1SFOJ

Rna polymerase ii strand separated elongation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1sfoJ00
1JKOC 1MBFA 3NAUA 1JUSA 1GV5A 3F0CA 2N8GA 1JT0A 3D1NI 2HOSA 4IHVA 2DA2A 1TWAJ 2E1OA 4JX5A 3HDDA 1MBEA 2JA5J 5FLVA 5IP9J 1ZQ3P 5FKKA 2EZHA 4QTRA 5HODA 4BY7J 1EF4A 2NVQJ 2NOGA 5E3LA 1MBGA 3BG5A 3FK6A 4JP0A 2DJNA 4AC0A 1HF0A 2XRLA 5M5WJ 2CQQA 2W48A 3JRDA 5M5YJ 2B63J 1JKPC 4C3IJ 1ZGWA 2GBYA 3LSRA 1A5JA 2EH3A 4M3BA 3GTLJ 4UUSA 2MG4A 3LSGA 4JX6A 2OF7A 4UUSB 1D5YA 5IYBJ 3IH4A 4MO7A 3G1MA 1IC8A 4DYRA 2EQRA 4BY1J 2DMQA 5FKLA 3RQIA 3BTIA 4M3GA 3DCFA 5IYDJ 2XPVA 4M3EA 3O8GA 2M0CA 3HOZJ 3A03A 1TWFJ 2JA6J 1ZKGA 1MSEC 4B1RA 3FIWA 5M3MJ 3JRAA 5E3OA 1PUFA 3HOYJ 2LD5A 3CCYA 4W97A 1PUFB 2ID6A 3H0GJ 3GTPJ 5F0FA 3GTGJ 1OFCX 2LLKA 2XGDA 4M3FA 3Q0WA 4A69C 2Y9ZA 5IPAA 3JRFA 4AUXA 1A6IA 4A3IJ 3A01B 3A02A 5C44J 2DMTA 2JA7J 2O9LA 4D5FA 2R7ZJ 1F36A 3LSPA 5E3MA 2M9HA 4A3MJ 2VKVA 2M34A 2ZB9A 2G0EA 1P7IA 2X48A 2E2HJ 2R93J 2GLOA 3O8HA 3TP3A 2DMUA 1FJLA 2HYJA 4UUTA 2LTPA 3SDGA 2JN6A 1FIPA 1AHDP 5F08A 1LFUP 4C3HJ 1FTZA 1IDZA 1BA5A 1JGGA 5DTDA 2AHQA 1TWGJ 4DYCA 3VPRA 2E19A 4D7MA 2L7FP 2HOTA 4J19A 2EZKA 2DN0A 4A3CJ 4DW6A 5EG0A 1POGA 2L0KA 4JYKA 1B72A 2LR8A 2LK2A 1JJ6C 3S1MJ 3GTJJ 3PO2J 1VF9A 1DU0A 5M3FJ 4A3EJ 4I6ZA 3QQAA 1LE8B 4D5CA 3M3YJ 2PMZN 1QVUA 3S1RJ 3LOCA 4BKXA 3QPSA 1MBKA 1GVDA 1ETXA 3ZQGA 3Q0VA 3FISA 2H8RA 1WGXA 2R0QC 4B4CA 5JLWA 2ID3A 3LNQA 2IBDA 4XRMA 3FK7A 1H89C 2DMPA 5EGOA 1MBJA 2R5ZA 1WCMJ 4XRSG 1YRNA 2JMWA 3RKQA 5EZGA 2K9SA 2LP0A 5EGOB 5F04A 3JRBA 4MFDA 1YRNB 3RZDJ 1JUPA 1ZTRA 4A3DJ 3OSGA 3UKGA 3JRCA 2DTZA 3C2BA 4RBOA 1RKTA 2HI3A 1JTXA 1VFCA 2ME0A 4A3BJ 2VKEA 4MFEA 2MW8A 3BR5A 2XGCA 1QPIA 2HDDA 4XICA 1U9OA 1I3QJ 3HKZN 5C3EJ 5J1RA 2YS9A 2FX0A 5EYRA 2L7ZA 3ZQFA 3TW7A 3S2HJ 1DU6A 2JK3A 3OIOA 3W6VA 2O8KA 1FTTA 2M2EA 4V2FA 5J1UA 4DZPA 2H1KA 3MVPA 1T33A 1HLVA 1NTCA 4JX4A 2Y2ZA 2CUEA 2R92J 1FIAA 1ETKA 1VNDA 3JREA 4FCYA 2MGQA 3S14J 4A3GJ 3HGYA 3BR6A 2DMNA 4L5EA 2NVYJ 3JR9A 2I10A 2MSYA 3TEDA 1U78A 3CMYA 5JLXA 2COBA 1IDYA 3OOUA 4C3JJ 5IYCJ 1OCTC 3I4MJ 4B3AA 1WH7A 2YUSA 3HM5A 4X1EA 3ZQIA 3B6AA 1LFBA 5IOYA 1UG2A 3B6CA 2DA3A 4DZJA 5J3LA 3BTJA 4BBRJ 1BJZA 5FJ8J 2E2JJ 3S1QJ 4DYQA 1UHSA 2M8GX 4QSHA 1JTYA 3HEFA 4XIDA 2LY9A 3I4NJ 1FEXA 1GV2A 2L9RA 2NS7A 2OPTA 4GFBA 1MNMC 3ZQLA 1HOMA 1T56A 2X9DA 3BTCA 1BL0A 2XGEA 3BG9A 2LVSA 1ETOA 2WB1N 2VPRA 3S16J 2K9NA 4A3KJ 3TP0A 2DA5A 2GM4A 1MBHA 1AU7A 1X2NA 2XB0X 2HOAA 4C2MJ 2O7OA 5DS9A 5EF6A 2E2IJ 1CQTA 1WH5A 2HXOA 2D5VA 1W0TA 1MH4A 1TC3C 3HBLA 1NK2P 1H8AC 3HOUJ 2KDZA 2P81A 2R5YA 5GPAA 3K7AJ 2CRGA 4CYCA 5EG0B 1U9NA 3TW6A 2R5YB 3QPLA 1B8IA 3HOVJ 3PO3J 5F0HA 2EZLA 4CYCB 1B72B 4A3JJ 2ME6A 4QIWN 4Y52J 1Z0XA 3Q3SA 2NS8A 3BG3A 3IH3A 1H88C 3K2AA 1X2MA 1RR7A 2IEKA 9ANTA 4A3LJ 4AYBN 2HQ5A 1XS9A 2WAQN 1XG1A 3MKLA 5EZHA 3WHCA 1ETWA 4BXXJ 3SFIA 5F1JA 1GT0C 2YU9J 4MLOA 3BR3A 1RPWA 1G2HA 2EZIA 1TWCJ 2CUFA 4IEJA 1RKWA 1Y1WJ 1JKQC 1ORKA 1U8BA 3IV5A 2R5ZB 2CU7A 4D7NA 1UMQA 3GTKJ 5F0CA 2Y30A 3WHBA 3DEWA 3GTQJ 3BR1A 1TWHJ 5F27A 3ZQHA 1P7JA 3HB9A 1ETYA 1XC5A 4BBSJ 1I6HJ 2DA4A 3ZOBA 5IP7J 2XPWA 1WI3A 2VI6A 3BR2A 1E3OC 2FQ4A 1O4XA 4Y7NJ 1BW5A 1IG7A 2XB5A 1RESA 3LSJA 2KT0A 4V2GA 1QVTA 4M3DA 2CQXA 3S1NJ 3S15J 4X6AJ 3M4OJ 2K40A 1IUFA 2Y0SN 3FKIJ 4XRSA 1K83J 1W0UA 3OSFA 2XPUA 4LOCA 3HOXJ 2ELKA 1RETA 2NVXJ 2VUMJ 1HDPA 5FKNA 3JRHA 4FTHA 1IGNA 3H3VK 1JKRC 1NK3P 1APLC 5C4JJ 4IHXA 2TRTA 3JRIA 1QRYA 5M5XJ 2LKXA 3G1LA 1AKHA 4HNVA 5EEAA 5EDNA 4RDUA 1R9TJ 2LFBA 1JUMA 5IP6A 3JRGA 1AKHB 5K7ZA 1ZK8A 1Y1VJ 3HGGA 2ECBA 1SFOJ 2RAEA 3L1PA 5GP9A 4A93J 2JJ7A 2EBIA 2XSDC 2Y9YA 5IOZA 1I50J 5K7HA 2X6OA 5J1YA 1GDTA 1ITYA 3G1OA 4IHYA 3ZQCA 2QCOA 3IH2A 2IAIA 1S7EA 2DA7A 3PM1A 3A01A 3S17J 1BW6A 4EEFG 3RZOJ 4MIMA 3GBGA 1ZR4A 4IHWA 1ZR2A 2FD5A 5K7FA 2DA6A 1JJ8C 2AO9A 5FKOA 1IV6A 1ETQA 4NDLA 3HOWJ 1WPKA 1OJLA 2DA1A 2NVTJ 1ETVA 1SANA 2TCTA 2CJJA 3BQZA 4FE7A 4A3FJ 1HDDC 1ENHA 2QF7A 3MN2A 4S0HB 3BQYA 4G12A 5FKMA 1X58A 3SJMA 3S2DJ 2Y31A 3Q0UA 2HXIA 2K9QA 2FJ1A 3CDLA 1K61A 4FE4A 3BT9A 1MSFC 4ABZA 1B8IB 3CQZJ 5C4XJ 2JA8J 4W1UA 1VI0A 5BNGA 4M6VA 3BTLA 1MH3A 5FLMJ 1HCRA 3GTOJ 2WV1A 3GTMJ 4FISA 4XK4A 2L7MP 4I76A 1IRZA 1OCPA 5GPCA 1JT6A 1LE8A 1Z77A 3BR0A 3E7LA 2ECCA 5E3NA 3NARA 1IJWC 1F43A 2JWTA 1Q1VA 1GUUA
chains in the Genus database with same CATH superfamily
1JKOC 2DYSH 3NAUA 3VYTB 3WG7H 1SFKA 2Y69H 1YE9A 1FPQA 4O6JA 1MGTA 4XLAA 3Q9VA 4LG0B 2LSOA 3I58A 2E1OA 2XAFA 3CCRI 4HDUA 2F4IA 4N9IA 4IPAA 4BS9A 3KYDB 4P9UA 2VOPA 5FKKA 2VQCA 4IKFA 2ZO4A 4FETA 2O5RA 2ZJQF 3GCMA 4JP0A 3PNTA 1HF0A 2LNBA 2Y0SA 2XRLA 1BI0A 2PFBA 3MEXA 4RB3C 2W57A 3K4KA 2B63J 4XRFA 4U87A 3M07A 2JZYA 4HF0A 3E97A 4BACA 1BIBA 4PJJA 2G7UA 4HYEA 4M3BA 1YIJI 5K1YA 3GX4X 3LSGA 3KCCA 4UVAA 2P5LC 4DIQA 4LIVA 4UUSB 2H27A 2KDOA 5IYBJ 5LFAA 3IH4A 1U8RA 2YSRA 3FMRA 4F92B 1XB4A 4DYRA 1DPRA 4BY1J 2DMQA 2OC6A 4Y13A 3MD2A 4Y17A 1PP8F 3I59B 4M3GA 4NC8A 2V6CA 3WTWC 3CJTB 4M3EA 1I39A 1J7KA 2DDBA 3WTZA 2OD5A 2M0CA 3F22A 3A03A 2JA6J 1TQIA 2L9VA 4B1RA 3K70C 4OIQF 3JAMZ 3F3XA 3CUOA 1PUFA 3GEZA 3CCYA 4RGUA 4W97A 1D1AA 4AIDA 4RLFA 1UELB 3GTPJ 4I01A 5F0FA 3GTGJ 1OFCX 1RR8C 3Q0WA 3QU3A 3F72A 4AUXA 1SC7A 1Z6TA 1IXCA 2QUFA 1VQMI 4A3IJ 3ZQQA 5KVRA 2LF8A 3I0TA 5H2FC 2QENA 5C44J 2GOXB 4NHJA 3VFZA 3QODA 2ZBKA 1EV7A 3GYHX 2OUMA 3OYFA 2GZWA 1X4OA 4KA4A 2FF4A 1P7IA 1ZRDA 2E2HJ 2R93J 3O8HA 2DMUA 3KZZA 2EFOA 3Q5FA 2LTPA 2L01A 5HDNA 2K4BA 2LY1A 1X4PA 4OIRF 5B5EC 3RKWA 1IDZA 1BA5A 4EJVA 4HQEA 4Q47A 5DTDA 4BNCA 3M1CA 4XLPF 4RLQA 2LYCA 2PEXA 3E5XA 3VPRA 5FLXK 3CLQA 2XAGA 4YIIA 4IO9F 1STZA 1HSJA 4J19A 3LMMA 1Z67A 4Q4ZF 3D0SA 5HVQC 5J47A 2RREA 3QWLA 5EG0A 1FX7A 5D5WB 2LKPA 5CVRA 3I55I 2DT6A 2LH9A 4PSWA 2PX9A 2RQPA 1B72A 2XF6A 5H6QA 5HOOA 1J75A 2K85A 1AA7A 1VF9A 5M3FJ 4I6ZA 2B9SA 2ZMEC 2O6GE 3ZMZA 1LE8B 2HYGD 2V6EA 3ZXSA 4LB5A 4BUPA 3QYEA 3ABMH 2PMZN 4E6KG 2MLKA 2HQAA 4DBRA 3RCOA 1PJRA 2MH9A 1T2KA 5HS8A 1MBKA 1IN4A 3QPHA 4IRHA 1MD0A 4PK4A 1ETXA 4MQ9F 3S32A 2J5PA 3SXYA 3OYDA 1MJAA 1WGXA 1OLTA 2ID3A 2IBDA 1BR2A 1PVEA 1S29A 2WA0A 3LAJA 3HUGA 5CVVA 4UXNA 4XONA 3HPGA 1BOAA 1SD4A 4F7ZA 4D9JA 3ASOH 2LP0A 3JRBA 2KRCA 3ZMDA 4R79A 1XX5A 4WCGA 2Q1ZB 2GWRA 2V9KA 1QHGA 2Y48A 5FD6A 5ICGA 3L00A 1FZPB 2PG4A 5D8KB 2IS4A 1RKTA 2HI3A 2HDCA 4WWCA 2F48A 3FXUA 4HNUA 1O7LA 4KIGA 4A3BJ 3H5AA 3R60A 4MFEA 3K0LA 4O3MA 4BJ5C 4XR6A 5K5OA 1OQYA 4MEXF 3ZQFA 3TW7A 1QZYA 2VASA 2R7UA 1YJNI 2V4JC 3DP7A 2K02A 2M2EA 5J1UA 4DZPA 2K5CA 4RGSA 1T33A 1GHCA 5F1RA 2DOFA 4II2A 1S3JA 1NTCA 4YFKF 2Y2ZA 3I9V2 1GXQA 1FIAA 2R92J 1ETKA 3AFHA 4PZJA 5H6RA 5EEHA 3VYUB 4A3GJ 1HKSA 2L9SA 1G4DA 2ELHA 3HGYA 4PJLA 2UZKA 1AOYA 1XD7A 3ISPA 3ZMSA 2O8XA 3BR6A 2NVYJ 2MSYA 3ZMTA 2WV0A 1U78A 3CMYA 2QSHX 1IDYA 4YELA 2HYFA 4R8HA 3V8KA 4X1EA 4I2OA 1O57A 3B6AA 3DU5A 4HF1A 5L3GA 1R5ID 1B9MA 3EUHC 1IN8A 1NG6A 3BTJA 2E2JJ 5FJ8J 2H8WA 4OAZA 4U0VA 4AD9A 3HEFA 4XIDA 2LY9A 2JUCA 3ROUA 5DV5A 4HNTA 4GFBA 2EK5A 3ZQLA 4EM0B 3HRUA 4D0PA 4Q5SF 3F8FA 1RIOH 4IZZA 3H1CA 4WX9A 5BOXA 5BS6A 3R6SA 2IVMA 1T95A 4EJWA 2XAHA 3DFGA 2DA5A 4A5MA 1ZRCA 2V9PA 1X2NA 2O0YA 4MGRA 5LGTA 3H0DA 5DS9A 2OCCH 2AQFA 2D5VA 1FSEA 1W0TA 1MH4A 1JI8A 5HDKA 3ABUA 3HRTA 2OBPA 3HBLA 4HZFA 3L7WA 3TMOA 1NK2P 3HOUJ 2DFFA 2F4MB 1RZ4A 2CRGA 4FQGA 1PP7U 3CCVI 4IOAF 4YFXF 1B9NA 1KA8A 2ME6A 4A3JJ 1K78A 3Q3SA 4Y52J 3BG3A 2RDPA 1H88C 1T98A 3VEPA 5DDGA 2DFHA 2PN6A 3IHUA 9ANTA 1VQ6I 2P7CB 3KLNA 1XS9A 3E5UA 2WAQN 1YITI 1A6QA 3BPXA 2V7FA 3MKLA 4IXAA 2IT0A 4BXXJ 1ETWA 5J8FA 5ILVA 1J59A 3SFIA 4GCVA 5F1JA 1S7AA 3J81Z 1RPWA 4LITA 5BPIA 2IPQX 4BHPA 4CXFA 4K2EA 1FBUA 5IY5H 3BP8A 3CCLI 4IEJA 1RKWA 3MFKA 3TOBA 1B6AA 3OYEA 1D0XA 2BVMA 1A31A 1YHQI 2TDXA 2XIGA 2R5ZB 2X6YA 2CV2A 2WBMA 2VBYA 2CU7A 3K2ZA 1FLIA 2IA1A 3COAC 1ON1A 4C2UA 4CICA 5F0CA 3WHBA 1ZYRF 3DEWA 2X1CA 1WSUA 3GTQJ 1TWHJ 4WK8F 4ENMA 1P7JA 3HB9A 1AWCA 2E71A 4EJOA 5HS9A 4LGWA 1Y56A 4ZZLA 1X1PA 3OYIA 2EFNA 2VI6A 3DEEA 5DCMB 3CC7I 1XSDA 3HTSB 5HLGA 5E17F 1N78A 2GAUA 1LDJA 2A3SA 2DFEA 1BW5A 3WODF 3SYTA 1QVTA 3NEUA 5J8CA 3ZRGA 1V55H 2DW4A 2BE5F 1T38A 2OZUA 2Y0SN 1K83J 3AG2H 1WJEA 2EILH 5BMZA 3OSFA 4R1HA 4U7BA 4BE0A 2L9NA 2ELKA 1RETA 2NVXJ 4EM1A 4FTHA 2JSCA 2R7DA 4HV6A 2XV4S 3AG1H 5EJCA 4CO8A 2HVSA 1XCVA 3OYGA 3HSRA 2A6EF 2Q2EA 4IHXA 2EA2A 3EUAA 4YFNF 3OYBA 1AKHA 1R9TJ 3M9AA 3R0AA 2LFBA 3M8JA 3CJNA 5D6FA 3K4BA 5IP6A 3JSPA 2FBKA 3AKZA 3HGGA 4M9ZA 4GYGA 1SFOJ 2RAEA 2F2EA 4ANJA 5FGMA 5ERIA 4A93J 3H3UA 4N9HA 3LFUA 4QPOA 1I50J 3CCMI 5K7HA 2A6TA 2Y75A 3G1OA 4OIOF 3BJAA 3W3CA 1XDUA 3IH2A 2IAIA 1S7EA 2YU3A 3PM1A 2ESNA 3A01A 1S9HA 3PL8A 4E7SA 3HRMA 3S17J 2ACJA 1R1TA 2CW0F 4EEFG 4IX7A 3C18A 1GXPA 4MIMA 4KT6A 5H20A 4BE2A 4IHWA 4XOPA 2CYYA 1GVJA 2FD5A 3U2RA 5K7FA 2E1MB 3BROA 5FKOA 3V8JA 1S7OA 2RKHA 3HOWJ 4BGDA 5BQTA 1YLFA 3J80Z 4LLGF 2DA1A 5E79C 4EJTA 3G73A 1HDDC 2YX4A 1D0ZA 1RI7A 4F3QA 4P96A 4FX4A 5FKMA 3S2DJ 3MQ0A 5E1ZB 2HXIA 1K61A 2FJ1A 2PMZA 1LVAA 4L9VA 4ABZA 3HJEA 1K7AA 1B8IB 3R61A 3CQZJ 3V8LA 4NNJA 4A2UA 1W36D 3O6BB 4LFUA 4IHTA 2ZMEA 4KDPA 2JA8J 1VI0A 1YIOA 4I09A 1SVOA 3FM3A 5BNGA 1Q1HA 3KP4A 2V1XA 5FLMJ 1VQPI 1MKMA 2OZ6A 4L0YB 2E36A 1FNNA 2E1CA 3HPHA 5K5QA 4CCMA 5D5XB 4I02A 1IRXA 1MNEA 3E7LA 4XSZF 3RI4A 1XGOA 5E3NA 4S04A 1Q1VA 1GUUA 2FQ3A 2F5DA 4O5VA 4ZYAA 1V5EA 2I5UA 3LA3A 1JUSA 2HVRA 1YX3A 4ZDPA 2DODA 2N8GA 3AL0B 1WZ2A 2HZDA 3I4PA 2BHZA 4HX8A 1WJDA 2VBZA 3KP6A 2HOSA 4IHVA 2ZFWA 3H9QA 3O3KA 1Z21A 1TWAJ 3SZGA 1V4RA 1MBEA 1ZG3A 3ESWB 5FLVA 4XQFA 3RPUD 2EZHA 2F6CA 2XGXA 2V1DA 1VZ0A 4BY7J 4MHGA 2HWVA 2HKOA 2PBIA 4PDKA 1XSXA 2WY7Q 5E3LA 2NVQJ 2VBXA 2X0LA 1B59A 1E3PA 1UG0A 4B48A 2P0WA 4BDZA 2BY3A 2VL8A 2CQQA 5AIQA 3MKYB 2VQLA 4C2TA 1JKPC 4C3IJ 3F21A 5E1WA 2PMHA 3DPLC 3VOEA 4E7IA 1A5JA 2EH3A 1LQ1A 2XHKA 1Z9CA 2MG4A 5IT9K 4UVBA 1OPCA 2Z2SB 2R7XA 2E34A 2OF7A 1HKQA 3M8FA 4IQ4A 4MO7A 4F91B 2WAFA 2BZTA 2M4KA 2F4OB 2KLOA 2ZCWA 5HS7A 5FKLA 3RQIA 3FF5A 3BTIA 1T6SA 2F5CA 4YEJA 3DCFA 3MKZA 1O3QA 5IYDJ 4RAYA 3O8GA 3HXLA 3OYHA 1N77A 4G6TB 3L2WA 2NS0A 3HOZJ 2IP2A 1DP3A 1TWFJ 2EJRA 3BG7A 1W4MA 3L2RA 2QSFX 2R7OA 3FIWA 4WXDA 3JRAA 3GW2A 4BEHB 1U6GA 3EUHA 1ODDA 3DBLB 3J7AO 1PUFB 3L9FA 2RN7A 3CMAI 2IJLA 1DP7P 2QSGX 2KHMA 1MJBA 3O2PE 2DJIA 3W2AA 2Q0OA 3EETA 4A69C 1LPQA 3KEOA 1YFHA 1X1AA 3TGNA 3CP2A 3RPQA 3OOPA 2NAZA 1HA8A 1IRGA 1DQUA 2VT2A 3QYBA 1I3AA 1ZHFA 2R7ZJ 2HQNA 5GAGJ 1QU3A 3IWZA 3P9IA 3BC8A 4A5NA 3ABKH 3QPTA 5KAFC 2ZB9A 3PQJA 5B3SH 3BY6A 4BQOA 2VE9A 4AIKA 2YR2A 3HOSA 1I1GA 2WWYA 1FJLA 2P5VA 3SDGA 1A35A 2JN6A 2CFOA 3D5RC 2MA3A 1FIPA 1FOXA 1Z6RA 3LSIA 1RUOA 2WAQA 1QBJA 4JBAA 4FASD 1LDKB 1OYIA 4ZJZA 5HLTA 1HC8A 2ZKZA 1XTAA 3I3LA 2PJRA 1YOVB 2EZKA 3QYFA 2DN0A 4A3CJ 4PGGA 1POGA 1T8IA 2Q8KA 2BXYA 4CA0A 3FX3A 2L0KA 1FT9A 5TRDA 1ON2A 2LR8A 2OQRA 2E1NA 1RNLA 1B1BA 1JJ6C 4ESJA 2VJJA 2XDVA 3PO2J 1DU0A 4M9XA 4Y33A 4Z2YA 5GAHJ 1E0EA 4PJNA 1SMYF 4G6QA 1EH8A 5L3DA 3OS2A 3S1RJ 1BR4A 3QPSA 3GMEA 4UB8C 5KAIC 2C6YA 1KQ8A 2XAQA 3RJPA 1GVDA 5CVUA 4ZTJA 1IXRC 3ZQGA 3Q0VA 1Y0NA 2H8RA 3RKXA 3T8RA 5GTIC 2A68F 2FOKA 1R58A 2R3SA 5JLWA 3WTYC 3T5XA 2R7VA 3HHHA 2VC0A 4XRMA 2HQRA 3FK7A 2A07F 1HKTA 3KZIC 3E3VA 2RQQA 3VYSB 1MBJA 2VODA 1KYWA 4XRSG 1VTNC 2RVCA 1YRNA 1YX5A 5EZGA 3N97A 1QHHD 5F04A 4HX4A 3EYIA 3U9GA 2E60A 1TNSA 5IT3A 1WFXA 3RZDJ 1ZTRA 1JGSA 2DBBA 3E6BA 3R0JA 2BW3A 2HKXA 3DLLF 3FBNB 2W7NA 1R36A 4E7JA 1U2WA 2WTEA 3ECHA 1JTXA 1VFCA 2FRHA 2EIKH 3NQOA 3CP8A 3ZN1A 2M45A 1W7PD 2DI3A 3BR5A 3ABTA 2X1EA 2L02A 3DEUA 3K9TA 3KIOA 4GYIA 1A36A 2HDDA 4XICA 1U9OA 3HKZN 5J1RA 3D5LA 2YS9A 2CV1A 5EYRA 3ECOA 5L3CA 2FE3A 1REPC 4B47A 1FYLA 4HDVA 3VSLA 3S2HJ 3GZ5A 3KLOA 3W2WA 3IKTA 1DU6A 1MMGA 2VONA 3DXJF 1E17A 2H1KA 3MVPA 2R7FA 1HLVA 1X1DA 2MD0A 1U5TB 2V1UA 4HLXA 3V4GA 1WRJA 3G3ZA 1VNDA 3A4CA 2QGUA 5CLSA 4M71A 3RPUA 1EH7A 3CDHA 2DMNA 1X1CA 1NG7A 3CC4I 2JSPA 2E7XA 2DO7A 2FA5A 3G71I 1MNDA 1VQ8I 2FSWA 3EUKL 5IYCJ 1OCTC 3I4MJ 4M73A 4B3AA 2VLAA 1X19A 1TNTA 5B1BH 2ZXWH 5F6FA 2A61A 2ADUA 1W7PB 2VIXA 2NNYA 3B6CA 1KU7A 4BBRJ 3S1QJ 1Y8RB 4DYQA 4QSHA 3TOAA 1FEXA 2L9RA 2NS7A 2OPTA 3LQRA 1MNMC 1X3WB 1T56A 3BTCA 3K1MA 1FYKA 2XGEA 2VC1A 3KEQA 4XORA 5CQEA 2I8DA 1P4XA 4EGYA 3W6JB 2IS1A 2X4HA 1HSTA 1UAAA 3G4SI 2GM4A 1Z1DA 1MBHA 3DQVC 2FBHA 4RGRA 3RKYA 3S3MA 1D1CA 4CCLA 4C2MJ 5FO5A 2P8TA 2E2IJ 1CQTA 1WH5A 2HXOA 5CVIA 2A5WA 4G6DA 1NH3A 1H8AC 4MQVA 1Y39A 1ULYA 3TW6A 1V5GA 2HGCA 1QGPA 2OQGA 2CQ7A 4P9FA 5L3FA 3LWFA 1KU2A 2HPIA 4UY8I 5F0HA 2EZLA 4KN4X 3V7SA 3P9KA 4RB1A 3MMYB 1OCZH 1Z0XA 2XKOA 3I64A 1JHFA 3IH3A 4ZDLA 3SEQA 2IGKA 1X2MA 2FOWA 1RR7A 4ITVA 4HQMA 2RV8A 3BDDA 3HIFA 4CZZA 4ZDOA 2VQGA 3NWSA 3IL2A 5EZHA 1YW8A 1SFEA 3WHCA 1P2FA 5J40A 3LSMA 3BLYA 2CWEA 3BR3A 3V7RA 2ZNZA 1IF1A 3BWGA 3FKJA 1G2HA 2VN2A 4JOMA 3M8EA 4PUSA 3SZTA 1X1BA 2LF7A 3WTTC 3C2HA 1F5TA 1GLNA 1JKQC 1WQ2A 1ORKA 3FWEA 4LG0A 1H0MA 3IV5A 2Z1DA 4L9TA 3ZMVA 1O7FA 3FMQA 1R00A 3W6KB 3CCEI 3GTKJ 3KFWX 2Y30A 3BR1A 4J00A 1I6XA 4IJAA 2R7SA 2UUZA 5ICCA 1ETYA 2NNNA 1G3YA 4RMNA 1IZ1A 1J2XA 3CTAA 4HW0A 5ILUA 2IXSA 3CO6C 2PJPA 2E35A 5L3BA 2FQ4A 1LEAA 2XAJA 1USSA 4RB0A 2DQRA 4CUGA 2GIZA 1V54H 2HVQA 1IG7A 1YI2I 2XB5A 3LSJA 5TISC 4AWXB 4LLNA 4M3DA 4ZYGA 1WKMA 3WGIA 5D5VB 2K40A 3A0HC 3RYRA 3FKIJ 5GADJ 5LBQA 1W0UA 1S6LA 2RNJA 5TGTA 3WE3A 2DPDA 4LOCA 3OY9A 4L5IA 4XLNF 1VQ4I 2KZVA 3PSFA 1HDPA 3JRHA 4AIJA 1IGNA 1WVRA 3H3VK 1NK3P 3CO7C 4BH9A 2YPRA 4FT8A 3I59A 2XUBA 3E5QA 5C4JJ 2TRTA 3JAMK 1HXDA 1QRYA 2KPMA 4ZTFA 4AM3A 2LKXA 5E1XA 4HNVA 5EEAA 4RDUA 3OYKA 1XMAA 3C2GA 1AKHB 1B4AA 1IXSB 1Z91A 3ELKA 2BEOA 1G59A 3L1PA 2KJCA 2KIUA 3ZQ7A 4RM2A 1FOKA 2IS6A 2EBIA 3NRVA 4OMZA 1MMSA 1OR7C 1GDTA 4XLEA 3OV8A 2OAZA 3GFMA 3I56I 3T1BA 2IGNA 1VQNI 1U0JA 2BOLA 1YJWI 3HC7A 2Z16A 5DYMA 3LSKA 2VXDA 2R7TA 4F93B 4LK0F 4AVPA 4JQFA 3ZN0A 3MAJA 3RZOJ 3K1PA 4ESBA 4BJTA 2GOMA 4MEYF 1E2XA 4U7DA 1T0FA 3CJQB 2ISZA 1R5GA 1BIAA 3D5SC 1R23A 4I98B 1IV6A 2AO9A 4P1WA 1ETQA 4NDLA 4HSTA 1YG2A 3L2VA 1HW2A 4G7ZF 3H9GA 5KHDA 4GXOA 1S72I 2OTJI 2E5NA 2QF7A 2CUZA 3REOA 4KJZA 3TBIA 1X58A 1VQ5I 4HOBA 3QP5A 5DEQA 2ZSIB 1X3ZB 4FE4A 1MSFC 1XN7A 2LREA 3TDZC 3OYMA 2BV6A 3CUQB 5E8IA 2O61A 1O3TA 1BOBA 4XKCA 2LBFA 4W1UA 3NWTA 4M6VA 3DV8A 3ERED 3IKVA 4B3XA 3LA7A 4G94A 3X2QH 4FISA 3OIQA 2L7MP 2NRAC 4XN3A 2JWTA 2RNGA 4G7OF 2HDWA 4DQ2A 3GFJA 5GPCA 1DDNA 1JT6A 1LE8A 2D1VA 3NARA 1F43A 4YIRX 3F8CA 3DTIA 1R5HA 3HSEA 4IRGA 4EJUA 1IAWA 3V42A 1GV5A 1WJ5A 3K4CA 1JT0A 4A0XA 3DLAA 5J4YA 2DA2A 1ZRFA 1OCOH 3PIPF 5DCFA 4JX5A 3LAPA 3GZ6A 2DK8A 2H09A 3SDBA 2QBYA 1RRJA 2JTVA 2NXNB 1YW9A 1ACIA 3HKZA 1EF4A 1SD5A 2NOGA 3BG5A 3FK6A 2FXAA 3CCJI 2O03A 4NBQA 4Y4RA 4A12A 3ZGKA 5M5WJ 3LL7A 2W48A 5AIPA 1FP2A 2CO5A 1ZREA 1W36C 5LHHA 2CW8A 2BYVE 4EGZA 5A2QZ 4KIBA 1ZGWA 1WWXA 2F5FA 3K4MA 4A0ZA 3LSRA 2XF5A 2COMA 3H35A 1L3LA 1XGMA 3F8BA 3ZPLA 3BZCA 2X6WA 4JX6A 2XAUA 3BZ6A 5FFXA 1D5YA 3E6CC 1OMIA 2JRMA 4ASNA 3G1MA 1IC8A 1XSVA 4Z6YA 1YS6A 1QNTA 3MZYA 1J09A 3OL4A 4I99C 1KZHA 4YG2F 1ZKGA 1MSEC 1P92A 2M8EA 2FEZA 3WE2A 3V7CA 5M3MJ 4NQWB 5GTHC 2LRDA 2W00A 2CUJA 3F6VA 4DBQA 3PJRA 1CF7B 1MMDA 1LNWA 1TT0A 2DXIA 3U1DA 1N25A 2STTA 2EFPA 4E4HA 5IPAA 2H6CA 1H9GA 4UUVA 2DCEA 5FD5A 2K7LA 1A6IA 3JTGA 2KRHA 2MC4A 3AAFA 2JA7J 2IW5A 2O9LA 3PFIA 3B02A 3LSPA 3KX2A 2V9VA 3DTKA 5E3MA 2M9HA 2QQBA 4GGGA 3ZMUA 2VKVA 2EINH 3P9CA 2M34A 3GLXA 1SD6A 2G0EA 4WF2A 4PSXA 3G6EI 1JE8A 3R4KA 3CCSI 3IRQA 2Z5UA 3TP3A 1VQKI 4KIFA 1D0YA 1E3HA 2K4JA 4ESFA 2IGMA 4ZZDA 4C3HJ 3WG9A 1FTZA 4Y3OA 4UV9A 1LKXA 4CCOA 1F1ZA 1JGGA 4E7ZA 2AHQA 1TWGJ 3WTSC 4DYCA 3DPUA 4D7MA 1J5YA 2HTJA 1R22A 1ZGJA 2GA1A 5CYVA 1ZLKA 1IN6A 4RB2C 4MNUA 1HBXG 3DKXA 3M7GA 2STWA 4BAYA 4XN0A 5FRMA 2BHYA 4CYDA 4BXUA 6PAXA 1G3WA 2M1BA 3J81K 3DU6A 2E5ZA 4PJMA 4A3EJ 2HEOA 4U0YA 1YYVA 5HNFA 4AVZA 2VBWA 3GXOA 3WTXC 3A1YA 4B8XA 1UFMA 4UVCA 1QVUA 4F52A 2GQQA 2PQ8A 1IN7A 2BY0A 4HV5A 2RGVA 3CC2I 2R0QC 4B4CA 2D2WA 2Y0MA 1XGNA 3LNQA 4E7KA 1BI3A 2DLLA 1H89C 5EGOA 2R5ZA 2W85A 4EQQA 3TO9A 1WCMJ 3BCAA 2B7EA 2H6BA 1UJ8A 2JMWA 2K9SA 3LSHA 5JR3A 2R7QA 1YRNB 4KNYA 3KP3A 3EYYA 1JUPA 1YS7A 4KICA 4A3DJ 4IVNA 3SFZA 1TL8A 4BJ6C 2H1LA 3VDXA 1USTA 4PFOA 3SQNA 3UKGA 3C2BA 4RBOA 2WC2A 1QPMA 2BW3B 3BZKA 5DCMA 4IOCF 2A05A 1K6YA 4E7HA 1D3YA 1SD7A 2XRNA 4FX0A 4CCJA 1QPIA 3U21A 2AXLA 5HLIA 5B1AH 2Z99A 2ZC2A 5LRRA 5C3EJ 1KQ0A 2FX0A 1W5CC 2LY2A 2DK5A 3KP2A 1DUXC 4XBFA 4X0GA 2E7WA 4B44A 1QO0D 1UCRA 2JK3A 2FMYA 3W6VA 4XKBA 1BC7C 3QU6A 2O8KA 2ZXHA 4V2FA 2KL4A 2P6SA 3M1EA 2ELJA 3OYCA 1KQ9A 2VKHA 4JX4A 2R7RA 2M0MA 2CUEA 2M4GA 3KPHA 4F55A 4FCYA 3S14J 2MGQA 5D5UB 3HYIA 1JXSA 3VYRB 3JR9A 2PLYA 2EIJH 1OR7A 2I10A 1U5TC 2BXZA 5JLXA 3E0JB 2QQ9A 2WADA 4C3JJ 3P5JA 1WH7A 3ZQIA 2W84A 1X3UA 2KISA 4LMYA 2DYRH 1UG2A 4DZJA 1PYVA 4C30A 5J3LA 2F5EA 1BJZA 2IA0A 2L7KA 2M8GX 1JTYA 4DNCA 5ICEA 1IW7F 3BG6A 4EM2A 4FHTA 3H92A 1IUYA 1BL0A 2CG4A 4XMYA 2XSJC 1TQPA 3BG9A 3HHGA 5CPRB 2HPMA 1LVKA 1Y8QB 2WB1N 4BDYA 3J80K 2MC3A 4EV0A 3CCUI 3P7NA 1T0FC 1FP1D 2VPRA 4XSXF 2CQKA 4A3KJ 2P6TA 4E70A 4ENJA 3QRFF 1TLHB 5L3EA 2HOAA 4U0WA 3OS0A 5D6EA 2W4SA 1ZLJA 1TW2A 4C9YA 1TC3C 2KIMA 2M3AA 3HZJA 1ZARA 2KDZA 3FXMA 3S8PA 2QM3A 3OR2C 1OYYA 2R5YA 2KFDA 1OYWA 1YQAA 1SMTA 5GPAA 3K7AJ 4M72A 3CLOA 4CYCA 5EG0B 1I5ZA 1U9NA 4L18B 1SAUA 3VB2A 3RQ4A 1B8IA 1KU3A 4BXFA 1VQ9I 3HOVJ 3PO3J 5FLXZ 2KRFA 1B72B 4OWRB 2BGCA 3FMSA 4QIWN 1D5VA 1MDMA 2HTSA 3WGHA 1BI2A 2IEKA 2DQLA 1OISA 3PFYA 4A3LJ 4AYBN 2HQ5A 4J01A 4PCQA 3PSIA 2L54A 1H9TA 1XG1A 4NC6A 1LUJB 3FXRA 4G8XA 1GT0C 4IQJA 5LGUA 3Q9SA 2XROA 1UHMA 3PNVA 3S2WA 4IL6C 2VKDA 2O3FA 2M87A 4ENNA 2FUG2 2CUFA 3K4LA 2DFIA 3TQNA 5J4VA 1K4SA 1WI9A 2GIVA 2CQNA 5LHIA 1U8BA 3W2VA 3HUGB 2EFWA 5JVGF 2VPLA 3K4JA 4D7NA 3WTUC 4HF2A 1Z3XA 2VQHA 3CMMA 5HDGA 2AXTC 3KYLA 5F27A 3ZQHA 3KE2A 1UZCA 4ZYEA 1XC5A 1I6HJ 5HNHA 2DA4A 3ZOBA 1ZG1A 4BL0B 1XCBA 1WI3A 1K79A 3BR2A 3E1SA 1HQCA 3IRRA 2L4MA 4XNFA 3CESA 2Z3YA 4V2GA 1RESA 2ZFUA 2AS5F 4BHCA 2JRTA 2CQXA 3RYPA 4OAYA 2CV0A 4N4NB 4QWQA 1IUFA 4XRSA 4UV8A 1FYMA 1Z3YA 3ONQA 1TQMA 3DBHB 3IP4B 5JFRA 2EFQA 3HOXJ 1T39A 4KUMA 5FKNA 3OL3A 1BM9A 2PMUA 3E6MA 3H9JA 1G3TA 1Z7LA 2IGOA 2QKLB 5M5XJ 5JHFA 2G9WA 3G1LA 3FXOA 5EDNA 3PUFA 1ZN2A 1SVMA 1L0OC 3K4NA 4M9SA 4LIUA 2W82A 1DGWY 3HL2A 4BEHA 2OTLI 1IO2A 3I53A 2A5YB 3CF5F 2ZJRF 2KIFA 2OV7A 4ZYDA 2XSDC 2Y9YA 5IOZA 4LD5A 2X6OA 5J1YA 3K69A 1FBSA 1O3RA 4Q48A 1TTYA 4ZYHA 3LFKA 2QKMB 1G6NA 2W24A 1TZLA 2DA7A 2JVHA 1FSHA 2F5VA 1M1EB 2D45A 1XGSA 1BW6A 1ZGAA 5DD4A 4KMFA 3KP7A 3GBGA 3J7YJ 5E8GA 2L3DA 1ZR2A 4RAFA 2DOEA 2EA4A 3JTHA 1R7JA 3TL4X 1S5LC 1JJ8C 1F9NA 3VODA 2ZXIA 1N75A 2WY8Q 2QLZA 1PDNC 2NVTJ 1ETVA 1SANA 2TCTA 1D8JA 2K27A 2ESHA 2NYXA 4GO1A 2CGPA 2KQRA 3LQQA 2NOJB 4EVIA 1ENHA 3MN2A 4LB6B 4S0HB 3SJMA 2FNPA 3RTRA 2JPBA 2ZNYA 2K9QA 2QYOA 3TDUC 3BPVA 3N4MA 1G3SA 3HOTA 3QOEA 2WAEA 5C4XJ 1R4NB 4HLYA 3RSNA 1K78B 3RDIA 5B66C 3T8TA 4M6XA 2LBFB 1MH3A 3K6GA 2JVGA 3UR3C 1HCRA 2JUGA 2WV1A 3CUQC 3GTOJ 1XDSA 3GTMJ 2JPCA 3IUOA 5TJJA 4XK4A 3FHNA 3BOQA 1RUNA 3OYAA 1SAXA 1IRZA 1OCPA 2VJ5A 1U3EM 3KP5A 4HAMA 1Z77A 3BR0A 1MW7A 5FB2A 2XASA 2ECCA 1Y6IA 3IWFA 3FXQA 2EIMH 4HPQA 5HLHA 4PGHA 1MBFA 3J7AY 1MIJA 3F0CA 1J9IA 2CFXA 3D1NI 2YX7A 2RC4A 3MCZA 1BI1A 3K70D 3HDDA 2JA5J 5IP9J 1ZQ3P 1FOWA 4QTRA 5HODA 1TP4A 2QBYB 1MBGA 2V26A 4OIPF 3BCBA 5D8LB 1R4MB 2JQ7A 3L2CA 2DJNA 3H5RA 4AC0A 4XOTA 1K6OA 2P5KA 2FNAA 3GFIA 2MH2A 2OA4A 3F8MA 2EWNA 3FZVA 3JRDA 2IA2A 3C7JA 4CDGA 5M5YJ 2CS3A 3GF2A 2Z9OA 2FBIA 2GBYA 2HR3A 3GTLJ 4BYYA 4UUSA 2CH0A 3T0YA 5FROA 4KN7X 4HA8A 3I5UA 2EQRA 4N0BA 1CGPA 2VJIA 1WJCA 5CVJA 2Q2EB 2P7VB 3FDYA 4KFCA 3OS1A 2LDUA 2XPVA 3S3NA 4NC7A 2LOOA 3EPZA 4OOIA 3H36A 2LKSA 1VQ7I 1U5TA 1YTYA 2ISYA 1F4KA 2CMPA 4MTDA 3CD6I 1FOYA 2ICWG 3GWZA 2CW7A 1FY7A 3JSOA 5E3OA 1D8KA 2QQAA 2WB1A 3HOYJ 2V79A 2LD5A 1RC9A 4YIFA 2ID6A 4I7HA 3H0GJ 3SEZA 5DUIA 4M74A 2MFZA 2OCEA 2LLKA 2XGDA 3QP6A 4GRIA 4M3FA 2VB6A 5AONA 2Y9ZA 3JRFA 4KYWA 2DTRA 2FMLA 1W7PA 4HX7A 4XLCA 3KEYA 3A01B 1SVLA 3A02A 2DMTA 5EEGA 4N4OB 1XMXA 2KZGA 3KYCB 4PFPA 1F36A 4PJ0C 3ZR8X 4D5FA 3E6DA 2K9LA 1WJBA 5JI6A 3OYLA 1LB2A 4E7LA 4A3MJ 2K86A 2HFHA 1QQIA 1K4TA 5F64A 3WU0A 2ETHA 5J6XA 2J5OA 2W25A 2X48A 5ICFA 2GLOA 1S8NA 2HYJA 4UUTA 2E1MC 1T08B 5KK1A 1ERDA 3WU2C 1AHDP 4AYBA 3DKWA 5F08A 1LFUP 3F9KA 2M7AA 1KU9A 3LA2A 4CCNA 1W5SA 2HZTA 2UV1A 2E19A 3K10A 2L7FP 2HOTA 2K3PA 4ON0A 2MYSA 4BQNA 2VT3A 3HTUA 4G9YA 4DW6A 1Y0UA 3U1KA 2ZMEB 3UNGC 3HSFA 3TKYA 1FMWA 4JYKA 2FU4A 1ZG5A 2LK2A 4IHSA 1BN5A 3S1MJ 3GTJJ 4A6EA 4AU7A 3RIRA 3QOPA 4ENKA 5DM7F 3QQAA 3FM5A 2CSOA 3S3OA 4D5CA 1O3SA 4XKVA 4EMSA 2M5WA 3M3YJ 2BY2A 3LOCA 4BKXA 2GXBA 2DOAA 4KT5C 1IRFA 4KMUX 2V1NA 5LRSA 2XF7A 3SHFA 3VWBA 4OINF 1R1UA 3FISA 1WJAA 3DBRB 2BBYA 2IS2A 3AL0C 2QQ8A 2L2OA 3AG3H 2W1OA 1TW3A 3PNYA 2DMPA 1DGRM 4RS8A 4BHBA 3RKQA 1ZH5A 1I1SA 4LG3A 2BVLA 5EGOB 4MFDA 2ZJPF 3H5NA 5LLQA 1EH6A 2X51A 4XKWA 3L09A 2R7WA 2K9MA 1UHWA 1LFPA 3OSGA 3A2KA 1SFXA 3JRCA 2DTZA 2VJ4A 2Z33A 3MKWB 2R4GA 3MWMA 4P55A 2ME0A 2QWWA 2UWMA 3F23A 2X6XA 2IRFG 2VKEA 2MD5A 2MW8A 5FFZA 1R1VA 2H94A 5FRNA 2XGCA 2L5QA 2MBFA 3SZPA 3DF8A 1FMVA 1I3QJ 1KYZA 4P5OA 1BC8C 3S93A 1OCRH 2MLGA 3IAS2 2L7ZA 4I0AA 5DM6F 5IT9Z 3ML6A 2HOEA 1Z7UA 1P4WA 2DDAA 4BQQA 5LEKA 4DOZA 3OIOA 4V19K 1TT5B 3MZHA 1FTTA 2GXGA 2DU9A 4UHTA 1Z05A 3AG4H 1BJAA 4A0YA 2LMDA 5CQGA 1QZZA 1MMNA 1VQOI 3JREA 3B73A 4UB6C 3LSTA 3OYJA 3FXJA 4I0BA 4L5EA 1ONVA 2D1HA 4CH7A 3WTVC 3TEDA 2HS5A 2DPUA 1DPUA 2COBA 3OOUA 2YUSA 3HM5A 1FC3A 1LFBA 1LJ9A 3H3ZA 5DD8A 5IOYA 3ERMA 3KETA 2UXXA 2DA3A 4CZCA 5LGNA 5KCMA 5LHGA 1WJFA 2PI0A 1UHSA 3GZNB 4L9NA 4IRIA 2BY1A 3HG9A 3I4NJ 4H0EA 1GV2A 2X1DA 1HOMA 3EDPA 2KIQA 2X9DA 1HW1A 3GVAA 1OKRA 2LVSA 2JT1A 1ETOA 4L9JA 2X85A 2XC7A 1BBYA 2KKOA 3S16J 2K9NA 3OMYA 5E20A 3TP0A 1W1WE 1AU7A 1KGSA 2XB0X 4WXHA 3OR1C 4EATA 3L2QA 2O7OA 1V5FA 5EF6A 4OMYA 3OWTA 3I54A 1LEBA 2VE8A 2QZ8A 2DT5A 2P4WA 2P81A 2PJRB 4NB5A 4M6YA 3FXKA 2GA2A 1LDDA 4ZC3A 3WGGA 2DT7B 2R5YB 1D1BA 3QPLA 3CUQA 4CCKA 3JCUC 4HG2A 2MABA 2G7HA 3IAM2 4CYCB 3JW4A 3G2BA 3C1DA 2NS8A 4Y15A 4KITB 3K2AA 5CJ9A 4LJZF 1OCCH 3OIPA 3I71A 1MDMB 4JK1X 5LEJA 4HRIA 2EPFA 1G8XA 1A04A 4G7HF 4B43A 2YU9J 1ZELA 4MLOA 2ZSHB 3FHZA 1P4AA 1V3FA 4B09A 5BPDA 3CZ6A 4HSRA 4U88A 2EZIA 4L5JA 3C3WA 4LLLA 1MZBA 1TWCJ 4D1QA 4XLHA 2EV5A 3A0BC 1Y1WJ 2QVOA 3QAHA 2HU9A 3BJ6A 3GFLA 3EQLF 4RGXA 3FXLA 2M30A 1UMQA 4CSWA 1EA3A 5E18F 3L2UA 2GXAA 2HNHA 2KP6A 3DTEA 3WU1B 4BU2A 4BBSJ 3GUDA 2K3FA 1UB9A 3HRSA 3J7ZI 1QA6A 5A2QK 1BR1A 5IP7J 2XPWA 5JVTA 4BE1A 3ULQB 4H4KC 2QA4I 4CGZA 4CHUA 1I27A 1O4XA 4Y7NJ 4RAGA 4NUBA 3CMEI 4YRVA 4AIHA 4IF4A 3N05A 2KT0A 2XVCA 4WXCA 1IV8A 3CDIA 5D4RA 3S1NJ 4ETSA 3S15J 4X6AJ 2UXNA 3M4OJ 1FWZA 1YO5C 4ZH4F 3CCQI 5JHUA 2QEXI 2LG4A 1TBXA 4A6DA 1MJ9A 4RAZA 2XPUA 2OU2A 2VUMJ 1P6RA 3TO6A 1W5TA 2OJED 4DJAA 1JKRC 1APLC 1J0RA 3ASNH 1SEUA 2L4AA 2NVUB 4BQAA 3DPTA 1QZEA 1EKEA 3JRIA 3DWLE 2LC2A 3PUBA 3PQKA 4RM3A 1SFUA 1JUMA 3JRGA 1KONA 5K7ZA 5LD2C 1XMKA 1Y1VJ 1ZK8A 4QPQA 4DGWB 4NQWA 2ECBA 4QLCU 3K1NA 4HEA2 3GO5A 2A69F 5GP9A 5KNLA 2JJ7A 1CF7A 5ED4A 1ITYA 1R6RA 3KZYA 3CJRB 4IHYA 2EB7A 1PUEE 3ZP5A 3ZQCA 2QCOA 4TV7A 4GDFA 3F8NA 2AQEA 4RA2A 4MTEA 2EV0A 5K5RA 1WHUA 1VQLI 4II3A 1ZR4A 2B0LA 1R49A 2DA6A 1EJ9A 5CKTA 4XLFA 5DUKA 4XM3A 2A6HF 1IN5A 1WPKA 1OJLA 3GLLA 1P9QC 3MZ8A 4UNOA 2CJJA 1NHAA 3BQZA 4FE7A 3ZCOA 4A3FJ 3BQYA 4G12A 3F6OA 1XPXA 4HBLA 3BJOA 2Y31A 3Q0UA 5GAEJ 3OYNA 3CDLA 4OU0A 2JA2A 3BT9A 5ILSA 4L0ZB 1FBQA 2XKPA 3CF2A 2ZXJA 4XL9A 1HW5A 3VSKA 2M7BA 4KISA 1YW7A 1ZAOA 3BTLA 2KJBA 1R71A 2ZJ2A 3FBIB 4LK1F 4S05A 1JHHA 3ABLH 3TO7A 2EV6A 2VOOA 4I76A 2KMUA 3IC7A 2DAOA 1MMAA 5D4SA 3PIOF 3DKYA 1YJ9I 1IJWC 2VXZA 1E3OC 1C0WA
chains in the Genus database with same CATH topology
1JKOC 1MBFA 3NAUA 1JUSA 1GV5A 3F0CA 2N8GA 1JT0A 3D1NI 2HOSA 4IHVA 2DA2A 1TWAJ 2E1OA 4JX5A 3HDDA 1MBEA 2JA5J 5FLVA 5IP9J 1ZQ3P 5FKKA 2EZHA 4QTRA 5HODA 4BY7J 1EF4A 2NVQJ 2NOGA 5E3LA 1MBGA 3BG5A 3FK6A 4JP0A 2DJNA 4AC0A 1HF0A 2XRLA 5M5WJ 2CQQA 2W48A 3JRDA 5M5YJ 2B63J 1JKPC 4C3IJ 1ZGWA 2GBYA 3LSRA 1A5JA 2EH3A 4M3BA 3GTLJ 4UUSA 2MG4A 3LSGA 4JX6A 2OF7A 4UUSB 1D5YA 5IYBJ 3IH4A 4MO7A 3G1MA 1IC8A 4DYRA 2EQRA 4BY1J 2DMQA 5FKLA 3RQIA 3BTIA 4M3GA 3DCFA 5IYDJ 2XPVA 4M3EA 3O8GA 2M0CA 3HOZJ 3A03A 1TWFJ 2JA6J 1ZKGA 1MSEC 4B1RA 3FIWA 5M3MJ 3JRAA 5E3OA 1PUFA 3HOYJ 2LD5A 3CCYA 4W97A 1PUFB 2ID6A 3H0GJ 3GTPJ 5F0FA 3GTGJ 1OFCX 2LLKA 2XGDA 4M3FA 3Q0WA 4A69C 2Y9ZA 5IPAA 3JRFA 4AUXA 1A6IA 4A3IJ 3A01B 3A02A 5C44J 2DMTA 2JA7J 2O9LA 4D5FA 2R7ZJ 1F36A 3LSPA 5E3MA 2M9HA 4A3MJ 2VKVA 2M34A 2ZB9A 2G0EA 1P7IA 2X48A 2E2HJ 2R93J 2GLOA 3O8HA 3TP3A 2DMUA 1FJLA 2HYJA 4UUTA 2LTPA 3SDGA 2JN6A 1FIPA 1AHDP 5F08A 1LFUP 4C3HJ 1FTZA 1IDZA 1BA5A 1JGGA 5DTDA 2AHQA 1TWGJ 4DYCA 3VPRA 2E19A 4D7MA 2L7FP 2HOTA 4J19A 2EZKA 2DN0A 4A3CJ 4DW6A 5EG0A 1POGA 2L0KA 4JYKA 1B72A 2LR8A 2LK2A 1JJ6C 3S1MJ 3GTJJ 3PO2J 1VF9A 1DU0A 5M3FJ 4A3EJ 4I6ZA 3QQAA 1LE8B 4D5CA 3M3YJ 2PMZN 1QVUA 3S1RJ 3LOCA 4BKXA 3QPSA 1MBKA 1GVDA 1ETXA 3ZQGA 3Q0VA 3FISA 2H8RA 1WGXA 2R0QC 4B4CA 5JLWA 2ID3A 3LNQA 2IBDA 4XRMA 3FK7A 1H89C 2DMPA 5EGOA 1MBJA 2R5ZA 1WCMJ 4XRSG 1YRNA 2JMWA 3RKQA 5EZGA 2K9SA 2LP0A 5EGOB 5F04A 3JRBA 4MFDA 1YRNB 3RZDJ 1JUPA 1ZTRA 4A3DJ 3OSGA 3UKGA 3JRCA 2DTZA 3C2BA 4RBOA 1RKTA 2HI3A 1JTXA 1VFCA 2ME0A 4A3BJ 2VKEA 4MFEA 2MW8A 3BR5A 2XGCA 1QPIA 2HDDA 4XICA 1U9OA 1I3QJ 3HKZN 5C3EJ 5J1RA 2YS9A 2FX0A 5EYRA 2L7ZA 3ZQFA 3TW7A 3S2HJ 1DU6A 2JK3A 3OIOA 3W6VA 2O8KA 1FTTA 2M2EA 4V2FA 5J1UA 4DZPA 2H1KA 3MVPA 1T33A 1HLVA 1NTCA 4JX4A 2Y2ZA 2CUEA 2R92J 1FIAA 1ETKA 1VNDA 3JREA 4FCYA 2MGQA 3S14J 4A3GJ 3HGYA 3BR6A 2DMNA 4L5EA 2NVYJ 3JR9A 2I10A 2MSYA 3TEDA 1U78A 3CMYA 5JLXA 2COBA 1IDYA 3OOUA 4C3JJ 5IYCJ 1OCTC 3I4MJ 4B3AA 1WH7A 2YUSA 3HM5A 4X1EA 3ZQIA 3B6AA 1LFBA 5IOYA 1UG2A 3B6CA 2DA3A 4DZJA 5J3LA 3BTJA 4BBRJ 1BJZA 5FJ8J 2E2JJ 3S1QJ 4DYQA 1UHSA 2M8GX 4QSHA 1JTYA 3HEFA 4XIDA 2LY9A 3I4NJ 1FEXA 1GV2A 2L9RA 2NS7A 2OPTA 4GFBA 1MNMC 3ZQLA 1HOMA 1T56A 2X9DA 3BTCA 1BL0A 2XGEA 3BG9A 2LVSA 1ETOA 2WB1N 2VPRA 3S16J 2K9NA 4A3KJ 3TP0A 2DA5A 2GM4A 1MBHA 1AU7A 1X2NA 2XB0X 2HOAA 4C2MJ 2O7OA 5DS9A 5EF6A 2E2IJ 1CQTA 1WH5A 2HXOA 2D5VA 1W0TA 1MH4A 1TC3C 3HBLA 1NK2P 1H8AC 3HOUJ 2KDZA 2P81A 2R5YA 5GPAA 3K7AJ 2CRGA 4CYCA 5EG0B 1U9NA 3TW6A 2R5YB 3QPLA 1B8IA 3HOVJ 3PO3J 5F0HA 2EZLA 4CYCB 1B72B 4A3JJ 2ME6A 4QIWN 4Y52J 1Z0XA 3Q3SA 2NS8A 3BG3A 3IH3A 1H88C 3K2AA 1X2MA 1RR7A 2IEKA 9ANTA 4A3LJ 4AYBN 2HQ5A 1XS9A 2WAQN 1XG1A 3MKLA 5EZHA 3WHCA 1ETWA 4BXXJ 3SFIA 5F1JA 1GT0C 2YU9J 4MLOA 3BR3A 1RPWA 1G2HA 2EZIA 1TWCJ 2CUFA 4IEJA 1RKWA 1Y1WJ 1JKQC 1ORKA 1U8BA 3IV5A 2R5ZB 2CU7A 4D7NA 1UMQA 3GTKJ 5F0CA 2Y30A 3WHBA 3DEWA 3GTQJ 3BR1A 1TWHJ 5F27A 3ZQHA 1P7JA 3HB9A 1ETYA 1XC5A 4BBSJ 1I6HJ 2DA4A 3ZOBA 5IP7J 2XPWA 1WI3A 2VI6A 3BR2A 1E3OC 2FQ4A 1O4XA 4Y7NJ 1BW5A 1IG7A 2XB5A 1RESA 3LSJA 2KT0A 4V2GA 1QVTA 4M3DA 2CQXA 3S1NJ 3S15J 4X6AJ 3M4OJ 2K40A 1IUFA 2Y0SN 3FKIJ 4XRSA 1K83J 1W0UA 3OSFA 2XPUA 4LOCA 3HOXJ 2ELKA 1RETA 2NVXJ 2VUMJ 1HDPA 5FKNA 3JRHA 4FTHA 1IGNA 3H3VK 1JKRC 1NK3P 1APLC 5C4JJ 4IHXA 2TRTA 3JRIA 1QRYA 5M5XJ 2LKXA 3G1LA 1AKHA 4HNVA 5EEAA 5EDNA 4RDUA 1R9TJ 2LFBA 1JUMA 5IP6A 3JRGA 1AKHB 5K7ZA 1ZK8A 1Y1VJ 3HGGA 2ECBA 1SFOJ 2RAEA 3L1PA 5GP9A 4A93J 2JJ7A 2EBIA 2XSDC 2Y9YA 5IOZA 1I50J 5K7HA 2X6OA 5J1YA 1GDTA 1ITYA 3G1OA 4IHYA 3ZQCA 2QCOA 3IH2A 2IAIA 1S7EA 2DA7A 3PM1A 3A01A 3S17J 1BW6A 4EEFG 3RZOJ 4MIMA 3GBGA 1ZR4A 4IHWA 1ZR2A 2FD5A 5K7FA 2DA6A 1JJ8C 2AO9A 5FKOA 1IV6A 1ETQA 4NDLA 3HOWJ 1WPKA 1OJLA 2DA1A 2NVTJ 1ETVA 1SANA 2TCTA 2CJJA 3BQZA 4FE7A 4A3FJ 1HDDC 1ENHA 2QF7A 3MN2A 4S0HB 3BQYA 4G12A 5FKMA 1X58A 3SJMA 3S2DJ 2Y31A 3Q0UA 2HXIA 2K9QA 2FJ1A 3CDLA 1K61A 4FE4A 3BT9A 1MSFC 4ABZA 1B8IB 3CQZJ 5C4XJ 2JA8J 4W1UA 1VI0A 5BNGA 4M6VA 3BTLA 1MH3A 5FLMJ 1HCRA 3GTOJ 2WV1A 3GTMJ 4FISA 4XK4A 2L7MP 4I76A 1IRZA 1OCPA 5GPCA 1JT6A 1LE8A 1Z77A 3BR0A 3E7LA 2ECCA 5E3NA 3NARA 1IJWC 1F43A 2JWTA 1Q1VA 1GUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKO C;  1MBF A;  3NAU A;  1JUS A;  1GV5 A;  3F0C A;  2N8G A;  1JT0 A;  3D1N I;  2HOS A;  4IHV A;  2DA2 A;  1TWA J;  2E1O A;  4JX5 A;  3HDD A;  1MBE A;  2JA5 J;  5FLV A;  5IP9 J;  1ZQ3 P;  5FKK A;  2EZH A;  4QTR A;  5HOD A;  4BY7 J;  1EF4 A;  2NVQ J;  2NOG A;  5E3L A;  1MBG A;  3BG5 A;  3FK6 A;  4JP0 A;  2DJN A;  4AC0 A;  1HF0 A;  2XRL A;  5M5W J;  2CQQ A;  2W48 A;  3JRD A;  5M5Y J;  2B63 J;  1JKP C;  4C3I J;  1ZGW A;  2GBY A;  3LSR A;  1A5J A;  2EH3 A;  4M3B A;  3GTL J;  4UUS A;  2MG4 A;  3LSG A;  4JX6 A;  2OF7 A;  4UUS B;  1D5Y A;  5IYB J;  3IH4 A;  4MO7 A;  3G1M A;  1IC8 A;  4DYR A;  2EQR A;  4BY1 J;  2DMQ A;  5FKL A;  3RQI A;  3BTI A;  4M3G A;  3DCF A;  5IYD J;  2XPV A;  4M3E A;  3O8G A;  2M0C A;  3HOZ J;  3A03 A;  1TWF J;  2JA6 J;  1ZKG A;  1MSE C;  4B1R A;  3FIW A;  5M3M J;  3JRA A;  5E3O A;  1PUF A;  3HOY J;  2LD5 A;  3CCY A;  4W97 A;  1PUF B;  2ID6 A;  3H0G J;  3GTP J;  5F0F A;  3GTG J;  1OFC X;  2LLK A;  2XGD A;  4M3F A;  3Q0W A;  4A69 C;  2Y9Z A;  5IPA A;  3JRF A;  4AUX A;  1A6I A;  4A3I J;  3A01 B;  3A02 A;  5C44 J;  2DMT A;  2JA7 J;  2O9L A;  4D5F A;  2R7Z J;  1F36 A;  3LSP A;  5E3M A;  2M9H A;  4A3M J;  2VKV A;  2M34 A;  2ZB9 A;  2G0E A;  1P7I A;  2X48 A;  2E2H J;  2R93 J;  2GLO A;  3O8H A;  3TP3 A;  2DMU A;  1FJL A;  2HYJ A;  4UUT A;  2LTP A;  3SDG A;  2JN6 A;  1FIP A;  1AHD P;  5F08 A;  1LFU P;  4C3H J;  1FTZ A;  1IDZ A;  1BA5 A;  1JGG A;  5DTD A;  2AHQ A;  1TWG J;  4DYC A;  3VPR A;  2E19 A;  4D7M A;  2L7F P;  2HOT A;  4J19 A;  2EZK A;  2DN0 A;  4A3C J;  4DW6 A;  5EG0 A;  1POG A;  2L0K A;  4JYK A;  1B72 A;  2LR8 A;  2LK2 A;  1JJ6 C;  3S1M J;  3GTJ J;  3PO2 J;  1VF9 A;  1DU0 A;  5M3F J;  4A3E J;  4I6Z A;  3QQA A;  1LE8 B;  4D5C A;  3M3Y J;  2PMZ N;  1QVU A;  3S1R J;  3LOC A;  4BKX A;  3QPS A;  1MBK A;  1GVD A;  1ETX A;  3ZQG A;  3Q0V A;  3FIS A;  2H8R A;  1WGX A;  2R0Q C;  4B4C A;  5JLW A;  2ID3 A;  3LNQ A;  2IBD A;  4XRM A;  3FK7 A;  1H89 C;  2DMP A;  5EGO A;  1MBJ A;  2R5Z A;  1WCM J;  4XRS G;  1YRN A;  2JMW A;  3RKQ A;  5EZG A;  2K9S A;  2LP0 A;  5EGO B;  5F04 A;  3JRB A;  4MFD A;  1YRN B;  3RZD J;  1JUP A;  1ZTR A;  4A3D J;  3OSG A;  3UKG A;  3JRC A;  2DTZ A;  3C2B A;  4RBO A;  1RKT A;  2HI3 A;  1JTX A;  1VFC A;  2ME0 A;  4A3B J;  2VKE A;  4MFE A;  2MW8 A;  3BR5 A;  2XGC A;  1QPI A;  2HDD A;  4XIC A;  1U9O A;  1I3Q J;  3HKZ N;  5C3E J;  5J1R A;  2YS9 A;  2FX0 A;  5EYR A;  2L7Z A;  3ZQF A;  3TW7 A;  3S2H J;  1DU6 A;  2JK3 A;  3OIO A;  3W6V A;  2O8K A;  1FTT A;  2M2E A;  4V2F A;  5J1U A;  4DZP A;  2H1K A;  3MVP A;  1T33 A;  1HLV A;  1NTC A;  4JX4 A;  2Y2Z A;  2CUE A;  2R92 J;  1FIA A;  1ETK A;  1VND A;  3JRE A;  4FCY A;  2MGQ A;  3S14 J;  4A3G J;  3HGY A;  3BR6 A;  2DMN A;  4L5E A;  2NVY J;  3JR9 A;  2I10 A;  2MSY A;  3TED A;  1U78 A;  3CMY A;  5JLX A;  2COB A;  1IDY A;  3OOU A;  4C3J J;  5IYC J;  1OCT C;  3I4M J;  4B3A A;  1WH7 A;  2YUS A;  3HM5 A;  4X1E A;  3ZQI A;  3B6A A;  1LFB A;  5IOY A;  1UG2 A;  3B6C A;  2DA3 A;  4DZJ A;  5J3L A;  3BTJ A;  4BBR J;  1BJZ A;  5FJ8 J;  2E2J J;  3S1Q J;  4DYQ A;  1UHS A;  2M8G X;  4QSH A;  1JTY A;  3HEF A;  4XID A;  2LY9 A;  3I4N J;  1FEX A;  1GV2 A;  2L9R A;  2NS7 A;  2OPT A;  4GFB A;  1MNM C;  3ZQL A;  1HOM A;  1T56 A;  2X9D A;  3BTC A;  1BL0 A;  2XGE A;  3BG9 A;  2LVS A;  1ETO A;  2WB1 N;  2VPR A;  3S16 J;  2K9N A;  4A3K J;  3TP0 A;  2DA5 A;  2GM4 A;  1MBH A;  1AU7 A;  1X2N A;  2XB0 X;  2HOA A;  4C2M J;  2O7O A;  5DS9 A;  5EF6 A;  2E2I J;  1CQT A;  1WH5 A;  2HXO A;  2D5V A;  1W0T A;  1MH4 A;  1TC3 C;  3HBL A;  1NK2 P;  1H8A C;  3HOU J;  2KDZ A;  2P81 A;  2R5Y A;  5GPA A;  3K7A J;  2CRG A;  4CYC A;  5EG0 B;  1U9N A;  3TW6 A;  2R5Y B;  3QPL A;  1B8I A;  3HOV J;  3PO3 J;  5F0H A;  2EZL A;  4CYC B;  1B72 B;  4A3J J;  2ME6 A;  4QIW N;  4Y52 J;  1Z0X A;  3Q3S A;  2NS8 A;  3BG3 A;  3IH3 A;  1H88 C;  3K2A A;  1X2M A;  1RR7 A;  2IEK A;  9ANT A;  4A3L J;  4AYB N;  2HQ5 A;  1XS9 A;  2WAQ N;  1XG1 A;  3MKL A;  5EZH A;  3WHC A;  1ETW A;  4BXX J;  3SFI A;  5F1J A;  1GT0 C;  2YU9 J;  4MLO A;  3BR3 A;  1RPW A;  1G2H A;  2EZI A;  1TWC J;  2CUF A;  4IEJ A;  1RKW A;  1Y1W J;  1JKQ C;  1ORK A;  1U8B A;  3IV5 A;  2R5Z B;  2CU7 A;  4D7N A;  1UMQ A;  3GTK J;  5F0C A;  2Y30 A;  3WHB A;  3DEW A;  3GTQ J;  3BR1 A;  1TWH J;  5F27 A;  3ZQH A;  1P7J A;  3HB9 A;  1ETY A;  1XC5 A;  4BBS J;  1I6H J;  2DA4 A;  3ZOB A;  5IP7 J;  2XPW A;  1WI3 A;  2VI6 A;  3BR2 A;  1E3O C;  2FQ4 A;  1O4X A;  4Y7N J;  1BW5 A;  1IG7 A;  2XB5 A;  1RES A;  3LSJ A;  2KT0 A;  4V2G A;  1QVT A;  4M3D A;  2CQX A;  3S1N J;  3S15 J;  4X6A J;  3M4O J;  2K40 A;  1IUF A;  2Y0S N;  3FKI J;  4XRS A;  1K83 J;  1W0U A;  3OSF A;  2XPU A;  4LOC A;  3HOX J;  2ELK A;  1RET A;  2NVX J;  2VUM J;  1HDP A;  5FKN A;  3JRH A;  4FTH A;  1IGN A;  3H3V K;  1JKR C;  1NK3 P;  1APL C;  5C4J J;  4IHX A;  2TRT A;  3JRI A;  1QRY A;  5M5X J;  2LKX A;  3G1L A;  1AKH A;  4HNV A;  5EEA A;  5EDN A;  4RDU A;  1R9T J;  2LFB A;  1JUM A;  5IP6 A;  3JRG A;  1AKH B;  5K7Z A;  1ZK8 A;  1Y1V J;  3HGG A;  2ECB A;  1SFO J;  2RAE A;  3L1P A;  5GP9 A;  4A93 J;  2JJ7 A;  2EBI A;  2XSD C;  2Y9Y A;  5IOZ A;  1I50 J;  5K7H A;  2X6O A;  5J1Y A;  1GDT A;  1ITY A;  3G1O A;  4IHY A;  3ZQC A;  2QCO A;  3IH2 A;  2IAI A;  1S7E A;  2DA7 A;  3PM1 A;  3A01 A;  3S17 J;  1BW6 A;  4EEF G;  3RZO J;  4MIM A;  3GBG A;  1ZR4 A;  4IHW A;  1ZR2 A;  2FD5 A;  5K7F A;  2DA6 A;  1JJ8 C;  2AO9 A;  5FKO A;  1IV6 A;  1ETQ A;  4NDL A;  3HOW J;  1WPK A;  1OJL A;  2DA1 A;  2NVT J;  1ETV A;  1SAN A;  2TCT A;  2CJJ A;  3BQZ A;  4FE7 A;  4A3F J;  1HDD C;  1ENH A;  2QF7 A;  3MN2 A;  4S0H B;  3BQY A;  4G12 A;  5FKM A;  1X58 A;  3SJM A;  3S2D J;  2Y31 A;  3Q0U A;  2HXI A;  2K9Q A;  2FJ1 A;  3CDL A;  1K61 A;  4FE4 A;  3BT9 A;  1MSF C;  4ABZ A;  1B8I B;  3CQZ J;  5C4X J;  2JA8 J;  4W1U A;  1VI0 A;  5BNG A;  4M6V A;  3BTL A;  1MH3 A;  5FLM J;  1HCR A;  3GTO J;  2WV1 A;  3GTM J;  4FIS A;  4XK4 A;  2L7M P;  4I76 A;  1IRZ A;  1OCP A;  5GPC A;  1JT6 A;  1LE8 A;  1Z77 A;  3BR0 A;  3E7L A;  2ECC A;  5E3N A;  3NAR A;  1IJW C;  1F43 A;  2JWT A;  1Q1V A;  1GUU A; 
#chains in the Genus database with same CATH topology
 1JKO C;  2DYS H;  3NAU A;  3VYT B;  3WG7 H;  1SFK A;  2Y69 H;  1YE9 A;  1FPQ A;  4O6J A;  1MGT A;  4XLA A;  3Q9V A;  4LG0 B;  2LSO A;  3I58 A;  2E1O A;  2XAF A;  3CCR I;  4HDU A;  2F4I A;  4N9I A;  4IPA A;  4BS9 A;  3KYD B;  4P9U A;  2VOP A;  5FKK A;  2VQC A;  4IKF A;  2ZO4 A;  4FET A;  2O5R A;  2ZJQ F;  3GCM A;  4JP0 A;  3PNT A;  1HF0 A;  2LNB A;  2Y0S A;  2XRL A;  1BI0 A;  2PFB A;  3MEX A;  4RB3 C;  2W57 A;  3K4K A;  2B63 J;  4XRF A;  4U87 A;  3M07 A;  2JZY A;  4HF0 A;  3E97 A;  4BAC A;  1BIB A;  4PJJ A;  2G7U A;  4HYE A;  4M3B A;  1YIJ I;  5K1Y A;  3GX4 X;  3LSG A;  3KCC A;  4UVA A;  2P5L C;  4DIQ A;  4LIV A;  4UUS B;  2H27 A;  2KDO A;  5IYB J;  5LFA A;  3IH4 A;  1U8R A;  2YSR A;  3FMR A;  4F92 B;  1XB4 A;  4DYR A;  1DPR A;  4BY1 J;  2DMQ A;  2OC6 A;  4Y13 A;  3MD2 A;  4Y17 A;  1PP8 F;  3I59 B;  4M3G A;  4NC8 A;  2V6C A;  3WTW C;  3CJT B;  4M3E A;  1I39 A;  1J7K A;  2DDB A;  3WTZ A;  2OD5 A;  2M0C A;  3F22 A;  3A03 A;  2JA6 J;  1TQI A;  2L9V A;  4B1R A;  3K70 C;  4OIQ F;  3JAM Z;  3F3X A;  3CUO A;  1PUF A;  3GEZ A;  3CCY A;  4RGU A;  4W97 A;  1D1A A;  4AID A;  4RLF A;  1UEL B;  3GTP J;  4I01 A;  5F0F A;  3GTG J;  1OFC X;  1RR8 C;  3Q0W A;  3QU3 A;  3F72 A;  4AUX A;  1SC7 A;  1Z6T A;  1IXC A;  2QUF A;  1VQM I;  4A3I J;  3ZQQ A;  5KVR A;  2LF8 A;  3I0T A;  5H2F C;  2QEN A;  5C44 J;  2GOX B;  4NHJ A;  3VFZ A;  3QOD A;  2ZBK A;  1EV7 A;  3GYH X;  2OUM A;  3OYF A;  2GZW A;  1X4O A;  4KA4 A;  2FF4 A;  1P7I A;  1ZRD A;  2E2H J;  2R93 J;  3O8H A;  2DMU A;  3KZZ A;  2EFO A;  3Q5F A;  2LTP A;  2L01 A;  5HDN A;  2K4B A;  2LY1 A;  1X4P A;  4OIR F;  5B5E C;  3RKW A;  1IDZ A;  1BA5 A;  4EJV A;  4HQE A;  4Q47 A;  5DTD A;  4BNC A;  3M1C A;  4XLP F;  4RLQ A;  2LYC A;  2PEX A;  3E5X A;  3VPR A;  5FLX K;  3CLQ A;  2XAG A;  4YII A;  4IO9 F;  1STZ A;  1HSJ A;  4J19 A;  3LMM A;  1Z67 A;  4Q4Z F;  3D0S A;  5HVQ C;  5J47 A;  2RRE A;  3QWL A;  5EG0 A;  1FX7 A;  5D5W B;  2LKP A;  5CVR A;  3I55 I;  2DT6 A;  2LH9 A;  4PSW A;  2PX9 A;  2RQP A;  1B72 A;  2XF6 A;  5H6Q A;  5HOO A;  1J75 A;  2K85 A;  1AA7 A;  1VF9 A;  5M3F J;  4I6Z A;  2B9S A;  2ZME C;  2O6G E;  3ZMZ A;  1LE8 B;  2HYG D;  2V6E A;  3ZXS A;  4LB5 A;  4BUP A;  3QYE A;  3ABM H;  2PMZ N;  4E6K G;  2MLK A;  2HQA A;  4DBR A;  3RCO A;  1PJR A;  2MH9 A;  1T2K A;  5HS8 A;  1MBK A;  1IN4 A;  3QPH A;  4IRH A;  1MD0 A;  4PK4 A;  1ETX A;  4MQ9 F;  3S32 A;  2J5P A;  3SXY A;  3OYD A;  1MJA A;  1WGX A;  1OLT A;  2ID3 A;  2IBD A;  1BR2 A;  1PVE A;  1S29 A;  2WA0 A;  3LAJ A;  3HUG A;  5CVV A;  4UXN A;  4XON A;  3HPG A;  1BOA A;  1SD4 A;  4F7Z A;  4D9J A;  3ASO H;  2LP0 A;  3JRB A;  2KRC A;  3ZMD A;  4R79 A;  1XX5 A;  4WCG A;  2Q1Z B;  2GWR A;  2V9K A;  1QHG A;  2Y48 A;  5FD6 A;  5ICG A;  3L00 A;  1FZP B;  2PG4 A;  5D8K B;  2IS4 A;  1RKT A;  2HI3 A;  2HDC A;  4WWC A;  2F48 A;  3FXU A;  4HNU A;  1O7L A;  4KIG A;  4A3B J;  3H5A A;  3R60 A;  4MFE A;  3K0L A;  4O3M A;  4BJ5 C;  4XR6 A;  5K5O A;  1OQY A;  4MEX F;  3ZQF A;  3TW7 A;  1QZY A;  2VAS A;  2R7U A;  1YJN I;  2V4J C;  3DP7 A;  2K02 A;  2M2E A;  5J1U A;  4DZP A;  2K5C A;  4RGS A;  1T33 A;  1GHC A;  5F1R A;  2DOF A;  4II2 A;  1S3J A;  1NTC A;  4YFK F;  2Y2Z A;  3I9V 2;  1GXQ A;  1FIA A;  2R92 J;  1ETK A;  3AFH A;  4PZJ A;  5H6R A;  5EEH A;  3VYU B;  4A3G J;  1HKS A;  2L9S A;  1G4D A;  2ELH A;  3HGY A;  4PJL A;  2UZK A;  1AOY A;  1XD7 A;  3ISP A;  3ZMS A;  2O8X A;  3BR6 A;  2NVY J;  2MSY A;  3ZMT A;  2WV0 A;  1U78 A;  3CMY A;  2QSH X;  1IDY A;  4YEL A;  2HYF A;  4R8H A;  3V8K A;  4X1E A;  4I2O A;  1O57 A;  3B6A A;  3DU5 A;  4HF1 A;  5L3G A;  1R5I D;  1B9M A;  3EUH C;  1IN8 A;  1NG6 A;  3BTJ A;  2E2J J;  5FJ8 J;  2H8W A;  4OAZ A;  4U0V A;  4AD9 A;  3HEF A;  4XID A;  2LY9 A;  2JUC A;  3ROU A;  5DV5 A;  4HNT A;  4GFB A;  2EK5 A;  3ZQL A;  4EM0 B;  3HRU A;  4D0P A;  4Q5S F;  3F8F A;  1RIO H;  4IZZ A;  3H1C A;  4WX9 A;  5BOX A;  5BS6 A;  3R6S A;  2IVM A;  1T95 A;  4EJW A;  2XAH A;  3DFG A;  2DA5 A;  4A5M A;  1ZRC A;  2V9P A;  1X2N A;  2O0Y A;  4MGR A;  5LGT A;  3H0D A;  5DS9 A;  2OCC H;  2AQF A;  2D5V A;  1FSE A;  1W0T A;  1MH4 A;  1JI8 A;  5HDK A;  3ABU A;  3HRT A;  2OBP A;  3HBL A;  4HZF A;  3L7W A;  3TMO A;  1NK2 P;  3HOU J;  2DFF A;  2F4M B;  1RZ4 A;  2CRG A;  4FQG A;  1PP7 U;  3CCV I;  4IOA F;  4YFX F;  1B9N A;  1KA8 A;  2ME6 A;  4A3J J;  1K78 A;  3Q3S A;  4Y52 J;  3BG3 A;  2RDP A;  1H88 C;  1T98 A;  3VEP A;  5DDG A;  2DFH A;  2PN6 A;  3IHU A;  9ANT A;  1VQ6 I;  2P7C B;  3KLN A;  1XS9 A;  3E5U A;  2WAQ N;  1YIT I;  1A6Q A;  3BPX A;  2V7F A;  3MKL A;  4IXA A;  2IT0 A;  4BXX J;  1ETW A;  5J8F A;  5ILV A;  1J59 A;  3SFI A;  4GCV A;  5F1J A;  1S7A A;  3J81 Z;  1RPW A;  4LIT A;  5BPI A;  2IPQ X;  4BHP A;  4CXF A;  4K2E A;  1FBU A;  5IY5 H;  3BP8 A;  3CCL I;  4IEJ A;  1RKW A;  3MFK A;  3TOB A;  1B6A A;  3OYE A;  1D0X A;  2BVM A;  1A31 A;  1YHQ I;  2TDX A;  2XIG A;  2R5Z B;  2X6Y A;  2CV2 A;  2WBM A;  2VBY A;  2CU7 A;  3K2Z A;  1FLI A;  2IA1 A;  3COA C;  1ON1 A;  4C2U A;  4CIC A;  5F0C A;  3WHB A;  1ZYR F;  3DEW A;  2X1C A;  1WSU A;  3GTQ J;  1TWH J;  4WK8 F;  4ENM A;  1P7J A;  3HB9 A;  1AWC A;  2E71 A;  4EJO A;  5HS9 A;  4LGW A;  1Y56 A;  4ZZL A;  1X1P A;  3OYI A;  2EFN A;  2VI6 A;  3DEE A;  5DCM B;  3CC7 I;  1XSD A;  3HTS B;  5HLG A;  5E17 F;  1N78 A;  2GAU A;  1LDJ A;  2A3S A;  2DFE A;  1BW5 A;  3WOD F;  3SYT A;  1QVT A;  3NEU A;  5J8C A;  3ZRG A;  1V55 H;  2DW4 A;  2BE5 F;  1T38 A;  2OZU A;  2Y0S N;  1K83 J;  3AG2 H;  1WJE A;  2EIL H;  5BMZ A;  3OSF A;  4R1H A;  4U7B A;  4BE0 A;  2L9N A;  2ELK A;  1RET A;  2NVX J;  4EM1 A;  4FTH A;  2JSC A;  2R7D A;  4HV6 A;  2XV4 S;  3AG1 H;  5EJC A;  4CO8 A;  2HVS A;  1XCV A;  3OYG A;  3HSR A;  2A6E F;  2Q2E A;  4IHX A;  2EA2 A;  3EUA A;  4YFN F;  3OYB A;  1AKH A;  1R9T J;  3M9A A;  3R0A A;  2LFB A;  3M8J A;  3CJN A;  5D6F A;  3K4B A;  5IP6 A;  3JSP A;  2FBK A;  3AKZ A;  3HGG A;  4M9Z A;  4GYG A;  1SFO J;  2RAE A;  2F2E A;  4ANJ A;  5FGM A;  5ERI A;  4A93 J;  3H3U A;  4N9H A;  3LFU A;  4QPO A;  1I50 J;  3CCM I;  5K7H A;  2A6T A;  2Y75 A;  3G1O A;  4OIO F;  3BJA A;  3W3C A;  1XDU A;  3IH2 A;  2IAI A;  1S7E A;  2YU3 A;  3PM1 A;  2ESN A;  3A01 A;  1S9H A;  3PL8 A;  4E7S A;  3HRM A;  3S17 J;  2ACJ A;  1R1T A;  2CW0 F;  4EEF G;  4IX7 A;  3C18 A;  1GXP A;  4MIM A;  4KT6 A;  5H20 A;  4BE2 A;  4IHW A;  4XOP A;  2CYY A;  1GVJ A;  2FD5 A;  3U2R A;  5K7F A;  2E1M B;  3BRO A;  5FKO A;  3V8J A;  1S7O A;  2RKH A;  3HOW J;  4BGD A;  5BQT A;  1YLF A;  3J80 Z;  4LLG F;  2DA1 A;  5E79 C;  4EJT A;  3G73 A;  1HDD C;  2YX4 A;  1D0Z A;  1RI7 A;  4F3Q A;  4P96 A;  4FX4 A;  5FKM A;  3S2D J;  3MQ0 A;  5E1Z B;  2HXI A;  1K61 A;  2FJ1 A;  2PMZ A;  1LVA A;  4L9V A;  4ABZ A;  3HJE A;  1K7A A;  1B8I B;  3R61 A;  3CQZ J;  3V8L A;  4NNJ A;  4A2U A;  1W36 D;  3O6B B;  4LFU A;  4IHT A;  2ZME A;  4KDP A;  2JA8 J;  1VI0 A;  1YIO A;  4I09 A;  1SVO A;  3FM3 A;  5BNG A;  1Q1H A;  3KP4 A;  2V1X A;  5FLM J;  1VQP I;  1MKM A;  2OZ6 A;  4L0Y B;  2E36 A;  1FNN A;  2E1C A;  3HPH A;  5K5Q A;  4CCM A;  5D5X B;  4I02 A;  1IRX A;  1MNE A;  3E7L A;  4XSZ F;  3RI4 A;  1XGO A;  5E3N A;  4S04 A;  1Q1V A;  1GUU A;  2FQ3 A;  2F5D A;  4O5V A;  4ZYA A;  1V5E A;  2I5U A;  3LA3 A;  1JUS A;  2HVR A;  1YX3 A;  4ZDP A;  2DOD A;  2N8G A;  3AL0 B;  1WZ2 A;  2HZD A;  3I4P A;  2BHZ A;  4HX8 A;  1WJD A;  2VBZ A;  3KP6 A;  2HOS A;  4IHV A;  2ZFW A;  3H9Q A;  3O3K A;  1Z21 A;  1TWA J;  3SZG A;  1V4R A;  1MBE A;  1ZG3 A;  3ESW B;  5FLV A;  4XQF A;  3RPU D;  2EZH A;  2F6C A;  2XGX A;  2V1D A;  1VZ0 A;  4BY7 J;  4MHG A;  2HWV A;  2HKO A;  2PBI A;  4PDK A;  1XSX A;  2WY7 Q;  5E3L A;  2NVQ J;  2VBX A;  2X0L A;  1B59 A;  1E3P A;  1UG0 A;  4B48 A;  2P0W A;  4BDZ A;  2BY3 A;  2VL8 A;  2CQQ A;  5AIQ A;  3MKY B;  2VQL A;  4C2T A;  1JKP C;  4C3I J;  3F21 A;  5E1W A;  2PMH A;  3DPL C;  3VOE A;  4E7I A;  1A5J A;  2EH3 A;  1LQ1 A;  2XHK A;  1Z9C A;  2MG4 A;  5IT9 K;  4UVB A;  1OPC A;  2Z2S B;  2R7X A;  2E34 A;  2OF7 A;  1HKQ A;  3M8F A;  4IQ4 A;  4MO7 A;  4F91 B;  2WAF A;  2BZT A;  2M4K A;  2F4O B;  2KLO A;  2ZCW A;  5HS7 A;  5FKL A;  3RQI A;  3FF5 A;  3BTI A;  1T6S A;  2F5C A;  4YEJ A;  3DCF A;  3MKZ A;  1O3Q A;  5IYD J;  4RAY A;  3O8G A;  3HXL A;  3OYH A;  1N77 A;  4G6T B;  3L2W A;  2NS0 A;  3HOZ J;  2IP2 A;  1DP3 A;  1TWF J;  2EJR A;  3BG7 A;  1W4M A;  3L2R A;  2QSF X;  2R7O A;  3FIW A;  4WXD A;  3JRA A;  3GW2 A;  4BEH B;  1U6G A;  3EUH A;  1ODD A;  3DBL B;  3J7A O;  1PUF B;  3L9F A;  2RN7 A;  3CMA I;  2IJL A;  1DP7 P;  2QSG X;  2KHM A;  1MJB A;  3O2P E;  2DJI A;  3W2A A;  2Q0O A;  3EET A;  4A69 C;  1LPQ A;  3KEO A;  1YFH A;  1X1A A;  3TGN A;  3CP2 A;  3RPQ A;  3OOP A;  2NAZ A;  1HA8 A;  1IRG A;  1DQU A;  2VT2 A;  3QYB A;  1I3A A;  1ZHF A;  2R7Z J;  2HQN A;  5GAG J;  1QU3 A;  3IWZ A;  3P9I A;  3BC8 A;  4A5N A;  3ABK H;  3QPT A;  5KAF C;  2ZB9 A;  3PQJ A;  5B3S H;  3BY6 A;  4BQO A;  2VE9 A;  4AIK A;  2YR2 A;  3HOS A;  1I1G A;  2WWY A;  1FJL A;  2P5V A;  3SDG A;  1A35 A;  2JN6 A;  2CFO A;  3D5R C;  2MA3 A;  1FIP A;  1FOX A;  1Z6R A;  3LSI A;  1RUO A;  2WAQ A;  1QBJ A;  4JBA A;  4FAS D;  1LDK B;  1OYI A;  4ZJZ A;  5HLT A;  1HC8 A;  2ZKZ A;  1XTA A;  3I3L A;  2PJR A;  1YOV B;  2EZK A;  3QYF A;  2DN0 A;  4A3C J;  4PGG A;  1POG A;  1T8I A;  2Q8K A;  2BXY A;  4CA0 A;  3FX3 A;  2L0K A;  1FT9 A;  5TRD A;  1ON2 A;  2LR8 A;  2OQR A;  2E1N A;  1RNL A;  1B1B A;  1JJ6 C;  4ESJ A;  2VJJ A;  2XDV A;  3PO2 J;  1DU0 A;  4M9X A;  4Y33 A;  4Z2Y A;  5GAH J;  1E0E A;  4PJN A;  1SMY F;  4G6Q A;  1EH8 A;  5L3D A;  3OS2 A;  3S1R J;  1BR4 A;  3QPS A;  3GME A;  4UB8 C;  5KAI C;  2C6Y A;  1KQ8 A;  2XAQ A;  3RJP A;  1GVD A;  5CVU A;  4ZTJ A;  1IXR C;  3ZQG A;  3Q0V A;  1Y0N A;  2H8R A;  3RKX A;  3T8R A;  5GTI C;  2A68 F;  2FOK A;  1R58 A;  2R3S A;  5JLW A;  3WTY C;  3T5X A;  2R7V A;  3HHH A;  2VC0 A;  4XRM A;  2HQR A;  3FK7 A;  2A07 F;  1HKT A;  3KZI C;  3E3V A;  2RQQ A;  3VYS B;  1MBJ A;  2VOD A;  1KYW A;  4XRS G;  1VTN C;  2RVC A;  1YRN A;  1YX5 A;  5EZG A;  3N97 A;  1QHH D;  5F04 A;  4HX4 A;  3EYI A;  3U9G A;  2E60 A;  1TNS A;  5IT3 A;  1WFX A;  3RZD J;  1ZTR A;  1JGS A;  2DBB A;  3E6B A;  3R0J A;  2BW3 A;  2HKX A;  3DLL F;  3FBN B;  2W7N A;  1R36 A;  4E7J A;  1U2W A;  2WTE A;  3ECH A;  1JTX A;  1VFC A;  2FRH A;  2EIK H;  3NQO A;  3CP8 A;  3ZN1 A;  2M45 A;  1W7P D;  2DI3 A;  3BR5 A;  3ABT A;  2X1E A;  2L02 A;  3DEU A;  3K9T A;  3KIO A;  4GYI A;  1A36 A;  2HDD A;  4XIC A;  1U9O A;  3HKZ N;  5J1R A;  3D5L A;  2YS9 A;  2CV1 A;  5EYR A;  3ECO A;  5L3C A;  2FE3 A;  1REP C;  4B47 A;  1FYL A;  4HDV A;  3VSL A;  3S2H J;  3GZ5 A;  3KLO A;  3W2W A;  3IKT A;  1DU6 A;  1MMG A;  2VON A;  3DXJ F;  1E17 A;  2H1K A;  3MVP A;  2R7F A;  1HLV A;  1X1D A;  2MD0 A;  1U5T B;  2V1U A;  4HLX A;  3V4G A;  1WRJ A;  3G3Z A;  1VND A;  3A4C A;  2QGU A;  5CLS A;  4M71 A;  3RPU A;  1EH7 A;  3CDH A;  2DMN A;  1X1C A;  1NG7 A;  3CC4 I;  2JSP A;  2E7X A;  2DO7 A;  2FA5 A;  3G71 I;  1MND A;  1VQ8 I;  2FSW A;  3EUK L;  5IYC J;  1OCT C;  3I4M J;  4M73 A;  4B3A A;  2VLA A;  1X19 A;  1TNT A;  5B1B H;  2ZXW H;  5F6F A;  2A61 A;  2ADU A;  1W7P B;  2VIX A;  2NNY A;  3B6C A;  1KU7 A;  4BBR J;  3S1Q J;  1Y8R B;  4DYQ A;  4QSH A;  3TOA A;  1FEX A;  2L9R A;  2NS7 A;  2OPT A;  3LQR A;  1MNM C;  1X3W B;  1T56 A;  3BTC A;  3K1M A;  1FYK A;  2XGE A;  2VC1 A;  3KEQ A;  4XOR A;  5CQE A;  2I8D A;  1P4X A;  4EGY A;  3W6J B;  2IS1 A;  2X4H A;  1HST A;  1UAA A;  3G4S I;  2GM4 A;  1Z1D A;  1MBH A;  3DQV C;  2FBH A;  4RGR A;  3RKY A;  3S3M A;  1D1C A;  4CCL A;  4C2M J;  5FO5 A;  2P8T A;  2E2I J;  1CQT A;  1WH5 A;  2HXO A;  5CVI A;  2A5W A;  4G6D A;  1NH3 A;  1H8A C;  4MQV A;  1Y39 A;  1ULY A;  3TW6 A;  1V5G A;  2HGC A;  1QGP A;  2OQG A;  2CQ7 A;  4P9F A;  5L3F A;  3LWF A;  1KU2 A;  2HPI A;  4UY8 I;  5F0H A;  2EZL A;  4KN4 X;  3V7S A;  3P9K A;  4RB1 A;  3MMY B;  1OCZ H;  1Z0X A;  2XKO A;  3I64 A;  1JHF A;  3IH3 A;  4ZDL A;  3SEQ A;  2IGK A;  1X2M A;  2FOW A;  1RR7 A;  4ITV A;  4HQM A;  2RV8 A;  3BDD A;  3HIF A;  4CZZ A;  4ZDO A;  2VQG A;  3NWS A;  3IL2 A;  5EZH A;  1YW8 A;  1SFE A;  3WHC A;  1P2F A;  5J40 A;  3LSM A;  3BLY A;  2CWE A;  3BR3 A;  3V7R A;  2ZNZ A;  1IF1 A;  3BWG A;  3FKJ A;  1G2H A;  2VN2 A;  4JOM A;  3M8E A;  4PUS A;  3SZT A;  1X1B A;  2LF7 A;  3WTT C;  3C2H A;  1F5T A;  1GLN A;  1JKQ C;  1WQ2 A;  1ORK A;  3FWE A;  4LG0 A;  1H0M A;  3IV5 A;  2Z1D A;  4L9T A;  3ZMV A;  1O7F A;  3FMQ A;  1R00 A;  3W6K B;  3CCE I;  3GTK J;  3KFW X;  2Y30 A;  3BR1 A;  4J00 A;  1I6X A;  4IJA A;  2R7S A;  2UUZ A;  5ICC A;  1ETY A;  2NNN A;  1G3Y A;  4RMN A;  1IZ1 A;  1J2X A;  3CTA A;  4HW0 A;  5ILU A;  2IXS A;  3CO6 C;  2PJP A;  2E35 A;  5L3B A;  2FQ4 A;  1LEA A;  2XAJ A;  1USS A;  4RB0 A;  2DQR A;  4CUG A;  2GIZ A;  1V54 H;  2HVQ A;  1IG7 A;  1YI2 I;  2XB5 A;  3LSJ A;  5TIS C;  4AWX B;  4LLN A;  4M3D A;  4ZYG A;  1WKM A;  3WGI A;  5D5V B;  2K40 A;  3A0H C;  3RYR A;  3FKI J;  5GAD J;  5LBQ A;  1W0U A;  1S6L A;  2RNJ A;  5TGT A;  3WE3 A;  2DPD A;  4LOC A;  3OY9 A;  4L5I A;  4XLN F;  1VQ4 I;  2KZV A;  3PSF A;  1HDP A;  3JRH A;  4AIJ A;  1IGN A;  1WVR A;  3H3V K;  1NK3 P;  3CO7 C;  4BH9 A;  2YPR A;  4FT8 A;  3I59 A;  2XUB A;  3E5Q A;  5C4J J;  2TRT A;  3JAM K;  1HXD A;  1QRY A;  2KPM A;  4ZTF A;  4AM3 A;  2LKX A;  5E1X A;  4HNV A;  5EEA A;  4RDU A;  3OYK A;  1XMA A;  3C2G A;  1AKH B;  1B4A A;  1IXS B;  1Z91 A;  3ELK A;  2BEO A;  1G59 A;  3L1P A;  2KJC A;  2KIU A;  3ZQ7 A;  4RM2 A;  1FOK A;  2IS6 A;  2EBI A;  3NRV A;  4OMZ A;  1MMS A;  1OR7 C;  1GDT A;  4XLE A;  3OV8 A;  2OAZ A;  3GFM A;  3I56 I;  3T1B A;  2IGN A;  1VQN I;  1U0J A;  2BOL A;  1YJW I;  3HC7 A;  2Z16 A;  5DYM A;  3LSK A;  2VXD A;  2R7T A;  4F93 B;  4LK0 F;  4AVP A;  4JQF A;  3ZN0 A;  3MAJ A;  3RZO J;  3K1P A;  4ESB A;  4BJT A;  2GOM A;  4MEY F;  1E2X A;  4U7D A;  1T0F A;  3CJQ B;  2ISZ A;  1R5G A;  1BIA A;  3D5S C;  1R23 A;  4I98 B;  1IV6 A;  2AO9 A;  4P1W A;  1ETQ A;  4NDL A;  4HST A;  1YG2 A;  3L2V A;  1HW2 A;  4G7Z F;  3H9G A;  5KHD A;  4GXO A;  1S72 I;  2OTJ I;  2E5N A;  2QF7 A;  2CUZ A;  3REO A;  4KJZ A;  3TBI A;  1X58 A;  1VQ5 I;  4HOB A;  3QP5 A;  5DEQ A;  2ZSI B;  1X3Z B;  4FE4 A;  1MSF C;  1XN7 A;  2LRE A;  3TDZ C;  3OYM A;  2BV6 A;  3CUQ B;  5E8I A;  2O61 A;  1O3T A;  1BOB A;  4XKC A;  2LBF A;  4W1U A;  3NWT A;  4M6V A;  3DV8 A;  3ERE D;  3IKV A;  4B3X A;  3LA7 A;  4G94 A;  3X2Q H;  4FIS A;  3OIQ A;  2L7M P;  2NRA C;  4XN3 A;  2JWT A;  2RNG A;  4G7O F;  2HDW A;  4DQ2 A;  3GFJ A;  5GPC A;  1DDN A;  1JT6 A;  1LE8 A;  2D1V A;  3NAR A;  1F43 A;  4YIR X;  3F8C A;  3DTI A;  1R5H A;  3HSE A;  4IRG A;  4EJU A;  1IAW A;  3V42 A;  1GV5 A;  1WJ5 A;  3K4C A;  1JT0 A;  4A0X A;  3DLA A;  5J4Y A;  2DA2 A;  1ZRF A;  1OCO H;  3PIP F;  5DCF A;  4JX5 A;  3LAP A;  3GZ6 A;  2DK8 A;  2H09 A;  3SDB A;  2QBY A;  1RRJ A;  2JTV A;  2NXN B;  1YW9 A;  1ACI A;  3HKZ A;  1EF4 A;  1SD5 A;  2NOG A;  3BG5 A;  3FK6 A;  2FXA A;  3CCJ I;  2O03 A;  4NBQ A;  4Y4R A;  4A12 A;  3ZGK A;  5M5W J;  3LL7 A;  2W48 A;  5AIP A;  1FP2 A;  2CO5 A;  1ZRE A;  1W36 C;  5LHH A;  2CW8 A;  2BYV E;  4EGZ A;  5A2Q Z;  4KIB A;  1ZGW A;  1WWX A;  2F5F A;  3K4M A;  4A0Z A;  3LSR A;  2XF5 A;  2COM A;  3H35 A;  1L3L A;  1XGM A;  3F8B A;  3ZPL A;  3BZC A;  2X6W A;  4JX6 A;  2XAU A;  3BZ6 A;  5FFX A;  1D5Y A;  3E6C C;  1OMI A;  2JRM A;  4ASN A;  3G1M A;  1IC8 A;  1XSV A;  4Z6Y A;  1YS6 A;  1QNT A;  3MZY A;  1J09 A;  3OL4 A;  4I99 C;  1KZH A;  4YG2 F;  1ZKG A;  1MSE C;  1P92 A;  2M8E A;  2FEZ A;  3WE2 A;  3V7C A;  5M3M J;  4NQW B;  5GTH C;  2LRD A;  2W00 A;  2CUJ A;  3F6V A;  4DBQ A;  3PJR A;  1CF7 B;  1MMD A;  1LNW A;  1TT0 A;  2DXI A;  3U1D A;  1N25 A;  2STT A;  2EFP A;  4E4H A;  5IPA A;  2H6C A;  1H9G A;  4UUV A;  2DCE A;  5FD5 A;  2K7L A;  1A6I A;  3JTG A;  2KRH A;  2MC4 A;  3AAF A;  2JA7 J;  2IW5 A;  2O9L A;  3PFI A;  3B02 A;  3LSP A;  3KX2 A;  2V9V A;  3DTK A;  5E3M A;  2M9H A;  2QQB A;  4GGG A;  3ZMU A;  2VKV A;  2EIN H;  3P9C A;  2M34 A;  3GLX A;  1SD6 A;  2G0E A;  4WF2 A;  4PSX A;  3G6E I;  1JE8 A;  3R4K A;  3CCS I;  3IRQ A;  2Z5U A;  3TP3 A;  1VQK I;  4KIF A;  1D0Y A;  1E3H A;  2K4J A;  4ESF A;  2IGM A;  4ZZD A;  4C3H J;  3WG9 A;  1FTZ A;  4Y3O A;  4UV9 A;  1LKX A;  4CCO A;  1F1Z A;  1JGG A;  4E7Z A;  2AHQ A;  1TWG J;  3WTS C;  4DYC A;  3DPU A;  4D7M A;  1J5Y A;  2HTJ A;  1R22 A;  1ZGJ A;  2GA1 A;  5CYV A;  1ZLK A;  1IN6 A;  4RB2 C;  4MNU A;  1HBX G;  3DKX A;  3M7G A;  2STW A;  4BAY A;  4XN0 A;  5FRM A;  2BHY A;  4CYD A;  4BXU A;  6PAX A;  1G3W A;  2M1B A;  3J81 K;  3DU6 A;  2E5Z A;  4PJM A;  4A3E J;  2HEO A;  4U0Y A;  1YYV A;  5HNF A;  4AVZ A;  2VBW A;  3GXO A;  3WTX C;  3A1Y A;  4B8X A;  1UFM A;  4UVC A;  1QVU A;  4F52 A;  2GQQ A;  2PQ8 A;  1IN7 A;  2BY0 A;  4HV5 A;  2RGV A;  3CC2 I;  2R0Q C;  4B4C A;  2D2W A;  2Y0M A;  1XGN A;  3LNQ A;  4E7K A;  1BI3 A;  2DLL A;  1H89 C;  5EGO A;  2R5Z A;  2W85 A;  4EQQ A;  3TO9 A;  1WCM J;  3BCA A;  2B7E A;  2H6B A;  1UJ8 A;  2JMW A;  2K9S A;  3LSH A;  5JR3 A;  2R7Q A;  1YRN B;  4KNY A;  3KP3 A;  3EYY A;  1JUP A;  1YS7 A;  4KIC A;  4A3D J;  4IVN A;  3SFZ A;  1TL8 A;  4BJ6 C;  2H1L A;  3VDX A;  1UST A;  4PFO A;  3SQN A;  3UKG A;  3C2B A;  4RBO A;  2WC2 A;  1QPM A;  2BW3 B;  3BZK A;  5DCM A;  4IOC F;  2A05 A;  1K6Y A;  4E7H A;  1D3Y A;  1SD7 A;  2XRN A;  4FX0 A;  4CCJ A;  1QPI A;  3U21 A;  2AXL A;  5HLI A;  5B1A H;  2Z99 A;  2ZC2 A;  5LRR A;  5C3E J;  1KQ0 A;  2FX0 A;  1W5C C;  2LY2 A;  2DK5 A;  3KP2 A;  1DUX C;  4XBF A;  4X0G A;  2E7W A;  4B44 A;  1QO0 D;  1UCR A;  2JK3 A;  2FMY A;  3W6V A;  4XKB A;  1BC7 C;  3QU6 A;  2O8K A;  2ZXH A;  4V2F A;  2KL4 A;  2P6S A;  3M1E A;  2ELJ A;  3OYC A;  1KQ9 A;  2VKH A;  4JX4 A;  2R7R A;  2M0M A;  2CUE A;  2M4G A;  3KPH A;  4F55 A;  4FCY A;  3S14 J;  2MGQ A;  5D5U B;  3HYI A;  1JXS A;  3VYR B;  3JR9 A;  2PLY A;  2EIJ H;  1OR7 A;  2I10 A;  1U5T C;  2BXZ A;  5JLX A;  3E0J B;  2QQ9 A;  2WAD A;  4C3J J;  3P5J A;  1WH7 A;  3ZQI A;  2W84 A;  1X3U A;  2KIS A;  4LMY A;  2DYR H;  1UG2 A;  4DZJ A;  1PYV A;  4C30 A;  5J3L A;  2F5E A;  1BJZ A;  2IA0 A;  2L7K A;  2M8G X;  1JTY A;  4DNC A;  5ICE A;  1IW7 F;  3BG6 A;  4EM2 A;  4FHT A;  3H92 A;  1IUY A;  1BL0 A;  2CG4 A;  4XMY A;  2XSJ C;  1TQP A;  3BG9 A;  3HHG A;  5CPR B;  2HPM A;  1LVK A;  1Y8Q B;  2WB1 N;  4BDY A;  3J80 K;  2MC3 A;  4EV0 A;  3CCU I;  3P7N A;  1T0F C;  1FP1 D;  2VPR A;  4XSX F;  2CQK A;  4A3K J;  2P6T A;  4E70 A;  4ENJ A;  3QRF F;  1TLH B;  5L3E A;  2HOA A;  4U0W A;  3OS0 A;  5D6E A;  2W4S A;  1ZLJ A;  1TW2 A;  4C9Y A;  1TC3 C;  2KIM A;  2M3A A;  3HZJ A;  1ZAR A;  2KDZ A;  3FXM A;  3S8P A;  2QM3 A;  3OR2 C;  1OYY A;  2R5Y A;  2KFD A;  1OYW A;  1YQA A;  1SMT A;  5GPA A;  3K7A J;  4M72 A;  3CLO A;  4CYC A;  5EG0 B;  1I5Z A;  1U9N A;  4L18 B;  1SAU A;  3VB2 A;  3RQ4 A;  1B8I A;  1KU3 A;  4BXF A;  1VQ9 I;  3HOV J;  3PO3 J;  5FLX Z;  2KRF A;  1B72 B;  4OWR B;  2BGC A;  3FMS A;  4QIW N;  1D5V A;  1MDM A;  2HTS A;  3WGH A;  1BI2 A;  2IEK A;  2DQL A;  1OIS A;  3PFY A;  4A3L J;  4AYB N;  2HQ5 A;  4J01 A;  4PCQ A;  3PSI A;  2L54 A;  1H9T A;  1XG1 A;  4NC6 A;  1LUJ B;  3FXR A;  4G8X A;  1GT0 C;  4IQJ A;  5LGU A;  3Q9S A;  2XRO A;  1UHM A;  3PNV A;  3S2W A;  4IL6 C;  2VKD A;  2O3F A;  2M87 A;  4ENN A;  2FUG 2;  2CUF A;  3K4L A;  2DFI A;  3TQN A;  5J4V A;  1K4S A;  1WI9 A;  2GIV A;  2CQN A;  5LHI A;  1U8B A;  3W2V A;  3HUG B;  2EFW A;  5JVG F;  2VPL A;  3K4J A;  4D7N A;  3WTU C;  4HF2 A;  1Z3X A;  2VQH A;  3CMM A;  5HDG A;  2AXT C;  3KYL A;  5F27 A;  3ZQH A;  3KE2 A;  1UZC A;  4ZYE A;  1XC5 A;  1I6H J;  5HNH A;  2DA4 A;  3ZOB A;  1ZG1 A;  4BL0 B;  1XCB A;  1WI3 A;  1K79 A;  3BR2 A;  3E1S A;  1HQC A;  3IRR A;  2L4M A;  4XNF A;  3CES A;  2Z3Y A;  4V2G A;  1RES A;  2ZFU A;  2AS5 F;  4BHC A;  2JRT A;  2CQX A;  3RYP A;  4OAY A;  2CV0 A;  4N4N B;  4QWQ A;  1IUF A;  4XRS A;  4UV8 A;  1FYM A;  1Z3Y A;  3ONQ A;  1TQM A;  3DBH B;  3IP4 B;  5JFR A;  2EFQ A;  3HOX J;  1T39 A;  4KUM A;  5FKN A;  3OL3 A;  1BM9 A;  2PMU A;  3E6M A;  3H9J A;  1G3T A;  1Z7L A;  2IGO A;  2QKL B;  5M5X J;  5JHF A;  2G9W A;  3G1L A;  3FXO A;  5EDN A;  3PUF A;  1ZN2 A;  1SVM A;  1L0O C;  3K4N A;  4M9S A;  4LIU A;  2W82 A;  1DGW Y;  3HL2 A;  4BEH A;  2OTL I;  1IO2 A;  3I53 A;  2A5Y B;  3CF5 F;  2ZJR F;  2KIF A;  2OV7 A;  4ZYD A;  2XSD C;  2Y9Y A;  5IOZ A;  4LD5 A;  2X6O A;  5J1Y A;  3K69 A;  1FBS A;  1O3R A;  4Q48 A;  1TTY A;  4ZYH A;  3LFK A;  2QKM B;  1G6N A;  2W24 A;  1TZL A;  2DA7 A;  2JVH A;  1FSH A;  2F5V A;  1M1E B;  2D45 A;  1XGS A;  1BW6 A;  1ZGA A;  5DD4 A;  4KMF A;  3KP7 A;  3GBG A;  3J7Y J;  5E8G A;  2L3D A;  1ZR2 A;  4RAF A;  2DOE A;  2EA4 A;  3JTH A;  1R7J A;  3TL4 X;  1S5L C;  1JJ8 C;  1F9N A;  3VOD A;  2ZXI A;  1N75 A;  2WY8 Q;  2QLZ A;  1PDN C;  2NVT J;  1ETV A;  1SAN A;  2TCT A;  1D8J A;  2K27 A;  2ESH A;  2NYX A;  4GO1 A;  2CGP A;  2KQR A;  3LQQ A;  2NOJ B;  4EVI A;  1ENH A;  3MN2 A;  4LB6 B;  4S0H B;  3SJM A;  2FNP A;  3RTR A;  2JPB A;  2ZNY A;  2K9Q A;  2QYO A;  3TDU C;  3BPV A;  3N4M A;  1G3S A;  3HOT A;  3QOE A;  2WAE A;  5C4X J;  1R4N B;  4HLY A;  3RSN A;  1K78 B;  3RDI A;  5B66 C;  3T8T A;  4M6X A;  2LBF B;  1MH3 A;  3K6G A;  2JVG A;  3UR3 C;  1HCR A;  2JUG A;  2WV1 A;  3CUQ C;  3GTO J;  1XDS A;  3GTM J;  2JPC A;  3IUO A;  5TJJ A;  4XK4 A;  3FHN A;  3BOQ A;  1RUN A;  3OYA A;  1SAX A;  1IRZ A;  1OCP A;  2VJ5 A;  1U3E M;  3KP5 A;  4HAM A;  1Z77 A;  3BR0 A;  1MW7 A;  5FB2 A;  2XAS A;  2ECC A;  1Y6I A;  3IWF A;  3FXQ A;  2EIM H;  4HPQ A;  5HLH A;  4PGH A;  1MBF A;  3J7A Y;  1MIJ A;  3F0C A;  1J9I A;  2CFX A;  3D1N I;  2YX7 A;  2RC4 A;  3MCZ A;  1BI1 A;  3K70 D;  3HDD A;  2JA5 J;  5IP9 J;  1ZQ3 P;  1FOW A;  4QTR A;  5HOD A;  1TP4 A;  2QBY B;  1MBG A;  2V26 A;  4OIP F;  3BCB A;  5D8L B;  1R4M B;  2JQ7 A;  3L2C A;  2DJN A;  3H5R A;  4AC0 A;  4XOT A;  1K6O A;  2P5K A;  2FNA A;  3GFI A;  2MH2 A;  2OA4 A;  3F8M A;  2EWN A;  3FZV A;  3JRD A;  2IA2 A;  3C7J A;  4CDG A;  5M5Y J;  2CS3 A;  3GF2 A;  2Z9O A;  2FBI A;  2GBY A;  2HR3 A;  3GTL J;  4BYY A;  4UUS A;  2CH0 A;  3T0Y A;  5FRO A;  4KN7 X;  4HA8 A;  3I5U A;  2EQR A;  4N0B A;  1CGP A;  2VJI A;  1WJC A;  5CVJ A;  2Q2E B;  2P7V B;  3FDY A;  4KFC A;  3OS1 A;  2LDU A;  2XPV A;  3S3N A;  4NC7 A;  2LOO A;  3EPZ A;  4OOI A;  3H36 A;  2LKS A;  1VQ7 I;  1U5T A;  1YTY A;  2ISY A;  1F4K A;  2CMP A;  4MTD A;  3CD6 I;  1FOY A;  2ICW G;  3GWZ A;  2CW7 A;  1FY7 A;  3JSO A;  5E3O A;  1D8K A;  2QQA A;  2WB1 A;  3HOY J;  2V79 A;  2LD5 A;  1RC9 A;  4YIF A;  2ID6 A;  4I7H A;  3H0G J;  3SEZ A;  5DUI A;  4M74 A;  2MFZ A;  2OCE A;  2LLK A;  2XGD A;  3QP6 A;  4GRI A;  4M3F A;  2VB6 A;  5AON A;  2Y9Z A;  3JRF A;  4KYW A;  2DTR A;  2FML A;  1W7P A;  4HX7 A;  4XLC A;  3KEY A;  3A01 B;  1SVL A;  3A02 A;  2DMT A;  5EEG A;  4N4O B;  1XMX A;  2KZG A;  3KYC B;  4PFP A;  1F36 A;  4PJ0 C;  3ZR8 X;  4D5F A;  3E6D A;  2K9L A;  1WJB A;  5JI6 A;  3OYL A;  1LB2 A;  4E7L A;  4A3M J;  2K86 A;  2HFH A;  1QQI A;  1K4T A;  5F64 A;  3WU0 A;  2ETH A;  5J6X A;  2J5O A;  2W25 A;  2X48 A;  5ICF A;  2GLO A;  1S8N A;  2HYJ A;  4UUT A;  2E1M C;  1T08 B;  5KK1 A;  1ERD A;  3WU2 C;  1AHD P;  4AYB A;  3DKW A;  5F08 A;  1LFU P;  3F9K A;  2M7A A;  1KU9 A;  3LA2 A;  4CCN A;  1W5S A;  2HZT A;  2UV1 A;  2E19 A;  3K10 A;  2L7F P;  2HOT A;  2K3P A;  4ON0 A;  2MYS A;  4BQN A;  2VT3 A;  3HTU A;  4G9Y A;  4DW6 A;  1Y0U A;  3U1K A;  2ZME B;  3UNG C;  3HSF A;  3TKY A;  1FMW A;  4JYK A;  2FU4 A;  1ZG5 A;  2LK2 A;  4IHS A;  1BN5 A;  3S1M J;  3GTJ J;  4A6E A;  4AU7 A;  3RIR A;  3QOP A;  4ENK A;  5DM7 F;  3QQA A;  3FM5 A;  2CSO A;  3S3O A;  4D5C A;  1O3S A;  4XKV A;  4EMS A;  2M5W A;  3M3Y J;  2BY2 A;  3LOC A;  4BKX A;  2GXB A;  2DOA A;  4KT5 C;  1IRF A;  4KMU X;  2V1N A;  5LRS A;  2XF7 A;  3SHF A;  3VWB A;  4OIN F;  1R1U A;  3FIS A;  1WJA A;  3DBR B;  2BBY A;  2IS2 A;  3AL0 C;  2QQ8 A;  2L2O A;  3AG3 H;  2W1O A;  1TW3 A;  3PNY A;  2DMP A;  1DGR M;  4RS8 A;  4BHB A;  3RKQ A;  1ZH5 A;  1I1S A;  4LG3 A;  2BVL A;  5EGO B;  4MFD A;  2ZJP F;  3H5N A;  5LLQ A;  1EH6 A;  2X51 A;  4XKW A;  3L09 A;  2R7W A;  2K9M A;  1UHW A;  1LFP A;  3OSG A;  3A2K A;  1SFX A;  3JRC A;  2DTZ A;  2VJ4 A;  2Z33 A;  3MKW B;  2R4G A;  3MWM A;  4P55 A;  2ME0 A;  2QWW A;  2UWM A;  3F23 A;  2X6X A;  2IRF G;  2VKE A;  2MD5 A;  2MW8 A;  5FFZ A;  1R1V A;  2H94 A;  5FRN A;  2XGC A;  2L5Q A;  2MBF A;  3SZP A;  3DF8 A;  1FMV A;  1I3Q J;  1KYZ A;  4P5O A;  1BC8 C;  3S93 A;  1OCR H;  2MLG A;  3IAS 2;  2L7Z A;  4I0A A;  5DM6 F;  5IT9 Z;  3ML6 A;  2HOE A;  1Z7U A;  1P4W A;  2DDA A;  4BQQ A;  5LEK A;  4DOZ A;  3OIO A;  4V19 K;  1TT5 B;  3MZH A;  1FTT A;  2GXG A;  2DU9 A;  4UHT A;  1Z05 A;  3AG4 H;  1BJA A;  4A0Y A;  2LMD A;  5CQG A;  1QZZ A;  1MMN A;  1VQO I;  3JRE A;  3B73 A;  4UB6 C;  3LST A;  3OYJ A;  3FXJ A;  4I0B A;  4L5E A;  1ONV A;  2D1H A;  4CH7 A;  3WTV C;  3TED A;  2HS5 A;  2DPU A;  1DPU A;  2COB A;  3OOU A;  2YUS A;  3HM5 A;  1FC3 A;  1LFB A;  1LJ9 A;  3H3Z A;  5DD8 A;  5IOY A;  3ERM A;  3KET A;  2UXX A;  2DA3 A;  4CZC A;  5LGN A;  5KCM A;  5LHG A;  1WJF A;  2PI0 A;  1UHS A;  3GZN B;  4L9N A;  4IRI A;  2BY1 A;  3HG9 A;  3I4N J;  4H0E A;  1GV2 A;  2X1D A;  1HOM A;  3EDP A;  2KIQ A;  2X9D A;  1HW1 A;  3GVA A;  1OKR A;  2LVS A;  2JT1 A;  1ETO A;  4L9J A;  2X85 A;  2XC7 A;  1BBY A;  2KKO A;  3S16 J;  2K9N A;  3OMY A;  5E20 A;  3TP0 A;  1W1W E;  1AU7 A;  1KGS A;  2XB0 X;  4WXH A;  3OR1 C;  4EAT A;  3L2Q A;  2O7O A;  1V5F A;  5EF6 A;  4OMY A;  3OWT A;  3I54 A;  1LEB A;  2VE8 A;  2QZ8 A;  2DT5 A;  2P4W A;  2P81 A;  2PJR B;  4NB5 A;  4M6Y A;  3FXK A;  2GA2 A;  1LDD A;  4ZC3 A;  3WGG A;  2DT7 B;  2R5Y B;  1D1B A;  3QPL A;  3CUQ A;  4CCK A;  3JCU C;  4HG2 A;  2MAB A;  2G7H A;  3IAM 2;  4CYC B;  3JW4 A;  3G2B A;  3C1D A;  2NS8 A;  4Y15 A;  4KIT B;  3K2A A;  5CJ9 A;  4LJZ F;  1OCC H;  3OIP A;  3I71 A;  1MDM B;  4JK1 X;  5LEJ A;  4HRI A;  2EPF A;  1G8X A;  1A04 A;  4G7H F;  4B43 A;  2YU9 J;  1ZEL A;  4MLO A;  2ZSH B;  3FHZ A;  1P4A A;  1V3F A;  4B09 A;  5BPD A;  3CZ6 A;  4HSR A;  4U88 A;  2EZI A;  4L5J A;  3C3W A;  4LLL A;  1MZB A;  1TWC J;  4D1Q A;  4XLH A;  2EV5 A;  3A0B C;  1Y1W J;  2QVO A;  3QAH A;  2HU9 A;  3BJ6 A;  3GFL A;  3EQL F;  4RGX A;  3FXL A;  2M30 A;  1UMQ A;  4CSW A;  1EA3 A;  5E18 F;  3L2U A;  2GXA A;  2HNH A;  2KP6 A;  3DTE A;  3WU1 B;  4BU2 A;  4BBS J;  3GUD A;  2K3F A;  1UB9 A;  3HRS A;  3J7Z I;  1QA6 A;  5A2Q K;  1BR1 A;  5IP7 J;  2XPW A;  5JVT A;  4BE1 A;  3ULQ B;  4H4K C;  2QA4 I;  4CGZ A;  4CHU A;  1I27 A;  1O4X A;  4Y7N J;  4RAG A;  4NUB A;  3CME I;  4YRV A;  4AIH A;  4IF4 A;  3N05 A;  2KT0 A;  2XVC A;  4WXC A;  1IV8 A;  3CDI A;  5D4R A;  3S1N J;  4ETS A;  3S15 J;  4X6A J;  2UXN A;  3M4O J;  1FWZ A;  1YO5 C;  4ZH4 F;  3CCQ I;  5JHU A;  2QEX I;  2LG4 A;  1TBX A;  4A6D A;  1MJ9 A;  4RAZ A;  2XPU A;  2OU2 A;  2VUM J;  1P6R A;  3TO6 A;  1W5T A;  2OJE D;  4DJA A;  1JKR C;  1APL C;  1J0R A;  3ASN H;  1SEU A;  2L4A A;  2NVU B;  4BQA A;  3DPT A;  1QZE A;  1EKE A;  3JRI A;  3DWL E;  2LC2 A;  3PUB A;  3PQK A;  4RM3 A;  1SFU A;  1JUM A;  3JRG A;  1KON A;  5K7Z A;  5LD2 C;  1XMK A;  1Y1V J;  1ZK8 A;  4QPQ A;  4DGW B;  4NQW A;  2ECB A;  4QLC U;  3K1N A;  4HEA 2;  3GO5 A;  2A69 F;  5GP9 A;  5KNL A;  2JJ7 A;  1CF7 A;  5ED4 A;  1ITY A;  1R6R A;  3KZY A;  3CJR B;  4IHY A;  2EB7 A;  1PUE E;  3ZP5 A;  3ZQC A;  2QCO A;  4TV7 A;  4GDF A;  3F8N A;  2AQE A;  4RA2 A;  4MTE A;  2EV0 A;  5K5R A;  1WHU A;  1VQL I;  4II3 A;  1ZR4 A;  2B0L A;  1R49 A;  2DA6 A;  1EJ9 A;  5CKT A;  4XLF A;  5DUK A;  4XM3 A;  2A6H F;  1IN5 A;  1WPK A;  1OJL A;  3GLL A;  1P9Q C;  3MZ8 A;  4UNO A;  2CJJ A;  1NHA A;  3BQZ A;  4FE7 A;  3ZCO A;  4A3F J;  3BQY A;  4G12 A;  3F6O A;  1XPX A;  4HBL A;  3BJO A;  2Y31 A;  3Q0U A;  5GAE J;  3OYN A;  3CDL A;  4OU0 A;  2JA2 A;  3BT9 A;  5ILS A;  4L0Z B;  1FBQ A;  2XKP A;  3CF2 A;  2ZXJ A;  4XL9 A;  1HW5 A;  3VSK A;  2M7B A;  4KIS A;  1YW7 A;  1ZAO A;  3BTL A;  2KJB A;  1R71 A;  2ZJ2 A;  3FBI B;  4LK1 F;  4S05 A;  1JHH A;  3ABL H;  3TO7 A;  2EV6 A;  2VOO A;  4I76 A;  2KMU A;  3IC7 A;  2DAO A;  1MMA A;  5D4S A;  3PIO F;  3DKY A;  1YJ9 I;  1IJW C;  2VXZ A;  1E3O C;  1C0W A; 
#chains in the Genus database with same CATH homology
 1JKO C;  1MBF A;  3NAU A;  1JUS A;  1GV5 A;  3F0C A;  2N8G A;  1JT0 A;  3D1N I;  2HOS A;  4IHV A;  2DA2 A;  1TWA J;  2E1O A;  4JX5 A;  3HDD A;  1MBE A;  2JA5 J;  5FLV A;  5IP9 J;  1ZQ3 P;  5FKK A;  2EZH A;  4QTR A;  5HOD A;  4BY7 J;  1EF4 A;  2NVQ J;  2NOG A;  5E3L A;  1MBG A;  3BG5 A;  3FK6 A;  4JP0 A;  2DJN A;  4AC0 A;  1HF0 A;  2XRL A;  5M5W J;  2CQQ A;  2W48 A;  3JRD A;  5M5Y J;  2B63 J;  1JKP C;  4C3I J;  1ZGW A;  2GBY A;  3LSR A;  1A5J A;  2EH3 A;  4M3B A;  3GTL J;  4UUS A;  2MG4 A;  3LSG A;  4JX6 A;  2OF7 A;  4UUS B;  1D5Y A;  5IYB J;  3IH4 A;  4MO7 A;  3G1M A;  1IC8 A;  4DYR A;  2EQR A;  4BY1 J;  2DMQ A;  5FKL A;  3RQI A;  3BTI A;  4M3G A;  3DCF A;  5IYD J;  2XPV A;  4M3E A;  3O8G A;  2M0C A;  3HOZ J;  3A03 A;  1TWF J;  2JA6 J;  1ZKG A;  1MSE C;  4B1R A;  3FIW A;  5M3M J;  3JRA A;  5E3O A;  1PUF A;  3HOY J;  2LD5 A;  3CCY A;  4W97 A;  1PUF B;  2ID6 A;  3H0G J;  3GTP J;  5F0F A;  3GTG J;  1OFC X;  2LLK A;  2XGD A;  4M3F A;  3Q0W A;  4A69 C;  2Y9Z A;  5IPA A;  3JRF A;  4AUX A;  1A6I A;  4A3I J;  3A01 B;  3A02 A;  5C44 J;  2DMT A;  2JA7 J;  2O9L A;  4D5F A;  2R7Z J;  1F36 A;  3LSP A;  5E3M A;  2M9H A;  4A3M J;  2VKV A;  2M34 A;  2ZB9 A;  2G0E A;  1P7I A;  2X48 A;  2E2H J;  2R93 J;  2GLO A;  3O8H A;  3TP3 A;  2DMU A;  1FJL A;  2HYJ A;  4UUT A;  2LTP A;  3SDG A;  2JN6 A;  1FIP A;  1AHD P;  5F08 A;  1LFU P;  4C3H J;  1FTZ A;  1IDZ A;  1BA5 A;  1JGG A;  5DTD A;  2AHQ A;  1TWG J;  4DYC A;  3VPR A;  2E19 A;  4D7M A;  2L7F P;  2HOT A;  4J19 A;  2EZK A;  2DN0 A;  4A3C J;  4DW6 A;  5EG0 A;  1POG A;  2L0K A;  4JYK A;  1B72 A;  2LR8 A;  2LK2 A;  1JJ6 C;  3S1M J;  3GTJ J;  3PO2 J;  1VF9 A;  1DU0 A;  5M3F J;  4A3E J;  4I6Z A;  3QQA A;  1LE8 B;  4D5C A;  3M3Y J;  2PMZ N;  1QVU A;  3S1R J;  3LOC A;  4BKX A;  3QPS A;  1MBK A;  1GVD A;  1ETX A;  3ZQG A;  3Q0V A;  3FIS A;  2H8R A;  1WGX A;  2R0Q C;  4B4C A;  5JLW A;  2ID3 A;  3LNQ A;  2IBD A;  4XRM A;  3FK7 A;  1H89 C;  2DMP A;  5EGO A;  1MBJ A;  2R5Z A;  1WCM J;  4XRS G;  1YRN A;  2JMW A;  3RKQ A;  5EZG A;  2K9S A;  2LP0 A;  5EGO B;  5F04 A;  3JRB A;  4MFD A;  1YRN B;  3RZD J;  1JUP A;  1ZTR A;  4A3D J;  3OSG A;  3UKG A;  3JRC A;  2DTZ A;  3C2B A;  4RBO A;  1RKT A;  2HI3 A;  1JTX A;  1VFC A;  2ME0 A;  4A3B J;  2VKE A;  4MFE A;  2MW8 A;  3BR5 A;  2XGC A;  1QPI A;  2HDD A;  4XIC A;  1U9O A;  1I3Q J;  3HKZ N;  5C3E J;  5J1R A;  2YS9 A;  2FX0 A;  5EYR A;  2L7Z A;  3ZQF A;  3TW7 A;  3S2H J;  1DU6 A;  2JK3 A;  3OIO A;  3W6V A;  2O8K A;  1FTT A;  2M2E A;  4V2F A;  5J1U A;  4DZP A;  2H1K A;  3MVP A;  1T33 A;  1HLV A;  1NTC A;  4JX4 A;  2Y2Z A;  2CUE A;  2R92 J;  1FIA A;  1ETK A;  1VND A;  3JRE A;  4FCY A;  2MGQ A;  3S14 J;  4A3G J;  3HGY A;  3BR6 A;  2DMN A;  4L5E A;  2NVY J;  3JR9 A;  2I10 A;  2MSY A;  3TED A;  1U78 A;  3CMY A;  5JLX A;  2COB A;  1IDY A;  3OOU A;  4C3J J;  5IYC J;  1OCT C;  3I4M J;  4B3A A;  1WH7 A;  2YUS A;  3HM5 A;  4X1E A;  3ZQI A;  3B6A A;  1LFB A;  5IOY A;  1UG2 A;  3B6C A;  2DA3 A;  4DZJ A;  5J3L A;  3BTJ A;  4BBR J;  1BJZ A;  5FJ8 J;  2E2J J;  3S1Q J;  4DYQ A;  1UHS A;  2M8G X;  4QSH A;  1JTY A;  3HEF A;  4XID A;  2LY9 A;  3I4N J;  1FEX A;  1GV2 A;  2L9R A;  2NS7 A;  2OPT A;  4GFB A;  1MNM C;  3ZQL A;  1HOM A;  1T56 A;  2X9D A;  3BTC A;  1BL0 A;  2XGE A;  3BG9 A;  2LVS A;  1ETO A;  2WB1 N;  2VPR A;  3S16 J;  2K9N A;  4A3K J;  3TP0 A;  2DA5 A;  2GM4 A;  1MBH A;  1AU7 A;  1X2N A;  2XB0 X;  2HOA A;  4C2M J;  2O7O A;  5DS9 A;  5EF6 A;  2E2I J;  1CQT A;  1WH5 A;  2HXO A;  2D5V A;  1W0T A;  1MH4 A;  1TC3 C;  3HBL A;  1NK2 P;  1H8A C;  3HOU J;  2KDZ A;  2P81 A;  2R5Y A;  5GPA A;  3K7A J;  2CRG A;  4CYC A;  5EG0 B;  1U9N A;  3TW6 A;  2R5Y B;  3QPL A;  1B8I A;  3HOV J;  3PO3 J;  5F0H A;  2EZL A;  4CYC B;  1B72 B;  4A3J J;  2ME6 A;  4QIW N;  4Y52 J;  1Z0X A;  3Q3S A;  2NS8 A;  3BG3 A;  3IH3 A;  1H88 C;  3K2A A;  1X2M A;  1RR7 A;  2IEK A;  9ANT A;  4A3L J;  4AYB N;  2HQ5 A;  1XS9 A;  2WAQ N;  1XG1 A;  3MKL A;  5EZH A;  3WHC A;  1ETW A;  4BXX J;  3SFI A;  5F1J A;  1GT0 C;  2YU9 J;  4MLO A;  3BR3 A;  1RPW A;  1G2H A;  2EZI A;  1TWC J;  2CUF A;  4IEJ A;  1RKW A;  1Y1W J;  1JKQ C;  1ORK A;  1U8B A;  3IV5 A;  2R5Z B;  2CU7 A;  4D7N A;  1UMQ A;  3GTK J;  5F0C A;  2Y30 A;  3WHB A;  3DEW A;  3GTQ J;  3BR1 A;  1TWH J;  5F27 A;  3ZQH A;  1P7J A;  3HB9 A;  1ETY A;  1XC5 A;  4BBS J;  1I6H J;  2DA4 A;  3ZOB A;  5IP7 J;  2XPW A;  1WI3 A;  2VI6 A;  3BR2 A;  1E3O C;  2FQ4 A;  1O4X A;  4Y7N J;  1BW5 A;  1IG7 A;  2XB5 A;  1RES A;  3LSJ A;  2KT0 A;  4V2G A;  1QVT A;  4M3D A;  2CQX A;  3S1N J;  3S15 J;  4X6A J;  3M4O J;  2K40 A;  1IUF A;  2Y0S N;  3FKI J;  4XRS A;  1K83 J;  1W0U A;  3OSF A;  2XPU A;  4LOC A;  3HOX J;  2ELK A;  1RET A;  2NVX J;  2VUM J;  1HDP A;  5FKN A;  3JRH A;  4FTH A;  1IGN A;  3H3V K;  1JKR C;  1NK3 P;  1APL C;  5C4J J;  4IHX A;  2TRT A;  3JRI A;  1QRY A;  5M5X J;  2LKX A;  3G1L A;  1AKH A;  4HNV A;  5EEA A;  5EDN A;  4RDU A;  1R9T J;  2LFB A;  1JUM A;  5IP6 A;  3JRG A;  1AKH B;  5K7Z A;  1ZK8 A;  1Y1V J;  3HGG A;  2ECB A;  1SFO J;  2RAE A;  3L1P A;  5GP9 A;  4A93 J;  2JJ7 A;  2EBI A;  2XSD C;  2Y9Y A;  5IOZ A;  1I50 J;  5K7H A;  2X6O A;  5J1Y A;  1GDT A;  1ITY A;  3G1O A;  4IHY A;  3ZQC A;  2QCO A;  3IH2 A;  2IAI A;  1S7E A;  2DA7 A;  3PM1 A;  3A01 A;  3S17 J;  1BW6 A;  4EEF G;  3RZO J;  4MIM A;  3GBG A;  1ZR4 A;  4IHW A;  1ZR2 A;  2FD5 A;  5K7F A;  2DA6 A;  1JJ8 C;  2AO9 A;  5FKO A;  1IV6 A;  1ETQ A;  4NDL A;  3HOW J;  1WPK A;  1OJL A;  2DA1 A;  2NVT J;  1ETV A;  1SAN A;  2TCT A;  2CJJ A;  3BQZ A;  4FE7 A;  4A3F J;  1HDD C;  1ENH A;  2QF7 A;  3MN2 A;  4S0H B;  3BQY A;  4G12 A;  5FKM A;  1X58 A;  3SJM A;  3S2D J;  2Y31 A;  3Q0U A;  2HXI A;  2K9Q A;  2FJ1 A;  3CDL A;  1K61 A;  4FE4 A;  3BT9 A;  1MSF C;  4ABZ A;  1B8I B;  3CQZ J;  5C4X J;  2JA8 J;  4W1U A;  1VI0 A;  5BNG A;  4M6V A;  3BTL A;  1MH3 A;  5FLM J;  1HCR A;  3GTO J;  2WV1 A;  3GTM J;  4FIS A;  4XK4 A;  2L7M P;  4I76 A;  1IRZ A;  1OCP A;  5GPC A;  1JT6 A;  1LE8 A;  1Z77 A;  3BR0 A;  3E7L A;  2ECC A;  5E3N A;  3NAR A;  1IJW C;  1F43 A;  2JWT A;  1Q1V A;  1GUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...