4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
3CTAA 5CCXA 3JSPA 2RDPA 4D0PA 2PXCA 2UZKA 5IH3A 2XHKA 3PB3A 2HTJA 3BROA 4EM0B 4MNUA 2ZSUA 3IV6A 4M6XA 4RWZA 5CVVA 3M6WA 4PWYA 1F1ZA 1ZREA 5DM2A 4MTLA 3HTUA 4KMUX 2WV0A 1IAWA 3RIRA 1ORIA 5B1SA 4EV0A 1I4WA 4HQEA 4AVPA 4RB1A 3RIEA 3V97A 2QYOA 1NW5A 4R6WA 5CVRA 4I98B 1N7IA 4EM1A 4KN4X 4ISCA 3C3YA 2CGPA 3TM5A 2AOVA 5EG5A 2IH2A 4E32A 2ZMEA 3FMRA 2ZULA 1UWVA 3CJNA 2FBHA 1L3LA 1W4MA 1DP7P 1UHWA 3FPFA 4LGWA 3DXZA 1ZGAA 2EFJA 4E30A 4YMGA 3FPHA 3GXOA 1SFXA 2FK8A 2HWVA 1B6AA 1YFHA 4F86A 3WTTC 5DX1A 3JTGA 3E6CC 3KPVA 2IDKA 2PLWA 4Q4ZF 1YLFA 2K4JA 1XCLA 3FTFA 3LCVB 1XDUA 2IFTA 3HP7A 5IKMA 3D5LA 3UFBA 1I9GA 2PLYA 3G89A 4RGUA 1VBFA 2O06A 4MTEA 3WTVC 1U5TB 1GXPA 2AOUA 2B0LA 1AOYA 4GCVA 1KP9A 3DPLC 4QVGA 1EJ6A 4BLWA 4ER3A 4Y15A 4ENNA 3P9CA 2BBYA 3HA5A 3FYDA 2PX8A 2DFIA 4N9IA 3FPGA 2H94A 4PYKA 3LGAA 1TNTA 2OY0A 4FX4A 3RW9A 5EMMA 3KP2A 1TQPA 4PGGA 1G4DA 5K5RA 4I01A 2HTEA 4X63A 2F2EA 3HIFA 4YIIA 1R23A 2CMGA 1HNNA 1NT2A 1QANA 3G5TA 1U5TA 2JTVA 2AOUB 4P58A 3E23A 3DLIA 3P7NA 3PFIA 2TDXA 2ZBQA 2IA1A 1ZLKA 2E5WA 3T1BA 5GOZA 2M1BA 2Z33A 2VT2A 5FD6A 3UJCA 1QAMA 4U7BA 3K0LA 5GWXA 2V1XA 1XJ5A 4PIPA 3CCFA 1A04A 5ICFA 3TDUC 1MKMA 3FF5A 1JTFA 2XAGA 3K0BA 2UYHA 3NWBA 4MGRA 1IM8A 1FYKA 5BPDA 2UXNA 5ICGA 5LHHA 3IRRA 2OB1A 3L09A 3JWIA 3E8SA 1D8KA 3LAPA 2EX4A 3C3WA 2XAHA 3GO4A 3A4TA 4X60A 1LEAA 2EA4A 3MZYA 4HX4A 5DD4A 1FNNA 2HTSA 3GRYA 1U3EM 3HVIA 2DTRA 1MJFA 5HLHA 5F1RA 3L7WA 3P9KA 2Z5UA 3BPXA 3FRIA 2L4MA 2QZ8A 3A25A 4GC9A 3FPJA 2FQ3A 3TFWA 4XSXF 4G8XA 2ZBRA 3HCEA 5LQJA 5DSXA 2FOKA 1C0WA 2GWRA 3TRKA 1TNSA 5ILVA 3FUUA 4CKEA 1J5YA 3VEPA 3HUGA 1I1NA 4GQBA 3GFMA 2RN7A 3GU3A 5EHGA 3P2EA 2G1PA 2VBWA 1QPMA 1JG2A 4IJAA 2EFWA 3RKYA 4KNYA 2HV9A 4H0EA 3SSNA 3LA3A 3THRA 3IEIA 3HTXA 2XKPA 2NP6A 5CD1A 3L9FA 3BJAA 2AXLA 5EZSA 5HIMA 2J5PA 3CUQC 1YS6A 3MTIA 3UJ9A 4KDPA 1BC8C 4HLXA 4YMHA 3GX4X 5EZQA 5BW4A 2MA3A 2BZGA 3HCDA 4FZVA 3GFLA 4DZRA 1D5VA 3NWEA 3IC7A 4RSRA 5GM1A 1D3YA 3A26A 1MZBA 3WU1B 5CJ9A 4HBLA 3RPQA 1JG3A 4HF1A 2M5WA 4DQ0A 5BW5A 3MEXA 5C0OE 1MHTA 3IKTA 5DDGA 1AV6A 2XKOA 1RZ4A 1W5SA 4IVNA 4WCGA 1JXSA 4MTDA 4O6JA 1PJZA 3FMQA 4FT2A 4B17A 2NXJA 3M6VA 5MHTA 2PWYA 2ZIGA 2A5YB 4MWZA 1B59A 1JQ3A 3HEMA 4KICA 4E2WA 3R0AA 5DUIA 1EAMA 4IXAA 2ZW9A 2R7DA 2X0LA 1RI1A 3E7PA 2EWNA 2BM8A 3BGDA 5HDNA 3KQMA 3WGHA 3KPUA 5H6RA 4BHBA 1FYLA 2VOPA 2ZKZA 2UYCA 3OPNA 4M9ZA 2KIUA 3G2PA 5D5XB 3M6XA 3FXUA 4RVFA 2ZTHA 4G7ZF 2VOOA 5DPMA 5L3EA 2NNYA 1H9GA 3KP7A 1U78A 4IWNA 4AWXB 2WTEA 3M7GA 3KR9A 1G3TA 1SMTA 2JZYA 1AQJA 3C3PA 4YUYA 2E1CA 2XRNA 3V4GA 5E8IA 1YW8A 1L3CA 2ZBKA 3KP6A 3BZ6A 3U9GA 5DD8A 4ASNA 2FE3A 5L3DA 1O3QA 2ZFUA 3ID6C 4TV7A 4ENJA 3G88A 5D4RA 2ZVJA 5K0FA 3GWZA 4UNOA 3G7UA 2V79A 5JI6A 4WXHA 3EYIA 1KYWA 1ZKDA 4HGZA 1ZRCA 4U0YA 4CTKA 4XLPF 2BV6A 2XGXA 4YV1A 5EVJA 2HKOA 5DCFA 2YX4A 2PWPA 1QYRA 2FF4A 3BDDA 5E8RA 3SGLA 3NQOA 1JSXA 4CDGA 3P2KA 1X1BA 1H9TA 3R24A 2ERCA 5IT9K 1R00A 1ZLJA 2YXLA 4HSGA 3T0IA 4LJZF 4RX1A 3E6DA 3IRQA 1R8XA 1SQFA 3ORHA 2E7WA 5KVAA 2IIPA 4I02A 3FXRA 4WVLA 3BY6A 2YR0A 5BS6A 4UVBA 2JPBA 1BKYA 5DYMA 2VODA 4KN7X 2GS9A 3QPTA 4HLYA 3P71T 5GP1A 4MHTA 1HW2A 1F9NA 4EQZA 3F8NA 3C7JA 1L3BA 3EEOA 2ZIFA 3KLOA 2FA5A 1RI5A 2BE5F 5FHQA 2B9EA 3FYCA 4IRIA 1G3WA 2WK1A 2JHCA 1G6NA 3U1DA 5EQJB 1IXCA 3QPHA 1KPIA 5T64A 3OZRA 4MQVA 2UWMA 1B9MA 5TJJA 3UWPA 4E2ZA 3SVZA 3WSTA 2JPCA 5CVJA 4P55A 2NRAC 5FGMA 3SMQA 4S05A 1T39A 3AWIA 3LCCA 2ZBPA 4CXMA 2Q8KA 1BI3A 2OAZA 4FT4A 2F5EA 3VFZA 4GYIA 4G9YA 1T6SA 4HF2A 3T7TA 1R22A 1WQ2A 1F4KA 4UUVA 5GIPE 1ZYRF 2COMA 4XSZF 1BC7C 1XCBA 2XAJA 2I7CA 4ER7A 1MGTA 2O3FA 5FA8A 2K86A 3DXJF 3PT9A 2EV6A 4R79A 1LJ9A 4L9JA 2O0YA 4DNCA 3RYPA 3FM3A 2DW4A 5EEHA 4GOOD 3ZQ7A 5LGTA 2GH1A 3J7AO 3Q9SA 2JJQA 3EGVA 3IWFA 3ABUA 5LQAA 3KQOA 2PV0A 1JTEA 2A69F 3GFJA 3UJBA 4XUEA 2CFXA 3LDFA 5E1MA 3JAMZ 5EIFA 2GAFA 4HA8A 3LA7A 4V0RA 2RKHA 2IGTA 2HDCA 2B3TA 4GUAA 3KQQA 3PX3A 3CUQB 2NXEA 4C4AA 2H09A 5H6QA 3REOA 2ZZNA 3WGIA 2IBTA 2YPRA 3FPEA 2YU3A 4P7FA 1H1DA 5DM4A 2ZNYA 2MH2A 1M6YA 1IN6A 1SMYF 1YYVA 5HOQA 2W57A 2QY6A 5E2AA 4YIFA 4YG2F 5BPIA 2HNKA 1IW7F 3KQYA 4KRGA 5F64A 5ILUA 4M36A 2LD4A 3F3XA 1STZA 4OMZA 2CQKA 3HOSA 2AN4A 4RGSA 1KU2A 3QV2A 3M33A 4HX8A 1DPUA 4RVGA 3AJDA 4RV9A 4FSXA 1K78A 2BH2A 3BJ6A 2VBXA 5DEQA 4QDJA 5T6BA 2OQRA 3QU3A 3EGEA 3MHTA 5CUQA 3ERED 3WTYC 2YSRA 2P8JA 4OIOF 1V4RA 2UYOA 5EOVA 5CM2Z 4PGHA 3ZPLA 1Z91A 3TO9A 1GHCA 1B9NA 3E97A 1LDKB 1KQ8A 4F7ZA 3KZYA 3NDJA 1QO0D 1AWCA 3SFZA 2B2CA 2LSOA 1DUXC 2V1UA 1U2WA 2GQQA 4HDVA 3A7DA 1XMKA 4L5JA 1MJ9A 3M9AA 3KCCA 2ORED 3I54A 2V6CA 1PDNC 2ETHA 4IHSA 4LB5A 1J0RA 4HTFB 1XDZA 5K09A 3TQSA 4EM2A 3GRUA 4GOND 1JHHA 3BGIA 4ZH4F 5BQTA 2AVDA 4PYOA 1OYIA 5K0GA 1XCJA 2HR3A 3GUDA 3HRUA 4Q48A 4LB6B 2PG4A 3JWJA 2MC3A 1X1AA 5E9JA 3JW4A 1YF3A 4CKCA 5CLSA 5D6EA 3IHTA 2PXXA 5EMLA 5FD5A 1KU3A 3H2BA 3WODF 2Z9OA 1VL5A 3HM2A 5D5WB 3MZHA 2L01A 3R0JA 3MWMA 5KYGA 1NV9A 4CICA 4AIJA 3LA2A 1TLHB 3I71A 2LKPA 3B3JA 3RPUA 4DQ2A 2GAUA 3DXYA 3R6TA 3FRHA 1T2KA 3OE5A 2EJRA 4AIKA 4PINA 3UA3A 3BXOA 3KPYA 2DLLA 4QDKA 5KK1A 5K01A 5KVRA 4FR0A 3C6MA 1D2CA 2QQ9A 5AIPA 3E5QA 4PCQA 3W6JB 2ACJA 3MAJA 4IRHA 3TKYA 1KHHA 3BWBA 4EJWA 2DK8A 4KUMA 7MHTA 4A0YA 2C7OA 1M6EX 4DF3A 4C07A 2A3SA 3WU0A 2Y75A 3T7SA 5L3BA 1FT9A 5FLXZ 5DTRA 3L8DA 3EVCA 2OBPA 2BEOA 2XUBA 5JHUA 5T67A 3EYYA 1BI1A 5E1OA 1G55A 3SHFA 1V3FA 4LG1A 4BQAA 4Y2HA 2F5CA 1G60A 1OPCA 4MEXF 3SSOA 1I1GA 1MD0A 1FWZA 4QTTB 2QM3A 2P40A 4LECA 4RTNA 4MEYF 3F21A 2YTZA 4NQWA 4EK9A 2VBYA 5E9QA 2B25A 3FM5A 4CKBA 4O5VA 2Z6UA 1JE8A 4ER0A 5K0CA 2FPOA 3VSEA 3CLOA 3F6OA 1U6GA 4KIBA 3RKXA 2F5FA 3EVAA 3S2WA 5D5VB 4RTRA 1QQIA 4CO8A 2WC2A 4GOMD 2G9WA 3HCBA 5FHRA 3RTRA 2YXEA 1X1DA 5DRTA 4NHJA 1HBXG 3S68A 3N4MA 5EMJA 2ZZMA 2I62A 4HX7A 3LHDA 4GEKA 5E8JA 1QAQA 5L3GA 4KWCA 2STWA 5BOXA 3DKWA 3SXYA 3HA3A 3SZPA 3K69A 2FBKA 1RJGA 5DSTA 5EIWA 2NNNA 3A27A 4HYEA 3ECOA 3F72A 1NW3A 1ZN2A 5HLIA 5CVUA 4FHTA 1IN8A 1TQIA 3ZMUA 1MJBA 1ZRDA 1XD7A 4QWQA 3I59B 3F6VA 4R8HA 1KPHA 2R7FA 3UJ8A 2DO7A 3ZMDA 5JR3A 1WXXA 4RB2C 3FMSA 2HR1A 3DTNA 1MJAA 2HGCA 1PP8F 3FX3A 3GVAA 3LQQA 2A68F 1EJ0A 2L54A 1XTPA 1WXWA 3A7EA 1DUSA 4UVAA 3RI4A 2YUIA 2OZUA 5FB2A 3HSRA 3LECA 4YFXF 3GLXA 4WX9A 5DXAA 2NYUA 3B89A 4IHTA 3BKWA 4Y17A 2XROA 1JQDA 3T5XA 1NV8A 1SKMA 2XIGA 4M6YA 2O8XA 1XB4A 4RB0A 4I2OA 4OA8A 3QOXA 2HWKA 2Y1XA 3RDIA 2ZCWA 1LDJA 3H3ZA 3P9NA 4R6XA 3FUXA 2IVMA 2IDJA 5C9ZA 1NHAA 3K1NA 3SSMA 1YG2A 4QQNA 2FBIA 2PT9A 2P3OA 1HKTA 1XMAA 4G7OF 1YB2A 1J59A 3FTDA 2PX5A 4WXCA 2FMYA 4BHPA 5L3FA 1P91A 3Q87B 2DT5A 3NJRA 4F84A 4EVIA 1JG4A 5BXYA 2O03A 1BJAA 1S29A 3G5LA 1YW9A 1GVJA 5LGUA 2JHAA 4M9XA 1P39A 5DX0A 2IBSA 1YFJA 4O29A 2A6HF 2ZJ2A 3G8AA 2CG4A 3LSTA 3DMGA 1SFUA 3LKZA 4RAZA 4C05A 3ERCA 1LNWA 3ELUA 5DX8A 3CUQA 2Q41A 2BR4A 1P1BA 2AS5F 1Q0TA 4B8XA 4UXNA 2OXTA 1BBYA 3BT7A 4OIPF 5IT9Z 1DPRA 3NTVA 3OU2A 4E33A 2DQRA 2UYQA 5LBQA 3WTWC 3QOPA 2LF8A 2VC0A 4XBFA 1OYYA 1Z05A 2R6ZA 3NVKI 3DH0A 1ODDA 3P97A 4RTKA 3WTUC 4OIQF 1S8NA 4NECA 4LK1F 2EA2A 4BLVA 3JSOA 4M37A 3PFHA 3GZ5A 5EC8A 5DTMA 3O2PE 4N0BA 4KYWA 2H6CA 5HVQC 2AOXA 4M72A 2VBZA 1ZAOA 2GIVA 2XVCA 2WA1A 2E7XA 1QAOA 3THSA 2YX7A 1ULYA 4PYQA 3HA7A 1P1CA 4FSDA 1VP3A 4ENMA 1JHFA 3SX0A 2B78A 1FX7A 4L7VA 3QU6A 4L9NA 3GJYA 4JQFA 5FA5A 4UOEA 4GYGA 2PXAA 5FQNA 2DI3A 2KKOA 3UJ6A 2DPDA 2JT1A 3JWGA 1N2XA 3EQLF 3R9XB 4N9HA 3IWZA 3P2IA 4RS8A 3V7SA 2G7HA 3V7RA 2PY6A 5EKUA 2QENA 4E70A 1U8RA 2NNWB 4MHGA 3DV8A 1J2XA 3SQNA 3V8LA 1SFEA 3PQJA 4RYLA 2PJDA 3HNRA 1KA8A 2FYTA 3GRZA 4P7GA 3W6KB 1RUNA 1JQEA 2KJBA 4UV8A 3HOTA 3O4FA 1SUIA 1P4WA 2AVNA 2M45A 5HFJA 4IV8A 3PVCA 9MHTA 3EDPA 2GZWA 6PAXA 3G2OA 3TO6A 4ER5A 3EVBA 2AOTB 1XDSA 4A2UA 1FBUA 1FBNA 4UHTA 4P7JA 5E8GA 3JTHA 1R8YA 3E6MA 3SZTA 2OA4A 2OPBA 2VZ9A 1FP1D 3LX6A 4YV0A 1BOAA 4UVCA 1XGOA 3GFIA 3NVMB 3CUOA 4Z2YA 2A14A 2ESRA 2GLUA 1F3LA 4IV0A 2PX4A 2IW5A 2G8NA 1FPQA 3BWMA 2ZZKA 1P6RA 1NBHA 3KR1A 3KEQA 1R7JA 2MH9A 3ML6A 4GF5A 1RJFA 2D2WA 4GO1A 1VP9A 3HVJA 1HW1A 3LWFA 4PZJA 1O9HA 1O7LA 2VDWA 4HQMA 2CMHA 1REPC 2EJTA 2K27A 4P9UA 2QE6A 4PIMA 3KEOA 4YV2A 2KW5A 1Q1HA 1G8SA 1S6LA 1HKQA 2HMYB 2QRVB 1FY7A 1RJDA 5FCDA 1KQ0A 5K05A 4KVZA 3M70A 3EVZA 3NMUF 2VE9A 4ZTBA 2AOTA 4K2EA 2FNAA 3BUSA 1HSTA 2CW0F 1IXSB 2VN2A 2BYVE 4X1OA 2EV5A 4GOLD 1HMYA 5CVDA 4AUKA 3EVEA 5F2NA 3CBGA 4I0BA 5FTWA 3FXQA 2D1VA 4RGRA 2H00A 1BHJA 1NW6A 3MQ2A 4YUVA 4BXUA 3I64A 2ZMEB 4AZWA 3V8KA 3KKZA 1L1EA 3NDIA 3FZVA 2L4AA 4O3MA 3C6KA 4HV6A 3CDHA 2DBBA 2BR5A 3KFWX 1YZ3A 1WRJA 3EMDA 4X61A 1YTYA 1AF7A 4ZYEA 2O0LA 5LRRA 1LQ1A 1IF1A 5E20A 1E2XA 4K6MA 4GBED 3CO7C 5FADA 5BMZA 3R0QA 1YIOA 1DCTA 2OB2A 2GXGA 3ISPA 5DLYA 1ON1A 1FSEA 1BN5A 4HW0A 2V74B 2ZLBA 1JG1A 2EFQA 1NW8A 3SXJA 2G71A 3SM3A 2H11A 1XCVA 4L9TA 1RJEA 1QZYA 3F8FA 5A2QZ 3BWGA 1ZG3A 4PYIA 1W7PB 3ZMSA 2VP3A 1FC3A 2XV4S 3LQRA 1NKVA 1XXLA 4ZZDA 3E6BA 4RB3C 3DULA 4L5IA 1O54A 3G2MA 4QVKA 2C7RA 4U0VA 2PBIA 4ESBA 3GO5A 1KU9A 4QPPA 1RI4A 2VDVE 3PS9A 3O31A 4P5OA 3PLAE 5LR6A 4DCMA 4G6DA 5FFZA 4WWCA 4C03A 1O57A 3TDZC 1I5ZA 2PFBA 2Y0MA 3Q7EA 2CWWA 2QBYB 4Y13A 2FXAA 4AX8A 1J75A 3J81Z 3WTSC 1R1UA 2M87A 3VOEA 3J80Z 2QQAA 3D0SA 3P9IA 2P3LA 5D8KB 5GIOE 1W7PD 3CO6C 4EQQA 2OQGA 5FFXA 4Y30A 4BLUA 5HOOA 2Z6QA 3MCTA 1Y8CA 2M30A 2P7HA 1FJXA 2JG3A 4DCGA 1IRFA 3ZMZA 1BIBA 4I09A 5K0LA 2IH5A 3KP3A 2IH4A 5KQSA 1WI9A 2P6SA 1OR7A 5E1XA 3T7RA 3IL2A 4E31A 1PRYA 2WA2A 1BC5A 3GGDA 3OZSA 1YUBA 2PBFA 5E1BA 4R05A 2ADUA 3TOBA 5E2BA 2FNPA 3GEZA 1QBJA 1S7AA 2QLZA 3DMFA 4WXDA 2ESNA 5FO5A 4JK1X 5K5QA 3R60A 5HDGA 1KPGA 1L0OC 4EJVA 1R5GA 3JAMK 1PP7U 3HHHA 5HEKA 3R61A 4A6DA 3DLCA 1S3JA 5DM0A 4UV9A 1VTNC 1FBSA 1D2HA 3FUTA 2GXBA 4PYNA 1EH6A 3VC2A 3HVHA 2Q0OA 4P96A 3FUVA 1IZ1A 1TBXA 3TGNA 4G56A 4R8RA 4EKGA 3BWCA 3GDHA 4FS8A 4G7HF 2O57A 3HVKA 1T38A 2VC1A 5LLQA 3FTCA 2RNJA 3KR0A 3LBFA 1IRGA 1KR5A 5G02A 2NP7A 1Z9CA 5IT3A 3DR5A 4OQEA 1R1TA 1P4XA 2L02A 5K03A 3OOPA 3R3HA 3KP5A 2IP2A 3ER9A 4CYDA 4EJTA 1R36A 3M6UA 2Z3YA 1D8JA 1TTYA 2P41A 3L00A 4YUZA 3LCUA 1ZG5A 2AN5A 3HSFA 1K78B 1TW3A 4AZSA 5U4XA 4LLLA 3RJPA 4LLNA 5FUBA 4ETSA 4C08A 1EV7A 2F8LA 5DRYA 3DMHA 1V39A 4LWPA 2FK7A 2FU4A 5BP7A 4WK8F 3NW9A 1W5TA 4RGXA 4RTSA 2ZWVA 3OZTA 5CYVA 3WE3A 1KXZA 2OYRA 2LDUA 2K4BA 2P5VA 3BGVA 4RVHA 1VPTA 5P8WA 1Z6RA 1ORHA 5ICCA 2NS0A 4ZYGA 2NAZA 1K6OA 3R4KA 1QGPA 4OBWA 3GCZA 4CTJA 3K9TA 2P4WA 4MIKA 2FRHA 3GIWA 3EPPA 2OKCA 3Q9VA 4YFKF 5H20A 5D4SA 3OV8A 1VLMA 1ZG1A 3EGIA 4FGZA 2HS5A 2JH8A 4XUDA 4LFUA 2CYYA 5HILA 1AQIA 3ELWA 2MLGA 2MLKA 2O6GE 3NEUA 5ED4A 2P8TA 2N47A 5DM1A 1FZPB 4HV5A 3O7WA 2EJUA 4ATNA 2EB7A 2LF7A 5D8LB 1G6Q1 1LVAA 1F38A 2Z99A 1WY7A 3FHZA 4OMYA 5L3CA 3HRMA 5LRSA 3ER8A 3I0TA 1XGNA 1H0MA 1USSA 2HQNA 4CWAA 4RAYA 2JH9A 2P35A 3L2CA 1PUEE 2PSSA 3F4KA 1NBIA 3H3UA 2D45A 2IPQX 1CGPA 4BHCA 3KQSA 1IN7A 2ZWAA 3AXSA 1X3UA 1USTA 3UA4A 4XCXA 4JBAA 5KS2A 1YO5C 4X41A 5KQRA 5EKXA 1BI2A 5FQOA 2YVLA 3DQVC 2C7PA 1HXDA 3E05A 2P5KA 1OKRA 4LMYA 5DWQA 1O3RA 1G3SA 4BY9E 2JHPA 2EFPA 3B7PA 5M5BA 2FHPA 5K0JA 5ERGB 1RI2A 2J5OA 3HSEA 3DXXA 2X4HA 5K0NA 4M71A 3GZ6A 1TW2A 2RGVA 3LAJA 4EJUA 8MHTA 1G3YA 1HW5A 5E9WA 4Q47A 2LNBA 4OX9Y 4HTFA 4PYJA 3HYIA 3JWHA 1KYZA 4G94A 3GRVA 1JR4A 2HZTA 4OBXA 2DK5A 2ZO4A 4L0YB 5LGNA 1HSJA 3TLJA 1SD7A 2WWYA 4I7HA 2ESHA 2DAOA 2M8EA 4G6QA 2XAQA 4LD5A 3KU1A 3TM4A 4DM3A 1P4AA 3CVOA 4OA5A 3ZMTA 5LQCA 5HDKA 3IHUA 3OFKA 3K1MA 2PX2A 4RTPA 4BYYA 4RVDA 4LLGF 4FP9A 1T0FA 2QVOA 5LQUA 1IXRC 3WE2A 1ZGJA 1L3IA 4H0NA 2W84A 1JGSA 3QP5A 3RYRA 1Z1DA 3HCAA 2P1DA 3K2ZA 4KDCA 4ON0A 3FTEA 5K8VA 2OD5A 5F2KA 2RC4A 1ZHFA 3BKXA 3RKWA 2VXZA 1M0EA 2QQBA 1P2FA 1X19A 4EMSA 1F5TA 4P7KA 4KFCA 2IT0A 1G38A 1DDNA 1KU7A 4LG0A 2W25A 3LPMA 2AOWA 3CC8A 2P5LC 3M1EA 2YR2A 2FRXA 3TPZA 5EMKA 2P6TA 5E1ZB 1SAXA 1LB2A 3KZZA 3F22A 4L0ZB 1YFLA 2ELHA 1O3SA 4YFNF 3QP6A 2A61A 5DUKA 1GXQA 3GW2A 4ENKA 4AD9A 4DA4A 2AR0A 4Q5SF 4A6EA 4RTQA 3LDGA 4U7TB 2BGCA 5F6FA 2K4MA 3DF8A 3NRVA 1ZH5A 1G8AA 3HCCA 2ISYA 5A2QK 1YQAA 3BP8A 3FUWA 3KETA 3C0KA 3B73A 3KQTA 3X0DA 2H27A 1VQ1A 5FWAA 2H6BA 4RTJA 3U81A 3TOAA 4NB5A 5EPEA 2GA9A 1X1CA 2EV0A 2P7VB 1HKSA 3WG9A 1ZQ9A 2YX1A 4HRAA 1Z6TA 4PYLA 1R5HA 3M4XA 2O05A 4M38A 2KRFA 5LHGA 2A6EF 4KW7A 3T8RA 2KJCA 3SR4A 2Y48A 4WF2A 4ZZLA 5E18F 5CIYA 3M8FA 2ZXJA 1FP2A 1U2ZA 1I1SA 1K7AA 4EGZA 2XVMA 4BP1A 5TRDA 2XYRA 1IN4A 5DCMB 2FMLA 3N97A 2OBFA 1FBQA 4BAYA 4ER6A 2ONZA 1ZRFA 3F8CA 4A0XA 3OCJA 4ZYDA 5EHIA 2VDUE 2PJPA 3KLNA 3BOQA 3HRSA 2UXXA 5GINE 1YZHA 1XVAA 2YQZA 3EUHA 2ZNZA 1O7FA 5GM2A 3CJQA 4S04A 2JRTA 4OINF 2W24A 1BIAA 5FWDA 1R6AA 4U7PB 2GA2A 2G72A 1LDDA 2QWWA 1B42A 1OYWA 3I53A 4DKJA 1YW7A 3ANXA 2UZ4A 1B4AA 2VT3A 3GRRA 4CGZA 3F23A 2PKWA 2K7LA 4KA4A 3E5UA 1N7JA 3AY0A 3OU7A 4XRFA 2VE8A 4FT8A 3MTEA 2XYQA 3EETA 4GGGA 5E1DA 4KT5C 3HRTA 4JXJA 1MDMB 5H02A 5CVIA 2C6YA 2QRVA 2PI0A 3KHKA 3F8MA 4HAMA 4EGYA 2XBMA 4L18B 5DTQA 1XN7A 3QAHA 4IRGA 4MQ9F 3EMBA 4XLNF 5AONA 1LEBA 1R1VA 5DV5A 3PTAA 3DOUA 1TPYA 5EEGA 3EVGA 3BPVA 1P92A 3BWYA 2PT6A 1IXKA 5LEJA 5LQRA 2XVAA 3TO7A 3LKDA 1WS6A 3IKVA 1Y0UA 3J81K 1WSUA 1QZZA 2HYFA 2XASA 2Z6AA 3BZBA 5HIKA 3V8JA 3B5IA 2HFHA 4M9SA 1MDMA 1EIZA 1UB9A 5ERIA 3MQ0A 3O3KA 1UIRA 4AIHA 4P9FA 3C1DA 4OU0A 5E17F 1Z7UA 2ZFWA 5E1WA 1CF7B 4HG2A 1U5TC 4F85A 4KIFA 3VODA 2ZCJA 2G70A 3TR6A 1RI3A 2DQLA 4HF0A 3CJTA 1XSVA 4XUCA 1IY9A 2DU9A 4YUWA 4ESFA 1B1BA 3I59A 2AS0A 3KPWA 3I4PA 4U7DA 2H1RA 2E1NA 1WG8A 3K6RA 2K02A 3B3FA 1WWXA 2NXCA 1TQMA 1BOOA 1JSZA 3ABTA 4OOIA 4GXOA 3ROUA 3FWEA 3ULQB 3GNLA 5DT2A 4L9VA 1K79A 1FLIA 3K1PA 4LK0F 4A12A 3HCFA 5HLGA 1UFKA 4DMGA 3GF2A 2MD5A 3C18A 4CZZA 3MGGA 1SD6A 2IJLA 3EVDA 3P8ZA 2FSWA 4GC5A 3DP7A 4PYMA 5DCMA 5HIJA 1R58A 2DPUA 1YS7A 4POOA 4U0WA 2FEZA 4B09A 1SG9A 4BH9A 2Y1WA 5HZMA 3WTZA 1RIOH 4HH4A 4V0QA 3PQKA 5D5UB 5HIIA 1L9KA 1RUOA 1KGSA 3E3VA 1Q0SA 2RV8A 1J9IA 5JVTA 1O9GA 1IN5A 1O3TA 1WZNA 1OR8A 3ELYA 1BI0A 3OFJA 3DPTA 3ZMVA 5F2OA 4HDUA 1R74A 3DFGA 2ZIEA 5ILSA 3HHGA 3KP4A 4EKIA 5LEKA 3V7CA 2F5DA 3QRFF 2HEOA 2ISZA 5J8FA 3G2QA 4A0ZA 3AAFA 3UZUA 3T8TA 2DPMA 5D6FA 2RQPA 3ZN0A 3TKAA 2EG5A 1FOKA 1D2GA 3MAGA 1RI7A 1KIAA 2GPYA 3U2RA 4HOBA 4HGYA 4CXFA 2XYVA 3KQVA 2P7CB 5LHIA 1SQGA 4FX0A 1HQCA 4U88A 4LWOA 3B3GA 4AZVA 2C7QA 3OU6A 4C06A 4HC4A 2NYXA 3I58A 2A07F 3I9FA 2DULA 5LQKA 1SD4A 2IA2A 3VYWA 2Q2EA 4QLCU 1WKMA 2PQ8A 1EQAA 2HYGD 4CHUA 3ELKA 2PVCA 1NE2A 1NW7A 10MHA 1XSDA 3CJRA 2V9VA 3H92A 2GB4A 1UHMA 1SVUA 2XAFA 2EFNA 2OZVA 3UJAA 5ICEA 2CKDA 2HOEA 2CL5A 5K0BA 1E17A 2PN6A 1UFMA 3RODA 2IRFG 2IA0A 2D1HA 4RTOA 1ZARA 1QNTA 3LBYA 2P7IA 1R18A 4A5NA 3WGGA 4M74A 2ADMA 1S7OA 1OMIA 5C1IA 2KIMA 2O07A 2HKXA 5HS9A 2HQRA 3G73A 2I6GA 3MB5A 5FULA 3HTSB 3MERA 2GA1A 3F8BA 1INLA 3T0YA 2FCAA 5JUWA 4RTMA 3M8EA 1BM9A 1UCRA 2OU2A 1I27A 3IYLW 2PMHA 3I5UA 1FSHA 4YUXA 5D1HA 3D2LA 2G7UA 3LL7A 3UJDA 4IF4A 4KDRA 4RTLA 3KR2A 1IUYA 4QQKA 2CWEA 1SUSA 2RVCA 1ON2A 1RNLA 4R1HA 2AZTA 3TMAA 4BP3A 2AN3A 2EFOA 2BR3A 1EH7A 5EGSA 2QBYA 5J8CA 4KIGA 4A5MA 2QUFA 2EK5A 1VE3A 2VONA 2I9KA 3KQPA 3LDUA 3QOWA 1FYMA 3O6BB 3OE4A 1CF7A 2MBFA 1SD5A 2CO5A 3B02A 3R6SA 1EH8A 3UBTA 5K1YA 1I6XA 1T98A 4IPAA 2YXDA 5K5OA 3MCZA 1KQ9A 5LQNA 2KIFA 4AZTA 2OO3A 5J6XA 5D1NA 2O61A 2ONYA 1XGMA 2PGXA 4EJOA 3TOSA 2P3QA 1J7KA 2W85A 3MFKA 4C04A 3FZGA 4ESJA 1XSXA 4E2YA 2OZ6A 2JSCA 3CKKA 4KMFA 4ZYHA 2BM9A 4QTUB 5LSAA 4PCAA 3ECHA 4PNEA 4PONA 5HS8A 4BNCA 4M73A 5CVEA 4E2XA 2STTA 2PEXA 3DEUA 3ZP5A 3TQNA 2VS1A 5FLXK 3ELDA 5DXJA 1ONVA 3E5XA 4MQ4A 3G3ZA 3COAC 3AXTA 2V1DA 3UJ7A 4HZFA 3ZN1A 5K0EA 2NXNA 3LFKA 4OIRF 3GYHX 3DUWA 3KE2A 3VB2A 2IPXA 2L3DA 5HS7A 4LG0B 5JFRA 1T43A 2V7EA 1VIDA 5CCBA 1W7PA 3KPJA 3CGGA 3J80K 4IKPA 3WTXC 3VC1A 5AIQA 3G8BA 1EG2A 3PFGA 3PX2A 4PDKA 4R8SA 2CSOA 3V8VA 2PMUA 2R3SA 3EVFA 3ME5A 4QPNA 1XGSA 4I0AA 4OQDA 3EEYA 3Q5FA 1DL5A 4M7RA 3KQWA 4PCLA 1Z3CA 3BJOA
chains in the Genus database with same CATH superfamily
5EWMB 5JCJD 2ID7A 1U31A 2J0UB 4F4CA 1GTJ1 1K08A 2C3OA 3BH0A 5B5EC 1XO1A 2RDPA 3PDUA 2UZKA 3AHCA 5JDCA 3I9JA 2HTJA 2G76A 5G0UA 2EFDB 2JA2A 3GVXA 4NIMA 5D85A 4RWZA 3H5TA 5L3QB 1G8HA 5CVVA 1L5WA 2GSDA 3DFFA 2GASA 2IGBA 1KOGA 3EXIA 3DA8A 4KMUX 4LNUA 3R3XA 1RPJA 2E2HJ 1V6SA 2ZYGA 5JCOC 3RIRA 1JILA 5GGYA 2GCPA 2FKAA 4UCWA 2HGZA 5KTPA 3AOEA 2JIBA 2QJOA 1I4WA 3UWOA 4HQEA 4EECA 3OBBA 3EGDB 1PYOA 3E1GA 3LRTA 4E11A 1B0UA 1A4IA 1WM1A 2JI9A 3VU8A 2TCTA 1TPZA 3PGKA 1BCRA 2ZVDA 2G0AA 1JXAA 2WF9A 1N7IA 1OCEA 2GO1A 7REQB 4KN4X 1H3FA 4K9MA 3TTVA 2PH3A 3CCQI 1FFXA 4UU1A 4IWYA 3WHIA 2EC5A 3WGNA 3B38A 3BD8A 1KDPA 2ZULA 3BPSA 4FMDF 2C20A 1G8YA 4PNPA 2PR2A 3IRVA 4XR9A 5DGCA 3Q3SA 3ZV6A 5KNCD 2NVXJ 1CR4A 4DZJA 3I3SR 3CWZA 4I08A 1W4MA 4NBVA 3CDIA 1DP7P 1C0LA 3H5IA 3OMWA 4FX5A 4XYMA 1A5SB 1WUKS 3VPBA 3PHBE 4NKRA 3AFIA 2VDRB 4ZDJA 3T0FA 1U7OA 3CCMI 3FPHA 2M9MA 3NHWA 5G1NA 3RRYA 3GLFA 2BZ0A 1VXRA 3OYMA 2GEVA 1P9LA 2FK8A 2HWVA 1QE0A 5CB4F 1H42A 1N6LA 2VTDA 4BU0A 4MUJA 2PUTA 1QFXA 4F86A 4Y52J 5DX1A 3HPRA 3EZ2A 3HUUA 3E6CC 3BXPA 4NOKA 3L7LA 1H6BA 1H8EA 1GUYA 1Z62A 2QVXX 2VZLA 3NWPA 4UNIA 4ZPJA 1Z9BA 4CKWA 3LCVB 5K8TA 1I8TA 4AJ1A 2LIVA 2ZWMA 4UBOA 5HIAA 1XDUA 3HP7A 2PRZA 3OAAD 4J7CA 2AI1A 2YHIB 1IY8A 4OHPA 2DA5A 1YZFA 3S8EA 1MA0A 1ZBDA 3B2NA 4MQ5A 3U7JA 1QHGA 3UNGC 4MTEA 1PUFB 3QE4A 1LRLA 1E3DA 4M49A 3U1VA 4WINA 3R3WA 2B0LA 4ZT7A 2LKXA 4EB0A 1SXIA 4C7OA 1G8PA 1SRQA 2VQCA 5MFPA 2GOMA 1ZEJA 3M4JA 3STVA 3I34X 2PPVA 3C2HA 5B5SA 4JLPA 4HB3A 2ZRHA 3ZS8A 3WAKA 1JJAA 3OECA 3IPRA 5BWOA 5I4KA 3P9CA 1H1LB 1J90A 1QPBA 2I8LA 2WLTA 3B9QA 4HT3B 1SQ5A 3HU5A 5FJJA 4S3MA 2DFIA 4N9IA 1WRBA 1G8JA 2Y0PA 3FPGA 3PFBA 3E2IA 2G6BA 4JOSA 3LGAA 5EJGA 1YVDA 3P0RA 5EXTA 2C7BA 2Y1LA 2NO9A 1X2BA 2R5ZB 1XVTA 4HRVA 1CUAA 2OV8A 1I6KA 3QE0A 1X1RA 3EJ6A 3H4VA 3LY7A 1M1UA 1TF2A 3KP2A 1TQPA 2D13A 2XTNA 1M75A 1JVSA 3O8NA 4PGGA 1JLMA 3EXHB 4M9CA 4O2RA 5AVKA 1N6OA 1DFIA 4HNUA 1U4OA 3NM6B 4X63A 5CK5A 1UQTA 4WCDA 4WKGA 4ZT6A 3R5SA 3WL4A 5I7OA 1AKNA 5F4BA 4OHOA 3VR2D 4QXMA 2JLUA 3IP1A 4OB7A 1QANA 4JX9A 4LN1A 5C53B 2ZPAA 5SYNA 1KVTA 3GTLJ 1U5TA 2JTVA 3G5TA 4R2KA 1J49A 3E23A 1XMJA 4X71A 3P7NA 1TZ2A 3N2NA 1FS5A 3PWTA 1NQVA 1DO8A 1N2ZA 2WHPB 3CZ9A 4WY2A 4HVAA 3RYHA 4AL4A 1R8QA 2ZUDA 2ZXHA 4RF4A 1HFKA 3U3MA 1Z0AA 5GOZA 1FNBA 4IFBA 4OQLA 2VT2A 5FD6A 3E7FA 2X2PA 3F7MA 3JYLA 5AW7A 1NBAA 4OQMA 1V5IA 2X85A 4ML3A 1XJ5A 2J9FB 3USCS 1UKEA 5AVWA 3AZPA 5AK0A 3FF5A 1K6JA 2W6JD 621PA 1IJEA 2UYHA 4CMEC 2GJ4A 1U5CA 2M98A 2W8BA 2EZ9A 4GSLA 1QUEA 4GWGA 3GFPA 1CVRA 3K9QO 1IM8A 4GMXA 1PWEA 1FYKA 1BS1A 2XGOA 4JXKA 5INTA 4S2UA 3FPLA 2QTLA 3IRRA 3HV2A 2G4VA 4EZIA 3IXQA 5GVSA 4MLPA 3T4UA 3E8SA 1C7JA 3HCRA 4MS4B 2LREA 5IBCA 1SKQA 1ADCA 1D8KA 4HUQA 3E5NA 2PPLA 4CRWB 2AQFA 2K3FA 3PX7A 1E89A 3A4TA 4RZHA 4X60A 1T6BY 4V38A 4OFWA 5EGOA 5DD4A 1IPHA 1PUJA 2C7VA 3PJEA 3H1TA 4WNYA 3RC1A 3ADDA 4ZVQA 2CHGA 2LUOA 3GRYA 1U3EM 2JSPA 1CRQA 2P0EA 3HVIA 3LCRA 4NEGA 3X1XA 2RHTA 2CL6X 5IRCD 4OYRA 3V46A 5DNYB 3P2YA 1Z21A 2EINH 2L4MA 4P8RA 3A25A 4QLOA 3FPJA 3NPAA 3WRXC 2PE5A 3QWAA 1JLLB 3BJEA 4UHJA 1PW7A 4BE9A 2HNAA 1ML4A 4YR9A 1EJBA 4LSGA 3TFQA 4YECA 3CMYA 4AJ4A 4YWJA 4XSXF 2QMZA 3DOIA 4AIDA 4HRXA 2X8LA 3RS5A 1T6NA 3JZMA 4FMDB 3T3MB 2GPJA 1SUEA 2PEZA 3FY4A 2FUG2 3L5KA 2DJ5A 1RS0A 1KJNA 3OSUA 5ESWA 4GL2A 1TNSA 2VDWB 1VKJA 2RG1A 3C1AA 3O21A 4Q1DA 1H5QA 1I1NA 1XROA 1E4OA 1FRQA 1XQ1A 3K2IA 1CLUA 3RF6A 3GU3A 5DZSA 5C7OO 3D6AA 3PIDA 3P2EA 3DDSA 4M54A 4AM8A 3HR4A 2PZFA 4D43A 1B23P 5KYUA 2VUHB 3OPVA 1DAOA 1SQ0A 3WA7A 1Y5LA 2MABA 4KNYA 1DQRA 4XLHA 4GRAA 4UJ3A 2O50A 3SFVA 5IAAA 4DB2A 2NGRA 3IEIA 3HTXA 2DBRA 2XKPA 2A35A 2QE7D 4X8HA 1GGHA 5C37A 1QRRA 3F5DA 4EVQA 3ZDBA 1F2DA 1ETHA 1K4MA 1XZAA 2GVZC 4JBNA 2J5PA 3CUQC 1OILA 1YS6A 4M8NE 2WY7Q 2YVQA 1DTWA 3P0JA 4V0KA 1W4ZA 3TOZA 5DBGA 3UJ9A 3VHXA 2GM4A 1PQYA 4BZWA 1YK1A 2JD2A 2J09A 5BW4A 1PUIA 1F4VA 5K3FB 2HCBA 1NUQA 4P92A 1LPSA 3N8KA 1PR4A 3U13A 1KMHA 4ZYYA 2WC1A 2XPCA 3LX5A 3COJA 3IC7A 2HRZA 3JQGA 3F2VA 2OHVA 2QP4A 3QPDA 5GM1A 4C2BA 2I10A 5M3FJ 2VF2A 4I36A 1YR8A 3WU1B 5CJ9A 2UUBB 1TECE 5B3JC 3JR3A 5I4IA 4YFYA 4YS6A 1NYLA 4OOFA 3B6KA 4RBOA 2B30A 2K2WA 5ERXA 3ROEA 4DQ0A 6ADHA 4X65B 1QP4A 4UUTA 1S89A 1T2VA 2GN8A 4N65A 4CEIA 2G5PA 1LPBB 5DWVA 4CM5A 3QLUA 3UJNA 1F5SA 2E19A 3DO6A 1UBKS 4G0YA 1E62A 4PSWA 1W9HA 3RKSA 1RZ4A 1UJ5A 2H57A 4IDEA 4Q7LA 4QBIA 3ZDQA 4IY1A 5IEJA 1PJZA 2FZLA 4FT2A 3VTAA 5CA1A 3I5AA 4B17A 4X92A 5LZ5A 2ZRDA 2X15A 3FKSD 5A06A 3AF4A 3R6LA 3UGJA 5MHTA 2Q1ZB 4MCIA 3CCYA 1V7PC 3IR7A 4LXYA 4HVLA 1BW5A 3ZY3A 3F9IA 1PJ4A 1WHSB 2PWYA 2A5YB 1B59A 1T3SA 1Z6ZA 5BN4A 1NSFA 1DQYA 4E2WA 3B82A 1DIHA 3W2FA 3DE2X 5FKJA 1VJ1A 2XUJA 1R4AA 4V2FA 4W5TA 2DCEA 2XB8A 3AINA 4JA2A 2YKGA 4MGHA 2BJHA 1L1RA 4NQWB 4U7JA 2AEEA 3KYDB 3IQGX 4JEIA 4MMYB 3A01B 4G6ZA 5TF0A 1SZPA 2BM8A 4J9UE 3K2QA 4BNUA 2JBWA 3UK1A 2E82A 2HSGA 2Y67A 2W8BB 3ON5A 4CCYB 1PYGA 1K98A 3WGHA 2X23A 2C1XA 1ZXXA 3PIOF 2XRLA 2D1QA 2BH9A 3KOOA 3SZRA 1XX6A 4HWSA 2DR2A 3CRQA 1Q20A 4N0EA 1U0TA 4A10A 1M8GA 4XIYA 4O4HA 5JDIA 2VOPA 1M34E 2J59A 2I6UA 1P2TA 2DAPA 3MTGA 4M6VA 3OPNA 3OY2A 2EDCA 2UYCA 3GLFB 2B2XA 2SICE 1PTKA 3M6XA 3O2JA 3TWOA 4BFYA 4RDXA 2ZTHA 2EKDA 1E0JA 1P3Y1 4OHRA 4DB4A 2QU7A 2X42A 3RLIA 3KT3A 4WMLA 3ROGA 1MFZA 1E2JA 2ECQA 4X7MA 2HNBA 4AWXB 3MS4A 1E94E 1Y1QA 3PG5A 3KR9A 4E6PA 3C87A 5ETJA 3AW9A 4LF5B 5D8DA 5SY6A 1ELOA 2JZYA 5FLXA 3K09C 3H5OA 1C3VA 2BEUB 2O7QA 1N6HA 4UDYX 1ZUIA 2F1JA 1D1TA 2PGNA 1QOPB 4YUYA 1Q7CA 2A5WA 5DNWA 4Q4AB 3BMNA 3T9CA 3OUTA 2VCEA 4RJ2A 3VZBA 2Q5CA 5D6OA 1EFVB 1RZVA 2R1VA 2V3CC 3PRYA 4J91A 4GIBA 4C5AA 5TEVA 1RHJA 1VSTA 3BF7A 1AMNA 3U4AA 3WGUA 3EPJA 4DC9A 1E61A 3X1ZA 4HEA6 1RRGA 1MQAA 5HR5A 5KDDA 2GLXA 5HFNA 4OIMA 4M9UA 1A3CA 4FFLA 1Y82A 4HB0A 4QUAA 4D7MA 4H3SA 4TV7A 5CJPA 4DW6A 5CITA 3G88A 2IYTA 5D4RA 2COEA 4L76A 1PX2A 4QSHA 1HORA 4UUNA 2AK2A 5LNK6 1YDWA 4CXMA 1IM5A 1YT5A 1I7PA 1LUJB 5HCUA 2I5PO 1TE2A 4R4JA 5I48A 1GT91 2FSPA 3JQ9A 1OCPA 4WXHA 3EYIA 1LE8B 1E3IA 4KAAA 1KYWA 3ZDZB 4BAUA 2B2NA 2X1DA 3W2AA 2VRWA 2IYAA 4DSNA 1K7XB 1ZRCA 1AD2A 1HEIA 1FTSA 2E5FA 2GHRA 1SCNE 1FJ2A 4I1IA 3LVBA 3WO1A 2F4MB 2A5DA 2GNAA 2QK4A 5F5XA 2YX4A 3PD1A 3QKUA 3STUA 4X7PA 1PAUA 1QGDA 3BDDA 1QYRA 3HDVA 2WJ3A 5JVGF 3SXUB 5JISA 2E6KA 3SGLA 4Y9DA 3Q5GA 4MLDA 5CURA 1RRPA 3M6LA 3V1NA 1PJSA 4IEIA 4MUXA 2O3TA 2CNBA 3BRWA 3SOPA 4CDGA 1J9GA 2BLNA 3VR2A 1X1BA 2P0AA 3R24A 1TUEA 3VSLA 4UDXX 2O3SA 4XLZA 1N8KA 3B6JA 3NCHA 3STHA 4PR3A 2ERCA 4F11A 4CKZA 3SP1A 1GQ2A 2YXPX 3A4VA 1BDHA 4JP2A 3DOOA 2VAWA 4CLOA 1U1DA 1N9GA 4QRIA 4ZRNA 4B46A 4RX1A 5JYBA 2HA7A 1EMDA 4B43A 1KJZA 1YR2A 2VDPB 3D9QX 1YVEI 1A5TA 3ZCUA 4DJTA 2ZTMA 5B7QA 5GJBA 2E7WA 2UVPB 4BQSA 2IIPA 3RB8A 2DXIA 4M1QA 4I02A 2XWJI 4PQRA 3FXRA 1YCFA 4WVLA 4UTZA 1LI7A 2MD0A 1REQB 3VPFA 1L0BA 4RAFA 1K2VN 1T0IA 2JPBA 2FRDC 5DYMA 4PVDA 4K3VA 4YRJA 4EI2A 2R7RA 4EPTA 2XDYA 2UDPA 3SQDA 1W4LA 3Q10A 3V4ZA 2GS9A 4QU9A 1Z45A 3VNQA 2YOGA 4BQRA 1GLVA 1KMMA 4MHTA 1HW2A 2HV8A 3H5VA 4FBGA 4IX7A 3BBLA 3ILSA 6Q21A 3F8NA 1LBQA 2IKSA 1TA0A 2Q46A 2YRXA 3WL7A 5BOSB 2QUJA 3WLAA 3TTYA 1ZY2A 3ZI7A 2W6IA 2QAGA 3KLOA 4DCUA 1V11B 1I7QB 2CDRA 3CLVA 3A6ZA 2XPWA 4IRIA 1XEWY 4ODIA 2PDAA 4ZVPA 3UO8B 3T7DA 3S70A 2OG2A 5EQJB 1IXCA 2P6OA 3QPHA 4HNVA 1LY1A 3GEGA 4NY1A 3ROTA 3R7WA 3LUGA 4NV0A 1AZSC 2PJUA 3LUFA 4NZ9A 5DOZA 5CLJA 3TQIA 3JQFC 2WY8Q 3A0UA 1FXUA 2INGX 1KMNA 2NRAC 2J0EA 3JAKA 4S05A 4JUBA 1A5AB 2D06A 4TQGA 2A58A 2Q8KA 1NTRA 5IMBA 4JBIA 3TSZA 2YYSA 1PQUA 3AB3A 3E48A 1NMQA 1XF1A 2H4WA 1FTWA 4H18A 3FK7A 4LX0A 4YJFA 4PZZA 4ZAVA 5KYUB 2C4VA 4C0AC 1P2DA 2IXSA 3UM9A 5FI0B 1SVNA 1WJBA 4C01A 1W46A 4EL5A 1CNEA 1ZDMA 2A4MA 2WPDD 4PANA 4KR6A 1R22A 1WQ2A 4UUVA 2BI8A 4GKVA 4J03A 4UQPA 1ZSVA 1ZYRF 2O7SA 3ZDRA 4BYGA 1JNYA 5IOZA 1ULUA 2FMXA 3DOCA 1HSOA 4IKFA 2ABWA 3EGCA 1XCBA 2HPAA 1C7IA 2I7CA 3P45A 1ISSA 4AYBN 3GT4A 4MS4A 4AN4A 4EG0A 1MOQA 3HWSA 4M86A 4ER7A 1JPNA 2DPYA 2LPMA 4L9AA 4DN6A 1XWWA 4F46A 4YPVA 3BT9A 2X1MA 1EWKA 4MITA 1LJ9A 1EBBA 2XNDA 3ZHCA 4DNCA 4Y7DA 2H7XA 1E2BA 4DPMA 2D3WA 1JJVA 2JI7A 4GBGA 4BQQA 2YN2A 2ZSAA 3ZZNA 3IC5A 3RFTA 2HXSA 4D6YA 4I1UA 5KTKA 1PI3A 4GOOD 2ZR8A 3JPYA 3DDHA 5KEIA 2BOVA 2C8KA 4BQNA 2NM0A 4HNHA 4E5VA 3Q9SA 2P9CA 2A3RA 2OVBA 1J00A 5A4IS 3NC4A 3AR9A 1U8YA 4RD3A 4RA9B 3I9OA 4M8IA 4K1LA 4F3KA 2PV0A 3NRBA 5L4LA 5A4JA 4FZRA 1HFWA 1JTEA 1Z4LA 3GBPA 1FMFA 5FBVB 5JNUA 4XUEA 2CFXA 1YTUA 5EIFA 3JRCA 2GM3A 4ZO8A 1T8TA 2Y9PB 4HA8A 1ZZEA 4DDHA 1V8ZA 2ZTLA 3RF7A 3ABOB 1C9JA 3L8CA 2P2DA 1NQWA 3KQQA 4GUAA 4FQGA 1OOEA 3HL2A 3PX3A 2ZBEA 1OVGA 4OAQA 1YC5A 3AF6A 3CUQB 1E99A 2KHMA 1E58A 4CSWA 1KJWA 3EWAA 3SAJA 2WLSA 3EXHC 2E34A 4HP8A 5DM4A 3EC2A 5AJHA 3K70B 1PVVA 1IN6A 3LLSA 3K4JA 1SMYF 1YYVA 1EFLA 4N5IX 5BO5A 2W57A 3MJVA 4Q93A 4YWHA 3JTEA 2ZXEA 3K0CC 3GG2A 2YZNA 4LRUA 5BPIA 2DPHA 3R6GA 3E5RA 1IW7F 5ES3A 1VTKA 4KRGA 4PZCA 5KTTA 1G20B 3QVXA 2JFNA 3QSYA 4M36A 3HOSA 3HSYA 3OM9A 1QLJA 2BP7A 3F67A 1H8HD 2RJ3A 3R5FA 4LAFA 3UFXB 3W5IA 5KYTA 3K0FA 3M33A 1ZIPA 5J4KA 3QEKA 4CCWA 4QDTA 3WWYA 4RV9A 3GNTA 3K92A 4WESA 5H4HA 1K78A 2CLFB 2LGJA 2HWXA 2WSYB 3NH9A 2C29D 3DO5A 5IABA 4C14A 1SBHA 3NNDA 1RYDA 3DLTA 5E0OA 1X7ZA 5IKXA 1QBKC 3N2YA 1NW9B 1YU9A 2AG6A 1V4RA 1I80A 2X19A 4OH7A 1XAHA 4PG7A 3O9MA 3ZPLA 1J22A 2PRJA 1XMSA 3BFJA 5EN4A 4BKUA 3OYGA 1LK5A 4DLTA 5A71A 4TYNA 1L5RA 2IPOA 3LA6A 3A4IA 4BKOA 1R6UA 2FW9A 4UAUA 4LZZA 2AX4A 3CVWA 2R5NA 3K9CA 3KJHA 1Y5NA 3TLZA 5L51A 3OT5A 1KY2A 3KJNA 2B37A 1FRZA 1DUXC 1XMOB 5HOEA 2V1UA 1XHEA 1KP3A 3AEKA 3E2MA 2QUAA 2R8ZA 4IW3B 4OU5A 3CNEA 4IH4A 4CN9A 3FCEA 1Y5RA 4L5JA 4IFEA 4X66B 2JUGA 1NMXA 1RKBA 2DMNA 2ORED 2ANCA 1GGMA 2CBXA 3OX2A 3ZHSA 4TROA 1U02A 4QBFA 2CRGA 1PDNC 4HEQA 3TE7A 3DL4A 3TP0A 1SUDA 2D1RA 1HOMA 2G9NA 1AU7A 1JEJA 1XDZA 2EZ4A 4IOAF 4FS3A 2H1VA 5BWCA 1PHPA 1W0UA 2JFHA 3LYLA 3KEFA 4U3JA 1XN4A 3BGIA 1EP2B 4ZH4F 5BQTA 2O8BA 3LYUA 1RTTA 1RPZA 1LW6E 4PYOA 3OF3A 3R7WB 1BN6A 3Q7IA 1LLUA 4LY0A 1XCJA 3Q40A 3HRUA 1OWLA 4V1CA 1OMOA 1RYMA 4NMWA 4DXDA 1KY3A 2NTYC 3WI7A 4YRKA 1G3IA 4E07A 1JKQC 4Q48A 2ILTA 5CM9C 4GP9A 3U4QA 2J0QA 4GPIB 4Y2XA 1SKMA 1S2NA 3G8CA 3UV6A 4ZI7F 2J3QA 4FD3A 1P9WA 4K9SA 5FBKA 2FJ1A 3ZH9B 4CDRA 5EY5B 4ITUA 3IHTA 1KI7A 4TZKA 2PXXA 2OCBA 3CX6A 2SNIE 1AHDP 4UUQA 1SOVA 5EMLA 3WLJA 5IXJA 1S7GA 1DIOB 1FUUA 2CY0A 3EJWA 5JNRA 1BOBA 5DYNA 1P80A 1K6IA 3PENA 1MOSA 2WZQA 1GR1A 1TQHA 4P93A 1BXRB 3HY4A 3L4EA 3MJHA 2Z9OA 2IZ6A 4OLHA 3GEBA 3SWWA 1K97A 4JHXA 5DIZA 3MZHA 3JQBA 2ECOA 3UXYA 1Y7IA 1FQOA 3HQ4O 4OKNA 1VYHA 4BY1J 5TS2A 2OM2A 3ASVA 4R3UC 5F9HA 2FWRA 1C7FA 2YOFA 2KT0A 1VPVA 3PKJA 4G86A 5ALMA 5IBQA 1M1NA 3N3AC 4W5WA 5F1KA 3LPNA 3B3JA 3D0QA 3I4CA 4RJIA 1MH3A 2H54A 5FUMA 1S5LC 1U7XA 4HNSA 1NVUQ 2GAUA 5DF1A 3DXYA 2BDUA 3WIOA 5KTNA 2QI9C 4JLKA 3LWDA 4F12A 1F14A 5C18A 4KV7A 1XYYA 2J6IA 1K8QA 3Q3GE 2RKWA 1BGXT 2PR7A 4HDQB 3L84A 2V6GA 4QDKA 5DB4A 1NRWA 4XFKA 1PDOA 4B76A 2FMIA 5AI0A 4XLCA 5JCOA 1OV6A 2G9VA 2UV8A 3QUCA 1YFKA 1MENA 4HX2A 4TL8A 4HLNA 2QQ9A 1HV8A 3QTBA 1GTVA 4OXNA 3EF0A 2FZ5A 1HLFA 1Z77A 4OSOA 3MAJA 4IRHA 2BI7A 1GG2A 3BWBA 1LE8A 1M2OB 1B72A 5FOUA 1WJDA 2D74A 1HK7A 1IIRA 5E4YA 4DCSA 2Z2YA 4KUMA 3A9VA 4B3BA 7MHTA 1SWVA 3UK7A 4UFPA 2DKFA 4PJ0C 3D3WB 4GI7A 1Z0UA 2I71A 4A3SA 1F8FA 2PUGA 1O94C 1GPUA 1EP1B 2JI6A 2HU8A 5DTRA 1MH4A 3SHWA 2OBPA 2IH2A 1YJBA 1ZJZA 3O8QA 1ISMA 2IYWA 4KSYA 2YW2A 1K9SA 2XUBA 5JHUA 3INRA 5HP4A 5CA1F 4RD4A 4YP9A 4NPHA 2JCSA 3X1MA 3A1VA 4D5EA 1EGQA 1JJFA 1V3FA 1O95A 2NWQA 3Q5EA 2ZUFA 1CHDA 4BQAA 2P5YA 4Y3UA 5B1IA 2HVSA 3EMKA 3DCIA 1RE1A 4KN9S 4Q3CA 3RBXA 1EA5A 1YJQA 4JP8A 1EFVA 2P2CA 4RHCA 5IU6A 3GROA 2DPGA 2W4SA 1JHOA 1K6MA 1YB5A 1I1GA 3GAAA 1MD0A 4IZOA 2PK3A 4TVOA 4DJ5X 1Q91A 1V9SA 3RC9A 3RTCA 4BY7J 4HTAA 5FL7A 3QGMA 1CQIB 1JMVA 7ADHA 2PVSA 2NXWA 2V65A 4HD8A 1SUBA 1EDDA 1I3AA 4HDRB 4L8GA 2AFRA 4XGKA 3IH3A 4EK9A 1P2BA 4CPDA 4KNVA 3FM5A 1J0XO 3VAAA 4YJ2B 4O5VA 3BL8A 4NK5A 3TLKA 4AMGA 3QBEA 5LFAA 5K8CA 2HQOA 1D0XA 4PO3X 4ER0A 1ZISA 1N1EA 1TX4B 2FPOA 1P45A 3CLOA 3MJCA 2Z95A 3NUQA 3UWMA 3ZI4A 1PE0A 1Z7GA 2ZB2A 1W0KD 2PFKA 3HWWA 3QE9Y 1U6GA 1Z2DA 5G0SA 4NFSA 1U0OC 1YDHA 1Z7WA 2VYCA 2XAAA 3D4OA 3NRCA 3PQ4A 3M1YA 4HH0A 2UZ1B 4MKXA 2MSYA 5CDFA 2BFBA 3RAPR 4QRHA 4CO8A 1T8PA 3FR8A 1C81A 5MFZA 3WL8A 2NUPB 3H84A 1BA2A 4AS2A 2Z2XA 1W87A 5H81A 1QGUA 3K1AB 1HBXG 3WOHA 4F6RB 2WKWA 2WM2A 4TVSA 3N4MA 3O2QB 1FNSA 2QVGA 4HX7A 2ME6A 2ID9A 4KDFA 4F55A 2NIPA 1MC8A 3PQCA 4G2TA 3WNBA 1YJCA 3HKEA 4XX0A 1N5IA 3UB4A 5L3GA 4XN0A 4KWCA 1KYTA 3WSWA 4NMHA 3ZE7A 1IL0A 1KY4A 3KXIA 4QUGA 5AIBA 3MS7A 4L6AA 3HA3A 1B72B 2ZJQF 3CC2I 1AQNA 4C78A 1ZICA 1A7UA 1ZI8A 4CKYA 3OPMA 1JU4A 4IL6C 1NW3A 2PKCA 4YV7A 3N7AA 4HPWA 4FHTA 1IN8A 3TVYA 3T95A 1DX6A 3ZMUA 3FKJA 2WAYA 1MJBA 4O0MA 4P0PB 3J7AC 2WBLC 1R15A 1R3DA 4MQ6A 4QRDA 2O4UX 3O47A 4FLEA 4QWQA 4L3WA 3UMGA 5CA1B 4OD0A 3UJ8A 2R7FA 3FWNA 3UENA 1R0XA 1L5OA 4GPTA 5JNSA 1UMBA 4YDQA 3K9BA 5JR3A 1WXXA 3DNMA 2KRCA 1BDMA 1TNDA 1NR5A 2ZYHA 3RCOA 2XQFA 3QUQA 1VQNI 2HR1A 4WOPA 1E6WA 3N2KB 2HGCA 1DRJA 3CZAA 4A0QA 4EJ0A 3FX3A 2ZT8A 4O2LA 3WLSA 1P81A 4FDAA 5JATA 3W6VA 3D0KA 3LQQA 2LV8A 4ZOLB 2F8TA 4LOAA 4XGIA 2O8EB 4GBJA 4RA2A 1D5WA 4QYWA 4X44A 2F48A 2PSHA 5ABPA 1XTPA 1BVUA 1NN5A 1YE5A 2GDZA 1PUXA 3ASZA 1C7ZA 3DG9A 4Q01A 4ALLA 3RIHA 4ZZ3A 1DUSA 1KA9H 4AJ2A 4YXWD 2V4UA 1MRNA 3DEZA 4DABA 3LF2A 5FB2A 3I8XA 2VPIA 5KNCA 4WXRA 1SBYA 2O8BB 4ZYZA 2WU4A 2CS3A 3DBOB 4O2BB 3I2FA 5DXAA 4WX9A 1TYBE 4K1XA 4EYKA 3AVWA 2PWZA 1XA4A 2P2LA 3MCWA 3S27A 5LMCA 1FSFA 3BL5A 4NQRA 4EVSA 1A2KC 3KFXA 3BKWA 3TNFA 3AEZA 4FYMA 1XRMA 3NX4A 4DEXA 2GCOB 2OA0A 4OAZA 2GO7A 3PUYA 2HJSA 3PEFA 4GLBA 4TTRA 3U4GA 3WHLA 2OYSA 1ONBA 2LOOA 5IYBJ 1TDJA 3H2IA 4RFLA 3RDIA 4I1YA 3WGJA 5DYYA 4R9UC 4Q9NA 3FCUB 3CINA 2UVPA 1LDJA 3A4YA 3DEAA 4Y6PA 4YY3B 1RKWA 4XW2A 2A92A 4EG7A 1E7WA 3A11A 3DBIA 1JXQA 2GSWA 3G82C 3GH3A 2IVMA 2F67A 4I1RA 5AKYA 3LXUX 4ZHQA 1QO0A 3K1NA 4U3JB 1E59A 4LHYA 2R1ZA 3DBHB 2E0IA 3CLTD 4QQNA 4XB1A 5D5QA 1KH1A 1LPPA 3I42A 1OTXA 1CY6A 4OLAA 2YJ3A 3V4RA 3M5DA 2Q6TA 4F4UA 2YV4A 1KARA 1UKBA 3QU5A 1BHSA 3WRXA 2ACVA 1B16A 2CLIB 1PVOA 5KHDA 3DNFA 3TSYA 4P4NA 5B64A 2XV1A 3GEPA 3Q9LA 3JQAA 1MH9A 4G7OF 4YK7A 4DLNA 3CUYA 3FTDA 4DQVA 2FMYA 5L3FA 4WCVA 4FGSA 3OWHA 1C9DB 3HO1A 2DT5A 3M6AA 3KOZA 4LXHA 1U3VA 2BGRA 2K6GA 5KAIC 1JG4A 1HRKA 3OQHA 5GZ1A 2H0QA 5BXYA 4EHHA 3M6MD 1BJAA 4A3GJ 4JKYA 4L28A 1E7RA 5C81A 3EYAA 1KAOA 1WW3A 1HDIA 4ZXPA 3ZHQA 3FFBA 1GVJA 5LGUA 5JQGF 3ZQKA 3W2GA 4M9XA 4F3CA 2NUAA 2V9PA 1Q21A 3R41A 2IBSA 4O29A 4MW0A 4K8RB 4MWCA 1XHFA 2O2YA 3IEKA 4C3HJ 3JRHA 4EG4A 3MOSA 5CBPA 2GX6A 2XA1A 1R5BA 4EY8A 3IE2A 1PF7E 2Z1NA 4MAFA 3FGOA 5LYYA 4YYZA 4DMRA 1GTZA 1FXWA 2OGUA 4A2WA 4ID3A 3RJTA 1Y81A 1YRWA 1PK8A 2IX3A 3ERCA 3ELUA 5DX8A 3CUQA 1QGZA 3L8ZA 1G21A 3WNQA 5JS2A 3QXCA 2VOJA 2L0KA 2IS1A 2R1VB 1BBYA 4Q7EA 4E6KG 4EGQA 1T2FA 3A0HC 1U2TA 3GDGA 1P1FA 3OU2A 3QKSB 2P4SA 2UYQA 2LE0A 4N3CA 4QAQA 5LBQA 4O4IF 4Q4AA 2IZ7A 3GAZA 3NBZC 2PYDA 1LF5A 2Q2WA 3GI1A 3JYPA 3PDHA 4J2HA 4RZ2A 2V7GA 3S2YA 3SPXA 1MMFB 4EEXA 2AZXA 5EDNA 1HSZA 3WTUC 3DF9A 3QENA 4JB8A 4XDYA 3I73A 5ALDA 4FFBB 4ZQEA 4BU2A 2PMFA 5DN9A 2K9SA 3G02A 5JT1A 4MX8A 5C5IA 3JW8A 4MW4A 4XKJA 4ZV9A 1PZEA 1FY2A 3JSOA 3DLPX 3PFHA 3V7WA 3IERA 3JQDA 4EH1A 2FW8A 2XEXA 3U0BA 4J16C 4N0BA 4BBSJ 3N0WA 3Q0IA 5IWAB 2V0GA 1EXMA 1C0EA 1C1XB 1U5AA 1P61B 2J8ZA 3TK1A 1ZAOA 2WA1A 1V37A 1QAOA 5L4SA 5A5VA 1H2ZA 2NO4A 2VBGA 2ZB4A 2HC9A 3CFYA 4MV7A 1P1CA 1IC6A 3EQ2A 1JDTA 1VP3A 4JVNA 4P08A 4C7XA 4PGFA 5ALKA 4ENMA 1SXPA 1CUIA 4TRNA 2HQBA 3VNBA 1DAFA 1DRUA 5CGQB 2C31A 1OGYA 1HM5A 4FYKA 5FR1A 4LFCB 1ZD9A 3Q72A 3RJZA 3SX0A 4EVRA 3UGKA 3ANNA 5EWLA 1ST3A 1V9CA 1SH7A 1YKGA 1YZUA 2PD6A 1TAHA 3LF1A 3GJYA 4N6GA 5FA5A 5IAOA 5IJ0B 2V03A 1HETA 2PXAA 2OCGA 3IMCA 2WKPA 1OXMA 2KKOA 4TTAA 5ALZA 2D1SA 2ID4A 1Q17A 4BBRJ 3FDZB 3H19A 1B93A 3GZ4A 2W98A 2ISSD 3O4GA 4TL7A 2I1VB 3AF1A 1NC3A 2I55A 3GVPA 3KWFA 1PT9A 3QTLA 1HLGA 2PMZN 1FU7A 1W0CA 2VJNA 5EKTA 4BO0A 3V7SA 1T2CA 3ABQB 4GP6A 1U8RA 4L02A 2E5NA 1XJQA 1T9BA 4ND8A 3I9V2 2NNWB 5EINA 4C7OB 3DV8A 2ZUCA 3UUEA 3BSSA 2VHVA 3IOEA 1V16A 2CE7A 1SFEA 1PR3A 4CVNA 1AJEA 2JFGA 4MLOA 3BWEA 3KJFA 3KB6A 3O8LA 4ZCLA 2V3VA 2GKSA 3HNRA 4F71A 4DGSA 4ETNA 3HOVJ 2QNIA 5ELLA 5SZHB 2J5BA 5AK6A 3ZQJA 4C3VA 1JQEA 4QBTA 2DA7A 5HVNA 3DZBA 1FPMA 1I7DA 1QQBA 4LYFA 1MJ5A 4BP9A 1NIPA 1X0XA 3L6RA 4KN6A 2Y3IA 1V11A 1AM4D 3V8BA 5HZHA 1BAPA 1P4WA 5F1JA 3FNRA 3OD1A 3PUJA 4G0WA 3EVTA 1WL8A 2I0FA 4YP5A 3ZWVA 2ZJRF 1KMHB 3EDPA 1UBSB 1ZK3A 6PAXA 3TO6A 1CFJA 3CBQA 4U39A 5A3SA 1KWKA 5F08A 1ZNWA 3T1OA 1XDSA 3USZA 3CNOA 2YH2A 1ZH0A 1ERDA 2UUZA 5JYCA 1RRFA 2VQSA 2VHXA 1R8YA 4NZMA 3RADC 2EIHA 4Q02A 2OA4A 1LV8A 5G1PA 2R7TA 1N2JA 2QNRA 1E5DA 1ZCFA 3LX6A 2CLSA 4NCNA 4WPGA 4YV0A 4EHKA 3GFIA 4IDDA 4JELA 1THMA 4Z2YA 4I55B 4TOIA 2A14A 4ZARA 1O58A 4OHZA 2CJJA 2QPTA 1Q1AA 3UV3A 3BWMA 4KVFA 2MHCA 1OZ0A 2F4IA 3FVVA 4WV3A 2ZZKA 4DNFA 2BGNA 1Z13A 2DSTA 2V7UA 3KR1A 2X7HA 2CHQA 2ZYRA 1R7JA 3DW1X 4BNKA 2BFOA 2FSSA 2JGJA 3B53X 4GF5A 5MN5A 1L4HA 1VP9A 3JQ9C 2PAFA 1UAAA 1OX6A 1TZCA 4UMDA 1WKBA 1BR1A 3LWFA 4PZJA 4K6OA 5FKLA 2VDWA 4HFRA 5IVDA 1DAPA 2NSJA 5YASA 3STTA 5KPJA 4MUEA 4X3CA 3NWJA 3U7QB 3A02A 2CMHA 5CFRA 1OFHA 2HMUA 2IHBA 3N53A 2FB9A 3M1LA 4PLCA 2EJTA 2K27A 1DOAA 2IW3A 4PUSA 1X15A 2PCLA 3GYGA 3KIPA 3NAGA 4X1IA 5BSMA 2KW5A 3OD5A 4F4HA 1WB9A 3K9HA 2Z2ZA 3S1RJ 1DARA 1CRLA 2QRVB 4TTJA 2AE1A 4TL6A 4YJ3B 4PSUA 5IC5A 2VSOA 5K05A 5L3QA 3ZGZA 4X54A 1C1HA 2CUFA 3L93A 3M70A 3KTAA 5CW2A 1GFSA 4F52A 2Y2ZA 2AOTA 4JBYA 5JD4A 1NBMA 4K2EA 1FYWA 4Z4HA 4LF6B 2G07A 2KQRA 1NN1A 4HAWA 1A9OA 1AK9A 3AUYA 3K0AB 4KP7A 1XD2B 1TIBA 2A9JA 1RQPA 3MTJA 3RR2A 2A0UA 3M4ZA 5HNKA 1DKMA 2EV5A 1ZMRA 1SGWA 4JNCA 5GV7A 1DADA 2BKXA 4U2DA 5CVDA 2C92A 1UFOA 4MVXA 4JJZA 4AUKA 2QXTA 2CYCA 4PQFA 4D4HA 3PKZA 5F2NA 3TPCA 5JJBA 3W8NA 1QS0A 4DE5A 4DRXB 5KC8A 3WV4A 3FXQA 3E03A 4PK4A 1I2BA 3NYRA 4RGRA 2QLTA 5EJ5A 1NW6A 2C3UA 2WPNA 3AKCA 5EIBC 4BXUA 1SXJC 1Q50A 2FWBA 1KJJA 3DVLA 2HRRA 3KK0A 4P5PA 5EYPA 2VHCA 5BP7A 2XNKA 4CKXA 3V8KA 5BUZA 3I09A 1A0OA 2O2ZA 3WIBA 1G4UR 2HOAA 2P79A 4Z4CA 3HXQA 1YRNA 1YL6A 2W82A 3FZVA 1DKLA 3H8SA 5A03A 3EUAA 3I3LA 3S2DJ 1SFRA 2WWWA 3C6KA 1ZUNB 4QC2A 5HTOA 4HV6A 2NVOA 3CDHA 3ZIAD 4BZZA 4BL0B 1YZ3A 1B1CA 4R1PA 3I39X 4IYRA 1JEEA 3DL0A 3PNVA 1KQ3A 1M2WA 3G85A 1Y8RB 1BO6A 4P3OA 4RJLA 4YASA 3IP6A 4CDMA 1GPH1 3BERA 1QC5B 3SYLA 1IF1A 1T0UA 3JQFA 5E20A 3PHCA 1E2XA 2DOFA 2HU2A 2GOXB 1BRMA 1C80A 3VKWA 2X3YA 3TL4X 4MI3A 5CP8A 3G79A 3HBMA 1KYXA 4HNAA 5BMZA 5ALLA 4CHTA 4IHWA 1XG5A 5TJHA 2ATVA 3ISPA 3DONA 3AVPA 2AWOA 5KNCH 2J48A 1QHXA 4TTTS 4C4SA 1ON1A 1IWPB 1FSEA 2H7YA 3K73O 5DCYA 1EGMB 2ZLBA 3JARB 5JCPA 3SXJA 4UEQA 1PL7A 1QH8A 3AHEA 4ANJA 1FS6A 3BD9A 5D3MB 3VU0A 4L73A 1IEXA 2HZBA 3HG7A 2BBTA 3MILA 4OHUA 1KI4A 1NBME 4BRWA 5EG0A 4CQMA 2DUJA 2FP4B 2H6EA 2WFMA 5EIEA 4BX0A 5EJ6A 2HRBA 2R9VA 3CP8A 2X5NA 2QTAA 4PYIA 4JL8A 5AHXA 3AERB 2QT9A 4OJMX 1YR7A 3AUAA 4PE5B 2PKXA 1M2VA 2Z5VA 1P0MA 2SBTA 4RZXA 1VYTA 3F1LA 4JA0A 4JT2A 4MPJA 1OA0A 1XZGA 4UZEA 4AMZA 3FBIB 2D2EA 1XXLA 4ZZDA 3E6BA 5IP6A 1ZM7A 2VKQA 4LBZA 4RB3C 5FKKA 1JHVA 3DULA 4L5IA 3FXLA 2FEAA 3G2MA 2FSVA 3IBYA 4K87A 2V7FA 4LYEA 4U0VA 2OFFA 3SR3A 1PVDA 4DC1A 1P0CA 4EKNB 4FB5A 4S0ZA 1U65A 5FD8A 4OB6A 3N2GA 3WLIA 2ODBA 4ETIA 5JSZB 4QPPA 5IEBA 1RI4A 2VDVE 2VT7A 3PS9A 3B9PA 3BIFA 4XPIA 3BILA 3OQJA 5IVKA 4I5IA 4P5OA 4EFNA 5LR6A 4DCMA 3CXRA 3GVIA 3W2IA 5FFZA 5AFSA 3DPSA 3EOAI 4B5KA 3PUHA 2JF0A 3ZCXA 5EJ8A 2I33A 4MAAA 4OYLA 5IBPA 4BV8A 4JZKA 2ZP1A 4GE0A 4B3GA 1K2WA 2PFBA 2ZSDA 2RARA 1BE6A 3Q7EA 2QBYB 2WVGA 5F23A 4CKWB 1FLVA 1Q7EA 5GZ6A 4BBPA 1UBHS 5BUQA 4B45A 5AIAA 4D81A 1AURA 1YIAA 4Q05A 4AX8A 3A4LA 1N0UA 4DCVA 3WTSC 5H82A 1R1UA 4U9IS 2C2GA 2M87A 3D8BA 5ES4B 3J80Z 2J9RA 4CG2A 3D0SA 1NNSA 4L16A 2P3LA 4R40A 4Z2AA 5AVRA 1I7SB 5D8KB 1C30A 2EP8A 4TLBA 3CO6C 3WB2A 2JCXA 2OUKA 4ZO7A 3ZWXA 4EQQA 2OQGA 1FX0B 5E7MA 2A4KA 3NHYA 3VYVA 4HAOA 5HKLA 3Q5DA 3DDUA 4IZ6A 4Y30A 2Q6OA 4PO9A 2H52A 4YEDA 1Y8CA 2M30A 2P7HA 4PLVA 3VMFA 4DDMA 1LSSA 2Z83A 3OHPA 4GPD1 4K86A 3EIQA 1QKKA 2JG3A 4J4HA 1IRFA 2CVQA 2IBMA 2ZANA 4I09A 5L53A 4EF4A 3AF3A 5FNVB 5K0LA 4ND3A 2IH5A 4W7HA 1Y8RA 4ZQFA 5E4TA 4MKZA 1GXSB 2BVNA 2BMVA 5KQSA 1K3TA 2HF2A 2VH1A 3HBFA 4UUBA 5DVZA 3ZCPA 4EW3A 2XSZD 1IXYA 2XTMA 3H1AA 5LCXA 2EFGA 3DWLE 1MBHA 1BC5A 2E6UX 5DYTA 3CF5F 1EK1A 4EHAA 3B51X 1ZIDA 1U8ZA 4BEHA 3K2BA 4MSUA 3PIIA 1TYAE 5T57A 3PJRA 3E9CA 2ADUA 2WZCA 3W1VA 3UB2A 2ISCA 3QPSA 4QUKA 1Z73A 4L95C 3DBLB 1W5EA 2IUTA 3OIPA 3GEZA 3FYHA 4PEVA 4DV7B 1L5HB 1FIAA 4R7GA 5KOHA 4KT6A 1Z18A 1XRRA 1N0HA 5FO5A 2WD8A 3PLNA 2OZLB 1QP8A 3G0DA 4OHBA 5K5QA 1XMQB 1KI2A 5AESA 3AV3A 1B3BA 4YIKA 3CRZA 1FMVA 1R5GA 1SHZA 1CY0A 2CE2X 3RS4A 1U0GA 2HIAA 3HYSA 4GVPA 3TAXA 4E5DA 7MDHA 1CUWA 3MMPA 4FZ3A 4EEFG 2XXAA 5B2FA 3R5XA 1N5JA 3N58A 1DWUA 4U7FA 4EAAA 4L9SA 5JHGB 4XN3A 4X0GA 1YR1A 2UUAB 2IHZA 3DQQA 3ISJA 4BB0A 3GL9A 3K6KA 3NAQA 1S3JA 2N42A 3KD3A 1CG6A 1XZDA 3H2KA 1TGYA 3KB2A 1T4CA 2FD5A 1JMKC 1UXJA 3NBUA 1W6UA 2KI5A 3D3EA 3R3JA 5DH9A 1VQ7I 1LVUA 4XM3A 5ALIA 3Q3JB 4XD7A 1RFLA 4RA6B 2AD1A 1SURA 1GIAA 1IOWA 2GXBA 4N5DA 4PYNA 1B2LA 1T0PA 1ODJA 1EH6A 1P5JA 4BMSA 2Q0OA 1X7WB 4W1QA 1H23A 2VYVA 3FUVA 4BGDA 1A9YA 4FIZA 2OK7A 1R3UA 4MXDA 4F2GA 1QVUA 2ZJBA 3PSFA 4G56A 4NS1A 1WXFA 2ATIA 1O6GA 3PQEA 4FGUA 4R8RA 1YZYA 4XRGA 3S2IA 3RVDA 2K85A 2HMSA 4AJJA 2R2GA 3FTCA 2WHEA 1EYZA 1G5RA 5LYJA 1PV1A 2RNJA 1Q0UA 1KR5A 3L6EA 2EFCB 1DWPA 1CVIA 2GZRA 1EFAA 2WI8A 2XQKA 3E9DA 1ZM2A 2QY9A 5JTUA 4OQEA 5DHUA 5J40A 1DTEA 1I13A 1YJ9I 1T13A 1Z6AA 3FPAA 5L95A 1Y34E 3VO1A 3H5NA 3ZWMA 1XC5A 3OZFA 1OX5A 3NBAA 4K8OA 1F8XA 5TMBA 5K03A 1W19A 1TCCA 2HIMA 3AY3A 4R41A 7ABPA 4EJTA 3EFHA 1T5SA 3W79A 4FCTA 4DOZA 4J0DA 1EH5A 4K3UA 3J7YJ 1P5HA 3QYPA 4QLBA 3HJBA 3STXA 1L6IA 2DYSH 3GTOJ 3IBTA 1UPXA 2M0MA 1ZOPA 1NVTA 3Q1LA 4TUYF 5CLLA 3SBEA 2RJNA 4NL4H 1U0HC 3KJXA 4OJNA 3ZNOA 5BN5B 4AO8A 1RXUA 2WPDA 3KG2A 2EL9A 2PQ6A 4P36A 3SNKA 3TTUA 5KVCA 3LQ1A 4ZVOA 3S2EA 1P77A 4TXLA 3RJPA 4LLNA 5FUBA 2FOXA 2XKAA 4BUZA 1EV7A 5HS4A 2XPUA 1VI5A 3E1SA 4AKTA 2W0MA 4CLXA 3HLYA 4YRBA 2Y71A 2MC4A 2EZHA 2FU4A 2I2BA 1XLTC 4WK8F 4QASA 1MBFA 3KALA 4RGXA 4GLLA 2EBIA 4RTSA 3ZQUA 3OZTA 3QVVA 4GXTA 4UM5A 5FBQB 1FW8A 1MDBA 2EERA 3W4KA 3U9TA 2P5VA 3BGVA 4J00A 2KWIA 3GYBA 3IMEA 4MV0A 4DG8A 3ETCA 4I6ZA 3LVQE 2CGEA 2IEDA 1IUPA 2YZ2A 3D31A 1V16B 4JUIA 5EZYF 5P8WA 1DJNA 3BFVA 4IDNA 4E3WA 5TSDA 4IO9F 4ZYGA 2WNHA 3F49S 5FRNA 3HY3A 3PHJA 5JLAA 3UPUA 2CZQA 5IN4A 2P4WA 3QUBA 4UPDA 5EPUA 2DWUA 4QYSA 1JT2A 4ZC3A 5HDQA 2J85A 2OKCA 3Q9VA 2Y31A 3WQBA 4N3AA 4EKEA 1VIAA 2WAQA 3G59A 3JZIA 1IBCA 2I6XA 2WUFA 1NSTA 2V54A 3EIHA 3DV2A 4KGXA 2CYYA 5C8YA 3WK5A 4R5MA 1AQIA 3KZ1E 4BV2A 1KGDA 1Z25A 4CYCA 1E6KA 1RZRD 3C41J 3ELWA 3UH0A 3C7AA 1Z5GA 3ICPA 4MR7B 2YVAA 3HMQA 4NZOA 3QX7A 1A27A 3GR6A 4IGFA 3R3YA 3F9RA 2OBLA 3HXKA 2VBCA 2EJUA 3UF0A 3PUZA 4BVFA 2LF7A 5D8LB 1RESA 4LJ9A 5JO0A 5KSOA 1PGPA 1F38A 3T1HB 1H94A 1VQ6I 1HH4A 3OY7A 4PPYA 1S3FA 1NQ5A 4DRYA 3B6CA 2Y9MB 5BN1A 1CZRA 4XARA 5HM6A 5L3CA 2EU8A 2R1TB 5LRSA 1C9MA 1L7MA 2P4EA 3GFGA 3O75A 3OJXA 4R5HA 4EA8A 3ER8A 1NG6A 3I0TA 2FE1A 3WYCA 5LQJA 5MDHA 1BR4A 1YWGO 2HQNA 1YDGA 1QMGA 4RAYA 1N0VC 1T5IA 2J7PA 2JH9A 3DZJA 4FE7A 4EYEA 2WJJA 2P35A 3BM5A 3INGA 1OQAA 2A1UB 4DIUA 3K7EA 3K4BA 1M7BA 2PJZA 3IBGA 3H3UA 2D45A 3ZGXA 3IQZA 3ISTA 2QTWB 2X9DA 1DP3A 2ETXA 1AGNA 1IN7A 2GPSA 3KQSA 1ZK8A 4F3QA 4IZIA 4X00A 3Q7PA 5HFAA 5AK3A 1KEEA 1X3UA 1Z6YA 4H7FA 2HW8A 4EYGA 2NZYA 2GN6A 1XEWX 2Z9DA 5HQ3A 2VZ0A 1BCRB 3KTOA 3E7DA 4KLRA 1CEQA 2OBMA 4L08A 4B6QA 3OZXA 2QYTA 3H3FA 4Y7CA 1YULA 4CM1A 2YMQA 2ODNA 2LBPA 2VJYA 3N8NA 4OYYA 3VOSA 1FUYB 1V26A 1QE5A 3WWPA 3BR1A 1GJRA 5EKXA 5ADWA 4LIVA 1ZMTA 3B2QA 4EFDA 2BW0A 2JLVA 1AKWA 2ME0A 2B82A 1P33A 1V43A 3EH2A 4U8HA 1HXDA 1JBKA 4QWMA 5ICSA 5FXMA 2A9QA 5K99A 4LMYA 3BZKA 3THXA 1O3RA 4DV6B 1DC7A 4KZPA 2EFPA 1V55H 2X76A 4LC1A 3P9XA 5HF6A 2HMVA 4RVCA 3TR5A 1M1ZA 5H1YA 5K0JA 2OV7A 1CUFA 1UCFA 2M2IA 5ERGB 3RH0A 5EWJB 1NN3A 3NIWA 3O90A 3P1JA 5EMNA 1YRYE 3VM6A 4C7KA 4M3BA 2ZBUA 1KFCB 5K0NA 3RD5A 3T3GA 4KXUA 3Q2KA 1MW9X 3CF4A 3DTVA 3UXMA 4JT8A 2RGVA 3FYUC 2ZJ4A 3OM0A 4LWZA 1G3YA 1BJKA 1FFSA 2EWWA 3GLTA 4OJKA 4PFQA 5EESA 1VJGA 4W9MC 4BNNA 4MVJH 3AOGA 2OCCH 5HG0A 1IOVA 5EZHA 4JQYA 4TT3D 5AVJA 3W34A 3WLHA 1LSJA 3I0ZA 1X7ZB 4Q47A 3F4BA 2BTOA 3MK31 1AS2A 4HTFA 4GZ5A 3JWHA 1MB0A 4G94A 4UMVA 2IYEA 3ZVNA 3W8RA 1JR4A 1R8JA 3MIZA 1RBQA 4L07A 3GXBA 4MV1A 5JS7A 3DMPA 1JKJB 2X8WA 3GAMA 3JR7A 3QXGA 1O8CA 1SD7A 4L0QA 3VPDA