 2IBMA 4ZQBA 2P9YA 2YMPA 6ABPA 3E22A 4KAXA 2D5AA 1STOA 2H29A 4PRLA 1A88A 1M1ZA 2F1OA 3A2LA 4MYCA 1L5RA 1C0KA 4HB4A 4UPDA 5DGXA 3UVEA 4E08A 4YX9A 1KDPA 1QORA 3MMYB 3H6HA 4NEGA 1N78A 2IYYA 4KQKA 3HDDA 1XRQA 3DVAB 2R00A 3LBIA 4H4CA 3CC2I 2O2GA 2OECA 4L16A 1X7GA 4RVUA 5K0TA 1F4KA 3ZCUA 5K0FA 1T2KA 4XFKA 4YPVA 1NLUA 3CEPB 3CRRA 1FEXA 3ZN2A 1L8AA 5CB8A 1AZWA 2WPDD 5HMMA 4MJLA 2AF3C 2GXUA 4ZYEA 2FZEA 3LE8A 1G2QA 4X0GA 1GNSA 1N33B 3OZIA 1UDWA 3ONVA 2MSNA 4MVJM 4J4BA 2PKQP 2PO7A 2B83A 3Q98A 1DQZA 1VBNA 4X90A 3TPFA 1SGWA 2Y9PB 5JD6A 4DZJA 2VUMJ 4RY8A 4QVKA 5DYNA 4AVPA 3S3TA 4MDFA 1TAUA 4MUNA 4G5GA 4N7MA 3JAMZ 2GNOA 4TLCA 3NGXA 2B78A 2PKYX 1SWWA 2JCVA 1ECCA 3E0QA 4QBKA 4H0EA 5A5VA 5HS7A 5EZGA 4MR7B 3LKDA 1ZEMA 2EYUA 2HCFA 3TW8B 4PLWA 2YH2A 2MR6A 1KA8A 3UTDA 2OILA 3DMYA 4KN4X 5IAAA 3VODA 1VQ4I 2IOFA 3O95A 3TXAA 1PLKA 3KFXA 2XMDA 3TDZC 2DECA 4JN6B 2QB5A 3BC8A 3K8OE 3GBVA 5KNBH 1E1YA 1Y8ZA 2YC4C 1H6AA 2CUEA 1S5LC 1GXPA 2QTVB 3OMXA 4ICIA 3Q41A 4K2HA 3SWWA 4NXNB 1S4QA 3EMBA 1WPXA 3A3KA 2VDLB 3IVMA 1ZQ1A 2O7RA 1Y81A 3E05A 4FCVA 1NRXA 4LCJA 1U2RA 2E71A 1UKZA 3RE1A 4LLNA 4M0CA 2W48A 3L41A 2DA7A 1ZONA 3AOGA 4OU4A 3RIYA 3MM4A 3W3AD 4JB0A 4ZC3A 1OCEA 1YRWA 4OI2A 4WLUA 5EIWA 1ZJWA 2JFUA 1DBPA 1O0BA 1VYTA 1LVGA 5FLYA 5FTMA 4ZCLA 3EUHC 3A6ZA 3ZVLA 1KY5A 3E9CA 4B76A 1BGWA 2WJPA 1RU3A 3E5MA 4KQCA 2MWMA 5DGCA 1Q0SA 2OESA 3HRHA 3AR2A 1CLUA 3GNLA 2OQVA 4NOJA 1TQDA 4H6XA 4E0BA 3KG2A 3HDHA 1ZEJA 4Z4GA 1W0JA 1R5OA 2ZB9A 3K16A 1FYLA 2AFIB 2O7QA 2ZTMA 2G09A 3KTAA 2JLRA 4M53A 4E7KA 4O8ZA 4BE0A 1SBNE 1PI3A 3CEAA 1ETOA 3I12A 4GMHA 4LY0A 5EERA 1DXOA 5IBPA 1NQWA 3IVCA 3X1WA 1WXWA 1H0SA 3MG9A 2QWXA 1ZVQA 2B3TA 5DE3A 2I4RA 4B47A 3QSYA 1YCGA 4DEVA 1LSSA 1LPQA 2ISSD 5MFPA 5LNK6 4F2WA 3K1NA 2CNNA 2PQMA 4Q4HB 1I8TA 3WK9A 3W2IA 2PH7A 2Z0MA 2SCUB 1HSTA 1IBLB 1EX1A 1JHDA 4ENRA 4L0ZB 3ABLH 4RU1A 1QTIA 5FUBA 4IMPA 1G4AE 2MHCA 1G8AA 3PQ3A 3HJUA 1RVV1 2YIDA 3QKRA 3IRRA 2YZNA 3WNZA 1THTA 4MVXA 5EHXA 1MKMA 2W2MA 2W2PA 4CPDA 2GCNA 4NS1A 3N0WA 3HPGA 2QSYA 3LY7A 1T9AA 2VJIA 3QX7A 3WGKA 3UCXA 5BYBA 2ZTHA 1Q0ZA 3IAEA 1R4NB 4TRRA 4LNUB 2ZFUA 2NZ8A 3IIMA 1C9JA 1GTVA 3ILXA 3NBFA 1UMCB 2G4VA 4Q7KA 1SXIA 2AOWA 2BY1A 1R8SA 4HPJB 4A73A 2Q9CA 3LH5A 3E48A 3HJHA 2G5CA 3QVVA 4JD5A 2ZW9A 4K9NA 5HDQA 3UHOA 2P9CA 1G0OA 1T56A 4AZVA 3MCWA 5JC1A 3W04A 4EA8A 1BCRB 2WB1N 1CF7A 1Z82A 5FBZA 1F12A 4OIMA 4TVKA 3VFDA 1FU7A 3EG9A 4F12A 3EULA 2J1LA