3F8FA

Crystal structure of multidrug binding transcriptional regulator lmrr complexed with daunomycin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
114
Chain Sequence
MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDEGGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR-like family
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
total genus 41
structure length 114
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8fA00
3ISPA 4LK0F 2F5FA 2VC1A 1MKMA 4IRIA 2HEOA 1YQAA 2LF7A 4RGRA 4OIQF 2XIGA 2OQGA 5ICGA 1IN7A 2NRAC 2NYXA 1USTA 4LLGF 4S05A 4KIBA 1D8JA 2DU9A 4OIPF 3KP3A 1OYIA 4KIGA 2R7DA 4ZYDA 5DUIA 2FSWA 1YIOA 5ED4A 3W6JB 2VBWA 2PLYA 2QQBA 3HHGA 4WXHA 1BI3A 2A69F 1B1BA 3SQNA 1IRGA 5BOXA 2CWEA 3BJAA 1XN7A 1Z91A 1PDNC 3DQVC 1JXSA 2A3SA 1UFMA 1ON1A 3IRRA 1DP7P 1KU2A 2X0LA 5DV5A 3HTUA 3JAMZ 1W5TA 2EA2A 2P5LC 3MZYA 1SMYF 3J7AO 3I5UA 4A0XA 3O6BB 2HQNA 4EJOA 3K1PA 4ZYEA 5EEHA 5L3BA 4ZZDA 1LDJA 4R1HA 1MDMB 2BEOA 3KFWX 5FLXZ 1I6XA 3TOAA 2HTSA 3H92A 3LA3A 2R7FA 4IRGA 5FFZA 2FMYA 1U2WA 1JHHA 1NHAA 5HS7A 1TNSA 1KYZA 3GLXA 4XLNF 1O7FA 2QVOA 5BS6A 3F3XA 1HW2A 2HOEA 5D6FA 5KVRA 4UV8A 2GQQA 3CJNA 1RIOH 5CYVA 1K6OA 1ZRFA 2IT0A 1ZREA 2HKOA 3SHFA 5K5OA 4U0VA 3FX3A 2COMA 2LF8A 3BP8A 5IT9Z 2STTA 4D0PA 3GFMA 3KZZA 1R7JA 2WWYA 4MHGA 1Z1DA 1OYYA 3H3ZA 3C18A 2LDUA 3QPTA 1WWXA 2M87A 3BJ6A 2O03A 3T5XA 5HLGA 3BY6A 1GVJA 4UV9A 1K79A 5D6EA 3RI4A 2YPRA 1IN8A 4P55A 2CW0F 3LQQA 3V4GA 3ECOA 3LQRA 1XGMA 1FPQA 2YX7A 4U0YA 3WGGA 1YW9A 2XASA 4LB5A 2ETHA 2G7HA 3R0AA 3Q5FA 2M30A 4LG0A 2PBIA 3HIFA 3ZN0A 2V1XA 5JHUA 2ZBKA 4EJUA 4EM1A 3GF2A 4U88A 3ZMTA 2QLZA 5LGNA 3K69A 1F9NA 4QWQA 2EV6A 1FYLA 4K2EA 3SXYA 3LAPA 4ETSA 1TQIA 3M9AA 3B02A 1RI7A 1XSXA 4R8HA 1G3TA 3DPTA 3MEXA 3HTSB 2H27A 4WX9A 3ZMDA 2C6YA 1Z6RA 1E17A 4MQVA 1BOAA 4GCVA 2F5DA 1XGSA 1QGPA 1FBUA 2Z5UA 3CO6C 5BMZA 1HSJA 2ZMEB 2Y48A 3Q9SA 3BPXA 4KUMA 3L9FA 1J7KA 1EH7A 2GXGA 1K78B 3V7SA 2QQ9A 4CO8A 4HQMA 4RAYA 3M7GA 3E3VA 4EMSA 1SD5A 3F8NA 3KP5A 3QP5A 5JVTA 2DK8A 5K1YA 2VBXA 4KA4A 5LRRA 4G9YA 4FX4A 2DQLA 1EV7A 4ENNA 2P7CB 1FP2A 4HOBA 4RAZA 3FMQA 3DF8A 3LA2A 5JI6A 3KE2A 1FSHA 4PCQA 1ZAOA 4ENMA 2L3DA 3HRTA 4IXAA 1YW8A 1WQ2A 2DFIA 2EV5A 4HQEA 1TTYA 2FQ3A 4O6JA 4A12A 3N4MA 1O3RA 2ZCWA 3KEOA 3K9TA 1XCBA 4BQAA 2P6SA 2DAOA 3E6BA 3V8LA 3JAMK 3AAFA 2CGPA 3GW2A 1KU7A 2Z9OA 2PMHA 3F8CA 2MA3A 2W85A 2ESNA 2GIVA 3FHZA 2DPUA 1B4AA 3JTGA 4HV6A 5D8LB 1AOYA 2DTRA 4AIKA 4MEXF 1SFEA 2DQRA 1LDDA 2HQRA 4M9ZA 3WTVC 2HKXA 2PEXA 2JRTA 1RUNA 3GYHX 2P7VB 2V1DA 5FLXK 3GZ6A 2VBYA 4I01A 2NNNA 2V6CA 2DW4A 3NRVA 2XROA 4RGXA 3HSEA 3F6OA 1R1VA 4I7HA 3EYIA 2EB7A 3E6CC 1MZBA 1XCVA 4KFCA 4UNOA 2MH2A 1BIAA 4L0ZB 4A6EA 3OOPA 3F72A 2M45A 2E1CA 2G7UA 3F8FA 2ZO4A 3IKTA 3CLOA 1KQ0A 4RS8A 3IHUA 3JW4A 2JT1A 4XLPF 4BH9A 4ESFA 4ZH4F 4YFKF 2RQPA 1TW3A 1IN4A 3DXJF 4HF2A 4Q5SF 1ZGAA 4M9XA 5FO5A 3ZMUA 2PFBA 1FYMA 1LVAA 5CVVA 4EQQA 1T39A 1R5HA 2L4MA 2A68F 3GFIA 2YX4A 4G7HF 3WE2A 2A61A 2MLKA 1FOKA 1IXSB 4M73A 3P9CA 3I59B 4FX0A 5L3EA 4EJTA 1R22A 4EV0A 2YSRA 1X3UA 2IP2A 5BPDA 3E5UA 3P9IA 4KMFA 3HSFA 1CF7B 3H3UA 4L0YB 2ZJ2A 3WTYC 4Q47A 3FXRA 3IKVA 1O3SA 1TLHB 2L01A 2CFXA 1XSVA 1BBYA 1T38A 4Y17A 3OV8A 3K1NA 4IVNA 2PQ8A 1T2KA 3LA7A 4CHUA 2A5YB 4TV7A 4XBFA 2A6HF 3KP7A 4MEYF 2FU4A 4ON0A 2RKHA 1BI2A 1E2XA 1FLIA 1MGTA 1HW5A 4BHPA 4JQFA 3RPQA 1G4DA 1FX7A 3ROUA 5ILSA 5E8IA 1F4KA 1D3YA 2O0YA 1LQ1A 4L9VA 1S8NA 2CQKA 1S3JA 1H0MA 2FEZA 2XGXA 2UWMA 4LD5A 2Q0OA 4MNUA 3BOQA 4UHTA 2VOOA 2EFWA 2UXNA 2VC0A 4IPAA 2EJRA 3K2ZA 1W7PA 2OBPA 3GVAA 2EV0A 1SAXA 4M74A 1HKSA 2X4HA 1SFXA 1FWZA 4HDVA 3JSOA 1LNWA 4I09A 2JSCA 4XRFA 4YIFA 3F23A 5H20A 4OMZA 4A5MA 2HZTA 5F6FA 3C7JA 3WTWC 2O61A 3GWZA 5DCMB 4AD9A 1TBXA 1ZN2A 1DUXC 3I58A 4JBAA 5HOOA 4HX7A 3I0TA 1B59A 1QZZA 2RDPA 3RIRA 1YG2A 3SZPA 4XSXF 2Y0MA 1U5TA 1AWCA 3CUQA 3FM5A 4CYDA 3WTZA 1QZYA 2NAZA 1PP8F 1FBQA 2LNBA 1WSUA 4A2UA 2VT3A 5LHIA 1JHFA 1ZG5A 2FBIA 4KT5C 3E5XA 3EUHA 1L0OC 1WRJA 4KNYA 3I59A 3R6SA 1P2FA 2MC3A 2P4WA 3QRFF 3TQNA 4G6DA 4E70A 3EDPA 1FYKA 3QPHA 3Q9VA 2PG4A 5FFXA 5BQTA 2D2WA 1R1UA 2V1UA 4HW0A 1DPRA 2OA4A 5KK1A 4RB2C 4CGZA 4U7DA 1OR7A 3KP2A 1F1ZA 5DYMA 3ELKA 4P9FA 3LAJA 4BXUA 1FP1D 2ZNYA 3T1BA 3F21A 3EQLF 3RJPA 4F7ZA 2E1NA 5LHHA 3PQJA 4UVCA 5LEJA 1FBSA 1P4AA 5HVQC 4JK1X 3D0SA 4WF2A 1I1SA 2IVMA 1VTNC 4WWCA 1T98A 1HQCA 3WTXC 5D5WB 1J2XA 1FT9A 4UVAA 2BV6A 4BYYA 2DI3A 4H0EA 2J5OA 2VN2A 1GXPA 3V8KA 4A6DA 4O3MA 3WG9A 4MTEA 3ABUA 1T0FA 3VEPA 1TW2A 4YIIA 1BJAA 2ZKZA 4M71A 2CG4A 5L3DA 1KQ8A 3VFZA 4ZYGA 1MJAA 1P4WA 1P92A 1XMKA 1SMTA 2EFNA 1XGOA 3RYRA 4R79A 2XKOA 1RUOA 1ULYA 2RVCA 1I1GA 3S2WA 2HFHA 1ZARA 3WE3A 1KGSA 2H6BA 2QBYB 1SD4A 3ZMVA 5LEKA 3RKWA 4DQ2A 4N0BA 1MD0A 4ZZLA 3WTSC 3G73A 2F2EA 2A6EF 2PMUA 3BZ6A 5CVRA 4I0BA 4CICA 2OU2A 4EM0B 2BE5F 2G9WA 2O3FA 4KN7X 1W5SA 1IAWA 5FD5A 4ESJA 1IW7F 1QNTA 3WU1B 5DEQA 3WGIA 1QPMA 4I0AA 4HLXA 4LLLA 3E6MA 4Q4ZF 1ZLJA 1MDMA 2HS5A 1JGSA 1ONVA 3VOEA 5D8KB 3F22A 3KEQA 3ABTA 2FF4A 3KP4A 3C3WA 1ZG1A 3HHHA 1ZHFA 4KN4X 1B6AA 3GFJA 3FMSA 4EGYA 3K1MA 1OYWA 2VE8A 2ELHA 1S7OA 4CZZA 2LSOA 2ACJA 4Z2YA 1G3WA 4KIFA 5E1WA 2XHKA 2EK5A 3TOBA 1P4XA 1SFUA 2YR2A 1DDNA 2EA4A 1W4MA 2IA1A 2FRHA 4S04A 2D1VA 3HOSA 3QAHA 5FGMA 4AWXB 2STWA 4EVIA 2ZFWA 2P6TA 2AXLA 3FWEA 3ZN1A 2QM3A 2XAGA 1MJBA 1FNNA 3RTRA 4L9JA 4HX8A 3RKYA 1STZA 5IT3A 1C0WA 1B9MA 3ZMSA 1XMAA 3NQOA 2P5KA 4HYEA 5LLQA 3TGNA 2MBFA 2HYFA 3E6DA 2L02A 4GYGA 2M8EA 1TNTA 2UZKA 1U78A 2R3SA 1YTYA 5FD6A 5CVUA 2BYVE 2FE3A 2NNYA 4L5JA 3DPLC 2EWNA 1J0RA 5DCFA 3M8EA 1ZRCA 1FZPB 5HLHA 1B9NA 5E17F 3P9KA 1XB4A 1Z7UA 3ZP5A 1QO0D 5AIQA 4KMUX 3DEUA 3MFKA 1S6LA 2W25A 4CXFA 1XD7A 3U9GA 3IRQA 2DBBA 1BC7C 4YG2F 1KYWA 5LGUA 1R1TA 4AIJA 1HKTA 2VBZA 4P5OA 2FA5A 2BGCA 5L3FA 4I02A 5AIPA 4NQWA 3TO6A 3HUGA 4LFUA 2CYYA 5HDNA 1S29A 4HAMA 3T8TA 1D8KA 2FBHA 3CTAA 3HRMA 2GA2A 4LMYA 3KZYA 4HF1A 2K7LA 2XRNA 3O2PE 5BPIA 5EEGA 1IRFA 2HYGD 3RPUA 2ZMEA 2XAFA 5E1ZB 2JZYA 2F5EA 2MH9A 4HV5A 1K7AA 1K78A 3ULQB 2KJBA 3WTUC 3F6VA 3F8MA 1UCRA 4WXDA 1ZLKA 1FC3A 1QBJA 4RGSA 4UXNA 3GXOA 4L9NA 2GWRA 1D5VA 3MZHA 2E7WA 3LFKA 4HZFA 3R60A 4MGRA 4HBLA 2H94A 3PFIA 3VODA 3MWMA 4A0ZA 4G6QA 3MQ0A 1HSTA 2OAZA 2P5VA 3BROA 4O5VA 1KU9A 2VOPA 2RV8A 2W84A 2IA0A 3KCCA 5J8FA 3K0LA 2A07F 4L9TA 5D4RA 1LDKB 2RGVA 1PUEE 3TO9A 1W7PD 3QU3A 1REPC 4OIRF 5E18F 3IWFA 3RYPA 3IL2A 1YW7A 3R0JA 3QU6A 3W6KB 1F5TA 1TQMA 3L7WA 2VONA 4N9IA 3F8BA 3R61A 4OINF 2PI0A 2D1HA 4U0WA 2J5PA 3RKXA 4AVPA 4M6YA 4IHTA 1YYVA 1LEBA 4RB0A 3WU0A 5D5XB 3EYYA 2O8XA 4NHJA 4ENJA 3GO5A 3P7NA 3BPVA 2JTVA 2FNPA 2OD5A 5L3GA 1Z9CA 1V3FA 3R4KA 1L3LA 1YS7A 3N97A 3E97A 4OU0A 5CVJA 2B0LA 4I2OA 2KKOA 2UXXA 3J81K 1U6GA 2HGCA 2DT5A 4AIHA 4WXCA 1U3EM 4M72A 2IW5A 2OZ6A 2ZXJA 2E7XA 2Q2EA 2RN7A 4LG0B 2Z99A 2QUFA 3U1DA 1J75A 5K5RA 4B09A 2H6CA 3M8FA 4LK1F 5ICCA 5A2QK 3IC7A 4PGHA 5DDGA 1OMIA 4G7OF 3I53A 4IRHA 2Z3YA 2GZWA 1ZH5A 1BI1A 2V9VA 3MCZA 4LLNA 4IJAA 1UB9A 2ADUA 2K4BA 4ESBA 4FHTA 4PDKA 3FXQA 2IRFG 1SD6A 3B73A 4EJVA 1RNLA 1BM9A 3WTTC 3GUDA 5CJ9A 4ZYHA 5E8GA 2KIFA 2EFOA 1T6SA 5ICEA 1XDSA 4BNCA 3L00A 5JR3A 3TKYA 3U2RA 4HF0A 3CO7C 2QYOA 2HR3A 3TDZC 1BC8C 2FXAA 3V7CA 2XAJA 3C1DA 3VB2A 1IXRC 2AS5F 1KQ9A 1G3YA 1O3TA 3M1EA 2W24A 1ZRDA 1LEAA 3MAJA 4B8XA 2EFQA 5E1XA 4L18B 4A5NA 4U7BA 2KRFA 4OIOF 1O3QA 3O3KA 2QENA 4GXOA 1CF7A 4G7ZF 2PJPA 5K5QA 3HRSA 1U5TC 5H6QA 4G94A 3CUQC 4XSZF 3EETA 2YU3A 5LGTA 1BI0A 2OQRA 2WTEA 2Y75A 1QQIA 4IHSA 3I54A 1R5GA 5L3CA 5FB2A 4G8XA 3BWGA 6PAXA 2IA2A 2IJLA 2VT2A 2MD5A 4LGWA 1J9IA 5HS8A 3DFGA 2P8TA 3J80K 5J8CA 1R58A 1YS6A 5JFRA 2K27A 3V8JA 1EH8A 1WKMA 5DUKA 4GYIA 2ISZA 5LRSA 2ISYA 3L2CA 3ERED 4OOIA 1XSDA 2FOKA 1BIBA 1SD7A 4EGZA 4Q48A 1Q1HA 5ILUA 2TDXA 1J5YA 1GXQA 2FBKA 2K4JA 1H9TA 3FMRA 2WV0A 1ZGJA 3KETA 1OPCA 2VXZA 3DV8A 2XAHA 4IF4A 3JSPA 5ERIA 1UHMA 2K86A 4GGGA 2VODA 3QOPA 5HLIA 2DPDA 1I27A 3ECHA 4NB5A 1J59A 2VE9A 2KIUA 3COAC 4UVBA 3GFLA 1JE8A 5DCMA 2MLGA 4MTDA 1TQPA 2WC2A 2W57A 3GZ5A 3REOA 4RB1A 4BHBA 3T8RA 1S7AA 1IN5A 3L09A 4PZJA 4FT8A 3LWFA 2CO5A 5DD8A 4MQ9F 4HDUA 1R00A 4RB3C 2OZUA 4HX4A 1WI9A 1PP7U 4KYWA 5TRDA 3V7RA 3J81Z 3KLNA 4BHCA 3LSTA 1XGNA 1LJ9A 4M6XA 4YFXF 1ON2A 1H9GA 4WCGA 3PQKA 3HRUA 3KP6A 1MJ9A 5J6XA 3ML6A 2Q8KA 5A2QZ 2XKPA 3JTHA 4GO1A 4RGUA 2Z33A 2K02A 2F5CA 2O6GE 4ASNA 4A0YA 1KU3A 1R23A 3DKWA 3CDHA 1FSEA 2BBYA 1ZYRF 4P96A 1EH6A 2XUBA 3ZQ7A 2JPBA 5ILVA 1IF1A 1HKQA 3FM3A 4KICA 2QWWA 3ZMZA 3GEZA 2RC4A 3WGHA 3I4PA 3SZTA 3E5QA 4HA8A 1YLFA 1P6RA 5F64A 2V79A 5LBQA 2PN6A 2D45A 3HSRA 3FXUA 2DLLA 4Y15A 3FZVA 2GA1A 3BJOA 2HTJA 1O57A 2FNAA 3ZPLA 4UUVA 1IUYA 3FF5A 4WK8F 4N9HA 2RNJA 2L4AA 5F1RA 2L54A 3DP7A 1ODDA 4CDGA 2KJCA 2QBYA 3SFZA 5DD4A 1KA8A 1LB2A 2HWVA 5HDKA 4HLYA 3T0YA 1Z6TA 1IN6A 2GXBA 1Z05A 2XVCA 2EFPA 1ZG3A 3RDIA 2QQAA 1HBXG 1R36A 4BAYA 3J80Z 4OMYA 4LJZF 2LKPA 4QLCU 2GAUA 2DK5A 1G6NA 5AONA 2CSOA 4EM2A 3BDDA 3KLOA 5D4SA 2ZNZA 1RZ4A 5D5VB 3G3ZA 1W7PB 5E20A 3I71A 1U8RA 1V4RA 4LB6B 1I5ZA 5CLSA 1USSA 5HDGA 2DO7A 3HYIA 1Y0UA 1CGPA 3NEUA 5HS9A 1OKRA 5D5UB 3IWZA 4Y13A 1G3SA 5CVIA 3WODF 2M5WA 5TJJA 1DPUA 1BN5A 4DNCA 1A04A 5LHGA 3I64A 4EJWA 5IT9K 5ICFA 2IPQX 5H6RA 1U5TB 2XAQA 3HOTA 1IZ1A 3CUQB 1IXCA 1O7LA 3TO7A 4I98B 1YFHA 2HDCA 3CUOA 3GX4X 1HXDA 1HW1A 2H09A 4P9UA 2XV4S 2ESHA 1FY7A 1UHWA 2M1BA 4M9SA 2QZ8A 1YO5C 2FMLA 4KDPA 4L5IA 3TDUC 4YFNF 1GHCA 2NS0A 3D5LA 4ENKA 4PGGA 2JPCA 3QP6A 2KIMA 1XDUA
chains in the Genus database with same CATH superfamily
3ISPA 3IUOA 5EZHA 4LK0F 4FTHA 2F5FA 2VC1A 5TGTA 5IPAA 1BJZA 1MKMA 4IRIA 1XX5A 2HEOA 1YQAA 3B6AA 2LF7A 4RGRA 4OIQF 1OLTA 4CYCA 3OYHA 2XIGA 5FRNA 2OQGA 5ICGA 4A3LJ 1IN7A 2NRAC 2KQRA 2NYXA 1USTA 4LLGF 5EZGA 4S05A 4KIBA 4NNJA 1D8JA 1UAAA 4XLAA 2DU9A 4OIPF 3RZOJ 2CU7A 1ETXA 4EEFG 1NH3A 2ZXIA 1EKEA 4C2TA 4PJMA 3KP3A 1PYVA 1OYIA 2JQ7A 4KIGA 4A3EJ 1JKOC 2R7DA 3O8HA 4ZYDA 1WPKA 5EYRA 5DUIA 2FSWA 4II2A 1YIOA 5F0HA 4KITB 2DDBA 2PJRA 1RR7A 3JCUC 3OYJA 3BQZA 5ED4A 5FKOA 3DTIA 3W6JB 1FMVA 2VBWA 2E1MB 3BTCA 5C44J 2PLYA 3CMMA 3J7AY 2QQBA 3PM1A 3HHGA 4WXHA 1BI3A 2XF7A 2LBFB 2A69F 2NVYJ 1B1BA 5F08A 3SQNA 5BOXA 1IRGA 4XLCA 2B7EA 3K4BA 2CWEA 4M3FA 5K7FA 3BJAA 1R9TJ 4XN0A 1XN7A 1Z91A 4NUBA 3UNGC 1PDNC 3DQVC 1JXSA 2MABA 2A3SA 1UFMA 1ON1A 3IRRA 3E7LA 1KU2A 1DP7P 2X0LA 5DV5A 2A5WA 3HTUA 3JAMZ 2LK2A 1W5TA 3CQZJ 2XC7A 5EJCA 4HNTA 1WJAA 1Z7LA 2EA2A 2P5LC 3MZYA 3ERMA 3DEEA 2JUCA 3DEWA 1VI0A 2ME6A 1ACIA 4XL9A 1SMYF 4W97A 3J7AO 5M3MJ 3I5UA 2EQRA 4A0XA 2IGMA 2Z1DA 3O6BB 2NVXJ 2BW3B 1WJFA 2X1DA 3A02A 4XLEA 2HQNA 4EJOA 3K1PA 2ZFUA 4ZYEA 3W2AA 5EEHA 5L3BA 4ZZDA 2QQ8A 2IGKA 1LDJA 1BW5A 1WFXA 3DLLF 3SEZA 3SDGA 4UB6C 4R1HA 1MDMB 4ZYAA 1GUUA 2BEOA 4FCYA 1K83J 1V54H 3HBLA 3KFWX 5FLXZ 4W1UA 1I6XA 2V9KA 3TOAA 2HTSA 3H92A 3LA3A 5J1RA 1EF4A 2R7FA 2EBIA 5JHFA 4IRGA 3SJMA 5FFZA 2FMYA 4BDYA 5B66C 1U2WA 1JHHA 1NHAA 5HS7A 3D5RC 3QYFA 1K6YA 1TNSA 3IH2A 4BE2A 1KYZA 3GLXA 4XLNF 5J1UA 1O7FA 2QVOA 2HYJA 2VKHA 1AKHA 1MBHA 4ZDPA 1VZ0A 2BXYA 4UUSB 5BS6A 5J1YA 3F3XA 1HW2A 5BNGA 3OYDA 2HOEA 1D1CA 1WJ5A 4B3XA 4ANJA 2E71A 5D6FA 5KVRA 2UUZA 4UV8A 2VKEA 4OAZA 5J47A 2GQQA 1IDZA 4PFOA 1IV6A 3CJNA 4HEA2 3SFIA 2VQCA 3PO3J 1VQKI 1RIOH 1Z67A 3QPLA 5CYVA 1K6OA 1ZRFA 1MMGA 2R93J 2R7VA 2IT0A 1ZREA 4IX7A 3M3YJ 2QGUA 2HKOA 3SHFA 5K5OA 4U0VA 4BQQA 2HQAA 3FX3A 2COMA 2LF8A 1AA7A 3BP8A 3ZQCA 4BBSJ 2FUG2 2AXTC 2FD5A 2W7NA 5IT9Z 4BJ6C 2NS7A 4D0PA 2STTA 3GFMA 2OUMA 3KZZA 1Z3YA 1R7JA 2WWYA 3BR2A 3C2GA 1JUPA 5JLXA 4MHGA 4D1QA 1Z1DA 1OYYA 2RNGA 4V2GA 2HVSA 3H3ZA 2RQQA 3C18A 3DPUA 2LDUA 3QPTA 1WWXA 1WHUA 2M87A 3BJ6A 3RQIA 1ETYA 2O03A 4RAFA 4J19A 2KDOA 3T5XA 5HLGA 1V5EA 3BY6A 2W82A 1GVJA 4UV9A 1JKQC 1K79A 5D6EA 3RI4A 2R7UA 2YPRA 1IN8A 4Y3OA 4P55A 4A3DJ 4D5FA 2CW0F 3ZQQA 3BG6A 3LQQA 1I6HJ 3V4GA 3WHCA 1M1EB 4IHWA 3ECOA 3G6EI 3LQRA 1XGMA 1FPQA 2YX7A 4ZC3A 3S1QJ 4U0YA 2W00A 3W2WA 3WGGA 1YW9A 3VDXA 2XASA 4LB5A 2ETHA 4CZCA 4HRIA 2KT0A 2G7HA 2DMTA 2Y0SA 2CQQA 3R0AA 3KYLA 3V42A 2VI6A 3ZOBA 3Q5FA 2M30A 1TWHJ 4LG0A 2LBFA 2PBIA 3HIFA 5GPAA 1QHGA 3ZN0A 2V1XA 1U0JA 2KISA 5JHUA 2FX0A 2ZBKA 4EJUA 4EM1A 2HPMA 3FXKA 3HB9A 3GF2A 4U88A 3ZMTA 5EG0A 2QLZA 5LD2C 4LOCA 5LGNA 5IY5H 3K69A 1X2NA 1F9NA 1EJ9A 2B63J 3K7AJ 4QWQA 2X1CA 2EV6A 2CFOA 4IOCF 1FYLA 4K2EA 2FOWA 4A3CJ 5GP9A 1IJWC 3RKQA 2CH0A 2HDWA 3SXYA 3LAPA 4DGWB 2LKXA 4ETSA 1TQIA 1UJ8A 3FXOA 4IHVA 3M9AA 3B02A 2F4OB 1RI7A 1XSXA 4R8HA 1SFOJ 1G3TA 1WCMJ 2QKMB 3DPTA 1LE8A 4ZTFA 5DS9A 3MEXA 4NQWB 2BXZA 2L7ZA 3F0CA 2H27A 3HTSB 3E0JB 4WX9A 1D5YA 3ZMDA 2C6YA 2F4MB 3ZCOA 1Z6RA 1TL8A 1E17A 3JREA 1A6IA 3M4OJ 2VQHA 4AVZA 4MQVA 1BOAA 4GCVA 2CV2A 2LRDA 5EGOA 2F5DA 1XGSA 1QGPA 1FBUA 2Z5UA 1D0YA 3CO6C 4E7ZA 3G71I 5HNHA 2ZJPF 3IV5A 5BMZA 1H88C 1HSJA 1JKPC 1OCTC 2ZMEB 4MIMA 1QU3A 1WH7A 2Y48A 2O5RA 3Q9SA 3BPXA 2IGOA 2ID3A 4KUMA 3L9FA 1JJ8C 3GZNB 2K40A 1J7KA 3H5RA 1MMAA 1EH7A 2GXGA 2L9RA 1K78B 3V7SA 2DXIA 2JA7J 3OY9A 1RRJA 3HEFA 2QQ9A 1JUSA 4CO8A 2DA7A 4HQMA 1SAUA 4RAYA 4QTRA 3M7GA 3E3VA 4EMSA 2OPTA 2LY1A 1SD5A 2X51A 4G6TB 4BXXJ 4GRIA 3F8NA 3KP5A 1RR8C 3QP5A 3GTKJ 1X1CA 3OWTA 2OJED 2W4SA 2DK8A 5JVTA 3DKXA 2VLAA 4ZJZA 5K1YA 2LD5A 2E2JJ 5E79C 2IS1A 3SYTA 2VBXA 4GFBA 4KA4A 3BTLA 2DA6A 5LRRA 4G9YA 4FX4A 2DQLA 1EV7A 4ENNA 2HOTA 4C2UA 1K61A 2P7CB 3L2VA 1FP2A 4HOBA 1HA8A 4RAZA 3FMQA 3DF8A 3LA2A 5JI6A 5E3LA 1JTXA 1FJLA 3PIPF 3GTPJ 3I4MJ 3KE2A 1FSHA 1HDPA 3VSLA 1WVRA 1DP3A 5F0CA 4BU2A 2R4GA 4PCQA 1ZAOA 2L5QA 3IH3A 1VQOI 2LY2A 1LFPA 1VQ8I 4ENMA 2L3DA 3HRTA 4IXAA 1YW8A 1WQ2A 2DFIA 2VJ5A 3LNQA 1TT0A 1S9HA 2EV5A 4HQEA 1TTYA 4DYRA 2FQ3A 2AHQA 3I4NJ 4O6JA 3OYMA 4A12A 2M34A 3N4MA 1O3RA 2ZCWA 3KEOA 3K9TA 1XCBA 3TL4X 1ZGWA 2OF7A 2P6SA 4BQAA 2DAOA 1FIPA 1F36A 4ITVA 3E6BA 2R92J 2WAQA 5HLTA 5IOZA 3V8LA 3AG1H 1DGRM 3JAMK 3AAFA 2CGPA 3GW2A 1P7JA 3FKJA 1KU7A 2Z9OA 2IS2A 3VYUB 1UG2A 2PMHA 3F8CA 1FOXA 1JT6A 2MA3A 4PK4A 2W85A 3CZ6A 2ESNA 1DGWY 2GIVA 2EZIA 4CCOA 3CC7I 3FHZA 2DPUA 1UG0A 1B4AA 5CQEA 5GAEJ 3JTGA 3OYNA 4HV6A 3OR2C 1X1DA 5D8LB 1AOYA 2DTRA 1W0TA 2DYSH 4AIKA 3P5JA 1ORKA 4BJTA 3I9V2 4MEXF 3H9GA 1SFEA 3DKYA 4AM3A 4BEHB 2DQRA 1LDDA 2HQRA 4M9ZA 3WTVC 1W1WE 2HKXA 2X9DA 2PEXA 2V7FA 2IS6A 2JRTA 1RUNA 2VPRA 5FLVA 3GYHX 2P7VB 2V1DA 2L7FP 1B8IA 5FLXK 3GZ6A 2H8RA 4HNVA 3WHBA 4QSHA 2VBYA 3FIWA 4I01A 1QVTA 2NNNA 2ECCA 2V6CA 4B44A 1OJLA 2DW4A 2GOMA 3CJTB 3NRVA 3I56I 5GPCA 1T8IA 1KONA 2DMNA 2XROA 4AIDA 1ERDA 1X3WB 4RGXA 4CCNA 3HSEA 2HQ5A 3F6OA 1R1VA 4I7HA 3ZQHA 3EYIA 2EB7A 3E6CC 1MZBA 1XCVA 4MFEA 4KFCA 4UNOA 3IP4B 2I10A 2MH2A 1BIAA 3NAUA 1VQ5I 4L0ZB 4A6EA 4BQNA 3OOPA 3HKZA 3F72A 2R5YB 2M45A 2E1CA 4II3A 4UB8C 2G7UA 3F8FA 2ZO4A 2VB6A 3IKTA 3CLOA 3CP2A 1KQ0A 4RS8A 3IHUA 3JW4A 5GAGJ 2LC2A 2ID6A 2GXAA 2JT1A 2E60A 3ESWB 3BZCA 3DU5A 3ZGKA 3S2HJ 4XLPF 4BH9A 3M1CA 1P9QC 3PFYA 4P1WA 4ESFA 4ZH4F 2GIZA 4YFKF 2RQPA 2LKSA 1TW3A 1IN4A 5B3SH 3U1KA 3DXJF 3K2AA 4HF2A 3AG2H 1G59A 4Q5SF 4XNFA 1ZGAA 4M9XA 4XONA 5FO5A 3ZMUA 1POGA 3ABKH 4X6AJ 4DJAA 2PFBA 4MFDA 2KLOA 1RKWA 1FYMA 2H1KA 2K9SA 2R0QC 4BGDA 3G1LA 1LVAA 5CVVA 4EQQA 1T39A 1OCZH 1I3AA 1R5HA 2L4MA 5TISC 2WB1A 2A68F 3GFIA 2YX4A 3CCRI 2JJ7A 4G7HF 2HXOA 3WE2A 2A61A 1N75A 2MLKA 4NDLA 1FOKA 1IXSB 4PJLA 3GTQJ 1GLNA 4M73A 3P9CA 2XSJC 4YIRX 3I59B 4A3GJ 3IAM2 3D1NI 4FX0A 3HL2A 5L3EA 4EJTA 1R22A 4EV0A 2YSRA 1X3UA 2IP2A 5BPDA 1ETKA 3E5UA 3P9IA 2IBDA 2HPIA 2HOSA 2K3FA 2XPWA 4KMFA 3HSFA 3OMYA 2CW7A 3H3UA 1CF7B 4L0YB 2ZJ2A 3WTYC 1APLC 2HNHA 3CF5F 4Q47A 3FXRA 5DM6F 4YEJA 3IKVA 1O3SA 3BG3A 5IP6A 1TLHB 2L01A 1IDYA 4C30A 4BJ5C 3X2QH 4V2FA 2CFXA 5K7ZA 2KRHA 1XSVA 3OR1C 1BBYA 1T38A 4XKVA 4Y17A 3OV8A 3K1NA 4IVNA 2CQXA 2PQ8A 1T2KA 3LA7A 4CHUA 5CPRB 3Q0UA 2V9PA 2A5YB 2BY2A 4TV7A 3O8GA 4XBFA 2A6HF 3KP7A 4MEYF 2FU4A 3OYCA 4ON0A 3FXJA 1BW6A 2RKHA 4EATA 1BI2A 1E2XA 1FLIA 3KZIC 1MGTA 1YJNI 1KZHA 1HW5A 3H9QA 4BHPA 1U8BA 4JQFA 1MBKA 2EZLA 2MG4A 3RPQA 1G4DA 1SEUA 1FX7A 3ROUA 5HNFA 5ILSA 2CQ7A 5E8IA 2HDDA 1F4KA 1D3YA 1X4OA 2TRTA 2O0YA 1TWAJ 1VFCA 1LQ1A 3HG9A 3S14J 2LR8A 3VYRB 3BZKA 4XR6A 2QA4I 2KIQA 4L9VA 2WY7Q 1S8NA 2CQKA 4HNUA 1IGNA 1S3JA 3OIQA 1LFUP 2CMPA 1GT0C 1H0MA 1I50J 1MBFA 2FEZA 2XGXA 3QYBA 2UWMA 4LD5A 2Q0OA 4MNUA 3BOQA 4UHTA 4BY1J 2VOOA 5KCMA 1RC9A 5GTIC 2EFWA 2UXNA 2VC0A 4IPAA 2EJRA 3BG7A 3K2ZA 3LSKA 4IHYA 1AU7A 5IYBJ 1W7PA 2OBPA 1R5ID 3GVAA 4JX6A 2EV0A 1SAXA 4D7MA 4M74A 2HVRA 3AG4H 4A93J 1HKSA 2X4HA 3EUKL 3MMYB 1SFXA 3H1CA 1S7EA 1FWZA 4A3KJ 1VQNI 4HDVA 3JSOA 1LNWA 2K9MA 4I09A 2DOFA 2R5YA 4MLOA 2EZKA 3FXMA 2JSCA 3FDYA 4E7IA 2DFFA 4FE7A 4XRFA 4YIFA 3F23A 5H20A 2XF6A 1BR4A 1RKTA 3OOUA 4OMZA 1ZTRA 4A5MA 3CJQB 4BACA 2HZTA 5F6FA 3CMAI 3K4JA 3C7JA 3WTWC 2O61A 4X1EA 3GWZA 5DCMB 1UMQA 2VKDA 2TCTA 4AD9A 1TBXA 1ZN2A 1DUXC 3I58A 4RA2A 4JBAA 5HOOA 4HX7A 2JUGA 3I0TA 1B59A 1E3OC 2NVTJ 4LG3A 1QZZA 1T08B 3L1PA 2RDPA 3RIRA 1YG2A 4IO9F 2KL4A 5F0FA 3DBRB 3SZPA 2QKLB 4RLFA 3CCVI 4XSXF 3PJRA 2Y0MA 1U5TA 4D5CA 1FIAA 1OISA 1AWCA 3GLLA 3B6CA 3CUQA 3VWBA 3FM5A 4CYDA 1OCPA 3DBLB 3WTZA 1QZYA 2NAZA 1PP8F 1FBQA 3HOVJ 2XPVA 4AC0A 2EIJH 2CV0A 2LNBA 1WJBA 5B1BH 5J4YA 1PJRA 1WSUA 2H1LA 3ZRGA 2L7KA 4A2UA 3LMMA 3QWLA 2QCOA 2VT3A 2YUSA 2ZXWH 3Q0WA 1JHFA 3BC8A 4F92B 5LHIA 1ZG5A 2FBIA 1GV5A 4KT5C 3E5XA 3EUHA 1L0OC 1WRJA 2IXSA 5FKMA 4KNYA 3I59A 1T33A 3R6SA 1P2FA 2MC3A 2P4WA 2BY0A 4MO7A 3QRFF 3TQNA 4G6DA 1NG7A 1AHDP 2HU9A 4E70A 2JVGA 1ZR2A 4PJNA 3EDPA 4RM2A 1FYKA 4OAYA 3QPHA 2O8KA 3Q9VA 2V4JC 2PG4A 3ZXSA 5FFXA 5BQTA 5J4VA 2X6XA 2D2WA 1R1UA 1DU6A 2V1UA 4HW0A 1DPRA 2CV1A 3S32A 2OA4A 5KK1A 4RB2C 4CGZA 4U7DA 2WA0A 3OS0A 1OR7A 3HOXJ 3H35A 1ENHA 3KP2A 1F1ZA 5DYMA 3ELKA 4P9FA 3LAJA 4BXUA 3LFUA 1ETVA 4IL6C 1FP1D 3A4CA 4XMYA 1T56A 2ZNYA 3PUBA 3T1BA 3F21A 3A01A 3EQLF 2ZC2A 3RJPA 2XPUA 4F7ZA 2E1NA 4HPQA 5LHHA 1Y1WJ 3ASNH 3PQJA 4UVCA 2HVQA 5FROA 5LEJA 2LG4A 1FBSA 2L2OA 4KT6A 1P4AA 5HVQC 4JK1X 3D0SA 3K4LA 3M8JA 5KAIC 2CUEA 2CS3A 4WF2A 1XC5A 1W0UA 1I1SA 1ETWA 2IVMA 1VTNC 4WWCA 1T98A 1HQCA 3WTXC 5FJ8J 2E5NA 1VQ6I 1PUFB 3TBIA 4B43A 5D5WB 1J2XA 1FT9A 4UVAA 4PJ0C 2BV6A 1WJEA 1VF9A 4BYYA 3AL0C 2DI3A 4H0EA 2J5OA 2VN2A 1YIJI 3BT9A 2K9NA 1GXPA 3V8KA 4A6DA 4F55A 4O3MA 1QRYA 3WG9A 5M5XJ 4MTEA 4DYCA 3ABUA 1R4MB 1T0FA 3VEPA 1TW2A 4YIIA 5IOYA 1BJAA 2R7WA 2ZKZA 4M71A 2CG4A 1XG1A 5L3DA 3LL7A 1KQ8A 2COBA 3VFZA 4ZYGA 1MJAA 2VPLA 1P4WA 1P92A 1XMKA 2DCEA 1SMTA 2XB5A 2EFNA 1XGOA 2A6TA 3BLYA 3RYRA 4R79A 2XKOA 1RUOA 1ULYA 2RVCA 2I5UA 4S0HB 1I1GA 3CP8A 2ZSHB 3S2WA 3M07A 2HFHA 1ZARA 3OYFA 4ZDOA 3WE3A 1KGSA 2H6BA 2JN6A 2QBYB 2GM4A 1SD4A 2BOLA 3ZMVA 3ZR8X 1JI8A 5LEKA 3RKWA 4DQ2A 4XRSA 3JRCA 3BR6A 4N0BA 1MD0A 2M0CA 4ZZLA 3WTSC 3G73A 3N05A 2F2EA 2A6EF 2PMUA 3BZ6A 5CVRA 1OCCH 2DYRH 1EA3A 3HPGA 4I0BA 5CQGA 2LTPA 4XIDA 1OQYA 2MFZA 4AU7A 3SEQA 4CICA 2OU2A 4FETA 3HUGB 2D5VA 2EZHA 4EM0B 3TW6A 2BE5F 2BW3A 2DOAA 2G9WA 1MBGA 2O3FA 4KN7X 2E1MC 2XF5A 1W5SA 3C2HA 1IAWA 1LKXA 2BZTA 5FD5A 4ESJA 1IW7F 1QNTA 4F52A 3WU1B 5DEQA 3WGIA 1QPMA 4I0AA 4HLXA 1JKRC 4LLLA 2NVQJ 2WY8Q 2I8DA 3E6MA 1ZLJA 4Q4ZF 4XICA 1MDMA 5B5EC 2HS5A 2OTJI 1JGSA 3PSFA 1ONVA 2DFHA 3VOEA 5D8KB 3F22A 1H8AC 4G12A 3BG5A 3KEQA 5JVGF 2CUFA 5JLWA 2OCEA 5C4XJ 3ABTA 1OCOH 2FF4A 3KP4A 2OCCH 3C3WA 3HHHA 4BY7J 1ZG1A 3FISA 4PJJA 1ZHFA 4KN4X 3G2BA 1B6AA 4QIWN 3GFJA 3G4SI 3FMSA 4EGYA 3K1MA 3CJRB 2XGCA 4IOAF 1OYWA 2VE8A 2ELHA 4UUSA 1S7OA 3BCBA 4CZZA 2LSOA 5KHDA 3BTJA 3FBNB 2DJNA 1MSFC 1D1AA 1LFBA 2ACJA 4Z2YA 1OFCX 1Q1VA 1G3WA 3H0DA 1BL0A 3L2WA 1ITYA 4C3JJ 4KIFA 1QA6A 2UV1A 5E1WA 5LFAA 3KYCB 3PO2J 1TT5B 3NWSA 2XHKA 2EK5A 3JRDA 3TOBA 4C2MJ 1P4XA 2LH9A 3A1YA 3SZGA 3UR3C 1SFUA 2YR2A 3VSKA 1DDNA 2EA4A 3FBIB 1Z0XA 2GBYA 2WAEA 4DBQA 1W4MA 2JA2A 1VQ7I 2KZVA 3K4NA 2IA1A 2FRHA 5FKKA 3CDLA 4S04A 2D1VA 4M3BA 3HOSA 5H2FC 3QAHA 2LYCA 3NARA 1NK2P 2L9VA 5FGMA 1ZR4A 3FHNA 4AWXB 2MYSA 2STWA 3PUFA 4EVIA 2ZFWA 1HLVA 2P6TA 2AXLA 3FWEA 4IEJA 3ZN1A 2QM3A 1J09A 2NS8A 3JR9A 2XAGA 1MJBA 1YRNB 3H5NA 2BVLA 1FNNA 4A3IJ 3RTRA 4L9JA 4HX8A 3RKYA 1STZA 2DFEA 1BA5A 5IT3A 1C0WA 1MNDA 4XLHA 1B9MA 3ZMSA 2M9HA 1XMAA 2RAEA 2VJ4A 4CUGA 3NQOA 2P5KA 2ICWG 2AQFA 4D9JA 4HYEA 5LLQA 4XQFA 3TGNA 2MBFA 2HYFA 3E6DA 2L02A 3LOCA 4PSWA 1SC7A 4GYGA 5M5WJ 1K4TA 4PSXA 1MNMC 1IRXA 1MMSA 2Y0SN 3BR5A 2M8EA 1TNTA 3AFHA 3OS2A 5C3EJ 2UZKA 1U78A 3HOUJ 2R3SA 1YTYA 4A3FJ 5FD6A 3AKZA 5CVUA 1X4PA 3CC4I 2BYVE 5GADJ 1WH5A 2FE3A 2NNYA 1MBJA 4L5JA 3OL4A 2P0WA 3DPLC 2EWNA 1J0RA 5DCFA 4CYCB 3M8EA 2M8GX 3JRIA 1X1AA 3J7ZI 3GTJJ 1FZPB 1ZRCA 3LSGA 5DTDA 1B9NA 5HLHA 5E17F 3OIOA 2MW8A 3P9KA 3FK7A 1XB4A 3F9KA 1Z7UA 3ZP5A 3CD6I 1QO0D 3C2BA 5AIQA 2ELJA 4KMUX 3DEUA 3MFKA 1E0EA 1S6LA 4AYBA 1LVKA 4E7KA 2W25A 4CXFA 1XD7A 4RLQA 5J3LA 3BTIA 3U9GA 2DBBA 5GTHC 3IRQA 4A3MJ 4YG2F 1BC7C 3HM5A 1VQ9I 3W2VA 1KYWA 2BY1A 5LGUA 1R1TA 2FJ1A 4M3EA 3MKZA 4AIJA 4XRSG 1BR2A 1HKTA 1IG7A 1WZ2A 2VBZA 4JOMA 3A03A 3VYTB 4CSWA 4P5OA 2PJRB 2FA5A 2BGCA 5L3FA 2EIKH 3D5SC 3HGGA 4I02A 5KNLA 5AIPA 4NQWA 3TO6A 3HUGA 3CDIA 4LFUA 2CYYA 5HDNA 1S29A 4N4OB 2Q2EB 4HAMA 3T8TA 2Y9ZA 2KDZA 4NC8A 1D8KA 2F4IA 2FBHA 1LUJB 1RPWA 1X1BA 4KJZA 3CTAA 3HRMA 2GOXB 4J00A 2GA2A 1G8XA 4LMYA 2LOOA 3KZYA 4HF1A 3K4MA 2K7LA 2XRNA 3O2PE 2BVMA 5BPIA 3RQ4A 4JX5A 3HOYJ 5EEGA 1IRFA 2VJJA 2HYGD 2CQNA 3RPUA 2ZMEA 2XAFA 3GTGJ 3HJEA 1V5FA 3OYBA 3QPSA 5E1ZB 2JZYA 2NXNB 2F5EA 1U9NA 1YE9A 2MH9A 2X85A 2XGDA 3OYAA 2QSHX 3TP0A 1I39A 2KHMA 2X6OA 2MSYA 1LPQA 4HV5A 1K7AA 3KYDB 2JWTA 1K78A 3ULQB 2EINH 2KJBA 3WTUC 3F6VA 3QODA 3F8MA 1UCRA 4WXDA 4F3QA 1X2MA 2R7XA 1ZLKA 4CA0A 1FC3A 4FASD 2M7AA 2ZJRF 4RGSA 1QBJA 4UXNA 3GXOA 4L9NA 2Z2SB 1ZELA 2GWRA 3H9JA 3MZHA 1D5VA 2E7WA 2X1EA 1YX3A 2K85A 3WG7H 3LFKA 4HZFA 3R60A 4CCJA 1ZKGA 4MGRA 4HBLA 3PL8A 2H94A 3PFIA 3VODA 1TC3C 3MWMA 3GTLJ 4G6QA 4A0ZA 3MQ0A 2ZMEC 5KAFC 1HSTA 2OAZA 2E2IJ 2P5VA 3BROA 4A69C 4O5VA 1KU9A 2VOPA 4M3GA 2RV8A 2M2EA 1FMWA 3MN2A 2W84A 2X48A 2IA0A 1X1PA 3KCCA 5J8FA 2XDVA 2R7ZJ 3K0LA 2JA6J 2A07F 3MZ8A 4L9TA 5D4RA 4U87A 4H4KC 1AKHB 1LDKB 4BKXA 2RGVA 1NG6A 1PUEE 4F93B 4BS9A 3TO9A 3ASOH 1W7PD 3QU3A 4I99C 4DOZA 3S1NJ 2DOEA 1REPC 4OIRF 5E18F 2VIXA 3OYGA 1FOWA 3OIPA 1VQMI 3OL3A 5EEAA 2DT6A 3IWFA 3RYPA 2VJIA 2WAQN 2XAUA 4FE4A 1HC8A 1SVOA 2V26A 1YW7A 3IL2A 3R0JA 1R6RA 4BE0A 2L0KA 2F5VA 3QU6A 3W6KB 1F5TA 1TQMA 3HOZJ 1SVLA 1YOVB 3L7WA 4CH7A 2VONA 1TWFJ 4N9IA 2LFBA 4DW6A 4D7NA 3F8BA 3R61A 2YS9A 4OINF 1JTYA 2PI0A 1WGXA 3FXLA 3OYEA 2D1HA 4U0WA 2DA5A 2J5PA 4QPQA 2DA1A 3LSIA 4A3BJ 3RKXA 3S2DJ 2M7BA 4GDFA 1W36D 4AVPA 3W3CA 1YX5A 3DTEA 4HG2A 2E5ZA 1V55H 4M6YA 4IHTA 1YYVA 1LEBA 4RB0A 1A5JA 3WU0A 2KMUA 5D5XB 1GDTA 3ABLH 1ETQA 3EYYA 4ABZA 2DDAA 1TWGJ 2F48A 2O8XA 4BEHA 3JRAA 1Y8QB 3JRHA 4NHJA 1V5GA 3DCFA 1A6QA 2X6WA 3GO5A 3P7NA 4ENJA 3BPVA 2JTVA 2FNPA 1Z3XA 2G0EA 2OD5A 5L3GA 4AYBN 4RBOA 1Z9CA 1Y1VJ 1SANA 1V3FA 3R4KA 1L3LA 1YS7A 2IAIA 3N97A 3E97A 2JVHA 4OU0A 5CVJA 2B0LA 3GTMJ 5E3OA 4I2OA 2KKOA 4XKBA 4E7JA 1F43A 2IEKA 2UXXA 5IP7J 1DU0A 1IRZA 3J81K 1U6GA 3BR1A 2HGCA 9ANTA 1B72B 3JRGA 2DMUA 2DT5A 4AIHA 4WXCA 3K4CA 1U3EM 4M72A 1QVUA 2IW5A 2OZ6A 2ZXJA 2OC6A 2E7XA 2MGQA 4XK4A 5EDNA 1W5CC 4UY8I 2Q2EA 3RZDJ 1ZK8A 3BR0A 2RN7A 4FISA 2CW8A 4LG0B 2Z99A 2M3AA 2MC4A 2QUFA 2M4KA 3U1DA 3HKZN 4XOTA 1J75A 2DODA 5K5RA 4IZZA 4B09A 2H6CA 3M8FA 1UHSA 4LK1F 5ICCA 2VASA 5A2QK 3IC7A 3ZQGA 4PGHA 3A0HC 5DDGA 4RDUA 1OMIA 5EG0B 3W6VA 3I53A 4G7OF 1Y0NA 4IRHA 2Z3YA 3S16J 2VKVA 2GZWA 2LVSA 1ZH5A 2JMWA 3G1MA 4RM3A 2DN0A 2Y30A 1BI1A 2V9VA 3MCZA 4LLNA 4IJAA 4V19K 1UB9A 2ADUA 2CRGA 2K4BA 2O7OA 2ME0A 4ESBA 4B4CA 2KRCA 1NK3P 4FHTA 4PDKA 3FXQA 2WBMA 3K4KA 2IRFG 3ZQIA 1SD6A 2CUZA 3B73A 4EJVA 1RNLA 1BM9A 3BCAA 3ZQLA 3WTTC 3GUDA 5CJ9A 4ZYHA 4QPOA 5E8GA 1LE8B 2KIFA 2EFOA 2DA4A 3DLAA 3CCYA 3GCMA 1T6SA 5ICEA 2B9SA 1XDSA 4BNCA 2ELKA 3L00A 3L2UA 2PMZA 5JR3A 3TKYA 1QPIA 3U2RA 4HF0A 3CO7C 3S3OA 3CCSI 1HOMA 2QYOA 2E34A 2HR3A 3TDZC 1U9OA 1OCRH 1BC8C 2FXAA 2WB1N 4B3AA 2R7RA 3V7CA 2XAJA 3C1DA 5EGOB 3LSRA 2DMQA 3VB2A 3MKWB 1IXRC 2AS5F 4I6ZA 1KQ9A 4C3HJ 4JP0A 1G3YA 2DTZA 2BY3A 1O3TA 1XMXA 3M1EA 2W24A 3DU6A 1ZRDA 1LEAA 3LSJA 4DZPA 3MAJA 4B8XA 3H5AA 1TWCJ 2VUMJ 2EFQA 3KX2A 5E1XA 4L18B 1W36C 4A5NA 2GLOA 4U7BA 3CCUI 2KRFA 4OIOF 3H36A 4HSTA 4ZTJA 1O3QA 3O3KA 2QENA 2QF7A 4GXOA 5E3NA 1CF7A 4G7ZF 2PJPA 5K5QA 2H8WA 3HRSA 1WI3A 1U5TC 2XSDC 3ONQA 5H6QA 4G94A 3CUQC 1MMNA 4ZDLA 2E36A 4XSZF 3EETA 2YU3A 5LGTA 1BI0A 3JRFA 2P81A 2OQRA 2KFDA 2NOGA 1QQIA 2M4GA 2WTEA 2Y75A 4IHSA 4NBQA 2K3PA 3I54A 1R5GA 1XTAA 3CCLI 5L3CA 5FB2A 1YI2I 2AQEA 2CUJA 4E6KG 3OYKA 4G8XA 4L5EA 3BWGA 1QHHD 3NWTA 6PAXA 3EUHC 2IA2A 2IJLA 2VT2A 1TP4A 2MD5A 2KPMA 4LGWA 1J9IA 4F91B 2QEXI 2EH3A 4XOPA 3BG9A 5HS8A 1BOBA 3DFGA 2P8TA 2VQLA 3J80K 5J8CA 1R58A 1YS6A 2ECBA 1ZQ3P 2L7MP 5JFRA 2K27A 2JA8J 3V8JA 3CLQA 1VQ4I 1EH8A 2E35A 2N8GA 1JT0A 1CQTA 4NC6A 1Z21A 1WKMA 5DUKA 5B1AH 4CCMA 2XRLA 2EILH 1OR7C 4GYIA 2ISZA 1N25A 4E4HA 3KEYA 5K7HA 1MH4A 5LRSA 5F1JA 2QSGX 2ISYA 3MVPA 3L2CA 4XRMA 3S3MA 3ERED 1HF0A 4OOIA 1RESA 3L2RA 1XSDA 1IUFA 1BIBA 2FOKA 1MW7A 1SD7A 3S8PA 4EGZA 4C9YA 4Q48A 1Q1HA 1MSEC 3G1OA 4Y52J 2Z16A 2ZSIB 3S1MJ 2Y31A 5ILUA 1E3HA 1UZCA 2TDXA 1J5YA 1GXQA 2XGEA 2FBKA 3K6GA 2OTLI 1B72A 2K4JA 4M6VA 1H9TA 1T95A 3FMRA 2WV0A 4IQ4A 1S5LC 2DA3A 2R7QA 2O9LA 1ZGJA 3KETA 3VPRA 3LSHA 1OPCA 3IAS2 3MKYB 2MD0A 2WV1A 5GAHJ 2VXZA 1QZEA 3DV8A 5IP9J 2XAHA 4IF4A 3OSFA 3HC7A 3JSPA 2HOAA 4JX4A 5ERIA 2WAFA 1UHMA 2K86A 3KPHA 4GGGA 1JUMA 2A05A 3OYIA 2VODA 3QOPA 5HLIA 2DPDA 1I27A 3ECHA 4NB5A 1J59A 2BHZA 2VE9A 2KIUA 3FK6A 3COAC 1R49A 5CKTA 3K10A 3GFLA 4UVBA 1B8IB 1JE8A 1T0FC 3HZJA 5FRMA 3VYSB 3AG3H 5DCMA 2MLGA 4MTDA 5FKNA 3WU2C 1TQPA 2WC2A 2Y69H 1ETOA 2W57A 2E1OA 2DJIA 3GZ5A 1DQUA 3REOA 4RB1A 4BHBA 2W48A 2NVUB 3PNVA 3T8RA 4DZJA 3TW7A 1S7AA 4Y7NJ 1IN5A 1H89C 3L09A 5M5YJ 4PZJA 1FEXA 4FT8A 1R4NB 3LWFA 2CO5A 5J40A 2PX9A 3PNYA 3OSGA 4XKCA 3DBHB 2PMZN 5DD8A 1Y6IA 4MQ9F 3RSNA 1R00A 3LSPA 4HDUA 4RB3C 1JGGA 3HOWJ 2K9LA 2OZUA 4HX4A 2KP6A 3L2QA 2HI3A 1WI9A 1PP7U 3EUAA 4KYWA 5TRDA 2BHYA 3V7RA 3GTOJ 1Y8RB 3J81Z 4BE1A 3KLNA 4BHCA 3LSTA 2K5CA 3CESA 1XGNA 1LJ9A 2HZDA 4I76A 2ZXHA 1MNEA 4M6XA 4YFXF 3TEDA 1ON2A 3HXLA 1H9GA 4WCGA 3CMYA 5EF6A 3PQKA 2HXIA 1N77A 3HRUA 3JRBA 3K70D 3I3LA 3KP6A 1MJ9A 5F27A 2LY9A 3S15J 5J6XA 2VQGA 3ML6A 2Q8KA 5A2QZ 2ZJQF 2L9SA 2XKPA 3BQYA 4Y33A 5IYCJ 5IYDJ 4IKFA 3JTHA 4GO1A 2LP0A 3CMEI 4RGUA 2Z33A 2K02A 2F5CA 2X6YA 3QYEA 3UKGA 3H3VK 2DA2A 2O6GE 1X3ZB 2AO9A 3LSMA 3A2KA 3PNTA 4ASNA 1XS9A 1A36A 3H0GJ 4A0YA 1KU3A 1RETA 4YRVA 4J01A 3S17J 1R23A 3DKWA 4DBRA 3CDHA 1YJWI 1FSEA 2BBYA 4DIQA 1ZYRF 4A3JJ 5HODA 4B48A 2FQ4A 3QOEA 3HPHA 4P96A 3TP3A 1EH6A 2XUBA 4DYQA 3ZQ7A 2JPBA 5ILVA 1K4SA 2JSPA 4X0GA 1IF1A 1HKQA 1Y39A 3DTKA 5FKLA 2ZB9A 2L9NA 2R5ZB 3FM3A 4KICA 2JA5J 3GMEA 2QWWA 1BR1A 3ZMZA 3GEZA 1JJ6C 2RC4A 1PUFA 3ABMH 3WGHA 3I4PA 3SZTA 3E5QA 1MMDA 2VL8A 4HA8A 1YLFA 1P6RA 1D0XA 2V79A 5F64A 5LBQA 2PN6A 2D45A 2K9QA 4BDZA 1YHQI 3FKIJ 3HSRA 3RCOA 3I55I 3FXUA 1VNDA 2DLLA 3MKLA 4IHXA 4Y15A 4M3DA 3Q3SA 3FZVA 4E7HA 4C3IJ 2GA1A 3RPUD 1P7IA 3BJOA 4N4NB 1Z77A 2VXDA 1IO2A 2HTJA 2QSFX 1FTTA 4RAGA 1O57A 1UELB 2FNAA 3S1RJ 3PIOF 1WJCA 3HGYA 1SFKA 1IV8A 3ZPLA 4LITA 4UUVA 1IUYA 3FF5A 4WK8F 4N9HA 2RNJA 3EPZA 4BUPA 4BBRJ 2L4AA 5F1RA 2L54A 1A31A 3DP7A 1ODDA 1N78A 4KISA 4CDGA 2IGNA 2KJCA 2QBYA 2JK3A 4LIUA 3SFZA 4BL0B 1VQLI 1FOYA 5DD4A 1KA8A 2M0MA 2W1OA 1D1BA 1HCRA 2R7SA 1LB2A 2HWVA 5HDKA 2LMDA 4HLYA 4UUTA 1Z6TA 3T0YA 1IN6A 1GV2A 1E3PA 2GXBA 1Z05A 1X58A 2XVCA 3SDBA 3A0BC 2EFPA 1ZG3A 4HSRA 3RDIA 3K70C 2QQAA 1HBXG 3CF2A 1HDDC 1R36A 4BAYA 2Q1ZB 3J80Z 4OMYA 4LJZF 2XB0X 1VQPI 1MH3A 2LKPA 3CCQI 1YJ9I 4QLCU 2GAUA 2DK5A 4LIVA 1G6NA 5AONA 2CSOA 4EM2A 1O4XA 1IC8A 3BDDA 3HDDA 3KLOA 5D4SA 2JRMA 2ZNZA 1XPXA 1RZ4A 5D5VB 3G3ZA 1W7PB 5E20A 3CCMI 3I71A 3CCJI 1D0ZA 4NC7A 1U8RA 3CC2I 1V4RA 4LB6B 1I5ZA 5CLSA 4RMNA 1USSA 5HDGA 2DO7A 2EPFA 3BR3A 3HYIA 1Y0UA 3OYLA 1CGPA 3NEUA 1MBEA 5HS9A 1OKRA 1TZLA 5D5UB 2IS4A 4XN3A 4CCLA 4AUXA 3IWZA 4Y13A 1G3SA 5CVIA 3WODF 2M5WA 4JYKA 5TJJA 2OV7A 4FQGA 4BXFA 1DPUA 2EIMH 2R7TA 1I3QJ 5DM7F 1BN5A 4DNCA 3S3NA 1A04A 5C4JJ 5LHGA 3U21A 3I64A 4EJWA 2Y9YA 5IT9K 5ICFA 2IPQX 2LREA 4B1RA 5H6RA 3J7YJ 1U5TB 2R7OA 3TMOA 2XAQA 4IQJA 3HOTA 2DMPA 3S93A 1IZ1A 3CUQB 1IXCA 2KZGA 4Z6YA 3E1SA 3CCEI 1O7LA 1SVMA 3TO7A 4CCKA 3PSIA 4I98B 1YFHA 2HDCA 2WADA 1A35A 3ZQFA 3CUOA 3Q0VA 2V1NA 4E7LA 4PFPA 4BQOA 3GX4X 1NTCA 1HXDA 1HW1A 2H09A 2RREA 4P9UA 2XV4S 3IH4A 2ESHA 4YELA 1S72I 1Y56A 2NOJB 3OS1A 4Y4RA 4E7SA 1YRNA 1FTZA 2LLKA 1FY7A 4B47A 1UHWA 4XLFA 3QQAA 4PUSA 2R5ZA 3KIOA 1GVDA 2M1BA 4M9SA 5FLMJ 1WJDA 2QZ8A 2F6CA 1YO5C 2DT7B 2FMLA 1G2HA 1R71A 4KDPA 4XORA 4L5IA 3TDUC 3AL0B 2V6EA 1PVEA 4XM3A 4XKWA 4YFNF 1GHCA 4OWRB 2NS0A 5E3MA 3D5LA 2YU9J 2Y2ZA 1MIJA 5F04A 4ENKA 3DWLE 4PGGA 5M3FJ 1X19A 2JPCA 3GBGA 3QP6A 2E2HJ 3A01B 2KIMA 2E19A 2CJJA 3MD2A 1YITI 1XDUA
chains in the Genus database with same CATH topology
3ISPA 4LK0F 2F5FA 2VC1A 1MKMA 4IRIA 2HEOA 1YQAA 2LF7A 4RGRA 4OIQF 2XIGA 2OQGA 5ICGA 1IN7A 2NRAC 2NYXA 1USTA 4LLGF 4S05A 4KIBA 1D8JA 2DU9A 4OIPF 3KP3A 1OYIA 4KIGA 2R7DA 4ZYDA 5DUIA 2FSWA 1YIOA 5ED4A 3W6JB 2VBWA 2PLYA 2QQBA 3HHGA 4WXHA 1BI3A 2A69F 1B1BA 3SQNA 1IRGA 5BOXA 2CWEA 3BJAA 1XN7A 1Z91A 1PDNC 3DQVC 1JXSA 2A3SA 1UFMA 1ON1A 3IRRA 1DP7P 1KU2A 2X0LA 5DV5A 3HTUA 3JAMZ 1W5TA 2EA2A 2P5LC 3MZYA 1SMYF 3J7AO 3I5UA 4A0XA 3O6BB 2HQNA 4EJOA 3K1PA 4ZYEA 5EEHA 5L3BA 4ZZDA 1LDJA 4R1HA 1MDMB 2BEOA 3KFWX 5FLXZ 1I6XA 3TOAA 2HTSA 3H92A 3LA3A 2R7FA 4IRGA 5FFZA 2FMYA 1U2WA 1JHHA 1NHAA 5HS7A 1TNSA 1KYZA 3GLXA 4XLNF 1O7FA 2QVOA 5BS6A 3F3XA 1HW2A 2HOEA 5D6FA 5KVRA 4UV8A 2GQQA 3CJNA 1RIOH 5CYVA 1K6OA 1ZRFA 2IT0A 1ZREA 2HKOA 3SHFA 5K5OA 4U0VA 3FX3A 2COMA 2LF8A 3BP8A 5IT9Z 2STTA 4D0PA 3GFMA 3KZZA 1R7JA 2WWYA 4MHGA 1Z1DA 1OYYA 3H3ZA 3C18A 2LDUA 3QPTA 1WWXA 2M87A 3BJ6A 2O03A 3T5XA 5HLGA 3BY6A 1GVJA 4UV9A 1K79A 5D6EA 3RI4A 2YPRA 1IN8A 4P55A 2CW0F 3LQQA 3V4GA 3ECOA 3LQRA 1XGMA 1FPQA 2YX7A 4U0YA 3WGGA 1YW9A 2XASA 4LB5A 2ETHA 2G7HA 3R0AA 3Q5FA 2M30A 4LG0A 2PBIA 3HIFA 3ZN0A 2V1XA 5JHUA 2ZBKA 4EJUA 4EM1A 3GF2A 4U88A 3ZMTA 2QLZA 5LGNA 3K69A 1F9NA 4QWQA 2EV6A 1FYLA 4K2EA 3SXYA 3LAPA 4ETSA 1TQIA 3M9AA 3B02A 1RI7A 1XSXA 4R8HA 1G3TA 3DPTA 3MEXA 3HTSB 2H27A 4WX9A 3ZMDA 2C6YA 1Z6RA 1E17A 4MQVA 1BOAA 4GCVA 2F5DA 1XGSA 1QGPA 1FBUA 2Z5UA 3CO6C 5BMZA 1HSJA 2ZMEB 2Y48A 3Q9SA 3BPXA 4KUMA 3L9FA 1J7KA 1EH7A 2GXGA 1K78B 3V7SA 2QQ9A 4CO8A 4HQMA 4RAYA 3M7GA 3E3VA 4EMSA 1SD5A 3F8NA 3KP5A 3QP5A 5JVTA 2DK8A 5K1YA 2VBXA 4KA4A 5LRRA 4G9YA 4FX4A 2DQLA 1EV7A 4ENNA 2P7CB 1FP2A 4HOBA 4RAZA 3FMQA 3DF8A 3LA2A 5JI6A 3KE2A 1FSHA 4PCQA 1ZAOA 4ENMA 2L3DA 3HRTA 4IXAA 1YW8A 1WQ2A 2DFIA 2EV5A 4HQEA 1TTYA 2FQ3A 4O6JA 4A12A 3N4MA 1O3RA 2ZCWA 3KEOA 3K9TA 1XCBA 4BQAA 2P6SA 2DAOA 3E6BA 3V8LA 3JAMK 3AAFA 2CGPA 3GW2A 1KU7A 2Z9OA 2PMHA 3F8CA 2MA3A 2W85A 2ESNA 2GIVA 3FHZA 2DPUA 1B4AA 3JTGA 4HV6A 5D8LB 1AOYA 2DTRA 4AIKA 4MEXF 1SFEA 2DQRA 1LDDA 2HQRA 4M9ZA 3WTVC 2HKXA 2PEXA 2JRTA 1RUNA 3GYHX 2P7VB 2V1DA 5FLXK 3GZ6A 2VBYA 4I01A 2NNNA 2V6CA 2DW4A 3NRVA 2XROA 4RGXA 3HSEA 3F6OA 1R1VA 4I7HA 3EYIA 2EB7A 3E6CC 1MZBA 1XCVA 4KFCA 4UNOA 2MH2A 1BIAA 4L0ZB 4A6EA 3OOPA 3F72A 2M45A 2E1CA 2G7UA 3F8FA 2ZO4A 3IKTA 3CLOA 1KQ0A 4RS8A 3IHUA 3JW4A 2JT1A 4XLPF 4BH9A 4ESFA 4ZH4F 4YFKF 2RQPA 1TW3A 1IN4A 3DXJF 4HF2A 4Q5SF 1ZGAA 4M9XA 5FO5A 3ZMUA 2PFBA 1FYMA 1LVAA 5CVVA 4EQQA 1T39A 1R5HA 2L4MA 2A68F 3GFIA 2YX4A 4G7HF 3WE2A 2A61A 2MLKA 1FOKA 1IXSB 4M73A 3P9CA 3I59B 4FX0A 5L3EA 4EJTA 1R22A 4EV0A 2YSRA 1X3UA 2IP2A 5BPDA 3E5UA 3P9IA 4KMFA 3HSFA 1CF7B 3H3UA 4L0YB 2ZJ2A 3WTYC 4Q47A 3FXRA 3IKVA 1O3SA 1TLHB 2L01A 2CFXA 1XSVA 1BBYA 1T38A 4Y17A 3OV8A 3K1NA 4IVNA 2PQ8A 1T2KA 3LA7A 4CHUA 2A5YB 4TV7A 4XBFA 2A6HF 3KP7A 4MEYF 2FU4A 4ON0A 2RKHA 1BI2A 1E2XA 1FLIA 1MGTA 1HW5A 4BHPA 4JQFA 3RPQA 1G4DA 1FX7A 3ROUA 5ILSA 5E8IA 1F4KA 1D3YA 2O0YA 1LQ1A 4L9VA 1S8NA 2CQKA 1S3JA 1H0MA 2FEZA 2XGXA 2UWMA 4LD5A 2Q0OA 4MNUA 3BOQA 4UHTA 2VOOA 2EFWA 2UXNA 2VC0A 4IPAA 2EJRA 3K2ZA 1W7PA 2OBPA 3GVAA 2EV0A 1SAXA 4M74A 1HKSA 2X4HA 1SFXA 1FWZA 4HDVA 3JSOA 1LNWA 4I09A 2JSCA 4XRFA 4YIFA 3F23A 5H20A 4OMZA 4A5MA 2HZTA 5F6FA 3C7JA 3WTWC 2O61A 3GWZA 5DCMB 4AD9A 1TBXA 1ZN2A 1DUXC 3I58A 4JBAA 5HOOA 4HX7A 3I0TA 1B59A 1QZZA 2RDPA 3RIRA 1YG2A 3SZPA 4XSXF 2Y0MA 1U5TA 1AWCA 3CUQA 3FM5A 4CYDA 3WTZA 1QZYA 2NAZA 1PP8F 1FBQA 2LNBA 1WSUA 4A2UA 2VT3A 5LHIA 1JHFA 1ZG5A 2FBIA 4KT5C 3E5XA 3EUHA 1L0OC 1WRJA 4KNYA 3I59A 3R6SA 1P2FA 2MC3A 2P4WA 3QRFF 3TQNA 4G6DA 4E70A 3EDPA 1FYKA 3QPHA 3Q9VA 2PG4A 5FFXA 5BQTA 2D2WA 1R1UA 2V1UA 4HW0A 1DPRA 2OA4A 5KK1A 4RB2C 4CGZA 4U7DA 1OR7A 3KP2A 1F1ZA 5DYMA 3ELKA 4P9FA 3LAJA 4BXUA 1FP1D 2ZNYA 3T1BA 3F21A 3EQLF 3RJPA 4F7ZA 2E1NA 5LHHA 3PQJA 4UVCA 5LEJA 1FBSA 1P4AA 5HVQC 4JK1X 3D0SA 4WF2A 1I1SA 2IVMA 1VTNC 4WWCA 1T98A 1HQCA 3WTXC 5D5WB 1J2XA 1FT9A 4UVAA 2BV6A 4BYYA 2DI3A 4H0EA 2J5OA 2VN2A 1GXPA 3V8KA 4A6DA 4O3MA 3WG9A 4MTEA 3ABUA 1T0FA 3VEPA 1TW2A 4YIIA 1BJAA 2ZKZA 4M71A 2CG4A 5L3DA 1KQ8A 3VFZA 4ZYGA 1MJAA 1P4WA 1P92A 1XMKA 1SMTA 2EFNA 1XGOA 3RYRA 4R79A 2XKOA 1RUOA 1ULYA 2RVCA 1I1GA 3S2WA 2HFHA 1ZARA 3WE3A 1KGSA 2H6BA 2QBYB 1SD4A 3ZMVA 5LEKA 3RKWA 4DQ2A 4N0BA 1MD0A 4ZZLA 3WTSC 3G73A 2F2EA 2A6EF 2PMUA 3BZ6A 5CVRA 4I0BA 4CICA 2OU2A 4EM0B 2BE5F 2G9WA 2O3FA 4KN7X 1W5SA 1IAWA 5FD5A 4ESJA 1IW7F 1QNTA 3WU1B 5DEQA 3WGIA 1QPMA 4I0AA 4HLXA 4LLLA 3E6MA 4Q4ZF 1ZLJA 1MDMA 2HS5A 1JGSA 1ONVA 3VOEA 5D8KB 3F22A 3KEQA 3ABTA 2FF4A 3KP4A 3C3WA 1ZG1A 3HHHA 1ZHFA 4KN4X 1B6AA 3GFJA 3FMSA 4EGYA 3K1MA 1OYWA 2VE8A 2ELHA 1S7OA 4CZZA 2LSOA 2ACJA 4Z2YA 1G3WA 4KIFA 5E1WA 2XHKA 2EK5A 3TOBA 1P4XA 1SFUA 2YR2A 1DDNA 2EA4A 1W4MA 2IA1A 2FRHA 4S04A 2D1VA 3HOSA 3QAHA 5FGMA 4AWXB 2STWA 4EVIA 2ZFWA 2P6TA 2AXLA 3FWEA 3ZN1A 2QM3A 2XAGA 1MJBA 1FNNA 3RTRA 4L9JA 4HX8A 3RKYA 1STZA 5IT3A 1C0WA 1B9MA 3ZMSA 1XMAA 3NQOA 2P5KA 4HYEA 5LLQA 3TGNA 2MBFA 2HYFA 3E6DA 2L02A 4GYGA 2M8EA 1TNTA 2UZKA 1U78A 2R3SA 1YTYA 5FD6A 5CVUA 2BYVE 2FE3A 2NNYA 4L5JA 3DPLC 2EWNA 1J0RA 5DCFA 3M8EA 1ZRCA 1FZPB 5HLHA 1B9NA 5E17F 3P9KA 1XB4A 1Z7UA 3ZP5A 1QO0D 5AIQA 4KMUX 3DEUA 3MFKA 1S6LA 2W25A 4CXFA 1XD7A 3U9GA 3IRQA 2DBBA 1BC7C 4YG2F 1KYWA 5LGUA 1R1TA 4AIJA 1HKTA 2VBZA 4P5OA 2FA5A 2BGCA 5L3FA 4I02A 5AIPA 4NQWA 3TO6A 3HUGA 4LFUA 2CYYA 5HDNA 1S29A 4HAMA 3T8TA 1D8KA 2FBHA 3CTAA 3HRMA 2GA2A 4LMYA 3KZYA 4HF1A 2K7LA 2XRNA 3O2PE 5BPIA 5EEGA 1IRFA 2HYGD 3RPUA 2ZMEA 2XAFA 5E1ZB 2JZYA 2F5EA 2MH9A 4HV5A 1K7AA 1K78A 3ULQB 2KJBA 3WTUC 3F6VA 3F8MA 1UCRA 4WXDA 1ZLKA 1FC3A 1QBJA 4RGSA 4UXNA 3GXOA 4L9NA 2GWRA 1D5VA 3MZHA 2E7WA 3LFKA 4HZFA 3R60A 4MGRA 4HBLA 2H94A 3PFIA 3VODA 3MWMA 4A0ZA 4G6QA 3MQ0A 1HSTA 2OAZA 2P5VA 3BROA 4O5VA 1KU9A 2VOPA 2RV8A 2W84A 2IA0A 3KCCA 5J8FA 3K0LA 2A07F 4L9TA 5D4RA 1LDKB 2RGVA 1PUEE 3TO9A 1W7PD 3QU3A 1REPC 4OIRF 5E18F 3IWFA 3RYPA 3IL2A 1YW7A 3R0JA 3QU6A 3W6KB 1F5TA 1TQMA 3L7WA 2VONA 4N9IA 3F8BA 3R61A 4OINF 2PI0A 2D1HA 4U0WA 2J5PA 3RKXA 4AVPA 4M6YA 4IHTA 1YYVA 1LEBA 4RB0A 3WU0A 5D5XB 3EYYA 2O8XA 4NHJA 4ENJA 3GO5A 3P7NA 3BPVA 2JTVA 2FNPA 2OD5A 5L3GA 1Z9CA 1V3FA 3R4KA 1L3LA 1YS7A 3N97A 3E97A 4OU0A 5CVJA 2B0LA 4I2OA 2KKOA 2UXXA 3J81K 1U6GA 2HGCA 2DT5A 4AIHA 4WXCA 1U3EM 4M72A 2IW5A 2OZ6A 2ZXJA 2E7XA 2Q2EA 2RN7A 4LG0B 2Z99A 2QUFA 3U1DA 1J75A 5K5RA 4B09A 2H6CA 3M8FA 4LK1F 5ICCA 5A2QK 3IC7A 4PGHA 5DDGA 1OMIA 4G7OF 3I53A 4IRHA 2Z3YA 2GZWA 1ZH5A 1BI1A 2V9VA 3MCZA 4LLNA 4IJAA 1UB9A 2ADUA 2K4BA 4ESBA 4FHTA 4PDKA 3FXQA 2IRFG 1SD6A 3B73A 4EJVA 1RNLA 1BM9A 3WTTC 3GUDA 5CJ9A 4ZYHA 5E8GA 2KIFA 2EFOA 1T6SA 5ICEA 1XDSA 4BNCA 3L00A 5JR3A 3TKYA 3U2RA 4HF0A 3CO7C 2QYOA 2HR3A 3TDZC 1BC8C 2FXAA 3V7CA 2XAJA 3C1DA 3VB2A 1IXRC 2AS5F 1KQ9A 1G3YA 1O3TA 3M1EA 2W24A 1ZRDA 1LEAA 3MAJA 4B8XA 2EFQA 5E1XA 4L18B 4A5NA 4U7BA 2KRFA 4OIOF 1O3QA 3O3KA 2QENA 4GXOA 1CF7A 4G7ZF 2PJPA 5K5QA 3HRSA 1U5TC 5H6QA 4G94A 3CUQC 4XSZF 3EETA 2YU3A 5LGTA 1BI0A 2OQRA 2WTEA 2Y75A 1QQIA 4IHSA 3I54A 1R5GA 5L3CA 5FB2A 4G8XA 3BWGA 6PAXA 2IA2A 2IJLA 2VT2A 2MD5A 4LGWA 1J9IA 5HS8A 3DFGA 2P8TA 3J80K 5J8CA 1R58A 1YS6A 5JFRA 2K27A 3V8JA 1EH8A 1WKMA 5DUKA 4GYIA 2ISZA 5LRSA 2ISYA 3L2CA 3ERED 4OOIA 1XSDA 2FOKA 1BIBA 1SD7A 4EGZA 4Q48A 1Q1HA 5ILUA 2TDXA 1J5YA 1GXQA 2FBKA 2K4JA 1H9TA 3FMRA 2WV0A 1ZGJA 3KETA 1OPCA 2VXZA 3DV8A 2XAHA 4IF4A 3JSPA 5ERIA 1UHMA 2K86A 4GGGA 2VODA 3QOPA 5HLIA 2DPDA 1I27A 3ECHA 4NB5A 1J59A 2VE9A 2KIUA 3COAC 4UVBA 3GFLA 1JE8A 5DCMA 2MLGA 4MTDA 1TQPA 2WC2A 2W57A 3GZ5A 3REOA 4RB1A 4BHBA 3T8RA 1S7AA 1IN5A 3L09A 4PZJA 4FT8A 3LWFA 2CO5A 5DD8A 4MQ9F 4HDUA 1R00A 4RB3C 2OZUA 4HX4A 1WI9A 1PP7U 4KYWA 5TRDA 3V7RA 3J81Z 3KLNA 4BHCA 3LSTA 1XGNA 1LJ9A 4M6XA 4YFXF 1ON2A 1H9GA 4WCGA 3PQKA 3HRUA 3KP6A 1MJ9A 5J6XA 3ML6A 2Q8KA 5A2QZ 2XKPA 3JTHA 4GO1A 4RGUA 2Z33A 2K02A 2F5CA 2O6GE 4ASNA 4A0YA 1KU3A 1R23A 3DKWA 3CDHA 1FSEA 2BBYA 1ZYRF 4P96A 1EH6A 2XUBA 3ZQ7A 2JPBA 5ILVA 1IF1A 1HKQA 3FM3A 4KICA 2QWWA 3ZMZA 3GEZA 2RC4A 3WGHA 3I4PA 3SZTA 3E5QA 4HA8A 1YLFA 1P6RA 5F64A 2V79A 5LBQA 2PN6A 2D45A 3HSRA 3FXUA 2DLLA 4Y15A 3FZVA 2GA1A 3BJOA 2HTJA 1O57A 2FNAA 3ZPLA 4UUVA 1IUYA 3FF5A 4WK8F 4N9HA 2RNJA 2L4AA 5F1RA 2L54A 3DP7A 1ODDA 4CDGA 2KJCA 2QBYA 3SFZA 5DD4A 1KA8A 1LB2A 2HWVA 5HDKA 4HLYA 3T0YA 1Z6TA 1IN6A 2GXBA 1Z05A 2XVCA 2EFPA 1ZG3A 3RDIA 2QQAA 1HBXG 1R36A 4BAYA 3J80Z 4OMYA 4LJZF 2LKPA 4QLCU 2GAUA 2DK5A 1G6NA 5AONA 2CSOA 4EM2A 3BDDA 3KLOA 5D4SA 2ZNZA 1RZ4A 5D5VB 3G3ZA 1W7PB 5E20A 3I71A 1U8RA 1V4RA 4LB6B 1I5ZA 5CLSA 1USSA 5HDGA 2DO7A 3HYIA 1Y0UA 1CGPA 3NEUA 5HS9A 1OKRA 5D5UB 3IWZA 4Y13A 1G3SA 5CVIA 3WODF 2M5WA 5TJJA 1DPUA 1BN5A 4DNCA 1A04A 5LHGA 3I64A 4EJWA 5IT9K 5ICFA 2IPQX 5H6RA 1U5TB 2XAQA 3HOTA 1IZ1A 3CUQB 1IXCA 1O7LA 3TO7A 4I98B 1YFHA 2HDCA 3CUOA 3GX4X 1HXDA 1HW1A 2H09A 4P9UA 2XV4S 2ESHA 1FY7A 1UHWA 2M1BA 4M9SA 2QZ8A 1YO5C 2FMLA 4KDPA 4L5IA 3TDUC 4YFNF 1GHCA 2NS0A 3D5LA 4ENKA 4PGGA 2JPCA 3QP6A 2KIMA 1XDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISP A;  4LK0 F;  2F5F A;  2VC1 A;  1MKM A;  4IRI A;  2HEO A;  1YQA A;  2LF7 A;  4RGR A;  4OIQ F;  2XIG A;  2OQG A;  5ICG A;  1IN7 A;  2NRA C;  2NYX A;  1UST A;  4LLG F;  4S05 A;  4KIB A;  1D8J A;  2DU9 A;  4OIP F;  3KP3 A;  1OYI A;  4KIG A;  2R7D A;  4ZYD A;  5DUI A;  2FSW A;  1YIO A;  5ED4 A;  3W6J B;  2VBW A;  2PLY A;  2QQB A;  3HHG A;  4WXH A;  1BI3 A;  2A69 F;  1B1B A;  3SQN A;  1IRG A;  5BOX A;  2CWE A;  3BJA A;  1XN7 A;  1Z91 A;  1PDN C;  3DQV C;  1JXS A;  2A3S A;  1UFM A;  1ON1 A;  3IRR A;  1DP7 P;  1KU2 A;  2X0L A;  5DV5 A;  3HTU A;  3JAM Z;  1W5T A;  2EA2 A;  2P5L C;  3MZY A;  1SMY F;  3J7A O;  3I5U A;  4A0X A;  3O6B B;  2HQN A;  4EJO A;  3K1P A;  4ZYE A;  5EEH A;  5L3B A;  4ZZD A;  1LDJ A;  4R1H A;  1MDM B;  2BEO A;  3KFW X;  5FLX Z;  1I6X A;  3TOA A;  2HTS A;  3H92 A;  3LA3 A;  2R7F A;  4IRG A;  5FFZ A;  2FMY A;  1U2W A;  1JHH A;  1NHA A;  5HS7 A;  1TNS A;  1KYZ A;  3GLX A;  4XLN F;  1O7F A;  2QVO A;  5BS6 A;  3F3X A;  1HW2 A;  2HOE A;  5D6F A;  5KVR A;  4UV8 A;  2GQQ A;  3CJN A;  1RIO H;  5CYV A;  1K6O A;  1ZRF A;  2IT0 A;  1ZRE A;  2HKO A;  3SHF A;  5K5O A;  4U0V A;  3FX3 A;  2COM A;  2LF8 A;  3BP8 A;  5IT9 Z;  2STT A;  4D0P A;  3GFM A;  3KZZ A;  1R7J A;  2WWY A;  4MHG A;  1Z1D A;  1OYY A;  3H3Z A;  3C18 A;  2LDU A;  3QPT A;  1WWX A;  2M87 A;  3BJ6 A;  2O03 A;  3T5X A;  5HLG A;  3BY6 A;  1GVJ A;  4UV9 A;  1K79 A;  5D6E A;  3RI4 A;  2YPR A;  1IN8 A;  4P55 A;  2CW0 F;  3LQQ A;  3V4G A;  3ECO A;  3LQR A;  1XGM A;  1FPQ A;  2YX7 A;  4U0Y A;  3WGG A;  1YW9 A;  2XAS A;  4LB5 A;  2ETH A;  2G7H A;  3R0A A;  3Q5F A;  2M30 A;  4LG0 A;  2PBI A;  3HIF A;  3ZN0 A;  2V1X A;  5JHU A;  2ZBK A;  4EJU A;  4EM1 A;  3GF2 A;  4U88 A;  3ZMT A;  2QLZ A;  5LGN A;  3K69 A;  1F9N A;  4QWQ A;  2EV6 A;  1FYL A;  4K2E A;  3SXY A;  3LAP A;  4ETS A;  1TQI A;  3M9A A;  3B02 A;  1RI7 A;  1XSX A;  4R8H A;  1G3T A;  3DPT A;  3MEX A;  3HTS B;  2H27 A;  4WX9 A;  3ZMD A;  2C6Y A;  1Z6R A;  1E17 A;  4MQV A;  1BOA A;  4GCV A;  2F5D A;  1XGS A;  1QGP A;  1FBU A;  2Z5U A;  3CO6 C;  5BMZ A;  1HSJ A;  2ZME B;  2Y48 A;  3Q9S A;  3BPX A;  4KUM A;  3L9F A;  1J7K A;  1EH7 A;  2GXG A;  1K78 B;  3V7S A;  2QQ9 A;  4CO8 A;  4HQM A;  4RAY A;  3M7G A;  3E3V A;  4EMS A;  1SD5 A;  3F8N A;  3KP5 A;  3QP5 A;  5JVT A;  2DK8 A;  5K1Y A;  2VBX A;  4KA4 A;  5LRR A;  4G9Y A;  4FX4 A;  2DQL A;  1EV7 A;  4ENN A;  2P7C B;  1FP2 A;  4HOB A;  4RAZ A;  3FMQ A;  3DF8 A;  3LA2 A;  5JI6 A;  3KE2 A;  1FSH A;  4PCQ A;  1ZAO A;  4ENM A;  2L3D A;  3HRT A;  4IXA A;  1YW8 A;  1WQ2 A;  2DFI A;  2EV5 A;  4HQE A;  1TTY A;  2FQ3 A;  4O6J A;  4A12 A;  3N4M A;  1O3R A;  2ZCW A;  3KEO A;  3K9T A;  1XCB A;  4BQA A;  2P6S A;  2DAO A;  3E6B A;  3V8L A;  3JAM K;  3AAF A;  2CGP A;  3GW2 A;  1KU7 A;  2Z9O A;  2PMH A;  3F8C A;  2MA3 A;  2W85 A;  2ESN A;  2GIV A;  3FHZ A;  2DPU A;  1B4A A;  3JTG A;  4HV6 A;  5D8L B;  1AOY A;  2DTR A;  4AIK A;  4MEX F;  1SFE A;  2DQR A;  1LDD A;  2HQR A;  4M9Z A;  3WTV C;  2HKX A;  2PEX A;  2JRT A;  1RUN A;  3GYH X;  2P7V B;  2V1D A;  5FLX K;  3GZ6 A;  2VBY A;  4I01 A;  2NNN A;  2V6C A;  2DW4 A;  3NRV A;  2XRO A;  4RGX A;  3HSE A;  3F6O A;  1R1V A;  4I7H A;  3EYI A;  2EB7 A;  3E6C C;  1MZB A;  1XCV A;  4KFC A;  4UNO A;  2MH2 A;  1BIA A;  4L0Z B;  4A6E A;  3OOP A;  3F72 A;  2M45 A;  2E1C A;  2G7U A;  3F8F A;  2ZO4 A;  3IKT A;  3CLO A;  1KQ0 A;  4RS8 A;  3IHU A;  3JW4 A;  2JT1 A;  4XLP F;  4BH9 A;  4ESF A;  4ZH4 F;  4YFK F;  2RQP A;  1TW3 A;  1IN4 A;  3DXJ F;  4HF2 A;  4Q5S F;  1ZGA A;  4M9X A;  5FO5 A;  3ZMU A;  2PFB A;  1FYM A;  1LVA A;  5CVV A;  4EQQ A;  1T39 A;  1R5H A;  2L4M A;  2A68 F;  3GFI A;  2YX4 A;  4G7H F;  3WE2 A;  2A61 A;  2MLK A;  1FOK A;  1IXS B;  4M73 A;  3P9C A;  3I59 B;  4FX0 A;  5L3E A;  4EJT A;  1R22 A;  4EV0 A;  2YSR A;  1X3U A;  2IP2 A;  5BPD A;  3E5U A;  3P9I A;  4KMF A;  3HSF A;  1CF7 B;  3H3U A;  4L0Y B;  2ZJ2 A;  3WTY C;  4Q47 A;  3FXR A;  3IKV A;  1O3S A;  1TLH B;  2L01 A;  2CFX A;  1XSV A;  1BBY A;  1T38 A;  4Y17 A;  3OV8 A;  3K1N A;  4IVN A;  2PQ8 A;  1T2K A;  3LA7 A;  4CHU A;  2A5Y B;  4TV7 A;  4XBF A;  2A6H F;  3KP7 A;  4MEY F;  2FU4 A;  4ON0 A;  2RKH A;  1BI2 A;  1E2X A;  1FLI A;  1MGT A;  1HW5 A;  4BHP A;  4JQF A;  3RPQ A;  1G4D A;  1FX7 A;  3ROU A;  5ILS A;  5E8I A;  1F4K A;  1D3Y A;  2O0Y A;  1LQ1 A;  4L9V A;  1S8N A;  2CQK A;  1S3J A;  1H0M A;  2FEZ A;  2XGX A;  2UWM A;  4LD5 A;  2Q0O A;  4MNU A;  3BOQ A;  4UHT A;  2VOO A;  2EFW A;  2UXN A;  2VC0 A;  4IPA A;  2EJR A;  3K2Z A;  1W7P A;  2OBP A;  3GVA A;  2EV0 A;  1SAX A;  4M74 A;  1HKS A;  2X4H A;  1SFX A;  1FWZ A;  4HDV A;  3JSO A;  1LNW A;  4I09 A;  2JSC A;  4XRF A;  4YIF A;  3F23 A;  5H20 A;  4OMZ A;  4A5M A;  2HZT A;  5F6F A;  3C7J A;  3WTW C;  2O61 A;  3GWZ A;  5DCM B;  4AD9 A;  1TBX A;  1ZN2 A;  1DUX C;  3I58 A;  4JBA A;  5HOO A;  4HX7 A;  3I0T A;  1B59 A;  1QZZ A;  2RDP A;  3RIR A;  1YG2 A;  3SZP A;  4XSX F;  2Y0M A;  1U5T A;  1AWC A;  3CUQ A;  3FM5 A;  4CYD A;  3WTZ A;  1QZY A;  2NAZ A;  1PP8 F;  1FBQ A;  2LNB A;  1WSU A;  4A2U A;  2VT3 A;  5LHI A;  1JHF A;  1ZG5 A;  2FBI A;  4KT5 C;  3E5X A;  3EUH A;  1L0O C;  1WRJ A;  4KNY A;  3I59 A;  3R6S A;  1P2F A;  2MC3 A;  2P4W A;  3QRF F;  3TQN A;  4G6D A;  4E70 A;  3EDP A;  1FYK A;  3QPH A;  3Q9V A;  2PG4 A;  5FFX A;  5BQT A;  2D2W A;  1R1U A;  2V1U A;  4HW0 A;  1DPR A;  2OA4 A;  5KK1 A;  4RB2 C;  4CGZ A;  4U7D A;  1OR7 A;  3KP2 A;  1F1Z A;  5DYM A;  3ELK A;  4P9F A;  3LAJ A;  4BXU A;  1FP1 D;  2ZNY A;  3T1B A;  3F21 A;  3EQL F;  3RJP A;  4F7Z A;  2E1N A;  5LHH A;  3PQJ A;  4UVC A;  5LEJ A;  1FBS A;  1P4A A;  5HVQ C;  4JK1 X;  3D0S A;  4WF2 A;  1I1S A;  2IVM A;  1VTN C;  4WWC A;  1T98 A;  1HQC A;  3WTX C;  5D5W B;  1J2X A;  1FT9 A;  4UVA A;  2BV6 A;  4BYY A;  2DI3 A;  4H0E A;  2J5O A;  2VN2 A;  1GXP A;  3V8K A;  4A6D A;  4O3M A;  3WG9 A;  4MTE A;  3ABU A;  1T0F A;  3VEP A;  1TW2 A;  4YII A;  1BJA A;  2ZKZ A;  4M71 A;  2CG4 A;  5L3D A;  1KQ8 A;  3VFZ A;  4ZYG A;  1MJA A;  1P4W A;  1P92 A;  1XMK A;  1SMT A;  2EFN A;  1XGO A;  3RYR A;  4R79 A;  2XKO A;  1RUO A;  1ULY A;  2RVC A;  1I1G A;  3S2W A;  2HFH A;  1ZAR A;  3WE3 A;  1KGS A;  2H6B A;  2QBY B;  1SD4 A;  3ZMV A;  5LEK A;  3RKW A;  4DQ2 A;  4N0B A;  1MD0 A;  4ZZL A;  3WTS C;  3G73 A;  2F2E A;  2A6E F;  2PMU A;  3BZ6 A;  5CVR A;  4I0B A;  4CIC A;  2OU2 A;  4EM0 B;  2BE5 F;  2G9W A;  2O3F A;  4KN7 X;  1W5S A;  1IAW A;  5FD5 A;  4ESJ A;  1IW7 F;  1QNT A;  3WU1 B;  5DEQ A;  3WGI A;  1QPM A;  4I0A A;  4HLX A;  4LLL A;  3E6M A;  4Q4Z F;  1ZLJ A;  1MDM A;  2HS5 A;  1JGS A;  1ONV A;  3VOE A;  5D8K B;  3F22 A;  3KEQ A;  3ABT A;  2FF4 A;  3KP4 A;  3C3W A;  1ZG1 A;  3HHH A;  1ZHF A;  4KN4 X;  1B6A A;  3GFJ A;  3FMS A;  4EGY A;  3K1M A;  1OYW A;  2VE8 A;  2ELH A;  1S7O A;  4CZZ A;  2LSO A;  2ACJ A;  4Z2Y A;  1G3W A;  4KIF A;  5E1W A;  2XHK A;  2EK5 A;  3TOB A;  1P4X A;  1SFU A;  2YR2 A;  1DDN A;  2EA4 A;  1W4M A;  2IA1 A;  2FRH A;  4S04 A;  2D1V A;  3HOS A;  3QAH A;  5FGM A;  4AWX B;  2STW A;  4EVI A;  2ZFW A;  2P6T A;  2AXL A;  3FWE A;  3ZN1 A;  2QM3 A;  2XAG A;  1MJB A;  1FNN A;  3RTR A;  4L9J A;  4HX8 A;  3RKY A;  1STZ A;  5IT3 A;  1C0W A;  1B9M A;  3ZMS A;  1XMA A;  3NQO A;  2P5K A;  4HYE A;  5LLQ A;  3TGN A;  2MBF A;  2HYF A;  3E6D A;  2L02 A;  4GYG A;  2M8E A;  1TNT A;  2UZK A;  1U78 A;  2R3S A;  1YTY A;  5FD6 A;  5CVU A;  2BYV E;  2FE3 A;  2NNY A;  4L5J A;  3DPL C;  2EWN A;  1J0R A;  5DCF A;  3M8E A;  1ZRC A;  1FZP B;  5HLH A;  1B9N A;  5E17 F;  3P9K A;  1XB4 A;  1Z7U A;  3ZP5 A;  1QO0 D;  5AIQ A;  4KMU X;  3DEU A;  3MFK A;  1S6L A;  2W25 A;  4CXF A;  1XD7 A;  3U9G A;  3IRQ A;  2DBB A;  1BC7 C;  4YG2 F;  1KYW A;  5LGU A;  1R1T A;  4AIJ A;  1HKT A;  2VBZ A;  4P5O A;  2FA5 A;  2BGC A;  5L3F A;  4I02 A;  5AIP A;  4NQW A;  3TO6 A;  3HUG A;  4LFU A;  2CYY A;  5HDN A;  1S29 A;  4HAM A;  3T8T A;  1D8K A;  2FBH A;  3CTA A;  3HRM A;  2GA2 A;  4LMY A;  3KZY A;  4HF1 A;  2K7L A;  2XRN A;  3O2P E;  5BPI A;  5EEG A;  1IRF A;  2HYG D;  3RPU A;  2ZME A;  2XAF A;  5E1Z B;  2JZY A;  2F5E A;  2MH9 A;  4HV5 A;  1K7A A;  1K78 A;  3ULQ B;  2KJB A;  3WTU C;  3F6V A;  3F8M A;  1UCR A;  4WXD A;  1ZLK A;  1FC3 A;  1QBJ A;  4RGS A;  4UXN A;  3GXO A;  4L9N A;  2GWR A;  1D5V A;  3MZH A;  2E7W A;  3LFK A;  4HZF A;  3R60 A;  4MGR A;  4HBL A;  2H94 A;  3PFI A;  3VOD A;  3MWM A;  4A0Z A;  4G6Q A;  3MQ0 A;  1HST A;  2OAZ A;  2P5V A;  3BRO A;  4O5V A;  1KU9 A;  2VOP A;  2RV8 A;  2W84 A;  2IA0 A;  3KCC A;  5J8F A;  3K0L A;  2A07 F;  4L9T A;  5D4R A;  1LDK B;  2RGV A;  1PUE E;  3TO9 A;  1W7P D;  3QU3 A;  1REP C;  4OIR F;  5E18 F;  3IWF A;  3RYP A;  3IL2 A;  1YW7 A;  3R0J A;  3QU6 A;  3W6K B;  1F5T A;  1TQM A;  3L7W A;  2VON A;  4N9I A;  3F8B A;  3R61 A;  4OIN F;  2PI0 A;  2D1H A;  4U0W A;  2J5P A;  3RKX A;  4AVP A;  4M6Y A;  4IHT A;  1YYV A;  1LEB A;  4RB0 A;  3WU0 A;  5D5X B;  3EYY A;  2O8X A;  4NHJ A;  4ENJ A;  3GO5 A;  3P7N A;  3BPV A;  2JTV A;  2FNP A;  2OD5 A;  5L3G A;  1Z9C A;  1V3F A;  3R4K A;  1L3L A;  1YS7 A;  3N97 A;  3E97 A;  4OU0 A;  5CVJ A;  2B0L A;  4I2O A;  2KKO A;  2UXX A;  3J81 K;  1U6G A;  2HGC A;  2DT5 A;  4AIH A;  4WXC A;  1U3E M;  4M72 A;  2IW5 A;  2OZ6 A;  2ZXJ A;  2E7X A;  2Q2E A;  2RN7 A;  4LG0 B;  2Z99 A;  2QUF A;  3U1D A;  1J75 A;  5K5R A;  4B09 A;  2H6C A;  3M8F A;  4LK1 F;  5ICC A;  5A2Q K;  3IC7 A;  4PGH A;  5DDG A;  1OMI A;  4G7O F;  3I53 A;  4IRH A;  2Z3Y A;  2GZW A;  1ZH5 A;  1BI1 A;  2V9V A;  3MCZ A;  4LLN A;  4IJA A;  1UB9 A;  2ADU A;  2K4B A;  4ESB A;  4FHT A;  4PDK A;  3FXQ A;  2IRF G;  1SD6 A;  3B73 A;  4EJV A;  1RNL A;  1BM9 A;  3WTT C;  3GUD A;  5CJ9 A;  4ZYH A;  5E8G A;  2KIF A;  2EFO A;  1T6S A;  5ICE A;  1XDS A;  4BNC A;  3L00 A;  5JR3 A;  3TKY A;  3U2R A;  4HF0 A;  3CO7 C;  2QYO A;  2HR3 A;  3TDZ C;  1BC8 C;  2FXA A;  3V7C A;  2XAJ A;  3C1D A;  3VB2 A;  1IXR C;  2AS5 F;  1KQ9 A;  1G3Y A;  1O3T A;  3M1E A;  2W24 A;  1ZRD A;  1LEA A;  3MAJ A;  4B8X A;  2EFQ A;  5E1X A;  4L18 B;  4A5N A;  4U7B A;  2KRF A;  4OIO F;  1O3Q A;  3O3K A;  2QEN A;  4GXO A;  1CF7 A;  4G7Z F;  2PJP A;  5K5Q A;  3HRS A;  1U5T C;  5H6Q A;  4G94 A;  3CUQ C;  4XSZ F;  3EET A;  2YU3 A;  5LGT A;  1BI0 A;  2OQR A;  2WTE A;  2Y75 A;  1QQI A;  4IHS A;  3I54 A;  1R5G A;  5L3C A;  5FB2 A;  4G8X A;  3BWG A;  6PAX A;  2IA2 A;  2IJL A;  2VT2 A;  2MD5 A;  4LGW A;  1J9I A;  5HS8 A;  3DFG A;  2P8T A;  3J80 K;  5J8C A;  1R58 A;  1YS6 A;  5JFR A;  2K27 A;  3V8J A;  1EH8 A;  1WKM A;  5DUK A;  4GYI A;  2ISZ A;  5LRS A;  2ISY A;  3L2C A;  3ERE D;  4OOI A;  1XSD A;  2FOK A;  1BIB A;  1SD7 A;  4EGZ A;  4Q48 A;  1Q1H A;  5ILU A;  2TDX A;  1J5Y A;  1GXQ A;  2FBK A;  2K4J A;  1H9T A;  3FMR A;  2WV0 A;  1ZGJ A;  3KET A;  1OPC A;  2VXZ A;  3DV8 A;  2XAH A;  4IF4 A;  3JSP A;  5ERI A;  1UHM A;  2K86 A;  4GGG A;  2VOD A;  3QOP A;  5HLI A;  2DPD A;  1I27 A;  3ECH A;  4NB5 A;  1J59 A;  2VE9 A;  2KIU A;  3COA C;  4UVB A;  3GFL A;  1JE8 A;  5DCM A;  2MLG A;  4MTD A;  1TQP A;  2WC2 A;  2W57 A;  3GZ5 A;  3REO A;  4RB1 A;  4BHB A;  3T8R A;  1S7A A;  1IN5 A;  3L09 A;  4PZJ A;  4FT8 A;  3LWF A;  2CO5 A;  5DD8 A;  4MQ9 F;  4HDU A;  1R00 A;  4RB3 C;  2OZU A;  4HX4 A;  1WI9 A;  1PP7 U;  4KYW A;  5TRD A;  3V7R A;  3J81 Z;  3KLN A;  4BHC A;  3LST A;  1XGN A;  1LJ9 A;  4M6X A;  4YFX F;  1ON2 A;  1H9G A;  4WCG A;  3PQK A;  3HRU A;  3KP6 A;  1MJ9 A;  5J6X A;  3ML6 A;  2Q8K A;  5A2Q Z;  2XKP A;  3JTH A;  4GO1 A;  4RGU A;  2Z33 A;  2K02 A;  2F5C A;  2O6G E;  4ASN A;  4A0Y A;  1KU3 A;  1R23 A;  3DKW A;  3CDH A;  1FSE A;  2BBY A;  1ZYR F;  4P96 A;  1EH6 A;  2XUB A;  3ZQ7 A;  2JPB A;  5ILV A;  1IF1 A;  1HKQ A;  3FM3 A;  4KIC A;  2QWW A;  3ZMZ A;  3GEZ A;  2RC4 A;  3WGH A;  3I4P A;  3SZT A;  3E5Q A;  4HA8 A;  1YLF A;  1P6R A;  5F64 A;  2V79 A;  5LBQ A;  2PN6 A;  2D45 A;  3HSR A;  3FXU A;  2DLL A;  4Y15 A;  3FZV A;  2GA1 A;  3BJO A;  2HTJ A;  1O57 A;  2FNA A;  3ZPL A;  4UUV A;  1IUY A;  3FF5 A;  4WK8 F;  4N9H A;  2RNJ A;  2L4A A;  5F1R A;  2L54 A;  3DP7 A;  1ODD A;  4CDG A;  2KJC A;  2QBY A;  3SFZ A;  5DD4 A;  1KA8 A;  1LB2 A;  2HWV A;  5HDK A;  4HLY A;  3T0Y A;  1Z6T A;  1IN6 A;  2GXB A;  1Z05 A;  2XVC A;  2EFP A;  1ZG3 A;  3RDI A;  2QQA A;  1HBX G;  1R36 A;  4BAY A;  3J80 Z;  4OMY A;  4LJZ F;  2LKP A;  4QLC U;  2GAU A;  2DK5 A;  1G6N A;  5AON A;  2CSO A;  4EM2 A;  3BDD A;  3KLO A;  5D4S A;  2ZNZ A;  1RZ4 A;  5D5V B;  3G3Z A;  1W7P B;  5E20 A;  3I71 A;  1U8R A;  1V4R A;  4LB6 B;  1I5Z A;  5CLS A;  1USS A;  5HDG A;  2DO7 A;  3HYI A;  1Y0U A;  1CGP A;  3NEU A;  5HS9 A;  1OKR A;  5D5U B;  3IWZ A;  4Y13 A;  1G3S A;  5CVI A;  3WOD F;  2M5W A;  5TJJ A;  1DPU A;  1BN5 A;  4DNC A;  1A04 A;  5LHG A;  3I64 A;  4EJW A;  5IT9 K;  5ICF A;  2IPQ X;  5H6R A;  1U5T B;  2XAQ A;  3HOT A;  1IZ1 A;  3CUQ B;  1IXC A;  1O7L A;  3TO7 A;  4I98 B;  1YFH A;  2HDC A;  3CUO A;  3GX4 X;  1HXD A;  1HW1 A;  2H09 A;  4P9U A;  2XV4 S;  2ESH A;  1FY7 A;  1UHW A;  2M1B A;  4M9S A;  2QZ8 A;  1YO5 C;  2FML A;  4KDP A;  4L5I A;  3TDU C;  4YFN F;  1GHC A;  2NS0 A;  3D5L A;  4ENK A;  4PGG A;  2JPC A;  3QP6 A;  2KIM A;  1XDU A; 
#chains in the Genus database with same CATH topology
 3ISP A;  3IUO A;  5EZH A;  4LK0 F;  4FTH A;  2F5F A;  2VC1 A;  5TGT A;  5IPA A;  1BJZ A;  1MKM A;  4IRI A;  1XX5 A;  2HEO A;  1YQA A;  3B6A A;  2LF7 A;  4RGR A;  4OIQ F;  1OLT A;  4CYC A;  3OYH A;  2XIG A;  5FRN A;  2OQG A;  5ICG A;  4A3L J;  1IN7 A;  2NRA C;  2KQR A;  2NYX A;  1UST A;  4LLG F;  5EZG A;  4S05 A;  4KIB A;  4NNJ A;  1D8J A;  1UAA A;  4XLA A;  2DU9 A;  4OIP F;  3RZO J;  2CU7 A;  1ETX A;  4EEF G;  1NH3 A;  2ZXI A;  1EKE A;  4C2T A;  4PJM A;  3KP3 A;  1PYV A;  1OYI A;  2JQ7 A;  4KIG A;  4A3E J;  1JKO C;  2R7D A;  3O8H A;  4ZYD A;  1WPK A;  5EYR A;  5DUI A;  2FSW A;  4II2 A;  1YIO A;  5F0H A;  4KIT B;  2DDB A;  2PJR A;  1RR7 A;  3JCU C;  3OYJ A;  3BQZ A;  5ED4 A;  5FKO A;  3DTI A;  3W6J B;  1FMV A;  2VBW A;  2E1M B;  3BTC A;  5C44 J;  2PLY A;  3CMM A;  3J7A Y;  2QQB A;  3PM1 A;  3HHG A;  4WXH A;  1BI3 A;  2XF7 A;  2LBF B;  2A69 F;  2NVY J;  1B1B A;  5F08 A;  3SQN A;  5BOX A;  1IRG A;  4XLC A;  2B7E A;  3K4B A;  2CWE A;  4M3F A;  5K7F A;  3BJA A;  1R9T J;  4XN0 A;  1XN7 A;  1Z91 A;  4NUB A;  3UNG C;  1PDN C;  3DQV C;  1JXS A;  2MAB A;  2A3S A;  1UFM A;  1ON1 A;  3IRR A;  3E7L A;  1KU2 A;  1DP7 P;  2X0L A;  5DV5 A;  2A5W A;  3HTU A;  3JAM Z;  2LK2 A;  1W5T A;  3CQZ J;  2XC7 A;  5EJC A;  4HNT A;  1WJA A;  1Z7L A;  2EA2 A;  2P5L C;  3MZY A;  3ERM A;  3DEE A;  2JUC A;  3DEW A;  1VI0 A;  2ME6 A;  1ACI A;  4XL9 A;  1SMY F;  4W97 A;  3J7A O;  5M3M J;  3I5U A;  2EQR A;  4A0X A;  2IGM A;  2Z1D A;  3O6B B;  2NVX J;  2BW3 B;  1WJF A;  2X1D A;  3A02 A;  4XLE A;  2HQN A;  4EJO A;  3K1P A;  2ZFU A;  4ZYE A;  3W2A A;  5EEH A;  5L3B A;  4ZZD A;  2QQ8 A;  2IGK A;  1LDJ A;  1BW5 A;  1WFX A;  3DLL F;  3SEZ A;  3SDG A;  4UB6 C;  4R1H A;  1MDM B;  4ZYA A;  1GUU A;  2BEO A;  4FCY A;  1K83 J;  1V54 H;  3HBL A;  3KFW X;  5FLX Z;  4W1U A;  1I6X A;  2V9K A;  3TOA A;  2HTS A;  3H92 A;  3LA3 A;  5J1R A;  1EF4 A;  2R7F A;  2EBI A;  5JHF A;  4IRG A;  3SJM A;  5FFZ A;  2FMY A;  4BDY A;  5B66 C;  1U2W A;  1JHH A;  1NHA A;  5HS7 A;  3D5R C;  3QYF A;  1K6Y A;  1TNS A;  3IH2 A;  4BE2 A;  1KYZ A;  3GLX A;  4XLN F;  5J1U A;  1O7F A;  2QVO A;  2HYJ A;  2VKH A;  1AKH A;  1MBH A;  4ZDP A;  1VZ0 A;  2BXY A;  4UUS B;  5BS6 A;  5J1Y A;  3F3X A;  1HW2 A;  5BNG A;  3OYD A;  2HOE A;  1D1C A;  1WJ5 A;  4B3X A;  4ANJ A;  2E71 A;  5D6F A;  5KVR A;  2UUZ A;  4UV8 A;  2VKE A;  4OAZ A;  5J47 A;  2GQQ A;  1IDZ A;  4PFO A;  1IV6 A;  3CJN A;  4HEA 2;  3SFI A;  2VQC A;  3PO3 J;  1VQK I;  1RIO H;  1Z67 A;  3QPL A;  5CYV A;  1K6O A;  1ZRF A;  1MMG A;  2R93 J;  2R7V A;  2IT0 A;  1ZRE A;  4IX7 A;  3M3Y J;  2QGU A;  2HKO A;  3SHF A;  5K5O A;  4U0V A;  4BQQ A;  2HQA A;  3FX3 A;  2COM A;  2LF8 A;  1AA7 A;  3BP8 A;  3ZQC A;  4BBS J;  2FUG 2;  2AXT C;  2FD5 A;  2W7N A;  5IT9 Z;  4BJ6 C;  2NS7 A;  4D0P A;  2STT A;  3GFM A;  2OUM A;  3KZZ A;  1Z3Y A;  1R7J A;  2WWY A;  3BR2 A;  3C2G A;  1JUP A;  5JLX A;  4MHG A;  4D1Q A;  1Z1D A;  1OYY A;  2RNG A;  4V2G A;  2HVS A;  3H3Z A;  2RQQ A;  3C18 A;  3DPU A;  2LDU A;  3QPT A;  1WWX A;  1WHU A;  2M87 A;  3BJ6 A;  3RQI A;  1ETY A;  2O03 A;  4RAF A;  4J19 A;  2KDO A;  3T5X A;  5HLG A;  1V5E A;  3BY6 A;  2W82 A;  1GVJ A;  4UV9 A;  1JKQ C;  1K79 A;  5D6E A;  3RI4 A;  2R7U A;  2YPR A;  1IN8 A;  4Y3O A;  4P55 A;  4A3D J;  4D5F A;  2CW0 F;  3ZQQ A;  3BG6 A;  3LQQ A;  1I6H J;  3V4G A;  3WHC A;  1M1E B;  4IHW A;  3ECO A;  3G6E I;  3LQR A;  1XGM A;  1FPQ A;  2YX7 A;  4ZC3 A;  3S1Q J;  4U0Y A;  2W00 A;  3W2W A;  3WGG A;  1YW9 A;  3VDX A;  2XAS A;  4LB5 A;  2ETH A;  4CZC A;  4HRI A;  2KT0 A;  2G7H A;  2DMT A;  2Y0S A;  2CQQ A;  3R0A A;  3KYL A;  3V42 A;  2VI6 A;  3ZOB A;  3Q5F A;  2M30 A;  1TWH J;  4LG0 A;  2LBF A;  2PBI A;  3HIF A;  5GPA A;  1QHG A;  3ZN0 A;  2V1X A;  1U0J A;  2KIS A;  5JHU A;  2FX0 A;  2ZBK A;  4EJU A;  4EM1 A;  2HPM A;  3FXK A;  3HB9 A;  3GF2 A;  4U88 A;  3ZMT A;  5EG0 A;  2QLZ A;  5LD2 C;  4LOC A;  5LGN A;  5IY5 H;  3K69 A;  1X2N A;  1F9N A;  1EJ9 A;  2B63 J;  3K7A J;  4QWQ A;  2X1C A;  2EV6 A;  2CFO A;  4IOC F;  1FYL A;  4K2E A;  2FOW A;  4A3C J;  5GP9 A;  1IJW C;  3RKQ A;  2CH0 A;  2HDW A;  3SXY A;  3LAP A;  4DGW B;  2LKX A;  4ETS A;  1TQI A;  1UJ8 A;  3FXO A;  4IHV A;  3M9A A;  3B02 A;  2F4O B;  1RI7 A;  1XSX A;  4R8H A;  1SFO J;  1G3T A;  1WCM J;  2QKM B;  3DPT A;  1LE8 A;  4ZTF A;  5DS9 A;  3MEX A;  4NQW B;  2BXZ A;  2L7Z A;  3F0C A;  2H27 A;  3HTS B;  3E0J B;  4WX9 A;  1D5Y A;  3ZMD A;  2C6Y A;  2F4M B;  3ZCO A;  1Z6R A;  1TL8 A;  1E17 A;  3JRE A;  1A6I A;  3M4O J;  2VQH A;  4AVZ A;  4MQV A;  1BOA A;  4GCV A;  2CV2 A;  2LRD A;  5EGO A;  2F5D A;  1XGS A;  1QGP A;  1FBU A;  2Z5U A;  1D0Y A;  3CO6 C;  4E7Z A;  3G71 I;  5HNH A;  2ZJP F;  3IV5 A;  5BMZ A;  1H88 C;  1HSJ A;  1JKP C;  1OCT C;  2ZME B;  4MIM A;  1QU3 A;  1WH7 A;  2Y48 A;  2O5R A;  3Q9S A;  3BPX A;  2IGO A;  2ID3 A;  4KUM A;  3L9F A;  1JJ8 C;  3GZN B;  2K40 A;  1J7K A;  3H5R A;  1MMA A;  1EH7 A;  2GXG A;  2L9R A;  1K78 B;  3V7S A;  2DXI A;  2JA7 J;  3OY9 A;  1RRJ A;  3HEF A;  2QQ9 A;  1JUS A;  4CO8 A;  2DA7 A;  4HQM A;  1SAU A;  4RAY A;  4QTR A;  3M7G A;  3E3V A;  4EMS A;  2OPT A;  2LY1 A;  1SD5 A;  2X51 A;  4G6T B;  4BXX J;  4GRI A;  3F8N A;  3KP5 A;  1RR8 C;  3QP5 A;  3GTK J;  1X1C A;  3OWT A;  2OJE D;  2W4S A;  2DK8 A;  5JVT A;  3DKX A;  2VLA A;  4ZJZ A;  5K1Y A;  2LD5 A;  2E2J J;  5E79 C;  2IS1 A;  3SYT A;  2VBX A;  4GFB A;  4KA4 A;  3BTL A;  2DA6 A;  5LRR A;  4G9Y A;  4FX4 A;  2DQL A;  1EV7 A;  4ENN A;  2HOT A;  4C2U A;  1K61 A;  2P7C B;  3L2V A;  1FP2 A;  4HOB A;  1HA8 A;  4RAZ A;  3FMQ A;  3DF8 A;  3LA2 A;  5JI6 A;  5E3L A;  1JTX A;  1FJL A;  3PIP F;  3GTP J;  3I4M J;  3KE2 A;  1FSH A;  1HDP A;  3VSL A;  1WVR A;  1DP3 A;  5F0C A;  4BU2 A;  2R4G A;  4PCQ A;  1ZAO A;  2L5Q A;  3IH3 A;  1VQO I;  2LY2 A;  1LFP A;  1VQ8 I;  4ENM A;  2L3D A;  3HRT A;  4IXA A;  1YW8 A;  1WQ2 A;  2DFI A;  2VJ5 A;  3LNQ A;  1TT0 A;  1S9H A;  2EV5 A;  4HQE A;  1TTY A;  4DYR A;  2FQ3 A;  2AHQ A;  3I4N J;  4O6J A;  3OYM A;  4A12 A;  2M34 A;  3N4M A;  1O3R A;  2ZCW A;  3KEO A;  3K9T A;  1XCB A;  3TL4 X;  1ZGW A;  2OF7 A;  2P6S A;  4BQA A;  2DAO A;  1FIP A;  1F36 A;  4ITV A;  3E6B A;  2R92 J;  2WAQ A;  5HLT A;  5IOZ A;  3V8L A;  3AG1 H;  1DGR M;  3JAM K;  3AAF A;  2CGP A;  3GW2 A;  1P7J A;  3FKJ A;  1KU7 A;  2Z9O A;  2IS2 A;  3VYU B;  1UG2 A;  2PMH A;  3F8C A;  1FOX A;  1JT6 A;  2MA3 A;  4PK4 A;  2W85 A;  3CZ6 A;  2ESN A;  1DGW Y;  2GIV A;  2EZI A;  4CCO A;  3CC7 I;  3FHZ A;  2DPU A;  1UG0 A;  1B4A A;  5CQE A;  5GAE J;  3JTG A;  3OYN A;  4HV6 A;  3OR2 C;  1X1D A;  5D8L B;  1AOY A;  2DTR A;  1W0T A;  2DYS H;  4AIK A;  3P5J A;  1ORK A;  4BJT A;  3I9V 2;  4MEX F;  3H9G A;  1SFE A;  3DKY A;  4AM3 A;  4BEH B;  2DQR A;  1LDD A;  2HQR A;  4M9Z A;  3WTV C;  1W1W E;  2HKX A;  2X9D A;  2PEX A;  2V7F A;  2IS6 A;  2JRT A;  1RUN A;  2VPR A;  5FLV A;  3GYH X;  2P7V B;  2V1D A;  2L7F P;  1B8I A;  5FLX K;  3GZ6 A;  2H8R A;  4HNV A;  3WHB A;  4QSH A;  2VBY A;  3FIW A;  4I01 A;  1QVT A;  2NNN A;  2ECC A;  2V6C A;  4B44 A;  1OJL A;  2DW4 A;  2GOM A;  3CJT B;  3NRV A;  3I56 I;  5GPC A;  1T8I A;  1KON A;  2DMN A;  2XRO A;  4AID A;  1ERD A;  1X3W B;  4RGX A;  4CCN A;  3HSE A;  2HQ5 A;  3F6O A;  1R1V A;  4I7H A;  3ZQH A;  3EYI A;  2EB7 A;  3E6C C;  1MZB A;  1XCV A;  4MFE A;  4KFC A;  4UNO A;  3IP4 B;  2I10 A;  2MH2 A;  1BIA A;  3NAU A;  1VQ5 I;  4L0Z B;  4A6E A;  4BQN A;  3OOP A;  3HKZ A;  3F72 A;  2R5Y B;  2M45 A;  2E1C A;  4II3 A;  4UB8 C;  2G7U A;  3F8F A;  2ZO4 A;  2VB6 A;  3IKT A;  3CLO A;  3CP2 A;  1KQ0 A;  4RS8 A;  3IHU A;  3JW4 A;  5GAG J;  2LC2 A;  2ID6 A;  2GXA A;  2JT1 A;  2E60 A;  3ESW B;  3BZC A;  3DU5 A;  3ZGK A;  3S2H J;  4XLP F;  4BH9 A;  3M1C A;  1P9Q C;  3PFY A;  4P1W A;  4ESF A;  4ZH4 F;  2GIZ A;  4YFK F;  2RQP A;  2LKS A;  1TW3 A;  1IN4 A;  5B3S H;  3U1K A;  3DXJ F;  3K2A A;  4HF2 A;  3AG2 H;  1G59 A;  4Q5S F;  4XNF A;  1ZGA A;  4M9X A;  4XON A;  5FO5 A;  3ZMU A;  1POG A;  3ABK H;  4X6A J;  4DJA A;  2PFB A;  4MFD A;  2KLO A;  1RKW A;  1FYM A;  2H1K A;  2K9S A;  2R0Q C;  4BGD A;  3G1L A;  1LVA A;  5CVV A;  4EQQ A;  1T39 A;  1OCZ H;  1I3A A;  1R5H A;  2L4M A;  5TIS C;  2WB1 A;  2A68 F;  3GFI A;  2YX4 A;  3CCR I;  2JJ7 A;  4G7H F;  2HXO A;  3WE2 A;  2A61 A;  1N75 A;  2MLK A;  4NDL A;  1FOK A;  1IXS B;  4PJL A;  3GTQ J;  1GLN A;  4M73 A;  3P9C A;  2XSJ C;  4YIR X;  3I59 B;  4A3G J;  3IAM 2;  3D1N I;  4FX0 A;  3HL2 A;  5L3E A;  4EJT A;  1R22 A;  4EV0 A;  2YSR A;  1X3U A;  2IP2 A;  5BPD A;  1ETK A;  3E5U A;  3P9I A;  2IBD A;  2HPI A;  2HOS A;  2K3F A;  2XPW A;  4KMF A;  3HSF A;  3OMY A;  2CW7 A;  3H3U A;  1CF7 B;  4L0Y B;  2ZJ2 A;  3WTY C;  1APL C;  2HNH A;  3CF5 F;  4Q47 A;  3FXR A;  5DM6 F;  4YEJ A;  3IKV A;  1O3S A;  3BG3 A;  5IP6 A;  1TLH B;  2L01 A;  1IDY A;  4C30 A;  4BJ5 C;  3X2Q H;  4V2F A;  2CFX A;  5K7Z A;  2KRH A;  1XSV A;  3OR1 C;  1BBY A;  1T38 A;  4XKV A;  4Y17 A;  3OV8 A;  3K1N A;  4IVN A;  2CQX A;  2PQ8 A;  1T2K A;  3LA7 A;  4CHU A;  5CPR B;  3Q0U A;  2V9P A;  2A5Y B;  2BY2 A;  4TV7 A;  3O8G A;  4XBF A;  2A6H F;  3KP7 A;  4MEY F;  2FU4 A;  3OYC A;  4ON0 A;  3FXJ A;  1BW6 A;  2RKH A;  4EAT A;  1BI2 A;  1E2X A;  1FLI A;  3KZI C;  1MGT A;  1YJN I;  1KZH A;  1HW5 A;  3H9Q A;  4BHP A;  1U8B A;  4JQF A;  1MBK A;  2EZL A;  2MG4 A;  3RPQ A;  1G4D A;  1SEU A;  1FX7 A;  3ROU A;  5HNF A;  5ILS A;  2CQ7 A;  5E8I A;  2HDD A;  1F4K A;  1D3Y A;  1X4O A;  2TRT A;  2O0Y A;  1TWA J;  1VFC A;  1LQ1 A;  3HG9 A;  3S14 J;  2LR8 A;  3VYR B;  3BZK A;  4XR6 A;  2QA4 I;  2KIQ A;  4L9V A;  2WY7 Q;  1S8N A;  2CQK A;  4HNU A;  1IGN A;  1S3J A;  3OIQ A;  1LFU P;  2CMP A;  1GT0 C;  1H0M A;  1I50 J;  1MBF A;  2FEZ A;  2XGX A;  3QYB A;  2UWM A;  4LD5 A;  2Q0O A;  4MNU A;  3BOQ A;  4UHT A;  4BY1 J;  2VOO A;  5KCM A;  1RC9 A;  5GTI C;  2EFW A;  2UXN A;  2VC0 A;  4IPA A;  2EJR A;  3BG7 A;  3K2Z A;  3LSK A;  4IHY A;  1AU7 A;  5IYB J;  1W7P A;  2OBP A;  1R5I D;  3GVA A;  4JX6 A;  2EV0 A;  1SAX A;  4D7M A;  4M74 A;  2HVR A;  3AG4 H;  4A93 J;  1HKS A;  2X4H A;  3EUK L;  3MMY B;  1SFX A;  3H1C A;  1S7E A;  1FWZ A;  4A3K J;  1VQN I;  4HDV A;  3JSO A;  1LNW A;  2K9M A;  4I09 A;  2DOF A;  2R5Y A;  4MLO A;  2EZK A;  3FXM A;  2JSC A;  3FDY A;  4E7I A;  2DFF A;  4FE7 A;  4XRF A;  4YIF A;  3F23 A;  5H20 A;  2XF6 A;  1BR4 A;  1RKT A;  3OOU A;  4OMZ A;  1ZTR A;  4A5M A;  3CJQ B;  4BAC A;  2HZT A;  5F6F A;  3CMA I;  3K4J A;  3C7J A;  3WTW C;  2O61 A;  4X1E A;  3GWZ A;  5DCM B;  1UMQ A;  2VKD A;  2TCT A;  4AD9 A;  1TBX A;  1ZN2 A;  1DUX C;  3I58 A;  4RA2 A;  4JBA A;  5HOO A;  4HX7 A;  2JUG A;  3I0T A;  1B59 A;  1E3O C;  2NVT J;  4LG3 A;  1QZZ A;  1T08 B;  3L1P A;  2RDP A;  3RIR A;  1YG2 A;  4IO9 F;  2KL4 A;  5F0F A;  3DBR B;  3SZP A;  2QKL B;  4RLF A;  3CCV I;  4XSX F;  3PJR A;  2Y0M A;  1U5T A;  4D5C A;  1FIA A;  1OIS A;  1AWC A;  3GLL A;  3B6C A;  3CUQ A;  3VWB A;  3FM5 A;  4CYD A;  1OCP A;  3DBL B;  3WTZ A;  1QZY A;  2NAZ A;  1PP8 F;  1FBQ A;  3HOV J;  2XPV A;  4AC0 A;  2EIJ H;  2CV0 A;  2LNB A;  1WJB A;  5B1B H;  5J4Y A;  1PJR A;  1WSU A;  2H1L A;  3ZRG A;  2L7K A;  4A2U A;  3LMM A;  3QWL A;  2QCO A;  2VT3 A;  2YUS A;  2ZXW H;  3Q0W A;  1JHF A;  3BC8 A;  4F92 B;  5LHI A;  1ZG5 A;  2FBI A;  1GV5 A;  4KT5 C;  3E5X A;  3EUH A;  1L0O C;  1WRJ A;  2IXS A;  5FKM A;  4KNY A;  3I59 A;  1T33 A;  3R6S A;  1P2F A;  2MC3 A;  2P4W A;  2BY0 A;  4MO7 A;  3QRF F;  3TQN A;  4G6D A;  1NG7 A;  1AHD P;  2HU9 A;  4E70 A;  2JVG A;  1ZR2 A;  4PJN A;  3EDP A;  4RM2 A;  1FYK A;  4OAY A;  3QPH A;  2O8K A;  3Q9V A;  2V4J C;  2PG4 A;  3ZXS A;  5FFX A;  5BQT A;  5J4V A;  2X6X A;  2D2W A;  1R1U A;  1DU6 A;  2V1U A;  4HW0 A;  1DPR A;  2CV1 A;  3S32 A;  2OA4 A;  5KK1 A;  4RB2 C;  4CGZ A;  4U7D A;  2WA0 A;  3OS0 A;  1OR7 A;  3HOX J;  3H35 A;  1ENH A;  3KP2 A;  1F1Z A;  5DYM A;  3ELK A;  4P9F A;  3LAJ A;  4BXU A;  3LFU A;  1ETV A;  4IL6 C;  1FP1 D;  3A4C A;  4XMY A;  1T56 A;  2ZNY A;  3PUB A;  3T1B A;  3F21 A;  3A01 A;  3EQL F;  2ZC2 A;  3RJP A;  2XPU A;  4F7Z A;  2E1N A;  4HPQ A;  5LHH A;  1Y1W J;  3ASN H;  3PQJ A;  4UVC A;  2HVQ A;  5FRO A;  5LEJ A;  2LG4 A;  1FBS A;  2L2O A;  4KT6 A;  1P4A A;  5HVQ C;  4JK1 X;  3D0S A;  3K4L A;  3M8J A;  5KAI C;  2CUE A;  2CS3 A;  4WF2 A;  1XC5 A;  1W0U A;  1I1S A;  1ETW A;  2IVM A;  1VTN C;  4WWC A;  1T98 A;  1HQC A;  3WTX C;  5FJ8 J;  2E5N A;  1VQ6 I;  1PUF B;  3TBI A;  4B43 A;  5D5W B;  1J2X A;  1FT9 A;  4UVA A;  4PJ0 C;  2BV6 A;  1WJE A;  1VF9 A;  4BYY A;  3AL0 C;  2DI3 A;  4H0E A;  2J5O A;  2VN2 A;  1YIJ I;  3BT9 A;  2K9N A;  1GXP A;  3V8K A;  4A6D A;  4F55 A;  4O3M A;  1QRY A;  3WG9 A;  5M5X J;  4MTE A;  4DYC A;  3ABU A;  1R4M B;  1T0F A;  3VEP A;  1TW2 A;  4YII A;  5IOY A;  1BJA A;  2R7W A;  2ZKZ A;  4M71 A;  2CG4 A;  1XG1 A;  5L3D A;  3LL7 A;  1KQ8 A;  2COB A;  3VFZ A;  4ZYG A;  1MJA A;  2VPL A;  1P4W A;  1P92 A;  1XMK A;  2DCE A;  1SMT A;  2XB5 A;  2EFN A;  1XGO A;  2A6T A;  3BLY A;  3RYR A;  4R79 A;  2XKO A;  1RUO A;  1ULY A;  2RVC A;  2I5U A;  4S0H B;  1I1G A;  3CP8 A;  2ZSH B;  3S2W A;  3M07 A;  2HFH A;  1ZAR A;  3OYF A;  4ZDO A;  3WE3 A;  1KGS A;  2H6B A;  2JN6 A;  2QBY B;  2GM4 A;  1SD4 A;  2BOL A;  3ZMV A;  3ZR8 X;  1JI8 A;  5LEK A;  3RKW A;  4DQ2 A;  4XRS A;  3JRC A;  3BR6 A;  4N0B A;  1MD0 A;  2M0C A;  4ZZL A;  3WTS C;  3G73 A;  3N05 A;  2F2E A;  2A6E F;  2PMU A;  3BZ6 A;  5CVR A;  1OCC H;  2DYR H;  1EA3 A;  3HPG A;  4I0B A;  5CQG A;  2LTP A;  4XID A;  1OQY A;  2MFZ A;  4AU7 A;  3SEQ A;  4CIC A;  2OU2 A;  4FET A;  3HUG B;  2D5V A;  2EZH A;  4EM0 B;  3TW6 A;  2BE5 F;  2BW3 A;  2DOA A;  2G9W A;  1MBG A;  2O3F A;  4KN7 X;  2E1M C;  2XF5 A;  1W5S A;  3C2H A;  1IAW A;  1LKX A;  2BZT A;  5FD5 A;  4ESJ A;  1IW7 F;  1QNT A;  4F52 A;  3WU1 B;  5DEQ A;  3WGI A;  1QPM A;  4I0A A;  4HLX A;  1JKR C;  4LLL A;  2NVQ J;  2WY8 Q;  2I8D A;  3E6M A;  1ZLJ A;  4Q4Z F;  4XIC A;  1MDM A;  5B5E C;  2HS5 A;  2OTJ I;  1JGS A;  3PSF A;  1ONV A;  2DFH A;  3VOE A;  5D8K B;  3F22 A;  1H8A C;  4G12 A;  3BG5 A;  3KEQ A;  5JVG F;  2CUF A;  5JLW A;  2OCE A;  5C4X J;  3ABT A;  1OCO H;  2FF4 A;  3KP4 A;  2OCC H;  3C3W A;  3HHH A;  4BY7 J;  1ZG1 A;  3FIS A;  4PJJ A;  1ZHF A;  4KN4 X;  3G2B A;  1B6A A;  4QIW N;  3GFJ A;  3G4S I;  3FMS A;  4EGY A;  3K1M A;  3CJR B;  2XGC A;  4IOA F;  1OYW A;  2VE8 A;  2ELH A;  4UUS A;  1S7O A;  3BCB A;  4CZZ A;  2LSO A;  5KHD A;  3BTJ A;  3FBN B;  2DJN A;  1MSF C;  1D1A A;  1LFB A;  2ACJ A;  4Z2Y A;  1OFC X;  1Q1V A;  1G3W A;  3H0D A;  1BL0 A;  3L2W A;  1ITY A;  4C3J J;  4KIF A;  1QA6 A;  2UV1 A;  5E1W A;  5LFA A;  3KYC B;  3PO2 J;  1TT5 B;  3NWS A;  2XHK A;  2EK5 A;  3JRD A;  3TOB A;  4C2M J;  1P4X A;  2LH9 A;  3A1Y A;  3SZG A;  3UR3 C;  1SFU A;  2YR2 A;  3VSK A;  1DDN A;  2EA4 A;  3FBI B;  1Z0X A;  2GBY A;  2WAE A;  4DBQ A;  1W4M A;  2JA2 A;  1VQ7 I;  2KZV A;  3K4N A;  2IA1 A;  2FRH A;  5FKK A;  3CDL A;  4S04 A;  2D1V A;  4M3B A;  3HOS A;  5H2F C;  3QAH A;  2LYC A;  3NAR A;  1NK2 P;  2L9V A;  5FGM A;  1ZR4 A;  3FHN A;  4AWX B;  2MYS A;  2STW A;  3PUF A;  4EVI A;  2ZFW A;  1HLV A;  2P6T A;  2AXL A;  3FWE A;  4IEJ A;  3ZN1 A;  2QM3 A;  1J09 A;  2NS8 A;  3JR9 A;  2XAG A;  1MJB A;  1YRN B;  3H5N A;  2BVL A;  1FNN A;  4A3I J;  3RTR A;  4L9J A;  4HX8 A;  3RKY A;  1STZ A;  2DFE A;  1BA5 A;  5IT3 A;  1C0W A;  1MND A;  4XLH A;  1B9M A;  3ZMS A;  2M9H A;  1XMA A;  2RAE A;  2VJ4 A;  4CUG A;  3NQO A;  2P5K A;  2ICW G;  2AQF A;  4D9J A;  4HYE A;  5LLQ A;  4XQF A;  3TGN A;  2MBF A;  2HYF A;  3E6D A;  2L02 A;  3LOC A;  4PSW A;  1SC7 A;  4GYG A;  5M5W J;  1K4T A;  4PSX A;  1MNM C;  1IRX A;  1MMS A;  2Y0S N;  3BR5 A;  2M8E A;  1TNT A;  3AFH A;  3OS2 A;  5C3E J;  2UZK A;  1U78 A;  3HOU J;  2R3S A;  1YTY A;  4A3F J;  5FD6 A;  3AKZ A;  5CVU A;  1X4P A;  3CC4 I;  2BYV E;  5GAD J;  1WH5 A;  2FE3 A;  2NNY A;  1MBJ A;  4L5J A;  3OL4 A;  2P0W A;  3DPL C;  2EWN A;  1J0R A;  5DCF A;  4CYC B;  3M8E A;  2M8G X;  3JRI A;  1X1A A;  3J7Z I;  3GTJ J;  1FZP B;  1ZRC A;  3LSG A;  5DTD A;  1B9N A;  5HLH A;  5E17 F;  3OIO A;  2MW8 A;  3P9K A;  3FK7 A;  1XB4 A;  3F9K A;  1Z7U A;  3ZP5 A;  3CD6 I;  1QO0 D;  3C2B A;  5AIQ A;  2ELJ A;  4KMU X;  3DEU A;  3MFK A;  1E0E A;  1S6L A;  4AYB A;  1LVK A;  4E7K A;  2W25 A;  4CXF A;  1XD7 A;  4RLQ A;  5J3L A;  3BTI A;  3U9G A;  2DBB A;  5GTH C;  3IRQ A;  4A3M J;  4YG2 F;  1BC7 C;  3HM5 A;  1VQ9 I;  3W2V A;  1KYW A;  2BY1 A;  5LGU A;  1R1T A;  2FJ1 A;  4M3E A;  3MKZ A;  4AIJ A;  4XRS G;  1BR2 A;  1HKT A;  1IG7 A;  1WZ2 A;  2VBZ A;  4JOM A;  3A03 A;  3VYT B;  4CSW A;  4P5O A;  2PJR B;  2FA5 A;  2BGC A;  5L3F A;  2EIK H;  3D5S C;  3HGG A;  4I02 A;  5KNL A;  5AIP A;  4NQW A;  3TO6 A;  3HUG A;  3CDI A;  4LFU A;  2CYY A;  5HDN A;  1S29 A;  4N4O B;  2Q2E B;  4HAM A;  3T8T A;  2Y9Z A;  2KDZ A;  4NC8 A;  1D8K A;  2F4I A;  2FBH A;  1LUJ B;  1RPW A;  1X1B A;  4KJZ A;  3CTA A;  3HRM A;  2GOX B;  4J00 A;  2GA2 A;  1G8X A;  4LMY A;  2LOO A;  3KZY A;  4HF1 A;  3K4M A;  2K7L A;  2XRN A;  3O2P E;  2BVM A;  5BPI A;  3RQ4 A;  4JX5 A;  3HOY J;  5EEG A;  1IRF A;  2VJJ A;  2HYG D;  2CQN A;  3RPU A;  2ZME A;  2XAF A;  3GTG J;  3HJE A;  1V5F A;  3OYB A;  3QPS A;  5E1Z B;  2JZY A;  2NXN B;  2F5E A;  1U9N A;  1YE9 A;  2MH9 A;  2X85 A;  2XGD A;  3OYA A;  2QSH X;  3TP0 A;  1I39 A;  2KHM A;  2X6O A;  2MSY A;  1LPQ A;  4HV5 A;  1K7A A;  3KYD B;  2JWT A;  1K78 A;  3ULQ B;  2EIN H;  2KJB A;  3WTU C;  3F6V A;  3QOD A;  3F8M A;  1UCR A;  4WXD A;  4F3Q A;  1X2M A;  2R7X A;  1ZLK A;  4CA0 A;  1FC3 A;  4FAS D;  2M7A A;  2ZJR F;  4RGS A;  1QBJ A;  4UXN A;  3GXO A;  4L9N A;  2Z2S B;  1ZEL A;  2GWR A;  3H9J A;  3MZH A;  1D5V A;  2E7W A;  2X1E A;  1YX3 A;  2K85 A;  3WG7 H;  3LFK A;  4HZF A;  3R60 A;  4CCJ A;  1ZKG A;  4MGR A;  4HBL A;  3PL8 A;  2H94 A;  3PFI A;  3VOD A;  1TC3 C;  3MWM A;  3GTL J;  4G6Q A;  4A0Z A;  3MQ0 A;  2ZME C;  5KAF C;  1HST A;  2OAZ A;  2E2I J;  2P5V A;  3BRO A;  4A69 C;  4O5V A;  1KU9 A;  2VOP A;  4M3G A;  2RV8 A;  2M2E A;  1FMW A;  3MN2 A;  2W84 A;  2X48 A;  2IA0 A;  1X1P A;  3KCC A;  5J8F A;  2XDV A;  2R7Z J;  3K0L A;  2JA6 J;  2A07 F;  3MZ8 A;  4L9T A;  5D4R A;  4U87 A;  4H4K C;  1AKH B;  1LDK B;  4BKX A;  2RGV A;  1NG6 A;  1PUE E;  4F93 B;  4BS9 A;  3TO9 A;  3ASO H;  1W7P D;  3QU3 A;  4I99 C;  4DOZ A;  3S1N J;  2DOE A;  1REP C;  4OIR F;  5E18 F;  2VIX A;  3OYG A;  1FOW A;  3OIP A;  1VQM I;  3OL3 A;  5EEA A;  2DT6 A;  3IWF A;  3RYP A;  2VJI A;  2WAQ N;  2XAU A;  4FE4 A;  1HC8 A;  1SVO A;  2V26 A;  1YW7 A;  3IL2 A;  3R0J A;  1R6R A;  4BE0 A;  2L0K A;  2F5V A;  3QU6 A;  3W6K B;  1F5T A;  1TQM A;  3HOZ J;  1SVL A;  1YOV B;  3L7W A;  4CH7 A;  2VON A;  1TWF J;  4N9I A;  2LFB A;  4DW6 A;  4D7N A;  3F8B A;  3R61 A;  2YS9 A;  4OIN F;  1JTY A;  2PI0 A;  1WGX A;  3FXL A;  3OYE A;  2D1H A;  4U0W A;  2DA5 A;  2J5P A;  4QPQ A;  2DA1 A;  3LSI A;  4A3B J;  3RKX A;  3S2D J;  2M7B A;  4GDF A;  1W36 D;  4AVP A;  3W3C A;  1YX5 A;  3DTE A;  4HG2 A;  2E5Z A;  1V55 H;  4M6Y A;  4IHT A;  1YYV A;  1LEB A;  4RB0 A;  1A5J A;  3WU0 A;  2KMU A;  5D5X B;  1GDT A;  3ABL H;  1ETQ A;  3EYY A;  4ABZ A;  2DDA A;  1TWG J;  2F48 A;  2O8X A;  4BEH A;  3JRA A;  1Y8Q B;  3JRH A;  4NHJ A;  1V5G A;  3DCF A;  1A6Q A;  2X6W A;  3GO5 A;  3P7N A;  4ENJ A;  3BPV A;  2JTV A;  2FNP A;  1Z3X A;  2G0E A;  2OD5 A;  5L3G A;  4AYB N;  4RBO A;  1Z9C A;  1Y1V J;  1SAN A;  1V3F A;  3R4K A;  1L3L A;  1YS7 A;  2IAI A;  3N97 A;  3E97 A;  2JVH A;  4OU0 A;  5CVJ A;  2B0L A;  3GTM J;  5E3O A;  4I2O A;  2KKO A;  4XKB A;  4E7J A;  1F43 A;  2IEK A;  2UXX A;  5IP7 J;  1DU0 A;  1IRZ A;  3J81 K;  1U6G A;  3BR1 A;  2HGC A;  9ANT A;  1B72 B;  3JRG A;  2DMU A;  2DT5 A;  4AIH A;  4WXC A;  3K4C A;  1U3E M;  4M72 A;  1QVU A;  2IW5 A;  2OZ6 A;  2ZXJ A;  2OC6 A;  2E7X A;  2MGQ A;  4XK4 A;  5EDN A;  1W5C C;  4UY8 I;  2Q2E A;  3RZD J;  1ZK8 A;  3BR0 A;  2RN7 A;  4FIS A;  2CW8 A;  4LG0 B;  2Z99 A;  2M3A A;  2MC4 A;  2QUF A;  2M4K A;  3U1D A;  3HKZ N;  4XOT A;  1J75 A;  2DOD A;  5K5R A;  4IZZ A;  4B09 A;  2H6C A;  3M8F A;  1UHS A;  4LK1 F;  5ICC A;  2VAS A;  5A2Q K;  3IC7 A;  3ZQG A;  4PGH A;  3A0H C;  5DDG A;  4RDU A;  1OMI A;  5EG0 B;  3W6V A;  3I53 A;  4G7O F;  1Y0N A;  4IRH A;  2Z3Y A;  3S16 J;  2VKV A;  2GZW A;  2LVS A;  1ZH5 A;  2JMW A;  3G1M A;  4RM3 A;  2DN0 A;  2Y30 A;  1BI1 A;  2V9V A;  3MCZ A;  4LLN A;  4IJA A;  4V19 K;  1UB9 A;  2ADU A;  2CRG A;  2K4B A;  2O7O A;  2ME0 A;  4ESB A;  4B4C A;  2KRC A;  1NK3 P;  4FHT A;  4PDK A;  3FXQ A;  2WBM A;  3K4K A;  2IRF G;  3ZQI A;  1SD6 A;  2CUZ A;  3B73 A;  4EJV A;  1RNL A;  1BM9 A;  3BCA A;  3ZQL A;  3WTT C;  3GUD A;  5CJ9 A;  4ZYH A;  4QPO A;  5E8G A;  1LE8 B;  2KIF A;  2EFO A;  2DA4 A;  3DLA A;  3CCY A;  3GCM A;  1T6S A;  5ICE A;  2B9S A;  1XDS A;  4BNC A;  2ELK A;  3L00 A;  3L2U A;  2PMZ A;  5JR3 A;  3TKY A;  1QPI A;  3U2R A;  4HF0 A;  3CO7 C;  3S3O A;  3CCS I;  1HOM A;  2QYO A;  2E34 A;  2HR3 A;  3TDZ C;  1U9O A;  1OCR H;  1BC8 C;  2FXA A;  2WB1 N;  4B3A A;  2R7R A;  3V7C A;  2XAJ A;  3C1D A;  5EGO B;  3LSR A;  2DMQ A;  3VB2 A;  3MKW B;  1IXR C;  2AS5 F;  4I6Z A;  1KQ9 A;  4C3H J;  4JP0 A;  1G3Y A;  2DTZ A;  2BY3 A;  1O3T A;  1XMX A;  3M1E A;  2W24 A;  3DU6 A;  1ZRD A;  1LEA A;  3LSJ A;  4DZP A;  3MAJ A;  4B8X A;  3H5A A;  1TWC J;  2VUM J;  2EFQ A;  3KX2 A;  5E1X A;  4L18 B;  1W36 C;  4A5N A;  2GLO A;  4U7B A;  3CCU I;  2KRF A;  4OIO F;  3H36 A;  4HST A;  4ZTJ A;  1O3Q A;  3O3K A;  2QEN A;  2QF7 A;  4GXO A;  5E3N A;  1CF7 A;  4G7Z F;  2PJP A;  5K5Q A;  2H8W A;  3HRS A;  1WI3 A;  1U5T C;  2XSD C;  3ONQ A;  5H6Q A;  4G94 A;  3CUQ C;  1MMN A;  4ZDL A;  2E36 A;  4XSZ F;  3EET A;  2YU3 A;  5LGT A;  1BI0 A;  3JRF A;  2P81 A;  2OQR A;  2KFD A;  2NOG A;  1QQI A;  2M4G A;  2WTE A;  2Y75 A;  4IHS A;  4NBQ A;  2K3P A;  3I54 A;  1R5G A;  1XTA A;  3CCL I;  5L3C A;  5FB2 A;  1YI2 I;  2AQE A;  2CUJ A;  4E6K G;  3OYK A;  4G8X A;  4L5E A;  3BWG A;  1QHH D;  3NWT A;  6PAX A;  3EUH C;  2IA2 A;  2IJL A;  2VT2 A;  1TP4 A;  2MD5 A;  2KPM A;  4LGW A;  1J9I A;  4F91 B;  2QEX I;  2EH3 A;  4XOP A;  3BG9 A;  5HS8 A;  1BOB A;  3DFG A;  2P8T A;  2VQL A;  3J80 K;  5J8C A;  1R58 A;  1YS6 A;  2ECB A;  1ZQ3 P;  2L7M P;  5JFR A;  2K27 A;  2JA8 J;  3V8J A;  3CLQ A;  1VQ4 I;  1EH8 A;  2E35 A;  2N8G A;  1JT0 A;  1CQT A;  4NC6 A;  1Z21 A;  1WKM A;  5DUK A;  5B1A H;  4CCM A;  2XRL A;  2EIL H;  1OR7 C;  4GYI A;  2ISZ A;  1N25 A;  4E4H A;  3KEY A;  5K7H A;  1MH4 A;  5LRS A;  5F1J A;  2QSG X;  2ISY A;  3MVP A;  3L2C A;  4XRM A;  3S3M A;  3ERE D;  1HF0 A;  4OOI A;  1RES A;  3L2R A;  1XSD A;  1IUF A;  1BIB A;  2FOK A;  1MW7 A;  1SD7 A;  3S8P A;  4EGZ A;  4C9Y A;  4Q48 A;  1Q1H A;  1MSE C;  3G1O A;  4Y52 J;  2Z16 A;  2ZSI B;  3S1M J;  2Y31 A;  5ILU A;  1E3H A;  1UZC A;  2TDX A;  1J5Y A;  1GXQ A;  2XGE A;  2FBK A;  3K6G A;  2OTL I;  1B72 A;  2K4J A;  4M6V A;  1H9T A;  1T95 A;  3FMR A;  2WV0 A;  4IQ4 A;  1S5L C;  2DA3 A;  2R7Q A;  2O9L A;  1ZGJ A;  3KET A;  3VPR A;  3LSH A;  1OPC A;  3IAS 2;  3MKY B;  2MD0 A;  2WV1 A;  5GAH J;  2VXZ A;  1QZE A;  3DV8 A;  5IP9 J;  2XAH A;  4IF4 A;  3OSF A;  3HC7 A;  3JSP A;  2HOA A;  4JX4 A;  5ERI A;  2WAF A;  1UHM A;  2K86 A;  3KPH A;  4GGG A;  1JUM A;  2A05 A;  3OYI A;  2VOD A;  3QOP A;  5HLI A;  2DPD A;  1I27 A;  3ECH A;  4NB5 A;  1J59 A;  2BHZ A;  2VE9 A;  2KIU A;  3FK6 A;  3COA C;  1R49 A;  5CKT A;  3K10 A;  3GFL A;  4UVB A;  1B8I B;  1JE8 A;  1T0F C;  3HZJ A;  5FRM A;  3VYS B;  3AG3 H;  5DCM A;  2MLG A;  4MTD A;  5FKN A;  3WU2 C;  1TQP A;  2WC2 A;  2Y69 H;  1ETO A;  2W57 A;  2E1O A;  2DJI A;  3GZ5 A;  1DQU A;  3REO A;  4RB1 A;  4BHB A;  2W48 A;  2NVU B;  3PNV A;  3T8R A;  4DZJ A;  3TW7 A;  1S7A A;  4Y7N J;  1IN5 A;  1H89 C;  3L09 A;  5M5Y J;  4PZJ A;  1FEX A;  4FT8 A;  1R4N B;  3LWF A;  2CO5 A;  5J40 A;  2PX9 A;  3PNY A;  3OSG A;  4XKC A;  3DBH B;  2PMZ N;  5DD8 A;  1Y6I A;  4MQ9 F;  3RSN A;  1R00 A;  3LSP A;  4HDU A;  4RB3 C;  1JGG A;  3HOW J;  2K9L A;  2OZU A;  4HX4 A;  2KP6 A;  3L2Q A;  2HI3 A;  1WI9 A;  1PP7 U;  3EUA A;  4KYW A;  5TRD A;  2BHY A;  3V7R A;  3GTO J;  1Y8R B;  3J81 Z;  4BE1 A;  3KLN A;  4BHC A;  3LST A;  2K5C A;  3CES A;  1XGN A;  1LJ9 A;  2HZD A;  4I76 A;  2ZXH A;  1MNE A;  4M6X A;  4YFX F;  3TED A;  1ON2 A;  3HXL A;  1H9G A;  4WCG A;  3CMY A;  5EF6 A;  3PQK A;  2HXI A;  1N77 A;  3HRU A;  3JRB A;  3K70 D;  3I3L A;  3KP6 A;  1MJ9 A;  5F27 A;  2LY9 A;  3S15 J;  5J6X A;  2VQG A;  3ML6 A;  2Q8K A;  5A2Q Z;  2ZJQ F;  2L9S A;  2XKP A;  3BQY A;  4Y33 A;  5IYC J;  5IYD J;  4IKF A;  3JTH A;  4GO1 A;  2LP0 A;  3CME I;  4RGU A;  2Z33 A;  2K02 A;  2F5C A;  2X6Y A;  3QYE A;  3UKG A;  3H3V K;  2DA2 A;  2O6G E;  1X3Z B;  2AO9 A;  3LSM A;  3A2K A;  3PNT A;  4ASN A;  1XS9 A;  1A36 A;  3H0G J;  4A0Y A;  1KU3 A;  1RET A;  4YRV A;  4J01 A;  3S17 J;  1R23 A;  3DKW A;  4DBR A;  3CDH A;  1YJW I;  1FSE A;  2BBY A;  4DIQ A;  1ZYR F;  4A3J J;  5HOD A;  4B48 A;  2FQ4 A;  3QOE A;  3HPH A;  4P96 A;  3TP3 A;  1EH6 A;  2XUB A;  4DYQ A;  3ZQ7 A;  2JPB A;  5ILV A;  1K4S A;  2JSP A;  4X0G A;  1IF1 A;  1HKQ A;  1Y39 A;  3DTK A;  5FKL A;  2ZB9 A;  2L9N A;  2R5Z B;  3FM3 A;  4KIC A;  2JA5 J;  3GME A;  2QWW A;  1BR1 A;  3ZMZ A;  3GEZ A;  1JJ6 C;  2RC4 A;  1PUF A;  3ABM H;  3WGH A;  3I4P A;  3SZT A;  3E5Q A;  1MMD A;  2VL8 A;  4HA8 A;  1YLF A;  1P6R A;  1D0X A;  2V79 A;  5F64 A;  5LBQ A;  2PN6 A;  2D45 A;  2K9Q A;  4BDZ A;  1YHQ I;  3FKI J;  3HSR A;  3RCO A;  3I55 I;  3FXU A;  1VND A;  2DLL A;  3MKL A;  4IHX A;  4Y15 A;  4M3D A;  3Q3S A;  3FZV A;  4E7H A;  4C3I J;  2GA1 A;  3RPU D;  1P7I A;  3BJO A;  4N4N B;  1Z77 A;  2VXD A;  1IO2 A;  2HTJ A;  2QSF X;  1FTT A;  4RAG A;  1O57 A;  1UEL B;  2FNA A;  3S1R J;  3PIO F;  1WJC A;  3HGY A;  1SFK A;  1IV8 A;  3ZPL A;  4LIT A;  4UUV A;  1IUY A;  3FF5 A;  4WK8 F;  4N9H A;  2RNJ A;  3EPZ A;  4BUP A;  4BBR J;  2L4A A;  5F1R A;  2L54 A;  1A31 A;  3DP7 A;  1ODD A;  1N78 A;  4KIS A;  4CDG A;  2IGN A;  2KJC A;  2QBY A;  2JK3 A;  4LIU A;  3SFZ A;  4BL0 B;  1VQL I;  1FOY A;  5DD4 A;  1KA8 A;  2M0M A;  2W1O A;  1D1B A;  1HCR A;  2R7S A;  1LB2 A;  2HWV A;  5HDK A;  2LMD A;  4HLY A;  4UUT A;  1Z6T A;  3T0Y A;  1IN6 A;  1GV2 A;  1E3P A;  2GXB A;  1Z05 A;  1X58 A;  2XVC A;  3SDB A;  3A0B C;  2EFP A;  1ZG3 A;  4HSR A;  3RDI A;  3K70 C;  2QQA A;  1HBX G;  3CF2 A;  1HDD C;  1R36 A;  4BAY A;  2Q1Z B;  3J80 Z;  4OMY A;  4LJZ F;  2XB0 X;  1VQP I;  1MH3 A;  2LKP A;  3CCQ I;  1YJ9 I;  4QLC U;  2GAU A;  2DK5 A;  4LIV A;  1G6N A;  5AON A;  2CSO A;  4EM2 A;  1O4X A;  1IC8 A;  3BDD A;  3HDD A;  3KLO A;  5D4S A;  2JRM A;  2ZNZ A;  1XPX A;  1RZ4 A;  5D5V B;  3G3Z A;  1W7P B;  5E20 A;  3CCM I;  3I71 A;  3CCJ I;  1D0Z A;  4NC7 A;  1U8R A;  3CC2 I;  1V4R A;  4LB6 B;  1I5Z A;  5CLS A;  4RMN A;  1USS A;  5HDG A;  2DO7 A;  2EPF A;  3BR3 A;  3HYI A;  1Y0U A;  3OYL A;  1CGP A;  3NEU A;  1MBE A;  5HS9 A;  1OKR A;  1TZL A;  5D5U B;  2IS4 A;  4XN3 A;  4CCL A;  4AUX A;  3IWZ A;  4Y13 A;  1G3S A;  5CVI A;  3WOD F;  2M5W A;  4JYK A;  5TJJ A;  2OV7 A;  4FQG A;  4BXF A;  1DPU A;  2EIM H;  2R7T A;  1I3Q J;  5DM7 F;  1BN5 A;  4DNC A;  3S3N A;  1A04 A;  5C4J J;  5LHG A;  3U21 A;  3I64 A;  4EJW A;  2Y9Y A;  5IT9 K;  5ICF A;  2IPQ X;  2LRE A;  4B1R A;  5H6R A;  3J7Y J;  1U5T B;  2R7O A;  3TMO A;  2XAQ A;  4IQJ A;  3HOT A;  2DMP A;  3S93 A;  1IZ1 A;  3CUQ B;  1IXC A;  2KZG A;  4Z6Y A;  3E1S A;  3CCE I;  1O7L A;  1SVM A;  3TO7 A;  4CCK A;  3PSI A;  4I98 B;  1YFH A;  2HDC A;  2WAD A;  1A35 A;  3ZQF A;  3CUO A;  3Q0V A;  2V1N A;  4E7L A;  4PFP A;  4BQO A;  3GX4 X;  1NTC A;  1HXD A;  1HW1 A;  2H09 A;  2RRE A;  4P9U A;  2XV4 S;  3IH4 A;  2ESH A;  4YEL A;  1S72 I;  1Y56 A;  2NOJ B;  3OS1 A;  4Y4R A;  4E7S A;  1YRN A;  1FTZ A;  2LLK A;  1FY7 A;  4B47 A;  1UHW A;  4XLF A;  3QQA A;  4PUS A;  2R5Z A;  3KIO A;  1GVD A;  2M1B A;  4M9S A;  5FLM J;  1WJD A;  2QZ8 A;  2F6C A;  1YO5 C;  2DT7 B;  2FML A;  1G2H A;  1R71 A;  4KDP A;  4XOR A;  4L5I A;  3TDU C;  3AL0 B;  2V6E A;  1PVE A;  4XM3 A;  4XKW A;  4YFN F;  1GHC A;  4OWR B;  2NS0 A;  5E3M A;  3D5L A;  2YU9 J;  2Y2Z A;  1MIJ A;  5F04 A;  4ENK A;  3DWL E;  4PGG A;  5M3F J;  1X19 A;  2JPC A;  3GBG A;  3QP6 A;  2E2H J;  3A01 B;  2KIM A;  2E19 A;  2CJJ A;  3MD2 A;  1YIT I;  1XDU A; 
#chains in the Genus database with same CATH homology
 3ISP A;  4LK0 F;  2F5F A;  2VC1 A;  1MKM A;  4IRI A;  2HEO A;  1YQA A;  2LF7 A;  4RGR A;  4OIQ F;  2XIG A;  2OQG A;  5ICG A;  1IN7 A;  2NRA C;  2NYX A;  1UST A;  4LLG F;  4S05 A;  4KIB A;  1D8J A;  2DU9 A;  4OIP F;  3KP3 A;  1OYI A;  4KIG A;  2R7D A;  4ZYD A;  5DUI A;  2FSW A;  1YIO A;  5ED4 A;  3W6J B;  2VBW A;  2PLY A;  2QQB A;  3HHG A;  4WXH A;  1BI3 A;  2A69 F;  1B1B A;  3SQN A;  1IRG A;  5BOX A;  2CWE A;  3BJA A;  1XN7 A;  1Z91 A;  1PDN C;  3DQV C;  1JXS A;  2A3S A;  1UFM A;  1ON1 A;  3IRR A;  1DP7 P;  1KU2 A;  2X0L A;  5DV5 A;  3HTU A;  3JAM Z;  1W5T A;  2EA2 A;  2P5L C;  3MZY A;  1SMY F;  3J7A O;  3I5U A;  4A0X A;  3O6B B;  2HQN A;  4EJO A;  3K1P A;  4ZYE A;  5EEH A;  5L3B A;  4ZZD A;  1LDJ A;  4R1H A;  1MDM B;  2BEO A;  3KFW X;  5FLX Z;  1I6X A;  3TOA A;  2HTS A;  3H92 A;  3LA3 A;  2R7F A;  4IRG A;  5FFZ A;  2FMY A;  1U2W A;  1JHH A;  1NHA A;  5HS7 A;  1TNS A;  1KYZ A;  3GLX A;  4XLN F;  1O7F A;  2QVO A;  5BS6 A;  3F3X A;  1HW2 A;  2HOE A;  5D6F A;  5KVR A;  4UV8 A;  2GQQ A;  3CJN A;  1RIO H;  5CYV A;  1K6O A;  1ZRF A;  2IT0 A;  1ZRE A;  2HKO A;  3SHF A;  5K5O A;  4U0V A;  3FX3 A;  2COM A;  2LF8 A;  3BP8 A;  5IT9 Z;  2STT A;  4D0P A;  3GFM A;  3KZZ A;  1R7J A;  2WWY A;  4MHG A;  1Z1D A;  1OYY A;  3H3Z A;  3C18 A;  2LDU A;  3QPT A;  1WWX A;  2M87 A;  3BJ6 A;  2O03 A;  3T5X A;  5HLG A;  3BY6 A;  1GVJ A;  4UV9 A;  1K79 A;  5D6E A;  3RI4 A;  2YPR A;  1IN8 A;  4P55 A;  2CW0 F;  3LQQ A;  3V4G A;  3ECO A;  3LQR A;  1XGM A;  1FPQ A;  2YX7 A;  4U0Y A;  3WGG A;  1YW9 A;  2XAS A;  4LB5 A;  2ETH A;  2G7H A;  3R0A A;  3Q5F A;  2M30 A;  4LG0 A;  2PBI A;  3HIF A;  3ZN0 A;  2V1X A;  5JHU A;  2ZBK A;  4EJU A;  4EM1 A;  3GF2 A;  4U88 A;  3ZMT A;  2QLZ A;  5LGN A;  3K69 A;  1F9N A;  4QWQ A;  2EV6 A;  1FYL A;  4K2E A;  3SXY A;  3LAP A;  4ETS A;  1TQI A;  3M9A A;  3B02 A;  1RI7 A;  1XSX A;  4R8H A;  1G3T A;  3DPT A;  3MEX A;  3HTS B;  2H27 A;  4WX9 A;  3ZMD A;  2C6Y A;  1Z6R A;  1E17 A;  4MQV A;  1BOA A;  4GCV A;  2F5D A;  1XGS A;  1QGP A;  1FBU A;  2Z5U A;  3CO6 C;  5BMZ A;  1HSJ A;  2ZME B;  2Y48 A;  3Q9S A;  3BPX A;  4KUM A;  3L9F A;  1J7K A;  1EH7 A;  2GXG A;  1K78 B;  3V7S A;  2QQ9 A;  4CO8 A;  4HQM A;  4RAY A;  3M7G A;  3E3V A;  4EMS A;  1SD5 A;  3F8N A;  3KP5 A;  3QP5 A;  5JVT A;  2DK8 A;  5K1Y A;  2VBX A;  4KA4 A;  5LRR A;  4G9Y A;  4FX4 A;  2DQL A;  1EV7 A;  4ENN A;  2P7C B;  1FP2 A;  4HOB A;  4RAZ A;  3FMQ A;  3DF8 A;  3LA2 A;  5JI6 A;  3KE2 A;  1FSH A;  4PCQ A;  1ZAO A;  4ENM A;  2L3D A;  3HRT A;  4IXA A;  1YW8 A;  1WQ2 A;  2DFI A;  2EV5 A;  4HQE A;  1TTY A;  2FQ3 A;  4O6J A;  4A12 A;  3N4M A;  1O3R A;  2ZCW A;  3KEO A;  3K9T A;  1XCB A;  4BQA A;  2P6S A;  2DAO A;  3E6B A;  3V8L A;  3JAM K;  3AAF A;  2CGP A;  3GW2 A;  1KU7 A;  2Z9O A;  2PMH A;  3F8C A;  2MA3 A;  2W85 A;  2ESN A;  2GIV A;  3FHZ A;  2DPU A;  1B4A A;  3JTG A;  4HV6 A;  5D8L B;  1AOY A;  2DTR A;  4AIK A;  4MEX F;  1SFE A;  2DQR A;  1LDD A;  2HQR A;  4M9Z A;  3WTV C;  2HKX A;  2PEX A;  2JRT A;  1RUN A;  3GYH X;  2P7V B;  2V1D A;  5FLX K;  3GZ6 A;  2VBY A;  4I01 A;  2NNN A;  2V6C A;  2DW4 A;  3NRV A;  2XRO A;  4RGX A;  3HSE A;  3F6O A;  1R1V A;  4I7H A;  3EYI A;  2EB7 A;  3E6C C;  1MZB A;  1XCV A;  4KFC A;  4UNO A;  2MH2 A;  1BIA A;  4L0Z B;  4A6E A;  3OOP A;  3F72 A;  2M45 A;  2E1C A;  2G7U A;  3F8F A;  2ZO4 A;  3IKT A;  3CLO A;  1KQ0 A;  4RS8 A;  3IHU A;  3JW4 A;  2JT1 A;  4XLP F;  4BH9 A;  4ESF A;  4ZH4 F;  4YFK F;  2RQP A;  1TW3 A;  1IN4 A;  3DXJ F;  4HF2 A;  4Q5S F;  1ZGA A;  4M9X A;  5FO5 A;  3ZMU A;  2PFB A;  1FYM A;  1LVA A;  5CVV A;  4EQQ A;  1T39 A;  1R5H A;  2L4M A;  2A68 F;  3GFI A;  2YX4 A;  4G7H F;  3WE2 A;  2A61 A;  2MLK A;  1FOK A;  1IXS B;  4M73 A;  3P9C A;  3I59 B;  4FX0 A;  5L3E A;  4EJT A;  1R22 A;  4EV0 A;  2YSR A;  1X3U A;  2IP2 A;  5BPD A;  3E5U A;  3P9I A;  4KMF A;  3HSF A;  1CF7 B;  3H3U A;  4L0Y B;  2ZJ2 A;  3WTY C;  4Q47 A;  3FXR A;  3IKV A;  1O3S A;  1TLH B;  2L01 A;  2CFX A;  1XSV A;  1BBY A;  1T38 A;  4Y17 A;  3OV8 A;  3K1N A;  4IVN A;  2PQ8 A;  1T2K A;  3LA7 A;  4CHU A;  2A5Y B;  4TV7 A;  4XBF A;  2A6H F;  3KP7 A;  4MEY F;  2FU4 A;  4ON0 A;  2RKH A;  1BI2 A;  1E2X A;  1FLI A;  1MGT A;  1HW5 A;  4BHP A;  4JQF A;  3RPQ A;  1G4D A;  1FX7 A;  3ROU A;  5ILS A;  5E8I A;  1F4K A;  1D3Y A;  2O0Y A;  1LQ1 A;  4L9V A;  1S8N A;  2CQK A;  1S3J A;  1H0M A;  2FEZ A;  2XGX A;  2UWM A;  4LD5 A;  2Q0O A;  4MNU A;  3BOQ A;  4UHT A;  2VOO A;  2EFW A;  2UXN A;  2VC0 A;  4IPA A;  2EJR A;  3K2Z A;  1W7P A;  2OBP A;  3GVA A;  2EV0 A;  1SAX A;  4M74 A;  1HKS A;  2X4H A;  1SFX A;  1FWZ A;  4HDV A;  3JSO A;  1LNW A;  4I09 A;  2JSC A;  4XRF A;  4YIF A;  3F23 A;  5H20 A;  4OMZ A;  4A5M A;  2HZT A;  5F6F A;  3C7J A;  3WTW C;  2O61 A;  3GWZ A;  5DCM B;  4AD9 A;  1TBX A;  1ZN2 A;  1DUX C;  3I58 A;  4JBA A;  5HOO A;  4HX7 A;  3I0T A;  1B59 A;  1QZZ A;  2RDP A;  3RIR A;  1YG2 A;  3SZP A;  4XSX F;  2Y0M A;  1U5T A;  1AWC A;  3CUQ A;  3FM5 A;  4CYD A;  3WTZ A;  1QZY A;  2NAZ A;  1PP8 F;  1FBQ A;  2LNB A;  1WSU A;  4A2U A;  2VT3 A;  5LHI A;  1JHF A;  1ZG5 A;  2FBI A;  4KT5 C;  3E5X A;  3EUH A;  1L0O C;  1WRJ A;  4KNY A;  3I59 A;  3R6S A;  1P2F A;  2MC3 A;  2P4W A;  3QRF F;  3TQN A;  4G6D A;  4E70 A;  3EDP A;  1FYK A;  3QPH A;  3Q9V A;  2PG4 A;  5FFX A;  5BQT A;  2D2W A;  1R1U A;  2V1U A;  4HW0 A;  1DPR A;  2OA4 A;  5KK1 A;  4RB2 C;  4CGZ A;  4U7D A;  1OR7 A;  3KP2 A;  1F1Z A;  5DYM A;  3ELK A;  4P9F A;  3LAJ A;  4BXU A;  1FP1 D;  2ZNY A;  3T1B A;  3F21 A;  3EQL F;  3RJP A;  4F7Z A;  2E1N A;  5LHH A;  3PQJ A;  4UVC A;  5LEJ A;  1FBS A;  1P4A A;  5HVQ C;  4JK1 X;  3D0S A;  4WF2 A;  1I1S A;  2IVM A;  1VTN C;  4WWC A;  1T98 A;  1HQC A;  3WTX C;  5D5W B;  1J2X A;  1FT9 A;  4UVA A;  2BV6 A;  4BYY A;  2DI3 A;  4H0E A;  2J5O A;  2VN2 A;  1GXP A;  3V8K A;  4A6D A;  4O3M A;  3WG9 A;  4MTE A;  3ABU A;  1T0F A;  3VEP A;  1TW2 A;  4YII A;  1BJA A;  2ZKZ A;  4M71 A;  2CG4 A;  5L3D A;  1KQ8 A;  3VFZ A;  4ZYG A;  1MJA A;  1P4W A;  1P92 A;  1XMK A;  1SMT A;  2EFN A;  1XGO A;  3RYR A;  4R79 A;  2XKO A;  1RUO A;  1ULY A;  2RVC A;  1I1G A;  3S2W A;  2HFH A;  1ZAR A;  3WE3 A;  1KGS A;  2H6B A;  2QBY B;  1SD4 A;  3ZMV A;  5LEK A;  3RKW A;  4DQ2 A;  4N0B A;  1MD0 A;  4ZZL A;  3WTS C;  3G73 A;  2F2E A;  2A6E F;  2PMU A;  3BZ6 A;  5CVR A;  4I0B A;  4CIC A;  2OU2 A;  4EM0 B;  2BE5 F;  2G9W A;  2O3F A;  4KN7 X;  1W5S A;  1IAW A;  5FD5 A;  4ESJ A;  1IW7 F;  1QNT A;  3WU1 B;  5DEQ A;  3WGI A;  1QPM A;  4I0A A;  4HLX A;  4LLL A;  3E6M A;  4Q4Z F;  1ZLJ A;  1MDM A;  2HS5 A;  1JGS A;  1ONV A;  3VOE A;  5D8K B;  3F22 A;  3KEQ A;  3ABT A;  2FF4 A;  3KP4 A;  3C3W A;  1ZG1 A;  3HHH A;  1ZHF A;  4KN4 X;  1B6A A;  3GFJ A;  3FMS A;  4EGY A;  3K1M A;  1OYW A;  2VE8 A;  2ELH A;  1S7O A;  4CZZ A;  2LSO A;  2ACJ A;  4Z2Y A;  1G3W A;  4KIF A;  5E1W A;  2XHK A;  2EK5 A;  3TOB A;  1P4X A;  1SFU A;  2YR2 A;  1DDN A;  2EA4 A;  1W4M A;  2IA1 A;  2FRH A;  4S04 A;  2D1V A;  3HOS A;  3QAH A;  5FGM A;  4AWX B;  2STW A;  4EVI A;  2ZFW A;  2P6T A;  2AXL A;  3FWE A;  3ZN1 A;  2QM3 A;  2XAG A;  1MJB A;  1FNN A;  3RTR A;  4L9J A;  4HX8 A;  3RKY A;  1STZ A;  5IT3 A;  1C0W A;  1B9M A;  3ZMS A;  1XMA A;  3NQO A;  2P5K A;  4HYE A;  5LLQ A;  3TGN A;  2MBF A;  2HYF A;  3E6D A;  2L02 A;  4GYG A;  2M8E A;  1TNT A;  2UZK A;  1U78 A;  2R3S A;  1YTY A;  5FD6 A;  5CVU A;  2BYV E;  2FE3 A;  2NNY A;  4L5J A;  3DPL C;  2EWN A;  1J0R A;  5DCF A;  3M8E A;  1ZRC A;  1FZP B;  5HLH A;  1B9N A;  5E17 F;  3P9K A;  1XB4 A;  1Z7U A;  3ZP5 A;  1QO0 D;  5AIQ A;  4KMU X;  3DEU A;  3MFK A;  1S6L A;  2W25 A;  4CXF A;  1XD7 A;  3U9G A;  3IRQ A;  2DBB A;  1BC7 C;  4YG2 F;  1KYW A;  5LGU A;  1R1T A;  4AIJ A;  1HKT A;  2VBZ A;  4P5O A;  2FA5 A;  2BGC A;  5L3F A;  4I02 A;  5AIP A;  4NQW A;  3TO6 A;  3HUG A;  4LFU A;  2CYY A;  5HDN A;  1S29 A;  4HAM A;  3T8T A;  1D8K A;  2FBH A;  3CTA A;  3HRM A;  2GA2 A;  4LMY A;  3KZY A;  4HF1 A;  2K7L A;  2XRN A;  3O2P E;  5BPI A;  5EEG A;  1IRF A;  2HYG D;  3RPU A;  2ZME A;  2XAF A;  5E1Z B;  2JZY A;  2F5E A;  2MH9 A;  4HV5 A;  1K7A A;  1K78 A;  3ULQ B;  2KJB A;  3WTU C;  3F6V A;  3F8M A;  1UCR A;  4WXD A;  1ZLK A;  1FC3 A;  1QBJ A;  4RGS A;  4UXN A;  3GXO A;  4L9N A;  2GWR A;  1D5V A;  3MZH A;  2E7W A;  3LFK A;  4HZF A;  3R60 A;  4MGR A;  4HBL A;  2H94 A;  3PFI A;  3VOD A;  3MWM A;  4A0Z A;  4G6Q A;  3MQ0 A;  1HST A;  2OAZ A;  2P5V A;  3BRO A;  4O5V A;  1KU9 A;  2VOP A;  2RV8 A;  2W84 A;  2IA0 A;  3KCC A;  5J8F A;  3K0L A;  2A07 F;  4L9T A;  5D4R A;  1LDK B;  2RGV A;  1PUE E;  3TO9 A;  1W7P D;  3QU3 A;  1REP C;  4OIR F;  5E18 F;  3IWF A;  3RYP A;  3IL2 A;  1YW7 A;  3R0J A;  3QU6 A;  3W6K B;  1F5T A;  1TQM A;  3L7W A;  2VON A;  4N9I A;  3F8B A;  3R61 A;  4OIN F;  2PI0 A;  2D1H A;  4U0W A;  2J5P A;  3RKX A;  4AVP A;  4M6Y A;  4IHT A;  1YYV A;  1LEB A;  4RB0 A;  3WU0 A;  5D5X B;  3EYY A;  2O8X A;  4NHJ A;  4ENJ A;  3GO5 A;  3P7N A;  3BPV A;  2JTV A;  2FNP A;  2OD5 A;  5L3G A;  1Z9C A;  1V3F A;  3R4K A;  1L3L A;  1YS7 A;  3N97 A;  3E97 A;  4OU0 A;  5CVJ A;  2B0L A;  4I2O A;  2KKO A;  2UXX A;  3J81 K;  1U6G A;  2HGC A;  2DT5 A;  4AIH A;  4WXC A;  1U3E M;  4M72 A;  2IW5 A;  2OZ6 A;  2ZXJ A;  2E7X A;  2Q2E A;  2RN7 A;  4LG0 B;  2Z99 A;  2QUF A;  3U1D A;  1J75 A;  5K5R A;  4B09 A;  2H6C A;  3M8F A;  4LK1 F;  5ICC A;  5A2Q K;  3IC7 A;  4PGH A;  5DDG A;  1OMI A;  4G7O F;  3I53 A;  4IRH A;  2Z3Y A;  2GZW A;  1ZH5 A;  1BI1 A;  2V9V A;  3MCZ A;  4LLN A;  4IJA A;  1UB9 A;  2ADU A;  2K4B A;  4ESB A;  4FHT A;  4PDK A;  3FXQ A;  2IRF G;  1SD6 A;  3B73 A;  4EJV A;  1RNL A;  1BM9 A;  3WTT C;  3GUD A;  5CJ9 A;  4ZYH A;  5E8G A;  2KIF A;  2EFO A;  1T6S A;  5ICE A;  1XDS A;  4BNC A;  3L00 A;  5JR3 A;  3TKY A;  3U2R A;  4HF0 A;  3CO7 C;  2QYO A;  2HR3 A;  3TDZ C;  1BC8 C;  2FXA A;  3V7C A;  2XAJ A;  3C1D A;  3VB2 A;  1IXR C;  2AS5 F;  1KQ9 A;  1G3Y A;  1O3T A;  3M1E A;  2W24 A;  1ZRD A;  1LEA A;  3MAJ A;  4B8X A;  2EFQ A;  5E1X A;  4L18 B;  4A5N A;  4U7B A;  2KRF A;  4OIO F;  1O3Q A;  3O3K A;  2QEN A;  4GXO A;  1CF7 A;  4G7Z F;  2PJP A;  5K5Q A;  3HRS A;  1U5T C;  5H6Q A;  4G94 A;  3CUQ C;  4XSZ F;  3EET A;  2YU3 A;  5LGT A;  1BI0 A;  2OQR A;  2WTE A;  2Y75 A;  1QQI A;  4IHS A;  3I54 A;  1R5G A;  5L3C A;  5FB2 A;  4G8X A;  3BWG A;  6PAX A;  2IA2 A;  2IJL A;  2VT2 A;  2MD5 A;  4LGW A;  1J9I A;  5HS8 A;  3DFG A;  2P8T A;  3J80 K;  5J8C A;  1R58 A;  1YS6 A;  5JFR A;  2K27 A;  3V8J A;  1EH8 A;  1WKM A;  5DUK A;  4GYI A;  2ISZ A;  5LRS A;  2ISY A;  3L2C A;  3ERE D;  4OOI A;  1XSD A;  2FOK A;  1BIB A;  1SD7 A;  4EGZ A;  4Q48 A;  1Q1H A;  5ILU A;  2TDX A;  1J5Y A;  1GXQ A;  2FBK A;  2K4J A;  1H9T A;  3FMR A;  2WV0 A;  1ZGJ A;  3KET A;  1OPC A;  2VXZ A;  3DV8 A;  2XAH A;  4IF4 A;  3JSP A;  5ERI A;  1UHM A;  2K86 A;  4GGG A;  2VOD A;  3QOP A;  5HLI A;  2DPD A;  1I27 A;  3ECH A;  4NB5 A;  1J59 A;  2VE9 A;  2KIU A;  3COA C;  4UVB A;  3GFL A;  1JE8 A;  5DCM A;  2MLG A;  4MTD A;  1TQP A;  2WC2 A;  2W57 A;  3GZ5 A;  3REO A;  4RB1 A;  4BHB A;  3T8R A;  1S7A A;  1IN5 A;  3L09 A;  4PZJ A;  4FT8 A;  3LWF A;  2CO5 A;  5DD8 A;  4MQ9 F;  4HDU A;  1R00 A;  4RB3 C;  2OZU A;  4HX4 A;  1WI9 A;  1PP7 U;  4KYW A;  5TRD A;  3V7R A;  3J81 Z;  3KLN A;  4BHC A;  3LST A;  1XGN A;  1LJ9 A;  4M6X A;  4YFX F;  1ON2 A;  1H9G A;  4WCG A;  3PQK A;  3HRU A;  3KP6 A;  1MJ9 A;  5J6X A;  3ML6 A;  2Q8K A;  5A2Q Z;  2XKP A;  3JTH A;  4GO1 A;  4RGU A;  2Z33 A;  2K02 A;  2F5C A;  2O6G E;  4ASN A;  4A0Y A;  1KU3 A;  1R23 A;  3DKW A;  3CDH A;  1FSE A;  2BBY A;  1ZYR F;  4P96 A;  1EH6 A;  2XUB A;  3ZQ7 A;  2JPB A;  5ILV A;  1IF1 A;  1HKQ A;  3FM3 A;  4KIC A;  2QWW A;  3ZMZ A;  3GEZ A;  2RC4 A;  3WGH A;  3I4P A;  3SZT A;  3E5Q A;  4HA8 A;  1YLF A;  1P6R A;  5F64 A;  2V79 A;  5LBQ A;  2PN6 A;  2D45 A;  3HSR A;  3FXU A;  2DLL A;  4Y15 A;  3FZV A;  2GA1 A;  3BJO A;  2HTJ A;  1O57 A;  2FNA A;  3ZPL A;  4UUV A;  1IUY A;  3FF5 A;  4WK8 F;  4N9H A;  2RNJ A;  2L4A A;  5F1R A;  2L54 A;  3DP7 A;  1ODD A;  4CDG A;  2KJC A;  2QBY A;  3SFZ A;  5DD4 A;  1KA8 A;  1LB2 A;  2HWV A;  5HDK A;  4HLY A;  3T0Y A;  1Z6T A;  1IN6 A;  2GXB A;  1Z05 A;  2XVC A;  2EFP A;  1ZG3 A;  3RDI A;  2QQA A;  1HBX G;  1R36 A;  4BAY A;  3J80 Z;  4OMY A;  4LJZ F;  2LKP A;  4QLC U;  2GAU A;  2DK5 A;  1G6N A;  5AON A;  2CSO A;  4EM2 A;  3BDD A;  3KLO A;  5D4S A;  2ZNZ A;  1RZ4 A;  5D5V B;  3G3Z A;  1W7P B;  5E20 A;  3I71 A;  1U8R A;  1V4R A;  4LB6 B;  1I5Z A;  5CLS A;  1USS A;  5HDG A;  2DO7 A;  3HYI A;  1Y0U A;  1CGP A;  3NEU A;  5HS9 A;  1OKR A;  5D5U B;  3IWZ A;  4Y13 A;  1G3S A;  5CVI A;  3WOD F;  2M5W A;  5TJJ A;  1DPU A;  1BN5 A;  4DNC A;  1A04 A;  5LHG A;  3I64 A;  4EJW A;  5IT9 K;  5ICF A;  2IPQ X;  5H6R A;  1U5T B;  2XAQ A;  3HOT A;  1IZ1 A;  3CUQ B;  1IXC A;  1O7L A;  3TO7 A;  4I98 B;  1YFH A;  2HDC A;  3CUO A;  3GX4 X;  1HXD A;  1HW1 A;  2H09 A;  4P9U A;  2XV4 S;  2ESH A;  1FY7 A;  1UHW A;  2M1B A;  4M9S A;  2QZ8 A;  1YO5 C;  2FML A;  4KDP A;  4L5I A;  3TDU C;  4YFN F;  1GHC A;  2NS0 A;  3D5L A;  4ENK A;  4PGG A;  2JPC A;  3QP6 A;  2KIM A;  1XDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...