4L9JA

Crystal structure of s. aureus mepr in dna-binding conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 40
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9jA00
3NEUA 3E5XA 3TGNA 2IPQX 2WTEA 2VC0A 3H3ZA 4RB2C 1F4KA 2EA2A 2H6BA 2HTSA 2Z3YA 5CVJA 1LB2A 4YIIA 2XAFA 4JK1X 4AD9A 2NNYA 3KZZA 3L2CA 3FXRA 2ESHA 5EEHA 1EH7A 3G3ZA 5FO5A 5LHIA 1W7PB 1J0RA 3M8FA 3C3WA 3EUHA 1T0FA 3WTTC 2FA5A 1FYKA 2ELHA 3P7NA 4CXFA 5FD5A 3BJOA 2DFIA 3MFKA 1FBSA 3P9IA 3K2ZA 1U5TA 4U0VA 3BOQA 4GGGA 2Y48A 2F5DA 1K79A 1D8JA 5K5RA 4O3MA 1Z1DA 4LD5A 2QBYA 3IKVA 3TO6A 1T6SA 1XMAA 2E1CA 2YPRA 1ZG3A 3F72A 2PN6A 1ZREA 1BOAA 1GXQA 1O3TA 2KIUA 2HFHA 3N97A 1RI7A 1S8NA 2V6CA 1QGPA 4KIFA 3IL2A 1IF1A 1FT9A 2K86A 2VODA 3H3UA 1MJ9A 1S7AA 1R5GA 3DPTA 2EFWA 4P5OA 3JTGA 4KA4A 4JQFA 1E2XA 2NAZA 4RB3C 2IA2A 1SMTA 2NS0A 5DD8A 2V1UA 3GO5A 4UV9A 2QQAA 2FSWA 5BS6A 1T38A 2QVOA 2F5CA 5D5VB 2PBIA 2ZMEB 4A5MA 2EB7A 2D2WA 5LGNA 3HOSA 5DYMA 4I7HA 2VT3A 1ZG1A 4L18B 4Q5SF 1BI0A 3CO6C 3WTWC 5F64A 1ZLJA 2STWA 1R22A 5HLGA 3TOAA 2EA4A 4IVNA 2M87A 5LGUA 3FXUA 1KU3A 1ZRFA 4AIHA 2GXGA 2XAGA 4A12A 4YG2F 3L9FA 3SFZA 1HQCA 2XKOA 4BH9A 4LLNA 5A2QK 3BJ6A 1ZHFA 4RGUA 3RJPA 1BI1A 2XAQA 2L4MA 2IA1A 2HYGD 3DV8A 3J80K 3O3KA 2XIGA 2VBXA 1U8RA 1LQ1A 2WV0A 1FSHA 2FE3A 2AS5F 4A6EA 3ZMZA 1S29A 3F8NA 1O3QA 2LDUA 1IRGA 1UHMA 4HOBA 1SD5A 1B6AA 2G9WA 5LRRA 2ACJA 1EH6A 4AWXB 4IRHA 2GA1A 3KEQA 4IPAA 1R00A 1GVJA 1BJAA 4A0YA 3KLNA 3U1DA 1PDNC 2KRFA 1TTYA 3CUQC 1IXCA 4PGHA 1LJ9A 1RUNA 1Z91A 2Q8KA 5IT9K 5DCMB 2HZTA 3KLOA 1RUOA 3CUOA 1KGSA 1KQ8A 3ZMVA 3Q9SA 1WSUA 3D0SA 2PG4A 4CZZA 2FF4A 3IHUA 3T5XA 4HDUA 4CICA 1IN5A 2DO7A 3MWMA 4M71A 5CVRA 4DQ2A 4ETSA 5DV5A 4EGZA 3V7SA 1FSEA 1FYLA 1HKQA 2HKXA 3HTUA 2P4WA 3TDZC 4HX8A 1FZPB 3F6OA 4Q47A 1RIOH 1I5ZA 4EM2A 4M9XA 4OU0A 3CO7C 5E1XA 1DPRA 2M8EA 3K1NA 4MEXF 3RKYA 5KVRA 5LLQA 1ZH5A 2DK8A 2ISYA 2EV0A 3LA2A 4H0EA 3T8RA 2QQ9A 2UXXA 4Z2YA 1P4XA 4WK8F 3ROUA 3MQ0A 5E1WA 5DUIA 3HRTA 2OA4A 2Y75A 1U6GA 3LQRA 2HTJA 2WC2A 3RPQA 3CLOA 1QZZA 1BBYA 3FWEA 3KETA 3R60A 5BOXA 1K6OA 3KP5A 1ZG5A 2VONA 4G94A 2A07F 5ICFA 2VBZA 1YYVA 1SD7A 4MTDA 2X0LA 3K1PA 1F9NA 4E70A 3CTAA 5E8GA 2ZXJA 1R1VA 1U78A 4PCQA 5L3FA 3F23A 3EQLF 5CLSA 2JRTA 1FBQA 3FZVA 1U2WA 2ZNZA 5D4RA 1HSTA 2O6GE 5E18F 1ZRCA 3J81Z 2EFPA 3LAJA 2L02A 2XVCA 3W6KB 3QP6A 1TQMA 3LFKA 2KJCA 1R7JA 3FHZA 2UZKA 1DPUA 1FP1D 5BPIA 5D8KB 3BROA 4G7OF 2A3SA 3TOBA 3E3VA 3LSTA 2YX7A 4AIKA 3WU0A 4G6QA 1HKTA 3RYRA 3L00A 3TO9A 2XROA 1YW7A 3I53A 1JXSA 3DP7A 1U5TB 1LEBA 2DQRA 3E5QA 2PEXA 4KIBA 1A04A 4BHCA 3V8LA 1R5HA 3RKWA 4YFXF 4XRFA 4G7ZF 3KCCA 1AWCA 4CO8A 1YS6A 3REOA 2ADUA 3I4PA 3TKYA 1DDNA 1IUYA 2O3FA 2RKHA 2LF7A 3DF8A 1V4RA 1OYIA 2DBBA 4HW0A 2W57A 4CGZA 4I98B 1XCBA 4MTEA 2STTA 3B73A 2K7LA 1IAWA 1G3TA 1IN8A 2EK5A 4ZH4F 1O7FA 5ERIA 4L9TA 5FLXZ 2Q0OA 3JSPA 3IWZA 1MDMA 2CG4A 1H0MA 1MZBA 2VBYA 1UCRA 3WE2A 2XASA 1LDDA 5ICEA 1MGTA 2D45A 1XGMA 2L3DA 5FFZA 4OOIA 1XCVA 1QBJA 5ICGA 4WCGA 1FWZA 4ON0A 1TQPA 3V4GA 4IRGA 4CHUA 4ESBA 5HOOA 4ENNA 4IRIA 2EFNA 4M9ZA 2J5PA 4I02A 5CVUA 3ZP5A 5L3DA 4EGYA 3CJNA 1TBXA 1KQ0A 3KP7A 2M30A 3DKWA 1ZLKA 5L3EA 1B59A 3M1EA 4EVIA 2DU9A 3DXJF 3M7GA 3VFZA 3FM5A 5HVQC 5ILSA 5H20A 1JE8A 4F7ZA 3HHHA 2GZWA 3HRMA 1CF7B 3TDUC 4P55A 2MD5A 3S2WA 2XKPA 1IRFA 3RI4A 2W25A 2LSOA 4YIFA 4N9IA 2R7FA 2ETHA 3I71A 2EJRA 1R36A 2CW0F 5D5UB 2FBKA 1O3SA 2B0LA 4PZJA 1FNNA 5FGMA 4ESJA 1V3FA 1PP8F 2MBFA 1IXSB 3ECOA 4UVAA 1YO5C 5BPDA 1OKRA 3R61A 2JPCA 1SFUA 1P4WA 2EFQA 2HQRA 5LGTA 2DPDA 3I5UA 3I54A 4OMZA 2ZJ2A 5CJ9A 1G3YA 1MKMA 1REPC 4BHBA 2A69F 5J8FA 2OBPA 1ODDA 1DP7P 3E5UA 2RN7A 3ERED 1SMYF 5HDGA 4MQ9F 2VBWA 1STZA 3F8FA 4RS8A 2ZFWA 1XDUA 4HYEA 3BWGA 4CDGA 1B4AA 4ENMA 2DI3A 3HSRA 1ZGAA 4WWCA 1HW2A 1JGSA 3QRFF 2HYFA 2D1VA 2PLYA 2Y0MA 3GLXA 2O61A 1ZRDA 1MD0A 3I59A 4BNCA 4EV0A 1XGNA 4OINF 2GXBA 1XDSA 2YX4A 1T39A 4ENKA 1HBXG 1D8KA 4R8HA 4UXNA 2IJLA 2F5FA 1HXDA 1G3WA 4AIJA 1K7AA 2M45A 2L54A 3LAPA 2PFBA 3WTUC 3IKTA 3H92A 3C18A 2MA3A 4XSXF 3WTYC 1YTYA 2RVCA 2F5EA 2P5KA 1NHAA 2K02A 2Z99A 3WGIA 2ZBKA 1I1SA 2LF8A 4P9FA 2P5LC 3T0YA 2V1XA 4EJOA 3ML6A 1CF7A 1TNTA 2NYXA 1FPQA 3CUQA 4LJZF 1WQ2A 1KU9A 3BP8A 1J7KA 1XSDA 5ILVA 2EV5A 3EETA 3FX3A 4N9HA 3ZMUA 3GWZA 4KMFA 2XUBA 3U9GA 3FXQA 5JHUA 3LQQA 3KP3A 2VC1A 2MLKA 2MC3A 1LDKB 1B9MA 3RDIA 4ENJA 2FNAA 1BI2A 3V7RA 2WWYA 4A0ZA 5K5QA 2P7CB 1J5YA 2A68F 4L9JA 5KK1A 3KE2A 1USSA 3IRRA 1OPCA 5HS9A 5DD4A 2PI0A 3KEOA 3GXOA 1Z7UA 5ILUA 1FX7A 1LVAA 2COMA 1S3JA 2A6HF 3HHGA 3QPTA 2HEOA 3WGGA 2H09A 5LHHA 2KIMA 5BMZA 2NRAC 2M5WA 4FX0A 4M6XA 4RGSA 3MAJA 1WRJA 2IA0A 4LG0A 4KT5C 4IJAA 4FT8A 3JAMZ 2FU4A 2HQNA 3ISPA 3E6DA 3ZQ7A 4HX4A 4M73A 3FF5A 2HOEA 4XBFA 2CGPA 3BY6A 5D6FA 1CGPA 3GZ6A 3ZPLA 1I6XA 3B02A 3COAC 3GF2A 1HKSA 3L09A 4HLYA 2FNPA 4LGWA 3T8TA 1FYMA 3QPHA 3FMSA 5E1ZB 1MDMB 4NQWA 4LB6B 1JHHA 4HV6A 2ZCWA 3N4MA 1BM9A 4L9NA 4ESFA 5L3CA 2IP2A 2JTVA 3MZYA 2FXAA 2EFOA 1Z6TA 2VXZA 4U7BA 2QYOA 5AONA 3HSEA 5CVVA 5HLIA 1XN7A 3I64A 4OIOF 5HS8A 4Q48A 3QOPA 4YFNF 4WXHA 1QZYA 1KQ9A 2P5VA 3R0JA 2P8TA 5E17F 3ABUA 3O6BB 3I58A 1XSVA 3V8JA 1I1GA 2J5OA 4U7DA 1RNLA 1K78A 4HA8A 2OU2A 1HSJA 3QP5A 3HTSB 2BV6A 1MJBA 4BQAA 4EJTA 3P9KA 4KFCA 4RAYA 4UV8A 3R4KA 1TQIA 3RKXA 4EJVA 2M1BA 1FC3A 2IVMA 3K69A 4G9YA 1IZ1A 4BXUA 4EJWA 2DAOA 5LHGA 4ZYEA 1W5SA 3HYIA 4OIQF 4OMYA 4L0YB 3WTXC 2R3SA 1Z05A 2QM3A 3F22A 2EV6A 2EWNA 3I0TA 2W85A 1BIAA 4I01A 1PUEE 5BQTA 2HWVA 4QWQA 4I09A 5FB2A 3GYHX 2A5YB 3GX4X 1D5VA 2VT2A 4GYGA 1MJAA 1QNTA 1QQIA 3C7JA 4LLGF 1KYWA 5LBQA 4UVBA 2RNJA 3K1MA 3SZPA 2OZ6A 4WXDA 4LFUA 2ZO4A 1G6NA 5HDNA 4EM1A 4KNYA 2A61A 2W84A 3WGHA 3TO7A 1J9IA 1P4AA 1KU7A 4ZZLA 2ESNA 4BHPA 4FX4A 3IC7A 5L3BA 5HS7A 3J81K 3GFJA 4R1HA 5LRSA 1WKMA 3MEXA 1ZGJA 3M8EA 4OIRF 1W4MA 3E6CC 4HF0A 3FM3A 2F2EA 6PAXA 1YLFA 3BZ6A 3KZYA 5D8LB 2FMLA 1F5TA 4Y17A 2IRFG 1LNWA 3I59B 4CYDA 1IN7A 1RZ4A 3MZHA 1FY7A 5JFRA 4QLCU 3C1DA 4ZYGA 5K5OA 4A6DA 4O6JA 2ZKZA 4HAMA 2RQPA 4LLLA 4HF2A 1USTA 1YQAA 4HQMA 4M72A 3SXYA 3IRQA 2JZYA 2DT5A 2P6TA 5FD6A 2H6CA 4ASNA 4ZZDA 4B8XA 1PP7U 2CO5A 2HKOA 4UUVA 4KMUX 1BIBA 2HS5A 2H27A 4MEYF 5D6EA 1GXPA 1R58A 4HZFA 1FP2A 1ON2A 3WG9A 5AIPA 3E97A 1YW8A 2KIFA 4BAYA 3KP4A 3CUQB 3EYYA 5FLXK 4M6YA 1F1ZA 1JHFA 5FFXA 4L9VA 4RAZA 4HBLA 1SD4A 1QO0D 4JBAA 3FMRA 2QENA 3GZ5A 2HDCA 2Q2EA 4KIGA 5F6FA 2DTRA 4UHTA 1FBUA 3SQNA 3QU6A 3TQNA 2YR2A 1YW9A 1B9NA 1XSXA 3P9CA 4HQEA 1R23A 2OQRA 1IXRC 2P7VB 5J8CA 1TW3A 1S6LA 3GUDA 1BC7C 2P6SA 2L01A 1X3UA 2RV8A 4RGRA 3VB2A 2Z9OA 3JSOA 4KDPA 4IHTA 4N0BA 3VODA 2C6YA 2XAJA 1Z6RA 4I0BA 1ZN2A 2XAHA 2E1NA 1EH8A 4U0YA 4I2OA 5A2QZ 3PFIA 3F8BA 3SHFA 5D4SA 3F3XA 4ZYDA 2PJPA 4R79A 4Y13A 1U5TC 2BBYA 3J80Z 1IW7F 3ECHA 5TRDA 1Y0UA 1BN5A 4LG0B 3FMQA 1R1TA 1HW5A 3BDDA 1ULYA 3MCZA 5DDGA 3VOEA 4MGRA 4S05A 5ICCA 1OR7A 1EV7A 1XGOA 1S7OA 2XV4S 3HOTA 3WODF 2DW4A 3F21A 4LK1F 4KN7X 1SD6A 1KYZA 4A2UA 3ULQB 3OV8A 1ZARA 2V1DA 3RPUA 1G4DA 4G6DA 1ONVA 5IT9Z 3Q5FA 2CWEA 2TDXA 2K4BA 1D3YA 4G8XA 2H94A 4P96A 5E20A 5JVTA 4XSZF 2OD5A 1ON1A 3D5LA 4GO1A 3ELKA 2BEOA 3CDHA 3BPXA 5TJJA 1J59A 3ZN0A 1P6RA 2D1HA 3G73A 4KYWA 2K27A 1Z9CA 1W7PA 2R7DA 5HLHA 1OMIA 2RC4A 3DFGA 2PQ8A 4GXOA 3GFIA 2VOPA 2IT0A 2MH9A 2FQ3A 4HV5A 3K9TA 3LWFA 2QQBA 4BYYA 1P92A 2V79A 1J2XA 2CQKA 4MHGA 2VN2A 4P9UA 2O0YA 4L5JA 3BPVA 3F8MA 4EM0B 1K78B 2BYVE 1O7LA 2FBIA 2LKPA 3IWFA 3RTRA 2XGXA 1QPMA 3F8CA 4ZYHA 3NQOA 1J75A 5H6QA 2O8XA 2E7XA 3F6VA 2FMYA 1VTNC 4M74A 4XLPF 3WU1B 4HDVA 2FOKA 3KP6A 3HUGA 1W7PD 1H9TA 1AOYA 2W24A 2OQGA 3NRVA 1O57A 3ZN1A 2RDPA 4DNCA 1H9GA 4TV7A 4L5IA 3LA7A 2G7UA 2QZ8A 1U3EM 1FOKA 1IN6A 1XMKA 2QUFA 4HF1A 4EQQA 1G3SA 3DPLC 1KA8A 1XB4A 2L4AA 3PQJA 4WF2A 4LB5A 2OAZA 2E7WA 2G7HA 2MLGA 4I0AA 1UFMA 4EMSA 2CYYA 1T98A 3GW2A 3HIFA 4LMYA 3KP2A 3HRSA 3RIRA 5CYVA 1T2KA 1FLIA 2ZMEA 5ED4A 2DQLA 3E6MA 3AAFA 3JW4A 1YFHA 5CVIA 4GYIA 1YS7A 2UWMA 4RGXA 3VEPA 1E17A 5JR3A 1SFXA 2PMHA 5E8IA 2VE8A 5H6RA 1KU2A 3V8KA 3BJAA 4FHTA 3GEZA 3EDPA 1L3LA 3WE3A 4LK0F 2IW5A 3V7CA 3U2RA 4L0ZB 2BGCA 3LA3A 3WTZA 3J7AO 3R0AA 3OOPA 5LEJA 1UB9A 1DUXC 1YIOA 2BE5F 2Z33A 1BC8C 3GVAA 4IXAA 4NHJA 1LDJA 5LEKA 2DK5A 1P2FA 3WTSC 1HW1A 4RB0A 2CSOA 2FBHA 4MNUA 4YFKF 3JAMK 4Q4ZF 3DQVC 4GCVA 4KICA 2OZUA 5J6XA 4Y15A 2QWWA 2XRNA 4UNOA 2NNNA 4U0WA 5JI6A 2GAUA 1ZAOA 3W6JB 3KFWX 5D5WB 2HGCA 5DEQA 5L3GA 4A0XA 1GHCA 1WI9A 2HR3A 5K1YA 4B09A 3O2PE 4G7HF 2XHKA 5D5XB 5DCMA 1IN4A 1XD7A 5DCFA 3K0LA 1O3RA 2K4JA 2Z5UA 3T1BA 4D0PA 1BI3A 4WXCA 2GA2A 2X4HA 4WX9A 4PDKA 1I27A 4HLXA 3GFLA 4M9SA 1XGSA 3EYIA 2DPUA 3Q9VA 4O5VA 4NB5A 1Q1HA 3QAHA 3M9AA 4IF4A 5F1RA 4KN4X 1SAXA 2RGVA 2LNBA 1ZYRF 2GIVA 4HX7A 1TLHB 3JTHA 4EJUA 2QBYB 3ABTA 2FRHA 5AIQA 2GWRA 3E6BA 3HRUA 4IHSA 5EEGA 3ZMTA 3WTVC 4AVPA 2JPBA 4KUMA 1SFEA 3R6SA 3QU3A 1LEAA 3L7WA 2FEZA 2VE9A 4S04A 1C0WA 2PMUA 4XLNF 1YG2A 2V9VA 4OIPF 4MQVA 2O03A 5IT3A 3PQKA 2A6EF 1UHWA 3RYPA 1R1UA 2YSRA 4U88A 3DEUA 2GQQA 2KKOA 4K2EA 1W5TA 2MH2A 2YU3A 2ZNYA 3GFMA 1WWXA 1TW2A 2AXLA 3ZMSA 3HSFA 5HDKA 4PGGA 1OYYA 1L0OC 2QLZA 2JT1A 2JSCA 4A5NA 2UXNA 1OYWA 2VOOA 2CFXA 4RB1A 4UVCA 1B1BA 2ISZA 3ZMDA 3SZTA 5DUKA 1TNSA 2KJBA 2DLLA
chains in the Genus database with same CATH superfamily
3NEUA 3E5XA 3TGNA 2IPQX 2WTEA 2VC0A 3H3ZA 4RB2C 1F4KA 2EA2A 3EPZA 3AKZA 2H6BA 2HTSA 4OAZA 1FIPA 2Z3YA 2CFOA 2ICWG 5CVJA 1VQ4I 3FXOA 1LB2A 4YIIA 2GIZA 2LVSA 1VQ7I 2XAFA 4JK1X 4AD9A 2LKSA 2NNYA 3BZCA 5EEAA 2H8WA 2LLKA 1YJ9I 3KZZA 5DM6F 3L2CA 3FXRA 1WJFA 2ESHA 5EEHA 1EH7A 3G3ZA 3GZNB 5FO5A 5LHIA 1W7PB 4IHYA 1J0RA 3M8FA 4BQQA 1MBFA 1JGGA 2DDBA 3C3WA 4PSWA 3EUHA 2E71A 2IS1A 1T0FA 3WTTC 2FA5A 2LR8A 2L7ZA 3JRFA 1FYKA 2ELHA 3P7NA 3OYJA 2HQAA 4CXFA 4ITVA 2YUSA 3BJOA 5FD5A 3CC7I 2DFIA 3FKJA 3MFKA 3M3YJ 1FBSA 3P9IA 1V54H 2LOOA 3K2ZA 1BR2A 1U5TA 2HVQA 2I8DA 4U0VA 3BOQA 4I76A 4A3KJ 4GGGA 1ZQ3P 3K4LA 2Y48A 3LOCA 3S1QJ 3BTJA 3DWLE 2F5DA 1K79A 1D8JA 5K5RA 4O3MA 1Z1DA 2M4GA 4GRIA 1XPXA 4LD5A 2IS4A 3IH4A 1X3WB 3IP4B 1UZCA 3IKVA 3TO6A 2QBYA 1T6SA 1XMAA 1Y6IA 2E1CA 3SZGA 2CU7A 1N78A 2YPRA 1ZG3A 3F72A 2ZSHB 2ELJA 2PN6A 1ZREA 3S14J 1BOAA 4FTHA 1GXQA 1O3TA 2JMWA 2KIUA 2VQGA 4IX7A 2HFHA 2QEXI 3VYTB 2HPMA 2VKHA 3HUGB 5M3FJ 4P1WA 2O8KA 3N97A 2I5UA 1RI7A 1YHQI 1S8NA 2V6CA 4M3EA 1QGPA 1GV5A 4KIFA 1IRZA 3IL2A 4B44A 1IF1A 1FT9A 3AL0B 2K86A 2DOAA 2VODA 3H3UA 1MJ9A 1S7AA 3H5NA 3PL8A 1R5GA 3DPTA 2KQRA 2V9PA 2EFWA 4P5OA 3JTGA 4KA4A 4JQFA 4L5EA 1E2XA 2NAZA 4RB3C 1JT0A 2F4IA 1HDDC 1OFCX 4MFDA 2IA2A 1HC8A 2PX9A 4NNJA 1SMTA 2NS0A 1VNDA 1RKTA 1GLNA 1ACIA 5DD8A 1SVLA 2V1UA 2K9MA 1QHGA 2VQHA 3GO5A 1AHDP 3CCYA 2WAQN 4UV9A 2QQAA 2CUFA 1K61A 3VWBA 1PVEA 2E34A 2FSWA 2XF7A 5BS6A 3PIPF 1IO2A 1T38A 2QVOA 2F5CA 3DLAA 5D5VB 2X1EA 2PBIA 2ZMEB 4A5MA 2EB7A 2D2WA 2F48A 5LGNA 2W1OA 3HOSA 2R7RA 5DYMA 3H1CA 2VT3A 4I7HA 4NC7A 2VJJA 1ZG1A 1RRJA 4L18B 1XG1A 9ANTA 3G1OA 1TWHJ 1U9OA 4II3A 3NWSA 3GTPJ 2KZGA 3OYLA 4Q5SF 1BI0A 2JVHA 3CO6C 4DJAA 3WTWC 2R7TA 5E79C 5F64A 1ZLJA 3O8GA 3Q0UA 3QYEA 3OYIA 2STWA 1R22A 5HLGA 3PJRA 3TOAA 2MFZA 2EA4A 4IVNA 1IUFA 1JUSA 2M87A 3ASNH 5LGUA 5C44J 3FXUA 4A3MJ 1KU3A 2ECCA 1ZRFA 4CCKA 4AIHA 2KDZA 2XGDA 3CF5F 4C3HJ 2GXGA 2XAGA 4V2FA 4A12A 4YG2F 3TEDA 2LRDA 1B72B 4XRSA 3L9FA 2LMDA 1HQCA 2XKOA 3SFZA 4BH9A 5F0CA 4LLNA 5A2QK 3KZIC 3BJ6A 3M1CA 1OISA 1ZHFA 4RGUA 3FIWA 3RJPA 1BI1A 2XAQA 2L4MA 2HNHA 2IA1A 2HYGD 3DV8A 3J80K 3O3KA 2XIGA 2E5NA 2VBXA 1U8RA 5GTIC 1LQ1A 2WV0A 1FSHA 1QZEA 2FE3A 5IP6A 2AS5F 4A6EA 3ZMZA 1S29A 4FISA 3F8NA 3A01A 1O3QA 2LDUA 2XPVA 4Y7NJ 3E0JB 1IRGA 2Y0SN 1UHMA 4HOBA 3VSKA 4BE2A 1SD5A 1B6AA 2G9WA 5LRRA 2ACJA 1V5GA 2LKXA 1EH6A 2KISA 4XMYA 4IHWA 3H3VK 4AWXB 1XC5A 4IRHA 1YOVB 2GA1A 3KEQA 4IPAA 1YX5A 1AU7A 1R00A 1GVJA 1BJAA 4A0YA 2L0KA 3KLNA 3U1DA 1PDNC 3BQZA 2KRFA 3AG3H 1TTYA 4ZTJA 3CUQC 1IXCA 4PGHA 1LJ9A 2GOXB 1RUNA 1Z91A 2Q8KA 2X9DA 5IT9K 1ETXA 5DCMB 1KONA 2HZTA 3GTLJ 3KLOA 1ETKA 2ZJPF 1RUOA 1JKRC 3JRBA 1VZ0A 3CUOA 4IKFA 1KGSA 5B1BH 3ZMVA 5GADJ 1KQ8A 3K4KA 3GMEA 4NBQA 3Q9SA 3W2AA 1WSUA 3DKXA 2L5QA 3D0SA 3HG9A 3DPUA 2PG4A 4CZZA 3PUBA 2FF4A 4XOTA 3IHUA 3T5XA 4HDUA 4CICA 1NG7A 4RAGA 3HGYA 3AFHA 1IN5A 4XOPA 2DO7A 3MWMA 4M71A 5CVRA 4DQ2A 4ETSA 5DV5A 4EGZA 3V7SA 1FSEA 2XSDC 3OSFA 1FYLA 3SEZA 1HKQA 2HKXA 3HTUA 2P4WA 3K70C 3TDZC 4FCYA 4HX8A 4B3XA 3IV5A 4E6KG 3HOVJ 4JP0A 2CW7A 1MBJA 1FZPB 3F6OA 4Q47A 1RIOH 3GTMJ 3BR3A 3H5AA 3FDYA 2WAQA 1I5ZA 1WZ2A 4EM2A 4M9XA 4OU0A 1APLC 3CO7C 1D0XA 5E1XA 1DPRA 2DXIA 1F43A 2M8EA 1Y39A 1UJ8A 3K1NA 3WG7H 1FMWA 4DZPA 4MEXF 1IGNA 2DYSH 5E3NA 3RKYA 5KVRA 5LLQA 2PJRB 1BL0A 3MZ8A 1ZH5A 2DK8A 2ISYA 3M4OJ 2JVGA 2M3AA 2EV0A 3LA2A 5FKKA 4H0EA 1GT0C 3T8RA 3NAUA 3CJRB 4D5CA 3BR5A 2X1CA 2QQ9A 2UXXA 2L9VA 4Z2YA 2UV1A 1P4XA 3WHCA 4WK8F 3ROUA 3MQ0A 5E1WA 2ELKA 5DUIA 5DM7F 3HRTA 3PIOF 2OA4A 2Y75A 5F04A 3S1MJ 4XLCA 1U6GA 2ZJRF 4IQJA 2X6WA 3LQRA 2HTJA 2WC2A 3RPQA 4M3DA 2LBFB 4AIDA 3CLOA 3QYBA 1QZZA 1YI2I 1BBYA 3FWEA 3OYBA 2N8GA 3KETA 1TWFJ 3R60A 5BOXA 3I56I 4BS9A 2BY2A 3O8HA 4D7MA 1K6OA 2WAFA 3KP5A 1TWCJ 1ZG5A 1X1CA 2JN6A 4G94A 2A07F 2VONA 1D1CA 1R6RA 3N05A 5ICFA 1WJAA 2VBZA 1YYVA 3QPLA 1SD7A 4MTDA 2X0LA 3K1PA 1F9NA 1PJRA 1DQUA 4E70A 1SC7A 3HOXJ 3CTAA 5E8GA 2ZXJA 4PUSA 1R1VA 3LSRA 1U78A 3OS0A 1BR4A 3CCEI 4PCQA 5EG0B 5L3FA 4LIVA 3OYNA 3F23A 3EQLF 1D1BA 2JRTA 5CLSA 5B5EC 1YX3A 3IH2A 3JRHA 3OR2C 1X58A 1FBQA 3FZVA 1U2WA 2ZNZA 5KHDA 2QKMB 2IXSA 5D4RA 1HSTA 1B8IB 2EZHA 5C4XJ 5J1UA 2LD5A 2H1LA 4E7HA 2O6GE 1AA7A 5J1YA 4D7NA 1JJ6C 2ME6A 5E18F 3TL4X 1VQNI 1A36A 1ZRCA 3J81Z 1VQPI 3CMEI 4CCOA 2LY1A 4A3CJ 2EFPA 3ZQGA 3JR9A 5FJ8J 3LAJA 3QOEA 1U0JA 1SVMA 4XRSG 3KYDB 2L02A 2DA1A 2XVCA 3W6KB 3GLLA 3QP6A 3ASOH 1TQMA 3LFKA 2KJCA 5LFAA 2Y9ZA 3OOUA 2M7BA 1MBHA 1R7JA 2EZLA 3FHZA 5H2FC 2UZKA 1DPUA 1Y0NA 1FP1D 2D5VA 1Y8RB 2MG4A 5BPIA 5D8KB 3BROA 1Y8QB 3L2RA 4M6VA 4G7OF 3BCAA 2A3SA 2NVXJ 2Z2SB 4IQ4A 3E3VA 3TOBA 3LSTA 4BBRJ 3G71I 2YX7A 4AIKA 3OYKA 3HPHA 3WU0A 3Q0WA 4G6QA 1MH4A 1HKTA 3RYRA 4BJ5C 3L00A 2E5ZA 3TO9A 2LP0A 2XROA 1R4MB 1YW7A 3I53A 1JXSA 3DP7A 3J7AY 3TW7A 1IV8A 3C2GA 1DGRM 1U5TB 3D1NI 3FISA 1LEBA 4E7ZA 2DOFA 2DQRA 3E5QA 2PEXA 2RQQA 3JCUC 1A04A 4KIBA 4BHCA 3V8LA 1LUJB 3PUFA 2DOEA 1VQ5I 1R5HA 3PSFA 3RKWA 4YFXF 4XRFA 4G7ZF 3KCCA 1AWCA 4CO8A 2PJRA 2VKDA 1YS6A 3REOA 2ADUA 4RA2A 2XPUA 3I4PA 3TKYA 1DDNA 2O3FA 2RKHA 3ZOBA 1IUYA 2LF7A 2EZKA 3DF8A 1V4RA 1W0UA 1OYIA 2DBBA 2L2OA 4HW0A 1V5FA 2ZXHA 1OCCH 2W57A 4CGZA 4I98B 1XCBA 4MTEA 2V4JC 2STTA 1V55H 3B73A 2K7LA 1IAWA 1G3TA 2VXDA 2K9SA 4XR6A 1IN8A 3H36A 2BOLA 2EK5A 4YRVA 4ZH4F 1O7FA 4AVZA 5ERIA 4L9TA 1K4TA 3BG9A 1TT5B 2Q0OA 3H0GJ 5FLXZ 3JSPA 3TMOA 4KISA 1TP4A 3IWZA 3BR6A 2LBFA 1MDMA 4DBQA 3CCRI 2CG4A 2B63J 2DA6A 1H0MA 1Z77A 3FXMA 3LSJA 1YRNA 1M1EB 3RSNA 1MZBA 2GOMA 2VBYA 5GTHC 1UCRA 3WE2A 2F5VA 2XASA 1LDDA 2Y30A 3ZR8X 5ICEA 1PUFA 2PMZN 1MGTA 2CUZA 2D45A 1XGMA 2L3DA 1SFKA 5FFZA 2QA4I 5HLTA 4OOIA 3VDXA 1XCVA 4FETA 2O7OA 1QBJA 1WH5A 5M5WJ 1TWGJ 1FTZA 5ICGA 4WCGA 1FWZA 1S5LC 3S15J 4ON0A 3K4CA 4I6ZA 3S2DJ 1CQTA 1MNEA 1TQPA 5JLXA 4CYCA 1TZLA 2E19A 2HQ5A 3V4GA 2K3FA 4IRGA 2EBIA 4CHUA 4ESBA 1ETWA 5HOOA 4ENNA 4IRIA 2HDWA 3Q0VA 2EFNA 4M9ZA 2J5PA 5GPAA 3JREA 5K7ZA 4B47A 4I02A 2BHZA 5CVUA 2XSJC 2OTJI 4RM2A 3ZP5A 4FASD 5L3DA 4EGYA 3CJNA 3RZOJ 2QSGX 2ZXWH 1MNMC 2Z1DA 4CZCA 4HNVA 4B43A 5FLVA 1TBXA 2BW3A 3DBHB 2FQ4A 1E0EA 1KQ0A 3KP7A 2M30A 3ABKH 3DKWA 4BJ6C 4XRMA 2KT0A 1Z21A 2V1NA 1ZLKA 3CCJI 5L3EA 3MN2A 1B59A 2VJ4A 3BR0A 5IP7J 3M1EA 3A0BC 1FOYA 4EVIA 3OYEA 3SDBA 2DU9A 3DXJF 3SJMA 4D9JA 3M7GA 3VFZA 3FM5A 5J4VA 3BTLA 5HVQC 5TISC 5IPAA 1ZELA 5ILSA 2KP6A 5H20A 1JE8A 4F7ZA 3HHHA 4M3BA 3I55I 1K83J 3GBGA 2GZWA 2M7AA 1HDPA 3HRMA 1BA5A 1CF7B 3TDUC 4P55A 2QSFX 1A6IA 2MD5A 3S2WA 4HNTA 2VKVA 1DU0A 2XKPA 1LFBA 1IRFA 4RLFA 3RI4A 2W25A 2LSOA 1FEXA 3ZRGA 2HPIA 4F3QA 4YIFA 4N9IA 1VQLI 1JJ8C 1VF9A 2EIMH 2K40A 2R7FA 3WU2C 2ETHA 2VJ5A 3I71A 4B4CA 2NXNB 4IL6C 2E2IJ 1R36A 2EJRA 2IGNA 2XRLA 3A01B 1Y1VJ 2CW0F 2CUEA 3CMYA 2JA5J 5D5UB 2FBKA 1O3SA 2B0LA 4PZJA 1UELB 1FNNA 3OIOA 1G8XA 5FGMA 4ESJA 4NUBA 2TCTA 1V3FA 1PP8F 1TWAJ 4BACA 2MBFA 1IXSB 3ECOA 2E1MC 2ZFUA 4UVAA 2NVUB 1YO5C 1X19A 2R93J 4PJJA 5BPDA 2X6OA 1A35A 1OKRA 3QODA 3R61A 3CF2A 2JPCA 1SFUA 4CCLA 4S0HB 1P4WA 2CRGA 3L2QA 2EFQA 1QVTA 2HQRA 5LGTA 2DPDA 3I5UA 3I54A 3HOUJ 4OMZA 2ZJ2A 2OJED 3BCBA 5CJ9A 1G3YA 4KITB 4XLHA 1GDTA 1MKMA 5FROA 4LOCA 1REPC 4BHBA 2A69F 3HJEA 5J8FA 4M3FA 2OBPA 1YIJI 1ODDA 1DP7P 1S7EA 3E5UA 1X4PA 3BG3A 3B6CA 2RN7A 3ERED 1GV2A 1SMYF 5HDGA 1ZTRA 2BVMA 4NC8A 4MQ9F 2VBWA 1STZA 3F8FA 4RS8A 2ZFWA 2B9SA 2IGKA 1XDUA 4HYEA 2H1KA 3BWGA 2CMPA 3JRAA 2XF6A 4CDGA 2DJNA 4LG3A 4XLEA 3ZQLA 3MKYB 1B4AA 3LSIA 4CSWA 4ENMA 2DI3A 2PMZA 1YITI 3HSRA 2ZC2A 4DIQA 1ZGAA 4WWCA 1HW2A 4PJ0C 1R49A 1JGSA 2KRCA 3QRFF 2HYFA 2D1VA 3PFYA 3SYTA 3K2AA 2PLYA 1X1BA 2Y0MA 3GLXA 2O61A 1ZRDA 1MD0A 2TRTA 1YJNI 3I59A 4BNCA 4EV0A 1XGNA 4OINF 2GXBA 1XDSA 1Z7LA 2YX4A 1T39A 1MBGA 5CPRB 1DGWY 1ZK8A 4ENKA 5FKNA 1W36C 4BEHA 4PFOA 4IOAF 1P9QC 1HBXG 1D8KA 1VI0A 4R8HA 2W4SA 3KPHA 4UXNA 2IJLA 2F5FA 1HXDA 4AM3A 2P0WA 1G3WA 1J09A 5GP9A 2HOTA 4AIJA 4PSXA 1K7AA 1N77A 2M45A 2L54A 1Z3XA 3LAPA 2PFBA 3WTUC 4HG2A 4IHXA 3IKTA 4OAYA 5FRNA 1WJBA 3FBIB 2EIJH 3RQIA 3W3CA 3H92A 3C18A 2MA3A 4XSXF 3WTYC 1YTYA 4DOZA 2RVCA 2F5EA 4AU7A 2E1OA 2P5KA 1NHAA 4UUSB 4BU2A 3CCQI 2K02A 2Z99A 3WGIA 2Z16A 2ZBKA 5B66C 1I1SA 2LF8A 2DN0A 4P9FA 2P5LC 4G6TB 3T0YA 2V1XA 2K5CA 3E7LA 3ML6A 4EJOA 1TNTA 2NYXA 1FPQA 2XF5A 3CUQA 1CF7A 4LJZF 1WQ2A 4ABZA 2DTZA 1KU9A 4H4KC 5KNLA 3BP8A 1QA6A 1J7KA 1XSDA 5ILVA 2EV5A 1OR7C 3EETA 3FX3A 4N9HA 4Y4RA 3GWZA 5F0FA 3ZMUA 2WB1N 2ZB9A 4XKBA 2YU9J 2DCEA 2K85A 4KMFA 2H8RA 4BDYA 3CC2I 2XUBA 4JOMA 1QRYA 2I10A 2R5YA 1SEUA 2IGOA 3U9GA 3FXQA 2Y69H 4A69C 5JHUA 3LQQA 1WCMJ 5EDNA 3KP3A 1ETYA 2VC1A 4DW6A 2MLKA 2MC3A 1MIJA 4XKVA 1LDKB 1B9MA 1MMAA 3RDIA 4ENJA 5JHFA 2FNAA 1BI2A 4V19K 3V7RA 4C3JJ 4JX6A 2WWYA 3QPSA 3OL4A 4A0ZA 2LFBA 5K5QA 3RZDJ 4HSTA 2P7CB 2KLOA 3A03A 1ETOA 1FMVA 3UR3C 1J5YA 2A68F 4BE0A 4L9JA 5KK1A 1G2HA 3FKIJ 2HDDA 3KE2A 3LSPA 4E7LA 1USSA 3IRRA 3QWLA 2X85A 1OPCA 1WHUA 2F6CA 5HS9A 1FOWA 2HXOA 5DD4A 4F91B 2PI0A 2X6XA 5DS9A 1WI3A 2JRMA 1WJ5A 2CV0A 3KEOA 3GXOA 2ID3A 1Z7UA 3TBIA 1ITYA 3MVPA 5ILUA 1LE8A 1I50J 1FX7A 2L7FP 4BBSJ 1LVAA 2XAUA 2COMA 1I39A 1S3JA 2A6HF 2ID6A 3HHGA 3TP0A 3KYCB 1DP3A 3QPTA 2CV2A 2HEOA 1T95A 3VYSB 4RMNA 3WGGA 4C2MJ 3BR2A 2H09A 4BDZA 1JUMA 3OR1C 5LHHA 2KIMA 5BMZA 2NRAC 2M5WA 1TT0A 4FX0A 3OS1A 3JRCA 3ZQQA 2KIQA 2NOJB 3CLQA 4J01A 4C30A 4ZDOA 4M6XA 4RGSA 3G6EI 2P81A 3WHBA 3FXLA 3MAJA 2MW8A 2EILH 1WRJA 3KIOA 2IA0A 4LG0A 3IAS2 3ERMA 2VPRA 1A6QA 1SVOA 4KT5C 4IJAA 4FT8A 3K70D 3SFIA 3JAMZ 2XB0X 4HNUA 3PO3J 2EPFA 2FU4A 2HQNA 3ISPA 3OSGA 1LPQA 2F4MB 3E6DA 2OV7A 2BZTA 5BNGA 3A1YA 3ZQ7A 2DMPA 4HX4A 4M73A 1IG7A 2KZVA 1V5EA 3FF5A 2HOEA 4XBFA 2CGPA 3BY6A 4B1RA 2LC2A 3TW6A 2R7QA 5D6FA 1CGPA 4JYKA 3GZ6A 3ZPLA 1I6XA 4BXFA 3B02A 3COAC 3GF2A 1HKSA 3L09A 2VI6A 4HLYA 1A31A 2FNPA 2UUZA 1QHHD 1D5YA 4LGWA 3AL0C 2KL4A 3T8TA 3SEQA 2JA8J 1FYMA 3QPHA 1QPIA 3FMSA 5E1ZB 3S8PA 4FQGA 4FE4A 1MDMB 4NQWA 5GPCA 3KX2A 4UUSA 4LB6B 2HU9A 4MLOA 1JHHA 4HV6A 1YRNB 4QTRA 2HOSA 2ZCWA 3OY9A 3N4MA 2CUJA 1D0ZA 1PUFB 2GM4A 1BM9A 4L9NA 4ESFA 3OS2A 5L3CA 2IP2A 2JTVA 3MZYA 4JX5A 2ECBA 2FXAA 1I3QJ 2EFOA 1Z6TA 2VXZA 4U7BA 4A3GJ 4RM3A 2QYOA 1U9NA 4XQFA 1YJWI 2BY0A 3FK6A 3HSEA 2K9NA 5CVVA 5AONA 5HLIA 1ENHA 1X2NA 1XN7A 3I64A 2K9QA 2WB1A 2ZMEC 2BVLA 3K4MA 4BE1A 5HS8A 4Q48A 1HF0A 4OIOF 4CCJA 3QOPA 4CYCB 4YFNF 3DBLB 4WXHA 1QZYA 4XONA 1KQ9A 1MMSA 3OIQA 2P5VA 3R0JA 2R92J 1ZR4A 1NH3A 3MMYB 3KEYA 2Y0SA 4KT6A 2P8TA 4FE7A 5E17F 3ABUA 3O6BB 2CS3A 3I58A 4XN3A 1XSVA 3FXKA 3V8JA 4F55A 1MH3A 3TP3A 1I1GA 1ORKA 2J5OA 4U7DA 1ETVA 1RNLA 1K78A 4HA8A 2OU2A 1HSJA 1EKEA 3QP5A 3BT9A 3HTSB 2BV6A 2NVQJ 3S32A 1MJBA 3GTQJ 3BG5A 5GAGJ 4BQAA 4EJTA 3P9KA 4KFCA 4RAYA 2BW3B 2VQCA 3CQZJ 2JA7J 4UV8A 3R4KA 1TQIA 3RKXA 4EJVA 3K10A 4CA0A 2M1BA 1FC3A 2IVMA 2LG4A 3K69A 4G9YA 3PNTA 4EATA 1IZ1A 4BXUA 5M3MJ 4UUTA 3EUKL 3ABLH 5C4JJ 2LREA 4ZC3A 3GTGJ 5JVGF 4EJWA 4XN0A 2DAOA 5LHGA 4ZYEA 1X4OA 2X48A 1W5SA 3BLYA 2YS9A 3HYIA 3MKWB 1K6YA 4OIQF 3A0HC 4OMYA 4L0YB 3WTXC 2R3SA 2RNGA 2M2EA 2OUMA 5J47A 1IJWC 1Z05A 2WAEA 2QM3A 3GTKJ 3NWTA 3F22A 1Z0XA 2EV6A 2EWNA 3I0TA 3HZJA 2BY3A 2W85A 1BIAA 4I01A 1PUEE 2L9SA 2JJ7A 4ANJA 5BQTA 2HWVA 2CQXA 4QWQA 4I09A 5FB2A 3OIPA 3GYHX 2A5YB 3GX4X 1AKHB 3HPGA 2JSPA 1D5VA 3OL3A 4Y52J 1FIAA 1EA3A 2VT2A 3PNVA 4GYGA 3RKQA 1IDZA 1MJAA 1QNTA 3DEEA 1QQIA 3C7JA 4LLGF 1KYWA 2QGUA 5LBQA 2DFFA 5IYBJ 4A3LJ 2E60A 2RNJA 4UVBA 2M0MA 3K1MA 3RQ4A 1RESA 3SZPA 4KJZA 5CKTA 2OZ6A 1YE9A 2DA2A 4WXDA 4LFUA 2ZO4A 1G6NA 2ZSIB 3PSIA 5EZHA 2LY9A 5HDNA 2MGQA 4EM1A 4KNYA 3HGGA 4AC0A 1MMDA 2A61A 2W84A 3WGHA 3TO7A 1J9IA 1P4AA 3LNQA 1KU7A 4II2A 1UG2A 3GTJJ 4ZZLA 2ESNA 4BHPA 4A3IJ 4XL9A 4FX4A 5FKMA 1LKXA 3H35A 3LFUA 3IC7A 5L3BA 5KAFC 5K7FA 1JTYA 5HS7A 2RAEA 3J81K 3S2HJ 2KMUA 3GFJA 2Y9YA 2Y2ZA 4R1HA 1VQ6I 3S3OA 3FXJA 5LRSA 4UB6C 1WKMA 3MEXA 2G0EA 1ZGJA 1DU6A 3M8EA 4OIRF 1W4MA 3L2UA 3E6CC 1POGA 3IAM2 3W2VA 1EF4A 4HF0A 3FM3A 1I6HJ 4C3IJ 3ESWB 2F2EA 4LITA 6PAXA 2W7NA 1YLFA 3BZ6A 3OYGA 3KZYA 5FKOA 2WY7Q 1XX5A 4ZJZA 5D8LB 2FMLA 1U8BA 1F5TA 4Y17A 5KCMA 2IRFG 3H9JA 5FRMA 5EGOB 1LNWA 4W97A 3I59B 4CYDA 1IN7A 4DBRA 1RZ4A 3MZHA 1FY7A 5JFRA 2ZXIA 3VPRA 3HBLA 5E3LA 4QLCU 2BXZA 3C1DA 4XORA 4ZYGA 5K5OA 4A6DA 1OCTC 4PFPA 3LSHA 4O6JA 2ZKZA 4BEHB 4F52A 4HAMA 1R5ID 2RQPA 4LLLA 2OC6A 4HF2A 1UAAA 1USTA 5K7HA 1N75A 1YQAA 1HA8A 4HQMA 2XC7A 4M72A 2CQQA 2JUGA 3SXYA 2E35A 2JZYA 3IRQA 4XM3A 2IS2A 2DT5A 2P6TA 2DYRH 5FD6A 2H6CA 4ASNA 4ZZDA 1IRXA 3DEWA 4B8XA 1PP7U 1WJCA 2CO5A 2HKOA 4UUVA 3CCSI 4KMUX 1MNDA 1BIBA 1XMXA 2AXTC 2HS5A 2H27A 3CZ6A 1BOBA 4MEYF 5D6EA 5J4YA 2W48A 1GXPA 1R58A 4HZFA 2LTPA 4C9YA 4GFBA 1Z67A 5E3MA 1JKQC 1FP2A 3BTCA 2E2HJ 1ON2A 3J7YJ 2ME0A 3V42A 3WG9A 3VYUB 3ZQCA 2IBDA 5AIPA 3E97A 5F08A 1YW8A 1HOMA 2KIFA 4HSRA 1H89C 4BAYA 3KP4A 3CUQB 3EYYA 4PK4A 1MMGA 5FLXK 4M6YA 4RDUA 3JRGA 1F1ZA 1JHFA 3CJQB 1UMQA 5FFXA 4L9VA 2M4KA 1TL8A 3CDIA 1RKWA 4RAZA 2R5ZB 2XGCA 4HBLA 3S17J 1SD4A 1GUUA 3DU6A 1QO0D 4JBAA 2R5YB 3FMRA 4D5FA 2KFDA 3W6VA 2QENA 2W00A 4JX4A 2ZJQF 4BY7J 1SFOJ 2CJJA 3GZ5A 2HDCA 2Q2EA 4KIGA 1AKHA 3A4CA 4BL0B 2R7WA 3BZKA 3P5JA 2DTRA 5F6FA 3BC8A 2KRHA 2B7EA 4DYCA 4UHTA 1FBUA 3ZQIA 1P7JA 3SQNA 3L2VA 4AUXA 3QU6A 3TQNA 2YR2A 2LH9A 1YW9A 1B9NA 2HXIA 4OWRB 1XSXA 3P9CA 4HQEA 1MBEA 1R23A 2OQRA 4E4HA 2EH3A 1IXRC 2P7VB 3F0CA 3U21A 3VSLA 5J8CA 1TW3A 2DT7B 1WJEA 1S6LA 3CCLI 3GUDA 1BC7C 4C2TA 2P6SA 2L01A 3K4BA 1SANA 4A3JJ 1RR8C 1WPKA 1X3UA 2NS8A 2RV8A 4RGRA 3VB2A 3BG7A 2Z9OA 2A5WA 3JSOA 4KDPA 2O5RA 5J3LA 4IHTA 1UG0A 2DMNA 4N0BA 3VODA 1NK3P 1JKPC 4BKXA 2E36A 2C6YA 1LE8B 1H8AC 3DU5A 5EYRA 2XAJA 1Z6RA 3K4JA 4I0BA 1ZN2A 2XAHA 2E1NA 1H88C 1EH8A 3EUHC 3HOZJ 1T0FC 4U0YA 2QQ8A 4J19A 3DKYA 4I2OA 4BQNA 2KHMA 3H9QA 5A2QZ 4A3DJ 2WBMA 3PFIA 1OCOH 1JTXA 3F8BA 3SHFA 3QYFA 5D4SA 3HDDA 2HZDA 3FBNB 3F3XA 3CP8A 2RREA 2CQ7A 2M8GX 4RLQA 4ZYDA 2DMTA 2PJPA 2E2JJ 4R79A 4Y13A 1U5TC 2BBYA 3J80Z 1IW7F 1QVUA 3ECHA 3LSKA 4NC6A 1Y0UA 5TRDA 1BN5A 3DBRB 4LG0B 4BGDA 3H0DA 2HOAA 4A3FJ 1MMNA 4AYBN 3FMQA 1OQYA 1BW5A 1R1TA 2XB5A 2JK3A 3G4SI 2NVYJ 5EGOA 2IGMA 1HW5A 3I9V2 3BDDA 3CESA 1X1PA 1ULYA 2X1DA 3B6AA 3MCZA 3VOEA 5DDGA 4MGRA 3G1MA 1HLVA 4S05A 3I3LA 2R0QC 2DA5A 2V26A 5IOYA 5ICCA 1OR7A 4IOCF 1EV7A 1XGOA 4CCNA 2Y31A 4XIDA 3HEFA 1S7OA 2XV4S 3HOTA 4XNFA 3WODF 2DW4A 3F21A 1W36D 4N4NB 4B3AA 1F36A 4KN7X 4LK1F 1SD6A 1KYZA 4A2UA 3ULQB 3OV8A 3HL2A 1ZARA 2V1DA 2EINH 2FOWA 1FOXA 3ABMH 3OYHA 2NS7A 4E7IA 3JRIA 1MBKA 1IV6A 2AQEA 3RPUA 3BR1A 1G4DA 3DTEA 2JUCA 4G6DA 1ONVA 5IT9Z 4C2UA 3Q5FA 2CWEA 2TDXA 4NQWB 2K4BA 1WGXA 2XDVA 3OYDA 1VQMI 3AG2H 1D3YA 2W82A 3J7ZI 4G8XA 2H94A 4P96A 5E20A 2HYJA 5JVTA 4XSZF 1GVDA 2OD5A 1ON1A 3D5LA 4GO1A 3ELKA 3MD2A 5KAIC 2BEOA 3CDHA 2EIKH 3BPXA 1RC9A 1A5JA 3HC7A 5TJJA 3LSMA 3X2QH 3E1SA 1J59A 2HVSA 2MD0A 3ZN0A 2AO9A 5IYDJ 1P6RA 2VJIA 2D1HA 2QF7A 3W2WA 4CUGA 3G73A 4KYWA 5F0HA 2K27A 2WA0A 1W7PA 2R7DA 1Z9CA 5HLHA 1OMIA 3Q3SA 1E3HA 2RC4A 3K6GA 3DFGA 5E3OA 2PQ8A 3PO2J 4GXOA 3GFIA 2X6YA 2Q1ZB 2IT0A 2VOPA 2MH9A 5B1AH 2FQ3A 3OMYA 4HV5A 4LIUA 3K9TA 3FHNA 4RAFA 3LWFA 1MSEC 1Z3YA 2QQBA 4BYYA 2BXYA 4UY8I 3A2KA 1P92A 3M07A 2V79A 1J2XA 1R4NB 2CQKA 4MHGA 2VN2A 4P9UA 2O0YA 2R7OA 4L5JA 3ZCOA 2VPLA 3BPVA 3F8MA 4EM0B 3IUOA 4ZDPA 1K78B 2BYVE 2L9NA 4ZTFA 1Y56A 1O7LA 2FBIA 2IAIA 3RPUD 4PJMA 1T33A 5HNFA 1X3ZB 3OYFA 2LKPA 1PYVA 4YELA 3IWFA 3AG1H 3RTRA 1R9TJ 2XGXA 1QPMA 3F8CA 4E7JA 4ZYHA 2R7SA 2FD5A 4NDLA 3H9GA 3NQOA 3DCFA 1OLTA 3HOYJ 1J75A 5H6QA 2MYSA 4ZYAA 1VQOI 2EQRA 2O8XA 2E7XA 3HB9A 1JKOC 3F6VA 2FMYA 1VTNC 5IP9J 4M74A 4XLPF 3WU1B 4HDVA 1UHSA 2FJ1A 2FOKA 3KP6A 3HUGA 4IZZA 1W7PD 1H9TA 1AOYA 3LSGA 4BJTA 2W24A 4DYQA 2OQGA 3NRVA 2FUG2 1WH7A 1O57A 3ZN1A 3OYCA 2RDPA 4DNCA 1JI8A 3CJTB 4B48A 1FJLA 1D0YA 1H9GA 4TV7A 2DDAA 4BXXJ 4V2GA 4L5IA 2HI3A 4M3GA 2XPWA 3LA7A 2G7UA 2QZ8A 1U3EM 1FOKA 1IN6A 1XMKA 2QUFA 4J00A 4HF1A 5EZGA 4EQQA 1G3SA 5C3EJ 2O9LA 3HOWJ 3DPLC 4BQOA 1KA8A 1RR7A 1XB4A 4XLFA 2L4AA 5F1JA 3D5RC 5EF6A 3PQJA 2CQNA 2WY8Q 4WF2A 3GTOJ 4LB5A 2OAZA 2E7WA 2G7HA 2MLGA 4ZDLA 4I0AA 1UFMA 4AYBA 1RETA 4X1EA 4EMSA 3DLLF 2CYYA 1T98A 3CCUI 3GW2A 3HIFA 3K7AJ 2R4GA 4LMYA 3KP2A 3HRSA 3CCMI 3RIRA 2IEKA 2DA7A 3S16J 3BTIA 5CYVA 1LFPA 2QSHX 1T2KA 4DYRA 3S1NJ 2F4OB 4F93B 2ZMEA 3EUAA 5ED4A 1EJ9A 2DQLA 3E6MA 1FLIA 3NARA 2VB6A 3QQAA 3AAFA 3JW4A 4XLAA 3I4MJ 1YFHA 5CVIA 1I3AA 3F9KA 4GYIA 3AG4H 4PJNA 3U1KA 2WV1A 3S1RJ 1G59A 1YS7A 2UWMA 4RGXA 3CD6I 2VUMJ 1XTAA 3VEPA 4QPQA 4A3BJ 2VASA 1E17A 5JR3A 1SFXA 1NK2P 2PMHA 5E8IA 2VLAA 1OCPA 2VE8A 5H6RA 1KU2A 3CCVI 4YIRX 3V8KA 3BJAA 4FHTA 1JT6A 3GEZA 3EDPA 3C2HA 2R5ZA 1E3OC 2CW8A 1L3LA 3WE3A 3C2BA 2IW5A 4LK0F 5IY5H 3PNYA 4XK4A 4PJLA 3V7CA 1TC3C 3ZXSA 3U2RA 4L0ZB 1VQ9I 1BW6A 2BGCA 3L2WA 3LA3A 3WTZA 3J7AO 2VL8A 3R0AA 3OOPA 1T8IA 2NVTJ 5LEJA 1UB9A 1QU3A 1ZKGA 1DUXC 1B72A 2CV1A 3GCMA 1YIOA 2BE5F 2Z33A 2V7FA 2COBA 4QPOA 1BC8C 3GVAA 3M8JA 1Q1VA 2DODA 4Y33A 3IH3A 4IXAA 4NHJA 3HKZN 2DFHA 2DFEA 1LDJA 5LEKA 1VQ8I 2DK5A 1P2FA 4QIWN 3WTSC 1HW1A 2DMUA 4E7KA 3S93A 5GAEJ 4RB0A 1WVRA 2CSOA 3PM1A 3S3NA 2OTLI 4YEJA 4DZJA 2FBHA 2V9KA 4MNUA 2A6TA 4YFKF 3JAMK 4D1QA 1X1DA 4Y3OA 4Q4ZF 3L1PA 2R7VA 2L9RA 4IEJA 3DQVC 4GCVA 2LK2A 4KICA 2OZUA 1T08B 5J6XA 4I99C 3DTKA 1ETQA 3DTIA 4Y15A 4XKWA 2L7KA 1VFCA 4UB8C 5EJCA 4IHVA 2QWWA 2XRNA 5F27A 4UNOA 2NNNA 4U0WA 5JI6A 2GAUA 1ZAOA 3LL7A 3W6JB 3KFWX 5M5XJ 5D5WB 1ERDA 2HGCA 5CQEA 2E1MB 5DEQA 5L3GA 4A0XA 1GHCA 1NG6A 1N25A 2M9HA 2OCEA 1WI9A 2HR3A 2DT6A 4N4OB 5K1YA 1LVKA 2K3PA 4B09A 3O2PE 4G7HF 2XHKA 5D5XB 4MFEA 2OCCH 5DCMA 1FTTA 1IN4A 1XD7A 5IYCJ 2DA3A 1SAUA 5DCFA 3K0LA 1O3RA 2K4JA 2Z5UA 3T1BA 4D0PA 1BI3A 1VQKI 2R7UA 4WXCA 2GA2A 5FLMJ 4BUPA 2X4HA 4WX9A 4PDKA 1I27A 4HLXA 3ONQA 3H5RA 3GFLA 2LYCA 4CCMA 2Q2EB 3ZQFA 4M9SA 3UKGA 1MSFC 1XGSA 2QCOA 3EYIA 3MKZA 2DPUA 3RCOA 1XS9A 3K4NA 1HCRA 3Q9VA 2R7XA 4O5VA 2X51A 2FX0A 4X6AJ 2JWTA 4NB5A 4F92B 1Q1HA 3QAHA 3M9AA 4IF4A 4QSHA 2MC4A 3HM5A 3G1LA 5CQGA 4CH7A 5F1RA 5JLWA 4KN4X 3MKLA 5J40A 1SAXA 2AHQA 2RGVA 1WFXA 2LNBA 1O4XA 4GDFA 3LMMA 1LFUP 1ZYRF 3BG6A 1OCZH 2GIVA 4HEA2 5FKLA 2XGEA 2BY1A 1IC8A 5HODA 4HX7A 2GXAA 1TLHB 3JTHA 5M5YJ 4EJUA 4X0GA 3ZQHA 3OWTA 2QBYB 1D1AA 3ABTA 2FRHA 5GAHJ 2MABA 2VIXA 2M0CA 5AIQA 4XICA 2EZIA 2JA2A 4E7SA 2R7ZJ 2GWRA 3E6BA 3HRUA 1Y1WJ 4IHSA 3CP2A 5EEGA 2LY2A 2GLOA 3ZMTA 3WTVC 4AVPA 1BJZA 1ZGWA 1S9HA 4RBOA 2M34A 2JQ7A 2GBYA 2QKLB 2OPTA 4MO7A 3ZGKA 2JPBA 3FK7A 1JUPA 4KUMA 1SFEA 1T56A 2KPMA 4W1UA 2AQFA 3QU3A 3R6SA 1LEAA 3L7WA 2FEZA 1W5CC 5J1RA 2VE9A 2K9LA 4S04A 1C0WA 2PMUA 3S3MA 4XLNF 1YG2A 2V9VA 1OJLA 2WADA 1W1WE 1WJDA 4OIPF 4MQVA 1OCRH 2CH0A 2DMQA 3CMMA 4BY1J 2NOGA 5LD2C 2O03A 5IT3A 3PQKA 2KDOA 2A6EF 2DJIA 1UHWA 2VQLA 3RYPA 2OF7A 4A93J 1R1UA 1S72I 2YSRA 1RPWA 4U88A 2HVRA 1MW7A 2JA6J 3DEUA 3A02A 2GQQA 5HNHA 2KKOA 4K2EA 2VKEA 3G2BA 5TGTA 3CC4I 1W5TA 2MH2A 2YU3A 2ZNYA 2BHYA 3GFMA 4MIMA 3OYAA 1R71A 3HXLA 1WWXA 3OYMA 2IS6A 3HKZA 1BR1A 1W0TA 1ZR2A 1E3PA 1TW2A 4XKCA 3KYLA 2AXLA 5B3SH 3D5SC 5DTDA 1KZHA 3ZMSA 3HSFA 2A05A 1X1AA 5HDKA 4PGGA 4EEFG 1OYYA 4U87A 1X2MA 1L0OC 2DA4A 2QLZA 4G12A 3JRDA 3I4NJ 4DGWB 5EG0A 2JT1A 2JSCA 4A5NA 4IO9F 2UXNA 1OYWA 5IOZA 3UNGC 2V6EA 3BQYA 4A3EJ 2VOOA 2CFXA 3SDGA 4HRIA 4RB1A 4UVCA 1B1BA 1B8IA 2ISZA 3ZMDA 2MSYA 4Z6YA 1K4SA 1IDYA 3SZTA 3CDLA 4HPQA 1NTCA 2L7MP 5DUKA 1P7IA 3VYRB 3CMAI 1TNSA 2KJBA 2DLLA
chains in the Genus database with same CATH topology
3NEUA 3E5XA 3TGNA 2IPQX 2WTEA 2VC0A 3H3ZA 4RB2C 1F4KA 2EA2A 2H6BA 2HTSA 2Z3YA 5CVJA 1LB2A 4YIIA 2XAFA 4JK1X 4AD9A 2NNYA 3KZZA 3L2CA 3FXRA 2ESHA 5EEHA 1EH7A 3G3ZA 5FO5A 5LHIA 1W7PB 1J0RA 3M8FA 3C3WA 3EUHA 1T0FA 3WTTC 2FA5A 1FYKA 2ELHA 3P7NA 4CXFA 5FD5A 3BJOA 2DFIA 3MFKA 1FBSA 3P9IA 3K2ZA 1U5TA 4U0VA 3BOQA 4GGGA 2Y48A 2F5DA 1K79A 1D8JA 5K5RA 4O3MA 1Z1DA 4LD5A 2QBYA 3IKVA 3TO6A 1T6SA 1XMAA 2E1CA 2YPRA 1ZG3A 3F72A 2PN6A 1ZREA 1BOAA 1GXQA 1O3TA 2KIUA 2HFHA 3N97A 1RI7A 1S8NA 2V6CA 1QGPA 4KIFA 3IL2A 1IF1A 1FT9A 2K86A 2VODA 3H3UA 1MJ9A 1S7AA 1R5GA 3DPTA 2EFWA 4P5OA 3JTGA 4KA4A 4JQFA 1E2XA 2NAZA 4RB3C 2IA2A 1SMTA 2NS0A 5DD8A 2V1UA 3GO5A 4UV9A 2QQAA 2FSWA 5BS6A 1T38A 2QVOA 2F5CA 5D5VB 2PBIA 2ZMEB 4A5MA 2EB7A 2D2WA 5LGNA 3HOSA 5DYMA 4I7HA 2VT3A 1ZG1A 4L18B 4Q5SF 1BI0A 3CO6C 3WTWC 5F64A 1ZLJA 2STWA 1R22A 5HLGA 3TOAA 2EA4A 4IVNA 2M87A 5LGUA 3FXUA 1KU3A 1ZRFA 4AIHA 2GXGA 2XAGA 4A12A 4YG2F 3L9FA 3SFZA 1HQCA 2XKOA 4BH9A 4LLNA 5A2QK 3BJ6A 1ZHFA 4RGUA 3RJPA 1BI1A 2XAQA 2L4MA 2IA1A 2HYGD 3DV8A 3J80K 3O3KA 2XIGA 2VBXA 1U8RA 1LQ1A 2WV0A 1FSHA 2FE3A 2AS5F 4A6EA 3ZMZA 1S29A 3F8NA 1O3QA 2LDUA 1IRGA 1UHMA 4HOBA 1SD5A 1B6AA 2G9WA 5LRRA 2ACJA 1EH6A 4AWXB 4IRHA 2GA1A 3KEQA 4IPAA 1R00A 1GVJA 1BJAA 4A0YA 3KLNA 3U1DA 1PDNC 2KRFA 1TTYA 3CUQC 1IXCA 4PGHA 1LJ9A 1RUNA 1Z91A 2Q8KA 5IT9K 5DCMB 2HZTA 3KLOA 1RUOA 3CUOA 1KGSA 1KQ8A 3ZMVA 3Q9SA 1WSUA 3D0SA 2PG4A 4CZZA 2FF4A 3IHUA 3T5XA 4HDUA 4CICA 1IN5A 2DO7A 3MWMA 4M71A 5CVRA 4DQ2A 4ETSA 5DV5A 4EGZA 3V7SA 1FSEA 1FYLA 1HKQA 2HKXA 3HTUA 2P4WA 3TDZC 4HX8A 1FZPB 3F6OA 4Q47A 1RIOH 1I5ZA 4EM2A 4M9XA 4OU0A 3CO7C 5E1XA 1DPRA 2M8EA 3K1NA 4MEXF 3RKYA 5KVRA 5LLQA 1ZH5A 2DK8A 2ISYA 2EV0A 3LA2A 4H0EA 3T8RA 2QQ9A 2UXXA 4Z2YA 1P4XA 4WK8F 3ROUA 3MQ0A 5E1WA 5DUIA 3HRTA 2OA4A 2Y75A 1U6GA 3LQRA 2HTJA 2WC2A 3RPQA 3CLOA 1QZZA 1BBYA 3FWEA 3KETA 3R60A 5BOXA 1K6OA 3KP5A 1ZG5A 2VONA 4G94A 2A07F 5ICFA 2VBZA 1YYVA 1SD7A 4MTDA 2X0LA 3K1PA 1F9NA 4E70A 3CTAA 5E8GA 2ZXJA 1R1VA 1U78A 4PCQA 5L3FA 3F23A 3EQLF 5CLSA 2JRTA 1FBQA 3FZVA 1U2WA 2ZNZA 5D4RA 1HSTA 2O6GE 5E18F 1ZRCA 3J81Z 2EFPA 3LAJA 2L02A 2XVCA 3W6KB 3QP6A 1TQMA 3LFKA 2KJCA 1R7JA 3FHZA 2UZKA 1DPUA 1FP1D 5BPIA 5D8KB 3BROA 4G7OF 2A3SA 3TOBA 3E3VA 3LSTA 2YX7A 4AIKA 3WU0A 4G6QA 1HKTA 3RYRA 3L00A 3TO9A 2XROA 1YW7A 3I53A 1JXSA 3DP7A 1U5TB 1LEBA 2DQRA 3E5QA 2PEXA 4KIBA 1A04A 4BHCA 3V8LA 1R5HA 3RKWA 4YFXF 4XRFA 4G7ZF 3KCCA 1AWCA 4CO8A 1YS6A 3REOA 2ADUA 3I4PA 3TKYA 1DDNA 1IUYA 2O3FA 2RKHA 2LF7A 3DF8A 1V4RA 1OYIA 2DBBA 4HW0A 2W57A 4CGZA 4I98B 1XCBA 4MTEA 2STTA 3B73A 2K7LA 1IAWA 1G3TA 1IN8A 2EK5A 4ZH4F 1O7FA 5ERIA 4L9TA 5FLXZ 2Q0OA 3JSPA 3IWZA 1MDMA 2CG4A 1H0MA 1MZBA 2VBYA 1UCRA 3WE2A 2XASA 1LDDA 5ICEA 1MGTA 2D45A 1XGMA 2L3DA 5FFZA 4OOIA 1XCVA 1QBJA 5ICGA 4WCGA 1FWZA 4ON0A 1TQPA 3V4GA 4IRGA 4CHUA 4ESBA 5HOOA 4ENNA 4IRIA 2EFNA 4M9ZA 2J5PA 4I02A 5CVUA 3ZP5A 5L3DA 4EGYA 3CJNA 1TBXA 1KQ0A 3KP7A 2M30A 3DKWA 1ZLKA 5L3EA 1B59A 3M1EA 4EVIA 2DU9A 3DXJF 3M7GA 3VFZA 3FM5A 5HVQC 5ILSA 5H20A 1JE8A 4F7ZA 3HHHA 2GZWA 3HRMA 1CF7B 3TDUC 4P55A 2MD5A 3S2WA 2XKPA 1IRFA 3RI4A 2W25A 2LSOA 4YIFA 4N9IA 2R7FA 2ETHA 3I71A 2EJRA 1R36A 2CW0F 5D5UB 2FBKA 1O3SA 2B0LA 4PZJA 1FNNA 5FGMA 4ESJA 1V3FA 1PP8F 2MBFA 1IXSB 3ECOA 4UVAA 1YO5C 5BPDA 1OKRA 3R61A 2JPCA 1SFUA 1P4WA 2EFQA 2HQRA 5LGTA 2DPDA 3I5UA 3I54A 4OMZA 2ZJ2A 5CJ9A 1G3YA 1MKMA 1REPC 4BHBA 2A69F 5J8FA 2OBPA 1ODDA 1DP7P 3E5UA 2RN7A 3ERED 1SMYF 5HDGA 4MQ9F 2VBWA 1STZA 3F8FA 4RS8A 2ZFWA 1XDUA 4HYEA 3BWGA 4CDGA 1B4AA 4ENMA 2DI3A 3HSRA 1ZGAA 4WWCA 1HW2A 1JGSA 3QRFF 2HYFA 2D1VA 2PLYA 2Y0MA 3GLXA 2O61A 1ZRDA 1MD0A 3I59A 4BNCA 4EV0A 1XGNA 4OINF 2GXBA 1XDSA 2YX4A 1T39A 4ENKA 1HBXG 1D8KA 4R8HA 4UXNA 2IJLA 2F5FA 1HXDA 1G3WA 4AIJA 1K7AA 2M45A 2L54A 3LAPA 2PFBA 3WTUC 3IKTA 3H92A 3C18A 2MA3A 4XSXF 3WTYC 1YTYA 2RVCA 2F5EA 2P5KA 1NHAA 2K02A 2Z99A 3WGIA 2ZBKA 1I1SA 2LF8A 4P9FA 2P5LC 3T0YA 2V1XA 4EJOA 3ML6A 1CF7A 1TNTA 2NYXA 1FPQA 3CUQA 4LJZF 1WQ2A 1KU9A 3BP8A 1J7KA 1XSDA 5ILVA 2EV5A 3EETA 3FX3A 4N9HA 3ZMUA 3GWZA 4KMFA 2XUBA 3U9GA 3FXQA 5JHUA 3LQQA 3KP3A 2VC1A 2MLKA 2MC3A 1LDKB 1B9MA 3RDIA 4ENJA 2FNAA 1BI2A 3V7RA 2WWYA 4A0ZA 5K5QA 2P7CB 1J5YA 2A68F 4L9JA 5KK1A 3KE2A 1USSA 3IRRA 1OPCA 5HS9A 5DD4A 2PI0A 3KEOA 3GXOA 1Z7UA 5ILUA 1FX7A 1LVAA 2COMA 1S3JA 2A6HF 3HHGA 3QPTA 2HEOA 3WGGA 2H09A 5LHHA 2KIMA 5BMZA 2NRAC 2M5WA 4FX0A 4M6XA 4RGSA 3MAJA 1WRJA 2IA0A 4LG0A 4KT5C 4IJAA 4FT8A 3JAMZ 2FU4A 2HQNA 3ISPA 3E6DA 3ZQ7A 4HX4A 4M73A 3FF5A 2HOEA 4XBFA 2CGPA 3BY6A 5D6FA 1CGPA 3GZ6A 3ZPLA 1I6XA 3B02A 3COAC 3GF2A 1HKSA 3L09A 4HLYA 2FNPA 4LGWA 3T8TA 1FYMA 3QPHA 3FMSA 5E1ZB 1MDMB 4NQWA 4LB6B 1JHHA 4HV6A 2ZCWA 3N4MA 1BM9A 4L9NA 4ESFA 5L3CA 2IP2A 2JTVA 3MZYA 2FXAA 2EFOA 1Z6TA 2VXZA 4U7BA 2QYOA 5AONA 3HSEA 5CVVA 5HLIA 1XN7A 3I64A 4OIOF 5HS8A 4Q48A 3QOPA 4YFNF 4WXHA 1QZYA 1KQ9A 2P5VA 3R0JA 2P8TA 5E17F 3ABUA 3O6BB 3I58A 1XSVA 3V8JA 1I1GA 2J5OA 4U7DA 1RNLA 1K78A 4HA8A 2OU2A 1HSJA 3QP5A 3HTSB 2BV6A 1MJBA 4BQAA 4EJTA 3P9KA 4KFCA 4RAYA 4UV8A 3R4KA 1TQIA 3RKXA 4EJVA 2M1BA 1FC3A 2IVMA 3K69A 4G9YA 1IZ1A 4BXUA 4EJWA 2DAOA 5LHGA 4ZYEA 1W5SA 3HYIA 4OIQF 4OMYA 4L0YB 3WTXC 2R3SA 1Z05A 2QM3A 3F22A 2EV6A 2EWNA 3I0TA 2W85A 1BIAA 4I01A 1PUEE 5BQTA 2HWVA 4QWQA 4I09A 5FB2A 3GYHX 2A5YB 3GX4X 1D5VA 2VT2A 4GYGA 1MJAA 1QNTA 1QQIA 3C7JA 4LLGF 1KYWA 5LBQA 4UVBA 2RNJA 3K1MA 3SZPA 2OZ6A 4WXDA 4LFUA 2ZO4A 1G6NA 5HDNA 4EM1A 4KNYA 2A61A 2W84A 3WGHA 3TO7A 1J9IA 1P4AA 1KU7A 4ZZLA 2ESNA 4BHPA 4FX4A 3IC7A 5L3BA 5HS7A 3J81K 3GFJA 4R1HA 5LRSA 1WKMA 3MEXA 1ZGJA 3M8EA 4OIRF 1W4MA 3E6CC 4HF0A 3FM3A 2F2EA 6PAXA 1YLFA 3BZ6A 3KZYA 5D8LB 2FMLA 1F5TA 4Y17A 2IRFG 1LNWA 3I59B 4CYDA 1IN7A 1RZ4A 3MZHA 1FY7A 5JFRA 4QLCU 3C1DA 4ZYGA 5K5OA 4A6DA 4O6JA 2ZKZA 4HAMA 2RQPA 4LLLA 4HF2A 1USTA 1YQAA 4HQMA 4M72A 3SXYA 3IRQA 2JZYA 2DT5A 2P6TA 5FD6A 2H6CA 4ASNA 4ZZDA 4B8XA 1PP7U 2CO5A 2HKOA 4UUVA 4KMUX 1BIBA 2HS5A 2H27A 4MEYF 5D6EA 1GXPA 1R58A 4HZFA 1FP2A 1ON2A 3WG9A 5AIPA 3E97A 1YW8A 2KIFA 4BAYA 3KP4A 3CUQB 3EYYA 5FLXK 4M6YA 1F1ZA 1JHFA 5FFXA 4L9VA 4RAZA 4HBLA 1SD4A 1QO0D 4JBAA 3FMRA 2QENA 3GZ5A 2HDCA 2Q2EA 4KIGA 5F6FA 2DTRA 4UHTA 1FBUA 3SQNA 3QU6A 3TQNA 2YR2A 1YW9A 1B9NA 1XSXA 3P9CA 4HQEA 1R23A 2OQRA 1IXRC 2P7VB 5J8CA 1TW3A 1S6LA 3GUDA 1BC7C 2P6SA 2L01A 1X3UA 2RV8A 4RGRA 3VB2A 2Z9OA 3JSOA 4KDPA 4IHTA 4N0BA 3VODA 2C6YA 2XAJA 1Z6RA 4I0BA 1ZN2A 2XAHA 2E1NA 1EH8A 4U0YA 4I2OA 5A2QZ 3PFIA 3F8BA 3SHFA 5D4SA 3F3XA 4ZYDA 2PJPA 4R79A 4Y13A 1U5TC 2BBYA 3J80Z 1IW7F 3ECHA 5TRDA 1Y0UA 1BN5A 4LG0B 3FMQA 1R1TA 1HW5A 3BDDA 1ULYA 3MCZA 5DDGA 3VOEA 4MGRA 4S05A 5ICCA 1OR7A 1EV7A 1XGOA 1S7OA 2XV4S 3HOTA 3WODF 2DW4A 3F21A 4LK1F 4KN7X 1SD6A 1KYZA 4A2UA 3ULQB 3OV8A 1ZARA 2V1DA 3RPUA 1G4DA 4G6DA 1ONVA 5IT9Z 3Q5FA 2CWEA 2TDXA 2K4BA 1D3YA 4G8XA 2H94A 4P96A 5E20A 5JVTA 4XSZF 2OD5A 1ON1A 3D5LA 4GO1A 3ELKA 2BEOA 3CDHA 3BPXA 5TJJA 1J59A 3ZN0A 1P6RA 2D1HA 3G73A 4KYWA 2K27A 1Z9CA 1W7PA 2R7DA 5HLHA 1OMIA 2RC4A 3DFGA 2PQ8A 4GXOA 3GFIA 2VOPA 2IT0A 2MH9A 2FQ3A 4HV5A 3K9TA 3LWFA 2QQBA 4BYYA 1P92A 2V79A 1J2XA 2CQKA 4MHGA 2VN2A 4P9UA 2O0YA 4L5JA 3BPVA 3F8MA 4EM0B 1K78B 2BYVE 1O7LA 2FBIA 2LKPA 3IWFA 3RTRA 2XGXA 1QPMA 3F8CA 4ZYHA 3NQOA 1J75A 5H6QA 2O8XA 2E7XA 3F6VA 2FMYA 1VTNC 4M74A 4XLPF 3WU1B 4HDVA 2FOKA 3KP6A 3HUGA 1W7PD 1H9TA 1AOYA 2W24A 2OQGA 3NRVA 1O57A 3ZN1A 2RDPA 4DNCA 1H9GA 4TV7A 4L5IA 3LA7A 2G7UA 2QZ8A 1U3EM 1FOKA 1IN6A 1XMKA 2QUFA 4HF1A 4EQQA 1G3SA 3DPLC 1KA8A 1XB4A 2L4AA 3PQJA 4WF2A 4LB5A 2OAZA 2E7WA 2G7HA 2MLGA 4I0AA 1UFMA 4EMSA 2CYYA 1T98A 3GW2A 3HIFA 4LMYA 3KP2A 3HRSA 3RIRA 5CYVA 1T2KA 1FLIA 2ZMEA 5ED4A 2DQLA 3E6MA 3AAFA 3JW4A 1YFHA 5CVIA 4GYIA 1YS7A 2UWMA 4RGXA 3VEPA 1E17A 5JR3A 1SFXA 2PMHA 5E8IA 2VE8A 5H6RA 1KU2A 3V8KA 3BJAA 4FHTA 3GEZA 3EDPA 1L3LA 3WE3A 4LK0F 2IW5A 3V7CA 3U2RA 4L0ZB 2BGCA 3LA3A 3WTZA 3J7AO 3R0AA 3OOPA 5LEJA 1UB9A 1DUXC 1YIOA 2BE5F 2Z33A 1BC8C 3GVAA 4IXAA 4NHJA 1LDJA 5LEKA 2DK5A 1P2FA 3WTSC 1HW1A 4RB0A 2CSOA 2FBHA 4MNUA 4YFKF 3JAMK 4Q4ZF 3DQVC 4GCVA 4KICA 2OZUA 5J6XA 4Y15A 2QWWA 2XRNA 4UNOA 2NNNA 4U0WA 5JI6A 2GAUA 1ZAOA 3W6JB 3KFWX 5D5WB 2HGCA 5DEQA 5L3GA 4A0XA 1GHCA 1WI9A 2HR3A 5K1YA 4B09A 3O2PE 4G7HF 2XHKA 5D5XB 5DCMA 1IN4A 1XD7A 5DCFA 3K0LA 1O3RA 2K4JA 2Z5UA 3T1BA 4D0PA 1BI3A 4WXCA 2GA2A 2X4HA 4WX9A 4PDKA 1I27A 4HLXA 3GFLA 4M9SA 1XGSA 3EYIA 2DPUA 3Q9VA 4O5VA 4NB5A 1Q1HA 3QAHA 3M9AA 4IF4A 5F1RA 4KN4X 1SAXA 2RGVA 2LNBA 1ZYRF 2GIVA 4HX7A 1TLHB 3JTHA 4EJUA 2QBYB 3ABTA 2FRHA 5AIQA 2GWRA 3E6BA 3HRUA 4IHSA 5EEGA 3ZMTA 3WTVC 4AVPA 2JPBA 4KUMA 1SFEA 3R6SA 3QU3A 1LEAA 3L7WA 2FEZA 2VE9A 4S04A 1C0WA 2PMUA 4XLNF 1YG2A 2V9VA 4OIPF 4MQVA 2O03A 5IT3A 3PQKA 2A6EF 1UHWA 3RYPA 1R1UA 2YSRA 4U88A 3DEUA 2GQQA 2KKOA 4K2EA 1W5TA 2MH2A 2YU3A 2ZNYA 3GFMA 1WWXA 1TW2A 2AXLA 3ZMSA 3HSFA 5HDKA 4PGGA 1OYYA 1L0OC 2QLZA 2JT1A 2JSCA 4A5NA 2UXNA 1OYWA 2VOOA 2CFXA 4RB1A 4UVCA 1B1BA 2ISZA 3ZMDA 3SZTA 5DUKA 1TNSA 2KJBA 2DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEU A;  3E5X A;  3TGN A;  2IPQ X;  2WTE A;  2VC0 A;  3H3Z A;  4RB2 C;  1F4K A;  2EA2 A;  2H6B A;  2HTS A;  2Z3Y A;  5CVJ A;  1LB2 A;  4YII A;  2XAF A;  4JK1 X;  4AD9 A;  2NNY A;  3KZZ A;  3L2C A;  3FXR A;  2ESH A;  5EEH A;  1EH7 A;  3G3Z A;  5FO5 A;  5LHI A;  1W7P B;  1J0R A;  3M8F A;  3C3W A;  3EUH A;  1T0F A;  3WTT C;  2FA5 A;  1FYK A;  2ELH A;  3P7N A;  4CXF A;  5FD5 A;  3BJO A;  2DFI A;  3MFK A;  1FBS A;  3P9I A;  3K2Z A;  1U5T A;  4U0V A;  3BOQ A;  4GGG A;  2Y48 A;  2F5D A;  1K79 A;  1D8J A;  5K5R A;  4O3M A;  1Z1D A;  4LD5 A;  2QBY A;  3IKV A;  3TO6 A;  1T6S A;  1XMA A;  2E1C A;  2YPR A;  1ZG3 A;  3F72 A;  2PN6 A;  1ZRE A;  1BOA A;  1GXQ A;  1O3T A;  2KIU A;  2HFH A;  3N97 A;  1RI7 A;  1S8N A;  2V6C A;  1QGP A;  4KIF A;  3IL2 A;  1IF1 A;  1FT9 A;  2K86 A;  2VOD A;  3H3U A;  1MJ9 A;  1S7A A;  1R5G A;  3DPT A;  2EFW A;  4P5O A;  3JTG A;  4KA4 A;  4JQF A;  1E2X A;  2NAZ A;  4RB3 C;  2IA2 A;  1SMT A;  2NS0 A;  5DD8 A;  2V1U A;  3GO5 A;  4UV9 A;  2QQA A;  2FSW A;  5BS6 A;  1T38 A;  2QVO A;  2F5C A;  5D5V B;  2PBI A;  2ZME B;  4A5M A;  2EB7 A;  2D2W A;  5LGN A;  3HOS A;  5DYM A;  4I7H A;  2VT3 A;  1ZG1 A;  4L18 B;  4Q5S F;  1BI0 A;  3CO6 C;  3WTW C;  5F64 A;  1ZLJ A;  2STW A;  1R22 A;  5HLG A;  3TOA A;  2EA4 A;  4IVN A;  2M87 A;  5LGU A;  3FXU A;  1KU3 A;  1ZRF A;  4AIH A;  2GXG A;  2XAG A;  4A12 A;  4YG2 F;  3L9F A;  3SFZ A;  1HQC A;  2XKO A;  4BH9 A;  4LLN A;  5A2Q K;  3BJ6 A;  1ZHF A;  4RGU A;  3RJP A;  1BI1 A;  2XAQ A;  2L4M A;  2IA1 A;  2HYG D;  3DV8 A;  3J80 K;  3O3K A;  2XIG A;  2VBX A;  1U8R A;  1LQ1 A;  2WV0 A;  1FSH A;  2FE3 A;  2AS5 F;  4A6E A;  3ZMZ A;  1S29 A;  3F8N A;  1O3Q A;  2LDU A;  1IRG A;  1UHM A;  4HOB A;  1SD5 A;  1B6A A;  2G9W A;  5LRR A;  2ACJ A;  1EH6 A;  4AWX B;  4IRH A;  2GA1 A;  3KEQ A;  4IPA A;  1R00 A;  1GVJ A;  1BJA A;  4A0Y A;  3KLN A;  3U1D A;  1PDN C;  2KRF A;  1TTY A;  3CUQ C;  1IXC A;  4PGH A;  1LJ9 A;  1RUN A;  1Z91 A;  2Q8K A;  5IT9 K;  5DCM B;  2HZT A;  3KLO A;  1RUO A;  3CUO A;  1KGS A;  1KQ8 A;  3ZMV A;  3Q9S A;  1WSU A;  3D0S A;  2PG4 A;  4CZZ A;  2FF4 A;  3IHU A;  3T5X A;  4HDU A;  4CIC A;  1IN5 A;  2DO7 A;  3MWM A;  4M71 A;  5CVR A;  4DQ2 A;  4ETS A;  5DV5 A;  4EGZ A;  3V7S A;  1FSE A;  1FYL A;  1HKQ A;  2HKX A;  3HTU A;  2P4W A;  3TDZ C;  4HX8 A;  1FZP B;  3F6O A;  4Q47 A;  1RIO H;  1I5Z A;  4EM2 A;  4M9X A;  4OU0 A;  3CO7 C;  5E1X A;  1DPR A;  2M8E A;  3K1N A;  4MEX F;  3RKY A;  5KVR A;  5LLQ A;  1ZH5 A;  2DK8 A;  2ISY A;  2EV0 A;  3LA2 A;  4H0E A;  3T8R A;  2QQ9 A;  2UXX A;  4Z2Y A;  1P4X A;  4WK8 F;  3ROU A;  3MQ0 A;  5E1W A;  5DUI A;  3HRT A;  2OA4 A;  2Y75 A;  1U6G A;  3LQR A;  2HTJ A;  2WC2 A;  3RPQ A;  3CLO A;  1QZZ A;  1BBY A;  3FWE A;  3KET A;  3R60 A;  5BOX A;  1K6O A;  3KP5 A;  1ZG5 A;  2VON A;  4G94 A;  2A07 F;  5ICF A;  2VBZ A;  1YYV A;  1SD7 A;  4MTD A;  2X0L A;  3K1P A;  1F9N A;  4E70 A;  3CTA A;  5E8G A;  2ZXJ A;  1R1V A;  1U78 A;  4PCQ A;  5L3F A;  3F23 A;  3EQL F;  5CLS A;  2JRT A;  1FBQ A;  3FZV A;  1U2W A;  2ZNZ A;  5D4R A;  1HST A;  2O6G E;  5E18 F;  1ZRC A;  3J81 Z;  2EFP A;  3LAJ A;  2L02 A;  2XVC A;  3W6K B;  3QP6 A;  1TQM A;  3LFK A;  2KJC A;  1R7J A;  3FHZ A;  2UZK A;  1DPU A;  1FP1 D;  5BPI A;  5D8K B;  3BRO A;  4G7O F;  2A3S A;  3TOB A;  3E3V A;  3LST A;  2YX7 A;  4AIK A;  3WU0 A;  4G6Q A;  1HKT A;  3RYR A;  3L00 A;  3TO9 A;  2XRO A;  1YW7 A;  3I53 A;  1JXS A;  3DP7 A;  1U5T B;  1LEB A;  2DQR A;  3E5Q A;  2PEX A;  4KIB A;  1A04 A;  4BHC A;  3V8L A;  1R5H A;  3RKW A;  4YFX F;  4XRF A;  4G7Z F;  3KCC A;  1AWC A;  4CO8 A;  1YS6 A;  3REO A;  2ADU A;  3I4P A;  3TKY A;  1DDN A;  1IUY A;  2O3F A;  2RKH A;  2LF7 A;  3DF8 A;  1V4R A;  1OYI A;  2DBB A;  4HW0 A;  2W57 A;  4CGZ A;  4I98 B;  1XCB A;  4MTE A;  2STT A;  3B73 A;  2K7L A;  1IAW A;  1G3T A;  1IN8 A;  2EK5 A;  4ZH4 F;  1O7F A;  5ERI A;  4L9T A;  5FLX Z;  2Q0O A;  3JSP A;  3IWZ A;  1MDM A;  2CG4 A;  1H0M A;  1MZB A;  2VBY A;  1UCR A;  3WE2 A;  2XAS A;  1LDD A;  5ICE A;  1MGT A;  2D45 A;  1XGM A;  2L3D A;  5FFZ A;  4OOI A;  1XCV A;  1QBJ A;  5ICG A;  4WCG A;  1FWZ A;  4ON0 A;  1TQP A;  3V4G A;  4IRG A;  4CHU A;  4ESB A;  5HOO A;  4ENN A;  4IRI A;  2EFN A;  4M9Z A;  2J5P A;  4I02 A;  5CVU A;  3ZP5 A;  5L3D A;  4EGY A;  3CJN A;  1TBX A;  1KQ0 A;  3KP7 A;  2M30 A;  3DKW A;  1ZLK A;  5L3E A;  1B59 A;  3M1E A;  4EVI A;  2DU9 A;  3DXJ F;  3M7G A;  3VFZ A;  3FM5 A;  5HVQ C;  5ILS A;  5H20 A;  1JE8 A;  4F7Z A;  3HHH A;  2GZW A;  3HRM A;  1CF7 B;  3TDU C;  4P55 A;  2MD5 A;  3S2W A;  2XKP A;  1IRF A;  3RI4 A;  2W25 A;  2LSO A;  4YIF A;  4N9I A;  2R7F A;  2ETH A;  3I71 A;  2EJR A;  1R36 A;  2CW0 F;  5D5U B;  2FBK A;  1O3S A;  2B0L A;  4PZJ A;  1FNN A;  5FGM A;  4ESJ A;  1V3F A;  1PP8 F;  2MBF A;  1IXS B;  3ECO A;  4UVA A;  1YO5 C;  5BPD A;  1OKR A;  3R61 A;  2JPC A;  1SFU A;  1P4W A;  2EFQ A;  2HQR A;  5LGT A;  2DPD A;  3I5U A;  3I54 A;  4OMZ A;  2ZJ2 A;  5CJ9 A;  1G3Y A;  1MKM A;  1REP C;  4BHB A;  2A69 F;  5J8F A;  2OBP A;  1ODD A;  1DP7 P;  3E5U A;  2RN7 A;  3ERE D;  1SMY F;  5HDG A;  4MQ9 F;  2VBW A;  1STZ A;  3F8F A;  4RS8 A;  2ZFW A;  1XDU A;  4HYE A;  3BWG A;  4CDG A;  1B4A A;  4ENM A;  2DI3 A;  3HSR A;  1ZGA A;  4WWC A;  1HW2 A;  1JGS A;  3QRF F;  2HYF A;  2D1V A;  2PLY A;  2Y0M A;  3GLX A;  2O61 A;  1ZRD A;  1MD0 A;  3I59 A;  4BNC A;  4EV0 A;  1XGN A;  4OIN F;  2GXB A;  1XDS A;  2YX4 A;  1T39 A;  4ENK A;  1HBX G;  1D8K A;  4R8H A;  4UXN A;  2IJL A;  2F5F A;  1HXD A;  1G3W A;  4AIJ A;  1K7A A;  2M45 A;  2L54 A;  3LAP A;  2PFB A;  3WTU C;  3IKT A;  3H92 A;  3C18 A;  2MA3 A;  4XSX F;  3WTY C;  1YTY A;  2RVC A;  2F5E A;  2P5K A;  1NHA A;  2K02 A;  2Z99 A;  3WGI A;  2ZBK A;  1I1S A;  2LF8 A;  4P9F A;  2P5L C;  3T0Y A;  2V1X A;  4EJO A;  3ML6 A;  1CF7 A;  1TNT A;  2NYX A;  1FPQ A;  3CUQ A;  4LJZ F;  1WQ2 A;  1KU9 A;  3BP8 A;  1J7K A;  1XSD A;  5ILV A;  2EV5 A;  3EET A;  3FX3 A;  4N9H A;  3ZMU A;  3GWZ A;  4KMF A;  2XUB A;  3U9G A;  3FXQ A;  5JHU A;  3LQQ A;  3KP3 A;  2VC1 A;  2MLK A;  2MC3 A;  1LDK B;  1B9M A;  3RDI A;  4ENJ A;  2FNA A;  1BI2 A;  3V7R A;  2WWY A;  4A0Z A;  5K5Q A;  2P7C B;  1J5Y A;  2A68 F;  4L9J A;  5KK1 A;  3KE2 A;  1USS A;  3IRR A;  1OPC A;  5HS9 A;  5DD4 A;  2PI0 A;  3KEO A;  3GXO A;  1Z7U A;  5ILU A;  1FX7 A;  1LVA A;  2COM A;  1S3J A;  2A6H F;  3HHG A;  3QPT A;  2HEO A;  3WGG A;  2H09 A;  5LHH A;  2KIM A;  5BMZ A;  2NRA C;  2M5W A;  4FX0 A;  4M6X A;  4RGS A;  3MAJ A;  1WRJ A;  2IA0 A;  4LG0 A;  4KT5 C;  4IJA A;  4FT8 A;  3JAM Z;  2FU4 A;  2HQN A;  3ISP A;  3E6D A;  3ZQ7 A;  4HX4 A;  4M73 A;  3FF5 A;  2HOE A;  4XBF A;  2CGP A;  3BY6 A;  5D6F A;  1CGP A;  3GZ6 A;  3ZPL A;  1I6X A;  3B02 A;  3COA C;  3GF2 A;  1HKS A;  3L09 A;  4HLY A;  2FNP A;  4LGW A;  3T8T A;  1FYM A;  3QPH A;  3FMS A;  5E1Z B;  1MDM B;  4NQW A;  4LB6 B;  1JHH A;  4HV6 A;  2ZCW A;  3N4M A;  1BM9 A;  4L9N A;  4ESF A;  5L3C A;  2IP2 A;  2JTV A;  3MZY A;  2FXA A;  2EFO A;  1Z6T A;  2VXZ A;  4U7B A;  2QYO A;  5AON A;  3HSE A;  5CVV A;  5HLI A;  1XN7 A;  3I64 A;  4OIO F;  5HS8 A;  4Q48 A;  3QOP A;  4YFN F;  4WXH A;  1QZY A;  1KQ9 A;  2P5V A;  3R0J A;  2P8T A;  5E17 F;  3ABU A;  3O6B B;  3I58 A;  1XSV A;  3V8J A;  1I1G A;  2J5O A;  4U7D A;  1RNL A;  1K78 A;  4HA8 A;  2OU2 A;  1HSJ A;  3QP5 A;  3HTS B;  2BV6 A;  1MJB A;  4BQA A;  4EJT A;  3P9K A;  4KFC A;  4RAY A;  4UV8 A;  3R4K A;  1TQI A;  3RKX A;  4EJV A;  2M1B A;  1FC3 A;  2IVM A;  3K69 A;  4G9Y A;  1IZ1 A;  4BXU A;  4EJW A;  2DAO A;  5LHG A;  4ZYE A;  1W5S A;  3HYI A;  4OIQ F;  4OMY A;  4L0Y B;  3WTX C;  2R3S A;  1Z05 A;  2QM3 A;  3F22 A;  2EV6 A;  2EWN A;  3I0T A;  2W85 A;  1BIA A;  4I01 A;  1PUE E;  5BQT A;  2HWV A;  4QWQ A;  4I09 A;  5FB2 A;  3GYH X;  2A5Y B;  3GX4 X;  1D5V A;  2VT2 A;  4GYG A;  1MJA A;  1QNT A;  1QQI A;  3C7J A;  4LLG F;  1KYW A;  5LBQ A;  4UVB A;  2RNJ A;  3K1M A;  3SZP A;  2OZ6 A;  4WXD A;  4LFU A;  2ZO4 A;  1G6N A;  5HDN A;  4EM1 A;  4KNY A;  2A61 A;  2W84 A;  3WGH A;  3TO7 A;  1J9I A;  1P4A A;  1KU7 A;  4ZZL A;  2ESN A;  4BHP A;  4FX4 A;  3IC7 A;  5L3B A;  5HS7 A;  3J81 K;  3GFJ A;  4R1H A;  5LRS A;  1WKM A;  3MEX A;  1ZGJ A;  3M8E A;  4OIR F;  1W4M A;  3E6C C;  4HF0 A;  3FM3 A;  2F2E A;  6PAX A;  1YLF A;  3BZ6 A;  3KZY A;  5D8L B;  2FML A;  1F5T A;  4Y17 A;  2IRF G;  1LNW A;  3I59 B;  4CYD A;  1IN7 A;  1RZ4 A;  3MZH A;  1FY7 A;  5JFR A;  4QLC U;  3C1D A;  4ZYG A;  5K5O A;  4A6D A;  4O6J A;  2ZKZ A;  4HAM A;  2RQP A;  4LLL A;  4HF2 A;  1UST A;  1YQA A;  4HQM A;  4M72 A;  3SXY A;  3IRQ A;  2JZY A;  2DT5 A;  2P6T A;  5FD6 A;  2H6C A;  4ASN A;  4ZZD A;  4B8X A;  1PP7 U;  2CO5 A;  2HKO A;  4UUV A;  4KMU X;  1BIB A;  2HS5 A;  2H27 A;  4MEY F;  5D6E A;  1GXP A;  1R58 A;  4HZF A;  1FP2 A;  1ON2 A;  3WG9 A;  5AIP A;  3E97 A;  1YW8 A;  2KIF A;  4BAY A;  3KP4 A;  3CUQ B;  3EYY A;  5FLX K;  4M6Y A;  1F1Z A;  1JHF A;  5FFX A;  4L9V A;  4RAZ A;  4HBL A;  1SD4 A;  1QO0 D;  4JBA A;  3FMR A;  2QEN A;  3GZ5 A;  2HDC A;  2Q2E A;  4KIG A;  5F6F A;  2DTR A;  4UHT A;  1FBU A;  3SQN A;  3QU6 A;  3TQN A;  2YR2 A;  1YW9 A;  1B9N A;  1XSX A;  3P9C A;  4HQE A;  1R23 A;  2OQR A;  1IXR C;  2P7V B;  5J8C A;  1TW3 A;  1S6L A;  3GUD A;  1BC7 C;  2P6S A;  2L01 A;  1X3U A;  2RV8 A;  4RGR A;  3VB2 A;  2Z9O A;  3JSO A;  4KDP A;  4IHT A;  4N0B A;  3VOD A;  2C6Y A;  2XAJ A;  1Z6R A;  4I0B A;  1ZN2 A;  2XAH A;  2E1N A;  1EH8 A;  4U0Y A;  4I2O A;  5A2Q Z;  3PFI A;  3F8B A;  3SHF A;  5D4S A;  3F3X A;  4ZYD A;  2PJP A;  4R79 A;  4Y13 A;  1U5T C;  2BBY A;  3J80 Z;  1IW7 F;  3ECH A;  5TRD A;  1Y0U A;  1BN5 A;  4LG0 B;  3FMQ A;  1R1T A;  1HW5 A;  3BDD A;  1ULY A;  3MCZ A;  5DDG A;  3VOE A;  4MGR A;  4S05 A;  5ICC A;  1OR7 A;  1EV7 A;  1XGO A;  1S7O A;  2XV4 S;  3HOT A;  3WOD F;  2DW4 A;  3F21 A;  4LK1 F;  4KN7 X;  1SD6 A;  1KYZ A;  4A2U A;  3ULQ B;  3OV8 A;  1ZAR A;  2V1D A;  3RPU A;  1G4D A;  4G6D A;  1ONV A;  5IT9 Z;  3Q5F A;  2CWE A;  2TDX A;  2K4B A;  1D3Y A;  4G8X A;  2H94 A;  4P96 A;  5E20 A;  5JVT A;  4XSZ F;  2OD5 A;  1ON1 A;  3D5L A;  4GO1 A;  3ELK A;  2BEO A;  3CDH A;  3BPX A;  5TJJ A;  1J59 A;  3ZN0 A;  1P6R A;  2D1H A;  3G73 A;  4KYW A;  2K27 A;  1Z9C A;  1W7P A;  2R7D A;  5HLH A;  1OMI A;  2RC4 A;  3DFG A;  2PQ8 A;  4GXO A;  3GFI A;  2VOP A;  2IT0 A;  2MH9 A;  2FQ3 A;  4HV5 A;  3K9T A;  3LWF A;  2QQB A;  4BYY A;  1P92 A;  2V79 A;  1J2X A;  2CQK A;  4MHG A;  2VN2 A;  4P9U A;  2O0Y A;  4L5J A;  3BPV A;  3F8M A;  4EM0 B;  1K78 B;  2BYV E;  1O7L A;  2FBI A;  2LKP A;  3IWF A;  3RTR A;  2XGX A;  1QPM A;  3F8C A;  4ZYH A;  3NQO A;  1J75 A;  5H6Q A;  2O8X A;  2E7X A;  3F6V A;  2FMY A;  1VTN C;  4M74 A;  4XLP F;  3WU1 B;  4HDV A;  2FOK A;  3KP6 A;  3HUG A;  1W7P D;  1H9T A;  1AOY A;  2W24 A;  2OQG A;  3NRV A;  1O57 A;  3ZN1 A;  2RDP A;  4DNC A;  1H9G A;  4TV7 A;  4L5I A;  3LA7 A;  2G7U A;  2QZ8 A;  1U3E M;  1FOK A;  1IN6 A;  1XMK A;  2QUF A;  4HF1 A;  4EQQ A;  1G3S A;  3DPL C;  1KA8 A;  1XB4 A;  2L4A A;  3PQJ A;  4WF2 A;  4LB5 A;  2OAZ A;  2E7W A;  2G7H A;  2MLG A;  4I0A A;  1UFM A;  4EMS A;  2CYY A;  1T98 A;  3GW2 A;  3HIF A;  4LMY A;  3KP2 A;  3HRS A;  3RIR A;  5CYV A;  1T2K A;  1FLI A;  2ZME A;  5ED4 A;  2DQL A;  3E6M A;  3AAF A;  3JW4 A;  1YFH A;  5CVI A;  4GYI A;  1YS7 A;  2UWM A;  4RGX A;  3VEP A;  1E17 A;  5JR3 A;  1SFX A;  2PMH A;  5E8I A;  2VE8 A;  5H6R A;  1KU2 A;  3V8K A;  3BJA A;  4FHT A;  3GEZ A;  3EDP A;  1L3L A;  3WE3 A;  4LK0 F;  2IW5 A;  3V7C A;  3U2R A;  4L0Z B;  2BGC A;  3LA3 A;  3WTZ A;  3J7A O;  3R0A A;  3OOP A;  5LEJ A;  1UB9 A;  1DUX C;  1YIO A;  2BE5 F;  2Z33 A;  1BC8 C;  3GVA A;  4IXA A;  4NHJ A;  1LDJ A;  5LEK A;  2DK5 A;  1P2F A;  3WTS C;  1HW1 A;  4RB0 A;  2CSO A;  2FBH A;  4MNU A;  4YFK F;  3JAM K;  4Q4Z F;  3DQV C;  4GCV A;  4KIC A;  2OZU A;  5J6X A;  4Y15 A;  2QWW A;  2XRN A;  4UNO A;  2NNN A;  4U0W A;  5JI6 A;  2GAU A;  1ZAO A;  3W6J B;  3KFW X;  5D5W B;  2HGC A;  5DEQ A;  5L3G A;  4A0X A;  1GHC A;  1WI9 A;  2HR3 A;  5K1Y A;  4B09 A;  3O2P E;  4G7H F;  2XHK A;  5D5X B;  5DCM A;  1IN4 A;  1XD7 A;  5DCF A;  3K0L A;  1O3R A;  2K4J A;  2Z5U A;  3T1B A;  4D0P A;  1BI3 A;  4WXC A;  2GA2 A;  2X4H A;  4WX9 A;  4PDK A;  1I27 A;  4HLX A;  3GFL A;  4M9S A;  1XGS A;  3EYI A;  2DPU A;  3Q9V A;  4O5V A;  4NB5 A;  1Q1H A;  3QAH A;  3M9A A;  4IF4 A;  5F1R A;  4KN4 X;  1SAX A;  2RGV A;  2LNB A;  1ZYR F;  2GIV A;  4HX7 A;  1TLH B;  3JTH A;  4EJU A;  2QBY B;  3ABT A;  2FRH A;  5AIQ A;  2GWR A;  3E6B A;  3HRU A;  4IHS A;  5EEG A;  3ZMT A;  3WTV C;  4AVP A;  2JPB A;  4KUM A;  1SFE A;  3R6S A;  3QU3 A;  1LEA A;  3L7W A;  2FEZ A;  2VE9 A;  4S04 A;  1C0W A;  2PMU A;  4XLN F;  1YG2 A;  2V9V A;  4OIP F;  4MQV A;  2O03 A;  5IT3 A;  3PQK A;  2A6E F;  1UHW A;  3RYP A;  1R1U A;  2YSR A;  4U88 A;  3DEU A;  2GQQ A;  2KKO A;  4K2E A;  1W5T A;  2MH2 A;  2YU3 A;  2ZNY A;  3GFM A;  1WWX A;  1TW2 A;  2AXL A;  3ZMS A;  3HSF A;  5HDK A;  4PGG A;  1OYY A;  1L0O C;  2QLZ A;  2JT1 A;  2JSC A;  4A5N A;  2UXN A;  1OYW A;  2VOO A;  2CFX A;  4RB1 A;  4UVC A;  1B1B A;  2ISZ A;  3ZMD A;  3SZT A;  5DUK A;  1TNS A;  2KJB A;  2DLL A; 
#chains in the Genus database with same CATH topology
 3NEU A;  3E5X A;  3TGN A;  2IPQ X;  2WTE A;  2VC0 A;  3H3Z A;  4RB2 C;  1F4K A;  2EA2 A;  3EPZ A;  3AKZ A;  2H6B A;  2HTS A;  4OAZ A;  1FIP A;  2Z3Y A;  2CFO A;  2ICW G;  5CVJ A;  1VQ4 I;  3FXO A;  1LB2 A;  4YII A;  2GIZ A;  2LVS A;  1VQ7 I;  2XAF A;  4JK1 X;  4AD9 A;  2LKS A;  2NNY A;  3BZC A;  5EEA A;  2H8W A;  2LLK A;  1YJ9 I;  3KZZ A;  5DM6 F;  3L2C A;  3FXR A;  1WJF A;  2ESH A;  5EEH A;  1EH7 A;  3G3Z A;  3GZN B;  5FO5 A;  5LHI A;  1W7P B;  4IHY A;  1J0R A;  3M8F A;  4BQQ A;  1MBF A;  1JGG A;  2DDB A;  3C3W A;  4PSW A;  3EUH A;  2E71 A;  2IS1 A;  1T0F A;  3WTT C;  2FA5 A;  2LR8 A;  2L7Z A;  3JRF A;  1FYK A;  2ELH A;  3P7N A;  3OYJ A;  2HQA A;  4CXF A;  4ITV A;  2YUS A;  3BJO A;  5FD5 A;  3CC7 I;  2DFI A;  3FKJ A;  3MFK A;  3M3Y J;  1FBS A;  3P9I A;  1V54 H;  2LOO A;  3K2Z A;  1BR2 A;  1U5T A;  2HVQ A;  2I8D A;  4U0V A;  3BOQ A;  4I76 A;  4A3K J;  4GGG A;  1ZQ3 P;  3K4L A;  2Y48 A;  3LOC A;  3S1Q J;  3BTJ A;  3DWL E;  2F5D A;  1K79 A;  1D8J A;  5K5R A;  4O3M A;  1Z1D A;  2M4G A;  4GRI A;  1XPX A;  4LD5 A;  2IS4 A;  3IH4 A;  1X3W B;  3IP4 B;  1UZC A;  3IKV A;  3TO6 A;  2QBY A;  1T6S A;  1XMA A;  1Y6I A;  2E1C A;  3SZG A;  2CU7 A;  1N78 A;  2YPR A;  1ZG3 A;  3F72 A;  2ZSH B;  2ELJ A;  2PN6 A;  1ZRE A;  3S14 J;  1BOA A;  4FTH A;  1GXQ A;  1O3T A;  2JMW A;  2KIU A;  2VQG A;  4IX7 A;  2HFH A;  2QEX I;  3VYT B;  2HPM A;  2VKH A;  3HUG B;  5M3F J;  4P1W A;  2O8K A;  3N97 A;  2I5U A;  1RI7 A;  1YHQ I;  1S8N A;  2V6C A;  4M3E A;  1QGP A;  1GV5 A;  4KIF A;  1IRZ A;  3IL2 A;  4B44 A;  1IF1 A;  1FT9 A;  3AL0 B;  2K86 A;  2DOA A;  2VOD A;  3H3U A;  1MJ9 A;  1S7A A;  3H5N A;  3PL8 A;  1R5G A;  3DPT A;  2KQR A;  2V9P A;  2EFW A;  4P5O A;  3JTG A;  4KA4 A;  4JQF A;  4L5E A;  1E2X A;  2NAZ A;  4RB3 C;  1JT0 A;  2F4I A;  1HDD C;  1OFC X;  4MFD A;  2IA2 A;  1HC8 A;  2PX9 A;  4NNJ A;  1SMT A;  2NS0 A;  1VND A;  1RKT A;  1GLN A;  1ACI A;  5DD8 A;  1SVL A;  2V1U A;  2K9M A;  1QHG A;  2VQH A;  3GO5 A;  1AHD P;  3CCY A;  2WAQ N;  4UV9 A;  2QQA A;  2CUF A;  1K61 A;  3VWB A;  1PVE A;  2E34 A;  2FSW A;  2XF7 A;  5BS6 A;  3PIP F;  1IO2 A;  1T38 A;  2QVO A;  2F5C A;  3DLA A;  5D5V B;  2X1E A;  2PBI A;  2ZME B;  4A5M A;  2EB7 A;  2D2W A;  2F48 A;  5LGN A;  2W1O A;  3HOS A;  2R7R A;  5DYM A;  3H1C A;  2VT3 A;  4I7H A;  4NC7 A;  2VJJ A;  1ZG1 A;  1RRJ A;  4L18 B;  1XG1 A;  9ANT A;  3G1O A;  1TWH J;  1U9O A;  4II3 A;  3NWS A;  3GTP J;  2KZG A;  3OYL A;  4Q5S F;  1BI0 A;  2JVH A;  3CO6 C;  4DJA A;  3WTW C;  2R7T A;  5E79 C;  5F64 A;  1ZLJ A;  3O8G A;  3Q0U A;  3QYE A;  3OYI A;  2STW A;  1R22 A;  5HLG A;  3PJR A;  3TOA A;  2MFZ A;  2EA4 A;  4IVN A;  1IUF A;  1JUS A;  2M87 A;  3ASN H;  5LGU A;  5C44 J;  3FXU A;  4A3M J;  1KU3 A;  2ECC A;  1ZRF A;  4CCK A;  4AIH A;  2KDZ A;  2XGD A;  3CF5 F;  4C3H J;  2GXG A;  2XAG A;  4V2F A;  4A12 A;  4YG2 F;  3TED A;  2LRD A;  1B72 B;  4XRS A;  3L9F A;  2LMD A;  1HQC A;  2XKO A;  3SFZ A;  4BH9 A;  5F0C A;  4LLN A;  5A2Q K;  3KZI C;  3BJ6 A;  3M1C A;  1OIS A;  1ZHF A;  4RGU A;  3FIW A;  3RJP A;  1BI1 A;  2XAQ A;  2L4M A;  2HNH A;  2IA1 A;  2HYG D;  3DV8 A;  3J80 K;  3O3K A;  2XIG A;  2E5N A;  2VBX A;  1U8R A;  5GTI C;  1LQ1 A;  2WV0 A;  1FSH A;  1QZE A;  2FE3 A;  5IP6 A;  2AS5 F;  4A6E A;  3ZMZ A;  1S29 A;  4FIS A;  3F8N A;  3A01 A;  1O3Q A;  2LDU A;  2XPV A;  4Y7N J;  3E0J B;  1IRG A;  2Y0S N;  1UHM A;  4HOB A;  3VSK A;  4BE2 A;  1SD5 A;  1B6A A;  2G9W A;  5LRR A;  2ACJ A;  1V5G A;  2LKX A;  1EH6 A;  2KIS A;  4XMY A;  4IHW A;  3H3V K;  4AWX B;  1XC5 A;  4IRH A;  1YOV B;  2GA1 A;  3KEQ A;  4IPA A;  1YX5 A;  1AU7 A;  1R00 A;  1GVJ A;  1BJA A;  4A0Y A;  2L0K A;  3KLN A;  3U1D A;  1PDN C;  3BQZ A;  2KRF A;  3AG3 H;  1TTY A;  4ZTJ A;  3CUQ C;  1IXC A;  4PGH A;  1LJ9 A;  2GOX B;  1RUN A;  1Z91 A;  2Q8K A;  2X9D A;  5IT9 K;  1ETX A;  5DCM B;  1KON A;  2HZT A;  3GTL J;  3KLO A;  1ETK A;  2ZJP F;  1RUO A;  1JKR C;  3JRB A;  1VZ0 A;  3CUO A;  4IKF A;  1KGS A;  5B1B H;  3ZMV A;  5GAD J;  1KQ8 A;  3K4K A;  3GME A;  4NBQ A;  3Q9S A;  3W2A A;  1WSU A;  3DKX A;  2L5Q A;  3D0S A;  3HG9 A;  3DPU A;  2PG4 A;  4CZZ A;  3PUB A;  2FF4 A;  4XOT A;  3IHU A;  3T5X A;  4HDU A;  4CIC A;  1NG7 A;  4RAG A;  3HGY A;  3AFH A;  1IN5 A;  4XOP A;  2DO7 A;  3MWM A;  4M71 A;  5CVR A;  4DQ2 A;  4ETS A;  5DV5 A;  4EGZ A;  3V7S A;  1FSE A;  2XSD C;  3OSF A;  1FYL A;  3SEZ A;  1HKQ A;  2HKX A;  3HTU A;  2P4W A;  3K70 C;  3TDZ C;  4FCY A;  4HX8 A;  4B3X A;  3IV5 A;  4E6K G;  3HOV J;  4JP0 A;  2CW7 A;  1MBJ A;  1FZP B;  3F6O A;  4Q47 A;  1RIO H;  3GTM J;  3BR3 A;  3H5A A;  3FDY A;  2WAQ A;  1I5Z A;  1WZ2 A;  4EM2 A;  4M9X A;  4OU0 A;  1APL C;  3CO7 C;  1D0X A;  5E1X A;  1DPR A;  2DXI A;  1F43 A;  2M8E A;  1Y39 A;  1UJ8 A;  3K1N A;  3WG7 H;  1FMW A;  4DZP A;  4MEX F;  1IGN A;  2DYS H;  5E3N A;  3RKY A;  5KVR A;  5LLQ A;  2PJR B;  1BL0 A;  3MZ8 A;  1ZH5 A;  2DK8 A;  2ISY A;  3M4O J;  2JVG A;  2M3A A;  2EV0 A;  3LA2 A;  5FKK A;  4H0E A;  1GT0 C;  3T8R A;  3NAU A;  3CJR B;  4D5C A;  3BR5 A;  2X1C A;  2QQ9 A;  2UXX A;  2L9V A;  4Z2Y A;  2UV1 A;  1P4X A;  3WHC A;  4WK8 F;  3ROU A;  3MQ0 A;  5E1W A;  2ELK A;  5DUI A;  5DM7 F;  3HRT A;  3PIO F;  2OA4 A;  2Y75 A;  5F04 A;  3S1M J;  4XLC A;  1U6G A;  2ZJR F;  4IQJ A;  2X6W A;  3LQR A;  2HTJ A;  2WC2 A;  3RPQ A;  4M3D A;  2LBF B;  4AID A;  3CLO A;  3QYB A;  1QZZ A;  1YI2 I;  1BBY A;  3FWE A;  3OYB A;  2N8G A;  3KET A;  1TWF J;  3R60 A;  5BOX A;  3I56 I;  4BS9 A;  2BY2 A;  3O8H A;  4D7M A;  1K6O A;  2WAF A;  3KP5 A;  1TWC J;  1ZG5 A;  1X1C A;  2JN6 A;  4G94 A;  2A07 F;  2VON A;  1D1C A;  1R6R A;  3N05 A;  5ICF A;  1WJA A;  2VBZ A;  1YYV A;  3QPL A;  1SD7 A;  4MTD A;  2X0L A;  3K1P A;  1F9N A;  1PJR A;  1DQU A;  4E70 A;  1SC7 A;  3HOX J;  3CTA A;  5E8G A;  2ZXJ A;  4PUS A;  1R1V A;  3LSR A;  1U78 A;  3OS0 A;  1BR4 A;  3CCE I;  4PCQ A;  5EG0 B;  5L3F A;  4LIV A;  3OYN A;  3F23 A;  3EQL F;  1D1B A;  2JRT A;  5CLS A;  5B5E C;  1YX3 A;  3IH2 A;  3JRH A;  3OR2 C;  1X58 A;  1FBQ A;  3FZV A;  1U2W A;  2ZNZ A;  5KHD A;  2QKM B;  2IXS A;  5D4R A;  1HST A;  1B8I B;  2EZH A;  5C4X J;  5J1U A;  2LD5 A;  2H1L A;  4E7H A;  2O6G E;  1AA7 A;  5J1Y A;  4D7N A;  1JJ6 C;  2ME6 A;  5E18 F;  3TL4 X;  1VQN I;  1A36 A;  1ZRC A;  3J81 Z;  1VQP I;  3CME I;  4CCO A;  2LY1 A;  4A3C J;  2EFP A;  3ZQG A;  3JR9 A;  5FJ8 J;  3LAJ A;  3QOE A;  1U0J A;  1SVM A;  4XRS G;  3KYD B;  2L02 A;  2DA1 A;  2XVC A;  3W6K B;  3GLL A;  3QP6 A;  3ASO H;  1TQM A;  3LFK A;  2KJC A;  5LFA A;  2Y9Z A;  3OOU A;  2M7B A;  1MBH A;  1R7J A;  2EZL A;  3FHZ A;  5H2F C;  2UZK A;  1DPU A;  1Y0N A;  1FP1 D;  2D5V A;  1Y8R B;  2MG4 A;  5BPI A;  5D8K B;  3BRO A;  1Y8Q B;  3L2R A;  4M6V A;  4G7O F;  3BCA A;  2A3S A;  2NVX J;  2Z2S B;  4IQ4 A;  3E3V A;  3TOB A;  3LST A;  4BBR J;  3G71 I;  2YX7 A;  4AIK A;  3OYK A;  3HPH A;  3WU0 A;  3Q0W A;  4G6Q A;  1MH4 A;  1HKT A;  3RYR A;  4BJ5 C;  3L00 A;  2E5Z A;  3TO9 A;  2LP0 A;  2XRO A;  1R4M B;  1YW7 A;  3I53 A;  1JXS A;  3DP7 A;  3J7A Y;  3TW7 A;  1IV8 A;  3C2G A;  1DGR M;  1U5T B;  3D1N I;  3FIS A;  1LEB A;  4E7Z A;  2DOF A;  2DQR A;  3E5Q A;  2PEX A;  2RQQ A;  3JCU C;  1A04 A;  4KIB A;  4BHC A;  3V8L A;  1LUJ B;  3PUF A;  2DOE A;  1VQ5 I;  1R5H A;  3PSF A;  3RKW A;  4YFX F;  4XRF A;  4G7Z F;  3KCC A;  1AWC A;  4CO8 A;  2PJR A;  2VKD A;  1YS6 A;  3REO A;  2ADU A;  4RA2 A;  2XPU A;  3I4P A;  3TKY A;  1DDN A;  2O3F A;  2RKH A;  3ZOB A;  1IUY A;  2LF7 A;  2EZK A;  3DF8 A;  1V4R A;  1W0U A;  1OYI A;  2DBB A;  2L2O A;  4HW0 A;  1V5F A;  2ZXH A;  1OCC H;  2W57 A;  4CGZ A;  4I98 B;  1XCB A;  4MTE A;  2V4J C;  2STT A;  1V55 H;  3B73 A;  2K7L A;  1IAW A;  1G3T A;  2VXD A;  2K9S A;  4XR6 A;  1IN8 A;  3H36 A;  2BOL A;  2EK5 A;  4YRV A;  4ZH4 F;  1O7F A;  4AVZ A;  5ERI A;  4L9T A;  1K4T A;  3BG9 A;  1TT5 B;  2Q0O A;  3H0G J;  5FLX Z;  3JSP A;  3TMO A;  4KIS A;  1TP4 A;  3IWZ A;  3BR6 A;  2LBF A;  1MDM A;  4DBQ A;  3CCR I;  2CG4 A;  2B63 J;  2DA6 A;  1H0M A;  1Z77 A;  3FXM A;  3LSJ A;  1YRN A;  1M1E B;  3RSN A;  1MZB A;  2GOM A;  2VBY A;  5GTH C;  1UCR A;  3WE2 A;  2F5V A;  2XAS A;  1LDD A;  2Y30 A;  3ZR8 X;  5ICE A;  1PUF A;  2PMZ N;  1MGT A;  2CUZ A;  2D45 A;  1XGM A;  2L3D A;  1SFK A;  5FFZ A;  2QA4 I;  5HLT A;  4OOI A;  3VDX A;  1XCV A;  4FET A;  2O7O A;  1QBJ A;  1WH5 A;  5M5W J;  1TWG J;  1FTZ A;  5ICG A;  4WCG A;  1FWZ A;  1S5L C;  3S15 J;  4ON0 A;  3K4C A;  4I6Z A;  3S2D J;  1CQT A;  1MNE A;  1TQP A;  5JLX A;  4CYC A;  1TZL A;  2E19 A;  2HQ5 A;  3V4G A;  2K3F A;  4IRG A;  2EBI A;  4CHU A;  4ESB A;  1ETW A;  5HOO A;  4ENN A;  4IRI A;  2HDW A;  3Q0V A;  2EFN A;  4M9Z A;  2J5P A;  5GPA A;  3JRE A;  5K7Z A;  4B47 A;  4I02 A;  2BHZ A;  5CVU A;  2XSJ C;  2OTJ I;  4RM2 A;  3ZP5 A;  4FAS D;  5L3D A;  4EGY A;  3CJN A;  3RZO J;  2QSG X;  2ZXW H;  1MNM C;  2Z1D A;  4CZC A;  4HNV A;  4B43 A;  5FLV A;  1TBX A;  2BW3 A;  3DBH B;  2FQ4 A;  1E0E A;  1KQ0 A;  3KP7 A;  2M30 A;  3ABK H;  3DKW A;  4BJ6 C;  4XRM A;  2KT0 A;  1Z21 A;  2V1N A;  1ZLK A;  3CCJ I;  5L3E A;  3MN2 A;  1B59 A;  2VJ4 A;  3BR0 A;  5IP7 J;  3M1E A;  3A0B C;  1FOY A;  4EVI A;  3OYE A;  3SDB A;  2DU9 A;  3DXJ F;  3SJM A;  4D9J A;  3M7G A;  3VFZ A;  3FM5 A;  5J4V A;  3BTL A;  5HVQ C;  5TIS C;  5IPA A;  1ZEL A;  5ILS A;  2KP6 A;  5H20 A;  1JE8 A;  4F7Z A;  3HHH A;  4M3B A;  3I55 I;  1K83 J;  3GBG A;  2GZW A;  2M7A A;  1HDP A;  3HRM A;  1BA5 A;  1CF7 B;  3TDU C;  4P55 A;  2QSF X;  1A6I A;  2MD5 A;  3S2W A;  4HNT A;  2VKV A;  1DU0 A;  2XKP A;  1LFB A;  1IRF A;  4RLF A;  3RI4 A;  2W25 A;  2LSO A;  1FEX A;  3ZRG A;  2HPI A;  4F3Q A;  4YIF A;  4N9I A;  1VQL I;  1JJ8 C;  1VF9 A;  2EIM H;  2K40 A;  2R7F A;  3WU2 C;  2ETH A;  2VJ5 A;  3I71 A;  4B4C A;  2NXN B;  4IL6 C;  2E2I J;  1R36 A;  2EJR A;  2IGN A;  2XRL A;  3A01 B;  1Y1V J;  2CW0 F;  2CUE A;  3CMY A;  2JA5 J;  5D5U B;  2FBK A;  1O3S A;  2B0L A;  4PZJ A;  1UEL B;  1FNN A;  3OIO A;  1G8X A;  5FGM A;  4ESJ A;  4NUB A;  2TCT A;  1V3F A;  1PP8 F;  1TWA J;  4BAC A;  2MBF A;  1IXS B;  3ECO A;  2E1M C;  2ZFU A;  4UVA A;  2NVU B;  1YO5 C;  1X19 A;  2R93 J;  4PJJ A;  5BPD A;  2X6O A;  1A35 A;  1OKR A;  3QOD A;  3R61 A;  3CF2 A;  2JPC A;  1SFU A;  4CCL A;  4S0H B;  1P4W A;  2CRG A;  3L2Q A;  2EFQ A;  1QVT A;  2HQR A;  5LGT A;  2DPD A;  3I5U A;  3I54 A;  3HOU J;  4OMZ A;  2ZJ2 A;  2OJE D;  3BCB A;  5CJ9 A;  1G3Y A;  4KIT B;  4XLH A;  1GDT A;  1MKM A;  5FRO A;  4LOC A;  1REP C;  4BHB A;  2A69 F;  3HJE A;  5J8F A;  4M3F A;  2OBP A;  1YIJ I;  1ODD A;  1DP7 P;  1S7E A;  3E5U A;  1X4P A;  3BG3 A;  3B6C A;  2RN7 A;  3ERE D;  1GV2 A;  1SMY F;  5HDG A;  1ZTR A;  2BVM A;  4NC8 A;  4MQ9 F;  2VBW A;  1STZ A;  3F8F A;  4RS8 A;  2ZFW A;  2B9S A;  2IGK A;  1XDU A;  4HYE A;  2H1K A;  3BWG A;  2CMP A;  3JRA A;  2XF6 A;  4CDG A;  2DJN A;  4LG3 A;  4XLE A;  3ZQL A;  3MKY B;  1B4A A;  3LSI A;  4CSW A;  4ENM A;  2DI3 A;  2PMZ A;  1YIT I;  3HSR A;  2ZC2 A;  4DIQ A;  1ZGA A;  4WWC A;  1HW2 A;  4PJ0 C;  1R49 A;  1JGS A;  2KRC A;  3QRF F;  2HYF A;  2D1V A;  3PFY A;  3SYT A;  3K2A A;  2PLY A;  1X1B A;  2Y0M A;  3GLX A;  2O61 A;  1ZRD A;  1MD0 A;  2TRT A;  1YJN I;  3I59 A;  4BNC A;  4EV0 A;  1XGN A;  4OIN F;  2GXB A;  1XDS A;  1Z7L A;  2YX4 A;  1T39 A;  1MBG A;  5CPR B;  1DGW Y;  1ZK8 A;  4ENK A;  5FKN A;  1W36 C;  4BEH A;  4PFO A;  4IOA F;  1P9Q C;  1HBX G;  1D8K A;  1VI0 A;  4R8H A;  2W4S A;  3KPH A;  4UXN A;  2IJL A;  2F5F A;  1HXD A;  4AM3 A;  2P0W A;  1G3W A;  1J09 A;  5GP9 A;  2HOT A;  4AIJ A;  4PSX A;  1K7A A;  1N77 A;  2M45 A;  2L54 A;  1Z3X A;  3LAP A;  2PFB A;  3WTU C;  4HG2 A;  4IHX A;  3IKT A;  4OAY A;  5FRN A;  1WJB A;  3FBI B;  2EIJ H;  3RQI A;  3W3C A;  3H92 A;  3C18 A;  2MA3 A;  4XSX F;  3WTY C;  1YTY A;  4DOZ A;  2RVC A;  2F5E A;  4AU7 A;  2E1O A;  2P5K A;  1NHA A;  4UUS B;  4BU2 A;  3CCQ I;  2K02 A;  2Z99 A;  3WGI A;  2Z16 A;  2ZBK A;  5B66 C;  1I1S A;  2LF8 A;  2DN0 A;  4P9F A;  2P5L C;  4G6T B;  3T0Y A;  2V1X A;  2K5C A;  3E7L A;  3ML6 A;  4EJO A;  1TNT A;  2NYX A;  1FPQ A;  2XF5 A;  3CUQ A;  1CF7 A;  4LJZ F;  1WQ2 A;  4ABZ A;  2DTZ A;  1KU9 A;  4H4K C;  5KNL A;  3BP8 A;  1QA6 A;  1J7K A;  1XSD A;  5ILV A;  2EV5 A;  1OR7 C;  3EET A;  3FX3 A;  4N9H A;  4Y4R A;  3GWZ A;  5F0F A;  3ZMU A;  2WB1 N;  2ZB9 A;  4XKB A;  2YU9 J;  2DCE A;  2K85 A;  4KMF A;  2H8R A;  4BDY A;  3CC2 I;  2XUB A;  4JOM A;  1QRY A;  2I10 A;  2R5Y A;  1SEU A;  2IGO A;  3U9G A;  3FXQ A;  2Y69 H;  4A69 C;  5JHU A;  3LQQ A;  1WCM J;  5EDN A;  3KP3 A;  1ETY A;  2VC1 A;  4DW6 A;  2MLK A;  2MC3 A;  1MIJ A;  4XKV A;  1LDK B;  1B9M A;  1MMA A;  3RDI A;  4ENJ A;  5JHF A;  2FNA A;  1BI2 A;  4V19 K;  3V7R A;  4C3J J;  4JX6 A;  2WWY A;  3QPS A;  3OL4 A;  4A0Z A;  2LFB A;  5K5Q A;  3RZD J;  4HST A;  2P7C B;  2KLO A;  3A03 A;  1ETO A;  1FMV A;  3UR3 C;  1J5Y A;  2A68 F;  4BE0 A;  4L9J A;  5KK1 A;  1G2H A;  3FKI J;  2HDD A;  3KE2 A;  3LSP A;  4E7L A;  1USS A;  3IRR A;  3QWL A;  2X85 A;  1OPC A;  1WHU A;  2F6C A;  5HS9 A;  1FOW A;  2HXO A;  5DD4 A;  4F91 B;  2PI0 A;  2X6X A;  5DS9 A;  1WI3 A;  2JRM A;  1WJ5 A;  2CV0 A;  3KEO A;  3GXO A;  2ID3 A;  1Z7U A;  3TBI A;  1ITY A;  3MVP A;  5ILU A;  1LE8 A;  1I50 J;  1FX7 A;  2L7F P;  4BBS J;  1LVA A;  2XAU A;  2COM A;  1I39 A;  1S3J A;  2A6H F;  2ID6 A;  3HHG A;  3TP0 A;  3KYC B;  1DP3 A;  3QPT A;  2CV2 A;  2HEO A;  1T95 A;  3VYS B;  4RMN A;  3WGG A;  4C2M J;  3BR2 A;  2H09 A;  4BDZ A;  1JUM A;  3OR1 C;  5LHH A;  2KIM A;  5BMZ A;  2NRA C;  2M5W A;  1TT0 A;  4FX0 A;  3OS1 A;  3JRC A;  3ZQQ A;  2KIQ A;  2NOJ B;  3CLQ A;  4J01 A;  4C30 A;  4ZDO A;  4M6X A;  4RGS A;  3G6E I;  2P81 A;  3WHB A;  3FXL A;  3MAJ A;  2MW8 A;  2EIL H;  1WRJ A;  3KIO A;  2IA0 A;  4LG0 A;  3IAS 2;  3ERM A;  2VPR A;  1A6Q A;  1SVO A;  4KT5 C;  4IJA A;  4FT8 A;  3K70 D;  3SFI A;  3JAM Z;  2XB0 X;  4HNU A;  3PO3 J;  2EPF A;  2FU4 A;  2HQN A;  3ISP A;  3OSG A;  1LPQ A;  2F4M B;  3E6D A;  2OV7 A;  2BZT A;  5BNG A;  3A1Y A;  3ZQ7 A;  2DMP A;  4HX4 A;  4M73 A;  1IG7 A;  2KZV A;  1V5E A;  3FF5 A;  2HOE A;  4XBF A;  2CGP A;  3BY6 A;  4B1R A;  2LC2 A;  3TW6 A;  2R7Q A;  5D6F A;  1CGP A;  4JYK A;  3GZ6 A;  3ZPL A;  1I6X A;  4BXF A;  3B02 A;  3COA C;  3GF2 A;  1HKS A;  3L09 A;  2VI6 A;  4HLY A;  1A31 A;  2FNP A;  2UUZ A;  1QHH D;  1D5Y A;  4LGW A;  3AL0 C;  2KL4 A;  3T8T A;  3SEQ A;  2JA8 J;  1FYM A;  3QPH A;  1QPI A;  3FMS A;  5E1Z B;  3S8P A;  4FQG A;  4FE4 A;  1MDM B;  4NQW A;  5GPC A;  3KX2 A;  4UUS A;  4LB6 B;  2HU9 A;  4MLO A;  1JHH A;  4HV6 A;  1YRN B;  4QTR A;  2HOS A;  2ZCW A;  3OY9 A;  3N4M A;  2CUJ A;  1D0Z A;  1PUF B;  2GM4 A;  1BM9 A;  4L9N A;  4ESF A;  3OS2 A;  5L3C A;  2IP2 A;  2JTV A;  3MZY A;  4JX5 A;  2ECB A;  2FXA A;  1I3Q J;  2EFO A;  1Z6T A;  2VXZ A;  4U7B A;  4A3G J;  4RM3 A;  2QYO A;  1U9N A;  4XQF A;  1YJW I;  2BY0 A;  3FK6 A;  3HSE A;  2K9N A;  5CVV A;  5AON A;  5HLI A;  1ENH A;  1X2N A;  1XN7 A;  3I64 A;  2K9Q A;  2WB1 A;  2ZME C;  2BVL A;  3K4M A;  4BE1 A;  5HS8 A;  4Q48 A;  1HF0 A;  4OIO F;  4CCJ A;  3QOP A;  4CYC B;  4YFN F;  3DBL B;  4WXH A;  1QZY A;  4XON A;  1KQ9 A;  1MMS A;  3OIQ A;  2P5V A;  3R0J A;  2R92 J;  1ZR4 A;  1NH3 A;  3MMY B;  3KEY A;  2Y0S A;  4KT6 A;  2P8T A;  4FE7 A;  5E17 F;  3ABU A;  3O6B B;  2CS3 A;  3I58 A;  4XN3 A;  1XSV A;  3FXK A;  3V8J A;  4F55 A;  1MH3 A;  3TP3 A;  1I1G A;  1ORK A;  2J5O A;  4U7D A;  1ETV A;  1RNL A;  1K78 A;  4HA8 A;  2OU2 A;  1HSJ A;  1EKE A;  3QP5 A;  3BT9 A;  3HTS B;  2BV6 A;  2NVQ J;  3S32 A;  1MJB A;  3GTQ J;  3BG5 A;  5GAG J;  4BQA A;  4EJT A;  3P9K A;  4KFC A;  4RAY A;  2BW3 B;  2VQC A;  3CQZ J;  2JA7 J;  4UV8 A;  3R4K A;  1TQI A;  3RKX A;  4EJV A;  3K10 A;  4CA0 A;  2M1B A;  1FC3 A;  2IVM A;  2LG4 A;  3K69 A;  4G9Y A;  3PNT A;  4EAT A;  1IZ1 A;  4BXU A;  5M3M J;  4UUT A;  3EUK L;  3ABL H;  5C4J J;  2LRE A;  4ZC3 A;  3GTG J;  5JVG F;  4EJW A;  4XN0 A;  2DAO A;  5LHG A;  4ZYE A;  1X4O A;  2X48 A;  1W5S A;  3BLY A;  2YS9 A;  3HYI A;  3MKW B;  1K6Y A;  4OIQ F;  3A0H C;  4OMY A;  4L0Y B;  3WTX C;  2R3S A;  2RNG A;  2M2E A;  2OUM A;  5J47 A;  1IJW C;  1Z05 A;  2WAE A;  2QM3 A;  3GTK J;  3NWT A;  3F22 A;  1Z0X A;  2EV6 A;  2EWN A;  3I0T A;  3HZJ A;  2BY3 A;  2W85 A;  1BIA A;  4I01 A;  1PUE E;  2L9S A;  2JJ7 A;  4ANJ A;  5BQT A;  2HWV A;  2CQX A;  4QWQ A;  4I09 A;  5FB2 A;  3OIP A;  3GYH X;  2A5Y B;  3GX4 X;  1AKH B;  3HPG A;  2JSP A;  1D5V A;  3OL3 A;  4Y52 J;  1FIA A;  1EA3 A;  2VT2 A;  3PNV A;  4GYG A;  3RKQ A;  1IDZ A;  1MJA A;  1QNT A;  3DEE A;  1QQI A;  3C7J A;  4LLG F;  1KYW A;  2QGU A;  5LBQ A;  2DFF A;  5IYB J;  4A3L J;  2E60 A;  2RNJ A;  4UVB A;  2M0M A;  3K1M A;  3RQ4 A;  1RES A;  3SZP A;  4KJZ A;  5CKT A;  2OZ6 A;  1YE9 A;  2DA2 A;  4WXD A;  4LFU A;  2ZO4 A;  1G6N A;  2ZSI B;  3PSI A;  5EZH A;  2LY9 A;  5HDN A;  2MGQ A;  4EM1 A;  4KNY A;  3HGG A;  4AC0 A;  1MMD A;  2A61 A;  2W84 A;  3WGH A;  3TO7 A;  1J9I A;  1P4A A;  3LNQ A;  1KU7 A;  4II2 A;  1UG2 A;  3GTJ J;  4ZZL A;  2ESN A;  4BHP A;  4A3I J;  4XL9 A;  4FX4 A;  5FKM A;  1LKX A;  3H35 A;  3LFU A;  3IC7 A;  5L3B A;  5KAF C;  5K7F A;  1JTY A;  5HS7 A;  2RAE A;  3J81 K;  3S2H J;  2KMU A;  3GFJ A;  2Y9Y A;  2Y2Z A;  4R1H A;  1VQ6 I;  3S3O A;  3FXJ A;  5LRS A;  4UB6 C;  1WKM A;  3MEX A;  2G0E A;  1ZGJ A;  1DU6 A;  3M8E A;  4OIR F;  1W4M A;  3L2U A;  3E6C C;  1POG A;  3IAM 2;  3W2V A;  1EF4 A;  4HF0 A;  3FM3 A;  1I6H J;  4C3I J;  3ESW B;  2F2E A;  4LIT A;  6PAX A;  2W7N A;  1YLF A;  3BZ6 A;  3OYG A;  3KZY A;  5FKO A;  2WY7 Q;  1XX5 A;  4ZJZ A;  5D8L B;  2FML A;  1U8B A;  1F5T A;  4Y17 A;  5KCM A;  2IRF G;  3H9J A;  5FRM A;  5EGO B;  1LNW A;  4W97 A;  3I59 B;  4CYD A;  1IN7 A;  4DBR A;  1RZ4 A;  3MZH A;  1FY7 A;  5JFR A;  2ZXI A;  3VPR A;  3HBL A;  5E3L A;  4QLC U;  2BXZ A;  3C1D A;  4XOR A;  4ZYG A;  5K5O A;  4A6D A;  1OCT C;  4PFP A;  3LSH A;  4O6J A;  2ZKZ A;  4BEH B;  4F52 A;  4HAM A;  1R5I D;  2RQP A;  4LLL A;  2OC6 A;  4HF2 A;  1UAA A;  1UST A;  5K7H A;  1N75 A;  1YQA A;  1HA8 A;  4HQM A;  2XC7 A;  4M72 A;  2CQQ A;  2JUG A;  3SXY A;  2E35 A;  2JZY A;  3IRQ A;  4XM3 A;  2IS2 A;  2DT5 A;  2P6T A;  2DYR H;  5FD6 A;  2H6C A;  4ASN A;  4ZZD A;  1IRX A;  3DEW A;  4B8X A;  1PP7 U;  1WJC A;  2CO5 A;  2HKO A;  4UUV A;  3CCS I;  4KMU X;  1MND A;  1BIB A;  1XMX A;  2AXT C;  2HS5 A;  2H27 A;  3CZ6 A;  1BOB A;  4MEY F;  5D6E A;  5J4Y A;  2W48 A;  1GXP A;  1R58 A;  4HZF A;  2LTP A;  4C9Y A;  4GFB A;  1Z67 A;  5E3M A;  1JKQ C;  1FP2 A;  3BTC A;  2E2H J;  1ON2 A;  3J7Y J;  2ME0 A;  3V42 A;  3WG9 A;  3VYU B;  3ZQC A;  2IBD A;  5AIP A;  3E97 A;  5F08 A;  1YW8 A;  1HOM A;  2KIF A;  4HSR A;  1H89 C;  4BAY A;  3KP4 A;  3CUQ B;  3EYY A;  4PK4 A;  1MMG A;  5FLX K;  4M6Y A;  4RDU A;  3JRG A;  1F1Z A;  1JHF A;  3CJQ B;  1UMQ A;  5FFX A;  4L9V A;  2M4K A;  1TL8 A;  3CDI A;  1RKW A;  4RAZ A;  2R5Z B;  2XGC A;  4HBL A;  3S17 J;  1SD4 A;  1GUU A;  3DU6 A;  1QO0 D;  4JBA A;  2R5Y B;  3FMR A;  4D5F A;  2KFD A;  3W6V A;  2QEN A;  2W00 A;  4JX4 A;  2ZJQ F;  4BY7 J;  1SFO J;  2CJJ A;  3GZ5 A;  2HDC A;  2Q2E A;  4KIG A;  1AKH A;  3A4C A;  4BL0 B;  2R7W A;  3BZK A;  3P5J A;  2DTR A;  5F6F A;  3BC8 A;  2KRH A;  2B7E A;  4DYC A;  4UHT A;  1FBU A;  3ZQI A;  1P7J A;  3SQN A;  3L2V A;  4AUX A;  3QU6 A;  3TQN A;  2YR2 A;  2LH9 A;  1YW9 A;  1B9N A;  2HXI A;  4OWR B;  1XSX A;  3P9C A;  4HQE A;  1MBE A;  1R23 A;  2OQR A;  4E4H A;  2EH3 A;  1IXR C;  2P7V B;  3F0C A;  3U21 A;  3VSL A;  5J8C A;  1TW3 A;  2DT7 B;  1WJE A;  1S6L A;  3CCL I;  3GUD A;  1BC7 C;  4C2T A;  2P6S A;  2L01 A;  3K4B A;  1SAN A;  4A3J J;  1RR8 C;  1WPK A;  1X3U A;  2NS8 A;  2RV8 A;  4RGR A;  3VB2 A;  3BG7 A;  2Z9O A;  2A5W A;  3JSO A;  4KDP A;  2O5R A;  5J3L A;  4IHT A;  1UG0 A;  2DMN A;  4N0B A;  3VOD A;  1NK3 P;  1JKP C;  4BKX A;  2E36 A;  2C6Y A;  1LE8 B;  1H8A C;  3DU5 A;  5EYR A;  2XAJ A;  1Z6R A;  3K4J A;  4I0B A;  1ZN2 A;  2XAH A;  2E1N A;  1H88 C;  1EH8 A;  3EUH C;  3HOZ J;  1T0F C;  4U0Y A;  2QQ8 A;  4J19 A;  3DKY A;  4I2O A;  4BQN A;  2KHM A;  3H9Q A;  5A2Q Z;  4A3D J;  2WBM A;  3PFI A;  1OCO H;  1JTX A;  3F8B A;  3SHF A;  3QYF A;  5D4S A;  3HDD A;  2HZD A;  3FBN B;  3F3X A;  3CP8 A;  2RRE A;  2CQ7 A;  2M8G X;  4RLQ A;  4ZYD A;  2DMT A;  2PJP A;  2E2J J;  4R79 A;  4Y13 A;  1U5T C;  2BBY A;  3J80 Z;  1IW7 F;  1QVU A;  3ECH A;  3LSK A;  4NC6 A;  1Y0U A;  5TRD A;  1BN5 A;  3DBR B;  4LG0 B;  4BGD A;  3H0D A;  2HOA A;  4A3F J;  1MMN A;  4AYB N;  3FMQ A;  1OQY A;  1BW5 A;  1R1T A;  2XB5 A;  2JK3 A;  3G4S I;  2NVY J;  5EGO A;  2IGM A;  1HW5 A;  3I9V 2;  3BDD A;  3CES A;  1X1P A;  1ULY A;  2X1D A;  3B6A A;  3MCZ A;  3VOE A;  5DDG A;  4MGR A;  3G1M A;  1HLV A;  4S05 A;  3I3L A;  2R0Q C;  2DA5 A;  2V26 A;  5IOY A;  5ICC A;  1OR7 A;  4IOC F;  1EV7 A;  1XGO A;  4CCN A;  2Y31 A;  4XID A;  3HEF A;  1S7O A;  2XV4 S;  3HOT A;  4XNF A;  3WOD F;  2DW4 A;  3F21 A;  1W36 D;  4N4N B;  4B3A A;  1F36 A;  4KN7 X;  4LK1 F;  1SD6 A;  1KYZ A;  4A2U A;  3ULQ B;  3OV8 A;  3HL2 A;  1ZAR A;  2V1D A;  2EIN H;  2FOW A;  1FOX A;  3ABM H;  3OYH A;  2NS7 A;  4E7I A;  3JRI A;  1MBK A;  1IV6 A;  2AQE A;  3RPU A;  3BR1 A;  1G4D A;  3DTE A;  2JUC A;  4G6D A;  1ONV A;  5IT9 Z;  4C2U A;  3Q5F A;  2CWE A;  2TDX A;  4NQW B;  2K4B A;  1WGX A;  2XDV A;  3OYD A;  1VQM I;  3AG2 H;  1D3Y A;  2W82 A;  3J7Z I;  4G8X A;  2H94 A;  4P96 A;  5E20 A;  2HYJ A;  5JVT A;  4XSZ F;  1GVD A;  2OD5 A;  1ON1 A;  3D5L A;  4GO1 A;  3ELK A;  3MD2 A;  5KAI C;  2BEO A;  3CDH A;  2EIK H;  3BPX A;  1RC9 A;  1A5J A;  3HC7 A;  5TJJ A;  3LSM A;  3X2Q H;  3E1S A;  1J59 A;  2HVS A;  2MD0 A;  3ZN0 A;  2AO9 A;  5IYD J;  1P6R A;  2VJI A;  2D1H A;  2QF7 A;  3W2W A;  4CUG A;  3G73 A;  4KYW A;  5F0H A;  2K27 A;  2WA0 A;  1W7P A;  2R7D A;  1Z9C A;  5HLH A;  1OMI A;  3Q3S A;  1E3H A;  2RC4 A;  3K6G A;  3DFG A;  5E3O A;  2PQ8 A;  3PO2 J;  4GXO A;  3GFI A;  2X6Y A;  2Q1Z B;  2IT0 A;  2VOP A;  2MH9 A;  5B1A H;  2FQ3 A;  3OMY A;  4HV5 A;  4LIU A;  3K9T A;  3FHN A;  4RAF A;  3LWF A;  1MSE C;  1Z3Y A;  2QQB A;  4BYY A;  2BXY A;  4UY8 I;  3A2K A;  1P92 A;  3M07 A;  2V79 A;  1J2X A;  1R4N B;  2CQK A;  4MHG A;  2VN2 A;  4P9U A;  2O0Y A;  2R7O A;  4L5J A;  3ZCO A;  2VPL A;  3BPV A;  3F8M A;  4EM0 B;  3IUO A;  4ZDP A;  1K78 B;  2BYV E;  2L9N A;  4ZTF A;  1Y56 A;  1O7L A;  2FBI A;  2IAI A;  3RPU D;  4PJM A;  1T33 A;  5HNF A;  1X3Z B;  3OYF A;  2LKP A;  1PYV A;  4YEL A;  3IWF A;  3AG1 H;  3RTR A;  1R9T J;  2XGX A;  1QPM A;  3F8C A;  4E7J A;  4ZYH A;  2R7S A;  2FD5 A;  4NDL A;  3H9G A;  3NQO A;  3DCF A;  1OLT A;  3HOY J;  1J75 A;  5H6Q A;  2MYS A;  4ZYA A;  1VQO I;  2EQR A;  2O8X A;  2E7X A;  3HB9 A;  1JKO C;  3F6V A;  2FMY A;  1VTN C;  5IP9 J;  4M74 A;  4XLP F;  3WU1 B;  4HDV A;  1UHS A;  2FJ1 A;  2FOK A;  3KP6 A;  3HUG A;  4IZZ A;  1W7P D;  1H9T A;  1AOY A;  3LSG A;  4BJT A;  2W24 A;  4DYQ A;  2OQG A;  3NRV A;  2FUG 2;  1WH7 A;  1O57 A;  3ZN1 A;  3OYC A;  2RDP A;  4DNC A;  1JI8 A;  3CJT B;  4B48 A;  1FJL A;  1D0Y A;  1H9G A;  4TV7 A;  2DDA A;  4BXX J;  4V2G A;  4L5I A;  2HI3 A;  4M3G A;  2XPW A;  3LA7 A;  2G7U A;  2QZ8 A;  1U3E M;  1FOK A;  1IN6 A;  1XMK A;  2QUF A;  4J00 A;  4HF1 A;  5EZG A;  4EQQ A;  1G3S A;  5C3E J;  2O9L A;  3HOW J;  3DPL C;  4BQO A;  1KA8 A;  1RR7 A;  1XB4 A;  4XLF A;  2L4A A;  5F1J A;  3D5R C;  5EF6 A;  3PQJ A;  2CQN A;  2WY8 Q;  4WF2 A;  3GTO J;  4LB5 A;  2OAZ A;  2E7W A;  2G7H A;  2MLG A;  4ZDL A;  4I0A A;  1UFM A;  4AYB A;  1RET A;  4X1E A;  4EMS A;  3DLL F;  2CYY A;  1T98 A;  3CCU I;  3GW2 A;  3HIF A;  3K7A J;  2R4G A;  4LMY A;  3KP2 A;  3HRS A;  3CCM I;  3RIR A;  2IEK A;  2DA7 A;  3S16 J;  3BTI A;  5CYV A;  1LFP A;  2QSH X;  1T2K A;  4DYR A;  3S1N J;  2F4O B;  4F93 B;  2ZME A;  3EUA A;  5ED4 A;  1EJ9 A;  2DQL A;  3E6M A;  1FLI A;  3NAR A;  2VB6 A;  3QQA A;  3AAF A;  3JW4 A;  4XLA A;  3I4M J;  1YFH A;  5CVI A;  1I3A A;  3F9K A;  4GYI A;  3AG4 H;  4PJN A;  3U1K A;  2WV1 A;  3S1R J;  1G59 A;  1YS7 A;  2UWM A;  4RGX A;  3CD6 I;  2VUM J;  1XTA A;  3VEP A;  4QPQ A;  4A3B J;  2VAS A;  1E17 A;  5JR3 A;  1SFX A;  1NK2 P;  2PMH A;  5E8I A;  2VLA A;  1OCP A;  2VE8 A;  5H6R A;  1KU2 A;  3CCV I;  4YIR X;  3V8K A;  3BJA A;  4FHT A;  1JT6 A;  3GEZ A;  3EDP A;  3C2H A;  2R5Z A;  1E3O C;  2CW8 A;  1L3L A;  3WE3 A;  3C2B A;  2IW5 A;  4LK0 F;  5IY5 H;  3PNY A;  4XK4 A;  4PJL A;  3V7C A;  1TC3 C;  3ZXS A;  3U2R A;  4L0Z B;  1VQ9 I;  1BW6 A;  2BGC A;  3L2W A;  3LA3 A;  3WTZ A;  3J7A O;  2VL8 A;  3R0A A;  3OOP A;  1T8I A;  2NVT J;  5LEJ A;  1UB9 A;  1QU3 A;  1ZKG A;  1DUX C;  1B72 A;  2CV1 A;  3GCM A;  1YIO A;  2BE5 F;  2Z33 A;  2V7F A;  2COB A;  4QPO A;  1BC8 C;  3GVA A;  3M8J A;  1Q1V A;  2DOD A;  4Y33 A;  3IH3 A;  4IXA A;  4NHJ A;  3HKZ N;  2DFH A;  2DFE A;  1LDJ A;  5LEK A;  1VQ8 I;  2DK5 A;  1P2F A;  4QIW N;  3WTS C;  1HW1 A;  2DMU A;  4E7K A;  3S93 A;  5GAE J;  4RB0 A;  1WVR A;  2CSO A;  3PM1 A;  3S3N A;  2OTL I;  4YEJ A;  4DZJ A;  2FBH A;  2V9K A;  4MNU A;  2A6T A;  4YFK F;  3JAM K;  4D1Q A;  1X1D A;  4Y3O A;  4Q4Z F;  3L1P A;  2R7V A;  2L9R A;  4IEJ A;  3DQV C;  4GCV A;  2LK2 A;  4KIC A;  2OZU A;  1T08 B;  5J6X A;  4I99 C;  3DTK A;  1ETQ A;  3DTI A;  4Y15 A;  4XKW A;  2L7K A;  1VFC A;  4UB8 C;  5EJC A;  4IHV A;  2QWW A;  2XRN A;  5F27 A;  4UNO A;  2NNN A;  4U0W A;  5JI6 A;  2GAU A;  1ZAO A;  3LL7 A;  3W6J B;  3KFW X;  5M5X J;  5D5W B;  1ERD A;  2HGC A;  5CQE A;  2E1M B;  5DEQ A;  5L3G A;  4A0X A;  1GHC A;  1NG6 A;  1N25 A;  2M9H A;  2OCE A;  1WI9 A;  2HR3 A;  2DT6 A;  4N4O B;  5K1Y A;  1LVK A;  2K3P A;  4B09 A;  3O2P E;  4G7H F;  2XHK A;  5D5X B;  4MFE A;  2OCC H;  5DCM A;  1FTT A;  1IN4 A;  1XD7 A;  5IYC J;  2DA3 A;  1SAU A;  5DCF A;  3K0L A;  1O3R A;  2K4J A;  2Z5U A;  3T1B A;  4D0P A;  1BI3 A;  1VQK I;  2R7U A;  4WXC A;  2GA2 A;  5FLM J;  4BUP A;  2X4H A;  4WX9 A;  4PDK A;  1I27 A;  4HLX A;  3ONQ A;  3H5R A;  3GFL A;  2LYC A;  4CCM A;  2Q2E B;  3ZQF A;  4M9S A;  3UKG A;  1MSF C;  1XGS A;  2QCO A;  3EYI A;  3MKZ A;  2DPU A;  3RCO A;  1XS9 A;  3K4N A;  1HCR A;  3Q9V A;  2R7X A;  4O5V A;  2X51 A;  2FX0 A;  4X6A J;  2JWT A;  4NB5 A;  4F92 B;  1Q1H A;  3QAH A;  3M9A A;  4IF4 A;  4QSH A;  2MC4 A;  3HM5 A;  3G1L A;  5CQG A;  4CH7 A;  5F1R A;  5JLW A;  4KN4 X;  3MKL A;  5J40 A;  1SAX A;  2AHQ A;  2RGV A;  1WFX A;  2LNB A;  1O4X A;  4GDF A;  3LMM A;  1LFU P;  1ZYR F;  3BG6 A;  1OCZ H;  2GIV A;  4HEA 2;  5FKL A;  2XGE A;  2BY1 A;  1IC8 A;  5HOD A;  4HX7 A;  2GXA A;  1TLH B;  3JTH A;  5M5Y J;  4EJU A;  4X0G A;  3ZQH A;  3OWT A;  2QBY B;  1D1A A;  3ABT A;  2FRH A;  5GAH J;  2MAB A;  2VIX A;  2M0C A;  5AIQ A;  4XIC A;  2EZI A;  2JA2 A;  4E7S A;  2R7Z J;  2GWR A;  3E6B A;  3HRU A;  1Y1W J;  4IHS A;  3CP2 A;  5EEG A;  2LY2 A;  2GLO A;  3ZMT A;  3WTV C;  4AVP A;  1BJZ A;  1ZGW A;  1S9H A;  4RBO A;  2M34 A;  2JQ7 A;  2GBY A;  2QKL B;  2OPT A;  4MO7 A;  3ZGK A;  2JPB A;  3FK7 A;  1JUP A;  4KUM A;  1SFE A;  1T56 A;  2KPM A;  4W1U A;  2AQF A;  3QU3 A;  3R6S A;  1LEA A;  3L7W A;  2FEZ A;  1W5C C;  5J1R A;  2VE9 A;  2K9L A;  4S04 A;  1C0W A;  2PMU A;  3S3M A;  4XLN F;  1YG2 A;  2V9V A;  1OJL A;  2WAD A;  1W1W E;  1WJD A;  4OIP F;  4MQV A;  1OCR H;  2CH0 A;  2DMQ A;  3CMM A;  4BY1 J;  2NOG A;  5LD2 C;  2O03 A;  5IT3 A;  3PQK A;  2KDO A;  2A6E F;  2DJI A;  1UHW A;  2VQL A;  3RYP A;  2OF7 A;  4A93 J;  1R1U A;  1S72 I;  2YSR A;  1RPW A;  4U88 A;  2HVR A;  1MW7 A;  2JA6 J;  3DEU A;  3A02 A;  2GQQ A;  5HNH A;  2KKO A;  4K2E A;  2VKE A;  3G2B A;  5TGT A;  3CC4 I;  1W5T A;  2MH2 A;  2YU3 A;  2ZNY A;  2BHY A;  3GFM A;  4MIM A;  3OYA A;  1R71 A;  3HXL A;  1WWX A;  3OYM A;  2IS6 A;  3HKZ A;  1BR1 A;  1W0T A;  1ZR2 A;  1E3P A;  1TW2 A;  4XKC A;  3KYL A;  2AXL A;  5B3S H;  3D5S C;  5DTD A;  1KZH A;  3ZMS A;  3HSF A;  2A05 A;  1X1A A;  5HDK A;  4PGG A;  4EEF G;  1OYY A;  4U87 A;  1X2M A;  1L0O C;  2DA4 A;  2QLZ A;  4G12 A;  3JRD A;  3I4N J;  4DGW B;  5EG0 A;  2JT1 A;  2JSC A;  4A5N A;  4IO9 F;  2UXN A;  1OYW A;  5IOZ A;  3UNG C;  2V6E A;  3BQY A;  4A3E J;  2VOO A;  2CFX A;  3SDG A;  4HRI A;  4RB1 A;  4UVC A;  1B1B A;  1B8I A;  2ISZ A;  3ZMD A;  2MSY A;  4Z6Y A;  1K4S A;  1IDY A;  3SZT A;  3CDL A;  4HPQ A;  1NTC A;  2L7M P;  5DUK A;  1P7I A;  3VYR B;  3CMA I;  1TNS A;  2KJB A;  2DLL A; 
#chains in the Genus database with same CATH homology
 3NEU A;  3E5X A;  3TGN A;  2IPQ X;  2WTE A;  2VC0 A;  3H3Z A;  4RB2 C;  1F4K A;  2EA2 A;  2H6B A;  2HTS A;  2Z3Y A;  5CVJ A;  1LB2 A;  4YII A;  2XAF A;  4JK1 X;  4AD9 A;  2NNY A;  3KZZ A;  3L2C A;  3FXR A;  2ESH A;  5EEH A;  1EH7 A;  3G3Z A;  5FO5 A;  5LHI A;  1W7P B;  1J0R A;  3M8F A;  3C3W A;  3EUH A;  1T0F A;  3WTT C;  2FA5 A;  1FYK A;  2ELH A;  3P7N A;  4CXF A;  5FD5 A;  3BJO A;  2DFI A;  3MFK A;  1FBS A;  3P9I A;  3K2Z A;  1U5T A;  4U0V A;  3BOQ A;  4GGG A;  2Y48 A;  2F5D A;  1K79 A;  1D8J A;  5K5R A;  4O3M A;  1Z1D A;  4LD5 A;  2QBY A;  3IKV A;  3TO6 A;  1T6S A;  1XMA A;  2E1C A;  2YPR A;  1ZG3 A;  3F72 A;  2PN6 A;  1ZRE A;  1BOA A;  1GXQ A;  1O3T A;  2KIU A;  2HFH A;  3N97 A;  1RI7 A;  1S8N A;  2V6C A;  1QGP A;  4KIF A;  3IL2 A;  1IF1 A;  1FT9 A;  2K86 A;  2VOD A;  3H3U A;  1MJ9 A;  1S7A A;  1R5G A;  3DPT A;  2EFW A;  4P5O A;  3JTG A;  4KA4 A;  4JQF A;  1E2X A;  2NAZ A;  4RB3 C;  2IA2 A;  1SMT A;  2NS0 A;  5DD8 A;  2V1U A;  3GO5 A;  4UV9 A;  2QQA A;  2FSW A;  5BS6 A;  1T38 A;  2QVO A;  2F5C A;  5D5V B;  2PBI A;  2ZME B;  4A5M A;  2EB7 A;  2D2W A;  5LGN A;  3HOS A;  5DYM A;  4I7H A;  2VT3 A;  1ZG1 A;  4L18 B;  4Q5S F;  1BI0 A;  3CO6 C;  3WTW C;  5F64 A;  1ZLJ A;  2STW A;  1R22 A;  5HLG A;  3TOA A;  2EA4 A;  4IVN A;  2M87 A;  5LGU A;  3FXU A;  1KU3 A;  1ZRF A;  4AIH A;  2GXG A;  2XAG A;  4A12 A;  4YG2 F;  3L9F A;  3SFZ A;  1HQC A;  2XKO A;  4BH9 A;  4LLN A;  5A2Q K;  3BJ6 A;  1ZHF A;  4RGU A;  3RJP A;  1BI1 A;  2XAQ A;  2L4M A;  2IA1 A;  2HYG D;  3DV8 A;  3J80 K;  3O3K A;  2XIG A;  2VBX A;  1U8R A;  1LQ1 A;  2WV0 A;  1FSH A;  2FE3 A;  2AS5 F;  4A6E A;  3ZMZ A;  1S29 A;  3F8N A;  1O3Q A;  2LDU A;  1IRG A;  1UHM A;  4HOB A;  1SD5 A;  1B6A A;  2G9W A;  5LRR A;  2ACJ A;  1EH6 A;  4AWX B;  4IRH A;  2GA1 A;  3KEQ A;  4IPA A;  1R00 A;  1GVJ A;  1BJA A;  4A0Y A;  3KLN A;  3U1D A;  1PDN C;  2KRF A;  1TTY A;  3CUQ C;  1IXC A;  4PGH A;  1LJ9 A;  1RUN A;  1Z91 A;  2Q8K A;  5IT9 K;  5DCM B;  2HZT A;  3KLO A;  1RUO A;  3CUO A;  1KGS A;  1KQ8 A;  3ZMV A;  3Q9S A;  1WSU A;  3D0S A;  2PG4 A;  4CZZ A;  2FF4 A;  3IHU A;  3T5X A;  4HDU A;  4CIC A;  1IN5 A;  2DO7 A;  3MWM A;  4M71 A;  5CVR A;  4DQ2 A;  4ETS A;  5DV5 A;  4EGZ A;  3V7S A;  1FSE A;  1FYL A;  1HKQ A;  2HKX A;  3HTU A;  2P4W A;  3TDZ C;  4HX8 A;  1FZP B;  3F6O A;  4Q47 A;  1RIO H;  1I5Z A;  4EM2 A;  4M9X A;  4OU0 A;  3CO7 C;  5E1X A;  1DPR A;  2M8E A;  3K1N A;  4MEX F;  3RKY A;  5KVR A;  5LLQ A;  1ZH5 A;  2DK8 A;  2ISY A;  2EV0 A;  3LA2 A;  4H0E A;  3T8R A;  2QQ9 A;  2UXX A;  4Z2Y A;  1P4X A;  4WK8 F;  3ROU A;  3MQ0 A;  5E1W A;  5DUI A;  3HRT A;  2OA4 A;  2Y75 A;  1U6G A;  3LQR A;  2HTJ A;  2WC2 A;  3RPQ A;  3CLO A;  1QZZ A;  1BBY A;  3FWE A;  3KET A;  3R60 A;  5BOX A;  1K6O A;  3KP5 A;  1ZG5 A;  2VON A;  4G94 A;  2A07 F;  5ICF A;  2VBZ A;  1YYV A;  1SD7 A;  4MTD A;  2X0L A;  3K1P A;  1F9N A;  4E70 A;  3CTA A;  5E8G A;  2ZXJ A;  1R1V A;  1U78 A;  4PCQ A;  5L3F A;  3F23 A;  3EQL F;  5CLS A;  2JRT A;  1FBQ A;  3FZV A;  1U2W A;  2ZNZ A;  5D4R A;  1HST A;  2O6G E;  5E18 F;  1ZRC A;  3J81 Z;  2EFP A;  3LAJ A;  2L02 A;  2XVC A;  3W6K B;  3QP6 A;  1TQM A;  3LFK A;  2KJC A;  1R7J A;  3FHZ A;  2UZK A;  1DPU A;  1FP1 D;  5BPI A;  5D8K B;  3BRO A;  4G7O F;  2A3S A;  3TOB A;  3E3V A;  3LST A;  2YX7 A;  4AIK A;  3WU0 A;  4G6Q A;  1HKT A;  3RYR A;  3L00 A;  3TO9 A;  2XRO A;  1YW7 A;  3I53 A;  1JXS A;  3DP7 A;  1U5T B;  1LEB A;  2DQR A;  3E5Q A;  2PEX A;  4KIB A;  1A04 A;  4BHC A;  3V8L A;  1R5H A;  3RKW A;  4YFX F;  4XRF A;  4G7Z F;  3KCC A;  1AWC A;  4CO8 A;  1YS6 A;  3REO A;  2ADU A;  3I4P A;  3TKY A;  1DDN A;  1IUY A;  2O3F A;  2RKH A;  2LF7 A;  3DF8 A;  1V4R A;  1OYI A;  2DBB A;  4HW0 A;  2W57 A;  4CGZ A;  4I98 B;  1XCB A;  4MTE A;  2STT A;  3B73 A;  2K7L A;  1IAW A;  1G3T A;  1IN8 A;  2EK5 A;  4ZH4 F;  1O7F A;  5ERI A;  4L9T A;  5FLX Z;  2Q0O A;  3JSP A;  3IWZ A;  1MDM A;  2CG4 A;  1H0M A;  1MZB A;  2VBY A;  1UCR A;  3WE2 A;  2XAS A;  1LDD A;  5ICE A;  1MGT A;  2D45 A;  1XGM A;  2L3D A;  5FFZ A;  4OOI A;  1XCV A;  1QBJ A;  5ICG A;  4WCG A;  1FWZ A;  4ON0 A;  1TQP A;  3V4G A;  4IRG A;  4CHU A;  4ESB A;  5HOO A;  4ENN A;  4IRI A;  2EFN A;  4M9Z A;  2J5P A;  4I02 A;  5CVU A;  3ZP5 A;  5L3D A;  4EGY A;  3CJN A;  1TBX A;  1KQ0 A;  3KP7 A;  2M30 A;  3DKW A;  1ZLK A;  5L3E A;  1B59 A;  3M1E A;  4EVI A;  2DU9 A;  3DXJ F;  3M7G A;  3VFZ A;  3FM5 A;  5HVQ C;  5ILS A;  5H20 A;  1JE8 A;  4F7Z A;  3HHH A;  2GZW A;  3HRM A;  1CF7 B;  3TDU C;  4P55 A;  2MD5 A;  3S2W A;  2XKP A;  1IRF A;  3RI4 A;  2W25 A;  2LSO A;  4YIF A;  4N9I A;  2R7F A;  2ETH A;  3I71 A;  2EJR A;  1R36 A;  2CW0 F;  5D5U B;  2FBK A;  1O3S A;  2B0L A;  4PZJ A;  1FNN A;  5FGM A;  4ESJ A;  1V3F A;  1PP8 F;  2MBF A;  1IXS B;  3ECO A;  4UVA A;  1YO5 C;  5BPD A;  1OKR A;  3R61 A;  2JPC A;  1SFU A;  1P4W A;  2EFQ A;  2HQR A;  5LGT A;  2DPD A;  3I5U A;  3I54 A;  4OMZ A;  2ZJ2 A;  5CJ9 A;  1G3Y A;  1MKM A;  1REP C;  4BHB A;  2A69 F;  5J8F A;  2OBP A;  1ODD A;  1DP7 P;  3E5U A;  2RN7 A;  3ERE D;  1SMY F;  5HDG A;  4MQ9 F;  2VBW A;  1STZ A;  3F8F A;  4RS8 A;  2ZFW A;  1XDU A;  4HYE A;  3BWG A;  4CDG A;  1B4A A;  4ENM A;  2DI3 A;  3HSR A;  1ZGA A;  4WWC A;  1HW2 A;  1JGS A;  3QRF F;  2HYF A;  2D1V A;  2PLY A;  2Y0M A;  3GLX A;  2O61 A;  1ZRD A;  1MD0 A;  3I59 A;  4BNC A;  4EV0 A;  1XGN A;  4OIN F;  2GXB A;  1XDS A;  2YX4 A;  1T39 A;  4ENK A;  1HBX G;  1D8K A;  4R8H A;  4UXN A;  2IJL A;  2F5F A;  1HXD A;  1G3W A;  4AIJ A;  1K7A A;  2M45 A;  2L54 A;  3LAP A;  2PFB A;  3WTU C;  3IKT A;  3H92 A;  3C18 A;  2MA3 A;  4XSX F;  3WTY C;  1YTY A;  2RVC A;  2F5E A;  2P5K A;  1NHA A;  2K02 A;  2Z99 A;  3WGI A;  2ZBK A;  1I1S A;  2LF8 A;  4P9F A;  2P5L C;  3T0Y A;  2V1X A;  4EJO A;  3ML6 A;  1CF7 A;  1TNT A;  2NYX A;  1FPQ A;  3CUQ A;  4LJZ F;  1WQ2 A;  1KU9 A;  3BP8 A;  1J7K A;  1XSD A;  5ILV A;  2EV5 A;  3EET A;  3FX3 A;  4N9H A;  3ZMU A;  3GWZ A;  4KMF A;  2XUB A;  3U9G A;  3FXQ A;  5JHU A;  3LQQ A;  3KP3 A;  2VC1 A;  2MLK A;  2MC3 A;  1LDK B;  1B9M A;  3RDI A;  4ENJ A;  2FNA A;  1BI2 A;  3V7R A;  2WWY A;  4A0Z A;  5K5Q A;  2P7C B;  1J5Y A;  2A68 F;  4L9J A;  5KK1 A;  3KE2 A;  1USS A;  3IRR A;  1OPC A;  5HS9 A;  5DD4 A;  2PI0 A;  3KEO A;  3GXO A;  1Z7U A;  5ILU A;  1FX7 A;  1LVA A;  2COM A;  1S3J A;  2A6H F;  3HHG A;  3QPT A;  2HEO A;  3WGG A;  2H09 A;  5LHH A;  2KIM A;  5BMZ A;  2NRA C;  2M5W A;  4FX0 A;  4M6X A;  4RGS A;  3MAJ A;  1WRJ A;  2IA0 A;  4LG0 A;  4KT5 C;  4IJA A;  4FT8 A;  3JAM Z;  2FU4 A;  2HQN A;  3ISP A;  3E6D A;  3ZQ7 A;  4HX4 A;  4M73 A;  3FF5 A;  2HOE A;  4XBF A;  2CGP A;  3BY6 A;  5D6F A;  1CGP A;  3GZ6 A;  3ZPL A;  1I6X A;  3B02 A;  3COA C;  3GF2 A;  1HKS A;  3L09 A;  4HLY A;  2FNP A;  4LGW A;  3T8T A;  1FYM A;  3QPH A;  3FMS A;  5E1Z B;  1MDM B;  4NQW A;  4LB6 B;  1JHH A;  4HV6 A;  2ZCW A;  3N4M A;  1BM9 A;  4L9N A;  4ESF A;  5L3C A;  2IP2 A;  2JTV A;  3MZY A;  2FXA A;  2EFO A;  1Z6T A;  2VXZ A;  4U7B A;  2QYO A;  5AON A;  3HSE A;  5CVV A;  5HLI A;  1XN7 A;  3I64 A;  4OIO F;  5HS8 A;  4Q48 A;  3QOP A;  4YFN F;  4WXH A;  1QZY A;  1KQ9 A;  2P5V A;  3R0J A;  2P8T A;  5E17 F;  3ABU A;  3O6B B;  3I58 A;  1XSV A;  3V8J A;  1I1G A;  2J5O A;  4U7D A;  1RNL A;  1K78 A;  4HA8 A;  2OU2 A;  1HSJ A;  3QP5 A;  3HTS B;  2BV6 A;  1MJB A;  4BQA A;  4EJT A;  3P9K A;  4KFC A;  4RAY A;  4UV8 A;  3R4K A;  1TQI A;  3RKX A;  4EJV A;  2M1B A;  1FC3 A;  2IVM A;  3K69 A;  4G9Y A;  1IZ1 A;  4BXU A;  4EJW A;  2DAO A;  5LHG A;  4ZYE A;  1W5S A;  3HYI A;  4OIQ F;  4OMY A;  4L0Y B;  3WTX C;  2R3S A;  1Z05 A;  2QM3 A;  3F22 A;  2EV6 A;  2EWN A;  3I0T A;  2W85 A;  1BIA A;  4I01 A;  1PUE E;  5BQT A;  2HWV A;  4QWQ A;  4I09 A;  5FB2 A;  3GYH X;  2A5Y B;  3GX4 X;  1D5V A;  2VT2 A;  4GYG A;  1MJA A;  1QNT A;  1QQI A;  3C7J A;  4LLG F;  1KYW A;  5LBQ A;  4UVB A;  2RNJ A;  3K1M A;  3SZP A;  2OZ6 A;  4WXD A;  4LFU A;  2ZO4 A;  1G6N A;  5HDN A;  4EM1 A;  4KNY A;  2A61 A;  2W84 A;  3WGH A;  3TO7 A;  1J9I A;  1P4A A;  1KU7 A;  4ZZL A;  2ESN A;  4BHP A;  4FX4 A;  3IC7 A;  5L3B A;  5HS7 A;  3J81 K;  3GFJ A;  4R1H A;  5LRS A;  1WKM A;  3MEX A;  1ZGJ A;  3M8E A;  4OIR F;  1W4M A;  3E6C C;  4HF0 A;  3FM3 A;  2F2E A;  6PAX A;  1YLF A;  3BZ6 A;  3KZY A;  5D8L B;  2FML A;  1F5T A;  4Y17 A;  2IRF G;  1LNW A;  3I59 B;  4CYD A;  1IN7 A;  1RZ4 A;  3MZH A;  1FY7 A;  5JFR A;  4QLC U;  3C1D A;  4ZYG A;  5K5O A;  4A6D A;  4O6J A;  2ZKZ A;  4HAM A;  2RQP A;  4LLL A;  4HF2 A;  1UST A;  1YQA A;  4HQM A;  4M72 A;  3SXY A;  3IRQ A;  2JZY A;  2DT5 A;  2P6T A;  5FD6 A;  2H6C A;  4ASN A;  4ZZD A;  4B8X A;  1PP7 U;  2CO5 A;  2HKO A;  4UUV A;  4KMU X;  1BIB A;  2HS5 A;  2H27 A;  4MEY F;  5D6E A;  1GXP A;  1R58 A;  4HZF A;  1FP2 A;  1ON2 A;  3WG9 A;  5AIP A;  3E97 A;  1YW8 A;  2KIF A;  4BAY A;  3KP4 A;  3CUQ B;  3EYY A;  5FLX K;  4M6Y A;  1F1Z A;  1JHF A;  5FFX A;  4L9V A;  4RAZ A;  4HBL A;  1SD4 A;  1QO0 D;  4JBA A;  3FMR A;  2QEN A;  3GZ5 A;  2HDC A;  2Q2E A;  4KIG A;  5F6F A;  2DTR A;  4UHT A;  1FBU A;  3SQN A;  3QU6 A;  3TQN A;  2YR2 A;  1YW9 A;  1B9N A;  1XSX A;  3P9C A;  4HQE A;  1R23 A;  2OQR A;  1IXR C;  2P7V B;  5J8C A;  1TW3 A;  1S6L A;  3GUD A;  1BC7 C;  2P6S A;  2L01 A;  1X3U A;  2RV8 A;  4RGR A;  3VB2 A;  2Z9O A;  3JSO A;  4KDP A;  4IHT A;  4N0B A;  3VOD A;  2C6Y A;  2XAJ A;  1Z6R A;  4I0B A;  1ZN2 A;  2XAH A;  2E1N A;  1EH8 A;  4U0Y A;  4I2O A;  5A2Q Z;  3PFI A;  3F8B A;  3SHF A;  5D4S A;  3F3X A;  4ZYD A;  2PJP A;  4R79 A;  4Y13 A;  1U5T C;  2BBY A;  3J80 Z;  1IW7 F;  3ECH A;  5TRD A;  1Y0U A;  1BN5 A;  4LG0 B;  3FMQ A;  1R1T A;  1HW5 A;  3BDD A;  1ULY A;  3MCZ A;  5DDG A;  3VOE A;  4MGR A;  4S05 A;  5ICC A;  1OR7 A;  1EV7 A;  1XGO A;  1S7O A;  2XV4 S;  3HOT A;  3WOD F;  2DW4 A;  3F21 A;  4LK1 F;  4KN7 X;  1SD6 A;  1KYZ A;  4A2U A;  3ULQ B;  3OV8 A;  1ZAR A;  2V1D A;  3RPU A;  1G4D A;  4G6D A;  1ONV A;  5IT9 Z;  3Q5F A;  2CWE A;  2TDX A;  2K4B A;  1D3Y A;  4G8X A;  2H94 A;  4P96 A;  5E20 A;  5JVT A;  4XSZ F;  2OD5 A;  1ON1 A;  3D5L A;  4GO1 A;  3ELK A;  2BEO A;  3CDH A;  3BPX A;  5TJJ A;  1J59 A;  3ZN0 A;  1P6R A;  2D1H A;  3G73 A;  4KYW A;  2K27 A;  1Z9C A;  1W7P A;  2R7D A;  5HLH A;  1OMI A;  2RC4 A;  3DFG A;  2PQ8 A;  4GXO A;  3GFI A;  2VOP A;  2IT0 A;  2MH9 A;  2FQ3 A;  4HV5 A;  3K9T A;  3LWF A;  2QQB A;  4BYY A;  1P92 A;  2V79 A;  1J2X A;  2CQK A;  4MHG A;  2VN2 A;  4P9U A;  2O0Y A;  4L5J A;  3BPV A;  3F8M A;  4EM0 B;  1K78 B;  2BYV E;  1O7L A;  2FBI A;  2LKP A;  3IWF A;  3RTR A;  2XGX A;  1QPM A;  3F8C A;  4ZYH A;  3NQO A;  1J75 A;  5H6Q A;  2O8X A;  2E7X A;  3F6V A;  2FMY A;  1VTN C;  4M74 A;  4XLP F;  3WU1 B;  4HDV A;  2FOK A;  3KP6 A;  3HUG A;  1W7P D;  1H9T A;  1AOY A;  2W24 A;  2OQG A;  3NRV A;  1O57 A;  3ZN1 A;  2RDP A;  4DNC A;  1H9G A;  4TV7 A;  4L5I A;  3LA7 A;  2G7U A;  2QZ8 A;  1U3E M;  1FOK A;  1IN6 A;  1XMK A;  2QUF A;  4HF1 A;  4EQQ A;  1G3S A;  3DPL C;  1KA8 A;  1XB4 A;  2L4A A;  3PQJ A;  4WF2 A;  4LB5 A;  2OAZ A;  2E7W A;  2G7H A;  2MLG A;  4I0A A;  1UFM A;  4EMS A;  2CYY A;  1T98 A;  3GW2 A;  3HIF A;  4LMY A;  3KP2 A;  3HRS A;  3RIR A;  5CYV A;  1T2K A;  1FLI A;  2ZME A;  5ED4 A;  2DQL A;  3E6M A;  3AAF A;  3JW4 A;  1YFH A;  5CVI A;  4GYI A;  1YS7 A;  2UWM A;  4RGX A;  3VEP A;  1E17 A;  5JR3 A;  1SFX A;  2PMH A;  5E8I A;  2VE8 A;  5H6R A;  1KU2 A;  3V8K A;  3BJA A;  4FHT A;  3GEZ A;  3EDP A;  1L3L A;  3WE3 A;  4LK0 F;  2IW5 A;  3V7C A;  3U2R A;  4L0Z B;  2BGC A;  3LA3 A;  3WTZ A;  3J7A O;  3R0A A;  3OOP A;  5LEJ A;  1UB9 A;  1DUX C;  1YIO A;  2BE5 F;  2Z33 A;  1BC8 C;  3GVA A;  4IXA A;  4NHJ A;  1LDJ A;  5LEK A;  2DK5 A;  1P2F A;  3WTS C;  1HW1 A;  4RB0 A;  2CSO A;  2FBH A;  4MNU A;  4YFK F;  3JAM K;  4Q4Z F;  3DQV C;  4GCV A;  4KIC A;  2OZU A;  5J6X A;  4Y15 A;  2QWW A;  2XRN A;  4UNO A;  2NNN A;  4U0W A;  5JI6 A;  2GAU A;  1ZAO A;  3W6J B;  3KFW X;  5D5W B;  2HGC A;  5DEQ A;  5L3G A;  4A0X A;  1GHC A;  1WI9 A;  2HR3 A;  5K1Y A;  4B09 A;  3O2P E;  4G7H F;  2XHK A;  5D5X B;  5DCM A;  1IN4 A;  1XD7 A;  5DCF A;  3K0L A;  1O3R A;  2K4J A;  2Z5U A;  3T1B A;  4D0P A;  1BI3 A;  4WXC A;  2GA2 A;  2X4H A;  4WX9 A;  4PDK A;  1I27 A;  4HLX A;  3GFL A;  4M9S A;  1XGS A;  3EYI A;  2DPU A;  3Q9V A;  4O5V A;  4NB5 A;  1Q1H A;  3QAH A;  3M9A A;  4IF4 A;  5F1R A;  4KN4 X;  1SAX A;  2RGV A;  2LNB A;  1ZYR F;  2GIV A;  4HX7 A;  1TLH B;  3JTH A;  4EJU A;  2QBY B;  3ABT A;  2FRH A;  5AIQ A;  2GWR A;  3E6B A;  3HRU A;  4IHS A;  5EEG A;  3ZMT A;  3WTV C;  4AVP A;  2JPB A;  4KUM A;  1SFE A;  3R6S A;  3QU3 A;  1LEA A;  3L7W A;  2FEZ A;  2VE9 A;  4S04 A;  1C0W A;  2PMU A;  4XLN F;  1YG2 A;  2V9V A;  4OIP F;  4MQV A;  2O03 A;  5IT3 A;  3PQK A;  2A6E F;  1UHW A;  3RYP A;  1R1U A;  2YSR A;  4U88 A;  3DEU A;  2GQQ A;  2KKO A;  4K2E A;  1W5T A;  2MH2 A;  2YU3 A;  2ZNY A;  3GFM A;  1WWX A;  1TW2 A;  2AXL A;  3ZMS A;  3HSF A;  5HDK A;  4PGG A;  1OYY A;  1L0O C;  2QLZ A;  2JT1 A;  2JSC A;  4A5N A;  2UXN A;  1OYW A;  2VOO A;  2CFX A;  4RB1 A;  4UVC A;  1B1B A;  2ISZ A;  3ZMD A;  3SZT A;  5DUK A;  1TNS A;  2KJB A;  2DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...