4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
3TOSA 2L01A 2ISYA 3OE5A 3WSTA 4A6EA 4FHTA 2A69F 3F8BA 2DFIA 1RUNA 1KPHA 3TKYA 3GRZA 3M6WA 4CKCA 4G6DA 2EG5A 1H9GA 2MLGA 2PX4A 4A5MA 5DWQA 1G38A 5BW4A 3E6MA 4GF5A 4CTKA 4HX4A 2XAJA 3FF5A 2P7VB 4YV2A 3C6KA 5DYMA 2HNKA 1LVAA 3A4TA 3K9TA 4HSGA 4PONA 2A6HF 3WE2A 2FRHA 2IPXA 3NVMB 3CO6C 5L3FA 4AZWA 4FSDA 4A0YA 3E7PA 1HKTA 3WTZA 5D1NA 4X41A 1WI9A 2ISZA 2COMA 4G7HF 3M6UA 3EGVA 3P7NA 4LLGF 4KNYA 1ZREA 2IA1A 3CCFA 3N97A 3SX0A 3EVDA 4GC5A 2VT3A 1X1DA 4PIPA 1G3YA 2ZKZA 3ELDA 3IYLW 5CLSA 4KT5C 4AZTA 2GXGA 5IH3A 1TBXA 4IJAA 3MQ2A 5F2KA 4WXDA 3W6JB 2H6CA 3LQRA 5H20A 2DK5A 5F2OA 2ZBRA 3WGIA 1SMYF 4RTRA 3FMRA 3MZYA 3KLNA 1XJ5A 4I7HA 4RGSA 2VODA 1FP1D 3HVHA 4LWPA 3TO6A 4U7TB 3LA3A 1T6SA 1PRYA 2Z6UA 2BZGA 3BGDA 3I64A 3V8LA 1BI0A 3NRVA 4ATNA 4HOBA 3SM3A 1SMTA 3TDZC 3DXXA 3IWZA 2P6TA 1JQDA 3OFKA 3RODA 5E9WA 3TLJA 3ERCA 1EG2A 5E8GA 3LBFA 1J0RA 5ICFA 3RKWA 5E8RA 4FT4A 2PLYA 4U0VA 1JG2A 4UVAA 3GIWA 4E32A 2K4JA 3DPTA 3FHZA 2ESNA 1FZPB 5LQNA 1ZRDA 5LHHA 1EJ6A 1MKMA 1Z6RA 2B9EA 4MWZA 3SXYA 1ORIA 1H9TA 2BE5F 1AOYA 3P9KA 1G8SA 5EGSA 4A6DA 1KYZA 5JR3A 3I59A 2OY0A 5MHTA 4CXFA 4L18B 3DF8A 4WWCA 3BKXA 1R58A 3BZBA 2ELHA 4B17A 3KQOA 4PNEA 2FF4A 3CKKA 5HLGA 4DF3A 2AN5A 2EJRA 3F8MA 3CC8A 3KEQA 5HVQC 4KRGA 3LA2A 3I0TA 4S05A 1TQMA 5E20A 4XSXF 3Q7EA 4GOOD 4B8XA 2OKCA 1Z91A 4EKGA 4WX9A 4YUVA 4HLYA 3T5XA 3MQ0A 4LD5A 2QY6A 3HTXA 5HIKA 5GIOE 1KQ0A 4C4AA 1O7LA 1STZA 3M8FA 2Q41A 5E1DA 1ZGJA 1FJXA 3WGGA 2IBTA 1VQ1A 1ONVA 5LHGA 3KR9A 1T2KA 4LG1A 2P8TA 4RTSA 2WV0A 3DXZA 3ORHA 4OIQF 1IXRC 3GDHA 4ZYGA 5CVEA 3KZZA 5E8IA 2Q2EA 2IFTA 2ZMEB 4IKPA 4HX8A 4P7KA 1P39A 5CJ9A 1J59A 2OU2A 2VT2A 1K79A 1S7AA 1SVUA 2PSSA 4O6JA 4HV5A 3SQNA 4B09A 4ESFA 3BKWA 5EOVA 5E8JA 3BJAA 3E5QA 3F8FA 2F2EA 2O0LA 5K0LA 3T8RA 1T0FA 5IT3A 1L3IA 2PV0A 2ZBQA 3SR4A 2PMUA 3E23A 4OA5A 3BT7A 2GQQA 3I4PA 5C0OE 2P35A 4MHTA 2XKOA 1J5YA 2UYQA 1ZLJA 2VS1A 1RI2A 3KP6A 3FPHA 4FS8A 4LLLA 1FWZA 4PIMA 2K27A 3GXOA 3CJRA 1Y8CA 1B6AA 5A2QZ 3VB2A 4ENNA 1GXQA 3PFHA 2PKWA 3JWIA 1W5TA 3F6OA 2VONA 1BBYA 2P6SA 3ZQ7A 1RJFA 1UIRA 4GXOA 1BC5A 1HSTA 2NS0A 4UUVA 2DU9A 2DAOA 5D5UB 5HOQA 1W7PA 1WXXA 1B59A 1HQCA 3PFIA 1AF7A 2HR1A 4M73A 2A5YB 2IDJA 4RVFA 4RB1A 3V97A 2W57A 5E2BA 4PYMA 2AOVA 3FXUA 4RTLA 1NW7A 1YG2A 3H92A 3OCJA 3GU3A 2KJBA 3GZ6A 2EA4A 2GZWA 1P92A 2P7HA 5FD5A 1HNNA 4YMGA 2YXLA 4XRFA 4BY9E 1XCJA 2ESRA 2EV0A 5DM2A 3GZ5A 2XV4S 5E18F 5JUWA 1BIAA 3SSMA 3KQWA 1FT9A 2VDVE 2VE8A 5LGNA 4OBXA 3K1MA 4S04A 2G1PA 5FCDA 2UYCA 3MTEA 2HYFA 2VC0A 5DM0A 5EIWA 1XMKA 4DMGA 4MHGA 2PT6A 3P2KA 5DD4A 2O3FA 5K0GA 4HW0A 4HX7A 3KPWA 2EA2A 4RB3C 3UJCA 2P5VA 3DTNA 1NBIA 5E2AA 5D5VB 1I9GA 2F5DA 4LFUA 3R0JA 3KP5A 1R1TA 4LMYA 5FLXK 3V4GA 2P40A 3V8JA 5FUBA 1OR8A 1YW9A 3MAJA 2D1HA 2ZULA 2GA9A 2I9KA 3GYHX 1P4AA 1ODDA 2WK1A 2RKHA 1MJ9A 1F4KA 5EQJB 2GH1A 1HBXG 4KICA 2AVNA 1RI3A 5DLYA 3UJAA 5CVDA 3V7RA 1MHTA 3B5IA 5LQKA 1XD7A 4C03A 2F5EA 5ERGB 5M5BA 3HEMA 1D2CA 2STTA 4R8SA 4JK1X 4E2WA 4ER6A 3WU0A 3CBGA 3J80K 1FY7A 1I1NA 5FADA 4M9SA 2Z3YA 3T8TA 2XYRA 2QQ9A 5KVRA 2BR3A 2LNBA 2V9VA 3EUHA 1ON1A 3GO5A 3MEXA 5DX1A 3NJRA 5HS8A 4HBLA 2CSOA 1I5ZA 1JHFA 1SUSA 4ER0A 3ZMDA 4XUEA 1BKYA 1SFXA 3BWBA 1IW7F 3ABUA 4ZYEA 2ZTHA 3U9GA 3DMGA 3BZ6A 2BM8A 5D8LB 3TO7A 5D5XB 4JQFA 3FRIA 1X3UA 2YXDA 4ESBA 4MIKA 1SD6A 2QBYA 1LB2A 3F72A 1USTA 2R7DA 6PAXA 3KE2A 5AONA 3LCUA 4DZRA 1KXZA 3FZGA 4HZFA 3SVZA 1B1BA 1K6OA 3KQYA 3CO7C 4CO8A 5ICGA 4CICA 4ENKA 5DUIA 2E1NA 1U6GA 3DH0A 2EJUA 1MDMB 3EVZA 2MC3A 1RUOA 4L9TA 4GGGA 4ETSA 3BJ6A 3OFJA 4IV8A 5DCMA 5HILA 3ML6A 3B7PA 2FYTA 5BPIA 2HEOA 2YX7A 4UVBA 2Y0MA 2ZXJA 4R6WA 3BGVA 1XXLA 1O3QA 3KQQA 2PEXA 2AS0A 3IKTA 2O8XA 3TPZA 1D5VA 2AOUA 2ZBPA 3FYCA 4UNOA 4R8HA 2HOEA 1IM8A 4HC4A 5EHGA 4QTUB 4ON0A 4P7FA 5HZMA 1WRJA 3LECA 4MNUA 1P4XA 2GS9A 2JH8A 3JSOA 1ON2A 1KIAA 1K78A 1RIOH 2NP7A 4I0BA 3OPNA 1XB4A 4QPPA 5FA5A 4F84A 3Q5FA 3LCVB 3HCBA 2OYRA 3GRVA 4KIGA 5JHUA 5EVJA 3C1DA 5K0EA 3R0AA 3BDDA 3WG9A 4CZZA 3FYDA 3CVOA 4LK1F 1MDMA 2VBWA 1VLMA 5D6EA 2QVOA 5GM1A 2XYQA 1YUBA 3TQNA 5JFRA 1X1AA 3DULA 2PQ8A 4ER7A 2UZKA 3GRYA 2PX5A 2IVMA 9MHTA 4DCGA 4QQKA 5EMKA 2M5WA 4RTOA 2JG3A 4EJOA 4BH9A 3B3JA 3DLIA 4R05A 1U5TC 1O9GA 1ZAOA 1V39A 1YQAA 3M33A 4QWQA 1C0WA 1G60A 5GM2A 4WXCA 1IN8A 2C7QA 3NDIA 2P41A 1Z3CA 2EWNA 2DLLA 1OMIA 4I0AA 1RI5A 1E2XA 1YW8A 3SGLA 5DCFA 3F23A 2AZTA 3EMDA 3IV6A 4HH4A 1TLHB 2NNWB 2GAFA 4Y2HA 2TDXA 4OOIA 4WVLA 2HKXA 5KVAA 5LEKA 4Y17A 1KYWA 4LECA 4Y13A 3FPEA 2XRNA 3NEUA 2JHAA 1YFHA 4KDRA 4F85A 5BQTA 4HQEA 4O29A 1HXDA 3H3UA 2HWKA 1XGOA 3FXQA 5J6XA 4YIFA 3RPUA 3R9XB 3WGHA 3FPGA 3U2RA 3KQMA 3FRHA 1FX7A 2E7WA 1Z1DA 2Y48A 5D6FA 5KK1A 1BJAA 5CM2Z 5IKMA 5IT9Z 2H27A 1JQEA 4N9HA 4RVDA 4G9YA 2ZZKA 1JSXA 3M6XA 3FUWA 2WA2A 4HYEA 3PS9A 7MHTA 2VC1A 1QO0D 1SQFA 1SAXA 5EKXA 2KIFA 1NHAA 3CUOA 1DDNA 5BW5A 3UA4A 3SHFA 5L3BA 3GF2A 1R1UA 1TTYA 4QLCU 4O3MA 5FA8A 2FSWA 1Z9CA 5K5QA 2P3QA 3QP5A 4TV7A 2E5WA 5HDGA 4U7DA 4XUCA 5HDNA 4ESJA 1R00A 1YLFA 3GRUA 2XASA 1WG8A 1TW3A 2VBZA 1S29A 4UXNA 1F3LA 3QP6A 3UJBA 3E05A 2IH4A 3VC1A 3LBYA 3BP8A 2XVCA 3S2WA 3G89A 4X63A 3E6DA 5DD8A 3EEYA 2ORED 1PP7U 4EM0B 5DEQA 4P7GA 3CLOA 2HZTA 3G88A 2KRFA 1U8RA 5ILVA 4U7PB 3T0YA 3VEPA 2GPYA 1ZHFA 4OIOF 3C6MA 3K1PA 1QPMA 2JPBA 2VBYA 3K1NA 4KVZA 2Z9OA 2BGCA 2N47A 5F1RA 3HCFA 2PT9A 2DO7A 3DMFA 3O4FA 2QYOA 2OXTA 5FGMA 4EJUA 2JRTA 3L09A 2I62A 4EGYA 3AJDA 1QZYA 3UZUA 4Q5SF 5DM1A 1EH7A 1JTEA 1NV9A 2XHKA 2O57A 3LCCA 4E31A 1MJBA 2W24A 1QAMA 2JHCA 4HGZA 2H11A 2PY6A 3OE4A 3QV2A 3MWMA 3PLAE 1S3JA 5BMZA 2W25A 3LPMA 4AUKA 3G8BA 2ZNYA 1EJ0A 5FFXA 1P2FA 2DPUA 4RTQA 4PZJA 2M87A 2GXBA 3EVCA 3COAC 1WY7A 3TM5A 2FCAA 4P55A 3B89A 1OPCA 5LQUA 4I01A 2QE6A 4YV0A 2XGXA 2FNAA 5L3DA 3UJ9A 5EHIA 2VXZA 2AOXA 3VOEA 2DPDA 2ZZMA 3HIFA 3OU2A 3PFGA 2O6GE 2XYVA 3G2PA 3P9CA 2YSRA 3NDJA 4WK8F 3E6CC 4C08A 3B73A 1BOAA 3GWZA 1L3LA 3R6TA 3N4MA 4AZVA 2PG4A 1ZGAA 4FP9A 1U5TB 1R5HA 1J7KA 4FR0A 2ETHA 2OAZA 3O3KA 3WODF 3JTHA 4EM1A 1SD7A 2VZ9A 2D2WA 2UYOA 1TW2A 1H1DA 1HW5A 2F5CA 2VBXA 2G7UA 4LG0B 3BXOA 1IN6A 2FE3A 2QZ8A 5EMJA 3X0DA 1P6RA 4RAYA 2RVCA 4BHPA 4EVIA 5CVJA 2ZVJA 2HWVA 1IAWA 1QBJA 1V4RA 1RI1A 1T43A 4RWZA 2O05A 3FTEA 1KU2A 2A61A 2AXLA 5G02A 3T7SA 2FU4A 3KCCA 3UBTA 5J8CA 4POOA 2PWYA 2XVAA 4G6QA 1U2ZA 4RTPA 3KPUA 2HS5A 3KP3A 1BI2A 5HDKA 3TQSA 2CGPA 2IA2A 1IXCA 4IXAA 2ADMA 4RTMA 1XCLA 5KYGA 3T7RA 4PYNA 3T1BA 4FGZA 3DFGA 5D8KB 2IIPA 2L4AA 2DK8A 3FTDA 4KN7X 2PVCA 1G3SA 2VDUE 4WCGA 3ZMVA 5K0JA 3BOQA 5DDGA 4HF0A 1J2XA 2A07F 2EX4A 3KR2A 4LG0A 3RYRA 3GRRA 3LFKA 1D3YA 3RYPA 5K8VA 4HG2A 3ZN0A 2V6CA 4YFXF 3MAGA 3R0QA 1WQ2A 2IW5A 3G5LA 3I9FA 4C06A 4E2XA 5HFJA 1O54A 5EPEA 5E9JA 3GFJA 1S6LA 4P9FA 3K69A 2UXXA 3M4XA 4CYDA 4BP3A 1XVAA 2BM9A 4MQ4A 5GWXA 3QOWA 2JSCA 3ANXA 1JQ3A 4HA8A 3C3WA 4IRGA 4LB6B 5K05A 5CCBA 3F21A 1FPQA 3KP4A 4BLVA 4QVKA 2R3SA 3G5TA 3CUQB 2YPRA 3EYYA 3FUVA 1EQAA 2IPQX 2VOPA 3GFMA 1HKSA 2DQLA 2JH9A 1UB9A 1T98A 3LSTA 4M72A 3EVAA 5K09A 1ZG1A 3I71A 4HQMA 1IN5A 2EB7A 2PWPA 3KP2A 1HW1A 5L3GA 2QQBA 4M7RA 1U3EM 5E9QA 1GXPA 1OYWA 4PYLA 4PYQA 5BPDA 3K0LA 2FA5A 1VP9A 3HHGA 5DTRA 1UHMA 2BBYA 2KW5A 1Q1HA 1RJGA 3R24A 1Z7UA 3RIEA 4OX9Y 2L54A 2G72A 2P1DA 1QQIA 4L7VA 3V7SA 3PT9A 1KU3A 5FTWA 4RS8A 3R60A 1SFUA 1FBNA 1O3SA 2ZMEA 1IF1A 5BS6A 4R6XA 1ZYRF 2PN6A 2Z99A 3KZYA 1FSHA 4RVGA 1G3TA 1LDJA 1RZ4A 3HCEA 4BLWA 2K02A 5LGTA 2ZW9A 3KLOA 5FD6A 4M37A 4M71A 3KQPA 4GC9A 3QOPA 1WKMA 1G55A 3CUQA 4ZYHA 4OIRF 4IHSA 3KPYA 4MTLA 4BP1A 2F8LA 3NMUF 4QVGA 1TQIA 5GOZA 1Z05A 2O61A 5H02A 4XBFA 4HDVA 1Q0SA 3LAJA 3AXSA 5C1IA 3VFZA 1RJEA 2AR0A 3GJYA 1FBSA 2BYVE 4NQWA 5K5RA 2Z6AA 5FLXZ 3BPXA 2EJTA 4UHTA 2IH2A 2PXXA 2PX8A 1JSZA 3PQJA 5ICEA 3KQSA 3M7GA 4OMZA 4ENMA 1XGSA 4PCQA 1NE2A 4XSZF 2YQZA 1WWXA 3RW9A 3ECHA 2X4HA 1QAOA 2R6ZA 4AIJA 4CKBA 3JWGA 1NT2A 4PGGA 3SSNA 4KIBA 3A7EA 4U88A 1NW8A 2ACJA 3BROA 3O2PE 1LEAA 3IWFA 1ZG3A 1SFEA 3L7WA 2RGVA 5T64A 3EDPA 1BN5A 4DQ2A 4XUDA 2J5OA 4DQ0A 3J80Z 4L9JA 4ER5A 3O6BB 3R4KA 1BIBA 4MGRA 4IWNA 3BJOA 3T7TA 3HCCA 2LF7A 1R1VA 4DCMA 2HYGD 2ZJ2A 1RI4A 4YIIA 3KP7A 3J81K 4CKEA 1YW7A 3KPJA 3KU1A 2ESHA 4P58A 1OYYA 2A6EF 3HRUA 2RQPA 3IC7A 2H6BA 1W5SA 2YXEA 5K0NA 2L02A 2QUFA 3EVFA 3WTYC 3IHUA 2P8JA 1JGSA 4LWOA 2XAHA 3SXJA 3EMBA 3FUTA 5K0BA 5GP1A 3F6VA 5E1ZB 3P9NA 1BC7C 3TFWA 2GIVA 3IHTA 4G7ZF 2VOOA 4ZTBA 3TOBA 3VSEA 4BHCA 3HRSA 1J75A 1X19A 1O7FA 3NTVA 2JTVA 3LKZA 3HCAA 5HIMA 2YTZA 3HNRA 3TMAA 3J7AO 2JZYA 3GO4A 5K1YA 3A27A 2NYUA 1XSVA 2ZNZA 3GNLA 1XMAA 3R61A 3TGNA 2Y1XA 3G7UA 5J8FA 3MZHA 4BHBA 3SFZA 4Q4ZF 3S68A 5L3CA 3PQKA 4IVNA 2DTRA 1B4AA 2GA1A 3CDHA 3V8VA 3F8NA 4QTTB 3CJNA 2STWA 3LL7A 1QYRA 5GIPE 2Z6QA 2E7XA 4P9UA 4RGRA 3HOSA 3G73A 1FYLA 4X60A 5D4SA 4ZYDA 2IRFG 2PJDA 3ELYA 2OZVA 4RSRA 5FB2A 4GOLD 3P2EA 4HF2A 4PINA 2IGTA 2HMYB 1VIDA 2VP3A 3JTGA 4YUXA 2FBIA 2ZBKA 3LWFA 3DQVC 3HM2A 2OPBA 4QQNA 1CGPA 2A14A 4EJVA 1LDDA 3LDUA 5D4RA 2LKPA 3DXYA 2M30A 3V8KA 4E70A 3HTSB 3FTCA 2G70A 3LA7A 3KQTA 1F9NA 1N7IA 2PJPA 3GFLA 2MLKA 4WF2A 1YF3A 4UV8A 2YX4A 1FBUA 1F38A 5DPMA 2H94A 2UWMA 2PFBA 2JJQA 4Q48A 5DTQA 3FWEA 4V0QA 4FX4A 1M6EX 2HTEA 3E6BA 3UWPA 2FPOA 2V7EA 4N9IA 3DKWA 5AIQA 2OA4A 4A2UA 3HRTA 1RJDA 3FX3A 1KQ8A 2M45A 3ZMTA 2P7CB 2L3DA 3RI4A 3T0IA 2V79A 1K7AA 4KYWA 2MD5A 1HKQA 4L0YB 5HIJA 2EFJA 4PDKA 2V1XA 1MJFA 5E1WA 3L2CA 2CO5A 4EJWA 2NXEA 4EK9A 4MTEA 2ONYA 3AY0A 3FXRA 1L3BA 1KP9A 3DOUA 3IRRA 1XCBA 2KIMA 4KDCA 4EQQA 2HGCA 1F1ZA 5CUQA 2NYXA 3TO9A 1H0MA 2GB4A 1XDSA 2XKPA 4NHJA 3OOPA 2IA0A 2ZCWA 4M6YA 4OA8A 1FLIA 2C6YA 2Q0OA 1NW3A 3F8CA 5DUKA 1QANA 1LEBA 2AOTB 2GAUA 3GVAA 3SZPA 2WWYA 3E3VA 5EIFA 3ZP5A 2E1CA 4OIPF 1FBQA 2OBPA 4MTDA 1PJZA 3JSPA 1EH8A 3DV8A 4I2OA 3ROUA 3JAMZ 3CGGA 3MTIA 4U7BA 2PX2A 1DPRA 1S8NA 4PWYA 3CTAA 1JXSA 3MCTA 2PXAA 4FT2A 1ULYA 3ECOA 2YVLA 2BH2A 4LGWA 3HTUA 5H6RA 1OKRA 3KR1A 2ZCJA 4G94A 2R7FA 4EGZA 2FXAA 5FQOA 1R8YA 5KS2A 2W84A 3U81A 2XBMA 2G71A 3OZSA 5ICCA 4RGXA 1SD4A 4YFNF 3G2QA 2O0YA 2FMYA 2PI0A 4G7OF 3KETA 3ELKA 1EAMA 5JVTA 3FUUA 1XCVA 4K6MA 2CW0F 2CFXA 2HR3A 4GOMD 1PP8F 2PBFA 5L3EA 3P2IA 4CTJA 5ED4A 4HTFB 4FSXA 4A5NA 3F3XA 3ELWA 3OU7A 1YFJA 4GEKA 3K6RA 3KKZA 1VE3A 1O9HA 5DXJA 4HAMA 3THSA 2NRAC 3BGIA 1NW5A 2QRVB 1INLA 3ZMSA 5K03A 2RN7A 4AVPA 1FYMA 3FMQA 2P5LC 3ID6C 1MGTA 1IY9A 3JWHA 5FFZA 4M38A 5DXAA 4E2ZA 2FQ3A 4V0RA 2NNNA 2YUIA 3HYIA 1R23A 1IUYA 2HV9A 5ILUA 4R8RA 4BAYA 4ER3A 4KIFA 4L9VA 1DCTA 3ISPA 3QAHA 2CWWA 4GO1A 3E5UA 5F2NA 3FTFA 4N0BA 2CG4A 4PGHA 1YFLA 5F64A 5IT9K 5AIPA 5BP7A 1G8AA 3UJ8A 2VDWA 1ZH5A 2Q8KA 1KU9A 1L9KA 5BOXA 2C7PA 5KQRA 2AVDA 2H00A 5CVVA 2B78A 3MHTA 2QM3A 3EPPA 2LD4A 4L5IA 2DPMA 2ZWAA 1P4WA 4H0EA 5CVRA 1NW6A 1LQ1A 4JBAA 1ZG5A 2KJCA 3NW9A 3BWYA 1HSJA 4KUMA 2GA2A 1B9NA 1IRFA 2X0LA 1I1GA 1OR7A 4IHTA 5C9ZA 5LRRA 3KPVA 3PB3A 2OZ6A 2XAFA 2V1DA 4GUAA 2P5KA 2PLWA 5D1HA 4P5OA 4PYIA 3BWGA 3C7JA 3O7WA 3QU6A 3FM3A 3EVGA 4C05A 3EETA 2A3SA 1VTNC 1R6AA 3M9AA 5H6QA 2D1VA 1ORHA 1REPC 1DPUA 3LX6A 3OV8A 1G6Q1 4RTJA 1L3CA 3C0KA 4QDJA 2CMHA 3MB5A 3E5XA 4R79A 3RIRA 1JG1A 3RKXA 1FYKA 1F5TA 3NQOA 1TQPA 4AIHA 3ME5A 2ZWVA 4CWAA 1XDUA 4QPNA 3B3FA 2HDCA 3GW2A 3WU1B 3WTUC 4YG2F 3LKDA 4XLNF 4RB0A 3B3GA 3GX4X 1D2HA 5EEGA 2AS5F 4FX0A 5F6FA 3FPJA 4E2YA 5LLQA 3HVJA 4HDUA 1KPIA 5E17F 4AWXB 1R7JA 2HQRA 1QNTA 3IKVA 4EM2A 1D8JA 1JR4A 5BXYA 3I59B 1R5GA 5TJJA 1JTFA 1EH6A 2PGXA 4NECA 4KWCA 2ONZA 5EG5A 2NAZA 5K5OA 4BNCA 2H09A 4LLNA 3AWIA 3G8AA 4IPAA 4Y15A 1T39A 3WTSC 3NWEA 5DRYA 2NNYA 1TNTA 3I53A 2CKDA 4CDGA 1M6YA 2IBSA 1ZKDA 1DL5A 3HA7A 2XIGA 5FWDA 1WXWA 3I5UA 2MH9A 2EFPA 2V74B 3TR6A 2UZ4A 5EC8A 3QOXA 2F5FA 4MEXF 1SUIA 1JG4A 3HSEA 1JHHA 5FHQA 2OQGA 3VC2A 1XSDA 2NP6A 5JI6A 4A12A 4KFCA 4KN4X 3IRQA 3HOTA 1U5TA 5DV5A 2XAGA 2FK7A 1ZRCA 2G8NA 2XVMA 1P91A 4C04A 1TPYA 3W6KB 2P7IA 3C18A 2FOKA 2OB1A 3E8SA 4E33A 2WTEA 4Y30A 3D0SA 3SZTA 4KA4A 1KA8A 2BR5A 3ZN1A 4L0ZB 2HFHA 1IZ1A 3REOA 3OZRA 5D5WB 3R6SA 1R36A 1YYVA 1KU7A 4I09A 1YZ3A 1SKMA 3O31A 3BWMA 3Q87B 2QQAA 3TKAA 1ZQ9A 4BXUA 1IRGA 4UV9A 3CJTA 2Z33A 4L5JA 2IH5A 4KW7A 1O3RA 3FUXA 1AV6A 4M6XA 4RV9A 2I7CA 3VYWA 4OQEA 3F22A 1YTYA 3LDGA 4PCAA 2YR0A 4ASNA 3WTTC 3OU6A 2CL5A 4X61A 2NXJA 5GINE 4Z2YA 1RI7A 1BI1A 1ZN2A 4M9XA 4PYJA 1X1BA 1CF7B 2G7HA 1W7PB 3NVKI 3L8DA 4AIKA 2QENA 1JG3A 1WZNA 1N2XA 2HQNA 4U0YA 3WTWC 2MA3A 1AWCA 3PX2A 1KGSA 3RTRA 2AOWA 3UA3A 3I54A 3QPTA 1B42A 2JHPA 2KIUA 4GCVA 2OB2A 4YUWA 3GEZA 2XAQA 3P9IA 1SG9A 2NXCA 1DP7P 3WTVC 1IN7A 4PCLA 2ERCA 2VN2A 1PDNC 3GCZA 1D8KA 5EMLA 3HVIA 3P8ZA 5CIYA 3MFKA 3MERA 3KQVA 3PTAA 3QRFF 3TDUC 3DLCA 2RV8A 1Y0UA 2WC2A 1G6NA 5HLIA 1W7PD 2EFNA 3THRA 2K86A 3GUDA 1QGPA 5CYVA 3PX3A 1BHJA 1P1CA 4OQDA 3GGDA 4A0XA 4LK0F 3RKYA 3AAFA 1N7JA 1P1BA 2PMHA 2UXNA 1CF7A 3UJ6A 4XLPF 3FMSA 5LRSA 3H3ZA 1QAQA 2DI3A 5TRDA 4CXMA 2DW4A 3ULQB 1J9IA 4M9ZA 2D45A 3QU3A 1XSXA 2CWEA 5LR6A 1MZBA 4ZH4F 1B9MA 3V7CA 5KQSA 1R22A 2NXNA 4CGZA 2HTJA 3J81Z 4K2EA 4IRHA 4E30A 1XGMA 2LDUA 1YO5C 3RDIA 4KMFA 1VL5A 3GLXA 5A2QK 4QDKA 5FHRA 3ZPLA 1GVJA 4A0ZA 4YUZA 4UOEA 4HGYA 5K0FA 2JPCA 2EFQA 4H0NA 4EJTA 2MH2A 4MQVA 2KKOA 4CHUA 1O3TA 2A68F 5T6BA 3E97A 4ZZLA 5FQNA 5EZSA 1AQJA 2O07A 2P3OA 1EIZA 3DP7A 1DUXC 3D2LA 4IRIA 1W4MA 5LGUA 3KHKA 4AX8A 5LQCA 1ZRFA 3LAPA 4DA4A 1NBHA 4FZVA 2ZO4A 1YZHA 3DR5A 5CVIA 2P3LA 4X1OA 3C3PA 2BR4A 2Y75A 3JWJA 1ZLKA 5DSTA 1E17A 3WTXC 3UFBA 4DM3A 5HS7A 1U78A 1FOKA 3FM5A 2B3TA 2V1UA 1XGNA 5P8WA 2K4MA 1X1CA 3A26A 1QZZA 2LF8A 3CJQA 2EV5A 3PVCA 3HCDA 2EV6A 1JE8A 4RX1A 1PUEE 2QBYB 1FNNA 2I6GA 2YX1A 2OO3A 3ELUA 1VPTA 2PXCA 3KEOA 4YUYA 2ZIGA 2K7LA 2Z5UA 2DT5A 1NV8A 2UYHA 3TM4A 1S7OA 5HOOA 2W85A 3BPVA 5HEKA 4EV0A 1Z6TA 4MQ9F 4KMUX 2ZFWA 3P97A 2B0LA 1SD5A 3WE3A 3I58A 1UFKA 1O57A 4G8XA 1RNLA 4ZZDA 1ZARA 5DCMB 3RJPA 3UJDA 4EQZA 1MJAA 5CVUA 5DM4A 2FRXA 2ZFUA 2C7OA 4O5VA 2O03A 2HTSA 2AOUB 3DEUA 3HVKA 3IEIA 4RAZA 3U1DA 3EQLF 5CCXA 1IXSB 2CYYA 4DNCA 2CMGA 2B2CA 2QLZA 2FK8A 3BWCA 1IN4A 3G2MA 5E1MA 3VODA 2IP2A 3Q9VA 4GOND 5U4XA 1K78B 4F86A 5LQRA 5DRTA 3M8EA 5EZQA 3B02A 2DULA 3A7DA 5LQAA 2Y1WA 2FBHA 5LSAA 1DUSA 2PBIA 1I4WA 1VBFA 3DXJF 4D0PA 3K2ZA 5E1BA 1GHCA 4P7JA 3BY6A 1L1EA 4AD9A 4ISCA 4XCXA 1R18A 1SQGA 3DUWA 5E1XA 3ZMUA 1LDKB 1UHWA 1LJ9A 5LBQA 3ER8A 4IV0A 3ZMZA 1I27A 3DPLC 5DTMA 2VE9A 3LGAA 1IXKA 4HLXA 3TRKA 4HRAA 3HSRA 2GWRA 1WSUA 5EEHA 4OBWA 5DX0A 1MD0A 1EV7A 3HSFA 3GFIA 3ER9A 4F7ZA 1YIOA 4P96A 4UVCA 1BC8C 4JXJA 4AZSA 1KR5A 3L00A 4L9NA 4YMHA 1I1SA 3A25A 4LB5A 4U0WA 5E1OA 3EVBA 1HMYA 2FHPA 4LJZF 3HRMA 1YS7A 2J5PA 2XROA 4C07A 2OQRA 2EFOA 1R8XA 5DX8A 3ABTA 2M1BA 4I98B 4KDPA 1U2WA 2OD5A 1OYIA 2FBKA 4HV6A 3OZTA 1KQ9A 5FO5A 4GYGA 4BYYA 4EKIA 3EYIA 1FP2A 3G2OA 3HA3A 5HS9A 5DSXA 2ADUA 2YU3A 4BQAA 1VP3A 2DQRA 3EVEA 4G56A 5EKUA 1XDZA 4MEYF 5CD1A 5LQJA 3Q9SA 2JT1A 2B25A 2AN4A 5B1SA 5K01A 2FNPA 4RYLA 4YV1A 3HHHA 3QPHA 3M70A 5EMMA 2RDPA 1BM9A 1D2GA 1T38A 2YR2A 1FC3A 2OZUA 2FEZA 3KFWX 3FPFA 2AN3A 3SSOA 1G4DA 1USSA 2BV6A 2EK5A 4HF1A 2IJLA 4WXHA 2H1RA 3HP7A 1BI3A 4RTKA 1LNWA 2FMLA 2DBBA 3G3ZA 1AQIA 2ZSUA 1BOOA 3H2BA 1FSEA 1NKVA 4GBED 2RC4A 4OINF 1YS6A 4BLUA 4RGUA 4OMYA 5HIIA 2IT0A 3BUSA 1UFMA 5LHIA 5DT2A 2AOTA 3LHDA 1G3WA 4M74A 5FWAA 4Q47A 3EEOA 5HLHA 4GQBA 4EMSA 2CQKA 4GYIA 2ZLBA 1Q0TA 3C3YA 3MGGA 1I6XA 1L0OC 2XUBA 3JAMK 2L4MA 3IL2A 3HUGA 2WA1A 3AXTA 2GLUA 3NWBA 3FZVA 2ZIEA 2O06A 1UWVA 4RB2C 3D5LA 1TNSA 4M36A 4IF4A 1KPGA 2G9WA 5FULA 2M8EA 10MHA 1A04A 4RVHA 2IDKA 4ENJA 1V3FA 4RTNA 2C7RA 2K4BA 3P71T 3EGIA 2ZZNA 8MHTA 1M0EA 3K0BA 3LQQA 4YFKF 3KR0A 2LSOA 2HKOA 1HW2A 3R3HA 4NB5A 5ERIA 1XTPA 5K0CA 5ILSA 5LEJA 1KHHA 3HA5A 4I02A 4OU0A 4FT8A 3LDFA 4DKJA 3JW4A 2QWWA 4HTFA 1XN7A 3M6VA 3M1EA 1WS6A 3TOAA 3F4KA 4PYOA 1R74A 1YB2A 4R1HA 1UCRA 3MCZA 3RPQA 3DMHA 2MBFA 2EFWA 3CUQC 4PYKA 2ZIFA 2RNJA 3SMQA 2P4WA 2OBFA 3L9FA 5T67A 3EGEA 3ERED 2BEOA 3UJ7A 2QRVA
chains in the Genus database with same CATH superfamily
3U16A 1P2TA 4PPNA 1WDMA 1WIWA 3JQRA 4G6DA 3KB2A 1YXMA 2JFYA 1H9GA 3TIVA 3VNVA 3RFFA 4IILA 5AHRA 5KX5B 1SD2A 2HJVA 1WI9A 2PEZA 1ULHA 4CUKA 1MTZA 4MQMA 1JYFA 3N3AC 4B45A 4BKOA 1G3YA 3T1QA 3ZHYA 1S1MA 4KT5C 5BWNA 2GXGA 2OTJI 2XC7A 1CTQA 3W7VA 3AQ4A 2AHQA 2IUFA 2C4KA 3UC9A 3MZYA 2R8BA 2A9VA 1VQLI 3MJVA 4RGSA 2GEFA 3TIFA 3ZVMA 3PIDA 1YMVA 3MK31 5CHYA 1GCGA 4NCAA 1YQUA 2EZ4A 1IBKB 3BGDA 1U2DA 4H7EA 3RODA 1TT5A 4GGOA 4QUBA 4D5EA 5E8RA 2VF7A 2ZQ5A 4KE9A 3PJRA 2WHRA 4EY7A 4U7FA 1LPOA 5I8WA 3SXYA 1E2IA 1YS9A 4ZU1X 3KE8A 4AWXA 4TXNA 1RHJA 4CR8A 3D0QA 2VKEA 3F49S 3V2GA 1Z8HA 5EG0B 3I32A 5JCJD 4IX7A 3SK0A 5IKOA 4PNPA 5AUNB 1WUTA 1MTOA 4OXNA 4PPGA 1FTZA 1JLKA 4F5ZA 4C4AA 1FEXA 4EO9A 3AG2H 1P8JA 3CH7A 4GRAA 2EWWA 3CIFA 4FYXA 2CJYA 1EKEA 1GZVA 5ICSA 4OQLA 3UNGC 3ZG6A 4RJJA 1IXRC 2ELJA 5CVEA 4HP8A 4B3SB 2ZRQA 1PJSA 1S7CA 1J59A 4AMZA 4CZCA 1K79A 1DP3A 3SQXA 5HPYB 2G5CA 2HIAA 1QWSA 5K0LA 4GKAA 1E1QD 1Z18A 1HL7A 2JIOA 2QRPA 1LE8A 3E8XA 2J5QA 3INGA 1FJLA 3VKHA 1ZM4A 3M82A 3VZPA 4PZDA 1U9ZA 2KP6A 3W6UA 4HNQA 4LCBA 4AG5A 3G1LA 4NENA 3Q3IA 4ENNA 4FMCF 3NFYA 4ZVKA 3NC1C 1FJGB 4G85A 3QYFA 4MLOA 1Z0SA 4UUVA 1Y98A 1VLJA 1J90A 1NBME 1JE1A 1FSZA 4Z4HA 4GICA 1MB4A 5E2BA 3TW8A 1MAVA 5K3EA 5BR1A 1L7BA 2MYNA 2Y0EA 5FD5A 5FL3A 4QYTA 1QH1B 4C5CA 1NASA 1QG4A 3HXOA 3ZDRA 4B3TB 2YMLA 5JUWA 1BIAA 1FT9A 3OLYA 3MINB 4S04A 2C98A 2BGGA 3QVGA 5CXUA 1TZCA 2HBQA 3NLLA 1IBRA 2HA6A 5K7SA 5TISC 1FDTA 1WMFA 1EFVB 3E0QA 3NC4A 4PV7A 4FQ5A 3GP5A 1CUJA 5FP0A 3TOVA 2BW3B 4JL5A 2WK1A 4OXKA 4WSOA 4X0EA 4KICA 1QH1A 4MR9A 1NXWA 5M2QA 5IYZA 3KALA 4R8SA 3WU0A 1H89C 4ZO7A 3BBPA 3RBZA 4Y3OA 3QEOA 3EUHA 1STOA 3D7RA 1O87A 1WVIA 2WTMA 3PXEA 3DMGA 4AM3A 4H2DA 3HJTA 3FIJA 3OCZA 5EPOA 2YXDA 2JVKA 1VQ9I 1W34A 1E59A 3NFRA 2MJLA 1GO2A 4HZFA 4ABTA 3ZI4A 4OCZA 1N5DA 4YRMA 1V7PC 5ICGA 2FSSA 2JH3A 4BGUA 5CJ2A 3M1CA 1I9CA 4II2A 4C0KA 4PW0A 2I1WA 4DUYB 4G0YA 3CUSA 1QGAA 3U3KA 2SECE 2HEOA 5HFNA 3EGDB 2JBWA 3BGVA 3V4FA 4S0XA 1WTCA 2HOEA 4HYYA 4CEJB 4ON0A 5DN9A 3K9NA 4J0CA 5HZMA 3GLUA 1QH0A 2CLOB 4XE5A 3LCVB 5JNUA 2AQFA 2NZYA 3FZQA 4ZQGA 2BSQA 1V3QE 3UGKA 3NG1A 3OZFA 2H5JA 3NRBA 2LKDA 5K0EA 3R0AA 2JQ7A 3GZNB 2PWZA 4CZZA 1O6CA 5DI3B 4FZJA 5JY1A 3JYQA 4D3ZA 1P9LA 4J3FA 4GKKB 3GRYA 3EGDA 3TDNA 2R7XA 3P5SA 4RTOA 4EJOA 1ULSA 5EE9A 3GWGA 4CEJA 4H31A 1V39A 2NLOA 1IN8A 5EHXA 1E3EA 4YBRA 1BXGA 1JLRA 1FLDA 2CNNA 4AKEA 1RWOA 4B7CA 3G59A 2H0AA 2TYSB 1OLXA 5DCFA 1Z34A 2RKBA 3NX4A 4TT3D 4JNCA 4MWTA 1PAUA 2IZZA 4J1QA 2CXNA 1GPJA 1G3UA 3NEUA 1VE1A 3K2IA 4LKRA 1MDBA 3TI9A 5L7WA 2IYAA 2P2NA 5F3DA 2B0JA 1BA2A 2HF8A 3KAPA 4NR0A 4IW3B 1XZEA 3DVSX 4WY8A 2GBYA 3EPHA 5D6FA 1JKPC 4ZV9A 3S81A 4N9HA 2JI6A 4X97A 2A1UB 3TRDA 4I8XA 1HF3A 2J3KA 3NNDA 5E3MA 4YRZA 2RC5A 4EYGA 4B5LA 5TJHA 3U4MA 1IUFA 5FA8A 4NPAA 2PUGA 1Z9CA 3DZKA 1RWNA 1TOAA 2Q99A 1ZUHA 5HDNA 4NQZA 3NBFA 3RRZA 4DJ5X 1RKVA 3EEYA 1JMVA 1Z21A 4DV3B 3EZ2A 3U44B 2DKNA 2SKCA 2CMFA 2FZ4A 2KRFA 4U7PB 4BLPA 2ODAA 4PLZA 1Y7LA 4Q4DA 1ZIPA 4DDTA 3JW8A 6LDHA 1V1RA 2JRTA 3L09A 3K30A 1D4FA 2Q1ZB 1A96A 1WY5A 1K6XA 1OBHA 1MJBA 3WL4A 3EZLA 4NTZA 2VI6A 4HADA 3OZDA 4FWTA 4M0MA 2IHZA 3OC6A 3RADC 3ZHCA 2VR1A 2CL7X 1OLUB 4PZJA 1IG3A 3T4XA 2I66A 1SU8A 2JIRA 1KO4A 1Z67A 4LXGA 3GCDA 4BC0A 3VWBA 3UJ9A 3W2EA 3GLQA 2RGGA 2I6XA 1O95A 4OQZA 2NAPA 5ECDA 1JA1A 4AROA 1CUWA 4I6JA 3P9XA 3E6CC 3B73A 3BL6A 3R6TA 1JJBA 5AXAA 1U5TB 3QE2A 4EEFG 1IEXA 3L40A 5IFLA 3TG8A 2WIFA 3CNOA 5DI9A 4CF6A 1U7WA 2DQ4A 2CKMA 3SYTA 3R8FA 3DO8A 2FE3A 3CA8A 3DHYA 4YP1A 3QTBA 1O94A 3FHNA 4L2IA 1NATA 1RI1A 4ZOEA 4RWZA 3EUHC 3E22A 4LJ6A 1MFZA 1C4OA 4L76A 3TNLA 4FB5A 3F2IA 2XQFA 5ADVA 5DBEX 3GLLA 1NL3A 1DLIA 5DHTA 4YMWA 1FW8A 2H1FA 1UBUS 1BMFD 4MWCA 1V4BA 2DK8A 3MWEB 2XODA 3WLJA 2AI1A 4M0LA 3WK7A 3BOQA 5DDGA 3Q98A 2QEXI 2C20A 2GO1A 1XQYA 1QHNA 1K6IA 1Y5IA 2PZ8A 4M88A 5F5LA 4YXFA 4MRNA 1JJ7A 1BQ4A 1JUDA 1O54A 3GV0A 3K69A 2UXXA 1X7ZA 1XJQA 1XVAA 2BM9A 4MQ4A 3RAEC 1JZQA 1SKUA 4O4IA 5GWXA 4DEYA 5E7MA 4BO3A 4Z4EA 1B73A 2VP0A 3LOPA 5BXQC 1W4BA 3PUIA 2P9TA 3IDZA 1HGXA 2H3HA 2GVDC 1O97C 3EQ8A 4QBIA 4DV4B 4B73A 1XVLA 2L9VA 3EVAA 1XRQA 2YV1A 3L6BA 1S3FA 2P9HA 3JS5A 4FUTA 3UMFA 2YRWA 1HW1A 2GVZC 1JEAA 5LIPA 5BPDA 2FA5A 2VHWA 2VASA 2JCYA 4EG1A 4BRUA 3W6VA 3U7QA 5CB6A 1PHRA 1C1XB 2WP8J 1J8DA 5FTWA 3T6KA 3GAZA 1O3SA 4ZQIA 2R7ZJ 2JCVA 3RAJA 5FD6A 3O21A 3KQPA 1IY1A 4DR5B 1B43A 2A59A 2YY5A 5KVSA 2RNGA 5BURA 4CQJA 4IX9A 2MCFA 8OHMA 5I3ZA 1FBSA 4G63A 2EJTA 4BNLA 4TYMA 3CX6A 1P1HA 1U0LA 3PQJA 4HXYA 3V00A 1CR0A 1ZKGA 1LI7A 2E1RA 3IJEB 4ZT2A 1AKEA 1SKAA 2OK7A 3FLBA 1TD1A 3NWTA 4NYIQ 3W4IA 1P2SA 1TDJA 4BJ5A 3M3DA 2ZUCA 2QR2A 2JANA 3LPAA 1YBMA 1W46A 1BN5A 2C95A 1L5VA 3L0DA 3ZY5A 1Q14A 4PEVA 3R4KA 2P9FA 3BC8A 6AT1A 4FHZA 3DEHA 4RA6A 1IYZA 4CG1A 3EW7A 1WPRA 1X1RA 3H36A 1PJRA 2BJWA 4EJ6A 2PMKA 3LP8A 4EGQA 2J7PA 4Z0NA 3I9KA 1MIOA 3E7LA 1KBQA 2TCTA 1KAQA 4F3QA 3C3BA 3DV0B 2O3QA 4YVFA 3TOBA 3A4MA 1TUIA 3GLFB 2JTVA 3CZCA 3LKZA 2HRBA 3BXXA 3RSGA 3RYCA 4H1TA 4FEGA 1A9XB 3WE7A 2NYUA 2JVIA 3KJQA 1KZGB 5EE0A 5P21A 3G7UA 1A5AB 3PEYA 4X1IA 1NVUQ 3S68A 4F71A 3IV7A 4EB6B 1Q1VA 4AMBA 1UJBA 1AKTA 3WB1A 4B3BA 2LCFA 4HY3A 1GYQA 1C7EA 5KINB 2IBMA 2IHNA 1EEHA 4CH7A 2HNHA 2STWA 5CPFA 4JX6A 3L8GA 1Q1AA 3N8IA 3WKBA 4CRWB 1DAKA 2PJDA 2PRZA 5TARA 5BT8A 4KXWA 1ZK4A 3AP2A 4PAQA 3C3CA 1XJCA 5C34B 1E6EA 2BCEA 3HM2A 2VDMB 1S7GA 1VPWA 5AWFC 3AG6A 3KYCB 1XBTA 3UJPA 1VB3A 3JWEA 1O95C 5FAKA 4L8WB 1NQUA 2WFLA 3WZMA 4I6EA 5CXXA 2VZ8A 2PAFA 4IKFA 1Y3FE 4V0QA 3LXRA 3DKWA 2EKDA 2D7DA 3PGMA 1T2EA 1PCXA 5B2EA 1TM5E 3LO8A 3ZGOA 4L0YB 1ZDMA 1S8AA 2H9YA 2CO5A 4WUVA 3FXRA 3ONVA 2AJDA 2ILVA 3TVDA 3RTBA 5JQWA 4OB6A 2I6QA 3O8HA 2ZIXA 1DAIA 2C6YA 1TZJA 2WE8A 4JVMA 2JK1A 1LQ2A 2QPAA 4LC1A 4XTRA 2OBPA 3WMXA 1Z38A 3LHFA 2YHUA 4IRXA 1B8VA 3O73A 3V8NA 3CZ6A 1SXJD 2GN0A 2YVLA 5I4BA 5H6RA 1AU7A 3LIPA 4DUGD 2FUKA 5F08A 2FXAA 2XSDC 4E13A 2XBMA 3W8RA 2V0NA 5ICCA 4D79A 1JIIA 1XCVA 2OHIA 3IIIA 4QDXA 3N28A 2OUKA 4EHIA 2DJ5A 3AV0B 2XLCA 1WPKA 1TUGA 5SV2A 3WLPA 3R7WA 2VDWB 3PDIA 5FT9A 4KWTA 3B2EA 1TUBB 2HSDA 1O9HA 3SE7A 4RK7A 3OF5A 2GEJA 2W0MA 2HDDA 5DNAA 3OE7D 2QT1A 1II8A 2XTJA 1DQUA 3W34A 3UBMA 2X51A 4I8DA 4FILA 4X64B 2IOHA 4NU5A 4D4GA 1YFLA 3L41A 2Y31A 4XLCA 4YCCA 4J4HA 5HBRA 4KUGA 2HT6A 2AEJA 1XRRA 2VDWA 3GFRA 4HSRA 4LXQA 4YMTA 4OXIA 3RS7A 5BOVA 3QQAA 1UM9A 2DPMA 2HU9A 4AW9A 4B85A 1A7AA 3BWYA 5IAKA 1A1VA 4IHAA 1B9NA 3B20A 1V8DA 4NESA 3B6ZA 2BJHA 5JADA 3VU9B 4DT1A 1OFCX 5AVWA 1UC5B 4G81A 5TQ2B 1NRXA 5F12A 4XUGB 1AZSC 3O7WA 3H05A 2D3TA 2M7BA 1VJRA 1OB5A 2ET6A 4RMHA 4JT4A 3QWLA 4BJ5C 4E6EA 5PNTA 1OXTA 3MB5A 4M7OA 2O5EA 3KZ1E 3O3MB 3NQOA 5TIIA 2VLBA 2WJGA 2C8LA 1ZR4A 1M1NA 3LKDA 2QR5A 1CZNA 4PO1A 3GR6A 1E2QA 3TLMA 1H1TA 3AEKB 3VU9A 3U60B 5I51A 1R5GA 2YJ6A 2P75A 4N6NA 4KTTE 3CR3C 2COEA 2B1QA 4Y15A 4WFQA 3NWEA 1Y1QA 3I53A 1GRVA 1GTVA 3R0VA 4MB6A 2HBRA 3A6GA 4I9GA 5FWDA 4FFVA 4K86A 1Z07A 4TVOA 3QUBA 3BULA 4JV5B 5DEOA 1JHHA 1UPTA 3WHKA 3U5TA 1Q6YA 2HFJA 4CMIA 3JASB 3BR5A 1IUPA 2WTEA 1JYEA 3D0SA 1TM2A 5IPAA 1MEOA 3C7DB 4JDUA 3RANA 4EKDA 4LDZA 2BWJA 4H35A 3WSVA 2AFIA 2H07A 1RQ7A 1OXBB 4BXUA 4L22A 1Y9AA 3PJFA 2Z33A 4GSYA 3HU5A 3NBMA 1NVMB 5IYCJ 3DGEC 4Q1AA 2WLTA 1PTKA 3CJRB 4YAWA 1E66A 2CL5A 1ZGCA 3OG9A 1H0HA 4UBNA 5A04A 2R6AA 3IOEA 5DTIA 1G20E 4A8PA 3OIDA 1EFAA 4BY7J 2EINH 1C4XA 3BL5A 4HH0A 4ZEMA 3RHFA 2I65A 4UEQA 4YUWA 2XAQA 1C2TA 4XQCA 2PO5A 4PZZA 2WIKA 1RRFA 1PDNC 1Z62A 3GDWA 4TWBA 3IHWA 5JCXA 3KQVA 2RGRA 4FFBA 1AQLA 3GUDA 4PFOA 1E60A 2QYHA 4B2YA 1BJTA 2YOHA 1XDGA 5TRDA 5K6AA 3BH7A 1M2JA 2X7JA 3BHIA 1PNRA 1EH5A 3N86A 2WC1A 1Z4JA 4QDKA 1XD2A 4JUAA 2UZ0A 5CKTA 2JPCA 3UXEA 2RGEA 1CY1A 1Z36A 1N0VC 5T6BA 3K9FC 4E7LA 2RCYA 1K08A 4CYCB 4UBIA 5BV0A 4JELA 1NBHA 1WJBA 2VKHA 1JQJC 5CM9C 1H4QA 5DSTA 4UAVA 1LZLA 1U78A 2R6JA 2MW8A 3IAS6 4PN7A 2MSNA 2WEKA 4PG4A 2X9DA 5EXEA 3I72A 4QOGA 4J00A 1VPTA 5F3RA 4YUYA 3I9NA 4QQ8A 1L5ZA 3H35A 4KNVA 3G23A 2I4RA 2Q1TA 4IL5A 3ETDA 4OLHA 1UFKA 1O57A 2EGGA 4ZPXA 1FMJA 4K28A 2VRBA 1JFFA 1L5HA 4D9MA 4XPIA 1CDOA 1EK5A 2O03A 4PLTA 3ASVA 2H9IA 3I12A 2GFIA 1TT7A 5G3ZA 2J87A 3KXKA 2DA2A 1UWLA 2GA8A 5IKXA 4GOND 4S12A 1SUBA 4TWAA 4F86A 4PJJA 1JG7A 5DRTA 2GBIA 1FFDA 2X0RA 5F52A 3BWXA 3I6ZA 4FPXA 4B6JA 2FZVA 1N6PA 4RPCA 4OJTA 2HA0A 2J4CA 4OSOA 2EYUA 2QPOA 2K9QA 3V7NA 3B1FA 1Y5RA 4UEJA 3PE6A 2PUTA 1QRUA 4X8MA 1A9YA 3WHCA 2DSTA 4O4JF 1UL1X 3FHJA 4IV0A 3D4IA 4I76A 3EPRA 2QEQA 1MXHA 2QW0X 2AG8A 2WYHA 1I7PA 5DX0A 5DNCA 4TV8F 2Z43A 1U5BB 2XQVA 2NO4A 2JI8A 4PO3X 1C8KA 3H86A 4U0WA 4G0PA 2G7ZA 3LUHA 1BX1A 1M7GA 1XELA 2G3YA 3HM9A 3EAQA 4K26A 3SOPA 1I6MA 3KZIC 5A0TA 4QUIA 5KKNB 3CE6A 2VXBA 5J4LA 1BA5A 5F04A 4YLGA 2VHUA 1T5TA 2NTYC 4MWSA 4E4HA 2F59A 4G01B 3LZCA 3L8YA 4F2PA 4UDOA 2X5OA 2VJBA 2VPTA 4RPJA 4OQYA 3LRTA 2YYAA 4YRNA 1NBAA 1ULUA 1I7LA 2BGRA 3ZI0A 3WK5A 4KG7A 3JYOA 5BV1A 4GBED 1O4WA 1XTRA 1ESNA 2I7DA 1JSLA 5DT2A 2AOTA 1TWFJ 1CPYA 4IG9A 3WRVA 4EMSA 2YYSA 1NLUA 1Q0TA 2X76A 1DIRA 1AS3A 4TTAA 2NOAA 4MVJG 2OBLA 2W42A 2ZIEA 1L9XA 1YVEI 3AJEA 2OGTA 2PRYA 4B7ZA 3ZGLA 4Y0NA 4Y6QA 3BR6A 4RVHA 521PA 3LC0A 4JYKA 2MU1A 4BCBA 2LSOA 1NVKA 4MKXA 2GXAA 3HY4A 1OXXK 1BGXT 2DFFA 3U1TA 1SBYA 4C7VA 2HQOA 2QRVA 4HF7A 3W5CA 5K6AC 4A1FA 3IUBA 4CIWA 4B0PA 2FN9A 1XTUA 1ZJJA 4YV2A 1HF0A 3PQ4A 2YDXA 1AXEA 3U17A 3ZDZB 1PL7A 1UR5A 4WOBA 1UBFA 4OHCA 4AC0A 3IELA 1TWGJ 3X44A 4BZZA 4ZVTA 3GD7A 4FDUA 3FH0A 3HEBA 1BDMA 1BMQA 4HEQA 3GN2A 3ELDA 4AZTA 1R4NA 3BORA 1NUPA 4WXDA 4GVPA 1GLVA 2I29A 1SOAA 5ARBA 3SAJA 2JFQA 3FHCB 3UYLA 1OF1A 3W5AA 5HE9A 3WRWA 5KC8A 3RVNA 2D7CA 3AB7A 2NMVA 4TZ6A 4RYDA 3HBMA 1WEHA 1RLOA 5HDQA 1DT3A 1BI0A 4QE3A 5IT4A 3UK6A 1UC9A 2PS0A 3TXXA 5K8LA 2A92A 2VHQA 2E3JA 1DWPA 4YMSA 2C2KA 4J4BA 3FFAA 4IHXA 3FKSA 2C96A 2ZM5A 4XVUA 4GMGA 4PUSA 1MW9X 3ILHA 2WSMA 2VPQA 1VLHA 4KE7A 5A4KA 5IDYA 2EJRA 4AY5A 1TZBA 4ZC3A 3TKLA 4WTOA 2QWXA 4XSXF 3A3PA 4UZEA 3USCS 4HLYA 1STZA 1JTYA 3MOSA 1JQBA 2YCBA 3KR9A 4DHEA 2CNBA 3E1SA 6REQA 2CD7A 4FN5A 3HRHA 2Q45A 4AECA 2MSWA 4EOGA 4G3XA 5CJ9A 2XPUA 5CB4B 1GEEA 2OPTA 1I3OA 3MW8A 1GADO 1VJ5A 4J3JA 2PV0A 3NEAA 1KEEA 2PQ0A 4MKRA 3W6NA 1CEXA 3DPUA 4HFJA 3IXLA 2W2KA 1NR7A 2C0QA 4NJEB 3RT7A 2V1NA 1V16B 3IAAA 3TL3A 4YMLA 2K27A 1N6NA 3GH3A 4XDGA 5B58C 5BVHB 2PRIA 2VHYA 2OV4A 4MDHA 4P4LA 1WXXA 3W2WA 2PGIA 1C9DB 3FNFA 4PXAA 4OH1A 2PKQP 3SLRA 4PYRA 3DEAA 5C7IO 4L16A 1I1OA 1TO6A 2QX4A 5EWLB 1YG2A 3IT2A 2IDZA 3C43A 4CKEB 1IV6A 5AUOB 3PEUA 1R6XA 1K4KA 3I8SA 4G9BA 3MHPA 5LGNA 1DAPA 2G1PA 2NO6A 4M76B 5EIHA 4FOSA 2DWQA 4QU8A 2Z8XA 2AW3A 1UKCA 2Z3VA 3JAWA 5CHEA 3E0JB 1GTJ1 5DASA 1ZJZA 3DAYA 1OXSC 2DA3A 3JQFC 1I3AA 3N0XA 3O1HB 1CS4C 4PG8A 4IIJB 1H3FA 1VJDA 1RI3A 3IR7A 3DLAA 4MWDA 2YYYA 1RESA 4YRIA 2NO1A 2HHLA 2O7OA 1GFIA 1KFEB 4D3YA 4ZGGA 5ERGB 1ZFNA 4NEHB 2STTA 4NS4A 4E2WA 2JI7A 5G3YA 1P0IA 4XWOA 2Z3YA 4CF5A 3GO5A 3EXG2 3EULA 5DNUA 3KLPX 2UAGA 1ZY2A 4DNXA 5A4DA 5E6UB 3N2ZB 4Y6PA 3TRHA 1QHYA 1F2VA 1CNEA 1FXUA 3FZYA 2P4EA 3VPGA 1DBWA 5JLAA 2E1NA 2CGEA 2D62A 2FLVA 2LBFA 1CBUA 3P9PA 2KJQA 1RC9A 2BKEA 1KSGA 4CCOA 1F8YA 1QYIA 3A28A 5FKMA 3FNGA 1EU1A 2A5LA 2ZBPA 1GHTA 1ZBQA 2LY2A 3AHDA 1UZLA 3MUNA 1RPJA 3IFSA 3AB8A 3NOOA 4JHLA 2RB4A 4DIEA 4I0BA 1XB4A 5ALOA 2B4KA 1VKOA 1YTUA 2CMDA 2QMQA 1H2HA 1WO8A 2CJWB 3WVNA 2DKFA 1C3XA 5C5CA 3AOGA 4UMFA 5AQEA 4MQLA 4X7BA 4HAIA 2IYUA 4QDOA 1D4ZA 5LP6A 3GGCA 4WE3A 4E7JA 2FQWA 4HMQA 4OQMA 2IVMA 4V3CA 1KI6B 2DOEA 3DLIA 2CY0A 3MMZA 3U7IA 3OP1A 4QWQA 2QTVB 3L2OB 2DLLA 3DO6A 3PJEA 2P9JA 4XGKA 4Z8XA 4I0AA 2CK3A 3EG9A 3PGVA 3D3JA 2R92J 2R6HA 1BD3A 1TLHB 2GAFA 2FUG6 4Y17A 1A72A 4B48A 1DKOA 3FPEA 1Z37A 2B63J 4AWAA 4TX1A 2H2IA 4O29A 2AFHB 4YP6A 2PUHA 1Z06A 3R9XB 2D2VA 3LVQE 4ILEA 5I9MA 3TPCA 1ZBDA 4GWLA 3DOIA 3NV9A 2HUPA 2M2EA 2BVNA 3OJWA 2Q7OE 3QLVA 2H27A 5LZ2A 2ZANA 3ZQ4A 3WLEA 1MX3A 1ONNA 3MJRA 1UF9A 4CQLA 2BXZA 1Z7GA 1NHAA 3UA4A 1EQ2A 1KXJA 4OHBA 2QR3A 3E9EA 3Q72A 3K53A 1QK5A 1TXGA 2P3QA 3VZBA 2CV1A 4G0QA 1CUVA 3F96A 1LKZA 2NVXJ 2HPIA 4Y52J 5AJXA 1IB0A 5AHXA 3VC1A 1LSSA 1YR7A 4RF2A 5D5PA 1VYVA 2H29A 4P3XA 3HABA 4IDQA 4P7GA 2GYUA 1GQYA 4UE3S 1AK1A 2XT9A 2IXSA 1QHHA 3WLQA 2OYCA 2GPYA 4FNAA 5M3FJ 4Q12A 1DWUA 3G85A 1ZJWA 3I1JA 3X2QH 2QGZA 3IO3A 4CQNA 3QE4A 5IC5A 3I52A 2NO9A 2W58A 3EWIA 1VSUA 3IBTA 2QW8A 3C87A 4BJTA 1J6UA 3WRXA 4JZYA 3OEEA 4RHYA 1ZQ1A 2AMJA 1GZHB 3MWMA 1AD2A 1YJNI 2JARA 3OECA 4QL3A 1PF7E 4EUSA 2PLRA 4DG9A 2JFZA 1KC1A 4TXMA 5KQPA 3AESB 1T26A 1RPZA 3WO0A 5HODA 5AHKA 2HPAA 2ZGVA 1NAHA 2QV7A 4BKUA 4KKVA 1K7XB 3QU4A 1KK3A 1C7FA 3PFGA 3IAM6 2EKLA 2H5IA 5ALFA 4ARAA 2QX8A 1YGYA 3CO0S 3KL4A 2OCLA 3CMEI 1N2JA 4XDYA 1J7KA 4XM0A 1E0DA 2VZ9A 1HW5A 4NOKA 5EP1A 1UKZA 4KZKA 4CM1A 3SDBA 3C8ZA 3QRWA 1JKOC 5HRUA 1IAWA 4XJVA 3K0HA 3B3QA 4POOA 1IOZA 3RSOA 4BVFA 3O8GA 1RKXA 4AK9A 2XUGA 2HS5A 3QVKA 2HU5A 2CGPA 1GPH1 3VKGA 2UUZA 3V8RA 2CVQA 3T1BA 1E3SA 2YIVX 4KN7X 5AESA 1U6JA 1G3SA 3TCKA 1GCOA 5BV8A 2R5ZB 1SCBA 3KR2A 1VYTA 2VI5A 1NLZA 9ATCA 4M22A 2OCCH 4JBYA 1RIIA 2XNHA 3RS8A 1GGVA 5FOTA 4AL4A 2CUFA 2ZWMA 1T6ZA 3PXDA 4W8GA 5AVUA 3TL4X 1AZTA 3V7YA 1PK8A 3WA6A 3Q0EA 1PFKA 1N2EA 3G2LA 1G16A 3UT0A 2X8AA 1AUQA 3BICA 1RYFA 3GRPA 5COQA 3I6QA 4PQEA 3QPLA 1EK0A 3K4CA 2PWPA 5CFLA 2H4HA 3CY6A 3OYLA 1JVBA 3S2UA 2H2WA 1UHMA 3ITKA 4NZ9A 5LP6C 1JJFA 4F3CA 3EC2A 3ZDFA 3TDKA 3UB4A 2L54A 3O2NA 1QWOA 2PU7A 3P4UA 3BM5A 4ZQHA 5G0TA 4RVGA 3QX9A 1PWEA 3U7GA 4NMLA 3ROTA 1IV8A 1F2TB 3IP8A 3WI7A 4MTLA 4C14A 1R0CA 2OFXA 5FEMA 1VPLA 2BBOA 1H8EA 2AR0A 3DW3X 4NQWA 2DT6A 3HMQA 1P5HA 5FLXZ 1NUQA 4FQ8A 1HRDA 1LFAA 1U2EA 2CFOA 4A2WA 1LLDA 2NGRA 3HACA 7REQB 3VR6D 1DV2A 2WU1A 3ECHA 2XAUA 3A31A 2GPSA 1TAHA 2VQDA 3BSSA 1Z4MA 4A0FA 3LC1O 3UUFA 4K81B 5C1BA 2DLNA 3ZQKA 1MH9A 3NHMA 3WRYC 1F2TA 5KNDD 2W7NA 2YJ5A 2HYGD 1PJQA 2FW0A 3TZBA 1LDMA 3VX3A 4WV3A 3F7OA 4K1LA 1YACA 2KQRA 4P58A 4LE1A 2RQPA 1RKUA 3DBVO 3H9BA 4DM4A 5KJCA 2P8JA 4JYPA 3W1EA 1YTLA 1NKSA 1KL7A 2R87A 4EPVA 1VG0B 2E4VA 1X19A 2RAVA 1E0AA 4XQFA 3HCAA 2WIJA 2XQGA 3PDJA 4MGYR 1IN1A 1IM2A 1XX5A 2HLDD 2JJ1A 4D80A 5KVCA 3AC0A 4CTOA 3QEBZ 4OYRA 3FCCA 3OKAA 1ETWA 3A6ZA 3WRXC 1NTRA 4MITA 3DW1X 4ZYAA 3ESAA 4P86A 3RE1A 2YWCA 2FWNA 4YUXA 2FBIA 1K98A 1GKLA 3QM1A 3ZQIA 5E7QA 4DOMA 3S7ZA 2PX6A 1LDDA 4UFOA 5MFPA 3EIUA 4FVTA 3ZXUB 3B82A 4DJEC 1KDTA 4JEUA 1F9NA 3RYIA 1IPHA 4LMPA 4RA9B 4QUEA 5D2CA 4YIHA 5BRJA 1M6EX 1NNSA 4P4NA 4RSHA 2V7EA 3C4VA 4ZU6X 3D4OA 2JLUA 4MB2A 4K9MA 2FLKA 1Q3HA 1K7AA 4QRHA 1WCIA 2AN9A 1XZPA 2EZUA 5JC1A 1HKQA 4RE5A 3T3NA 1OE0A 4PDKA 1AO3A 1O8CA 2WU4A 3CTMA 4EJWA 1NJ2A 2MSEB 4WIAA 4EK9A 2OGUA 3HGMA 4TRMA 1F1ZA 2HH9A 2VF8A 1NP7A 1ZK2A 1XMSA 1IUNA 1FLIA 1Z2EA 2H8KA 3QXGA 4Z0PA 1FBQA 4ZAWA 2Y9YA 4W5NA 3LUKA 3TJRA 1DC4A 2IKQA 3AL0C 1QC5B 2PXAA 4TROA 3KPHA 2GARA 3ROQA 4MWEA 1OKRA 2HEIA 5H80A 1NX6A 2ODEA 4QSMA 1R8YA 3HVRA 4XJXA 4I9HA 2NPIA 3DZIA 1H4SA 1DV1A 4YFNF 5B4VA 1J9ZA 5D01A 3A6KA 4HSEA 1ONPA 4K6MA 4U5XA 4Q93A 1ZAYA 3LXXA 1IXYA 1NXQA 4IIVA 4URUR 1YI1A 3WYGA 3EZYA 3KKZA 1UZUA 2GCIA 5DXJA 3THSA 2BZSA 1WJFA 1INLA 2P5UA 4LSGA 2YNMC 1QC5A 3A03A 3B1ZA 2R7KA 5A05A 2QVBA 2NYVA 5JV5A 4JCOA 4RZ2A 2LREA 3L7AA 4L9VA 1H2AS 3QAHA 2EU8A 2CSUA 2FB9A 1WXGA 4PGHA 3JRCA 1A69A 5F4ZA 4H17A 1RLUA 4IZIA 2WJJA 1MB9A 5CVVA 1TUEA 3BTUA 1RDFA 4HEA6 1QQTA 3T15A 3ZD6A 3BMCA 5CBPA 3L7IA 1VL0A 2O1WA 3NDRA 3ADDA 1FS5A 3UOWA 3U4QA 1X3ZB 5BNWA 5EJ9A 4MW6A 1G21E 2XGDA 3OS2A 4RD6A 5D3MA 2A0YA 4AY4A 5EHQA 1YU9A 5D1HA 1U0GA 4P5OA 4H1WA 3EVGA 3PIIA 3M6FA 2LWIA 3L0YA 5L40A 1AMUA 3L4KA 3AR5A 3LX6A 3MBOA 2WQ6A 4WRRA 2CMHA 2MYTA 4DY4A 1TT5B 3I5AA 4AIHA 1RADA 5ISMA 4LYDA 1YJ5A 1KMMA 5KOJA 1VG9B 1DPGA 4WZBB 4E2YA 5TF0A 1BWSA 3TW0A 4AWXB 4J07A 2HQRA 4G86A 4E11A 4Q9IA 2A0UA 5IF3A 3SJAA 3PNQA 1DL5A 2VYVA 4LHWA 2OGSA 4OYHA 3IAUA 4WKNA 1FSFA 4OI2A 1SBIA 2ZUVA 4RZ3A 3FCYA 1E79A 2CVHA 4PX2A 5IEBA 4J0GA 4WZBA 1M10A 2LP0A 3PF8A 3HOTA 4IDCA 3W3AA 2ZI5A 3QV1A 4FQGA 4E5KA 3VPBA 3TTVA 1ZYUA 2ZT6A 1M6NA 3SWWA 2F3TA 1LE8B 3LT5A 2AG6A 2QJRA 4JXXA 1E5LA 2VYQA 1SUCA 4FFLA 3TB4A 4ZTFA 1TWAJ 4NENB 4ZWNA 2O52A 3FF4A 3BMNA 2O0JA 1BI1A 1YIJI 1F17A 3I3SR 2DFVA 4HWOA 3LT0A 5C8YF 4AIKA 1YS2X 2D2EA 3TW8B 2WAMA 3TOZA 5H70A 5B55A 1Z5PA 3ZHVA 4DZPA 2BFPA 2JLWA 3T35A 3RK0A 3K0FA 3KNZA 3CCSI 3WTVC 1V7CA 4IP0A 5FL7A 3PWTA 2E6UX 3P8ZA 3MERA 1CQXA 2IT1A 2RV8A 3OESA 3D4NA 1QFXA 3RF7A 1DZ3A 2NU6B 3QVGB 3K9WA 1HNWB 2OHJA 1P1BA 1V6AA 4BV2A 4PR0A 4CXMA 4RJTA 3ZKWA 5LR6A 1MZBA 3QKTA 4NS1A 3J81A 2GFHA 2HADA 1TI7A 2PA3A 3KM0A 1WABA 2WSBA 4MR9B 2WSYB 4A3MJ 3H2SA 1QB7A 4EKNB 5IYZB 2H52A 1IZ0A 4PSWA 2ZATA 4Q1BA 1H85A 1DKLA 3LQKA 3VO1A 3GTPJ 2NU6A 3MSCA 5LGUA 1C3EA 3IQWA 4L4SA 3IVCA 2NM0A 1XPJA 2CQXA 4A0RA 1BROA 2C4MA 5KAPA 3JWJA 3WTBA 1BOBA 3RARA 4OH7A 3WTXC 1A7UA 3B1WA 2Y8EA 3PA6A 1G7CA 2QHXA 4B7XA 1UAAA 4JD5A 3HPHA 4M9QA 2IHJA 4RELA 1NN0A 1E92A 4D9KA 4Y2RA 1C7IA 5L53A 2UYHA 4YAJA 2BVLA 4PZPA 4UUAA 2WNIA 1HXHA 4EQZA 1PIWA 1XQ6A 1IOWA 2FRXA 1X70A 2C7OA 3JY6A 3HHEA 1OAAA 3L4BA 1XHEA 1VCNA 1Z0XA 2FK8A 1KMHA 5C53B 1FTGA 3M8EA 4EA9A 4LRXA 2C0PA 3BHMA 2E1PA 4F9GA 2YN4A 4L75A 1JL3A 1TADA 2PO7A 2GD0A 2AV6A 4ZODA 5ITWA 3VTFA 1Y63A 2C4UA 2JSPA 3STTA 3EK2A 1X2MA 4LE0A 4J19A 2ZRDA 2X40A 3ZMZA 4MUJA 5DTMA 5JH7A 1Y6ZA 5IEJA 3EVTA 3V1KA 3KKOA 4UZFA 4GPBA 1P72A 4XD7D 4BX2A 1BXGB 4OHWA 2GM5A 2JIZA 1OLXB 2FHPA 4NU0A 4C07A 1R4AA 5FUYA 4GI1A 3ZHZA 3MELA 3BERA 4DYVA 3LYLA 1FNCA 1RVDA 1GZ4A 3D4PA 1MPXA 3QH4A 1W19A 1KY3A 4TTTS 4D7AA 4D1QA 4ME6A 5CD1A 3DG9A 4RHFA 5H3CA 2RDPA 5BSKA 5A06A 1CFZA 5SYNA 2JRLA 2FQ4A 5ALPA 4LJ9A 2I1LA 2RE8A 4WBNA 2XHZA 4CLRA 2BV6A 3DWIA 4FYPA 1V5GA 3LGSA 4C0QC 1WCYA 3U2QA 2JUGA 2FMLA 3OFSA 2HMUA 1L5LA 1VZ3A 1RAFA 3DEKA 3QG1A 2PD4A 3H2BA 1JHVA 2H1CA 1RYYA 2QB5A 3ZE6A 4BLUA 2X9GA 4EW2A 3H2KA 2A33A 4Q47A 1U63A 3I5MA 2I6UA 4GMFA 2HCRA 2L4MA 1E7WA 1DQRA 1TM4E 5IDWA 4QM7A 3L8ZA 3CZ4A 4RUKA 3I73A 5E3JA 3AM4A 5MFZA 4MWOA 1A9TA 1V1RB 2NW6A 2C7RA 3Q6MA 5CVCA 2UVPA 1M0EA 4BACA 4QREA 2YMQA 3Q41A 3QOFA 3CYFA 3I37X 2IGOA 3E27A 1GCUA 4PYOA 4U87A 4R1HA 2HFKA 4ZQCB 1BW5A 1R50A 1ESZA 1VLLA 3UJ7A 2NYAA 5I7SA 1YASA 3OE5A 2BDTA 1ACIA 1AE1A 5AM0A 2Y99A 5JLJA 2R47A 4GF5A 4ZYZA 1QPIA 1DGRM 4OAQA 1LVAA 4M1SA 4PONA 3A4CA 2NACA 4L0QA 3RTEA 2ZDHA 3E5NA 1TLTA 4BIIA 1U2PA 4YIKA 4MH0R 2G4CA 1YJCA 4D9IA 2FX0A 5DHQA 2BEJA 2Q5OA 3DCNA 4L2IB 1W5BA 3ABOB 1OD6A 3E22B 5CJJA 2COUA 4RXMA 3F6CA 1QGOA 2GBPA 1AGXA 1I3CA 1AN0A 1G8JA 3K2BA 4QUHA 3OD5A 2ISQA 2A78A 4WACA 1J0CA 1XWWA 3A6PC 2WZDA 3SM3A 1N34B 2KZVA 4F5YA 1EG2A 3LBFA 3LY9A 1SHTX 4H1HA 3NYQA 4I14A 4KIWA 1LPNA 1ORVA 4JJEA 2MABA 2GK6A 3CCYA 1X7ZB 4NBRA 1KOGA 2B8JA 5ALYA 1PSDA 1ORIA 3L4BC 2RAFA 1H9TA 4O4IB 4HAOA 4R68A 1R58A 4FQ7A 2JVGA 3CKKA 4NL4H 5LKAA 4KSCA 3F8MA 2R8EA 1TQMA 3K2AA 5CDHA 5L45A 2JKYA 5AKKA 5G0WA 1RZRA 1JXMA 3SM9A 3KFVA 1P6UA 2Q41A 3UAGA 3H3JA 2R11A 1I10A 3DFMA 3WGGA 4MSUA 3A1YA 4UAUA 3U7QB 3V6MA 3K7AJ 5J1UA 3S27A 3TEFA 3LMKA 2F2TA 3FNQA 2RB5A 5JVDA 2OAP1 3L7CA 4O6JA 2PUWA 5DHFA 1S01A 3E5QA 2W22A 5CXSA 2GTIA 2IC5A 3NBYC 1UOQA 4GZ3A 4UMDA 3AW8A 2YHIB 3GJZA 4E03A 3OYJA 3N8KA 2L9RA 4QOEA 3GT7A 1IONA 4FS8A 1FWZA 3A70A 2AD1A 2HA7A 2VPLA 3CG4A 4LYEA 5EN4A 3JWIA 1FDRA 4IIBA 5FLEX 3WLAA 4A6XA 3CLVA 2DU9A 1OHHA 1KJNA 3A0RB 2SHKA 1ZMRA 4O4HF 5EQDA 1GPDG 2Q2QA 5BSTA 3I23A 3ZQJA 3DFUA 2PWBA 4XSVA 4RA6B 4C7XA 3OCJA 4JR1A 2P7HA 2QL7A 4DRZA 2YHIA 4JUBA 1DGQA 3MEQA 1MIOB 1Y42X 3V1NA 1XZNA 5M5WJ 5FCDA 3IP4B 1QORA 1YR9A 3LQ2A 3T0GA 4DABA 4I08A 3HCNA 1L5YA 1PUXA 5A9SA 3P2KA 4QXMA 1Y8QA 2EA2A 3RYCB 1K2WA 4FFMA 3ABLH 4DB4A 1X7XA 5BT9A 1QGZA 5FLXK 4JU8A 1CVLA 1YCFA 3N6XA 5DTJA 1ABEA 1S8FA 3K0KA 4X1IB 3Q7IA 1JALA 2K3PA 3E9QA 4GM0A 2WTUA 3PNVA 3R7LA 1FB5A 2ST1A 4ZHSA 4IJ6A 3AFIA 3B5IA 3AR2A 1XD7A 1A2KC 4UMEA 1ATZA 2YWEA 3G2KA 4NQRA 5FADA 1QQAA 1DJLA 5K7HA 1JR3D 1DT5A 1UBJS 4HBLA 1I5ZA 3ANSA 2L7FP 1KDVA 5DNVA 2SBTA 1KETA 2R84A 1C7JA 5HE8A 4QELA 5ADUS 2WFLB 3KB8A 2AB0A 4NJMA 3F2VA 1L7XA 2ZJ0A 1P1KA 4OXXA 3ZGZA 4PRLA 2IYWA 4DA7A 2BGJA 5CNJA 3OZXA 4AJPA 4ARIA 5LB4A 4R6WA 5EZ5A 2VH1A 1IE3A 1F7VA 1IM8A 4HC4A 4B0OA 3AJ9A 2NSYA 5BQ5A 1P4XA 2CF5A 2ZIXB 3AHFA 4E22A 1AZLA 4QG7A 5DGHA 2ZDGA 4E7ZA 3TYXA 4V0KA 2Y69H 1T9BA 3MJHA 2BEUA 1QONA 3V80A 1SJ9A 3O5AA 1ZN9A 4LUCA 2X9VA 3HWRA 2AI3A 4OHXA 2C42A 5IAEA 1ERDA 2V6BA 2HHHB 3HDJA 3ZCOA 2N75A 4FFSA 5FO1A 4AXBA 5DNYB 3F4LA 4UFNA 1YAHA 4CIVA 1ZAOA 4IFIA 4DW6A 4M8LA 2C7QA 3R7WB 3PDIB 4CL2A 4X24A 1QRTA 2Z2KA 4G0VA 3SGLA 5I47A 1KS2A 2TDXA 4C88A 1KZ6A 2AX4A 2CXQA 1QFZA 1II8B 2O8VA 2HWKA 3LNCA 2EGHA 4DBLC 3U2RA 3FCSB 1N9ZA 4FR5A 2E7WA 1Z1DA 5B6PA 5SZHB 2CLHB 4FLEA 1SA0A 3N05A 5EERA 3IMEA 1UM9B 2ZM6B 3QP5A 1KYTA 2I3BA 4EW1A 4LHVA 4D7NA 2V26A 1R00A 5H68A 3L43A 1S29A 4UXNA 1MD9A 3QP6A 4DT1B 3LBYA 3BFVA 3G89A 4G1FA 3F98A 4QDTA 5KQLA 4KE8A 2IAIA 4EGFA 2QQGA 5K5EA 1PVDA 2C61A 2X6RA 3S5JA 3GW8A 4R4JA 2N0SA 1M1NB 5FGMA 4MLCA 3DVLA 2FMUA 3DMPA 3F6BX 3A1DA 5JASA 5KYKA 4LI3X 2BMAA 4ID3A 2PY6A 1PGOA 1QVWA 1N6KA 2VQSA 1TTTA 3I2KA 3COAC 3THOA 5LQUA 4IQFA 5AVQA 4OJKA 1XNQB 2CNWD 1X86B 3HGTA 2HTFA 2AOXA 2C4HA 1TP4A 1VJGA 4TLDA 4G12A 2X0IA 3K20A 1IQRA 2WJ6A 2G77B 1PZMA 3WLSA 2W6JD 3WK4A 4FR0A 4CMIB 3VR5A 2VRWA 3N5CA 4YWJA 2LIPA 2P1ZA 1VFNA 2ZIVB 2YXBA 1Q50A 5LU9A 5CVJA 5FROA 3T9CA 4OGGA 1FP7A 2DA7A 1OX6A 2AFIB 2A61A 4EB0A 1VYHA 3WIOA 3OHSX 1OU0A 1WF6A 1CR6A 1AK2A 2KQUA 2JA8J 2K87A 3PC8C 1FTYA 3WQRA 1GDDA 4XVQA 2VPPA 3T7RA 5LN1A 5L4LA 2P4UA 2IIPA 2HO4A 4I5IA 2BF4A 5K0JA 1XYVA 2JFPA 2OESA 2R86A 2J9FA 1DJNA 4O4LA 3RYPA 5HQTA 3JREA 5K8VA 1DKRA 4YQEA 3A04A 2HOAA 1RKTA 4MVJH 1P4RA 2ZETA 1GR0A 3NTUA 2P62A 2I8AA 5BSWA 4A8HA 4IRGA 1RU3A 4I50A 4ZVPA 4HR7A 4FFBB 1UUFA 3R41A 3ZXYA 2YPRA 3MOIA 1HKSA 2V8BA 2HU2A 5CEEA 2E34A 1CWUA 1W49A 3WJ2A 1IN5A 2BISA 1ZNYA 2X42A 2K85A 2IDMA 5D6NA 3DT9A 4M7RA 4AJ2A 1ZI8A 3WGTA 3ABRB 4PYQA 5DTRA 3HHGA 4V24A 5CEFA 1LEHA 3QFRA 3REFA 3LYHA 2QORA 1XD2B 1SHKA 1TF5A 4B33A 1I4OA 4F60A 4WBXC 2NTJA 3ADBA 1ST2A 4S1PA 4QTRA 1WKMA 4RGYA 4YCBA 3OD1A 4UM9B 1SNYA 2MSKA 1T35A 4IICA 2ACEA 4TZTA 3TUJC 4HDVA 4HWPA 3LAJA 2WY8Q 1V43A 5KYNA 1CRPA 2VOEA 2PQ6A 2GN6A 3PRYA 5CDFE 5D5HA 4B3DA 5BR7A 4XIYA 4C7BA 3RKQA 2O1XA 4C0BA 1YOVA 3CCCA 3JWGA 4RADA 2VUIB 3W05A 3ZWBA 2GBCA 3E4DA 3J80A 2J9ZB 4XUDA 5HP4A 1HDYA 5ETJA 1Z68A 3CNBA 4YRLA 3D5SC 1JFFB 5IFKA 1JXAA 1ODKA 1L5HB 2K2WA 3KSUA 4XPIB 1ULTA 1YW7A 2Q3JA 3KPJA 3GQVA 3JQEA 4G67A 3D3WA 1U8UA 3D6NB 3R23A 1W5SA 3BG5A 3DM5A 4O25A 2KSQA 3D5RC 4QKQA 1GT6A 4I4IA 3P9NA 1XLUA 3IHTA 2VOOA 5AI5A 1HFEL 4LRSB 3BWDD 3LT1A 3J7AO 5TPWA 3R61A 4JEMA 3DTVA 2C5FA 3EVNA 3QSYA 1OI3A 3CDHA 4GM1A 1C29B 4QU9A 4KN5A 1TYCA 1AIPA 2B7CA 4KAJA 1ECPA 3RC2A 4X60A 1ZO8A 1GQFA 3R77A 4GOLD 3TEDA 3KVRA 4HF2A 2P9ZA 3JYPA 3E48A 2DDAA 3VA7A 3IC5A 4N9QA 5ESDA 1UEJA 4XVHA 3DUFA 3WL5A 2PLAA 1GPMA 2F17A 4JYCA 1IQ0A 4Q4LA 1J09A 2ZB3A 1NK2P 4Q48A 2VHTA 5GAEJ 3EIQA 2A7XA 3IHKA 1XU4A 4LX8A 4ZMRA 3H9GA 2P7CB 2YWHA 3BILA 5IP6A 1EUCA 1ZD8A 2BBSA 2P79A 1MXFA 5ILOA 1MJFA 4C78A 3D6AA 2MR6A 1V54H 5IN5A 4RIEA 2AC2A 1TYDE 4EQQA 4HLNA 1H0MA 1E3LA 3IV9A 2EQ5A 2PNJA 2WOOA 1YQEA 1LEBA 2AOTB 2GAUA 4N40A 4RMIA 3G2JA 4NYMR 5K3BA 1YKGA 1X2BA 4TSFA 2O2HA 2V4ZA 1R3DA 1ULYA 3K73O 1U1DA 1F7UA 1L4KA 2ZAOA 4TM7A 2R7FA 1H22A 3OIOA 2Y4OA 4OHMA 3W6OA 3KAKA 1GGJA 1ZWKA 8ATCA 5HKKD 5FNVF 3UAXA 4K2AA 1NVTA 3EZGA 4H4CA 4R0VA 3NNSA 1LDYA 1N5KA 4QPJC 4HDNA 1U8CB 3ZQCA 1E4OA 1J22A 421PA 3DE5X 1T0IA 4EABA 2QRVB 2FJPA 2YV2A 5LVAA 1UXIA 4OFXA 4PF1A 2WJIA 3EBPA 4IVQA 2PUJA 2WAYA 3UW3A 5I7RA 3TMOA 3H8SA 2V7GA 3JQFA 3SQMA 5KJFA 3VR3D 1O5IA 3FPKA 5JZ9A 1Z29A 2IEBA 5EEAA 1M2GA 5F2NA 3CX8A 4DPKA 3FTFA 4DQUA 4E5UA 4WZAE 2L9SA 2PWAA 1HDXA 2P4HX 1V8OA 1B0UA 3BE5A 2ZJYA 5H3LA 5T3YA 1R4NB 1NJSA 3QVSA 5JMPA 2AZXA 1QYDA 1HSJA 1M1UA 1FLAA 1PLJA 4HRXA 1EA7A 4B6RA 3GEEA 1I3MA 1P29A 1U7TA 2I99A 1KWGA 1VTNC 3M9AA 4CZ2A 4BUPA 1Z0DA 2I4TA 1FYKA 4RSMA 3I55I 1NWHA 1C14A 2FZKA 5AIBA 2J5XA 3AOEA 2Q6IA 1IVSA 3VHQA 1RRCA 4XIFA 2FEOA 1I7QB 3L5KA 4HDUA 2XYPA 5TPZD 4J29A 3HNPA 1PEKE 4UU7A 4NECA 2ONZA 1AKVA 1NONA 3PFCA 2B36A 5AVOA 5L6LB 4JJ8A 3BXHA 1XMVA 4QXOA 3ML1A 2XCOA 2ZSDA 3EXFA 4GM4A 1TA0A 3CSDA 3UKOA 4MMYB 1WU7A 2ZKLA 3PLNA 1VG1A 4A3GJ 3RQ4A 2FZWA 4BUZA 3ZQFA 1J0EA 3TR6A 4CCLA 4PIVA 3VMMA 4NXNB 1V1JA 5FBHA 3BTCA 5JRDS 6REQB 1O9BA 4W7IA 5AKJA 3PUWA 5DV5A 3STVA 5DTDA 1P91A 3BFJA 2P7IA 4MEJA 4F9TA 4CV2A 4FBLA 4EUEA 1LTHR 4KSYA 4NOMA 2O2ZA 2HCJB 4CLEA 4MV3A 3VDNB 4CT4B 4YHHB 1KEEB 3QMMA 3CLKA 2ZBFA 2W2KB 3QX7A 2XADA 1FTQA 2VH5R 3QPBA 1XKLA 1W85A 3U80A 1CSEE 2ONKA 1UQUA 4XYGA 5IVKA 2PR2A 1XCPA 4NZMA 2VUHB 3AF0A 2CB9A 4HD8A 1XALA 1H5UA 2V7QA 3CE9A 1PLKA 5FIUA 4PZEA