1W7PD

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VPS22, YPL002C
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04157 EAP30 EAP30/Vps36 family
D PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
D PF16988 Vps36-NZF-N Vacuolar protein sorting 36 NZF-N zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD02
4CDGA 1W7PB 4AWXB 4L9JA 2QWWA 2XKOA 2DAOA 5LEJA 5LRSA 3BOQA 5LHGA 4EVIA 4DQ2A 1GVJA 1BN5A 4ENMA 1FZPB 4LG0A 3IRRA 4ZYGA 1C0WA 1ZH5A 2O0YA 3N97A 3WTZA 2ZFWA 3DEUA 2IA1A 1BIAA 2VONA 2LSOA 3J7AO 1CGPA 2AXLA 2ISYA 1DP7P 1SMYF 1OKRA 1MJAA 3WTYC 5HS7A 1YTYA 1ZLJA 3EUHA 2IVMA 4ZYHA 3E6DA 1OMIA 2XAJA 2VODA 1MGTA 2VT2A 2R3SA 4ENKA 3CTAA 3LAJA 5TRDA 1R1VA 4GGGA 1SD6A 4FX4A 4EQQA 3WGHA 2GAUA 3F22A 3DQVC 5HS9A 2M8EA 3KP6A 3FX3A 4YFKF 2NNYA 2PBIA 3IWZA 4XSXF 5D6EA 3DPTA 1YG2A 1K79A 4HX7A 3BJAA 4BYYA 2PG4A 1ZLKA 2ACJA 5E18F 4L9NA 1HW1A 3ERED 4KMUX 5LEKA 3QPHA 2G7UA 5HDGA 3J80K 5L3GA 3COAC 3GZ5A 5D5WB 1Z9CA 3GXOA 3GFJA 5FFXA 2PN6A 1RI7A 2NS0A 3RKYA 5HDNA 5LGTA 2A3SA 4EJWA 1U3EM 2G7HA 2YU3A 3N4MA 1F1ZA 1P4WA 4WK8F 4HDUA 4R79A 1FOKA 1MZBA 1E2XA 1TBXA 4MTEA 3RJPA 2V9VA 1QBJA 1FWZA 2ISZA 3KCCA 5ILUA 1F5TA 2XVCA 2O8XA 3MWMA 1GHCA 2R7DA 4KNYA 4EM0B 3QAHA 2QQBA 2Z33A 2HZTA 1U8RA 4CZZA 4MTDA 4R8HA 2A61A 1U5TA 3WTTC 3U1DA 2W57A 3ML6A 1RZ4A 4IJAA 4EGZA 4RGXA 5D5UB 4U0WA 4XLNF 4HAMA 4A2UA 4LLNA 1U5TB 3F8CA 3GFLA 4UVAA 4RAYA 3QP6A 3VB2A 2FNPA 1FP2A 3B02A 1TQIA 3MFKA 4KFCA 3ABTA 3F3XA 1J2XA 4WXDA 1G3TA 3HTUA 4BH9A 3F21A 5DUKA 2GXBA 2MA3A 2O03A 1V3FA 2Z9OA 3LAPA 2JSCA 1S6LA 2DT5A 1KQ9A 3FM5A 4G9YA 5DEQA 3P9KA 2DQLA 1B9NA 1F9NA 4UXNA 3RIRA 5H6RA 5BQTA 3WE2A 5D5VB 5DCMB 3IKVA 3WGIA 4A0YA 1HXDA 3LA3A 5H20A 3J80Z 3FF5A 3FM3A 3ZQ7A 3V7SA 1D8KA 1BM9A 4GCVA 1QGPA 3FWEA 2J5OA 3VFZA 2PI0A 2ZBKA 1YFHA 4EMSA 1ZRDA 2EFWA 1Z1DA 2CSOA 4FT8A 2CW0F 1USTA 4A6EA 2K86A 3CJNA 2RQPA 1MD0A 1HBXG 4RGSA 2RN7A 4NHJA 2JPCA 2XAQA 4HLYA 1T6SA 1AWCA 3IHUA 3VEPA 3RDIA 1P92A 2GA1A 4WCGA 4O5VA 1ZHFA 4HBLA 1RIOH 3HTSB 3WTVC 3ECOA 1BIBA 2WV0A 3HYIA 2QUFA 3TQNA 1XGNA 2V6CA 5D4SA 4BNCA 1ODDA 1Z91A 4EJVA 5LRRA 3FHZA 1ZYRF 1UFMA 4ASNA 3WTSC 1P2FA 3E3VA 1B6AA 3BP8A 2MLKA 4IF4A 1JHFA 5L3DA 3HUGA 2VC0A 5LGNA 2VOPA 3VOEA 2KRFA 2YX7A 3RYRA 4S05A 3P9CA 1ZG3A 3E6BA 1FY7A 4RGRA 3CO7C 4M6YA 4KIGA 1SFXA 1J9IA 3M8FA 4IVNA 3HSFA 4IRHA 4H0EA 4HA8A 1Z6RA 1FNNA 3RI4A 4ESJA 3SFZA 1GXPA 1YW9A 2EFQA 3KP2A 3KP4A 2M30A 4G7HF 5L3FA 2FBKA 2W84A 2MH9A 3PQKA 2XKPA 1JGSA 3KLNA 3DP7A 2MH2A 2JT1A 4LGWA 3TOAA 3V7CA 1ZRCA 2STTA 5ED4A 5JFRA 3L7WA 5K1YA 3WGGA 1QO0D 1P4AA 3L09A 4UV8A 3G73A 3JSOA 3TO9A 1XB4A 1QQIA 4U0YA 1SD5A 2ZO4A 1S7OA 1D8JA 5FB2A 1R58A 2EA4A 2QM3A 1QPMA 1OR7A 3HRSA 2HS5A 1BOAA 4UV9A 3M1EA 3KP3A 1R36A 2LDUA 2XHKA 2HKXA 4MNUA 3JSPA 3SZTA 4ZH4F 4WWCA 2VC1A 2O61A 2V1DA 1TTYA 1TLHB 3T5XA 1JHHA 1WWXA 1IUYA 3RYPA 3ULQB 1ON2A 5BMZA 3B73A 3GEZA 2AS5F 1B1BA 3J81K 3O2PE 3WU0A 2MD5A 1R5HA 3IWFA 2H94A 2BBYA 4HX8A 3SQNA 3DKWA 4HF0A 1ZAOA 2ESHA 2Q0OA 4UNOA 4L0YB 4IRIA 1JXSA 3TGNA 4IHTA 2XAGA 1IF1A 2L54A 2HQNA 1LDJA 1O7FA 2Z5UA 1FSHA 1I1GA 1EV7A 1MDMB 4Q5SF 3WTUC 4M6XA 3IKTA 2TDXA 3F6VA 2BYVE 3CUOA 3C3WA 2HTSA 2L4MA 3FMSA 4I09A 1I6XA 3I59A 4EM2A 4PZJA 3IL2A 2GZWA 1PUEE 2DK8A 3VODA 1FX7A 3RKXA 1G3WA 2DW4A 4I02A 2EV6A 5F1RA 2CQKA 3I58A 4JK1X 4CXFA 1G3SA 3SZPA 5HLIA 3D5LA 3O3KA 2RV8A 3T0YA 5L3BA 3BWGA 4B09A 3I71A 2RDPA 3HSRA 4Q47A 2DLLA 4LJZF 1U78A 5HOOA 2YPRA 2B0LA 1ZG1A 2E1NA 4EV0A 2A07F 2FU4A 2VT3A 2ESNA 1J0RA 3QRFF 1HQCA 4M72A 1ZREA 3TO7A 5FD5A 4M74A 4RGUA 1U6GA 1VTNC 5J8CA 2JZYA 4U88A 5HVQC 5DYMA 4RB2C 3NEUA 1P4XA 4GO1A 1ZN2A 3K9TA 2P8TA 4EJTA 4CICA 1V4RA 3BPXA 2VE9A 2FF4A 1SD4A 5ILVA 3KP7A 2V79A 3R6SA 2PMUA 1I1SA 2O6GE 1LEBA 2H27A 3JTHA 5CLSA 3I0TA 2KIMA 4P5OA 4WXHA 5JVTA 2PLYA 1UHMA 2HYFA 1FSEA 4G8XA 2KJBA 1L0OC 2V1UA 2K7LA 3BJ6A 1WKMA 1PP7U 1K78B 1T38A 3I53A 2HEOA 2L02A 1YQAA 5BOXA 2QQ9A 2CFXA 5JI6A 2EV0A 3DFGA 2VN2A 1R5GA 2KIFA 4BXUA 4ESBA 3TOBA 2OA4A 4RB3C 1ZGAA 3R61A 1NHAA 1KU7A 2NAZA 4XRFA 1O3RA 1XSDA 2H6BA 2YR2A 4MEYF 3EQLF 5E1ZB 3I54A 3MCZA 3K2ZA 1OPCA 3GFIA 2UXNA 1CF7A 3HRTA 1BJAA 2D2WA 3CLOA 2HGCA 2H09A 1TW3A 1G4DA 4A12A 1EH7A 2X4HA 3TKYA 3DPLC 4LB6B 1WSUA 2M1BA 2BEOA 2C6YA 3BPVA 3QP5A 3EYIA 5HLHA 2KJCA 2DPDA 3REOA 2EA2A 1H9TA 4KA4A 3F23A 3NQOA 2QVOA 1XSVA 2HWVA 4PGHA 2K02A 1FC3A 2RNJA 3Q9SA 5A2QK 3KZZA 3HOTA 3D0SA 3ELKA 2H6CA 4YG2F 3KLOA 4BAYA 4L9VA 2M87A 1HSJA 1T98A 1R7JA 2XROA 4Q48A 3RPUA 4LMYA 3CUQB 3MZHA 4LB5A 1XGMA 4LK0F 2Y0MA 1S29A 4G94A 2GWRA 4LLGF 4HZFA 2ZMEA 3ABUA 2VBZA 3QU3A 4NB5A 1W7PA 1PP8F 2WWYA 1W7PD 2BGCA 4O6JA 1GXQA 4D0PA 2J5PA 4MQVA 1KQ0A 2F5FA 2EB7A 2P7VB 4P55A 4CO8A 3MQ0A 3ZPLA 1WQ2A 2XAHA 5HDKA 4I98B 2ETHA 2P6TA 5E1XA 3E6CC 3KEQA 1QNTA 3RTRA 4PGGA 5E17F 1LDKB 4NQWA 4Y13A 1T39A 1DPRA 1D5VA 4HV5A 2DK5A 3PQJA 4XLPF 3GYHX 1IN6A 4MEXF 5K5OA 3GW2A 4TV7A 2FQ3A 4KUMA 3EYYA 4GYGA 1MJ9A 2OZUA 2HYGD 3JTGA 5LHIA 4HOBA 5E8IA 2RGVA 4OIQF 1ZARA 2XAFA 3CUQC 3I5UA 2LF7A 3TO6A 3I4PA 4EJUA 4N9IA 5D8KB 2CG4A 4P9FA 4U7BA 2R7FA 3FXRA 2VOOA 3L2CA 3ZMZA 5FLXK 1MJBA 5FD6A 2CGPA 4IXAA 2PMHA 5CJ9A 3F8NA 5AIPA 4ZYDA 2L3DA 5ICCA 3OOPA 2LF8A 2G9WA 1UHWA 3ROUA 5ICEA 3M9AA 4I7HA 1G6NA 1YIOA 1WI9A 3LQQA 1HW5A 4B8XA 3GLXA 2P5KA 3QU6A 3WTXC 4A0XA 1IRFA 3ZMDA 4MQ9F 5CVJA 3FXUA 1S7AA 3BJOA 2Q8KA 2A6HF 4YFNF 4OIPF 1HKQA 2FXAA 2DO7A 2ELHA 1H0MA 3V7RA 1REPC 4L5JA 1R1TA 3MAJA 3WG9A 5JHUA 1QZYA 3PFIA 3M7GA 1IZ1A 2ZJ2A 1FYMA 2E7XA 4U0VA 3HHGA 1TW2A 1HW2A 1KGSA 3LA2A 1DPUA 3FMRA 4IPAA 4K2EA 4P96A 2ZKZA 4A6DA 2QENA 5IT9K 2MBFA 2IP2A 1B9MA 4L18B 1IN4A 1AOYA 4KICA 3O6BB 2EWNA 3LA7A 2PEXA 3T8TA 4KYWA 4ESFA 2Y75A 3P9IA 1LEAA 4ZZLA 2DFIA 2D1HA 2CWEA 4KDPA 1Q1HA 3EDPA 1IW7F 1R1UA 3E6MA 2FBIA 4HW0A 5ILSA 1U2WA 1Y0UA 2P5VA 1W5TA 4QLCU 2DBBA 2QBYA 2E1CA 3W6JB 4XBFA 3H3UA 5IT3A 2A6EF 5BPDA 2BE5F 3FZVA 3KEOA 4HV6A 3G3ZA 4AIHA 1LJ9A 2IA0A 2IJLA 2DPUA 4M9SA 1XMKA 4G6DA 4IHSA 2XGXA 3TDZC 3NRVA 5EEHA 4BHPA 4HDVA 4KIBA 2OQRA 4LG0B 4GYIA 5LBQA 1BC7C 1WRJA 2ZMEB 4F7ZA 5JR3A 1XD7A 2MLGA 1J5YA 5LGUA 3F6OA 1HSTA 3M8EA 4BQAA 2KIUA 4FX0A 5CYVA 3LFKA 4DNCA 2X0LA 5K5RA 3IRQA 3SHFA 1K78A 4I0BA 1I5ZA 3H92A 5LLQA 2ZCWA 2IW5A 1PDNC 2EFOA 1ULYA 1OYIA 2HR3A 2QBYB 3V8JA 3FXQA 2FE3A 3L00A 1KYZA 3F8BA 1IN7A 3QOPA 3KETA 3Q5FA 3I64A 2HTJA 1ON1A 4LLLA 2QYOA 2FA5A 2L4AA 2GXGA 1FYKA 2JRTA 5L3EA 2FMYA 1BBYA 4PCQA 1TQPA 2JTVA 3R0JA 1S3JA 2K4JA 3GZ6A 3ZMSA 3DXJF 1B59A 2Y48A 1HKTA 3IC7A 2P6SA 4L0ZB 2K27A 2HDCA 2RC4A 4EM1A 1CF7B 4OMZA 2OQGA 2E7WA 5J6XA 4O3MA 2P4WA 3HIFA 3ISPA 1K7AA 5CVVA 1JE8A 4I0AA 4HLXA 4P9UA 3BROA 5H6QA 3K1NA 3Q9VA 3R0AA 4AD9A 1LQ1A 3R60A 2IRFG 2OBPA 2EFNA 4R1HA 4I01A 5K5QA 1ZGJA 2BV6A 4ETSA 1P6RA 3K0LA 1B4AA 1KU3A 4EGYA 4AIKA 3WTWC 4ENNA 1O3SA 1HKSA 3LWFA 3WODF 2NNNA 1Z7UA 1MDMA 1XDSA 1DDNA 5D6FA 1FBQA 2F5EA 2F5CA 3GFMA 4UHTA 1O3QA 1FP1D 5D4RA 4HQEA 4KT5C 4MHGA 5HLGA 2D1VA 2FEZA 2OZ6A 2WTEA 2XV4S 4ZZDA 4YIFA 1KA8A 1J7KA 5KVRA 1T2KA 1XDUA 2WC2A 4N0BA 1SFEA 2COMA 1IN5A 4EJOA 4OINF 1W5SA 4Q4ZF 1IXRC 4RS8A 2QQAA 3BZ6A 3GWZA 2IT0A 3V8LA 1SAXA 1R22A 5FFZA 3TDUC 4WXCA 2HOEA 3ZN0A 1FBSA 4HYEA 2LNBA 3LSTA 4Z2YA 2FSWA 4G7ZF 1R23A 4CGZA 3T1BA 4E70A 3LQRA 1YLFA 1ONVA 3T8RA 2JPBA 1DUXC 2HFHA 4OMYA 3HRMA 1TNSA 2NYXA 1EH6A 2Q2EA 2EJRA 3U9GA 2VBWA 4FHTA 3WE3A 1QZZA 4MGRA 1SMTA 2UXXA 3FMQA 3GO5A 2DI3A 2XUBA 5EEGA 2M5WA 4A0ZA 2PQ8A 4RAZA 2OD5A 1J75A 1RUOA 1H9GA 5E20A 2VXZA 1BI2A 4WF2A 2IPQX 5ERIA 1YW7A 3EETA 2CO5A 4L5IA 5A2QZ 5D8LB 3MEXA 3ZMVA 1RUNA 1K6OA 1XMAA 2F2EA 1A04A 4XSZF 1KYWA 4N9HA 3L9FA 1F4KA 4AVPA 3K69A 2DTRA 3GX4X 3V8KA 2GA2A 4M9ZA 3GUDA 4LFUA 3BY6A 1BI3A 1STZA 1USSA 4L9TA 2EV5A 1L3LA 1BC8C 3JW4A 5DCFA 5DD4A 3J81Z 3R4KA 1XGSA 2YX4A 2EFPA 1LDDA 1IRGA 2P7CB 1EH8A 1KQ8A 1U5TC 2HQRA 4A5MA 4KIFA 1LB2A 4S04A 3E5QA 1RNLA 3H3ZA 1FPQA 4LK1F 3K1PA 3P7NA 1BI1A 2PFBA 4UUVA 2P5LC 3F8MA 3SXYA 6PAXA 4JBAA 2W24A 1IAWA 5AIQA 1FYLA 5DD8A 2FMLA 2MC3A 3C1DA 5L3CA 2FOKA 1X3UA 1XGOA 4OIOF 3KFWX 4KN4X 3HSEA 1XN7A 2XIGA 1YS6A 2M45A 1KU2A 1UCRA 3ZN1A 4OOIA 1IXSB 2A68F 4BHBA 3E97A 3CUQA 3KP5A 5BPIA 1OYYA 1XSXA 2DQRA 3GVAA 4M73A 1BI0A 1FT9A 4HF2A 2Z3YA 2QZ8A 1T0FA 3KZYA 4YIIA 2XRNA 5HS8A 1LNWA 2UWMA 2F5DA 1YS7A 2O3FA 3W6KB 2V1XA 1FLIA 5BS6A 4G6QA 3RPQA 2UZKA 2YSRA 4RB1A 5ICGA 2VBYA 1O3TA 3E5XA 1TNTA 3MZYA 1ZG5A 4OU0A 5E1WA 2GIVA 1XCVA 4QWQA 3AAFA 2A69F 4CYDA 1YW8A 2L01A 4JQFA 1O7LA 1FBUA 1YYVA 5LHHA 2HKOA 3OV8A 1Z05A 1IXCA 4RB0A 5IT9Z 3JAMK 2FBHA 5E8GA 2RKHA 4UVCA 2D45A 4HQMA 4ON0A 3F72A 2OAZA 5CVUA 3HOSA 1I27A 3BDDA 5FO5A 3KE2A 4ENJA 3CO6C 4WX9A 2KKOA 1E17A 3ZMUA 2VBXA 3QPTA 3I59B 4LD5A 5F6FA 4KMFA 5DCMA 5D5XB 5FGMA 2FRHA 2LKPA 2OU2A 4OIRF 4I2OA 3C7JA 5DUIA 1R00A 3ZP5A 3V4GA 1IN8A 1MKMA 2DU9A 4M9XA 1Z6TA 3HHHA 5AONA 3JAMZ 2CYYA 3F8FA 2EK5A 2Z99A 3WU1B 4GXOA 2STWA 3RKWA 5DV5A 4HX4A 1KU9A 1SFUA 2PJPA 1J59A 2FNAA 3U2RA 3E5UA 5DDGA 4IRGA 2W85A 5F64A 1G3YA 2NRAC 2XASA 2ZNZA 5CVRA 5ICFA 4KN7X 1W4MA 4G7OF 5FLXZ 3HRUA 1UB9A 2K4BA 4M71A 2VE8A 4UVBA 1TQMA 4HF1A 3DF8A 4Y17A 5KK1A 4AIJA 3K1MA 2ZXJA 4YFXF 3GF2A 1O57A 3ZMTA 2ZNYA 1D3YA 3C18A 4U7DA 4CHUA 3DV8A 4A5NA 2W25A 1LVAA 2GQQA 5CVIA 3ECHA 5TJJA 1SD7A 1S8NA 2QLZA 5J8FA 1ZRFA 2RVCA 4Y15A 2IA2A 1YO5C 2ADUA 3S2WA 4PDKA 1XCBA 4ZYEA 4BHCA 3CDHA 1OYWA 2A5YB
chains in the Genus database with same CATH superfamily
1QU3A 4CDGA 1W7PB 2ZSIB 4AWXB 3HEFA 2NVUB 4L9JA 2QWWA 3ZR8X 2M4KA 2DMUA 2XKOA 2DAOA 5LEJA 5LRSA 3BOQA 2JA2A 2UUZA 4UB8C 3F9KA 2JUCA 5LHGA 4EVIA 3K6GA 4DQ2A 3CJRB 1T33A 1HF0A 1GVJA 4RA2A 1BN5A 4ENMA 1XG1A 3ABLH 3PSFA 1G59A 1LE8A 2XPUA 1FZPB 4J01A 4LG0A 3IRRA 1X19A 4ZYGA 1C0WA 2M34A 3IH2A 4A3FJ 1ZH5A 1B72A 2O0YA 3N97A 3WTZA 4GDFA 1IV8A 2ZFWA 3DEUA 2IA1A 3I4MJ 1BIAA 2VONA 1WJDA 1X1AA 2LSOA 2CQQA 4GRIA 4FASD 3J7AO 3LSJA 1CGPA 2AXLA 1VQ5I 3OYDA 2DA4A 2ISYA 3KYLA 1DP7P 4Y33A 2CQ7A 3J7AY 3CCYA 1SMYF 2KPMA 3EUHC 1OKRA 1MJAA 2R7QA 3WTYC 5HS7A 1YTYA 1TL8A 3HPGA 1ZLJA 3EUHA 1MBEA 1DU6A 2IVMA 4Y52J 2MGQA 2NS7A 4ZYHA 3E6DA 5GPAA 1OMIA 2O8KA 1TT5B 4BXFA 2XAJA 2VODA 5KCMA 1MGTA 2AXTC 4Y4RA 2VT2A 2R3SA 3H0DA 4ENKA 4IHXA 3CTAA 3LAJA 4M3GA 1X3WB 5TRDA 3DU6A 1R1VA 3E1SA 1QVUA 4GGGA 1ETOA 3OL4A 3GTPJ 1SD6A 4FX4A 4EQQA 3WGHA 2GAUA 3LSHA 3F22A 3DQVC 3VSKA 5HS9A 1MNDA 4CA0A 2K3FA 2M8EA 1SVMA 3DTEA 3KP6A 1LFUP 3FX3A 4YFKF 2NNYA 2PBIA 3I4NJ 4XLCA 3IWZA 4XSXF 5D6EA 4HNTA 2EINH 4B44A 3DPTA 3CDIA 3L2QA 2VQCA 1YG2A 1MBKA 1K79A 1PUFB 3O8GA 4HX7A 2L0KA 3PSIA 2X51A 2CMPA 3BJAA 3BR3A 5E3LA 4BYYA 2PG4A 1ZLKA 1JUMA 2QQ8A 2ACJA 5E18F 3DKXA 2E5NA 4L9NA 5J1YA 1BR4A 3PO3J 1FOWA 1HW1A 3ERED 2XC7A 3H9GA 2OCCH 4KMUX 5LEKA 3QPHA 1RRJA 2G7UA 2H8RA 4KT6A 5HDGA 5CKTA 3J80K 2KP6A 5L3GA 4A3IJ 3COAC 3GZ5A 4JYKA 3S1RJ 3OYJA 1GVDA 3OSFA 3HOVJ 5D5WB 2HOTA 1Z9CA 3GXOA 2ZB9A 3ZRGA 5C3EJ 3GFJA 2M4GA 5FFXA 3S1NJ 2PN6A 1J09A 3LSMA 1RI7A 2NS0A 5EGOA 3RKYA 1X1BA 3PJRA 5DS9A 5HDNA 5LGTA 2R7SA 2PMZA 2A3SA 4CCLA 2Z1DA 1KZHA 4EJWA 4XKWA 1U3EM 2G7HA 2B7EA 2DDAA 1ETXA 2YU3A 2LKXA 3K4CA 3N4MA 1F1ZA 3GTJJ 4HSRA 4IX7A 1P4WA 4WK8F 3CDLA 4HDUA 4R79A 2JN6A 3KZIC 3L2WA 1FOKA 1MZBA 1E2XA 5IP7J 5M3MJ 1TBXA 4MTEA 1IDZA 4AU7A 5C4JJ 4IHVA 2KL4A 1ETYA 3RJPA 3S8PA 5E3MA 2V9VA 1T8IA 1QBJA 1FWZA 2ISZA 2XPWA 3KCCA 2MYSA 5ILUA 1F5TA 1RC9A 5CQEA 4AVZA 2XVCA 1MSEC 1WJFA 2NVYJ 2O8XA 3MWMA 1GHCA 4UUSA 2R7DA 4KNYA 4EM0B 3QAHA 4C2MJ 3QYEA 3LSRA 2QQBA 2Z33A 1F43A 3F0CA 2HZTA 3TW6A 4CZZA 3OY9A 1U8RA 1T56A 4MTDA 4F55A 4R8HA 3JRBA 2A61A 3KYDB 1U5TA 3ZOBA 1QVTA 3BTCA 3WTTC 3U1DA 1OCZH 4ABZA 2W57A 3ML6A 2KHMA 5GTIC 1RZ4A 2E36A 2ZXHA 4IJAA 4EGZA 2Y69H 1TWHJ 4RGXA 5D5UB 4U0WA 4XLNF 1TC3C 4HAMA 2OTLI 4A2UA 4LLNA 1U5TB 3F8CA 3GFLA 4UVAA 1ZR2A 4RAYA 3CCSI 4B1RA 2ZC2A 3H0GJ 1T0FC 3QP6A 2MC4A 3VB2A 2VASA 4RAGA 2FNPA 1R4MB 2VIXA 1P7JA 1OFCX 4XQFA 1TZLA 1PYVA 1FP2A 3B02A 1TQIA 4DW6A 3TEDA 3MFKA 4KFCA 1W36D 2ID3A 3ABTA 3F3XA 1J2XA 5B1AH 2V4JC 4WXDA 1VQ4I 1G3TA 3HTUA 2VQHA 3K2AA 1X1CA 4BH9A 3F21A 5DUKA 2GXBA 2MA3A 2O03A 3QYFA 1V3FA 2Z9OA 2LY2A 4UUSB 2DOFA 3LAPA 2DDBA 2JSCA 2F4OB 1S6LA 3W2VA 2DT5A 4QPQA 2WV1A 1KQ9A 3L1PA 3FM5A 4ZDPA 2W7NA 1UZCA 4G9YA 1P9QC 3P9KA 5DEQA 3VYTB 2B9SA 2DQLA 4JX4A 1LVKA 1F9NA 1B9NA 4UXNA 4NC8A 2VPLA 5KAIC 2IS4A 2PMZN 3RIRA 2B63J 2DCEA 3KYCB 2HOSA 5H6RA 4BY1J 3JRHA 5BQTA 2X1CA 3WE2A 5D5VB 2IS1A 2XSDC 1QZEA 2F4MB 5DCMB 5B5EC 3IKVA 1V55H 3WGIA 3H5NA 3HBLA 4A0YA 1XS9A 4MFEA 1HXDA 3LA3A 5H20A 5IPAA 3J80Z 3FF5A 2TCTA 3FM3A 2WAQN 5FROA 3ZQ7A 3V7SA 1D8KA 4HG2A 1EF4A 3OIOA 1BM9A 4GCVA 1QGPA 3FWEA 3CD6I 1TWAJ 2DMNA 2J5OA 4IKFA 1ETKA 2L9SA 5TISC 3VFZA 2PI0A 2ZBKA 3CJTB 1YFHA 4BS9A 1YHQI 5K7ZA 4EMSA 1ZRDA 1V5GA 2KRHA 2M8GX 4D5CA 4CCJA 2EFWA 1Z1DA 2CSOA 4FT8A 1A35A 2CW0F 1VQ8I 1VQPI 3CP2A 3S17J 4I6ZA 1USTA 3E0JB 4A6EA 2K86A 1VF9A 3CJNA 2RQPA 2DXIA 1MD0A 1HBXG 3PUFA 4RGSA 2RN7A 4JX6A 4NHJA 2CFOA 2JPCA 5F1JA 2XAQA 1YE9A 3G71I 4HLYA 1W0UA 1T6SA 3GTOJ 2W48A 4A3GJ 1AWCA 4XR6A 3FBIB 1EA3A 3IHUA 3VEPA 2HZDA 3RDIA 4G6TB 5EZGA 2AHQA 5EG0A 2R7UA 1PUFA 4N4OB 1P92A 5B1BH 2GA1A 3BT9A 4II3A 4Y7NJ 4PJ0C 4RDUA 4BDYA 1E3PA 4BY7J 4WCGA 5J4YA 1JKRC 4XICA 4O5VA 1W5CC 1ZHFA 3CZ6A 3S2DJ 4HBLA 1RIOH 3GCMA 3HTSB 3WTVC 4DOZA 3JRDA 3ECOA 1BR2A 1BIBA 2WV0A 1KONA 3HYIA 4BJTA 2ZXIA 2QUFA 4CUGA 3TQNA 1XGNA 3EUAA 2V6CA 2L5QA 5IP9J 5D4SA 2R7XA 3IV5A 4BNCA 1ODDA 1Z91A 4EJVA 5LRRA 1R6RA 3FHZA 1ZYRF 1UFMA 3HG9A 4ASNA 3DEEA 3WTSC 1P2FA 3E3VA 1B6AA 3BP8A 5TGTA 4CSWA 1E0EA 2BOLA 3CMYA 2MLKA 3AG2H 5J40A 2HDWA 2E60A 2CW7A 4DZPA 4IF4A 1JHFA 2KZGA 5J4VA 5L3DA 3HUGA 2VC0A 5LGNA 2V26A 5M5XJ 2MD0A 2VOPA 3VOEA 2KRFA 2YX7A 3RYRA 3S16J 1ZKGA 3P9CA 4S05A 2BY0A 1ZG3A 2HPIA 1K61A 3E6BA 1FY7A 4CH7A 4D5FA 2G0EA 2EQRA 1TWGJ 4RGRA 4BBRJ 2Z16A 3CO7C 4M6YA 3DPUA 2GXAA 1MW7A 4KIGA 1VQ7I 1SFXA 3GZNB 3SFIA 1H88C 1J9IA 1R5ID 3M8FA 4IVNA 3HSFA 4IRHA 4H0EA 4HA8A 5EDNA 1Z6RA 1FNNA 3RI4A 2LD5A 1SEUA 4ESJA 3JCUC 3SFZA 1GXPA 1YW9A 2EFQA 2JMWA 4CCNA 3KP2A 4B47A 1A6IA 3GTLJ 2BXYA 3A1YA 2M30A 3KP4A 4G7HF 2LYCA 3I9V2 3LSGA 3H5RA 4YEJA 2FBKA 5L3FA 4CCKA 2W84A 2MH9A 1ZELA 2AQFA 3PQKA 4DBRA 2XKPA 1JGSA 2A05A 3KLNA 3DP7A 2MH2A 4RLQA 3OYFA 2JT1A 4LGWA 3TOAA 3V7CA 1ZRCA 3BTIA 1ZGWA 2STTA 3DTIA 5ED4A 4BL0B 5EYRA 3ZXSA 5JFRA 3L7WA 5K1YA 2R7OA 3WGGA 1QO0D 1I3AA 1P4AA 3L09A 3BG5A 4UV8A 3G73A 5EEAA 3JSOA 3H36A 3TO9A 2CRGA 1XB4A 4BEHB 1QQIA 3VDXA 4U0YA 1SD5A 2ZO4A 1S7OA 1XMXA 2HDDA 1D8JA 5FB2A 1R58A 2EA4A 1HOMA 2QM3A 4ZDLA 1SAUA 1GV2A 1QPMA 1OR7A 3HRSA 3S3NA 2HS5A 2BW3A 2QKLB 3LSIA 1BOAA 4UV9A 3M1EA 3KP3A 1R36A 2LDUA 2Y9YA 2XHKA 5DM6F 2HKXA 3A02A 4LG3A 4MNUA 3JSPA 3SZTA 3VSLA 4ZH4F 2PJRB 1YI2I 1HLVA 4WWCA 1MMAA 3D1NI 2VC1A 3B6AA 1YRNA 2O61A 2R5YB 2V1DA 1TTYA 1TLHB 5GAEJ 2K9NA 3T5XA 5LFAA 1JHHA 2YUSA 1WWXA 3HOXJ 2BHZA 1IUYA 1JI8A 3QPSA 1JUPA 3RYPA 4ZJZA 3ULQB 1ON2A 5BMZA 2R92J 3B73A 3GEZA 2AS5F 5FKMA 1B1BA 2VJ5A 2WB1A 3J81K 2L7ZA 3O2PE 3WU0A 3PFYA 1FEXA 1N75A 2MD5A 1OLTA 2VL8A 2EZHA 1R5HA 3IWFA 2H94A 3MN2A 2BBYA 3ZQLA 2E2IJ 4HX8A 3SQNA 1DU0A 4CYCA 3DKWA 3CMEI 1IRZA 3JRCA 3A4CA 4HF0A 1ZAOA 2ESHA 2Q0OA 4UNOA 4L0YB 4IRIA 1JXSA 3TGNA 3BG6A 2AQEA 3CCVI 4IHTA 2XAGA 1IF1A 1BR1A 2L54A 1LPQA 2HQNA 1LDJA 1O7FA 3FXLA 3TBIA 2Z5UA 1FSHA 4E7HA 1I1GA 1EV7A 1MDMB 1Y1VJ 4Q5SF 2XAUA 2RAEA 3I56I 4BACA 5C4XJ 2HI3A 2ME6A 2NVTJ 3WTUC 4P1WA 1V5FA 1EKEA 4DYCA 4M6XA 2LTPA 3IKTA 2TDXA 3F6VA 3OYGA 2BYVE 3CUOA 3C3WA 2HTSA 2GOMA 2L4MA 3FMSA 3IP4B 4I09A 1I6XA 3G1LA 3I59A 3I3LA 3IAS2 3MZ8A 4EM2A 4PZJA 3IL2A 2GZWA 1PUEE 2DK8A 3VODA 1FX7A 3RKXA 4EEFG 1G3WA 2DW4A 1HCRA 4I02A 2W82A 4FCYA 2EV6A 4QIWN 5F1RA 2CQKA 2LY1A 3I58A 2K5CA 1MIJA 2W1OA 4JK1X 4DYRA 4B3XA 3D5RC 5FKOA 4UB6C 4CXFA 1G3SA 2Q2EB 3SZPA 5HLIA 4BE1A 3D5LA 4E7KA 3O3KA 1A6QA 2RV8A 3T0YA 5L3BA 3BWGA 4B09A 3I71A 2RDPA 3HSRA 4B48A 2I8DA 3M1CA 2DLLA 4Q47A 1MBGA 4LJZF 4F3QA 4PUSA 5HOOA 2YPRA 1MBFA 1U78A 2QSHX 2B0LA 1ZG1A 1JT6A 2CW8A 2E1NA 3DLAA 4EV0A 3ERMA 2FU4A 2VT3A 2A07F 2ESNA 1J0RA 3QRFF 1HQCA 4M72A 3IUOA 4J19A 1ZREA 3TO7A 5FD5A 3I55I 4XL9A 1AKHB 4M74A 4RGUA 1SVLA 1U6GA 3K7AJ 5J8CA 1VTNC 3CCQI 2QF7A 2JZYA 4U88A 1WH5A 5HVQC 2EILH 3CCEI 3CCMI 1OCPA 5DYMA 3CF2A 4NDLA 1WVRA 3NEUA 4RB2C 1Y39A 1RR8C 1GT0C 1P4XA 3NWTA 4GO1A 3GMEA 1ZN2A 3K9TA 2P8TA 3CQZJ 2NVXJ 4EJTA 4CICA 3VYUB 1V4RA 3BPXA 2VE9A 2FF4A 1VI0A 1SD4A 5ILVA 3OYEA 3KP7A 2V79A 2QCOA 2KMUA 3R6SA 1XTAA 4XRMA 2WAQA 3OWTA 3HJEA 2DTZA 2PMUA 1I1SA 5LD2C 2O6GE 2E34A 1LEBA 3Q0WA 2H27A 3OS2A 3JTHA 5CLSA 3I0TA 2KIMA 4P5OA 4WXHA 5JVTA 1VFCA 2PLYA 4MIMA 1UHMA 2HYFA 1FSEA 3SJMA 1LFPA 1MMSA 1W36C 4G8XA 3DLLF 2KJBA 2A5WA 1L0OC 3KX2A 2V1UA 2K7LA 3BJ6A 5FRMA 2Y30A 5H2FC 1WKMA 3M3YJ 3LFUA 1PP7U 1K78B 1T38A 4A3CJ 5IYDJ 2DODA 3I53A 2HEOA 3H5AA 2EH3A 4XN3A 2LLKA 3HKZN 2L02A 3BQYA 1YQAA 2HOAA 3BTLA 2EIKH 3S1QJ 5BOXA 2QQ9A 2CFXA 5JI6A 2ZJPF 2EV0A 4PJLA 4DJAA 3DFGA 2VN2A 4PSXA 1R5GA 1Z3YA 2VXDA 2KIFA 4BXUA 4ESBA 3TOBA 3OYCA 3PIOF 1U8BA 2Y0SN 4PSWA 3H9JA 3AL0B 2OA4A 4RB3C 2K9SA 1ZGAA 3R61A 1NHAA 2XRLA 5FKKA 1KU7A 2KRCA 2NAZA 2X85A 2OJED 4XRFA 1X4OA 4ZTJA 2XB0X 2DOEA 3JRFA 1XSDA 1O3RA 4JOMA 2H6BA 3UKGA 2XGCA 1BJZA 4M3FA 2YR2A 3FDYA 1OCOH 1K6YA 1VQMI 5EGOB 4MEYF 1BA5A 3IH4A 2OF7A 5F0CA 2RNGA 1QA6A 3EQLF 1ENHA 5E1ZB 3QWLA 4YRVA 1VQKI 4C2TA 2XPVA 3S2HJ 3CC2I 1I6HJ 3I54A 3BR0A 2CJJA 2CV1A 1BOBA 3MKLA 1RR7A 3MCZA 2KDOA 3K2ZA 1OPCA 3GFIA 2DJNA 3BR5A 2UXNA 4G12A 4ZC3A 3HRTA 1CF7A 1BJAA 4FETA 3K70C 2D2WA 3CLOA 3DEWA 2HGCA 3ASNH 2M0MA 2H09A 2L7FP 1TW3A 2QEXI 1X4PA 2E1MC 1G4DA 1PVEA 1ETWA 4A12A 3HOUJ 1YOVB 3GTKJ 3ESWB 4RBOA 1DP3A 1B8IB 2DA3A 1HC8A 1EH7A 2X4HA 2P0WA 1SFKA 4XOTA 4XONA 3TKYA 3DPLC 4IEJA 3JRIA 4LB6B 2E2HJ 3OIPA 1WSUA 2M1BA 3HUGB 2R5YA 1WI3A 3ONQA 2BEOA 3LSKA 2M7BA 3OYIA 2C6YA 1FOYA 2KT0A 2OC6A 3MD2A 1I39A 2IGKA 3BPVA 3AG3H 3QP5A 4C3HJ 2IS6A 3NARA 3L2UA 3EYIA 1X58A 1MBHA 3S3MA 5HLHA 2KJCA 2DPDA 2DOAA 3REOA 3TL4X 1OJLA 2ELJA 3OIQA 1POGA 1TP4A 2EA2A 2ID6A 1H9TA 4KA4A 1ORKA 3F23A 2JA6J 1D0YA 2XF5A 3NQOA 3MKWB 4BBSJ 2QVOA 2O9LA 5CQGA 1XSVA 4IOCF 4I99C 2HWVA 4BDZA 2HVSA 4PGHA 1Z7LA 2EIMH 5DTDA 2K02A 4BJ6C 1FC3A 2RNJA 3Q9SA 5J47A 5A2QK 4A3BJ 3KZZA 3HOTA 3FIWA 3D0SA 3ELKA 1O4XA 2H6CA 4I76A 2R0QC 2V6EA 2XB5A 4B4CA 3SDBA 2KIQA 4AYBA 4YG2F 3KLOA 1W0TA 4BAYA 4L9VA 1N77A 2M87A 3K4KA 1UJ8A 1MMNA 2JA5J 5IYCJ 1HSJA 1V5EA 2L7KA 1T98A 2K9QA 1R7JA 2XROA 4X1EA 1D1CA 4Q48A 3RPUA 2DA5A 4LMYA 1NH3A 3CUQB 3OYMA 4N4NB 3MZHA 3RPUD 4LB5A 2DA1A 2OV7A 1XGMA 2HVQA 4LK0F 2Y0MA 2COBA 3ZQFA 3FBNB 1S29A 1RESA 2I5UA 4G94A 3G4SI 1H89C 2GLOA 4XOPA 2GWRA 4LLGF 2HXIA 4HZFA 2L9VA 2ZMEA 2VBZA 3ABUA 3QU3A 4NB5A 1W7PA 1PP8F 2WWYA 1JTYA 2HXOA 1W7PD 3BR1A 5GPCA 2BGCA 4O6JA 1GXQA 2KZVA 4D0PA 2CV2A 2J5PA 4MQVA 3S3OA 1KQ0A 4XLHA 2F5FA 3FHNA 1UMQA 2QKMB 2EB7A 1GV5A 2P7VB 4P55A 2WBMA 2ZJRF 4CO8A 3MQ0A 2X1EA 3ZPLA 1WQ2A 1P7IA 2XAHA 4A3DJ 5HDKA 4I98B 1MMDA 1VZ0A 2ETHA 5DM7F 4V19K 1AU7A 5M5WJ 1N25A 1JKOC 2P6TA 4IHYA 5E1XA 3E6CC 2H8WA 3KEQA 2DA7A 3PL8A 1QNTA 3RTRA 4IHWA 4PGGA 3VYRB 5E17F 3OSGA 1LDKB 5E3NA 4NQWA 4Y13A 1T39A 1DPRA 4DGWB 3BTJA 2VQGA 1D5VA 4HV5A 2JUGA 3CMMA 2BVLA 2DK5A 1ZTRA 1JJ6C 3FXJA 3PQJA 4XLPF 3GYHX 1IN6A 4MEXF 4B43A 3UR3C 3K4NA 1AA7A 2ME0A 2XSJC 5K5OA 3GW2A 4TV7A 2FQ3A 1BL0A 2E1MB 2IXSA 4KUMA 2MABA 3QOEA 5HLTA 3EYYA 4GYGA 3U1KA 1MJ9A 2X1DA 2OZUA 4F92B 2HYGD 4NNJA 3JTGA 4DYQA 5FRNA 5LHIA 3H9QA 3IH3A 4HOBA 3PIPF 5E8IA 3CMAI 1D0XA 2RGVA 4OIQF 1ZARA 4YIRX 2XAFA 2JWTA 1WJAA 3B6CA 3CUQC 3GBGA 3KPHA 3I5UA 2LF7A 3TO6A 5FLMJ 3I4PA 1Z77A 3NWSA 1E3OC 4EJUA 3CC7I 4N9IA 5D8KB 2CG4A 4P9FA 4U7BA 2VLAA 2DMPA 1MBJA 2R7FA 1F36A 2H1KA 2HVRA 3FXRA 2VOOA 5F27A 3L2CA 4NQWB 3ZMZA 1X1DA 3BQZA 2R7ZJ 4A3JJ 3SYTA 1MJBA 5FD6A 5FLXK 2CGPA 2K9LA 1NTCA 4IXAA 2PMHA 5CJ9A 3F8NA 3LL7A 1T08B 5AIPA 4C9YA 4ZYDA 5KAFC 2L3DA 5ICCA 3OOPA 2LF8A 1VQNI 1UELB 2G9WA 1UHWA 3ROUA 5ICEA 4V2FA 3SEZA 4UY8I 2R93J 2LK2A 2W00A 3L2VA 3M9AA 4I7HA 1G6NA 3FXKA 2L7MP 4E7SA 3Q3SA 3CP8A 2X6OA 4E7JA 1YIOA 1WI9A 2BHYA 1JGGA 3LQQA 1HW5A 1MNMC 2DN0A 4B8XA 3GLXA 2P5KA 2O5RA 3QU6A 3WTXC 2R7WA 4A0XA 1IRFA 4M3BA 2LC2A 1XX5A 3ZMDA 4MQ9F 5CVJA 2VQLA 5FJ8J 3BR6A 2DFFA 2CUFA 3FXUA 3RZDJ 1S7AA 3BJOA 2Q8KA 2A6HF 4IOAF 3GTQJ 4YFNF 4OIPF 1HKQA 2F48A 2FXAA 3HDDA 5HNHA 2DO7A 2ELHA 1WCMJ 4D7NA 2ECCA 1H0MA 3V7RA 1NK3P 3LOCA 4L5JA 4MLOA 1REPC 5JVGF 4IZZA 1R1TA 4PFOA 3DBHB 3MAJA 1U9NA 2Z2SB 1GDTA 3WG9A 5JHUA 1QZYA 4FISA 3M8JA 1S5LC 3PFIA 4RM3A 1D5YA 2M3AA 4XLFA 3M7GA 1IZ1A 3QQAA 2A6TA 4E7ZA 2VB6A 3BCBA 2ZJ2A 1FYMA 1ZQ3P 2E7XA 4U0VA 3HHGA 2FOWA 1TW2A 1D1AA 1HW2A 1WPKA 2P81A 1KGSA 3LA2A 3HPHA 4AYBN 4IQ4A 1DPUA 3FKIJ 3FMRA 4IPAA 3QPLA 4K2EA 4P96A 4CYCB 5E79C 1IG7A 1GUUA 2ZKZA 1A31A 1D0ZA 4A6DA 2QENA 3HOZJ 5IT9K 3RZOJ 3J7YJ 2MBFA 1X2MA 2IP2A 1B9MA 3FXMA 3H1CA 4L18B 1YIJI 1IN4A 1AOYA 2DA6A 1ITYA 3MKYB 4KICA 2WAFA 3O6BB 2EWNA 3LA7A 2PEXA 2KQRA 3T8TA 4KYWA 4ESFA 2DT7B 4OWRB 5E3OA 2Y9ZA 2Y75A 2PJRA 3P9IA 1LEAA 4ZZLA 4U87A 2DFIA 4LITA 2D1HA 1AHDP 3W2WA 2CWEA 4KDPA 1Q1HA 3AG1H 3EDPA 1R1UA 1IW7F 3E6MA 1ZK8A 2FBIA 2KLOA 4AM3A 4HW0A 5ILSA 1U2WA 1Y0UA 2P5VA 1W5TA 1BW5A 1Y0NA 4QLCU 2VJIA 1I50J 2DBBA 4A3KJ 2QBYA 2E1CA 3G2BA 1IUFA 3W6JB 1QRYA 2OCEA 2ZJQF 4XBFA 2XF6A 3H3UA 3SZGA 2A6EF 4NC7A 5IT3A 5BPDA 2IEKA 2BE5F 3FZVA 2V7FA 3KEOA 4W1UA 4BEHA 1B72B 2ZXWH 1T95A 4HV6A 2XGDA 3G3ZA 4AIHA 1LJ9A 2IA0A 2ZFUA 2IJLA 2DPUA 4C2UA 1UG2A 4M9SA 1JKPC 1K83J 4IQJA 5J1UA 2QGUA 1XMKA 2HQ5A 2F4IA 3CC4I 4G6DA 1S72I 3OYBA 3K4BA 4A3LJ 1U0JA 2XGXA 2WADA 3NRVA 3TDZC 4IHSA 2WB1N 3A01A 2DMQA 1HDPA 5EEHA 4BHPA 4HDVA 4KIBA 2JRMA 2OQRA 2OUMA 2O7OA 2QSGX 4LG0B 4GYIA 5LBQA 1D1BA 2FJ1A 4XRSG 1BC7C 3MKZA 1W1WE 1WRJA 2XDVA 2ZMEB 3MMYB 4F7ZA 5JR3A 1XD7A 2NXNB 2MLGA 1J5YA 1ETQA 5LGUA 4F91B 3F6OA 1HSTA 3M8EA 3MVPA 4BQAA 2KIUA 4FX0A 5CYVA 3LFKA 4DNCA 1K4TA 2PX9A 2X0LA 3DCFA 5K5RA 4AIDA 2VKEA 3IRQA 5IY5H 4HSTA 3HZJA 3NAUA 3SHFA 1K78A 5JLWA 4I0BA 2MG4A 1I5ZA 2JQ7A 3H92A 5LLQA 1X2NA 2ZCWA 2IW5A 1PDNC 4XKVA 2VJJA 2EFOA 4BQOA 1ULYA 4Y3OA 1OYIA 2YU9J 4BQNA 2HR3A 4E6KG 2QBYB 2X6XA 3V8JA 2LBFA 4MFDA 4XN0A 4XLAA 3CCUI 3FXQA 2FE3A 3L00A 1R4NB 2F5VA 1KYZA 3F8BA 1IN7A 3QOPA 1OCTC 2DMTA 3KETA 2RREA 3Q5FA 2I10A 3I64A 2V9KA 3ZQCA 2HTJA 1ON1A 2DFHA 5K7HA 4LLLA 1I3QJ 2QYOA 3DWLE 2FA5A 2L4AA 2VUMJ 2GXGA 3HOYJ 1OISA 1FYKA 2GBYA 2JRTA 5L3EA 2LVSA 2FMYA 2GM4A 1BBYA 4PCQA 1TQPA 2JTVA 2FX0A 3R0JA 2HYJA 3RQ4A 4BQQA 1S3JA 1WHUA 2K4JA 5EG0B 4KITB 3GZ6A 3ZMSA 2K40A 3DXJF 1B59A 2Y48A 1AKHA 1HKTA 2ZSHB 3IC7A 4FE7A 1FMWA 2P6SA 4L0ZB 2K27A 3HL2A 3A03A 2LBFB 3GLLA 2HDCA 1LKXA 2RC4A 4EM1A 1CF7B 4FQGA 4OMZA 1MMGA 2E7WA 2OQGA 1B8IA 5J6XA 4O3MA 2P4WA 1WJCA 3HIFA 3ISPA 5B3SH 1K7AA 2EZLA 5CVVA 4BU2A 2WY7Q 3TP0A 2JA7J 2D5VA 1JE8A 4I0AA 4HLXA 4BXXJ 4P9UA 3BROA 4XK4A 2VJ4A 3K1NA 3Q9VA 4HPQA 1SANA 5H6QA 3OS1A 3R0AA 4CCMA 5GADJ 4AD9A 1FIPA 3WU2C 2EPFA 1LQ1A 3R60A 2IRFG 2OBPA 4IL6C 2CH0A 2EFNA 2E2JJ 3ABMH 4R1HA 2IBDA 2YS9A 4I01A 1UG0A 1ZGJA 2BV6A 1DQUA 5K5QA 1CQTA 2LP0A 4ETSA 1P6RA 1QHGA 1A5JA 3K0LA 1B4AA 1KU3A 2EBIA 4BE0A 4EGYA 2WA0A 2R7RA 4AIKA 3WTWC 4ENNA 4F93B 1O3SA 1HKSA 4YELA 5FKNA 3LWFA 3WODF 3LNQA 4X6AJ 1MNEA 2NNNA 4X0GA 1Z7UA 3CESA 1MDMA 1IRXA 1XDSA 2BVMA 4C30A 1DDNA 5D6FA 1FBQA 2F5EA 2E5ZA 2F5CA 4BE2A 3GFMA 3K4LA 3QYBA 4UHTA 1O3QA 3FISA 4S0HB 3QODA 1FP1D 2L9RA 1WJEA 5D4RA 4ANJA 3BCAA 4KT5C 4HQEA 3A2KA 3CJQB 4FE4A 4MHGA 5HLGA 2D1VA 2FEZA 2Q1ZB 3BZKA 2OZ6A 2WTEA 2XV4S 3DKYA 3S32A 1Y6IA 4ZZDA 1Y8RB 4YIFA 1KA8A 3CF5F 4GFBA 1J7KA 3S93A 4AUXA 5KVRA 1IGNA 3OOUA 1DGWY 3BLYA 5F04A 1T2KA 1XDUA 2WC2A 2JK3A 4N0BA 3C2GA 5EZHA 1ACIA 1SFEA 2COMA 1IN5A 2DYSH 4EJOA 1WZ2A 4OINF 1W5SA 4BJ5C 4Q4ZF 1IXRC 4RS8A 2QQAA 3BZ6A 3GWZA 4RLFA 2IT0A 3V8LA 1SAXA 4LIUA 1YX5A 2NOJB 1R22A 5FFZA 3TDUC 2E71A 4WXCA 2HOEA 2Y31A 3ZN0A 5CPRB 1ERDA 1FBSA 1TWFJ 1G8XA 2JA8J 4HYEA 3CLQA 2LNBA 2R7TA 3LSTA 2LRDA 5M5YJ 4Z2YA 4M3DA 3BR2A 1U9OA 3OL3A 2FSWA 4XMYA 4A69C 4G7ZF 1R23A 1YJ9I 5EJCA 1FMVA 5IOZA 4CGZA 3SEQA 2IS2A 3T1BA 4E70A 2DT6A 3LQRA 1YLFA 2CQNA 3W6VA 1ONVA 2BW3B 4OAZA 3T8RA 2JPBA 2VKDA 3BG9A 3WG7H 3OYHA 1H8AC 2FQ4A 3EUKL 1G2HA 1DUXC 2HFHA 1BW6A 1NK2P 4OMYA 4Z6YA 3HRMA 2HU9A 1TNSA 3HGYA 2MFZA 2NYXA 1EH6A 2CU7A 2Q2EA 1R71A 2BY2A 1S9HA 2EJRA 3CCJI 3U9GA 2CV0A 1M1EB 2VBWA 4D9JA 2KISA 4II2A 2X9DA 4FHTA 2K85A 1HA8A 3WE3A 1QZZA 4ITVA 4MGRA 5F0FA 2CUJA 1SMTA 3OR1C 3KEYA 3ZCOA 4A93J 1WH7A 2UXXA 3FMQA 3GO5A 2DI3A 3HB9A 2XUBA 1V54H 5EEGA 2M5WA 1Y8QB 4A0ZA 4HRIA 1RKTA 2PQ8A 4RAZA 2H1LA 2OD5A 1J75A 1LFBA 1RUOA 2BY3A 1H9GA 5E20A 1MH3A 2QSFX 3V42A 5C44J 2VXZA 4PK4A 1BI2A 4WF2A 2IPQX 5ERIA 1YW7A 1R49A 3SDGA 3PNYA 3EETA 4BGDA 2CO5A 4L5IA 5A2QZ 1YJWI 3K70D 4DIQA 5D8LB 3MEXA 4E7IA 3ZMVA 1APLC 4EATA 1YITI 1RUNA 3BZCA 1K6OA 1MH4A 3PNTA 3VPRA 1XMAA 2F2EA 1A04A 3K10A 4KJZA 9ANTA 3ABKH 4NC6A 4XSZF 3G1MA 1KYWA 3G6EI 4N9HA 3L9FA 3OMYA 1F4KA 4AVPA 2JVHA 1Y56A 3K69A 3HOWJ 2DTRA 3LSPA 2IGMA 3GX4X 3ASOH 3EPZA 3V8KA 3OYLA 1EJ9A 1UHSA 2KFDA 2GA2A 4M9ZA 3GUDA 4LFUA 3LMMA 3WHCA 2XF7A 3BY6A 4RMNA 2IGNA 4QTRA 1VQ9I 2CUZA 1BI3A 1STZA 2BY1A 2HNHA 1QPIA 2GIZA 1USSA 1IC8A 2HPMA 4L9TA 2ICWG 1GLNA 2EV5A 1L3LA 1TWCJ 2WAEA 2M9HA 1BC8C 4PJMA 3JW4A 3S14J 1WGXA 2KDZA 5DCFA 5DD4A 3ZQQA 3J81Z 4F52A 1A36A 3R4KA 5IP6A 1XGSA 2YX4A 2EFPA 1LDDA 1IRGA 2GOXB 2P7CB 3BG7A 4BUPA 3FXOA 3VYSB 1EH8A 5JHFA 3AFHA 5EF6A 4ZDOA 4RM2A 5HODA 1KQ8A 1U5TC 2HQRA 4A5MA 3CCLI 4KIFA 3GTMJ 1JJ8C 4XM3A 3ZQGA 1LB2A 4LIVA 4S04A 5BNGA 3E5QA 1RNLA 2DJIA 2OTJI 3H3ZA 1FPQA 1K4SA 4AC0A 4LK1F 2OPTA 4C3JJ 1Z3XA 3K1PA 2FD5A 5F08A 4E4HA 4V2GA 1SC7A 3P7NA 3HC7A 2UV1A 1BI1A 2PFBA 4UUVA 2P5LC 3F8MA 3SXYA 4RAFA 6PAXA 4JBAA 1N78A 1XC5A 2W24A 2WY8Q 5IYBJ 1IAWA 5AIQA 1WJ5A 5KNLA 4HNUA 5F0HA 1FYLA 4UUTA 4XKBA 5DD8A 2FMLA 2MC3A 1QHHD 3C1DA 1LE8B 2M7AA 2Y0SA 5L3CA 2FOKA 1FTTA 1X3UA 1XGOA 1ZR4A 4OIOF 1IO2A 2VI6A 2IGOA 3KFWX 3TP3A 1VNDA 1OCCH 4KN4X 4W97A 3HSEA 4JP0A 1XN7A 2XIGA 3BC8A 1YS6A 2DFEA 1JTXA 3W3CA 2NS8A 2M45A 1KU2A 1UCRA 3C2HA 4OOIA 1E3HA 3ZN1A 3RSNA 1VQ6I 1IXSB 2A68F 3E97A 4BHBA 3CUQA 3KP5A 5J1RA 4BKXA 5BPIA 3A01B 2K9MA 5FKLA 1OYYA 1XSXA 2DQRA 2LREA 1Z67A 3GVAA 2W4SA 1WFXA 4H4KC 2K3PA 3J7ZI 3H3VK 1OR7C 3RQIA 4A3EJ 3OS0A 3M07A 2TRTA 4M73A 1BI0A 1FT9A 1IV6A 2L9NA 4HF2A 2Z3YA 1Q1VA 2QZ8A 4D7MA 3O8HA 1T0FA 4CCOA 3KZYA 2L2OA 3E7LA 3S15J 4YIIA 2XRNA 3ZGKA 1WJBA 5HS8A 5IOYA 1JUSA 1LNWA 5GP9A 1Z0XA 2UWMA 3DTKA 2F5DA 3OYKA 1S7EA 3PM1A 1YS7A 2R4GA 2VPRA 3M4OJ 2O3FA 3W6KB 1NG6A 2V1XA 5HNFA 5BS6A 3FK7A 4G6QA 1FIAA 1FLIA 1VQLI 3RPQA 3OYAA 2UZKA 2YSRA 4XIDA 3OYNA 1SVOA 3AKZA 4RB1A 2VKVA 5ICGA 2VBYA 1SFOJ 3PNVA 3E5XA 1O3TA 1TNTA 3P5JA 2M2EA 2VKHA 4NBQA 2E19A 4OAYA 3MZYA 2XGEA 3A0HC 1ZG5A 3H35A 1Z21A 4OU0A 5E1WA 5GAHJ 4KISA 3DBRB 2GIVA 3C2BA 1PJRA 1XCVA 2DYRH 2MW8A 4QWQA 3KIOA 3JR9A 4A3MJ 3UNGC 3AAFA 2A69F 2CQXA 4CYDA 1Y1WJ 1YW8A 2L01A 4JQFA 4CZCA 1O7LA 1FBUA 1YYVA 2M0CA 5LHHA 2LMDA 2HKOA 3OV8A 5FLVA 1Z05A 1IXCA 1YJNI 4RB0A 5IT9Z 1X1PA 3JAMK 4HEA2 2FBHA 5E8GA 2LR8A 2RKHA 4UVCA 2D45A 4HQMA 4ON0A 3F72A 2OAZA 5CVUA 5JLXA 2QA4I 2BXZA 2NVQJ 1X3ZB 3HOSA 1I27A 4XRSA 3BDDA 3S1MJ 5FO5A 5M3FJ 5J3LA 3JREA 3KE2A 3HM5A 3AG4H 3TMOA 4ENJA 3CO6C 3PUBA 4WX9A 2KKOA 2BZTA 1E17A 2V9PA 1IJWC 3JRGA 3ZMUA 4M6VA 3DBLB 2VBXA 1OCRH 3QPTA 3I59B 4LD5A 5F6FA 1R9TJ 4KMFA 2R5ZB 3FK6A 3Q0UA 3N05A 2LKSA 5DCMA 5GAGJ 5D5XB 2R5ZA 4JX5A 4PJJA 2ZMEC 3HXLA 3WHBA 1HDDC 4MO7A 4XORA 5FGMA 2FRHA 4ZTFA 1OQYA 4XNFA 2CUEA 2LKPA 2OU2A 4OIRF 5GTHC 1FJLA 4I2OA 4C3IJ 3C7JA 5DUIA 4HNVA 1R00A 3ZP5A 3V4GA 2EZKA 1IN8A 1MKMA 3DU5A 2DU9A 4M9XA 1Z6TA 2JVGA 3HHHA 4PJNA 5AONA 2N8GA 3JAMZ 5KHDA 1JKQC 2CYYA 3F8FA 2LY9A 2ECBA 2EK5A 2Z99A 3WU1B 3HGGA 4GXOA 4XKCA 2STWA 3RKWA 5DV5A 4HX4A 2DA2A 2X48A 1KU9A 1SFUA 2PJPA 1J59A 2FNAA 3OR2C 3U2RA 4B3AA 3E5UA 5DDGA 3BG3A 3ZQIA 1RPWA 3PO2J 1UAAA 4DBQA 3D5SC 4IRGA 2W85A 5F64A 4ZYAA 4QPOA 4NUBA 1JT0A 2LG4A 2LOOA 1G3YA 2IAIA 2NRAC 2XASA 2ZNZA 1FOXA 2F6CA 1FTZA 1IDYA 5CVRA 5ICFA 1RKWA 4KN7X 1W4MA 2LFBA 2JJ7A 4G7OF 3A0BC 3Q0VA 5FLXZ 1RETA 3HRUA 1UB9A 2K4BA 4M71A 1MSFC 2VE8A 4UVBA 1TQMA 3W2AA 3IAM2 2ELKA 4HF1A 2FUG2 4PFPA 2R7VA 2X6WA 4L5EA 3DF8A 4Y17A 1NG7A 5KK1A 2HQAA 3AL0C 4D1QA 4AIJA 3K1MA 2ZXJA 4YFXF 3K4MA 2Y2ZA 3GF2A 3CCRI 1O57A 4DZJA 3RKQA 3U21A 3ZMTA 1YRNB 2ZNYA 1D3YA 2V1NA 3C18A 2EZIA 4U7DA 4CHUA 3DV8A 3G1OA 4IO9F 4FTHA 4A5NA 3GTGJ 2AO9A 2W25A 3ZQHA 1LUJB 2E1OA 4J00A 1LVAA 3JRAA 2GQQA 3FKJA 3K4JA 1TT0A 2MSYA 2JSPA 5CVIA 5K7FA 1YX3A 3ECHA 5TJJA 4E7LA 2E35A 1SD7A 1S8NA 2X6YA 3TW7A 2QLZA 2NOGA 4LOCA 2EIJH 4M3EA 5J8FA 1ZRFA 3RCOA 2RVCA 4XLEA 3HKZA 4Y15A 3X2QH 3L2RA 2LH9A 2IA2A 1YO5C 2ADUA 3S2WA 1XPXA 4PDKA 1ETVA 1XCBA 3VWBA 1VQOI 4ZYEA 4BHCA 2CS3A 3CDHA 1OYWA 2A5YB 1DGRM 4QSHA 5B66C 2RQQA
chains in the Genus database with same CATH topology
4CDGA 1W7PB 4AWXB 4L9JA 2QWWA 2XKOA 2DAOA 5LEJA 5LRSA 3BOQA 5LHGA 4EVIA 4DQ2A 1GVJA 1BN5A 4ENMA 1FZPB 4LG0A 3IRRA 4ZYGA 1C0WA 1ZH5A 2O0YA 3N97A 3WTZA 2ZFWA 3DEUA 2IA1A 1BIAA 2VONA 2LSOA 3J7AO 1CGPA 2AXLA 2ISYA 1DP7P 1SMYF 1OKRA 1MJAA 3WTYC 5HS7A 1YTYA 1ZLJA 3EUHA 2IVMA 4ZYHA 3E6DA 1OMIA 2XAJA 2VODA 1MGTA 2VT2A 2R3SA 4ENKA 3CTAA 3LAJA 5TRDA 1R1VA 4GGGA 1SD6A 4FX4A 4EQQA 3WGHA 2GAUA 3F22A 3DQVC 5HS9A 2M8EA 3KP6A 3FX3A 4YFKF 2NNYA 2PBIA 3IWZA 4XSXF 5D6EA 3DPTA 1YG2A 1K79A 4HX7A 3BJAA 4BYYA 2PG4A 1ZLKA 2ACJA 5E18F 4L9NA 1HW1A 3ERED 4KMUX 5LEKA 3QPHA 2G7UA 5HDGA 3J80K 5L3GA 3COAC 3GZ5A 5D5WB 1Z9CA 3GXOA 3GFJA 5FFXA 2PN6A 1RI7A 2NS0A 3RKYA 5HDNA 5LGTA 2A3SA 4EJWA 1U3EM 2G7HA 2YU3A 3N4MA 1F1ZA 1P4WA 4WK8F 4HDUA 4R79A 1FOKA 1MZBA 1E2XA 1TBXA 4MTEA 3RJPA 2V9VA 1QBJA 1FWZA 2ISZA 3KCCA 5ILUA 1F5TA 2XVCA 2O8XA 3MWMA 1GHCA 2R7DA 4KNYA 4EM0B 3QAHA 2QQBA 2Z33A 2HZTA 1U8RA 4CZZA 4MTDA 4R8HA 2A61A 1U5TA 3WTTC 3U1DA 2W57A 3ML6A 1RZ4A 4IJAA 4EGZA 4RGXA 5D5UB 4U0WA 4XLNF 4HAMA 4A2UA 4LLNA 1U5TB 3F8CA 3GFLA 4UVAA 4RAYA 3QP6A 3VB2A 2FNPA 1FP2A 3B02A 1TQIA 3MFKA 4KFCA 3ABTA 3F3XA 1J2XA 4WXDA 1G3TA 3HTUA 4BH9A 3F21A 5DUKA 2GXBA 2MA3A 2O03A 1V3FA 2Z9OA 3LAPA 2JSCA 1S6LA 2DT5A 1KQ9A 3FM5A 4G9YA 5DEQA 3P9KA 2DQLA 1B9NA 1F9NA 4UXNA 3RIRA 5H6RA 5BQTA 3WE2A 5D5VB 5DCMB 3IKVA 3WGIA 4A0YA 1HXDA 3LA3A 5H20A 3J80Z 3FF5A 3FM3A 3ZQ7A 3V7SA 1D8KA 1BM9A 4GCVA 1QGPA 3FWEA 2J5OA 3VFZA 2PI0A 2ZBKA 1YFHA 4EMSA 1ZRDA 2EFWA 1Z1DA 2CSOA 4FT8A 2CW0F 1USTA 4A6EA 2K86A 3CJNA 2RQPA 1MD0A 1HBXG 4RGSA 2RN7A 4NHJA 2JPCA 2XAQA 4HLYA 1T6SA 1AWCA 3IHUA 3VEPA 3RDIA 1P92A 2GA1A 4WCGA 4O5VA 1ZHFA 4HBLA 1RIOH 3HTSB 3WTVC 3ECOA 1BIBA 2WV0A 3HYIA 2QUFA 3TQNA 1XGNA 2V6CA 5D4SA 4BNCA 1ODDA 1Z91A 4EJVA 5LRRA 3FHZA 1ZYRF 1UFMA 4ASNA 3WTSC 1P2FA 3E3VA 1B6AA 3BP8A 2MLKA 4IF4A 1JHFA 5L3DA 3HUGA 2VC0A 5LGNA 2VOPA 3VOEA 2KRFA 2YX7A 3RYRA 4S05A 3P9CA 1ZG3A 3E6BA 1FY7A 4RGRA 3CO7C 4M6YA 4KIGA 1SFXA 1J9IA 3M8FA 4IVNA 3HSFA 4IRHA 4H0EA 4HA8A 1Z6RA 1FNNA 3RI4A 4ESJA 3SFZA 1GXPA 1YW9A 2EFQA 3KP2A 3KP4A 2M30A 4G7HF 5L3FA 2FBKA 2W84A 2MH9A 3PQKA 2XKPA 1JGSA 3KLNA 3DP7A 2MH2A 2JT1A 4LGWA 3TOAA 3V7CA 1ZRCA 2STTA 5ED4A 5JFRA 3L7WA 5K1YA 3WGGA 1QO0D 1P4AA 3L09A 4UV8A 3G73A 3JSOA 3TO9A 1XB4A 1QQIA 4U0YA 1SD5A 2ZO4A 1S7OA 1D8JA 5FB2A 1R58A 2EA4A 2QM3A 1QPMA 1OR7A 3HRSA 2HS5A 1BOAA 4UV9A 3M1EA 3KP3A 1R36A 2LDUA 2XHKA 2HKXA 4MNUA 3JSPA 3SZTA 4ZH4F 4WWCA 2VC1A 2O61A 2V1DA 1TTYA 1TLHB 3T5XA 1JHHA 1WWXA 1IUYA 3RYPA 3ULQB 1ON2A 5BMZA 3B73A 3GEZA 2AS5F 1B1BA 3J81K 3O2PE 3WU0A 2MD5A 1R5HA 3IWFA 2H94A 2BBYA 4HX8A 3SQNA 3DKWA 4HF0A 1ZAOA 2ESHA 2Q0OA 4UNOA 4L0YB 4IRIA 1JXSA 3TGNA 4IHTA 2XAGA 1IF1A 2L54A 2HQNA 1LDJA 1O7FA 2Z5UA 1FSHA 1I1GA 1EV7A 1MDMB 4Q5SF 3WTUC 4M6XA 3IKTA 2TDXA 3F6VA 2BYVE 3CUOA 3C3WA 2HTSA 2L4MA 3FMSA 4I09A 1I6XA 3I59A 4EM2A 4PZJA 3IL2A 2GZWA 1PUEE 2DK8A 3VODA 1FX7A 3RKXA 1G3WA 2DW4A 4I02A 2EV6A 5F1RA 2CQKA 3I58A 4JK1X 4CXFA 1G3SA 3SZPA 5HLIA 3D5LA 3O3KA 2RV8A 3T0YA 5L3BA 3BWGA 4B09A 3I71A 2RDPA 3HSRA 4Q47A 2DLLA 4LJZF 1U78A 5HOOA 2YPRA 2B0LA 1ZG1A 2E1NA 4EV0A 2A07F 2FU4A 2VT3A 2ESNA 1J0RA 3QRFF 1HQCA 4M72A 1ZREA 3TO7A 5FD5A 4M74A 4RGUA 1U6GA 1VTNC 5J8CA 2JZYA 4U88A 5HVQC 5DYMA 4RB2C 3NEUA 1P4XA 4GO1A 1ZN2A 3K9TA 2P8TA 4EJTA 4CICA 1V4RA 3BPXA 2VE9A 2FF4A 1SD4A 5ILVA 3KP7A 2V79A 3R6SA 2PMUA 1I1SA 2O6GE 1LEBA 2H27A 3JTHA 5CLSA 3I0TA 2KIMA 4P5OA 4WXHA 5JVTA 2PLYA 1UHMA 2HYFA 1FSEA 4G8XA 2KJBA 1L0OC 2V1UA 2K7LA 3BJ6A 1WKMA 1PP7U 1K78B 1T38A 3I53A 2HEOA 2L02A 1YQAA 5BOXA 2QQ9A 2CFXA 5JI6A 2EV0A 3DFGA 2VN2A 1R5GA 2KIFA 4BXUA 4ESBA 3TOBA 2OA4A 4RB3C 1ZGAA 3R61A 1NHAA 1KU7A 2NAZA 4XRFA 1O3RA 1XSDA 2H6BA 2YR2A 4MEYF 3EQLF 5E1ZB 3I54A 3MCZA 3K2ZA 1OPCA 3GFIA 2UXNA 1CF7A 3HRTA 1BJAA 2D2WA 3CLOA 2HGCA 2H09A 1TW3A 1G4DA 4A12A 1EH7A 2X4HA 3TKYA 3DPLC 4LB6B 1WSUA 2M1BA 2BEOA 2C6YA 3BPVA 3QP5A 3EYIA 5HLHA 2KJCA 2DPDA 3REOA 2EA2A 1H9TA 4KA4A 3F23A 3NQOA 2QVOA 1XSVA 2HWVA 4PGHA 2K02A 1FC3A 2RNJA 3Q9SA 5A2QK 3KZZA 3HOTA 3D0SA 3ELKA 2H6CA 4YG2F 3KLOA 4BAYA 4L9VA 2M87A 1HSJA 1T98A 1R7JA 2XROA 4Q48A 3RPUA 4LMYA 3CUQB 3MZHA 4LB5A 1XGMA 4LK0F 2Y0MA 1S29A 4G94A 2GWRA 4LLGF 4HZFA 2ZMEA 3ABUA 2VBZA 3QU3A 4NB5A 1W7PA 1PP8F 2WWYA 1W7PD 2BGCA 4O6JA 1GXQA 4D0PA 2J5PA 4MQVA 1KQ0A 2F5FA 2EB7A 2P7VB 4P55A 4CO8A 3MQ0A 3ZPLA 1WQ2A 2XAHA 5HDKA 4I98B 2ETHA 2P6TA 5E1XA 3E6CC 3KEQA 1QNTA 3RTRA 4PGGA 5E17F 1LDKB 4NQWA 4Y13A 1T39A 1DPRA 1D5VA 4HV5A 2DK5A 3PQJA 4XLPF 3GYHX 1IN6A 4MEXF 5K5OA 3GW2A 4TV7A 2FQ3A 4KUMA 3EYYA 4GYGA 1MJ9A 2OZUA 2HYGD 3JTGA 5LHIA 4HOBA 5E8IA 2RGVA 4OIQF 1ZARA 2XAFA 3CUQC 3I5UA 2LF7A 3TO6A 3I4PA 4EJUA 4N9IA 5D8KB 2CG4A 4P9FA 4U7BA 2R7FA 3FXRA 2VOOA 3L2CA 3ZMZA 5FLXK 1MJBA 5FD6A 2CGPA 4IXAA 2PMHA 5CJ9A 3F8NA 5AIPA 4ZYDA 2L3DA 5ICCA 3OOPA 2LF8A 2G9WA 1UHWA 3ROUA 5ICEA 3M9AA 4I7HA 1G6NA 1YIOA 1WI9A 3LQQA 1HW5A 4B8XA 3GLXA 2P5KA 3QU6A 3WTXC 4A0XA 1IRFA 3ZMDA 4MQ9F 5CVJA 3FXUA 1S7AA 3BJOA 2Q8KA 2A6HF 4YFNF 4OIPF 1HKQA 2FXAA 2DO7A 2ELHA 1H0MA 3V7RA 1REPC 4L5JA 1R1TA 3MAJA 3WG9A 5JHUA 1QZYA 3PFIA 3M7GA 1IZ1A 2ZJ2A 1FYMA 2E7XA 4U0VA 3HHGA 1TW2A 1HW2A 1KGSA 3LA2A 1DPUA 3FMRA 4IPAA 4K2EA 4P96A 2ZKZA 4A6DA 2QENA 5IT9K 2MBFA 2IP2A 1B9MA 4L18B 1IN4A 1AOYA 4KICA 3O6BB 2EWNA 3LA7A 2PEXA 3T8TA 4KYWA 4ESFA 2Y75A 3P9IA 1LEAA 4ZZLA 2DFIA 2D1HA 2CWEA 4KDPA 1Q1HA 3EDPA 1IW7F 1R1UA 3E6MA 2FBIA 4HW0A 5ILSA 1U2WA 1Y0UA 2P5VA 1W5TA 4QLCU 2DBBA 2QBYA 2E1CA 3W6JB 4XBFA 3H3UA 5IT3A 2A6EF 5BPDA 2BE5F 3FZVA 3KEOA 4HV6A 3G3ZA 4AIHA 1LJ9A 2IA0A 2IJLA 2DPUA 4M9SA 1XMKA 4G6DA 4IHSA 2XGXA 3TDZC 3NRVA 5EEHA 4BHPA 4HDVA 4KIBA 2OQRA 4LG0B 4GYIA 5LBQA 1BC7C 1WRJA 2ZMEB 4F7ZA 5JR3A 1XD7A 2MLGA 1J5YA 5LGUA 3F6OA 1HSTA 3M8EA 4BQAA 2KIUA 4FX0A 5CYVA 3LFKA 4DNCA 2X0LA 5K5RA 3IRQA 3SHFA 1K78A 4I0BA 1I5ZA 3H92A 5LLQA 2ZCWA 2IW5A 1PDNC 2EFOA 1ULYA 1OYIA 2HR3A 2QBYB 3V8JA 3FXQA 2FE3A 3L00A 1KYZA 3F8BA 1IN7A 3QOPA 3KETA 3Q5FA 3I64A 2HTJA 1ON1A 4LLLA 2QYOA 2FA5A 2L4AA 2GXGA 1FYKA 2JRTA 5L3EA 2FMYA 1BBYA 4PCQA 1TQPA 2JTVA 3R0JA 1S3JA 2K4JA 3GZ6A 3ZMSA 3DXJF 1B59A 2Y48A 1HKTA 3IC7A 2P6SA 4L0ZB 2K27A 2HDCA 2RC4A 4EM1A 1CF7B 4OMZA 2OQGA 2E7WA 5J6XA 4O3MA 2P4WA 3HIFA 3ISPA 1K7AA 5CVVA 1JE8A 4I0AA 4HLXA 4P9UA 3BROA 5H6QA 3K1NA 3Q9VA 3R0AA 4AD9A 1LQ1A 3R60A 2IRFG 2OBPA 2EFNA 4R1HA 4I01A 5K5QA 1ZGJA 2BV6A 4ETSA 1P6RA 3K0LA 1B4AA 1KU3A 4EGYA 4AIKA 3WTWC 4ENNA 1O3SA 1HKSA 3LWFA 3WODF 2NNNA 1Z7UA 1MDMA 1XDSA 1DDNA 5D6FA 1FBQA 2F5EA 2F5CA 3GFMA 4UHTA 1O3QA 1FP1D 5D4RA 4HQEA 4KT5C 4MHGA 5HLGA 2D1VA 2FEZA 2OZ6A 2WTEA 2XV4S 4ZZDA 4YIFA 1KA8A 1J7KA 5KVRA 1T2KA 1XDUA 2WC2A 4N0BA 1SFEA 2COMA 1IN5A 4EJOA 4OINF 1W5SA 4Q4ZF 1IXRC 4RS8A 2QQAA 3BZ6A 3GWZA 2IT0A 3V8LA 1SAXA 1R22A 5FFZA 3TDUC 4WXCA 2HOEA 3ZN0A 1FBSA 4HYEA 2LNBA 3LSTA 4Z2YA 2FSWA 4G7ZF 1R23A 4CGZA 3T1BA 4E70A 3LQRA 1YLFA 1ONVA 3T8RA 2JPBA 1DUXC 2HFHA 4OMYA 3HRMA 1TNSA 2NYXA 1EH6A 2Q2EA 2EJRA 3U9GA 2VBWA 4FHTA 3WE3A 1QZZA 4MGRA 1SMTA 2UXXA 3FMQA 3GO5A 2DI3A 2XUBA 5EEGA 2M5WA 4A0ZA 2PQ8A 4RAZA 2OD5A 1J75A 1RUOA 1H9GA 5E20A 2VXZA 1BI2A 4WF2A 2IPQX 5ERIA 1YW7A 3EETA 2CO5A 4L5IA 5A2QZ 5D8LB 3MEXA 3ZMVA 1RUNA 1K6OA 1XMAA 2F2EA 1A04A 4XSZF 1KYWA 4N9HA 3L9FA 1F4KA 4AVPA 3K69A 2DTRA 3GX4X 3V8KA 2GA2A 4M9ZA 3GUDA 4LFUA 3BY6A 1BI3A 1STZA 1USSA 4L9TA 2EV5A 1L3LA 1BC8C 3JW4A 5DCFA 5DD4A 3J81Z 3R4KA 1XGSA 2YX4A 2EFPA 1LDDA 1IRGA 2P7CB 1EH8A 1KQ8A 1U5TC 2HQRA 4A5MA 4KIFA 1LB2A 4S04A 3E5QA 1RNLA 3H3ZA 1FPQA 4LK1F 3K1PA 3P7NA 1BI1A 2PFBA 4UUVA 2P5LC 3F8MA 3SXYA 6PAXA 4JBAA 2W24A 1IAWA 5AIQA 1FYLA 5DD8A 2FMLA 2MC3A 3C1DA 5L3CA 2FOKA 1X3UA 1XGOA 4OIOF 3KFWX 4KN4X 3HSEA 1XN7A 2XIGA 1YS6A 2M45A 1KU2A 1UCRA 3ZN1A 4OOIA 1IXSB 2A68F 4BHBA 3E97A 3CUQA 3KP5A 5BPIA 1OYYA 1XSXA 2DQRA 3GVAA 4M73A 1BI0A 1FT9A 4HF2A 2Z3YA 2QZ8A 1T0FA 3KZYA 4YIIA 2XRNA 5HS8A 1LNWA 2UWMA 2F5DA 1YS7A 2O3FA 3W6KB 2V1XA 1FLIA 5BS6A 4G6QA 3RPQA 2UZKA 2YSRA 4RB1A 5ICGA 2VBYA 1O3TA 3E5XA 1TNTA 3MZYA 1ZG5A 4OU0A 5E1WA 2GIVA 1XCVA 4QWQA 3AAFA 2A69F 4CYDA 1YW8A 2L01A 4JQFA 1O7LA 1FBUA 1YYVA 5LHHA 2HKOA 3OV8A 1Z05A 1IXCA 4RB0A 5IT9Z 3JAMK 2FBHA 5E8GA 2RKHA 4UVCA 2D45A 4HQMA 4ON0A 3F72A 2OAZA 5CVUA 3HOSA 1I27A 3BDDA 5FO5A 3KE2A 4ENJA 3CO6C 4WX9A 2KKOA 1E17A 3ZMUA 2VBXA 3QPTA 3I59B 4LD5A 5F6FA 4KMFA 5DCMA 5D5XB 5FGMA 2FRHA 2LKPA 2OU2A 4OIRF 4I2OA 3C7JA 5DUIA 1R00A 3ZP5A 3V4GA 1IN8A 1MKMA 2DU9A 4M9XA 1Z6TA 3HHHA 5AONA 3JAMZ 2CYYA 3F8FA 2EK5A 2Z99A 3WU1B 4GXOA 2STWA 3RKWA 5DV5A 4HX4A 1KU9A 1SFUA 2PJPA 1J59A 2FNAA 3U2RA 3E5UA 5DDGA 4IRGA 2W85A 5F64A 1G3YA 2NRAC 2XASA 2ZNZA 5CVRA 5ICFA 4KN7X 1W4MA 4G7OF 5FLXZ 3HRUA 1UB9A 2K4BA 4M71A 2VE8A 4UVBA 1TQMA 4HF1A 3DF8A 4Y17A 5KK1A 4AIJA 3K1MA 2ZXJA 4YFXF 3GF2A 1O57A 3ZMTA 2ZNYA 1D3YA 3C18A 4U7DA 4CHUA 3DV8A 4A5NA 2W25A 1LVAA 2GQQA 5CVIA 3ECHA 5TJJA 1SD7A 1S8NA 2QLZA 5J8FA 1ZRFA 2RVCA 4Y15A 2IA2A 1YO5C 2ADUA 3S2WA 4PDKA 1XCBA 4ZYEA 4BHCA 3CDHA 1OYWA 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDG A;  1W7P B;  4AWX B;  4L9J A;  2QWW A;  2XKO A;  2DAO A;  5LEJ A;  5LRS A;  3BOQ A;  5LHG A;  4EVI A;  4DQ2 A;  1GVJ A;  1BN5 A;  4ENM A;  1FZP B;  4LG0 A;  3IRR A;  4ZYG A;  1C0W A;  1ZH5 A;  2O0Y A;  3N97 A;  3WTZ A;  2ZFW A;  3DEU A;  2IA1 A;  1BIA A;  2VON A;  2LSO A;  3J7A O;  1CGP A;  2AXL A;  2ISY A;  1DP7 P;  1SMY F;  1OKR A;  1MJA A;  3WTY C;  5HS7 A;  1YTY A;  1ZLJ A;  3EUH A;  2IVM A;  4ZYH A;  3E6D A;  1OMI A;  2XAJ A;  2VOD A;  1MGT A;  2VT2 A;  2R3S A;  4ENK A;  3CTA A;  3LAJ A;  5TRD A;  1R1V A;  4GGG A;  1SD6 A;  4FX4 A;  4EQQ A;  3WGH A;  2GAU A;  3F22 A;  3DQV C;  5HS9 A;  2M8E A;  3KP6 A;  3FX3 A;  4YFK F;  2NNY A;  2PBI A;  3IWZ A;  4XSX F;  5D6E A;  3DPT A;  1YG2 A;  1K79 A;  4HX7 A;  3BJA A;  4BYY A;  2PG4 A;  1ZLK A;  2ACJ A;  5E18 F;  4L9N A;  1HW1 A;  3ERE D;  4KMU X;  5LEK A;  3QPH A;  2G7U A;  5HDG A;  3J80 K;  5L3G A;  3COA C;  3GZ5 A;  5D5W B;  1Z9C A;  3GXO A;  3GFJ A;  5FFX A;  2PN6 A;  1RI7 A;  2NS0 A;  3RKY A;  5HDN A;  5LGT A;  2A3S A;  4EJW A;  1U3E M;  2G7H A;  2YU3 A;  3N4M A;  1F1Z A;  1P4W A;  4WK8 F;  4HDU A;  4R79 A;  1FOK A;  1MZB A;  1E2X A;  1TBX A;  4MTE A;  3RJP A;  2V9V A;  1QBJ A;  1FWZ A;  2ISZ A;  3KCC A;  5ILU A;  1F5T A;  2XVC A;  2O8X A;  3MWM A;  1GHC A;  2R7D A;  4KNY A;  4EM0 B;  3QAH A;  2QQB A;  2Z33 A;  2HZT A;  1U8R A;  4CZZ A;  4MTD A;  4R8H A;  2A61 A;  1U5T A;  3WTT C;  3U1D A;  2W57 A;  3ML6 A;  1RZ4 A;  4IJA A;  4EGZ A;  4RGX A;  5D5U B;  4U0W A;  4XLN F;  4HAM A;  4A2U A;  4LLN A;  1U5T B;  3F8C A;  3GFL A;  4UVA A;  4RAY A;  3QP6 A;  3VB2 A;  2FNP A;  1FP2 A;  3B02 A;  1TQI A;  3MFK A;  4KFC A;  3ABT A;  3F3X A;  1J2X A;  4WXD A;  1G3T A;  3HTU A;  4BH9 A;  3F21 A;  5DUK A;  2GXB A;  2MA3 A;  2O03 A;  1V3F A;  2Z9O A;  3LAP A;  2JSC A;  1S6L A;  2DT5 A;  1KQ9 A;  3FM5 A;  4G9Y A;  5DEQ A;  3P9K A;  2DQL A;  1B9N A;  1F9N A;  4UXN A;  3RIR A;  5H6R A;  5BQT A;  3WE2 A;  5D5V B;  5DCM B;  3IKV A;  3WGI A;  4A0Y A;  1HXD A;  3LA3 A;  5H20 A;  3J80 Z;  3FF5 A;  3FM3 A;  3ZQ7 A;  3V7S A;  1D8K A;  1BM9 A;  4GCV A;  1QGP A;  3FWE A;  2J5O A;  3VFZ A;  2PI0 A;  2ZBK A;  1YFH A;  4EMS A;  1ZRD A;  2EFW A;  1Z1D A;  2CSO A;  4FT8 A;  2CW0 F;  1UST A;  4A6E A;  2K86 A;  3CJN A;  2RQP A;  1MD0 A;  1HBX G;  4RGS A;  2RN7 A;  4NHJ A;  2JPC A;  2XAQ A;  4HLY A;  1T6S A;  1AWC A;  3IHU A;  3VEP A;  3RDI A;  1P92 A;  2GA1 A;  4WCG A;  4O5V A;  1ZHF A;  4HBL A;  1RIO H;  3HTS B;  3WTV C;  3ECO A;  1BIB A;  2WV0 A;  3HYI A;  2QUF A;  3TQN A;  1XGN A;  2V6C A;  5D4S A;  4BNC A;  1ODD A;  1Z91 A;  4EJV A;  5LRR A;  3FHZ A;  1ZYR F;  1UFM A;  4ASN A;  3WTS C;  1P2F A;  3E3V A;  1B6A A;  3BP8 A;  2MLK A;  4IF4 A;  1JHF A;  5L3D A;  3HUG A;  2VC0 A;  5LGN A;  2VOP A;  3VOE A;  2KRF A;  2YX7 A;  3RYR A;  4S05 A;  3P9C A;  1ZG3 A;  3E6B A;  1FY7 A;  4RGR A;  3CO7 C;  4M6Y A;  4KIG A;  1SFX A;  1J9I A;  3M8F A;  4IVN A;  3HSF A;  4IRH A;  4H0E A;  4HA8 A;  1Z6R A;  1FNN A;  3RI4 A;  4ESJ A;  3SFZ A;  1GXP A;  1YW9 A;  2EFQ A;  3KP2 A;  3KP4 A;  2M30 A;  4G7H F;  5L3F A;  2FBK A;  2W84 A;  2MH9 A;  3PQK A;  2XKP A;  1JGS A;  3KLN A;  3DP7 A;  2MH2 A;  2JT1 A;  4LGW A;  3TOA A;  3V7C A;  1ZRC A;  2STT A;  5ED4 A;  5JFR A;  3L7W A;  5K1Y A;  3WGG A;  1QO0 D;  1P4A A;  3L09 A;  4UV8 A;  3G73 A;  3JSO A;  3TO9 A;  1XB4 A;  1QQI A;  4U0Y A;  1SD5 A;  2ZO4 A;  1S7O A;  1D8J A;  5FB2 A;  1R58 A;  2EA4 A;  2QM3 A;  1QPM A;  1OR7 A;  3HRS A;  2HS5 A;  1BOA A;  4UV9 A;  3M1E A;  3KP3 A;  1R36 A;  2LDU A;  2XHK A;  2HKX A;  4MNU A;  3JSP A;  3SZT A;  4ZH4 F;  4WWC A;  2VC1 A;  2O61 A;  2V1D A;  1TTY A;  1TLH B;  3T5X A;  1JHH A;  1WWX A;  1IUY A;  3RYP A;  3ULQ B;  1ON2 A;  5BMZ A;  3B73 A;  3GEZ A;  2AS5 F;  1B1B A;  3J81 K;  3O2P E;  3WU0 A;  2MD5 A;  1R5H A;  3IWF A;  2H94 A;  2BBY A;  4HX8 A;  3SQN A;  3DKW A;  4HF0 A;  1ZAO A;  2ESH A;  2Q0O A;  4UNO A;  4L0Y B;  4IRI A;  1JXS A;  3TGN A;  4IHT A;  2XAG A;  1IF1 A;  2L54 A;  2HQN A;  1LDJ A;  1O7F A;  2Z5U A;  1FSH A;  1I1G A;  1EV7 A;  1MDM B;  4Q5S F;  3WTU C;  4M6X A;  3IKT A;  2TDX A;  3F6V A;  2BYV E;  3CUO A;  3C3W A;  2HTS A;  2L4M A;  3FMS A;  4I09 A;  1I6X A;  3I59 A;  4EM2 A;  4PZJ A;  3IL2 A;  2GZW A;  1PUE E;  2DK8 A;  3VOD A;  1FX7 A;  3RKX A;  1G3W A;  2DW4 A;  4I02 A;  2EV6 A;  5F1R A;  2CQK A;  3I58 A;  4JK1 X;  4CXF A;  1G3S A;  3SZP A;  5HLI A;  3D5L A;  3O3K A;  2RV8 A;  3T0Y A;  5L3B A;  3BWG A;  4B09 A;  3I71 A;  2RDP A;  3HSR A;  4Q47 A;  2DLL A;  4LJZ F;  1U78 A;  5HOO A;  2YPR A;  2B0L A;  1ZG1 A;  2E1N A;  4EV0 A;  2A07 F;  2FU4 A;  2VT3 A;  2ESN A;  1J0R A;  3QRF F;  1HQC A;  4M72 A;  1ZRE A;  3TO7 A;  5FD5 A;  4M74 A;  4RGU A;  1U6G A;  1VTN C;  5J8C A;  2JZY A;  4U88 A;  5HVQ C;  5DYM A;  4RB2 C;  3NEU A;  1P4X A;  4GO1 A;  1ZN2 A;  3K9T A;  2P8T A;  4EJT A;  4CIC A;  1V4R A;  3BPX A;  2VE9 A;  2FF4 A;  1SD4 A;  5ILV A;  3KP7 A;  2V79 A;  3R6S A;  2PMU A;  1I1S A;  2O6G E;  1LEB A;  2H27 A;  3JTH A;  5CLS A;  3I0T A;  2KIM A;  4P5O A;  4WXH A;  5JVT A;  2PLY A;  1UHM A;  2HYF A;  1FSE A;  4G8X A;  2KJB A;  1L0O C;  2V1U A;  2K7L A;  3BJ6 A;  1WKM A;  1PP7 U;  1K78 B;  1T38 A;  3I53 A;  2HEO A;  2L02 A;  1YQA A;  5BOX A;  2QQ9 A;  2CFX A;  5JI6 A;  2EV0 A;  3DFG A;  2VN2 A;  1R5G A;  2KIF A;  4BXU A;  4ESB A;  3TOB A;  2OA4 A;  4RB3 C;  1ZGA A;  3R61 A;  1NHA A;  1KU7 A;  2NAZ A;  4XRF A;  1O3R A;  1XSD A;  2H6B A;  2YR2 A;  4MEY F;  3EQL F;  5E1Z B;  3I54 A;  3MCZ A;  3K2Z A;  1OPC A;  3GFI A;  2UXN A;  1CF7 A;  3HRT A;  1BJA A;  2D2W A;  3CLO A;  2HGC A;  2H09 A;  1TW3 A;  1G4D A;  4A12 A;  1EH7 A;  2X4H A;  3TKY A;  3DPL C;  4LB6 B;  1WSU A;  2M1B A;  2BEO A;  2C6Y A;  3BPV A;  3QP5 A;  3EYI A;  5HLH A;  2KJC A;  2DPD A;  3REO A;  2EA2 A;  1H9T A;  4KA4 A;  3F23 A;  3NQO A;  2QVO A;  1XSV A;  2HWV A;  4PGH A;  2K02 A;  1FC3 A;  2RNJ A;  3Q9S A;  5A2Q K;  3KZZ A;  3HOT A;  3D0S A;  3ELK A;  2H6C A;  4YG2 F;  3KLO A;  4BAY A;  4L9V A;  2M87 A;  1HSJ A;  1T98 A;  1R7J A;  2XRO A;  4Q48 A;  3RPU A;  4LMY A;  3CUQ B;  3MZH A;  4LB5 A;  1XGM A;  4LK0 F;  2Y0M A;  1S29 A;  4G94 A;  2GWR A;  4LLG F;  4HZF A;  2ZME A;  3ABU A;  2VBZ A;  3QU3 A;  4NB5 A;  1W7P A;  1PP8 F;  2WWY A;  1W7P D;  2BGC A;  4O6J A;  1GXQ A;  4D0P A;  2J5P A;  4MQV A;  1KQ0 A;  2F5F A;  2EB7 A;  2P7V B;  4P55 A;  4CO8 A;  3MQ0 A;  3ZPL A;  1WQ2 A;  2XAH A;  5HDK A;  4I98 B;  2ETH A;  2P6T A;  5E1X A;  3E6C C;  3KEQ A;  1QNT A;  3RTR A;  4PGG A;  5E17 F;  1LDK B;  4NQW A;  4Y13 A;  1T39 A;  1DPR A;  1D5V A;  4HV5 A;  2DK5 A;  3PQJ A;  4XLP F;  3GYH X;  1IN6 A;  4MEX F;  5K5O A;  3GW2 A;  4TV7 A;  2FQ3 A;  4KUM A;  3EYY A;  4GYG A;  1MJ9 A;  2OZU A;  2HYG D;  3JTG A;  5LHI A;  4HOB A;  5E8I A;  2RGV A;  4OIQ F;  1ZAR A;  2XAF A;  3CUQ C;  3I5U A;  2LF7 A;  3TO6 A;  3I4P A;  4EJU A;  4N9I A;  5D8K B;  2CG4 A;  4P9F A;  4U7B A;  2R7F A;  3FXR A;  2VOO A;  3L2C A;  3ZMZ A;  5FLX K;  1MJB A;  5FD6 A;  2CGP A;  4IXA A;  2PMH A;  5CJ9 A;  3F8N A;  5AIP A;  4ZYD A;  2L3D A;  5ICC A;  3OOP A;  2LF8 A;  2G9W A;  1UHW A;  3ROU A;  5ICE A;  3M9A A;  4I7H A;  1G6N A;  1YIO A;  1WI9 A;  3LQQ A;  1HW5 A;  4B8X A;  3GLX A;  2P5K A;  3QU6 A;  3WTX C;  4A0X A;  1IRF A;  3ZMD A;  4MQ9 F;  5CVJ A;  3FXU A;  1S7A A;  3BJO A;  2Q8K A;  2A6H F;  4YFN F;  4OIP F;  1HKQ A;  2FXA A;  2DO7 A;  2ELH A;  1H0M A;  3V7R A;  1REP C;  4L5J A;  1R1T A;  3MAJ A;  3WG9 A;  5JHU A;  1QZY A;  3PFI A;  3M7G A;  1IZ1 A;  2ZJ2 A;  1FYM A;  2E7X A;  4U0V A;  3HHG A;  1TW2 A;  1HW2 A;  1KGS A;  3LA2 A;  1DPU A;  3FMR A;  4IPA A;  4K2E A;  4P96 A;  2ZKZ A;  4A6D A;  2QEN A;  5IT9 K;  2MBF A;  2IP2 A;  1B9M A;  4L18 B;  1IN4 A;  1AOY A;  4KIC A;  3O6B B;  2EWN A;  3LA7 A;  2PEX A;  3T8T A;  4KYW A;  4ESF A;  2Y75 A;  3P9I A;  1LEA A;  4ZZL A;  2DFI A;  2D1H A;  2CWE A;  4KDP A;  1Q1H A;  3EDP A;  1IW7 F;  1R1U A;  3E6M A;  2FBI A;  4HW0 A;  5ILS A;  1U2W A;  1Y0U A;  2P5V A;  1W5T A;  4QLC U;  2DBB A;  2QBY A;  2E1C A;  3W6J B;  4XBF A;  3H3U A;  5IT3 A;  2A6E F;  5BPD A;  2BE5 F;  3FZV A;  3KEO A;  4HV6 A;  3G3Z A;  4AIH A;  1LJ9 A;  2IA0 A;  2IJL A;  2DPU A;  4M9S A;  1XMK A;  4G6D A;  4IHS A;  2XGX A;  3TDZ C;  3NRV A;  5EEH A;  4BHP A;  4HDV A;  4KIB A;  2OQR A;  4LG0 B;  4GYI A;  5LBQ A;  1BC7 C;  1WRJ A;  2ZME B;  4F7Z A;  5JR3 A;  1XD7 A;  2MLG A;  1J5Y A;  5LGU A;  3F6O A;  1HST A;  3M8E A;  4BQA A;  2KIU A;  4FX0 A;  5CYV A;  3LFK A;  4DNC A;  2X0L A;  5K5R A;  3IRQ A;  3SHF A;  1K78 A;  4I0B A;  1I5Z A;  3H92 A;  5LLQ A;  2ZCW A;  2IW5 A;  1PDN C;  2EFO A;  1ULY A;  1OYI A;  2HR3 A;  2QBY B;  3V8J A;  3FXQ A;  2FE3 A;  3L00 A;  1KYZ A;  3F8B A;  1IN7 A;  3QOP A;  3KET A;  3Q5F A;  3I64 A;  2HTJ A;  1ON1 A;  4LLL A;  2QYO A;  2FA5 A;  2L4A A;  2GXG A;  1FYK A;  2JRT A;  5L3E A;  2FMY A;  1BBY A;  4PCQ A;  1TQP A;  2JTV A;  3R0J A;  1S3J A;  2K4J A;  3GZ6 A;  3ZMS A;  3DXJ F;  1B59 A;  2Y48 A;  1HKT A;  3IC7 A;  2P6S A;  4L0Z B;  2K27 A;  2HDC A;  2RC4 A;  4EM1 A;  1CF7 B;  4OMZ A;  2OQG A;  2E7W A;  5J6X A;  4O3M A;  2P4W A;  3HIF A;  3ISP A;  1K7A A;  5CVV A;  1JE8 A;  4I0A A;  4HLX A;  4P9U A;  3BRO A;  5H6Q A;  3K1N A;  3Q9V A;  3R0A A;  4AD9 A;  1LQ1 A;  3R60 A;  2IRF G;  2OBP A;  2EFN A;  4R1H A;  4I01 A;  5K5Q A;  1ZGJ A;  2BV6 A;  4ETS A;  1P6R A;  3K0L A;  1B4A A;  1KU3 A;  4EGY A;  4AIK A;  3WTW C;  4ENN A;  1O3S A;  1HKS A;  3LWF A;  3WOD F;  2NNN A;  1Z7U A;  1MDM A;  1XDS A;  1DDN A;  5D6F A;  1FBQ A;  2F5E A;  2F5C A;  3GFM A;  4UHT A;  1O3Q A;  1FP1 D;  5D4R A;  4HQE A;  4KT5 C;  4MHG A;  5HLG A;  2D1V A;  2FEZ A;  2OZ6 A;  2WTE A;  2XV4 S;  4ZZD A;  4YIF A;  1KA8 A;  1J7K A;  5KVR A;  1T2K A;  1XDU A;  2WC2 A;  4N0B A;  1SFE A;  2COM A;  1IN5 A;  4EJO A;  4OIN F;  1W5S A;  4Q4Z F;  1IXR C;  4RS8 A;  2QQA A;  3BZ6 A;  3GWZ A;  2IT0 A;  3V8L A;  1SAX A;  1R22 A;  5FFZ A;  3TDU C;  4WXC A;  2HOE A;  3ZN0 A;  1FBS A;  4HYE A;  2LNB A;  3LST A;  4Z2Y A;  2FSW A;  4G7Z F;  1R23 A;  4CGZ A;  3T1B A;  4E70 A;  3LQR A;  1YLF A;  1ONV A;  3T8R A;  2JPB A;  1DUX C;  2HFH A;  4OMY A;  3HRM A;  1TNS A;  2NYX A;  1EH6 A;  2Q2E A;  2EJR A;  3U9G A;  2VBW A;  4FHT A;  3WE3 A;  1QZZ A;  4MGR A;  1SMT A;  2UXX A;  3FMQ A;  3GO5 A;  2DI3 A;  2XUB A;  5EEG A;  2M5W A;  4A0Z A;  2PQ8 A;  4RAZ A;  2OD5 A;  1J75 A;  1RUO A;  1H9G A;  5E20 A;  2VXZ A;  1BI2 A;  4WF2 A;  2IPQ X;  5ERI A;  1YW7 A;  3EET A;  2CO5 A;  4L5I A;  5A2Q Z;  5D8L B;  3MEX A;  3ZMV A;  1RUN A;  1K6O A;  1XMA A;  2F2E A;  1A04 A;  4XSZ F;  1KYW A;  4N9H A;  3L9F A;  1F4K A;  4AVP A;  3K69 A;  2DTR A;  3GX4 X;  3V8K A;  2GA2 A;  4M9Z A;  3GUD A;  4LFU A;  3BY6 A;  1BI3 A;  1STZ A;  1USS A;  4L9T A;  2EV5 A;  1L3L A;  1BC8 C;  3JW4 A;  5DCF A;  5DD4 A;  3J81 Z;  3R4K A;  1XGS A;  2YX4 A;  2EFP A;  1LDD A;  1IRG A;  2P7C B;  1EH8 A;  1KQ8 A;  1U5T C;  2HQR A;  4A5M A;  4KIF A;  1LB2 A;  4S04 A;  3E5Q A;  1RNL A;  3H3Z A;  1FPQ A;  4LK1 F;  3K1P A;  3P7N A;  1BI1 A;  2PFB A;  4UUV A;  2P5L C;  3F8M A;  3SXY A;  6PAX A;  4JBA A;  2W24 A;  1IAW A;  5AIQ A;  1FYL A;  5DD8 A;  2FML A;  2MC3 A;  3C1D A;  5L3C A;  2FOK A;  1X3U A;  1XGO A;  4OIO F;  3KFW X;  4KN4 X;  3HSE A;  1XN7 A;  2XIG A;  1YS6 A;  2M45 A;  1KU2 A;  1UCR A;  3ZN1 A;  4OOI A;  1IXS B;  2A68 F;  4BHB A;  3E97 A;  3CUQ A;  3KP5 A;  5BPI A;  1OYY A;  1XSX A;  2DQR A;  3GVA A;  4M73 A;  1BI0 A;  1FT9 A;  4HF2 A;  2Z3Y A;  2QZ8 A;  1T0F A;  3KZY A;  4YII A;  2XRN A;  5HS8 A;  1LNW A;  2UWM A;  2F5D A;  1YS7 A;  2O3F A;  3W6K B;  2V1X A;  1FLI A;  5BS6 A;  4G6Q A;  3RPQ A;  2UZK A;  2YSR A;  4RB1 A;  5ICG A;  2VBY A;  1O3T A;  3E5X A;  1TNT A;  3MZY A;  1ZG5 A;  4OU0 A;  5E1W A;  2GIV A;  1XCV A;  4QWQ A;  3AAF A;  2A69 F;  4CYD A;  1YW8 A;  2L01 A;  4JQF A;  1O7L A;  1FBU A;  1YYV A;  5LHH A;  2HKO A;  3OV8 A;  1Z05 A;  1IXC A;  4RB0 A;  5IT9 Z;  3JAM K;  2FBH A;  5E8G A;  2RKH A;  4UVC A;  2D45 A;  4HQM A;  4ON0 A;  3F72 A;  2OAZ A;  5CVU A;  3HOS A;  1I27 A;  3BDD A;  5FO5 A;  3KE2 A;  4ENJ A;  3CO6 C;  4WX9 A;  2KKO A;  1E17 A;  3ZMU A;  2VBX A;  3QPT A;  3I59 B;  4LD5 A;  5F6F A;  4KMF A;  5DCM A;  5D5X B;  5FGM A;  2FRH A;  2LKP A;  2OU2 A;  4OIR F;  4I2O A;  3C7J A;  5DUI A;  1R00 A;  3ZP5 A;  3V4G A;  1IN8 A;  1MKM A;  2DU9 A;  4M9X A;  1Z6T A;  3HHH A;  5AON A;  3JAM Z;  2CYY A;  3F8F A;  2EK5 A;  2Z99 A;  3WU1 B;  4GXO A;  2STW A;  3RKW A;  5DV5 A;  4HX4 A;  1KU9 A;  1SFU A;  2PJP A;  1J59 A;  2FNA A;  3U2R A;  3E5U A;  5DDG A;  4IRG A;  2W85 A;  5F64 A;  1G3Y A;  2NRA C;  2XAS A;  2ZNZ A;  5CVR A;  5ICF A;  4KN7 X;  1W4M A;  4G7O F;  5FLX Z;  3HRU A;  1UB9 A;  2K4B A;  4M71 A;  2VE8 A;  4UVB A;  1TQM A;  4HF1 A;  3DF8 A;  4Y17 A;  5KK1 A;  4AIJ A;  3K1M A;  2ZXJ A;  4YFX F;  3GF2 A;  1O57 A;  3ZMT A;  2ZNY A;  1D3Y A;  3C18 A;  4U7D A;  4CHU A;  3DV8 A;  4A5N A;  2W25 A;  1LVA A;  2GQQ A;  5CVI A;  3ECH A;  5TJJ A;  1SD7 A;  1S8N A;  2QLZ A;  5J8F A;  1ZRF A;  2RVC A;  4Y15 A;  2IA2 A;  1YO5 C;  2ADU A;  3S2W A;  4PDK A;  1XCB A;  4ZYE A;  4BHC A;  3CDH A;  1OYW A;  2A5Y B; 
#chains in the Genus database with same CATH topology
 1QU3 A;  4CDG A;  1W7P B;  2ZSI B;  4AWX B;  3HEF A;  2NVU B;  4L9J A;  2QWW A;  3ZR8 X;  2M4K A;  2DMU A;  2XKO A;  2DAO A;  5LEJ A;  5LRS A;  3BOQ A;  2JA2 A;  2UUZ A;  4UB8 C;  3F9K A;  2JUC A;  5LHG A;  4EVI A;  3K6G A;  4DQ2 A;  3CJR B;  1T33 A;  1HF0 A;  1GVJ A;  4RA2 A;  1BN5 A;  4ENM A;  1XG1 A;  3ABL H;  3PSF A;  1G59 A;  1LE8 A;  2XPU A;  1FZP B;  4J01 A;  4LG0 A;  3IRR A;  1X19 A;  4ZYG A;  1C0W A;  2M34 A;  3IH2 A;  4A3F J;  1ZH5 A;  1B72 A;  2O0Y A;  3N97 A;  3WTZ A;  4GDF A;  1IV8 A;  2ZFW A;  3DEU A;  2IA1 A;  3I4M J;  1BIA A;  2VON A;  1WJD A;  1X1A A;  2LSO A;  2CQQ A;  4GRI A;  4FAS D;  3J7A O;  3LSJ A;  1CGP A;  2AXL A;  1VQ5 I;  3OYD A;  2DA4 A;  2ISY A;  3KYL A;  1DP7 P;  4Y33 A;  2CQ7 A;  3J7A Y;  3CCY A;  1SMY F;  2KPM A;  3EUH C;  1OKR A;  1MJA A;  2R7Q A;  3WTY C;  5HS7 A;  1YTY A;  1TL8 A;  3HPG A;  1ZLJ A;  3EUH A;  1MBE A;  1DU6 A;  2IVM A;  4Y52 J;  2MGQ A;  2NS7 A;  4ZYH A;  3E6D A;  5GPA A;  1OMI A;  2O8K A;  1TT5 B;  4BXF A;  2XAJ A;  2VOD A;  5KCM A;  1MGT A;  2AXT C;  4Y4R A;  2VT2 A;  2R3S A;  3H0D A;  4ENK A;  4IHX A;  3CTA A;  3LAJ A;  4M3G A;  1X3W B;  5TRD A;  3DU6 A;  1R1V A;  3E1S A;  1QVU A;  4GGG A;  1ETO A;  3OL4 A;  3GTP J;  1SD6 A;  4FX4 A;  4EQQ A;  3WGH A;  2GAU A;  3LSH A;  3F22 A;  3DQV C;  3VSK A;  5HS9 A;  1MND A;  4CA0 A;  2K3F A;  2M8E A;  1SVM A;  3DTE A;  3KP6 A;  1LFU P;  3FX3 A;  4YFK F;  2NNY A;  2PBI A;  3I4N J;  4XLC A;  3IWZ A;  4XSX F;  5D6E A;  4HNT A;  2EIN H;  4B44 A;  3DPT A;  3CDI A;  3L2Q A;  2VQC A;  1YG2 A;  1MBK A;  1K79 A;  1PUF B;  3O8G A;  4HX7 A;  2L0K A;  3PSI A;  2X51 A;  2CMP A;  3BJA A;  3BR3 A;  5E3L A;  4BYY A;  2PG4 A;  1ZLK A;  1JUM A;  2QQ8 A;  2ACJ A;  5E18 F;  3DKX A;  2E5N A;  4L9N A;  5J1Y A;  1BR4 A;  3PO3 J;  1FOW A;  1HW1 A;  3ERE D;  2XC7 A;  3H9G A;  2OCC H;  4KMU X;  5LEK A;  3QPH A;  1RRJ A;  2G7U A;  2H8R A;  4KT6 A;  5HDG A;  5CKT A;  3J80 K;  2KP6 A;  5L3G A;  4A3I J;  3COA C;  3GZ5 A;  4JYK A;  3S1R J;  3OYJ A;  1GVD A;  3OSF A;  3HOV J;  5D5W B;  2HOT A;  1Z9C A;  3GXO A;  2ZB9 A;  3ZRG A;  5C3E J;  3GFJ A;  2M4G A;  5FFX A;  3S1N J;  2PN6 A;  1J09 A;  3LSM A;  1RI7 A;  2NS0 A;  5EGO A;  3RKY A;  1X1B A;  3PJR A;  5DS9 A;  5HDN A;  5LGT A;  2R7S A;  2PMZ A;  2A3S A;  4CCL A;  2Z1D A;  1KZH A;  4EJW A;  4XKW A;  1U3E M;  2G7H A;  2B7E A;  2DDA A;  1ETX A;  2YU3 A;  2LKX A;  3K4C A;  3N4M A;  1F1Z A;  3GTJ J;  4HSR A;  4IX7 A;  1P4W A;  4WK8 F;  3CDL A;  4HDU A;  4R79 A;  2JN6 A;  3KZI C;  3L2W A;  1FOK A;  1MZB A;  1E2X A;  5IP7 J;  5M3M J;  1TBX A;  4MTE A;  1IDZ A;  4AU7 A;  5C4J J;  4IHV A;  2KL4 A;  1ETY A;  3RJP A;  3S8P A;  5E3M A;  2V9V A;  1T8I A;  1QBJ A;  1FWZ A;  2ISZ A;  2XPW A;  3KCC A;  2MYS A;  5ILU A;  1F5T A;  1RC9 A;  5CQE A;  4AVZ A;  2XVC A;  1MSE C;  1WJF A;  2NVY J;  2O8X A;  3MWM A;  1GHC A;  4UUS A;  2R7D A;  4KNY A;  4EM0 B;  3QAH A;  4C2M J;  3QYE A;  3LSR A;  2QQB A;  2Z33 A;  1F43 A;  3F0C A;  2HZT A;  3TW6 A;  4CZZ A;  3OY9 A;  1U8R A;  1T56 A;  4MTD A;  4F55 A;  4R8H A;  3JRB A;  2A61 A;  3KYD B;  1U5T A;  3ZOB A;  1QVT A;  3BTC A;  3WTT C;  3U1D A;  1OCZ H;  4ABZ A;  2W57 A;  3ML6 A;  2KHM A;  5GTI C;  1RZ4 A;  2E36 A;  2ZXH A;  4IJA A;  4EGZ A;  2Y69 H;  1TWH J;  4RGX A;  5D5U B;  4U0W A;  4XLN F;  1TC3 C;  4HAM A;  2OTL I;  4A2U A;  4LLN A;  1U5T B;  3F8C A;  3GFL A;  4UVA A;  1ZR2 A;  4RAY A;  3CCS I;  4B1R A;  2ZC2 A;  3H0G J;  1T0F C;  3QP6 A;  2MC4 A;  3VB2 A;  2VAS A;  4RAG A;  2FNP A;  1R4M B;  2VIX A;  1P7J A;  1OFC X;  4XQF A;  1TZL A;  1PYV A;  1FP2 A;  3B02 A;  1TQI A;  4DW6 A;  3TED A;  3MFK A;  4KFC A;  1W36 D;  2ID3 A;  3ABT A;  3F3X A;  1J2X A;  5B1A H;  2V4J C;  4WXD A;  1VQ4 I;  1G3T A;  3HTU A;  2VQH A;  3K2A A;  1X1C A;  4BH9 A;  3F21 A;  5DUK A;  2GXB A;  2MA3 A;  2O03 A;  3QYF A;  1V3F A;  2Z9O A;  2LY2 A;  4UUS B;  2DOF A;  3LAP A;  2DDB A;  2JSC A;  2F4O B;  1S6L A;  3W2V A;  2DT5 A;  4QPQ A;  2WV1 A;  1KQ9 A;  3L1P A;  3FM5 A;  4ZDP A;  2W7N A;  1UZC A;  4G9Y A;  1P9Q C;  3P9K A;  5DEQ A;  3VYT B;  2B9S A;  2DQL A;  4JX4 A;  1LVK A;  1F9N A;  1B9N A;  4UXN A;  4NC8 A;  2VPL A;  5KAI C;  2IS4 A;  2PMZ N;  3RIR A;  2B63 J;  2DCE A;  3KYC B;  2HOS A;  5H6R A;  4BY1 J;  3JRH A;  5BQT A;  2X1C A;  3WE2 A;  5D5V B;  2IS1 A;  2XSD C;  1QZE A;  2F4M B;  5DCM B;  5B5E C;  3IKV A;  1V55 H;  3WGI A;  3H5N A;  3HBL A;  4A0Y A;  1XS9 A;  4MFE A;  1HXD A;  3LA3 A;  5H20 A;  5IPA A;  3J80 Z;  3FF5 A;  2TCT A;  3FM3 A;  2WAQ N;  5FRO A;  3ZQ7 A;  3V7S A;  1D8K A;  4HG2 A;  1EF4 A;  3OIO A;  1BM9 A;  4GCV A;  1QGP A;  3FWE A;  3CD6 I;  1TWA J;  2DMN A;  2J5O A;  4IKF A;  1ETK A;  2L9S A;  5TIS C;  3VFZ A;  2PI0 A;  2ZBK A;  3CJT B;  1YFH A;  4BS9 A;  1YHQ I;  5K7Z A;  4EMS A;  1ZRD A;  1V5G A;  2KRH A;  2M8G X;  4D5C A;  4CCJ A;  2EFW A;  1Z1D A;  2CSO A;  4FT8 A;  1A35 A;  2CW0 F;  1VQ8 I;  1VQP I;  3CP2 A;  3S17 J;  4I6Z A;  1UST A;  3E0J B;  4A6E A;  2K86 A;  1VF9 A;  3CJN A;  2RQP A;  2DXI A;  1MD0 A;  1HBX G;  3PUF A;  4RGS A;  2RN7 A;  4JX6 A;  4NHJ A;  2CFO A;  2JPC A;  5F1J A;  2XAQ A;  1YE9 A;  3G71 I;  4HLY A;  1W0U A;  1T6S A;  3GTO J;  2W48 A;  4A3G J;  1AWC A;  4XR6 A;  3FBI B;  1EA3 A;  3IHU A;  3VEP A;  2HZD A;  3RDI A;  4G6T B;  5EZG A;  2AHQ A;  5EG0 A;  2R7U A;  1PUF A;  4N4O B;  1P92 A;  5B1B H;  2GA1 A;  3BT9 A;  4II3 A;  4Y7N J;  4PJ0 C;  4RDU A;  4BDY A;  1E3P A;  4BY7 J;  4WCG A;  5J4Y A;  1JKR C;  4XIC A;  4O5V A;  1W5C C;  1ZHF A;  3CZ6 A;  3S2D J;  4HBL A;  1RIO H;  3GCM A;  3HTS B;  3WTV C;  4DOZ A;  3JRD A;  3ECO A;  1BR2 A;  1BIB A;  2WV0 A;  1KON A;  3HYI A;  4BJT A;  2ZXI A;  2QUF A;  4CUG A;  3TQN A;  1XGN A;  3EUA A;  2V6C A;  2L5Q A;  5IP9 J;  5D4S A;  2R7X A;  3IV5 A;  4BNC A;  1ODD A;  1Z91 A;  4EJV A;  5LRR A;  1R6R A;  3FHZ A;  1ZYR F;  1UFM A;  3HG9 A;  4ASN A;  3DEE A;  3WTS C;  1P2F A;  3E3V A;  1B6A A;  3BP8 A;  5TGT A;  4CSW A;  1E0E A;  2BOL A;  3CMY A;  2MLK A;  3AG2 H;  5J40 A;  2HDW A;  2E60 A;  2CW7 A;  4DZP A;  4IF4 A;  1JHF A;  2KZG A;  5J4V A;  5L3D A;  3HUG A;  2VC0 A;  5LGN A;  2V26 A;  5M5X J;  2MD0 A;  2VOP A;  3VOE A;  2KRF A;  2YX7 A;  3RYR A;  3S16 J;  1ZKG A;  3P9C A;  4S05 A;  2BY0 A;  1ZG3 A;  2HPI A;  1K61 A;  3E6B A;  1FY7 A;  4CH7 A;  4D5F A;  2G0E A;  2EQR A;  1TWG J;  4RGR A;  4BBR J;  2Z16 A;  3CO7 C;  4M6Y A;  3DPU A;  2GXA A;  1MW7 A;  4KIG A;  1VQ7 I;  1SFX A;  3GZN B;  3SFI A;  1H88 C;  1J9I A;  1R5I D;  3M8F A;  4IVN A;  3HSF A;  4IRH A;  4H0E A;  4HA8 A;  5EDN A;  1Z6R A;  1FNN A;  3RI4 A;  2LD5 A;  1SEU A;  4ESJ A;  3JCU C;  3SFZ A;  1GXP A;  1YW9 A;  2EFQ A;  2JMW A;  4CCN A;  3KP2 A;  4B47 A;  1A6I A;  3GTL J;  2BXY A;  3A1Y A;  2M30 A;  3KP4 A;  4G7H F;  2LYC A;  3I9V 2;  3LSG A;  3H5R A;  4YEJ A;  2FBK A;  5L3F A;  4CCK A;  2W84 A;  2MH9 A;  1ZEL A;  2AQF A;  3PQK A;  4DBR A;  2XKP A;  1JGS A;  2A05 A;  3KLN A;  3DP7 A;  2MH2 A;  4RLQ A;  3OYF A;  2JT1 A;  4LGW A;  3TOA A;  3V7C A;  1ZRC A;  3BTI A;  1ZGW A;  2STT A;  3DTI A;  5ED4 A;  4BL0 B;  5EYR A;  3ZXS A;  5JFR A;  3L7W A;  5K1Y A;  2R7O A;  3WGG A;  1QO0 D;  1I3A A;  1P4A A;  3L09 A;  3BG5 A;  4UV8 A;  3G73 A;  5EEA A;  3JSO A;  3H36 A;  3TO9 A;  2CRG A;  1XB4 A;  4BEH B;  1QQI A;  3VDX A;  4U0Y A;  1SD5 A;  2ZO4 A;  1S7O A;  1XMX A;  2HDD A;  1D8J A;  5FB2 A;  1R58 A;  2EA4 A;  1HOM A;  2QM3 A;  4ZDL A;  1SAU A;  1GV2 A;  1QPM A;  1OR7 A;  3HRS A;  3S3N A;  2HS5 A;  2BW3 A;  2QKL B;  3LSI A;  1BOA A;  4UV9 A;  3M1E A;  3KP3 A;  1R36 A;  2LDU A;  2Y9Y A;  2XHK A;  5DM6 F;  2HKX A;  3A02 A;  4LG3 A;  4MNU A;  3JSP A;  3SZT A;  3VSL A;  4ZH4 F;  2PJR B;  1YI2 I;  1HLV A;  4WWC A;  1MMA A;  3D1N I;  2VC1 A;  3B6A A;  1YRN A;  2O61 A;  2R5Y B;  2V1D A;  1TTY A;  1TLH B;  5GAE J;  2K9N A;  3T5X A;  5LFA A;  1JHH A;  2YUS A;  1WWX A;  3HOX J;  2BHZ A;  1IUY A;  1JI8 A;  3QPS A;  1JUP A;  3RYP A;  4ZJZ A;  3ULQ B;  1ON2 A;  5BMZ A;  2R92 J;  3B73 A;  3GEZ A;  2AS5 F;  5FKM A;  1B1B A;  2VJ5 A;  2WB1 A;  3J81 K;  2L7Z A;  3O2P E;  3WU0 A;  3PFY A;  1FEX A;  1N75 A;  2MD5 A;  1OLT A;  2VL8 A;  2EZH A;  1R5H A;  3IWF A;  2H94 A;  3MN2 A;  2BBY A;  3ZQL A;  2E2I J;  4HX8 A;  3SQN A;  1DU0 A;  4CYC A;  3DKW A;  3CME I;  1IRZ A;  3JRC A;  3A4C A;  4HF0 A;  1ZAO A;  2ESH A;  2Q0O A;  4UNO A;  4L0Y B;  4IRI A;  1JXS A;  3TGN A;  3BG6 A;  2AQE A;  3CCV I;  4IHT A;  2XAG A;  1IF1 A;  1BR1 A;  2L54 A;  1LPQ A;  2HQN A;  1LDJ A;  1O7F A;  3FXL A;  3TBI A;  2Z5U A;  1FSH A;  4E7H A;  1I1G A;  1EV7 A;  1MDM B;  1Y1V J;  4Q5S F;  2XAU A;  2RAE A;  3I56 I;  4BAC A;  5C4X J;  2HI3 A;  2ME6 A;  2NVT J;  3WTU C;  4P1W A;  1V5F A;  1EKE A;  4DYC A;  4M6X A;  2LTP A;  3IKT A;  2TDX A;  3F6V A;  3OYG A;  2BYV E;  3CUO A;  3C3W A;  2HTS A;  2GOM A;  2L4M A;  3FMS A;  3IP4 B;  4I09 A;  1I6X A;  3G1L A;  3I59 A;  3I3L A;  3IAS 2;  3MZ8 A;  4EM2 A;  4PZJ A;  3IL2 A;  2GZW A;  1PUE E;  2DK8 A;  3VOD A;  1FX7 A;  3RKX A;  4EEF G;  1G3W A;  2DW4 A;  1HCR A;  4I02 A;  2W82 A;  4FCY A;  2EV6 A;  4QIW N;  5F1R A;  2CQK A;  2LY1 A;  3I58 A;  2K5C A;  1MIJ A;  2W1O A;  4JK1 X;  4DYR A;  4B3X A;  3D5R C;  5FKO A;  4UB6 C;  4CXF A;  1G3S A;  2Q2E B;  3SZP A;  5HLI A;  4BE1 A;  3D5L A;  4E7K A;  3O3K A;  1A6Q A;  2RV8 A;  3T0Y A;  5L3B A;  3BWG A;  4B09 A;  3I71 A;  2RDP A;  3HSR A;  4B48 A;  2I8D A;  3M1C A;  2DLL A;  4Q47 A;  1MBG A;  4LJZ F;  4F3Q A;  4PUS A;  5HOO A;  2YPR A;  1MBF A;  1U78 A;  2QSH X;  2B0L A;  1ZG1 A;  1JT6 A;  2CW8 A;  2E1N A;  3DLA A;  4EV0 A;  3ERM A;  2FU4 A;  2VT3 A;  2A07 F;  2ESN A;  1J0R A;  3QRF F;  1HQC A;  4M72 A;  3IUO A;  4J19 A;  1ZRE A;  3TO7 A;  5FD5 A;  3I55 I;  4XL9 A;  1AKH B;  4M74 A;  4RGU A;  1SVL A;  1U6G A;  3K7A J;  5J8C A;  1VTN C;  3CCQ I;  2QF7 A;  2JZY A;  4U88 A;  1WH5 A;  5HVQ C;  2EIL H;  3CCE I;  3CCM I;  1OCP A;  5DYM A;  3CF2 A;  4NDL A;  1WVR A;  3NEU A;  4RB2 C;  1Y39 A;  1RR8 C;  1GT0 C;  1P4X A;  3NWT A;  4GO1 A;  3GME A;  1ZN2 A;  3K9T A;  2P8T A;  3CQZ J;  2NVX J;  4EJT A;  4CIC A;  3VYU B;  1V4R A;  3BPX A;  2VE9 A;  2FF4 A;  1VI0 A;  1SD4 A;  5ILV A;  3OYE A;  3KP7 A;  2V79 A;  2QCO A;  2KMU A;  3R6S A;  1XTA A;  4XRM A;  2WAQ A;  3OWT A;  3HJE A;  2DTZ A;  2PMU A;  1I1S A;  5LD2 C;  2O6G E;  2E34 A;  1LEB A;  3Q0W A;  2H27 A;  3OS2 A;  3JTH A;  5CLS A;  3I0T A;  2KIM A;  4P5O A;  4WXH A;  5JVT A;  1VFC A;  2PLY A;  4MIM A;  1UHM A;  2HYF A;  1FSE A;  3SJM A;  1LFP A;  1MMS A;  1W36 C;  4G8X A;  3DLL F;  2KJB A;  2A5W A;  1L0O C;  3KX2 A;  2V1U A;  2K7L A;  3BJ6 A;  5FRM A;  2Y30 A;  5H2F C;  1WKM A;  3M3Y J;  3LFU A;  1PP7 U;  1K78 B;  1T38 A;  4A3C J;  5IYD J;  2DOD A;  3I53 A;  2HEO A;  3H5A A;  2EH3 A;  4XN3 A;  2LLK A;  3HKZ N;  2L02 A;  3BQY A;  1YQA A;  2HOA A;  3BTL A;  2EIK H;  3S1Q J;  5BOX A;  2QQ9 A;  2CFX A;  5JI6 A;  2ZJP F;  2EV0 A;  4PJL A;  4DJA A;  3DFG A;  2VN2 A;  4PSX A;  1R5G A;  1Z3Y A;  2VXD A;  2KIF A;  4BXU A;  4ESB A;  3TOB A;  3OYC A;  3PIO F;  1U8B A;  2Y0S N;  4PSW A;  3H9J A;  3AL0 B;  2OA4 A;  4RB3 C;  2K9S A;  1ZGA A;  3R61 A;  1NHA A;  2XRL A;  5FKK A;  1KU7 A;  2KRC A;  2NAZ A;  2X85 A;  2OJE D;  4XRF A;  1X4O A;  4ZTJ A;  2XB0 X;  2DOE A;  3JRF A;  1XSD A;  1O3R A;  4JOM A;  2H6B A;  3UKG A;  2XGC A;  1BJZ A;  4M3F A;  2YR2 A;  3FDY A;  1OCO H;  1K6Y A;  1VQM I;  5EGO B;  4MEY F;  1BA5 A;  3IH4 A;  2OF7 A;  5F0C A;  2RNG A;  1QA6 A;  3EQL F;  1ENH A;  5E1Z B;  3QWL A;  4YRV A;  1VQK I;  4C2T A;  2XPV A;  3S2H J;  3CC2 I;  1I6H J;  3I54 A;  3BR0 A;  2CJJ A;  2CV1 A;  1BOB A;  3MKL A;  1RR7 A;  3MCZ A;  2KDO A;  3K2Z A;  1OPC A;  3GFI A;  2DJN A;  3BR5 A;  2UXN A;  4G12 A;  4ZC3 A;  3HRT A;  1CF7 A;  1BJA A;  4FET A;  3K70 C;  2D2W A;  3CLO A;  3DEW A;  2HGC A;  3ASN H;  2M0M A;  2H09 A;  2L7F P;  1TW3 A;  2QEX I;  1X4P A;  2E1M C;  1G4D A;  1PVE A;  1ETW A;  4A12 A;  3HOU J;  1YOV B;  3GTK J;  3ESW B;  4RBO A;  1DP3 A;  1B8I B;  2DA3 A;  1HC8 A;  1EH7 A;  2X4H A;  2P0W A;  1SFK A;  4XOT A;  4XON A;  3TKY A;  3DPL C;  4IEJ A;  3JRI A;  4LB6 B;  2E2H J;  3OIP A;  1WSU A;  2M1B A;  3HUG B;  2R5Y A;  1WI3 A;  3ONQ A;  2BEO A;  3LSK A;  2M7B A;  3OYI A;  2C6Y A;  1FOY A;  2KT0 A;  2OC6 A;  3MD2 A;  1I39 A;  2IGK A;  3BPV A;  3AG3 H;  3QP5 A;  4C3H J;  2IS6 A;  3NAR A;  3L2U A;  3EYI A;  1X58 A;  1MBH A;  3S3M A;  5HLH A;  2KJC A;  2DPD A;  2DOA A;  3REO A;  3TL4 X;  1OJL A;  2ELJ A;  3OIQ A;  1POG A;  1TP4 A;  2EA2 A;  2ID6 A;  1H9T A;  4KA4 A;  1ORK A;  3F23 A;  2JA6 J;  1D0Y A;  2XF5 A;  3NQO A;  3MKW B;  4BBS J;  2QVO A;  2O9L A;  5CQG A;  1XSV A;  4IOC F;  4I99 C;  2HWV A;  4BDZ A;  2HVS A;  4PGH A;  1Z7L A;  2EIM H;  5DTD A;  2K02 A;  4BJ6 C;  1FC3 A;  2RNJ A;  3Q9S A;  5J47 A;  5A2Q K;  4A3B J;  3KZZ A;  3HOT A;  3FIW A;  3D0S A;  3ELK A;  1O4X A;  2H6C A;  4I76 A;  2R0Q C;  2V6E A;  2XB5 A;  4B4C A;  3SDB A;  2KIQ A;  4AYB A;  4YG2 F;  3KLO A;  1W0T A;  4BAY A;  4L9V A;  1N77 A;  2M87 A;  3K4K A;  1UJ8 A;  1MMN A;  2JA5 J;  5IYC J;  1HSJ A;  1V5E A;  2L7K A;  1T98 A;  2K9Q A;  1R7J A;  2XRO A;  4X1E A;  1D1C A;  4Q48 A;  3RPU A;  2DA5 A;  4LMY A;  1NH3 A;  3CUQ B;  3OYM A;  4N4N B;  3MZH A;  3RPU D;  4LB5 A;  2DA1 A;  2OV7 A;  1XGM A;  2HVQ A;  4LK0 F;  2Y0M A;  2COB A;  3ZQF A;  3FBN B;  1S29 A;  1RES A;  2I5U A;  4G94 A;  3G4S I;  1H89 C;  2GLO A;  4XOP A;  2GWR A;  4LLG F;  2HXI A;  4HZF A;  2L9V A;  2ZME A;  2VBZ A;  3ABU A;  3QU3 A;  4NB5 A;  1W7P A;  1PP8 F;  2WWY A;  1JTY A;  2HXO A;  1W7P D;  3BR1 A;  5GPC A;  2BGC A;  4O6J A;  1GXQ A;  2KZV A;  4D0P A;  2CV2 A;  2J5P A;  4MQV A;  3S3O A;  1KQ0 A;  4XLH A;  2F5F A;  3FHN A;  1UMQ A;  2QKM B;  2EB7 A;  1GV5 A;  2P7V B;  4P55 A;  2WBM A;  2ZJR F;  4CO8 A;  3MQ0 A;  2X1E A;  3ZPL A;  1WQ2 A;  1P7I A;  2XAH A;  4A3D J;  5HDK A;  4I98 B;  1MMD A;  1VZ0 A;  2ETH A;  5DM7 F;  4V19 K;  1AU7 A;  5M5W J;  1N25 A;  1JKO C;  2P6T A;  4IHY A;  5E1X A;  3E6C C;  2H8W A;  3KEQ A;  2DA7 A;  3PL8 A;  1QNT A;  3RTR A;  4IHW A;  4PGG A;  3VYR B;  5E17 F;  3OSG A;  1LDK B;  5E3N A;  4NQW A;  4Y13 A;  1T39 A;  1DPR A;  4DGW B;  3BTJ A;  2VQG A;  1D5V A;  4HV5 A;  2JUG A;  3CMM A;  2BVL A;  2DK5 A;  1ZTR A;  1JJ6 C;  3FXJ A;  3PQJ A;  4XLP F;  3GYH X;  1IN6 A;  4MEX F;  4B43 A;  3UR3 C;  3K4N A;  1AA7 A;  2ME0 A;  2XSJ C;  5K5O A;  3GW2 A;  4TV7 A;  2FQ3 A;  1BL0 A;  2E1M B;  2IXS A;  4KUM A;  2MAB A;  3QOE A;  5HLT A;  3EYY A;  4GYG A;  3U1K A;  1MJ9 A;  2X1D A;  2OZU A;  4F92 B;  2HYG D;  4NNJ A;  3JTG A;  4DYQ A;  5FRN A;  5LHI A;  3H9Q A;  3IH3 A;  4HOB A;  3PIP F;  5E8I A;  3CMA I;  1D0X A;  2RGV A;  4OIQ F;  1ZAR A;  4YIR X;  2XAF A;  2JWT A;  1WJA A;  3B6C A;  3CUQ C;  3GBG A;  3KPH A;  3I5U A;  2LF7 A;  3TO6 A;  5FLM J;  3I4P A;  1Z77 A;  3NWS A;  1E3O C;  4EJU A;  3CC7 I;  4N9I A;  5D8K B;  2CG4 A;  4P9F A;  4U7B A;  2VLA A;  2DMP A;  1MBJ A;  2R7F A;  1F36 A;  2H1K A;  2HVR A;  3FXR A;  2VOO A;  5F27 A;  3L2C A;  4NQW B;  3ZMZ A;  1X1D A;  3BQZ A;  2R7Z J;  4A3J J;  3SYT A;  1MJB A;  5FD6 A;  5FLX K;  2CGP A;  2K9L A;  1NTC A;  4IXA A;  2PMH A;  5CJ9 A;  3F8N A;  3LL7 A;  1T08 B;  5AIP A;  4C9Y A;  4ZYD A;  5KAF C;  2L3D A;  5ICC A;  3OOP A;  2LF8 A;  1VQN I;  1UEL B;  2G9W A;  1UHW A;  3ROU A;  5ICE A;  4V2F A;  3SEZ A;  4UY8 I;  2R93 J;  2LK2 A;  2W00 A;  3L2V A;  3M9A A;  4I7H A;  1G6N A;  3FXK A;  2L7M P;  4E7S A;  3Q3S A;  3CP8 A;  2X6O A;  4E7J A;  1YIO A;  1WI9 A;  2BHY A;  1JGG A;  3LQQ A;  1HW5 A;  1MNM C;  2DN0 A;  4B8X A;  3GLX A;  2P5K A;  2O5R A;  3QU6 A;  3WTX C;  2R7W A;  4A0X A;  1IRF A;  4M3B A;  2LC2 A;  1XX5 A;  3ZMD A;  4MQ9 F;  5CVJ A;  2VQL A;  5FJ8 J;  3BR6 A;  2DFF A;  2CUF A;  3FXU A;  3RZD J;  1S7A A;  3BJO A;  2Q8K A;  2A6H F;  4IOA F;  3GTQ J;  4YFN F;  4OIP F;  1HKQ A;  2F48 A;  2FXA A;  3HDD A;  5HNH A;  2DO7 A;  2ELH A;  1WCM J;  4D7N A;  2ECC A;  1H0M A;  3V7R A;  1NK3 P;  3LOC A;  4L5J A;  4MLO A;  1REP C;  5JVG F;  4IZZ A;  1R1T A;  4PFO A;  3DBH B;  3MAJ A;  1U9N A;  2Z2S B;  1GDT A;  3WG9 A;  5JHU A;  1QZY A;  4FIS A;  3M8J A;  1S5L C;  3PFI A;  4RM3 A;  1D5Y A;  2M3A A;  4XLF A;  3M7G A;  1IZ1 A;  3QQA A;  2A6T A;  4E7Z A;  2VB6 A;  3BCB A;  2ZJ2 A;  1FYM A;  1ZQ3 P;  2E7X A;  4U0V A;  3HHG A;  2FOW A;  1TW2 A;  1D1A A;  1HW2 A;  1WPK A;  2P81 A;  1KGS A;  3LA2 A;  3HPH A;  4AYB N;  4IQ4 A;  1DPU A;  3FKI J;  3FMR A;  4IPA A;  3QPL A;  4K2E A;  4P96 A;  4CYC B;  5E79 C;  1IG7 A;  1GUU A;  2ZKZ A;  1A31 A;  1D0Z A;  4A6D A;  2QEN A;  3HOZ J;  5IT9 K;  3RZO J;  3J7Y J;  2MBF A;  1X2M A;  2IP2 A;  1B9M A;  3FXM A;  3H1C A;  4L18 B;  1YIJ I;  1IN4 A;  1AOY A;  2DA6 A;  1ITY A;  3MKY B;  4KIC A;  2WAF A;  3O6B B;  2EWN A;  3LA7 A;  2PEX A;  2KQR A;  3T8T A;  4KYW A;  4ESF A;  2DT7 B;  4OWR B;  5E3O A;  2Y9Z A;  2Y75 A;  2PJR A;  3P9I A;  1LEA A;  4ZZL A;  4U87 A;  2DFI A;  4LIT A;  2D1H A;  1AHD P;  3W2W A;  2CWE A;  4KDP A;  1Q1H A;  3AG1 H;  3EDP A;  1R1U A;  1IW7 F;  3E6M A;  1ZK8 A;  2FBI A;  2KLO A;  4AM3 A;  4HW0 A;  5ILS A;  1U2W A;  1Y0U A;  2P5V A;  1W5T A;  1BW5 A;  1Y0N A;  4QLC U;  2VJI A;  1I50 J;  2DBB A;  4A3K J;  2QBY A;  2E1C A;  3G2B A;  1IUF A;  3W6J B;  1QRY A;  2OCE A;  2ZJQ F;  4XBF A;  2XF6 A;  3H3U A;  3SZG A;  2A6E F;  4NC7 A;  5IT3 A;  5BPD A;  2IEK A;  2BE5 F;  3FZV A;  2V7F A;  3KEO A;  4W1U A;  4BEH A;  1B72 B;  2ZXW H;  1T95 A;  4HV6 A;  2XGD A;  3G3Z A;  4AIH A;  1LJ9 A;  2IA0 A;  2ZFU A;  2IJL A;  2DPU A;  4C2U A;  1UG2 A;  4M9S A;  1JKP C;  1K83 J;  4IQJ A;  5J1U A;  2QGU A;  1XMK A;  2HQ5 A;  2F4I A;  3CC4 I;  4G6D A;  1S72 I;  3OYB A;  3K4B A;  4A3L J;  1U0J A;  2XGX A;  2WAD A;  3NRV A;  3TDZ C;  4IHS A;  2WB1 N;  3A01 A;  2DMQ A;  1HDP A;  5EEH A;  4BHP A;  4HDV A;  4KIB A;  2JRM A;  2OQR A;  2OUM A;  2O7O A;  2QSG X;  4LG0 B;  4GYI A;  5LBQ A;  1D1B A;  2FJ1 A;  4XRS G;  1BC7 C;  3MKZ A;  1W1W E;  1WRJ A;  2XDV A;  2ZME B;  3MMY B;  4F7Z A;  5JR3 A;  1XD7 A;  2NXN B;  2MLG A;  1J5Y A;  1ETQ A;  5LGU A;  4F91 B;  3F6O A;  1HST A;  3M8E A;  3MVP A;  4BQA A;  2KIU A;  4FX0 A;  5CYV A;  3LFK A;  4DNC A;  1K4T A;  2PX9 A;  2X0L A;  3DCF A;  5K5R A;  4AID A;  2VKE A;  3IRQ A;  5IY5 H;  4HST A;  3HZJ A;  3NAU A;  3SHF A;  1K78 A;  5JLW A;  4I0B A;  2MG4 A;  1I5Z A;  2JQ7 A;  3H92 A;  5LLQ A;  1X2N A;  2ZCW A;  2IW5 A;  1PDN C;  4XKV A;  2VJJ A;  2EFO A;  4BQO A;  1ULY A;  4Y3O A;  1OYI A;  2YU9 J;  4BQN A;  2HR3 A;  4E6K G;  2QBY B;  2X6X A;  3V8J A;  2LBF A;  4MFD A;  4XN0 A;  4XLA A;  3CCU I;  3FXQ A;  2FE3 A;  3L00 A;  1R4N B;  2F5V A;  1KYZ A;  3F8B A;  1IN7 A;  3QOP A;  1OCT C;  2DMT A;  3KET A;  2RRE A;  3Q5F A;  2I10 A;  3I64 A;  2V9K A;  3ZQC A;  2HTJ A;  1ON1 A;  2DFH A;  5K7H A;  4LLL A;  1I3Q J;  2QYO A;  3DWL E;  2FA5 A;  2L4A A;  2VUM J;  2GXG A;  3HOY J;  1OIS A;  1FYK A;  2GBY A;  2JRT A;  5L3E A;  2LVS A;  2FMY A;  2GM4 A;  1BBY A;  4PCQ A;  1TQP A;  2JTV A;  2FX0 A;  3R0J A;  2HYJ A;  3RQ4 A;  4BQQ A;  1S3J A;  1WHU A;  2K4J A;  5EG0 B;  4KIT B;  3GZ6 A;  3ZMS A;  2K40 A;  3DXJ F;  1B59 A;  2Y48 A;  1AKH A;  1HKT A;  2ZSH B;  3IC7 A;  4FE7 A;  1FMW A;  2P6S A;  4L0Z B;  2K27 A;  3HL2 A;  3A03 A;  2LBF B;  3GLL A;  2HDC A;  1LKX A;  2RC4 A;  4EM1 A;  1CF7 B;  4FQG A;  4OMZ A;  1MMG A;  2E7W A;  2OQG A;  1B8I A;  5J6X A;  4O3M A;  2P4W A;  1WJC A;  3HIF A;  3ISP A;  5B3S H;  1K7A A;  2EZL A;  5CVV A;  4BU2 A;  2WY7 Q;  3TP0 A;  2JA7 J;  2D5V A;  1JE8 A;  4I0A A;  4HLX A;  4BXX J;  4P9U A;  3BRO A;  4XK4 A;  2VJ4 A;  3K1N A;  3Q9V A;  4HPQ A;  1SAN A;  5H6Q A;  3OS1 A;  3R0A A;  4CCM A;  5GAD J;  4AD9 A;  1FIP A;  3WU2 C;  2EPF A;  1LQ1 A;  3R60 A;  2IRF G;  2OBP A;  4IL6 C;  2CH0 A;  2EFN A;  2E2J J;  3ABM H;  4R1H A;  2IBD A;  2YS9 A;  4I01 A;  1UG0 A;  1ZGJ A;  2BV6 A;  1DQU A;  5K5Q A;  1CQT A;  2LP0 A;  4ETS A;  1P6R A;  1QHG A;  1A5J A;  3K0L A;  1B4A A;  1KU3 A;  2EBI A;  4BE0 A;  4EGY A;  2WA0 A;  2R7R A;  4AIK A;  3WTW C;  4ENN A;  4F93 B;  1O3S A;  1HKS A;  4YEL A;  5FKN A;  3LWF A;  3WOD F;  3LNQ A;  4X6A J;  1MNE A;  2NNN A;  4X0G A;  1Z7U A;  3CES A;  1MDM A;  1IRX A;  1XDS A;  2BVM A;  4C30 A;  1DDN A;  5D6F A;  1FBQ A;  2F5E A;  2E5Z A;  2F5C A;  4BE2 A;  3GFM A;  3K4L A;  3QYB A;  4UHT A;  1O3Q A;  3FIS A;  4S0H B;  3QOD A;  1FP1 D;  2L9R A;  1WJE A;  5D4R A;  4ANJ A;  3BCA A;  4KT5 C;  4HQE A;  3A2K A;  3CJQ B;  4FE4 A;  4MHG A;  5HLG A;  2D1V A;  2FEZ A;  2Q1Z B;  3BZK A;  2OZ6 A;  2WTE A;  2XV4 S;  3DKY A;  3S32 A;  1Y6I A;  4ZZD A;  1Y8R B;  4YIF A;  1KA8 A;  3CF5 F;  4GFB A;  1J7K A;  3S93 A;  4AUX A;  5KVR A;  1IGN A;  3OOU A;  1DGW Y;  3BLY A;  5F04 A;  1T2K A;  1XDU A;  2WC2 A;  2JK3 A;  4N0B A;  3C2G A;  5EZH A;  1ACI A;  1SFE A;  2COM A;  1IN5 A;  2DYS H;  4EJO A;  1WZ2 A;  4OIN F;  1W5S A;  4BJ5 C;  4Q4Z F;  1IXR C;  4RS8 A;  2QQA A;  3BZ6 A;  3GWZ A;  4RLF A;  2IT0 A;  3V8L A;  1SAX A;  4LIU A;  1YX5 A;  2NOJ B;  1R22 A;  5FFZ A;  3TDU C;  2E71 A;  4WXC A;  2HOE A;  2Y31 A;  3ZN0 A;  5CPR B;  1ERD A;  1FBS A;  1TWF J;  1G8X A;  2JA8 J;  4HYE A;  3CLQ A;  2LNB A;  2R7T A;  3LST A;  2LRD A;  5M5Y J;  4Z2Y A;  4M3D A;  3BR2 A;  1U9O A;  3OL3 A;  2FSW A;  4XMY A;  4A69 C;  4G7Z F;  1R23 A;  1YJ9 I;  5EJC A;  1FMV A;  5IOZ A;  4CGZ A;  3SEQ A;  2IS2 A;  3T1B A;  4E70 A;  2DT6 A;  3LQR A;  1YLF A;  2CQN A;  3W6V A;  1ONV A;  2BW3 B;  4OAZ A;  3T8R A;  2JPB A;  2VKD A;  3BG9 A;  3WG7 H;  3OYH A;  1H8A C;  2FQ4 A;  3EUK L;  1G2H A;  1DUX C;  2HFH A;  1BW6 A;  1NK2 P;  4OMY A;  4Z6Y A;  3HRM A;  2HU9 A;  1TNS A;  3HGY A;  2MFZ A;  2NYX A;  1EH6 A;  2CU7 A;  2Q2E A;  1R71 A;  2BY2 A;  1S9H A;  2EJR A;  3CCJ I;  3U9G A;  2CV0 A;  1M1E B;  2VBW A;  4D9J A;  2KIS A;  4II2 A;  2X9D A;  4FHT A;  2K85 A;  1HA8 A;  3WE3 A;  1QZZ A;  4ITV A;  4MGR A;  5F0F A;  2CUJ A;  1SMT A;  3OR1 C;  3KEY A;  3ZCO A;  4A93 J;  1WH7 A;  2UXX A;  3FMQ A;  3GO5 A;  2DI3 A;  3HB9 A;  2XUB A;  1V54 H;  5EEG A;  2M5W A;  1Y8Q B;  4A0Z A;  4HRI A;  1RKT A;  2PQ8 A;  4RAZ A;  2H1L A;  2OD5 A;  1J75 A;  1LFB A;  1RUO A;  2BY3 A;  1H9G A;  5E20 A;  1MH3 A;  2QSF X;  3V42 A;  5C44 J;  2VXZ A;  4PK4 A;  1BI2 A;  4WF2 A;  2IPQ X;  5ERI A;  1YW7 A;  1R49 A;  3SDG A;  3PNY A;  3EET A;  4BGD A;  2CO5 A;  4L5I A;  5A2Q Z;  1YJW I;  3K70 D;  4DIQ A;  5D8L B;  3MEX A;  4E7I A;  3ZMV A;  1APL C;  4EAT A;  1YIT I;  1RUN A;  3BZC A;  1K6O A;  1MH4 A;  3PNT A;  3VPR A;  1XMA A;  2F2E A;  1A04 A;  3K10 A;  4KJZ A;  9ANT A;  3ABK H;  4NC6 A;  4XSZ F;  3G1M A;  1KYW A;  3G6E I;  4N9H A;  3L9F A;  3OMY A;  1F4K A;  4AVP A;  2JVH A;  1Y56 A;  3K69 A;  3HOW J;  2DTR A;  3LSP A;  2IGM A;  3GX4 X;  3ASO H;  3EPZ A;  3V8K A;  3OYL A;  1EJ9 A;  1UHS A;  2KFD A;  2GA2 A;  4M9Z A;  3GUD A;  4LFU A;  3LMM A;  3WHC A;  2XF7 A;  3BY6 A;  4RMN A;  2IGN A;  4QTR A;  1VQ9 I;  2CUZ A;  1BI3 A;  1STZ A;  2BY1 A;  2HNH A;  1QPI A;  2GIZ A;  1USS A;  1IC8 A;  2HPM A;  4L9T A;  2ICW G;  1GLN A;  2EV5 A;  1L3L A;  1TWC J;  2WAE A;  2M9H A;  1BC8 C;  4PJM A;  3JW4 A;  3S14 J;  1WGX A;  2KDZ A;  5DCF A;  5DD4 A;  3ZQQ A;  3J81 Z;  4F52 A;  1A36 A;  3R4K A;  5IP6 A;  1XGS A;  2YX4 A;  2EFP A;  1LDD A;  1IRG A;  2GOX B;  2P7C B;  3BG7 A;  4BUP A;  3FXO A;  3VYS B;  1EH8 A;  5JHF A;  3AFH A;  5EF6 A;  4ZDO A;  4RM2 A;  5HOD A;  1KQ8 A;  1U5T C;  2HQR A;  4A5M A;  3CCL I;  4KIF A;  3GTM J;  1JJ8 C;  4XM3 A;  3ZQG A;  1LB2 A;  4LIV A;  4S04 A;  5BNG A;  3E5Q A;  1RNL A;  2DJI A;  2OTJ I;  3H3Z A;  1FPQ A;  1K4S A;  4AC0 A;  4LK1 F;  2OPT A;  4C3J J;  1Z3X A;  3K1P A;  2FD5 A;  5F08 A;  4E4H A;  4V2G A;  1SC7 A;  3P7N A;  3HC7 A;  2UV1 A;  1BI1 A;  2PFB A;  4UUV A;  2P5L C;  3F8M A;  3SXY A;  4RAF A;  6PAX A;  4JBA A;  1N78 A;  1XC5 A;  2W24 A;  2WY8 Q;  5IYB J;  1IAW A;  5AIQ A;  1WJ5 A;  5KNL A;  4HNU A;  5F0H A;  1FYL A;  4UUT A;  4XKB A;  5DD8 A;  2FML A;  2MC3 A;  1QHH D;  3C1D A;  1LE8 B;  2M7A A;  2Y0S A;  5L3C A;  2FOK A;  1FTT A;  1X3U A;  1XGO A;  1ZR4 A;  4OIO F;  1IO2 A;  2VI6 A;  2IGO A;  3KFW X;  3TP3 A;  1VND A;  1OCC H;  4KN4 X;  4W97 A;  3HSE A;  4JP0 A;  1XN7 A;  2XIG A;  3BC8 A;  1YS6 A;  2DFE A;  1JTX A;  3W3C A;  2NS8 A;  2M45 A;  1KU2 A;  1UCR A;  3C2H A;  4OOI A;  1E3H A;  3ZN1 A;  3RSN A;  1VQ6 I;  1IXS B;  2A68 F;  3E97 A;  4BHB A;  3CUQ A;  3KP5 A;  5J1R A;  4BKX A;  5BPI A;  3A01 B;  2K9M A;  5FKL A;  1OYY A;  1XSX A;  2DQR A;  2LRE A;  1Z67 A;  3GVA A;  2W4S A;  1WFX A;  4H4K C;  2K3P A;  3J7Z I;  3H3V K;  1OR7 C;  3RQI A;  4A3E J;  3OS0 A;  3M07 A;  2TRT A;  4M73 A;  1BI0 A;  1FT9 A;  1IV6 A;  2L9N A;  4HF2 A;  2Z3Y A;  1Q1V A;  2QZ8 A;  4D7M A;  3O8H A;  1T0F A;  4CCO A;  3KZY A;  2L2O A;  3E7L A;  3S15 J;  4YII A;  2XRN A;  3ZGK A;  1WJB A;  5HS8 A;  5IOY A;  1JUS A;  1LNW A;  5GP9 A;  1Z0X A;  2UWM A;  3DTK A;  2F5D A;  3OYK A;  1S7E A;  3PM1 A;  1YS7 A;  2R4G A;  2VPR A;  3M4O J;  2O3F A;  3W6K B;  1NG6 A;  2V1X A;  5HNF A;  5BS6 A;  3FK7 A;  4G6Q A;  1FIA A;  1FLI A;  1VQL I;  3RPQ A;  3OYA A;  2UZK A;  2YSR A;  4XID A;  3OYN A;  1SVO A;  3AKZ A;  4RB1 A;  2VKV A;  5ICG A;  2VBY A;  1SFO J;  3PNV A;  3E5X A;  1O3T A;  1TNT A;  3P5J A;  2M2E A;  2VKH A;  4NBQ A;  2E19 A;  4OAY A;  3MZY A;  2XGE A;  3A0H C;  1ZG5 A;  3H35 A;  1Z21 A;  4OU0 A;  5E1W A;  5GAH J;  4KIS A;  3DBR B;  2GIV A;  3C2B A;  1PJR A;  1XCV A;  2DYR H;  2MW8 A;  4QWQ A;  3KIO A;  3JR9 A;  4A3M J;  3UNG C;  3AAF A;  2A69 F;  2CQX A;  4CYD A;  1Y1W J;  1YW8 A;  2L01 A;  4JQF A;  4CZC A;  1O7L A;  1FBU A;  1YYV A;  2M0C A;  5LHH A;  2LMD A;  2HKO A;  3OV8 A;  5FLV A;  1Z05 A;  1IXC A;  1YJN I;  4RB0 A;  5IT9 Z;  1X1P A;  3JAM K;  4HEA 2;  2FBH A;  5E8G A;  2LR8 A;  2RKH A;  4UVC A;  2D45 A;  4HQM A;  4ON0 A;  3F72 A;  2OAZ A;  5CVU A;  5JLX A;  2QA4 I;  2BXZ A;  2NVQ J;  1X3Z B;  3HOS A;  1I27 A;  4XRS A;  3BDD A;  3S1M J;  5FO5 A;  5M3F J;  5J3L A;  3JRE A;  3KE2 A;  3HM5 A;  3AG4 H;  3TMO A;  4ENJ A;  3CO6 C;  3PUB A;  4WX9 A;  2KKO A;  2BZT A;  1E17 A;  2V9P A;  1IJW C;  3JRG A;  3ZMU A;  4M6V A;  3DBL B;  2VBX A;  1OCR H;  3QPT A;  3I59 B;  4LD5 A;  5F6F A;  1R9T J;  4KMF A;  2R5Z B;  3FK6 A;  3Q0U A;  3N05 A;  2LKS A;  5DCM A;  5GAG J;  5D5X B;  2R5Z A;  4JX5 A;  4PJJ A;  2ZME C;  3HXL A;  3WHB A;  1HDD C;  4MO7 A;  4XOR A;  5FGM A;  2FRH A;  4ZTF A;  1OQY A;  4XNF A;  2CUE A;  2LKP A;  2OU2 A;  4OIR F;  5GTH C;  1FJL A;  4I2O A;  4C3I J;  3C7J A;  5DUI A;  4HNV A;  1R00 A;  3ZP5 A;  3V4G A;  2EZK A;  1IN8 A;  1MKM A;  3DU5 A;  2DU9 A;  4M9X A;  1Z6T A;  2JVG A;  3HHH A;  4PJN A;  5AON A;  2N8G A;  3JAM Z;  5KHD A;  1JKQ C;  2CYY A;  3F8F A;  2LY9 A;  2ECB A;  2EK5 A;  2Z99 A;  3WU1 B;  3HGG A;  4GXO A;  4XKC A;  2STW A;  3RKW A;  5DV5 A;  4HX4 A;  2DA2 A;  2X48 A;  1KU9 A;  1SFU A;  2PJP A;  1J59 A;  2FNA A;  3OR2 C;  3U2R A;  4B3A A;  3E5U A;  5DDG A;  3BG3 A;  3ZQI A;  1RPW A;  3PO2 J;  1UAA A;  4DBQ A;  3D5S C;  4IRG A;  2W85 A;  5F64 A;  4ZYA A;  4QPO A;  4NUB A;  1JT0 A;  2LG4 A;  2LOO A;  1G3Y A;  2IAI A;  2NRA C;  2XAS A;  2ZNZ A;  1FOX A;  2F6C A;  1FTZ A;  1IDY A;  5CVR A;  5ICF A;  1RKW A;  4KN7 X;  1W4M A;  2LFB A;  2JJ7 A;  4G7O F;  3A0B C;  3Q0V A;  5FLX Z;  1RET A;  3HRU A;  1UB9 A;  2K4B A;  4M71 A;  1MSF C;  2VE8 A;  4UVB A;  1TQM A;  3W2A A;  3IAM 2;  2ELK A;  4HF1 A;  2FUG 2;  4PFP A;  2R7V A;  2X6W A;  4L5E A;  3DF8 A;  4Y17 A;  1NG7 A;  5KK1 A;  2HQA A;  3AL0 C;  4D1Q A;  4AIJ A;  3K1M A;  2ZXJ A;  4YFX F;  3K4M A;  2Y2Z A;  3GF2 A;  3CCR I;  1O57 A;  4DZJ A;  3RKQ A;  3U21 A;  3ZMT A;  1YRN B;  2ZNY A;  1D3Y A;  2V1N A;  3C18 A;  2EZI A;  4U7D A;  4CHU A;  3DV8 A;  3G1O A;  4IO9 F;  4FTH A;  4A5N A;  3GTG J;  2AO9 A;  2W25 A;  3ZQH A;  1LUJ B;  2E1O A;  4J00 A;  1LVA A;  3JRA A;  2GQQ A;  3FKJ A;  3K4J A;  1TT0 A;  2MSY A;  2JSP A;  5CVI A;  5K7F A;  1YX3 A;  3ECH A;  5TJJ A;  4E7L A;  2E35 A;  1SD7 A;  1S8N A;  2X6Y A;  3TW7 A;  2QLZ A;  2NOG A;  4LOC A;  2EIJ H;  4M3E A;  5J8F A;  1ZRF A;  3RCO A;  2RVC A;  4XLE A;  3HKZ A;  4Y15 A;  3X2Q H;  3L2R A;  2LH9 A;  2IA2 A;  1YO5 C;  2ADU A;  3S2W A;  1XPX A;  4PDK A;  1ETV A;  1XCB A;  3VWB A;  1VQO I;  4ZYE A;  4BHC A;  2CS3 A;  3CDH A;  1OYW A;  2A5Y B;  1DGR M;  4QSH A;  5B66 C;  2RQQ A; 
#chains in the Genus database with same CATH homology
 4CDG A;  1W7P B;  4AWX B;  4L9J A;  2QWW A;  2XKO A;  2DAO A;  5LEJ A;  5LRS A;  3BOQ A;  5LHG A;  4EVI A;  4DQ2 A;  1GVJ A;  1BN5 A;  4ENM A;  1FZP B;  4LG0 A;  3IRR A;  4ZYG A;  1C0W A;  1ZH5 A;  2O0Y A;  3N97 A;  3WTZ A;  2ZFW A;  3DEU A;  2IA1 A;  1BIA A;  2VON A;  2LSO A;  3J7A O;  1CGP A;  2AXL A;  2ISY A;  1DP7 P;  1SMY F;  1OKR A;  1MJA A;  3WTY C;  5HS7 A;  1YTY A;  1ZLJ A;  3EUH A;  2IVM A;  4ZYH A;  3E6D A;  1OMI A;  2XAJ A;  2VOD A;  1MGT A;  2VT2 A;  2R3S A;  4ENK A;  3CTA A;  3LAJ A;  5TRD A;  1R1V A;  4GGG A;  1SD6 A;  4FX4 A;  4EQQ A;  3WGH A;  2GAU A;  3F22 A;  3DQV C;  5HS9 A;  2M8E A;  3KP6 A;  3FX3 A;  4YFK F;  2NNY A;  2PBI A;  3IWZ A;  4XSX F;  5D6E A;  3DPT A;  1YG2 A;  1K79 A;  4HX7 A;  3BJA A;  4BYY A;  2PG4 A;  1ZLK A;  2ACJ A;  5E18 F;  4L9N A;  1HW1 A;  3ERE D;  4KMU X;  5LEK A;  3QPH A;  2G7U A;  5HDG A;  3J80 K;  5L3G A;  3COA C;  3GZ5 A;  5D5W B;  1Z9C A;  3GXO A;  3GFJ A;  5FFX A;  2PN6 A;  1RI7 A;  2NS0 A;  3RKY A;  5HDN A;  5LGT A;  2A3S A;  4EJW A;  1U3E M;  2G7H A;  2YU3 A;  3N4M A;  1F1Z A;  1P4W A;  4WK8 F;  4HDU A;  4R79 A;  1FOK A;  1MZB A;  1E2X A;  1TBX A;  4MTE A;  3RJP A;  2V9V A;  1QBJ A;  1FWZ A;  2ISZ A;  3KCC A;  5ILU A;  1F5T A;  2XVC A;  2O8X A;  3MWM A;  1GHC A;  2R7D A;  4KNY A;  4EM0 B;  3QAH A;  2QQB A;  2Z33 A;  2HZT A;  1U8R A;  4CZZ A;  4MTD A;  4R8H A;  2A61 A;  1U5T A;  3WTT C;  3U1D A;  2W57 A;  3ML6 A;  1RZ4 A;  4IJA A;  4EGZ A;  4RGX A;  5D5U B;  4U0W A;  4XLN F;  4HAM A;  4A2U A;  4LLN A;  1U5T B;  3F8C A;  3GFL A;  4UVA A;  4RAY A;  3QP6 A;  3VB2 A;  2FNP A;  1FP2 A;  3B02 A;  1TQI A;  3MFK A;  4KFC A;  3ABT A;  3F3X A;  1J2X A;  4WXD A;  1G3T A;  3HTU A;  4BH9 A;  3F21 A;  5DUK A;  2GXB A;  2MA3 A;  2O03 A;  1V3F A;  2Z9O A;  3LAP A;  2JSC A;  1S6L A;  2DT5 A;  1KQ9 A;  3FM5 A;  4G9Y A;  5DEQ A;  3P9K A;  2DQL A;  1B9N A;  1F9N A;  4UXN A;  3RIR A;  5H6R A;  5BQT A;  3WE2 A;  5D5V B;  5DCM B;  3IKV A;  3WGI A;  4A0Y A;  1HXD A;  3LA3 A;  5H20 A;  3J80 Z;  3FF5 A;  3FM3 A;  3ZQ7 A;  3V7S A;  1D8K A;  1BM9 A;  4GCV A;  1QGP A;  3FWE A;  2J5O A;  3VFZ A;  2PI0 A;  2ZBK A;  1YFH A;  4EMS A;  1ZRD A;  2EFW A;  1Z1D A;  2CSO A;  4FT8 A;  2CW0 F;  1UST A;  4A6E A;  2K86 A;  3CJN A;  2RQP A;  1MD0 A;  1HBX G;  4RGS A;  2RN7 A;  4NHJ A;  2JPC A;  2XAQ A;  4HLY A;  1T6S A;  1AWC A;  3IHU A;  3VEP A;  3RDI A;  1P92 A;  2GA1 A;  4WCG A;  4O5V A;  1ZHF A;  4HBL A;  1RIO H;  3HTS B;  3WTV C;  3ECO A;  1BIB A;  2WV0 A;  3HYI A;  2QUF A;  3TQN A;  1XGN A;  2V6C A;  5D4S A;  4BNC A;  1ODD A;  1Z91 A;  4EJV A;  5LRR A;  3FHZ A;  1ZYR F;  1UFM A;  4ASN A;  3WTS C;  1P2F A;  3E3V A;  1B6A A;  3BP8 A;  2MLK A;  4IF4 A;  1JHF A;  5L3D A;  3HUG A;  2VC0 A;  5LGN A;  2VOP A;  3VOE A;  2KRF A;  2YX7 A;  3RYR A;  4S05 A;  3P9C A;  1ZG3 A;  3E6B A;  1FY7 A;  4RGR A;  3CO7 C;  4M6Y A;  4KIG A;  1SFX A;  1J9I A;  3M8F A;  4IVN A;  3HSF A;  4IRH A;  4H0E A;  4HA8 A;  1Z6R A;  1FNN A;  3RI4 A;  4ESJ A;  3SFZ A;  1GXP A;  1YW9 A;  2EFQ A;  3KP2 A;  3KP4 A;  2M30 A;  4G7H F;  5L3F A;  2FBK A;  2W84 A;  2MH9 A;  3PQK A;  2XKP A;  1JGS A;  3KLN A;  3DP7 A;  2MH2 A;  2JT1 A;  4LGW A;  3TOA A;  3V7C A;  1ZRC A;  2STT A;  5ED4 A;  5JFR A;  3L7W A;  5K1Y A;  3WGG A;  1QO0 D;  1P4A A;  3L09 A;  4UV8 A;  3G73 A;  3JSO A;  3TO9 A;  1XB4 A;  1QQI A;  4U0Y A;  1SD5 A;  2ZO4 A;  1S7O A;  1D8J A;  5FB2 A;  1R58 A;  2EA4 A;  2QM3 A;  1QPM A;  1OR7 A;  3HRS A;  2HS5 A;  1BOA A;  4UV9 A;  3M1E A;  3KP3 A;  1R36 A;  2LDU A;  2XHK A;  2HKX A;  4MNU A;  3JSP A;  3SZT A;  4ZH4 F;  4WWC A;  2VC1 A;  2O61 A;  2V1D A;  1TTY A;  1TLH B;  3T5X A;  1JHH A;  1WWX A;  1IUY A;  3RYP A;  3ULQ B;  1ON2 A;  5BMZ A;  3B73 A;  3GEZ A;  2AS5 F;  1B1B A;  3J81 K;  3O2P E;  3WU0 A;  2MD5 A;  1R5H A;  3IWF A;  2H94 A;  2BBY A;  4HX8 A;  3SQN A;  3DKW A;  4HF0 A;  1ZAO A;  2ESH A;  2Q0O A;  4UNO A;  4L0Y B;  4IRI A;  1JXS A;  3TGN A;  4IHT A;  2XAG A;  1IF1 A;  2L54 A;  2HQN A;  1LDJ A;  1O7F A;  2Z5U A;  1FSH A;  1I1G A;  1EV7 A;  1MDM B;  4Q5S F;  3WTU C;  4M6X A;  3IKT A;  2TDX A;  3F6V A;  2BYV E;  3CUO A;  3C3W A;  2HTS A;  2L4M A;  3FMS A;  4I09 A;  1I6X A;  3I59 A;  4EM2 A;  4PZJ A;  3IL2 A;  2GZW A;  1PUE E;  2DK8 A;  3VOD A;  1FX7 A;  3RKX A;  1G3W A;  2DW4 A;  4I02 A;  2EV6 A;  5F1R A;  2CQK A;  3I58 A;  4JK1 X;  4CXF A;  1G3S A;  3SZP A;  5HLI A;  3D5L A;  3O3K A;  2RV8 A;  3T0Y A;  5L3B A;  3BWG A;  4B09 A;  3I71 A;  2RDP A;  3HSR A;  4Q47 A;  2DLL A;  4LJZ F;  1U78 A;  5HOO A;  2YPR A;  2B0L A;  1ZG1 A;  2E1N A;  4EV0 A;  2A07 F;  2FU4 A;  2VT3 A;  2ESN A;  1J0R A;  3QRF F;  1HQC A;  4M72 A;  1ZRE A;  3TO7 A;  5FD5 A;  4M74 A;  4RGU A;  1U6G A;  1VTN C;  5J8C A;  2JZY A;  4U88 A;  5HVQ C;  5DYM A;  4RB2 C;  3NEU A;  1P4X A;  4GO1 A;  1ZN2 A;  3K9T A;  2P8T A;  4EJT A;  4CIC A;  1V4R A;  3BPX A;  2VE9 A;  2FF4 A;  1SD4 A;  5ILV A;  3KP7 A;  2V79 A;  3R6S A;  2PMU A;  1I1S A;  2O6G E;  1LEB A;  2H27 A;  3JTH A;  5CLS A;  3I0T A;  2KIM A;  4P5O A;  4WXH A;  5JVT A;  2PLY A;  1UHM A;  2HYF A;  1FSE A;  4G8X A;  2KJB A;  1L0O C;  2V1U A;  2K7L A;  3BJ6 A;  1WKM A;  1PP7 U;  1K78 B;  1T38 A;  3I53 A;  2HEO A;  2L02 A;  1YQA A;  5BOX A;  2QQ9 A;  2CFX A;  5JI6 A;  2EV0 A;  3DFG A;  2VN2 A;  1R5G A;  2KIF A;  4BXU A;  4ESB A;  3TOB A;  2OA4 A;  4RB3 C;  1ZGA A;  3R61 A;  1NHA A;  1KU7 A;  2NAZ A;  4XRF A;  1O3R A;  1XSD A;  2H6B A;  2YR2 A;  4MEY F;  3EQL F;  5E1Z B;  3I54 A;  3MCZ A;  3K2Z A;  1OPC A;  3GFI A;  2UXN A;  1CF7 A;  3HRT A;  1BJA A;  2D2W A;  3CLO A;  2HGC A;  2H09 A;  1TW3 A;  1G4D A;  4A12 A;  1EH7 A;  2X4H A;  3TKY A;  3DPL C;  4LB6 B;  1WSU A;  2M1B A;  2BEO A;  2C6Y A;  3BPV A;  3QP5 A;  3EYI A;  5HLH A;  2KJC A;  2DPD A;  3REO A;  2EA2 A;  1H9T A;  4KA4 A;  3F23 A;  3NQO A;  2QVO A;  1XSV A;  2HWV A;  4PGH A;  2K02 A;  1FC3 A;  2RNJ A;  3Q9S A;  5A2Q K;  3KZZ A;  3HOT A;  3D0S A;  3ELK A;  2H6C A;  4YG2 F;  3KLO A;  4BAY A;  4L9V A;  2M87 A;  1HSJ A;  1T98 A;  1R7J A;  2XRO A;  4Q48 A;  3RPU A;  4LMY A;  3CUQ B;  3MZH A;  4LB5 A;  1XGM A;  4LK0 F;  2Y0M A;  1S29 A;  4G94 A;  2GWR A;  4LLG F;  4HZF A;  2ZME A;  3ABU A;  2VBZ A;  3QU3 A;  4NB5 A;  1W7P A;  1PP8 F;  2WWY A;  1W7P D;  2BGC A;  4O6J A;  1GXQ A;  4D0P A;  2J5P A;  4MQV A;  1KQ0 A;  2F5F A;  2EB7 A;  2P7V B;  4P55 A;  4CO8 A;  3MQ0 A;  3ZPL A;  1WQ2 A;  2XAH A;  5HDK A;  4I98 B;  2ETH A;  2P6T A;  5E1X A;  3E6C C;  3KEQ A;  1QNT A;  3RTR A;  4PGG A;  5E17 F;  1LDK B;  4NQW A;  4Y13 A;  1T39 A;  1DPR A;  1D5V A;  4HV5 A;  2DK5 A;  3PQJ A;  4XLP F;  3GYH X;  1IN6 A;  4MEX F;  5K5O A;  3GW2 A;  4TV7 A;  2FQ3 A;  4KUM A;  3EYY A;  4GYG A;  1MJ9 A;  2OZU A;  2HYG D;  3JTG A;  5LHI A;  4HOB A;  5E8I A;  2RGV A;  4OIQ F;  1ZAR A;  2XAF A;  3CUQ C;  3I5U A;  2LF7 A;  3TO6 A;  3I4P A;  4EJU A;  4N9I A;  5D8K B;  2CG4 A;  4P9F A;  4U7B A;  2R7F A;  3FXR A;  2VOO A;  3L2C A;  3ZMZ A;  5FLX K;  1MJB A;  5FD6 A;  2CGP A;  4IXA A;  2PMH A;  5CJ9 A;  3F8N A;  5AIP A;  4ZYD A;  2L3D A;  5ICC A;  3OOP A;  2LF8 A;  2G9W A;  1UHW A;  3ROU A;  5ICE A;  3M9A A;  4I7H A;  1G6N A;  1YIO A;  1WI9 A;  3LQQ A;  1HW5 A;  4B8X A;  3GLX A;  2P5K A;  3QU6 A;  3WTX C;  4A0X A;  1IRF A;  3ZMD A;  4MQ9 F;  5CVJ A;  3FXU A;  1S7A A;  3BJO A;  2Q8K A;  2A6H F;  4YFN F;  4OIP F;  1HKQ A;  2FXA A;  2DO7 A;  2ELH A;  1H0M A;  3V7R A;  1REP C;  4L5J A;  1R1T A;  3MAJ A;  3WG9 A;  5JHU A;  1QZY A;  3PFI A;  3M7G A;  1IZ1 A;  2ZJ2 A;  1FYM A;  2E7X A;  4U0V A;  3HHG A;  1TW2 A;  1HW2 A;  1KGS A;  3LA2 A;  1DPU A;  3FMR A;  4IPA A;  4K2E A;  4P96 A;  2ZKZ A;  4A6D A;  2QEN A;  5IT9 K;  2MBF A;  2IP2 A;  1B9M A;  4L18 B;  1IN4 A;  1AOY A;  4KIC A;  3O6B B;  2EWN A;  3LA7 A;  2PEX A;  3T8T A;  4KYW A;  4ESF A;  2Y75 A;  3P9I A;  1LEA A;  4ZZL A;  2DFI A;  2D1H A;  2CWE A;  4KDP A;  1Q1H A;  3EDP A;  1IW7 F;  1R1U A;  3E6M A;  2FBI A;  4HW0 A;  5ILS A;  1U2W A;  1Y0U A;  2P5V A;  1W5T A;  4QLC U;  2DBB A;  2QBY A;  2E1C A;  3W6J B;  4XBF A;  3H3U A;  5IT3 A;  2A6E F;  5BPD A;  2BE5 F;  3FZV A;  3KEO A;  4HV6 A;  3G3Z A;  4AIH A;  1LJ9 A;  2IA0 A;  2IJL A;  2DPU A;  4M9S A;  1XMK A;  4G6D A;  4IHS A;  2XGX A;  3TDZ C;  3NRV A;  5EEH A;  4BHP A;  4HDV A;  4KIB A;  2OQR A;  4LG0 B;  4GYI A;  5LBQ A;  1BC7 C;  1WRJ A;  2ZME B;  4F7Z A;  5JR3 A;  1XD7 A;  2MLG A;  1J5Y A;  5LGU A;  3F6O A;  1HST A;  3M8E A;  4BQA A;  2KIU A;  4FX0 A;  5CYV A;  3LFK A;  4DNC A;  2X0L A;  5K5R A;  3IRQ A;  3SHF A;  1K78 A;  4I0B A;  1I5Z A;  3H92 A;  5LLQ A;  2ZCW A;  2IW5 A;  1PDN C;  2EFO A;  1ULY A;  1OYI A;  2HR3 A;  2QBY B;  3V8J A;  3FXQ A;  2FE3 A;  3L00 A;  1KYZ A;  3F8B A;  1IN7 A;  3QOP A;  3KET A;  3Q5F A;  3I64 A;  2HTJ A;  1ON1 A;  4LLL A;  2QYO A;  2FA5 A;  2L4A A;  2GXG A;  1FYK A;  2JRT A;  5L3E A;  2FMY A;  1BBY A;  4PCQ A;  1TQP A;  2JTV A;  3R0J A;  1S3J A;  2K4J A;  3GZ6 A;  3ZMS A;  3DXJ F;  1B59 A;  2Y48 A;  1HKT A;  3IC7 A;  2P6S A;  4L0Z B;  2K27 A;  2HDC A;  2RC4 A;  4EM1 A;  1CF7 B;  4OMZ A;  2OQG A;  2E7W A;  5J6X A;  4O3M A;  2P4W A;  3HIF A;  3ISP A;  1K7A A;  5CVV A;  1JE8 A;  4I0A A;  4HLX A;  4P9U A;  3BRO A;  5H6Q A;  3K1N A;  3Q9V A;  3R0A A;  4AD9 A;  1LQ1 A;  3R60 A;  2IRF G;  2OBP A;  2EFN A;  4R1H A;  4I01 A;  5K5Q A;  1ZGJ A;  2BV6 A;  4ETS A;  1P6R A;  3K0L A;  1B4A A;  1KU3 A;  4EGY A;  4AIK A;  3WTW C;  4ENN A;  1O3S A;  1HKS A;  3LWF A;  3WOD F;  2NNN A;  1Z7U A;  1MDM A;  1XDS A;  1DDN A;  5D6F A;  1FBQ A;  2F5E A;  2F5C A;  3GFM A;  4UHT A;  1O3Q A;  1FP1 D;  5D4R A;  4HQE A;  4KT5 C;  4MHG A;  5HLG A;  2D1V A;  2FEZ A;  2OZ6 A;  2WTE A;  2XV4 S;  4ZZD A;  4YIF A;  1KA8 A;  1J7K A;  5KVR A;  1T2K A;  1XDU A;  2WC2 A;  4N0B A;  1SFE A;  2COM A;  1IN5 A;  4EJO A;  4OIN F;  1W5S A;  4Q4Z F;  1IXR C;  4RS8 A;  2QQA A;  3BZ6 A;  3GWZ A;  2IT0 A;  3V8L A;  1SAX A;  1R22 A;  5FFZ A;  3TDU C;  4WXC A;  2HOE A;  3ZN0 A;  1FBS A;  4HYE A;  2LNB A;  3LST A;  4Z2Y A;  2FSW A;  4G7Z F;  1R23 A;  4CGZ A;  3T1B A;  4E70 A;  3LQR A;  1YLF A;  1ONV A;  3T8R A;  2JPB A;  1DUX C;  2HFH A;  4OMY A;  3HRM A;  1TNS A;  2NYX A;  1EH6 A;  2Q2E A;  2EJR A;  3U9G A;  2VBW A;  4FHT A;  3WE3 A;  1QZZ A;  4MGR A;  1SMT A;  2UXX A;  3FMQ A;  3GO5 A;  2DI3 A;  2XUB A;  5EEG A;  2M5W A;  4A0Z A;  2PQ8 A;  4RAZ A;  2OD5 A;  1J75 A;  1RUO A;  1H9G A;  5E20 A;  2VXZ A;  1BI2 A;  4WF2 A;  2IPQ X;  5ERI A;  1YW7 A;  3EET A;  2CO5 A;  4L5I A;  5A2Q Z;  5D8L B;  3MEX A;  3ZMV A;  1RUN A;  1K6O A;  1XMA A;  2F2E A;  1A04 A;  4XSZ F;  1KYW A;  4N9H A;  3L9F A;  1F4K A;  4AVP A;  3K69 A;  2DTR A;  3GX4 X;  3V8K A;  2GA2 A;  4M9Z A;  3GUD A;  4LFU A;  3BY6 A;  1BI3 A;  1STZ A;  1USS A;  4L9T A;  2EV5 A;  1L3L A;  1BC8 C;  3JW4 A;  5DCF A;  5DD4 A;  3J81 Z;  3R4K A;  1XGS A;  2YX4 A;  2EFP A;  1LDD A;  1IRG A;  2P7C B;  1EH8 A;  1KQ8 A;  1U5T C;  2HQR A;  4A5M A;  4KIF A;  1LB2 A;  4S04 A;  3E5Q A;  1RNL A;  3H3Z A;  1FPQ A;  4LK1 F;  3K1P A;  3P7N A;  1BI1 A;  2PFB A;  4UUV A;  2P5L C;  3F8M A;  3SXY A;  6PAX A;  4JBA A;  2W24 A;  1IAW A;  5AIQ A;  1FYL A;  5DD8 A;  2FML A;  2MC3 A;  3C1D A;  5L3C A;  2FOK A;  1X3U A;  1XGO A;  4OIO F;  3KFW X;  4KN4 X;  3HSE A;  1XN7 A;  2XIG A;  1YS6 A;  2M45 A;  1KU2 A;  1UCR A;  3ZN1 A;  4OOI A;  1IXS B;  2A68 F;  4BHB A;  3E97 A;  3CUQ A;  3KP5 A;  5BPI A;  1OYY A;  1XSX A;  2DQR A;  3GVA A;  4M73 A;  1BI0 A;  1FT9 A;  4HF2 A;  2Z3Y A;  2QZ8 A;  1T0F A;  3KZY A;  4YII A;  2XRN A;  5HS8 A;  1LNW A;  2UWM A;  2F5D A;  1YS7 A;  2O3F A;  3W6K B;  2V1X A;  1FLI A;  5BS6 A;  4G6Q A;  3RPQ A;  2UZK A;  2YSR A;  4RB1 A;  5ICG A;  2VBY A;  1O3T A;  3E5X A;  1TNT A;  3MZY A;  1ZG5 A;  4OU0 A;  5E1W A;  2GIV A;  1XCV A;  4QWQ A;  3AAF A;  2A69 F;  4CYD A;  1YW8 A;  2L01 A;  4JQF A;  1O7L A;  1FBU A;  1YYV A;  5LHH A;  2HKO A;  3OV8 A;  1Z05 A;  1IXC A;  4RB0 A;  5IT9 Z;  3JAM K;  2FBH A;  5E8G A;  2RKH A;  4UVC A;  2D45 A;  4HQM A;  4ON0 A;  3F72 A;  2OAZ A;  5CVU A;  3HOS A;  1I27 A;  3BDD A;  5FO5 A;  3KE2 A;  4ENJ A;  3CO6 C;  4WX9 A;  2KKO A;  1E17 A;  3ZMU A;  2VBX A;  3QPT A;  3I59 B;  4LD5 A;  5F6F A;  4KMF A;  5DCM A;  5D5X B;  5FGM A;  2FRH A;  2LKP A;  2OU2 A;  4OIR F;  4I2O A;  3C7J A;  5DUI A;  1R00 A;  3ZP5 A;  3V4G A;  1IN8 A;  1MKM A;  2DU9 A;  4M9X A;  1Z6T A;  3HHH A;  5AON A;  3JAM Z;  2CYY A;  3F8F A;  2EK5 A;  2Z99 A;  3WU1 B;  4GXO A;  2STW A;  3RKW A;  5DV5 A;  4HX4 A;  1KU9 A;  1SFU A;  2PJP A;  1J59 A;  2FNA A;  3U2R A;  3E5U A;  5DDG A;  4IRG A;  2W85 A;  5F64 A;  1G3Y A;  2NRA C;  2XAS A;  2ZNZ A;  5CVR A;  5ICF A;  4KN7 X;  1W4M A;  4G7O F;  5FLX Z;  3HRU A;  1UB9 A;  2K4B A;  4M71 A;  2VE8 A;  4UVB A;  1TQM A;  4HF1 A;  3DF8 A;  4Y17 A;  5KK1 A;  4AIJ A;  3K1M A;  2ZXJ A;  4YFX F;  3GF2 A;  1O57 A;  3ZMT A;  2ZNY A;  1D3Y A;  3C18 A;  4U7D A;  4CHU A;  3DV8 A;  4A5N A;  2W25 A;  1LVA A;  2GQQ A;  5CVI A;  3ECH A;  5TJJ A;  1SD7 A;  1S8N A;  2QLZ A;  5J8F A;  1ZRF A;  2RVC A;  4Y15 A;  2IA2 A;  1YO5 C;  2ADU A;  3S2W A;  4PDK A;  1XCB A;  4ZYE A;  4BHC A;  3CDH A;  1OYW A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...