1SFOJ

Rna polymerase ii strand separated elongation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1sfoJ00
2R5ZB 1UG2A 1YRNB 2DA1A 3RKQA 2M8GX 4JYKA 2M34A 5M5YJ 2ECBA 2ELKA 1RETA 2MW8A 3H0GJ 1JTXA 1F43A 4B3AA 2R7ZJ 2LD5A 3OOUA 1WCMJ 3S15J 5K7HA 3FISA 1MSFC 3HOUJ 1ZR4A 4DYRA 1JJ6C 2LLKA 4AC0A 3OSFA 1RESA 4M6VA 2YU9J 3JRBA 3GTGJ 3HGYA 5IPAA 1T33A 2DN0A 2Y30A 3S1QJ 2TRTA 3TP3A 5EZGA 4IHWA 5EZHA 1Q1VA 3S1RJ 3OSGA 5IOYA 4A3DJ 1TWGJ 5C44J 1LFUP 1IC8A 3E7LA 1EF4A 4A3BJ 2L7FP 2ME0A 2EQRA 1IG7A 2EZKA 1H8AC 2JA8J 1W0UA 2L7MP 3IH2A 1JKRC 4M3BA 1O4XA 2GLOA 2MGQA 4IHVA 3GTPJ 3S2DJ 2YS9A 1NK3P 3JRHA 1MSEC 4CYCA 3FK7A 3G1OA 1MBGA 4A3CJ 2XSDC 3BR0A 4A3GJ 1AHDP 2LTPA 1TWHJ 5F27A 3LSGA 9ANTA 1RKWA 4C2MJ 1QVUA 2IEKA 4MFDA 3A01B 1WH5A 1HF0A 4BBRJ 3MN2A 3IV5A 1ZKGA 2G0EA 1F36A 4DYCA 3LNQA 4ABZA 1HLVA 4DW6A 3K7AJ 3S1NJ 2E19A 4W1UA 1FTZA 1XS9A 4A3KJ 4Y52J 5IOZA 4CYCB 5EF6A 3B6CA 1ORKA 3BTLA 3CDLA 3M3YJ 3GTLJ 2DA6A 5EEAA 5IYDJ 2E2HJ 5DTDA 1AU7A 2M9HA 2XPVA 1TWAJ 2XRLA 5EG0A 2K40A 1FJLA 2HOAA 3PO2J 1IDYA 5F1JA 4FCYA 4A3IJ 2EZLA 1H89C 4AYBN 2CQXA 1YRNA 1B72B 4JX6A 4IHYA 5FJ8J 5EDNA 2COBA 2XB5A 3ZOBA 4QSHA 5E3NA 5M3MJ 3HOWJ 1WH7A 1WGXA 3Q0UA 4X1EA 1XG1A 1CQTA 2XGCA 5BNGA 1ETKA 4D7MA 3Q0WA 2ECCA 2LY9A 2E2IJ 1WI3A 1MBJA 3QPLA 5E3MA 1U78A 4I76A 3GBGA 1HDPA 1JT0A 1GV2A 1JKOC 1HOMA 3O8HA 1OCPA 2AHQA 1BW5A 2CUEA 2N8GA 3ZQHA 3S1MJ 1IUFA 2XPUA 2ME6A 4QTRA 3ZQLA 1TWFJ 1S7EA 2AO9A 4A3EJ 4M3GA 2CQQA 1JTYA 2KT0A 4BXXJ 2JK3A 2WV1A 1A6IA 1IDZA 3QQAA 4D7NA 1BL0A 3S14J 1SFOJ 4XK4A 2MSYA 2EBIA 5IP9J 5FLVA 1LFBA 5IP7J 5IYCJ 2HXOA 3JRGA 1I50J 2DA3A 4IEJA 1RKTA 1QRYA 3JREA 2JA7J 3BR1A 3A01A 3H3VK 1ITYA 2OPTA 4XRSA 3DCFA 1VFCA 4RBOA 2K9SA 2X48A 2H1KA 4HNVA 4M3FA 3B6AA 2RAEA 3BQYA 1ZR2A 2DA5A 3GTQJ 3Q3SA 5F0HA 1ETWA 2CJJA 3OIOA 2VI6A 3L1PA 1DU0A 1ZTRA 1ETVA 2QCOA 3HOZJ 5C4JJ 3JRIA 4V2GA 4D5CA 3Q0VA 4JX5A 1ZK8A 4X6AJ 3ZQGA 3TW7A 5J1RA 2JA6J 4A3MJ 2JMWA 3HBLA 1ETXA 4L5EA 1QVTA 2DMTA 4Y7NJ 2Y9ZA 5K7ZA 2PMZN 1B72A 1NK2P 4BY7J 1FTTA 3UKGA 3BT9A 2M2EA 2VUMJ 3BR5A 3FK6A 1ETOA 5FLMJ 2VPRA 3BTIA 3JRDA 3ZQCA 1BW6A 4XIDA 1VF9A 4MFEA 2HQ5A 3NARA 2XGEA 5F08A 4JP0A 3BR6A 2FJ1A 2DA7A 5GP9A 2JN6A 1APLC 2NVYJ 3BR3A 4MO7A 3HOVJ 1E3OC 1D5YA 1MBFA 1OJLA 2HXIA 3BG9A 3HOXJ 4BBSJ 3LSRA 2R92J 5M3FJ 1X2MA 1I6HJ 2LKXA 5DS9A 3BTCA 1G2HA 1MBHA 5EGOB 3VPRA 1X58A 2IBDA 2JJ7A 1VI0A 1TWCJ 1WPKA 2K9NA 3FIWA 3JR9A 2JWTA 4C3JJ 2EH3A 3S2HJ 2H8RA 2FX0A 1ZGWA 2LK2A 2Y2ZA 3WHCA 4S0HB 5IP6A 3F0CA 2DA2A 1U9NA 2Y0SN 3GTMJ 1X2NA 2FQ4A 2EZHA 1GUUA 2O8KA 1IJWC 5EYRA 2VKEA 1XC5A 2KDZA 2NVXJ 2X9DA 3CQZJ 3W6VA 2CU7A 2IAIA 3BR2A 4UUSA 2E1OA 4JX4A 1LE8B 2CUFA 3G1MA 5HODA 5E3OA 4BY1J 1POGA 3ZQFA 3TP0A 1RPWA 3FKIJ 3S16J 3BQZA 2HDDA 4D5FA 4M3DA 5J1UA 2HI3A 2LR8A 4MIMA 5FKLA 4A93J 1DU6A 3TW6A 2DMPA 2HYJA 2EZIA 3GTOJ 2O7OA 3HGGA 4C3IJ 3JRFA 3BG5A 4XRSG 2L9RA 2XPWA 4IHXA 1JJ8C 1P7IA 1UHSA 2NS8A 1HCRA 5F0CA 2R93J 4B1RA 1FIPA 1JGGA 1OCTC 1MBKA 1JKPC 3HB9A 5FKKA 4UUSB 4FTHA 1H88C 5JLWA 1A5JA 4J19A 3QPSA 1TC3C 2LVSA 3G1LA 5M5XJ 3K2AA 4BKXA 2Y31A 4LOCA 3SFIA 2DA4A 3HDDA 1W0TA 1JUPA 5FKOA 3RQIA 3HOYJ 2XB0X 2WB1N 1T56A 1Y1WJ 2HOTA 3CCYA 4AUXA 4XICA 1HDDC 3NAUA 1JKQC 2YUSA 2DMUA 3HEFA 3IH4A 4MLOA 3HKZN 2W48A 3BTJA 1GDTA 3LSPA 2L7ZA 5JLXA 3ZQIA 4C3HJ 1UMQA 1JUMA 2NVTJ 2R0QC 1NTCA 4V2FA 3RZDJ 2P81A 4EEFG 3DEWA 5C3EJ 5C4XJ 2I10A 2GM4A 2HOSA 3MVPA 5GPCA 1VNDA 3MKLA 1PUFA 2D5VA 5J1YA 4DZJA 3PM1A 1FEXA 1GV5A 2MG4A 5GPAA 1JT6A 5EGOA 3SJMA 4QIWN 5FKNA 4NDLA 3A03A 2O9LA 1JUSA 3O8GA 4I6ZA 1AKHA 2TCTA 1GT0C 2B63J 2NOGA 1K83J 5K7FA 2DJNA 1ENHA 3A02A 4A3LJ 1Y1VJ 2ID6A 3IH3A 1FIAA 2OF7A 3I4MJ 1Z0XA 5F0FA 1R9TJ 3LSJA 4W97A 1MBEA 2L0KA 2K9QA 1U8BA 1U9OA 2ID3A 1PUFB 4M3EA 2LP0A 1IV6A 2GBYA 2QF7A 1OFCX 3LOCA 1ETQA 5IYBJ 2DTZA 1LE8A 4B4CA 2M0CA 1QPIA 3I4NJ 2WAQN 5FKMA 3JRCA 1B8IA 1GVDA 2X6OA 1AKHB 2CRGA 3SDGA 4DYQA 1RR7A 5F04A 3WHBA 3GTJJ 2R5YA 3M4OJ 2NVQJ 1MH3A 1Z77A 4FISA 4A3FJ 2FD5A 2JA5J 3JRAA 4A3JJ 1P7JA 1SANA 2NS7A 2R5ZA 2VKVA 1MH4A 4DZPA 3GTKJ 1BA5A 1MNMC 2ZB9A 5J3LA 2DMQA 4RDUA 1K61A 1ZQ3P 3PO3J 3C2BA 1BJZA 3S17J 2DMNA 1IGNA 4FE7A 5EG0B 1I3QJ 3CMYA 2Y9YA 3BG3A 4XRMA 1B8IB 4A69C 5E3LA 4FE4A 4UUTA 5M5WJ 1IRZA 2R5YB 2LFBA 2E2JJ 3HM5A 4GFBA 2XGDA 4G12A 3RZOJ 3D1NI 1ETYA 3TEDA
chains in the Genus database with same CATH superfamily
2COMA 3FM3A 4CCNA 2ELKA 3H0GJ 1SVOA 3OYKA 1I1GA 2CUJA 1JTXA 3BJ6A 2P0WA 4CH7A 1ZYRF 1QO0D 2R7ZJ 4LG3A 3DF8A 3H3UA 1WCMJ 3S15J 2P6SA 2VQCA 3SZPA 3H3ZA 2EA4A 2KJBA 2BHYA 1PYVA 1JJ6C 1ZARA 2LLKA 3DP7A 3LAPA 3OSFA 1VQLI 4OOIA 1U6GA 2YU9J 2A07F 4LG0B 1BOBA 3JRBA 4Q4ZF 2DOFA 1V4RA 1T33A 2BYVE 2BOLA 5FRNA 2X51A 4IHWA 5EZHA 2AXTC 1OYIA 1TWGJ 2V9PA 3FF5A 5C44J 1EF4A 2Z3YA 1SAUA 5D8LB 3RJPA 2ME0A 1TT5B 4PJ0C 1SFUA 3OOPA 4F91B 4IHVA 2MGQA 2L2OA 1J59A 1NG7A 1U0JA 3SQNA 3TOAA 3Q5FA 1MJ9A 1QZZA 3U2RA 4CYCA 3N97A 3ZMTA 1VZ0A 3FK7A 1MBGA 5JFRA 3D5RC 3S3OA 2XSDC 3OL4A 1W5CC 3FXKA 1TWHJ 4CICA 3LSGA 4PSWA 4KITB 3BC8A 4ENMA 1RKWA 4A0YA 2IEKA 3FXUA 3I9V2 2ZFUA 3LNQA 4OU0A 2DQLA 4ZTFA 2L4MA 2FBIA 1KGSA 3P9IA 2HTJA 4IOCF 4A3KJ 1PDNC 2X6WA 3HSFA 5L3BA 4F3QA 5EF6A 2HZDA 1ORKA 3X2QH 2RQQA 5EEAA 3P7NA 4EVIA 1XGMA 2E1MC 2FOWA 3F8CA 2K86A 2OC6A 3ZGKA 2A5YB 1IXCA 2VT2A 4A12A 4BHCA 5EG0A 1VQNI 2XGXA 5E1ZB 2E5ZA 2K40A 4BUPA 2HOAA 2QBYB 3K69A 4D1QA 1G4DA 2V6CA 4CCMA 4EJVA 5F1JA 4P55A 2ZSIB 3T8RA 4FCYA 5CLSA 3DPLC 2HR3A 4U0YA 2OBPA 2CQXA 4EM2A 1R5GA 4MEXF 2HDWA 4YFXF 3MKYB 3KYCB 1G3WA 2LF8A 2XB5A 2ADUA 2X1DA 4KN4X 3OYNA 5TRDA 3DU5A 2RREA 1GLNA 3W2WA 2R7VA 2EFPA 1CQTA 2E7XA 1R36A 3OYMA 2RC4A 4XL9A 5BNGA 1ETKA 1A31A 2QQAA 3TO6A 2ECCA 4AD9A 1WI3A 4A5MA 5CVUA 2DBBA 5GAGJ 1IXSB 2BEOA 4OMZA 2QA4I 1S29A 1U78A 3GBGA 1BI1A 1HDPA 3S3MA 3CZ6A 5GTIC 4QWQA 3RSNA 2HKXA 1Z67A 4LG0A 4BQQA 1HOMA 3HRTA 4E7SA 4D9JA 3GFIA 3QP5A 3LA7A 2CUEA 2PEXA 3BZ6A 3OIPA 5D4RA 1XMKA 2F2EA 4QTRA 4H4KC 1FSHA 1KU2A 2AO9A 3S8PA 4MHGA 2MLGA 3FMRA 3G71I 2KT0A 5K1YA 2LYCA 4F55A 4NHJA 2XV4S 3WTTC 4I0AA 2IS2A 4D7NA 1BL0A 2ESHA 2FEZA 5DD8A 2MSYA 5ICEA 1ACIA 5IP9J 4E7IA 5FLVA 3CD6I 5IP7J 2OQGA 4UB6C 3CMMA 3WU0A 1OR7C 1JE8A 4IEJA 2L3DA 2EB7A 1RKTA 5CVIA 1QRYA 3TGNA 3D0SA 4OINF 2VIXA 2R7OA 3H5RA 2DLLA 3ABTA 4JOMA 5LHHA 3QPHA 2ELHA 5GAHJ 1OR7A 2OPTA 4Q5SF 5ILVA 1EH6A 3QOPA 3DCFA 3A0HC 2LKSA 2VBWA 2K9SA 1KU7A 5CKTA 2Z2SB 1XGNA 5HLGA 1MDMB 1YJNI 2VLAA 4IX7A 3BDDA 2LKPA 3NWSA 4YFNF 3F8BA 4BU2A 4UV8A 2R3SA 2CJJA 2Q2EB 2HYGD 1S72I 3B73A 1R4MB 4A6EA 1MD0A 4Z2YA 2W1OA 3E97A 4BGDA 1B9NA 4KDPA 4V2GA 3RI4A 4FT8A 1ZG3A 3Q0VA 1FOWA 2AXLA 2XAJA 1ZK8A 4JX5A 4L9VA 1RIOH 3T0YA 2GZWA 2QBYA 2DI3A 3NQOA 4ANJA 3KLNA 4XSZF 1A35A 2W85A 4WX9A 4CSWA 3TQNA 3I55I 4L5EA 2Y9ZA 3K4NA 3WU2C 2Z5UA 1FT9A 1NG6A 2W25A 3WGHA 1NK2P 5BPDA 1V5EA 1D1AA 5CJ9A 2J5OA 4KFCA 1ZG5A 3J81Z 1LEAA 2P7CB 2L01A 3L2VA 3M7GA 3JRDA 1T38A 2QSFX 3ASNH 4CO8A 1VF9A 2HQ5A 4BH9A 3M1CA 2XGEA 2DDBA 4I99C 4F7ZA 2FJ1A 1SEUA 1OCCH 1FWZA 3HG9A 4XOTA 3W6KB 1Y0UA 2NVYJ 3BR3A 2EINH 4HNTA 4BHBA 3G6EI 2L54A 3HHGA 3VDXA 3CMEI 2RGVA 2M30A 2VONA 2XKPA 3ESWB 2P8TA 2ZNZA 5KAFC 4BACA 4B3XA 1I6HJ 3FKJA 3OIQA 1LB2A 3I56I 1D0ZA 1R4NB 3JAMZ 1D0XA 1MBHA 2IGKA 1QZYA 1X58A 2IBDA 5FLXK 2Y0SA 3KFWX 3FIWA 3CCMI 3ABMH 4LFUA 3H35A 3I3LA 4EM0B 2FX0A 1ZGWA 2LK2A 3GVAA 2IXSA 1DP3A 2DA2A 2Y0SN 5JR3A 3H1CA 5F6FA 1GXPA 1WSUA 1Z6TA 4PSXA 1IJWC 3ZQ7A 3DU6A 3EYYA 1WJEA 1P92A 2WADA 3CUQB 3W3CA 2CUFA 4RMNA 4KJZA 5HLIA 5HODA 2HNHA 3HSEA 4NC6A 5E3OA 4BY1J 2LOOA 3S16J 2K02A 3L2WA 1BR4A 4M3DA 3CJTB 1HW2A 1W7PB 1IRXA 2DMPA 2FXAA 3E5XA 2M7AA 4C3IJ 4LGWA 3JRFA 1R6RA 2KFDA 5LHGA 2VB6A 3HYIA 4J00A 3R4KA 5HNFA 2I8DA 1CGPA 1UHSA 2R93J 3PQKA 1BI0A 1ODDA 2EA2A 4B1RA 1MGTA 2M3AA 2IP2A 1MBKA 2WTEA 3IAM2 4EGYA 4LLNA 1HKTA 4FTHA 1H88C 1PP7U 3KYDB 1OYWA 1A5JA 4J19A 2HZTA 3ABLH 1FYLA 1TC3C 4L9TA 3G1LA 4HG2A 1TBXA 3HRUA 3SFIA 2JVGA 2HTSA 1EH7A 4HF1A 1W0TA 2LC2A 3DKYA 3CESA 2WAFA 3H9QA 2CFXA 3RQIA 3HKZA 3HOYJ 4WF2A 2EV0A 3C1DA 4PFPA 4LK1F 3CO6C 2V1XA 3BWGA 3PJRA 3NAUA 5DEQA 2YUSA 2DT6A 4B09A 2DMUA 4HV5A 3HKZN 2VJIA 3KCCA 3BTJA 2HVRA 4HZFA 3ZQIA 2RNJA 5FB2A 1UMQA 1JUMA 5HS9A 2JPCA 4CUGA 2R7QA 3KEQA 2Y69H 4OIRF 2JQ7A 5B1BH 2YX4A 3FXQA 3E5QA 2ETHA 1VQMI 1VNDA 3SZGA 2EWNA 2KJCA 1IAWA 2D5VA 3OYEA 3WGGA 4G8XA 2CS3A 2KLOA 1X19A 1GV5A 1Z3XA 1TW2A 3KEYA 2G9WA 2ZXIA 4IPAA 2MD0A 3JSPA 2GXBA 4HF0A 1JUSA 1DQUA 1P9QC 5IY5H 1AKHA 1WJ5A 2JUCA 2W24A 5K7FA 3K4KA 1XMXA 2DJNA 2ZJ2A 3BCAA 2LY1A 1Y1VJ 2H27A 3F3XA 1ZLKA 3SZTA 3J7ZI 4M6XA 4AU7A 2P5VA 4RB1A 4P1WA 3I4MJ 4FQGA 3TDZC 1TT0A 3CUQC 1MBEA 3GW2A 4HRIA 3MQ0A 2ID3A 4M3EA 1R49A 1J09A 2GBYA 1ETQA 3CUQA 2PJRB 1O3QA 4B4CA 3GO5A 4HOBA 1R00A 1RC9A 2M0CA 2V9KA 3TBIA 2MH2A 4HQMA 1U5TB 3JRCA 1GVDA 1ZELA 1OMIA 3SDGA 2R5YA 3PIOF 3WHBA 1JGSA 4EJUA 3DTEA 2NVQJ 4XLEA 1HSJA 4RLQA 1ERDA 4P9FA 3LA2A 2CQKA 3OS0A 3JRAA 1FLIA 2R5ZA 4ITVA 2JZYA 2P6TA 2Z9OA 4DZPA 3PFIA 2DW4A 2ZB9A 1K61A 4LMYA 2EFOA 2CUZA 4AVZA 1BJZA 3LQRA 2QVOA 3DEUA 2VJJA 4N9HA 4GXOA 3VOEA 3I71A 1IGNA 1D5VA 5D5XB 5KAIC 4PUSA 2CV2A 3BG6A 2ZBKA 3AL0C 1SC7A 4L5IA 2E2JJ 3HM5A 2JUGA 3HRMA 4UY8I 4GFBA 2FMLA 2IA0A 2XGDA 3P9CA 2WV0A 2PI0A 1LEBA 2O0YA 1BI3A 1WFXA 1YRNB 2FUG2 3RKQA 1C0WA 4JYKA 5JVTA 2M34A 4I02A 2P5LC 4J01A 4UUVA 1WJAA 5ILSA 1F1ZA 1P4WA 2QQ9A 5E17F 4B3AA 2GA1A 5K5OA 2DO7A 3R60A 2F5FA 5HS7A 4X0GA 2D2WA 2VPLA 2PQ8A 4DYRA 1RESA 4PCQA 1Y6IA 1OKRA 1IN8A 4L18B 2B9SA 5EEGA 2DN0A 4KMFA 4U0WA 4UXNA 5H20A 4U0VA 5EZGA 1Q1VA 3S1RJ 2F48A 3OSGA 5IOYA 4A3DJ 2QQ8A 1YJ9I 4E7ZA 2K4JA 1LFUP 3GLLA 4ZDPA 3PSIA 1DUXC 4XLCA 2ESNA 1IG7A 1H8AC 3FBNB 2JA8J 2L7MP 1QGPA 1JKRC 1SAXA 3WGIA 1IW7F 3TMOA 2YS9A 2R7UA 2L9SA 4KT5C 3E1SA 1STZA 3G1OA 3QU3A 5DM6F 4ENNA 1FBUA 4BAYA 3QODA 2WAEA 2M8EA 3TOBA 1U5TC 2M1BA 3WG7H 3CC4I 4ZTJA 5HDNA 4RLFA 5FROA 2CW7A 2ZXJA 2D45A 3L2RA 3A01B 1WH5A 2IT0A 1U5TA 4YG2F 4UVBA 1Y56A 4I09A 4KUMA 4E70A 1CF7B 4DW6A 3K7AJ 1O7FA 1QQIA 2X1EA 2IGOA 1OISA 4Y33A 4RM3A 5ICCA 4PGHA 4CYCB 2R7XA 1ZRCA 3QPTA 2BXYA 4BL0B 3GTLJ 5LBQA 2DA6A 5CVVA 3ROUA 2OTLI 5DTDA 1AU7A 3MZ8A 2LBFB 4ZH4F 2Z99A 2XPVA 1TWAJ 2XRLA 1ZN2A 2WBMA 3HOSA 4M9SA 4IL6C 1FJLA 2BZTA 1DDNA 3FZVA 2XF6A 3ZMVA 5HS8A 3K4JA 1JI8A 2ZJRF 3MFKA 3ELKA 5B5EC 4A3IJ 2EZLA 1H89C 2VOOA 1YRNA 1Z9CA 4IHYA 2MC4A 4LB6B 4HBLA 1JHFA 5FJ8J 1VQ8I 2DFIA 4QSHA 3GFJA 3HOWJ 2OTJI 3VYSB 2YSRA 1XG1A 4L5JA 4NNJA 3AFHA 3AG3H 4ZDOA 3HSRA 4D7MA 3MZYA 3Q0WA 2LY9A 1YFHA 2E2IJ 1W1WE 3C2GA 1X3WB 4GCVA 1N77A 2E1MB 3EYIA 5AONA 2DTRA 2L02A 1BIBA 5CQGA 3OY9A 4ESBA 3SDBA 5K5QA 1JKOC 2L9NA 2DOEA 1F4KA 2A05A 3W6JB 3CCLI 1BW5A 3GLXA 2JT1A 2BHZA 2M87A 3OR2C 1LDJA 2ME6A 2XF7A 2OQRA 3N4MA 4M3GA 3PUFA 1JTYA 4BXXJ 4BJTA 3WTSC 1RI7A 3PNTA 4M73A 1HKSA 4RM2A 2WV1A 4B43A 1X1CA 2PMUA 4EJTA 1IDZA 1SFOJ 1P4XA 2FE3A 3H9GA 3COAC 1RR8C 1LFBA 1HQCA 3ABKH 3ISPA 4F93B 2HXOA 1I50J 1FP2A 2KPMA 3IP4B 1D1CA 2OJED 4RGSA 2M45A 3F8NA 2EFNA 3DXJF 2CGPA 2W00A 3BG7A 1YITI 3E6DA 4DGWB 3A01A 2M7BA 1FOXA 2EILH 4P9UA 5FFZA 1IV8A 2A69F 5HVQC 3FWEA 1VFCA 3JTGA 2M4KA 1CF7A 3I59A 2H1KA 2XHKA 4XKBA 3FXLA 4PK4A 3H5NA 1UHWA 3LFKA 1YO5C 3R0AA 2NOJB 5FRMA 3SFZA 5JHFA 2P4WA 1S6LA 1KQ8A 1SVMA 2GXGA 3OIOA 1LDDA 3K10A 1DU0A 1ZTRA 5CVJA 1MJAA 2QCOA 5ICFA 3HOZJ 1B4AA 1B6AA 4CHUA 3LSMA 2LBFA 1KU9A 3GF2A 4N4OB 5HLTA 1GVJA 4OAYA 3IKVA 4YRVA 4RS8A 1YW7A 4BQNA 4WXCA 3B02A 3ZQGA 5J1RA 4A3MJ 2JMWA 3HBLA 1ON1A 3CDIA 5J4VA 4GYIA 4QLCU 2IW5A 2B7EA 2HWVA 2IGNA 1S9HA 1FTTA 3TL4X 5J6XA 1YQAA 3BT9A 3UKGA 3FMSA 1ETOA 5FLMJ 2LREA 1FSEA 3E6MA 2EV6A 2DYSH 2VE9A 4XIDA 5L3CA 1N25A 2MD5A 3BP8A 5F08A 1D8JA 2GIZA 3WTWC 4AVPA 5TISC 5GP9A 3HUGB 3HOVJ 3CLQA 2XAGA 1E3OC 2O61A 5KHDA 1R1UA 1OJLA 3H5AA 5HNHA 1F9NA 3G4SI 3CJRB 1G8XA 1LDKB 2R92J 5M3FJ 1KYZA 2LKXA 4YFKF 4U88A 1R1VA 1Y8QB 5LRRA 1G2HA 1K4SA 2MFZA 4RGRA 3RCOA 1K4TA 1TWCJ 4A6DA 3V8LA 3IUOA 2EH3A 5L3GA 4FHTA 4LLLA 4WCGA 1T39A 2KQRA 2Y2ZA 4R8HA 4S0HB 2VXZA 3F23A 1OLTA 2NAZA 1U9NA 1SFKA 5L3DA 1VQPI 4XSXF 3IHUA 3PQJA 1GUUA 3GWZA 3I0TA 1HKQA 3ZRGA 4NC8A 4DBQA 4BE1A 2O8KA 3PL8A 4OIQF 2F5VA 4IO9F 2XIGA 1BC7C 1XC5A 2KDZA 4L0YB 3CQZJ 3W6VA 2DXIA 2CU7A 3BR2A 4UUSA 2E1OA 1LE8B 1KYWA 4O6JA 4IKFA 2ZXWH 2O6GE 2VT3A 4XLAA 3ZR8X 1RPWA 3FKIJ 1EH8A 2HDDA 1ZGJA 2FBHA 4GDFA 3BPVA 5J1UA 2LR8A 4MIMA 2HYFA 2WWYA 2P7VB 2EZIA 2JTVA 2O7OA 3BG5A 3GZ5A 3QWLA 1PVEA 3HHHA 1EJ9A 2XPWA 4BYYA 3VEPA 2FOKA 1JJ8C 1Z05A 5J47A 2CV0A 4M72A 2A6TA 3I53A 4WWCA 1OCTC 3J7AY 2VJ5A 5FD5A 1ZREA 2E1CA 5FKKA 4YEJA 3FDYA 2K3FA 5JLWA 2OCCH 3SEQA 3QPSA 3K4LA 4AWXB 2WB1A 3CUOA 3L2QA 2HPMA 4BDYA 5M5XJ 2ZO4A 1U3EM 2XROA 1OCOH 4LITA 2A61A 1FMVA 1JUPA 5FKOA 3CO7C 2QYOA 4MEYF 3A2KA 2IA2A 4K2EA 2UXXA 1TQIA 2LY2A 5LRSA 1DGRM 4RGUA 1TNTA 2CW0F 2WB1N 3DQVC 1I6XA 4ZJZA 3CCYA 2EJRA 4XLHA 3RIRA 1JKQC 4IRGA 1PJRA 2EFWA 1YX5A 4PJMA 3LSPA 4WK8F 4C3HJ 4II3A 1GXQA 3WTUC 3HUGA 2W84A 1Y0NA 2VODA 4EEFG 5C4XJ 2NS0A 3RDIA 2I10A 2KIUA 2KZGA 2VXDA 2HOSA 2IS1A 2KISA 1R1TA 4CXFA 1R22A 1OCRH 2HU9A 1OQYA 1WQ2A 1PUFA 2L4AA 1TL8A 2HVQA 5GPAA 1KZHA 4N4NB 3VB2A 3F72A 4QIWN 3CMAI 5DD4A 1LFPA 2V1UA 3WTXC 4KICA 4AM3A 2LRDA 5JI6A 3QU6A 3K1PA 2JA2A 1BOAA 3HPGA 2NOGA 1K83J 3CCJI 3S93A 4ZYEA 3A02A 2VBZA 3KE2A 3E3VA 2FNPA 3IH3A 2OF7A 2FMYA 3LSJA 4W97A 2E71A 1YS7A 2R7SA 1U8BA 2QF7A 1OFCX 1YLFA 5FO5A 5IYBJ 1MNDA 1LE8A 2GWRA 3RYPA 3IWFA 1SD4A 2BY0A 2BW3B 2WAQN 4Y15A 5KCMA 1AKHB 1YHQI 4HA8A 1VQ9I 1KQ9A 3FX3A 4FASD 1RR7A 4BJ5C 3GTJJ 1WRJA 1MH3A 1Z77A 4FISA 2NRAC 3KZIC 1P7JA 1SANA 2L9VA 2NS7A 4N0BA 3RKXA 1BR1A 1MNMC 5ERIA 1Z1DA 4RDUA 3IWZA 3R61A 2X0LA 1BIAA 3GCMA 2XUBA 4LIVA 3NEUA 3SYTA 4KIFA 3L9FA 5D6FA 1P2FA 2HKOA 2Y9YA 4KMUX 4PJLA 4XRMA 4IQJA 5M5WJ 4UUTA 2DT5A 2XDVA 1IRZA 3V7SA 5LGNA 2R5YB 3JCUC 4EGZA 4KISA 2A6HF 4ZYHA 4HEA2 2VJ4A 1K78B 1VQKI 2R5ZB 3K0LA 2HOEA 3VFZA 3DPUA 3OYLA 2M8GX 2ECBA 2EFQA 2MW8A 1PUEE 5A2QK 4ZC3A 1F43A 2DK5A 4HV6A 4XM3A 1LPQA 2ICWG 4IOAF 2KIFA 3OOUA 3HJEA 3AKZA 3FISA 1I5ZA 1H9GA 3FXOA 3CLOA 1YI2I 1USSA 4AC0A 3HL2A 4GO1A 2Y0MA 5IT9K 3J80K 4G7ZF 3GTGJ 4MGRA 3HGYA 1REPC 5IPAA 2QUFA 3S1QJ 4HYEA 1O7LA 2TRTA 3LSTA 3IRQA 3AL0B 3OV8A 2LF7A 4LLGF 2E35A 1MW7A 4D0PA 4PJJA 4LB5A 3E7LA 4A3BJ 2GOXB 3HIFA 3FBIB 1FOYA 3WE2A 1A36A 2BXZA 1W0UA 4M9ZA 1HXDA 4M3BA 1O4XA 1V5GA 1R58A 3GTPJ 1FP1D 1RNLA 3C18A 3S2DJ 3JRHA 5LFAA 3KP3A 3MKWB 4XOPA 2IPQX 3MAJA 3E0JB 3BR0A 3MZHA 1XDSA 3K4CA 3K9TA 4A3GJ 4BXFA 4KIGA 3IKTA 4FX0A 3QRFF 9ANTA 1LKXA 4M74A 3A0BC 4C2MJ 1Z6RA 2MLKA 4XQFA 4ZYAA 4BXUA 4MFDA 2GOMA 4Z6YA 2BW3A 2CSOA 1HF0A 4OIOF 1Z7LA 4BBRJ 1EV7A 3MN2A 3IV5A 1ZKGA 1F36A 4EJWA 4PJNA 3DFGA 2KDOA 1D1BA 2QGUA 1HLVA 3S1NJ 4KIBA 2RVCA 2E19A 2JPBA 3RTRA 4E7JA 4HX7A 1O57A 4FETA 3VYRB 4Y52J 1HBXG 5IOZA 2F4OB 2XAUA 1BR2A 3BTLA 3IC7A 3PIPF 3M3YJ 4RAYA 5FD6A 4XR6A 4CZZA 5IYDJ 3ZMDA 5BQTA 3LMMA 2J5PA 2E2HJ 1HC8A 1P6RA 4EMSA 2DYRH 2M9HA 5J8CA 3M9AA 1TNSA 2MABA 1MMAA 4RB2C 1WJFA 1PP8F 2AQFA 4LIUA 4IXAA 2OA4A 1J5YA 1FBSA 1YW9A 3O6BB 3Q9VA 1IDYA 3OMYA 2K27A 3EETA 1G3TA 5F64A 4BNCA 3S3NA 4XLPF 1I39A 2EIJH 1XD7A 2Y75A 1K78A 1E3HA 1FOKA 3IRRA 4JX6A 2DK8A 3ZN0A 2DU9A 5EDNA 1E3PA 1J7KA 2COBA 3ZOBA 1YOVB 5E3NA 2VQHA 5M3MJ 3HOTA 3BOQA 1WH7A 1Y8RB 1V5FA 3Q0UA 4X1EA 2QLZA 3V42A 2KRCA 2MYSA 2KRFA 3U21A 3ECOA 3VWBA 2M5WA 1MKMA 4M9XA 1H9TA 3QPLA 5E3MA 2EV5A 4WXHA 1XDUA 4I76A 4XLNF 2WC2A 1FC3A 3J7YJ 1JT0A 1GV2A 3O8HA 2D1VA 2RNGA 2GA2A 3S1MJ 2EIKH 2NXNB 1Y39A 1R23A 6PAXA 3LL7A 4NQWA 4MQVA 4KT6A 2XPUA 4OWRB 2Z33A 4KYWA 2FBKA 3VYTB 1ZRDA 1S7EA 4A3EJ 1ZGAA 2CQQA 2DFHA 3H0DA 1ZAOA 3U1DA 3KP4A 5HDGA 5BPIA 2OZUA 1V55H 1UG0A 3G2BA 3GFMA 2YPRA 2W82A 4XORA 1A6IA 3U9GA 3OYAA 4DQ2A 1WJDA 2EBIA 2H94A 2DFFA 2X6YA 4CA0A 4RB3C 1SD7A 1ZRFA 1Z7UA 1MMGA 4CCOA 1AOYA 1YE9A 2DA3A 4MTEA 5KNLA 1HW1A 2BVLA 2YR2A 2E36A 1XCBA 2JA7J 3H3VK 2V4JC 4XKVA 5ED4A 1R7JA 2X48A 3VSKA 1E2XA 1U2WA 2LG4A 3VSLA 3B6AA 2RAEA 2GQQA 3BQYA 4LJZF 4H0EA 3GYHX 1ZR2A 2XF5A 2CMPA 1ETWA 3FMQA 5F0HA 4OAZA 1VQ7I 5LEJA 3L00A 1MMNA 1WJCA 2EIMH 2VE8A 2F4IA 3QOEA 4CZCA 1IRFA 5C4JJ 2DJIA 3D5SC 4HQEA 4XONA 3BPXA 1XMAA 1K6OA 2W4SA 3GXOA 1RUNA 5ILUA 1RUOA 4X6AJ 4Y3OA 5D4SA 1ZG1A 1FYMA 3TW7A 2Y48A 2OU2A 5J40A 1KQ0A 3I59B 2E1NA 3A4CA 1IN4A 5HDKA 3WU1B 1WJBA 3E6BA 3ZQQA 1T8IA 1TLHB 5LGUA 4HLXA 5E1XA 1I27A 2BE5F 2M2EA 2V1DA 4RA2A 2VUMJ 3FK6A 3T1BA 1G59A 3BTIA 3ZQCA 3T5XA 1BJAA 5H2FC 2PMHA 2K7LA 4MFEA 3I5UA 4P5OA 2JRMA 3ZMZA 2QSGX 3NARA 4B44A 2A6EF 4IVNA 3BZKA 3OYBA 2DA7A 2JN6A 3PNYA 3R6SA 4E6KG 1D5YA 2V1NA 3KP2A 1USTA 3WTYC 3JW4A 3BG9A 3O3KA 4JBAA 2CO5A 2ZMEC 1YIJI 2VASA 5DS9A 3TO7A 3BTCA 5EGOB 4E4HA 1X4PA 2AQEA 3DV8A 2ZMEA 3KZZA 2ACJA 2JSPA 3SXYA 4DJAA 2K9NA 1AWCA 2VQGA 4GRIA 3JR9A 2DCEA 1OYYA 4C3JJ 4KN7X 1T2KA 2STWA 3S2HJ 2H8RA 4S04A 4RB0A 4DIQA 1WHUA 1D3YA 4HLYA 2FQ4A 4EV0A 4UVCA 3OYHA 2LDUA 4TV7A 1IUYA 5EYRA 2NYXA 1MIJA 2NVXJ 1F5TA 3EQLF 4XN3A 2IAIA 4E7KA 3GZNB 1ONVA 1A04A 2FA5A 4YELA 3ZQFA 3HRSA 4HPQA 4PGGA 3QYBA 4D5FA 5DV5A 3HXLA 3PNVA 2H8WA 4DOZA 2HI3A 4HF2A 3K6GA 3MD2A 4A93J 3TW6A 2HYJA 5D8KB 2FRHA 2ISZA 3F9KA 3P5JA 3CCUI 1S3JA 4O5VA 1QU3A 4XRSG 2W7NA 1O3SA 3DLAA 1FNNA 3JTHA 4IHXA 4DNCA 1P7IA 2NS8A 2D1HA 2XVCA 1HCRA 1FIPA 1T08B 3K1NA 4N9IA 4B47A 3RQ4A 1XSVA 4RGXA 1IO2A 1B9MA 1MZBA 2E34A 3LSKA 4XLFA 3UNGC 3ZPLA 4LK0F 1JKPC 3HB9A 4UUSB 2ZNYA 2LVSA 1XSXA 3K2AA 4BKXA 2Y31A 5CQEA 4LOCA 5KVRA 2A68F 2DA4A 2V26A 4E7HA 2VN2A 2QEXI 2B0LA 1L0OC 2JSCA 1T95A 3QYFA 2XB0X 3LSIA 3CCQI 4RAZA 3J81K 2BVMA 2CQ7A 2HOTA 1UHMA 4AUXA 5BOXA 1QA6A 3OYGA 2H6CA 4ASNA 1T6SA 3IH4A 5EEHA 3BROA 2FSWA 2K85A 2ZXHA 3U1KA 2L7ZA 5JLXA 2GAUA 2OCEA 2IRFG 3GMEA 3GUDA 3MMYB 1NTCA 4V2FA 2P81A 3V4GA 2GM4A 1Z3YA 1LQ1A 4I2OA 3H36A 3MVPA 1R71A 1IN6A 5GPCA 3VYUB 2BGCA 5E1WA 3MKLA 5J1YA 2VKHA 2L7KA 4QPOA 2K9MA 3JAMK 1S5LC 2MG4A 3W2AA 3HZJA 5FGMA 2CQNA 5EGOA 3SJMA 1QBJA 5FKNA 1YYVA 1QPMA 1SMYF 3A03A 5ICGA 2HDCA 4I6ZA 2NNNA 3EUHC 4M71A 3DBRB 4IJAA 4G9YA 2TCTA 1GT0C 1J75A 2B63J 5BMZA 2STTA 5AIPA 2XC7A 1BI2A 1IXRC 2RDPA 4A3LJ 2ID6A 3K70D 2RQPA 2NNYA 1FIAA 3EUHA 2G7HA 2NVUB 2CWEA 4A0XA 5F0FA 1R9TJ 3PSFA 2V6EA 2BV6A 3DLLF 2L0KA 3CC2I 1LNWA 1LVAA 4GYGA 1PUFB 4U87A 2LP0A 3I54A 1IV6A 5GTHC 2BBYA 2A3SA 3CCSI 4ENKA 2DTZA 2QM3A 3L2CA 2XASA 3R0JA 5LEKA 3ABUA 2KP6A 2DFEA 1B8IA 2X6OA 3KP7A 2CRGA 3C2HA 2Z1DA 1I1SA 1X3UA 3MEXA 4MTDA 2OD5A 3AAFA 1Q1HA 1XSDA 3EPZA 2K9LA 3KZYA 3WE3A 4A3FJ 2FD5A 2JA5J 4A3JJ 1O3TA 1TZLA 2Q0OA 1MH4A 4PZJA 1UAAA 4FX4A 2WA0A 3L2UA 3K70C 3GTKJ 3OYFA 2HEOA 4JQFA 3D5LA 1ZQ3P 3PO3J 1QHHD 1YS6A 3KLOA 3KETA 4IHSA 1VQ6I 3WG9A 3TKYA 2E5NA 1G6NA 2ZKZA 5E79C 3FHNA 3MKZA 4FE7A 2QWWA 1SD6A 1SD5A 3ZXSA 1BM9A 2X6XA 2PFBA 3DEEA 3CMYA 3CF5F 4A69C 5E3LA 4FE4A 5TGTA 4RAGA 5D5WB 4IRHA 2DOAA 4G12A 3D1NI 3TEDA 1X1AA 3WODF 5H6RA 1UG2A 3V8KA 4EM1A 1OCZH 2PX9A 2DA1A 3O2PE 5D5UB 1W5SA 2CV1A 3HC7A 2DQRA 4HSTA 5M5YJ 2XAHA 1RETA 4BDZA 1ULYA 3H92A 1VQ4I 1ZH5A 4JK1X 2HS5A 2F5DA 3F6OA 4C9YA 2LD5A 3BCBA 1FPQA 5DCFA 4CYDA 1D0YA 2KRHA 2LMDA 5K7HA 4L9NA 3C3WA 1MSFC 2LH9A 3HOUJ 1ZR4A 2IJLA 3QAHA 1LJ9A 4M6VA 1FY7A 1G3SA 2R7FA 1EKEA 2JRTA 2R7TA 1X3ZB 2IA1A 4HDVA 2PLYA 5B3SH 1FMWA 2Y30A 1X4OA 1IF1A 3TP3A 4ON0A 1IC8A 2PG4A 1R5HA 5LD2C 1DPRA 2L7FP 2HQAA 2Q1ZB 4Y4RA 5E8GA 2EQRA 2EZKA 4CCKA 3IH2A 2KIMA 4ZYDA 3S2WA 3M8JA 2GLOA 3KP5A 1L3LA 4ZZLA 3CDHA 3CTAA 1NK3P 1MSEC 1RRJA 4A3CJ 3F8FA 3LFUA 2F4MB 4HX8A 2MC3A 1WWXA 3OYJA 3DBHB 2V7FA 1AHDP 1YIOA 2LTPA 5F27A 1GHCA 2RV8A 2M0MA 3ASOH 3M8FA 4P96A 1XGSA 3GX4X 2JVHA 4G7OF 2UWMA 3N05A 3H9JA 1QVUA 5IT3A 1D8KA 2H6BA 2VBXA 4ENJA 3ONQA 2HQNA 4C2TA 2G0EA 4U7BA 4DYCA 2DDAA 4ABZA 3CP2A 4BQAA 5DDGA 4W1UA 4I0BA 3BJAA 4C2UA 1FTZA 1XS9A 2CH0A 3BJOA 3SHFA 2RKHA 3B6CA 2WAQA 2M4GA 3CDLA 3GZ6A 4BJ6C 1NHAA 1SFXA 1J9IA 1N75A 4AYBA 2FQ3A 1UCRA 4CDGA 3RYRA 3P9KA 5D6EA 3ERED 4IF4A 3PO2J 1FZPB 1N78A 2K5CA 4EJOA 5HOOA 3IL2A 5E20A 1B59A 4AYBN 3F8MA 3NRVA 4HAMA 2W57A 3Q9SA 2K4BA 1B72B 4AIDA 2MA3A 5K5RA 3CC7I 4M6YA 2OAZA 3PFYA 1VTNC 4ZYGA 1WGXA 2UZKA 4XRFA 2LNBA 2QKMB 2XGCA 3UR3C 2ZCWA 4R79A 1MBJA 4OIPF 2RN7A 4WXDA 3LSHA 5AIQA 4CGZA 4ESFA 2DAOA 1SMTA 3BY6A 1XCVA 2VQLA 3CJNA 3OWTA 4HSRA 1OCPA 2AHQA 2VKDA 2N8GA 3ZQHA 4A2UA 5DM7F 4BS9A 4EATA 1IUFA 2X1CA 1T98A 4I01A 1BC8C 3ZQLA 1TWFJ 2A5WA 2HGCA 1VQOI 2HPIA 2X85A 2CYYA 2JK3A 3L7WA 4XNFA 4IRIA 4Y17A 4EQQA 1HW5A 3DPTA 1YW8A 1MDMA 4ESJA 2KKOA 1J0RA 3QQAA 4C30A 3S14J 3I4PA 4UHTA 2O3FA 4XK4A 2I5UA 3AG2H 5F1RA 3NWTA 2KL4A 3FHZA 3AG4H 5IYCJ 2Q2EA 4BE2A 3V7CA 2DPUA 1TQPA 3QYEA 3JRGA 3ZN1A 4AIJA 4ZDLA 4E7LA 3TDUC 1BBYA 3CP8A 4NQWB 1DPUA 3JREA 3BR1A 1K7AA 1ITYA 3J7AO 2KZVA 1YG2A 4XRSA 1UELB 1SFEA 2O03A 2LSOA 3ZCOA 5GADJ 4RBOA 2IVMA 3LA3A 4HNVA 4L0ZB 1E17A 2QZ8A 3KP6A 5TJJA 3ZMSA 4M3FA 3WTZA 1JHHA 2FNAA 2XSJC 2DA5A 4MNUA 1P4AA 3Q3SA 3V7RA 4YIFA 5BS6A 3GTQJ 4II2A 2UV1A 3KIOA 3L1PA 2VI6A 1ETVA 4OMYA 1ZHFA 2EPFA 5LLQA 3K4MA 4CCJA 4UNOA 1AA7A 1UJ8A 1ON2A 3MWMA 3JRIA 2X4HA 2VC0A 2Q8KA 4BQOA 2KMUA 4D5CA 5L3FA 2PMZA 4Q47A 1E0EA 4G6DA 1X1BA 2O8XA 2XAQA 2JA6J 1WZ2A 2Z16A 1MNEA 3CF2A 2O5RA 2IGMA 4PFOA 4O3MA 1QNTA 2FF4A 1ETXA 1DGWY 1QVTA 2DMTA 2ZFWA 3DBLB 4Y7NJ 5K7ZA 4BE0A 2PMZN 3V8JA 1W7PD 1B72A 2HFHA 2DT7B 3A1YA 4BY7J 5J4YA 1XTAA 3HTSB 3I64A 3BR5A 3K2ZA 3ERMA 1UFMA 2VPRA 2R4GA 2XKOA 1J2XA 1BW6A 1ZLJA 2F5EA 1OPCA 1QZEA 1S7OA 4CCLA 2R7WA 4RAFA 2XAFA 5EJCA 3CCRI 1YJWI 3HPHA 2HQRA 4JP0A 3BR6A 1UZCA 3SEZA 1B1BA 1APLC 4MO7A 1JXSA 3PUBA 1MJBA 1TTYA 4XKWA 3T8TA 1MBFA 2KIQA 2XRNA 1YTYA 2HXIA 2YU3A 4BBSJ 3HOXJ 3CCVI 3LSRA 3RKYA 4V19K 1W4MA 2VBYA 2PJPA 3OR1C 1X2MA 4YIRX 3ZMUA 4A5NA 2QENA 1BN5A 5LHIA 1MMSA 3OYIA 2CW8A 3DKWA 3RKWA 4F92B 4YIIA 1IN5A 1RZ4A 3FXMA 1IN7A 3VPRA 2G7UA 2JJ7A 3JSOA 5DYMA 1VI0A 2EK5A 1WPKA 2E60A 1NH3A 2QKLB 2JWTA 1W7PA 3M1EA 1W5TA 4ZZDA 2KHMA 2PBIA 5LGTA 3WHCA 4ETSA 5IP6A 3F22A 1IRGA 3F0CA 3GTMJ 3OL3A 1X2NA 3HTUA 2ISYA 2EZHA 1LVKA 4UV9A 1U8RA 2VKEA 3G73A 2X9DA 4G94A 2F6CA 3L09A 4NUBA 4BHPA 1XN7A 3TO9A 2GXAA 4JX4A 2R7RA 1XB4A 3LQQA 3RPQA 3G1MA 1X1DA 3EUKL 2ZMEB 1POGA 2BY1A 3TP0A 2WY8Q 2PN6A 3BQZA 4S05A 2WY7Q 5L3EA 5FLXZ 4KNYA 3AG1H 3E5UA 5B1AH 1K79A 5FKLA 2L5QA 1DU6A 1I3AA 1SVLA 5J8FA 2ZSHB 3GTOJ 3HGGA 5D5VB 2H1LA 3DTKA 3RPUD 4UVAA 5DCMB 1UB9A 1FX7A 2L9RA 3KPHA 3REOA 4A0ZA 3QP6A 1KA8A 5F0CA 3VODA 4LD5A 3CJQB 1V54H 3OS1A 3OS2A 1K6YA 1G3YA 3I58A 3GEZA 4GGGA 3CCEI 1Z91A 1Z21A 4MQ9F 1HSTA 1WKMA 2CFOA 2VL8A 3EDPA 4BEHB 2QQBA 3F6VA 4G7HF 2TDXA 3HDDA 1YX3A 3WTVC 2VOPA 1EA3A 4F52A 3FXRA 1T56A 1S8NA 1Y1WJ 2IS6A 2ELJA 4XICA 1HDDC 1FYKA 2C6YA 3HEFA 4QPQA 1LUJB 5JVGF 4MLOA 5CVRA 2W48A 5HLHA 4U7DA 1GDTA 5A2QZ 3ZP5A 2H09A 3W2VA 4XMYA 1FBQA 3KYLA 2NVTJ 4NBQA 3RPUA 1XX5A 3OYDA 2R0QC 4Q48A 3RZDJ 5C3EJ 3DEWA 2UUZA 2AS5F 2V79A 2CG4A 2BY3A 3LWFA 2MBFA 1X1PA 4IQ4A 2QSHX 5IT9Z 3J80Z 4DZJA 3PM1A 1FEXA 3EUAA 2GIVA 1KONA 3ECHA 2PJRA 1JT6A 3S32A 4NDLA 4DBRA 3LAJA 1JGGA 4HNUA 5FFXA 3K4BA 3MCZA 3O8GA 2O9LA 4HX4A 4AIHA 4AIKA 4L9JA 1ENHA 2OUMA 5H6QA 4HDUA 3FXJA 4KA4A 1V3FA 2DODA 5CPRB 5DUKA 2IS4A 3KEOA 5E18F 1WVRA 1Z0XA 2V9VA 2ZJPF 4XBFA 4NC7A 2K9QA 1U9OA 3OYCA 1A6QA 1W36D 3ULQB 2UXNA 2OV7A 3DTIA 3LOCA 4XKCA 5B66C 2P5KA 1QHGA 4G6TB 4IHTA 4I98B 1WI9A 4XN0A 5KK1A 1O3RA 1QPIA 5FKMA 2E7WA 4PDKA 3I4NJ 1MMDA 3M8EA 3F21A 3GFLA 4IZZA 1T0FC 3C7JA 2VC1A 3FM5A 1TP4A 2DPDA 1H0MA 4DYQA 5F04A 2MH9A 3M4OJ 2ZC2A 5CYVA 3KX2A 2R7DA 1M1EB 3M07A 3ML6A 3DKXA 5DCMA 1T0FA 2F5CA 2VKVA 4UB8C 4R1HA 3DWLE 5DUIA 1BA5A 1TQMA 1TW3A 5J3LA 2DMQA 4NB5A 5GAEJ 1XPXA 3C2BA 3IAS2 4I7HA 1W36C 3S17J 3BLYA 2DMNA 1S7AA 3G3ZA 2ZJQF 5EG0B 1I3QJ 4BEHA 4Y13A 3BG3A 1DP7P 1R5ID 1B8IB 1VQ5I 4HW0A 2YX7A 3K1MA 3E6CC 1XGOA 4B48A 5E8IA 2LFBA 2OZ6A 1IZ1A 2BY2A 4G6QA 4B8XA 1HA8A 1KU3A 2K3PA 2FU4A 3RZOJ 1ETYA 2HVSA 5JHUA 3BZCA
chains in the Genus database with same CATH topology
2R5ZB 1UG2A 1YRNB 2DA1A 3RKQA 2M8GX 4JYKA 2M34A 5M5YJ 2ECBA 2ELKA 1RETA 2MW8A 3H0GJ 1JTXA 1F43A 4B3AA 2R7ZJ 2LD5A 3OOUA 1WCMJ 3S15J 5K7HA 3FISA 1MSFC 3HOUJ 1ZR4A 4DYRA 1JJ6C 2LLKA 4AC0A 3OSFA 1RESA 4M6VA 2YU9J 3JRBA 3GTGJ 3HGYA 5IPAA 1T33A 2DN0A 2Y30A 3S1QJ 2TRTA 3TP3A 5EZGA 4IHWA 5EZHA 1Q1VA 3S1RJ 3OSGA 5IOYA 4A3DJ 1TWGJ 5C44J 1LFUP 1IC8A 3E7LA 1EF4A 4A3BJ 2L7FP 2ME0A 2EQRA 1IG7A 2EZKA 1H8AC 2JA8J 1W0UA 2L7MP 3IH2A 1JKRC 4M3BA 1O4XA 2GLOA 2MGQA 4IHVA 3GTPJ 3S2DJ 2YS9A 1NK3P 3JRHA 1MSEC 4CYCA 3FK7A 3G1OA 1MBGA 4A3CJ 2XSDC 3BR0A 4A3GJ 1AHDP 2LTPA 1TWHJ 5F27A 3LSGA 9ANTA 1RKWA 4C2MJ 1QVUA 2IEKA 4MFDA 3A01B 1WH5A 1HF0A 4BBRJ 3MN2A 3IV5A 1ZKGA 2G0EA 1F36A 4DYCA 3LNQA 4ABZA 1HLVA 4DW6A 3K7AJ 3S1NJ 2E19A 4W1UA 1FTZA 1XS9A 4A3KJ 4Y52J 5IOZA 4CYCB 5EF6A 3B6CA 1ORKA 3BTLA 3CDLA 3M3YJ 3GTLJ 2DA6A 5EEAA 5IYDJ 2E2HJ 5DTDA 1AU7A 2M9HA 2XPVA 1TWAJ 2XRLA 5EG0A 2K40A 1FJLA 2HOAA 3PO2J 1IDYA 5F1JA 4FCYA 4A3IJ 2EZLA 1H89C 4AYBN 2CQXA 1YRNA 1B72B 4JX6A 4IHYA 5FJ8J 5EDNA 2COBA 2XB5A 3ZOBA 4QSHA 5E3NA 5M3MJ 3HOWJ 1WH7A 1WGXA 3Q0UA 4X1EA 1XG1A 1CQTA 2XGCA 5BNGA 1ETKA 4D7MA 3Q0WA 2ECCA 2LY9A 2E2IJ 1WI3A 1MBJA 3QPLA 5E3MA 1U78A 4I76A 3GBGA 1HDPA 1JT0A 1GV2A 1JKOC 1HOMA 3O8HA 1OCPA 2AHQA 1BW5A 2CUEA 2N8GA 3ZQHA 3S1MJ 1IUFA 2XPUA 2ME6A 4QTRA 3ZQLA 1TWFJ 1S7EA 2AO9A 4A3EJ 4M3GA 2CQQA 1JTYA 2KT0A 4BXXJ 2JK3A 2WV1A 1A6IA 1IDZA 3QQAA 4D7NA 1BL0A 3S14J 1SFOJ 4XK4A 2MSYA 2EBIA 5IP9J 5FLVA 1LFBA 5IP7J 5IYCJ 2HXOA 3JRGA 1I50J 2DA3A 4IEJA 1RKTA 1QRYA 3JREA 2JA7J 3BR1A 3A01A 3H3VK 1ITYA 2OPTA 4XRSA 3DCFA 1VFCA 4RBOA 2K9SA 2X48A 2H1KA 4HNVA 4M3FA 3B6AA 2RAEA 3BQYA 1ZR2A 2DA5A 3GTQJ 3Q3SA 5F0HA 1ETWA 2CJJA 3OIOA 2VI6A 3L1PA 1DU0A 1ZTRA 1ETVA 2QCOA 3HOZJ 5C4JJ 3JRIA 4V2GA 4D5CA 3Q0VA 4JX5A 1ZK8A 4X6AJ 3ZQGA 3TW7A 5J1RA 2JA6J 4A3MJ 2JMWA 3HBLA 1ETXA 4L5EA 1QVTA 2DMTA 4Y7NJ 2Y9ZA 5K7ZA 2PMZN 1B72A 1NK2P 4BY7J 1FTTA 3UKGA 3BT9A 2M2EA 2VUMJ 3BR5A 3FK6A 1ETOA 5FLMJ 2VPRA 3BTIA 3JRDA 3ZQCA 1BW6A 4XIDA 1VF9A 4MFEA 2HQ5A 3NARA 2XGEA 5F08A 4JP0A 3BR6A 2FJ1A 2DA7A 5GP9A 2JN6A 1APLC 2NVYJ 3BR3A 4MO7A 3HOVJ 1E3OC 1D5YA 1MBFA 1OJLA 2HXIA 3BG9A 3HOXJ 4BBSJ 3LSRA 2R92J 5M3FJ 1X2MA 1I6HJ 2LKXA 5DS9A 3BTCA 1G2HA 1MBHA 5EGOB 3VPRA 1X58A 2IBDA 2JJ7A 1VI0A 1TWCJ 1WPKA 2K9NA 3FIWA 3JR9A 2JWTA 4C3JJ 2EH3A 3S2HJ 2H8RA 2FX0A 1ZGWA 2LK2A 2Y2ZA 3WHCA 4S0HB 5IP6A 3F0CA 2DA2A 1U9NA 2Y0SN 3GTMJ 1X2NA 2FQ4A 2EZHA 1GUUA 2O8KA 1IJWC 5EYRA 2VKEA 1XC5A 2KDZA 2NVXJ 2X9DA 3CQZJ 3W6VA 2CU7A 2IAIA 3BR2A 4UUSA 2E1OA 4JX4A 1LE8B 2CUFA 3G1MA 5HODA 5E3OA 4BY1J 1POGA 3ZQFA 3TP0A 1RPWA 3FKIJ 3S16J 3BQZA 2HDDA 4D5FA 4M3DA 5J1UA 2HI3A 2LR8A 4MIMA 5FKLA 4A93J 1DU6A 3TW6A 2DMPA 2HYJA 2EZIA 3GTOJ 2O7OA 3HGGA 4C3IJ 3JRFA 3BG5A 4XRSG 2L9RA 2XPWA 4IHXA 1JJ8C 1P7IA 1UHSA 2NS8A 1HCRA 5F0CA 2R93J 4B1RA 1FIPA 1JGGA 1OCTC 1MBKA 1JKPC 3HB9A 5FKKA 4UUSB 4FTHA 1H88C 5JLWA 1A5JA 4J19A 3QPSA 1TC3C 2LVSA 3G1LA 5M5XJ 3K2AA 4BKXA 2Y31A 4LOCA 3SFIA 2DA4A 3HDDA 1W0TA 1JUPA 5FKOA 3RQIA 3HOYJ 2XB0X 2WB1N 1T56A 1Y1WJ 2HOTA 3CCYA 4AUXA 4XICA 1HDDC 3NAUA 1JKQC 2YUSA 2DMUA 3HEFA 3IH4A 4MLOA 3HKZN 2W48A 3BTJA 1GDTA 3LSPA 2L7ZA 5JLXA 3ZQIA 4C3HJ 1UMQA 1JUMA 2NVTJ 2R0QC 1NTCA 4V2FA 3RZDJ 2P81A 4EEFG 3DEWA 5C3EJ 5C4XJ 2I10A 2GM4A 2HOSA 3MVPA 5GPCA 1VNDA 3MKLA 1PUFA 2D5VA 5J1YA 4DZJA 3PM1A 1FEXA 1GV5A 2MG4A 5GPAA 1JT6A 5EGOA 3SJMA 4QIWN 5FKNA 4NDLA 3A03A 2O9LA 1JUSA 3O8GA 4I6ZA 1AKHA 2TCTA 1GT0C 2B63J 2NOGA 1K83J 5K7FA 2DJNA 1ENHA 3A02A 4A3LJ 1Y1VJ 2ID6A 3IH3A 1FIAA 2OF7A 3I4MJ 1Z0XA 5F0FA 1R9TJ 3LSJA 4W97A 1MBEA 2L0KA 2K9QA 1U8BA 1U9OA 2ID3A 1PUFB 4M3EA 2LP0A 1IV6A 2GBYA 2QF7A 1OFCX 3LOCA 1ETQA 5IYBJ 2DTZA 1LE8A 4B4CA 2M0CA 1QPIA 3I4NJ 2WAQN 5FKMA 3JRCA 1B8IA 1GVDA 2X6OA 1AKHB 2CRGA 3SDGA 4DYQA 1RR7A 5F04A 3WHBA 3GTJJ 2R5YA 3M4OJ 2NVQJ 1MH3A 1Z77A 4FISA 4A3FJ 2FD5A 2JA5J 3JRAA 4A3JJ 1P7JA 1SANA 2NS7A 2R5ZA 2VKVA 1MH4A 4DZPA 3GTKJ 1BA5A 1MNMC 2ZB9A 5J3LA 2DMQA 4RDUA 1K61A 1ZQ3P 3PO3J 3C2BA 1BJZA 3S17J 2DMNA 1IGNA 4FE7A 5EG0B 1I3QJ 3CMYA 2Y9YA 3BG3A 4XRMA 1B8IB 4A69C 5E3LA 4FE4A 4UUTA 5M5WJ 1IRZA 2R5YB 2LFBA 2E2JJ 3HM5A 4GFBA 2XGDA 4G12A 3RZOJ 3D1NI 1ETYA 3TEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Z B;  1UG2 A;  1YRN B;  2DA1 A;  3RKQ A;  2M8G X;  4JYK A;  2M34 A;  5M5Y J;  2ECB A;  2ELK A;  1RET A;  2MW8 A;  3H0G J;  1JTX A;  1F43 A;  4B3A A;  2R7Z J;  2LD5 A;  3OOU A;  1WCM J;  3S15 J;  5K7H A;  3FIS A;  1MSF C;  3HOU J;  1ZR4 A;  4DYR A;  1JJ6 C;  2LLK A;  4AC0 A;  3OSF A;  1RES A;  4M6V A;  2YU9 J;  3JRB A;  3GTG J;  3HGY A;  5IPA A;  1T33 A;  2DN0 A;  2Y30 A;  3S1Q J;  2TRT A;  3TP3 A;  5EZG A;  4IHW A;  5EZH A;  1Q1V A;  3S1R J;  3OSG A;  5IOY A;  4A3D J;  1TWG J;  5C44 J;  1LFU P;  1IC8 A;  3E7L A;  1EF4 A;  4A3B J;  2L7F P;  2ME0 A;  2EQR A;  1IG7 A;  2EZK A;  1H8A C;  2JA8 J;  1W0U A;  2L7M P;  3IH2 A;  1JKR C;  4M3B A;  1O4X A;  2GLO A;  2MGQ A;  4IHV A;  3GTP J;  3S2D J;  2YS9 A;  1NK3 P;  3JRH A;  1MSE C;  4CYC A;  3FK7 A;  3G1O A;  1MBG A;  4A3C J;  2XSD C;  3BR0 A;  4A3G J;  1AHD P;  2LTP A;  1TWH J;  5F27 A;  3LSG A;  9ANT A;  1RKW A;  4C2M J;  1QVU A;  2IEK A;  4MFD A;  3A01 B;  1WH5 A;  1HF0 A;  4BBR J;  3MN2 A;  3IV5 A;  1ZKG A;  2G0E A;  1F36 A;  4DYC A;  3LNQ A;  4ABZ A;  1HLV A;  4DW6 A;  3K7A J;  3S1N J;  2E19 A;  4W1U A;  1FTZ A;  1XS9 A;  4A3K J;  4Y52 J;  5IOZ A;  4CYC B;  5EF6 A;  3B6C A;  1ORK A;  3BTL A;  3CDL A;  3M3Y J;  3GTL J;  2DA6 A;  5EEA A;  5IYD J;  2E2H J;  5DTD A;  1AU7 A;  2M9H A;  2XPV A;  1TWA J;  2XRL A;  5EG0 A;  2K40 A;  1FJL A;  2HOA A;  3PO2 J;  1IDY A;  5F1J A;  4FCY A;  4A3I J;  2EZL A;  1H89 C;  4AYB N;  2CQX A;  1YRN A;  1B72 B;  4JX6 A;  4IHY A;  5FJ8 J;  5EDN A;  2COB A;  2XB5 A;  3ZOB A;  4QSH A;  5E3N A;  5M3M J;  3HOW J;  1WH7 A;  1WGX A;  3Q0U A;  4X1E A;  1XG1 A;  1CQT A;  2XGC A;  5BNG A;  1ETK A;  4D7M A;  3Q0W A;  2ECC A;  2LY9 A;  2E2I J;  1WI3 A;  1MBJ A;  3QPL A;  5E3M A;  1U78 A;  4I76 A;  3GBG A;  1HDP A;  1JT0 A;  1GV2 A;  1JKO C;  1HOM A;  3O8H A;  1OCP A;  2AHQ A;  1BW5 A;  2CUE A;  2N8G A;  3ZQH A;  3S1M J;  1IUF A;  2XPU A;  2ME6 A;  4QTR A;  3ZQL A;  1TWF J;  1S7E A;  2AO9 A;  4A3E J;  4M3G A;  2CQQ A;  1JTY A;  2KT0 A;  4BXX J;  2JK3 A;  2WV1 A;  1A6I A;  1IDZ A;  3QQA A;  4D7N A;  1BL0 A;  3S14 J;  1SFO J;  4XK4 A;  2MSY A;  2EBI A;  5IP9 J;  5FLV A;  1LFB A;  5IP7 J;  5IYC J;  2HXO A;  3JRG A;  1I50 J;  2DA3 A;  4IEJ A;  1RKT A;  1QRY A;  3JRE A;  2JA7 J;  3BR1 A;  3A01 A;  3H3V K;  1ITY A;  2OPT A;  4XRS A;  3DCF A;  1VFC A;  4RBO A;  2K9S A;  2X48 A;  2H1K A;  4HNV A;  4M3F A;  3B6A A;  2RAE A;  3BQY A;  1ZR2 A;  2DA5 A;  3GTQ J;  3Q3S A;  5F0H A;  1ETW A;  2CJJ A;  3OIO A;  2VI6 A;  3L1P A;  1DU0 A;  1ZTR A;  1ETV A;  2QCO A;  3HOZ J;  5C4J J;  3JRI A;  4V2G A;  4D5C A;  3Q0V A;  4JX5 A;  1ZK8 A;  4X6A J;  3ZQG A;  3TW7 A;  5J1R A;  2JA6 J;  4A3M J;  2JMW A;  3HBL A;  1ETX A;  4L5E A;  1QVT A;  2DMT A;  4Y7N J;  2Y9Z A;  5K7Z A;  2PMZ N;  1B72 A;  1NK2 P;  4BY7 J;  1FTT A;  3UKG A;  3BT9 A;  2M2E A;  2VUM J;  3BR5 A;  3FK6 A;  1ETO A;  5FLM J;  2VPR A;  3BTI A;  3JRD A;  3ZQC A;  1BW6 A;  4XID A;  1VF9 A;  4MFE A;  2HQ5 A;  3NAR A;  2XGE A;  5F08 A;  4JP0 A;  3BR6 A;  2FJ1 A;  2DA7 A;  5GP9 A;  2JN6 A;  1APL C;  2NVY J;  3BR3 A;  4MO7 A;  3HOV J;  1E3O C;  1D5Y A;  1MBF A;  1OJL A;  2HXI A;  3BG9 A;  3HOX J;  4BBS J;  3LSR A;  2R92 J;  5M3F J;  1X2M A;  1I6H J;  2LKX A;  5DS9 A;  3BTC A;  1G2H A;  1MBH A;  5EGO B;  3VPR A;  1X58 A;  2IBD A;  2JJ7 A;  1VI0 A;  1TWC J;  1WPK A;  2K9N A;  3FIW A;  3JR9 A;  2JWT A;  4C3J J;  2EH3 A;  3S2H J;  2H8R A;  2FX0 A;  1ZGW A;  2LK2 A;  2Y2Z A;  3WHC A;  4S0H B;  5IP6 A;  3F0C A;  2DA2 A;  1U9N A;  2Y0S N;  3GTM J;  1X2N A;  2FQ4 A;  2EZH A;  1GUU A;  2O8K A;  1IJW C;  5EYR A;  2VKE A;  1XC5 A;  2KDZ A;  2NVX J;  2X9D A;  3CQZ J;  3W6V A;  2CU7 A;  2IAI A;  3BR2 A;  4UUS A;  2E1O A;  4JX4 A;  1LE8 B;  2CUF A;  3G1M A;  5HOD A;  5E3O A;  4BY1 J;  1POG A;  3ZQF A;  3TP0 A;  1RPW A;  3FKI J;  3S16 J;  3BQZ A;  2HDD A;  4D5F A;  4M3D A;  5J1U A;  2HI3 A;  2LR8 A;  4MIM A;  5FKL A;  4A93 J;  1DU6 A;  3TW6 A;  2DMP A;  2HYJ A;  2EZI A;  3GTO J;  2O7O A;  3HGG A;  4C3I J;  3JRF A;  3BG5 A;  4XRS G;  2L9R A;  2XPW A;  4IHX A;  1JJ8 C;  1P7I A;  1UHS A;  2NS8 A;  1HCR A;  5F0C A;  2R93 J;  4B1R A;  1FIP A;  1JGG A;  1OCT C;  1MBK A;  1JKP C;  3HB9 A;  5FKK A;  4UUS B;  4FTH A;  1H88 C;  5JLW A;  1A5J A;  4J19 A;  3QPS A;  1TC3 C;  2LVS A;  3G1L A;  5M5X J;  3K2A A;  4BKX A;  2Y31 A;  4LOC A;  3SFI A;  2DA4 A;  3HDD A;  1W0T A;  1JUP A;  5FKO A;  3RQI A;  3HOY J;  2XB0 X;  2WB1 N;  1T56 A;  1Y1W J;  2HOT A;  3CCY A;  4AUX A;  4XIC A;  1HDD C;  3NAU A;  1JKQ C;  2YUS A;  2DMU A;  3HEF A;  3IH4 A;  4MLO A;  3HKZ N;  2W48 A;  3BTJ A;  1GDT A;  3LSP A;  2L7Z A;  5JLX A;  3ZQI A;  4C3H J;  1UMQ A;  1JUM A;  2NVT J;  2R0Q C;  1NTC A;  4V2F A;  3RZD J;  2P81 A;  4EEF G;  3DEW A;  5C3E J;  5C4X J;  2I10 A;  2GM4 A;  2HOS A;  3MVP A;  5GPC A;  1VND A;  3MKL A;  1PUF A;  2D5V A;  5J1Y A;  4DZJ A;  3PM1 A;  1FEX A;  1GV5 A;  2MG4 A;  5GPA A;  1JT6 A;  5EGO A;  3SJM A;  4QIW N;  5FKN A;  4NDL A;  3A03 A;  2O9L A;  1JUS A;  3O8G A;  4I6Z A;  1AKH A;  2TCT A;  1GT0 C;  2B63 J;  2NOG A;  1K83 J;  5K7F A;  2DJN A;  1ENH A;  3A02 A;  4A3L J;  1Y1V J;  2ID6 A;  3IH3 A;  1FIA A;  2OF7 A;  3I4M J;  1Z0X A;  5F0F A;  1R9T J;  3LSJ A;  4W97 A;  1MBE A;  2L0K A;  2K9Q A;  1U8B A;  1U9O A;  2ID3 A;  1PUF B;  4M3E A;  2LP0 A;  1IV6 A;  2GBY A;  2QF7 A;  1OFC X;  3LOC A;  1ETQ A;  5IYB J;  2DTZ A;  1LE8 A;  4B4C A;  2M0C A;  1QPI A;  3I4N J;  2WAQ N;  5FKM A;  3JRC A;  1B8I A;  1GVD A;  2X6O A;  1AKH B;  2CRG A;  3SDG A;  4DYQ A;  1RR7 A;  5F04 A;  3WHB A;  3GTJ J;  2R5Y A;  3M4O J;  2NVQ J;  1MH3 A;  1Z77 A;  4FIS A;  4A3F J;  2FD5 A;  2JA5 J;  3JRA A;  4A3J J;  1P7J A;  1SAN A;  2NS7 A;  2R5Z A;  2VKV A;  1MH4 A;  4DZP A;  3GTK J;  1BA5 A;  1MNM C;  2ZB9 A;  5J3L A;  2DMQ A;  4RDU A;  1K61 A;  1ZQ3 P;  3PO3 J;  3C2B A;  1BJZ A;  3S17 J;  2DMN A;  1IGN A;  4FE7 A;  5EG0 B;  1I3Q J;  3CMY A;  2Y9Y A;  3BG3 A;  4XRM A;  1B8I B;  4A69 C;  5E3L A;  4FE4 A;  4UUT A;  5M5W J;  1IRZ A;  2R5Y B;  2LFB A;  2E2J J;  3HM5 A;  4GFB A;  2XGD A;  4G12 A;  3RZO J;  3D1N I;  1ETY A;  3TED A; 
#chains in the Genus database with same CATH topology
 2COM A;  3FM3 A;  4CCN A;  2ELK A;  3H0G J;  1SVO A;  3OYK A;  1I1G A;  2CUJ A;  1JTX A;  3BJ6 A;  2P0W A;  4CH7 A;  1ZYR F;  1QO0 D;  2R7Z J;  4LG3 A;  3DF8 A;  3H3U A;  1WCM J;  3S15 J;  2P6S A;  2VQC A;  3SZP A;  3H3Z A;  2EA4 A;  2KJB A;  2BHY A;  1PYV A;  1JJ6 C;  1ZAR A;  2LLK A;  3DP7 A;  3LAP A;  3OSF A;  1VQL I;  4OOI A;  1U6G A;  2YU9 J;  2A07 F;  4LG0 B;  1BOB A;  3JRB A;  4Q4Z F;  2DOF A;  1V4R A;  1T33 A;  2BYV E;  2BOL A;  5FRN A;  2X51 A;  4IHW A;  5EZH A;  2AXT C;  1OYI A;  1TWG J;  2V9P A;  3FF5 A;  5C44 J;  1EF4 A;  2Z3Y A;  1SAU A;  5D8L B;  3RJP A;  2ME0 A;  1TT5 B;  4PJ0 C;  1SFU A;  3OOP A;  4F91 B;  4IHV A;  2MGQ A;  2L2O A;  1J59 A;  1NG7 A;  1U0J A;  3SQN A;  3TOA A;  3Q5F A;  1MJ9 A;  1QZZ A;  3U2R A;  4CYC A;  3N97 A;  3ZMT A;  1VZ0 A;  3FK7 A;  1MBG A;  5JFR A;  3D5R C;  3S3O A;  2XSD C;  3OL4 A;  1W5C C;  3FXK A;  1TWH J;  4CIC A;  3LSG A;  4PSW A;  4KIT B;  3BC8 A;  4ENM A;  1RKW A;  4A0Y A;  2IEK A;  3FXU A;  3I9V 2;  2ZFU A;  3LNQ A;  4OU0 A;  2DQL A;  4ZTF A;  2L4M A;  2FBI A;  1KGS A;  3P9I A;  2HTJ A;  4IOC F;  4A3K J;  1PDN C;  2X6W A;  3HSF A;  5L3B A;  4F3Q A;  5EF6 A;  2HZD A;  1ORK A;  3X2Q H;  2RQQ A;  5EEA A;  3P7N A;  4EVI A;  1XGM A;  2E1M C;  2FOW A;  3F8C A;  2K86 A;  2OC6 A;  3ZGK A;  2A5Y B;  1IXC A;  2VT2 A;  4A12 A;  4BHC A;  5EG0 A;  1VQN I;  2XGX A;  5E1Z B;  2E5Z A;  2K40 A;  4BUP A;  2HOA A;  2QBY B;  3K69 A;  4D1Q A;  1G4D A;  2V6C A;  4CCM A;  4EJV A;  5F1J A;  4P55 A;  2ZSI B;  3T8R A;  4FCY A;  5CLS A;  3DPL C;  2HR3 A;  4U0Y A;  2OBP A;  2CQX A;  4EM2 A;  1R5G A;  4MEX F;  2HDW A;  4YFX F;  3MKY B;  3KYC B;  1G3W A;  2LF8 A;  2XB5 A;  2ADU A;  2X1D A;  4KN4 X;  3OYN A;  5TRD A;  3DU5 A;  2RRE A;  1GLN A;  3W2W A;  2R7V A;  2EFP A;  1CQT A;  2E7X A;  1R36 A;  3OYM A;  2RC4 A;  4XL9 A;  5BNG A;  1ETK A;  1A31 A;  2QQA A;  3TO6 A;  2ECC A;  4AD9 A;  1WI3 A;  4A5M A;  5CVU A;  2DBB A;  5GAG J;  1IXS B;  2BEO A;  4OMZ A;  2QA4 I;  1S29 A;  1U78 A;  3GBG A;  1BI1 A;  1HDP A;  3S3M A;  3CZ6 A;  5GTI C;  4QWQ A;  3RSN A;  2HKX A;  1Z67 A;  4LG0 A;  4BQQ A;  1HOM A;  3HRT A;  4E7S A;  4D9J A;  3GFI A;  3QP5 A;  3LA7 A;  2CUE A;  2PEX A;  3BZ6 A;  3OIP A;  5D4R A;  1XMK A;  2F2E A;  4QTR A;  4H4K C;  1FSH A;  1KU2 A;  2AO9 A;  3S8P A;  4MHG A;  2MLG A;  3FMR A;  3G71 I;  2KT0 A;  5K1Y A;  2LYC A;  4F55 A;  4NHJ A;  2XV4 S;  3WTT C;  4I0A A;  2IS2 A;  4D7N A;  1BL0 A;  2ESH A;  2FEZ A;  5DD8 A;  2MSY A;  5ICE A;  1ACI A;  5IP9 J;  4E7I A;  5FLV A;  3CD6 I;  5IP7 J;  2OQG A;  4UB6 C;  3CMM A;  3WU0 A;  1OR7 C;  1JE8 A;  4IEJ A;  2L3D A;  2EB7 A;  1RKT A;  5CVI A;  1QRY A;  3TGN A;  3D0S A;  4OIN F;  2VIX A;  2R7O A;  3H5R A;  2DLL A;  3ABT A;  4JOM A;  5LHH A;  3QPH A;  2ELH A;  5GAH J;  1OR7 A;  2OPT A;  4Q5S F;  5ILV A;  1EH6 A;  3QOP A;  3DCF A;  3A0H C;  2LKS A;  2VBW A;  2K9S A;  1KU7 A;  5CKT A;  2Z2S B;  1XGN A;  5HLG A;  1MDM B;  1YJN I;  2VLA A;  4IX7 A;  3BDD A;  2LKP A;  3NWS A;  4YFN F;  3F8B A;  4BU2 A;  4UV8 A;  2R3S A;  2CJJ A;  2Q2E B;  2HYG D;  1S72 I;  3B73 A;  1R4M B;  4A6E A;  1MD0 A;  4Z2Y A;  2W1O A;  3E97 A;  4BGD A;  1B9N A;  4KDP A;  4V2G A;  3RI4 A;  4FT8 A;  1ZG3 A;  3Q0V A;  1FOW A;  2AXL A;  2XAJ A;  1ZK8 A;  4JX5 A;  4L9V A;  1RIO H;  3T0Y A;  2GZW A;  2QBY A;  2DI3 A;  3NQO A;  4ANJ A;  3KLN A;  4XSZ F;  1A35 A;  2W85 A;  4WX9 A;  4CSW A;  3TQN A;  3I55 I;  4L5E A;  2Y9Z A;  3K4N A;  3WU2 C;  2Z5U A;  1FT9 A;  1NG6 A;  2W25 A;  3WGH A;  1NK2 P;  5BPD A;  1V5E A;  1D1A A;  5CJ9 A;  2J5O A;  4KFC A;  1ZG5 A;  3J81 Z;  1LEA A;  2P7C B;  2L01 A;  3L2V A;  3M7G A;  3JRD A;  1T38 A;  2QSF X;  3ASN H;  4CO8 A;  1VF9 A;  2HQ5 A;  4BH9 A;  3M1C A;  2XGE A;  2DDB A;  4I99 C;  4F7Z A;  2FJ1 A;  1SEU A;  1OCC H;  1FWZ A;  3HG9 A;  4XOT A;  3W6K B;  1Y0U A;  2NVY J;  3BR3 A;  2EIN H;  4HNT A;  4BHB A;  3G6E I;  2L54 A;  3HHG A;  3VDX A;  3CME I;  2RGV A;  2M30 A;  2VON A;  2XKP A;  3ESW B;  2P8T A;  2ZNZ A;  5KAF C;  4BAC A;  4B3X A;  1I6H J;  3FKJ A;  3OIQ A;  1LB2 A;  3I56 I;  1D0Z A;  1R4N B;  3JAM Z;  1D0X A;  1MBH A;  2IGK A;  1QZY A;  1X58 A;  2IBD A;  5FLX K;  2Y0S A;  3KFW X;  3FIW A;  3CCM I;  3ABM H;  4LFU A;  3H35 A;  3I3L A;  4EM0 B;  2FX0 A;  1ZGW A;  2LK2 A;  3GVA A;  2IXS A;  1DP3 A;  2DA2 A;  2Y0S N;  5JR3 A;  3H1C A;  5F6F A;  1GXP A;  1WSU A;  1Z6T A;  4PSX A;  1IJW C;  3ZQ7 A;  3DU6 A;  3EYY A;  1WJE A;  1P92 A;  2WAD A;  3CUQ B;  3W3C A;  2CUF A;  4RMN A;  4KJZ A;  5HLI A;  5HOD A;  2HNH A;  3HSE A;  4NC6 A;  5E3O A;  4BY1 J;  2LOO A;  3S16 J;  2K02 A;  3L2W A;  1BR4 A;  4M3D A;  3CJT B;  1HW2 A;  1W7P B;  1IRX A;  2DMP A;  2FXA A;  3E5X A;  2M7A A;  4C3I J;  4LGW A;  3JRF A;  1R6R A;  2KFD A;  5LHG A;  2VB6 A;  3HYI A;  4J00 A;  3R4K A;  5HNF A;  2I8D A;  1CGP A;  1UHS A;  2R93 J;  3PQK A;  1BI0 A;  1ODD A;  2EA2 A;  4B1R A;  1MGT A;  2M3A A;  2IP2 A;  1MBK A;  2WTE A;  3IAM 2;  4EGY A;  4LLN A;  1HKT A;  4FTH A;  1H88 C;  1PP7 U;  3KYD B;  1OYW A;  1A5J A;  4J19 A;  2HZT A;  3ABL H;  1FYL A;  1TC3 C;  4L9T A;  3G1L A;  4HG2 A;  1TBX A;  3HRU A;  3SFI A;  2JVG A;  2HTS A;  1EH7 A;  4HF1 A;  1W0T A;  2LC2 A;  3DKY A;  3CES A;  2WAF A;  3H9Q A;  2CFX A;  3RQI A;  3HKZ A;  3HOY J;  4WF2 A;  2EV0 A;  3C1D A;  4PFP A;  4LK1 F;  3CO6 C;  2V1X A;  3BWG A;  3PJR A;  3NAU A;  5DEQ A;  2YUS A;  2DT6 A;  4B09 A;  2DMU A;  4HV5 A;  3HKZ N;  2VJI A;  3KCC A;  3BTJ A;  2HVR A;  4HZF A;  3ZQI A;  2RNJ A;  5FB2 A;  1UMQ A;  1JUM A;  5HS9 A;  2JPC A;  4CUG A;  2R7Q A;  3KEQ A;  2Y69 H;  4OIR F;  2JQ7 A;  5B1B H;  2YX4 A;  3FXQ A;  3E5Q A;  2ETH A;  1VQM I;  1VND A;  3SZG A;  2EWN A;  2KJC A;  1IAW A;  2D5V A;  3OYE A;  3WGG A;  4G8X A;  2CS3 A;  2KLO A;  1X19 A;  1GV5 A;  1Z3X A;  1TW2 A;  3KEY A;  2G9W A;  2ZXI A;  4IPA A;  2MD0 A;  3JSP A;  2GXB A;  4HF0 A;  1JUS A;  1DQU A;  1P9Q C;  5IY5 H;  1AKH A;  1WJ5 A;  2JUC A;  2W24 A;  5K7F A;  3K4K A;  1XMX A;  2DJN A;  2ZJ2 A;  3BCA A;  2LY1 A;  1Y1V J;  2H27 A;  3F3X A;  1ZLK A;  3SZT A;  3J7Z I;  4M6X A;  4AU7 A;  2P5V A;  4RB1 A;  4P1W A;  3I4M J;  4FQG A;  3TDZ C;  1TT0 A;  3CUQ C;  1MBE A;  3GW2 A;  4HRI A;  3MQ0 A;  2ID3 A;  4M3E A;  1R49 A;  1J09 A;  2GBY A;  1ETQ A;  3CUQ A;  2PJR B;  1O3Q A;  4B4C A;  3GO5 A;  4HOB A;  1R00 A;  1RC9 A;  2M0C A;  2V9K A;  3TBI A;  2MH2 A;  4HQM A;  1U5T B;  3JRC A;  1GVD A;  1ZEL A;  1OMI A;  3SDG A;  2R5Y A;  3PIO F;  3WHB A;  1JGS A;  4EJU A;  3DTE A;  2NVQ J;  4XLE A;  1HSJ A;  4RLQ A;  1ERD A;  4P9F A;  3LA2 A;  2CQK A;  3OS0 A;  3JRA A;  1FLI A;  2R5Z A;  4ITV A;  2JZY A;  2P6T A;  2Z9O A;  4DZP A;  3PFI A;  2DW4 A;  2ZB9 A;  1K61 A;  4LMY A;  2EFO A;  2CUZ A;  4AVZ A;  1BJZ A;  3LQR A;  2QVO A;  3DEU A;  2VJJ A;  4N9H A;  4GXO A;  3VOE A;  3I71 A;  1IGN A;  1D5V A;  5D5X B;  5KAI C;  4PUS A;  2CV2 A;  3BG6 A;  2ZBK A;  3AL0 C;  1SC7 A;  4L5I A;  2E2J J;  3HM5 A;  2JUG A;  3HRM A;  4UY8 I;  4GFB A;  2FML A;  2IA0 A;  2XGD A;  3P9C A;  2WV0 A;  2PI0 A;  1LEB A;  2O0Y A;  1BI3 A;  1WFX A;  1YRN B;  2FUG 2;  3RKQ A;  1C0W A;  4JYK A;  5JVT A;  2M34 A;  4I02 A;  2P5L C;  4J01 A;  4UUV A;  1WJA A;  5ILS A;  1F1Z A;  1P4W A;  2QQ9 A;  5E17 F;  4B3A A;  2GA1 A;  5K5O A;  2DO7 A;  3R60 A;  2F5F A;  5HS7 A;  4X0G A;  2D2W A;  2VPL A;  2PQ8 A;  4DYR A;  1RES A;  4PCQ A;  1Y6I A;  1OKR A;  1IN8 A;  4L18 B;  2B9S A;  5EEG A;  2DN0 A;  4KMF A;  4U0W A;  4UXN A;  5H20 A;  4U0V A;  5EZG A;  1Q1V A;  3S1R J;  2F48 A;  3OSG A;  5IOY A;  4A3D J;  2QQ8 A;  1YJ9 I;  4E7Z A;  2K4J A;  1LFU P;  3GLL A;  4ZDP A;  3PSI A;  1DUX C;  4XLC A;  2ESN A;  1IG7 A;  1H8A C;  3FBN B;  2JA8 J;  2L7M P;  1QGP A;  1JKR C;  1SAX A;  3WGI A;  1IW7 F;  3TMO A;  2YS9 A;  2R7U A;  2L9S A;  4KT5 C;  3E1S A;  1STZ A;  3G1O A;  3QU3 A;  5DM6 F;  4ENN A;  1FBU A;  4BAY A;  3QOD A;  2WAE A;  2M8E A;  3TOB A;  1U5T C;  2M1B A;  3WG7 H;  3CC4 I;  4ZTJ A;  5HDN A;  4RLF A;  5FRO A;  2CW7 A;  2ZXJ A;  2D45 A;  3L2R A;  3A01 B;  1WH5 A;  2IT0 A;  1U5T A;  4YG2 F;  4UVB A;  1Y56 A;  4I09 A;  4KUM A;  4E70 A;  1CF7 B;  4DW6 A;  3K7A J;  1O7F A;  1QQI A;  2X1E A;  2IGO A;  1OIS A;  4Y33 A;  4RM3 A;  5ICC A;  4PGH A;  4CYC B;  2R7X A;  1ZRC A;  3QPT A;  2BXY A;  4BL0 B;  3GTL J;  5LBQ A;  2DA6 A;  5CVV A;  3ROU A;  2OTL I;  5DTD A;  1AU7 A;  3MZ8 A;  2LBF B;  4ZH4 F;  2Z99 A;  2XPV A;  1TWA J;  2XRL A;  1ZN2 A;  2WBM A;  3HOS A;  4M9S A;  4IL6 C;  1FJL A;  2BZT A;  1DDN A;  3FZV A;  2XF6 A;  3ZMV A;  5HS8 A;  3K4J A;  1JI8 A;  2ZJR F;  3MFK A;  3ELK A;  5B5E C;  4A3I J;  2EZL A;  1H89 C;  2VOO A;  1YRN A;  1Z9C A;  4IHY A;  2MC4 A;  4LB6 B;  4HBL A;  1JHF A;  5FJ8 J;  1VQ8 I;  2DFI A;  4QSH A;  3GFJ A;  3HOW J;  2OTJ I;  3VYS B;  2YSR A;  1XG1 A;  4L5J A;  4NNJ A;  3AFH A;  3AG3 H;  4ZDO A;  3HSR A;  4D7M A;  3MZY A;  3Q0W A;  2LY9 A;  1YFH A;  2E2I J;  1W1W E;  3C2G A;  1X3W B;  4GCV A;  1N77 A;  2E1M B;  3EYI A;  5AON A;  2DTR A;  2L02 A;  1BIB A;  5CQG A;  3OY9 A;  4ESB A;  3SDB A;  5K5Q A;  1JKO C;  2L9N A;  2DOE A;  1F4K A;  2A05 A;  3W6J B;  3CCL I;  1BW5 A;  3GLX A;  2JT1 A;  2BHZ A;  2M87 A;  3OR2 C;  1LDJ A;  2ME6 A;  2XF7 A;  2OQR A;  3N4M A;  4M3G A;  3PUF A;  1JTY A;  4BXX J;  4BJT A;  3WTS C;  1RI7 A;  3PNT A;  4M73 A;  1HKS A;  4RM2 A;  2WV1 A;  4B43 A;  1X1C A;  2PMU A;  4EJT A;  1IDZ A;  1SFO J;  1P4X A;  2FE3 A;  3H9G A;  3COA C;  1RR8 C;  1LFB A;  1HQC A;  3ABK H;  3ISP A;  4F93 B;  2HXO A;  1I50 J;  1FP2 A;  2KPM A;  3IP4 B;  1D1C A;  2OJE D;  4RGS A;  2M45 A;  3F8N A;  2EFN A;  3DXJ F;  2CGP A;  2W00 A;  3BG7 A;  1YIT I;  3E6D A;  4DGW B;  3A01 A;  2M7B A;  1FOX A;  2EIL H;  4P9U A;  5FFZ A;  1IV8 A;  2A69 F;  5HVQ C;  3FWE A;  1VFC A;  3JTG A;  2M4K A;  1CF7 A;  3I59 A;  2H1K A;  2XHK A;  4XKB A;  3FXL A;  4PK4 A;  3H5N A;  1UHW A;  3LFK A;  1YO5 C;  3R0A A;  2NOJ B;  5FRM A;  3SFZ A;  5JHF A;  2P4W A;  1S6L A;  1KQ8 A;  1SVM A;  2GXG A;  3OIO A;  1LDD A;  3K10 A;  1DU0 A;  1ZTR A;  5CVJ A;  1MJA A;  2QCO A;  5ICF A;  3HOZ J;  1B4A A;  1B6A A;  4CHU A;  3LSM A;  2LBF A;  1KU9 A;  3GF2 A;  4N4O B;  5HLT A;  1GVJ A;  4OAY A;  3IKV A;  4YRV A;  4RS8 A;  1YW7 A;  4BQN A;  4WXC A;  3B02 A;  3ZQG A;  5J1R A;  4A3M J;  2JMW A;  3HBL A;  1ON1 A;  3CDI A;  5J4V A;  4GYI A;  4QLC U;  2IW5 A;  2B7E A;  2HWV A;  2IGN A;  1S9H A;  1FTT A;  3TL4 X;  5J6X A;  1YQA A;  3BT9 A;  3UKG A;  3FMS A;  1ETO A;  5FLM J;  2LRE A;  1FSE A;  3E6M A;  2EV6 A;  2DYS H;  2VE9 A;  4XID A;  5L3C A;  1N25 A;  2MD5 A;  3BP8 A;  5F08 A;  1D8J A;  2GIZ A;  3WTW C;  4AVP A;  5TIS C;  5GP9 A;  3HUG B;  3HOV J;  3CLQ A;  2XAG A;  1E3O C;  2O61 A;  5KHD A;  1R1U A;  1OJL A;  3H5A A;  5HNH A;  1F9N A;  3G4S I;  3CJR B;  1G8X A;  1LDK B;  2R92 J;  5M3F J;  1KYZ A;  2LKX A;  4YFK F;  4U88 A;  1R1V A;  1Y8Q B;  5LRR A;  1G2H A;  1K4S A;  2MFZ A;  4RGR A;  3RCO A;  1K4T A;  1TWC J;  4A6D A;  3V8L A;  3IUO A;  2EH3 A;  5L3G A;  4FHT A;  4LLL A;  4WCG A;  1T39 A;  2KQR A;  2Y2Z A;  4R8H A;  4S0H B;  2VXZ A;  3F23 A;  1OLT A;  2NAZ A;  1U9N A;  1SFK A;  5L3D A;  1VQP I;  4XSX F;  3IHU A;  3PQJ A;  1GUU A;  3GWZ A;  3I0T A;  1HKQ A;  3ZRG A;  4NC8 A;  4DBQ A;  4BE1 A;  2O8K A;  3PL8 A;  4OIQ F;  2F5V A;  4IO9 F;  2XIG A;  1BC7 C;  1XC5 A;  2KDZ A;  4L0Y B;  3CQZ J;  3W6V A;  2DXI A;  2CU7 A;  3BR2 A;  4UUS A;  2E1O A;  1LE8 B;  1KYW A;  4O6J A;  4IKF A;  2ZXW H;  2O6G E;  2VT3 A;  4XLA A;  3ZR8 X;  1RPW A;  3FKI J;  1EH8 A;  2HDD A;  1ZGJ A;  2FBH A;  4GDF A;  3BPV A;  5J1U A;  2LR8 A;  4MIM A;  2HYF A;  2WWY A;  2P7V B;  2EZI A;  2JTV A;  2O7O A;  3BG5 A;  3GZ5 A;  3QWL A;  1PVE A;  3HHH A;  1EJ9 A;  2XPW A;  4BYY A;  3VEP A;  2FOK A;  1JJ8 C;  1Z05 A;  5J47 A;  2CV0 A;  4M72 A;  2A6T A;  3I53 A;  4WWC A;  1OCT C;  3J7A Y;  2VJ5 A;  5FD5 A;  1ZRE A;  2E1C A;  5FKK A;  4YEJ A;  3FDY A;  2K3F A;  5JLW A;  2OCC H;  3SEQ A;  3QPS A;  3K4L A;  4AWX B;  2WB1 A;  3CUO A;  3L2Q A;  2HPM A;  4BDY A;  5M5X J;  2ZO4 A;  1U3E M;  2XRO A;  1OCO H;  4LIT A;  2A61 A;  1FMV A;  1JUP A;  5FKO A;  3CO7 C;  2QYO A;  4MEY F;  3A2K A;  2IA2 A;  4K2E A;  2UXX A;  1TQI A;  2LY2 A;  5LRS A;  1DGR M;  4RGU A;  1TNT A;  2CW0 F;  2WB1 N;  3DQV C;  1I6X A;  4ZJZ A;  3CCY A;  2EJR A;  4XLH A;  3RIR A;  1JKQ C;  4IRG A;  1PJR A;  2EFW A;  1YX5 A;  4PJM A;  3LSP A;  4WK8 F;  4C3H J;  4II3 A;  1GXQ A;  3WTU C;  3HUG A;  2W84 A;  1Y0N A;  2VOD A;  4EEF G;  5C4X J;  2NS0 A;  3RDI A;  2I10 A;  2KIU A;  2KZG A;  2VXD A;  2HOS A;  2IS1 A;  2KIS A;  1R1T A;  4CXF A;  1R22 A;  1OCR H;  2HU9 A;  1OQY A;  1WQ2 A;  1PUF A;  2L4A A;  1TL8 A;  2HVQ A;  5GPA A;  1KZH A;  4N4N B;  3VB2 A;  3F72 A;  4QIW N;  3CMA I;  5DD4 A;  1LFP A;  2V1U A;  3WTX C;  4KIC A;  4AM3 A;  2LRD A;  5JI6 A;  3QU6 A;  3K1P A;  2JA2 A;  1BOA A;  3HPG A;  2NOG A;  1K83 J;  3CCJ I;  3S93 A;  4ZYE A;  3A02 A;  2VBZ A;  3KE2 A;  3E3V A;  2FNP A;  3IH3 A;  2OF7 A;  2FMY A;  3LSJ A;  4W97 A;  2E71 A;  1YS7 A;  2R7S A;  1U8B A;  2QF7 A;  1OFC X;  1YLF A;  5FO5 A;  5IYB J;  1MND A;  1LE8 A;  2GWR A;  3RYP A;  3IWF A;  1SD4 A;  2BY0 A;  2BW3 B;  2WAQ N;  4Y15 A;  5KCM A;  1AKH B;  1YHQ I;  4HA8 A;  1VQ9 I;  1KQ9 A;  3FX3 A;  4FAS D;  1RR7 A;  4BJ5 C;  3GTJ J;  1WRJ A;  1MH3 A;  1Z77 A;  4FIS A;  2NRA C;  3KZI C;  1P7J A;  1SAN A;  2L9V A;  2NS7 A;  4N0B A;  3RKX A;  1BR1 A;  1MNM C;  5ERI A;  1Z1D A;  4RDU A;  3IWZ A;  3R61 A;  2X0L A;  1BIA A;  3GCM A;  2XUB A;  4LIV A;  3NEU A;  3SYT A;  4KIF A;  3L9F A;  5D6F A;  1P2F A;  2HKO A;  2Y9Y A;  4KMU X;  4PJL A;  4XRM A;  4IQJ A;  5M5W J;  4UUT A;  2DT5 A;  2XDV A;  1IRZ A;  3V7S A;  5LGN A;  2R5Y B;  3JCU C;  4EGZ A;  4KIS A;  2A6H F;  4ZYH A;  4HEA 2;  2VJ4 A;  1K78 B;  1VQK I;  2R5Z B;  3K0L A;  2HOE A;  3VFZ A;  3DPU A;  3OYL A;  2M8G X;  2ECB A;  2EFQ A;  2MW8 A;  1PUE E;  5A2Q K;  4ZC3 A;  1F43 A;  2DK5 A;  4HV6 A;  4XM3 A;  1LPQ A;  2ICW G;  4IOA F;  2KIF A;  3OOU A;  3HJE A;  3AKZ A;  3FIS A;  1I5Z A;  1H9G A;  3FXO A;  3CLO A;  1YI2 I;  1USS A;  4AC0 A;  3HL2 A;  4GO1 A;  2Y0M A;  5IT9 K;  3J80 K;  4G7Z F;  3GTG J;  4MGR A;  3HGY A;  1REP C;  5IPA A;  2QUF A;  3S1Q J;  4HYE A;  1O7L A;  2TRT A;  3LST A;  3IRQ A;  3AL0 B;  3OV8 A;  2LF7 A;  4LLG F;  2E35 A;  1MW7 A;  4D0P A;  4PJJ A;  4LB5 A;  3E7L A;  4A3B J;  2GOX B;  3HIF A;  3FBI B;  1FOY A;  3WE2 A;  1A36 A;  2BXZ A;  1W0U A;  4M9Z A;  1HXD A;  4M3B A;  1O4X A;  1V5G A;  1R58 A;  3GTP J;  1FP1 D;  1RNL A;  3C18 A;  3S2D J;  3JRH A;  5LFA A;  3KP3 A;  3MKW B;  4XOP A;  2IPQ X;  3MAJ A;  3E0J B;  3BR0 A;  3MZH A;  1XDS A;  3K4C A;  3K9T A;  4A3G J;  4BXF A;  4KIG A;  3IKT A;  4FX0 A;  3QRF F;  9ANT A;  1LKX A;  4M74 A;  3A0B C;  4C2M J;  1Z6R A;  2MLK A;  4XQF A;  4ZYA A;  4BXU A;  4MFD A;  2GOM A;  4Z6Y A;  2BW3 A;  2CSO A;  1HF0 A;  4OIO F;  1Z7L A;  4BBR J;  1EV7 A;  3MN2 A;  3IV5 A;  1ZKG A;  1F36 A;  4EJW A;  4PJN A;  3DFG A;  2KDO A;  1D1B A;  2QGU A;  1HLV A;  3S1N J;  4KIB A;  2RVC A;  2E19 A;  2JPB A;  3RTR A;  4E7J A;  4HX7 A;  1O57 A;  4FET A;  3VYR B;  4Y52 J;  1HBX G;  5IOZ A;  2F4O B;  2XAU A;  1BR2 A;  3BTL A;  3IC7 A;  3PIP F;  3M3Y J;  4RAY A;  5FD6 A;  4XR6 A;  4CZZ A;  5IYD J;  3ZMD A;  5BQT A;  3LMM A;  2J5P A;  2E2H J;  1HC8 A;  1P6R A;  4EMS A;  2DYR H;  2M9H A;  5J8C A;  3M9A A;  1TNS A;  2MAB A;  1MMA A;  4RB2 C;  1WJF A;  1PP8 F;  2AQF A;  4LIU A;  4IXA A;  2OA4 A;  1J5Y A;  1FBS A;  1YW9 A;  3O6B B;  3Q9V A;  1IDY A;  3OMY A;  2K27 A;  3EET A;  1G3T A;  5F64 A;  4BNC A;  3S3N A;  4XLP F;  1I39 A;  2EIJ H;  1XD7 A;  2Y75 A;  1K78 A;  1E3H A;  1FOK A;  3IRR A;  4JX6 A;  2DK8 A;  3ZN0 A;  2DU9 A;  5EDN A;  1E3P A;  1J7K A;  2COB A;  3ZOB A;  1YOV B;  5E3N A;  2VQH A;  5M3M J;  3HOT A;  3BOQ A;  1WH7 A;  1Y8R B;  1V5F A;  3Q0U A;  4X1E A;  2QLZ A;  3V42 A;  2KRC A;  2MYS A;  2KRF A;  3U21 A;  3ECO A;  3VWB A;  2M5W A;  1MKM A;  4M9X A;  1H9T A;  3QPL A;  5E3M A;  2EV5 A;  4WXH A;  1XDU A;  4I76 A;  4XLN F;  2WC2 A;  1FC3 A;  3J7Y J;  1JT0 A;  1GV2 A;  3O8H A;  2D1V A;  2RNG A;  2GA2 A;  3S1M J;  2EIK H;  2NXN B;  1Y39 A;  1R23 A;  6PAX A;  3LL7 A;  4NQW A;  4MQV A;  4KT6 A;  2XPU A;  4OWR B;  2Z33 A;  4KYW A;  2FBK A;  3VYT B;  1ZRD A;  1S7E A;  4A3E J;  1ZGA A;  2CQQ A;  2DFH A;  3H0D A;  1ZAO A;  3U1D A;  3KP4 A;  5HDG A;  5BPI A;  2OZU A;  1V55 H;  1UG0 A;  3G2B A;  3GFM A;  2YPR A;  2W82 A;  4XOR A;  1A6I A;  3U9G A;  3OYA A;  4DQ2 A;  1WJD A;  2EBI A;  2H94 A;  2DFF A;  2X6Y A;  4CA0 A;  4RB3 C;  1SD7 A;  1ZRF A;  1Z7U A;  1MMG A;  4CCO A;  1AOY A;  1YE9 A;  2DA3 A;  4MTE A;  5KNL A;  1HW1 A;  2BVL A;  2YR2 A;  2E36 A;  1XCB A;  2JA7 J;  3H3V K;  2V4J C;  4XKV A;  5ED4 A;  1R7J A;  2X48 A;  3VSK A;  1E2X A;  1U2W A;  2LG4 A;  3VSL A;  3B6A A;  2RAE A;  2GQQ A;  3BQY A;  4LJZ F;  4H0E A;  3GYH X;  1ZR2 A;  2XF5 A;  2CMP A;  1ETW A;  3FMQ A;  5F0H A;  4OAZ A;  1VQ7 I;  5LEJ A;  3L00 A;  1MMN A;  1WJC A;  2EIM H;  2VE8 A;  2F4I A;  3QOE A;  4CZC A;  1IRF A;  5C4J J;  2DJI A;  3D5S C;  4HQE A;  4XON A;  3BPX A;  1XMA A;  1K6O A;  2W4S A;  3GXO A;  1RUN A;  5ILU A;  1RUO A;  4X6A J;  4Y3O A;  5D4S A;  1ZG1 A;  1FYM A;  3TW7 A;  2Y48 A;  2OU2 A;  5J40 A;  1KQ0 A;  3I59 B;  2E1N A;  3A4C A;  1IN4 A;  5HDK A;  3WU1 B;  1WJB A;  3E6B A;  3ZQQ A;  1T8I A;  1TLH B;  5LGU A;  4HLX A;  5E1X A;  1I27 A;  2BE5 F;  2M2E A;  2V1D A;  4RA2 A;  2VUM J;  3FK6 A;  3T1B A;  1G59 A;  3BTI A;  3ZQC A;  3T5X A;  1BJA A;  5H2F C;  2PMH A;  2K7L A;  4MFE A;  3I5U A;  4P5O A;  2JRM A;  3ZMZ A;  2QSG X;  3NAR A;  4B44 A;  2A6E F;  4IVN A;  3BZK A;  3OYB A;  2DA7 A;  2JN6 A;  3PNY A;  3R6S A;  4E6K G;  1D5Y A;  2V1N A;  3KP2 A;  1UST A;  3WTY C;  3JW4 A;  3BG9 A;  3O3K A;  4JBA A;  2CO5 A;  2ZME C;  1YIJ I;  2VAS A;  5DS9 A;  3TO7 A;  3BTC A;  5EGO B;  4E4H A;  1X4P A;  2AQE A;  3DV8 A;  2ZME A;  3KZZ A;  2ACJ A;  2JSP A;  3SXY A;  4DJA A;  2K9N A;  1AWC A;  2VQG A;  4GRI A;  3JR9 A;  2DCE A;  1OYY A;  4C3J J;  4KN7 X;  1T2K A;  2STW A;  3S2H J;  2H8R A;  4S04 A;  4RB0 A;  4DIQ A;  1WHU A;  1D3Y A;  4HLY A;  2FQ4 A;  4EV0 A;  4UVC A;  3OYH A;  2LDU A;  4TV7 A;  1IUY A;  5EYR A;  2NYX A;  1MIJ A;  2NVX J;  1F5T A;  3EQL F;  4XN3 A;  2IAI A;  4E7K A;  3GZN B;  1ONV A;  1A04 A;  2FA5 A;  4YEL A;  3ZQF A;  3HRS A;  4HPQ A;  4PGG A;  3QYB A;  4D5F A;  5DV5 A;  3HXL A;  3PNV A;  2H8W A;  4DOZ A;  2HI3 A;  4HF2 A;  3K6G A;  3MD2 A;  4A93 J;  3TW6 A;  2HYJ A;  5D8K B;  2FRH A;  2ISZ A;  3F9K A;  3P5J A;  3CCU I;  1S3J A;  4O5V A;  1QU3 A;  4XRS G;  2W7N A;  1O3S A;  3DLA A;  1FNN A;  3JTH A;  4IHX A;  4DNC A;  1P7I A;  2NS8 A;  2D1H A;  2XVC A;  1HCR A;  1FIP A;  1T08 B;  3K1N A;  4N9I A;  4B47 A;  3RQ4 A;  1XSV A;  4RGX A;  1IO2 A;  1B9M A;  1MZB A;  2E34 A;  3LSK A;  4XLF A;  3UNG C;  3ZPL A;  4LK0 F;  1JKP C;  3HB9 A;  4UUS B;  2ZNY A;  2LVS A;  1XSX A;  3K2A A;  4BKX A;  2Y31 A;  5CQE A;  4LOC A;  5KVR A;  2A68 F;  2DA4 A;  2V26 A;  4E7H A;  2VN2 A;  2QEX I;  2B0L A;  1L0O C;  2JSC A;  1T95 A;  3QYF A;  2XB0 X;  3LSI A;  3CCQ I;  4RAZ A;  3J81 K;  2BVM A;  2CQ7 A;  2HOT A;  1UHM A;  4AUX A;  5BOX A;  1QA6 A;  3OYG A;  2H6C A;  4ASN A;  1T6S A;  3IH4 A;  5EEH A;  3BRO A;  2FSW A;  2K85 A;  2ZXH A;  3U1K A;  2L7Z A;  5JLX A;  2GAU A;  2OCE A;  2IRF G;  3GME A;  3GUD A;  3MMY B;  1NTC A;  4V2F A;  2P81 A;  3V4G A;  2GM4 A;  1Z3Y A;  1LQ1 A;  4I2O A;  3H36 A;  3MVP A;  1R71 A;  1IN6 A;  5GPC A;  3VYU B;  2BGC A;  5E1W A;  3MKL A;  5J1Y A;  2VKH A;  2L7K A;  4QPO A;  2K9M A;  3JAM K;  1S5L C;  2MG4 A;  3W2A A;  3HZJ A;  5FGM A;  2CQN A;  5EGO A;  3SJM A;  1QBJ A;  5FKN A;  1YYV A;  1QPM A;  1SMY F;  3A03 A;  5ICG A;  2HDC A;  4I6Z A;  2NNN A;  3EUH C;  4M71 A;  3DBR B;  4IJA A;  4G9Y A;  2TCT A;  1GT0 C;  1J75 A;  2B63 J;  5BMZ A;  2STT A;  5AIP A;  2XC7 A;  1BI2 A;  1IXR C;  2RDP A;  4A3L J;  2ID6 A;  3K70 D;  2RQP A;  2NNY A;  1FIA A;  3EUH A;  2G7H A;  2NVU B;  2CWE A;  4A0X A;  5F0F A;  1R9T J;  3PSF A;  2V6E A;  2BV6 A;  3DLL F;  2L0K A;  3CC2 I;  1LNW A;  1LVA A;  4GYG A;  1PUF B;  4U87 A;  2LP0 A;  3I54 A;  1IV6 A;  5GTH C;  2BBY A;  2A3S A;  3CCS I;  4ENK A;  2DTZ A;  2QM3 A;  3L2C A;  2XAS A;  3R0J A;  5LEK A;  3ABU A;  2KP6 A;  2DFE A;  1B8I A;  2X6O A;  3KP7 A;  2CRG A;  3C2H A;  2Z1D A;  1I1S A;  1X3U A;  3MEX A;  4MTD A;  2OD5 A;  3AAF A;  1Q1H A;  1XSD A;  3EPZ A;  2K9L A;  3KZY A;  3WE3 A;  4A3F J;  2FD5 A;  2JA5 J;  4A3J J;  1O3T A;  1TZL A;  2Q0O A;  1MH4 A;  4PZJ A;  1UAA A;  4FX4 A;  2WA0 A;  3L2U A;  3K70 C;  3GTK J;  3OYF A;  2HEO A;  4JQF A;  3D5L A;  1ZQ3 P;  3PO3 J;  1QHH D;  1YS6 A;  3KLO A;  3KET A;  4IHS A;  1VQ6 I;  3WG9 A;  3TKY A;  2E5N A;  1G6N A;  2ZKZ A;  5E79 C;  3FHN A;  3MKZ A;  4FE7 A;  2QWW A;  1SD6 A;  1SD5 A;  3ZXS A;  1BM9 A;  2X6X A;  2PFB A;  3DEE A;  3CMY A;  3CF5 F;  4A69 C;  5E3L A;  4FE4 A;  5TGT A;  4RAG A;  5D5W B;  4IRH A;  2DOA A;  4G12 A;  3D1N I;  3TED A;  1X1A A;  3WOD F;  5H6R A;  1UG2 A;  3V8K A;  4EM1 A;  1OCZ H;  2PX9 A;  2DA1 A;  3O2P E;  5D5U B;  1W5S A;  2CV1 A;  3HC7 A;  2DQR A;  4HST A;  5M5Y J;  2XAH A;  1RET A;  4BDZ A;  1ULY A;  3H92 A;  1VQ4 I;  1ZH5 A;  4JK1 X;  2HS5 A;  2F5D A;  3F6O A;  4C9Y A;  2LD5 A;  3BCB A;  1FPQ A;  5DCF A;  4CYD A;  1D0Y A;  2KRH A;  2LMD A;  5K7H A;  4L9N A;  3C3W A;  1MSF C;  2LH9 A;  3HOU J;  1ZR4 A;  2IJL A;  3QAH A;  1LJ9 A;  4M6V A;  1FY7 A;  1G3S A;  2R7F A;  1EKE A;  2JRT A;  2R7T A;  1X3Z B;  2IA1 A;  4HDV A;  2PLY A;  5B3S H;  1FMW A;  2Y30 A;  1X4O A;  1IF1 A;  3TP3 A;  4ON0 A;  1IC8 A;  2PG4 A;  1R5H A;  5LD2 C;  1DPR A;  2L7F P;  2HQA A;  2Q1Z B;  4Y4R A;  5E8G A;  2EQR A;  2EZK A;  4CCK A;  3IH2 A;  2KIM A;  4ZYD A;  3S2W A;  3M8J A;  2GLO A;  3KP5 A;  1L3L A;  4ZZL A;  3CDH A;  3CTA A;  1NK3 P;  1MSE C;  1RRJ A;  4A3C J;  3F8F A;  3LFU A;  2F4M B;  4HX8 A;  2MC3 A;  1WWX A;  3OYJ A;  3DBH B;  2V7F A;  1AHD P;  1YIO A;  2LTP A;  5F27 A;  1GHC A;  2RV8 A;  2M0M A;  3ASO H;  3M8F A;  4P96 A;  1XGS A;  3GX4 X;  2JVH A;  4G7O F;  2UWM A;  3N05 A;  3H9J A;  1QVU A;  5IT3 A;  1D8K A;  2H6B A;  2VBX A;  4ENJ A;  3ONQ A;  2HQN A;  4C2T A;  2G0E A;  4U7B A;  4DYC A;  2DDA A;  4ABZ A;  3CP2 A;  4BQA A;  5DDG A;  4W1U A;  4I0B A;  3BJA A;  4C2U A;  1FTZ A;  1XS9 A;  2CH0 A;  3BJO A;  3SHF A;  2RKH A;  3B6C A;  2WAQ A;  2M4G A;  3CDL A;  3GZ6 A;  4BJ6 C;  1NHA A;  1SFX A;  1J9I A;  1N75 A;  4AYB A;  2FQ3 A;  1UCR A;  4CDG A;  3RYR A;  3P9K A;  5D6E A;  3ERE D;  4IF4 A;  3PO2 J;  1FZP B;  1N78 A;  2K5C A;  4EJO A;  5HOO A;  3IL2 A;  5E20 A;  1B59 A;  4AYB N;  3F8M A;  3NRV A;  4HAM A;  2W57 A;  3Q9S A;  2K4B A;  1B72 B;  4AID A;  2MA3 A;  5K5R A;  3CC7 I;  4M6Y A;  2OAZ A;  3PFY A;  1VTN C;  4ZYG A;  1WGX A;  2UZK A;  4XRF A;  2LNB A;  2QKM B;  2XGC A;  3UR3 C;  2ZCW A;  4R79 A;  1MBJ A;  4OIP F;  2RN7 A;  4WXD A;  3LSH A;  5AIQ A;  4CGZ A;  4ESF A;  2DAO A;  1SMT A;  3BY6 A;  1XCV A;  2VQL A;  3CJN A;  3OWT A;  4HSR A;  1OCP A;  2AHQ A;  2VKD A;  2N8G A;  3ZQH A;  4A2U A;  5DM7 F;  4BS9 A;  4EAT A;  1IUF A;  2X1C A;  1T98 A;  4I01 A;  1BC8 C;  3ZQL A;  1TWF J;  2A5W A;  2HGC A;  1VQO I;  2HPI A;  2X85 A;  2CYY A;  2JK3 A;  3L7W A;  4XNF A;  4IRI A;  4Y17 A;  4EQQ A;  1HW5 A;  3DPT A;  1YW8 A;  1MDM A;  4ESJ A;  2KKO A;  1J0R A;  3QQA A;  4C30 A;  3S14 J;  3I4P A;  4UHT A;  2O3F A;  4XK4 A;  2I5U A;  3AG2 H;  5F1R A;  3NWT A;  2KL4 A;  3FHZ A;  3AG4 H;  5IYC J;  2Q2E A;  4BE2 A;  3V7C A;  2DPU A;  1TQP A;  3QYE A;  3JRG A;  3ZN1 A;  4AIJ A;  4ZDL A;  4E7L A;  3TDU C;  1BBY A;  3CP8 A;  4NQW B;  1DPU A;  3JRE A;  3BR1 A;  1K7A A;  1ITY A;  3J7A O;  2KZV A;  1YG2 A;  4XRS A;  1UEL B;  1SFE A;  2O03 A;  2LSO A;  3ZCO A;  5GAD J;  4RBO A;  2IVM A;  3LA3 A;  4HNV A;  4L0Z B;  1E17 A;  2QZ8 A;  3KP6 A;  5TJJ A;  3ZMS A;  4M3F A;  3WTZ A;  1JHH A;  2FNA A;  2XSJ C;  2DA5 A;  4MNU A;  1P4A A;  3Q3S A;  3V7R A;  4YIF A;  5BS6 A;  3GTQ J;  4II2 A;  2UV1 A;  3KIO A;  3L1P A;  2VI6 A;  1ETV A;  4OMY A;  1ZHF A;  2EPF A;  5LLQ A;  3K4M A;  4CCJ A;  4UNO A;  1AA7 A;  1UJ8 A;  1ON2 A;  3MWM A;  3JRI A;  2X4H A;  2VC0 A;  2Q8K A;  4BQO A;  2KMU A;  4D5C A;  5L3F A;  2PMZ A;  4Q47 A;  1E0E A;  4G6D A;  1X1B A;  2O8X A;  2XAQ A;  2JA6 J;  1WZ2 A;  2Z16 A;  1MNE A;  3CF2 A;  2O5R A;  2IGM A;  4PFO A;  4O3M A;  1QNT A;  2FF4 A;  1ETX A;  1DGW Y;  1QVT A;  2DMT A;  2ZFW A;  3DBL B;  4Y7N J;  5K7Z A;  4BE0 A;  2PMZ N;  3V8J A;  1W7P D;  1B72 A;  2HFH A;  2DT7 B;  3A1Y A;  4BY7 J;  5J4Y A;  1XTA A;  3HTS B;  3I64 A;  3BR5 A;  3K2Z A;  3ERM A;  1UFM A;  2VPR A;  2R4G A;  2XKO A;  1J2X A;  1BW6 A;  1ZLJ A;  2F5E A;  1OPC A;  1QZE A;  1S7O A;  4CCL A;  2R7W A;  4RAF A;  2XAF A;  5EJC A;  3CCR I;  1YJW I;  3HPH A;  2HQR A;  4JP0 A;  3BR6 A;  1UZC A;  3SEZ A;  1B1B A;  1APL C;  4MO7 A;  1JXS A;  3PUB A;  1MJB A;  1TTY A;  4XKW A;  3T8T A;  1MBF A;  2KIQ A;  2XRN A;  1YTY A;  2HXI A;  2YU3 A;  4BBS J;  3HOX J;  3CCV I;  3LSR A;  3RKY A;  4V19 K;  1W4M A;  2VBY A;  2PJP A;  3OR1 C;  1X2M A;  4YIR X;  3ZMU A;  4A5N A;  2QEN A;  1BN5 A;  5LHI A;  1MMS A;  3OYI A;  2CW8 A;  3DKW A;  3RKW A;  4F92 B;  4YII A;  1IN5 A;  1RZ4 A;  3FXM A;  1IN7 A;  3VPR A;  2G7U A;  2JJ7 A;  3JSO A;  5DYM A;  1VI0 A;  2EK5 A;  1WPK A;  2E60 A;  1NH3 A;  2QKL B;  2JWT A;  1W7P A;  3M1E A;  1W5T A;  4ZZD A;  2KHM A;  2PBI A;  5LGT A;  3WHC A;  4ETS A;  5IP6 A;  3F22 A;  1IRG A;  3F0C A;  3GTM J;  3OL3 A;  1X2N A;  3HTU A;  2ISY A;  2EZH A;  1LVK A;  4UV9 A;  1U8R A;  2VKE A;  3G73 A;  2X9D A;  4G94 A;  2F6C A;  3L09 A;  4NUB A;  4BHP A;  1XN7 A;  3TO9 A;  2GXA A;  4JX4 A;  2R7R A;  1XB4 A;  3LQQ A;  3RPQ A;  3G1M A;  1X1D A;  3EUK L;  2ZME B;  1POG A;  2BY1 A;  3TP0 A;  2WY8 Q;  2PN6 A;  3BQZ A;  4S05 A;  2WY7 Q;  5L3E A;  5FLX Z;  4KNY A;  3AG1 H;  3E5U A;  5B1A H;  1K79 A;  5FKL A;  2L5Q A;  1DU6 A;  1I3A A;  1SVL A;  5J8F A;  2ZSH B;  3GTO J;  3HGG A;  5D5V B;  2H1L A;  3DTK A;  3RPU D;  4UVA A;  5DCM B;  1UB9 A;  1FX7 A;  2L9R A;  3KPH A;  3REO A;  4A0Z A;  3QP6 A;  1KA8 A;  5F0C A;  3VOD A;  4LD5 A;  3CJQ B;  1V54 H;  3OS1 A;  3OS2 A;  1K6Y A;  1G3Y A;  3I58 A;  3GEZ A;  4GGG A;  3CCE I;  1Z91 A;  1Z21 A;  4MQ9 F;  1HST A;  1WKM A;  2CFO A;  2VL8 A;  3EDP A;  4BEH B;  2QQB A;  3F6V A;  4G7H F;  2TDX A;  3HDD A;  1YX3 A;  3WTV C;  2VOP A;  1EA3 A;  4F52 A;  3FXR A;  1T56 A;  1S8N A;  1Y1W J;  2IS6 A;  2ELJ A;  4XIC A;  1HDD C;  1FYK A;  2C6Y A;  3HEF A;  4QPQ A;  1LUJ B;  5JVG F;  4MLO A;  5CVR A;  2W48 A;  5HLH A;  4U7D A;  1GDT A;  5A2Q Z;  3ZP5 A;  2H09 A;  3W2V A;  4XMY A;  1FBQ A;  3KYL A;  2NVT J;  4NBQ A;  3RPU A;  1XX5 A;  3OYD A;  2R0Q C;  4Q48 A;  3RZD J;  5C3E J;  3DEW A;  2UUZ A;  2AS5 F;  2V79 A;  2CG4 A;  2BY3 A;  3LWF A;  2MBF A;  1X1P A;  4IQ4 A;  2QSH X;  5IT9 Z;  3J80 Z;  4DZJ A;  3PM1 A;  1FEX A;  3EUA A;  2GIV A;  1KON A;  3ECH A;  2PJR A;  1JT6 A;  3S32 A;  4NDL A;  4DBR A;  3LAJ A;  1JGG A;  4HNU A;  5FFX A;  3K4B A;  3MCZ A;  3O8G A;  2O9L A;  4HX4 A;  4AIH A;  4AIK A;  4L9J A;  1ENH A;  2OUM A;  5H6Q A;  4HDU A;  3FXJ A;  4KA4 A;  1V3F A;  2DOD A;  5CPR B;  5DUK A;  2IS4 A;  3KEO A;  5E18 F;  1WVR A;  1Z0X A;  2V9V A;  2ZJP F;  4XBF A;  4NC7 A;  2K9Q A;  1U9O A;  3OYC A;  1A6Q A;  1W36 D;  3ULQ B;  2UXN A;  2OV7 A;  3DTI A;  3LOC A;  4XKC A;  5B66 C;  2P5K A;  1QHG A;  4G6T B;  4IHT A;  4I98 B;  1WI9 A;  4XN0 A;  5KK1 A;  1O3R A;  1QPI A;  5FKM A;  2E7W A;  4PDK A;  3I4N J;  1MMD A;  3M8E A;  3F21 A;  3GFL A;  4IZZ A;  1T0F C;  3C7J A;  2VC1 A;  3FM5 A;  1TP4 A;  2DPD A;  1H0M A;  4DYQ A;  5F04 A;  2MH9 A;  3M4O J;  2ZC2 A;  5CYV A;  3KX2 A;  2R7D A;  1M1E B;  3M07 A;  3ML6 A;  3DKX A;  5DCM A;  1T0F A;  2F5C A;  2VKV A;  4UB8 C;  4R1H A;  3DWL E;  5DUI A;  1BA5 A;  1TQM A;  1TW3 A;  5J3L A;  2DMQ A;  4NB5 A;  5GAE J;  1XPX A;  3C2B A;  3IAS 2;  4I7H A;  1W36 C;  3S17 J;  3BLY A;  2DMN A;  1S7A A;  3G3Z A;  2ZJQ F;  5EG0 B;  1I3Q J;  4BEH A;  4Y13 A;  3BG3 A;  1DP7 P;  1R5I D;  1B8I B;  1VQ5 I;  4HW0 A;  2YX7 A;  3K1M A;  3E6C C;  1XGO A;  4B48 A;  5E8I A;  2LFB A;  2OZ6 A;  1IZ1 A;  2BY2 A;  4G6Q A;  4B8X A;  1HA8 A;  1KU3 A;  2K3P A;  2FU4 A;  3RZO J;  1ETY A;  2HVS A;  5JHU A;  3BZC A; 
#chains in the Genus database with same CATH homology
 2R5Z B;  1UG2 A;  1YRN B;  2DA1 A;  3RKQ A;  2M8G X;  4JYK A;  2M34 A;  5M5Y J;  2ECB A;  2ELK A;  1RET A;  2MW8 A;  3H0G J;  1JTX A;  1F43 A;  4B3A A;  2R7Z J;  2LD5 A;  3OOU A;  1WCM J;  3S15 J;  5K7H A;  3FIS A;  1MSF C;  3HOU J;  1ZR4 A;  4DYR A;  1JJ6 C;  2LLK A;  4AC0 A;  3OSF A;  1RES A;  4M6V A;  2YU9 J;  3JRB A;  3GTG J;  3HGY A;  5IPA A;  1T33 A;  2DN0 A;  2Y30 A;  3S1Q J;  2TRT A;  3TP3 A;  5EZG A;  4IHW A;  5EZH A;  1Q1V A;  3S1R J;  3OSG A;  5IOY A;  4A3D J;  1TWG J;  5C44 J;  1LFU P;  1IC8 A;  3E7L A;  1EF4 A;  4A3B J;  2L7F P;  2ME0 A;  2EQR A;  1IG7 A;  2EZK A;  1H8A C;  2JA8 J;  1W0U A;  2L7M P;  3IH2 A;  1JKR C;  4M3B A;  1O4X A;  2GLO A;  2MGQ A;  4IHV A;  3GTP J;  3S2D J;  2YS9 A;  1NK3 P;  3JRH A;  1MSE C;  4CYC A;  3FK7 A;  3G1O A;  1MBG A;  4A3C J;  2XSD C;  3BR0 A;  4A3G J;  1AHD P;  2LTP A;  1TWH J;  5F27 A;  3LSG A;  9ANT A;  1RKW A;  4C2M J;  1QVU A;  2IEK A;  4MFD A;  3A01 B;  1WH5 A;  1HF0 A;  4BBR J;  3MN2 A;  3IV5 A;  1ZKG A;  2G0E A;  1F36 A;  4DYC A;  3LNQ A;  4ABZ A;  1HLV A;  4DW6 A;  3K7A J;  3S1N J;  2E19 A;  4W1U A;  1FTZ A;  1XS9 A;  4A3K J;  4Y52 J;  5IOZ A;  4CYC B;  5EF6 A;  3B6C A;  1ORK A;  3BTL A;  3CDL A;  3M3Y J;  3GTL J;  2DA6 A;  5EEA A;  5IYD J;  2E2H J;  5DTD A;  1AU7 A;  2M9H A;  2XPV A;  1TWA J;  2XRL A;  5EG0 A;  2K40 A;  1FJL A;  2HOA A;  3PO2 J;  1IDY A;  5F1J A;  4FCY A;  4A3I J;  2EZL A;  1H89 C;  4AYB N;  2CQX A;  1YRN A;  1B72 B;  4JX6 A;  4IHY A;  5FJ8 J;  5EDN A;  2COB A;  2XB5 A;  3ZOB A;  4QSH A;  5E3N A;  5M3M J;  3HOW J;  1WH7 A;  1WGX A;  3Q0U A;  4X1E A;  1XG1 A;  1CQT A;  2XGC A;  5BNG A;  1ETK A;  4D7M A;  3Q0W A;  2ECC A;  2LY9 A;  2E2I J;  1WI3 A;  1MBJ A;  3QPL A;  5E3M A;  1U78 A;  4I76 A;  3GBG A;  1HDP A;  1JT0 A;  1GV2 A;  1JKO C;  1HOM A;  3O8H A;  1OCP A;  2AHQ A;  1BW5 A;  2CUE A;  2N8G A;  3ZQH A;  3S1M J;  1IUF A;  2XPU A;  2ME6 A;  4QTR A;  3ZQL A;  1TWF J;  1S7E A;  2AO9 A;  4A3E J;  4M3G A;  2CQQ A;  1JTY A;  2KT0 A;  4BXX J;  2JK3 A;  2WV1 A;  1A6I A;  1IDZ A;  3QQA A;  4D7N A;  1BL0 A;  3S14 J;  1SFO J;  4XK4 A;  2MSY A;  2EBI A;  5IP9 J;  5FLV A;  1LFB A;  5IP7 J;  5IYC J;  2HXO A;  3JRG A;  1I50 J;  2DA3 A;  4IEJ A;  1RKT A;  1QRY A;  3JRE A;  2JA7 J;  3BR1 A;  3A01 A;  3H3V K;  1ITY A;  2OPT A;  4XRS A;  3DCF A;  1VFC A;  4RBO A;  2K9S A;  2X48 A;  2H1K A;  4HNV A;  4M3F A;  3B6A A;  2RAE A;  3BQY A;  1ZR2 A;  2DA5 A;  3GTQ J;  3Q3S A;  5F0H A;  1ETW A;  2CJJ A;  3OIO A;  2VI6 A;  3L1P A;  1DU0 A;  1ZTR A;  1ETV A;  2QCO A;  3HOZ J;  5C4J J;  3JRI A;  4V2G A;  4D5C A;  3Q0V A;  4JX5 A;  1ZK8 A;  4X6A J;  3ZQG A;  3TW7 A;  5J1R A;  2JA6 J;  4A3M J;  2JMW A;  3HBL A;  1ETX A;  4L5E A;  1QVT A;  2DMT A;  4Y7N J;  2Y9Z A;  5K7Z A;  2PMZ N;  1B72 A;  1NK2 P;  4BY7 J;  1FTT A;  3UKG A;  3BT9 A;  2M2E A;  2VUM J;  3BR5 A;  3FK6 A;  1ETO A;  5FLM J;  2VPR A;  3BTI A;  3JRD A;  3ZQC A;  1BW6 A;  4XID A;  1VF9 A;  4MFE A;  2HQ5 A;  3NAR A;  2XGE A;  5F08 A;  4JP0 A;  3BR6 A;  2FJ1 A;  2DA7 A;  5GP9 A;  2JN6 A;  1APL C;  2NVY J;  3BR3 A;  4MO7 A;  3HOV J;  1E3O C;  1D5Y A;  1MBF A;  1OJL A;  2HXI A;  3BG9 A;  3HOX J;  4BBS J;  3LSR A;  2R92 J;  5M3F J;  1X2M A;  1I6H J;  2LKX A;  5DS9 A;  3BTC A;  1G2H A;  1MBH A;  5EGO B;  3VPR A;  1X58 A;  2IBD A;  2JJ7 A;  1VI0 A;  1TWC J;  1WPK A;  2K9N A;  3FIW A;  3JR9 A;  2JWT A;  4C3J J;  2EH3 A;  3S2H J;  2H8R A;  2FX0 A;  1ZGW A;  2LK2 A;  2Y2Z A;  3WHC A;  4S0H B;  5IP6 A;  3F0C A;  2DA2 A;  1U9N A;  2Y0S N;  3GTM J;  1X2N A;  2FQ4 A;  2EZH A;  1GUU A;  2O8K A;  1IJW C;  5EYR A;  2VKE A;  1XC5 A;  2KDZ A;  2NVX J;  2X9D A;  3CQZ J;  3W6V A;  2CU7 A;  2IAI A;  3BR2 A;  4UUS A;  2E1O A;  4JX4 A;  1LE8 B;  2CUF A;  3G1M A;  5HOD A;  5E3O A;  4BY1 J;  1POG A;  3ZQF A;  3TP0 A;  1RPW A;  3FKI J;  3S16 J;  3BQZ A;  2HDD A;  4D5F A;  4M3D A;  5J1U A;  2HI3 A;  2LR8 A;  4MIM A;  5FKL A;  4A93 J;  1DU6 A;  3TW6 A;  2DMP A;  2HYJ A;  2EZI A;  3GTO J;  2O7O A;  3HGG A;  4C3I J;  3JRF A;  3BG5 A;  4XRS G;  2L9R A;  2XPW A;  4IHX A;  1JJ8 C;  1P7I A;  1UHS A;  2NS8 A;  1HCR A;  5F0C A;  2R93 J;  4B1R A;  1FIP A;  1JGG A;  1OCT C;  1MBK A;  1JKP C;  3HB9 A;  5FKK A;  4UUS B;  4FTH A;  1H88 C;  5JLW A;  1A5J A;  4J19 A;  3QPS A;  1TC3 C;  2LVS A;  3G1L A;  5M5X J;  3K2A A;  4BKX A;  2Y31 A;  4LOC A;  3SFI A;  2DA4 A;  3HDD A;  1W0T A;  1JUP A;  5FKO A;  3RQI A;  3HOY J;  2XB0 X;  2WB1 N;  1T56 A;  1Y1W J;  2HOT A;  3CCY A;  4AUX A;  4XIC A;  1HDD C;  3NAU A;  1JKQ C;  2YUS A;  2DMU A;  3HEF A;  3IH4 A;  4MLO A;  3HKZ N;  2W48 A;  3BTJ A;  1GDT A;  3LSP A;  2L7Z A;  5JLX A;  3ZQI A;  4C3H J;  1UMQ A;  1JUM A;  2NVT J;  2R0Q C;  1NTC A;  4V2F A;  3RZD J;  2P81 A;  4EEF G;  3DEW A;  5C3E J;  5C4X J;  2I10 A;  2GM4 A;  2HOS A;  3MVP A;  5GPC A;  1VND A;  3MKL A;  1PUF A;  2D5V A;  5J1Y A;  4DZJ A;  3PM1 A;  1FEX A;  1GV5 A;  2MG4 A;  5GPA A;  1JT6 A;  5EGO A;  3SJM A;  4QIW N;  5FKN A;  4NDL A;  3A03 A;  2O9L A;  1JUS A;  3O8G A;  4I6Z A;  1AKH A;  2TCT A;  1GT0 C;  2B63 J;  2NOG A;  1K83 J;  5K7F A;  2DJN A;  1ENH A;  3A02 A;  4A3L J;  1Y1V J;  2ID6 A;  3IH3 A;  1FIA A;  2OF7 A;  3I4M J;  1Z0X A;  5F0F A;  1R9T J;  3LSJ A;  4W97 A;  1MBE A;  2L0K A;  2K9Q A;  1U8B A;  1U9O A;  2ID3 A;  1PUF B;  4M3E A;  2LP0 A;  1IV6 A;  2GBY A;  2QF7 A;  1OFC X;  3LOC A;  1ETQ A;  5IYB J;  2DTZ A;  1LE8 A;  4B4C A;  2M0C A;  1QPI A;  3I4N J;  2WAQ N;  5FKM A;  3JRC A;  1B8I A;  1GVD A;  2X6O A;  1AKH B;  2CRG A;  3SDG A;  4DYQ A;  1RR7 A;  5F04 A;  3WHB A;  3GTJ J;  2R5Y A;  3M4O J;  2NVQ J;  1MH3 A;  1Z77 A;  4FIS A;  4A3F J;  2FD5 A;  2JA5 J;  3JRA A;  4A3J J;  1P7J A;  1SAN A;  2NS7 A;  2R5Z A;  2VKV A;  1MH4 A;  4DZP A;  3GTK J;  1BA5 A;  1MNM C;  2ZB9 A;  5J3L A;  2DMQ A;  4RDU A;  1K61 A;  1ZQ3 P;  3PO3 J;  3C2B A;  1BJZ A;  3S17 J;  2DMN A;  1IGN A;  4FE7 A;  5EG0 B;  1I3Q J;  3CMY A;  2Y9Y A;  3BG3 A;  4XRM A;  1B8I B;  4A69 C;  5E3L A;  4FE4 A;  4UUT A;  5M5W J;  1IRZ A;  2R5Y B;  2LFB A;  2E2J J;  3HM5 A;  4GFB A;  2XGD A;  4G12 A;  3RZO J;  3D1N I;  1ETY A;  3TED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...