4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
3LECA 5E8RA 3I0TA 3S68A 5CVRA 3G8AA 3NRVA 3MHTA 1LVAA 3SXJA 1UHMA 2YXEA 2IGTA 5BP7A 2YR2A 3LBYA 4OMZA 4EQZA 3R9XB 2NS0A 3HVJA 3LAJA 2GA9A 2V79A 4EGYA 1ZN2A 1KGSA 3W6JB 1YFHA 2VXZA 3EUHA 3GYHX 4GXOA 3BT7A 1FBQA 4RTJA 3HVHA 3QOWA 2DAOA 5K01A 4HF2A 2PX4A 3ELWA 5CVUA 1P2FA 1WQ2A 1SD5A 3M9AA 2ZIEA 1TQIA 4ENMA 4QDKA 3G2MA 5LQKA 4DCGA 1KA8A 4LJZF 4G7OF 5D5VB 2K4JA 3RKXA 3B3FA 2KRFA 2LNBA 4ZYHA 3FZGA 2HTJA 2ZO4A 4PGGA 1IN6A 4N0BA 4PCQA 1J7KA 4GUAA 2F2EA 3LCVB 4WCGA 3FXQA 1T43A 2MA3A 1IN7A 4O3MA 2F5FA 3HHHA 1XSDA 1V39A 3HTSB 4QVKA 3H2BA 1HNNA 3TO6A 4KDCA 2ZZMA 4HYEA 2UYCA 2PJPA 2FYTA 2F5EA 2GA1A 1O7FA 3OZSA 3LAPA 2FRXA 3IL2A 3KQWA 4G9YA 5J8FA 1F9NA 4EK9A 3C6KA 2EFOA 5GIOE 1FC3A 1F5TA 4GEKA 2PG4A 2W85A 2LD4A 4JK1X 1H9TA 2IA0A 2VE9A 3CJTA 4HV5A 3J81K 1O3RA 4M36A 3SVZA 3WGHA 2P40A 1TLHB 1TTYA 3GZ6A 2P5VA 4L9JA 1YQAA 2Y1XA 1ZG1A 1G6Q1 1VIDA 1R7JA 5FGMA 5D8LB 4XUEA 5EG5A 3ISPA 4A6DA 4AIHA 4BQAA 2H1RA 4ZYEA 5CYVA 4H0NA 5CVVA 2AS0A 4N9IA 2Z99A 3R60A 3KLOA 1M0EA 4G7ZF 5FFXA 4L0YB 3EEYA 5T67A 3LL7A 2PT9A 4HF1A 3BJ6A 1U2WA 5J6XA 2FNAA 4U7TB 2XYQA 3BGIA 3ZN1A 4XRFA 5EIWA 3GEZA 5LGUA 1YB2A 4PCLA 4CTKA 2HTSA 3UA4A 2OB1A 2JG3A 4GOOD 4YFXF 2KIUA 2VOPA 2IBTA 3LSTA 4CHUA 4MEYF 1EJ6A 1R18A 3M6XA 3OFKA 4QTTB 2ISYA 2QY6A 3MFKA 2EA2A 2V1DA 3KQPA 5K0GA 1BIAA 1IM8A 5DSTA 5F6FA 3KU1A 5LEJA 2ZLBA 5F2NA 4A6EA 2HV9A 2WC2A 4P7KA 3UA3A 1R1VA 2CWEA 3GFJA 2HKXA 5LEKA 3HCFA 2GWRA 2L3DA 4HX7A 1XXLA 5K05A 1P92A 3P97A 2IT0A 3BGVA 5EPEA 2AOWA 5HLIA 4IPAA 1XDSA 1QPMA 4FGZA 2OBPA 3HIFA 4OU0A 4YV0A 5FWAA 4LLGF 1S3JA 3ELYA 1MKMA 3KP2A 1NHAA 4RAYA 2KJCA 1RUNA 3Q9SA 5DDGA 1FBNA 2NXCA 2FXAA 2M8EA 3QV2A 4EKIA 4BXUA 3KPWA 2OA4A 2V1UA 4KT5C 3SSNA 5EMLA 4UVCA 2O05A 5HLHA 2RC4A 3MAJA 5HIMA 3C3YA 1RI4A 4P7GA 3V7CA 5E1BA 2M45A 2Y75A 4RGUA 3B5IA 3UJCA 1Z9CA 4EV0A 4KFCA 2VODA 5DX0A 1FP2A 1QZYA 1G3WA 2BM8A 1R00A 4KIFA 3V4GA 2G8NA 4HTFA 3TOAA 3ER8A 1BHJA 5K0EA 3N97A 4L0ZB 4DZRA 3U1DA 1DCTA 3B73A 3HHGA 3K0BA 2JHCA 3BWBA 3TM4A 4MTDA 3PLAE 4PYOA 5D6EA 5HDNA 3F8FA 4EJWA 3KP3A 4EKGA 1KXZA 2QBYB 1FWZA 3EVAA 3RIRA 4MGRA 5CVJA 5B1SA 3TPZA 3GJYA 4BLWA 1P4XA 2D1HA 3QOXA 3FTFA 1J5YA 5P8WA 3M1EA 3R61A 5JFRA 4QLCU 3NW9A 3FUUA 4DNCA 4ZZLA 2JHAA 2B3TA 3GRUA 3NVMB 2A6EF 4HDVA 1AWCA 1XMAA 1UHWA 4RV9A 2I62A 1BOOA 1B1BA 1UB9A 4B8XA 2V74B 1EH6A 1WG8A 4L9TA 1SFUA 4DA4A 2HQRA 3L2CA 4M38A 4LWOA 3E6CC 3PB3A 3U2RA 2OBFA 1QZZA 2L54A 5L3DA 3TDZC 3E8SA 3GFIA 1X1AA 5EZQA 3V8VA 1QQIA 2L02A 3TQNA 3L8DA 4FT4A 1YFLA 1DDNA 1SQFA 4EM1A 2CGPA 3EGVA 1KU7A 3LKDA 2QE6A 3Q7EA 2J5PA 3SZTA 3AAFA 1EH7A 3FF5A 3JW4A 3BZ6A 4E2XA 3E7PA 4I7HA 4RWZA 3G73A 3ER9A 4GGGA 5K0LA 2ZKZA 3DEUA 3ECHA 3H92A 3BWYA 2VP3A 1U5TC 2NP7A 1XD7A 1XGOA 2C6YA 3PQJA 3RDIA 4QTUB 1XSVA 3FX3A 3Q5FA 5FCDA 3M33A 1FP1D 2YXLA 3ERED 1AOYA 1SD7A 4PINA 2FE3A 4HV6A 1KR5A 1IXCA 2EJRA 3I59A 3T7SA 4I2OA 2CWWA 3BROA 1AQIA 1OYIA 1T6SA 3HVKA 1JGSA 5LR6A 3KLNA 1NW6A 4YMHA 1CF7A 2FHPA 3KR0A 1Z3CA 4FHTA 2CO5A 1R8XA 1L1EA 3J80Z 3TGNA 2RNJA 4HAMA 3UFBA 2WV0A 1WZNA 1FT9A 4BLVA 3AWIA 4HA8A 3BUSA 5M5BA 3DV8A 4MTEA 2BR3A 4GC5A 5D4RA 4L9VA 2IFTA 5C9ZA 1F1ZA 2K86A 4FR0A 3KPUA 3EMBA 1IXSB 3CTAA 1MZBA 3BJOA 4EJUA 1VL5A 1T39A 4FT2A 3UJ8A 4RTLA 1YG2A 3LFKA 1K7AA 3EDPA 3TO9A 3M6WA 3HA3A 1TW2A 4FP9A 2DULA 1R5HA 3NWEA 3CJRA 4X1OA 3RIEA 1SAXA 2JH9A 2YR0A 1KQ8A 1W5SA 4A5MA 5FA8A 2X0LA 4YFKF 1I1SA 2PKWA 2XV4S 3C3WA 1FYMA 3MERA 3NWBA 3CJQA 1BM9A 1D8KA 2R7FA 5DCMA 2DPUA 2FF4A 3K6RA 3KQSA 1G3SA 1QAOA 4M37A 4LG0B 2IRFG 4YUYA 2H11A 2DLLA 1F4KA 1W4MA 3EVBA 4RTSA 3TKAA 3NMUF 5DUKA 1Y8CA 7MHTA 3THSA 4HQEA 3PFGA 3RYRA 4ENNA 4OIQF 4GOLD 4PYQA 1TQMA 2D45A 4R8SA 2PWYA 4BH9A 2ZCWA 3EYYA 4UOEA 1LDKB 3BZBA 1MGTA 3ZMTA 1EV7A 1QAQA 1WS6A 5EQJB 4HGZA 3ULQB 5HS7A 2YUIA 1UFKA 1B6AA 2GB4A 2H6BA 2JPBA 1C0WA 3KPYA 4G7HF 3KQMA 5K5QA 4P5OA 4CYDA 1SUIA 4PYIA 2Z9OA 4QQKA 2DO7A 2GIVA 5EMMA 4PGHA 1L3LA 2B2CA 1FOKA 5CM2Z 3ML6A 1MDMA 4KN4X 1FY7A 4R1HA 1P1CA 2H00A 5CVEA 1G3YA 3OE4A 4CDGA 1G3TA 2PMUA 3QU3A 5EGSA 5U4XA 3OE5A 3BPXA 2FEZA 3HCEA 1TW3A 1HKSA 2CKDA 2NXEA 1TNTA 2XGXA 4HGYA 5DD8A 5EMJA 3SXYA 3VB2A 3G89A 3B7PA 3RTRA 2XKPA 4U7PB 4M72A 1L3IA 1KU2A 2E1NA 2MBFA 1NW8A 5HIJA 2RKHA 4PYLA 2P6TA 3IV6A 3QRFF 1VQ1A 4RVHA 5HFJA 2PXAA 4XCXA 1FZPB 3IWFA 5K1YA 1K6OA 1FSEA 3K1PA 2XVAA 1IRFA 5GM1A 4ATNA 2KIFA 4A5NA 4RVGA 1P4AA 3GFLA 3HSEA 2QLZA 4NECA 1WRJA 4OIPF 2OZVA 4ON0A 2IJLA 3T0IA 4HH4A 4U7BA 5DM1A 3TR6A 4CKBA 3PQKA 4XSZF 1BC8C 5BOXA 2PX8A 3V97A 3KP4A 5EMKA 2RGVA 4IVNA 1PP7U 2O57A 5KQSA 4EJTA 3DPLC 4BHPA 2AN4A 4RTRA 1GHCA 1QBJA 3CGGA 4OOIA 1G4DA 1LQ1A 3MAGA 4X61A 3AY0A 4Q47A 4X63A 3P2IA 5EC8A 3NTVA 4RTMA 3FWEA 1ZLJA 3DP7A 3GUDA 5BMZA 4KVZA 5BW4A 4Y15A 5FB2A 4KDPA 4HW0A 1USSA 1JXSA 4L5JA 4LMYA 3OPNA 2ONZA 2WA1A 4GOMD 2AN5A 1ODDA 3V8LA 3DQVC 4NQWA 4LB5A 5H02A 1JQDA 2P7CB 4DQ2A 1GXQA 2CYYA 5H20A 2FRHA 1YZHA 2P6SA 4CWAA 1GVJA 2H6CA 3Q9VA 3MEXA 3BXOA 2YX4A 3GWZA 4EM0B 3R3HA 4PWYA 2YVLA 2F5DA 2PEXA 1BKYA 3EVEA 2EV6A 3FHZA 1JSXA 4DMGA 3VYWA 1PUEE 4HF0A 1INLA 3WGIA 3A7DA 3WTTC 5EVJA 3OOPA 3K1NA 3F8NA 2PLWA 5HDKA 4BHBA 1TPYA 2B9EA 3G88A 4BP3A 3UJAA 2JSCA 5FQNA 2ZIGA 4ISCA 4LFUA 2TDXA 5HIIA 4FT8A 1WSUA 1SFEA 2G7UA 4C4AA 3PT9A 2DT5A 2WTEA 3LQRA 1U6GA 4LG1A 2UXNA 2C7QA 2EWNA 4R6XA 1W7PA 2XYRA 3HNRA 3OCJA 4RB3C 2XAHA 1OR8A 3O3KA 3DXXA 1I4WA 1BI3A 4M9XA 4B17A 5E8GA 5LGNA 4X60A 2E1CA 1UFMA 1NE2A 1M6EX 1VLMA 1VPTA 3UZUA 5E18F 2PBIA 1S6LA 1GXPA 2BZGA 3CBGA 2ESNA 4PCAA 4HLYA 4RB2C 3F6OA 5BPDA 1RUOA 2XYVA 2LDUA 2QBYA 2DU9A 3DMHA 3GRYA 2P8JA 2W25A 3WGGA 4KIGA 1KU9A 2ZIFA 4E31A 4DKJA 5JHUA 4KDRA 1RI2A 1YIOA 4UVBA 4C03A 1U2ZA 3P9NA 5CCXA 1N7JA 4XUCA 3FM3A 3TKYA 3SM3A 4R6WA 5ED4A 1OMIA 1B42A 1XB4A 3ZMVA 3FTEA 3KP6A 4IRIA 5KK1A 1ULYA 2M5WA 3ECOA 3PFHA 3LGAA 3GW2A 3WSTA 4M6YA 3RJPA 3G7UA 2FBHA 4WVLA 5LSAA 1D2CA 2ZZKA 5DM0A 4JQFA 3IKTA 3WODF 3TMAA 1HW1A 5EEHA 3UJBA 2Z6QA 4I0AA 2OD5A 3NDJA 2XAGA 3WTZA 3WE2A 2YPRA 1ZRCA 3BY6A 2OYRA 1IAWA 4ER0A 4BLUA 4YUVA 4EM2A 4UV8A 4QDJA 4K6MA 2ZBPA 8MHTA 3WTSC 1LDDA 4M9ZA 1YYVA 4MEXF 3CO7C 2ZWVA 2GLUA 1F3LA 5CD1A 4Y17A 2VBWA 4HX8A 3VEPA 2BH2A 2P35A 2RV8A 3WTXC 4RAZA 2YX1A 2PY6A 3CO6C 2GH1A 2NXJA 1R36A 3OU2A 2PX2A 5LQJA 3P9KA 2IH4A 2PBFA 4ZH4F 4DF3A 4MNUA 3G5LA 2O06A 4FSXA 1G8AA 4KN7X 1QAMA 1OYWA 3FPEA 3BJAA 5FD5A 3Q87B 5G02A 3CCFA 2PXXA 3LA3A 2A68F 1MJ9A 1W5TA 4AWXB 2W57A 1DUSA 4IV8A 2B78A 5DX1A 5CIYA 1RZ4A 4C06A 2UYQA 3FM5A 1TQPA 4CICA 5E1MA 4A2UA 3G2PA 3ORHA 3IRRA 4C05A 1HW2A 4P7JA 1WI9A 1T38A 3ZMDA 2STWA 2J5OA 3REOA 4E30A 4GYIA 2H09A 2PQ8A 4TV7A 1UWVA 4IF4A 2AOUA 2IBSA 3TOBA 3UWPA 3ZN0A 2NYUA 3GVAA 4O29A 3R6SA 4LB6B 3FMRA 4MQVA 3E6BA 4N9HA 3D5LA 1T98A 3KR2A 4M9SA 1F38A 2HWKA 5LRRA 3E5QA 1NKVA 4Z2YA 1SG9A 5D5UB 3J7AO 3CVOA 3FUWA 3KQOA 5KYGA 3D2LA 4B09A 1JE8A 5HEKA 1RI5A 5DM2A 4YUWA 3BDDA 2I7CA 5K0JA 4YG2F 3LDFA 4EVIA 3F8MA 2KKOA 5TRDA 4AZSA 3EETA 1RJEA 1YF3A 5A2QZ 1IY9A 1VTNC 5GINE 1REPC 4A0YA 1U3EM 5DXAA 4G94A 3LDGA 3GLXA 1JR4A 3UJDA 3B3JA 4MWZA 2GAFA 3FTCA 3KE2A 2UYOA 1U8RA 2FMLA 1ZYRF 5EOVA 3FYDA 3BKXA 2R3SA 1MD0A 3QP5A 3A25A 4C04A 2YSRA 2GXBA 3KETA 2FU4A 3WTVC 1XMKA 4RS8A 4NHJA 2HFHA 4U7DA 1G55A 4PYMA 5LQNA 2ZBKA 5D5XB 3HOTA 3ME5A 3A7EA 1QYRA 1H0MA 3R24A 3E23A 5DM4A 3FPJA 3OFJA 2DFIA 2W24A 1KIAA 1R5GA 4Y2HA 2WWYA 3BWCA 2VDUE 2Y1WA 1JTEA 2LKPA 3CDHA 3A27A 5JI6A 5D5WB 2OPBA 1XN7A 3QPHA 1XDZA 5IT9Z 1G8SA 3RW9A 2G72A 1LEAA 5C1IA 2ACJA 3FYCA 1MJBA 2Z5UA 4O5VA 5BS6A 1PJZA 3HCAA 2DQLA 3MWMA 5HZMA 2D1VA 2IA2A 2ZFUA 2AVDA 3VFZA 3SZPA 1L0OC 5CJ9A 5L3CA 2FSWA 3K2ZA 4XLNF 4ENJA 4YIFA 1JG3A 2Z6AA 2MLKA 1EG2A 1O3TA 2VBYA 2BE5F 4F86A 2L4MA 3BKWA 3KQTA 3L00A 5LHHA 3EVGA 2E7XA 3G5TA 5L3FA 2VT2A 4POOA 3ABUA 2H27A 3ANXA 4A0ZA 4EJVA 5H6QA 1YW7A 1L9KA 3IEIA 3KP7A 3KPVA 2PVCA 4BHCA 3ERCA 1Q0SA 2PFBA 2JPCA 5IT3A 4HBLA 1BJAA 4HRAA 1L3BA 2OQRA 1IN4A 2I6GA 1QNTA 4P9FA 3P71T 1TNSA 1EH8A 4AIJA 2H94A 3ZPLA 4QPPA 3N4MA 2ZNYA 4FZVA 3JWHA 3SSMA 1G6NA 2LF8A 2Y48A 3DH0A 1JG2A 1G60A 2M1BA 1Y0UA 1I9GA 2OY0A 3TFWA 2ZMEA 1RI3A 2GQQA 1O9GA 3I53A 5DCMB 4P9UA 2AOUB 3AXSA 3VOEA 3JAMZ 1YTYA 1X1CA 1Z05A 4GBED 4Q5SF 5ERIA 1EQAA 2HKOA 1ZQ9A 3IHUA 3PX2A 3C18A 1CGPA 2RVCA 3C0KA 3HEMA 3BWGA 3I5UA 4WXCA 3QP6A 3EEOA 1DUXC 4KNYA 1KQ0A 1WXWA 5C0OE 1Q1HA 5BW5A 3MCTA 2V6CA 4MIKA 4KICA 1JG1A 3SQNA 1B4AA 4I02A 3CC8A 2Y0MA 4EMSA 1OR7A 5L3GA 4BP1A 2RDPA 1XGNA 3HRTA 4PONA 2A3SA 2AR0A 4EGZA 4QQNA 4K2EA 4F7ZA 5FLXZ 2O07A 3UJ7A 3PS9A 1MDMB 4P58A 2IH2A 2XUBA 2P3OA 1O54A 4IXAA 5HILA 5DLYA 2JHPA 5FWDA 2NNWB 2HYGD 2NNYA 3R6TA 2DK5A 3LKZA 3HTUA 2JTVA 4DCMA 4PIMA 2HWVA 3F4KA 4P55A 3RYPA 1LB2A 1VE3A 4IKPA 2P7VB 3I9FA 1BN5A 1KYWA 2ZULA 3HVIA 1Z91A 2HS5A 4G6DA 3TO7A 5ILVA 2O0LA 5TJJA 1HSTA 2IDJA 3F22A 4E2WA 3SR4A 2K02A 3FZVA 2XRNA 3DXJF 4IRGA 3LA7A 3IC7A 4PNEA 3GZ5A 3IYLW 1HSJA 4ESJA 1XCJA 3IWZA 3JTHA 3T7RA 5E17F 4G8XA 1K78A 1EAMA 4KYWA 4V0RA 4GF5A 3SMQA 4HX4A 1ZLKA 4C08A 2E7WA 1L3CA 2V7EA 3AXTA 5FQOA 5GOZA 2BV6A 4UUVA 4WF2A 2P7HA 5KS2A 2BGCA 1XCVA 3F8CA 1ONVA 4QVGA 3HOSA 5KVRA 2D2WA 3DULA 1XCBA 2MLGA 3M7GA 1R6AA 3OZRA 3H3UA 2RN7A 3KQYA 4RGRA 4I01A 2QVOA 5EIFA 1PP8F 2PLYA 4LWPA 4F84A 1CF7B 3LQQA 4DQ0A 2QYOA 2PN6A 3J81Z 2VOOA 1JHFA 1XGMA 4U0WA 3F8BA 5CVDA 2EV0A 5FUBA 2VONA 2A69F 2EFNA 5LRSA 2DW4A 2EFWA 2PJDA 2CSOA 1S7AA 4ZYGA 4RVDA 1T2KA 5E9QA 3O7WA 3RPUA 3KKZA 4GC9A 3FRHA 3OV8A 4UNOA 1IW7F 3DLCA 1B9MA 2IH5A 5DSXA 5F2KA 1P1BA 5E9WA 2EFJA 1O3SA 1R1UA 3E97A 1R8YA 1BI2A 3PVCA 1HW5A 4MHTA 5HVQC 4LGWA 3U9GA 2ESHA 1ZRDA 3T7TA 5K8VA 4CZZA 3GFMA 3JWGA 2X4HA 2O3FA 5EEGA 4OA5A 1J0RA 3DUWA 1B59A 3DR5A 2Z33A 1SQGA 1N7IA 3V7RA 4RVFA 2ZFWA 2EJUA 3EGIA 1U5TB 2PGXA 1YLFA 3QPTA 2DPDA 4ENKA 5E1ZB 2P4WA 4ESFA 3JTGA 2ZCJA 3RPQA 1VP3A 1BI1A 1FX7A 2VT3A 5E1XA 4AVPA 3E6DA 3KR1A 2QWWA 2UWMA 4QPNA 4WK8F 2A14A 2FCAA 5E9JA 1J2XA 1OKRA 2XHKA 4OQDA 4CGZA 3JSOA 2XKOA 4CXMA 4YFNF 3K1MA 2E5WA 2Q0OA 2IPXA 3ZMSA 2ESRA 4L7VA 1I5ZA 2GAUA 1SMTA 3FMQA 2ZVJA 2KW5A 3V7SA 3HA7A 2HR1A 5DYMA 2IIPA 1BI0A 3GRRA 3KPJA 1MHTA 5E8JA 4MQ9F 3VC1A 1IXRC 4HQMA 3ZMUA 1Q0TA 1IXKA 4XUDA 1E2XA 5EKXA 1ZHFA 1Z7UA 1LEBA 2OAZA 1VBFA 2NNNA 1D5VA 4ER6A 3C1DA 2FPOA 3WG9A 1JHHA 2IA1A 2EFPA 3KR9A 3TRKA 5ILSA 1LDJA 3BPVA 4S05A 4F85A 2ELHA 3HUGA 4FSDA 3G2OA 3COAC 4RGXA 5DD4A 3O31A 2BM9A 3LA2A 2P3QA 3TDUC 3GRZA 2ONYA 3TLJA 2G7HA 3P2KA 2XASA 3TM5A 5DRTA 3GRVA 1H1DA 2QM3A 5D1NA 1ZG3A 2V9VA 5FADA 3RKWA 1KPHA 3KCCA 3I59B 2XBMA 3F72A 3RKYA 2RQPA 3LDUA 2HR3A 4L9NA 2G70A 4JXJA 4OBWA 5DUIA 5E1DA 5FFZA 4OQEA 5K5OA 3HYIA 2QRVB 3G3ZA 3CUQB 3CUQC 1BBYA 5LQRA 1YUBA 3DKWA 3CUOA 3THRA 2O8XA 4C07A 2Z6UA 2HNKA 1AQJA 3MQ0A 3PFIA 4RB1A 1ZARA 3R0AA 3FXUA 3HRSA 2IDKA 3FPGA 4GOND 4ETSA 3IHTA 3TQSA 2AOVA 4DM3A 1PDNC 4LK1F 1R58A 4ER3A 1I1NA 2QQAA 2MH9A 4WXDA 3WTUC 1WXXA 5DT2A 4CXFA 2HTEA 5J8CA 2EG5A 5JVTA 3NEUA 2MH2A 5BQTA 1D8JA 1JTFA 3C3PA 1XDUA 3DMFA 5K03A 2WA2A 1MJFA 1RNLA 1FSHA 4CKEA 2MD5A 2STTA 2VC1A 2CG4A 4FS8A 3T5XA 2P8TA 1HKTA 1KU3A 1JG4A 3O2PE 1IZ1A 3HRMA 2DI3A 5FLXK 1SD4A 4YV1A 3T0YA 3ELKA 3E5UA 3QU6A 1RIOH 4GO1A 1B9NA 2K4MA 4IHSA 2OQGA 3D0SA 1NW7A 2DK8A 1ZAOA 4RTOA 2OZ6A 2ADUA 4LG0A 3GCZA 3GDHA 4MHGA 4WXHA 1VP9A 5EHGA 5K09A 5MHTA 4XSXF 3MCZA 2PSSA 3BOQA 5T6BA 5HS9A 3VC2A 4YMGA 1AV6A 4BY9E 3KEQA 5F1RA 4YUXA 1XGSA 3QAHA 1P39A 4ER7A 3QOPA 3P8ZA 1X19A 2OXTA 2P7IA 4AD9A 2OKCA 4KRGA 3FRIA 3OU6A 4RTKA 1UIRA 9MHTA 3MTIA 3MGGA 3F21A 2ZBQA 1X1DA 1NW5A 1N2XA 5E2BA 4BAYA 5CCBA 2XAJA 4OIOF 4V0QA 3F23A 1IN5A 5CLSA 4OINF 1KQ9A 5HOQA 3KFWX 4EQQA 1PRYA 1J75A 2AOTA 1SKMA 1FLIA 3G8BA 1BC5A 5CVIA 3HCBA 1I1GA 5L3EA 2HZTA 3V8JA 4KW7A 4Q48A 5A2QK 4LD5A 5T64A 2ADMA 3ZQ7A 3T8RA 2I9KA 5DV5A 2NYXA 1IUYA 1IF1A 2V1XA 2G9WA 3FPFA 1R22A 5E20A 3I64A 4MTLA 4LLNA 4P96A 4YV2A 2Q41A 2BBYA 3HA5A 3LHDA 3F3XA 2FK8A 2KIMA 1JQ3A 2DQRA 2O0YA 4HC4A 2B25A 2YXDA 2XAFA 2QENA 4OIRF 4P7FA 2AOTB 2XAQA 2EX4A 4PIPA 3HRUA 4AX8A 4AZVA 2BEOA 1DP7P 1QGPA 3DLIA 4LLLA 3UJ9A 3DMGA 3AJDA 3FUVA 3DPTA 4OBXA 3RODA 1O7LA 5FO5A 2ZSUA 2VN2A 2VS1A 2IVMA 1ON1A 1P4WA 2Q8KA 3E6MA 3DF8A 4OA8A 2FBKA 3JAMK 1STZA 4FX0A 3I58A 2VE8A 2ISZA 2GXGA 1RJFA 4MQ4A 5LLQA 5KVAA 4KA4A 4U0YA 2LSOA 1R74A 1T0FA 2FNPA 3MZYA 4KIBA 2BR4A 1P6RA 2EA4A 5L3BA 5K5RA 4RTNA 2VBXA 2OZUA 3SHFA 1V4RA 1W7PD 4L5IA 3ROUA 3CJNA 3CLOA 3FUTA 3KQVA 4IRHA 3LPMA 5F2OA 1X3UA 3BWMA 4R05A 4BYYA 3FPHA 3R0JA 2VZ9A 3ZMZA 2O61A 3HP7A 5AIPA 3E5XA 2XROA 5EZSA 1SVUA 3EVDA 3SX0A 4E33A 1WWXA 4ER5A 1K78B 4CKCA 1P91A 3ABTA 1FBUA 3K69A 1IRGA 4RSRA 4PYJA 5DCFA 1Z6RA 4M71A 1X1BA 2ZTHA 5HS8A 3IRQA 5BPIA 4RGSA 2AZTA 1DL5A 3EVFA 3M4XA 2A07F 3O4FA 1E17A 1BC7C 1RJGA 3KEOA 2P1DA 4QWQA 2NXNA 5ILUA 5DXJA 2ZBRA 3C6MA 2ZMEB 4D0PA 2VDVE 3PTAA 3P2EA 2MC3A 4GQBA 3I71A 3SGLA 1G38A 1W7PB 4HZFA 3OU7A 1NT2A 3FUXA 3LCUA 2N47A 2O03A 2LF7A 2W84A 1HKQA 1ZGJA 2M87A 1QO0D 3FXRA 4ZZDA 3P9IA 5K0CA 2XVMA 3DFGA 4LK0F 5DEQA 2JZYA 3DXYA 2EFQA 4S04A 4LECA 4YUZA 4HOBA 1DPRA 5ICEA 1S8NA 3MZHA 1XVAA 1XTPA 1ORIA 1KP9A 5CUQA 2PV0A 4Y30A 1JQEA 5FD6A 1D2HA 1V3FA 4AZTA 5ERGB 3LX6A 1O57A 4EJOA 1NV8A 1SMYF 5ICCA 1EJ0A 1HXDA 2ZWAA 4E70A 1RI7A 2GA2A 4RTPA 3RI4A 3TOSA 5GWXA 4GCVA 3EQLF 3DOUA 2CMGA 3WTWC 1NBHA 2VC0A 3OZTA 3R4KA 2K27A 3B3GA 1U5TA 3GF2A 3WTYC 1A04A 4RTQA 4UXNA 5LQAA 3IKVA 1D2GA 2VDWA 2QQ9A 5E1OA 3KZYA 2JRTA 3HCCA 3GX4X 3E05A 3ID6C 2YQZA 5LHIA 2OO3A 4OMYA 5E2AA 3LBFA 5GP1A 2YU3A 3GXOA 1XCLA 1YFJA 3KZZA 4UV9A 1LNWA 4G6QA 1AF7A 3GGDA 4E32A 3JWJA 1K79A 3L7WA 1WKMA 2PXCA 3E3VA 3PX3A 2C7OA 1XJ5A 3HTXA 4ZYDA 1YO5C 1FBSA 4I0BA 3HSRA 3WE3A 5LHGA 4WWCA 2GZWA 2AOXA 4KWCA 1KYZA 2R6ZA 2COMA 3EVZA 2JT1A 1EIZA 1WY7A 2VBZA 2A61A 5D4SA 3F6VA 3M8FA 2UZKA 5EHIA 4BNCA 1YW8A 2EB7A 2XIGA 5F64A 1TBXA 3GNLA 1YS7A 1FYKA 2L4AA 5ICGA 4O6JA 3X0DA 4Y13A 4AUKA 2HYFA 1Z1DA 3MQ2A 1MJAA 5DTRA 2M30A 3WU1B 2GPYA 1R23A 5AIQA 3M6VA 3R0QA 4ESBA 2F5CA 2OB2A 2G71A 3B89A 1ZRFA 5DTMA 10MHA 1I27A 4JBAA 2CL5A 2EV5A 2A6HF 3P9CA 2FBIA 4HLXA 3C7JA 2ZZNA 1UCRA 1BIBA 3CUQA 3T1BA 5LGTA 5FA5A 2PT6A 4I09A 3NQOA 3KP5A 2PWPA 1NV9A 4M7RA 3BGDA 1ON2A 1OYYA 1SUSA 3H3ZA 4ASNA 1H9GA 4H0EA 2BR5A 1R1TA 5AONA 4RB0A 3A4TA 3NDIA 5GM2A 3JSPA 4IV0A 1O9HA 2P5KA 2YTZA 2HQNA 4HG2A 4PYNA 1KHHA 2CMHA 3S2WA 5HOOA 2Z3YA 4CTJA 3VSEA 3SFZA 2P41A 2HOEA 1ZH5A 3I54A 3O6BB 3KHKA 3UJ6A 5DPMA 1ORHA 2HGCA 1IN8A 4PZJA 1FYLA 4M6XA 4AZWA 1ZGAA 3M8EA 5HDGA 2JH8A 2GS9A 5ICFA 4HTFB 3GU3A 5JUWA 2QQBA 1HBXG 3NVKI 3FTDA 3B02A 2IW5A 2PI0A 3G2QA 1YW9A 5FTWA 2CFXA 4IJAA 5E1WA 5IKMA 5EKUA 3UBTA 2AXLA 4U88A 3GIWA 2NRAC 4A12A 5IH3A 2G1PA 5D6FA 1S29A 5K0BA 2R7DA 1KPIA 4KMFA 2EJTA 2C7RA 3K9TA 3L9FA 3LCCA 2ZNZA 4L18B 4XLPF 4YIIA 3ZP5A 3T8TA 1S7OA 1J59A 5D1HA 4E2YA 1FPQA 2HDCA 1JSZA 4AIKA 2ERCA 2IPQX 4NB5A 2O6GE 1HMYA 2JJQA 2UXXA 3EGEA 1ZREA 2BYVE 3CKKA 4R8HA 2ZW9A 5LQUA 3EPPA 2OU2A 5DTQA 4XBFA 2FMYA 2AS5F 3HCDA 1RJDA 1FNNA 5K0FA 4R8RA 4I98B 2AN3A 5GIPE 3SSOA 2KJBA 4OX9Y 2CQKA 2K7LA 1YS6A 3EYIA 1DPUA 2F8LA 4UVAA 3BP8A 1M6YA 1Z6TA 3J80K 3P7NA 4CO8A 4WX9A 2FA5A 3ELDA 1D3YA 2DBBA 5H6RA 3DTNA 5FHQA 3HSFA 6PAXA 2C7PA 2DPMA 2IP2A 1OPCA 2WK1A 4UHTA 1U78A 3A26A 5HLGA 2QRVA 2UZ4A 5DRYA 5KQRA 4A0XA 3JWIA 1ZG5A 1KPGA 5BXYA 2NP6A 4IWNA 3M6UA 5K0NA 3U81A 4R79A 4Q4ZF 5LBQA 3W6KB 2P3LA 5DWQA 2DTRA 2K4BA 4M74A 4HDUA 3EVCA 2B0LA 1J9IA 5JR3A 4G56A 3V8KA 2A5YB 3WU0A 1ZKDA 1I6XA 3KQQA 4M73A 1XSXA 1BOAA 5D8KB 2HEOA 4RYLA 4U0VA 3MB5A 2Q2EA 2ZXJA 4KMUX 3LWFA 5IT9K 1NW3A 5E8IA 4KUMA 3M70A 1RI1A 2ZJ2A 1HQCA 4PDKA 2UYHA 2CW0F 1FJXA 3K0LA 4GYGA 3EMDA 1SD6A 4FX4A 2FOKA 2FK7A 1USTA 4ZTBA 2NAZA 3GO5A 2P5LC 3L09A 4PYKA 1NBIA 2QZ8A 2ORED 4E2ZA 3DXZA 1O3QA 2ETHA 2XVCA 2AVNA 2PX5A 2HMYB 1LJ9A 3MTEA 3VODA 3NJRA 4X41A 3GO4A 5FHRA 3I4PA 3HM2A 1QANA 5DX8A 3FMSA 5FULA 2YX7A 3ELUA 1YZ3A 2L01A 2QUFA 5LQCA 4IHTA 2EK5A 1SFXA 4RX1A 5HIKA 2PMHA 2FQ3A 4HSGA
chains in the Genus database with same CATH superfamily
2H51A 3LECA 2ZQYA 3AQIA 2BVMA 5E8RA 1MABA 1X7DA 3C4VA 2BXYA 2ENUA 3I0TA 2EV9A 3FZEA 5HK8A 1XN4A 4W9MC 5CVRA 1Q84A 3I4LA 3IHWA 13PKA 1POXA 3P4UA 4EJMA 1IH8A 3HBFA 1FQWA 2ZSHA 4YFYA 1SANA 2MOKA 4K9RA 2FD5A 3L05A 3EZFA 1FYFA 2FZKA 2K9NA 5HGJA 3S3MA 1KR2A 2YR2A 4BEHA 3ROPA 5D5QA 1IHOA 4E5YA 4M0PA 8GPBA 2GHQA 2W2XA 2X8JA 3R23A 3PV0A 2C3OA 3MAAC 4TQUS 4QXOA 1W48A 2IXAA 1Y39A 4EG8A 2IV7A 3K16A 5FD8A 4PFQA 3AMVA 1D5CA 4NH0A 4BQPA 1WXIA 2B30A 2GA9A 3WK9A 2L42A 4REOA 1F8YA 4R9UC 2VXZA 1WB5A 2ZJ4A 3EUHA 5TQ2B 4WN9A 4QGSA 4CKCB 3J81A 4W5QA 1C1HA 1EP1B 1JLSA 1VHQA 2D7CA 1FBQA 3PO2J 1Q74A 3FKSA 2WD8A 2R84A 1ZZEA 3ORQA 2G6BA 3BA1A 4FUTA 4P38A 5LP6B 2BYTA 1QYIA 2JA8J 1YO6A 2C31A 3PPIA 4G85A 1KMHB 3T3IA 4YRLA 4XFJA 1RPTA 3H5IA 3D6TB 5K01A 3PEFA 1KSHA 1QP8A 3X1JA 3JZMA 3L0SA 3C8MA 3TSOA 2QKLB 2NN3C 1WQ2A 4I6JA 3OM9A 3AIMA 1SD5A 4K5QA 1KMCA 1ZR2A 4NPAA 2AZDA 1RABA 2Q2OA 2D13A 1CJBA 1HH4A 5CJPA 3K9CA 1XEWX 3QVUA 3LCJA 3G2MA 4QDKA 3B51X 3VYSB 1C0KA 4PFJA 4OMFG 3IJPA 4W99A 4G7OF 1KYQA 3HDHA 4I55F 1D0IA 1TJ4A 4L07A 3DM9B 2O50A 4FYJA 2FHSA 4LAFA 4XUGB 1MSFC 3HZJA 2FH5B 3I4NJ 2YQ4A 4L73A 1M2KA 1EFVA 5ALUA 1J8DA 2QLBA 5EWMB 3TQQA 2KLOA 2F1KA 3G02A 4LYEA 4YECA 3ZR4B 5JFGA 3PSAA 1KDRA 3IALA 1IN6A 4N0BA 2X14A 4JOCA 1CZHA 1L7PA 4N3BA 2LBFA 1J7KA 4R7GA 4GUAA 1RPNA 3LCVB 4MMYB 4N5DA 4Z4FA 3IFSA 1XPUA 4O3MA 4ZGGA 3CUEF 2F5FA 1L4NA 4YCDA 4OHBA 2B2NA 5JSUA 1XSDA 1VC2A 2H4JA 3BJZA 2IVZA 2RHTA 5MF6A 1V39A 3FCAA 3JYHA 3IS3A 2ELJA 4Z53A 3IP8A 3SJCA 5L7YA 2IOFA 2R86A 3UXYA 4BWYA 4Q18A 2J4CA 5CW2A 5EYRA 4I5GA 3GA0A 8ADHA 4QLOA 1UODA 2JGIA 1YGYA 3L40A 4KU4A 4C7VA 3I28A 2PJPA 1YI0A 1EFDN 4HKTA 4EUFA 2GN0A 2XZPA 3P0RA 5KZMB 4G8JA 1RMYA 4LYGA 5DHTA 3CVUA 1O7FA 4GMGA 3G9ZA 1EEHA 2FRXA 2F8MA 5IANA 1HR0B 2PFKA 3KQWA 4PPGA 4AJEA 2CQ7A 3ZJYA 4GPZA 3DLAA 1SO8A 1NQVA 2EFOA 4W1RA 3NOXA 4D02A 5B58C 1QP7A 1E4EA 4XOTA 2BD0A 2O2SA 5DK4A 2W85A 1W52X 1Z5OA 3DKKA 1G1MA 3U19A 5DS9A 1GGVA 3TUIC 4EB3A 2CFIA 2IA0A 1KARA 1NVWQ 3HJRA 4YJFA 1F7UA 1BFUA 3BJIC 4KK4A 3VZCA 3VSDA 2HK8A 1VQ4I 1ZZGA 2YV3A 1GV0A 2ZK7A 3H5AA 3WGHA 1RTKA 2CJWA 4M36A 3WBJA 3ZS9A 5K6AA 4EHIA 3EC2A 3GZ6A 1IO2A 1OPXA 2XNJA 4PE5B 4Z9FA 2F5VA 4LJYA 5K6TA 1G6Q1 1TWAJ 1VIDA 2B7EA 5FGMA 2GK3A 2QRGA 1VL6A 3HEAA 4A6DA 2EIMH 4AIHA 1O6GA 1USIA 3G17A 3FFBA 3H7AA 3QZUA 3FWHA 4IGAA 4NJEB 4XQCA 2R8YA 4R1LA 4ZO8A 5JLAA 5HOEA 2O8CB 2OGWA 5CYVA 3S14J 3ZDBA 3GJ5A 5CVVA 1QOZA 2WVJA 3G3EA 2AS0A 3DMTC 2YOGA 1DDIA 3QH4A 1TT7A 1UZNA 4O2BF 1BFKA 3R60A 2FN3A 1DS6A 3WHBA 2WY7Q 2CDNA 2YYSA 4QARA 4LOCA 1K5GA 5DF1A 5B7NA 2B20A 5I4KA 2Q1WA 1ONNA 1P0CA 4IEEA 5J6XA 5DCYA 3OLVA 3MJRA 4JP0A 3H1TA 4ZV7A 3GTOJ 3BGIA 3KT3A 2BFEA 1KI9A 3OYBA 4G0ZA 1IONA 4ND8B 4BNVA 4WFIA 3ESAA 3LCRA 3GEZA 5LGUA 4PCLA 5B4VA 3JQPA 1PL0A 1BGVA 1CUHA 4HH0A 3ZWMA 2ZYTX 3N87A 1MO5A 4D8VA 3UJ3X 1UBCA 4UUMA 3CJTB 5J2UB 3ZWVA 2LCFA 4F3QA 2H63A 2MDTA 3EDOA 2ONJA 3VZPA 1QQAA 4YFXF 2KQUA 2TECE 3F1LA 4DLXA 3D7NA 1W0JD 2EP5A 2OGTA 1MH3A 4ADSG 4CHUA 1SXJB 1UM8A 4DYQA 1KI6B 1R18A 2C59A 2I1QA 4QG3A 1G5PA 3P26A 2VSFA 3A4IA 3DW3X 4KIUA 4QTTB 4U3JB 1DQNA 3I83A 1SBCA 4XVCA 5CDFE 3WGNA 5K0GA 1LPPA 2QUZA 3D64A 1G21B 3QWFA 1W73A 1WKVA 4CMAA 5JCPA 2W7TA 4K6KA 5JECA 2C2MA 1LK0A 1E2DA 3HGTA 1DJLA 2G4VA 5F6FA 3GRCA 3KU1A 4IG4A 5AUQA 5F1KA 2NZJA 3T99A 1W5EA 2CNKA 4JLOA 2G40A 2AMFA 4ZQFA 2A9QA 5LEJA 3UT6A 3N8HA 3EPLA 3K0AB 1U3UA 3PL1A 2CDBA 4CIBA 2KMUA 5DHAA 3RASA 2JEYA 1PBTA 1MU0A 2HV9A 1L5VA 2VRCD 1C3VA 2OV4A 2GOYA 3ENQA 3Q6MA 5COQA 3WWPA 1AKQA 2RC5A 3GA7A 1ECBA 4GRAA 4PAOA 3U0BA 3V3KA 4KUHA 4KYVA 4MWGA 4XTCS 4P7KA 3GLIA 5J9FA 1R1VA 5JD5A 4PFSA 1BRMA 4M0MA 4CM9A 2C9CA 3NO4A 4UNIA 1CUWA 4BJ6C 3HCFA 3Q5GA 5JRJA 2L3DA 1CUEA 4J6EA 2K40A 4PWZA 3NHFA 2QYTA 3OYCA 3M8KA 2OFPA 2ZRPA 4YAGA 1L4HA 4U9UA 1QP0A 2X5OA 1U9IC 2J3IA 3QENA 2CMPA 1EG7A 3MN2A 3WYFA 3KVYA 4IIEA 1LDBA 3BAZA 3RVSA 3LP8A 3NV7A 2FEXA 5FWAA 4LLGF 4J4TA 3F5QA 3I52A 4I99C 1TYDE 2W7NA 4ETNA 4D7MA 3EISA 5HCNA 5B1IA 5IEBA 2ID8A 3RF6A 4HNSA 5EWJB 2B35A 2RI0A 2PMKA 2Z3WA 3IAM6 1M0WA 1SVMA 3Q9SA 1RUNA 3SDGA 1AUOA 1FBNA 1LBSA 1YZYA 2I4RA 2ZTMA 1O4WA 3QFSA 2PVSA 1SULA 2IYUA 3GWGA 4ZEOA 4OAQA 4CYMA 5C8VA 4O4JB 2QD3A 3D2CA 1T0BA 3E3LA 5EZGA 2CUZA 1K4MA 3KSMA 4I19A 3GJ8A 4JX4A 2TMDA 4BLQA 2YVQA 2JF0A 1RWMA 1QYXA 3SSNA 1YS4A 2GEBA 3PQ3A 4Q3BA 3MAJA 1OSNA 2NVBA 2XOKD 4JENA 5HIMA 3C3YA 3M34A 2Z09A 1HL3A 3Q4GA 2KQRA 1OFCX 5C8DA 1D0XA 3IQGX 3ZI4A 4POAA 1T1GA 1U8UA 1VE6A 4RGVA 4ME6A 1THGA 5ALXA 3RBAA 1Z9CA 4EV0A 1RU3A 4L9WA 4MPJA 4NFYA 4O8ZA 4Q7LA 3U17A 1KYXA 5EIBC 3RYFB 5FDFA 2VODA 4IIJA 4J6FA 4O02B 4I1YA 4K05A 1DI0A 1SRRA 4AJ1A 2BM8A 2VZEA 3CURA 3WBKA 3WY9A 4DGWB 3CMAI 1D09A 1TZBA 4JELA 4K6HA 4LRXA 5GGYA 1VPDA 1NF9A 1UJ2A 4CG3A 1OI7A 2CLLB 4CM6A 3NRBA 3RIHA 2QJTA 2HVSA 1U8YA 2LY2A 2V6JA 4G07A 3N97A 2CXOA 3M2PA 5AI5A 3NBAA 3WVNA 4UNRA 2DQSA 1V35A 4GKBA 5LDDC 3M5DA 1NZJA 3AHDA 1N5MA 1OT5A 1T24A 1RWNA 3PEWA 3JS5A 5FF9A 5GPBA 1H0HA 2GNPA 1ZLXA 2XGOA 4MTDA 3EE6A 4E7LA 5AVRA 4U2DA 2NG1A 2DWUA 3DBHA 3F8FA 1SBYA 1GGJA 4HDNA 2EKLA 2Z5LA 3WMRA 3QVWA 3O74A 1AKWA 4EKGA 3TXYA 5HZGA 1R4MB 1OYVA 1D7OA 1E7QA 1F60A 1XD2A 3E9ZA 1FWZA 2GSWA 3TW0A 3DZBA 3EVAA 3KZMA 2XXAA 4AKHA 4WA7A 5M5XJ 4UCQA 5IK2A 5JMOA 3AI2A 3DV0B 4JGBA 4WESA 4X8LA 3EQZA 3H3JA 1L8OA 3BMXA 3GBGA 3RC2A 4BLWA 4OI4A 3ZQQA 4DW6A 4MV3A 3FTFA 2C5SA 2L9RA 1NXXA 4JJ4A 4M89A 4QYXA 3EA0A 3ADKA 1GTSA 1VE5A 2JFYA 2P6UA 3N2LA 3RU9A 3PR2B 1ZM4A 3VOTA 5JQGA 1EE2A 2NZ8A 2PIAA 1Y89A 4LC9A 1QGZA 1XMAA 3NKLA 2IEAA 4YQFA 4W9NA 3AEUB 3KEFA 5JH7B 2G1JA 1QFMA 1JIIA 1B1BA 2WU4A 1QC5A 4KRYA 3CZ6A 1EH6A 3HB9A 1WMDA 3E70C 5DYNA 3V1KA 4PN7A 3I01M 2GZSA 3V8PA 1YVRA 2H8GA 4DA4A 2D7DA 3GELA 4KEAA 1TDJA 3L2CA 1UQRA 4BC0A 5G4LA 3JQBA 4LWOA 3E6CC 3DG9A 5KVSA 3RV4A 4Z0NA 4Y9DA 4EKDA 3GFIA 4I1UA 3C5CA 4YAOA 4JNCA 4BFLA 1R0LA 3THYB 4JI6B 2P2SA 3OIDA 1CNMA 2D1RA 4L7QA 4TWBA 3TW7A 3TQNA 2A1UA 3L8DA 5MFPA 1GLNA 3SQWA 1F0YA 4L5EA 1CZLA 5CB0A 2X3FA 4FFSA 1WPGA 1QFZA 4J1TA 4WXRA 3B9QA 4C0JA 1YFLA 1EK5A 1DDNA 1G5QA 4YJHA 4NZYA 4F3NA 3OEEA 4LDRA 2YYYA 1H2ZA 1OAOC 1I5RA 1XCMA 5CFOA 3BCUA 5HR5A 2Y1LA 2QE6A 1CY8A 3Q7EA 1FSFA 4N5MA 2A30A 4OATA 1RIFA 2H8WA 2Q46A 2YOFA 4X9XA 5B6PA 3ZS8A 5ICMA 3FHJA 1EXDA 3STUA 3CCBA 1E3TA 1LNSA 2QRLA 1F36A 1V9CA 1QGAA 3PKIA 3WGJA 2GUWA 1Z6GA 2OQIA 3FF5A 4G41A 4JT4A 1Y8AA 4RJLA 3BZ6A 2DTEA 4GG1A 1XZQA 3H7IA 3E7PA 4B3BA 1TEHA 2K9QA 1GN9A 2PUVA 1RHKA 3AIIA 3DOFA 4L5BA 3UGKA 4JX5A 1EFRA 4I7HA 3ER9A 3G73A 1BE8A 1LPMA 4GGGA 1LH0A 2WNHA 4TV9B 4WK4B 5K0LA 5TR9A 4RFLA 2CK3D 2CUEA 3Q0WA 2IS6A 5CKTA 4DVJA 1A82A 2RD2A 2XPCA 5C4GB 3TRFA 1Y7TA 2J9RA 3THWA 2VP3A 1ML3A 1U5TC 4N40A 5FXMA 4RQUA 2AFIE 3HCOA 1SFRA 2RGWA 3ZV5A 3O47A 3O1LA 4QDZA 4QTUB 1XSVA 3EG9A 4XSGA 3GMDA 1JX6A 5FCDA 1JBKA 3WGOA 1SC6A 3DZGA 1AN0A 3WRXC 2YXLA 5KTSA 2ZUFA 2HLNA 1EUCA 4IMPA 3AERA 3DDWA 3WX0A 3E9DA 3FDIA 5GZ1A 4PXAA 1VMEA 1I0LA 1OASA 4MKZA 1ZBQA 2WIKA 3ZGVA 5IAEA 3W3CA 4HV6A 4NLLA 4GMKA 5JWOA 1XWIA 3HR7A 3I59A 3T7SA 1VIAA 3RS0A 3IEUA 4I2OA 4D0NA 3K1ZA 2BP7A 3MTDA 5ULLA 2NTYC 3LXRA 1OYIA 1QV9A 2IUYA 1XC7A 3ACBA 4J91A 5F3RA 3HVKA 5A4KA 3PXDA 2XQJA 2W6JD 3CF4G 2XHZA 3CU5A 4EY4A 3BT9A 1NSTA 4FEYA 4HFMA 3O1IC 4OF4A 4RV5A 1CF7A 4Z9BA 4D99A 4YMHA 3O8QA 5KNDD 4P80A 1H1TA 4NV1A 2IEYA 2X6OA 4LF5B 1AK9A 1T6ZA 3C6YA 1CJMA 5IF9A 1XVIA 5JPCA 2EYUA 5EHZA 2AG8A 1SC1A 3A6LA 3OYIA 1V8BA 1L1EA 4OB6A 5AKJA 4JOQA 3GN1A 4JBHA 2RNJA 1ESCA 4D4IA 2NO4A 1USUA 1X42A 2WV0A 1WZNA 1FT9A 2PMBA 2NOJB 3ROKA 4BKRA 4BX3A 3OJ0A 4OMCA 4DQUA 3NEPX 3AWIA 3GUUA 5IWAB 4Z0TA 5TMDA 4E22A 4FLEA 3CNHA 1OBFO 1KY4A 3R8CA 3SLRA 4I50A 2AF4C 4GC5A 5D4RA 4WCFB 2VJYA 1Z8DA 5ALNA 1ZD3A 2IFTA 4FU0A 4K9SA 4MUXA 5BN5B 5EE1A 2W58A 5IWCA 2P6PA 4FFBB 2H1IA 2X9LA 2Z56A 4JLDA 5CMLA 1K0FA 3C3AA 4EGCB 4TLMB 2YV5A 1U6JA 5IDWA 1BJZA 1IXSB 1IHXA 2H08A 3EMBA 5CPBA 2MJLA 3VNRA 4A0SA 4EJUA 1SR8A 5EJCA 1MDBA 1RTTA 4G1FA 4IL5A 3AIKA 3GZ4A 5EQFA 4D43A 2WJWA 1JFTA 1HFEL 1TM1E 1YG2A 1YJAA 1K7AA 3TO9A 5M5YJ 1L8QA 5JNTA 1XP8A 3QLUA 1UG2A 4G63A 1OFHA 4QUAA 5DI3A 4DLWA 2DDBA 2E21A 2DULA 3LE8A 2V7VA 1GRRA 3CJRA 3NWEA 4TLLB 1NW4A 3AHCA 3OE7D 1EE1A 4OFZA 4ENVA 5AUNB 2HVQA 2YR0A 3F3MA 1G5HA 1HYEA 3EASA 4FZ3A 4LIUA 3AZQA 1ODKA 5CHYA 2EBWA 2C77A 1PUFB 4MHOA 1C0PA 1M0SA 1QIEA 4Z3DA 3ZE8A 2PKWA 5H82A 1R0ZA 1LFBA 2L7MP 3K4QA 4R1NA 5ARDA 1TQDA 1D03A 5AJXA 3WGQA 1RBQA 2A0UA 3ND5A 3TI7A 2TS1A 3MERA 2DZDA 3K70D 1GXSA 4HDAA 1BM9A 3D5SC 2HPHA 2ODPA 3T7KA 5HPYB 1MT3A 2C7VA 4B3AA 4BV3A 2H1LA 1WZIA 5KX5B 5EXDA 3R5KA 3M6MD 2F3TA 1FP4A 5DW3A 3MOGA 4L9SA 1ODFA 2DPUA 1F20A 3BVPA 3BMNA 3ZHZA 5KVCA 5L4LA 3DWFA 4CMBA 1N7HA 3KQSA 4ETWA 3GW8A 1QAOA 4M0EA 5EF6A 2CRGA 1XCOA 2Y71A 3DOJA 4V2UA 1ODIA 1XQWA 4S1WA 4ZT7A 3WGLA 2HA6A 1Y48E 5AK6A 2IRFG 3DWEX 4YUYA 3U39A 4MQ6A 2PWZA 3M1LA 5L7TA 3O8HA 4PG6A 5JYEA 3GQBB 1UJ8A 3TKAA 2WQ6A 3HGQA 5DUKA 1O0SA 3RD5A 4K81B 4RM3A 5J59A 3OO1A 2F6RA 4DJ5X 1V6AA 2VSYA 2V55B 1X3ZB 1BXRB 2RGEA 3THSA 2GVDC 2DDAA 4ABZA 3S8YA 4H3SA 4B3SB 2DOEA 1W5FA 1P5JA 2OUMA 3C3JA 3PUHA 4INJA 1SVKA 3ZHUA 1ENHA 4M88A 1TAHA 5B4UA 5IT0A 2PUBA 1LFUP 2C0QA 2DFFA 2QJRA 5F4ZA 4BH9A 3D6NB 4ZQEA 4M9QA 3WBFA 3L2RA 4ND1A 5IG2A 2RJNA 1EXVA 1LUAA 3NAGA 3P9ZA 1T9CA 2BGIA 2PK3A 2CJJA 2QN7A 3OZVA 4MLZA 1T1IA 4O2AA 4Q3KA 5EQJB 4BNXA 5LM3A 1D1BA 2NSDA 4Y4RA 1ZD5A 4FE3A 1XELA 3FMPB 3PU6A 3ZDQA 1ZM7A 2JPBA 2QUJA 3EXFB 4B4UA 1E3EA 5KNBH 1SC7A 4WBSA 3OQMA 1EQUA 1MQSA 2NU7A 4G7HF 3KQMA 3RTGA 4P5OA 3R4CA 1O6CA 2P2CA 3IIIA 3NANA 5GONF 3WZ2A 4U87A 2EAUA 4PYIA 5T4HA 5TV2A 3LOQA 2DO7A 1FTQA 4GX1A 1OX5A 2IY7A 2HJRA 1LLDA 2P2GA 4PGHA 1L3LA 3UHFA 3CWZA 2R5ZA 1I0IA 5C81A 5A6SA 5CM2Z 5AJYA 5BOSB 5EJAA 4KN4X 1KYYA 3DMPA 3I2IA 2F8TA 2BGLA 4CEIA 4WK6A 1W8DA 1P1CA 1C8VB 2F62A 1COZA 4V2GA 2J07A 4YASA 3C45A 2ILTA 1MNAA 2NTJA 4HXYA 5CVEA 4EIWA 4CDGA 1G3TA 2IYEA 9LDTA 4AN4A 3QU3A 3PGVA 3H2HA 5IJWA 4NFHA 4KLAA 5U4XA 3UUGA 1A76A 4YLEA 2FEZA 2RGRA 5F52A 2L9VA 1IIRA 3X43A 1A2KC 1NI5A 3A6EA 4FHFA 4LQCA 1NJ6A 4OQXA 1TCVA 3G7NA 1NUSA 1BWQA 4M1ZA 4NMXB 4ZEMA 2XUPA 2WJPA 5CFLA 3E1KA 2JCGA 1UINA 3E7XA 4OI0A 5FEUA 1OGJA 1WXDA 4Q7JB 5EMJA 5TVKA 2JFZA 3B7PA 1SZCA 4ZI7A 5DU2A 2L69A 2R97A 3MRTA 3KAKA 1SM4A 1KU2A 2R8ZA 1FK8A 4DR1B 1NW8A 3ULKA 1F9EA 5FOUA 4PYLA 2IYRA 3PTLA 2PXAA 4Q9NA 4XCXA 1FZPB 3T5CA 1OT3A 1K6OA 2XUKA 4NC8A 4BBRJ 3OC6A 4RW0A 1CUDA 2M8GX 1XXHB 2AI2A 2Z58A 2VZ8A 4E7HA 3PI6A 2O8EB 1Z3YA 2Y8EA 3ILYA 4ND8A 2HYJA 3HSEA 4UUBA 2CE2X 4LHYA 4NECA 3RVMA 3SLKA 5BR7A 3L3BA 3VYUB 1UHSA 3QVKA 1KE1A 2OZVA 4ON0A 2IJLA 1WPXA 3TR6A 4U7BA 3X2FA 2OHVA 2ECFA 5AXCA 4MRNA 4N76A 2C82A 4HQ0A 5JLJA 2UU9B 4EJFA 2J7PD 1QCCA 1DARA 3HBLA 5AOVA 3I0MA 2RGVA 3BB3A 3MZ8A 1CFJA 1ZH2A 5KQSA 1QGED 3PUKA 2IU6A 4BWGA 3OZGA 4C2AA 5IMSA 2QM8A 3BRWA 3D6MA 1GZUA 1JAHA 2OZLA 2V7XA 3MINA 1I3AA 3MKLA 3LUGA 3VNQA 5AM2A 2KWIA 3N0TA 3O2QB 3MAGA 1WUHS 2JNWA 2QRQA 1BXGA 2Q6KA 3EW7A 4JVSB 1T29A 4O4IF 4PRYA 4X1KA 4XAQA 3UWDA 3ZV4A 3TECE 2C2WA 1U2DA 2ZE7A 2JIZA 3BTVA 5EC8A 5LIPA 3O4VA 4F97A 2HJ9A 3AP1A 1UEIA 3OZIA 5F2EA 4JEMA 1DC7A 1UJBA 4MUKA 4TVBA 3VVCA 3ZY6A 4BNWA 3CKYA 1UPFA 1TRKA 3CP8A 1JJFA 4KDPA 1FX0A 4I9FA 2FY8A 4BO2A 1XPRA 1USSA 3V9PA 3GY0A 5IT9A 4L0DA 3TBFA 2ONZA 1C0EA 1KO1A 3R0IA 1U0TA 2AN5A 1ODDA 1J90A 1FB5A 3JASA 5I7VA 4BPBA 3S1AB 3D4BA 1BR1A 5B64A 2KPOA 4EQ6B 3UBTA 2HA4A 2P7CB 2M4KA 3CPHA 3GEHA 3ANMA 1CD5A 1KU0A 1ITYA 2CYYA 4LF4B 1ADJA 3AVYA 5H20A 4HQFA 4UUSB 3L8YA 1ZO8A 2BE7A 2QNRA 2NOGA 1GVJA 4KACA 4PUSA 2CCGA 4HT3B 3MEXA 4JV5B 3KP1A 2HBZA 3K6SB 3R3HA 4EOGA 3HUEA 4QGAA 3BHMA 4BL0B 1QG2A 4UZSA 5L6LB 3IAM2 2AEJA 4FONA 3VYWA 3LZDA 3HJFA 3WLNA 2XWQA 3BG6A 3WGIA 3MW8A 3A9UA 1LWOA 3OOPA 3I1YA 1YL7A 1NYLA 5FL7D 5AVSA 1BHQ1 3H9GA 1GQOA 1I2MA 3CCVI 1FDTA 3CBQA 4J2TA 3UYKA 3WGZA 4CV1A 1TE2A 4LI0A 1OLOA 2UV1A 4IZZA 5T3YA 4BP3A 3MYYA 4MVYA 4F7DA 3AIOA 4RJJA 1FNMA 1Y8QA 1FYXA 2A0WA 4HDKB 3GLTA 2D59A 1BW9A 2ZIGA 3HQ4O 3OZUA 3Q7TA 4ISCA 3UAYA 2N42A 4WKNA 1Z38A 5CA1A 4LPKA 4YQZA 4XOUA 1A7UA 1BXZA 4YJGA 4G5HA 5DLPA 4IRXA 4JVLA 5FKNA 1MB0A 4K40A 4LJAA 1RXVA 2DT5A 2WTEA 3EDYA 3FBGA 4AYTA 3LC1O 4MITA 5KEIA 3NBKA 2I78A 3TZ6A 2UXNA 2FKAA 2H2IA 4UTVA 1JGTA 4R6XA 3W5DA 1W7PA 2C7QA 2AIRA 1V25A 1FUIA 4RB3C 3OCJA 1OR8A 1DG1G 3O3KA 4HBGA 2PX9A 3SDBA 1GPAA 1ID1A 2G5CA 2HSWA 4HRXA 3SF0A 4X1EA 4BQRA 2VZLA 1Z7EA 5G4KA 1Z6PA 2F1OA 4WJZA 1UFRA 2DQZA 1A8SA 4QUIA 2UXDB 1RZVA 4H3HB 3L18A 1F12A 1VPTA 2G9QA 2X76A 1JR3D 2O8CA 3LCMA 1BX3A 3ASYA 4F6CA 4MV0A 1EWKA 3AVPA 1E1KA 3WKDA 2ZT8A 4A2WA 3M2TA 3TX6A 5CH5A 4QTRA 3DKYA 5BMVF 2OYCA 1NURA 1FS5A 2MSCB 3KOUA 4PCAA 3WYEA 4NZMA 1T3TA 1BDIA 4RB2C 2Q0QA 4FI3F 3ONVA 4ZK2A 2BXZA 3AG1H 1KNQA 2JVIA 2YNMD 4FFNA 4XX1A 3W1EA 3VU1A 3A14A 4B8ZA 4BFVA 2LDUA 1XD2B 1ZX1A 3STYA 2VFAA 2POQX 2P91A 4D3YA 2W25A 1J39A 2X23A 1C7JA 2EL7A 3O0DA 3HG9A 2O3SA 3QY0A 1T95A 2HZDA 4D9IA 1YB1A 1I0ZA 2L0XA 3CDLA 3DR3A 5FROA 1JWBB 4IWXA 1GPWB 4R0NA 4AJHA 4C3ZA 3WISA 5E3MA 5JHUA 3OKCA 4XM3A 4KDRA 3TIIA 3WC4A 4DDWA 4QU9A 2QU8A 5GADJ 4C03A 2JUGA 2LC2A 5B53A 1DWQA 5A4MS 1AQLA 2VCEA 1U8ZA 1N7JA 2PCLA 2JVKA 3ITKA 3PJFA 4N18A 2HLHA 4XUCA 5B37A 5HS4A 2ZDQA 5C1PA 3KQLA 3I62A 3O9ZA 1RW4A 2C94A 5DTIA 3I34X 2NV0A 3N5KA 1W0UA 5B1DA 4A3KJ 5I9TA 4I9UA 2KB0A 1OMIA 1B42A 5HWSA 1M33A 3OT1A 4BNNA 1XB4A 3FW1A 4YRIA 2ECOA 4OSOA 3SY8A 4H0CA 4BYGA 1P17A 5KK1A 4IRIA 3ZHRA 1X38A 3KZCA 2M5WA 3MWGA 1N8TA 2G80A 3B48A 2OZKA 3ZXYA 5CCEA 1DTWA 3K1AA 2X7HA 1F51E 3K8OE 5EE5B 4DG5A 3WL7A 1XZNA 1NUUA 5A7HA 3ZVMA 2JFBA 1FBTA 2ZRCA 4HEA1 3PC3A 4NAVA 1EP3B 3GC6A 3GLSA 5AIAA 5BYBA 5EZ5A 3IDOA 2R8RA 1T5TA 4IFTA 1H6DA 1D2CA 3OPYB 3LDHA 2HRZA 1Y3CE 1WDMA 4C6TB 2DLDA 4JQFA 2OV2A 3IKTA 1COWA 3VGJA 4AG5A 2GEFA 1DXYA 4NBRA 4DIBA 3KDSE 1F48A 1ZJYA 4D96A 2YL2A 3Q0TA 1PGQA 1X9HA 4OHYA 2W2KA 2RK4A 2BSXA 1AG9A 3SXUB 1CQIA 1UPAA 1EKEA 2XAGA 3WBBA 3DQPA 3PUXA 1AS3A 3FWZA 3HB5X 4HYQA 1SVSA 4QTXA 1OBOA 1YITI 1Q0LA 2SCUB 5C31A 3NU1A 2OYRA 3TUJC 1IAWA 1MMDA 4M0KA 4ER0A 1H66A 1MAAA 3PFNA 4MVJM 5GY7A 4EVSA 4KKVA 4HV4A 3OBBA 4K6MA 2ZBPA 2AI1A 3T15A 4ECEA 2NZWA 4E51A 1JBEA 1TZLA 2JANA 2QDXA 1JALA 3FM9A 4UBJA 1YYVA 1DBPA 3VR2A 4OIMA 5JLWA 3UXHA 1FVXA 1QRYA 5HUJA 3BLYA 4Y17A 3CN7A 2E5NA 4HX8A 1BKDR 2WJVA 2RAFA 3GJ0A 2ATCA 3PUJA 1DLJA 4EB0A 3EC1A 2HQAA 5KSOA 5BSHA 4QLBA 1A8UA 1O0CA 2BH2A 4XIYA 4S12A 1NJFA 4A10A 3ANYB 1B8VA 2HIMA 2ZU0C 2WJHA 2FLVA 2YY6A 4XI9A 4XYGA 3WJ7A 3GMIA 3H5NA 1AB5A 4C78A 4B43A 1TLTA 1AKVA 1R36A 2XPVA 4FISA 1R6BX 1WCXA 1BNCA 1ICIA 1ZEJA 2YY5A 3IUNA 3BFXA 4LXIA 1Z6YA 3WLSA 1TFUA 3M1AA 5LQJA 2WAAA 4AKSA 3ZK8A 3SWWA 2CXNA 4X62B 2IH4A 3ZBQA 2XQFA 5CNIA 2O06A 2VVTA 5FL3A 3IAUA 4G0OA 4ZEWA 3NDPA 1Q12A 4GR4A 3COSA 1YBHA 3LYLA 4MYUA 1E7RA 5FBWB 1LCIA 1TWCJ 3DCJA 3UICA 1WJDA 1NUAA 5FLEX 1MH1A 2I1WA 4MB0A 2B6HA 3QWLA 2TMYA 2AJTA 4WZAA 1DUSA 3M89A 2O2EA 2VKDA 1HGXA 2KI5A 5JSQA 3QQAA 2YKGA 2HIGA 4Y6LA 5FOWA 1TQPA 2FMHA 2IYFA 4E5VA 1B4DA 4Z7QB 1BMDA 2FGKA 4A2UA 4N39A 1UZCA 1XLUA 5U4QA 5JFTA 3J81k 2ZRBA 1OLSA 2RBEA 3G2PA 1GV2A 1GAEO 4WACA 3QMPA 4P1WA 1KVTA 4UAGA 5BWLA 2MINA 2OHJA 2YRXA 1J6UA 1EFTA 2AJDA 5D7NA 4X66B 4E6KG 3ZMDA 6LDHA 3REOA 2VJAA 3WGUA 2DFTA 3DAYA 3ZVKA 2W2QA 1XQ9A 1XMPA 4X0GA 3QF4B 1A9QA 3M4NA 4I8DA 4XQGA 3I2HA 2PMEA 1UWVA 3E3AA 1XMQB 3EARA 4I1PA 3VTKA 4JYPA 5AW5A 1KQGA 4BUJA 3ZN0A 1PJRA 3DFZA 1CZRA 2NYUA 4EKEA 1CS0B 2WG2A 3GGSA 3N6VA 3T4EA 4LB6B 1UDRA 4MQVA 3O9VA 1Z4MA 1VL2A 1XNHA 2GSDA 2DM6A 2CFTA 3DMRA 3ICPA 3KR2A 2E18A 3AI3A 1P0IA 2QD2A 4HWOA 1OW3B 2I3GA 2FI1A 4U2BA 3T1VA 1CR6A 4Y1RB 5D5UB 3CVOA 1A5AB 3FUWA 3KQOA 4FC7A 4P3XA 3UAWA 4MV1A 3PSIA 4Q5IA 4E5NA 4F04A 1VPWA 3KJNA 1UJCA 2N46A 2E82A 2EARA 1PR5A 2W9XA 4ZOLB 3PNMA 1K2WA 3JQEA 5DM2A 1X92A 4XRMA 2O2JA 2R5YB 1EZ4A 3L1IA 4Y3OA 4ENRA 1PR6A 4BE4A 1SHZA 4OKIA 4ARZB 5K0JA 5HF6A 3ER6A 5KX5A 3AG5A 3Q3HA 3ZDRA 1U7XA 4KBFA 1ZWLA 2FZ4A 1PQYA 3ONDA 4P53A 1ISJA 4PTZA 5H70A 2LP4Y 4WLUA 2O1WA 2EC5A 5BSRA 3ZLJA 4GPTA 1PDWA 4WNAB 2DHQA 5TS2A 1N2HA 1NHGA 1TQ2A 2AWOA 3E3MA 4KFUA 4AZSA 3AVTA 4PGMA 5IBQA 1WKBA 2PWBA 3AW8A 5HZMA 2WJGA 3V80A 2P1RA 1RKXA 2W2MA 2EZ8A 3RSZA 1VGRA 5GINE 1GU0A 3DHNA 3QPWA 1TD1A 3EPKA 1I13A 3V2HA 2W00A 4J1SA 3UK7A 1Z4NA 1JR4A 4RD1A 5EIHA 1U3CA 2HMWA 2X40A 3GCWA 3GMSA 3V00A 5IW8A 2UYGA 3SIWA 5JI3E 2EW1A 2Q3FA 4NBVA 1X4PA 5AW9A 3GPCA 4KQXA 1QZ3A 1P61B 1JPUA 4EMUA 2Z8ZA 1FNBA 5PGMA 2R3SA 2PZBA 1AVTA 3DMDA 4IGIA 1ZL2A 2AB0A 1R5JA 1MD0A 2AFHB 1IJWC 2BOVA 3A25A 4Q00A 1ESEA 4J94A 4A8JC 2LXNA 3CVJA 1E89A 3H86A 3BG3A 1NF2A 1D1PA 1WAMA 2BFBB 2DFNA 2Z43A 3I3SR 4ITUA 4JJAA 4OMUA 3WTVC 2AQIA 2C2OA 3OQHA 5FV7A 3UHAA 2P11A 1TVKA 1T3SA 5LQNA 4PYMA 1OH5A 4XYMA 1Y1PA 16PKA 1ZOOA 1BWPA 2OEPA 1PJTA 1Z35A 3MCVA 3VTAA 4B3DA 3A7EA 5AKEA 3FAZA 3AGQA 3L84A 1H2BA 3B2EA 2FR1A 2PYDA 1VMKA 1RE1A 3I1FA 3R24A 5DM4A 4AJJA 5CFNA 5KNLA 3FPJA 4E7ZA 1K6XA 4JHXA 4NCHA 5KKNB 2M34A 1R9NA 5FR1A 2W24A 3AR9A 3RRJA 2JHFA 3F74A 2WWYA 2AR7A 4JUAA 2ZSKA 1PYDA 2J1LA 1E2HA 3WFJA 2C8LA 2G3YA 1B16A 1JTEA 2Y1WA 1JAXA 5FAXA 4DSAA 1SBHA 5JSZA 3LLMA 3H2ZA 3N8IA 5TC4A 5LCXA 1M2JA 3KVOA 4MFEA 1WKCA 2QAIA 2VUIB 2GDJA 1WJ5A 2IF0A 4A3JJ 1DP3A 1L5NA 1G9SA 2GA8A 5IT9Z 3BH7A 3R44A 4LXYA 4GH5A 2G72A 4URYR 4GI2A 4RH1A 3VH2A 1HX7A 3GBVA 3L6UA 5GADl 2HPVA 1QPIA 1T5BA 4BGUA 4DIDA 2V0NA 2Z5UA 4IIHA 4EFDA 1PFUA 1I30A 3IIEA 3SC3A 1PJZA 3OSFA 4BJ5C 1QG4A 4DSOA 1QIGA 1OLUB 2ZFUA 4KXXA 2Q7OE 4RAGA 3VR4H 3ES9A 3QPAA 2CVHA 4TT8A 5MN5A 3A70A 3TLEA 1XX6A 4JI7B 1TO6A 1T10A 2QQFA 1AKNA 1J5XA 2D4AA 2K2QB 3R9WA 3K2ZA 1IHDA 4N5HX 4XLNF 1N7GA 2X0NA 2R7SA 2R4QA 1JG3A 4N0EA 3TQTA 3S44A 1ZNXA 4FMBB 5L95A 1E60A 5A4JA 1GGEA 3JQGB 1CUSA 5T5QA 4KH1A 4JA2A 2H0AA 3PYMA 4I1OA 4ZQBA 3HJCA 2CHUA 2EYQA 3RUEA 2OFFA 1B0UA 4DJTA 3GZTB 3FSGD 1V95A 4IQ4A 1WBJB 1YDEA 3EVGA 4FD2A 4TMYA 2FKNA 2EATA 2VCHA 5F7JA 1HE2A 2JJ7A 2ZR0A 4X8OA 4PLYA 4D46A 5E4TA 1Z13A 3ABUA 2VH5R 3ANXA 3H05A 3CMMA 1Y3IA 4GXQA 4J0GA 4LYHA 5ENVA 4Z0PA 2ZVQX 3RVOA 3S5UA 3UB2A 4F8JA 2NMVA 4OHOA 5EUMA 4FCYA 5M34A 3OY7A 3KP7A 3BPSA 5IAAA 1WCIB 1BXGB 4IEJA 2AFHE 2AHOA 2AI3A 4JR2A 4OUDA 4X1KB 5FFMA 3WOHA 1UBKS 1I2CA 2I87A 4JB8A 1IQRA 3ERCA 4KHPB 4EWLA 3ASOH 4O4LB 4B81A 1YTUA 5IT3A 3QYFA 2JJ2D 2O0JA 1ZU5A 2B6NA 2FQQA 2VH2A 2I6GA 5EP4A 4YUVA 1QNTA 3QLJA 1L1FA 1M1XB 1XTVA 3F5SA 5DNYB 2OCYC 2I5UA 2XBLA 5TMPA 4CETA 1CP3A 1VNDA 1R4ZA 3UUFA 3VR6A 2NO7A 5LVAA 3SSMA 3H9JA 4OWRB 3DH0A 4BKXA 3Q40A 4H7HA 4BVAA 5PNTA 5L3QA 2CB9A 3CEAA 1SBTA 3IV7A 1OA1A 2XITA 3TTSA 6REQB 5FRNA 1FTYA 1YR1A 3PXXA 1NP6A 1PCXA 2W93A 1B2LA 2OY0A 4A9AA 2ZE6A 4J3JA 3VOBA 3JX9A 4E1AA 3NUGA 4CA0A 1O9GA 1BQ4A 1CDDA 3I2JA 1DEOA 1HLFA 1WLSA 3PI7A 1G5IA 1QYDA 1F6DA 3PP8A 5BQOA 2WWFA 4BWVA 3ASNH 3VOEA 4PTLA 1YTYA 1X1CA 5JW6A 1PI3A 1MMGA 1AC5A 2XCTB 4IG9A 2ELKA 2QVGA 3HDGA 4Q5SF 5ERIA 3COZA 4MRMB 3UPDA 2FUCA 4JC8A 4ALKA 1SOWA 2GILA 5BYJA 2HKOA 5BWCA 3WKEA 4TXNA 1HDEA 2RGGA 4MA4A 4MR8B 1BDHA 3D6AA 3LHIA 1PJ8A 3HEMA 4FOPA 4XRRA 1UMQA 4AIDA 2J0EA 3BWGA 3I2KA 3GBSA 4RY0A 4ZJUA 3NAZA 4WXCA 5SZHB 1A98A 4QDXA 5HFNA 4KNYA 2IEKA 3QBDA 2X1DA 1N2GA 3FBIB 1P0MA 5ERXA 1R0SA 5BW5A 1D4FA 2IUSA 1MOZA 4RD2A 2CXQA 4BTLA 3VR1A 5I3CA 2V6CA 3PIRA 5HM6A 3ZV3A 5EIXA 1XMOB 3OCCA 2XUIA 1FJGB 1PD0A 3KC2A 3NRCA 1L4LA 1YRYE 2B61A 1NVFA 4Q9IA 4BLPA 2VYND 5LLTA 2Y0MA 2M4GA 4EMSA 2K3PA 3HFRA 1AQ6A 1UBJS 3FSEA 5L3GA 1XDBA 4GWKA 2R0QC 4UCFA 1W75A 2JS7A 1XGNA 4A3GJ 2HU9A 2RGBA 3FBWA 3ITDA 4MP6A 4PONA 1U0FA 4QQNA 4EGZA 1QLHA 1GRVA 4H77A 4F7ZA 3EHDA 4MTCA 1E1CB 1PS8A 2X42A 4MUJA 5C7OO 4LW8A 4URZR 1MDMB 1ISSA 2YYAA 2XUBA 1P2VA 3TZKA 1TT0A 2VPTA 4IXAA 1JEJA 1SIUA 1L9XA 1MEOA 3AG2H 3A1VA 4OHCA 4L3VA 4WH0A 2QOEA 2JHPA 5HILA 4BO9A 3HXLA 4D9JA 2C1EA 9ABPA 1ZUWA 2NNYA 4CLRA 3JD0A 1JLHA 1M7HA 4TGLA 2DK5A 3F0CA 1TA0A 3AG6A 3F9CA 3HTUA 1HZZC 1K7YA 3ZIAA 1ENYA 1Z68A 2GZDA 4PIMA 2HWVA 2GHIA 5FWXB 1CU1A 2R7OA 2ET6A 4WVFA 4UU0A 1D4OA 1SG6A 4LBYA 3HABA 2EFEB 2X1LA 3L06A 4GL4A 3F67A 3H1BA 2P7VB 4IKPA 1OC2A 2CNWA 4EA7A 1Y42X 4NK4A 5E7MA 3HVIA 4TMWA 1XYGA 4QUBA 4F4JA 4JI1B 3HKCA 1FX1A 2HS5A 4G6DA 1HF3A 1GUFA 4LJ9A 4HNUA 2O0LA 3E9CA 1FSSA 3EDCA 4KXWA 3V3TA 1PFYA 1JPJA 3E84A 2XDQA 4NS1A 4MKHA 3ZZ0A 1UANA 2I22A 3GR6A 5JMTA 1E8MA 3AC0A 2DC1A 3QLTA 3I61A 1HPLA 3ZU6A 2PBZA 4FB4A 3FZVA 3V9AA 4D0RA 4PNEA 1HSJA 3VA7A 2AQ8A 3LIIA 1EM8A 3IWZA 4OHKA 3QE0A 4BNYA 2HPMA 1CEQA 3OY9A 3GFBA 3N0RA 3JTHA 1MZVA 4OJNA 3UWSA 3DAPA 3MMYB 3WICA 3NWJA 4J0CA 2EW2A 5CR9A 3P2OA 3QV1A 1CUAA 3F1KA 4GF5A 2NZXA 4HX4A 1SVWA 1QVRA 2QV0A 1NR5A 1VPEA 2G77B 4FYPA 4IUCS 2E7WA 1L3CA 4XIGS 1P44A 2ECPA 3KAPA 3W2FA 2W42A 3WLOA 4GP7A 1G2PA 5CJ2A 3O83A 1WR8A 2NAPA 3P1JA 1V5FA 1ZJJA 2I29A 2P7HA 4GOKA 1U28C 3LL4A 2BGCA 3GFRA 3OQPA 4D9HA 4H1HA 1A1SA 4AYWA 3F8CA 1ONVA 3BXZA 1LFPA 2B83A 4QHSA 5LQSA 1OOEA 1KJWA 1PSDA 1I7DA 1S7EA 1P9QC 1Z2NX 1K1EA 3ZLUA 1Q7EA 3AVXA 2X6XA 5KVRA 1JNYA 3GTMJ 1MDFA 1VLJA 3C85A 4YROA 3TF5A 4IMIB 3TCXB 2BP7B 4RJTA 5K51A 4M83A 3UGTA 3H3UA 2RN7A 4KMMA 2QUKA 4RGRA 2PRIA 2QVOA 4JX6A 3VR0A 1FTZA 3W3AH 1GIAA 1R49A 3EWIA 4CJXA 2MYSA 1OLXA 5A4AA 2CH0A 3LQQA 4PO9A 1T8RA 3Q3GE 2QYOA 1NQXA 1Y3AA 5E4JA 1ZH4A 4DR2B 2VOOA 2OLEA 3ILSA 1YE3A 3P32A 3L8CA 4ZO6A 1Z63A 3H11B 3D3QA 1XGMA 3RVDA 1SVNA 3PFWO 3TZLA 1O7JA 2QRMA 4MUIA 3DF9A 2UZ1B 4GE0A 1WCIA 4I4CA 4FHCA 2IQIA 2FSPA 2PRJA 4C5BA 1A7KA 3B82A 4QUGA 1S2LA 5AW2A 5BWOA 1RAHA 1ZQ1A 2VONA 4URXR 1IBSA 4ES6A 2A69F 1S2DA 2IUFA 4Q93A 5CXXA 3QNUA 3S8MA 2PA3A 3WK6A 1SKQA 2EFWA 1EVZA 1U3GA 2D0DA 2PJDA 2ZRQA 4DLYA 3M6LA 1U1GA 2RMKA 2O8DA 5JXWA 3JY6A 5HJ5A 2UZ4A 3HXOA 2HUNA 1NG7A 1T2KA 4B5LA 1P6QA 3IKMB 4KWEA 4Z4EA 4RIGA 2ID4A 3GT4A 2PGIA 3W2HA 4XDYA 4GC9A 3HJGA 2XUAA 3DLCA 4GVLA 5DSXA 3K70C 2IYZA 3V4ZA 5F2KA 1KVSA 4B75A 4HMPA 3VX3A 2EFJA 3DF7A 5F9MA 2Q6TA 5FA6A 1SQ0A 4JLSA 3RS2A 1QK4A 2WT4A 3SYRA 2GBPA 4R2XA 2MC4A 3NBUA 4B4DA 4BFYA 3U9GA 1C3XA 3E7LA 2ESHA 1UKCA 2JIOA 4QOIA 3KKOA 2QN1A 3T7TA 4TWRA 5CA0A 2FW0A 4BQEA 3LY7A 5DHPA 5H3HA 5B1HA 4WGFA 4UTRA 2IAIA 4A2CA 1QC5B 4LDNA 2IZ6A 4XLCA 1J0RA 2R751 2ZYVX 3OP4A 3IBTA 4OLFA 2Q1ZB 3LOUA 5DN6A 3WLIA 1SQGA 4AKTA 4YACA 4C7MA 3K4KA 4RVFA 1VQOI 4P54A 1W9HA 1U5TB 2F4MB 2PGXA 4ZQIA 3J80A 1YLFA 2CL6X 2VN8A 2DPDA 4ENKA 4RNDB 3JTGA 4ESFA 4DV3B 2O5EA 1ZMBA 5F9FA 1BI1A 1C7IA 1Y8RA 3V4SA 2WM3A 5DKFA 5TIIA 4YGYA 3FH0A 3IUBA 5AJTA 1I2AA 4KYIB 2FGJA 3E6DA 2WHYA 1M0TA 3UANA 2PL9A 2QWWA 4F5WA 4D5GA 2UWMA 2WICA 3D8UA 3CF5F 1NR7A 1E8NA 3X1ZA 2FCAA 1FDWA 4GD3Q 4Y2GA 5E9JA 1J2XA 4QNNA 3D6HA 3ZPXA 1HNZB 5LOVF 2XHKA 1X94A 1WBBA 1G16A 1U0NA 2IPMA 4WXEA 4XRSG 4DLTA 2UVPB 2XKOA 3H9CA 5AVWA 1JDJA 1BZYA 2E5WA 2IPXA 4L7VA 3FMQA 2GAUA 1SMTA 3K2BA 5EZ6B 2O8FB 3PHBE 4ZPXA 3ZWPA 3HA7A 2I99A 1QZXA 4K1LA 4R68A 1BI0A 3GRRA 5LYJA 3EZLA 1MHTA 2HR1A 3M83A 3V7FA 1PJCA 2DMRA 1U2QA 5E8JA 3RC7A 1NVUQ 3FDJA 3VC1A 2FA9A 3H9QA 1UM9A 1VZ2A 3HWX1 3ZMUA 3OQNA 3PC2A 4FJ2A 1VMDA 2H7YA 4V39A 4ZKDA 4Y2TA 4CM8A 1N4DA 5B7QA 3ND8A 1CF9A 1SUDA 2O14A 2XADA 2VJPA 2ZYAA 2P2LA 1JDUA 3R5FA 1YQTA 2OAZA 3IAM1 4XJSA 4EFLA 3V8QA 5FYQA 3ZNOA 1PV4A 1ZC3A 5GAHJ 1G3UA 2P5UA 2QG4A 1PVDA 2EFPA 1SXJD 2ZJBA 5FBHA 4TYNA 4F85A 1PAUA 2HXSA 2Y05A 3HUGA 4G0MA 2UKDA 4HQOA 1AGRA 3QKWA 2SKCA 1UDAA 4BMZA 3COAC 4I0WB 1W94A 1J21A 5BV8A 2HEIA 5GGXA 4KQCA 1QR6A 2C2BA 3E0XA 3TI9A 1MBZA 1WCWA 4XICA 1AXEA 1V4VA 2X1MA 4FYYA 1YT5A 2QX7A 3ABZA 3C8UA 5D7BA 3E5NA 2BI4A 2Y9YA 3PFYA 3TM5A 1IZZA 5CIQA 2J48A 3TVDA 4KREA 2QM3A 3JRAA 1BE1A 2BFMA 5D1NA 3OPVA 2N3ZA 3A11A 3HBJA 4H4EA 2QIOA 1T3ZA 4KTVE 5FADA 5JS7A 4LNUA 2XF7A 3B20A 3O95A 1QP4A 1KPHA 4ZWNA 1W2WB 5H5JA 3I59B 4TM8A 1S4MA 2YIMA 4CCKA 2VJQA 1K5HA 4EA6A 2E0IA 3BDAA 4JXJA 4EA8A 4XW2A 4EM6A 1E58A 1G3MA 2VTVA 5AKGA 4CM4A 2VSQA 5K5OA 1ZBDA 3G3ZA 1Z16A 1ZMOA 1UZUA 2J67A 5IMBA 2RAPA 4M4SA 4RHCA 4LE1A 5CT6A 3N53A 4MW7A 1UBSB 3QNWA 4F55A 4AL4A 1YUBA 4BKMA 5JAPA 4GBMA 3S2ZA 3U31A 3I23A 1R66A 3T4PA 3CUOA 5F4BA 1U7WA 4BKOA 1JEQB 4CV3A 3W6OA 4H1UA 2HNKA 3AFNA 3I8OA 3JQFC 1CX9B 3MQ0A 4F9FA 1OUMA 1AQJA 1B1AA 5JXIA 3X1DA 4EL5A 3R0AA 3WRYC 2IDKA 2IK8A 2JFPA 2NIPA 2P79A 3IHTA 3TL4X 4BC1A 1L5OA 1PDNC 1O6FA 5C3EJ 4LK1F 3SVTA 1R58A 4GZ5A 5FBVB 3KSZO 1ZJWA 2Y4NA 2XDWA 3LUBA 1AZTA 2MH9A 1YE9A 2O7OA 5EMHA 2NSYA 2JN6A 1IMJA 1WXXA 4QGBA 3K0FB 3A3NA 4JI3B 2FG7C 2REBA 2V6MA 3FGNA 3PE3A 4ML3A 4OYYA 2CJPA 1F2UA 3BTSA 3MIZA 1UR5A 5IN4A 3K70B 3GFFA 1QU2A 1PVVA 3H8VA 3SNKA 3VV2A 5KOYA 5E3HA 3NEUA 3V7YA 2N1MA 4N49A 1QLJA 3H2IA 4P3YA 1OLXB 2XMQA 3DFFA 3IBYA 4NOKA 1KH1A 3C3PA 5IC5A 3H2KA 3H9BA 2ZRFA 1THMA 2ANCA 2WA2A 1U31A 1OTYA 1MJFA 1FSHA 3OJOA 4HYTA 4CKEA 2XMPA 5LMCA 4Z99A 1GPUA 2C7GA 2QW0X 4Q4JB 4R4JA 5FR2A 4V0ME 4EO9A 1NYRA 2Q0SA