1W7PD

The crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
171
structure length
171
Chain Sequence
LDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VPS22, YPL002C
publication title Escrt-II, an Endosome-Associated Complex Required for Protein Sorting: Crystal Structure and Interactions with Escrt-III and Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 49
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04157 EAP30 EAP30/Vps36 family
D PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36
D PF16988 Vps36-NZF-N Vacuolar protein sorting 36 NZF-N zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w7pD02
3FMSA 1IN7A 3ZMDA 4LFUA 3HRMA 2HGCA 3CDHA 5K5OA 1GXPA 3MZYA 4CO8A 4FT8A 2Y75A 1BI0A 1ZG5A 1J7KA 3V7RA 1BIAA 4AWXB 4A5MA 3E5QA 4CYDA 2CO5A 4G94A 1FSHA 4BXUA 3LQQA 3F8CA 5HLIA 3TOBA 5D5XB 4Y17A 3GYHX 2FMLA 1Z91A 3IRQA 2JPBA 5F6FA 4EV0A 4KIFA 4A5NA 4FX4A 2ACJA 3CO6C 3RYRA 4D0PA 4N0BA 2UXXA 2Z9OA 4U7DA 4I7HA 1U78A 3HOTA 1R22A 1TQPA 1LNWA 3IKVA 1OYWA 4RB1A 3IRRA 3P9CA 2GXGA 1HXDA 2M8EA 1B6AA 3P9IA 2F2EA 5DUKA 3CLOA 1PP7U 2LF7A 4XBFA 5JVTA 1XN7A 2KJBA 4BAYA 2ISZA 2LF8A 1W5TA 2X4HA 5EEGA 4ETSA 1WWXA 1BI2A 4MHGA 3B73A 2DI3A 2F5FA 3W6KB 5K5QA 4HQEA 4N9IA 1IXRC 2FSWA 1FOKA 2M30A 1G3WA 1B1BA 4IXAA 2OZ6A 2FF4A 1ZYRF 2Z3YA 5JFRA 1RUOA 4HBLA 4UVAA 3ISPA 1DPUA 2IRFG 5LGNA 2H09A 4A6EA 2DU9A 2XAGA 3GXOA 2DO7A 2LKPA 5LHHA 5HOOA 2E1NA 3PFIA 4WXHA 3DV8A 1LEAA 2PEXA 3E5UA 1P6RA 1PUEE 2J5PA 1LDKB 5FD5A 2FBIA 3RKXA 1ZARA 4A0XA 3R61A 3ERED 1YS6A 4UVCA 3J7AO 4XSZF 4ENJA 1B9NA 5LHGA 4MQVA 1P4WA 4MEXF 3SZPA 3I0TA 3TKYA 1ZHFA 1T2KA 1Z9CA 3GZ6A 2XASA 2NYXA 1KU2A 3KE2A 2NNNA 1Q1HA 2O0YA 1B4AA 4RB2C 5ICEA 2RNJA 1FYKA 2M5WA 2DK8A 1PDNC 4CXFA 2OU2A 3K1PA 2RDPA 1WRJA 2XV4S 1TNTA 3I64A 5KVRA 4R79A 2YU3A 3VB2A 1Z7UA 1YLFA 4GXOA 2QBYB 3E6DA 3TO6A 3JAMZ 5DDGA 1JHFA 3F6OA 1VTNC 3R0JA 3BPVA 5DD8A 4YFKF 3SHFA 3ZMTA 1F4KA 4JQFA 2CYYA 3QU3A 1ZN2A 4EM0B 1IF1A 3WU1B 2YR2A 3F8BA 5F1RA 5LBQA 3D5LA 2ESNA 1W7PA 4OIOF 1O3TA 5FFZA 5A2QZ 3ZN1A 2XAFA 2H27A 2ZMEA 4EJTA 2QYOA 4AIJA 5CVRA 2MC3A 5D8LB 1U6GA 1MD0A 3GF2A 3N97A 3Q5FA 1ZLKA 4HA8A 2EV5A 1S7OA 4KFCA 3FZVA 4M9ZA 3OV8A 1HW5A 3GZ5A 1IXCA 2XKPA 2EFQA 2W57A 2VC1A 3QP6A 2UWMA 5L3BA 2A61A 3WTYC 4OIPF 2VOOA 2MD5A 2HZTA 1HW2A 4KIGA 1J9IA 1CGPA 5LRRA 3U9GA 1R00A 4N9HA 1OKRA 1E2XA 1K6OA 1BM9A 1KU3A 4Q48A 1YW7A 4LLLA 5CVIA 1K7AA 2A07F 3J81K 2EA4A 2HEOA 1EH6A 2PBIA 3TO9A 3B02A 4MEYF 2EK5A 2P5KA 3DP7A 1Y0UA 4LGWA 1J59A 4OIQF 2VE8A 5DUIA 2ZJ2A 2L02A 2ZMEB 2DAOA 3I4PA 1FT9A 3KCCA 1L0OC 2OZUA 1IN5A 3E6BA 3KEQA 1WQ2A 4ZYDA 5FGMA 1S8NA 1UHWA 3R60A 3TO7A 2OQGA 1UFMA 2YX4A 5ICCA 1K78A 2PLYA 3WGHA 1RI7A 2K4BA 2FBKA 3QP5A 1O3QA 2E7WA 2OQRA 4I02A 2HYFA 2QQ9A 5AIQA 2ZO4A 2DW4A 2E1CA 2HKOA 1FNNA 3IHUA 4MNUA 2WC2A 2VOPA 1YIOA 1ZH5A 3U2RA 1QO0D 4BNCA 3ZMSA 1KQ0A 3SQNA 2MH9A 1S3JA 1SMTA 2DFIA 4HDUA 3GUDA 2EWNA 3FM3A 2YSRA 2DTRA 3KP3A 3JTHA 4ZH4F 1LQ1A 2OD5A 1FX7A 4HV6A 4I01A 3WTZA 5D6EA 5CVVA 3RTRA 2EJRA 1USSA 5D4RA 2CWEA 3SFZA 1U8RA 4IHTA 2PMHA 1XDUA 2EFPA 2FNAA 3DPLC 3HSEA 4ENKA 3F3XA 1JE8A 5HLHA 2O3FA 3L9FA 3GW2A 3EDPA 3FHZA 5JHUA 4LMYA 2L3DA 3GLXA 3HIFA 1SFEA 3TQNA 4EJUA 4IF4A 1B9MA 2JRTA 5AONA 1S6LA 3I59B 3T1BA 2HTSA 4A2UA 4XRFA 5JI6A 3RYPA 1XDSA 4EMSA 3FF5A 2L01A 1YW9A 1R58A 2TDXA 1ZRFA 2D2WA 3MZHA 1J75A 3L7WA 1EH8A 2QENA 4ESFA 2R7FA 1O3SA 2ZKZA 5CYVA 3H92A 4RAYA 3KETA 2XAQA 3GFJA 1ZREA 4MQ9F 5H6RA 3H3UA 2VE9A 4KT5C 3T8TA 4PZJA 3COAC 1FZPB 3NEUA 5K5RA 3WTWC 1W7PD 1CF7B 3KP7A 5HLGA 3C7JA 2QWWA 2P4WA 1C0WA 2ADUA 3SZTA 3T5XA 5ERIA 2P6SA 2L4AA 2HQNA 4CHUA 2UZKA 1X3UA 4YIFA 4HX7A 4KN7X 3HOSA 2Q0OA 3I58A 3BPXA 3ECHA 5IT9Z 2F5EA 2W84A 4WF2A 5DCMB 3J80Z 5J8FA 2DLLA 4L9VA 4ZZDA 3FMRA 5H20A 1R5GA 2IA1A 2W85A 2UXNA 4U0WA 4EQQA 2G9WA 2GA2A 5K1YA 3WTUC 1WI9A 3GFMA 1R1VA 5J8CA 3MFKA 4ASNA 1RIOH 2DPUA 4LLNA 1OPCA 1YO5C 1KU7A 1UCRA 3C3WA 3HRUA 4Y15A 2CG4A 2X0LA 3R4KA 4BHBA 5E17F 2JT1A 4ESJA 1SD7A 4Q47A 2QLZA 5BPDA 3ULQB 1R1TA 3V8KA 4KDPA 1SAXA 4L5IA 5D5WB 3AAFA 3M7GA 2A68F 1QGPA 5F64A 2HQRA 1NHAA 3E5XA 2Z5UA 5JR3A 3MEXA 4L5JA 4AD9A 1PP8F 1WKMA 2BBYA 5L3GA 3LQRA 4IJAA 2XUBA 3JSOA 3R6SA 2VBZA 4G8XA 5ICGA 4M71A 1R5HA 4PGHA 4HX4A 1WSUA 3ECOA 4RGXA 1TQIA 1P4XA 2KIMA 4BH9A 5D4SA 5FLXZ 1KYWA 2PQ8A 2M45A 4P5OA 4U88A 4IRHA 3U1DA 4IVNA 3BJOA 3ZN0A 1P4AA 3VODA 4I98B 3RPQA 1SD6A 4LG0A 5DD4A 1I5ZA 2FBHA 1ZGJA 3F8FA 2FQ3A 4Z2YA 1HKQA 4Q5SF 1FP2A 1I1GA 2IPQX 4RS8A 1YW8A 1TW2A 2JPCA 4HYEA 2M87A 4IHSA 1H0MA 3BP8A 4F7ZA 2RC4A 5E20A 4HW0A 4IPAA 4CGZA 3R0AA 1XSVA 3TDUC 2VC0A 5BQTA 4OMYA 2FEZA 3FXRA 5E1ZB 2M1BA 1SMYF 2J5OA 3ZMUA 4UUVA 5EEHA 2GAUA 4GYIA 1XMAA 1KU9A 1QBJA 1O7FA 1T39A 2YPRA 2JSCA 4R1HA 1FBUA 3HSRA 1T38A 2PG4A 3V7CA 4P55A 4HLYA 2COMA 2FOKA 3K9TA 2NAZA 3E97A 2DQRA 3BDDA 3O3KA 1MJBA 3KZZA 3I54A 3M8FA 5ED4A 4KICA 1D8KA 4FHTA 1LEBA 4LLGF 2FRHA 4KMUX 1DUXC 2V6CA 4LG0B 4CZZA 1F9NA 1G6NA 1QPMA 2HTJA 4LB5A 4JK1X 2ISYA 4P96A 2VODA 1U5TA 1FBSA 1KA8A 3E3VA 4EJWA 5CJ9A 2IA0A 1JXSA 1AWCA 3ROUA 3TDZC 3WE3A 1R1UA 4MTDA 3TGNA 3F8MA 2C6YA 3FXUA 3QOPA 4IRIA 4RB3C 4O5VA 3HSFA 1MJ9A 3F21A 1MDMA 5DCFA 2VBYA 2WTEA 2L4MA 1XD7A 3M8EA 4WXDA 4WWCA 1QNTA 3BJAA 3DKWA 1QQIA 3Q9VA 2EA2A 2XHKA 1OMIA 2KIFA 1OYYA 1D5VA 2HOEA 3IC7A 3KP6A 4NB5A 4KA4A 2PFBA 3IWZA 1FP1D 1ZGAA 4B8XA 1MKMA 4R8HA 2MA3A 2EFWA 2FXAA 2RGVA 3KFWX 4EJVA 2NNYA 3N4MA 1IN6A 1Z05A 3C18A 3CTAA 3P9KA 3F6VA 3RI4A 3CUQA 5HDGA 2O61A 2ZBKA 4LK0F 3E6CC 2BE5F 4L9TA 1USTA 3RKYA 1LJ9A 2RVCA 4ZZLA 3JTGA 3RPUA 3DXJF 1IAWA 1R7JA 1YS7A 1QZYA 1KQ9A 2XIGA 2IW5A 2A6EF 2MLGA 4EGYA 1XMKA 1W7PB 4ESBA 5DYMA 3PQJA 3LA2A 4RGSA 2G7UA 3CUQC 4DNCA 4MGRA 2ZNYA 2BV6A 1HQCA 1U2WA 1J2XA 3LA3A 3TOAA 2P6TA 5LRSA 1FSEA 1ZLJA 1HSTA 5D5VB 3RKWA 2ZXJA 1HSJA 1BIBA 3HHGA 2FA5A 1O3RA 2KIUA 1W5SA 2V1DA 3FWEA 2OA4A 1Z6TA 4WCGA 3CUQB 1FYMA 2P8TA 3C1DA 3WE2A 2PMUA 2VT2A 1OR7A 2HYGD 3KLNA 1V3FA 3BJ6A 2A69F 3MWMA 4BHPA 5LEKA 1RUNA 4G7OF 2MLKA 1HW1A 4M6YA 4EJOA 4XLNF 3DQVC 5BS6A 3NRVA 5L3EA 3QPHA 2Y0MA 3MQ0A 1J5YA 4L9JA 1IXSB 4KN4X 3MAJA 1STZA 4S05A 1K78B 2XKOA 4UHTA 2XAHA 5ILSA 3NQOA 4UVBA 1ZG1A 3SXYA 3I5UA 2L54A 4BHCA 1V4RA 3IKTA 2QVOA 1EH7A 2ETHA 2XROA 1KQ8A 2FMYA 1LDJA 1TBXA 5HS7A 5FB2A 1ODDA 3JAMK 4K2EA 3P7NA 2QM3A 3K1MA 2ELHA 3HUGA 3GX4X 5BOXA 3IL2A 3ZMZA 4OIRF 1H9TA 1XB4A 3VEPA 3L09A 2HS5A 2AXLA 2V1UA 3QRFF 4HOBA 4I0BA 1G3TA 2Q2EA 2IVMA 1SD4A 2O8XA 3IWFA 2GIVA 2V79A 3REOA 4ZYHA 4UV9A 1K79A 5A2QK 4WXCA 2VONA 4GO1A 4YIIA 4XLPF 1IUYA 1YQAA 2K4JA 2XAJA 5E18F 1G4DA 1BJAA 1ULYA 3T0YA 2G7HA 3CO7C 5HVQC 4LK1F 1GHCA 4NHJA 4PGGA 3ZP5A 3CUOA 5L3CA 1G3SA 4A6DA 3GVAA 2V1XA 4P9UA 4RGRA 5E1XA 2VXZA 4ENNA 4M72A 2VBWA 3I53A 2STTA 2H94A 2P7VB 4B09A 1L3LA 4AIHA 3L00A 1FC3A 3MCZA 2DQLA 2F5CA 4EGZA 2BGCA 2OBPA 1FPQA 3GFIA 4M74A 4UV8A 4HZFA 2VBXA 3LWFA 3LAJA 1T6SA 5AIPA 4HV5A 3ZQ7A 1I27A 2D1HA 4UXNA 3K0LA 1YYVA 3LAPA 4BQAA 3D0SA 5D8KB 3WTSC 3ABUA 1DPRA 3J81Z 1OYIA 4O6JA 4EM1A 2H6CA 4YFNF 5HDNA 1XSXA 3GFLA 1XCVA 2K27A 3JSPA 2OAZA 1B59A 3LA7A 2GWRA 2Y48A 1FWZA 2IJLA 4E70A 4AIKA 1TLHB 3KZYA 2LNBA 4HLXA 4HAMA 5D5UB 1RNLA 3FMQA 1BBYA 3PQKA 1MGTA 1W4MA 4Q4ZF 1BOAA 4I2OA 5BPIA 1RZ4A 4L0YB 1F1ZA 3OOPA 2FE3A 3WG9A 4XSXF 5E1WA 5D6FA 3WGGA 3ZPLA 3GO5A 4P9FA 4ZYGA 2CSOA 2GA1A 1J0RA 1REPC 4PCQA 5ICFA 2PN6A 2IT0A 4M6XA 2D45A 2P5LC 5HS8A 4CICA 2IA2A 5CVJA 2QBYA 4CDGA 5IT3A 4I0AA 1BI1A 2XVCA 4EVIA 3WGIA 1FY7A 2DK5A 4U0VA 4WX9A 2Z99A 3WODF 4GYGA 5J6XA 3ML6A 1YG2A 2HWVA 2EV0A 3F72A 5KK1A 3KEOA 4G7HF 1KYZA 4HF0A 3EQLF 1QZZA 4U0YA 3LSTA 1IZ1A 3ELKA 2CFXA 3F8NA 2GQQA 3M9AA 5LLQA 4GCVA 1Z1DA 2MBFA 2HDCA 2PJPA 2P7CB 4IRGA 1I1SA 3BROA 5E8GA 1FLIA 4KYWA 1YTYA 3HRTA 3WU0A 2Q8KA 2RKHA 1A04A 1SFXA 2R3SA 1UHMA 2A3SA 4OMZA 4RGUA 4U7BA 2FNPA 2H6BA 1KGSA 4G7ZF 1LDDA 4EM2A 4BYYA 3O2PE 5H6QA 2RQPA 3V4GA 1BI3A 1TTYA 5E8IA 4RAZA 4I09A 3BZ6A 3ABTA 1TW3A 4O3MA 4LJZF 3JW4A 3I71A 2W24A 4L9NA 3W6JB 1S7AA 4NQWA 2NS0A 2CW0F 3GWZA 1U3EM 1ON1A 1AOYA 2QZ8A 3EYIA 4WK8F 2CGPA 5IT9K 5BMZA 2ZCWA 4LD5A 4QLCU 5HS9A 3WTTC 4RB0A 2V9VA 1U5TC 2PI0A 3J80K 2HKXA 3RDIA 1T0FA 2FU4A 1IN4A 3G73A 2D1VA 1GVJA 3FM5A 2RN7A 1S29A 1GXQA 2HFHA 3V7SA 4G6DA 3VFZA 3F23A 3K69A 1BN5A 2BEOA 4A0YA 1IRGA 4LB6B 2O6GE 3V8JA 1TNSA 1U5TB 2QUFA 4UNOA 1DDNA 4KNYA 1UB9A 3K1NA 1HKTA 4H0EA 1JGSA 4JBAA 1IN8A 1MJAA 1LB2A 1E17A 2XGXA 2JTVA 1MDMB 4OINF 3BOQA 2JZYA 2HR3A 2ZFWA 5TJJA 2DBBA 3HTSB 1ZRCA 1SFUA 3EUHA 2O03A 5LHIA 1LVAA 5TRDA 4KIBA 2B0LA 3WTXC 4ZYEA 2AS5F 3LFKA 3ZMVA 1XSDA 3RJPA 3FX3A 4MTEA 1XGMA 4Y13A 2P5VA 2LSOA 2DT5A 3I59A 1EV7A 3QAHA 4HF2A 2MH2A 2QQAA 2DPDA 1MZBA 5DV5A 5DEQA 4YFXF 5FLXK 3KLOA 3GEZA 1IW7F 3HRSA 5FO5A 3KP2A 3QU6A 4HX8A 1BC7C 3HHHA 2IP2A 1O57A 2LDUA 2EB7A 3V8LA 4A12A 4KMFA 1P2FA 1XGNA 3DPTA 5CVUA 5FD6A 3HYIA 4M73A 4A0ZA 3CJNA 5LEJA 2EFNA 5ILVA 2K86A 3QPTA 3T8RA 1IRFA 1R23A 2YX7A 2Z33A 4L0ZB 1DP7P 3RIRA 1P92A 1JHHA 4TV7A 2F5DA 2WWYA 1ONVA 2KRFA 1BC8C 5L3FA 2VT3A 1CF7A 5CLSA 2ESHA 5ILUA 1ZAOA 3EYYA 3K2ZA 4YG2F 5FFXA 3FXQA 1TQMA 1XGSA 1R36A 3DFGA 2XRNA 3EETA 3G3ZA 2KJCA 1D3YA 2WV0A 2EFOA 1G3YA 3DF8A 2BYVE 3KP4A 4PDKA 1ZG3A 5HDKA 2K02A 1YFHA 3HTUA 3WTVC 5DCMA 1O7LA 3KP5A 1HKSA 2W25A 3E6MA 1XGOA 5LGTA 3L2CA 3M1EA 4G6QA 2A6HF 3S2WA 2E7XA 4ON0A 5LGUA 2K7LA 1I6XA 3BWGA 1FYLA 4ENMA 1H9GA 2NRAC 4FX0A 2KKOA 4AVPA 2VN2A 1D8JA 3H3ZA 4HF1A 3F22A 1HBXG 3Q9SA 2GZWA 1SD5A 3BY6A 4OU0A 2STWA 3VOEA 4L18B 2R7DA 2GXBA 2ZNZA 4DQ2A 2RV8A 1FBQA 4GGGA 2EV6A 2A5YB 6PAXA 1ON2A 4M9XA 1ZRDA 4G9YA 2QQBA 4HDVA 4KUMA 4S04A 5L3DA 3O6BB 3DEUA 4OOIA 4M9SA 1Z6RA 2CQKA 1F5TA 4QWQA 1XCBA 4HQMA 1T98A
chains in the Genus database with same CATH superfamily
3FMSA 3LSMA 3P5JA 1IN7A 3LSHA 3ZMDA 3OYAA 2O9LA 2H8WA 4LFUA 3HRMA 1B8IA 2HGCA 3CDHA 5K5OA 1GXPA 1BJZA 3MZYA 3HUGB 4B48A 4CO8A 2W48A 4FT8A 3I4NJ 2Y75A 1WJEA 1TT5B 1BI0A 1R71A 2R7OA 1ZG5A 1J7KA 3V7RA 2M4KA 2QKMB 3KZIC 4CCNA 1BIAA 2XF7A 4AWXB 4A5MA 4KJZA 2JWTA 3E5QA 4CYDA 4CYCA 3VSKA 3ZXSA 2LP0A 2CO5A 3BCAA 3BTIA 2CV0A 2IGKA 3HM5A 5EYRA 4G94A 1FSHA 3L2WA 2R7QA 4BXUA 3LQQA 3F8CA 5HLIA 3TOBA 5D5XB 4IHWA 4Y17A 2Q2EB 4II3A 3GYHX 2FMLA 3I55I 5J4VA 5F27A 1APLC 4XRMA 3H9GA 1Z91A 3IRQA 3Q0VA 4HG2A 2JPBA 2ECBA 5F6FA 4EV0A 3K70D 3ZGKA 4KIFA 3BTLA 2IAIA 1ETYA 4A5NA 4FX4A 2ACJA 1VQLI 5GPAA 2N8GA 3CO6C 3RYRA 3L2RA 4D0PA 4N0BA 3K10A 2OPTA 9ANTA 2UXXA 2NVXJ 2DA7A 5EF6A 3K2AA 3CCQI 2Z9OA 4G6TB 4U7DA 3FXOA 4I7HA 1U78A 3HOTA 1R22A 1TQPA 1LNWA 3IKVA 1XTAA 1OYWA 4RB1A 3IRRA 3P9CA 2CUEA 2GXGA 1FOWA 1HXDA 2DA2A 2M8EA 1Y1VJ 3BG9A 1B6AA 1VQNI 3P9IA 4BBSJ 2F2EA 3FISA 3BCBA 3GTKJ 5DUKA 3H0GJ 5HODA 2R5YB 3OYKA 3CLOA 4BY1J 5CKTA 2IS6A 2HPIA 4M3GA 1IDYA 1PP7U 2LF7A 4XBFA 5JVTA 1XN7A 2EIJH 4NUBA 1Z21A 2KJBA 2XPVA 4BAYA 1QRYA 3BR0A 3K4NA 2ISZA 2LF8A 4A3EJ 1W5TA 2WB1N 2GBYA 2MGQA 2X4HA 5EEGA 3AG4H 4A3IJ 4ETSA 1WWXA 2L5QA 1BI2A 3IH3A 1F43A 3H5RA 3BZCA 2L9VA 1V5GA 4MHGA 1JKOC 3B73A 3DKYA 3ASNH 2DI3A 2F5FA 4AM3A 3W6KB 5K5QA 4HQEA 1QVTA 4N9IA 1IXRC 2FSWA 1FOKA 2BVMA 1VQPI 2M30A 1G3WA 1B1BA 4IXAA 4QIWN 2OZ6A 2FF4A 1ZYRF 2Z3YA 4D5CA 5JFRA 4C2UA 1RUOA 2QCOA 4HBLA 4UVAA 1W5CC 3ISPA 4B44A 1DPUA 2W7NA 2IRFG 5LGNA 1FTZA 2H09A 3IV5A 3E7LA 1QA6A 4A6EA 2K5CA 2DU9A 2HQ5A 2XAGA 3GXOA 2DO7A 2A6TA 4PJNA 4BJ6C 2LKPA 5LHHA 5HOOA 4W1UA 2AXTC 2E1NA 2DA4A 3PFIA 4WXHA 2LY1A 3DV8A 1LEAA 2PEXA 3E5UA 1P6RA 1CQTA 1PUEE 2PJRB 5FKNA 1X1AA 2J5PA 1LDKB 5FD5A 4BQQA 3OYJA 2FBIA 3RKXA 1ZARA 2DFEA 4XICA 4A0XA 3R61A 1UJ8A 3ERED 1YS6A 4UVCA 3J7AO 1WH7A 4XSZF 4ENJA 1B9NA 1FOXA 5LHGA 1MIJA 4MQVA 1P4WA 2HPMA 4B43A 2I10A 3TW6A 2OJED 2V7FA 4MEXF 1IJWC 3CCEI 3SZPA 3C2HA 3I0TA 3TKYA 1ZHFA 1T2KA 2JQ7A 1X1BA 1Z9CA 3GZ6A 3IH4A 1MMNA 3QOEA 3IAS2 1BR4A 2RNGA 2XASA 1YJWI 3KYLA 1X1DA 2NYXA 3SDGA 4XKWA 1KU2A 3J7AY 5FKLA 3KE2A 5M5YJ 2EQRA 4KISA 2NNNA 1Q1HA 3OYCA 4A3BJ 3PNYA 2O0YA 3TBIA 4L5EA 1B4AA 4RB2C 5ICEA 3TP0A 2RNJA 1FYKA 3H9QA 3JRIA 2M5WA 2K9QA 3Q0UA 2X85A 5CPRB 3GTPJ 4PFPA 2DK8A 1PDNC 4CXFA 2OU2A 3K1PA 2RDPA 1WRJA 2XV4S 4E7IA 4C9YA 1TNTA 3I64A 5KVRA 4R79A 2YU3A 3VB2A 4IX7A 2E5NA 1IRXA 1Z7UA 1RRJA 1YLFA 4GXOA 2MC4A 2QBYB 1Q1VA 3E6DA 4I6ZA 2NS7A 3W6VA 3BG5A 3TO6A 3JAMZ 1PUFA 2K9MA 4XM3A 2OCCH 5DDGA 1JHFA 1MBHA 3F6OA 1N77A 2K3FA 5KAIC 3FXMA 1VTNC 3R0JA 1WJDA 3BPVA 2LY9A 5DD8A 1TC3C 4YFKF 3SHFA 3ZMTA 3ONQA 1F4KA 4JQFA 3BG7A 2CYYA 3DBRB 4ZTFA 3PFYA 3K4LA 2ZXIA 3QU3A 1ZN2A 1QVUA 1ETWA 2LMDA 2NVYJ 2NVUB 2V6EA 4EM0B 2VI6A 2VJ4A 1IF1A 2I8DA 3WU1B 2YR2A 3F8BA 2R92J 2Y9YA 4D7MA 2KPMA 3IH2A 4ZDLA 5F1RA 2X6XA 1LPQA 5LBQA 1GUUA 2W1OA 3D5LA 3F9KA 1Z0XA 2ESNA 4MIMA 1W7PA 4QPQA 3Q3SA 4CA0A 1QHHD 4OIOF 1O3TA 1R49A 5FFZA 5A2QZ 3ZN1A 3G4SI 5EGOA 3U1KA 2XAFA 4Y33A 2H27A 3S14J 1X3ZB 2ZMEA 4EJTA 2LRDA 2QYOA 4AIJA 5CVRA 2MC3A 3O8HA 5D8LB 4RMNA 2DA6A 1D0XA 2RQQA 3SEQA 1K83J 2Y0SA 3CC4I 1U6GA 5FKMA 1MD0A 1WH5A 4LIUA 4RLFA 4Y52J 2ID3A 3GF2A 4M3DA 4XIDA 3LSIA 3N97A 3Q5FA 1OFCX 1ZLKA 4HA8A 2EV5A 3A03A 1S7OA 4KFCA 3FZVA 2DA5A 2JJ7A 4M9ZA 3OV8A 1HW5A 3F0CA 2B9SA 3GZ5A 4A3LJ 3A01B 1WVRA 2E36A 3HOZJ 1IXCA 3EUAA 2XKPA 5M5WJ 2EFQA 2W57A 3DLAA 2VC1A 4XN3A 2WAQN 5GPCA 3QP6A 3FK6A 2LYCA 3FK7A 5L3BA 2A61A 4Z6YA 2UWMA 3WTYC 4OIPF 2VOOA 2MD5A 2HZTA 5KCMA 1HW2A 2Y69H 1ZGWA 2ZMEC 4KIGA 1J9IA 4IL6C 1CGPA 5LRRA 3U9GA 1R00A 4N9HA 5EZHA 1OKRA 2V4JC 3GMEA 1E2XA 1K6OA 4M6VA 1BM9A 1KU3A 1RKWA 4Q48A 3QODA 1YW7A 4LLLA 1X58A 3JRBA 5CVIA 3PM1A 4NQWB 2LD5A 1K7AA 4HNVA 2DDBA 3J81K 2A07F 1R6RA 4BJTA 2EA4A 5DM7F 2HEOA 1EH6A 4XMYA 2XSJC 2PBIA 3L2VA 3TO9A 3B02A 2CUJA 4MEYF 3MKZA 1N75A 2EK5A 2CFOA 2LLKA 2P5KA 2HOTA 2K9LA 1EF4A 3DP7A 1ZR4A 4ZDPA 1Y0UA 4LGWA 4AYBA 1J59A 4XKVA 4OIQF 3DU5A 2VE8A 3UR3C 5DUIA 3QYBA 2ZJ2A 2HI3A 2L02A 2ZMEB 1U8BA 3ZQHA 3CCUI 2DAOA 3I4PA 1QU3A 1FT9A 3KCCA 1L0OC 2OZUA 1IN5A 3TW7A 3E6BA 4NDLA 2OCEA 3KEQA 1BOBA 1WQ2A 4RLQA 3SYTA 5GAHJ 4ZYDA 3C2GA 2VLAA 1BR2A 4CZCA 4CCMA 5FGMA 1S8NA 1UHWA 3R60A 3TO7A 2OQGA 3ABMH 1UFMA 4DYRA 2E1MC 2YX4A 2WADA 5ICCA 1K78A 2K9NA 1MNEA 2PLYA 3WGHA 1RI7A 4F93B 3OS2A 2K4BA 2XGDA 2FBKA 4XONA 1I6HJ 3QP5A 1O3QA 2HVSA 2E7WA 2OQRA 1I50J 4I02A 2HYFA 2QQ9A 3B6AA 5AIQA 1PJRA 2ZO4A 2DW4A 3EUHC 2E1CA 2HKOA 1TP4A 1FNNA 2E19A 2JVHA 3IHUA 4MNUA 1E0EA 2WC2A 2VOPA 1YIOA 1ZH5A 1T08B 1QO0D 3U2RA 2ZFUA 2IXSA 2CQXA 3ZMSA 4BNCA 1VQ7I 4IHYA 1KQ0A 3SQNA 4CCOA 2MH9A 4YIRX 1VQOI 1S3JA 1SMTA 3LSKA 3RZDJ 2DFIA 4HDUA 3GUDA 2EWNA 2F4MB 3BR6A 3FM3A 1GV2A 2YSRA 2DTRA 3KP3A 2KQRA 3JTHA 2E1MB 2VASA 3CESA 4ZH4F 4XKCA 1LQ1A 2JA7J 3BT9A 2OD5A 1FX7A 4HV6A 4KITB 2AQFA 4BACA 4I01A 3WTZA 3S1NJ 5D6EA 1IO2A 5CVVA 3RTRA 3ZQGA 1X1CA 4XNFA 2EJRA 1USSA 5GP9A 5D4RA 5FJ8J 2A5WA 2CWEA 2L2OA 3SFZA 2WA0A 3VYRB 4FTHA 1U8RA 4IHTA 2PMHA 1XDUA 3FXLA 3HOWJ 1GT0C 1NTCA 3JRDA 2X9DA 2EFPA 2FNAA 3DPLC 5F1JA 5M3FJ 3HSEA 4X1EA 4ENKA 3F3XA 1JE8A 3W3CA 2F4OB 5HLHA 2O3FA 3L9FA 5C4JJ 2KHMA 3GW2A 3OMYA 2QF7A 3EDPA 5DS9A 2V9PA 4FETA 2BY3A 3VYSB 5JHUA 4LMYA 2L3DA 3GLXA 3HIFA 1SFEA 5J4YA 5EG0B 3TQNA 4EJUA 5LD2C 4IF4A 1B9MA 2JRTA 4DIQA 3OSFA 5AONA 1S6LA 1Z7LA 2QSFX 3I59B 5E3NA 2HVRA 4ZYAA 3T1BA 2DMUA 3E1SA 2L9SA 2AO9A 3OWTA 3SFIA 2HTSA 1X3WB 5E79C 4A2UA 1HDDC 4XRFA 1Y0NA 3M1CA 5JI6A 3RYPA 1IV6A 3S17J 1Z67A 4RAGA 3A4CA 3LL7A 1MBGA 1XDSA 4EMSA 1GLNA 2KFDA 3MKLA 3FF5A 1VZ0A 2L01A 5KNLA 2VUMJ 4PK4A 4RM3A 2LBFA 2ZJPF 3ZQLA 1YW9A 1R58A 4IHVA 1UAAA 3H1CA 2TDXA 1ZRFA 2D2WA 3MZHA 2DA1A 1J75A 3L7WA 1EH8A 2QENA 4ESFA 1ENHA 2DODA 2R7FA 1O3SA 3OOUA 1SFKA 2EBIA 2RAEA 1LE8A 2ZKZA 5CYVA 3ERMA 3HOUJ 3H92A 4RAYA 5C3EJ 2CQ7A 3KETA 2XAQA 3GFJA 3QYEA 1ZREA 5EDNA 1JT0A 1KONA 4MQ9F 5H6RA 1ERDA 3H3UA 2VE9A 1B72A 2DOFA 3CCMI 4KT5C 4UB8C 4XLEA 2WB1A 1NK2P 3CDIA 3T8TA 1V5FA 4A69C 1JJ8C 4PZJA 3COAC 1FZPB 3NEUA 4HNUA 3VYTB 4BL0B 5K5RA 3WTWC 2M9HA 3OYBA 1PVEA 3PUBA 1W7PD 4RA2A 4DYCA 2OV7A 1CF7B 3BG6A 3KP7A 1HLVA 5HLGA 1G8XA 5IYDJ 3C7JA 2QWWA 2NOGA 1EA3A 2JN6A 2P4WA 1C0WA 2ADUA 2H8RA 5J3LA 2Y31A 1Z3XA 3AG2H 3SZTA 3T5XA 5ERIA 1TWHJ 2P6SA 2L4AA 1I39A 3C2BA 1T95A 3ZQCA 2E71A 2HQNA 1DU6A 4CHUA 2UZKA 1X3UA 4PJJA 4YIFA 3ZRGA 2TCTA 4HX7A 4KN7X 3HOSA 3DWLE 4H4KC 3WHBA 2Q0OA 3I58A 2CS3A 1WPKA 3BPXA 3ECHA 3GTOJ 3AG3H 5IT9Z 2F5EA 3G6EI 2ELJA 2W84A 4WF2A 1XPXA 5DCMB 3J80Z 2LBFB 4BKXA 3LMMA 5GAGJ 5TGTA 5J8FA 3WHCA 3JREA 1R4NB 4BEHA 2DLLA 4E6KG 2ZJQF 3ABLH 1D5YA 4L9VA 5LFAA 2HYJA 4ZZDA 2LKXA 4XR6A 3FMRA 5H20A 1R5GA 3L2UA 4DOZA 4CCKA 5B1AH 4GDFA 2IA1A 3AKZA 2K85A 2W85A 1LE8B 2UXNA 4MFDA 4U0WA 2G9WA 3OIQA 4EQQA 2GA2A 5K1YA 3WTUC 1OCZH 1VNDA 1WI9A 2MW8A 3GFMA 1R1VA 3LSJA 5J8CA 3MFKA 3S2DJ 4ASNA 2CMPA 4X6AJ 1K6YA 1RIOH 2DPUA 4LLNA 2E60A 1OPCA 3BQYA 1YO5C 1KU7A 1UCRA 3C3WA 3HRUA 1ETKA 1PYVA 3H5NA 4V2FA 4DGWB 1QPIA 3OS1A 3CF2A 1N25A 4Y15A 3MD2A 4B1RA 2CG4A 2X0LA 3R4KA 4BHBA 4OWRB 5E17F 2JT1A 4ESJA 3CP8A 4S0HB 1YRNB 1SD7A 2FJ1A 2XPWA 4Q47A 2QLZA 1ETOA 2VB6A 3A1YA 5BPDA 1BW6A 3ULQB 1F36A 1R1TA 3BQZA 3ZQFA 1SVLA 3PSFA 3V8KA 4EATA 3H3VK 5J40A 4E7KA 3PSIA 2PX9A 1R4MB 4KDPA 1SAXA 5KHDA 3DTIA 2FX0A 4L5IA 5D5WB 4FE7A 3K4CA 4XOPA 3AAFA 1JKQC 1BL0A 3M7GA 2A68F 1QGPA 5F64A 2OC6A 2HQRA 3HXLA 4PJLA 4C3HJ 4AVZA 1NHAA 5C44J 2HOSA 3E5XA 2Z5UA 1WJFA 5JR3A 2GM4A 3MEXA 4L5JA 1B8IB 4BU2A 4AD9A 1PP8F 1WKMA 1U9NA 2BBYA 5L3GA 2ME0A 3LQRA 2B7EA 4IJAA 4RBOA 3FHZA 2XUBA 1TT0A 3PIPF 2DMNA 4BE0A 1TWCJ 5IP9J 3MN2A 3R6SA 3JSOA 2VBZA 4G8XA 5ICGA 4M71A 4CYCB 1R5HA 4PGHA 4HX4A 1WSUA 2DMPA 4A3KJ 2BHYA 1IGNA 3ECOA 4RGXA 1TQIA 1P4XA 2KIMA 4F91B 5DM6F 1XS9A 3DPUA 3PO3J 4BH9A 1OCPA 5D4SA 1OCOH 3ZQIA 2XF6A 1OCRH 2AQEA 2X48A 4M3EA 1KYWA 2PQ8A 5FLXZ 2M45A 4P5OA 5J1YA 4U88A 1ETXA 4IRHA 3U1DA 1QHGA 3LSPA 4IVNA 3BJOA 3ZN0A 4DZJA 2KISA 4E7JA 2IGMA 2GLOA 1P4AA 3VODA 4I98B 3QPLA 3RPQA 2KT0A 1SD6A 4FE4A 4LG0A 1E3OC 2DT7B 4B4CA 5DD4A 3S16J 1OLTA 5IOYA 5HNHA 1I5ZA 2FBHA 1ZGJA 1GV5A 3F8FA 2FQ3A 4Z2YA 1HKQA 4Q5SF 3HEFA 1RKTA 1ZTRA 1FP2A 1I1GA 1NH3A 2IPQX 4RS8A 1YW8A 1MH4A 4HEA2 1TW2A 2JPCA 2W4SA 4C2MJ 4HYEA 2M87A 2NOJB 2E2HJ 4IHSA 5JVGF 5FKKA 2R7ZJ 1H0MA 3BP8A 3OYHA 4F7ZA 2RC4A 2R7SA 5E20A 4HW0A 2MFZA 4IPAA 3GTMJ 2EZHA 4CGZA 2X6WA 3R0AA 2LREA 1XSVA 3TDUC 2VC0A 2VJIA 3DTKA 5BQTA 4OMYA 2FEZA 3FXRA 3NWSA 1BA5A 5E1ZB 2M1BA 1SMYF 2J5OA 2ZXHA 1SFOJ 2QA4I 3ZMUA 4UUVA 5EEHA 3PIOF 2GAUA 4GYIA 1XMAA 5K7ZA 1YI2I 4FASD 1W0TA 1KU9A 5F04A 1E3PA 2AHQA 1O7FA 1QBJA 2G0EA 2DDAA 1T39A 4XQFA 2XPUA 2YPRA 2JSCA 2EPFA 5IYBJ 4R1HA 3TEDA 1FBUA 3GLLA 1AA7A 3HSRA 1X2NA 1T38A 2Y9ZA 2PG4A 3V7CA 5K7HA 2I5UA 2IGOA 4P55A 4HLYA 2COMA 2VPLA 1VQ5I 2FOKA 3OIOA 3MZ8A 3K9TA 1MBFA 2NAZA 3E97A 1N78A 3TMOA 1SAUA 1YJNI 2DQRA 4E7LA 3BDDA 3O3KA 1MJBA 3KZZA 1X4OA 2YS9A 3I54A 1M1EB 2WBMA 3LFUA 3M8FA 4ITVA 5ED4A 4KICA 1D8KA 4FHTA 3VWBA 1LEBA 4LLGF 2FRHA 5J1UA 4KMUX 1DUXC 5FKOA 2V6CA 2O8KA 4LG0B 2KP6A 4CZZA 3HOYJ 1F9NA 1G6NA 2OF7A 1QPMA 2HTJA 4LB5A 1AKHA 4JK1X 1HC8A 2ISYA 1D0ZA 3LNQA 4P96A 2VODA 1U5TA 5F0CA 3HOVJ 1FBSA 1KA8A 3E3VA 4EJWA 4PUSA 5CJ9A 4U87A 2IA0A 1JXSA 1AWCA 3ROUA 3TDZC 3WE3A 1SC7A 1R1UA 4MTDA 3TGNA 3F8MA 3CC2I 2C6YA 2NXNB 3FXUA 3QOPA 1D1AA 4IRIA 4XLAA 1IDZA 3J7YJ 1H89C 4RB3C 3GTLJ 4O5VA 3HC7A 3HSFA 1DP3A 2NS8A 4M3BA 2Z2SB 3WG7H 1RR8C 1MJ9A 3F21A 2R93J 4B3AA 2CJJA 1MDMA 3OL3A 5DCFA 1K4TA 2VBYA 2WTEA 2L4MA 4I76A 3H9JA 2XSDC 2W00A 1XD7A 2BHZA 4E7HA 1VQMI 3M8EA 2MABA 4WXDA 4WWCA 1R9TJ 1QNTA 3BJAA 2LY2A 3DKWA 2VIXA 2R7UA 1QQIA 3Q9VA 2EA2A 2XHKA 1OMIA 5B3SH 2KIFA 1OYYA 2LTPA 2HOEA 3J7ZI 3IC7A 1D5VA 1WJBA 2EZKA 3KP6A 2Y30A 4NB5A 2CU7A 4BXFA 1G59A 4KA4A 2PFBA 2VKEA 1FP1D 1Y8RB 3IWZA 1ZGAA 3MVPA 4B8XA 3Q0WA 2YUSA 3RZOJ 3BZKA 2QSGX 1NG7A 2L0KA 3BR5A 1JKRC 1MKMA 4R8HA 2MA3A 2VKHA 2EFWA 2FXAA 2RGVA 3KFWX 3LOCA 2LVSA 5B5EC 4EJVA 2M7BA 4D5FA 2NNYA 2BY2A 3N4MA 1PUFB 1IN6A 1Z05A 2X1EA 3FIWA 3C18A 3CTAA 3P9KA 2NVTJ 3F6VA 3RI4A 3HB9A 3CUQA 5HDGA 2O61A 2ZBKA 4MO7A 3HPGA 2EIMH 3CJTB 2CV2A 4LK0F 3LSGA 3E6CC 2BE5F 3FKIJ 2L7FP 4L9TA 1USTA 4KT6A 1J09A 1IG7A 1TWAJ 2R7RA 3RKYA 1LJ9A 2RVCA 4ZZLA 3JTGA 3RPUA 2IGNA 3CCYA 3S3OA 3DXJF 1IAWA 3CCLI 1R7JA 2EIKH 1YS7A 1QZYA 1KQ9A 2XIGA 2HZDA 2IW5A 1W36C 2A6EF 2QQ8A 2MLGA 4BDZA 2R7XA 4XLHA 4BE2A 3TP3A 4EGYA 1XMKA 1W7PB 4OAYA 4ESBA 1T56A 5DYMA 3PQJA 2KDZA 2E35A 3LA2A 3S3MA 2JVGA 5EGOB 4BDYA 5F0FA 5BNGA 4RGSA 2DXIA 4IQ4A 2G7UA 3CUQC 3S3NA 1NK3P 3MMYB 2OUMA 1DGWY 3N05A 4MGRA 1XC5A 2BY0A 5CQEA 4DNCA 2EH3A 2ZNYA 2BV6A 1HQCA 1U2WA 1J2XA 3LA3A 3TOAA 4F55A 4MFEA 1FIPA 2P6TA 5E3OA 2LKSA 5LRSA 3NWTA 1FSEA 1ZLJA 1HSTA 5D5VB 2FUG2 3RKWA 1U0JA 2ZXJA 3FXKA 3ZQQA 1MSFC 1HSJA 3GZNB 4IOAF 2JSPA 1RETA 1BIBA 1P7JA 2R7WA 3HHGA 2R7TA 2K9SA 2FA5A 1O3RA 2KIUA 1FMVA 1W5SA 4XKBA 2KIQA 4A3DJ 3ZCOA 1MNMC 3HL2A 2V1DA 1TL8A 3FWEA 4A3CJ 2OA4A 4ZDOA 3VDXA 1Z6TA 4WCGA 3L2QA 3CUQB 1FYMA 4E7SA 1LVKA 3HZJA 2P8TA 1VFCA 1HDPA 3C1DA 4PFOA 1JUPA 3WE2A 2PMUA 2JA2A 1YE9A 2O5RA 2VT2A 1OR7A 5F08A 2HYGD 3G71I 4XOTA 3KLNA 1TZLA 1V3FA 2WY8Q 3D5SC 2BXYA 2R0QC 3BJ6A 2A69F 3MWMA 4BHPA 3O8GA 5LEKA 4D9JA 1XMXA 3M8JA 1RUNA 4E7ZA 1GDTA 2ID6A 2YU9J 4G7OF 2MLKA 1ZELA 1HW1A 3BR3A 4M6YA 1V55H 4EJOA 5GTHC 4XLNF 3OYNA 4JP0A 3DQVC 5BS6A 3NRVA 5L3EA 1POGA 3MKYB 3S15J 3QPHA 1JGGA 2P0WA 4BS9A 2A05A 1S9HA 1Y8QB 2HVQA 2Y0MA 1MBJA 3IP4B 3MQ0A 1J5YA 4L9JA 4C3IJ 1YX3A 4NC8A 3E0JB 4YEJA 1D1BA 1DU0A 2UV1A 1IXSB 1S7EA 4KN4X 3CJQB 2CUFA 3MAJA 3GTJJ 4J01A 1SANA 1STZA 4S05A 1DGRM 1K78B 2XKOA 3OR2C 2H1LA 1IUFA 4AUXA 3KIOA 4UHTA 2XAHA 5ILSA 3EPZA 5B66C 4Y7NJ 3NQOA 4UVBA 1ZG1A 4DJAA 2CW7A 3ZR8X 3SXYA 3OL4A 3I5UA 2L54A 3MKWB 4BHCA 2ZC2A 1V4RA 3IKTA 2BW3A 3K4BA 3HKZN 2QVOA 4RDUA 3K4MA 1EH7A 2ETHA 2B63J 2XROA 1KQ8A 4IOCF 3OYFA 2FMYA 3A0BC 1LDJA 4UY8I 1TBXA 5HS7A 4NBQA 5FB2A 3JR9A 2R5ZA 4JOMA 1LFBA 1ODDA 2XAUA 3AL0C 3KX2A 2W82A 3JAMK 5JHFA 2VKDA 4K2EA 3P7NA 3SJMA 4FISA 2VQLA 2QM3A 1MBEA 3K1MA 2PMZN 4AYBN 4F92B 4P1WA 1MBKA 2ELHA 3HUGA 1Z77A 3GX4X 2DFHA 3X2QH 3IL2A 5BOXA 3ZMZA 4BQOA 4XLCA 1JT6A 4OIRF 4PJMA 1H9TA 1T33A 3OIPA 3PJRA 3OYGA 1XB4A 4ZJZA 3VEPA 2LC2A 1AU7A 3L09A 2HS5A 2AXLA 3JRAA 4XORA 1MMDA 3I4MJ 4OAZA 2V1UA 3QRFF 4HOBA 4I0BA 2CW8A 3OYLA 1G3TA 1A6IA 2WAFA 2Q2EA 2IVMA 1SD4A 2O8XA 2XDVA 3IWFA 3ZOBA 2GIVA 2V79A 3AL0B 3REOA 4ZYHA 1WFXA 4UV9A 1K79A 2MSYA 5A2QK 1YOVB 4WXCA 2VONA 4GO1A 5M5XJ 4YIIA 4XLPF 1IUYA 1YQAA 2K4JA 2XAJA 3VYUB 1LFUP 4G12A 3PUFA 5E18F 1VQ8I 2DTZA 2JA6J 2WAEA 3RKQA 1G4DA 1BJAA 1ULYA 2Q1ZB 3AG1H 4HPQA 1K61A 3T0YA 3UNGC 2E2JJ 2G7HA 3OYIA 3CO7C 5HVQC 4LK1F 1GHCA 4C3JJ 4CH7A 1MW7A 4NHJA 4PGGA 1W36D 3ZP5A 4A3GJ 3CUOA 4JYKA 5L3CA 4UUTA 2MD0A 2X1DA 1G3SA 4A6DA 2X6OA 3GVAA 2V1XA 4P9UA 5HNFA 5J47A 1A35A 2DJIA 4IZZA 1MMAA 4B3XA 2KRHA 4RGRA 5E1XA 3DLLF 2VXZA 4Y4RA 4ENNA 4M72A 2VBWA 2R5ZB 2DYRH 3I53A 2R5YA 2STTA 2H94A 1NG6A 2ZSHB 2P7VB 3BLYA 1X2MA 5FRMA 4B09A 2QSHX 2BXZA 1S72I 3H35A 4HSRA 2LFBA 1ORKA 3B6CA 4AIHA 2MG4A 3CCRI 1L3LA 3L00A 1FC3A 3BTCA 3S1QJ 2M2EA 3MCZA 2EINH 2DQLA 3CMAI 1B72B 5HLTA 2COBA 2F5CA 4EGZA 1FIAA 2H1KA 2TRTA 3RPUD 2BGCA 2X51A 1MH3A 2VXDA 3SDBA 2IS4A 2OBPA 2DMQA 1FPQA 3GFIA 4M74A 2E2IJ 4UV8A 1UELB 4HZFA 2JK3A 2LOOA 2XC7A 2DN0A 2VBXA 3LWFA 2VPRA 3LAJA 3CC7I 4BUPA 2DMTA 1T6SA 3HJEA 1MNDA 2WV1A 5AIPA 4HV5A 3ZQ7A 1I27A 1H88C 2D1HA 4PJ0C 4UXNA 3K0LA 3S8PA 1YYVA 3LAPA 1FEXA 4BQAA 3D0SA 4LITA 5D8KB 3WTSC 3ABUA 1DPRA 4HSTA 3J81Z 2HOAA 1OYIA 4O6JA 4EM1A 2H6CA 4YFNF 5HDNA 1D1CA 1XSXA 3W2WA 3GFLA 1XCVA 4IO9F 2K27A 2CH0A 4UUSA 3JSPA 4RM2A 4RAFA 2OAZA 1B59A 4PSXA 3LA7A 1WZ2A 2GWRA 3SEZA 2Y48A 2PJRA 1FWZA 4A3MJ 4ZC3A 2IJLA 4CUGA 3VPRA 1Y56A 4E70A 4AIKA 1YJ9I 1JI8A 5IP7J 1TLHB 3KZYA 2JA8J 2LNBA 1A5JA 4HLXA 4IEJA 4HAMA 5D5UB 1RNLA 3FMQA 3H5AA 1BBYA 5GADJ 4GRIA 3PQKA 3OYMA 1MGTA 1W4MA 3OSGA 4BEHB 2VKVA 5TISC 1JUSA 2KRCA 1BOAA 2ME6A 4AIDA 4F3QA 4JX6A 4Q4ZF 3UKGA 3JRHA 2XGCA 4I2OA 4BQNA 5BPIA 5IOZA 1RZ4A 1BW5A 3K7AJ 3RQ4A 3FBIB 4L0YB 3DEEA 3OY9A 2DYSH 3KYCB 1F1ZA 3OOPA 3OR1C 2FE3A 2V1NA 3BTJA 3WG9A 2R7VA 4XSXF 4YRVA 3JCUC 4YELA 1W1WE 5E1WA 5D6FA 3WGGA 3ZPLA 1A6QA 3GO5A 4P9FA 4ZYGA 2CSOA 1XX5A 2GA1A 3S1RJ 1HOMA 1J0RA 4IQJA 1REPC 4PCQA 5ICFA 4JX4A 2PN6A 2IT0A 4M6XA 2F4IA 2WY7Q 4V2GA 1H8AC 2D45A 5C4XJ 5IPAA 2P5LC 1OISA 5HS8A 4AC0A 2RREA 1JUMA 3QPSA 3OS0A 4CICA 2IA2A 2E5ZA 1Z3YA 5CVJA 2QBYA 4CDGA 3QWLA 5IT3A 3S1MJ 4I0AA 1BI1A 2XVCA 4EVIA 3K6GA 5E3LA 1AHDP 1R5ID 2KLOA 3A2KA 4UUSB 3WGIA 1FY7A 2DK5A 1LFPA 3ESWB 4U0VA 4WX9A 2Z99A 2WAQA 3WODF 1WJCA 1W0UA 2CQQA 4ANJA 2GOMA 1A31A 1Y39A 2XB0X 1ACIA 4GYGA 2CQNA 5J6XA 3FDYA 3ML6A 3HBLA 1YG2A 1X19A 2HWVA 2KMUA 2EV0A 3F72A 5KK1A 3KEOA 1I3QJ 1SVMA 4G7HF 5H2FC 1KYZA 4HF0A 3SZGA 3CZ6A 3CQZJ 3EQLF 1QZZA 3L1PA 4U0YA 4XK4A 3LSTA 4LOCA 1IZ1A 3CDLA 2CFXA 3ELKA 3W2VA 2ZB9A 3F8NA 2GQQA 3M9AA 2IEKA 2FD5A 1RESA 5LLQA 4GCVA 2IS2A 2KZGA 1Z1DA 2MBFA 2HDCA 2PJPA 2P7CB 4IRGA 1I1SA 2M4GA 1EKEA 4CCJA 2E34A 2EZLA 3HGYA 4PSWA 2DCEA 2ELKA 3BROA 1ZQ3P 5E8GA 4ZTJA 1FLIA 4KYWA 2JUGA 1YTYA 1P7IA 5DTDA 5GTIC 5J1RA 3FBNB 1VQ9I 2MYSA 3HRTA 3WU0A 3G2BA 2Q8KA 4DBRA 4XRSG 1YHQI 2K3PA 2RKHA 1FJLA 1A04A 1SFXA 2R3SA 2F5VA 3CMMA 4HNTA 3CCVI 1UHMA 2A3SA 4OMZA 4RGUA 1RPWA 4U7BA 2FNPA 2H6BA 1KGSA 3CMEI 3DU6A 4G7ZF 1LDDA 2DOEA 5FLVA 2BOLA 4EM2A 4BYYA 3A01A 1LUJB 3O2PE 5H6QA 2M0MA 2FQ4A 1VQ4I 1T8IA 2QKLB 2RQPA 3V4GA 1TWGJ 2HXIA 4CCLA 3G1MA 1BI3A 2Z16A 1TTYA 5E8IA 3OYDA 4RAZA 3DTEA 4I09A 3BZ6A 4DZPA 5IP6A 3ABTA 1TW3A 3A02A 3H36A 2VQHA 4D7NA 4LJZF 4O3MA 3JW4A 3FXJA 3OYEA 1WJ5A 3I71A 4DBQA 2W24A 1UHSA 4L9NA 3W6JB 1S7AA 4NQWA 2CRGA 2L9NA 1HCRA 2M3AA 2NS0A 2CW0F 2L7ZA 2KL4A 2V26A 3GWZA 3AFHA 2EILH 2ZSIB 4NC7A 3A0HC 1OQYA 1U3EM 1ETQA 1ON1A 5EJCA 2GXAA 1AOYA 3QQAA 2QZ8A 3EYIA 3CMYA 4WK8F 3LSRA 2CGPA 5IT9K 5BMZA 2ZCWA 5CQGA 4LIVA 2IBDA 3D5RC 4LD5A 5HS9A 2M7AA 4QLCU 5K7FA 3WTTC 4RB0A 2V9VA 1U5TC 3VSLA 3V42A 2PI0A 3J80K 2HKXA 3RDIA 2XF5A 1T0FA 2DT6A 4EEFG 2M0CA 3M07A 3HOXJ 3GCMA 2FU4A 1IN4A 3G73A 3I56I 2D1VA 1GVJA 3FM5A 3PNVA 2LH9A 1VQ6I 2RN7A 2FOWA 1S29A 4A3JJ 1EJ9A 1IRZA 1GXQA 3G1LA 2HFHA 3FHNA 3V7SA 3RQIA 4G6DA 3VFZA 3F23A 4J19A 3K69A 1BN5A 2BEOA 2JMWA 4A0YA 2L7KA 1K4SA 1IRGA 4LB6B 1AKHB 2UUZA 2O6GE 3V8JA 4NNJA 1ETVA 3ASOH 1TNSA 4XN0A 3BR1A 2VQGA 2ZJRF 1U5TB 2ZXWH 4BE1A 2QUFA 4UNOA 1DDNA 1UG2A 3U21A 4KNYA 1T0FC 1UB9A 3EUKL 3K1NA 1HKTA 2QGUA 4H0EA 4HRIA 1XG1A 5GAEJ 1JGSA 1SEUA 1DQUA 1IN8A 4JBAA 1MJAA 1I3AA 3JRGA 2BY1A 3HKZA 2DJNA 4B47A 1FTTA 1LB2A 4II2A 2GIZA 2VJJA 1OCTC 1E17A 2XGXA 2JTVA 2V9KA 3FKJA 3CD6I 3RCOA 1MMSA 1MDMB 4C2TA 4OINF 3BOQA 4BY7J 2Y2ZA 3G1OA 2JZYA 2HR3A 2ZFWA 3D1NI 1MMGA 3K4KA 1JKPC 2HDWA 1HA8A 2BVLA 5TJJA 2DBBA 3HTSB 3CCSI 1ZRCA 4BBRJ 1SFUA 3EUHA 1FMWA 4QPOA 2PMZA 2O03A 2JA5J 3BG3A 5LHIA 1KZHA 1S5LC 2VQCA 4QSHA 1LVAA 1WHUA 5FRNA 5TRDA 4KIBA 2P81A 3HGGA 1LKXA 1YIJI 2B0LA 4XRSA 2L7MP 3WTXC 4ZYEA 2AS5F 3LFKA 1MSEC 3PL8A 5EZGA 3W2AA 3ZMVA 1P9QC 2QEXI 4W97A 1OCCH 1XSDA 3S2HJ 3RJPA 2HNHA 3FX3A 5EG0A 3IUOA 1SVOA 1BR1A 2K40A 3IAM2 4MTEA 1XGMA 4Y13A 2F48A 2P5VA 2LSOA 2CUZA 4CSWA 2DT5A 3I59A 3K70C 1EV7A 3QAHA 4J00A 4HF2A 2MH2A 2VL8A 2DA3A 2DFFA 3CF5F 4JX5A 3NARA 4AU7A 2ECCA 2QQAA 2XRLA 2DPDA 1MZBA 2LG4A 5DV5A 5DEQA 4YFXF 5FLXK 3KLOA 5FROA 3GEZA 4DW6A 1TWFJ 1IW7F 3HRSA 5FO5A 3KP2A 3QU6A 4HX8A 1BC7C 3HHHA 2IP2A 1HF0A 1O57A 4LG3A 3BC8A 1VI0A 2LDUA 1WJAA 2EB7A 3V8LA 4A12A 2L9RA 4QTRA 1A36A 3GBGA 4KMFA 1QZEA 1P2FA 5B1BH 5JLXA 3DBLB 1XGNA 3DPTA 3K4JA 5CVUA 1OJLA 5FD6A 3HYIA 4M73A 5F0HA 4GFBA 3WU2C 4UB6C 2VJ5A 2Y0SN 4A0ZA 1JTXA 5IYCJ 2LR8A 2HQAA 3H0DA 3CJNA 3S32A 5LEJA 2OTJI 2DOAA 2EFNA 4MLOA 2HU9A 2R4GA 5ILVA 4IKFA 2K86A 3HPHA 1X1PA 3TL4X 3QPTA 1UZCA 4M3FA 3T8RA 1OR7C 2JRMA 4BJ5C 1IRFA 1R23A 1YX5A 2ICWG 2YX7A 1ZR2A 2Z33A 4L0ZB 4BGDA 1DP7P 3RIRA 3M3YJ 1P92A 1JHHA 4TV7A 2F5DA 2X1CA 1IC8A 1Y1WJ 3CLQA 3KPHA 2WWYA 1ONVA 2E1OA 2KRFA 1UG0A 1BC8C 5L3FA 4A93J 2VT3A 1CF7A 1IV8A 4XL9A 2KZVA 1WCMJ 3CCJI 5CLSA 2ESHA 1VF9A 1ZAOA 3K2ZA 1Y6IA 3EYYA 3KYDB 5ILUA 2CV1A 4YG2F 5FFXA 4A3FJ 1ZKGA 4DYQA 3FXQA 1TQMA 4XLFA 3JRFA 3M4OJ 1XGSA 1R36A 3CJRB 5M3MJ 3DFGA 5EEAA 3GTQJ 2HDDA 2XRNA 4N4OB 3EETA 3G3ZA 1JJ6C 2XB5A 3ABKH 2KJCA 4X0GA 2GOXB 1D3YA 3HG9A 2WV0A 4N4NB 4C30A 1V54H 2EFOA 1G3YA 3DF8A 2BYVE 3QYFA 4BXXJ 3KP4A 4FQGA 4PDKA 3PO2J 1ZG3A 3CP2A 5HDKA 2HXOA 2K02A 1YFHA 3HTUA 3WTVC 1O4XA 5DCMA 2IS1A 3DBHB 1O7LA 3KP5A 1HKSA 2W25A 1VQKI 3E6MA 3I9V2 5JLWA 1XGOA 5LGTA 3L2CA 3DCFA 3M1EA 4G6QA 1GVDA 2A6HF 2M8GX 3S2WA 2E7XA 4ON0A 5LGUA 2LK2A 2K7LA 3I3LA 1I6XA 3GTGJ 3BWGA 1FYLA 3RSNA 2OTLI 4ENMA 1RC9A 3BR2A 1FOYA 1H9GA 2NRAC 2D5VA 1V5EA 1WI3A 4FX0A 1UMQA 3HDDA 2KKOA 2F6CA 1E3HA 2M34A 4AVPA 4Y3OA 3NAUA 4V19K 2VN2A 2JUCA 1D0YA 1D8JA 4I99C 3H3ZA 4HF1A 3F22A 1HBXG 2NVQJ 3Q9SA 2GZWA 4E4HA 1SD5A 3PNTA 3BY6A 4OU0A 1RR7A 3VOEA 2STWA 4IHXA 4L18B 3DEWA 2R7DA 2GXBA 1YITI 1G2HA 2KDOA 3S93A 2ZNZA 4DQ2A 4NC6A 3DKXA 4F52A 2RV8A 4ABZA 1ITYA 2Z1DA 1FBQA 1U9OA 2EV6A 4GGGA 2BZTA 1YRNA 5IY5H 2A5YB 1ZK8A 2O7OA 6PAXA 4D1QA 1ON2A 2X6YA 4M9XA 1WGXA 2BW3B 5KAFC 1ZRDA 4G9YA 3KEYA 2QQBA 4HDVA 3JRCA 1X4PA 4KUMA 4S04A 5L3DA 3O6BB 3DEUA 4OOIA 4M9SA 5E3MA 1Z6RA 4FCYA 2CQKA 5FLMJ 1F5TA 1JTYA 2EZIA 2XGEA 1XCBA 4QWQA 4HQMA 1T98A
chains in the Genus database with same CATH topology
3FMSA 1IN7A 3ZMDA 4LFUA 3HRMA 2HGCA 3CDHA 5K5OA 1GXPA 3MZYA 4CO8A 4FT8A 2Y75A 1BI0A 1ZG5A 1J7KA 3V7RA 1BIAA 4AWXB 4A5MA 3E5QA 4CYDA 2CO5A 4G94A 1FSHA 4BXUA 3LQQA 3F8CA 5HLIA 3TOBA 5D5XB 4Y17A 3GYHX 2FMLA 1Z91A 3IRQA 2JPBA 5F6FA 4EV0A 4KIFA 4A5NA 4FX4A 2ACJA 3CO6C 3RYRA 4D0PA 4N0BA 2UXXA 2Z9OA 4U7DA 4I7HA 1U78A 3HOTA 1R22A 1TQPA 1LNWA 3IKVA 1OYWA 4RB1A 3IRRA 3P9CA 2GXGA 1HXDA 2M8EA 1B6AA 3P9IA 2F2EA 5DUKA 3CLOA 1PP7U 2LF7A 4XBFA 5JVTA 1XN7A 2KJBA 4BAYA 2ISZA 2LF8A 1W5TA 2X4HA 5EEGA 4ETSA 1WWXA 1BI2A 4MHGA 3B73A 2DI3A 2F5FA 3W6KB 5K5QA 4HQEA 4N9IA 1IXRC 2FSWA 1FOKA 2M30A 1G3WA 1B1BA 4IXAA 2OZ6A 2FF4A 1ZYRF 2Z3YA 5JFRA 1RUOA 4HBLA 4UVAA 3ISPA 1DPUA 2IRFG 5LGNA 2H09A 4A6EA 2DU9A 2XAGA 3GXOA 2DO7A 2LKPA 5LHHA 5HOOA 2E1NA 3PFIA 4WXHA 3DV8A 1LEAA 2PEXA 3E5UA 1P6RA 1PUEE 2J5PA 1LDKB 5FD5A 2FBIA 3RKXA 1ZARA 4A0XA 3R61A 3ERED 1YS6A 4UVCA 3J7AO 4XSZF 4ENJA 1B9NA 5LHGA 4MQVA 1P4WA 4MEXF 3SZPA 3I0TA 3TKYA 1ZHFA 1T2KA 1Z9CA 3GZ6A 2XASA 2NYXA 1KU2A 3KE2A 2NNNA 1Q1HA 2O0YA 1B4AA 4RB2C 5ICEA 2RNJA 1FYKA 2M5WA 2DK8A 1PDNC 4CXFA 2OU2A 3K1PA 2RDPA 1WRJA 2XV4S 1TNTA 3I64A 5KVRA 4R79A 2YU3A 3VB2A 1Z7UA 1YLFA 4GXOA 2QBYB 3E6DA 3TO6A 3JAMZ 5DDGA 1JHFA 3F6OA 1VTNC 3R0JA 3BPVA 5DD8A 4YFKF 3SHFA 3ZMTA 1F4KA 4JQFA 2CYYA 3QU3A 1ZN2A 4EM0B 1IF1A 3WU1B 2YR2A 3F8BA 5F1RA 5LBQA 3D5LA 2ESNA 1W7PA 4OIOF 1O3TA 5FFZA 5A2QZ 3ZN1A 2XAFA 2H27A 2ZMEA 4EJTA 2QYOA 4AIJA 5CVRA 2MC3A 5D8LB 1U6GA 1MD0A 3GF2A 3N97A 3Q5FA 1ZLKA 4HA8A 2EV5A 1S7OA 4KFCA 3FZVA 4M9ZA 3OV8A 1HW5A 3GZ5A 1IXCA 2XKPA 2EFQA 2W57A 2VC1A 3QP6A 2UWMA 5L3BA 2A61A 3WTYC 4OIPF 2VOOA 2MD5A 2HZTA 1HW2A 4KIGA 1J9IA 1CGPA 5LRRA 3U9GA 1R00A 4N9HA 1OKRA 1E2XA 1K6OA 1BM9A 1KU3A 4Q48A 1YW7A 4LLLA 5CVIA 1K7AA 2A07F 3J81K 2EA4A 2HEOA 1EH6A 2PBIA 3TO9A 3B02A 4MEYF 2EK5A 2P5KA 3DP7A 1Y0UA 4LGWA 1J59A 4OIQF 2VE8A 5DUIA 2ZJ2A 2L02A 2ZMEB 2DAOA 3I4PA 1FT9A 3KCCA 1L0OC 2OZUA 1IN5A 3E6BA 3KEQA 1WQ2A 4ZYDA 5FGMA 1S8NA 1UHWA 3R60A 3TO7A 2OQGA 1UFMA 2YX4A 5ICCA 1K78A 2PLYA 3WGHA 1RI7A 2K4BA 2FBKA 3QP5A 1O3QA 2E7WA 2OQRA 4I02A 2HYFA 2QQ9A 5AIQA 2ZO4A 2DW4A 2E1CA 2HKOA 1FNNA 3IHUA 4MNUA 2WC2A 2VOPA 1YIOA 1ZH5A 3U2RA 1QO0D 4BNCA 3ZMSA 1KQ0A 3SQNA 2MH9A 1S3JA 1SMTA 2DFIA 4HDUA 3GUDA 2EWNA 3FM3A 2YSRA 2DTRA 3KP3A 3JTHA 4ZH4F 1LQ1A 2OD5A 1FX7A 4HV6A 4I01A 3WTZA 5D6EA 5CVVA 3RTRA 2EJRA 1USSA 5D4RA 2CWEA 3SFZA 1U8RA 4IHTA 2PMHA 1XDUA 2EFPA 2FNAA 3DPLC 3HSEA 4ENKA 3F3XA 1JE8A 5HLHA 2O3FA 3L9FA 3GW2A 3EDPA 3FHZA 5JHUA 4LMYA 2L3DA 3GLXA 3HIFA 1SFEA 3TQNA 4EJUA 4IF4A 1B9MA 2JRTA 5AONA 1S6LA 3I59B 3T1BA 2HTSA 4A2UA 4XRFA 5JI6A 3RYPA 1XDSA 4EMSA 3FF5A 2L01A 1YW9A 1R58A 2TDXA 1ZRFA 2D2WA 3MZHA 1J75A 3L7WA 1EH8A 2QENA 4ESFA 2R7FA 1O3SA 2ZKZA 5CYVA 3H92A 4RAYA 3KETA 2XAQA 3GFJA 1ZREA 4MQ9F 5H6RA 3H3UA 2VE9A 4KT5C 3T8TA 4PZJA 3COAC 1FZPB 3NEUA 5K5RA 3WTWC 1W7PD 1CF7B 3KP7A 5HLGA 3C7JA 2QWWA 2P4WA 1C0WA 2ADUA 3SZTA 3T5XA 5ERIA 2P6SA 2L4AA 2HQNA 4CHUA 2UZKA 1X3UA 4YIFA 4HX7A 4KN7X 3HOSA 2Q0OA 3I58A 3BPXA 3ECHA 5IT9Z 2F5EA 2W84A 4WF2A 5DCMB 3J80Z 5J8FA 2DLLA 4L9VA 4ZZDA 3FMRA 5H20A 1R5GA 2IA1A 2W85A 2UXNA 4U0WA 4EQQA 2G9WA 2GA2A 5K1YA 3WTUC 1WI9A 3GFMA 1R1VA 5J8CA 3MFKA 4ASNA 1RIOH 2DPUA 4LLNA 1OPCA 1YO5C 1KU7A 1UCRA 3C3WA 3HRUA 4Y15A 2CG4A 2X0LA 3R4KA 4BHBA 5E17F 2JT1A 4ESJA 1SD7A 4Q47A 2QLZA 5BPDA 3ULQB 1R1TA 3V8KA 4KDPA 1SAXA 4L5IA 5D5WB 3AAFA 3M7GA 2A68F 1QGPA 5F64A 2HQRA 1NHAA 3E5XA 2Z5UA 5JR3A 3MEXA 4L5JA 4AD9A 1PP8F 1WKMA 2BBYA 5L3GA 3LQRA 4IJAA 2XUBA 3JSOA 3R6SA 2VBZA 4G8XA 5ICGA 4M71A 1R5HA 4PGHA 4HX4A 1WSUA 3ECOA 4RGXA 1TQIA 1P4XA 2KIMA 4BH9A 5D4SA 5FLXZ 1KYWA 2PQ8A 2M45A 4P5OA 4U88A 4IRHA 3U1DA 4IVNA 3BJOA 3ZN0A 1P4AA 3VODA 4I98B 3RPQA 1SD6A 4LG0A 5DD4A 1I5ZA 2FBHA 1ZGJA 3F8FA 2FQ3A 4Z2YA 1HKQA 4Q5SF 1FP2A 1I1GA 2IPQX 4RS8A 1YW8A 1TW2A 2JPCA 4HYEA 2M87A 4IHSA 1H0MA 3BP8A 4F7ZA 2RC4A 5E20A 4HW0A 4IPAA 4CGZA 3R0AA 1XSVA 3TDUC 2VC0A 5BQTA 4OMYA 2FEZA 3FXRA 5E1ZB 2M1BA 1SMYF 2J5OA 3ZMUA 4UUVA 5EEHA 2GAUA 4GYIA 1XMAA 1KU9A 1QBJA 1O7FA 1T39A 2YPRA 2JSCA 4R1HA 1FBUA 3HSRA 1T38A 2PG4A 3V7CA 4P55A 4HLYA 2COMA 2FOKA 3K9TA 2NAZA 3E97A 2DQRA 3BDDA 3O3KA 1MJBA 3KZZA 3I54A 3M8FA 5ED4A 4KICA 1D8KA 4FHTA 1LEBA 4LLGF 2FRHA 4KMUX 1DUXC 2V6CA 4LG0B 4CZZA 1F9NA 1G6NA 1QPMA 2HTJA 4LB5A 4JK1X 2ISYA 4P96A 2VODA 1U5TA 1FBSA 1KA8A 3E3VA 4EJWA 5CJ9A 2IA0A 1JXSA 1AWCA 3ROUA 3TDZC 3WE3A 1R1UA 4MTDA 3TGNA 3F8MA 2C6YA 3FXUA 3QOPA 4IRIA 4RB3C 4O5VA 3HSFA 1MJ9A 3F21A 1MDMA 5DCFA 2VBYA 2WTEA 2L4MA 1XD7A 3M8EA 4WXDA 4WWCA 1QNTA 3BJAA 3DKWA 1QQIA 3Q9VA 2EA2A 2XHKA 1OMIA 2KIFA 1OYYA 1D5VA 2HOEA 3IC7A 3KP6A 4NB5A 4KA4A 2PFBA 3IWZA 1FP1D 1ZGAA 4B8XA 1MKMA 4R8HA 2MA3A 2EFWA 2FXAA 2RGVA 3KFWX 4EJVA 2NNYA 3N4MA 1IN6A 1Z05A 3C18A 3CTAA 3P9KA 3F6VA 3RI4A 3CUQA 5HDGA 2O61A 2ZBKA 4LK0F 3E6CC 2BE5F 4L9TA 1USTA 3RKYA 1LJ9A 2RVCA 4ZZLA 3JTGA 3RPUA 3DXJF 1IAWA 1R7JA 1YS7A 1QZYA 1KQ9A 2XIGA 2IW5A 2A6EF 2MLGA 4EGYA 1XMKA 1W7PB 4ESBA 5DYMA 3PQJA 3LA2A 4RGSA 2G7UA 3CUQC 4DNCA 4MGRA 2ZNYA 2BV6A 1HQCA 1U2WA 1J2XA 3LA3A 3TOAA 2P6TA 5LRSA 1FSEA 1ZLJA 1HSTA 5D5VB 3RKWA 2ZXJA 1HSJA 1BIBA 3HHGA 2FA5A 1O3RA 2KIUA 1W5SA 2V1DA 3FWEA 2OA4A 1Z6TA 4WCGA 3CUQB 1FYMA 2P8TA 3C1DA 3WE2A 2PMUA 2VT2A 1OR7A 2HYGD 3KLNA 1V3FA 3BJ6A 2A69F 3MWMA 4BHPA 5LEKA 1RUNA 4G7OF 2MLKA 1HW1A 4M6YA 4EJOA 4XLNF 3DQVC 5BS6A 3NRVA 5L3EA 3QPHA 2Y0MA 3MQ0A 1J5YA 4L9JA 1IXSB 4KN4X 3MAJA 1STZA 4S05A 1K78B 2XKOA 4UHTA 2XAHA 5ILSA 3NQOA 4UVBA 1ZG1A 3SXYA 3I5UA 2L54A 4BHCA 1V4RA 3IKTA 2QVOA 1EH7A 2ETHA 2XROA 1KQ8A 2FMYA 1LDJA 1TBXA 5HS7A 5FB2A 1ODDA 3JAMK 4K2EA 3P7NA 2QM3A 3K1MA 2ELHA 3HUGA 3GX4X 5BOXA 3IL2A 3ZMZA 4OIRF 1H9TA 1XB4A 3VEPA 3L09A 2HS5A 2AXLA 2V1UA 3QRFF 4HOBA 4I0BA 1G3TA 2Q2EA 2IVMA 1SD4A 2O8XA 3IWFA 2GIVA 2V79A 3REOA 4ZYHA 4UV9A 1K79A 5A2QK 4WXCA 2VONA 4GO1A 4YIIA 4XLPF 1IUYA 1YQAA 2K4JA 2XAJA 5E18F 1G4DA 1BJAA 1ULYA 3T0YA 2G7HA 3CO7C 5HVQC 4LK1F 1GHCA 4NHJA 4PGGA 3ZP5A 3CUOA 5L3CA 1G3SA 4A6DA 3GVAA 2V1XA 4P9UA 4RGRA 5E1XA 2VXZA 4ENNA 4M72A 2VBWA 3I53A 2STTA 2H94A 2P7VB 4B09A 1L3LA 4AIHA 3L00A 1FC3A 3MCZA 2DQLA 2F5CA 4EGZA 2BGCA 2OBPA 1FPQA 3GFIA 4M74A 4UV8A 4HZFA 2VBXA 3LWFA 3LAJA 1T6SA 5AIPA 4HV5A 3ZQ7A 1I27A 2D1HA 4UXNA 3K0LA 1YYVA 3LAPA 4BQAA 3D0SA 5D8KB 3WTSC 3ABUA 1DPRA 3J81Z 1OYIA 4O6JA 4EM1A 2H6CA 4YFNF 5HDNA 1XSXA 3GFLA 1XCVA 2K27A 3JSPA 2OAZA 1B59A 3LA7A 2GWRA 2Y48A 1FWZA 2IJLA 4E70A 4AIKA 1TLHB 3KZYA 2LNBA 4HLXA 4HAMA 5D5UB 1RNLA 3FMQA 1BBYA 3PQKA 1MGTA 1W4MA 4Q4ZF 1BOAA 4I2OA 5BPIA 1RZ4A 4L0YB 1F1ZA 3OOPA 2FE3A 3WG9A 4XSXF 5E1WA 5D6FA 3WGGA 3ZPLA 3GO5A 4P9FA 4ZYGA 2CSOA 2GA1A 1J0RA 1REPC 4PCQA 5ICFA 2PN6A 2IT0A 4M6XA 2D45A 2P5LC 5HS8A 4CICA 2IA2A 5CVJA 2QBYA 4CDGA 5IT3A 4I0AA 1BI1A 2XVCA 4EVIA 3WGIA 1FY7A 2DK5A 4U0VA 4WX9A 2Z99A 3WODF 4GYGA 5J6XA 3ML6A 1YG2A 2HWVA 2EV0A 3F72A 5KK1A 3KEOA 4G7HF 1KYZA 4HF0A 3EQLF 1QZZA 4U0YA 3LSTA 1IZ1A 3ELKA 2CFXA 3F8NA 2GQQA 3M9AA 5LLQA 4GCVA 1Z1DA 2MBFA 2HDCA 2PJPA 2P7CB 4IRGA 1I1SA 3BROA 5E8GA 1FLIA 4KYWA 1YTYA 3HRTA 3WU0A 2Q8KA 2RKHA 1A04A 1SFXA 2R3SA 1UHMA 2A3SA 4OMZA 4RGUA 4U7BA 2FNPA 2H6BA 1KGSA 4G7ZF 1LDDA 4EM2A 4BYYA 3O2PE 5H6QA 2RQPA 3V4GA 1BI3A 1TTYA 5E8IA 4RAZA 4I09A 3BZ6A 3ABTA 1TW3A 4O3MA 4LJZF 3JW4A 3I71A 2W24A 4L9NA 3W6JB 1S7AA 4NQWA 2NS0A 2CW0F 3GWZA 1U3EM 1ON1A 1AOYA 2QZ8A 3EYIA 4WK8F 2CGPA 5IT9K 5BMZA 2ZCWA 4LD5A 4QLCU 5HS9A 3WTTC 4RB0A 2V9VA 1U5TC 2PI0A 3J80K 2HKXA 3RDIA 1T0FA 2FU4A 1IN4A 3G73A 2D1VA 1GVJA 3FM5A 2RN7A 1S29A 1GXQA 2HFHA 3V7SA 4G6DA 3VFZA 3F23A 3K69A 1BN5A 2BEOA 4A0YA 1IRGA 4LB6B 2O6GE 3V8JA 1TNSA 1U5TB 2QUFA 4UNOA 1DDNA 4KNYA 1UB9A 3K1NA 1HKTA 4H0EA 1JGSA 4JBAA 1IN8A 1MJAA 1LB2A 1E17A 2XGXA 2JTVA 1MDMB 4OINF 3BOQA 2JZYA 2HR3A 2ZFWA 5TJJA 2DBBA 3HTSB 1ZRCA 1SFUA 3EUHA 2O03A 5LHIA 1LVAA 5TRDA 4KIBA 2B0LA 3WTXC 4ZYEA 2AS5F 3LFKA 3ZMVA 1XSDA 3RJPA 3FX3A 4MTEA 1XGMA 4Y13A 2P5VA 2LSOA 2DT5A 3I59A 1EV7A 3QAHA 4HF2A 2MH2A 2QQAA 2DPDA 1MZBA 5DV5A 5DEQA 4YFXF 5FLXK 3KLOA 3GEZA 1IW7F 3HRSA 5FO5A 3KP2A 3QU6A 4HX8A 1BC7C 3HHHA 2IP2A 1O57A 2LDUA 2EB7A 3V8LA 4A12A 4KMFA 1P2FA 1XGNA 3DPTA 5CVUA 5FD6A 3HYIA 4M73A 4A0ZA 3CJNA 5LEJA 2EFNA 5ILVA 2K86A 3QPTA 3T8RA 1IRFA 1R23A 2YX7A 2Z33A 4L0ZB 1DP7P 3RIRA 1P92A 1JHHA 4TV7A 2F5DA 2WWYA 1ONVA 2KRFA 1BC8C 5L3FA 2VT3A 1CF7A 5CLSA 2ESHA 5ILUA 1ZAOA 3EYYA 3K2ZA 4YG2F 5FFXA 3FXQA 1TQMA 1XGSA 1R36A 3DFGA 2XRNA 3EETA 3G3ZA 2KJCA 1D3YA 2WV0A 2EFOA 1G3YA 3DF8A 2BYVE 3KP4A 4PDKA 1ZG3A 5HDKA 2K02A 1YFHA 3HTUA 3WTVC 5DCMA 1O7LA 3KP5A 1HKSA 2W25A 3E6MA 1XGOA 5LGTA 3L2CA 3M1EA 4G6QA 2A6HF 3S2WA 2E7XA 4ON0A 5LGUA 2K7LA 1I6XA 3BWGA 1FYLA 4ENMA 1H9GA 2NRAC 4FX0A 2KKOA 4AVPA 2VN2A 1D8JA 3H3ZA 4HF1A 3F22A 1HBXG 3Q9SA 2GZWA 1SD5A 3BY6A 4OU0A 2STWA 3VOEA 4L18B 2R7DA 2GXBA 2ZNZA 4DQ2A 2RV8A 1FBQA 4GGGA 2EV6A 2A5YB 6PAXA 1ON2A 4M9XA 1ZRDA 4G9YA 2QQBA 4HDVA 4KUMA 4S04A 5L3DA 3O6BB 3DEUA 4OOIA 4M9SA 1Z6RA 2CQKA 1F5TA 4QWQA 1XCBA 4HQMA 1T98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMS A;  1IN7 A;  3ZMD A;  4LFU A;  3HRM A;  2HGC A;  3CDH A;  5K5O A;  1GXP A;  3MZY A;  4CO8 A;  4FT8 A;  2Y75 A;  1BI0 A;  1ZG5 A;  1J7K A;  3V7R A;  1BIA A;  4AWX B;  4A5M A;  3E5Q A;  4CYD A;  2CO5 A;  4G94 A;  1FSH A;  4BXU A;  3LQQ A;  3F8C A;  5HLI A;  3TOB A;  5D5X B;  4Y17 A;  3GYH X;  2FML A;  1Z91 A;  3IRQ A;  2JPB A;  5F6F A;  4EV0 A;  4KIF A;  4A5N A;  4FX4 A;  2ACJ A;  3CO6 C;  3RYR A;  4D0P A;  4N0B A;  2UXX A;  2Z9O A;  4U7D A;  4I7H A;  1U78 A;  3HOT A;  1R22 A;  1TQP A;  1LNW A;  3IKV A;  1OYW A;  4RB1 A;  3IRR A;  3P9C A;  2GXG A;  1HXD A;  2M8E A;  1B6A A;  3P9I A;  2F2E A;  5DUK A;  3CLO A;  1PP7 U;  2LF7 A;  4XBF A;  5JVT A;  1XN7 A;  2KJB A;  4BAY A;  2ISZ A;  2LF8 A;  1W5T A;  2X4H A;  5EEG A;  4ETS A;  1WWX A;  1BI2 A;  4MHG A;  3B73 A;  2DI3 A;  2F5F A;  3W6K B;  5K5Q A;  4HQE A;  4N9I A;  1IXR C;  2FSW A;  1FOK A;  2M30 A;  1G3W A;  1B1B A;  4IXA A;  2OZ6 A;  2FF4 A;  1ZYR F;  2Z3Y A;  5JFR A;  1RUO A;  4HBL A;  4UVA A;  3ISP A;  1DPU A;  2IRF G;  5LGN A;  2H09 A;  4A6E A;  2DU9 A;  2XAG A;  3GXO A;  2DO7 A;  2LKP A;  5LHH A;  5HOO A;  2E1N A;  3PFI A;  4WXH A;  3DV8 A;  1LEA A;  2PEX A;  3E5U A;  1P6R A;  1PUE E;  2J5P A;  1LDK B;  5FD5 A;  2FBI A;  3RKX A;  1ZAR A;  4A0X A;  3R61 A;  3ERE D;  1YS6 A;  4UVC A;  3J7A O;  4XSZ F;  4ENJ A;  1B9N A;  5LHG A;  4MQV A;  1P4W A;  4MEX F;  3SZP A;  3I0T A;  3TKY A;  1ZHF A;  1T2K A;  1Z9C A;  3GZ6 A;  2XAS A;  2NYX A;  1KU2 A;  3KE2 A;  2NNN A;  1Q1H A;  2O0Y A;  1B4A A;  4RB2 C;  5ICE A;  2RNJ A;  1FYK A;  2M5W A;  2DK8 A;  1PDN C;  4CXF A;  2OU2 A;  3K1P A;  2RDP A;  1WRJ A;  2XV4 S;  1TNT A;  3I64 A;  5KVR A;  4R79 A;  2YU3 A;  3VB2 A;  1Z7U A;  1YLF A;  4GXO A;  2QBY B;  3E6D A;  3TO6 A;  3JAM Z;  5DDG A;  1JHF A;  3F6O A;  1VTN C;  3R0J A;  3BPV A;  5DD8 A;  4YFK F;  3SHF A;  3ZMT A;  1F4K A;  4JQF A;  2CYY A;  3QU3 A;  1ZN2 A;  4EM0 B;  1IF1 A;  3WU1 B;  2YR2 A;  3F8B A;  5F1R A;  5LBQ A;  3D5L A;  2ESN A;  1W7P A;  4OIO F;  1O3T A;  5FFZ A;  5A2Q Z;  3ZN1 A;  2XAF A;  2H27 A;  2ZME A;  4EJT A;  2QYO A;  4AIJ A;  5CVR A;  2MC3 A;  5D8L B;  1U6G A;  1MD0 A;  3GF2 A;  3N97 A;  3Q5F A;  1ZLK A;  4HA8 A;  2EV5 A;  1S7O A;  4KFC A;  3FZV A;  4M9Z A;  3OV8 A;  1HW5 A;  3GZ5 A;  1IXC A;  2XKP A;  2EFQ A;  2W57 A;  2VC1 A;  3QP6 A;  2UWM A;  5L3B A;  2A61 A;  3WTY C;  4OIP F;  2VOO A;  2MD5 A;  2HZT A;  1HW2 A;  4KIG A;  1J9I A;  1CGP A;  5LRR A;  3U9G A;  1R00 A;  4N9H A;  1OKR A;  1E2X A;  1K6O A;  1BM9 A;  1KU3 A;  4Q48 A;  1YW7 A;  4LLL A;  5CVI A;  1K7A A;  2A07 F;  3J81 K;  2EA4 A;  2HEO A;  1EH6 A;  2PBI A;  3TO9 A;  3B02 A;  4MEY F;  2EK5 A;  2P5K A;  3DP7 A;  1Y0U A;  4LGW A;  1J59 A;  4OIQ F;  2VE8 A;  5DUI A;  2ZJ2 A;  2L02 A;  2ZME B;  2DAO A;  3I4P A;  1FT9 A;  3KCC A;  1L0O C;  2OZU A;  1IN5 A;  3E6B A;  3KEQ A;  1WQ2 A;  4ZYD A;  5FGM A;  1S8N A;  1UHW A;  3R60 A;  3TO7 A;  2OQG A;  1UFM A;  2YX4 A;  5ICC A;  1K78 A;  2PLY A;  3WGH A;  1RI7 A;  2K4B A;  2FBK A;  3QP5 A;  1O3Q A;  2E7W A;  2OQR A;  4I02 A;  2HYF A;  2QQ9 A;  5AIQ A;  2ZO4 A;  2DW4 A;  2E1C A;  2HKO A;  1FNN A;  3IHU A;  4MNU A;  2WC2 A;  2VOP A;  1YIO A;  1ZH5 A;  3U2R A;  1QO0 D;  4BNC A;  3ZMS A;  1KQ0 A;  3SQN A;  2MH9 A;  1S3J A;  1SMT A;  2DFI A;  4HDU A;  3GUD A;  2EWN A;  3FM3 A;  2YSR A;  2DTR A;  3KP3 A;  3JTH A;  4ZH4 F;  1LQ1 A;  2OD5 A;  1FX7 A;  4HV6 A;  4I01 A;  3WTZ A;  5D6E A;  5CVV A;  3RTR A;  2EJR A;  1USS A;  5D4R A;  2CWE A;  3SFZ A;  1U8R A;  4IHT A;  2PMH A;  1XDU A;  2EFP A;  2FNA A;  3DPL C;  3HSE A;  4ENK A;  3F3X A;  1JE8 A;  5HLH A;  2O3F A;  3L9F A;  3GW2 A;  3EDP A;  3FHZ A;  5JHU A;  4LMY A;  2L3D A;  3GLX A;  3HIF A;  1SFE A;  3TQN A;  4EJU A;  4IF4 A;  1B9M A;  2JRT A;  5AON A;  1S6L A;  3I59 B;  3T1B A;  2HTS A;  4A2U A;  4XRF A;  5JI6 A;  3RYP A;  1XDS A;  4EMS A;  3FF5 A;  2L01 A;  1YW9 A;  1R58 A;  2TDX A;  1ZRF A;  2D2W A;  3MZH A;  1J75 A;  3L7W A;  1EH8 A;  2QEN A;  4ESF A;  2R7F A;  1O3S A;  2ZKZ A;  5CYV A;  3H92 A;  4RAY A;  3KET A;  2XAQ A;  3GFJ A;  1ZRE A;  4MQ9 F;  5H6R A;  3H3U A;  2VE9 A;  4KT5 C;  3T8T A;  4PZJ A;  3COA C;  1FZP B;  3NEU A;  5K5R A;  3WTW C;  1W7P D;  1CF7 B;  3KP7 A;  5HLG A;  3C7J A;  2QWW A;  2P4W A;  1C0W A;  2ADU A;  3SZT A;  3T5X A;  5ERI A;  2P6S A;  2L4A A;  2HQN A;  4CHU A;  2UZK A;  1X3U A;  4YIF A;  4HX7 A;  4KN7 X;  3HOS A;  2Q0O A;  3I58 A;  3BPX A;  3ECH A;  5IT9 Z;  2F5E A;  2W84 A;  4WF2 A;  5DCM B;  3J80 Z;  5J8F A;  2DLL A;  4L9V A;  4ZZD A;  3FMR A;  5H20 A;  1R5G A;  2IA1 A;  2W85 A;  2UXN A;  4U0W A;  4EQQ A;  2G9W A;  2GA2 A;  5K1Y A;  3WTU C;  1WI9 A;  3GFM A;  1R1V A;  5J8C A;  3MFK A;  4ASN A;  1RIO H;  2DPU A;  4LLN A;  1OPC A;  1YO5 C;  1KU7 A;  1UCR A;  3C3W A;  3HRU A;  4Y15 A;  2CG4 A;  2X0L A;  3R4K A;  4BHB A;  5E17 F;  2JT1 A;  4ESJ A;  1SD7 A;  4Q47 A;  2QLZ A;  5BPD A;  3ULQ B;  1R1T A;  3V8K A;  4KDP A;  1SAX A;  4L5I A;  5D5W B;  3AAF A;  3M7G A;  2A68 F;  1QGP A;  5F64 A;  2HQR A;  1NHA A;  3E5X A;  2Z5U A;  5JR3 A;  3MEX A;  4L5J A;  4AD9 A;  1PP8 F;  1WKM A;  2BBY A;  5L3G A;  3LQR A;  4IJA A;  2XUB A;  3JSO A;  3R6S A;  2VBZ A;  4G8X A;  5ICG A;  4M71 A;  1R5H A;  4PGH A;  4HX4 A;  1WSU A;  3ECO A;  4RGX A;  1TQI A;  1P4X A;  2KIM A;  4BH9 A;  5D4S A;  5FLX Z;  1KYW A;  2PQ8 A;  2M45 A;  4P5O A;  4U88 A;  4IRH A;  3U1D A;  4IVN A;  3BJO A;  3ZN0 A;  1P4A A;  3VOD A;  4I98 B;  3RPQ A;  1SD6 A;  4LG0 A;  5DD4 A;  1I5Z A;  2FBH A;  1ZGJ A;  3F8F A;  2FQ3 A;  4Z2Y A;  1HKQ A;  4Q5S F;  1FP2 A;  1I1G A;  2IPQ X;  4RS8 A;  1YW8 A;  1TW2 A;  2JPC A;  4HYE A;  2M87 A;  4IHS A;  1H0M A;  3BP8 A;  4F7Z A;  2RC4 A;  5E20 A;  4HW0 A;  4IPA A;  4CGZ A;  3R0A A;  1XSV A;  3TDU C;  2VC0 A;  5BQT A;  4OMY A;  2FEZ A;  3FXR A;  5E1Z B;  2M1B A;  1SMY F;  2J5O A;  3ZMU A;  4UUV A;  5EEH A;  2GAU A;  4GYI A;  1XMA A;  1KU9 A;  1QBJ A;  1O7F A;  1T39 A;  2YPR A;  2JSC A;  4R1H A;  1FBU A;  3HSR A;  1T38 A;  2PG4 A;  3V7C A;  4P55 A;  4HLY A;  2COM A;  2FOK A;  3K9T A;  2NAZ A;  3E97 A;  2DQR A;  3BDD A;  3O3K A;  1MJB A;  3KZZ A;  3I54 A;  3M8F A;  5ED4 A;  4KIC A;  1D8K A;  4FHT A;  1LEB A;  4LLG F;  2FRH A;  4KMU X;  1DUX C;  2V6C A;  4LG0 B;  4CZZ A;  1F9N A;  1G6N A;  1QPM A;  2HTJ A;  4LB5 A;  4JK1 X;  2ISY A;  4P96 A;  2VOD A;  1U5T A;  1FBS A;  1KA8 A;  3E3V A;  4EJW A;  5CJ9 A;  2IA0 A;  1JXS A;  1AWC A;  3ROU A;  3TDZ C;  3WE3 A;  1R1U A;  4MTD A;  3TGN A;  3F8M A;  2C6Y A;  3FXU A;  3QOP A;  4IRI A;  4RB3 C;  4O5V A;  3HSF A;  1MJ9 A;  3F21 A;  1MDM A;  5DCF A;  2VBY A;  2WTE A;  2L4M A;  1XD7 A;  3M8E A;  4WXD A;  4WWC A;  1QNT A;  3BJA A;  3DKW A;  1QQI A;  3Q9V A;  2EA2 A;  2XHK A;  1OMI A;  2KIF A;  1OYY A;  1D5V A;  2HOE A;  3IC7 A;  3KP6 A;  4NB5 A;  4KA4 A;  2PFB A;  3IWZ A;  1FP1 D;  1ZGA A;  4B8X A;  1MKM A;  4R8H A;  2MA3 A;  2EFW A;  2FXA A;  2RGV A;  3KFW X;  4EJV A;  2NNY A;  3N4M A;  1IN6 A;  1Z05 A;  3C18 A;  3CTA A;  3P9K A;  3F6V A;  3RI4 A;  3CUQ A;  5HDG A;  2O61 A;  2ZBK A;  4LK0 F;  3E6C C;  2BE5 F;  4L9T A;  1UST A;  3RKY A;  1LJ9 A;  2RVC A;  4ZZL A;  3JTG A;  3RPU A;  3DXJ F;  1IAW A;  1R7J A;  1YS7 A;  1QZY A;  1KQ9 A;  2XIG A;  2IW5 A;  2A6E F;  2MLG A;  4EGY A;  1XMK A;  1W7P B;  4ESB A;  5DYM A;  3PQJ A;  3LA2 A;  4RGS A;  2G7U A;  3CUQ C;  4DNC A;  4MGR A;  2ZNY A;  2BV6 A;  1HQC A;  1U2W A;  1J2X A;  3LA3 A;  3TOA A;  2P6T A;  5LRS A;  1FSE A;  1ZLJ A;  1HST A;  5D5V B;  3RKW A;  2ZXJ A;  1HSJ A;  1BIB A;  3HHG A;  2FA5 A;  1O3R A;  2KIU A;  1W5S A;  2V1D A;  3FWE A;  2OA4 A;  1Z6T A;  4WCG A;  3CUQ B;  1FYM A;  2P8T A;  3C1D A;  3WE2 A;  2PMU A;  2VT2 A;  1OR7 A;  2HYG D;  3KLN A;  1V3F A;  3BJ6 A;  2A69 F;  3MWM A;  4BHP A;  5LEK A;  1RUN A;  4G7O F;  2MLK A;  1HW1 A;  4M6Y A;  4EJO A;  4XLN F;  3DQV C;  5BS6 A;  3NRV A;  5L3E A;  3QPH A;  2Y0M A;  3MQ0 A;  1J5Y A;  4L9J A;  1IXS B;  4KN4 X;  3MAJ A;  1STZ A;  4S05 A;  1K78 B;  2XKO A;  4UHT A;  2XAH A;  5ILS A;  3NQO A;  4UVB A;  1ZG1 A;  3SXY A;  3I5U A;  2L54 A;  4BHC A;  1V4R A;  3IKT A;  2QVO A;  1EH7 A;  2ETH A;  2XRO A;  1KQ8 A;  2FMY A;  1LDJ A;  1TBX A;  5HS7 A;  5FB2 A;  1ODD A;  3JAM K;  4K2E A;  3P7N A;  2QM3 A;  3K1M A;  2ELH A;  3HUG A;  3GX4 X;  5BOX A;  3IL2 A;  3ZMZ A;  4OIR F;  1H9T A;  1XB4 A;  3VEP A;  3L09 A;  2HS5 A;  2AXL A;  2V1U A;  3QRF F;  4HOB A;  4I0B A;  1G3T A;  2Q2E A;  2IVM A;  1SD4 A;  2O8X A;  3IWF A;  2GIV A;  2V79 A;  3REO A;  4ZYH A;  4UV9 A;  1K79 A;  5A2Q K;  4WXC A;  2VON A;  4GO1 A;  4YII A;  4XLP F;  1IUY A;  1YQA A;  2K4J A;  2XAJ A;  5E18 F;  1G4D A;  1BJA A;  1ULY A;  3T0Y A;  2G7H A;  3CO7 C;  5HVQ C;  4LK1 F;  1GHC A;  4NHJ A;  4PGG A;  3ZP5 A;  3CUO A;  5L3C A;  1G3S A;  4A6D A;  3GVA A;  2V1X A;  4P9U A;  4RGR A;  5E1X A;  2VXZ A;  4ENN A;  4M72 A;  2VBW A;  3I53 A;  2STT A;  2H94 A;  2P7V B;  4B09 A;  1L3L A;  4AIH A;  3L00 A;  1FC3 A;  3MCZ A;  2DQL A;  2F5C A;  4EGZ A;  2BGC A;  2OBP A;  1FPQ A;  3GFI A;  4M74 A;  4UV8 A;  4HZF A;  2VBX A;  3LWF A;  3LAJ A;  1T6S A;  5AIP A;  4HV5 A;  3ZQ7 A;  1I27 A;  2D1H A;  4UXN A;  3K0L A;  1YYV A;  3LAP A;  4BQA A;  3D0S A;  5D8K B;  3WTS C;  3ABU A;  1DPR A;  3J81 Z;  1OYI A;  4O6J A;  4EM1 A;  2H6C A;  4YFN F;  5HDN A;  1XSX A;  3GFL A;  1XCV A;  2K27 A;  3JSP A;  2OAZ A;  1B59 A;  3LA7 A;  2GWR A;  2Y48 A;  1FWZ A;  2IJL A;  4E70 A;  4AIK A;  1TLH B;  3KZY A;  2LNB A;  4HLX A;  4HAM A;  5D5U B;  1RNL A;  3FMQ A;  1BBY A;  3PQK A;  1MGT A;  1W4M A;  4Q4Z F;  1BOA A;  4I2O A;  5BPI A;  1RZ4 A;  4L0Y B;  1F1Z A;  3OOP A;  2FE3 A;  3WG9 A;  4XSX F;  5E1W A;  5D6F A;  3WGG A;  3ZPL A;  3GO5 A;  4P9F A;  4ZYG A;  2CSO A;  2GA1 A;  1J0R A;  1REP C;  4PCQ A;  5ICF A;  2PN6 A;  2IT0 A;  4M6X A;  2D45 A;  2P5L C;  5HS8 A;  4CIC A;  2IA2 A;  5CVJ A;  2QBY A;  4CDG A;  5IT3 A;  4I0A A;  1BI1 A;  2XVC A;  4EVI A;  3WGI A;  1FY7 A;  2DK5 A;  4U0V A;  4WX9 A;  2Z99 A;  3WOD F;  4GYG A;  5J6X A;  3ML6 A;  1YG2 A;  2HWV A;  2EV0 A;  3F72 A;  5KK1 A;  3KEO A;  4G7H F;  1KYZ A;  4HF0 A;  3EQL F;  1QZZ A;  4U0Y A;  3LST A;  1IZ1 A;  3ELK A;  2CFX A;  3F8N A;  2GQQ A;  3M9A A;  5LLQ A;  4GCV A;  1Z1D A;  2MBF A;  2HDC A;  2PJP A;  2P7C B;  4IRG A;  1I1S A;  3BRO A;  5E8G A;  1FLI A;  4KYW A;  1YTY A;  3HRT A;  3WU0 A;  2Q8K A;  2RKH A;  1A04 A;  1SFX A;  2R3S A;  1UHM A;  2A3S A;  4OMZ A;  4RGU A;  4U7B A;  2FNP A;  2H6B A;  1KGS A;  4G7Z F;  1LDD A;  4EM2 A;  4BYY A;  3O2P E;  5H6Q A;  2RQP A;  3V4G A;  1BI3 A;  1TTY A;  5E8I A;  4RAZ A;  4I09 A;  3BZ6 A;  3ABT A;  1TW3 A;  4O3M A;  4LJZ F;  3JW4 A;  3I71 A;  2W24 A;  4L9N A;  3W6J B;  1S7A A;  4NQW A;  2NS0 A;  2CW0 F;  3GWZ A;  1U3E M;  1ON1 A;  1AOY A;  2QZ8 A;  3EYI A;  4WK8 F;  2CGP A;  5IT9 K;  5BMZ A;  2ZCW A;  4LD5 A;  4QLC U;  5HS9 A;  3WTT C;  4RB0 A;  2V9V A;  1U5T C;  2PI0 A;  3J80 K;  2HKX A;  3RDI A;  1T0F A;  2FU4 A;  1IN4 A;  3G73 A;  2D1V A;  1GVJ A;  3FM5 A;  2RN7 A;  1S29 A;  1GXQ A;  2HFH A;  3V7S A;  4G6D A;  3VFZ A;  3F23 A;  3K69 A;  1BN5 A;  2BEO A;  4A0Y A;  1IRG A;  4LB6 B;  2O6G E;  3V8J A;  1TNS A;  1U5T B;  2QUF A;  4UNO A;  1DDN A;  4KNY A;  1UB9 A;  3K1N A;  1HKT A;  4H0E A;  1JGS A;  4JBA A;  1IN8 A;  1MJA A;  1LB2 A;  1E17 A;  2XGX A;  2JTV A;  1MDM B;  4OIN F;  3BOQ A;  2JZY A;  2HR3 A;  2ZFW A;  5TJJ A;  2DBB A;  3HTS B;  1ZRC A;  1SFU A;  3EUH A;  2O03 A;  5LHI A;  1LVA A;  5TRD A;  4KIB A;  2B0L A;  3WTX C;  4ZYE A;  2AS5 F;  3LFK A;  3ZMV A;  1XSD A;  3RJP A;  3FX3 A;  4MTE A;  1XGM A;  4Y13 A;  2P5V A;  2LSO A;  2DT5 A;  3I59 A;  1EV7 A;  3QAH A;  4HF2 A;  2MH2 A;  2QQA A;  2DPD A;  1MZB A;  5DV5 A;  5DEQ A;  4YFX F;  5FLX K;  3KLO A;  3GEZ A;  1IW7 F;  3HRS A;  5FO5 A;  3KP2 A;  3QU6 A;  4HX8 A;  1BC7 C;  3HHH A;  2IP2 A;  1O57 A;  2LDU A;  2EB7 A;  3V8L A;  4A12 A;  4KMF A;  1P2F A;  1XGN A;  3DPT A;  5CVU A;  5FD6 A;  3HYI A;  4M73 A;  4A0Z A;  3CJN A;  5LEJ A;  2EFN A;  5ILV A;  2K86 A;  3QPT A;  3T8R A;  1IRF A;  1R23 A;  2YX7 A;  2Z33 A;  4L0Z B;  1DP7 P;  3RIR A;  1P92 A;  1JHH A;  4TV7 A;  2F5D A;  2WWY A;  1ONV A;  2KRF A;  1BC8 C;  5L3F A;  2VT3 A;  1CF7 A;  5CLS A;  2ESH A;  5ILU A;  1ZAO A;  3EYY A;  3K2Z A;  4YG2 F;  5FFX A;  3FXQ A;  1TQM A;  1XGS A;  1R36 A;  3DFG A;  2XRN A;  3EET A;  3G3Z A;  2KJC A;  1D3Y A;  2WV0 A;  2EFO A;  1G3Y A;  3DF8 A;  2BYV E;  3KP4 A;  4PDK A;  1ZG3 A;  5HDK A;  2K02 A;  1YFH A;  3HTU A;  3WTV C;  5DCM A;  1O7L A;  3KP5 A;  1HKS A;  2W25 A;  3E6M A;  1XGO A;  5LGT A;  3L2C A;  3M1E A;  4G6Q A;  2A6H F;  3S2W A;  2E7X A;  4ON0 A;  5LGU A;  2K7L A;  1I6X A;  3BWG A;  1FYL A;  4ENM A;  1H9G A;  2NRA C;  4FX0 A;  2KKO A;  4AVP A;  2VN2 A;  1D8J A;  3H3Z A;  4HF1 A;  3F22 A;  1HBX G;  3Q9S A;  2GZW A;  1SD5 A;  3BY6 A;  4OU0 A;  2STW A;  3VOE A;  4L18 B;  2R7D A;  2GXB A;  2ZNZ A;  4DQ2 A;  2RV8 A;  1FBQ A;  4GGG A;  2EV6 A;  2A5Y B;  6PAX A;  1ON2 A;  4M9X A;  1ZRD A;  4G9Y A;  2QQB A;  4HDV A;  4KUM A;  4S04 A;  5L3D A;  3O6B B;  3DEU A;  4OOI A;  4M9S A;  1Z6R A;  2CQK A;  1F5T A;  4QWQ A;  1XCB A;  4HQM A;  1T98 A; 
#chains in the Genus database with same CATH topology
 3FMS A;  3LSM A;  3P5J A;  1IN7 A;  3LSH A;  3ZMD A;  3OYA A;  2O9L A;  2H8W A;  4LFU A;  3HRM A;  1B8I A;  2HGC A;  3CDH A;  5K5O A;  1GXP A;  1BJZ A;  3MZY A;  3HUG B;  4B48 A;  4CO8 A;  2W48 A;  4FT8 A;  3I4N J;  2Y75 A;  1WJE A;  1TT5 B;  1BI0 A;  1R71 A;  2R7O A;  1ZG5 A;  1J7K A;  3V7R A;  2M4K A;  2QKM B;  3KZI C;  4CCN A;  1BIA A;  2XF7 A;  4AWX B;  4A5M A;  4KJZ A;  2JWT A;  3E5Q A;  4CYD A;  4CYC A;  3VSK A;  3ZXS A;  2LP0 A;  2CO5 A;  3BCA A;  3BTI A;  2CV0 A;  2IGK A;  3HM5 A;  5EYR A;  4G94 A;  1FSH A;  3L2W A;  2R7Q A;  4BXU A;  3LQQ A;  3F8C A;  5HLI A;  3TOB A;  5D5X B;  4IHW A;  4Y17 A;  2Q2E B;  4II3 A;  3GYH X;  2FML A;  3I55 I;  5J4V A;  5F27 A;  1APL C;  4XRM A;  3H9G A;  1Z91 A;  3IRQ A;  3Q0V A;  4HG2 A;  2JPB A;  2ECB A;  5F6F A;  4EV0 A;  3K70 D;  3ZGK A;  4KIF A;  3BTL A;  2IAI A;  1ETY A;  4A5N A;  4FX4 A;  2ACJ A;  1VQL I;  5GPA A;  2N8G A;  3CO6 C;  3RYR A;  3L2R A;  4D0P A;  4N0B A;  3K10 A;  2OPT A;  9ANT A;  2UXX A;  2NVX J;  2DA7 A;  5EF6 A;  3K2A A;  3CCQ I;  2Z9O A;  4G6T B;  4U7D A;  3FXO A;  4I7H A;  1U78 A;  3HOT A;  1R22 A;  1TQP A;  1LNW A;  3IKV A;  1XTA A;  1OYW A;  4RB1 A;  3IRR A;  3P9C A;  2CUE A;  2GXG A;  1FOW A;  1HXD A;  2DA2 A;  2M8E A;  1Y1V J;  3BG9 A;  1B6A A;  1VQN I;  3P9I A;  4BBS J;  2F2E A;  3FIS A;  3BCB A;  3GTK J;  5DUK A;  3H0G J;  5HOD A;  2R5Y B;  3OYK A;  3CLO A;  4BY1 J;  5CKT A;  2IS6 A;  2HPI A;  4M3G A;  1IDY A;  1PP7 U;  2LF7 A;  4XBF A;  5JVT A;  1XN7 A;  2EIJ H;  4NUB A;  1Z21 A;  2KJB A;  2XPV A;  4BAY A;  1QRY A;  3BR0 A;  3K4N A;  2ISZ A;  2LF8 A;  4A3E J;  1W5T A;  2WB1 N;  2GBY A;  2MGQ A;  2X4H A;  5EEG A;  3AG4 H;  4A3I J;  4ETS A;  1WWX A;  2L5Q A;  1BI2 A;  3IH3 A;  1F43 A;  3H5R A;  3BZC A;  2L9V A;  1V5G A;  4MHG A;  1JKO C;  3B73 A;  3DKY A;  3ASN H;  2DI3 A;  2F5F A;  4AM3 A;  3W6K B;  5K5Q A;  4HQE A;  1QVT A;  4N9I A;  1IXR C;  2FSW A;  1FOK A;  2BVM A;  1VQP I;  2M30 A;  1G3W A;  1B1B A;  4IXA A;  4QIW N;  2OZ6 A;  2FF4 A;  1ZYR F;  2Z3Y A;  4D5C A;  5JFR A;  4C2U A;  1RUO A;  2QCO A;  4HBL A;  4UVA A;  1W5C C;  3ISP A;  4B44 A;  1DPU A;  2W7N A;  2IRF G;  5LGN A;  1FTZ A;  2H09 A;  3IV5 A;  3E7L A;  1QA6 A;  4A6E A;  2K5C A;  2DU9 A;  2HQ5 A;  2XAG A;  3GXO A;  2DO7 A;  2A6T A;  4PJN A;  4BJ6 C;  2LKP A;  5LHH A;  5HOO A;  4W1U A;  2AXT C;  2E1N A;  2DA4 A;  3PFI A;  4WXH A;  2LY1 A;  3DV8 A;  1LEA A;  2PEX A;  3E5U A;  1P6R A;  1CQT A;  1PUE E;  2PJR B;  5FKN A;  1X1A A;  2J5P A;  1LDK B;  5FD5 A;  4BQQ A;  3OYJ A;  2FBI A;  3RKX A;  1ZAR A;  2DFE A;  4XIC A;  4A0X A;  3R61 A;  1UJ8 A;  3ERE D;  1YS6 A;  4UVC A;  3J7A O;  1WH7 A;  4XSZ F;  4ENJ A;  1B9N A;  1FOX A;  5LHG A;  1MIJ A;  4MQV A;  1P4W A;  2HPM A;  4B43 A;  2I10 A;  3TW6 A;  2OJE D;  2V7F A;  4MEX F;  1IJW C;  3CCE I;  3SZP A;  3C2H A;  3I0T A;  3TKY A;  1ZHF A;  1T2K A;  2JQ7 A;  1X1B A;  1Z9C A;  3GZ6 A;  3IH4 A;  1MMN A;  3QOE A;  3IAS 2;  1BR4 A;  2RNG A;  2XAS A;  1YJW I;  3KYL A;  1X1D A;  2NYX A;  3SDG A;  4XKW A;  1KU2 A;  3J7A Y;  5FKL A;  3KE2 A;  5M5Y J;  2EQR A;  4KIS A;  2NNN A;  1Q1H A;  3OYC A;  4A3B J;  3PNY A;  2O0Y A;  3TBI A;  4L5E A;  1B4A A;  4RB2 C;  5ICE A;  3TP0 A;  2RNJ A;  1FYK A;  3H9Q A;  3JRI A;  2M5W A;  2K9Q A;  3Q0U A;  2X85 A;  5CPR B;  3GTP J;  4PFP A;  2DK8 A;  1PDN C;  4CXF A;  2OU2 A;  3K1P A;  2RDP A;  1WRJ A;  2XV4 S;  4E7I A;  4C9Y A;  1TNT A;  3I64 A;  5KVR A;  4R79 A;  2YU3 A;  3VB2 A;  4IX7 A;  2E5N A;  1IRX A;  1Z7U A;  1RRJ A;  1YLF A;  4GXO A;  2MC4 A;  2QBY B;  1Q1V A;  3E6D A;  4I6Z A;  2NS7 A;  3W6V A;  3BG5 A;  3TO6 A;  3JAM Z;  1PUF A;  2K9M A;  4XM3 A;  2OCC H;  5DDG A;  1JHF A;  1MBH A;  3F6O A;  1N77 A;  2K3F A;  5KAI C;  3FXM A;  1VTN C;  3R0J A;  1WJD A;  3BPV A;  2LY9 A;  5DD8 A;  1TC3 C;  4YFK F;  3SHF A;  3ZMT A;  3ONQ A;  1F4K A;  4JQF A;  3BG7 A;  2CYY A;  3DBR B;  4ZTF A;  3PFY A;  3K4L A;  2ZXI A;  3QU3 A;  1ZN2 A;  1QVU A;  1ETW A;  2LMD A;  2NVY J;  2NVU B;  2V6E A;  4EM0 B;  2VI6 A;  2VJ4 A;  1IF1 A;  2I8D A;  3WU1 B;  2YR2 A;  3F8B A;  2R92 J;  2Y9Y A;  4D7M A;  2KPM A;  3IH2 A;  4ZDL A;  5F1R A;  2X6X A;  1LPQ A;  5LBQ A;  1GUU A;  2W1O A;  3D5L A;  3F9K A;  1Z0X A;  2ESN A;  4MIM A;  1W7P A;  4QPQ A;  3Q3S A;  4CA0 A;  1QHH D;  4OIO F;  1O3T A;  1R49 A;  5FFZ A;  5A2Q Z;  3ZN1 A;  3G4S I;  5EGO A;  3U1K A;  2XAF A;  4Y33 A;  2H27 A;  3S14 J;  1X3Z B;  2ZME A;  4EJT A;  2LRD A;  2QYO A;  4AIJ A;  5CVR A;  2MC3 A;  3O8H A;  5D8L B;  4RMN A;  2DA6 A;  1D0X A;  2RQQ A;  3SEQ A;  1K83 J;  2Y0S A;  3CC4 I;  1U6G A;  5FKM A;  1MD0 A;  1WH5 A;  4LIU A;  4RLF A;  4Y52 J;  2ID3 A;  3GF2 A;  4M3D A;  4XID A;  3LSI A;  3N97 A;  3Q5F A;  1OFC X;  1ZLK A;  4HA8 A;  2EV5 A;  3A03 A;  1S7O A;  4KFC A;  3FZV A;  2DA5 A;  2JJ7 A;  4M9Z A;  3OV8 A;  1HW5 A;  3F0C A;  2B9S A;  3GZ5 A;  4A3L J;  3A01 B;  1WVR A;  2E36 A;  3HOZ J;  1IXC A;  3EUA A;  2XKP A;  5M5W J;  2EFQ A;  2W57 A;  3DLA A;  2VC1 A;  4XN3 A;  2WAQ N;  5GPC A;  3QP6 A;  3FK6 A;  2LYC A;  3FK7 A;  5L3B A;  2A61 A;  4Z6Y A;  2UWM A;  3WTY C;  4OIP F;  2VOO A;  2MD5 A;  2HZT A;  5KCM A;  1HW2 A;  2Y69 H;  1ZGW A;  2ZME C;  4KIG A;  1J9I A;  4IL6 C;  1CGP A;  5LRR A;  3U9G A;  1R00 A;  4N9H A;  5EZH A;  1OKR A;  2V4J C;  3GME A;  1E2X A;  1K6O A;  4M6V A;  1BM9 A;  1KU3 A;  1RKW A;  4Q48 A;  3QOD A;  1YW7 A;  4LLL A;  1X58 A;  3JRB A;  5CVI A;  3PM1 A;  4NQW B;  2LD5 A;  1K7A A;  4HNV A;  2DDB A;  3J81 K;  2A07 F;  1R6R A;  4BJT A;  2EA4 A;  5DM7 F;  2HEO A;  1EH6 A;  4XMY A;  2XSJ C;  2PBI A;  3L2V A;  3TO9 A;  3B02 A;  2CUJ A;  4MEY F;  3MKZ A;  1N75 A;  2EK5 A;  2CFO A;  2LLK A;  2P5K A;  2HOT A;  2K9L A;  1EF4 A;  3DP7 A;  1ZR4 A;  4ZDP A;  1Y0U A;  4LGW A;  4AYB A;  1J59 A;  4XKV A;  4OIQ F;  3DU5 A;  2VE8 A;  3UR3 C;  5DUI A;  3QYB A;  2ZJ2 A;  2HI3 A;  2L02 A;  2ZME B;  1U8B A;  3ZQH A;  3CCU I;  2DAO A;  3I4P A;  1QU3 A;  1FT9 A;  3KCC A;  1L0O C;  2OZU A;  1IN5 A;  3TW7 A;  3E6B A;  4NDL A;  2OCE A;  3KEQ A;  1BOB A;  1WQ2 A;  4RLQ A;  3SYT A;  5GAH J;  4ZYD A;  3C2G A;  2VLA A;  1BR2 A;  4CZC A;  4CCM A;  5FGM A;  1S8N A;  1UHW A;  3R60 A;  3TO7 A;  2OQG A;  3ABM H;  1UFM A;  4DYR A;  2E1M C;  2YX4 A;  2WAD A;  5ICC A;  1K78 A;  2K9N A;  1MNE A;  2PLY A;  3WGH A;  1RI7 A;  4F93 B;  3OS2 A;  2K4B A;  2XGD A;  2FBK A;  4XON A;  1I6H J;  3QP5 A;  1O3Q A;  2HVS A;  2E7W A;  2OQR A;  1I50 J;  4I02 A;  2HYF A;  2QQ9 A;  3B6A A;  5AIQ A;  1PJR A;  2ZO4 A;  2DW4 A;  3EUH C;  2E1C A;  2HKO A;  1TP4 A;  1FNN A;  2E19 A;  2JVH A;  3IHU A;  4MNU A;  1E0E A;  2WC2 A;  2VOP A;  1YIO A;  1ZH5 A;  1T08 B;  1QO0 D;  3U2R A;  2ZFU A;  2IXS A;  2CQX A;  3ZMS A;  4BNC A;  1VQ7 I;  4IHY A;  1KQ0 A;  3SQN A;  4CCO A;  2MH9 A;  4YIR X;  1VQO I;  1S3J A;  1SMT A;  3LSK A;  3RZD J;  2DFI A;  4HDU A;  3GUD A;  2EWN A;  2F4M B;  3BR6 A;  3FM3 A;  1GV2 A;  2YSR A;  2DTR A;  3KP3 A;  2KQR A;  3JTH A;  2E1M B;  2VAS A;  3CES A;  4ZH4 F;  4XKC A;  1LQ1 A;  2JA7 J;  3BT9 A;  2OD5 A;  1FX7 A;  4HV6 A;  4KIT B;  2AQF A;  4BAC A;  4I01 A;  3WTZ A;  3S1N J;  5D6E A;  1IO2 A;  5CVV A;  3RTR A;  3ZQG A;  1X1C A;  4XNF A;  2EJR A;  1USS A;  5GP9 A;  5D4R A;  5FJ8 J;  2A5W A;  2CWE A;  2L2O A;  3SFZ A;  2WA0 A;  3VYR B;  4FTH A;  1U8R A;  4IHT A;  2PMH A;  1XDU A;  3FXL A;  3HOW J;  1GT0 C;  1NTC A;  3JRD A;  2X9D A;  2EFP A;  2FNA A;  3DPL C;  5F1J A;  5M3F J;  3HSE A;  4X1E A;  4ENK A;  3F3X A;  1JE8 A;  3W3C A;  2F4O B;  5HLH A;  2O3F A;  3L9F A;  5C4J J;  2KHM A;  3GW2 A;  3OMY A;  2QF7 A;  3EDP A;  5DS9 A;  2V9P A;  4FET A;  2BY3 A;  3VYS B;  5JHU A;  4LMY A;  2L3D A;  3GLX A;  3HIF A;  1SFE A;  5J4Y A;  5EG0 B;  3TQN A;  4EJU A;  5LD2 C;  4IF4 A;  1B9M A;  2JRT A;  4DIQ A;  3OSF A;  5AON A;  1S6L A;  1Z7L A;  2QSF X;  3I59 B;  5E3N A;  2HVR A;  4ZYA A;  3T1B A;  2DMU A;  3E1S A;  2L9S A;  2AO9 A;  3OWT A;  3SFI A;  2HTS A;  1X3W B;  5E79 C;  4A2U A;  1HDD C;  4XRF A;  1Y0N A;  3M1C A;  5JI6 A;  3RYP A;  1IV6 A;  3S17 J;  1Z67 A;  4RAG A;  3A4C A;  3LL7 A;  1MBG A;  1XDS A;  4EMS A;  1GLN A;  2KFD A;  3MKL A;  3FF5 A;  1VZ0 A;  2L01 A;  5KNL A;  2VUM J;  4PK4 A;  4RM3 A;  2LBF A;  2ZJP F;  3ZQL A;  1YW9 A;  1R58 A;  4IHV A;  1UAA A;  3H1C A;  2TDX A;  1ZRF A;  2D2W A;  3MZH A;  2DA1 A;  1J75 A;  3L7W A;  1EH8 A;  2QEN A;  4ESF A;  1ENH A;  2DOD A;  2R7F A;  1O3S A;  3OOU A;  1SFK A;  2EBI A;  2RAE A;  1LE8 A;  2ZKZ A;  5CYV A;  3ERM A;  3HOU J;  3H92 A;  4RAY A;  5C3E J;  2CQ7 A;  3KET A;  2XAQ A;  3GFJ A;  3QYE A;  1ZRE A;  5EDN A;  1JT0 A;  1KON A;  4MQ9 F;  5H6R A;  1ERD A;  3H3U A;  2VE9 A;  1B72 A;  2DOF A;  3CCM I;  4KT5 C;  4UB8 C;  4XLE A;  2WB1 A;  1NK2 P;  3CDI A;  3T8T A;  1V5F A;  4A69 C;  1JJ8 C;  4PZJ A;  3COA C;  1FZP B;  3NEU A;  4HNU A;  3VYT B;  4BL0 B;  5K5R A;  3WTW C;  2M9H A;  3OYB A;  1PVE A;  3PUB A;  1W7P D;  4RA2 A;  4DYC A;  2OV7 A;  1CF7 B;  3BG6 A;  3KP7 A;  1HLV A;  5HLG A;  1G8X A;  5IYD J;  3C7J A;  2QWW A;  2NOG A;  1EA3 A;  2JN6 A;  2P4W A;  1C0W A;  2ADU A;  2H8R A;  5J3L A;  2Y31 A;  1Z3X A;  3AG2 H;  3SZT A;  3T5X A;  5ERI A;  1TWH J;  2P6S A;  2L4A A;  1I39 A;  3C2B A;  1T95 A;  3ZQC A;  2E71 A;  2HQN A;  1DU6 A;  4CHU A;  2UZK A;  1X3U A;  4PJJ A;  4YIF A;  3ZRG A;  2TCT A;  4HX7 A;  4KN7 X;  3HOS A;  3DWL E;  4H4K C;  3WHB A;  2Q0O A;  3I58 A;  2CS3 A;  1WPK A;  3BPX A;  3ECH A;  3GTO J;  3AG3 H;  5IT9 Z;  2F5E A;  3G6E I;  2ELJ A;  2W84 A;  4WF2 A;  1XPX A;  5DCM B;  3J80 Z;  2LBF B;  4BKX A;  3LMM A;  5GAG J;  5TGT A;  5J8F A;  3WHC A;  3JRE A;  1R4N B;  4BEH A;  2DLL A;  4E6K G;  2ZJQ F;  3ABL H;  1D5Y A;  4L9V A;  5LFA A;  2HYJ A;  4ZZD A;  2LKX A;  4XR6 A;  3FMR A;  5H20 A;  1R5G A;  3L2U A;  4DOZ A;  4CCK A;  5B1A H;  4GDF A;  2IA1 A;  3AKZ A;  2K85 A;  2W85 A;  1LE8 B;  2UXN A;  4MFD A;  4U0W A;  2G9W A;  3OIQ A;  4EQQ A;  2GA2 A;  5K1Y A;  3WTU C;  1OCZ H;  1VND A;  1WI9 A;  2MW8 A;  3GFM A;  1R1V A;  3LSJ A;  5J8C A;  3MFK A;  3S2D J;  4ASN A;  2CMP A;  4X6A J;  1K6Y A;  1RIO H;  2DPU A;  4LLN A;  2E60 A;  1OPC A;  3BQY A;  1YO5 C;  1KU7 A;  1UCR A;  3C3W A;  3HRU A;  1ETK A;  1PYV A;  3H5N A;  4V2F A;  4DGW B;  1QPI A;  3OS1 A;  3CF2 A;  1N25 A;  4Y15 A;  3MD2 A;  4B1R A;  2CG4 A;  2X0L A;  3R4K A;  4BHB A;  4OWR B;  5E17 F;  2JT1 A;  4ESJ A;  3CP8 A;  4S0H B;  1YRN B;  1SD7 A;  2FJ1 A;  2XPW A;  4Q47 A;  2QLZ A;  1ETO A;  2VB6 A;  3A1Y A;  5BPD A;  1BW6 A;  3ULQ B;  1F36 A;  1R1T A;  3BQZ A;  3ZQF A;  1SVL A;  3PSF A;  3V8K A;  4EAT A;  3H3V K;  5J40 A;  4E7K A;  3PSI A;  2PX9 A;  1R4M B;  4KDP A;  1SAX A;  5KHD A;  3DTI A;  2FX0 A;  4L5I A;  5D5W B;  4FE7 A;  3K4C A;  4XOP A;  3AAF A;  1JKQ C;  1BL0 A;  3M7G A;  2A68 F;  1QGP A;  5F64 A;  2OC6 A;  2HQR A;  3HXL A;  4PJL A;  4C3H J;  4AVZ A;  1NHA A;  5C44 J;  2HOS A;  3E5X A;  2Z5U A;  1WJF A;  5JR3 A;  2GM4 A;  3MEX A;  4L5J A;  1B8I B;  4BU2 A;  4AD9 A;  1PP8 F;  1WKM A;  1U9N A;  2BBY A;  5L3G A;  2ME0 A;  3LQR A;  2B7E A;  4IJA A;  4RBO A;  3FHZ A;  2XUB A;  1TT0 A;  3PIP F;  2DMN A;  4BE0 A;  1TWC J;  5IP9 J;  3MN2 A;  3R6S A;  3JSO A;  2VBZ A;  4G8X A;  5ICG A;  4M71 A;  4CYC B;  1R5H A;  4PGH A;  4HX4 A;  1WSU A;  2DMP A;  4A3K J;  2BHY A;  1IGN A;  3ECO A;  4RGX A;  1TQI A;  1P4X A;  2KIM A;  4F91 B;  5DM6 F;  1XS9 A;  3DPU A;  3PO3 J;  4BH9 A;  1OCP A;  5D4S A;  1OCO H;  3ZQI A;  2XF6 A;  1OCR H;  2AQE A;  2X48 A;  4M3E A;  1KYW A;  2PQ8 A;  5FLX Z;  2M45 A;  4P5O A;  5J1Y A;  4U88 A;  1ETX A;  4IRH A;  3U1D A;  1QHG A;  3LSP A;  4IVN A;  3BJO A;  3ZN0 A;  4DZJ A;  2KIS A;  4E7J A;  2IGM A;  2GLO A;  1P4A A;  3VOD A;  4I98 B;  3QPL A;  3RPQ A;  2KT0 A;  1SD6 A;  4FE4 A;  4LG0 A;  1E3O C;  2DT7 B;  4B4C A;  5DD4 A;  3S16 J;  1OLT A;  5IOY A;  5HNH A;  1I5Z A;  2FBH A;  1ZGJ A;  1GV5 A;  3F8F A;  2FQ3 A;  4Z2Y A;  1HKQ A;  4Q5S F;  3HEF A;  1RKT A;  1ZTR A;  1FP2 A;  1I1G A;  1NH3 A;  2IPQ X;  4RS8 A;  1YW8 A;  1MH4 A;  4HEA 2;  1TW2 A;  2JPC A;  2W4S A;  4C2M J;  4HYE A;  2M87 A;  2NOJ B;  2E2H J;  4IHS A;  5JVG F;  5FKK A;  2R7Z J;  1H0M A;  3BP8 A;  3OYH A;  4F7Z A;  2RC4 A;  2R7S A;  5E20 A;  4HW0 A;  2MFZ A;  4IPA A;  3GTM J;  2EZH A;  4CGZ A;  2X6W A;  3R0A A;  2LRE A;  1XSV A;  3TDU C;  2VC0 A;  2VJI A;  3DTK A;  5BQT A;  4OMY A;  2FEZ A;  3FXR A;  3NWS A;  1BA5 A;  5E1Z B;  2M1B A;  1SMY F;  2J5O A;  2ZXH A;  1SFO J;  2QA4 I;  3ZMU A;  4UUV A;  5EEH A;  3PIO F;  2GAU A;  4GYI A;  1XMA A;  5K7Z A;  1YI2 I;  4FAS D;  1W0T A;  1KU9 A;  5F04 A;  1E3P A;  2AHQ A;  1O7F A;  1QBJ A;  2G0E A;  2DDA A;  1T39 A;  4XQF A;  2XPU A;  2YPR A;  2JSC A;  2EPF A;  5IYB J;  4R1H A;  3TED A;  1FBU A;  3GLL A;  1AA7 A;  3HSR A;  1X2N A;  1T38 A;  2Y9Z A;  2PG4 A;  3V7C A;  5K7H A;  2I5U A;  2IGO A;  4P55 A;  4HLY A;  2COM A;  2VPL A;  1VQ5 I;  2FOK A;  3OIO A;  3MZ8 A;  3K9T A;  1MBF A;  2NAZ A;  3E97 A;  1N78 A;  3TMO A;  1SAU A;  1YJN I;  2DQR A;  4E7L A;  3BDD A;  3O3K A;  1MJB A;  3KZZ A;  1X4O A;  2YS9 A;  3I54 A;  1M1E B;  2WBM A;  3LFU A;  3M8F A;  4ITV A;  5ED4 A;  4KIC A;  1D8K A;  4FHT A;  3VWB A;  1LEB A;  4LLG F;  2FRH A;  5J1U A;  4KMU X;  1DUX C;  5FKO A;  2V6C A;  2O8K A;  4LG0 B;  2KP6 A;  4CZZ A;  3HOY J;  1F9N A;  1G6N A;  2OF7 A;  1QPM A;  2HTJ A;  4LB5 A;  1AKH A;  4JK1 X;  1HC8 A;  2ISY A;  1D0Z A;  3LNQ A;  4P96 A;  2VOD A;  1U5T A;  5F0C A;  3HOV J;  1FBS A;  1KA8 A;  3E3V A;  4EJW A;  4PUS A;  5CJ9 A;  4U87 A;  2IA0 A;  1JXS A;  1AWC A;  3ROU A;  3TDZ C;  3WE3 A;  1SC7 A;  1R1U A;  4MTD A;  3TGN A;  3F8M A;  3CC2 I;  2C6Y A;  2NXN B;  3FXU A;  3QOP A;  1D1A A;  4IRI A;  4XLA A;  1IDZ A;  3J7Y J;  1H89 C;  4RB3 C;  3GTL J;  4O5V A;  3HC7 A;  3HSF A;  1DP3 A;  2NS8 A;  4M3B A;  2Z2S B;  3WG7 H;  1RR8 C;  1MJ9 A;  3F21 A;  2R93 J;  4B3A A;  2CJJ A;  1MDM A;  3OL3 A;  5DCF A;  1K4T A;  2VBY A;  2WTE A;  2L4M A;  4I76 A;  3H9J A;  2XSD C;  2W00 A;  1XD7 A;  2BHZ A;  4E7H A;  1VQM I;  3M8E A;  2MAB A;  4WXD A;  4WWC A;  1R9T J;  1QNT A;  3BJA A;  2LY2 A;  3DKW A;  2VIX A;  2R7U A;  1QQI A;  3Q9V A;  2EA2 A;  2XHK A;  1OMI A;  5B3S H;  2KIF A;  1OYY A;  2LTP A;  2HOE A;  3J7Z I;  3IC7 A;  1D5V A;  1WJB A;  2EZK A;  3KP6 A;  2Y30 A;  4NB5 A;  2CU7 A;  4BXF A;  1G59 A;  4KA4 A;  2PFB A;  2VKE A;  1FP1 D;  1Y8R B;  3IWZ A;  1ZGA A;  3MVP A;  4B8X A;  3Q0W A;  2YUS A;  3RZO J;  3BZK A;  2QSG X;  1NG7 A;  2L0K A;  3BR5 A;  1JKR C;  1MKM A;  4R8H A;  2MA3 A;  2VKH A;  2EFW A;  2FXA A;  2RGV A;  3KFW X;  3LOC A;  2LVS A;  5B5E C;  4EJV A;  2M7B A;  4D5F A;  2NNY A;  2BY2 A;  3N4M A;  1PUF B;  1IN6 A;  1Z05 A;  2X1E A;  3FIW A;  3C18 A;  3CTA A;  3P9K A;  2NVT J;  3F6V A;  3RI4 A;  3HB9 A;  3CUQ A;  5HDG A;  2O61 A;  2ZBK A;  4MO7 A;  3HPG A;  2EIM H;  3CJT B;  2CV2 A;  4LK0 F;  3LSG A;  3E6C C;  2BE5 F;  3FKI J;  2L7F P;  4L9T A;  1UST A;  4KT6 A;  1J09 A;  1IG7 A;  1TWA J;  2R7R A;  3RKY A;  1LJ9 A;  2RVC A;  4ZZL A;  3JTG A;  3RPU A;  2IGN A;  3CCY A;  3S3O A;  3DXJ F;  1IAW A;  3CCL I;  1R7J A;  2EIK H;  1YS7 A;  1QZY A;  1KQ9 A;  2XIG A;  2HZD A;  2IW5 A;  1W36 C;  2A6E F;  2QQ8 A;  2MLG A;  4BDZ A;  2R7X A;  4XLH A;  4BE2 A;  3TP3 A;  4EGY A;  1XMK A;  1W7P B;  4OAY A;  4ESB A;  1T56 A;  5DYM A;  3PQJ A;  2KDZ A;  2E35 A;  3LA2 A;  3S3M A;  2JVG A;  5EGO B;  4BDY A;  5F0F A;  5BNG A;  4RGS A;  2DXI A;  4IQ4 A;  2G7U A;  3CUQ C;  3S3N A;  1NK3 P;  3MMY B;  2OUM A;  1DGW Y;  3N05 A;  4MGR A;  1XC5 A;  2BY0 A;  5CQE A;  4DNC A;  2EH3 A;  2ZNY A;  2BV6 A;  1HQC A;  1U2W A;  1J2X A;  3LA3 A;  3TOA A;  4F55 A;  4MFE A;  1FIP A;  2P6T A;  5E3O A;  2LKS A;  5LRS A;  3NWT A;  1FSE A;  1ZLJ A;  1HST A;  5D5V B;  2FUG 2;  3RKW A;  1U0J A;  2ZXJ A;  3FXK A;  3ZQQ A;  1MSF C;  1HSJ A;  3GZN B;  4IOA F;  2JSP A;  1RET A;  1BIB A;  1P7J A;  2R7W A;  3HHG A;  2R7T A;  2K9S A;  2FA5 A;  1O3R A;  2KIU A;  1FMV A;  1W5S A;  4XKB A;  2KIQ A;  4A3D J;  3ZCO A;  1MNM C;  3HL2 A;  2V1D A;  1TL8 A;  3FWE A;  4A3C J;  2OA4 A;  4ZDO A;  3VDX A;  1Z6T A;  4WCG A;  3L2Q A;  3CUQ B;  1FYM A;  4E7S A;  1LVK A;  3HZJ A;  2P8T A;  1VFC A;  1HDP A;  3C1D A;  4PFO A;  1JUP A;  3WE2 A;  2PMU A;  2JA2 A;  1YE9 A;  2O5R A;  2VT2 A;  1OR7 A;  5F08 A;  2HYG D;  3G71 I;  4XOT A;  3KLN A;  1TZL A;  1V3F A;  2WY8 Q;  3D5S C;  2BXY A;  2R0Q C;  3BJ6 A;  2A69 F;  3MWM A;  4BHP A;  3O8G A;  5LEK A;  4D9J A;  1XMX A;  3M8J A;  1RUN A;  4E7Z A;  1GDT A;  2ID6 A;  2YU9 J;  4G7O F;  2MLK A;  1ZEL A;  1HW1 A;  3BR3 A;  4M6Y A;  1V55 H;  4EJO A;  5GTH C;  4XLN F;  3OYN A;  4JP0 A;  3DQV C;  5BS6 A;  3NRV A;  5L3E A;  1POG A;  3MKY B;  3S15 J;  3QPH A;  1JGG A;  2P0W A;  4BS9 A;  2A05 A;  1S9H A;  1Y8Q B;  2HVQ A;  2Y0M A;  1MBJ A;  3IP4 B;  3MQ0 A;  1J5Y A;  4L9J A;  4C3I J;  1YX3 A;  4NC8 A;  3E0J B;  4YEJ A;  1D1B A;  1DU0 A;  2UV1 A;  1IXS B;  1S7E A;  4KN4 X;  3CJQ B;  2CUF A;  3MAJ A;  3GTJ J;  4J01 A;  1SAN A;  1STZ A;  4S05 A;  1DGR M;  1K78 B;  2XKO A;  3OR2 C;  2H1L A;  1IUF A;  4AUX A;  3KIO A;  4UHT A;  2XAH A;  5ILS A;  3EPZ A;  5B66 C;  4Y7N J;  3NQO A;  4UVB A;  1ZG1 A;  4DJA A;  2CW7 A;  3ZR8 X;  3SXY A;  3OL4 A;  3I5U A;  2L54 A;  3MKW B;  4BHC A;  2ZC2 A;  1V4R A;  3IKT A;  2BW3 A;  3K4B A;  3HKZ N;  2QVO A;  4RDU A;  3K4M A;  1EH7 A;  2ETH A;  2B63 J;  2XRO A;  1KQ8 A;  4IOC F;  3OYF A;  2FMY A;  3A0B C;  1LDJ A;  4UY8 I;  1TBX A;  5HS7 A;  4NBQ A;  5FB2 A;  3JR9 A;  2R5Z A;  4JOM A;  1LFB A;  1ODD A;  2XAU A;  3AL0 C;  3KX2 A;  2W82 A;  3JAM K;  5JHF A;  2VKD A;  4K2E A;  3P7N A;  3SJM A;  4FIS A;  2VQL A;  2QM3 A;  1MBE A;  3K1M A;  2PMZ N;  4AYB N;  4F92 B;  4P1W A;  1MBK A;  2ELH A;  3HUG A;  1Z77 A;  3GX4 X;  2DFH A;  3X2Q H;  3IL2 A;  5BOX A;  3ZMZ A;  4BQO A;  4XLC A;  1JT6 A;  4OIR F;  4PJM A;  1H9T A;  1T33 A;  3OIP A;  3PJR A;  3OYG A;  1XB4 A;  4ZJZ A;  3VEP A;  2LC2 A;  1AU7 A;  3L09 A;  2HS5 A;  2AXL A;  3JRA A;  4XOR A;  1MMD A;  3I4M J;  4OAZ A;  2V1U A;  3QRF F;  4HOB A;  4I0B A;  2CW8 A;  3OYL A;  1G3T A;  1A6I A;  2WAF A;  2Q2E A;  2IVM A;  1SD4 A;  2O8X A;  2XDV A;  3IWF A;  3ZOB A;  2GIV A;  2V79 A;  3AL0 B;  3REO A;  4ZYH A;  1WFX A;  4UV9 A;  1K79 A;  2MSY A;  5A2Q K;  1YOV B;  4WXC A;  2VON A;  4GO1 A;  5M5X J;  4YII A;  4XLP F;  1IUY A;  1YQA A;  2K4J A;  2XAJ A;  3VYU B;  1LFU P;  4G12 A;  3PUF A;  5E18 F;  1VQ8 I;  2DTZ A;  2JA6 J;  2WAE A;  3RKQ A;  1G4D A;  1BJA A;  1ULY A;  2Q1Z B;  3AG1 H;  4HPQ A;  1K61 A;  3T0Y A;  3UNG C;  2E2J J;  2G7H A;  3OYI A;  3CO7 C;  5HVQ C;  4LK1 F;  1GHC A;  4C3J J;  4CH7 A;  1MW7 A;  4NHJ A;  4PGG A;  1W36 D;  3ZP5 A;  4A3G J;  3CUO A;  4JYK A;  5L3C A;  4UUT A;  2MD0 A;  2X1D A;  1G3S A;  4A6D A;  2X6O A;  3GVA A;  2V1X A;  4P9U A;  5HNF A;  5J47 A;  1A35 A;  2DJI A;  4IZZ A;  1MMA A;  4B3X A;  2KRH A;  4RGR A;  5E1X A;  3DLL F;  2VXZ A;  4Y4R A;  4ENN A;  4M72 A;  2VBW A;  2R5Z B;  2DYR H;  3I53 A;  2R5Y A;  2STT A;  2H94 A;  1NG6 A;  2ZSH B;  2P7V B;  3BLY A;  1X2M A;  5FRM A;  4B09 A;  2QSH X;  2BXZ A;  1S72 I;  3H35 A;  4HSR A;  2LFB A;  1ORK A;  3B6C A;  4AIH A;  2MG4 A;  3CCR I;  1L3L A;  3L00 A;  1FC3 A;  3BTC A;  3S1Q J;  2M2E A;  3MCZ A;  2EIN H;  2DQL A;  3CMA I;  1B72 B;  5HLT A;  2COB A;  2F5C A;  4EGZ A;  1FIA A;  2H1K A;  2TRT A;  3RPU D;  2BGC A;  2X51 A;  1MH3 A;  2VXD A;  3SDB A;  2IS4 A;  2OBP A;  2DMQ A;  1FPQ A;  3GFI A;  4M74 A;  2E2I J;  4UV8 A;  1UEL B;  4HZF A;  2JK3 A;  2LOO A;  2XC7 A;  2DN0 A;  2VBX A;  3LWF A;  2VPR A;  3LAJ A;  3CC7 I;  4BUP A;  2DMT A;  1T6S A;  3HJE A;  1MND A;  2WV1 A;  5AIP A;  4HV5 A;  3ZQ7 A;  1I27 A;  1H88 C;  2D1H A;  4PJ0 C;  4UXN A;  3K0L A;  3S8P A;  1YYV A;  3LAP A;  1FEX A;  4BQA A;  3D0S A;  4LIT A;  5D8K B;  3WTS C;  3ABU A;  1DPR A;  4HST A;  3J81 Z;  2HOA A;  1OYI A;  4O6J A;  4EM1 A;  2H6C A;  4YFN F;  5HDN A;  1D1C A;  1XSX A;  3W2W A;  3GFL A;  1XCV A;  4IO9 F;  2K27 A;  2CH0 A;  4UUS A;  3JSP A;  4RM2 A;  4RAF A;  2OAZ A;  1B59 A;  4PSX A;  3LA7 A;  1WZ2 A;  2GWR A;  3SEZ A;  2Y48 A;  2PJR A;  1FWZ A;  4A3M J;  4ZC3 A;  2IJL A;  4CUG A;  3VPR A;  1Y56 A;  4E70 A;  4AIK A;  1YJ9 I;  1JI8 A;  5IP7 J;  1TLH B;  3KZY A;  2JA8 J;  2LNB A;  1A5J A;  4HLX A;  4IEJ A;  4HAM A;  5D5U B;  1RNL A;  3FMQ A;  3H5A A;  1BBY A;  5GAD J;  4GRI A;  3PQK A;  3OYM A;  1MGT A;  1W4M A;  3OSG A;  4BEH B;  2VKV A;  5TIS C;  1JUS A;  2KRC A;  1BOA A;  2ME6 A;  4AID A;  4F3Q A;  4JX6 A;  4Q4Z F;  3UKG A;  3JRH A;  2XGC A;  4I2O A;  4BQN A;  5BPI A;  5IOZ A;  1RZ4 A;  1BW5 A;  3K7A J;  3RQ4 A;  3FBI B;  4L0Y B;  3DEE A;  3OY9 A;  2DYS H;  3KYC B;  1F1Z A;  3OOP A;  3OR1 C;  2FE3 A;  2V1N A;  3BTJ A;  3WG9 A;  2R7V A;  4XSX F;  4YRV A;  3JCU C;  4YEL A;  1W1W E;  5E1W A;  5D6F A;  3WGG A;  3ZPL A;  1A6Q A;  3GO5 A;  4P9F A;  4ZYG A;  2CSO A;  1XX5 A;  2GA1 A;  3S1R J;  1HOM A;  1J0R A;  4IQJ A;  1REP C;  4PCQ A;  5ICF A;  4JX4 A;  2PN6 A;  2IT0 A;  4M6X A;  2F4I A;  2WY7 Q;  4V2G A;  1H8A C;  2D45 A;  5C4X J;  5IPA A;  2P5L C;  1OIS A;  5HS8 A;  4AC0 A;  2RRE A;  1JUM A;  3QPS A;  3OS0 A;  4CIC A;  2IA2 A;  2E5Z A;  1Z3Y A;  5CVJ A;  2QBY A;  4CDG A;  3QWL A;  5IT3 A;  3S1M J;  4I0A A;  1BI1 A;  2XVC A;  4EVI A;  3K6G A;  5E3L A;  1AHD P;  1R5I D;  2KLO A;  3A2K A;  4UUS B;  3WGI A;  1FY7 A;  2DK5 A;  1LFP A;  3ESW B;  4U0V A;  4WX9 A;  2Z99 A;  2WAQ A;  3WOD F;  1WJC A;  1W0U A;  2CQQ A;  4ANJ A;  2GOM A;  1A31 A;  1Y39 A;  2XB0 X;  1ACI A;  4GYG A;  2CQN A;  5J6X A;  3FDY A;  3ML6 A;  3HBL A;  1YG2 A;  1X19 A;  2HWV A;  2KMU A;  2EV0 A;  3F72 A;  5KK1 A;  3KEO A;  1I3Q J;  1SVM A;  4G7H F;  5H2F C;  1KYZ A;  4HF0 A;  3SZG A;  3CZ6 A;  3CQZ J;  3EQL F;  1QZZ A;  3L1P A;  4U0Y A;  4XK4 A;  3LST A;  4LOC A;  1IZ1 A;  3CDL A;  2CFX A;  3ELK A;  3W2V A;  2ZB9 A;  3F8N A;  2GQQ A;  3M9A A;  2IEK A;  2FD5 A;  1RES A;  5LLQ A;  4GCV A;  2IS2 A;  2KZG A;  1Z1D A;  2MBF A;  2HDC A;  2PJP A;  2P7C B;  4IRG A;  1I1S A;  2M4G A;  1EKE A;  4CCJ A;  2E34 A;  2EZL A;  3HGY A;  4PSW A;  2DCE A;  2ELK A;  3BRO A;  1ZQ3 P;  5E8G A;  4ZTJ A;  1FLI A;  4KYW A;  2JUG A;  1YTY A;  1P7I A;  5DTD A;  5GTI C;  5J1R A;  3FBN B;  1VQ9 I;  2MYS A;  3HRT A;  3WU0 A;  3G2B A;  2Q8K A;  4DBR A;  4XRS G;  1YHQ I;  2K3P A;  2RKH A;  1FJL A;  1A04 A;  1SFX A;  2R3S A;  2F5V A;  3CMM A;  4HNT A;  3CCV I;  1UHM A;  2A3S A;  4OMZ A;  4RGU A;  1RPW A;  4U7B A;  2FNP A;  2H6B A;  1KGS A;  3CME I;  3DU6 A;  4G7Z F;  1LDD A;  2DOE A;  5FLV A;  2BOL A;  4EM2 A;  4BYY A;  3A01 A;  1LUJ B;  3O2P E;  5H6Q A;  2M0M A;  2FQ4 A;  1VQ4 I;  1T8I A;  2QKL B;  2RQP A;  3V4G A;  1TWG J;  2HXI A;  4CCL A;  3G1M A;  1BI3 A;  2Z16 A;  1TTY A;  5E8I A;  3OYD A;  4RAZ A;  3DTE A;  4I09 A;  3BZ6 A;  4DZP A;  5IP6 A;  3ABT A;  1TW3 A;  3A02 A;  3H36 A;  2VQH A;  4D7N A;  4LJZ F;  4O3M A;  3JW4 A;  3FXJ A;  3OYE A;  1WJ5 A;  3I71 A;  4DBQ A;  2W24 A;  1UHS A;  4L9N A;  3W6J B;  1S7A A;  4NQW A;  2CRG A;  2L9N A;  1HCR A;  2M3A A;  2NS0 A;  2CW0 F;  2L7Z A;  2KL4 A;  2V26 A;  3GWZ A;  3AFH A;  2EIL H;  2ZSI B;  4NC7 A;  3A0H C;  1OQY A;  1U3E M;  1ETQ A;  1ON1 A;  5EJC A;  2GXA A;  1AOY A;  3QQA A;  2QZ8 A;  3EYI A;  3CMY A;  4WK8 F;  3LSR A;  2CGP A;  5IT9 K;  5BMZ A;  2ZCW A;  5CQG A;  4LIV A;  2IBD A;  3D5R C;  4LD5 A;  5HS9 A;  2M7A A;  4QLC U;  5K7F A;  3WTT C;  4RB0 A;  2V9V A;  1U5T C;  3VSL A;  3V42 A;  2PI0 A;  3J80 K;  2HKX A;  3RDI A;  2XF5 A;  1T0F A;  2DT6 A;  4EEF G;  2M0C A;  3M07 A;  3HOX J;  3GCM A;  2FU4 A;  1IN4 A;  3G73 A;  3I56 I;  2D1V A;  1GVJ A;  3FM5 A;  3PNV A;  2LH9 A;  1VQ6 I;  2RN7 A;  2FOW A;  1S29 A;  4A3J J;  1EJ9 A;  1IRZ A;  1GXQ A;  3G1L A;  2HFH A;  3FHN A;  3V7S A;  3RQI A;  4G6D A;  3VFZ A;  3F23 A;  4J19 A;  3K69 A;  1BN5 A;  2BEO A;  2JMW A;  4A0Y A;  2L7K A;  1K4S A;  1IRG A;  4LB6 B;  1AKH B;  2UUZ A;  2O6G E;  3V8J A;  4NNJ A;  1ETV A;  3ASO H;  1TNS A;  4XN0 A;  3BR1 A;  2VQG A;  2ZJR F;  1U5T B;  2ZXW H;  4BE1 A;  2QUF A;  4UNO A;  1DDN A;  1UG2 A;  3U21 A;  4KNY A;  1T0F C;  1UB9 A;  3EUK L;  3K1N A;  1HKT A;  2QGU A;  4H0E A;  4HRI A;  1XG1 A;  5GAE J;  1JGS A;  1SEU A;  1DQU A;  1IN8 A;  4JBA A;  1MJA A;  1I3A A;  3JRG A;  2BY1 A;  3HKZ A;  2DJN A;  4B47 A;  1FTT A;  1LB2 A;  4II2 A;  2GIZ A;  2VJJ A;  1OCT C;  1E17 A;  2XGX A;  2JTV A;  2V9K A;  3FKJ A;  3CD6 I;  3RCO A;  1MMS A;  1MDM B;  4C2T A;  4OIN F;  3BOQ A;  4BY7 J;  2Y2Z A;  3G1O A;  2JZY A;  2HR3 A;  2ZFW A;  3D1N I;  1MMG A;  3K4K A;  1JKP C;  2HDW A;  1HA8 A;  2BVL A;  5TJJ A;  2DBB A;  3HTS B;  3CCS I;  1ZRC A;  4BBR J;  1SFU A;  3EUH A;  1FMW A;  4QPO A;  2PMZ A;  2O03 A;  2JA5 J;  3BG3 A;  5LHI A;  1KZH A;  1S5L C;  2VQC A;  4QSH A;  1LVA A;  1WHU A;  5FRN A;  5TRD A;  4KIB A;  2P81 A;  3HGG A;  1LKX A;  1YIJ I;  2B0L A;  4XRS A;  2L7M P;  3WTX C;  4ZYE A;  2AS5 F;  3LFK A;  1MSE C;  3PL8 A;  5EZG A;  3W2A A;  3ZMV A;  1P9Q C;  2QEX I;  4W97 A;  1OCC H;  1XSD A;  3S2H J;  3RJP A;  2HNH A;  3FX3 A;  5EG0 A;  3IUO A;  1SVO A;  1BR1 A;  2K40 A;  3IAM 2;  4MTE A;  1XGM A;  4Y13 A;  2F48 A;  2P5V A;  2LSO A;  2CUZ A;  4CSW A;  2DT5 A;  3I59 A;  3K70 C;  1EV7 A;  3QAH A;  4J00 A;  4HF2 A;  2MH2 A;  2VL8 A;  2DA3 A;  2DFF A;  3CF5 F;  4JX5 A;  3NAR A;  4AU7 A;  2ECC A;  2QQA A;  2XRL A;  2DPD A;  1MZB A;  2LG4 A;  5DV5 A;  5DEQ A;  4YFX F;  5FLX K;  3KLO A;  5FRO A;  3GEZ A;  4DW6 A;  1TWF J;  1IW7 F;  3HRS A;  5FO5 A;  3KP2 A;  3QU6 A;  4HX8 A;  1BC7 C;  3HHH A;  2IP2 A;  1HF0 A;  1O57 A;  4LG3 A;  3BC8 A;  1VI0 A;  2LDU A;  1WJA A;  2EB7 A;  3V8L A;  4A12 A;  2L9R A;  4QTR A;  1A36 A;  3GBG A;  4KMF A;  1QZE A;  1P2F A;  5B1B H;  5JLX A;  3DBL B;  1XGN A;  3DPT A;  3K4J A;  5CVU A;  1OJL A;  5FD6 A;  3HYI A;  4M73 A;  5F0H A;  4GFB A;  3WU2 C;  4UB6 C;  2VJ5 A;  2Y0S N;  4A0Z A;  1JTX A;  5IYC J;  2LR8 A;  2HQA A;  3H0D A;  3CJN A;  3S32 A;  5LEJ A;  2OTJ I;  2DOA A;  2EFN A;  4MLO A;  2HU9 A;  2R4G A;  5ILV A;  4IKF A;  2K86 A;  3HPH A;  1X1P A;  3TL4 X;  3QPT A;  1UZC A;  4M3F A;  3T8R A;  1OR7 C;  2JRM A;  4BJ5 C;  1IRF A;  1R23 A;  1YX5 A;  2ICW G;  2YX7 A;  1ZR2 A;  2Z33 A;  4L0Z B;  4BGD A;  1DP7 P;  3RIR A;  3M3Y J;  1P92 A;  1JHH A;  4TV7 A;  2F5D A;  2X1C A;  1IC8 A;  1Y1W J;  3CLQ A;  3KPH A;  2WWY A;  1ONV A;  2E1O A;  2KRF A;  1UG0 A;  1BC8 C;  5L3F A;  4A93 J;  2VT3 A;  1CF7 A;  1IV8 A;  4XL9 A;  2KZV A;  1WCM J;  3CCJ I;  5CLS A;  2ESH A;  1VF9 A;  1ZAO A;  3K2Z A;  1Y6I A;  3EYY A;  3KYD B;  5ILU A;  2CV1 A;  4YG2 F;  5FFX A;  4A3F J;  1ZKG A;  4DYQ A;  3FXQ A;  1TQM A;  4XLF A;  3JRF A;  3M4O J;  1XGS A;  1R36 A;  3CJR B;  5M3M J;  3DFG A;  5EEA A;  3GTQ J;  2HDD A;  2XRN A;  4N4O B;  3EET A;  3G3Z A;  1JJ6 C;  2XB5 A;  3ABK H;  2KJC A;  4X0G A;  2GOX B;  1D3Y A;  3HG9 A;  2WV0 A;  4N4N B;  4C30 A;  1V54 H;  2EFO A;  1G3Y A;  3DF8 A;  2BYV E;  3QYF A;  4BXX J;  3KP4 A;  4FQG A;  4PDK A;  3PO2 J;  1ZG3 A;  3CP2 A;  5HDK A;  2HXO A;  2K02 A;  1YFH A;  3HTU A;  3WTV C;  1O4X A;  5DCM A;  2IS1 A;  3DBH B;  1O7L A;  3KP5 A;  1HKS A;  2W25 A;  1VQK I;  3E6M A;  3I9V 2;  5JLW A;  1XGO A;  5LGT A;  3L2C A;  3DCF A;  3M1E A;  4G6Q A;  1GVD A;  2A6H F;  2M8G X;  3S2W A;  2E7X A;  4ON0 A;  5LGU A;  2LK2 A;  2K7L A;  3I3L A;  1I6X A;  3GTG J;  3BWG A;  1FYL A;  3RSN A;  2OTL I;  4ENM A;  1RC9 A;  3BR2 A;  1FOY A;  1H9G A;  2NRA C;  2D5V A;  1V5E A;  1WI3 A;  4FX0 A;  1UMQ A;  3HDD A;  2KKO A;  2F6C A;  1E3H A;  2M34 A;  4AVP A;  4Y3O A;  3NAU A;  4V19 K;  2VN2 A;  2JUC A;  1D0Y A;  1D8J A;  4I99 C;  3H3Z A;  4HF1 A;  3F22 A;  1HBX G;  2NVQ J;  3Q9S A;  2GZW A;  4E4H A;  1SD5 A;  3PNT A;  3BY6 A;  4OU0 A;  1RR7 A;  3VOE A;  2STW A;  4IHX A;  4L18 B;  3DEW A;  2R7D A;  2GXB A;  1YIT I;  1G2H A;  2KDO A;  3S93 A;  2ZNZ A;  4DQ2 A;  4NC6 A;  3DKX A;  4F52 A;  2RV8 A;  4ABZ A;  1ITY A;  2Z1D A;  1FBQ A;  1U9O A;  2EV6 A;  4GGG A;  2BZT A;  1YRN A;  5IY5 H;  2A5Y B;  1ZK8 A;  2O7O A;  6PAX A;  4D1Q A;  1ON2 A;  2X6Y A;  4M9X A;  1WGX A;  2BW3 B;  5KAF C;  1ZRD A;  4G9Y A;  3KEY A;  2QQB A;  4HDV A;  3JRC A;  1X4P A;  4KUM A;  4S04 A;  5L3D A;  3O6B B;  3DEU A;  4OOI A;  4M9S A;  5E3M A;  1Z6R A;  4FCY A;  2CQK A;  5FLM J;  1F5T A;  1JTY A;  2EZI A;  2XGE A;  1XCB A;  4QWQ A;  4HQM A;  1T98 A; 
#chains in the Genus database with same CATH homology
 3FMS A;  1IN7 A;  3ZMD A;  4LFU A;  3HRM A;  2HGC A;  3CDH A;  5K5O A;  1GXP A;  3MZY A;  4CO8 A;  4FT8 A;  2Y75 A;  1BI0 A;  1ZG5 A;  1J7K A;  3V7R A;  1BIA A;  4AWX B;  4A5M A;  3E5Q A;  4CYD A;  2CO5 A;  4G94 A;  1FSH A;  4BXU A;  3LQQ A;  3F8C A;  5HLI A;  3TOB A;  5D5X B;  4Y17 A;  3GYH X;  2FML A;  1Z91 A;  3IRQ A;  2JPB A;  5F6F A;  4EV0 A;  4KIF A;  4A5N A;  4FX4 A;  2ACJ A;  3CO6 C;  3RYR A;  4D0P A;  4N0B A;  2UXX A;  2Z9O A;  4U7D A;  4I7H A;  1U78 A;  3HOT A;  1R22 A;  1TQP A;  1LNW A;  3IKV A;  1OYW A;  4RB1 A;  3IRR A;  3P9C A;  2GXG A;  1HXD A;  2M8E A;  1B6A A;  3P9I A;  2F2E A;  5DUK A;  3CLO A;  1PP7 U;  2LF7 A;  4XBF A;  5JVT A;  1XN7 A;  2KJB A;  4BAY A;  2ISZ A;  2LF8 A;  1W5T A;  2X4H A;  5EEG A;  4ETS A;  1WWX A;  1BI2 A;  4MHG A;  3B73 A;  2DI3 A;  2F5F A;  3W6K B;  5K5Q A;  4HQE A;  4N9I A;  1IXR C;  2FSW A;  1FOK A;  2M30 A;  1G3W A;  1B1B A;  4IXA A;  2OZ6 A;  2FF4 A;  1ZYR F;  2Z3Y A;  5JFR A;  1RUO A;  4HBL A;  4UVA A;  3ISP A;  1DPU A;  2IRF G;  5LGN A;  2H09 A;  4A6E A;  2DU9 A;  2XAG A;  3GXO A;  2DO7 A;  2LKP A;  5LHH A;  5HOO A;  2E1N A;  3PFI A;  4WXH A;  3DV8 A;  1LEA A;  2PEX A;  3E5U A;  1P6R A;  1PUE E;  2J5P A;  1LDK B;  5FD5 A;  2FBI A;  3RKX A;  1ZAR A;  4A0X A;  3R61 A;  3ERE D;  1YS6 A;  4UVC A;  3J7A O;  4XSZ F;  4ENJ A;  1B9N A;  5LHG A;  4MQV A;  1P4W A;  4MEX F;  3SZP A;  3I0T A;  3TKY A;  1ZHF A;  1T2K A;  1Z9C A;  3GZ6 A;  2XAS A;  2NYX A;  1KU2 A;  3KE2 A;  2NNN A;  1Q1H A;  2O0Y A;  1B4A A;  4RB2 C;  5ICE A;  2RNJ A;  1FYK A;  2M5W A;  2DK8 A;  1PDN C;  4CXF A;  2OU2 A;  3K1P A;  2RDP A;  1WRJ A;  2XV4 S;  1TNT A;  3I64 A;  5KVR A;  4R79 A;  2YU3 A;  3VB2 A;  1Z7U A;  1YLF A;  4GXO A;  2QBY B;  3E6D A;  3TO6 A;  3JAM Z;  5DDG A;  1JHF A;  3F6O A;  1VTN C;  3R0J A;  3BPV A;  5DD8 A;  4YFK F;  3SHF A;  3ZMT A;  1F4K A;  4JQF A;  2CYY A;  3QU3 A;  1ZN2 A;  4EM0 B;  1IF1 A;  3WU1 B;  2YR2 A;  3F8B A;  5F1R A;  5LBQ A;  3D5L A;  2ESN A;  1W7P A;  4OIO F;  1O3T A;  5FFZ A;  5A2Q Z;  3ZN1 A;  2XAF A;  2H27 A;  2ZME A;  4EJT A;  2QYO A;  4AIJ A;  5CVR A;  2MC3 A;  5D8L B;  1U6G A;  1MD0 A;  3GF2 A;  3N97 A;  3Q5F A;  1ZLK A;  4HA8 A;  2EV5 A;  1S7O A;  4KFC A;  3FZV A;  4M9Z A;  3OV8 A;  1HW5 A;  3GZ5 A;  1IXC A;  2XKP A;  2EFQ A;  2W57 A;  2VC1 A;  3QP6 A;  2UWM A;  5L3B A;  2A61 A;  3WTY C;  4OIP F;  2VOO A;  2MD5 A;  2HZT A;  1HW2 A;  4KIG A;  1J9I A;  1CGP A;  5LRR A;  3U9G A;  1R00 A;  4N9H A;  1OKR A;  1E2X A;  1K6O A;  1BM9 A;  1KU3 A;  4Q48 A;  1YW7 A;  4LLL A;  5CVI A;  1K7A A;  2A07 F;  3J81 K;  2EA4 A;  2HEO A;  1EH6 A;  2PBI A;  3TO9 A;  3B02 A;  4MEY F;  2EK5 A;  2P5K A;  3DP7 A;  1Y0U A;  4LGW A;  1J59 A;  4OIQ F;  2VE8 A;  5DUI A;  2ZJ2 A;  2L02 A;  2ZME B;  2DAO A;  3I4P A;  1FT9 A;  3KCC A;  1L0O C;  2OZU A;  1IN5 A;  3E6B A;  3KEQ A;  1WQ2 A;  4ZYD A;  5FGM A;  1S8N A;  1UHW A;  3R60 A;  3TO7 A;  2OQG A;  1UFM A;  2YX4 A;  5ICC A;  1K78 A;  2PLY A;  3WGH A;  1RI7 A;  2K4B A;  2FBK A;  3QP5 A;  1O3Q A;  2E7W A;  2OQR A;  4I02 A;  2HYF A;  2QQ9 A;  5AIQ A;  2ZO4 A;  2DW4 A;  2E1C A;  2HKO A;  1FNN A;  3IHU A;  4MNU A;  2WC2 A;  2VOP A;  1YIO A;  1ZH5 A;  3U2R A;  1QO0 D;  4BNC A;  3ZMS A;  1KQ0 A;  3SQN A;  2MH9 A;  1S3J A;  1SMT A;  2DFI A;  4HDU A;  3GUD A;  2EWN A;  3FM3 A;  2YSR A;  2DTR A;  3KP3 A;  3JTH A;  4ZH4 F;  1LQ1 A;  2OD5 A;  1FX7 A;  4HV6 A;  4I01 A;  3WTZ A;  5D6E A;  5CVV A;  3RTR A;  2EJR A;  1USS A;  5D4R A;  2CWE A;  3SFZ A;  1U8R A;  4IHT A;  2PMH A;  1XDU A;  2EFP A;  2FNA A;  3DPL C;  3HSE A;  4ENK A;  3F3X A;  1JE8 A;  5HLH A;  2O3F A;  3L9F A;  3GW2 A;  3EDP A;  3FHZ A;  5JHU A;  4LMY A;  2L3D A;  3GLX A;  3HIF A;  1SFE A;  3TQN A;  4EJU A;  4IF4 A;  1B9M A;  2JRT A;  5AON A;  1S6L A;  3I59 B;  3T1B A;  2HTS A;  4A2U A;  4XRF A;  5JI6 A;  3RYP A;  1XDS A;  4EMS A;  3FF5 A;  2L01 A;  1YW9 A;  1R58 A;  2TDX A;  1ZRF A;  2D2W A;  3MZH A;  1J75 A;  3L7W A;  1EH8 A;  2QEN A;  4ESF A;  2R7F A;  1O3S A;  2ZKZ A;  5CYV A;  3H92 A;  4RAY A;  3KET A;  2XAQ A;  3GFJ A;  1ZRE A;  4MQ9 F;  5H6R A;  3H3U A;  2VE9 A;  4KT5 C;  3T8T A;  4PZJ A;  3COA C;  1FZP B;  3NEU A;  5K5R A;  3WTW C;  1W7P D;  1CF7 B;  3KP7 A;  5HLG A;  3C7J A;  2QWW A;  2P4W A;  1C0W A;  2ADU A;  3SZT A;  3T5X A;  5ERI A;  2P6S A;  2L4A A;  2HQN A;  4CHU A;  2UZK A;  1X3U A;  4YIF A;  4HX7 A;  4KN7 X;  3HOS A;  2Q0O A;  3I58 A;  3BPX A;  3ECH A;  5IT9 Z;  2F5E A;  2W84 A;  4WF2 A;  5DCM B;  3J80 Z;  5J8F A;  2DLL A;  4L9V A;  4ZZD A;  3FMR A;  5H20 A;  1R5G A;  2IA1 A;  2W85 A;  2UXN A;  4U0W A;  4EQQ A;  2G9W A;  2GA2 A;  5K1Y A;  3WTU C;  1WI9 A;  3GFM A;  1R1V A;  5J8C A;  3MFK A;  4ASN A;  1RIO H;  2DPU A;  4LLN A;  1OPC A;  1YO5 C;  1KU7 A;  1UCR A;  3C3W A;  3HRU A;  4Y15 A;  2CG4 A;  2X0L A;  3R4K A;  4BHB A;  5E17 F;  2JT1 A;  4ESJ A;  1SD7 A;  4Q47 A;  2QLZ A;  5BPD A;  3ULQ B;  1R1T A;  3V8K A;  4KDP A;  1SAX A;  4L5I A;  5D5W B;  3AAF A;  3M7G A;  2A68 F;  1QGP A;  5F64 A;  2HQR A;  1NHA A;  3E5X A;  2Z5U A;  5JR3 A;  3MEX A;  4L5J A;  4AD9 A;  1PP8 F;  1WKM A;  2BBY A;  5L3G A;  3LQR A;  4IJA A;  2XUB A;  3JSO A;  3R6S A;  2VBZ A;  4G8X A;  5ICG A;  4M71 A;  1R5H A;  4PGH A;  4HX4 A;  1WSU A;  3ECO A;  4RGX A;  1TQI A;  1P4X A;  2KIM A;  4BH9 A;  5D4S A;  5FLX Z;  1KYW A;  2PQ8 A;  2M45 A;  4P5O A;  4U88 A;  4IRH A;  3U1D A;  4IVN A;  3BJO A;  3ZN0 A;  1P4A A;  3VOD A;  4I98 B;  3RPQ A;  1SD6 A;  4LG0 A;  5DD4 A;  1I5Z A;  2FBH A;  1ZGJ A;  3F8F A;  2FQ3 A;  4Z2Y A;  1HKQ A;  4Q5S F;  1FP2 A;  1I1G A;  2IPQ X;  4RS8 A;  1YW8 A;  1TW2 A;  2JPC A;  4HYE A;  2M87 A;  4IHS A;  1H0M A;  3BP8 A;  4F7Z A;  2RC4 A;  5E20 A;  4HW0 A;  4IPA A;  4CGZ A;  3R0A A;  1XSV A;  3TDU C;  2VC0 A;  5BQT A;  4OMY A;  2FEZ A;  3FXR A;  5E1Z B;  2M1B A;  1SMY F;  2J5O A;  3ZMU A;  4UUV A;  5EEH A;  2GAU A;  4GYI A;  1XMA A;  1KU9 A;  1QBJ A;  1O7F A;  1T39 A;  2YPR A;  2JSC A;  4R1H A;  1FBU A;  3HSR A;  1T38 A;  2PG4 A;  3V7C A;  4P55 A;  4HLY A;  2COM A;  2FOK A;  3K9T A;  2NAZ A;  3E97 A;  2DQR A;  3BDD A;  3O3K A;  1MJB A;  3KZZ A;  3I54 A;  3M8F A;  5ED4 A;  4KIC A;  1D8K A;  4FHT A;  1LEB A;  4LLG F;  2FRH A;  4KMU X;  1DUX C;  2V6C A;  4LG0 B;  4CZZ A;  1F9N A;  1G6N A;  1QPM A;  2HTJ A;  4LB5 A;  4JK1 X;  2ISY A;  4P96 A;  2VOD A;  1U5T A;  1FBS A;  1KA8 A;  3E3V A;  4EJW A;  5CJ9 A;  2IA0 A;  1JXS A;  1AWC A;  3ROU A;  3TDZ C;  3WE3 A;  1R1U A;  4MTD A;  3TGN A;  3F8M A;  2C6Y A;  3FXU A;  3QOP A;  4IRI A;  4RB3 C;  4O5V A;  3HSF A;  1MJ9 A;  3F21 A;  1MDM A;  5DCF A;  2VBY A;  2WTE A;  2L4M A;  1XD7 A;  3M8E A;  4WXD A;  4WWC A;  1QNT A;  3BJA A;  3DKW A;  1QQI A;  3Q9V A;  2EA2 A;  2XHK A;  1OMI A;  2KIF A;  1OYY A;  1D5V A;  2HOE A;  3IC7 A;  3KP6 A;  4NB5 A;  4KA4 A;  2PFB A;  3IWZ A;  1FP1 D;  1ZGA A;  4B8X A;  1MKM A;  4R8H A;  2MA3 A;  2EFW A;  2FXA A;  2RGV A;  3KFW X;  4EJV A;  2NNY A;  3N4M A;  1IN6 A;  1Z05 A;  3C18 A;  3CTA A;  3P9K A;  3F6V A;  3RI4 A;  3CUQ A;  5HDG A;  2O61 A;  2ZBK A;  4LK0 F;  3E6C C;  2BE5 F;  4L9T A;  1UST A;  3RKY A;  1LJ9 A;  2RVC A;  4ZZL A;  3JTG A;  3RPU A;  3DXJ F;  1IAW A;  1R7J A;  1YS7 A;  1QZY A;  1KQ9 A;  2XIG A;  2IW5 A;  2A6E F;  2MLG A;  4EGY A;  1XMK A;  1W7P B;  4ESB A;  5DYM A;  3PQJ A;  3LA2 A;  4RGS A;  2G7U A;  3CUQ C;  4DNC A;  4MGR A;  2ZNY A;  2BV6 A;  1HQC A;  1U2W A;  1J2X A;  3LA3 A;  3TOA A;  2P6T A;  5LRS A;  1FSE A;  1ZLJ A;  1HST A;  5D5V B;  3RKW A;  2ZXJ A;  1HSJ A;  1BIB A;  3HHG A;  2FA5 A;  1O3R A;  2KIU A;  1W5S A;  2V1D A;  3FWE A;  2OA4 A;  1Z6T A;  4WCG A;  3CUQ B;  1FYM A;  2P8T A;  3C1D A;  3WE2 A;  2PMU A;  2VT2 A;  1OR7 A;  2HYG D;  3KLN A;  1V3F A;  3BJ6 A;  2A69 F;  3MWM A;  4BHP A;  5LEK A;  1RUN A;  4G7O F;  2MLK A;  1HW1 A;  4M6Y A;  4EJO A;  4XLN F;  3DQV C;  5BS6 A;  3NRV A;  5L3E A;  3QPH A;  2Y0M A;  3MQ0 A;  1J5Y A;  4L9J A;  1IXS B;  4KN4 X;  3MAJ A;  1STZ A;  4S05 A;  1K78 B;  2XKO A;  4UHT A;  2XAH A;  5ILS A;  3NQO A;  4UVB A;  1ZG1 A;  3SXY A;  3I5U A;  2L54 A;  4BHC A;  1V4R A;  3IKT A;  2QVO A;  1EH7 A;  2ETH A;  2XRO A;  1KQ8 A;  2FMY A;  1LDJ A;  1TBX A;  5HS7 A;  5FB2 A;  1ODD A;  3JAM K;  4K2E A;  3P7N A;  2QM3 A;  3K1M A;  2ELH A;  3HUG A;  3GX4 X;  5BOX A;  3IL2 A;  3ZMZ A;  4OIR F;  1H9T A;  1XB4 A;  3VEP A;  3L09 A;  2HS5 A;  2AXL A;  2V1U A;  3QRF F;  4HOB A;  4I0B A;  1G3T A;  2Q2E A;  2IVM A;  1SD4 A;  2O8X A;  3IWF A;  2GIV A;  2V79 A;  3REO A;  4ZYH A;  4UV9 A;  1K79 A;  5A2Q K;  4WXC A;  2VON A;  4GO1 A;  4YII A;  4XLP F;  1IUY A;  1YQA A;  2K4J A;  2XAJ A;  5E18 F;  1G4D A;  1BJA A;  1ULY A;  3T0Y A;  2G7H A;  3CO7 C;  5HVQ C;  4LK1 F;  1GHC A;  4NHJ A;  4PGG A;  3ZP5 A;  3CUO A;  5L3C A;  1G3S A;  4A6D A;  3GVA A;  2V1X A;  4P9U A;  4RGR A;  5E1X A;  2VXZ A;  4ENN A;  4M72 A;  2VBW A;  3I53 A;  2STT A;  2H94 A;  2P7V B;  4B09 A;  1L3L A;  4AIH A;  3L00 A;  1FC3 A;  3MCZ A;  2DQL A;  2F5C A;  4EGZ A;  2BGC A;  2OBP A;  1FPQ A;  3GFI A;  4M74 A;  4UV8 A;  4HZF A;  2VBX A;  3LWF A;  3LAJ A;  1T6S A;  5AIP A;  4HV5 A;  3ZQ7 A;  1I27 A;  2D1H A;  4UXN A;  3K0L A;  1YYV A;  3LAP A;  4BQA A;  3D0S A;  5D8K B;  3WTS C;  3ABU A;  1DPR A;  3J81 Z;  1OYI A;  4O6J A;  4EM1 A;  2H6C A;  4YFN F;  5HDN A;  1XSX A;  3GFL A;  1XCV A;  2K27 A;  3JSP A;  2OAZ A;  1B59 A;  3LA7 A;  2GWR A;  2Y48 A;  1FWZ A;  2IJL A;  4E70 A;  4AIK A;  1TLH B;  3KZY A;  2LNB A;  4HLX A;  4HAM A;  5D5U B;  1RNL A;  3FMQ A;  1BBY A;  3PQK A;  1MGT A;  1W4M A;  4Q4Z F;  1BOA A;  4I2O A;  5BPI A;  1RZ4 A;  4L0Y B;  1F1Z A;  3OOP A;  2FE3 A;  3WG9 A;  4XSX F;  5E1W A;  5D6F A;  3WGG A;  3ZPL A;  3GO5 A;  4P9F A;  4ZYG A;  2CSO A;  2GA1 A;  1J0R A;  1REP C;  4PCQ A;  5ICF A;  2PN6 A;  2IT0 A;  4M6X A;  2D45 A;  2P5L C;  5HS8 A;  4CIC A;  2IA2 A;  5CVJ A;  2QBY A;  4CDG A;  5IT3 A;  4I0A A;  1BI1 A;  2XVC A;  4EVI A;  3WGI A;  1FY7 A;  2DK5 A;  4U0V A;  4WX9 A;  2Z99 A;  3WOD F;  4GYG A;  5J6X A;  3ML6 A;  1YG2 A;  2HWV A;  2EV0 A;  3F72 A;  5KK1 A;  3KEO A;  4G7H F;  1KYZ A;  4HF0 A;  3EQL F;  1QZZ A;  4U0Y A;  3LST A;  1IZ1 A;  3ELK A;  2CFX A;  3F8N A;  2GQQ A;  3M9A A;  5LLQ A;  4GCV A;  1Z1D A;  2MBF A;  2HDC A;  2PJP A;  2P7C B;  4IRG A;  1I1S A;  3BRO A;  5E8G A;  1FLI A;  4KYW A;  1YTY A;  3HRT A;  3WU0 A;  2Q8K A;  2RKH A;  1A04 A;  1SFX A;  2R3S A;  1UHM A;  2A3S A;  4OMZ A;  4RGU A;  4U7B A;  2FNP A;  2H6B A;  1KGS A;  4G7Z F;  1LDD A;  4EM2 A;  4BYY A;  3O2P E;  5H6Q A;  2RQP A;  3V4G A;  1BI3 A;  1TTY A;  5E8I A;  4RAZ A;  4I09 A;  3BZ6 A;  3ABT A;  1TW3 A;  4O3M A;  4LJZ F;  3JW4 A;  3I71 A;  2W24 A;  4L9N A;  3W6J B;  1S7A A;  4NQW A;  2NS0 A;  2CW0 F;  3GWZ A;  1U3E M;  1ON1 A;  1AOY A;  2QZ8 A;  3EYI A;  4WK8 F;  2CGP A;  5IT9 K;  5BMZ A;  2ZCW A;  4LD5 A;  4QLC U;  5HS9 A;  3WTT C;  4RB0 A;  2V9V A;  1U5T C;  2PI0 A;  3J80 K;  2HKX A;  3RDI A;  1T0F A;  2FU4 A;  1IN4 A;  3G73 A;  2D1V A;  1GVJ A;  3FM5 A;  2RN7 A;  1S29 A;  1GXQ A;  2HFH A;  3V7S A;  4G6D A;  3VFZ A;  3F23 A;  3K69 A;  1BN5 A;  2BEO A;  4A0Y A;  1IRG A;  4LB6 B;  2O6G E;  3V8J A;  1TNS A;  1U5T B;  2QUF A;  4UNO A;  1DDN A;  4KNY A;  1UB9 A;  3K1N A;  1HKT A;  4H0E A;  1JGS A;  4JBA A;  1IN8 A;  1MJA A;  1LB2 A;  1E17 A;  2XGX A;  2JTV A;  1MDM B;  4OIN F;  3BOQ A;  2JZY A;  2HR3 A;  2ZFW A;  5TJJ A;  2DBB A;  3HTS B;  1ZRC A;  1SFU A;  3EUH A;  2O03 A;  5LHI A;  1LVA A;  5TRD A;  4KIB A;  2B0L A;  3WTX C;  4ZYE A;  2AS5 F;  3LFK A;  3ZMV A;  1XSD A;  3RJP A;  3FX3 A;  4MTE A;  1XGM A;  4Y13 A;  2P5V A;  2LSO A;  2DT5 A;  3I59 A;  1EV7 A;  3QAH A;  4HF2 A;  2MH2 A;  2QQA A;  2DPD A;  1MZB A;  5DV5 A;  5DEQ A;  4YFX F;  5FLX K;  3KLO A;  3GEZ A;  1IW7 F;  3HRS A;  5FO5 A;  3KP2 A;  3QU6 A;  4HX8 A;  1BC7 C;  3HHH A;  2IP2 A;  1O57 A;  2LDU A;  2EB7 A;  3V8L A;  4A12 A;  4KMF A;  1P2F A;  1XGN A;  3DPT A;  5CVU A;  5FD6 A;  3HYI A;  4M73 A;  4A0Z A;  3CJN A;  5LEJ A;  2EFN A;  5ILV A;  2K86 A;  3QPT A;  3T8R A;  1IRF A;  1R23 A;  2YX7 A;  2Z33 A;  4L0Z B;  1DP7 P;  3RIR A;  1P92 A;  1JHH A;  4TV7 A;  2F5D A;  2WWY A;  1ONV A;  2KRF A;  1BC8 C;  5L3F A;  2VT3 A;  1CF7 A;  5CLS A;  2ESH A;  5ILU A;  1ZAO A;  3EYY A;  3K2Z A;  4YG2 F;  5FFX A;  3FXQ A;  1TQM A;  1XGS A;  1R36 A;  3DFG A;  2XRN A;  3EET A;  3G3Z A;  2KJC A;  1D3Y A;  2WV0 A;  2EFO A;  1G3Y A;  3DF8 A;  2BYV E;  3KP4 A;  4PDK A;  1ZG3 A;  5HDK A;  2K02 A;  1YFH A;  3HTU A;  3WTV C;  5DCM A;  1O7L A;  3KP5 A;  1HKS A;  2W25 A;  3E6M A;  1XGO A;  5LGT A;  3L2C A;  3M1E A;  4G6Q A;  2A6H F;  3S2W A;  2E7X A;  4ON0 A;  5LGU A;  2K7L A;  1I6X A;  3BWG A;  1FYL A;  4ENM A;  1H9G A;  2NRA C;  4FX0 A;  2KKO A;  4AVP A;  2VN2 A;  1D8J A;  3H3Z A;  4HF1 A;  3F22 A;  1HBX G;  3Q9S A;  2GZW A;  1SD5 A;  3BY6 A;  4OU0 A;  2STW A;  3VOE A;  4L18 B;  2R7D A;  2GXB A;  2ZNZ A;  4DQ2 A;  2RV8 A;  1FBQ A;  4GGG A;  2EV6 A;  2A5Y B;  6PAX A;  1ON2 A;  4M9X A;  1ZRD A;  4G9Y A;  2QQB A;  4HDV A;  4KUM A;  4S04 A;  5L3D A;  3O6B B;  3DEU A;  4OOI A;  4M9S A;  1Z6R A;  2CQK A;  1F5T A;  4QWQ A;  1XCB A;  4HQM A;  1T98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...