4L9JA

Crystal structure of s. aureus mepr in dna-binding conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords MepR
total genus 40
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9jA00
1XMKA 1YW8A 2ZNZA 4RB0A 5DYMA 1FT9A 4BNCA 4D0PA 2J5OA 3G73A 3HSRA 5LGUA 1YLFA 4CXFA 3VFZA 3ELKA 3KEQA 3QAHA 3P9IA 2QQ9A 1ZLJA 4L9VA 4Y15A 3MCZA 1FBSA 2VC0A 2PN6A 1ZG3A 1IRGA 5LEJA 2VODA 4KDPA 3QP5A 3PQKA 5TRDA 1HKSA 4HYEA 2H27A 1RNLA 2CO5A 2M8EA 5EEGA 4YIIA 2L4MA 5A2QZ 4Q4ZF 3LAJA 4MTDA 1PP7U 5ICGA 2FXAA 5CVVA 3HOTA 2ESHA 2XAFA 2FU4A 2JRTA 4UXNA 3JTGA 1USTA 2R3SA 2QENA 2CQKA 2HR3A 4PZJA 4BYYA 2GAUA 4HAMA 1TQMA 2LF7A 4UV9A 4EJVA 1USSA 3O2PE 1ULYA 3V8JA 4WXCA 1XGSA 2OZ6A 4RB3C 2ZFWA 2OD5A 3I64A 1P92A 1BJAA 3RJPA 2XAJA 4N0BA 1ZYRF 5JI6A 3IWZA 4M71A 3HTSB 4U7BA 3R4KA 5D5VB 1ZH5A 1ZGJA 5L3CA 2K4BA 3BWGA 3RKXA 3SXYA 3GFLA 3WTZA 5ICEA 2FMYA 4A5MA 1V3FA 3GFJA 3NEUA 4EMSA 5L3EA 3ECHA 3FMRA 2UXXA 1EH7A 3E5QA 4LMYA 1R1VA 3NRVA 5E20A 4O6JA 4HX7A 2A3SA 2FEZA 1CF7A 4S04A 4ENKA 1EH6A 1SFEA 3C7JA 1U5TA 1LDDA 1IRFA 3JSOA 5DCMA 2MA3A 1S7AA 2QQBA 1DPUA 2XV4S 3R61A 3W6KB 1ZRDA 5FFXA 4A6EA 4IVNA 1W7PD 4RGRA 2KJCA 4M9SA 2V79A 4NQWA 2M1BA 1LEBA 1D5VA 3FMQA 4LJZF 4OMZA 3WU1B 4ENNA 2RN7A 2OQRA 2UZKA 2HFHA 3M8FA 3F8NA 5EEHA 4KT5C 4YIFA 4LB5A 5E1XA 2UWMA 2KRFA 3IWFA 4HDVA 1G3YA 3WGIA 1AWCA 3G3ZA 4AIHA 3I53A 4Y13A 1MD0A 2L02A 4G8XA 4UVCA 2QUFA 3IKVA 5HS7A 1ZRFA 1X3UA 2ZMEB 4HF2A 2WC2A 5CVJA 2PLYA 4EQQA 1BI3A 1UFMA 2R7FA 2OA4A 3E6DA 1TLHB 4AIKA 4L5JA 3WE3A 1U8RA 4G7HF 3EYYA 3HYIA 1ODDA 4RGXA 3TQNA 1EH8A 3WTUC 2K86A 4GO1A 2ZKZA 1E17A 2FSWA 1J9IA 3EDPA 3VB2A 3K1NA 2ZNYA 2O61A 2Q8KA 4M9ZA 2A6HF 2A6EF 4Q47A 1U3EM 4L18B 4WCGA 2L3DA 5JHUA 3O6BB 3JTHA 4HV6A 4JK1X 5LRSA 5FFZA 4IHTA 1I27A 2D1VA 1BIAA 2P6TA 2F5CA 1FLIA 1HQCA 1D3YA 2H09A 3LSTA 3WTYC 4CYDA 4XRFA 3KE2A 1S7OA 2JTVA 3I59A 4XSZF 1MKMA 3WG9A 1YW7A 2TDXA 5HDKA 3WTXC 2EFNA 1B1BA 2YU3A 4UV8A 2VE8A 3HRMA 4R79A 1HSTA 2MBFA 4KUMA 2IJLA 1O7FA 2EFOA 1G3SA 3LA7A 3FXUA 4GYIA 4I0BA 3IL2A 3C1DA 4KA4A 2HQNA 3B73A 5FD5A 4XLPF 4KFCA 4HF0A 1SFUA 5D5WB 4EJTA 1T6SA 1BI1A 5BS6A 1Z7UA 2ZJ2A 3ZN0A 3N97A 1WI9A 5BPIA 1J7KA 5DD8A 1R36A 3KLNA 3KFWX 1SMTA 1UHWA 1IXSB 1P2FA 4JBAA 5D6FA 4RB2C 4E70A 2BBYA 1XMAA 4OINF 1BC7C 4I2OA 4NB5A 1UHMA 4IF4A 2GA2A 1YTYA 5L3BA 6PAXA 1FOKA 3I71A 2PEXA 4WX9A 4EGYA 1TBXA 3MAJA 3TGNA 3D5LA 1ZARA 1JXSA 4M74A 3CUQC 2ZCWA 2HQRA 1B6AA 1MJAA 4I7HA 1IXRC 1JHFA 1ZHFA 1MDMA 2E1CA 2WWYA 2O8XA 1O3RA 1IUYA 2OZUA 1PP8F 3ABUA 1BI2A 4CO8A 5K5OA 2K4JA 3ULQB 2RQPA 1FWZA 4R1HA 4GXOA 1TW3A 5L3FA 3PFIA 2XUBA 5E1ZB 2Q0OA 1ON1A 1QGPA 3MQ0A 3L9FA 2ESNA 2FBIA 2CSOA 4LGWA 3FF5A 1S6LA 2O3FA 2D45A 1IZ1A 3SZTA 4UVAA 3FXRA 5DV5A 4LLLA 1R1UA 3E97A 1RI7A 2FNPA 1F9NA 4YFKF 3E5UA 3LAPA 3ZP5A 4CICA 3WTSC 4ESFA 2XHKA 2BEOA 3RIRA 3V7RA 1WKMA 4CGZA 1Y0UA 2Y75A 5FD6A 4HOBA 2VC1A 5JVTA 2G7HA 1ZGAA 3J80K 4F7ZA 4LK0F 1S8NA 4O3MA 2HEOA 2Z9OA 2Z3YA 4EM0B 1KQ8A 1ZLKA 4OOIA 1YFHA 3JSPA 4LG0B 2RVCA 5K1YA 5ILUA 3R6SA 3HRUA 2K02A 1OR7A 4AVPA 2RV8A 2V9VA 3MEXA 3DPLC 4M73A 1OMIA 3P9KA 4LB6B 2IP2A 1XN7A 2PMUA 2HYGD 3RKYA 3CDHA 2W25A 3KP2A 3BROA 1XGOA 1SFXA 3BY6A 1Z05A 3FM5A 2VBXA 2RC4A 4A12A 5E17F 1W4MA 2NS0A 5J8CA 3L7WA 3I54A 1H9TA 1DDNA 3BPVA 2P5VA 1HW1A 4G6DA 3QU6A 3V4GA 1TQIA 1D8JA 4I02A 1IW7F 5K5QA 1U78A 4P9UA 4EGZA 2STTA 1WRJA 1GXQA 3DFGA 5H6QA 2XIGA 3ISPA 4LLNA 3FM3A 4I09A 4PCQA 3WTVC 2QZ8A 2PFBA 2Y48A 1K7AA 3CTAA 3O3KA 2LDUA 3H3ZA 5E18F 3LQQA 4CDGA 1FNNA 3V8LA 1B9MA 3HIFA 2CWEA 1LNWA 1TQPA 3TKYA 3H92A 1W5TA 5F6FA 1LDKB 3C18A 2LF8A 1H0MA 2STWA 3FXQA 1HW2A 2L54A 1FC3A 2IVMA 3HTUA 1FY7A 1RZ4A 4TV7A 4Y17A 2XGXA 4GGGA 3U2RA 4ETSA 2QYOA 3E5XA 1BC8C 3J81Z 4Z2YA 2A07F 2DAOA 5L3GA 2QBYB 1U2WA 4OIOF 4B8XA 1CF7B 3TO9A 1GXPA 1LEAA 1FYMA 5TJJA 3B02A 1HKTA 1J2XA 4MQ9F 5E8GA 3GYHX 3DP7A 4IRIA 2VOPA 3J7AO 2QM3A 3CJNA 2VOOA 1IXCA 2COMA 2YX7A 4KMUX 2V1DA 3WGGA 1XDUA 3GX4X 3HRTA 1E2XA 2CGPA 2RDPA 5AIQA 2DBBA 3KP4A 1KQ0A 3IRRA 3J80Z 1I1GA 2CG4A 2W85A 4KICA 2EA4A 4BXUA 2K7LA 4LK1F 1FZPB 3M8EA 2HDCA 1YS6A 1KA8A 2VXZA 3GVAA 1TNTA 1IN5A 3GXOA 1Z1DA 2ZBKA 3DXJF 2EJRA 3K9TA 2XVCA 3FMSA 4MNUA 3ERED 3ZPLA 4Q48A 5DD4A 2M5WA 2CFXA 2DPUA 3LQRA 5D5UB 4U0VA 5LEKA 1MJBA 1EV7A 4ZYEA 2B0LA 3EQLF 1H9GA 2L01A 2P7VB 1O3TA 3GW2A 1OYWA 1HKQA 3HUGA 5DCMB 4ON0A 1BN5A 2UXNA 4ESBA 3F72A 3DPTA 2FF4A 2WTEA 2HOEA 2W24A 1SMYF 4I01A 5IT9K 5K5RA 2EFWA 5HOOA 4PGGA 2MH9A 2YPRA 3GF2A 5BOXA 2ISYA 2JT1A 2ACJA 1IF1A 1I1SA 1TNSA 2EFPA 2F5DA 3RPUA 1KYZA 3LA3A 5D8KB 2DLLA 1XGNA 2NAZA 2QLZA 2IA1A 2RGVA 4YFNF 4RS8A 3GLXA 2V1UA 2QQAA 2HS5A 2ZMEA 2JZYA 2F2EA 1LVAA 1XSVA 5DCFA 3VOEA 4MHGA 3M1EA 1F1ZA 1RUNA 1BOAA 2HKXA 2KKOA 3T8TA 5F1RA 3BZ6A 3GUDA 4ENJA 4RGUA 4CHUA 2K27A 3F21A 1U6GA 2EA2A 4A5NA 3GZ6A 1FYKA 4IHSA 4L5IA 3JAMK 1KU2A 1QZZA 2D1HA 1BIBA 1ZG5A 2YSRA 2WV0A 4RAZA 4ZZLA 2P4WA 4BAYA 3R60A 1LDJA 2KIMA 5D6EA 1YIOA 2EFQA 3QPTA 1XDSA 1T39A 2P5KA 5FGMA 3K2ZA 5ILVA 2FBHA 1F5TA 1O57A 5E1WA 3F3XA 5LBQA 1ZN2A 4UVBA 2V1XA 3I0TA 3K1PA 3I4PA 4G7OF 4ZYDA 2JPBA 3R0AA 4EM2A 5A2QK 1V4RA 3LA2A 2IW5A 3KZYA 4AWXB 5BPDA 1LJ9A 1K78B 2HKOA 5ED4A 2E7WA 1J75A 5DEQA 5CVIA 2DU9A 2EK5A 1T2KA 3KP5A 2Y0MA 3TOBA 4KIFA 2P7CB 5LHIA 1QO0D 1XCBA 4FHTA 4HX4A 4XBFA 2VBZA 4JQFA 3FZVA 3WE2A 1B4AA 5FLXK 4OU0A 3DF8A 2EB7A 3IHUA 1JGSA 1P4AA 1IAWA 3LWFA 5DDGA 4HLYA 3P9CA 1XSXA 2J5PA 2BV6A 4HBLA 3ZMVA 4ZYHA 4KMFA 1FBUA 3D0SA 3RKWA 4EM1A 4G7ZF 3I59B 4OIQF 5LRRA 2GXBA 4KN4X 4IRHA 3F8FA 4LFUA 3DEUA 1L3LA 1YG2A 4U7DA 3ZMUA 3H3UA 2VE9A 3ROUA 2EV6A 1W7PB 4U88A 1R22A 4BHBA 3R0JA 1R7JA 1HXDA 5ERIA 3SQNA 1PUEE 3EETA 4ASNA 4XLNF 1LQ1A 2KIFA 5HLIA 4UNOA 1ZRCA 2XKOA 3DQVC 4IPAA 2IRFG 4OIRF 2DW4A 3KP7A 4RAYA 2RKHA 1J5YA 4EJOA 1FX7A 5AONA 1I5ZA 4WXHA 2A5YB 3LFKA 3GZ5A 1T98A 3E6BA 2ZXJA 4EJUA 4MEXF 1AOYA 4A0YA 3TDZC 5KK1A 1UCRA 3ZMZA 3IKTA 3VEPA 2XASA 2C6YA 2KIUA 3W6JB 3NQOA 3F8BA 2GZWA 2LNBA 4ZH4F 2IA0A 2MD5A 3P7NA 4QLCU 1XB4A 3AAFA 1G3WA 1MGTA 4L0ZB 1FSEA 4GCVA 4MEYF 3EUHA 4KNYA 1PDNC 2MLGA 5H20A 1FPQA 2H6BA 5LHHA 5LGNA 2GXGA 2IPQX 2JPCA 1Z6RA 4R8HA 1BI0A 1IN7A 3KCCA 3QOPA 3F23A 3KLOA 4HLXA 2M87A 2PJPA 2Z5UA 3L00A 3RPQA 3WTWC 1CGPA 3GEZA 4BHCA 2HTSA 3I5UA 4EJWA 4DQ2A 4P9FA 2NNYA 4A0ZA 4CZZA 3TDUC 4BHPA 2RNJA 2DO7A 1SD6A 2M30A 2FOKA 3BPXA 4P5OA 2DT5A 1SD4A 2VONA 3WU0A 1U5TB 4G94A 1XD7A 2FA5A 1ZG1A 4FT8A 1SD7A 2P5LC 3BP8A 3F6OA 5JFRA 2QBYA 3F8CA 3REOA 3SFZA 1S3JA 1IN4A 4NHJA 4IJAA 1DP7P 1QPMA 2FNAA 2D2WA 1DPRA 3F8MA 4DNCA 1QBJA 3K69A 2FQ3A 3M7GA 5BMZA 1ONVA 1W5SA 2PMHA 1TTYA 3C3WA 3M9AA 2G7UA 4HF1A 1KU9A 3BJOA 1ON2A 5FB2A 3IRQA 5CJ9A 4O5VA 5LLQA 1J0RA 3ZMDA 3QPHA 2ETHA 2X4HA 3CO7C 3V7SA 3GFIA 2QWWA 2P8TA 2LSOA 5J8FA 3HHGA 3BOQA 1BBYA 1KU3A 3COAC 5CLSA 4HX8A 3CUOA 4PGHA 2VN2A 3E6CC 4RGSA 2HZTA 3E6MA 4I98B 1G6NA 2DTRA 2Q2EA 1XCVA 4ZZDA 3CUQA 3OV8A 5FLXZ 1OYYA 3V8KA 1XGMA 4MQVA 5KVRA 3F22A 2DK8A 4H0EA 2AXLA 1P4WA 1ZREA 3CLOA 4KN7X 1QNTA 2O03A 1K79A 3RYPA 4MTEA 4OMYA 4EVIA 1R5GA 1TW2A 1UB9A 3RDIA 3ZN1A 1P6RA 1S29A 3ABTA 2XAQA 3KZZA 4A2UA 2F5FA 4AIJA 4G9YA 3TOAA 3KP6A 3T5XA 2DQLA 3RYRA 2XRNA 2F5EA 3J81K 4ESJA 4G6QA 1DUXC 3QRFF 2L4AA 4A0XA 3U1DA 1IN8A 3E3VA 3IC7A 1YO5C 3EYIA 3T8RA 1FP2A 4WWCA 5LGTA 4N9IA 2HTJA 3L2CA 3KETA 2VT2A 5BQTA 1C0WA 3JAMZ 3ECOA 2PI0A 1B9NA 1O3SA 2VBYA 4A6DA 1SAXA 5D4SA 5FO5A 1HSJA 4N9HA 2IT0A 2YX4A 2MH2A 1ZAOA 2E7XA 2E1NA 4MGRA 4LG0A 2EV5A 2BE5F 3K1MA 1FSHA 2BYVE 4YG2F 4WK8F 3L09A 2GA1A 2ZO4A 4UHTA 2XKPA 2EV0A 3T0YA 4ENMA 1XSDA 4K2EA 2GIVA 3WTTC 3PQJA 3TO6A 3DKWA 4HZFA 2IA2A 1F4KA 3HSEA 1O3QA 1MZBA 5CYVA 2DPDA 1I6XA 5CVUA 3MZYA 1KGSA 2G9WA 2KJBA 1RIOH 3N4MA 1K6OA 4PDKA 3FHZA 2GQQA 4OIPF 1JE8A 1R00A 4Q5SF 3F6VA 4EV0A 2AS5F 5HVQC 2DQRA 4M9XA 1REPC 4WF2A 5D8LB 2HWVA 4M6YA 2ELHA 3GFMA 3RTRA 5HLGA 3RI4A 1GHCA 1G4DA 1SD5A 2V6CA 4KYWA 1MJ9A 1QQIA 1WWXA 2VT3A 5IT9Z 1R5HA 1T0FA 2H94A 1OYIA 4BQAA 4XSXF 1BM9A 3HOSA 1OPCA 5D5XB 2CW0F 1R58A 4YFXF 2PQ8A 4AD9A 1YS7A 4WXDA 4L9TA 3ZMSA 1FBQA 4FX0A 2DFIA 5H6RA 4HQMA 3FWEA 2NYXA 3GWZA 2ISZA 1Z6TA 4IRGA 1MDMB 3VODA 2M45A 4UUVA 5JR3A 4HA8A 2NRAC 3ZQ7A 1KYWA 3CO6C 1A04A 3WGHA 2X0LA 1YQAA 3U9GA 3Q9VA 1R1TA 2GWRA 5ICCA 5HDGA 3QU3A 1QZYA 5IT3A 4FX4A 2FBKA 2P6SA 2HYFA 2XAGA 1D8KA 2A69F 2MC3A 1HW5A 5DUIA 2A68F 4HW0A 2EWNA 2OBPA 4IXAA 5LHGA 4KIGA 1L0OC 4P96A 3ML6A 5AIPA 2R7DA 2VBWA 2OQGA 1WSUA 5HS9A 1IN6A 2Z33A 2CYYA 2OU2A 1KQ9A 1T38A 2HGCA 5HS8A 4HV5A 2H6CA 1KU7A 3V7CA 4RB1A 3DV8A 2Z99A 3FX3A 1HBXG 2FMLA 3ZMTA 1K78A 4L9JA 2O6GE 3BDDA 4M6XA 5HDNA 4B09A 2W84A 4L0YB 4M72A 3BJAA 2XROA 4HDUA 4KIBA 1STZA 4QWQA 1O7LA 3HRSA 1YYVA 1FP1D 2A61A 5ICFA 1B59A 1J59A 1LB2A 3MWMA 4LLGF 5E8IA 5DUKA 2JSCA 3OOPA 2DI3A 2FRHA 3BJ6A 4S05A 3TO7A 5ILSA 3Q9SA 4P55A 1Q1HA 3MZHA 1Z91A 3S2WA 2LKPA 4LD5A 1P4XA 3HSFA 1Z9CA 3T1BA 3Q5FA 2ADUA 1VTNC 4U0YA 1W7PA 3GO5A 1U5TC 3KP3A 2O0YA 1G3TA 2PG4A 4HQEA 1RUOA 5HLHA 3JW4A 2NNNA 2QVOA 1R23A 3QP6A 5J6XA 5D4RA 1NHAA 1YW9A 5CVRA 2FE3A 3KEOA 3HHHA 4L9NA 2YR2A 4I0AA 1JHHA 1OKRA 3SZPA 3MFKA 3SHFA 1WQ2A 5F64A 3CUQB 2DK5A 4ZYGA 4GYGA 2BGCA 4U0WA 2W57A 3K0LA 3WODF 2PBIA 2XAHA 3I58A 2OAZA 2MLKA 4BH9A 1GVJA 5L3DA 1FYLA
chains in the Genus database with same CATH superfamily
1XMKA 1YW8A 1I3QJ 2K9QA 3OS0A 2ZNZA 4RB0A 5DYMA 3BR6A 5EZGA 1FT9A 4BNCA 1RETA 3QOEA 4D0PA 2J5OA 3G73A 4E7LA 3LSKA 3HSRA 5LGUA 2GLOA 3BTLA 2JA6J 1Z21A 1WCMJ 1YLFA 4CXFA 3ZQIA 2HXOA 3VFZA 3ELKA 3KEQA 3QAHA 3P9IA 2HXIA 2QQ9A 1ZLJA 5HODA 2NVUB 2WY8Q 4L9VA 4UB6C 4Y15A 3H9QA 3RQIA 3MCZA 5LD2C 1FBSA 2VC0A 2PN6A 3P5JA 2QA4I 3VSKA 1ZG3A 3OYKA 1IRGA 5GPAA 2M7AA 2CMPA 5LEJA 2VODA 3HOVJ 3ESWB 4BE2A 4KDPA 3QP5A 3W6VA 1PJRA 3GMEA 3PQKA 4BEHB 3DLLF 5TRDA 1HKSA 4HYEA 2H27A 3QPLA 1MNEA 1RNLA 1S72I 5F04A 2CO5A 2M8EA 2F4OB 3JRFA 5EEGA 4YIIA 1GUUA 2L4MA 5A2QZ 4Q4ZF 3DU5A 3LAJA 4MTDA 2W1OA 1PP7U 1ZQ3P 5ICGA 4XN3A 4X6AJ 2FXAA 5CVVA 3HOTA 3DBHB 3EUHC 2ESHA 2XAFA 2FU4A 2JRTA 3FHNA 4UXNA 3JTGA 1USTA 2DFEA 2QENA 2R3SA 2CQKA 2HR3A 1GV5A 4PZJA 3PUBA 1MSFC 1QRYA 3BG3A 4BYYA 3K4JA 1VNDA 4ZDPA 2GAUA 4HAMA 4A93J 1TQMA 3CCLI 2LF7A 2M3AA 1NK3P 3H36A 3BC8A 2X6YA 3ABKH 2F4MB 3JRBA 4BE1A 5E3MA 2QQ8A 2VJ5A 1XG1A 5FKMA 1TWCJ 5HNHA 3ASOH 4HSTA 4A3BJ 4UV9A 4EJVA 3GTJJ 1LKXA 2VQLA 1E3OC 1USSA 1MMNA 1Y1VJ 3K4LA 2DFFA 3O2PE 4BXFA 1DGWY 1ULYA 2EILH 3K7AJ 3ZQGA 3V8JA 3BR1A 4WXCA 1XGSA 3BR5A 2OZ6A 4RB3C 2ZFWA 2OD5A 3I64A 4AYBN 4A69C 1P92A 2CUJA 1BJZA 1SAUA 2DN0A 4M3DA 2BZTA 1N77A 1BJAA 3LSRA 3RJPA 2XAJA 1LFBA 1P7JA 3VPRA 4N0BA 2QF7A 1ZYRF 5FRNA 4F93B 4GFBA 5JI6A 3IWZA 4M71A 2LKXA 3QODA 3VSLA 2DMTA 2JQ7A 3HTSB 4U7BA 2Y31A 3R4KA 5D5VB 1ZH5A 1ZGJA 5L3CA 2K4BA 3BWGA 5E79C 3RKXA 3SXYA 3A01A 1WPKA 3GFLA 2O8KA 3WTZA 5ICEA 2FMYA 4A5MA 2IEKA 1V3FA 4XKVA 3GFJA 3NEUA 2K9NA 4EMSA 4NC6A 5L3EA 4HRIA 2M34A 3ECHA 3FMRA 2UXXA 1G8XA 2UV1A 1EH7A 3IAS2 3G4SI 3E5QA 4LMYA 1FOWA 2NVYJ 1R1VA 3NRVA 5E20A 3CC2I 1HC8A 1X3WB 4O6JA 4HX7A 1BL0A 5KCMA 2HDDA 2A3SA 2FEZA 3W2WA 1CF7A 4S04A 4ENKA 1EH6A 1SFEA 3C7JA 1AA7A 1U5TA 5IP9J 1LDDA 2LK2A 1IRFA 1JTYA 3JSOA 2K9SA 5DCMA 1K6YA 2MA3A 1S7AA 1IRXA 2B7EA 2QQBA 1DPUA 4BUPA 2XV4S 3R61A 3W6KB 1ZRDA 5FFXA 1YE9A 2NVQJ 4A6EA 1OISA 4IVNA 1W7PD 4RGRA 1QHGA 3PNYA 2KJCA 4M9SA 2NS7A 4GDFA 2V79A 4NQWA 3S1QJ 2LREA 3I3LA 2M1BA 2BY2A 5J40A 1LEBA 2MW8A 1D5VA 1TZLA 2ZJRF 1SFOJ 2BVMA 3OR1C 3FMQA 4LJZF 4OMZA 3WU1B 3HJEA 2Y30A 5E3NA 1A6QA 3N05A 4ENNA 2KIQA 4XR6A 2RN7A 2OQRA 2UZKA 2HFHA 3M3YJ 2Y9YA 3M8FA 3BTIA 2P0WA 3F8NA 5EEHA 2CUEA 2ME6A 1GLNA 3C2BA 4KT5C 3GTKJ 4DOZA 1WJAA 4YIFA 2VPLA 4LB5A 5E1XA 3TW6A 2UWMA 2KRFA 3IWFA 4HDVA 1ETOA 1G3YA 3WGIA 1AWCA 3GTOJ 2OUMA 3G3ZA 4AIHA 2HOAA 2L9RA 3H9GA 3I53A 2XGDA 5EJCA 4Y13A 2CV0A 2VKHA 1YOVB 1MD0A 2L02A 2JRMA 3PIOF 3OYBA 3GTPJ 4G8XA 4UVCA 2QUFA 2VASA 3IKVA 5HS7A 1ZRFA 2KT0A 1X3UA 1D1BA 2NOGA 1K4SA 1EKEA 2ZMEB 4HF2A 4Y33A 2DA1A 2WC2A 5CVJA 2A6TA 5DM6F 4YIRX 2PLYA 5F0FA 4EQQA 1BI3A 3K6GA 1UFMA 3UNGC 5IPAA 2R7FA 2OA4A 2X9DA 3E6DA 1BA5A 1TLHB 4AIKA 2E35A 2JN6A 3CCSI 4L5JA 1LFUP 3WE3A 2KLOA 3A03A 1U8RA 2F5VA 3MN2A 4H4KC 4G7HF 3EYYA 1IGNA 3HYIA 3AL0B 5B66C 3IV5A 1ODDA 4RGXA 3TQNA 1Y6IA 1EH8A 3WTUC 4DJAA 1Y8RB 4J19A 5FKOA 2K86A 4GO1A 2ZKZA 1E17A 2LG4A 3X2QH 2FSWA 4CCKA 3EDPA 1J9IA 3VB2A 3K1NA 1DGRM 1JT0A 2PMZA 2DA2A 2ZNYA 4XL9A 2O61A 2HOSA 2Q8KA 4M9ZA 1P7IA 2M0MA 2A6HF 2A6EF 4Q47A 1U3EM 1R71A 4L18B 1B72B 2LY9A 2PX9A 5EF6A 2L7ZA 4WCGA 2L3DA 2Y2ZA 5JHUA 3O6BB 3JTHA 3TMOA 4HV6A 4P1WA 2R93J 2V9KA 4V19K 2QSHX 4UB8C 2MABA 2CV1A 2FOWA 4JK1X 5LRSA 1YITI 2IS4A 5FFZA 3FKJA 4IHTA 1I27A 3OIQA 2K9LA 2D1VA 4AUXA 1BIAA 2VJIA 2E2HJ 3HG9A 2P6TA 2WBMA 2XB0X 3MD2A 3ZQFA 2F5CA 1FLIA 2CU7A 2Q1ZB 4CYCB 3MKWB 2KDOA 2XF7A 1HQCA 4YELA 1D3YA 2H09A 3LSTA 3WTYC 3H5AA 5EGOA 4CYDA 2V6EA 4XRFA 1U8BA 3KE2A 5IYDJ 3HOXJ 1S7OA 2JTVA 3I59A 4XSZF 4QTRA 1BR2A 3ZGKA 2XB5A 2HPIA 1MKMA 2YU9J 4A3GJ 3WG9A 1QA6A 1YW7A 2FUG2 2TDXA 5HDKA 3WTXC 1H88C 2EFNA 2L9VA 3K10A 1B1BA 3EUAA 2YU3A 4UV8A 3JRIA 5FRMA 2VE8A 3HRMA 2L7KA 4R79A 1HSTA 3MMYB 2DJNA 2MBFA 4KUMA 1HOMA 1OR7C 3BQYA 1DQUA 2IJLA 2BXZA 1O7FA 2EFOA 1G3SA 3LA7A 3FXUA 4GYIA 3SYTA 2WA0A 4AU7A 1OCRH 4I0BA 3IL2A 3C1DA 4KA4A 3CCRI 5C44J 2HQNA 3CDLA 3B73A 1OLTA 5FD5A 4XLPF 1NK2P 3LSPA 3V42A 3QPSA 4DBQA 1TWAJ 3S3OA 4A3IJ 4KFCA 1E3HA 3FBNB 5J1RA 4HF0A 1I6HJ 5DTDA 2R5ZB 1SFUA 2PJRA 4BEHA 5D5WB 1ZR2A 4EJTA 1T6SA 1BI1A 3SEQA 5BS6A 4IHXA 2XDVA 5DM7F 4DZPA 1Z7UA 1ETWA 2DOEA 3MKZA 5KAFC 3HPHA 2ZJ2A 3ZN0A 3N97A 1WI9A 3UR3C 5BPIA 2IBDA 1J7KA 3VWBA 4C3HJ 4IZZA 5CKTA 5JHFA 1HDPA 5IOYA 5DD8A 1R36A 2VKDA 3KLNA 3KFWX 1SMTA 1UHWA 4PUSA 1IXSB 5B5EC 1P2FA 4JBAA 3ABMH 5D6FA 1UG0A 4RB2C 2EQRA 2V7FA 1A31A 4E70A 2JJ7A 3BR2A 4XICA 2BBYA 4IQJA 3A2KA 1SVOA 1XMAA 4OINF 1BC7C 4I2OA 4NB5A 4B4CA 1UHMA 2QKLB 4IF4A 2GA2A 3HXLA 1YTYA 5L3BA 1OJLA 6PAXA 1FOKA 2E1MB 3I71A 2BHYA 2PEXA 4IEJA 4WX9A 1TBXA 4EGYA 4A3FJ 4NC8A 3MAJA 4JOMA 3RKQA 1ETKA 3TGNA 3D5LA 1ZARA 3A01B 1JGGA 1WH7A 4LG3A 1JXSA 5CQGA 4M74A 1V55H 3CUQC 3L2RA 3K4CA 2ZCWA 2AO9A 2TRTA 2HQRA 1B6AA 1MJAA 4I7HA 5CQEA 3SZGA 1LPQA 1IXRC 1JHFA 1ZHFA 1MDMA 3GTQJ 4CSWA 3DCFA 5HNFA 2E1CA 3OWTA 3C2HA 2WWYA 2WB1N 3GCMA 2O8XA 1JJ6C 2CH0A 1T56A 1O3RA 4G12A 3NAUA 2DA6A 1LE8B 2AXTC 1VQOI 1GT0C 4DZJA 2L9NA 1IUYA 2OZUA 1WZ2A 1PP8F 3ABUA 3AL0C 3CC7I 1BI2A 4CO8A 3HGGA 2CUFA 4CUGA 5K5OA 2E1MC 2K4JA 1TT5B 2RQQA 3ULQB 1XX5A 2RQPA 1FWZA 2HOTA 4R1HA 1D0YA 4IO9F 4GXOA 2M2EA 1TW3A 5L3FA 3PFIA 3S15J 3G6EI 1K83J 1TWFJ 3KPHA 2XUBA 5E1ZB 1Z0XA 2N8GA 1X4OA 2Q0OA 2E2IJ 1ON1A 3VDXA 1QGPA 3MQ0A 1VQ6I 3L9FA 2X1EA 3W2AA 5J47A 3PO2J 3S1NJ 3ZQLA 1XTAA 2ESNA 2FBIA 2R5ZA 2ECCA 2VXDA 5IOZA 2CSOA 4LGWA 4U87A 3G2BA 3FF5A 1S6LA 3FK7A 2JVGA 2O3FA 2D45A 2ID3A 2OF7A 1IZ1A 3WU2C 3SZTA 4PJ0C 4UVAA 3M07A 1F43A 2IS2A 3FXRA 2R7TA 5DV5A 3CCYA 3WHBA 4LLLA 2QGUA 1R1UA 3E97A 3IAM2 5C3EJ 4Y4RA 1YRNB 1RI7A 2FNPA 1F9NA 1BW6A 4YFKF 1U0JA 3E5UA 3LAPA 3ZP5A 4CICA 3WTSC 4ESFA 2XHKA 1OQYA 3G1OA 2BEOA 3RIRA 1B8IB 2LP0A 3V7RA 2NS8A 5KAIC 1WKMA 4ZTFA 3NARA 1Y0UA 2Y75A 4CGZA 1IDZA 5FD6A 3M1CA 2MSYA 4HOBA 4FETA 5M3MJ 4XQFA 2VC1A 3J7AY 2XPUA 3DU6A 4D7NA 3JREA 1F36A 5JVTA 2X48A 1MBJA 2G7HA 2LMDA 1D0ZA 1ZGAA 2L7FP 3J80K 2WAQA 4F7ZA 1M1EB 4LK0F 2I10A 1MH3A 3K70D 1S8NA 4O3MA 2PMZN 2HEOA 4PFPA 2Z9OA 4MFEA 5IYBJ 2Z3YA 4EM0B 1SVMA 1IO2A 2HPMA 1KQ8A 1ZLKA 4OOIA 1YFHA 3JSPA 1FJLA 4LG0B 2RVCA 2HVSA 3U1KA 5K1YA 5EG0B 3S32A 5DS9A 5ILUA 4RA2A 3R6SA 4YEJA 1JI8A 2LVSA 3HRUA 2K02A 2DMQA 5J4YA 1OR7A 4AVPA 2ELKA 2RV8A 1QVTA 1VQNI 2CFOA 2V9VA 3M4OJ 3MEXA 4KISA 1JT6A 3DPLC 4CZCA 1B72A 4M73A 2LY2A 1OMIA 3P9KA 3FXOA 4CH7A 4LB6B 2IP2A 1XN7A 2PMUA 2OTJI 2GXAA 2Z16A 2HYGD 4BXXJ 3RKYA 2BY3A 4IHVA 2EBIA 2WY7Q 3CDHA 3H35A 3L2VA 2W25A 3KP2A 1H89C 3BROA 5TISC 4D5CA 1XGOA 5FJ8J 1SFXA 5IP7J 3F9KA 3BY6A 3KZIC 2X1CA 1Z05A 3FM5A 2VBXA 2RC4A 1V5EA 4A12A 5E17F 1QPIA 1W4MA 2NS0A 5J8CA 3L7WA 3I54A 1H9TA 4BACA 1DDNA 1V54H 3BPVA 2P5VA 1HW1A 4G6DA 2KDZA 3QU6A 3V4GA 1TQIA 4HSRA 1D8JA 2XSDC 4I02A 3H5NA 1IW7F 2KPMA 4LIVA 5K5QA 3UKGA 1U78A 1PVEA 4P9UA 4EGZA 4UUTA 2STTA 1G2HA 1WRJA 1GXQA 3DFGA 5H6QA 2E19A 2XIGA 2Y69H 3ISPA 1RPWA 4N4NB 4ZDLA 3AKZA 3ONQA 4LLNA 5EYRA 3O8GA 2EZKA 1Q1VA 1FMVA 1U9OA 2DMUA 3FM3A 4I09A 4PCQA 3OMYA 3WTVC 2QZ8A 2PFBA 3ZCOA 3B6CA 4CA0A 2KISA 2Y48A 4D5FA 4MFDA 2HNHA 3G71I 1K7AA 3CTAA 3O3KA 3D1NI 2LDUA 4ABZA 4XNFA 1IJWC 2KFDA 4JX6A 3H3ZA 4ZDOA 5E18F 3S1RJ 2V26A 1FMWA 3IP4B 3LQQA 3I55I 2L9SA 4CDGA 2DTZA 3I4MJ 2GOMA 1FNNA 1W5CC 3V8LA 4M6VA 3CZ6A 1B9MA 3HIFA 2CWEA 1LNWA 1WJ5A 1TQPA 3TKYA 4C30A 3H92A 1W5TA 1UHSA 3K4KA 5F6FA 1LDKB 1DU6A 1PUFB 4ZJZA 3C18A 1YHQI 1MBEA 2VQCA 2LF8A 1H0MA 2EINH 2STWA 3FXQA 1HW2A 2L54A 1FC3A 1BW5A 2DMPA 2IVMA 3HTUA 4B44A 1FY7A 3ZOBA 1AKHA 3HUGB 1RZ4A 4TV7A 4Y17A 5F27A 2XGXA 4GGGA 3U2RA 2QCOA 4ETSA 2QYOA 1WH5A 5IP6A 3S1MJ 3E5XA 4BU2A 1BC8C 2MGQA 2E36A 1R5ID 3J81Z 4Z2YA 2A07F 2B9SA 4V2FA 2DAOA 5L3GA 4YRVA 2QBYB 1U2WA 2FQ4A 4OIOF 4B8XA 1CF7B 2KZGA 3TO9A 2XSJC 3BT9A 1GXPA 2D5VA 2VI6A 2MD0A 1LEAA 2ZXWH 1ETQA 2XGCA 1FTZA 1FYMA 1ZR4A 3FBIB 2O9LA 5TJJA 3B02A 1APLC 2DT7B 3OR2C 1VQ5I 2EIKH 2R7WA 1BOBA 5GPCA 2IGMA 2XGEA 1HKTA 1J2XA 4MQ9F 5E8GA 3GYHX 3DP7A 4IRIA 2VOPA 2JA2A 3ZQHA 3J7AO 1K4TA 2QKMB 3CCJI 2ID6A 3GTMJ 2JA5J 2QM3A 3CJNA 5K7FA 2VOOA 3DLAA 1IXCA 2COMA 2YX7A 2LKSA 4KMUX 2ICWG 2V1DA 3WGGA 2X6XA 1XDUA 4D7MA 2UUZA 4XMYA 3GX4X 3HRTA 1X19A 1E2XA 2CGPA 2RDPA 5AIQA 3E1SA 2DBBA 3KP4A 1KQ0A 3DPUA 3IRRA 3J80Z 1I1GA 3FIWA 2CUZA 2CG4A 2W85A 3OYIA 3CCVI 4DIQA 4KICA 2EA4A 4BXUA 1TWGJ 2K7LA 4LK1F 3CESA 3M8EA 1FZPB 2HDCA 1YS6A 2DOAA 3SDGA 3GLLA 4I6ZA 2L7MP 5B1BH 1KA8A 3BCBA 4M3EA 3VYTB 2OC6A 3OYJA 2VXZA 1MMAA 1EJ9A 3GVAA 3H9JA 1TNTA 1IN5A 3GXOA 2XC7A 2W00A 1Z1DA 2ZBKA 3JRHA 3DXJF 2EJRA 1YX3A 3K9TA 2VLAA 2XVCA 4KJZA 3FMSA 4MNUA 1MNDA 2DT6A 3ERED 3ZPLA 4Q48A 5DD4A 3CQZJ 2M5WA 5FLVA 2CFXA 1AKHB 3LQRA 2DPUA 5D5UB 4U0VA 4Z6YA 5LEKA 3K2AA 3SDBA 1MJBA 4PSWA 1EV7A 1SC7A 4ZYEA 2B0LA 3D5RC 1TL8A 1JKPC 5GTHC 2R5YB 1QVUA 3EQLF 1H9GA 2L01A 4CCMA 2R7OA 2P7VB 2E60A 3RPUD 3HGYA 3VYSB 3ASNH 5C4JJ 1TT0A 5FKLA 2EH3A 1O3TA 3GW2A 3NWTA 2TCTA 1OYWA 1HKQA 3HUGA 5DCMB 1E3PA 3PL8A 5HLTA 4OAYA 4ON0A 1BN5A 2UXNA 4ESBA 3GTLJ 3F72A 3DPTA 1MMDA 4M3GA 2YS9A 2FF4A 4LITA 2E71A 2WTEA 2BW3B 3A02A 4NC7A 1I39A 2HOEA 4Y7NJ 1PUFA 5GADJ 2W24A 1VQPI 1SMYF 4I01A 3CC4I 4C2UA 5IT9K 1HA8A 5K5RA 2EFWA 2DJIA 1WJFA 5HOOA 4EATA 4PGGA 1FEXA 2R7UA 2OPTA 2MH9A 2YPRA 3GBGA 3GF2A 5H2FC 4XLFA 5BOXA 1P9QC 3A4CA 3DKXA 3SFIA 2ISYA 5M5WJ 2JT1A 2WV1A 4B3XA 3BLYA 1IG7A 1T0FC 2ACJA 1IF1A 1VQ8I 1I1SA 2KMUA 2LTPA 3CDIA 1TNSA 2EFPA 3HBLA 2F5DA 3K4BA 3L2WA 5B3SH 3RPUA 1KYZA 2DLLA 3LA3A 5D8KB 4RBOA 1XGNA 2NVTJ 2NAZA 3S2HJ 2M7BA 4NBQA 4CCJA 5TGTA 2QLZA 2IA1A 3MVPA 2M9HA 2RGVA 4PSXA 3RCOA 1I3AA 4YFNF 4RS8A 3CF2A 1SVLA 3GLXA 3OS1A 2V1UA 2QQAA 2HS5A 2ZMEA 4CCOA 4DW6A 3JRCA 2JZYA 2LBFA 2F2EA 4UUSB 1LVAA 1XSVA 5DCFA 3VOEA 1O4XA 4MHGA 3M1EA 1JUSA 1F1ZA 4PJNA 1RUNA 2ZXIA 1BOAA 2JUGA 2HKXA 2KKOA 2RREA 3T8TA 4BS9A 5F1RA 3BZ6A 3CJRB 3ZRGA 1MNMC 4BQNA 3GUDA 4GRIA 4A3LJ 1N78A 4W1UA 4ENJA 2L2OA 4RGUA 4CHUA 2K27A 4B47A 4HNUA 3F21A 1U6GA 2EA2A 4A5NA 3GZ6A 4C2TA 1JUMA 1FYKA 2X1DA 4IHSA 3G1LA 4L5IA 3FKIJ 3JAMK 4AC0A 1A5JA 1KU2A 1FIAA 4PJLA 5KNLA 1QZZA 1GVDA 2D1HA 1JTXA 1BIBA 4ZTJA 3J7YJ 1ZG5A 2YSRA 2WV0A 2ZJQF 4RAZA 4BBRJ 1T95A 4ZZLA 4KITB 2P4WA 1ZK8A 4BAYA 3I9V2 4PK4A 5IYCJ 3R60A 2IS1A 1LDJA 2LYCA 3S3MA 2KIMA 5D6EA 1YIOA 1R9TJ 5LFAA 2EFQA 3CF5F 5M3FJ 2DDAA 3QPTA 1XDSA 1ACIA 4DBRA 1ETVA 1T39A 2P5KA 5FGMA 3HDDA 4IHWA 3K2ZA 3CP8A 3FDYA 2M4GA 5ILVA 3L2UA 2FBHA 2W48A 1F5TA 1O57A 1YX5A 5E1WA 4JYKA 3F3XA 1LVKA 3HKZN 4ITVA 3FXLA 5LBQA 1ZN2A 4I99C 2VQHA 3PIPF 4UVBA 2V1XA 5EGOB 3I0TA 4XRSA 1UELB 3K1PA 3SJMA 3I4PA 4G7OF 4AVZA 4AYBA 2H1LA 4ZYDA 2IGKA 4IHYA 2JPBA 3R0AA 3QQAA 4EM2A 5A2QK 2M0CA 3WG7H 1V4RA 3LA2A 1HLVA 2R92J 3OYEA 4NUBA 2HQAA 4E6KG 2IW5A 3Q0WA 3KZYA 4AWXB 5BPDA 1LJ9A 1K78B 3AG4H 1MBGA 2HKOA 5ED4A 2E7WA 2EPFA 1J75A 5DEQA 5CVIA 2DU9A 2EK5A 4NNJA 2HVQA 2ZSHB 1T2KA 3KP5A 1RKTA 2Y0MA 3TOBA 2IGNA 4KIFA 1Z77A 2DDBA 2P7CB 1Y39A 2K85A 5LHIA 1QO0D 1X3ZB 1XCBA 4FHTA 4HX4A 2R7RA 4XBFA 3HC7A 4MLOA 3TP0A 3OSFA 2VBZA 4JQFA 3OS2A 4RDUA 2V1NA 2MFZA 2HVRA 3FZVA 2KHMA 1B4AA 3WE2A 5KHDA 5FLXK 4OU0A 5J1UA 3DF8A 4AM3A 1MBHA 4XKWA 2EB7A 1G59A 3IHUA 1D0XA 1JGSA 2MC4A 1P4AA 1IAWA 2VL8A 2DYRH 4ZC3A 3LWFA 5DDGA 4HLYA 3P9CA 3B6AA 1XSXA 1JJ8C 2CQQA 2J5PA 1VF9A 2BV6A 3TL4X 9ANTA 2BOLA 4HBLA 3ZMVA 3L1PA 3PSIA 4ZYHA 4KMFA 2M4KA 2DOFA 3CJTB 1FBUA 3D0SA 4IOAF 3RKWA 4EM1A 1LUJB 3QWLA 4G7ZF 3I59B 4OIQF 5LRRA 2GXBA 4KN4X 4II2A 2JA7J 4B48A 3ERMA 4IRHA 3GTGJ 3IH4A 3F8FA 4LFUA 3DEUA 3CMMA 2EIMH 1WHUA 1L3LA 1YG2A 4FASD 2XAUA 1FOYA 4U7DA 3ZMUA 3DEWA 3H3VK 3H3UA 2VE9A 3ROUA 2EV6A 1W7PB 4U88A 4M3BA 1R22A 4BHBA 5GAGJ 2CQNA 2W4SA 3OYLA 3R0JA 1R7JA 1HXDA 5FKNA 2BY0A 5ERIA 3SQNA 1PUEE 2LLKA 3EETA 1JKRC 4PJMA 3DWLE 4ASNA 2OV7A 2ECBA 4XLNF 1QHHD 2R7XA 1LQ1A 2KIFA 5HLIA 1MW7A 2COBA 4UNOA 1WI3A 4BY7J 1ZRCA 4BL0B 3DBRB 3HEFA 2XKOA 1UJ8A 5FLMJ 3DQVC 4IPAA 2IRFG 4OIRF 2DW4A 3KP7A 4RAYA 1KONA 1OFCX 3HOZJ 2RKHA 1ITYA 1J5YA 4EJOA 4F92B 4C3JJ 4X1EA 1FX7A 1X4PA 1I5ZA 1Y0NA 2A5YB 2CS3A 3LFKA 4WXHA 3GZ5A 2DA4A 5AONA 1T98A 2LRDA 3G1MA 1YIJI 1XS9A 4BDZA 3E6BA 2ZXJA 4XORA 4EJUA 4MEXF 4D9JA 2JMWA 1AOYA 4A0YA 4C3IJ 3TDZC 5KK1A 3ABLH 5M5YJ 1IV6A 1UCRA 2CW7A 4BJ6C 3BR0A 3ZMZA 3LNQA 3CMEI 4Y3OA 3IKTA 3VEPA 2XASA 1WJBA 2C6YA 2KIUA 3HOYJ 3CMAI 3W6JB 3NQOA 4F55A 3F8BA 2CV2A 1ORKA 2GZWA 2LNBA 4ZH4F 3MKLA 3DTIA 2IA0A 2MD5A 3P7NA 4QLCU 3OYNA 3PO3J 1XB4A 3AAFA 2R7ZJ 1G3WA 1MGTA 2OJED 2E5NA 2CQXA 4L0ZB 1FSEA 4GCVA 3JCUC 4XLEA 3KYLA 3HOUJ 1QU3A 4MEYF 3EUHA 4KNYA 2LOOA 1PDNC 2MLGA 5H20A 1FPQA 2H6BA 4RM2A 5LHHA 5LGNA 1YJNI 2GXGA 2IXSA 2IPQX 4HG2A 2JPCA 1Z6RA 1K61A 4R8HA 1OCTC 1BI0A 1IN7A 3KCCA 1R4NB 3W2VA 4E7ZA 3C2GA 3QOPA 5M5XJ 4J00A 3F23A 3KLOA 1KZHA 4HLXA 2KZVA 2L5QA 2M87A 2V4JC 3OYHA 2PJPA 2Z5UA 3L00A 1XMXA 1JKQC 3RPQA 3WTWC 1CGPA 1W0TA 2JK3A 2Y0SN 3GEZA 2L0KA 4BKXA 2GM4A 3CCQI 4I76A 4BHCA 2HTSA 3I5UA 4EJWA 5J1YA 4DQ2A 4UUSA 2Z2SB 4P9FA 4A3EJ 3PJRA 1WGXA 1WVRA 2NNYA 3DKYA 3E7LA 2K3FA 2OTLI 3OYAA 4FISA 4A0ZA 4E7JA 3ZQCA 3PFYA 3TDUC 4CZZA 4BHPA 2F48A 1VQKI 2RNJA 1NTCA 2DO7A 4XIDA 3FK6A 1LE8A 1SD6A 2M30A 5C4XJ 2FOKA 1J09A 2XF6A 3BPXA 4B1RA 2EZIA 2DT5A 2KQRA 4P5OA 3S93A 1SD4A 2VONA 3WU0A 2LC2A 1U5TB 1XPXA 4G94A 1BR4A 1XD7A 4XKCA 4W97A 2FA5A 3OL4A 1MIJA 5IY5H 1ZG1A 3QYEA 4FT8A 1SD7A 2P5LC 3BP8A 3F6OA 4ANJA 5JFRA 2QBYA 1X2NA 3F8CA 3REOA 3SFZA 1S3JA 1IN4A 4NHJA 1LFPA 1WJEA 1MBKA 4IJAA 4A3DJ 2HYJA 1DP7P 4D1QA 5F1JA 1ZELA 2VB6A 1QPMA 2FNAA 2X6WA 3BG6A 4QPOA 2D2WA 4A3JJ 1DPRA 3TEDA 3S17J 3F8MA 4DNCA 1QBJA 3K69A 3FXMA 2FQ3A 1ZKGA 3M7GA 2X51A 3JR9A 5BMZA 3BCAA 4JX5A 4BQQA 4XLCA 4IOCF 3S2DJ 3OYMA 1ONVA 1W5SA 4FE4A 2PMHA 1TTYA 3C3WA 2VPRA 4XKBA 2CQ7A 3M9AA 2G7UA 2LY1A 1X1AA 1AU7A 4HF1A 3S16J 2FX0A 1KU9A 1DP3A 3BJOA 1RC9A 1ON2A 5FB2A 4QIWN 3IRQA 4DGWB 2WAEA 5CJ9A 4O5VA 5LLQA 3BG5A 4XK4A 1J0RA 3ZMDA 2NVXJ 3QPHA 2OCCH 2ETHA 2LD5A 1GV2A 4MO7A 2X4HA 2DMNA 3D5SC 3CO7C 3V7SA 3TBIA 1QZEA 3GFIA 2QWWA 2JA8J 2DODA 2P8TA 2LSOA 3HHGA 5J8FA 3BOQA 3LSHA 1BBYA 1KU3A 3COAC 2VUMJ 1EA3A 1Y56A 1Z7LA 5CLSA 4HX8A 2RNGA 3CUOA 1YJWI 4PGHA 5BNGA 2VN2A 4ZYAA 3E6CC 4BE0A 2HQ5A 4RGSA 2HZTA 3K4MA 5K7ZA 3E6MA 4I98B 2MG4A 1G6NA 2DCEA 2Y9ZA 2DTRA 2Q2EA 4RAGA 5EZHA 3Q0VA 3HL2A 1XCVA 4ZZDA 3OOUA 3QYFA 1VQMI 2P81A 2Z1DA 3CUQA 1CQTA 3OV8A 2O7OA 1MMSA 5FLXZ 1N25A 3MKYB 2H8RA 1OYYA 1SEUA 3Q3SA 3V8KA 3WHCA 1X1DA 1XGMA 4RM3A 4MQVA 3H1CA 2K5CA 1TC3C 5KVRA 3F22A 2E5ZA 2XPVA 3RQ4A 5J4VA 3JRDA 2DK8A 4H0EA 1Y8QB 2KL4A 2X6OA 1S7EA 3PM1A 2AXLA 1P4WA 3VYUB 2I5UA 1ZREA 3CLOA 4KN7X 2AQEA 4NQWB 1QNTA 5FKKA 4BQOA 3LMMA 2O03A 1OCPA 1K79A 3F0CA 3RYPA 1RESA 3Q0UA 4MTEA 3KIOA 4OMYA 4EVIA 1R5GA 1TW2A 1UB9A 3BG9A 3I4NJ 2JVHA 3RDIA 3ZN1A 1P6RA 1XC5A 2F6CA 3K4NA 1S29A 3ABTA 1ZTRA 2ELJA 1W1WE 3W3CA 2WAQN 3H5RA 2G0EA 2XAQA 3KZZA 4A2UA 2F5FA 4AIJA 2GOXB 2M8GX 4IQ4A 4G9YA 3TOAA 3KP6A 3T5XA 2HZDA 2DQLA 2QEXI 3DTKA 4IL6C 3RYRA 3EPZA 2XRNA 4XRMA 1Z3YA 1MBFA 2F5EA 3J81K 4ESJA 1ETXA 4G6QA 1SFKA 1R49A 4LIUA 2I8DA 2QSGX 1DUXC 3QRFF 2L4AA 4A0XA 3U1DA 1IN8A 3CLQA 3E3VA 1MH4A 2CJJA 3I56I 3IC7A 2R5YA 1YO5C 4BJ5C 3EYIA 3T8RA 1FP2A 4J01A 1V5GA 4WWCA 2VJJA 5LGTA 3IUOA 4N9IA 1DU0A 4XONA 1JUPA 2HTJA 1MSEC 5EG0A 3L2CA 3KETA 2VT2A 2IGOA 5BQTA 1C0WA 3JAMZ 1RKWA 3ECOA 2PI0A 1B9NA 1O3SA 5E3LA 1TP4A 2VBYA 3A0BC 4A6DA 3CCEI 1SAXA 2HU9A 4CCLA 4X0GA 4B43A 5D4SA 3KYDB 5FO5A 1HSJA 1NG6A 4FQGA 4N9HA 3KEYA 1I50J 2IT0A 2WAFA 2YX4A 1Y1WJ 2MH2A 4L5EA 3AG1H 2H1KA 1ZAOA 2E7XA 2E1NA 3FXJA 2LFBA 3M8JA 4MGRA 4LG0A 2EV5A 2DA5A 2BE5F 4BDYA 4DYRA 3K1MA 4RAFA 2W7NA 1FSHA 2BYVE 4YG2F 4WK8F 3L09A 2GA1A 2ZO4A 1N75A 4UHTA 2KRHA 2LH9A 3L2QA 2A5WA 3LSMA 1VQ4I 2XKPA 2DA7A 2EV0A 2ZMEC 3T0YA 4ENMA 3ZR8X 1XSDA 4K2EA 2GIVA 3WTTC 1NH3A 4G6TB 4II3A 2BY1A 4IKFA 1NG7A 3PQJA 1FTTA 4OWRB 2ZFUA 3PUFA 1EF4A 2XF5A 2DYSH 3TO6A 2ZSIB 3KYCB 1A6IA 4E7IA 4OAZA 3DKWA 1HF0A 4HZFA 3CJQB 2IA2A 1F4KA 3A1YA 1UMQA 2Q2EB 3HSEA 3JRGA 1O3QA 1MZBA 1IV8A 5CYVA 2DPDA 3OIOA 1I6XA 5CVUA 2H8WA 2VJ4A 3BTCA 3MZYA 1KGSA 2G9WA 2KJBA 1RIOH 3OSGA 3N4MA 1K6OA 4PDKA 2JSPA 3FHZA 1Z67A 2GQQA 3K70C 4OIPF 1JE8A 1R00A 4Q5SF 3OYGA 2VQGA 2BW3A 3F6VA 4EV0A 2AS5F 5HVQC 2DQRA 2WADA 4M9XA 1REPC 2FJ1A 4WF2A 5D8LB 2HWVA 5F0CA 3AFHA 4M6YA 4S0HB 4N4OB 3PNTA 2ELHA 1W36C 1YJ9I 4QPQA 3GFMA 3RTRA 5HLGA 1R4MB 3RI4A 3OYDA 4DYCA 1GHCA 1G4DA 1WJCA 1IRZA 1SD5A 2BVLA 4XRSG 1D1CA 3CD6I 2V6CA 4KYWA 2K40A 1MJ9A 1QQIA 3A0HC 3RSNA 1TWHJ 1WWXA 1WFXA 4FCYA 5F0HA 2VT3A 5IT9Z 1R5HA 1T0FA 2H94A 1OYIA 4BQAA 3HB9A 4F52A 2ME0A 4XSXF 1BM9A 1X1CA 3OYCA 3HOSA 1OPCA 5D5XB 2DA3A 3OYFA 2JUCA 4A3MJ 2CW0F 1R58A 3BQZA 3OIPA 4YFXF 2GIZA 2PQ8A 4AD9A 1YS7A 4WXDA 4L9TA 3ZMSA 4XN0A 1FBQA 3BZCA 4FX0A 2DFIA 4EEFG 1S5LC 4Y52J 1UZCA 5H6RA 1W36D 2A05A 2K9MA 2WB1A 3JRAA 4HQMA 3FWEA 3LSGA 1X1BA 2NYXA 3GWZA 2HDWA 1FIPA 3AG3H 1R6RA 2MYSA 2ISZA 4UY8I 2LR8A 1Z6TA 4IRGA 3HPGA 1MDMB 3VODA 3IH2A 1PYVA 2M45A 3TP3A 4UUVA 4RMNA 4XOPA 5JR3A 4M3FA 2R7VA 3O8HA 4HA8A 4E7SA 2NRAC 3ZQ7A 4E7KA 3DTEA 1KYWA 3MZ8A 4KT6A 3CO6C 2X0LA 1A04A 1ETYA 3WGHA 4AIDA 1YQAA 5E3OA 3S14J 3U9GA 3HM5A 3Q9VA 1R1TA 3PNVA 2GWRA 4PFOA 2VKVA 2O5RA 5ICCA 1X1PA 5HDGA 3QU3A 1QZYA 5IT3A 4FX4A 1ZGWA 2FBKA 2P6SA 2HYFA 3QYBA 2XAGA 1D8KA 1VZ0A 2A69F 2MC3A 1HW5A 1T08B 2YUSA 4PJJA 5K7HA 3J7ZI 2KP6A 2ZXHA 5DUIA 2A68F 2NXNB 4HW0A 1RRJA 3HOWJ 1D1AA 3LFUA 2EWNA 1IC8A 2OBPA 4IXAA 2R7QA 4KIGA 5LHGA 1L0OC 1OCZH 4P96A 4DYQA 4C9YA 3ML6A 3ZXSA 5AIPA 2R7DA 2DFHA 2VBWA 1OCCH 1IUFA 2VIXA 2OQGA 1WSUA 2BXYA 3BTJA 5GP9A 5HS9A 1IN6A 4F91B 2Z33A 2CYYA 2OCEA 2OU2A 1KQ9A 1POGA 1T38A 2HGCA 3BR3A 5HS8A 4HV5A 2H6CA 1KU7A 3V7CA 1VFCA 3RZOJ 3FXKA 1X58A 5GAEJ 4A3KJ 4RLQA 2E1OA 2E34A 1JKOC 4E7HA 4MIMA 3IH3A 4RB1A 3DV8A 4IX7A 1BR1A 2Z99A 4HEA2 2VKEA 5EDNA 2CRGA 3FX3A 2GBYA 4FE7A 4FTHA 1HBXG 3H0GJ 2FMLA 2CW8A 2R4GA 3ZMTA 1MMGA 1SANA 1K78A 4L9JA 2FD5A 3FISA 2O6GE 3U21A 3BDDA 4M6XA 5HDNA 4B09A 2W84A 1OCOH 4L0YB 4M72A 4BY1J 3BJAA 3KX2A 2K3PA 2XROA 3OL3A 4HDUA 4KIBA 4BJTA 2XPWA 1VI0A 1V5FA 1D5YA 1STZA 1VQ9I 1UG2A 4QWQA 1O7LA 3HRSA 1VQLI 1E0EA 1HDDC 3LOCA 1U9NA 2JWTA 4CYCA 1YYVA 1FP1D 1WJDA 2A61A 5ICFA 5B1AH 1T8IA 3LSIA 3OY9A 4BBSJ 1B59A 1J59A 4B3AA 1RR8C 5FROA 1Z3XA 1ERDA 1LB2A 2BHZA 3MWMA 1B8IA 3GZNB 4F3QA 2V9PA 4LLGF 3DEEA 5E8IA 5DUKA 1A35A 2R7SA 5J3LA 2JSCA 4XLHA 3OOPA 2IS6A 2AHQA 2DI3A 4A3CJ 2AQFA 2FRHA 4XM3A 2ZB9A 2PJRB 3LL7A 4QSHA 3BJ6A 4S05A 2Y0SA 3TO7A 2B63J 1A36A 2X85A 5ILSA 4XLAA 3Q9SA 4P55A 1GDTA 1RR7A 2W82A 2KRCA 3CP2A 1Q1HA 2QSFX 3MZHA 1Z91A 3E0JB 3H0DA 4HNTA 5CPRB 1YRNA 3S2WA 3SEZA 2F4IA 2LKPA 3HZJA 4LD5A 2IAIA 1P4XA 1VQ7I 1FOXA 3RZDJ 4C2MJ 4JP0A 1W0UA 2ZJPF 3HSFA 1Z9CA 3T1BA 1H8AC 3TW7A 1HCRA 4V2GA 2ADUA 3Q5FA 2XRLA 1VTNC 4U0YA 1W7PA 3GO5A 1U5TC 4E4HA 3KP3A 4NDLA 1X2MA 2O0YA 3HKZA 3NWSA 1G3TA 2PG4A 5GTIC 4HQEA 1RUOA 4JX4A 5HLHA 3AG2H 3JW4A 5JLXA 1T33A 1UAAA 2NNNA 2QVOA 2RAEA 2NOJB 3CCMI 1R23A 3QP6A 2HI3A 5J6XA 5D4RA 3BG7A 1NHAA 1YW9A 5EEAA 5CVRA 2FE3A 2R0QC 5F08A 3KEOA 3HHHA 4L9NA 1ENHA 3ZQQA 2DXIA 4HPQA 2E2JJ 4XOTA 1YI2I 2YR2A 3S8PA 4I0AA 3CCUI 3LSJA 2LBFB 1JHHA 1OKRA 4RLFA 3SZPA 3MFKA 5JVGF 3SHFA 4HNVA 1WQ2A 1AHDP 4BGDA 2EIJH 2ZC2A 5F64A 1S9HA 3CUQB 2DK5A 4ZYGA 4GYGA 3S3NA 2BGCA 3PSFA 3DBLB 5JLWA 3BZKA 1IDYA 4U0WA 2W57A 2EZLA 3K0LA 2EZHA 3VYRB 3CMYA 3WODF 4LOCA 2PBIA 2XAHA 3I58A 4CCNA 2OAZA 2MLKA 4BH9A 1GVJA 5L3DA 5GAHJ 1FYLA 3EUKL
chains in the Genus database with same CATH topology
1XMKA 1YW8A 2ZNZA 4RB0A 5DYMA 1FT9A 4BNCA 4D0PA 2J5OA 3G73A 3HSRA 5LGUA 1YLFA 4CXFA 3VFZA 3ELKA 3KEQA 3QAHA 3P9IA 2QQ9A 1ZLJA 4L9VA 4Y15A 3MCZA 1FBSA 2VC0A 2PN6A 1ZG3A 1IRGA 5LEJA 2VODA 4KDPA 3QP5A 3PQKA 5TRDA 1HKSA 4HYEA 2H27A 1RNLA 2CO5A 2M8EA 5EEGA 4YIIA 2L4MA 5A2QZ 4Q4ZF 3LAJA 4MTDA 1PP7U 5ICGA 2FXAA 5CVVA 3HOTA 2ESHA 2XAFA 2FU4A 2JRTA 4UXNA 3JTGA 1USTA 2R3SA 2QENA 2CQKA 2HR3A 4PZJA 4BYYA 2GAUA 4HAMA 1TQMA 2LF7A 4UV9A 4EJVA 1USSA 3O2PE 1ULYA 3V8JA 4WXCA 1XGSA 2OZ6A 4RB3C 2ZFWA 2OD5A 3I64A 1P92A 1BJAA 3RJPA 2XAJA 4N0BA 1ZYRF 5JI6A 3IWZA 4M71A 3HTSB 4U7BA 3R4KA 5D5VB 1ZH5A 1ZGJA 5L3CA 2K4BA 3BWGA 3RKXA 3SXYA 3GFLA 3WTZA 5ICEA 2FMYA 4A5MA 1V3FA 3GFJA 3NEUA 4EMSA 5L3EA 3ECHA 3FMRA 2UXXA 1EH7A 3E5QA 4LMYA 1R1VA 3NRVA 5E20A 4O6JA 4HX7A 2A3SA 2FEZA 1CF7A 4S04A 4ENKA 1EH6A 1SFEA 3C7JA 1U5TA 1LDDA 1IRFA 3JSOA 5DCMA 2MA3A 1S7AA 2QQBA 1DPUA 2XV4S 3R61A 3W6KB 1ZRDA 5FFXA 4A6EA 4IVNA 1W7PD 4RGRA 2KJCA 4M9SA 2V79A 4NQWA 2M1BA 1LEBA 1D5VA 3FMQA 4LJZF 4OMZA 3WU1B 4ENNA 2RN7A 2OQRA 2UZKA 2HFHA 3M8FA 3F8NA 5EEHA 4KT5C 4YIFA 4LB5A 5E1XA 2UWMA 2KRFA 3IWFA 4HDVA 1G3YA 3WGIA 1AWCA 3G3ZA 4AIHA 3I53A 4Y13A 1MD0A 2L02A 4G8XA 4UVCA 2QUFA 3IKVA 5HS7A 1ZRFA 1X3UA 2ZMEB 4HF2A 2WC2A 5CVJA 2PLYA 4EQQA 1BI3A 1UFMA 2R7FA 2OA4A 3E6DA 1TLHB 4AIKA 4L5JA 3WE3A 1U8RA 4G7HF 3EYYA 3HYIA 1ODDA 4RGXA 3TQNA 1EH8A 3WTUC 2K86A 4GO1A 2ZKZA 1E17A 2FSWA 1J9IA 3EDPA 3VB2A 3K1NA 2ZNYA 2O61A 2Q8KA 4M9ZA 2A6HF 2A6EF 4Q47A 1U3EM 4L18B 4WCGA 2L3DA 5JHUA 3O6BB 3JTHA 4HV6A 4JK1X 5LRSA 5FFZA 4IHTA 1I27A 2D1VA 1BIAA 2P6TA 2F5CA 1FLIA 1HQCA 1D3YA 2H09A 3LSTA 3WTYC 4CYDA 4XRFA 3KE2A 1S7OA 2JTVA 3I59A 4XSZF 1MKMA 3WG9A 1YW7A 2TDXA 5HDKA 3WTXC 2EFNA 1B1BA 2YU3A 4UV8A 2VE8A 3HRMA 4R79A 1HSTA 2MBFA 4KUMA 2IJLA 1O7FA 2EFOA 1G3SA 3LA7A 3FXUA 4GYIA 4I0BA 3IL2A 3C1DA 4KA4A 2HQNA 3B73A 5FD5A 4XLPF 4KFCA 4HF0A 1SFUA 5D5WB 4EJTA 1T6SA 1BI1A 5BS6A 1Z7UA 2ZJ2A 3ZN0A 3N97A 1WI9A 5BPIA 1J7KA 5DD8A 1R36A 3KLNA 3KFWX 1SMTA 1UHWA 1IXSB 1P2FA 4JBAA 5D6FA 4RB2C 4E70A 2BBYA 1XMAA 4OINF 1BC7C 4I2OA 4NB5A 1UHMA 4IF4A 2GA2A 1YTYA 5L3BA 6PAXA 1FOKA 3I71A 2PEXA 4WX9A 4EGYA 1TBXA 3MAJA 3TGNA 3D5LA 1ZARA 1JXSA 4M74A 3CUQC 2ZCWA 2HQRA 1B6AA 1MJAA 4I7HA 1IXRC 1JHFA 1ZHFA 1MDMA 2E1CA 2WWYA 2O8XA 1O3RA 1IUYA 2OZUA 1PP8F 3ABUA 1BI2A 4CO8A 5K5OA 2K4JA 3ULQB 2RQPA 1FWZA 4R1HA 4GXOA 1TW3A 5L3FA 3PFIA 2XUBA 5E1ZB 2Q0OA 1ON1A 1QGPA 3MQ0A 3L9FA 2ESNA 2FBIA 2CSOA 4LGWA 3FF5A 1S6LA 2O3FA 2D45A 1IZ1A 3SZTA 4UVAA 3FXRA 5DV5A 4LLLA 1R1UA 3E97A 1RI7A 2FNPA 1F9NA 4YFKF 3E5UA 3LAPA 3ZP5A 4CICA 3WTSC 4ESFA 2XHKA 2BEOA 3RIRA 3V7RA 1WKMA 4CGZA 1Y0UA 2Y75A 5FD6A 4HOBA 2VC1A 5JVTA 2G7HA 1ZGAA 3J80K 4F7ZA 4LK0F 1S8NA 4O3MA 2HEOA 2Z9OA 2Z3YA 4EM0B 1KQ8A 1ZLKA 4OOIA 1YFHA 3JSPA 4LG0B 2RVCA 5K1YA 5ILUA 3R6SA 3HRUA 2K02A 1OR7A 4AVPA 2RV8A 2V9VA 3MEXA 3DPLC 4M73A 1OMIA 3P9KA 4LB6B 2IP2A 1XN7A 2PMUA 2HYGD 3RKYA 3CDHA 2W25A 3KP2A 3BROA 1XGOA 1SFXA 3BY6A 1Z05A 3FM5A 2VBXA 2RC4A 4A12A 5E17F 1W4MA 2NS0A 5J8CA 3L7WA 3I54A 1H9TA 1DDNA 3BPVA 2P5VA 1HW1A 4G6DA 3QU6A 3V4GA 1TQIA 1D8JA 4I02A 1IW7F 5K5QA 1U78A 4P9UA 4EGZA 2STTA 1WRJA 1GXQA 3DFGA 5H6QA 2XIGA 3ISPA 4LLNA 3FM3A 4I09A 4PCQA 3WTVC 2QZ8A 2PFBA 2Y48A 1K7AA 3CTAA 3O3KA 2LDUA 3H3ZA 5E18F 3LQQA 4CDGA 1FNNA 3V8LA 1B9MA 3HIFA 2CWEA 1LNWA 1TQPA 3TKYA 3H92A 1W5TA 5F6FA 1LDKB 3C18A 2LF8A 1H0MA 2STWA 3FXQA 1HW2A 2L54A 1FC3A 2IVMA 3HTUA 1FY7A 1RZ4A 4TV7A 4Y17A 2XGXA 4GGGA 3U2RA 4ETSA 2QYOA 3E5XA 1BC8C 3J81Z 4Z2YA 2A07F 2DAOA 5L3GA 2QBYB 1U2WA 4OIOF 4B8XA 1CF7B 3TO9A 1GXPA 1LEAA 1FYMA 5TJJA 3B02A 1HKTA 1J2XA 4MQ9F 5E8GA 3GYHX 3DP7A 4IRIA 2VOPA 3J7AO 2QM3A 3CJNA 2VOOA 1IXCA 2COMA 2YX7A 4KMUX 2V1DA 3WGGA 1XDUA 3GX4X 3HRTA 1E2XA 2CGPA 2RDPA 5AIQA 2DBBA 3KP4A 1KQ0A 3IRRA 3J80Z 1I1GA 2CG4A 2W85A 4KICA 2EA4A 4BXUA 2K7LA 4LK1F 1FZPB 3M8EA 2HDCA 1YS6A 1KA8A 2VXZA 3GVAA 1TNTA 1IN5A 3GXOA 1Z1DA 2ZBKA 3DXJF 2EJRA 3K9TA 2XVCA 3FMSA 4MNUA 3ERED 3ZPLA 4Q48A 5DD4A 2M5WA 2CFXA 2DPUA 3LQRA 5D5UB 4U0VA 5LEKA 1MJBA 1EV7A 4ZYEA 2B0LA 3EQLF 1H9GA 2L01A 2P7VB 1O3TA 3GW2A 1OYWA 1HKQA 3HUGA 5DCMB 4ON0A 1BN5A 2UXNA 4ESBA 3F72A 3DPTA 2FF4A 2WTEA 2HOEA 2W24A 1SMYF 4I01A 5IT9K 5K5RA 2EFWA 5HOOA 4PGGA 2MH9A 2YPRA 3GF2A 5BOXA 2ISYA 2JT1A 2ACJA 1IF1A 1I1SA 1TNSA 2EFPA 2F5DA 3RPUA 1KYZA 3LA3A 5D8KB 2DLLA 1XGNA 2NAZA 2QLZA 2IA1A 2RGVA 4YFNF 4RS8A 3GLXA 2V1UA 2QQAA 2HS5A 2ZMEA 2JZYA 2F2EA 1LVAA 1XSVA 5DCFA 3VOEA 4MHGA 3M1EA 1F1ZA 1RUNA 1BOAA 2HKXA 2KKOA 3T8TA 5F1RA 3BZ6A 3GUDA 4ENJA 4RGUA 4CHUA 2K27A 3F21A 1U6GA 2EA2A 4A5NA 3GZ6A 1FYKA 4IHSA 4L5IA 3JAMK 1KU2A 1QZZA 2D1HA 1BIBA 1ZG5A 2YSRA 2WV0A 4RAZA 4ZZLA 2P4WA 4BAYA 3R60A 1LDJA 2KIMA 5D6EA 1YIOA 2EFQA 3QPTA 1XDSA 1T39A 2P5KA 5FGMA 3K2ZA 5ILVA 2FBHA 1F5TA 1O57A 5E1WA 3F3XA 5LBQA 1ZN2A 4UVBA 2V1XA 3I0TA 3K1PA 3I4PA 4G7OF 4ZYDA 2JPBA 3R0AA 4EM2A 5A2QK 1V4RA 3LA2A 2IW5A 3KZYA 4AWXB 5BPDA 1LJ9A 1K78B 2HKOA 5ED4A 2E7WA 1J75A 5DEQA 5CVIA 2DU9A 2EK5A 1T2KA 3KP5A 2Y0MA 3TOBA 4KIFA 2P7CB 5LHIA 1QO0D 1XCBA 4FHTA 4HX4A 4XBFA 2VBZA 4JQFA 3FZVA 3WE2A 1B4AA 5FLXK 4OU0A 3DF8A 2EB7A 3IHUA 1JGSA 1P4AA 1IAWA 3LWFA 5DDGA 4HLYA 3P9CA 1XSXA 2J5PA 2BV6A 4HBLA 3ZMVA 4ZYHA 4KMFA 1FBUA 3D0SA 3RKWA 4EM1A 4G7ZF 3I59B 4OIQF 5LRRA 2GXBA 4KN4X 4IRHA 3F8FA 4LFUA 3DEUA 1L3LA 1YG2A 4U7DA 3ZMUA 3H3UA 2VE9A 3ROUA 2EV6A 1W7PB 4U88A 1R22A 4BHBA 3R0JA 1R7JA 1HXDA 5ERIA 3SQNA 1PUEE 3EETA 4ASNA 4XLNF 1LQ1A 2KIFA 5HLIA 4UNOA 1ZRCA 2XKOA 3DQVC 4IPAA 2IRFG 4OIRF 2DW4A 3KP7A 4RAYA 2RKHA 1J5YA 4EJOA 1FX7A 5AONA 1I5ZA 4WXHA 2A5YB 3LFKA 3GZ5A 1T98A 3E6BA 2ZXJA 4EJUA 4MEXF 1AOYA 4A0YA 3TDZC 5KK1A 1UCRA 3ZMZA 3IKTA 3VEPA 2XASA 2C6YA 2KIUA 3W6JB 3NQOA 3F8BA 2GZWA 2LNBA 4ZH4F 2IA0A 2MD5A 3P7NA 4QLCU 1XB4A 3AAFA 1G3WA 1MGTA 4L0ZB 1FSEA 4GCVA 4MEYF 3EUHA 4KNYA 1PDNC 2MLGA 5H20A 1FPQA 2H6BA 5LHHA 5LGNA 2GXGA 2IPQX 2JPCA 1Z6RA 4R8HA 1BI0A 1IN7A 3KCCA 3QOPA 3F23A 3KLOA 4HLXA 2M87A 2PJPA 2Z5UA 3L00A 3RPQA 3WTWC 1CGPA 3GEZA 4BHCA 2HTSA 3I5UA 4EJWA 4DQ2A 4P9FA 2NNYA 4A0ZA 4CZZA 3TDUC 4BHPA 2RNJA 2DO7A 1SD6A 2M30A 2FOKA 3BPXA 4P5OA 2DT5A 1SD4A 2VONA 3WU0A 1U5TB 4G94A 1XD7A 2FA5A 1ZG1A 4FT8A 1SD7A 2P5LC 3BP8A 3F6OA 5JFRA 2QBYA 3F8CA 3REOA 3SFZA 1S3JA 1IN4A 4NHJA 4IJAA 1DP7P 1QPMA 2FNAA 2D2WA 1DPRA 3F8MA 4DNCA 1QBJA 3K69A 2FQ3A 3M7GA 5BMZA 1ONVA 1W5SA 2PMHA 1TTYA 3C3WA 3M9AA 2G7UA 4HF1A 1KU9A 3BJOA 1ON2A 5FB2A 3IRQA 5CJ9A 4O5VA 5LLQA 1J0RA 3ZMDA 3QPHA 2ETHA 2X4HA 3CO7C 3V7SA 3GFIA 2QWWA 2P8TA 2LSOA 5J8FA 3HHGA 3BOQA 1BBYA 1KU3A 3COAC 5CLSA 4HX8A 3CUOA 4PGHA 2VN2A 3E6CC 4RGSA 2HZTA 3E6MA 4I98B 1G6NA 2DTRA 2Q2EA 1XCVA 4ZZDA 3CUQA 3OV8A 5FLXZ 1OYYA 3V8KA 1XGMA 4MQVA 5KVRA 3F22A 2DK8A 4H0EA 2AXLA 1P4WA 1ZREA 3CLOA 4KN7X 1QNTA 2O03A 1K79A 3RYPA 4MTEA 4OMYA 4EVIA 1R5GA 1TW2A 1UB9A 3RDIA 3ZN1A 1P6RA 1S29A 3ABTA 2XAQA 3KZZA 4A2UA 2F5FA 4AIJA 4G9YA 3TOAA 3KP6A 3T5XA 2DQLA 3RYRA 2XRNA 2F5EA 3J81K 4ESJA 4G6QA 1DUXC 3QRFF 2L4AA 4A0XA 3U1DA 1IN8A 3E3VA 3IC7A 1YO5C 3EYIA 3T8RA 1FP2A 4WWCA 5LGTA 4N9IA 2HTJA 3L2CA 3KETA 2VT2A 5BQTA 1C0WA 3JAMZ 3ECOA 2PI0A 1B9NA 1O3SA 2VBYA 4A6DA 1SAXA 5D4SA 5FO5A 1HSJA 4N9HA 2IT0A 2YX4A 2MH2A 1ZAOA 2E7XA 2E1NA 4MGRA 4LG0A 2EV5A 2BE5F 3K1MA 1FSHA 2BYVE 4YG2F 4WK8F 3L09A 2GA1A 2ZO4A 4UHTA 2XKPA 2EV0A 3T0YA 4ENMA 1XSDA 4K2EA 2GIVA 3WTTC 3PQJA 3TO6A 3DKWA 4HZFA 2IA2A 1F4KA 3HSEA 1O3QA 1MZBA 5CYVA 2DPDA 1I6XA 5CVUA 3MZYA 1KGSA 2G9WA 2KJBA 1RIOH 3N4MA 1K6OA 4PDKA 3FHZA 2GQQA 4OIPF 1JE8A 1R00A 4Q5SF 3F6VA 4EV0A 2AS5F 5HVQC 2DQRA 4M9XA 1REPC 4WF2A 5D8LB 2HWVA 4M6YA 2ELHA 3GFMA 3RTRA 5HLGA 3RI4A 1GHCA 1G4DA 1SD5A 2V6CA 4KYWA 1MJ9A 1QQIA 1WWXA 2VT3A 5IT9Z 1R5HA 1T0FA 2H94A 1OYIA 4BQAA 4XSXF 1BM9A 3HOSA 1OPCA 5D5XB 2CW0F 1R58A 4YFXF 2PQ8A 4AD9A 1YS7A 4WXDA 4L9TA 3ZMSA 1FBQA 4FX0A 2DFIA 5H6RA 4HQMA 3FWEA 2NYXA 3GWZA 2ISZA 1Z6TA 4IRGA 1MDMB 3VODA 2M45A 4UUVA 5JR3A 4HA8A 2NRAC 3ZQ7A 1KYWA 3CO6C 1A04A 3WGHA 2X0LA 1YQAA 3U9GA 3Q9VA 1R1TA 2GWRA 5ICCA 5HDGA 3QU3A 1QZYA 5IT3A 4FX4A 2FBKA 2P6SA 2HYFA 2XAGA 1D8KA 2A69F 2MC3A 1HW5A 5DUIA 2A68F 4HW0A 2EWNA 2OBPA 4IXAA 5LHGA 4KIGA 1L0OC 4P96A 3ML6A 5AIPA 2R7DA 2VBWA 2OQGA 1WSUA 5HS9A 1IN6A 2Z33A 2CYYA 2OU2A 1KQ9A 1T38A 2HGCA 5HS8A 4HV5A 2H6CA 1KU7A 3V7CA 4RB1A 3DV8A 2Z99A 3FX3A 1HBXG 2FMLA 3ZMTA 1K78A 4L9JA 2O6GE 3BDDA 4M6XA 5HDNA 4B09A 2W84A 4L0YB 4M72A 3BJAA 2XROA 4HDUA 4KIBA 1STZA 4QWQA 1O7LA 3HRSA 1YYVA 1FP1D 2A61A 5ICFA 1B59A 1J59A 1LB2A 3MWMA 4LLGF 5E8IA 5DUKA 2JSCA 3OOPA 2DI3A 2FRHA 3BJ6A 4S05A 3TO7A 5ILSA 3Q9SA 4P55A 1Q1HA 3MZHA 1Z91A 3S2WA 2LKPA 4LD5A 1P4XA 3HSFA 1Z9CA 3T1BA 3Q5FA 2ADUA 1VTNC 4U0YA 1W7PA 3GO5A 1U5TC 3KP3A 2O0YA 1G3TA 2PG4A 4HQEA 1RUOA 5HLHA 3JW4A 2NNNA 2QVOA 1R23A 3QP6A 5J6XA 5D4RA 1NHAA 1YW9A 5CVRA 2FE3A 3KEOA 3HHHA 4L9NA 2YR2A 4I0AA 1JHHA 1OKRA 3SZPA 3MFKA 3SHFA 1WQ2A 5F64A 3CUQB 2DK5A 4ZYGA 4GYGA 2BGCA 4U0WA 2W57A 3K0LA 3WODF 2PBIA 2XAHA 3I58A 2OAZA 2MLKA 4BH9A 1GVJA 5L3DA 1FYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMK A;  1YW8 A;  2ZNZ A;  4RB0 A;  5DYM A;  1FT9 A;  4BNC A;  4D0P A;  2J5O A;  3G73 A;  3HSR A;  5LGU A;  1YLF A;  4CXF A;  3VFZ A;  3ELK A;  3KEQ A;  3QAH A;  3P9I A;  2QQ9 A;  1ZLJ A;  4L9V A;  4Y15 A;  3MCZ A;  1FBS A;  2VC0 A;  2PN6 A;  1ZG3 A;  1IRG A;  5LEJ A;  2VOD A;  4KDP A;  3QP5 A;  3PQK A;  5TRD A;  1HKS A;  4HYE A;  2H27 A;  1RNL A;  2CO5 A;  2M8E A;  5EEG A;  4YII A;  2L4M A;  5A2Q Z;  4Q4Z F;  3LAJ A;  4MTD A;  1PP7 U;  5ICG A;  2FXA A;  5CVV A;  3HOT A;  2ESH A;  2XAF A;  2FU4 A;  2JRT A;  4UXN A;  3JTG A;  1UST A;  2R3S A;  2QEN A;  2CQK A;  2HR3 A;  4PZJ A;  4BYY A;  2GAU A;  4HAM A;  1TQM A;  2LF7 A;  4UV9 A;  4EJV A;  1USS A;  3O2P E;  1ULY A;  3V8J A;  4WXC A;  1XGS A;  2OZ6 A;  4RB3 C;  2ZFW A;  2OD5 A;  3I64 A;  1P92 A;  1BJA A;  3RJP A;  2XAJ A;  4N0B A;  1ZYR F;  5JI6 A;  3IWZ A;  4M71 A;  3HTS B;  4U7B A;  3R4K A;  5D5V B;  1ZH5 A;  1ZGJ A;  5L3C A;  2K4B A;  3BWG A;  3RKX A;  3SXY A;  3GFL A;  3WTZ A;  5ICE A;  2FMY A;  4A5M A;  1V3F A;  3GFJ A;  3NEU A;  4EMS A;  5L3E A;  3ECH A;  3FMR A;  2UXX A;  1EH7 A;  3E5Q A;  4LMY A;  1R1V A;  3NRV A;  5E20 A;  4O6J A;  4HX7 A;  2A3S A;  2FEZ A;  1CF7 A;  4S04 A;  4ENK A;  1EH6 A;  1SFE A;  3C7J A;  1U5T A;  1LDD A;  1IRF A;  3JSO A;  5DCM A;  2MA3 A;  1S7A A;  2QQB A;  1DPU A;  2XV4 S;  3R61 A;  3W6K B;  1ZRD A;  5FFX A;  4A6E A;  4IVN A;  1W7P D;  4RGR A;  2KJC A;  4M9S A;  2V79 A;  4NQW A;  2M1B A;  1LEB A;  1D5V A;  3FMQ A;  4LJZ F;  4OMZ A;  3WU1 B;  4ENN A;  2RN7 A;  2OQR A;  2UZK A;  2HFH A;  3M8F A;  3F8N A;  5EEH A;  4KT5 C;  4YIF A;  4LB5 A;  5E1X A;  2UWM A;  2KRF A;  3IWF A;  4HDV A;  1G3Y A;  3WGI A;  1AWC A;  3G3Z A;  4AIH A;  3I53 A;  4Y13 A;  1MD0 A;  2L02 A;  4G8X A;  4UVC A;  2QUF A;  3IKV A;  5HS7 A;  1ZRF A;  1X3U A;  2ZME B;  4HF2 A;  2WC2 A;  5CVJ A;  2PLY A;  4EQQ A;  1BI3 A;  1UFM A;  2R7F A;  2OA4 A;  3E6D A;  1TLH B;  4AIK A;  4L5J A;  3WE3 A;  1U8R A;  4G7H F;  3EYY A;  3HYI A;  1ODD A;  4RGX A;  3TQN A;  1EH8 A;  3WTU C;  2K86 A;  4GO1 A;  2ZKZ A;  1E17 A;  2FSW A;  1J9I A;  3EDP A;  3VB2 A;  3K1N A;  2ZNY A;  2O61 A;  2Q8K A;  4M9Z A;  2A6H F;  2A6E F;  4Q47 A;  1U3E M;  4L18 B;  4WCG A;  2L3D A;  5JHU A;  3O6B B;  3JTH A;  4HV6 A;  4JK1 X;  5LRS A;  5FFZ A;  4IHT A;  1I27 A;  2D1V A;  1BIA A;  2P6T A;  2F5C A;  1FLI A;  1HQC A;  1D3Y A;  2H09 A;  3LST A;  3WTY C;  4CYD A;  4XRF A;  3KE2 A;  1S7O A;  2JTV A;  3I59 A;  4XSZ F;  1MKM A;  3WG9 A;  1YW7 A;  2TDX A;  5HDK A;  3WTX C;  2EFN A;  1B1B A;  2YU3 A;  4UV8 A;  2VE8 A;  3HRM A;  4R79 A;  1HST A;  2MBF A;  4KUM A;  2IJL A;  1O7F A;  2EFO A;  1G3S A;  3LA7 A;  3FXU A;  4GYI A;  4I0B A;  3IL2 A;  3C1D A;  4KA4 A;  2HQN A;  3B73 A;  5FD5 A;  4XLP F;  4KFC A;  4HF0 A;  1SFU A;  5D5W B;  4EJT A;  1T6S A;  1BI1 A;  5BS6 A;  1Z7U A;  2ZJ2 A;  3ZN0 A;  3N97 A;  1WI9 A;  5BPI A;  1J7K A;  5DD8 A;  1R36 A;  3KLN A;  3KFW X;  1SMT A;  1UHW A;  1IXS B;  1P2F A;  4JBA A;  5D6F A;  4RB2 C;  4E70 A;  2BBY A;  1XMA A;  4OIN F;  1BC7 C;  4I2O A;  4NB5 A;  1UHM A;  4IF4 A;  2GA2 A;  1YTY A;  5L3B A;  6PAX A;  1FOK A;  3I71 A;  2PEX A;  4WX9 A;  4EGY A;  1TBX A;  3MAJ A;  3TGN A;  3D5L A;  1ZAR A;  1JXS A;  4M74 A;  3CUQ C;  2ZCW A;  2HQR A;  1B6A A;  1MJA A;  4I7H A;  1IXR C;  1JHF A;  1ZHF A;  1MDM A;  2E1C A;  2WWY A;  2O8X A;  1O3R A;  1IUY A;  2OZU A;  1PP8 F;  3ABU A;  1BI2 A;  4CO8 A;  5K5O A;  2K4J A;  3ULQ B;  2RQP A;  1FWZ A;  4R1H A;  4GXO A;  1TW3 A;  5L3F A;  3PFI A;  2XUB A;  5E1Z B;  2Q0O A;  1ON1 A;  1QGP A;  3MQ0 A;  3L9F A;  2ESN A;  2FBI A;  2CSO A;  4LGW A;  3FF5 A;  1S6L A;  2O3F A;  2D45 A;  1IZ1 A;  3SZT A;  4UVA A;  3FXR A;  5DV5 A;  4LLL A;  1R1U A;  3E97 A;  1RI7 A;  2FNP A;  1F9N A;  4YFK F;  3E5U A;  3LAP A;  3ZP5 A;  4CIC A;  3WTS C;  4ESF A;  2XHK A;  2BEO A;  3RIR A;  3V7R A;  1WKM A;  4CGZ A;  1Y0U A;  2Y75 A;  5FD6 A;  4HOB A;  2VC1 A;  5JVT A;  2G7H A;  1ZGA A;  3J80 K;  4F7Z A;  4LK0 F;  1S8N A;  4O3M A;  2HEO A;  2Z9O A;  2Z3Y A;  4EM0 B;  1KQ8 A;  1ZLK A;  4OOI A;  1YFH A;  3JSP A;  4LG0 B;  2RVC A;  5K1Y A;  5ILU A;  3R6S A;  3HRU A;  2K02 A;  1OR7 A;  4AVP A;  2RV8 A;  2V9V A;  3MEX A;  3DPL C;  4M73 A;  1OMI A;  3P9K A;  4LB6 B;  2IP2 A;  1XN7 A;  2PMU A;  2HYG D;  3RKY A;  3CDH A;  2W25 A;  3KP2 A;  3BRO A;  1XGO A;  1SFX A;  3BY6 A;  1Z05 A;  3FM5 A;  2VBX A;  2RC4 A;  4A12 A;  5E17 F;  1W4M A;  2NS0 A;  5J8C A;  3L7W A;  3I54 A;  1H9T A;  1DDN A;  3BPV A;  2P5V A;  1HW1 A;  4G6D A;  3QU6 A;  3V4G A;  1TQI A;  1D8J A;  4I02 A;  1IW7 F;  5K5Q A;  1U78 A;  4P9U A;  4EGZ A;  2STT A;  1WRJ A;  1GXQ A;  3DFG A;  5H6Q A;  2XIG A;  3ISP A;  4LLN A;  3FM3 A;  4I09 A;  4PCQ A;  3WTV C;  2QZ8 A;  2PFB A;  2Y48 A;  1K7A A;  3CTA A;  3O3K A;  2LDU A;  3H3Z A;  5E18 F;  3LQQ A;  4CDG A;  1FNN A;  3V8L A;  1B9M A;  3HIF A;  2CWE A;  1LNW A;  1TQP A;  3TKY A;  3H92 A;  1W5T A;  5F6F A;  1LDK B;  3C18 A;  2LF8 A;  1H0M A;  2STW A;  3FXQ A;  1HW2 A;  2L54 A;  1FC3 A;  2IVM A;  3HTU A;  1FY7 A;  1RZ4 A;  4TV7 A;  4Y17 A;  2XGX A;  4GGG A;  3U2R A;  4ETS A;  2QYO A;  3E5X A;  1BC8 C;  3J81 Z;  4Z2Y A;  2A07 F;  2DAO A;  5L3G A;  2QBY B;  1U2W A;  4OIO F;  4B8X A;  1CF7 B;  3TO9 A;  1GXP A;  1LEA A;  1FYM A;  5TJJ A;  3B02 A;  1HKT A;  1J2X A;  4MQ9 F;  5E8G A;  3GYH X;  3DP7 A;  4IRI A;  2VOP A;  3J7A O;  2QM3 A;  3CJN A;  2VOO A;  1IXC A;  2COM A;  2YX7 A;  4KMU X;  2V1D A;  3WGG A;  1XDU A;  3GX4 X;  3HRT A;  1E2X A;  2CGP A;  2RDP A;  5AIQ A;  2DBB A;  3KP4 A;  1KQ0 A;  3IRR A;  3J80 Z;  1I1G A;  2CG4 A;  2W85 A;  4KIC A;  2EA4 A;  4BXU A;  2K7L A;  4LK1 F;  1FZP B;  3M8E A;  2HDC A;  1YS6 A;  1KA8 A;  2VXZ A;  3GVA A;  1TNT A;  1IN5 A;  3GXO A;  1Z1D A;  2ZBK A;  3DXJ F;  2EJR A;  3K9T A;  2XVC A;  3FMS A;  4MNU A;  3ERE D;  3ZPL A;  4Q48 A;  5DD4 A;  2M5W A;  2CFX A;  2DPU A;  3LQR A;  5D5U B;  4U0V A;  5LEK A;  1MJB A;  1EV7 A;  4ZYE A;  2B0L A;  3EQL F;  1H9G A;  2L01 A;  2P7V B;  1O3T A;  3GW2 A;  1OYW A;  1HKQ A;  3HUG A;  5DCM B;  4ON0 A;  1BN5 A;  2UXN A;  4ESB A;  3F72 A;  3DPT A;  2FF4 A;  2WTE A;  2HOE A;  2W24 A;  1SMY F;  4I01 A;  5IT9 K;  5K5R A;  2EFW A;  5HOO A;  4PGG A;  2MH9 A;  2YPR A;  3GF2 A;  5BOX A;  2ISY A;  2JT1 A;  2ACJ A;  1IF1 A;  1I1S A;  1TNS A;  2EFP A;  2F5D A;  3RPU A;  1KYZ A;  3LA3 A;  5D8K B;  2DLL A;  1XGN A;  2NAZ A;  2QLZ A;  2IA1 A;  2RGV A;  4YFN F;  4RS8 A;  3GLX A;  2V1U A;  2QQA A;  2HS5 A;  2ZME A;  2JZY A;  2F2E A;  1LVA A;  1XSV A;  5DCF A;  3VOE A;  4MHG A;  3M1E A;  1F1Z A;  1RUN A;  1BOA A;  2HKX A;  2KKO A;  3T8T A;  5F1R A;  3BZ6 A;  3GUD A;  4ENJ A;  4RGU A;  4CHU A;  2K27 A;  3F21 A;  1U6G A;  2EA2 A;  4A5N A;  3GZ6 A;  1FYK A;  4IHS A;  4L5I A;  3JAM K;  1KU2 A;  1QZZ A;  2D1H A;  1BIB A;  1ZG5 A;  2YSR A;  2WV0 A;  4RAZ A;  4ZZL A;  2P4W A;  4BAY A;  3R60 A;  1LDJ A;  2KIM A;  5D6E A;  1YIO A;  2EFQ A;  3QPT A;  1XDS A;  1T39 A;  2P5K A;  5FGM A;  3K2Z A;  5ILV A;  2FBH A;  1F5T A;  1O57 A;  5E1W A;  3F3X A;  5LBQ A;  1ZN2 A;  4UVB A;  2V1X A;  3I0T A;  3K1P A;  3I4P A;  4G7O F;  4ZYD A;  2JPB A;  3R0A A;  4EM2 A;  5A2Q K;  1V4R A;  3LA2 A;  2IW5 A;  3KZY A;  4AWX B;  5BPD A;  1LJ9 A;  1K78 B;  2HKO A;  5ED4 A;  2E7W A;  1J75 A;  5DEQ A;  5CVI A;  2DU9 A;  2EK5 A;  1T2K A;  3KP5 A;  2Y0M A;  3TOB A;  4KIF A;  2P7C B;  5LHI A;  1QO0 D;  1XCB A;  4FHT A;  4HX4 A;  4XBF A;  2VBZ A;  4JQF A;  3FZV A;  3WE2 A;  1B4A A;  5FLX K;  4OU0 A;  3DF8 A;  2EB7 A;  3IHU A;  1JGS A;  1P4A A;  1IAW A;  3LWF A;  5DDG A;  4HLY A;  3P9C A;  1XSX A;  2J5P A;  2BV6 A;  4HBL A;  3ZMV A;  4ZYH A;  4KMF A;  1FBU A;  3D0S A;  3RKW A;  4EM1 A;  4G7Z F;  3I59 B;  4OIQ F;  5LRR A;  2GXB A;  4KN4 X;  4IRH A;  3F8F A;  4LFU A;  3DEU A;  1L3L A;  1YG2 A;  4U7D A;  3ZMU A;  3H3U A;  2VE9 A;  3ROU A;  2EV6 A;  1W7P B;  4U88 A;  1R22 A;  4BHB A;  3R0J A;  1R7J A;  1HXD A;  5ERI A;  3SQN A;  1PUE E;  3EET A;  4ASN A;  4XLN F;  1LQ1 A;  2KIF A;  5HLI A;  4UNO A;  1ZRC A;  2XKO A;  3DQV C;  4IPA A;  2IRF G;  4OIR F;  2DW4 A;  3KP7 A;  4RAY A;  2RKH A;  1J5Y A;  4EJO A;  1FX7 A;  5AON A;  1I5Z A;  4WXH A;  2A5Y B;  3LFK A;  3GZ5 A;  1T98 A;  3E6B A;  2ZXJ A;  4EJU A;  4MEX F;  1AOY A;  4A0Y A;  3TDZ C;  5KK1 A;  1UCR A;  3ZMZ A;  3IKT A;  3VEP A;  2XAS A;  2C6Y A;  2KIU A;  3W6J B;  3NQO A;  3F8B A;  2GZW A;  2LNB A;  4ZH4 F;  2IA0 A;  2MD5 A;  3P7N A;  4QLC U;  1XB4 A;  3AAF A;  1G3W A;  1MGT A;  4L0Z B;  1FSE A;  4GCV A;  4MEY F;  3EUH A;  4KNY A;  1PDN C;  2MLG A;  5H20 A;  1FPQ A;  2H6B A;  5LHH A;  5LGN A;  2GXG A;  2IPQ X;  2JPC A;  1Z6R A;  4R8H A;  1BI0 A;  1IN7 A;  3KCC A;  3QOP A;  3F23 A;  3KLO A;  4HLX A;  2M87 A;  2PJP A;  2Z5U A;  3L00 A;  3RPQ A;  3WTW C;  1CGP A;  3GEZ A;  4BHC A;  2HTS A;  3I5U A;  4EJW A;  4DQ2 A;  4P9F A;  2NNY A;  4A0Z A;  4CZZ A;  3TDU C;  4BHP A;  2RNJ A;  2DO7 A;  1SD6 A;  2M30 A;  2FOK A;  3BPX A;  4P5O A;  2DT5 A;  1SD4 A;  2VON A;  3WU0 A;  1U5T B;  4G94 A;  1XD7 A;  2FA5 A;  1ZG1 A;  4FT8 A;  1SD7 A;  2P5L C;  3BP8 A;  3F6O A;  5JFR A;  2QBY A;  3F8C A;  3REO A;  3SFZ A;  1S3J A;  1IN4 A;  4NHJ A;  4IJA A;  1DP7 P;  1QPM A;  2FNA A;  2D2W A;  1DPR A;  3F8M A;  4DNC A;  1QBJ A;  3K69 A;  2FQ3 A;  3M7G A;  5BMZ A;  1ONV A;  1W5S A;  2PMH A;  1TTY A;  3C3W A;  3M9A A;  2G7U A;  4HF1 A;  1KU9 A;  3BJO A;  1ON2 A;  5FB2 A;  3IRQ A;  5CJ9 A;  4O5V A;  5LLQ A;  1J0R A;  3ZMD A;  3QPH A;  2ETH A;  2X4H A;  3CO7 C;  3V7S A;  3GFI A;  2QWW A;  2P8T A;  2LSO A;  5J8F A;  3HHG A;  3BOQ A;  1BBY A;  1KU3 A;  3COA C;  5CLS A;  4HX8 A;  3CUO A;  4PGH A;  2VN2 A;  3E6C C;  4RGS A;  2HZT A;  3E6M A;  4I98 B;  1G6N A;  2DTR A;  2Q2E A;  1XCV A;  4ZZD A;  3CUQ A;  3OV8 A;  5FLX Z;  1OYY A;  3V8K A;  1XGM A;  4MQV A;  5KVR A;  3F22 A;  2DK8 A;  4H0E A;  2AXL A;  1P4W A;  1ZRE A;  3CLO A;  4KN7 X;  1QNT A;  2O03 A;  1K79 A;  3RYP A;  4MTE A;  4OMY A;  4EVI A;  1R5G A;  1TW2 A;  1UB9 A;  3RDI A;  3ZN1 A;  1P6R A;  1S29 A;  3ABT A;  2XAQ A;  3KZZ A;  4A2U A;  2F5F A;  4AIJ A;  4G9Y A;  3TOA A;  3KP6 A;  3T5X A;  2DQL A;  3RYR A;  2XRN A;  2F5E A;  3J81 K;  4ESJ A;  4G6Q A;  1DUX C;  3QRF F;  2L4A A;  4A0X A;  3U1D A;  1IN8 A;  3E3V A;  3IC7 A;  1YO5 C;  3EYI A;  3T8R A;  1FP2 A;  4WWC A;  5LGT A;  4N9I A;  2HTJ A;  3L2C A;  3KET A;  2VT2 A;  5BQT A;  1C0W A;  3JAM Z;  3ECO A;  2PI0 A;  1B9N A;  1O3S A;  2VBY A;  4A6D A;  1SAX A;  5D4S A;  5FO5 A;  1HSJ A;  4N9H A;  2IT0 A;  2YX4 A;  2MH2 A;  1ZAO A;  2E7X A;  2E1N A;  4MGR A;  4LG0 A;  2EV5 A;  2BE5 F;  3K1M A;  1FSH A;  2BYV E;  4YG2 F;  4WK8 F;  3L09 A;  2GA1 A;  2ZO4 A;  4UHT A;  2XKP A;  2EV0 A;  3T0Y A;  4ENM A;  1XSD A;  4K2E A;  2GIV A;  3WTT C;  3PQJ A;  3TO6 A;  3DKW A;  4HZF A;  2IA2 A;  1F4K A;  3HSE A;  1O3Q A;  1MZB A;  5CYV A;  2DPD A;  1I6X A;  5CVU A;  3MZY A;  1KGS A;  2G9W A;  2KJB A;  1RIO H;  3N4M A;  1K6O A;  4PDK A;  3FHZ A;  2GQQ A;  4OIP F;  1JE8 A;  1R00 A;  4Q5S F;  3F6V A;  4EV0 A;  2AS5 F;  5HVQ C;  2DQR A;  4M9X A;  1REP C;  4WF2 A;  5D8L B;  2HWV A;  4M6Y A;  2ELH A;  3GFM A;  3RTR A;  5HLG A;  3RI4 A;  1GHC A;  1G4D A;  1SD5 A;  2V6C A;  4KYW A;  1MJ9 A;  1QQI A;  1WWX A;  2VT3 A;  5IT9 Z;  1R5H A;  1T0F A;  2H94 A;  1OYI A;  4BQA A;  4XSX F;  1BM9 A;  3HOS A;  1OPC A;  5D5X B;  2CW0 F;  1R58 A;  4YFX F;  2PQ8 A;  4AD9 A;  1YS7 A;  4WXD A;  4L9T A;  3ZMS A;  1FBQ A;  4FX0 A;  2DFI A;  5H6R A;  4HQM A;  3FWE A;  2NYX A;  3GWZ A;  2ISZ A;  1Z6T A;  4IRG A;  1MDM B;  3VOD A;  2M45 A;  4UUV A;  5JR3 A;  4HA8 A;  2NRA C;  3ZQ7 A;  1KYW A;  3CO6 C;  1A04 A;  3WGH A;  2X0L A;  1YQA A;  3U9G A;  3Q9V A;  1R1T A;  2GWR A;  5ICC A;  5HDG A;  3QU3 A;  1QZY A;  5IT3 A;  4FX4 A;  2FBK A;  2P6S A;  2HYF A;  2XAG A;  1D8K A;  2A69 F;  2MC3 A;  1HW5 A;  5DUI A;  2A68 F;  4HW0 A;  2EWN A;  2OBP A;  4IXA A;  5LHG A;  4KIG A;  1L0O C;  4P96 A;  3ML6 A;  5AIP A;  2R7D A;  2VBW A;  2OQG A;  1WSU A;  5HS9 A;  1IN6 A;  2Z33 A;  2CYY A;  2OU2 A;  1KQ9 A;  1T38 A;  2HGC A;  5HS8 A;  4HV5 A;  2H6C A;  1KU7 A;  3V7C A;  4RB1 A;  3DV8 A;  2Z99 A;  3FX3 A;  1HBX G;  2FML A;  3ZMT A;  1K78 A;  4L9J A;  2O6G E;  3BDD A;  4M6X A;  5HDN A;  4B09 A;  2W84 A;  4L0Y B;  4M72 A;  3BJA A;  2XRO A;  4HDU A;  4KIB A;  1STZ A;  4QWQ A;  1O7L A;  3HRS A;  1YYV A;  1FP1 D;  2A61 A;  5ICF A;  1B59 A;  1J59 A;  1LB2 A;  3MWM A;  4LLG F;  5E8I A;  5DUK A;  2JSC A;  3OOP A;  2DI3 A;  2FRH A;  3BJ6 A;  4S05 A;  3TO7 A;  5ILS A;  3Q9S A;  4P55 A;  1Q1H A;  3MZH A;  1Z91 A;  3S2W A;  2LKP A;  4LD5 A;  1P4X A;  3HSF A;  1Z9C A;  3T1B A;  3Q5F A;  2ADU A;  1VTN C;  4U0Y A;  1W7P A;  3GO5 A;  1U5T C;  3KP3 A;  2O0Y A;  1G3T A;  2PG4 A;  4HQE A;  1RUO A;  5HLH A;  3JW4 A;  2NNN A;  2QVO A;  1R23 A;  3QP6 A;  5J6X A;  5D4R A;  1NHA A;  1YW9 A;  5CVR A;  2FE3 A;  3KEO A;  3HHH A;  4L9N A;  2YR2 A;  4I0A A;  1JHH A;  1OKR A;  3SZP A;  3MFK A;  3SHF A;  1WQ2 A;  5F64 A;  3CUQ B;  2DK5 A;  4ZYG A;  4GYG A;  2BGC A;  4U0W A;  2W57 A;  3K0L A;  3WOD F;  2PBI A;  2XAH A;  3I58 A;  2OAZ A;  2MLK A;  4BH9 A;  1GVJ A;  5L3D A;  1FYL A; 
#chains in the Genus database with same CATH topology
 1XMK A;  1YW8 A;  1I3Q J;  2K9Q A;  3OS0 A;  2ZNZ A;  4RB0 A;  5DYM A;  3BR6 A;  5EZG A;  1FT9 A;  4BNC A;  1RET A;  3QOE A;  4D0P A;  2J5O A;  3G73 A;  4E7L A;  3LSK A;  3HSR A;  5LGU A;  2GLO A;  3BTL A;  2JA6 J;  1Z21 A;  1WCM J;  1YLF A;  4CXF A;  3ZQI A;  2HXO A;  3VFZ A;  3ELK A;  3KEQ A;  3QAH A;  3P9I A;  2HXI A;  2QQ9 A;  1ZLJ A;  5HOD A;  2NVU B;  2WY8 Q;  4L9V A;  4UB6 C;  4Y15 A;  3H9Q A;  3RQI A;  3MCZ A;  5LD2 C;  1FBS A;  2VC0 A;  2PN6 A;  3P5J A;  2QA4 I;  3VSK A;  1ZG3 A;  3OYK A;  1IRG A;  5GPA A;  2M7A A;  2CMP A;  5LEJ A;  2VOD A;  3HOV J;  3ESW B;  4BE2 A;  4KDP A;  3QP5 A;  3W6V A;  1PJR A;  3GME A;  3PQK A;  4BEH B;  3DLL F;  5TRD A;  1HKS A;  4HYE A;  2H27 A;  3QPL A;  1MNE A;  1RNL A;  1S72 I;  5F04 A;  2CO5 A;  2M8E A;  2F4O B;  3JRF A;  5EEG A;  4YII A;  1GUU A;  2L4M A;  5A2Q Z;  4Q4Z F;  3DU5 A;  3LAJ A;  4MTD A;  2W1O A;  1PP7 U;  1ZQ3 P;  5ICG A;  4XN3 A;  4X6A J;  2FXA A;  5CVV A;  3HOT A;  3DBH B;  3EUH C;  2ESH A;  2XAF A;  2FU4 A;  2JRT A;  3FHN A;  4UXN A;  3JTG A;  1UST A;  2DFE A;  2QEN A;  2R3S A;  2CQK A;  2HR3 A;  1GV5 A;  4PZJ A;  3PUB A;  1MSF C;  1QRY A;  3BG3 A;  4BYY A;  3K4J A;  1VND A;  4ZDP A;  2GAU A;  4HAM A;  4A93 J;  1TQM A;  3CCL I;  2LF7 A;  2M3A A;  1NK3 P;  3H36 A;  3BC8 A;  2X6Y A;  3ABK H;  2F4M B;  3JRB A;  4BE1 A;  5E3M A;  2QQ8 A;  2VJ5 A;  1XG1 A;  5FKM A;  1TWC J;  5HNH A;  3ASO H;  4HST A;  4A3B J;  4UV9 A;  4EJV A;  3GTJ J;  1LKX A;  2VQL A;  1E3O C;  1USS A;  1MMN A;  1Y1V J;  3K4L A;  2DFF A;  3O2P E;  4BXF A;  1DGW Y;  1ULY A;  2EIL H;  3K7A J;  3ZQG A;  3V8J A;  3BR1 A;  4WXC A;  1XGS A;  3BR5 A;  2OZ6 A;  4RB3 C;  2ZFW A;  2OD5 A;  3I64 A;  4AYB N;  4A69 C;  1P92 A;  2CUJ A;  1BJZ A;  1SAU A;  2DN0 A;  4M3D A;  2BZT A;  1N77 A;  1BJA A;  3LSR A;  3RJP A;  2XAJ A;  1LFB A;  1P7J A;  3VPR A;  4N0B A;  2QF7 A;  1ZYR F;  5FRN A;  4F93 B;  4GFB A;  5JI6 A;  3IWZ A;  4M71 A;  2LKX A;  3QOD A;  3VSL A;  2DMT A;  2JQ7 A;  3HTS B;  4U7B A;  2Y31 A;  3R4K A;  5D5V B;  1ZH5 A;  1ZGJ A;  5L3C A;  2K4B A;  3BWG A;  5E79 C;  3RKX A;  3SXY A;  3A01 A;  1WPK A;  3GFL A;  2O8K A;  3WTZ A;  5ICE A;  2FMY A;  4A5M A;  2IEK A;  1V3F A;  4XKV A;  3GFJ A;  3NEU A;  2K9N A;  4EMS A;  4NC6 A;  5L3E A;  4HRI A;  2M34 A;  3ECH A;  3FMR A;  2UXX A;  1G8X A;  2UV1 A;  1EH7 A;  3IAS 2;  3G4S I;  3E5Q A;  4LMY A;  1FOW A;  2NVY J;  1R1V A;  3NRV A;  5E20 A;  3CC2 I;  1HC8 A;  1X3W B;  4O6J A;  4HX7 A;  1BL0 A;  5KCM A;  2HDD A;  2A3S A;  2FEZ A;  3W2W A;  1CF7 A;  4S04 A;  4ENK A;  1EH6 A;  1SFE A;  3C7J A;  1AA7 A;  1U5T A;  5IP9 J;  1LDD A;  2LK2 A;  1IRF A;  1JTY A;  3JSO A;  2K9S A;  5DCM A;  1K6Y A;  2MA3 A;  1S7A A;  1IRX A;  2B7E A;  2QQB A;  1DPU A;  4BUP A;  2XV4 S;  3R61 A;  3W6K B;  1ZRD A;  5FFX A;  1YE9 A;  2NVQ J;  4A6E A;  1OIS A;  4IVN A;  1W7P D;  4RGR A;  1QHG A;  3PNY A;  2KJC A;  4M9S A;  2NS7 A;  4GDF A;  2V79 A;  4NQW A;  3S1Q J;  2LRE A;  3I3L A;  2M1B A;  2BY2 A;  5J40 A;  1LEB A;  2MW8 A;  1D5V A;  1TZL A;  2ZJR F;  1SFO J;  2BVM A;  3OR1 C;  3FMQ A;  4LJZ F;  4OMZ A;  3WU1 B;  3HJE A;  2Y30 A;  5E3N A;  1A6Q A;  3N05 A;  4ENN A;  2KIQ A;  4XR6 A;  2RN7 A;  2OQR A;  2UZK A;  2HFH A;  3M3Y J;  2Y9Y A;  3M8F A;  3BTI A;  2P0W A;  3F8N A;  5EEH A;  2CUE A;  2ME6 A;  1GLN A;  3C2B A;  4KT5 C;  3GTK J;  4DOZ A;  1WJA A;  4YIF A;  2VPL A;  4LB5 A;  5E1X A;  3TW6 A;  2UWM A;  2KRF A;  3IWF A;  4HDV A;  1ETO A;  1G3Y A;  3WGI A;  1AWC A;  3GTO J;  2OUM A;  3G3Z A;  4AIH A;  2HOA A;  2L9R A;  3H9G A;  3I53 A;  2XGD A;  5EJC A;  4Y13 A;  2CV0 A;  2VKH A;  1YOV B;  1MD0 A;  2L02 A;  2JRM A;  3PIO F;  3OYB A;  3GTP J;  4G8X A;  4UVC A;  2QUF A;  2VAS A;  3IKV A;  5HS7 A;  1ZRF A;  2KT0 A;  1X3U A;  1D1B A;  2NOG A;  1K4S A;  1EKE A;  2ZME B;  4HF2 A;  4Y33 A;  2DA1 A;  2WC2 A;  5CVJ A;  2A6T A;  5DM6 F;  4YIR X;  2PLY A;  5F0F A;  4EQQ A;  1BI3 A;  3K6G A;  1UFM A;  3UNG C;  5IPA A;  2R7F A;  2OA4 A;  2X9D A;  3E6D A;  1BA5 A;  1TLH B;  4AIK A;  2E35 A;  2JN6 A;  3CCS I;  4L5J A;  1LFU P;  3WE3 A;  2KLO A;  3A03 A;  1U8R A;  2F5V A;  3MN2 A;  4H4K C;  4G7H F;  3EYY A;  1IGN A;  3HYI A;  3AL0 B;  5B66 C;  3IV5 A;  1ODD A;  4RGX A;  3TQN A;  1Y6I A;  1EH8 A;  3WTU C;  4DJA A;  1Y8R B;  4J19 A;  5FKO A;  2K86 A;  4GO1 A;  2ZKZ A;  1E17 A;  2LG4 A;  3X2Q H;  2FSW A;  4CCK A;  3EDP A;  1J9I A;  3VB2 A;  3K1N A;  1DGR M;  1JT0 A;  2PMZ A;  2DA2 A;  2ZNY A;  4XL9 A;  2O61 A;  2HOS A;  2Q8K A;  4M9Z A;  1P7I A;  2M0M A;  2A6H F;  2A6E F;  4Q47 A;  1U3E M;  1R71 A;  4L18 B;  1B72 B;  2LY9 A;  2PX9 A;  5EF6 A;  2L7Z A;  4WCG A;  2L3D A;  2Y2Z A;  5JHU A;  3O6B B;  3JTH A;  3TMO A;  4HV6 A;  4P1W A;  2R93 J;  2V9K A;  4V19 K;  2QSH X;  4UB8 C;  2MAB A;  2CV1 A;  2FOW A;  4JK1 X;  5LRS A;  1YIT I;  2IS4 A;  5FFZ A;  3FKJ A;  4IHT A;  1I27 A;  3OIQ A;  2K9L A;  2D1V A;  4AUX A;  1BIA A;  2VJI A;  2E2H J;  3HG9 A;  2P6T A;  2WBM A;  2XB0 X;  3MD2 A;  3ZQF A;  2F5C A;  1FLI A;  2CU7 A;  2Q1Z B;  4CYC B;  3MKW B;  2KDO A;  2XF7 A;  1HQC A;  4YEL A;  1D3Y A;  2H09 A;  3LST A;  3WTY C;  3H5A A;  5EGO A;  4CYD A;  2V6E A;  4XRF A;  1U8B A;  3KE2 A;  5IYD J;  3HOX J;  1S7O A;  2JTV A;  3I59 A;  4XSZ F;  4QTR A;  1BR2 A;  3ZGK A;  2XB5 A;  2HPI A;  1MKM A;  2YU9 J;  4A3G J;  3WG9 A;  1QA6 A;  1YW7 A;  2FUG 2;  2TDX A;  5HDK A;  3WTX C;  1H88 C;  2EFN A;  2L9V A;  3K10 A;  1B1B A;  3EUA A;  2YU3 A;  4UV8 A;  3JRI A;  5FRM A;  2VE8 A;  3HRM A;  2L7K A;  4R79 A;  1HST A;  3MMY B;  2DJN A;  2MBF A;  4KUM A;  1HOM A;  1OR7 C;  3BQY A;  1DQU A;  2IJL A;  2BXZ A;  1O7F A;  2EFO A;  1G3S A;  3LA7 A;  3FXU A;  4GYI A;  3SYT A;  2WA0 A;  4AU7 A;  1OCR H;  4I0B A;  3IL2 A;  3C1D A;  4KA4 A;  3CCR I;  5C44 J;  2HQN A;  3CDL A;  3B73 A;  1OLT A;  5FD5 A;  4XLP F;  1NK2 P;  3LSP A;  3V42 A;  3QPS A;  4DBQ A;  1TWA J;  3S3O A;  4A3I J;  4KFC A;  1E3H A;  3FBN B;  5J1R A;  4HF0 A;  1I6H J;  5DTD A;  2R5Z B;  1SFU A;  2PJR A;  4BEH A;  5D5W B;  1ZR2 A;  4EJT A;  1T6S A;  1BI1 A;  3SEQ A;  5BS6 A;  4IHX A;  2XDV A;  5DM7 F;  4DZP A;  1Z7U A;  1ETW A;  2DOE A;  3MKZ A;  5KAF C;  3HPH A;  2ZJ2 A;  3ZN0 A;  3N97 A;  1WI9 A;  3UR3 C;  5BPI A;  2IBD A;  1J7K A;  3VWB A;  4C3H J;  4IZZ A;  5CKT A;  5JHF A;  1HDP A;  5IOY A;  5DD8 A;  1R36 A;  2VKD A;  3KLN A;  3KFW X;  1SMT A;  1UHW A;  4PUS A;  1IXS B;  5B5E C;  1P2F A;  4JBA A;  3ABM H;  5D6F A;  1UG0 A;  4RB2 C;  2EQR A;  2V7F A;  1A31 A;  4E70 A;  2JJ7 A;  3BR2 A;  4XIC A;  2BBY A;  4IQJ A;  3A2K A;  1SVO A;  1XMA A;  4OIN F;  1BC7 C;  4I2O A;  4NB5 A;  4B4C A;  1UHM A;  2QKL B;  4IF4 A;  2GA2 A;  3HXL A;  1YTY A;  5L3B A;  1OJL A;  6PAX A;  1FOK A;  2E1M B;  3I71 A;  2BHY A;  2PEX A;  4IEJ A;  4WX9 A;  1TBX A;  4EGY A;  4A3F J;  4NC8 A;  3MAJ A;  4JOM A;  3RKQ A;  1ETK A;  3TGN A;  3D5L A;  1ZAR A;  3A01 B;  1JGG A;  1WH7 A;  4LG3 A;  1JXS A;  5CQG A;  4M74 A;  1V55 H;  3CUQ C;  3L2R A;  3K4C A;  2ZCW A;  2AO9 A;  2TRT A;  2HQR A;  1B6A A;  1MJA A;  4I7H A;  5CQE A;  3SZG A;  1LPQ A;  1IXR C;  1JHF A;  1ZHF A;  1MDM A;  3GTQ J;  4CSW A;  3DCF A;  5HNF A;  2E1C A;  3OWT A;  3C2H A;  2WWY A;  2WB1 N;  3GCM A;  2O8X A;  1JJ6 C;  2CH0 A;  1T56 A;  1O3R A;  4G12 A;  3NAU A;  2DA6 A;  1LE8 B;  2AXT C;  1VQO I;  1GT0 C;  4DZJ A;  2L9N A;  1IUY A;  2OZU A;  1WZ2 A;  1PP8 F;  3ABU A;  3AL0 C;  3CC7 I;  1BI2 A;  4CO8 A;  3HGG A;  2CUF A;  4CUG A;  5K5O A;  2E1M C;  2K4J A;  1TT5 B;  2RQQ A;  3ULQ B;  1XX5 A;  2RQP A;  1FWZ A;  2HOT A;  4R1H A;  1D0Y A;  4IO9 F;  4GXO A;  2M2E A;  1TW3 A;  5L3F A;  3PFI A;  3S15 J;  3G6E I;  1K83 J;  1TWF J;  3KPH A;  2XUB A;  5E1Z B;  1Z0X A;  2N8G A;  1X4O A;  2Q0O A;  2E2I J;  1ON1 A;  3VDX A;  1QGP A;  3MQ0 A;  1VQ6 I;  3L9F A;  2X1E A;  3W2A A;  5J47 A;  3PO2 J;  3S1N J;  3ZQL A;  1XTA A;  2ESN A;  2FBI A;  2R5Z A;  2ECC A;  2VXD A;  5IOZ A;  2CSO A;  4LGW A;  4U87 A;  3G2B A;  3FF5 A;  1S6L A;  3FK7 A;  2JVG A;  2O3F A;  2D45 A;  2ID3 A;  2OF7 A;  1IZ1 A;  3WU2 C;  3SZT A;  4PJ0 C;  4UVA A;  3M07 A;  1F43 A;  2IS2 A;  3FXR A;  2R7T A;  5DV5 A;  3CCY A;  3WHB A;  4LLL A;  2QGU A;  1R1U A;  3E97 A;  3IAM 2;  5C3E J;  4Y4R A;  1YRN B;  1RI7 A;  2FNP A;  1F9N A;  1BW6 A;  4YFK F;  1U0J A;  3E5U A;  3LAP A;  3ZP5 A;  4CIC A;  3WTS C;  4ESF A;  2XHK A;  1OQY A;  3G1O A;  2BEO A;  3RIR A;  1B8I B;  2LP0 A;  3V7R A;  2NS8 A;  5KAI C;  1WKM A;  4ZTF A;  3NAR A;  1Y0U A;  2Y75 A;  4CGZ A;  1IDZ A;  5FD6 A;  3M1C A;  2MSY A;  4HOB A;  4FET A;  5M3M J;  4XQF A;  2VC1 A;  3J7A Y;  2XPU A;  3DU6 A;  4D7N A;  3JRE A;  1F36 A;  5JVT A;  2X48 A;  1MBJ A;  2G7H A;  2LMD A;  1D0Z A;  1ZGA A;  2L7F P;  3J80 K;  2WAQ A;  4F7Z A;  1M1E B;  4LK0 F;  2I10 A;  1MH3 A;  3K70 D;  1S8N A;  4O3M A;  2PMZ N;  2HEO A;  4PFP A;  2Z9O A;  4MFE A;  5IYB J;  2Z3Y A;  4EM0 B;  1SVM A;  1IO2 A;  2HPM A;  1KQ8 A;  1ZLK A;  4OOI A;  1YFH A;  3JSP A;  1FJL A;  4LG0 B;  2RVC A;  2HVS A;  3U1K A;  5K1Y A;  5EG0 B;  3S32 A;  5DS9 A;  5ILU A;  4RA2 A;  3R6S A;  4YEJ A;  1JI8 A;  2LVS A;  3HRU A;  2K02 A;  2DMQ A;  5J4Y A;  1OR7 A;  4AVP A;  2ELK A;  2RV8 A;  1QVT A;  1VQN I;  2CFO A;  2V9V A;  3M4O J;  3MEX A;  4KIS A;  1JT6 A;  3DPL C;  4CZC A;  1B72 A;  4M73 A;  2LY2 A;  1OMI A;  3P9K A;  3FXO A;  4CH7 A;  4LB6 B;  2IP2 A;  1XN7 A;  2PMU A;  2OTJ I;  2GXA A;  2Z16 A;  2HYG D;  4BXX J;  3RKY A;  2BY3 A;  4IHV A;  2EBI A;  2WY7 Q;  3CDH A;  3H35 A;  3L2V A;  2W25 A;  3KP2 A;  1H89 C;  3BRO A;  5TIS C;  4D5C A;  1XGO A;  5FJ8 J;  1SFX A;  5IP7 J;  3F9K A;  3BY6 A;  3KZI C;  2X1C A;  1Z05 A;  3FM5 A;  2VBX A;  2RC4 A;  1V5E A;  4A12 A;  5E17 F;  1QPI A;  1W4M A;  2NS0 A;  5J8C A;  3L7W A;  3I54 A;  1H9T A;  4BAC A;  1DDN A;  1V54 H;  3BPV A;  2P5V A;  1HW1 A;  4G6D A;  2KDZ A;  3QU6 A;  3V4G A;  1TQI A;  4HSR A;  1D8J A;  2XSD C;  4I02 A;  3H5N A;  1IW7 F;  2KPM A;  4LIV A;  5K5Q A;  3UKG A;  1U78 A;  1PVE A;  4P9U A;  4EGZ A;  4UUT A;  2STT A;  1G2H A;  1WRJ A;  1GXQ A;  3DFG A;  5H6Q A;  2E19 A;  2XIG A;  2Y69 H;  3ISP A;  1RPW A;  4N4N B;  4ZDL A;  3AKZ A;  3ONQ A;  4LLN A;  5EYR A;  3O8G A;  2EZK A;  1Q1V A;  1FMV A;  1U9O A;  2DMU A;  3FM3 A;  4I09 A;  4PCQ A;  3OMY A;  3WTV C;  2QZ8 A;  2PFB A;  3ZCO A;  3B6C A;  4CA0 A;  2KIS A;  2Y48 A;  4D5F A;  4MFD A;  2HNH A;  3G71 I;  1K7A A;  3CTA A;  3O3K A;  3D1N I;  2LDU A;  4ABZ A;  4XNF A;  1IJW C;  2KFD A;  4JX6 A;  3H3Z A;  4ZDO A;  5E18 F;  3S1R J;  2V26 A;  1FMW A;  3IP4 B;  3LQQ A;  3I55 I;  2L9S A;  4CDG A;  2DTZ A;  3I4M J;  2GOM A;  1FNN A;  1W5C C;  3V8L A;  4M6V A;  3CZ6 A;  1B9M A;  3HIF A;  2CWE A;  1LNW A;  1WJ5 A;  1TQP A;  3TKY A;  4C30 A;  3H92 A;  1W5T A;  1UHS A;  3K4K A;  5F6F A;  1LDK B;  1DU6 A;  1PUF B;  4ZJZ A;  3C18 A;  1YHQ I;  1MBE A;  2VQC A;  2LF8 A;  1H0M A;  2EIN H;  2STW A;  3FXQ A;  1HW2 A;  2L54 A;  1FC3 A;  1BW5 A;  2DMP A;  2IVM A;  3HTU A;  4B44 A;  1FY7 A;  3ZOB A;  1AKH A;  3HUG B;  1RZ4 A;  4TV7 A;  4Y17 A;  5F27 A;  2XGX A;  4GGG A;  3U2R A;  2QCO A;  4ETS A;  2QYO A;  1WH5 A;  5IP6 A;  3S1M J;  3E5X A;  4BU2 A;  1BC8 C;  2MGQ A;  2E36 A;  1R5I D;  3J81 Z;  4Z2Y A;  2A07 F;  2B9S A;  4V2F A;  2DAO A;  5L3G A;  4YRV A;  2QBY B;  1U2W A;  2FQ4 A;  4OIO F;  4B8X A;  1CF7 B;  2KZG A;  3TO9 A;  2XSJ C;  3BT9 A;  1GXP A;  2D5V A;  2VI6 A;  2MD0 A;  1LEA A;  2ZXW H;  1ETQ A;  2XGC A;  1FTZ A;  1FYM A;  1ZR4 A;  3FBI B;  2O9L A;  5TJJ A;  3B02 A;  1APL C;  2DT7 B;  3OR2 C;  1VQ5 I;  2EIK H;  2R7W A;  1BOB A;  5GPC A;  2IGM A;  2XGE A;  1HKT A;  1J2X A;  4MQ9 F;  5E8G A;  3GYH X;  3DP7 A;  4IRI A;  2VOP A;  2JA2 A;  3ZQH A;  3J7A O;  1K4T A;  2QKM B;  3CCJ I;  2ID6 A;  3GTM J;  2JA5 J;  2QM3 A;  3CJN A;  5K7F A;  2VOO A;  3DLA A;  1IXC A;  2COM A;  2YX7 A;  2LKS A;  4KMU X;  2ICW G;  2V1D A;  3WGG A;  2X6X A;  1XDU A;  4D7M A;  2UUZ A;  4XMY A;  3GX4 X;  3HRT A;  1X19 A;  1E2X A;  2CGP A;  2RDP A;  5AIQ A;  3E1S A;  2DBB A;  3KP4 A;  1KQ0 A;  3DPU A;  3IRR A;  3J80 Z;  1I1G A;  3FIW A;  2CUZ A;  2CG4 A;  2W85 A;  3OYI A;  3CCV I;  4DIQ A;  4KIC A;  2EA4 A;  4BXU A;  1TWG J;  2K7L A;  4LK1 F;  3CES A;  3M8E A;  1FZP B;  2HDC A;  1YS6 A;  2DOA A;  3SDG A;  3GLL A;  4I6Z A;  2L7M P;  5B1B H;  1KA8 A;  3BCB A;  4M3E A;  3VYT B;  2OC6 A;  3OYJ A;  2VXZ A;  1MMA A;  1EJ9 A;  3GVA A;  3H9J A;  1TNT A;  1IN5 A;  3GXO A;  2XC7 A;  2W00 A;  1Z1D A;  2ZBK A;  3JRH A;  3DXJ F;  2EJR A;  1YX3 A;  3K9T A;  2VLA A;  2XVC A;  4KJZ A;  3FMS A;  4MNU A;  1MND A;  2DT6 A;  3ERE D;  3ZPL A;  4Q48 A;  5DD4 A;  3CQZ J;  2M5W A;  5FLV A;  2CFX A;  1AKH B;  3LQR A;  2DPU A;  5D5U B;  4U0V A;  4Z6Y A;  5LEK A;  3K2A A;  3SDB A;  1MJB A;  4PSW A;  1EV7 A;  1SC7 A;  4ZYE A;  2B0L A;  3D5R C;  1TL8 A;  1JKP C;  5GTH C;  2R5Y B;  1QVU A;  3EQL F;  1H9G A;  2L01 A;  4CCM A;  2R7O A;  2P7V B;  2E60 A;  3RPU D;  3HGY A;  3VYS B;  3ASN H;  5C4J J;  1TT0 A;  5FKL A;  2EH3 A;  1O3T A;  3GW2 A;  3NWT A;  2TCT A;  1OYW A;  1HKQ A;  3HUG A;  5DCM B;  1E3P A;  3PL8 A;  5HLT A;  4OAY A;  4ON0 A;  1BN5 A;  2UXN A;  4ESB A;  3GTL J;  3F72 A;  3DPT A;  1MMD A;  4M3G A;  2YS9 A;  2FF4 A;  4LIT A;  2E71 A;  2WTE A;  2BW3 B;  3A02 A;  4NC7 A;  1I39 A;  2HOE A;  4Y7N J;  1PUF A;  5GAD J;  2W24 A;  1VQP I;  1SMY F;  4I01 A;  3CC4 I;  4C2U A;  5IT9 K;  1HA8 A;  5K5R A;  2EFW A;  2DJI A;  1WJF A;  5HOO A;  4EAT A;  4PGG A;  1FEX A;  2R7U A;  2OPT A;  2MH9 A;  2YPR A;  3GBG A;  3GF2 A;  5H2F C;  4XLF A;  5BOX A;  1P9Q C;  3A4C A;  3DKX A;  3SFI A;  2ISY A;  5M5W J;  2JT1 A;  2WV1 A;  4B3X A;  3BLY A;  1IG7 A;  1T0F C;  2ACJ A;  1IF1 A;  1VQ8 I;  1I1S A;  2KMU A;  2LTP A;  3CDI A;  1TNS A;  2EFP A;  3HBL A;  2F5D A;  3K4B A;  3L2W A;  5B3S H;  3RPU A;  1KYZ A;  2DLL A;  3LA3 A;  5D8K B;  4RBO A;  1XGN A;  2NVT J;  2NAZ A;  3S2H J;  2M7B A;  4NBQ A;  4CCJ A;  5TGT A;  2QLZ A;  2IA1 A;  3MVP A;  2M9H A;  2RGV A;  4PSX A;  3RCO A;  1I3A A;  4YFN F;  4RS8 A;  3CF2 A;  1SVL A;  3GLX A;  3OS1 A;  2V1U A;  2QQA A;  2HS5 A;  2ZME A;  4CCO A;  4DW6 A;  3JRC A;  2JZY A;  2LBF A;  2F2E A;  4UUS B;  1LVA A;  1XSV A;  5DCF A;  3VOE A;  1O4X A;  4MHG A;  3M1E A;  1JUS A;  1F1Z A;  4PJN A;  1RUN A;  2ZXI A;  1BOA A;  2JUG A;  2HKX A;  2KKO A;  2RRE A;  3T8T A;  4BS9 A;  5F1R A;  3BZ6 A;  3CJR B;  3ZRG A;  1MNM C;  4BQN A;  3GUD A;  4GRI A;  4A3L J;  1N78 A;  4W1U A;  4ENJ A;  2L2O A;  4RGU A;  4CHU A;  2K27 A;  4B47 A;  4HNU A;  3F21 A;  1U6G A;  2EA2 A;  4A5N A;  3GZ6 A;  4C2T A;  1JUM A;  1FYK A;  2X1D A;  4IHS A;  3G1L A;  4L5I A;  3FKI J;  3JAM K;  4AC0 A;  1A5J A;  1KU2 A;  1FIA A;  4PJL A;  5KNL A;  1QZZ A;  1GVD A;  2D1H A;  1JTX A;  1BIB A;  4ZTJ A;  3J7Y J;  1ZG5 A;  2YSR A;  2WV0 A;  2ZJQ F;  4RAZ A;  4BBR J;  1T95 A;  4ZZL A;  4KIT B;  2P4W A;  1ZK8 A;  4BAY A;  3I9V 2;  4PK4 A;  5IYC J;  3R60 A;  2IS1 A;  1LDJ A;  2LYC A;  3S3M A;  2KIM A;  5D6E A;  1YIO A;  1R9T J;  5LFA A;  2EFQ A;  3CF5 F;  5M3F J;  2DDA A;  3QPT A;  1XDS A;  1ACI A;  4DBR A;  1ETV A;  1T39 A;  2P5K A;  5FGM A;  3HDD A;  4IHW A;  3K2Z A;  3CP8 A;  3FDY A;  2M4G A;  5ILV A;  3L2U A;  2FBH A;  2W48 A;  1F5T A;  1O57 A;  1YX5 A;  5E1W A;  4JYK A;  3F3X A;  1LVK A;  3HKZ N;  4ITV A;  3FXL A;  5LBQ A;  1ZN2 A;  4I99 C;  2VQH A;  3PIP F;  4UVB A;  2V1X A;  5EGO B;  3I0T A;  4XRS A;  1UEL B;  3K1P A;  3SJM A;  3I4P A;  4G7O F;  4AVZ A;  4AYB A;  2H1L A;  4ZYD A;  2IGK A;  4IHY A;  2JPB A;  3R0A A;  3QQA A;  4EM2 A;  5A2Q K;  2M0C A;  3WG7 H;  1V4R A;  3LA2 A;  1HLV A;  2R92 J;  3OYE A;  4NUB A;  2HQA A;  4E6K G;  2IW5 A;  3Q0W A;  3KZY A;  4AWX B;  5BPD A;  1LJ9 A;  1K78 B;  3AG4 H;  1MBG A;  2HKO A;  5ED4 A;  2E7W A;  2EPF A;  1J75 A;  5DEQ A;  5CVI A;  2DU9 A;  2EK5 A;  4NNJ A;  2HVQ A;  2ZSH B;  1T2K A;  3KP5 A;  1RKT A;  2Y0M A;  3TOB A;  2IGN A;  4KIF A;  1Z77 A;  2DDB A;  2P7C B;  1Y39 A;  2K85 A;  5LHI A;  1QO0 D;  1X3Z B;  1XCB A;  4FHT A;  4HX4 A;  2R7R A;  4XBF A;  3HC7 A;  4MLO A;  3TP0 A;  3OSF A;  2VBZ A;  4JQF A;  3OS2 A;  4RDU A;  2V1N A;  2MFZ A;  2HVR A;  3FZV A;  2KHM A;  1B4A A;  3WE2 A;  5KHD A;  5FLX K;  4OU0 A;  5J1U A;  3DF8 A;  4AM3 A;  1MBH A;  4XKW A;  2EB7 A;  1G59 A;  3IHU A;  1D0X A;  1JGS A;  2MC4 A;  1P4A A;  1IAW A;  2VL8 A;  2DYR H;  4ZC3 A;  3LWF A;  5DDG A;  4HLY A;  3P9C A;  3B6A A;  1XSX A;  1JJ8 C;  2CQQ A;  2J5P A;  1VF9 A;  2BV6 A;  3TL4 X;  9ANT A;  2BOL A;  4HBL A;  3ZMV A;  3L1P A;  3PSI A;  4ZYH A;  4KMF A;  2M4K A;  2DOF A;  3CJT B;  1FBU A;  3D0S A;  4IOA F;  3RKW A;  4EM1 A;  1LUJ B;  3QWL A;  4G7Z F;  3I59 B;  4OIQ F;  5LRR A;  2GXB A;  4KN4 X;  4II2 A;  2JA7 J;  4B48 A;  3ERM A;  4IRH A;  3GTG J;  3IH4 A;  3F8F A;  4LFU A;  3DEU A;  3CMM A;  2EIM H;  1WHU A;  1L3L A;  1YG2 A;  4FAS D;  2XAU A;  1FOY A;  4U7D A;  3ZMU A;  3DEW A;  3H3V K;  3H3U A;  2VE9 A;  3ROU A;  2EV6 A;  1W7P B;  4U88 A;  4M3B A;  1R22 A;  4BHB A;  5GAG J;  2CQN A;  2W4S A;  3OYL A;  3R0J A;  1R7J A;  1HXD A;  5FKN A;  2BY0 A;  5ERI A;  3SQN A;  1PUE E;  2LLK A;  3EET A;  1JKR C;  4PJM A;  3DWL E;  4ASN A;  2OV7 A;  2ECB A;  4XLN F;  1QHH D;  2R7X A;  1LQ1 A;  2KIF A;  5HLI A;  1MW7 A;  2COB A;  4UNO A;  1WI3 A;  4BY7 J;  1ZRC A;  4BL0 B;  3DBR B;  3HEF A;  2XKO A;  1UJ8 A;  5FLM J;  3DQV C;  4IPA A;  2IRF G;  4OIR F;  2DW4 A;  3KP7 A;  4RAY A;  1KON A;  1OFC X;  3HOZ J;  2RKH A;  1ITY A;  1J5Y A;  4EJO A;  4F92 B;  4C3J J;  4X1E A;  1FX7 A;  1X4P A;  1I5Z A;  1Y0N A;  2A5Y B;  2CS3 A;  3LFK A;  4WXH A;  3GZ5 A;  2DA4 A;  5AON A;  1T98 A;  2LRD A;  3G1M A;  1YIJ I;  1XS9 A;  4BDZ A;  3E6B A;  2ZXJ A;  4XOR A;  4EJU A;  4MEX F;  4D9J A;  2JMW A;  1AOY A;  4A0Y A;  4C3I J;  3TDZ C;  5KK1 A;  3ABL H;  5M5Y J;  1IV6 A;  1UCR A;  2CW7 A;  4BJ6 C;  3BR0 A;  3ZMZ A;  3LNQ A;  3CME I;  4Y3O A;  3IKT A;  3VEP A;  2XAS A;  1WJB A;  2C6Y A;  2KIU A;  3HOY J;  3CMA I;  3W6J B;  3NQO A;  4F55 A;  3F8B A;  2CV2 A;  1ORK A;  2GZW A;  2LNB A;  4ZH4 F;  3MKL A;  3DTI A;  2IA0 A;  2MD5 A;  3P7N A;  4QLC U;  3OYN A;  3PO3 J;  1XB4 A;  3AAF A;  2R7Z J;  1G3W A;  1MGT A;  2OJE D;  2E5N A;  2CQX A;  4L0Z B;  1FSE A;  4GCV A;  3JCU C;  4XLE A;  3KYL A;  3HOU J;  1QU3 A;  4MEY F;  3EUH A;  4KNY A;  2LOO A;  1PDN C;  2MLG A;  5H20 A;  1FPQ A;  2H6B A;  4RM2 A;  5LHH A;  5LGN A;  1YJN I;  2GXG A;  2IXS A;  2IPQ X;  4HG2 A;  2JPC A;  1Z6R A;  1K61 A;  4R8H A;  1OCT C;  1BI0 A;  1IN7 A;  3KCC A;  1R4N B;  3W2V A;  4E7Z A;  3C2G A;  3QOP A;  5M5X J;  4J00 A;  3F23 A;  3KLO A;  1KZH A;  4HLX A;  2KZV A;  2L5Q A;  2M87 A;  2V4J C;  3OYH A;  2PJP A;  2Z5U A;  3L00 A;  1XMX A;  1JKQ C;  3RPQ A;  3WTW C;  1CGP A;  1W0T A;  2JK3 A;  2Y0S N;  3GEZ A;  2L0K A;  4BKX A;  2GM4 A;  3CCQ I;  4I76 A;  4BHC A;  2HTS A;  3I5U A;  4EJW A;  5J1Y A;  4DQ2 A;  4UUS A;  2Z2S B;  4P9F A;  4A3E J;  3PJR A;  1WGX A;  1WVR A;  2NNY A;  3DKY A;  3E7L A;  2K3F A;  2OTL I;  3OYA A;  4FIS A;  4A0Z A;  4E7J A;  3ZQC A;  3PFY A;  3TDU C;  4CZZ A;  4BHP A;  2F48 A;  1VQK I;  2RNJ A;  1NTC A;  2DO7 A;  4XID A;  3FK6 A;  1LE8 A;  1SD6 A;  2M30 A;  5C4X J;  2FOK A;  1J09 A;  2XF6 A;  3BPX A;  4B1R A;  2EZI A;  2DT5 A;  2KQR A;  4P5O A;  3S93 A;  1SD4 A;  2VON A;  3WU0 A;  2LC2 A;  1U5T B;  1XPX A;  4G94 A;  1BR4 A;  1XD7 A;  4XKC A;  4W97 A;  2FA5 A;  3OL4 A;  1MIJ A;  5IY5 H;  1ZG1 A;  3QYE A;  4FT8 A;  1SD7 A;  2P5L C;  3BP8 A;  3F6O A;  4ANJ A;  5JFR A;  2QBY A;  1X2N A;  3F8C A;  3REO A;  3SFZ A;  1S3J A;  1IN4 A;  4NHJ A;  1LFP A;  1WJE A;  1MBK A;  4IJA A;  4A3D J;  2HYJ A;  1DP7 P;  4D1Q A;  5F1J A;  1ZEL A;  2VB6 A;  1QPM A;  2FNA A;  2X6W A;  3BG6 A;  4QPO A;  2D2W A;  4A3J J;  1DPR A;  3TED A;  3S17 J;  3F8M A;  4DNC A;  1QBJ A;  3K69 A;  3FXM A;  2FQ3 A;  1ZKG A;  3M7G A;  2X51 A;  3JR9 A;  5BMZ A;  3BCA A;  4JX5 A;  4BQQ A;  4XLC A;  4IOC F;  3S2D J;  3OYM A;  1ONV A;  1W5S A;  4FE4 A;  2PMH A;  1TTY A;  3C3W A;  2VPR A;  4XKB A;  2CQ7 A;  3M9A A;  2G7U A;  2LY1 A;  1X1A A;  1AU7 A;  4HF1 A;  3S16 J;  2FX0 A;  1KU9 A;  1DP3 A;  3BJO A;  1RC9 A;  1ON2 A;  5FB2 A;  4QIW N;  3IRQ A;  4DGW B;  2WAE A;  5CJ9 A;  4O5V A;  5LLQ A;  3BG5 A;  4XK4 A;  1J0R A;  3ZMD A;  2NVX J;  3QPH A;  2OCC H;  2ETH A;  2LD5 A;  1GV2 A;  4MO7 A;  2X4H A;  2DMN A;  3D5S C;  3CO7 C;  3V7S A;  3TBI A;  1QZE A;  3GFI A;  2QWW A;  2JA8 J;  2DOD A;  2P8T A;  2LSO A;  3HHG A;  5J8F A;  3BOQ A;  3LSH A;  1BBY A;  1KU3 A;  3COA C;  2VUM J;  1EA3 A;  1Y56 A;  1Z7L A;  5CLS A;  4HX8 A;  2RNG A;  3CUO A;  1YJW I;  4PGH A;  5BNG A;  2VN2 A;  4ZYA A;  3E6C C;  4BE0 A;  2HQ5 A;  4RGS A;  2HZT A;  3K4M A;  5K7Z A;  3E6M A;  4I98 B;  2MG4 A;  1G6N A;  2DCE A;  2Y9Z A;  2DTR A;  2Q2E A;  4RAG A;  5EZH A;  3Q0V A;  3HL2 A;  1XCV A;  4ZZD A;  3OOU A;  3QYF A;  1VQM I;  2P81 A;  2Z1D A;  3CUQ A;  1CQT A;  3OV8 A;  2O7O A;  1MMS A;  5FLX Z;  1N25 A;  3MKY B;  2H8R A;  1OYY A;  1SEU A;  3Q3S A;  3V8K A;  3WHC A;  1X1D A;  1XGM A;  4RM3 A;  4MQV A;  3H1C A;  2K5C A;  1TC3 C;  5KVR A;  3F22 A;  2E5Z A;  2XPV A;  3RQ4 A;  5J4V A;  3JRD A;  2DK8 A;  4H0E A;  1Y8Q B;  2KL4 A;  2X6O A;  1S7E A;  3PM1 A;  2AXL A;  1P4W A;  3VYU B;  2I5U A;  1ZRE A;  3CLO A;  4KN7 X;  2AQE A;  4NQW B;  1QNT A;  5FKK A;  4BQO A;  3LMM A;  2O03 A;  1OCP A;  1K79 A;  3F0C A;  3RYP A;  1RES A;  3Q0U A;  4MTE A;  3KIO A;  4OMY A;  4EVI A;  1R5G A;  1TW2 A;  1UB9 A;  3BG9 A;  3I4N J;  2JVH A;  3RDI A;  3ZN1 A;  1P6R A;  1XC5 A;  2F6C A;  3K4N A;  1S29 A;  3ABT A;  1ZTR A;  2ELJ A;  1W1W E;  3W3C A;  2WAQ N;  3H5R A;  2G0E A;  2XAQ A;  3KZZ A;  4A2U A;  2F5F A;  4AIJ A;  2GOX B;  2M8G X;  4IQ4 A;  4G9Y A;  3TOA A;  3KP6 A;  3T5X A;  2HZD A;  2DQL A;  2QEX I;  3DTK A;  4IL6 C;  3RYR A;  3EPZ A;  2XRN A;  4XRM A;  1Z3Y A;  1MBF A;  2F5E A;  3J81 K;  4ESJ A;  1ETX A;  4G6Q A;  1SFK A;  1R49 A;  4LIU A;  2I8D A;  2QSG X;  1DUX C;  3QRF F;  2L4A A;  4A0X A;  3U1D A;  1IN8 A;  3CLQ A;  3E3V A;  1MH4 A;  2CJJ A;  3I56 I;  3IC7 A;  2R5Y A;  1YO5 C;  4BJ5 C;  3EYI A;  3T8R A;  1FP2 A;  4J01 A;  1V5G A;  4WWC A;  2VJJ A;  5LGT A;  3IUO A;  4N9I A;  1DU0 A;  4XON A;  1JUP A;  2HTJ A;  1MSE C;  5EG0 A;  3L2C A;  3KET A;  2VT2 A;  2IGO A;  5BQT A;  1C0W A;  3JAM Z;  1RKW A;  3ECO A;  2PI0 A;  1B9N A;  1O3S A;  5E3L A;  1TP4 A;  2VBY A;  3A0B C;  4A6D A;  3CCE I;  1SAX A;  2HU9 A;  4CCL A;  4X0G A;  4B43 A;  5D4S A;  3KYD B;  5FO5 A;  1HSJ A;  1NG6 A;  4FQG A;  4N9H A;  3KEY A;  1I50 J;  2IT0 A;  2WAF A;  2YX4 A;  1Y1W J;  2MH2 A;  4L5E A;  3AG1 H;  2H1K A;  1ZAO A;  2E7X A;  2E1N A;  3FXJ A;  2LFB A;  3M8J A;  4MGR A;  4LG0 A;  2EV5 A;  2DA5 A;  2BE5 F;  4BDY A;  4DYR A;  3K1M A;  4RAF A;  2W7N A;  1FSH A;  2BYV E;  4YG2 F;  4WK8 F;  3L09 A;  2GA1 A;  2ZO4 A;  1N75 A;  4UHT A;  2KRH A;  2LH9 A;  3L2Q A;  2A5W A;  3LSM A;  1VQ4 I;  2XKP A;  2DA7 A;  2EV0 A;  2ZME C;  3T0Y A;  4ENM A;  3ZR8 X;  1XSD A;  4K2E A;  2GIV A;  3WTT C;  1NH3 A;  4G6T B;  4II3 A;  2BY1 A;  4IKF A;  1NG7 A;  3PQJ A;  1FTT A;  4OWR B;  2ZFU A;  3PUF A;  1EF4 A;  2XF5 A;  2DYS H;  3TO6 A;  2ZSI B;  3KYC B;  1A6I A;  4E7I A;  4OAZ A;  3DKW A;  1HF0 A;  4HZF A;  3CJQ B;  2IA2 A;  1F4K A;  3A1Y A;  1UMQ A;  2Q2E B;  3HSE A;  3JRG A;  1O3Q A;  1MZB A;  1IV8 A;  5CYV A;  2DPD A;  3OIO A;  1I6X A;  5CVU A;  2H8W A;  2VJ4 A;  3BTC A;  3MZY A;  1KGS A;  2G9W A;  2KJB A;  1RIO H;  3OSG A;  3N4M A;  1K6O A;  4PDK A;  2JSP A;  3FHZ A;  1Z67 A;  2GQQ A;  3K70 C;  4OIP F;  1JE8 A;  1R00 A;  4Q5S F;  3OYG A;  2VQG A;  2BW3 A;  3F6V A;  4EV0 A;  2AS5 F;  5HVQ C;  2DQR A;  2WAD A;  4M9X A;  1REP C;  2FJ1 A;  4WF2 A;  5D8L B;  2HWV A;  5F0C A;  3AFH A;  4M6Y A;  4S0H B;  4N4O B;  3PNT A;  2ELH A;  1W36 C;  1YJ9 I;  4QPQ A;  3GFM A;  3RTR A;  5HLG A;  1R4M B;  3RI4 A;  3OYD A;  4DYC A;  1GHC A;  1G4D A;  1WJC A;  1IRZ A;  1SD5 A;  2BVL A;  4XRS G;  1D1C A;  3CD6 I;  2V6C A;  4KYW A;  2K40 A;  1MJ9 A;  1QQI A;  3A0H C;  3RSN A;  1TWH J;  1WWX A;  1WFX A;  4FCY A;  5F0H A;  2VT3 A;  5IT9 Z;  1R5H A;  1T0F A;  2H94 A;  1OYI A;  4BQA A;  3HB9 A;  4F52 A;  2ME0 A;  4XSX F;  1BM9 A;  1X1C A;  3OYC A;  3HOS A;  1OPC A;  5D5X B;  2DA3 A;  3OYF A;  2JUC A;  4A3M J;  2CW0 F;  1R58 A;  3BQZ A;  3OIP A;  4YFX F;  2GIZ A;  2PQ8 A;  4AD9 A;  1YS7 A;  4WXD A;  4L9T A;  3ZMS A;  4XN0 A;  1FBQ A;  3BZC A;  4FX0 A;  2DFI A;  4EEF G;  1S5L C;  4Y52 J;  1UZC A;  5H6R A;  1W36 D;  2A05 A;  2K9M A;  2WB1 A;  3JRA A;  4HQM A;  3FWE A;  3LSG A;  1X1B A;  2NYX A;  3GWZ A;  2HDW A;  1FIP A;  3AG3 H;  1R6R A;  2MYS A;  2ISZ A;  4UY8 I;  2LR8 A;  1Z6T A;  4IRG A;  3HPG A;  1MDM B;  3VOD A;  3IH2 A;  1PYV A;  2M45 A;  3TP3 A;  4UUV A;  4RMN A;  4XOP A;  5JR3 A;  4M3F A;  2R7V A;  3O8H A;  4HA8 A;  4E7S A;  2NRA C;  3ZQ7 A;  4E7K A;  3DTE A;  1KYW A;  3MZ8 A;  4KT6 A;  3CO6 C;  2X0L A;  1A04 A;  1ETY A;  3WGH A;  4AID A;  1YQA A;  5E3O A;  3S14 J;  3U9G A;  3HM5 A;  3Q9V A;  1R1T A;  3PNV A;  2GWR A;  4PFO A;  2VKV A;  2O5R A;  5ICC A;  1X1P A;  5HDG A;  3QU3 A;  1QZY A;  5IT3 A;  4FX4 A;  1ZGW A;  2FBK A;  2P6S A;  2HYF A;  3QYB A;  2XAG A;  1D8K A;  1VZ0 A;  2A69 F;  2MC3 A;  1HW5 A;  1T08 B;  2YUS A;  4PJJ A;  5K7H A;  3J7Z I;  2KP6 A;  2ZXH A;  5DUI A;  2A68 F;  2NXN B;  4HW0 A;  1RRJ A;  3HOW J;  1D1A A;  3LFU A;  2EWN A;  1IC8 A;  2OBP A;  4IXA A;  2R7Q A;  4KIG A;  5LHG A;  1L0O C;  1OCZ H;  4P96 A;  4DYQ A;  4C9Y A;  3ML6 A;  3ZXS A;  5AIP A;  2R7D A;  2DFH A;  2VBW A;  1OCC H;  1IUF A;  2VIX A;  2OQG A;  1WSU A;  2BXY A;  3BTJ A;  5GP9 A;  5HS9 A;  1IN6 A;  4F91 B;  2Z33 A;  2CYY A;  2OCE A;  2OU2 A;  1KQ9 A;  1POG A;  1T38 A;  2HGC A;  3BR3 A;  5HS8 A;  4HV5 A;  2H6C A;  1KU7 A;  3V7C A;  1VFC A;  3RZO J;  3FXK A;  1X58 A;  5GAE J;  4A3K J;  4RLQ A;  2E1O A;  2E34 A;  1JKO C;  4E7H A;  4MIM A;  3IH3 A;  4RB1 A;  3DV8 A;  4IX7 A;  1BR1 A;  2Z99 A;  4HEA 2;  2VKE A;  5EDN A;  2CRG A;  3FX3 A;  2GBY A;  4FE7 A;  4FTH A;  1HBX G;  3H0G J;  2FML A;  2CW8 A;  2R4G A;  3ZMT A;  1MMG A;  1SAN A;  1K78 A;  4L9J A;  2FD5 A;  3FIS A;  2O6G E;  3U21 A;  3BDD A;  4M6X A;  5HDN A;  4B09 A;  2W84 A;  1OCO H;  4L0Y B;  4M72 A;  4BY1 J;  3BJA A;  3KX2 A;  2K3P A;  2XRO A;  3OL3 A;  4HDU A;  4KIB A;  4BJT A;  2XPW A;  1VI0 A;  1V5F A;  1D5Y A;  1STZ A;  1VQ9 I;  1UG2 A;  4QWQ A;  1O7L A;  3HRS A;  1VQL I;  1E0E A;  1HDD C;  3LOC A;  1U9N A;  2JWT A;  4CYC A;  1YYV A;  1FP1 D;  1WJD A;  2A61 A;  5ICF A;  5B1A H;  1T8I A;  3LSI A;  3OY9 A;  4BBS J;  1B59 A;  1J59 A;  4B3A A;  1RR8 C;  5FRO A;  1Z3X A;  1ERD A;  1LB2 A;  2BHZ A;  3MWM A;  1B8I A;  3GZN B;  4F3Q A;  2V9P A;  4LLG F;  3DEE A;  5E8I A;  5DUK A;  1A35 A;  2R7S A;  5J3L A;  2JSC A;  4XLH A;  3OOP A;  2IS6 A;  2AHQ A;  2DI3 A;  4A3C J;  2AQF A;  2FRH A;  4XM3 A;  2ZB9 A;  2PJR B;  3LL7 A;  4QSH A;  3BJ6 A;  4S05 A;  2Y0S A;  3TO7 A;  2B63 J;  1A36 A;  2X85 A;  5ILS A;  4XLA A;  3Q9S A;  4P55 A;  1GDT A;  1RR7 A;  2W82 A;  2KRC A;  3CP2 A;  1Q1H A;  2QSF X;  3MZH A;  1Z91 A;  3E0J B;  3H0D A;  4HNT A;  5CPR B;  1YRN A;  3S2W A;  3SEZ A;  2F4I A;  2LKP A;  3HZJ A;  4LD5 A;  2IAI A;  1P4X A;  1VQ7 I;  1FOX A;  3RZD J;  4C2M J;  4JP0 A;  1W0U A;  2ZJP F;  3HSF A;  1Z9C A;  3T1B A;  1H8A C;  3TW7 A;  1HCR A;  4V2G A;  2ADU A;  3Q5F A;  2XRL A;  1VTN C;  4U0Y A;  1W7P A;  3GO5 A;  1U5T C;  4E4H A;  3KP3 A;  4NDL A;  1X2M A;  2O0Y A;  3HKZ A;  3NWS A;  1G3T A;  2PG4 A;  5GTI C;  4HQE A;  1RUO A;  4JX4 A;  5HLH A;  3AG2 H;  3JW4 A;  5JLX A;  1T33 A;  1UAA A;  2NNN A;  2QVO A;  2RAE A;  2NOJ B;  3CCM I;  1R23 A;  3QP6 A;  2HI3 A;  5J6X A;  5D4R A;  3BG7 A;  1NHA A;  1YW9 A;  5EEA A;  5CVR A;  2FE3 A;  2R0Q C;  5F08 A;  3KEO A;  3HHH A;  4L9N A;  1ENH A;  3ZQQ A;  2DXI A;  4HPQ A;  2E2J J;  4XOT A;  1YI2 I;  2YR2 A;  3S8P A;  4I0A A;  3CCU I;  3LSJ A;  2LBF B;  1JHH A;  1OKR A;  4RLF A;  3SZP A;  3MFK A;  5JVG F;  3SHF A;  4HNV A;  1WQ2 A;  1AHD P;  4BGD A;  2EIJ H;  2ZC2 A;  5F64 A;  1S9H A;  3CUQ B;  2DK5 A;  4ZYG A;  4GYG A;  3S3N A;  2BGC A;  3PSF A;  3DBL B;  5JLW A;  3BZK A;  1IDY A;  4U0W A;  2W57 A;  2EZL A;  3K0L A;  2EZH A;  3VYR B;  3CMY A;  3WOD F;  4LOC A;  2PBI A;  2XAH A;  3I58 A;  4CCN A;  2OAZ A;  2MLK A;  4BH9 A;  1GVJ A;  5L3D A;  5GAH J;  1FYL A;  3EUK L; 
#chains in the Genus database with same CATH homology
 1XMK A;  1YW8 A;  2ZNZ A;  4RB0 A;  5DYM A;  1FT9 A;  4BNC A;  4D0P A;  2J5O A;  3G73 A;  3HSR A;  5LGU A;  1YLF A;  4CXF A;  3VFZ A;  3ELK A;  3KEQ A;  3QAH A;  3P9I A;  2QQ9 A;  1ZLJ A;  4L9V A;  4Y15 A;  3MCZ A;  1FBS A;  2VC0 A;  2PN6 A;  1ZG3 A;  1IRG A;  5LEJ A;  2VOD A;  4KDP A;  3QP5 A;  3PQK A;  5TRD A;  1HKS A;  4HYE A;  2H27 A;  1RNL A;  2CO5 A;  2M8E A;  5EEG A;  4YII A;  2L4M A;  5A2Q Z;  4Q4Z F;  3LAJ A;  4MTD A;  1PP7 U;  5ICG A;  2FXA A;  5CVV A;  3HOT A;  2ESH A;  2XAF A;  2FU4 A;  2JRT A;  4UXN A;  3JTG A;  1UST A;  2R3S A;  2QEN A;  2CQK A;  2HR3 A;  4PZJ A;  4BYY A;  2GAU A;  4HAM A;  1TQM A;  2LF7 A;  4UV9 A;  4EJV A;  1USS A;  3O2P E;  1ULY A;  3V8J A;  4WXC A;  1XGS A;  2OZ6 A;  4RB3 C;  2ZFW A;  2OD5 A;  3I64 A;  1P92 A;  1BJA A;  3RJP A;  2XAJ A;  4N0B A;  1ZYR F;  5JI6 A;  3IWZ A;  4M71 A;  3HTS B;  4U7B A;  3R4K A;  5D5V B;  1ZH5 A;  1ZGJ A;  5L3C A;  2K4B A;  3BWG A;  3RKX A;  3SXY A;  3GFL A;  3WTZ A;  5ICE A;  2FMY A;  4A5M A;  1V3F A;  3GFJ A;  3NEU A;  4EMS A;  5L3E A;  3ECH A;  3FMR A;  2UXX A;  1EH7 A;  3E5Q A;  4LMY A;  1R1V A;  3NRV A;  5E20 A;  4O6J A;  4HX7 A;  2A3S A;  2FEZ A;  1CF7 A;  4S04 A;  4ENK A;  1EH6 A;  1SFE A;  3C7J A;  1U5T A;  1LDD A;  1IRF A;  3JSO A;  5DCM A;  2MA3 A;  1S7A A;  2QQB A;  1DPU A;  2XV4 S;  3R61 A;  3W6K B;  1ZRD A;  5FFX A;  4A6E A;  4IVN A;  1W7P D;  4RGR A;  2KJC A;  4M9S A;  2V79 A;  4NQW A;  2M1B A;  1LEB A;  1D5V A;  3FMQ A;  4LJZ F;  4OMZ A;  3WU1 B;  4ENN A;  2RN7 A;  2OQR A;  2UZK A;  2HFH A;  3M8F A;  3F8N A;  5EEH A;  4KT5 C;  4YIF A;  4LB5 A;  5E1X A;  2UWM A;  2KRF A;  3IWF A;  4HDV A;  1G3Y A;  3WGI A;  1AWC A;  3G3Z A;  4AIH A;  3I53 A;  4Y13 A;  1MD0 A;  2L02 A;  4G8X A;  4UVC A;  2QUF A;  3IKV A;  5HS7 A;  1ZRF A;  1X3U A;  2ZME B;  4HF2 A;  2WC2 A;  5CVJ A;  2PLY A;  4EQQ A;  1BI3 A;  1UFM A;  2R7F A;  2OA4 A;  3E6D A;  1TLH B;  4AIK A;  4L5J A;  3WE3 A;  1U8R A;  4G7H F;  3EYY A;  3HYI A;  1ODD A;  4RGX A;  3TQN A;  1EH8 A;  3WTU C;  2K86 A;  4GO1 A;  2ZKZ A;  1E17 A;  2FSW A;  1J9I A;  3EDP A;  3VB2 A;  3K1N A;  2ZNY A;  2O61 A;  2Q8K A;  4M9Z A;  2A6H F;  2A6E F;  4Q47 A;  1U3E M;  4L18 B;  4WCG A;  2L3D A;  5JHU A;  3O6B B;  3JTH A;  4HV6 A;  4JK1 X;  5LRS A;  5FFZ A;  4IHT A;  1I27 A;  2D1V A;  1BIA A;  2P6T A;  2F5C A;  1FLI A;  1HQC A;  1D3Y A;  2H09 A;  3LST A;  3WTY C;  4CYD A;  4XRF A;  3KE2 A;  1S7O A;  2JTV A;  3I59 A;  4XSZ F;  1MKM A;  3WG9 A;  1YW7 A;  2TDX A;  5HDK A;  3WTX C;  2EFN A;  1B1B A;  2YU3 A;  4UV8 A;  2VE8 A;  3HRM A;  4R79 A;  1HST A;  2MBF A;  4KUM A;  2IJL A;  1O7F A;  2EFO A;  1G3S A;  3LA7 A;  3FXU A;  4GYI A;  4I0B A;  3IL2 A;  3C1D A;  4KA4 A;  2HQN A;  3B73 A;  5FD5 A;  4XLP F;  4KFC A;  4HF0 A;  1SFU A;  5D5W B;  4EJT A;  1T6S A;  1BI1 A;  5BS6 A;  1Z7U A;  2ZJ2 A;  3ZN0 A;  3N97 A;  1WI9 A;  5BPI A;  1J7K A;  5DD8 A;  1R36 A;  3KLN A;  3KFW X;  1SMT A;  1UHW A;  1IXS B;  1P2F A;  4JBA A;  5D6F A;  4RB2 C;  4E70 A;  2BBY A;  1XMA A;  4OIN F;  1BC7 C;  4I2O A;  4NB5 A;  1UHM A;  4IF4 A;  2GA2 A;  1YTY A;  5L3B A;  6PAX A;  1FOK A;  3I71 A;  2PEX A;  4WX9 A;  4EGY A;  1TBX A;  3MAJ A;  3TGN A;  3D5L A;  1ZAR A;  1JXS A;  4M74 A;  3CUQ C;  2ZCW A;  2HQR A;  1B6A A;  1MJA A;  4I7H A;  1IXR C;  1JHF A;  1ZHF A;  1MDM A;  2E1C A;  2WWY A;  2O8X A;  1O3R A;  1IUY A;  2OZU A;  1PP8 F;  3ABU A;  1BI2 A;  4CO8 A;  5K5O A;  2K4J A;  3ULQ B;  2RQP A;  1FWZ A;  4R1H A;  4GXO A;  1TW3 A;  5L3F A;  3PFI A;  2XUB A;  5E1Z B;  2Q0O A;  1ON1 A;  1QGP A;  3MQ0 A;  3L9F A;  2ESN A;  2FBI A;  2CSO A;  4LGW A;  3FF5 A;  1S6L A;  2O3F A;  2D45 A;  1IZ1 A;  3SZT A;  4UVA A;  3FXR A;  5DV5 A;  4LLL A;  1R1U A;  3E97 A;  1RI7 A;  2FNP A;  1F9N A;  4YFK F;  3E5U A;  3LAP A;  3ZP5 A;  4CIC A;  3WTS C;  4ESF A;  2XHK A;  2BEO A;  3RIR A;  3V7R A;  1WKM A;  4CGZ A;  1Y0U A;  2Y75 A;  5FD6 A;  4HOB A;  2VC1 A;  5JVT A;  2G7H A;  1ZGA A;  3J80 K;  4F7Z A;  4LK0 F;  1S8N A;  4O3M A;  2HEO A;  2Z9O A;  2Z3Y A;  4EM0 B;  1KQ8 A;  1ZLK A;  4OOI A;  1YFH A;  3JSP A;  4LG0 B;  2RVC A;  5K1Y A;  5ILU A;  3R6S A;  3HRU A;  2K02 A;  1OR7 A;  4AVP A;  2RV8 A;  2V9V A;  3MEX A;  3DPL C;  4M73 A;  1OMI A;  3P9K A;  4LB6 B;  2IP2 A;  1XN7 A;  2PMU A;  2HYG D;  3RKY A;  3CDH A;  2W25 A;  3KP2 A;  3BRO A;  1XGO A;  1SFX A;  3BY6 A;  1Z05 A;  3FM5 A;  2VBX A;  2RC4 A;  4A12 A;  5E17 F;  1W4M A;  2NS0 A;  5J8C A;  3L7W A;  3I54 A;  1H9T A;  1DDN A;  3BPV A;  2P5V A;  1HW1 A;  4G6D A;  3QU6 A;  3V4G A;  1TQI A;  1D8J A;  4I02 A;  1IW7 F;  5K5Q A;  1U78 A;  4P9U A;  4EGZ A;  2STT A;  1WRJ A;  1GXQ A;  3DFG A;  5H6Q A;  2XIG A;  3ISP A;  4LLN A;  3FM3 A;  4I09 A;  4PCQ A;  3WTV C;  2QZ8 A;  2PFB A;  2Y48 A;  1K7A A;  3CTA A;  3O3K A;  2LDU A;  3H3Z A;  5E18 F;  3LQQ A;  4CDG A;  1FNN A;  3V8L A;  1B9M A;  3HIF A;  2CWE A;  1LNW A;  1TQP A;  3TKY A;  3H92 A;  1W5T A;  5F6F A;  1LDK B;  3C18 A;  2LF8 A;  1H0M A;  2STW A;  3FXQ A;  1HW2 A;  2L54 A;  1FC3 A;  2IVM A;  3HTU A;  1FY7 A;  1RZ4 A;  4TV7 A;  4Y17 A;  2XGX A;  4GGG A;  3U2R A;  4ETS A;  2QYO A;  3E5X A;  1BC8 C;  3J81 Z;  4Z2Y A;  2A07 F;  2DAO A;  5L3G A;  2QBY B;  1U2W A;  4OIO F;  4B8X A;  1CF7 B;  3TO9 A;  1GXP A;  1LEA A;  1FYM A;  5TJJ A;  3B02 A;  1HKT A;  1J2X A;  4MQ9 F;  5E8G A;  3GYH X;  3DP7 A;  4IRI A;  2VOP A;  3J7A O;  2QM3 A;  3CJN A;  2VOO A;  1IXC A;  2COM A;  2YX7 A;  4KMU X;  2V1D A;  3WGG A;  1XDU A;  3GX4 X;  3HRT A;  1E2X A;  2CGP A;  2RDP A;  5AIQ A;  2DBB A;  3KP4 A;  1KQ0 A;  3IRR A;  3J80 Z;  1I1G A;  2CG4 A;  2W85 A;  4KIC A;  2EA4 A;  4BXU A;  2K7L A;  4LK1 F;  1FZP B;  3M8E A;  2HDC A;  1YS6 A;  1KA8 A;  2VXZ A;  3GVA A;  1TNT A;  1IN5 A;  3GXO A;  1Z1D A;  2ZBK A;  3DXJ F;  2EJR A;  3K9T A;  2XVC A;  3FMS A;  4MNU A;  3ERE D;  3ZPL A;  4Q48 A;  5DD4 A;  2M5W A;  2CFX A;  2DPU A;  3LQR A;  5D5U B;  4U0V A;  5LEK A;  1MJB A;  1EV7 A;  4ZYE A;  2B0L A;  3EQL F;  1H9G A;  2L01 A;  2P7V B;  1O3T A;  3GW2 A;  1OYW A;  1HKQ A;  3HUG A;  5DCM B;  4ON0 A;  1BN5 A;  2UXN A;  4ESB A;  3F72 A;  3DPT A;  2FF4 A;  2WTE A;  2HOE A;  2W24 A;  1SMY F;  4I01 A;  5IT9 K;  5K5R A;  2EFW A;  5HOO A;  4PGG A;  2MH9 A;  2YPR A;  3GF2 A;  5BOX A;  2ISY A;  2JT1 A;  2ACJ A;  1IF1 A;  1I1S A;  1TNS A;  2EFP A;  2F5D A;  3RPU A;  1KYZ A;  3LA3 A;  5D8K B;  2DLL A;  1XGN A;  2NAZ A;  2QLZ A;  2IA1 A;  2RGV A;  4YFN F;  4RS8 A;  3GLX A;  2V1U A;  2QQA A;  2HS5 A;  2ZME A;  2JZY A;  2F2E A;  1LVA A;  1XSV A;  5DCF A;  3VOE A;  4MHG A;  3M1E A;  1F1Z A;  1RUN A;  1BOA A;  2HKX A;  2KKO A;  3T8T A;  5F1R A;  3BZ6 A;  3GUD A;  4ENJ A;  4RGU A;  4CHU A;  2K27 A;  3F21 A;  1U6G A;  2EA2 A;  4A5N A;  3GZ6 A;  1FYK A;  4IHS A;  4L5I A;  3JAM K;  1KU2 A;  1QZZ A;  2D1H A;  1BIB A;  1ZG5 A;  2YSR A;  2WV0 A;  4RAZ A;  4ZZL A;  2P4W A;  4BAY A;  3R60 A;  1LDJ A;  2KIM A;  5D6E A;  1YIO A;  2EFQ A;  3QPT A;  1XDS A;  1T39 A;  2P5K A;  5FGM A;  3K2Z A;  5ILV A;  2FBH A;  1F5T A;  1O57 A;  5E1W A;  3F3X A;  5LBQ A;  1ZN2 A;  4UVB A;  2V1X A;  3I0T A;  3K1P A;  3I4P A;  4G7O F;  4ZYD A;  2JPB A;  3R0A A;  4EM2 A;  5A2Q K;  1V4R A;  3LA2 A;  2IW5 A;  3KZY A;  4AWX B;  5BPD A;  1LJ9 A;  1K78 B;  2HKO A;  5ED4 A;  2E7W A;  1J75 A;  5DEQ A;  5CVI A;  2DU9 A;  2EK5 A;  1T2K A;  3KP5 A;  2Y0M A;  3TOB A;  4KIF A;  2P7C B;  5LHI A;  1QO0 D;  1XCB A;  4FHT A;  4HX4 A;  4XBF A;  2VBZ A;  4JQF A;  3FZV A;  3WE2 A;  1B4A A;  5FLX K;  4OU0 A;  3DF8 A;  2EB7 A;  3IHU A;  1JGS A;  1P4A A;  1IAW A;  3LWF A;  5DDG A;  4HLY A;  3P9C A;  1XSX A;  2J5P A;  2BV6 A;  4HBL A;  3ZMV A;  4ZYH A;  4KMF A;  1FBU A;  3D0S A;  3RKW A;  4EM1 A;  4G7Z F;  3I59 B;  4OIQ F;  5LRR A;  2GXB A;  4KN4 X;  4IRH A;  3F8F A;  4LFU A;  3DEU A;  1L3L A;  1YG2 A;  4U7D A;  3ZMU A;  3H3U A;  2VE9 A;  3ROU A;  2EV6 A;  1W7P B;  4U88 A;  1R22 A;  4BHB A;  3R0J A;  1R7J A;  1HXD A;  5ERI A;  3SQN A;  1PUE E;  3EET A;  4ASN A;  4XLN F;  1LQ1 A;  2KIF A;  5HLI A;  4UNO A;  1ZRC A;  2XKO A;  3DQV C;  4IPA A;  2IRF G;  4OIR F;  2DW4 A;  3KP7 A;  4RAY A;  2RKH A;  1J5Y A;  4EJO A;  1FX7 A;  5AON A;  1I5Z A;  4WXH A;  2A5Y B;  3LFK A;  3GZ5 A;  1T98 A;  3E6B A;  2ZXJ A;  4EJU A;  4MEX F;  1AOY A;  4A0Y A;  3TDZ C;  5KK1 A;  1UCR A;  3ZMZ A;  3IKT A;  3VEP A;  2XAS A;  2C6Y A;  2KIU A;  3W6J B;  3NQO A;  3F8B A;  2GZW A;  2LNB A;  4ZH4 F;  2IA0 A;  2MD5 A;  3P7N A;  4QLC U;  1XB4 A;  3AAF A;  1G3W A;  1MGT A;  4L0Z B;  1FSE A;  4GCV A;  4MEY F;  3EUH A;  4KNY A;  1PDN C;  2MLG A;  5H20 A;  1FPQ A;  2H6B A;  5LHH A;  5LGN A;  2GXG A;  2IPQ X;  2JPC A;  1Z6R A;  4R8H A;  1BI0 A;  1IN7 A;  3KCC A;  3QOP A;  3F23 A;  3KLO A;  4HLX A;  2M87 A;  2PJP A;  2Z5U A;  3L00 A;  3RPQ A;  3WTW C;  1CGP A;  3GEZ A;  4BHC A;  2HTS A;  3I5U A;  4EJW A;  4DQ2 A;  4P9F A;  2NNY A;  4A0Z A;  4CZZ A;  3TDU C;  4BHP A;  2RNJ A;  2DO7 A;  1SD6 A;  2M30 A;  2FOK A;  3BPX A;  4P5O A;  2DT5 A;  1SD4 A;  2VON A;  3WU0 A;  1U5T B;  4G94 A;  1XD7 A;  2FA5 A;  1ZG1 A;  4FT8 A;  1SD7 A;  2P5L C;  3BP8 A;  3F6O A;  5JFR A;  2QBY A;  3F8C A;  3REO A;  3SFZ A;  1S3J A;  1IN4 A;  4NHJ A;  4IJA A;  1DP7 P;  1QPM A;  2FNA A;  2D2W A;  1DPR A;  3F8M A;  4DNC A;  1QBJ A;  3K69 A;  2FQ3 A;  3M7G A;  5BMZ A;  1ONV A;  1W5S A;  2PMH A;  1TTY A;  3C3W A;  3M9A A;  2G7U A;  4HF1 A;  1KU9 A;  3BJO A;  1ON2 A;  5FB2 A;  3IRQ A;  5CJ9 A;  4O5V A;  5LLQ A;  1J0R A;  3ZMD A;  3QPH A;  2ETH A;  2X4H A;  3CO7 C;  3V7S A;  3GFI A;  2QWW A;  2P8T A;  2LSO A;  5J8F A;  3HHG A;  3BOQ A;  1BBY A;  1KU3 A;  3COA C;  5CLS A;  4HX8 A;  3CUO A;  4PGH A;  2VN2 A;  3E6C C;  4RGS A;  2HZT A;  3E6M A;  4I98 B;  1G6N A;  2DTR A;  2Q2E A;  1XCV A;  4ZZD A;  3CUQ A;  3OV8 A;  5FLX Z;  1OYY A;  3V8K A;  1XGM A;  4MQV A;  5KVR A;  3F22 A;  2DK8 A;  4H0E A;  2AXL A;  1P4W A;  1ZRE A;  3CLO A;  4KN7 X;  1QNT A;  2O03 A;  1K79 A;  3RYP A;  4MTE A;  4OMY A;  4EVI A;  1R5G A;  1TW2 A;  1UB9 A;  3RDI A;  3ZN1 A;  1P6R A;  1S29 A;  3ABT A;  2XAQ A;  3KZZ A;  4A2U A;  2F5F A;  4AIJ A;  4G9Y A;  3TOA A;  3KP6 A;  3T5X A;  2DQL A;  3RYR A;  2XRN A;  2F5E A;  3J81 K;  4ESJ A;  4G6Q A;  1DUX C;  3QRF F;  2L4A A;  4A0X A;  3U1D A;  1IN8 A;  3E3V A;  3IC7 A;  1YO5 C;  3EYI A;  3T8R A;  1FP2 A;  4WWC A;  5LGT A;  4N9I A;  2HTJ A;  3L2C A;  3KET A;  2VT2 A;  5BQT A;  1C0W A;  3JAM Z;  3ECO A;  2PI0 A;  1B9N A;  1O3S A;  2VBY A;  4A6D A;  1SAX A;  5D4S A;  5FO5 A;  1HSJ A;  4N9H A;  2IT0 A;  2YX4 A;  2MH2 A;  1ZAO A;  2E7X A;  2E1N A;  4MGR A;  4LG0 A;  2EV5 A;  2BE5 F;  3K1M A;  1FSH A;  2BYV E;  4YG2 F;  4WK8 F;  3L09 A;  2GA1 A;  2ZO4 A;  4UHT A;  2XKP A;  2EV0 A;  3T0Y A;  4ENM A;  1XSD A;  4K2E A;  2GIV A;  3WTT C;  3PQJ A;  3TO6 A;  3DKW A;  4HZF A;  2IA2 A;  1F4K A;  3HSE A;  1O3Q A;  1MZB A;  5CYV A;  2DPD A;  1I6X A;  5CVU A;  3MZY A;  1KGS A;  2G9W A;  2KJB A;  1RIO H;  3N4M A;  1K6O A;  4PDK A;  3FHZ A;  2GQQ A;  4OIP F;  1JE8 A;  1R00 A;  4Q5S F;  3F6V A;  4EV0 A;  2AS5 F;  5HVQ C;  2DQR A;  4M9X A;  1REP C;  4WF2 A;  5D8L B;  2HWV A;  4M6Y A;  2ELH A;  3GFM A;  3RTR A;  5HLG A;  3RI4 A;  1GHC A;  1G4D A;  1SD5 A;  2V6C A;  4KYW A;  1MJ9 A;  1QQI A;  1WWX A;  2VT3 A;  5IT9 Z;  1R5H A;  1T0F A;  2H94 A;  1OYI A;  4BQA A;  4XSX F;  1BM9 A;  3HOS A;  1OPC A;  5D5X B;  2CW0 F;  1R58 A;  4YFX F;  2PQ8 A;  4AD9 A;  1YS7 A;  4WXD A;  4L9T A;  3ZMS A;  1FBQ A;  4FX0 A;  2DFI A;  5H6R A;  4HQM A;  3FWE A;  2NYX A;  3GWZ A;  2ISZ A;  1Z6T A;  4IRG A;  1MDM B;  3VOD A;  2M45 A;  4UUV A;  5JR3 A;  4HA8 A;  2NRA C;  3ZQ7 A;  1KYW A;  3CO6 C;  1A04 A;  3WGH A;  2X0L A;  1YQA A;  3U9G A;  3Q9V A;  1R1T A;  2GWR A;  5ICC A;  5HDG A;  3QU3 A;  1QZY A;  5IT3 A;  4FX4 A;  2FBK A;  2P6S A;  2HYF A;  2XAG A;  1D8K A;  2A69 F;  2MC3 A;  1HW5 A;  5DUI A;  2A68 F;  4HW0 A;  2EWN A;  2OBP A;  4IXA A;  5LHG A;  4KIG A;  1L0O C;  4P96 A;  3ML6 A;  5AIP A;  2R7D A;  2VBW A;  2OQG A;  1WSU A;  5HS9 A;  1IN6 A;  2Z33 A;  2CYY A;  2OU2 A;  1KQ9 A;  1T38 A;  2HGC A;  5HS8 A;  4HV5 A;  2H6C A;  1KU7 A;  3V7C A;  4RB1 A;  3DV8 A;  2Z99 A;  3FX3 A;  1HBX G;  2FML A;  3ZMT A;  1K78 A;  4L9J A;  2O6G E;  3BDD A;  4M6X A;  5HDN A;  4B09 A;  2W84 A;  4L0Y B;  4M72 A;  3BJA A;  2XRO A;  4HDU A;  4KIB A;  1STZ A;  4QWQ A;  1O7L A;  3HRS A;  1YYV A;  1FP1 D;  2A61 A;  5ICF A;  1B59 A;  1J59 A;  1LB2 A;  3MWM A;  4LLG F;  5E8I A;  5DUK A;  2JSC A;  3OOP A;  2DI3 A;  2FRH A;  3BJ6 A;  4S05 A;  3TO7 A;  5ILS A;  3Q9S A;  4P55 A;  1Q1H A;  3MZH A;  1Z91 A;  3S2W A;  2LKP A;  4LD5 A;  1P4X A;  3HSF A;  1Z9C A;  3T1B A;  3Q5F A;  2ADU A;  1VTN C;  4U0Y A;  1W7P A;  3GO5 A;  1U5T C;  3KP3 A;  2O0Y A;  1G3T A;  2PG4 A;  4HQE A;  1RUO A;  5HLH A;  3JW4 A;  2NNN A;  2QVO A;  1R23 A;  3QP6 A;  5J6X A;  5D4R A;  1NHA A;  1YW9 A;  5CVR A;  2FE3 A;  3KEO A;  3HHH A;  4L9N A;  2YR2 A;  4I0A A;  1JHH A;  1OKR A;  3SZP A;  3MFK A;  3SHF A;  1WQ2 A;  5F64 A;  3CUQ B;  2DK5 A;  4ZYG A;  4GYG A;  2BGC A;  4U0W A;  2W57 A;  3K0L A;  3WOD F;  2PBI A;  2XAH A;  3I58 A;  2OAZ A;  2MLK A;  4BH9 A;  1GVJ A;  5L3D A;  1FYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...