4L9JA

Crystal structure of s. aureus mepr in dna-binding conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 40
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9jA00
4S05A 2RQPA 4M71A 3I64A 3RTRA 3U2RA 1O3QA 4L9NA 2DPUA 2ESNA 2ACJA 4KN4X 3KLNA 3FMSA 2Y75A 3O2PE 1G3SA 2RVCA 2G9WA 1YLFA 2BGCA 2PG4A 5HS8A 1FYMA 1F9NA 3KP6A 3ERED 1P92A 1XMKA 2W84A 4KMUX 3EDPA 4A0ZA 4U7BA 1BBYA 1W7PB 5FGMA 1I1GA 5HS9A 5LEKA 3BROA 3U1DA 1I5ZA 2P5LC 2M1BA 1LDDA 1Z1DA 3K0LA 2G7HA 2A07F 5FD6A 4B8XA 4FHTA 1FT9A 3I0TA 4LGWA 3VFZA 2E1CA 4ETSA 1BIBA 4LB5A 3V8LA 4HW0A 2H27A 2UXXA 3GWZA 3LQQA 1YTYA 3FM3A 1KU2A 2IRFG 4HX7A 3EQLF 4H0EA 3TO7A 3EYIA 1B6AA 1LDKB 3BP8A 2STTA 1BI0A 3L00A 3WE3A 4YFXF 1I27A 5H20A 4IHTA 1XDSA 2ESHA 1FY7A 4KYWA 3MWMA 3DXJF 2FMYA 2WC2A 1ZH5A 5EEGA 2EFNA 2OQRA 5DUKA 1YS7A 2OA4A 2MBFA 1K7AA 4K2EA 4M9XA 2VT2A 4HX8A 2P6TA 3NQOA 3R61A 4F7ZA 1YS6A 4HX4A 4G9YA 4P96A 5CYVA 4GYIA 4L5IA 3MEXA 1YG2A 1DDNA 3KE2A 2EK5A 4BYYA 1OYYA 2FNAA 4RB1A 3V7SA 5F64A 2ZXJA 5CVJA 3E97A 1FYKA 4HDUA 1LJ9A 2QWWA 3MZHA 2W85A 2FSWA 3CDHA 2EA2A 3ZMDA 4AIHA 1HSTA 2EFQA 2Z99A 2MLKA 1FP1D 2QENA 1BIAA 1JXSA 2IVMA 3M7GA 5DCMA 4P9UA 4XSXF 3E6DA 2HQNA 4OIQF 1S7AA 4BXUA 5TRDA 2FRHA 2G7UA 3V8KA 4R1HA 3W6KB 2PJPA 3T8TA 4KT5C 2VBWA 1W4MA 4FX4A 3T1BA 1WRJA 2PMUA 1CF7A 3R4KA 5FLXZ 2Z3YA 4G6DA 5L3DA 1IN8A 2XAHA 1FOKA 2VOPA 2HEOA 1H0MA 2HOEA 1BC7C 2ZBKA 3BZ6A 4UV9A 1IW7F 4OIOF 4HLXA 3TO9A 4AWXB 3LWFA 3WTWC 2NAZA 4RGUA 1PUEE 2CG4A 1I6XA 1S8NA 1HW2A 2QZ8A 4XSZF 1U3EM 2MLGA 3WG9A 1SAXA 3PQJA 5IT9Z 3WTYC 5H6RA 2HTSA 3I58A 2EFPA 2KJCA 2FBKA 5DV5A 1FLIA 1MJBA 5LHIA 4UXNA 1STZA 2PBIA 4ENMA 3SXYA 2KIUA 3O6BB 2HR3A 2OQGA 3J81Z 5HLHA 1R1TA 5E1ZB 3IKTA 2RGVA 2O3FA 1KGSA 2EV6A 1ZRCA 2K02A 5DCMB 1W5SA 2VODA 3E3VA 2EA4A 1J7KA 2Q2EA 1A04A 2A6EF 4U0VA 4LK0F 5E17F 1BJAA 4LLGF 2STWA 2COMA 4MNUA 5JFRA 2BE5F 1EH7A 1YYVA 2Q8KA 4G7HF 1TNSA 4N9IA 2P5VA 1WKMA 4RS8A 2HTJA 2MH9A 1S29A 5ED4A 1FSEA 1CGPA 1XGOA 3J7AO 2OZUA 4Q5SF 2GIVA 1SFXA 2HQRA 2KKOA 1FZPB 4G7OF 2FQ3A 3QU6A 3Q9SA 2LF8A 5L3EA 2JPBA 3V7CA 2YX7A 2XIGA 4A12A 1O3SA 4A5NA 1PDNC 1KU3A 1OKRA 2EFWA 2DAOA 2P7CB 4YIIA 2BYVE 2HGCA 2RNJA 3R0JA 3KCCA 4ENKA 1T2KA 2HS5A 5L3CA 2UWMA 3RDIA 4MTEA 1ZGJA 3GW2A 2H6BA 1P6RA 1Q1HA 1KU7A 3DKWA 5D4RA 1REPC 2VC0A 2V1DA 2CO5A 3C3WA 1ZLJA 3DFGA 5ICCA 4ZYEA 1TQPA 1ZLKA 2PLYA 4BNCA 4KIGA 2IA2A 3R0AA 1GHCA 1EH8A 3CJNA 2DBBA 1USSA 1B4AA 4CXFA 1EV7A 4A6EA 2O61A 4M9ZA 1WQ2A 1L3LA 2QQAA 1R22A 5LBQA 4FT8A 4I98B 4KIBA 2XKOA 4YFKF 4IRGA 3F72A 2GA2A 1KA8A 2IPQX 4MHGA 2HWVA 4QWQA 4GCVA 3QP5A 3WTVC 2W25A 1IRGA 1IZ1A 3HRMA 5KK1A 4O6JA 4M6XA 4UVCA 4AIKA 3FXQA 2OU2A 3V8JA 4Y13A 1D8JA 4NHJA 1LEBA 1B1BA 2WV0A 4ESJA 3NEUA 1XGSA 5DD4A 4JQFA 2XROA 4EM0B 3LA2A 3RI4A 3ZMVA 3Q9VA 3COAC 3F6OA 1U5TC 5EEHA 3CUQA 1T39A 4WXCA 4LD5A 1J75A 4KA4A 1J0RA 3HYIA 2FOKA 3ZMTA 3RYRA 1S6LA 2YSRA 5CVIA 1O3TA 3EETA 4KUMA 3BWGA 2BBYA 4KFCA 5D5WB 4OMZA 3F6VA 2QYOA 1HQCA 5E20A 4HAMA 2D1VA 5E1WA 1D5VA 2O03A 3TKYA 4PGGA 3IL2A 4EJTA 3K2ZA 1R5HA 2IT0A 3D5LA 1FPQA 2F5CA 4Y15A 3WTXC 4UUVA 1UHWA 4AD9A 5D5UB 3HTSB 1MJ9A 4BHBA 3WTTC 1YW9A 3KEQA 5F1RA 4CZZA 4HBLA 1LB2A 3L9FA 1ZREA 4EMSA 2VT3A 2K27A 2E1NA 1IN6A 5ICGA 1SD5A 2HKOA 1HBXG 2DTRA 2KIMA 1J5YA 1ZAOA 3QPTA 2K4BA 3WTUC 1OPCA 4FX0A 3GO5A 4NB5A 2DQRA 4MEYF 2XUBA 5FB2A 4YG2F 1E17A 4I09A 3CUQB 5JVTA 4S04A 5FD5A 4YFNF 2W24A 1U8RA 4OIPF 1YW8A 4I2OA 3V7RA 1G3WA 1O7LA 3F8BA 3JW4A 3TQNA 5K5RA 3ROUA 2XAJA 1F1ZA 3E6MA 3DPLC 4A2UA 1GVJA 2HZTA 4AVPA 3KP2A 4EJOA 1IN4A 3DPTA 4G94A 4L0ZB 4I7HA 5TJJA 1FBUA 4LG0B 1ZRDA 4RGXA 2EWNA 4I0BA 4D0PA 2QLZA 1SFUA 2DPDA 3R60A 4HOBA 3F8FA 4MEXF 1WWXA 2L54A 1HKTA 3JAMK 5BPIA 2NYXA 1G3YA 2DFIA 2LNBA 3DV8A 3RPUA 4PZJA 1TTYA 1ZRFA 4PGHA 3DEUA 3I5UA 1R1UA 2F5EA 4GGGA 4HF1A 3RYPA 2XAQA 3J80Z 4EM2A 3JTGA 2ZO4A 4N0BA 3WODF 4U0YA 3TDUC 4OMYA 4ZZLA 2Y0MA 4Q47A 4GXOA 1XN7A 1SD7A 2IP2A 5LEJA 2JT1A 3QOPA 1DPRA 4LFUA 4N9HA 2O8XA 1U2WA 2RV8A 2GQQA 3F22A 3NRVA 4CYDA 3L2CA 2FF4A 4HQMA 3K1MA 2HYFA 3EUHA 1K79A 2VC1A 3I71A 1DUXC 2O6GE 2GXBA 3HRTA 1R7JA 2ZMEA 3KP5A 1TQIA 4IRIA 3CO6C 1Z7UA 2QBYA 1IXRC 5DYMA 1FBSA 2DLLA 5LHGA 2VN2A 1HKQA 4IPAA 3MQ0A 4P55A 4KN7X 5AIQA 1IF1A 3H3UA 4HDVA 4CGZA 4I02A 3TGNA 4KDPA 2AXLA 2XVCA 1T98A 1R00A 2EV0A 4MGRA 1ON1A 1FC3A 1MDMB 5DUIA 3WU1B 1KU9A 1P4WA 3N4MA 3IRRA 1QNTA 3SHFA 4WK8F 4PCQA 4TV7A 4YIFA 2ZKZA 2VE9A 5HOOA 5L3GA 3KFWX 4DNCA 2FE3A 3VB2A 3KP3A 3ZMZA 1MKMA 5DEQA 2VE8A 3ISPA 4B09A 4UNOA 4XBFA 4L9JA 2VBYA 1JHHA 1TNTA 3HRSA 1DPUA 1YIOA 4LB6B 1UFMA 2FEZA 4WXDA 3L09A 1WSUA 1FX7A 2OBPA 1ZG1A 2P6SA 3IRQA 3BJOA 4WWCA 1ONVA 1Z9CA 3P9KA 2ZMEB 4EM1A 4GYGA 2PN6A 3REOA 2UXNA 4ZYHA 4ESBA 5LRSA 2QBYB 3M8EA 2ZFWA 4OIRF 2WWYA 3KZZA 1BI3A 2HDCA 3P7NA 3SZPA 1HKSA 3SFZA 1SD4A 1LNWA 4MTDA 1P4AA 5BMZA 2J5OA 5JR3A 4HQEA 1ZG3A 5BOXA 4O5VA 2PFBA 5BPDA 1SMTA 2CGPA 3HHHA 2K4JA 4JK1X 1SD6A 4A0XA 3E6CC 3HRUA 1LQ1A 5ERIA 5ICEA 1XD7A 1E2XA 1UCRA 3TOAA 1BN5A 2XRNA 2O0YA 4UVBA 3RKYA 1UHMA 4LK1F 3KEOA 2RDPA 3P9CA 2OAZA 3IWFA 5ILUA 3E6BA 3JSPA 1HXDA 4M72A 2GAUA 1VTNC 4HZFA 4HF0A 1QPMA 5HS7A 3LSTA 5LGNA 3GVAA 5LLQA 1EH6A 1ON2A 3EYYA 3WGGA 2L4AA 2ZNYA 5FFXA 1YO5C 1TW3A 1F5TA 3CUQC 3V4GA 1BI2A 3GFMA 3WGIA 2P5KA 1XDUA 2HYGD 5FO5A 1USTA 2XHKA 1KQ8A 4RGSA 5JHUA 2XGXA 1GXQA 1FWZA 3F3XA 4WX9A 3WE2A 2M87A 4CDGA 4L18B 3PQKA 2FU4A 4CHUA 5A2QZ 2EV5A 1ODDA 3KP7A 2KIFA 3ZP5A 3G73A 3HOSA 1MZBA 3FF5A 5BQTA 5IT9K 3K1PA 3ECOA 2RKHA 2PI0A 1FYLA 1SFEA 3TO6A 3N97A 2JZYA 3FMQA 4Y17A 2VOOA 4RAZA 2MA3A 3FMRA 1T0FA 1BC8C 1T6SA 1K6OA 3M9AA 3HHGA 3J81K 2NRAC 4OU0A 4G6QA 2NNNA 3C1DA 5HLGA 4RB3C 1IXSB 1IN7A 3F8NA 4IVNA 2P8TA 2F2EA 4ASNA 3I54A 2BV6A 2M8EA 5E8IA 5DD8A 2UZKA 4R8HA 4RB0A 3CO7C 5BS6A 3KLOA 2FBHA 3FHZA 1LEAA 1W5TA 1TLHB 1BI1A 1WI9A 2QUFA 3IC7A 4P5OA 3LQRA 3GYHX 2Y48A 5CLSA 2D1HA 4ZYDA 2FXAA 3HSFA 3LA3A 2GWRA 4Q4ZF 1XSVA 2M30A 4BHCA 3OV8A 2KRFA 1B9NA 1L0OC 4LG0A 3JSOA 2V1XA 1RIOH 1ZYRF 1O3RA 3MCZA 4IJAA 1HSJA 5D5XB 2WTEA 1ZHFA 5J8FA 3JTHA 5K1YA 5L3BA 2H09A 1QZYA 5HLIA 4KMFA 4U7DA 1J2XA 2DK8A 2F5DA 4HF2A 4A0YA 3GFJA 1FNNA 4WF2A 4RB2C 5ILVA 2XASA 3KETA 3LAJA 2F5FA 5HVQC 5J6XA 1B59A 1JGSA 1GXPA 3G3ZA 2XKPA 1FBQA 1R5GA 1XB4A 1MJAA 2V6CA 3B02A 3AAFA 2R7DA 1RUOA 4P9FA 2AS5F 2M5WA 2DT5A 3U9GA 1IUYA 3W6JB 3QRFF 2E7WA 1U78A 2H94A 3WTSC 2K86A 3HOTA 4M6YA 4BHPA 3HIFA 1YFHA 3T0YA 4IF4A 4XLPF 3S2WA 1ZARA 3M8FA 2A69F 3WGHA 3D0SA 1T38A 1U5TA 4KICA 1G4DA 5J8CA 5HDKA 1ZGAA 2A61A 3RKXA 3FZVA 3GF2A 2A68F 4GO1A 2C6YA 1Z05A 4ENJA 2FA5A 2IA1A 2FMLA 4BAYA 5D5VB 2K7LA 4IHSA 1XMAA 3GFIA 1ZG5A 2A3SA 4M74A 2H6CA 3B73A 2XV4S 3ULQB 2LSOA 3I53A 2NNYA 2DO7A 3O3KA 3FXUA 4Z2YA 3GZ5A 4ZZDA 3FX3A 3IHUA 2L3DA 1IRFA 5E1XA 3BJAA 2V79A 2IJLA 3CTAA 4EJVA 1Z6RA 4EJUA 5CVRA 3ZN1A 2LDUA 1NHAA 4L9TA 1P2FA 3ZMUA 3GX4X 2QQBA 1G6NA 2VONA 5JI6A 4AIJA 3GUDA 2JRTA 1RNLA 4LJZF 3DP7A 2DK5A 1MDMA 4PDKA 4NQWA 5D6FA 4ZYGA 4ZH4F 2PEXA 3MAJA 4ENNA 2W57A 3T5XA 5E8GA 3ZQ7A 3SQNA 4I01A 4G7ZF 1U5TB 3VODA 3K9TA 5E18F 5K5OA 5D4SA 1QQIA 2VBXA 2EB7A 2DW4A 2P4WA 5CVUA 2D45A 3M1EA 3OOPA 1FSHA 3E5XA 2GA1A 2DI3A 2MH2A 4HYEA 3F8MA 1S7OA 3BPVA 2CW0F 1RZ4A 3L7WA 1KQ9A 3ABUA 1K78A 2X0LA 1QGPA 1FP2A 4G8XA 3I4PA 4HV6A 4A5MA 4ESFA 2QVOA 3H92A 3TOBA 2CWEA 1UB9A 3RJPA 4R79A 3QU3A 5F6FA 2DU9A 1KYZA 2J5PA 1BOAA 2DQLA 2YU3A 4HV5A 2HFHA 2NS0A 2JPCA 5HDGA 1SMYF 2QQ9A 2VBZA 3HTUA 3C7JA 2IW5A 2XAGA 1ZN2A 4Q48A 1TQMA 1X3UA 4MQVA 3QPHA 4IXAA 5DCFA 2V9VA 4LMYA 4U88A 4M9SA 3BOQA 1P4XA 2M45A 3LA7A 1Y0UA 4BQAA 3ELKA 4RAYA 5ICFA 3QP6A 3FXRA 1KYWA 4L0YB 2IA0A 3ZMSA 2Z5UA 3Q5FA 1J59A 1IN5A 1QBJA 4CO8A 5LRRA 1XCVA 2L02A 4U0WA 3J80K 3GXOA 2CQKA 2ISYA 2L4MA 3H3ZA 2LKPA 5LGTA 1K78B 3QAHA 3GLXA 5K5QA 4BH9A 4UVAA 5KVRA 3LAPA 3F21A 2OD5A 2QM3A 2ELHA 3ML6A 3HSEA 2ADUA 1DP7P 4OOIA 2ETHA 2P7VB 1RUNA 2JSCA 5ILSA 5LGUA 1Z91A 3CUOA 2YX4A 1ULYA 3WTZA 4XLNF 1XSXA 4EVIA 4QLCU 1XGNA 2A5YB 1R58A 1CF7B 2Q0OA 3IKVA 4M73A 2R3SA 4E70A 1Z6TA 3PFIA 4EGYA 3E5UA 4UHTA 4RGRA 1YW7A 2ZJ2A 4WCGA 1R36A 4LLNA 2MC3A 5AONA 3BDDA 3R6SA 5LHHA 4LLLA 4IRHA 3BPXA 2CFXA 3RPQA 2Z9OA 2LF7A 4L5JA 5FLXK 5FFZA 3TDZC 3E5QA 3ZN0A 1AWCA 1TW2A 2A6HF 2L01A 4KNYA 1OYWA 3WU0A 2VXZA 1MD0A 1I1SA 5D6EA 2V1UA 2PQ8A 3HSRA 2Z33A 1W7PD 1D8KA 2FNPA 3RIRA 5D8LB 4KIFA 3RKWA 1RI7A 3K1NA 6PAXA 2MD5A 2HKXA 3I59A 3ABTA 1OYIA 3MFKA 4DQ2A 1C0WA 2RC4A 4O3MA 5L3FA 2KJBA 1KQ0A 1LVAA 1JE8A 4I0AA 2FBIA 3VEPA 1V3FA 1TBXA 2PMHA 4EJWA 2ZNZA 4EGZA 1PP7U 2X4HA 1XCBA 3LFKA 3KZYA 1F4KA 4XRFA 1G3TA 2GXGA 3K69A 1BM9A 3F23A 3BY6A 2BEOA 4CICA 2ZCWA 3MZYA 1PP8F 1QO0D 3FM5A 4A6DA 3DQVC 1H9TA 1QZZA 3F8CA 2JTVA 4EQQA 2OZ6A 1JHFA 3GEZA 1LDJA 2E7XA 1XGMA 1R1VA 4JBAA 1H9GA 2YR2A 1R23A 1B9MA 1W7PA 2TDXA 3KP4A 4OINF 5CVVA 3DF8A 3VOEA 2GZWA 3ZPLA 5D8KB 4MQ9F 5CJ9A 4WXHA 4ON0A 1S3JA 3HUGA 5AIPA 3JAMZ 1D3YA 1HW1A 4UV8A 3SZTA 3GFLA 2R7FA 1OMIA 5HDNA 1YQAA 1AOYA 3I59B 5IT3A 3IWZA 3P9IA 2EFOA 1IAWA 1XSDA 2D2WA 1O57A 1MGTA 2CSOA 2ISZA 3FWEA 1OR7A 3BJ6A 1O7FA 2B0LA 1HW5A 4HLYA 2XAFA 2YPRA 5H6QA 1U6GA 5DDGA 2RN7A 3ECHA 1J9IA 2EJRA 4HA8A 4EV0A 1IXCA 2CYYA 4L9VA 1V4RA 5A2QK 3C18A 3GZ6A 3T8RA 3CLOA
chains in the Genus database with same CATH superfamily
1WJ5A 1LPQA 2LFBA 2RQPA 4S05A 3CCMI 4JX4A 3WHBA 4M71A 3ZRGA 2HOAA 3I64A 3RTRA 3U2RA 5C3EJ 2RQQA 3OYNA 1O3QA 4L9NA 1W36C 2QSGX 2DPUA 2ESNA 2X6YA 2ACJA 2NOGA 4KN4X 3KLNA 3FMSA 2Y75A 3Q0VA 2R7SA 3O2PE 1G3SA 2RVCA 2G9WA 3RPUD 3W2VA 1YLFA 1D1AA 2BGCA 1VI0A 2PG4A 2LBFB 5HS8A 1FYMA 1F9NA 3KP6A 4M3GA 3ERED 1P92A 4C2UA 2WB1N 1XMKA 2W84A 1HOMA 3GBGA 4KMUX 3EDPA 2OTLI 3HG9A 1OCTC 4A0ZA 4U7BA 4E7HA 4PJLA 2EZIA 3TP0A 1BBYA 1W7PB 5FGMA 1I1GA 2DDBA 3H0GJ 1EKEA 5K7HA 5HS9A 4YEJA 5LEKA 3ZQIA 3BROA 3U1DA 3DEWA 3HUGB 1I5ZA 4UB6C 2P5LC 2EZLA 3EUHC 3H3VK 4PK4A 4DBRA 2M1BA 4N4NB 1XS9A 1LDDA 1Z1DA 2W4SA 3K0LA 2G7HA 2A07F 5FD6A 4UUTA 2IGNA 4B8XA 3DKXA 4FHTA 1FT9A 3I0TA 1I39A 2CQXA 1B8IA 1NTCA 1X2NA 4LGWA 1JT6A 3VFZA 4ETSA 5M3MJ 2E1CA 1BIBA 5GAEJ 4Z6YA 2B9SA 4LB5A 2KDZA 3RQ4A 5CPRB 3V8LA 3ESWB 2MABA 4CCNA 5E3LA 2VJJA 4HW0A 4M3FA 2H27A 1TC3C 1DGWY 2UXXA 3GWZA 3LQQA 4BKXA 1ZELA 1KU2A 3FM3A 4C3JJ 3DLLF 1YTYA 3GTPJ 2GM4A 5IP7J 3CCYA 2IRFG 4HX7A 2JA7J 2Y69H 4XRMA 1GUUA 3EQLF 1KZHA 2R0QC 4H0EA 3TO7A 3EYIA 2QGUA 1B6AA 3A0BC 1LDKB 3BP8A 3G1MA 2IEKA 2STTA 1MNEA 4AYBN 1BI0A 4D9JA 3L00A 1JTYA 3WE3A 3KX2A 4D5FA 4YFXF 2N8GA 2VB6A 3SZGA 3SEZA 1I27A 5H20A 4IHTA 2F48A 1XDSA 2ESHA 1FY7A 3GLLA 2XB0X 2CU7A 4KYWA 3MWMA 3BR0A 3ZQQA 3DXJF 1APLC 5FKNA 3H5NA 4ZTJA 3A2KA 1A6IA 2FMYA 2WC2A 2XGDA 3K4BA 1ZH5A 5EEGA 2EFNA 2OQRA 5DUKA 1MBGA 1FMVA 1YS7A 2OA4A 3A01A 2E36A 2M9HA 2MBFA 1K7AA 1XMXA 4K2EA 4M9XA 2VT2A 4CSWA 4HX8A 1T95A 2P6TA 3K4MA 5IP9J 3NQOA 2XSJC 3R61A 4F7ZA 2JA5J 1YS6A 1G59A 4HX4A 4G9YA 4P96A 2B63J 5CYVA 4GYIA 4L5IA 2NVTJ 3MEXA 1YG2A 1DDNA 3LMMA 3KE2A 5IYBJ 2EK5A 4YELA 1DQUA 3MN2A 4BYYA 2G0EA 5J3LA 1OYYA 4F52A 2FNAA 3HGGA 2E1MC 4RB1A 3V7SA 5F64A 2ZXJA 2VKEA 3LFUA 3H5AA 5CVJA 4PSWA 3E97A 1FYKA 3GTQJ 4HDUA 2L9SA 4HG2A 3BG3A 1LJ9A 1QHGA 2QWWA 3J7YJ 3MZHA 2W85A 2FSWA 4KJZA 1B8IB 3CDHA 4AIDA 2KZGA 1GVDA 1ZTRA 5M5WJ 4XLCA 2EA2A 3ZMDA 4AIHA 3MVPA 1HSTA 2EFQA 2Z99A 3JREA 3FXJA 1D0ZA 2MLKA 1FP1D 2QENA 2LP0A 4XM3A 1Z21A 3CMYA 4XQFA 1VQPI 1BIAA 3H9GA 1JXSA 2FX0A 3S32A 2IVMA 3M7GA 3FISA 4U87A 5DCMA 4P9UA 2EBIA 1OCZH 3E6DA 2HVQA 2HQNA 4XSXF 4V2GA 2CRGA 3KYLA 4OIQF 1S7AA 4BXUA 3ZQLA 5TRDA 2FRHA 2G7UA 3V8KA 4R1HA 3W6KB 4D5CA 2PJPA 2R93J 3J7AY 3D5SC 3T8TA 4KT5C 2XGCA 2VBWA 4GDFA 1W4MA 4AM3A 4FX4A 3T1BA 1WRJA 2Y9YA 2PMUA 4M3BA 1CF7A 3R4KA 2JSPA 2VJ5A 5LD2C 5FLXZ 5K7ZA 2Y30A 2K9QA 2Z3YA 4B1RA 3L2RA 4G6DA 5L3DA 1IN8A 5KAFC 4XIDA 2XAHA 1FOKA 2GXAA 2VOPA 3TW7A 2F4OB 1UMQA 2HEOA 4BJTA 1H0MA 1X1BA 2HOEA 3A01B 1BC7C 3W2WA 2ZBKA 4Y52J 3BZ6A 5TISC 1MMDA 4UV9A 1IW7F 4OIOF 4HLXA 2Q1ZB 2BY3A 3TO9A 4AWXB 1K4TA 3DTEA 3LWFA 3WTWC 2NAZA 4RGUA 1PUEE 1YE9A 1AKHA 3SDBA 4J19A 2CG4A 1I6XA 3V42A 4C2MJ 1S8NA 5GTIC 1HW2A 4UY8I 4CCOA 2QZ8A 4DW6A 2HPMA 2LG4A 3CDIA 2JUGA 3K7AJ 5GTHC 4XSZF 1U3EM 2E60A 2MLGA 3HKZA 1IUFA 3DLAA 3CZ6A 3WG9A 4G6TB 3CJRB 1SAXA 3PQJA 1K6YA 5IT9Z 1Y1VJ 2RREA 1ZK8A 3WTYC 4IX7A 5H6RA 2HTSA 3I58A 3H5RA 1BJZA 3UNGC 4G12A 2JMWA 5J47A 2EFPA 2KJCA 4BBRJ 2FBKA 5DV5A 1FLIA 1ACIA 1MJBA 1TT5B 5LHIA 1GT0C 4UXNA 1STZA 2R7XA 2PBIA 4ENMA 3A02A 3X2QH 3SXYA 4DGWB 2KIUA 2CFOA 4BACA 3O6BB 2HR3A 3MKWB 2HQ5A 2OQGA 2BXZA 3J81Z 1JKQC 4PJJA 5HLHA 1R1TA 5E1ZB 1F43A 3BR6A 4DZJA 2RGVA 3IKTA 4A3LJ 2O3FA 5F1JA 2JWTA 1KGSA 2EV6A 1ZRCA 3L1PA 2DOEA 2K02A 5DCMB 2X6XA 2VPRA 1X58A 1W5SA 2VODA 2AO9A 3E3VA 2EA4A 2XF7A 1J7KA 2Q2EA 1BOBA 1A04A 5EG0A 2A6EF 4U0VA 4LK0F 5E17F 1BJAA 4LLGF 2BHZA 2STWA 3RZDJ 1IRXA 4XR6A 1VQKI 2OUMA 2COMA 4MNUA 2TRTA 2GOMA 5JFRA 3GZNB 1MBEA 4A3MJ 2BE5F 1LKXA 2M34A 1EH7A 1YYVA 2Q8KA 4G7HF 1AU7A 1IO2A 1TNSA 4N9IA 3CCQI 2P5VA 2OF7A 1WKMA 4RS8A 2HTJA 2MH9A 1S29A 1Z3YA 2F6CA 4ZDOA 5ED4A 3NWSA 1FSEA 1CGPA 1XGOA 5EJCA 1GV5A 4DZPA 3J7AO 3HDDA 3G6EI 1JUSA 2M0CA 3FXKA 2M4GA 2OZUA 4Y7NJ 4Q5SF 2GIVA 1SFXA 2HQRA 2KKOA 4BJ5C 1FZPB 3CCUI 3W2AA 4AVZA 2RAEA 2KQRA 2FQ3A 1JT0A 4G7OF 3HPHA 3QU6A 3Q9SA 2LF8A 1OLTA 2ELJA 5L3EA 2JPBA 3CCEI 1R71A 3V7CA 2DA2A 4IHVA 2YX7A 1AKHB 2XIGA 4A12A 2K9MA 1O3SA 2QCOA 4A5NA 1I3QJ 4F92B 2LY1A 1PDNC 4CCMA 3NARA 1RR8C 2EQRA 1KU3A 1OKRA 2EFWA 2ZXHA 2DAOA 4C30A 2P7CB 4YIIA 1BR2A 2BYVE 2HGCA 2RNJA 3R0JA 2WA0A 2XF6A 3KCCA 2UV1A 5IP6A 3ZXSA 3H9QA 4ENKA 2CV1A 1T2KA 2HS5A 5L3CA 2UWMA 2X1EA 3RDIA 4MTEA 5GPAA 4DOZA 1ZGJA 2VPLA 4YIRX 3H1CA 3JRIA 1BL0A 3GW2A 2H6BA 1Y1WJ 4XOTA 2KPMA 1P6RA 1ZR4A 2NVXJ 4BBSJ 1Q1HA 3BT9A 1KU7A 4MFDA 3DKWA 4NBQA 3LNQA 2XGEA 5D4RA 4BDYA 1REPC 2VC0A 4PFOA 2V1DA 2CO5A 3C3WA 3DFGA 1ZLJA 1I50J 5ICCA 3PIOF 4ZYEA 1TQPA 1ZLKA 2F4MB 1ETVA 4AYBA 3PIPF 2PLYA 1SFKA 4BNCA 3SEQA 4KIGA 2IA2A 3R0AA 3HPGA 1XG1A 1GHCA 1EH8A 1RETA 5CQGA 3CJNA 2DBBA 2M7BA 2X6OA 3ABKH 4A3CJ 1USSA 1B4AA 2XPVA 3BR2A 3FKIJ 4CXFA 4E7SA 1Y8RB 1EV7A 5EG0B 1NG7A 4A6EA 2O61A 2WADA 4M9ZA 1WQ2A 1L3LA 1IDZA 2L9NA 2QQAA 1R4MB 1R22A 3E0JB 2JJ7A 4F3QA 2Y0SA 4FT8A 5LBQA 4I98B 3OS1A 4KIBA 2XKOA 4YFKF 3OYGA 4A69C 4IRGA 3F72A 1OR7C 2GA2A 1KA8A 3ZQFA 3S17J 4A3IJ 3GTMJ 3HOYJ 2IPQX 4DJAA 4MHGA 4LITA 2NXNB 4HRIA 3OS2A 2HWVA 3OYCA 3O8HA 4QWQA 4GCVA 2O5RA 2EPFA 1W0UA 1CQTA 3QP5A 3HM5A 3WTVC 3RQIA 2W25A 5M3FJ 3HBLA 1XPXA 2VASA 1IRGA 1IZ1A 3HRMA 5KK1A 4O6JA 4M6XA 4UVCA 4A3FJ 3CF2A 5JHFA 3S93A 2IS2A 4AIKA 3FBNB 3FXQA 2OU2A 3V8JA 4Y13A 1F36A 1D8JA 2WAQN 4NHJA 2PJRA 1LEBA 5F0FA 1B1BA 2JN6A 2IS4A 2WV0A 4ESJA 5EZGA 3NEUA 2LBFA 1QA6A 3OL4A 1XGSA 5DD4A 2KISA 2E35A 1V5GA 3IAS2 4JQFA 2XROA 4J01A 4CUGA 4EM0B 5M5XJ 3LA2A 4NC7A 4CYCA 1QVTA 3RI4A 4AUXA 3G1OA 1YX5A 3Q9VA 3ZMVA 3COAC 2L7FP 3F6OA 1U5TC 5EEHA 3CUQA 1T39A 2VQLA 3OIPA 1N77A 4WXCA 4LD5A 1YRNA 1J75A 4KA4A 3BG6A 3DU6A 1J0RA 4BE2A 2IXSA 4KT6A 3HXLA 3HYIA 1WJEA 2FOKA 3ZMTA 5HODA 4IOCF 2E2JJ 3RYRA 2JA8J 1HC8A 4B48A 1S6LA 4QTRA 2TCTA 1TP4A 2CUJA 1LE8A 4BY1J 2YSRA 3M4OJ 5CVIA 1BW5A 3U1KA 3S8PA 3HC7A 1O3TA 4OAYA 2XPUA 3EETA 4KUMA 3BCAA 3BWGA 2JQ7A 1NK3P 2BBYA 4KFCA 5DTDA 5D5WB 3H36A 4OMZA 3F6VA 4A3JJ 1PJRA 2LKXA 2QYOA 1HQCA 1BR1A 5E20A 3E7LA 4HAMA 2FOWA 2D1VA 1IC8A 5E1WA 1X4OA 1D5VA 2M7AA 1SAUA 2O03A 5J1RA 3BG5A 1SVLA 1BW6A 3TKYA 3CMEI 3K4CA 4PGGA 1VQ7I 2OJED 3IL2A 4EJTA 3K2ZA 1R5HA 2IT0A 1QU3A 3D5LA 1FPQA 2F5CA 4Y15A 3WTXC 2HVSA 1QZEA 4UUVA 1UHWA 4AD9A 5D5UB 3HTSB 2W48A 3HOXJ 2A5WA 1MJ9A 4BHBA 2ICWG 1JJ8C 2X1CA 3WTTC 3L2VA 1N25A 3OYLA 1YW9A 3KEQA 5F1RA 2M0MA 4CZZA 4HBLA 1LB2A 3L9FA 1ZREA 4EMSA 5E3OA 4KISA 1JI8A 2VT3A 2EZKA 2VI6A 2K27A 2E1NA 1W0TA 2PJRB 1IN6A 5ICGA 1SD5A 2HKOA 1DGRM 1HBXG 1VQ4I 2DTRA 2CW7A 2K5CA 2KIMA 1J5YA 1ZAOA 3KYDB 3QPTA 2K4BA 3WTUC 4JOMA 1OPCA 1TWFJ 4FX0A 5KHDA 3GO5A 2DA3A 2L7MP 4BEHA 4NB5A 2IGOA 4Y4RA 4CYCB 2DQRA 1IG7A 4MEYF 2BHYA 1J09A 1P7IA 3DBRB 2IBDA 2XUBA 5FB2A 3S2DJ 4YG2F 4F55A 2H1KA 1E17A 4I09A 2BY1A 3ZOBA 3BZCA 3CUQB 1W36D 2R7OA 3MMYB 5JVTA 5E79C 1YJ9I 2KL4A 1YRNB 2K9LA 4S04A 4JYKA 1YX3A 5FD5A 2EIJH 4C3IJ 4YFNF 2W24A 1R49A 1U8RA 4OIPF 1WJBA 1YW8A 4I2OA 2VLAA 1WI3A 3V7RA 1G3WA 1O7LA 5DM6F 3F8BA 4QSHA 2HQAA 3JW4A 3TQNA 2K9NA 3L2QA 5K5RA 1LE8B 3DKYA 4DYQA 3ROUA 2XAJA 1F1ZA 4XKWA 1S5LC 3DPLC 3E6MA 3H0DA 4A2UA 3S14J 1HCRA 2VKHA 1GVJA 2HZTA 2L7ZA 4AVPA 4FETA 1YJWI 1WVRA 3KP2A 4EJOA 1MW7A 1IN4A 3DPTA 3HOZJ 4H4KC 4G94A 3PNVA 5E3MA 3PL8A 2KMUA 1IGNA 2MSYA 5FLVA 4L0ZB 2E34A 2OPTA 4I7HA 3IH4A 4XKVA 5TJJA 1U8BA 2HOSA 1FBUA 2HOTA 3G71I 2K40A 2DT7B 2Y31A 1ZRDA 1R6RA 4LG0B 4RGXA 2VQHA 1WGXA 1G2HA 2EWNA 2WBMA 4I0BA 4D0PA 1UHSA 2QLZA 3P5JA 1SFUA 1A5JA 2DPDA 3R60A 1NK2P 4HOBA 3PSFA 4IEJA 1TWGJ 3F8FA 3K4KA 4MEXF 2XRLA 1WWXA 2ZSIB 2KZVA 2JK3A 2L54A 2EH3A 1HKTA 1FEXA 3JAMK 4IO9F 5BPIA 2NYXA 3KIOA 1G3YA 2DFIA 2CMPA 2DYRH 4HNVA 3RZOJ 1WCMJ 2MG4A 3QPLA 4LIVA 2LNBA 2MC4A 3DV8A 3RPUA 4XRSG 4PZJA 1TTYA 2DOFA 1ZRFA 4YRVA 3AKZA 4PGHA 4B3AA 3DEUA 4QPQA 2Z16A 1DP3A 2PMZN 5F04A 3IV5A 2OC6A 2IGMA 4I6ZA 1GLNA 2XPWA 2ECBA 3I5UA 1FOWA 1R1UA 2F5EA 4GGGA 2HNHA 2KHMA 4HF1A 2QKMB 3RYPA 2XAQA 4BEHB 2ID6A 3J80Z 5EGOA 4EM2A 3JTGA 2ZO4A 4V2FA 4N0BA 3HL2A 3WODF 4U0YA 3TDUC 4OMYA 2E5ZA 4ZZLA 1D0YA 2Y0MA 4CZCA 1GDTA 2IS6A 3I3LA 2AHQA 2FQ4A 3KPHA 3IUOA 4Q47A 4GXOA 2R7UA 1XN7A 1SD7A 2WY7Q 2IP2A 4E7KA 5LEJA 2DA5A 3FIWA 3VSLA 2JT1A 3QOPA 1DPRA 4LFUA 4N9HA 2JRMA 3ZGKA 1A31A 2R92J 4E7ZA 2O8XA 3J7ZI 1WPKA 1U2WA 2NS8A 5EF6A 1EF4A 2E1OA 3I9V2 2RV8A 2GQQA 3F22A 3TMOA 3NRVA 1QVUA 4CYDA 3LSKA 3S3NA 2DTZA 4HPQA 1VNDA 3L2CA 4RLQA 4XRSA 2FF4A 2P0WA 4HQMA 3K1MA 2HYFA 3EUHA 3FXLA 1K79A 3W3CA 2V1NA 2ID3A 2LVSA 2VC1A 2CQQA 3I71A 1DUXC 3HEFA 3CC4I 2O6GE 2GXBA 3HRTA 4II3A 1R7JA 3HB9A 2E2HJ 2ZMEA 3KP5A 3DBHB 1TQIA 3B6AA 3OIQA 4IRIA 2E5NA 3CO6C 4E4HA 1Z7UA 2QBYA 5IYCJ 4IQ4A 4HNUA 1IXRC 5DYMA 1U0JA 3BCBA 1FBSA 3BR1A 1LFBA 2DLLA 5LHGA 1SC7A 2K3PA 1P7JA 2VN2A 1HKQA 4IPAA 4BU2A 3MQ0A 1IV6A 3FK7A 4P55A 4W97A 4KN7X 5IPAA 2KRCA 2M8GX 5AIQA 4UUSB 1A36A 5FKLA 1IF1A 1G8XA 3MKZA 3H3UA 4HDVA 5FRNA 3Q0WA 3CCVI 4CGZA 4FQGA 1O4XA 2FUG2 3IH3A 3AL0B 4I02A 3ONQA 3TGNA 4KDPA 4C3HJ 4NC8A 3FXOA 2AXLA 5GAGJ 2XVCA 3L2UA 1T98A 1R00A 2EV0A 1S7EA 4MGRA 4RM2A 1ON1A 1FC3A 1MDMB 1AHDP 1P9QC 5DUIA 3WU1B 1KU9A 1MMNA 1P4WA 2MGQA 3N4MA 2HYJA 1QNTA 5EGOB 3SHFA 3IRRA 1ZQ3P 4PCQA 4WK8F 1TL8A 2HXIA 4TV7A 4YIFA 2ZKZA 2VE9A 5HOOA 5L3GA 1JUMA 3KFWX 4DNCA 2FE3A 3VB2A 4CCLA 3AG4H 3KP3A 2VUMJ 2LY9A 2V9KA 1MKMA 5DEQA 3ZMZA 2VE8A 3ISPA 3HZJA 5J40A 4PUSA 2PX9A 4B09A 4UNOA 4RMNA 1T56A 4XBFA 4E7LA 4L9JA 1D0XA 2VBYA 1JHHA 1TNTA 4C9YA 3AG3H 3HRSA 1UJ8A 4HSRA 1YIOA 1DPUA 3U21A 4IKFA 5EDNA 4LB6B 1UFMA 2FEZA 2CW8A 2ZFUA 1M1EB 1PYVA 2A05A 3G1LA 4WXDA 1B72A 3O8GA 2X6WA 4XN0A 2X85A 3L09A 1D1BA 4MFEA 2LK2A 5FKKA 1V5FA 3PSIA 1WSUA 2RNGA 3OSFA 1FX7A 2CUEA 2OBPA 1ZG1A 2P6SA 4FE7A 3IRQA 4FE4A 3BJOA 2M3AA 1FOYA 3I4MJ 4WWCA 1ONVA 3VYTB 3WU2C 1Z9CA 2COBA 2WAFA 1X1DA 3P9KA 1YIJI 2ZMEB 4EM1A 2HDWA 4GYGA 2PN6A 3REOA 2UXNA 2R7TA 3M3YJ 1RRJA 1OCOH 4XICA 4ZYHA 4ESBA 1T8IA 3BQZA 5LRSA 2QBYB 1YJNI 3KEYA 3M8EA 1NH3A 2ZFWA 2A6TA 4X0GA 2R4GA 2ZSHB 4OIRF 2WWYA 1MBHA 3KZZA 1BI3A 4LG3A 4B44A 5B1BH 1VQOI 2HDCA 3DCFA 1MNMC 3P7NA 3ZQHA 4OAZA 3SZPA 1HKSA 3SFZA 1SD4A 1LNWA 4MTDA 1SEUA 1P4AA 3Q0UA 5BMZA 2WB1A 2CQNA 3NAUA 1JGGA 1VQNI 1S9HA 2J5OA 5JR3A 5C4JJ 3B6CA 1VQ6I 4HQEA 2V26A 1Z0XA 1ZG3A 2MD0A 5BOXA 4O5VA 5IOZA 2PFBA 5BPDA 1SMTA 2AQEA 1N75A 2CGPA 3QYBA 4A3DJ 3HHHA 2K4JA 1SANA 3K70C 4JK1X 1V5EA 2ZJPF 1SD6A 3M1CA 4A0XA 3BG9A 3E6CC 2IGKA 3HRUA 1UZCA 1LQ1A 5ERIA 3IP4B 2Y9ZA 1YI2I 1LFUP 5ICEA 3PNTA 4XLAA 4DIQA 1XD7A 2LREA 2CH0A 1T08B 1E2XA 2K3FA 3RKQA 3AG2H 1UCRA 3TOAA 1BN5A 4FTHA 2XRNA 1Q1VA 3MKYB 2O0YA 1X1CA 4UVBA 3EUAA 4Y33A 5B1AH 3RKYA 4OWRB 4ANJA 1UHMA 2KLOA 3KEOA 4LK1F 5EEAA 2RDPA 3P9CA 2OAZA 3KZIC 3IWFA 5ILUA 2O8KA 2KDOA 4XN3A 3E6BA 3VSKA 4PSXA 3JSPA 5JVGF 4XK4A 2BW3B 3OY9A 1HXDA 4M72A 3CC7I 2GAUA 1VTNC 3W6VA 4JX5A 4HZFA 3OYEA 4HF0A 4LOCA 1WHUA 1QPMA 2BXYA 5HS7A 3LSTA 5LGNA 1B72B 3GVAA 2X1DA 5LLQA 1EH6A 1ON2A 3EYYA 1SVOA 4ITVA 3BZKA 3WGGA 2ZXWH 2L4AA 2ZNYA 5FFXA 3QYFA 2DCEA 1YO5C 1TW3A 1F5TA 3S3MA 3CUQC 3DU5A 3V4GA 1RESA 5GAHJ 2CV2A 2E1MB 1BI2A 3GFMA 2HI3A 1TZLA 3LSMA 4ZDPA 3WGIA 2P5KA 3E1SA 2W7NA 1XDUA 2HYGD 5FO5A 1USTA 2XHKA 1KQ8A 4RGSA 5JHUA 2XGXA 1GXQA 1E3HA 1FWZA 3F3XA 4WX9A 1WJFA 2M87A 3WE2A 4B3XA 4CDGA 1LFPA 2B7EA 4L18B 1K4SA 3PQKA 2FU4A 2L9RA 2LMDA 4CHUA 3GMEA 4PJ0C 5A2QZ 3QODA 1XX5A 3FBIB 3HJEA 2EV5A 1ODDA 3A03A 3AG1H 1PVEA 3KP7A 2KIFA 3ZP5A 2LRDA 3G73A 1IRZA 2HDDA 3SYTA 2E19A 3HOSA 1MZBA 4BXFA 3FF5A 5BQTA 5IT9K 3K1PA 3ECOA 2RKHA 2LH9A 2PI0A 1FYLA 1SFEA 3TO6A 3N97A 4IQJA 3BQYA 1TT0A 4NUBA 2JZYA 3FMQA 4Y17A 2VOOA 4X6AJ 4DBQA 4RAZA 2MA3A 3VPRA 2VKVA 2LOOA 3FMRA 3TEDA 1T0FA 1BC8C 1T6SA 1K6OA 3M9AA 3HHGA 3J81K 2NRAC 2EINH 3CMMA 4G6QA 3C2HA 2NNNA 4OU0A 1SFOJ 1QRYA 3C1DA 5HLGA 2HU9A 2L5QA 4RB3C 2IS1A 1IXSB 1VF9A 1IN7A 3S2HJ 1R9TJ 3F8NA 3I4NJ 2IAIA 4QIWN 2VJ4A 3UR3C 4JX6A 4IVNA 2P8TA 4XLHA 1A35A 2F2EA 4ASNA 2DODA 1MSEC 3I54A 1MBFA 2BV6A 1UAAA 2M8EA 5E8IA 5DD8A 5E3NA 2HXOA 2UZKA 4R8HA 4RB0A 1H8AC 2VQCA 3CP8A 4M6VA 3CO7C 5BS6A 3KLOA 1X1PA 1A6QA 2FBHA 1UG2A 3FHZA 1LEAA 1W5TA 5KNLA 4BL0B 3RSNA 1TLHB 3GTKJ 1BI1A 4XLEA 1WI9A 1Z77A 2QUFA 3IC7A 4P5OA 2DOAA 2CQ7A 3HOWJ 5K7FA 3LQRA 1WZ2A 1FJLA 4EATA 2EILH 2K85A 3GYHX 1OCRH 3PUBA 1VQ5I 2Y48A 5CLSA 2D1HA 3HOUJ 4AC0A 4ZYDA 3K6GA 2FXAA 4BS9A 3CCRI 3HSFA 3A0HC 3HGYA 3LA3A 1H88C 1X3ZB 2YS9A 4RA2A 2GWRA 4UB8C 4Q4ZF 2DJNA 5C4XJ 1I3AA 1XSVA 1MBKA 2M30A 4CA0A 3SJMA 4BHCA 2DFFA 4IOAF 3BG7A 1UELB 3OV8A 3DTKA 2KRFA 1B9NA 1T33A 3IH2A 1L0OC 4LG0A 3JSOA 2V1XA 1TWHJ 4RAGA 1ZYRF 4P1WA 1RIOH 3ASNH 5KCMA 1O3RA 4IHWA 4X1EA 3MCZA 4IJAA 1HSJA 2GOXB 4J00A 1WJDA 5D5XB 2WTEA 1ZHFA 5J8FA 1OQYA 3JTHA 5K1YA 1JUPA 2VJIA 2QF7A 5L3BA 1WFXA 2H09A 2F4IA 3OYAA 1QZYA 2OCEA 5HLIA 1W5CC 4KMFA 4U7DA 3ABLH 1J2XA 1ENHA 2DK8A 2F5DA 4HF2A 3ERMA 4A0YA 5FJ8J 2DDAA 4N4OB 1Y39A 3GFJA 1KONA 4FCYA 3MD2A 1FNNA 4WF2A 5JLWA 4RB2C 5ILVA 1FOXA 1HF0A 4GFBA 2XASA 3KETA 3LAJA 4S0HB 2F5FA 5HVQC 4QPOA 3GCMA 5J6XA 2CUFA 1B59A 2EZHA 1JGSA 2LD5A 1GXPA 2V9PA 4BQNA 3G3ZA 2XKPA 1FBQA 1R5GA 2DFEA 1XB4A 3CLQA 2QKLB 4D1QA 1OCPA 1MJAA 2V6CA 3OYBA 5KAIC 3B02A 3AAFA 2R7DA 1RUOA 2DYSH 2R7QA 4P9FA 2AS5F 4BQOA 2H8WA 4M3DA 1WH5A 2M5WA 2DT5A 3I56I 3U9GA 1IUYA 1AA7A 3W6JB 2LC2A 1H89C 5C44J 3QRFF 2E2IJ 2E7WA 1U78A 2H94A 3WTSC 3JRDA 2K86A 3H9JA 3HOTA 2CUZA 2DMQA 3K4JA 4M6YA 2V4JC 4BHPA 3HIFA 1E0EA 3CC2I 5TGTA 1YFHA 3T0YA 4IF4A 4XLPF 4BGDA 3S2WA 1ZARA 2NS7A 2XDVA 3M8FA 1SVMA 3TW6A 4XL9A 3FDYA 2A69F 4JP0A 3JRBA 5FRMA 3WGHA 3D0SA 1T38A 3OR1C 1U5TA 3WG7H 2ZJRF 4A3BJ 1ZR2A 4KICA 4ZDLA 1G4DA 5J8CA 2BZTA 4XMYA 2ME6A 4IL6C 4E6KG 3CMAI 5HDKA 4XORA 4PJMA 2I10A 1ZGAA 2A61A 3RKXA 3FZVA 3GF2A 2WAEA 2A68F 4GO1A 1W1WE 2C6YA 1Z05A 4ENJA 2QQ8A 3A4CA 4B43A 2FA5A 2H1LA 2IA1A 2FMLA 4BAYA 5D5VB 2K7LA 1Y56A 4IHSA 2ECCA 2UUZA 1XMAA 3GFIA 1ZG5A 2A3SA 3GTOJ 4HEA2 5JLXA 2ZB9A 4A3GJ 4M74A 2H6CA 5IYDJ 4A3KJ 2X9DA 3S1MJ 1N78A 3B73A 2XV4S 3ULQB 3OYKA 1RKWA 2LSOA 3I53A 2KP6A 2NNYA 2DO7A 3O3KA 2ZMEC 3FXUA 4Z2YA 1X1AA 3GZ5A 4ZZDA 1WH7A 3FX3A 3ZQCA 3IHUA 2L3DA 1IRFA 5E1XA 3BJAA 1X3WB 3OOUA 3FXMA 2V79A 2IJLA 3CTAA 2LLKA 2KIQA 1R4NB 2R5YA 5IY5H 4EJVA 3S1QJ 4UUSA 2ZC2A 1I6HJ 5DS9A 1E3PA 4XOPA 1Z6RA 3BR3A 4EJUA 1ETXA 4I76A 3PO3J 5CVRA 1D5YA 4LIUA 3ZN1A 2LDUA 3JR9A 3Q3SA 1NHAA 4L9TA 1P2FA 3ZMUA 3GX4X 3M8JA 2QQBA 2KRHA 1G6NA 2VQGA 1MIJA 2VONA 5JI6A 4AIJA 3AFHA 5F0CA 3GUDA 2JRTA 1RNLA 2LY2A 2R7WA 4LJZF 3DP7A 2K9SA 2DK5A 3LOCA 3OYJA 3BTCA 2R7RA 2CJJA 2AXTC 1MDMA 4PDKA 1ORKA 4NQWA 3ASOH 5D6FA 4ZYGA 1U9OA 1ETYA 4ZH4F 2GLOA 3CJTB 2PEXA 1VQMI 3DEEA 4BQQA 3MAJA 3CF5F 4II2A 1PUFA 5HNFA 4ENNA 4D7NA 2KT0A 2W82A 2W57A 3T5XA 4BXXJ 2JA6J 5E8GA 3ZQ7A 3SQNA 3DTIA 2XC7A 3BR5A 2VIXA 3OWTA 1MMSA 4I01A 2Y0SN 5GPCA 1MBJA 4G7ZF 1U5TB 3S15J 4MLOA 3VODA 2M2EA 2KFDA 3S3OA 1JTXA 2BOLA 3K9TA 2R5ZA 5E18F 5K5OA 2F5VA 5D4SA 2V7FA 3DPUA 1QQIA 3OMYA 2HVRA 2VBXA 2EB7A 4NNJA 2DW4A 1Z3XA 2P4WA 5CVUA 2D45A 1K61A 3PFYA 2OTJI 1DU6A 3M1EA 3OOPA 1FSHA 3E5XA 2GA1A 3S16J 2ZJQF 2DI3A 2E71A 2MH2A 4BJ6C 4HYEA 3F8MA 3N05A 1S7OA 3BPVA 1WJAA 3BTJA 2CW0F 1RZ4A 1FIPA 3C2BA 4XKCA 4HNTA 3JRCA 3L7WA 1KQ9A 3UKGA 2XF5A 3ABUA 1K78A 2X0LA 1QGPA 2XAUA 1FP2A 4G8XA 4ZTFA 3I4PA 2FJ1A 4L5EA 2WAQA 4HV6A 4A5MA 4ESFA 2QVOA 5CKTA 1RPWA 3PNYA 3G2BA 3H92A 4IHXA 3VYSB 5DM7F 3TOBA 3IAM2 2LYCA 2CWEA 3KYCB 1UB9A 2X48A 3RJPA 4R79A 2R5YB 5F27A 5F0HA 3K2AA 1OFCX 2AQFA 4B4CA 3QU3A 2GIZA 5F6FA 1ETKA 2DU9A 1KYZA 1HA8A 3OYFA 2DA6A 2J5PA 1BOAA 4EEFG 3H35A 3OYIA 3TP3A 2DQLA 3JRGA 5IOYA 2YU3A 4HV5A 2DA7A 2HFHA 2NS0A 2YU9J 1ITYA 2JPCA 5HDGA 2CV0A 1SMYF 3CDLA 2QQ9A 3ZR8X 2VBZA 4MO7A 5GP9A 3HTUA 1RR7A 3C7JA 2IW5A 2MFZA 4NQWB 2XAGA 1ZN2A 2R7ZJ 1ZKGA 4Q48A 4RAFA 1TQMA 1X3UA 1VQ8I 3GTJJ 4MQVA 3QPHA 4F93B 1PUFB 4IXAA 3ABMH 5EZHA 1OCCH 5DCFA 2QSHX 3FHNA 5B5EC 1U9NA 2V9VA 1XC5A 4LMYA 4U88A 4M9SA 3BOQA 1MMAA 3CCLI 2Z2SB 1P4XA 2BW3A 2M45A 3LA7A 1VFCA 4E7JA 4CCKA 2DMNA 1Y0UA 4BQAA 1BA5A 3ELKA 2R5ZB 1FTTA 4XNFA 5EYRA 1E3OC 4RAYA 3TL4X 3CQZJ 3LSIA 5ICFA 3F0CA 1IJWC 3QP6A 3FXRA 4IZZA 1KYWA 4L0YB 1Z67A 2IA0A 2DA1A 3ZMSA 2Z5UA 3Q5FA 1J59A 1IN5A 4BUPA 3S1RJ 2M4KA 5F08A 3BC8A 4RDUA 1QBJA 2X51A 4CO8A 4RM3A 5FLMJ 5LRRA 3VDXA 2P81A 1ETWA 1WJCA 1XCVA 2L02A 3QWLA 4U0WA 5HNHA 4M3EA 3GXOA 3J80K 2CQKA 2ISYA 2L4MA 3H3ZA 3OSGA 2LKPA 2XB5A 5LGTA 5B66C 1K78B 3QAHA 1HDDC 3GLXA 5K5QA 4BH9A 4UVAA 3F9KA 3VYRB 5FKMA 5KVRA 3LL7A 3LAPA 3F21A 2OD5A 2DMUA 3PM1A 2QEXI 3CCSI 3D1NI 2FD5A 4XKBA 2DXIA 2LKSA 2QM3A 2OV7A 2ELHA 3ML6A 3PJRA 3HSEA 1HDPA 2ADUA 1HLVA 3JRHA 3PUFA 1DP7P 4OOIA 2W1OA 2ETHA 2P7VB 2YUSA 1RUNA 2V6EA 3OL3A 2JSCA 5ILSA 1X4PA 5GADJ 5LGUA 3TBIA 1Z91A 3CUOA 4A3EJ 1Y0NA 3GTGJ 2YX4A 1ULYA 1QPIA 3SFIA 3WTZA 2O7OA 4XLNF 3OYDA 2L2OA 1XSXA 2O9LA 4EVIA 3C2GA 4HSTA 1T0FC 4QLCU 1XGNA 2A5YB 1R58A 1CF7B 2Q0OA 3IKVA 4M73A 2HPIA 2R3SA 2JVHA 3DWLE 4E70A 1LVKA 3ZQGA 5J1UA 5J4VA 3BTLA 4D7MA 3K70D 1Z6TA 3PFIA 3D5RC 4EGYA 3GTLJ 1ERDA 3E5UA 4UHTA 3EUKL 4RGRA 4DYRA 2NVUB 4RBOA 1YW7A 2ZJ2A 4WCGA 3S1NJ 2EIMH 1R36A 4LLNA 2MC3A 4XONA 2L9VA 5AONA 3BDDA 4NC6A 3R6SA 4Y3OA 1X2MA 5LHHA 2DN0A 2L0KA 4LLLA 4W1UA 3M07A 4IRHA 4ABZA 3BPXA 2CFXA 3RPQA 2Z9OA 5HLTA 1OISA 2LF7A 4L5JA 5FLXK 5FFZA 4ZYAA 1YOVB 3FKJA 3A1YA 4RLFA 3CESA 1XTAA 4BY7J 3TDZC 3E5QA 3OR2C 3ZN0A 2BY2A 1R5ID 1AWCA 1TW2A 3LSHA 5FROA 2ELKA 4CCJA 2JVGA 1FTZA 3I55I 1POGA 2R7VA 1ZGWA 2LTPA 2A6HF 2L01A 1EJ9A 4KNYA 4BDZA 1OYWA 1BR4A 3WHCA 3WU0A 3QQAA 2VXZA 1MD0A 3K4NA 1I1SA 3VYUB 2D5VA 1Y6IA 4FASD 5D6EA 4ZJZA 2V1UA 2PQ8A 2BVLA 3HSRA 3OS0A 2JA2A 2PMZA 3DBLB 2Z33A 1W7PD 2DA4A 1D8KA 2FNPA 4A93J 1FMWA 3EPZA 5FKOA 1K83J 1Z7LA 2Y2ZA 2VKDA 3RIRA 5D8LB 2NVYJ 4KIFA 2MYSA 4PJNA 3RKWA 2WY8Q 1RI7A 3VWBA 1OJLA 1V54H 3K1NA 6PAXA 2NVQJ 2MW8A 3K10A 1JJ6C 1MNDA 4KITB 2MD5A 1IDYA 2HKXA 3I59A 3ABTA 2ZXIA 1OYIA 1MSFC 2DFHA 2Q2EB 3MFKA 2ME0A 2QSFX 4AU7A 4DQ2A 1C0WA 2RC4A 1S72I 4O3MA 5L3FA 2KJBA 1KQ0A 2DJIA 2BY0A 1LVAA 1ETOA 1FIAA 3SDGA 3NWTA 4I99C 1JE8A 1QHHD 4FISA 1JKOC 4I0AA 1IV8A 2FBIA 5J1YA 2BVMA 3VEPA 1V3FA 3RCOA 1TBXA 2PMHA 4PFPA 2VXDA 4EJWA 2ZNZA 4EGZA 1VZ0A 1PP7U 1JKRC 3LSGA 4F91B 2X4HA 1XCBA 3LFKA 3KZYA 5H2FC 5LFAA 1F4KA 4XRFA 1G3TA 4BE1A 2GXGA 1V55H 1MMGA 2W00A 3K69A 1BM9A 3HOVJ 3F23A 4IHYA 3CD6I 1D1CA 3QPSA 3BY6A 2BEOA 2ZCWA 4CICA 3MZYA 3L2WA 2Z1DA 1VQ9I 2L7KA 4ZC3A 3QOEA 1PP8F 1QO0D 5J4YA 3FM5A 4GRIA 4A6DA 3DQVC 1H9TA 1QZZA 3F8CA 2JTVA 3CP2A 3QYEA 2H8RA 4EQQA 1YHQI 2DMTA 2OZ6A 2QA4I 1JHFA 3GEZA 1LDJA 3MKLA 4MIMA 1EA3A 2E7XA 1XGMA 1R1VA 3BLYA 4B47A 3OYMA 4JBAA 1H9GA 3OYHA 2YR2A 1R23A 2GBYA 2OCCH 1TWCJ 5BNGA 1B9MA 1RC9A 1W7PA 1JKPC 2XSDC 2TDXA 3KP4A 2VL8A 4CH7A 4OINF 5CVVA 3DF8A 3VOEA 2GZWA 3ZPLA 5D8KB 2CS3A 1UG0A 4MQ9F 2I5UA 2WV1A 5CJ9A 4WXHA 1S3JA 4ON0A 3HUGA 5AIPA 3JCUC 3MZ8A 1YITI 3PO2J 3JAMZ 1X19A 1MH3A 4BE0A 1GV2A 2DT6A 1D3YA 1LUJB 1HW1A 4UV8A 3SZTA 3ZCOA 3GFLA 3CJQB 2LR8A 2R7FA 3K4LA 1OMIA 3OIOA 1NG6A 4V19K 5HDNA 3LSRA 2DMPA 1YQAA 1AOYA 3LSJA 3I59B 2EIKH 5IT3A 3IWZA 3P9IA 3HKZN 2EFOA 1IAWA 1XSDA 2D2WA 4NDLA 5M5YJ 3JRAA 5CQEA 1O57A 1MGTA 3JRFA 2CSOA 2ISZA 3CCJI 2JUCA 4DYCA 3FWEA 1OR7A 3BJ6A 1TWAJ 3G4SI 1O7FA 2B0LA 1HW5A 4HLYA 2XAFA 2I8DA 2YPRA 5H6QA 1U6GA 5DDGA 1ETQA 3LSPA 1DU0A 2HZDA 2RN7A 3ECHA 5B3SH 4XLFA 1Y8QB 1J9IA 2EJRA 3FK6A 4HA8A 1MH4A 4EV0A 4C2TA 1IXCA 2CYYA 4L9VA 9ANTA 1V4RA 3BTIA 5A2QK 3C18A 3GZ6A 3T8RA 3AL0C 2NOJB 4E7IA 3CLOA 1RKTA 1VQLI
chains in the Genus database with same CATH topology
4S05A 2RQPA 4M71A 3I64A 3RTRA 3U2RA 1O3QA 4L9NA 2DPUA 2ESNA 2ACJA 4KN4X 3KLNA 3FMSA 2Y75A 3O2PE 1G3SA 2RVCA 2G9WA 1YLFA 2BGCA 2PG4A 5HS8A 1FYMA 1F9NA 3KP6A 3ERED 1P92A 1XMKA 2W84A 4KMUX 3EDPA 4A0ZA 4U7BA 1BBYA 1W7PB 5FGMA 1I1GA 5HS9A 5LEKA 3BROA 3U1DA 1I5ZA 2P5LC 2M1BA 1LDDA 1Z1DA 3K0LA 2G7HA 2A07F 5FD6A 4B8XA 4FHTA 1FT9A 3I0TA 4LGWA 3VFZA 2E1CA 4ETSA 1BIBA 4LB5A 3V8LA 4HW0A 2H27A 2UXXA 3GWZA 3LQQA 1YTYA 3FM3A 1KU2A 2IRFG 4HX7A 3EQLF 4H0EA 3TO7A 3EYIA 1B6AA 1LDKB 3BP8A 2STTA 1BI0A 3L00A 3WE3A 4YFXF 1I27A 5H20A 4IHTA 1XDSA 2ESHA 1FY7A 4KYWA 3MWMA 3DXJF 2FMYA 2WC2A 1ZH5A 5EEGA 2EFNA 2OQRA 5DUKA 1YS7A 2OA4A 2MBFA 1K7AA 4K2EA 4M9XA 2VT2A 4HX8A 2P6TA 3NQOA 3R61A 4F7ZA 1YS6A 4HX4A 4G9YA 4P96A 5CYVA 4GYIA 4L5IA 3MEXA 1YG2A 1DDNA 3KE2A 2EK5A 4BYYA 1OYYA 2FNAA 4RB1A 3V7SA 5F64A 2ZXJA 5CVJA 3E97A 1FYKA 4HDUA 1LJ9A 2QWWA 3MZHA 2W85A 2FSWA 3CDHA 2EA2A 3ZMDA 4AIHA 1HSTA 2EFQA 2Z99A 2MLKA 1FP1D 2QENA 1BIAA 1JXSA 2IVMA 3M7GA 5DCMA 4P9UA 4XSXF 3E6DA 2HQNA 4OIQF 1S7AA 4BXUA 5TRDA 2FRHA 2G7UA 3V8KA 4R1HA 3W6KB 2PJPA 3T8TA 4KT5C 2VBWA 1W4MA 4FX4A 3T1BA 1WRJA 2PMUA 1CF7A 3R4KA 5FLXZ 2Z3YA 4G6DA 5L3DA 1IN8A 2XAHA 1FOKA 2VOPA 2HEOA 1H0MA 2HOEA 1BC7C 2ZBKA 3BZ6A 4UV9A 1IW7F 4OIOF 4HLXA 3TO9A 4AWXB 3LWFA 3WTWC 2NAZA 4RGUA 1PUEE 2CG4A 1I6XA 1S8NA 1HW2A 2QZ8A 4XSZF 1U3EM 2MLGA 3WG9A 1SAXA 3PQJA 5IT9Z 3WTYC 5H6RA 2HTSA 3I58A 2EFPA 2KJCA 2FBKA 5DV5A 1FLIA 1MJBA 5LHIA 4UXNA 1STZA 2PBIA 4ENMA 3SXYA 2KIUA 3O6BB 2HR3A 2OQGA 3J81Z 5HLHA 1R1TA 5E1ZB 3IKTA 2RGVA 2O3FA 1KGSA 2EV6A 1ZRCA 2K02A 5DCMB 1W5SA 2VODA 3E3VA 2EA4A 1J7KA 2Q2EA 1A04A 2A6EF 4U0VA 4LK0F 5E17F 1BJAA 4LLGF 2STWA 2COMA 4MNUA 5JFRA 2BE5F 1EH7A 1YYVA 2Q8KA 4G7HF 1TNSA 4N9IA 2P5VA 1WKMA 4RS8A 2HTJA 2MH9A 1S29A 5ED4A 1FSEA 1CGPA 1XGOA 3J7AO 2OZUA 4Q5SF 2GIVA 1SFXA 2HQRA 2KKOA 1FZPB 4G7OF 2FQ3A 3QU6A 3Q9SA 2LF8A 5L3EA 2JPBA 3V7CA 2YX7A 2XIGA 4A12A 1O3SA 4A5NA 1PDNC 1KU3A 1OKRA 2EFWA 2DAOA 2P7CB 4YIIA 2BYVE 2HGCA 2RNJA 3R0JA 3KCCA 4ENKA 1T2KA 2HS5A 5L3CA 2UWMA 3RDIA 4MTEA 1ZGJA 3GW2A 2H6BA 1P6RA 1Q1HA 1KU7A 3DKWA 5D4RA 1REPC 2VC0A 2V1DA 2CO5A 3C3WA 1ZLJA 3DFGA 5ICCA 4ZYEA 1TQPA 1ZLKA 2PLYA 4BNCA 4KIGA 2IA2A 3R0AA 1GHCA 1EH8A 3CJNA 2DBBA 1USSA 1B4AA 4CXFA 1EV7A 4A6EA 2O61A 4M9ZA 1WQ2A 1L3LA 2QQAA 1R22A 5LBQA 4FT8A 4I98B 4KIBA 2XKOA 4YFKF 4IRGA 3F72A 2GA2A 1KA8A 2IPQX 4MHGA 2HWVA 4QWQA 4GCVA 3QP5A 3WTVC 2W25A 1IRGA 1IZ1A 3HRMA 5KK1A 4O6JA 4M6XA 4UVCA 4AIKA 3FXQA 2OU2A 3V8JA 4Y13A 1D8JA 4NHJA 1LEBA 1B1BA 2WV0A 4ESJA 3NEUA 1XGSA 5DD4A 4JQFA 2XROA 4EM0B 3LA2A 3RI4A 3ZMVA 3Q9VA 3COAC 3F6OA 1U5TC 5EEHA 3CUQA 1T39A 4WXCA 4LD5A 1J75A 4KA4A 1J0RA 3HYIA 2FOKA 3ZMTA 3RYRA 1S6LA 2YSRA 5CVIA 1O3TA 3EETA 4KUMA 3BWGA 2BBYA 4KFCA 5D5WB 4OMZA 3F6VA 2QYOA 1HQCA 5E20A 4HAMA 2D1VA 5E1WA 1D5VA 2O03A 3TKYA 4PGGA 3IL2A 4EJTA 3K2ZA 1R5HA 2IT0A 3D5LA 1FPQA 2F5CA 4Y15A 3WTXC 4UUVA 1UHWA 4AD9A 5D5UB 3HTSB 1MJ9A 4BHBA 3WTTC 1YW9A 3KEQA 5F1RA 4CZZA 4HBLA 1LB2A 3L9FA 1ZREA 4EMSA 2VT3A 2K27A 2E1NA 1IN6A 5ICGA 1SD5A 2HKOA 1HBXG 2DTRA 2KIMA 1J5YA 1ZAOA 3QPTA 2K4BA 3WTUC 1OPCA 4FX0A 3GO5A 4NB5A 2DQRA 4MEYF 2XUBA 5FB2A 4YG2F 1E17A 4I09A 3CUQB 5JVTA 4S04A 5FD5A 4YFNF 2W24A 1U8RA 4OIPF 1YW8A 4I2OA 3V7RA 1G3WA 1O7LA 3F8BA 3JW4A 3TQNA 5K5RA 3ROUA 2XAJA 1F1ZA 3E6MA 3DPLC 4A2UA 1GVJA 2HZTA 4AVPA 3KP2A 4EJOA 1IN4A 3DPTA 4G94A 4L0ZB 4I7HA 5TJJA 1FBUA 4LG0B 1ZRDA 4RGXA 2EWNA 4I0BA 4D0PA 2QLZA 1SFUA 2DPDA 3R60A 4HOBA 3F8FA 4MEXF 1WWXA 2L54A 1HKTA 3JAMK 5BPIA 2NYXA 1G3YA 2DFIA 2LNBA 3DV8A 3RPUA 4PZJA 1TTYA 1ZRFA 4PGHA 3DEUA 3I5UA 1R1UA 2F5EA 4GGGA 4HF1A 3RYPA 2XAQA 3J80Z 4EM2A 3JTGA 2ZO4A 4N0BA 3WODF 4U0YA 3TDUC 4OMYA 4ZZLA 2Y0MA 4Q47A 4GXOA 1XN7A 1SD7A 2IP2A 5LEJA 2JT1A 3QOPA 1DPRA 4LFUA 4N9HA 2O8XA 1U2WA 2RV8A 2GQQA 3F22A 3NRVA 4CYDA 3L2CA 2FF4A 4HQMA 3K1MA 2HYFA 3EUHA 1K79A 2VC1A 3I71A 1DUXC 2O6GE 2GXBA 3HRTA 1R7JA 2ZMEA 3KP5A 1TQIA 4IRIA 3CO6C 1Z7UA 2QBYA 1IXRC 5DYMA 1FBSA 2DLLA 5LHGA 2VN2A 1HKQA 4IPAA 3MQ0A 4P55A 4KN7X 5AIQA 1IF1A 3H3UA 4HDVA 4CGZA 4I02A 3TGNA 4KDPA 2AXLA 2XVCA 1T98A 1R00A 2EV0A 4MGRA 1ON1A 1FC3A 1MDMB 5DUIA 3WU1B 1KU9A 1P4WA 3N4MA 3IRRA 1QNTA 3SHFA 4WK8F 4PCQA 4TV7A 4YIFA 2ZKZA 2VE9A 5HOOA 5L3GA 3KFWX 4DNCA 2FE3A 3VB2A 3KP3A 3ZMZA 1MKMA 5DEQA 2VE8A 3ISPA 4B09A 4UNOA 4XBFA 4L9JA 2VBYA 1JHHA 1TNTA 3HRSA 1DPUA 1YIOA 4LB6B 1UFMA 2FEZA 4WXDA 3L09A 1WSUA 1FX7A 2OBPA 1ZG1A 2P6SA 3IRQA 3BJOA 4WWCA 1ONVA 1Z9CA 3P9KA 2ZMEB 4EM1A 4GYGA 2PN6A 3REOA 2UXNA 4ZYHA 4ESBA 5LRSA 2QBYB 3M8EA 2ZFWA 4OIRF 2WWYA 3KZZA 1BI3A 2HDCA 3P7NA 3SZPA 1HKSA 3SFZA 1SD4A 1LNWA 4MTDA 1P4AA 5BMZA 2J5OA 5JR3A 4HQEA 1ZG3A 5BOXA 4O5VA 2PFBA 5BPDA 1SMTA 2CGPA 3HHHA 2K4JA 4JK1X 1SD6A 4A0XA 3E6CC 3HRUA 1LQ1A 5ERIA 5ICEA 1XD7A 1E2XA 1UCRA 3TOAA 1BN5A 2XRNA 2O0YA 4UVBA 3RKYA 1UHMA 4LK1F 3KEOA 2RDPA 3P9CA 2OAZA 3IWFA 5ILUA 3E6BA 3JSPA 1HXDA 4M72A 2GAUA 1VTNC 4HZFA 4HF0A 1QPMA 5HS7A 3LSTA 5LGNA 3GVAA 5LLQA 1EH6A 1ON2A 3EYYA 3WGGA 2L4AA 2ZNYA 5FFXA 1YO5C 1TW3A 1F5TA 3CUQC 3V4GA 1BI2A 3GFMA 3WGIA 2P5KA 1XDUA 2HYGD 5FO5A 1USTA 2XHKA 1KQ8A 4RGSA 5JHUA 2XGXA 1GXQA 1FWZA 3F3XA 4WX9A 3WE2A 2M87A 4CDGA 4L18B 3PQKA 2FU4A 4CHUA 5A2QZ 2EV5A 1ODDA 3KP7A 2KIFA 3ZP5A 3G73A 3HOSA 1MZBA 3FF5A 5BQTA 5IT9K 3K1PA 3ECOA 2RKHA 2PI0A 1FYLA 1SFEA 3TO6A 3N97A 2JZYA 3FMQA 4Y17A 2VOOA 4RAZA 2MA3A 3FMRA 1T0FA 1BC8C 1T6SA 1K6OA 3M9AA 3HHGA 3J81K 2NRAC 4OU0A 4G6QA 2NNNA 3C1DA 5HLGA 4RB3C 1IXSB 1IN7A 3F8NA 4IVNA 2P8TA 2F2EA 4ASNA 3I54A 2BV6A 2M8EA 5E8IA 5DD8A 2UZKA 4R8HA 4RB0A 3CO7C 5BS6A 3KLOA 2FBHA 3FHZA 1LEAA 1W5TA 1TLHB 1BI1A 1WI9A 2QUFA 3IC7A 4P5OA 3LQRA 3GYHX 2Y48A 5CLSA 2D1HA 4ZYDA 2FXAA 3HSFA 3LA3A 2GWRA 4Q4ZF 1XSVA 2M30A 4BHCA 3OV8A 2KRFA 1B9NA 1L0OC 4LG0A 3JSOA 2V1XA 1RIOH 1ZYRF 1O3RA 3MCZA 4IJAA 1HSJA 5D5XB 2WTEA 1ZHFA 5J8FA 3JTHA 5K1YA 5L3BA 2H09A 1QZYA 5HLIA 4KMFA 4U7DA 1J2XA 2DK8A 2F5DA 4HF2A 4A0YA 3GFJA 1FNNA 4WF2A 4RB2C 5ILVA 2XASA 3KETA 3LAJA 2F5FA 5HVQC 5J6XA 1B59A 1JGSA 1GXPA 3G3ZA 2XKPA 1FBQA 1R5GA 1XB4A 1MJAA 2V6CA 3B02A 3AAFA 2R7DA 1RUOA 4P9FA 2AS5F 2M5WA 2DT5A 3U9GA 1IUYA 3W6JB 3QRFF 2E7WA 1U78A 2H94A 3WTSC 2K86A 3HOTA 4M6YA 4BHPA 3HIFA 1YFHA 3T0YA 4IF4A 4XLPF 3S2WA 1ZARA 3M8FA 2A69F 3WGHA 3D0SA 1T38A 1U5TA 4KICA 1G4DA 5J8CA 5HDKA 1ZGAA 2A61A 3RKXA 3FZVA 3GF2A 2A68F 4GO1A 2C6YA 1Z05A 4ENJA 2FA5A 2IA1A 2FMLA 4BAYA 5D5VB 2K7LA 4IHSA 1XMAA 3GFIA 1ZG5A 2A3SA 4M74A 2H6CA 3B73A 2XV4S 3ULQB 2LSOA 3I53A 2NNYA 2DO7A 3O3KA 3FXUA 4Z2YA 3GZ5A 4ZZDA 3FX3A 3IHUA 2L3DA 1IRFA 5E1XA 3BJAA 2V79A 2IJLA 3CTAA 4EJVA 1Z6RA 4EJUA 5CVRA 3ZN1A 2LDUA 1NHAA 4L9TA 1P2FA 3ZMUA 3GX4X 2QQBA 1G6NA 2VONA 5JI6A 4AIJA 3GUDA 2JRTA 1RNLA 4LJZF 3DP7A 2DK5A 1MDMA 4PDKA 4NQWA 5D6FA 4ZYGA 4ZH4F 2PEXA 3MAJA 4ENNA 2W57A 3T5XA 5E8GA 3ZQ7A 3SQNA 4I01A 4G7ZF 1U5TB 3VODA 3K9TA 5E18F 5K5OA 5D4SA 1QQIA 2VBXA 2EB7A 2DW4A 2P4WA 5CVUA 2D45A 3M1EA 3OOPA 1FSHA 3E5XA 2GA1A 2DI3A 2MH2A 4HYEA 3F8MA 1S7OA 3BPVA 2CW0F 1RZ4A 3L7WA 1KQ9A 3ABUA 1K78A 2X0LA 1QGPA 1FP2A 4G8XA 3I4PA 4HV6A 4A5MA 4ESFA 2QVOA 3H92A 3TOBA 2CWEA 1UB9A 3RJPA 4R79A 3QU3A 5F6FA 2DU9A 1KYZA 2J5PA 1BOAA 2DQLA 2YU3A 4HV5A 2HFHA 2NS0A 2JPCA 5HDGA 1SMYF 2QQ9A 2VBZA 3HTUA 3C7JA 2IW5A 2XAGA 1ZN2A 4Q48A 1TQMA 1X3UA 4MQVA 3QPHA 4IXAA 5DCFA 2V9VA 4LMYA 4U88A 4M9SA 3BOQA 1P4XA 2M45A 3LA7A 1Y0UA 4BQAA 3ELKA 4RAYA 5ICFA 3QP6A 3FXRA 1KYWA 4L0YB 2IA0A 3ZMSA 2Z5UA 3Q5FA 1J59A 1IN5A 1QBJA 4CO8A 5LRRA 1XCVA 2L02A 4U0WA 3J80K 3GXOA 2CQKA 2ISYA 2L4MA 3H3ZA 2LKPA 5LGTA 1K78B 3QAHA 3GLXA 5K5QA 4BH9A 4UVAA 5KVRA 3LAPA 3F21A 2OD5A 2QM3A 2ELHA 3ML6A 3HSEA 2ADUA 1DP7P 4OOIA 2ETHA 2P7VB 1RUNA 2JSCA 5ILSA 5LGUA 1Z91A 3CUOA 2YX4A 1ULYA 3WTZA 4XLNF 1XSXA 4EVIA 4QLCU 1XGNA 2A5YB 1R58A 1CF7B 2Q0OA 3IKVA 4M73A 2R3SA 4E70A 1Z6TA 3PFIA 4EGYA 3E5UA 4UHTA 4RGRA 1YW7A 2ZJ2A 4WCGA 1R36A 4LLNA 2MC3A 5AONA 3BDDA 3R6SA 5LHHA 4LLLA 4IRHA 3BPXA 2CFXA 3RPQA 2Z9OA 2LF7A 4L5JA 5FLXK 5FFZA 3TDZC 3E5QA 3ZN0A 1AWCA 1TW2A 2A6HF 2L01A 4KNYA 1OYWA 3WU0A 2VXZA 1MD0A 1I1SA 5D6EA 2V1UA 2PQ8A 3HSRA 2Z33A 1W7PD 1D8KA 2FNPA 3RIRA 5D8LB 4KIFA 3RKWA 1RI7A 3K1NA 6PAXA 2MD5A 2HKXA 3I59A 3ABTA 1OYIA 3MFKA 4DQ2A 1C0WA 2RC4A 4O3MA 5L3FA 2KJBA 1KQ0A 1LVAA 1JE8A 4I0AA 2FBIA 3VEPA 1V3FA 1TBXA 2PMHA 4EJWA 2ZNZA 4EGZA 1PP7U 2X4HA 1XCBA 3LFKA 3KZYA 1F4KA 4XRFA 1G3TA 2GXGA 3K69A 1BM9A 3F23A 3BY6A 2BEOA 4CICA 2ZCWA 3MZYA 1PP8F 1QO0D 3FM5A 4A6DA 3DQVC 1H9TA 1QZZA 3F8CA 2JTVA 4EQQA 2OZ6A 1JHFA 3GEZA 1LDJA 2E7XA 1XGMA 1R1VA 4JBAA 1H9GA 2YR2A 1R23A 1B9MA 1W7PA 2TDXA 3KP4A 4OINF 5CVVA 3DF8A 3VOEA 2GZWA 3ZPLA 5D8KB 4MQ9F 5CJ9A 4WXHA 4ON0A 1S3JA 3HUGA 5AIPA 3JAMZ 1D3YA 1HW1A 4UV8A 3SZTA 3GFLA 2R7FA 1OMIA 5HDNA 1YQAA 1AOYA 3I59B 5IT3A 3IWZA 3P9IA 2EFOA 1IAWA 1XSDA 2D2WA 1O57A 1MGTA 2CSOA 2ISZA 3FWEA 1OR7A 3BJ6A 1O7FA 2B0LA 1HW5A 4HLYA 2XAFA 2YPRA 5H6QA 1U6GA 5DDGA 2RN7A 3ECHA 1J9IA 2EJRA 4HA8A 4EV0A 1IXCA 2CYYA 4L9VA 1V4RA 5A2QK 3C18A 3GZ6A 3T8RA 3CLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S05 A;  2RQP A;  4M71 A;  3I64 A;  3RTR A;  3U2R A;  1O3Q A;  4L9N A;  2DPU A;  2ESN A;  2ACJ A;  4KN4 X;  3KLN A;  3FMS A;  2Y75 A;  3O2P E;  1G3S A;  2RVC A;  2G9W A;  1YLF A;  2BGC A;  2PG4 A;  5HS8 A;  1FYM A;  1F9N A;  3KP6 A;  3ERE D;  1P92 A;  1XMK A;  2W84 A;  4KMU X;  3EDP A;  4A0Z A;  4U7B A;  1BBY A;  1W7P B;  5FGM A;  1I1G A;  5HS9 A;  5LEK A;  3BRO A;  3U1D A;  1I5Z A;  2P5L C;  2M1B A;  1LDD A;  1Z1D A;  3K0L A;  2G7H A;  2A07 F;  5FD6 A;  4B8X A;  4FHT A;  1FT9 A;  3I0T A;  4LGW A;  3VFZ A;  2E1C A;  4ETS A;  1BIB A;  4LB5 A;  3V8L A;  4HW0 A;  2H27 A;  2UXX A;  3GWZ A;  3LQQ A;  1YTY A;  3FM3 A;  1KU2 A;  2IRF G;  4HX7 A;  3EQL F;  4H0E A;  3TO7 A;  3EYI A;  1B6A A;  1LDK B;  3BP8 A;  2STT A;  1BI0 A;  3L00 A;  3WE3 A;  4YFX F;  1I27 A;  5H20 A;  4IHT A;  1XDS A;  2ESH A;  1FY7 A;  4KYW A;  3MWM A;  3DXJ F;  2FMY A;  2WC2 A;  1ZH5 A;  5EEG A;  2EFN A;  2OQR A;  5DUK A;  1YS7 A;  2OA4 A;  2MBF A;  1K7A A;  4K2E A;  4M9X A;  2VT2 A;  4HX8 A;  2P6T A;  3NQO A;  3R61 A;  4F7Z A;  1YS6 A;  4HX4 A;  4G9Y A;  4P96 A;  5CYV A;  4GYI A;  4L5I A;  3MEX A;  1YG2 A;  1DDN A;  3KE2 A;  2EK5 A;  4BYY A;  1OYY A;  2FNA A;  4RB1 A;  3V7S A;  5F64 A;  2ZXJ A;  5CVJ A;  3E97 A;  1FYK A;  4HDU A;  1LJ9 A;  2QWW A;  3MZH A;  2W85 A;  2FSW A;  3CDH A;  2EA2 A;  3ZMD A;  4AIH A;  1HST A;  2EFQ A;  2Z99 A;  2MLK A;  1FP1 D;  2QEN A;  1BIA A;  1JXS A;  2IVM A;  3M7G A;  5DCM A;  4P9U A;  4XSX F;  3E6D A;  2HQN A;  4OIQ F;  1S7A A;  4BXU A;  5TRD A;  2FRH A;  2G7U A;  3V8K A;  4R1H A;  3W6K B;  2PJP A;  3T8T A;  4KT5 C;  2VBW A;  1W4M A;  4FX4 A;  3T1B A;  1WRJ A;  2PMU A;  1CF7 A;  3R4K A;  5FLX Z;  2Z3Y A;  4G6D A;  5L3D A;  1IN8 A;  2XAH A;  1FOK A;  2VOP A;  2HEO A;  1H0M A;  2HOE A;  1BC7 C;  2ZBK A;  3BZ6 A;  4UV9 A;  1IW7 F;  4OIO F;  4HLX A;  3TO9 A;  4AWX B;  3LWF A;  3WTW C;  2NAZ A;  4RGU A;  1PUE E;  2CG4 A;  1I6X A;  1S8N A;  1HW2 A;  2QZ8 A;  4XSZ F;  1U3E M;  2MLG A;  3WG9 A;  1SAX A;  3PQJ A;  5IT9 Z;  3WTY C;  5H6R A;  2HTS A;  3I58 A;  2EFP A;  2KJC A;  2FBK A;  5DV5 A;  1FLI A;  1MJB A;  5LHI A;  4UXN A;  1STZ A;  2PBI A;  4ENM A;  3SXY A;  2KIU A;  3O6B B;  2HR3 A;  2OQG A;  3J81 Z;  5HLH A;  1R1T A;  5E1Z B;  3IKT A;  2RGV A;  2O3F A;  1KGS A;  2EV6 A;  1ZRC A;  2K02 A;  5DCM B;  1W5S A;  2VOD A;  3E3V A;  2EA4 A;  1J7K A;  2Q2E A;  1A04 A;  2A6E F;  4U0V A;  4LK0 F;  5E17 F;  1BJA A;  4LLG F;  2STW A;  2COM A;  4MNU A;  5JFR A;  2BE5 F;  1EH7 A;  1YYV A;  2Q8K A;  4G7H F;  1TNS A;  4N9I A;  2P5V A;  1WKM A;  4RS8 A;  2HTJ A;  2MH9 A;  1S29 A;  5ED4 A;  1FSE A;  1CGP A;  1XGO A;  3J7A O;  2OZU A;  4Q5S F;  2GIV A;  1SFX A;  2HQR A;  2KKO A;  1FZP B;  4G7O F;  2FQ3 A;  3QU6 A;  3Q9S A;  2LF8 A;  5L3E A;  2JPB A;  3V7C A;  2YX7 A;  2XIG A;  4A12 A;  1O3S A;  4A5N A;  1PDN C;  1KU3 A;  1OKR A;  2EFW A;  2DAO A;  2P7C B;  4YII A;  2BYV E;  2HGC A;  2RNJ A;  3R0J A;  3KCC A;  4ENK A;  1T2K A;  2HS5 A;  5L3C A;  2UWM A;  3RDI A;  4MTE A;  1ZGJ A;  3GW2 A;  2H6B A;  1P6R A;  1Q1H A;  1KU7 A;  3DKW A;  5D4R A;  1REP C;  2VC0 A;  2V1D A;  2CO5 A;  3C3W A;  1ZLJ A;  3DFG A;  5ICC A;  4ZYE A;  1TQP A;  1ZLK A;  2PLY A;  4BNC A;  4KIG A;  2IA2 A;  3R0A A;  1GHC A;  1EH8 A;  3CJN A;  2DBB A;  1USS A;  1B4A A;  4CXF A;  1EV7 A;  4A6E A;  2O61 A;  4M9Z A;  1WQ2 A;  1L3L A;  2QQA A;  1R22 A;  5LBQ A;  4FT8 A;  4I98 B;  4KIB A;  2XKO A;  4YFK F;  4IRG A;  3F72 A;  2GA2 A;  1KA8 A;  2IPQ X;  4MHG A;  2HWV A;  4QWQ A;  4GCV A;  3QP5 A;  3WTV C;  2W25 A;  1IRG A;  1IZ1 A;  3HRM A;  5KK1 A;  4O6J A;  4M6X A;  4UVC A;  4AIK A;  3FXQ A;  2OU2 A;  3V8J A;  4Y13 A;  1D8J A;  4NHJ A;  1LEB A;  1B1B A;  2WV0 A;  4ESJ A;  3NEU A;  1XGS A;  5DD4 A;  4JQF A;  2XRO A;  4EM0 B;  3LA2 A;  3RI4 A;  3ZMV A;  3Q9V A;  3COA C;  3F6O A;  1U5T C;  5EEH A;  3CUQ A;  1T39 A;  4WXC A;  4LD5 A;  1J75 A;  4KA4 A;  1J0R A;  3HYI A;  2FOK A;  3ZMT A;  3RYR A;  1S6L A;  2YSR A;  5CVI A;  1O3T A;  3EET A;  4KUM A;  3BWG A;  2BBY A;  4KFC A;  5D5W B;  4OMZ A;  3F6V A;  2QYO A;  1HQC A;  5E20 A;  4HAM A;  2D1V A;  5E1W A;  1D5V A;  2O03 A;  3TKY A;  4PGG A;  3IL2 A;  4EJT A;  3K2Z A;  1R5H A;  2IT0 A;  3D5L A;  1FPQ A;  2F5C A;  4Y15 A;  3WTX C;  4UUV A;  1UHW A;  4AD9 A;  5D5U B;  3HTS B;  1MJ9 A;  4BHB A;  3WTT C;  1YW9 A;  3KEQ A;  5F1R A;  4CZZ A;  4HBL A;  1LB2 A;  3L9F A;  1ZRE A;  4EMS A;  2VT3 A;  2K27 A;  2E1N A;  1IN6 A;  5ICG A;  1SD5 A;  2HKO A;  1HBX G;  2DTR A;  2KIM A;  1J5Y A;  1ZAO A;  3QPT A;  2K4B A;  3WTU C;  1OPC A;  4FX0 A;  3GO5 A;  4NB5 A;  2DQR A;  4MEY F;  2XUB A;  5FB2 A;  4YG2 F;  1E17 A;  4I09 A;  3CUQ B;  5JVT A;  4S04 A;  5FD5 A;  4YFN F;  2W24 A;  1U8R A;  4OIP F;  1YW8 A;  4I2O A;  3V7R A;  1G3W A;  1O7L A;  3F8B A;  3JW4 A;  3TQN A;  5K5R A;  3ROU A;  2XAJ A;  1F1Z A;  3E6M A;  3DPL C;  4A2U A;  1GVJ A;  2HZT A;  4AVP A;  3KP2 A;  4EJO A;  1IN4 A;  3DPT A;  4G94 A;  4L0Z B;  4I7H A;  5TJJ A;  1FBU A;  4LG0 B;  1ZRD A;  4RGX A;  2EWN A;  4I0B A;  4D0P A;  2QLZ A;  1SFU A;  2DPD A;  3R60 A;  4HOB A;  3F8F A;  4MEX F;  1WWX A;  2L54 A;  1HKT A;  3JAM K;  5BPI A;  2NYX A;  1G3Y A;  2DFI A;  2LNB A;  3DV8 A;  3RPU A;  4PZJ A;  1TTY A;  1ZRF A;  4PGH A;  3DEU A;  3I5U A;  1R1U A;  2F5E A;  4GGG A;  4HF1 A;  3RYP A;  2XAQ A;  3J80 Z;  4EM2 A;  3JTG A;  2ZO4 A;  4N0B A;  3WOD F;  4U0Y A;  3TDU C;  4OMY A;  4ZZL A;  2Y0M A;  4Q47 A;  4GXO A;  1XN7 A;  1SD7 A;  2IP2 A;  5LEJ A;  2JT1 A;  3QOP A;  1DPR A;  4LFU A;  4N9H A;  2O8X A;  1U2W A;  2RV8 A;  2GQQ A;  3F22 A;  3NRV A;  4CYD A;  3L2C A;  2FF4 A;  4HQM A;  3K1M A;  2HYF A;  3EUH A;  1K79 A;  2VC1 A;  3I71 A;  1DUX C;  2O6G E;  2GXB A;  3HRT A;  1R7J A;  2ZME A;  3KP5 A;  1TQI A;  4IRI A;  3CO6 C;  1Z7U A;  2QBY A;  1IXR C;  5DYM A;  1FBS A;  2DLL A;  5LHG A;  2VN2 A;  1HKQ A;  4IPA A;  3MQ0 A;  4P55 A;  4KN7 X;  5AIQ A;  1IF1 A;  3H3U A;  4HDV A;  4CGZ A;  4I02 A;  3TGN A;  4KDP A;  2AXL A;  2XVC A;  1T98 A;  1R00 A;  2EV0 A;  4MGR A;  1ON1 A;  1FC3 A;  1MDM B;  5DUI A;  3WU1 B;  1KU9 A;  1P4W A;  3N4M A;  3IRR A;  1QNT A;  3SHF A;  4WK8 F;  4PCQ A;  4TV7 A;  4YIF A;  2ZKZ A;  2VE9 A;  5HOO A;  5L3G A;  3KFW X;  4DNC A;  2FE3 A;  3VB2 A;  3KP3 A;  3ZMZ A;  1MKM A;  5DEQ A;  2VE8 A;  3ISP A;  4B09 A;  4UNO A;  4XBF A;  4L9J A;  2VBY A;  1JHH A;  1TNT A;  3HRS A;  1DPU A;  1YIO A;  4LB6 B;  1UFM A;  2FEZ A;  4WXD A;  3L09 A;  1WSU A;  1FX7 A;  2OBP A;  1ZG1 A;  2P6S A;  3IRQ A;  3BJO A;  4WWC A;  1ONV A;  1Z9C A;  3P9K A;  2ZME B;  4EM1 A;  4GYG A;  2PN6 A;  3REO A;  2UXN A;  4ZYH A;  4ESB A;  5LRS A;  2QBY B;  3M8E A;  2ZFW A;  4OIR F;  2WWY A;  3KZZ A;  1BI3 A;  2HDC A;  3P7N A;  3SZP A;  1HKS A;  3SFZ A;  1SD4 A;  1LNW A;  4MTD A;  1P4A A;  5BMZ A;  2J5O A;  5JR3 A;  4HQE A;  1ZG3 A;  5BOX A;  4O5V A;  2PFB A;  5BPD A;  1SMT A;  2CGP A;  3HHH A;  2K4J A;  4JK1 X;  1SD6 A;  4A0X A;  3E6C C;  3HRU A;  1LQ1 A;  5ERI A;  5ICE A;  1XD7 A;  1E2X A;  1UCR A;  3TOA A;  1BN5 A;  2XRN A;  2O0Y A;  4UVB A;  3RKY A;  1UHM A;  4LK1 F;  3KEO A;  2RDP A;  3P9C A;  2OAZ A;  3IWF A;  5ILU A;  3E6B A;  3JSP A;  1HXD A;  4M72 A;  2GAU A;  1VTN C;  4HZF A;  4HF0 A;  1QPM A;  5HS7 A;  3LST A;  5LGN A;  3GVA A;  5LLQ A;  1EH6 A;  1ON2 A;  3EYY A;  3WGG A;  2L4A A;  2ZNY A;  5FFX A;  1YO5 C;  1TW3 A;  1F5T A;  3CUQ C;  3V4G A;  1BI2 A;  3GFM A;  3WGI A;  2P5K A;  1XDU A;  2HYG D;  5FO5 A;  1UST A;  2XHK A;  1KQ8 A;  4RGS A;  5JHU A;  2XGX A;  1GXQ A;  1FWZ A;  3F3X A;  4WX9 A;  3WE2 A;  2M87 A;  4CDG A;  4L18 B;  3PQK A;  2FU4 A;  4CHU A;  5A2Q Z;  2EV5 A;  1ODD A;  3KP7 A;  2KIF A;  3ZP5 A;  3G73 A;  3HOS A;  1MZB A;  3FF5 A;  5BQT A;  5IT9 K;  3K1P A;  3ECO A;  2RKH A;  2PI0 A;  1FYL A;  1SFE A;  3TO6 A;  3N97 A;  2JZY A;  3FMQ A;  4Y17 A;  2VOO A;  4RAZ A;  2MA3 A;  3FMR A;  1T0F A;  1BC8 C;  1T6S A;  1K6O A;  3M9A A;  3HHG A;  3J81 K;  2NRA C;  4OU0 A;  4G6Q A;  2NNN A;  3C1D A;  5HLG A;  4RB3 C;  1IXS B;  1IN7 A;  3F8N A;  4IVN A;  2P8T A;  2F2E A;  4ASN A;  3I54 A;  2BV6 A;  2M8E A;  5E8I A;  5DD8 A;  2UZK A;  4R8H A;  4RB0 A;  3CO7 C;  5BS6 A;  3KLO A;  2FBH A;  3FHZ A;  1LEA A;  1W5T A;  1TLH B;  1BI1 A;  1WI9 A;  2QUF A;  3IC7 A;  4P5O A;  3LQR A;  3GYH X;  2Y48 A;  5CLS A;  2D1H A;  4ZYD A;  2FXA A;  3HSF A;  3LA3 A;  2GWR A;  4Q4Z F;  1XSV A;  2M30 A;  4BHC A;  3OV8 A;  2KRF A;  1B9N A;  1L0O C;  4LG0 A;  3JSO A;  2V1X A;  1RIO H;  1ZYR F;  1O3R A;  3MCZ A;  4IJA A;  1HSJ A;  5D5X B;  2WTE A;  1ZHF A;  5J8F A;  3JTH A;  5K1Y A;  5L3B A;  2H09 A;  1QZY A;  5HLI A;  4KMF A;  4U7D A;  1J2X A;  2DK8 A;  2F5D A;  4HF2 A;  4A0Y A;  3GFJ A;  1FNN A;  4WF2 A;  4RB2 C;  5ILV A;  2XAS A;  3KET A;  3LAJ A;  2F5F A;  5HVQ C;  5J6X A;  1B59 A;  1JGS A;  1GXP A;  3G3Z A;  2XKP A;  1FBQ A;  1R5G A;  1XB4 A;  1MJA A;  2V6C A;  3B02 A;  3AAF A;  2R7D A;  1RUO A;  4P9F A;  2AS5 F;  2M5W A;  2DT5 A;  3U9G A;  1IUY A;  3W6J B;  3QRF F;  2E7W A;  1U78 A;  2H94 A;  3WTS C;  2K86 A;  3HOT A;  4M6Y A;  4BHP A;  3HIF A;  1YFH A;  3T0Y A;  4IF4 A;  4XLP F;  3S2W A;  1ZAR A;  3M8F A;  2A69 F;  3WGH A;  3D0S A;  1T38 A;  1U5T A;  4KIC A;  1G4D A;  5J8C A;  5HDK A;  1ZGA A;  2A61 A;  3RKX A;  3FZV A;  3GF2 A;  2A68 F;  4GO1 A;  2C6Y A;  1Z05 A;  4ENJ A;  2FA5 A;  2IA1 A;  2FML A;  4BAY A;  5D5V B;  2K7L A;  4IHS A;  1XMA A;  3GFI A;  1ZG5 A;  2A3S A;  4M74 A;  2H6C A;  3B73 A;  2XV4 S;  3ULQ B;  2LSO A;  3I53 A;  2NNY A;  2DO7 A;  3O3K A;  3FXU A;  4Z2Y A;  3GZ5 A;  4ZZD A;  3FX3 A;  3IHU A;  2L3D A;  1IRF A;  5E1X A;  3BJA A;  2V79 A;  2IJL A;  3CTA A;  4EJV A;  1Z6R A;  4EJU A;  5CVR A;  3ZN1 A;  2LDU A;  1NHA A;  4L9T A;  1P2F A;  3ZMU A;  3GX4 X;  2QQB A;  1G6N A;  2VON A;  5JI6 A;  4AIJ A;  3GUD A;  2JRT A;  1RNL A;  4LJZ F;  3DP7 A;  2DK5 A;  1MDM A;  4PDK A;  4NQW A;  5D6F A;  4ZYG A;  4ZH4 F;  2PEX A;  3MAJ A;  4ENN A;  2W57 A;  3T5X A;  5E8G A;  3ZQ7 A;  3SQN A;  4I01 A;  4G7Z F;  1U5T B;  3VOD A;  3K9T A;  5E18 F;  5K5O A;  5D4S A;  1QQI A;  2VBX A;  2EB7 A;  2DW4 A;  2P4W A;  5CVU A;  2D45 A;  3M1E A;  3OOP A;  1FSH A;  3E5X A;  2GA1 A;  2DI3 A;  2MH2 A;  4HYE A;  3F8M A;  1S7O A;  3BPV A;  2CW0 F;  1RZ4 A;  3L7W A;  1KQ9 A;  3ABU A;  1K78 A;  2X0L A;  1QGP A;  1FP2 A;  4G8X A;  3I4P A;  4HV6 A;  4A5M A;  4ESF A;  2QVO A;  3H92 A;  3TOB A;  2CWE A;  1UB9 A;  3RJP A;  4R79 A;  3QU3 A;  5F6F A;  2DU9 A;  1KYZ A;  2J5P A;  1BOA A;  2DQL A;  2YU3 A;  4HV5 A;  2HFH A;  2NS0 A;  2JPC A;  5HDG A;  1SMY F;  2QQ9 A;  2VBZ A;  3HTU A;  3C7J A;  2IW5 A;  2XAG A;  1ZN2 A;  4Q48 A;  1TQM A;  1X3U A;  4MQV A;  3QPH A;  4IXA A;  5DCF A;  2V9V A;  4LMY A;  4U88 A;  4M9S A;  3BOQ A;  1P4X A;  2M45 A;  3LA7 A;  1Y0U A;  4BQA A;  3ELK A;  4RAY A;  5ICF A;  3QP6 A;  3FXR A;  1KYW A;  4L0Y B;  2IA0 A;  3ZMS A;  2Z5U A;  3Q5F A;  1J59 A;  1IN5 A;  1QBJ A;  4CO8 A;  5LRR A;  1XCV A;  2L02 A;  4U0W A;  3J80 K;  3GXO A;  2CQK A;  2ISY A;  2L4M A;  3H3Z A;  2LKP A;  5LGT A;  1K78 B;  3QAH A;  3GLX A;  5K5Q A;  4BH9 A;  4UVA A;  5KVR A;  3LAP A;  3F21 A;  2OD5 A;  2QM3 A;  2ELH A;  3ML6 A;  3HSE A;  2ADU A;  1DP7 P;  4OOI A;  2ETH A;  2P7V B;  1RUN A;  2JSC A;  5ILS A;  5LGU A;  1Z91 A;  3CUO A;  2YX4 A;  1ULY A;  3WTZ A;  4XLN F;  1XSX A;  4EVI A;  4QLC U;  1XGN A;  2A5Y B;  1R58 A;  1CF7 B;  2Q0O A;  3IKV A;  4M73 A;  2R3S A;  4E70 A;  1Z6T A;  3PFI A;  4EGY A;  3E5U A;  4UHT A;  4RGR A;  1YW7 A;  2ZJ2 A;  4WCG A;  1R36 A;  4LLN A;  2MC3 A;  5AON A;  3BDD A;  3R6S A;  5LHH A;  4LLL A;  4IRH A;  3BPX A;  2CFX A;  3RPQ A;  2Z9O A;  2LF7 A;  4L5J A;  5FLX K;  5FFZ A;  3TDZ C;  3E5Q A;  3ZN0 A;  1AWC A;  1TW2 A;  2A6H F;  2L01 A;  4KNY A;  1OYW A;  3WU0 A;  2VXZ A;  1MD0 A;  1I1S A;  5D6E A;  2V1U A;  2PQ8 A;  3HSR A;  2Z33 A;  1W7P D;  1D8K A;  2FNP A;  3RIR A;  5D8L B;  4KIF A;  3RKW A;  1RI7 A;  3K1N A;  6PAX A;  2MD5 A;  2HKX A;  3I59 A;  3ABT A;  1OYI A;  3MFK A;  4DQ2 A;  1C0W A;  2RC4 A;  4O3M A;  5L3F A;  2KJB A;  1KQ0 A;  1LVA A;  1JE8 A;  4I0A A;  2FBI A;  3VEP A;  1V3F A;  1TBX A;  2PMH A;  4EJW A;  2ZNZ A;  4EGZ A;  1PP7 U;  2X4H A;  1XCB A;  3LFK A;  3KZY A;  1F4K A;  4XRF A;  1G3T A;  2GXG A;  3K69 A;  1BM9 A;  3F23 A;  3BY6 A;  2BEO A;  4CIC A;  2ZCW A;  3MZY A;  1PP8 F;  1QO0 D;  3FM5 A;  4A6D A;  3DQV C;  1H9T A;  1QZZ A;  3F8C A;  2JTV A;  4EQQ A;  2OZ6 A;  1JHF A;  3GEZ A;  1LDJ A;  2E7X A;  1XGM A;  1R1V A;  4JBA A;  1H9G A;  2YR2 A;  1R23 A;  1B9M A;  1W7P A;  2TDX A;  3KP4 A;  4OIN F;  5CVV A;  3DF8 A;  3VOE A;  2GZW A;  3ZPL A;  5D8K B;  4MQ9 F;  5CJ9 A;  4WXH A;  4ON0 A;  1S3J A;  3HUG A;  5AIP A;  3JAM Z;  1D3Y A;  1HW1 A;  4UV8 A;  3SZT A;  3GFL A;  2R7F A;  1OMI A;  5HDN A;  1YQA A;  1AOY A;  3I59 B;  5IT3 A;  3IWZ A;  3P9I A;  2EFO A;  1IAW A;  1XSD A;  2D2W A;  1O57 A;  1MGT A;  2CSO A;  2ISZ A;  3FWE A;  1OR7 A;  3BJ6 A;  1O7F A;  2B0L A;  1HW5 A;  4HLY A;  2XAF A;  2YPR A;  5H6Q A;  1U6G A;  5DDG A;  2RN7 A;  3ECH A;  1J9I A;  2EJR A;  4HA8 A;  4EV0 A;  1IXC A;  2CYY A;  4L9V A;  1V4R A;  5A2Q K;  3C18 A;  3GZ6 A;  3T8R A;  3CLO A; 
#chains in the Genus database with same CATH topology
 1WJ5 A;  1LPQ A;  2LFB A;  2RQP A;  4S05 A;  3CCM I;  4JX4 A;  3WHB A;  4M71 A;  3ZRG A;  2HOA A;  3I64 A;  3RTR A;  3U2R A;  5C3E J;  2RQQ A;  3OYN A;  1O3Q A;  4L9N A;  1W36 C;  2QSG X;  2DPU A;  2ESN A;  2X6Y A;  2ACJ A;  2NOG A;  4KN4 X;  3KLN A;  3FMS A;  2Y75 A;  3Q0V A;  2R7S A;  3O2P E;  1G3S A;  2RVC A;  2G9W A;  3RPU D;  3W2V A;  1YLF A;  1D1A A;  2BGC A;  1VI0 A;  2PG4 A;  2LBF B;  5HS8 A;  1FYM A;  1F9N A;  3KP6 A;  4M3G A;  3ERE D;  1P92 A;  4C2U A;  2WB1 N;  1XMK A;  2W84 A;  1HOM A;  3GBG A;  4KMU X;  3EDP A;  2OTL I;  3HG9 A;  1OCT C;  4A0Z A;  4U7B A;  4E7H A;  4PJL A;  2EZI A;  3TP0 A;  1BBY A;  1W7P B;  5FGM A;  1I1G A;  2DDB A;  3H0G J;  1EKE A;  5K7H A;  5HS9 A;  4YEJ A;  5LEK A;  3ZQI A;  3BRO A;  3U1D A;  3DEW A;  3HUG B;  1I5Z A;  4UB6 C;  2P5L C;  2EZL A;  3EUH C;  3H3V K;  4PK4 A;  4DBR A;  2M1B A;  4N4N B;  1XS9 A;  1LDD A;  1Z1D A;  2W4S A;  3K0L A;  2G7H A;  2A07 F;  5FD6 A;  4UUT A;  2IGN A;  4B8X A;  3DKX A;  4FHT A;  1FT9 A;  3I0T A;  1I39 A;  2CQX A;  1B8I A;  1NTC A;  1X2N A;  4LGW A;  1JT6 A;  3VFZ A;  4ETS A;  5M3M J;  2E1C A;  1BIB A;  5GAE J;  4Z6Y A;  2B9S A;  4LB5 A;  2KDZ A;  3RQ4 A;  5CPR B;  3V8L A;  3ESW B;  2MAB A;  4CCN A;  5E3L A;  2VJJ A;  4HW0 A;  4M3F A;  2H27 A;  1TC3 C;  1DGW Y;  2UXX A;  3GWZ A;  3LQQ A;  4BKX A;  1ZEL A;  1KU2 A;  3FM3 A;  4C3J J;  3DLL F;  1YTY A;  3GTP J;  2GM4 A;  5IP7 J;  3CCY A;  2IRF G;  4HX7 A;  2JA7 J;  2Y69 H;  4XRM A;  1GUU A;  3EQL F;  1KZH A;  2R0Q C;  4H0E A;  3TO7 A;  3EYI A;  2QGU A;  1B6A A;  3A0B C;  1LDK B;  3BP8 A;  3G1M A;  2IEK A;  2STT A;  1MNE A;  4AYB N;  1BI0 A;  4D9J A;  3L00 A;  1JTY A;  3WE3 A;  3KX2 A;  4D5F A;  4YFX F;  2N8G A;  2VB6 A;  3SZG A;  3SEZ A;  1I27 A;  5H20 A;  4IHT A;  2F48 A;  1XDS A;  2ESH A;  1FY7 A;  3GLL A;  2XB0 X;  2CU7 A;  4KYW A;  3MWM A;  3BR0 A;  3ZQQ A;  3DXJ F;  1APL C;  5FKN A;  3H5N A;  4ZTJ A;  3A2K A;  1A6I A;  2FMY A;  2WC2 A;  2XGD A;  3K4B A;  1ZH5 A;  5EEG A;  2EFN A;  2OQR A;  5DUK A;  1MBG A;  1FMV A;  1YS7 A;  2OA4 A;  3A01 A;  2E36 A;  2M9H A;  2MBF A;  1K7A A;  1XMX A;  4K2E A;  4M9X A;  2VT2 A;  4CSW A;  4HX8 A;  1T95 A;  2P6T A;  3K4M A;  5IP9 J;  3NQO A;  2XSJ C;  3R61 A;  4F7Z A;  2JA5 J;  1YS6 A;  1G59 A;  4HX4 A;  4G9Y A;  4P96 A;  2B63 J;  5CYV A;  4GYI A;  4L5I A;  2NVT J;  3MEX A;  1YG2 A;  1DDN A;  3LMM A;  3KE2 A;  5IYB J;  2EK5 A;  4YEL A;  1DQU A;  3MN2 A;  4BYY A;  2G0E A;  5J3L A;  1OYY A;  4F52 A;  2FNA A;  3HGG A;  2E1M C;  4RB1 A;  3V7S A;  5F64 A;  2ZXJ A;  2VKE A;  3LFU A;  3H5A A;  5CVJ A;  4PSW A;  3E97 A;  1FYK A;  3GTQ J;  4HDU A;  2L9S A;  4HG2 A;  3BG3 A;  1LJ9 A;  1QHG A;  2QWW A;  3J7Y J;  3MZH A;  2W85 A;  2FSW A;  4KJZ A;  1B8I B;  3CDH A;  4AID A;  2KZG A;  1GVD A;  1ZTR A;  5M5W J;  4XLC A;  2EA2 A;  3ZMD A;  4AIH A;  3MVP A;  1HST A;  2EFQ A;  2Z99 A;  3JRE A;  3FXJ A;  1D0Z A;  2MLK A;  1FP1 D;  2QEN A;  2LP0 A;  4XM3 A;  1Z21 A;  3CMY A;  4XQF A;  1VQP I;  1BIA A;  3H9G A;  1JXS A;  2FX0 A;  3S32 A;  2IVM A;  3M7G A;  3FIS A;  4U87 A;  5DCM A;  4P9U A;  2EBI A;  1OCZ H;  3E6D A;  2HVQ A;  2HQN A;  4XSX F;  4V2G A;  2CRG A;  3KYL A;  4OIQ F;  1S7A A;  4BXU A;  3ZQL A;  5TRD A;  2FRH A;  2G7U A;  3V8K A;  4R1H A;  3W6K B;  4D5C A;  2PJP A;  2R93 J;  3J7A Y;  3D5S C;  3T8T A;  4KT5 C;  2XGC A;  2VBW A;  4GDF A;  1W4M A;  4AM3 A;  4FX4 A;  3T1B A;  1WRJ A;  2Y9Y A;  2PMU A;  4M3B A;  1CF7 A;  3R4K A;  2JSP A;  2VJ5 A;  5LD2 C;  5FLX Z;  5K7Z A;  2Y30 A;  2K9Q A;  2Z3Y A;  4B1R A;  3L2R A;  4G6D A;  5L3D A;  1IN8 A;  5KAF C;  4XID A;  2XAH A;  1FOK A;  2GXA A;  2VOP A;  3TW7 A;  2F4O B;  1UMQ A;  2HEO A;  4BJT A;  1H0M A;  1X1B A;  2HOE A;  3A01 B;  1BC7 C;  3W2W A;  2ZBK A;  4Y52 J;  3BZ6 A;  5TIS C;  1MMD A;  4UV9 A;  1IW7 F;  4OIO F;  4HLX A;  2Q1Z B;  2BY3 A;  3TO9 A;  4AWX B;  1K4T A;  3DTE A;  3LWF A;  3WTW C;  2NAZ A;  4RGU A;  1PUE E;  1YE9 A;  1AKH A;  3SDB A;  4J19 A;  2CG4 A;  1I6X A;  3V42 A;  4C2M J;  1S8N A;  5GTI C;  1HW2 A;  4UY8 I;  4CCO A;  2QZ8 A;  4DW6 A;  2HPM A;  2LG4 A;  3CDI A;  2JUG A;  3K7A J;  5GTH C;  4XSZ F;  1U3E M;  2E60 A;  2MLG A;  3HKZ A;  1IUF A;  3DLA A;  3CZ6 A;  3WG9 A;  4G6T B;  3CJR B;  1SAX A;  3PQJ A;  1K6Y A;  5IT9 Z;  1Y1V J;  2RRE A;  1ZK8 A;  3WTY C;  4IX7 A;  5H6R A;  2HTS A;  3I58 A;  3H5R A;  1BJZ A;  3UNG C;  4G12 A;  2JMW A;  5J47 A;  2EFP A;  2KJC A;  4BBR J;  2FBK A;  5DV5 A;  1FLI A;  1ACI A;  1MJB A;  1TT5 B;  5LHI A;  1GT0 C;  4UXN A;  1STZ A;  2R7X A;  2PBI A;  4ENM A;  3A02 A;  3X2Q H;  3SXY A;  4DGW B;  2KIU A;  2CFO A;  4BAC A;  3O6B B;  2HR3 A;  3MKW B;  2HQ5 A;  2OQG A;  2BXZ A;  3J81 Z;  1JKQ C;  4PJJ A;  5HLH A;  1R1T A;  5E1Z B;  1F43 A;  3BR6 A;  4DZJ A;  2RGV A;  3IKT A;  4A3L J;  2O3F A;  5F1J A;  2JWT A;  1KGS A;  2EV6 A;  1ZRC A;  3L1P A;  2DOE A;  2K02 A;  5DCM B;  2X6X A;  2VPR A;  1X58 A;  1W5S A;  2VOD A;  2AO9 A;  3E3V A;  2EA4 A;  2XF7 A;  1J7K A;  2Q2E A;  1BOB A;  1A04 A;  5EG0 A;  2A6E F;  4U0V A;  4LK0 F;  5E17 F;  1BJA A;  4LLG F;  2BHZ A;  2STW A;  3RZD J;  1IRX A;  4XR6 A;  1VQK I;  2OUM A;  2COM A;  4MNU A;  2TRT A;  2GOM A;  5JFR A;  3GZN B;  1MBE A;  4A3M J;  2BE5 F;  1LKX A;  2M34 A;  1EH7 A;  1YYV A;  2Q8K A;  4G7H F;  1AU7 A;  1IO2 A;  1TNS A;  4N9I A;  3CCQ I;  2P5V A;  2OF7 A;  1WKM A;  4RS8 A;  2HTJ A;  2MH9 A;  1S29 A;  1Z3Y A;  2F6C A;  4ZDO A;  5ED4 A;  3NWS A;  1FSE A;  1CGP A;  1XGO A;  5EJC A;  1GV5 A;  4DZP A;  3J7A O;  3HDD A;  3G6E I;  1JUS A;  2M0C A;  3FXK A;  2M4G A;  2OZU A;  4Y7N J;  4Q5S F;  2GIV A;  1SFX A;  2HQR A;  2KKO A;  4BJ5 C;  1FZP B;  3CCU I;  3W2A A;  4AVZ A;  2RAE A;  2KQR A;  2FQ3 A;  1JT0 A;  4G7O F;  3HPH A;  3QU6 A;  3Q9S A;  2LF8 A;  1OLT A;  2ELJ A;  5L3E A;  2JPB A;  3CCE I;  1R71 A;  3V7C A;  2DA2 A;  4IHV A;  2YX7 A;  1AKH B;  2XIG A;  4A12 A;  2K9M A;  1O3S A;  2QCO A;  4A5N A;  1I3Q J;  4F92 B;  2LY1 A;  1PDN C;  4CCM A;  3NAR A;  1RR8 C;  2EQR A;  1KU3 A;  1OKR A;  2EFW A;  2ZXH A;  2DAO A;  4C30 A;  2P7C B;  4YII A;  1BR2 A;  2BYV E;  2HGC A;  2RNJ A;  3R0J A;  2WA0 A;  2XF6 A;  3KCC A;  2UV1 A;  5IP6 A;  3ZXS A;  3H9Q A;  4ENK A;  2CV1 A;  1T2K A;  2HS5 A;  5L3C A;  2UWM A;  2X1E A;  3RDI A;  4MTE A;  5GPA A;  4DOZ A;  1ZGJ A;  2VPL A;  4YIR X;  3H1C A;  3JRI A;  1BL0 A;  3GW2 A;  2H6B A;  1Y1W J;  4XOT A;  2KPM A;  1P6R A;  1ZR4 A;  2NVX J;  4BBS J;  1Q1H A;  3BT9 A;  1KU7 A;  4MFD A;  3DKW A;  4NBQ A;  3LNQ A;  2XGE A;  5D4R A;  4BDY A;  1REP C;  2VC0 A;  4PFO A;  2V1D A;  2CO5 A;  3C3W A;  3DFG A;  1ZLJ A;  1I50 J;  5ICC A;  3PIO F;  4ZYE A;  1TQP A;  1ZLK A;  2F4M B;  1ETV A;  4AYB A;  3PIP F;  2PLY A;  1SFK A;  4BNC A;  3SEQ A;  4KIG A;  2IA2 A;  3R0A A;  3HPG A;  1XG1 A;  1GHC A;  1EH8 A;  1RET A;  5CQG A;  3CJN A;  2DBB A;  2M7B A;  2X6O A;  3ABK H;  4A3C J;  1USS A;  1B4A A;  2XPV A;  3BR2 A;  3FKI J;  4CXF A;  4E7S A;  1Y8R B;  1EV7 A;  5EG0 B;  1NG7 A;  4A6E A;  2O61 A;  2WAD A;  4M9Z A;  1WQ2 A;  1L3L A;  1IDZ A;  2L9N A;  2QQA A;  1R4M B;  1R22 A;  3E0J B;  2JJ7 A;  4F3Q A;  2Y0S A;  4FT8 A;  5LBQ A;  4I98 B;  3OS1 A;  4KIB A;  2XKO A;  4YFK F;  3OYG A;  4A69 C;  4IRG A;  3F72 A;  1OR7 C;  2GA2 A;  1KA8 A;  3ZQF A;  3S17 J;  4A3I J;  3GTM J;  3HOY J;  2IPQ X;  4DJA A;  4MHG A;  4LIT A;  2NXN B;  4HRI A;  3OS2 A;  2HWV A;  3OYC A;  3O8H A;  4QWQ A;  4GCV A;  2O5R A;  2EPF A;  1W0U A;  1CQT A;  3QP5 A;  3HM5 A;  3WTV C;  3RQI A;  2W25 A;  5M3F J;  3HBL A;  1XPX A;  2VAS A;  1IRG A;  1IZ1 A;  3HRM A;  5KK1 A;  4O6J A;  4M6X A;  4UVC A;  4A3F J;  3CF2 A;  5JHF A;  3S93 A;  2IS2 A;  4AIK A;  3FBN B;  3FXQ A;  2OU2 A;  3V8J A;  4Y13 A;  1F36 A;  1D8J A;  2WAQ N;  4NHJ A;  2PJR A;  1LEB A;  5F0F A;  1B1B A;  2JN6 A;  2IS4 A;  2WV0 A;  4ESJ A;  5EZG A;  3NEU A;  2LBF A;  1QA6 A;  3OL4 A;  1XGS A;  5DD4 A;  2KIS A;  2E35 A;  1V5G A;  3IAS 2;  4JQF A;  2XRO A;  4J01 A;  4CUG A;  4EM0 B;  5M5X J;  3LA2 A;  4NC7 A;  4CYC A;  1QVT A;  3RI4 A;  4AUX A;  3G1O A;  1YX5 A;  3Q9V A;  3ZMV A;  3COA C;  2L7F P;  3F6O A;  1U5T C;  5EEH A;  3CUQ A;  1T39 A;  2VQL A;  3OIP A;  1N77 A;  4WXC A;  4LD5 A;  1YRN A;  1J75 A;  4KA4 A;  3BG6 A;  3DU6 A;  1J0R A;  4BE2 A;  2IXS A;  4KT6 A;  3HXL A;  3HYI A;  1WJE A;  2FOK A;  3ZMT A;  5HOD A;  4IOC F;  2E2J J;  3RYR A;  2JA8 J;  1HC8 A;  4B48 A;  1S6L A;  4QTR A;  2TCT A;  1TP4 A;  2CUJ A;  1LE8 A;  4BY1 J;  2YSR A;  3M4O J;  5CVI A;  1BW5 A;  3U1K A;  3S8P A;  3HC7 A;  1O3T A;  4OAY A;  2XPU A;  3EET A;  4KUM A;  3BCA A;  3BWG A;  2JQ7 A;  1NK3 P;  2BBY A;  4KFC A;  5DTD A;  5D5W B;  3H36 A;  4OMZ A;  3F6V A;  4A3J J;  1PJR A;  2LKX A;  2QYO A;  1HQC A;  1BR1 A;  5E20 A;  3E7L A;  4HAM A;  2FOW A;  2D1V A;  1IC8 A;  5E1W A;  1X4O A;  1D5V A;  2M7A A;  1SAU A;  2O03 A;  5J1R A;  3BG5 A;  1SVL A;  1BW6 A;  3TKY A;  3CME I;  3K4C A;  4PGG A;  1VQ7 I;  2OJE D;  3IL2 A;  4EJT A;  3K2Z A;  1R5H A;  2IT0 A;  1QU3 A;  3D5L A;  1FPQ A;  2F5C A;  4Y15 A;  3WTX C;  2HVS A;  1QZE A;  4UUV A;  1UHW A;  4AD9 A;  5D5U B;  3HTS B;  2W48 A;  3HOX J;  2A5W A;  1MJ9 A;  4BHB A;  2ICW G;  1JJ8 C;  2X1C A;  3WTT C;  3L2V A;  1N25 A;  3OYL A;  1YW9 A;  3KEQ A;  5F1R A;  2M0M A;  4CZZ A;  4HBL A;  1LB2 A;  3L9F A;  1ZRE A;  4EMS A;  5E3O A;  4KIS A;  1JI8 A;  2VT3 A;  2EZK A;  2VI6 A;  2K27 A;  2E1N A;  1W0T A;  2PJR B;  1IN6 A;  5ICG A;  1SD5 A;  2HKO A;  1DGR M;  1HBX G;  1VQ4 I;  2DTR A;  2CW7 A;  2K5C A;  2KIM A;  1J5Y A;  1ZAO A;  3KYD B;  3QPT A;  2K4B A;  3WTU C;  4JOM A;  1OPC A;  1TWF J;  4FX0 A;  5KHD A;  3GO5 A;  2DA3 A;  2L7M P;  4BEH A;  4NB5 A;  2IGO A;  4Y4R A;  4CYC B;  2DQR A;  1IG7 A;  4MEY F;  2BHY A;  1J09 A;  1P7I A;  3DBR B;  2IBD A;  2XUB A;  5FB2 A;  3S2D J;  4YG2 F;  4F55 A;  2H1K A;  1E17 A;  4I09 A;  2BY1 A;  3ZOB A;  3BZC A;  3CUQ B;  1W36 D;  2R7O A;  3MMY B;  5JVT A;  5E79 C;  1YJ9 I;  2KL4 A;  1YRN B;  2K9L A;  4S04 A;  4JYK A;  1YX3 A;  5FD5 A;  2EIJ H;  4C3I J;  4YFN F;  2W24 A;  1R49 A;  1U8R A;  4OIP F;  1WJB A;  1YW8 A;  4I2O A;  2VLA A;  1WI3 A;  3V7R A;  1G3W A;  1O7L A;  5DM6 F;  3F8B A;  4QSH A;  2HQA A;  3JW4 A;  3TQN A;  2K9N A;  3L2Q A;  5K5R A;  1LE8 B;  3DKY A;  4DYQ A;  3ROU A;  2XAJ A;  1F1Z A;  4XKW A;  1S5L C;  3DPL C;  3E6M A;  3H0D A;  4A2U A;  3S14 J;  1HCR A;  2VKH A;  1GVJ A;  2HZT A;  2L7Z A;  4AVP A;  4FET A;  1YJW I;  1WVR A;  3KP2 A;  4EJO A;  1MW7 A;  1IN4 A;  3DPT A;  3HOZ J;  4H4K C;  4G94 A;  3PNV A;  5E3M A;  3PL8 A;  2KMU A;  1IGN A;  2MSY A;  5FLV A;  4L0Z B;  2E34 A;  2OPT A;  4I7H A;  3IH4 A;  4XKV A;  5TJJ A;  1U8B A;  2HOS A;  1FBU A;  2HOT A;  3G71 I;  2K40 A;  2DT7 B;  2Y31 A;  1ZRD A;  1R6R A;  4LG0 B;  4RGX A;  2VQH A;  1WGX A;  1G2H A;  2EWN A;  2WBM A;  4I0B A;  4D0P A;  1UHS A;  2QLZ A;  3P5J A;  1SFU A;  1A5J A;  2DPD A;  3R60 A;  1NK2 P;  4HOB A;  3PSF A;  4IEJ A;  1TWG J;  3F8F A;  3K4K A;  4MEX F;  2XRL A;  1WWX A;  2ZSI B;  2KZV A;  2JK3 A;  2L54 A;  2EH3 A;  1HKT A;  1FEX A;  3JAM K;  4IO9 F;  5BPI A;  2NYX A;  3KIO A;  1G3Y A;  2DFI A;  2CMP A;  2DYR H;  4HNV A;  3RZO J;  1WCM J;  2MG4 A;  3QPL A;  4LIV A;  2LNB A;  2MC4 A;  3DV8 A;  3RPU A;  4XRS G;  4PZJ A;  1TTY A;  2DOF A;  1ZRF A;  4YRV A;  3AKZ A;  4PGH A;  4B3A A;  3DEU A;  4QPQ A;  2Z16 A;  1DP3 A;  2PMZ N;  5F04 A;  3IV5 A;  2OC6 A;  2IGM A;  4I6Z A;  1GLN A;  2XPW A;  2ECB A;  3I5U A;  1FOW A;  1R1U A;  2F5E A;  4GGG A;  2HNH A;  2KHM A;  4HF1 A;  2QKM B;  3RYP A;  2XAQ A;  4BEH B;  2ID6 A;  3J80 Z;  5EGO A;  4EM2 A;  3JTG A;  2ZO4 A;  4V2F A;  4N0B A;  3HL2 A;  3WOD F;  4U0Y A;  3TDU C;  4OMY A;  2E5Z A;  4ZZL A;  1D0Y A;  2Y0M A;  4CZC A;  1GDT A;  2IS6 A;  3I3L A;  2AHQ A;  2FQ4 A;  3KPH A;  3IUO A;  4Q47 A;  4GXO A;  2R7U A;  1XN7 A;  1SD7 A;  2WY7 Q;  2IP2 A;  4E7K A;  5LEJ A;  2DA5 A;  3FIW A;  3VSL A;  2JT1 A;  3QOP A;  1DPR A;  4LFU A;  4N9H A;  2JRM A;  3ZGK A;  1A31 A;  2R92 J;  4E7Z A;  2O8X A;  3J7Z I;  1WPK A;  1U2W A;  2NS8 A;  5EF6 A;  1EF4 A;  2E1O A;  3I9V 2;  2RV8 A;  2GQQ A;  3F22 A;  3TMO A;  3NRV A;  1QVU A;  4CYD A;  3LSK A;  3S3N A;  2DTZ A;  4HPQ A;  1VND A;  3L2C A;  4RLQ A;  4XRS A;  2FF4 A;  2P0W A;  4HQM A;  3K1M A;  2HYF A;  3EUH A;  3FXL A;  1K79 A;  3W3C A;  2V1N A;  2ID3 A;  2LVS A;  2VC1 A;  2CQQ A;  3I71 A;  1DUX C;  3HEF A;  3CC4 I;  2O6G E;  2GXB A;  3HRT A;  4II3 A;  1R7J A;  3HB9 A;  2E2H J;  2ZME A;  3KP5 A;  3DBH B;  1TQI A;  3B6A A;  3OIQ A;  4IRI A;  2E5N A;  3CO6 C;  4E4H A;  1Z7U A;  2QBY A;  5IYC J;  4IQ4 A;  4HNU A;  1IXR C;  5DYM A;  1U0J A;  3BCB A;  1FBS A;  3BR1 A;  1LFB A;  2DLL A;  5LHG A;  1SC7 A;  2K3P A;  1P7J A;  2VN2 A;  1HKQ A;  4IPA A;  4BU2 A;  3MQ0 A;  1IV6 A;  3FK7 A;  4P55 A;  4W97 A;  4KN7 X;  5IPA A;  2KRC A;  2M8G X;  5AIQ A;  4UUS B;  1A36 A;  5FKL A;  1IF1 A;  1G8X A;  3MKZ A;  3H3U A;  4HDV A;  5FRN A;  3Q0W A;  3CCV I;  4CGZ A;  4FQG A;  1O4X A;  2FUG 2;  3IH3 A;  3AL0 B;  4I02 A;  3ONQ A;  3TGN A;  4KDP A;  4C3H J;  4NC8 A;  3FXO A;  2AXL A;  5GAG J;  2XVC A;  3L2U A;  1T98 A;  1R00 A;  2EV0 A;  1S7E A;  4MGR A;  4RM2 A;  1ON1 A;  1FC3 A;  1MDM B;  1AHD P;  1P9Q C;  5DUI A;  3WU1 B;  1KU9 A;  1MMN A;  1P4W A;  2MGQ A;  3N4M A;  2HYJ A;  1QNT A;  5EGO B;  3SHF A;  3IRR A;  1ZQ3 P;  4PCQ A;  4WK8 F;  1TL8 A;  2HXI A;  4TV7 A;  4YIF A;  2ZKZ A;  2VE9 A;  5HOO A;  5L3G A;  1JUM A;  3KFW X;  4DNC A;  2FE3 A;  3VB2 A;  4CCL A;  3AG4 H;  3KP3 A;  2VUM J;  2LY9 A;  2V9K A;  1MKM A;  5DEQ A;  3ZMZ A;  2VE8 A;  3ISP A;  3HZJ A;  5J40 A;  4PUS A;  2PX9 A;  4B09 A;  4UNO A;  4RMN A;  1T56 A;  4XBF A;  4E7L A;  4L9J A;  1D0X A;  2VBY A;  1JHH A;  1TNT A;  4C9Y A;  3AG3 H;  3HRS A;  1UJ8 A;  4HSR A;  1YIO A;  1DPU A;  3U21 A;  4IKF A;  5EDN A;  4LB6 B;  1UFM A;  2FEZ A;  2CW8 A;  2ZFU A;  1M1E B;  1PYV A;  2A05 A;  3G1L A;  4WXD A;  1B72 A;  3O8G A;  2X6W A;  4XN0 A;  2X85 A;  3L09 A;  1D1B A;  4MFE A;  2LK2 A;  5FKK A;  1V5F A;  3PSI A;  1WSU A;  2RNG A;  3OSF A;  1FX7 A;  2CUE A;  2OBP A;  1ZG1 A;  2P6S A;  4FE7 A;  3IRQ A;  4FE4 A;  3BJO A;  2M3A A;  1FOY A;  3I4M J;  4WWC A;  1ONV A;  3VYT B;  3WU2 C;  1Z9C A;  2COB A;  2WAF A;  1X1D A;  3P9K A;  1YIJ I;  2ZME B;  4EM1 A;  2HDW A;  4GYG A;  2PN6 A;  3REO A;  2UXN A;  2R7T A;  3M3Y J;  1RRJ A;  1OCO H;  4XIC A;  4ZYH A;  4ESB A;  1T8I A;  3BQZ A;  5LRS A;  2QBY B;  1YJN I;  3KEY A;  3M8E A;  1NH3 A;  2ZFW A;  2A6T A;  4X0G A;  2R4G A;  2ZSH B;  4OIR F;  2WWY A;  1MBH A;  3KZZ A;  1BI3 A;  4LG3 A;  4B44 A;  5B1B H;  1VQO I;  2HDC A;  3DCF A;  1MNM C;  3P7N A;  3ZQH A;  4OAZ A;  3SZP A;  1HKS A;  3SFZ A;  1SD4 A;  1LNW A;  4MTD A;  1SEU A;  1P4A A;  3Q0U A;  5BMZ A;  2WB1 A;  2CQN A;  3NAU A;  1JGG A;  1VQN I;  1S9H A;  2J5O A;  5JR3 A;  5C4J J;  3B6C A;  1VQ6 I;  4HQE A;  2V26 A;  1Z0X A;  1ZG3 A;  2MD0 A;  5BOX A;  4O5V A;  5IOZ A;  2PFB A;  5BPD A;  1SMT A;  2AQE A;  1N75 A;  2CGP A;  3QYB A;  4A3D J;  3HHH A;  2K4J A;  1SAN A;  3K70 C;  4JK1 X;  1V5E A;  2ZJP F;  1SD6 A;  3M1C A;  4A0X A;  3BG9 A;  3E6C C;  2IGK A;  3HRU A;  1UZC A;  1LQ1 A;  5ERI A;  3IP4 B;  2Y9Z A;  1YI2 I;  1LFU P;  5ICE A;  3PNT A;  4XLA A;  4DIQ A;  1XD7 A;  2LRE A;  2CH0 A;  1T08 B;  1E2X A;  2K3F A;  3RKQ A;  3AG2 H;  1UCR A;  3TOA A;  1BN5 A;  4FTH A;  2XRN A;  1Q1V A;  3MKY B;  2O0Y A;  1X1C A;  4UVB A;  3EUA A;  4Y33 A;  5B1A H;  3RKY A;  4OWR B;  4ANJ A;  1UHM A;  2KLO A;  3KEO A;  4LK1 F;  5EEA A;  2RDP A;  3P9C A;  2OAZ A;  3KZI C;  3IWF A;  5ILU A;  2O8K A;  2KDO A;  4XN3 A;  3E6B A;  3VSK A;  4PSX A;  3JSP A;  5JVG F;  4XK4 A;  2BW3 B;  3OY9 A;  1HXD A;  4M72 A;  3CC7 I;  2GAU A;  1VTN C;  3W6V A;  4JX5 A;  4HZF A;  3OYE A;  4HF0 A;  4LOC A;  1WHU A;  1QPM A;  2BXY A;  5HS7 A;  3LST A;  5LGN A;  1B72 B;  3GVA A;  2X1D A;  5LLQ A;  1EH6 A;  1ON2 A;  3EYY A;  1SVO A;  4ITV A;  3BZK A;  3WGG A;  2ZXW H;  2L4A A;  2ZNY A;  5FFX A;  3QYF A;  2DCE A;  1YO5 C;  1TW3 A;  1F5T A;  3S3M A;  3CUQ C;  3DU5 A;  3V4G A;  1RES A;  5GAH J;  2CV2 A;  2E1M B;  1BI2 A;  3GFM A;  2HI3 A;  1TZL A;  3LSM A;  4ZDP A;  3WGI A;  2P5K A;  3E1S A;  2W7N A;  1XDU A;  2HYG D;  5FO5 A;  1UST A;  2XHK A;  1KQ8 A;  4RGS A;  5JHU A;  2XGX A;  1GXQ A;  1E3H A;  1FWZ A;  3F3X A;  4WX9 A;  1WJF A;  2M87 A;  3WE2 A;  4B3X A;  4CDG A;  1LFP A;  2B7E A;  4L18 B;  1K4S A;  3PQK A;  2FU4 A;  2L9R A;  2LMD A;  4CHU A;  3GME A;  4PJ0 C;  5A2Q Z;  3QOD A;  1XX5 A;  3FBI B;  3HJE A;  2EV5 A;  1ODD A;  3A03 A;  3AG1 H;  1PVE A;  3KP7 A;  2KIF A;  3ZP5 A;  2LRD A;  3G73 A;  1IRZ A;  2HDD A;  3SYT A;  2E19 A;  3HOS A;  1MZB A;  4BXF A;  3FF5 A;  5BQT A;  5IT9 K;  3K1P A;  3ECO A;  2RKH A;  2LH9 A;  2PI0 A;  1FYL A;  1SFE A;  3TO6 A;  3N97 A;  4IQJ A;  3BQY A;  1TT0 A;  4NUB A;  2JZY A;  3FMQ A;  4Y17 A;  2VOO A;  4X6A J;  4DBQ A;  4RAZ A;  2MA3 A;  3VPR A;  2VKV A;  2LOO A;  3FMR A;  3TED A;  1T0F A;  1BC8 C;  1T6S A;  1K6O A;  3M9A A;  3HHG A;  3J81 K;  2NRA C;  2EIN H;  3CMM A;  4G6Q A;  3C2H A;  2NNN A;  4OU0 A;  1SFO J;  1QRY A;  3C1D A;  5HLG A;  2HU9 A;  2L5Q A;  4RB3 C;  2IS1 A;  1IXS B;  1VF9 A;  1IN7 A;  3S2H J;  1R9T J;  3F8N A;  3I4N J;  2IAI A;  4QIW N;  2VJ4 A;  3UR3 C;  4JX6 A;  4IVN A;  2P8T A;  4XLH A;  1A35 A;  2F2E A;  4ASN A;  2DOD A;  1MSE C;  3I54 A;  1MBF A;  2BV6 A;  1UAA A;  2M8E A;  5E8I A;  5DD8 A;  5E3N A;  2HXO A;  2UZK A;  4R8H A;  4RB0 A;  1H8A C;  2VQC A;  3CP8 A;  4M6V A;  3CO7 C;  5BS6 A;  3KLO A;  1X1P A;  1A6Q A;  2FBH A;  1UG2 A;  3FHZ A;  1LEA A;  1W5T A;  5KNL A;  4BL0 B;  3RSN A;  1TLH B;  3GTK J;  1BI1 A;  4XLE A;  1WI9 A;  1Z77 A;  2QUF A;  3IC7 A;  4P5O A;  2DOA A;  2CQ7 A;  3HOW J;  5K7F A;  3LQR A;  1WZ2 A;  1FJL A;  4EAT A;  2EIL H;  2K85 A;  3GYH X;  1OCR H;  3PUB A;  1VQ5 I;  2Y48 A;  5CLS A;  2D1H A;  3HOU J;  4AC0 A;  4ZYD A;  3K6G A;  2FXA A;  4BS9 A;  3CCR I;  3HSF A;  3A0H C;  3HGY A;  3LA3 A;  1H88 C;  1X3Z B;  2YS9 A;  4RA2 A;  2GWR A;  4UB8 C;  4Q4Z F;  2DJN A;  5C4X J;  1I3A A;  1XSV A;  1MBK A;  2M30 A;  4CA0 A;  3SJM A;  4BHC A;  2DFF A;  4IOA F;  3BG7 A;  1UEL B;  3OV8 A;  3DTK A;  2KRF A;  1B9N A;  1T33 A;  3IH2 A;  1L0O C;  4LG0 A;  3JSO A;  2V1X A;  1TWH J;  4RAG A;  1ZYR F;  4P1W A;  1RIO H;  3ASN H;  5KCM A;  1O3R A;  4IHW A;  4X1E A;  3MCZ A;  4IJA A;  1HSJ A;  2GOX B;  4J00 A;  1WJD A;  5D5X B;  2WTE A;  1ZHF A;  5J8F A;  1OQY A;  3JTH A;  5K1Y A;  1JUP A;  2VJI A;  2QF7 A;  5L3B A;  1WFX A;  2H09 A;  2F4I A;  3OYA A;  1QZY A;  2OCE A;  5HLI A;  1W5C C;  4KMF A;  4U7D A;  3ABL H;  1J2X A;  1ENH A;  2DK8 A;  2F5D A;  4HF2 A;  3ERM A;  4A0Y A;  5FJ8 J;  2DDA A;  4N4O B;  1Y39 A;  3GFJ A;  1KON A;  4FCY A;  3MD2 A;  1FNN A;  4WF2 A;  5JLW A;  4RB2 C;  5ILV A;  1FOX A;  1HF0 A;  4GFB A;  2XAS A;  3KET A;  3LAJ A;  4S0H B;  2F5F A;  5HVQ C;  4QPO A;  3GCM A;  5J6X A;  2CUF A;  1B59 A;  2EZH A;  1JGS A;  2LD5 A;  1GXP A;  2V9P A;  4BQN A;  3G3Z A;  2XKP A;  1FBQ A;  1R5G A;  2DFE A;  1XB4 A;  3CLQ A;  2QKL B;  4D1Q A;  1OCP A;  1MJA A;  2V6C A;  3OYB A;  5KAI C;  3B02 A;  3AAF A;  2R7D A;  1RUO A;  2DYS H;  2R7Q A;  4P9F A;  2AS5 F;  4BQO A;  2H8W A;  4M3D A;  1WH5 A;  2M5W A;  2DT5 A;  3I56 I;  3U9G A;  1IUY A;  1AA7 A;  3W6J B;  2LC2 A;  1H89 C;  5C44 J;  3QRF F;  2E2I J;  2E7W A;  1U78 A;  2H94 A;  3WTS C;  3JRD A;  2K86 A;  3H9J A;  3HOT A;  2CUZ A;  2DMQ A;  3K4J A;  4M6Y A;  2V4J C;  4BHP A;  3HIF A;  1E0E A;  3CC2 I;  5TGT A;  1YFH A;  3T0Y A;  4IF4 A;  4XLP F;  4BGD A;  3S2W A;  1ZAR A;  2NS7 A;  2XDV A;  3M8F A;  1SVM A;  3TW6 A;  4XL9 A;  3FDY A;  2A69 F;  4JP0 A;  3JRB A;  5FRM A;  3WGH A;  3D0S A;  1T38 A;  3OR1 C;  1U5T A;  3WG7 H;  2ZJR F;  4A3B J;  1ZR2 A;  4KIC A;  4ZDL A;  1G4D A;  5J8C A;  2BZT A;  4XMY A;  2ME6 A;  4IL6 C;  4E6K G;  3CMA I;  5HDK A;  4XOR A;  4PJM A;  2I10 A;  1ZGA A;  2A61 A;  3RKX A;  3FZV A;  3GF2 A;  2WAE A;  2A68 F;  4GO1 A;  1W1W E;  2C6Y A;  1Z05 A;  4ENJ A;  2QQ8 A;  3A4C A;  4B43 A;  2FA5 A;  2H1L A;  2IA1 A;  2FML A;  4BAY A;  5D5V B;  2K7L A;  1Y56 A;  4IHS A;  2ECC A;  2UUZ A;  1XMA A;  3GFI A;  1ZG5 A;  2A3S A;  3GTO J;  4HEA 2;  5JLX A;  2ZB9 A;  4A3G J;  4M74 A;  2H6C A;  5IYD J;  4A3K J;  2X9D A;  3S1M J;  1N78 A;  3B73 A;  2XV4 S;  3ULQ B;  3OYK A;  1RKW A;  2LSO A;  3I53 A;  2KP6 A;  2NNY A;  2DO7 A;  3O3K A;  2ZME C;  3FXU A;  4Z2Y A;  1X1A A;  3GZ5 A;  4ZZD A;  1WH7 A;  3FX3 A;  3ZQC A;  3IHU A;  2L3D A;  1IRF A;  5E1X A;  3BJA A;  1X3W B;  3OOU A;  3FXM A;  2V79 A;  2IJL A;  3CTA A;  2LLK A;  2KIQ A;  1R4N B;  2R5Y A;  5IY5 H;  4EJV A;  3S1Q J;  4UUS A;  2ZC2 A;  1I6H J;  5DS9 A;  1E3P A;  4XOP A;  1Z6R A;  3BR3 A;  4EJU A;  1ETX A;  4I76 A;  3PO3 J;  5CVR A;  1D5Y A;  4LIU A;  3ZN1 A;  2LDU A;  3JR9 A;  3Q3S A;  1NHA A;  4L9T A;  1P2F A;  3ZMU A;  3GX4 X;  3M8J A;  2QQB A;  2KRH A;  1G6N A;  2VQG A;  1MIJ A;  2VON A;  5JI6 A;  4AIJ A;  3AFH A;  5F0C A;  3GUD A;  2JRT A;  1RNL A;  2LY2 A;  2R7W A;  4LJZ F;  3DP7 A;  2K9S A;  2DK5 A;  3LOC A;  3OYJ A;  3BTC A;  2R7R A;  2CJJ A;  2AXT C;  1MDM A;  4PDK A;  1ORK A;  4NQW A;  3ASO H;  5D6F A;  4ZYG A;  1U9O A;  1ETY A;  4ZH4 F;  2GLO A;  3CJT B;  2PEX A;  1VQM I;  3DEE A;  4BQQ A;  3MAJ A;  3CF5 F;  4II2 A;  1PUF A;  5HNF A;  4ENN A;  4D7N A;  2KT0 A;  2W82 A;  2W57 A;  3T5X A;  4BXX J;  2JA6 J;  5E8G A;  3ZQ7 A;  3SQN A;  3DTI A;  2XC7 A;  3BR5 A;  2VIX A;  3OWT A;  1MMS A;  4I01 A;  2Y0S N;  5GPC A;  1MBJ A;  4G7Z F;  1U5T B;  3S15 J;  4MLO A;  3VOD A;  2M2E A;  2KFD A;  3S3O A;  1JTX A;  2BOL A;  3K9T A;  2R5Z A;  5E18 F;  5K5O A;  2F5V A;  5D4S A;  2V7F A;  3DPU A;  1QQI A;  3OMY A;  2HVR A;  2VBX A;  2EB7 A;  4NNJ A;  2DW4 A;  1Z3X A;  2P4W A;  5CVU A;  2D45 A;  1K61 A;  3PFY A;  2OTJ I;  1DU6 A;  3M1E A;  3OOP A;  1FSH A;  3E5X A;  2GA1 A;  3S16 J;  2ZJQ F;  2DI3 A;  2E71 A;  2MH2 A;  4BJ6 C;  4HYE A;  3F8M A;  3N05 A;  1S7O A;  3BPV A;  1WJA A;  3BTJ A;  2CW0 F;  1RZ4 A;  1FIP A;  3C2B A;  4XKC A;  4HNT A;  3JRC A;  3L7W A;  1KQ9 A;  3UKG A;  2XF5 A;  3ABU A;  1K78 A;  2X0L A;  1QGP A;  2XAU A;  1FP2 A;  4G8X A;  4ZTF A;  3I4P A;  2FJ1 A;  4L5E A;  2WAQ A;  4HV6 A;  4A5M A;  4ESF A;  2QVO A;  5CKT A;  1RPW A;  3PNY A;  3G2B A;  3H92 A;  4IHX A;  3VYS B;  5DM7 F;  3TOB A;  3IAM 2;  2LYC A;  2CWE A;  3KYC B;  1UB9 A;  2X48 A;  3RJP A;  4R79 A;  2R5Y B;  5F27 A;  5F0H A;  3K2A A;  1OFC X;  2AQF A;  4B4C A;  3QU3 A;  2GIZ A;  5F6F A;  1ETK A;  2DU9 A;  1KYZ A;  1HA8 A;  3OYF A;  2DA6 A;  2J5P A;  1BOA A;  4EEF G;  3H35 A;  3OYI A;  3TP3 A;  2DQL A;  3JRG A;  5IOY A;  2YU3 A;  4HV5 A;  2DA7 A;  2HFH A;  2NS0 A;  2YU9 J;  1ITY A;  2JPC A;  5HDG A;  2CV0 A;  1SMY F;  3CDL A;  2QQ9 A;  3ZR8 X;  2VBZ A;  4MO7 A;  5GP9 A;  3HTU A;  1RR7 A;  3C7J A;  2IW5 A;  2MFZ A;  4NQW B;  2XAG A;  1ZN2 A;  2R7Z J;  1ZKG A;  4Q48 A;  4RAF A;  1TQM A;  1X3U A;  1VQ8 I;  3GTJ J;  4MQV A;  3QPH A;  4F93 B;  1PUF B;  4IXA A;  3ABM H;  5EZH A;  1OCC H;  5DCF A;  2QSH X;  3FHN A;  5B5E C;  1U9N A;  2V9V A;  1XC5 A;  4LMY A;  4U88 A;  4M9S A;  3BOQ A;  1MMA A;  3CCL I;  2Z2S B;  1P4X A;  2BW3 A;  2M45 A;  3LA7 A;  1VFC A;  4E7J A;  4CCK A;  2DMN A;  1Y0U A;  4BQA A;  1BA5 A;  3ELK A;  2R5Z B;  1FTT A;  4XNF A;  5EYR A;  1E3O C;  4RAY A;  3TL4 X;  3CQZ J;  3LSI A;  5ICF A;  3F0C A;  1IJW C;  3QP6 A;  3FXR A;  4IZZ A;  1KYW A;  4L0Y B;  1Z67 A;  2IA0 A;  2DA1 A;  3ZMS A;  2Z5U A;  3Q5F A;  1J59 A;  1IN5 A;  4BUP A;  3S1R J;  2M4K A;  5F08 A;  3BC8 A;  4RDU A;  1QBJ A;  2X51 A;  4CO8 A;  4RM3 A;  5FLM J;  5LRR A;  3VDX A;  2P81 A;  1ETW A;  1WJC A;  1XCV A;  2L02 A;  3QWL A;  4U0W A;  5HNH A;  4M3E A;  3GXO A;  3J80 K;  2CQK A;  2ISY A;  2L4M A;  3H3Z A;  3OSG A;  2LKP A;  2XB5 A;  5LGT A;  5B66 C;  1K78 B;  3QAH A;  1HDD C;  3GLX A;  5K5Q A;  4BH9 A;  4UVA A;  3F9K A;  3VYR B;  5FKM A;  5KVR A;  3LL7 A;  3LAP A;  3F21 A;  2OD5 A;  2DMU A;  3PM1 A;  2QEX I;  3CCS I;  3D1N I;  2FD5 A;  4XKB A;  2DXI A;  2LKS A;  2QM3 A;  2OV7 A;  2ELH A;  3ML6 A;  3PJR A;  3HSE A;  1HDP A;  2ADU A;  1HLV A;  3JRH A;  3PUF A;  1DP7 P;  4OOI A;  2W1O A;  2ETH A;  2P7V B;  2YUS A;  1RUN A;  2V6E A;  3OL3 A;  2JSC A;  5ILS A;  1X4P A;  5GAD J;  5LGU A;  3TBI A;  1Z91 A;  3CUO A;  4A3E J;  1Y0N A;  3GTG J;  2YX4 A;  1ULY A;  1QPI A;  3SFI A;  3WTZ A;  2O7O A;  4XLN F;  3OYD A;  2L2O A;  1XSX A;  2O9L A;  4EVI A;  3C2G A;  4HST A;  1T0F C;  4QLC U;  1XGN A;  2A5Y B;  1R58 A;  1CF7 B;  2Q0O A;  3IKV A;  4M73 A;  2HPI A;  2R3S A;  2JVH A;  3DWL E;  4E70 A;  1LVK A;  3ZQG A;  5J1U A;  5J4V A;  3BTL A;  4D7M A;  3K70 D;  1Z6T A;  3PFI A;  3D5R C;  4EGY A;  3GTL J;  1ERD A;  3E5U A;  4UHT A;  3EUK L;  4RGR A;  4DYR A;  2NVU B;  4RBO A;  1YW7 A;  2ZJ2 A;  4WCG A;  3S1N J;  2EIM H;  1R36 A;  4LLN A;  2MC3 A;  4XON A;  2L9V A;  5AON A;  3BDD A;  4NC6 A;  3R6S A;  4Y3O A;  1X2M A;  5LHH A;  2DN0 A;  2L0K A;  4LLL A;  4W1U A;  3M07 A;  4IRH A;  4ABZ A;  3BPX A;  2CFX A;  3RPQ A;  2Z9O A;  5HLT A;  1OIS A;  2LF7 A;  4L5J A;  5FLX K;  5FFZ A;  4ZYA A;  1YOV B;  3FKJ A;  3A1Y A;  4RLF A;  3CES A;  1XTA A;  4BY7 J;  3TDZ C;  3E5Q A;  3OR2 C;  3ZN0 A;  2BY2 A;  1R5I D;  1AWC A;  1TW2 A;  3LSH A;  5FRO A;  2ELK A;  4CCJ A;  2JVG A;  1FTZ A;  3I55 I;  1POG A;  2R7V A;  1ZGW A;  2LTP A;  2A6H F;  2L01 A;  1EJ9 A;  4KNY A;  4BDZ A;  1OYW A;  1BR4 A;  3WHC A;  3WU0 A;  3QQA A;  2VXZ A;  1MD0 A;  3K4N A;  1I1S A;  3VYU B;  2D5V A;  1Y6I A;  4FAS D;  5D6E A;  4ZJZ A;  2V1U A;  2PQ8 A;  2BVL A;  3HSR A;  3OS0 A;  2JA2 A;  2PMZ A;  3DBL B;  2Z33 A;  1W7P D;  2DA4 A;  1D8K A;  2FNP A;  4A93 J;  1FMW A;  3EPZ A;  5FKO A;  1K83 J;  1Z7L A;  2Y2Z A;  2VKD A;  3RIR A;  5D8L B;  2NVY J;  4KIF A;  2MYS A;  4PJN A;  3RKW A;  2WY8 Q;  1RI7 A;  3VWB A;  1OJL A;  1V54 H;  3K1N A;  6PAX A;  2NVQ J;  2MW8 A;  3K10 A;  1JJ6 C;  1MND A;  4KIT B;  2MD5 A;  1IDY A;  2HKX A;  3I59 A;  3ABT A;  2ZXI A;  1OYI A;  1MSF C;  2DFH A;  2Q2E B;  3MFK A;  2ME0 A;  2QSF X;  4AU7 A;  4DQ2 A;  1C0W A;  2RC4 A;  1S72 I;  4O3M A;  5L3F A;  2KJB A;  1KQ0 A;  2DJI A;  2BY0 A;  1LVA A;  1ETO A;  1FIA A;  3SDG A;  3NWT A;  4I99 C;  1JE8 A;  1QHH D;  4FIS A;  1JKO C;  4I0A A;  1IV8 A;  2FBI A;  5J1Y A;  2BVM A;  3VEP A;  1V3F A;  3RCO A;  1TBX A;  2PMH A;  4PFP A;  2VXD A;  4EJW A;  2ZNZ A;  4EGZ A;  1VZ0 A;  1PP7 U;  1JKR C;  3LSG A;  4F91 B;  2X4H A;  1XCB A;  3LFK A;  3KZY A;  5H2F C;  5LFA A;  1F4K A;  4XRF A;  1G3T A;  4BE1 A;  2GXG A;  1V55 H;  1MMG A;  2W00 A;  3K69 A;  1BM9 A;  3HOV J;  3F23 A;  4IHY A;  3CD6 I;  1D1C A;  3QPS A;  3BY6 A;  2BEO A;  2ZCW A;  4CIC A;  3MZY A;  3L2W A;  2Z1D A;  1VQ9 I;  2L7K A;  4ZC3 A;  3QOE A;  1PP8 F;  1QO0 D;  5J4Y A;  3FM5 A;  4GRI A;  4A6D A;  3DQV C;  1H9T A;  1QZZ A;  3F8C A;  2JTV A;  3CP2 A;  3QYE A;  2H8R A;  4EQQ A;  1YHQ I;  2DMT A;  2OZ6 A;  2QA4 I;  1JHF A;  3GEZ A;  1LDJ A;  3MKL A;  4MIM A;  1EA3 A;  2E7X A;  1XGM A;  1R1V A;  3BLY A;  4B47 A;  3OYM A;  4JBA A;  1H9G A;  3OYH A;  2YR2 A;  1R23 A;  2GBY A;  2OCC H;  1TWC J;  5BNG A;  1B9M A;  1RC9 A;  1W7P A;  1JKP C;  2XSD C;  2TDX A;  3KP4 A;  2VL8 A;  4CH7 A;  4OIN F;  5CVV A;  3DF8 A;  3VOE A;  2GZW A;  3ZPL A;  5D8K B;  2CS3 A;  1UG0 A;  4MQ9 F;  2I5U A;  2WV1 A;  5CJ9 A;  4WXH A;  1S3J A;  4ON0 A;  3HUG A;  5AIP A;  3JCU C;  3MZ8 A;  1YIT I;  3PO2 J;  3JAM Z;  1X19 A;  1MH3 A;  4BE0 A;  1GV2 A;  2DT6 A;  1D3Y A;  1LUJ B;  1HW1 A;  4UV8 A;  3SZT A;  3ZCO A;  3GFL A;  3CJQ B;  2LR8 A;  2R7F A;  3K4L A;  1OMI A;  3OIO A;  1NG6 A;  4V19 K;  5HDN A;  3LSR A;  2DMP A;  1YQA A;  1AOY A;  3LSJ A;  3I59 B;  2EIK H;  5IT3 A;  3IWZ A;  3P9I A;  3HKZ N;  2EFO A;  1IAW A;  1XSD A;  2D2W A;  4NDL A;  5M5Y J;  3JRA A;  5CQE A;  1O57 A;  1MGT A;  3JRF A;  2CSO A;  2ISZ A;  3CCJ I;  2JUC A;  4DYC A;  3FWE A;  1OR7 A;  3BJ6 A;  1TWA J;  3G4S I;  1O7F A;  2B0L A;  1HW5 A;  4HLY A;  2XAF A;  2I8D A;  2YPR A;  5H6Q A;  1U6G A;  5DDG A;  1ETQ A;  3LSP A;  1DU0 A;  2HZD A;  2RN7 A;  3ECH A;  5B3S H;  4XLF A;  1Y8Q B;  1J9I A;  2EJR A;  3FK6 A;  4HA8 A;  1MH4 A;  4EV0 A;  4C2T A;  1IXC A;  2CYY A;  4L9V A;  9ANT A;  1V4R A;  3BTI A;  5A2Q K;  3C18 A;  3GZ6 A;  3T8R A;  3AL0 C;  2NOJ B;  4E7I A;  3CLO A;  1RKT A;  1VQL I; 
#chains in the Genus database with same CATH homology
 4S05 A;  2RQP A;  4M71 A;  3I64 A;  3RTR A;  3U2R A;  1O3Q A;  4L9N A;  2DPU A;  2ESN A;  2ACJ A;  4KN4 X;  3KLN A;  3FMS A;  2Y75 A;  3O2P E;  1G3S A;  2RVC A;  2G9W A;  1YLF A;  2BGC A;  2PG4 A;  5HS8 A;  1FYM A;  1F9N A;  3KP6 A;  3ERE D;  1P92 A;  1XMK A;  2W84 A;  4KMU X;  3EDP A;  4A0Z A;  4U7B A;  1BBY A;  1W7P B;  5FGM A;  1I1G A;  5HS9 A;  5LEK A;  3BRO A;  3U1D A;  1I5Z A;  2P5L C;  2M1B A;  1LDD A;  1Z1D A;  3K0L A;  2G7H A;  2A07 F;  5FD6 A;  4B8X A;  4FHT A;  1FT9 A;  3I0T A;  4LGW A;  3VFZ A;  2E1C A;  4ETS A;  1BIB A;  4LB5 A;  3V8L A;  4HW0 A;  2H27 A;  2UXX A;  3GWZ A;  3LQQ A;  1YTY A;  3FM3 A;  1KU2 A;  2IRF G;  4HX7 A;  3EQL F;  4H0E A;  3TO7 A;  3EYI A;  1B6A A;  1LDK B;  3BP8 A;  2STT A;  1BI0 A;  3L00 A;  3WE3 A;  4YFX F;  1I27 A;  5H20 A;  4IHT A;  1XDS A;  2ESH A;  1FY7 A;  4KYW A;  3MWM A;  3DXJ F;  2FMY A;  2WC2 A;  1ZH5 A;  5EEG A;  2EFN A;  2OQR A;  5DUK A;  1YS7 A;  2OA4 A;  2MBF A;  1K7A A;  4K2E A;  4M9X A;  2VT2 A;  4HX8 A;  2P6T A;  3NQO A;  3R61 A;  4F7Z A;  1YS6 A;  4HX4 A;  4G9Y A;  4P96 A;  5CYV A;  4GYI A;  4L5I A;  3MEX A;  1YG2 A;  1DDN A;  3KE2 A;  2EK5 A;  4BYY A;  1OYY A;  2FNA A;  4RB1 A;  3V7S A;  5F64 A;  2ZXJ A;  5CVJ A;  3E97 A;  1FYK A;  4HDU A;  1LJ9 A;  2QWW A;  3MZH A;  2W85 A;  2FSW A;  3CDH A;  2EA2 A;  3ZMD A;  4AIH A;  1HST A;  2EFQ A;  2Z99 A;  2MLK A;  1FP1 D;  2QEN A;  1BIA A;  1JXS A;  2IVM A;  3M7G A;  5DCM A;  4P9U A;  4XSX F;  3E6D A;  2HQN A;  4OIQ F;  1S7A A;  4BXU A;  5TRD A;  2FRH A;  2G7U A;  3V8K A;  4R1H A;  3W6K B;  2PJP A;  3T8T A;  4KT5 C;  2VBW A;  1W4M A;  4FX4 A;  3T1B A;  1WRJ A;  2PMU A;  1CF7 A;  3R4K A;  5FLX Z;  2Z3Y A;  4G6D A;  5L3D A;  1IN8 A;  2XAH A;  1FOK A;  2VOP A;  2HEO A;  1H0M A;  2HOE A;  1BC7 C;  2ZBK A;  3BZ6 A;  4UV9 A;  1IW7 F;  4OIO F;  4HLX A;  3TO9 A;  4AWX B;  3LWF A;  3WTW C;  2NAZ A;  4RGU A;  1PUE E;  2CG4 A;  1I6X A;  1S8N A;  1HW2 A;  2QZ8 A;  4XSZ F;  1U3E M;  2MLG A;  3WG9 A;  1SAX A;  3PQJ A;  5IT9 Z;  3WTY C;  5H6R A;  2HTS A;  3I58 A;  2EFP A;  2KJC A;  2FBK A;  5DV5 A;  1FLI A;  1MJB A;  5LHI A;  4UXN A;  1STZ A;  2PBI A;  4ENM A;  3SXY A;  2KIU A;  3O6B B;  2HR3 A;  2OQG A;  3J81 Z;  5HLH A;  1R1T A;  5E1Z B;  3IKT A;  2RGV A;  2O3F A;  1KGS A;  2EV6 A;  1ZRC A;  2K02 A;  5DCM B;  1W5S A;  2VOD A;  3E3V A;  2EA4 A;  1J7K A;  2Q2E A;  1A04 A;  2A6E F;  4U0V A;  4LK0 F;  5E17 F;  1BJA A;  4LLG F;  2STW A;  2COM A;  4MNU A;  5JFR A;  2BE5 F;  1EH7 A;  1YYV A;  2Q8K A;  4G7H F;  1TNS A;  4N9I A;  2P5V A;  1WKM A;  4RS8 A;  2HTJ A;  2MH9 A;  1S29 A;  5ED4 A;  1FSE A;  1CGP A;  1XGO A;  3J7A O;  2OZU A;  4Q5S F;  2GIV A;  1SFX A;  2HQR A;  2KKO A;  1FZP B;  4G7O F;  2FQ3 A;  3QU6 A;  3Q9S A;  2LF8 A;  5L3E A;  2JPB A;  3V7C A;  2YX7 A;  2XIG A;  4A12 A;  1O3S A;  4A5N A;  1PDN C;  1KU3 A;  1OKR A;  2EFW A;  2DAO A;  2P7C B;  4YII A;  2BYV E;  2HGC A;  2RNJ A;  3R0J A;  3KCC A;  4ENK A;  1T2K A;  2HS5 A;  5L3C A;  2UWM A;  3RDI A;  4MTE A;  1ZGJ A;  3GW2 A;  2H6B A;  1P6R A;  1Q1H A;  1KU7 A;  3DKW A;  5D4R A;  1REP C;  2VC0 A;  2V1D A;  2CO5 A;  3C3W A;  1ZLJ A;  3DFG A;  5ICC A;  4ZYE A;  1TQP A;  1ZLK A;  2PLY A;  4BNC A;  4KIG A;  2IA2 A;  3R0A A;  1GHC A;  1EH8 A;  3CJN A;  2DBB A;  1USS A;  1B4A A;  4CXF A;  1EV7 A;  4A6E A;  2O61 A;  4M9Z A;  1WQ2 A;  1L3L A;  2QQA A;  1R22 A;  5LBQ A;  4FT8 A;  4I98 B;  4KIB A;  2XKO A;  4YFK F;  4IRG A;  3F72 A;  2GA2 A;  1KA8 A;  2IPQ X;  4MHG A;  2HWV A;  4QWQ A;  4GCV A;  3QP5 A;  3WTV C;  2W25 A;  1IRG A;  1IZ1 A;  3HRM A;  5KK1 A;  4O6J A;  4M6X A;  4UVC A;  4AIK A;  3FXQ A;  2OU2 A;  3V8J A;  4Y13 A;  1D8J A;  4NHJ A;  1LEB A;  1B1B A;  2WV0 A;  4ESJ A;  3NEU A;  1XGS A;  5DD4 A;  4JQF A;  2XRO A;  4EM0 B;  3LA2 A;  3RI4 A;  3ZMV A;  3Q9V A;  3COA C;  3F6O A;  1U5T C;  5EEH A;  3CUQ A;  1T39 A;  4WXC A;  4LD5 A;  1J75 A;  4KA4 A;  1J0R A;  3HYI A;  2FOK A;  3ZMT A;  3RYR A;  1S6L A;  2YSR A;  5CVI A;  1O3T A;  3EET A;  4KUM A;  3BWG A;  2BBY A;  4KFC A;  5D5W B;  4OMZ A;  3F6V A;  2QYO A;  1HQC A;  5E20 A;  4HAM A;  2D1V A;  5E1W A;  1D5V A;  2O03 A;  3TKY A;  4PGG A;  3IL2 A;  4EJT A;  3K2Z A;  1R5H A;  2IT0 A;  3D5L A;  1FPQ A;  2F5C A;  4Y15 A;  3WTX C;  4UUV A;  1UHW A;  4AD9 A;  5D5U B;  3HTS B;  1MJ9 A;  4BHB A;  3WTT C;  1YW9 A;  3KEQ A;  5F1R A;  4CZZ A;  4HBL A;  1LB2 A;  3L9F A;  1ZRE A;  4EMS A;  2VT3 A;  2K27 A;  2E1N A;  1IN6 A;  5ICG A;  1SD5 A;  2HKO A;  1HBX G;  2DTR A;  2KIM A;  1J5Y A;  1ZAO A;  3QPT A;  2K4B A;  3WTU C;  1OPC A;  4FX0 A;  3GO5 A;  4NB5 A;  2DQR A;  4MEY F;  2XUB A;  5FB2 A;  4YG2 F;  1E17 A;  4I09 A;  3CUQ B;  5JVT A;  4S04 A;  5FD5 A;  4YFN F;  2W24 A;  1U8R A;  4OIP F;  1YW8 A;  4I2O A;  3V7R A;  1G3W A;  1O7L A;  3F8B A;  3JW4 A;  3TQN A;  5K5R A;  3ROU A;  2XAJ A;  1F1Z A;  3E6M A;  3DPL C;  4A2U A;  1GVJ A;  2HZT A;  4AVP A;  3KP2 A;  4EJO A;  1IN4 A;  3DPT A;  4G94 A;  4L0Z B;  4I7H A;  5TJJ A;  1FBU A;  4LG0 B;  1ZRD A;  4RGX A;  2EWN A;  4I0B A;  4D0P A;  2QLZ A;  1SFU A;  2DPD A;  3R60 A;  4HOB A;  3F8F A;  4MEX F;  1WWX A;  2L54 A;  1HKT A;  3JAM K;  5BPI A;  2NYX A;  1G3Y A;  2DFI A;  2LNB A;  3DV8 A;  3RPU A;  4PZJ A;  1TTY A;  1ZRF A;  4PGH A;  3DEU A;  3I5U A;  1R1U A;  2F5E A;  4GGG A;  4HF1 A;  3RYP A;  2XAQ A;  3J80 Z;  4EM2 A;  3JTG A;  2ZO4 A;  4N0B A;  3WOD F;  4U0Y A;  3TDU C;  4OMY A;  4ZZL A;  2Y0M A;  4Q47 A;  4GXO A;  1XN7 A;  1SD7 A;  2IP2 A;  5LEJ A;  2JT1 A;  3QOP A;  1DPR A;  4LFU A;  4N9H A;  2O8X A;  1U2W A;  2RV8 A;  2GQQ A;  3F22 A;  3NRV A;  4CYD A;  3L2C A;  2FF4 A;  4HQM A;  3K1M A;  2HYF A;  3EUH A;  1K79 A;  2VC1 A;  3I71 A;  1DUX C;  2O6G E;  2GXB A;  3HRT A;  1R7J A;  2ZME A;  3KP5 A;  1TQI A;  4IRI A;  3CO6 C;  1Z7U A;  2QBY A;  1IXR C;  5DYM A;  1FBS A;  2DLL A;  5LHG A;  2VN2 A;  1HKQ A;  4IPA A;  3MQ0 A;  4P55 A;  4KN7 X;  5AIQ A;  1IF1 A;  3H3U A;  4HDV A;  4CGZ A;  4I02 A;  3TGN A;  4KDP A;  2AXL A;  2XVC A;  1T98 A;  1R00 A;  2EV0 A;  4MGR A;  1ON1 A;  1FC3 A;  1MDM B;  5DUI A;  3WU1 B;  1KU9 A;  1P4W A;  3N4M A;  3IRR A;  1QNT A;  3SHF A;  4WK8 F;  4PCQ A;  4TV7 A;  4YIF A;  2ZKZ A;  2VE9 A;  5HOO A;  5L3G A;  3KFW X;  4DNC A;  2FE3 A;  3VB2 A;  3KP3 A;  3ZMZ A;  1MKM A;  5DEQ A;  2VE8 A;  3ISP A;  4B09 A;  4UNO A;  4XBF A;  4L9J A;  2VBY A;  1JHH A;  1TNT A;  3HRS A;  1DPU A;  1YIO A;  4LB6 B;  1UFM A;  2FEZ A;  4WXD A;  3L09 A;  1WSU A;  1FX7 A;  2OBP A;  1ZG1 A;  2P6S A;  3IRQ A;  3BJO A;  4WWC A;  1ONV A;  1Z9C A;  3P9K A;  2ZME B;  4EM1 A;  4GYG A;  2PN6 A;  3REO A;  2UXN A;  4ZYH A;  4ESB A;  5LRS A;  2QBY B;  3M8E A;  2ZFW A;  4OIR F;  2WWY A;  3KZZ A;  1BI3 A;  2HDC A;  3P7N A;  3SZP A;  1HKS A;  3SFZ A;  1SD4 A;  1LNW A;  4MTD A;  1P4A A;  5BMZ A;  2J5O A;  5JR3 A;  4HQE A;  1ZG3 A;  5BOX A;  4O5V A;  2PFB A;  5BPD A;  1SMT A;  2CGP A;  3HHH A;  2K4J A;  4JK1 X;  1SD6 A;  4A0X A;  3E6C C;  3HRU A;  1LQ1 A;  5ERI A;  5ICE A;  1XD7 A;  1E2X A;  1UCR A;  3TOA A;  1BN5 A;  2XRN A;  2O0Y A;  4UVB A;  3RKY A;  1UHM A;  4LK1 F;  3KEO A;  2RDP A;  3P9C A;  2OAZ A;  3IWF A;  5ILU A;  3E6B A;  3JSP A;  1HXD A;  4M72 A;  2GAU A;  1VTN C;  4HZF A;  4HF0 A;  1QPM A;  5HS7 A;  3LST A;  5LGN A;  3GVA A;  5LLQ A;  1EH6 A;  1ON2 A;  3EYY A;  3WGG A;  2L4A A;  2ZNY A;  5FFX A;  1YO5 C;  1TW3 A;  1F5T A;  3CUQ C;  3V4G A;  1BI2 A;  3GFM A;  3WGI A;  2P5K A;  1XDU A;  2HYG D;  5FO5 A;  1UST A;  2XHK A;  1KQ8 A;  4RGS A;  5JHU A;  2XGX A;  1GXQ A;  1FWZ A;  3F3X A;  4WX9 A;  3WE2 A;  2M87 A;  4CDG A;  4L18 B;  3PQK A;  2FU4 A;  4CHU A;  5A2Q Z;  2EV5 A;  1ODD A;  3KP7 A;  2KIF A;  3ZP5 A;  3G73 A;  3HOS A;  1MZB A;  3FF5 A;  5BQT A;  5IT9 K;  3K1P A;  3ECO A;  2RKH A;  2PI0 A;  1FYL A;  1SFE A;  3TO6 A;  3N97 A;  2JZY A;  3FMQ A;  4Y17 A;  2VOO A;  4RAZ A;  2MA3 A;  3FMR A;  1T0F A;  1BC8 C;  1T6S A;  1K6O A;  3M9A A;  3HHG A;  3J81 K;  2NRA C;  4OU0 A;  4G6Q A;  2NNN A;  3C1D A;  5HLG A;  4RB3 C;  1IXS B;  1IN7 A;  3F8N A;  4IVN A;  2P8T A;  2F2E A;  4ASN A;  3I54 A;  2BV6 A;  2M8E A;  5E8I A;  5DD8 A;  2UZK A;  4R8H A;  4RB0 A;  3CO7 C;  5BS6 A;  3KLO A;  2FBH A;  3FHZ A;  1LEA A;  1W5T A;  1TLH B;  1BI1 A;  1WI9 A;  2QUF A;  3IC7 A;  4P5O A;  3LQR A;  3GYH X;  2Y48 A;  5CLS A;  2D1H A;  4ZYD A;  2FXA A;  3HSF A;  3LA3 A;  2GWR A;  4Q4Z F;  1XSV A;  2M30 A;  4BHC A;  3OV8 A;  2KRF A;  1B9N A;  1L0O C;  4LG0 A;  3JSO A;  2V1X A;  1RIO H;  1ZYR F;  1O3R A;  3MCZ A;  4IJA A;  1HSJ A;  5D5X B;  2WTE A;  1ZHF A;  5J8F A;  3JTH A;  5K1Y A;  5L3B A;  2H09 A;  1QZY A;  5HLI A;  4KMF A;  4U7D A;  1J2X A;  2DK8 A;  2F5D A;  4HF2 A;  4A0Y A;  3GFJ A;  1FNN A;  4WF2 A;  4RB2 C;  5ILV A;  2XAS A;  3KET A;  3LAJ A;  2F5F A;  5HVQ C;  5J6X A;  1B59 A;  1JGS A;  1GXP A;  3G3Z A;  2XKP A;  1FBQ A;  1R5G A;  1XB4 A;  1MJA A;  2V6C A;  3B02 A;  3AAF A;  2R7D A;  1RUO A;  4P9F A;  2AS5 F;  2M5W A;  2DT5 A;  3U9G A;  1IUY A;  3W6J B;  3QRF F;  2E7W A;  1U78 A;  2H94 A;  3WTS C;  2K86 A;  3HOT A;  4M6Y A;  4BHP A;  3HIF A;  1YFH A;  3T0Y A;  4IF4 A;  4XLP F;  3S2W A;  1ZAR A;  3M8F A;  2A69 F;  3WGH A;  3D0S A;  1T38 A;  1U5T A;  4KIC A;  1G4D A;  5J8C A;  5HDK A;  1ZGA A;  2A61 A;  3RKX A;  3FZV A;  3GF2 A;  2A68 F;  4GO1 A;  2C6Y A;  1Z05 A;  4ENJ A;  2FA5 A;  2IA1 A;  2FML A;  4BAY A;  5D5V B;  2K7L A;  4IHS A;  1XMA A;  3GFI A;  1ZG5 A;  2A3S A;  4M74 A;  2H6C A;  3B73 A;  2XV4 S;  3ULQ B;  2LSO A;  3I53 A;  2NNY A;  2DO7 A;  3O3K A;  3FXU A;  4Z2Y A;  3GZ5 A;  4ZZD A;  3FX3 A;  3IHU A;  2L3D A;  1IRF A;  5E1X A;  3BJA A;  2V79 A;  2IJL A;  3CTA A;  4EJV A;  1Z6R A;  4EJU A;  5CVR A;  3ZN1 A;  2LDU A;  1NHA A;  4L9T A;  1P2F A;  3ZMU A;  3GX4 X;  2QQB A;  1G6N A;  2VON A;  5JI6 A;  4AIJ A;  3GUD A;  2JRT A;  1RNL A;  4LJZ F;  3DP7 A;  2DK5 A;  1MDM A;  4PDK A;  4NQW A;  5D6F A;  4ZYG A;  4ZH4 F;  2PEX A;  3MAJ A;  4ENN A;  2W57 A;  3T5X A;  5E8G A;  3ZQ7 A;  3SQN A;  4I01 A;  4G7Z F;  1U5T B;  3VOD A;  3K9T A;  5E18 F;  5K5O A;  5D4S A;  1QQI A;  2VBX A;  2EB7 A;  2DW4 A;  2P4W A;  5CVU A;  2D45 A;  3M1E A;  3OOP A;  1FSH A;  3E5X A;  2GA1 A;  2DI3 A;  2MH2 A;  4HYE A;  3F8M A;  1S7O A;  3BPV A;  2CW0 F;  1RZ4 A;  3L7W A;  1KQ9 A;  3ABU A;  1K78 A;  2X0L A;  1QGP A;  1FP2 A;  4G8X A;  3I4P A;  4HV6 A;  4A5M A;  4ESF A;  2QVO A;  3H92 A;  3TOB A;  2CWE A;  1UB9 A;  3RJP A;  4R79 A;  3QU3 A;  5F6F A;  2DU9 A;  1KYZ A;  2J5P A;  1BOA A;  2DQL A;  2YU3 A;  4HV5 A;  2HFH A;  2NS0 A;  2JPC A;  5HDG A;  1SMY F;  2QQ9 A;  2VBZ A;  3HTU A;  3C7J A;  2IW5 A;  2XAG A;  1ZN2 A;  4Q48 A;  1TQM A;  1X3U A;  4MQV A;  3QPH A;  4IXA A;  5DCF A;  2V9V A;  4LMY A;  4U88 A;  4M9S A;  3BOQ A;  1P4X A;  2M45 A;  3LA7 A;  1Y0U A;  4BQA A;  3ELK A;  4RAY A;  5ICF A;  3QP6 A;  3FXR A;  1KYW A;  4L0Y B;  2IA0 A;  3ZMS A;  2Z5U A;  3Q5F A;  1J59 A;  1IN5 A;  1QBJ A;  4CO8 A;  5LRR A;  1XCV A;  2L02 A;  4U0W A;  3J80 K;  3GXO A;  2CQK A;  2ISY A;  2L4M A;  3H3Z A;  2LKP A;  5LGT A;  1K78 B;  3QAH A;  3GLX A;  5K5Q A;  4BH9 A;  4UVA A;  5KVR A;  3LAP A;  3F21 A;  2OD5 A;  2QM3 A;  2ELH A;  3ML6 A;  3HSE A;  2ADU A;  1DP7 P;  4OOI A;  2ETH A;  2P7V B;  1RUN A;  2JSC A;  5ILS A;  5LGU A;  1Z91 A;  3CUO A;  2YX4 A;  1ULY A;  3WTZ A;  4XLN F;  1XSX A;  4EVI A;  4QLC U;  1XGN A;  2A5Y B;  1R58 A;  1CF7 B;  2Q0O A;  3IKV A;  4M73 A;  2R3S A;  4E70 A;  1Z6T A;  3PFI A;  4EGY A;  3E5U A;  4UHT A;  4RGR A;  1YW7 A;  2ZJ2 A;  4WCG A;  1R36 A;  4LLN A;  2MC3 A;  5AON A;  3BDD A;  3R6S A;  5LHH A;  4LLL A;  4IRH A;  3BPX A;  2CFX A;  3RPQ A;  2Z9O A;  2LF7 A;  4L5J A;  5FLX K;  5FFZ A;  3TDZ C;  3E5Q A;  3ZN0 A;  1AWC A;  1TW2 A;  2A6H F;  2L01 A;  4KNY A;  1OYW A;  3WU0 A;  2VXZ A;  1MD0 A;  1I1S A;  5D6E A;  2V1U A;  2PQ8 A;  3HSR A;  2Z33 A;  1W7P D;  1D8K A;  2FNP A;  3RIR A;  5D8L B;  4KIF A;  3RKW A;  1RI7 A;  3K1N A;  6PAX A;  2MD5 A;  2HKX A;  3I59 A;  3ABT A;  1OYI A;  3MFK A;  4DQ2 A;  1C0W A;  2RC4 A;  4O3M A;  5L3F A;  2KJB A;  1KQ0 A;  1LVA A;  1JE8 A;  4I0A A;  2FBI A;  3VEP A;  1V3F A;  1TBX A;  2PMH A;  4EJW A;  2ZNZ A;  4EGZ A;  1PP7 U;  2X4H A;  1XCB A;  3LFK A;  3KZY A;  1F4K A;  4XRF A;  1G3T A;  2GXG A;  3K69 A;  1BM9 A;  3F23 A;  3BY6 A;  2BEO A;  4CIC A;  2ZCW A;  3MZY A;  1PP8 F;  1QO0 D;  3FM5 A;  4A6D A;  3DQV C;  1H9T A;  1QZZ A;  3F8C A;  2JTV A;  4EQQ A;  2OZ6 A;  1JHF A;  3GEZ A;  1LDJ A;  2E7X A;  1XGM A;  1R1V A;  4JBA A;  1H9G A;  2YR2 A;  1R23 A;  1B9M A;  1W7P A;  2TDX A;  3KP4 A;  4OIN F;  5CVV A;  3DF8 A;  3VOE A;  2GZW A;  3ZPL A;  5D8K B;  4MQ9 F;  5CJ9 A;  4WXH A;  4ON0 A;  1S3J A;  3HUG A;  5AIP A;  3JAM Z;  1D3Y A;  1HW1 A;  4UV8 A;  3SZT A;  3GFL A;  2R7F A;  1OMI A;  5HDN A;  1YQA A;  1AOY A;  3I59 B;  5IT3 A;  3IWZ A;  3P9I A;  2EFO A;  1IAW A;  1XSD A;  2D2W A;  1O57 A;  1MGT A;  2CSO A;  2ISZ A;  3FWE A;  1OR7 A;  3BJ6 A;  1O7F A;  2B0L A;  1HW5 A;  4HLY A;  2XAF A;  2YPR A;  5H6Q A;  1U6G A;  5DDG A;  2RN7 A;  3ECH A;  1J9I A;  2EJR A;  4HA8 A;  4EV0 A;  1IXC A;  2CYY A;  4L9V A;  1V4R A;  5A2Q K;  3C18 A;  3GZ6 A;  3T8R A;  3CLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...