3F8FA

Crystal structure of multidrug binding transcriptional regulator lmrr complexed with daunomycin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
114
Chain Sequence
MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDEGGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PadR-like family
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
total genus 41
structure length 114
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8fA00
3HHHA 1ZAOA 4OIRF 1EV7A 4LK0F 3KCCA 4MTEA 4EM2A 1Z9CA 1LEBA 1DP7P 5IT9K 3REOA 4N0BA 5E1ZB 4RGUA 5K1YA 4FT8A 4RGSA 1FWZA 2CYYA 3IHUA 1EH8A 1L3LA 1DDNA 5JHUA 2ACJA 2ZKZA 1R7JA 3L00A 3FMQA 2DQLA 2D1HA 2PEXA 4KT5C 5HLIA 5ERIA 1P2FA 4AVPA 2RGVA 2D1VA 2LF7A 2FBKA 2NAZA 1D8KA 4RB0A 1ONVA 4OMYA 3WG9A 2Q8KA 1LDJA 2JZYA 2ZO4A 3QP5A 2QQ9A 4DQ2A 3CJNA 2EK5A 2M45A 5L3DA 4ESFA 2VE9A 2ETHA 2QVOA 4OOIA 2W25A 1UHWA 5DEQA 1G3SA 3CUOA 4WF2A 3RYPA 1WKMA 2ELHA 2OZ6A 1KQ9A 1ZGJA 4UNOA 2FQ3A 1BIBA 1R36A 5BS6A 2VT3A 5JI6A 1RUNA 3K1PA 2GXBA 4ENKA 1MZBA 1U78A 2V6CA 1S29A 2HQRA 2XIGA 3WTXC 2FRHA 2GZWA 2PQ8A 3QRFF 2EB7A 2NRAC 6PAXA 3RPUA 2OQRA 3I5UA 3KEQA 4WXHA 2OBPA 3SQNA 4MNUA 1ZHFA 1FOKA 2ZNZA 2MH2A 2KJBA 2G9WA 3HTUA 4ENMA 1B1BA 2L02A 3GEZA 3P9CA 1P4WA 1XDUA 5ILSA 2D2WA 3I64A 4PGHA 1R58A 3OOPA 4G94A 1HXDA 2K02A 3ABUA 4YFNF 4KUMA 3BOQA 3E5QA 4L0ZB 2DPDA 1E2XA 2MD5A 2L01A 4WWCA 4HF0A 5E8GA 3J81K 2GXGA 4K2EA 2LDUA 4ZYEA 3KP3A 3WGIA 2BBYA 4O6JA 5KK1A 5LRSA 1Z05A 3K1MA 4CICA 1TW3A 2HEOA 1XSXA 3HTSB 4OIOF 1UB9A 3DEUA 2XAFA 4UUVA 2NS0A 1YW8A 3DPTA 3LA7A 4B09A 4GCVA 1FP1D 1F4KA 2VC0A 1C0WA 4OU0A 4KMUX 3TO7A 3F3XA 1U8RA 3HRUA 4UVAA 3IWZA 2A6EF 3CTAA 5K5RA 4KIFA 1JGSA 2Y75A 2HZTA 1ZRDA 3MAJA 2GA2A 5LEKA 2OQGA 1Z91A 2UZKA 4M71A 4P96A 2R7DA 2Y0MA 3KE2A 1I1SA 3F72A 2HYFA 1KGSA 2FBHA 1R1UA 2JPBA 3J7AO 3LA2A 1ZG1A 1I27A 4CGZA 3WU0A 2ZMEB 4ESJA 4Q5SF 3K9TA 2GAUA 3ZMTA 2KIMA 3P7NA 2R3SA 1YG2A 2VONA 3D5LA 1Q1HA 3O2PE 2Q0OA 3LAJA 1O3QA 5HDKA 2DTRA 3HRSA 4HQEA 1JHFA 1WWXA 4MHGA 4HF2A 3AAFA 3BWGA 4JK1X 5ICFA 3MZHA 2VXZA 4ZYGA 1X3UA 5LHIA 3QU6A 4XRFA 2CO5A 2KRFA 1FZPB 2VOPA 5BPDA 2P5VA 3BPXA 5FB2A 4QLCU 4RGRA 2O0YA 1ZRCA 4ZZDA 4Q4ZF 4I2OA 5JFRA 5F1RA 3VOEA 1H9TA 1ODDA 1BM9A 5J8CA 3SZTA 3EYIA 2PMUA 1MJAA 1I6XA 1BIAA 1UCRA 5FGMA 5DD8A 1YS7A 3OV8A 1BN5A 1DUXC 2MLKA 1TQMA 3R61A 2VODA 4ZZLA 1A04A 1UFMA 2O6GE 5JR3A 2WV0A 3F6VA 1OYYA 3KFWX 2ISYA 5ILVA 2FNPA 3HOTA 1MJ9A 1U5TB 3JW4A 3QPTA 4KN7X 1T39A 4ZH4F 3WTSC 2DLLA 4KIBA 3WTUC 1O3SA 2O8XA 2MC3A 3F8BA 2MH9A 1J2XA 2ZMEA 3SFZA 2HKXA 2Q2EA 2HTJA 3HOSA 5AIQA 5ICCA 3JTGA 3N97A 1B9NA 1LDKB 2A5YB 5LGTA 1U5TC 4L9NA 3F8FA 1JXSA 3GZ6A 2A3SA 3KP2A 3RI4A 4RB3C 1XCBA 2RV8A 2VC1A 4IHTA 1LEAA 5BQTA 2CWEA 1OYIA 3GF2A 4HZFA 4Y17A 5L3GA 1O3RA 3M8EA 1BI1A 3ISPA 3BPVA 4CO8A 2DK8A 2QLZA 4G9YA 2QZ8A 4AD9A 1FBSA 5D5VB 1BC8C 2FSWA 5ICEA 4OIQF 2XAJA 4HV6A 3WTVC 3U9GA 4BYYA 2QQBA 1K6OA 2HFHA 3E6BA 3TOBA 2FMYA 2STTA 1IRGA 3L09A 4O3MA 1OMIA 3ZP5A 2QYOA 3DXJF 4A12A 2HQNA 1XSVA 1QQIA 4IRHA 3ERED 2G7HA 2V1UA 1ZGAA 2HKOA 1DPUA 3V8JA 2VT2A 3O6BB 2DPUA 1U5TA 3GYHX 4WXDA 4MEYF 2M1BA 4R79A 1ZLJA 3TKYA 1T98A 4BNCA 2Z3YA 3LA3A 4LLNA 3NRVA 3FMRA 3IKTA 5CVJA 5IT9Z 2D45A 4IRIA 2A6HF 3VB2A 2ZJ2A 3TO6A 3EUHA 2A07F 3TGNA 4U88A 2ZNYA 5HLHA 1BI0A 3RKWA 3L9FA 4GO1A 2LNBA 1XMAA 4OIPF 2RNJA 3SHFA 3WE3A 1K7AA 5HS9A 2YX7A 3E6MA 3KEOA 4CDGA 2BV6A 5FD5A 3F23A 2NYXA 1T38A 1B6AA 5DD4A 5L3BA 1QGPA 2DO7A 4YFXF 1U2WA 5BMZA 2P7VB 1D3YA 1G6NA 3ZN0A 4YG2F 5DUIA 4A6DA 3GW2A 4LK1F 1NHAA 2X0LA 2Z33A 2RVCA 2FF4A 3FHZA 4WK8F 4HX4A 2VBZA 1KA8A 5E17F 4Q47A 4A2UA 2DK5A 5IT3A 2XAQA 4HOBA 2L54A 1QNTA 3QOPA 1YYVA 4XLPF 1RNLA 4HYEA 3I71A 3WGHA 5A2QK 4ON0A 1H9GA 3MEXA 5DUKA 1XD7A 2HS5A 2W84A 3JSPA 1KU3A 3GFJA 4NQWA 4U7BA 2ESHA 3F8CA 5LRRA 3ULQB 4L18B 5LHHA 4UVBA 1QBJA 2P6SA 1KYWA 4R8HA 3HSRA 1GHCA 2HDCA 3K0LA 1O3TA 4OMZA 3ZMVA 2ADUA 3ECHA 2ISZA 1ZG3A 2EFOA 4L9VA 2O03A 4HX8A 3PQKA 3C1DA 2L4AA 1IN7A 2J5PA 2OZUA 2M8EA 4A5NA 2KIUA 4O5VA 1CF7A 3F21A 2LKPA 2F5FA 1YIOA 4IXAA 1F5TA 1PP8F 4UVCA 1BJAA 4KIGA 2VN2A 3J81Z 3G73A 2RKHA 4EGZA 3ECOA 4MQ9F 3EQLF 4CXFA 1I1GA 3E97A 3DPLC 3SZPA 3V8LA 2EJRA 2JSCA 5LGNA 4RAYA 3E5XA 4IVNA 3GFLA 3LWFA 1F1ZA 2GA1A 4UXNA 3TQNA 1XGOA 1FYKA 1I5ZA 1V4RA 3RDIA 2YX4A 3C18A 5TRDA 1R1TA 2B0LA 4R1HA 2M5WA 3GXOA 4F7ZA 4ZYHA 1W5SA 1V3FA 4ASNA 2IJLA 2IW5A 2ZCWA 2QQAA 3LAPA 4S05A 1IF1A 1J9IA 3M1EA 2IT0A 5FFZA 5DCMB 5D8KB 1XN7A 2EFWA 2FE3A 2K86A 3R0JA 3KETA 2VE8A 3COAC 4XSZF 5HDGA 3WTTC 1RIOH 3Q9SA 3BZ6A 3T1BA 4BH9A 1STZA 3TDUC 2F2EA 4BHCA 3W6KB 1SFXA 2IPQX 3WTYC 3B02A 1FT9A 4WCGA 1DPRA 5FFXA 1XDSA 2PLYA 2YR2A 4L5IA 4BQAA 3E5UA 2HTSA 3GUDA 3MQ0A 3HRTA 1KU2A 1YFHA 4OINF 2EWNA 2M87A 1S7OA 1SFUA 4N9HA 2H6CA 2UXXA 5HVQC 4ENJA 3BROA 5ICGA 5JVTA 2OU2A 4EMSA 1SMTA 5E18F 2VBYA 1LVAA 1TTYA 3WGGA 3HSFA 4G7HF 1YQAA 1GXQA 5DCFA 1REPC 3FM5A 4BXUA 5J6XA 4KN4X 1HW2A 2KIFA 1PP7U 1HSJA 3QP6A 2IA2A 2V79A 5J8FA 1MDMA 4M6XA 4YIIA 2PMHA 1S6LA 5D5UB 2YPRA 3S2WA 3I54A 2Z99A 1CGPA 2K7LA 2YU3A 3K2ZA 4PCQA 2DQRA 1KU9A 3ELKA 2MA3A 1IXCA 2O61A 1P4AA 1P4XA 5DCMA 3I59B 4QWQA 2BYVE 2OAZA 2BE5F 2XGXA 4HF1A 2QENA 1P92A 4AIHA 3J80K 1Z7UA 1W5TA 3KLOA 4G6DA 2KKOA 1F9NA 4HLYA 1T0FA 1BI3A 3V4GA 1S3JA 5D5XB 1OPCA 4Q48A 4P9UA 4M74A 4A0YA 2CSOA 1BBYA 1YW7A 2CQKA 4EJUA 2C6YA 2AXLA 4LJZF 3I0TA 1Z6RA 4M9ZA 1XGMA 1B59A 1R22A 2CW0F 4HDUA 4Y13A 3IC7A 5D6EA 5BOXA 5FO5A 1TLHB 5TJJA 3F8NA 4A5MA 2KJCA 3VFZA 3JSOA 5D4RA 1KU7A 1MKMA 1WI9A 3CO7C 1O7LA 5CYVA 1OYWA 1AOYA 3FX3A 4YIFA 5K5OA 3HYIA 4CYDA 3P9KA 4P9FA 2P8TA 4I98B 1AWCA 4RGXA 3M8FA 1IN5A 4NHJA 4A0XA 1MGTA 2A68F 3LQQA 1W7PA 4M73A 3RPQA 1G3YA 3DQVC 3FMSA 4LB5A 4AIKA 5CVUA 5ILUA 1TQIA 4U0WA 3T8RA 5F6FA 3RKXA 2RN7A 3KP4A 1ZYRF 3I59A 2YSRA 2F5DA 1SMYF 4CZZA 5H6QA 1USTA 2O3FA 5DYMA 2FMLA 2XKOA 2PN6A 2VOOA 2IA1A 4IPAA 2DT5A 4KA4A 2ZXJA 3T8TA 4I0BA 1O57A 1XGNA 2IA0A 2DI3A 2CG4A 4UHTA 2FNAA 1FSHA 4U0YA 3K1NA 4EJOA 3IRQA 1E17A 1R5GA 3ZMUA 1HKTA 4B8XA 5LLQA 2Y48A 3V7SA 1IZ1A 1KYZA 1Z6TA 1B4AA 3QU3A 1XSDA 1R1VA 1ZARA 5KVRA 2MLGA 3C7JA 4M72A 5FLXK 5LGUA 4MQVA 5L3EA 5HLGA 2DAOA 3T5XA 3IWFA 2XASA 1IN4A 3FF5A 3MZYA 1KQ8A 2QUFA 1U6GA 1FYMA 3ZN1A 4PGGA 5E20A 1TBXA 4LB6B 1CF7B 2BGCA 4WXCA 1LB2A 1TNSA 2XUBA 1YS6A 2XHKA 2JTVA 4HV5A 2PFBA 3EDPA 4U7DA 5H6RA 5CVVA 4HX7A 2JRTA 5F64A 4HBLA 3E3VA 1BI2A 4L0YB 2PJPA 3KP6A 2A61A 1IXSB 3R60A 2XROA 3JTHA 2OD5A 3E6CC 2DFIA 3M7GA 2F5EA 3N4MA 3NEUA 2HR3A 2L4MA 3H3UA 4EV0A 5A2QZ 2IRFG 3DFGA 2A69F 4RS8A 1XCVA 5CVRA 3ZMZA 2G7UA 1LQ1A 3ZMSA 5EEHA 3MWMA 4L9JA 3ZQ7A 4G6QA 1IAWA 3QAHA 1TQPA 2COMA 1J0RA 2RDPA 3KLNA 3TOAA 3ML6A 2H94A 4EQQA 4RB1A 3CO6C 4ESBA 4IF4A 2WTEA 3R6SA 2VBXA 3HRMA 3R4KA 1HBXG 2XAHA 3IKVA 3QPHA 2Z9OA 4LG0B 1JE8A 2HWVA 1USSA 4G8XA 1SD4A 1SD6A 2TDXA 3LQRA 1PUEE 1IW7F 1K78A 3GX4X 5HS7A 1FC3A 1IXRC 4HA8A 2RQPA 4U0VA 1FYLA 1QZYA 1K79A 1RZ4A 3K69A 5HOOA 2W24A 4ETSA 4LLLA 2ZFWA 2FXAA 2OA4A 3GZ5A 4A6EA 3EETA 3NQOA 3Q9VA 1SAXA 1HKQA 2HYGD 1MJBA 5E8IA 1W7PD 2E7XA 2E7WA 3RTRA 1ON1A 3L2CA 4M6YA 4A0ZA 4G7ZF 3O3KA 4RAZA 1ON2A 2FOKA 1ZG5A 3U1DA 1IUYA 5L3CA 2EFPA 3CDHA 4CHUA 3I53A 2GWRA 1MDMB 1ZH5A 4LFUA 4G7OF 3BJAA 5L3FA 2P6TA 1S7AA 2M30A 5AONA 2QWWA 5LBQA 4ZYDA 2JT1A 4EJTA 1IN6A 4HDVA 2EV5A 2LF8A 4WX9A 3LFKA 1P6RA 1R23A 5LHGA 2EV6A 4EJVA 4LMYA 4I0AA 2FEZA 4LLGF 1D5VA 2JPCA 3RIRA 4MGRA 3EYYA 3FXRA 2RC4A 4RB2C 1WSUA 1J7KA 3TO9A 1TNTA 1SD5A 4JQFA 5EEGA 5D5WB 2FBIA 4LG0A 1GXPA 4FX0A 4P55A 5HDNA 2EA2A 1YO5C 4KDPA 2W85A 3T0YA 5K5QA 5D4SA 3KZYA 2LSOA 1T2KA 5HS8A 4IJAA 2UWMA 4S04A 3I4PA 2CFXA 1SFEA 5E1XA 2ZBKA 2WWYA 3HHGA 2XAGA 4M9SA 2Z5UA 1FBUA 3BY6A 2XVCA 1FSEA 4I02A 3VEPA 1LDDA 2FU4A 1EH6A 4FX4A 1PDNC 4GGGA 3KP5A 1ZREA 5ED4A 2CGPA 4Y15A 3G3ZA 4ENNA 1HW1A 4BHBA 3WTWC 4HAMA 2XRNA 3F8MA 2DBBA 2F5CA 1LJ9A 1YLFA 3WE2A 4XLNF 1IN8A 3ROUA 2W57A 2J5OA 4L9TA 1L0OC 3D0SA 2L3DA 1G4DA 1W7PB 3J80Z 1FNNA 5E1WA 3Q5FA 1JHHA 3F22A 3ZMDA 3LSTA 3U2RA 2PBIA 1ZLKA 2NNYA 2V1DA 4AWXB 3IRRA 2VBWA 3FXUA 2QBYB 3GO5A 2PG4A 4H0EA 4N9IA 1QZZA 3V7CA 1TW2A 3BJ6A 3FZVA 1YTYA 5AIPA 1UHMA 4PDKA 2STWA 3FM3A 5H20A 3L7WA 3MCZA 3JAMZ 4M9XA 1IRFA 3I58A 1FX7A 2EFQA 3HUGA 3GFMA 4PZJA 1D8JA 4NB5A 4UV9A 1EH7A 3SXYA 1B9MA 4FHTA 1G3WA 3BP8A 2PI0A 4E70A 3VODA 4EJWA 3PQJA 2P5KA 4I01A 5D6FA 4XBFA 1BOAA 1Y0UA 4XSXF 4I09A 1MD0A 1HQCA 4BAYA 4L5JA 3JAMK 3TDZC 2DW4A 4AIJA 1FLIA 2R7FA 1J75A 1XB4A 2UXNA 4DNCA 3CLOA 4EM1A 1YW9A 1T6SA 1Z1DA 1FBQA 1R5HA 4I7HA 2HOEA 1KQ0A 1OR7A 2EV0A 5LEJA 2BEOA 2GIVA 5CJ9A 1J5YA 2K27A 1WRJA 4HW0A 4HQMA 1HW5A 3ABTA 1G3TA 3IL2A 2P7CB 3WTZA 3W6JB 1QO0D 5FD6A 2HGCA 4KICA 1ULYA 3CUQB 4GYGA 3GWZA 1H0MA 2V9VA 2IVMA 3H3ZA 3E6DA 3PFIA 2E1NA 5DDGA 5DV5A 4MTDA 4BHPA 2EFNA 4LGWA 4IHSA 2P4WA 2IP2A 1FP2A 1R00A 1S8NA 1LNWA 4KNYA 4D0PA 4KYWA 4GYIA 2X4HA 2QBYA 1XGSA 3FXQA 2WC2A 3GLXA 2XKPA 3M9AA 1WQ2A 2GQQA 3CUQC 3P9IA 2H6BA 1RUOA 2FA5A 2K4BA 3C3WA 4IRGA 1VTNC 1QPMA 1O7FA 3DKWA 4LD5A 1BC7C 3HIFA 2V1XA 1J59A 3H92A 4Z2YA 1ZN2A 3RKYA 3DV8A 3GVAA 1ZRFA 3RYRA 5FLXZ 2XV4S 3R0AA 2EA4A 3BDDA 3ZPLA 1FPQA 4EGYA 1GVJA 1OKRA 1RI7A 4KFCA 4GXOA 2MBFA 3GFIA 3V7RA 4HLXA 3HSEA 2ESNA 2AS5F 2H09A 5D8LB 2K4JA 4JBAA 1K78B 1HSTA 1SD7A 4MEXF 2DU9A 2NNNA 5CVIA 4EM0B 2E1CA 3FWEA 3DP7A 4P5OA 5BPIA 3KP7A 4YFKF 3B73A 3WU1B 3V8KA 4UV8A 3CUQA 1W4MA 2QM3A 2P5LC 4TV7A 3WODF 4EVIA 1U3EM 3MFKA 1XMKA 4KMFA 5CLSA 3F6OA 3BJOA 1HKSA 3DF8A 1FY7A 2H27A 3RJPA 3KZZA
chains in the Genus database with same CATH superfamily
3HHHA 3NAUA 1ZAOA 4OIRF 5JVGF 3B6CA 3ZCOA 1EV7A 2QSHX 3OYCA 4LK0F 3KCCA 2NVQJ 4MTEA 4EM2A 1Z9CA 1LEBA 1YJNI 1DP7P 1VQNI 5IT9K 1ETKA 3REOA 4N0BA 3HDDA 5E1ZB 4KITB 4RGUA 2R92J 5K1YA 4FT8A 4RGSA 1FWZA 2DTZA 3ZOBA 2CYYA 3IHUA 2WADA 1EH8A 1L3LA 1DDNA 3CCLI 5JHUA 2ACJA 2L7ZA 2MW8A 2ZKZA 1R7JA 4FETA 1W0TA 2CUEA 2KRHA 3DBHB 1ZKGA 5CQEA 3L00A 3FMQA 2DQLA 4QPQA 2D1HA 2AHQA 2PEXA 4KT5C 5HLIA 2DDAA 3MVPA 3OIPA 4LIVA 2CQNA 5IPAA 2VJJA 5ERIA 1P2FA 4AVPA 1S9HA 4HNUA 3SEQA 1YX3A 2RGVA 2D1VA 2LF7A 2FBKA 2NAZA 1D8KA 2WAQA 4RB0A 1ONVA 4OMYA 3WG9A 3IV5A 2Q8KA 1LDJA 2JZYA 2OJED 2ZO4A 4E7HA 2TCTA 3QP5A 2QQ9A 4DQ2A 2R7TA 1E0EA 2HNHA 3CJNA 2EK5A 3BZKA 2M45A 5L3DA 4ESFA 2VE9A 2ETHA 2K85A 1D0ZA 2QVOA 3WHBA 4OOIA 4DIQA 2DMPA 4CSWA 2W25A 1UHWA 5DEQA 3PM1A 1G3SA 3CMYA 2QA4I 3CUOA 4WF2A 3K4CA 3RYPA 1WKMA 2ELHA 2OZ6A 3ZQCA 1KQ9A 4ABZA 3CP8A 1ZGJA 4LIUA 4JX4A 3HOXJ 2O8KA 1TP4A 4UNOA 2FQ3A 1BIBA 5KAFC 4M3EA 2CFOA 1R36A 2AXTC 1Y8RB 5BS6A 2VT3A 2KFDA 1P7JA 3H35A 3K70D 5JI6A 1RUNA 4F93B 3K1PA 1Z67A 5J4YA 4E4HA 2GXBA 4ENKA 1MZBA 1U78A 2KT0A 1V55H 2V6CA 1S29A 2HQRA 3DLLF 4C3JJ 2V1NA 3ZQFA 3EPZA 2XIGA 3WTXC 2FRHA 3GBGA 1JI8A 2GZWA 3CJQB 2PQ8A 2EZKA 1PUFB 3S16J 4CCNA 3G2BA 3QRFF 2EB7A 1MNDA 2NRAC 6PAXA 4XONA 2LR8A 4D9JA 3RPUA 2P81A 2E2JJ 4G6TB 2X85A 1ETQA 2OQRA 4RMNA 3I5UA 3KEQA 4HG2A 2MSYA 1N75A 2CW7A 4MFDA 1A6IA 1X3WB 3FDYA 4WXHA 2OBPA 3GTGJ 2HPMA 2W00A 2R7WA 1I39A 3SQNA 4DYQA 2E60A 4A3FJ 4MNUA 5C4XJ 1X2NA 3AG4H 3BR1A 3K7AJ 3BG7A 2F5VA 1BJZA 3SDBA 1ZHFA 1FOKA 2ZNZA 4M3GA 2MH2A 1V54H 1BL0A 2KJBA 3RQIA 4QSHA 5FKKA 2G9WA 3HTUA 4AC0A 4ENMA 1B1BA 2Y0SN 2HVSA 5M3MJ 2L02A 3GEZA 3LSGA 3P9CA 1P4WA 1XDUA 5ILSA 2OCCH 1VQ7I 2D2WA 3AG2H 3I64A 4PGHA 1R58A 3OOPA 4G94A 4CCLA 1HXDA 2K02A 3CDLA 3ABUA 2CUZA 3LL7A 2ID3A 1WH7A 3TEDA 4YFNF 1A35A 4DJAA 1W0UA 4KUMA 3RQ4A 1YJ9I 4BACA 4Y52J 1FJLA 3BOQA 3E5QA 5J1RA 3RSNA 2DPDA 1E2XA 4L0ZB 2Z16A 2MD5A 2L01A 4WWCA 4HF0A 5E8GA 3J81K 5H2FC 2GXGA 4DYCA 4K2EA 2LDUA 3K4NA 4ZYEA 3KP3A 3WGIA 2BBYA 1R6RA 4O6JA 5CQGA 2Y9ZA 4HSRA 1IGNA 1MIJA 5KK1A 5LRSA 1Z05A 3K1MA 4CICA 1TW3A 2R7VA 3BG6A 2F6CA 2HEOA 1XSXA 5EYRA 3BQYA 2M4KA 3HTSB 4OIOF 3DU6A 1UB9A 1UAAA 3DEUA 3SFIA 2XAFA 4YELA 4NDLA 4UUVA 2NS0A 1RRJA 1YW8A 3DPTA 3LA7A 4B09A 4PK4A 2ZB9A 4GCVA 1FP1D 2DYRH 1F4KA 2VC0A 1C0WA 1YOVB 2W1OA 4OU0A 4KMUX 3TO7A 1Y0NA 2DT6A 3F3XA 1U8RA 3HRUA 1QVUA 4UVAA 3IWZA 2A6EF 3CTAA 5K5RA 4KIFA 1JGSA 2Y75A 4BJTA 2HZTA 1ZRDA 3TP3A 3IAS2 3MAJA 3PIPF 5LD2C 2EQRA 2WY7Q 2GA2A 4CYCA 5LEKA 2DA1A 2OQGA 1Z91A 2V4JC 3A0HC 2UZKA 2HQAA 4M71A 4P96A 2R7DA 2Y0MA 1PUFA 4BE1A 4BXFA 4IL6C 4IOAF 3KE2A 3HL2A 1I1SA 3ONQA 5CPRB 3K4JA 1W5CC 2OV7A 2HYFA 1WHUA 3F72A 2O9LA 4ZYAA 4CCOA 3GTMJ 1KGSA 2VKDA 2FBHA 1R1UA 2JPBA 4XICA 2Q1ZB 1SVMA 3J7AO 3LA2A 1ZG1A 1I27A 1ERDA 3H5AA 2E35A 4CGZA 2PJRA 3WU0A 2ZMEB 2GOMA 4ESJA 4A3DJ 3OS1A 1VNDA 3H36A 3K9TA 4Q5SF 3EUKL 1EF4A 2GAUA 3ZMTA 2KIMA 4H4KC 3P7NA 4JP0A 2R3SA 1R4MB 1YG2A 2VONA 3MZ8A 3D5LA 1Q1HA 3O2PE 2Q0OA 3LAJA 1O3QA 3OYFA 5HDKA 1NK2P 2DTRA 3HB9A 4QPOA 3DPUA 5F27A 3HRSA 4DZJA 3W3CA 3H1CA 3J7YJ 3K70C 1JHFA 4HQEA 1WWXA 1VQ9I 1UZCA 4MHGA 2DMUA 4HF2A 3OYGA 2CV0A 3K6GA 3AAFA 3BWGA 3FBIB 4JK1X 2KMUA 5ICFA 4AYBA 5E3NA 1TWFJ 1RKTA 2ZMEC 4XRMA 3MZHA 2DT7B 2VXZA 4ZYGA 3S3NA 1X3UA 5LHIA 2NVXJ 3QU6A 4XRFA 2CO5A 4B43A 2KRFA 2JN6A 1FZPB 1TL8A 2VOPA 2JA5J 2LKXA 1AKHB 3PO2J 4B48A 5BPDA 5C44J 2P5VA 2OTJI 9ANTA 3BPXA 2DMTA 4IKFA 3OMYA 5FB2A 4QLCU 4RGRA 2O0YA 1RR7A 2X1CA 1DU6A 1ZRCA 4ZZDA 1ETWA 4Q4ZF 4I2OA 5IOZA 5JFRA 3E7LA 3I56I 5F1RA 4BY1J 3DTEA 4XLEA 3VOEA 1H9TA 2VPLA 1LVKA 4NC6A 2IBDA 2DA2A 1HF0A 1ODDA 1BM9A 3KX2A 5J8CA 3SZTA 1OLTA 4L5EA 5E3OA 3EYIA 2PMUA 3TMOA 1MJAA 1I6XA 2Y30A 2WB1A 5FKOA 2DDBA 3CCRI 2R5ZA 1VQKI 1BIAA 1QA6A 1UCRA 3LMMA 5E79C 4KISA 5FGMA 2DFHA 5DD8A 2IEKA 2LK2A 2GLOA 1YS7A 3OV8A 2WAFA 2HOAA 2JVGA 3Q3SA 5KNLA 1BN5A 2DA3A 4LG3A 3W2WA 1DUXC 2MLKA 1TQMA 2ZXWH 1H89C 3R61A 2VODA 5KHDA 4ZZLA 1A04A 5FRMA 1UFMA 2O6GE 5JR3A 2DMQA 2WV0A 3F6VA 1OYYA 3KFWX 2ISYA 2M34A 5ILVA 1OCOH 2FNPA 3HOTA 3RPUD 3GTOJ 1MJ9A 1U5TB 5J4VA 3MKZA 3JW4A 4Y4RA 3QPTA 4KN7X 3SEZA 1T39A 4BE0A 1KZHA 4ZH4F 1D5YA 3WTSC 2DLLA 4KIBA 4DW6A 3WTUC 1O3SA 2R7UA 3OOUA 2O8XA 2MC3A 3F8BA 1ETOA 2MH9A 1J2XA 2ZMEA 4D5CA 1QRYA 3SFZA 2XDVA 2V6EA 1WJEA 2HKXA 1X1PA 1OISA 2Q2EA 2HTJA 2LTPA 3ABKH 3HOSA 2VKHA 5AIQA 5ICCA 2KZVA 3PUBA 1WJFA 1FTZA 3JTGA 3M07A 3N97A 1WJBA 1B9NA 1LDKB 2X48A 3IH3A 2A5YB 2K5CA 5LGTA 3VDXA 2H1LA 2CU7A 3C2GA 4FASD 1U5TC 4L9NA 3F8FA 1Z3XA 1LE8B 1JXSA 3GZ6A 5KAIC 1HOMA 2A3SA 3I4NJ 3KP2A 3RI4A 3ZQQA 4RB3C 3L2QA 1H8AC 1TWCJ 5FKMA 2RQQA 1XCBA 3CZ6A 2RV8A 3CCMI 2VC1A 4IHTA 2X6YA 1LEAA 2VLAA 4IQJA 5BQTA 2CWEA 3PSIA 1BW6A 1OYIA 2IGMA 3S3OA 3GF2A 4HZFA 1IJWC 3GTLJ 2ZSIB 2XGDA 4Y17A 2CS3A 5L3GA 1O3RA 2L5QA 3M8EA 2JVHA 3EUHC 1BI1A 5B1BH 4B1RA 3ISPA 4FE7A 3BPVA 4CO8A 1WJCA 3MKYB 2DK8A 2QLZA 4G9YA 2QZ8A 2VJIA 1JJ8C 1JJ6C 4AD9A 1FBSA 1TWHJ 5D5VB 1BC8C 3GTKJ 4XLFA 2FSWA 5ICEA 1X4OA 3BR5A 2R7QA 2DFEA 2ZJPF 1NK3P 3HPGA 4OIQF 2MABA 2XAJA 4HV6A 3WTVC 3JCUC 4OAZA 1V5FA 3U9GA 4BYYA 1S7EA 2QQBA 1K6OA 4XKWA 2HFHA 3E6BA 3TOBA 2FMYA 3DU5A 2STTA 1IRGA 2HOTA 3L09A 2ID6A 4ZDLA 4O3MA 1OMIA 3ZP5A 1S72I 2QYOA 3CF2A 2VL8A 3S8PA 4BL0B 3O8HA 1I3QJ 3DXJF 4I99C 3JRFA 2RAEA 4A12A 2L7FP 2HQNA 5J1UA 1XSVA 1ZR2A 4C3IJ 1T08B 1HLVA 3BT9A 3A02A 1QQIA 1VI0A 1NG7A 4IRHA 2X6WA 4HRIA 3ERED 1EJ9A 2LD5A 3S93A 3WHCA 2X51A 2G7HA 3H0DA 2V1UA 2D5VA 1ZGAA 2HKOA 1OCRH 4NQWB 1DPUA 1HA8A 1MBEA 3S2DJ 3V8JA 2VT2A 3O6BB 4XMYA 1U5TA 5GADJ 1MNMC 2DPUA 3NARA 3BTJA 3GYHX 3BG5A 4WXDA 4JYKA 4MEYF 1LKXA 2M1BA 3L2VA 1WVRA 1ZLJA 2LMDA 3TKYA 4R79A 1JTYA 3BTLA 1T98A 1LFUP 4BNCA 4V2FA 2A5WA 2ZSHB 2Z3YA 3LA3A 1TZLA 5K7HA 4LLNA 1RESA 3NRVA 3FMRA 1GV2A 3IKTA 3HOZJ 2JRMA 5CVJA 4AVZA 5IT9Z 2D45A 4IRIA 2A6HF 3JRBA 3VB2A 2XB5A 2ZJ2A 3TO6A 2IS1A 3M8JA 5F1JA 1Y39A 3EUHA 2XSJC 2A07F 1UJ8A 3TGNA 4U88A 2ZNYA 5HLHA 1BI0A 2UUZA 3RKWA 1ZR4A 5EGOB 1SFKA 2BW3B 3L9FA 4GO1A 2EZLA 2LNBA 1XMAA 4OIPF 2BVMA 2X6OA 2RNJA 2OCEA 3I55I 4RA2A 2NOJB 1LFBA 3SHFA 3WE3A 1K7AA 2ZJRF 5HS9A 2YX7A 1X2MA 3E6MA 1QZEA 3KEOA 4XORA 2Z2SB 2BV6A 4IEJA 2LY2A 5FD5A 4CDGA 3S32A 4RBOA 3F23A 2NYXA 1ZGWA 4KT6A 3OS0A 1T38A 1B6AA 5DD4A 1ETXA 5L3BA 2VXDA 1PYVA 1QGPA 2DO7A 4PJLA 4YFXF 5J1YA 1U2WA 5BMZA 2P7VB 1D3YA 1G6NA 3ZN0A 4YG2F 5DUIA 4HEA2 4A6DA 4HSTA 4W1UA 3GW2A 5HODA 2F4OB 3VWBA 4G12A 4LK1F 1NHAA 1X58A 2X0LA 2XPUA 2Z33A 3FXOA 2ZJQF 2BY2A 3DTKA 3KYCB 4MLOA 2RVCA 2VASA 2FF4A 4XLAA 1T8IA 1MMGA 3FHZA 4WK8F 4HX4A 2IXSA 2VBZA 3OYIA 1KA8A 3HKZN 5E17F 4Q47A 4XNFA 2K40A 4A2UA 1MSEC 2DK5A 1RETA 3ZGKA 5EEAA 4IZZA 5IT3A 1VQMI 2XAQA 4PJ0C 2OPTA 4HOBA 1OCCH 2L9RA 4ZTJA 1U9NA 3DEEA 3F0CA 4BJ5C 2L54A 4PJJA 3VYRB 4BDZA 1QNTA 2E1OA 4IX7A 3FIWA 3QOPA 3HPHA 1YYVA 4XLPF 1RNLA 1V5EA 4HYEA 4ZDPA 2CV2A 3Q0WA 2OTLI 3I71A 3WGHA 1BW5A 1Y8QB 4C9YA 5J3LA 1UG0A 5A2QK 4ON0A 1H9GA 2IGKA 3MEXA 5DUKA 1XD7A 1SAUA 3VSLA 2QSFX 4AU7A 2HS5A 2HZDA 2W84A 3K4LA 3N05A 3JSPA 1KU3A 3UNGC 3GFJA 4NQWA 4U7BA 1X1DA 3GTQJ 2ESHA 3F8CA 1YX5A 5IP6A 5LRRA 4GFBA 3VYUB 3ULQB 3KZIC 4L18B 5LHHA 3X2QH 1LUJB 2NVTJ 5F0HA 1FIPA 4UVBA 1QBJA 2P6SA 1KYWA 3FK7A 4R8HA 3L2WA 3HSRA 4KJZA 1Y1WJ 1GHCA 4LOCA 2HDCA 3K0LA 4M3BA 3H5RA 1IUFA 3DKXA 5FKLA 1V5GA 1O3TA 2CRGA 4OMZA 3ZMVA 2ADUA 3ECHA 4CYCB 2ISZA 1O4XA 1EKEA 3KEYA 2WA0A 1IV8A 1ZG3A 3A01B 2EFOA 2CJJA 1VF9A 1FEXA 4L9VA 1JUMA 1UG2A 2O03A 1RKWA 2M4GA 4HX8A 4I76A 3PQKA 3C1DA 2L4AA 5EGOA 2BW3A 1IN7A 1POGA 2E36A 2J5PA 4A3IJ 4BXXJ 2OZUA 4RAFA 4XLHA 2M8EA 4IHXA 4A5NA 3CQZJ 3LSIA 3K2AA 2KIUA 4O5VA 2PJRB 1CF7A 4HNTA 3F21A 2LKPA 2F5FA 2HXIA 1YIOA 4IXAA 2HDDA 5E3LA 1F5TA 1PP8F 4UVCA 2CH0A 1BJAA 4J19A 2R0QC 4E7JA 4ZC3A 3S1MJ 3BZCA 2W82A 1S5LC 2COBA 2EIKH 1IDYA 4QIWN 4KIGA 3CCEI 2VN2A 3J81Z 3G73A 2RKHA 3DEWA 4EGZA 4YEJA 2DA6A 3ECOA 4MQ9F 1XPXA 1LPQA 1A31A 3EQLF 2LYCA 4CXFA 1I1GA 3E97A 2EIMH 1QVTA 3DPLC 3CMAI 3SZPA 2RREA 1P9QC 3V8LA 2EJRA 2JSCA 3VYTB 1X3ZB 5LGNA 4U87A 3M3YJ 4RAYA 3LSPA 3E5XA 4UB6C 5F04A 4IVNA 1AU7A 3GFLA 2EZIA 3LWFA 3CCVI 2XPVA 5TGTA 3BR3A 1WCMJ 4M3FA 2H1KA 2IS2A 1F1ZA 4ZJZA 4ITVA 2GA1A 3FK6A 4MO7A 4UXNA 3TQNA 1XGOA 1D1CA 1FYKA 1I5ZA 1V4RA 3IH2A 3RDIA 2YX4A 3C18A 1ETVA 4B4CA 4RDUA 2Y69H 5TRDA 2CW8A 3FKJA 3H9GA 3PJRA 1R1TA 2B0LA 4R1HA 3OL4A 2M5WA 3GXOA 4F7ZA 4ZYHA 1W5SA 2DODA 1VFCA 1V3FA 2QKLB 4PSXA 2IS4A 4ASNA 1GV5A 2XAUA 2IJLA 2IW5A 2ZCWA 2M2EA 1WH5A 2QQAA 3LAPA 4S05A 1IF1A 3HEFA 5DM6F 1J9IA 3M1EA 2IT0A 5FFZA 5DCMB 5D8KB 3QWLA 3H5NA 1XN7A 5JLXA 1Z21A 2EPFA 2FE3A 2KDOA 2K86A 3R0JA 3KETA 2EFWA 4A3KJ 2VE8A 2M0MA 3COAC 4XSZF 5HDGA 3OWTA 3WTTC 1RIOH 1G59A 3Q9SA 1H88C 4A69C 1YE9A 1RC9A 3BZ6A 3CJRB 3T1BA 4BH9A 2R5ZB 1U9OA 1STZA 2AQEA 3TDUC 2F2EA 5HNFA 4BHCA 4DYRA 3W6KB 5FROA 2R7SA 1SFXA 2IPQX 3WTYC 1FIAA 5GPAA 1P7IA 3B02A 3H3VK 2I10A 2ME0A 4P1WA 1FT9A 5KCMA 4WCGA 1DPRA 5FFXA 1XDSA 2PLYA 3W2AA 3A01A 2YR2A 1F43A 4L5IA 4BQAA 3E5UA 2HTSA 3GUDA 3MQ0A 3G4SI 1X4PA 2HOSA 3HRTA 1KU2A 2BY0A 2R5YB 1YFHA 2PMZN 3PUFA 4A3CJ 3K4MA 4OINF 2B9SA 2EWNA 2LREA 2M87A 3E0JB 1S7OA 1SFUA 2JA2A 4N9HA 2H6CA 4BQOA 3L1PA 2UXXA 1T0FC 5HVQC 3OY9A 4ENJA 3SYTA 3BROA 5ICGA 4ZDOA 2M3AA 2OU2A 5JVTA 4EMSA 2Q2EB 1SMTA 5E18F 4A3BJ 2VBYA 5EZGA 2VKVA 4E7KA 1LVAA 1TTYA 3WGGA 3HSFA 4G7HF 4BUPA 1YQAA 1GXQA 2JUGA 1MMSA 5B1AH 2VQHA 3BR0A 3RCOA 5DCFA 1REPC 2HPIA 3FM5A 1OQYA 4BXUA 5GAGJ 5J6XA 4KN4X 1HW2A 2KIFA 5EF6A 1PP7U 2L7MP 1HSJA 3QP6A 2IA2A 1MNEA 2V79A 5J8FA 3QODA 1MDMA 4M6XA 4Z6YA 4YIIA 2PMHA 1S6LA 2OF7A 5D5UB 2HYJA 3VYSB 1MBJA 2YPRA 3S2WA 3I54A 2Z99A 4UUTA 1Q1VA 3BLYA 1CGPA 5GTIC 2K7LA 2YU3A 3K2ZA 4PCQA 3W2VA 2DQRA 4ZTFA 4UUSB 1KU9A 3ELKA 4JOMA 1YIJI 2IS6A 2MA3A 3S3MA 2GOXB 4C3HJ 1JGGA 1T56A 1IXCA 1CQTA 1BA5A 2IGNA 1KONA 2O61A 1P4AA 1P4XA 3KIOA 2XB0X 3JREA 5DCMA 3I59B 5CKTA 1MBKA 1WJDA 5EG0B 2M8GX 4QWQA 4F3QA 2BYVE 2OAZA 2BE5F 3PFYA 2XGXA 4HF1A 2QENA 2BY3A 1DGRM 4M3DA 3ZQIA 2JJ7A 1WZ2A 2K9LA 2XC7A 2Y0SA 1BR4A 1P92A 4AIHA 3J80K 1Z7UA 1W5TA 4XRSA 3KLOA 4G6DA 3QPSA 3J7AY 2JUCA 2KKOA 2QQ8A 1F9NA 2LY9A 2VQCA 4HLYA 1T0FA 2DOEA 1BI3A 3V4GA 1S3JA 2BVLA 5D5XB 4D5FA 5DM7F 3LSRA 2HQ5A 1OPCA 4Q48A 4GDFA 3ZXSA 4P9UA 1XMXA 3ZQGA 4C2MJ 4M74A 2LVSA 1MH4A 5DS9A 3P5JA 2F4IA 4A0YA 1ZELA 1K83J 2NVYJ 3PL8A 1GDTA 1LFPA 2CSOA 4X0GA 1BBYA 1YW7A 2CQKA 4E7IA 4EJUA 2R5YA 5FKNA 3CC4I 3KYLA 3JRDA 1JT0A 2C6YA 2AXLA 3M1CA 1GVDA 4LJZF 2DJIA 1X1AA 3SDGA 3QOEA 3I0TA 2GBYA 1Z6RA 2DCEA 3LOCA 1XGMA 2Y2ZA 4M9ZA 2K3FA 1FOXA 3BG9A 1K61A 1B59A 1R22A 2CW0F 5F0FA 1BOBA 2HI3A 1R71A 4HDUA 2ECCA 3ASNH 5M5XJ 1Z3YA 4Y13A 3HJEA 3IC7A 5D6EA 5BOXA 2CQXA 3OYNA 5FO5A 3OL3A 1TLHB 3HOYJ 5TJJA 3F8NA 4A5MA 2NVUB 1ORKA 2KJCA 1OCPA 3VFZA 3JSOA 5D4RA 1KU7A 2GIZA 1E3OC 1MKMA 1WI9A 3CO7C 1O7LA 5J40A 5CYVA 4PJMA 4QTRA 1OYWA 3FXLA 4II2A 3DBRB 3BR2A 3M4OJ 3D5RC 1AOYA 3FX3A 4YIFA 1SVOA 5K5OA 3HYIA 2GM4A 4CYDA 2IAIA 2WAQN 1DGWY 1SFOJ 3P9KA 4P9FA 2P8TA 4I98B 4HNVA 1AWCA 4RGXA 2O7OA 1IG7A 1HDPA 5EJCA 2QSGX 2Y9YA 3M8FA 3OR1C 1IN5A 2OC6A 3ERMA 4RM2A 3BC8A 3FISA 4NHJA 4GRIA 4A0XA 2UV1A 1MGTA 2A68F 3LQQA 1QPIA 1W7PA 3DBLB 4CUGA 3CF5F 4M73A 3RPQA 2B63J 4FTHA 1G3YA 3DQVC 3HZJA 4XKVA 4B47A 3JRAA 2R4GA 1ACIA 1RPWA 3FMSA 4UUSA 2E71A 4LB5A 4AIKA 2DA5A 3CLQA 5CVUA 5ILUA 1TQIA 1SC7A 3E1SA 4W97A 4U0WA 1BR1A 3T8RA 5F6FA 3RKXA 2RN7A 2HVQA 3KP4A 3K4KA 2HDWA 1WFXA 1ZYRF 3I59A 1MBHA 2F5DA 2YSRA 5EG0A 1SMYF 4CZZA 5H6QA 1USTA 1DU0A 2O3FA 5DYMA 5GP9A 4BDYA 3TW7A 2FMLA 3DLAA 5F0CA 1XX5A 2XKOA 2PN6A 3G71I 2XF7A 5HNHA 2R7RA 2VOOA 4E7LA 2IA1A 4IPAA 2ME6A 3IAM2 2BY1A 5FLVA 2JA8J 2FX0A 3CCQI 3QYEA 3GMEA 2DT5A 2LG4A 4KA4A 2X1DA 2ZXJA 3T8TA 4ANJA 4I0BA 1O57A 1Y56A 4DBRA 1XGNA 2IA0A 3H9QA 1K4SA 2L7KA 3OSGA 2DI3A 2PX9A 2CG4A 1K6YA 4UHTA 1ENHA 2QGUA 2FNAA 2NS8A 1FSHA 2ZC2A 3NWSA 4U0YA 3K1NA 4EJOA 3LSJA 4OAYA 3KYDB 3IRQA 1IC8A 1Z7LA 1UELB 1E17A 3RKQA 1R5GA 3ZMUA 1HKTA 4B8XA 3C2HA 5LLQA 2Y48A 1WI3A 2E34A 3V7SA 2DA4A 5IYBJ 5J47A 1IZ1A 1KYZA 2NXNB 1Z6TA 5JHFA 4XOTA 4YRVA 1B4AA 2KISA 3QU3A 2K9SA 3DKYA 1XSDA 2DA7A 1R1VA 1JUPA 1ZARA 2Y31A 3GCMA 4E6KG 3OYDA 1GT0C 2K3PA 5B3SH 2XGCA 2LLKA 2ICWG 2YS9A 5KVRA 3GTJJ 1OFCX 4CH7A 2E1MB 1XG1A 1R49A 2MLGA 3CD6I 3C7JA 4M72A 3S15J 1MSFC 2VIXA 2JA6J 3MD2A 5FLXK 5LGUA 3IUOA 4MQVA 4X1EA 4DZPA 5L3EA 4Y7NJ 2LH9A 5HLGA 2DAOA 3T5XA 3IWFA 3WU2C 2XASA 1IN4A 3FF5A 3MZYA 1KQ8A 2MFZA 5M5YJ 2QUFA 1U6GA 1FYMA 2VI6A 3ZN1A 2E2IJ 4PGGA 5E20A 1TBXA 1FMWA 5M3FJ 1JKPC 1NG6A 4LB6B 1MBGA 1CF7B 2BGCA 4WXCA 1LB2A 1TNSA 2XUBA 4N4NB 3OS2A 3D5SC 1YS6A 3G1LA 4E7SA 4A93J 2BHZA 2E1MC 1D0YA 2XHKA 3PNYA 2JTVA 4HV5A 1MMNA 4XIDA 5F08A 2PFBA 3OYAA 3HOWJ 3HC7A 3EDPA 4U7DA 4PFPA 5H6RA 5CVVA 4HX7A 2JRTA 5F64A 2B7EA 2W48A 4HBLA 3E3VA 1BI2A 3CESA 3ZQLA 4L0YB 4PSWA 2XF5A 2LRDA 2PJPA 3KP6A 1R9TJ 2A61A 1IXSB 3R60A 2XROA 3JTHA 2TRTA 2OD5A 2DXIA 2X6XA 3E6CC 2L9VA 2DFIA 3M7GA 2F5EA 3N4MA 1N78A 3NEUA 2HR3A 2L2OA 2L4MA 4NC8A 5E3MA 2CV1A 1D1AA 3H3UA 4EV0A 4HPQA 5K7FA 5A2QZ 2IRFG 1U8BA 3DFGA 2A69F 4RS8A 1XCVA 5CVRA 3ZMZA 2G7UA 1LQ1A 1YRNB 2QCOA 3OSFA 3ZMSA 4X6AJ 2XGEA 5EEHA 2V9PA 3PIOF 1E3HA 2M9HA 3MWMA 2P0WA 2LOOA 4L9JA 4XLCA 3ZQ7A 4G6QA 1IAWA 3QAHA 1JKRC 2DJNA 2X1EA 1F36A 1TQPA 2COMA 1J0RA 3CDIA 2YU9J 2RDPA 5FJ8J 1J09A 3KLNA 3TOAA 3OYJA 3ML6A 1OCZH 2H94A 4B44A 4I6ZA 4EQQA 4RB1A 3CO6C 4B3AA 1N77A 5GTHC 1YJWI 1D1BA 4BQNA 3O8GA 3A03A 4ESBA 4IF4A 1B72B 2WTEA 3R6SA 3QPLA 2JSPA 2VBXA 3HRMA 3QYFA 3R4KA 1ZQ3P 1HBXG 3OIQA 2R93J 2XAHA 3IH4A 1PVEA 5IP9J 1FOYA 1JT6A 4J01A 3BCBA 3IKVA 3KPHA 3QPHA 1SVLA 3S14J 3MMYB 4BS9A 2Z9OA 3OYHA 4LG0B 1JE8A 2BXYA 2HWVA 3I4MJ 1USSA 2F48A 4G8XA 1SD4A 1QHHD 1SD6A 3K4BA 2TDXA 1VQ5I 1BR2A 3LQRA 1PUEE 1IW7F 1K78A 3GX4X 4XR6A 3CCSI 5HS7A 1FC3A 1IXRC 4HA8A 2RQPA 4U0VA 1FYLA 1QZYA 1K79A 1RZ4A 2HXOA 3K69A 4MFEA 5HOOA 4F52A 2JMWA 1T95A 1VQLI 2W24A 1N25A 2KL4A 2DN0A 4PJNA 4LLLA 4ETSA 2ZFWA 1RR8C 2FXAA 3HXLA 4IHYA 2OA4A 3GLLA 1W36D 3TP0A 2W7NA 3GZ5A 3A1YA 3HM5A 4A6EA 1XTAA 3EETA 4AYBN 4BBRJ 3NQOA 1R5ID 3Q9VA 2CQQA 1SAXA 1HKQA 1IDZA 3CJTB 2JQ7A 1R4NB 2HYGD 2EZHA 4LITA 3WG7H 2VB6A 1MJBA 3HGGA 1QHGA 5E8IA 1W7PD 2EBIA 4NC7A 2VPRA 3JRIA 2E7XA 3AKZA 3FXKA 4EATA 2E7WA 2XSDC 2MGQA 3RTRA 1ON1A 3L2CA 1IRZA 4M6YA 4A3LJ 5IYCJ 4A0ZA 1QU3A 4G7ZF 1E3PA 4JX6A 3O3KA 3S1QJ 4RAZA 1ON2A 2FOKA 3UR3C 3U1DA 1ZG5A 3D1NI 1IUYA 2DYSH 3BTCA 5L3CA 2CUFA 2EFPA 2Z1DA 3CDHA 2K9QA 4CHUA 3I53A 2BZTA 2GWRA 1MDMB 1ZH5A 4LFUA 4G7OF 3BJAA 1YRNA 5L3FA 2LBFB 2I5UA 3QYBA 2P6TA 1S7AA 2M30A 3FXMA 2WB1N 5AONA 2DFFA 2QWWA 5LBQA 5FLMJ 3CCJI 4ZYDA 2JT1A 2G0EA 4EJTA 4J00A 1IN6A 4HDVA 2EV5A 2LF8A 2HVRA 1JKQC 4WX9A 1A6QA 3LFKA 1P6RA 1R23A 4C30A 5LHGA 1B72A 4BQQA 5C4JJ 2MD0A 2EV6A 3TW6A 3CMMA 4EJVA 2V9KA 4LMYA 1XS9A 4IHWA 4I0AA 2FEZA 4BY7J 4RLQA 4LLGF 1D5VA 2JPCA 3RIRA 1YHQI 2E2HJ 4MGRA 3TL4X 3EYYA 4Y3OA 4CCKA 3FXRA 4F91B 3CCYA 2RC4A 1FOWA 5GPCA 4RB2C 3L2RA 1WSUA 4FE4A 2FJ1A 5TISC 2JA7J 1J7KA 3TO9A 3GTPJ 1TNTA 4FQGA 3AG3H 1SD5A 4JQFA 5EEGA 3ESWB 3FKIJ 3AFHA 3GZNB 3QQAA 3BQZA 2KPMA 5D5WB 2FBIA 4LG0A 4IO9F 1GXPA 2QEXI 2GXAA 4FX0A 4P55A 3HGYA 4XN3A 5HDNA 2K9NA 2EA2A 3HUGB 3CC7I 1YO5C 5EDNA 4KDPA 3HKZA 4A3EJ 2ELJA 2W85A 3T0YA 4AUXA 3UKGA 2V7FA 4DGWB 5K5QA 5D4SA 3KZYA 5FRNA 2LSOA 2CUJA 1T33A 1T2KA 4NNJA 5DTDA 3JRGA 3DTIA 2VJ4A 2KLOA 1XC5A 5HS8A 4V2GA 1M1EB 4IJAA 2UWMA 3HBLA 4S04A 3HOUJ 1TT0A 2CFXA 1SFEA 2DOAA 3I4PA 2EILH 5E1XA 2ZBKA 2WWYA 1MW7A 3HHGA 3OYKA 2XAGA 4M9SA 1MH3A 4UY8I 2Z5UA 3A2KA 1FBUA 1FMVA 1ZK8A 2KQRA 2EIJH 2RNGA 2XVCA 3BY6A 3OYLA 1FSEA 4I02A 3VEPA 1LDDA 2FU4A 1EH6A 4BBSJ 4FX4A 2AO9A 3V42A 2XRLA 1PDNC 4GGGA 1JKOC 3W6VA 4CCJA 4B3XA 4V19K 2LC2A 1NH3A 2LKSA 3KP5A 4PUSA 2KHMA 1ZREA 2L9SA 5ED4A 4S0HB 2CGPA 3CP2A 4Y15A 2H8WA 3AG1H 3G3ZA 3OR2C 4ENNA 1HW1A 3U21A 4BHBA 3WTWC 4HAMA 3G1OA 2XRNA 2QF7A 1NTCA 2DOFA 3MN2A 3F8MA 2KP6A 3JR9A 2DBBA 2F5CA 2HU9A 1LJ9A 3B6AA 1YLFA 3WE2A 4AM3A 2FQ4A 4N4OB 2WBMA 4XLNF 1IN8A 2BHYA 1WGXA 3JRHA 3BTIA 1YITI 5K7ZA 4II3A 3ROUA 2CMPA 2FUG2 2LBFA 2W57A 3S1RJ 2J5OA 4L9TA 1L0OC 3D0SA 1OR7C 2XPWA 3ZRGA 2L3DA 3LNQA 1G4DA 1GUUA 1W7PB 3LFUA 3J80Z 1FNNA 5E1WA 1PJRA 4FISA 4M6VA 3Q5FA 1JHHA 3F22A 2VKEA 3HOVJ 3ZMDA 3LSTA 1X19A 2X9DA 3U2RA 2VUMJ 1WJ5A 2PBIA 1ZLKA 2NNYA 2V1DA 4AWXB 4RLFA 3IRRA 1UHSA 2VBWA 4A3GJ 3FXUA 3CCUI 2QBYB 3GO5A 3ABLH 2PG4A 2M7BA 2IGOA 4H0EA 4N9IA 1QZZA 3V7CA 1TW2A 3BJ6A 3MKLA 1W36C 3S17J 1JTXA 1AHDP 5GAEJ 3FZVA 2MYSA 3RZDJ 2JK3A 2LY1A 1YTYA 1ITYA 5AIPA 1UHMA 4C2TA 4PDKA 2WV1A 3OYEA 2STWA 3FM3A 1TWAJ 5H20A 2ZFUA 3L7WA 3MCZA 3L2UA 3I9V2 2KDZA 4XK4A 3JAMZ 4M9XA 1IRFA 1YI2I 2JWTA 3I58A 1FX7A 3CMEI 2EFQA 2EH3A 3HUGA 4XKBA 4AIDA 3GFMA 5IP7J 3ABMH 4PZJA 4D7MA 1D8JA 4NB5A 1GLNA 1EH7A 1DQUA 2A6TA 2ELKA 1Y6IA 4UV9A 3SXYA 4EEFG 4F55A 3CC2I 3C2BA 1B9MA 4FHTA 3TBIA 5IY5H 1G3WA 3BP8A 3OIOA 1VQPI 2PI0A 1TWGJ 4E70A 3VODA 4EJWA 3PQJA 2I8DA 3PNTA 3NWTA 2P5KA 1HDDC 4I01A 5D6FA 4XBFA 4XM3A 4XL9A 1BOAA 2M0CA 2E5ZA 1HC8A 3OYBA 1Y0UA 4XSXF 4Y33A 3MKWB 2WY8Q 4I09A 3VPRA 4IOCF 4A3JJ 1MD0A 1HQCA 2XF6A 4BAYA 4L5JA 3JAMK 3TDZC 2DW4A 4AIJA 1FLIA 2R7FA 1J75A 1XB4A 2UXNA 4CCMA 3CLOA 4DNCA 2E19A 4EM1A 1YW9A 1TC3C 1WPKA 1T6SA 1Z1DA 3S1NJ 1FBQA 1R5HA 4I7HA 2HOEA 2KIQA 1WJAA 3BR6A 1KQ0A 1HCRA 1OR7A 2EV0A 5LEJA 2BEOA 4UB8C 1TT5B 2GIVA 3ZR8X 5CJ9A 5C3EJ 1J5YA 2K27A 1WRJA 4HW0A 4IQ4A 1B8IB 3EUAA 2LFBA 4HQMA 4FCYA 5BNGA 1HW5A 3ABTA 1G3TA 3IL2A 2P7CB 3WTZA 3W6JB 3J7ZI 1APLC 1QO0D 3VSKA 5FD6A 2HGCA 2LP0A 5B66C 4KICA 1ULYA 3CUQB 3F9KA 1K4TA 4GYGA 3GWZA 5M5WJ 3BCAA 1H0MA 2V9VA 4JX5A 2IVMA 3H3ZA 3E6DA 3PFIA 3PSFA 2E1NA 2WAEA 1ZTRA 5DDGA 2EINH 4NBQA 5DV5A 4MTDA 4BHPA 4BEHB 2EFNA 1D0XA 4LGWA 4RAGA 2PMZA 4IHSA 2O5RA 4XRSG 2P4WA 1AA7A 1IO2A 2IP2A 1FP2A 1R00A 1FTTA 1S8NA 1LNWA 4KNYA 4DBQA 3DCFA 4D0PA 4KYWA 4GYIA 2X4HA 3H0GJ 3SJMA 2QBYA 1XGSA 3FXQA 2WC2A 3GLXA 2AQFA 4NUBA 5B5EC 4D7NA 1VQOI 1Z0XA 2VQLA 1VZ0A 2ZXHA 4BU2A 2XKPA 3M9AA 5IYDJ 1WQ2A 5LFAA 1SANA 2GQQA 3CUQC 1OCTC 1JUSA 3P9IA 3G1MA 2H6BA 4OWRB 3ASOH 2BXZA 1RUOA 1OJLA 1A36A 2W4SA 1AKHA 2FA5A 4XQFA 2K4BA 3C3WA 4IRGA 1VTNC 5GAHJ 2H8RA 1QPMA 1Z77A 1O7FA 1VQ4I 2R7ZJ 5EZHA 3DKWA 1IRXA 4LD5A 1BC7C 1X1BA 1IV6A 4IHVA 2N8GA 3HIFA 1SEUA 2V1XA 3LSMA 3FXJA 2DMNA 3H9JA 1J59A 2R7OA 4BE2A 3H92A 4XN0A 4Z2YA 2E5NA 1VQ6I 2L9NA 1ZN2A 3RKYA 3DV8A 1X1CA 3GVAA 1MBFA 1ZRFA 3U1KA 3RYRA 4CZCA 5FLXZ 2XV4S 3A4CA 3R0AA 3LSHA 3SZGA 3ZQHA 3HG9A 4CA0A 1MMDA 2EA4A 3K10A 3BDDA 1DP3A 3ZPLA 1FPQA 1W1WE 4EGYA 1GVJA 2F4MB 1Y1VJ 1OKRA 4XKCA 4F92B 3JRCA 1RI7A 2FOWA 2OUMA 2KZGA 4KFCA 2MG4A 2QKMB 2NS7A 2ZXIA 3Q0VA 4GXOA 2MBFA 3GFIA 2M7AA 4E7ZA 2VQGA 3RZOJ 3V7RA 4HLXA 3HSEA 2CQ7A 3DWLE 4MIMA 3I3LA 3FBNB 2ESNA 3G6EI 1A5JA 2AS5F 2L0KA 4C2UA 2H09A 5D8LB 2K4JA 4JBAA 1K78B 1I6HJ 1HSTA 4PFOA 2A05A 5IOYA 3AL0B 1SD7A 3FHNA 4MEXF 2DU9A 2NNNA 1I3AA 1MMAA 5CVIA 1I50J 1VQ8I 1B8IA 4EM0B 1EA3A 2E1CA 2YUSA 3PO3J 1G2HA 2V26A 3FWEA 1ETYA 3DP7A 4P5OA 3LSKA 3KP7A 5BPIA 4XOPA 4YFKF 3BG3A 3A0BC 2FD5A 2NOGA 3B73A 3WU1B 3V8KA 4UV8A 1U0JA 3CUQA 1W4MA 4BKXA 2QM3A 2P5LC 4TV7A 1G8XA 2ECBA 1UMQA 3WODF 4YIRX 5HLTA 4EVIA 3S2HJ 3PNVA 1U3EM 2MC4A 3MFKA 4BGDA 1XMKA 2R7XA 2VJ5A 4BJ6C 3OYMA 4KMFA 4BEHA 3Q0UA 5JLWA 5CLSA 2KRCA 3F6OA 3AL0C 3BJOA 4DOZA 2K9MA 4D1QA 4A3MJ 3IP4B 1HKSA 3DF8A 4RM3A 2BOLA 1FY7A 1LE8A 2H27A 3RJPA 3KZZA
chains in the Genus database with same CATH topology
3HHHA 1ZAOA 4OIRF 1EV7A 4LK0F 3KCCA 4MTEA 4EM2A 1Z9CA 1LEBA 1DP7P 5IT9K 3REOA 4N0BA 5E1ZB 4RGUA 5K1YA 4FT8A 4RGSA 1FWZA 2CYYA 3IHUA 1EH8A 1L3LA 1DDNA 5JHUA 2ACJA 2ZKZA 1R7JA 3L00A 3FMQA 2DQLA 2D1HA 2PEXA 4KT5C 5HLIA 5ERIA 1P2FA 4AVPA 2RGVA 2D1VA 2LF7A 2FBKA 2NAZA 1D8KA 4RB0A 1ONVA 4OMYA 3WG9A 2Q8KA 1LDJA 2JZYA 2ZO4A 3QP5A 2QQ9A 4DQ2A 3CJNA 2EK5A 2M45A 5L3DA 4ESFA 2VE9A 2ETHA 2QVOA 4OOIA 2W25A 1UHWA 5DEQA 1G3SA 3CUOA 4WF2A 3RYPA 1WKMA 2ELHA 2OZ6A 1KQ9A 1ZGJA 4UNOA 2FQ3A 1BIBA 1R36A 5BS6A 2VT3A 5JI6A 1RUNA 3K1PA 2GXBA 4ENKA 1MZBA 1U78A 2V6CA 1S29A 2HQRA 2XIGA 3WTXC 2FRHA 2GZWA 2PQ8A 3QRFF 2EB7A 2NRAC 6PAXA 3RPUA 2OQRA 3I5UA 3KEQA 4WXHA 2OBPA 3SQNA 4MNUA 1ZHFA 1FOKA 2ZNZA 2MH2A 2KJBA 2G9WA 3HTUA 4ENMA 1B1BA 2L02A 3GEZA 3P9CA 1P4WA 1XDUA 5ILSA 2D2WA 3I64A 4PGHA 1R58A 3OOPA 4G94A 1HXDA 2K02A 3ABUA 4YFNF 4KUMA 3BOQA 3E5QA 4L0ZB 2DPDA 1E2XA 2MD5A 2L01A 4WWCA 4HF0A 5E8GA 3J81K 2GXGA 4K2EA 2LDUA 4ZYEA 3KP3A 3WGIA 2BBYA 4O6JA 5KK1A 5LRSA 1Z05A 3K1MA 4CICA 1TW3A 2HEOA 1XSXA 3HTSB 4OIOF 1UB9A 3DEUA 2XAFA 4UUVA 2NS0A 1YW8A 3DPTA 3LA7A 4B09A 4GCVA 1FP1D 1F4KA 2VC0A 1C0WA 4OU0A 4KMUX 3TO7A 3F3XA 1U8RA 3HRUA 4UVAA 3IWZA 2A6EF 3CTAA 5K5RA 4KIFA 1JGSA 2Y75A 2HZTA 1ZRDA 3MAJA 2GA2A 5LEKA 2OQGA 1Z91A 2UZKA 4M71A 4P96A 2R7DA 2Y0MA 3KE2A 1I1SA 3F72A 2HYFA 1KGSA 2FBHA 1R1UA 2JPBA 3J7AO 3LA2A 1ZG1A 1I27A 4CGZA 3WU0A 2ZMEB 4ESJA 4Q5SF 3K9TA 2GAUA 3ZMTA 2KIMA 3P7NA 2R3SA 1YG2A 2VONA 3D5LA 1Q1HA 3O2PE 2Q0OA 3LAJA 1O3QA 5HDKA 2DTRA 3HRSA 4HQEA 1JHFA 1WWXA 4MHGA 4HF2A 3AAFA 3BWGA 4JK1X 5ICFA 3MZHA 2VXZA 4ZYGA 1X3UA 5LHIA 3QU6A 4XRFA 2CO5A 2KRFA 1FZPB 2VOPA 5BPDA 2P5VA 3BPXA 5FB2A 4QLCU 4RGRA 2O0YA 1ZRCA 4ZZDA 4Q4ZF 4I2OA 5JFRA 5F1RA 3VOEA 1H9TA 1ODDA 1BM9A 5J8CA 3SZTA 3EYIA 2PMUA 1MJAA 1I6XA 1BIAA 1UCRA 5FGMA 5DD8A 1YS7A 3OV8A 1BN5A 1DUXC 2MLKA 1TQMA 3R61A 2VODA 4ZZLA 1A04A 1UFMA 2O6GE 5JR3A 2WV0A 3F6VA 1OYYA 3KFWX 2ISYA 5ILVA 2FNPA 3HOTA 1MJ9A 1U5TB 3JW4A 3QPTA 4KN7X 1T39A 4ZH4F 3WTSC 2DLLA 4KIBA 3WTUC 1O3SA 2O8XA 2MC3A 3F8BA 2MH9A 1J2XA 2ZMEA 3SFZA 2HKXA 2Q2EA 2HTJA 3HOSA 5AIQA 5ICCA 3JTGA 3N97A 1B9NA 1LDKB 2A5YB 5LGTA 1U5TC 4L9NA 3F8FA 1JXSA 3GZ6A 2A3SA 3KP2A 3RI4A 4RB3C 1XCBA 2RV8A 2VC1A 4IHTA 1LEAA 5BQTA 2CWEA 1OYIA 3GF2A 4HZFA 4Y17A 5L3GA 1O3RA 3M8EA 1BI1A 3ISPA 3BPVA 4CO8A 2DK8A 2QLZA 4G9YA 2QZ8A 4AD9A 1FBSA 5D5VB 1BC8C 2FSWA 5ICEA 4OIQF 2XAJA 4HV6A 3WTVC 3U9GA 4BYYA 2QQBA 1K6OA 2HFHA 3E6BA 3TOBA 2FMYA 2STTA 1IRGA 3L09A 4O3MA 1OMIA 3ZP5A 2QYOA 3DXJF 4A12A 2HQNA 1XSVA 1QQIA 4IRHA 3ERED 2G7HA 2V1UA 1ZGAA 2HKOA 1DPUA 3V8JA 2VT2A 3O6BB 2DPUA 1U5TA 3GYHX 4WXDA 4MEYF 2M1BA 4R79A 1ZLJA 3TKYA 1T98A 4BNCA 2Z3YA 3LA3A 4LLNA 3NRVA 3FMRA 3IKTA 5CVJA 5IT9Z 2D45A 4IRIA 2A6HF 3VB2A 2ZJ2A 3TO6A 3EUHA 2A07F 3TGNA 4U88A 2ZNYA 5HLHA 1BI0A 3RKWA 3L9FA 4GO1A 2LNBA 1XMAA 4OIPF 2RNJA 3SHFA 3WE3A 1K7AA 5HS9A 2YX7A 3E6MA 3KEOA 4CDGA 2BV6A 5FD5A 3F23A 2NYXA 1T38A 1B6AA 5DD4A 5L3BA 1QGPA 2DO7A 4YFXF 1U2WA 5BMZA 2P7VB 1D3YA 1G6NA 3ZN0A 4YG2F 5DUIA 4A6DA 3GW2A 4LK1F 1NHAA 2X0LA 2Z33A 2RVCA 2FF4A 3FHZA 4WK8F 4HX4A 2VBZA 1KA8A 5E17F 4Q47A 4A2UA 2DK5A 5IT3A 2XAQA 4HOBA 2L54A 1QNTA 3QOPA 1YYVA 4XLPF 1RNLA 4HYEA 3I71A 3WGHA 5A2QK 4ON0A 1H9GA 3MEXA 5DUKA 1XD7A 2HS5A 2W84A 3JSPA 1KU3A 3GFJA 4NQWA 4U7BA 2ESHA 3F8CA 5LRRA 3ULQB 4L18B 5LHHA 4UVBA 1QBJA 2P6SA 1KYWA 4R8HA 3HSRA 1GHCA 2HDCA 3K0LA 1O3TA 4OMZA 3ZMVA 2ADUA 3ECHA 2ISZA 1ZG3A 2EFOA 4L9VA 2O03A 4HX8A 3PQKA 3C1DA 2L4AA 1IN7A 2J5PA 2OZUA 2M8EA 4A5NA 2KIUA 4O5VA 1CF7A 3F21A 2LKPA 2F5FA 1YIOA 4IXAA 1F5TA 1PP8F 4UVCA 1BJAA 4KIGA 2VN2A 3J81Z 3G73A 2RKHA 4EGZA 3ECOA 4MQ9F 3EQLF 4CXFA 1I1GA 3E97A 3DPLC 3SZPA 3V8LA 2EJRA 2JSCA 5LGNA 4RAYA 3E5XA 4IVNA 3GFLA 3LWFA 1F1ZA 2GA1A 4UXNA 3TQNA 1XGOA 1FYKA 1I5ZA 1V4RA 3RDIA 2YX4A 3C18A 5TRDA 1R1TA 2B0LA 4R1HA 2M5WA 3GXOA 4F7ZA 4ZYHA 1W5SA 1V3FA 4ASNA 2IJLA 2IW5A 2ZCWA 2QQAA 3LAPA 4S05A 1IF1A 1J9IA 3M1EA 2IT0A 5FFZA 5DCMB 5D8KB 1XN7A 2EFWA 2FE3A 2K86A 3R0JA 3KETA 2VE8A 3COAC 4XSZF 5HDGA 3WTTC 1RIOH 3Q9SA 3BZ6A 3T1BA 4BH9A 1STZA 3TDUC 2F2EA 4BHCA 3W6KB 1SFXA 2IPQX 3WTYC 3B02A 1FT9A 4WCGA 1DPRA 5FFXA 1XDSA 2PLYA 2YR2A 4L5IA 4BQAA 3E5UA 2HTSA 3GUDA 3MQ0A 3HRTA 1KU2A 1YFHA 4OINF 2EWNA 2M87A 1S7OA 1SFUA 4N9HA 2H6CA 2UXXA 5HVQC 4ENJA 3BROA 5ICGA 5JVTA 2OU2A 4EMSA 1SMTA 5E18F 2VBYA 1LVAA 1TTYA 3WGGA 3HSFA 4G7HF 1YQAA 1GXQA 5DCFA 1REPC 3FM5A 4BXUA 5J6XA 4KN4X 1HW2A 2KIFA 1PP7U 1HSJA 3QP6A 2IA2A 2V79A 5J8FA 1MDMA 4M6XA 4YIIA 2PMHA 1S6LA 5D5UB 2YPRA 3S2WA 3I54A 2Z99A 1CGPA 2K7LA 2YU3A 3K2ZA 4PCQA 2DQRA 1KU9A 3ELKA 2MA3A 1IXCA 2O61A 1P4AA 1P4XA 5DCMA 3I59B 4QWQA 2BYVE 2OAZA 2BE5F 2XGXA 4HF1A 2QENA 1P92A 4AIHA 3J80K 1Z7UA 1W5TA 3KLOA 4G6DA 2KKOA 1F9NA 4HLYA 1T0FA 1BI3A 3V4GA 1S3JA 5D5XB 1OPCA 4Q48A 4P9UA 4M74A 4A0YA 2CSOA 1BBYA 1YW7A 2CQKA 4EJUA 2C6YA 2AXLA 4LJZF 3I0TA 1Z6RA 4M9ZA 1XGMA 1B59A 1R22A 2CW0F 4HDUA 4Y13A 3IC7A 5D6EA 5BOXA 5FO5A 1TLHB 5TJJA 3F8NA 4A5MA 2KJCA 3VFZA 3JSOA 5D4RA 1KU7A 1MKMA 1WI9A 3CO7C 1O7LA 5CYVA 1OYWA 1AOYA 3FX3A 4YIFA 5K5OA 3HYIA 4CYDA 3P9KA 4P9FA 2P8TA 4I98B 1AWCA 4RGXA 3M8FA 1IN5A 4NHJA 4A0XA 1MGTA 2A68F 3LQQA 1W7PA 4M73A 3RPQA 1G3YA 3DQVC 3FMSA 4LB5A 4AIKA 5CVUA 5ILUA 1TQIA 4U0WA 3T8RA 5F6FA 3RKXA 2RN7A 3KP4A 1ZYRF 3I59A 2YSRA 2F5DA 1SMYF 4CZZA 5H6QA 1USTA 2O3FA 5DYMA 2FMLA 2XKOA 2PN6A 2VOOA 2IA1A 4IPAA 2DT5A 4KA4A 2ZXJA 3T8TA 4I0BA 1O57A 1XGNA 2IA0A 2DI3A 2CG4A 4UHTA 2FNAA 1FSHA 4U0YA 3K1NA 4EJOA 3IRQA 1E17A 1R5GA 3ZMUA 1HKTA 4B8XA 5LLQA 2Y48A 3V7SA 1IZ1A 1KYZA 1Z6TA 1B4AA 3QU3A 1XSDA 1R1VA 1ZARA 5KVRA 2MLGA 3C7JA 4M72A 5FLXK 5LGUA 4MQVA 5L3EA 5HLGA 2DAOA 3T5XA 3IWFA 2XASA 1IN4A 3FF5A 3MZYA 1KQ8A 2QUFA 1U6GA 1FYMA 3ZN1A 4PGGA 5E20A 1TBXA 4LB6B 1CF7B 2BGCA 4WXCA 1LB2A 1TNSA 2XUBA 1YS6A 2XHKA 2JTVA 4HV5A 2PFBA 3EDPA 4U7DA 5H6RA 5CVVA 4HX7A 2JRTA 5F64A 4HBLA 3E3VA 1BI2A 4L0YB 2PJPA 3KP6A 2A61A 1IXSB 3R60A 2XROA 3JTHA 2OD5A 3E6CC 2DFIA 3M7GA 2F5EA 3N4MA 3NEUA 2HR3A 2L4MA 3H3UA 4EV0A 5A2QZ 2IRFG 3DFGA 2A69F 4RS8A 1XCVA 5CVRA 3ZMZA 2G7UA 1LQ1A 3ZMSA 5EEHA 3MWMA 4L9JA 3ZQ7A 4G6QA 1IAWA 3QAHA 1TQPA 2COMA 1J0RA 2RDPA 3KLNA 3TOAA 3ML6A 2H94A 4EQQA 4RB1A 3CO6C 4ESBA 4IF4A 2WTEA 3R6SA 2VBXA 3HRMA 3R4KA 1HBXG 2XAHA 3IKVA 3QPHA 2Z9OA 4LG0B 1JE8A 2HWVA 1USSA 4G8XA 1SD4A 1SD6A 2TDXA 3LQRA 1PUEE 1IW7F 1K78A 3GX4X 5HS7A 1FC3A 1IXRC 4HA8A 2RQPA 4U0VA 1FYLA 1QZYA 1K79A 1RZ4A 3K69A 5HOOA 2W24A 4ETSA 4LLLA 2ZFWA 2FXAA 2OA4A 3GZ5A 4A6EA 3EETA 3NQOA 3Q9VA 1SAXA 1HKQA 2HYGD 1MJBA 5E8IA 1W7PD 2E7XA 2E7WA 3RTRA 1ON1A 3L2CA 4M6YA 4A0ZA 4G7ZF 3O3KA 4RAZA 1ON2A 2FOKA 1ZG5A 3U1DA 1IUYA 5L3CA 2EFPA 3CDHA 4CHUA 3I53A 2GWRA 1MDMB 1ZH5A 4LFUA 4G7OF 3BJAA 5L3FA 2P6TA 1S7AA 2M30A 5AONA 2QWWA 5LBQA 4ZYDA 2JT1A 4EJTA 1IN6A 4HDVA 2EV5A 2LF8A 4WX9A 3LFKA 1P6RA 1R23A 5LHGA 2EV6A 4EJVA 4LMYA 4I0AA 2FEZA 4LLGF 1D5VA 2JPCA 3RIRA 4MGRA 3EYYA 3FXRA 2RC4A 4RB2C 1WSUA 1J7KA 3TO9A 1TNTA 1SD5A 4JQFA 5EEGA 5D5WB 2FBIA 4LG0A 1GXPA 4FX0A 4P55A 5HDNA 2EA2A 1YO5C 4KDPA 2W85A 3T0YA 5K5QA 5D4SA 3KZYA 2LSOA 1T2KA 5HS8A 4IJAA 2UWMA 4S04A 3I4PA 2CFXA 1SFEA 5E1XA 2ZBKA 2WWYA 3HHGA 2XAGA 4M9SA 2Z5UA 1FBUA 3BY6A 2XVCA 1FSEA 4I02A 3VEPA 1LDDA 2FU4A 1EH6A 4FX4A 1PDNC 4GGGA 3KP5A 1ZREA 5ED4A 2CGPA 4Y15A 3G3ZA 4ENNA 1HW1A 4BHBA 3WTWC 4HAMA 2XRNA 3F8MA 2DBBA 2F5CA 1LJ9A 1YLFA 3WE2A 4XLNF 1IN8A 3ROUA 2W57A 2J5OA 4L9TA 1L0OC 3D0SA 2L3DA 1G4DA 1W7PB 3J80Z 1FNNA 5E1WA 3Q5FA 1JHHA 3F22A 3ZMDA 3LSTA 3U2RA 2PBIA 1ZLKA 2NNYA 2V1DA 4AWXB 3IRRA 2VBWA 3FXUA 2QBYB 3GO5A 2PG4A 4H0EA 4N9IA 1QZZA 3V7CA 1TW2A 3BJ6A 3FZVA 1YTYA 5AIPA 1UHMA 4PDKA 2STWA 3FM3A 5H20A 3L7WA 3MCZA 3JAMZ 4M9XA 1IRFA 3I58A 1FX7A 2EFQA 3HUGA 3GFMA 4PZJA 1D8JA 4NB5A 4UV9A 1EH7A 3SXYA 1B9MA 4FHTA 1G3WA 3BP8A 2PI0A 4E70A 3VODA 4EJWA 3PQJA 2P5KA 4I01A 5D6FA 4XBFA 1BOAA 1Y0UA 4XSXF 4I09A 1MD0A 1HQCA 4BAYA 4L5JA 3JAMK 3TDZC 2DW4A 4AIJA 1FLIA 2R7FA 1J75A 1XB4A 2UXNA 4DNCA 3CLOA 4EM1A 1YW9A 1T6SA 1Z1DA 1FBQA 1R5HA 4I7HA 2HOEA 1KQ0A 1OR7A 2EV0A 5LEJA 2BEOA 2GIVA 5CJ9A 1J5YA 2K27A 1WRJA 4HW0A 4HQMA 1HW5A 3ABTA 1G3TA 3IL2A 2P7CB 3WTZA 3W6JB 1QO0D 5FD6A 2HGCA 4KICA 1ULYA 3CUQB 4GYGA 3GWZA 1H0MA 2V9VA 2IVMA 3H3ZA 3E6DA 3PFIA 2E1NA 5DDGA 5DV5A 4MTDA 4BHPA 2EFNA 4LGWA 4IHSA 2P4WA 2IP2A 1FP2A 1R00A 1S8NA 1LNWA 4KNYA 4D0PA 4KYWA 4GYIA 2X4HA 2QBYA 1XGSA 3FXQA 2WC2A 3GLXA 2XKPA 3M9AA 1WQ2A 2GQQA 3CUQC 3P9IA 2H6BA 1RUOA 2FA5A 2K4BA 3C3WA 4IRGA 1VTNC 1QPMA 1O7FA 3DKWA 4LD5A 1BC7C 3HIFA 2V1XA 1J59A 3H92A 4Z2YA 1ZN2A 3RKYA 3DV8A 3GVAA 1ZRFA 3RYRA 5FLXZ 2XV4S 3R0AA 2EA4A 3BDDA 3ZPLA 1FPQA 4EGYA 1GVJA 1OKRA 1RI7A 4KFCA 4GXOA 2MBFA 3GFIA 3V7RA 4HLXA 3HSEA 2ESNA 2AS5F 2H09A 5D8LB 2K4JA 4JBAA 1K78B 1HSTA 1SD7A 4MEXF 2DU9A 2NNNA 5CVIA 4EM0B 2E1CA 3FWEA 3DP7A 4P5OA 5BPIA 3KP7A 4YFKF 3B73A 3WU1B 3V8KA 4UV8A 3CUQA 1W4MA 2QM3A 2P5LC 4TV7A 3WODF 4EVIA 1U3EM 3MFKA 1XMKA 4KMFA 5CLSA 3F6OA 3BJOA 1HKSA 3DF8A 1FY7A 2H27A 3RJPA 3KZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHH A;  1ZAO A;  4OIR F;  1EV7 A;  4LK0 F;  3KCC A;  4MTE A;  4EM2 A;  1Z9C A;  1LEB A;  1DP7 P;  5IT9 K;  3REO A;  4N0B A;  5E1Z B;  4RGU A;  5K1Y A;  4FT8 A;  4RGS A;  1FWZ A;  2CYY A;  3IHU A;  1EH8 A;  1L3L A;  1DDN A;  5JHU A;  2ACJ A;  2ZKZ A;  1R7J A;  3L00 A;  3FMQ A;  2DQL A;  2D1H A;  2PEX A;  4KT5 C;  5HLI A;  5ERI A;  1P2F A;  4AVP A;  2RGV A;  2D1V A;  2LF7 A;  2FBK A;  2NAZ A;  1D8K A;  4RB0 A;  1ONV A;  4OMY A;  3WG9 A;  2Q8K A;  1LDJ A;  2JZY A;  2ZO4 A;  3QP5 A;  2QQ9 A;  4DQ2 A;  3CJN A;  2EK5 A;  2M45 A;  5L3D A;  4ESF A;  2VE9 A;  2ETH A;  2QVO A;  4OOI A;  2W25 A;  1UHW A;  5DEQ A;  1G3S A;  3CUO A;  4WF2 A;  3RYP A;  1WKM A;  2ELH A;  2OZ6 A;  1KQ9 A;  1ZGJ A;  4UNO A;  2FQ3 A;  1BIB A;  1R36 A;  5BS6 A;  2VT3 A;  5JI6 A;  1RUN A;  3K1P A;  2GXB A;  4ENK A;  1MZB A;  1U78 A;  2V6C A;  1S29 A;  2HQR A;  2XIG A;  3WTX C;  2FRH A;  2GZW A;  2PQ8 A;  3QRF F;  2EB7 A;  2NRA C;  6PAX A;  3RPU A;  2OQR A;  3I5U A;  3KEQ A;  4WXH A;  2OBP A;  3SQN A;  4MNU A;  1ZHF A;  1FOK A;  2ZNZ A;  2MH2 A;  2KJB A;  2G9W A;  3HTU A;  4ENM A;  1B1B A;  2L02 A;  3GEZ A;  3P9C A;  1P4W A;  1XDU A;  5ILS A;  2D2W A;  3I64 A;  4PGH A;  1R58 A;  3OOP A;  4G94 A;  1HXD A;  2K02 A;  3ABU A;  4YFN F;  4KUM A;  3BOQ A;  3E5Q A;  4L0Z B;  2DPD A;  1E2X A;  2MD5 A;  2L01 A;  4WWC A;  4HF0 A;  5E8G A;  3J81 K;  2GXG A;  4K2E A;  2LDU A;  4ZYE A;  3KP3 A;  3WGI A;  2BBY A;  4O6J A;  5KK1 A;  5LRS A;  1Z05 A;  3K1M A;  4CIC A;  1TW3 A;  2HEO A;  1XSX A;  3HTS B;  4OIO F;  1UB9 A;  3DEU A;  2XAF A;  4UUV A;  2NS0 A;  1YW8 A;  3DPT A;  3LA7 A;  4B09 A;  4GCV A;  1FP1 D;  1F4K A;  2VC0 A;  1C0W A;  4OU0 A;  4KMU X;  3TO7 A;  3F3X A;  1U8R A;  3HRU A;  4UVA A;  3IWZ A;  2A6E F;  3CTA A;  5K5R A;  4KIF A;  1JGS A;  2Y75 A;  2HZT A;  1ZRD A;  3MAJ A;  2GA2 A;  5LEK A;  2OQG A;  1Z91 A;  2UZK A;  4M71 A;  4P96 A;  2R7D A;  2Y0M A;  3KE2 A;  1I1S A;  3F72 A;  2HYF A;  1KGS A;  2FBH A;  1R1U A;  2JPB A;  3J7A O;  3LA2 A;  1ZG1 A;  1I27 A;  4CGZ A;  3WU0 A;  2ZME B;  4ESJ A;  4Q5S F;  3K9T A;  2GAU A;  3ZMT A;  2KIM A;  3P7N A;  2R3S A;  1YG2 A;  2VON A;  3D5L A;  1Q1H A;  3O2P E;  2Q0O A;  3LAJ A;  1O3Q A;  5HDK A;  2DTR A;  3HRS A;  4HQE A;  1JHF A;  1WWX A;  4MHG A;  4HF2 A;  3AAF A;  3BWG A;  4JK1 X;  5ICF A;  3MZH A;  2VXZ A;  4ZYG A;  1X3U A;  5LHI A;  3QU6 A;  4XRF A;  2CO5 A;  2KRF A;  1FZP B;  2VOP A;  5BPD A;  2P5V A;  3BPX A;  5FB2 A;  4QLC U;  4RGR A;  2O0Y A;  1ZRC A;  4ZZD A;  4Q4Z F;  4I2O A;  5JFR A;  5F1R A;  3VOE A;  1H9T A;  1ODD A;  1BM9 A;  5J8C A;  3SZT A;  3EYI A;  2PMU A;  1MJA A;  1I6X A;  1BIA A;  1UCR A;  5FGM A;  5DD8 A;  1YS7 A;  3OV8 A;  1BN5 A;  1DUX C;  2MLK A;  1TQM A;  3R61 A;  2VOD A;  4ZZL A;  1A04 A;  1UFM A;  2O6G E;  5JR3 A;  2WV0 A;  3F6V A;  1OYY A;  3KFW X;  2ISY A;  5ILV A;  2FNP A;  3HOT A;  1MJ9 A;  1U5T B;  3JW4 A;  3QPT A;  4KN7 X;  1T39 A;  4ZH4 F;  3WTS C;  2DLL A;  4KIB A;  3WTU C;  1O3S A;  2O8X A;  2MC3 A;  3F8B A;  2MH9 A;  1J2X A;  2ZME A;  3SFZ A;  2HKX A;  2Q2E A;  2HTJ A;  3HOS A;  5AIQ A;  5ICC A;  3JTG A;  3N97 A;  1B9N A;  1LDK B;  2A5Y B;  5LGT A;  1U5T C;  4L9N A;  3F8F A;  1JXS A;  3GZ6 A;  2A3S A;  3KP2 A;  3RI4 A;  4RB3 C;  1XCB A;  2RV8 A;  2VC1 A;  4IHT A;  1LEA A;  5BQT A;  2CWE A;  1OYI A;  3GF2 A;  4HZF A;  4Y17 A;  5L3G A;  1O3R A;  3M8E A;  1BI1 A;  3ISP A;  3BPV A;  4CO8 A;  2DK8 A;  2QLZ A;  4G9Y A;  2QZ8 A;  4AD9 A;  1FBS A;  5D5V B;  1BC8 C;  2FSW A;  5ICE A;  4OIQ F;  2XAJ A;  4HV6 A;  3WTV C;  3U9G A;  4BYY A;  2QQB A;  1K6O A;  2HFH A;  3E6B A;  3TOB A;  2FMY A;  2STT A;  1IRG A;  3L09 A;  4O3M A;  1OMI A;  3ZP5 A;  2QYO A;  3DXJ F;  4A12 A;  2HQN A;  1XSV A;  1QQI A;  4IRH A;  3ERE D;  2G7H A;  2V1U A;  1ZGA A;  2HKO A;  1DPU A;  3V8J A;  2VT2 A;  3O6B B;  2DPU A;  1U5T A;  3GYH X;  4WXD A;  4MEY F;  2M1B A;  4R79 A;  1ZLJ A;  3TKY A;  1T98 A;  4BNC A;  2Z3Y A;  3LA3 A;  4LLN A;  3NRV A;  3FMR A;  3IKT A;  5CVJ A;  5IT9 Z;  2D45 A;  4IRI A;  2A6H F;  3VB2 A;  2ZJ2 A;  3TO6 A;  3EUH A;  2A07 F;  3TGN A;  4U88 A;  2ZNY A;  5HLH A;  1BI0 A;  3RKW A;  3L9F A;  4GO1 A;  2LNB A;  1XMA A;  4OIP F;  2RNJ A;  3SHF A;  3WE3 A;  1K7A A;  5HS9 A;  2YX7 A;  3E6M A;  3KEO A;  4CDG A;  2BV6 A;  5FD5 A;  3F23 A;  2NYX A;  1T38 A;  1B6A A;  5DD4 A;  5L3B A;  1QGP A;  2DO7 A;  4YFX F;  1U2W A;  5BMZ A;  2P7V B;  1D3Y A;  1G6N A;  3ZN0 A;  4YG2 F;  5DUI A;  4A6D A;  3GW2 A;  4LK1 F;  1NHA A;  2X0L A;  2Z33 A;  2RVC A;  2FF4 A;  3FHZ A;  4WK8 F;  4HX4 A;  2VBZ A;  1KA8 A;  5E17 F;  4Q47 A;  4A2U A;  2DK5 A;  5IT3 A;  2XAQ A;  4HOB A;  2L54 A;  1QNT A;  3QOP A;  1YYV A;  4XLP F;  1RNL A;  4HYE A;  3I71 A;  3WGH A;  5A2Q K;  4ON0 A;  1H9G A;  3MEX A;  5DUK A;  1XD7 A;  2HS5 A;  2W84 A;  3JSP A;  1KU3 A;  3GFJ A;  4NQW A;  4U7B A;  2ESH A;  3F8C A;  5LRR A;  3ULQ B;  4L18 B;  5LHH A;  4UVB A;  1QBJ A;  2P6S A;  1KYW A;  4R8H A;  3HSR A;  1GHC A;  2HDC A;  3K0L A;  1O3T A;  4OMZ A;  3ZMV A;  2ADU A;  3ECH A;  2ISZ A;  1ZG3 A;  2EFO A;  4L9V A;  2O03 A;  4HX8 A;  3PQK A;  3C1D A;  2L4A A;  1IN7 A;  2J5P A;  2OZU A;  2M8E A;  4A5N A;  2KIU A;  4O5V A;  1CF7 A;  3F21 A;  2LKP A;  2F5F A;  1YIO A;  4IXA A;  1F5T A;  1PP8 F;  4UVC A;  1BJA A;  4KIG A;  2VN2 A;  3J81 Z;  3G73 A;  2RKH A;  4EGZ A;  3ECO A;  4MQ9 F;  3EQL F;  4CXF A;  1I1G A;  3E97 A;  3DPL C;  3SZP A;  3V8L A;  2EJR A;  2JSC A;  5LGN A;  4RAY A;  3E5X A;  4IVN A;  3GFL A;  3LWF A;  1F1Z A;  2GA1 A;  4UXN A;  3TQN A;  1XGO A;  1FYK A;  1I5Z A;  1V4R A;  3RDI A;  2YX4 A;  3C18 A;  5TRD A;  1R1T A;  2B0L A;  4R1H A;  2M5W A;  3GXO A;  4F7Z A;  4ZYH A;  1W5S A;  1V3F A;  4ASN A;  2IJL A;  2IW5 A;  2ZCW A;  2QQA A;  3LAP A;  4S05 A;  1IF1 A;  1J9I A;  3M1E A;  2IT0 A;  5FFZ A;  5DCM B;  5D8K B;  1XN7 A;  2EFW A;  2FE3 A;  2K86 A;  3R0J A;  3KET A;  2VE8 A;  3COA C;  4XSZ F;  5HDG A;  3WTT C;  1RIO H;  3Q9S A;  3BZ6 A;  3T1B A;  4BH9 A;  1STZ A;  3TDU C;  2F2E A;  4BHC A;  3W6K B;  1SFX A;  2IPQ X;  3WTY C;  3B02 A;  1FT9 A;  4WCG A;  1DPR A;  5FFX A;  1XDS A;  2PLY A;  2YR2 A;  4L5I A;  4BQA A;  3E5U A;  2HTS A;  3GUD A;  3MQ0 A;  3HRT A;  1KU2 A;  1YFH A;  4OIN F;  2EWN A;  2M87 A;  1S7O A;  1SFU A;  4N9H A;  2H6C A;  2UXX A;  5HVQ C;  4ENJ A;  3BRO A;  5ICG A;  5JVT A;  2OU2 A;  4EMS A;  1SMT A;  5E18 F;  2VBY A;  1LVA A;  1TTY A;  3WGG A;  3HSF A;  4G7H F;  1YQA A;  1GXQ A;  5DCF A;  1REP C;  3FM5 A;  4BXU A;  5J6X A;  4KN4 X;  1HW2 A;  2KIF A;  1PP7 U;  1HSJ A;  3QP6 A;  2IA2 A;  2V79 A;  5J8F A;  1MDM A;  4M6X A;  4YII A;  2PMH A;  1S6L A;  5D5U B;  2YPR A;  3S2W A;  3I54 A;  2Z99 A;  1CGP A;  2K7L A;  2YU3 A;  3K2Z A;  4PCQ A;  2DQR A;  1KU9 A;  3ELK A;  2MA3 A;  1IXC A;  2O61 A;  1P4A A;  1P4X A;  5DCM A;  3I59 B;  4QWQ A;  2BYV E;  2OAZ A;  2BE5 F;  2XGX A;  4HF1 A;  2QEN A;  1P92 A;  4AIH A;  3J80 K;  1Z7U A;  1W5T A;  3KLO A;  4G6D A;  2KKO A;  1F9N A;  4HLY A;  1T0F A;  1BI3 A;  3V4G A;  1S3J A;  5D5X B;  1OPC A;  4Q48 A;  4P9U A;  4M74 A;  4A0Y A;  2CSO A;  1BBY A;  1YW7 A;  2CQK A;  4EJU A;  2C6Y A;  2AXL A;  4LJZ F;  3I0T A;  1Z6R A;  4M9Z A;  1XGM A;  1B59 A;  1R22 A;  2CW0 F;  4HDU A;  4Y13 A;  3IC7 A;  5D6E A;  5BOX A;  5FO5 A;  1TLH B;  5TJJ A;  3F8N A;  4A5M A;  2KJC A;  3VFZ A;  3JSO A;  5D4R A;  1KU7 A;  1MKM A;  1WI9 A;  3CO7 C;  1O7L A;  5CYV A;  1OYW A;  1AOY A;  3FX3 A;  4YIF A;  5K5O A;  3HYI A;  4CYD A;  3P9K A;  4P9F A;  2P8T A;  4I98 B;  1AWC A;  4RGX A;  3M8F A;  1IN5 A;  4NHJ A;  4A0X A;  1MGT A;  2A68 F;  3LQQ A;  1W7P A;  4M73 A;  3RPQ A;  1G3Y A;  3DQV C;  3FMS A;  4LB5 A;  4AIK A;  5CVU A;  5ILU A;  1TQI A;  4U0W A;  3T8R A;  5F6F A;  3RKX A;  2RN7 A;  3KP4 A;  1ZYR F;  3I59 A;  2YSR A;  2F5D A;  1SMY F;  4CZZ A;  5H6Q A;  1UST A;  2O3F A;  5DYM A;  2FML A;  2XKO A;  2PN6 A;  2VOO A;  2IA1 A;  4IPA A;  2DT5 A;  4KA4 A;  2ZXJ A;  3T8T A;  4I0B A;  1O57 A;  1XGN A;  2IA0 A;  2DI3 A;  2CG4 A;  4UHT A;  2FNA A;  1FSH A;  4U0Y A;  3K1N A;  4EJO A;  3IRQ A;  1E17 A;  1R5G A;  3ZMU A;  1HKT A;  4B8X A;  5LLQ A;  2Y48 A;  3V7S A;  1IZ1 A;  1KYZ A;  1Z6T A;  1B4A A;  3QU3 A;  1XSD A;  1R1V A;  1ZAR A;  5KVR A;  2MLG A;  3C7J A;  4M72 A;  5FLX K;  5LGU A;  4MQV A;  5L3E A;  5HLG A;  2DAO A;  3T5X A;  3IWF A;  2XAS A;  1IN4 A;  3FF5 A;  3MZY A;  1KQ8 A;  2QUF A;  1U6G A;  1FYM A;  3ZN1 A;  4PGG A;  5E20 A;  1TBX A;  4LB6 B;  1CF7 B;  2BGC A;  4WXC A;  1LB2 A;  1TNS A;  2XUB A;  1YS6 A;  2XHK A;  2JTV A;  4HV5 A;  2PFB A;  3EDP A;  4U7D A;  5H6R A;  5CVV A;  4HX7 A;  2JRT A;  5F64 A;  4HBL A;  3E3V A;  1BI2 A;  4L0Y B;  2PJP A;  3KP6 A;  2A61 A;  1IXS B;  3R60 A;  2XRO A;  3JTH A;  2OD5 A;  3E6C C;  2DFI A;  3M7G A;  2F5E A;  3N4M A;  3NEU A;  2HR3 A;  2L4M A;  3H3U A;  4EV0 A;  5A2Q Z;  2IRF G;  3DFG A;  2A69 F;  4RS8 A;  1XCV A;  5CVR A;  3ZMZ A;  2G7U A;  1LQ1 A;  3ZMS A;  5EEH A;  3MWM A;  4L9J A;  3ZQ7 A;  4G6Q A;  1IAW A;  3QAH A;  1TQP A;  2COM A;  1J0R A;  2RDP A;  3KLN A;  3TOA A;  3ML6 A;  2H94 A;  4EQQ A;  4RB1 A;  3CO6 C;  4ESB A;  4IF4 A;  2WTE A;  3R6S A;  2VBX A;  3HRM A;  3R4K A;  1HBX G;  2XAH A;  3IKV A;  3QPH A;  2Z9O A;  4LG0 B;  1JE8 A;  2HWV A;  1USS A;  4G8X A;  1SD4 A;  1SD6 A;  2TDX A;  3LQR A;  1PUE E;  1IW7 F;  1K78 A;  3GX4 X;  5HS7 A;  1FC3 A;  1IXR C;  4HA8 A;  2RQP A;  4U0V A;  1FYL A;  1QZY A;  1K79 A;  1RZ4 A;  3K69 A;  5HOO A;  2W24 A;  4ETS A;  4LLL A;  2ZFW A;  2FXA A;  2OA4 A;  3GZ5 A;  4A6E A;  3EET A;  3NQO A;  3Q9V A;  1SAX A;  1HKQ A;  2HYG D;  1MJB A;  5E8I A;  1W7P D;  2E7X A;  2E7W A;  3RTR A;  1ON1 A;  3L2C A;  4M6Y A;  4A0Z A;  4G7Z F;  3O3K A;  4RAZ A;  1ON2 A;  2FOK A;  1ZG5 A;  3U1D A;  1IUY A;  5L3C A;  2EFP A;  3CDH A;  4CHU A;  3I53 A;  2GWR A;  1MDM B;  1ZH5 A;  4LFU A;  4G7O F;  3BJA A;  5L3F A;  2P6T A;  1S7A A;  2M30 A;  5AON A;  2QWW A;  5LBQ A;  4ZYD A;  2JT1 A;  4EJT A;  1IN6 A;  4HDV A;  2EV5 A;  2LF8 A;  4WX9 A;  3LFK A;  1P6R A;  1R23 A;  5LHG A;  2EV6 A;  4EJV A;  4LMY A;  4I0A A;  2FEZ A;  4LLG F;  1D5V A;  2JPC A;  3RIR A;  4MGR A;  3EYY A;  3FXR A;  2RC4 A;  4RB2 C;  1WSU A;  1J7K A;  3TO9 A;  1TNT A;  1SD5 A;  4JQF A;  5EEG A;  5D5W B;  2FBI A;  4LG0 A;  1GXP A;  4FX0 A;  4P55 A;  5HDN A;  2EA2 A;  1YO5 C;  4KDP A;  2W85 A;  3T0Y A;  5K5Q A;  5D4S A;  3KZY A;  2LSO A;  1T2K A;  5HS8 A;  4IJA A;  2UWM A;  4S04 A;  3I4P A;  2CFX A;  1SFE A;  5E1X A;  2ZBK A;  2WWY A;  3HHG A;  2XAG A;  4M9S A;  2Z5U A;  1FBU A;  3BY6 A;  2XVC A;  1FSE A;  4I02 A;  3VEP A;  1LDD A;  2FU4 A;  1EH6 A;  4FX4 A;  1PDN C;  4GGG A;  3KP5 A;  1ZRE A;  5ED4 A;  2CGP A;  4Y15 A;  3G3Z A;  4ENN A;  1HW1 A;  4BHB A;  3WTW C;  4HAM A;  2XRN A;  3F8M A;  2DBB A;  2F5C A;  1LJ9 A;  1YLF A;  3WE2 A;  4XLN F;  1IN8 A;  3ROU A;  2W57 A;  2J5O A;  4L9T A;  1L0O C;  3D0S A;  2L3D A;  1G4D A;  1W7P B;  3J80 Z;  1FNN A;  5E1W A;  3Q5F A;  1JHH A;  3F22 A;  3ZMD A;  3LST A;  3U2R A;  2PBI A;  1ZLK A;  2NNY A;  2V1D A;  4AWX B;  3IRR A;  2VBW A;  3FXU A;  2QBY B;  3GO5 A;  2PG4 A;  4H0E A;  4N9I A;  1QZZ A;  3V7C A;  1TW2 A;  3BJ6 A;  3FZV A;  1YTY A;  5AIP A;  1UHM A;  4PDK A;  2STW A;  3FM3 A;  5H20 A;  3L7W A;  3MCZ A;  3JAM Z;  4M9X A;  1IRF A;  3I58 A;  1FX7 A;  2EFQ A;  3HUG A;  3GFM A;  4PZJ A;  1D8J A;  4NB5 A;  4UV9 A;  1EH7 A;  3SXY A;  1B9M A;  4FHT A;  1G3W A;  3BP8 A;  2PI0 A;  4E70 A;  3VOD A;  4EJW A;  3PQJ A;  2P5K A;  4I01 A;  5D6F A;  4XBF A;  1BOA A;  1Y0U A;  4XSX F;  4I09 A;  1MD0 A;  1HQC A;  4BAY A;  4L5J A;  3JAM K;  3TDZ C;  2DW4 A;  4AIJ A;  1FLI A;  2R7F A;  1J75 A;  1XB4 A;  2UXN A;  4DNC A;  3CLO A;  4EM1 A;  1YW9 A;  1T6S A;  1Z1D A;  1FBQ A;  1R5H A;  4I7H A;  2HOE A;  1KQ0 A;  1OR7 A;  2EV0 A;  5LEJ A;  2BEO A;  2GIV A;  5CJ9 A;  1J5Y A;  2K27 A;  1WRJ A;  4HW0 A;  4HQM A;  1HW5 A;  3ABT A;  1G3T A;  3IL2 A;  2P7C B;  3WTZ A;  3W6J B;  1QO0 D;  5FD6 A;  2HGC A;  4KIC A;  1ULY A;  3CUQ B;  4GYG A;  3GWZ A;  1H0M A;  2V9V A;  2IVM A;  3H3Z A;  3E6D A;  3PFI A;  2E1N A;  5DDG A;  5DV5 A;  4MTD A;  4BHP A;  2EFN A;  4LGW A;  4IHS A;  2P4W A;  2IP2 A;  1FP2 A;  1R00 A;  1S8N A;  1LNW A;  4KNY A;  4D0P A;  4KYW A;  4GYI A;  2X4H A;  2QBY A;  1XGS A;  3FXQ A;  2WC2 A;  3GLX A;  2XKP A;  3M9A A;  1WQ2 A;  2GQQ A;  3CUQ C;  3P9I A;  2H6B A;  1RUO A;  2FA5 A;  2K4B A;  3C3W A;  4IRG A;  1VTN C;  1QPM A;  1O7F A;  3DKW A;  4LD5 A;  1BC7 C;  3HIF A;  2V1X A;  1J59 A;  3H92 A;  4Z2Y A;  1ZN2 A;  3RKY A;  3DV8 A;  3GVA A;  1ZRF A;  3RYR A;  5FLX Z;  2XV4 S;  3R0A A;  2EA4 A;  3BDD A;  3ZPL A;  1FPQ A;  4EGY A;  1GVJ A;  1OKR A;  1RI7 A;  4KFC A;  4GXO A;  2MBF A;  3GFI A;  3V7R A;  4HLX A;  3HSE A;  2ESN A;  2AS5 F;  2H09 A;  5D8L B;  2K4J A;  4JBA A;  1K78 B;  1HST A;  1SD7 A;  4MEX F;  2DU9 A;  2NNN A;  5CVI A;  4EM0 B;  2E1C A;  3FWE A;  3DP7 A;  4P5O A;  5BPI A;  3KP7 A;  4YFK F;  3B73 A;  3WU1 B;  3V8K A;  4UV8 A;  3CUQ A;  1W4M A;  2QM3 A;  2P5L C;  4TV7 A;  3WOD F;  4EVI A;  1U3E M;  3MFK A;  1XMK A;  4KMF A;  5CLS A;  3F6O A;  3BJO A;  1HKS A;  3DF8 A;  1FY7 A;  2H27 A;  3RJP A;  3KZZ A; 
#chains in the Genus database with same CATH topology
 3HHH A;  3NAU A;  1ZAO A;  4OIR F;  5JVG F;  3B6C A;  3ZCO A;  1EV7 A;  2QSH X;  3OYC A;  4LK0 F;  3KCC A;  2NVQ J;  4MTE A;  4EM2 A;  1Z9C A;  1LEB A;  1YJN I;  1DP7 P;  1VQN I;  5IT9 K;  1ETK A;  3REO A;  4N0B A;  3HDD A;  5E1Z B;  4KIT B;  4RGU A;  2R92 J;  5K1Y A;  4FT8 A;  4RGS A;  1FWZ A;  2DTZ A;  3ZOB A;  2CYY A;  3IHU A;  2WAD A;  1EH8 A;  1L3L A;  1DDN A;  3CCL I;  5JHU A;  2ACJ A;  2L7Z A;  2MW8 A;  2ZKZ A;  1R7J A;  4FET A;  1W0T A;  2CUE A;  2KRH A;  3DBH B;  1ZKG A;  5CQE A;  3L00 A;  3FMQ A;  2DQL A;  4QPQ A;  2D1H A;  2AHQ A;  2PEX A;  4KT5 C;  5HLI A;  2DDA A;  3MVP A;  3OIP A;  4LIV A;  2CQN A;  5IPA A;  2VJJ A;  5ERI A;  1P2F A;  4AVP A;  1S9H A;  4HNU A;  3SEQ A;  1YX3 A;  2RGV A;  2D1V A;  2LF7 A;  2FBK A;  2NAZ A;  1D8K A;  2WAQ A;  4RB0 A;  1ONV A;  4OMY A;  3WG9 A;  3IV5 A;  2Q8K A;  1LDJ A;  2JZY A;  2OJE D;  2ZO4 A;  4E7H A;  2TCT A;  3QP5 A;  2QQ9 A;  4DQ2 A;  2R7T A;  1E0E A;  2HNH A;  3CJN A;  2EK5 A;  3BZK A;  2M45 A;  5L3D A;  4ESF A;  2VE9 A;  2ETH A;  2K85 A;  1D0Z A;  2QVO A;  3WHB A;  4OOI A;  4DIQ A;  2DMP A;  4CSW A;  2W25 A;  1UHW A;  5DEQ A;  3PM1 A;  1G3S A;  3CMY A;  2QA4 I;  3CUO A;  4WF2 A;  3K4C A;  3RYP A;  1WKM A;  2ELH A;  2OZ6 A;  3ZQC A;  1KQ9 A;  4ABZ A;  3CP8 A;  1ZGJ A;  4LIU A;  4JX4 A;  3HOX J;  2O8K A;  1TP4 A;  4UNO A;  2FQ3 A;  1BIB A;  5KAF C;  4M3E A;  2CFO A;  1R36 A;  2AXT C;  1Y8R B;  5BS6 A;  2VT3 A;  2KFD A;  1P7J A;  3H35 A;  3K70 D;  5JI6 A;  1RUN A;  4F93 B;  3K1P A;  1Z67 A;  5J4Y A;  4E4H A;  2GXB A;  4ENK A;  1MZB A;  1U78 A;  2KT0 A;  1V55 H;  2V6C A;  1S29 A;  2HQR A;  3DLL F;  4C3J J;  2V1N A;  3ZQF A;  3EPZ A;  2XIG A;  3WTX C;  2FRH A;  3GBG A;  1JI8 A;  2GZW A;  3CJQ B;  2PQ8 A;  2EZK A;  1PUF B;  3S16 J;  4CCN A;  3G2B A;  3QRF F;  2EB7 A;  1MND A;  2NRA C;  6PAX A;  4XON A;  2LR8 A;  4D9J A;  3RPU A;  2P81 A;  2E2J J;  4G6T B;  2X85 A;  1ETQ A;  2OQR A;  4RMN A;  3I5U A;  3KEQ A;  4HG2 A;  2MSY A;  1N75 A;  2CW7 A;  4MFD A;  1A6I A;  1X3W B;  3FDY A;  4WXH A;  2OBP A;  3GTG J;  2HPM A;  2W00 A;  2R7W A;  1I39 A;  3SQN A;  4DYQ A;  2E60 A;  4A3F J;  4MNU A;  5C4X J;  1X2N A;  3AG4 H;  3BR1 A;  3K7A J;  3BG7 A;  2F5V A;  1BJZ A;  3SDB A;  1ZHF A;  1FOK A;  2ZNZ A;  4M3G A;  2MH2 A;  1V54 H;  1BL0 A;  2KJB A;  3RQI A;  4QSH A;  5FKK A;  2G9W A;  3HTU A;  4AC0 A;  4ENM A;  1B1B A;  2Y0S N;  2HVS A;  5M3M J;  2L02 A;  3GEZ A;  3LSG A;  3P9C A;  1P4W A;  1XDU A;  5ILS A;  2OCC H;  1VQ7 I;  2D2W A;  3AG2 H;  3I64 A;  4PGH A;  1R58 A;  3OOP A;  4G94 A;  4CCL A;  1HXD A;  2K02 A;  3CDL A;  3ABU A;  2CUZ A;  3LL7 A;  2ID3 A;  1WH7 A;  3TED A;  4YFN F;  1A35 A;  4DJA A;  1W0U A;  4KUM A;  3RQ4 A;  1YJ9 I;  4BAC A;  4Y52 J;  1FJL A;  3BOQ A;  3E5Q A;  5J1R A;  3RSN A;  2DPD A;  1E2X A;  4L0Z B;  2Z16 A;  2MD5 A;  2L01 A;  4WWC A;  4HF0 A;  5E8G A;  3J81 K;  5H2F C;  2GXG A;  4DYC A;  4K2E A;  2LDU A;  3K4N A;  4ZYE A;  3KP3 A;  3WGI A;  2BBY A;  1R6R A;  4O6J A;  5CQG A;  2Y9Z A;  4HSR A;  1IGN A;  1MIJ A;  5KK1 A;  5LRS A;  1Z05 A;  3K1M A;  4CIC A;  1TW3 A;  2R7V A;  3BG6 A;  2F6C A;  2HEO A;  1XSX A;  5EYR A;  3BQY A;  2M4K A;  3HTS B;  4OIO F;  3DU6 A;  1UB9 A;  1UAA A;  3DEU A;  3SFI A;  2XAF A;  4YEL A;  4NDL A;  4UUV A;  2NS0 A;  1RRJ A;  1YW8 A;  3DPT A;  3LA7 A;  4B09 A;  4PK4 A;  2ZB9 A;  4GCV A;  1FP1 D;  2DYR H;  1F4K A;  2VC0 A;  1C0W A;  1YOV B;  2W1O A;  4OU0 A;  4KMU X;  3TO7 A;  1Y0N A;  2DT6 A;  3F3X A;  1U8R A;  3HRU A;  1QVU A;  4UVA A;  3IWZ A;  2A6E F;  3CTA A;  5K5R A;  4KIF A;  1JGS A;  2Y75 A;  4BJT A;  2HZT A;  1ZRD A;  3TP3 A;  3IAS 2;  3MAJ A;  3PIP F;  5LD2 C;  2EQR A;  2WY7 Q;  2GA2 A;  4CYC A;  5LEK A;  2DA1 A;  2OQG A;  1Z91 A;  2V4J C;  3A0H C;  2UZK A;  2HQA A;  4M71 A;  4P96 A;  2R7D A;  2Y0M A;  1PUF A;  4BE1 A;  4BXF A;  4IL6 C;  4IOA F;  3KE2 A;  3HL2 A;  1I1S A;  3ONQ A;  5CPR B;  3K4J A;  1W5C C;  2OV7 A;  2HYF A;  1WHU A;  3F72 A;  2O9L A;  4ZYA A;  4CCO A;  3GTM J;  1KGS A;  2VKD A;  2FBH A;  1R1U A;  2JPB A;  4XIC A;  2Q1Z B;  1SVM A;  3J7A O;  3LA2 A;  1ZG1 A;  1I27 A;  1ERD A;  3H5A A;  2E35 A;  4CGZ A;  2PJR A;  3WU0 A;  2ZME B;  2GOM A;  4ESJ A;  4A3D J;  3OS1 A;  1VND A;  3H36 A;  3K9T A;  4Q5S F;  3EUK L;  1EF4 A;  2GAU A;  3ZMT A;  2KIM A;  4H4K C;  3P7N A;  4JP0 A;  2R3S A;  1R4M B;  1YG2 A;  2VON A;  3MZ8 A;  3D5L A;  1Q1H A;  3O2P E;  2Q0O A;  3LAJ A;  1O3Q A;  3OYF A;  5HDK A;  1NK2 P;  2DTR A;  3HB9 A;  4QPO A;  3DPU A;  5F27 A;  3HRS A;  4DZJ A;  3W3C A;  3H1C A;  3J7Y J;  3K70 C;  1JHF A;  4HQE A;  1WWX A;  1VQ9 I;  1UZC A;  4MHG A;  2DMU A;  4HF2 A;  3OYG A;  2CV0 A;  3K6G A;  3AAF A;  3BWG A;  3FBI B;  4JK1 X;  2KMU A;  5ICF A;  4AYB A;  5E3N A;  1TWF J;  1RKT A;  2ZME C;  4XRM A;  3MZH A;  2DT7 B;  2VXZ A;  4ZYG A;  3S3N A;  1X3U A;  5LHI A;  2NVX J;  3QU6 A;  4XRF A;  2CO5 A;  4B43 A;  2KRF A;  2JN6 A;  1FZP B;  1TL8 A;  2VOP A;  2JA5 J;  2LKX A;  1AKH B;  3PO2 J;  4B48 A;  5BPD A;  5C44 J;  2P5V A;  2OTJ I;  9ANT A;  3BPX A;  2DMT A;  4IKF A;  3OMY A;  5FB2 A;  4QLC U;  4RGR A;  2O0Y A;  1RR7 A;  2X1C A;  1DU6 A;  1ZRC A;  4ZZD A;  1ETW A;  4Q4Z F;  4I2O A;  5IOZ A;  5JFR A;  3E7L A;  3I56 I;  5F1R A;  4BY1 J;  3DTE A;  4XLE A;  3VOE A;  1H9T A;  2VPL A;  1LVK A;  4NC6 A;  2IBD A;  2DA2 A;  1HF0 A;  1ODD A;  1BM9 A;  3KX2 A;  5J8C A;  3SZT A;  1OLT A;  4L5E A;  5E3O A;  3EYI A;  2PMU A;  3TMO A;  1MJA A;  1I6X A;  2Y30 A;  2WB1 A;  5FKO A;  2DDB A;  3CCR I;  2R5Z A;  1VQK I;  1BIA A;  1QA6 A;  1UCR A;  3LMM A;  5E79 C;  4KIS A;  5FGM A;  2DFH A;  5DD8 A;  2IEK A;  2LK2 A;  2GLO A;  1YS7 A;  3OV8 A;  2WAF A;  2HOA A;  2JVG A;  3Q3S A;  5KNL A;  1BN5 A;  2DA3 A;  4LG3 A;  3W2W A;  1DUX C;  2MLK A;  1TQM A;  2ZXW H;  1H89 C;  3R61 A;  2VOD A;  5KHD A;  4ZZL A;  1A04 A;  5FRM A;  1UFM A;  2O6G E;  5JR3 A;  2DMQ A;  2WV0 A;  3F6V A;  1OYY A;  3KFW X;  2ISY A;  2M34 A;  5ILV A;  1OCO H;  2FNP A;  3HOT A;  3RPU D;  3GTO J;  1MJ9 A;  1U5T B;  5J4V A;  3MKZ A;  3JW4 A;  4Y4R A;  3QPT A;  4KN7 X;  3SEZ A;  1T39 A;  4BE0 A;  1KZH A;  4ZH4 F;  1D5Y A;  3WTS C;  2DLL A;  4KIB A;  4DW6 A;  3WTU C;  1O3S A;  2R7U A;  3OOU A;  2O8X A;  2MC3 A;  3F8B A;  1ETO A;  2MH9 A;  1J2X A;  2ZME A;  4D5C A;  1QRY A;  3SFZ A;  2XDV A;  2V6E A;  1WJE A;  2HKX A;  1X1P A;  1OIS A;  2Q2E A;  2HTJ A;  2LTP A;  3ABK H;  3HOS A;  2VKH A;  5AIQ A;  5ICC A;  2KZV A;  3PUB A;  1WJF A;  1FTZ A;  3JTG A;  3M07 A;  3N97 A;  1WJB A;  1B9N A;  1LDK B;  2X48 A;  3IH3 A;  2A5Y B;  2K5C A;  5LGT A;  3VDX A;  2H1L A;  2CU7 A;  3C2G A;  4FAS D;  1U5T C;  4L9N A;  3F8F A;  1Z3X A;  1LE8 B;  1JXS A;  3GZ6 A;  5KAI C;  1HOM A;  2A3S A;  3I4N J;  3KP2 A;  3RI4 A;  3ZQQ A;  4RB3 C;  3L2Q A;  1H8A C;  1TWC J;  5FKM A;  2RQQ A;  1XCB A;  3CZ6 A;  2RV8 A;  3CCM I;  2VC1 A;  4IHT A;  2X6Y A;  1LEA A;  2VLA A;  4IQJ A;  5BQT A;  2CWE A;  3PSI A;  1BW6 A;  1OYI A;  2IGM A;  3S3O A;  3GF2 A;  4HZF A;  1IJW C;  3GTL J;  2ZSI B;  2XGD A;  4Y17 A;  2CS3 A;  5L3G A;  1O3R A;  2L5Q A;  3M8E A;  2JVH A;  3EUH C;  1BI1 A;  5B1B H;  4B1R A;  3ISP A;  4FE7 A;  3BPV A;  4CO8 A;  1WJC A;  3MKY B;  2DK8 A;  2QLZ A;  4G9Y A;  2QZ8 A;  2VJI A;  1JJ8 C;  1JJ6 C;  4AD9 A;  1FBS A;  1TWH J;  5D5V B;  1BC8 C;  3GTK J;  4XLF A;  2FSW A;  5ICE A;  1X4O A;  3BR5 A;  2R7Q A;  2DFE A;  2ZJP F;  1NK3 P;  3HPG A;  4OIQ F;  2MAB A;  2XAJ A;  4HV6 A;  3WTV C;  3JCU C;  4OAZ A;  1V5F A;  3U9G A;  4BYY A;  1S7E A;  2QQB A;  1K6O A;  4XKW A;  2HFH A;  3E6B A;  3TOB A;  2FMY A;  3DU5 A;  2STT A;  1IRG A;  2HOT A;  3L09 A;  2ID6 A;  4ZDL A;  4O3M A;  1OMI A;  3ZP5 A;  1S72 I;  2QYO A;  3CF2 A;  2VL8 A;  3S8P A;  4BL0 B;  3O8H A;  1I3Q J;  3DXJ F;  4I99 C;  3JRF A;  2RAE A;  4A12 A;  2L7F P;  2HQN A;  5J1U A;  1XSV A;  1ZR2 A;  4C3I J;  1T08 B;  1HLV A;  3BT9 A;  3A02 A;  1QQI A;  1VI0 A;  1NG7 A;  4IRH A;  2X6W A;  4HRI A;  3ERE D;  1EJ9 A;  2LD5 A;  3S93 A;  3WHC A;  2X51 A;  2G7H A;  3H0D A;  2V1U A;  2D5V A;  1ZGA A;  2HKO A;  1OCR H;  4NQW B;  1DPU A;  1HA8 A;  1MBE A;  3S2D J;  3V8J A;  2VT2 A;  3O6B B;  4XMY A;  1U5T A;  5GAD J;  1MNM C;  2DPU A;  3NAR A;  3BTJ A;  3GYH X;  3BG5 A;  4WXD A;  4JYK A;  4MEY F;  1LKX A;  2M1B A;  3L2V A;  1WVR A;  1ZLJ A;  2LMD A;  3TKY A;  4R79 A;  1JTY A;  3BTL A;  1T98 A;  1LFU P;  4BNC A;  4V2F A;  2A5W A;  2ZSH B;  2Z3Y A;  3LA3 A;  1TZL A;  5K7H A;  4LLN A;  1RES A;  3NRV A;  3FMR A;  1GV2 A;  3IKT A;  3HOZ J;  2JRM A;  5CVJ A;  4AVZ A;  5IT9 Z;  2D45 A;  4IRI A;  2A6H F;  3JRB A;  3VB2 A;  2XB5 A;  2ZJ2 A;  3TO6 A;  2IS1 A;  3M8J A;  5F1J A;  1Y39 A;  3EUH A;  2XSJ C;  2A07 F;  1UJ8 A;  3TGN A;  4U88 A;  2ZNY A;  5HLH A;  1BI0 A;  2UUZ A;  3RKW A;  1ZR4 A;  5EGO B;  1SFK A;  2BW3 B;  3L9F A;  4GO1 A;  2EZL A;  2LNB A;  1XMA A;  4OIP F;  2BVM A;  2X6O A;  2RNJ A;  2OCE A;  3I55 I;  4RA2 A;  2NOJ B;  1LFB A;  3SHF A;  3WE3 A;  1K7A A;  2ZJR F;  5HS9 A;  2YX7 A;  1X2M A;  3E6M A;  1QZE A;  3KEO A;  4XOR A;  2Z2S B;  2BV6 A;  4IEJ A;  2LY2 A;  5FD5 A;  4CDG A;  3S32 A;  4RBO A;  3F23 A;  2NYX A;  1ZGW A;  4KT6 A;  3OS0 A;  1T38 A;  1B6A A;  5DD4 A;  1ETX A;  5L3B A;  2VXD A;  1PYV A;  1QGP A;  2DO7 A;  4PJL A;  4YFX F;  5J1Y A;  1U2W A;  5BMZ A;  2P7V B;  1D3Y A;  1G6N A;  3ZN0 A;  4YG2 F;  5DUI A;  4HEA 2;  4A6D A;  4HST A;  4W1U A;  3GW2 A;  5HOD A;  2F4O B;  3VWB A;  4G12 A;  4LK1 F;  1NHA A;  1X58 A;  2X0L A;  2XPU A;  2Z33 A;  3FXO A;  2ZJQ F;  2BY2 A;  3DTK A;  3KYC B;  4MLO A;  2RVC A;  2VAS A;  2FF4 A;  4XLA A;  1T8I A;  1MMG A;  3FHZ A;  4WK8 F;  4HX4 A;  2IXS A;  2VBZ A;  3OYI A;  1KA8 A;  3HKZ N;  5E17 F;  4Q47 A;  4XNF A;  2K40 A;  4A2U A;  1MSE C;  2DK5 A;  1RET A;  3ZGK A;  5EEA A;  4IZZ A;  5IT3 A;  1VQM I;  2XAQ A;  4PJ0 C;  2OPT A;  4HOB A;  1OCC H;  2L9R A;  4ZTJ A;  1U9N A;  3DEE A;  3F0C A;  4BJ5 C;  2L54 A;  4PJJ A;  3VYR B;  4BDZ A;  1QNT A;  2E1O A;  4IX7 A;  3FIW A;  3QOP A;  3HPH A;  1YYV A;  4XLP F;  1RNL A;  1V5E A;  4HYE A;  4ZDP A;  2CV2 A;  3Q0W A;  2OTL I;  3I71 A;  3WGH A;  1BW5 A;  1Y8Q B;  4C9Y A;  5J3L A;  1UG0 A;  5A2Q K;  4ON0 A;  1H9G A;  2IGK A;  3MEX A;  5DUK A;  1XD7 A;  1SAU A;  3VSL A;  2QSF X;  4AU7 A;  2HS5 A;  2HZD A;  2W84 A;  3K4L A;  3N05 A;  3JSP A;  1KU3 A;  3UNG C;  3GFJ A;  4NQW A;  4U7B A;  1X1D A;  3GTQ J;  2ESH A;  3F8C A;  1YX5 A;  5IP6 A;  5LRR A;  4GFB A;  3VYU B;  3ULQ B;  3KZI C;  4L18 B;  5LHH A;  3X2Q H;  1LUJ B;  2NVT J;  5F0H A;  1FIP A;  4UVB A;  1QBJ A;  2P6S A;  1KYW A;  3FK7 A;  4R8H A;  3L2W A;  3HSR A;  4KJZ A;  1Y1W J;  1GHC A;  4LOC A;  2HDC A;  3K0L A;  4M3B A;  3H5R A;  1IUF A;  3DKX A;  5FKL A;  1V5G A;  1O3T A;  2CRG A;  4OMZ A;  3ZMV A;  2ADU A;  3ECH A;  4CYC B;  2ISZ A;  1O4X A;  1EKE A;  3KEY A;  2WA0 A;  1IV8 A;  1ZG3 A;  3A01 B;  2EFO A;  2CJJ A;  1VF9 A;  1FEX A;  4L9V A;  1JUM A;  1UG2 A;  2O03 A;  1RKW A;  2M4G A;  4HX8 A;  4I76 A;  3PQK A;  3C1D A;  2L4A A;  5EGO A;  2BW3 A;  1IN7 A;  1POG A;  2E36 A;  2J5P A;  4A3I J;  4BXX J;  2OZU A;  4RAF A;  4XLH A;  2M8E A;  4IHX A;  4A5N A;  3CQZ J;  3LSI A;  3K2A A;  2KIU A;  4O5V A;  2PJR B;  1CF7 A;  4HNT A;  3F21 A;  2LKP A;  2F5F A;  2HXI A;  1YIO A;  4IXA A;  2HDD A;  5E3L A;  1F5T A;  1PP8 F;  4UVC A;  2CH0 A;  1BJA A;  4J19 A;  2R0Q C;  4E7J A;  4ZC3 A;  3S1M J;  3BZC A;  2W82 A;  1S5L C;  2COB A;  2EIK H;  1IDY A;  4QIW N;  4KIG A;  3CCE I;  2VN2 A;  3J81 Z;  3G73 A;  2RKH A;  3DEW A;  4EGZ A;  4YEJ A;  2DA6 A;  3ECO A;  4MQ9 F;  1XPX A;  1LPQ A;  1A31 A;  3EQL F;  2LYC A;  4CXF A;  1I1G A;  3E97 A;  2EIM H;  1QVT A;  3DPL C;  3CMA I;  3SZP A;  2RRE A;  1P9Q C;  3V8L A;  2EJR A;  2JSC A;  3VYT B;  1X3Z B;  5LGN A;  4U87 A;  3M3Y J;  4RAY A;  3LSP A;  3E5X A;  4UB6 C;  5F04 A;  4IVN A;  1AU7 A;  3GFL A;  2EZI A;  3LWF A;  3CCV I;  2XPV A;  5TGT A;  3BR3 A;  1WCM J;  4M3F A;  2H1K A;  2IS2 A;  1F1Z A;  4ZJZ A;  4ITV A;  2GA1 A;  3FK6 A;  4MO7 A;  4UXN A;  3TQN A;  1XGO A;  1D1C A;  1FYK A;  1I5Z A;  1V4R A;  3IH2 A;  3RDI A;  2YX4 A;  3C18 A;  1ETV A;  4B4C A;  4RDU A;  2Y69 H;  5TRD A;  2CW8 A;  3FKJ A;  3H9G A;  3PJR A;  1R1T A;  2B0L A;  4R1H A;  3OL4 A;  2M5W A;  3GXO A;  4F7Z A;  4ZYH A;  1W5S A;  2DOD A;  1VFC A;  1V3F A;  2QKL B;  4PSX A;  2IS4 A;  4ASN A;  1GV5 A;  2XAU A;  2IJL A;  2IW5 A;  2ZCW A;  2M2E A;  1WH5 A;  2QQA A;  3LAP A;  4S05 A;  1IF1 A;  3HEF A;  5DM6 F;  1J9I A;  3M1E A;  2IT0 A;  5FFZ A;  5DCM B;  5D8K B;  3QWL A;  3H5N A;  1XN7 A;  5JLX A;  1Z21 A;  2EPF A;  2FE3 A;  2KDO A;  2K86 A;  3R0J A;  3KET A;  2EFW A;  4A3K J;  2VE8 A;  2M0M A;  3COA C;  4XSZ F;  5HDG A;  3OWT A;  3WTT C;  1RIO H;  1G59 A;  3Q9S A;  1H88 C;  4A69 C;  1YE9 A;  1RC9 A;  3BZ6 A;  3CJR B;  3T1B A;  4BH9 A;  2R5Z B;  1U9O A;  1STZ A;  2AQE A;  3TDU C;  2F2E A;  5HNF A;  4BHC A;  4DYR A;  3W6K B;  5FRO A;  2R7S A;  1SFX A;  2IPQ X;  3WTY C;  1FIA A;  5GPA A;  1P7I A;  3B02 A;  3H3V K;  2I10 A;  2ME0 A;  4P1W A;  1FT9 A;  5KCM A;  4WCG A;  1DPR A;  5FFX A;  1XDS A;  2PLY A;  3W2A A;  3A01 A;  2YR2 A;  1F43 A;  4L5I A;  4BQA A;  3E5U A;  2HTS A;  3GUD A;  3MQ0 A;  3G4S I;  1X4P A;  2HOS A;  3HRT A;  1KU2 A;  2BY0 A;  2R5Y B;  1YFH A;  2PMZ N;  3PUF A;  4A3C J;  3K4M A;  4OIN F;  2B9S A;  2EWN A;  2LRE A;  2M87 A;  3E0J B;  1S7O A;  1SFU A;  2JA2 A;  4N9H A;  2H6C A;  4BQO A;  3L1P A;  2UXX A;  1T0F C;  5HVQ C;  3OY9 A;  4ENJ A;  3SYT A;  3BRO A;  5ICG A;  4ZDO A;  2M3A A;  2OU2 A;  5JVT A;  4EMS A;  2Q2E B;  1SMT A;  5E18 F;  4A3B J;  2VBY A;  5EZG A;  2VKV A;  4E7K A;  1LVA A;  1TTY A;  3WGG A;  3HSF A;  4G7H F;  4BUP A;  1YQA A;  1GXQ A;  2JUG A;  1MMS A;  5B1A H;  2VQH A;  3BR0 A;  3RCO A;  5DCF A;  1REP C;  2HPI A;  3FM5 A;  1OQY A;  4BXU A;  5GAG J;  5J6X A;  4KN4 X;  1HW2 A;  2KIF A;  5EF6 A;  1PP7 U;  2L7M P;  1HSJ A;  3QP6 A;  2IA2 A;  1MNE A;  2V79 A;  5J8F A;  3QOD A;  1MDM A;  4M6X A;  4Z6Y A;  4YII A;  2PMH A;  1S6L A;  2OF7 A;  5D5U B;  2HYJ A;  3VYS B;  1MBJ A;  2YPR A;  3S2W A;  3I54 A;  2Z99 A;  4UUT A;  1Q1V A;  3BLY A;  1CGP A;  5GTI C;  2K7L A;  2YU3 A;  3K2Z A;  4PCQ A;  3W2V A;  2DQR A;  4ZTF A;  4UUS B;  1KU9 A;  3ELK A;  4JOM A;  1YIJ I;  2IS6 A;  2MA3 A;  3S3M A;  2GOX B;  4C3H J;  1JGG A;  1T56 A;  1IXC A;  1CQT A;  1BA5 A;  2IGN A;  1KON A;  2O61 A;  1P4A A;  1P4X A;  3KIO A;  2XB0 X;  3JRE A;  5DCM A;  3I59 B;  5CKT A;  1MBK A;  1WJD A;  5EG0 B;  2M8G X;  4QWQ A;  4F3Q A;  2BYV E;  2OAZ A;  2BE5 F;  3PFY A;  2XGX A;  4HF1 A;  2QEN A;  2BY3 A;  1DGR M;  4M3D A;  3ZQI A;  2JJ7 A;  1WZ2 A;  2K9L A;  2XC7 A;  2Y0S A;  1BR4 A;  1P92 A;  4AIH A;  3J80 K;  1Z7U A;  1W5T A;  4XRS A;  3KLO A;  4G6D A;  3QPS A;  3J7A Y;  2JUC A;  2KKO A;  2QQ8 A;  1F9N A;  2LY9 A;  2VQC A;  4HLY A;  1T0F A;  2DOE A;  1BI3 A;  3V4G A;  1S3J A;  2BVL A;  5D5X B;  4D5F A;  5DM7 F;  3LSR A;  2HQ5 A;  1OPC A;  4Q48 A;  4GDF A;  3ZXS A;  4P9U A;  1XMX A;  3ZQG A;  4C2M J;  4M74 A;  2LVS A;  1MH4 A;  5DS9 A;  3P5J A;  2F4I A;  4A0Y A;  1ZEL A;  1K83 J;  2NVY J;  3PL8 A;  1GDT A;  1LFP A;  2CSO A;  4X0G A;  1BBY A;  1YW7 A;  2CQK A;  4E7I A;  4EJU A;  2R5Y A;  5FKN A;  3CC4 I;  3KYL A;  3JRD A;  1JT0 A;  2C6Y A;  2AXL A;  3M1C A;  1GVD A;  4LJZ F;  2DJI A;  1X1A A;  3SDG A;  3QOE A;  3I0T A;  2GBY A;  1Z6R A;  2DCE A;  3LOC A;  1XGM A;  2Y2Z A;  4M9Z A;  2K3F A;  1FOX A;  3BG9 A;  1K61 A;  1B59 A;  1R22 A;  2CW0 F;  5F0F A;  1BOB A;  2HI3 A;  1R71 A;  4HDU A;  2ECC A;  3ASN H;  5M5X J;  1Z3Y A;  4Y13 A;  3HJE A;  3IC7 A;  5D6E A;  5BOX A;  2CQX A;  3OYN A;  5FO5 A;  3OL3 A;  1TLH B;  3HOY J;  5TJJ A;  3F8N A;  4A5M A;  2NVU B;  1ORK A;  2KJC A;  1OCP A;  3VFZ A;  3JSO A;  5D4R A;  1KU7 A;  2GIZ A;  1E3O C;  1MKM A;  1WI9 A;  3CO7 C;  1O7L A;  5J40 A;  5CYV A;  4PJM A;  4QTR A;  1OYW A;  3FXL A;  4II2 A;  3DBR B;  3BR2 A;  3M4O J;  3D5R C;  1AOY A;  3FX3 A;  4YIF A;  1SVO A;  5K5O A;  3HYI A;  2GM4 A;  4CYD A;  2IAI A;  2WAQ N;  1DGW Y;  1SFO J;  3P9K A;  4P9F A;  2P8T A;  4I98 B;  4HNV A;  1AWC A;  4RGX A;  2O7O A;  1IG7 A;  1HDP A;  5EJC A;  2QSG X;  2Y9Y A;  3M8F A;  3OR1 C;  1IN5 A;  2OC6 A;  3ERM A;  4RM2 A;  3BC8 A;  3FIS A;  4NHJ A;  4GRI A;  4A0X A;  2UV1 A;  1MGT A;  2A68 F;  3LQQ A;  1QPI A;  1W7P A;  3DBL B;  4CUG A;  3CF5 F;  4M73 A;  3RPQ A;  2B63 J;  4FTH A;  1G3Y A;  3DQV C;  3HZJ A;  4XKV A;  4B47 A;  3JRA A;  2R4G A;  1ACI A;  1RPW A;  3FMS A;  4UUS A;  2E71 A;  4LB5 A;  4AIK A;  2DA5 A;  3CLQ A;  5CVU A;  5ILU A;  1TQI A;  1SC7 A;  3E1S A;  4W97 A;  4U0W A;  1BR1 A;  3T8R A;  5F6F A;  3RKX A;  2RN7 A;  2HVQ A;  3KP4 A;  3K4K A;  2HDW A;  1WFX A;  1ZYR F;  3I59 A;  1MBH A;  2F5D A;  2YSR A;  5EG0 A;  1SMY F;  4CZZ A;  5H6Q A;  1UST A;  1DU0 A;  2O3F A;  5DYM A;  5GP9 A;  4BDY A;  3TW7 A;  2FML A;  3DLA A;  5F0C A;  1XX5 A;  2XKO A;  2PN6 A;  3G71 I;  2XF7 A;  5HNH A;  2R7R A;  2VOO A;  4E7L A;  2IA1 A;  4IPA A;  2ME6 A;  3IAM 2;  2BY1 A;  5FLV A;  2JA8 J;  2FX0 A;  3CCQ I;  3QYE A;  3GME A;  2DT5 A;  2LG4 A;  4KA4 A;  2X1D A;  2ZXJ A;  3T8T A;  4ANJ A;  4I0B A;  1O57 A;  1Y56 A;  4DBR A;  1XGN A;  2IA0 A;  3H9Q A;  1K4S A;  2L7K A;  3OSG A;  2DI3 A;  2PX9 A;  2CG4 A;  1K6Y A;  4UHT A;  1ENH A;  2QGU A;  2FNA A;  2NS8 A;  1FSH A;  2ZC2 A;  3NWS A;  4U0Y A;  3K1N A;  4EJO A;  3LSJ A;  4OAY A;  3KYD B;  3IRQ A;  1IC8 A;  1Z7L A;  1UEL B;  1E17 A;  3RKQ A;  1R5G A;  3ZMU A;  1HKT A;  4B8X A;  3C2H A;  5LLQ A;  2Y48 A;  1WI3 A;  2E34 A;  3V7S A;  2DA4 A;  5IYB J;  5J47 A;  1IZ1 A;  1KYZ A;  2NXN B;  1Z6T A;  5JHF A;  4XOT A;  4YRV A;  1B4A A;  2KIS A;  3QU3 A;  2K9S A;  3DKY A;  1XSD A;  2DA7 A;  1R1V A;  1JUP A;  1ZAR A;  2Y31 A;  3GCM A;  4E6K G;  3OYD A;  1GT0 C;  2K3P A;  5B3S H;  2XGC A;  2LLK A;  2ICW G;  2YS9 A;  5KVR A;  3GTJ J;  1OFC X;  4CH7 A;  2E1M B;  1XG1 A;  1R49 A;  2MLG A;  3CD6 I;  3C7J A;  4M72 A;  3S15 J;  1MSF C;  2VIX A;  2JA6 J;  3MD2 A;  5FLX K;  5LGU A;  3IUO A;  4MQV A;  4X1E A;  4DZP A;  5L3E A;  4Y7N J;  2LH9 A;  5HLG A;  2DAO A;  3T5X A;  3IWF A;  3WU2 C;  2XAS A;  1IN4 A;  3FF5 A;  3MZY A;  1KQ8 A;  2MFZ A;  5M5Y J;  2QUF A;  1U6G A;  1FYM A;  2VI6 A;  3ZN1 A;  2E2I J;  4PGG A;  5E20 A;  1TBX A;  1FMW A;  5M3F J;  1JKP C;  1NG6 A;  4LB6 B;  1MBG A;  1CF7 B;  2BGC A;  4WXC A;  1LB2 A;  1TNS A;  2XUB A;  4N4N B;  3OS2 A;  3D5S C;  1YS6 A;  3G1L A;  4E7S A;  4A93 J;  2BHZ A;  2E1M C;  1D0Y A;  2XHK A;  3PNY A;  2JTV A;  4HV5 A;  1MMN A;  4XID A;  5F08 A;  2PFB A;  3OYA A;  3HOW J;  3HC7 A;  3EDP A;  4U7D A;  4PFP A;  5H6R A;  5CVV A;  4HX7 A;  2JRT A;  5F64 A;  2B7E A;  2W48 A;  4HBL A;  3E3V A;  1BI2 A;  3CES A;  3ZQL A;  4L0Y B;  4PSW A;  2XF5 A;  2LRD A;  2PJP A;  3KP6 A;  1R9T J;  2A61 A;  1IXS B;  3R60 A;  2XRO A;  3JTH A;  2TRT A;  2OD5 A;  2DXI A;  2X6X A;  3E6C C;  2L9V A;  2DFI A;  3M7G A;  2F5E A;  3N4M A;  1N78 A;  3NEU A;  2HR3 A;  2L2O A;  2L4M A;  4NC8 A;  5E3M A;  2CV1 A;  1D1A A;  3H3U A;  4EV0 A;  4HPQ A;  5K7F A;  5A2Q Z;  2IRF G;  1U8B A;  3DFG A;  2A69 F;  4RS8 A;  1XCV A;  5CVR A;  3ZMZ A;  2G7U A;  1LQ1 A;  1YRN B;  2QCO A;  3OSF A;  3ZMS A;  4X6A J;  2XGE A;  5EEH A;  2V9P A;  3PIO F;  1E3H A;  2M9H A;  3MWM A;  2P0W A;  2LOO A;  4L9J A;  4XLC A;  3ZQ7 A;  4G6Q A;  1IAW A;  3QAH A;  1JKR C;  2DJN A;  2X1E A;  1F36 A;  1TQP A;  2COM A;  1J0R A;  3CDI A;  2YU9 J;  2RDP A;  5FJ8 J;  1J09 A;  3KLN A;  3TOA A;  3OYJ A;  3ML6 A;  1OCZ H;  2H94 A;  4B44 A;  4I6Z A;  4EQQ A;  4RB1 A;  3CO6 C;  4B3A A;  1N77 A;  5GTH C;  1YJW I;  1D1B A;  4BQN A;  3O8G A;  3A03 A;  4ESB A;  4IF4 A;  1B72 B;  2WTE A;  3R6S A;  3QPL A;  2JSP A;  2VBX A;  3HRM A;  3QYF A;  3R4K A;  1ZQ3 P;  1HBX G;  3OIQ A;  2R93 J;  2XAH A;  3IH4 A;  1PVE A;  5IP9 J;  1FOY A;  1JT6 A;  4J01 A;  3BCB A;  3IKV A;  3KPH A;  3QPH A;  1SVL A;  3S14 J;  3MMY B;  4BS9 A;  2Z9O A;  3OYH A;  4LG0 B;  1JE8 A;  2BXY A;  2HWV A;  3I4M J;  1USS A;  2F48 A;  4G8X A;  1SD4 A;  1QHH D;  1SD6 A;  3K4B A;  2TDX A;  1VQ5 I;  1BR2 A;  3LQR A;  1PUE E;  1IW7 F;  1K78 A;  3GX4 X;  4XR6 A;  3CCS I;  5HS7 A;  1FC3 A;  1IXR C;  4HA8 A;  2RQP A;  4U0V A;  1FYL A;  1QZY A;  1K79 A;  1RZ4 A;  2HXO A;  3K69 A;  4MFE A;  5HOO A;  4F52 A;  2JMW A;  1T95 A;  1VQL I;  2W24 A;  1N25 A;  2KL4 A;  2DN0 A;  4PJN A;  4LLL A;  4ETS A;  2ZFW A;  1RR8 C;  2FXA A;  3HXL A;  4IHY A;  2OA4 A;  3GLL A;  1W36 D;  3TP0 A;  2W7N A;  3GZ5 A;  3A1Y A;  3HM5 A;  4A6E A;  1XTA A;  3EET A;  4AYB N;  4BBR J;  3NQO A;  1R5I D;  3Q9V A;  2CQQ A;  1SAX A;  1HKQ A;  1IDZ A;  3CJT B;  2JQ7 A;  1R4N B;  2HYG D;  2EZH A;  4LIT A;  3WG7 H;  2VB6 A;  1MJB A;  3HGG A;  1QHG A;  5E8I A;  1W7P D;  2EBI A;  4NC7 A;  2VPR A;  3JRI A;  2E7X A;  3AKZ A;  3FXK A;  4EAT A;  2E7W A;  2XSD C;  2MGQ A;  3RTR A;  1ON1 A;  3L2C A;  1IRZ A;  4M6Y A;  4A3L J;  5IYC J;  4A0Z A;  1QU3 A;  4G7Z F;  1E3P A;  4JX6 A;  3O3K A;  3S1Q J;  4RAZ A;  1ON2 A;  2FOK A;  3UR3 C;  3U1D A;  1ZG5 A;  3D1N I;  1IUY A;  2DYS H;  3BTC A;  5L3C A;  2CUF A;  2EFP A;  2Z1D A;  3CDH A;  2K9Q A;  4CHU A;  3I53 A;  2BZT A;  2GWR A;  1MDM B;  1ZH5 A;  4LFU A;  4G7O F;  3BJA A;  1YRN A;  5L3F A;  2LBF B;  2I5U A;  3QYB A;  2P6T A;  1S7A A;  2M30 A;  3FXM A;  2WB1 N;  5AON A;  2DFF A;  2QWW A;  5LBQ A;  5FLM J;  3CCJ I;  4ZYD A;  2JT1 A;  2G0E A;  4EJT A;  4J00 A;  1IN6 A;  4HDV A;  2EV5 A;  2LF8 A;  2HVR A;  1JKQ C;  4WX9 A;  1A6Q A;  3LFK A;  1P6R A;  1R23 A;  4C30 A;  5LHG A;  1B72 A;  4BQQ A;  5C4J J;  2MD0 A;  2EV6 A;  3TW6 A;  3CMM A;  4EJV A;  2V9K A;  4LMY A;  1XS9 A;  4IHW A;  4I0A A;  2FEZ A;  4BY7 J;  4RLQ A;  4LLG F;  1D5V A;  2JPC A;  3RIR A;  1YHQ I;  2E2H J;  4MGR A;  3TL4 X;  3EYY A;  4Y3O A;  4CCK A;  3FXR A;  4F91 B;  3CCY A;  2RC4 A;  1FOW A;  5GPC A;  4RB2 C;  3L2R A;  1WSU A;  4FE4 A;  2FJ1 A;  5TIS C;  2JA7 J;  1J7K A;  3TO9 A;  3GTP J;  1TNT A;  4FQG A;  3AG3 H;  1SD5 A;  4JQF A;  5EEG A;  3ESW B;  3FKI J;  3AFH A;  3GZN B;  3QQA A;  3BQZ A;  2KPM A;  5D5W B;  2FBI A;  4LG0 A;  4IO9 F;  1GXP A;  2QEX I;  2GXA A;  4FX0 A;  4P55 A;  3HGY A;  4XN3 A;  5HDN A;  2K9N A;  2EA2 A;  3HUG B;  3CC7 I;  1YO5 C;  5EDN A;  4KDP A;  3HKZ A;  4A3E J;  2ELJ A;  2W85 A;  3T0Y A;  4AUX A;  3UKG A;  2V7F A;  4DGW B;  5K5Q A;  5D4S A;  3KZY A;  5FRN A;  2LSO A;  2CUJ A;  1T33 A;  1T2K A;  4NNJ A;  5DTD A;  3JRG A;  3DTI A;  2VJ4 A;  2KLO A;  1XC5 A;  5HS8 A;  4V2G A;  1M1E B;  4IJA A;  2UWM A;  3HBL A;  4S04 A;  3HOU J;  1TT0 A;  2CFX A;  1SFE A;  2DOA A;  3I4P A;  2EIL H;  5E1X A;  2ZBK A;  2WWY A;  1MW7 A;  3HHG A;  3OYK A;  2XAG A;  4M9S A;  1MH3 A;  4UY8 I;  2Z5U A;  3A2K A;  1FBU A;  1FMV A;  1ZK8 A;  2KQR A;  2EIJ H;  2RNG A;  2XVC A;  3BY6 A;  3OYL A;  1FSE A;  4I02 A;  3VEP A;  1LDD A;  2FU4 A;  1EH6 A;  4BBS J;  4FX4 A;  2AO9 A;  3V42 A;  2XRL A;  1PDN C;  4GGG A;  1JKO C;  3W6V A;  4CCJ A;  4B3X A;  4V19 K;  2LC2 A;  1NH3 A;  2LKS A;  3KP5 A;  4PUS A;  2KHM A;  1ZRE A;  2L9S A;  5ED4 A;  4S0H B;  2CGP A;  3CP2 A;  4Y15 A;  2H8W A;  3AG1 H;  3G3Z A;  3OR2 C;  4ENN A;  1HW1 A;  3U21 A;  4BHB A;  3WTW C;  4HAM A;  3G1O A;  2XRN A;  2QF7 A;  1NTC A;  2DOF A;  3MN2 A;  3F8M A;  2KP6 A;  3JR9 A;  2DBB A;  2F5C A;  2HU9 A;  1LJ9 A;  3B6A A;  1YLF A;  3WE2 A;  4AM3 A;  2FQ4 A;  4N4O B;  2WBM A;  4XLN F;  1IN8 A;  2BHY A;  1WGX A;  3JRH A;  3BTI A;  1YIT I;  5K7Z A;  4II3 A;  3ROU A;  2CMP A;  2FUG 2;  2LBF A;  2W57 A;  3S1R J;  2J5O A;  4L9T A;  1L0O C;  3D0S A;  1OR7 C;  2XPW A;  3ZRG A;  2L3D A;  3LNQ A;  1G4D A;  1GUU A;  1W7P B;  3LFU A;  3J80 Z;  1FNN A;  5E1W A;  1PJR A;  4FIS A;  4M6V A;  3Q5F A;  1JHH A;  3F22 A;  2VKE A;  3HOV J;  3ZMD A;  3LST A;  1X19 A;  2X9D A;  3U2R A;  2VUM J;  1WJ5 A;  2PBI A;  1ZLK A;  2NNY A;  2V1D A;  4AWX B;  4RLF A;  3IRR A;  1UHS A;  2VBW A;  4A3G J;  3FXU A;  3CCU I;  2QBY B;  3GO5 A;  3ABL H;  2PG4 A;  2M7B A;  2IGO A;  4H0E A;  4N9I A;  1QZZ A;  3V7C A;  1TW2 A;  3BJ6 A;  3MKL A;  1W36 C;  3S17 J;  1JTX A;  1AHD P;  5GAE J;  3FZV A;  2MYS A;  3RZD J;  2JK3 A;  2LY1 A;  1YTY A;  1ITY A;  5AIP A;  1UHM A;  4C2T A;  4PDK A;  2WV1 A;  3OYE A;  2STW A;  3FM3 A;  1TWA J;  5H20 A;  2ZFU A;  3L7W A;  3MCZ A;  3L2U A;  3I9V 2;  2KDZ A;  4XK4 A;  3JAM Z;  4M9X A;  1IRF A;  1YI2 I;  2JWT A;  3I58 A;  1FX7 A;  3CME I;  2EFQ A;  2EH3 A;  3HUG A;  4XKB A;  4AID A;  3GFM A;  5IP7 J;  3ABM H;  4PZJ A;  4D7M A;  1D8J A;  4NB5 A;  1GLN A;  1EH7 A;  1DQU A;  2A6T A;  2ELK A;  1Y6I A;  4UV9 A;  3SXY A;  4EEF G;  4F55 A;  3CC2 I;  3C2B A;  1B9M A;  4FHT A;  3TBI A;  5IY5 H;  1G3W A;  3BP8 A;  3OIO A;  1VQP I;  2PI0 A;  1TWG J;  4E70 A;  3VOD A;  4EJW A;  3PQJ A;  2I8D A;  3PNT A;  3NWT A;  2P5K A;  1HDD C;  4I01 A;  5D6F A;  4XBF A;  4XM3 A;  4XL9 A;  1BOA A;  2M0C A;  2E5Z A;  1HC8 A;  3OYB A;  1Y0U A;  4XSX F;  4Y33 A;  3MKW B;  2WY8 Q;  4I09 A;  3VPR A;  4IOC F;  4A3J J;  1MD0 A;  1HQC A;  2XF6 A;  4BAY A;  4L5J A;  3JAM K;  3TDZ C;  2DW4 A;  4AIJ A;  1FLI A;  2R7F A;  1J75 A;  1XB4 A;  2UXN A;  4CCM A;  3CLO A;  4DNC A;  2E19 A;  4EM1 A;  1YW9 A;  1TC3 C;  1WPK A;  1T6S A;  1Z1D A;  3S1N J;  1FBQ A;  1R5H A;  4I7H A;  2HOE A;  2KIQ A;  1WJA A;  3BR6 A;  1KQ0 A;  1HCR A;  1OR7 A;  2EV0 A;  5LEJ A;  2BEO A;  4UB8 C;  1TT5 B;  2GIV A;  3ZR8 X;  5CJ9 A;  5C3E J;  1J5Y A;  2K27 A;  1WRJ A;  4HW0 A;  4IQ4 A;  1B8I B;  3EUA A;  2LFB A;  4HQM A;  4FCY A;  5BNG A;  1HW5 A;  3ABT A;  1G3T A;  3IL2 A;  2P7C B;  3WTZ A;  3W6J B;  3J7Z I;  1APL C;  1QO0 D;  3VSK A;  5FD6 A;  2HGC A;  2LP0 A;  5B66 C;  4KIC A;  1ULY A;  3CUQ B;  3F9K A;  1K4T A;  4GYG A;  3GWZ A;  5M5W J;  3BCA A;  1H0M A;  2V9V A;  4JX5 A;  2IVM A;  3H3Z A;  3E6D A;  3PFI A;  3PSF A;  2E1N A;  2WAE A;  1ZTR A;  5DDG A;  2EIN H;  4NBQ A;  5DV5 A;  4MTD A;  4BHP A;  4BEH B;  2EFN A;  1D0X A;  4LGW A;  4RAG A;  2PMZ A;  4IHS A;  2O5R A;  4XRS G;  2P4W A;  1AA7 A;  1IO2 A;  2IP2 A;  1FP2 A;  1R00 A;  1FTT A;  1S8N A;  1LNW A;  4KNY A;  4DBQ A;  3DCF A;  4D0P A;  4KYW A;  4GYI A;  2X4H A;  3H0G J;  3SJM A;  2QBY A;  1XGS A;  3FXQ A;  2WC2 A;  3GLX A;  2AQF A;  4NUB A;  5B5E C;  4D7N A;  1VQO I;  1Z0X A;  2VQL A;  1VZ0 A;  2ZXH A;  4BU2 A;  2XKP A;  3M9A A;  5IYD J;  1WQ2 A;  5LFA A;  1SAN A;  2GQQ A;  3CUQ C;  1OCT C;  1JUS A;  3P9I A;  3G1M A;  2H6B A;  4OWR B;  3ASO H;  2BXZ A;  1RUO A;  1OJL A;  1A36 A;  2W4S A;  1AKH A;  2FA5 A;  4XQF A;  2K4B A;  3C3W A;  4IRG A;  1VTN C;  5GAH J;  2H8R A;  1QPM A;  1Z77 A;  1O7F A;  1VQ4 I;  2R7Z J;  5EZH A;  3DKW A;  1IRX A;  4LD5 A;  1BC7 C;  1X1B A;  1IV6 A;  4IHV A;  2N8G A;  3HIF A;  1SEU A;  2V1X A;  3LSM A;  3FXJ A;  2DMN A;  3H9J A;  1J59 A;  2R7O A;  4BE2 A;  3H92 A;  4XN0 A;  4Z2Y A;  2E5N A;  1VQ6 I;  2L9N A;  1ZN2 A;  3RKY A;  3DV8 A;  1X1C A;  3GVA A;  1MBF A;  1ZRF A;  3U1K A;  3RYR A;  4CZC A;  5FLX Z;  2XV4 S;  3A4C A;  3R0A A;  3LSH A;  3SZG A;  3ZQH A;  3HG9 A;  4CA0 A;  1MMD A;  2EA4 A;  3K10 A;  3BDD A;  1DP3 A;  3ZPL A;  1FPQ A;  1W1W E;  4EGY A;  1GVJ A;  2F4M B;  1Y1V J;  1OKR A;  4XKC A;  4F92 B;  3JRC A;  1RI7 A;  2FOW A;  2OUM A;  2KZG A;  4KFC A;  2MG4 A;  2QKM B;  2NS7 A;  2ZXI A;  3Q0V A;  4GXO A;  2MBF A;  3GFI A;  2M7A A;  4E7Z A;  2VQG A;  3RZO J;  3V7R A;  4HLX A;  3HSE A;  2CQ7 A;  3DWL E;  4MIM A;  3I3L A;  3FBN B;  2ESN A;  3G6E I;  1A5J A;  2AS5 F;  2L0K A;  4C2U A;  2H09 A;  5D8L B;  2K4J A;  4JBA A;  1K78 B;  1I6H J;  1HST A;  4PFO A;  2A05 A;  5IOY A;  3AL0 B;  1SD7 A;  3FHN A;  4MEX F;  2DU9 A;  2NNN A;  1I3A A;  1MMA A;  5CVI A;  1I50 J;  1VQ8 I;  1B8I A;  4EM0 B;  1EA3 A;  2E1C A;  2YUS A;  3PO3 J;  1G2H A;  2V26 A;  3FWE A;  1ETY A;  3DP7 A;  4P5O A;  3LSK A;  3KP7 A;  5BPI A;  4XOP A;  4YFK F;  3BG3 A;  3A0B C;  2FD5 A;  2NOG A;  3B73 A;  3WU1 B;  3V8K A;  4UV8 A;  1U0J A;  3CUQ A;  1W4M A;  4BKX A;  2QM3 A;  2P5L C;  4TV7 A;  1G8X A;  2ECB A;  1UMQ A;  3WOD F;  4YIR X;  5HLT A;  4EVI A;  3S2H J;  3PNV A;  1U3E M;  2MC4 A;  3MFK A;  4BGD A;  1XMK A;  2R7X A;  2VJ5 A;  4BJ6 C;  3OYM A;  4KMF A;  4BEH A;  3Q0U A;  5JLW A;  5CLS A;  2KRC A;  3F6O A;  3AL0 C;  3BJO A;  4DOZ A;  2K9M A;  4D1Q A;  4A3M J;  3IP4 B;  1HKS A;  3DF8 A;  4RM3 A;  2BOL A;  1FY7 A;  1LE8 A;  2H27 A;  3RJP A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 3HHH A;  1ZAO A;  4OIR F;  1EV7 A;  4LK0 F;  3KCC A;  4MTE A;  4EM2 A;  1Z9C A;  1LEB A;  1DP7 P;  5IT9 K;  3REO A;  4N0B A;  5E1Z B;  4RGU A;  5K1Y A;  4FT8 A;  4RGS A;  1FWZ A;  2CYY A;  3IHU A;  1EH8 A;  1L3L A;  1DDN A;  5JHU A;  2ACJ A;  2ZKZ A;  1R7J A;  3L00 A;  3FMQ A;  2DQL A;  2D1H A;  2PEX A;  4KT5 C;  5HLI A;  5ERI A;  1P2F A;  4AVP A;  2RGV A;  2D1V A;  2LF7 A;  2FBK A;  2NAZ A;  1D8K A;  4RB0 A;  1ONV A;  4OMY A;  3WG9 A;  2Q8K A;  1LDJ A;  2JZY A;  2ZO4 A;  3QP5 A;  2QQ9 A;  4DQ2 A;  3CJN A;  2EK5 A;  2M45 A;  5L3D A;  4ESF A;  2VE9 A;  2ETH A;  2QVO A;  4OOI A;  2W25 A;  1UHW A;  5DEQ A;  1G3S A;  3CUO A;  4WF2 A;  3RYP A;  1WKM A;  2ELH A;  2OZ6 A;  1KQ9 A;  1ZGJ A;  4UNO A;  2FQ3 A;  1BIB A;  1R36 A;  5BS6 A;  2VT3 A;  5JI6 A;  1RUN A;  3K1P A;  2GXB A;  4ENK A;  1MZB A;  1U78 A;  2V6C A;  1S29 A;  2HQR A;  2XIG A;  3WTX C;  2FRH A;  2GZW A;  2PQ8 A;  3QRF F;  2EB7 A;  2NRA C;  6PAX A;  3RPU A;  2OQR A;  3I5U A;  3KEQ A;  4WXH A;  2OBP A;  3SQN A;  4MNU A;  1ZHF A;  1FOK A;  2ZNZ A;  2MH2 A;  2KJB A;  2G9W A;  3HTU A;  4ENM A;  1B1B A;  2L02 A;  3GEZ A;  3P9C A;  1P4W A;  1XDU A;  5ILS A;  2D2W A;  3I64 A;  4PGH A;  1R58 A;  3OOP A;  4G94 A;  1HXD A;  2K02 A;  3ABU A;  4YFN F;  4KUM A;  3BOQ A;  3E5Q A;  4L0Z B;  2DPD A;  1E2X A;  2MD5 A;  2L01 A;  4WWC A;  4HF0 A;  5E8G A;  3J81 K;  2GXG A;  4K2E A;  2LDU A;  4ZYE A;  3KP3 A;  3WGI A;  2BBY A;  4O6J A;  5KK1 A;  5LRS A;  1Z05 A;  3K1M A;  4CIC A;  1TW3 A;  2HEO A;  1XSX A;  3HTS B;  4OIO F;  1UB9 A;  3DEU A;  2XAF A;  4UUV A;  2NS0 A;  1YW8 A;  3DPT A;  3LA7 A;  4B09 A;  4GCV A;  1FP1 D;  1F4K A;  2VC0 A;  1C0W A;  4OU0 A;  4KMU X;  3TO7 A;  3F3X A;  1U8R A;  3HRU A;  4UVA A;  3IWZ A;  2A6E F;  3CTA A;  5K5R A;  4KIF A;  1JGS A;  2Y75 A;  2HZT A;  1ZRD A;  3MAJ A;  2GA2 A;  5LEK A;  2OQG A;  1Z91 A;  2UZK A;  4M71 A;  4P96 A;  2R7D A;  2Y0M A;  3KE2 A;  1I1S A;  3F72 A;  2HYF A;  1KGS A;  2FBH A;  1R1U A;  2JPB A;  3J7A O;  3LA2 A;  1ZG1 A;  1I27 A;  4CGZ A;  3WU0 A;  2ZME B;  4ESJ A;  4Q5S F;  3K9T A;  2GAU A;  3ZMT A;  2KIM A;  3P7N A;  2R3S A;  1YG2 A;  2VON A;  3D5L A;  1Q1H A;  3O2P E;  2Q0O A;  3LAJ A;  1O3Q A;  5HDK A;  2DTR A;  3HRS A;  4HQE A;  1JHF A;  1WWX A;  4MHG A;  4HF2 A;  3AAF A;  3BWG A;  4JK1 X;  5ICF A;  3MZH A;  2VXZ A;  4ZYG A;  1X3U A;  5LHI A;  3QU6 A;  4XRF A;  2CO5 A;  2KRF A;  1FZP B;  2VOP A;  5BPD A;  2P5V A;  3BPX A;  5FB2 A;  4QLC U;  4RGR A;  2O0Y A;  1ZRC A;  4ZZD A;  4Q4Z F;  4I2O A;  5JFR A;  5F1R A;  3VOE A;  1H9T A;  1ODD A;  1BM9 A;  5J8C A;  3SZT A;  3EYI A;  2PMU A;  1MJA A;  1I6X A;  1BIA A;  1UCR A;  5FGM A;  5DD8 A;  1YS7 A;  3OV8 A;  1BN5 A;  1DUX C;  2MLK A;  1TQM A;  3R61 A;  2VOD A;  4ZZL A;  1A04 A;  1UFM A;  2O6G E;  5JR3 A;  2WV0 A;  3F6V A;  1OYY A;  3KFW X;  2ISY A;  5ILV A;  2FNP A;  3HOT A;  1MJ9 A;  1U5T B;  3JW4 A;  3QPT A;  4KN7 X;  1T39 A;  4ZH4 F;  3WTS C;  2DLL A;  4KIB A;  3WTU C;  1O3S A;  2O8X A;  2MC3 A;  3F8B A;  2MH9 A;  1J2X A;  2ZME A;  3SFZ A;  2HKX A;  2Q2E A;  2HTJ A;  3HOS A;  5AIQ A;  5ICC A;  3JTG A;  3N97 A;  1B9N A;  1LDK B;  2A5Y B;  5LGT A;  1U5T C;  4L9N A;  3F8F A;  1JXS A;  3GZ6 A;  2A3S A;  3KP2 A;  3RI4 A;  4RB3 C;  1XCB A;  2RV8 A;  2VC1 A;  4IHT A;  1LEA A;  5BQT A;  2CWE A;  1OYI A;  3GF2 A;  4HZF A;  4Y17 A;  5L3G A;  1O3R A;  3M8E A;  1BI1 A;  3ISP A;  3BPV A;  4CO8 A;  2DK8 A;  2QLZ A;  4G9Y A;  2QZ8 A;  4AD9 A;  1FBS A;  5D5V B;  1BC8 C;  2FSW A;  5ICE A;  4OIQ F;  2XAJ A;  4HV6 A;  3WTV C;  3U9G A;  4BYY A;  2QQB A;  1K6O A;  2HFH A;  3E6B A;  3TOB A;  2FMY A;  2STT A;  1IRG A;  3L09 A;  4O3M A;  1OMI A;  3ZP5 A;  2QYO A;  3DXJ F;  4A12 A;  2HQN A;  1XSV A;  1QQI A;  4IRH A;  3ERE D;  2G7H A;  2V1U A;  1ZGA A;  2HKO A;  1DPU A;  3V8J A;  2VT2 A;  3O6B B;  2DPU A;  1U5T A;  3GYH X;  4WXD A;  4MEY F;  2M1B A;  4R79 A;  1ZLJ A;  3TKY A;  1T98 A;  4BNC A;  2Z3Y A;  3LA3 A;  4LLN A;  3NRV A;  3FMR A;  3IKT A;  5CVJ A;  5IT9 Z;  2D45 A;  4IRI A;  2A6H F;  3VB2 A;  2ZJ2 A;  3TO6 A;  3EUH A;  2A07 F;  3TGN A;  4U88 A;  2ZNY A;  5HLH A;  1BI0 A;  3RKW A;  3L9F A;  4GO1 A;  2LNB A;  1XMA A;  4OIP F;  2RNJ A;  3SHF A;  3WE3 A;  1K7A A;  5HS9 A;  2YX7 A;  3E6M A;  3KEO A;  4CDG A;  2BV6 A;  5FD5 A;  3F23 A;  2NYX A;  1T38 A;  1B6A A;  5DD4 A;  5L3B A;  1QGP A;  2DO7 A;  4YFX F;  1U2W A;  5BMZ A;  2P7V B;  1D3Y A;  1G6N A;  3ZN0 A;  4YG2 F;  5DUI A;  4A6D A;  3GW2 A;  4LK1 F;  1NHA A;  2X0L A;  2Z33 A;  2RVC A;  2FF4 A;  3FHZ A;  4WK8 F;  4HX4 A;  2VBZ A;  1KA8 A;  5E17 F;  4Q47 A;  4A2U A;  2DK5 A;  5IT3 A;  2XAQ A;  4HOB A;  2L54 A;  1QNT A;  3QOP A;  1YYV A;  4XLP F;  1RNL A;  4HYE A;  3I71 A;  3WGH A;  5A2Q K;  4ON0 A;  1H9G A;  3MEX A;  5DUK A;  1XD7 A;  2HS5 A;  2W84 A;  3JSP A;  1KU3 A;  3GFJ A;  4NQW A;  4U7B A;  2ESH A;  3F8C A;  5LRR A;  3ULQ B;  4L18 B;  5LHH A;  4UVB A;  1QBJ A;  2P6S A;  1KYW A;  4R8H A;  3HSR A;  1GHC A;  2HDC A;  3K0L A;  1O3T A;  4OMZ A;  3ZMV A;  2ADU A;  3ECH A;  2ISZ A;  1ZG3 A;  2EFO A;  4L9V A;  2O03 A;  4HX8 A;  3PQK A;  3C1D A;  2L4A A;  1IN7 A;  2J5P A;  2OZU A;  2M8E A;  4A5N A;  2KIU A;  4O5V A;  1CF7 A;  3F21 A;  2LKP A;  2F5F A;  1YIO A;  4IXA A;  1F5T A;  1PP8 F;  4UVC A;  1BJA A;  4KIG A;  2VN2 A;  3J81 Z;  3G73 A;  2RKH A;  4EGZ A;  3ECO A;  4MQ9 F;  3EQL F;  4CXF A;  1I1G A;  3E97 A;  3DPL C;  3SZP A;  3V8L A;  2EJR A;  2JSC A;  5LGN A;  4RAY A;  3E5X A;  4IVN A;  3GFL A;  3LWF A;  1F1Z A;  2GA1 A;  4UXN A;  3TQN A;  1XGO A;  1FYK A;  1I5Z A;  1V4R A;  3RDI A;  2YX4 A;  3C18 A;  5TRD A;  1R1T A;  2B0L A;  4R1H A;  2M5W A;  3GXO A;  4F7Z A;  4ZYH A;  1W5S A;  1V3F A;  4ASN A;  2IJL A;  2IW5 A;  2ZCW A;  2QQA A;  3LAP A;  4S05 A;  1IF1 A;  1J9I A;  3M1E A;  2IT0 A;  5FFZ A;  5DCM B;  5D8K B;  1XN7 A;  2EFW A;  2FE3 A;  2K86 A;  3R0J A;  3KET A;  2VE8 A;  3COA C;  4XSZ F;  5HDG A;  3WTT C;  1RIO H;  3Q9S A;  3BZ6 A;  3T1B A;  4BH9 A;  1STZ A;  3TDU C;  2F2E A;  4BHC A;  3W6K B;  1SFX A;  2IPQ X;  3WTY C;  3B02 A;  1FT9 A;  4WCG A;  1DPR A;  5FFX A;  1XDS A;  2PLY A;  2YR2 A;  4L5I A;  4BQA A;  3E5U A;  2HTS A;  3GUD A;  3MQ0 A;  3HRT A;  1KU2 A;  1YFH A;  4OIN F;  2EWN A;  2M87 A;  1S7O A;  1SFU A;  4N9H A;  2H6C A;  2UXX A;  5HVQ C;  4ENJ A;  3BRO A;  5ICG A;  5JVT A;  2OU2 A;  4EMS A;  1SMT A;  5E18 F;  2VBY A;  1LVA A;  1TTY A;  3WGG A;  3HSF A;  4G7H F;  1YQA A;  1GXQ A;  5DCF A;  1REP C;  3FM5 A;  4BXU A;  5J6X A;  4KN4 X;  1HW2 A;  2KIF A;  1PP7 U;  1HSJ A;  3QP6 A;  2IA2 A;  2V79 A;  5J8F A;  1MDM A;  4M6X A;  4YII A;  2PMH A;  1S6L A;  5D5U B;  2YPR A;  3S2W A;  3I54 A;  2Z99 A;  1CGP A;  2K7L A;  2YU3 A;  3K2Z A;  4PCQ A;  2DQR A;  1KU9 A;  3ELK A;  2MA3 A;  1IXC A;  2O61 A;  1P4A A;  1P4X A;  5DCM A;  3I59 B;  4QWQ A;  2BYV E;  2OAZ A;  2BE5 F;  2XGX A;  4HF1 A;  2QEN A;  1P92 A;  4AIH A;  3J80 K;  1Z7U A;  1W5T A;  3KLO A;  4G6D A;  2KKO A;  1F9N A;  4HLY A;  1T0F A;  1BI3 A;  3V4G A;  1S3J A;  5D5X B;  1OPC A;  4Q48 A;  4P9U A;  4M74 A;  4A0Y A;  2CSO A;  1BBY A;  1YW7 A;  2CQK A;  4EJU A;  2C6Y A;  2AXL A;  4LJZ F;  3I0T A;  1Z6R A;  4M9Z A;  1XGM A;  1B59 A;  1R22 A;  2CW0 F;  4HDU A;  4Y13 A;  3IC7 A;  5D6E A;  5BOX A;  5FO5 A;  1TLH B;  5TJJ A;  3F8N A;  4A5M A;  2KJC A;  3VFZ A;  3JSO A;  5D4R A;  1KU7 A;  1MKM A;  1WI9 A;  3CO7 C;  1O7L A;  5CYV A;  1OYW A;  1AOY A;  3FX3 A;  4YIF A;  5K5O A;  3HYI A;  4CYD A;  3P9K A;  4P9F A;  2P8T A;  4I98 B;  1AWC A;  4RGX A;  3M8F A;  1IN5 A;  4NHJ A;  4A0X A;  1MGT A;  2A68 F;  3LQQ A;  1W7P A;  4M73 A;  3RPQ A;  1G3Y A;  3DQV C;  3FMS A;  4LB5 A;  4AIK A;  5CVU A;  5ILU A;  1TQI A;  4U0W A;  3T8R A;  5F6F A;  3RKX A;  2RN7 A;  3KP4 A;  1ZYR F;  3I59 A;  2YSR A;  2F5D A;  1SMY F;  4CZZ A;  5H6Q A;  1UST A;  2O3F A;  5DYM A;  2FML A;  2XKO A;  2PN6 A;  2VOO A;  2IA1 A;  4IPA A;  2DT5 A;  4KA4 A;  2ZXJ A;  3T8T A;  4I0B A;  1O57 A;  1XGN A;  2IA0 A;  2DI3 A;  2CG4 A;  4UHT A;  2FNA A;  1FSH A;  4U0Y A;  3K1N A;  4EJO A;  3IRQ A;  1E17 A;  1R5G A;  3ZMU A;  1HKT A;  4B8X A;  5LLQ A;  2Y48 A;  3V7S A;  1IZ1 A;  1KYZ A;  1Z6T A;  1B4A A;  3QU3 A;  1XSD A;  1R1V A;  1ZAR A;  5KVR A;  2MLG A;  3C7J A;  4M72 A;  5FLX K;  5LGU A;  4MQV A;  5L3E A;  5HLG A;  2DAO A;  3T5X A;  3IWF A;  2XAS A;  1IN4 A;  3FF5 A;  3MZY A;  1KQ8 A;  2QUF A;  1U6G A;  1FYM A;  3ZN1 A;  4PGG A;  5E20 A;  1TBX A;  4LB6 B;  1CF7 B;  2BGC A;  4WXC A;  1LB2 A;  1TNS A;  2XUB A;  1YS6 A;  2XHK A;  2JTV A;  4HV5 A;  2PFB A;  3EDP A;  4U7D A;  5H6R A;  5CVV A;  4HX7 A;  2JRT A;  5F64 A;  4HBL A;  3E3V A;  1BI2 A;  4L0Y B;  2PJP A;  3KP6 A;  2A61 A;  1IXS B;  3R60 A;  2XRO A;  3JTH A;  2OD5 A;  3E6C C;  2DFI A;  3M7G A;  2F5E A;  3N4M A;  3NEU A;  2HR3 A;  2L4M A;  3H3U A;  4EV0 A;  5A2Q Z;  2IRF G;  3DFG A;  2A69 F;  4RS8 A;  1XCV A;  5CVR A;  3ZMZ A;  2G7U A;  1LQ1 A;  3ZMS A;  5EEH A;  3MWM A;  4L9J A;  3ZQ7 A;  4G6Q A;  1IAW A;  3QAH A;  1TQP A;  2COM A;  1J0R A;  2RDP A;  3KLN A;  3TOA A;  3ML6 A;  2H94 A;  4EQQ A;  4RB1 A;  3CO6 C;  4ESB A;  4IF4 A;  2WTE A;  3R6S A;  2VBX A;  3HRM A;  3R4K A;  1HBX G;  2XAH A;  3IKV A;  3QPH A;  2Z9O A;  4LG0 B;  1JE8 A;  2HWV A;  1USS A;  4G8X A;  1SD4 A;  1SD6 A;  2TDX A;  3LQR A;  1PUE E;  1IW7 F;  1K78 A;  3GX4 X;  5HS7 A;  1FC3 A;  1IXR C;  4HA8 A;  2RQP A;  4U0V A;  1FYL A;  1QZY A;  1K79 A;  1RZ4 A;  3K69 A;  5HOO A;  2W24 A;  4ETS A;  4LLL A;  2ZFW A;  2FXA A;  2OA4 A;  3GZ5 A;  4A6E A;  3EET A;  3NQO A;  3Q9V A;  1SAX A;  1HKQ A;  2HYG D;  1MJB A;  5E8I A;  1W7P D;  2E7X A;  2E7W A;  3RTR A;  1ON1 A;  3L2C A;  4M6Y A;  4A0Z A;  4G7Z F;  3O3K A;  4RAZ A;  1ON2 A;  2FOK A;  1ZG5 A;  3U1D A;  1IUY A;  5L3C A;  2EFP A;  3CDH A;  4CHU A;  3I53 A;  2GWR A;  1MDM B;  1ZH5 A;  4LFU A;  4G7O F;  3BJA A;  5L3F A;  2P6T A;  1S7A A;  2M30 A;  5AON A;  2QWW A;  5LBQ A;  4ZYD A;  2JT1 A;  4EJT A;  1IN6 A;  4HDV A;  2EV5 A;  2LF8 A;  4WX9 A;  3LFK A;  1P6R A;  1R23 A;  5LHG A;  2EV6 A;  4EJV A;  4LMY A;  4I0A A;  2FEZ A;  4LLG F;  1D5V A;  2JPC A;  3RIR A;  4MGR A;  3EYY A;  3FXR A;  2RC4 A;  4RB2 C;  1WSU A;  1J7K A;  3TO9 A;  1TNT A;  1SD5 A;  4JQF A;  5EEG A;  5D5W B;  2FBI A;  4LG0 A;  1GXP A;  4FX0 A;  4P55 A;  5HDN A;  2EA2 A;  1YO5 C;  4KDP A;  2W85 A;  3T0Y A;  5K5Q A;  5D4S A;  3KZY A;  2LSO A;  1T2K A;  5HS8 A;  4IJA A;  2UWM A;  4S04 A;  3I4P A;  2CFX A;  1SFE A;  5E1X A;  2ZBK A;  2WWY A;  3HHG A;  2XAG A;  4M9S A;  2Z5U A;  1FBU A;  3BY6 A;  2XVC A;  1FSE A;  4I02 A;  3VEP A;  1LDD A;  2FU4 A;  1EH6 A;  4FX4 A;  1PDN C;  4GGG A;  3KP5 A;  1ZRE A;  5ED4 A;  2CGP A;  4Y15 A;  3G3Z A;  4ENN A;  1HW1 A;  4BHB A;  3WTW C;  4HAM A;  2XRN A;  3F8M A;  2DBB A;  2F5C A;  1LJ9 A;  1YLF A;  3WE2 A;  4XLN F;  1IN8 A;  3ROU A;  2W57 A;  2J5O A;  4L9T A;  1L0O C;  3D0S A;  2L3D A;  1G4D A;  1W7P B;  3J80 Z;  1FNN A;  5E1W A;  3Q5F A;  1JHH A;  3F22 A;  3ZMD A;  3LST A;  3U2R A;  2PBI A;  1ZLK A;  2NNY A;  2V1D A;  4AWX B;  3IRR A;  2VBW A;  3FXU A;  2QBY B;  3GO5 A;  2PG4 A;  4H0E A;  4N9I A;  1QZZ A;  3V7C A;  1TW2 A;  3BJ6 A;  3FZV A;  1YTY A;  5AIP A;  1UHM A;  4PDK A;  2STW A;  3FM3 A;  5H20 A;  3L7W A;  3MCZ A;  3JAM Z;  4M9X A;  1IRF A;  3I58 A;  1FX7 A;  2EFQ A;  3HUG A;  3GFM A;  4PZJ A;  1D8J A;  4NB5 A;  4UV9 A;  1EH7 A;  3SXY A;  1B9M A;  4FHT A;  1G3W A;  3BP8 A;  2PI0 A;  4E70 A;  3VOD A;  4EJW A;  3PQJ A;  2P5K A;  4I01 A;  5D6F A;  4XBF A;  1BOA A;  1Y0U A;  4XSX F;  4I09 A;  1MD0 A;  1HQC A;  4BAY A;  4L5J A;  3JAM K;  3TDZ C;  2DW4 A;  4AIJ A;  1FLI A;  2R7F A;  1J75 A;  1XB4 A;  2UXN A;  4DNC A;  3CLO A;  4EM1 A;  1YW9 A;  1T6S A;  1Z1D A;  1FBQ A;  1R5H A;  4I7H A;  2HOE A;  1KQ0 A;  1OR7 A;  2EV0 A;  5LEJ A;  2BEO A;  2GIV A;  5CJ9 A;  1J5Y A;  2K27 A;  1WRJ A;  4HW0 A;  4HQM A;  1HW5 A;  3ABT A;  1G3T A;  3IL2 A;  2P7C B;  3WTZ A;  3W6J B;  1QO0 D;  5FD6 A;  2HGC A;  4KIC A;  1ULY A;  3CUQ B;  4GYG A;  3GWZ A;  1H0M A;  2V9V A;  2IVM A;  3H3Z A;  3E6D A;  3PFI A;  2E1N A;  5DDG A;  5DV5 A;  4MTD A;  4BHP A;  2EFN A;  4LGW A;  4IHS A;  2P4W A;  2IP2 A;  1FP2 A;  1R00 A;  1S8N A;  1LNW A;  4KNY A;  4D0P A;  4KYW A;  4GYI A;  2X4H A;  2QBY A;  1XGS A;  3FXQ A;  2WC2 A;  3GLX A;  2XKP A;  3M9A A;  1WQ2 A;  2GQQ A;  3CUQ C;  3P9I A;  2H6B A;  1RUO A;  2FA5 A;  2K4B A;  3C3W A;  4IRG A;  1VTN C;  1QPM A;  1O7F A;  3DKW A;  4LD5 A;  1BC7 C;  3HIF A;  2V1X A;  1J59 A;  3H92 A;  4Z2Y A;  1ZN2 A;  3RKY A;  3DV8 A;  3GVA A;  1ZRF A;  3RYR A;  5FLX Z;  2XV4 S;  3R0A A;  2EA4 A;  3BDD A;  3ZPL A;  1FPQ A;  4EGY A;  1GVJ A;  1OKR A;  1RI7 A;  4KFC A;  4GXO A;  2MBF A;  3GFI A;  3V7R A;  4HLX A;  3HSE A;  2ESN A;  2AS5 F;  2H09 A;  5D8L B;  2K4J A;  4JBA A;  1K78 B;  1HST A;  1SD7 A;  4MEX F;  2DU9 A;  2NNN A;  5CVI A;  4EM0 B;  2E1C A;  3FWE A;  3DP7 A;  4P5O A;  5BPI A;  3KP7 A;  4YFK F;  3B73 A;  3WU1 B;  3V8K A;  4UV8 A;  3CUQ A;  1W4M A;  2QM3 A;  2P5L C;  4TV7 A;  3WOD F;  4EVI A;  1U3E M;  3MFK A;  1XMK A;  4KMF A;  5CLS A;  3F6O A;  3BJO A;  1HKS A;  3DF8 A;  1FY7 A;  2H27 A;  3RJP A;  3KZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...