4L9JA

Crystal structure of s. aureus mepr in dna-binding conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 40
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9jA00
4EJOA 4HX7A 1YW9A 2Z3YA 4RB0A 5HLIA 2FSWA 2FA5A 2GXBA 2EA4A 1SMYF 3V7SA 1RI7A 4L9TA 1RIOH 3BWGA 1XDUA 2F5CA 4HZFA 2O6GE 5K5RA 1BN5A 5DCMB 2OBPA 1O57A 3MZHA 3G3ZA 5LRSA 4CXFA 1XGNA 1U5TA 4EMSA 2QENA 2Y0MA 5LGTA 2VODA 1YQAA 4LJZF 2EWNA 1OYYA 1TQPA 1ON2A 3BJOA 3DPLC 3HIFA 3M8FA 3TO9A 4LLNA 4I09A 2EV5A 1JGSA 2H6CA 1T98A 3KETA 3C3WA 4KUMA 1J59A 3OOPA 3FMSA 4Q4ZF 2QYOA 4I2OA 3J81Z 5CVVA 2IJLA 3IC7A 3Q5FA 1DP7P 2KJCA 1U8RA 2HYGD 3PQKA 3E6DA 2HFHA 5L3BA 4AIJA 3ZN1A 3RTRA 2XRNA 4ZH4F 2COMA 2DQRA 1UHMA 5H6QA 5D6FA 4BXUA 2D1HA 2FMLA 4RGXA 2STWA 1K6OA 1QPMA 2LDUA 2FBKA 2X4HA 4LG0B 2RV8A 3T0YA 3BZ6A 4BHPA 4CHUA 2A68F 2HDCA 4LK0F 1HSTA 2NNNA 2PQ8A 1IN6A 5F64A 3ABTA 3GX4X 1ZLKA 3IRQA 3P9CA 5BQTA 1R5HA 3F23A 3LA2A 3EDPA 3HOTA 4ENJA 2VXZA 2ESNA 1I6XA 5E1WA 3U1DA 1IXCA 1G4DA 4H0EA 3KLNA 3GO5A 1LEBA 1FP2A 5BS6A 2V9VA 3I71A 2OA4A 3LFKA 2VT2A 5ICEA 4HYEA 2VBXA 4KNYA 5LHHA 4PZJA 2LKPA 4I02A 2XVCA 5LRRA 3TO6A 2A69F 1HKSA 4G8XA 1K78A 2X0LA 5HVQC 1QZZA 5BPDA 3F8BA 5E1XA 4ESBA 3CDHA 2KKOA 3VOEA 2FE3A 4XLPF 4ZZLA 1BJAA 2GA2A 3O6BB 1YIOA 4G6QA 4A0ZA 2P6SA 2E1NA 1P4WA 1ZH5A 3I0TA 4P9FA 1S29A 1QNTA 3ERED 1IN4A 4L9NA 5ED4A 4BYYA 2Y48A 2QUFA 2A61A 3SFZA 1U5TB 1D5VA 3PQJA 2D1VA 3U2RA 2BEOA 4HA8A 2IA1A 3F72A 4PGHA 2HGCA 4U7DA 1F9NA 5K1YA 4KYWA 2H6BA 2L3DA 2PFBA 2G7HA 1I1GA 1KU9A 4I0BA 2EV6A 4KFCA 2EJRA 2ZJ2A 1LJ9A 5JI6A 4AD9A 3JTGA 5HLGA 3K0LA 5H20A 4FT8A 5E17F 1LDDA 4HW0A 4YIIA 3GFLA 5L3DA 4YFXF 4L0YB 3J7AO 2JZYA 2QWWA 3KP6A 4OIPF 4OMYA 1D8JA 2GIVA 5DEQA 3BY6A 5A2QK 1FWZA 3QPHA 2R3SA 1XD7A 2GA1A 2KIMA 4AIKA 2DPDA 4FX4A 3R4KA 2FF4A 3I64A 1C0WA 4GO1A 1FSHA 2YSRA 3QU6A 4EM1A 1ODDA 3C1DA 2A6EF 3L09A 4CICA 1RUOA 4HLXA 5TJJA 3OV8A 3MZYA 4R79A 2PI0A 3IL2A 4OOIA 2BBYA 3BPXA 2OU2A 1O3TA 1W5TA 3TDUC 3K1NA 2WV0A 1JE8A 2CSOA 5J8FA 2MH9A 5DUIA 1FYMA 3IRRA 2A6HF 5J6XA 3IWZA 5FD5A 4P96A 4KMFA 3I4PA 2GWRA 4M73A 1G3YA 3RYPA 1LB2A 2QQ9A 4IVNA 2XIGA 4YFKF 2EFWA 3EUHA 1USSA 4AIHA 2Z33A 4CZZA 4KIBA 3QP6A 2HS5A 4CO8A 3W6KB 3KFWX 4KIFA 4KT5C 1ZGAA 2MBFA 1WWXA 2O8XA 2VBWA 1W7PA 3GLXA 2CFXA 4NQWA 5LLQA 5AIPA 2AS5F 3Q9VA 2Q8KA 2VT3A 1G3SA 1STZA 4LB6B 1VTNC 3VODA 2VONA 3L2CA 2DPUA 2QZ8A 1GXPA 2VC1A 3JSPA 1QZYA 3DFGA 5AONA 4ZYHA 3HTSB 3CLOA 5DD8A 5BPIA 3T5XA 3QAHA 4JK1X 2VBYA 2IA0A 2GAUA 5E8IA 4EM2A 4GYIA 1O7FA 2DTRA 3V7CA 5FB2A 5L3FA 4NHJA 1YYVA 5A2QZ 1EH6A 2GQQA 3CO7C 3HRMA 4UVAA 2IVMA 5ICCA 3V8JA 2VBZA 4UVCA 5D5UB 1R22A 2F5DA 4ASNA 3ZQ7A 2DW4A 5D4SA 1O7LA 1ULYA 4LK1F 2EFOA 4O6JA 1S7AA 4ZYGA 2HKOA 3CUOA 2Y75A 1TW3A 2PBIA 1J75A 1KYWA 3KP7A 3V8KA 2ZBKA 3KP5A 2F5EA 4MGRA 2L01A 2OAZA 5JR3A 5LEJA 3SZTA 4R1HA 3R6SA 1SD7A 3C18A 2ACJA 1FOKA 5ILVA 3H3UA 4G6DA 3EYIA 1CF7A 1ZAOA 2UZKA 3H3ZA 5L3CA 1IW7F 3FMQA 1OR7A 3C7JA 3DF8A 3ZMUA 2JT1A 5F1RA 4KN7X 4U0WA 1J5YA 1K79A 1FNNA 1MJAA 2ISZA 3FMRA 2OQGA 3E6BA 3DEUA 2JSCA 2P5VA 4BH9A 4CGZA 1T2KA 1BBYA 3T8RA 4UNOA 4KA4A 3E6MA 4B8XA 4A2UA 3CO6C 1Z05A 1RUNA 1J0RA 3F8NA 1IN5A 2EFNA 3ZMTA 1MZBA 4WCGA 4HBLA 1P4XA 2XAGA 4Y13A 4KICA 5F6FA 3ZMZA 1W7PB 1ZARA 2P5KA 3KZZA 4YG2F 2J5OA 1ZG5A 3E5QA 1YLFA 1U2WA 3FXRA 2VOPA 2H27A 3NQOA 1BM9A 5D6EA 1Z1DA 4YIFA 3MQ0A 4IPAA 4A12A 1HKQA 1S6LA 4U88A 1ZHFA 5CYVA 4MHGA 4CDGA 1T39A 4LFUA 2P5LC 4LLGF 3KCCA 1MDMA 3MEXA 4N9HA 4ZYDA 1KQ8A 2HKXA 2XHKA 4IRGA 3L7WA 2O0YA 5FFXA 3F6VA 2WWYA 2XAQA 4HAMA 2QVOA 2OD5A 1ZLJA 3F3XA 5IT9K 5BOXA 2ZNZA 5H6RA 4ENKA 3NRVA 4IJAA 1D3YA 4G94A 1ZREA 1R58A 5E1ZB 4G7OF 5FLXK 2PJPA 3D5LA 4LMYA 5FFZA 1DDNA 3BOQA 1OYWA 2CYYA 3Q9SA 3WG9A 1SFEA 3QU3A 3JSOA 3SHFA 1OMIA 3EYYA 2HYFA 2CG4A 1OPCA 2HR3A 4G7ZF 2R7DA 2TDXA 1F1ZA 2UXNA 1U78A 1CGPA 3JAMK 4U7BA 2ZFWA 3TGNA 5FGMA 2HQNA 3FZVA 1FBQA 5HDNA 3IHUA 2NNYA 2M30A 3T8TA 1CF7B 1YFHA 1H9TA 1OYIA 4A0YA 1PP7U 3WU1B 3JTHA 4M6YA 2JTVA 2PEXA 3MAJA 3B02A 3E6CC 2YX4A 4HQEA 1LVAA 4O5VA 1J2XA 3RIRA 4HLYA 3ROUA 5K5OA 1XGOA 3HRUA 3V4GA 3MWMA 4GGGA 4LGWA 4HV5A 5JVTA 2Z9OA 3QOPA 3BJAA 2DK5A 5ERIA 1QBJA 1YW8A 1IN8A 4LLLA 1TW2A 3FM5A 2KIUA 4EJWA 1XMAA 2R7FA 1S8NA 2V6CA 2E7WA 2G9WA 2HTSA 2V79A 2VE9A 1U3EM 3HSFA 4L9JA 1REPC 3LQQA 5DV5A 1TNSA 4L9VA 1XCBA 2IPQX 2XAJA 4RB3C 5D5WB 2KJBA 4WX9A 3BDDA 3RI4A 2EK5A 2STTA 1U6GA 3R60A 4GCVA 2PLYA 2XKOA 1ZRFA 2D2WA 3I53A 2A07F 1WQ2A 4A5NA 1FBUA 1ONVA 2EV0A 2QQBA 3TOBA 3ELKA 5IT9Z 1FYKA 4FX0A 3BP8A 1MDMB 3WTWC 3RPQA 3GW2A 5FLXZ 4HF0A 1Z6TA 4RAYA 4Y17A 3M8EA 5CJ9A 3FX3A 2H09A 2FBHA 3GFMA 5D8KB 4I0AA 3CUQC 3W6JB 3HHGA 1KQ9A 2OZUA 1O3SA 3GF2A 4ZYEA 3WTSC 4L18B 4WXDA 5ICGA 1FP1D 2LSOA 1BI0A 3K1MA 3LWFA 1A04A 4OINF 4NB5A 1EH7A 3JW4A 1DPUA 3R0AA 2WTEA 3BPVA 2FRHA 5FD6A 3JAMZ 2YX7A 1MJ9A 1SFXA 1ZRCA 3GZ6A 1J9IA 2C6YA 4B09A 5CVRA 4M6XA 1W7PD 4XRFA 4KDPA 4JQFA 1HQCA 4IHTA 4EQQA 3E5UA 3IKTA 4K2EA 4P9UA 1F4KA 4LD5A 2BYVE 3K69A 3WE3A 5HOOA 2CGPA 3HSEA 2BGCA 4WXCA 3HYIA 3CUQA 4UV8A 1P92A 1MKMA 4MQ9F 2ZO4A 1I1SA 2V1XA 4A5MA 3VB2A 1K78B 2UWMA 3J80K 3E97A 2F2EA 3ML6A 1IZ1A 2IRFG 1IRFA 1Y0UA 3R0JA 4MQVA 3FWEA 2V1DA 3FHZA 1PDNC 3BJ6A 2L4MA 4EV0A 3WGHA 4HDVA 5DCMA 1R1VA 1AWCA 5EEHA 3HUGA 2FXAA 1BI2A 3WTVC 1W5SA 1G3TA 4M72A 2VOOA 4TV7A 4A6DA 2ETHA 1HW2A 2H94A 3REOA 3ZMDA 1FLIA 2E1CA 3GFJA 2DBBA 1LNWA 4FHTA 2XUBA 3RKXA 3PFIA 1SMTA 3L9FA 4ENNA 3I5UA 4KIGA 1TBXA 3U9GA 1BIAA 3LA3A 4JBAA 2FU4A 2ZXJA 3FM3A 5FO5A 4HDUA 5BMZA 2CWEA 2M5WA 4P5OA 1XCVA 3KP4A 4MEYF 4A6EA 5CLSA 4DQ2A 3F6OA 2MA3A 1PP8F 4WWCA 1SAXA 3WU0A 2FEZA 5JFRA 3N97A 2DQLA 1L0OC 4GXOA 1SD6A 5IT3A 4RB1A 2ZCWA 5AIQA 4UHTA 2HEOA 2B0LA 4UUVA 3S2WA 3VEPA 4HQMA 5CVUA 3GFIA 4EJUA 1IUYA 3DQVC 3HHHA 2FOKA 2QLZA 4Q5SF 1KQ0A 3ABUA 2CO5A 5LHGA 4A0XA 2XAHA 1B4AA 5ILUA 4MEXF 1KA8A 3QRFF 5ICFA 1IRGA 2YPRA 1RNLA 4EGYA 1YS7A 4PGGA 3B73A 1Q1HA 3QP5A 2PG4A 1TQMA 1WKMA 3I59A 1HKTA 4IRHA 2BE5F 1DPRA 4IF4A 2MD5A 1NHAA 1XDSA 2J5PA 3J80Z 3DPTA 4L5IA 4D0PA 1EH8A 4HF1A 2PN6A 4EJTA 3K9TA 1KGSA 3CUQB 2NYXA 1ZG1A 3O3KA 2A3SA 1YTYA 3FXQA 3G73A 1BI1A 1JHFA 2HZTA 3SQNA 2HTJA 2JPCA 1FPQA 1B59A 3VFZA 5KK1A 4G7HF 3LA7A 3WTTC 4KN4X 1F5TA 1H0MA 2DLLA 1IN7A 5LBQA 1IXSB 1L3LA 1H9GA 5CVJA 3IWFA 2Z99A 4WK8F 3M7GA 1BC7C 2FNPA 1G3WA 4S05A 3D0SA 1S7OA 2OZ6A 4RGUA 2JPBA 2FQ3A 2M87A 1T6SA 3DKWA 1FX7A 5D8LB 2A5YB 3P7NA 2W25A 3LAPA 3T1BA 1FY7A 2HOEA 4BQAA 2RKHA 2DI3A 3WODF 3NEUA 1B9NA 1RZ4A 1W4MA 2LF7A 3GVAA 5LGUA 2XKPA 4MTEA 2GZWA 1JXSA 4BHCA 3R61A 4RGSA 2QM3A 2ADUA 2LF8A 5J8CA 5TRDA 2IP2A 2FNAA 4AWXB 2P7CB 1SFUA 5HS8A 3E3VA 3MFKA 2DO7A 3KP2A 2AXLA 4OMZA 2NRAC 3F8FA 4I7HA 3GZ5A 4OIOF 2HQRA 2K4BA 2RGVA 4XLNF 2K86A 3KEOA 4ESFA 4N0BA 1EV7A 1HBXG 1I27A 1SD4A 3IKVA 3ZPLA 1P2FA 1KU7A 3ZMSA 5D4RA 5DYMA 4PDKA 4UV9A 1PUEE 2YU3A 3BROA 2UXXA 1K7AA 2P8TA 2QBYA 2RQPA 4M71A 1FT9A 2ZMEA 2OQRA 4QWQA 2K7LA 2K4JA 1XN7A 1O3QA 4U0YA 4N9IA 4EGZA 3HSRA 1XMKA 2W57A 3F21A 1R5GA 2IA2A 1XSXA 3M1EA 2RN7A 2CW0F 2FMYA 3I58A 3WGIA 4ENMA 2VN2A 1KYZA 4HF2A 2Q2EA 1UB9A 2O03A 4UXNA 3RJPA 2V1UA 3QPTA 2XAFA 5DD4A 1USTA 3GEZA 3CJNA 1BI3A 4OU0A 2XV4S 3V8LA 3DP7A 4BAYA 1TNTA 2IW5A 1R7JA 1ZYRF 3V7RA 3I59B 1GXQA 3ZN0A 4OIRF 3TDZC 4WF2A 1GVJA 1QO0D 3RKWA 1XSVA 2O3FA 2VE8A 4PCQA 4Q47A 4ON0A 4M9SA 3RDIA 1TQIA 3GXOA 1T0FA 1YS6A 4L0ZB 4F7ZA 1OKRA 3DV8A 5DDGA 2NAZA 1B6AA 4BNCA 4E70A 2HWVA 3KEQA 2DAOA 4I01A 3HTUA 1ZG3A 5D5VB 3F8CA 3HRSA 1HXDA 4BHBA 1MJBA 2QQAA 2MLGA 2EA2A 2P7VB 3TQNA 4IHSA 1R00A 3K1PA 2XGXA 2EFPA 1T38A 3CTAA 1QGPA 4WXHA 1ZRDA 5DCFA 3P9IA 4S04A 3GUDA 3O2PE 4IXAA 4IRIA 3DXJF 1TLHB 2GXGA 1D8KA 5ILSA 1Z6RA 4M74A 3TKYA 4RAZA 3ZP5A 3TO7A 1FSEA 4EM0B 1IXRC 4HV6A 2IT0A 2W84A 3KP3A 4CYDA 5HS7A 2F5FA 1HSJA 2BV6A 3SZPA 1V4RA 5E8GA 1YO5C 2G7UA 1JHHA 2PMUA 1XGSA 2KRFA 4XSXF 2Z5UA 1BOAA 2DK8A 4HX8A 2RNJA 1DUXC 1YW7A 4QLCU 2DFIA 4RGRA 1P6RA 1QQIA 3N4MA 2ESHA 3HOSA 4EJVA 3WTZA 1J7KA 1FC3A 4GYGA 1S3JA 2P4WA 4DNCA 2RDPA 1Z7UA 3WTYC 5CVIA 5K5QA 1WSUA 1V3FA 5HLHA 1XB4A 5HDGA 2QBYB 1LEAA 2P6TA 2D45A 5HS9A 2ZMEB 2L54A 1MGTA 2CQKA 3ECHA 3ZMVA 1MD0A 4UVBA 3P9KA 2ISYA 2M1BA 2JRTA 1ON1A 3KZYA 1KU2A 4Z2YA 5LHIA 1O3RA 3COAC 4HX4A 2W24A 4I98B 1R23A 3ECOA 2K02A 4R8HA 2DT5A 1UCRA 2Q0OA 3LSTA 1XGMA 1ZN2A 3TOAA 5E18F 2MLKA 1XSDA 1E2XA 2E7XA 2PMHA 3K2ZA 3SXYA 3LQRA 4YFNF 1BC8C 1Z9CA 2O61A 4ESJA 4HOBA 3F22A 2MC3A 2K27A 3M9AA 2WC2A 3ISPA 3FXUA 3KLOA 1BIBA 4G9YA 4MTDA 4MNUA 3F8MA 1R36A 5D5XB 5HDKA 1TTYA 1UHWA 2YR2A 3MCZA 4Q48A 2XASA 2M8EA 1X3UA 2RC4A 3H92A 2ZKZA 2VC0A 4O3MA 5JHUA 2KIFA 4P55A 4KMUX 4L5JA 1R1UA 3RYRA 1KU3A 4LB5A 1LDKB 4XBFA 1I5ZA 5KVRA 1R1TA 3KE2A 1B1BA 3RPUA 4Y15A 5LEKA 1UFMA 2LNBA 2NS0A 4M9XA 2XROA 2EFQA 4AVPA 4EVIA 2FBIA 4OIQF 3J81K 1AOYA 3HRTA 2W85A 3WTUC 1ZGJA 1WRJA 1Z91A 2EB7A 4M9ZA 5L3EA 3WE2A 1IF1A 4XSZF 2M45A 4LG0A 1FZPB 2L02A 1GHCA 3ULQB 1FBSA 3GYHX 1G6NA 4RS8A 2L4AA 5EEGA 3L00A 1IAWA 3WTXC 1SD5A 3EQLF 3GWZA 1HW5A 3E5XA 2ZNYA 1E17A 3I54A 2MH2A 1U5TC 3AAFA 3EETA 2ELHA 5LGNA 2DU9A 1FYLA 1LQ1A 1B9MA 3FF5A 5DUKA 1LDJA 1YG2A 5E20A 1WI9A 4U0VA 3RKYA 6PAXA 4ETSA 5L3GA 4ZZDA 2RVCA 4RB2C 1HW1A 1P4AA 3WGGA 3LAJA
chains in the Genus database with same CATH superfamily
3ZQCA 4EJOA 2Z2SB 4HX7A 2Y0SA 1YW9A 2VJJA 2Z3YA 4RB0A 5HLIA 2FSWA 1QHHD 5FJ8J 4JOMA 2FA5A 2GXBA 2EA4A 1SMYF 3V7SA 1RI7A 4L9TA 1RIOH 3BWGA 1P9QC 1XDUA 3OYBA 2F5CA 4HZFA 2O6GE 2R7VA 5K5RA 4A3IJ 1BN5A 1F36A 4F91B 3OSFA 2L0KA 1J09A 5DCMB 3F9KA 2OBPA 1O57A 3MZHA 2GIZA 3BTJA 4HG2A 2KDOA 2DCEA 4IHWA 3G3ZA 5LRSA 4CXFA 1XGNA 3MKLA 1U5TA 4EMSA 3K70C 1NG6A 2QENA 4CCNA 2Y0MA 3A1YA 5LGTA 2O5RA 1D5YA 2VODA 2DA5A 4RBOA 3LSMA 3ZCOA 1YQAA 4LJZF 2EWNA 2CUJA 1OYYA 1TQPA 4W1UA 1ON2A 2LOOA 3BJOA 3DPLC 3HIFA 3M8FA 3LSRA 3QWLA 4CYCB 1ZR4A 3A0HC 3TO9A 4LLNA 4I09A 1Z77A 5E3LA 2EV5A 1JGSA 2H6CA 3MMYB 2KQRA 2R7WA 1T98A 1S9HA 5GPAA 3KETA 3C3WA 3SDBA 4IOAF 1W0TA 1LE8A 4KUMA 2OC6A 1J59A 2ZXIA 4NC6A 3OOPA 3FMSA 4Q4ZF 2KFDA 2DOFA 2LLKA 2AQFA 2EIJH 2QYOA 2VKHA 4I2OA 3J81Z 2R7UA 5CVVA 2IJLA 4ZDLA 3IC7A 5F04A 2UUZA 3Q5FA 4YELA 1DP7P 1BW6A 2KJCA 3S1MJ 2JUGA 1U8RA 5JHFA 2BXZA 1BW5A 2HYGD 3LSIA 2IGNA 3PQKA 2W7NA 3E6DA 2HFHA 2LH9A 5L3BA 4AIJA 3ZN1A 5FKMA 2HYJA 3RTRA 2XRNA 3GCMA 1D0YA 3BG6A 3S8PA 4ZH4F 2COMA 2DQRA 1UHMA 1N75A 2V7FA 5H6QA 3H35A 5D6FA 3S14J 4BXUA 3CCJI 3DKYA 2D1HA 2FMLA 3ZQQA 3LOCA 4RGXA 3G4SI 2OTLI 2PX9A 2STWA 3C2HA 1TT0A 1K6OA 4Y52J 1QPMA 2LDUA 2FBKA 2X4HA 1Y0NA 5KAIC 1X1CA 2K9MA 4LG0B 3TMOA 2RV8A 3T0YA 3BZ6A 4BHPA 2NOJB 3L2QA 1G59A 4CHUA 2A68F 2HDCA 4LK0F 1JUMA 1HSTA 2E34A 2NNNA 1ETOA 3D1NI 2PQ8A 1IN6A 5F64A 1FIPA 3FKIJ 3VYUB 2FX0A 3ABTA 1VQ4I 3DLLF 3GX4X 1ZLKA 3IRQA 1OQYA 1GUUA 3P9CA 5BQTA 4NNJA 3DTIA 1R5HA 3F23A 2OJED 1FMVA 2CUZA 1AHDP 3LA2A 3EDPA 2I5UA 3HOTA 1XTAA 2LBFA 3OYIA 4ENJA 2VXZA 2ESNA 3OS0A 1I6XA 5E1WA 2K40A 3U1DA 3ZQFA 1IXCA 1G4DA 4H0EA 1T33A 3KLNA 3I56I 3GO5A 1LEBA 1FP2A 5BS6A 2IGOA 2V9VA 3I71A 4CCOA 3CF5F 3AG2H 2OA4A 3LFKA 3OYNA 1YHQI 2DFEA 2D5VA 2VT2A 5ICEA 4HYEA 3E7LA 1MBEA 2VBXA 4KNYA 1TWGJ 5LHHA 4PZJA 3JCUC 2LKPA 2H8WA 3GTOJ 3A2KA 3NAUA 4I02A 3TP0A 2XVCA 5LRRA 4L5EA 1BR1A 3TO6A 2Z16A 2A69F 5F0CA 2KISA 4X0GA 1TWCJ 2YS9A 1HKSA 4G8XA 1K78A 3FBNB 2MW8A 2X0LA 5HVQC 1QZZA 5BPDA 3F8BA 5E1XA 4ESBA 2GXAA 2XSDC 3CDHA 2KKOA 3VOEA 1ETXA 1JJ8C 2K9LA 2FE3A 2DA4A 2K5CA 4XLPF 2K3FA 4D7NA 4GFBA 3FXLA 3HBLA 4ZZLA 1BJAA 2BXYA 3CC4I 1I50J 2GA2A 5B5EC 3O6BB 1MW7A 1V54H 2NOGA 2LKXA 4BE1A 4G6QA 4A0ZA 2P6SA 3HDDA 2E1NA 1P4WA 3JREA 1ZH5A 2LY1A 3I0TA 1IUFA 4P9FA 1S29A 1QNTA 1GLNA 2E2JJ 3CMMA 1MBGA 3ERED 1IN4A 1U9NA 3K4MA 4L9NA 5ED4A 4Y33A 4XN3A 4XLHA 4BYYA 2Y48A 3QOEA 2QUFA 2A61A 3SFZA 5K7ZA 2A5WA 2NVXJ 1U5TB 1D5VA 3S3OA 3PQJA 2D1VA 3G1OA 3U2RA 2BEOA 4BU2A 4HA8A 2IA1A 3F72A 3JRGA 4E6KG 2L5QA 4PGHA 2HGCA 4U7DA 1F9NA 3I9V2 5K1YA 2IS6A 3K4JA 1EKEA 1K4SA 4KYWA 2H6BA 4UY8I 2L3DA 2LVSA 2PFBA 4BY1J 2G7HA 4HNUA 5IP7J 1Y6IA 1I1GA 2B9SA 1KU9A 1TL8A 4IKFA 4I0BA 4N4NB 3K4NA 2EV6A 5J1YA 4MFDA 3BTCA 3OS1A 4KFCA 2LG4A 3DBRB 3LSJA 2EJRA 1MNMC 2ZJ2A 1LJ9A 3RSNA 3VSLA 5JI6A 3A03A 3K7AJ 4AD9A 3JTGA 5HLGA 3K0LA 2F48A 4FT8A 5H20A 3HXLA 5E17F 1LDDA 4HW0A 4XRMA 4YIIA 1N25A 2HZDA 2L9NA 4KITB 3GFLA 2EZHA 5L3DA 5GADJ 3ZOBA 2DMPA 3FISA 4XONA 4YFXF 4L0YB 3J7AO 2JMWA 3CCRI 2JZYA 3HKZN 2QWWA 3CLQA 3KP6A 1ACIA 4OIPF 4OMYA 2VQHA 3FXKA 1D8JA 2GIVA 5DEQA 1HOMA 3HG9A 3BY6A 1WJFA 5A2QK 3H5NA 3W6VA 1FWZA 1KONA 3QPHA 2R3SA 4PFPA 4U87A 1VQ9I 1XD7A 2JA6J 2GA1A 1QRYA 2AO9A 4A3GJ 2HVRA 2KIMA 3DEWA 4AIKA 2DPDA 2XPVA 4FX4A 3R4KA 2FF4A 2ZFUA 3I64A 1C0WA 4JYKA 2JA2A 4GO1A 2GLOA 2QA4I 1FSHA 2YSRA 3QU6A 4EM1A 1OISA 2JRMA 4FE4A 3RQ4A 3P5JA 1ODDA 3C1DA 2A6EF 2DDAA 3L09A 4CICA 1RUOA 3EUAA 1R9TJ 4HLXA 3TW7A 5TJJA 3OV8A 3ZRGA 2BHZA 3MZYA 2QKMB 3SZGA 1QVUA 3H0GJ 4R79A 2PI0A 3D5RC 3NWTA 3BQYA 4IL6C 3IL2A 4XRSA 2W48A 2NXNB 4OOIA 2M34A 2Q2EB 1AU7A 3HKZA 3OYHA 2BBYA 3BPXA 1Y39A 3G71I 2OU2A 2LBFB 4NC7A 1O3TA 1W5TA 3BZKA 3TDUC 3K1NA 2WV0A 5C4JJ 1HA8A 1JE8A 2CSOA 5J8FA 3LSKA 2MH9A 5DUIA 1FYMA 3IRRA 3CC2I 2IGKA 2JN6A 4AVZA 2A6HF 2B63J 3OL3A 5J6XA 4E7JA 3PFYA 3IWZA 5FD5A 3BR2A 4BDZA 1V5GA 4P96A 1FOXA 3OMYA 5J47A 4KMFA 2CMPA 3I4PA 2GWRA 3H1CA 1UAAA 2CU7A 4M73A 3LAJA 1G3YA 5GAHJ 3PIOF 3RYPA 1LB2A 2QQ9A 3BR3A 3LL7A 4IVNA 1UZCA 4PJMA 1Y8QB 2XIGA 4YFKF 2EFWA 3EUHA 1USSA 3CZ6A 4X1EA 2WAFA 4AIHA 3QODA 2Z33A 4CZZA 4B47A 4CCJA 4KIBA 1Z67A 3QP6A 3RPUD 2HS5A 3OYCA 3LSHA 2KRHA 4CO8A 3W6KB 3KFWX 3S93A 1TWFJ 4KIFA 2R7TA 4KT5C 5J1UA 1ZGAA 2MBFA 1WWXA 2O8XA 2VBWA 1W7PA 3GLXA 2CFXA 4NQWA 1VQPI 4C3HJ 1FMWA 2ZXHA 5FKLA 5LLQA 1S5LC 1Z3XA 1RRJA 5AIPA 2XGEA 1A35A 2AS5F 3Q9VA 2Q8KA 2VT3A 1G3SA 5E3NA 1STZA 4LB6B 1VTNC 3Q3SA 2O9LA 1X2MA 3VODA 2E1MC 4JX4A 3VYRB 1MBFA 3CCLI 2LYCA 1ETVA 2M4GA 2AXTC 2XF7A 2VONA 5KAFC 3L2CA 2DPUA 2QZ8A 1GXPA 4XK4A 1GV2A 2HOAA 2VC1A 3U1KA 3JSPA 4HNVA 1QZYA 3DFGA 5AONA 3ZR8X 4ZYHA 2V26A 3HTSB 2DODA 3CLOA 5DD8A 5BPIA 3T5XA 5TGTA 2DOEA 5C44J 1BL0A 3QAHA 2ICWG 3OR1C 5B1BH 4V19K 3CESA 1VQ7I 1YX5A 4JK1X 5F08A 2VBYA 1TZLA 5M3MJ 2IA0A 2JA5J 3M8JA 1OR7C 2GAUA 4UB8C 5E8IA 4EM2A 4GYIA 3ASOH 2MFZA 4FETA 4NUBA 1O7FA 2DTRA 2DMTA 3V7CA 5FB2A 5L3FA 4NHJA 3JRAA 3RZDJ 1YYVA 2LFBA 3JRIA 5A2QZ 3I3LA 3G1LA 2KL4A 2XAUA 5B3SH 1EH6A 3UKGA 2CQNA 2GQQA 3FBIB 4H4KC 4M3GA 1X58A 3CO7C 2HXIA 4V2FA 3HRMA 4DIQA 4UVAA 4CH7A 1KZHA 2IVMA 5ICCA 3BR0A 3V8JA 3PO2J 2VBZA 2M2EA 2OV7A 4UVCA 2CUFA 5D5UB 3JRCA 3GTMJ 3S2HJ 1R22A 2F5DA 4ASNA 3ZQ7A 2DW4A 3OYKA 4PK4A 5D4SA 1O7LA 2XSJC 1WJ5A 1ULYA 2V9KA 3BG5A 4LK1F 2EFOA 4O6JA 4E7HA 5LFAA 1S7AA 4ZYGA 2HKOA 1YJWI 2HVSA 3CUOA 1FOWA 2Y75A 3CMYA 4UUSA 1MBHA 1TW3A 1RETA 1FOYA 1OCRH 3PL8A 2W1OA 2PBIA 1J75A 1KYWA 2LREA 3KP7A 3V8KA 2ZBKA 2KPMA 3ABKH 3KP5A 2F5EA 3J7YJ 4XL9A 2BY1A 4MGRA 2ZJPF 5IOZA 2HXOA 2L01A 4RMNA 2OAZA 5JR3A 5LEJA 3SZTA 1DP3A 4R1HA 4JX5A 3R6SA 1JKOC 1XG1A 1SD7A 3C18A 5EEAA 2ACJA 2NS7A 2Y2ZA 1FOKA 3S2DJ 4XQFA 5ILVA 3H3UA 4G6DA 3EYIA 1CF7A 1ZAOA 5HNHA 2UZKA 1VQOI 3H3ZA 5L3CA 2OF7A 1IW7F 3FMQA 1OR7A 4F3QA 3OOUA 2R5YA 3C7JA 1IDZA 3DF8A 3ZMUA 3PSIA 4EEFG 1X3ZB 3OYMA 4XKWA 4S0HB 2X9DA 2F4MB 2JT1A 4BJ6C 4Z6YA 5F1RA 4KN7X 3K10A 3OYAA 3WHCA 5TISC 4ITVA 1J5YA 4U0WA 1LPQA 1K79A 1FNNA 3K4CA 1MJAA 4RLQA 1JKQC 2ISZA 3FMRA 2OTJI 2OQGA 2Y69H 1WJCA 1IO2A 4FQGA 1X3WB 2AHQA 2MD0A 3CJQB 3E6BA 5FLVA 3B6CA 4DYRA 3DEUA 2JSCA 2P5VA 4BH9A 4CGZA 1IC8A 4BL0B 4D1QA 2M8GX 1Y1VJ 2VKEA 1T2KA 1BBYA 3T8RA 4UNOA 2VPLA 4BDYA 5GTHC 4HSRA 4KA4A 3E6MA 5CPRB 3A01A 4B8XA 4A2UA 5IP6A 3CO6C 1Z05A 1RUNA 1J0RA 3F8NA 1APLC 2BY2A 4B44A 1IN5A 2EFNA 3ZMTA 1MZBA 4WCGA 1YIJI 4HBLA 1P4XA 1S7EA 2XAGA 3SYTA 4Y13A 3ABLH 1H88C 4C9YA 4KICA 2OCCH 1V5FA 5F6FA 3RKQA 3L2WA 1R4NB 2X1DA 3ZMZA 3HM5A 2A05A 2H8RA 1W7PB 2VB6A 4NQWB 1ZARA 1HLVA 3HJEA 2P5KA 1X2NA 3FK6A 3KZZA 4YG2F 2J5OA 3MZ8A 1ZG5A 3E5QA 3ZQLA 1YLFA 4BS9A 1T56A 2QSHX 1U2WA 3FXRA 3K70D 4LG3A 5J1RA 5M5WJ 1SFOJ 3NQOA 2H27A 3S17J 2VOPA 2W82A 1BM9A 5D6EA 2V4JC 1S72I 3LSPA 2QSFX 4QTRA 1VFCA 3K4BA 1Z1DA 3KYCB 4YIFA 1VZ0A 3AKZA 3VPRA 5IYBJ 3AG4H 3MQ0A 3ZGKA 2WADA 2EBIA 4IPAA 4A12A 1HKQA 3V42A 1OCZH 2COBA 2DDBA 5M5XJ 4QIWN 3UNGC 2IS1A 1S6LA 4U88A 1ZHFA 5CYVA 1WCMJ 4MHGA 4CDGA 1ZGWA 3JRDA 4LFUA 1T39A 2P5LC 4LLGF 3KCCA 1MDMA 3M1CA 2ZSIB 2DMNA 3DPUA 3MEXA 5E3OA 4N9HA 4ZYDA 3W3CA 1KQ8A 5IYCJ 2HKXA 2XHKA 4IRGA 3L7WA 2O0YA 5FFXA 2L7KA 3F6VA 2WWYA 2XAQA 2H1KA 2KZVA 3TW6A 4HAMA 4D7MA 3A4CA 1QZEA 2QVOA 2ME6A 2OD5A 1ZR2A 2ZC2A 2Q1ZB 5FKKA 1ZLJA 2KZGA 3F3XA 5IT9K 5BOXA 2ZNZA 5H6RA 4ENKA 2L9VA 2M0CA 3NRVA 4IJAA 1D3YA 4G94A 3KYLA 2ZJQF 2NS8A 3KIOA 1ZREA 1R58A 4RAFA 1ORKA 5E1ZB 4G7OF 3S15J 5FLXK 2WB1N 1YX3A 2PJPA 3D5LA 4XLCA 2V6EA 2L9SA 4LMYA 5FFZA 3ZQGA 3LSGA 1DDNA 3BOQA 1OYWA 4YRVA 2CYYA 4IQJA 3Q9SA 4MIMA 2E1OA 3WG9A 4BUPA 4ZJZA 1SFEA 4AIDA 3QU3A 1YITI 3JSOA 3SHFA 2E1MB 1OMIA 3EYYA 1RR8C 2HYFA 4J01A 1K4TA 1MMDA 4BEHA 4HRIA 3JR9A 4IHVA 2CG4A 1OPCA 4UUSB 1BA5A 1ETYA 2HR3A 4G7ZF 2R7DA 4HPQA 2TDXA 4EATA 1F1ZA 3PJRA 5EZHA 2UXNA 4LIVA 4W97A 1U78A 3AFHA 1CGPA 1A5JA 3BR5A 3JAMK 4U7BA 3S3NA 2ZFWA 1ZKGA 3TGNA 1MH4A 5FGMA 2HQNA 3FZVA 1Y1WJ 1FBQA 4XORA 3IHUA 5HDNA 2QF7A 2NNYA 2M30A 3KZIC 3SDGA 3T8TA 2DXIA 2WAQN 1CF7B 1YFHA 1H9TA 1OYIA 4A0YA 1PP7U 2M9HA 2EIKH 2WB1A 3WU1B 2R5YB 3JTHA 4M6YA 2EINH 4AC0A 1IGNA 2FOWA 3NARA 2JTVA 3PO3J 2ID3A 2WAEA 2NVUB 1MH3A 2X6YA 2NVQJ 3A0BC 5FRMA 2PEXA 2L7FP 4FE7A 2K9SA 3MAJA 2DTZA 3B02A 3ERMA 2DMQA 1CQTA 3E6CC 3PSFA 1JT0A 3MKYB 1PUFA 2YX4A 4HQEA 1LVAA 4O5VA 1J2XA 4D5FA 3RIRA 4PJ0C 2VL8A 5IY5H 4HLYA 3ROUA 1HDPA 3G2BA 1POGA 2M0MA 2I10A 5K5OA 1XGOA 2DJNA 2PMZN 3HRUA 2R7ZJ 3V4GA 3MWMA 4GGGA 2BY3A 4MFEA 4LGWA 4BE0A 4HV5A 5JVTA 2Z9OA 3QOPA 3BJAA 4RLFA 1H89C 2QSGX 2DK5A 5ERIA 1QBJA 2BVMA 1YW8A 1MNEA 1IN8A 4LLLA 1TW2A 1F43A 4ZC3A 3FM5A 3A01B 3L1PA 2KIUA 4EJWA 2H1LA 1XMAA 3CP2A 2R7FA 1X1BA 2CV1A 1S8NA 3CJRB 1H8AC 2V6CA 2V1NA 2E7WA 2G9WA 2HTSA 2WAQA 2V79A 4JP0A 1X4PA 4ZDPA 4A3FJ 2VE9A 1U3EM 2BVLA 1E3HA 1MSEC 4Y3OA 2CW7A 3PNYA 2L9RA 3HSFA 4L9JA 1REPC 3LQQA 3W2WA 2Y31A 1DQUA 1GVDA 5DV5A 1TNSA 5HLTA 4L9VA 1XCBA 1LKXA 5J3LA 4CCMA 5EG0A 2VKDA 3H3VK 2IPQX 2XAJA 3G1MA 1DGWY 3GTGJ 4RB3C 5D5WB 2KJBA 1IG7A 4WX9A 3BDDA 5K7HA 4B3XA 5GAGJ 3RI4A 2EK5A 2STTA 4HNTA 1U6GA 3R60A 3RCOA 2O8KA 4GCVA 2PLYA 4PSXA 2FQ4A 2BOLA 3FIWA 2XKOA 2P81A 1ZRFA 2PMZA 1LE8B 2HOTA 2JQ7A 2D2WA 4G12A 2OPTA 3I53A 2GOXB 2A07F 1WQ2A 4AUXA 4A5NA 4CZCA 1FBUA 1ONVA 2EV0A 2QQBA 3TOBA 3ELKA 3LNQA 5IT9Z 3BTLA 3BG9A 9ANTA 4IO9F 2IS2A 3C2BA 1FYKA 2PJRA 4FX0A 4A3BJ 3BP8A 3AG3H 4B4CA 1MDMB 3WTWC 4OAZA 3RPQA 3GW2A 1IRXA 2XF5A 4BQNA 5FLXZ 4J00A 1LFUP 4HF0A 5CQGA 1Z6TA 4RAYA 4Y17A 2JA8J 3M8EA 2ECBA 2NVTJ 2DT7B 4F92B 5CJ9A 4C2UA 1SAUA 3DBHB 3FX3A 1EJ9A 5GAEJ 4LITA 2H09A 3N05A 2FBHA 3GFMA 2JUCA 5D8KB 4I0AA 3CUQC 3W6JB 5E79C 3CP8A 3EUHC 3HHGA 1IDYA 1MMAA 3CMEI 1KQ9A 2VQGA 2OZUA 3L2UA 1O3SA 3GF2A 2CS3A 4ZYEA 3WTSC 4L18B 4WXDA 5ICGA 1FP1D 2LSOA 1BI0A 5EF6A 3K1MA 4BKXA 3LWFA 1A04A 4OINF 4NB5A 1EH7A 3JW4A 4GRIA 1DPUA 3R0AA 2WTEA 3BPVA 1ETWA 2FRHA 5FD6A 3JAMZ 2YX7A 3J7ZI 1MJ9A 1SFXA 2CV2A 1ZRCA 2GBYA 2M3AA 3GZ6A 1T8IA 1YJNI 1J9IA 1X1DA 2BW3A 2C6YA 2XB5A 5HNFA 2QEXI 4B09A 5CVRA 1K83J 3F0CA 5GP9A 5JVGF 2VIXA 4BEHB 4M6XA 1W7PD 2O7OA 4XRFA 2XB0X 5FLMJ 2JK3A 2DFFA 4DBRA 3OY9A 1BR4A 1X1PA 2N8GA 1TC3C 3MVPA 1W1WE 4KDPA 4BGDA 4JQFA 4M6VA 2HI3A 1HQCA 4IHTA 4EQQA 2WV1A 3E5UA 1LVKA 1WH5A 1T95A 3IKTA 3AG1H 4K2EA 4P9UA 3K4KA 3IH3A 4DYQA 3GTJJ 2KRCA 1F4KA 4LD5A 1VQKI 1B8IA 2BYVE 3FXMA 2E71A 3K69A 5KNLA 2MABA 3WE3A 1I3AA 5HOOA 2CGPA 1UG2A 3HSEA 3IH4A 3OYEA 2XPUA 3OIPA 2BGCA 1JJ6C 4WXCA 1Q1VA 1YE9A 3HYIA 1K6YA 1LFPA 3CQZJ 3CUQA 3O8HA 4X6AJ 4UV8A 3CDLA 1M1EB 1P92A 1MKMA 1WFXA 1R6RA 4MQ9F 5F0FA 2ZO4A 2RQQA 1BOBA 1I1SA 2V1XA 1PUFB 2FUG2 3VB2A 4A5MA 1K78B 2RAEA 1JUPA 2E2HJ 2UWMA 1I6HJ 2CW8A 3J80K 3E97A 2F2EA 1UHSA 3ML6A 4BBSJ 2LK2A 1TP4A 1IZ1A 3HGGA 3HZJA 2IRFG 3E1SA 2X51A 4B3AA 1IRFA 1E3OC 1Y0UA 3R0JA 3OYGA 4MQVA 4A3EJ 3FWEA 2MGQA 3OS2A 2V1DA 3FHZA 1PDNC 5C3EJ 4CCKA 3BJ6A 3PUFA 3CCMI 2L4MA 4UB6C 1OCPA 3WGHA 4EV0A 1IRZA 4M3FA 5DCMA 4HDVA 1R1VA 1R4MB 1AWCA 2E19A 5EEHA 3H36A 3HUGA 2FXAA 1AKHA 1BI2A 4A3MJ 1HF0A 3WTVC 5FRNA 2XGCA 4IOCF 1W5SA 1G3TA 4M72A 2VOOA 1SVMA 4TV7A 1WJDA 4A6DA 1R71A 1B72A 3ASNH 2ETHA 3H5AA 3OYJA 1YRNA 1HW2A 1FIAA 2G0EA 4OAYA 2H94A 2WY7Q 3FK7A 3REOA 3ZMDA 4FCYA 1FLIA 1N77A 2E1CA 4UUTA 3GFJA 3S1QJ 2DBBA 2R7XA 2LP0A 1PYVA 5EG0B 3A02A 1R5ID 1LNWA 4FHTA 2XUBA 3RKXA 4E7LA 3PFIA 2A6TA 1SMTA 3L9FA 5C4XJ 4ENNA 4C2TA 3I4MJ 2F5VA 1X1AA 3DEEA 3I5UA 4KIGA 1TBXA 3U9GA 1BIAA 3LA3A 4JBAA 4C3JJ 2E60A 1ZQ3P 2ID6A 2FU4A 2ZXJA 1A31A 3FM3A 5FO5A 4HDUA 5BMZA 2CWEA 2CQ7A 2M5WA 3PIPF 4P5OA 2AQEA 4IX7A 1XCVA 1NH3A 5IP9J 3KP4A 4JX6A 4MEYF 1VF9A 1QHGA 4A6EA 2CJJA 5CLSA 4DQ2A 3F6OA 2MA3A 1PP8F 1VQNI 4WWCA 1SAXA 3WU0A 2PJRB 2FEZA 4QPOA 3MKZA 4FISA 5JFRA 2DYRH 1P7IA 2DQLA 1L0OC 3D5SC 3N97A 4IHYA 4GXOA 3WU2C 1SD6A 5IT3A 1JKPC 4RB1A 2ZCWA 5AIQA 3FXOA 3J7AY 4UHTA 2HEOA 2B0LA 5GTIC 4UUVA 3S2WA 3VEPA 2E35A 4XICA 4HQMA 2WBMA 3E0JB 1JTYA 2CUEA 2CRGA 2IXSA 2OCEA 2EZLA 5CVUA 3GFIA 4EJUA 3ONQA 3WHBA 1IUYA 5KHDA 2LD5A 3DQVC 3HHHA 2FOKA 4ZYAA 2QLZA 2F6CA 4Q5SF 1KQ0A 3HPGA 2F4OB 1FTTA 1WGXA 3ABUA 4C3IJ 2CO5A 4E7SA 5LHGA 4A0XA 2XAHA 4AYBN 1B4AA 5HODA 4A3JJ 3OIOA 5ILUA 1VQMI 4OWRB 2BW3B 4MEXF 2K9QA 4FASD 1KA8A 4J19A 1U0JA 3QRFF 3H9JA 5ICFA 2K85A 2YPRA 1VQ8I 1IRGA 1RNLA 4EGYA 1YS7A 1DGRM 4FTHA 1JT6A 4PGGA 1N78A 1HDDC 3B73A 3GTKJ 1Q1HA 3QP5A 1NK3P 1JUSA 2PG4A 4KJZA 5K7FA 1TT5B 3JRHA 3EPZA 1TQMA 2R93J 1WKMA 1ZK8A 3I59A 2VUMJ 2VASA 3BQZA 1HKTA 4IRHA 2BE5F 3KEYA 4PJJA 1DPRA 4IF4A 2MD5A 5DTDA 4KT6A 5F27A 1TWAJ 1NHAA 1XDSA 2J5PA 5EGOA 3J80Z 1NG7A 2DA2A 3BZCA 1B8IB 3DPTA 4L5IA 2M7BA 1MMGA 4PFOA 4YEJA 4D0PA 1EH8A 2JVHA 1W36C 4HF1A 2PN6A 1VQLI 2MC4A 4EJTA 3K9TA 2BHYA 1KGSA 2BY0A 2NYXA 3CUQB 3O3KA 1ZG1A 2A3SA 1YTYA 1WJAA 5JLWA 4AYBA 2DA1A 2Y9ZA 3FXQA 3K4LA 2R5ZA 1R49A 3G73A 3CCQI 1BI1A 1JHFA 2HZTA 1W0UA 3NWSA 3SQNA 2HTJA 2JPCA 1FPQA 3CF2A 4DZJA 1B59A 2KHMA 5CQEA 4BQQA 3VFZA 5KK1A 4G7HF 3LA7A 2ELJA 4KN4X 3WTTC 1F5TA 1MBKA 2DN0A 2KMUA 1H0MA 4E7KA 2DLLA 3KYDB 1IN7A 5LBQA 3SFIA 1IXSB 1L3LA 4LIUA 1H9GA 5CVJA 3IWFA 3S16J 2Z99A 4WK8F 2VJIA 3M7GA 3QYBA 3OYLA 1BC7C 2BZTA 2FNPA 4GDFA 1D1AA 1G3WA 4S05A 3D0SA 1S7OA 2OZ6A 4RGUA 2JPBA 3HUGB 2Z1DA 2FQ3A 1AKHB 2M87A 1T6SA 2LR8A 3DKWA 1FX7A 5D8LB 2EQRA 3GTPJ 1ZTRA 2A5YB 3OIQA 2ZMEC 3P7NA 2W25A 1UJ8A 3LAPA 2KLOA 1B72B 3T1BA 3ESWB 1FY7A 2HOEA 4BQAA 1YRNB 4DW6A 2ELKA 2DYSH 3S1RJ 2RKHA 2R92J 2DI3A 3HOXJ 3LMMA 4XM3A 4C30A 1ETKA 3NEUA 3WODF 1B9NA 1RZ4A 3HC7A 3HEFA 1W4MA 2LF7A 3BG7A 3GVAA 2XKPA 4MTEA 5LGUA 2DT6A 2GZWA 4HEA2 3Q0VA 1E3PA 1JXSA 4BHCA 3R61A 2KP6A 4DOZA 1Z3YA 4RGSA 2QM3A 1BR2A 2ADUA 2LF8A 2NVYJ 2VPRA 4NC8A 5J8CA 5TRDA 2E2IJ 2XDVA 2IP2A 2FNAA 4AWXB 2P7CB 2W00A 1SFUA 1BJZA 5HS8A 3E3VA 2E36A 4G6TB 1EF4A 3MFKA 4PUSA 5DM6F 2DO7A 3KP2A 2AXLA 3TBIA 4CUGA 1JGGA 2K9NA 1RKTA 4BJ5C 2X48A 2L7MP 2ME0A 4OMZA 3CCEI 5DS9A 2NRAC 3F8FA 4I7HA 3GZ5A 4OIOF 4ZDOA 2HQRA 2K4BA 4DZPA 2X1EA 2RGVA 1OJLA 2LKSA 4XLNF 2K86A 3KEOA 4ESFA 4N0BA 1EV7A 1HBXG 1I27A 1SD4A 3L2RA 1UMQA 3IKVA 3ZPLA 2JJ7A 3VDXA 3H9QA 1P2FA 1KU7A 3S1NJ 3ZMSA 5D4RA 1IV8A 5DYMA 1MSFC 1T0FC 4PDKA 4UV9A 3H9GA 1PUEE 2YU3A 3BROA 1OFCX 2UXXA 4LOCA 1K7AA 2HQ5A 4XKBA 2P8TA 1OCCH 2JWTA 4I6ZA 3M3YJ 2QGUA 4BQOA 2RQPA 2QBYA 4M71A 2ZJRF 4A3KJ 2DFHA 1FT9A 2ZMEA 2OQRA 4M3EA 4QWQA 1QVTA 3OSGA 1ZELA 2K7LA 4XOTA 2K4JA 3HOUJ 2E5NA 2DMUA 1XN7A 1O3QA 2IS4A 4U0YA 4N9IA 1XMXA 3CC7I 1D1BA 4EGZA 3HSRA 1XMKA 2W57A 3DTKA 4QSHA 2CQXA 1R5GA 2IA2A 4XLFA 1XSXA 3M1EA 3F21A 2RN7A 2HPMA 2CW0F 2QKLB 3U21A 2FMYA 3I58A 4QPQA 5E3MA 3WGIA 4V2GA 5CKTA 4ENMA 2VN2A 3ZQHA 1KYZA 2V9PA 4HF2A 2Q2EA 1UB9A 2O03A 4UXNA 3RJPA 2GOMA 3B6AA 2XRLA 1JTXA 2V1UA 2M7AA 2MYSA 3QPTA 2XAFA 5DD4A 1USTA 2DA7A 3GMEA 3GEZA 1G8XA 3CJNA 2IBDA 1BI3A 4MO7A 2XV4S 4OU0A 4XKCA 1GDTA 3V8LA 5GPCA 3DP7A 4BAYA 4XLEA 1TNTA 1WHUA 5J4YA 2IW5A 3CDIA 4II2A 1R7JA 1ZYRF 3V7RA 3HPHA 3I59B 1GXQA 1JKRC 1PVEA 3ZN0A 5F0HA 3AL0C 4OIRF 3CCSI 3GBGA 2K3PA 4WF2A 1GVJA 1QO0D 3RKWA 3OL4A 3TDZC 1XSVA 2O3FA 1RPWA 2Y9YA 1A36A 2VE8A 3OYFA 4PCQA 4Q47A 4ON0A 4M9SA 3RDIA 3X2QH 5EGOB 1TQIA 3GXOA 1U8BA 3IAS2 1Z7LA 3O8GA 5EDNA 1T0FA 4A93J 3VWBA 1YS6A 4RAGA 4L0ZB 4F7ZA 1OKRA 2XGDA 5IOYA 3DV8A 4B48A 5DDGA 3QPLA 1OCTC 2NAZA 1B6AA 3M4OJ 2X6XA 4IEJA 4ABZA 2VLAA 3ZQIA 1G2HA 4BNCA 4NBQA 4E70A 2HWVA 3BLYA 1MIJA 1V55H 2R5ZB 3DU6A 2EZKA 1D0XA 2X1CA 3KEQA 2DAOA 5M3FJ 4I01A 3HTUA 1ZG3A 2RNGA 3F8CA 5D5VB 3IP4B 3MKWB 1P7JA 1HXDA 1XC5A 3HRSA 4BHBA 1MJBA 2DJIA 2M4KA 2MG4A 2QQAA 2MLGA 2EA2A 2P7VB 3TQNA 4IHSA 4IHXA 3W2VA 5LD2C 1R00A 2EPFA 3K1PA 3CCVI 1A6IA 1IJWC 4D9JA 2VQCA 2XGXA 4YIRX 1LUJB 4BE2A 1VNDA 1D0ZA 2EFPA 1T38A 3CTAA 1QGPA 2ZXWH 2KT0A 2EILH 4WXHA 1K61A 1ZRDA 5DCFA 1MBJA 3P9IA 4S04A 3GUDA 3O2PE 3BCBA 4IXAA 4IRIA 3DXJF 1TLHB 2XPWA 2GXGA 1D8KA 3OWTA 5ILSA 3QYEA 1Z6RA 4PJNA 5EYRA 4A3CJ 4M74A 4CCLA 3TKYA 3BG3A 2WY8Q 2VXDA 2LMDA 4RAZA 4DJAA 1HC8A 3ZP5A 3OR2C 3TO7A 4DYCA 4KISA 1FSEA 3HOZJ 4EM0B 1IXRC 4HV6A 2IT0A 2W84A 2E5ZA 3KP3A 4NDLA 5FKNA 4CYDA 5HS7A 4XNFA 4IZZA 3GTQJ 4XMYA 2F5FA 2HNHA 3SJMA 1HSJA 2BV6A 3SZPA 3L2VA 1ETQA 1V4RA 5E8GA 1YO5C 1Y56A 3CCYA 2G7UA 1JHHA 2EZIA 1VQ5I 4IQ4A 2LC2A 1X19A 2PMUA 1XGSA 4DGWB 4XLAA 3IUOA 2KRFA 3JRBA 4ZTJA 4XSXF 1RC9A 2Z5UA 3HOWJ 1BOAA 3QPSA 2DK8A 5H2FC 1IV6A 3HOVJ 3CMAI 4HX8A 2RNJA 1DUXC 1VI0A 2X6OA 2VJ5A 2ZSHB 5DM7F 1YW7A 4QLCU 4PJLA 2DFIA 4RGRA 3PNTA 1P6RA 1QQIA 3N4MA 2ESHA 3HOSA 3QQAA 2R7RA 4EJVA 3WTZA 1J7KA 1SVLA 1FC3A 4GYGA 1S3JA 2P4WA 4DNCA 2XF6A 1DU0A 2RDPA 4BBRJ 1V5EA 1Z7UA 4XR6A 3WTYC 3H0DA 1ITYA 5CVIA 5K5QA 1WSUA 1V3FA 5HLHA 1XB4A 2QQ8A 2WA0A 1RR7A 5HDGA 4Y7NJ 2JVGA 2QBYB 1LEAA 2P6TA 1O4XA 2D45A 2W4SA 5HS9A 2ZMEB 4Y4RA 4N4OB 1AA7A 5FROA 3OYDA 2L54A 1MGTA 2CQKA 3ECHA 3TL4X 3ZMVA 3TP3A 1ENHA 2HOSA 2ECCA 1OLTA 1MD0A 4RM2A 2LY2A 4UVBA 4F52A 2FD5A 2GM4A 3P9KA 2ISYA 2M1BA 2JRTA 3DBLB 1ON1A 3KZYA 1KU2A 1VQ6I 2R7SA 4Z2YA 1WH7A 3BR1A 4CA0A 5LHIA 4D5CA 1O3RA 3VSKA 3BT9A 4P1WA 1TWHJ 3COAC 4HX4A 3ZXSA 3IAM2 2W24A 5J4VA 3FDYA 4I98B 3K2AA 1R23A 3PNVA 3ECOA 3W2AA 2K02A 1SEUA 4R8HA 2DT5A 4F55A 3HB9A 3KX2A 1UCRA 2Q0OA 2B7EA 3LSTA 4AU7A 2VQLA 1XGMA 1ZN2A 3IV5A 3TOAA 1T08B 2VKVA 2MLKA 5B1AH 5E18F 2HPIA 2DOAA 2LTPA 1XSDA 1E2XA 1QPIA 2E7XA 1QA6A 1UG0A 1FTZA 2PMHA 3K2ZA 3SXYA 2KDZA 3LQRA 1WPKA 2VJ4A 4YFNF 3I55I 3KPHA 1BC8C 1Z9CA 3DKXA 2FJ1A 2O61A 4HSTA 1YI2I 4ESJA 3HOYJ 4HOBA 1NTCA 5EJCA 5IYDJ 3CD6I 3F22A 1WI3A 2X85A 2MC3A 1W5CC 3ABMH 5BNGA 4A3LJ 1SC7A 2K27A 3HGYA 1E0EA 2HDWA 3CCUI 1MMSA 4XRSG 3M9AA 4A69C 2WC2A 3FKJA 4A3DJ 3ISPA 1A6QA 4RA2A 4BACA 3FXUA 3KLOA 3SEZA 1GT0C 4ANJA 1BIBA 4G9YA 4MTDA 4AM3A 4MNUA 2CQQA 2LY9A 1SANA 3F8MA 1R36A 1DU6A 2YUSA 3RZOJ 1WJEA 5D5XB 5HDKA 2L2OA 5EZGA 1TTYA 1UHWA 2TCTA 2YR2A 3MCZA 4Q48A 3PUBA 1FEXA 2XASA 2M8EA 1X3UA 4CYCA 3S32A 3M07A 3UR3C 3VYTB 4C2MJ 1GV5A 2RC4A 3H92A 1XX5A 2EH3A 2KIQA 2VI6A 2ZKZA 1SFKA 2VC0A 4O3MA 2Y30A 5JHUA 2KIFA 4P55A 4XKVA 3H5RA 4KMUX 3FXJA 2RREA 4L5JA 4RM3A 1R1UA 4E7IA 4ZTFA 3RYRA 1WVRA 1KU3A 4LB5A 1LDKB 5F1JA 2F4IA 1I5ZA 4XBFA 4XOPA 1UELB 5KVRA 3C2GA 1WJBA 1I39A 4F93B 1R1TA 1U9OA 3AL0B 3KE2A 2L7ZA 2HQAA 5B66C 4CSWA 4MLOA 1PJRA 4RDUA 2XC7A 1B1BA 3RPUA 4I99C 4Y15A 2IGMA 5LEKA 1UFMA 2UV1A 3VYSB 2LNBA 1ERDA 2NS0A 4M9XA 1QU3A 2XROA 2EFQA 1Y8RB 4AVPA 2I8DA 4EVIA 2FBIA 3RQIA 4OIQF 4B43A 2CFOA 3J81K 1AOYA 4PSWA 3BC8A 3BCAA 1D1CA 3DTEA 2W85A 3HRTA 4XN0A 3WTUC 4XIDA 1ZGJA 1WRJA 3IH2A 1Z91A 5FKOA 3QYFA 2HU9A 1RKWA 1RESA 2CH0A 2EB7A 4M9ZA 1FJLA 1MNDA 5L3EA 3WE2A 1NK2P 3HL2A 1IF1A 2P0WA 4XSZF 5JLXA 3JRFA 2M45A 3EUKL 4LG0A 4II3A 1FZPB 2L02A 1GHCA 2IAIA 2LRDA 3ULQB 3DU5A 2R0QC 1FBSA 4B1RA 2HVQA 3SEQA 3Q0UA 2ZB9A 3LFUA 5KCMA 3GYHX 4E4HA 2HDDA 2YU9J 1WZ2A 1LFBA 1G6NA 4RS8A 1I3QJ 1Z21A 2L4AA 5EEGA 3GZNB 3L00A 1X4OA 1IAWA 3K6GA 1HCRA 2JA7J 2QCOA 4E7ZA 3WTXC 1EA3A 1SD5A 4I76A 3BTIA 2EIMH 2CV0A 3EQLF 2IEKA 3GWZA 2X6WA 2Y0SN 1HW5A 3E5XA 4M3BA 1YOVB 2ZNYA 1E17A 2DA3A 3I54A 2MH2A 1U5TC 3G6EI 1Z0XA 2R7QA 3AAFA 3S3MA 2OUMA 2MSYA 3MD2A 3EETA 3TEDA 2ELHA 1SVOA 4BJTA 5LGNA 2DU9A 5IPAA 3WG7H 1FYLA 1LQ1A 2R7OA 4BY7J 4BXXJ 5M5YJ 1YJ9I 3FHNA 1B9MA 3MN2A 3FF5A 5DUKA 1LDJA 3DLAA 1YG2A 3Q0WA 1WI9A 5E20A 1XS9A 3PM1A 4U0VA 4M3DA 3CJTB 4DBQA 1MMNA 3RKYA 3DCFA 1XPXA 2DA6A 4ETSA 6PAXA 3GTLJ 3I4NJ 2TRTA 5L3GA 3DWLE 2R4GA 2JSPA 4ZZDA 1JI8A 5J40A 2RVCA 4RB2C 1OCOH 4BXFA 1HW1A 1P4AA 3WGGA 1YIOA 1W36D 3GLLA 3BR6A
chains in the Genus database with same CATH topology
4EJOA 4HX7A 1YW9A 2Z3YA 4RB0A 5HLIA 2FSWA 2FA5A 2GXBA 2EA4A 1SMYF 3V7SA 1RI7A 4L9TA 1RIOH 3BWGA 1XDUA 2F5CA 4HZFA 2O6GE 5K5RA 1BN5A 5DCMB 2OBPA 1O57A 3MZHA 3G3ZA 5LRSA 4CXFA 1XGNA 1U5TA 4EMSA 2QENA 2Y0MA 5LGTA 2VODA 1YQAA 4LJZF 2EWNA 1OYYA 1TQPA 1ON2A 3BJOA 3DPLC 3HIFA 3M8FA 3TO9A 4LLNA 4I09A 2EV5A 1JGSA 2H6CA 1T98A 3KETA 3C3WA 4KUMA 1J59A 3OOPA 3FMSA 4Q4ZF 2QYOA 4I2OA 3J81Z 5CVVA 2IJLA 3IC7A 3Q5FA 1DP7P 2KJCA 1U8RA 2HYGD 3PQKA 3E6DA 2HFHA 5L3BA 4AIJA 3ZN1A 3RTRA 2XRNA 4ZH4F 2COMA 2DQRA 1UHMA 5H6QA 5D6FA 4BXUA 2D1HA 2FMLA 4RGXA 2STWA 1K6OA 1QPMA 2LDUA 2FBKA 2X4HA 4LG0B 2RV8A 3T0YA 3BZ6A 4BHPA 4CHUA 2A68F 2HDCA 4LK0F 1HSTA 2NNNA 2PQ8A 1IN6A 5F64A 3ABTA 3GX4X 1ZLKA 3IRQA 3P9CA 5BQTA 1R5HA 3F23A 3LA2A 3EDPA 3HOTA 4ENJA 2VXZA 2ESNA 1I6XA 5E1WA 3U1DA 1IXCA 1G4DA 4H0EA 3KLNA 3GO5A 1LEBA 1FP2A 5BS6A 2V9VA 3I71A 2OA4A 3LFKA 2VT2A 5ICEA 4HYEA 2VBXA 4KNYA 5LHHA 4PZJA 2LKPA 4I02A 2XVCA 5LRRA 3TO6A 2A69F 1HKSA 4G8XA 1K78A 2X0LA 5HVQC 1QZZA 5BPDA 3F8BA 5E1XA 4ESBA 3CDHA 2KKOA 3VOEA 2FE3A 4XLPF 4ZZLA 1BJAA 2GA2A 3O6BB 1YIOA 4G6QA 4A0ZA 2P6SA 2E1NA 1P4WA 1ZH5A 3I0TA 4P9FA 1S29A 1QNTA 3ERED 1IN4A 4L9NA 5ED4A 4BYYA 2Y48A 2QUFA 2A61A 3SFZA 1U5TB 1D5VA 3PQJA 2D1VA 3U2RA 2BEOA 4HA8A 2IA1A 3F72A 4PGHA 2HGCA 4U7DA 1F9NA 5K1YA 4KYWA 2H6BA 2L3DA 2PFBA 2G7HA 1I1GA 1KU9A 4I0BA 2EV6A 4KFCA 2EJRA 2ZJ2A 1LJ9A 5JI6A 4AD9A 3JTGA 5HLGA 3K0LA 5H20A 4FT8A 5E17F 1LDDA 4HW0A 4YIIA 3GFLA 5L3DA 4YFXF 4L0YB 3J7AO 2JZYA 2QWWA 3KP6A 4OIPF 4OMYA 1D8JA 2GIVA 5DEQA 3BY6A 5A2QK 1FWZA 3QPHA 2R3SA 1XD7A 2GA1A 2KIMA 4AIKA 2DPDA 4FX4A 3R4KA 2FF4A 3I64A 1C0WA 4GO1A 1FSHA 2YSRA 3QU6A 4EM1A 1ODDA 3C1DA 2A6EF 3L09A 4CICA 1RUOA 4HLXA 5TJJA 3OV8A 3MZYA 4R79A 2PI0A 3IL2A 4OOIA 2BBYA 3BPXA 2OU2A 1O3TA 1W5TA 3TDUC 3K1NA 2WV0A 1JE8A 2CSOA 5J8FA 2MH9A 5DUIA 1FYMA 3IRRA 2A6HF 5J6XA 3IWZA 5FD5A 4P96A 4KMFA 3I4PA 2GWRA 4M73A 1G3YA 3RYPA 1LB2A 2QQ9A 4IVNA 2XIGA 4YFKF 2EFWA 3EUHA 1USSA 4AIHA 2Z33A 4CZZA 4KIBA 3QP6A 2HS5A 4CO8A 3W6KB 3KFWX 4KIFA 4KT5C 1ZGAA 2MBFA 1WWXA 2O8XA 2VBWA 1W7PA 3GLXA 2CFXA 4NQWA 5LLQA 5AIPA 2AS5F 3Q9VA 2Q8KA 2VT3A 1G3SA 1STZA 4LB6B 1VTNC 3VODA 2VONA 3L2CA 2DPUA 2QZ8A 1GXPA 2VC1A 3JSPA 1QZYA 3DFGA 5AONA 4ZYHA 3HTSB 3CLOA 5DD8A 5BPIA 3T5XA 3QAHA 4JK1X 2VBYA 2IA0A 2GAUA 5E8IA 4EM2A 4GYIA 1O7FA 2DTRA 3V7CA 5FB2A 5L3FA 4NHJA 1YYVA 5A2QZ 1EH6A 2GQQA 3CO7C 3HRMA 4UVAA 2IVMA 5ICCA 3V8JA 2VBZA 4UVCA 5D5UB 1R22A 2F5DA 4ASNA 3ZQ7A 2DW4A 5D4SA 1O7LA 1ULYA 4LK1F 2EFOA 4O6JA 1S7AA 4ZYGA 2HKOA 3CUOA 2Y75A 1TW3A 2PBIA 1J75A 1KYWA 3KP7A 3V8KA 2ZBKA 3KP5A 2F5EA 4MGRA 2L01A 2OAZA 5JR3A 5LEJA 3SZTA 4R1HA 3R6SA 1SD7A 3C18A 2ACJA 1FOKA 5ILVA 3H3UA 4G6DA 3EYIA 1CF7A 1ZAOA 2UZKA 3H3ZA 5L3CA 1IW7F 3FMQA 1OR7A 3C7JA 3DF8A 3ZMUA 2JT1A 5F1RA 4KN7X 4U0WA 1J5YA 1K79A 1FNNA 1MJAA 2ISZA 3FMRA 2OQGA 3E6BA 3DEUA 2JSCA 2P5VA 4BH9A 4CGZA 1T2KA 1BBYA 3T8RA 4UNOA 4KA4A 3E6MA 4B8XA 4A2UA 3CO6C 1Z05A 1RUNA 1J0RA 3F8NA 1IN5A 2EFNA 3ZMTA 1MZBA 4WCGA 4HBLA 1P4XA 2XAGA 4Y13A 4KICA 5F6FA 3ZMZA 1W7PB 1ZARA 2P5KA 3KZZA 4YG2F 2J5OA 1ZG5A 3E5QA 1YLFA 1U2WA 3FXRA 2VOPA 2H27A 3NQOA 1BM9A 5D6EA 1Z1DA 4YIFA 3MQ0A 4IPAA 4A12A 1HKQA 1S6LA 4U88A 1ZHFA 5CYVA 4MHGA 4CDGA 1T39A 4LFUA 2P5LC 4LLGF 3KCCA 1MDMA 3MEXA 4N9HA 4ZYDA 1KQ8A 2HKXA 2XHKA 4IRGA 3L7WA 2O0YA 5FFXA 3F6VA 2WWYA 2XAQA 4HAMA 2QVOA 2OD5A 1ZLJA 3F3XA 5IT9K 5BOXA 2ZNZA 5H6RA 4ENKA 3NRVA 4IJAA 1D3YA 4G94A 1ZREA 1R58A 5E1ZB 4G7OF 5FLXK 2PJPA 3D5LA 4LMYA 5FFZA 1DDNA 3BOQA 1OYWA 2CYYA 3Q9SA 3WG9A 1SFEA 3QU3A 3JSOA 3SHFA 1OMIA 3EYYA 2HYFA 2CG4A 1OPCA 2HR3A 4G7ZF 2R7DA 2TDXA 1F1ZA 2UXNA 1U78A 1CGPA 3JAMK 4U7BA 2ZFWA 3TGNA 5FGMA 2HQNA 3FZVA 1FBQA 5HDNA 3IHUA 2NNYA 2M30A 3T8TA 1CF7B 1YFHA 1H9TA 1OYIA 4A0YA 1PP7U 3WU1B 3JTHA 4M6YA 2JTVA 2PEXA 3MAJA 3B02A 3E6CC 2YX4A 4HQEA 1LVAA 4O5VA 1J2XA 3RIRA 4HLYA 3ROUA 5K5OA 1XGOA 3HRUA 3V4GA 3MWMA 4GGGA 4LGWA 4HV5A 5JVTA 2Z9OA 3QOPA 3BJAA 2DK5A 5ERIA 1QBJA 1YW8A 1IN8A 4LLLA 1TW2A 3FM5A 2KIUA 4EJWA 1XMAA 2R7FA 1S8NA 2V6CA 2E7WA 2G9WA 2HTSA 2V79A 2VE9A 1U3EM 3HSFA 4L9JA 1REPC 3LQQA 5DV5A 1TNSA 4L9VA 1XCBA 2IPQX 2XAJA 4RB3C 5D5WB 2KJBA 4WX9A 3BDDA 3RI4A 2EK5A 2STTA 1U6GA 3R60A 4GCVA 2PLYA 2XKOA 1ZRFA 2D2WA 3I53A 2A07F 1WQ2A 4A5NA 1FBUA 1ONVA 2EV0A 2QQBA 3TOBA 3ELKA 5IT9Z 1FYKA 4FX0A 3BP8A 1MDMB 3WTWC 3RPQA 3GW2A 5FLXZ 4HF0A 1Z6TA 4RAYA 4Y17A 3M8EA 5CJ9A 3FX3A 2H09A 2FBHA 3GFMA 5D8KB 4I0AA 3CUQC 3W6JB 3HHGA 1KQ9A 2OZUA 1O3SA 3GF2A 4ZYEA 3WTSC 4L18B 4WXDA 5ICGA 1FP1D 2LSOA 1BI0A 3K1MA 3LWFA 1A04A 4OINF 4NB5A 1EH7A 3JW4A 1DPUA 3R0AA 2WTEA 3BPVA 2FRHA 5FD6A 3JAMZ 2YX7A 1MJ9A 1SFXA 1ZRCA 3GZ6A 1J9IA 2C6YA 4B09A 5CVRA 4M6XA 1W7PD 4XRFA 4KDPA 4JQFA 1HQCA 4IHTA 4EQQA 3E5UA 3IKTA 4K2EA 4P9UA 1F4KA 4LD5A 2BYVE 3K69A 3WE3A 5HOOA 2CGPA 3HSEA 2BGCA 4WXCA 3HYIA 3CUQA 4UV8A 1P92A 1MKMA 4MQ9F 2ZO4A 1I1SA 2V1XA 4A5MA 3VB2A 1K78B 2UWMA 3J80K 3E97A 2F2EA 3ML6A 1IZ1A 2IRFG 1IRFA 1Y0UA 3R0JA 4MQVA 3FWEA 2V1DA 3FHZA 1PDNC 3BJ6A 2L4MA 4EV0A 3WGHA 4HDVA 5DCMA 1R1VA 1AWCA 5EEHA 3HUGA 2FXAA 1BI2A 3WTVC 1W5SA 1G3TA 4M72A 2VOOA 4TV7A 4A6DA 2ETHA 1HW2A 2H94A 3REOA 3ZMDA 1FLIA 2E1CA 3GFJA 2DBBA 1LNWA 4FHTA 2XUBA 3RKXA 3PFIA 1SMTA 3L9FA 4ENNA 3I5UA 4KIGA 1TBXA 3U9GA 1BIAA 3LA3A 4JBAA 2FU4A 2ZXJA 3FM3A 5FO5A 4HDUA 5BMZA 2CWEA 2M5WA 4P5OA 1XCVA 3KP4A 4MEYF 4A6EA 5CLSA 4DQ2A 3F6OA 2MA3A 1PP8F 4WWCA 1SAXA 3WU0A 2FEZA 5JFRA 3N97A 2DQLA 1L0OC 4GXOA 1SD6A 5IT3A 4RB1A 2ZCWA 5AIQA 4UHTA 2HEOA 2B0LA 4UUVA 3S2WA 3VEPA 4HQMA 5CVUA 3GFIA 4EJUA 1IUYA 3DQVC 3HHHA 2FOKA 2QLZA 4Q5SF 1KQ0A 3ABUA 2CO5A 5LHGA 4A0XA 2XAHA 1B4AA 5ILUA 4MEXF 1KA8A 3QRFF 5ICFA 1IRGA 2YPRA 1RNLA 4EGYA 1YS7A 4PGGA 3B73A 1Q1HA 3QP5A 2PG4A 1TQMA 1WKMA 3I59A 1HKTA 4IRHA 2BE5F 1DPRA 4IF4A 2MD5A 1NHAA 1XDSA 2J5PA 3J80Z 3DPTA 4L5IA 4D0PA 1EH8A 4HF1A 2PN6A 4EJTA 3K9TA 1KGSA 3CUQB 2NYXA 1ZG1A 3O3KA 2A3SA 1YTYA 3FXQA 3G73A 1BI1A 1JHFA 2HZTA 3SQNA 2HTJA 2JPCA 1FPQA 1B59A 3VFZA 5KK1A 4G7HF 3LA7A 3WTTC 4KN4X 1F5TA 1H0MA 2DLLA 1IN7A 5LBQA 1IXSB 1L3LA 1H9GA 5CVJA 3IWFA 2Z99A 4WK8F 3M7GA 1BC7C 2FNPA 1G3WA 4S05A 3D0SA 1S7OA 2OZ6A 4RGUA 2JPBA 2FQ3A 2M87A 1T6SA 3DKWA 1FX7A 5D8LB 2A5YB 3P7NA 2W25A 3LAPA 3T1BA 1FY7A 2HOEA 4BQAA 2RKHA 2DI3A 3WODF 3NEUA 1B9NA 1RZ4A 1W4MA 2LF7A 3GVAA 5LGUA 2XKPA 4MTEA 2GZWA 1JXSA 4BHCA 3R61A 4RGSA 2QM3A 2ADUA 2LF8A 5J8CA 5TRDA 2IP2A 2FNAA 4AWXB 2P7CB 1SFUA 5HS8A 3E3VA 3MFKA 2DO7A 3KP2A 2AXLA 4OMZA 2NRAC 3F8FA 4I7HA 3GZ5A 4OIOF 2HQRA 2K4BA 2RGVA 4XLNF 2K86A 3KEOA 4ESFA 4N0BA 1EV7A 1HBXG 1I27A 1SD4A 3IKVA 3ZPLA 1P2FA 1KU7A 3ZMSA 5D4RA 5DYMA 4PDKA 4UV9A 1PUEE 2YU3A 3BROA 2UXXA 1K7AA 2P8TA 2QBYA 2RQPA 4M71A 1FT9A 2ZMEA 2OQRA 4QWQA 2K7LA 2K4JA 1XN7A 1O3QA 4U0YA 4N9IA 4EGZA 3HSRA 1XMKA 2W57A 3F21A 1R5GA 2IA2A 1XSXA 3M1EA 2RN7A 2CW0F 2FMYA 3I58A 3WGIA 4ENMA 2VN2A 1KYZA 4HF2A 2Q2EA 1UB9A 2O03A 4UXNA 3RJPA 2V1UA 3QPTA 2XAFA 5DD4A 1USTA 3GEZA 3CJNA 1BI3A 4OU0A 2XV4S 3V8LA 3DP7A 4BAYA 1TNTA 2IW5A 1R7JA 1ZYRF 3V7RA 3I59B 1GXQA 3ZN0A 4OIRF 3TDZC 4WF2A 1GVJA 1QO0D 3RKWA 1XSVA 2O3FA 2VE8A 4PCQA 4Q47A 4ON0A 4M9SA 3RDIA 1TQIA 3GXOA 1T0FA 1YS6A 4L0ZB 4F7ZA 1OKRA 3DV8A 5DDGA 2NAZA 1B6AA 4BNCA 4E70A 2HWVA 3KEQA 2DAOA 4I01A 3HTUA 1ZG3A 5D5VB 3F8CA 3HRSA 1HXDA 4BHBA 1MJBA 2QQAA 2MLGA 2EA2A 2P7VB 3TQNA 4IHSA 1R00A 3K1PA 2XGXA 2EFPA 1T38A 3CTAA 1QGPA 4WXHA 1ZRDA 5DCFA 3P9IA 4S04A 3GUDA 3O2PE 4IXAA 4IRIA 3DXJF 1TLHB 2GXGA 1D8KA 5ILSA 1Z6RA 4M74A 3TKYA 4RAZA 3ZP5A 3TO7A 1FSEA 4EM0B 1IXRC 4HV6A 2IT0A 2W84A 3KP3A 4CYDA 5HS7A 2F5FA 1HSJA 2BV6A 3SZPA 1V4RA 5E8GA 1YO5C 2G7UA 1JHHA 2PMUA 1XGSA 2KRFA 4XSXF 2Z5UA 1BOAA 2DK8A 4HX8A 2RNJA 1DUXC 1YW7A 4QLCU 2DFIA 4RGRA 1P6RA 1QQIA 3N4MA 2ESHA 3HOSA 4EJVA 3WTZA 1J7KA 1FC3A 4GYGA 1S3JA 2P4WA 4DNCA 2RDPA 1Z7UA 3WTYC 5CVIA 5K5QA 1WSUA 1V3FA 5HLHA 1XB4A 5HDGA 2QBYB 1LEAA 2P6TA 2D45A 5HS9A 2ZMEB 2L54A 1MGTA 2CQKA 3ECHA 3ZMVA 1MD0A 4UVBA 3P9KA 2ISYA 2M1BA 2JRTA 1ON1A 3KZYA 1KU2A 4Z2YA 5LHIA 1O3RA 3COAC 4HX4A 2W24A 4I98B 1R23A 3ECOA 2K02A 4R8HA 2DT5A 1UCRA 2Q0OA 3LSTA 1XGMA 1ZN2A 3TOAA 5E18F 2MLKA 1XSDA 1E2XA 2E7XA 2PMHA 3K2ZA 3SXYA 3LQRA 4YFNF 1BC8C 1Z9CA 2O61A 4ESJA 4HOBA 3F22A 2MC3A 2K27A 3M9AA 2WC2A 3ISPA 3FXUA 3KLOA 1BIBA 4G9YA 4MTDA 4MNUA 3F8MA 1R36A 5D5XB 5HDKA 1TTYA 1UHWA 2YR2A 3MCZA 4Q48A 2XASA 2M8EA 1X3UA 2RC4A 3H92A 2ZKZA 2VC0A 4O3MA 5JHUA 2KIFA 4P55A 4KMUX 4L5JA 1R1UA 3RYRA 1KU3A 4LB5A 1LDKB 4XBFA 1I5ZA 5KVRA 1R1TA 3KE2A 1B1BA 3RPUA 4Y15A 5LEKA 1UFMA 2LNBA 2NS0A 4M9XA 2XROA 2EFQA 4AVPA 4EVIA 2FBIA 4OIQF 3J81K 1AOYA 3HRTA 2W85A 3WTUC 1ZGJA 1WRJA 1Z91A 2EB7A 4M9ZA 5L3EA 3WE2A 1IF1A 4XSZF 2M45A 4LG0A 1FZPB 2L02A 1GHCA 3ULQB 1FBSA 3GYHX 1G6NA 4RS8A 2L4AA 5EEGA 3L00A 1IAWA 3WTXC 1SD5A 3EQLF 3GWZA 1HW5A 3E5XA 2ZNYA 1E17A 3I54A 2MH2A 1U5TC 3AAFA 3EETA 2ELHA 5LGNA 2DU9A 1FYLA 1LQ1A 1B9MA 3FF5A 5DUKA 1LDJA 1YG2A 5E20A 1WI9A 4U0VA 3RKYA 6PAXA 4ETSA 5L3GA 4ZZDA 2RVCA 4RB2C 1HW1A 1P4AA 3WGGA 3LAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJO A;  4HX7 A;  1YW9 A;  2Z3Y A;  4RB0 A;  5HLI A;  2FSW A;  2FA5 A;  2GXB A;  2EA4 A;  1SMY F;  3V7S A;  1RI7 A;  4L9T A;  1RIO H;  3BWG A;  1XDU A;  2F5C A;  4HZF A;  2O6G E;  5K5R A;  1BN5 A;  5DCM B;  2OBP A;  1O57 A;  3MZH A;  3G3Z A;  5LRS A;  4CXF A;  1XGN A;  1U5T A;  4EMS A;  2QEN A;  2Y0M A;  5LGT A;  2VOD A;  1YQA A;  4LJZ F;  2EWN A;  1OYY A;  1TQP A;  1ON2 A;  3BJO A;  3DPL C;  3HIF A;  3M8F A;  3TO9 A;  4LLN A;  4I09 A;  2EV5 A;  1JGS A;  2H6C A;  1T98 A;  3KET A;  3C3W A;  4KUM A;  1J59 A;  3OOP A;  3FMS A;  4Q4Z F;  2QYO A;  4I2O A;  3J81 Z;  5CVV A;  2IJL A;  3IC7 A;  3Q5F A;  1DP7 P;  2KJC A;  1U8R A;  2HYG D;  3PQK A;  3E6D A;  2HFH A;  5L3B A;  4AIJ A;  3ZN1 A;  3RTR A;  2XRN A;  4ZH4 F;  2COM A;  2DQR A;  1UHM A;  5H6Q A;  5D6F A;  4BXU A;  2D1H A;  2FML A;  4RGX A;  2STW A;  1K6O A;  1QPM A;  2LDU A;  2FBK A;  2X4H A;  4LG0 B;  2RV8 A;  3T0Y A;  3BZ6 A;  4BHP A;  4CHU A;  2A68 F;  2HDC A;  4LK0 F;  1HST A;  2NNN A;  2PQ8 A;  1IN6 A;  5F64 A;  3ABT A;  3GX4 X;  1ZLK A;  3IRQ A;  3P9C A;  5BQT A;  1R5H A;  3F23 A;  3LA2 A;  3EDP A;  3HOT A;  4ENJ A;  2VXZ A;  2ESN A;  1I6X A;  5E1W A;  3U1D A;  1IXC A;  1G4D A;  4H0E A;  3KLN A;  3GO5 A;  1LEB A;  1FP2 A;  5BS6 A;  2V9V A;  3I71 A;  2OA4 A;  3LFK A;  2VT2 A;  5ICE A;  4HYE A;  2VBX A;  4KNY A;  5LHH A;  4PZJ A;  2LKP A;  4I02 A;  2XVC A;  5LRR A;  3TO6 A;  2A69 F;  1HKS A;  4G8X A;  1K78 A;  2X0L A;  5HVQ C;  1QZZ A;  5BPD A;  3F8B A;  5E1X A;  4ESB A;  3CDH A;  2KKO A;  3VOE A;  2FE3 A;  4XLP F;  4ZZL A;  1BJA A;  2GA2 A;  3O6B B;  1YIO A;  4G6Q A;  4A0Z A;  2P6S A;  2E1N A;  1P4W A;  1ZH5 A;  3I0T A;  4P9F A;  1S29 A;  1QNT A;  3ERE D;  1IN4 A;  4L9N A;  5ED4 A;  4BYY A;  2Y48 A;  2QUF A;  2A61 A;  3SFZ A;  1U5T B;  1D5V A;  3PQJ A;  2D1V A;  3U2R A;  2BEO A;  4HA8 A;  2IA1 A;  3F72 A;  4PGH A;  2HGC A;  4U7D A;  1F9N A;  5K1Y A;  4KYW A;  2H6B A;  2L3D A;  2PFB A;  2G7H A;  1I1G A;  1KU9 A;  4I0B A;  2EV6 A;  4KFC A;  2EJR A;  2ZJ2 A;  1LJ9 A;  5JI6 A;  4AD9 A;  3JTG A;  5HLG A;  3K0L A;  5H20 A;  4FT8 A;  5E17 F;  1LDD A;  4HW0 A;  4YII A;  3GFL A;  5L3D A;  4YFX F;  4L0Y B;  3J7A O;  2JZY A;  2QWW A;  3KP6 A;  4OIP F;  4OMY A;  1D8J A;  2GIV A;  5DEQ A;  3BY6 A;  5A2Q K;  1FWZ A;  3QPH A;  2R3S A;  1XD7 A;  2GA1 A;  2KIM A;  4AIK A;  2DPD A;  4FX4 A;  3R4K A;  2FF4 A;  3I64 A;  1C0W A;  4GO1 A;  1FSH A;  2YSR A;  3QU6 A;  4EM1 A;  1ODD A;  3C1D A;  2A6E F;  3L09 A;  4CIC A;  1RUO A;  4HLX A;  5TJJ A;  3OV8 A;  3MZY A;  4R79 A;  2PI0 A;  3IL2 A;  4OOI A;  2BBY A;  3BPX A;  2OU2 A;  1O3T A;  1W5T A;  3TDU C;  3K1N A;  2WV0 A;  1JE8 A;  2CSO A;  5J8F A;  2MH9 A;  5DUI A;  1FYM A;  3IRR A;  2A6H F;  5J6X A;  3IWZ A;  5FD5 A;  4P96 A;  4KMF A;  3I4P A;  2GWR A;  4M73 A;  1G3Y A;  3RYP A;  1LB2 A;  2QQ9 A;  4IVN A;  2XIG A;  4YFK F;  2EFW A;  3EUH A;  1USS A;  4AIH A;  2Z33 A;  4CZZ A;  4KIB A;  3QP6 A;  2HS5 A;  4CO8 A;  3W6K B;  3KFW X;  4KIF A;  4KT5 C;  1ZGA A;  2MBF A;  1WWX A;  2O8X A;  2VBW A;  1W7P A;  3GLX A;  2CFX A;  4NQW A;  5LLQ A;  5AIP A;  2AS5 F;  3Q9V A;  2Q8K A;  2VT3 A;  1G3S A;  1STZ A;  4LB6 B;  1VTN C;  3VOD A;  2VON A;  3L2C A;  2DPU A;  2QZ8 A;  1GXP A;  2VC1 A;  3JSP A;  1QZY A;  3DFG A;  5AON A;  4ZYH A;  3HTS B;  3CLO A;  5DD8 A;  5BPI A;  3T5X A;  3QAH A;  4JK1 X;  2VBY A;  2IA0 A;  2GAU A;  5E8I A;  4EM2 A;  4GYI A;  1O7F A;  2DTR A;  3V7C A;  5FB2 A;  5L3F A;  4NHJ A;  1YYV A;  5A2Q Z;  1EH6 A;  2GQQ A;  3CO7 C;  3HRM A;  4UVA A;  2IVM A;  5ICC A;  3V8J A;  2VBZ A;  4UVC A;  5D5U B;  1R22 A;  2F5D A;  4ASN A;  3ZQ7 A;  2DW4 A;  5D4S A;  1O7L A;  1ULY A;  4LK1 F;  2EFO A;  4O6J A;  1S7A A;  4ZYG A;  2HKO A;  3CUO A;  2Y75 A;  1TW3 A;  2PBI A;  1J75 A;  1KYW A;  3KP7 A;  3V8K A;  2ZBK A;  3KP5 A;  2F5E A;  4MGR A;  2L01 A;  2OAZ A;  5JR3 A;  5LEJ A;  3SZT A;  4R1H A;  3R6S A;  1SD7 A;  3C18 A;  2ACJ A;  1FOK A;  5ILV A;  3H3U A;  4G6D A;  3EYI A;  1CF7 A;  1ZAO A;  2UZK A;  3H3Z A;  5L3C A;  1IW7 F;  3FMQ A;  1OR7 A;  3C7J A;  3DF8 A;  3ZMU A;  2JT1 A;  5F1R A;  4KN7 X;  4U0W A;  1J5Y A;  1K79 A;  1FNN A;  1MJA A;  2ISZ A;  3FMR A;  2OQG A;  3E6B A;  3DEU A;  2JSC A;  2P5V A;  4BH9 A;  4CGZ A;  1T2K A;  1BBY A;  3T8R A;  4UNO A;  4KA4 A;  3E6M A;  4B8X A;  4A2U A;  3CO6 C;  1Z05 A;  1RUN A;  1J0R A;  3F8N A;  1IN5 A;  2EFN A;  3ZMT A;  1MZB A;  4WCG A;  4HBL A;  1P4X A;  2XAG A;  4Y13 A;  4KIC A;  5F6F A;  3ZMZ A;  1W7P B;  1ZAR A;  2P5K A;  3KZZ A;  4YG2 F;  2J5O A;  1ZG5 A;  3E5Q A;  1YLF A;  1U2W A;  3FXR A;  2VOP A;  2H27 A;  3NQO A;  1BM9 A;  5D6E A;  1Z1D A;  4YIF A;  3MQ0 A;  4IPA A;  4A12 A;  1HKQ A;  1S6L A;  4U88 A;  1ZHF A;  5CYV A;  4MHG A;  4CDG A;  1T39 A;  4LFU A;  2P5L C;  4LLG F;  3KCC A;  1MDM A;  3MEX A;  4N9H A;  4ZYD A;  1KQ8 A;  2HKX A;  2XHK A;  4IRG A;  3L7W A;  2O0Y A;  5FFX A;  3F6V A;  2WWY A;  2XAQ A;  4HAM A;  2QVO A;  2OD5 A;  1ZLJ A;  3F3X A;  5IT9 K;  5BOX A;  2ZNZ A;  5H6R A;  4ENK A;  3NRV A;  4IJA A;  1D3Y A;  4G94 A;  1ZRE A;  1R58 A;  5E1Z B;  4G7O F;  5FLX K;  2PJP A;  3D5L A;  4LMY A;  5FFZ A;  1DDN A;  3BOQ A;  1OYW A;  2CYY A;  3Q9S A;  3WG9 A;  1SFE A;  3QU3 A;  3JSO A;  3SHF A;  1OMI A;  3EYY A;  2HYF A;  2CG4 A;  1OPC A;  2HR3 A;  4G7Z F;  2R7D A;  2TDX A;  1F1Z A;  2UXN A;  1U78 A;  1CGP A;  3JAM K;  4U7B A;  2ZFW A;  3TGN A;  5FGM A;  2HQN A;  3FZV A;  1FBQ A;  5HDN A;  3IHU A;  2NNY A;  2M30 A;  3T8T A;  1CF7 B;  1YFH A;  1H9T A;  1OYI A;  4A0Y A;  1PP7 U;  3WU1 B;  3JTH A;  4M6Y A;  2JTV A;  2PEX A;  3MAJ A;  3B02 A;  3E6C C;  2YX4 A;  4HQE A;  1LVA A;  4O5V A;  1J2X A;  3RIR A;  4HLY A;  3ROU A;  5K5O A;  1XGO A;  3HRU A;  3V4G A;  3MWM A;  4GGG A;  4LGW A;  4HV5 A;  5JVT A;  2Z9O A;  3QOP A;  3BJA A;  2DK5 A;  5ERI A;  1QBJ A;  1YW8 A;  1IN8 A;  4LLL A;  1TW2 A;  3FM5 A;  2KIU A;  4EJW A;  1XMA A;  2R7F A;  1S8N A;  2V6C A;  2E7W A;  2G9W A;  2HTS A;  2V79 A;  2VE9 A;  1U3E M;  3HSF A;  4L9J A;  1REP C;  3LQQ A;  5DV5 A;  1TNS A;  4L9V A;  1XCB A;  2IPQ X;  2XAJ A;  4RB3 C;  5D5W B;  2KJB A;  4WX9 A;  3BDD A;  3RI4 A;  2EK5 A;  2STT A;  1U6G A;  3R60 A;  4GCV A;  2PLY A;  2XKO A;  1ZRF A;  2D2W A;  3I53 A;  2A07 F;  1WQ2 A;  4A5N A;  1FBU A;  1ONV A;  2EV0 A;  2QQB A;  3TOB A;  3ELK A;  5IT9 Z;  1FYK A;  4FX0 A;  3BP8 A;  1MDM B;  3WTW C;  3RPQ A;  3GW2 A;  5FLX Z;  4HF0 A;  1Z6T A;  4RAY A;  4Y17 A;  3M8E A;  5CJ9 A;  3FX3 A;  2H09 A;  2FBH A;  3GFM A;  5D8K B;  4I0A A;  3CUQ C;  3W6J B;  3HHG A;  1KQ9 A;  2OZU A;  1O3S A;  3GF2 A;  4ZYE A;  3WTS C;  4L18 B;  4WXD A;  5ICG A;  1FP1 D;  2LSO A;  1BI0 A;  3K1M A;  3LWF A;  1A04 A;  4OIN F;  4NB5 A;  1EH7 A;  3JW4 A;  1DPU A;  3R0A A;  2WTE A;  3BPV A;  2FRH A;  5FD6 A;  3JAM Z;  2YX7 A;  1MJ9 A;  1SFX A;  1ZRC A;  3GZ6 A;  1J9I A;  2C6Y A;  4B09 A;  5CVR A;  4M6X A;  1W7P D;  4XRF A;  4KDP A;  4JQF A;  1HQC A;  4IHT A;  4EQQ A;  3E5U A;  3IKT A;  4K2E A;  4P9U A;  1F4K A;  4LD5 A;  2BYV E;  3K69 A;  3WE3 A;  5HOO A;  2CGP A;  3HSE A;  2BGC A;  4WXC A;  3HYI A;  3CUQ A;  4UV8 A;  1P92 A;  1MKM A;  4MQ9 F;  2ZO4 A;  1I1S A;  2V1X A;  4A5M A;  3VB2 A;  1K78 B;  2UWM A;  3J80 K;  3E97 A;  2F2E A;  3ML6 A;  1IZ1 A;  2IRF G;  1IRF A;  1Y0U A;  3R0J A;  4MQV A;  3FWE A;  2V1D A;  3FHZ A;  1PDN C;  3BJ6 A;  2L4M A;  4EV0 A;  3WGH A;  4HDV A;  5DCM A;  1R1V A;  1AWC A;  5EEH A;  3HUG A;  2FXA A;  1BI2 A;  3WTV C;  1W5S A;  1G3T A;  4M72 A;  2VOO A;  4TV7 A;  4A6D A;  2ETH A;  1HW2 A;  2H94 A;  3REO A;  3ZMD A;  1FLI A;  2E1C A;  3GFJ A;  2DBB A;  1LNW A;  4FHT A;  2XUB A;  3RKX A;  3PFI A;  1SMT A;  3L9F A;  4ENN A;  3I5U A;  4KIG A;  1TBX A;  3U9G A;  1BIA A;  3LA3 A;  4JBA A;  2FU4 A;  2ZXJ A;  3FM3 A;  5FO5 A;  4HDU A;  5BMZ A;  2CWE A;  2M5W A;  4P5O A;  1XCV A;  3KP4 A;  4MEY F;  4A6E A;  5CLS A;  4DQ2 A;  3F6O A;  2MA3 A;  1PP8 F;  4WWC A;  1SAX A;  3WU0 A;  2FEZ A;  5JFR A;  3N97 A;  2DQL A;  1L0O C;  4GXO A;  1SD6 A;  5IT3 A;  4RB1 A;  2ZCW A;  5AIQ A;  4UHT A;  2HEO A;  2B0L A;  4UUV A;  3S2W A;  3VEP A;  4HQM A;  5CVU A;  3GFI A;  4EJU A;  1IUY A;  3DQV C;  3HHH A;  2FOK A;  2QLZ A;  4Q5S F;  1KQ0 A;  3ABU A;  2CO5 A;  5LHG A;  4A0X A;  2XAH A;  1B4A A;  5ILU A;  4MEX F;  1KA8 A;  3QRF F;  5ICF A;  1IRG A;  2YPR A;  1RNL A;  4EGY A;  1YS7 A;  4PGG A;  3B73 A;  1Q1H A;  3QP5 A;  2PG4 A;  1TQM A;  1WKM A;  3I59 A;  1HKT A;  4IRH A;  2BE5 F;  1DPR A;  4IF4 A;  2MD5 A;  1NHA A;  1XDS A;  2J5P A;  3J80 Z;  3DPT A;  4L5I A;  4D0P A;  1EH8 A;  4HF1 A;  2PN6 A;  4EJT A;  3K9T A;  1KGS A;  3CUQ B;  2NYX A;  1ZG1 A;  3O3K A;  2A3S A;  1YTY A;  3FXQ A;  3G73 A;  1BI1 A;  1JHF A;  2HZT A;  3SQN A;  2HTJ A;  2JPC A;  1FPQ A;  1B59 A;  3VFZ A;  5KK1 A;  4G7H F;  3LA7 A;  3WTT C;  4KN4 X;  1F5T A;  1H0M A;  2DLL A;  1IN7 A;  5LBQ A;  1IXS B;  1L3L A;  1H9G A;  5CVJ A;  3IWF A;  2Z99 A;  4WK8 F;  3M7G A;  1BC7 C;  2FNP A;  1G3W A;  4S05 A;  3D0S A;  1S7O A;  2OZ6 A;  4RGU A;  2JPB A;  2FQ3 A;  2M87 A;  1T6S A;  3DKW A;  1FX7 A;  5D8L B;  2A5Y B;  3P7N A;  2W25 A;  3LAP A;  3T1B A;  1FY7 A;  2HOE A;  4BQA A;  2RKH A;  2DI3 A;  3WOD F;  3NEU A;  1B9N A;  1RZ4 A;  1W4M A;  2LF7 A;  3GVA A;  5LGU A;  2XKP A;  4MTE A;  2GZW A;  1JXS A;  4BHC A;  3R61 A;  4RGS A;  2QM3 A;  2ADU A;  2LF8 A;  5J8C A;  5TRD A;  2IP2 A;  2FNA A;  4AWX B;  2P7C B;  1SFU A;  5HS8 A;  3E3V A;  3MFK A;  2DO7 A;  3KP2 A;  2AXL A;  4OMZ A;  2NRA C;  3F8F A;  4I7H A;  3GZ5 A;  4OIO F;  2HQR A;  2K4B A;  2RGV A;  4XLN F;  2K86 A;  3KEO A;  4ESF A;  4N0B A;  1EV7 A;  1HBX G;  1I27 A;  1SD4 A;  3IKV A;  3ZPL A;  1P2F A;  1KU7 A;  3ZMS A;  5D4R A;  5DYM A;  4PDK A;  4UV9 A;  1PUE E;  2YU3 A;  3BRO A;  2UXX A;  1K7A A;  2P8T A;  2QBY A;  2RQP A;  4M71 A;  1FT9 A;  2ZME A;  2OQR A;  4QWQ A;  2K7L A;  2K4J A;  1XN7 A;  1O3Q A;  4U0Y A;  4N9I A;  4EGZ A;  3HSR A;  1XMK A;  2W57 A;  3F21 A;  1R5G A;  2IA2 A;  1XSX A;  3M1E A;  2RN7 A;  2CW0 F;  2FMY A;  3I58 A;  3WGI A;  4ENM A;  2VN2 A;  1KYZ A;  4HF2 A;  2Q2E A;  1UB9 A;  2O03 A;  4UXN A;  3RJP A;  2V1U A;  3QPT A;  2XAF A;  5DD4 A;  1UST A;  3GEZ A;  3CJN A;  1BI3 A;  4OU0 A;  2XV4 S;  3V8L A;  3DP7 A;  4BAY A;  1TNT A;  2IW5 A;  1R7J A;  1ZYR F;  3V7R A;  3I59 B;  1GXQ A;  3ZN0 A;  4OIR F;  3TDZ C;  4WF2 A;  1GVJ A;  1QO0 D;  3RKW A;  1XSV A;  2O3F A;  2VE8 A;  4PCQ A;  4Q47 A;  4ON0 A;  4M9S A;  3RDI A;  1TQI A;  3GXO A;  1T0F A;  1YS6 A;  4L0Z B;  4F7Z A;  1OKR A;  3DV8 A;  5DDG A;  2NAZ A;  1B6A A;  4BNC A;  4E70 A;  2HWV A;  3KEQ A;  2DAO A;  4I01 A;  3HTU A;  1ZG3 A;  5D5V B;  3F8C A;  3HRS A;  1HXD A;  4BHB A;  1MJB A;  2QQA A;  2MLG A;  2EA2 A;  2P7V B;  3TQN A;  4IHS A;  1R00 A;  3K1P A;  2XGX A;  2EFP A;  1T38 A;  3CTA A;  1QGP A;  4WXH A;  1ZRD A;  5DCF A;  3P9I A;  4S04 A;  3GUD A;  3O2P E;  4IXA A;  4IRI A;  3DXJ F;  1TLH B;  2GXG A;  1D8K A;  5ILS A;  1Z6R A;  4M74 A;  3TKY A;  4RAZ A;  3ZP5 A;  3TO7 A;  1FSE A;  4EM0 B;  1IXR C;  4HV6 A;  2IT0 A;  2W84 A;  3KP3 A;  4CYD A;  5HS7 A;  2F5F A;  1HSJ A;  2BV6 A;  3SZP A;  1V4R A;  5E8G A;  1YO5 C;  2G7U A;  1JHH A;  2PMU A;  1XGS A;  2KRF A;  4XSX F;  2Z5U A;  1BOA A;  2DK8 A;  4HX8 A;  2RNJ A;  1DUX C;  1YW7 A;  4QLC U;  2DFI A;  4RGR A;  1P6R A;  1QQI A;  3N4M A;  2ESH A;  3HOS A;  4EJV A;  3WTZ A;  1J7K A;  1FC3 A;  4GYG A;  1S3J A;  2P4W A;  4DNC A;  2RDP A;  1Z7U A;  3WTY C;  5CVI A;  5K5Q A;  1WSU A;  1V3F A;  5HLH A;  1XB4 A;  5HDG A;  2QBY B;  1LEA A;  2P6T A;  2D45 A;  5HS9 A;  2ZME B;  2L54 A;  1MGT A;  2CQK A;  3ECH A;  3ZMV A;  1MD0 A;  4UVB A;  3P9K A;  2ISY A;  2M1B A;  2JRT A;  1ON1 A;  3KZY A;  1KU2 A;  4Z2Y A;  5LHI A;  1O3R A;  3COA C;  4HX4 A;  2W24 A;  4I98 B;  1R23 A;  3ECO A;  2K02 A;  4R8H A;  2DT5 A;  1UCR A;  2Q0O A;  3LST A;  1XGM A;  1ZN2 A;  3TOA A;  5E18 F;  2MLK A;  1XSD A;  1E2X A;  2E7X A;  2PMH A;  3K2Z A;  3SXY A;  3LQR A;  4YFN F;  1BC8 C;  1Z9C A;  2O61 A;  4ESJ A;  4HOB A;  3F22 A;  2MC3 A;  2K27 A;  3M9A A;  2WC2 A;  3ISP A;  3FXU A;  3KLO A;  1BIB A;  4G9Y A;  4MTD A;  4MNU A;  3F8M A;  1R36 A;  5D5X B;  5HDK A;  1TTY A;  1UHW A;  2YR2 A;  3MCZ A;  4Q48 A;  2XAS A;  2M8E A;  1X3U A;  2RC4 A;  3H92 A;  2ZKZ A;  2VC0 A;  4O3M A;  5JHU A;  2KIF A;  4P55 A;  4KMU X;  4L5J A;  1R1U A;  3RYR A;  1KU3 A;  4LB5 A;  1LDK B;  4XBF A;  1I5Z A;  5KVR A;  1R1T A;  3KE2 A;  1B1B A;  3RPU A;  4Y15 A;  5LEK A;  1UFM A;  2LNB A;  2NS0 A;  4M9X A;  2XRO A;  2EFQ A;  4AVP A;  4EVI A;  2FBI A;  4OIQ F;  3J81 K;  1AOY A;  3HRT A;  2W85 A;  3WTU C;  1ZGJ A;  1WRJ A;  1Z91 A;  2EB7 A;  4M9Z A;  5L3E A;  3WE2 A;  1IF1 A;  4XSZ F;  2M45 A;  4LG0 A;  1FZP B;  2L02 A;  1GHC A;  3ULQ B;  1FBS A;  3GYH X;  1G6N A;  4RS8 A;  2L4A A;  5EEG A;  3L00 A;  1IAW A;  3WTX C;  1SD5 A;  3EQL F;  3GWZ A;  1HW5 A;  3E5X A;  2ZNY A;  1E17 A;  3I54 A;  2MH2 A;  1U5T C;  3AAF A;  3EET A;  2ELH A;  5LGN A;  2DU9 A;  1FYL A;  1LQ1 A;  1B9M A;  3FF5 A;  5DUK A;  1LDJ A;  1YG2 A;  5E20 A;  1WI9 A;  4U0V A;  3RKY A;  6PAX A;  4ETS A;  5L3G A;  4ZZD A;  2RVC A;  4RB2 C;  1HW1 A;  1P4A A;  3WGG A;  3LAJ A; 
#chains in the Genus database with same CATH topology
 3ZQC A;  4EJO A;  2Z2S B;  4HX7 A;  2Y0S A;  1YW9 A;  2VJJ A;  2Z3Y A;  4RB0 A;  5HLI A;  2FSW A;  1QHH D;  5FJ8 J;  4JOM A;  2FA5 A;  2GXB A;  2EA4 A;  1SMY F;  3V7S A;  1RI7 A;  4L9T A;  1RIO H;  3BWG A;  1P9Q C;  1XDU A;  3OYB A;  2F5C A;  4HZF A;  2O6G E;  2R7V A;  5K5R A;  4A3I J;  1BN5 A;  1F36 A;  4F91 B;  3OSF A;  2L0K A;  1J09 A;  5DCM B;  3F9K A;  2OBP A;  1O57 A;  3MZH A;  2GIZ A;  3BTJ A;  4HG2 A;  2KDO A;  2DCE A;  4IHW A;  3G3Z A;  5LRS A;  4CXF A;  1XGN A;  3MKL A;  1U5T A;  4EMS A;  3K70 C;  1NG6 A;  2QEN A;  4CCN A;  2Y0M A;  3A1Y A;  5LGT A;  2O5R A;  1D5Y A;  2VOD A;  2DA5 A;  4RBO A;  3LSM A;  3ZCO A;  1YQA A;  4LJZ F;  2EWN A;  2CUJ A;  1OYY A;  1TQP A;  4W1U A;  1ON2 A;  2LOO A;  3BJO A;  3DPL C;  3HIF A;  3M8F A;  3LSR A;  3QWL A;  4CYC B;  1ZR4 A;  3A0H C;  3TO9 A;  4LLN A;  4I09 A;  1Z77 A;  5E3L A;  2EV5 A;  1JGS A;  2H6C A;  3MMY B;  2KQR A;  2R7W A;  1T98 A;  1S9H A;  5GPA A;  3KET A;  3C3W A;  3SDB A;  4IOA F;  1W0T A;  1LE8 A;  4KUM A;  2OC6 A;  1J59 A;  2ZXI A;  4NC6 A;  3OOP A;  3FMS A;  4Q4Z F;  2KFD A;  2DOF A;  2LLK A;  2AQF A;  2EIJ H;  2QYO A;  2VKH A;  4I2O A;  3J81 Z;  2R7U A;  5CVV A;  2IJL A;  4ZDL A;  3IC7 A;  5F04 A;  2UUZ A;  3Q5F A;  4YEL A;  1DP7 P;  1BW6 A;  2KJC A;  3S1M J;  2JUG A;  1U8R A;  5JHF A;  2BXZ A;  1BW5 A;  2HYG D;  3LSI A;  2IGN A;  3PQK A;  2W7N A;  3E6D A;  2HFH A;  2LH9 A;  5L3B A;  4AIJ A;  3ZN1 A;  5FKM A;  2HYJ A;  3RTR A;  2XRN A;  3GCM A;  1D0Y A;  3BG6 A;  3S8P A;  4ZH4 F;  2COM A;  2DQR A;  1UHM A;  1N75 A;  2V7F A;  5H6Q A;  3H35 A;  5D6F A;  3S14 J;  4BXU A;  3CCJ I;  3DKY A;  2D1H A;  2FML A;  3ZQQ A;  3LOC A;  4RGX A;  3G4S I;  2OTL I;  2PX9 A;  2STW A;  3C2H A;  1TT0 A;  1K6O A;  4Y52 J;  1QPM A;  2LDU A;  2FBK A;  2X4H A;  1Y0N A;  5KAI C;  1X1C A;  2K9M A;  4LG0 B;  3TMO A;  2RV8 A;  3T0Y A;  3BZ6 A;  4BHP A;  2NOJ B;  3L2Q A;  1G59 A;  4CHU A;  2A68 F;  2HDC A;  4LK0 F;  1JUM A;  1HST A;  2E34 A;  2NNN A;  1ETO A;  3D1N I;  2PQ8 A;  1IN6 A;  5F64 A;  1FIP A;  3FKI J;  3VYU B;  2FX0 A;  3ABT A;  1VQ4 I;  3DLL F;  3GX4 X;  1ZLK A;  3IRQ A;  1OQY A;  1GUU A;  3P9C A;  5BQT A;  4NNJ A;  3DTI A;  1R5H A;  3F23 A;  2OJE D;  1FMV A;  2CUZ A;  1AHD P;  3LA2 A;  3EDP A;  2I5U A;  3HOT A;  1XTA A;  2LBF A;  3OYI A;  4ENJ A;  2VXZ A;  2ESN A;  3OS0 A;  1I6X A;  5E1W A;  2K40 A;  3U1D A;  3ZQF A;  1IXC A;  1G4D A;  4H0E A;  1T33 A;  3KLN A;  3I56 I;  3GO5 A;  1LEB A;  1FP2 A;  5BS6 A;  2IGO A;  2V9V A;  3I71 A;  4CCO A;  3CF5 F;  3AG2 H;  2OA4 A;  3LFK A;  3OYN A;  1YHQ I;  2DFE A;  2D5V A;  2VT2 A;  5ICE A;  4HYE A;  3E7L A;  1MBE A;  2VBX A;  4KNY A;  1TWG J;  5LHH A;  4PZJ A;  3JCU C;  2LKP A;  2H8W A;  3GTO J;  3A2K A;  3NAU A;  4I02 A;  3TP0 A;  2XVC A;  5LRR A;  4L5E A;  1BR1 A;  3TO6 A;  2Z16 A;  2A69 F;  5F0C A;  2KIS A;  4X0G A;  1TWC J;  2YS9 A;  1HKS A;  4G8X A;  1K78 A;  3FBN B;  2MW8 A;  2X0L A;  5HVQ C;  1QZZ A;  5BPD A;  3F8B A;  5E1X A;  4ESB A;  2GXA A;  2XSD C;  3CDH A;  2KKO A;  3VOE A;  1ETX A;  1JJ8 C;  2K9L A;  2FE3 A;  2DA4 A;  2K5C A;  4XLP F;  2K3F A;  4D7N A;  4GFB A;  3FXL A;  3HBL A;  4ZZL A;  1BJA A;  2BXY A;  3CC4 I;  1I50 J;  2GA2 A;  5B5E C;  3O6B B;  1MW7 A;  1V54 H;  2NOG A;  2LKX A;  4BE1 A;  4G6Q A;  4A0Z A;  2P6S A;  3HDD A;  2E1N A;  1P4W A;  3JRE A;  1ZH5 A;  2LY1 A;  3I0T A;  1IUF A;  4P9F A;  1S29 A;  1QNT A;  1GLN A;  2E2J J;  3CMM A;  1MBG A;  3ERE D;  1IN4 A;  1U9N A;  3K4M A;  4L9N A;  5ED4 A;  4Y33 A;  4XN3 A;  4XLH A;  4BYY A;  2Y48 A;  3QOE A;  2QUF A;  2A61 A;  3SFZ A;  5K7Z A;  2A5W A;  2NVX J;  1U5T B;  1D5V A;  3S3O A;  3PQJ A;  2D1V A;  3G1O A;  3U2R A;  2BEO A;  4BU2 A;  4HA8 A;  2IA1 A;  3F72 A;  3JRG A;  4E6K G;  2L5Q A;  4PGH A;  2HGC A;  4U7D A;  1F9N A;  3I9V 2;  5K1Y A;  2IS6 A;  3K4J A;  1EKE A;  1K4S A;  4KYW A;  2H6B A;  4UY8 I;  2L3D A;  2LVS A;  2PFB A;  4BY1 J;  2G7H A;  4HNU A;  5IP7 J;  1Y6I A;  1I1G A;  2B9S A;  1KU9 A;  1TL8 A;  4IKF A;  4I0B A;  4N4N B;  3K4N A;  2EV6 A;  5J1Y A;  4MFD A;  3BTC A;  3OS1 A;  4KFC A;  2LG4 A;  3DBR B;  3LSJ A;  2EJR A;  1MNM C;  2ZJ2 A;  1LJ9 A;  3RSN A;  3VSL A;  5JI6 A;  3A03 A;  3K7A J;  4AD9 A;  3JTG A;  5HLG A;  3K0L A;  2F48 A;  4FT8 A;  5H20 A;  3HXL A;  5E17 F;  1LDD A;  4HW0 A;  4XRM A;  4YII A;  1N25 A;  2HZD A;  2L9N A;  4KIT B;  3GFL A;  2EZH A;  5L3D A;  5GAD J;  3ZOB A;  2DMP A;  3FIS A;  4XON A;  4YFX F;  4L0Y B;  3J7A O;  2JMW A;  3CCR I;  2JZY A;  3HKZ N;  2QWW A;  3CLQ A;  3KP6 A;  1ACI A;  4OIP F;  4OMY A;  2VQH A;  3FXK A;  1D8J A;  2GIV A;  5DEQ A;  1HOM A;  3HG9 A;  3BY6 A;  1WJF A;  5A2Q K;  3H5N A;  3W6V A;  1FWZ A;  1KON A;  3QPH A;  2R3S A;  4PFP A;  4U87 A;  1VQ9 I;  1XD7 A;  2JA6 J;  2GA1 A;  1QRY A;  2AO9 A;  4A3G J;  2HVR A;  2KIM A;  3DEW A;  4AIK A;  2DPD A;  2XPV A;  4FX4 A;  3R4K A;  2FF4 A;  2ZFU A;  3I64 A;  1C0W A;  4JYK A;  2JA2 A;  4GO1 A;  2GLO A;  2QA4 I;  1FSH A;  2YSR A;  3QU6 A;  4EM1 A;  1OIS A;  2JRM A;  4FE4 A;  3RQ4 A;  3P5J A;  1ODD A;  3C1D A;  2A6E F;  2DDA A;  3L09 A;  4CIC A;  1RUO A;  3EUA A;  1R9T J;  4HLX A;  3TW7 A;  5TJJ A;  3OV8 A;  3ZRG A;  2BHZ A;  3MZY A;  2QKM B;  3SZG A;  1QVU A;  3H0G J;  4R79 A;  2PI0 A;  3D5R C;  3NWT A;  3BQY A;  4IL6 C;  3IL2 A;  4XRS A;  2W48 A;  2NXN B;  4OOI A;  2M34 A;  2Q2E B;  1AU7 A;  3HKZ A;  3OYH A;  2BBY A;  3BPX A;  1Y39 A;  3G71 I;  2OU2 A;  2LBF B;  4NC7 A;  1O3T A;  1W5T A;  3BZK A;  3TDU C;  3K1N A;  2WV0 A;  5C4J J;  1HA8 A;  1JE8 A;  2CSO A;  5J8F A;  3LSK A;  2MH9 A;  5DUI A;  1FYM A;  3IRR A;  3CC2 I;  2IGK A;  2JN6 A;  4AVZ A;  2A6H F;  2B63 J;  3OL3 A;  5J6X A;  4E7J A;  3PFY A;  3IWZ A;  5FD5 A;  3BR2 A;  4BDZ A;  1V5G A;  4P96 A;  1FOX A;  3OMY A;  5J47 A;  4KMF A;  2CMP A;  3I4P A;  2GWR A;  3H1C A;  1UAA A;  2CU7 A;  4M73 A;  3LAJ A;  1G3Y A;  5GAH J;  3PIO F;  3RYP A;  1LB2 A;  2QQ9 A;  3BR3 A;  3LL7 A;  4IVN A;  1UZC A;  4PJM A;  1Y8Q B;  2XIG A;  4YFK F;  2EFW A;  3EUH A;  1USS A;  3CZ6 A;  4X1E A;  2WAF A;  4AIH A;  3QOD A;  2Z33 A;  4CZZ A;  4B47 A;  4CCJ A;  4KIB A;  1Z67 A;  3QP6 A;  3RPU D;  2HS5 A;  3OYC A;  3LSH A;  2KRH A;  4CO8 A;  3W6K B;  3KFW X;  3S93 A;  1TWF J;  4KIF A;  2R7T A;  4KT5 C;  5J1U A;  1ZGA A;  2MBF A;  1WWX A;  2O8X A;  2VBW A;  1W7P A;  3GLX A;  2CFX A;  4NQW A;  1VQP I;  4C3H J;  1FMW A;  2ZXH A;  5FKL A;  5LLQ A;  1S5L C;  1Z3X A;  1RRJ A;  5AIP A;  2XGE A;  1A35 A;  2AS5 F;  3Q9V A;  2Q8K A;  2VT3 A;  1G3S A;  5E3N A;  1STZ A;  4LB6 B;  1VTN C;  3Q3S A;  2O9L A;  1X2M A;  3VOD A;  2E1M C;  4JX4 A;  3VYR B;  1MBF A;  3CCL I;  2LYC A;  1ETV A;  2M4G A;  2AXT C;  2XF7 A;  2VON A;  5KAF C;  3L2C A;  2DPU A;  2QZ8 A;  1GXP A;  4XK4 A;  1GV2 A;  2HOA A;  2VC1 A;  3U1K A;  3JSP A;  4HNV A;  1QZY A;  3DFG A;  5AON A;  3ZR8 X;  4ZYH A;  2V26 A;  3HTS B;  2DOD A;  3CLO A;  5DD8 A;  5BPI A;  3T5X A;  5TGT A;  2DOE A;  5C44 J;  1BL0 A;  3QAH A;  2ICW G;  3OR1 C;  5B1B H;  4V19 K;  3CES A;  1VQ7 I;  1YX5 A;  4JK1 X;  5F08 A;  2VBY A;  1TZL A;  5M3M J;  2IA0 A;  2JA5 J;  3M8J A;  1OR7 C;  2GAU A;  4UB8 C;  5E8I A;  4EM2 A;  4GYI A;  3ASO H;  2MFZ A;  4FET A;  4NUB A;  1O7F A;  2DTR A;  2DMT A;  3V7C A;  5FB2 A;  5L3F A;  4NHJ A;  3JRA A;  3RZD J;  1YYV A;  2LFB A;  3JRI A;  5A2Q Z;  3I3L A;  3G1L A;  2KL4 A;  2XAU A;  5B3S H;  1EH6 A;  3UKG A;  2CQN A;  2GQQ A;  3FBI B;  4H4K C;  4M3G A;  1X58 A;  3CO7 C;  2HXI A;  4V2F A;  3HRM A;  4DIQ A;  4UVA A;  4CH7 A;  1KZH A;  2IVM A;  5ICC A;  3BR0 A;  3V8J A;  3PO2 J;  2VBZ A;  2M2E A;  2OV7 A;  4UVC A;  2CUF A;  5D5U B;  3JRC A;  3GTM J;  3S2H J;  1R22 A;  2F5D A;  4ASN A;  3ZQ7 A;  2DW4 A;  3OYK A;  4PK4 A;  5D4S A;  1O7L A;  2XSJ C;  1WJ5 A;  1ULY A;  2V9K A;  3BG5 A;  4LK1 F;  2EFO A;  4O6J A;  4E7H A;  5LFA A;  1S7A A;  4ZYG A;  2HKO A;  1YJW I;  2HVS A;  3CUO A;  1FOW A;  2Y75 A;  3CMY A;  4UUS A;  1MBH A;  1TW3 A;  1RET A;  1FOY A;  1OCR H;  3PL8 A;  2W1O A;  2PBI A;  1J75 A;  1KYW A;  2LRE A;  3KP7 A;  3V8K A;  2ZBK A;  2KPM A;  3ABK H;  3KP5 A;  2F5E A;  3J7Y J;  4XL9 A;  2BY1 A;  4MGR A;  2ZJP F;  5IOZ A;  2HXO A;  2L01 A;  4RMN A;  2OAZ A;  5JR3 A;  5LEJ A;  3SZT A;  1DP3 A;  4R1H A;  4JX5 A;  3R6S A;  1JKO C;  1XG1 A;  1SD7 A;  3C18 A;  5EEA A;  2ACJ A;  2NS7 A;  2Y2Z A;  1FOK A;  3S2D J;  4XQF A;  5ILV A;  3H3U A;  4G6D A;  3EYI A;  1CF7 A;  1ZAO A;  5HNH A;  2UZK A;  1VQO I;  3H3Z A;  5L3C A;  2OF7 A;  1IW7 F;  3FMQ A;  1OR7 A;  4F3Q A;  3OOU A;  2R5Y A;  3C7J A;  1IDZ A;  3DF8 A;  3ZMU A;  3PSI A;  4EEF G;  1X3Z B;  3OYM A;  4XKW A;  4S0H B;  2X9D A;  2F4M B;  2JT1 A;  4BJ6 C;  4Z6Y A;  5F1R A;  4KN7 X;  3K10 A;  3OYA A;  3WHC A;  5TIS C;  4ITV A;  1J5Y A;  4U0W A;  1LPQ A;  1K79 A;  1FNN A;  3K4C A;  1MJA A;  4RLQ A;  1JKQ C;  2ISZ A;  3FMR A;  2OTJ I;  2OQG A;  2Y69 H;  1WJC A;  1IO2 A;  4FQG A;  1X3W B;  2AHQ A;  2MD0 A;  3CJQ B;  3E6B A;  5FLV A;  3B6C A;  4DYR A;  3DEU A;  2JSC A;  2P5V A;  4BH9 A;  4CGZ A;  1IC8 A;  4BL0 B;  4D1Q A;  2M8G X;  1Y1V J;  2VKE A;  1T2K A;  1BBY A;  3T8R A;  4UNO A;  2VPL A;  4BDY A;  5GTH C;  4HSR A;  4KA4 A;  3E6M A;  5CPR B;  3A01 A;  4B8X A;  4A2U A;  5IP6 A;  3CO6 C;  1Z05 A;  1RUN A;  1J0R A;  3F8N A;  1APL C;  2BY2 A;  4B44 A;  1IN5 A;  2EFN A;  3ZMT A;  1MZB A;  4WCG A;  1YIJ I;  4HBL A;  1P4X A;  1S7E A;  2XAG A;  3SYT A;  4Y13 A;  3ABL H;  1H88 C;  4C9Y A;  4KIC A;  2OCC H;  1V5F A;  5F6F A;  3RKQ A;  3L2W A;  1R4N B;  2X1D A;  3ZMZ A;  3HM5 A;  2A05 A;  2H8R A;  1W7P B;  2VB6 A;  4NQW B;  1ZAR A;  1HLV A;  3HJE A;  2P5K A;  1X2N A;  3FK6 A;  3KZZ A;  4YG2 F;  2J5O A;  3MZ8 A;  1ZG5 A;  3E5Q A;  3ZQL A;  1YLF A;  4BS9 A;  1T56 A;  2QSH X;  1U2W A;  3FXR A;  3K70 D;  4LG3 A;  5J1R A;  5M5W J;  1SFO J;  3NQO A;  2H27 A;  3S17 J;  2VOP A;  2W82 A;  1BM9 A;  5D6E A;  2V4J C;  1S72 I;  3LSP A;  2QSF X;  4QTR A;  1VFC A;  3K4B A;  1Z1D A;  3KYC B;  4YIF A;  1VZ0 A;  3AKZ A;  3VPR A;  5IYB J;  3AG4 H;  3MQ0 A;  3ZGK A;  2WAD A;  2EBI A;  4IPA A;  4A12 A;  1HKQ A;  3V42 A;  1OCZ H;  2COB A;  2DDB A;  5M5X J;  4QIW N;  3UNG C;  2IS1 A;  1S6L A;  4U88 A;  1ZHF A;  5CYV A;  1WCM J;  4MHG A;  4CDG A;  1ZGW A;  3JRD A;  4LFU A;  1T39 A;  2P5L C;  4LLG F;  3KCC A;  1MDM A;  3M1C A;  2ZSI B;  2DMN A;  3DPU A;  3MEX A;  5E3O A;  4N9H A;  4ZYD A;  3W3C A;  1KQ8 A;  5IYC J;  2HKX A;  2XHK A;  4IRG A;  3L7W A;  2O0Y A;  5FFX A;  2L7K A;  3F6V A;  2WWY A;  2XAQ A;  2H1K A;  2KZV A;  3TW6 A;  4HAM A;  4D7M A;  3A4C A;  1QZE A;  2QVO A;  2ME6 A;  2OD5 A;  1ZR2 A;  2ZC2 A;  2Q1Z B;  5FKK A;  1ZLJ A;  2KZG A;  3F3X A;  5IT9 K;  5BOX A;  2ZNZ A;  5H6R A;  4ENK A;  2L9V A;  2M0C A;  3NRV A;  4IJA A;  1D3Y A;  4G94 A;  3KYL A;  2ZJQ F;  2NS8 A;  3KIO A;  1ZRE A;  1R58 A;  4RAF A;  1ORK A;  5E1Z B;  4G7O F;  3S15 J;  5FLX K;  2WB1 N;  1YX3 A;  2PJP A;  3D5L A;  4XLC A;  2V6E A;  2L9S A;  4LMY A;  5FFZ A;  3ZQG A;  3LSG A;  1DDN A;  3BOQ A;  1OYW A;  4YRV A;  2CYY A;  4IQJ A;  3Q9S A;  4MIM A;  2E1O A;  3WG9 A;  4BUP A;  4ZJZ A;  1SFE A;  4AID A;  3QU3 A;  1YIT I;  3JSO A;  3SHF A;  2E1M B;  1OMI A;  3EYY A;  1RR8 C;  2HYF A;  4J01 A;  1K4T A;  1MMD A;  4BEH A;  4HRI A;  3JR9 A;  4IHV A;  2CG4 A;  1OPC A;  4UUS B;  1BA5 A;  1ETY A;  2HR3 A;  4G7Z F;  2R7D A;  4HPQ A;  2TDX A;  4EAT A;  1F1Z A;  3PJR A;  5EZH A;  2UXN A;  4LIV A;  4W97 A;  1U78 A;  3AFH A;  1CGP A;  1A5J A;  3BR5 A;  3JAM K;  4U7B A;  3S3N A;  2ZFW A;  1ZKG A;  3TGN A;  1MH4 A;  5FGM A;  2HQN A;  3FZV A;  1Y1W J;  1FBQ A;  4XOR A;  3IHU A;  5HDN A;  2QF7 A;  2NNY A;  2M30 A;  3KZI C;  3SDG A;  3T8T A;  2DXI A;  2WAQ N;  1CF7 B;  1YFH A;  1H9T A;  1OYI A;  4A0Y A;  1PP7 U;  2M9H A;  2EIK H;  2WB1 A;  3WU1 B;  2R5Y B;  3JTH A;  4M6Y A;  2EIN H;  4AC0 A;  1IGN A;  2FOW A;  3NAR A;  2JTV A;  3PO3 J;  2ID3 A;  2WAE A;  2NVU B;  1MH3 A;  2X6Y A;  2NVQ J;  3A0B C;  5FRM A;  2PEX A;  2L7F P;  4FE7 A;  2K9S A;  3MAJ A;  2DTZ A;  3B02 A;  3ERM A;  2DMQ A;  1CQT A;  3E6C C;  3PSF A;  1JT0 A;  3MKY B;  1PUF A;  2YX4 A;  4HQE A;  1LVA A;  4O5V A;  1J2X A;  4D5F A;  3RIR A;  4PJ0 C;  2VL8 A;  5IY5 H;  4HLY A;  3ROU A;  1HDP A;  3G2B A;  1POG A;  2M0M A;  2I10 A;  5K5O A;  1XGO A;  2DJN A;  2PMZ N;  3HRU A;  2R7Z J;  3V4G A;  3MWM A;  4GGG A;  2BY3 A;  4MFE A;  4LGW A;  4BE0 A;  4HV5 A;  5JVT A;  2Z9O A;  3QOP A;  3BJA A;  4RLF A;  1H89 C;  2QSG X;  2DK5 A;  5ERI A;  1QBJ A;  2BVM A;  1YW8 A;  1MNE A;  1IN8 A;  4LLL A;  1TW2 A;  1F43 A;  4ZC3 A;  3FM5 A;  3A01 B;  3L1P A;  2KIU A;  4EJW A;  2H1L A;  1XMA A;  3CP2 A;  2R7F A;  1X1B A;  2CV1 A;  1S8N A;  3CJR B;  1H8A C;  2V6C A;  2V1N A;  2E7W A;  2G9W A;  2HTS A;  2WAQ A;  2V79 A;  4JP0 A;  1X4P A;  4ZDP A;  4A3F J;  2VE9 A;  1U3E M;  2BVL A;  1E3H A;  1MSE C;  4Y3O A;  2CW7 A;  3PNY A;  2L9R A;  3HSF A;  4L9J A;  1REP C;  3LQQ A;  3W2W A;  2Y31 A;  1DQU A;  1GVD A;  5DV5 A;  1TNS A;  5HLT A;  4L9V A;  1XCB A;  1LKX A;  5J3L A;  4CCM A;  5EG0 A;  2VKD A;  3H3V K;  2IPQ X;  2XAJ A;  3G1M A;  1DGW Y;  3GTG J;  4RB3 C;  5D5W B;  2KJB A;  1IG7 A;  4WX9 A;  3BDD A;  5K7H A;  4B3X A;  5GAG J;  3RI4 A;  2EK5 A;  2STT A;  4HNT A;  1U6G A;  3R60 A;  3RCO A;  2O8K A;  4GCV A;  2PLY A;  4PSX A;  2FQ4 A;  2BOL A;  3FIW A;  2XKO A;  2P81 A;  1ZRF A;  2PMZ A;  1LE8 B;  2HOT A;  2JQ7 A;  2D2W A;  4G12 A;  2OPT A;  3I53 A;  2GOX B;  2A07 F;  1WQ2 A;  4AUX A;  4A5N A;  4CZC A;  1FBU A;  1ONV A;  2EV0 A;  2QQB A;  3TOB A;  3ELK A;  3LNQ A;  5IT9 Z;  3BTL A;  3BG9 A;  9ANT A;  4IO9 F;  2IS2 A;  3C2B A;  1FYK A;  2PJR A;  4FX0 A;  4A3B J;  3BP8 A;  3AG3 H;  4B4C A;  1MDM B;  3WTW C;  4OAZ A;  3RPQ A;  3GW2 A;  1IRX A;  2XF5 A;  4BQN A;  5FLX Z;  4J00 A;  1LFU P;  4HF0 A;  5CQG A;  1Z6T A;  4RAY A;  4Y17 A;  2JA8 J;  3M8E A;  2ECB A;  2NVT J;  2DT7 B;  4F92 B;  5CJ9 A;  4C2U A;  1SAU A;  3DBH B;  3FX3 A;  1EJ9 A;  5GAE J;  4LIT A;  2H09 A;  3N05 A;  2FBH A;  3GFM A;  2JUC A;  5D8K B;  4I0A A;  3CUQ C;  3W6J B;  5E79 C;  3CP8 A;  3EUH C;  3HHG A;  1IDY A;  1MMA A;  3CME I;  1KQ9 A;  2VQG A;  2OZU A;  3L2U A;  1O3S A;  3GF2 A;  2CS3 A;  4ZYE A;  3WTS C;  4L18 B;  4WXD A;  5ICG A;  1FP1 D;  2LSO A;  1BI0 A;  5EF6 A;  3K1M A;  4BKX A;  3LWF A;  1A04 A;  4OIN F;  4NB5 A;  1EH7 A;  3JW4 A;  4GRI A;  1DPU A;  3R0A A;  2WTE A;  3BPV A;  1ETW A;  2FRH A;  5FD6 A;  3JAM Z;  2YX7 A;  3J7Z I;  1MJ9 A;  1SFX A;  2CV2 A;  1ZRC A;  2GBY A;  2M3A A;  3GZ6 A;  1T8I A;  1YJN I;  1J9I A;  1X1D A;  2BW3 A;  2C6Y A;  2XB5 A;  5HNF A;  2QEX I;  4B09 A;  5CVR A;  1K83 J;  3F0C A;  5GP9 A;  5JVG F;  2VIX A;  4BEH B;  4M6X A;  1W7P D;  2O7O A;  4XRF A;  2XB0 X;  5FLM J;  2JK3 A;  2DFF A;  4DBR A;  3OY9 A;  1BR4 A;  1X1P A;  2N8G A;  1TC3 C;  3MVP A;  1W1W E;  4KDP A;  4BGD A;  4JQF A;  4M6V A;  2HI3 A;  1HQC A;  4IHT A;  4EQQ A;  2WV1 A;  3E5U A;  1LVK A;  1WH5 A;  1T95 A;  3IKT A;  3AG1 H;  4K2E A;  4P9U A;  3K4K A;  3IH3 A;  4DYQ A;  3GTJ J;  2KRC A;  1F4K A;  4LD5 A;  1VQK I;  1B8I A;  2BYV E;  3FXM A;  2E71 A;  3K69 A;  5KNL A;  2MAB A;  3WE3 A;  1I3A A;  5HOO A;  2CGP A;  1UG2 A;  3HSE A;  3IH4 A;  3OYE A;  2XPU A;  3OIP A;  2BGC A;  1JJ6 C;  4WXC A;  1Q1V A;  1YE9 A;  3HYI A;  1K6Y A;  1LFP A;  3CQZ J;  3CUQ A;  3O8H A;  4X6A J;  4UV8 A;  3CDL A;  1M1E B;  1P92 A;  1MKM A;  1WFX A;  1R6R A;  4MQ9 F;  5F0F A;  2ZO4 A;  2RQQ A;  1BOB A;  1I1S A;  2V1X A;  1PUF B;  2FUG 2;  3VB2 A;  4A5M A;  1K78 B;  2RAE A;  1JUP A;  2E2H J;  2UWM A;  1I6H J;  2CW8 A;  3J80 K;  3E97 A;  2F2E A;  1UHS A;  3ML6 A;  4BBS J;  2LK2 A;  1TP4 A;  1IZ1 A;  3HGG A;  3HZJ A;  2IRF G;  3E1S A;  2X51 A;  4B3A A;  1IRF A;  1E3O C;  1Y0U A;  3R0J A;  3OYG A;  4MQV A;  4A3E J;  3FWE A;  2MGQ A;  3OS2 A;  2V1D A;  3FHZ A;  1PDN C;  5C3E J;  4CCK A;  3BJ6 A;  3PUF A;  3CCM I;  2L4M A;  4UB6 C;  1OCP A;  3WGH A;  4EV0 A;  1IRZ A;  4M3F A;  5DCM A;  4HDV A;  1R1V A;  1R4M B;  1AWC A;  2E19 A;  5EEH A;  3H36 A;  3HUG A;  2FXA A;  1AKH A;  1BI2 A;  4A3M J;  1HF0 A;  3WTV C;  5FRN A;  2XGC A;  4IOC F;  1W5S A;  1G3T A;  4M72 A;  2VOO A;  1SVM A;  4TV7 A;  1WJD A;  4A6D A;  1R71 A;  1B72 A;  3ASN H;  2ETH A;  3H5A A;  3OYJ A;  1YRN A;  1HW2 A;  1FIA A;  2G0E A;  4OAY A;  2H94 A;  2WY7 Q;  3FK7 A;  3REO A;  3ZMD A;  4FCY A;  1FLI A;  1N77 A;  2E1C A;  4UUT A;  3GFJ A;  3S1Q J;  2DBB A;  2R7X A;  2LP0 A;  1PYV A;  5EG0 B;  3A02 A;  1R5I D;  1LNW A;  4FHT A;  2XUB A;  3RKX A;  4E7L A;  3PFI A;  2A6T A;  1SMT A;  3L9F A;  5C4X J;  4ENN A;  4C2T A;  3I4M J;  2F5V A;  1X1A A;  3DEE A;  3I5U A;  4KIG A;  1TBX A;  3U9G A;  1BIA A;  3LA3 A;  4JBA A;  4C3J J;  2E60 A;  1ZQ3 P;  2ID6 A;  2FU4 A;  2ZXJ A;  1A31 A;  3FM3 A;  5FO5 A;  4HDU A;  5BMZ A;  2CWE A;  2CQ7 A;  2M5W A;  3PIP F;  4P5O A;  2AQE A;  4IX7 A;  1XCV A;  1NH3 A;  5IP9 J;  3KP4 A;  4JX6 A;  4MEY F;  1VF9 A;  1QHG A;  4A6E A;  2CJJ A;  5CLS A;  4DQ2 A;  3F6O A;  2MA3 A;  1PP8 F;  1VQN I;  4WWC A;  1SAX A;  3WU0 A;  2PJR B;  2FEZ A;  4QPO A;  3MKZ A;  4FIS A;  5JFR A;  2DYR H;  1P7I A;  2DQL A;  1L0O C;  3D5S C;  3N97 A;  4IHY A;  4GXO A;  3WU2 C;  1SD6 A;  5IT3 A;  1JKP C;  4RB1 A;  2ZCW A;  5AIQ A;  3FXO A;  3J7A Y;  4UHT A;  2HEO A;  2B0L A;  5GTI C;  4UUV A;  3S2W A;  3VEP A;  2E35 A;  4XIC A;  4HQM A;  2WBM A;  3E0J B;  1JTY A;  2CUE A;  2CRG A;  2IXS A;  2OCE A;  2EZL A;  5CVU A;  3GFI A;  4EJU A;  3ONQ A;  3WHB A;  1IUY A;  5KHD A;  2LD5 A;  3DQV C;  3HHH A;  2FOK A;  4ZYA A;  2QLZ A;  2F6C A;  4Q5S F;  1KQ0 A;  3HPG A;  2F4O B;  1FTT A;  1WGX A;  3ABU A;  4C3I J;  2CO5 A;  4E7S A;  5LHG A;  4A0X A;  2XAH A;  4AYB N;  1B4A A;  5HOD A;  4A3J J;  3OIO A;  5ILU A;  1VQM I;  4OWR B;  2BW3 B;  4MEX F;  2K9Q A;  4FAS D;  1KA8 A;  4J19 A;  1U0J A;  3QRF F;  3H9J A;  5ICF A;  2K85 A;  2YPR A;  1VQ8 I;  1IRG A;  1RNL A;  4EGY A;  1YS7 A;  1DGR M;  4FTH A;  1JT6 A;  4PGG A;  1N78 A;  1HDD C;  3B73 A;  3GTK J;  1Q1H A;  3QP5 A;  1NK3 P;  1JUS A;  2PG4 A;  4KJZ A;  5K7F A;  1TT5 B;  3JRH A;  3EPZ A;  1TQM A;  2R93 J;  1WKM A;  1ZK8 A;  3I59 A;  2VUM J;  2VAS A;  3BQZ A;  1HKT A;  4IRH A;  2BE5 F;  3KEY A;  4PJJ A;  1DPR A;  4IF4 A;  2MD5 A;  5DTD A;  4KT6 A;  5F27 A;  1TWA J;  1NHA A;  1XDS A;  2J5P A;  5EGO A;  3J80 Z;  1NG7 A;  2DA2 A;  3BZC A;  1B8I B;  3DPT A;  4L5I A;  2M7B A;  1MMG A;  4PFO A;  4YEJ A;  4D0P A;  1EH8 A;  2JVH A;  1W36 C;  4HF1 A;  2PN6 A;  1VQL I;  2MC4 A;  4EJT A;  3K9T A;  2BHY A;  1KGS A;  2BY0 A;  2NYX A;  3CUQ B;  3O3K A;  1ZG1 A;  2A3S A;  1YTY A;  1WJA A;  5JLW A;  4AYB A;  2DA1 A;  2Y9Z A;  3FXQ A;  3K4L A;  2R5Z A;  1R49 A;  3G73 A;  3CCQ I;  1BI1 A;  1JHF A;  2HZT A;  1W0U A;  3NWS A;  3SQN A;  2HTJ A;  2JPC A;  1FPQ A;  3CF2 A;  4DZJ A;  1B59 A;  2KHM A;  5CQE A;  4BQQ A;  3VFZ A;  5KK1 A;  4G7H F;  3LA7 A;  2ELJ A;  4KN4 X;  3WTT C;  1F5T A;  1MBK A;  2DN0 A;  2KMU A;  1H0M A;  4E7K A;  2DLL A;  3KYD B;  1IN7 A;  5LBQ A;  3SFI A;  1IXS B;  1L3L A;  4LIU A;  1H9G A;  5CVJ A;  3IWF A;  3S16 J;  2Z99 A;  4WK8 F;  2VJI A;  3M7G A;  3QYB A;  3OYL A;  1BC7 C;  2BZT A;  2FNP A;  4GDF A;  1D1A A;  1G3W A;  4S05 A;  3D0S A;  1S7O A;  2OZ6 A;  4RGU A;  2JPB A;  3HUG B;  2Z1D A;  2FQ3 A;  1AKH B;  2M87 A;  1T6S A;  2LR8 A;  3DKW A;  1FX7 A;  5D8L B;  2EQR A;  3GTP J;  1ZTR A;  2A5Y B;  3OIQ A;  2ZME C;  3P7N A;  2W25 A;  1UJ8 A;  3LAP A;  2KLO A;  1B72 B;  3T1B A;  3ESW B;  1FY7 A;  2HOE A;  4BQA A;  1YRN B;  4DW6 A;  2ELK A;  2DYS H;  3S1R J;  2RKH A;  2R92 J;  2DI3 A;  3HOX J;  3LMM A;  4XM3 A;  4C30 A;  1ETK A;  3NEU A;  3WOD F;  1B9N A;  1RZ4 A;  3HC7 A;  3HEF A;  1W4M A;  2LF7 A;  3BG7 A;  3GVA A;  2XKP A;  4MTE A;  5LGU A;  2DT6 A;  2GZW A;  4HEA 2;  3Q0V A;  1E3P A;  1JXS A;  4BHC A;  3R61 A;  2KP6 A;  4DOZ A;  1Z3Y A;  4RGS A;  2QM3 A;  1BR2 A;  2ADU A;  2LF8 A;  2NVY J;  2VPR A;  4NC8 A;  5J8C A;  5TRD A;  2E2I J;  2XDV A;  2IP2 A;  2FNA A;  4AWX B;  2P7C B;  2W00 A;  1SFU A;  1BJZ A;  5HS8 A;  3E3V A;  2E36 A;  4G6T B;  1EF4 A;  3MFK A;  4PUS A;  5DM6 F;  2DO7 A;  3KP2 A;  2AXL A;  3TBI A;  4CUG A;  1JGG A;  2K9N A;  1RKT A;  4BJ5 C;  2X48 A;  2L7M P;  2ME0 A;  4OMZ A;  3CCE I;  5DS9 A;  2NRA C;  3F8F A;  4I7H A;  3GZ5 A;  4OIO F;  4ZDO A;  2HQR A;  2K4B A;  4DZP A;  2X1E A;  2RGV A;  1OJL A;  2LKS A;  4XLN F;  2K86 A;  3KEO A;  4ESF A;  4N0B A;  1EV7 A;  1HBX G;  1I27 A;  1SD4 A;  3L2R A;  1UMQ A;  3IKV A;  3ZPL A;  2JJ7 A;  3VDX A;  3H9Q A;  1P2F A;  1KU7 A;  3S1N J;  3ZMS A;  5D4R A;  1IV8 A;  5DYM A;  1MSF C;  1T0F C;  4PDK A;  4UV9 A;  3H9G A;  1PUE E;  2YU3 A;  3BRO A;  1OFC X;  2UXX A;  4LOC A;  1K7A A;  2HQ5 A;  4XKB A;  2P8T A;  1OCC H;  2JWT A;  4I6Z A;  3M3Y J;  2QGU A;  4BQO A;  2RQP A;  2QBY A;  4M71 A;  2ZJR F;  4A3K J;  2DFH A;  1FT9 A;  2ZME A;  2OQR A;  4M3E A;  4QWQ A;  1QVT A;  3OSG A;  1ZEL A;  2K7L A;  4XOT A;  2K4J A;  3HOU J;  2E5N A;  2DMU A;  1XN7 A;  1O3Q A;  2IS4 A;  4U0Y A;  4N9I A;  1XMX A;  3CC7 I;  1D1B A;  4EGZ A;  3HSR A;  1XMK A;  2W57 A;  3DTK A;  4QSH A;  2CQX A;  1R5G A;  2IA2 A;  4XLF A;  1XSX A;  3M1E A;  3F21 A;  2RN7 A;  2HPM A;  2CW0 F;  2QKL B;  3U21 A;  2FMY A;  3I58 A;  4QPQ A;  5E3M A;  3WGI A;  4V2G A;  5CKT A;  4ENM A;  2VN2 A;  3ZQH A;  1KYZ A;  2V9P A;  4HF2 A;  2Q2E A;  1UB9 A;  2O03 A;  4UXN A;  3RJP A;  2GOM A;  3B6A A;  2XRL A;  1JTX A;  2V1U A;  2M7A A;  2MYS A;  3QPT A;  2XAF A;  5DD4 A;  1UST A;  2DA7 A;  3GME A;  3GEZ A;  1G8X A;  3CJN A;  2IBD A;  1BI3 A;  4MO7 A;  2XV4 S;  4OU0 A;  4XKC A;  1GDT A;  3V8L A;  5GPC A;  3DP7 A;  4BAY A;  4XLE A;  1TNT A;  1WHU A;  5J4Y A;  2IW5 A;  3CDI A;  4II2 A;  1R7J A;  1ZYR F;  3V7R A;  3HPH A;  3I59 B;  1GXQ A;  1JKR C;  1PVE A;  3ZN0 A;  5F0H A;  3AL0 C;  4OIR F;  3CCS I;  3GBG A;  2K3P A;  4WF2 A;  1GVJ A;  1QO0 D;  3RKW A;  3OL4 A;  3TDZ C;  1XSV A;  2O3F A;  1RPW A;  2Y9Y A;  1A36 A;  2VE8 A;  3OYF A;  4PCQ A;  4Q47 A;  4ON0 A;  4M9S A;  3RDI A;  3X2Q H;  5EGO B;  1TQI A;  3GXO A;  1U8B A;  3IAS 2;  1Z7L A;  3O8G A;  5EDN A;  1T0F A;  4A93 J;  3VWB A;  1YS6 A;  4RAG A;  4L0Z B;  4F7Z A;  1OKR A;  2XGD A;  5IOY A;  3DV8 A;  4B48 A;  5DDG A;  3QPL A;  1OCT C;  2NAZ A;  1B6A A;  3M4O J;  2X6X A;  4IEJ A;  4ABZ A;  2VLA A;  3ZQI A;  1G2H A;  4BNC A;  4NBQ A;  4E70 A;  2HWV A;  3BLY A;  1MIJ A;  1V55 H;  2R5Z B;  3DU6 A;  2EZK A;  1D0X A;  2X1C A;  3KEQ A;  2DAO A;  5M3F J;  4I01 A;  3HTU A;  1ZG3 A;  2RNG A;  3F8C A;  5D5V B;  3IP4 B;  3MKW B;  1P7J A;  1HXD A;  1XC5 A;  3HRS A;  4BHB A;  1MJB A;  2DJI A;  2M4K A;  2MG4 A;  2QQA A;  2MLG A;  2EA2 A;  2P7V B;  3TQN A;  4IHS A;  4IHX A;  3W2V A;  5LD2 C;  1R00 A;  2EPF A;  3K1P A;  3CCV I;  1A6I A;  1IJW C;  4D9J A;  2VQC A;  2XGX A;  4YIR X;  1LUJ B;  4BE2 A;  1VND A;  1D0Z A;  2EFP A;  1T38 A;  3CTA A;  1QGP A;  2ZXW H;  2KT0 A;  2EIL H;  4WXH A;  1K61 A;  1ZRD A;  5DCF A;  1MBJ A;  3P9I A;  4S04 A;  3GUD A;  3O2P E;  3BCB A;  4IXA A;  4IRI A;  3DXJ F;  1TLH B;  2XPW A;  2GXG A;  1D8K A;  3OWT A;  5ILS A;  3QYE A;  1Z6R A;  4PJN A;  5EYR A;  4A3C J;  4M74 A;  4CCL A;  3TKY A;  3BG3 A;  2WY8 Q;  2VXD A;  2LMD A;  4RAZ A;  4DJA A;  1HC8 A;  3ZP5 A;  3OR2 C;  3TO7 A;  4DYC A;  4KIS A;  1FSE A;  3HOZ J;  4EM0 B;  1IXR C;  4HV6 A;  2IT0 A;  2W84 A;  2E5Z A;  3KP3 A;  4NDL A;  5FKN A;  4CYD A;  5HS7 A;  4XNF A;  4IZZ A;  3GTQ J;  4XMY A;  2F5F A;  2HNH A;  3SJM A;  1HSJ A;  2BV6 A;  3SZP A;  3L2V A;  1ETQ A;  1V4R A;  5E8G A;  1YO5 C;  1Y56 A;  3CCY A;  2G7U A;  1JHH A;  2EZI A;  1VQ5 I;  4IQ4 A;  2LC2 A;  1X19 A;  2PMU A;  1XGS A;  4DGW B;  4XLA A;  3IUO A;  2KRF A;  3JRB A;  4ZTJ A;  4XSX F;  1RC9 A;  2Z5U A;  3HOW J;  1BOA A;  3QPS A;  2DK8 A;  5H2F C;  1IV6 A;  3HOV J;  3CMA I;  4HX8 A;  2RNJ A;  1DUX C;  1VI0 A;  2X6O A;  2VJ5 A;  2ZSH B;  5DM7 F;  1YW7 A;  4QLC U;  4PJL A;  2DFI A;  4RGR A;  3PNT A;  1P6R A;  1QQI A;  3N4M A;  2ESH A;  3HOS A;  3QQA A;  2R7R A;  4EJV A;  3WTZ A;  1J7K A;  1SVL A;  1FC3 A;  4GYG A;  1S3J A;  2P4W A;  4DNC A;  2XF6 A;  1DU0 A;  2RDP A;  4BBR J;  1V5E A;  1Z7U A;  4XR6 A;  3WTY C;  3H0D A;  1ITY A;  5CVI A;  5K5Q A;  1WSU A;  1V3F A;  5HLH A;  1XB4 A;  2QQ8 A;  2WA0 A;  1RR7 A;  5HDG A;  4Y7N J;  2JVG A;  2QBY B;  1LEA A;  2P6T A;  1O4X A;  2D45 A;  2W4S A;  5HS9 A;  2ZME B;  4Y4R A;  4N4O B;  1AA7 A;  5FRO A;  3OYD A;  2L54 A;  1MGT A;  2CQK A;  3ECH A;  3TL4 X;  3ZMV A;  3TP3 A;  1ENH A;  2HOS A;  2ECC A;  1OLT A;  1MD0 A;  4RM2 A;  2LY2 A;  4UVB A;  4F52 A;  2FD5 A;  2GM4 A;  3P9K A;  2ISY A;  2M1B A;  2JRT A;  3DBL B;  1ON1 A;  3KZY A;  1KU2 A;  1VQ6 I;  2R7S A;  4Z2Y A;  1WH7 A;  3BR1 A;  4CA0 A;  5LHI A;  4D5C A;  1O3R A;  3VSK A;  3BT9 A;  4P1W A;  1TWH J;  3COA C;  4HX4 A;  3ZXS A;  3IAM 2;  2W24 A;  5J4V A;  3FDY A;  4I98 B;  3K2A A;  1R23 A;  3PNV A;  3ECO A;  3W2A A;  2K02 A;  1SEU A;  4R8H A;  2DT5 A;  4F55 A;  3HB9 A;  3KX2 A;  1UCR A;  2Q0O A;  2B7E A;  3LST A;  4AU7 A;  2VQL A;  1XGM A;  1ZN2 A;  3IV5 A;  3TOA A;  1T08 B;  2VKV A;  2MLK A;  5B1A H;  5E18 F;  2HPI A;  2DOA A;  2LTP A;  1XSD A;  1E2X A;  1QPI A;  2E7X A;  1QA6 A;  1UG0 A;  1FTZ A;  2PMH A;  3K2Z A;  3SXY A;  2KDZ A;  3LQR A;  1WPK A;  2VJ4 A;  4YFN F;  3I55 I;  3KPH A;  1BC8 C;  1Z9C A;  3DKX A;  2FJ1 A;  2O61 A;  4HST A;  1YI2 I;  4ESJ A;  3HOY J;  4HOB A;  1NTC A;  5EJC A;  5IYD J;  3CD6 I;  3F22 A;  1WI3 A;  2X85 A;  2MC3 A;  1W5C C;  3ABM H;  5BNG A;  4A3L J;  1SC7 A;  2K27 A;  3HGY A;  1E0E A;  2HDW A;  3CCU I;  1MMS A;  4XRS G;  3M9A A;  4A69 C;  2WC2 A;  3FKJ A;  4A3D J;  3ISP A;  1A6Q A;  4RA2 A;  4BAC A;  3FXU A;  3KLO A;  3SEZ A;  1GT0 C;  4ANJ A;  1BIB A;  4G9Y A;  4MTD A;  4AM3 A;  4MNU A;  2CQQ A;  2LY9 A;  1SAN A;  3F8M A;  1R36 A;  1DU6 A;  2YUS A;  3RZO J;  1WJE A;  5D5X B;  5HDK A;  2L2O A;  5EZG A;  1TTY A;  1UHW A;  2TCT A;  2YR2 A;  3MCZ A;  4Q48 A;  3PUB A;  1FEX A;  2XAS A;  2M8E A;  1X3U A;  4CYC A;  3S32 A;  3M07 A;  3UR3 C;  3VYT B;  4C2M J;  1GV5 A;  2RC4 A;  3H92 A;  1XX5 A;  2EH3 A;  2KIQ A;  2VI6 A;  2ZKZ A;  1SFK A;  2VC0 A;  4O3M A;  2Y30 A;  5JHU A;  2KIF A;  4P55 A;  4XKV A;  3H5R A;  4KMU X;  3FXJ A;  2RRE A;  4L5J A;  4RM3 A;  1R1U A;  4E7I A;  4ZTF A;  3RYR A;  1WVR A;  1KU3 A;  4LB5 A;  1LDK B;  5F1J A;  2F4I A;  1I5Z A;  4XBF A;  4XOP A;  1UEL B;  5KVR A;  3C2G A;  1WJB A;  1I39 A;  4F93 B;  1R1T A;  1U9O A;  3AL0 B;  3KE2 A;  2L7Z A;  2HQA A;  5B66 C;  4CSW A;  4MLO A;  1PJR A;  4RDU A;  2XC7 A;  1B1B A;  3RPU A;  4I99 C;  4Y15 A;  2IGM A;  5LEK A;  1UFM A;  2UV1 A;  3VYS B;  2LNB A;  1ERD A;  2NS0 A;  4M9X A;  1QU3 A;  2XRO A;  2EFQ A;  1Y8R B;  4AVP A;  2I8D A;  4EVI A;  2FBI A;  3RQI A;  4OIQ F;  4B43 A;  2CFO A;  3J81 K;  1AOY A;  4PSW A;  3BC8 A;  3BCA A;  1D1C A;  3DTE A;  2W85 A;  3HRT A;  4XN0 A;  3WTU C;  4XID A;  1ZGJ A;  1WRJ A;  3IH2 A;  1Z91 A;  5FKO A;  3QYF A;  2HU9 A;  1RKW A;  1RES A;  2CH0 A;  2EB7 A;  4M9Z A;  1FJL A;  1MND A;  5L3E A;  3WE2 A;  1NK2 P;  3HL2 A;  1IF1 A;  2P0W A;  4XSZ F;  5JLX A;  3JRF A;  2M45 A;  3EUK L;  4LG0 A;  4II3 A;  1FZP B;  2L02 A;  1GHC A;  2IAI A;  2LRD A;  3ULQ B;  3DU5 A;  2R0Q C;  1FBS A;  4B1R A;  2HVQ A;  3SEQ A;  3Q0U A;  2ZB9 A;  3LFU A;  5KCM A;  3GYH X;  4E4H A;  2HDD A;  2YU9 J;  1WZ2 A;  1LFB A;  1G6N A;  4RS8 A;  1I3Q J;  1Z21 A;  2L4A A;  5EEG A;  3GZN B;  3L00 A;  1X4O A;  1IAW A;  3K6G A;  1HCR A;  2JA7 J;  2QCO A;  4E7Z A;  3WTX C;  1EA3 A;  1SD5 A;  4I76 A;  3BTI A;  2EIM H;  2CV0 A;  3EQL F;  2IEK A;  3GWZ A;  2X6W A;  2Y0S N;  1HW5 A;  3E5X A;  4M3B A;  1YOV B;  2ZNY A;  1E17 A;  2DA3 A;  3I54 A;  2MH2 A;  1U5T C;  3G6E I;  1Z0X A;  2R7Q A;  3AAF A;  3S3M A;  2OUM A;  2MSY A;  3MD2 A;  3EET A;  3TED A;  2ELH A;  1SVO A;  4BJT A;  5LGN A;  2DU9 A;  5IPA A;  3WG7 H;  1FYL A;  1LQ1 A;  2R7O A;  4BY7 J;  4BXX J;  5M5Y J;  1YJ9 I;  3FHN A;  1B9M A;  3MN2 A;  3FF5 A;  5DUK A;  1LDJ A;  3DLA A;  1YG2 A;  3Q0W A;  1WI9 A;  5E20 A;  1XS9 A;  3PM1 A;  4U0V A;  4M3D A;  3CJT B;  4DBQ A;  1MMN A;  3RKY A;  3DCF A;  1XPX A;  2DA6 A;  4ETS A;  6PAX A;  3GTL J;  3I4N J;  2TRT A;  5L3G A;  3DWL E;  2R4G A;  2JSP A;  4ZZD A;  1JI8 A;  5J40 A;  2RVC A;  4RB2 C;  1OCO H;  4BXF A;  1HW1 A;  1P4A A;  3WGG A;  1YIO A;  1W36 D;  3GLL A;  3BR6 A; 
#chains in the Genus database with same CATH homology
 4EJO A;  4HX7 A;  1YW9 A;  2Z3Y A;  4RB0 A;  5HLI A;  2FSW A;  2FA5 A;  2GXB A;  2EA4 A;  1SMY F;  3V7S A;  1RI7 A;  4L9T A;  1RIO H;  3BWG A;  1XDU A;  2F5C A;  4HZF A;  2O6G E;  5K5R A;  1BN5 A;  5DCM B;  2OBP A;  1O57 A;  3MZH A;  3G3Z A;  5LRS A;  4CXF A;  1XGN A;  1U5T A;  4EMS A;  2QEN A;  2Y0M A;  5LGT A;  2VOD A;  1YQA A;  4LJZ F;  2EWN A;  1OYY A;  1TQP A;  1ON2 A;  3BJO A;  3DPL C;  3HIF A;  3M8F A;  3TO9 A;  4LLN A;  4I09 A;  2EV5 A;  1JGS A;  2H6C A;  1T98 A;  3KET A;  3C3W A;  4KUM A;  1J59 A;  3OOP A;  3FMS A;  4Q4Z F;  2QYO A;  4I2O A;  3J81 Z;  5CVV A;  2IJL A;  3IC7 A;  3Q5F A;  1DP7 P;  2KJC A;  1U8R A;  2HYG D;  3PQK A;  3E6D A;  2HFH A;  5L3B A;  4AIJ A;  3ZN1 A;  3RTR A;  2XRN A;  4ZH4 F;  2COM A;  2DQR A;  1UHM A;  5H6Q A;  5D6F A;  4BXU A;  2D1H A;  2FML A;  4RGX A;  2STW A;  1K6O A;  1QPM A;  2LDU A;  2FBK A;  2X4H A;  4LG0 B;  2RV8 A;  3T0Y A;  3BZ6 A;  4BHP A;  4CHU A;  2A68 F;  2HDC A;  4LK0 F;  1HST A;  2NNN A;  2PQ8 A;  1IN6 A;  5F64 A;  3ABT A;  3GX4 X;  1ZLK A;  3IRQ A;  3P9C A;  5BQT A;  1R5H A;  3F23 A;  3LA2 A;  3EDP A;  3HOT A;  4ENJ A;  2VXZ A;  2ESN A;  1I6X A;  5E1W A;  3U1D A;  1IXC A;  1G4D A;  4H0E A;  3KLN A;  3GO5 A;  1LEB A;  1FP2 A;  5BS6 A;  2V9V A;  3I71 A;  2OA4 A;  3LFK A;  2VT2 A;  5ICE A;  4HYE A;  2VBX A;  4KNY A;  5LHH A;  4PZJ A;  2LKP A;  4I02 A;  2XVC A;  5LRR A;  3TO6 A;  2A69 F;  1HKS A;  4G8X A;  1K78 A;  2X0L A;  5HVQ C;  1QZZ A;  5BPD A;  3F8B A;  5E1X A;  4ESB A;  3CDH A;  2KKO A;  3VOE A;  2FE3 A;  4XLP F;  4ZZL A;  1BJA A;  2GA2 A;  3O6B B;  1YIO A;  4G6Q A;  4A0Z A;  2P6S A;  2E1N A;  1P4W A;  1ZH5 A;  3I0T A;  4P9F A;  1S29 A;  1QNT A;  3ERE D;  1IN4 A;  4L9N A;  5ED4 A;  4BYY A;  2Y48 A;  2QUF A;  2A61 A;  3SFZ A;  1U5T B;  1D5V A;  3PQJ A;  2D1V A;  3U2R A;  2BEO A;  4HA8 A;  2IA1 A;  3F72 A;  4PGH A;  2HGC A;  4U7D A;  1F9N A;  5K1Y A;  4KYW A;  2H6B A;  2L3D A;  2PFB A;  2G7H A;  1I1G A;  1KU9 A;  4I0B A;  2EV6 A;  4KFC A;  2EJR A;  2ZJ2 A;  1LJ9 A;  5JI6 A;  4AD9 A;  3JTG A;  5HLG A;  3K0L A;  5H20 A;  4FT8 A;  5E17 F;  1LDD A;  4HW0 A;  4YII A;  3GFL A;  5L3D A;  4YFX F;  4L0Y B;  3J7A O;  2JZY A;  2QWW A;  3KP6 A;  4OIP F;  4OMY A;  1D8J A;  2GIV A;  5DEQ A;  3BY6 A;  5A2Q K;  1FWZ A;  3QPH A;  2R3S A;  1XD7 A;  2GA1 A;  2KIM A;  4AIK A;  2DPD A;  4FX4 A;  3R4K A;  2FF4 A;  3I64 A;  1C0W A;  4GO1 A;  1FSH A;  2YSR A;  3QU6 A;  4EM1 A;  1ODD A;  3C1D A;  2A6E F;  3L09 A;  4CIC A;  1RUO A;  4HLX A;  5TJJ A;  3OV8 A;  3MZY A;  4R79 A;  2PI0 A;  3IL2 A;  4OOI A;  2BBY A;  3BPX A;  2OU2 A;  1O3T A;  1W5T A;  3TDU C;  3K1N A;  2WV0 A;  1JE8 A;  2CSO A;  5J8F A;  2MH9 A;  5DUI A;  1FYM A;  3IRR A;  2A6H F;  5J6X A;  3IWZ A;  5FD5 A;  4P96 A;  4KMF A;  3I4P A;  2GWR A;  4M73 A;  1G3Y A;  3RYP A;  1LB2 A;  2QQ9 A;  4IVN A;  2XIG A;  4YFK F;  2EFW A;  3EUH A;  1USS A;  4AIH A;  2Z33 A;  4CZZ A;  4KIB A;  3QP6 A;  2HS5 A;  4CO8 A;  3W6K B;  3KFW X;  4KIF A;  4KT5 C;  1ZGA A;  2MBF A;  1WWX A;  2O8X A;  2VBW A;  1W7P A;  3GLX A;  2CFX A;  4NQW A;  5LLQ A;  5AIP A;  2AS5 F;  3Q9V A;  2Q8K A;  2VT3 A;  1G3S A;  1STZ A;  4LB6 B;  1VTN C;  3VOD A;  2VON A;  3L2C A;  2DPU A;  2QZ8 A;  1GXP A;  2VC1 A;  3JSP A;  1QZY A;  3DFG A;  5AON A;  4ZYH A;  3HTS B;  3CLO A;  5DD8 A;  5BPI A;  3T5X A;  3QAH A;  4JK1 X;  2VBY A;  2IA0 A;  2GAU A;  5E8I A;  4EM2 A;  4GYI A;  1O7F A;  2DTR A;  3V7C A;  5FB2 A;  5L3F A;  4NHJ A;  1YYV A;  5A2Q Z;  1EH6 A;  2GQQ A;  3CO7 C;  3HRM A;  4UVA A;  2IVM A;  5ICC A;  3V8J A;  2VBZ A;  4UVC A;  5D5U B;  1R22 A;  2F5D A;  4ASN A;  3ZQ7 A;  2DW4 A;  5D4S A;  1O7L A;  1ULY A;  4LK1 F;  2EFO A;  4O6J A;  1S7A A;  4ZYG A;  2HKO A;  3CUO A;  2Y75 A;  1TW3 A;  2PBI A;  1J75 A;  1KYW A;  3KP7 A;  3V8K A;  2ZBK A;  3KP5 A;  2F5E A;  4MGR A;  2L01 A;  2OAZ A;  5JR3 A;  5LEJ A;  3SZT A;  4R1H A;  3R6S A;  1SD7 A;  3C18 A;  2ACJ A;  1FOK A;  5ILV A;  3H3U A;  4G6D A;  3EYI A;  1CF7 A;  1ZAO A;  2UZK A;  3H3Z A;  5L3C A;  1IW7 F;  3FMQ A;  1OR7 A;  3C7J A;  3DF8 A;  3ZMU A;  2JT1 A;  5F1R A;  4KN7 X;  4U0W A;  1J5Y A;  1K79 A;  1FNN A;  1MJA A;  2ISZ A;  3FMR A;  2OQG A;  3E6B A;  3DEU A;  2JSC A;  2P5V A;  4BH9 A;  4CGZ A;  1T2K A;  1BBY A;  3T8R A;  4UNO A;  4KA4 A;  3E6M A;  4B8X A;  4A2U A;  3CO6 C;  1Z05 A;  1RUN A;  1J0R A;  3F8N A;  1IN5 A;  2EFN A;  3ZMT A;  1MZB A;  4WCG A;  4HBL A;  1P4X A;  2XAG A;  4Y13 A;  4KIC A;  5F6F A;  3ZMZ A;  1W7P B;  1ZAR A;  2P5K A;  3KZZ A;  4YG2 F;  2J5O A;  1ZG5 A;  3E5Q A;  1YLF A;  1U2W A;  3FXR A;  2VOP A;  2H27 A;  3NQO A;  1BM9 A;  5D6E A;  1Z1D A;  4YIF A;  3MQ0 A;  4IPA A;  4A12 A;  1HKQ A;  1S6L A;  4U88 A;  1ZHF A;  5CYV A;  4MHG A;  4CDG A;  1T39 A;  4LFU A;  2P5L C;  4LLG F;  3KCC A;  1MDM A;  3MEX A;  4N9H A;  4ZYD A;  1KQ8 A;  2HKX A;  2XHK A;  4IRG A;  3L7W A;  2O0Y A;  5FFX A;  3F6V A;  2WWY A;  2XAQ A;  4HAM A;  2QVO A;  2OD5 A;  1ZLJ A;  3F3X A;  5IT9 K;  5BOX A;  2ZNZ A;  5H6R A;  4ENK A;  3NRV A;  4IJA A;  1D3Y A;  4G94 A;  1ZRE A;  1R58 A;  5E1Z B;  4G7O F;  5FLX K;  2PJP A;  3D5L A;  4LMY A;  5FFZ A;  1DDN A;  3BOQ A;  1OYW A;  2CYY A;  3Q9S A;  3WG9 A;  1SFE A;  3QU3 A;  3JSO A;  3SHF A;  1OMI A;  3EYY A;  2HYF A;  2CG4 A;  1OPC A;  2HR3 A;  4G7Z F;  2R7D A;  2TDX A;  1F1Z A;  2UXN A;  1U78 A;  1CGP A;  3JAM K;  4U7B A;  2ZFW A;  3TGN A;  5FGM A;  2HQN A;  3FZV A;  1FBQ A;  5HDN A;  3IHU A;  2NNY A;  2M30 A;  3T8T A;  1CF7 B;  1YFH A;  1H9T A;  1OYI A;  4A0Y A;  1PP7 U;  3WU1 B;  3JTH A;  4M6Y A;  2JTV A;  2PEX A;  3MAJ A;  3B02 A;  3E6C C;  2YX4 A;  4HQE A;  1LVA A;  4O5V A;  1J2X A;  3RIR A;  4HLY A;  3ROU A;  5K5O A;  1XGO A;  3HRU A;  3V4G A;  3MWM A;  4GGG A;  4LGW A;  4HV5 A;  5JVT A;  2Z9O A;  3QOP A;  3BJA A;  2DK5 A;  5ERI A;  1QBJ A;  1YW8 A;  1IN8 A;  4LLL A;  1TW2 A;  3FM5 A;  2KIU A;  4EJW A;  1XMA A;  2R7F A;  1S8N A;  2V6C A;  2E7W A;  2G9W A;  2HTS A;  2V79 A;  2VE9 A;  1U3E M;  3HSF A;  4L9J A;  1REP C;  3LQQ A;  5DV5 A;  1TNS A;  4L9V A;  1XCB A;  2IPQ X;  2XAJ A;  4RB3 C;  5D5W B;  2KJB A;  4WX9 A;  3BDD A;  3RI4 A;  2EK5 A;  2STT A;  1U6G A;  3R60 A;  4GCV A;  2PLY A;  2XKO A;  1ZRF A;  2D2W A;  3I53 A;  2A07 F;  1WQ2 A;  4A5N A;  1FBU A;  1ONV A;  2EV0 A;  2QQB A;  3TOB A;  3ELK A;  5IT9 Z;  1FYK A;  4FX0 A;  3BP8 A;  1MDM B;  3WTW C;  3RPQ A;  3GW2 A;  5FLX Z;  4HF0 A;  1Z6T A;  4RAY A;  4Y17 A;  3M8E A;  5CJ9 A;  3FX3 A;  2H09 A;  2FBH A;  3GFM A;  5D8K B;  4I0A A;  3CUQ C;  3W6J B;  3HHG A;  1KQ9 A;  2OZU A;  1O3S A;  3GF2 A;  4ZYE A;  3WTS C;  4L18 B;  4WXD A;  5ICG A;  1FP1 D;  2LSO A;  1BI0 A;  3K1M A;  3LWF A;  1A04 A;  4OIN F;  4NB5 A;  1EH7 A;  3JW4 A;  1DPU A;  3R0A A;  2WTE A;  3BPV A;  2FRH A;  5FD6 A;  3JAM Z;  2YX7 A;  1MJ9 A;  1SFX A;  1ZRC A;  3GZ6 A;  1J9I A;  2C6Y A;  4B09 A;  5CVR A;  4M6X A;  1W7P D;  4XRF A;  4KDP A;  4JQF A;  1HQC A;  4IHT A;  4EQQ A;  3E5U A;  3IKT A;  4K2E A;  4P9U A;  1F4K A;  4LD5 A;  2BYV E;  3K69 A;  3WE3 A;  5HOO A;  2CGP A;  3HSE A;  2BGC A;  4WXC A;  3HYI A;  3CUQ A;  4UV8 A;  1P92 A;  1MKM A;  4MQ9 F;  2ZO4 A;  1I1S A;  2V1X A;  4A5M A;  3VB2 A;  1K78 B;  2UWM A;  3J80 K;  3E97 A;  2F2E A;  3ML6 A;  1IZ1 A;  2IRF G;  1IRF A;  1Y0U A;  3R0J A;  4MQV A;  3FWE A;  2V1D A;  3FHZ A;  1PDN C;  3BJ6 A;  2L4M A;  4EV0 A;  3WGH A;  4HDV A;  5DCM A;  1R1V A;  1AWC A;  5EEH A;  3HUG A;  2FXA A;  1BI2 A;  3WTV C;  1W5S A;  1G3T A;  4M72 A;  2VOO A;  4TV7 A;  4A6D A;  2ETH A;  1HW2 A;  2H94 A;  3REO A;  3ZMD A;  1FLI A;  2E1C A;  3GFJ A;  2DBB A;  1LNW A;  4FHT A;  2XUB A;  3RKX A;  3PFI A;  1SMT A;  3L9F A;  4ENN A;  3I5U A;  4KIG A;  1TBX A;  3U9G A;  1BIA A;  3LA3 A;  4JBA A;  2FU4 A;  2ZXJ A;  3FM3 A;  5FO5 A;  4HDU A;  5BMZ A;  2CWE A;  2M5W A;  4P5O A;  1XCV A;  3KP4 A;  4MEY F;  4A6E A;  5CLS A;  4DQ2 A;  3F6O A;  2MA3 A;  1PP8 F;  4WWC A;  1SAX A;  3WU0 A;  2FEZ A;  5JFR A;  3N97 A;  2DQL A;  1L0O C;  4GXO A;  1SD6 A;  5IT3 A;  4RB1 A;  2ZCW A;  5AIQ A;  4UHT A;  2HEO A;  2B0L A;  4UUV A;  3S2W A;  3VEP A;  4HQM A;  5CVU A;  3GFI A;  4EJU A;  1IUY A;  3DQV C;  3HHH A;  2FOK A;  2QLZ A;  4Q5S F;  1KQ0 A;  3ABU A;  2CO5 A;  5LHG A;  4A0X A;  2XAH A;  1B4A A;  5ILU A;  4MEX F;  1KA8 A;  3QRF F;  5ICF A;  1IRG A;  2YPR A;  1RNL A;  4EGY A;  1YS7 A;  4PGG A;  3B73 A;  1Q1H A;  3QP5 A;  2PG4 A;  1TQM A;  1WKM A;  3I59 A;  1HKT A;  4IRH A;  2BE5 F;  1DPR A;  4IF4 A;  2MD5 A;  1NHA A;  1XDS A;  2J5P A;  3J80 Z;  3DPT A;  4L5I A;  4D0P A;  1EH8 A;  4HF1 A;  2PN6 A;  4EJT A;  3K9T A;  1KGS A;  3CUQ B;  2NYX A;  1ZG1 A;  3O3K A;  2A3S A;  1YTY A;  3FXQ A;  3G73 A;  1BI1 A;  1JHF A;  2HZT A;  3SQN A;  2HTJ A;  2JPC A;  1FPQ A;  1B59 A;  3VFZ A;  5KK1 A;  4G7H F;  3LA7 A;  3WTT C;  4KN4 X;  1F5T A;  1H0M A;  2DLL A;  1IN7 A;  5LBQ A;  1IXS B;  1L3L A;  1H9G A;  5CVJ A;  3IWF A;  2Z99 A;  4WK8 F;  3M7G A;  1BC7 C;  2FNP A;  1G3W A;  4S05 A;  3D0S A;  1S7O A;  2OZ6 A;  4RGU A;  2JPB A;  2FQ3 A;  2M87 A;  1T6S A;  3DKW A;  1FX7 A;  5D8L B;  2A5Y B;  3P7N A;  2W25 A;  3LAP A;  3T1B A;  1FY7 A;  2HOE A;  4BQA A;  2RKH A;  2DI3 A;  3WOD F;  3NEU A;  1B9N A;  1RZ4 A;  1W4M A;  2LF7 A;  3GVA A;  5LGU A;  2XKP A;  4MTE A;  2GZW A;  1JXS A;  4BHC A;  3R61 A;  4RGS A;  2QM3 A;  2ADU A;  2LF8 A;  5J8C A;  5TRD A;  2IP2 A;  2FNA A;  4AWX B;  2P7C B;  1SFU A;  5HS8 A;  3E3V A;  3MFK A;  2DO7 A;  3KP2 A;  2AXL A;  4OMZ A;  2NRA C;  3F8F A;  4I7H A;  3GZ5 A;  4OIO F;  2HQR A;  2K4B A;  2RGV A;  4XLN F;  2K86 A;  3KEO A;  4ESF A;  4N0B A;  1EV7 A;  1HBX G;  1I27 A;  1SD4 A;  3IKV A;  3ZPL A;  1P2F A;  1KU7 A;  3ZMS A;  5D4R A;  5DYM A;  4PDK A;  4UV9 A;  1PUE E;  2YU3 A;  3BRO A;  2UXX A;  1K7A A;  2P8T A;  2QBY A;  2RQP A;  4M71 A;  1FT9 A;  2ZME A;  2OQR A;  4QWQ A;  2K7L A;  2K4J A;  1XN7 A;  1O3Q A;  4U0Y A;  4N9I A;  4EGZ A;  3HSR A;  1XMK A;  2W57 A;  3F21 A;  1R5G A;  2IA2 A;  1XSX A;  3M1E A;  2RN7 A;  2CW0 F;  2FMY A;  3I58 A;  3WGI A;  4ENM A;  2VN2 A;  1KYZ A;  4HF2 A;  2Q2E A;  1UB9 A;  2O03 A;  4UXN A;  3RJP A;  2V1U A;  3QPT A;  2XAF A;  5DD4 A;  1UST A;  3GEZ A;  3CJN A;  1BI3 A;  4OU0 A;  2XV4 S;  3V8L A;  3DP7 A;  4BAY A;  1TNT A;  2IW5 A;  1R7J A;  1ZYR F;  3V7R A;  3I59 B;  1GXQ A;  3ZN0 A;  4OIR F;  3TDZ C;  4WF2 A;  1GVJ A;  1QO0 D;  3RKW A;  1XSV A;  2O3F A;  2VE8 A;  4PCQ A;  4Q47 A;  4ON0 A;  4M9S A;  3RDI A;  1TQI A;  3GXO A;  1T0F A;  1YS6 A;  4L0Z B;  4F7Z A;  1OKR A;  3DV8 A;  5DDG A;  2NAZ A;  1B6A A;  4BNC A;  4E70 A;  2HWV A;  3KEQ A;  2DAO A;  4I01 A;  3HTU A;  1ZG3 A;  5D5V B;  3F8C A;  3HRS A;  1HXD A;  4BHB A;  1MJB A;  2QQA A;  2MLG A;  2EA2 A;  2P7V B;  3TQN A;  4IHS A;  1R00 A;  3K1P A;  2XGX A;  2EFP A;  1T38 A;  3CTA A;  1QGP A;  4WXH A;  1ZRD A;  5DCF A;  3P9I A;  4S04 A;  3GUD A;  3O2P E;  4IXA A;  4IRI A;  3DXJ F;  1TLH B;  2GXG A;  1D8K A;  5ILS A;  1Z6R A;  4M74 A;  3TKY A;  4RAZ A;  3ZP5 A;  3TO7 A;  1FSE A;  4EM0 B;  1IXR C;  4HV6 A;  2IT0 A;  2W84 A;  3KP3 A;  4CYD A;  5HS7 A;  2F5F A;  1HSJ A;  2BV6 A;  3SZP A;  1V4R A;  5E8G A;  1YO5 C;  2G7U A;  1JHH A;  2PMU A;  1XGS A;  2KRF A;  4XSX F;  2Z5U A;  1BOA A;  2DK8 A;  4HX8 A;  2RNJ A;  1DUX C;  1YW7 A;  4QLC U;  2DFI A;  4RGR A;  1P6R A;  1QQI A;  3N4M A;  2ESH A;  3HOS A;  4EJV A;  3WTZ A;  1J7K A;  1FC3 A;  4GYG A;  1S3J A;  2P4W A;  4DNC A;  2RDP A;  1Z7U A;  3WTY C;  5CVI A;  5K5Q A;  1WSU A;  1V3F A;  5HLH A;  1XB4 A;  5HDG A;  2QBY B;  1LEA A;  2P6T A;  2D45 A;  5HS9 A;  2ZME B;  2L54 A;  1MGT A;  2CQK A;  3ECH A;  3ZMV A;  1MD0 A;  4UVB A;  3P9K A;  2ISY A;  2M1B A;  2JRT A;  1ON1 A;  3KZY A;  1KU2 A;  4Z2Y A;  5LHI A;  1O3R A;  3COA C;  4HX4 A;  2W24 A;  4I98 B;  1R23 A;  3ECO A;  2K02 A;  4R8H A;  2DT5 A;  1UCR A;  2Q0O A;  3LST A;  1XGM A;  1ZN2 A;  3TOA A;  5E18 F;  2MLK A;  1XSD A;  1E2X A;  2E7X A;  2PMH A;  3K2Z A;  3SXY A;  3LQR A;  4YFN F;  1BC8 C;  1Z9C A;  2O61 A;  4ESJ A;  4HOB A;  3F22 A;  2MC3 A;  2K27 A;  3M9A A;  2WC2 A;  3ISP A;  3FXU A;  3KLO A;  1BIB A;  4G9Y A;  4MTD A;  4MNU A;  3F8M A;  1R36 A;  5D5X B;  5HDK A;  1TTY A;  1UHW A;  2YR2 A;  3MCZ A;  4Q48 A;  2XAS A;  2M8E A;  1X3U A;  2RC4 A;  3H92 A;  2ZKZ A;  2VC0 A;  4O3M A;  5JHU A;  2KIF A;  4P55 A;  4KMU X;  4L5J A;  1R1U A;  3RYR A;  1KU3 A;  4LB5 A;  1LDK B;  4XBF A;  1I5Z A;  5KVR A;  1R1T A;  3KE2 A;  1B1B A;  3RPU A;  4Y15 A;  5LEK A;  1UFM A;  2LNB A;  2NS0 A;  4M9X A;  2XRO A;  2EFQ A;  4AVP A;  4EVI A;  2FBI A;  4OIQ F;  3J81 K;  1AOY A;  3HRT A;  2W85 A;  3WTU C;  1ZGJ A;  1WRJ A;  1Z91 A;  2EB7 A;  4M9Z A;  5L3E A;  3WE2 A;  1IF1 A;  4XSZ F;  2M45 A;  4LG0 A;  1FZP B;  2L02 A;  1GHC A;  3ULQ B;  1FBS A;  3GYH X;  1G6N A;  4RS8 A;  2L4A A;  5EEG A;  3L00 A;  1IAW A;  3WTX C;  1SD5 A;  3EQL F;  3GWZ A;  1HW5 A;  3E5X A;  2ZNY A;  1E17 A;  3I54 A;  2MH2 A;  1U5T C;  3AAF A;  3EET A;  2ELH A;  5LGN A;  2DU9 A;  1FYL A;  1LQ1 A;  1B9M A;  3FF5 A;  5DUK A;  1LDJ A;  1YG2 A;  5E20 A;  1WI9 A;  4U0V A;  3RKY A;  6PAX A;  4ETS A;  5L3G A;  4ZZD A;  2RVC A;  4RB2 C;  1HW1 A;  1P4A A;  3WGG A;  3LAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...