1W7PD

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VPS22, YPL002C
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04157 EAP30 EAP30/Vps36 family
D PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
D PF16988 Vps36-NZF-N Vacuolar protein sorting 36 NZF-N zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD02
2OD5A 4IRGA 1B9MA 1T39A 2Z99A 2JT1A 2BE5F 5J8CA 3WU0A 2KJBA 2FBHA 5IT9Z 2ZMEA 1U5TC 4NB5A 4GGGA 4RGUA 3ZN0A 4EJOA 4HAMA 1W5SA 1G6NA 3GFLA 1XCBA 2CGPA 4ESFA 4I2OA 2V6CA 1LVAA 4LLNA 2NNYA 2P6SA 2UZKA 4U0VA 3RIRA 1XSDA 5BS6A 2DW4A 2EV5A 5HDNA 3ZMUA 1LEBA 1E2XA 2FF4A 2XASA 4A5NA 4IXAA 4M73A 2KRFA 5L3DA 3F23A 2KKOA 1TTYA 3LQRA 2EA4A 1ZLKA 1XGNA 3HUGA 4UVCA 2GXBA 2VE8A 2HZTA 2P5LC 3DV8A 1PDNC 1ZREA 1ULYA 1YLFA 1SFXA 4LFUA 1OPCA 4OIPF 4G8XA 3RYRA 5FLXK 2FU4A 1QBJA 4BXUA 3L00A 5J6XA 3CO7C 5L3CA 2RKHA 3BP8A 2VT3A 2EV6A 4N9IA 2OAZA 5K5QA 4XSXF 4KIGA 1PP8F 1R58A 1IN4A 3I0TA 1HKTA 3FM5A 2ISZA 2PJPA 2MLGA 3QP5A 4O6JA 3GZ6A 2GAUA 1IRFA 4MTEA 2XAFA 3JSPA 5H6RA 1FYLA 1BJAA 2FA5A 1T6SA 2P8TA 3TDUC 4EMSA 2NNNA 3COAC 3F8BA 2M30A 2WTEA 3EUHA 2HTJA 3TGNA 3J80K 1RI7A 1RUOA 1XD7A 5J8FA 4HX4A 2A69F 2ESNA 5K1YA 1MJAA 3HSFA 1XGSA 1ON1A 1DPRA 2ACJA 3WTTC 3ZMTA 2GZWA 3J7AO 4MHGA 2EB7A 1J2XA 3GX4X 5BOXA 3WTXC 2IP2A 4OU0A 4RGRA 4YFNF 1HKSA 3MQ0A 4WXDA 4HX8A 1R36A 1BN5A 3F8MA 1FLIA 4M9SA 2DLLA 2EV0A 1KA8A 2ZO4A 2E1NA 2VN2A 3RDIA 3MAJA 4I01A 4ZZLA 1FPQA 3C7JA 4BYYA 1YQAA 2XKPA 5IT9K 3FMRA 3KP6A 4QLCU 2H27A 5AIPA 2HQNA 3JSOA 3OV8A 4A6EA 2ISYA 1EV7A 2PEXA 3U2RA 4XBFA 4WWCA 3P9CA 4HV5A 4K2EA 3WTSC 2CO5A 4HA8A 1WRJA 2P5KA 1P4AA 3HRTA 4FX4A 5DUIA 4HDVA 1AOYA 3I4PA 2D1HA 2JSCA 5ERIA 3U9GA 3MWMA 4RS8A 1WWXA 3W6JB 1LJ9A 2M5WA 5FO5A 3WODF 5LEKA 3ZQ7A 4PGHA 1QZZA 2OA4A 4G7OF 2YR2A 2EJRA 1J9IA 5CVRA 5AIQA 3R61A 4EM2A 5K5OA 4QWQA 3WGIA 1SFUA 4P5OA 2P4WA 3E6MA 1MJBA 1OYYA 5LGUA 4LB6B 1IN6A 2QQAA 5D6FA 4L9VA 3EDPA 5HVQC 1L3LA 4HF1A 3TDZC 3IRQA 3TQNA 3ZP5A 4GO1A 1OYIA 2O3FA 3FMQA 2BV6A 2HDCA 4RB3C 4WCGA 3JAMZ 4WK8F 4L5IA 3F21A 3RPQA 1YYVA 4EJUA 2HWVA 4FT8A 3KFWX 2QQ9A 3V7CA 3T8TA 1I27A 5L3FA 4BHPA 1JHFA 2O8XA 2AXLA 4UNOA 2LNBA 4HDUA 2GA2A 6PAXA 2AS5F 2OU2A 1I1SA 1G3WA 4ETSA 5ICCA 4WXHA 2EFPA 4KMUX 3D5LA 1I1GA 1XB4A 1BBYA 2XROA 1IAWA 3TOBA 1O7FA 3BZ6A 1V3FA 4OMYA 1U5TB 2P6TA 4RB2C 1XMKA 2QVOA 4OIQF 1ZG5A 1XGMA 4CXFA 5D5WB 5H20A 4NQWA 2IW5A 3GXOA 3HOSA 3VODA 3SZTA 5KVRA 3MZYA 1I6XA 4A2UA 4Q4ZF 5IT3A 1TQMA 3H3ZA 1LB2A 4N0BA 2XAHA 2FSWA 3K1NA 1C0WA 2QQBA 3NQOA 2X0LA 1O3SA 3QU6A 4I02A 1R1TA 2VOOA 5JR3A 2A61A 4UV8A 2W84A 1SD6A 1FYKA 4EM1A 3BPXA 2IJLA 1ZYRF 4CZZA 4EVIA 1R7JA 1QZYA 2O61A 2J5PA 2CG4A 1K6OA 2XKOA 2HFHA 2FBIA 3MEXA 1H9TA 2ADUA 4G6DA 3I71A 2YX7A 3IHUA 2YSRA 4N9HA 2ZBKA 4HQMA 2XUBA 4BHCA 4U7BA 3BWGA 3ZMZA 4ZYGA 2LKPA 5F1RA 4IF4A 2OBPA 4PGGA 3M7GA 4IHSA 3M8EA 2CW0F 2L3DA 3DPLC 2V79A 3DKWA 1FT9A 3WE3A 4P9UA 4EGYA 1BI3A 1W7PB 5E1XA 2DBBA 3I59B 3F22A 2H94A 2R7FA 2XVCA 1ZRDA 5K5RA 1S29A 3FF5A 3RJPA 1MD0A 4MTDA 3KETA 1O57A 1DUXC 5HLHA 5D4SA 1GXQA 2H6BA 3ZMSA 2G7HA 3BJAA 3K1MA 1IXRC 1Z1DA 5JHUA 3E5XA 1BM9A 1B59A 3JAMK 5E17F 4M9ZA 5DEQA 3GZ5A 3G73A 4LK1F 3REOA 3M8FA 3ZMDA 1MZBA 2CQKA 1LQ1A 1RIOH 1FOKA 2ZNYA 4XSZF 2KIMA 5BPDA 2V1XA 1J0RA 3HRUA 4ZH4F 1OR7A 2DK8A 1ZN2A 1R22A 2F5DA 3ZN1A 3SHFA 1KQ8A 3HSRA 1GXPA 1B1BA 4Z2YA 3HYIA 1BOAA 1FX7A 1UCRA 2EFNA 4CDGA 2VBZA 3KP4A 1YTYA 2MLKA 5FD5A 3HIFA 1JE8A 2J5OA 3LSTA 4S04A 2V9VA 2A6EF 4CGZA 4KN7X 2VC1A 1G3SA 1TBXA 2YX4A 4CYDA 2OQRA 2PBIA 4DNCA 2Y48A 3SXYA 2EWNA 4U7DA 4M72A 3KP5A 5HS9A 2HQRA 2IA2A 5CLSA 3K9TA 4A0YA 3HRMA 2ESHA 3O6BB 2G9WA 5DV5A 2RC4A 2VOPA 3CJNA 3C3WA 1JGSA 3WGHA 4LG0A 4M9XA 3RTRA 3K2ZA 2L4MA 3NRVA 5FFZA 2O03A 3DQVC 1HKQA 3DXJF 3QU3A 3HRSA 4XLPF 2FEZA 3FXQA 3Q9SA 3C1DA 4R8HA 4OOIA 2Q2EA 3I59A 3I53A 5ILUA 3E6BA 1Z6TA 2L4AA 1K7AA 1ZLJA 4A5MA 4B09A 4ESBA 4CHUA 3BJOA 3BROA 5EEGA 2PQ8A 3PQKA 1I5ZA 2NAZA 3I54A 1SFEA 5E1WA 2QLZA 4GYIA 1S7AA 2VT2A 2OZ6A 4HQEA 3FX3A 4NHJA 4KMFA 5E8IA 1ONVA 4I09A 1FY7A 3TO6A 3IL2A 2XAGA 4AIKA 3F8FA 2K7LA 1YFHA 4G6QA 2GA1A 3CUQB 3GFMA 2DPDA 2ETHA 2Y75A 2R7DA 5LGNA 4LJZF 4M6YA 3ISPA 2Z5UA 2COMA 4YFXF 3E97A 1W4MA 2GIVA 2G7UA 2V1DA 1SMYF 2BBYA 4U88A 1BI0A 3F8CA 1CF7B 2K27A 2UWMA 2FMLA 3WTUC 1SD4A 1FSEA 5ED4A 1REPC 4Y15A 1P4WA 2KIFA 1R1UA 2ZNZA 1H0MA 2RDPA 3WU1B 2V1UA 3MFKA 2NRAC 3B73A 5HLGA 1R1VA 4L5JA 5LHHA 1XN7A 4HLYA 4AVPA 1IXSB 4RB0A 3S2WA 2W85A 1JXSA 2HKOA 4MEYF 2X4HA 2L54A 2DPUA 1F9NA 3V8JA 4M74A 1IN7A 1ZARA 3ERED 5JVTA 3CLOA 4UVAA 2DT5A 3O2PE 3P7NA 2W25A 3KP7A 1RUNA 2QENA 2EFQA 3T8RA 3V7RA 3E6CC 4KFCA 4L0YB 1F4KA 4L0ZB 1TQIA 1IF1A 1BI1A 4G9YA 5CYVA 3DEUA 2CYYA 3DF8A 1SD5A 5ILVA 4OINF 1TNTA 3J81Z 2QYOA 2ELHA 2VXZA 5BQTA 4PDKA 4OMZA 5E18F 1FSHA 3OOPA 2YU3A 5L3BA 1EH7A 2MA3A 2DI3A 3L9FA 3JTHA 3QP6A 3CUQA 2KJCA 1EH6A 4R1HA 2H09A 2H6CA 1W5TA 3FM3A 3GEZA 2EFOA 4ENKA 2RQPA 1KU3A 4YFKF 5JFRA 1CF7A 3KZZA 3V7SA 4M6XA 2D2WA 1BIBA 4HBLA 2F2EA 3GFJA 2PFBA 2R3SA 3L09A 1DDNA 2WV0A 1FP1D 5FFXA 2A6HF 2VODA 2XIGA 3RKXA 2FXAA 2CFXA 2K02A 4CICA 3B02A 5LEJA 4UV9A 1MDMB 1T0FA 2STWA 4L9TA 5ICGA 5AONA 3EQLF 3QPTA 3R0AA 3IKVA 4BH9A 1YW9A 2XAJA 1LEAA 2HKXA 3P9KA 2PLYA 1QQIA 3FWEA 2DAOA 2IVMA 4KT5C 3LAPA 2ZJ2A 4GYGA 2QWWA 2JPCA 2FE3A 4UHTA 1Z7UA 1KQ0A 1KU7A 1ZG3A 1TQPA 2Z3YA 5DYMA 3M9AA 3EYYA 1FNNA 2IA1A 1UHWA 1B4AA 1LDJA 4ZYHA 5DD4A 1LNWA 1TNSA 5TJJA 3AAFA 2XAQA 3V8KA 1T2KA 4G94A 1QPMA 1D3YA 2F5FA 3GF2A 4WX9A 1WQ2A 5DUKA 3RKYA 3MZHA 4EJWA 3F6VA 1BI2A 5L3EA 2ZFWA 1FBUA 1D5VA 3CUOA 5JI6A 1J59A 3F6OA 4HOBA 2A5YB 3GLXA 1YW8A 1LDKB 5EEHA 4AWXB 4KN4X 1U78A 3SQNA 3W6KB 5LBQA 4ON0A 5D5UB 4I0BA 3ABTA 4G7ZF 5CVUA 5D8LB 1B9NA 2ZMEB 4EGZA 2HOEA 4Y17A 4MNUA 3J81K 4PCQA 1BIAA 2XHKA 4HF2A 5CVJA 1ZG1A 4MEXF 1DP7P 1ON2A 2NYXA 2RV8A 2JTVA 1HXDA 2DQRA 2L01A 5D4RA 4AIJA 4KUMA 1U3EM 3CO6C 3GO5A 2M45A 2IA0A 4EQQA 1MDMA 2EFWA 1P4XA 2A68F 4G7HF 2MH9A 3M1EA 2YPRA 3KLOA 3PQJA 1KGSA 2HEOA 3HHGA 1ZGAA 4O5VA 4ASNA 2BGCA 3I5UA 3IRRA 1HW1A 3RPUA 1BC7C 2O0YA 3ULQB 3HSEA 4YIFA 2RN7A 1HW2A 4L9JA 5LHIA 1Q1HA 1D8JA 2F5EA 1Z6RA 4RB1A 2M1BA 5HDGA 3ZMVA 4KIFA 2K4BA 5FGMA 1FZPB 3L2CA 1HBXG 1U5TA 1IZ1A 2RGVA 4IRHA 1QGPA 4Y13A 2PN6A 1XGOA 2LF7A 2MD5A 1HSTA 3BJ6A 4CO8A 2VC0A 1YIOA 4ZZDA 1O3QA 2D1VA 2FMYA 4OIRF 2HR3A 1W7PD 3FHZA 3R0JA 3KLNA 2UXNA 4EJTA 1OYWA 1R00A 4HW0A 3GWZA 2QBYB 5LRSA 4KNYA 2L02A 4HLXA 4GCVA 2P7VB 5FB2A 3KZYA 3WG9A 4ENMA 2MH2A 1XDSA 4EJVA 1PP7U 1DPUA 2EA2A 4ENJA 1F1ZA 2C6YA 3V8LA 4A0XA 4Q5SF 3BOQA 1SMTA 1IRGA 1F5TA 1IXCA 5F64A 1CGPA 1P2FA 3LA2A 3HOTA 3VFZA 4UXNA 1FBSA 5D5XB 2ZXJA 5KK1A 3DPTA 2B0LA 1P6RA 2Q0OA 2QZ8A 5LHGA 2JPBA 3TKYA 3LA3A 1W7PA 1A04A 2E7XA 2CSOA 4LB5A 2HTSA 1L0OC 3GFIA 4Q48A 3N97A 2A07F 2FBKA 3GW2A 2STTA 5ICFA 1T38A 2A3SA 3K1PA 3RYPA 1YS6A 4KIBA 1YS7A 3TOAA 5DD8A 2FRHA 1GVJA 4IRIA 2IT0A 1QO0D 3G3ZA 1O7LA 4I7HA 1SD7A 2LF8A 4UVBA 1ZAOA 3TO9A 2GWRA 4RAYA 1J5YA 2Z33A 2K4JA 1VTNC 1XSXA 4L18B 3LWFA 1ZRFA 1HW5A 1B6AA 2HGCA 2D45A 1H9GA 1T98A 5CVIA 4WF2A 5DDGA 4E70A 1XDUA 2TDXA 4FHTA 2XV4S 3Q5FA 2PI0A 2GXGA 2PMHA 1BC8C 1PUEE 2W24A 5LLQA 4XLNF 3WTWC 3CTAA 4PZJA 5DCMB 4YIIA 1MKMA 5HS8A 2BEOA 1GHCA 5A2QZ 4ENNA 4P9FA 2EK5A 1FC3A 2QBYA 3C18A 2HS5A 3D0SA 4RGXA 2WWYA 1OMIA 4L9NA 2IPQX 2ZKZA 4LLLA 2VONA 1Z91A 4ZYDA 2JRTA 4MQ9F 3BPVA 1IUYA 3RI4A 2DQLA 2XGXA 3E6DA 4WXCA 4KDPA 4LMYA 2VBYA 3LA7A 3R6SA 3TO7A 3L7WA 3DP7A 1R5GA 3ABUA 1KU9A 3R4KA 3V4GA 3KP2A 3LFKA 2W57A 1X3UA 4HZFA 4A12A 4IJAA 1KYZA 1XMAA 1KQ9A 2HYGD 3KEOA 4FX0A 4I0AA 4P55A 1NHAA 2DO7A 2ZCWA 5F6FA 4BHBA 3E5QA 3O3KA 1WI9A 1XSVA 4O3MA 1ZRCA 1UFMA 3KP3A 4ESJA 2QM3A 4R79A 3T1BA 4H0EA 4TV7A 3ML6A 1Z05A 3GYHX 1UB9A 3F3XA 3JTGA 3WTYC 5HOOA 1J7KA 3R60A 4M71A 4Q47A 3VOEA 1K79A 1UHMA 4BNCA 2P7CB 5L3GA 3DFGA 3HTUA 5HLIA 3N4MA 3RKWA 1O3RA 1TLHB 3QPHA 4YG2F 4I98B 3FMSA 2E7WA 2FNAA 2FNPA 4HV6A 2O6GE 5DCMA 5E8GA 5TRDA 2RNJA 3ECOA 4LLGF 1YG2A 3LAJA 2DTRA 1E17A 3H92A 3FXUA 2VBXA 3MCZA 5ICEA 1IN5A 5D5VB 2DU9A 4RGSA 2PMUA 3ECHA 5D8KB 3SFZA 3H3UA 3K69A 4LK0F 1K78B 1G4DA 4A0ZA 1ZH5A 3CDHA 4XRFA 3QRFF 2P5VA 1IN8A 1ZGJA 2MBFA 4BAYA 1S7OA 4AD9A 5H6QA 3ROUA 2OQGA 1XCVA 1D8KA 5A2QK 3CUQC 4B8XA 3F8NA 1USSA 1R5HA 3GUDA 3KCCA 2DK5A 4KYWA 3KEQA 4HYEA 1U8RA 1KU2A 1FBQA 1MGTA 2OZUA 3SZPA 2F5CA 2Z9OA 1IW7F 3WE2A 3WGGA 5E1ZB 4U0WA 4ZYEA 1HSJA 1G3TA 4BQAA 3EYIA 5BPIA 3WTVC 1EH8A 1Y0UA 2BYVE 5ILSA 5LRRA 1G3YA 4LD5A 3E5UA 2LSOA 2MC3A 2WC2A 1ZHFA 2Q8KA 3F72A 5LGTA 2KIUA 2RVCA 4RAZA 2NS0A 5E20A 1JHHA 3KE2A 1U6GA 4AIHA 2GQQA 1OKRA 3VEPA 5CVVA 4KA4A 4DQ2A 1TW2A 3ELKA 4P96A 5BMZA 4KICA 5D6EA 4IVNA 2HYFA 2M8EA 1MJ9A 4U0YA 2QUFA 3QOPA 2VBWA 1YW7A 3WTZA 1FYMA 4HX7A 1TW3A 3QAHA 4JK1X 2CWEA 2DFIA 4MQVA 4LGWA 1S3JA 1S8NA 3U1DA 2JZYA 3IWZA 3NEUA 1Z9CA 3T5XA 3K0LA 5FLXZ 1WSUA 2Y0MA 1K78A 2K86A 4JQFA 4S05A 3I64A 3P9IA 3IWFA 1WKMA 4F7ZA 3FZVA 3T0YA 1YO5C 4LG0B 3PFIA 1V4RA 3HHHA 1RZ4A 4IPAA 2PG4A 1P92A 1FP2A 3IC7A 3HTSB 2LDUA 3VB2A 5CJ9A 1QNTA 2UXXA 2IRFG 4EM0B 2VE9A 4UUVA 1FWZA 3ZPLA 1R23A 4IHTA 1AWCA 5HDKA 1J75A 3J80Z 5DCFA 1STZA 1U2WA 3JW4A 2M87A 3BDDA 1O3TA 4JBAA 1LDDA 1USTA 3EETA 4D0PA 1S6LA 5FD6A 3FXRA 4GXOA 4EV0A 2E1CA 4HF0A 2FOKA 3BY6A 1SAXA 4A6DA 1ODDA 2FQ3A 4MGRA 3I58A 1KYWA 1RNLA 3GVAA 4OIOF 5HS7A 3LQQA 3Q9VA 2XRNA 3IKTA 1HQCA 3E3VA
chains in the Genus database with same CATH superfamily
2OD5A 4IRGA 4OAYA 5EG0B 4MO7A 1B9MA 3BG6A 1T39A 2Z99A 2JT1A 2HU9A 3BG9A 1X2NA 4RLQA 4A69C 1VQ4I 2BE5F 5J8CA 3WU0A 2KJBA 2FBHA 1SVMA 1MBJA 1XS9A 2NXNB 3QODA 4C2TA 2ZMEA 1U5TC 2DMUA 4NB5A 3K70D 5IT9Z 4NNJA 3VWBA 4GGGA 4RGUA 4ZTFA 4D5CA 3ZN0A 3GBGA 2E35A 4EJOA 4HAMA 1W5SA 1G6NA 1JUMA 2Y31A 4UUSA 3GFLA 2LD5A 1OCTC 1XCBA 2CGPA 5IPAA 4ESFA 2Z2SB 4BE2A 3QYFA 1X1BA 4E7KA 4NUBA 2QSGX 4I2OA 2V6CA 1MMGA 3MKYB 1Q1VA 1QHHD 1LVAA 4XM3A 2NNYA 2P6SA 4LLNA 3HGYA 1H8AC 2UZKA 4U0VA 1UG2A 3DLAA 3RIRA 1WH5A 1XSDA 5BS6A 2ZJQF 4A3CJ 2DW4A 3VSKA 2EV5A 5HDNA 1FMWA 2MG4A 3ZMUA 1LEBA 5EGOB 5IYBJ 1WPKA 4C30A 1E2XA 4BL0B 2FF4A 1XTAA 2XASA 2PJRA 4A5NA 4GFBA 3DEEA 3K4NA 4AYBN 1HDPA 1VQKI 1VNDA 4IXAA 4M73A 4ZC3A 3SZGA 2KZGA 1BJZA 2DA3A 4RM3A 2KRFA 5L3DA 3F23A 2KKOA 1TTYA 3B6AA 2DA2A 3CC2I 1IUFA 2ICWG 4IHVA 3LQRA 2EA4A 2HPMA 2E36A 3G71I 1ZLKA 1XGNA 2EZKA 2M2EA 3HUGA 4B47A 4UVCA 2GXBA 1MSFC 2L9RA 2VE8A 4BBSJ 2HZTA 2P5LC 3C2GA 3DV8A 1PDNC 1ZREA 1ULYA 3MKZA 4E7IA 1YLFA 1SFXA 2K40A 4LFUA 4NC6A 1OPCA 4BJ5C 1AKHB 4OIPF 2DFHA 1V55H 2RNGA 4G8XA 4YEJA 3RYRA 2LBFB 4QPOA 4Y4RA 5FLXK 2UUZA 2FU4A 2RAEA 4BXUA 1QBJA 2IXSA 3L00A 2JJ7A 1QZEA 5J6XA 3H9QA 3CO7C 5L3CA 3JRHA 2RKHA 3BZKA 2JN6A 3BP8A 4RAFA 4FQGA 2VT3A 1NK3P 2M7BA 4RM2A 2EV6A 4N9IA 2OAZA 5K5QA 4XSXF 4KIGA 1QPIA 1PP8F 1R58A 1IN4A 5EF6A 3I0TA 3OYNA 1HKTA 2ZFUA 1FOWA 3FM5A 2ISZA 2PJPA 2MLGA 3QP5A 4O6JA 3GZ6A 1Y1VJ 4IX7A 2GAUA 2NOGA 1IRFA 4MTEA 2XAFA 3JSPA 5H6RA 5EDNA 1FYLA 1BJAA 2XGDA 2FA5A 1T6SA 2P8TA 2P81A 3TDUC 4EMSA 3D1NI 2NNNA 3COAC 3SDGA 3F8BA 2M30A 4MFEA 2WTEA 3EUHA 3AG3H 4CYCA 2JK3A 2HTJA 1A36A 1E3PA 2QCOA 5C44J 1X2MA 1NTCA 2DA7A 3TGNA 2DA1A 2Z1DA 4B1RA 2A05A 3GCMA 3PO3J 5IYDJ 2R5YA 3J80K 3IP4B 1RI7A 4A3BJ 4AVZA 1RUOA 2B63J 3TEDA 2FUG2 5EG0A 4XRSG 1XD7A 3J7ZI 5J8FA 2K9LA 3HXLA 4HX4A 2A69F 1MMDA 2ESNA 5K1YA 4XOTA 1MJAA 1T8IA 3HSFA 3LSJA 1AHDP 2E5NA 1XGSA 1MH3A 3AG1H 1TL8A 1ON1A 1DPRA 4AM3A 3PNTA 4M3DA 3OYGA 2ACJA 4UY8I 3WTTC 1MMAA 3ZMTA 2EZIA 3BCBA 3PUFA 2X51A 3K70C 1WJEA 2GZWA 2CUJA 4NBQA 3J7AO 3MVPA 2KHMA 3JRGA 2KT0A 1F43A 3N05A 2X48A 4MHGA 2EB7A 2VQHA 1IGNA 1J2XA 1ETVA 3GX4X 1JKPC 5BOXA 3WTXC 2IP2A 4OU0A 2DA6A 4RGRA 4YFNF 1HKSA 3QOEA 2NS7A 3DTKA 4Z6YA 3MQ0A 1X4OA 4WXDA 4HX8A 1R36A 1VZ0A 1BN5A 1XX5A 1Y8QB 2ZXWH 4DOZA 2DYRH 3F8MA 2Y0SN 3K10A 4M3GA 2DLLA 4M9SA 1W0TA 1FLIA 2EV0A 4XLFA 1SAUA 1KA8A 3SFIA 3FISA 2ZO4A 2E1NA 3IUOA 2VN2A 3RDIA 3OS2A 3FK6A 5DM7F 3MAJA 4I01A 2K5CA 4ZZLA 1FPQA 4BXFA 2QKLB 3C7JA 4BYYA 2I5UA 5E3LA 4JP0A 1YQAA 1N25A 2XKPA 5IT9K 3FMRA 3CCYA 3KP6A 4QLCU 2H27A 4UB8C 1LVKA 5M5YJ 5AIPA 2HQNA 1Z3YA 3JSOA 3OV8A 1S7EA 5J3LA 2XSJC 4JX6A 3H5RA 4A6EA 4IOCF 2ISYA 4J19A 1EV7A 2HOSA 4IHWA 2PEXA 3U2RA 4XBFA 4WWCA 3P9CA 4HV5A 4K2EA 3WTSC 3OYLA 1W0UA 5IYCJ 1X19A 3AG4H 2CO5A 3I9V2 4HA8A 2DMNA 1WRJA 2P5KA 1P4AA 3FBIB 3HRTA 1SEUA 4FX4A 4DJAA 1VI0A 1UMQA 5DUIA 1W1WE 3SEQA 1YOVB 4HDVA 1AOYA 3I4PA 2AXTC 2D1HA 3ZR8X 3BR6A 3W2VA 2JSCA 5ERIA 1PVEA 1YJ9I 3OYMA 2DOFA 3U9GA 3MWMA 2L9NA 3S93A 4RS8A 3BTJA 1WWXA 3W6JB 3GZNB 5KCMA 1LJ9A 2M5WA 5FO5A 5C4JJ 3WODF 5LEKA 3ZQ7A 1V54H 1I3QJ 2OTLI 3G1MA 1DP3A 2QSFX 1QZZA 2OA4A 4PGHA 2DMPA 4G7OF 2YR2A 1KZHA 2Y9YA 2EJRA 1J9IA 5CVRA 3DEWA 1V5EA 5AIQA 3R61A 4EM2A 5K5OA 4GDFA 2FJ1A 4I6ZA 3SJMA 2KRHA 2XGCA 1RR7A 2ZXHA 2L7ZA 4XONA 1ETOA 1T33A 4QWQA 3WGIA 3OYAA 2JQ7A 1SFUA 4P5OA 4A3JJ 2P4WA 3E6MA 5BNGA 1MJBA 1OYYA 3I55I 3HOYJ 4HNVA 3CMMA 1YRNA 4DW6A 5LGUA 3CMEI 1D0ZA 3LSMA 3NARA 4LB6B 1IN6A 2OPTA 2QQAA 4U87A 5GADJ 4Y7NJ 3DLLF 2E1MC 5D6FA 1GV5A 4L9VA 1MMNA 1TWAJ 3EDPA 4ABZA 3LL7A 5HVQC 3H36A 1L3LA 2H1LA 1EA3A 4HF1A 3TDZC 3IRQA 2OTJI 4BE1A 3TQNA 1APLC 3ZP5A 4GO1A 2HOTA 1R4MB 1OYIA 2V9PA 2O3FA 3TBIA 2O7OA 3FMQA 1LE8B 2BV6A 3AL0C 2HQ5A 1OCZH 3DBHB 2HDCA 4RB3C 3CCLI 4A3MJ 1VQ6I 4WCGA 2M9HA 3JAMZ 2CS3A 4W1UA 3K7AJ 2XF7A 4WK8F 4L5IA 3F21A 3RPQA 1YYVA 2I10A 3A4CA 4EJUA 3D5SC 2HWVA 4FT8A 3M07A 1RETA 3K6GA 3HB9A 3CLQA 3KFWX 4XKWA 3RSNA 2QQ9A 1BW6A 3T8TA 3V7CA 1I27A 5L3FA 4BHPA 1JHFA 2O8XA 4QIWN 4BU2A 2AXLA 3BR3A 5GAGJ 3OL4A 4UNOA 4YIRX 1HLVA 1ZK8A 1EJ9A 2LNBA 1GUUA 1A31A 4HDUA 2GA2A 6PAXA 5JLWA 4KISA 2BHZA 3ASOH 3I56I 2AS5F 2OU2A 1I1SA 1G3WA 4ETSA 5ICCA 4BEHB 3LSGA 3K4CA 2WY8Q 4WXHA 3S2HJ 2EFPA 3CCJI 2G0EA 4KMUX 4IHYA 2CQQA 5HNFA 4XLHA 3D5LA 4Y3OA 2LY2A 1I1GA 3H5AA 1XB4A 3LSIA 1BBYA 3S3MA 1QHGA 2R7WA 3CZ6A 2XROA 5K7HA 1IAWA 3TOBA 1O7FA 2ZC2A 3MMYB 2ID3A 3BZ6A 1ZKGA 4ZTJA 1V3FA 3HOVJ 4OMYA 3NAUA 2JA8J 1U5TB 2P6TA 4RB2C 1XMKA 2QVOA 3E1SA 1BR4A 4OIQF 1ZG5A 3BG3A 1LFUP 1XGMA 3G1LA 2CUZA 2H8WA 2R7UA 2MGQA 4CXFA 2VJ5A 2KL4A 5H20A 5D5WB 4NQWA 2HI3A 4ITVA 2IW5A 1MBHA 3GXOA 3HOSA 1N78A 3FKIJ 3VODA 3SZTA 3M4OJ 1Y6IA 5KVRA 3MZYA 1I6XA 4A2UA 4Q4ZF 5IT3A 3S14J 3I4MJ 2FD5A 5EEAA 2WAQN 1VF9A 5KAFC 1TQMA 5CPRB 3H3ZA 1LB2A 3FDYA 2K3FA 2L9VA 4N0BA 5EZHA 1K61A 4D7NA 2XAHA 2YUSA 2FSWA 3K1NA 1C0WA 2QQBA 3NQOA 1TWHJ 2X0LA 1O3SA 3QU6A 1Y39A 4I02A 1R1TA 2VOOA 1OLTA 5JR3A 2A61A 1G8XA 1P7IA 4UV8A 2W84A 1SD6A 1FYKA 4EM1A 3BPXA 3ZXSA 3JR9A 4E7JA 4BGDA 3JRIA 2IJLA 1ZYRF 4AYBA 1Z3XA 4M3EA 4C2UA 1WJFA 3FXMA 4CZZA 4EVIA 3W2WA 5F0HA 4N4OB 4B48A 1R7JA 1QZYA 2W4SA 5M3MJ 2O61A 2J5PA 2CG4A 4II2A 1K6OA 1K6YA 2XKOA 2HFHA 3ZQHA 2IS1A 5FLMJ 1VQ9I 2VQCA 3NWTA 1RRJA 2BY2A 2VKVA 3BQYA 4NC7A 2FBIA 3MEXA 2IGNA 2R7TA 1IDYA 1H9TA 2VKDA 3ZRGA 2ADUA 2WADA 5TISC 4G6DA 4C3JJ 1HCRA 3I71A 1AA7A 5FKNA 2YX7A 3IHUA 3O8GA 1X1CA 2YSRA 4GRIA 2WB1N 4N9HA 2ZBKA 4HQMA 2XUBA 4BHCA 4U7BA 2R0QC 2XGEA 3BWGA 5M5WJ 1OFCX 3ZMZA 1IC8A 4ZYGA 1UZCA 2LG4A 2LKPA 3TW7A 5F1RA 4IF4A 1LFBA 2OBPA 4PGGA 3M7GA 4IHSA 1IRXA 2LLKA 2VQLA 2XPUA 1YITI 1VQLI 2X1EA 1VQNI 3M8EA 2CW0F 3TMOA 4CCNA 2L3DA 3DPLC 1FTTA 2V79A 2JA6J 3DKWA 2CH0A 1FT9A 3WE3A 2OC6A 4P9UA 3CP8A 5IP9J 3HOXJ 4EGYA 1JI8A 3VPRA 1BI3A 1W7PB 1JKRC 5E1XA 2DBBA 3I59B 3F22A 2H94A 2QF7A 3OYKA 2R4GA 4X6AJ 1X4PA 3H5NA 2X85A 2R7FA 4UUTA 2XVCA 4F92B 1ZRDA 2JA7J 5K5RA 1S29A 3FF5A 3RJPA 1MD0A 1T95A 3M8JA 4MTDA 4DGWB 3KETA 1O57A 2IBDA 2OJED 5IOYA 5HLHA 1DUXC 3CCSI 3GTJJ 4IHXA 5D4SA 1GXQA 2H6BA 2UV1A 2G7HA 3MN2A 3BJAA 3ZMSA 3K1MA 1IXRC 1Z1DA 5JHUA 2QEXI 3E5XA 1S72I 3OMYA 2DOEA 1BM9A 1B59A 3JAMK 5E17F 4M9ZA 3BG5A 3GZ5A 5DEQA 3G73A 4PFPA 4LK1F 2LP0A 3REOA 3M8FA 3ZMDA 1MZBA 1X58A 2CQKA 1RIOH 4BQQA 1LQ1A 3ZGKA 1FOKA 2ZNYA 4XSZF 2KIMA 5BPDA 4FASD 2DDAA 3KX2A 3H0DA 2V1XA 1J0RA 4KJZA 3HRUA 2LY9A 2F4OB 2EIJH 4ZH4F 3K4KA 1OR7A 2DK8A 1ZN2A 2QQ8A 1R22A 2F5DA 3ZN1A 2HDWA 4XRSA 1WHUA 1B8IB 1MIJA 2VPLA 3SHFA 4XLEA 2CRGA 4E7ZA 2XB0X 1KQ8A 3HSRA 3OIQA 2X6WA 1PUFB 1GXPA 1B1BA 4Z2YA 4BY7J 3VYSB 3HYIA 1BOAA 2XPVA 1FX7A 5KNLA 3OIOA 1UCRA 2EFNA 3CJQB 3QPSA 1M1EB 2GBYA 4CDGA 1UJ8A 2ME6A 2VBZA 3KP4A 2Y0SA 2MLKA 1YTYA 3O8HA 4JX4A 4QSHA 5FD5A 2GOXB 3CCMI 1VFCA 3HIFA 1JE8A 2J5OA 3LSTA 2VQGA 4S04A 2V9VA 2LVSA 4B3XA 2A6EF 1ZTRA 3IAM2 3S1RJ 4CGZA 1G2HA 2B9SA 4KN7X 2VC1A 1G3SA 1TBXA 2YX4A 4CYDA 3LSPA 1E0EA 1U9NA 2LTPA 2OQRA 3DBRB 3HOUJ 1Y8RB 2PBIA 3EUAA 4DNCA 2Y48A 4X1EA 3CF2A 2VJJA 2EWNA 3SXYA 2E5ZA 3SEZA 2OUMA 4CCLA 4M72A 4U7DA 4I76A 3ZQCA 3OYJA 1NG6A 3KP5A 5HS9A 2LKSA 4A93J 1D1CA 1WCMJ 2HQRA 4PJJA 3H9JA 2IA2A 5CLSA 3K9TA 1T08B 4A0YA 1YHQI 3HRMA 2ESHA 3O6BB 3G4SI 1TP4A 2DMQA 2G9WA 2YS9A 1OR7C 3QPLA 5DV5A 2RC4A 1IO2A 2X1CA 3H9GA 3H0GJ 2WV1A 2CQXA 3JRAA 2VOPA 1DGWY 1X3WB 3CJNA 3C3WA 3VDXA 1JGSA 3ABKH 3WGHA 1PJRA 4LG0A 2GIZA 5B66C 1I39A 2XRLA 4M9XA 1YI2I 3RTRA 3K2ZA 2L4MA 3HGGA 4BDYA 1U9OA 1SANA 3NRVA 5FFZA 2O03A 1E3OC 3DQVC 1HKQA 3DXJF 5EYRA 3QU3A 2LRDA 3AKZA 2GLOA 2CJJA 3HRSA 4XLPF 2FEZA 3FXQA 4ZYAA 3LSRA 1N77A 3Q9SA 3C1DA 4R8HA 2LY1A 3VYUB 4OOIA 5DM6F 2L9SA 2Q2EA 3I59A 2W00A 3I53A 5ILUA 5J47A 3E6BA 1Z6TA 1YX3A 2L4AA 1K7AA 2MABA 1ZLJA 4A5MA 5FKOA 2JMWA 4B09A 4ESBA 4CHUA 3BJOA 3BROA 2COBA 5EEGA 2PQ8A 3GTOJ 2ZMEC 4PSXA 1R9TJ 3PQKA 5DS9A 2DTZA 1OCPA 2E1OA 1MNMC 1I5ZA 2ECCA 1JUPA 2NAZA 3I54A 4LG3A 4BQOA 3OS0A 1SFEA 2X6XA 3EPZA 5E1WA 5HODA 4MLOA 2QLZA 2MYSA 4GYIA 3K4JA 1S7AA 5CKTA 1K4TA 1G59A 1MBFA 2VT2A 2OZ6A 4HQEA 3FX3A 4NHJA 4KMFA 5E8IA 2R7RA 1Z7LA 3HPHA 1ONVA 2LMDA 4I09A 1FY7A 3TO6A 2WA0A 1B72B 2F4IA 3IL2A 2XAGA 2KRCA 4AIKA 4BACA 1B8IA 3F8FA 2IGMA 4E7HA 2K7LA 3NWSA 1YFHA 1DQUA 2GA1A 4G6QA 3CUQB 3GFMA 4A3IJ 2DPDA 2ETHA 2JSPA 2Y75A 1YE9A 2R7DA 4LJZF 4M6YA 5LGNA 3S1MJ 3ISPA 5E3NA 2Z5UA 2COMA 2N8GA 4YFXF 5GAEJ 3PJRA 3E97A 2HVQA 1W4MA 2GIVA 2DDBA 1ETQA 2G7UA 2E34A 2V1DA 1BL0A 1TT5B 1SMYF 2Y30A 3PL8A 2HNHA 4JYKA 2BBYA 4U88A 1P7JA 2V6EA 1BI0A 3DKYA 1VQ7I 1ORKA 1R49A 3F8CA 1CF7B 2K27A 2UWMA 3PIPF 2NOJB 4MFDA 3A01B 2ID6A 2FMLA 1HA8A 2V1NA 5J40A 4RAGA 3FKJA 5C3EJ 3GTQJ 1ETKA 4RLFA 3WTUC 2VKHA 1SD4A 1X1DA 3CC4I 1FSEA 3E0JB 5ED4A 1HDDC 2BHYA 1REPC 4Y15A 1P4WA 2BVLA 3CCQI 2KIFA 1R1UA 2ZNZA 3H1CA 1TT0A 1H0MA 4F55A 2RDPA 4A3KJ 3WU1B 2DXIA 4HNUA 2V1UA 3OYHA 1QVUA 3MFKA 2NRAC 3B73A 5HLGA 1R1VA 4L5JA 2MSYA 5LHHA 1XN7A 2EBIA 3C2HA 4HLYA 1N75A 1ETWA 4AVPA 1IXSB 4RB0A 4ANJA 4F91B 5EGOA 4XRMA 3S2WA 2IGOA 2R93J 4Y52J 2W85A 1JXSA 4F3QA 2HKOA 4HEA2 4MEYF 2CQ7A 3CMYA 2KP6A 2KLOA 2X4HA 2L54A 4D9JA 2DA5A 2WAQA 3EUHC 3U1KA 2DPUA 1F9NA 3V8JA 1MBGA 4M74A 1IN7A 1ZARA 2GXAA 4Y33A 2DFEA 3ERED 5JVTA 3CLOA 4UVAA 3CCVI 3HM5A 4CUGA 3BTCA 2DT5A 5FKMA 2RQQA 3O2PE 3P7NA 3BR5A 4CCJA 3CCEI 1NG7A 2W25A 4CCKA 2IS6A 2I8DA 3KP7A 1RUNA 2QENA 1S9HA 4C3IJ 2EFQA 3T8RA 4FISA 3V7RA 3E6CC 3FBNB 3QWLA 1AKHA 4KFCA 4L0YB 1F4KA 3HG9A 4L0ZB 3V42A 2LBFA 2OCEA 3I4NJ 3HZJA 1TQIA 3DKXA 1IF1A 1BI1A 2KPMA 4G9YA 1ETYA 5M3FJ 3TL4X 5CYVA 1J09A 3DEUA 4RDUA 2NVXJ 4IQJA 2CYYA 3DU5A 3DF8A 1SD5A 5J4VA 5ILVA 4OINF 4BJ6C 1TNTA 3PFYA 1H89C 3J81Z 1Z77A 4BQNA 2QYOA 1JT0A 1UHSA 2ELHA 4V19K 2VXZA 5BQTA 2XF6A 1T56A 1QU3A 4PDKA 4OMZA 2WB1A 3VYTB 5E18F 2F48A 2VPRA 1FSHA 2MW8A 3OOPA 2YU3A 1TWFJ 5L3BA 1F36A 1DU0A 1EH7A 2W1OA 1WGXA 3KEYA 1UG0A 2X6YA 2MA3A 2DI3A 3GLLA 3L9FA 3C2BA 2LOOA 2F5VA 3JTHA 3QP6A 3G1OA 1JJ6C 2CV0A 3CUQA 4QTRA 2KJCA 1EH6A 4R1HA 4XOPA 2H09A 2K9QA 2FQ4A 2H6CA 4BY1J 3HEFA 1W5TA 5KAIC 4BBRJ 3CJTB 3FM3A 4XKVA 3BR2A 3GEZA 2EFOA 2AQFA 1ZR4A 4ENKA 2RQPA 1KU3A 3DU6A 4HSTA 4YFKF 5JFRA 3E7LA 2XSDC 1CF7A 3KZZA 4UB6C 3V7SA 2NS8A 3K4BA 3W6VA 1JTXA 1FOXA 4M6XA 2D2WA 1BIBA 4HBLA 2F2EA 3ZQFA 1OQYA 3GFJA 3BTIA 3TW6A 2PFBA 2R3SA 1GT0C 3L09A 4HSRA 3Q3SA 3OYDA 1DDNA 1I6HJ 3RKQA 4V2FA 3RCOA 2AHQA 2QKMB 2WV0A 3OL3A 1FP1D 4II3A 5FKKA 3KZIC 4YRVA 5FFXA 3AFHA 1ACIA 2A6HF 5GTHC 1D1AA 3CDLA 2VODA 2XIGA 1Z21A 2M0MA 3RKXA 2CW7A 2FXAA 2CFXA 2K02A 2O5RA 5EJCA 4KITB 4CICA 3B02A 5LEJA 4UV9A 2HOAA 1MDMB 2R7VA 1MBKA 3MZ8A 1T0FA 5GPAA 1WJCA 2STWA 4FCYA 4L9TA 3EUKL 5ICGA 5AONA 3EQLF 1FJLA 3PO2J 3QPTA 2CFOA 2KIQA 3R0AA 1D5YA 3IKVA 3IH2A 4BH9A 1YW9A 1JUSA 1LEAA 2XAJA 1BOBA 1MBEA 2HKXA 4KT6A 4XL9A 3DWLE 3P9KA 2PLYA 1QQIA 2KZVA 3FWEA 4S0HB 2DAOA 1NH3A 2IVMA 4KT5C 3LAPA 2ZJ2A 4GYGA 2QWWA 2JPCA 2FE3A 4UHTA 1Z7UA 1KQ0A 2L0KA 2EH3A 5FRNA 3A2KA 1KU7A 1ZG3A 1TQPA 2Z3YA 1W5CC 4JOMA 5DYMA 4ZDOA 3M9AA 1FMVA 4X0GA 3QYEA 1K4SA 3A0HC 4CZCA 3EYYA 1Z67A 1FNNA 2DMTA 2HDDA 2IA1A 3PUBA 3Q0WA 2X1DA 1JKQC 4E6KG 1UHWA 1B4AA 5J1RA 2LYCA 1LDJA 4ZYHA 5DD4A 4HNTA 1LNWA 1TNSA 5LD2C 1WH7A 2CV2A 3JRDA 4DBRA 3HKZN 5TJJA 3WHBA 5F27A 3AAFA 2XAQA 2R7QA 2JUGA 2F6CA 2FX0A 3W3CA 3V8KA 1T2KA 4G94A 1QPMA 3GTPJ 3K2AA 1D3YA 2F5FA 2BZTA 3GF2A 4WX9A 3ERMA 1WQ2A 2BOLA 5DUKA 3RKYA 2ZJRF 3MZHA 4EJWA 3F6VA 4QPQA 1BI2A 5GAHJ 2ZXIA 5L3EA 2X6OA 4DZJA 2ZFWA 1FBUA 1D5VA 3CUOA 3OSFA 5JI6A 1QA6A 1J59A 3F6OA 3F0CA 2ZSIB 4HOBA 1OCOH 3HC7A 3KYLA 2A5YB 2DT6A 2Z16A 3G6EI 3GLXA 1YW8A 2HVRA 4HRIA 1LDKB 5EEHA 1FTZA 4AWXB 1DGRM 4KN4X 1U78A 2LK2A 3SQNA 3W6KB 5LBQA 3BQZA 4ON0A 1XC5A 5D5UB 2KMUA 3LMMA 3L2QA 3WHCA 3S8PA 1P9QC 4LOCA 4I0BA 3ABTA 4G7ZF 2L7FP 2M34A 2BW3B 4LIUA 5CVUA 5D8LB 5J1YA 4A3FJ 1BW5A 1B9NA 2ZMEB 2V26A 4EGZA 3PM1A 3RQIA 2HOEA 4Y17A 2LREA 4MNUA 3J81K 4PCQA 1A35A 4UUSB 1BIAA 2KQRA 2XHKA 1PYVA 3BT9A 5CVJA 1ZG1A 4HF2A 1LE8A 3JCUC 4MEXF 1DP7P 4XN3A 2H1KA 2XB5A 3GTMJ 1ON2A 2NYXA 3CCUI 3DTEA 1V5GA 4LITA 2RV8A 1O4XA 2EIKH 1GV2A 5LFAA 2JTVA 1HXDA 1WJAA 2DQRA 4AC0A 2L01A 5D4RA 5TGTA 4AIJA 4KUMA 1U3EM 3ABLH 2CUFA 3FXOA 3CO6C 3GO5A 3OY9A 2M45A 2IA0A 4EQQA 2JVGA 1SC7A 2EFWA 1MDMA 1P4XA 3BC8A 2A68F 4G7HF 3MD2A 2MH9A 3JREA 2PJRB 3M1EA 1GVDA 2YPRA 3KLOA 4CH7A 2WAFA 3M1CA 3PQJA 4J01A 3ZQIA 1KGSA 3S3OA 2HEOA 3HHGA 1ZGAA 4O5VA 3ZQQA 4ASNA 4LIVA 2VASA 2BGCA 3I5UA 3IRRA 1HW1A 3RPUA 2Y69H 1BC7C 2O0YA 3ULQB 3HSEA 2JWTA 4BEHA 4YIFA 4FETA 2RN7A 1VQMI 1HW2A 4L9JA 1IV8A 2NVYJ 1Q1HA 5LHIA 1D8JA 2F5EA 1Z6RA 4RB1A 2M1BA 3HUGB 3A0BC 5HDGA 3ZMVA 1RKTA 1JKOC 1KONA 2VB6A 4KIFA 3J7AY 2VJIA 2K4BA 5FGMA 1FZPB 2HZDA 3L2UA 3L2CA 2KDOA 1A6IA 1HBXG 1U5TA 3IAS2 1IZ1A 2ECBA 2RGVA 4IRHA 2Y9ZA 3S1QJ 2L2OA 1YX5A 1ETXA 1IJWC 1QGPA 4Y13A 3CQZJ 2B7EA 2PN6A 1XGOA 3TP0A 2LF7A 2MD5A 3ZQLA 1HSTA 3BJ6A 4CO8A 4BDZA 2VL8A 2VC0A 2L7KA 1YIOA 4ZZDA 1RPWA 2R7OA 1Y56A 1O3QA 2D1VA 3HL2A 5GTIC 1FOYA 2FMYA 2K9MA 4OIRF 3K4MA 4G6TB 2R7XA 2HR3A 4H4KC 1W7PD 5JLXA 3OR2C 3FHZA 3IH3A 3R0JA 3KLNA 2UXNA 3BLYA 1QVTA 4EJTA 1OJLA 1OYWA 1SVOA 2P0WA 3WU2C 4CYCB 2V4JC 2TRTA 3DPUA 1IG7A 1R00A 2DCEA 5JHFA 4HW0A 3GWZA 2QBYB 3HOWJ 5LRSA 2R5YB 4KNYA 4DZPA 2L02A 4HLXA 4GCVA 2F4MB 4V2GA 2XC7A 2P7VB 5FB2A 1TWGJ 3KZYA 1ITYA 2AQEA 3WG9A 4ZDPA 4ENMA 2MH2A 4DIQA 2IS4A 1XDSA 2RREA 2QA4I 1D0XA 1WJBA 4EJVA 5CQEA 1PP7U 1VQ8I 1XPXA 1DPUA 2M4GA 3Q0UA 2EA2A 4ENJA 1F1ZA 2BW3A 2C6YA 2E2JJ 4F52A 4PK4A 3V8LA 4XN0A 2E19A 2O9LA 2X9DA 4A0XA 1TC3C 5CQGA 4Q5SF 3W2AA 1U0JA 3BOQA 2DT7B 1SMTA 1IRGA 1BA5A 1F5TA 3A1YA 1IXCA 5F64A 1CGPA 4BXXJ 1P2FA 1R71A 1XG1A 3LA2A 1MMSA 4RBOA 3HOTA 2IGKA 3L2RA 3VFZA 2OF7A 4F93B 2R92J 2D5VA 2DJIA 2VUMJ 4ZJZA 1YJNI 4UXNA 5HNHA 1FBSA 1ZQ3P 5D5XB 2ZXJA 5KK1A 2HVSA 3DPTA 1LFPA 2B0LA 1P6RA 3HOZJ 2Q0OA 4D5FA 3Q0VA 3PIOF 3ZOBA 2QZ8A 5LHGA 4BE0A 5F08A 5F0FA 2JPBA 3TKYA 2H8RA 3LA3A 1W7PA 1A04A 4RMNA 3LSKA 1HOMA 2E7XA 2CSOA 2QSHX 3OIPA 4LB5A 2HTSA 3H35A 3P5JA 1L0OC 3GFIA 4Q48A 4NC8A 2W7NA 3CD6I 2IAIA 5J1UA 3N97A 2E2HJ 2A07F 2FBKA 3GW2A 2E1MB 2STTA 5ICFA 3LFUA 1T38A 1EKEA 2A3SA 3K1PA 2NVUB 3RYPA 4B4CA 4B43A 2BVMA 1YS6A 4KIBA 4FTHA 1YS7A 3TOAA 1MNEA 5DD8A 2FRHA 1GVJA 4IRIA 2LH9A 2IT0A 1QO0D 3G3ZA 1CQTA 1O7LA 3U21A 4CSWA 3PSFA 4I7HA 1SD7A 1XMXA 2LF8A 4UVBA 2PX9A 2AO9A 1ZAOA 3AL0B 3TO9A 4AU7A 2GWRA 3ASNH 3GTGJ 4RAYA 4L5EA 1J5YA 3CMAI 2Z33A 3CDIA 2K4JA 1VTNC 1XSXA 4L18B 3LWFA 1ZRFA 1HW5A 4PSWA 4PJ0C 1B6AA 2HGCA 3FK7A 3CCRI 1ZGWA 2DOAA 3LOCA 2D45A 1HF0A 1H9GA 1T98A 2M4KA 2DODA 1OISA 2WBMA 1D0YA 5CVIA 4WF2A 2PMZN 2OV7A 1XDUA 2TDXA 4FHTA 2XV4S 4E70A 5DDGA 3Q5FA 2PI0A 1VQOI 2GXGA 2R7ZJ 2PMHA 3LNQA 1PUFA 1BC8C 5IY5H 1PUEE 3A03A 3OYFA 2W24A 5LLQA 4W97A 4XLNF 3WTWC 3CTAA 4YELA 1YIJI 4PZJA 4PJMA 5DCMB 4YIIA 4A3DJ 1MKMA 3ABMH 3RZOJ 1X1AA 2ZSHB 5HS8A 3UKGA 3OSGA 3OYEA 2BEOA 1JT6A 3KPHA 1ENHA 1GHCA 2E60A 2JVHA 5A2QZ 1ERDA 4ENNA 4P9FA 1YRNB 4DYQA 2YU9J 2EK5A 1FC3A 2QBYA 3C18A 2HS5A 3D0SA 4OAZA 1I3AA 2DJNA 3CF5F 2K85A 3S32A 4A3EJ 4RGXA 3OS1A 3PSIA 2WWYA 1FIPA 1OMIA 4L9NA 3L2VA 2JRMA 2IPQX 2ZKZA 4LLLA 3BR0A 2W48A 1Z91A 2VONA 4ZYDA 3S3NA 2JRTA 4MQ9F 3BPVA 4CCOA 3HPGA 1IUYA 3RI4A 2DQLA 2XGXA 3E6DA 2LFBA 5EZGA 4WXCA 4KDPA 4LMYA 2KFDA 3JRBA 1A5JA 2VBYA 2WAEA 3LA7A 4C3HJ 3R6SA 1W36D 3TO7A 3L7WA 3DP7A 4XICA 5FJ8J 1R5GA 4IKFA 1WZ2A 3ABUA 2GOMA 4C9YA 3OOUA 1KU9A 4J00A 3R4KA 4IZZA 4BJTA 2DYSH 3HKZA 3V4GA 3KP2A 3OYCA 3LFKA 5JVGF 2W57A 1X3UA 4HZFA 2BY1A 4PJNA 4A12A 3CC7I 4IJAA 4A3GJ 1KYZA 1XMAA 4M6VA 1KQ9A 1GDTA 3J7YJ 2HYGD 2VIXA 3KEOA 1NK2P 3S1NJ 4FX0A 4MIMA 1WI3A 3GTLJ 4I0AA 1ZELA 3FXLA 2VKEA 5F04A 4P55A 2KDZA 2JA5J 1NHAA 1FIAA 4IOAF 2DO7A 2EZHA 2ZCWA 2M3AA 5F6FA 3FHNA 2MD0A 3BCAA 4BHBA 3OYIA 4D7MA 3E5QA 2E2IJ 5B1BH 3O3KA 3FXJA 4IQ4A 1WI9A 4G12A 5K7FA 1XSVA 4M3BA 4O3MA 4DYCA 1ZRCA 1UFMA 3KP3A 1YJWI 4ESJA 4EATA 2QM3A 5B3SH 4R79A 3T1BA 4H0EA 3G2BA 4TV7A 3ML6A 3HDDA 4XNFA 1Z05A 3L2WA 3GYHX 3BR1A 2ZJPF 2HXIA 2BY3A 4NQWB 1UB9A 3F3XA 4NDLA 5E3OA 3JTGA 2R5ZB 3WTYC 5HOOA 2E71A 1J7KA 4N4NB 5E79C 4DBQA 3R60A 3OWTA 3VSLA 4M71A 5IOZA 3UNGC 2EPFA 4Q47A 3VOEA 3X2QH 4XK4A 1B72A 1K79A 3CESA 1UHMA 4BNCA 1WJDA 3DBLB 2P7CB 5L3GA 3DFGA 1H88C 3HTUA 2L5QA 5HLIA 2M7AA 1IV6A 3N4MA 2XPWA 3RKWA 1OCRH 1O3RA 1TLHB 3QPHA 4YG2F 4I99C 4I98B 4XKBA 1SFOJ 3FMSA 3JRFA 3PNVA 2E7WA 5KHDA 2FNAA 2FNPA 4HV6A 2O6GE 2HQAA 1GLNA 5DCMA 5E8GA 5TRDA 2A6TA 3RZDJ 2RNJA 3ECOA 4LLGF 1YG2A 3ZQGA 1LUJB 3LAJA 4XKCA 2DTRA 1E17A 3A01A 1EF4A 1ZR2A 2VLAA 4HPQA 3KYDB 3H92A 2JA2A 3FXUA 4P1WA 2VBXA 3MCZA 2EQRA 3ESWB 3S15J 5ICEA 1IN5A 5D5VB 2DU9A 5F0CA 4RGSA 4AUXA 1VQPI 2VXDA 5B1AH 1WVRA 2A5WA 2PMUA 3ECHA 4RA2A 4E7LA 1IRZA 4E7SA 5FKLA 3A02A 1MH4A 5D8KB 4EEFG 3SFZA 1OCCH 3H3UA 3K69A 4LK0F 1K78B 1G4DA 3B6CA 4A0ZA 1ZH5A 3CDHA 4XRFA 1Y1WJ 2BXZA 2K9NA 3QRFF 1R5ID 4E4HA 2P5VA 5M5XJ 1IN8A 1JGGA 1ZGJA 1UELB 2MBFA 3CP2A 3H3VK 1W36C 2CMPA 3BG7A 4BAYA 4JX5A 1S7OA 4AD9A 5H6QA 4A3LJ 3ROUA 2OQGA 4B3AA 1XCVA 1D8KA 5A2QK 3CUQC 2NVTJ 2ZB9A 1MW7A 5J4YA 4B8XA 1DU6A 3F8NA 1USSA 1R5HA 2CW8A 3GUDA 3KCCA 1JTYA 1X3ZB 1Y0NA 1QRYA 5E3MA 1V5FA 5K7ZA 2CU7A 2DK5A 2HPIA 3JRCA 1U8BA 2TCTA 3KEQA 4HYEA 4KYWA 1U8RA 4BS9A 1BR2A 1KU2A 1FBQA 3IH4A 1MGTA 1HC8A 2W82A 2CUEA 2OZUA 3CJRB 2VJ4A 3SZPA 2F5CA 3FIWA 2L7MP 2Z9OA 3SDBA 1X1PA 2M8GX 4XQFA 1R6RA 1IW7F 3WE2A 3WGGA 5E1ZB 4XIDA 1SVLA 3FXKA 4U0WA 4ZYEA 5DTDA 1HSJA 3MKWB 1G3TA 1I50J 4BQAA 5HLTA 2DA4A 3EYIA 5BPIA 3WTVC 1EH8A 2ELKA 3K4LA 1Y0UA 2BYVE 2BXYA 3MKLA 5ILSA 4DYRA 5C4XJ 4HG2A 1AU7A 5LRRA 1G3YA 3GMEA 2KISA 4LD5A 3ZCOA 1A6QA 3E5UA 2BY0A 2LSOA 2MC3A 2CV1A 2O8KA 3DTIA 2WC2A 1ZHFA 2V7FA 2Q8KA 3F72A 5LGTA 2R5ZA 2KIUA 4BKXA 1T0FC 2RVCA 5GP9A 4RAZA 2NS0A 2R7SA 3HBLA 5E20A 1JHHA 3KE2A 3RPUD 4FE7A 1U6GA 5IP7J 4XMYA 4AIHA 2V9KA 2GQQA 3L1PA 1VQ5I 1OKRA 3VEPA 5CVVA 4KA4A 1RESA 1TW2A 4DQ2A 3UR3C 1UAAA 3KYCB 4CA0A 1WJ5A 1E3HA 1LPQA 1S5LC 3ONQA 2EIMH 4C2MJ 5F1JA 2OCCH 2M0CA 2VI6A 3ELKA 4P96A 3WG7H 5BMZA 4KICA 4XR6A 2GM4A 5D6EA 4IVNA 2XDVA 1BR1A 1POGA 2HYFA 2M8EA 1MJ9A 2ME0A 2QUFA 3QOPA 4U0YA 2VBWA 1YW7A 3WTZA 1FYMA 5B5EC 3RQ4A 4BUPA 4HX7A 1TW3A 4PFOA 4D1QA 1IDZA 3QAHA 4JK1X 2CWEA 5FRMA 2DFIA 4MQVA 4ZDLA 4PUSA 2HYJA 3OR1C 4LGWA 1MNDA 2JUCA 1S3JA 1S8NA 3U1DA 2JZYA 3BTLA 3IWZA 3TP3A 3NEUA 5FLVA 1Z9CA 3T5XA 3K0LA 5FLXZ 9ANTA 1TZLA 4IL6C 2Y0MA 1WSUA 1K78A 2ELJA 2K86A 3S17J 4JQFA 2LR8A 3VYRB 4S05A 4FE4A 3S2DJ 3I64A 3P9IA 2IEKA 2K9SA 3IWFA 5FROA 2IS2A 1WKMA 2QGUA 1WFXA 2DN0A 3KIOA 4F7ZA 3SYTA 2XF5A 3FZVA 3I3LA 3T0YA 1YO5C 4LG0B 3PFIA 2Y2ZA 2LC2A 1V4RA 2FOWA 3HHHA 4XLCA 1RZ4A 4IPAA 2CQNA 2PMZA 2PG4A 1P92A 2XAUA 2DFFA 3D5RC 1RR8C 1SFKA 4M3FA 1FP2A 3QYBA 3IC7A 3HTSB 2LDUA 3VB2A 5CJ9A 1JJ8C 4IEJA 2Q1ZB 3PNYA 1QNTA 2Q2EB 2UXXA 2EILH 4PJLA 2IRFG 4EM0B 2VE9A 1RKWA 1RC9A 3F9KA 4UUVA 1FWZA 3ZPLA 1R23A 4XORA 4IHTA 1AWCA 5HDKA 5IP6A 3HJEA 1J75A 1D1BA 3J80Z 5DCFA 3QQAA 1STZA 1U2WA 3JW4A 2MFZA 2M87A 3OYBA 4B44A 4OWRB 2LKXA 3BZCA 3BDDA 2K3PA 3IV5A 1O3TA 4JBAA 1LDDA 2WY7Q 2MC4A 1USTA 4AIDA 3EETA 4D0PA 1FEXA 1S6LA 1LKXA 5FD6A 3FXRA 4GXOA 4EV0A 4XLAA 1MSEC 4HF0A 2FOKA 2E1CA 5GPCA 2HXOA 4IO9F 3BY6A 4CCMA 1SAXA 3S16J 2EZLA 1Z0XA 4A6DA 3GTKJ 1ODDA 3LSHA 3M3YJ 3AG2H 2FQ3A 3DCFA 4MGRA 5H2FC 3I58A 1K83J 2NVQJ 1KYWA 1RNLA 3GVAA 4OIOF 2EINH 5HS7A 1TWCJ 3LQQA 3Q9VA 2XRNA 3IKTA 1R4NB 1HQCA 3E3VA
chains in the Genus database with same CATH topology
2OD5A 4IRGA 1B9MA 1T39A 2Z99A 2JT1A 2BE5F 5J8CA 3WU0A 2KJBA 2FBHA 5IT9Z 2ZMEA 1U5TC 4NB5A 4GGGA 4RGUA 3ZN0A 4EJOA 4HAMA 1W5SA 1G6NA 3GFLA 1XCBA 2CGPA 4ESFA 4I2OA 2V6CA 1LVAA 4LLNA 2NNYA 2P6SA 2UZKA 4U0VA 3RIRA 1XSDA 5BS6A 2DW4A 2EV5A 5HDNA 3ZMUA 1LEBA 1E2XA 2FF4A 2XASA 4A5NA 4IXAA 4M73A 2KRFA 5L3DA 3F23A 2KKOA 1TTYA 3LQRA 2EA4A 1ZLKA 1XGNA 3HUGA 4UVCA 2GXBA 2VE8A 2HZTA 2P5LC 3DV8A 1PDNC 1ZREA 1ULYA 1YLFA 1SFXA 4LFUA 1OPCA 4OIPF 4G8XA 3RYRA 5FLXK 2FU4A 1QBJA 4BXUA 3L00A 5J6XA 3CO7C 5L3CA 2RKHA 3BP8A 2VT3A 2EV6A 4N9IA 2OAZA 5K5QA 4XSXF 4KIGA 1PP8F 1R58A 1IN4A 3I0TA 1HKTA 3FM5A 2ISZA 2PJPA 2MLGA 3QP5A 4O6JA 3GZ6A 2GAUA 1IRFA 4MTEA 2XAFA 3JSPA 5H6RA 1FYLA 1BJAA 2FA5A 1T6SA 2P8TA 3TDUC 4EMSA 2NNNA 3COAC 3F8BA 2M30A 2WTEA 3EUHA 2HTJA 3TGNA 3J80K 1RI7A 1RUOA 1XD7A 5J8FA 4HX4A 2A69F 2ESNA 5K1YA 1MJAA 3HSFA 1XGSA 1ON1A 1DPRA 2ACJA 3WTTC 3ZMTA 2GZWA 3J7AO 4MHGA 2EB7A 1J2XA 3GX4X 5BOXA 3WTXC 2IP2A 4OU0A 4RGRA 4YFNF 1HKSA 3MQ0A 4WXDA 4HX8A 1R36A 1BN5A 3F8MA 1FLIA 4M9SA 2DLLA 2EV0A 1KA8A 2ZO4A 2E1NA 2VN2A 3RDIA 3MAJA 4I01A 4ZZLA 1FPQA 3C7JA 4BYYA 1YQAA 2XKPA 5IT9K 3FMRA 3KP6A 4QLCU 2H27A 5AIPA 2HQNA 3JSOA 3OV8A 4A6EA 2ISYA 1EV7A 2PEXA 3U2RA 4XBFA 4WWCA 3P9CA 4HV5A 4K2EA 3WTSC 2CO5A 4HA8A 1WRJA 2P5KA 1P4AA 3HRTA 4FX4A 5DUIA 4HDVA 1AOYA 3I4PA 2D1HA 2JSCA 5ERIA 3U9GA 3MWMA 4RS8A 1WWXA 3W6JB 1LJ9A 2M5WA 5FO5A 3WODF 5LEKA 3ZQ7A 4PGHA 1QZZA 2OA4A 4G7OF 2YR2A 2EJRA 1J9IA 5CVRA 5AIQA 3R61A 4EM2A 5K5OA 4QWQA 3WGIA 1SFUA 4P5OA 2P4WA 3E6MA 1MJBA 1OYYA 5LGUA 4LB6B 1IN6A 2QQAA 5D6FA 4L9VA 3EDPA 5HVQC 1L3LA 4HF1A 3TDZC 3IRQA 3TQNA 3ZP5A 4GO1A 1OYIA 2O3FA 3FMQA 2BV6A 2HDCA 4RB3C 4WCGA 3JAMZ 4WK8F 4L5IA 3F21A 3RPQA 1YYVA 4EJUA 2HWVA 4FT8A 3KFWX 2QQ9A 3V7CA 3T8TA 1I27A 5L3FA 4BHPA 1JHFA 2O8XA 2AXLA 4UNOA 2LNBA 4HDUA 2GA2A 6PAXA 2AS5F 2OU2A 1I1SA 1G3WA 4ETSA 5ICCA 4WXHA 2EFPA 4KMUX 3D5LA 1I1GA 1XB4A 1BBYA 2XROA 1IAWA 3TOBA 1O7FA 3BZ6A 1V3FA 4OMYA 1U5TB 2P6TA 4RB2C 1XMKA 2QVOA 4OIQF 1ZG5A 1XGMA 4CXFA 5D5WB 5H20A 4NQWA 2IW5A 3GXOA 3HOSA 3VODA 3SZTA 5KVRA 3MZYA 1I6XA 4A2UA 4Q4ZF 5IT3A 1TQMA 3H3ZA 1LB2A 4N0BA 2XAHA 2FSWA 3K1NA 1C0WA 2QQBA 3NQOA 2X0LA 1O3SA 3QU6A 4I02A 1R1TA 2VOOA 5JR3A 2A61A 4UV8A 2W84A 1SD6A 1FYKA 4EM1A 3BPXA 2IJLA 1ZYRF 4CZZA 4EVIA 1R7JA 1QZYA 2O61A 2J5PA 2CG4A 1K6OA 2XKOA 2HFHA 2FBIA 3MEXA 1H9TA 2ADUA 4G6DA 3I71A 2YX7A 3IHUA 2YSRA 4N9HA 2ZBKA 4HQMA 2XUBA 4BHCA 4U7BA 3BWGA 3ZMZA 4ZYGA 2LKPA 5F1RA 4IF4A 2OBPA 4PGGA 3M7GA 4IHSA 3M8EA 2CW0F 2L3DA 3DPLC 2V79A 3DKWA 1FT9A 3WE3A 4P9UA 4EGYA 1BI3A 1W7PB 5E1XA 2DBBA 3I59B 3F22A 2H94A 2R7FA 2XVCA 1ZRDA 5K5RA 1S29A 3FF5A 3RJPA 1MD0A 4MTDA 3KETA 1O57A 1DUXC 5HLHA 5D4SA 1GXQA 2H6BA 3ZMSA 2G7HA 3BJAA 3K1MA 1IXRC 1Z1DA 5JHUA 3E5XA 1BM9A 1B59A 3JAMK 5E17F 4M9ZA 5DEQA 3GZ5A 3G73A 4LK1F 3REOA 3M8FA 3ZMDA 1MZBA 2CQKA 1LQ1A 1RIOH 1FOKA 2ZNYA 4XSZF 2KIMA 5BPDA 2V1XA 1J0RA 3HRUA 4ZH4F 1OR7A 2DK8A 1ZN2A 1R22A 2F5DA 3ZN1A 3SHFA 1KQ8A 3HSRA 1GXPA 1B1BA 4Z2YA 3HYIA 1BOAA 1FX7A 1UCRA 2EFNA 4CDGA 2VBZA 3KP4A 1YTYA 2MLKA 5FD5A 3HIFA 1JE8A 2J5OA 3LSTA 4S04A 2V9VA 2A6EF 4CGZA 4KN7X 2VC1A 1G3SA 1TBXA 2YX4A 4CYDA 2OQRA 2PBIA 4DNCA 2Y48A 3SXYA 2EWNA 4U7DA 4M72A 3KP5A 5HS9A 2HQRA 2IA2A 5CLSA 3K9TA 4A0YA 3HRMA 2ESHA 3O6BB 2G9WA 5DV5A 2RC4A 2VOPA 3CJNA 3C3WA 1JGSA 3WGHA 4LG0A 4M9XA 3RTRA 3K2ZA 2L4MA 3NRVA 5FFZA 2O03A 3DQVC 1HKQA 3DXJF 3QU3A 3HRSA 4XLPF 2FEZA 3FXQA 3Q9SA 3C1DA 4R8HA 4OOIA 2Q2EA 3I59A 3I53A 5ILUA 3E6BA 1Z6TA 2L4AA 1K7AA 1ZLJA 4A5MA 4B09A 4ESBA 4CHUA 3BJOA 3BROA 5EEGA 2PQ8A 3PQKA 1I5ZA 2NAZA 3I54A 1SFEA 5E1WA 2QLZA 4GYIA 1S7AA 2VT2A 2OZ6A 4HQEA 3FX3A 4NHJA 4KMFA 5E8IA 1ONVA 4I09A 1FY7A 3TO6A 3IL2A 2XAGA 4AIKA 3F8FA 2K7LA 1YFHA 4G6QA 2GA1A 3CUQB 3GFMA 2DPDA 2ETHA 2Y75A 2R7DA 5LGNA 4LJZF 4M6YA 3ISPA 2Z5UA 2COMA 4YFXF 3E97A 1W4MA 2GIVA 2G7UA 2V1DA 1SMYF 2BBYA 4U88A 1BI0A 3F8CA 1CF7B 2K27A 2UWMA 2FMLA 3WTUC 1SD4A 1FSEA 5ED4A 1REPC 4Y15A 1P4WA 2KIFA 1R1UA 2ZNZA 1H0MA 2RDPA 3WU1B 2V1UA 3MFKA 2NRAC 3B73A 5HLGA 1R1VA 4L5JA 5LHHA 1XN7A 4HLYA 4AVPA 1IXSB 4RB0A 3S2WA 2W85A 1JXSA 2HKOA 4MEYF 2X4HA 2L54A 2DPUA 1F9NA 3V8JA 4M74A 1IN7A 1ZARA 3ERED 5JVTA 3CLOA 4UVAA 2DT5A 3O2PE 3P7NA 2W25A 3KP7A 1RUNA 2QENA 2EFQA 3T8RA 3V7RA 3E6CC 4KFCA 4L0YB 1F4KA 4L0ZB 1TQIA 1IF1A 1BI1A 4G9YA 5CYVA 3DEUA 2CYYA 3DF8A 1SD5A 5ILVA 4OINF 1TNTA 3J81Z 2QYOA 2ELHA 2VXZA 5BQTA 4PDKA 4OMZA 5E18F 1FSHA 3OOPA 2YU3A 5L3BA 1EH7A 2MA3A 2DI3A 3L9FA 3JTHA 3QP6A 3CUQA 2KJCA 1EH6A 4R1HA 2H09A 2H6CA 1W5TA 3FM3A 3GEZA 2EFOA 4ENKA 2RQPA 1KU3A 4YFKF 5JFRA 1CF7A 3KZZA 3V7SA 4M6XA 2D2WA 1BIBA 4HBLA 2F2EA 3GFJA 2PFBA 2R3SA 3L09A 1DDNA 2WV0A 1FP1D 5FFXA 2A6HF 2VODA 2XIGA 3RKXA 2FXAA 2CFXA 2K02A 4CICA 3B02A 5LEJA 4UV9A 1MDMB 1T0FA 2STWA 4L9TA 5ICGA 5AONA 3EQLF 3QPTA 3R0AA 3IKVA 4BH9A 1YW9A 2XAJA 1LEAA 2HKXA 3P9KA 2PLYA 1QQIA 3FWEA 2DAOA 2IVMA 4KT5C 3LAPA 2ZJ2A 4GYGA 2QWWA 2JPCA 2FE3A 4UHTA 1Z7UA 1KQ0A 1KU7A 1ZG3A 1TQPA 2Z3YA 5DYMA 3M9AA 3EYYA 1FNNA 2IA1A 1UHWA 1B4AA 1LDJA 4ZYHA 5DD4A 1LNWA 1TNSA 5TJJA 3AAFA 2XAQA 3V8KA 1T2KA 4G94A 1QPMA 1D3YA 2F5FA 3GF2A 4WX9A 1WQ2A 5DUKA 3RKYA 3MZHA 4EJWA 3F6VA 1BI2A 5L3EA 2ZFWA 1FBUA 1D5VA 3CUOA 5JI6A 1J59A 3F6OA 4HOBA 2A5YB 3GLXA 1YW8A 1LDKB 5EEHA 4AWXB 4KN4X 1U78A 3SQNA 3W6KB 5LBQA 4ON0A 5D5UB 4I0BA 3ABTA 4G7ZF 5CVUA 5D8LB 1B9NA 2ZMEB 4EGZA 2HOEA 4Y17A 4MNUA 3J81K 4PCQA 1BIAA 2XHKA 4HF2A 5CVJA 1ZG1A 4MEXF 1DP7P 1ON2A 2NYXA 2RV8A 2JTVA 1HXDA 2DQRA 2L01A 5D4RA 4AIJA 4KUMA 1U3EM 3CO6C 3GO5A 2M45A 2IA0A 4EQQA 1MDMA 2EFWA 1P4XA 2A68F 4G7HF 2MH9A 3M1EA 2YPRA 3KLOA 3PQJA 1KGSA 2HEOA 3HHGA 1ZGAA 4O5VA 4ASNA 2BGCA 3I5UA 3IRRA 1HW1A 3RPUA 1BC7C 2O0YA 3ULQB 3HSEA 4YIFA 2RN7A 1HW2A 4L9JA 5LHIA 1Q1HA 1D8JA 2F5EA 1Z6RA 4RB1A 2M1BA 5HDGA 3ZMVA 4KIFA 2K4BA 5FGMA 1FZPB 3L2CA 1HBXG 1U5TA 1IZ1A 2RGVA 4IRHA 1QGPA 4Y13A 2PN6A 1XGOA 2LF7A 2MD5A 1HSTA 3BJ6A 4CO8A 2VC0A 1YIOA 4ZZDA 1O3QA 2D1VA 2FMYA 4OIRF 2HR3A 1W7PD 3FHZA 3R0JA 3KLNA 2UXNA 4EJTA 1OYWA 1R00A 4HW0A 3GWZA 2QBYB 5LRSA 4KNYA 2L02A 4HLXA 4GCVA 2P7VB 5FB2A 3KZYA 3WG9A 4ENMA 2MH2A 1XDSA 4EJVA 1PP7U 1DPUA 2EA2A 4ENJA 1F1ZA 2C6YA 3V8LA 4A0XA 4Q5SF 3BOQA 1SMTA 1IRGA 1F5TA 1IXCA 5F64A 1CGPA 1P2FA 3LA2A 3HOTA 3VFZA 4UXNA 1FBSA 5D5XB 2ZXJA 5KK1A 3DPTA 2B0LA 1P6RA 2Q0OA 2QZ8A 5LHGA 2JPBA 3TKYA 3LA3A 1W7PA 1A04A 2E7XA 2CSOA 4LB5A 2HTSA 1L0OC 3GFIA 4Q48A 3N97A 2A07F 2FBKA 3GW2A 2STTA 5ICFA 1T38A 2A3SA 3K1PA 3RYPA 1YS6A 4KIBA 1YS7A 3TOAA 5DD8A 2FRHA 1GVJA 4IRIA 2IT0A 1QO0D 3G3ZA 1O7LA 4I7HA 1SD7A 2LF8A 4UVBA 1ZAOA 3TO9A 2GWRA 4RAYA 1J5YA 2Z33A 2K4JA 1VTNC 1XSXA 4L18B 3LWFA 1ZRFA 1HW5A 1B6AA 2HGCA 2D45A 1H9GA 1T98A 5CVIA 4WF2A 5DDGA 4E70A 1XDUA 2TDXA 4FHTA 2XV4S 3Q5FA 2PI0A 2GXGA 2PMHA 1BC8C 1PUEE 2W24A 5LLQA 4XLNF 3WTWC 3CTAA 4PZJA 5DCMB 4YIIA 1MKMA 5HS8A 2BEOA 1GHCA 5A2QZ 4ENNA 4P9FA 2EK5A 1FC3A 2QBYA 3C18A 2HS5A 3D0SA 4RGXA 2WWYA 1OMIA 4L9NA 2IPQX 2ZKZA 4LLLA 2VONA 1Z91A 4ZYDA 2JRTA 4MQ9F 3BPVA 1IUYA 3RI4A 2DQLA 2XGXA 3E6DA 4WXCA 4KDPA 4LMYA 2VBYA 3LA7A 3R6SA 3TO7A 3L7WA 3DP7A 1R5GA 3ABUA 1KU9A 3R4KA 3V4GA 3KP2A 3LFKA 2W57A 1X3UA 4HZFA 4A12A 4IJAA 1KYZA 1XMAA 1KQ9A 2HYGD 3KEOA 4FX0A 4I0AA 4P55A 1NHAA 2DO7A 2ZCWA 5F6FA 4BHBA 3E5QA 3O3KA 1WI9A 1XSVA 4O3MA 1ZRCA 1UFMA 3KP3A 4ESJA 2QM3A 4R79A 3T1BA 4H0EA 4TV7A 3ML6A 1Z05A 3GYHX 1UB9A 3F3XA 3JTGA 3WTYC 5HOOA 1J7KA 3R60A 4M71A 4Q47A 3VOEA 1K79A 1UHMA 4BNCA 2P7CB 5L3GA 3DFGA 3HTUA 5HLIA 3N4MA 3RKWA 1O3RA 1TLHB 3QPHA 4YG2F 4I98B 3FMSA 2E7WA 2FNAA 2FNPA 4HV6A 2O6GE 5DCMA 5E8GA 5TRDA 2RNJA 3ECOA 4LLGF 1YG2A 3LAJA 2DTRA 1E17A 3H92A 3FXUA 2VBXA 3MCZA 5ICEA 1IN5A 5D5VB 2DU9A 4RGSA 2PMUA 3ECHA 5D8KB 3SFZA 3H3UA 3K69A 4LK0F 1K78B 1G4DA 4A0ZA 1ZH5A 3CDHA 4XRFA 3QRFF 2P5VA 1IN8A 1ZGJA 2MBFA 4BAYA 1S7OA 4AD9A 5H6QA 3ROUA 2OQGA 1XCVA 1D8KA 5A2QK 3CUQC 4B8XA 3F8NA 1USSA 1R5HA 3GUDA 3KCCA 2DK5A 4KYWA 3KEQA 4HYEA 1U8RA 1KU2A 1FBQA 1MGTA 2OZUA 3SZPA 2F5CA 2Z9OA 1IW7F 3WE2A 3WGGA 5E1ZB 4U0WA 4ZYEA 1HSJA 1G3TA 4BQAA 3EYIA 5BPIA 3WTVC 1EH8A 1Y0UA 2BYVE 5ILSA 5LRRA 1G3YA 4LD5A 3E5UA 2LSOA 2MC3A 2WC2A 1ZHFA 2Q8KA 3F72A 5LGTA 2KIUA 2RVCA 4RAZA 2NS0A 5E20A 1JHHA 3KE2A 1U6GA 4AIHA 2GQQA 1OKRA 3VEPA 5CVVA 4KA4A 4DQ2A 1TW2A 3ELKA 4P96A 5BMZA 4KICA 5D6EA 4IVNA 2HYFA 2M8EA 1MJ9A 4U0YA 2QUFA 3QOPA 2VBWA 1YW7A 3WTZA 1FYMA 4HX7A 1TW3A 3QAHA 4JK1X 2CWEA 2DFIA 4MQVA 4LGWA 1S3JA 1S8NA 3U1DA 2JZYA 3IWZA 3NEUA 1Z9CA 3T5XA 3K0LA 5FLXZ 1WSUA 2Y0MA 1K78A 2K86A 4JQFA 4S05A 3I64A 3P9IA 3IWFA 1WKMA 4F7ZA 3FZVA 3T0YA 1YO5C 4LG0B 3PFIA 1V4RA 3HHHA 1RZ4A 4IPAA 2PG4A 1P92A 1FP2A 3IC7A 3HTSB 2LDUA 3VB2A 5CJ9A 1QNTA 2UXXA 2IRFG 4EM0B 2VE9A 4UUVA 1FWZA 3ZPLA 1R23A 4IHTA 1AWCA 5HDKA 1J75A 3J80Z 5DCFA 1STZA 1U2WA 3JW4A 2M87A 3BDDA 1O3TA 4JBAA 1LDDA 1USTA 3EETA 4D0PA 1S6LA 5FD6A 3FXRA 4GXOA 4EV0A 2E1CA 4HF0A 2FOKA 3BY6A 1SAXA 4A6DA 1ODDA 2FQ3A 4MGRA 3I58A 1KYWA 1RNLA 3GVAA 4OIOF 5HS7A 3LQQA 3Q9VA 2XRNA 3IKTA 1HQCA 3E3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OD5 A;  4IRG A;  1B9M A;  1T39 A;  2Z99 A;  2JT1 A;  2BE5 F;  5J8C A;  3WU0 A;  2KJB A;  2FBH A;  5IT9 Z;  2ZME A;  1U5T C;  4NB5 A;  4GGG A;  4RGU A;  3ZN0 A;  4EJO A;  4HAM A;  1W5S A;  1G6N A;  3GFL A;  1XCB A;  2CGP A;  4ESF A;  4I2O A;  2V6C A;  1LVA A;  4LLN A;  2NNY A;  2P6S A;  2UZK A;  4U0V A;  3RIR A;  1XSD A;  5BS6 A;  2DW4 A;  2EV5 A;  5HDN A;  3ZMU A;  1LEB A;  1E2X A;  2FF4 A;  2XAS A;  4A5N A;  4IXA A;  4M73 A;  2KRF A;  5L3D A;  3F23 A;  2KKO A;  1TTY A;  3LQR A;  2EA4 A;  1ZLK A;  1XGN A;  3HUG A;  4UVC A;  2GXB A;  2VE8 A;  2HZT A;  2P5L C;  3DV8 A;  1PDN C;  1ZRE A;  1ULY A;  1YLF A;  1SFX A;  4LFU A;  1OPC A;  4OIP F;  4G8X A;  3RYR A;  5FLX K;  2FU4 A;  1QBJ A;  4BXU A;  3L00 A;  5J6X A;  3CO7 C;  5L3C A;  2RKH A;  3BP8 A;  2VT3 A;  2EV6 A;  4N9I A;  2OAZ A;  5K5Q A;  4XSX F;  4KIG A;  1PP8 F;  1R58 A;  1IN4 A;  3I0T A;  1HKT A;  3FM5 A;  2ISZ A;  2PJP A;  2MLG A;  3QP5 A;  4O6J A;  3GZ6 A;  2GAU A;  1IRF A;  4MTE A;  2XAF A;  3JSP A;  5H6R A;  1FYL A;  1BJA A;  2FA5 A;  1T6S A;  2P8T A;  3TDU C;  4EMS A;  2NNN A;  3COA C;  3F8B A;  2M30 A;  2WTE A;  3EUH A;  2HTJ A;  3TGN A;  3J80 K;  1RI7 A;  1RUO A;  1XD7 A;  5J8F A;  4HX4 A;  2A69 F;  2ESN A;  5K1Y A;  1MJA A;  3HSF A;  1XGS A;  1ON1 A;  1DPR A;  2ACJ A;  3WTT C;  3ZMT A;  2GZW A;  3J7A O;  4MHG A;  2EB7 A;  1J2X A;  3GX4 X;  5BOX A;  3WTX C;  2IP2 A;  4OU0 A;  4RGR A;  4YFN F;  1HKS A;  3MQ0 A;  4WXD A;  4HX8 A;  1R36 A;  1BN5 A;  3F8M A;  1FLI A;  4M9S A;  2DLL A;  2EV0 A;  1KA8 A;  2ZO4 A;  2E1N A;  2VN2 A;  3RDI A;  3MAJ A;  4I01 A;  4ZZL A;  1FPQ A;  3C7J A;  4BYY A;  1YQA A;  2XKP A;  5IT9 K;  3FMR A;  3KP6 A;  4QLC U;  2H27 A;  5AIP A;  2HQN A;  3JSO A;  3OV8 A;  4A6E A;  2ISY A;  1EV7 A;  2PEX A;  3U2R A;  4XBF A;  4WWC A;  3P9C A;  4HV5 A;  4K2E A;  3WTS C;  2CO5 A;  4HA8 A;  1WRJ A;  2P5K A;  1P4A A;  3HRT A;  4FX4 A;  5DUI A;  4HDV A;  1AOY A;  3I4P A;  2D1H A;  2JSC A;  5ERI A;  3U9G A;  3MWM A;  4RS8 A;  1WWX A;  3W6J B;  1LJ9 A;  2M5W A;  5FO5 A;  3WOD F;  5LEK A;  3ZQ7 A;  4PGH A;  1QZZ A;  2OA4 A;  4G7O F;  2YR2 A;  2EJR A;  1J9I A;  5CVR A;  5AIQ A;  3R61 A;  4EM2 A;  5K5O A;  4QWQ A;  3WGI A;  1SFU A;  4P5O A;  2P4W A;  3E6M A;  1MJB A;  1OYY A;  5LGU A;  4LB6 B;  1IN6 A;  2QQA A;  5D6F A;  4L9V A;  3EDP A;  5HVQ C;  1L3L A;  4HF1 A;  3TDZ C;  3IRQ A;  3TQN A;  3ZP5 A;  4GO1 A;  1OYI A;  2O3F A;  3FMQ A;  2BV6 A;  2HDC A;  4RB3 C;  4WCG A;  3JAM Z;  4WK8 F;  4L5I A;  3F21 A;  3RPQ A;  1YYV A;  4EJU A;  2HWV A;  4FT8 A;  3KFW X;  2QQ9 A;  3V7C A;  3T8T A;  1I27 A;  5L3F A;  4BHP A;  1JHF A;  2O8X A;  2AXL A;  4UNO A;  2LNB A;  4HDU A;  2GA2 A;  6PAX A;  2AS5 F;  2OU2 A;  1I1S A;  1G3W A;  4ETS A;  5ICC A;  4WXH A;  2EFP A;  4KMU X;  3D5L A;  1I1G A;  1XB4 A;  1BBY A;  2XRO A;  1IAW A;  3TOB A;  1O7F A;  3BZ6 A;  1V3F A;  4OMY A;  1U5T B;  2P6T A;  4RB2 C;  1XMK A;  2QVO A;  4OIQ F;  1ZG5 A;  1XGM A;  4CXF A;  5D5W B;  5H20 A;  4NQW A;  2IW5 A;  3GXO A;  3HOS A;  3VOD A;  3SZT A;  5KVR A;  3MZY A;  1I6X A;  4A2U A;  4Q4Z F;  5IT3 A;  1TQM A;  3H3Z A;  1LB2 A;  4N0B A;  2XAH A;  2FSW A;  3K1N A;  1C0W A;  2QQB A;  3NQO A;  2X0L A;  1O3S A;  3QU6 A;  4I02 A;  1R1T A;  2VOO A;  5JR3 A;  2A61 A;  4UV8 A;  2W84 A;  1SD6 A;  1FYK A;  4EM1 A;  3BPX A;  2IJL A;  1ZYR F;  4CZZ A;  4EVI A;  1R7J A;  1QZY A;  2O61 A;  2J5P A;  2CG4 A;  1K6O A;  2XKO A;  2HFH A;  2FBI A;  3MEX A;  1H9T A;  2ADU A;  4G6D A;  3I71 A;  2YX7 A;  3IHU A;  2YSR A;  4N9H A;  2ZBK A;  4HQM A;  2XUB A;  4BHC A;  4U7B A;  3BWG A;  3ZMZ A;  4ZYG A;  2LKP A;  5F1R A;  4IF4 A;  2OBP A;  4PGG A;  3M7G A;  4IHS A;  3M8E A;  2CW0 F;  2L3D A;  3DPL C;  2V79 A;  3DKW A;  1FT9 A;  3WE3 A;  4P9U A;  4EGY A;  1BI3 A;  1W7P B;  5E1X A;  2DBB A;  3I59 B;  3F22 A;  2H94 A;  2R7F A;  2XVC A;  1ZRD A;  5K5R A;  1S29 A;  3FF5 A;  3RJP A;  1MD0 A;  4MTD A;  3KET A;  1O57 A;  1DUX C;  5HLH A;  5D4S A;  1GXQ A;  2H6B A;  3ZMS A;  2G7H A;  3BJA A;  3K1M A;  1IXR C;  1Z1D A;  5JHU A;  3E5X A;  1BM9 A;  1B59 A;  3JAM K;  5E17 F;  4M9Z A;  5DEQ A;  3GZ5 A;  3G73 A;  4LK1 F;  3REO A;  3M8F A;  3ZMD A;  1MZB A;  2CQK A;  1LQ1 A;  1RIO H;  1FOK A;  2ZNY A;  4XSZ F;  2KIM A;  5BPD A;  2V1X A;  1J0R A;  3HRU A;  4ZH4 F;  1OR7 A;  2DK8 A;  1ZN2 A;  1R22 A;  2F5D A;  3ZN1 A;  3SHF A;  1KQ8 A;  3HSR A;  1GXP A;  1B1B A;  4Z2Y A;  3HYI A;  1BOA A;  1FX7 A;  1UCR A;  2EFN A;  4CDG A;  2VBZ A;  3KP4 A;  1YTY A;  2MLK A;  5FD5 A;  3HIF A;  1JE8 A;  2J5O A;  3LST A;  4S04 A;  2V9V A;  2A6E F;  4CGZ A;  4KN7 X;  2VC1 A;  1G3S A;  1TBX A;  2YX4 A;  4CYD A;  2OQR A;  2PBI A;  4DNC A;  2Y48 A;  3SXY A;  2EWN A;  4U7D A;  4M72 A;  3KP5 A;  5HS9 A;  2HQR A;  2IA2 A;  5CLS A;  3K9T A;  4A0Y A;  3HRM A;  2ESH A;  3O6B B;  2G9W A;  5DV5 A;  2RC4 A;  2VOP A;  3CJN A;  3C3W A;  1JGS A;  3WGH A;  4LG0 A;  4M9X A;  3RTR A;  3K2Z A;  2L4M A;  3NRV A;  5FFZ A;  2O03 A;  3DQV C;  1HKQ A;  3DXJ F;  3QU3 A;  3HRS A;  4XLP F;  2FEZ A;  3FXQ A;  3Q9S A;  3C1D A;  4R8H A;  4OOI A;  2Q2E A;  3I59 A;  3I53 A;  5ILU A;  3E6B A;  1Z6T A;  2L4A A;  1K7A A;  1ZLJ A;  4A5M A;  4B09 A;  4ESB A;  4CHU A;  3BJO A;  3BRO A;  5EEG A;  2PQ8 A;  3PQK A;  1I5Z A;  2NAZ A;  3I54 A;  1SFE A;  5E1W A;  2QLZ A;  4GYI A;  1S7A A;  2VT2 A;  2OZ6 A;  4HQE A;  3FX3 A;  4NHJ A;  4KMF A;  5E8I A;  1ONV A;  4I09 A;  1FY7 A;  3TO6 A;  3IL2 A;  2XAG A;  4AIK A;  3F8F A;  2K7L A;  1YFH A;  4G6Q A;  2GA1 A;  3CUQ B;  3GFM A;  2DPD A;  2ETH A;  2Y75 A;  2R7D A;  5LGN A;  4LJZ F;  4M6Y A;  3ISP A;  2Z5U A;  2COM A;  4YFX F;  3E97 A;  1W4M A;  2GIV A;  2G7U A;  2V1D A;  1SMY F;  2BBY A;  4U88 A;  1BI0 A;  3F8C A;  1CF7 B;  2K27 A;  2UWM A;  2FML A;  3WTU C;  1SD4 A;  1FSE A;  5ED4 A;  1REP C;  4Y15 A;  1P4W A;  2KIF A;  1R1U A;  2ZNZ A;  1H0M A;  2RDP A;  3WU1 B;  2V1U A;  3MFK A;  2NRA C;  3B73 A;  5HLG A;  1R1V A;  4L5J A;  5LHH A;  1XN7 A;  4HLY A;  4AVP A;  1IXS B;  4RB0 A;  3S2W A;  2W85 A;  1JXS A;  2HKO A;  4MEY F;  2X4H A;  2L54 A;  2DPU A;  1F9N A;  3V8J A;  4M74 A;  1IN7 A;  1ZAR A;  3ERE D;  5JVT A;  3CLO A;  4UVA A;  2DT5 A;  3O2P E;  3P7N A;  2W25 A;  3KP7 A;  1RUN A;  2QEN A;  2EFQ A;  3T8R A;  3V7R A;  3E6C C;  4KFC A;  4L0Y B;  1F4K A;  4L0Z B;  1TQI A;  1IF1 A;  1BI1 A;  4G9Y A;  5CYV A;  3DEU A;  2CYY A;  3DF8 A;  1SD5 A;  5ILV A;  4OIN F;  1TNT A;  3J81 Z;  2QYO A;  2ELH A;  2VXZ A;  5BQT A;  4PDK A;  4OMZ A;  5E18 F;  1FSH A;  3OOP A;  2YU3 A;  5L3B A;  1EH7 A;  2MA3 A;  2DI3 A;  3L9F A;  3JTH A;  3QP6 A;  3CUQ A;  2KJC A;  1EH6 A;  4R1H A;  2H09 A;  2H6C A;  1W5T A;  3FM3 A;  3GEZ A;  2EFO A;  4ENK A;  2RQP A;  1KU3 A;  4YFK F;  5JFR A;  1CF7 A;  3KZZ A;  3V7S A;  4M6X A;  2D2W A;  1BIB A;  4HBL A;  2F2E A;  3GFJ A;  2PFB A;  2R3S A;  3L09 A;  1DDN A;  2WV0 A;  1FP1 D;  5FFX A;  2A6H F;  2VOD A;  2XIG A;  3RKX A;  2FXA A;  2CFX A;  2K02 A;  4CIC A;  3B02 A;  5LEJ A;  4UV9 A;  1MDM B;  1T0F A;  2STW A;  4L9T A;  5ICG A;  5AON A;  3EQL F;  3QPT A;  3R0A A;  3IKV A;  4BH9 A;  1YW9 A;  2XAJ A;  1LEA A;  2HKX A;  3P9K A;  2PLY A;  1QQI A;  3FWE A;  2DAO A;  2IVM A;  4KT5 C;  3LAP A;  2ZJ2 A;  4GYG A;  2QWW A;  2JPC A;  2FE3 A;  4UHT A;  1Z7U A;  1KQ0 A;  1KU7 A;  1ZG3 A;  1TQP A;  2Z3Y A;  5DYM A;  3M9A A;  3EYY A;  1FNN A;  2IA1 A;  1UHW A;  1B4A A;  1LDJ A;  4ZYH A;  5DD4 A;  1LNW A;  1TNS A;  5TJJ A;  3AAF A;  2XAQ A;  3V8K A;  1T2K A;  4G94 A;  1QPM A;  1D3Y A;  2F5F A;  3GF2 A;  4WX9 A;  1WQ2 A;  5DUK A;  3RKY A;  3MZH A;  4EJW A;  3F6V A;  1BI2 A;  5L3E A;  2ZFW A;  1FBU A;  1D5V A;  3CUO A;  5JI6 A;  1J59 A;  3F6O A;  4HOB A;  2A5Y B;  3GLX A;  1YW8 A;  1LDK B;  5EEH A;  4AWX B;  4KN4 X;  1U78 A;  3SQN A;  3W6K B;  5LBQ A;  4ON0 A;  5D5U B;  4I0B A;  3ABT A;  4G7Z F;  5CVU A;  5D8L B;  1B9N A;  2ZME B;  4EGZ A;  2HOE A;  4Y17 A;  4MNU A;  3J81 K;  4PCQ A;  1BIA A;  2XHK A;  4HF2 A;  5CVJ A;  1ZG1 A;  4MEX F;  1DP7 P;  1ON2 A;  2NYX A;  2RV8 A;  2JTV A;  1HXD A;  2DQR A;  2L01 A;  5D4R A;  4AIJ A;  4KUM A;  1U3E M;  3CO6 C;  3GO5 A;  2M45 A;  2IA0 A;  4EQQ A;  1MDM A;  2EFW A;  1P4X A;  2A68 F;  4G7H F;  2MH9 A;  3M1E A;  2YPR A;  3KLO A;  3PQJ A;  1KGS A;  2HEO A;  3HHG A;  1ZGA A;  4O5V A;  4ASN A;  2BGC A;  3I5U A;  3IRR A;  1HW1 A;  3RPU A;  1BC7 C;  2O0Y A;  3ULQ B;  3HSE A;  4YIF A;  2RN7 A;  1HW2 A;  4L9J A;  5LHI A;  1Q1H A;  1D8J A;  2F5E A;  1Z6R A;  4RB1 A;  2M1B A;  5HDG A;  3ZMV A;  4KIF A;  2K4B A;  5FGM A;  1FZP B;  3L2C A;  1HBX G;  1U5T A;  1IZ1 A;  2RGV A;  4IRH A;  1QGP A;  4Y13 A;  2PN6 A;  1XGO A;  2LF7 A;  2MD5 A;  1HST A;  3BJ6 A;  4CO8 A;  2VC0 A;  1YIO A;  4ZZD A;  1O3Q A;  2D1V A;  2FMY A;  4OIR F;  2HR3 A;  1W7P D;  3FHZ A;  3R0J A;  3KLN A;  2UXN A;  4EJT A;  1OYW A;  1R00 A;  4HW0 A;  3GWZ A;  2QBY B;  5LRS A;  4KNY A;  2L02 A;  4HLX A;  4GCV A;  2P7V B;  5FB2 A;  3KZY A;  3WG9 A;  4ENM A;  2MH2 A;  1XDS A;  4EJV A;  1PP7 U;  1DPU A;  2EA2 A;  4ENJ A;  1F1Z A;  2C6Y A;  3V8L A;  4A0X A;  4Q5S F;  3BOQ A;  1SMT A;  1IRG A;  1F5T A;  1IXC A;  5F64 A;  1CGP A;  1P2F A;  3LA2 A;  3HOT A;  3VFZ A;  4UXN A;  1FBS A;  5D5X B;  2ZXJ A;  5KK1 A;  3DPT A;  2B0L A;  1P6R A;  2Q0O A;  2QZ8 A;  5LHG A;  2JPB A;  3TKY A;  3LA3 A;  1W7P A;  1A04 A;  2E7X A;  2CSO A;  4LB5 A;  2HTS A;  1L0O C;  3GFI A;  4Q48 A;  3N97 A;  2A07 F;  2FBK A;  3GW2 A;  2STT A;  5ICF A;  1T38 A;  2A3S A;  3K1P A;  3RYP A;  1YS6 A;  4KIB A;  1YS7 A;  3TOA A;  5DD8 A;  2FRH A;  1GVJ A;  4IRI A;  2IT0 A;  1QO0 D;  3G3Z A;  1O7L A;  4I7H A;  1SD7 A;  2LF8 A;  4UVB A;  1ZAO A;  3TO9 A;  2GWR A;  4RAY A;  1J5Y A;  2Z33 A;  2K4J A;  1VTN C;  1XSX A;  4L18 B;  3LWF A;  1ZRF A;  1HW5 A;  1B6A A;  2HGC A;  2D45 A;  1H9G A;  1T98 A;  5CVI A;  4WF2 A;  5DDG A;  4E70 A;  1XDU A;  2TDX A;  4FHT A;  2XV4 S;  3Q5F A;  2PI0 A;  2GXG A;  2PMH A;  1BC8 C;  1PUE E;  2W24 A;  5LLQ A;  4XLN F;  3WTW C;  3CTA A;  4PZJ A;  5DCM B;  4YII A;  1MKM A;  5HS8 A;  2BEO A;  1GHC A;  5A2Q Z;  4ENN A;  4P9F A;  2EK5 A;  1FC3 A;  2QBY A;  3C18 A;  2HS5 A;  3D0S A;  4RGX A;  2WWY A;  1OMI A;  4L9N A;  2IPQ X;  2ZKZ A;  4LLL A;  2VON A;  1Z91 A;  4ZYD A;  2JRT A;  4MQ9 F;  3BPV A;  1IUY A;  3RI4 A;  2DQL A;  2XGX A;  3E6D A;  4WXC A;  4KDP A;  4LMY A;  2VBY A;  3LA7 A;  3R6S A;  3TO7 A;  3L7W A;  3DP7 A;  1R5G A;  3ABU A;  1KU9 A;  3R4K A;  3V4G A;  3KP2 A;  3LFK A;  2W57 A;  1X3U A;  4HZF A;  4A12 A;  4IJA A;  1KYZ A;  1XMA A;  1KQ9 A;  2HYG D;  3KEO A;  4FX0 A;  4I0A A;  4P55 A;  1NHA A;  2DO7 A;  2ZCW A;  5F6F A;  4BHB A;  3E5Q A;  3O3K A;  1WI9 A;  1XSV A;  4O3M A;  1ZRC A;  1UFM A;  3KP3 A;  4ESJ A;  2QM3 A;  4R79 A;  3T1B A;  4H0E A;  4TV7 A;  3ML6 A;  1Z05 A;  3GYH X;  1UB9 A;  3F3X A;  3JTG A;  3WTY C;  5HOO A;  1J7K A;  3R60 A;  4M71 A;  4Q47 A;  3VOE A;  1K79 A;  1UHM A;  4BNC A;  2P7C B;  5L3G A;  3DFG A;  3HTU A;  5HLI A;  3N4M A;  3RKW A;  1O3R A;  1TLH B;  3QPH A;  4YG2 F;  4I98 B;  3FMS A;  2E7W A;  2FNA A;  2FNP A;  4HV6 A;  2O6G E;  5DCM A;  5E8G A;  5TRD A;  2RNJ A;  3ECO A;  4LLG F;  1YG2 A;  3LAJ A;  2DTR A;  1E17 A;  3H92 A;  3FXU A;  2VBX A;  3MCZ A;  5ICE A;  1IN5 A;  5D5V B;  2DU9 A;  4RGS A;  2PMU A;  3ECH A;  5D8K B;  3SFZ A;  3H3U A;  3K69 A;  4LK0 F;  1K78 B;  1G4D A;  4A0Z A;  1ZH5 A;  3CDH A;  4XRF A;  3QRF F;  2P5V A;  1IN8 A;  1ZGJ A;  2MBF A;  4BAY A;  1S7O A;  4AD9 A;  5H6Q A;  3ROU A;  2OQG A;  1XCV A;  1D8K A;  5A2Q K;  3CUQ C;  4B8X A;  3F8N A;  1USS A;  1R5H A;  3GUD A;  3KCC A;  2DK5 A;  4KYW A;  3KEQ A;  4HYE A;  1U8R A;  1KU2 A;  1FBQ A;  1MGT A;  2OZU A;  3SZP A;  2F5C A;  2Z9O A;  1IW7 F;  3WE2 A;  3WGG A;  5E1Z B;  4U0W A;  4ZYE A;  1HSJ A;  1G3T A;  4BQA A;  3EYI A;  5BPI A;  3WTV C;  1EH8 A;  1Y0U A;  2BYV E;  5ILS A;  5LRR A;  1G3Y A;  4LD5 A;  3E5U A;  2LSO A;  2MC3 A;  2WC2 A;  1ZHF A;  2Q8K A;  3F72 A;  5LGT A;  2KIU A;  2RVC A;  4RAZ A;  2NS0 A;  5E20 A;  1JHH A;  3KE2 A;  1U6G A;  4AIH A;  2GQQ A;  1OKR A;  3VEP A;  5CVV A;  4KA4 A;  4DQ2 A;  1TW2 A;  3ELK A;  4P96 A;  5BMZ A;  4KIC A;  5D6E A;  4IVN A;  2HYF A;  2M8E A;  1MJ9 A;  4U0Y A;  2QUF A;  3QOP A;  2VBW A;  1YW7 A;  3WTZ A;  1FYM A;  4HX7 A;  1TW3 A;  3QAH A;  4JK1 X;  2CWE A;  2DFI A;  4MQV A;  4LGW A;  1S3J A;  1S8N A;  3U1D A;  2JZY A;  3IWZ A;  3NEU A;  1Z9C A;  3T5X A;  3K0L A;  5FLX Z;  1WSU A;  2Y0M A;  1K78 A;  2K86 A;  4JQF A;  4S05 A;  3I64 A;  3P9I A;  3IWF A;  1WKM A;  4F7Z A;  3FZV A;  3T0Y A;  1YO5 C;  4LG0 B;  3PFI A;  1V4R A;  3HHH A;  1RZ4 A;  4IPA A;  2PG4 A;  1P92 A;  1FP2 A;  3IC7 A;  3HTS B;  2LDU A;  3VB2 A;  5CJ9 A;  1QNT A;  2UXX A;  2IRF G;  4EM0 B;  2VE9 A;  4UUV A;  1FWZ A;  3ZPL A;  1R23 A;  4IHT A;  1AWC A;  5HDK A;  1J75 A;  3J80 Z;  5DCF A;  1STZ A;  1U2W A;  3JW4 A;  2M87 A;  3BDD A;  1O3T A;  4JBA A;  1LDD A;  1UST A;  3EET A;  4D0P A;  1S6L A;  5FD6 A;  3FXR A;  4GXO A;  4EV0 A;  2E1C A;  4HF0 A;  2FOK A;  3BY6 A;  1SAX A;  4A6D A;  1ODD A;  2FQ3 A;  4MGR A;  3I58 A;  1KYW A;  1RNL A;  3GVA A;  4OIO F;  5HS7 A;  3LQQ A;  3Q9V A;  2XRN A;  3IKT A;  1HQC A;  3E3V A; 
#chains in the Genus database with same CATH topology
 2OD5 A;  4IRG A;  4OAY A;  5EG0 B;  4MO7 A;  1B9M A;  3BG6 A;  1T39 A;  2Z99 A;  2JT1 A;  2HU9 A;  3BG9 A;  1X2N A;  4RLQ A;  4A69 C;  1VQ4 I;  2BE5 F;  5J8C A;  3WU0 A;  2KJB A;  2FBH A;  1SVM A;  1MBJ A;  1XS9 A;  2NXN B;  3QOD A;  4C2T A;  2ZME A;  1U5T C;  2DMU A;  4NB5 A;  3K70 D;  5IT9 Z;  4NNJ A;  3VWB A;  4GGG A;  4RGU A;  4ZTF A;  4D5C A;  3ZN0 A;  3GBG A;  2E35 A;  4EJO A;  4HAM A;  1W5S A;  1G6N A;  1JUM A;  2Y31 A;  4UUS A;  3GFL A;  2LD5 A;  1OCT C;  1XCB A;  2CGP A;  5IPA A;  4ESF A;  2Z2S B;  4BE2 A;  3QYF A;  1X1B A;  4E7K A;  4NUB A;  2QSG X;  4I2O A;  2V6C A;  1MMG A;  3MKY B;  1Q1V A;  1QHH D;  1LVA A;  4XM3 A;  2NNY A;  2P6S A;  4LLN A;  3HGY A;  1H8A C;  2UZK A;  4U0V A;  1UG2 A;  3DLA A;  3RIR A;  1WH5 A;  1XSD A;  5BS6 A;  2ZJQ F;  4A3C J;  2DW4 A;  3VSK A;  2EV5 A;  5HDN A;  1FMW A;  2MG4 A;  3ZMU A;  1LEB A;  5EGO B;  5IYB J;  1WPK A;  4C30 A;  1E2X A;  4BL0 B;  2FF4 A;  1XTA A;  2XAS A;  2PJR A;  4A5N A;  4GFB A;  3DEE A;  3K4N A;  4AYB N;  1HDP A;  1VQK I;  1VND A;  4IXA A;  4M73 A;  4ZC3 A;  3SZG A;  2KZG A;  1BJZ A;  2DA3 A;  4RM3 A;  2KRF A;  5L3D A;  3F23 A;  2KKO A;  1TTY A;  3B6A A;  2DA2 A;  3CC2 I;  1IUF A;  2ICW G;  4IHV A;  3LQR A;  2EA4 A;  2HPM A;  2E36 A;  3G71 I;  1ZLK A;  1XGN A;  2EZK A;  2M2E A;  3HUG A;  4B47 A;  4UVC A;  2GXB A;  1MSF C;  2L9R A;  2VE8 A;  4BBS J;  2HZT A;  2P5L C;  3C2G A;  3DV8 A;  1PDN C;  1ZRE A;  1ULY A;  3MKZ A;  4E7I A;  1YLF A;  1SFX A;  2K40 A;  4LFU A;  4NC6 A;  1OPC A;  4BJ5 C;  1AKH B;  4OIP F;  2DFH A;  1V55 H;  2RNG A;  4G8X A;  4YEJ A;  3RYR A;  2LBF B;  4QPO A;  4Y4R A;  5FLX K;  2UUZ A;  2FU4 A;  2RAE A;  4BXU A;  1QBJ A;  2IXS A;  3L00 A;  2JJ7 A;  1QZE A;  5J6X A;  3H9Q A;  3CO7 C;  5L3C A;  3JRH A;  2RKH A;  3BZK A;  2JN6 A;  3BP8 A;  4RAF A;  4FQG A;  2VT3 A;  1NK3 P;  2M7B A;  4RM2 A;  2EV6 A;  4N9I A;  2OAZ A;  5K5Q A;  4XSX F;  4KIG A;  1QPI A;  1PP8 F;  1R58 A;  1IN4 A;  5EF6 A;  3I0T A;  3OYN A;  1HKT A;  2ZFU A;  1FOW A;  3FM5 A;  2ISZ A;  2PJP A;  2MLG A;  3QP5 A;  4O6J A;  3GZ6 A;  1Y1V J;  4IX7 A;  2GAU A;  2NOG A;  1IRF A;  4MTE A;  2XAF A;  3JSP A;  5H6R A;  5EDN A;  1FYL A;  1BJA A;  2XGD A;  2FA5 A;  1T6S A;  2P8T A;  2P81 A;  3TDU C;  4EMS A;  3D1N I;  2NNN A;  3COA C;  3SDG A;  3F8B A;  2M30 A;  4MFE A;  2WTE A;  3EUH A;  3AG3 H;  4CYC A;  2JK3 A;  2HTJ A;  1A36 A;  1E3P A;  2QCO A;  5C44 J;  1X2M A;  1NTC A;  2DA7 A;  3TGN A;  2DA1 A;  2Z1D A;  4B1R A;  2A05 A;  3GCM A;  3PO3 J;  5IYD J;  2R5Y A;  3J80 K;  3IP4 B;  1RI7 A;  4A3B J;  4AVZ A;  1RUO A;  2B63 J;  3TED A;  2FUG 2;  5EG0 A;  4XRS G;  1XD7 A;  3J7Z I;  5J8F A;  2K9L A;  3HXL A;  4HX4 A;  2A69 F;  1MMD A;  2ESN A;  5K1Y A;  4XOT A;  1MJA A;  1T8I A;  3HSF A;  3LSJ A;  1AHD P;  2E5N A;  1XGS A;  1MH3 A;  3AG1 H;  1TL8 A;  1ON1 A;  1DPR A;  4AM3 A;  3PNT A;  4M3D A;  3OYG A;  2ACJ A;  4UY8 I;  3WTT C;  1MMA A;  3ZMT A;  2EZI A;  3BCB A;  3PUF A;  2X51 A;  3K70 C;  1WJE A;  2GZW A;  2CUJ A;  4NBQ A;  3J7A O;  3MVP A;  2KHM A;  3JRG A;  2KT0 A;  1F43 A;  3N05 A;  2X48 A;  4MHG A;  2EB7 A;  2VQH A;  1IGN A;  1J2X A;  1ETV A;  3GX4 X;  1JKP C;  5BOX A;  3WTX C;  2IP2 A;  4OU0 A;  2DA6 A;  4RGR A;  4YFN F;  1HKS A;  3QOE A;  2NS7 A;  3DTK A;  4Z6Y A;  3MQ0 A;  1X4O A;  4WXD A;  4HX8 A;  1R36 A;  1VZ0 A;  1BN5 A;  1XX5 A;  1Y8Q B;  2ZXW H;  4DOZ A;  2DYR H;  3F8M A;  2Y0S N;  3K10 A;  4M3G A;  2DLL A;  4M9S A;  1W0T A;  1FLI A;  2EV0 A;  4XLF A;  1SAU A;  1KA8 A;  3SFI A;  3FIS A;  2ZO4 A;  2E1N A;  3IUO A;  2VN2 A;  3RDI A;  3OS2 A;  3FK6 A;  5DM7 F;  3MAJ A;  4I01 A;  2K5C A;  4ZZL A;  1FPQ A;  4BXF A;  2QKL B;  3C7J A;  4BYY A;  2I5U A;  5E3L A;  4JP0 A;  1YQA A;  1N25 A;  2XKP A;  5IT9 K;  3FMR A;  3CCY A;  3KP6 A;  4QLC U;  2H27 A;  4UB8 C;  1LVK A;  5M5Y J;  5AIP A;  2HQN A;  1Z3Y A;  3JSO A;  3OV8 A;  1S7E A;  5J3L A;  2XSJ C;  4JX6 A;  3H5R A;  4A6E A;  4IOC F;  2ISY A;  4J19 A;  1EV7 A;  2HOS A;  4IHW A;  2PEX A;  3U2R A;  4XBF A;  4WWC A;  3P9C A;  4HV5 A;  4K2E A;  3WTS C;  3OYL A;  1W0U A;  5IYC J;  1X19 A;  3AG4 H;  2CO5 A;  3I9V 2;  4HA8 A;  2DMN A;  1WRJ A;  2P5K A;  1P4A A;  3FBI B;  3HRT A;  1SEU A;  4FX4 A;  4DJA A;  1VI0 A;  1UMQ A;  5DUI A;  1W1W E;  3SEQ A;  1YOV B;  4HDV A;  1AOY A;  3I4P A;  2AXT C;  2D1H A;  3ZR8 X;  3BR6 A;  3W2V A;  2JSC A;  5ERI A;  1PVE A;  1YJ9 I;  3OYM A;  2DOF A;  3U9G A;  3MWM A;  2L9N A;  3S93 A;  4RS8 A;  3BTJ A;  1WWX A;  3W6J B;  3GZN B;  5KCM A;  1LJ9 A;  2M5W A;  5FO5 A;  5C4J J;  3WOD F;  5LEK A;  3ZQ7 A;  1V54 H;  1I3Q J;  2OTL I;  3G1M A;  1DP3 A;  2QSF X;  1QZZ A;  2OA4 A;  4PGH A;  2DMP A;  4G7O F;  2YR2 A;  1KZH A;  2Y9Y A;  2EJR A;  1J9I A;  5CVR A;  3DEW A;  1V5E A;  5AIQ A;  3R61 A;  4EM2 A;  5K5O A;  4GDF A;  2FJ1 A;  4I6Z A;  3SJM A;  2KRH A;  2XGC A;  1RR7 A;  2ZXH A;  2L7Z A;  4XON A;  1ETO A;  1T33 A;  4QWQ A;  3WGI A;  3OYA A;  2JQ7 A;  1SFU A;  4P5O A;  4A3J J;  2P4W A;  3E6M A;  5BNG A;  1MJB A;  1OYY A;  3I55 I;  3HOY J;  4HNV A;  3CMM A;  1YRN A;  4DW6 A;  5LGU A;  3CME I;  1D0Z A;  3LSM A;  3NAR A;  4LB6 B;  1IN6 A;  2OPT A;  2QQA A;  4U87 A;  5GAD J;  4Y7N J;  3DLL F;  2E1M C;  5D6F A;  1GV5 A;  4L9V A;  1MMN A;  1TWA J;  3EDP A;  4ABZ A;  3LL7 A;  5HVQ C;  3H36 A;  1L3L A;  2H1L A;  1EA3 A;  4HF1 A;  3TDZ C;  3IRQ A;  2OTJ I;  4BE1 A;  3TQN A;  1APL C;  3ZP5 A;  4GO1 A;  2HOT A;  1R4M B;  1OYI A;  2V9P A;  2O3F A;  3TBI A;  2O7O A;  3FMQ A;  1LE8 B;  2BV6 A;  3AL0 C;  2HQ5 A;  1OCZ H;  3DBH B;  2HDC A;  4RB3 C;  3CCL I;  4A3M J;  1VQ6 I;  4WCG A;  2M9H A;  3JAM Z;  2CS3 A;  4W1U A;  3K7A J;  2XF7 A;  4WK8 F;  4L5I A;  3F21 A;  3RPQ A;  1YYV A;  2I10 A;  3A4C A;  4EJU A;  3D5S C;  2HWV A;  4FT8 A;  3M07 A;  1RET A;  3K6G A;  3HB9 A;  3CLQ A;  3KFW X;  4XKW A;  3RSN A;  2QQ9 A;  1BW6 A;  3T8T A;  3V7C A;  1I27 A;  5L3F A;  4BHP A;  1JHF A;  2O8X A;  4QIW N;  4BU2 A;  2AXL A;  3BR3 A;  5GAG J;  3OL4 A;  4UNO A;  4YIR X;  1HLV A;  1ZK8 A;  1EJ9 A;  2LNB A;  1GUU A;  1A31 A;  4HDU A;  2GA2 A;  6PAX A;  5JLW A;  4KIS A;  2BHZ A;  3ASO H;  3I56 I;  2AS5 F;  2OU2 A;  1I1S A;  1G3W A;  4ETS A;  5ICC A;  4BEH B;  3LSG A;  3K4C A;  2WY8 Q;  4WXH A;  3S2H J;  2EFP A;  3CCJ I;  2G0E A;  4KMU X;  4IHY A;  2CQQ A;  5HNF A;  4XLH A;  3D5L A;  4Y3O A;  2LY2 A;  1I1G A;  3H5A A;  1XB4 A;  3LSI A;  1BBY A;  3S3M A;  1QHG A;  2R7W A;  3CZ6 A;  2XRO A;  5K7H A;  1IAW A;  3TOB A;  1O7F A;  2ZC2 A;  3MMY B;  2ID3 A;  3BZ6 A;  1ZKG A;  4ZTJ A;  1V3F A;  3HOV J;  4OMY A;  3NAU A;  2JA8 J;  1U5T B;  2P6T A;  4RB2 C;  1XMK A;  2QVO A;  3E1S A;  1BR4 A;  4OIQ F;  1ZG5 A;  3BG3 A;  1LFU P;  1XGM A;  3G1L A;  2CUZ A;  2H8W A;  2R7U A;  2MGQ A;  4CXF A;  2VJ5 A;  2KL4 A;  5H20 A;  5D5W B;  4NQW A;  2HI3 A;  4ITV A;  2IW5 A;  1MBH A;  3GXO A;  3HOS A;  1N78 A;  3FKI J;  3VOD A;  3SZT A;  3M4O J;  1Y6I A;  5KVR A;  3MZY A;  1I6X A;  4A2U A;  4Q4Z F;  5IT3 A;  3S14 J;  3I4M J;  2FD5 A;  5EEA A;  2WAQ N;  1VF9 A;  5KAF C;  1TQM A;  5CPR B;  3H3Z A;  1LB2 A;  3FDY A;  2K3F A;  2L9V A;  4N0B A;  5EZH A;  1K61 A;  4D7N A;  2XAH A;  2YUS A;  2FSW A;  3K1N A;  1C0W A;  2QQB A;  3NQO A;  1TWH J;  2X0L A;  1O3S A;  3QU6 A;  1Y39 A;  4I02 A;  1R1T A;  2VOO A;  1OLT A;  5JR3 A;  2A61 A;  1G8X A;  1P7I A;  4UV8 A;  2W84 A;  1SD6 A;  1FYK A;  4EM1 A;  3BPX A;  3ZXS A;  3JR9 A;  4E7J A;  4BGD A;  3JRI A;  2IJL A;  1ZYR F;  4AYB A;  1Z3X A;  4M3E A;  4C2U A;  1WJF A;  3FXM A;  4CZZ A;  4EVI A;  3W2W A;  5F0H A;  4N4O B;  4B48 A;  1R7J A;  1QZY A;  2W4S A;  5M3M J;  2O61 A;  2J5P A;  2CG4 A;  4II2 A;  1K6O A;  1K6Y A;  2XKO A;  2HFH A;  3ZQH A;  2IS1 A;  5FLM J;  1VQ9 I;  2VQC A;  3NWT A;  1RRJ A;  2BY2 A;  2VKV A;  3BQY A;  4NC7 A;  2FBI A;  3MEX A;  2IGN A;  2R7T A;  1IDY A;  1H9T A;  2VKD A;  3ZRG A;  2ADU A;  2WAD A;  5TIS C;  4G6D A;  4C3J J;  1HCR A;  3I71 A;  1AA7 A;  5FKN A;  2YX7 A;  3IHU A;  3O8G A;  1X1C A;  2YSR A;  4GRI A;  2WB1 N;  4N9H A;  2ZBK A;  4HQM A;  2XUB A;  4BHC A;  4U7B A;  2R0Q C;  2XGE A;  3BWG A;  5M5W J;  1OFC X;  3ZMZ A;  1IC8 A;  4ZYG A;  1UZC A;  2LG4 A;  2LKP A;  3TW7 A;  5F1R A;  4IF4 A;  1LFB A;  2OBP A;  4PGG A;  3M7G A;  4IHS A;  1IRX A;  2LLK A;  2VQL A;  2XPU A;  1YIT I;  1VQL I;  2X1E A;  1VQN I;  3M8E A;  2CW0 F;  3TMO A;  4CCN A;  2L3D A;  3DPL C;  1FTT A;  2V79 A;  2JA6 J;  3DKW A;  2CH0 A;  1FT9 A;  3WE3 A;  2OC6 A;  4P9U A;  3CP8 A;  5IP9 J;  3HOX J;  4EGY A;  1JI8 A;  3VPR A;  1BI3 A;  1W7P B;  1JKR C;  5E1X A;  2DBB A;  3I59 B;  3F22 A;  2H94 A;  2QF7 A;  3OYK A;  2R4G A;  4X6A J;  1X4P A;  3H5N A;  2X85 A;  2R7F A;  4UUT A;  2XVC A;  4F92 B;  1ZRD A;  2JA7 J;  5K5R A;  1S29 A;  3FF5 A;  3RJP A;  1MD0 A;  1T95 A;  3M8J A;  4MTD A;  4DGW B;  3KET A;  1O57 A;  2IBD A;  2OJE D;  5IOY A;  5HLH A;  1DUX C;  3CCS I;  3GTJ J;  4IHX A;  5D4S A;  1GXQ A;  2H6B A;  2UV1 A;  2G7H A;  3MN2 A;  3BJA A;  3ZMS A;  3K1M A;  1IXR C;  1Z1D A;  5JHU A;  2QEX I;  3E5X A;  1S72 I;  3OMY A;  2DOE A;  1BM9 A;  1B59 A;  3JAM K;  5E17 F;  4M9Z A;  3BG5 A;  3GZ5 A;  5DEQ A;  3G73 A;  4PFP A;  4LK1 F;  2LP0 A;  3REO A;  3M8F A;  3ZMD A;  1MZB A;  1X58 A;  2CQK A;  1RIO H;  4BQQ A;  1LQ1 A;  3ZGK A;  1FOK A;  2ZNY A;  4XSZ F;  2KIM A;  5BPD A;  4FAS D;  2DDA A;  3KX2 A;  3H0D A;  2V1X A;  1J0R A;  4KJZ A;  3HRU A;  2LY9 A;  2F4O B;  2EIJ H;  4ZH4 F;  3K4K A;  1OR7 A;  2DK8 A;  1ZN2 A;  2QQ8 A;  1R22 A;  2F5D A;  3ZN1 A;  2HDW A;  4XRS A;  1WHU A;  1B8I B;  1MIJ A;  2VPL A;  3SHF A;  4XLE A;  2CRG A;  4E7Z A;  2XB0 X;  1KQ8 A;  3HSR A;  3OIQ A;  2X6W A;  1PUF B;  1GXP A;  1B1B A;  4Z2Y A;  4BY7 J;  3VYS B;  3HYI A;  1BOA A;  2XPV A;  1FX7 A;  5KNL A;  3OIO A;  1UCR A;  2EFN A;  3CJQ B;  3QPS A;  1M1E B;  2GBY A;  4CDG A;  1UJ8 A;  2ME6 A;  2VBZ A;  3KP4 A;  2Y0S A;  2MLK A;  1YTY A;  3O8H A;  4JX4 A;  4QSH A;  5FD5 A;  2GOX B;  3CCM I;  1VFC A;  3HIF A;  1JE8 A;  2J5O A;  3LST A;  2VQG A;  4S04 A;  2V9V A;  2LVS A;  4B3X A;  2A6E F;  1ZTR A;  3IAM 2;  3S1R J;  4CGZ A;  1G2H A;  2B9S A;  4KN7 X;  2VC1 A;  1G3S A;  1TBX A;  2YX4 A;  4CYD A;  3LSP A;  1E0E A;  1U9N A;  2LTP A;  2OQR A;  3DBR B;  3HOU J;  1Y8R B;  2PBI A;  3EUA A;  4DNC A;  2Y48 A;  4X1E A;  3CF2 A;  2VJJ A;  2EWN A;  3SXY A;  2E5Z A;  3SEZ A;  2OUM A;  4CCL A;  4M72 A;  4U7D A;  4I76 A;  3ZQC A;  3OYJ A;  1NG6 A;  3KP5 A;  5HS9 A;  2LKS A;  4A93 J;  1D1C A;  1WCM J;  2HQR A;  4PJJ A;  3H9J A;  2IA2 A;  5CLS A;  3K9T A;  1T08 B;  4A0Y A;  1YHQ I;  3HRM A;  2ESH A;  3O6B B;  3G4S I;  1TP4 A;  2DMQ A;  2G9W A;  2YS9 A;  1OR7 C;  3QPL A;  5DV5 A;  2RC4 A;  1IO2 A;  2X1C A;  3H9G A;  3H0G J;  2WV1 A;  2CQX A;  3JRA A;  2VOP A;  1DGW Y;  1X3W B;  3CJN A;  3C3W A;  3VDX A;  1JGS A;  3ABK H;  3WGH A;  1PJR A;  4LG0 A;  2GIZ A;  5B66 C;  1I39 A;  2XRL A;  4M9X A;  1YI2 I;  3RTR A;  3K2Z A;  2L4M A;  3HGG A;  4BDY A;  1U9O A;  1SAN A;  3NRV A;  5FFZ A;  2O03 A;  1E3O C;  3DQV C;  1HKQ A;  3DXJ F;  5EYR A;  3QU3 A;  2LRD A;  3AKZ A;  2GLO A;  2CJJ A;  3HRS A;  4XLP F;  2FEZ A;  3FXQ A;  4ZYA A;  3LSR A;  1N77 A;  3Q9S A;  3C1D A;  4R8H A;  2LY1 A;  3VYU B;  4OOI A;  5DM6 F;  2L9S A;  2Q2E A;  3I59 A;  2W00 A;  3I53 A;  5ILU A;  5J47 A;  3E6B A;  1Z6T A;  1YX3 A;  2L4A A;  1K7A A;  2MAB A;  1ZLJ A;  4A5M A;  5FKO A;  2JMW A;  4B09 A;  4ESB A;  4CHU A;  3BJO A;  3BRO A;  2COB A;  5EEG A;  2PQ8 A;  3GTO J;  2ZME C;  4PSX A;  1R9T J;  3PQK A;  5DS9 A;  2DTZ A;  1OCP A;  2E1O A;  1MNM C;  1I5Z A;  2ECC A;  1JUP A;  2NAZ A;  3I54 A;  4LG3 A;  4BQO A;  3OS0 A;  1SFE A;  2X6X A;  3EPZ A;  5E1W A;  5HOD A;  4MLO A;  2QLZ A;  2MYS A;  4GYI A;  3K4J A;  1S7A A;  5CKT A;  1K4T A;  1G59 A;  1MBF A;  2VT2 A;  2OZ6 A;  4HQE A;  3FX3 A;  4NHJ A;  4KMF A;  5E8I A;  2R7R A;  1Z7L A;  3HPH A;  1ONV A;  2LMD A;  4I09 A;  1FY7 A;  3TO6 A;  2WA0 A;  1B72 B;  2F4I A;  3IL2 A;  2XAG A;  2KRC A;  4AIK A;  4BAC A;  1B8I A;  3F8F A;  2IGM A;  4E7H A;  2K7L A;  3NWS A;  1YFH A;  1DQU A;  2GA1 A;  4G6Q A;  3CUQ B;  3GFM A;  4A3I J;  2DPD A;  2ETH A;  2JSP A;  2Y75 A;  1YE9 A;  2R7D A;  4LJZ F;  4M6Y A;  5LGN A;  3S1M J;  3ISP A;  5E3N A;  2Z5U A;  2COM A;  2N8G A;  4YFX F;  5GAE J;  3PJR A;  3E97 A;  2HVQ A;  1W4M A;  2GIV A;  2DDB A;  1ETQ A;  2G7U A;  2E34 A;  2V1D A;  1BL0 A;  1TT5 B;  1SMY F;  2Y30 A;  3PL8 A;  2HNH A;  4JYK A;  2BBY A;  4U88 A;  1P7J A;  2V6E A;  1BI0 A;  3DKY A;  1VQ7 I;  1ORK A;  1R49 A;  3F8C A;  1CF7 B;  2K27 A;  2UWM A;  3PIP F;  2NOJ B;  4MFD A;  3A01 B;  2ID6 A;  2FML A;  1HA8 A;  2V1N A;  5J40 A;  4RAG A;  3FKJ A;  5C3E J;  3GTQ J;  1ETK A;  4RLF A;  3WTU C;  2VKH A;  1SD4 A;  1X1D A;  3CC4 I;  1FSE A;  3E0J B;  5ED4 A;  1HDD C;  2BHY A;  1REP C;  4Y15 A;  1P4W A;  2BVL A;  3CCQ I;  2KIF A;  1R1U A;  2ZNZ A;  3H1C A;  1TT0 A;  1H0M A;  4F55 A;  2RDP A;  4A3K J;  3WU1 B;  2DXI A;  4HNU A;  2V1U A;  3OYH A;  1QVU A;  3MFK A;  2NRA C;  3B73 A;  5HLG A;  1R1V A;  4L5J A;  2MSY A;  5LHH A;  1XN7 A;  2EBI A;  3C2H A;  4HLY A;  1N75 A;  1ETW A;  4AVP A;  1IXS B;  4RB0 A;  4ANJ A;  4F91 B;  5EGO A;  4XRM A;  3S2W A;  2IGO A;  2R93 J;  4Y52 J;  2W85 A;  1JXS A;  4F3Q A;  2HKO A;  4HEA 2;  4MEY F;  2CQ7 A;  3CMY A;  2KP6 A;  2KLO A;  2X4H A;  2L54 A;  4D9J A;  2DA5 A;  2WAQ A;  3EUH C;  3U1K A;  2DPU A;  1F9N A;  3V8J A;  1MBG A;  4M74 A;  1IN7 A;  1ZAR A;  2GXA A;  4Y33 A;  2DFE A;  3ERE D;  5JVT A;  3CLO A;  4UVA A;  3CCV I;  3HM5 A;  4CUG A;  3BTC A;  2DT5 A;  5FKM A;  2RQQ A;  3O2P E;  3P7N A;  3BR5 A;  4CCJ A;  3CCE I;  1NG7 A;  2W25 A;  4CCK A;  2IS6 A;  2I8D A;  3KP7 A;  1RUN A;  2QEN A;  1S9H A;  4C3I J;  2EFQ A;  3T8R A;  4FIS A;  3V7R A;  3E6C C;  3FBN B;  3QWL A;  1AKH A;  4KFC A;  4L0Y B;  1F4K A;  3HG9 A;  4L0Z B;  3V42 A;  2LBF A;  2OCE A;  3I4N J;  3HZJ A;  1TQI A;  3DKX A;  1IF1 A;  1BI1 A;  2KPM A;  4G9Y A;  1ETY A;  5M3F J;  3TL4 X;  5CYV A;  1J09 A;  3DEU A;  4RDU A;  2NVX J;  4IQJ A;  2CYY A;  3DU5 A;  3DF8 A;  1SD5 A;  5J4V A;  5ILV A;  4OIN F;  4BJ6 C;  1TNT A;  3PFY A;  1H89 C;  3J81 Z;  1Z77 A;  4BQN A;  2QYO A;  1JT0 A;  1UHS A;  2ELH A;  4V19 K;  2VXZ A;  5BQT A;  2XF6 A;  1T56 A;  1QU3 A;  4PDK A;  4OMZ A;  2WB1 A;  3VYT B;  5E18 F;  2F48 A;  2VPR A;  1FSH A;  2MW8 A;  3OOP A;  2YU3 A;  1TWF J;  5L3B A;  1F36 A;  1DU0 A;  1EH7 A;  2W1O A;  1WGX A;  3KEY A;  1UG0 A;  2X6Y A;  2MA3 A;  2DI3 A;  3GLL A;  3L9F A;  3C2B A;  2LOO A;  2F5V A;  3JTH A;  3QP6 A;  3G1O A;  1JJ6 C;  2CV0 A;  3CUQ A;  4QTR A;  2KJC A;  1EH6 A;  4R1H A;  4XOP A;  2H09 A;  2K9Q A;  2FQ4 A;  2H6C A;  4BY1 J;  3HEF A;  1W5T A;  5KAI C;  4BBR J;  3CJT B;  3FM3 A;  4XKV A;  3BR2 A;  3GEZ A;  2EFO A;  2AQF A;  1ZR4 A;  4ENK A;  2RQP A;  1KU3 A;  3DU6 A;  4HST A;  4YFK F;  5JFR A;  3E7L A;  2XSD C;  1CF7 A;  3KZZ A;  4UB6 C;  3V7S A;  2NS8 A;  3K4B A;  3W6V A;  1JTX A;  1FOX A;  4M6X A;  2D2W A;  1BIB A;  4HBL A;  2F2E A;  3ZQF A;  1OQY A;  3GFJ A;  3BTI A;  3TW6 A;  2PFB A;  2R3S A;  1GT0 C;  3L09 A;  4HSR A;  3Q3S A;  3OYD A;  1DDN A;  1I6H J;  3RKQ A;  4V2F A;  3RCO A;  2AHQ A;  2QKM B;  2WV0 A;  3OL3 A;  1FP1 D;  4II3 A;  5FKK A;  3KZI C;  4YRV A;  5FFX A;  3AFH A;  1ACI A;  2A6H F;  5GTH C;  1D1A A;  3CDL A;  2VOD A;  2XIG A;  1Z21 A;  2M0M A;  3RKX A;  2CW7 A;  2FXA A;  2CFX A;  2K02 A;  2O5R A;  5EJC A;  4KIT B;  4CIC A;  3B02 A;  5LEJ A;  4UV9 A;  2HOA A;  1MDM B;  2R7V A;  1MBK A;  3MZ8 A;  1T0F A;  5GPA A;  1WJC A;  2STW A;  4FCY A;  4L9T A;  3EUK L;  5ICG A;  5AON A;  3EQL F;  1FJL A;  3PO2 J;  3QPT A;  2CFO A;  2KIQ A;  3R0A A;  1D5Y A;  3IKV A;  3IH2 A;  4BH9 A;  1YW9 A;  1JUS A;  1LEA A;  2XAJ A;  1BOB A;  1MBE A;  2HKX A;  4KT6 A;  4XL9 A;  3DWL E;  3P9K A;  2PLY A;  1QQI A;  2KZV A;  3FWE A;  4S0H B;  2DAO A;  1NH3 A;  2IVM A;  4KT5 C;  3LAP A;  2ZJ2 A;  4GYG A;  2QWW A;  2JPC A;  2FE3 A;  4UHT A;  1Z7U A;  1KQ0 A;  2L0K A;  2EH3 A;  5FRN A;  3A2K A;  1KU7 A;  1ZG3 A;  1TQP A;  2Z3Y A;  1W5C C;  4JOM A;  5DYM A;  4ZDO A;  3M9A A;  1FMV A;  4X0G A;  3QYE A;  1K4S A;  3A0H C;  4CZC A;  3EYY A;  1Z67 A;  1FNN A;  2DMT A;  2HDD A;  2IA1 A;  3PUB A;  3Q0W A;  2X1D A;  1JKQ C;  4E6K G;  1UHW A;  1B4A A;  5J1R A;  2LYC A;  1LDJ A;  4ZYH A;  5DD4 A;  4HNT A;  1LNW A;  1TNS A;  5LD2 C;  1WH7 A;  2CV2 A;  3JRD A;  4DBR A;  3HKZ N;  5TJJ A;  3WHB A;  5F27 A;  3AAF A;  2XAQ A;  2R7Q A;  2JUG A;  2F6C A;  2FX0 A;  3W3C A;  3V8K A;  1T2K A;  4G94 A;  1QPM A;  3GTP J;  3K2A A;  1D3Y A;  2F5F A;  2BZT A;  3GF2 A;  4WX9 A;  3ERM A;  1WQ2 A;  2BOL A;  5DUK A;  3RKY A;  2ZJR F;  3MZH A;  4EJW A;  3F6V A;  4QPQ A;  1BI2 A;  5GAH J;  2ZXI A;  5L3E A;  2X6O A;  4DZJ A;  2ZFW A;  1FBU A;  1D5V A;  3CUO A;  3OSF A;  5JI6 A;  1QA6 A;  1J59 A;  3F6O A;  3F0C A;  2ZSI B;  4HOB A;  1OCO H;  3HC7 A;  3KYL A;  2A5Y B;  2DT6 A;  2Z16 A;  3G6E I;  3GLX A;  1YW8 A;  2HVR A;  4HRI A;  1LDK B;  5EEH A;  1FTZ A;  4AWX B;  1DGR M;  4KN4 X;  1U78 A;  2LK2 A;  3SQN A;  3W6K B;  5LBQ A;  3BQZ A;  4ON0 A;  1XC5 A;  5D5U B;  2KMU A;  3LMM A;  3L2Q A;  3WHC A;  3S8P A;  1P9Q C;  4LOC A;  4I0B A;  3ABT A;  4G7Z F;  2L7F P;  2M34 A;  2BW3 B;  4LIU A;  5CVU A;  5D8L B;  5J1Y A;  4A3F J;  1BW5 A;  1B9N A;  2ZME B;  2V26 A;  4EGZ A;  3PM1 A;  3RQI A;  2HOE A;  4Y17 A;  2LRE A;  4MNU A;  3J81 K;  4PCQ A;  1A35 A;  4UUS B;  1BIA A;  2KQR A;  2XHK A;  1PYV A;  3BT9 A;  5CVJ A;  1ZG1 A;  4HF2 A;  1LE8 A;  3JCU C;  4MEX F;  1DP7 P;  4XN3 A;  2H1K A;  2XB5 A;  3GTM J;  1ON2 A;  2NYX A;  3CCU I;  3DTE A;  1V5G A;  4LIT A;  2RV8 A;  1O4X A;  2EIK H;  1GV2 A;  5LFA A;  2JTV A;  1HXD A;  1WJA A;  2DQR A;  4AC0 A;  2L01 A;  5D4R A;  5TGT A;  4AIJ A;  4KUM A;  1U3E M;  3ABL H;  2CUF A;  3FXO A;  3CO6 C;  3GO5 A;  3OY9 A;  2M45 A;  2IA0 A;  4EQQ A;  2JVG A;  1SC7 A;  2EFW A;  1MDM A;  1P4X A;  3BC8 A;  2A68 F;  4G7H F;  3MD2 A;  2MH9 A;  3JRE A;  2PJR B;  3M1E A;  1GVD A;  2YPR A;  3KLO A;  4CH7 A;  2WAF A;  3M1C A;  3PQJ A;  4J01 A;  3ZQI A;  1KGS A;  3S3O A;  2HEO A;  3HHG A;  1ZGA A;  4O5V A;  3ZQQ A;  4ASN A;  4LIV A;  2VAS A;  2BGC A;  3I5U A;  3IRR A;  1HW1 A;  3RPU A;  2Y69 H;  1BC7 C;  2O0Y A;  3ULQ B;  3HSE A;  2JWT A;  4BEH A;  4YIF A;  4FET A;  2RN7 A;  1VQM I;  1HW2 A;  4L9J A;  1IV8 A;  2NVY J;  1Q1H A;  5LHI A;  1D8J A;  2F5E A;  1Z6R A;  4RB1 A;  2M1B A;  3HUG B;  3A0B C;  5HDG A;  3ZMV A;  1RKT A;  1JKO C;  1KON A;  2VB6 A;  4KIF A;  3J7A Y;  2VJI A;  2K4B A;  5FGM A;  1FZP B;  2HZD A;  3L2U A;  3L2C A;  2KDO A;  1A6I A;  1HBX G;  1U5T A;  3IAS 2;  1IZ1 A;  2ECB A;  2RGV A;  4IRH A;  2Y9Z A;  3S1Q J;  2L2O A;  1YX5 A;  1ETX A;  1IJW C;  1QGP A;  4Y13 A;  3CQZ J;  2B7E A;  2PN6 A;  1XGO A;  3TP0 A;  2LF7 A;  2MD5 A;  3ZQL A;  1HST A;  3BJ6 A;  4CO8 A;  4BDZ A;  2VL8 A;  2VC0 A;  2L7K A;  1YIO A;  4ZZD A;  1RPW A;  2R7O A;  1Y56 A;  1O3Q A;  2D1V A;  3HL2 A;  5GTI C;  1FOY A;  2FMY A;  2K9M A;  4OIR F;  3K4M A;  4G6T B;  2R7X A;  2HR3 A;  4H4K C;  1W7P D;  5JLX A;  3OR2 C;  3FHZ A;  3IH3 A;  3R0J A;  3KLN A;  2UXN A;  3BLY A;  1QVT A;  4EJT A;  1OJL A;  1OYW A;  1SVO A;  2P0W A;  3WU2 C;  4CYC B;  2V4J C;  2TRT A;  3DPU A;  1IG7 A;  1R00 A;  2DCE A;  5JHF A;  4HW0 A;  3GWZ A;  2QBY B;  3HOW J;  5LRS A;  2R5Y B;  4KNY A;  4DZP A;  2L02 A;  4HLX A;  4GCV A;  2F4M B;  4V2G A;  2XC7 A;  2P7V B;  5FB2 A;  1TWG J;  3KZY A;  1ITY A;  2AQE A;  3WG9 A;  4ZDP A;  4ENM A;  2MH2 A;  4DIQ A;  2IS4 A;  1XDS A;  2RRE A;  2QA4 I;  1D0X A;  1WJB A;  4EJV A;  5CQE A;  1PP7 U;  1VQ8 I;  1XPX A;  1DPU A;  2M4G A;  3Q0U A;  2EA2 A;  4ENJ A;  1F1Z A;  2BW3 A;  2C6Y A;  2E2J J;  4F52 A;  4PK4 A;  3V8L A;  4XN0 A;  2E19 A;  2O9L A;  2X9D A;  4A0X A;  1TC3 C;  5CQG A;  4Q5S F;  3W2A A;  1U0J A;  3BOQ A;  2DT7 B;  1SMT A;  1IRG A;  1BA5 A;  1F5T A;  3A1Y A;  1IXC A;  5F64 A;  1CGP A;  4BXX J;  1P2F A;  1R71 A;  1XG1 A;  3LA2 A;  1MMS A;  4RBO A;  3HOT A;  2IGK A;  3L2R A;  3VFZ A;  2OF7 A;  4F93 B;  2R92 J;  2D5V A;  2DJI A;  2VUM J;  4ZJZ A;  1YJN I;  4UXN A;  5HNH A;  1FBS A;  1ZQ3 P;  5D5X B;  2ZXJ A;  5KK1 A;  2HVS A;  3DPT A;  1LFP A;  2B0L A;  1P6R A;  3HOZ J;  2Q0O A;  4D5F A;  3Q0V A;  3PIO F;  3ZOB A;  2QZ8 A;  5LHG A;  4BE0 A;  5F08 A;  5F0F A;  2JPB A;  3TKY A;  2H8R A;  3LA3 A;  1W7P A;  1A04 A;  4RMN A;  3LSK A;  1HOM A;  2E7X A;  2CSO A;  2QSH X;  3OIP A;  4LB5 A;  2HTS A;  3H35 A;  3P5J A;  1L0O C;  3GFI A;  4Q48 A;  4NC8 A;  2W7N A;  3CD6 I;  2IAI A;  5J1U A;  3N97 A;  2E2H J;  2A07 F;  2FBK A;  3GW2 A;  2E1M B;  2STT A;  5ICF A;  3LFU A;  1T38 A;  1EKE A;  2A3S A;  3K1P A;  2NVU B;  3RYP A;  4B4C A;  4B43 A;  2BVM A;  1YS6 A;  4KIB A;  4FTH A;  1YS7 A;  3TOA A;  1MNE A;  5DD8 A;  2FRH A;  1GVJ A;  4IRI A;  2LH9 A;  2IT0 A;  1QO0 D;  3G3Z A;  1CQT A;  1O7L A;  3U21 A;  4CSW A;  3PSF A;  4I7H A;  1SD7 A;  1XMX A;  2LF8 A;  4UVB A;  2PX9 A;  2AO9 A;  1ZAO A;  3AL0 B;  3TO9 A;  4AU7 A;  2GWR A;  3ASN H;  3GTG J;  4RAY A;  4L5E A;  1J5Y A;  3CMA I;  2Z33 A;  3CDI A;  2K4J A;  1VTN C;  1XSX A;  4L18 B;  3LWF A;  1ZRF A;  1HW5 A;  4PSW A;  4PJ0 C;  1B6A A;  2HGC A;  3FK7 A;  3CCR I;  1ZGW A;  2DOA A;  3LOC A;  2D45 A;  1HF0 A;  1H9G A;  1T98 A;  2M4K A;  2DOD A;  1OIS A;  2WBM A;  1D0Y A;  5CVI A;  4WF2 A;  2PMZ N;  2OV7 A;  1XDU A;  2TDX A;  4FHT A;  2XV4 S;  4E70 A;  5DDG A;  3Q5F A;  2PI0 A;  1VQO I;  2GXG A;  2R7Z J;  2PMH A;  3LNQ A;  1PUF A;  1BC8 C;  5IY5 H;  1PUE E;  3A03 A;  3OYF A;  2W24 A;  5LLQ A;  4W97 A;  4XLN F;  3WTW C;  3CTA A;  4YEL A;  1YIJ I;  4PZJ A;  4PJM A;  5DCM B;  4YII A;  4A3D J;  1MKM A;  3ABM H;  3RZO J;  1X1A A;  2ZSH B;  5HS8 A;  3UKG A;  3OSG A;  3OYE A;  2BEO A;  1JT6 A;  3KPH A;  1ENH A;  1GHC A;  2E60 A;  2JVH A;  5A2Q Z;  1ERD A;  4ENN A;  4P9F A;  1YRN B;  4DYQ A;  2YU9 J;  2EK5 A;  1FC3 A;  2QBY A;  3C18 A;  2HS5 A;  3D0S A;  4OAZ A;  1I3A A;  2DJN A;  3CF5 F;  2K85 A;  3S32 A;  4A3E J;  4RGX A;  3OS1 A;  3PSI A;  2WWY A;  1FIP A;  1OMI A;  4L9N A;  3L2V A;  2JRM A;  2IPQ X;  2ZKZ A;  4LLL A;  3BR0 A;  2W48 A;  1Z91 A;  2VON A;  4ZYD A;  3S3N A;  2JRT A;  4MQ9 F;  3BPV A;  4CCO A;  3HPG A;  1IUY A;  3RI4 A;  2DQL A;  2XGX A;  3E6D A;  2LFB A;  5EZG A;  4WXC A;  4KDP A;  4LMY A;  2KFD A;  3JRB A;  1A5J A;  2VBY A;  2WAE A;  3LA7 A;  4C3H J;  3R6S A;  1W36 D;  3TO7 A;  3L7W A;  3DP7 A;  4XIC A;  5FJ8 J;  1R5G A;  4IKF A;  1WZ2 A;  3ABU A;  2GOM A;  4C9Y A;  3OOU A;  1KU9 A;  4J00 A;  3R4K A;  4IZZ A;  4BJT A;  2DYS H;  3HKZ A;  3V4G A;  3KP2 A;  3OYC A;  3LFK A;  5JVG F;  2W57 A;  1X3U A;  4HZF A;  2BY1 A;  4PJN A;  4A12 A;  3CC7 I;  4IJA A;  4A3G J;  1KYZ A;  1XMA A;  4M6V A;  1KQ9 A;  1GDT A;  3J7Y J;  2HYG D;  2VIX A;  3KEO A;  1NK2 P;  3S1N J;  4FX0 A;  4MIM A;  1WI3 A;  3GTL J;  4I0A A;  1ZEL A;  3FXL A;  2VKE A;  5F04 A;  4P55 A;  2KDZ A;  2JA5 J;  1NHA A;  1FIA A;  4IOA F;  2DO7 A;  2EZH A;  2ZCW A;  2M3A A;  5F6F A;  3FHN A;  2MD0 A;  3BCA A;  4BHB A;  3OYI A;  4D7M A;  3E5Q A;  2E2I J;  5B1B H;  3O3K A;  3FXJ A;  4IQ4 A;  1WI9 A;  4G12 A;  5K7F A;  1XSV A;  4M3B A;  4O3M A;  4DYC A;  1ZRC A;  1UFM A;  3KP3 A;  1YJW I;  4ESJ A;  4EAT A;  2QM3 A;  5B3S H;  4R79 A;  3T1B A;  4H0E A;  3G2B A;  4TV7 A;  3ML6 A;  3HDD A;  4XNF A;  1Z05 A;  3L2W A;  3GYH X;  3BR1 A;  2ZJP F;  2HXI A;  2BY3 A;  4NQW B;  1UB9 A;  3F3X A;  4NDL A;  5E3O A;  3JTG A;  2R5Z B;  3WTY C;  5HOO A;  2E71 A;  1J7K A;  4N4N B;  5E79 C;  4DBQ A;  3R60 A;  3OWT A;  3VSL A;  4M71 A;  5IOZ A;  3UNG C;  2EPF A;  4Q47 A;  3VOE A;  3X2Q H;  4XK4 A;  1B72 A;  1K79 A;  3CES A;  1UHM A;  4BNC A;  1WJD A;  3DBL B;  2P7C B;  5L3G A;  3DFG A;  1H88 C;  3HTU A;  2L5Q A;  5HLI A;  2M7A A;  1IV6 A;  3N4M A;  2XPW A;  3RKW A;  1OCR H;  1O3R A;  1TLH B;  3QPH A;  4YG2 F;  4I99 C;  4I98 B;  4XKB A;  1SFO J;  3FMS A;  3JRF A;  3PNV A;  2E7W A;  5KHD A;  2FNA A;  2FNP A;  4HV6 A;  2O6G E;  2HQA A;  1GLN A;  5DCM A;  5E8G A;  5TRD A;  2A6T A;  3RZD J;  2RNJ A;  3ECO A;  4LLG F;  1YG2 A;  3ZQG A;  1LUJ B;  3LAJ A;  4XKC A;  2DTR A;  1E17 A;  3A01 A;  1EF4 A;  1ZR2 A;  2VLA A;  4HPQ A;  3KYD B;  3H92 A;  2JA2 A;  3FXU A;  4P1W A;  2VBX A;  3MCZ A;  2EQR A;  3ESW B;  3S15 J;  5ICE A;  1IN5 A;  5D5V B;  2DU9 A;  5F0C A;  4RGS A;  4AUX A;  1VQP I;  2VXD A;  5B1A H;  1WVR A;  2A5W A;  2PMU A;  3ECH A;  4RA2 A;  4E7L A;  1IRZ A;  4E7S A;  5FKL A;  3A02 A;  1MH4 A;  5D8K B;  4EEF G;  3SFZ A;  1OCC H;  3H3U A;  3K69 A;  4LK0 F;  1K78 B;  1G4D A;  3B6C A;  4A0Z A;  1ZH5 A;  3CDH A;  4XRF A;  1Y1W J;  2BXZ A;  2K9N A;  3QRF F;  1R5I D;  4E4H A;  2P5V A;  5M5X J;  1IN8 A;  1JGG A;  1ZGJ A;  1UEL B;  2MBF A;  3CP2 A;  3H3V K;  1W36 C;  2CMP A;  3BG7 A;  4BAY A;  4JX5 A;  1S7O A;  4AD9 A;  5H6Q A;  4A3L J;  3ROU A;  2OQG A;  4B3A A;  1XCV A;  1D8K A;  5A2Q K;  3CUQ C;  2NVT J;  2ZB9 A;  1MW7 A;  5J4Y A;  4B8X A;  1DU6 A;  3F8N A;  1USS A;  1R5H A;  2CW8 A;  3GUD A;  3KCC A;  1JTY A;  1X3Z B;  1Y0N A;  1QRY A;  5E3M A;  1V5F A;  5K7Z A;  2CU7 A;  2DK5 A;  2HPI A;  3JRC A;  1U8B A;  2TCT A;  3KEQ A;  4HYE A;  4KYW A;  1U8R A;  4BS9 A;  1BR2 A;  1KU2 A;  1FBQ A;  3IH4 A;  1MGT A;  1HC8 A;  2W82 A;  2CUE A;  2OZU A;  3CJR B;  2VJ4 A;  3SZP A;  2F5C A;  3FIW A;  2L7M P;  2Z9O A;  3SDB A;  1X1P A;  2M8G X;  4XQF A;  1R6R A;  1IW7 F;  3WE2 A;  3WGG A;  5E1Z B;  4XID A;  1SVL A;  3FXK A;  4U0W A;  4ZYE A;  5DTD A;  1HSJ A;  3MKW B;  1G3T A;  1I50 J;  4BQA A;  5HLT A;  2DA4 A;  3EYI A;  5BPI A;  3WTV C;  1EH8 A;  2ELK A;  3K4L A;  1Y0U A;  2BYV E;  2BXY A;  3MKL A;  5ILS A;  4DYR A;  5C4X J;  4HG2 A;  1AU7 A;  5LRR A;  1G3Y A;  3GME A;  2KIS A;  4LD5 A;  3ZCO A;  1A6Q A;  3E5U A;  2BY0 A;  2LSO A;  2MC3 A;  2CV1 A;  2O8K A;  3DTI A;  2WC2 A;  1ZHF A;  2V7F A;  2Q8K A;  3F72 A;  5LGT A;  2R5Z A;  2KIU A;  4BKX A;  1T0F C;  2RVC A;  5GP9 A;  4RAZ A;  2NS0 A;  2R7S A;  3HBL A;  5E20 A;  1JHH A;  3KE2 A;  3RPU D;  4FE7 A;  1U6G A;  5IP7 J;  4XMY A;  4AIH A;  2V9K A;  2GQQ A;  3L1P A;  1VQ5 I;  1OKR A;  3VEP A;  5CVV A;  4KA4 A;  1RES A;  1TW2 A;  4DQ2 A;  3UR3 C;  1UAA A;  3KYC B;  4CA0 A;  1WJ5 A;  1E3H A;  1LPQ A;  1S5L C;  3ONQ A;  2EIM H;  4C2M J;  5F1J A;  2OCC H;  2M0C A;  2VI6 A;  3ELK A;  4P96 A;  3WG7 H;  5BMZ A;  4KIC A;  4XR6 A;  2GM4 A;  5D6E A;  4IVN A;  2XDV A;  1BR1 A;  1POG A;  2HYF A;  2M8E A;  1MJ9 A;  2ME0 A;  2QUF A;  3QOP A;  4U0Y A;  2VBW A;  1YW7 A;  3WTZ A;  1FYM A;  5B5E C;  3RQ4 A;  4BUP A;  4HX7 A;  1TW3 A;  4PFO A;  4D1Q A;  1IDZ A;  3QAH A;  4JK1 X;  2CWE A;  5FRM A;  2DFI A;  4MQV A;  4ZDL A;  4PUS A;  2HYJ A;  3OR1 C;  4LGW A;  1MND A;  2JUC A;  1S3J A;  1S8N A;  3U1D A;  2JZY A;  3BTL A;  3IWZ A;  3TP3 A;  3NEU A;  5FLV A;  1Z9C A;  3T5X A;  3K0L A;  5FLX Z;  9ANT A;  1TZL A;  4IL6 C;  2Y0M A;  1WSU A;  1K78 A;  2ELJ A;  2K86 A;  3S17 J;  4JQF A;  2LR8 A;  3VYR B;  4S05 A;  4FE4 A;  3S2D J;  3I64 A;  3P9I A;  2IEK A;  2K9S A;  3IWF A;  5FRO A;  2IS2 A;  1WKM A;  2QGU A;  1WFX A;  2DN0 A;  3KIO A;  4F7Z A;  3SYT A;  2XF5 A;  3FZV A;  3I3L A;  3T0Y A;  1YO5 C;  4LG0 B;  3PFI A;  2Y2Z A;  2LC2 A;  1V4R A;  2FOW A;  3HHH A;  4XLC A;  1RZ4 A;  4IPA A;  2CQN A;  2PMZ A;  2PG4 A;  1P92 A;  2XAU A;  2DFF A;  3D5R C;  1RR8 C;  1SFK A;  4M3F A;  1FP2 A;  3QYB A;  3IC7 A;  3HTS B;  2LDU A;  3VB2 A;  5CJ9 A;  1JJ8 C;  4IEJ A;  2Q1Z B;  3PNY A;  1QNT A;  2Q2E B;  2UXX A;  2EIL H;  4PJL A;  2IRF G;  4EM0 B;  2VE9 A;  1RKW A;  1RC9 A;  3F9K A;  4UUV A;  1FWZ A;  3ZPL A;  1R23 A;  4XOR A;  4IHT A;  1AWC A;  5HDK A;  5IP6 A;  3HJE A;  1J75 A;  1D1B A;  3J80 Z;  5DCF A;  3QQA A;  1STZ A;  1U2W A;  3JW4 A;  2MFZ A;  2M87 A;  3OYB A;  4B44 A;  4OWR B;  2LKX A;  3BZC A;  3BDD A;  2K3P A;  3IV5 A;  1O3T A;  4JBA A;  1LDD A;  2WY7 Q;  2MC4 A;  1UST A;  4AID A;  3EET A;  4D0P A;  1FEX A;  1S6L A;  1LKX A;  5FD6 A;  3FXR A;  4GXO A;  4EV0 A;  4XLA A;  1MSE C;  4HF0 A;  2FOK A;  2E1C A;  5GPC A;  2HXO A;  4IO9 F;  3BY6 A;  4CCM A;  1SAX A;  3S16 J;  2EZL A;  1Z0X A;  4A6D A;  3GTK J;  1ODD A;  3LSH A;  3M3Y J;  3AG2 H;  2FQ3 A;  3DCF A;  4MGR A;  5H2F C;  3I58 A;  1K83 J;  2NVQ J;  1KYW A;  1RNL A;  3GVA A;  4OIO F;  2EIN H;  5HS7 A;  1TWC J;  3LQQ A;  3Q9V A;  2XRN A;  3IKT A;  1R4N B;  1HQC A;  3E3V A; 
#chains in the Genus database with same CATH homology
 2OD5 A;  4IRG A;  1B9M A;  1T39 A;  2Z99 A;  2JT1 A;  2BE5 F;  5J8C A;  3WU0 A;  2KJB A;  2FBH A;  5IT9 Z;  2ZME A;  1U5T C;  4NB5 A;  4GGG A;  4RGU A;  3ZN0 A;  4EJO A;  4HAM A;  1W5S A;  1G6N A;  3GFL A;  1XCB A;  2CGP A;  4ESF A;  4I2O A;  2V6C A;  1LVA A;  4LLN A;  2NNY A;  2P6S A;  2UZK A;  4U0V A;  3RIR A;  1XSD A;  5BS6 A;  2DW4 A;  2EV5 A;  5HDN A;  3ZMU A;  1LEB A;  1E2X A;  2FF4 A;  2XAS A;  4A5N A;  4IXA A;  4M73 A;  2KRF A;  5L3D A;  3F23 A;  2KKO A;  1TTY A;  3LQR A;  2EA4 A;  1ZLK A;  1XGN A;  3HUG A;  4UVC A;  2GXB A;  2VE8 A;  2HZT A;  2P5L C;  3DV8 A;  1PDN C;  1ZRE A;  1ULY A;  1YLF A;  1SFX A;  4LFU A;  1OPC A;  4OIP F;  4G8X A;  3RYR A;  5FLX K;  2FU4 A;  1QBJ A;  4BXU A;  3L00 A;  5J6X A;  3CO7 C;  5L3C A;  2RKH A;  3BP8 A;  2VT3 A;  2EV6 A;  4N9I A;  2OAZ A;  5K5Q A;  4XSX F;  4KIG A;  1PP8 F;  1R58 A;  1IN4 A;  3I0T A;  1HKT A;  3FM5 A;  2ISZ A;  2PJP A;  2MLG A;  3QP5 A;  4O6J A;  3GZ6 A;  2GAU A;  1IRF A;  4MTE A;  2XAF A;  3JSP A;  5H6R A;  1FYL A;  1BJA A;  2FA5 A;  1T6S A;  2P8T A;  3TDU C;  4EMS A;  2NNN A;  3COA C;  3F8B A;  2M30 A;  2WTE A;  3EUH A;  2HTJ A;  3TGN A;  3J80 K;  1RI7 A;  1RUO A;  1XD7 A;  5J8F A;  4HX4 A;  2A69 F;  2ESN A;  5K1Y A;  1MJA A;  3HSF A;  1XGS A;  1ON1 A;  1DPR A;  2ACJ A;  3WTT C;  3ZMT A;  2GZW A;  3J7A O;  4MHG A;  2EB7 A;  1J2X A;  3GX4 X;  5BOX A;  3WTX C;  2IP2 A;  4OU0 A;  4RGR A;  4YFN F;  1HKS A;  3MQ0 A;  4WXD A;  4HX8 A;  1R36 A;  1BN5 A;  3F8M A;  1FLI A;  4M9S A;  2DLL A;  2EV0 A;  1KA8 A;  2ZO4 A;  2E1N A;  2VN2 A;  3RDI A;  3MAJ A;  4I01 A;  4ZZL A;  1FPQ A;  3C7J A;  4BYY A;  1YQA A;  2XKP A;  5IT9 K;  3FMR A;  3KP6 A;  4QLC U;  2H27 A;  5AIP A;  2HQN A;  3JSO A;  3OV8 A;  4A6E A;  2ISY A;  1EV7 A;  2PEX A;  3U2R A;  4XBF A;  4WWC A;  3P9C A;  4HV5 A;  4K2E A;  3WTS C;  2CO5 A;  4HA8 A;  1WRJ A;  2P5K A;  1P4A A;  3HRT A;  4FX4 A;  5DUI A;  4HDV A;  1AOY A;  3I4P A;  2D1H A;  2JSC A;  5ERI A;  3U9G A;  3MWM A;  4RS8 A;  1WWX A;  3W6J B;  1LJ9 A;  2M5W A;  5FO5 A;  3WOD F;  5LEK A;  3ZQ7 A;  4PGH A;  1QZZ A;  2OA4 A;  4G7O F;  2YR2 A;  2EJR A;  1J9I A;  5CVR A;  5AIQ A;  3R61 A;  4EM2 A;  5K5O A;  4QWQ A;  3WGI A;  1SFU A;  4P5O A;  2P4W A;  3E6M A;  1MJB A;  1OYY A;  5LGU A;  4LB6 B;  1IN6 A;  2QQA A;  5D6F A;  4L9V A;  3EDP A;  5HVQ C;  1L3L A;  4HF1 A;  3TDZ C;  3IRQ A;  3TQN A;  3ZP5 A;  4GO1 A;  1OYI A;  2O3F A;  3FMQ A;  2BV6 A;  2HDC A;  4RB3 C;  4WCG A;  3JAM Z;  4WK8 F;  4L5I A;  3F21 A;  3RPQ A;  1YYV A;  4EJU A;  2HWV A;  4FT8 A;  3KFW X;  2QQ9 A;  3V7C A;  3T8T A;  1I27 A;  5L3F A;  4BHP A;  1JHF A;  2O8X A;  2AXL A;  4UNO A;  2LNB A;  4HDU A;  2GA2 A;  6PAX A;  2AS5 F;  2OU2 A;  1I1S A;  1G3W A;  4ETS A;  5ICC A;  4WXH A;  2EFP A;  4KMU X;  3D5L A;  1I1G A;  1XB4 A;  1BBY A;  2XRO A;  1IAW A;  3TOB A;  1O7F A;  3BZ6 A;  1V3F A;  4OMY A;  1U5T B;  2P6T A;  4RB2 C;  1XMK A;  2QVO A;  4OIQ F;  1ZG5 A;  1XGM A;  4CXF A;  5D5W B;  5H20 A;  4NQW A;  2IW5 A;  3GXO A;  3HOS A;  3VOD A;  3SZT A;  5KVR A;  3MZY A;  1I6X A;  4A2U A;  4Q4Z F;  5IT3 A;  1TQM A;  3H3Z A;  1LB2 A;  4N0B A;  2XAH A;  2FSW A;  3K1N A;  1C0W A;  2QQB A;  3NQO A;  2X0L A;  1O3S A;  3QU6 A;  4I02 A;  1R1T A;  2VOO A;  5JR3 A;  2A61 A;  4UV8 A;  2W84 A;  1SD6 A;  1FYK A;  4EM1 A;  3BPX A;  2IJL A;  1ZYR F;  4CZZ A;  4EVI A;  1R7J A;  1QZY A;  2O61 A;  2J5P A;  2CG4 A;  1K6O A;  2XKO A;  2HFH A;  2FBI A;  3MEX A;  1H9T A;  2ADU A;  4G6D A;  3I71 A;  2YX7 A;  3IHU A;  2YSR A;  4N9H A;  2ZBK A;  4HQM A;  2XUB A;  4BHC A;  4U7B A;  3BWG A;  3ZMZ A;  4ZYG A;  2LKP A;  5F1R A;  4IF4 A;  2OBP A;  4PGG A;  3M7G A;  4IHS A;  3M8E A;  2CW0 F;  2L3D A;  3DPL C;  2V79 A;  3DKW A;  1FT9 A;  3WE3 A;  4P9U A;  4EGY A;  1BI3 A;  1W7P B;  5E1X A;  2DBB A;  3I59 B;  3F22 A;  2H94 A;  2R7F A;  2XVC A;  1ZRD A;  5K5R A;  1S29 A;  3FF5 A;  3RJP A;  1MD0 A;  4MTD A;  3KET A;  1O57 A;  1DUX C;  5HLH A;  5D4S A;  1GXQ A;  2H6B A;  3ZMS A;  2G7H A;  3BJA A;  3K1M A;  1IXR C;  1Z1D A;  5JHU A;  3E5X A;  1BM9 A;  1B59 A;  3JAM K;  5E17 F;  4M9Z A;  5DEQ A;  3GZ5 A;  3G73 A;  4LK1 F;  3REO A;  3M8F A;  3ZMD A;  1MZB A;  2CQK A;  1LQ1 A;  1RIO H;  1FOK A;  2ZNY A;  4XSZ F;  2KIM A;  5BPD A;  2V1X A;  1J0R A;  3HRU A;  4ZH4 F;  1OR7 A;  2DK8 A;  1ZN2 A;  1R22 A;  2F5D A;  3ZN1 A;  3SHF A;  1KQ8 A;  3HSR A;  1GXP A;  1B1B A;  4Z2Y A;  3HYI A;  1BOA A;  1FX7 A;  1UCR A;  2EFN A;  4CDG A;  2VBZ A;  3KP4 A;  1YTY A;  2MLK A;  5FD5 A;  3HIF A;  1JE8 A;  2J5O A;  3LST A;  4S04 A;  2V9V A;  2A6E F;  4CGZ A;  4KN7 X;  2VC1 A;  1G3S A;  1TBX A;  2YX4 A;  4CYD A;  2OQR A;  2PBI A;  4DNC A;  2Y48 A;  3SXY A;  2EWN A;  4U7D A;  4M72 A;  3KP5 A;  5HS9 A;  2HQR A;  2IA2 A;  5CLS A;  3K9T A;  4A0Y A;  3HRM A;  2ESH A;  3O6B B;  2G9W A;  5DV5 A;  2RC4 A;  2VOP A;  3CJN A;  3C3W A;  1JGS A;  3WGH A;  4LG0 A;  4M9X A;  3RTR A;  3K2Z A;  2L4M A;  3NRV A;  5FFZ A;  2O03 A;  3DQV C;  1HKQ A;  3DXJ F;  3QU3 A;  3HRS A;  4XLP F;  2FEZ A;  3FXQ A;  3Q9S A;  3C1D A;  4R8H A;  4OOI A;  2Q2E A;  3I59 A;  3I53 A;  5ILU A;  3E6B A;  1Z6T A;  2L4A A;  1K7A A;  1ZLJ A;  4A5M A;  4B09 A;  4ESB A;  4CHU A;  3BJO A;  3BRO A;  5EEG A;  2PQ8 A;  3PQK A;  1I5Z A;  2NAZ A;  3I54 A;  1SFE A;  5E1W A;  2QLZ A;  4GYI A;  1S7A A;  2VT2 A;  2OZ6 A;  4HQE A;  3FX3 A;  4NHJ A;  4KMF A;  5E8I A;  1ONV A;  4I09 A;  1FY7 A;  3TO6 A;  3IL2 A;  2XAG A;  4AIK A;  3F8F A;  2K7L A;  1YFH A;  4G6Q A;  2GA1 A;  3CUQ B;  3GFM A;  2DPD A;  2ETH A;  2Y75 A;  2R7D A;  5LGN A;  4LJZ F;  4M6Y A;  3ISP A;  2Z5U A;  2COM A;  4YFX F;  3E97 A;  1W4M A;  2GIV A;  2G7U A;  2V1D A;  1SMY F;  2BBY A;  4U88 A;  1BI0 A;  3F8C A;  1CF7 B;  2K27 A;  2UWM A;  2FML A;  3WTU C;  1SD4 A;  1FSE A;  5ED4 A;  1REP C;  4Y15 A;  1P4W A;  2KIF A;  1R1U A;  2ZNZ A;  1H0M A;  2RDP A;  3WU1 B;  2V1U A;  3MFK A;  2NRA C;  3B73 A;  5HLG A;  1R1V A;  4L5J A;  5LHH A;  1XN7 A;  4HLY A;  4AVP A;  1IXS B;  4RB0 A;  3S2W A;  2W85 A;  1JXS A;  2HKO A;  4MEY F;  2X4H A;  2L54 A;  2DPU A;  1F9N A;  3V8J A;  4M74 A;  1IN7 A;  1ZAR A;  3ERE D;  5JVT A;  3CLO A;  4UVA A;  2DT5 A;  3O2P E;  3P7N A;  2W25 A;  3KP7 A;  1RUN A;  2QEN A;  2EFQ A;  3T8R A;  3V7R A;  3E6C C;  4KFC A;  4L0Y B;  1F4K A;  4L0Z B;  1TQI A;  1IF1 A;  1BI1 A;  4G9Y A;  5CYV A;  3DEU A;  2CYY A;  3DF8 A;  1SD5 A;  5ILV A;  4OIN F;  1TNT A;  3J81 Z;  2QYO A;  2ELH A;  2VXZ A;  5BQT A;  4PDK A;  4OMZ A;  5E18 F;  1FSH A;  3OOP A;  2YU3 A;  5L3B A;  1EH7 A;  2MA3 A;  2DI3 A;  3L9F A;  3JTH A;  3QP6 A;  3CUQ A;  2KJC A;  1EH6 A;  4R1H A;  2H09 A;  2H6C A;  1W5T A;  3FM3 A;  3GEZ A;  2EFO A;  4ENK A;  2RQP A;  1KU3 A;  4YFK F;  5JFR A;  1CF7 A;  3KZZ A;  3V7S A;  4M6X A;  2D2W A;  1BIB A;  4HBL A;  2F2E A;  3GFJ A;  2PFB A;  2R3S A;  3L09 A;  1DDN A;  2WV0 A;  1FP1 D;  5FFX A;  2A6H F;  2VOD A;  2XIG A;  3RKX A;  2FXA A;  2CFX A;  2K02 A;  4CIC A;  3B02 A;  5LEJ A;  4UV9 A;  1MDM B;  1T0F A;  2STW A;  4L9T A;  5ICG A;  5AON A;  3EQL F;  3QPT A;  3R0A A;  3IKV A;  4BH9 A;  1YW9 A;  2XAJ A;  1LEA A;  2HKX A;  3P9K A;  2PLY A;  1QQI A;  3FWE A;  2DAO A;  2IVM A;  4KT5 C;  3LAP A;  2ZJ2 A;  4GYG A;  2QWW A;  2JPC A;  2FE3 A;  4UHT A;  1Z7U A;  1KQ0 A;  1KU7 A;  1ZG3 A;  1TQP A;  2Z3Y A;  5DYM A;  3M9A A;  3EYY A;  1FNN A;  2IA1 A;  1UHW A;  1B4A A;  1LDJ A;  4ZYH A;  5DD4 A;  1LNW A;  1TNS A;  5TJJ A;  3AAF A;  2XAQ A;  3V8K A;  1T2K A;  4G94 A;  1QPM A;  1D3Y A;  2F5F A;  3GF2 A;  4WX9 A;  1WQ2 A;  5DUK A;  3RKY A;  3MZH A;  4EJW A;  3F6V A;  1BI2 A;  5L3E A;  2ZFW A;  1FBU A;  1D5V A;  3CUO A;  5JI6 A;  1J59 A;  3F6O A;  4HOB A;  2A5Y B;  3GLX A;  1YW8 A;  1LDK B;  5EEH A;  4AWX B;  4KN4 X;  1U78 A;  3SQN A;  3W6K B;  5LBQ A;  4ON0 A;  5D5U B;  4I0B A;  3ABT A;  4G7Z F;  5CVU A;  5D8L B;  1B9N A;  2ZME B;  4EGZ A;  2HOE A;  4Y17 A;  4MNU A;  3J81 K;  4PCQ A;  1BIA A;  2XHK A;  4HF2 A;  5CVJ A;  1ZG1 A;  4MEX F;  1DP7 P;  1ON2 A;  2NYX A;  2RV8 A;  2JTV A;  1HXD A;  2DQR A;  2L01 A;  5D4R A;  4AIJ A;  4KUM A;  1U3E M;  3CO6 C;  3GO5 A;  2M45 A;  2IA0 A;  4EQQ A;  1MDM A;  2EFW A;  1P4X A;  2A68 F;  4G7H F;  2MH9 A;  3M1E A;  2YPR A;  3KLO A;  3PQJ A;  1KGS A;  2HEO A;  3HHG A;  1ZGA A;  4O5V A;  4ASN A;  2BGC A;  3I5U A;  3IRR A;  1HW1 A;  3RPU A;  1BC7 C;  2O0Y A;  3ULQ B;  3HSE A;  4YIF A;  2RN7 A;  1HW2 A;  4L9J A;  5LHI A;  1Q1H A;  1D8J A;  2F5E A;  1Z6R A;  4RB1 A;  2M1B A;  5HDG A;  3ZMV A;  4KIF A;  2K4B A;  5FGM A;  1FZP B;  3L2C A;  1HBX G;  1U5T A;  1IZ1 A;  2RGV A;  4IRH A;  1QGP A;  4Y13 A;  2PN6 A;  1XGO A;  2LF7 A;  2MD5 A;  1HST A;  3BJ6 A;  4CO8 A;  2VC0 A;  1YIO A;  4ZZD A;  1O3Q A;  2D1V A;  2FMY A;  4OIR F;  2HR3 A;  1W7P D;  3FHZ A;  3R0J A;  3KLN A;  2UXN A;  4EJT A;  1OYW A;  1R00 A;  4HW0 A;  3GWZ A;  2QBY B;  5LRS A;  4KNY A;  2L02 A;  4HLX A;  4GCV A;  2P7V B;  5FB2 A;  3KZY A;  3WG9 A;  4ENM A;  2MH2 A;  1XDS A;  4EJV A;  1PP7 U;  1DPU A;  2EA2 A;  4ENJ A;  1F1Z A;  2C6Y A;  3V8L A;  4A0X A;  4Q5S F;  3BOQ A;  1SMT A;  1IRG A;  1F5T A;  1IXC A;  5F64 A;  1CGP A;  1P2F A;  3LA2 A;  3HOT A;  3VFZ A;  4UXN A;  1FBS A;  5D5X B;  2ZXJ A;  5KK1 A;  3DPT A;  2B0L A;  1P6R A;  2Q0O A;  2QZ8 A;  5LHG A;  2JPB A;  3TKY A;  3LA3 A;  1W7P A;  1A04 A;  2E7X A;  2CSO A;  4LB5 A;  2HTS A;  1L0O C;  3GFI A;  4Q48 A;  3N97 A;  2A07 F;  2FBK A;  3GW2 A;  2STT A;  5ICF A;  1T38 A;  2A3S A;  3K1P A;  3RYP A;  1YS6 A;  4KIB A;  1YS7 A;  3TOA A;  5DD8 A;  2FRH A;  1GVJ A;  4IRI A;  2IT0 A;  1QO0 D;  3G3Z A;  1O7L A;  4I7H A;  1SD7 A;  2LF8 A;  4UVB A;  1ZAO A;  3TO9 A;  2GWR A;  4RAY A;  1J5Y A;  2Z33 A;  2K4J A;  1VTN C;  1XSX A;  4L18 B;  3LWF A;  1ZRF A;  1HW5 A;  1B6A A;  2HGC A;  2D45 A;  1H9G A;  1T98 A;  5CVI A;  4WF2 A;  5DDG A;  4E70 A;  1XDU A;  2TDX A;  4FHT A;  2XV4 S;  3Q5F A;  2PI0 A;  2GXG A;  2PMH A;  1BC8 C;  1PUE E;  2W24 A;  5LLQ A;  4XLN F;  3WTW C;  3CTA A;  4PZJ A;  5DCM B;  4YII A;  1MKM A;  5HS8 A;  2BEO A;  1GHC A;  5A2Q Z;  4ENN A;  4P9F A;  2EK5 A;  1FC3 A;  2QBY A;  3C18 A;  2HS5 A;  3D0S A;  4RGX A;  2WWY A;  1OMI A;  4L9N A;  2IPQ X;  2ZKZ A;  4LLL A;  2VON A;  1Z91 A;  4ZYD A;  2JRT A;  4MQ9 F;  3BPV A;  1IUY A;  3RI4 A;  2DQL A;  2XGX A;  3E6D A;  4WXC A;  4KDP A;  4LMY A;  2VBY A;  3LA7 A;  3R6S A;  3TO7 A;  3L7W A;  3DP7 A;  1R5G A;  3ABU A;  1KU9 A;  3R4K A;  3V4G A;  3KP2 A;  3LFK A;  2W57 A;  1X3U A;  4HZF A;  4A12 A;  4IJA A;  1KYZ A;  1XMA A;  1KQ9 A;  2HYG D;  3KEO A;  4FX0 A;  4I0A A;  4P55 A;  1NHA A;  2DO7 A;  2ZCW A;  5F6F A;  4BHB A;  3E5Q A;  3O3K A;  1WI9 A;  1XSV A;  4O3M A;  1ZRC A;  1UFM A;  3KP3 A;  4ESJ A;  2QM3 A;  4R79 A;  3T1B A;  4H0E A;  4TV7 A;  3ML6 A;  1Z05 A;  3GYH X;  1UB9 A;  3F3X A;  3JTG A;  3WTY C;  5HOO A;  1J7K A;  3R60 A;  4M71 A;  4Q47 A;  3VOE A;  1K79 A;  1UHM A;  4BNC A;  2P7C B;  5L3G A;  3DFG A;  3HTU A;  5HLI A;  3N4M A;  3RKW A;  1O3R A;  1TLH B;  3QPH A;  4YG2 F;  4I98 B;  3FMS A;  2E7W A;  2FNA A;  2FNP A;  4HV6 A;  2O6G E;  5DCM A;  5E8G A;  5TRD A;  2RNJ A;  3ECO A;  4LLG F;  1YG2 A;  3LAJ A;  2DTR A;  1E17 A;  3H92 A;  3FXU A;  2VBX A;  3MCZ A;  5ICE A;  1IN5 A;  5D5V B;  2DU9 A;  4RGS A;  2PMU A;  3ECH A;  5D8K B;  3SFZ A;  3H3U A;  3K69 A;  4LK0 F;  1K78 B;  1G4D A;  4A0Z A;  1ZH5 A;  3CDH A;  4XRF A;  3QRF F;  2P5V A;  1IN8 A;  1ZGJ A;  2MBF A;  4BAY A;  1S7O A;  4AD9 A;  5H6Q A;  3ROU A;  2OQG A;  1XCV A;  1D8K A;  5A2Q K;  3CUQ C;  4B8X A;  3F8N A;  1USS A;  1R5H A;  3GUD A;  3KCC A;  2DK5 A;  4KYW A;  3KEQ A;  4HYE A;  1U8R A;  1KU2 A;  1FBQ A;  1MGT A;  2OZU A;  3SZP A;  2F5C A;  2Z9O A;  1IW7 F;  3WE2 A;  3WGG A;  5E1Z B;  4U0W A;  4ZYE A;  1HSJ A;  1G3T A;  4BQA A;  3EYI A;  5BPI A;  3WTV C;  1EH8 A;  1Y0U A;  2BYV E;  5ILS A;  5LRR A;  1G3Y A;  4LD5 A;  3E5U A;  2LSO A;  2MC3 A;  2WC2 A;  1ZHF A;  2Q8K A;  3F72 A;  5LGT A;  2KIU A;  2RVC A;  4RAZ A;  2NS0 A;  5E20 A;  1JHH A;  3KE2 A;  1U6G A;  4AIH A;  2GQQ A;  1OKR A;  3VEP A;  5CVV A;  4KA4 A;  4DQ2 A;  1TW2 A;  3ELK A;  4P96 A;  5BMZ A;  4KIC A;  5D6E A;  4IVN A;  2HYF A;  2M8E A;  1MJ9 A;  4U0Y A;  2QUF A;  3QOP A;  2VBW A;  1YW7 A;  3WTZ A;  1FYM A;  4HX7 A;  1TW3 A;  3QAH A;  4JK1 X;  2CWE A;  2DFI A;  4MQV A;  4LGW A;  1S3J A;  1S8N A;  3U1D A;  2JZY A;  3IWZ A;  3NEU A;  1Z9C A;  3T5X A;  3K0L A;  5FLX Z;  1WSU A;  2Y0M A;  1K78 A;  2K86 A;  4JQF A;  4S05 A;  3I64 A;  3P9I A;  3IWF A;  1WKM A;  4F7Z A;  3FZV A;  3T0Y A;  1YO5 C;  4LG0 B;  3PFI A;  1V4R A;  3HHH A;  1RZ4 A;  4IPA A;  2PG4 A;  1P92 A;  1FP2 A;  3IC7 A;  3HTS B;  2LDU A;  3VB2 A;  5CJ9 A;  1QNT A;  2UXX A;  2IRF G;  4EM0 B;  2VE9 A;  4UUV A;  1FWZ A;  3ZPL A;  1R23 A;  4IHT A;  1AWC A;  5HDK A;  1J75 A;  3J80 Z;  5DCF A;  1STZ A;  1U2W A;  3JW4 A;  2M87 A;  3BDD A;  1O3T A;  4JBA A;  1LDD A;  1UST A;  3EET A;  4D0P A;  1S6L A;  5FD6 A;  3FXR A;  4GXO A;  4EV0 A;  2E1C A;  4HF0 A;  2FOK A;  3BY6 A;  1SAX A;  4A6D A;  1ODD A;  2FQ3 A;  4MGR A;  3I58 A;  1KYW A;  1RNL A;  3GVA A;  4OIO F;  5HS7 A;  3LQQ A;  3Q9V A;  2XRN A;  3IKT A;  1HQC A;  3E3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...