1SFOJ

Rna polymerase ii strand separated elongation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA STRAND
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1sfoJ00
2LLKA 2Y2ZA 1TWCJ 3I4NJ 2L7ZA 2CUFA 4M6VA 4IHWA 3E7LA 3JRFA 4I76A 3S15J 2XPUA 3CCYA 1OCPA 3HKZN 1VF9A 3JREA 2COBA 3JRDA 1H88C 3HOUJ 2DJNA 4XRSG 1WCMJ 5FJ8J 5FLMJ 1Y1WJ 4AUXA 5J1RA 3HOXJ 1ITYA 5DTDA 5E3NA 1QRYA 1JJ8C 3Q3SA 1IV6A 4V2GA 1X2MA 3JRIA 1I50J 1MBJA 2VUMJ 3S14J 3S2DJ 4CYCB 4B1RA 1H89C 4IHVA 3L1PA 2HYJA 2Y0SN 3QPSA 1RKWA 3O8HA 3LSGA 4J19A 2PMZN 4XRMA 4C3HJ 3ZQFA 3A01A 2XPWA 1JUPA 3ZQIA 2ME6A 4M3GA 3PO2J 1JT6A 2YU9J 5EZHA 3RQIA 1ZGWA 3OSFA 2XGEA 4X6AJ 1I3QJ 3VPRA 5E3MA 1BW6A 2NS7A 4MLOA 4FE4A 3HDDA 1S7EA 2QF7A 1APLC 3HOZJ 3HOWJ 2XRLA 1O4XA 3BR1A 4D5CA 1JKOC 3NARA 1X58A 3K7AJ 2IBDA 2NOGA 2R93J 3TW6A 5DS9A 2W48A 1MSEC 1FIAA 1WI3A 5C4JJ 4A3KJ 1U9NA 2HOAA 1F43A 2DMUA 2OF7A 5FKKA 2Y30A 4IHXA 4S0HB 3A01B 3ZOBA 4AC0A 1BA5A 2X9DA 4DYCA 1MSFC 3QQAA 5F27A 4BY1J 3TEDA 2NVXJ 4EEFG 3DCFA 1HLVA 1U8BA 3BTLA 1QVTA 1MNMC 3WHBA 1CQTA 2NVTJ 2HDDA 9ANTA 3FISA 1T33A 2CQQA 4DYRA 5EEAA 2TRTA 4MFEA 2HXIA 2L0KA 3BTJA 1LE8B 2GBYA 1YRNA 2FD5A 1LFBA 3NAUA 4IEJA 2LKXA 1IC8A 3I4MJ 2EZKA 1B72A 4RBOA 4IHYA 2HXOA 5C4XJ 2M2EA 3HGGA 3CDLA 1YRNB 5IOZA 1LE8A 1MBHA 4D7MA 3PM1A 3BR6A 1AKHB 1IG7A 3RZOJ 4X1EA 3ZQCA 4M3EA 3Q0UA 2JA5J 1DU6A 5GPCA 4QIWN 3FIWA 3K2AA 2FX0A 3OIOA 2K9NA 2TCTA 2LY9A 2DA1A 3BR3A 2LTPA 4XICA 5J1YA 2YUSA 1ETVA 3TP0A 2HOTA 4B4CA 2DMTA 2I10A 4NDLA 4W97A 1JKRC 3B6CA 5JLWA 1A5JA 3HBLA 5FKOA 3O8GA 4M3BA 3LSPA 3GTQJ 3HEFA 3F0CA 2H8RA 2E2IJ 2ID6A 3FK7A 5EZGA 3GTPJ 2DMNA 2CU7A 5FKLA 3QPLA 5K7ZA 2MG4A 2VKVA 5EGOA 5E3OA 3RZDJ 3HGYA 5C44J 1JTYA 4A3FJ 2P81A 4FCYA 1G2HA 4MFDA 1IUFA 3W6VA 3A03A 1X2NA 2DTZA 3GTLJ 1TWAJ 2CRGA 1MBKA 1BW5A 1PUFA 1BJZA 2K9QA 1ETYA 4FE7A 1GDTA 2D5VA 2IEKA 2ELKA 3A02A 4G12A 3CQZJ 2B63J 3FKIJ 1TWGJ 2EZLA 2E2JJ 3JR9A 1F36A 4MIMA 1Z0XA 2X48A 3JRBA 3S16J 2R92J 3WHCA 5FLVA 3M4OJ 4A3CJ 2DA6A 4Y52J 4JP0A 3BG5A 1TWFJ 2LK2A 2EZHA 4BBRJ 4D5FA 1ETWA 2ECBA 3BTIA 4DYQA 4HNVA 4MO7A 2ZB9A 1AU7A 5K7FA 2L7FP 5HODA 2XB0X 5C3EJ 1K61A 1PUFB 3BG3A 3SFIA 1P7JA 1XG1A 5BNGA 1JUMA 1OFCX 2E19A 1P7IA 5EYRA 3BR2A 1H8AC 2VKEA 1WH7A 2ME0A 5M3FJ 1ZTRA 3LSRA 3PO3J 1RKTA 3B6AA 1D5YA 3IH2A 1ZKGA 4JX6A 4BY7J 3GTOJ 5F0HA 2WV1A 2DA3A 2JWTA 1B8IA 2E2HJ 2JJ7A 5F0CA 1RETA 3OOUA 5FKMA 2MGQA 2LR8A 2FQ4A 3TW7A 1W0TA 2XGCA 2AHQA 1ETQA 2NS8A 1FJLA 4V2FA 1FIPA 3HOYJ 1XC5A 2M34A 4JX5A 4C2MJ 3S1MJ 3DEWA 1FTZA 5JLXA 4QSHA 3JRHA 3SJMA 3MN2A 1HCRA 4UUTA 2M9HA 4L5EA 1VNDA 4DZJA 1ZR4A 2HI3A 5EG0B 4A3DJ 2Y9YA 1ETOA 4M3DA 1HOMA 4B3AA 1AKHA 2XSDC 1JKPC 2DMQA 3JRCA 2GM4A 1Z77A 3RKQA 4A3GJ 3IV5A 3G1OA 1ETKA 1VI0A 2CUEA 4XRSA 3HB9A 4XIDA 2XGDA 1AHDP 2Y9ZA 2IAIA 2DA4A 2L7MP 2JA6J 5IYCJ 4DW6A 1JJ6C 2DA7A 3UKGA 4XK4A 2JA7J 2R5ZB 1I6HJ 4A3MJ 1GV5A 1RPWA 3ZQGA 4I6ZA 4A3LJ 4FISA 1ETXA 2R5YB 1W0UA 1T56A 1WPKA 4W1UA 2R5ZA 2OPTA 4JYKA 2KDZA 2K9SA 1NK2P 4AYBN 2M0CA 2LD5A 1K83J 2MW8A 3BQZA 5E3LA 2AO9A 2O8KA 1RR7A 2Y31A 5M3MJ 1GUUA 2FJ1A 3BT9A 5K7HA 4A3EJ 1ZQ3P 2QCOA 1SANA 2DN0A 4A69C 4UUSA 2NVQJ 2R7ZJ 2WB1N 1JKQC 3GTGJ 2L9RA 2O7OA 2EH3A 5J1UA 3D1NI 1TC3C 3Q0VA 2CJJA 5FKNA 2H1KA 2DA5A 4FTHA 3S1QJ 3H3VK 1GVDA 3MVPA 5IYDJ 1FTTA 1HF0A 5IP6A 5F1JA 2HOSA 3LOCA 1IGNA 3BTCA 1HDPA 3S1NJ 4BKXA 1EF4A 4A3IJ 1VFCA 1MH4A 3FK6A 1JUSA 1LFUP 3H0GJ 4ABZA 1XS9A 1GT0C 2N8GA 1UHSA 5EF6A 2VPRA 3S2HJ 1Q1VA 2DMPA 3G1MA 1HDDC 3OSGA 1RESA 3BG9A 3GTJJ 2XB5A 3BR0A 1MBFA 5GP9A 4UUSB 4LOCA 1B72B 2E1OA 5EDNA 2NVYJ 1B8IB 3GTMJ 2JMWA 2G0EA 1E3OC 2VI6A 3GBGA 2JA8J 2MSYA 3M3YJ 2XPVA 1WH5A 1DU0A 1Y1VJ 3SDGA 2HQ5A 2EZIA 3IH3A 2O9LA 2ID3A 3HM5A 1QPIA 5F08A 5M5YJ 1MBEA 2R5YA 2EBIA 4Y7NJ 3CMYA 2R0QC 1MBGA 1NK3P 3G1LA 5M5XJ 4BXXJ 5IP9J 1OJLA 1POGA 4C3IJ 1OCTC 2KT0A 5IYBJ 2CQXA 1IJWC 1JTXA 5IP7J 2LVSA 5GPAA 1R9TJ 3S1RJ 1U9OA 3MKLA 3BR5A 3JRAA 1U78A 2WAQN 2JK3A 2GLOA 4BBSJ 4C3JJ 5F04A 2JN6A 2LP0A 1MH3A 3IH4A 2M8GX 5M5WJ 1GV2A 1ZK8A 3C2BA 4M3FA 5IOYA 4D7NA 1ZR2A 1TWHJ 5EG0A 4RDUA 3ZQLA 1JGGA 1IRZA 1QVUA 1ORKA 3LNQA 3HOVJ 2X6OA 5F0FA 1SFOJ 3ZQHA 4A3JJ 4QTRA 2K40A 3LSJA 1BL0A 1ENHA 5EGOB 4GFBA 3TP3A 2ECCA 1JT0A 1FEXA 4JX4A 4CYCA 3BQYA 1WGXA 2RAEA 4DZPA 1IDYA 2EQRA 2YS9A 5J3LA 1NTCA 2DA2A 4A3BJ 3Q0WA 1A6IA 3GTKJ 5IPAA 1UG2A 3JRGA 1IDZA 2LFBA 3S17J 1UMQA 4A93J
chains in the Genus database with same CATH superfamily
4AIDA 3WGGA 5E20A 4N4OB 4KNYA 1I5ZA 2L7ZA 1F5TA 4M6VA 5K5OA 1K79A 1D3YA 4AVZA 1OYIA 4Z2YA 3OYEA 5J6XA 1FMVA 4LLNA 2KQRA 2VN2A 3MQ0A 2DLLA 1H88C 3P9KA 4XRSG 1WCMJ 3OYJA 5ILVA 4HV6A 4PCQA 3G6EI 3D0SA 1Y1WJ 4BE0A 2VKHA 4B09A 4BGDA 3U9GA 2STTA 1ITYA 1ERDA 2VBWA 5E3NA 1WWXA 2OA4A 1HW2A 1IN4A 1R22A 3K4NA 3PQJA 4U0VA 3S14J 2VUMJ 1XX5A 2ISZA 2X1CA 4M9SA 3FZVA 3FBIB 4YIRX 3T0YA 3WE3A 1ULYA 3OYLA 2RVCA 4UV8A 3FXLA 5CPRB 4KMUX 2MC4A 4C3HJ 1MMAA 2H1LA 1YG2A 1GLNA 1ZAOA 1JUPA 1X1PA 3SHFA 4D9JA 3PFYA 3GFLA 5DCMB 3ZQIA 3HIFA 1ZRDA 1FWZA 3PO2J 3E6BA 3HSRA 2XAJA 3DPLC 3F8NA 1XGMA 3OWTA 2DFHA 4X6AJ 1VQ8I 1I3QJ 2M30A 3C2HA 3OMYA 3TGNA 4N4NB 2DFFA 4AIHA 4OIQF 1IN6A 2V7FA 4FE4A 2GXGA 3BP8A 4EV0A 3I3LA 2VB6A 2IS4A 3TO7A 3EYIA 3HOWJ 4A6EA 4D5CA 3SEQA 2K27A 2P5LC 3V7CA 4PGGA 4PUSA 2W84A 3TW6A 1R7JA 1R00A 1QHHD 2HZTA 2HOAA 2JA2A 4R79A 2Y30A 2GXAA 4XN0A 1BR1A 3ZOBA 2X9DA 4WXDA 1DPUA 2KRHA 1Y39A 5KK1A 1MSFC 4BJ5C 2XKPA 5AIPA 3TO6A 3ZRGA 4E7HA 2CFOA 3FMSA 3ECHA 2NVXJ 2ZO4A 3GFIA 4BY1J 4EEFG 5D5XB 1HLVA 1O3SA 1U8BA 3FBNB 3F22A 3WHBA 1CQTA 5HS9A 2IW5A 1MMGA 4AD9A 4WWCA 2PBIA 3KFWX 1VQ7I 2V1NA 5DDGA 2RC4A 2DYRH 3CJQB 4FQGA 2F5VA 3G3ZA 1TL8A 2LKXA 3RPQA 1YS6A 3FXMA 4PJNA 3T5XA 2ZCWA 2HXOA 3CUQA 2BY0A 1YRNB 5J4VA 3KEQA 5IOZA 1MBHA 3I55I 3PM1A 1NH3A 2PMZA 3ZQ7A 4MGRA 1X4OA 3ZQCA 4E7JA 2B0LA 3ABKH 3VFZA 1MIJA 4HZFA 4UVBA 1WJFA 4EMSA 3IKVA 1V54H 2TCTA 2ESNA 1J2XA 2OV7A 2WAEA 2XVCA 3BR3A 3AG4H 2CWEA 2HQRA 4G94A 4CZCA 4ENMA 2YUSA 3TP0A 1ODDA 4CZZA 4NDLA 1W7PD 2A3SA 2G7HA 5JHUA 2RGVA 2ZFUA 4IVNA 3B6CA 2OBPA 4U0WA 1A31A 5FKOA 4M3BA 1B59A 5FD5A 3HEFA 4HF2A 2NS0A 2H8RA 4IQ4A 3RYPA 2ID6A 3BLYA 4UB8C 4XLHA 3MZYA 3QPLA 5K7ZA 2GIZA 5EEHA 2VKVA 2R7XA 3ZMZA 3H5NA 2ZJRF 1OQYA 2VE9A 2K9MA 1H9TA 4EATA 2XAFA 3H35A 4XRFA 1N75A 4MFDA 1IUFA 4LITA 3L9FA 3WGIA 1Z6TA 3LQRA 3GTLJ 5B66C 1FLIA 3FHZA 2CFXA 3K2ZA 1BJZA 1ETYA 3LFUA 3GX4X 3HJEA 3A02A 1V3FA 5KVRA 2RNJA 3CQZJ 2KISA 1GVJA 3FKIJ 3VYSB 2EZLA 4RM3A 5E1XA 3H3UA 5H6QA 2UXNA 4A2UA 5L3EA 4ZH4F 2X48A 2A61A 5CKTA 2GOMA 3WU0A 5J47A 4E7IA 5BQTA 3BZCA 1EA3A 2EJRA 3WHCA 2JRMA 4MHGA 4KDPA 2DA6A 4ESFA 2QQ8A 3BG5A 4FT8A 1BI3A 1JHFA 2EIJH 3BTIA 5E17F 4MO7A 4D1QA 4UY8I 4XBFA 1N25A 3FMQA 4XONA 1HQCA 2KLOA 1P7IA 4XLEA 2LG4A 4Q48A 2P7CB 1LNWA 3BR2A 1H8AC 1DGRM 1HXDA 4ENNA 3DQVC 3EPZA 2M3AA 4RS8A 3DLAA 1RR8C 2FBKA 1D5YA 1YJNI 4JX6A 1SVMA 1ACIA 2BY1A 2DA3A 5D6EA 1B8IA 3HHGA 1ZG1A 1SD4A 1WZ2A 4XOPA 4HX7A 1PDNC 1QNTA 2MGQA 1WFXA 2VBXA 1FX7A 3CC4I 1VQ6I 3QPTA 1FOXA 2CV0A 4NQWA 3HOYJ 1TW3A 3RDIA 3WTYC 4S04A 1BBYA 2CQ7A 3FDYA 2HS5A 2E5ZA 3JRHA 2ZJQF 3MN2A 4BDYA 4UUTA 1YHQI 1HCRA 2ZBKA 2HDCA 4LJZF 4L5EA 3T8RA 4XKBA 2KHMA 2V26A 1Z91A 2JPBA 1ZR4A 2DI3A 2HI3A 2L4AA 3DTKA 5H2FC 4A3DJ 1OLTA 2Y9YA 3ONQA 3MKWB 4IO9F 5D4SA 4HG2A 1NG7A 3L2CA 3D5LA 1F1ZA 3QP5A 5HOOA 2W57A 1JKPC 4RLFA 5E79C 1HBXG 5FLXK 1D0YA 2CYYA 3AG3H 3IV5A 3COAC 4QPOA 4UHTA 4LG0A 1VI0A 5TJJA 4XRSA 3SYTA 4XIDA 2XGDA 1QA6A 2IAIA 2NRAC 2A6EF 2XIGA 4RB2C 1H0MA 4S05A 1BC8C 1Z1DA 2JA6J 1VQOI 2PLYA 3GXOA 4R8HA 2KKOA 3UKGA 1S7AA 4XK4A 5CQEA 4L0YB 4EJOA 2M7BA 1I6HJ 5BMZA 3ZQGA 3K1NA 1ETXA 5CVJA 5CQGA 3WE2A 1T56A 2PN6A 4W1UA 2J5PA 1R4NB 2K9SA 5D6FA 1NK2P 4NC8A 2IGKA 3OS1A 3MMYB 1Y8RB 1P4AA 3BQZA 4KIGA 1R5HA 4OU0A 2O8KA 5M3MJ 1RC9A 1MNEA 3VSLA 2FJ1A 2STWA 3BT9A 1ZQ3P 2NAZA 2QCOA 2COMA 2WB1A 4I02A 4A69C 3EUHC 2RREA 2L9RA 2JPCA 2M8EA 1TC3C 2AS5F 2CJJA 2FQ3A 5FFZA 4E7ZA 4HF0A 2VXZA 3DP7A 1VQMI 1T95A 4KIBA 1SD5A 3H3VK 3A0BC 5IYDJ 3BJOA 2GIVA 2HOSA 3JTHA 2VC1A 3I59A 4Y4RA 4ABZA 5F1RA 2ZJ2A 1XS9A 2N8GA 1G8XA 3CTAA 4NQWB 1O3QA 3IRRA 3CCMI 1S9HA 1SMTA 2FOKA 5CLSA 3RYRA 4MTDA 1Q1VA 4RGRA 1VQPI 1KONA 2E1MB 4E4HA 1RESA 3KP3A 2Y0MA 3OL3A 1MBFA 3PSIA 1TQIA 2W82A 4WK8F 2E1OA 5CVRA 1W5SA 5B5EC 3GBGA 2CW7A 3M3YJ 5A2QZ 2XPVA 2KRFA 1FT9A 3BJAA 3SDGA 1X19A 2EZIA 2HQ5A 3VYTB 2DPUA 3KIOA 2KIUA 1LUJB 1E0EA 4IHTA 1D1CA 1Z6RA 2ID3A 2L9VA 1X1BA 2PJRA 1QPIA 1KQ8A 1SMYF 2DT7B 1MBEA 2F4MB 5F64A 3RKYA 3CF2A 2R5YA 1IF1A 3CMYA 1PUEE 3F23A 2L9SA 3E3VA 2F4IA 3BCAA 3V4GA 3C18A 2R7VA 1RIOH 3MZHA 1UB9A 1X1DA 2KT0A 4RAZA 1ZGAA 3PL8A 3F8CA 4ZYEA 5LEKA 2FF4A 2LMDA 4E7KA 1P92A 2QLZA 1E3HA 3BR5A 4I0AA 2BHZA 1I1SA 4IPAA 2WAQN 3OYAA 4KT6A 2FBIA 3D5SC 2RQPA 2X51A 1MH3A 5KCMA 4YFKF 1N77A 2UZKA 1ZK8A 2XKOA 5IOYA 3ZN1A 5IT9K 4XKCA 5IY5H 5ICCA 2R7TA 3P9IA 5ILSA 5E18F 4JOMA 4GO1A 1WJDA 1ORKA 5LHGA 1GXPA 2X6OA 1P6RA 5F0FA 4CCJA 3ZQHA 4QTRA 5LFAA 1K78A 5EGOB 4GFBA 3WU1B 2V1UA 4IOAF 1MKMA 2E1CA 2Z33A 4JK1X 4TV7A 4JX4A 3QU6A 3GEZA 5HDGA 2BOLA 2EQRA 5K1YA 2O03A 3WTTC 2DA2A 3G2BA 1PVEA 4AWXB 2F2EA 2LY1A 3GTKJ 1EH6A 3OYDA 3PSFA 1QZZA 3JRGA 2QQ9A 2LFBA 4CA0A 2VOPA 2VJ4A 1FPQA 3S17J 4XNFA 2Y2ZA 3Q9VA 1STZA 5GTHC 3ASOH 2OZUA 3E7LA 1S8NA 3JRFA 4I76A 3KEYA 2QSFX 3HC7A 3OYFA 3CCYA 1VF9A 4CCOA 2COBA 3U1KA 3LWFA 4L9VA 1MMNA 2O0YA 3AG2H 5D8LB 1BI2A 5FLMJ 4LK1F 3K6GA 1TP4A 2Z9OA 3OR2C 5HLGA 3HOXJ 2QYOA 4PZJA 5J8FA 4O3MA 2W1OA 4I2OA 5B1BH 1R6RA 5GTIC 3CDIA 1JJ8C 1IV6A 2I8DA 4V2GA 1V5FA 1MBJA 2IXSA 1G3SA 1X3UA 3DBRB 3HPHA 3QYBA 4R1HA 3TMOA 1H89C 4PJJA 3QPHA 1SVLA 3K69A 1RKWA 3O8HA 1VQLI 3A0HC 4NUBA 4NNJA 1XSVA 3EUKL 4XRMA 1I1GA 3J81Z 2VQLA 2R3SA 4XSXF 3C3WA 1ZYRF 4AYBA 3Q9SA 4HV5A 4UNOA 4PGHA 3OSFA 4XLFA 2XGEA 3J7AO 2UV1A 4G6QA 5E3MA 3SEZA 1T0FC 1G3YA 2ZXHA 2NS7A 1F9NA 4MLOA 1QO0D 1YTYA 4M72A 2QF7A 4KFCA 3VWBA 4FX0A 2NVUB 3JAMK 3DTEA 4LLGF 2XRLA 1A36A 1VQ9I 4BQAA 3F8MA 3VYRB 1IV8A 3VDXA 1IRFA 1X58A 3K7AJ 2IBDA 3ZCOA 3ZMUA 2Z5UA 2R93J 4IHSA 5DS9A 4FHTA 4XKVA 1FIAA 5C4JJ 4HDVA 2KIFA 3BROA 5FKKA 3DKXA 4XLCA 3AL0B 3LSTA 2BW3B 1O7FA 2HOEA 3S3MA 3GZ6A 1DPRA 1DP7P 3DF8A 5F27A 2E60A 3TEDA 3DCFA 4A12A 5TISC 1QVTA 1MNMC 1W7PA 1T2KA 4EQQA 2XF6A 3QWLA 2V9KA 4NC6A 4Y3OA 4MFEA 2Y0SA 2HXIA 1YI2I 3OYNA 1VTNC 4ZDLA 2EFNA 1LFBA 3I4MJ 2LF7A 5HVQC 1IC8A 2VBYA 4IHYA 4LG3A 2QSGX 2OQGA 2V9PA 5C4XJ 3HGGA 4EGYA 1QQIA 2IJLA 2MLKA 3QU3A 1LE8A 3RTRA 2R7WA 3CLQA 3Q5FA 1AKHB 3RZOJ 4BHCA 3MCZA 2JA5J 3CP8A 1OYWA 3AKZA 3QRFF 1KZHA 4P1WA 2K9NA 2ETHA 3KETA 2A5WA 2LY9A 3E6MA 3KZIC 2Q1ZB 2LTPA 2EPFA 4XICA 2H8WA 5J1YA 1ETVA 3LA3A 3F72A 4ZYAA 4BHBA 4B4CA 5LEJA 1U0JA 2HOTA 1BI0A 2CO5A 3EETA 5K5QA 1FOKA 2K3FA 2ZNYA 3I0TA 2K86A 5JLWA 4N9IA 1X1AA 3W3CA 1F4KA 2HQAA 2NXNB 1RUNA 3F6OA 2MABA 3F0CA 1QGPA 5KAIC 4U7BA 1XB4A 3KPHA 1I27A 2A6TA 1Z05A 2OCEA 4XMYA 4L0ZB 2K3PA 5EZGA 3J7ZI 2DMNA 2CU7A 2VT2A 5FKLA 3GTPJ 3KP7A 2NYXA 1CF7A 1UFMA 1X3ZB 5L3CA 2HR3A 2EA2A 2OTLI 3HGYA 2A68F 4A3FJ 1O3TA 1P4WA 1Y8QB 3ASNH 1JI8A 3H1CA 2OTJI 4FCYA 4A93J 2B9SA 3M9AA 3S93A 2DTZA 1U5TA 3NQOA 1MBKA 3OV8A 4RA2A 1TBXA 1PUFA 4ESBA 4G8XA 2IPQX 2KMUA 2ELKA 3KCCA 4CSWA 3HRUA 2FBHA 1MJAA 4N9HA 5LRRA 2JVGA 3LSIA 4A5NA 2EA4A 4M9XA 3GFMA 5DUIA 1R5GA 2A69F 3E5QA 4XKWA 3CF5F 1OPCA 3OIPA 4Y13A 2R92J 4EJTA 4L18B 3M4OJ 3OYGA 4CCNA 1YFHA 1TWFJ 2LK2A 2EZHA 2X6YA 1ETWA 4WX9A 3OYKA 2CW8A 4HNVA 1S5LC 5HDNA 1LEBA 4Q5SF 5LHHA 5HODA 2XB0X 3R4KA 3GWZA 2FNPA 1PUFB 1EJ9A 3BG3A 2BY2A 2QBYA 1P7JA 1LQ1A 2DXIA 3TDUC 2E19A 1B1BA 2HDWA 2YPRA 4H0EA 4X0GA 2UXXA 3HG9A 1WH7A 2RDPA 2ME0A 4IXAA 5M3FJ 3CCSI 1T38A 3PIPF 2ZMEB 3BG7A 4YG2F 2Z3YA 3R0JA 1ZKGA 1WHUA 4C30A 5F0HA 1T0FA 1KYZA 2WV1A 3IRQA 2VOOA 3L2VA 3DPTA 2XSJC 5F0CA 3U1DA 4JQFA 3I58A 1SFXA 2LR8A 2DW4A 1W0TA 4WXHA 4ZYHA 1Z9CA 2FA5A 3PUFA 3K10A 4WXCA 2MD5A 4Y17A 1WJCA 1S6LA 1XC5A 4CYDA 3QOEA 2LH9A 4C2MJ 5HS7A 2BGCA 5L3FA 4CGZA 1XGSA 1FTZA 1K78B 1KQ9A 4LGWA 1JGSA 2KZVA 1U2WA 5LRSA 3CMMA 4FASD 3J80Z 3CD6I 1USSA 1AA7A 5DEQA 2RV8A 3HYIA 2VBZA 3K70C 2PQ8A 1FC3A 2MBFA 1MMDA 2PMHA 1ETOA 1IUYA 4UVAA 1ZG5A 1AKHA 1QPMA 5CYVA 2CV2A 2DMQA 3JRCA 3LAJA 2L54A 4RGXA 3RKQA 2JUCA 3VB2A 5FRMA 2CUEA 2KJCA 3HB9A 2M45A 2Y9ZA 2IA2A 3AAFA 2DA4A 2KP6A 3FM3A 3MD2A 3NEUA 5DV5A 4ENJA 2DQLA 5ICFA 1W7PB 1SFKA 4LD5A 1EH8A 2ZSIB 2R5ZB 3HZJA 2H6CA 1RPWA 1YW7A 1MW7A 1O3RA 3VOEA 1MDMA 4ESJA 3D5RC 1KGSA 5KAFC 3HL2A 1WPKA 2DBBA 3TOAA 3V8LA 1R71A 2F6CA 1WVRA 3IAS2 3K4JA 4JYKA 2KDZA 1DDNA 1J7KA 3L09A 2M0CA 3M8JA 2G9WA 1I39A 3FXOA 4IQJA 5E3LA 4E7SA 3HHHA 3OY9A 3JSPA 2AO9A 2KDOA 5JVTA 2CW0F 2EINH 1SANA 2Q2EB 1Y56A 2NVQJ 4UUSA 3S3OA 2B7EA 2JUGA 2WB1N 1ZLKA 3NWTA 3GTGJ 1K6OA 1ZELA 2O7OA 2EH3A 2ELHA 3D1NI 3Q0VA 1FMWA 5FKNA 2FEZA 3SQNA 2DT5A 3I9V2 2M4KA 2MLGA 3S1QJ 2P8TA 1GVDA 3ZMDA 2JTVA 1FTTA 3ZXSA 1HF0A 5D4RA 4RB0A 3QOPA 1UHMA 3LOCA 2EV6A 2GA2A 1IGNA 2VXDA 3S1NJ 1FY7A 2R7SA 1X4PA 3OYHA 4A3IJ 1TLHB 2E1MC 3H9JA 1VFCA 2WC2A 1MH4A 3CCQI 1UELB 4A6DA 2O61A 3OS2A 1LFUP 4YFNF 3A4CA 5FLXZ 1V55H 2LOOA 3ROUA 2BV6A 1GT0C 2UWMA 2E36A 3F8FA 1UHSA 2OUMA 4ZDPA 4BJTA 3CJRB 3CUOA 5EF6A 5HLIA 3VSKA 2IP2A 1SC7A 3S2HJ 2DMPA 2VASA 3G1MA 2VJJA 3CCRI 3WTWC 3BG9A 2XB5A 4BAYA 3I71A 5GP9A 4UUSB 1B72B 4MEXF 2V4JC 3QYEA 2JMWA 2CUJA 2QZ8A 2A5YB 2G0EA 4I98B 1D5VA 3MAJA 4IKFA 2W00A 1WH5A 1RRJA 4II3A 2LYCA 3CCUI 3HPGA 2MYSA 2W4SA 3G4SI 2DAOA 3DPUA 1VQNI 1SEUA 2KL4A 4BU2A 4Y7NJ 4O6JA 1J5YA 2MH2A 3G1LA 5M5XJ 5IP9J 1OJLA 2IA0A 1POGA 2DFEA 3MFKA 4RAYA 1YLFA 2VC0A 4ON0A 3JTGA 2IGMA 5IP7J 2LVSA 3M8FA 4LG0B 1U9OA 3MKLA 3EUAA 1ZHFA 2XDVA 1PYVA 3FKJA 3JRAA 3WTUC 1VZ0A 1QBJA 2XROA 1U78A 3DLLF 2JK3A 4BBSJ 3BG6A 2V6EA 2KFDA 2W25A 2LP0A 4XLNF 3OYCA 1YE9A 1R5ID 5LBQA 1GV2A 4HNTA 4IRIA 3FXUA 4D7NA 1ZR2A 1TWHJ 4FETA 4BQOA 4Z6YA 1TQPA 2XAHA 3ZQLA 1LFPA 2DPDA 2R4GA 2L5QA 1JGGA 2ZMEC 2L4MA 3TOBA 1IRZA 2EV0A 1QVUA 1MD0A 3KYDB 3CO7C 4FX4A 2BVLA 3SDBA 1YIJI 1WI9A 4M74A 2D2WA 4BUPA 5D8KB 1BL0A 4KN7X 2R7FA 1Z7LA 2FSWA 4HBLA 4KIFA 5ED4A 3ZN0A 2WWYA 4F91B 3P7NA 4L9JA 5A2QK 2X1EA 2XF5A 2VONA 2RAEA 2ZFWA 3PUBA 2F5DA 1NTCA 3OR1C 3K4LA 1TQMA 4A3BJ 3Q0WA 4GYIA 3V8JA 3H0DA 1Z3YA 3MEXA 2L02A 1UG2A 2JSPA 2WA0A 4JBAA 1XSDA 2CMPA 1UMQA 3KLNA 2LLKA 4GXOA 3WU2C 1TWCJ 4O5VA 1JE8A 4BXUA 5JR3A 4YIFA 3V7SA 2BXZA 4IHWA 3SZPA 1IW7F 1W5TA 5DYMA 3I56I 2I5UA 3O3KA 1OCPA 3JREA 3ZR8X 2NNNA 1IN8A 2LNBA 3HOUJ 1A35A 2IS6A 1O57A 2DJNA 3HSEA 3P5JA 5FJ8J 1UJ8A 2P6SA 4WF2A 3M7GA 5J1RA 5JI6A 5DTDA 1LPQA 2G7UA 1QRYA 4XN3A 1ZGJA 1SAXA 4HLYA 3JRIA 3PNYA 1M1EB 4CYCB 1WSUA 1SD6A 3WGHA 2FU4A 3L1PA 2Y0SN 5F6FA 4BS9A 2K9LA 1BIAA 3S8PA 3QPSA 4XLPF 4EVIA 3E1SA 3M8EA 4J19A 3LSGA 2RKHA 1HW5A 2WAFA 4NBQA 2VIXA 3IWZA 3T1BA 2BE5F 4BXFA 2XPWA 1WRJA 3DWLE 4M3GA 1NG6A 5EZHA 1ZGWA 2TDXA 3FF5A 1CGPA 1CF7B 2DTRA 1B9NA 2MA3A 2XASA 4Y33A 2FUG2 4ZJZA 3HDDA 1BN5A 4ZYDA 3GF2A 4HAMA 1U5TC 3QAHA 1APLC 4G9YA 1IRXA 3HOZJ 4GDFA 3VODA 2KZGA 1LVAA 2L9NA 1TZLA 2NOGA 2ZXJA 1LJ9A 3LSHA 3MKZA 3SXYA 3GZNB 4A3KJ 3DKYA 1U9NA 1F43A 2OF7A 4IHXA 3A01B 4WCGA 4L9TA 2WTEA 4DYCA 4C2TA 3H36A 4H4KC 2R7OA 4CCMA 1V5EA 1A04A 2L2OA 5GADJ 2Y75A 1FNNA 5IT9Z 1C0WA 3BTLA 2QEXI 2HDDA 9ANTA 5ILUA 1T33A 4I7HA 4ZC3A 4DYRA 1ON2A 3LA2A 1OYYA 2K85A 3ULQB 2L0KA 4HX8A 2XV4S 4C9YA 3KEOA 4RM2A 1LE8B 1VQ4I 2GBYA 3UR3C 1YRNA 2FD5A 3NAUA 4IEJA 3E5XA 1B72A 2JSCA 4XORA 4IOCF 2M2EA 1XDUA 4BL0B 5ICEA 2VJIA 4D7MA 3BR6A 4BQQA 3EDPA 3CESA 1USTA 3Q0UA 5AONA 5D5VB 4IRGA 3E0JB 1K4SA 1DU6A 3E97A 2CSOA 4AIJA 2BY3A 4BHPA 3FIWA 1JXSA 2FX0A 1TT5B 1J59A 3ABUA 2ISYA 3K4CA 4CDGA 2HVSA 3WODF 4XR6A 4DIQA 3BPXA 4E7LA 2I10A 2BVMA 3K1MA 2JT1A 3ESWB 1AWCA 1KU9A 4NB5A 3WG7H 2CH0A 3HSFA 4W97A 1JKRC 3T8TA 2YX4A 3CP2A 2DQRA 2VJ5A 3LSPA 3M07A 1EV7A 1ZREA 1V5GA 3KP2A 2XF7A 4HLXA 2ZC2A 3KP5A 3RCOA 3FK7A 2ZNZA 2HGCA 4RAGA 3CLOA 1R1TA 1HSTA 3L7WA 1R58A 3LSKA 3ZP5A 3K1PA 3R0AA 2C6YA 2PX9A 3RZDJ 3K9TA 2PEXA 2HWVA 2YU3A 1IO2A 4ZZLA 1AOYA 2DCEA 3N05A 2ZXIA 3WTZA 1G2HA 3WTSC 5LGUA 5HLTA 1XTAA 3A03A 4P96A 1EKEA 2CRGA 3HRSA 1MDMB 3FX3A 2K7LA 1BW5A 3KZZA 2K9QA 4FE7A 3BOQA 2IEKA 2QWWA 2D5VA 3I53A 5L3GA 2B63J 3LL7A 2XC7A 3HOTA 3PNTA 1T08B 1XMAA 4DBRA 1PP7U 4MEYF 3JR9A 1F36A 3J81K 4IX7A 3N4MA 3QYFA 3ERED 4BEHA 3V42A 3ZQQA 2ELJA 3ZPLA 3NRVA 3BCBA 5ERIA 1B9MA 2BXYA 2X6XA 4JP0A 1BOBA 4HQMA 3GCMA 4BE1A 2EFOA 3H3ZA 1WKMA 1YJ9I 1W1WE 3KLOA 3O6BB 4ZZDA 4DYQA 1AU7A 2RN7A 2VQHA 2L7FP 3IP4B 2QENA 5K7FA 3OOPA 4BACA 5GAEJ 2QVOA 1OCCH 3BPVA 5HLHA 2YSRA 3ELKA 1OFCX 2H94A 5EYRA 4A5MA 1D1AA 1S7OA 1Z7UA 1HKSA 2QQAA 1J09A 3LSRA 3DTIA 2HYGD 2DJIA 2Z2SB 4F7ZA 5J8CA 1RKTA 4J01A 4U88A 2M5WA 3TQNA 3B6AA 3IH2A 4PFOA 1KA8A 3GTOJ 1OR7C 3PNVA 2JJ7A 4DOZA 1RETA 3OOUA 1K7AA 4CHUA 5FKMA 3F8BA 3TW7A 2XGCA 1ETQA 2NS8A 2XAGA 4F93B 5E1ZB 1FIPA 1FOWA 3W2WA 1FP1D 1OCOH 1W5CC 3ERMA 2Y48A 3S1MJ 2CUZA 4RAFA 3DEWA 3EQLF 1UZCA 3LA7A 3RPUD 5JFRA 4I0BA 1WQ2A 3W2VA 2QUFA 3J7AY 2P6TA 1VNDA 2PMUA 5DD8A 2O5RA 1T98A 3TBIA 3TL4X 2QBYB 5IT3A 3WG9A 1O7LA 4BQNA 1HOMA 4B3AA 4J00A 3W6KB 4EJVA 1G59A 4PSXA 2XSDC 3FHNA 3CUQB 1S72I 4ZYGA 2GM4A 4A3GJ 4AM3A 3G1OA 4U0YA 5K5RA 3FXKA 1X3WB 4LLLA 1MNDA 4YELA 5ICGA 4BEHB 1SFUA 3VYUB 2HVRA 1YITI 4DW6A 3M1CA 5HS8A 2DA7A 1JJ6C 2M87A 1J75A 1BC7C 1Z3XA 3ML6A 1L0OC 2EFWA 4A3MJ 1R4MB 2BZTA 3RPUA 3W6JB 4KUMA 4A3LJ 4FISA 1PJRA 2R5YB 3E6CC 1W0UA 1U5TB 3PJRA 4Q47A 3QP6A 3ZMVA 2AXLA 2R5ZA 3M1EA 4EM1A 3HUGB 2OPTA 1PP8F 2HKXA 2BHYA 4UUVA 3AFHA 4UVCA 1G3TA 2F5FA 5D5WB 1G4DA 1HSJA 2OCCH 4P9UA 2EB7A 4K2EA 4B3XA 4RGSA 2DU9A 2Y31A 3RKWA 4GRIA 4GCVA 3BJ6A 4A3EJ 3UNGC 4HNUA 4HDUA 2DN0A 1ZRCA 2R7ZJ 1JKQC 4KYWA 3G73A 3BDDA 3RSNA 5J1UA 4CCKA 2H1KA 1R36A 2WV0A 2OQRA 4AVPA 4CXFA 4G7OF 3AG1H 3HOSA 3H92A 5DCMA 3GFJA 3MVPA 3J7YJ 2JVHA 4AIKA 1FBQA 5F1JA 1FSHA 3B73A 1UCRA 1HDPA 1FOYA 1EF4A 1KYWA 1UHWA 2FXAA 3LSMA 4II2A 3RI4A 5DD4A 1JUSA 1LKXA 3L2RA 2HVQA 4LB6B 3GYHX 3H0GJ 2KIQA 3CZ6A 1Y0UA 2AQFA 5TRDA 2VPRA 4HX4A 1WJAA 1IN5A 2CGPA 2ZJPF 4KT5C 3GTJJ 4CUGA 3CC7I 3BR0A 1J9IA 1HA8A 4G7ZF 1YIOA 2PG4A 3GTMJ 1V4RA 3CJNA 2DFIA 2LREA 3BWGA 4UV9A 1IXSB 2VI6A 4UB6C 1WJBA 3OYBA 3LAPA 5J40A 1DU0A 1Y1VJ 2X0LA 2IRFG 3ABTA 2ESHA 3IH3A 1NHAA 2O9LA 3QODA 5B1AH 3CCJI 1BIBA 1J0RA 1D8JA 1QZYA 3FXJA 5BOXA 2EBIA 4F52A 1P2FA 3AL0C 2R0QC 1MBGA 4KN4X 4DQ2A 1NK3P 4RGUA 3GZ5A 4A0XA 2D45A 1ON1A 2EILH 5FO5A 2GXBA 5D5UB 3G71I 1IXRC 1OCTC 3CCVI 2JZYA 2OZ6A 2QSHX 2VKDA 3C2GA 5IYBJ 1Y6IA 1XD7A 2CQXA 3HTUA 3I64A 1IJWC 1LDJA 3K0LA 1R9TJ 1KQ0A 2M4GA 2VQGA 1XPXA 5FFXA 4RMNA 2DOAA 3HRMA 2H6BA 3DFGA 4NHJA 2LDUA 2GLOA 2GZWA 4C3JJ 2FOWA 5F04A 2JN6A 5DM7F 3IH4A 2HTJA 4B44A 2EV5A 2AXTC 5M5WJ 3IHUA 3DKWA 1IZ1A 1QHGA 4HSTA 5EG0A 4OMYA 4RDUA 4ETSA 2DK5A 1D1BA 2O6GE 1W36C 4ZDOA 3RJPA 1ZG3A 2K5CA 2K40A 1ENHA 1R1VA 1U6GA 2VL8A 4E6KG 1Y0NA 1U3EM 1YJWI 2MC3A 4Q4ZF 4BNCA 3TP3A 2HFHA 1XGOA 4CYCA 3BQYA 2VPLA 1WGXA 1EH7A 1ZN2A 5LHIA 5J3LA 2A6HF 3RKXA 1ZRFA 5FROA 2XAUA 4PJLA 1A6QA 1QU3A 5B3SH 2H27A 2E71A 1IDZA 3SZGA 2R7UA 3I4NJ 2WY8Q 2CUFA 1G3WA 1I6XA 1ZLJA 3IL2A 3S15J 2V1DA 2XPUA 1E3PA 1OR7A 3HKZN 3U21A 2OC6A 5LGNA 3JRDA 1FYMA 4OIPF 1RNLA 2AQEA 3IKTA 1XMXA 2X4HA 5CVIA 4PK4A 4AUXA 1ZH5A 5KHDA 3S32A 3WTVC 2HYFA 5DUKA 1LVKA 4GGGA 5FGMA 1SAUA 3CCEI 1RUOA 3Q3SA 3JAMZ 2W85A 1X2MA 1I50J 4LIVA 3C7JA 2PI0A 3S2DJ 4KISA 2WADA 1R23A 4B1RA 3NWSA 4IHVA 3GLLA 2VT3A 5TGTA 2D1VA 4OAZA 2HYJA 3FXQA 2GQQA 1DP3A 1VQ5I 1YW8A 2ICWG 1N78A 3F6VA 4HSRA 3E6DA 1BR2A 1BI1A 2JRTA 2CV1A 2PMZN 3K70D 4OAYA 3CJTB 2Q0OA 3KX2A 4MNUA 2P5VA 3BZ6A 3V8KA 3ZQFA 1B4AA 1W36D 3A01A 2L01A 3KYLA 2ME6A 1FP2A 2LBFA 1JT6A 2HQNA 2YU9J 3RQIA 1B6AA 3I4PA 4F92B 3SZTA 2E7WA 2CQNA 5J4YA 4XM3A 3VPRA 1BW6A 2LSOA 2Z16A 2E1NA 3CC2I 1S7EA 2EK5A 2V6CA 1O4XA 3BR1A 4XSZF 4XQFA 1JKOC 2MH9A 3NARA 1REPC 1IRGA 1R1UA 1U8RA 2NNYA 4RLQA 2W48A 1MSEC 1WI3A 4E70A 2DMUA 1FZPB 4P9FA 1T8IA 2IS2A 1HKTA 4S0HB 4AC0A 1BA5A 2PFBA 3GUDA 4G7HF 3QQAA 4RB3C 3W2AA 2OD5A 4I01A 5L3DA 2E34A 5FRNA 1Z67A 4BYYA 2ZSHB 2F5EA 2PJRB 4AU7A 2NVTJ 3ECOA 2O8XA 5LGTA 2P5KA 2IS1A 3FISA 2EIMH 2CQQA 4DBQA 4MQ9F 2RNGA 2TRTA 5EEAA 4B8XA 4BJ6C 1DGWY 2P0WA 1T6SA 3BTJA 2E7XA 4IZZA 2XGXA 2LKSA 3ZMTA 2XUBA 4MQVA 2EZKA 3U2RA 3CO6C 1JHHA 4RBOA 3TDZC 4EJWA 3R60A 3CDLA 3C1DA 4PSWA 3DEUA 1IG7A 5CVUA 5E8GA 4X1EA 2V9VA 4M3EA 4U87A 5GPCA 3K4BA 4QIWN 3FXRA 3K2AA 1WJ5A 5E8IA 3OIOA 3I59B 5E1WA 4DJAA 4HEA2 1XMKA 1WJEA 2DA1A 3ZGKA 2FNAA 2XRNA 3IC7A 2DMTA 1OMIA 2HU9A 3CMEI 5H20A 1K6YA 3EYYA 4KICA 1S29A 5HNFA 1TNTA 1R49A 4IJAA 1FSEA 3DBHB 3HBLA 3MZ8A 2GWRA 3O8GA 3CMAI 1A5JA 2KJBA 4M6YA 3GTQJ 5JHFA 4BE2A 3KP6A 2QGUA 4LFUA 2E2IJ 4PFPA 2K4JA 1KU7A 2XAQA 3KZYA 2EFQA 1RZ4A 2HEOA 3ABMH 1MMSA 3FWEA 2MG4A 4CICA 5GAGJ 5E3OA 4B43A 4DGWB 5EGOA 5BPIA 2HKOA 5C44J 1JTYA 1L3LA 2P81A 2ZKZA 1S3JA 3W6VA 1X2NA 4L9NA 1TWAJ 4ASNA 2FE3A 5L3BA 1E17A 4HW0A 3L2QA 3B02A 1IN7A 1GDTA 4D0PA 3OL4A 4G12A 3WTXC 4G6TB 4I99C 1GHCA 1TWGJ 1XCVA 4ZTFA 3DEEA 2E2JJ 5DCFA 4MIMA 1Z0XA 1K4TA 1UAAA 2YR2A 3PIOF 2A05A 2M1BA 4IL6C 1YX3A 3JRBA 3S16J 2LKPA 1DUXC 2M7AA 4L5IA 4EM0B 2M0MA 1TW2A 2EIKH 2IGNA 5FLVA 4KMFA 2VODA 4A3CJ 4Y52J 1RI7A 1SD7A 4OWRB 3JCUC 1BM9A 2QKMB 3HRTA 3PFIA 4HPQA 2DODA 4BBRJ 4D5FA 4RB1A 3L2UA 2DT6A 2ECBA 2ZB9A 2D1HA 5C3EJ 5KNLA 1D0ZA 4M71A 1K61A 3SFIA 2P7VB 3KE2A 1KU2A 1XG1A 2BEOA 1JUMA 3DBLB 5BNGA 4CCLA 3ZMSA 1LB2A 3CUQC 4LK0F 3IWFA 2VKEA 3F3XA 2IA1A 4M6XA 5CJ9A 2CQKA 1ZTRA 3OS0A 2F48A 1XN7A 2ACJA 3PO3J 1YS7A 1MJ9A 4BY7J 5EJCA 3CCLI 4P55A 3IAM2 3JSOA 4UXNA 2JWTA 2ADUA 2P4WA 1OCRH 2E2HJ 3FMRA 1DQUA 2FQ4A 4HF1A 3H9QA 4OIOF 2AHQA 1FJLA 2J5OA 4V2FA 4GYGA 2LC2A 2DOEA 2M34A 4JX5A 4F3QA 2L3DA 2Z99A 1BOAA 4C2UA 5JLXA 1Z21A 2BYVE 4QSHA 1H9GA 2DK8A 2OJED 2DDAA 2R7QA 3SJMA 2M9HA 4DNCA 2LF8A 4IRHA 5HDKA 4QWQA 4DZJA 5EG0B 1ONVA 4LIUA 5FD6A 2DO7A 1OCZH 3DXJF 1MZBA 4M3DA 3A2KA 3R6SA 3EUHA 1FYLA 4U7DA 2V1XA 4M73A 1TNSA 2E35A 2IGOA 2W7NA 4XL9A 4N0BA 3H9GA 4L5JA 1Z77A 2Q2EA 1BR4A 2R7RA 3KP4A 1ETKA 1OISA 3REOA 1YOVB 1AHDP 2LRDA 4YFXF 1HKQA 2L7MP 4MTEA 2HPIA 1QZEA 1FYKA 4P5OA 5IYCJ 2VQCA 4KITB 2FMYA 3R61A 4XLAA 3HKZA 4LB5A 5LD2C 3S3NA 5GAHJ 1YW9A 2JA7J 4PDKA 4YIIA 3IUOA 4I09A 3F21A 4M9ZA 1GV5A 5LLQA 2WAQA 3HXLA 2DDBA 4KA4A 4I6ZA 2GA1A 4EM2A 3J80K 6PAXA 2MFZA 3GLXA 4OIRF 2X1DA 4ITVA 2F5CA 2GAUA 2FRHA 2HNHA 5CVVA 1MJBA 2NOJB 5BS6A 3MWMA 2K02A 3GO5A 4PJMA 4AYBN 1YQAA 4BDZA 1K83J 5EEGA 4QPQA 2HZDA 2MW8A 3L2WA 2LD5A 2PJPA 5FB2A 4ZTJA 1RR7A 1GUUA 3VEPA 5K7HA 4HOBA 3H5AA 4G6DA 2IT0A 3I5UA 2Q8KA 3E5UA 2R7DA 2EFPA 2GOXB 1D0XA 2X6WA 5AIQA 3O2PE 2CG4A 2DA5A 4V19K 3HTSB 2Y69H 4FTHA 2LBFB 2QKLB 5BPDA 4F55A 2A07F 1FBUA 3LMMA 2BBYA 5IP6A 3BY6A 3BTCA 1BJAA 2L7KA 4BKXA 2KIMA 3GW2A 2XHKA 3RQ4A 3FM5A 4A0YA 4HQEA 3FK6A 2E5NA 2JQ7A 4HRIA 1Q1HA 4KJZA 2OU2A 1D8KA 4HA8A 1T39A 3SFZA 3A1YA 3JW4A 1W4MA 1HDDC 3OSGA 2KRCA 5DM6F 4LOCA 5EDNA 1SFEA 2NVYJ 1B8IB 2OAZA 3CDHA 4YRVA 1P4XA 1E3OC 3V7RA 2JA8J 2EWNA 2MSYA 1OKRA 2ZMEA 3L00A 2O3FA 3ISPA 2WBMA 4B47A 1TT0A 2DYSH 1UG0A 2FMLA 3HM5A 2QM3A 3HUGA 3KYCB 5F08A 3X2QH 4EJUA 4XOTA 5M5YJ 2K4BA 3BC8A 3PQKA 2DOFA 1LEAA 2VE8A 4EGZA 3ABLH 3K4KA 3LQQA 4IF4A 2BW3A 1YX5A 2LY2A 4BXXJ 1YYVA 3RIRA 2IVMA 3LFKA 1ZARA 3I54A 3OIQA 4C3IJ 2WY7Q 3OYMA 4LMYA 5JVGF 1JTXA 2ZXWH 1P9QC 5GPAA 4Y15A 3S1RJ 5H6RA 1FBSA 4ENKA 3GVAA 4A0ZA 3MKYB 3BZKA 4BH9A 4CO8A 4NC7A 1XCBA 2F4OB 2MD0A 2HTSA 1SVOA 3F9KA 1KU3A 2M8GX 4M3FA 3C2BA 4ANJA 4QLCU 2QQBA 3DV8A 4PJ0C 4OINF 2X85A 4HYEA 1X1CA 1IAWA 5HNHA 1I3AA 3P9CA 3GMEA 1LDKB 1E2XA 3LNQA 1SFOJ 1LDDA 1HW1A 3HOVJ 3DU6A 1YO5C 2CS3A 4A3JJ 4OOIA 3LSJA 3S2WA 1VQKI 3OYIA 3DU5A 3K4MA 1MGTA 1HC8A 2HPMA 2KPMA 2ECCA 4OMZA 3TKYA 1JT0A 1XGNA 1FEXA 2UUZA 2Z1DA 4B48A 2VLAA 1XDSA 2YX7A 4DZPA 3N97A 3H5RA 1IDYA 2YS9A 1G6NA 1IXCA 2QA4I 4CH7A 2W24A 1XSXA 2RQQA 1A6IA 1GXQA 5IPAA 2H09A 4YEJA 2V79A 3TO9A 1TTYA
chains in the Genus database with same CATH topology
2LLKA 2Y2ZA 1TWCJ 3I4NJ 2L7ZA 2CUFA 4M6VA 4IHWA 3E7LA 3JRFA 4I76A 3S15J 2XPUA 3CCYA 1OCPA 3HKZN 1VF9A 3JREA 2COBA 3JRDA 1H88C 3HOUJ 2DJNA 4XRSG 1WCMJ 5FJ8J 5FLMJ 1Y1WJ 4AUXA 5J1RA 3HOXJ 1ITYA 5DTDA 5E3NA 1QRYA 1JJ8C 3Q3SA 1IV6A 4V2GA 1X2MA 3JRIA 1I50J 1MBJA 2VUMJ 3S14J 3S2DJ 4CYCB 4B1RA 1H89C 4IHVA 3L1PA 2HYJA 2Y0SN 3QPSA 1RKWA 3O8HA 3LSGA 4J19A 2PMZN 4XRMA 4C3HJ 3ZQFA 3A01A 2XPWA 1JUPA 3ZQIA 2ME6A 4M3GA 3PO2J 1JT6A 2YU9J 5EZHA 3RQIA 1ZGWA 3OSFA 2XGEA 4X6AJ 1I3QJ 3VPRA 5E3MA 1BW6A 2NS7A 4MLOA 4FE4A 3HDDA 1S7EA 2QF7A 1APLC 3HOZJ 3HOWJ 2XRLA 1O4XA 3BR1A 4D5CA 1JKOC 3NARA 1X58A 3K7AJ 2IBDA 2NOGA 2R93J 3TW6A 5DS9A 2W48A 1MSEC 1FIAA 1WI3A 5C4JJ 4A3KJ 1U9NA 2HOAA 1F43A 2DMUA 2OF7A 5FKKA 2Y30A 4IHXA 4S0HB 3A01B 3ZOBA 4AC0A 1BA5A 2X9DA 4DYCA 1MSFC 3QQAA 5F27A 4BY1J 3TEDA 2NVXJ 4EEFG 3DCFA 1HLVA 1U8BA 3BTLA 1QVTA 1MNMC 3WHBA 1CQTA 2NVTJ 2HDDA 9ANTA 3FISA 1T33A 2CQQA 4DYRA 5EEAA 2TRTA 4MFEA 2HXIA 2L0KA 3BTJA 1LE8B 2GBYA 1YRNA 2FD5A 1LFBA 3NAUA 4IEJA 2LKXA 1IC8A 3I4MJ 2EZKA 1B72A 4RBOA 4IHYA 2HXOA 5C4XJ 2M2EA 3HGGA 3CDLA 1YRNB 5IOZA 1LE8A 1MBHA 4D7MA 3PM1A 3BR6A 1AKHB 1IG7A 3RZOJ 4X1EA 3ZQCA 4M3EA 3Q0UA 2JA5J 1DU6A 5GPCA 4QIWN 3FIWA 3K2AA 2FX0A 3OIOA 2K9NA 2TCTA 2LY9A 2DA1A 3BR3A 2LTPA 4XICA 5J1YA 2YUSA 1ETVA 3TP0A 2HOTA 4B4CA 2DMTA 2I10A 4NDLA 4W97A 1JKRC 3B6CA 5JLWA 1A5JA 3HBLA 5FKOA 3O8GA 4M3BA 3LSPA 3GTQJ 3HEFA 3F0CA 2H8RA 2E2IJ 2ID6A 3FK7A 5EZGA 3GTPJ 2DMNA 2CU7A 5FKLA 3QPLA 5K7ZA 2MG4A 2VKVA 5EGOA 5E3OA 3RZDJ 3HGYA 5C44J 1JTYA 4A3FJ 2P81A 4FCYA 1G2HA 4MFDA 1IUFA 3W6VA 3A03A 1X2NA 2DTZA 3GTLJ 1TWAJ 2CRGA 1MBKA 1BW5A 1PUFA 1BJZA 2K9QA 1ETYA 4FE7A 1GDTA 2D5VA 2IEKA 2ELKA 3A02A 4G12A 3CQZJ 2B63J 3FKIJ 1TWGJ 2EZLA 2E2JJ 3JR9A 1F36A 4MIMA 1Z0XA 2X48A 3JRBA 3S16J 2R92J 3WHCA 5FLVA 3M4OJ 4A3CJ 2DA6A 4Y52J 4JP0A 3BG5A 1TWFJ 2LK2A 2EZHA 4BBRJ 4D5FA 1ETWA 2ECBA 3BTIA 4DYQA 4HNVA 4MO7A 2ZB9A 1AU7A 5K7FA 2L7FP 5HODA 2XB0X 5C3EJ 1K61A 1PUFB 3BG3A 3SFIA 1P7JA 1XG1A 5BNGA 1JUMA 1OFCX 2E19A 1P7IA 5EYRA 3BR2A 1H8AC 2VKEA 1WH7A 2ME0A 5M3FJ 1ZTRA 3LSRA 3PO3J 1RKTA 3B6AA 1D5YA 3IH2A 1ZKGA 4JX6A 4BY7J 3GTOJ 5F0HA 2WV1A 2DA3A 2JWTA 1B8IA 2E2HJ 2JJ7A 5F0CA 1RETA 3OOUA 5FKMA 2MGQA 2LR8A 2FQ4A 3TW7A 1W0TA 2XGCA 2AHQA 1ETQA 2NS8A 1FJLA 4V2FA 1FIPA 3HOYJ 1XC5A 2M34A 4JX5A 4C2MJ 3S1MJ 3DEWA 1FTZA 5JLXA 4QSHA 3JRHA 3SJMA 3MN2A 1HCRA 4UUTA 2M9HA 4L5EA 1VNDA 4DZJA 1ZR4A 2HI3A 5EG0B 4A3DJ 2Y9YA 1ETOA 4M3DA 1HOMA 4B3AA 1AKHA 2XSDC 1JKPC 2DMQA 3JRCA 2GM4A 1Z77A 3RKQA 4A3GJ 3IV5A 3G1OA 1ETKA 1VI0A 2CUEA 4XRSA 3HB9A 4XIDA 2XGDA 1AHDP 2Y9ZA 2IAIA 2DA4A 2L7MP 2JA6J 5IYCJ 4DW6A 1JJ6C 2DA7A 3UKGA 4XK4A 2JA7J 2R5ZB 1I6HJ 4A3MJ 1GV5A 1RPWA 3ZQGA 4I6ZA 4A3LJ 4FISA 1ETXA 2R5YB 1W0UA 1T56A 1WPKA 4W1UA 2R5ZA 2OPTA 4JYKA 2KDZA 2K9SA 1NK2P 4AYBN 2M0CA 2LD5A 1K83J 2MW8A 3BQZA 5E3LA 2AO9A 2O8KA 1RR7A 2Y31A 5M3MJ 1GUUA 2FJ1A 3BT9A 5K7HA 4A3EJ 1ZQ3P 2QCOA 1SANA 2DN0A 4A69C 4UUSA 2NVQJ 2R7ZJ 2WB1N 1JKQC 3GTGJ 2L9RA 2O7OA 2EH3A 5J1UA 3D1NI 1TC3C 3Q0VA 2CJJA 5FKNA 2H1KA 2DA5A 4FTHA 3S1QJ 3H3VK 1GVDA 3MVPA 5IYDJ 1FTTA 1HF0A 5IP6A 5F1JA 2HOSA 3LOCA 1IGNA 3BTCA 1HDPA 3S1NJ 4BKXA 1EF4A 4A3IJ 1VFCA 1MH4A 3FK6A 1JUSA 1LFUP 3H0GJ 4ABZA 1XS9A 1GT0C 2N8GA 1UHSA 5EF6A 2VPRA 3S2HJ 1Q1VA 2DMPA 3G1MA 1HDDC 3OSGA 1RESA 3BG9A 3GTJJ 2XB5A 3BR0A 1MBFA 5GP9A 4UUSB 4LOCA 1B72B 2E1OA 5EDNA 2NVYJ 1B8IB 3GTMJ 2JMWA 2G0EA 1E3OC 2VI6A 3GBGA 2JA8J 2MSYA 3M3YJ 2XPVA 1WH5A 1DU0A 1Y1VJ 3SDGA 2HQ5A 2EZIA 3IH3A 2O9LA 2ID3A 3HM5A 1QPIA 5F08A 5M5YJ 1MBEA 2R5YA 2EBIA 4Y7NJ 3CMYA 2R0QC 1MBGA 1NK3P 3G1LA 5M5XJ 4BXXJ 5IP9J 1OJLA 1POGA 4C3IJ 1OCTC 2KT0A 5IYBJ 2CQXA 1IJWC 1JTXA 5IP7J 2LVSA 5GPAA 1R9TJ 3S1RJ 1U9OA 3MKLA 3BR5A 3JRAA 1U78A 2WAQN 2JK3A 2GLOA 4BBSJ 4C3JJ 5F04A 2JN6A 2LP0A 1MH3A 3IH4A 2M8GX 5M5WJ 1GV2A 1ZK8A 3C2BA 4M3FA 5IOYA 4D7NA 1ZR2A 1TWHJ 5EG0A 4RDUA 3ZQLA 1JGGA 1IRZA 1QVUA 1ORKA 3LNQA 3HOVJ 2X6OA 5F0FA 1SFOJ 3ZQHA 4A3JJ 4QTRA 2K40A 3LSJA 1BL0A 1ENHA 5EGOB 4GFBA 3TP3A 2ECCA 1JT0A 1FEXA 4JX4A 4CYCA 3BQYA 1WGXA 2RAEA 4DZPA 1IDYA 2EQRA 2YS9A 5J3LA 1NTCA 2DA2A 4A3BJ 3Q0WA 1A6IA 3GTKJ 5IPAA 1UG2A 3JRGA 1IDZA 2LFBA 3S17J 1UMQA 4A93J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLK A;  2Y2Z A;  1TWC J;  3I4N J;  2L7Z A;  2CUF A;  4M6V A;  4IHW A;  3E7L A;  3JRF A;  4I76 A;  3S15 J;  2XPU A;  3CCY A;  1OCP A;  3HKZ N;  1VF9 A;  3JRE A;  2COB A;  3JRD A;  1H88 C;  3HOU J;  2DJN A;  4XRS G;  1WCM J;  5FJ8 J;  5FLM J;  1Y1W J;  4AUX A;  5J1R A;  3HOX J;  1ITY A;  5DTD A;  5E3N A;  1QRY A;  1JJ8 C;  3Q3S A;  1IV6 A;  4V2G A;  1X2M A;  3JRI A;  1I50 J;  1MBJ A;  2VUM J;  3S14 J;  3S2D J;  4CYC B;  4B1R A;  1H89 C;  4IHV A;  3L1P A;  2HYJ A;  2Y0S N;  3QPS A;  1RKW A;  3O8H A;  3LSG A;  4J19 A;  2PMZ N;  4XRM A;  4C3H J;  3ZQF A;  3A01 A;  2XPW A;  1JUP A;  3ZQI A;  2ME6 A;  4M3G A;  3PO2 J;  1JT6 A;  2YU9 J;  5EZH A;  3RQI A;  1ZGW A;  3OSF A;  2XGE A;  4X6A J;  1I3Q J;  3VPR A;  5E3M A;  1BW6 A;  2NS7 A;  4MLO A;  4FE4 A;  3HDD A;  1S7E A;  2QF7 A;  1APL C;  3HOZ J;  3HOW J;  2XRL A;  1O4X A;  3BR1 A;  4D5C A;  1JKO C;  3NAR A;  1X58 A;  3K7A J;  2IBD A;  2NOG A;  2R93 J;  3TW6 A;  5DS9 A;  2W48 A;  1MSE C;  1FIA A;  1WI3 A;  5C4J J;  4A3K J;  1U9N A;  2HOA A;  1F43 A;  2DMU A;  2OF7 A;  5FKK A;  2Y30 A;  4IHX A;  4S0H B;  3A01 B;  3ZOB A;  4AC0 A;  1BA5 A;  2X9D A;  4DYC A;  1MSF C;  3QQA A;  5F27 A;  4BY1 J;  3TED A;  2NVX J;  4EEF G;  3DCF A;  1HLV A;  1U8B A;  3BTL A;  1QVT A;  1MNM C;  3WHB A;  1CQT A;  2NVT J;  2HDD A;  9ANT A;  3FIS A;  1T33 A;  2CQQ A;  4DYR A;  5EEA A;  2TRT A;  4MFE A;  2HXI A;  2L0K A;  3BTJ A;  1LE8 B;  2GBY A;  1YRN A;  2FD5 A;  1LFB A;  3NAU A;  4IEJ A;  2LKX A;  1IC8 A;  3I4M J;  2EZK A;  1B72 A;  4RBO A;  4IHY A;  2HXO A;  5C4X J;  2M2E A;  3HGG A;  3CDL A;  1YRN B;  5IOZ A;  1LE8 A;  1MBH A;  4D7M A;  3PM1 A;  3BR6 A;  1AKH B;  1IG7 A;  3RZO J;  4X1E A;  3ZQC A;  4M3E A;  3Q0U A;  2JA5 J;  1DU6 A;  5GPC A;  4QIW N;  3FIW A;  3K2A A;  2FX0 A;  3OIO A;  2K9N A;  2TCT A;  2LY9 A;  2DA1 A;  3BR3 A;  2LTP A;  4XIC A;  5J1Y A;  2YUS A;  1ETV A;  3TP0 A;  2HOT A;  4B4C A;  2DMT A;  2I10 A;  4NDL A;  4W97 A;  1JKR C;  3B6C A;  5JLW A;  1A5J A;  3HBL A;  5FKO A;  3O8G A;  4M3B A;  3LSP A;  3GTQ J;  3HEF A;  3F0C A;  2H8R A;  2E2I J;  2ID6 A;  3FK7 A;  5EZG A;  3GTP J;  2DMN A;  2CU7 A;  5FKL A;  3QPL A;  5K7Z A;  2MG4 A;  2VKV A;  5EGO A;  5E3O A;  3RZD J;  3HGY A;  5C44 J;  1JTY A;  4A3F J;  2P81 A;  4FCY A;  1G2H A;  4MFD A;  1IUF A;  3W6V A;  3A03 A;  1X2N A;  2DTZ A;  3GTL J;  1TWA J;  2CRG A;  1MBK A;  1BW5 A;  1PUF A;  1BJZ A;  2K9Q A;  1ETY A;  4FE7 A;  1GDT A;  2D5V A;  2IEK A;  2ELK A;  3A02 A;  4G12 A;  3CQZ J;  2B63 J;  3FKI J;  1TWG J;  2EZL A;  2E2J J;  3JR9 A;  1F36 A;  4MIM A;  1Z0X A;  2X48 A;  3JRB A;  3S16 J;  2R92 J;  3WHC A;  5FLV A;  3M4O J;  4A3C J;  2DA6 A;  4Y52 J;  4JP0 A;  3BG5 A;  1TWF J;  2LK2 A;  2EZH A;  4BBR J;  4D5F A;  1ETW A;  2ECB A;  3BTI A;  4DYQ A;  4HNV A;  4MO7 A;  2ZB9 A;  1AU7 A;  5K7F A;  2L7F P;  5HOD A;  2XB0 X;  5C3E J;  1K61 A;  1PUF B;  3BG3 A;  3SFI A;  1P7J A;  1XG1 A;  5BNG A;  1JUM A;  1OFC X;  2E19 A;  1P7I A;  5EYR A;  3BR2 A;  1H8A C;  2VKE A;  1WH7 A;  2ME0 A;  5M3F J;  1ZTR A;  3LSR A;  3PO3 J;  1RKT A;  3B6A A;  1D5Y A;  3IH2 A;  1ZKG A;  4JX6 A;  4BY7 J;  3GTO J;  5F0H A;  2WV1 A;  2DA3 A;  2JWT A;  1B8I A;  2E2H J;  2JJ7 A;  5F0C A;  1RET A;  3OOU A;  5FKM A;  2MGQ A;  2LR8 A;  2FQ4 A;  3TW7 A;  1W0T A;  2XGC A;  2AHQ A;  1ETQ A;  2NS8 A;  1FJL A;  4V2F A;  1FIP A;  3HOY J;  1XC5 A;  2M34 A;  4JX5 A;  4C2M J;  3S1M J;  3DEW A;  1FTZ A;  5JLX A;  4QSH A;  3JRH A;  3SJM A;  3MN2 A;  1HCR A;  4UUT A;  2M9H A;  4L5E A;  1VND A;  4DZJ A;  1ZR4 A;  2HI3 A;  5EG0 B;  4A3D J;  2Y9Y A;  1ETO A;  4M3D A;  1HOM A;  4B3A A;  1AKH A;  2XSD C;  1JKP C;  2DMQ A;  3JRC A;  2GM4 A;  1Z77 A;  3RKQ A;  4A3G J;  3IV5 A;  3G1O A;  1ETK A;  1VI0 A;  2CUE A;  4XRS A;  3HB9 A;  4XID A;  2XGD A;  1AHD P;  2Y9Z A;  2IAI A;  2DA4 A;  2L7M P;  2JA6 J;  5IYC J;  4DW6 A;  1JJ6 C;  2DA7 A;  3UKG A;  4XK4 A;  2JA7 J;  2R5Z B;  1I6H J;  4A3M J;  1GV5 A;  1RPW A;  3ZQG A;  4I6Z A;  4A3L J;  4FIS A;  1ETX A;  2R5Y B;  1W0U A;  1T56 A;  1WPK A;  4W1U A;  2R5Z A;  2OPT A;  4JYK A;  2KDZ A;  2K9S A;  1NK2 P;  4AYB N;  2M0C A;  2LD5 A;  1K83 J;  2MW8 A;  3BQZ A;  5E3L A;  2AO9 A;  2O8K A;  1RR7 A;  2Y31 A;  5M3M J;  1GUU A;  2FJ1 A;  3BT9 A;  5K7H A;  4A3E J;  1ZQ3 P;  2QCO A;  1SAN A;  2DN0 A;  4A69 C;  4UUS A;  2NVQ J;  2R7Z J;  2WB1 N;  1JKQ C;  3GTG J;  2L9R A;  2O7O A;  2EH3 A;  5J1U A;  3D1N I;  1TC3 C;  3Q0V A;  2CJJ A;  5FKN A;  2H1K A;  2DA5 A;  4FTH A;  3S1Q J;  3H3V K;  1GVD A;  3MVP A;  5IYD J;  1FTT A;  1HF0 A;  5IP6 A;  5F1J A;  2HOS A;  3LOC A;  1IGN A;  3BTC A;  1HDP A;  3S1N J;  4BKX A;  1EF4 A;  4A3I J;  1VFC A;  1MH4 A;  3FK6 A;  1JUS A;  1LFU P;  3H0G J;  4ABZ A;  1XS9 A;  1GT0 C;  2N8G A;  1UHS A;  5EF6 A;  2VPR A;  3S2H J;  1Q1V A;  2DMP A;  3G1M A;  1HDD C;  3OSG A;  1RES A;  3BG9 A;  3GTJ J;  2XB5 A;  3BR0 A;  1MBF A;  5GP9 A;  4UUS B;  4LOC A;  1B72 B;  2E1O A;  5EDN A;  2NVY J;  1B8I B;  3GTM J;  2JMW A;  2G0E A;  1E3O C;  2VI6 A;  3GBG A;  2JA8 J;  2MSY A;  3M3Y J;  2XPV A;  1WH5 A;  1DU0 A;  1Y1V J;  3SDG A;  2HQ5 A;  2EZI A;  3IH3 A;  2O9L A;  2ID3 A;  3HM5 A;  1QPI A;  5F08 A;  5M5Y J;  1MBE A;  2R5Y A;  2EBI A;  4Y7N J;  3CMY A;  2R0Q C;  1MBG A;  1NK3 P;  3G1L A;  5M5X J;  4BXX J;  5IP9 J;  1OJL A;  1POG A;  4C3I J;  1OCT C;  2KT0 A;  5IYB J;  2CQX A;  1IJW C;  1JTX A;  5IP7 J;  2LVS A;  5GPA A;  1R9T J;  3S1R J;  1U9O A;  3MKL A;  3BR5 A;  3JRA A;  1U78 A;  2WAQ N;  2JK3 A;  2GLO A;  4BBS J;  4C3J J;  5F04 A;  2JN6 A;  2LP0 A;  1MH3 A;  3IH4 A;  2M8G X;  5M5W J;  1GV2 A;  1ZK8 A;  3C2B A;  4M3F A;  5IOY A;  4D7N A;  1ZR2 A;  1TWH J;  5EG0 A;  4RDU A;  3ZQL A;  1JGG A;  1IRZ A;  1QVU A;  1ORK A;  3LNQ A;  3HOV J;  2X6O A;  5F0F A;  1SFO J;  3ZQH A;  4A3J J;  4QTR A;  2K40 A;  3LSJ A;  1BL0 A;  1ENH A;  5EGO B;  4GFB A;  3TP3 A;  2ECC A;  1JT0 A;  1FEX A;  4JX4 A;  4CYC A;  3BQY A;  1WGX A;  2RAE A;  4DZP A;  1IDY A;  2EQR A;  2YS9 A;  5J3L A;  1NTC A;  2DA2 A;  4A3B J;  3Q0W A;  1A6I A;  3GTK J;  5IPA A;  1UG2 A;  3JRG A;  1IDZ A;  2LFB A;  3S17 J;  1UMQ A;  4A93 J; 
#chains in the Genus database with same CATH topology
 4AID A;  3WGG A;  5E20 A;  4N4O B;  4KNY A;  1I5Z A;  2L7Z A;  1F5T A;  4M6V A;  5K5O A;  1K79 A;  1D3Y A;  4AVZ A;  1OYI A;  4Z2Y A;  3OYE A;  5J6X A;  1FMV A;  4LLN A;  2KQR A;  2VN2 A;  3MQ0 A;  2DLL A;  1H88 C;  3P9K A;  4XRS G;  1WCM J;  3OYJ A;  5ILV A;  4HV6 A;  4PCQ A;  3G6E I;  3D0S A;  1Y1W J;  4BE0 A;  2VKH A;  4B09 A;  4BGD A;  3U9G A;  2STT A;  1ITY A;  1ERD A;  2VBW A;  5E3N A;  1WWX A;  2OA4 A;  1HW2 A;  1IN4 A;  1R22 A;  3K4N A;  3PQJ A;  4U0V A;  3S14 J;  2VUM J;  1XX5 A;  2ISZ A;  2X1C A;  4M9S A;  3FZV A;  3FBI B;  4YIR X;  3T0Y A;  3WE3 A;  1ULY A;  3OYL A;  2RVC A;  4UV8 A;  3FXL A;  5CPR B;  4KMU X;  2MC4 A;  4C3H J;  1MMA A;  2H1L A;  1YG2 A;  1GLN A;  1ZAO A;  1JUP A;  1X1P A;  3SHF A;  4D9J A;  3PFY A;  3GFL A;  5DCM B;  3ZQI A;  3HIF A;  1ZRD A;  1FWZ A;  3PO2 J;  3E6B A;  3HSR A;  2XAJ A;  3DPL C;  3F8N A;  1XGM A;  3OWT A;  2DFH A;  4X6A J;  1VQ8 I;  1I3Q J;  2M30 A;  3C2H A;  3OMY A;  3TGN A;  4N4N B;  2DFF A;  4AIH A;  4OIQ F;  1IN6 A;  2V7F A;  4FE4 A;  2GXG A;  3BP8 A;  4EV0 A;  3I3L A;  2VB6 A;  2IS4 A;  3TO7 A;  3EYI A;  3HOW J;  4A6E A;  4D5C A;  3SEQ A;  2K27 A;  2P5L C;  3V7C A;  4PGG A;  4PUS A;  2W84 A;  3TW6 A;  1R7J A;  1R00 A;  1QHH D;  2HZT A;  2HOA A;  2JA2 A;  4R79 A;  2Y30 A;  2GXA A;  4XN0 A;  1BR1 A;  3ZOB A;  2X9D A;  4WXD A;  1DPU A;  2KRH A;  1Y39 A;  5KK1 A;  1MSF C;  4BJ5 C;  2XKP A;  5AIP A;  3TO6 A;  3ZRG A;  4E7H A;  2CFO A;  3FMS A;  3ECH A;  2NVX J;  2ZO4 A;  3GFI A;  4BY1 J;  4EEF G;  5D5X B;  1HLV A;  1O3S A;  1U8B A;  3FBN B;  3F22 A;  3WHB A;  1CQT A;  5HS9 A;  2IW5 A;  1MMG A;  4AD9 A;  4WWC A;  2PBI A;  3KFW X;  1VQ7 I;  2V1N A;  5DDG A;  2RC4 A;  2DYR H;  3CJQ B;  4FQG A;  2F5V A;  3G3Z A;  1TL8 A;  2LKX A;  3RPQ A;  1YS6 A;  3FXM A;  4PJN A;  3T5X A;  2ZCW A;  2HXO A;  3CUQ A;  2BY0 A;  1YRN B;  5J4V A;  3KEQ A;  5IOZ A;  1MBH A;  3I55 I;  3PM1 A;  1NH3 A;  2PMZ A;  3ZQ7 A;  4MGR A;  1X4O A;  3ZQC A;  4E7J A;  2B0L A;  3ABK H;  3VFZ A;  1MIJ A;  4HZF A;  4UVB A;  1WJF A;  4EMS A;  3IKV A;  1V54 H;  2TCT A;  2ESN A;  1J2X A;  2OV7 A;  2WAE A;  2XVC A;  3BR3 A;  3AG4 H;  2CWE A;  2HQR A;  4G94 A;  4CZC A;  4ENM A;  2YUS A;  3TP0 A;  1ODD A;  4CZZ A;  4NDL A;  1W7P D;  2A3S A;  2G7H A;  5JHU A;  2RGV A;  2ZFU A;  4IVN A;  3B6C A;  2OBP A;  4U0W A;  1A31 A;  5FKO A;  4M3B A;  1B59 A;  5FD5 A;  3HEF A;  4HF2 A;  2NS0 A;  2H8R A;  4IQ4 A;  3RYP A;  2ID6 A;  3BLY A;  4UB8 C;  4XLH A;  3MZY A;  3QPL A;  5K7Z A;  2GIZ A;  5EEH A;  2VKV A;  2R7X A;  3ZMZ A;  3H5N A;  2ZJR F;  1OQY A;  2VE9 A;  2K9M A;  1H9T A;  4EAT A;  2XAF A;  3H35 A;  4XRF A;  1N75 A;  4MFD A;  1IUF A;  4LIT A;  3L9F A;  3WGI A;  1Z6T A;  3LQR A;  3GTL J;  5B66 C;  1FLI A;  3FHZ A;  2CFX A;  3K2Z A;  1BJZ A;  1ETY A;  3LFU A;  3GX4 X;  3HJE A;  3A02 A;  1V3F A;  5KVR A;  2RNJ A;  3CQZ J;  2KIS A;  1GVJ A;  3FKI J;  3VYS B;  2EZL A;  4RM3 A;  5E1X A;  3H3U A;  5H6Q A;  2UXN A;  4A2U A;  5L3E A;  4ZH4 F;  2X48 A;  2A61 A;  5CKT A;  2GOM A;  3WU0 A;  5J47 A;  4E7I A;  5BQT A;  3BZC A;  1EA3 A;  2EJR A;  3WHC A;  2JRM A;  4MHG A;  4KDP A;  2DA6 A;  4ESF A;  2QQ8 A;  3BG5 A;  4FT8 A;  1BI3 A;  1JHF A;  2EIJ H;  3BTI A;  5E17 F;  4MO7 A;  4D1Q A;  4UY8 I;  4XBF A;  1N25 A;  3FMQ A;  4XON A;  1HQC A;  2KLO A;  1P7I A;  4XLE A;  2LG4 A;  4Q48 A;  2P7C B;  1LNW A;  3BR2 A;  1H8A C;  1DGR M;  1HXD A;  4ENN A;  3DQV C;  3EPZ A;  2M3A A;  4RS8 A;  3DLA A;  1RR8 C;  2FBK A;  1D5Y A;  1YJN I;  4JX6 A;  1SVM A;  1ACI A;  2BY1 A;  2DA3 A;  5D6E A;  1B8I A;  3HHG A;  1ZG1 A;  1SD4 A;  1WZ2 A;  4XOP A;  4HX7 A;  1PDN C;  1QNT A;  2MGQ A;  1WFX A;  2VBX A;  1FX7 A;  3CC4 I;  1VQ6 I;  3QPT A;  1FOX A;  2CV0 A;  4NQW A;  3HOY J;  1TW3 A;  3RDI A;  3WTY C;  4S04 A;  1BBY A;  2CQ7 A;  3FDY A;  2HS5 A;  2E5Z A;  3JRH A;  2ZJQ F;  3MN2 A;  4BDY A;  4UUT A;  1YHQ I;  1HCR A;  2ZBK A;  2HDC A;  4LJZ F;  4L5E A;  3T8R A;  4XKB A;  2KHM A;  2V26 A;  1Z91 A;  2JPB A;  1ZR4 A;  2DI3 A;  2HI3 A;  2L4A A;  3DTK A;  5H2F C;  4A3D J;  1OLT A;  2Y9Y A;  3ONQ A;  3MKW B;  4IO9 F;  5D4S A;  4HG2 A;  1NG7 A;  3L2C A;  3D5L A;  1F1Z A;  3QP5 A;  5HOO A;  2W57 A;  1JKP C;  4RLF A;  5E79 C;  1HBX G;  5FLX K;  1D0Y A;  2CYY A;  3AG3 H;  3IV5 A;  3COA C;  4QPO A;  4UHT A;  4LG0 A;  1VI0 A;  5TJJ A;  4XRS A;  3SYT A;  4XID A;  2XGD A;  1QA6 A;  2IAI A;  2NRA C;  2A6E F;  2XIG A;  4RB2 C;  1H0M A;  4S05 A;  1BC8 C;  1Z1D A;  2JA6 J;  1VQO I;  2PLY A;  3GXO A;  4R8H A;  2KKO A;  3UKG A;  1S7A A;  4XK4 A;  5CQE A;  4L0Y B;  4EJO A;  2M7B A;  1I6H J;  5BMZ A;  3ZQG A;  3K1N A;  1ETX A;  5CVJ A;  5CQG A;  3WE2 A;  1T56 A;  2PN6 A;  4W1U A;  2J5P A;  1R4N B;  2K9S A;  5D6F A;  1NK2 P;  4NC8 A;  2IGK A;  3OS1 A;  3MMY B;  1Y8R B;  1P4A A;  3BQZ A;  4KIG A;  1R5H A;  4OU0 A;  2O8K A;  5M3M J;  1RC9 A;  1MNE A;  3VSL A;  2FJ1 A;  2STW A;  3BT9 A;  1ZQ3 P;  2NAZ A;  2QCO A;  2COM A;  2WB1 A;  4I02 A;  4A69 C;  3EUH C;  2RRE A;  2L9R A;  2JPC A;  2M8E A;  1TC3 C;  2AS5 F;  2CJJ A;  2FQ3 A;  5FFZ A;  4E7Z A;  4HF0 A;  2VXZ A;  3DP7 A;  1VQM I;  1T95 A;  4KIB A;  1SD5 A;  3H3V K;  3A0B C;  5IYD J;  3BJO A;  2GIV A;  2HOS A;  3JTH A;  2VC1 A;  3I59 A;  4Y4R A;  4ABZ A;  5F1R A;  2ZJ2 A;  1XS9 A;  2N8G A;  1G8X A;  3CTA A;  4NQW B;  1O3Q A;  3IRR A;  3CCM I;  1S9H A;  1SMT A;  2FOK A;  5CLS A;  3RYR A;  4MTD A;  1Q1V A;  4RGR A;  1VQP I;  1KON A;  2E1M B;  4E4H A;  1RES A;  3KP3 A;  2Y0M A;  3OL3 A;  1MBF A;  3PSI A;  1TQI A;  2W82 A;  4WK8 F;  2E1O A;  5CVR A;  1W5S A;  5B5E C;  3GBG A;  2CW7 A;  3M3Y J;  5A2Q Z;  2XPV A;  2KRF A;  1FT9 A;  3BJA A;  3SDG A;  1X19 A;  2EZI A;  2HQ5 A;  3VYT B;  2DPU A;  3KIO A;  2KIU A;  1LUJ B;  1E0E A;  4IHT A;  1D1C A;  1Z6R A;  2ID3 A;  2L9V A;  1X1B A;  2PJR A;  1QPI A;  1KQ8 A;  1SMY F;  2DT7 B;  1MBE A;  2F4M B;  5F64 A;  3RKY A;  3CF2 A;  2R5Y A;  1IF1 A;  3CMY A;  1PUE E;  3F23 A;  2L9S A;  3E3V A;  2F4I A;  3BCA A;  3V4G A;  3C18 A;  2R7V A;  1RIO H;  3MZH A;  1UB9 A;  1X1D A;  2KT0 A;  4RAZ A;  1ZGA A;  3PL8 A;  3F8C A;  4ZYE A;  5LEK A;  2FF4 A;  2LMD A;  4E7K A;  1P92 A;  2QLZ A;  1E3H A;  3BR5 A;  4I0A A;  2BHZ A;  1I1S A;  4IPA A;  2WAQ N;  3OYA A;  4KT6 A;  2FBI A;  3D5S C;  2RQP A;  2X51 A;  1MH3 A;  5KCM A;  4YFK F;  1N77 A;  2UZK A;  1ZK8 A;  2XKO A;  5IOY A;  3ZN1 A;  5IT9 K;  4XKC A;  5IY5 H;  5ICC A;  2R7T A;  3P9I A;  5ILS A;  5E18 F;  4JOM A;  4GO1 A;  1WJD A;  1ORK A;  5LHG A;  1GXP A;  2X6O A;  1P6R A;  5F0F A;  4CCJ A;  3ZQH A;  4QTR A;  5LFA A;  1K78 A;  5EGO B;  4GFB A;  3WU1 B;  2V1U A;  4IOA F;  1MKM A;  2E1C A;  2Z33 A;  4JK1 X;  4TV7 A;  4JX4 A;  3QU6 A;  3GEZ A;  5HDG A;  2BOL A;  2EQR A;  5K1Y A;  2O03 A;  3WTT C;  2DA2 A;  3G2B A;  1PVE A;  4AWX B;  2F2E A;  2LY1 A;  3GTK J;  1EH6 A;  3OYD A;  3PSF A;  1QZZ A;  3JRG A;  2QQ9 A;  2LFB A;  4CA0 A;  2VOP A;  2VJ4 A;  1FPQ A;  3S17 J;  4XNF A;  2Y2Z A;  3Q9V A;  1STZ A;  5GTH C;  3ASO H;  2OZU A;  3E7L A;  1S8N A;  3JRF A;  4I76 A;  3KEY A;  2QSF X;  3HC7 A;  3OYF A;  3CCY A;  1VF9 A;  4CCO A;  2COB A;  3U1K A;  3LWF A;  4L9V A;  1MMN A;  2O0Y A;  3AG2 H;  5D8L B;  1BI2 A;  5FLM J;  4LK1 F;  3K6G A;  1TP4 A;  2Z9O A;  3OR2 C;  5HLG A;  3HOX J;  2QYO A;  4PZJ A;  5J8F A;  4O3M A;  2W1O A;  4I2O A;  5B1B H;  1R6R A;  5GTI C;  3CDI A;  1JJ8 C;  1IV6 A;  2I8D A;  4V2G A;  1V5F A;  1MBJ A;  2IXS A;  1G3S A;  1X3U A;  3DBR B;  3HPH A;  3QYB A;  4R1H A;  3TMO A;  1H89 C;  4PJJ A;  3QPH A;  1SVL A;  3K69 A;  1RKW A;  3O8H A;  1VQL I;  3A0H C;  4NUB A;  4NNJ A;  1XSV A;  3EUK L;  4XRM A;  1I1G A;  3J81 Z;  2VQL A;  2R3S A;  4XSX F;  3C3W A;  1ZYR F;  4AYB A;  3Q9S A;  4HV5 A;  4UNO A;  4PGH A;  3OSF A;  4XLF A;  2XGE A;  3J7A O;  2UV1 A;  4G6Q A;  5E3M A;  3SEZ A;  1T0F C;  1G3Y A;  2ZXH A;  2NS7 A;  1F9N A;  4MLO A;  1QO0 D;  1YTY A;  4M72 A;  2QF7 A;  4KFC A;  3VWB A;  4FX0 A;  2NVU B;  3JAM K;  3DTE A;  4LLG F;  2XRL A;  1A36 A;  1VQ9 I;  4BQA A;  3F8M A;  3VYR B;  1IV8 A;  3VDX A;  1IRF A;  1X58 A;  3K7A J;  2IBD A;  3ZCO A;  3ZMU A;  2Z5U A;  2R93 J;  4IHS A;  5DS9 A;  4FHT A;  4XKV A;  1FIA A;  5C4J J;  4HDV A;  2KIF A;  3BRO A;  5FKK A;  3DKX A;  4XLC A;  3AL0 B;  3LST A;  2BW3 B;  1O7F A;  2HOE A;  3S3M A;  3GZ6 A;  1DPR A;  1DP7 P;  3DF8 A;  5F27 A;  2E60 A;  3TED A;  3DCF A;  4A12 A;  5TIS C;  1QVT A;  1MNM C;  1W7P A;  1T2K A;  4EQQ A;  2XF6 A;  3QWL A;  2V9K A;  4NC6 A;  4Y3O A;  4MFE A;  2Y0S A;  2HXI A;  1YI2 I;  3OYN A;  1VTN C;  4ZDL A;  2EFN A;  1LFB A;  3I4M J;  2LF7 A;  5HVQ C;  1IC8 A;  2VBY A;  4IHY A;  4LG3 A;  2QSG X;  2OQG A;  2V9P A;  5C4X J;  3HGG A;  4EGY A;  1QQI A;  2IJL A;  2MLK A;  3QU3 A;  1LE8 A;  3RTR A;  2R7W A;  3CLQ A;  3Q5F A;  1AKH B;  3RZO J;  4BHC A;  3MCZ A;  2JA5 J;  3CP8 A;  1OYW A;  3AKZ A;  3QRF F;  1KZH A;  4P1W A;  2K9N A;  2ETH A;  3KET A;  2A5W A;  2LY9 A;  3E6M A;  3KZI C;  2Q1Z B;  2LTP A;  2EPF A;  4XIC A;  2H8W A;  5J1Y A;  1ETV A;  3LA3 A;  3F72 A;  4ZYA A;  4BHB A;  4B4C A;  5LEJ A;  1U0J A;  2HOT A;  1BI0 A;  2CO5 A;  3EET A;  5K5Q A;  1FOK A;  2K3F A;  2ZNY A;  3I0T A;  2K86 A;  5JLW A;  4N9I A;  1X1A A;  3W3C A;  1F4K A;  2HQA A;  2NXN B;  1RUN A;  3F6O A;  2MAB A;  3F0C A;  1QGP A;  5KAI C;  4U7B A;  1XB4 A;  3KPH A;  1I27 A;  2A6T A;  1Z05 A;  2OCE A;  4XMY A;  4L0Z B;  2K3P A;  5EZG A;  3J7Z I;  2DMN A;  2CU7 A;  2VT2 A;  5FKL A;  3GTP J;  3KP7 A;  2NYX A;  1CF7 A;  1UFM A;  1X3Z B;  5L3C A;  2HR3 A;  2EA2 A;  2OTL I;  3HGY A;  2A68 F;  4A3F J;  1O3T A;  1P4W A;  1Y8Q B;  3ASN H;  1JI8 A;  3H1C A;  2OTJ I;  4FCY A;  4A93 J;  2B9S A;  3M9A A;  3S93 A;  2DTZ A;  1U5T A;  3NQO A;  1MBK A;  3OV8 A;  4RA2 A;  1TBX A;  1PUF A;  4ESB A;  4G8X A;  2IPQ X;  2KMU A;  2ELK A;  3KCC A;  4CSW A;  3HRU A;  2FBH A;  1MJA A;  4N9H A;  5LRR A;  2JVG A;  3LSI A;  4A5N A;  2EA4 A;  4M9X A;  3GFM A;  5DUI A;  1R5G A;  2A69 F;  3E5Q A;  4XKW A;  3CF5 F;  1OPC A;  3OIP A;  4Y13 A;  2R92 J;  4EJT A;  4L18 B;  3M4O J;  3OYG A;  4CCN A;  1YFH A;  1TWF J;  2LK2 A;  2EZH A;  2X6Y A;  1ETW A;  4WX9 A;  3OYK A;  2CW8 A;  4HNV A;  1S5L C;  5HDN A;  1LEB A;  4Q5S F;  5LHH A;  5HOD A;  2XB0 X;  3R4K A;  3GWZ A;  2FNP A;  1PUF B;  1EJ9 A;  3BG3 A;  2BY2 A;  2QBY A;  1P7J A;  1LQ1 A;  2DXI A;  3TDU C;  2E19 A;  1B1B A;  2HDW A;  2YPR A;  4H0E A;  4X0G A;  2UXX A;  3HG9 A;  1WH7 A;  2RDP A;  2ME0 A;  4IXA A;  5M3F J;  3CCS I;  1T38 A;  3PIP F;  2ZME B;  3BG7 A;  4YG2 F;  2Z3Y A;  3R0J A;  1ZKG A;  1WHU A;  4C30 A;  5F0H A;  1T0F A;  1KYZ A;  2WV1 A;  3IRQ A;  2VOO A;  3L2V A;  3DPT A;  2XSJ C;  5F0C A;  3U1D A;  4JQF A;  3I58 A;  1SFX A;  2LR8 A;  2DW4 A;  1W0T A;  4WXH A;  4ZYH A;  1Z9C A;  2FA5 A;  3PUF A;  3K10 A;  4WXC A;  2MD5 A;  4Y17 A;  1WJC A;  1S6L A;  1XC5 A;  4CYD A;  3QOE A;  2LH9 A;  4C2M J;  5HS7 A;  2BGC A;  5L3F A;  4CGZ A;  1XGS A;  1FTZ A;  1K78 B;  1KQ9 A;  4LGW A;  1JGS A;  2KZV A;  1U2W A;  5LRS A;  3CMM A;  4FAS D;  3J80 Z;  3CD6 I;  1USS A;  1AA7 A;  5DEQ A;  2RV8 A;  3HYI A;  2VBZ A;  3K70 C;  2PQ8 A;  1FC3 A;  2MBF A;  1MMD A;  2PMH A;  1ETO A;  1IUY A;  4UVA A;  1ZG5 A;  1AKH A;  1QPM A;  5CYV A;  2CV2 A;  2DMQ A;  3JRC A;  3LAJ A;  2L54 A;  4RGX A;  3RKQ A;  2JUC A;  3VB2 A;  5FRM A;  2CUE A;  2KJC A;  3HB9 A;  2M45 A;  2Y9Z A;  2IA2 A;  3AAF A;  2DA4 A;  2KP6 A;  3FM3 A;  3MD2 A;  3NEU A;  5DV5 A;  4ENJ A;  2DQL A;  5ICF A;  1W7P B;  1SFK A;  4LD5 A;  1EH8 A;  2ZSI B;  2R5Z B;  3HZJ A;  2H6C A;  1RPW A;  1YW7 A;  1MW7 A;  1O3R A;  3VOE A;  1MDM A;  4ESJ A;  3D5R C;  1KGS A;  5KAF C;  3HL2 A;  1WPK A;  2DBB A;  3TOA A;  3V8L A;  1R71 A;  2F6C A;  1WVR A;  3IAS 2;  3K4J A;  4JYK A;  2KDZ A;  1DDN A;  1J7K A;  3L09 A;  2M0C A;  3M8J A;  2G9W A;  1I39 A;  3FXO A;  4IQJ A;  5E3L A;  4E7S A;  3HHH A;  3OY9 A;  3JSP A;  2AO9 A;  2KDO A;  5JVT A;  2CW0 F;  2EIN H;  1SAN A;  2Q2E B;  1Y56 A;  2NVQ J;  4UUS A;  3S3O A;  2B7E A;  2JUG A;  2WB1 N;  1ZLK A;  3NWT A;  3GTG J;  1K6O A;  1ZEL A;  2O7O A;  2EH3 A;  2ELH A;  3D1N I;  3Q0V A;  1FMW A;  5FKN A;  2FEZ A;  3SQN A;  2DT5 A;  3I9V 2;  2M4K A;  2MLG A;  3S1Q J;  2P8T A;  1GVD A;  3ZMD A;  2JTV A;  1FTT A;  3ZXS A;  1HF0 A;  5D4R A;  4RB0 A;  3QOP A;  1UHM A;  3LOC A;  2EV6 A;  2GA2 A;  1IGN A;  2VXD A;  3S1N J;  1FY7 A;  2R7S A;  1X4P A;  3OYH A;  4A3I J;  1TLH B;  2E1M C;  3H9J A;  1VFC A;  2WC2 A;  1MH4 A;  3CCQ I;  1UEL B;  4A6D A;  2O61 A;  3OS2 A;  1LFU P;  4YFN F;  3A4C A;  5FLX Z;  1V55 H;  2LOO A;  3ROU A;  2BV6 A;  1GT0 C;  2UWM A;  2E36 A;  3F8F A;  1UHS A;  2OUM A;  4ZDP A;  4BJT A;  3CJR B;  3CUO A;  5EF6 A;  5HLI A;  3VSK A;  2IP2 A;  1SC7 A;  3S2H J;  2DMP A;  2VAS A;  3G1M A;  2VJJ A;  3CCR I;  3WTW C;  3BG9 A;  2XB5 A;  4BAY A;  3I71 A;  5GP9 A;  4UUS B;  1B72 B;  4MEX F;  2V4J C;  3QYE A;  2JMW A;  2CUJ A;  2QZ8 A;  2A5Y B;  2G0E A;  4I98 B;  1D5V A;  3MAJ A;  4IKF A;  2W00 A;  1WH5 A;  1RRJ A;  4II3 A;  2LYC A;  3CCU I;  3HPG A;  2MYS A;  2W4S A;  3G4S I;  2DAO A;  3DPU A;  1VQN I;  1SEU A;  2KL4 A;  4BU2 A;  4Y7N J;  4O6J A;  1J5Y A;  2MH2 A;  3G1L A;  5M5X J;  5IP9 J;  1OJL A;  2IA0 A;  1POG A;  2DFE A;  3MFK A;  4RAY A;  1YLF A;  2VC0 A;  4ON0 A;  3JTG A;  2IGM A;  5IP7 J;  2LVS A;  3M8F A;  4LG0 B;  1U9O A;  3MKL A;  3EUA A;  1ZHF A;  2XDV A;  1PYV A;  3FKJ A;  3JRA A;  3WTU C;  1VZ0 A;  1QBJ A;  2XRO A;  1U78 A;  3DLL F;  2JK3 A;  4BBS J;  3BG6 A;  2V6E A;  2KFD A;  2W25 A;  2LP0 A;  4XLN F;  3OYC A;  1YE9 A;  1R5I D;  5LBQ A;  1GV2 A;  4HNT A;  4IRI A;  3FXU A;  4D7N A;  1ZR2 A;  1TWH J;  4FET A;  4BQO A;  4Z6Y A;  1TQP A;  2XAH A;  3ZQL A;  1LFP A;  2DPD A;  2R4G A;  2L5Q A;  1JGG A;  2ZME C;  2L4M A;  3TOB A;  1IRZ A;  2EV0 A;  1QVU A;  1MD0 A;  3KYD B;  3CO7 C;  4FX4 A;  2BVL A;  3SDB A;  1YIJ I;  1WI9 A;  4M74 A;  2D2W A;  4BUP A;  5D8K B;  1BL0 A;  4KN7 X;  2R7F A;  1Z7L A;  2FSW A;  4HBL A;  4KIF A;  5ED4 A;  3ZN0 A;  2WWY A;  4F91 B;  3P7N A;  4L9J A;  5A2Q K;  2X1E A;  2XF5 A;  2VON A;  2RAE A;  2ZFW A;  3PUB A;  2F5D A;  1NTC A;  3OR1 C;  3K4L A;  1TQM A;  4A3B J;  3Q0W A;  4GYI A;  3V8J A;  3H0D A;  1Z3Y A;  3MEX A;  2L02 A;  1UG2 A;  2JSP A;  2WA0 A;  4JBA A;  1XSD A;  2CMP A;  1UMQ A;  3KLN A;  2LLK A;  4GXO A;  3WU2 C;  1TWC J;  4O5V A;  1JE8 A;  4BXU A;  5JR3 A;  4YIF A;  3V7S A;  2BXZ A;  4IHW A;  3SZP A;  1IW7 F;  1W5T A;  5DYM A;  3I56 I;  2I5U A;  3O3K A;  1OCP A;  3JRE A;  3ZR8 X;  2NNN A;  1IN8 A;  2LNB A;  3HOU J;  1A35 A;  2IS6 A;  1O57 A;  2DJN A;  3HSE A;  3P5J A;  5FJ8 J;  1UJ8 A;  2P6S A;  4WF2 A;  3M7G A;  5J1R A;  5JI6 A;  5DTD A;  1LPQ A;  2G7U A;  1QRY A;  4XN3 A;  1ZGJ A;  1SAX A;  4HLY A;  3JRI A;  3PNY A;  1M1E B;  4CYC B;  1WSU A;  1SD6 A;  3WGH A;  2FU4 A;  3L1P A;  2Y0S N;  5F6F A;  4BS9 A;  2K9L A;  1BIA A;  3S8P A;  3QPS A;  4XLP F;  4EVI A;  3E1S A;  3M8E A;  4J19 A;  3LSG A;  2RKH A;  1HW5 A;  2WAF A;  4NBQ A;  2VIX A;  3IWZ A;  3T1B A;  2BE5 F;  4BXF A;  2XPW A;  1WRJ A;  3DWL E;  4M3G A;  1NG6 A;  5EZH A;  1ZGW A;  2TDX A;  3FF5 A;  1CGP A;  1CF7 B;  2DTR A;  1B9N A;  2MA3 A;  2XAS A;  4Y33 A;  2FUG 2;  4ZJZ A;  3HDD A;  1BN5 A;  4ZYD A;  3GF2 A;  4HAM A;  1U5T C;  3QAH A;  1APL C;  4G9Y A;  1IRX A;  3HOZ J;  4GDF A;  3VOD A;  2KZG A;  1LVA A;  2L9N A;  1TZL A;  2NOG A;  2ZXJ A;  1LJ9 A;  3LSH A;  3MKZ A;  3SXY A;  3GZN B;  4A3K J;  3DKY A;  1U9N A;  1F43 A;  2OF7 A;  4IHX A;  3A01 B;  4WCG A;  4L9T A;  2WTE A;  4DYC A;  4C2T A;  3H36 A;  4H4K C;  2R7O A;  4CCM A;  1V5E A;  1A04 A;  2L2O A;  5GAD J;  2Y75 A;  1FNN A;  5IT9 Z;  1C0W A;  3BTL A;  2QEX I;  2HDD A;  9ANT A;  5ILU A;  1T33 A;  4I7H A;  4ZC3 A;  4DYR A;  1ON2 A;  3LA2 A;  1OYY A;  2K85 A;  3ULQ B;  2L0K A;  4HX8 A;  2XV4 S;  4C9Y A;  3KEO A;  4RM2 A;  1LE8 B;  1VQ4 I;  2GBY A;  3UR3 C;  1YRN A;  2FD5 A;  3NAU A;  4IEJ A;  3E5X A;  1B72 A;  2JSC A;  4XOR A;  4IOC F;  2M2E A;  1XDU A;  4BL0 B;  5ICE A;  2VJI A;  4D7M A;  3BR6 A;  4BQQ A;  3EDP A;  3CES A;  1UST A;  3Q0U A;  5AON A;  5D5V B;  4IRG A;  3E0J B;  1K4S A;  1DU6 A;  3E97 A;  2CSO A;  4AIJ A;  2BY3 A;  4BHP A;  3FIW A;  1JXS A;  2FX0 A;  1TT5 B;  1J59 A;  3ABU A;  2ISY A;  3K4C A;  4CDG A;  2HVS A;  3WOD F;  4XR6 A;  4DIQ A;  3BPX A;  4E7L A;  2I10 A;  2BVM A;  3K1M A;  2JT1 A;  3ESW B;  1AWC A;  1KU9 A;  4NB5 A;  3WG7 H;  2CH0 A;  3HSF A;  4W97 A;  1JKR C;  3T8T A;  2YX4 A;  3CP2 A;  2DQR A;  2VJ5 A;  3LSP A;  3M07 A;  1EV7 A;  1ZRE A;  1V5G A;  3KP2 A;  2XF7 A;  4HLX A;  2ZC2 A;  3KP5 A;  3RCO A;  3FK7 A;  2ZNZ A;  2HGC A;  4RAG A;  3CLO A;  1R1T A;  1HST A;  3L7W A;  1R58 A;  3LSK A;  3ZP5 A;  3K1P A;  3R0A A;  2C6Y A;  2PX9 A;  3RZD J;  3K9T A;  2PEX A;  2HWV A;  2YU3 A;  1IO2 A;  4ZZL A;  1AOY A;  2DCE A;  3N05 A;  2ZXI A;  3WTZ A;  1G2H A;  3WTS C;  5LGU A;  5HLT A;  1XTA A;  3A03 A;  4P96 A;  1EKE A;  2CRG A;  3HRS A;  1MDM B;  3FX3 A;  2K7L A;  1BW5 A;  3KZZ A;  2K9Q A;  4FE7 A;  3BOQ A;  2IEK A;  2QWW A;  2D5V A;  3I53 A;  5L3G A;  2B63 J;  3LL7 A;  2XC7 A;  3HOT A;  3PNT A;  1T08 B;  1XMA A;  4DBR A;  1PP7 U;  4MEY F;  3JR9 A;  1F36 A;  3J81 K;  4IX7 A;  3N4M A;  3QYF A;  3ERE D;  4BEH A;  3V42 A;  3ZQQ A;  2ELJ A;  3ZPL A;  3NRV A;  3BCB A;  5ERI A;  1B9M A;  2BXY A;  2X6X A;  4JP0 A;  1BOB A;  4HQM A;  3GCM A;  4BE1 A;  2EFO A;  3H3Z A;  1WKM A;  1YJ9 I;  1W1W E;  3KLO A;  3O6B B;  4ZZD A;  4DYQ A;  1AU7 A;  2RN7 A;  2VQH A;  2L7F P;  3IP4 B;  2QEN A;  5K7F A;  3OOP A;  4BAC A;  5GAE J;  2QVO A;  1OCC H;  3BPV A;  5HLH A;  2YSR A;  3ELK A;  1OFC X;  2H94 A;  5EYR A;  4A5M A;  1D1A A;  1S7O A;  1Z7U A;  1HKS A;  2QQA A;  1J09 A;  3LSR A;  3DTI A;  2HYG D;  2DJI A;  2Z2S B;  4F7Z A;  5J8C A;  1RKT A;  4J01 A;  4U88 A;  2M5W A;  3TQN A;  3B6A A;  3IH2 A;  4PFO A;  1KA8 A;  3GTO J;  1OR7 C;  3PNV A;  2JJ7 A;  4DOZ A;  1RET A;  3OOU A;  1K7A A;  4CHU A;  5FKM A;  3F8B A;  3TW7 A;  2XGC A;  1ETQ A;  2NS8 A;  2XAG A;  4F93 B;  5E1Z B;  1FIP A;  1FOW A;  3W2W A;  1FP1 D;  1OCO H;  1W5C C;  3ERM A;  2Y48 A;  3S1M J;  2CUZ A;  4RAF A;  3DEW A;  3EQL F;  1UZC A;  3LA7 A;  3RPU D;  5JFR A;  4I0B A;  1WQ2 A;  3W2V A;  2QUF A;  3J7A Y;  2P6T A;  1VND A;  2PMU A;  5DD8 A;  2O5R A;  1T98 A;  3TBI A;  3TL4 X;  2QBY B;  5IT3 A;  3WG9 A;  1O7L A;  4BQN A;  1HOM A;  4B3A A;  4J00 A;  3W6K B;  4EJV A;  1G59 A;  4PSX A;  2XSD C;  3FHN A;  3CUQ B;  1S72 I;  4ZYG A;  2GM4 A;  4A3G J;  4AM3 A;  3G1O A;  4U0Y A;  5K5R A;  3FXK A;  1X3W B;  4LLL A;  1MND A;  4YEL A;  5ICG A;  4BEH B;  1SFU A;  3VYU B;  2HVR A;  1YIT I;  4DW6 A;  3M1C A;  5HS8 A;  2DA7 A;  1JJ6 C;  2M87 A;  1J75 A;  1BC7 C;  1Z3X A;  3ML6 A;  1L0O C;  2EFW A;  4A3M J;  1R4M B;  2BZT A;  3RPU A;  3W6J B;  4KUM A;  4A3L J;  4FIS A;  1PJR A;  2R5Y B;  3E6C C;  1W0U A;  1U5T B;  3PJR A;  4Q47 A;  3QP6 A;  3ZMV A;  2AXL A;  2R5Z A;  3M1E A;  4EM1 A;  3HUG B;  2OPT A;  1PP8 F;  2HKX A;  2BHY A;  4UUV A;  3AFH A;  4UVC A;  1G3T A;  2F5F A;  5D5W B;  1G4D A;  1HSJ A;  2OCC H;  4P9U A;  2EB7 A;  4K2E A;  4B3X A;  4RGS A;  2DU9 A;  2Y31 A;  3RKW A;  4GRI A;  4GCV A;  3BJ6 A;  4A3E J;  3UNG C;  4HNU A;  4HDU A;  2DN0 A;  1ZRC A;  2R7Z J;  1JKQ C;  4KYW A;  3G73 A;  3BDD A;  3RSN A;  5J1U A;  4CCK A;  2H1K A;  1R36 A;  2WV0 A;  2OQR A;  4AVP A;  4CXF A;  4G7O F;  3AG1 H;  3HOS A;  3H92 A;  5DCM A;  3GFJ A;  3MVP A;  3J7Y J;  2JVH A;  4AIK A;  1FBQ A;  5F1J A;  1FSH A;  3B73 A;  1UCR A;  1HDP A;  1FOY A;  1EF4 A;  1KYW A;  1UHW A;  2FXA A;  3LSM A;  4II2 A;  3RI4 A;  5DD4 A;  1JUS A;  1LKX A;  3L2R A;  2HVQ A;  4LB6 B;  3GYH X;  3H0G J;  2KIQ A;  3CZ6 A;  1Y0U A;  2AQF A;  5TRD A;  2VPR A;  4HX4 A;  1WJA A;  1IN5 A;  2CGP A;  2ZJP F;  4KT5 C;  3GTJ J;  4CUG A;  3CC7 I;  3BR0 A;  1J9I A;  1HA8 A;  4G7Z F;  1YIO A;  2PG4 A;  3GTM J;  1V4R A;  3CJN A;  2DFI A;  2LRE A;  3BWG A;  4UV9 A;  1IXS B;  2VI6 A;  4UB6 C;  1WJB A;  3OYB A;  3LAP A;  5J40 A;  1DU0 A;  1Y1V J;  2X0L A;  2IRF G;  3ABT A;  2ESH A;  3IH3 A;  1NHA A;  2O9L A;  3QOD A;  5B1A H;  3CCJ I;  1BIB A;  1J0R A;  1D8J A;  1QZY A;  3FXJ A;  5BOX A;  2EBI A;  4F52 A;  1P2F A;  3AL0 C;  2R0Q C;  1MBG A;  4KN4 X;  4DQ2 A;  1NK3 P;  4RGU A;  3GZ5 A;  4A0X A;  2D45 A;  1ON1 A;  2EIL H;  5FO5 A;  2GXB A;  5D5U B;  3G71 I;  1IXR C;  1OCT C;  3CCV I;  2JZY A;  2OZ6 A;  2QSH X;  2VKD A;  3C2G A;  5IYB J;  1Y6I A;  1XD7 A;  2CQX A;  3HTU A;  3I64 A;  1IJW C;  1LDJ A;  3K0L A;  1R9T J;  1KQ0 A;  2M4G A;  2VQG A;  1XPX A;  5FFX A;  4RMN A;  2DOA A;  3HRM A;  2H6B A;  3DFG A;  4NHJ A;  2LDU A;  2GLO A;  2GZW A;  4C3J J;  2FOW A;  5F04 A;  2JN6 A;  5DM7 F;  3IH4 A;  2HTJ A;  4B44 A;  2EV5 A;  2AXT C;  5M5W J;  3IHU A;  3DKW A;  1IZ1 A;  1QHG A;  4HST A;  5EG0 A;  4OMY A;  4RDU A;  4ETS A;  2DK5 A;  1D1B A;  2O6G E;  1W36 C;  4ZDO A;  3RJP A;  1ZG3 A;  2K5C A;  2K40 A;  1ENH A;  1R1V A;  1U6G A;  2VL8 A;  4E6K G;  1Y0N A;  1U3E M;  1YJW I;  2MC3 A;  4Q4Z F;  4BNC A;  3TP3 A;  2HFH A;  1XGO A;  4CYC A;  3BQY A;  2VPL A;  1WGX A;  1EH7 A;  1ZN2 A;  5LHI A;  5J3L A;  2A6H F;  3RKX A;  1ZRF A;  5FRO A;  2XAU A;  4PJL A;  1A6Q A;  1QU3 A;  5B3S H;  2H27 A;  2E71 A;  1IDZ A;  3SZG A;  2R7U A;  3I4N J;  2WY8 Q;  2CUF A;  1G3W A;  1I6X A;  1ZLJ A;  3IL2 A;  3S15 J;  2V1D A;  2XPU A;  1E3P A;  1OR7 A;  3HKZ N;  3U21 A;  2OC6 A;  5LGN A;  3JRD A;  1FYM A;  4OIP F;  1RNL A;  2AQE A;  3IKT A;  1XMX A;  2X4H A;  5CVI A;  4PK4 A;  4AUX A;  1ZH5 A;  5KHD A;  3S32 A;  3WTV C;  2HYF A;  5DUK A;  1LVK A;  4GGG A;  5FGM A;  1SAU A;  3CCE I;  1RUO A;  3Q3S A;  3JAM Z;  2W85 A;  1X2M A;  1I50 J;  4LIV A;  3C7J A;  2PI0 A;  3S2D J;  4KIS A;  2WAD A;  1R23 A;  4B1R A;  3NWS A;  4IHV A;  3GLL A;  2VT3 A;  5TGT A;  2D1V A;  4OAZ A;  2HYJ A;  3FXQ A;  2GQQ A;  1DP3 A;  1VQ5 I;  1YW8 A;  2ICW G;  1N78 A;  3F6V A;  4HSR A;  3E6D A;  1BR2 A;  1BI1 A;  2JRT A;  2CV1 A;  2PMZ N;  3K70 D;  4OAY A;  3CJT B;  2Q0O A;  3KX2 A;  4MNU A;  2P5V A;  3BZ6 A;  3V8K A;  3ZQF A;  1B4A A;  1W36 D;  3A01 A;  2L01 A;  3KYL A;  2ME6 A;  1FP2 A;  2LBF A;  1JT6 A;  2HQN A;  2YU9 J;  3RQI A;  1B6A A;  3I4P A;  4F92 B;  3SZT A;  2E7W A;  2CQN A;  5J4Y A;  4XM3 A;  3VPR A;  1BW6 A;  2LSO A;  2Z16 A;  2E1N A;  3CC2 I;  1S7E A;  2EK5 A;  2V6C A;  1O4X A;  3BR1 A;  4XSZ F;  4XQF A;  1JKO C;  2MH9 A;  3NAR A;  1REP C;  1IRG A;  1R1U A;  1U8R A;  2NNY A;  4RLQ A;  2W48 A;  1MSE C;  1WI3 A;  4E70 A;  2DMU A;  1FZP B;  4P9F A;  1T8I A;  2IS2 A;  1HKT A;  4S0H B;  4AC0 A;  1BA5 A;  2PFB A;  3GUD A;  4G7H F;  3QQA A;  4RB3 C;  3W2A A;  2OD5 A;  4I01 A;  5L3D A;  2E34 A;  5FRN A;  1Z67 A;  4BYY A;  2ZSH B;  2F5E A;  2PJR B;  4AU7 A;  2NVT J;  3ECO A;  2O8X A;  5LGT A;  2P5K A;  2IS1 A;  3FIS A;  2EIM H;  2CQQ A;  4DBQ A;  4MQ9 F;  2RNG A;  2TRT A;  5EEA A;  4B8X A;  4BJ6 C;  1DGW Y;  2P0W A;  1T6S A;  3BTJ A;  2E7X A;  4IZZ A;  2XGX A;  2LKS A;  3ZMT A;  2XUB A;  4MQV A;  2EZK A;  3U2R A;  3CO6 C;  1JHH A;  4RBO A;  3TDZ C;  4EJW A;  3R60 A;  3CDL A;  3C1D A;  4PSW A;  3DEU A;  1IG7 A;  5CVU A;  5E8G A;  4X1E A;  2V9V A;  4M3E A;  4U87 A;  5GPC A;  3K4B A;  4QIW N;  3FXR A;  3K2A A;  1WJ5 A;  5E8I A;  3OIO A;  3I59 B;  5E1W A;  4DJA A;  4HEA 2;  1XMK A;  1WJE A;  2DA1 A;  3ZGK A;  2FNA A;  2XRN A;  3IC7 A;  2DMT A;  1OMI A;  2HU9 A;  3CME I;  5H20 A;  1K6Y A;  3EYY A;  4KIC A;  1S29 A;  5HNF A;  1TNT A;  1R49 A;  4IJA A;  1FSE A;  3DBH B;  3HBL A;  3MZ8 A;  2GWR A;  3O8G A;  3CMA I;  1A5J A;  2KJB A;  4M6Y A;  3GTQ J;  5JHF A;  4BE2 A;  3KP6 A;  2QGU A;  4LFU A;  2E2I J;  4PFP A;  2K4J A;  1KU7 A;  2XAQ A;  3KZY A;  2EFQ A;  1RZ4 A;  2HEO A;  3ABM H;  1MMS A;  3FWE A;  2MG4 A;  4CIC A;  5GAG J;  5E3O A;  4B43 A;  4DGW B;  5EGO A;  5BPI A;  2HKO A;  5C44 J;  1JTY A;  1L3L A;  2P81 A;  2ZKZ A;  1S3J A;  3W6V A;  1X2N A;  4L9N A;  1TWA J;  4ASN A;  2FE3 A;  5L3B A;  1E17 A;  4HW0 A;  3L2Q A;  3B02 A;  1IN7 A;  1GDT A;  4D0P A;  3OL4 A;  4G12 A;  3WTX C;  4G6T B;  4I99 C;  1GHC A;  1TWG J;  1XCV A;  4ZTF A;  3DEE A;  2E2J J;  5DCF A;  4MIM A;  1Z0X A;  1K4T A;  1UAA A;  2YR2 A;  3PIO F;  2A05 A;  2M1B A;  4IL6 C;  1YX3 A;  3JRB A;  3S16 J;  2LKP A;  1DUX C;  2M7A A;  4L5I A;  4EM0 B;  2M0M A;  1TW2 A;  2EIK H;  2IGN A;  5FLV A;  4KMF A;  2VOD A;  4A3C J;  4Y52 J;  1RI7 A;  1SD7 A;  4OWR B;  3JCU C;  1BM9 A;  2QKM B;  3HRT A;  3PFI A;  4HPQ A;  2DOD A;  4BBR J;  4D5F A;  4RB1 A;  3L2U A;  2DT6 A;  2ECB A;  2ZB9 A;  2D1H A;  5C3E J;  5KNL A;  1D0Z A;  4M71 A;  1K61 A;  3SFI A;  2P7V B;  3KE2 A;  1KU2 A;  1XG1 A;  2BEO A;  1JUM A;  3DBL B;  5BNG A;  4CCL A;  3ZMS A;  1LB2 A;  3CUQ C;  4LK0 F;  3IWF A;  2VKE A;  3F3X A;  2IA1 A;  4M6X A;  5CJ9 A;  2CQK A;  1ZTR A;  3OS0 A;  2F48 A;  1XN7 A;  2ACJ A;  3PO3 J;  1YS7 A;  1MJ9 A;  4BY7 J;  5EJC A;  3CCL I;  4P55 A;  3IAM 2;  3JSO A;  4UXN A;  2JWT A;  2ADU A;  2P4W A;  1OCR H;  2E2H J;  3FMR A;  1DQU A;  2FQ4 A;  4HF1 A;  3H9Q A;  4OIO F;  2AHQ A;  1FJL A;  2J5O A;  4V2F A;  4GYG A;  2LC2 A;  2DOE A;  2M34 A;  4JX5 A;  4F3Q A;  2L3D A;  2Z99 A;  1BOA A;  4C2U A;  5JLX A;  1Z21 A;  2BYV E;  4QSH A;  1H9G A;  2DK8 A;  2OJE D;  2DDA A;  2R7Q A;  3SJM A;  2M9H A;  4DNC A;  2LF8 A;  4IRH A;  5HDK A;  4QWQ A;  4DZJ A;  5EG0 B;  1ONV A;  4LIU A;  5FD6 A;  2DO7 A;  1OCZ H;  3DXJ F;  1MZB A;  4M3D A;  3A2K A;  3R6S A;  3EUH A;  1FYL A;  4U7D A;  2V1X A;  4M73 A;  1TNS A;  2E35 A;  2IGO A;  2W7N A;  4XL9 A;  4N0B A;  3H9G A;  4L5J A;  1Z77 A;  2Q2E A;  1BR4 A;  2R7R A;  3KP4 A;  1ETK A;  1OIS A;  3REO A;  1YOV B;  1AHD P;  2LRD A;  4YFX F;  1HKQ A;  2L7M P;  4MTE A;  2HPI A;  1QZE A;  1FYK A;  4P5O A;  5IYC J;  2VQC A;  4KIT B;  2FMY A;  3R61 A;  4XLA A;  3HKZ A;  4LB5 A;  5LD2 C;  3S3N A;  5GAH J;  1YW9 A;  2JA7 J;  4PDK A;  4YII A;  3IUO A;  4I09 A;  3F21 A;  4M9Z A;  1GV5 A;  5LLQ A;  2WAQ A;  3HXL A;  2DDB A;  4KA4 A;  4I6Z A;  2GA1 A;  4EM2 A;  3J80 K;  6PAX A;  2MFZ A;  3GLX A;  4OIR F;  2X1D A;  4ITV A;  2F5C A;  2GAU A;  2FRH A;  2HNH A;  5CVV A;  1MJB A;  2NOJ B;  5BS6 A;  3MWM A;  2K02 A;  3GO5 A;  4PJM A;  4AYB N;  1YQA A;  4BDZ A;  1K83 J;  5EEG A;  4QPQ A;  2HZD A;  2MW8 A;  3L2W A;  2LD5 A;  2PJP A;  5FB2 A;  4ZTJ A;  1RR7 A;  1GUU A;  3VEP A;  5K7H A;  4HOB A;  3H5A A;  4G6D A;  2IT0 A;  3I5U A;  2Q8K A;  3E5U A;  2R7D A;  2EFP A;  2GOX B;  1D0X A;  2X6W A;  5AIQ A;  3O2P E;  2CG4 A;  2DA5 A;  4V19 K;  3HTS B;  2Y69 H;  4FTH A;  2LBF B;  2QKL B;  5BPD A;  4F55 A;  2A07 F;  1FBU A;  3LMM A;  2BBY A;  5IP6 A;  3BY6 A;  3BTC A;  1BJA A;  2L7K A;  4BKX A;  2KIM A;  3GW2 A;  2XHK A;  3RQ4 A;  3FM5 A;  4A0Y A;  4HQE A;  3FK6 A;  2E5N A;  2JQ7 A;  4HRI A;  1Q1H A;  4KJZ A;  2OU2 A;  1D8K A;  4HA8 A;  1T39 A;  3SFZ A;  3A1Y A;  3JW4 A;  1W4M A;  1HDD C;  3OSG A;  2KRC A;  5DM6 F;  4LOC A;  5EDN A;  1SFE A;  2NVY J;  1B8I B;  2OAZ A;  3CDH A;  4YRV A;  1P4X A;  1E3O C;  3V7R A;  2JA8 J;  2EWN A;  2MSY A;  1OKR A;  2ZME A;  3L00 A;  2O3F A;  3ISP A;  2WBM A;  4B47 A;  1TT0 A;  2DYS H;  1UG0 A;  2FML A;  3HM5 A;  2QM3 A;  3HUG A;  3KYC B;  5F08 A;  3X2Q H;  4EJU A;  4XOT A;  5M5Y J;  2K4B A;  3BC8 A;  3PQK A;  2DOF A;  1LEA A;  2VE8 A;  4EGZ A;  3ABL H;  3K4K A;  3LQQ A;  4IF4 A;  2BW3 A;  1YX5 A;  2LY2 A;  4BXX J;  1YYV A;  3RIR A;  2IVM A;  3LFK A;  1ZAR A;  3I54 A;  3OIQ A;  4C3I J;  2WY7 Q;  3OYM A;  4LMY A;  5JVG F;  1JTX A;  2ZXW H;  1P9Q C;  5GPA A;  4Y15 A;  3S1R J;  5H6R A;  1FBS A;  4ENK A;  3GVA A;  4A0Z A;  3MKY B;  3BZK A;  4BH9 A;  4CO8 A;  4NC7 A;  1XCB A;  2F4O B;  2MD0 A;  2HTS A;  1SVO A;  3F9K A;  1KU3 A;  2M8G X;  4M3F A;  3C2B A;  4ANJ A;  4QLC U;  2QQB A;  3DV8 A;  4PJ0 C;  4OIN F;  2X85 A;  4HYE A;  1X1C A;  1IAW A;  5HNH A;  1I3A A;  3P9C A;  3GME A;  1LDK B;  1E2X A;  3LNQ A;  1SFO J;  1LDD A;  1HW1 A;  3HOV J;  3DU6 A;  1YO5 C;  2CS3 A;  4A3J J;  4OOI A;  3LSJ A;  3S2W A;  1VQK I;  3OYI A;  3DU5 A;  3K4M A;  1MGT A;  1HC8 A;  2HPM A;  2KPM A;  2ECC A;  4OMZ A;  3TKY A;  1JT0 A;  1XGN A;  1FEX A;  2UUZ A;  2Z1D A;  4B48 A;  2VLA A;  1XDS A;  2YX7 A;  4DZP A;  3N97 A;  3H5R A;  1IDY A;  2YS9 A;  1G6N A;  1IXC A;  2QA4 I;  4CH7 A;  2W24 A;  1XSX A;  2RQQ A;  1A6I A;  1GXQ A;  5IPA A;  2H09 A;  4YEJ A;  2V79 A;  3TO9 A;  1TTY A; 
#chains in the Genus database with same CATH homology
 2LLK A;  2Y2Z A;  1TWC J;  3I4N J;  2L7Z A;  2CUF A;  4M6V A;  4IHW A;  3E7L A;  3JRF A;  4I76 A;  3S15 J;  2XPU A;  3CCY A;  1OCP A;  3HKZ N;  1VF9 A;  3JRE A;  2COB A;  3JRD A;  1H88 C;  3HOU J;  2DJN A;  4XRS G;  1WCM J;  5FJ8 J;  5FLM J;  1Y1W J;  4AUX A;  5J1R A;  3HOX J;  1ITY A;  5DTD A;  5E3N A;  1QRY A;  1JJ8 C;  3Q3S A;  1IV6 A;  4V2G A;  1X2M A;  3JRI A;  1I50 J;  1MBJ A;  2VUM J;  3S14 J;  3S2D J;  4CYC B;  4B1R A;  1H89 C;  4IHV A;  3L1P A;  2HYJ A;  2Y0S N;  3QPS A;  1RKW A;  3O8H A;  3LSG A;  4J19 A;  2PMZ N;  4XRM A;  4C3H J;  3ZQF A;  3A01 A;  2XPW A;  1JUP A;  3ZQI A;  2ME6 A;  4M3G A;  3PO2 J;  1JT6 A;  2YU9 J;  5EZH A;  3RQI A;  1ZGW A;  3OSF A;  2XGE A;  4X6A J;  1I3Q J;  3VPR A;  5E3M A;  1BW6 A;  2NS7 A;  4MLO A;  4FE4 A;  3HDD A;  1S7E A;  2QF7 A;  1APL C;  3HOZ J;  3HOW J;  2XRL A;  1O4X A;  3BR1 A;  4D5C A;  1JKO C;  3NAR A;  1X58 A;  3K7A J;  2IBD A;  2NOG A;  2R93 J;  3TW6 A;  5DS9 A;  2W48 A;  1MSE C;  1FIA A;  1WI3 A;  5C4J J;  4A3K J;  1U9N A;  2HOA A;  1F43 A;  2DMU A;  2OF7 A;  5FKK A;  2Y30 A;  4IHX A;  4S0H B;  3A01 B;  3ZOB A;  4AC0 A;  1BA5 A;  2X9D A;  4DYC A;  1MSF C;  3QQA A;  5F27 A;  4BY1 J;  3TED A;  2NVX J;  4EEF G;  3DCF A;  1HLV A;  1U8B A;  3BTL A;  1QVT A;  1MNM C;  3WHB A;  1CQT A;  2NVT J;  2HDD A;  9ANT A;  3FIS A;  1T33 A;  2CQQ A;  4DYR A;  5EEA A;  2TRT A;  4MFE A;  2HXI A;  2L0K A;  3BTJ A;  1LE8 B;  2GBY A;  1YRN A;  2FD5 A;  1LFB A;  3NAU A;  4IEJ A;  2LKX A;  1IC8 A;  3I4M J;  2EZK A;  1B72 A;  4RBO A;  4IHY A;  2HXO A;  5C4X J;  2M2E A;  3HGG A;  3CDL A;  1YRN B;  5IOZ A;  1LE8 A;  1MBH A;  4D7M A;  3PM1 A;  3BR6 A;  1AKH B;  1IG7 A;  3RZO J;  4X1E A;  3ZQC A;  4M3E A;  3Q0U A;  2JA5 J;  1DU6 A;  5GPC A;  4QIW N;  3FIW A;  3K2A A;  2FX0 A;  3OIO A;  2K9N A;  2TCT A;  2LY9 A;  2DA1 A;  3BR3 A;  2LTP A;  4XIC A;  5J1Y A;  2YUS A;  1ETV A;  3TP0 A;  2HOT A;  4B4C A;  2DMT A;  2I10 A;  4NDL A;  4W97 A;  1JKR C;  3B6C A;  5JLW A;  1A5J A;  3HBL A;  5FKO A;  3O8G A;  4M3B A;  3LSP A;  3GTQ J;  3HEF A;  3F0C A;  2H8R A;  2E2I J;  2ID6 A;  3FK7 A;  5EZG A;  3GTP J;  2DMN A;  2CU7 A;  5FKL A;  3QPL A;  5K7Z A;  2MG4 A;  2VKV A;  5EGO A;  5E3O A;  3RZD J;  3HGY A;  5C44 J;  1JTY A;  4A3F J;  2P81 A;  4FCY A;  1G2H A;  4MFD A;  1IUF A;  3W6V A;  3A03 A;  1X2N A;  2DTZ A;  3GTL J;  1TWA J;  2CRG A;  1MBK A;  1BW5 A;  1PUF A;  1BJZ A;  2K9Q A;  1ETY A;  4FE7 A;  1GDT A;  2D5V A;  2IEK A;  2ELK A;  3A02 A;  4G12 A;  3CQZ J;  2B63 J;  3FKI J;  1TWG J;  2EZL A;  2E2J J;  3JR9 A;  1F36 A;  4MIM A;  1Z0X A;  2X48 A;  3JRB A;  3S16 J;  2R92 J;  3WHC A;  5FLV A;  3M4O J;  4A3C J;  2DA6 A;  4Y52 J;  4JP0 A;  3BG5 A;  1TWF J;  2LK2 A;  2EZH A;  4BBR J;  4D5F A;  1ETW A;  2ECB A;  3BTI A;  4DYQ A;  4HNV A;  4MO7 A;  2ZB9 A;  1AU7 A;  5K7F A;  2L7F P;  5HOD A;  2XB0 X;  5C3E J;  1K61 A;  1PUF B;  3BG3 A;  3SFI A;  1P7J A;  1XG1 A;  5BNG A;  1JUM A;  1OFC X;  2E19 A;  1P7I A;  5EYR A;  3BR2 A;  1H8A C;  2VKE A;  1WH7 A;  2ME0 A;  5M3F J;  1ZTR A;  3LSR A;  3PO3 J;  1RKT A;  3B6A A;  1D5Y A;  3IH2 A;  1ZKG A;  4JX6 A;  4BY7 J;  3GTO J;  5F0H A;  2WV1 A;  2DA3 A;  2JWT A;  1B8I A;  2E2H J;  2JJ7 A;  5F0C A;  1RET A;  3OOU A;  5FKM A;  2MGQ A;  2LR8 A;  2FQ4 A;  3TW7 A;  1W0T A;  2XGC A;  2AHQ A;  1ETQ A;  2NS8 A;  1FJL A;  4V2F A;  1FIP A;  3HOY J;  1XC5 A;  2M34 A;  4JX5 A;  4C2M J;  3S1M J;  3DEW A;  1FTZ A;  5JLX A;  4QSH A;  3JRH A;  3SJM A;  3MN2 A;  1HCR A;  4UUT A;  2M9H A;  4L5E A;  1VND A;  4DZJ A;  1ZR4 A;  2HI3 A;  5EG0 B;  4A3D J;  2Y9Y A;  1ETO A;  4M3D A;  1HOM A;  4B3A A;  1AKH A;  2XSD C;  1JKP C;  2DMQ A;  3JRC A;  2GM4 A;  1Z77 A;  3RKQ A;  4A3G J;  3IV5 A;  3G1O A;  1ETK A;  1VI0 A;  2CUE A;  4XRS A;  3HB9 A;  4XID A;  2XGD A;  1AHD P;  2Y9Z A;  2IAI A;  2DA4 A;  2L7M P;  2JA6 J;  5IYC J;  4DW6 A;  1JJ6 C;  2DA7 A;  3UKG A;  4XK4 A;  2JA7 J;  2R5Z B;  1I6H J;  4A3M J;  1GV5 A;  1RPW A;  3ZQG A;  4I6Z A;  4A3L J;  4FIS A;  1ETX A;  2R5Y B;  1W0U A;  1T56 A;  1WPK A;  4W1U A;  2R5Z A;  2OPT A;  4JYK A;  2KDZ A;  2K9S A;  1NK2 P;  4AYB N;  2M0C A;  2LD5 A;  1K83 J;  2MW8 A;  3BQZ A;  5E3L A;  2AO9 A;  2O8K A;  1RR7 A;  2Y31 A;  5M3M J;  1GUU A;  2FJ1 A;  3BT9 A;  5K7H A;  4A3E J;  1ZQ3 P;  2QCO A;  1SAN A;  2DN0 A;  4A69 C;  4UUS A;  2NVQ J;  2R7Z J;  2WB1 N;  1JKQ C;  3GTG J;  2L9R A;  2O7O A;  2EH3 A;  5J1U A;  3D1N I;  1TC3 C;  3Q0V A;  2CJJ A;  5FKN A;  2H1K A;  2DA5 A;  4FTH A;  3S1Q J;  3H3V K;  1GVD A;  3MVP A;  5IYD J;  1FTT A;  1HF0 A;  5IP6 A;  5F1J A;  2HOS A;  3LOC A;  1IGN A;  3BTC A;  1HDP A;  3S1N J;  4BKX A;  1EF4 A;  4A3I J;  1VFC A;  1MH4 A;  3FK6 A;  1JUS A;  1LFU P;  3H0G J;  4ABZ A;  1XS9 A;  1GT0 C;  2N8G A;  1UHS A;  5EF6 A;  2VPR A;  3S2H J;  1Q1V A;  2DMP A;  3G1M A;  1HDD C;  3OSG A;  1RES A;  3BG9 A;  3GTJ J;  2XB5 A;  3BR0 A;  1MBF A;  5GP9 A;  4UUS B;  4LOC A;  1B72 B;  2E1O A;  5EDN A;  2NVY J;  1B8I B;  3GTM J;  2JMW A;  2G0E A;  1E3O C;  2VI6 A;  3GBG A;  2JA8 J;  2MSY A;  3M3Y J;  2XPV A;  1WH5 A;  1DU0 A;  1Y1V J;  3SDG A;  2HQ5 A;  2EZI A;  3IH3 A;  2O9L A;  2ID3 A;  3HM5 A;  1QPI A;  5F08 A;  5M5Y J;  1MBE A;  2R5Y A;  2EBI A;  4Y7N J;  3CMY A;  2R0Q C;  1MBG A;  1NK3 P;  3G1L A;  5M5X J;  4BXX J;  5IP9 J;  1OJL A;  1POG A;  4C3I J;  1OCT C;  2KT0 A;  5IYB J;  2CQX A;  1IJW C;  1JTX A;  5IP7 J;  2LVS A;  5GPA A;  1R9T J;  3S1R J;  1U9O A;  3MKL A;  3BR5 A;  3JRA A;  1U78 A;  2WAQ N;  2JK3 A;  2GLO A;  4BBS J;  4C3J J;  5F04 A;  2JN6 A;  2LP0 A;  1MH3 A;  3IH4 A;  2M8G X;  5M5W J;  1GV2 A;  1ZK8 A;  3C2B A;  4M3F A;  5IOY A;  4D7N A;  1ZR2 A;  1TWH J;  5EG0 A;  4RDU A;  3ZQL A;  1JGG A;  1IRZ A;  1QVU A;  1ORK A;  3LNQ A;  3HOV J;  2X6O A;  5F0F A;  1SFO J;  3ZQH A;  4A3J J;  4QTR A;  2K40 A;  3LSJ A;  1BL0 A;  1ENH A;  5EGO B;  4GFB A;  3TP3 A;  2ECC A;  1JT0 A;  1FEX A;  4JX4 A;  4CYC A;  3BQY A;  1WGX A;  2RAE A;  4DZP A;  1IDY A;  2EQR A;  2YS9 A;  5J3L A;  1NTC A;  2DA2 A;  4A3B J;  3Q0W A;  1A6I A;  3GTK J;  5IPA A;  1UG2 A;  3JRG A;  1IDZ A;  2LFB A;  3S17 J;  1UMQ A;  4A93 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...