1SFOJ

Rna polymerase ii strand separated elongation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1sfoJ00
2KDZA 5EEAA 2P81A 5M5YJ 4RBOA 3LOCA 3K2AA 1QVTA 5C44J 1ZQ3P 2TCTA 5J3LA 3MN2A 3S16J 2XPUA 2R7ZJ 5F04A 1RR7A 2NVYJ 2EBIA 4DYCA 2E2JJ 2QF7A 2X6OA 1U8BA 2JWTA 4L5EA 5FKLA 1ETVA 3JR9A 2WV1A 3TW6A 1UG2A 4JX5A 5FKOA 5M5XJ 2CRGA 3I4NJ 2ID6A 3BR6A 4FTHA 2NS8A 4IHYA 4V2GA 3F0CA 1ITYA 1DU0A 4G12A 3JRGA 1F36A 3LNQA 3GBGA 4M3DA 3IH2A 4QIWN 2H8RA 3OSFA 1X2NA 2EZLA 5IYCJ 1FIPA 3UKGA 2NS7A 4A3BJ 2QCOA 4V2FA 2DA4A 1LFUP 1FIAA 3RZDJ 3TEDA 4C3HJ 3BTCA 3PO3J 2L7FP 4A93J 5FJ8J 1XC5A 1ETQA 3DCFA 3HOUJ 2JA8J 3S1QJ 1W0TA 5K7ZA 1A6IA 4BBSJ 3H0GJ 1ETXA 1GV5A 4DYRA 5EF6A 2JA5J 1P7IA 2DMPA 1Y1VJ 3OSGA 4DW6A 1JKQC 3QQAA 1HDDC 4XICA 4AUXA 2O9LA 2M9HA 3HGGA 3BG3A 2HXOA 1OJLA 2DA5A 1YRNB 3Q3SA 4C3JJ 2IBDA 1XS9A 2HYJA 4MIMA 1P7JA 3S1RJ 2Y0SN 5E3OA 3HGYA 3SDGA 5F0FA 1VFCA 4UUSB 4EEFG 1TWGJ 1BW5A 2L7ZA 2XB5A 3LSJA 2VUMJ 3TW7A 2MG4A 2DMQA 3HKZN 1APLC 3JRHA 1X2MA 2G0EA 2GBYA 4FE7A 2DMTA 2CQQA 5IYBJ 5BNGA 3D1NI 2COBA 4A3MJ 3LSRA 4MLOA 5IOZA 1PUFA 1LE8B 1MH4A 3BR0A 1H89C 2KT0A 1U78A 3CMYA 3A01A 2LK2A 1IDZA 4CYCA 1MBKA 4QTRA 2LP0A 2FJ1A 3JRBA 2R5ZA 5DS9A 4A3CJ 1QVUA 3ZQHA 2DMNA 3BT9A 2I10A 4JP0A 1T33A 3OOUA 9ANTA 1B72A 2O7OA 1GDTA 2JA6J 2LVSA 1Z0XA 1I50J 2LR8A 2AO9A 1WH7A 1B8IA 3B6AA 2DA1A 1TWAJ 2HQ5A 1POGA 3WHBA 5EGOB 5FKKA 2HI3A 2LY9A 1IDYA 3E7LA 1HLVA 3MKLA 1QRYA 4XRSA 1RKTA 3BR5A 4RDUA 4XRSG 3ZQCA 5JLXA 3O8GA 2ME0A 2LFBA 3GTMJ 3BR3A 3GTLJ 1WI3A 1ORKA 3GTOJ 3JRDA 1U9OA 3MVPA 3HDDA 4X1EA 1VF9A 4M3EA 2NVQJ 4XIDA 1OCTC 1NK3P 3I4MJ 4A3LJ 2XPWA 5EZHA 1NTCA 2TRTA 3SFIA 4IHWA 3GTPJ 1JUMA 3S17J 4D7MA 5IP6A 3S2DJ 4BY7J 2NOGA 1JTXA 5EG0B 5EZGA 2HDDA 4BXXJ 3BTIA 2CJJA 2LLKA 2EZKA 3M4OJ 4Y52J 5FLVA 4A3GJ 1FEXA 1MBJA 3JRFA 1MBEA 2VPRA 3NARA 5GP9A 5M5WJ 3IH4A 1GT0C 2XGEA 2FQ4A 2VKVA 2YS9A 5J1YA 2E2HJ 3GTJJ 1VNDA 5EYRA 1JKPC 1D5YA 1RKWA 2Y31A 4I6ZA 3GTKJ 2MGQA 1ZGWA 5FLMJ 3SJMA 2B63J 1XG1A 5K7FA 1ETYA 1JJ6C 3BQZA 5F0HA 3JRCA 3HOVJ 3BTJA 1JKRC 4D5CA 4DYQA 2PMZN 1SFOJ 3FISA 1GV2A 4NDLA 1WPKA 3G1LA 1GVDA 2DA7A 1JUSA 1IG7A 3GTGJ 1R9TJ 1MBGA 2R5YB 1AKHB 2IAIA 1JJ8C 3HOYJ 3Q0VA 2LKXA 2OF7A 1YRNA 4BY1J 1EF4A 2ME6A 3QPLA 1FTZA 3A02A 2MW8A 3Q0UA 3IV5A 2YUSA 5M3MJ 4MFDA 2LTPA 3TP0A 2HOSA 2ELKA 5GPAA 1PUFB 3ZQGA 2EQRA 5J1RA 3CCYA 4M3FA 4D7NA 2R92J 3BTLA 5E3MA 1FTTA 3ZOBA 2ECCA 5IOYA 2RAEA 4FE4A 2X9DA 2LD5A 3RKQA 3A01B 1SANA 3BR1A 3RQIA 1JTYA 4CYCB 4A3IJ 3Q0WA 3S1MJ 2DA6A 4Y7NJ 2JJ7A 3S2HJ 1TWFJ 5F0CA 2R5ZB 1LE8A 3QPSA 4M6VA 2E19A 1K61A 4UUTA 1FJLA 1IC8A 4C2MJ 1IJWC 2ECBA 2NVXJ 1IGNA 1F43A 2M8GX 1QPIA 2DTZA 3BG9A 3O8HA 1B8IB 2X48A 5DTDA 4BBRJ 1H8AC 2GLOA 4A3KJ 1I6HJ 3S1NJ 4X6AJ 2Y2ZA 2K9NA 2ID3A 2D5VA 1T56A 4M3BA 2WAQN 3CDLA 4MO7A 2K9QA 2VKEA 4JX4A 5FKMA 4QSHA 5C4XJ 3JRIA 1JGGA 1NK2P 3CQZJ 1WGXA 4A3DJ 4B4CA 4AC0A 3PO2J 1W0UA 1ETWA 3OIOA 1GUUA 2M34A 4IHVA 1RPWA 1UHSA 5EDNA 5EGOA 1DU6A 3W6VA 5F27A 3ZQLA 1BJZA 2EZHA 4B1RA 5IYDJ 2Y30A 1BA5A 4AYBN 2FX0A 1MBFA 3HB9A 2R0QC 1JKOC 3TP3A 4IEJA 2M0CA 4GFBA 1MH3A 2DN0A 1RETA 3K7AJ 3S15J 2N8GA 4XRMA 1LFBA 1JUPA 2EH3A 1O4XA 5IP7J 4J19A 2CQXA 3M3YJ 2W48A 2HOAA 5GPCA 1HCRA 5J1UA 2XB0X 3LSGA 1AHDP 4FISA 2JA7J 5EG0A 2XGCA 2L0KA 3BQYA 1ETKA 1HF0A 4JYKA 2Y9ZA 4D5FA 5C4JJ 1ZR2A 4I76A 2XSDC 2MSYA 1ZTRA 1MBHA 2L7MP 2XGDA 4C3IJ 2HOTA 4DZPA 1WCMJ 3HBLA 1BL0A 2OPTA 2E2IJ 4B3AA 5IP9J 4LOCA 1TWHJ 5JLWA 3BG5A 4FCYA 2Y9YA 2E1OA 1IV6A 1IRZA 1U9NA 4A69C 1UMQA 2FD5A 2WB1N 1JT0A 1G2HA 2CUEA 1MSFC 3HM5A 3C2BA 4HNVA 3NAUA 1ZR4A 4IHXA 3WHCA 4JX6A 2JMWA 3HOWJ 1BW6A 5FKNA 1AU7A 2HXIA 2K40A 4BKXA 4W1UA 1E3OC 1ZKGA 5E3LA 1S7EA 1RESA 4UUSA 2DMUA 1X58A 1AKHA 2R5YA 3ZQFA 2IEKA 2XRLA 2YU9J 4M3GA 2JN6A 4MFEA 5HODA 3HEFA 3PM1A 4ABZA 1TWCJ 5K7HA 3FK6A 2DJNA 1ZK8A 3JRAA 3HOXJ 3VPRA 5M3FJ 4W97A 3HOZJ 1H88C 3BR2A 2M2EA 1OFCX 3GTQJ 3JREA 1A5JA 2CU7A 1I3QJ 2DA2A 3FIWA 1OCPA 1VI0A 3FKIJ 3S14J 2K9SA 1ETOA 5C3EJ 1B72B 4A3JJ 3H3VK 4A3EJ 3RZOJ 1HOMA 1JT6A 5F1JA 3A03A 1CQTA 3G1OA 1MSEC 2NVTJ 3G1MA 2JK3A 1Z77A 2H1KA 3FK7A 2CUFA 3B6CA 4DZJA 2L9RA 2EZIA 4S0HB 3L1PA 1WH5A 5IPAA 2ZB9A 3ZQIA 3IH3A 3DEWA 5F08A 2GM4A 2DA3A 2O8KA 4XK4A 2R93J 2VI6A 1Q1VA 1K83J 1ENHA 4A3FJ 1Y1WJ 1TC3C 3LSPA 1HDPA 5E3NA 2XPVA 2AHQA 1IUFA 1MNMC
chains in the Genus database with same CATH superfamily
1D8KA 4JOMA 2HZDA 2JVGA 4II3A 4GYGA 2EA4A 3LOCA 3S8PA 1ZQ3P 3GEZA 1HC8A 3JSPA 3H92A 5DV5A 4UHTA 2XPUA 2DAOA 3PNVA 1RR7A 3CUQC 4DYCA 4P55A 2E2JJ 3ELKA 2QF7A 3OY9A 3MKZA 2O8XA 1ACIA 4HG2A 2WV1A 5DD8A 5M5XJ 2P6SA 2BEOA 1ULYA 3BR6A 3KE2A 4FTHA 1XMXA 4BDZA 2NS8A 1MW7A 3E6DA 3OOPA 4BH9A 4G12A 4WXHA 4XN3A 1T95A 2WC2A 2IT0A 3WTUC 3LNQA 2PLYA 1HSJA 3C18A 2DK8A 1PP7U 2BZTA 2M7BA 4EMSA 1IRXA 3MZHA 1PVEA 5E18F 1X2NA 1W4MA 2EZLA 2L54A 3GYHX 4MQ9F 3UKGA 1FIPA 4LLNA 2NS7A 3W6KB 2QCOA 2MLKA 4M73A 1ZN2A 2DQRA 2V1NA 4G94A 2UV1A 3E0JB 1YFHA 4I98B 3TEDA 4OINF 2MBFA 3BTCA 2M7AA 3PO3J 5F1RA 4M6XA 1XC5A 2NXNB 3HOUJ 2JA8J 1W0TA 5K7ZA 2QENA 2LSOA 1A6IA 3OYGA 4BBSJ 1Y0NA 3H0GJ 1LPQA 2HZTA 2L9SA 4DYRA 4MEXF 2JA5J 1TBXA 1P7IA 2KISA 3I56I 2IS2A 1JKQC 2QKMB 2AXTC 3O6BB 4LK1F 3SZTA 1HDDC 4XSZF 2Z2SB 5BOXA 2BY3A 1G6NA 3HGGA 4M9XA 2X1DA 3KZIC 1W7PB 4U87A 1D0YA 1XS9A 3HOSA 2MC3A 4MIMA 3S1RJ 1LB2A 5D5XB 2Y0SN 4CCJA 3F6OA 4ETSA 5E3OA 3U21A 4X0GA 5F0FA 2JA2A 3OYEA 2EILH 2UXXA 3ZN1A 3C2HA 4XN0A 2DK5A 3HRMA 1ZARA 5GTIC 2VOOA 1ZRCA 4LB6B 5BQTA 4EEFG 1WWXA 2RNGA 3SEZA 3KZYA 2XB5A 1BW5A 4BACA 2KLOA 4Y33A 4N9IA 2PJRA 3J7ZI 5KVRA 2YR2A 4E4HA 1I39A 2E1MB 2W85A 3A4CA 2AXLA 2HKXA 1X2MA 3M1CA 5BNGA 2BXYA 2COBA 3L2VA 1P9QC 2E1NA 3I59A 3BR0A 2HKOA 3OYMA 3AG2H 3OYKA 3I3LA 3ERED 2W1OA 1H89C 3N97A 1UELB 2ZFUA 3G3ZA 3FZVA 2ZJQF 1VQPI 4P96A 4CYCA 3CUOA 4QTRA 1BN5A 1R1VA 3A2KA 3TDZC 1R49A 1YIOA 3IKVA 2CQ7A 1B4AA 2IS6A 3AKZA 1U0JA 5DCMB 1R4MB 1WI9A 2O03A 1T33A 4BAYA 4HV6A 2OZUA 2F4OB 3OYCA 1GDTA 2DFEA 3RYRA 4P9FA 2LVSA 3HRTA 5FLXZ 3BOQA 2L7KA 2IP2A 4OAZA 2DOEA 3ZQQA 2W82A 3I4PA 3GCMA 3SHFA 2GOXB 3KEOA 3MWMA 5LEKA 1OCOH 1IAWA 1EA3A 5JVGF 1S9HA 1HLVA 5DM6F 3MKLA 1JHHA 4EM0B 2CGPA 2NRAC 3M7GA 1RKTA 4RDUA 4XRSG 3H5AA 3O8GA 4PGGA 5HLGA 3N05A 2JQ7A 1Z05A 4IHTA 1YG2A 2PMUA 2VJ4A 1U9OA 2W57A 2ELHA 4X1EA 4II2A 2A61A 1IRFA 3ECHA 3V8KA 4P9UA 3WU1B 1NK3P 1IRGA 1U8RA 1NTCA 1EH8A 4JQFA 4RM2A 5LBQA 1WQ2A 3OYAA 4IHWA 1JUMA 4D7MA 3G71I 2EIJH 3FXRA 3NEUA 4BY7J 3CCMI 4EQQA 4ZYAA 4A0YA 1JE8A 3TDUC 3ZMVA 5KAFC 2UXNA 1SD7A 3I54A 4A5MA 5GAHJ 3Q9SA 3K4BA 2X4HA 3M4OJ 2DFIA 3FXJA 1FEXA 3S3NA 3MKWB 1R23A 3ECOA 2D2WA 2VPRA 1S8NA 2WWYA 2R7RA 3NARA 5M5WJ 3H5RA 2CW7A 1XN7A 3CUQB 2IGMA 5DUKA 3RSNA 2XGEA 1TT0A 4HV5A 4L9TA 4OAYA 3OYBA 1STZA 2WAQA 5EYRA 5LHIA 4BQAA 1XCVA 2GXAA 2ISYA 3RPQA 5FB2A 4KN4X 2Z99A 2OBPA 3JW4A 2V6EA 2COMA 3QU3A 4HF0A 5FLMJ 2KPMA 2KJCA 1ZGAA 4B47A 1K6YA 2ZMEC 2QYOA 1TQMA 2FUG2 2PBIA 2CO5A 3H5NA 2PMZN 2QM3A 1FOXA 1BR4A 2KL4A 2LMDA 2MH9A 4BS9A 1KYWA 3B02A 3F72A 2BW3A 3FISA 4ZYGA 2XAQA 3KEYA 1WPKA 1X4OA 4QLCU 1V5EA 1I1GA 1YW8A 1R9TJ 4B48A 2IAIA 4R8HA 5LRSA 1E17A 2DPDA 2NS0A 5J8CA 3NWSA 1YRNA 2EINH 5EEHA 2HS5A 4H4KC 2STTA 3H9JA 2ZNZA 2RN7A 1IXSB 5GPAA 3CCLI 4RA2A 4P1WA 2FF4A 2EQRA 3I9V2 2E5NA 1GLNA 3P9CA 3CF2A 4KICA 3G73A 4U0YA 5GTHC 2LD5A 3LQQA 2AQEA 3RKQA 2VE8A 3NRVA 4CYCB 3F3XA 1W36D 2STWA 2DU9A 2DT6A 4L0ZB 2DA6A 2ZJPF 1MJBA 3S2HJ 4FQGA 3GWZA 1TWFJ 2LNBA 1WKMA 1LE8A 3VEPA 3H35A 1K61A 4UXNA 3C3WA 4UUTA 1LNWA 1PDNC 3GLXA 1LDDA 4ZDOA 1XCBA 4F92B 1CF7A 2M8GX 1QPIA 4OMZA 5GADJ 3O8HA 3HOTA 1P4XA 2X48A 1H8AC 2GLOA 2WB1A 1O57A 2OCCH 4B3XA 4X6AJ 3P7NA 2KDOA 1YS6A 1T56A 2ZC2A 2XROA 1DGWY 3CDLA 1X4PA 2VKEA 2VQCA 5LEJA 3OYLA 4JX4A 1O3TA 4XOPA 4QSHA 3BC8A 1ZRDA 1JGGA 3ZMSA 1DPUA 3L2UA 3LSTA 3IRQA 1KU2A 2IA1A 4G6TB 3T1BA 5LGTA 4U88A 3ZXSA 1QU3A 5EGOA 3IRRA 5HS9A 3T8TA 1FY7A 3W6VA 1BJZA 2KFDA 2FBHA 2HPIA 2X6XA 3DKWA 2NOJB 3WTVC 2DO7A 3L2WA 3ESWB 2HYGD 3VFZA 4IO9F 4PDKA 2OCEA 1MBFA 5ILVA 4BL0B 1MH3A 4A5NA 2DN0A 2VBWA 4HF2A 4KUMA 3S15J 2VXDA 2OD5A 4XRMA 4IOAF 3V42A 1LFBA 1PUEE 1SD6A 1MMGA 1T8IA 2CH0A 4XLAA 2EH3A 2V9VA 4I01A 2HNHA 1R1UA 4GDFA 4J19A 3M3YJ 3IKTA 1TNSA 1HCRA 2HOAA 4XSXF 2XB0X 1R6RA 2DYSH 3FM5A 4LJZF 4Y4RA 2DTRA 4LD5A 3H3ZA 2G7HA 3BQYA 5E8IA 3JTGA 1G3YA 2EFQA 2Z5UA 5B5EC 2ZFWA 1UFMA 4D5FA 2Y9ZA 2V1DA 5EEGA 4DGWB 3AG4H 4EJOA 2XGDA 4C3IJ 1D5VA 2BVLA 3ZCOA 3F8BA 2HOTA 1O7LA 2VPLA 1WCMJ 2HU9A 1XGNA 2JSCA 2EFNA 1Q1HA 4L9NA 5IP9J 5J6XA 1TWHJ 3GO5A 1HQCA 2LY2A 2EV5A 2E1OA 1U9NA 4AVPA 3LFKA 2HR3A 3RI4A 5HNHA 5JFRA 3PSIA 3C2BA 3NAUA 2NVUB 2DOAA 2V1UA 2KIMA 1MJ9A 1U2WA 3REOA 3IAS2 4BKXA 5TRDA 4BHPA 2RGVA 1VTNC 4F91B 3WG7H 5E3LA 3OS2A 5L3EA 1S7EA 2QLZA 3VOEA 2A6HF 2DMUA 2ZSIB 4HX4A 1WRJA 5FGMA 3EUAA 1R22A 3ZQFA 5F6FA 2BE5F 2Q0OA 4HEA2 1X1DA 3K70C 3FMSA 5HNFA 6PAXA 5K7HA 1ZK8A 2IXSA 2L2OA 3JRAA 2ZMEB 3HOZJ 1OMIA 1LDKB 2X0LA 2K9MA 3W2WA 4GRIA 1NHAA 2DA2A 4KIGA 2K5CA 4HRIA 3K4KA 4XL9A 2FNAA 2NAZA 4OIPF 3H3VK 2K3PA 3RZOJ 2O0YA 2M87A 2F4IA 5F1JA 1MNEA 1CF7B 3G1OA 2EWNA 4AIDA 3H9GA 2NVTJ 4BYYA 4FX0A 3VSLA 1L3LA 1Z77A 2H1KA 4YELA 2A07F 4DZJA 3WU2C 5IPAA 4U7DA 3CJTB 2IVMA 3FBNB 3HHHA 3KLOA 4QWQA 1K83J 2PEXA 3FX3A 1Y1WJ 1OR7A 4I02A 1RNLA 3S93A 3LSPA 1J9IA 2ZNYA 1QPMA 2XPVA 1WJCA 1X1PA 4A12A 4XRFA 3K2AA 2KZVA 5C44J 1SC7A 5J3LA 1XGOA 3J80K 2LDUA 1UHWA 2KZGA 2EBIA 4ZYEA 1J7KA 1RIOH 2JWTA 4HSRA 1SMYF 2QEXI 4ESFA 3W2AA 2CRGA 4RM3A 4IHYA 1A36A 2XSJC 3SZGA 1DU0A 3EUKL 2ADUA 2R7SA 2M30A 4HBLA 3HTSB 3QWLA 3GBGA 1M1EB 4QIWN 3IH2A 2H8RA 4HAMA 1MZBA 5E1ZB 3EPZA 2K86A 2M4KA 3KPHA 3DPUA 2VJIA 3WTXC 1W5SA 2E1CA 2P5VA 2YU3A 4V2FA 4KMFA 1LFUP 1FIAA 2BGCA 2ESNA 4R79A 1CGPA 4U0WA 1N78A 1RUOA 3J7AY 4C3HJ 2BOLA 2L7FP 2LC2A 3DLAA 3DCFA 2Q1ZB 1BOAA 2Z16A 1FYLA 3OL3A 1IN5A 1E3HA 1ETXA 1J2XA 4RB0A 3VSKA 3TL4X 3PUFA 2R7DA 1LQ1A 1Y1VJ 3ABUA 3OSGA 3CJRB 4RAGA 3OYNA 3DWLE 5HLTA 4IOCF 2O6GE 2IGKA 2JVHA 2R7UA 2GQQA 2BBYA 4Q5SF 2O9LA 3CJNA 4IPAA 4XMYA 1Z21A 2VL8A 3BG3A 3F6VA 3MZ8A 3Q3SA 5LD2C 3JTHA 1REPC 3WGGA 2IBDA 4C3JJ 1F5TA 2HYJA 4MTEA 3A0BC 3B73A 3TMOA 1KQ9A 3DXJF 4ZTJA 3BPVA 5DEQA 2W25A 2VOPA 2OA4A 5B1BH 4NC6A 1ZRFA 3E6CC 1LJ9A 2Y48A 1X1AA 3TW7A 3VYUB 5E8GA 1APLC 3D0SA 1GXPA 1MNDA 2CQQA 3HXLA 1IXRC 4A2UA 3D1NI 2WADA 3LSRA 5IOZA 3K1MA 4LGWA 1MH4A 4M74A 4IRGA 2KT0A 4BXFA 4G7HF 1WJDA 3QYEA 2XAJA 2VQGA 1V4RA 3A01A 2LBFA 4FHTA 4RAZA 1TW2A 2L02A 4EJTA 4HA8A 1E3PA 2FJ1A 4Q4ZF 1IF1A 3M9AA 2WBMA 2DFFA 3KCCA 4CSWA 3CJQB 3H1CA 1YO5C 3FXKA 1TQPA 5DS9A 3KYDB 1G3SA 2GA1A 2V1XA 2I10A 2AQFA 2EIKH 4CCNA 2JA6J 2LY1A 1Z0XA 1I50J 1B8IA 2ZCWA 1G8XA 3B6AA 2DA1A 1TWAJ 1IUYA 4LLLA 1XPXA 1TW3A 3BDDA 2QQ8A 3F9KA 3H36A 3V7CA 3QPHA 3F21A 5DCFA 3MAJA 3EETA 1MDMA 5FKKA 3NWTA 5FFXA 1U5TA 4XLHA 2DJIA 3GZNB 1UHMA 3NQOA 1TL8A 1PJRA 3BR5A 5ILUA 4YIFA 5H2FC 1D8JA 3H3UA 1YOVB 1Y0UA 3GTLJ 1WI3A 1XB4A 1ORKA 4RMNA 3JRDA 5E20A 1YI2I 3FM3A 2EFPA 4B44A 4YG2F 2A68F 3HL2A 4M3EA 2A3SA 2XF6A 3DEUA 4XIDA 5IY5H 5EZHA 3CO6C 3E3VA 4E7ZA 3GTPJ 3M8FA 3PQKA 2YX7A 1ERDA 2V9KA 2M4GA 1JTXA 2NOGA 1QHGA 5ERIA 5EG0B 3CCQI 2Y0MA 2QA4I 4I7HA 2DPUA 3FHZA 3PJRA 5FRNA 3L7WA 3M8JA 4GGGA 1FZPB 1MGTA 1UJ8A 1MBJA 3KX2A 2OQGA 1DPRA 4MTDA 4WCGA 2HYFA 1WFXA 1FBQA 3PNYA 2VIXA 4A0ZA 3QODA 4XM3A 4A6DA 3KETA 3E1SA 2V7FA 3IH4A 5J40A 1BI0A 2H8WA 4EM2A 3QOEA 1FWZA 3GTJJ 3PNTA 1LDJA 4A0XA 5JI6A 1RKWA 2KIFA 5D5UB 2Y31A 4XKVA 1TLHB 5HDNA 1PYVA 2GOMA 1HW2A 1FOKA 1UCRA 3GLLA 1ETYA 1O3RA 1JJ6C 5DM7F 3BQZA 4PJNA 1VQ7I 3DPTA 4J00A 3BTJA 2PJPA 1BI3A 4OMYA 2W84A 5J47A 2KHMA 3RKWA 1GV2A 2P6TA 3P9IA 4NDLA 3CC2I 1GXQA 2DA7A 1IG7A 1KU3A 3K69A 3KP3A 5ICEA 4O3MA 2R5YB 3FF5A 5JVTA 1JJ8C 4BDYA 3HOYJ 2LKXA 2A5WA 2BXZA 3VB2A 3FMRA 2E7WA 3KLNA 2P8TA 3RCOA 1FT9A 4BHBA 4BY1J 3IAM2 3IHUA 1EF4A 1WJ5A 5K5RA 2QBYA 3QPLA 4YIIA 1XGSA 1I6XA 3A02A 2MW8A 3Q0UA 4RGSA 2YUSA 5M3MJ 2CYYA 1NG6A 3LQRA 5ED4A 1XTAA 3BCAA 3CMEI 2OC6A 1VQ4I 1K4SA 2KIQA 5J1RA 2MFZA 3I55I 2Z9OA 4IL6C 4DBQA 4D7NA 1RR8C 1K6OA 2OU2A 5E3MA 1SFEA 2DT5A 4CA0A 5IOYA 4I99C 2RAEA 4FE4A 2X9DA 3CP8A 4EGZA 2B0LA 3WTTC 3A01B 2LBFB 1SANA 5TJJA 3BR1A 4MHGA 2P7CB 2CS3A 2RQPA 3Q0WA 1HBXG 1MMAA 2DT7B 3DU6A 3GUDA 1MMDA 3BJAA 4CHUA 3HG9A 1P2FA 2BYVE 3QPSA 2ZJRF 3CDIA 4IRIA 2E19A 4E7KA 2P7VB 1FJLA 3EYIA 3GXOA 5AONA 3WE3A 1FSEA 2OTJI 2F5DA 4CICA 1D3YA 3ZMTA 5DUIA 2DTZA 4IQ4A 2CV1A 1B8IB 5DTDA 4BBRJ 1N75A 2GIZA 3QYBA 4RAYA 3R6SA 1PP8F 1XDSA 3OR2C 1ZHFA 2Y2ZA 1R00A 2ID3A 2K9NA 1MDMB 4RGRA 3OYDA 3FXLA 4MO7A 3RYPA 2PI0A 4HOBA 2K9QA 2BY2A 1U5TB 2NYXA 3CMMA 4RAFA 2HTJA 2RVCA 4IHSA 3OV8A 5CVRA 4KISA 2DFHA 3RPUD 2PMHA 3ZPLA 4A3DJ 2BV6A 5B3SH 2E34A 3OIOA 5CVVA 1VZ0A 1SVMA 1RPWA 1UHSA 4I0BA 3FXMA 5EDNA 2KP6A 3O3KA 4LMYA 2A69F 5F27A 1I1SA 3DBRB 3IWZA 4D9JA 1R5HA 1Z1DA 1H9TA 2KQRA 4HNUA 1J5YA 2QVOA 1H0MA 2K3FA 4KIBA 2CUJA 2FX0A 1ON1A 3RDIA 2HPMA 1ON2A 4IEJA 4GFBA 3K7AJ 4EM1A 2N8GA 1EJ9A 5LRRA 2ETHA 1JUPA 3CP2A 3QP5A 4ZC3A 2YPRA 1N25A 2ACJA 4CZZA 1Y8RB 4G6QA 1QO0D 5GPCA 2QQBA 4Y13A 4XOTA 2QWWA 2ZXIA 3LSGA 1Z7UA 1P6RA 3PUBA 3JCUC 1X19A 2X6WA 2QGUA 2XGCA 5CQEA 3HYIA 3FXOA 5FROA 2VQLA 3WE2A 5J4VA 2GWRA 1USTA 3WTSC 4JYKA 4ENNA 4KYWA 3HUGA 3PQJA 5C4JJ 2M5WA 2MSYA 3COAC 2GIVA 1VQ6I 4QPOA 4UV8A 4ZDPA 1Z9CA 1BL0A 4WXDA 2DDBA 2OPTA 2E2IJ 4Y3OA 3BG5A 2YSRA 4FCYA 3RQ4A 1T2KA 5CJ9A 3TOAA 4C2UA 4NQWA 4KA4A 4I2OA 2L5QA 1MSFC 1ZELA 3HM5A 1SVOA 2PJRB 2PX9A 3GFMA 1BIBA 4NC7A 2K27A 3TO9A 3KEQA 3OL4A 3ISPA 1BW6A 1HW5A 2K7LA 2MC4A 3IWFA 5FKNA 5TISC 2QBYB 3WTYC 2K40A 4RB1A 2QSHX 5CKTA 1ZG3A 1E3OC 4AM3A 1R58A 4XLNF 2IS4A 3GFLA 3I59B 2IA0A 3R0AA 1AKHA 1FMVA 3WTZA 3J80Z 2XRLA 1HKSA 2JN6A 3OWTA 5HODA 4YRVA 3HEFA 2M0MA 1TWCJ 5JHFA 2DYRH 3J7AO 3SZPA 5ICCA 4F93B 2KRFA 3ERMA 1VQKI 5CPRB 1A04A 2M8EA 3F23A 1H88C 4E7IA 5IT3A 2JPBA 5K5OA 2F5FA 3G4SI 3GTQJ 4U7BA 2F5VA 2F2EA 3V8JA 2Y69H 3HIFA 3FIWA 3U9GA 1DDNA 1VI0A 2R3SA 4FX4A 2K9SA 2X51A 3F8CA 1LKXA 3AL0B 3K4CA 4A3JJ 2VKDA 3R0JA 3A03A 3DEEA 1ZAOA 3E6BA 1WSUA 3DP7A 1WJAA 2JK3A 2R7TA 2CUFA 1P92A 2PQ8A 2DQLA 1ZGJA 2E7XA 2ELJA 4S0HB 1WH5A 2R7QA 1S3JA 1IW7F 4HQEA 5JR3A 3BP8A 4XK4A 3RPUA 1ZG1A 2ZXHA 5HLIA 1KU7A 4C9YA 3LSIA 3PFYA 4UY8I 1TC3C 4A3FJ 4IX7A 1USSA 1HDPA 1N77A 1IZ1A 2TDXA 3L2RA 3D5SC 2EJRA 5L3CA 1D1AA 4EV0A 4G8XA 4RBOA 4UVBA 3CMAI 4CYDA 2TCTA 4G7OF 3S16J 4Q48A 2MABA 2VBZA 1WZ2A 2R7WA 1J09A 2OV7A 3E5QA 3T5XA 2NVYJ 4E7JA 3H9QA 2XAFA 2X6OA 1U8BA 2ZBKA 5BPDA 3S3OA 5FKLA 3JR9A 3TW6A 3ZN0A 4JX5A 5FKOA 3BY6A 4IF4A 4UB8C 4UVAA 3I4NJ 1Z67A 5AIPA 1OPCA 4V2GA 3ASNH 2LOOA 3GF2A 1F36A 2Z3YA 4IZZA 3OMYA 4I09A 2QUFA 3K70D 2VC1A 1GHCA 1LVKA 1W1WE 1W5TA 3K4NA 3LWFA 4M3DA 3SEQA 5J4YA 4XLFA 4EATA 4GXOA 5IYCJ 4UV9A 3Q9VA 1Z3YA 2DA4A 1J59A 3DQVC 1W36C 3QU6A 4ON0A 3RZDJ 1R71A 1QZEA 1XGMA 3HSFA 3CO7C 3QP6A 1FP1D 4LITA 2CV2A 1ETQA 5CVJA 3S1QJ 3LL7A 4ZDLA 3VYRB 2EA2A 2J5OA 2VONA 4E70A 4YFNF 3LAJA 1GV5A 2PG4A 3LAPA 3R61A 2DMPA 2BW3B 3MKYB 1I3AA 2WAFA 2RDPA 1Z7LA 4XICA 4AUXA 3MCZA 4KT5C 2L9VA 2Y75A 2M9HA 4GO1A 2JPCA 3QRFF 1IN8A 2RKHA 1K7AA 3RKXA 2HXOA 2O5RA 1FSHA 1OJLA 3K9TA 2DA5A 1YRNB 2BY0A 5J8FA 3BZKA 3FKJA 3CF5F 4F7ZA 4HZFA 4ZYDA 3J81K 3HGYA 2LG4A 4WXCA 3SDGA 1KA8A 2RV8A 1YTYA 4RLFA 3CCJI 1T39A 4XNFA 3EUHA 4BUPA 1B9MA 3FBIB 1TWGJ 5CLSA 1R7JA 4HX7A 3BWGA 3DBHB 5F64A 4BEHA 4KIFA 1LEAA 5CVUA 2XIGA 4AWXB 1MMSA 2VUMJ 1OR7C 1V55H 2ZKZA 5LHGA 1XMKA 4EVIA 5LGUA 3HKZN 4OWRB 2X1EA 3LA2A 2E5ZA 2G0EA 2GBYA 5IYBJ 4M71A 3V7RA 2HOEA 1W7PD 1LE8B 2HQRA 1ZLKA 4OIOF 4ZZDA 3GX4X 1R4NB 3L00A 2XKPA 4Y15A 2BHZA 1ZG5A 1K4TA 3HSEA 5A2QK 2Z33A 2CV0A 2H6BA 1IDZA 2IGOA 3G6EI 5GAEJ 1MBKA 2LP0A 5L3DA 4Y17A 4L5JA 3IP4B 2W4SA 1BC7C 3BG7A 4DIQA 1BBYA 3KYCB 2XAGA 1FOYA 1YE9A 4MNUA 1T08B 2GXGA 4JP0A 3OOUA 1B72A 2O7OA 1OISA 2L4AA 5FD5A 2AO9A 5DD4A 3LA3A 2RNJA 1SVLA 4DJAA 5EJCA 3E5UA 4E7SA 2VT3A 3WHBA 2CFXA 3BPXA 5EGOB 5K5QA 3PIOF 3K2ZA 5HVQC 2HI3A 2LY9A 1IDYA 3RKYA 3C1DA 3E7LA 4FT8A 4IXAA 1KZHA 1YIJI 5TGTA 2MLGA 4N4NB 4LG3A 4U0VA 3VYSB 5K1YA 2G9WA 4PFPA 2HTSA 2DLLA 3KP7A 2VASA 3IUOA 2ME0A 3GTMJ 5AIQA 4WF2A 3GTOJ 3HSRA 1S5LC 4IKFA 3MVPA 1VF9A 5KCMA 1O7FA 3CC4I 4A3LJ 3I4MJ 3OYFA 2XPWA 2HGCA 4UVCA 4DOZA 2CW0F 4BE1A 1SD5A 5EZGA 2HDDA 2WV0A 4BXXJ 2DXIA 3BTIA 2FE3A 2CJJA 2LLKA 1NH3A 4EJWA 2EZKA 3TKYA 1B1BA 4NHJA 1UZCA 3DTIA 2V4JC 4A3GJ 2DOFA 3MFKA 1UB9A 4GYIA 5D8KB 4Z6YA 2CUZA 2DDAA 2VC0A 3CD6I 1GT0C 2CWEA 2YS9A 2FQ4A 2VKVA 3ZRGA 5J1YA 5FD6A 1VNDA 2RC4A 3TBIA 4LLGF 3N4MA 1JKPC 1XX5A 1OLTA 1FMWA 2O3FA 3GTKJ 1VQ9I 2MGQA 4MGRA 3DBLB 4CXFA 2FEZA 3BLYA 2D1HA 5CQGA 5KAIC 1P4AA 1XG1A 4NUBA 3WGHA 1YW7A 4CO8A 5F0HA 1I27A 1JKRC 3DTEA 4CGZA 4DYQA 1X3UA 3KP4A 2BY1A 2R7FA 3W6JB 1MJAA 1SFOJ 4BNCA 3LSKA 3K4JA 1GVDA 1JUSA 3LSMA 3A1YA 3C7JA 4ITVA 4KMUX 2EIMH 3VDXA 2IGNA 1KQ8A 4BEHB 2DBBA 1BR1A 2ZJ2A 3DF8A 1K78A 4XR6A 1FTZA 3IV5A 3KP2A 4ENJA 2IW5A 4MFDA 3AAFA 2LTPA 3LSHA 4BJ5C 2HVSA 3OR1C 5LHHA 1O3QA 2EFWA 4LFUA 4M3FA 1WHUA 1U5TC 5D6EA 3BTLA 1FLIA 2ECCA 5DDGA 2DI3A 4CDGA 1S29A 1E0EA 1B9NA 5ICFA 5D8LB 1D0XA 3RQIA 1RI7A 1JTYA 4A3IJ 4CH7A 2BVMA 2IJLA 3TO6A 1U3EM 3PIPF 4LG0A 1Z91A 3PSFA 5F0CA 4BE0A 3GZ6A 4M6VA 4EGYA 2IS1A 5H20A 2DCEA 3GMEA 1IC8A 2MH2A 4HPQA 2CFOA 1HW1A 2NVXJ 2X1CA 3OS0A 2NNNA 5HDGA 3BG9A 4F55A 3OIQA 4RGXA 1FC3A 1R1TA 1L0OC 3X2QH 4A3KJ 3S1NJ 3AG1H 1RZ4A 1K79A 4M3BA 3WG9A 1H9GA 3E6MA 1G3WA 3SXYA 2FQ3A 4JBAA 4NC8A 5FKMA 5C4XJ 2HDWA 1TZLA 1X1BA 4CUGA 3JRIA 3CQZJ 2DODA 4HDVA 1WGXA 4B4CA 4AC0A 3PO2J 3CCVI 4CCKA 1W0UA 1ETWA 2KRCA 4IHVA 4RS8A 2ZSHB 1SAUA 1DU6A 1MKMA 2J5PA 2EZHA 2UWMA 1D1CA 5IYDJ 3JSOA 2Y30A 1BA5A 1S7AA 4KN7X 4NB5A 5E17F 2MD5A 2A6EF 1IV8A 3BJOA 3HB9A 2R0QC 2JRMA 1JKOC 5BS6A 3TP3A 2M0CA 1KONA 5D5VB 2VE9A 4UUVA 1ZYRF 1O4XA 2CQXA 4M72A 3ROUA 1T0FA 2W48A 1W5CC 1Z3XA 4PJ0C 3ZQ7A 4FISA 3I64A 1A6QA 2BHYA 5HOOA 2FXAA 2JA7J 1BM9A 1B6AA 3ZMUA 1X3ZB 4G7ZF 1Z6TA 1HF0A 1HXDA 3HPGA 1VQLI 2H27A 3M07A 3GW2A 2XSDC 1T6SA 2P0WA 2GXBA 4B09A 2DW4A 3MMYB 1MBHA 2L7MP 4F52A 4N9HA 4BQOA 1BIAA 4DZPA 3CESA 3CUQA 3H0DA 4B3AA 5JLWA 3CLQA 3CZ6A 1IV6A 1IRZA 4A69C 4KNYA 1UMQA 2FD5A 2OQRA 3AL0C 1TT5B 1JT0A 2CQKA 1G2HA 3UNGC 2LH9A 4KDPA 3OYIA 1UG0A 3AFHA 3WHCA 3L2CA 4WX9A 1K78B 4UNOA 1BI1A 1QZZA 2HXIA 1AU7A 3W2VA 4W1UA 2QZ8A 5FO5A 3V4GA 1RESA 4UUSA 5D4SA 2ESHA 2ZO4A 4BU2A 2E36A 2E35A 4KJZA 2IEKA 4RGUA 2YU9J 4M3GA 1FYKA 4MFEA 2MD0A 4ABZA 3FK6A 2DJNA 4I0AA 4AIKA 3VPRA 1EH7A 3J7YJ 3F8NA 2EFOA 1A5JA 4GCVA 1I3QJ 1P4WA 4B43A 5HS8A 4J01A 4LG0B 1MD0A 3E97A 3MD2A 3BROA 1ETOA 4EJVA 3ABLH 1KYZA 3ZR8X 1D1BA 3L09A 4A3EJ 3VODA 1JT6A 1RC9A 3GFIA 1CQTA 4HF1A 2QSFX 1FBUA 3G1MA 2E71A 2WY7Q 1R5ID 1RUNA 3FK7A 4N4OB 3IC7A 4PJLA 2I8DA 2L9RA 2EZIA 5IT9K 2OJED 3L1PA 1OYYA 2CG4A 2ZB9A 3AG3H 3ZQIA 2E60A 3IH3A 5F08A 2Z1DA 1ZLJA 2O8KA 4L0YB 3JAMK 2VI6A 3CCEI 1YITI 4LB5A 1Q1VA 2F6CA 4ZH4F 2W7NA 3ZMDA 2HFHA 2CQNA 2KJBA 4JK1X 5H6RA 1IUFA 2GA2A 4UB6C 4O6JA 4Y7NJ 4WK8F 3S2WA 2KDZA 5EEAA 2P81A 5M5YJ 1LEBA 1QVTA 3MN2A 4M9SA 1ODDA 1FX7A 5JHUA 1S7OA 3HKZA 2R7ZJ 5F04A 5KNLA 1R5GA 1OKRA 4NNJA 4ENMA 1YYVA 1FP2A 5ICGA 2OZ6A 1GVJA 2XKOA 5KK1A 4S04A 2VT2A 1Y8QB 4L5EA 4MQVA 2EB7A 1ETVA 1LVAA 1SMTA 2K85A 3QYFA 3V8LA 1UG2A 4DQ2A 5GAGJ 3J81Z 2G7UA 2OTLI 2ID6A 2FA5A 3WODF 1YQAA 2R7OA 3F0CA 3O2PE 1ITYA 3BZ6A 1QHHD 3JRGA 1SFXA 1LUJB 3K4LA 3DFGA 4E7HA 2R7VA 4LIUA 1C0WA 4PSXA 2HVRA 3OSFA 4R1HA 2FOKA 4M9ZA 3HHGA 4IRHA 2XASA 2R4GA 3EDPA 1V54H 4E6KG 4A3BJ 2NNYA 3V7SA 5L3GA 2XAUA 5LLQA 3ASOH 2V79A 2HWVA 5LFAA 4A93J 2VBYA 5FJ8J 3R4KA 2H1LA 2JSPA 4PZJA 2P5KA 4G9YA 4HX8A 2O61A 1S6LA 5A2QZ 4XORA 5LGNA 2UUZA 5EF6A 1EH6A 4DW6A 3QQAA 1HKQA 3HZJA 2HEOA 1VQNI 3HRSA 2F5CA 1J0RA 2F48A 1TP4A 1AA7A 1FNNA 3PFIA 3K4MA 5CVIA 1DGRM 1P7JA 2IPQX 3TGNA 3K6GA 4V19K 2JZYA 2VB6A 1XD7A 4RLQA 2AS5F 2X85A 1VFCA 2K4JA 4UUSB 4AU7A 4HLYA 1VQ5I 4AYBA 2L7ZA 3LSJA 4XLPF 2WAEA 1E2XA 2DMQA 2MG4A 2CW8A 3DU5A 3M8EA 4HSTA 3F8FA 4HQMA 3F22A 3JRHA 2IA2A 4FE7A 1G59A 2DMTA 4XLEA 1ONVA 1XSDA 3GVAA 2W00A 4A3MJ 4IQJA 2H6CA 4MLOA 2EPFA 5FRMA 1PUFA 3KZZA 1IXCA 3DPLC 3SQNA 1AOYA 1IN4A 4A6EA 4PJMA 1U78A 1G4DA 2KRHA 3CMYA 1KGSA 2LK2A 3KP6A 4DNCA 4O5VA 3CCSI 3L2QA 5BPIA 2FSWA 2LRDA 2ZMEA 1QGPA 3HJEA 4LIVA 3FDYA 3JRBA 2WA0A 2R5ZA 4BQQA 2MA3A 2JT1A 3PL8A 4A3CJ 1QVUA 3ZQHA 1DUXC 2DMNA 3BT9A 1LFPA 1JGSA 4Q47A 2JRTA 3LMMA 9ANTA 3QPTA 4BGDA 2P5LC 3G2BA 4ZTFA 2KKOA 2LR8A 2M3AA 1WH7A 2FNPA 2B7EA 2XVCA 1TQIA 2HQ5A 2L01A 4NBQA 2M45A 3VWBA 2L3DA 5E1XA 4PSWA 1TTYA 1POGA 1KU9A 2F4MB 3HRUA 3D5LA 1EKEA 1Z6RA 3U1KA 4YFXF 1QRYA 4Z2YA 4L5IA 3ONQA 4XRSA 4YEJA 3KYLA 2XDVA 3QAHA 2D45A 1T38A 1BOBA 3ZQCA 2EK5A 5JLXA 4F3QA 1T98A 2LYCA 3ZP5A 3CDHA 2LFBA 3BR3A 5E1WA 2VODA 3HDDA 3VYTB 4AIHA 4HNTA 2NVQJ 4BXUA 1OCTC 3OIPA 3SFIA 2TRTA 2HDCA 3LA7A 3S17J 4CCOA 1YHQI 5IP6A 3S2DJ 2GAUA 3K10A 1NG7A 3FXQA 3I5UA 3EUHC 1F9NA 2XUBA 5HLHA 3HUGB 4Y52J 1SFUA 4D1QA 5FLVA 3BCBA 3FHNA 4YIRX 4MEYF 5D5WB 3JRFA 3W3CA 1MBEA 3L9FA 1OYWA 2RQQA 3LFUA 2CSOA 2VN2A 3T0YA 5GP9A 3K0LA 5FLXK 4AD9A 2PFBA 3CCUI 3BG6A 3EYYA 4PGHA 2E2HJ 2ZXJA 4M6YA 3OS1A 1SEUA 3E5XA 1D5YA 2V26A 4KFCA 3HTUA 4PUSA 4CZCA 4I6ZA 4ZJZA 1V5GA 2LREA 4NQWB 1FYMA 2XF7A 2D1VA 1ZGWA 1X3WB 3SJMA 1XDUA 4L9VA 2UZKA 2B63J 1HKTA 4ESBA 3UR3C 4YFKF 5K7FA 2QQAA 2XC7A 3JRCA 3HOVJ 2XAHA 2VBXA 1DP7P 3DTKA 4D5CA 2OAZA 3P9KA 3CC7I 2ISZA 1YX5A 3G1LA 2YX4A 1QQIA 2GZWA 3GTGJ 4XKCA 1MBGA 1AKHB 4WWCA 3IL2A 2JUGA 2P4WA 3Q0VA 4ASNA 2OF7A 1V5FA 2L9NA 1X1CA 2ME6A 2Q2EA 3CCRI 4PK4A 3C2GA 1WVRA 1AWCA 2EV6A 3TP0A 4PFOA 4FASD 2HOSA 2ELKA 3MZYA 4TV7A 1DQUA 3DKYA 3HPHA 4XKWA 3ZQGA 1PUFB 4XBFA 1QA6A 3CCYA 1FBSA 4ENKA 2R92J 1G3TA 2X6YA 1ZH5A 4OU0A 2FMYA 3FXUA 4P5OA 3ZOBA 1DP3A 1FTTA 2VXZA 4AVZA 3GZ5A 4IJAA 1YX3A 3K1NA 4LK0F 1YJNI 2WY8Q 2M1BA 3S1MJ 3Q5FA 1JHFA 3OYJA 4BJ6C 2JJ7A 2HVQA 2R5ZB 2K4BA 4RB3C 2F5EA 3U1DA 5B1AH 3M1EA 1JI8A 4PJJA 1HA8A 3BJ6A 3DLLF 1B59A 1VQMI 1WJEA 3ULQB 3CLOA 4C2MJ 2KMUA 1IJWC 1F4KA 2ECBA 1BI2A 1IGNA 1F43A 3ZMZA 3ZGKA 3CTAA 4ZZLA 3ABKH 4H0EA 3I71A 1I5ZA 1SFKA 1BJAA 1I6HJ 2VQHA 2XGXA 2A05A 3HC7A 2QKLB 5BMZA 5DYMA 2D5VA 3DKXA 4DBRA 2EV0A 2LKPA 2WAQN 3ABTA 1S72I 3P5JA 1ZREA 1FPQA 4L9JA 2CMPA 1NK2P 2Y0SA 5FFZA 4XONA 4XKBA 3DV8A 4ZYHA 4HDUA 1GUUA 2M34A 1YLFA 4BHCA 1XMAA 4CCMA 3S3MA 3TQNA 1Y56A 3ZQLA 1V3FA 1A31A 4B1RA 2RREA 2FOWA 3RJPA 3T8RA 1J75A 4AYBN 1VQ8I 2A5YB 2K9LA 3I53A 4S05A 1RETA 1TNTA 3KP5A 2H09A 1KQ0A 5HDKA 1SAXA 3FMQA 1Y6IA 2XF5A 1QNTA 3KIOA 4KT6A 5IP7J 5KHDA 2QQ9A 5J1UA 1RRJA 1AHDP 3ML6A 2FBIA 5EG0A 2FBKA 2L0KA 2VLAA 1ETKA 3SFZA 3ABMH 2HQAA 5B66C 1OQYA 4I76A 1ZR2A 2OUMA 4PCQA 1ZTRA 2FU4A 1YJ9I 2MYSA 4HLXA 2E1MC 3I58A 2R7XA 5L3BA 1QZYA 1WJBA 1MIJA 3HBLA 1QBJA 2W24A 1HSTA 2Q8KA 1A35A 2KIUA 5D6FA 1OYIA 2LKSA 3R60A 2LF7A 2HQNA 3RTRA 5D4RA 3I0TA 3TO7A 4LOCA 5CYVA 1F1ZA 5IT9Z 2Y9YA 4N0BA 1OCRH 2ZXWH 1Y39A 1D0ZA 2A6TA 3FWEA 4K2EA 2WB1N 4OIQF 2CUEA 4XLCA 2V6CA 3JAMZ 5E79C 4KITB 2ICWG 3WU0A 4HNVA 1OCCH 1ZR4A 4IHXA 1W7PA 2PN6A 4JX6A 2JMWA 3HOWJ 1IN6A 4C2TA 2I5UA 5ILSA 2Q2EB 3K1PA 3S32A 4OIRF 4ESJA 3QOPA 5H6QA 1ZKGA 1WJFA 4BJTA 3D5RC 4IVNA 1U6GA 2JUCA 3MEXA 3EQLF 2B9SA 3A0HC 1X58A 1XSVA 2R5YA 1IO2A 4HYEA 1YS7A 2VKHA 2C6YA 1UAAA 4AIJA 4FETA 2VJ5A 3PM1A 1JXSA 4EJUA 4XQFA 3HOXJ 4L18B 4BQNA 4CCLA 1YW9A 5M3FJ 4W97A 4D0PA 3BR2A 3RIRA 2M2EA 1OFCX 3JREA 3BZCA 2CU7A 2FMLA 2XV4S 1OCPA 1VQOI 3FKIJ 3S14J 2L4MA 4RB2C 2K02A 4G6DA 2XHKA 2VJJA 3MQ0A 4C30A 5C3EJ 1B72B 2H94A 1O3SA 3F8MA 1HOMA 2JTVA 2V9PA 5L3FA 1MSEC 3SYTA 1BR2A 2LF8A 3B6CA 3U2RA 1MMNA 2IRFG 1EV7A 4E7LA 3TOBA 3DEWA 5DCMA 2GM4A 2QSGX 1SD4A 2DA3A 2R93J 4B8XA 1T0FC 1OCZH 1FOWA 3SDBA 3OYHA 2XRNA 3KFWX 2WTEA 2PMZA 1R36A 1YJWI 3GFJA 4BE2A 1XSXA 2FRHA 1ENHA 3WTWC 5HS7A 4OOIA 4HW0A 5E3NA 4ANJA 3WGIA 1BC8C 4QPQA 2AHQA 1IN7A 1MNMC
chains in the Genus database with same CATH topology
2KDZA 5EEAA 2P81A 5M5YJ 4RBOA 3LOCA 3K2AA 1QVTA 5C44J 1ZQ3P 2TCTA 5J3LA 3MN2A 3S16J 2XPUA 2R7ZJ 5F04A 1RR7A 2NVYJ 2EBIA 4DYCA 2E2JJ 2QF7A 2X6OA 1U8BA 2JWTA 4L5EA 5FKLA 1ETVA 3JR9A 2WV1A 3TW6A 1UG2A 4JX5A 5FKOA 5M5XJ 2CRGA 3I4NJ 2ID6A 3BR6A 4FTHA 2NS8A 4IHYA 4V2GA 3F0CA 1ITYA 1DU0A 4G12A 3JRGA 1F36A 3LNQA 3GBGA 4M3DA 3IH2A 4QIWN 2H8RA 3OSFA 1X2NA 2EZLA 5IYCJ 1FIPA 3UKGA 2NS7A 4A3BJ 2QCOA 4V2FA 2DA4A 1LFUP 1FIAA 3RZDJ 3TEDA 4C3HJ 3BTCA 3PO3J 2L7FP 4A93J 5FJ8J 1XC5A 1ETQA 3DCFA 3HOUJ 2JA8J 3S1QJ 1W0TA 5K7ZA 1A6IA 4BBSJ 3H0GJ 1ETXA 1GV5A 4DYRA 5EF6A 2JA5J 1P7IA 2DMPA 1Y1VJ 3OSGA 4DW6A 1JKQC 3QQAA 1HDDC 4XICA 4AUXA 2O9LA 2M9HA 3HGGA 3BG3A 2HXOA 1OJLA 2DA5A 1YRNB 3Q3SA 4C3JJ 2IBDA 1XS9A 2HYJA 4MIMA 1P7JA 3S1RJ 2Y0SN 5E3OA 3HGYA 3SDGA 5F0FA 1VFCA 4UUSB 4EEFG 1TWGJ 1BW5A 2L7ZA 2XB5A 3LSJA 2VUMJ 3TW7A 2MG4A 2DMQA 3HKZN 1APLC 3JRHA 1X2MA 2G0EA 2GBYA 4FE7A 2DMTA 2CQQA 5IYBJ 5BNGA 3D1NI 2COBA 4A3MJ 3LSRA 4MLOA 5IOZA 1PUFA 1LE8B 1MH4A 3BR0A 1H89C 2KT0A 1U78A 3CMYA 3A01A 2LK2A 1IDZA 4CYCA 1MBKA 4QTRA 2LP0A 2FJ1A 3JRBA 2R5ZA 5DS9A 4A3CJ 1QVUA 3ZQHA 2DMNA 3BT9A 2I10A 4JP0A 1T33A 3OOUA 9ANTA 1B72A 2O7OA 1GDTA 2JA6J 2LVSA 1Z0XA 1I50J 2LR8A 2AO9A 1WH7A 1B8IA 3B6AA 2DA1A 1TWAJ 2HQ5A 1POGA 3WHBA 5EGOB 5FKKA 2HI3A 2LY9A 1IDYA 3E7LA 1HLVA 3MKLA 1QRYA 4XRSA 1RKTA 3BR5A 4RDUA 4XRSG 3ZQCA 5JLXA 3O8GA 2ME0A 2LFBA 3GTMJ 3BR3A 3GTLJ 1WI3A 1ORKA 3GTOJ 3JRDA 1U9OA 3MVPA 3HDDA 4X1EA 1VF9A 4M3EA 2NVQJ 4XIDA 1OCTC 1NK3P 3I4MJ 4A3LJ 2XPWA 5EZHA 1NTCA 2TRTA 3SFIA 4IHWA 3GTPJ 1JUMA 3S17J 4D7MA 5IP6A 3S2DJ 4BY7J 2NOGA 1JTXA 5EG0B 5EZGA 2HDDA 4BXXJ 3BTIA 2CJJA 2LLKA 2EZKA 3M4OJ 4Y52J 5FLVA 4A3GJ 1FEXA 1MBJA 3JRFA 1MBEA 2VPRA 3NARA 5GP9A 5M5WJ 3IH4A 1GT0C 2XGEA 2FQ4A 2VKVA 2YS9A 5J1YA 2E2HJ 3GTJJ 1VNDA 5EYRA 1JKPC 1D5YA 1RKWA 2Y31A 4I6ZA 3GTKJ 2MGQA 1ZGWA 5FLMJ 3SJMA 2B63J 1XG1A 5K7FA 1ETYA 1JJ6C 3BQZA 5F0HA 3JRCA 3HOVJ 3BTJA 1JKRC 4D5CA 4DYQA 2PMZN 1SFOJ 3FISA 1GV2A 4NDLA 1WPKA 3G1LA 1GVDA 2DA7A 1JUSA 1IG7A 3GTGJ 1R9TJ 1MBGA 2R5YB 1AKHB 2IAIA 1JJ8C 3HOYJ 3Q0VA 2LKXA 2OF7A 1YRNA 4BY1J 1EF4A 2ME6A 3QPLA 1FTZA 3A02A 2MW8A 3Q0UA 3IV5A 2YUSA 5M3MJ 4MFDA 2LTPA 3TP0A 2HOSA 2ELKA 5GPAA 1PUFB 3ZQGA 2EQRA 5J1RA 3CCYA 4M3FA 4D7NA 2R92J 3BTLA 5E3MA 1FTTA 3ZOBA 2ECCA 5IOYA 2RAEA 4FE4A 2X9DA 2LD5A 3RKQA 3A01B 1SANA 3BR1A 3RQIA 1JTYA 4CYCB 4A3IJ 3Q0WA 3S1MJ 2DA6A 4Y7NJ 2JJ7A 3S2HJ 1TWFJ 5F0CA 2R5ZB 1LE8A 3QPSA 4M6VA 2E19A 1K61A 4UUTA 1FJLA 1IC8A 4C2MJ 1IJWC 2ECBA 2NVXJ 1IGNA 1F43A 2M8GX 1QPIA 2DTZA 3BG9A 3O8HA 1B8IB 2X48A 5DTDA 4BBRJ 1H8AC 2GLOA 4A3KJ 1I6HJ 3S1NJ 4X6AJ 2Y2ZA 2K9NA 2ID3A 2D5VA 1T56A 4M3BA 2WAQN 3CDLA 4MO7A 2K9QA 2VKEA 4JX4A 5FKMA 4QSHA 5C4XJ 3JRIA 1JGGA 1NK2P 3CQZJ 1WGXA 4A3DJ 4B4CA 4AC0A 3PO2J 1W0UA 1ETWA 3OIOA 1GUUA 2M34A 4IHVA 1RPWA 1UHSA 5EDNA 5EGOA 1DU6A 3W6VA 5F27A 3ZQLA 1BJZA 2EZHA 4B1RA 5IYDJ 2Y30A 1BA5A 4AYBN 2FX0A 1MBFA 3HB9A 2R0QC 1JKOC 3TP3A 4IEJA 2M0CA 4GFBA 1MH3A 2DN0A 1RETA 3K7AJ 3S15J 2N8GA 4XRMA 1LFBA 1JUPA 2EH3A 1O4XA 5IP7J 4J19A 2CQXA 3M3YJ 2W48A 2HOAA 5GPCA 1HCRA 5J1UA 2XB0X 3LSGA 1AHDP 4FISA 2JA7J 5EG0A 2XGCA 2L0KA 3BQYA 1ETKA 1HF0A 4JYKA 2Y9ZA 4D5FA 5C4JJ 1ZR2A 4I76A 2XSDC 2MSYA 1ZTRA 1MBHA 2L7MP 2XGDA 4C3IJ 2HOTA 4DZPA 1WCMJ 3HBLA 1BL0A 2OPTA 2E2IJ 4B3AA 5IP9J 4LOCA 1TWHJ 5JLWA 3BG5A 4FCYA 2Y9YA 2E1OA 1IV6A 1IRZA 1U9NA 4A69C 1UMQA 2FD5A 2WB1N 1JT0A 1G2HA 2CUEA 1MSFC 3HM5A 3C2BA 4HNVA 3NAUA 1ZR4A 4IHXA 3WHCA 4JX6A 2JMWA 3HOWJ 1BW6A 5FKNA 1AU7A 2HXIA 2K40A 4BKXA 4W1UA 1E3OC 1ZKGA 5E3LA 1S7EA 1RESA 4UUSA 2DMUA 1X58A 1AKHA 2R5YA 3ZQFA 2IEKA 2XRLA 2YU9J 4M3GA 2JN6A 4MFEA 5HODA 3HEFA 3PM1A 4ABZA 1TWCJ 5K7HA 3FK6A 2DJNA 1ZK8A 3JRAA 3HOXJ 3VPRA 5M3FJ 4W97A 3HOZJ 1H88C 3BR2A 2M2EA 1OFCX 3GTQJ 3JREA 1A5JA 2CU7A 1I3QJ 2DA2A 3FIWA 1OCPA 1VI0A 3FKIJ 3S14J 2K9SA 1ETOA 5C3EJ 1B72B 4A3JJ 3H3VK 4A3EJ 3RZOJ 1HOMA 1JT6A 5F1JA 3A03A 1CQTA 3G1OA 1MSEC 2NVTJ 3G1MA 2JK3A 1Z77A 2H1KA 3FK7A 2CUFA 3B6CA 4DZJA 2L9RA 2EZIA 4S0HB 3L1PA 1WH5A 5IPAA 2ZB9A 3ZQIA 3IH3A 3DEWA 5F08A 2GM4A 2DA3A 2O8KA 4XK4A 2R93J 2VI6A 1Q1VA 1K83J 1ENHA 4A3FJ 1Y1WJ 1TC3C 3LSPA 1HDPA 5E3NA 2XPVA 2AHQA 1IUFA 1MNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDZ A;  5EEA A;  2P81 A;  5M5Y J;  4RBO A;  3LOC A;  3K2A A;  1QVT A;  5C44 J;  1ZQ3 P;  2TCT A;  5J3L A;  3MN2 A;  3S16 J;  2XPU A;  2R7Z J;  5F04 A;  1RR7 A;  2NVY J;  2EBI A;  4DYC A;  2E2J J;  2QF7 A;  2X6O A;  1U8B A;  2JWT A;  4L5E A;  5FKL A;  1ETV A;  3JR9 A;  2WV1 A;  3TW6 A;  1UG2 A;  4JX5 A;  5FKO A;  5M5X J;  2CRG A;  3I4N J;  2ID6 A;  3BR6 A;  4FTH A;  2NS8 A;  4IHY A;  4V2G A;  3F0C A;  1ITY A;  1DU0 A;  4G12 A;  3JRG A;  1F36 A;  3LNQ A;  3GBG A;  4M3D A;  3IH2 A;  4QIW N;  2H8R A;  3OSF A;  1X2N A;  2EZL A;  5IYC J;  1FIP A;  3UKG A;  2NS7 A;  4A3B J;  2QCO A;  4V2F A;  2DA4 A;  1LFU P;  1FIA A;  3RZD J;  3TED A;  4C3H J;  3BTC A;  3PO3 J;  2L7F P;  4A93 J;  5FJ8 J;  1XC5 A;  1ETQ A;  3DCF A;  3HOU J;  2JA8 J;  3S1Q J;  1W0T A;  5K7Z A;  1A6I A;  4BBS J;  3H0G J;  1ETX A;  1GV5 A;  4DYR A;  5EF6 A;  2JA5 J;  1P7I A;  2DMP A;  1Y1V J;  3OSG A;  4DW6 A;  1JKQ C;  3QQA A;  1HDD C;  4XIC A;  4AUX A;  2O9L A;  2M9H A;  3HGG A;  3BG3 A;  2HXO A;  1OJL A;  2DA5 A;  1YRN B;  3Q3S A;  4C3J J;  2IBD A;  1XS9 A;  2HYJ A;  4MIM A;  1P7J A;  3S1R J;  2Y0S N;  5E3O A;  3HGY A;  3SDG A;  5F0F A;  1VFC A;  4UUS B;  4EEF G;  1TWG J;  1BW5 A;  2L7Z A;  2XB5 A;  3LSJ A;  2VUM J;  3TW7 A;  2MG4 A;  2DMQ A;  3HKZ N;  1APL C;  3JRH A;  1X2M A;  2G0E A;  2GBY A;  4FE7 A;  2DMT A;  2CQQ A;  5IYB J;  5BNG A;  3D1N I;  2COB A;  4A3M J;  3LSR A;  4MLO A;  5IOZ A;  1PUF A;  1LE8 B;  1MH4 A;  3BR0 A;  1H89 C;  2KT0 A;  1U78 A;  3CMY A;  3A01 A;  2LK2 A;  1IDZ A;  4CYC A;  1MBK A;  4QTR A;  2LP0 A;  2FJ1 A;  3JRB A;  2R5Z A;  5DS9 A;  4A3C J;  1QVU A;  3ZQH A;  2DMN A;  3BT9 A;  2I10 A;  4JP0 A;  1T33 A;  3OOU A;  9ANT A;  1B72 A;  2O7O A;  1GDT A;  2JA6 J;  2LVS A;  1Z0X A;  1I50 J;  2LR8 A;  2AO9 A;  1WH7 A;  1B8I A;  3B6A A;  2DA1 A;  1TWA J;  2HQ5 A;  1POG A;  3WHB A;  5EGO B;  5FKK A;  2HI3 A;  2LY9 A;  1IDY A;  3E7L A;  1HLV A;  3MKL A;  1QRY A;  4XRS A;  1RKT A;  3BR5 A;  4RDU A;  4XRS G;  3ZQC A;  5JLX A;  3O8G A;  2ME0 A;  2LFB A;  3GTM J;  3BR3 A;  3GTL J;  1WI3 A;  1ORK A;  3GTO J;  3JRD A;  1U9O A;  3MVP A;  3HDD A;  4X1E A;  1VF9 A;  4M3E A;  2NVQ J;  4XID A;  1OCT C;  1NK3 P;  3I4M J;  4A3L J;  2XPW A;  5EZH A;  1NTC A;  2TRT A;  3SFI A;  4IHW A;  3GTP J;  1JUM A;  3S17 J;  4D7M A;  5IP6 A;  3S2D J;  4BY7 J;  2NOG A;  1JTX A;  5EG0 B;  5EZG A;  2HDD A;  4BXX J;  3BTI A;  2CJJ A;  2LLK A;  2EZK A;  3M4O J;  4Y52 J;  5FLV A;  4A3G J;  1FEX A;  1MBJ A;  3JRF A;  1MBE A;  2VPR A;  3NAR A;  5GP9 A;  5M5W J;  3IH4 A;  1GT0 C;  2XGE A;  2FQ4 A;  2VKV A;  2YS9 A;  5J1Y A;  2E2H J;  3GTJ J;  1VND A;  5EYR A;  1JKP C;  1D5Y A;  1RKW A;  2Y31 A;  4I6Z A;  3GTK J;  2MGQ A;  1ZGW A;  5FLM J;  3SJM A;  2B63 J;  1XG1 A;  5K7F A;  1ETY A;  1JJ6 C;  3BQZ A;  5F0H A;  3JRC A;  3HOV J;  3BTJ A;  1JKR C;  4D5C A;  4DYQ A;  2PMZ N;  1SFO J;  3FIS A;  1GV2 A;  4NDL A;  1WPK A;  3G1L A;  1GVD A;  2DA7 A;  1JUS A;  1IG7 A;  3GTG J;  1R9T J;  1MBG A;  2R5Y B;  1AKH B;  2IAI A;  1JJ8 C;  3HOY J;  3Q0V A;  2LKX A;  2OF7 A;  1YRN A;  4BY1 J;  1EF4 A;  2ME6 A;  3QPL A;  1FTZ A;  3A02 A;  2MW8 A;  3Q0U A;  3IV5 A;  2YUS A;  5M3M J;  4MFD A;  2LTP A;  3TP0 A;  2HOS A;  2ELK A;  5GPA A;  1PUF B;  3ZQG A;  2EQR A;  5J1R A;  3CCY A;  4M3F A;  4D7N A;  2R92 J;  3BTL A;  5E3M A;  1FTT A;  3ZOB A;  2ECC A;  5IOY A;  2RAE A;  4FE4 A;  2X9D A;  2LD5 A;  3RKQ A;  3A01 B;  1SAN A;  3BR1 A;  3RQI A;  1JTY A;  4CYC B;  4A3I J;  3Q0W A;  3S1M J;  2DA6 A;  4Y7N J;  2JJ7 A;  3S2H J;  1TWF J;  5F0C A;  2R5Z B;  1LE8 A;  3QPS A;  4M6V A;  2E19 A;  1K61 A;  4UUT A;  1FJL A;  1IC8 A;  4C2M J;  1IJW C;  2ECB A;  2NVX J;  1IGN A;  1F43 A;  2M8G X;  1QPI A;  2DTZ A;  3BG9 A;  3O8H A;  1B8I B;  2X48 A;  5DTD A;  4BBR J;  1H8A C;  2GLO A;  4A3K J;  1I6H J;  3S1N J;  4X6A J;  2Y2Z A;  2K9N A;  2ID3 A;  2D5V A;  1T56 A;  4M3B A;  2WAQ N;  3CDL A;  4MO7 A;  2K9Q A;  2VKE A;  4JX4 A;  5FKM A;  4QSH A;  5C4X J;  3JRI A;  1JGG A;  1NK2 P;  3CQZ J;  1WGX A;  4A3D J;  4B4C A;  4AC0 A;  3PO2 J;  1W0U A;  1ETW A;  3OIO A;  1GUU A;  2M34 A;  4IHV A;  1RPW A;  1UHS A;  5EDN A;  5EGO A;  1DU6 A;  3W6V A;  5F27 A;  3ZQL A;  1BJZ A;  2EZH A;  4B1R A;  5IYD J;  2Y30 A;  1BA5 A;  4AYB N;  2FX0 A;  1MBF A;  3HB9 A;  2R0Q C;  1JKO C;  3TP3 A;  4IEJ A;  2M0C A;  4GFB A;  1MH3 A;  2DN0 A;  1RET A;  3K7A J;  3S15 J;  2N8G A;  4XRM A;  1LFB A;  1JUP A;  2EH3 A;  1O4X A;  5IP7 J;  4J19 A;  2CQX A;  3M3Y J;  2W48 A;  2HOA A;  5GPC A;  1HCR A;  5J1U A;  2XB0 X;  3LSG A;  1AHD P;  4FIS A;  2JA7 J;  5EG0 A;  2XGC A;  2L0K A;  3BQY A;  1ETK A;  1HF0 A;  4JYK A;  2Y9Z A;  4D5F A;  5C4J J;  1ZR2 A;  4I76 A;  2XSD C;  2MSY A;  1ZTR A;  1MBH A;  2L7M P;  2XGD A;  4C3I J;  2HOT A;  4DZP A;  1WCM J;  3HBL A;  1BL0 A;  2OPT A;  2E2I J;  4B3A A;  5IP9 J;  4LOC A;  1TWH J;  5JLW A;  3BG5 A;  4FCY A;  2Y9Y A;  2E1O A;  1IV6 A;  1IRZ A;  1U9N A;  4A69 C;  1UMQ A;  2FD5 A;  2WB1 N;  1JT0 A;  1G2H A;  2CUE A;  1MSF C;  3HM5 A;  3C2B A;  4HNV A;  3NAU A;  1ZR4 A;  4IHX A;  3WHC A;  4JX6 A;  2JMW A;  3HOW J;  1BW6 A;  5FKN A;  1AU7 A;  2HXI A;  2K40 A;  4BKX A;  4W1U A;  1E3O C;  1ZKG A;  5E3L A;  1S7E A;  1RES A;  4UUS A;  2DMU A;  1X58 A;  1AKH A;  2R5Y A;  3ZQF A;  2IEK A;  2XRL A;  2YU9 J;  4M3G A;  2JN6 A;  4MFE A;  5HOD A;  3HEF A;  3PM1 A;  4ABZ A;  1TWC J;  5K7H A;  3FK6 A;  2DJN A;  1ZK8 A;  3JRA A;  3HOX J;  3VPR A;  5M3F J;  4W97 A;  3HOZ J;  1H88 C;  3BR2 A;  2M2E A;  1OFC X;  3GTQ J;  3JRE A;  1A5J A;  2CU7 A;  1I3Q J;  2DA2 A;  3FIW A;  1OCP A;  1VI0 A;  3FKI J;  3S14 J;  2K9S A;  1ETO A;  5C3E J;  1B72 B;  4A3J J;  3H3V K;  4A3E J;  3RZO J;  1HOM A;  1JT6 A;  5F1J A;  3A03 A;  1CQT A;  3G1O A;  1MSE C;  2NVT J;  3G1M A;  2JK3 A;  1Z77 A;  2H1K A;  3FK7 A;  2CUF A;  3B6C A;  4DZJ A;  2L9R A;  2EZI A;  4S0H B;  3L1P A;  1WH5 A;  5IPA A;  2ZB9 A;  3ZQI A;  3IH3 A;  3DEW A;  5F08 A;  2GM4 A;  2DA3 A;  2O8K A;  4XK4 A;  2R93 J;  2VI6 A;  1Q1V A;  1K83 J;  1ENH A;  4A3F J;  1Y1W J;  1TC3 C;  3LSP A;  1HDP A;  5E3N A;  2XPV A;  2AHQ A;  1IUF A;  1MNM C; 
#chains in the Genus database with same CATH topology
 1D8K A;  4JOM A;  2HZD A;  2JVG A;  4II3 A;  4GYG A;  2EA4 A;  3LOC A;  3S8P A;  1ZQ3 P;  3GEZ A;  1HC8 A;  3JSP A;  3H92 A;  5DV5 A;  4UHT A;  2XPU A;  2DAO A;  3PNV A;  1RR7 A;  3CUQ C;  4DYC A;  4P55 A;  2E2J J;  3ELK A;  2QF7 A;  3OY9 A;  3MKZ A;  2O8X A;  1ACI A;  4HG2 A;  2WV1 A;  5DD8 A;  5M5X J;  2P6S A;  2BEO A;  1ULY A;  3BR6 A;  3KE2 A;  4FTH A;  1XMX A;  4BDZ A;  2NS8 A;  1MW7 A;  3E6D A;  3OOP A;  4BH9 A;  4G12 A;  4WXH A;  4XN3 A;  1T95 A;  2WC2 A;  2IT0 A;  3WTU C;  3LNQ A;  2PLY A;  1HSJ A;  3C18 A;  2DK8 A;  1PP7 U;  2BZT A;  2M7B A;  4EMS A;  1IRX A;  3MZH A;  1PVE A;  5E18 F;  1X2N A;  1W4M A;  2EZL A;  2L54 A;  3GYH X;  4MQ9 F;  3UKG A;  1FIP A;  4LLN A;  2NS7 A;  3W6K B;  2QCO A;  2MLK A;  4M73 A;  1ZN2 A;  2DQR A;  2V1N A;  4G94 A;  2UV1 A;  3E0J B;  1YFH A;  4I98 B;  3TED A;  4OIN F;  2MBF A;  3BTC A;  2M7A A;  3PO3 J;  5F1R A;  4M6X A;  1XC5 A;  2NXN B;  3HOU J;  2JA8 J;  1W0T A;  5K7Z A;  2QEN A;  2LSO A;  1A6I A;  3OYG A;  4BBS J;  1Y0N A;  3H0G J;  1LPQ A;  2HZT A;  2L9S A;  4DYR A;  4MEX F;  2JA5 J;  1TBX A;  1P7I A;  2KIS A;  3I56 I;  2IS2 A;  1JKQ C;  2QKM B;  2AXT C;  3O6B B;  4LK1 F;  3SZT A;  1HDD C;  4XSZ F;  2Z2S B;  5BOX A;  2BY3 A;  1G6N A;  3HGG A;  4M9X A;  2X1D A;  3KZI C;  1W7P B;  4U87 A;  1D0Y A;  1XS9 A;  3HOS A;  2MC3 A;  4MIM A;  3S1R J;  1LB2 A;  5D5X B;  2Y0S N;  4CCJ A;  3F6O A;  4ETS A;  5E3O A;  3U21 A;  4X0G A;  5F0F A;  2JA2 A;  3OYE A;  2EIL H;  2UXX A;  3ZN1 A;  3C2H A;  4XN0 A;  2DK5 A;  3HRM A;  1ZAR A;  5GTI C;  2VOO A;  1ZRC A;  4LB6 B;  5BQT A;  4EEF G;  1WWX A;  2RNG A;  3SEZ A;  3KZY A;  2XB5 A;  1BW5 A;  4BAC A;  2KLO A;  4Y33 A;  4N9I A;  2PJR A;  3J7Z I;  5KVR A;  2YR2 A;  4E4H A;  1I39 A;  2E1M B;  2W85 A;  3A4C A;  2AXL A;  2HKX A;  1X2M A;  3M1C A;  5BNG A;  2BXY A;  2COB A;  3L2V A;  1P9Q C;  2E1N A;  3I59 A;  3BR0 A;  2HKO A;  3OYM A;  3AG2 H;  3OYK A;  3I3L A;  3ERE D;  2W1O A;  1H89 C;  3N97 A;  1UEL B;  2ZFU A;  3G3Z A;  3FZV A;  2ZJQ F;  1VQP I;  4P96 A;  4CYC A;  3CUO A;  4QTR A;  1BN5 A;  1R1V A;  3A2K A;  3TDZ C;  1R49 A;  1YIO A;  3IKV A;  2CQ7 A;  1B4A A;  2IS6 A;  3AKZ A;  1U0J A;  5DCM B;  1R4M B;  1WI9 A;  2O03 A;  1T33 A;  4BAY A;  4HV6 A;  2OZU A;  2F4O B;  3OYC A;  1GDT A;  2DFE A;  3RYR A;  4P9F A;  2LVS A;  3HRT A;  5FLX Z;  3BOQ A;  2L7K A;  2IP2 A;  4OAZ A;  2DOE A;  3ZQQ A;  2W82 A;  3I4P A;  3GCM A;  3SHF A;  2GOX B;  3KEO A;  3MWM A;  5LEK A;  1OCO H;  1IAW A;  1EA3 A;  5JVG F;  1S9H A;  1HLV A;  5DM6 F;  3MKL A;  1JHH A;  4EM0 B;  2CGP A;  2NRA C;  3M7G A;  1RKT A;  4RDU A;  4XRS G;  3H5A A;  3O8G A;  4PGG A;  5HLG A;  3N05 A;  2JQ7 A;  1Z05 A;  4IHT A;  1YG2 A;  2PMU A;  2VJ4 A;  1U9O A;  2W57 A;  2ELH A;  4X1E A;  4II2 A;  2A61 A;  1IRF A;  3ECH A;  3V8K A;  4P9U A;  3WU1 B;  1NK3 P;  1IRG A;  1U8R A;  1NTC A;  1EH8 A;  4JQF A;  4RM2 A;  5LBQ A;  1WQ2 A;  3OYA A;  4IHW A;  1JUM A;  4D7M A;  3G71 I;  2EIJ H;  3FXR A;  3NEU A;  4BY7 J;  3CCM I;  4EQQ A;  4ZYA A;  4A0Y A;  1JE8 A;  3TDU C;  3ZMV A;  5KAF C;  2UXN A;  1SD7 A;  3I54 A;  4A5M A;  5GAH J;  3Q9S A;  3K4B A;  2X4H A;  3M4O J;  2DFI A;  3FXJ A;  1FEX A;  3S3N A;  3MKW B;  1R23 A;  3ECO A;  2D2W A;  2VPR A;  1S8N A;  2WWY A;  2R7R A;  3NAR A;  5M5W J;  3H5R A;  2CW7 A;  1XN7 A;  3CUQ B;  2IGM A;  5DUK A;  3RSN A;  2XGE A;  1TT0 A;  4HV5 A;  4L9T A;  4OAY A;  3OYB A;  1STZ A;  2WAQ A;  5EYR A;  5LHI A;  4BQA A;  1XCV A;  2GXA A;  2ISY A;  3RPQ A;  5FB2 A;  4KN4 X;  2Z99 A;  2OBP A;  3JW4 A;  2V6E A;  2COM A;  3QU3 A;  4HF0 A;  5FLM J;  2KPM A;  2KJC A;  1ZGA A;  4B47 A;  1K6Y A;  2ZME C;  2QYO A;  1TQM A;  2FUG 2;  2PBI A;  2CO5 A;  3H5N A;  2PMZ N;  2QM3 A;  1FOX A;  1BR4 A;  2KL4 A;  2LMD A;  2MH9 A;  4BS9 A;  1KYW A;  3B02 A;  3F72 A;  2BW3 A;  3FIS A;  4ZYG A;  2XAQ A;  3KEY A;  1WPK A;  1X4O A;  4QLC U;  1V5E A;  1I1G A;  1YW8 A;  1R9T J;  4B48 A;  2IAI A;  4R8H A;  5LRS A;  1E17 A;  2DPD A;  2NS0 A;  5J8C A;  3NWS A;  1YRN A;  2EIN H;  5EEH A;  2HS5 A;  4H4K C;  2STT A;  3H9J A;  2ZNZ A;  2RN7 A;  1IXS B;  5GPA A;  3CCL I;  4RA2 A;  4P1W A;  2FF4 A;  2EQR A;  3I9V 2;  2E5N A;  1GLN A;  3P9C A;  3CF2 A;  4KIC A;  3G73 A;  4U0Y A;  5GTH C;  2LD5 A;  3LQQ A;  2AQE A;  3RKQ A;  2VE8 A;  3NRV A;  4CYC B;  3F3X A;  1W36 D;  2STW A;  2DU9 A;  2DT6 A;  4L0Z B;  2DA6 A;  2ZJP F;  1MJB A;  3S2H J;  4FQG A;  3GWZ A;  1TWF J;  2LNB A;  1WKM A;  1LE8 A;  3VEP A;  3H35 A;  1K61 A;  4UXN A;  3C3W A;  4UUT A;  1LNW A;  1PDN C;  3GLX A;  1LDD A;  4ZDO A;  1XCB A;  4F92 B;  1CF7 A;  2M8G X;  1QPI A;  4OMZ A;  5GAD J;  3O8H A;  3HOT A;  1P4X A;  2X48 A;  1H8A C;  2GLO A;  2WB1 A;  1O57 A;  2OCC H;  4B3X A;  4X6A J;  3P7N A;  2KDO A;  1YS6 A;  1T56 A;  2ZC2 A;  2XRO A;  1DGW Y;  3CDL A;  1X4P A;  2VKE A;  2VQC A;  5LEJ A;  3OYL A;  4JX4 A;  1O3T A;  4XOP A;  4QSH A;  3BC8 A;  1ZRD A;  1JGG A;  3ZMS A;  1DPU A;  3L2U A;  3LST A;  3IRQ A;  1KU2 A;  2IA1 A;  4G6T B;  3T1B A;  5LGT A;  4U88 A;  3ZXS A;  1QU3 A;  5EGO A;  3IRR A;  5HS9 A;  3T8T A;  1FY7 A;  3W6V A;  1BJZ A;  2KFD A;  2FBH A;  2HPI A;  2X6X A;  3DKW A;  2NOJ B;  3WTV C;  2DO7 A;  3L2W A;  3ESW B;  2HYG D;  3VFZ A;  4IO9 F;  4PDK A;  2OCE A;  1MBF A;  5ILV A;  4BL0 B;  1MH3 A;  4A5N A;  2DN0 A;  2VBW A;  4HF2 A;  4KUM A;  3S15 J;  2VXD A;  2OD5 A;  4XRM A;  4IOA F;  3V42 A;  1LFB A;  1PUE E;  1SD6 A;  1MMG A;  1T8I A;  2CH0 A;  4XLA A;  2EH3 A;  2V9V A;  4I01 A;  2HNH A;  1R1U A;  4GDF A;  4J19 A;  3M3Y J;  3IKT A;  1TNS A;  1HCR A;  2HOA A;  4XSX F;  2XB0 X;  1R6R A;  2DYS H;  3FM5 A;  4LJZ F;  4Y4R A;  2DTR A;  4LD5 A;  3H3Z A;  2G7H A;  3BQY A;  5E8I A;  3JTG A;  1G3Y A;  2EFQ A;  2Z5U A;  5B5E C;  2ZFW A;  1UFM A;  4D5F A;  2Y9Z A;  2V1D A;  5EEG A;  4DGW B;  3AG4 H;  4EJO A;  2XGD A;  4C3I J;  1D5V A;  2BVL A;  3ZCO A;  3F8B A;  2HOT A;  1O7L A;  2VPL A;  1WCM J;  2HU9 A;  1XGN A;  2JSC A;  2EFN A;  1Q1H A;  4L9N A;  5IP9 J;  5J6X A;  1TWH J;  3GO5 A;  1HQC A;  2LY2 A;  2EV5 A;  2E1O A;  1U9N A;  4AVP A;  3LFK A;  2HR3 A;  3RI4 A;  5HNH A;  5JFR A;  3PSI A;  3C2B A;  3NAU A;  2NVU B;  2DOA A;  2V1U A;  2KIM A;  1MJ9 A;  1U2W A;  3REO A;  3IAS 2;  4BKX A;  5TRD A;  4BHP A;  2RGV A;  1VTN C;  4F91 B;  3WG7 H;  5E3L A;  3OS2 A;  5L3E A;  1S7E A;  2QLZ A;  3VOE A;  2A6H F;  2DMU A;  2ZSI B;  4HX4 A;  1WRJ A;  5FGM A;  3EUA A;  1R22 A;  3ZQF A;  5F6F A;  2BE5 F;  2Q0O A;  4HEA 2;  1X1D A;  3K70 C;  3FMS A;  5HNF A;  6PAX A;  5K7H A;  1ZK8 A;  2IXS A;  2L2O A;  3JRA A;  2ZME B;  3HOZ J;  1OMI A;  1LDK B;  2X0L A;  2K9M A;  3W2W A;  4GRI A;  1NHA A;  2DA2 A;  4KIG A;  2K5C A;  4HRI A;  3K4K A;  4XL9 A;  2FNA A;  2NAZ A;  4OIP F;  3H3V K;  2K3P A;  3RZO J;  2O0Y A;  2M87 A;  2F4I A;  5F1J A;  1MNE A;  1CF7 B;  3G1O A;  2EWN A;  4AID A;  3H9G A;  2NVT J;  4BYY A;  4FX0 A;  3VSL A;  1L3L A;  1Z77 A;  2H1K A;  4YEL A;  2A07 F;  4DZJ A;  3WU2 C;  5IPA A;  4U7D A;  3CJT B;  2IVM A;  3FBN B;  3HHH A;  3KLO A;  4QWQ A;  1K83 J;  2PEX A;  3FX3 A;  1Y1W J;  1OR7 A;  4I02 A;  1RNL A;  3S93 A;  3LSP A;  1J9I A;  2ZNY A;  1QPM A;  2XPV A;  1WJC A;  1X1P A;  4A12 A;  4XRF A;  3K2A A;  2KZV A;  5C44 J;  1SC7 A;  5J3L A;  1XGO A;  3J80 K;  2LDU A;  1UHW A;  2KZG A;  2EBI A;  4ZYE A;  1J7K A;  1RIO H;  2JWT A;  4HSR A;  1SMY F;  2QEX I;  4ESF A;  3W2A A;  2CRG A;  4RM3 A;  4IHY A;  1A36 A;  2XSJ C;  3SZG A;  1DU0 A;  3EUK L;  2ADU A;  2R7S A;  2M30 A;  4HBL A;  3HTS B;  3QWL A;  3GBG A;  1M1E B;  4QIW N;  3IH2 A;  2H8R A;  4HAM A;  1MZB A;  5E1Z B;  3EPZ A;  2K86 A;  2M4K A;  3KPH A;  3DPU A;  2VJI A;  3WTX C;  1W5S A;  2E1C A;  2P5V A;  2YU3 A;  4V2F A;  4KMF A;  1LFU P;  1FIA A;  2BGC A;  2ESN A;  4R79 A;  1CGP A;  4U0W A;  1N78 A;  1RUO A;  3J7A Y;  4C3H J;  2BOL A;  2L7F P;  2LC2 A;  3DLA A;  3DCF A;  2Q1Z B;  1BOA A;  2Z16 A;  1FYL A;  3OL3 A;  1IN5 A;  1E3H A;  1ETX A;  1J2X A;  4RB0 A;  3VSK A;  3TL4 X;  3PUF A;  2R7D A;  1LQ1 A;  1Y1V J;  3ABU A;  3OSG A;  3CJR B;  4RAG A;  3OYN A;  3DWL E;  5HLT A;  4IOC F;  2O6G E;  2IGK A;  2JVH A;  2R7U A;  2GQQ A;  2BBY A;  4Q5S F;  2O9L A;  3CJN A;  4IPA A;  4XMY A;  1Z21 A;  2VL8 A;  3BG3 A;  3F6V A;  3MZ8 A;  3Q3S A;  5LD2 C;  3JTH A;  1REP C;  3WGG A;  2IBD A;  4C3J J;  1F5T A;  2HYJ A;  4MTE A;  3A0B C;  3B73 A;  3TMO A;  1KQ9 A;  3DXJ F;  4ZTJ A;  3BPV A;  5DEQ A;  2W25 A;  2VOP A;  2OA4 A;  5B1B H;  4NC6 A;  1ZRF A;  3E6C C;  1LJ9 A;  2Y48 A;  1X1A A;  3TW7 A;  3VYU B;  5E8G A;  1APL C;  3D0S A;  1GXP A;  1MND A;  2CQQ A;  3HXL A;  1IXR C;  4A2U A;  3D1N I;  2WAD A;  3LSR A;  5IOZ A;  3K1M A;  4LGW A;  1MH4 A;  4M74 A;  4IRG A;  2KT0 A;  4BXF A;  4G7H F;  1WJD A;  3QYE A;  2XAJ A;  2VQG A;  1V4R A;  3A01 A;  2LBF A;  4FHT A;  4RAZ A;  1TW2 A;  2L02 A;  4EJT A;  4HA8 A;  1E3P A;  2FJ1 A;  4Q4Z F;  1IF1 A;  3M9A A;  2WBM A;  2DFF A;  3KCC A;  4CSW A;  3CJQ B;  3H1C A;  1YO5 C;  3FXK A;  1TQP A;  5DS9 A;  3KYD B;  1G3S A;  2GA1 A;  2V1X A;  2I10 A;  2AQF A;  2EIK H;  4CCN A;  2JA6 J;  2LY1 A;  1Z0X A;  1I50 J;  1B8I A;  2ZCW A;  1G8X A;  3B6A A;  2DA1 A;  1TWA J;  1IUY A;  4LLL A;  1XPX A;  1TW3 A;  3BDD A;  2QQ8 A;  3F9K A;  3H36 A;  3V7C A;  3QPH A;  3F21 A;  5DCF A;  3MAJ A;  3EET A;  1MDM A;  5FKK A;  3NWT A;  5FFX A;  1U5T A;  4XLH A;  2DJI A;  3GZN B;  1UHM A;  3NQO A;  1TL8 A;  1PJR A;  3BR5 A;  5ILU A;  4YIF A;  5H2F C;  1D8J A;  3H3U A;  1YOV B;  1Y0U A;  3GTL J;  1WI3 A;  1XB4 A;  1ORK A;  4RMN A;  3JRD A;  5E20 A;  1YI2 I;  3FM3 A;  2EFP A;  4B44 A;  4YG2 F;  2A68 F;  3HL2 A;  4M3E A;  2A3S A;  2XF6 A;  3DEU A;  4XID A;  5IY5 H;  5EZH A;  3CO6 C;  3E3V A;  4E7Z A;  3GTP J;  3M8F A;  3PQK A;  2YX7 A;  1ERD A;  2V9K A;  2M4G A;  1JTX A;  2NOG A;  1QHG A;  5ERI A;  5EG0 B;  3CCQ I;  2Y0M A;  2QA4 I;  4I7H A;  2DPU A;  3FHZ A;  3PJR A;  5FRN A;  3L7W A;  3M8J A;  4GGG A;  1FZP B;  1MGT A;  1UJ8 A;  1MBJ A;  3KX2 A;  2OQG A;  1DPR A;  4MTD A;  4WCG A;  2HYF A;  1WFX A;  1FBQ A;  3PNY A;  2VIX A;  4A0Z A;  3QOD A;  4XM3 A;  4A6D A;  3KET A;  3E1S A;  2V7F A;  3IH4 A;  5J40 A;  1BI0 A;  2H8W A;  4EM2 A;  3QOE A;  1FWZ A;  3GTJ J;  3PNT A;  1LDJ A;  4A0X A;  5JI6 A;  1RKW A;  2KIF A;  5D5U B;  2Y31 A;  4XKV A;  1TLH B;  5HDN A;  1PYV A;  2GOM A;  1HW2 A;  1FOK A;  1UCR A;  3GLL A;  1ETY A;  1O3R A;  1JJ6 C;  5DM7 F;  3BQZ A;  4PJN A;  1VQ7 I;  3DPT A;  4J00 A;  3BTJ A;  2PJP A;  1BI3 A;  4OMY A;  2W84 A;  5J47 A;  2KHM A;  3RKW A;  1GV2 A;  2P6T A;  3P9I A;  4NDL A;  3CC2 I;  1GXQ A;  2DA7 A;  1IG7 A;  1KU3 A;  3K69 A;  3KP3 A;  5ICE A;  4O3M A;  2R5Y B;  3FF5 A;  5JVT A;  1JJ8 C;  4BDY A;  3HOY J;  2LKX A;  2A5W A;  2BXZ A;  3VB2 A;  3FMR A;  2E7W A;  3KLN A;  2P8T A;  3RCO A;  1FT9 A;  4BHB A;  4BY1 J;  3IAM 2;  3IHU A;  1EF4 A;  1WJ5 A;  5K5R A;  2QBY A;  3QPL A;  4YII A;  1XGS A;  1I6X A;  3A02 A;  2MW8 A;  3Q0U A;  4RGS A;  2YUS A;  5M3M J;  2CYY A;  1NG6 A;  3LQR A;  5ED4 A;  1XTA A;  3BCA A;  3CME I;  2OC6 A;  1VQ4 I;  1K4S A;  2KIQ A;  5J1R A;  2MFZ A;  3I55 I;  2Z9O A;  4IL6 C;  4DBQ A;  4D7N A;  1RR8 C;  1K6O A;  2OU2 A;  5E3M A;  1SFE A;  2DT5 A;  4CA0 A;  5IOY A;  4I99 C;  2RAE A;  4FE4 A;  2X9D A;  3CP8 A;  4EGZ A;  2B0L A;  3WTT C;  3A01 B;  2LBF B;  1SAN A;  5TJJ A;  3BR1 A;  4MHG A;  2P7C B;  2CS3 A;  2RQP A;  3Q0W A;  1HBX G;  1MMA A;  2DT7 B;  3DU6 A;  3GUD A;  1MMD A;  3BJA A;  4CHU A;  3HG9 A;  1P2F A;  2BYV E;  3QPS A;  2ZJR F;  3CDI A;  4IRI A;  2E19 A;  4E7K A;  2P7V B;  1FJL A;  3EYI A;  3GXO A;  5AON A;  3WE3 A;  1FSE A;  2OTJ I;  2F5D A;  4CIC A;  1D3Y A;  3ZMT A;  5DUI A;  2DTZ A;  4IQ4 A;  2CV1 A;  1B8I B;  5DTD A;  4BBR J;  1N75 A;  2GIZ A;  3QYB A;  4RAY A;  3R6S A;  1PP8 F;  1XDS A;  3OR2 C;  1ZHF A;  2Y2Z A;  1R00 A;  2ID3 A;  2K9N A;  1MDM B;  4RGR A;  3OYD A;  3FXL A;  4MO7 A;  3RYP A;  2PI0 A;  4HOB A;  2K9Q A;  2BY2 A;  1U5T B;  2NYX A;  3CMM A;  4RAF A;  2HTJ A;  2RVC A;  4IHS A;  3OV8 A;  5CVR A;  4KIS A;  2DFH A;  3RPU D;  2PMH A;  3ZPL A;  4A3D J;  2BV6 A;  5B3S H;  2E34 A;  3OIO A;  5CVV A;  1VZ0 A;  1SVM A;  1RPW A;  1UHS A;  4I0B A;  3FXM A;  5EDN A;  2KP6 A;  3O3K A;  4LMY A;  2A69 F;  5F27 A;  1I1S A;  3DBR B;  3IWZ A;  4D9J A;  1R5H A;  1Z1D A;  1H9T A;  2KQR A;  4HNU A;  1J5Y A;  2QVO A;  1H0M A;  2K3F A;  4KIB A;  2CUJ A;  2FX0 A;  1ON1 A;  3RDI A;  2HPM A;  1ON2 A;  4IEJ A;  4GFB A;  3K7A J;  4EM1 A;  2N8G A;  1EJ9 A;  5LRR A;  2ETH A;  1JUP A;  3CP2 A;  3QP5 A;  4ZC3 A;  2YPR A;  1N25 A;  2ACJ A;  4CZZ A;  1Y8R B;  4G6Q A;  1QO0 D;  5GPC A;  2QQB A;  4Y13 A;  4XOT A;  2QWW A;  2ZXI A;  3LSG A;  1Z7U A;  1P6R A;  3PUB A;  3JCU C;  1X19 A;  2X6W A;  2QGU A;  2XGC A;  5CQE A;  3HYI A;  3FXO A;  5FRO A;  2VQL A;  3WE2 A;  5J4V A;  2GWR A;  1UST A;  3WTS C;  4JYK A;  4ENN A;  4KYW A;  3HUG A;  3PQJ A;  5C4J J;  2M5W A;  2MSY A;  3COA C;  2GIV A;  1VQ6 I;  4QPO A;  4UV8 A;  4ZDP A;  1Z9C A;  1BL0 A;  4WXD A;  2DDB A;  2OPT A;  2E2I J;  4Y3O A;  3BG5 A;  2YSR A;  4FCY A;  3RQ4 A;  1T2K A;  5CJ9 A;  3TOA A;  4C2U A;  4NQW A;  4KA4 A;  4I2O A;  2L5Q A;  1MSF C;  1ZEL A;  3HM5 A;  1SVO A;  2PJR B;  2PX9 A;  3GFM A;  1BIB A;  4NC7 A;  2K27 A;  3TO9 A;  3KEQ A;  3OL4 A;  3ISP A;  1BW6 A;  1HW5 A;  2K7L A;  2MC4 A;  3IWF A;  5FKN A;  5TIS C;  2QBY B;  3WTY C;  2K40 A;  4RB1 A;  2QSH X;  5CKT A;  1ZG3 A;  1E3O C;  4AM3 A;  1R58 A;  4XLN F;  2IS4 A;  3GFL A;  3I59 B;  2IA0 A;  3R0A A;  1AKH A;  1FMV A;  3WTZ A;  3J80 Z;  2XRL A;  1HKS A;  2JN6 A;  3OWT A;  5HOD A;  4YRV A;  3HEF A;  2M0M A;  1TWC J;  5JHF A;  2DYR H;  3J7A O;  3SZP A;  5ICC A;  4F93 B;  2KRF A;  3ERM A;  1VQK I;  5CPR B;  1A04 A;  2M8E A;  3F23 A;  1H88 C;  4E7I A;  5IT3 A;  2JPB A;  5K5O A;  2F5F A;  3G4S I;  3GTQ J;  4U7B A;  2F5V A;  2F2E A;  3V8J A;  2Y69 H;  3HIF A;  3FIW A;  3U9G A;  1DDN A;  1VI0 A;  2R3S A;  4FX4 A;  2K9S A;  2X51 A;  3F8C A;  1LKX A;  3AL0 B;  3K4C A;  4A3J J;  2VKD A;  3R0J A;  3A03 A;  3DEE A;  1ZAO A;  3E6B A;  1WSU A;  3DP7 A;  1WJA A;  2JK3 A;  2R7T A;  2CUF A;  1P92 A;  2PQ8 A;  2DQL A;  1ZGJ A;  2E7X A;  2ELJ A;  4S0H B;  1WH5 A;  2R7Q A;  1S3J A;  1IW7 F;  4HQE A;  5JR3 A;  3BP8 A;  4XK4 A;  3RPU A;  1ZG1 A;  2ZXH A;  5HLI A;  1KU7 A;  4C9Y A;  3LSI A;  3PFY A;  4UY8 I;  1TC3 C;  4A3F J;  4IX7 A;  1USS A;  1HDP A;  1N77 A;  1IZ1 A;  2TDX A;  3L2R A;  3D5S C;  2EJR A;  5L3C A;  1D1A A;  4EV0 A;  4G8X A;  4RBO A;  4UVB A;  3CMA I;  4CYD A;  2TCT A;  4G7O F;  3S16 J;  4Q48 A;  2MAB A;  2VBZ A;  1WZ2 A;  2R7W A;  1J09 A;  2OV7 A;  3E5Q A;  3T5X A;  2NVY J;  4E7J A;  3H9Q A;  2XAF A;  2X6O A;  1U8B A;  2ZBK A;  5BPD A;  3S3O A;  5FKL A;  3JR9 A;  3TW6 A;  3ZN0 A;  4JX5 A;  5FKO A;  3BY6 A;  4IF4 A;  4UB8 C;  4UVA A;  3I4N J;  1Z67 A;  5AIP A;  1OPC A;  4V2G A;  3ASN H;  2LOO A;  3GF2 A;  1F36 A;  2Z3Y A;  4IZZ A;  3OMY A;  4I09 A;  2QUF A;  3K70 D;  2VC1 A;  1GHC A;  1LVK A;  1W1W E;  1W5T A;  3K4N A;  3LWF A;  4M3D A;  3SEQ A;  5J4Y A;  4XLF A;  4EAT A;  4GXO A;  5IYC J;  4UV9 A;  3Q9V A;  1Z3Y A;  2DA4 A;  1J59 A;  3DQV C;  1W36 C;  3QU6 A;  4ON0 A;  3RZD J;  1R71 A;  1QZE A;  1XGM A;  3HSF A;  3CO7 C;  3QP6 A;  1FP1 D;  4LIT A;  2CV2 A;  1ETQ A;  5CVJ A;  3S1Q J;  3LL7 A;  4ZDL A;  3VYR B;  2EA2 A;  2J5O A;  2VON A;  4E70 A;  4YFN F;  3LAJ A;  1GV5 A;  2PG4 A;  3LAP A;  3R61 A;  2DMP A;  2BW3 B;  3MKY B;  1I3A A;  2WAF A;  2RDP A;  1Z7L A;  4XIC A;  4AUX A;  3MCZ A;  4KT5 C;  2L9V A;  2Y75 A;  2M9H A;  4GO1 A;  2JPC A;  3QRF F;  1IN8 A;  2RKH A;  1K7A A;  3RKX A;  2HXO A;  2O5R A;  1FSH A;  1OJL A;  3K9T A;  2DA5 A;  1YRN B;  2BY0 A;  5J8F A;  3BZK A;  3FKJ A;  3CF5 F;  4F7Z A;  4HZF A;  4ZYD A;  3J81 K;  3HGY A;  2LG4 A;  4WXC A;  3SDG A;  1KA8 A;  2RV8 A;  1YTY A;  4RLF A;  3CCJ I;  1T39 A;  4XNF A;  3EUH A;  4BUP A;  1B9M A;  3FBI B;  1TWG J;  5CLS A;  1R7J A;  4HX7 A;  3BWG A;  3DBH B;  5F64 A;  4BEH A;  4KIF A;  1LEA A;  5CVU A;  2XIG A;  4AWX B;  1MMS A;  2VUM J;  1OR7 C;  1V55 H;  2ZKZ A;  5LHG A;  1XMK A;  4EVI A;  5LGU A;  3HKZ N;  4OWR B;  2X1E A;  3LA2 A;  2E5Z A;  2G0E A;  2GBY A;  5IYB J;  4M71 A;  3V7R A;  2HOE A;  1W7P D;  1LE8 B;  2HQR A;  1ZLK A;  4OIO F;  4ZZD A;  3GX4 X;  1R4N B;  3L00 A;  2XKP A;  4Y15 A;  2BHZ A;  1ZG5 A;  1K4T A;  3HSE A;  5A2Q K;  2Z33 A;  2CV0 A;  2H6B A;  1IDZ A;  2IGO A;  3G6E I;  5GAE J;  1MBK A;  2LP0 A;  5L3D A;  4Y17 A;  4L5J A;  3IP4 B;  2W4S A;  1BC7 C;  3BG7 A;  4DIQ A;  1BBY A;  3KYC B;  2XAG A;  1FOY A;  1YE9 A;  4MNU A;  1T08 B;  2GXG A;  4JP0 A;  3OOU A;  1B72 A;  2O7O A;  1OIS A;  2L4A A;  5FD5 A;  2AO9 A;  5DD4 A;  3LA3 A;  2RNJ A;  1SVL A;  4DJA A;  5EJC A;  3E5U A;  4E7S A;  2VT3 A;  3WHB A;  2CFX A;  3BPX A;  5EGO B;  5K5Q A;  3PIO F;  3K2Z A;  5HVQ C;  2HI3 A;  2LY9 A;  1IDY A;  3RKY A;  3C1D A;  3E7L A;  4FT8 A;  4IXA A;  1KZH A;  1YIJ I;  5TGT A;  2MLG A;  4N4N B;  4LG3 A;  4U0V A;  3VYS B;  5K1Y A;  2G9W A;  4PFP A;  2HTS A;  2DLL A;  3KP7 A;  2VAS A;  3IUO A;  2ME0 A;  3GTM J;  5AIQ A;  4WF2 A;  3GTO J;  3HSR A;  1S5L C;  4IKF A;  3MVP A;  1VF9 A;  5KCM A;  1O7F A;  3CC4 I;  4A3L J;  3I4M J;  3OYF A;  2XPW A;  2HGC A;  4UVC A;  4DOZ A;  2CW0 F;  4BE1 A;  1SD5 A;  5EZG A;  2HDD A;  2WV0 A;  4BXX J;  2DXI A;  3BTI A;  2FE3 A;  2CJJ A;  2LLK A;  1NH3 A;  4EJW A;  2EZK A;  3TKY A;  1B1B A;  4NHJ A;  1UZC A;  3DTI A;  2V4J C;  4A3G J;  2DOF A;  3MFK A;  1UB9 A;  4GYI A;  5D8K B;  4Z6Y A;  2CUZ A;  2DDA A;  2VC0 A;  3CD6 I;  1GT0 C;  2CWE A;  2YS9 A;  2FQ4 A;  2VKV A;  3ZRG A;  5J1Y A;  5FD6 A;  1VND A;  2RC4 A;  3TBI A;  4LLG F;  3N4M A;  1JKP C;  1XX5 A;  1OLT A;  1FMW A;  2O3F A;  3GTK J;  1VQ9 I;  2MGQ A;  4MGR A;  3DBL B;  4CXF A;  2FEZ A;  3BLY A;  2D1H A;  5CQG A;  5KAI C;  1P4A A;  1XG1 A;  4NUB A;  3WGH A;  1YW7 A;  4CO8 A;  5F0H A;  1I27 A;  1JKR C;  3DTE A;  4CGZ A;  4DYQ A;  1X3U A;  3KP4 A;  2BY1 A;  2R7F A;  3W6J B;  1MJA A;  1SFO J;  4BNC A;  3LSK A;  3K4J A;  1GVD A;  1JUS A;  3LSM A;  3A1Y A;  3C7J A;  4ITV A;  4KMU X;  2EIM H;  3VDX A;  2IGN A;  1KQ8 A;  4BEH B;  2DBB A;  1BR1 A;  2ZJ2 A;  3DF8 A;  1K78 A;  4XR6 A;  1FTZ A;  3IV5 A;  3KP2 A;  4ENJ A;  2IW5 A;  4MFD A;  3AAF A;  2LTP A;  3LSH A;  4BJ5 C;  2HVS A;  3OR1 C;  5LHH A;  1O3Q A;  2EFW A;  4LFU A;  4M3F A;  1WHU A;  1U5T C;  5D6E A;  3BTL A;  1FLI A;  2ECC A;  5DDG A;  2DI3 A;  4CDG A;  1S29 A;  1E0E A;  1B9N A;  5ICF A;  5D8L B;  1D0X A;  3RQI A;  1RI7 A;  1JTY A;  4A3I J;  4CH7 A;  2BVM A;  2IJL A;  3TO6 A;  1U3E M;  3PIP F;  4LG0 A;  1Z91 A;  3PSF A;  5F0C A;  4BE0 A;  3GZ6 A;  4M6V A;  4EGY A;  2IS1 A;  5H20 A;  2DCE A;  3GME A;  1IC8 A;  2MH2 A;  4HPQ A;  2CFO A;  1HW1 A;  2NVX J;  2X1C A;  3OS0 A;  2NNN A;  5HDG A;  3BG9 A;  4F55 A;  3OIQ A;  4RGX A;  1FC3 A;  1R1T A;  1L0O C;  3X2Q H;  4A3K J;  3S1N J;  3AG1 H;  1RZ4 A;  1K79 A;  4M3B A;  3WG9 A;  1H9G A;  3E6M A;  1G3W A;  3SXY A;  2FQ3 A;  4JBA A;  4NC8 A;  5FKM A;  5C4X J;  2HDW A;  1TZL A;  1X1B A;  4CUG A;  3JRI A;  3CQZ J;  2DOD A;  4HDV A;  1WGX A;  4B4C A;  4AC0 A;  3PO2 J;  3CCV I;  4CCK A;  1W0U A;  1ETW A;  2KRC A;  4IHV A;  4RS8 A;  2ZSH B;  1SAU A;  1DU6 A;  1MKM A;  2J5P A;  2EZH A;  2UWM A;  1D1C A;  5IYD J;  3JSO A;  2Y30 A;  1BA5 A;  1S7A A;  4KN7 X;  4NB5 A;  5E17 F;  2MD5 A;  2A6E F;  1IV8 A;  3BJO A;  3HB9 A;  2R0Q C;  2JRM A;  1JKO C;  5BS6 A;  3TP3 A;  2M0C A;  1KON A;  5D5V B;  2VE9 A;  4UUV A;  1ZYR F;  1O4X A;  2CQX A;  4M72 A;  3ROU A;  1T0F A;  2W48 A;  1W5C C;  1Z3X A;  4PJ0 C;  3ZQ7 A;  4FIS A;  3I64 A;  1A6Q A;  2BHY A;  5HOO A;  2FXA A;  2JA7 J;  1BM9 A;  1B6A A;  3ZMU A;  1X3Z B;  4G7Z F;  1Z6T A;  1HF0 A;  1HXD A;  3HPG A;  1VQL I;  2H27 A;  3M07 A;  3GW2 A;  2XSD C;  1T6S A;  2P0W A;  2GXB A;  4B09 A;  2DW4 A;  3MMY B;  1MBH A;  2L7M P;  4F52 A;  4N9H A;  4BQO A;  1BIA A;  4DZP A;  3CES A;  3CUQ A;  3H0D A;  4B3A A;  5JLW A;  3CLQ A;  3CZ6 A;  1IV6 A;  1IRZ A;  4A69 C;  4KNY A;  1UMQ A;  2FD5 A;  2OQR A;  3AL0 C;  1TT5 B;  1JT0 A;  2CQK A;  1G2H A;  3UNG C;  2LH9 A;  4KDP A;  3OYI A;  1UG0 A;  3AFH A;  3WHC A;  3L2C A;  4WX9 A;  1K78 B;  4UNO A;  1BI1 A;  1QZZ A;  2HXI A;  1AU7 A;  3W2V A;  4W1U A;  2QZ8 A;  5FO5 A;  3V4G A;  1RES A;  4UUS A;  5D4S A;  2ESH A;  2ZO4 A;  4BU2 A;  2E36 A;  2E35 A;  4KJZ A;  2IEK A;  4RGU A;  2YU9 J;  4M3G A;  1FYK A;  4MFE A;  2MD0 A;  4ABZ A;  3FK6 A;  2DJN A;  4I0A A;  4AIK A;  3VPR A;  1EH7 A;  3J7Y J;  3F8N A;  2EFO A;  1A5J A;  4GCV A;  1I3Q J;  1P4W A;  4B43 A;  5HS8 A;  4J01 A;  4LG0 B;  1MD0 A;  3E97 A;  3MD2 A;  3BRO A;  1ETO A;  4EJV A;  3ABL H;  1KYZ A;  3ZR8 X;  1D1B A;  3L09 A;  4A3E J;  3VOD A;  1JT6 A;  1RC9 A;  3GFI A;  1CQT A;  4HF1 A;  2QSF X;  1FBU A;  3G1M A;  2E71 A;  2WY7 Q;  1R5I D;  1RUN A;  3FK7 A;  4N4O B;  3IC7 A;  4PJL A;  2I8D A;  2L9R A;  2EZI A;  5IT9 K;  2OJE D;  3L1P A;  1OYY A;  2CG4 A;  2ZB9 A;  3AG3 H;  3ZQI A;  2E60 A;  3IH3 A;  5F08 A;  2Z1D A;  1ZLJ A;  2O8K A;  4L0Y B;  3JAM K;  2VI6 A;  3CCE I;  1YIT I;  4LB5 A;  1Q1V A;  2F6C A;  4ZH4 F;  2W7N A;  3ZMD A;  2HFH A;  2CQN A;  2KJB A;  4JK1 X;  5H6R A;  1IUF A;  2GA2 A;  4UB6 C;  4O6J A;  4Y7N J;  4WK8 F;  3S2W A;  2KDZ A;  5EEA A;  2P81 A;  5M5Y J;  1LEB A;  1QVT A;  3MN2 A;  4M9S A;  1ODD A;  1FX7 A;  5JHU A;  1S7O A;  3HKZ A;  2R7Z J;  5F04 A;  5KNL A;  1R5G A;  1OKR A;  4NNJ A;  4ENM A;  1YYV A;  1FP2 A;  5ICG A;  2OZ6 A;  1GVJ A;  2XKO A;  5KK1 A;  4S04 A;  2VT2 A;  1Y8Q B;  4L5E A;  4MQV A;  2EB7 A;  1ETV A;  1LVA A;  1SMT A;  2K85 A;  3QYF A;  3V8L A;  1UG2 A;  4DQ2 A;  5GAG J;  3J81 Z;  2G7U A;  2OTL I;  2ID6 A;  2FA5 A;  3WOD F;  1YQA A;  2R7O A;  3F0C A;  3O2P E;  1ITY A;  3BZ6 A;  1QHH D;  3JRG A;  1SFX A;  1LUJ B;  3K4L A;  3DFG A;  4E7H A;  2R7V A;  4LIU A;  1C0W A;  4PSX A;  2HVR A;  3OSF A;  4R1H A;  2FOK A;  4M9Z A;  3HHG A;  4IRH A;  2XAS A;  2R4G A;  3EDP A;  1V54 H;  4E6K G;  4A3B J;  2NNY A;  3V7S A;  5L3G A;  2XAU A;  5LLQ A;  3ASO H;  2V79 A;  2HWV A;  5LFA A;  4A93 J;  2VBY A;  5FJ8 J;  3R4K A;  2H1L A;  2JSP A;  4PZJ A;  2P5K A;  4G9Y A;  4HX8 A;  2O61 A;  1S6L A;  5A2Q Z;  4XOR A;  5LGN A;  2UUZ A;  5EF6 A;  1EH6 A;  4DW6 A;  3QQA A;  1HKQ A;  3HZJ A;  2HEO A;  1VQN I;  3HRS A;  2F5C A;  1J0R A;  2F48 A;  1TP4 A;  1AA7 A;  1FNN A;  3PFI A;  3K4M A;  5CVI A;  1DGR M;  1P7J A;  2IPQ X;  3TGN A;  3K6G A;  4V19 K;  2JZY A;  2VB6 A;  1XD7 A;  4RLQ A;  2AS5 F;  2X85 A;  1VFC A;  2K4J A;  4UUS B;  4AU7 A;  4HLY A;  1VQ5 I;  4AYB A;  2L7Z A;  3LSJ A;  4XLP F;  2WAE A;  1E2X A;  2DMQ A;  2MG4 A;  2CW8 A;  3DU5 A;  3M8E A;  4HST A;  3F8F A;  4HQM A;  3F22 A;  3JRH A;  2IA2 A;  4FE7 A;  1G59 A;  2DMT A;  4XLE A;  1ONV A;  1XSD A;  3GVA A;  2W00 A;  4A3M J;  4IQJ A;  2H6C A;  4MLO A;  2EPF A;  5FRM A;  1PUF A;  3KZZ A;  1IXC A;  3DPL C;  3SQN A;  1AOY A;  1IN4 A;  4A6E A;  4PJM A;  1U78 A;  1G4D A;  2KRH A;  3CMY A;  1KGS A;  2LK2 A;  3KP6 A;  4DNC A;  4O5V A;  3CCS I;  3L2Q A;  5BPI A;  2FSW A;  2LRD A;  2ZME A;  1QGP A;  3HJE A;  4LIV A;  3FDY A;  3JRB A;  2WA0 A;  2R5Z A;  4BQQ A;  2MA3 A;  2JT1 A;  3PL8 A;  4A3C J;  1QVU A;  3ZQH A;  1DUX C;  2DMN A;  3BT9 A;  1LFP A;  1JGS A;  4Q47 A;  2JRT A;  3LMM A;  9ANT A;  3QPT A;  4BGD A;  2P5L C;  3G2B A;  4ZTF A;  2KKO A;  2LR8 A;  2M3A A;  1WH7 A;  2FNP A;  2B7E A;  2XVC A;  1TQI A;  2HQ5 A;  2L01 A;  4NBQ A;  2M45 A;  3VWB A;  2L3D A;  5E1X A;  4PSW A;  1TTY A;  1POG A;  1KU9 A;  2F4M B;  3HRU A;  3D5L A;  1EKE A;  1Z6R A;  3U1K A;  4YFX F;  1QRY A;  4Z2Y A;  4L5I A;  3ONQ A;  4XRS A;  4YEJ A;  3KYL A;  2XDV A;  3QAH A;  2D45 A;  1T38 A;  1BOB A;  3ZQC A;  2EK5 A;  5JLX A;  4F3Q A;  1T98 A;  2LYC A;  3ZP5 A;  3CDH A;  2LFB A;  3BR3 A;  5E1W A;  2VOD A;  3HDD A;  3VYT B;  4AIH A;  4HNT A;  2NVQ J;  4BXU A;  1OCT C;  3OIP A;  3SFI A;  2TRT A;  2HDC A;  3LA7 A;  3S17 J;  4CCO A;  1YHQ I;  5IP6 A;  3S2D J;  2GAU A;  3K10 A;  1NG7 A;  3FXQ A;  3I5U A;  3EUH C;  1F9N A;  2XUB A;  5HLH A;  3HUG B;  4Y52 J;  1SFU A;  4D1Q A;  5FLV A;  3BCB A;  3FHN A;  4YIR X;  4MEY F;  5D5W B;  3JRF A;  3W3C A;  1MBE A;  3L9F A;  1OYW A;  2RQQ A;  3LFU A;  2CSO A;  2VN2 A;  3T0Y A;  5GP9 A;  3K0L A;  5FLX K;  4AD9 A;  2PFB A;  3CCU I;  3BG6 A;  3EYY A;  4PGH A;  2E2H J;  2ZXJ A;  4M6Y A;  3OS1 A;  1SEU A;  3E5X A;  1D5Y A;  2V26 A;  4KFC A;  3HTU A;  4PUS A;  4CZC A;  4I6Z A;  4ZJZ A;  1V5G A;  2LRE A;  4NQW B;  1FYM A;  2XF7 A;  2D1V A;  1ZGW A;  1X3W B;  3SJM A;  1XDU A;  4L9V A;  2UZK A;  2B63 J;  1HKT A;  4ESB A;  3UR3 C;  4YFK F;  5K7F A;  2QQA A;  2XC7 A;  3JRC A;  3HOV J;  2XAH A;  2VBX A;  1DP7 P;  3DTK A;  4D5C A;  2OAZ A;  3P9K A;  3CC7 I;  2ISZ A;  1YX5 A;  3G1L A;  2YX4 A;  1QQI A;  2GZW A;  3GTG J;  4XKC A;  1MBG A;  1AKH B;  4WWC A;  3IL2 A;  2JUG A;  2P4W A;  3Q0V A;  4ASN A;  2OF7 A;  1V5F A;  2L9N A;  1X1C A;  2ME6 A;  2Q2E A;  3CCR I;  4PK4 A;  3C2G A;  1WVR A;  1AWC A;  2EV6 A;  3TP0 A;  4PFO A;  4FAS D;  2HOS A;  2ELK A;  3MZY A;  4TV7 A;  1DQU A;  3DKY A;  3HPH A;  4XKW A;  3ZQG A;  1PUF B;  4XBF A;  1QA6 A;  3CCY A;  1FBS A;  4ENK A;  2R92 J;  1G3T A;  2X6Y A;  1ZH5 A;  4OU0 A;  2FMY A;  3FXU A;  4P5O A;  3ZOB A;  1DP3 A;  1FTT A;  2VXZ A;  4AVZ A;  3GZ5 A;  4IJA A;  1YX3 A;  3K1N A;  4LK0 F;  1YJN I;  2WY8 Q;  2M1B A;  3S1M J;  3Q5F A;  1JHF A;  3OYJ A;  4BJ6 C;  2JJ7 A;  2HVQ A;  2R5Z B;  2K4B A;  4RB3 C;  2F5E A;  3U1D A;  5B1A H;  3M1E A;  1JI8 A;  4PJJ A;  1HA8 A;  3BJ6 A;  3DLL F;  1B59 A;  1VQM I;  1WJE A;  3ULQ B;  3CLO A;  4C2M J;  2KMU A;  1IJW C;  1F4K A;  2ECB A;  1BI2 A;  1IGN A;  1F43 A;  3ZMZ A;  3ZGK A;  3CTA A;  4ZZL A;  3ABK H;  4H0E A;  3I71 A;  1I5Z A;  1SFK A;  1BJA A;  1I6H J;  2VQH A;  2XGX A;  2A05 A;  3HC7 A;  2QKL B;  5BMZ A;  5DYM A;  2D5V A;  3DKX A;  4DBR A;  2EV0 A;  2LKP A;  2WAQ N;  3ABT A;  1S72 I;  3P5J A;  1ZRE A;  1FPQ A;  4L9J A;  2CMP A;  1NK2 P;  2Y0S A;  5FFZ A;  4XON A;  4XKB A;  3DV8 A;  4ZYH A;  4HDU A;  1GUU A;  2M34 A;  1YLF A;  4BHC A;  1XMA A;  4CCM A;  3S3M A;  3TQN A;  1Y56 A;  3ZQL A;  1V3F A;  1A31 A;  4B1R A;  2RRE A;  2FOW A;  3RJP A;  3T8R A;  1J75 A;  4AYB N;  1VQ8 I;  2A5Y B;  2K9L A;  3I53 A;  4S05 A;  1RET A;  1TNT A;  3KP5 A;  2H09 A;  1KQ0 A;  5HDK A;  1SAX A;  3FMQ A;  1Y6I A;  2XF5 A;  1QNT A;  3KIO A;  4KT6 A;  5IP7 J;  5KHD A;  2QQ9 A;  5J1U A;  1RRJ A;  1AHD P;  3ML6 A;  2FBI A;  5EG0 A;  2FBK A;  2L0K A;  2VLA A;  1ETK A;  3SFZ A;  3ABM H;  2HQA A;  5B66 C;  1OQY A;  4I76 A;  1ZR2 A;  2OUM A;  4PCQ A;  1ZTR A;  2FU4 A;  1YJ9 I;  2MYS A;  4HLX A;  2E1M C;  3I58 A;  2R7X A;  5L3B A;  1QZY A;  1WJB A;  1MIJ A;  3HBL A;  1QBJ A;  2W24 A;  1HST A;  2Q8K A;  1A35 A;  2KIU A;  5D6F A;  1OYI A;  2LKS A;  3R60 A;  2LF7 A;  2HQN A;  3RTR A;  5D4R A;  3I0T A;  3TO7 A;  4LOC A;  5CYV A;  1F1Z A;  5IT9 Z;  2Y9Y A;  4N0B A;  1OCR H;  2ZXW H;  1Y39 A;  1D0Z A;  2A6T A;  3FWE A;  4K2E A;  2WB1 N;  4OIQ F;  2CUE A;  4XLC A;  2V6C A;  3JAM Z;  5E79 C;  4KIT B;  2ICW G;  3WU0 A;  4HNV A;  1OCC H;  1ZR4 A;  4IHX A;  1W7P A;  2PN6 A;  4JX6 A;  2JMW A;  3HOW J;  1IN6 A;  4C2T A;  2I5U A;  5ILS A;  2Q2E B;  3K1P A;  3S32 A;  4OIR F;  4ESJ A;  3QOP A;  5H6Q A;  1ZKG A;  1WJF A;  4BJT A;  3D5R C;  4IVN A;  1U6G A;  2JUC A;  3MEX A;  3EQL F;  2B9S A;  3A0H C;  1X58 A;  1XSV A;  2R5Y A;  1IO2 A;  4HYE A;  1YS7 A;  2VKH A;  2C6Y A;  1UAA A;  4AIJ A;  4FET A;  2VJ5 A;  3PM1 A;  1JXS A;  4EJU A;  4XQF A;  3HOX J;  4L18 B;  4BQN A;  4CCL A;  1YW9 A;  5M3F J;  4W97 A;  4D0P A;  3BR2 A;  3RIR A;  2M2E A;  1OFC X;  3JRE A;  3BZC A;  2CU7 A;  2FML A;  2XV4 S;  1OCP A;  1VQO I;  3FKI J;  3S14 J;  2L4M A;  4RB2 C;  2K02 A;  4G6D A;  2XHK A;  2VJJ A;  3MQ0 A;  4C30 A;  5C3E J;  1B72 B;  2H94 A;  1O3S A;  3F8M A;  1HOM A;  2JTV A;  2V9P A;  5L3F A;  1MSE C;  3SYT A;  1BR2 A;  2LF8 A;  3B6C A;  3U2R A;  1MMN A;  2IRF G;  1EV7 A;  4E7L A;  3TOB A;  3DEW A;  5DCM A;  2GM4 A;  2QSG X;  1SD4 A;  2DA3 A;  2R93 J;  4B8X A;  1T0F C;  1OCZ H;  1FOW A;  3SDB A;  3OYH A;  2XRN A;  3KFW X;  2WTE A;  2PMZ A;  1R36 A;  1YJW I;  3GFJ A;  4BE2 A;  1XSX A;  2FRH A;  1ENH A;  3WTW C;  5HS7 A;  4OOI A;  4HW0 A;  5E3N A;  4ANJ A;  3WGI A;  1BC8 C;  4QPQ A;  2AHQ A;  1IN7 A;  1MNM C; 
#chains in the Genus database with same CATH homology
 2KDZ A;  5EEA A;  2P81 A;  5M5Y J;  4RBO A;  3LOC A;  3K2A A;  1QVT A;  5C44 J;  1ZQ3 P;  2TCT A;  5J3L A;  3MN2 A;  3S16 J;  2XPU A;  2R7Z J;  5F04 A;  1RR7 A;  2NVY J;  2EBI A;  4DYC A;  2E2J J;  2QF7 A;  2X6O A;  1U8B A;  2JWT A;  4L5E A;  5FKL A;  1ETV A;  3JR9 A;  2WV1 A;  3TW6 A;  1UG2 A;  4JX5 A;  5FKO A;  5M5X J;  2CRG A;  3I4N J;  2ID6 A;  3BR6 A;  4FTH A;  2NS8 A;  4IHY A;  4V2G A;  3F0C A;  1ITY A;  1DU0 A;  4G12 A;  3JRG A;  1F36 A;  3LNQ A;  3GBG A;  4M3D A;  3IH2 A;  4QIW N;  2H8R A;  3OSF A;  1X2N A;  2EZL A;  5IYC J;  1FIP A;  3UKG A;  2NS7 A;  4A3B J;  2QCO A;  4V2F A;  2DA4 A;  1LFU P;  1FIA A;  3RZD J;  3TED A;  4C3H J;  3BTC A;  3PO3 J;  2L7F P;  4A93 J;  5FJ8 J;  1XC5 A;  1ETQ A;  3DCF A;  3HOU J;  2JA8 J;  3S1Q J;  1W0T A;  5K7Z A;  1A6I A;  4BBS J;  3H0G J;  1ETX A;  1GV5 A;  4DYR A;  5EF6 A;  2JA5 J;  1P7I A;  2DMP A;  1Y1V J;  3OSG A;  4DW6 A;  1JKQ C;  3QQA A;  1HDD C;  4XIC A;  4AUX A;  2O9L A;  2M9H A;  3HGG A;  3BG3 A;  2HXO A;  1OJL A;  2DA5 A;  1YRN B;  3Q3S A;  4C3J J;  2IBD A;  1XS9 A;  2HYJ A;  4MIM A;  1P7J A;  3S1R J;  2Y0S N;  5E3O A;  3HGY A;  3SDG A;  5F0F A;  1VFC A;  4UUS B;  4EEF G;  1TWG J;  1BW5 A;  2L7Z A;  2XB5 A;  3LSJ A;  2VUM J;  3TW7 A;  2MG4 A;  2DMQ A;  3HKZ N;  1APL C;  3JRH A;  1X2M A;  2G0E A;  2GBY A;  4FE7 A;  2DMT A;  2CQQ A;  5IYB J;  5BNG A;  3D1N I;  2COB A;  4A3M J;  3LSR A;  4MLO A;  5IOZ A;  1PUF A;  1LE8 B;  1MH4 A;  3BR0 A;  1H89 C;  2KT0 A;  1U78 A;  3CMY A;  3A01 A;  2LK2 A;  1IDZ A;  4CYC A;  1MBK A;  4QTR A;  2LP0 A;  2FJ1 A;  3JRB A;  2R5Z A;  5DS9 A;  4A3C J;  1QVU A;  3ZQH A;  2DMN A;  3BT9 A;  2I10 A;  4JP0 A;  1T33 A;  3OOU A;  9ANT A;  1B72 A;  2O7O A;  1GDT A;  2JA6 J;  2LVS A;  1Z0X A;  1I50 J;  2LR8 A;  2AO9 A;  1WH7 A;  1B8I A;  3B6A A;  2DA1 A;  1TWA J;  2HQ5 A;  1POG A;  3WHB A;  5EGO B;  5FKK A;  2HI3 A;  2LY9 A;  1IDY A;  3E7L A;  1HLV A;  3MKL A;  1QRY A;  4XRS A;  1RKT A;  3BR5 A;  4RDU A;  4XRS G;  3ZQC A;  5JLX A;  3O8G A;  2ME0 A;  2LFB A;  3GTM J;  3BR3 A;  3GTL J;  1WI3 A;  1ORK A;  3GTO J;  3JRD A;  1U9O A;  3MVP A;  3HDD A;  4X1E A;  1VF9 A;  4M3E A;  2NVQ J;  4XID A;  1OCT C;  1NK3 P;  3I4M J;  4A3L J;  2XPW A;  5EZH A;  1NTC A;  2TRT A;  3SFI A;  4IHW A;  3GTP J;  1JUM A;  3S17 J;  4D7M A;  5IP6 A;  3S2D J;  4BY7 J;  2NOG A;  1JTX A;  5EG0 B;  5EZG A;  2HDD A;  4BXX J;  3BTI A;  2CJJ A;  2LLK A;  2EZK A;  3M4O J;  4Y52 J;  5FLV A;  4A3G J;  1FEX A;  1MBJ A;  3JRF A;  1MBE A;  2VPR A;  3NAR A;  5GP9 A;  5M5W J;  3IH4 A;  1GT0 C;  2XGE A;  2FQ4 A;  2VKV A;  2YS9 A;  5J1Y A;  2E2H J;  3GTJ J;  1VND A;  5EYR A;  1JKP C;  1D5Y A;  1RKW A;  2Y31 A;  4I6Z A;  3GTK J;  2MGQ A;  1ZGW A;  5FLM J;  3SJM A;  2B63 J;  1XG1 A;  5K7F A;  1ETY A;  1JJ6 C;  3BQZ A;  5F0H A;  3JRC A;  3HOV J;  3BTJ A;  1JKR C;  4D5C A;  4DYQ A;  2PMZ N;  1SFO J;  3FIS A;  1GV2 A;  4NDL A;  1WPK A;  3G1L A;  1GVD A;  2DA7 A;  1JUS A;  1IG7 A;  3GTG J;  1R9T J;  1MBG A;  2R5Y B;  1AKH B;  2IAI A;  1JJ8 C;  3HOY J;  3Q0V A;  2LKX A;  2OF7 A;  1YRN A;  4BY1 J;  1EF4 A;  2ME6 A;  3QPL A;  1FTZ A;  3A02 A;  2MW8 A;  3Q0U A;  3IV5 A;  2YUS A;  5M3M J;  4MFD A;  2LTP A;  3TP0 A;  2HOS A;  2ELK A;  5GPA A;  1PUF B;  3ZQG A;  2EQR A;  5J1R A;  3CCY A;  4M3F A;  4D7N A;  2R92 J;  3BTL A;  5E3M A;  1FTT A;  3ZOB A;  2ECC A;  5IOY A;  2RAE A;  4FE4 A;  2X9D A;  2LD5 A;  3RKQ A;  3A01 B;  1SAN A;  3BR1 A;  3RQI A;  1JTY A;  4CYC B;  4A3I J;  3Q0W A;  3S1M J;  2DA6 A;  4Y7N J;  2JJ7 A;  3S2H J;  1TWF J;  5F0C A;  2R5Z B;  1LE8 A;  3QPS A;  4M6V A;  2E19 A;  1K61 A;  4UUT A;  1FJL A;  1IC8 A;  4C2M J;  1IJW C;  2ECB A;  2NVX J;  1IGN A;  1F43 A;  2M8G X;  1QPI A;  2DTZ A;  3BG9 A;  3O8H A;  1B8I B;  2X48 A;  5DTD A;  4BBR J;  1H8A C;  2GLO A;  4A3K J;  1I6H J;  3S1N J;  4X6A J;  2Y2Z A;  2K9N A;  2ID3 A;  2D5V A;  1T56 A;  4M3B A;  2WAQ N;  3CDL A;  4MO7 A;  2K9Q A;  2VKE A;  4JX4 A;  5FKM A;  4QSH A;  5C4X J;  3JRI A;  1JGG A;  1NK2 P;  3CQZ J;  1WGX A;  4A3D J;  4B4C A;  4AC0 A;  3PO2 J;  1W0U A;  1ETW A;  3OIO A;  1GUU A;  2M34 A;  4IHV A;  1RPW A;  1UHS A;  5EDN A;  5EGO A;  1DU6 A;  3W6V A;  5F27 A;  3ZQL A;  1BJZ A;  2EZH A;  4B1R A;  5IYD J;  2Y30 A;  1BA5 A;  4AYB N;  2FX0 A;  1MBF A;  3HB9 A;  2R0Q C;  1JKO C;  3TP3 A;  4IEJ A;  2M0C A;  4GFB A;  1MH3 A;  2DN0 A;  1RET A;  3K7A J;  3S15 J;  2N8G A;  4XRM A;  1LFB A;  1JUP A;  2EH3 A;  1O4X A;  5IP7 J;  4J19 A;  2CQX A;  3M3Y J;  2W48 A;  2HOA A;  5GPC A;  1HCR A;  5J1U A;  2XB0 X;  3LSG A;  1AHD P;  4FIS A;  2JA7 J;  5EG0 A;  2XGC A;  2L0K A;  3BQY A;  1ETK A;  1HF0 A;  4JYK A;  2Y9Z A;  4D5F A;  5C4J J;  1ZR2 A;  4I76 A;  2XSD C;  2MSY A;  1ZTR A;  1MBH A;  2L7M P;  2XGD A;  4C3I J;  2HOT A;  4DZP A;  1WCM J;  3HBL A;  1BL0 A;  2OPT A;  2E2I J;  4B3A A;  5IP9 J;  4LOC A;  1TWH J;  5JLW A;  3BG5 A;  4FCY A;  2Y9Y A;  2E1O A;  1IV6 A;  1IRZ A;  1U9N A;  4A69 C;  1UMQ A;  2FD5 A;  2WB1 N;  1JT0 A;  1G2H A;  2CUE A;  1MSF C;  3HM5 A;  3C2B A;  4HNV A;  3NAU A;  1ZR4 A;  4IHX A;  3WHC A;  4JX6 A;  2JMW A;  3HOW J;  1BW6 A;  5FKN A;  1AU7 A;  2HXI A;  2K40 A;  4BKX A;  4W1U A;  1E3O C;  1ZKG A;  5E3L A;  1S7E A;  1RES A;  4UUS A;  2DMU A;  1X58 A;  1AKH A;  2R5Y A;  3ZQF A;  2IEK A;  2XRL A;  2YU9 J;  4M3G A;  2JN6 A;  4MFE A;  5HOD A;  3HEF A;  3PM1 A;  4ABZ A;  1TWC J;  5K7H A;  3FK6 A;  2DJN A;  1ZK8 A;  3JRA A;  3HOX J;  3VPR A;  5M3F J;  4W97 A;  3HOZ J;  1H88 C;  3BR2 A;  2M2E A;  1OFC X;  3GTQ J;  3JRE A;  1A5J A;  2CU7 A;  1I3Q J;  2DA2 A;  3FIW A;  1OCP A;  1VI0 A;  3FKI J;  3S14 J;  2K9S A;  1ETO A;  5C3E J;  1B72 B;  4A3J J;  3H3V K;  4A3E J;  3RZO J;  1HOM A;  1JT6 A;  5F1J A;  3A03 A;  1CQT A;  3G1O A;  1MSE C;  2NVT J;  3G1M A;  2JK3 A;  1Z77 A;  2H1K A;  3FK7 A;  2CUF A;  3B6C A;  4DZJ A;  2L9R A;  2EZI A;  4S0H B;  3L1P A;  1WH5 A;  5IPA A;  2ZB9 A;  3ZQI A;  3IH3 A;  3DEW A;  5F08 A;  2GM4 A;  2DA3 A;  2O8K A;  4XK4 A;  2R93 J;  2VI6 A;  1Q1V A;  1K83 J;  1ENH A;  4A3F J;  1Y1W J;  1TC3 C;  3LSP A;  1HDP A;  5E3N A;  2XPV A;  2AHQ A;  1IUF A;  1MNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...