4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
3MFKA 4H0NA 3FM5A 4GO1A 2P5KA 3GRVA 4XLNF 1OYWA 3E6CC 2AVNA 3DUWA 1SAXA 3T0YA 1F9NA 5DXJA 2K4BA 1NW7A 3TO9A 2YQZA 2EK5A 1WRJA 3BUSA 4CTJA 4KDRA 3UZUA 4YG2F 3ROUA 3QRFF 1QZZA 4PGHA 5D5VB 2CW0F 3MGGA 4JXJA 4LB5A 5FLXK 2P7IA 3T7TA 3RYPA 1YF3A 3CJRA 4HF1A 1YFLA 4Q5SF 1IXCA 1J0RA 3QP6A 5FQNA 2R7DA 3DFGA 1EJ0A 4KRGA 5L3EA 4P9UA 2JZYA 4KNYA 2YVLA 3N97A 2XROA 4M73A 1PUEE 5EG5A 1RI7A 4U88A 1T38A 4ESFA 4DMGA 1L3IA 5ILSA 5HOQA 2FHPA 5DWQA 2STWA 1I1NA 5K09A 1RI4A 4OA5A 5LLQA 5LGNA 5CYVA 1OPCA 2O8XA 3UJAA 1EV7A 3FUVA 5JR3A 3F23A 2BM9A 5LEJA 3DEUA 2OXTA 4BP3A 1WG8A 2IT0A 3CVOA 1PP7U 4EJVA 2XAGA 3GFIA 3RPUA 3KR1A 5DTRA 2V6CA 2K86A 4LLLA 4RX1A 1NW5A 4P9FA 2XRNA 2W85A 5FO5A 1V39A 1I5ZA 3WTWC 1SQFA 4PYLA 2A69F 2KJBA 1U3EM 2ETHA 3J81Z 5B1SA 4CGZA 3IRQA 1VP3A 3ABUA 2BBYA 2ZTHA 3LBFA 5F64A 5HEKA 2ESNA 1S6LA 1I9GA 5ILVA 3T8TA 4S05A 1Q0SA 4JBAA 3T5XA 1XB4A 4EQQA 4G56A 5LHHA 2PT6A 5DD4A 1R8YA 5L3BA 4YUZA 2VBZA 2DLLA 1SD4A 2YPRA 3P71T 4FT4A 3SGLA 3B3JA 1UWVA 4F85A 2DAOA 1Z91A 3IL2A 1O9GA 1MDMB 4EV0A 3I0TA 3E6MA 1RI3A 3KPJA 3BKWA 5J8FA 2XYRA 3BY6A 4RGXA 1F1ZA 2HEOA 4HTFB 4YMGA 5HS9A 2A6EF 1Z1DA 4HDUA 2P6TA 3AWIA 2C7RA 3LECA 4C06A 1XDSA 4G94A 1AQJA 3HTSB 2VE8A 3JWGA 1YYVA 1LEBA 3E5QA 2E1CA 1Z6TA 3FPEA 3DOUA 3I5UA 2XKPA 3SHFA 3LKDA 3QOPA 3PFGA 3GF2A 4ER7A 2VDVE 4I0AA 3CJTA 2ADMA 3G2OA 3R60A 5CVIA 1ON1A 2YTZA 1VBFA 1JXSA 1FYLA 3C3YA 1YZHA 1N7IA 4GXOA 5IT9Z 4AIHA 3E8SA 1UFKA 1Z7UA 4PNEA 4QLCU 1VQ1A 5L3FA 4KYWA 2ELHA 4GCVA 1KXZA 4OIOF 3EMDA 4HX8A 1XN7A 2ZIFA 2W84A 5FB2A 3GRRA 3M6VA 4C08A 1JQDA 1TTYA 4AZWA 4U0VA 3I71A 2NAZA 3MZYA 5EHGA 1ZGAA 4E2XA 2OBPA 2FCAA 3A7DA 1S3JA 2V1DA 1ULYA 5E8GA 2FE3A 3AXTA 3K69A 1BC7C 3KFWX 3BJ6A 3CDHA 2AOUA 2GA9A 1P4AA 3NWEA 3UJCA 1MJAA 3D2LA 3U81A 2B9EA 3I59A 1U78A 2PMUA 3V8VA 3NVKI 1HW2A 4ZYEA 2AN3A 2YUIA 3P7NA 2QRVA 1W4MA 2XVCA 1I1SA 4HV5A 3BT7A 1R1TA 2A6HF 3ELWA 1RUNA 1KYWA 1T0FA 2ZXJA 4RTLA 5MHTA 3QU3A 3AJDA 3ZMVA 4U7BA 4BNCA 2VZ9A 3HHHA 3FPHA 3ZPLA 4Y17A 1D2GA 2OZ6A 5LRRA 2G71A 2JTVA 3HRTA 2RDPA 3FXRA 3T7RA 2QWWA 3KR2A 2O06A 3EVCA 4G7OF 1FC3A 1S7AA 4L7VA 2Y0MA 3UJ9A 3TDUC 3SSNA 3NQOA 2FK7A 4M9SA 1D5VA 3NTVA 1BN5A 5IH3A 2EWNA 3WE3A 4UVAA 1HW1A 1KU7A 2E7XA 3ISPA 1W7PA 2OZVA 3ZMTA 1G3SA 2ZKZA 2LF8A 4RB3C 3HA5A 4ETSA 2BM8A 2VC1A 3EYYA 3V8KA 4EM0B 4OIRF 2ZBQA 2O0LA 2W25A 1XDUA 5ERIA 3KZYA 1ZN2A 2JPBA 4Q4ZF 2XAHA 2ZNZA 2E7WA 3NEUA 3ER8A 2F5EA 1P1BA 2YSRA 4RWZA 2MC3A 1H1DA 1QNTA 2V9VA 1RJDA 3E23A 3HCBA 4OBXA 2UZKA 2W24A 3D0SA 3CCFA 3CLOA 4KN7X 1YW8A 3TM4A 2ZMEA 3F8FA 3FYCA 2VODA 4DZRA 3MHTA 3G8BA 3NRVA 3NDJA 4OX9Y 3HSRA 4L9JA 4OINF 3PFHA 3TPZA 3QOXA 1FYKA 1U5TB 1JHHA 4MHTA 3PLAE 4NB5A 3IWZA 2VXZA 2GXBA 5EZSA 4N9HA 1NW3A 2ZIEA 2IH4A 4JQFA 3IV6A 2ZBPA 5FFZA 4M7RA 3UJ8A 2EFOA 3IHUA 2JT1A 4EJTA 1G8SA 3X0DA 2KIFA 3O2PE 3EETA 1SUSA 2XHKA 2FBIA 1P2FA 1B9NA 2HWVA 1G3YA 4KVZA 1YW9A 1Q0TA 3MWMA 3BWBA 2HYGD 3FYDA 3JAMZ 1BI3A 3LA7A 3JWIA 4QDJA 3CUQC 3JW4A 1J5YA 2VS1A 2H6BA 2EJRA 4PYOA 2ZZKA 5HLIA 3WG9A 2KW5A 2VBYA 4FT8A 5HS7A 2QBYB 1L3LA 5C9ZA 1H9GA 4YV1A 2RV8A 1G55A 4WWCA 5KYGA 2NXCA 1BM9A 4KW7A 3ABTA 3O31A 4M6YA 1YUBA 5EMMA 4PYIA 1E2XA 3F4KA 2FMYA 2D2WA 3EYIA 1R00A 6PAXA 5DM2A 2Q2EA 5ICCA 5LSAA 4ASNA 2HGCA 3FMQA 4U7TB 3SZPA 2COMA 2OB1A 4EJUA 3G8AA 3L2CA 3QU6A 4FX0A 1JG2A 2C6YA 3MQ0A 1G6NA 5LRSA 2GAUA 3M4XA 1B6AA 3ME5A 1FY7A 3LAPA 2PQ8A 2Y75A 1DCTA 1KU2A 1L9KA 1R23A 3QV2A 2HDCA 1SQGA 3HCAA 4L9TA 5HLGA 1ZH5A 5CD1A 2I6GA 2XAJA 3EVFA 1WSUA 2FPOA 2YR0A 1HBXG 4HQMA 4PDKA 4DCMA 3THSA 1LJ9A 2X0LA 5P8WA 1KU9A 4WCGA 1XVAA 1ZREA 5DXAA 4RV9A 4X41A 5LHGA 1BC5A 3KPYA 2WV0A 4L5IA 4BLUA 4RYLA 3PX3A 1R5GA 5EHIA 3E6DA 3HEMA 5DM4A 2XUBA 1T39A 3KQVA 3OFJA 3HOTA 2RKHA 5BS6A 1ORIA 5HIIA 1X3UA 1PP8F 3J80Z 1IY9A 1VTNC 3FTFA 1F4KA 2HKXA 2OA4A 2KIMA 1NW6A 4LECA 2IIPA 3R0QA 2ORED 2X4HA 3LFKA 5F2KA 2DQLA 3WTZA 5TRDA 2PFBA 2P6SA 3M6UA 3HVJA 3HVIA 3HSEA 3P2EA 2QE6A 2VC0A 2H09A 3ID6C 5K0JA 2BE5F 1SD7A 1P39A 3L8DA 5AONA 2RVCA 5LR6A 3I9FA 2ZJ2A 4EGZA 2QUFA 1CF7A 2A5YB 1WKMA 2JHCA 4IRHA 4DQ2A 2IH2A 4ZYHA 3V7SA 2IRFG 2NYUA 5E1ZB 2P41A 1LDJA 4MTDA 1F3LA 3KU1A 1OKRA 4OA8A 3OE4A 5DDGA 3SSOA 1DUXC 3T1BA 3HRUA 4MWZA 5D6FA 3OZRA 1MGTA 3HA7A 5GIPE 1OYIA 2IBTA 4I01A 3KQYA 5D8KB 3KLOA 4XUCA 5DD8A 1R7JA 3MTEA 4E2ZA 3CUQA 1YZ3A 2ZWAA 4A5NA 3C6KA 1WXWA 1A04A 1K78A 4MEXF 4LD5A 10MHA 5K0GA 1ZYRF 2GB4A 2VDUE 3WODF 3H2BA 2BH2A 3FXQA 5DV5A 3FUTA 3CC8A 2R3SA 2RC4A 4PGGA 1D2HA 1JQ3A 2FMLA 4XSXF 1JQEA 1IM8A 3K0BA 3KHKA 4G9YA 1PDNC 3Q9SA 5K1YA 3TQNA 3M6WA 4M74A 1QZYA 4YIIA 4EK9A 4IVNA 2ZBRA 1NW8A 3G2MA 2HQRA 4M38A 2DPMA 2PX5A 5HIJA 3BOQA 3F22A 1ZRFA 4RTMA 4GEKA 1Z6RA 3VYWA 4RVDA 5A2QK 5GIOE 2LD4A 4QVKA 3HTXA 4R8SA 3ELDA 4M9ZA 2CWWA 4OQDA 1BBYA 3EMBA 4UXNA 5GP1A 5FD5A 5GINE 3NVMB 4EMSA 3GFLA 3PS9A 3BGVA 4CKEA 1USSA 2XGXA 2JH8A 5E1WA 4CXMA 2P7VB 1U6GA 3R3HA 3E3VA 4CHUA 4FGZA 4BLWA 3IRRA 3LDGA 3UJ6A 4KN4X 3NDIA 4I98B 1VL5A 1OR8A 4S04A 3MEXA 4IXAA 2XKOA 1WXXA 5DCMA 2FU4A 4Y13A 1D2CA 5IT3A 2AZTA 1EH8A 1NE2A 5FA8A 1M0EA 2P3LA 3ZMZA 1B59A 4AD9A 3H92A 3KEOA 2HR1A 2A61A 2EA2A 4RTPA 3B89A 4V0RA 1FP2A 2E5WA 2ZWVA 5DTMA 2ZCJA 5LBQA 4PIMA 1XCVA 1FP1D 4R6XA 4LLNA 4HC4A 2JH9A 2V1XA 3PT9A 1BIBA 1FNNA 2YU3A 5BP7A 5LEKA 1RI2A 2CYYA 3GXOA 5HZMA 1K79A 3B02A 3KQQA 4XUDA 2ZCWA 2P4WA 3GZ5A 2P8JA 2HTSA 5JFRA 1V4RA 1MDMA 2V7EA 2LF7A 4M37A 2P5VA 4P55A 5K0LA 3KCCA 1ZG5A 3KQPA 5KVAA 3C18A 2VN2A 1QAOA 3UBTA 3HIFA 3R0JA 1QBJA 1LNWA 3ZMUA 3LL7A 1UFMA 1ZAOA 2QQAA 2IJLA 2OBFA 4RSRA 3ELUA 2HS5A 2L3DA 5K0EA 1ORHA 2WWYA 3FPFA 4RTSA 3HNRA 4L9VA 2A07F 3QAHA 5GM1A 4C03A 1XCJA 2CWEA 3DV8A 5F1RA 4FT2A 4KIFA 3W6KB 2XVMA 4FP9A 3G2QA 2W57A 2HR3A 2PJPA 1O3RA 1OYYA 3GIWA 5CVRA 3EGVA 5CVEA 4O5VA 1DDNA 3U1DA 3TKAA 3P9CA 3TM5A 1KQ0A 1WQ2A 4RGUA 3F8NA 4C07A 4F7ZA 3Q9VA 1G3TA 5HDGA 5T67A 3ELKA 2K4MA 1MJFA 1FBQA 4FZVA 2IA2A 2N47A 2P3OA 5FGMA 3GGDA 1HW5A 1IUYA 3WU1B 2OZUA 2NXJA 3FUWA 4EM1A 5DRTA 3SXYA 2IH5A 5K05A 2PLWA 3KLNA 5ED4A 3KETA 3KKZA 1JG4A 2ESRA 1FLIA 2NP6A 3DULA 3V7CA 4GYGA 2CMHA 3PFIA 2XVAA 1YG2A 4FSDA 1R36A 3E5XA 2YXLA 3K2ZA 3ER9A 1SMYF 2PX4A 5LQJA 4NQWA 5KQSA 1XSVA 3FZGA 2XYQA 1RI1A 2Q41A 3WTXC 3FXUA 2B3TA 1YO5C 3KZZA 3CKKA 4DCGA 1RJEA 3PVCA 2PT9A 4KA4A 2BGCA 3WGHA 1EAMA 3ORHA 4X1OA 5LQNA 2VE9A 5FLXZ 3A27A 4KIBA 1QGPA 3NMUF 2BV6A 2EB7A 4KWCA 5D4RA 2PX8A 4XCXA 1LDKB 3TRKA 3MB5A 4M71A 3KR9A 3EVEA 1HSJA 4LK0F 4E2YA 3NWBA 2AXLA 3KEQA 4PYMA 3SSMA 3S2WA 1FPQA 4RTRA 1XMKA 4LJZF 2VONA 4OQEA 1XGOA 4ESBA 1D8KA 5E1BA 2WC2A 2WTEA 5LQCA 2R6ZA 4QPPA 2M8EA 5L3GA 4BHPA 1SKMA 4GOND 4P58A 4BY9E 4MQ9F 4ZYDA 3BPXA 2HTJA 3EVBA 4YIFA 1XSDA 4E2WA 4ER5A 2L01A 2MD5A 4KICA 2Y48A 1FWZA 4UNOA 4O3MA 2PEXA 3Q7EA 3RW9A 3E05A 3O3KA 1VIDA 2ZLBA 5DX1A 3THRA 2L54A 4HAMA 1IXKA 3MZHA 2CL5A 3G5LA 3RKWA 1QYRA 1T43A 5D6EA 3RKYA 1KPGA 4ZH4F 5D8LB 3IKTA 5K8VA 2ZBKA 3KP6A 3FZVA 3ELYA 2VT3A 5GM2A 1U5TA 5FHQA 5EVJA 4RB2C 2FBHA 3ANXA 3AY0A 2HZTA 2ZSUA 2P40A 1FT9A 3LA3A 3GRZA 4PYJA 1AF7A 3V7RA 4HQEA 1INLA 4PIPA 1JSZA 3R6TA 3JWJA 5EMJA 5E9QA 2DT5A 4PYQA 2V74B 4MEYF 5AIQA 2P5LC 4KDPA 3VFZA 4ZZDA 4L18B 1K7AA 4L5JA 3HUGA 3U9GA 5EEHA 1IF1A 3VB2A 3IHTA 2FOKA 5D5UB 2CO5A 4R79A 2AS0A 3HCDA 2AS5F 2WA2A 4BHBA 3KQSA 3ECOA 3B7PA 4IV0A 1R58A 4P7GA 3BJOA 3MQ2A 1HQCA 2ESHA 4MTLA 4XBFA 2HNKA 2O03A 4WXCA 1FX7A 3P2IA 3DMHA 3UWPA 1UIRA 2F5CA 3IWFA 1R1UA 4A5MA 1L3BA 5EOVA 3ULQB 5DM1A 3M8EA 4U7PB 1TNTA 2EX4A 4HX7A 2PI0A 2PG4A 5L3DA 1R8XA 2K4JA 2Z6UA 2MH9A 3AAFA 3JTGA 1B9MA 5FHRA 5DTQA 3BROA 4A2UA 1SG9A 3SM3A 4C05A 4HX4A 5D1NA 2MLKA 5BOXA 5LHIA 4AUKA 3FM3A 1F5TA 4LG0B 3OZSA 3BXOA 3FTCA 4AZTA 1XMAA 2NS0A 5DM0A 4ENMA 1IN7A 3RJPA 1U2ZA 5EMKA 4HLXA 3GDHA 1SD6A 1YQAA 3K1MA 3R24A 3I59B 4UHTA 4RVFA 3KR0A 3A25A 2FK8A 4HYEA 2BEOA 3B5IA 5ILUA 1UCRA 3RTRA 1ON2A 2HV9A 3GJYA 5EZQA 1VPTA 3LDFA 1W5SA 1R6AA 4QQNA 2ZZNA 1KGSA 5EQJB 4B17A 3I58A 2EV6A 2FXAA 4DA4A 5E8IA 1TW3A 5F6FA 3MERA 1HSTA 1GXPA 2DULA 4R05A 2QQBA 3LCVB 4WVLA 2Z99A 5IKMA 2JHPA 1E17A 5HIMA 1X1AA 5GOZA 2D1VA 1J75A 4E33A 5KQRA 2G8NA 4IJAA 4LFUA 4RTNA 3DTNA 2B2CA 3KPVA 1W7PB 1JHFA 1QAMA 2I62A 2G7HA 3HVKA 4GF5A 5EKUA 2C7OA 5EC8A 5K5RA 2PV0A 4N9IA 2QYOA 1H9TA 1IXSB 2MLGA 3SZTA 1VE3A 3KQOA 1HMYA 1BHJA 1O54A 3IYLW 3A26A 1MKMA 3TKYA 3LQRA 1SVUA 3CBGA 2HMYB 3KQMA 3E6BA 1O7LA 2PWYA 5HOOA 2IW5A 4KFCA 1RNLA 4UV9A 4G7ZF 3WE2A 2DW4A 2HYFA 3P2KA 3F8MA 3BWMA 1I1GA 4EJWA 2PN6A 1ZLJA 2P3QA 4GOMD 1BI1A 5BPIA 1KA8A 1PJZA 2QQ9A 5D5XB 1P91A 3DMFA 4QWQA 1P4XA 5FCDA 4ER0A 2GPYA 4KUMA 2DFIA 3PB3A 4YUVA 2EV5A 3DXXA 2FA5A 2H94A 5D1HA 3PQKA 1EIZA 4AVPA 4UUVA 2M87A 1R5HA 4I02A 2ACJA 1B1BA 2O61A 1LEAA 4R1HA 2XV4S 4HOBA 4PCAA 3HCCA 4C4AA 3KP5A 3BWCA 3P9NA 3KPUA 2EFQA 2FRXA 3CO6C 1TQIA 1AWCA 5CM2Z 2XIGA 1I4WA 2GQQA 5JI6A 3PX2A 2EJTA 2VBWA 1Z9CA 3GVAA 3BWYA 1ZLKA 3DPLC 1QO0D 3KP7A 3PQJA 2LNBA 1J59A 1REPC 1X1DA 1OMIA 3D5LA 3P9KA 3TO6A 3MCTA 1QANA 1KYZA 1IN4A 2EA4A 3G3ZA 1G38A 3ZN1A 1N2XA 2STTA 4HSGA 1FJXA 1SFEA 4O29A 4WXHA 3V97A 1BI0A 2J5PA 1EG2A 5DT2A 4FS8A 3G73A 3BPVA 1XCBA 4X60A 1ZARA 2HOEA 4HF0A 3E97A 5C0OE 3FUUA 3OPNA 3DPTA 3MTIA 5D5WB 3FWEA 4BH9A 3OU2A 2IA1A 1YS7A 2UYHA 3FUXA 5CVDA 2YXDA 3B3GA 1WI9A 1UB9A 3P97A 2RQPA 5DSXA 3KQWA 2UYCA 1LQ1A 3GFMA 4LWOA 3WSTA 1UHWA 3ZP5A 1KHHA 4ZZLA 3DXZA 1H0MA 3CGGA 3O6BB 3MAGA 1IRGA 1G60A 2O57A 1FBNA 3EGEA 4ENJA 3M70A 2PVCA 5E18F 2IBSA 3HM2A 1TQMA 3FX3A 3DQVC 2ERCA 3UFBA 1P92A 5CVUA 3LAJA 3TR6A 2OQRA 1NBHA 2FYTA 1VLMA 3DLIA 4PCLA 2PWPA 4UVCA 3JTHA 3HYIA 1DUSA 2GIVA 1KIAA 3PTAA 2BYVE 5HLHA 3QPHA 4WK8F 1D3YA 3VODA 4HZFA 4GUAA 3EGIA 2DBBA 2FRHA 2Z6QA 1STZA 4MIKA 1KPHA 1RI5A 4AIJA 3M6XA 3CO7C 1YLFA 5H20A 4PCQA 4IPAA 5DUKA 3RI4A 1SMTA 2IP2A 4OIPF 5DUIA 1QAQA 3TLJA 2NRAC 1USTA 3K0LA 1DPUA 3WGIA 1KQ8A 3IC7A 3LCUA 3ECHA 1XCLA 3GNLA 3R0AA 4DM3A 1YTYA 5HDNA 3HCFA 4ZTBA 5FWAA 1TQPA 1ZRCA 2I7CA 4CWAA 2P8TA 4A0XA 4ON0A 2DK5A 3DMGA 3R61A 1NKVA 2VOOA 1FBUA 5DLYA 3EUHA 5FD6A 4Q48A 5LGUA 4KT5C 1YFJA 3HRMA 2QLZA 5BQTA 1CF7B 2QVOA 5E17F 2IDKA 3T7SA 2IVMA 1ZG1A 2GH1A 5K5OA 3V8JA 4UVBA 2AOXA 1ODDA 3H3UA 2Z33A 4EJOA 2BR4A 2FSWA 2P35A 5FWDA 5EMLA 1S29A 3WTYC 2WK1A 3HHGA 3SFZA 5DSTA 3MAJA 4RTOA 5BW4A 2GWRA 1X19A 4RVGA 2PBIA 4EVIA 5DRYA 3UA4A 5CIYA 4A12A 1Z05A 4CYDA 3FPJA 3ERED 5E9WA 5H02A 4GC9A 5K0BA 3S68A 3J81K 1P6RA 3HRSA 2HTEA 1ONVA 2NNYA 2KRFA 3I64A 2WA1A 1JG3A 3CTAA 5E9JA 3GUDA 3LBYA 1R18A 4L0ZB 4ZYGA 3LA2A 1PRYA 4HGZA 5KK1A 2AN4A 1B42A 4GOLD 4LLGF 3VSEA 4ER6A 4QDKA 4Y2HA 4ENKA 2Q8KA 4IWNA 4HTFA 3TQSA 3T0IA 3K1PA 3KE2A 3GO4A 5H6QA 5AIPA 4EM2A 5GWXA 2JJQA 4AZSA 5T64A 5M5BA 2G9WA 2V1UA 4ENNA 3EEYA 2DU9A 4X61A 5A2QZ 1NT2A 2EFJA 1U5TC 3N4MA 4V0QA 5DPMA 1XXLA 4HW0A 3K6RA 4K6MA 3EPPA 4N0BA 5CVJA 2DK8A 2K02A 3EDPA 3EVAA 3LSTA 2QM3A 4LMYA 1QQIA 5HS8A 4EKGA 5BXYA 4IF4A 3KP4A 1M6YA 5K03A 3VEPA 4E70A 5ICEA 4PYKA 4WXDA 2CGPA 1KR5A 2ONYA 1VP9A 1HKTA 1NHAA 4HG2A 5FULA 2QENA 2AOTB 3OU7A 4Q47A 4Z2YA 5IT9K 4AWXB 2PXAA 2GA2A 1FYMA 3P9IA 3LPMA 3L9FA 4A6EA 2CG4A 1MZBA 2IDJA 3FRIA 3LWFA 2ADUA 4CXFA 3LQQA 4M6XA 5T6BA 1FOKA 2ZULA 5DCFA 4QVGA 4G7HF 4WX9A 2H00A 2OPBA 3ERCA 1NBIA 3FHZA 5U4XA 2AOWA 5DCMB 4IHTA 3FTEA 4IKPA 2L4MA 2JPCA 3I4PA 3VC2A 5EEGA 5E2BA 4HGYA 3JWHA 2O6GE 1BJAA 1KPIA 2A3SA 5BMZA 5K5QA 2NXEA 1X1BA 4CICA 3BWGA 1EQAA 3FMSA 3HA3A 4RTJA 2HWKA 2EFWA 4EGYA 2J5OA 2M1BA 4HH4A 5H6RA 3REOA 5JVTA 3RODA 1HNNA 4YV2A 2OD5A 1O9HA 4M9XA 3I53A 3EVGA 5F2OA 1KQ9A 2M5WA 3TO7A 5HDKA 4AX8A 3TOAA 4HA8A 4H0EA 1T2KA 4FSXA 2JSCA 4FHTA 3OU6A 2F8LA 4C04A 1YW7A 1F38A 3DXJF 1K6OA 3C1DA 4POOA 2MH2A 5C1IA 4OOIA 5JHUA 3OOPA 2YXEA 3KPWA 1YIOA 5ERGB 2UYQA 2Z3YA 1DP7P 4QPNA 4A0YA 3M9AA 1JE8A 3L00A 2UZ4A 1G3WA 2OU2A 2BR3A 1XGSA 1P1CA 2PY6A 2D45A 4YV0A 1I27A 2PKWA 1BOAA 3DXYA 1O3TA 1FSHA 2G7UA 4P7FA 2CFXA 2Y1WA 3LCCA 2Q0OA 2IA0A 1RJFA 3HOSA 3U2RA 4QTUB 1JGSA 4CO8A 1TPYA 1XGMA 3HP7A 2Z6AA 3ZMDA 3WTUC 4YFXF 4HLYA 4I2OA 3DP7A 4IRIA 1J9IA 1S8NA 4RTQA 3V8LA 1MJBA 1ZHFA 1NV8A 3LX6A 3F6VA 4GGGA 2ISZA 3KQTA 3BZ6A 4RB0A 4F84A 4CZZA 4FX4A 4MHGA 4GOOD 4LG0A 4R8RA 3BJAA 3QOWA 1GHCA 1AQIA 3BGIA 4GBED 1T98A 4G8XA 3NW9A 2OQGA 1J2XA 2B25A 1IZ1A 2FEZA 3GX4X 3QPTA 3WGGA 3TDZC 1TBXA 4GYIA 4HV6A 3KP3A 2DTRA 4BLVA 3WTVC 3LGAA 1XJ5A 2I9KA 2DO7A 2KIUA 2P7CB 2P1DA 3DR5A 4P7KA 4OU0A 5TJJA 2P7HA 2VBXA 2PLYA 4KDCA 4E31A 1ZRDA 3GU3A 3BGDA 5EIFA 3UJBA 5CJ9A 2VOPA 3BKXA 4DF3A 5LQUA 1XD7A 2GXGA 4M36A 5K0NA 1WWXA 3JAMK 3O7WA 3UJDA 4YUXA 4LG1A 3TGNA 5K0CA 4LGWA 3WTTC 2G72A 1HXDA 3LDUA 5LQKA 2H6CA 2JG3A 2QBYA 4MQVA 2L4AA 1JG1A 2DPUA 4Y15A 1RJGA 4ISCA 2EFPA 1MHTA 2FNPA 1GVJA 3ZMSA 2M45A 2CMGA 3F8BA 5E8JA 4P7JA 1JSXA 1S7OA 1N7JA 1O3QA 3G2PA 2YR2A 3GZ6A 4F86A 5J6XA 2L02A 4U7DA 2CKDA 4EQZA 5CLSA 2OB2A 2UYOA 4NHJA 5HIKA 3FRHA 3M7GA 3QP5A 4YUWA 1JR4A 1IXRC 4MTEA 3F6OA 4PZJA 1G4DA 4B09A 2R7FA 2GZWA 2OAZA 2AOUB 3M33A 2B78A 2Z9OA 3DH0A 4PYNA 4WF2A 4LWPA 3A4TA 1XGNA 2B0LA 3V4GA 1AOYA 2DPDA 3AXSA 2FBKA 2ZIGA 2IGTA 4PINA 2QRVB 4RVHA 1YFHA 5E1MA 2EV0A 2LDUA 2HQNA 2PX2A 4YFKF 1D8JA 3F8CA 5ICGA 2NNWB 4UOEA 4BAYA 4RTKA 1HKSA 2RN7A 3C3PA 2M30A 1O57A 1SFXA 1LDDA 4MQ4A 3VOEA 2OY0A 3C0KA 4HBLA 2PXCA 1W5TA 3NJRA 1U8RA 5FA5A 2GS9A 2IPQX 3FF5A 4P96A 3GW2A 3J80K 2NNNA 1BOOA 4GQBA 2NYXA 5L3CA 3RPQA 2ZZMA 3A7EA 1WZNA 3DF8A 1JTEA 4R6WA 4LB6B 1QPMA 3EVDA 4I0BA 4IRGA 3GEZA 5K01A 4AIKA 3G88A 7MHTA 4XRFA 1YB2A 1WS6A 2EG5A 3B3FA 2GAFA 2RGVA 2H11A 2QY6A 1ZQ9A 2IFTA 2IPXA 3GRYA 5CVVA 2ONZA 2C7QA 1G6Q1 5E1XA 1Q1HA 4GC5A 2CQKA 1SUIA 5FQOA 4G6DA 3SQNA 3G5TA 4RS8A 1DPRA 2JRTA 1NV9A 3R4KA 5FTWA 1EH7A 2YX1A 1T6SA 4P5OA 1I6XA 2MA3A 1AV6A 2ZMEB 2O3FA 2NXNA 1IW7F 4YFNF 2ZNYA 3F72A 1L1EA 1IAWA 3UJ7A 4MNUA 3RKXA 2VDWA 4CDGA 4K2EA 3DLCA 4QTTB 1SFUA 1V3FA 3CUOA 4MGRA 5LQAA 3SR4A 1BIAA 1ZKDA 3JSOA 5JUWA 4RAYA 2TDXA 5DYMA 1X1CA 3HVHA 3F3XA 4D0PA 2JHAA 1Y8CA 2O07A 3C3WA 3IKVA 3K9TA 1LVAA 4XLPF 2KKOA 1W7PD 2F5DA 5DX8A 1JTFA 1IN8A 1BI2A 4JK1X 2OKCA 1R1VA 2QZ8A 4RGRA 2MBFA 5EGSA 3EVZA 2FNAA 3EEOA 3HCEA 5EKXA 2Z5UA 3R9XB 1R74A 3B73A 3FTDA 5DEQA 5DX0A 5CCXA 3SVZA 2AN5A 1M6EX 3SMQA 2XASA 5LGTA 3M8FA 4NECA 4IHSA 4L0YB 1IN6A 4EKIA 1O3SA 1TNSA 3G7UA 3OFKA 1TW2A 5KVRA 1WY7A 1XTPA 5BW5A 1XDZA 2GLUA 3R6SA 4ESJA 4BHCA 3JSPA 1EH6A 2PGXA 3C7JA 1U2WA 4M72A 2VP3A 4CKCA 1RIOH 3TOBA 4A0ZA 5BPDA 2Y1XA 4UV8A 2AR0A 4RB1A 5CUQA 4B8XA 1BC8C 3DKWA 1KP9A 2O05A 2FF4A 9MHTA 4TV7A 3I54A 4OBWA 5ICFA 3RYRA 2EJUA 4XSZF 2F5FA 4HF2A 3HTUA 2ZVJA 4BYYA 3VC1A 1P4WA 3C6MA 3GRUA 1GXQA 3P8ZA 4KIGA 1J7KA 1YS6A 3TFWA 2ZW9A 2H1RA 3TMAA 5FFXA 3LKZA 2LKPA 2OYRA 2LSOA 4L9NA 4A6DA 2VT2A 3COAC 3FPGA 5G02A 4AZVA 2D1HA 5LQRA 2ZFWA 4RAZA 3FMRA 3G89A 3OV8A 1Y0UA 2PSSA 2E1NA 5CCBA 5FUBA 4I7HA 4HRAA 1IRFA 3EQLF 1L3CA 1L0OC 4BXUA 3CJQA 3LHDA 3OCJA 4DQ0A 4CKBA 2AOVA 2OO3A 2PXXA 4OMZA 4FR0A 3GFJA 2F2EA 1IN5A 2G70A 5K0FA 1ZGJA 3RIEA 4O6JA 3KP2A 2ISYA 3BDDA 3F21A 4Y30A 1OR7A 4BP1A 3CJNA 5E1OA 1XSXA 5HILA 3BP8A 4ER3A 2UXNA 2YX7A 3HSFA 4E30A 4U0YA 3L09A 4HDVA 3J7AO 4IV8A 5EPEA 2FQ3A 1EJ6A 2BR5A 2XYVA 2CSOA 3Q5FA 2V79A 2KJCA 2PMHA 4DNCA 3GO5A 1DL5A 3UA3A 2NP7A 5E2AA 2K27A 3WU0A 5FADA 2XAQA 1MD0A 3RIRA 5D4SA 2GA1A 1UHMA 4YMHA 1KU3A 3SX0A 2O0YA 2C7PA 1B4AA 4RGSA 5EIWA 2XBMA 2A68F 3E5UA 3GLXA 1BKYA 2UXXA 4PONA 5KS2A 2K7LA 4CTKA 4U0WA 4DKJA 3E7PA 3RDIA 2ZO4A 3BZBA 3Q87B 2HFHA 5J8CA 1MJ9A 1ZG3A 4X63A 2PBFA 1O7FA 1FZPB 4OIQF 3ZN0A 1HKQA 3MCZA 2ZFUA 4LK1F 4R8HA 1TLHB 5HVQC 1RUOA 3OZTA 3M1EA 2DQRA 1FBSA 4BQAA 2AOTA 3WTSC 3GYHX 1C0WA 2XAFA 4E32A 4QQKA 4KMUX 3GWZA 2H27A 2UWMA 3IEIA 4PWYA 4ATNA 2EFNA 5E1DA 1Z3CA 2HKOA 3CUQB 3ZQ7A 2YX4A 4XUEA 5E8RA 2G1PA 3W6JB 1LB2A 3H3ZA 5HFJA 2DI3A 1K78B 2PJDA 5F2NA 2RNJA 8MHTA 3L7WA 3K1NA 1G8AA 1SD5A 3GCZA 1R22A 3TOSA 5E20A 3T8RA 2BZGA 3SXJA 4YUYA 1RZ4A 4I09A 3ML6A 1FSEA 3O4FA 4OMYA 2A14A 2AVDA 3OE5A 4G6QA 4KMFA 1CGPA
chains in the Genus database with same CATH superfamily
5AUPB 1CDEA 3TQFA 1ADBA 2PVSA 4AS1A 5C1DA 1K7CA 4R5HA 3UT5B 5DXJA 2VPLA 3WIBA 3MRVA 1T2EA 1ULSA 5FTKA 2BSAA 5JD4A 5DI9A 3UQZA 4M6VA 4A2CA 4JN6B 1AQYA 2J7KA 3D0OA 4HVTA 1SCBA 3N97A 3OZVA 4JA2A 5EG5A 1IN1A 1CVRA 4ESFA 3I2YX 5HOQA 2VQCA 3W5VA 1N57A 5CP8A 3USES 3RVKA 4QASA 521PA 1OPCA 4MVJE 4C0KA 4IQJA 2QUKA 4AROA 4EJVA 5DTRA 4YRSA 2JIDA 4P9FA 3IGFA 3KZCA 1NONA 5FO5A 1I5ZA 1SQFA 2ZAYA 2KJBA 1U3EM 3ZK7A 1VQOI 4OHBA 3JVUA 2ESNA 2WYOA 1J1UA 2C2YA 3PC3A 4JWKA 1RRGA 3R3XA 2XB4A 3FF1A 3QVSA 4XRRA 3PFNA 4P2GA 4YDHB 3K10A 1FQJA 3W8NA 4HUTA 1F1ZA 3RYIA 4C06A 4MWCA 1QQTA 1U81A 1IHDA 1XQ9A 2W48A 2WYIA 3HU1A 1JDPA 4RQAA 3T5DA 3ZDFA 2R7MA 4L6CA 3EVTA 1PS8A 4TWIA 3FKQA 3LJKA 5K8IA 5GMOA 5CNKA 2JMWA 5IDQA 1YI8A 4PQFA 1TUGA 1K8YB 1SH7A 4Q39A 5JQGB 4DJ5X 1UH5A 1GRNA 3GRRA 1D1SA 1ZI9A 1W5BA 4YJFB 3FHTA 4ND4A 1WGXA 5M3FJ 1R10A 1NVGA 4WCFB 4IOJA 4KR0A 1RLUA 3KALA 4PBRA 3AL2A 1R9NA 3I59A 1FTSA 3UWDA 1HW2A 1V8BA 2Q28A 2KL4A 1TEXA 1I4TD 3VH3A 4X7BA 3LX8A 4HV5A 5HODA 2N46A 3QU3A 3HHHA 4P83A 1A72A 2H4HA 1PEDA 4GI5A 1NFFA 1RPTA 4MJXA 3K70B 2L17A 1HW1A 4CLOA 1W7PA 4U7WA 2FLKA 4CMIA 2PD3A 1NDQA 2G3YA 1DKMA 1X9GA 2W25A 1WXFA 1FLNA 4HS9A 1AGYA 5A71A 2PMZN 1E7YA 4RWZA 2V9VA 1DBPA 1D6MA 3SK0A 4J2OA 1LY1A 4JB3A 3H5TA 4IR7A 2BW3A 2VC2B 1GZDA 4M2LA 1CZNA 1XNQB 1KDTA 4GX0A 1I7PA 2VJQA 3TPZA 2QNRA 5HCNA 3QKSB 5LZ5A 1MABB 1K83J 4ND1A 2DTZA 2VAMA 5GTHC 3DEIA 4EZEA 2QI9C 2EFOA 1G8SA 4X64B 4KXFB 4D4LA 5I4KA 1PT8A 3BIFA 3TDNA 2J67A 3SP1A 4A10A 2DA3A 2GKGA 3U62A 4KXMA 2WD9A 4MFDA 1TF7A 3O26A 4D41A 3EPLA 1TTHA 3HG9A 1GFZA 4DCNA 1DS6A 3PUZA 4Z3DA 1ZNZA 3O38A 1UM9B 3MSCA 4DXHA 2KW5A 5ES3A 3IUQA 3K0FB 1F7VA 4GUDA 2MYSA 3ABTA 4YMSA 1X0VA 5E6RB 4U7GA 1X9IA 1GGKA 3NNSA 4MUYA 2CQXA 3ICCA 3F1KA 1NVVR 1MMDA 1MD9A 1SG0A 1B6AA 1UPAA 4A73A 1WL8A 1Q15A 1TGYA 2K2WA 2KYRA 1T56A 1EGMB 1N2GA 1L7PA 1WSUA 3GCWA 3N8NA 4DCMA 5AW1A 3BDVA 3L92A 4WCGA 3RJ5A 3CRVA 5LHGA 4WE3A 3NRJA 3IOCA 1E98A 1NULA 4XIIA 2Z5LA 1JX6A 1P6QA 1USWA 3TRJA 4C7JA 4ARIA 4DGWB 1IY9A 4HEQA 1PFWA 5FV4A 3DE1X 3KBOA 2ERYA 3E9YA 4IIHA 3K31A 2C2HA 1JI8A 4FASD 3M6UA 4XCQA 4DDKA 3HVIA 3NBQA 3LBAA 2QTZA 5J4LA 1HLDA 1N0VC 4O2BB 3K6SA 2O1XA 1KMHA 3ID6C 2P0YA 2R48A 3UHAA 1SD7A 1MC4A 2OCGA 2BEVB 2DT6A 4ILEA 3RYTC 2AA3A 3HO1A 4KQJA 1F3LA 5A3RA 4OAPA 2VDWB 3BK7A 1MGTA 2V4UA 3HA7A 5AKEA 1OYIA 3GH1A 3HI4A 4I01A 3G79A 1RE1A 3KQYA 4WZAE 5D8KB 1Z4OA 5DWDA 2B9VA 3C6KA 1F4VA 2V7GA 3H2BA 1VXRA 3FYUC 1LBSA 1KYIA 4WD3A 2NO0A 4TYPA 1JQ3A 1DG9A 6ABPA 2XUJA 1ZZGA 5MFPA 2GAIA 1NXSA 1NW8A 2FPRA 1E6EA 2RI0A 1PR0A 1C9MA 3LHIA 2PX5A 5KYYB 5BWLA 3UPDA 1AU9A 1RKVA 3EASA 4R9NA 3I04M 4P3OA 5ARBA 2P9EA 4UXNA 3PQFA 1MIOA 2OPTA 2HX1A 4EO4A 4CEHB 1J8YF 2O2XA 1V26A 4IGKA 1Q1EA 2XGXA 3PD7A 4YMTA 3U0BA 2Q9AA 4M3FA 3H3VK 1U3VA 4GEGA 1GQQA 4KN4X 3X1XA 1VL5A 3MCUA 4S04A 1WFXA 2IZZA 5JYEA 5DCMA 2EXXA 3BX1A 1V11B 3UPUA 3L40A 3OTIA 4NBVA 3EYAA 5AJHA 4ZYAA 5BSUA 5CB4A 2VSXA 4RTPA 3CH7A 5IZCC 4S1PA 3KUUA 1B8NA 1MMNA 3HBFA 3RYHB 1C7EA 4F3QA 1K79A 1KQOA 2E19A 3USZA 1RQNA 5JSKA 5K0LA 3E2PA 4LRXA 1MKYA 4JC0A 2NYVA 3FXAA 2ZAOA 4CI0B 3W3CA 4IOCF 2Q6TA 2LDBA 2ATCA 2WWYA 4KBGA 1WVRA 4RTSA 3HNRA 4BL0B 3WSWA 2A1UB 2HFKA 3DV8A 3QPSA 4KIFA 4YN3A 1H88C 1DOZA 1KE1A 2Q3CA 5CVEA 1DDNA 1TI7A 3W6ZA 1KQ0A 4HN2A 2P2SA 4RF3A 3NTUA 2Y1CA 3FZNA 3ZDEA 4A16A 4YECA 2V4MA 5HDGA 2WWWA 3OI7A 3EJWA 4OUKX 4LNUA 3FUWA 2OQVA 2QV7A 3QPLA 4CM4B 1ZH6A 5IZ4A 1R0KA 4DMLA 4KR7A 4QTRA 3ABMH 2FPUA 1V37A 2ODAA 4KP7A 2WLSA 4WX2B 2GLXA 4DUGD 3VH1A 3OLQA 2K2QB 1RYFA 2HJRA 1CF9A 4NQWA 4ZTJA 2FUG6 4DLUA 3A1UA 3WTXC 2B3TA 4GNKA 4P0QB 2BGCA 4MW4A 2CV0A 4F1JA 3A2NA 5DYYA 3J7ZI 1DJOA 1GV5A 2WHYA 1CXZA 1XKXA 2WP0A 1S8OA 3SG0A 4MMZB 2C0QA 2JZCA 2PMWB 3NC0C 3T5TA 5LIPA 2KJQA 4NEQA 2Q5CA 3FE2A 4CR6A 1JEAA 3X3HA 3C2GA 4CIAA 3G3EA 3V7YA 4MQ9F 5F21A 4DYCA 1CE8B 5ALMA 3VC3A 1Y1WJ 1BX3A 3SNKA 1EKEA 4HX9A 4O3MA 1D0XA 3AP2A 2Y1EA 3LLVA 5BNZA 1N7GA 4AQYB 1QYRA 3SEQA 1UJCA 2W6ZA 1I36A 4AW9A 4QDZA 3LPAA 1JTYA 2BFCA 4FYXA 4BTLA 3AY0A 2J59A 4D9NA 1FMJA 3E7LA 1VCIA 4BHTA 1SBTA 1VBKA 5E9QA 2HQAA 4A6PA 2VZ8A 2EKQA 3WL7A 4UULA 4DQKA 3THXB 1NATA 2V7QD 5EJ7A 2AS0A 5KEIA 3HCDA 3PFWO 4A3SA 5GGXA 1SU6A 5AW7A 4BCDA 3P4XA 3TD6A 2D3WA 1VE9A 1BCRA 3LQYA 4MP8A 4R31A 3VDNB 2JLQA 5EOVA 3NTLA 4NMWA 3TSOA 1DIOB 2JGDA 4O5AA 4XB6B 1Z17A 4IF6A 2PS0A 1GQYA 2ZM5A 2JLCA 3PLNA 4A2UA 1QWOA 2IU4A 1LQ2A 2X6OA 5B1IA 3QOYA 3EC1A 3PUJA 4YS6A 1V7CA 4U8HA 2UZIR 4I6GA 2DODA 2PFKA 4XEUA 2NS0A 4H6XA 1QB8A 2PJUA 5FI1B 1T0BA 3C3BA 4KFRA 2D5LA 4NMXB 3I59B 5UKDA 2SKCA 4RVFA 3LGXA 2YC2C 3SE0A 1THZA 3H9QA 1G3QA 4QBFA 5IFKA 5JT1A 3PDHA 1YIAA 1K5DA 8ATCA 1SC7A 1TT5B 1GP2A 1J75A 4KVGA 2C96A 2P0WA 3RIGA 5A02A 2B2CA 4CLOB 1W7PB 4LJYA 1EVYA 4NCXA 1EM6A 4GXQA 1W1WA 5K0TA 1GPWB 4UU7A 1HMYA 3A26A 1NUTA 4XICA 1MKMA 4GE3A 5E7QA 3ZDBA 3GTOJ 1RNLA 3JQBA 3CW2A 2PGAA 3V1TC 1NOJA 5AOVA 4F45A 4EL0A 4RADA 4HNVA 1N3BA 2A6PA 2NTYC 3I30X 3ZWAA 1E96A 5L9AA 1IUPA 2Z2XA 4AJJA 3DVRX 3A3YA 1ZGCA 4AVPA 3G68A 4CCOA 2R0QC 2FSVC 4UCWA 2PKEA 1U8YA 5BVGB 3WLAA 1FU4A 2NZ8A 3BWCA 3GA0A 4O2AF 3S8PA 1JJ8C 2WSBA 1TQIA 2XIGA 5I45A 2YMQA 2JVGA 5KTSA 1ETVA 1LBQA 4JSTA 3ZQJA 4DYHA 1Z35A 4JCCA 4QUIA 2QAIA 1J0BA 1FUYB 2ZXHA 3L7IA 1OGIA 3V97A 3HMKA 2VUTA 4UHKA 2B4YA 2OILA 3U7FB 1QP7A 3BPVA 4HF0A 4PO3X 1JIJA 4QX6A 2NYRA 5GAHJ 3PEYA 3A28A 3YASA 4BECA 5CU7A 1U4NA 3BSYA 3SXUA 1LNZA 5B7QA 3BH6A 3EG9B 2LY9A 4GWKA 4DADA 4N54A 3LNTA 1O2DA 4XSHA 5J2TF 1XF9A 3UFBA 3TR6A 2I91A 3CO0S 4R8VA 3HYIA 4AF6A 4C78A 5DS9A 4U2CA 3QMMA 4AQDA 1HT3A 4EHAA 1IK6A 2ZYUX 2GFQA 3KSMA 1GEGA 3GLGA 3VH2A 5JAHA 4ETIA 1UBUS 4WJKB 3RI4A 2ZTUA 2BFFA 3RRJA 1YDGA 5DUIA 5JFGA 5TMPA 5F1JA 1XCLA 4B3BA 5HDNA 3O4IA 3GLIB 4HWTA 4IX7A 3CT6A 4R16A 3AINA 3H04A 2I22A 4UXJA 2KQRA 5LGUA 3K0CA 1OTXA 1ZINA 3NHZA 2IDKA 4A93J 2IVMA 2WE7A 1KGDA 3LPNA 3HR8A 2GN8A 1UR5A 4CTOA 2IYOA 4OLJA 2UXBB 1D8TA 3WDLA 4NEGA 1PZEA 3L4EA 1JEJA 2I2WA 2BC9A 3HRSA 3FH0A 4GPBA 3TSCA 2LV8A 1E7RA 3VZDA 2AN4A 1W76A 1B42A 1O95A 2BZ1A 4GOLD 1OJ7A 3HGYA 3G8YA 3V48A 1ZH0A 4IWNA 5J1TB 2A84A 4C3UA 1IB0A 1GL3A 3MJSA 2G5TA 3MT7A 4ENNA 2HA4A 1VLHA 1MR3F 2EFJA 3ABKH 5BN5A 3GT0A 2EZIA 1YQ9A 1G21E 5CDTA 1LI4A 4TOIA 3F78A 4XM3A 4PLCA 4E70A 3NYWA 5CDFE 1NVVQ 1HF3A 4IYJA 4XLAA 3GDWA 3MOGA 1BVYF 3LPMA 2HRZA 1ZUNA 2KMLA 4QT4A 4H08A 4HEHA 4PQEA 2GBLC 3FHZA 4GLLA 5E6UB 5DCMB 2OTLI 4IKPA 3VC2A 5EJCA 5FOVA 5CFOA 4ABTA 2O6GE 1KPIA 2HSDA 3RVMA 4ISBA 4IJWA 1J8FA 1MFZA 3FMSA 2R8RA 1WVIA 3NU1A 4RPLA 3BORA 5AVRA 3ADOA 1BX1A 1PFYA 2WPDA 1A69A 5DCLA 2W90A 1K5GA 1GZVA 5C7YA 4K2AA 1R66A 5CTAA 2F4NA 4CT5A 4UVGA 2G1JA 3TGPA 1UKEA 1I4LD 1ML3A 2Z3YA 1SK9A 2WG0A 3OEEA 1IRIA 3RHZA 1Y4ZA 3RAFC 2IIBA 4JOQA 5CURA 2HJVA 4DB4A 2DYKA 1ZSVA 1E1MA 4YAJA 4JH0A 5B5SA 4EG5A 3NOOA 3HOSA 2X85A 3MD0A 1TA4A 2Z6AA 2GPTA 1IE3A 4YFXF 1J9IA 2XGMA 3H0KA 3K1TA 3NHKA 3AHHA 1Y4DE 4ND7A 1TAUA 1TWFJ 4N0PA 1Q0HA 2SKDA 3B7GA 4HV6A 1DP4A 1KBQA 2VKVA 1FFBA 3Q5EA 3ISJA 2ALJA 2OGWA 4NQWB 4DABA 4P4TA 3HB5X 4MS1B 1JXAA 2CXRA 1DBQA 2R6R1 4YJ3B 4B71A 3EDCA 2H92A 1ZRDA 4EJMA 4LZPA 2W2KA 3MKWB 1X3SA 2WD7A 2QBYA 2L4AA 3PZBA 1RETA 2KM1A 2H17A 1D6NA 3PNOA 4IXDA 2XGOA 4XN0A 5JZ9A 1E0DA 1KKUA 3NT2A 2KS6A 2ZI9A 4NHEA 3WR5A 1JUMA 1ODCA 4MO2A 4DGSA 4Q4DA 2AUNA 3NLLA 5DHUA 3TZQA 4BVJA 1JDBC 5DTJA 5LZ2A 2DQSA 3P9QA 3IV9A 2KPOA 2ECKA 4YUWA 3SJBA 2HPIA 1LX6A 2OCAA 3DSRA 2R7FA 4W1RA 3E2IA 2K5CA 4WK6A 2ZC2A 3ECSA 4WF2A 4PR3A 5A9SB 1JFFB 5L7WA 2D6FA 3U7JA 5IP9J 1IIRA 5L3QA 4RVHA 2IYQA 1T5SA 1DFGA 3RC8A 3U56A 2C00A 5E7JA 4QRDA 4BAYA 3DMYA 3SC2A 1LDDA 4YJHA 5LU8A 1EYZA 2OY0A 3EQ6A 3HPQA 5DNVA 2ZUEA 3NEAA 4GYJA 2JAQA 2PRIA 2IGKA 1T5LA 4KLAA 5AW4A 4GBGA 5TMEA 5DGXA 4QZVA 3FYSA 4XKCA 1WS6A 3BMXA 2F1HA 2P2NA 2FWMX 3NDRA 4U02A 5E1XA 3OZUA 4U9HS 4Z8XA 4HDKB 3R4KA 2YX1A 2WFZA 2O3FA 1OPXA 2V0GA 4TKZA 1D5YA 1JXQA 1IAWA 2I54A 2NNLD 3CVUA 3K1ZA 3VUEA 3GTLJ 4QTTB 4B31A 4MGRA 3SR4A 1EXWA 4U9IS 1C1YA 2JZNA 1NLFA 3C3WA 4KVFA 4WECA 2DR3A 3OZGA 3FWZA 4ENWA 4XD2A 1GV0A 5B4VA 2HLPA 5GJCA 4PZAA 3RHSA 1D2MA 3BCBA 5HJ5A 2WHPA 3MTGA 3EEOA 3VYSB 4DIKA 1JHRA 2G0EA 3CU5A 5K3BA 1OXSC 4EKIA 4R54A 3G7UA 3PWKA 2XQIA 4JYPA 4QBKA 2B94A 1KI7A 5BW5A 3QE2A 2NUBA 2P79A 4BO4A 5JANA 1BR2A 2DQZA 1RIOH 3TOBA 3ZS9A 4LBWA 5CUQA 4M87A 1ZD2P 1OBOA 4LGCA 4L3OA 3N2LA 3HL2A 1NQVA 3NI2A 1HM5A 4OP1A 3P8ZA 4HGRA 4CZ2A 2QJRA 1WV1A 2UZ0A 1CSEE 2HBRA 2VOEA 4G4IA 5GJVC 3AM5A 1UOOA 3D1JA 4AJPA 1S96A 5TX7A 2PSSA 2A33A 3OTHA 2UVQA 4IGIA 1L3CA 1L0OC 3OA2A 4QOEA 4ZYZA 2VUIB 3OYJA 4JOSA 1A0OA 6GPBA 1WCMJ 4K9MA 2NUPA 2B8EA 4ARBA 5EPEA 4RKWA 4KR6A 3URKA 1GARA 3IIKA 3ZXSA 3FR8A 1DL5A 1Q44A 1YBMA 3BAFA 5EP4A 1G20A 2GR9A 4DSOA 2CUEA 3JRIA 1OC4A 2ETVA 5THQA 2EJBA 4AJ4A 1T4CB 3CWZA 4U0WA 1KXJA 3Q87B 1QQAA 2PBFA 4IEJA 4YFVA 2X7JA 4DIDA 4Y67A 1RUOA 1SXJD 4D56A 2XAFA 5H9VA 1RD4A 1L1FA 1KWKA 1XMQB 4W5HA 3GNTA 2H5EA 2OFXA 3GELA 1I3AA 1Z73A 1PQPA 2XT0A 4MKGA 2R1ZA 5JS2A 3GHHA 3VYRB 4G0PA 4YUYA 3U3JA 4FYHA 2KZGA 2VLBA 1LZLA 2G0AA 4RA9A 4ZFNA 4KMFA 1PYOA 5B3JA 3FM5A 4GO1A 2OC9A 3E6CC 2PMBA 2DOAA 3ZZ1A 3ANSA 2H8WA 1PW5A 2GGSA 2IOYA 2VK4A 4MYTA 1NW7A 4WOPA 3FMFA 3B7WA 2PIDA 3QOEA 2RJNA 3PUWA 2B7EA 4YYZA 2JGMA 3ZZMA 4PGHA 4BX2A 4HF1A 2WM2A 3FMPB 3E7DA 3JD4A 3I5XA 4MJ7A 3S5JA 3V8RA 5BWOA 4CHGA 4CKEB 1NE7A 1Z4MA 4WOCA 3DZFA 4RPCA 4RWEA 1RI4A 1EM8B 3CLRD 2Y4NA 1ETOA 3K5WA 1E66A 2CMPA 2OXTA 4G1VA 5K3DA 1Z7LA 2E35A 3DU6A 2IEZA 5CA1A 3U4MA 3PR1A 5KTOA 1C8LA 1FFSA 3ZY6A 1X58A 2PMDA 5ALOA 3QXSA 1NQTA 4OYYA 3D3NA 2AV6A 1R8YA 1ZA1A 4EHKA 1NQ5A 4TTTS 4EV0A 1OBCA 4CMBA 3U80A 3BY6A 1V96A 1X80B 4EUSA 2C7RA 3S2DJ 3W5BA 4Y1EA 3NZEA 5DYNA 4EQ6A 1A7JA 3A6EA 5BN5B 4YP5A 2JLBA 3DOUA 3ON5A 2HHHB 3T99A 1XMIA 2O0KA 1Q57A 4HDQB 5ES4B 3OIPA 4G0QA 3ENZA 4OV6B 2AWOA 5A0TA 1U9ZA 4PNEA 5FWXA 4HX8A 2CLIB 1Z67A 4UVDA 4X54A 2ZSHA 4BKRA 2XJ9A 3PG5A 2C31A 4ZZ1A 4INJA 1KY4A 4NS4A 2M9HA 1BRTA 3QA3E 2V1DA 4QVIA 2VBGA 1JIKA 1O5TA 3NIDB 1F9EA 1B8IA 2BFAA 3KE8A 3NM6B 1E3SA 1RCTE 1IJFA 3IT0A 4KQHA 1XZBA 4QEDA 2WNSA 1D4OA 1Z4KA 1HRKA 1OVGA 1CK4A 3HUEA 4A03A 4IHXA 1SKAA 4MRPA 1XVVA 1WQ4A 1JQJC 1C4KA 4E51A 2O06A 3VZRA 3TDUC 4C6TB 3E03A 1UZLA 5KKAA 2OZVA 3VR6D 1KJJA 1ST2A 1CNFA 1VRVA 5INTA 5M5YJ 2ZIXB 1M5UA 2GBCA 5KINB 2E49A 3T9EA 2RBGA 1G2OA 1GGNA 2O2GA 2OHVA 1RJDA 2KP6A 3PNBA 1E77A 4JDUA 1UWKA 4CLRA 1TZKA 2PSJA 4FD2A 2GN4A 2C5AA 2C4UA 5AXDA 5I9TA 1SO8A 2Z0MA 2IYXA 4QBGB 4IKEA 4JQFA 4HXYA 3Q3EA 3UJ8A 3LRXA 3VTZA 5FIUA 4X0GA 5JSHA 4US1R 4BNHA 1TVEA 3DDUA 4KVZA 1WHSA 4DNQA 2OD2A 4JLMA 3HXQA 3R9XA 3NM5A 3BR6A 4YMVA 4QDJA 2W2KB 2EFEB 2HXYA 2VBYA 1P44A 5HS7A 2QBYB 1L3LA 4EPVA 3C3EA 1YUBA 2X9VA 5FPSA 1LE8B 1E2XA 5B1EA 4JQSA 4G85A 2Q2EA 3K6GA 2D0PB 5AXAA 1QMGA 2VJPA 3L6RA 4N0MA 4NHOA 2BJWA 3EXG1 2I2CA 5JZSA 2JIZA 1A82A 3ZGOA 5IANA 1SQGA 2W6CX 4ZV7A 3ZCQA 2HVQA 4UZEA 2I6GA 1SQSA 3HJGA 4DCCA 1GLGA 3EUEA 3I45A 4B7XA 1LKXA 5H1YA 2R8YA 2G9RA 4N41A 1SVNA 2QZZA 1FVXA 3CZCA 2OO5A 3U7QB 4UBKA 1FS4A 2F3SA 5IXSA 4YJHB 3W04A 5T4BA 4KAXA 5JYBA 3D6AA 4BEWA 3ZX4A 3J80Z 4MR9A 2KIMA 3BC1A 2A9PA 1O08A 4P54A 2J1LA 4K6OA 2P6SA 4KMMA 3C7KA 4QUAA 4CQMA 1TLFA 2H09A 1FIUA 4L5YA 4IQGA 1GG9A 2B1JA 3W6VA 4KBFA 4B1FA 2O3UA 3GTGJ 2I4OA 3OAAA 4QBIA 4UCQA 2P41A 3M8KA 5AXCA 4IKFA 4D9BA 2P90A 2R1VB 2XWBF 1N2IA 2Y27A 4AJIA 5REQB 2X1EA 1JR3A 5GIPE 3O7MA 4WEQA 4KQ1A 4JI0B 3GC6A 1ICEA 1L5VA 1I7SB 5EZYA 1PVVA 3KJQA 1V5GA 4UCFA 1K78A 1COWA 4BBPA 5B2EA 3T5AA 3WLTA 1JT2A 4GDFA 3ETLA 1V2HE 1GGMA 3MYYA 1EFVA 3Q10A 2IIVA 1WIWA 5BSKA 1NXWA 2J4DA 2WHPB 2EBUA 1M2WA 4RGBA 1EGVB 3Q9SA 3GVCA 1QHGA 4EUFA 1WCYA 4M74A 3I1YA 2X8AA 2FVXA 4JR1A 2RJ3A 1TO6A 3J7YJ 1RR6A 3F22A 3CKLA 4M83A 4URVR 3BJMA 3HBNA 1QHXA 5A2QK 4G23A 2PR7A 3CRW1 3ELDA 3KXIA 2HF9A 3RB8A 2Q3DA 1Z4NA 4Y4RA 4G89A 3IUBA 4YMWA 4JASB 5IC5A 3GFLA 3D0RA 2WICA 2JH8A 2BY1A 1MDBA 3T5BA 4K1XA 1EDZA 4TTAA 2VQDA 3UJ6A 1EE1A 2V03A 4I98B 2A78A 3SYKA 3QNWA 4B3TB 1R4MB 2YDYA 5BSRA 3EG5A 5IT3A 1MO2A 1SBYA 4V2GA 4Y7DA 4YJGB 4GKVA 1LLUA 4ZVKA 3ZU3A 1FTTA 3S1LA 5HXAA 3UG7A 3W1VA 4LLNA 4ARZB 5JNTA 2BHRA 1ZGBA 2BDTA 2YU3A 4RANA 1J9ZA 1CYDA 5HZMA 2NYAA 1V35A 4WXPA 2D3TA 3GCGA 3TINA 4IDAA 3U09A 4J4BA 4QUGA 5FPPA 4PNPA 2XMZA 4HAVA 2B3DA 4LF6B 1G20B 3HN7A 3CFYA 3SICE 3S7TA 1ETYA 3SBXA 1KEEB 2H65A 2A07F 3LD9A 1JPJA 3T4XA 3OO1A 4JLWA 4FDAA 1EWVA 3KCQA 1XRNA 5DGIA 3JZMA 3QMVA 4MPTA 1M10A 2HR3A 1FFGA 2PJPA 1TX4B 1V4NA 2IZOA 4TV8B 3ETDA 1NYTA 2Z16A 5PNTA 4F2DA 3GJSA 4MMYB 5IMBA 1G3TA 2GI4A 4I5DA 4DY4A 1O6BA 4YCSA 3INRA 2B7BA 5BQXA 1BJKA 3ZGVA 1JKMA 1HDGO 4QOJA 3ZD6A 4DN6A 4N49A 4EZBA 3QVOA 3UCEA 2PWBA 4F5WA 4CFYA 3ZK9A 5EWMB 4RA9B 3DULA 4PW0A 2YMLA 1N2SA 2XE6A 2HD4A 4KGVA 5IJ0A 3GZ4A 2X76A 5JEEA 1YO5C 3WMRA 1FU8A 3AG6A 4R68A 5KQMA 2J3EA 4KXUA 2OKGA 1UBGA 2ZS9A 4BO5A 4CNBA 1JUDA 1E62A 3E7WA 3ASNH 3SQXA 3BMCB 1SXPA 3UMBA 4LK0F 1ZM4A 1TWCJ 2YHIB 1B74A 4Q00A 4IJKA 4LBVA 3QPAA 4B7AA 4YA6A 4ZCIA 2V9PA 3I8SA 3DE2X 4NCJA 3QMWA 1A76A 4ZTZB 1V1JA 1ZP6A 3I6IA 3C5EA 2BF4A 2OFPA 1BQ3A 4OL0A 2PRZA 3A3OA 1H8HD 3L8ZA 1IY2A 1DXOA 1MG0A 1ZMTA 2BKXA 1U7UA 3WB1A 3I0ZA 4P80A 3S99A 5E7MA 5HJ7A 3GIDA 4P7BA 2I4RA 1AA6A 3CCYA 3C2HA 4Q16A 4KX3A 2V74B 1PYVA 1RYNA 1AY0A 2XMRA 1ZXLA 3U9GA 2RCYA 5CHEA 4HNTA 1ND5A 3ECOA 1R58A 3LU1A 2ESHA 1OFUA 3WBKA 4J76A 2WQ7A 2LC2A 4BCBA 4ZA2A 1WRBA 3K0FA 4MV8A 3DM5A 1G17A 1X1PA 3JCZA 1DAIA 2XLBA 5FWXB 5E6RA 3HWWA 4A8JC 2MLKA 2QDKA 1EFRA 3HJNA 1T1JA 1RAIA 3V6MA 5CNMA 1KNQA 2QP9X 4AZTA 2R6HA 1QVVA 4FETA 4OI4A 4YCBA 4IIJF 1NSTA 3A1DA 1E9RA 1YQAA 4G5FA 1GDDA 2R7NA 1ECGA 1T91A 5JASA 1HDRA 1SUCA 2C3PA 4FFLA 4ZPXA 5DGCA 1FDIA 2VK8A 2C0PA 3LDHA 1K9VF 5BUCA 2FAXA 2IYPA 3LT4A 4MKRA 4RHCA 2G9VA 1YXMA 3IIMA 3HU5A 3I73A 3DTNA 4JOCA 2ADFA 4I5GA 3OUZA 3AYXB 5ECGC 4QLOA 3HC7A 3QVUA 2XCLA 3FCAA 2CVOA 1VE3A 3VVCA 5AVSA 1GLVA 1N1GA 4UC0A 4O2BA 2R93J 3LLUA 2ECFA 2AKEA 1RXIA 1AHHA 3KTFA 5L45A 1E3TA 1Q83A 2BEVA 2IW5A 4JJ8A 2XF7A 2WWGA 3NGLA 1QHHB 2Q8NA 3C3CA 2PN6A 2WJ4A 1XZLA 4TN5A 5CM8B 1HDZA 3ITKA 5B1BH 2W9XA 1YB6A 4JBYA 3E7XA 2Y0SA 3WJ1A 5BMVF 1H2XA 2Q5FA 3UAOA 2X2EA 4C5AA 1D2NA 1GN9A 3U1BA 3ZC3A 1E2PA 4R1HA 3WGOA 2ZR8A 3R6LA 4BE2A 1G2QA 1EKXA 1QB7A 2PUAA 3GUCA 2PL5A 3WGNA 5H5JA 2VBWA 4LJAA 3GVAA 5KTKA 1TQ8A 3GTMJ 3KP7A 3FHOA 1WHSB 1REPC 3D5LA 3P9KA 1KYZA 1G38A 3ZN1A 3NDBB 1TJYA 4I1UA 3W2FA 4PLVA 3ZDZB 3KX2A 3G73A 1Z75A 4XA8A 3AZQA 2CJJA 3BG7A 4REMA 4N7JA 4Y2RA 4V19K 1XD2B 1H3EA 1GU0A 2YNMD 3EWNA 4CEHA 2P5SA 1ENHA 1JJVA 3O8DA 1WI9A 1NIPA 4M0UA 1Z2OX 5AW5A 2OAGA 2VNKA 3T5GA 5GV8A 3N7UA 1UP7A 3AY7A 3R4VA 3SDBA 1TEZA 5CVUA 1NJ8A 2OQRA 3T7DA 1RHUA 5JHHB 1MQ9A 2YOFA 3G9ZA 5C5DA 5ADHA 1VKOA 2BW0A 2WWIA 3LKBA 1DAFA 4UQOA 4YAWA 5LUAA 4D82A 3RYHA 2NLOA 3M6XA 5BNIA 3D3QA 4HPWA 1AURA 2OSBA 2UYYA 3FIUA 4IKOA 4HWKA 3EUAA 1YTYA 4CQMB 2R7KA 4MDYA 2CJYA 3AIKA 3QW4B 5ITWA 4MKFA 1VLZA 2A1UA 4ZI7B 3OY7A 4X24A 1EDEA 1E1RD 1LH0A 4HFMA 1PR6A 3IOBA 3HHGA 3BE6A 4Z53A 2O9JA 1H4SA 3E81A 1MNQA 2G17A 1U1FA 4IUBS 2XCRB 3D5RC 3ESCA 2QMHA 2A9JA 1ZONA 4JA0A 3RSFA 3G2HA 1NTOA 2NNYA 1JV2B 4R71A 4CM4A 2EPFA 4RE6A 3RSSA 1ZITA 1EFVB 4IDGA 4HGZA 5J23A 1NIJA 5BYJA 3I2GA 5JVDF 2XCIA 1XIVA 2VNHA 4FN5A 1SKQA 5H6QA 3RFCA 3H9BA 1X94A 4DEYA 2G9WA 5AHRA 4KUGA 3EEYA 2RHMA 4V0QA 1MV8A 5DPMA 1ECPA 1DKUA 2I4NA 3LSTA 3IUEA 2IYYA 2FFJA 1NZFA 3DE4X 2EX1A 1ZVVA 1U7XA 5CK4A 4PYKA 3HDHA 2JC3A 3LNCA 1VFCA 1FC0A 3F73A 5L3SB 2FN4A 4U39A 2GA2A 3RCOA 2CV2A 2D54A 1IU9A 4QVGA 3ERCA 4FQGA 3ZE2B 4GXNA 1CE8A 4OVKA 1UJMA 1H2AS 3TLZA 2PSHA 2FEXA 4ACBA 2F4VB 2ZYTX 4MQLA 2FFRA 3LCMA 1ZL2A 4KUHA 2DJNA 4RPIA 3NV9A 2Q0SA 3RO7A 4D0RA 1RM0A 3LWBA 2VHXA 3GRCA 2PG3A 3ZJ4A 4E08A 4C04A 4W7HA 1GYPA 2XWSA 3WY9A 1VJRA 3THXA 1DKPA 1N6IA 3A2MA 4EI7A 1XJ0A 1G3WA 5KAFC 3AM1A 1BOAA 5B30A 4BRZA 1HUQA 3W5IA 3CQZJ 1GVHA 3V00A 2GEDA 4KWHA 3ZMDA 2C8LA 1P73A 1HTWA 3AK4A 1I39A 2I1LA 1NV8A 3R3UA 1H0RA 2R7UA 3GQBB 5IJ9B 5NULA 2Z3WA 4F9GA 1UXIA 2C8VA 2QSUA 2CVQA 4GYIA 3X2FA 2GT1A 2NVUA 1C3EA 1K7XB 4QEZA 5ALFA 1E58A 5DHTA 2DERA 5G41A 2LWIA 1M6NA 5IJ0B 1C3XA 4IM7A 3GU3A 4QYWA 3BJEA 3LP5A 4WNIA 2PUCA 2J0EA 4EG3A 3JAMK 3UJDA 3SZUA 3TGNA 2NPOA 1RKTA 3KVYA 4KPUA 2EQAA 5ELMA 1TT5A 4G0OA 1T0PA 5ILOA 4Y15A 2WJIA 3LBIA 2J31A 3PIPF 1NGSA 2CMGA 2FEOA 5E8JA 4OU4A 1N7JA 2EP5A 4HI0E 2V0NA 3M7GA 4DQVA 4EX7A 1AK2A 4X91A 2VQEB 1QYDA 4MTEA 2FI1A 5CQEA 1JU9A 2HPVA 4P4LA 3RWBA 4CR8A 3OZXA 5DZSA 1A9SA 4LYDA 5A6SB 2B99A 1PVEA 1J0XO 5BVGA 1OCOH 3OYLA 1IZ7A 1R0XA 4EGJA 3U6KA 3VOEA 1QPIA 4XIJA 2IEIA 4LVNA 1IQRA 5LA6B 2R2GA 5TT0A 3WB9A 2FMUA 2KIQA 2K7FA 2FLVA 2CB9A 2H1VA 4B6OA 2HL6A 7MHTA 3ZU2A 1Y1PA 3B3FA 4DDMA 5KWEA 1WUTA 1ZQ9A 2IPXA 1TJ4A 2WOJA 5IY5H 4DLXA 5FQOA 4YRIA 4R41A 1NV9A 4IDCA 4LYAA 2C0CA 3PUYA 4DTIA 3IPXA 2G0TA 1YQDA 4B6GA 3CZRA 3HVUA 1XD8A 3EG9A 3K1YA 8OHMA 4H18A 1X86B 4DXAA 4YJDA 1L7VC 2QQ5A 2FX2A 4AO8A 4IEEA 1HORA 1ISGA 4XLPF 2KKOA 3HBAA 5DX8A 1JTFA 4CCAA 2BGGA 1CUJA 3FDYA 2DE0X 2JK3A 3L6CA 2WQZA 5EKXA 3B73A 3ZE8A 1RQ7A 2J9YB 3UGQA 1I4DD 5KQPA 1LV7A 1ZHOA 5FAXA 4GD3Q 2V54A 1TW2A 4AJNA 2GF0A 1L5GB 3HKEB 4MVJF 2XNDD 2PGXA 4Q4HA 1PR4A 2CEAA 3E53A 3OCWA 3ZR8X 4TVBA 2VNIA 4DLKA 2VP3A 3CONA 3N58A 4XFKA 2WVJA 4BUZA 2NV6A 2JA6J 4B8XA 1F2UB 4B44A 3GLIA 4C4OA 4O4HF 4XXHA 3CH6A 5FBVB 2EF1A 4BVHA 3NXKA 1QGUA 4LI3X 4RDUA 4E15A 1RAHA 2ONKA 4LXQA 3AQ4A 2A4MA 4N3GA 5E3LA 1R15A 4LXGA 4TZTA 4LXHA 5K1ZA 3ZYCA 4L9NA 1Y37A 3O2QB 4TMZA 3K0SA 3OV8A 1R4NB 1ZXBA 2O7NA 4YONB 3SFTA 5IP6A 1JVNA 3P9ZA 1M6VB 1C9DB 3KZIC 2DA1A 3KDAA 2P67A 5DLEA 4WW0A 3OCVA 1BGVA 1CULC 3ZJ5A 4H1WA 1XDGA 4MV1A 1IDN1 3L09A 1K86A 4R1OA 1V8ZA 1TAQA 2EW8A 3KJHA 2OVFA 1MBEA 1MB2A 1XMVA 1JHYA 2C2KA 4N7RA 4NBUA 1IAVA 2BTEA 3GLXA 4KTTE 4MA4A 1DEOA 1K4TA 2HFHA 3HEFA 1ACMA 3MCZA 5M7EA 2J5BA 3BXEA 3OZTA 5G40A 4LF5B 2J32A 1FBSA 3IB3A 1OI4A 4Z7QB 2C58A 1B6RA 4NDZA 4FEGA 4BVAA 4U2EA 1QYVA 3FTNA 4YI3A 2G1PA 4IH4A 2Q1XA 2PJDA 2HPAA 4MO7A 1JQLB 4FE3A 5E6UA 3D8HA 3DVAB 3TOSA 4ZAVA 1FVFA 3QLVC 4E03A 2D7JA 3RQSA 2DETA 2VFAA 5AKLA 1MORA 4P81A 3QKWA 5LQSA 4ASUD 3E18A 4W97A 1PD1A 4KDRA 5AI5A 1WX1A 1UQUA 2AR9A 4RNCA 5DP1A 3MGGA 2VPQA 1QRYA 1RWOA 1YF3A 1V45E 3OOWA 2MYPA 3QQPA 3Q3SA 3TOCA 2QMZA 3DAGA 4UKDA 5L3EA 2BZ0A 3MGAA 2IHYA 2QPLA 1UOEA 2D13A 4PVCA 3KSBC 3NAQA 1DO0A 1TGVA 2J3KA 4U7HA 3FUVA 4YRLA 3RKRA 1FDVA 4F5DA 5TE9A 4I4CA 4NAHA 4ZJZA 1YRLA 1NF2A 2YZ2A 1UBHS 2G09A 2HZDA 1XX5A 3L5KA 4C2MJ 3L84A 3LOUA 1RJ9B 4PBSA 1N6OA 4BUPA 2E2HJ 1PYDA 4D80A 3HKZA 1P0MA 1VJ5A 4LDAA 1NG1A 2CN1A 5AW6A 4RGVA 2Q4DA 1Z4QA 4A4DA 4GZ5A 2P69A 1EVQA 2ZIWB 5TS3A 5C4IA 4FKZA 4IUCS 2DLDA 3UAGA 4MS1A 4YJ3A 1PGNA 3HUTA 1E3DA 2X4GA 1KF0A 3V7WA 2GEBA 1NM5C 3SX2A 4PSXA 5F78A 4GICA 1EFHA 1AKVA 3PFGA 2VJOA 3F74A 1F6WA 3W8FA 3AUKA 3DAFA 3PHHA 3DDOA 1AN0A 3G9UA 1VBFA 2O7SA 1MLDA 3ZJYA 2ZB7A 5IVDA 4LISA 4CMCA 3D6NB 3RS2A 5K9ZA 4RDXA 3PPYA 2OC4A 2O2ZA 1WF3A 2QM7A 4O6VA 5E8GA 1ULYA 4BMNA 3T7IA 2ZVDA 4UM8B 4X62B 1WW3A 1XYGA 1DAHA 1DXQA 5A9SA 4CMHA 1JFFA 4BIMA 4R9UC 3NVKI 1P4JA 2IS1A 3TNDA 1I1SA 2AZ4A 4BDSA 4QHSA 2DMRA 4R98A 4H15A 2VZ9A 4MIYA 421PA 3FXRA 3WXBA 5FR1A 1KJWA 5T4HA 3UAYA 2Y0MA 4PPQA 1NBMD 5BN3B 2QD5A 2X86A 3AF0A 1S2LA 5AVTA 2XUZA 4UVAA 4XAQA 3TR5A 1XDBA 1TC2A 3H0GJ 2PSFA 4D3YA 4M0EA 2BP7B 4I9UA 1PJSA 2JPBA 5KC8A 4HDKA 4E5PA 1P1BA 5TNXA 5C44J 1UBOS 3N07A 3BEOA 3CSDA 1H3FA 3B48A 3H4IA 2VODA 2W7TA 2VYFA 1CZLA 3G8BA 1T6ZA 2P5YA 1P31A 5EESA 2VZEA 4TKLA 4AY3A 1QIEA 1G1AA 1AT1A 2D5AA 2YN0A 3UXMA 2NVUB 3TCNA 2KIFA 1WUHS 4IXTA 4BRSA 4JAVC 1YE3A 2V45A 2HWVA 3UANA 3ZGKA 1YW9A 3UIEA 4KE6A 2XJ4A 4ALMA 1FJ2A 2OWEA 1TTQB 3GAMA 3GNSA 1KI6B 3MILA 2VS1A 2F6CA 4KPUB 5IP5A 1I14A 1BVHA 3IXLA 3GEPA 3UXYA 3O8HA 5IBPA 1KAQA 3IIJA 1A8IA 2QUJA 2AZXA 2COMA 5JISA 2BUCA 1N7HA 3C5HA 3AF5A 3SIRA 2HTFA 2I1QA 4GPIB 5CQGA 4HAYA 4REQA 1HQYE 2BVMA 1A5TA 2YQ4A 5CT8A 2YR0A 2E85A 2V5UA 4PVDA 2CW5A 2XUQA 2DUNA 2ZUDA 1S1MA 2M6RA 5G1PA 3EY9A 5ALWA 4I2VA 4ZYTA 4YQYA 1R5GA 2JFGA 3ZDRA 4BDYA 5DM4A 3CLTD 1T39A 3HYSA 4OXXA 2A9FA 4U6SA 4J7CA 3OEWA 4F5YA 3M6LA 4RHFA 3WTZA 3W1WA 5G4KA 1PS9A 4I9GA 4DQUA 4UNNA 1ZJYA 4IOLA 3UF0A 2VC0A 1YI1A 3ORQA 5TISC 3OCUA 1T4CA 3RQIA 3UWSA 4W1UA 1GITA 3L7NA 1NN0A 5IOYA 5FNVA 1DUXC 2DPXA 2R6DA 1CUGA 2J6IA 2Q3JA 4E5YA 5CLJA 4F55A 1H0HA 3OSUA 4MPRA 4P2BA 4WOJA 1I2BA 2MOKA 1R7JA 1A2BA 4L57A 4I1RA 1J20A 1D4ZA 4TN1A 4MB2A 3IQXA 4FCWA 4YV7A 4LYHA 1PKXA 1OU0A 3CC8A 4DR7B 2R3SA 4PK4A 1Y9AA 4TTQA 3H1EA 4UQPA 1ISRA 4O4LF 1M8FA 2ABWA 1TO2E 2OZLA 5M29A 5LDHA 2XOKD 2DBVO 3CCRI 3CMMA 3BOQA 2WG1A 3TZBA 3QX8A 3VU0A 1ZIOA 4QVKA 1JPUA 3SIPA 2WAFA 5F9FA 4Q4HB 3AR7A 1ISHA 1NVWQ 5LD2C 3OECA 4TMKA 4PGAA 1L8LA 1TJNA 3L4KA 4CKEA 1QGUB 2I3DA 7REQA 4PGFA 2QMEA 5JAUA 2WVGA 1NW9B 3EQ2A 2GHQA 1MB9A 1EK6A 2FRDC 1EM8A 3Q5DA 4A6XA 3I4LA 2C2WA 5CFNA 2WE8A 3MEXA 5AO9A 3DG9A 3LK6A 1WJEA 2FMHA 4FMDF 1NE2A 1UDRA 3H92A 4XWGA 4U87A 1YFZA 3SI7A 4W82A 3AR4A 1FP2A 2H08A 2C2OA 4ZVNA 4KQ6A 1QFJA 1L7XA 1FNNA 4LY6A 1JWLA 4TRJA 2QTVA 4K0RA 2CNWA 4P82A 3G59A 1Y6JA 1AM4D 2HSGA 2J3HA 1V4RA 2QTCA 3CSUA 3WHLA 1ZG5A 1GV1A 1X80A 5A0FA 4NAUA 3RYFA 3R0JA 3ZMUA 1RLMA 4LHEA 4WY8A 1ORHA 4MVJI 3C2QA 1CFZA 2EWMA 4UHJA 5JS8A 1T5TA 5JCJD 1IHUA 3Q9NA 1XJQA 2M6LA 4O5VA 4BPRA 1Y5NA 4QODA 2WT9A 4RGUA 3ZWKA 4JUAA 1D9XA 4NAVA 3OR2C 1KMIY 2MSCB 1EWYA 2OGZA 1YE8A 2K4MA 4OXQA 4IJ5A 2GZRA 4IDHA 1RKQA 4EG4A 4EM1A 2IUFA 3KLNA 2QUZA 2JHFA 1Q2UA 1QBKC 2C92A 2XVAA 1MTZA 3LHFA 1YG2A 3C43A 4R2JA 3O4RA 4KC0A 4CM9A 3FNGA 4IQ0A 2ZMEC 3K8ZA 2XYQA 4G0VA 1KYTA 4ECAA 4DCGA 3HS3A 1U0RA 4QDOA 4V1CB 4HKTA 4D5FA 2FFHA 4YCMA 5TIIA 4R1NA 4NZPA 1R6BX 1QGPA 2EB7A 4J3NA 4FQ7A 1D9ZA 1J39A 4M71A 4C6TA 1W4CA 3K72B 3H86A 2LIVA 3S8EA 1D04A 4RV5A 1PFGA 1XGOA 1CX9B 3VSLA 1E94E 2ZIXA 3NC1C 1SKMA 4G01B 5LXTF 3MNFA 3RLIA 1VBMA 1JKRC 2COUA 2QQFA 1GTG1 4UNOA 1PKEA 3E05A 2ZLBA 2Y2UA 3VZBA 3VZPA 2OR3A 3GI1A 3EDYA 3RKWA 3QE9Y 3QVMA 5D6EA 3GLKA 3AH8A 2P4EA 3OCXA 3VSAA 4H3KB 5EVJA 5AJXA 3O9VA 2Z30A 4ZEWA 2C3OA 2XMBA 2Y9ZA 3AI2A 4L5JA 4ZDPA 3PRKE 1E2EA 4HD8A 5D5UB 2CO5A 4FTWA 4EHNA 4HJRA 2O3QA 3BJOA 1JT6A 1SKBA 4L8GA 2UUAB 4IIGA 5TB5A 4WXCA 3U1VA 4DMKA 5IBCA 4EMBA 5F7OA 1FOWA 2DPHA 1LE8A 1GTSA 4K9DA 1P81A 3RUAA 2X1MA 5FHRA 3OZCA 1OBHA 4BVBA 2X7XA 1U8TA 4F2GA 1I5RA 5A5DA 4HAIA 5GGYA 2XD9A 5HNFA 1MMGA 3EFBA 1KYQA 2DY1A 5T3YA 4O59O 2DFNA 4TMYA 3ZXIA 5T3UA 4E4HA 3IAEA 3RTGA 3DKIA 1DP3A 3JQAD 3CCQI 4M8IA 3T7JA 3U7QA 5EQJB 3ROTA 1OOEA 4ZK6A 2W71A 3KB1A 5F1OA 4EI9A 5EUMA 4XRSG 3W4IA 3L1VA 1HYEA 2D1VA 2XMGA 2G8NA 5IP7J 2Z57A 4C0HA 3KTAB 1NW4A 1D5CA 4C3VA 1PWYE 2C9YA 4CQNA 4LJKA 1ISIA 3UHPA 2H1HA 2ZBGA 1D8AA 4RD1A 1R5NA 4AUEA 1O54A 3U37A 4RH0A 5B5EC 3GEGA 4HRYA 2HMYB 2EKPA 2OO7A 1VIVA 1O7LA 1X2MA 4E2FA 2CJXA 4MCAA 3WE2A 1KO1A 5BUSA 4UZFA 4GOMD 1EE9A 3DMFA 3G2NA 4IWXA 2LLKA 4UTRA 2XEDA 2R1VA 1MX5A 1L5WA 4YO7A 5REQA 1CEQA 2JI9A 2C4VA 3QWAA 4TWBA 1Z6YA 4MVWA 5AW9A 3W2WA 1FNCA 5BQFA 1DAEA 2PL1A 3LSHA 1SUDA 3ORRA 3RFUA 2PXHA 3SJCA 5AXBA 3ZVMA 5H3LA 3MWYW 4ZODA 2BD0A 3I3OA 1J59A 4RLSA 1NFRA 3K4BA 5F7JA 4CM7A 2OHIA 2AMLA 1KOLA 1V9SA 5ER9A 2B1RA 1AUPA 4HSRA 2V55B 3BB3A 2F00A 3U21A 1R5ID 5F5LA 2I8AA 2O2IA 1GPLA 4FS8A 5A3SA 3TJRA 2J3JA 2P68A 3RUFA 3H0CA 4QDTA 1I10A 2OXFA 2HOEA 1G3RA 2ZVQX 4QPOA 3ND9A 3V80A 4DBQA 3GTPJ 3VHXA 4HQLA 1TL8A 1CQPA 4CCWA 2DQ4A 2UYCA 1Y7LA 3O6BB 2ZCVA 4REQB 3KYBA 1R4MA 2PAFA 3BOSA 4EY4A 1MMFB 5EXSA 3IEUA 1NLUA 1FDTA 3ILHA 4YJGA 4KMOA 4WZBB 4TQ9A 1TU0A 1TMKA 5EERA 4I6JA 4ARZA 3WOVA 1W2GA 4EHDA 1G64A 1HL7A 1ZN8A 3H1BA 2ODQA 4GE0A 1EUQA 4JUDX 3UBMA 3K0LA 3C3AA 3PDUA 4R81A 4ZDLA 1FEXA 2XYGA 5G4KB 5IU6A 3LHSA 1FRVA 4OQ4A 5I7AA 1AKUA 2LCFA 3W5UA 1FFAA 3DMGA 3KZOA 3ESAA 1FBUA 4PICA 1KEEA 3R6GA 3Q40A 5HKLA 3CZ5A 4G1UC 3HRMA 2FW8A 1VF9A 2TSYB 2C4NA 5K5OA 4DJEC 4UVBA 5L6LB 1UPBA 3DT6A 4TV8A 5FNVB 3E1GA 3TIVA 4NNJA 5FWDA 2WK1A 4Z9BA 4KQWA 3VDRA 5CCEA 3OZIA 4RVGA 1HDXA 5CVCA 3T3IA 1D1BA 1CB0A 1EX6A 2A0UA 3LVFO 3J81K 1MH1A 2VT6A 1TTTA 5EWMA 3Q72A 4LDNA 2CK3D 4ZGGA 3STWA 2JD2A 2OZLB 5K3EA 3KM0A 4QYXA 1XZPA 4JU8A 5KWVA 3AM4A 1HG0A 1U2GA 3FSEA 4ENTA 2BONA 4MUMA 2PFGA 3TZKA 3HDGA 5C37A 5CVJA 2AG8A 2NVXJ 1U8ZA 3BMCA 5K7FA 1D5WA 4K8RB 1NHAA 3E0QA 4IZOA 2YHIA 5IT9K 7REQB 4PLPA 1L5MA 1VQNI 4E5DA 4RK5A 3ZI7A 2ZULA 3I39X 1DKOA 1NBIA 3CZMA 3F98A 1B8OA 1K6JA 3A2KA 3FTEA 2O8KA 1SCNE 4CCYA 3V4SA 5A06A 4ZK2A 4JKYA 1YITI 1WNFA 3BWGA 5CK5A 1ACIA 2BMEA 4BNTA 4K86A 4BASA 2W00A 3VJKA 4M9XA 2QTVB 3I53A 3C85A 3ONWA 1EQUA 1MJHA 3QBJA 2QAJA 2F8LA 1W5EA 1M83A 3K4QA 3RYFB 1AZWA 1GCIA 3D3JA 4AG5A 2XGCA 1G7TA 1CJTC 1I32A 3E9NA 1VHQA 4ZOBA 3QU5A 3D4IA 4JI7B 2OU2A 4EECA 2PY6A 3FHCB 5DTDA 3MJHA 3ZHZA 3H3JA 3FYTA 3BDAA 2FPLA 1J09A 4KDFA 2CL7X