4KIFA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with phenylpyruvic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
335
structure length
335
Chain Sequence
b'TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 121
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kifA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kifA02
4EGYA 3WU0A 2WV0A 1BHJA 4RTPA 2F8LA 3BWMA 2NNYA 5D5WB 1O3SA 3C0KA 2OA4A 1FP2A 4GOMD 2A6EF 5EHGA 3GFLA 5K0BA 1NV8A 5E1OA 2FK7A 3M33A 3GRUA 4AZVA 1RI7A 3LFKA 3BKXA 4BP1A 4P55A 3L9FA 1KYWA 4EGZA 2ZIEA 2VXZA 4HQMA 1FSEA 3C6KA 3BT7A 2YX4A 3OZRA 3FUWA 2P40A 5HIIA 5DLYA 4AZTA 4O29A 2FA5A 1BC8C 5CVDA 3BJAA 2E7XA 2VONA 4N0BA 3L8DA 3DR5A 2FMYA 4JK1X 2JPBA 3P9IA 3KQTA 2L02A 1FBUA 10MHA 5T6BA 2GAFA 3EPPA 3CUQA 1U5TC 1D5VA 2X4HA 5JR3A 2PQ8A 3M1EA 4M71A 4RB1A 1I1NA 4OMZA 1ZGAA 3S2WA 4MGRA 1XCJA 3BPVA 3TO7A 3HHGA 5D6FA 4FR0A 4PWYA 2UXNA 2HYGD 2PWYA 3KHKA 1O54A 5E8RA 2LD4A 1WKMA 4M7RA 5IT9K 4FSXA 5DM4A 3TKYA 3FXUA 3JTGA 3G8BA 2ACJA 2F5CA 1BIAA 2HWVA 4YUYA 3DPLC 4YFNF 3LWFA 3P2IA 2UYCA 1VIDA 1YW9A 2HS5A 1G8AA 4EQQA 4U88A 5EPEA 3SX0A 2XAJA 4R05A 1R58A 2HZTA 4DZRA 2IA2A 2E5WA 3GFIA 1VP3A 3HEMA 4IRGA 1OYWA 2PX8A 4HAMA 1N2XA 3M8FA 1LDDA 3FUUA 4P7JA 3GYHX 4HF0A 3PLAE 1O3RA 3QOXA 1PUEE 3WODF 4G7HF 4OA5A 3R0AA 4OIOF 2X0LA 5E20A 4YV0A 3KP6A 1NW5A 2JPCA 1SMYF 4O6JA 4GOLD 1SFEA 3SR4A 3KE2A 1SG9A 3V8VA 1T6SA 3OU2A 1MHTA 2XKOA 3SXYA 2CWWA 2RKHA 1TNTA 2OB2A 1QAOA 5CUQA 2P8TA 3V4GA 4A0YA 1WS6A 1U8RA 1L0OC 2JRTA 3MERA 4YG2F 4GOOD 5CVUA 1J75A 4GC9A 5E8GA 5H02A 4K2EA 2O8XA 3KPWA 4HW0A 4Y15A 3EMBA 3QP6A 4QWQA 1MDMA 1DUSA 3VC2A 3SMQA 3KR2A 2P6TA 4EJWA 2W85A 3ERED 4F84A 2QBYB 1P4WA 1JR4A 1BM9A 2H94A 3GZ6A 5EHIA 4RYLA 4UUVA 2EFQA 5CCBA 3WTSC 5D6EA 1W7PB 1HKQA 3NTVA 1YQAA 4CYDA 5E1WA 1QZYA 3REOA 2XYVA 1D2CA 2XVAA 2NXJA 5LSAA 4V0QA 5DX1A 5LRRA 4UV9A 4XUCA 4KRGA 5DSXA 3VC1A 5K1YA 3PFGA 2JHCA 4D0PA 4X63A 2RNJA 2FHPA 4L9TA 5GINE 4K6MA 2BEOA 4IWNA 4NHJA 1XMKA 3J80K 3FMQA 3THRA 2ZWVA 5C0OE 2FBHA 5FWAA 3TRKA 2ZSUA 4P7GA 3F4KA 1FP1D 2HTEA 3KZYA 4UVCA 3EGVA 3B3FA 4OBWA 3HUGA 2ZZMA 4ASNA 2G70A 3E8SA 1EH8A 1R22A 4TV7A 1W4MA 3BWCA 2H6BA 2D1VA 2G7UA 1UHWA 5EMLA 2VBYA 4CXMA 4L7VA 3TQNA 2OXTA 2DK8A 2QYOA 1TW2A 3IKVA 5JHUA 2IRFG 4OBXA 1WZNA 3SM3A 2Z5UA 3BZ6A 3HVKA 3M8EA 5FLXZ 4QPPA 4P9UA 4YUZA 5DPMA 1ZKDA 4G6QA 1Q0TA 3KPJA 1EH6A 4EQZA 4BHPA 3RODA 4C04A 2HKOA 1SQGA 1HXDA 3ISPA 1FJXA 2P8JA 4XSZF 2IFTA 1FYKA 1BJAA 1ZARA 3V7SA 2GZWA 1FLIA 2K02A 4HTFB 4ER6A 5CD1A 1S7AA 3OZSA 2PBIA 3R0JA 2AOTA 1Z3CA 4HGZA 2LDUA 2ZULA 3ZN1A 3F8NA 2NXNA 4HLYA 1Y0UA 1K6OA 3TDZC 3RKWA 3OFJA 3LCVB 3HCDA 5GM2A 2CL5A 3E5XA 3FPFA 2FMLA 2P7HA 1ZAOA 3OZTA 3PTAA 3UJAA 3BDDA 3MAGA 1WY7A 1XB4A 4GYGA 4MHTA 2PG4A 3KP3A 2AXLA 5GM1A 3TM4A 2R7DA 2ZKZA 5GIPE 1KGSA 1JSXA 3HCEA 3KLNA 3FTCA 1NW6A 1YG2A 5EZSA 1G6Q1 3AXSA 2KJBA 5HS9A 2AN5A 2ZCJA 1YTYA 1RJDA 3A7DA 1G3WA 4AZWA 1QQIA 4E70A 5IKMA 1FX7A 1R6AA 2ZZNA 3I59A 5LLQA 3DMGA 3Q5FA 3KU1A 4IHSA 1GHCA 4BQAA 2HGCA 4MEYF 2GA2A 2B25A 1JQDA 4L9NA 2FE3A 1S8NA 4BLWA 3SFZA 2YXDA 5D8KB 5HEKA 2PX2A 1EAMA 4OQDA 2OZVA 4C4AA 3ECOA 2WWYA 5LQJA 2P5LC 4GBED 2FU4A 3GF2A 4MQ4A 2QQAA 2NNNA 1GVJA 4QQKA 2ZJ2A 3G73A 5E1ZB 3PX2A 5K0JA 4RTMA 2IW5A 4IXAA 5ILVA 3KQOA 4LB5A 4U0WA 3AY0A 1YFJA 1FNNA 4JXJA 1SD7A 3FWEA 3GZ5A 1R36A 5FCDA 3EVFA 4L0YB 4ENJA 5HLHA 4LB6B 2OPBA 3PT9A 4FSDA 5B1SA 1J2XA 3UFBA 3UJBA 2Y75A 5L3BA 1U6GA 2VT2A 4OIPF 1NE2A 4GGGA 4ER5A 2DBBA 3TR6A 4DKJA 5L3FA 4KT5C 1U78A 2UXXA 4YUVA 4UVBA 3CDHA 1FZPB 4WK8F 1P92A 3E6DA 1REPC 3HCAA 1IZ1A 1S6LA 1MJBA 1WI9A 4MHGA 2EK5A 2CO5A 3C7JA 2L01A 5H20A 3LAPA 3L7WA 4HSGA 2OO3A 3F72A 1RI1A 4G94A 2ISZA 3LBYA 2I9KA 5EMKA 1LB2A 2A68F 5ERIA 3R6TA 3ULQB 3K1PA 3EGEA 1ON1A 1V3FA 4S04A 2Q8KA 3CO6C 2STWA 3HRSA 4C06A 4PDKA 2NP7A 4PYMA 3GW2A 4M6XA 1XJ5A 2W57A 5GIOE 3KKZA 2GA9A 3DXXA 1EH7A 3OU6A 2O0YA 3I64A 5DSTA 3KEOA 1S3JA 3GRRA 2K4BA 5DCMA 2C7PA 4BXUA 5FQOA 4EK9A 2ETHA 4IV0A 4G8XA 1LNWA 3HSRA 1TQIA 1YO5C 1ODDA 4IJAA 2UYHA 5EEGA 1AV6A 1BOOA 1MKMA 2ZO4A 1DPRA 5DCFA 3BKWA 3COAC 1KU2A 1IRFA 4ENNA 3HTSB 3THSA 4GYIA 3CUQB 4ER7A 3SVZA 4KUMA 3P71T 2VN2A 2AS5F 2O06A 1OYIA 2P7VB 5DM2A 1XGSA 5EIFA 2E1CA 3R3HA 3R24A 3I0TA 5DYMA 1ORHA 2EX4A 5BPDA 4X61A 4RTOA 2NRAC 5FLXK 4C07A 5KYGA 3EMDA 2FSWA 3DQVC 3R6SA 3PFHA 4EM0B 3KP4A 4RGUA 3BROA 5D5UB 3DLCA 1ZHFA 1BI1A 4ESFA 2QLZA 1RIOH 1F38A 3MCTA 5KQRA 1SKMA 2YR0A 4CHUA 9MHTA 4HV5A 4IV8A 1XD7A 3K1NA 1YZ3A 3G8AA 3TGNA 1LVAA 4N9IA 4MTLA 1Z7UA 1ULYA 3S68A 1X1BA 3SSMA 2LF8A 3V97A 1XCVA 1OMIA 2ZBRA 3WGHA 2ONYA 5JFRA 4YV1A 2JG3A 5E2AA 4CICA 3HCBA 2C7QA 5HS7A 4DNCA 2VP3A 2CMGA 3HYIA 1VL5A 3HVHA 2BGCA 2O05A 1ZN2A 2B0LA 5IT3A 4O3MA 1YYVA 3WTXC 2HDCA 3RW9A 5HS8A 2XVMA 2LNBA 3SSOA 2O07A 3KQWA 1TQMA 1IM8A 1RZ4A 1E2XA 2VE9A 2I7CA 3OOPA 2W84A 1H1DA 5E1BA 1G3SA 4ON0A 4UXNA 1LQ1A 3T7RA 4CO8A 3CUQC 3GWZA 1SUSA 2F5FA 2HQRA 2XIGA 3IRRA 1MDMB 2Z6UA 2YUIA 2YSRA 1V39A 1UWVA 4S05A 3JAMZ 5LQCA 2YX7A 4M36A 5AIPA 1VTNC 3P97A 3KR1A 2ZCWA 1QBJA 2P41A 5JVTA 3ZMZA 1M0EA 1NW3A 1RI3A 5DXJA 3NVMB 5FFXA 2GXBA 2Y1XA 1U5TB 4DCGA 4MTDA 1ZG1A 2A5YB 2IIPA 3DH0A 4RTJA 2Z6QA 5DTMA 4HOBA 2O61A 3TO6A 4MQ9F 3HRTA 4RTKA 5FO5A 2ZNZA 3W6KB 3GRZA 3EGIA 3IYLW 1KQ0A 5FWDA 4PZJA 4ENKA 3KCCA 3EQLF 1KQ8A 3HIFA 4F85A 4L5IA 1BBYA 1R7JA 1BN5A 2PLWA 1X1CA 5K8VA 3MWMA 3NRVA 4QQNA 2GA1A 4GC5A 2J5PA 3JW4A 2EV0A 4MNUA 3LBFA 2STTA 3V8JA 2F2EA 1H9TA 4AWXB 4CKBA 1I1SA 2M30A 5ILUA 3F21A 3NWBA 3HHHA 3LA7A 3GJYA 3MFKA 3T0YA 1FY7A 1Z91A 2UZ4A 5BQTA 3CCFA 1MJFA 1AF7A 5HDNA 4IPAA 5HZMA 3BWYA 3LA2A 3B73A 1USSA 3ML6A 4PGHA 3BGVA 5EOVA 2V79A 2FBIA 3B7PA 2PMHA 1W7PD 1IN6A 2EJUA 4KVZA 2VC0A 1QAMA 4R8HA 3DPTA 3VOEA 4KIGA 2G7HA 1MJ9A 8MHTA 3H92A 3HM2A 3SHFA 4ESJA 2EV6A 3MHTA 3I54A 1ZLJA 4HV6A 3WSTA 3HA5A 2HMYB 3PS9A 1SD6A 1ON2A 4X1OA 5HOOA 4CXFA 1CF7A 4KDPA 4LWOA 3DULA 5FGMA 4DMGA 2AZTA 5CYVA 5DD8A 3EETA 4P7FA 3C1DA 4YMHA 1CGPA 3LHDA 1IAWA 5G02A 4QDKA 4LMYA 1XTPA 2P7IA 2MA3A 3KP2A 2L3DA 4M9XA 3LCCA 3F3XA 1B9NA 4HX8A 2PKWA 4ISCA 1P1BA 2CYYA 3IWFA 4I7HA 3VB2A 5HILA 4R1HA 2EJRA 2P4WA 3PX3A 4WXCA 2DPUA 5EQJB 4M74A 1KYZA 3FPHA 4L5JA 3V8KA 1YLFA 3UBTA 1E17A 2ZW9A 5KS2A 1GXPA 2OD5A 3TOAA 5T67A 5LGUA 1PP7U 1RNLA 1RI4A 4F7ZA 3T8TA 1IXRC 4DCMA 4ZYEA 1I5ZA 1Q1HA 4PCAA 4XCXA 4LG1A 3FMRA 2FRHA 4KDRA 4KA4A 4GUAA 5J6XA 4M38A 1R1VA 3J81Z 4PYNA 2QUFA 4PGGA 4CZZA 1G55A 5FA5A 1IXSB 2VC1A 1HW1A 3KQYA 4HZFA 4IVNA 1P2FA 2ZMEA 3V7RA 3E23A 1JSZA 1QZZA 2QWWA 3WTZA 4EM1A 2DW4A 3TO9A 2P3LA 3JWJA 4KYWA 3GXOA 2XUBA 1U3EM 2ESHA 5DV5A 3OCJA 2IA1A 1JG1A 1D2HA 1J9IA 1WG8A 3M6XA 3FYCA 1AWCA 3K2ZA 2OZ6A 4XLPF 3U9GA 2PFBA 2PY6A 1SVUA 4FX0A 4RVHA 1Z05A 5ED4A 1D8KA 2O3FA 1FT9A 2HV9A 2ESNA 2PXCA 2BR3A 2O0LA 2VDVE 1JHFA 1FYLA 1PP8F 2OB1A 3A27A 1JG3A 2LF7A 2FYTA 4ZZLA 4LG0A 2RDPA 2A69F 1G3YA 1V4RA 4WXDA 1VQ1A 1IXCA 3JWGA 3CBGA 3SQNA 4KN7X 2A14A 2RV8A 1R18A 2QRVA 4B8XA 3JAMK 4E32A 3LX6A 2EFPA 3C3WA 5BPIA 3UJ6A 2ZVJA 1P6RA 4ESBA 4ZTBA 3BGDA 3VODA 3AAFA 4PYIA 3B89A 3KPUA 2FK8A 3PB3A 2QQBA 1S29A 4EKGA 4OA8A 1HKSA 4YFKF 3MQ2A 4PYJA 1G60A 3ELUA 5BS6A 2AOUA 1MD0A 1KU7A 3FPEA 4WCGA 3GLXA 1RJEA 2OY0A 3PQJA 4HDVA 1IW7F 2FPOA 2PX5A 3ZMDA 4FT2A 1AOYA 2GQQA 4AIHA 2V1UA 2G1PA 5L3EA 4R6XA 3U2RA 3HA7A 5FHRA 3E6MA 4P9FA 3FTFA 1KHHA 3E7PA 4PCQA 2DI3A 3P8ZA 4HDUA 5EG5A 1UHMA 5DT2A 5DCMB 4UNOA 3GFJA 1YF3A 4H0NA 5DM1A 5AONA 5KVAA 5DX8A 3LDUA 4LGWA 4HF1A 3ELDA 3ELKA 3RI4A 2PLYA 4E33A 1PDNC 5MHTA 3DXYA 3GDHA 4WF2A 5D1NA 1LJ9A 5FADA 2PI0A 3M4XA 2EA2A 3EVBA 3QRFF 2CWEA 1U2WA 4MTEA 3LGAA 4HX7A 3NW9A 5EVJA 4RX1A 3GGDA 3RTRA 3M7GA 2DU9A 4PYLA 1SD5A 3WGGA 4YMGA 1B6AA 3HNRA 3KEQA 1P91A 4GEKA 1TNSA 1USTA 2BE5F 2YPRA 2V9VA 4Y30A 3E5QA 3EVCA 3HVIA 4OX9Y 2ERCA 3KR9A 1D2GA 3ELYA 2CKDA 5LQKA 1F1ZA 5CCXA 2GIVA 4LLLA 3UWPA 4QPNA 3C3PA 1OR7A 5LHGA 5LQNA 1ZRCA 3RJPA 1O57A 1EQAA 3TKAA 3DMFA 3M70A 4RVDA 2EFOA 4MIKA 2IH2A 4M9SA 4P5OA 4HG2A 5D1HA 1R00A 3CO7C 2DQRA 1J5YA 1B59A 2OAZA 5FFZA 2A61A 1NBHA 4X60A 1ORIA 4HC4A 3DXZA 1B42A 1QAQA 4BHBA 3FZVA 3MQ0A 4RTRA 3DKWA 1G6NA 2D45A 2BBYA 2XV4S 3GX4X 3QOWA 2NS0A 3D5LA 2MC3A 3MCZA 3NMUF 4XRFA 3O4FA 4XSXF 1X1AA 2Y1WA 1JG2A 1S7OA 2Y48A 2K4MA 1R1TA 2CGPA 2VDUE 3KQVA 4OOIA 1F3LA 5LRSA 3L09A 5ICFA 2HQNA 5CVIA 3CGGA 2IBTA 3FHZA 3ER9A 3BJ6A 4HBLA 3LKDA 1RUNA 2BZGA 1NHAA 2IDKA 2IVMA 3HCCA 3TFWA 3IHUA 2L4AA 5E1XA 2ADUA 3GUDA 5LQUA 2B2CA 4OMYA 4BLVA 3EVDA 1XGNA 4BAYA 3H3ZA 5HDKA 1XMAA 3LSTA 1G38A 2P5KA 2K27A 3RYPA 5K5RA 3J81K 2JT1A 1PJZA 3EUHA 1FOKA 3KR0A 5TJJA 4PYQA 4E2WA 3TMAA 4IHTA 2DT5A 5KK1A 2B9EA 1UFMA 2V1DA 1G8SA 3GEZA 2FQ3A 5K0CA 4M73A 2EB7A 2YU3A 2XASA 3WE2A 3Q87B 1TLHB 2IH5A 1U2ZA 4Q4ZF 3JSPA 1B1BA 3K1MA 4EJTA 4RSRA 1DCTA 2YXLA 5E8JA 4V0RA 1BKYA 2JZYA 3O3KA 5HIMA 1J59A 3DV8A 4G9YA 3ERCA 1FBQA 3T8RA 4GO1A 1J0RA 3RIEA 2P3QA 4E2ZA 4DM3A 4A5MA 2H00A 4P7KA 1B4AA 3O6BB 2VOPA 4I02A 3EYIA 1GXQA 4BY9E 1I4WA 3B3JA 4E2XA 4O5VA 1SD4A 1YZHA 1JQEA 3CJRA 4CTKA 3G89A 4L9JA 4M37A 3HRUA 2M1BA 3LECA 4Q48A 3GIWA 1L9KA 2CSOA 3NJRA 5LR6A 4AUKA 1KXZA 2IP2A 5P8WA 1KR5A 2GWRA 3JWHA 3UJ7A 2DPMA 1MJAA 3P2EA 4QDJA 2XKPA 2JSCA 2XHKA 3EVEA 3E5UA 3FRHA 3ZMUA 5LGNA 2AVDA 1HW2A 3UZUA 3UJCA 2P3OA 3FZGA 2IPQX 4F86A 2FNPA 4DF3A 3EEOA 5LHIA 1ZREA 3RKXA 2R3SA 2L54A 2RQPA 3QOPA 3K69A 2JH8A 4YUWA 4EVIA 2O57A 1STZA 4OQEA 2AR0A 5E1DA 4L0ZB 5JUWA 2HTSA 3RIRA 1CF7B 4PYOA 3JSOA 1KU9A 4A5NA 1BC5A 5EEHA 1W5SA 1OYYA 2ZBPA 2EWNA 2ESRA 2DPDA 2AOXA 3OFKA 4LFUA 3GRVA 2GLUA 5D4RA 3KLOA 2ZIGA 2IJLA 4XBFA 1J7KA 2PEXA 1N7IA 1DDNA 3CJNA 4HA8A 2NYUA 2UYOA 2QE6A 3C6MA 4HLXA 2Y0MA 1BC7C 4IRIA 1JGSA 5FD5A 1O3TA 5K09A 1IN4A 4PONA 3ABUA 4PNEA 3ORHA 5GOZA 5HFJA 5M5BA 4M72A 2QY6A 1UIRA 4M9ZA 3ZP5A 3QU3A 3AJDA 1IY9A 6PAXA 5EKUA 4E30A 3TM5A 3ELWA 2Z3YA 3F22A 3MTEA 1SQFA 2V1XA 2PJPA 4U7DA 3ZQ7A 1A04A 3KFWX 5D4SA 1I9GA 5K0NA 5CM2Z 4DQ0A 2C6YA 2OQRA 4PIMA 1K79A 4HQEA 4A2UA 2C7OA 1ZG3A 3Q7EA 3FX3A 4PYKA 3R9XB 1VP9A 3HSEA 4RTLA 5K5OA 3IC7A 5FB2A 2F5EA 3UA3A 2L4MA 2LKPA 1NW8A 1R5HA 3WTUC 4EM2A 4ZYDA 3RPQA 2ZMEB 4HTFA 4A12A 1AQJA 4Y13A 4WWCA 2OKCA 3WU1B 4Y2HA 4RTSA 4M6YA 4FT4A 2BH2A 2ZBKA 4GCVA 2LSOA 3ME5A 2I6GA 5E18F 2EV5A 1WXXA 1B9MA 3R61A 5ICGA 2UYQA 4OIRF 2VT3A 4RS8A 3WG9A 3PFIA 1KP9A 4XLNF 3CVOA 2ISYA 1ZG5A 1ZRDA 1IN7A 2JH9A 5EC8A 2FRXA 2XYQA 4RWZA 2AS0A 2VDWA 3HTXA 3DP7A 2Z99A 2A07F 4HYEA 3HP7A 2YXEA 2XAFA 4RB0A 1R5GA 4QTTB 2JTVA 2IH4A 3L2CA 2QRVB 3VFZA 2W25A 5DXAA 3E6BA 3QP5A 1BI2A 4KNYA 4HF2A 1DUXC 3RDIA 4EMSA 2G71A 3HVJA 4FX4A 3O31A 3OE4A 1ZLKA 1ZQ9A 3QPHA 3ZMTA 2XGXA 1KPGA 2KKOA 1IN5A 3DFGA 5HIJA 2CG4A 5ERGB 3GU3A 4GOND 1NV9A 3SXJA 1G4DA 3G5TA 5EKXA 2VE8A 3KP7A 3LPMA 4NECA 5E9JA 1MZBA 4RAZA 5IH3A 3KQPA 1FYMA 1T43A 3LAJA 5EMMA 2BV6A 4GQBA 2AOWA 2MH9A 1ZH5A 2KIFA 4KIFA 4ER3A 1EV7A 2EFWA 1FC3A 3R60A 3LKZA 4KW7A 4AIKA 2OYRA 3UA4A 2P6SA 2BM8A 5DUIA 2AN4A 3O2PE 1YUBA 5LBQA 3JTHA 3ROUA 2PN6A 3K9TA 2GAUA 3SZPA 1Z6TA 2DLLA 2GB4A 4E2YA 1SAXA 3M6VA 1SFXA 1RI2A 1BI3A 5BW5A 3CC8A 5ICEA 3EVZA 2HR1A 5FUBA 1X1DA 1KU3A 1VE3A 3FXRA 5C1IA 4A0XA 1YFHA 2YTZA 5D5VB 1QNTA 2YX1A 3EVGA 1XVAA 4R8SA 4JBAA 5EGSA 1R8YA 2CQKA 2GPYA 1HBXG 4AZSA 2DQLA 2COMA 5GWXA 5DUKA 5JI6A 2CFXA 2PVCA 5E1MA 3LCUA 2JJQA 4RVGA 4KMUX 3RKYA 1EIZA 4GXOA 2P35A 4FT8A 3A26A 3TDUC 3V8LA 5E9QA 1I1GA 3FM3A 2VBWA 3PVCA 1QO0D 3LDFA 2WA1A 4H0EA 3IHTA 5CVJA 5E2BA 2EFJA 1ZGJA 2ORED 2K7LA 4FZVA 3RYRA 2BR5A 3WTVC 5D8LB 3LL7A 3F8CA 2AOTB 4BYYA 1ZYRF 2HKXA 1IRGA 2H11A 2M45A 5LHHA 1K78A 3KP5A 1WRJA 2ZBQA 5K0EA 5E17F 3SZTA 3TOSA 5DRTA 5EIWA 3MB5A 2VOOA 3DUWA 2O6GE 5HOQA 2GH1A 3V7CA 3ER8A 2G8NA 3K0BA 4QLCU 5DTQA 2Q2EA 1L3BA 3FTEA 5BOXA 2ZWAA 5F2OA 4U0VA 3O7WA 3GO5A 4EJUA 2HWKA 3HRMA 1YS7A 2G72A 1TPYA 4YUXA 2I62A 4JQFA 2K86A 3T5XA 4NB5A 2K4JA 3G3ZA 2XAQA 3DOUA 4GF5A 3I59B 4FP9A 5F2NA 4AD9A 2PGXA 4LLGF 3KQMA 1KPHA 2WA2A 2WTEA 3FMSA 5CVEA 5CIYA 4KWCA 1NW7A 3BOQA 2HYFA 1M6EX 2NAZA 2NP6A 1O7LA 4I0BA 3KZZA 3P9NA 1NBIA 2V6CA 5FD6A 5KVRA 1QYRA 4HGYA 4CDGA 2C7RA 1H9GA 3P9KA 1F4KA 3U1DA 4WX9A 2XAHA 3MZHA 4LJZF 3LDGA 4RVFA 2EA4A 5HVQC 3FM5A 3D2LA 2PSSA 3QU6A 5LEJA 1NKVA 4ER0A 2EG5A 3TPZA 4C05A 2A3SA 3K6RA 5FQNA 5CVVA 4RB3C 1XXLA 1IF1A 1RJGA 4X41A 2B3TA 4N9HA 4EJVA 2DK5A 4RGXA 2GS9A 2DFIA 3BXOA 3HA3A 1OR8A 2ZZKA 2P5VA 3NEUA 3M6UA 2CW0F 4P58A 4B09A 2AOVA 1TBXA 1YFLA 5C9ZA 1HQCA 1JQ3A 3DTNA 4CKCA 2IGTA 5F1RA 2J5OA 4CKEA 4BH9A 2N47A 3FRIA 5EZQA 3OU7A 4QVGA 3G88A 1O9HA 1IXKA 2OBPA 5T64A 1YS6A 2RVCA 3T7SA 2NNWB 4UV8A 2IPXA 5LQAA 3I71A 4BNCA 2HNKA 1WWXA 4YIFA 3N4MA 3B5IA 3C3YA 1L3LA 4UOEA 3NQOA 4G6DA 3HOSA 1Y8CA 4WXHA 4MEXF 4R6WA 2HEOA 4RTNA 2IA0A 1U5TA 3FXQA 2GXGA 5U4XA 2OQGA 1IN8A 5BW4A 3LQQA 4QVKA 5DDGA 4UHTA 1KA8A 1EJ6A 4HRAA 3BGIA 2PMUA 3FUTA 2ELHA 1SFUA 3L00A 4L9VA 2Q41A 2ZTHA 1BIBA 4EJOA 1HNNA 2WC2A 5K0FA 2PT9A 4OINF 3HCFA 4LECA 3TOBA 2DO7A 4ZYGA 2MLGA 1XGOA 3NDIA 5DM0A 3F6VA 1XSXA 2F5DA 3D0SA 4EKIA 1FSHA 5HDGA 2DAOA 1T38A 2ONZA 3WTWC 3BPXA 5CJ9A 3I53A 3KQQA 2Z9OA 5FHQA 2ZIFA 3VSEA 3B02A 3FYDA 2ZXJA 2XAGA 2PBFA 3ECHA 1HW5A 3C18A 1XDZA 1FBSA 3DLIA 5L3CA 2RN7A 2XBMA 2OBFA 2VZ9A 3VEPA 4CGZA 4IF4A 1JXSA 2NXCA 3G2PA 2QQ9A 2HOEA 1R23A 4I0AA 2VBZA 1FWZA 3P7NA 2TDXA 3E3VA 3QAHA 3BUSA 4IKPA 1XDSA 5F64A 2XYRA 2IT0A 4RGRA 3FPJA 3ID6C 1TW3A 4LK1F 5DTRA 4RTQA 3PQKA 3CKKA 4C08A 1EG2A 1IUYA 3ZPLA 3DMHA 2ADMA 2RGVA 4G7OF 1VLMA 2CMHA 2H6CA 5ILSA 2EFNA 4I98B 2DTRA 5TRDA 2IDJA 4AX8A 2AN3A 3I4PA 3ZMSA 4Z2YA 1SUIA 1R74A 3KPYA 3IWZA 3ZN0A 2KW5A 5DEQA 4FS8A 2KIMA 1JG4A 1O9GA 2KRFA 5FA8A 1UCRA 3SGLA 1N7JA 5K01A 3IRQA 1QPMA 3UJ8A 3F8MA 2FEZA 5H6QA 2HR3A 1UB9A 3AWIA 4QTUB 1SMTA 5FTWA 4CWAA 3F23A 4G56A 5DRYA 3T7TA 2FCAA 3WTYC 2Z6AA 5HLGA 2PXAA 3NWEA 3A7EA 1DP7P 5E8IA 1JHHA 4KN4X 4KFCA 2ZLBA 4Q47A 2G9WA 4KIBA 4P96A 1BOAA 2PV0A 2HTJA 2QENA 1F5TA 5AIQA 5K0GA 3J7AO 3JWIA 3FF5A 4FGZA 1T2KA 3A4TA 4MQVA 3EYYA 3Q9VA 4ZH4F 2Q0OA 4XUEA 3NVKI 5A2QZ 3FPGA 2M87A 4RGSA 4DQ2A 4IRHA 1WQ2A 3EEYA 4OIQF 2M8EA 2V7EA 1K7AA 4YIIA 3E05A 2A6HF 4PIPA 1FBNA 2M5WA 3GVAA 4A0ZA 4U7PB 4OU0A 4XUDA 1LDJA 1H0MA 1P4XA 3BY6A 4E31A 3TQSA 1HSJA 3EDPA 3KETA 3DF8A 1DL5A 3KQSA 4BP3A 5FULA 1JTEA 3H3UA 3T1BA 3U81A 1VPTA 3FTDA 4MWZA 4A6DA 1HSTA 2QM3A 3NDJA 3DXJF 1T39A 5LGTA 1T0FA 2FOKA 1PRYA 4R8RA 1ZRFA 5K03A 2QBYA 2KJCA 4ENMA 3BP8A 1C0WA 2PT6A 4EV0A 1EJ0A 4ZZDA 3QPTA 1QANA 1D3YA 3IKTA 2IBSA 1W7PA 3BZBA 4NQWA 1VBFA 2VS1A 2H09A 1X19A 1YW7A 4G7ZF 5K0LA 1M6YA 3R0QA 3WGIA 2PX4A 1P4AA 2O03A 5DD4A 3VYWA 4A6EA 2PWPA 5CLSA 5K5QA 4C03A 3GCZA 7MHTA 5KQSA 2BYVE 4I01A 3H2BA 2B78A 2D2WA 2ZNYA 5EMJA 2JHPA 2ZFUA 1O7FA 1R1UA 4RB2C 1DPUA 3N97A 1XSDA 1KPIA 4RAYA 2MD5A 1Z9CA 1K78B 2BM9A 4Y17A 3HSFA 1TTYA 1KQ9A 3MEXA 3ZMVA 3EVAA 4B17A 4U0YA 3E6CC 2OU2A 5HLIA 3G2QA 3I9FA 3DEUA 2H27A 4RV9A 4HX4A 2E1NA 4WVLA 2OZUA 3F8BA 1T98A 3ANXA 4KMFA 1X3UA 2PXXA 3P2KA 2QZ8A 1TQPA 3AXTA 3IL2A 5IT9Z 3WE3A 2D1HA 1F9NA 5J8FA 3B3GA 4Q5SF 3M6WA 3F6OA 5F6FA 5BMZA 2RC4A 2UWMA 1WXWA 5J8CA 4LWPA 2MH2A 1JE8A 1KIAA 3Q9SA 1NT2A 2XROA 1MGTA 3F8FA 4HH4A 4I2OA 2E7WA 5F2KA 3MGGA 5LEKA 1QGPA 5D5XB 3MZYA 4FHTA 1RUOA 3FUVA 1OPCA 2VODA 4CTJA 2YVLA 4ATNA 2HFHA 1I27A 1W5TA 4BHCA 4UVAA 1XDUA 2FF4A 5ICCA 2WK1A 2R7FA 2KIUA 3G2OA 3UJDA 4AIJA 5L3DA 3OPNA 3GRYA 3TLJA 2XVCA 3CUOA 5K05A 4ZYHA 3G5LA 4POOA 4I09A 3LA3A 3P9CA 4YV2A 2UZKA 1Q0SA 3G7UA 3I58A 3BWBA 1ONVA 5LQRA 3FUXA 4PINA 4LG0B 3HTUA 1XGMA 3GNLA 4BLUA 2BR4A 3I5UA 2EJTA 5HIKA 1FPQA 3W6JB 4U7TB 1XN7A 3GFMA 3CLOA 1BI0A 1RJFA 3CTAA 3CJQA 5H6RA 1HKTA 2MBFA 4LK0F 3HOTA 3QV2A 1G3TA 2PJDA 4KDCA 1L3CA 2R6ZA 1RI5A 1L3IA 3OV8A 3E97A 4U7BA 1YB2A 2MLKA 3R4KA 5GP1A 5DWQA 2NXEA 1Z6RA 2Z33A 1R8XA 1WSUA 3SSNA 1P1CA 3G2MA 5DX0A 2AOUB 2YQZA 3BJOA 2JHAA 2W24A 3KPVA 4AVPA 1L1EA 1OKRA 2P7CB 2XRNA 3A25A 2H1RA 1INLA 3MTIA 1YIOA 4YFXF 5BXYA 4R79A 4KICA 1LEBA 5A2QK 4L18B 3T0IA 3IEIA 2DULA 3GO4A 4PCLA 2NYXA 3IV6A 3WTTC 5BP7A 4DA4A 1JTFA 3X0DA 3MAJA 2FXAA 5E9WA 3ABTA 3K0LA 2FNAA 3OE5A 2P1DA 1LDKB 1LEAA 4ETSA 3J80Z 2VBXA 1O3QA 5CVRA 1AQIA 2AVNA 3CJTA 2ZFWA 1HMYA 1XSVA 2QVOA 1UFKA 3BWGA 4LD5A 1YW8A 1Z1DA 1XCLA 3LQRA 1D8JA 1I6XA 2FBKA 4LLNA 2V74B 3UJ9A 2YR2A 1P39A 3M9AA 3RPUA 5L3GA 1XCBA
chains in the Genus database with same CATH superfamily
4XD7A 1JQBA 2QK4A 4FOSA 4E3WA 2V6BA 3C0KA 2G6BA 4H4EA 3G8DA 4TS1A 1NV8A 3D2BA 1M6HA 4Q7MB 2ARKA 2LP0A 2A9KA 5DCUA 4HQMA 3H9BA 4G8CA 1Y3AA 4DIQA 1EWRA 2CL6X 3C1OA 1NF8A 4XX0A 5SYMA 3DQZA 1T36B 1Y1TA 2WMDA 4HWGA 1QDUA 4G2NA 1D5VA 1X39A 1MQAA 3IGFA 2DQSA 2VUMJ 5LP6C 2QLBA 3L7BA 4Z4QA 1O54A 3CLVA 3PXGA 2L5QA 5I9LA 3D7RA 1NMZA 4W5RA 1JDZA 3TAHA 3G8BA 1ELOA 3RROA 1BIAA 2QVXX 2HWVA 3VHXB 2A1IA 2XH8A 3E53A 4IDAA 4D9JA 3IAFA 1IUNA 3RIMA 3R2JA 4BWGA 1PBTA 4GR5A 3V1MA 3VNQA 3GFIA 4EI7A 1OWOA 4TL6A 4HAMA 1N57A 2YHBA 2GARA 2ZI7A 5A2GA 5FUQA 4KZKA 1TNTA 1XKLA 1U8RA 2VJKA 1HQKA 4L3WA 1U7DA 5E6SA 1UP4A 4EHDA 4OHCA 2JARA 4CQLB 2ATEA 4RPJA 3KR2A 3FWYA 2JMWA 1RIIA 4BFWA 1XBTA 2IYEA 2BD0A 1QHHB 4AMGA 2XZLA 5C80A 3E9MA 5CCBA 1M83A 5D3MB 1W7PB 1OXUA 2M3AA 4TT3D 4EBBA 1E9SA 5E1WA 1RJ9B 1QZYA 4K9PA 2OG2A 2NXJA 4QRHA 4NE9A 3LPDA 3GLHB 4KRGA 3PFGA 3EXEA 4LSMA 3LVRE 4K6MA 4YTEA 3MWDB 5KNLA 3O8RA 2ZSUA 5JFGA 4OL9A 2P5UA 3O94A 3AIKA 3I5XA 4WD3A 1RP7A 4PEVA 1CT9A 2QLNA 4JJ7A 4C14A 3W2EA 3N2EA 1IUKA 4XD2A 1C5KA 5EGOA 2LCQA 4DWOA 2R7ZJ 1S3GA 1MEJA 2QYOA 1LE8B 2IRFG 2R2GA 4MVJM 2GJ9A 1RKQA 3LTNC 3ZNNA 3AL0B 3P20A 2HKOA 1JJFA 3H1FA 3KFVA 4XSZF 2A57A 4ZTZB 5GTDA 5KZMB 1E3PA 4J0KA 3JYNA 3GJQA 4B5KA 2QRGA 2AOTA 2AUMA 1XP5A 1ZOPA 2GZ3A 1MENA 2HZBA 2DHQA 1S5PA 1CLEA 2VTEA 3O2NA 1UEXC 5HKAA 3II6X 1NMEA 2P27A 3GPLA 1V96A 2F1HA 2XD4A 2X9NA 2UXBB 3WDMA 4BDYA 1IM2A 2JZCA 1QQIA 5EIBC 3FXAA 2YMLA 1S8FA 2FWRA 4EAAA 1VSUA 2ORIA 1A5ZA 3QPVA 5HCNA 3E8MA 2A1UB 2XEXA 5LOVB 4K03A 2FU4A 2WW8A 4WEQA 1UQRA 2IW5A 3KYBA 3M3PA 1KSFX 2ZAIA 1T4GA 1ZQ3P 1L5YA 2ZC2A 4DKXA 1JIKA 2B99A 2QRHA 2F59A 3OMWA 4J43A 5L3BA 2OC6A 3WL7A 3JQRA 1RQ2A 4QXPA 1EK0A 3KJXA 1FTTA 3LUPA 2J4CA 2HPZA 1U78A 4YUVA 3WGVA 4OQXA 3E9RA 2OO5C 3I6MA 2YIMA 3AZPA 3GELA 4WK2B 2WU8A 3LAPA 2NUBA 4JL8A 2D4AA 3KYCB 2ZG6A 3S6JA 2NADA 4YAOA 5KU1A 1DKOA 2XZPA 5AOVA 4FFBA 1NXSA 2W57A 1Y80A 1FU7A 2FEPA 3T5DA 1RYDA 1QBKC 2RH9B 4EK9A 1P7ZA 2JLYA 5B1BH 3HSRA 1ODDA 4JU9A 4HUQA 3FM9A 1K4YA 2MR6A 4PRLA 4XSVA 4DMRA 4I76A 1WUTA 4D3ZA 2DRIA 3FWKA 3P71T 2D1TA 5IKOA 1HEYA 2BAGA 4OHWA 2XUHA 1OJ7A 3Q40A 4YRDA 2FMKA 1NVEA 3PFHA 4RF5A 4N5NA 3KP4A 1L7MA 4ESFA 1REQB 5BYKA 5I47A 2XRFA 4NAVA 4BAGA 2D2XA 1ES9A 3W8EA 1Z7UA 5A9RA 2CVOA 5IXYA 2PSFA 2X86A 2HU7A 5C3MA 1A7KA 4NBKA 5JXJA 3M4OJ 1I36A 2PBRA 1HI9A 1UKBA 4QT0A 4B0OA 1LPNA 3PSFA 4MA4A 1CQJB 1L0BA 3HDDA 1DBPA 3H04A 3BE6A 3TIGA 4RANA 3GGPA 4NMHA 4G0QA 2IPMA 3N2KB 5FL7A 2G9ZA 4F97A 2LE0A 4TXNA 3ZW9A 2Q1ZB 2RBEA 2TMYA 1LJ8A 1JDJA 5BRJA 1VHDA 1KRXA 1VYTA 4H3HB 1HG0A 1T2NA 3SBDA 1NVUQ 4G4SO 3FCOA 4URZR 1ZOLA 4JYMA 2FEWB 2W6MA 3LFTA 3GJXC 3QPLA 3F49S 1R7JA 2JJ8A 1TZKA 3C7TA 4KWHA 3T3GA 2JJ1D 4AMZA 1CBUA 3VR5A 4ZAVA 3R7DA 1G5QA 3KTDA 1PYDA 4M49A 3CMAI 1I1SA 2WTAA 2M30A 2KBFA 3HJEA 3UCXA 3FTNA 4XIIA 4DOMA 2WYUA 1E9AA 3WKEA 4N5MA 1TZCA 3PXDA 1PJ4A 3JXEA 2BEWB 4XRGA 3DPTA 1C29B 3SDSA 1BJKA 4KIGA 1MJ9A 1WJFA 2JF0A 4HV6A 3EY9A 1X15A 3LOUA 4JB2A 3JYLA 1XN4A 2X9QA 3UV6A 3SC3A 3F8SA 1CB7A 1W36B 4DMGA 1Y1WJ 2IA5A 4P7FA 5G02A 2JVIA 2AK2A 2L3DA 4LF5B 4M9XA 2CF5A 5BW8A 1FS4A 1KMQA 1V16A 4GM4A 1YHNA 5EIBD 4WHMA 3QG5A 1IDN1 1KBQA 5AXAA 3TW8B 3OPYA 1NH3A 3AI1A 1RYYA 4YBZA 4AZ0B 4L28A 4EVRA 2NUTB 1GSOA 3CP2A 3A2LA 2L9RA 3PI6A 4PCAA 4XCXA 3LRTA 1IIRA 1R1VA 3H6KA 3FN4A 3NFRA 1XMPA 1QZZA 2FDRA 1QGAA 2WJYA 2DW4A 2NTNA 4K26A 1C0PA 2OMEA 2WJZB 2H18A 4Q9LA 1D1QA 3FK6A 4QXQA 4PAWA 3SYNA 2EG9A 3OA0A 3P52A 4HFJA 1X58A 3O1HB 5THXA 3A27A 3SJMA 2HMVA 2A69F 2BGMA 1W0KA 2VJAA 6LDHA 2FMXA 3REQA 1Z38A 3BGDA 4PYIA 3UK2A 1DUIA 1CY0A 3KPUA 2ZRBA 4EKGA 3C39A 4OA8A 3TG8A 3WK4A 2W6JA 1XWIA 2QW0X 4OI4A 3R6GA 1PJRA 2PX5A 3MT8A 4AIHA 3U2RA 5DU2A 3WQRA 13PKA 3HB1A 1T1JA 4OFXA 1Y3HA 5CJPA 4FFNA 4NLLA 3BULA 1UHMA 3T94A 1BXRA 2CV1A 2FFAA 2CHEA 3DD5A 4GE3A 5FJIA 3ESWB 2HF2A 4PPFA 2D0DA 5D1NA 1LJ9A 1CQIB 5F7XA 4LRSB 2E87A 2FMFA 5DM6F 1GGHA 4F1JA 3QBDA 3B6ZA 3CVWA 1PWYE 3DTEA 1J25A 2AYXA 3EVCA 4OX9Y 2IU0A 3VNUA 1F1ZA 4NOMA 2EX0A 2RAPA 3I92A 1UG2A 3KZNA 2QMZA 4MUYA 3RHTA 4EHAA 4WASA 5D1HA 1COWA 4XRSG 2DQRA 4X60A 1BRTA 5IYZA 4JI4B 2DG2A 4LDZA 1Q1EA 5IFKA 1I01A 2DCMA 2V0NA 3KTOA 1L4MA 2MC3A 3MCZA 3QEOA 4U9HS 2CGPA 5FUMA 5F1YA 3L09A 3B8EA 2C2GA 3VAYA 2ZUDA 4XIGS 3C3EA 3JPWA 2RREA 3KT0A 2X4LA 4R0MA 2DP4E 3HPHA 3VSDA 1TMOA 4MKGA 1BXKA 4LZLA 4Z7QB 5HX7A 1BFUA 4ETIA 2FEOA 3VHXA 1ZBQA 1PJZA 2LNDA 2QRKA 3L6BA 3O4VA 2LIPA 1PV2A 3RK1A 3RJ5A 2H92A 5K0CA 4M73A 1A5AB 1YH3A 2YU3A 3K1AB 2IS2A 2X8LA 2XTAA 4RSRA 1ZCZA 4X6UA 1XZAA 2E1RA 3FIJA 2EATA 4IUDS 5L95A 4PTYA 3MUNA 4QDXA 4DABA 3OCCA 2X58A 1W88B 4JC5A 5E7MA 4BY9E 3SZ3A 2F9MA 5TXGA 3MN2A 4BY7J 2WM9B 3NC4A 3MBKA 2ZUEA 4OUKX 3TMYA 4LAFA 1E7SA 4CG3A 2GWRA 1ID8A 3QE4A 3E5UA 2LCIA 3ZMUA 3GFFA 3UJCA 3OIQA 3V33A 5AWFC 4DLUA 4RMJA 1SQ6A 5C8YB 3TQIA 3WLOA 2FPUA 1X2NA 2CY0A 3MWDA 1FU4A 1P7WA 2ICWG 1NTRA 3JRAA 4XLZA 2GLUA 5TPWB 3VH2A 2JANA 2PUJA 1F2UB 2PEXA 1D7AA 1PGPA 5A02A 3I3LA 4IRIA 1O3TA 4GLJA 1YUNA 4UUMA 3C7AA 3BFVA 1BDBA 1LE8A 4RYDA 2O2JA 1W9HA 4E30A 1EHYA 2JA5J 3G6KA 3VVBA 4DCPA 2K7ZA 2NU7B 1XNJA 2YYYA 5IKXA 3WMEA 1K79A 4UM7A 1X38A 1S3SA 2PEYA 1W2WB 1WJEA 1QYIA 1E92A 3L0BA 4PXAA 3RV3A 2BMFA 3R5XA 3U9LA 3RPQA 2OR3A 2BKEA 4DR4B 2CVPA 1SC1A 3WWDA 1LPOA 2ZBKA 4GCVA 1ZXXA 5E18F 4KRYA 3RVKA 1U7OA 4NYJQ 1TLLA 2O0JA 4LK3A 1R8SA 2XQKA 2DFFA 1BHO1 3H2JA 5CITA 2GK7A 1ZA2A 3W5SA 4D8UA 3W4IA 2JTVA 4GWGA 1A4XA 3TP0A 4JB3A 3ZQGA 1EG7A 4HF2A 1DUXC 3H6GA 3HCRA 2L19A 2WADA 3VHLB 2CXSA 3EIUA 3DFGA 2CG4A 3ZHTA 1DNPA 2VHUA 2LLKA 1HKHA 2AR7A 2A1UA 1P5ZB 3WSWA 2F6CA 3W2IA 2J5QA 1VFCA 5EWMB 1UELB 2QQFA 2XOKA 1RAFA 5IC5A 1P6UA 2II6A 4A3MJ 3HL4A 4OHKA 3DO6A 3WLKX 3FFAA 4K8RB 1QPIA 1JGTA 2WYHA 1SAXA 1MXHA 4L8LA 1BI3A 3EVZA 3RJTA 3IEMA 2YRXA 1PGJA 3CLUC 1YFHA 4L8GA 5KOJB 2EZKA 3IAM6 3GLHE 3F8TA 2GPYA 2H07A 1PR2A 2XQFA 2QVLA 4EABA 4RKEA 2IX9A 1FDSA 3LPNA 4LNAA 3KYCA 3Q6MA 3CUTA 4PO9A 2ACWA 4H0EA 1F8YA 3MF4A 4MUNA 2HKXA 3QLJA 3E0JB 3H17A 3JQEA 2VHQA 5LHHA 1K78A 1WRJA 2OFWA 2J5KA 3GW8A 2B0JA 4K1LA 2Z2IA 3TOSA 2GM4A 4E1VA 4ZDOA 3MB5A 2VOOA 5EXXA 4GOKA 4K6FA 2IE8A 3TG2A 5AUNB 2JFOA 3JQBA 3RIHA 2XVZA 2BP7B 1HRKA 4BVGA 3O7WA 1JBEA 3LP6A 2E21A 2G72A 4KQFA 1ZXBA 4QGGA 3L2QA 3W5UA 2HJHA 1HQYE 4V38A 1REQA 4BMVA 1SD2A 1ESNA 1AUOA 4J16A 4JWTA 2OLEA 4H31A 4TLLB 5C5IA 4HTAA 3NHSA 4M0DA 3QIAA 2WEKA 2FLWA 1SK8A 2FR0A 1XAJA 2EA4A 3QKUA 1GNVA 1LUAA 4B4VA 4X45A 2JRMA 1V1MB 2CMDA 3P2JA 3A3KA 4DIFA 2BOVA 4AM8A 4RGXA 2QMEA 4REQB 4AF7A 2VT7A 3HA3A 3WNBA 3N2KA 2LTPA 2PO5A 1UEIA 1ZK1A 2EF1A 4FX2A 2VLBA 2QUIA 4KHPB 3QXJA 3WTBA 3SE0A 1IK4A 5F1RA 1R0WA 4JROA 4UE3S 5AW0A 3T7SA 3SHWA 1OV6A 2R7LA 2Y2VA 3OF2A 4RXUA 2KZVA 4AX4A 3VZDA 2BSXA 4FFPA 3A9VA 4C4PA 4YAWA 1P8AA 2YUTA 3HKBA 5A05A 2ZSJA 1XMQB 1KI1A 3HCFA 4CQMB 3WWCA 4ZDLA 1IHYA 2PS0A 5DM0A 3KB2A 1OYVA 2DAOA 3QVWA 2WF7A 4LJ8A 3NAGA 2ZIFA 2W7TA 2QPOA 5HDQA 4JP3A 2ZRNA 2ILTA 4PR0A 3CLQA 4X00A 5EPUA 3LKVA 2RN7A 3KDSE 4BVBA 4MRPA 3C2GA 3I6QA 2R7QA 1MAVA 1L8OA 1Z39A 2P6RA 2QAGC 3CLSC 3IJPA 1R12A 5AKXA 3FBGA 3V32A 1Q74A 3ANTA 1EFLA 1PS9A 4MWDA 2QTGA 2JZNA 3HLYA 3ZGNA 3S3NA 1W76A 3KOOA 3OOJA 2B1JA 1W581 4ND5A 2ADOA 1KJJA 3TW8A 3HK2A 1N0WA 2QD2A 4K9DA 5IN5A 3MTAA 1RHQA 4KR6A 1U1IA 3NWEA 1HYGA 1ZIPA 2G8LA 2PK3A 1VQ6I 1QCYA 2HTJA 4B7CA 4XYBA 4PAMA 4P4SA 4QUJA 4BKOA 1CEXA 1ST2A 3CLUD 2X7JA 4OIQF 1U0GA 1YJ9I 5D6OA 3GV0A 4YP1A 5B58C 1IPFA 1D1CA 1RC8A 2G7MC 4B7UA 2FWNA 1COZA 1RM0A 2C95A 1QX4A 4CKBB 2B21A 3U81A 4HSEA 2H08A 3P0RA 1T0FA 4C6RA 1BJTA 2F2TA 2NGRA 4R8RA 4MHSA 4EG5A 2JUGA 4EV0A 1E3SA 4AJIA 2XUAA 3P19A 1QANA 4G63A 2ZSEA 3CVJA 2IBSA 3G1UA 1U4SA 2PBLA 3R7AA 2B4KA 3R0QA 1OCEA 4Z3KA 2BUAA 1BWSA 1JV2B 4DC9A 4OXQA 4W8OA 4JNCA 1D0SA 2R8ZA 3IQHX 4E6EA 3L93A 3KJHA 2GZHA 1ULSA 4OB6A 3AF2A 3G71I 5IP7J 2F90A 2FMHA 1E4YA 4CCAA 4BNXA 1CQIA 2PEZA 1A8SA 4DLBA 2ZJBA 4YRMA 4Y2PA 2IXEA 1XTUA 4ZOBA 1PL0A 3NHYA 4XIFA 1J33A 5AVQA 3NHFA 4BFUA 4D1YA 5FUVA 4NR0A 3VR3D 1BR2A 4HMOA 2J0UB 3Q9SA 2CMPA 1GTVA 2HK8A 2E7WA 4ZYLA 3VDMA 5LEKA 4EY7A 2YVLA 3OPVA 4QPQA 2H1SA 1XWFA 3V00A 1QTRA 4MHOA 1Z5GA 3FF4A 4U6SA 5T41A 4P0TA 4Q01A 3F6BX 2CV0A 2PGDA 4G2TA 4ENSA 4GKJB 4TXLA 5IP6A 3HTUA 5T8KC 2FSHA 1FPQA 2F8TA 2IWHA 3E0XA 5KJFA 3ESDA 4AURA 5B1HA 4UVGA 4P5DA 2MLKA 4US1R 1GARA 2BCEA 2EW2A 3A1UA 3O8HA 2A9VA 2QZ9A 4XA8A 5AOCA 3O3NB 1FEZA 3PR1A 3K1AA 1E0JA 4NSNA 5JAMA 3E35A 1GL9B 1NOIA 5LUAA 4LYDA 2QE7D 1YIOA 4DA0A 3MM4A 1IK6A 2DBVO 3IQIX 3HO1A 4JYZA 4G4IA 3VFDA 2CU7A 3WTTC 1VJ0A 1ORVA 2FXAA 4DNOA 1PF7E 3ANYB 2OILA 4WK4B 4HLQB 3HR4A 1E3QA 1LFBA 3LQRA 2EKPA 1AV7A 2HN9A 5B2EA 2NZ2A 4WZZA 2P79A 3OURA 1R6DA 2GD2A 1CZLA 4L9RA 1NBAA 3AEKB 1PYOA 4DXDA 3CLSD 2BGTA 4ITRC 1EINA 1NNI1 2WIFA 4AZVA 1RI7A 1Z4PX 2ZOSA 2QQ5A 2QLTA 4ZYAA 3SI7A 2GHTA 5M7EA 4EGZA 1NP3A 3K4LA 3PSHA 2WABA 3HSKA 3ED1A 4MDHA 4OKSA 1SXPA 3PD1A 3OD5A 3EQ7A 3GP8A 3BDIA 2AJ8A 4F5EA 4TN1A 2DMUA 4CYMA 3CY6A 2DOFA 1ZGAA 2H1VA 1PFKA 1CIPA 3ECCA 3C45A 2JASA 4FSXA 1UINA 1Z0IA 1EFHA 5KTOA 3BMQA 4FXPA 5DYIA 5AUPB 2G4LA 3T3MB 4G1EB 3DWFA 1FTGA 5L51A 5KAMA 1NVTA 4J00A 2R7RA 2Y0EA 1Q11A 5JAUA 3M8FA 3GYHX 5KNCA 5JV5A 3MJCA 2V0CA 1LLCA 4J0EA 1HQDA 2JPCA 3U09A 3JQPA 5LZ4A 4QLAA 4DZPA 3SXYA 1F17A 3FISA 3UWMA 2R7WA 4A0YA 5AW2A 1L0OC 1HTBA 3MERA 4R1PA 1XQ6A 4CE6A 2Q49A 4QWQA 4RXTA 3VKUA 3CUKA 3NYWA 4EJWA 3ERED 4IGAA 3CCJI 1X2BA 1C3XA 4UUVA 4FGJA 5LJIA 2OC9A 3V7FA 3RT1A 1GPUA 2AC2A 2PX0A 1ZIDA 1DAHA 1LTKA 5LRRA 4GXQA 2N3ZA 4XRSA 4A16A 1D2EA 2JHCA 1GL6A 3EHEA 9ABPA 5EFOA 3THRA 4LRTB 1PUFA 4PQRA 1O89A 3CTMA 1HZZA 2ZRAA 1TO1E 3F4KA 2OHOA 3PHLA 3BJZA 3LPCA 3OYDA 4LYGA 5LNK1 5DBEX 2IYOA 2J7PD 4A0GA 2CUNA 3FTQA 2CE7A 5KSWB 4M0PA 1GQOA 1I3QJ 1R0SA 3DBLB 1Y4ZA 1QGYA 2OM2A 2DWQA 3HVKA 3L1HA 5BVGB 3BCSA 2R1VA 4G6QA 1EH6A 4Y9TA 4XWKA 1NPTO 4UNPA 1R9TJ 4NZPA 3UMSA 3VV3A 3BN3A 5C5CA 4DJEC 4QDUA 4DRZA 2YVQA 1FYKA 3QVOA 4CCLA 3UMBA 4HGZA 3BIJA 4RO0A 3W7AA 5JI3E 1EZZA 1XTRA 4C22A 2OECA 3NONA 4M0EA 5GM2A 2CL5A 2CVQA 2WHEA 1SCIA 4J2HA 1ZY2A 2IKSA 1DIRA 4RPKA 2NQ8A 3F3YA 1RHRA 4X85A 3RVNA 2AJCA 1XB4A 2BF4A 2QEXI 1TJ3A 4D44A 1ATIA 4KU4A 1WWKA 3KLNA 1YG2A 4G0XA 4Y0NA 3URMA 4N7RA 4BCCA 1G3WA 4AZWA 2BHZA 3FDYA 1R6AA 4PCVA 5HOEA 3EEBA 3DOIA 2LPMA 3ND8A 2D5IA 2JFFA 3V2HA 1U1FA 3AILA 3B53X 2FE3A 4J9VA 4HDOB 4HDSA 4BLOA 2PX2A 3ASZA 4XR6A 3GG2A 1RLMA 4HYTA 4JKIA 2IHNA 1JLHA 3TD6A 2X6OA 1G9SA 2GVZC 3MCAA 1FNCA 1YHYA 3OMLA 3I9LA 1LQTA 2ZJ5A 4REQA 2XYGA 2D74A 3U44B 3ET4A 4JJFA 2POQX 2EZ9A 3VO8A 3IUJA 2HXGA 1IZ1A 1S6LA 1U2DA 4ESOA 4GSKA 2EK5A 4EH1A 1E8DA 1XU4A 4DEXA 4E14A 4OB7A 3T41A 4MV8A 3OKAA 1DJQA 3QFSA 4RC9A 3P9PA 4B85A 4MWTA 3BMNA 1KTVA 2Y8EA 3I64A 1RYHA 4C0JA 3T7EA 2KS6A 3GRRA 5DCMA 4RLSA 3AUYA 4ENRA 3RAFC 3GDWA 3JVEA 1SUEA 4OP2A 1C30A 1ZD4A 3MMZA 4NBVA 3S2UA 4CQMA 2L17A 2QT0A 3THSA 3H3FA 3ORRA 1MMFB 4WESA 1DG9A 2FUKA 1Q0RA 4B31A 1ZH6A 2P7VB 3TRIA 3NAMA 4XVHA 4CN8A 1Z36A 1DJOA 1CY1A 1O97D 2QYTA 4TS4A 3R6SA 2IUFA 1UK9A 1WLSA 4RGUA 2FWAA 4FWBA 1VOTA 1ZICA 6ABPA 1HE1C 4CLRB 3QXCA 4N9IA 1G3UA 2O2IA 1FFEA 3OSZA 2OCEA 2JG3A 4HDAA 4PFPA 1NMSA 5LMZA 3DKRA 2IZOA 2X0RA 2R8OA 4TLCA 1DELA 1ZN2A 1Y6ZA 3GFOA 1NHGA 3LYUA 1CU1A 4FGKA 1U1DA 3WV4A 3KCQA 1RZ4A 3IDFA 4HQRA 2W84A 4UXNA 3BG3A 2FN3A 1TM7E 2QPTA 2HBZA 2HQRA 5E6SB 1IAQA 1C14A 1P5JA 3H35A 1UWVA 3NWTA 2I22A 1ZITA 3O21A 2RIPA 2E2JJ 1U8AA 2ZSDA 1V4NA 1SUCA 3TI9A 2IU3A 4X9XA 5FOSA 4EDHA 4FQ8A 1N6IA 1OVMA 5BSGA 2DQKA 3EXEB 3FY4A 4PSKA 3EQLF 3IP3A 1ZL0A 1NASA 1S7GA 4Y6LA 1SR8A 4UD2A 5BNIA 2B94A 5G0WA 2GNOA 2JFVA 1H9TA 4CKBA 2AZ4A 3H1TA 5BQTA 4QOSA 5M5YJ 2FSIA 5AUQA 3KJQA 1LGYA 4XQGA 1ZM3A 2CXNA 3OOHA 1ZN9A 1R4AA 3CYFA 3I54A 1GZ5A 4QIWN 1UZAA 4LWOA 2ZUFA 4IR7A 3DULA 3MRSA 2AZTA 5CYVA 4CW7A 5TMEA 2NU9B 1CRZA 1N9KA 4QDKA 2KFDA 4CEJB 2P7IA 4CHTA 4RACA 4AZ3B 5ALEA 4EOGA 2VDLB 1B9NA 1EJ9A 2Q0XA 5AW1A 1P4HA 2OPHA 1MFPA 4PSWA 3QQPA 3GPBA 5DGCA 3UWOA 4L5JA 1FMFA 3RHFA 4UNSA 4L8YA 1NVWQ 4QHTA 1PJ2A 1NLFA 1UPXA 2ODBA 1DQYA 2ET6A 4N0QA 4IIEA 2EKQA 3RSGA 5BV1A 3WIOA 1EBBA 4EY5A 3ZCRA 2HJWA 2J0UA 2P2DA 1F5NA 1G55A 5FA5A 3I9MA 1AQ6A 1X80A 2E4ZA 1EWQA 1DQRA 1V47A 1D2HA 4UHCA 1W0JA 4XLPF 2ZI5A 3NFYA 5CNKA 2A9OA 3H7IA 4YP0A 1C0EA 2ANBA 4TV8F 4PIVA 4AXBA 4EFMA 1W75A 3DF9A 3GUCA 3CBGA 1I0LA 1SK9A 3IEUA 3JAMK 5A1TA 3W1EA 5BPIA 4PQFA 3DBHB 2HWXA 4OYLA 3CF5F 2IYRA 5ALOA 5AK0A 1ZK0A 4C5BA 2P8SA 2Q3FA 4HQFA 1QM5A 4V0LA 2ZE7A 3LBAA 2W42A 1ZNXA 2RHRA 3E6MA 1NF2A 2D59A 4A03A 4FFBB 1TUGA 4FI3C 3QVSA 2PRKA 1GTZA 4R2IA 5TVKA 2VTDA 4HDNA 2Q1SA 1CVLA 3C6ZA 3OE7A 4LJ9A 4UTRA 3DGEC 3DXYA 3GDHA 4HUQB 3UUGA 2QN9A 2ZVDA 3M4XA 2VP2A 1N78A 3D2AA 3E2PA 2OV3A 4D4MA 3WGGA 5HA5A 4DBQA 4YRJA 5EIHA 3UGKA 2PYZA 1P7VA 2V9VA 1HG1A 4CR8A 3ELYA 4MGIR 1X2EA 4P54A 4HNQA 5HFAA 1YRYE 4OJYA 1ZRCA 4EY8A 2V5VA 2RG1A 4FGWA 3GH1A 1QUFA 4ILKA 1E2UA 1J5YA 2HSDA 1XK6A 5FFZA 2C99A 1B42A 4ZZ0A 4UHKA 4BN5A 4BHBA 1QRUA 2OD2A 3VPFA 2YY7A 2VB6A 2CYCA 4RJKA 1X1AA 1EVIA 5HKKD 4F11A 3NQ41 2N75A 4ND2A 3EE6A 2V3VA 1UXHA 1GFSA 1VQ8I 3BD7A 1P2TA 1SVNA 5IVDA 1NJ8A 2EFGA 2CXHA 3TFWA 2ZJRF 4M7OA 1VE9A 4GPZA 4Z6KA 2JLWA 4KT6A 1PIWA 2OYCA 3MOIA 2P5KA 2C42A 3EUHA 2QUBA 4KNVA 4YASA 1UADA 4FKMA 1PZHA 2FQ3A 3KTFA 1T91A 3KAKA 1AK1A 2ZDHA 1QYDA 1KI6A 1Q16A 4DNPA 2A58A 3LGSA 5E8JA 1PUJA 4V0RA 1VZ3A 3HGTA 2AC4A 4HP8A 3RD5A 1K4SA 2WB4A 2DAPA 5IMSA 1Z0SA 4ILEA 4KAXA 2GLXA 1OV4A 3JD3A 3LI2A 5FPTA 4KSYA 3EYIA 1ZELA 3KAJA 3CJRA 4CTKA 4ES6A 4OATA 1L4GA 3HRUA 5FJ8J 4X5OA 5DEIA 3NJRA 1T9GS 4HDMA 2JBHA 5TVGA 1T5OA 5AW4A 3NWJA 1Z77A 1L7QA 2MC4A 2O8BB 1DTSA 1NG9A 3DFFA 2C9ZA 1B8PA 2OVFA 3MFYA 2B98A 5JUWA 4F3RA 2TMDA 1RXSA 4LXGA 1A82A 1EFPB 4MITA 1JFRA 2W2NA 3B1KA 5HE9A 2ZIGA 3NATA 4JLOA 1HE4A 1V16B 1KVTA 3PCXA 3AFIA 1NVGA 3OPYB 3RTBA 1OC2A 3QU3A 1LPMA 2QSYA 1H2BA 2H5JA 5AICA 1OX6A 4O5AA 4PQEA 4B43A 4U7DA 5CM2Z 1E2LA 3S2DJ 1F6WA 1CRLA 2H1HA 1OXTA 3WGKA 4RTLA 1SIOA 1UBNA 4I6EA 2CQQA 2QL5A 3JQ8A 3H75A 2ZITA 1N36B 2ZWMA 2XI4A 3ZC3A 3QE2A 3VGPA 4EUEA 3HJBA 5HW0A 2GHQA 1VQKI 2FH5B 5B4TA 3FX2A 3THXA 2PLRA 1U63A 3FLBA 1T3TA 1Q0UA 1IOLA 1KJQA 4ALIA 1YDFA 3BTVA 2QN7A 2FRXA 3GCWA 3PXCX 1NG1A 3Q5DA 5B58T 3DP7A 4IOMA 4DBLE 3MWYW 2EFYA 4OM8A 1FMJA 2XWJI 3TBHA 1K5PA 4L6AA 5DLDA 2L0KA 2P90A 1BI2A 1BXZA 3NKVA 3HVJA 2WAOA 4CT5A 3GTLJ 4ASUD 1ZLKA 2QP4A 3V3KA 2XGXA 2EVWX 1K3FA 5H2FC 4FGUA 4QBGB 3VKWA 4TT3A 5JVDA 1KO1A 3SIRA 1V5EA 5H59A 4XORA 1U9IA 4I50B 1KRWA 1W6RA 4QT4A 4V2GA 4Q39A 2DPGA 4AICA 2P6SA 2BHNA 1BXRB 3EA0A 3PEEA 1E62A 3DG9A 3CE6A 4JWKA 1Z29A 4MLPA 1I4TD 2WJHA 2OBYA 4U2KA 2WQ7A 4G37A 5ADUS 4A0XA 1XVAA 3AOEC 2XQIA 3MQ4A 4CA0A 1YS1X 1ORKA 5AKZA 1MUUA 3JRIA 1G8JA 3DJYA 4QYWA 1P0FA 4BV9A 4QATA 4D9IA 4TWBA 4CU2A 1L7RA 4TLDA 3F8CA 1R66A 5M29A 4PLCA 3TOCA 5IYZB 4B6PA 3MK31 1CS0A 2J9GA 2J9ZB 4A2QA 1RBZA 2JH3A 3QU4A 3JTMA 1N6HA 3DCIA 2C2YA 5GQSA 1UHSA 3E3AA 2VUUA 5GZ1A 3KTAA 2KIQA 5BYAA 1WD5A 3GO5A 4YRFA 5KSPA 1RU3A 1DKQA 1XFDA 1A3CA 2YU9J 2Q5OA 1AGPA 4G4SP 1K8ZB 1XX6A 2CLFB 4BO1A 4D82A 5CIYA 1BHQ1 4CLRA 3PUZA 4YT4A 3Q2OA 3G5AA 2E5NA 1BZYA 2IRWA 1W25A 3DMYA 1QYRA 3N87A 2AQEA 2WIKA 1U28C 4GUDA 3CMEI 3HEFA 3TLCA 2HBYA 3IVRA 2QGZA 3W2TA 1E5QA 4LKOA 3BIWA 1GT0C 4LDPA 4BMYA 4ER0A 1EJ2A 1Z4OA 1Q22A 2RKWA 3U48A 2HT1A 5E7JA 1DAMA 1XRLA 4OUDA 2C8JA 2DFIA 5I3ZA 2Y31A 2EIKH 4PXSA 1WXHA 4YCDA 4ZI7A 3RSFA 4BJ1A 2AHOA 3QMVA 4BMOB 2M6LA 4BGEA 1N0IA 2EGHA 3HB0A 1W9MA 1AK9A 3I71A 3OFSA 1L3LA 2O3UA 2EJBA 4PJ0C 4WZBA 2GXGA 5U4XA 1JDNA 2AW5A 5LP6A 2J30A 2O9JA 3FUTA 3CCMI 4UDYX 4EBFA 4JP0A 2ZTHA 4UXIA 1Z7GA 3CN9A 3A4VA 3H2YA 4K2HA 3O95A 1QMPA 4F6RA 4EUFA 1TADA 5JJ5A 1L4FA 1I7QB 3MIZA 2QA5A 5CJ9A 4YRBA 4K6CA 2AHQA 2GTHA 5DHPA 3B02A 3WG7H 1U2QA 1Z2CA 3FTPA 4KXLA 4UASA 4E5VA 2QQ9A 2XE4A 3VO2A 3EXIB 1QVUA 3QVTA 1JMVA 3LXMA 4XM2A 3JSXA 2K9QA 1BJRE 4KBGA 4X0EA 4EI2A 4IUBS 3UV7A 2GCNA 1HC7A 1G3MA 1YQGA 3N5KA 5BMVF 1VZ0A 2NU9A 4CEJA 2PUAA 1VLMA 4AZ3A 3JRDA 3DE2X 1KVUA 4BO6A 2FG5A 2M1ZA 4P4UA 2V7UA 2HSEA 3P27A 4IG4A 5GPBA 1XELA 2FWJA 5L4SA 3O4HA 3ZV3A 4XUGB 5DRYA 1U99A 2HMAA 4NZYA 1N6RA 2XNJA 3O8GA 1K61A 4NU8X 3AR6A 2O2EA 5FOUA 1R7RA 2HOTA 1TKBA 4IO1A 3TIXB 1D1SA 1F5TA 4CMAA 5K0GA 2XGSA 3CZMA 4FGZA 2O2ZA 3DL4A 1KOGA 2J0VA 3TNYA 3L4EA 4ENQA 2VL8A 1MH9A 3PP8A 4YIIA 3UJNA 4PIPA 4DAEA 1R9JA 1Q1BA 2V7BA 1LDNA 4WGFA 3VPHA 3KETA 3KQSA 1SWWA 2Y3IA 3H99A 4CR7A 1BQ3A 4O8ZA 3OJ0A 2LV8A 3FZEA 2TMGA 1GTMA 2FOKA 4HXGA 4TS9A 2J46A 3DBHA 2VNIA 3HRIA 1OZ0A 2MTBA 2WR8A 3OYLA 1I6WA 4L4XA 4BECA 3ND9A 3CCVI 1YW7A 3DMNA 1VG0B 1QHGA 2ZSAA 1O2DA 5G53C 4FCCA 1JHAA 1MH1A 4R84A 3S3TA 2KQRA 3GIDA 2Z8YM 5T3UA 1SOUA 3QI7A 1Y48E 3C41J 2ZNYA 1YZTA 2KYRA 3OM8A 4RB2C 4DQVA 3N97A 4CF6A 4YQZA 5IARA 3ZEIA 1IV8A 5JMOA 9ANTA 1K78B 3MEXA 5AHXA 2UUBB 2IHTA 3NHAA 3R76A 4QICA 3QMWA 4HNHA 3NALA 4WVLA 4E08A 5CLQA 3PUBA 2PXXA 4AC9A 1L9XA 2Q0SA 3N0WA 3IL2A 1XL1A 4Q5SF 1W34A 2WI8A 3RU7A 3IS3A 4P3XA 1HFEL 2ZRKA 3AO0B 1Y8RA 3OQNA 3AW8A 2FQ1A 4ZO6A 3KVVA 5JH7F 2VODA 4CIBA 4BLPA 4BU2A 4BJ3A 4L78A 2R7FA 4DLYA 2XVXA 3JWPA 4LBWA 3GJ8A 3LA3A 4YV2A 2C5EA 3AI2A 1N8TA 2OO5A 3I58A 3KVOA 4OKNA 1OWPA 5EHXA 1W73A 1XRPA 4U7TB 3ASUA 1RJFA 4QTXA 2X5XA 2OCPA 1A50B 4C4ZA 4M3NA 3HDVA 3NIWA 2WJJA 2PSDA 2BVLA 3RBAA 3R4KA 4MR8A 1R8XA 3OFND 1T2VA 4AK9A 1NBEA 2XCUA 1N2CA 1INLA 1UAAA 3NU1A 3RQSA 2PUBA 1DC3A 1AS0A 1K0FA 3A2MA 4UU7A 1VGQA 1JTFA 2GN2A 4CH7A 3VDQA 3OE5A 3HCOA 3HKBB 4ETSA 3GFPA 3OICA 5DV9A 2AVNA 2OJED 4ZCQA 2BGRA 1HA8A 4KFRA 4ZCPA 4L3OA 1ZGCA 3TTSA 4BC0A 2PE5A 2A6EF 4HUJA 3MLBA 5ECYA 3RGWS 3NBYC 4J1NA 4H1HA 4FFSA 4BP1A 4E12A 1RRJA 5DHRA 2O8BA 1G5IA 4YMSA 2E4VA 3E9QA 1LDBA 2VRCA 2GYWA 3TD9A 5A0TA 1VIYA 1RQXA 1R1DA 1XZBA 1UC5B 1EFPA 4ZU6X 1JZSA 3AM3A 3RPEA 3UCFA 1C1DB 3OYGA 2KI5A 2J3DA 4LWZA 3ZTTA 4OMZA 3K5PA 2BY1A 3S2WA 1FDWA 2M0MA 5D6FA 5E8RA 4F2DA 2LD4A 2AFIB 1TM2A 4O25A 5DM4A 4H7HA 1MF7A 1X1QA 3X1WA 2IDZA 3BMOB 1ATZA 3WHBA 5EPEA 1F1JA 7ABPA 3OMYA 4F72A 1QIJA 1OFVA 3MA0A 4CF5A 2HZTA 1O95C 2IA2A 1NLYA 1UKZA 2I8CA 1SCAA 1LDMA 1XTQA 3FJOA 3OEHA 3HXPA 2D62A 2BM1A 4P4SB 1QIFA 1BCRA 3ZD8A 1MX5A 3L4JA 2X0LA 1NW5A 3W5HA 4UNQA 3EIQA 3GPDG 4BRUA 3FZNA 4ENPA 3L43A 1L5WA 1IHUA 1OFUA 2ZRDA 4YMWA 1E9BA 4KMMA 4R9UC 4CIAA 3V4GA 1MAWA 2J3KA 1SKYB 2JRTA 1U3CA 3VM6A 1QMGA 4CMKA 5E8GA 3LQ4A 1N2CE 2Y93A 1MDMA 4KQEA 3VC2A 2LUOA 3WGTA 3ZDQA 4OH1A 1QB8A 3CR8A 3D2CA 3D7KA 4M0LA 5JPDA 2Z9DA 2ZQZA 3CSUA 3WVNA 1P4WA 4BE9A 1JA1A 1G291 2QAGB 4YT8A 5CEJA 3FOBA 4JIMA 1QTNA 3NTVA 4BUPA 3FYUC 2IXDA 1XEFA 4B7XA 5H4HA 2FHPA 5C52B 3PNKA 3QX7A 3R8XA 5EZYF 1XMKA 4I50A 5J2UA 3IB3A 4UBNA 1AZWA 4RS4A 1XX5A 2QLLA 1GN8A 1KEVA 3T3DA 1ZW1A 4UVCA 4XPZA 2R4UA 3IPRA 5U1PA 2H6BA 4J0DA 1F8UA 5EMLA 3W6OA 1UDWA 4R01A 3R3VA 1BKDR 5AYVA 1K83J 1J6UA 3M8EA 1RPJA 3RNOA 1ZKDA 4C29A 3TTXA 4BHPA 2A33A 1GLNA 4EECA 1YQEA 3MTJA 5DP1A 1U0LA 1Z2PX 5B64A 4D7NA 1BJAA 3TUZC 1Y8ZA 2K02A 5IH7A 4XFDA 4QGSA 1U90A 3CX8A 3USES 3ZTYA 2BVNA 1R0YA 1T3ZA 3SJUA 1IRIA 1J21A 3IOEA 4EKDA 2DB3A 1UZCA 1K6OA 5JJKA 1AGRA 4DCUA 3CLKA 1FMWA 1P75A 5L53A 1QVRA 3HDHA 4LGVA 3HY3A 4B2PA 4LY6A 1I1OA 3V7UA 1P0QA 3RG2A 4JBGA 2BFMA 1QTQA 1IZYA 4QARA 2NOAA 1FP6A 5EZSA 4RJIA 3TD2A 1W0CA 4MYSA 4UB6C 1G8HA 4OHZA 1RJDA 2ZREA 8ABPA 1PWXA 5LLQA 1Q20A 4L76A 5AM0A 2ASVA 4R9NA 4R69A 2G9UA 4NXMB 2YHIA 5CFOA 1H4VB 1S8NA 2C8KA 2QRQA 5D8KB 1V45E 1G16A 3LQYA 2WTMA 2VXDA 1T1RA 2Z4SA 3PX2A 4RTMA 2FX2A 1AXGA 3AY0A 4B34A 1FUYB 1N5IA 1SD7A 4IOKA 4K0RA 4RJJA 4KR9A 3EVFA 5DZSA 2JEOA 1MSEC 3UFBA 4TMYA 3DTVD 2G0AA 3PC6A 1CZNA 3GLGA 5H68A 4DKJA 3V46A 2EZHA 2I2AA 4P38A 1HETA 1MTZA 5BUZA 2CO5A 1W47A 3F72A 1Y1VJ 1UQTA 1HRDA 4KE7A 1FW6A 2FX0A 2PD6A 4ZODA 1J9GA 4CR6A 1V5WA 3DXXA 1YULA 3ZDDA 1CD5A 1NJ2A 3K5WA 4AYBN 4K9KA 3HXOA 4DIUA 2DJ5A 2JATA 5KHAA 2ZYDA 5I7VA 1WJBA 4XIYA 3K30A 4JHLA 1Q6YA 3ZXSA 2O06A 2FRDC 4IIFA 5T4HA 1Q3HA 4CM9D 5HKOA 5L40A 1O95D 1DLIA 2C04A 1RRKA 5I8WA 2CDBA 3EMDA 1D6MA 3EF0A 2FUCA 4F06A 4EM0B 2XE8A 2R60A 1ZHFA 3BMQB 1SKMA 2B1GA 2LBPA 3KVYA 3K1NA 1ZWLA 2HB6A 3EXIA 3S68A 2HIMA 4UB8C 2ZRHA 5TEVA 4DV7B 4W8HA 1ULHA 3PA6A 1YV9A 1T35A 5CT8A 2IU6A 1GZHB 2ZE8A 4TXHA 3IA2A 4QE3A 1YASA 2V6FA 2RQQA 3HGGA 3N3BC 3EZXA 4UM8B 1QDEA 3HBMA 4RDIA 3IRRA 1LS6A 4MKXA 4BFSA 2FQXA 1NA5A 2KE5A 3AIIA 2E82A 2VPIA 2A05A 3HUTA 2NPIA 1IRXA 2GPBA 3GHYA 1VI6A 2GXBA 1NJFA 3H2ZA 1DFHA 2OGZA 3TO6A 3HRTA 1CX9B 2XNSA 4DR2B 3GLGE 4ONEA 1Y39A 2ZM5A 1BBYA 3QTBA 2DFLA 5I9TA 1PUFB 2HJVA 4QQNA 2GESA 3L7CA 4MNUA 1Q95A 3R74A 1TB4A 2HKIA 2Y1GA 3CCFA 3BWYA 3F98A 2ODEA 3TF5A 2C97A 2I5PO 1OTXA 1ZRNA 5D3ZA 3H8WA 2RGYA 2JAHA 4Y33A 2R1VB 3L8ZA 1ZLJA 3OYAA 3K6JA 1H22A 1GRRA 2Q6IA 4F52A 2TS1A 5FGMA 2VO1A 3L8CA 2AL7A 4QUBA 2ORVA 1Z28A 1YE8A 4W9NC 3KYIB 1NLUA 3VJMA 3ZQIA 4MJ3A 4Q9KA 1QTIA 4S1VA 4I7HA 1Z08A 1D2AA 1GKLA 1H2YA 4WXCA 3P45A 3HDYA 5HHTA 1UOPA 3LX5A 1YLFA 4KV9A 3RQIA 3ZGLA 5IBPA 1XPXA 4EMUA 2OV2A 1XB2A 1MQ9A 2HQ5A 1IXRC 4GMKA 5K3AA 4TQUS 3C1UA 5C46F 1Q1HA 1YNOA 4J1SA 2PZMA 2YJNA 4EHFA 2HHJA 5CLFA 3ILYA 1UC8A 1IXSB 5CGZA 1FUIA 1QZUA 3GUZA 5TJHA 3WA6A 1E7RA 4KO3S 2IA1A 4HDSB 1TX4B 2A67A 3F5MA 1KJNA 3NP9A 3M4NA 4JVSB 1NDUA 1DC6A 4MYRA 5H80A 4ZEOA 4AI6A 4JX8A 3U7RA 5JRZA 4PO1A 3WWPA 1ZLXA 2HADA 4DLTA 7REQA 4W1QA 2PDAA 1F51E 1OWLA 4KN7X 2RV8A 3IQEA 4BQNA 3HEBA 3L1VA 4ZRDA 2BEJA 1OB5A 3PB3A 2FK8A 2INGX 4YFKF 3MQ2A 3N75A 4XGNA 4WZAA 2WFLB 3NBUA 1PEDA 3PQJA 4WUTA 1BS1A 3ZMDA 4JLDA 2VNSA 1RRMA 3BMNB 4R3NA 3DOFA 4Z4FA 5DNUA 3VPSA 3FJ1A 2FW6A 3UAYA 5DCMB 4UNOA 5ALPA 1WZIA 5DM1A 3WRWA 5ITWA 3V8RA 1F8FA 3WXBA 1C30B 5MHTA 1QIHA 3AR9A 3IUYA 5IC6A 2YJGA 4F04A 4MUEA 2ODTX 2F3SA 4FLMA 3E7LA 3T9EA 1PLJA 4WESB 1GPBA 1R0CA 4IS3A 1Z5UA 1M2JA 3FNEA 4BCDA 5JY1A 1E0EA 3KEQA 5IRCD 3TVDA 4CKYA 5HPYB 4EQ6B 2CJJA 3AZOA 5LQKA 4JI3B 1BG6A 4YJ3F 3I34X 2VFAA 4FHGA 5J9FA 2PD4A 1FFDA 4A0FA 5AW6A 2DFVA 4CRWB 2WUVA 2Q1YA 1WVGA 1U3FA 4MFEA 2WV1A 3W9SA 3FZVA 3MQ0A 5K8TA 4A1OA 1YRWA 4X8MA 3KM0A 5FKKA 5AOBA 1WW2A 3H2SA 4TRRA 4JB0A 4FPXA 1ULZA 1C1DA 1SAUA 2XMPA 3NIBA 4M76B 2AFIA 5I5EA 4KQWA 2MD0A 3DCYA 4MR9B 3QOEA 2O1XA 2WU0A 4ZP1A 2A5LA 3CM0A 1T9BA 3BDAA 2Y0DA 3BMOA 1ZD9A 3NHJA 2EIHA 4XM0A 4CV2A 4Q4ZF 2G07A 3G9XA 2QE7A 4ML3A 1LWOA 3FDJA 5M3MJ 3Q5EA 1V1RA 4G4JA 4LY0A 3JR9A 3QU5A 2GOXB 1TVEA 2P3QA 4D6YA 1P17A 1SIBE 2CW7A 3L0CA 5P21A 4WZAE 4YREA 1M2NA 4PGMA 3MWGA 3P2EA 4DA8A 4M53A 2G7ZA 3H1PA 4DIBA 4DLLA 3AV0B 3Q85A 2XZDA 2QAGA 4UJ5A 4H7IA 4X8HA 4QXMA 4IDEA 2BHTA 2QUJA 2L54A 3K69A 3EIXA 5CLLA 4BAUA 3K0KA 3DKKA 2BH9A 2IPAB 3MTGA 3ORFA 1OU4A 3QYBA 5MGNA 1BH2A 3CONA 4BNTA 3LNCA 4Q9NA 2FN9A 4LZZA 1FLNA 1N25A 4HA8A 1MBGA 4D9NA 4R81A 1N5JA 2BFDA 3ZBQA 2ZDQA 3I6IA 1E9EA 5CPFA 4HFRA 1PK9A 3BEDA 4IHAA 2ON6A 4KQ1A 5CJ2A 2ZCUA 2P6OA 2HRBA 3IURA 1ZG3A 2FP3A 4NBTA 5J1YA 1ZMXA 2WT4A 4AECA 4A15A 1WOYA 2F5EA 2OV7A 5IOYA 3D6FA 3R44A 5IHXA 1OCZH 3WTUC 5EJFA 3E1KA 4A12A 3LOCA 2X8JA 5FB3A 1X80B 4RTSA 4HK4A 1F2DA 2AFIE 1IIBA 5IDVA 4C4RA 4OK6A 1QQAA 3PI7A 3QVVA 1JQ5A 1NUPA 3B3QA 4UU0A 3M4JA 3CW8X 3H8SA 3OZXA 4M1QA 2D0OB 1LI7A 1UBTS 4LF9B 3EMKA 1VKHA 1KI7A 4LDJA 1KJ8A 3AVWA 1PG0A 3TNJA 2XUGA 5G1PA 3T5PA 3V4OA 3ABQB 2B82A 2LZ0A 2JGDB 3VUFA 5BSHA 1CUEA 5DXAA 3M9LA 1QHSA 4FGLA 1E2IA 3ORQA 4PY2A 4DILA 2ATCA 5DASA 3V7YA 2O1EA 3L0PA 4CM1A 5HIJA 4IJQA 1Y82A 5EKXA 2MW8A 4C43A 3SYLA 1SKYE 2VAMA 4AIDA 4P3OA 3EQ6A 1ZH5A 2C84A 4JSYA 3LY5A 5BWMA 5LZ5A 2WD8A 1Y9JA 3E9DA 1J0DA 4HDNB 4ARBA 3DFUA 1FOWA 3DZDA 2HRCA 1ISFA 4HQOA 4D99A 1DMRA 2R7MA 4YAFA 5EESA 1HA3A 5C37A 3R7SA 4R8SA 2I4RA 3KKMA 3TTVA 2QNRA 5GWXA 3HI4A 2UVPA 1ZVQA 4DG9A 4PSXA 1GPDG 3E27A 4ZVPA 4MLCA 4WRRA 3ZZMA 2AG8A 2IL1A 2ORED 2BR5A 5FFMA 5T8KA 1V3UA 3KOMA 3PIOF 3ACDA 5DYNA 5K0EA 3M0EA 1ZO8A 4UU8A 5E17F 3W3AH 5GOTA 4BQEA 2DDBA 3DUWA 2J6BA 1IWPB 3LSGA 3AU8A 4U9IS 4W1RA 3SVLA 1N34B 3GEIA 4J6FA 2Q2EA 1RXVA 4IP0A 4TMWA 4N03A 4MWEA 3HRMA 4OIFA 1TPYA 2I62A 1XJ0A 4A92A 5GP9A 4RL6A 1DC7A 3MAAC 3LL4A 1NNUA 4GF5A 1QOPB 3RTCA 2HNBA 3NWSA 3DYBA 1C2TA 2WAFA 3UT6A 3BOSA 3CEMA 5EZHA 2CL0X 3S2GA 1XPJA 4C1BA 2AKAB 3ZIAD 1QKKA 5CNIA 3QPAA 4LHYA 5KVRA 3TQRA 1KI6B 1X86B 4KK3A 2Y69H 1U02A 2HWWA 3MT7A 4QUAA 1ZX1A 4KYVA 3GRFA 5I6DA 2I6QA 3CNBA 1O97C 4UULA 2JFPA 3A05A 2A3SA 3K6RA 4XGKA 5KCMA 3WL8A 3SQMA 3L8YA 1VXRA 3QUBA 5FYDA 5MN6A 1VC2A 1PW5A 1OR8A 1FTYA 1BDMA 1L7VC 1TIBA 1YFLA 4F55A 5C9ZA 4ZARA 3CJRB 5BMOA 4GMGA 4RPLA 4R7TA 5JCJD 4HDMB 3G6WA 1RRVA 3F73A 3SQXA 2C77A 3MT9A 3E18A 4WXHA 1MVLA 2HRRA 2BE9A 5JSUA 2OQ2A 4XWYA 3LQQA 4QVKA 3G7NA 3GLVA 3BGIA 2PMUA 2DSTA 3S2EA 4B79A 2X0NA 4I9UA 5IVPA 3MUEA 3Q8LA 2BGJA 5HDGA 3LGXA 5HK9A 5IXSA 1NQXA 1K8RA 2Z9OA 3MJ4A 4ZYZA 3IPAA 2FPGA 1Y1SA 1GPWB 3IIJA 1T8TA 5DGIA 5L3CA 1YGPA 5HFNA 3FBNB 3AJ9A 2WF5A 1VPWA