4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
4OMZA 4I0BA 3K1NA 4KVZA 2H09A 2DPDA 1R36A 4HF2A 3HVHA 3C6KA 2FOKA 3F21A 2NNYA 4LG1A 1BKYA 5D4RA 2K7LA 4A5NA 4MTDA 6PAXA 2B78A 4UOEA 1P1BA 1R5GA 1XN7A 3NJRA 4PCQA 4DM3A 4IRIA 3PS9A 4HDUA 3OZTA 1B6AA 1YW8A 3QP5A 1XMKA 4JXJA 5K0BA 1FPQA 1KQ0A 3E8SA 3E5XA 5ICCA 1LDJA 1ZQ9A 1XJ5A 1JSZA 4MIKA 2V6CA 4UVAA 4KIGA 1SAXA 2ESNA 3LDUA 4A2UA 1FYMA 2M8EA 2QY6A 3KEQA 4LMYA 1SFUA 4UVBA 5CLSA 5TJJA 4R8SA 3QOXA 4AUKA 2JG3A 3F8NA 4FX0A 2EWNA 3LQRA 3LHDA 1YLFA 1U78A 3L09A 2LKPA 1OR8A 3GU3A 4Q48A 2V9VA 1Z7UA 3TDZC 1S6LA 3MTIA 4GOMD 4MQ9F 2QWWA 3ME5A 2YU3A 1PRYA 3G8AA 1VLMA 3IL2A 3M8EA 2AN4A 4WF2A 3JSPA 5CVIA 2H11A 1QNTA 5FFXA 1ZREA 3PFIA 1L3LA 3UJ6A 3VODA 5E1DA 2IIPA 2RGVA 1NV8A 2RV8A 5HVQC 2AOUA 3RPQA 5L3CA 2YUIA 5K0JA 4NQWA 3DUWA 3LECA 2P7HA 4RGXA 5DPMA 4M73A 3DMFA 2FNAA 4N9IA 4CGZA 5LHGA 2OB1A 1XSVA 3IC7A 1UHMA 4E2YA 3A4TA 3R3HA 2ESRA 4GBED 3PLAE 3Q87B 2ZNZA 3BJ6A 5E17F 5KK1A 4MNUA 3CJQA 3HHGA 2PY6A 2F2EA 2EFWA 4L7VA 2GQQA 3LDFA 1J7KA 1XDSA 3TPZA 1BC7C 4R8RA 3WGIA 4OQEA 4FR0A 2WTEA 2FA5A 4HGZA 5FWAA 1YW9A 5FLXK 3MGGA 4C04A 1XVAA 3F8FA 5EKXA 5BOXA 5FO5A 2VODA 2EJRA 2K86A 1R23A 3C3WA 3GZ6A 1NBIA 4MQ4A 1FC3A 1PJZA 5BPDA 3IYLW 2M87A 1UWVA 3T1BA 1KPHA 1Z05A 2UWMA 2HTEA 3G5LA 5E1OA 2AVNA 4O5VA 2EJTA 1T43A 1OYYA 1I9GA 3GYHX 2P8TA 2COMA 3KLNA 4F7ZA 2HMYB 5D8LB 2NAZA 3QU3A 1F1ZA 2A14A 4OIOF 4R6WA 2ZBKA 1IN8A 3WU0A 2ZBQA 2PWYA 5K05A 3TO6A 2RN7A 1M6YA 5EEHA 4CXFA 4IKPA 1R6AA 1XCBA 1O57A 4GOND 3RIEA 3GRVA 5DD8A 2GA1A 3TKAA 1X1DA 2L4MA 1B9NA 5DEQA 4HLYA 3TOAA 2ZTHA 3DXZA 1QAOA 3J7AO 4XLPF 1TQMA 3CUQA 2OKCA 2P3QA 4ER6A 5E1WA 1SD4A 3GCZA 5LQUA 5DRTA 4YFNF 2XASA 2DI3A 2E1CA 2EFQA 3CJRA 4E33A 4EM1A 4BNCA 2Z6QA 2QVOA 2XAJA 5IT3A 2CG4A 3LPMA 3RYRA 2PQ8A 3ECOA 3ZMVA 5EMLA 3RKWA 4RB2C 3AWIA 3BWYA 3EVFA 3OOPA 1XCVA 5IKMA 3NRVA 2R6ZA 3NMUF 2OU2A 2Q8KA 2IFTA 3SR4A 4F86A 5LQCA 2PX2A 2F8LA 2BH2A 2EFOA 4HTFA 1S3JA 3BPXA 2P8JA 1YFLA 4CKBA 1JHFA 3PT9A 5HDNA 3HSEA 1I4WA 1L3BA 1SG9A 4PIMA 4M38A 2NYXA 2N47A 2Y0MA 4RTNA 3NVKI 3GGDA 3F3XA 5DSXA 4AD9A 5FD5A 3E3VA 4U88A 2YXEA 2K27A 4P7KA 2LF7A 2HS5A 1ODDA 3I5UA 1PP7U 2M30A 3EVAA 5JUWA 2A3SA 2RC4A 4IRHA 1ZYRF 1BHJA 4CTJA 4YG2F 1KR5A 3SXJA 4EQZA 4YUYA 2D1VA 2K4JA 1RI3A 4ENMA 4P96A 2Z6UA 2QRVA 3CBGA 3PVCA 5FHQA 1P39A 1IUYA 3THRA 1S7AA 2PI0A 1ONVA 3DQVC 4OOIA 4WK8F 4RX1A 3GUDA 1EJ0A 4R05A 1P91A 5CJ9A 3OE4A 3OPNA 4O29A 1J9IA 3I0TA 4HQEA 2VE9A 4GUAA 3UJ8A 4OA5A 4HV6A 3KZYA 5GM2A 2O6GE 4OBXA 3WTUC 3GZ5A 4RYLA 1XB4A 1U2WA 1LDDA 4RTKA 4QQNA 4ZYGA 2XKPA 4H0EA 1XGOA 3V7RA 2ZIEA 3U81A 4DZRA 3ZP5A 5DYMA 2XUBA 4E2ZA 1JQ3A 2AR0A 3E97A 2L01A 5BPIA 3FUXA 5L3FA 1S8NA 3WTVC 5FA5A 1MJAA 3LBYA 3ISPA 3FYCA 4YUXA 1ZGJA 3PFGA 5P8WA 4HYEA 2O0LA 2AOTB 3UBTA 1AV6A 3G3ZA 5CVJA 5T64A 4EV0A 4DCMA 3AXSA 3RYPA 4G6DA 5EZSA 5E1BA 4QDJA 1ZLJA 2GLUA 3EGIA 1JXSA 2BEOA 2OBFA 3EEYA 3WG9A 2YVLA 4BXUA 5LQRA 4GC5A 1ZKDA 3OFJA 4V0QA 1WSUA 5BS6A 1YF3A 1B42A 4P7JA 4Y17A 2AN3A 4EJVA 3JTHA 4UV8A 4WCGA 1KXZA 4XUDA 3BZ6A 4RVDA 2IBSA 5CCBA 4UV9A 1WXXA 3HVIA 5BP7A 4PYIA 5J8FA 5LQJA 2G8NA 2DPMA 3JWHA 1H9GA 2H6BA 3KLOA 3DLCA 3TR6A 1REPC 2Q41A 1STZA 1X1BA 5KQSA 3MTEA 2OXTA 2F5EA 3H2BA 4KICA 3IRQA 1D2HA 1XDUA 5AONA 2B0LA 3LBFA 3J81Z 4XBFA 3KR2A 2KJBA 1W7PB 4P9FA 1P4XA 1IY9A 3SSMA 3R6TA 1HBXG 1G55A 1XCJA 3P9CA 3FMQA 2UYCA 4QDKA 2JJQA 1K7AA 4DNCA 2CFXA 3E6DA 3FUVA 4P55A 1P1CA 1GHCA 2P1DA 5BW5A 2KIUA 2W85A 5DUIA 1DPUA 4HOBA 3C3YA 3OU6A 5AIPA 4GO1A 4RAZA 2IVMA 3LFKA 3B3GA 3VC2A 4RV9A 3HCFA 1R8XA 5DV5A 4HAMA 4RVGA 4OQDA 1XXLA 1NW8A 5IT9K 3B89A 1UIRA 3BJOA 3BPVA 1M6EX 5IH3A 2WK1A 2EA4A 3W6KB 5F1RA 3GIWA 1XDZA 1MDMA 1N2XA 1V39A 2PX8A 5E1XA 3OU2A 5EMJA 2ZMEB 4UHTA 1AQJA 4OMYA 5J6XA 5EHGA 3KR1A 5H6QA 5FADA 1R8YA 3GRUA 4EKIA 3IEIA 4S04A 3NDJA 1KQ8A 1AOYA 2VBZA 3I53A 5HLIA 1OYWA 2ZIFA 4HW0A 4CICA 1ZG3A 2ZWAA 3D5LA 1U6GA 1QZZA 4ON0A 5CVDA 2DQRA 1VL5A 5D4SA 5EPEA 4IF4A 4NB5A 1F9NA 2IJLA 1VPTA 5CM2Z 5ERGB 4ER3A 4Y15A 4FP9A 1QAQA 1R74A 1F5TA 2I7CA 2A6HF 1WS6A 4KWCA 4CHUA 1I1SA 3ERCA 2HNKA 4AZVA 1G60A 2QUFA 1IW7F 3DLIA 3V8VA 3Q9SA 2ZW9A 4QVGA 3PFHA 1TTYA 4LK0F 2GA2A 1RZ4A 1UFMA 2H1RA 1FBUA 2ONZA 1Y8CA 3GF2A 3HTUA 2VOOA 1QANA 2PG4A 3JWIA 5FA8A 1O7LA 2C7OA 9MHTA 3KFWX 2EB7A 2UXXA 2ZFWA 5FULA 2XROA 3MQ2A 1NW6A 3M6UA 2IT0A 3P7NA 1UCRA 4ENJA 4M9XA 3P8ZA 3T5XA 2H6CA 3WTWC 4RGSA 5DCMB 5EKUA 4YFXF 2F5DA 2I6GA 2O06A 5L3BA 2XBMA 2WA2A 4A6DA 2PFBA 2IA2A 4ZTBA 1BJAA 2RDPA 5HLGA 2NYUA 5ILUA 1P4WA 2BV6A 5LQKA 2V74B 1NW7A 3MCZA 2ONYA 2P6TA 1LEAA 1YUBA 4LWPA 4PGHA 4DQ0A 5DRYA 2JPCA 3EYYA 3RTRA 2P5KA 3KR0A 5HS8A 2GB4A 2MA3A 5FLXZ 4I01A 4BAYA 2YXLA 4R8HA 5BXYA 1C0WA 3EVCA 4IV8A 3HM2A 5EEGA 2UYOA 3VYWA 3K6RA 4RTQA 2BYVE 3SHFA 5D6FA 3P97A 4BY9E 3CJTA 2GZWA 2PN6A 3NEUA 5CIYA 3PQJA 4M9ZA 4O3MA 3E5QA 4C08A 4UNOA 2Q2EA 3FXQA 5H6RA 1ON2A 5HFJA 3EGEA 3KHKA 3HIFA 4M9SA 5F64A 1K79A 2PXCA 1FP2A 3K69A 5E8RA 2P3LA 2O03A 4BP1A 2GS9A 4OIRF 2CMGA 3EYIA 2EV6A 4KW7A 1YFJA 2WWYA 4HX4A 3EETA 4LG0B 2E5WA 2ZKZA 4B17A 3LCCA 3UA4A 3HCDA 3KU1A 2NXEA 5HOOA 1PDNC 3BT7A 3ELDA 3T8RA 2YPRA 5ICEA 5FFZA 1Z9CA 3I4PA 4PGGA 2VS1A 3P2EA 1EH7A 1PP8F 2CKDA 1DUSA 1R00A 2G70A 4C4AA 3EGVA 2H00A 4AIHA 2XGXA 1B1BA 2EV0A 3TM5A 3MQ0A 3SGLA 1WXWA 2JZYA 2BM9A 2ADMA 5K0CA 5EZQA 4F84A 1WG8A 4BHPA 3TOSA 3ORHA 3ABUA 4CYDA 3AJDA 4JBAA 1FWZA 2F5CA 1MJ9A 2MLKA 1G3SA 3CC8A 1SD5A 5LHHA 3DKWA 2QM3A 2DBBA 1TNSA 3F6VA 5EIWA 3KE2A 3QPHA 1IAWA 5LGUA 1G4DA 5FCDA 3VEPA 2EK5A 4WWCA 3LAJA 4EM0B 1RIOH 3DTNA 2PXAA 1KYZA 2ZNYA 4YIIA 3GFLA 5JFRA 4WXCA 4E32A 4AWXB 4RS8A 5DDGA 4LJZF 4M71A 4BH9A 2XAGA 1ZG5A 3Q7EA 4RTOA 4OU0A 4Q47A 5DTMA 5HIMA 4B8XA 3MHTA 1RI7A 2G7HA 4XLNF 3T7RA 1R7JA 3PX2A 4N0BA 2EA2A 1P4AA 3R0AA 1K6OA 1SMYF 5B1SA 3M6WA 1BI3A 1TLHB 3OZRA 3CTAA 3R0JA 4U0WA 3HRTA 1FLIA 1WY7A 4X41A 2NRAC 1JG4A 4KN4X 3FM5A 1IXCA 4PWYA 1W5SA 3K9TA 4WX9A 4MEXF 4C06A 4S05A 4RTSA 3GW2A 2OAZA 5G02A 1U8RA 3DXJF 5FHRA 4M6YA 4LK1F 3G8BA 4POOA 2EX4A 3C3PA 1KQ9A 4M37A 3V97A 1M0EA 2NP6A 4HF1A 3OE5A 2IDKA 3L9FA 3QAHA 2ZZNA 1JGSA 2P5LC 2ZVJA 2ZLBA 5JVTA 3KCCA 1LVAA 5DXJA 5HEKA 5K01A 2IH5A 5K03A 3A26A 2Y48A 1BC8C 3KQSA 4BP3A 2V1DA 1G3TA 2OBPA 3DPLC 3FXUA 1Z91A 2VDUE 2PV0A 4BQAA 2RQPA 2RVCA 3RPUA 3GFIA 1J59A 4OIQF 3LKZA 4LLGF 1XTPA 2JTVA 3TO9A 4YV0A 4MTLA 4L5IA 2MLGA 3GFMA 3HSFA 5ILVA 3UJDA 1RI1A 3T0YA 2M5WA 1R22A 3WGGA 2FBHA 5MHTA 3IV6A 2EV5A 3ELKA 4OA8A 5HS7A 2DAOA 4ESFA 1YFHA 2NNWB 3R24A 2NNNA 3E23A 5EIFA 1ZGAA 2MH9A 5LEKA 3R6SA 3FPEA 4I02A 3WTZA 3UWPA 4MQVA 4V0RA 1V3FA 5GIPE 3W6JB 2A68F 5F2KA 2GXBA 3OV8A 4GC9A 2CO5A 3HCBA 3S68A 3F72A 3Q9VA 2CGPA 3M70A 2XVCA 2C7RA 4PYQA 3FRHA 2JHCA 5DM2A 3HCEA 3GWZA 4WXHA 3C6MA 3QOPA 1LQ1A 3GVAA 3BWMA 2IA1A 4GOLD 2Z5UA 3RODA 4ASNA 2HKXA 1SUIA 2V79A 1JTFA 4U7DA 1HSJA 3DV8A 1L0OC 3SM3A 3GFJA 2BGCA 2Y1WA 3HVJA 2XYQA 1QPMA 2OB2A 1UHWA 3MAJA 4L9NA 1S7OA 3QOWA 1KP9A 4QPNA 3PX3A 4EM2A 3UJBA 2O3FA 3CGGA 1K78B 2PXXA 4KA4A 2WC2A 4AX8A 4OINF 3R60A 4RSRA 5HS9A 4UXNA 3MZHA 3HVKA 3AAFA 4L9VA 2L4AA 1JQEA 1N7IA 5CCXA 4BLVA 2FXAA 4R6XA 3KR9A 3HP7A 2HQNA 4GF5A 4EK9A 3MERA 5K5RA 3G89A 2E7WA 4ZYHA 4U0YA 1SQFA 1NT2A 1SD6A 1CF7B 2ORED 3HCCA 2NXCA 3LA2A 3KQOA 1DL5A 1Z6TA 1NW3A 2W57A 5D5UB 5DX1A 3S2WA 5D1HA 4RTJA 5D8KB 2ZULA 2ZZMA 3DXYA 3KPWA 1W4MA 1EV7A 2BE5F 4ZYDA 1F3LA 2GAFA 4GGGA 3N4MA 4DF3A 3ER8A 5DT2A 2FF4A 3T7SA 1ZARA 3L00A 2D45A 2PBFA 3QU6A 2JH9A 1KU9A 5J8CA 1O3RA 5LR6A 3BROA 1T38A 3BWGA 4GQBA 2JHPA 3GX4X 1IM8A 2HR1A 4CO8A 3DOUA 1PUEE 2ZSUA 3BGVA 4PNEA 2YTZA 3CVOA 7MHTA 3FTFA 1T98A 3HRSA 1D5VA 1FNNA 5E9JA 4CTKA 4KT5C 1X1CA 4ER5A 3HNRA 2OZUA 5CVUA 4BLWA 3EMDA 3ID6C 3FMRA 2FEZA 3Q5FA 1I1NA 5EC8A 2TDXA 2DT5A 3HTSB 3LKDA 1L3CA 4PCAA 1DPRA 2ESHA 4HC4A 4RB3C 5T6BA 3V7CA 3WGHA 3CO6C 1ULYA 2OQGA 3SVZA 3UZUA 3M6XA 4DCGA 1D8JA 4AIKA 4LB5A 1X19A 1E2XA 2HR3A 4A5MA 1SKMA 2VT2A 1L9KA 3C1DA 1MJFA 2GIVA 2FE3A 4RTMA 3CJNA 2PT6A 2ZCJA 5DX0A 3K1MA 3FUWA 3DR5A 5E2AA 3GDHA 1ZAOA 3FX3A 4GYIA 4L0YB 4FHTA 3MAGA 5D5XB 2FBIA 5DX8A 2F5FA 3BUSA 4XUCA 4MEYF 3COAC 2VP3A 4G94A 1R58A 4EJOA 3HTXA 2GH1A 2GPYA 5HIKA 2ZCWA 5K8VA 4KDCA 3AY0A 1FSHA 3EEOA 2FHPA 3GJYA 3P9IA 2VBWA 3A7EA 1ZHFA 2Z6AA 3SQNA 4U0VA 5K5QA 2PT9A 1BI0A 3HRMA 5LBQA 4ETSA 5LRRA 2VBYA 5L3DA 2OY0A 5E2BA 1INLA 2QYOA 3P9KA 3C0KA 1D3YA 5F6FA 1QAMA 4K2EA 3O6BB 3KP3A 4AIJA 3J80K 1GXQA 3TFWA 4QWQA 3UJ7A 1FZPB 3EVZA 3ABTA 5D6EA 3FPGA 4IWNA 3EPPA 8MHTA 3BDDA 3R61A 4GXOA 4ZZLA 2QQBA 3BKWA 5JHUA 3SMQA 5ICFA 1F38A 3KP6A 3BGDA 2UZKA 3WTYC 1HNNA 4G6QA 4EJTA 1KIAA 4KIFA 2EFNA 1YZHA 2CSOA 3F8CA 3G5TA 5HOQA 3BZBA 2W25A 1SUSA 2XV4S 2BR4A 2PMUA 5EGSA 1J0RA 2H27A 2PX4A 3WU1B 3H3ZA 3F8MA 3BKXA 2OZVA 2XVAA 4HG2A 4AZWA 1O3TA 1N7JA 1CGPA 3ZMDA 3F23A 3M7GA 2L02A 1QBJA 2XYRA 1OYIA 2FNPA 2VC0A 5C0OE 5F2OA 2AOTA 2HZTA 2OO3A 2FCAA 5TRDA 3ELUA 2GWRA 1JG1A 1FX7A 2LF8A 5E8JA 2NS0A 2FU4A 3LAPA 3SX0A 5LSAA 1B4AA 1VIDA 4UUVA 1D2GA 5DM1A 4LFUA 2UYQA 1YYVA 2KKOA 2B25A 1IRGA 3G73A 2ZJ2A 2P40A 1IXKA 4QPPA 4LLNA 3B3JA 2P35A 5ILSA 3KQPA 3GXOA 2OYRA 1I6XA 3IWFA 3ANXA 2UXNA 1O54A 2QBYB 3ZN1A 3BY6A 2M45A 5E1ZB 3G2MA 1FJXA 2IH2A 3K2ZA 5KS2A 1HQCA 3WODF 1RUOA 5EMKA 4RGRA 5FUBA 1TPYA 3HUGA 4ESBA 2O05A 1WWXA 3IWZA 5A2QK 2P7CB 1Y0UA 2P6SA 3LL7A 3JTGA 4GCVA 5HILA 2YXDA 3DULA 2HYFA 2DK8A 4ENNA 1W7PA 3K0BA 2MC3A 4G7OF 5D5WB 3O7WA 5E8GA 1XSDA 2PEXA 1IF1A 3OZSA 4IHSA 2E7XA 2ZWVA 3DFGA 4I09A 2JHAA 5EMMA 3THSA 3AXTA 3BWCA 3G2QA 1XMAA 2PJDA 3DP7A 1UB9A 1E17A 3ELYA 4OBWA 2CMHA 3B5IA 2G72A 4GOOD 3EQLF 4RTLA 2XAHA 2OD5A 3I71A 2QZ8A 3U2RA 4BLUA 2BM8A 3CCFA 3UA3A 1Q0TA 4IVNA 4EMSA 3FWEA 4MGRA 4YIFA 1O3SA 1SD7A 3T7TA 5DD4A 3WTTC 1Q0SA 4BYYA 2R7DA 3SSOA 4Y30A 3TO7A 3HSRA 2K4MA 1H1DA 3EVGA 5GOZA 2FMLA 2JPBA 3KETA 2ZMEA 3I59B 3EVDA 4QTTB 2O0YA 3DMGA 2V1XA 3NQOA 2KW5A 1FY7A 3E05A 1YG2A 2JH8A 1IN5A 3MEXA 4PIPA 3P71T 3RDIA 4BHBA 2P5VA 3FTDA 2XAFA 1QYRA 2HEOA 1BI2A 5KVRA 1L3IA 4ENKA 5C1IA 2HOEA 5CVRA 3U1DA 5HLHA 4P7FA 2IRFG 2ZIGA 3CUOA 3G2PA 2I9KA 2IW5A 4DQ2A 4H0NA 3FPHA 2L54A 3KP2A 1ZLKA 1NKVA 4IXAA 5CYVA 4E30A 4R79A 1KU2A 2FMYA 1YW7A 2IBTA 3KP4A 2QLZA 3QV2A 4G7ZF 1LB2A 1R18A 3R4KA 3GO5A 1TQPA 3O4FA 4P5OA 3ECHA 3ROUA 5ED4A 5ERIA 5H20A 1JSXA 2PGXA 2NP7A 3KKZA 4KIBA 1RI2A 3GRZA 3FPJA 1YTYA 1R5HA 2XHKA 1Z3CA 1IXRC 3P2KA 3M9AA 4Q5SF 2PMHA 5LEJA 2EJUA 4O6JA 4I7HA 2VDWA 1YZ3A 1DCTA 1G6Q1 2OQRA 4L9TA 4RB1A 5DCMA 2O57A 4HV5A 1U2ZA 2AS0A 1IXSB 3FPFA 5HIIA 1XGMA 3F6OA 4QTUB 2G7UA 3QRFF 1H0MA 3IHTA 5LRSA 4CKCA 5CVVA 2J5PA 4B09A 2ZFUA 4E31A 4LD5A 2C7QA 1USTA 3I9FA 1WRJA 4G7HF 3B02A 4I2OA 3HA7A 1OPCA 3VC1A 3WSTA 4HZFA 1NHAA 1J2XA 4FSDA 2FK7A 4IRGA 1WKMA 2HV9A 5GWXA 1FBQA 2DQLA 5HDGA 1YO5C 3FYDA 4C07A 3DF8A 5C9ZA 4Z2YA 1R1UA 3WE3A 5DM4A 2KIFA 2KJCA 4IPAA 2E1NA 1RI5A 1WQ2A 2VBXA 2A07F 2AZTA 1O3QA 3E6MA 3KQQA 4N9HA 4LB6B 4QVKA 1MKMA 2MBFA 3KQTA 5EOVA 3LWFA 3TRKA 2X0LA 3MZYA 2UYHA 1FP1D 3I54A 1BI1A 4HQMA 4P7GA 4IV0A 4LG0A 5FQNA 3ZMSA 4KFCA 3KQYA 3TDUC 3I58A 1JG3A 1RJFA 1U3EM 3DXXA 1LEBA 3UFBA 3FHZA 2PJPA 4PINA 3RIRA 1WI9A 4AVPA 2P7IA 1RJEA 2BR3A 4RVHA 3HRUA 1Q1HA 2K4BA 4RAYA 5M5BA 3FUTA 4ESJA 5BW4A 3KEOA 3P9NA 3LDGA 1FBNA 4QQKA 4M72A 3ZPLA 5FGMA 5E8IA 1BM9A 4EKGA 1T0FA 4HLXA 4KN7X 2PSSA 4CXMA 4YUWA 1G8AA 2K02A 3L8DA 1USSA 5LLQA 4P58A 1IN6A 1O9GA 4FZVA 3BGIA 4MTEA 2V7EA 3JWGA 4Y2HA 5K09A 4FS8A 4Y13A 1I1GA 3D0SA 3HYIA 5FB2A 4RB0A 3CUQB 5FQOA 2ZO4A 5GIOE 2O8XA 1OR7A 2HQRA 2DTRA 2J5OA 4ZH4F 1T39A 3OU7A 2YX1A 2CWEA 2CYYA 3TKYA 1YB2A 3F4KA 3LQQA 5LGTA 5D5VB 1KPGA 3SZPA 1VP9A 4MHTA 2HDCA 3J80Z 1DDNA 2WA1A 1F4KA 1OMIA 5CVEA 2Y75A 1T6SA 4E2XA 3V8KA 1ZN2A 3SZTA 5CUQA 3M33A 4PONA 2VC1A 1VQ1A 1EJ6A 4HTFB 4I0AA 3E5UA 3ZMTA 3FF5A 1JG2A 2O61A 1P2FA 3E6CC 1KGSA 1HW2A 1BC5A 1MJBA 5DM0A 5K0GA 4XSZF 2IPXA 3G7UA 5H02A 5L3EA 2G9WA 3ZN0A 1KPIA 2B9EA 3HHHA 4KYWA 3G2OA 3JAMK 2G71A 3A25A 2XAQA 1JR4A 1HKQA 1R1TA 4RTPA 4XUEA 1FT9A 3TLJA 1O9HA 4M7RA 4DKJA 2W84A 3KPYA 2YX4A 1X1AA 2IPQX 2EFJA 3RKYA 4PYNA 3V7SA 2EG5A 1NE2A 3WTSC 4L18B 2MD5A 5EVJA 2QRVB 1B9MA 5FD6A 3A27A 2MH2A 2ZBPA 3CKKA 4EVIA 5DXAA 4ZZDA 2OZ6A 2R3SA 1O7FA 2YR2A 3VFZA 2D1HA 1YIOA 2PBIA 4HF0A 4LWOA 1YS6A 2HTSA 4I98B 2JRTA 1SFXA 2CQKA 4YUVA 1D2CA 2AXLA 2FK8A 4LECA 5IT9Z 1ON1A 1QGPA 1JTEA 4CKEA 1G8SA 3B3FA 2HTJA 3KZZA 4RVFA 3DPTA 4G8XA 1IZ1A 4NHJA 3KQVA 3O31A 2FBKA 4KDRA 4X1OA 2I62A 1IN7A 3BWBA 2VONA 1JHHA 2AS5F 4PCLA 5CD1A 2P3OA 2G1PA 4A6EA 4IHTA 2FQ3A 3KP7A 3T0IA 5ICGA 3EVBA 2HWVA 1Z6RA 3N97A 3GEZA 2P7VB 2D2WA 3C18A 4G9YA 4CDGA 2XVMA 1BN5A 1ORHA 2VE8A 1QZYA 3M1EA 4KUMA 4A0YA 3P2IA 4EQQA 3BXOA 1DP7P 1JE8A 4BHCA 1KU3A 1MD0A 2ACJA 1K78A 3HOSA 5A2QZ 1RJDA 1ZRDA 3L7WA 4XCXA 3GNLA 3V8JA 3H3UA 2W24A 3O2PE 3DEUA 3SFZA 4E2WA 3FMSA 3LGAA 4KRGA 4PYMA 1TQIA 3VB2A 2HGCA 2P41A 1BIBA 2FPOA 1LJ9A 2V1UA 1IRFA 1U5TB 2LNBA 3TOBA 4TV7A 5KQRA 3TGNA 4XSXF 2AOXA 3GO4A 1AF7A 1ZRFA 3ZMUA 4ZYEA 4ER7A 1CF7A 2XKOA 1BBYA 4JK1X 2IH4A 2UZ4A 3KPVA 3BP8A 3GRYA 4IJAA 4GEKA 4FX4A 3KPUA 3FTEA 2AOWA 1HW1A 2Q0OA 1X3UA 1VTNC 5GM1A 4MHGA 3IHUA 5DUKA 3U9GA 1XCLA 1HKSA 2QQ9A 3K1PA 2OPBA 5K0NA 5E1MA 4UVCA 1KU7A 2VOPA 3LA3A 4WVLA 5HZMA 2DULA 3ULQB 2QENA 3M8FA 5DSTA 1VP3A 1FSEA 3PQKA 2PLWA 5HDKA 2GXGA 2R7FA 3FZGA 3OFKA 2GA9A 5FTWA 4FT4A 4JQFA 2QE6A 1RUNA 1TNTA 3L2CA 4C03A 3CLOA 3VOEA 2O07A 2RKHA 3CO7C 1B59A 4HA8A 4F85A 4FT8A 2FYTA 5K0FA 1ZH5A 3V4GA 3FXRA 2HKOA 3H92A 3NWEA 3X0DA 1HSTA 1QQIA 1HMYA 3KP5A 5E9WA 1YQAA 4YMGA 1BOOA 3MFKA 5U4XA 5JR3A 3EDPA 4KMFA 3OCJA 3WTXC 5DTQA 2DK5A 1MDMB 1FYKA 2Z3YA 2PKWA 1EG2A 4AZSA 5JI6A 4HRAA 4K6MA 1ORIA 1U5TA 3QP6A 5HIJA 2DFIA 4WXDA 2PWPA 3E7PA 5T67A 2ISZA 4KMUX 5E9QA 5LQNA 4NECA 4MWZA 3FZVA 3UJAA 1EH6A 1Z1DA 2IP2A 1L1EA 1NBHA 1EAMA 3CDHA 2HWKA 3HA5A 4YV1A 3PTAA 1T2KA 4M6XA 4HX8A 1G3YA 3REOA 2XRNA 4Q4ZF 3HA3A 4PYLA 3FRIA 4YFKF 2VN2A 1MZBA 2BZGA 2Z99A 3LX6A 1A04A 2KRFA 4DA4A 2ISYA 1KYWA 1FOKA 2DW4A 2DO7A 4FT2A 1EIZA 4LGWA 1G6NA 5F2NA 2CW0F 3IRRA 2VXZA 4QLCU 1G38A 4G56A 5DWQA 3TQNA 2C6YA 3ERED 1GXPA 3LCVB 1TW2A 3V8LA 2ZZKA 1VBFA 1AQIA 1NW5A 1R1VA 2PX5A 3F8BA 3FTCA 2OA4A 3MCTA 3R0QA 4E70A 3IKVA 4X63A 4EGZA 1YS7A 4HX7A 4KNYA 1LNWA 2ADUA 1OKRA 2DLLA 1G3WA 2PVCA 4KDPA 4RTRA 2CWWA 1RNLA 2VT3A 3PB3A 1FBSA 3DMHA 3BOQA 1VE3A 3NTVA 4PDKA 5DCFA 4YV2A 1S29A 1FYLA 2M1BA 1EQAA 4M74A 4LLLA 4EGYA 1SQGA 5DTRA 1V4RA 2EFPA 1RJGA 2BR5A 1XGNA 2HYGD 3TQSA 1TBXA 1KA8A 3ML6A 3SXYA 2IA0A 4FGZA 1MGTA 3B7PA 1J75A 4X60A 3UJCA 2AN5A 4ER0A 5KVAA 4D0PA 3ER9A 3JWJA 3EUHA 3RW9A 3RKXA 2Z9OA 2VDVE 2B2CA 2B3TA 4HDVA 2FRXA 4FSXA 5BMZA 4C05A 2XIGA 1ZG1A 2DPUA 5DLYA 4L5JA 2LD4A 5EHIA 3CUQC 3HCAA 2AVDA 2FRHA 3B73A 3SSNA 2JSCA 4GYGA 3VSEA 2NXJA 4HBLA 5D1NA 3LCUA 5FWDA 1W5TA 5LHIA 3O3KA 1TW3A 3DH0A 2DU9A 3ZMZA 2YQZA 3KPJA 2P4WA 1XD7A 5K0EA 2YSRA 4X61A 3M4XA 5K5OA 4PYJA 3ELWA 3A7DA 2QQAA 4YUZA 4RWZA 2A5YB 2A61A 3RI4A 1XSXA 1UFKA 4DMGA 1HXDA 5LQAA 1IN4A 3NDIA 4A0ZA 4A12A 4PYKA 2Y1XA 3I64A 4R1HA 2A6EF 4M36A 2HFHA 3IKTA 4RGUA 3T8TA 3KQMA 5GINE 2QBYA 2JT1A 3JW4A 5K0LA 1GVJA 3MWMA 2C7PA 1P6RA 4CZZA 3BJAA 3NW9A 2NXNA 2LDUA 5AIQA 4L9JA 3LSTA 1AWCA 3JSOA 5EG5A 3TM4A 4U7PB 1D8KA 5BQTA 3FM3A 1WZNA 4HSGA 4AZTA 4PZJA 3LA7A 3K0LA 1H9TA 3UJ9A 1P92A 1NV9A 3EMBA 1HKTA 2STTA 4OX9Y 2ZXJA 3G88A 2A69F 4A0XA 2L3DA 2RNJA 2WV0A 1EH8A 2ZBRA 1J5YA 2ETHA 3WE2A 3MB5A 3F22A 4P9UA 3RJPA 4EJWA 5K1YA 4L0ZB 3FUUA 2YX7A 1SVUA 4ISCA 4U7TB 2LSOA 2XYVA 2ERCA 3QPTA 3D2LA 3C7JA 4U7BA 2Z33A 2STWA 3KQWA 3JAMZ 2PLYA 1XGSA 1W7PD 3HOTA 1I5ZA 2VZ9A 1ZRCA 3ZQ7A 1I27A 3EVEA 2AOVA 5E20A 2YR0A 3TMAA 3J81K 1HW5A 1QO0D 1DUXC 4CWAA 1MHTA 3E6BA 5L3GA 1KHHA 4PYOA 1JQDA 4XRFA 1RI4A 2IGTA 2BBYA 3I59A 2GAUA 3NVMB 4HGYA 2H94A 2X4HA 4YMHA 5E18F 5KYGA 3HEMA 2AOUB 4HH4A 1BOAA 4ATNA 2CL5A 5EQJB 2FSWA 10MHA 4OIPF 3GLXA 2KIMA 2IDJA 5GP1A 5LGNA 4EJUA 3NWBA 3GRRA 1SFEA 1SMTA 1LDKB 1U5TC 2ELHA 3M6VA 3R9XB 1BIAA
chains in the Genus database with same CATH superfamily
1PEAA 2GCOA 5CK5A 4QD3A 1HFKA 1OROA 4R3UC 2FLKA 5KB3A 2VQDA 4PCQA 2E6KA 3QP5A 2FFBA 1P5HA 3B13B 4GPZA 3V1YA 4UE2A 3EDRA 1MG5A 4HNQA 4Q1AA 4A3LJ 1Y0BA 1D2AA 2DMTA 3WMRA 4B0PA 4R8SA 1IBKB 1KE1A 2I8DA 2PIAA 2AK3A 1YGPA 1O7JA 4HQOA 1JHZA 5P21A 1J97A 3KVNA 3EW7A 1QNTA 2F1JA 2DOKA 4I2NA 1U2GA 1L3LA 1T9ZA 1LK7A 4I8XA 3K4CA 1GRVA 2FZVA 4B71A 3KZNA 4M73A 4Y4RA 4FLFA 5JS6A 1E4YA 3PF8A 4I4TA 3VR2D 1JDTA 3BG7A 2PO7A 2M2IA 3WDKA 3W5HA 5K2MA 4WH0A 3HO8A 3H8JA 3H1TA 1UT5A 3HHGA 3D6VA 2E4ZA 4JA0A 3NWOA 2FRVA 5LMNB 5EXSA 4HNTA 4MPRA 2Y2UA 3P5JA 1LBEA 5G0WA 1WMSA 2P9GA 4DCSA 1UQTA 1V16A 2C04A 4YDQA 3P0RA 3QLUA 1U1GA 2H65A 3AL0B 5LXTF 2ORYA 2JBHA 3PRHA 2ZWMA 4MVXA 3AHDA 1GG9A 1QH9A 5AUQA 4ERNA 1X42A 1JHXA 1UPXA 1MIHA 4LE0A 5K8UA 3D7LA 1M6YA 4CXFA 4IKPA 1R6AA 2O20A 5COQA 3DQZA 5IDXA 3TL6A 4ZDPA 3HJUA 1QFMA 3D8BA 3MJVA 4QPJC 2GIZA 4KQ2A 4BTLA 1BD3A 1DZIA 4GZLA 4YC7A 1NKTA 1CZLA 2HIHA 3RYRA 2PQ8A 1QS0B 2FSFA 2F1KA 1AKMA 5LQCA 3UXEA 2C5SA 2EZ8A 1SPBS 4WECA 3O2NA 3B3QA 2UYYA 1BRMA 2F3TA 1IHYA 4X7RA 3NBQA 1JZQA 1D2RA 3WICA 4B8ZA 3LPCA 2SKDA 4XWAA 3UF0A 3I5UA 2VZ0A 3REQB 2A88A 3FUCA 1RWMA 3QE3A 3UMJA 1MUUA 5ERXA 1F2DA 4KUHA 3ZE9A 1IUYA 1U7WA 4B34A 2LW7A 3ICEA 1VE7A 2PXHA 2BTQA 5DFAA 4FK8A 2MFZA 1DJQA 2EW8A 5FF9A 1TT7A 5B64A 4RX1A 2AQEA 2Q8NA 3OE4A 3DOEA 2ZPUA 4GUAA 3IA2A 1EB9A 3LE8A 4NWIA 1GTL1 1P2DA 2QMZA 4JUFA 5A6SA 1XGOA 1NMQA 5BMVB 1A8HA 4B8YA 3CW9A 4KXFB 3LUBA 2B37A 2L01A 5FA5A 2CV0A 3MUOA 1GNTA 2M6SA 4UHKA 2AOTB 3PA8A 3DUFB 4V2FA 4W99A 3P96A 2FWNA 3AXSA 4CUGA 3EGIA 4UBMA 4YACA 3PEUA 1ESDA 5BVGA 2OBFA 2ZYDA 1KVQA 4NOMA 3FWYA 2ZAOA 3NBFA 2KBFA 1C7IA 4DPKA 3RAEC 1WWKA 2G8NA 2J41A 1OYVA 3CUYA 1P60A 3OIPA 3OOHA 1POWA 1WR8A 4EDFA 3IMEA 4GM4A 1X1BA 3ANMA 3A04A 2DMUA 3H2BA 1DEAA 5DCYA 1Y7LA 2Y31A 3DONA 3TDNA 3PK0A 4ZCRA 3N39C 4CSWA 4LTDA 1Y6RA 1GHCA 2J33A 1O95A 2EC5A 5DUIA 1F8XA 4KSYA 4OYLA 1REQA 1YL7A 3GRKA 3S8YA 2R87A 2OLKA 4HAMA 5IT9K 3ISTA 2Q21A 5C7LO 1JGTA 2ZMEB 3CBQA 3DNMA 4QUBA 4EW2A 1L5YA 4BJ6A 3AVPA 3DAGA 5HLIA 3NKFA 4DE5A 4G37A 4HW0A 2BF4A 4LDQA 1SKAA 3AEZA 3ZWPA 2RHJA 1MIJA 1IK6A 2VJIA 1GEEA 3DV2A 1OWMA 4DGSA 4A3IJ 5AHXA 4TTSA 1M33A 5ERGB 5F33A 3R75A 5C5DA 1R74A 4N9QA 2A6HF 1R4MA 4CMAA 2BHYA 2Q46A 3E6AA 3VKVA 1ZFNA 3LZDA 2WF5A 4POAA 2C5AA 2HEGA 1XZBA 2DGDA 3W5UA 5HNFA 4WINA 3MQ2A 3U40A 2DQ4A 3EQ9A 4C7VA 4R2LA 1U04A 4A8TA 2DODA 2PL5A 5HLGA 4BE9A 2GD6A 2IJGX 2MC4A 3GDFA 4KLZA 1Z6ZA 1OXXK 5DRYA 2EU8A 4OWRB 6REQA 2WAQA 4Y9DA 3D4LA 2V4ZA 2BGNA 3V8PA 1NVWQ 3L06A 3H0GJ 3L8EA 4YX9A 5IT9A 1CF2O 3BD9A 4KCGA 2GFQA 2RHOA 3CJTA 3MSXA 3MYYA 1ZRMA 4NATA 5H6RA 5HFJA 4QQRA 1BWRA 4KDEA 1WETA 3TPFA 3K4QA 1EUQA 3IKMB 4BE2A 3QU4A 4S1NA 1N33B 1P17A 2E5WA 2O8VA 2ICAA 1NOJA 4MVCA 4LGVA 4CMEC 5CTAA 2GK4A 3EPLA 3ONWA 3DAYA 1T9HA 1EH7A 2CKDA 5EPUA 3CNLA 2F3RA 4P2BA 3BTUA 2FW7A 3EF0A 4AU7A 2PMDA 4A3MJ 2VWHA 1R27A 1ISMA 3CPEA 1FB5A 3S27A 4EVRA 3D0RA 4H6WA 5LB4A 3ORHA 3NM4A 2YWCA 4RCZA 5AVOA 3KE2A 1GILA 3NFYA 4HDMA 3EFHA 5HZGA 4Z3OA 3Q7EA 4HCJA 1RC8A 4HLDA 4REMA 4ND2A 4CCAA 3AOGA 4BUZA 1JFSA 3BSWA 4J0JA 3HJTA 5LOVA 2QTVA 5DLDA 3SVTA 3X1KA 2HUNA 2B34A 4QJIA 1NTRA 2EX4A 3C3PA 4TYNA 2F6CA 4M9UA 4HF1A 4ABTA 5CH3A 5IFKA 4RFSB 1EZZA 1GYQA 2XB4A 4GMXA 2B1RA 2ZBVA 4RV4A 1DT5A 1G3TA 3E27A 2VDUE 2RVCA 3AETA 4PJ0C 4PC7A 4JC5A 3AFHA 9ANTA 1L6RA 1SU4A 1KRHA 3JQRA 3C8DA 2GEFA 3FMGA 5CM9C 1Y3DE 1DMRA 4TMTA 3LWZA 3COPA 4C6RA 3A2MA 4EX7A 2IHBA 3C6MA 3QOPA 3U31A 3GVAA 2PRZA 3O94A 3IQEA 2HKXA 3ZE6A 3SM3A 3GFJA 4PFOA 2O3QA 2ZTSA 3GJ0A 1LRKA 2L82A 1L8AA 1UHWA 1HQKA 3QFRA 3E58A 3L1IA 4QPNA 1HZJA 1ODLA 3CGGA 2R2GA 2HWWA 4ALNA 4A2QA 2PT7A 5E6RB 2X0KA 2CNWA 4BLSA 1XZCA 1KY4A 4R6XA 4Q6WA 3TW0A 1W0KA 2PL1A 1NDQA 1WPQA 5KYYA 1SD6A 2NXCA 4X1IB 4LIVA 3CEPB 1NX9A 2EFCB 1D1SA 3WLAA 2V9ZA 2I78A 3QRWA 3RYCA 4G1MB 4E6PA 1O8CA 4MV8A 2PBFA 2O54A 3TX6A 4UFNA 2PWBA 1PK9A 1WIWA 1HT2E 4LEIA 4G6ZA 4YMIA 1P61B 2OTLI 2HT6A 1JDNA 1D5VA 2ZR7A 2WLTA 4OL0A 1X1CA 5F5NA 3FMRA 2DCEA 2O5CA 2RG7A 3AQ4A 1M0SA 4J43A 3O9VA 2VRNA 4A5MA 4ALIA 2OFPA 2EJVA 4BTVA 1GLGA 1AB5A 3R3VA 2FE3A 2OPTA 1DFHA 2PT6A 1VIYA 3SD7A 4Q9AA 3FUWA 5E2AA 1QYDA 2LDBA 2FBIA 3UAOA 5L3SB 1RTKA 5IM4F 3KT3A 3FGPA 5CQGA 2O2ZA 1U0RA 3GJYA 2ANCA 2QLBA 1RRMA 3E9CA 4PE5B 1ETXA 2WHYA 4UKDA 1ZMRA 2FEXA 2I8CA 1K88A 2G3YA 5GAHJ 2I29A 2AQHA 2HMSA 2JAWA 3WQRA 1JIXA 2QJOA 4NCNA 4IHAA 2DB3A 4NCBA 3TW7A 2NAFA 2PUBA 1N8SA 3ZTYA 4NFLA 4BP8A 2BR4A 1SUSA 1UM9B 1VFCA 4OLHA 3RQSA 1DWOA 1PFKA 1NVBA 1AC5A 1TA0A 2BUBA 4HPJB 1V7CA 3WRYC 4CPDA 2BFEA 4LJ8A 1CRWG 4PLZA 1WUTA 3T94A 4UREA 2Z9BA 3DTVB 3KQLA 1MJGM 1TK9A 3K1YA 4HJXA 2J30A 3GBGA 2Z3ZA 4DLTA 5EZYB 4I1OA 2RAPA 5G1PA 3OT1A 1LUJB 4U6NA 2P27A 2QNIA 7ABPA 3M8JA 4XR9A 1SD1A 3HADA 4OLBA 3FI0A 4QPPA 1U3VA 1H5NA 3VYTB 1UBCA 3HM9A 3OIGA 3HXLA 3IH5A 1U5BA 1H22A 1PT6A 3GD7A 3GEHA 2NXNB 4JVSB 4IG4A 3JRDA 2WEKA 3GA0A 5IASA 2VA9A 3HUGA 1JB9A 2P7CB 4XVHA 1LE8B 4IHWA 4QTRA 3JALA 1I1OA 3OR1C 1VMIA 3IQIX 1LX6A 2ALJA 2I8AA 4FM9A 2PUDA 3PEFA 4L6CA 1VQ6I 2PEXA 4A27A 2G80A 4F06A 3SDBA 2PEYA 3DGEC 4UMEA 3U4QA 4GE3A 4G07A 1NAIA 5CFLA 2XAHA 1IZ9A 3SIWA 3HJFA 3UA3A 3ZW8A 2QU8A 4TMFA 4CLRB 3X2FA 1WJDA 3NIGB 3H5LA 1H1DA 5GOZA 4DJ5X 2NW6A 1QLWA 2W6NA 3E0XA 1J70A 3EVDA 1J2TA 3KXIA 2GPWA 4PQGA 3G1TA 4E7IA 1VQKI 3GD5A 4RAGA 4UVHA 1LW7A 1GARA 3ZZ0A 1YULA 4ZKEA 1ONSA 4C4OA 5AKXA 5IJWA 3U1DA 1QFXA 1TKRA 4X64B 1TM3E 4B75A 3OL3A 3VR5A 4H0NA 2I2CA 2VHXA 5CYVA 5CPBA 4AKHA 2DT7B 3X1WA 3ZHTA 4CL2A 3ESRA 2HOAA 4G7ZF 1ZWLA 3HR8A 3KKZA 5GTIC 1RLTA 4X1YA 3STTA 1UMDA 3RTCA 1G8XA 1SXJD 2VDWA 2VJQA 3MUEA 4M98A 3VKFA 1K3FA 4E3ZA 3A9VA 4PRKA 1SZPA 2B99A 3HCWA 3LZCA 3FMFA 1YU6A 3ESDA 1FQJA 3TWOA 2I3ZA 4XKWA 3N6RA 4J0DA 2BP7A 2EBUA 4HFNA 4CM5A 1LBTA 5TMDA 4GFBA 1IIBA 1NDHA 2WFZA 1UZLA 5HDGA 2HSZA 3BCAA 1F5SA 1U0GA 5CLGA 2AJDA 2Q3CA 4YPOA 2ZI7A 5AHRA 3OFNA 2QTTA 1MIOA 1C0PA 1D7OA 4IFEA 1LTKA 3SDSA 4BUJA 2GFHA 5BV2P 4QVKA 3MJRA 1MKMA 5GAJA 3T5TA 2MW8A 1IGNA 1BI1A 1A4RA 4A5SA 3F97A 4MA0A 3TDUC 4PPGA 1RJFA 3DXXA 5C4GB 4PQRA 4PINA 5JRZA 2B2XA 2BEUB 2XDVA 4A0HA 4TMKA 1OGYA 4R31A 4DL9A 2ZUFA 3VZQA 2R62A 2YZGA 5BW4A 3K9CA 1U63A 2BGWA 2KYRA 1NUUA 4OQMA 1EK2A 4I1PA 4IDBA 3FNIA 2EZTA 3BGIA 5IKEA 4OB7A 5HLTA 1VCMA 4K6FA 5I5GA 4AC9A 4CM8A 2HXGA 1K0UA 3WGTA 4ZMSA 1GZHB 3HXMA 3OS2A 3NGLA 3BTJA 1LKXA 2CXXA 1U4SA 4XJSA 1HDGO 4FCCA 5JIBA 3QWIA 1DELA 1VM6A 3UMMA 1PUJA 2WE8A 2W43A 1EUDB 3HJEA 1XTRA 2X8JB 3I92A 1KGSA 1CZNA 3SBEA 3OOEA 2OF7A 1NLMA 2P9QA 1HFWA 5KMGB 1AS3A 2DPHA 2WB1N 1FSZA 4QO8A 3ZYZA 2KJQA 5MGNA 1R1TA 3NAZA 5HQTA 5JVDA 4RMNA 4HY3A 2OPHA 4MCJA 4U5QA 4XW2A 2OGUA 1UODA 1VIVA 1L2TA 1CJKC 4B3XA 2HHJA 2NU9A 1LFPA 4ZZDA 3FCSB 1WGXA 2EX0A 3AG1H 3GYGA 1QGAA 3G1WA 2EKLA 3ESWB 1D2CA 3FBIB 2AN1A 3KB6A 3OH8A 4BMCA 2KT0A 2ZROA 1GAJA 3JAWA 4LXXA 4J29A 3VPBA 3TIIA 4RDUA 3QG1A 4EELA 2HF7A 4ND3A 1RCFA 2QKYA 2IUYA 3DR3A 3HOSA 4HNHA 5TNXA 5B5EC 4KACA 2JIRA 4I1VA 5FI3A 4U2FA 2Z2JA 4E2WA 2IPLA 3LGAA 2ZANA 1U5TB 1XELA 2IQIA 2VP4A 3TGNA 5AVTA 5KSOA 3OPVA 4GLBA 3RFTA 4AFNA 4CR8A 2PSHA 1OBVA 1KC1A 1Y8QB 5AK6A 3WKCA 3JR7A 3U7FB 1ETQA 5GM1A 1CZRA 3OYCA 4HQ0A 3CRVA 3C4QA 5E1MA 3LXUX 3LA3A 1RHJA 1JHOA 5DP2A 4L0DA 3AB3A 1E3PA 1LZKA 4WNYA 1DC8A 5ECDA 4IDFA 2O07A 3WYCA 2RKHA 3PNSA 4FT8A 1RWVA 1LFUP 4P4TA 4QATA 3N05A 4UM9D 3V4GA 1M74A 3JSAA 4BCDA 4MW0A 5E9WA 4YMGA 1E5DA 4EWLA 3RIXA 1EWRA 4BV3A 5JNTA 1EG2A 4IUDS 5HIJA 1P1FA 1UDAA 4MVJP 3STVA 5AVYA 1KEEA 3LQ1A 5DNUA 2QTNA 3A03A 2ZRFA 1QHSA 1Y1WJ 1V55H 2GTIA 5CFOA 4R8VA 3LX6A 2JI7A 2XODA 3BMCA 5JRDS 3MCUA 4YGYA 1WPGA 3LCVB 3OQ1A 1DJOA 2IE8A 4ARBA 1QGED 4RAFA 3MCTA 1Q17A 3OM0A 4GXQA 1X58A 3ZGNA 4RJKA 4YRSA 3J7AC 2BEJA 1PTKA 2JJMA 3X1MA 2VT3A 1FQKA 4WBNA 1UADA 1CUYA 4Q4LA 4WSOA 2VEDA 5AOVA 2NT3A 1T36B 2IU3A 1NLZA 4MI6A 3QEMA 1XGNA 2VNSA 3VH1A 3E15A 4BRSA 4L72A 3S2EA 2FE1A 3SKYA 3ZOZA 4EY4A 3KT6A 1ZP6A 1ML3A 3ER9A 3GCDA 4URWR 1QIHA 1T6YA 4YAKA 3V8MA 3HBNA 1T8YA 2XIGA 2FMTA 2BI4A 2ZS7A 3CUQC 2GZDA 4QM6A 1VQPI 1DS6A 4RAOA 5KAIC 1D1PA 1SUWA 5L6MB 1JHRA 3ZHXA 4RNCA 3MWLA 1XD7A 4OQPA 2YSRA 4X61A 5DIZA 4WLUA 4RIFA 4LRWA 5ITSA 2XUGA 2R00C 4IJQA 4FC6A 4DT1A 1BE6A 4QG3A 4FYYA 3VSBA 4GZ3A 4XFKA 2RGWA 2LDUA 1C1XB 3EZ2A 3O21A 2IW3A 5AI9A 3W77A 4RADA 3LNTA 2JNWA 4UCXA 1ZM9A 2EWWA 3PEEA 3IIIA 2OZLA 2DJ5A 4L0ZB 5DYGA 1TD9A 3BTLA 2J9ZB 2HXYA 2AWNA 2PU5A 1PG2A 4EATA 3UV6A 1I27A 1P0IA 2E55A 4I08A 4AMYA 3JQ9C 5EJ9A 3GFFA 2JBAA 4K81B 3T9DA 3ONFA 5FUXA 1MHTA 3C5EA 1E6KA 4D2IA 4O25A 3LJKA 3RS5A 3P52A 1M8GA 4DM4A 1VQ4I 3LDHA 2FSWA 2FQ1A 5CX1A 4LHXA 3N07A 3E3MA 3OCYA 4LDNA 2WJAA 5YASA 1DXYA 1ZSVA 3DDHA 2Y1FA 4IMIB 5LM3A 3RWBA 1PWYE 1Z4QA 3WOVA 2XMGA 1BKYA 3OOYA 1R5GA 1Z2OX 1MNAA 4LCJA 3M6IA 1DKNA 3E5XA 3ZCSA 4FKBA 2W2TA 4JENA 3RJMA 2JCGA 4YJHA 4PRZA 3WNDA 5F76A 4D45A 3T99A 1SCIA 3D59A 2CHQA 3TDZC 2RAUA 2AYYA 1XZJA 1H66A 2E2JJ 2B7BA 4QJBA 5CA0F 4WF2A 5FFXA 4JFAA 1ZD3A 2AKAB 5HVQC 3KJHA 3ZHOA 1DKQA 1MA3A 2UXDB 1VB3A 3ORYA 4F8JA 5DTEA 4XWOA 3TTYA 4E2YA 1OI7A 5C5EA 1HPLA 4QSMA 1NF8A 4JJEA 1E6LA 4HEA1 4AJHA 2C78A 1M7BA 3CQ9A 1K2WA 2G25A 4PSKA 2GQQA 4RH0A 4QIHA 2SBTA 5IW8A 4XVCA 1OZGA 4L08A 1N9GB 1HV8A 5FO5A 5KSWB 4HKTA 2K86A 2IZ7A 1XPJA 3O4JA 4C2MJ 1JA0A 1E3IA 1SBNE 3IXLA 1KAHA 4A3SA 2J0EA 2WYOA 1QE0A 4HL6A 4RF5A 4KFSA 3S8PA 2A9JA 3W05A 2EJTA 4GI5A 4K2AA 3QPVA 5KU1A 2B8EA 3GA5A 4L0QA 5FNZA 1M9NA 1KYXA 1IN8A 4IIDA 3MKWB 2CXHA 3JRWA 4S24A 1M34A 4HLYA 1QAOA 4D96A 4BE0A 1RWKA 3C15C 4JNCA 1Z0SA 4GKJB 2ZSIB 2C8KA 5JAQA 4E33A 3CZQA 1RP7A 2E4AA 1XWIA 4J0CA 2GEVA 2VTVA 4NKRA 2OU2A 4F86A 1JSLA 4X7MA 1T5HX 4D26A 3Q3EA 5IP7J 3WK4A 1MD9A 2Q1WA 2LKSA 3BR0A 4CKBA 3M3HA 3V34A 1L3BA 4M38A 3C8ZA 1VJ1A 4NBRA 1Y9JA 3ZNQA 3I9V6 2FA9A 1TKCA 4MW2A 4IIJB 5K7ZA 1ZD8A 3BA6A 3WX0A 5K8LA 3GUZA 2HK9A 3AFGA 2D2FA 4F4DA 2W0SA 1KDOA 5I48A 2R1UA 3DQVC 5HRAA 2HDHA 4P8RA 1WF6A 4EHKA 3TVTA 2J5QA 4W1SA 3E5MA 4O29A 1B73A 1TA4A 3I0TA 4LDZA 1H9AA 2X0FA 5JEEA 1Y6ZA 5GM2A 3T1VA 4MUBA 4EEFG 5F73A 1NBAA 1WDTA 4ZYGA 4H0EA 4DLUA 4MEBA 4YO8A 4B7ZA 4D57A 3VHXA 1QVRA 4MJLA 5DYMA 2XUBA 3ZBPA 3JVDA 1L5SA 2Q9AA 3SS8A 2X6QA 4BVKA 4DCVA 1QPIA 3D1VA 1SKUA 1CIJA 3PT5A 1ZGJA 1NVXQ 3SZMA 2DFFA 1OY1A 4V2IA 4DCMA 3KU4A 2RHCA 4NFYA 1YBVA 2HSDA 2FUKA 2AN3A 1SKYB 3RUHA 3QLJA 1JHMA 2LY2A 1X13A 4UV9A 3MG9A 3CN7A 4QO7A 1FFSA 4Q3LA 2BEKA 4B4KA 1TU3A 1STZA 1AUOA 2I65A 2VOJA 1K4YA 3GUUA 2O5RA 3IE1A 5HBRA 3LBFA 2V3VA 2YJGA 4YCBA 1IVNA 4ZRNA 4DYDA 3SSMA 3R6TA 3Q9UA 3ZY3A 1NR7A 5BUCA 2NN3C 4OVKA 4A3EJ 2DCMA 1MAVA 3ZIAD 3DE5X 3B3GA 2NT4A 2J5BA 1VCOA 1XVIA 5DV5A 4RSGA 3ZCPA 1YBMA 1KGDA 5A04A 1C50A 3CNEA 2CUKA 2QIOA 1Q6YA 3UAGA 1TWGJ 4DMHA 1JT9A 5CFRA 4EKIA 4QECA 3EMKA 3GH1A 4X84A 2ZIFA 1W6RA 1ZG3A 5D3ZA 2BHRA 2WTXA 2CZCA 3IPRA 3PD7A 3KSUA 3OCUA 2IJLA 1MBHA 4N3CA 1G5TA 3FDXA 1QAQA 2F43A 5FYQA 3HGYA 2C94A 3ERCA 2O7VA 3UANA 4LISA 2WAAA 1UFMA 5KTOA 3RHTA 2QV0A 3QENA 2VOOA 4XQCA 1U65A 3TP0A 5FA8A 4GW3A 2YNMA 3JD3A 3GJTA 2GZSA 2FH5B 2IPOA 2IHUA 1JMKC 1H65A 2I6GA 2PFSA 2QZ4A 4BAZA 5EZ6B 4DY6A 4ZPJA 4PX9A 4CNBA 4LSZA 3IDZA 4Z0NA 3HL0A 3JD4A 1TEZA 3E5NA 2P5KA 2GB4A 4WCFC 4R8HA 2VJDA 1C0WA 3EVCA 1V43A 4CEHB 2BYVE 4N3GA 1ZNXA 5E3MA 4JP1A 2IZ1A 5EF6A 2NU6B 2A9QA 3PXXA 1HNWB 4C3JJ 1UBNA 4UUBA 1JVNA 2YVKA 4P0QB 2DPLA 1LJ8A 3B6JA 4IOKA 1A9QA 2PCLA 2F3SA 2LZ0A 4Z4QA 2BFFB 3T1HB 3GBVA 4JJ6A 1Z9CA 4MUHA 4HADA 3O4VA 1PP8F 1FYEA 3V8EA 1V4NA 3OJ0A 2H00A 3EEIA 2JJ1D 1GCAA 3OIUA 3X3HA 3ZV6A 1JQJC 4E08A 1SD5A 4DREA 3WVNA 1GJRA 4H0FA 2JCBA 4BO9A 5FCDA 3VEPA 1PO7A 2LKXA 4WWCA 4JL6A 3RS0A 1QB8A 2Q5HA 4E32A 1LLUA 4RS8A 3G0CA 3MMSA 5SYMA 3MVEA 4DV5B 4RENA 4DNOA 3H2GA 1JAZA 2ZGVA 2XY4A 5DW3A 4X8OA 3WAGA 4FJ2A 3DXJF 4KKXB 3DL4A 4PZZA 1OFUX 3G8BA 4M0EA 4MV0A 1VKJA 5HF8A 3K6KA 4GMGA 4BLQA 2PS9A 3QAHA 1NONA 4UMFA 2IH5A 1P74A 5K2OA 3INNA 5JJ5A 2HRRA 3R9XA 5JBIA 2PV0A 3N58A 4G5FA 4DYVA 3OQIA 5I9NA 4XX1A 4EY8A 3GFMA 3LVQE 1CUFA 4X8LA 1STOA 1UJ2A 4LQ4A 4Y7CA 1YFHA 2VQLA 4S1PA 2XGOA 2I34A 1PN3A 3R6SA 4I02A 4MRRA 4RGVA 4CG3A 4MLZA 3OF3A 2UV1A 4BZPA 3UXMA 3M70A 3K2AA 1E4VA 4HDOB 3WWCA 2MT9A 2EERA 2GXAA 3WHKA 4BV9A 1HO3A 5TPWA 3I9NA 4D9KA 2ZYVX 3WZLA 4X90A 3DV8A 2OLEA 2E9SA 3D3KA 3UAZA 4L6IA 3DFIA 5A2GA 1Y89A 2OB2A 3RI3A 3DLBA 2VDQB 1I4TD 3PX3A 3IIKA 1KK1A 2OCLA 3MJTA 4EFNA 1FMCA 1JG7A 2UAGA 4GPD1 3UCXA 5ITWA 4LDJA 4BX0A 5LNK1 4LNAA 5DEIA 3OZDA 4FB4A 2QTRA 1NYQA 4MS1A 3ZHRA 1GL3A 2Z6VA 1N8KA 2KWIA 1D9ZA 4H1HA 2ORED 5K6AA 2OQIA 2R8XA 3HSSA 1P1JA 1SZJG 3KL2A 1RR6A 3NP9A 1F4PA 4QXQA 5CLLA 5CBPA 4ZYDA 2WPDA 5E38A 2V6JA 2DT8A 1VZ3A 3T7SA 4OGFA 2Z30A 1AGXA 1TLFA 3BTSA 1Z5GA 1IM8A 1E59A 3R7SA 1YI1A 4PNEA 1IY1A 1SXHA 3DVAB 5EIOA 3OZWA 1KMHB 4B3GA 1MTOA 5GP9A 3OURA 3PNOA 1ZC4A 4RBOA 1CVRA 1FFXB 3HI4A 4DCGA 3ROMA 2AO9A 1KAMA 5FPSA 1X19A 1A8PA 1U7UA 4H9GA 3SJCA 2B63J 3PQ5A 2QSZA 3OC0A 3WLNA 4FHTA 3NR2A 3PLRA 1ZD4A 2B36A 3I45A 5IWCA 2F5FA 1IATA 4RW0A 3RS9A 2VP3A 4GYJA 2R5WA 1RQLA 4IHQA 1Z0KA 5L3QA 4AI6A 3ASVA 2VZLA 1V3UA 3HXKA 1KBZA 2O8FB 3V6LA 4EY6A 4BBPA 4ETSA 4JT2A 4DMRA 1OX5A 2IKSA 4DANA 1QAMA 1S89A 2J8ZA 3AFNA 1NQTA 1DC3A 5IYZA 5FOWA 3UJ7A 1EUCB 4Y52J 3P2OA 2XUHA 4FCYA 4XRSG 2G04A 4RKYA 2AXQA 1XXHA 2VTBB 1W0TA 4MAMA 3V9AA 3AESA 4G8JA 3OLCX 3BRCA 2WHQA 5DULA 4BJTA 3U4GA 3WAJA 3PGJA 5L45A 4EUHA 4BEHB 3LCJA 4DVGA 3O90A 5EUMA 5KVQA 3KVVA 2WWRA 2NTJA 3RTAA 5ALDA 4WQMA 2VI6A 1ZNZA 3BKXA 3OWXA 2RHLA 2JC3A 2XE8A 3F23A 3CZMA 3G6WA 3UWMA 5C0OE 4J07A 3NJ4A 4UHDA 1WCV1 3OY7A 2Z5GA 5ALXA 3B2NA 4ZYAA 4EVQA 5L8VA 4HWKA 4M3EA 1IRGA 4YELA 2P40A 1UEJA 4XPIA 3VDXA 4FOOA 5BSGA 4F4FA 3ANXA 1LWOA 3ZCUA 2FN9A 3VJMA 4GM0A 1N9ZA 3V7UA 5JCZA 3MIIA 1GP2A 3O73A 3VV2A 4JYBA 3LL7A 3QVOA 4R9RA 4X8HA 3A6PC 8ADHA 3NH6A 1QTIA 3VO2A 2OHFA 2FSHA 1Z6QA 2ZT8A 3AOEC 4DNPA 5KNDH 3AHEA 1GU0A 3OM1A 1XMAA 4NQZA 4BFXA 2OA0A 4HP8A 1CVLA 2XOXA 2JGMA 3WYEA 1A2QA 4EB0A 4MQFA 2ZUUA 1Q0SA 1ZW6A 2ZCUA 4TLCA 1SH7A 1BE1A 4LYFA 2FMLA 2WB1A 1MABA 1V45E 4QTTB 1CB7A 1P3Y1 3E05A 4MQ5A 2JH8A 4PIPA 1P45A 2R44A 3BH0A 2PYDA 3BEOA 3QJGA 1DIHA 3T7KA 2ZBUA 4LTMA 1XZGA 2R97A 1JILA 1D1AA 2DA1A 2IL1A 3IP9A 2IWHA 1CZHA 4AVZA 1RXYA 1ETWA 1EXMA 3BEDA 4B7AA 3ECHA 3I8OA 1J25A 1SVSA 1U0EA 4BKQA 3TLEA 4XWWA 3NHJA 3U5TA 1SUDA 2CXPA 3ZJ4A 3L0DA 1IXSB 3FPFA 1JEYA 2VQ3A 4Z8YA 2VBGA 2OL4A 5L4SA 1XMXA 1Z21A 4B09A 5B57C 3KJIA 1J5XA 2C7QA 4KJXA 4KLRA 3JAKB 5ESDA 4C3IJ 2XQKA 3LKVA 4HMOA 3FLBA 1E3HA 5F98A 4F2WA 3M1IA 1SHLA 4NU6A 3VX3A 1JQBA 4U9UA 1V5FA 3PPVA 4D3ZA 3RSSA 3KQTA 3TOXA 1X7XB 5JISA 1YC2A 2MMGA 2XKBA 4BC0A 4MDYA 1SBZA 4P7GA 3ZMSA 2PJRA 2NO9A 3I58A 3L1UA 4M22A 1DQZA 4AS1A 3COWA 3BJIC 3NHRA 1HKHA 3ZGLA 2BCJQ 1P9LA 2DDBA 2Q6KA 3ONEA 3N7TA 4KQ6A 2NVXJ 1FDOA 3RGGA 3FUTA 2FUNB 2EV9A 5FGMA 1D8AA 3Q1LA 5TF4A 3WRXA 1N2ZA 2VRWA 1JQAA 2P6PA 3PQ4A 2UUCB 4Y2HA 4MGYR 4Y1RB 4UUQA 2QN2A 4FNMA 4W9MC 2W42A 3NGMA 5GONB 5L3RA 3QE0A 3UM9A 3X1YA 2F4IA 1KSHA 3EZ6A 1R10A 2O8XA 2R4QA 3TQHA 1I7NA 2DTRA 4B4DA 2ZXEA 1X87A 1I3CA 2FMIA 3TSYA 2VRCD 5JD6A 3CJRB 3PX7A 4JB8A 1I32A 3AZQA 5TVGA 3OX2A 1OQAA 3DT8A 1QZEA 1X7ZA 1J0AA 2B9EA 4ZAZA 5JJKA 4W5JA 1W30A 3QMWA 1NUAA 1MRNA 1NQOA 1T2DA 1L5KA 2QXTA 1PWHA 4RK6A 4CM3A 2CJPA 2IPQX 4KYIB 4RACA 3TKLA 1EFLA 3PC8A 1CUXA 4F3CA 1OAOA 2EBHX 3R7BA 5DXAA 5TQ0A 1K61A 1ENPA 3WLLA 4AYBN 2QM0A 1TVEA 3VFZA 2E1MB 3L8HA 2WAMA 4Z4GA 4YUVA 1IPEA 2AXLA 4KXQA 4CFSA 1N2CA 5EHQA 4X20B 1G8SA 1N2SA 4UUPA 4K6KA 2J7PA 3RG2A 3WDSA 5EIXA 2O1XA 1NVEA 2QVYX 3EXIB 5IT4A 2W2LD 3HFGA 1P0QA 1OH6A 4P81A 1M8KA 4E22A 1BN5A 2VE8A 4KUMA 1E1CB 1Y5IA 4B3MB 2ACJA 2I6TA 4U2GA 3V8JA 1BMTA 2H54A 4FN4A 4I50A 3BAZA 3PGVA 2XJ4A 4DEYA 4MDHA 5AOCA 3ZWKA 4NS1A 1PJ4A 4TV7A 1FLNA 5BV1A 1SUBA 4NZ9A 3FHCB 1W0JA 1I5EA 1YJBA 4JK1X 4AP6A 2UZ4A 3BP8A 5DHUA 3GRYA 2OO5C 4E1VA 3ZQCA 5AJXA 4QJ3A 3AIMA 3IR5A 3KYDA 4Y6LA 5DUKA 5DXFA 1XAJA 4L4SA 4K9SA 4B3HA 3TR5A 4HDRA 4OFWA 3RUFA 4PX3A 5HZMA 2LV8A 2I4OA 2M7BA 4D3YA 3LSIA 3L2CA 1K7FB 4ZEMA 4JJGA 1HLFA 5H59A 1YGYA 4JHLA 4N4AA 4NPHA 4I8DA 1YQAA 1RRVA 3EDPA 5DTQA 5FO1A 2HF9A 1KJZA 1EFAA 1A4XA 2DHRA 5FOVA 3LPNA 2ORVA 2VJLA 1GTRA 4JV5B 1U2RA 1J6UA 4C01A 2WIJA 3JZMA 3HWRA 2DUNA 3AM1A 3H2YA 3SDGA 4YAWA 4RVSA 3F3SA 3S2DJ 5JLWA 4YFKF 4QVIA 2HMTA 3IUEA 5DGHA 4FT2A 2DO7A 1W5FA 5F2NA 2CW0F 3IV7A 1O94A 1G38A 2L7FP 3FR8A 4R9NA 5KPDA 2HMUA 3FLMA 3DLLF 4ND8A 2EKZA 4FINA 4GOXA 4LJ6A 3K16A 4P3XA 4HX7A 2NZXA 3AQIA 4HAXA 3RWMB 1PHPA 4IFTA 3GZTB 1HLDA 4FBLA 4AUNA 1FS6A 3DMHA 3BOQA 1THZA 2JKYA 4N82A 1VHDA 1JVBA 1MVNA 4Z9FA 1WXHA 2FAXA 4RY9A 3VNUA 1J75A 4JKIA 2QMUA 4PBTA 2VDVE 3ETEA 3BERA 2SNIE 3DCJA 1NYLA 5JHGB 1R6BX 4FDTA 4GICA 1NXVA 2BVNA 4N0PA 5T4BA 4OJQA 2Q5QA 2GHRA 3LFTA 3UKJA 1T5IA 1WTAA 1R6RA 4DRXA 4GXNA 3NTOA 4BMVA 1X7WA 1FX1A 3QFSA 5JWHA 3INTA 3AVUA 4ZVNA 2A59A 2I5UA 3A7DA 4XQ0A 1R0LA 2WJVA 3W0LB 2PFGA 2AUTA 4ZO6A 2O0JA 3LH5A 4TRNA 2HFHA 1PNOA 3BREA 3K09C 2VHWA 3C48A 4WN9A 4Q05A 5H7XA 3JW4A 3GFGA 1GVJA 2WIFA 3THYA 1THTA 1L4UA 4R1TA 1TYBE 4H4EA 4OTZA 1H9TA 2H8WA 1QYVA 3K72B 3TRFA 3LY9A 2JQ7A 2P6UA 1DGRM 2P9TA 4Y6QA 1ES9A 3VVBA 2LKDA 1GAQA 1FX0B 4RQBA 3FDJA 5G0VA 2YX7A 1K7CA 1SVUA 3G9ZA 2X9GA 4D8VA 2TCTA 2P2SA 4JR2A 3RU7A 4U7BA 4R2KA 4HXFB 2O2JA 3ZBUA 3HZHA 1I5ZA 3RAJA 3CTPA 3FBWA 1SCDA 4B4VA 2IPNA 3AGQA 2EOAA 3QGMA 1HW5A 1QO0D 1NG7A 1X0XA 4WLEA 2ASEA 4YLGA 1I6HJ 5KTYA 5B58T 4FYKA 1NPYA 4HYYA 2JVIA 1OTYA 2CC2A 3O83A 4MPPA 3HLTA 1GQOA 2CL5A 1L4BA 2SKCA 5E3OA 1OLSB 1GNPA 1KARA 1IHPA 1XQYA 2ZQZA 3DT9A 1GTG1 5FL7A 1G17A 3HVHA 3HRHA 3RVJA 2B78A 1P1BA 1IY0A 1YSCA 5FORA 1NVVR 3BIWA 5K0BA 4DC1A 4JEHA 4YQZA 1XJ5A 5TPZD 3DBIA 4G6TB 3M6FA 3THXA 3LDUA 6AT1A 3CMYA 4IWYA 3OIVA 1AHNA 5JSHA 3PR3A 5ALJA 4MQ9F 4YCCA 4QUKA 4HVLA 3F5MA 3E8XA 4DA0A 3PFIA 3SOPA 2BL4A 2H2IA 3CF2A 4UU1A 3QIAA 4WOBA 2QN7A 3MWEB 4PXYA 3G1OA 1IONA 2UVQA 4BKXA 3A4TA 3R3HA 4FGWA 3AJ9A 1HK7A 4B1FA 5LVAA 3EHEA 3PE4A 4MNUA 2PY6A 1JNXX 3KEFA 2FQWA 4YONB 3I76A 3O7MA 3SBXA 5BOXA 3H1CA 4ZZ2A 4EAAA 2VHJA 1T1GA 5TRTA 3C3WA 3HU2A 1Z4MA 4AJIA 1FP4A 1MBEA 3G5LA 1VLHA 5KC8A 2CW5A 5J43A 1XJ0A 1PFYA 2N75A 2XUQA 1NZFA 2DAPA 5ALOA 4J0GA 3X44A 5C7IO 2A14A 1W1UA 1YZVA 2IU6A 2ZBKA 4A9AA 5I7VA 4JVOA 4AG6A 3WISA 5DD8A 1ZEMA 1I10A 1QFZA 3QF4A 5ITVA 1GTZA 1PFVA 3RT9A 3CR8A 3PQ6A 5LDDC 2WY7Q 1JVSA 5IJXA 5KYWA 2ZSKA 3ECOA 3TAHA 5LBUA 4A8HA 4ARVA 2ZIAA 2NACA 3A06A 3ZCVA 3FZQA 4D4LA 4S1VA 1UXJA 1DGWY 3NHSA 4B32A 2XNKA 1NX6A 2XE6A 1XF1A 3ZE0B 3VPDA 2KZVA 2BKEA 4L8GA 2M30A 3EVAA 2XAUA 3II6X 4U2DA 5ALRA 5FKLA 1AKHB 4CM9D 3T1OA 2PPVA 3MBOA 5B1YA 1ZGCA 3C5HA 4KDFA 4Q4DA 3R44A 4OBBA 5KU7A 2IHYA 2GDJA 4EH1A 1A1VA 4K9OA 4C6SA 1R0YA 3QFCA 1P91A 1L5GB 1AF4A 4YXWA 2O6GE 4RYLA 4RQTA 3R6GA 4BC1A 2JFXA 1QG2A 3AY3A 1Z6PA 4ENWA 1UJNA 1EP2B 3ISPA 3EISA 5FKNA 2QG6A 4OKSA 5KOJA 2VDMB 3SX2A 2XPUA 3HYCA 1XS9A 1QUEA 4TV8A 3EPHA 2O3RA 3ABRB 3IJEB 2PBRA 1T3SA 2C61A 1YF3A 1EI9A 1QQAA 3OJEA 4ENPA 5FPHA 3HYNA 2FN4A 3DHVA 2CXRA 4KE6A 4H3SA 1H9GA 1RYDA 2J85A 1KQ3A 2Q41A 1V26A 2VO1A 4YP6A 4I99C 2VSOA 5L40A 3DAFA 2PX3A 2G6TA 2PIDA 2ARKA 4C21A 2HSEA 1BR2A 1P2VA 1MJ5A 3RO7A 4C14A 1YKFA 1KYYA 1PBNA 4KSBA 3FMQA 2M6RA 3O2JA 3TIVA 4URFA 3M1CA 4DNCA 1PNQA 1WZ2A 3QNUA 2KIUA 4TN1A 4RAZA 4AIRA 3DL0A 2NTNA 1PL8A 2MMCA 2NU7B 3RYFB 4DLRA 3UH1A 3ESBA 1W76A 3WGYA 3VR3A 5IH3A 3B1WA 3FWHA 4GR5A 4AJ2A 5FD8A 3R5HA 4IQJA 5H6QA 4DUGA 2NZWA 3C85A 4N49A 4W1UA 3A4MA 2RREA 2IXFA 1W47A 1KO8A 3ZQJA 1R4NB 3F74A 3LCMA 1ZK2A 1TMGE 2DQRA 5D4SA 1D4FA 3STWA 1ST2A 3K6SB 3QBDA 1VI0A 5CXXA 1I1SA 2HNKA 4NR0A 4AZVA 1G60A 2QUFA 1KI1A 3VVMA 4G4SO 2O3JA 1TTYA 1FFGA 4DJEC 5FX2A 2JAXA 1YJ9I 1HM5A 1UH5A 3G49A 3ONDA 3PBKA 1W0CA 4OY3A 4DADA 5ECGC 4GLLA 1LV7A 1LH0A 5IF9A 5AKGA 4YFXF 1JHQA 2IE0A 3HCOA 4ZTBA 4BNXA 2C3OA 4HEHA 3KKMA 3W8FA 3GUCA 1L5MA 3KR0A 3O8QB 1TGVA 5BQXA 5JAMA 3LM8A 3GFQA 4AC0A 5GGYA 2GZWA 2PN6A 4PZLA 1HLPA 1EVIA 4M9ZA 1XL1A 4GVXA 3RU9A 4C08A 3FXQA 3A28A 1ABFA 3IIJA 4ZI7A 2ZS8A 4KRYA 1T34A 4OIRF 2GGSA 3UK6A 4KK4A 3EYIA 5GTDA 2QJTA 1SVMA 3KU1A 3NZEA 1M34E 5JCOA 2HRQA 4U8HA 3PGLA 4A8JC 4BKRA 4PPNA 2R5ZB 3DO8A 1SCJA 1YVUA 3MJEA 2YVAA 3GT0A 2JZYA 1MGOA 3H5WA 3ABUA 1RLUA 5EZYF 1I4LD 4IVQA 4ZEWA 1PFWA 1G4DA 3D6AA 4XIFA 3QW2A 5K3CA 4DMKA 1BKSB 2LCIA 5JFRA 1RMTA 1HTTA 5DDGA 4M71A 2LCFA 3L92A 1PP4A 2G9NA 1WCIB 4MWOA 4LAFA 3FWKA 4Q47A 3IAFA 4LHYA 1P4AA 3R0AA 2QRHA 1RRCA 4I1UA 3C6ZA 4ZK6A 2OUKA 4QWMA 1E0DA 4ZYTA 1JG4A 1TM4E 3LGSA 4TWJA 1KFBB 5AH0A 4MIOA 4OHVA 4C06A 4WX9A 2O0HA 2O8CB 1K9VF 5JQGB 3G1MA 1ABBA 1Y4UA 1YDFA 4M37A 3V97A 1IUOA 3L93A 1KI4A 1DDIA 4C0JA 3KZ1E 4D0LB 2Y48A 3KFVA 2EQRA 2V1DA 4OGWA 3WNVA 2PD6A 3GFIA 3QKRA 3U7HB 2DMQA 4MTLA 3HSFA 5H3LA 3NAGA 3CNNA 5HQ3A 4JEIA 4ZU6X 1WULS 3R24A 1CBUA 4J03A 1ZGAA 3QHQA 1RXSA 3SJZA 1PLJA 4BEBA 3NPAA 3VR4H 2VIIA 3R7NA 4CKEB 4EQ6A 1LDNA 3JQAB 2KP6A 1SUIA 2V79A 2VPRA 2ZKIA 5CCDA 1L0OC 3TYXA 4A3BJ 1TJ5A 5ALUA 5A9SA 1FYVA 2E4WA 3ZOBA 3VPCA 3VISA 3KVRA 2XIQA 4INAA 1JUSA 4EDHA 3UJBA 4IMRA 5KYXB 3U13A 4AX8A 1QCZA 3R60A 4IJVA 4JBIA 2H16A 2R85A 3DLHA 4B4WA 2F9LA 1HT3A 2QB5A 4C0SA 4MVJA 1NXOA 3N28A 4ZYHA 2VYND 3LSMA 3KQOA 1S8OA 4AO8A 5CFZA 5DX1A 5DGTA 3HDHA 3QW4B 3JRNA 4RTJA 3PRJA 4TUYB 3WZ2A 4DLZA 4BNHA 5HCIA 3GHHA 3VSAA 1B6RA 3L00A 2X76A 5E6SA 1O3RA 3DAHA 1L5FA 3J7YJ 3OPQA 3D43A 4DBQA 2B7CA 5KVVA 3D7KA 3BGVA 4BCBA 4RZSA 3B2EA 1EM6A 1T24A 3IQHX 1CUGA 2QS9A 4JFRA 3FFTA 4D0RA 4LJSA 4DABA 3O4GA 3WJ2A 4LY9A 4RB3C 4CTOA 3VX4A 3GDWA 2GNPA 3UZUA 2JJ8A 3CZ5A 1YONA 4L9RA 4E5DA 2BMEA 2OENG 2WG2A 1FMFA 2R1VB 2I7XA 3S29A 4B47A 4YP1A 1B76A 5DX8A 5AK5A 3HUFA 1IQUA 1HSOA 3AFMA 1R58A 3HTXA 5HIKA 1HEUA 3IRVA 5DLQC 3AM4A 4ID3A 4MWTA 2VBWA 3A7EA 2YN4A 3D5EA 2WU0A 2A0KA 3RSOA 2I4IA 3A1FA 1INLA 2GLTA 5DGXA 3Q8MA 2CFCA 4JUCA 2Z5FA 2OVBA 1ZGBA 2XCSB 4QWWA 3O8GA 2VF4X 2QY9A 1PEKE 1K3UB 1C8KA 4GXOA 4ZZLA 2PRSA 1U1FA 2R751 2V7GA 1SXGA 2CSOA 3S2YA 2PUWA 2CE7A 3LZ6A 3LBNA 3LIPA 3L8ZA 3DMDA 3HJHA 4GMDA 5IS2A 1O3TA 1TDJA 3CMEI 4PY2A 1USVA 3U4AA 2B1GA 3EUAA 2FCAA 3E84A 3FE2A 4FZJA 5BNGA 3ZU4A 5BWOA 2XXAA 1R66A 4YJ2B 1QHHA 3SHVA 1YS9A 2MR5A 5I51A 5FPYA 3OEWA 3UUEA 2IPMA 5E3IA 2VATA 3U7QB 3WNBA 2JGEA 1NVAA 2NYAA 3FXMA 2JFZA 5H82A 2CRGA 1QYIA 3FYTA 5BN3B 1V8PA 4MV5A 1ID1A 1JSCA 4D4MA 4R3NA 2I4TA 4ND6A 2WJ4A 1D2EA 1LZLA 3A1TA 1T0UA 4DR7B 2IP1A 4GLOA 4DV6B 2IGKA 4M3FA 4H7DA 5LN1A 5BRJA 4O4IA 1ETYA 1T4MA 5DYNA 1ECGA 2MGQA 3FMOB 4PPFA 2X19A 3TO7A 1UKBA 3AWDA 3QLVA 1PW7A 4FFLA 1SCNE 3ZV5A 2ZIVB 5CH8A 2X85A 1ZBDA 5LZ4A 1GKUB 4JJKA 1F12A 1G98A 5CVCA 2H2AA 3OLXA 2JFGA 2MYTA 3M4YA 2L54A 1UFOA 5ADWA 1C4XA 4CLEA 4PJJA 1KU2A 1CY6A 3IOYA 3UMYA 1TCCA 3O4FA 4BNMA 3U44B 1TK3A 4NI5A 1YJCA 4OU5A 4LHEA 3H17A 1R5HA 1TCAA 4UASA 4FMCB 1QRAA 2XITA 1Z3CA 1IXRC 1AHIA 1U8CB 3SQDA 3C5CA 2WU4A 2JARA 4OHKA 2EFEB 1DCTA 1OU0A 4P38A 2QR3A 2XUZA 3JARB 1LSUA 2LP4Y 4D42A 4XRGA 2D4HA 2J9GA 2O2YA 4YRVA 4YAUA 3OLYA 4RABA 5TY0A 3B6EA 2GBIA 3LNCA 2EHDA 4DB2A 2C20A 3PJRA 3VC1A 5D2CA 2K9SA 2WKPA 2FK7A 1J0XO 2O7RA 3FYDA 4BMZA 3EH1A 3HBJA 1Q1EA 2GZHA 2YIDA 4XPZA 3STUA 3LK6A 2MBFA 2UYHA 3HBAA 2DYRH 5J2UB 1A69A 1P62B 1G8MA 5LA6A 3UFBA 3FHZA 3IP1A 4EJFA 4K28A 4P34A 3RIRA 2PR7A 1K6MA 2HB6A 2YHBA 4AG5A 4CUJA 1RSZA 5BRAA 1D1TA 4N12A 4ZAWA 2WQZA 4MTCA 2R1TA 4P58A 1O9GA 3BC8A 2E18A 4Q4AB 1FRQA 4I36A 1QNFA 2VTEA 4RIEA 3GLIB 3SYRA 3E81A 5GADl 5CDHA 3WWDA 2IEKA 3TIXB 4KK3A 3UN1A 3VSCA 1TC1A 4KAFA 3LBIA 2EL9A 3KDSE 4XQGA 5C3MA 2HDCA 3J80Z 2QE7A 2WQ7A 1XXHE 2H4XA 2BEVA 1YIDA 4OREX 1BAPA 1VQ1A 4KP7A 2Y9YA 3V48A 1ULBA 4E4RA 1MJBA 3ND6A 4HHEA 4DIBA 2QXUA 4R2WA 3JAMK 2FB9A 4R54A 1PHRA 5EFZA 1UDBA 2W2OA 5EKTA 4G65A 2H6EA 1CY8A 1TFRA 2Y2VA 1NUQA 2EFJA 4W1PA 4NTZA 4R51A 2WSMA 3CKKA 5ARBA 3JU3A 1NVGA 5J3JA 3ACBA 2Y99A 4RPGA 4LWOA 1NA5A 3WZMA 4I98B 2RAEA 2W93A 2L2QA 1HFJA 5DBGA 4J9VA 1IZ1A 1FDRA 4C4TA 4F3YA 1P7WA 3CT6A 1YMUA 1KETA 1NC1A 2PMBA 1JHHA 5CD1A 1RKUA 4MV6A 1QX4A 3KP7A 2YWGA 5JNSA 2HAEA 4HNAB 1T10A 3C18A 4C3HJ 2G09A 2W6QA 1A9XA 1RIFA 3EFOA 4PHTA 2JFFA 2IPAB 1F51E 3D02A 2O2IA 2QGZA 4JAVC 4BKOA 3C2QA 4EGQA 2I4RA 3CZPA 1IRFA 4KOAA 1MRZA 4GPAA 1R15A 4Y2PA 1HYEA 3I0ZA 4Q01A 4OHWA 4B87A 2FOWA 4RYDA 3DD1A 6YASA 3JAMA 4V0KA 2Q0XA 5EP4A 2L0XA 2LR8A 4JD5A 2QN1A 4E0BA 3K1PA 2WOOA 1XIVA 1KDPA 1UBEA 1ZI6A 2V7QA 1NMSA 4DNQA 1VP3A 5LB2A 1AH2A 4L73A 4IGKA 1V5GA 5EE0A 4G3XA 2E82A 2WUGA 4GFDA 4WKPA 2G7ZA 4NU5A 3K0AA 4XSVA 5KI6A 1VF9A 1JX6A 4CZCA 3DVRX 3KP5A 3K70C 5LKRA 2HWUA 1ZLXA 4IDDA 4DA9A 4YRMA 1LNQA 1EQ2A 1QYXA 3BIFA 5IJAA 2XCQA 1KDVA 4C20A 2C31A 3JD0A 2F5VA 3K9FC 1NRWA 1EAMA 5I4BA 1QPGA 3D9QX 3BN3A 1Q1GA 4U6QA 3NRJA 4ZDKA 2WHEA 2VXZA 1G66A 4Q37A 3WBFA 3BLYA 5F27A 1GYRA 4LRXA 5DMHA 5CFQA 2RAFA 5EHZA 1Z18A 5CH5A 3JRBA 1EK1A 2DLLA 5EJGA 3ABSB