1D8KA

Solution structure of the central core domain of tfiie beta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8kA00
1MDMA 4GO1A 2FU4A 4YFKF 1ZHFA 3DKWA 1GHCA 2P4WA 1ZRDA 4FHTA 4HF0A 3HOSA 3J80Z 1REPC 1B1BA 2FRHA 4XLNF 4M71A 4G7OF 3FXQA 2VODA 2MLGA 3K2ZA 2DK8A 4FX4A 1O3TA 2IA1A 5ILUA 4P9FA 3LWFA 1H9GA 4A0YA 3E5UA 3BZ6A 2H94A 3V8KA 3E97A 2HFHA 4ESBA 4YIIA 2XUBA 1OKRA 1YW9A 4RAYA 1H9TA 5D8KB 2QM3A 2D2WA 2QQAA 2HOEA 1YTYA 5CYVA 2NNYA 2A07F 1UCRA 3I4PA 4MTEA 5E20A 4WXHA 4A0XA 1B9NA 1I27A 1LB2A 4IXAA 4L9NA 2Q2EA 1TQPA 4MHGA 4IRIA 4L9VA 4U0WA 3GYHX 4G8XA 2BYVE 3ULQB 3F8BA 4EM2A 4I0BA 2HQRA 4L9JA 4RB1A 4UVCA 3F21A 2YSRA 3ELKA 2W57A 1W4MA 2P5VA 5E1XA 2XRNA 4AIHA 1O7LA 1B59A 4NB5A 2RN7A 3TO9A 3ZN0A 1TQMA 3QAHA 2CGPA 2QQ9A 2FA5A 1QPMA 5DUKA 3KLOA 5F1RA 3GX4X 1RI7A 3NEUA 5ICGA 4N9HA 3TGNA 1FBSA 3OV8A 2VC1A 4EGZA 1K7AA 1SFEA 5LHIA 2DW4A 2DTRA 5DCMB 5K1YA 4OMZA 5FLXZ 3KLNA 1O3RA 1IN5A 1OMIA 3JAMK 1LQ1A 3F6OA 4P96A 4GCVA 1FPQA 4GXOA 2RNJA 2EFPA 5D8LB 3EETA 4ZYGA 2JPCA 2FOKA 3DPTA 1LJ9A 3KEOA 4G6DA 3WU0A 4IRHA 2EWNA 2W25A 1XMKA 3RYPA 4HQMA 2XAHA 3TDUC 1KU9A 1UHMA 3TQNA 5IT3A 3LQRA 3SFZA 3TOBA 3MAJA 5FB2A 1OYIA 5IT9K 1KYZA 1WQ2A 1BIBA 2A61A 4L0ZB 2KIUA 2OD5A 1T38A 3RYRA 1Y0UA 1OYYA 5CVRA 1QO0D 2HGCA 3O2PE 2IA0A 4M73A 2DPDA 5ICCA 3LAJA 3HIFA 3VFZA 5LHHA 1MZBA 4ENJA 2HS5A 1OPCA 3H3UA 1QBJA 3T1BA 3U9GA 2ISZA 2R7FA 2DQLA 1P92A 3RJPA 3WU1B 2XAGA 5FD5A 4LG0A 1A04A 2A68F 2HQNA 4PZJA 1BI1A 3J80K 4LK0F 3RKXA 3WTWC 1KQ9A 3RKYA 3PQJA 3C1DA 1B9MA 5TRDA 4XLPF 1T6SA 1U2WA 3QRFF 4ZYDA 2CSOA 4L5JA 4O6JA 2A6EF 5LGTA 2DPUA 4ESJA 1XGMA 3TKYA 5L3CA 2PMHA 5DD8A 4K2EA 2MLKA 2VXZA 3BY6A 2CO5A 2QBYB 1J5YA 4BH9A 2VOOA 1SD5A 3EUHA 1H0MA 2RDPA 2XAFA 2RV8A 2F5EA 4NHJA 2W24A 3KP3A 4S05A 3E6MA 1KA8A 3DV8A 4R79A 3N4MA 2XAJA 2JZYA 3KP7A 4I98B 2STTA 4UNOA 1BOAA 1T39A 1YS6A 2Q8KA 3WG9A 1ZGJA 1J75A 3BROA 1XDSA 2H27A 1JHFA 3CJNA 2HTSA 2X0LA 1YW7A 1FYLA 2WV0A 1F1ZA 1BIAA 2IP2A 3RTRA 4ETSA 5FD6A 5E1WA 3IRQA 1UB9A 4HBLA 5HS7A 3KP6A 4P9UA 2PFBA 1IN4A 1YG2A 3RPQA 3BJAA 2GIVA 1W7PB 4CXFA 2EV0A 1SAXA 4A6DA 3PQKA 3F8FA 2BGCA 2EJRA 2LSOA 1XGNA 5JHUA 1HKQA 1P2FA 1R23A 1Z91A 2YU3A 3MZYA 4MQVA 4YFXF 5H6RA 3CUQB 4JQFA 3F8NA 3I53A 3EQLF 4HF1A 2E7XA 3U2RA 3I5UA 3EYYA 1TNSA 5HS8A 2O03A 4AD9A 2H6CA 1KQ8A 2NYXA 2FE3A 4G7HF 4WCGA 3RPUA 3K69A 1FC3A 3E5QA 3ISPA 3QP5A 3GZ6A 2CW0F 3JAMZ 4BNCA 1IXRC 1L3LA 1AOYA 1KGSA 1LDKB 2PEXA 3AAFA 2IT0A 4KFCA 3BJ6A 4HYEA 1J59A 1XDUA 2HTJA 3B02A 2IRFG 3EDPA 2DT5A 2P5LC 2ZFWA 1XMAA 2GA1A 1S7OA 2Y75A 1P4WA 1TNTA 4WK8F 4Q5SF 2L54A 2IVMA 4M72A 4RS8A 4IPAA 3HRUA 5ERIA 5FO5A 2PN6A 1SD6A 1J2XA 1U5TB 3IKVA 3VB2A 4IVNA 2HDCA 1O3QA 2L4AA 1PUEE 1ZRCA 1XGSA 1J7KA 1S3JA 4EVIA 4IRGA 5IT9Z 3OOPA 5BMZA 1ZGAA 3IHUA 4ON0A 2D45A 1IXCA 4KIFA 1ZN2A 2O3FA 4GGGA 3WE3A 2Z33A 2CYYA 2QENA 1FBQA 3HRSA 4PGGA 5CJ9A 2QVOA 5ILSA 5LGUA 5AONA 3SZTA 2K4BA 4HDUA 4LJZF 4A2UA 2A69F 4CDGA 3BDDA 2FMYA 3T5XA 5D4RA 4IJAA 1FSEA 5J8FA 4ESFA 1IXSB 1FZPB 4U0VA 1LDDA 1D5VA 1OYWA 1ZAOA 1HKTA 5FGMA 2XKOA 5F64A 4G6QA 5HOOA 4EJTA 2F5FA 3D0SA 3F6VA 5LEKA 1Z6RA 3P7NA 5LGNA 2L01A 4L5IA 1LEAA 4P5OA 4HOBA 1G3YA 2BV6A 2KIMA 3MZHA 2QBYA 3GFMA 2P8TA 2O6GE 2HYFA 2D1HA 2BEOA 2WTEA 2MC3A 2FF4A 2UWMA 5AIPA 3IC7A 2XHKA 4U7DA 1JXSA 4EJOA 4ZYEA 2QYOA 2DK5A 4ENNA 4O3MA 4EJUA 1XB4A 5D5UB 3M1EA 3QU3A 3R60A 2GWRA 3BJOA 2R3SA 3KZZA 1S7AA 4U88A 1IZ1A 4M9SA 3DF8A 1LVAA 3L9FA 1U8RA 2V6CA 2ZMEA 3NRVA 3F22A 5D5XB 4HW0A 1IAWA 4HQEA 3F8MA 4XSXF 2P5KA 2FMLA 2CFXA 1WI9A 1D8JA 2XVCA 4Q48A 4H0EA 3CTAA 3V8JA 1O57A 2PMUA 4UVAA 1ZLKA 5E18F 2HKOA 3LQQA 3I59B 4UVBA 3R6SA 1FYMA 1FP1D 3CUOA 4BQAA 3KCCA 2PLYA 3V4GA 4MGRA 1E17A 1HQCA 3LSTA 3CLOA 3K0LA 3TOAA 2OA4A 3DPLC 3ZQ7A 3M9AA 1ZG3A 3QPTA 4AWXB 2GZWA 1IN6A 1T0FA 3LA2A 5DD4A 3GF2A 2ZNZA 1RNLA 1F4KA 2E1CA 2EB7A 4EJWA 2OAZA 2KKOA 1EH7A 4BHCA 2QWWA 2KJCA 4OIRF 3G73A 1G3SA 3RIRA 3WTSC 3C7JA 1G3WA 1WKMA 4E70A 3TO6A 5DDGA 4EJVA 1FLIA 5ICFA 3WTYC 2HEOA 2DO7A 4LMYA 4I09A 2Z3YA 2P7VB 3ECHA 2DU9A 1F9NA 2VBXA 3DP7A 5D5VB 1G3TA 2M8EA 1Z1DA 2C6YA 1O3SA 4YG2F 2P6SA 3V7RA 5HLIA 3GW2A 1DPUA 2GXGA 4LB5A 4KIGA 1X3UA 2GXBA 2WWYA 1F5TA 4OIQF 1KQ0A 2DAOA 2ZBKA 3R4KA 2FBIA 4PGHA 2L3DA 5CLSA 2DFIA 3E6DA 3CO6C 2ESNA 4KMFA 3FF5A 3KFWX 3NQOA 3IWZA 4XSZF 2V79A 4ASNA 1ZG5A 1K78B 4UV9A 2RQPA 3C18A 4YIFA 4CICA 1R7JA 3SQNA 2QUFA 4OIPF 4P55A 3TDZC 1BM9A 1TLHB 2Z99A 1C0WA 2HKXA 1YS7A 4R8HA 3FXUA 3KZYA 4IF4A 3ZPLA 2VBYA 5H20A 1XSDA 4L9TA 2VOPA 2QZ8A 4HX7A 2DBBA 2DI3A 1ZG1A 2CWEA 1I6XA 4HA8A 5KVRA 1J9IA 3ZMZA 4A0ZA 1VTNC 1EH6A 5LLQA 4LLLA 1LDJA 4D0PA 4HX8A 4KDPA 4KYWA 2Y48A 5D4SA 1HW5A 3MWMA 2F5CA 1KU2A 2HZTA 4A6EA 4Q4ZF 1MDMB 1R22A 2CG4A 3GLXA 2FNAA 1XCVA 2Z5UA 3IRRA 4U7BA 4UHTA 3E5XA 3ABTA 2OU2A 5DV5A 1HXDA 4CZZA 3C3WA 4ZYHA 5D6FA 1MJ9A 2K02A 2A3SA 4Q47A 1YQAA 1QQIA 1TW2A 1P6RA 3KE2A 4RB2C 2GQQA 2VONA 3D5LA 4OOIA 1L0OC 2VE9A 2HYGD 1ZH5A 4WXDA 1ZREA 2LNBA 1MGTA 2M1BA 1R1VA 4FT8A 3SXYA 1HSJA 2IW5A 2J5PA 1ZLJA 2VBZA 3G3ZA 2O0YA 2XROA 3E6BA 1DPRA 3GFJA 1T98A 4HZFA 1ZYRF 1ON2A 1S6LA 3Q9SA 1IRGA 2EV5A 5BPIA 1BN5A 3LFKA 2NS0A 4LB6B 4KUMA 1USTA 5DCMA 2R7DA 1U78A 3T8TA 2V9VA 3I54A 3REOA 3ZMVA 2KIFA 2YR2A 4ZZDA 2MH2A 2B0LA 2M5WA 4LGWA 5CVJA 3K1MA 4N9IA 1XD7A 2E1NA 1YLFA 3Q9VA 3TO7A 3KETA 1YW8A 5L3FA 1TBXA 4LFUA 2VE8A 1YO5C 3H92A 4OIOF 2ZCWA 3QP6A 1D8KA 1XGOA 3BP8A 1IRFA 1FBUA 3P9KA 2XKPA 3L09A 1RIOH 2E7WA 4M6YA 2OBPA 3SHFA 3I0TA 1FY7A 1QZYA 5DYMA 4AVPA 3WODF 3K1NA 5J6XA 1I1SA 3MQ0A 1RUOA 4I0AA 1WSUA 1DDNA 3FXRA 4XBFA 2EFOA 1XSVA 2Z9OA 1BI2A 3ZMUA 2JSCA 4LK1F 2FBHA 5EEGA 1Q1HA 2ZKZA 3HHGA 2P6TA 3M7GA 3FMRA 4M74A 4L0YB 1ZARA 4ENKA 2NNNA 5LHGA 1YFHA 2H6BA 2AS5F 1W5SA 2ZXJA 4A12A 2PQ8A 5L3DA 2HWVA 4KN7X 2ACJA 3LA7A 3N97A 3O3KA 3ERED 3T8RA 4WX9A 4KN4X 2M87A 1BJAA 2W85A 5HDGA 4DNCA 1XN7A 5BQTA 1TQIA 3FZVA 4KICA 4RAZA 5DEQA 2IJLA 4HLYA 4A5NA 1BI3A 4LG0B 5DCFA 5L3EA 1NHAA 1USSA 2VBWA 1FT9A 5HDKA 3L7WA 3HYIA 5EEHA 2VC0A 3JTGA 1S8NA 4MQ9F 2XGXA 2XV4S 2ZNYA 3ABUA 3E3VA 4UV8A 4B09A 4JK1X 1RZ4A 2EV6A 1MJAA 2F2EA 1R1TA 3SZPA 2EA4A 2M45A 2NRAC 3RKWA 1PP8F 2RVCA 4EV0A 3QU6A 1CGPA 4S04A 4N0BA 1R00A 2PG4A 1BC7C 3FMSA 2DLLA 4WXCA 3P9CA 1XCBA 5AIQA 3L00A 4CO8A 1GVJA 1JHHA 4CHUA 4HV6A 4M6XA 3R61A 4LLNA 3MCZA 3IL2A 3V8LA 2YX7A 4PDKA 2HR3A 4QWQA 2KJBA 5JFRA 4WF2A 5K5OA 1ON1A 4ENMA 2IPQX 2VT3A 4OU0A 1ZRFA 1ODDA 4B8XA 2WC2A 1OR7A 5CVVA 1FOKA 3V7SA 2L02A 3HTUA 3FHZA 1SMTA 1CF7B 1SFXA 1WWXA 3JSOA 1W7PA 2X4HA 2ISYA 3J7AO 2A5YB 2K86A 1KYWA 5TJJA 2ADUA 2YX4A 4KA4A 3MEXA 5JR3A 2V1UA 4UUVA 1SD4A 1WRJA 1B6AA 4KIBA 4BXUA 3CUQA 2VN2A 3WGIA 2UXNA 3GEZA 3Q5FA 1O7FA 3W6KB 5KK1A 5A2QZ 4EMSA 2FQ3A 2LF7A 1HSTA 2K4JA 3HOTA 2ZJ2A 5FFZA 2OQGA 3QOPA 4IHSA 1QZZA 2EA2A 3RDIA 5K5QA 5LRRA 1JE8A 1S29A 1YYVA 3GFLA 5E8IA 3J81K 4EQQA 2PBIA 3E6CC 4LD5A 5HLGA 1BI0A 3F3XA 3QPHA 1IUYA 1K6OA 1QGPA 4NQWA 1R1UA 4HX4A 2YPRA 3U1DA 1UFMA 3BOQA 4R1HA 4XRFA 3IKTA 3DFGA 1ULYA 2BE5F 1JGSA 5DUIA 2XASA 2O61A 4GYGA 3V7CA 4BHBA 5HS9A 2ZO4A 4UXNA 2A6HF 3M8EA 4I02A 2J5OA 3FWEA 3VOEA 5BPDA 1IN8A 1U5TA 3K1PA 3RI4A 4CGZA 5E17F 3LA3A 4Z2YA 3WTVC 4BAYA 3ZN1A 4MEYF 1Z9CA 4RGRA 3O6BB 2G7HA 4BHPA 1Z05A 1Z6TA 2FXAA 5CVUA 1TTYA 2GAUA 2O8XA 4I01A 1SD7A 4QLCU 3BWGA 2P7CB 1AWCA 5FFXA 4PCQA 1U3EM 5F6FA 3GUDA 4O5VA 3I58A 4RGXA 3ZMSA 1QNTA 2L4MA 4YFNF 4MNUA 1MJBA 3GO5A 3FX3A 5HDNA 5D6EA 5L3BA 3T0YA 1PDNC 3HUGA 2W84A 3P9IA 2F5DA 5J8CA 4G94A 3GWZA 2MD5A 1G4DA 2MA3A 2UZKA 2EFQA 3I71A 1GXQA 2K7LA 3MFKA 3ROUA 5CVIA 5BS6A 3CDHA 3DEUA 3L2CA 4F7ZA 4KMUX 1MD0A 1GXPA 3KP2A 2FEZA 3WGGA 3HRMA 3WTZA 3ECOA 1IW7F 4I2OA 3S2WA 3BPXA 1DP7P 1FNNA 3JSPA 5D5WB 3FMQA 3HTSB 3BPVA 1W5TA 1B4AA 3H3ZA 3IWFA 3FM5A 1HW2A 3FM3A 3HHHA 1HKSA 3HRTA 1W7PD 4HDVA 3VEPA 2G9WA 3CUQC 3HSFA 3WGHA 2LF8A 2XIGA 3VODA 5E8GA 2COMA 3CO7C 2QQBA 3DXJF 4LLGF 1D3YA 1T2KA 3LAPA 5ILVA 2MBFA 4WWCA 3F8CA 1TW3A 4FX0A 2DQRA 1FP2A 4AIJA 3GXOA 4GYIA 6PAXA 1G6NA 1HW1A 2NAZA 4CYDA 3GFIA 4MTDA 1FX7A 3KP4A 2EK5A 1CF7A 2VT2A 3I59A 3DQVC 1IN7A 5E1ZB 3WTTC 1KU7A 1K79A 1IF1A 2TDXA 2LKPA 5A2QK 2RKHA 3R0AA 3HSEA 1FSHA 2ELHA 5ED4A 2JT1A 4Y13A 2D1VA 4MEXF 2ZMEB 1E2XA 1BBYA 2V1XA 1XSXA 4EM1A 2EFNA 2M30A 2RC4A 5FLXK 4KT5C 1Z7UA 1I1GA 1FWZA 1EV7A 3KEQA 4M9ZA 2IA2A 4JBAA 1LNWA 2OQRA 3ZMTA 3GVAA 1UHWA 2ETHA 4HLXA 1YIOA 1U5TC 1V4RA 3HSRA 3JW4A 1KU3A 4RGUA 5LEJA 3B73A 1R36A 2FNPA 1ONVA 3WTUC 2QLZA 1J0RA 2FBKA 2JTVA 5JVTA 4RGSA 4L18B 2MH9A 2JPBA 3I64A 4KNYA 4DQ2A 4BYYA 3M8FA 2Y0MA 3J81Z 3COAC 4U0YA 1STZA 2GA2A 4RB3C 2KRFA 2EFWA 1R5GA 3ZMDA 1I5ZA 1V3FA 2ESHA 4Y15A 2PI0A 3PFIA 2BBYA 3WTXC 4EGYA 3EYIA 4Y17A 2LDUA 4I7HA 4G7ZF 5K5RA 2PJPA 4TV7A 2JRTA 4HAMA 5LBQA 1SMYF 3F72A 1PP7U 4OINF 3KP5A 5H6QA 2XAQA 3F23A 5BOXA 5ICEA 1K78A 3WE2A 4OMYA 2CQKA 5HLHA 4AIKA 1RUNA 3GZ5A 2OZ6A 1DUXC 3JTHA 4HF2A 4ZZLA 1SFUA 2STWA 4HV5A 2AXLA 2G7UA 2H09A 3ML6A 5LRSA 2FSWA 2OZUA 1EH8A 1U6GA 4RB0A 4G9YA 1R58A 1FYKA 1HBXG 1BC8C 2K27A 3W6JB 5HVQC 1R5HA 5JI6A 1P4AA 4M9XA 2Q0OA 4EM0B 2UXXA 3R0JA 3ZP5A 1P4XA 2V1DA 4A5MA 4IHTA 5L3GA 2RGVA 3K9TA 1LEBA 4ZH4F 1MKMA
chains in the Genus database with same CATH superfamily
1UG2A 4G12A 1MDMA 2XRLA 4GO1A 2FU4A 4YFKF 1ZHFA 3ABKH 3DKWA 1TWCJ 1GHCA 2P4WA 1ZRDA 2F5VA 3QQAA 2VJJA 4FHTA 5B1AH 4HF0A 3HOSA 2E35A 4BJTA 1TL8A 3J80Z 2LR8A 2Y31A 1REPC 2VI6A 1B1BA 2FRHA 2B9SA 1VQOI 4XLNF 2DFHA 2XSDC 3HPHA 4E7HA 3B6AA 4M71A 4HNVA 4G7OF 4A3IJ 1ZK8A 3S1RJ 3FXQA 3OYAA 3LSIA 2VODA 2MLGA 2Y69H 2AQFA 4QPOA 3K2ZA 2DK8A 1LKXA 4FX4A 1O3TA 3D5RC 2IA1A 5ILUA 4P9FA 3LWFA 3IV5A 1H9GA 4A0YA 3ZQLA 3E5UA 3BZ6A 1POGA 1V5EA 2H94A 2MFZA 3V8KA 3E97A 2HFHA 2BVMA 2AHQA 1F43A 2FQ4A 4ESBA 4YIIA 2XUBA 1OKRA 1YW9A 4RAYA 1A36A 1K83J 1H9TA 3TBIA 3CF5F 5D8KB 2QM3A 4M3BA 2X1CA 2L9SA 2D2WA 2QQAA 2HOEA 1YTYA 5CYVA 2NNYA 2NS7A 2MG4A 1JI8A 1OISA 2A07F 1UCRA 4IO9F 3I4PA 4MTEA 4JOMA 5E20A 2CV1A 4WXHA 1K61A 5IY5H 1UG0A 1T08B 4A0XA 1LFPA 3G6EI 1B9NA 2QSHX 1I27A 1OQYA 3FDYA 5FKOA 1I3QJ 1YX3A 4IXAA 1J09A 1LB2A 2B7EA 4L9NA 1VQNI 1TWGJ 1TQPA 2Q2EA 4H4KC 1P9QC 4MHGA 4IRIA 2ICWG 4L9VA 4U0WA 3GYHX 4G8XA 2BYVE 3ULQB 3L2UA 4AM3A 4M3FA 3F8BA 4EM2A 4LIUA 2LVSA 1Y1VJ 1P7IA 4I0BA 2HQRA 4L9JA 2H1KA 3BG9A 3FXJA 4RB1A 4UVCA 2L0KA 3ABLH 1B72A 2XGCA 3F21A 2JK3A 2KISA 2YSRA 3ELKA 4ZDLA 2F4IA 2W57A 3I4NJ 2R7OA 1W4MA 2P5VA 5E1XA 3S32A 2XRNA 4AIHA 2EINH 3LSJA 4FQGA 2DCEA 3JRCA 1VQLI 1O7LA 1B59A 4NB5A 2RN7A 2HVQA 3TO9A 1TQMA 3ZN0A 4DIQA 3CC7I 1G59A 2A5WA 2DT6A 3QAHA 2CGPA 2M3AA 3K4NA 2QQ9A 2FA5A 1QU3A 1QPMA 4IHWA 5DUKA 5J4VA 3KLOA 5F1RA 2ZJQF 3GX4X 1RI7A 3NEUA 5ICGA 3IH3A 1Z0XA 4N9HA 2LBFB 3TGNA 2R92J 4HRIA 2R5ZA 4XLEA 1FBSA 3OV8A 3OYLA 2VC1A 4D5FA 4EGZA 1K7AA 1SFEA 4B44A 5LHIA 2DW4A 2PX9A 2OUMA 2DTRA 5DCMB 5K1YA 4OMZA 2XF7A 3GBGA 3KLNA 3M07A 5FLXZ 5EZGA 1IN5A 1O3RA 2JUGA 1OMIA 3JAMK 2E2HJ 2CQQA 1IRXA 3OWTA 1LQ1A 3BZCA 1DGRM 3F6OA 1MNEA 1TWAJ 2VUMJ 2O9LA 1YHQI 1NK2P 4P96A 1VQ6I 4GCVA 1FPQA 4GXOA 3OYIA 4F93B 2RNJA 2EFPA 3PJRA 2K9SA 2K5CA 5D8LB 5JVGF 3EETA 2ME0A 4ZYGA 2XB5A 2JPCA 2JA6J 2FOKA 3E1SA 3RCOA 4CCNA 2WADA 3DPTA 1A5JA 2AO9A 4FE7A 1LJ9A 1SFOJ 3KEOA 1WJAA 3GTPJ 4G6DA 3SDBA 3WU0A 4IRHA 5GAHJ 5E3MA 3OIOA 1JT6A 3G2BA 3AG2H 2EWNA 1IUFA 1PVEA 2W25A 3F9KA 1YJ9I 2M2EA 1GVDA 1MSFC 1X1DA 1XMKA 3RYPA 2ZSIB 1VNDA 4HQMA 2XAHA 3TDUC 2LFBA 2LP0A 1KU9A 4XN3A 1UHMA 3CDIA 3TQNA 4X6AJ 4M3DA 4IKFA 3FISA 5IT3A 3LQRA 3SFZA 3TOBA 3ZQIA 2M34A 1JTYA 4YEJA 3MAJA 5FB2A 1A31A 2MABA 1OYIA 3ZXSA 2VASA 4A3BJ 5IT9K 1KYZA 2K9LA 5GAEJ 3CCEI 1NK3P 1WQ2A 1BIBA 4N4OB 1LPQA 2A61A 4IL6C 1WZ2A 1MBEA 1WH7A 2KIUA 4L0ZB 2EZKA 2OD5A 2QKMB 4XICA 1T38A 4UY8I 2JN6A 5J4YA 4PSXA 3RYRA 1UELB 1X3ZB 1Y0UA 2LOOA 3J7ZI 1OYYA 1MMGA 3DEEA 3HZJA 5CVRA 1QO0D 2HGCA 3HEFA 4CCJA 3WHCA 3UKGA 2M0CA 3O2PE 2IA0A 4HNTA 4BGDA 4M73A 1ZR2A 2DPDA 5ICCA 3DTIA 2WV1A 3LAJA 2CH0A 3HIFA 1U9NA 2MC4A 3VFZA 5LHHA 3RSNA 1R9TJ 1MZBA 2Y2ZA 2DJNA 4ENJA 2HS5A 1OPCA 3H3UA 2QA4I 4C9YA 1QBJA 4DYQA 4XOTA 2L9VA 4E6KG 2BW3B 3T1BA 3U9GA 2ISZA 2DA2A 3WHBA 2R7FA 2DQLA 1P92A 3RJPA 5FLMJ 2XAGA 2VKHA 3WU1B 2VJ5A 5FD5A 4LG0A 4BE2A 2FOWA 1GUUA 1JGGA 3CCQI 5FKKA 4GRIA 3HC7A 1A04A 2A68F 2HQNA 1ZR4A 4PZJA 1IV8A 1BI1A 3MKZA 1JJ6C 4U87A 3OYDA 3K4CA 2ZXIA 3H5RA 3FXMA 2R7UA 3J80K 4NBQA 1WVRA 3HOVJ 4LK0F 3RKXA 3WTWC 5B1BH 3H3VK 1KQ9A 2CUEA 4XR6A 3RKYA 1ZELA 3S14J 3PQJA 3C1DA 1B9MA 5TRDA 1OR7C 1TP4A 5J3LA 4XLPF 1Z67A 1T6SA 1N78A 2KFDA 4ZTFA 2VPRA 2CQ7A 1U2WA 3HJEA 3IP4B 2K85A 3QRFF 4ZYDA 3FKIJ 2CSOA 3DCFA 4L5JA 4O6JA 3OSGA 2A6EF 5LGTA 2DPUA 2KL4A 4ESJA 1XGMA 3TKYA 5B3SH 2PMHA 5L3CA 3TP3A 5DM6F 2CQNA 3O8GA 5DD8A 4K2EA 2AXTC 2MLKA 4IHXA 3QWLA 1SANA 2VXZA 1E0EA 4CYCB 2V9KA 3BY6A 2JVGA 3PL8A 2CO5A 2QBYB 1J5YA 2W4SA 4BH9A 4X1EA 2VOOA 3CD6I 1SD5A 2OCEA 3EUHA 1H0MA 3JCUC 2RDPA 2XAFA 2RV8A 2F5EA 2QSGX 4NHJA 2E34A 3TL4X 4D1QA 2W24A 1WH5A 4ITVA 2VQHA 3KP3A 1ENHA 2KDOA 4QTRA 4S05A 3E6MA 1KA8A 3P5JA 3DV8A 4BXFA 2VIXA 3UR3C 2M9HA 4R79A 3N4MA 2XAJA 1FIPA 1EF4A 3DPUA 2JZYA 3KP7A 4I98B 3PM1A 2EILH 2STTA 4UNOA 5CPRB 1BOAA 4BQOA 5C4XJ 3OYJA 1T39A 1YS6A 1WHUA 3TW7A 4P1WA 2Q8KA 3WG9A 4XM3A 1ZGJA 1J75A 2DA4A 3BROA 1XDSA 4MLOA 1JHFA 2JSPA 2H27A 3CJNA 2E71A 2HTSA 2KMUA 1XTAA 2X0LA 1YW7A 1R71A 4BEHA 3A1YA 1FYLA 2YS9A 3BC8A 2WV0A 1F1ZA 1BIAA 3CCUI 2IP2A 4J00A 3RTRA 4ETSA 2CUZA 5FD6A 2DMQA 5E1WA 3ZQCA 3DWLE 3Q0WA 4PJLA 1PUFB 5E3OA 2JMWA 1UB9A 3IRQA 4HBLA 5HS7A 3KP6A 4P9UA 3A01B 1WJCA 1IN4A 2PFBA 3JRFA 2KDZA 1YG2A 3RPQA 2R7QA 3BJAA 5FKMA 2GIVA 1TT5B 1W7PB 4CXFA 2EV0A 2OTJI 1SAXA 4A6DA 1QVTA 3F8FA 3PQKA 2BGCA 4QSHA 2EJRA 2LBFA 2LSOA 1QVUA 1XGNA 3HOZJ 1NG7A 4V2GA 4RM2A 3ZRGA 2W7NA 3J7YJ 5JHUA 1HKQA 1P2FA 3ZQHA 1R23A 3HOXJ 3CMMA 1Z91A 4S0HB 2KT0A 2YU3A 3MZYA 4MQVA 1EKEA 4YFXF 5H6RA 3CUQB 4JQFA 1X58A 2JRMA 3F8NA 4RAGA 3I53A 1WGXA 3EQLF 1MBHA 3F0CA 4LOCA 4HF1A 2JQ7A 2ELJA 1TC3C 2E7XA 2KIQA 2EZLA 2VKVA 3LSMA 3U2RA 3BG3A 2BZTA 1VFCA 3I5UA 1MBKA 3A0HC 3EYYA 2ELKA 2OPTA 1TNSA 5HS8A 2O03A 2H8WA 3MZ8A 2H6CA 4AD9A 1KQ8A 2NYXA 2CMPA 3H35A 2FE3A 4G7HF 4WCGA 3RPUA 4DOZA 3AG4H 3K69A 1FC3A 3E5QA 3ISPA 3QP5A 3GZ6A 3BTCA 4HPQA 4XRMA 5J40A 2CW0F 3JAMZ 4DYRA 4BNCA 1E3PA 1IXRC 2A6TA 1L3LA 1AOYA 1KGSA 1D1AA 1LDKB 5EDNA 2YUSA 2PEXA 2LC2A 3AAFA 2QQ8A 2IT0A 4FCYA 4KFCA 3BJ6A 4BE0A 4HYEA 5K7ZA 1J59A 1XDUA 3MKYB 3BQYA 2HTJA 3B02A 2GOXB 2IRFG 4W97A 3EDPA 2E2IJ 4NQWB 1ETQA 2DT5A 4YELA 2P5LC 3H5NA 2BY3A 2ZFWA 2ZXWH 1XMAA 2GA1A 1S7OA 2JA2A 3D5SC 5M5XJ 2Y75A 1P4WA 3K4KA 3QPSA 1TNTA 4WK8F 3FHNA 2VLAA 4AC0A 4Q5SF 2EBIA 2L54A 3K6GA 2IVMA 2N8GA 3K4BA 3TEDA 4M72A 1FJLA 2MSYA 4RS8A 5EG0B 4IPAA 2XAUA 3HRUA 5ERIA 5FO5A 3CDLA 2LY1A 2PN6A 1SD6A 1Z21A 2EIJH 1J2XA 2VB6A 1G2HA 1U5TB 2KRHA 1H89C 2O8KA 3AKZA 4F92B 3IKVA 3VB2A 1W0TA 5F27A 4IVNA 1FOWA 2HDCA 1O3QA 2L4AA 1PUEE 1ZRCA 2K9MA 1XGSA 1J7KA 1ZQ3P 1S3JA 4EVIA 4IRGA 5IT9Z 3OOPA 4PJMA 3SYTA 1ZGAA 3IHUA 4ON0A 5BMZA 2D45A 1IXCA 4KIFA 2M4GA 3LSKA 3OS2A 1ZN2A 4RDUA 3FK6A 4DZJA 1HOMA 1LUJB 2BW3A 3WG7H 5J47A 2IGKA 2O3FA 1U0JA 3FIWA 5J1UA 2LLKA 3BTLA 4GGGA 3WE3A 2Z33A 2CYYA 2XF5A 2QENA 5M3FJ 3ZGKA 1FBQA 2IS2A 1GLNA 4BE1A 3HRSA 4PGGA 4UB6C 5CJ9A 2QVOA 3OYBA 3EUHC 5ILSA 5LGUA 2R7RA 5AONA 3SZTA 1RKWA 2K4BA 4HDUA 1HA8A 3FKJA 2HNHA 2DDAA 4LJZF 1AHDP 4A2UA 5J1YA 3HUGB 2A69F 4CDGA 3BDDA 2LY2A 2FMYA 3T5XA 5D4RA 4IJAA 1M1EB 1MBJA 5KNLA 1FSEA 5J8FA 1RR8C 4ESFA 4II3A 4AIDA 1IXSB 1MMSA 1FZPB 3BCAA 1MIJA 1MNDA 2DA7A 4U0VA 1UAAA 2CW7A 1LDDA 1D5VA 1OYWA 1ZAOA 1SEUA 3MN2A 4I76A 1HKTA 2VKDA 4C2MJ 4GFBA 5FGMA 2AQEA 2XKOA 1T95A 5F64A 4G6QA 5HOOA 2E1MC 3DKYA 2F5FA 4EJTA 2BHYA 3UNGC 2V9PA 3MMYB 3D0SA 3F6VA 5LEKA 1Z6RA 3P7NA 5LGNA 4DBQA 1XMXA 2L01A 4L5IA 1BW6A 3A03A 4EEFG 1LEAA 4P5OA 1WFXA 4HOBA 4CYCA 2Y9YA 1LFUP 1SVMA 1G3YA 2BV6A 2KIMA 3MZHA 4ZYAA 1JKRC 3S1MJ 3LSPA 2QBYA 3CCLI 2X1EA 2DTZA 3GFMA 2R5YA 2P8TA 1YITI 1GT0C 2VL8A 2O6GE 2HYFA 2D1HA 2BEOA 3HM5A 2WTEA 2OC6A 3KYCB 2O7OA 1AU7A 2MC3A 2FF4A 3AG3H 2UWMA 3N05A 2JA7J 5AIPA 2JWTA 4Y33A 1OCOH 2XHKA 3IC7A 4A93J 2LTPA 3W6VA 1FTZA 1ETWA 3BTIA 5DTDA 4U7DA 4MFEA 3I4MJ 1Y8RB 1JXSA 2OJED 3CCJI 1NTCA 4EJOA 4ZYEA 2QYOA 3LL7A 2EPFA 2DK5A 4ENNA 3NAUA 4O3MA 4EJUA 1XB4A 1BL0A 5D5UB 4OAZA 3DBRB 2NVTJ 3M1EA 4HNUA 3QU3A 3R60A 3RKQA 2GWRA 3PSFA 3BJOA 5E79C 2L7FP 2R3SA 2M4KA 4HSRA 3CP8A 3KZZA 4EATA 4OWRB 1B8IB 1ITYA 1S7AA 4U88A 2KPMA 3ZR8X 1IZ1A 3CCYA 4XLCA 1HLVA 4M9SA 3DF8A 1LVAA 2XSJC 1SVLA 3L9FA 4CH7A 4JX6A 1U8RA 2V6CA 3S3NA 1K4SA 2ZMEA 4NDLA 1JT0A 3NRVA 3F22A 5D5XB 4HW0A 2WBMA 4A3MJ 1IAWA 2DA3A 2EQRA 4HQEA 3F8MA 2CQXA 3KX2A 4CZCA 2E36A 4D7MA 4XSXF 5IYBJ 2P5KA 1IGNA 4E7SA 2MD0A 2FMLA 3A0BC 3A01A 2M0MA 2CFXA 1WI9A 4GDFA 3HL2A 1WCMJ 2XVCA 1D8JA 4Q48A 1ZKGA 4H0EA 3CTAA 3V8JA 1O57A 2PMUA 3DTEA 3CLQA 4UVAA 1ZLKA 3H9JA 5E18F 2HKOA 3LQQA 1X4PA 1LE8A 3I59B 4UVBA 1RESA 2WA0A 3R6SA 2V7FA 3RPUD 4A3FJ 1FYMA 1FP1D 3GMEA 4D9JA 3CUOA 3JR9A 1OFCX 4BQAA 5GPAA 4L5EA 3KCCA 3QOEA 2PLYA 3V4GA 4Y52J 1BOBA 4MGRA 1E17A 4ABZA 5HNFA 1ETOA 1HQCA 2HXIA 3LSTA 3SZGA 4ZDPA 3CLOA 3L1PA 3K0LA 3TOAA 5C4JJ 2OA4A 2ZB9A 3OYKA 3DPLC 3CZ6A 2LG4A 3NARA 3ZQ7A 3M9AA 1ZG3A 3QPTA 4AWXB 2M7AA 2GZWA 1IN6A 1T0FA 4CSWA 3W3CA 1K6YA 3OL4A 3H36A 1T8IA 3U1KA 2Q1ZB 3S8PA 5TGTA 3LA2A 3IUOA 4J01A 5DD4A 1AKHA 1SVOA 3GF2A 3OR2C 1EA3A 4II2A 3OYMA 2ZNZA 1RNLA 1F4KA 2E1CA 2EB7A 2NVUB 4XORA 4EJWA 4E7KA 3CMYA 5HODA 2OAZA 2KKOA 5GTHC 1EH7A 3CF2A 4BHCA 2ECBA 2QWWA 2KJCA 2HXOA 4OIRF 3G73A 1G3SA 3RIRA 3WTSC 3C7JA 1G3WA 1OCPA 1OCCH 1WKMA 4E70A 1SFKA 1IC8A 4IEJA 3TO6A 5DDGA 4EJVA 1FLIA 2K9NA 5ICFA 3WTYC 2HEOA 2DO7A 4FE4A 3GTQJ 4LMYA 1VQ7I 1I50J 4I09A 2Z3YA 3RZOJ 1VQMI 1DU0A 2P7VB 3ECHA 3MKWB 2DU9A 1Y1WJ 1W36D 2XGEA 2R0QC 3CJRB 2DA6A 2DN0A 2EIKH 1F9NA 2VBXA 3DP7A 1XX5A 2CUFA 1D5YA 5D5VB 2M8EA 1G3TA 1Z1DA 1SAUA 4UUSB 2C6YA 3O8HA 2NOJB 4YG2F 1O3SA 2P6SA 3V7RA 5HLIA 3GW2A 3GTMJ 1DPUA 1MW7A 4QIWN 2GXGA 1RRJA 4LB5A 4F52A 1JKPC 4KIGA 3EUKL 4BJ5C 2E2JJ 2H8RA 1X3UA 1MMDA 2QF7A 2GXBA 2WWYA 3G1OA 1F5TA 2RAEA 4OIQF 4ZJZA 1S9HA 2BHZA 3OYCA 1KQ0A 2DAOA 2R7TA 1JUMA 4OAYA 4PJNA 1R4MB 2O5RA 2ZBKA 3R4KA 2FBIA 1S5LC 2DA1A 2L3DA 4PGHA 5CLSA 1V54H 5F1JA 2DFIA 4V2FA 3E6DA 3HPGA 3CO6C 2ESNA 3OR1C 2IS1A 2I5UA 3KYLA 1Y6IA 4KMFA 1YRNA 2NVYJ 3FF5A 3KFWX 3NQOA 2MGQA 1FMWA 3IWZA 4XSZF 2V79A 4ASNA 1ZG5A 1TWFJ 1K78B 4UV9A 1MMNA 2RQPA 3C18A 4YIFA 4CICA 1R7JA 3SQNA 2QUFA 3S1QJ 4J19A 3EUAA 4PK4A 3ABMH 4P55A 4OIPF 3TDZC 1S7EA 3K70C 5H2FC 2L2OA 1BM9A 2NOGA 1TLHB 3LOCA 1YJWI 2K40A 2Z99A 4IQ4A 1C0WA 5EGOB 3QODA 2HKXA 1YS7A 4XLAA 4R8HA 3JRHA 3FXUA 3KZYA 2P0WA 3U21A 4IF4A 2V6EA 2VBYA 3ZPLA 5H20A 3GTGJ 4A3LJ 1XSDA 2M8GX 2F48A 1FOYA 3K70D 4JYKA 4L9TA 5FKNA 2VOPA 2FD5A 2QZ8A 4NC8A 1DQUA 4HX7A 5KAFC 1X1CA 2DBBA 2DI3A 2XGDA 1ZG1A 1FOXA 2CWEA 2TCTA 1I6XA 3HG9A 4HA8A 3KIOA 5KVRA 1J9IA 4JP0A 3ZMZA 4A0ZA 1VTNC 1EH6A 2XPVA 3FXOA 5LLQA 4LLLA 1RKTA 1LDJA 5EZHA 5GPCA 4D0PA 2ZMEC 4CA0A 4HX8A 4RM3A 4XKCA 4KDPA 4BJ6C 3LFUA 4KYWA 2QEXI 2Y48A 3HBLA 5D4SA 1HW5A 2DFEA 3MWMA 2F5CA 1KU2A 4RAFA 2HZTA 5GADJ 4A6EA 4Q4ZF 5KHDA 3M8JA 3DTKA 1MDMB 1RETA 4I6ZA 3CMEI 3DBHB 1E3HA 1IDZA 1R22A 2CG4A 2TRTA 1Z3XA 4F3QA 1JKQC 1HCRA 5EF6A 3ASNH 2DXIA 1NH3A 3GLXA 3BTJA 1PYVA 3H0DA 2FNAA 3PUBA 1XCVA 2Z5UA 3IRRA 4U7BA 4UHTA 3E5XA 3ABTA 2OU2A 3A02A 2FJ1A 5DV5A 1IDYA 3CC2I 1HXDA 4CZZA 2EZIA 3OYGA 3C3WA 3ZOBA 1VQKI 3PSIA 4ZYHA 3OYFA 5D6FA 1MJ9A 3AL0C 4ZDOA 2IS4A 3EPZA 2B63J 2K02A 2A3SA 2WAQN 1VQ9I 4A3KJ 1D0XA 4Q47A 1YQAA 3LSHA 1QQIA 1T0FC 1TW2A 1LVKA 1P6RA 3KE2A 4QPQA 2IBDA 4W1UA 4RB2C 2GQQA 1D1BA 2VONA 3D5LA 4OOIA 1L0OC 2VE9A 2HYGD 1ZH5A 4B43A 4I99C 3I9V2 4WXDA 4Y7NJ 1OCTC 1ZREA 4Y4RA 2LNBA 1MGTA 1VQPI 1X2MA 3Q0VA 2M1BA 1RC9A 5K7FA 1R1VA 1D0ZA 4FT8A 4IOAF 5HLTA 3SXYA 1HSJA 3M4OJ 2IW5A 1UHSA 4B47A 2J5PA 1ZLJA 2VBZA 2ZJPF 4KISA 3G3ZA 2O0YA 2Q2EB 2XROA 3E6BA 2E5NA 1DPRA 2HDDA 3GFJA 1T98A 4HZFA 1YX5A 3BR2A 1ZYRF 1ON2A 2X85A 1S6LA 2XPUA 3Q9SA 5FJ8J 1CQTA 1D1CA 3G4SI 1IRGA 4HSTA 1B72B 2EV5A 3NWSA 5BPIA 1BN5A 3LFKA 4PJJA 1W0UA 2NS0A 4LB6B 4KUMA 3IH4A 1USTA 5DCMA 2R7DA 1U78A 2NVQJ 4XONA 2PJRB 2F6CA 2QGUA 2DDBA 3T8TA 2V9VA 3VYUB 1BA5A 2CW8A 3I54A 3REOA 3ZMVA 4RLFA 2KIFA 2EZHA 2YR2A 4ZZDA 2ZSHB 2MH2A 2B0LA 2M5WA 3BG7A 1GDTA 4LGWA 5CVJA 3K1MA 1WJDA 1X1AA 1APLC 4N9IA 2CV0A 3OS1A 2W1OA 2LD5A 1XD7A 4MO7A 1O4XA 4XKVA 2E1NA 2VJ4A 2XPWA 2Z2SB 5FRMA 1YLFA 3Q9VA 3NWTA 1R5ID 3TO7A 3KETA 1YW8A 5L3FA 2R5ZB 3VYSB 1TBXA 4LFUA 3HXLA 2VE8A 3SDGA 1YO5C 3LNQA 1QPIA 1JKOC 3H92A 3W2WA 5F0CA 4AYBN 2W00A 3GTJJ 4OIOF 3JRDA 2ZCWA 3QP6A 1D8KA 1A35A 1XGOA 3BP8A 1IRFA 3PIOF 3E0JB 1FBUA 2L9NA 3P9KA 2XKPA 3CCRI 3L09A 1RIOH 2CV2A 2F4MB 2E7WA 4M6YA 2OBPA 3SHFA 3I0TA 1FY7A 4MFDA 1QHGA 3S17J 1QZYA 2WAQA 5FROA 5DYMA 3CCMI 4BY7J 2DOEA 1JJ8C 2DMUA 5JLWA 4AVPA 2K3FA 1N77A 3KPHA 2CJJA 3BR0A 1QZEA 2LMDA 3OOUA 1IRZA 5K7HA 3S16J 5IYDJ 3WODF 3K1NA 3L2WA 3CMAI 5J6XA 3CQZJ 1I1SA 3MQ0A 1A6IA 4BDZA 4UUTA 4JX5A 2LREA 2X51A 1RUOA 4I0AA 1WSUA 2KZGA 1DDNA 2E60A 3FXRA 4XBFA 2EFOA 1XSVA 4FISA 2Z9OA 2ZC2A 1SC7A 3PO3J 4DBRA 1BI2A 3IAS2 3MD2A 4CCLA 3ZMUA 2JSCA 4LK1F 4XKBA 2FBHA 4X0GA 5IOYA 1D0YA 5EEGA 1I6HJ 5CQGA 2ZKZA 1Q1HA 2CFOA 3HHGA 3K10A 2IXSA 2P6TA 2R7ZJ 3M7GA 3TMOA 3FMRA 3OSFA 4M74A 4L0YB 1ZARA 4ENKA 2NNNA 5IP9J 5LHGA 1YFHA 2Y0SN 3CJQB 4B3XA 2H6BA 1YIJI 4A3JJ 1MNMC 2AS5F 1W5SA 2ZXJA 3RZDJ 4A12A 1BR4A 1Q1VA 2PQ8A 5L3DA 1X4OA 2HWVA 4KN7X 2ACJA 3JRBA 3I55I 3LA7A 4B1RA 2VPLA 2X6OA 1MH4A 3PO2J 3N97A 2I10A 4B48A 1TT0A 3MKLA 3O3KA 2DOFA 3VYTB 4RA2A 3ERED 3T8RA 4WX9A 2QKLB 2LRDA 4KN4X 5KCMA 3BR5A 3LSRA 3S3MA 4A69C 2M87A 4BDYA 1OJLA 1BJAA 2IAIA 2W85A 1I39A 4C3IJ 5HDGA 4BXXJ 4DNCA 1XN7A 1H88C 1V55H 4YRVA 4BY1J 2Y9ZA 5BQTA 1TQIA 3FZVA 4KICA 4RAZA 4AYBA 5DEQA 4FASD 1XPXA 2IJLA 4HLYA 4A5NA 1BI3A 2L7MP 4LG0B 1WJ5A 5DCFA 3OYNA 3DLAA 3S93A 5L3EA 2ZXHA 1NHAA 1USSA 3CC4I 4XK4A 2VBWA 2HQAA 1FT9A 3AFHA 5HDKA 1Y8QB 3L7WA 3W2VA 3HYIA 5EEHA 2VC0A 3JTGA 1S8NA 4MQ9F 2ME6A 2XGXA 2XV4S 2ZNYA 3ABUA 3E3VA 4UV8A 3FBIB 4B09A 4JK1X 1RZ4A 2EV6A 1MJAA 2F2EA 1R1TA 3SZPA 3V42A 2EA4A 1ETXA 2M45A 2NRAC 2WAFA 3RKWA 1PP8F 2RVCA 3BLYA 1ETYA 3RQ4A 3G1LA 4EV0A 3JREA 3A4CA 3H1CA 3QU6A 4S04A 3G71I 1CGPA 4ANJA 5IOZA 4N0BA 4ZTJA 1R00A 2X48A 3PUFA 5M5WJ 1FMVA 2GM4A 2PG4A 1IJWC 3SEQA 1BC7C 5DS9A 3FMSA 1ORKA 3BT9A 2DLLA 2WY7Q 4WXCA 4MIMA 1BR1A 3P9CA 1T33A 3OS0A 1OCZH 1XCBA 5AIQA 2DT7B 1U9OA 1UMQA 3L00A 1F36A 1HDPA 1GVJA 4CO8A 5TISC 5F08A 2IGNA 1JHHA 3Q3SA 4CHUA 4HV6A 4M6XA 3M3YJ 3ZQGA 3R61A 2X1DA 5JLXA 4LLNA 3K2AA 3MCZA 3IL2A 4LIVA 3HOYJ 3V8LA 4DYCA 2YX7A 4PDKA 5F0HA 3J7AY 2HR3A 4QWQA 2KRCA 3BG6A 2KJBA 2Y0SA 5JFRA 4WF2A 4IHYA 1ACIA 5K5OA 3OIQA 1VI0A 1ON1A 1W1WE 1E3OC 4ENMA 2IPQX 4XLFA 2JVHA 2VT3A 3PFYA 1QRYA 4OU0A 2ID6A 2A05A 3RQIA 1ZRFA 4IQJA 3BR1A 1ODDA 3VYRB 4B8XA 2WC2A 2X6WA 1OR7A 5CVVA 2KQRA 3DEWA 1FOKA 1PUFA 2VXDA 3V7SA 2L02A 1V5GA 1WPKA 2WB1N 2LK2A 3HTUA 3K4MA 3GTLJ 3FHZA 1OLTA 1SMTA 1CF7B 1SFXA 1WWXA 3JSOA 2E1MB 1W7PA 2X4HA 2ISYA 3K4JA 2A5YB 3J7AO 2K86A 2R7XA 3VWBA 5J1RA 1KYWA 1MBGA 5TJJA 2ADUA 4BEHB 2YX4A 3HOUJ 4PJ0C 3MEXA 4AUXA 4KA4A 5JR3A 2V1UA 4UUVA 4A3GJ 1SD4A 1WRJA 1B6AA 4A3CJ 4KIBA 1W5CC 4BXUA 3CUQA 2PJRA 2VN2A 2BY1A 5B66C 4D5CA 3WGIA 2UXNA 3GEZA 3Q5FA 2VQLA 1O7FA 1ETKA 3W6KB 1JUSA 2CRGA 5KK1A 5A2QZ 3ZQQA 3S1NJ 2BY2A 5F04A 2L9RA 4EMSA 1GV5A 3ZCOA 1VZ0A 1FTTA 2R7VA 2FQ3A 2LF7A 3MVPA 5E3NA 2UUZA 4XN0A 4B3AA 4YIRX 1HSTA 3DU6A 2K4JA 4LG3A 4BKXA 3TW6A 3HOTA 2DYSH 2X6XA 3VDXA 4IHVA 3B6CA 5LFAA 4C2UA 2ZJ2A 5FFZA 4E7JA 3S3OA 2OQGA 3QOPA 4IHSA 4A3DJ 1DU6A 1HF0A 4DZPA 1QZZA 3BCBA 2EA2A 1YE9A 3RDIA 5K5QA 4ZC3A 2NXNB 5LRRA 1JE8A 2V1NA 2CS3A 2YU9J 1S29A 1YYVA 3GFLA 5E8IA 2XF6A 3J81K 2HYJA 3D1NI 1W36C 1WJBA 4EQQA 2PBIA 3E6CC 4E7LA 3ASOH 3JRIA 2RREA 4LD5A 5HLGA 4NNJA 1BI0A 2WY8Q 2R7WA 4XRSA 3F3XA 4F55A 3QPHA 4XIDA 1IUYA 1K6OA 2BY0A 5CQEA 2L7ZA 2OCCH 1QGPA 4NQWA 2GLOA 3S2DJ 1R1UA 4HX4A 2YPRA 4M3EA 4HEA2 2H1LA 4LITA 4XOPA 2HI3A 3U1DA 1UFMA 2QSFX 3SEZA 3BOQA 4R1HA 2HOTA 4XRFA 3IKTA 2OV7A 5EEAA 3PNYA 3DFGA 2L5QA 1WI3A 1ULYA 4AVZA 1S72I 2BE5F 1JGSA 3W2AA 5DUIA 2XASA 2O61A 4GYGA 3V7CA 4BHBA 5HS9A 1AA7A 2ZO4A 1X3WB 2A6HF 4UXNA 5EG0A 3M8EA 1XS9A 5FLVA 5IYCJ 3JRGA 4I02A 2J5OA 3C2BA 2Z16A 3FWEA 3IAM2 1IN8A 1U5TA 3VOEA 3X2QH 5BPDA 2WB1A 3K1PA 3RI4A 1FEXA 4CGZA 2IGMA 5E17F 3LA3A 2K3PA 4Z2YA 3WTVC 4BAYA 4BACA 3ZN1A 4MEYF 1Z9CA 2FX0A 3BZKA 4RGRA 2HQ5A 3O6BB 5E3LA 2G7HA 3H5AA 4BHPA 1Z05A 3PNTA 1Z6TA 2FXAA 5CVUA 3ESWB 1TTYA 2GAUA 2O8XA 4I01A 1SD7A 1I3AA 4C3HJ 4QLCU 1MH3A 3OYHA 2D5VA 5KAIC 3BWGA 2BXYA 2P7CB 1AWCA 3L2QA 5FFXA 4CCMA 4PCQA 2IGOA 1U3EM 5F6FA 3G1MA 2HU9A 3GUDA 3KZIC 4O5VA 2R93J 2CUJA 3I58A 2PMZN 4JX4A 2DYRH 2LYCA 1G8XA 2COBA 2HPMA 4RGXA 3ZMSA 4RMNA 3H9QA 1QNTA 3A2KA 2E5ZA 1IV6A 1Z3YA 3CCSI 2L4MA 4BBRJ 1IO2A 4YFNF 4MNUA 1MJBA 3BR3A 5EJCA 3GO5A 3FX3A 5HDNA 4UB8C 4M6VA 1T56A 3IH2A 5D6EA 5L3BA 1K4TA 3T0YA 4E4HA 3VPRA 3Q0UA 1PDNC 3HUGA 2X6YA 2W84A 3P9IA 2X9DA 2F5DA 2KZVA 3C2GA 3WU2C 5J8CA 4G94A 3ONQA 3GWZA 2V4JC 3PIPF 2MD5A 5C3EJ 1G4DA 3SJMA 2MA3A 2UZKA 5M3MJ 2NVXJ 2EFQA 2JUCA 3I71A 3LMMA 1GXQA 1V5FA 1LFBA 2K7LA 3MFKA 3ROUA 1U8BA 5CVIA 1MBFA 5BS6A 3KEYA 3DKXA 3CDHA 3DEUA 3GTOJ 3L2CA 3H9GA 2L7KA 1R49A 4F7ZA 4KMUX 1MD0A 4KITB 1XG1A 1GXPA 3OMYA 3KP2A 3GTKJ 1VQ5I 2HVRA 1N75A 4NC7A 1UJ8A 4XRSG 1X19A 2FEZA 2G0EA 3WGGA 3HRMA 1X1BA 3WTZA 5JHFA 1VQ4I 3ECOA 1VF9A 5FKLA 1IW7F 4I2OA 1Y56A 3S2WA 3BPXA 1DP3A 1DP7P 1FNNA 4NUBA 3H0GJ 3FMQA 4F91B 5D5WB 3JSPA 3HTSB 1TZLA 3FXLA 4DGWB 3BPVA 1W5TA 1B4AA 3H3ZA 4Z6YA 3IWFA 3FM5A 1HW2A 2ECCA 1R6RA 1UZCA 3HKZN 4IX7A 3FM3A 3HHHA 1KZHA 3ZQFA 5GAGJ 1ERDA 5EYRA 1TWHJ 4PSWA 3QPLA 1HKSA 2LY9A 3HRTA 3BG5A 1P7JA 3SFIA 2XC7A 1W7PD 4HDVA 3VEPA 5DM7F 2G9WA 2E19A 2KP6A 1FIAA 3CUQC 3HSFA 3WGHA 4IOCF 2KHMA 2LF8A 2XIGA 4KT6A 3VODA 5E8GA 4DJAA 2COMA 3CO7C 2R5YB 2QQBA 3DXJF 2OTLI 2DMNA 4LLGF 2GIZA 2NS8A 3K7AJ 1D3YA 1T2KA 1B8IA 1Y39A 3S2HJ 3LAPA 4RLQA 3FBNB 1EJ9A 5ILVA 2MBFA 2W82A 1Y0NA 4WWCA 3F8CA 1TW3A 2HVSA 4FX0A 2DQRA 2KLOA 2PMZA 4IZZA 1FP2A 1ZTRA 5F0FA 4AIJA 3GXOA 4GYIA 6PAXA 1G6NA 1HW1A 4XLHA 3GLLA 2NAZA 4C3JJ 4CYDA 3GFIA 1N25A 4MTDA 1FX7A 2IEKA 3KP4A 2JA5J 4HG2A 2XDVA 2EK5A 2HDWA 1CF7A 4PFPA 3M1CA 1BW5A 1MSEC 2VT2A 3I59A 3DQVC 1IN7A 5E1ZB 3WTTC 1KU7A 2DODA 1K79A 1IF1A 4DW6A 4RBOA 1HDDC 2TDXA 2DFFA 2LKPA 5A2QK 2RKHA 3VSKA 3R0AA 3HSEA 4BUPA 1FSHA 4BL0B 2ELHA 4Y13A 2JT1A 2M7BA 2D1VA 5ED4A 2ZMEB 4MEXF 5CKTA 2HZDA 2HOAA 2EH3A 1E2XA 4FETA 3OIPA 1BBYA 2V1XA 1XSXA 1H8AC 4EM1A 4FTHA 2OF7A 2EFNA 2M30A 2IS6A 2RC4A 3QYBA 5FLXK 4KT5C 3GZNB 1LE8B 1Z7UA 5GP9A 4BQQA 1I1GA 2ZJRF 1FWZA 1WJEA 2MYSA 1EV7A 1RPWA 3KEQA 4M9ZA 2IA2A 4JBAA 3QYFA 1LNWA 4G6TB 2OQRA 1GV2A 3GVAA 3ZMTA 4AU7A 4BS9A 2BXZA 4A3EJ 3ERMA 1UHWA 2RNGA 2ETHA 4HLXA 1YIOA 3DLLF 1U5TC 2GBYA 4BBSJ 1MMAA 1QA6A 1V4RA 2LH9A 3HSRA 3AL0B 1HC8A 1XC5A 4XKWA 4C2TA 5GTIC 3JW4A 1KU3A 4RGUA 4B4CA 3HKZA 2DA5A 5LEJA 2VQCA 3B73A 4M3GA 4PFOA 1QHHD 2DOAA 3BQZA 3L2RA 1R36A 3CCVI 2FNPA 1ONVA 3WTUC 2QLZA 1J0RA 3FXKA 1AKHB 4NC6A 2DMTA 2FBKA 2F4OB 4E7ZA 3S15J 2JTVA 3DBLB 5JVTA 4RGSA 5BNGA 4L18B 1DGWY 2MH9A 1ETVA 2JPBA 2BVLA 3I64A 3HOWJ 4KNYA 1Z7LA 4UUSA 4DQ2A 2BOLA 2ID3A 4V19K 5HNHA 2MW8A 4BYYA 2V26A 5C44J 2GXAA 3PNVA 1X2NA 3M8FA 2UV1A 4CCOA 5B5EC 2Y0MA 4C30A 3J81Z 3COAC 1KONA 4U0YA 1PJRA 1STZA 2GA2A 4RB3C 2JA8J 2KRFA 2ZFUA 1R5GA 2EFWA 2CU7A 1OCRH 1BJZA 3ZMDA 4Y3OA 1I5ZA 1Z77A 1V3FA 2ESHA 3CESA 4Y15A 1ZGWA 2PI0A 3PFIA 2BBYA 9ANTA 3WTXC 1R4NB 4CUGA 2VKEA 3K4LA 2LKSA 4EGYA 3GCMA 3EYIA 5FRNA 4Y17A 5LD2C 4BQNA 2LDUA 4CCKA 2HOSA 4I7HA 3L2VA 2QCOA 4G7ZF 1YI2I 4BU2A 5K5RA 2PJPA 4TV7A 2DJIA 2JRTA 3FK7A 4HAMA 2W48A 2RQQA 3LSGA 5LBQA 1SMYF 3F72A 1PP7U 4OINF 2K9QA 1WJFA 3KP5A 5H6QA 1JTXA 2XAQA 3F23A 5BOXA 5ICEA 2E1OA 3WE2A 1K78A 4OMYA 3CP2A 4XNFA 3I56I 2LKXA 2CQKA 5HLHA 3OYEA 1BR2A 4AIKA 1RUNA 4XL9A 3BR6A 4PUSA 3GZ5A 2JJ7A 1NG6A 2OZ6A 3C2HA 1DUXC 3JTHA 4HF2A 4D7NA 4ZZLA 3I3LA 2FUG2 2VJIA 2Z1DA 1X1PA 4E7IA 4N4NB 1SFUA 2STWA 4HV5A 5IPAA 1RR7A 2AXLA 2G7UA 5EGOA 1IG7A 3TP0A 1YRNB 2I8DA 4KJZA 3HB9A 2WAEA 2H09A 3ML6A 5LRSA 1JUPA 3AG1H 2Y30A 2FSWA 2OZUA 3QYEA 1EH8A 1U6GA 2R4GA 4RB0A 2P81A 4G9YA 1R58A 1FYKA 1YJNI 1HBXG 1BC8C 3VSLA 2K27A 2EIMH 3HDDA 2VQGA 3W6JB 5IP6A 1VQ8I 5HVQC 1R5HA 5JI6A 1P4AA 2HPIA 2XB0X 3HGYA 4XQFA 3HGGA 3KYDB 2GOMA 3OL3A 4M9XA 4XMYA 2Q0OA 3DU5A 4EM0B 2R7SA 5M5YJ 2UXXA 3R0JA 1YOVB 3CJTB 1P4XA 2V1DA 3ZP5A 2DMPA 4A5MA 5IP7J 4IHTA 5L3GA 2RGVA 3K9TA 3OY9A 3JRAA 1A6QA 1LEBA 3E7LA 4ZH4F 1MKMA
chains in the Genus database with same CATH topology
1MDMA 4GO1A 2FU4A 4YFKF 1ZHFA 3DKWA 1GHCA 2P4WA 1ZRDA 4FHTA 4HF0A 3HOSA 3J80Z 1REPC 1B1BA 2FRHA 4XLNF 4M71A 4G7OF 3FXQA 2VODA 2MLGA 3K2ZA 2DK8A 4FX4A 1O3TA 2IA1A 5ILUA 4P9FA 3LWFA 1H9GA 4A0YA 3E5UA 3BZ6A 2H94A 3V8KA 3E97A 2HFHA 4ESBA 4YIIA 2XUBA 1OKRA 1YW9A 4RAYA 1H9TA 5D8KB 2QM3A 2D2WA 2QQAA 2HOEA 1YTYA 5CYVA 2NNYA 2A07F 1UCRA 3I4PA 4MTEA 5E20A 4WXHA 4A0XA 1B9NA 1I27A 1LB2A 4IXAA 4L9NA 2Q2EA 1TQPA 4MHGA 4IRIA 4L9VA 4U0WA 3GYHX 4G8XA 2BYVE 3ULQB 3F8BA 4EM2A 4I0BA 2HQRA 4L9JA 4RB1A 4UVCA 3F21A 2YSRA 3ELKA 2W57A 1W4MA 2P5VA 5E1XA 2XRNA 4AIHA 1O7LA 1B59A 4NB5A 2RN7A 3TO9A 3ZN0A 1TQMA 3QAHA 2CGPA 2QQ9A 2FA5A 1QPMA 5DUKA 3KLOA 5F1RA 3GX4X 1RI7A 3NEUA 5ICGA 4N9HA 3TGNA 1FBSA 3OV8A 2VC1A 4EGZA 1K7AA 1SFEA 5LHIA 2DW4A 2DTRA 5DCMB 5K1YA 4OMZA 5FLXZ 3KLNA 1O3RA 1IN5A 1OMIA 3JAMK 1LQ1A 3F6OA 4P96A 4GCVA 1FPQA 4GXOA 2RNJA 2EFPA 5D8LB 3EETA 4ZYGA 2JPCA 2FOKA 3DPTA 1LJ9A 3KEOA 4G6DA 3WU0A 4IRHA 2EWNA 2W25A 1XMKA 3RYPA 4HQMA 2XAHA 3TDUC 1KU9A 1UHMA 3TQNA 5IT3A 3LQRA 3SFZA 3TOBA 3MAJA 5FB2A 1OYIA 5IT9K 1KYZA 1WQ2A 1BIBA 2A61A 4L0ZB 2KIUA 2OD5A 1T38A 3RYRA 1Y0UA 1OYYA 5CVRA 1QO0D 2HGCA 3O2PE 2IA0A 4M73A 2DPDA 5ICCA 3LAJA 3HIFA 3VFZA 5LHHA 1MZBA 4ENJA 2HS5A 1OPCA 3H3UA 1QBJA 3T1BA 3U9GA 2ISZA 2R7FA 2DQLA 1P92A 3RJPA 3WU1B 2XAGA 5FD5A 4LG0A 1A04A 2A68F 2HQNA 4PZJA 1BI1A 3J80K 4LK0F 3RKXA 3WTWC 1KQ9A 3RKYA 3PQJA 3C1DA 1B9MA 5TRDA 4XLPF 1T6SA 1U2WA 3QRFF 4ZYDA 2CSOA 4L5JA 4O6JA 2A6EF 5LGTA 2DPUA 4ESJA 1XGMA 3TKYA 5L3CA 2PMHA 5DD8A 4K2EA 2MLKA 2VXZA 3BY6A 2CO5A 2QBYB 1J5YA 4BH9A 2VOOA 1SD5A 3EUHA 1H0MA 2RDPA 2XAFA 2RV8A 2F5EA 4NHJA 2W24A 3KP3A 4S05A 3E6MA 1KA8A 3DV8A 4R79A 3N4MA 2XAJA 2JZYA 3KP7A 4I98B 2STTA 4UNOA 1BOAA 1T39A 1YS6A 2Q8KA 3WG9A 1ZGJA 1J75A 3BROA 1XDSA 2H27A 1JHFA 3CJNA 2HTSA 2X0LA 1YW7A 1FYLA 2WV0A 1F1ZA 1BIAA 2IP2A 3RTRA 4ETSA 5FD6A 5E1WA 3IRQA 1UB9A 4HBLA 5HS7A 3KP6A 4P9UA 2PFBA 1IN4A 1YG2A 3RPQA 3BJAA 2GIVA 1W7PB 4CXFA 2EV0A 1SAXA 4A6DA 3PQKA 3F8FA 2BGCA 2EJRA 2LSOA 1XGNA 5JHUA 1HKQA 1P2FA 1R23A 1Z91A 2YU3A 3MZYA 4MQVA 4YFXF 5H6RA 3CUQB 4JQFA 3F8NA 3I53A 3EQLF 4HF1A 2E7XA 3U2RA 3I5UA 3EYYA 1TNSA 5HS8A 2O03A 4AD9A 2H6CA 1KQ8A 2NYXA 2FE3A 4G7HF 4WCGA 3RPUA 3K69A 1FC3A 3E5QA 3ISPA 3QP5A 3GZ6A 2CW0F 3JAMZ 4BNCA 1IXRC 1L3LA 1AOYA 1KGSA 1LDKB 2PEXA 3AAFA 2IT0A 4KFCA 3BJ6A 4HYEA 1J59A 1XDUA 2HTJA 3B02A 2IRFG 3EDPA 2DT5A 2P5LC 2ZFWA 1XMAA 2GA1A 1S7OA 2Y75A 1P4WA 1TNTA 4WK8F 4Q5SF 2L54A 2IVMA 4M72A 4RS8A 4IPAA 3HRUA 5ERIA 5FO5A 2PN6A 1SD6A 1J2XA 1U5TB 3IKVA 3VB2A 4IVNA 2HDCA 1O3QA 2L4AA 1PUEE 1ZRCA 1XGSA 1J7KA 1S3JA 4EVIA 4IRGA 5IT9Z 3OOPA 5BMZA 1ZGAA 3IHUA 4ON0A 2D45A 1IXCA 4KIFA 1ZN2A 2O3FA 4GGGA 3WE3A 2Z33A 2CYYA 2QENA 1FBQA 3HRSA 4PGGA 5CJ9A 2QVOA 5ILSA 5LGUA 5AONA 3SZTA 2K4BA 4HDUA 4LJZF 4A2UA 2A69F 4CDGA 3BDDA 2FMYA 3T5XA 5D4RA 4IJAA 1FSEA 5J8FA 4ESFA 1IXSB 1FZPB 4U0VA 1LDDA 1D5VA 1OYWA 1ZAOA 1HKTA 5FGMA 2XKOA 5F64A 4G6QA 5HOOA 4EJTA 2F5FA 3D0SA 3F6VA 5LEKA 1Z6RA 3P7NA 5LGNA 2L01A 4L5IA 1LEAA 4P5OA 4HOBA 1G3YA 2BV6A 2KIMA 3MZHA 2QBYA 3GFMA 2P8TA 2O6GE 2HYFA 2D1HA 2BEOA 2WTEA 2MC3A 2FF4A 2UWMA 5AIPA 3IC7A 2XHKA 4U7DA 1JXSA 4EJOA 4ZYEA 2QYOA 2DK5A 4ENNA 4O3MA 4EJUA 1XB4A 5D5UB 3M1EA 3QU3A 3R60A 2GWRA 3BJOA 2R3SA 3KZZA 1S7AA 4U88A 1IZ1A 4M9SA 3DF8A 1LVAA 3L9FA 1U8RA 2V6CA 2ZMEA 3NRVA 3F22A 5D5XB 4HW0A 1IAWA 4HQEA 3F8MA 4XSXF 2P5KA 2FMLA 2CFXA 1WI9A 1D8JA 2XVCA 4Q48A 4H0EA 3CTAA 3V8JA 1O57A 2PMUA 4UVAA 1ZLKA 5E18F 2HKOA 3LQQA 3I59B 4UVBA 3R6SA 1FYMA 1FP1D 3CUOA 4BQAA 3KCCA 2PLYA 3V4GA 4MGRA 1E17A 1HQCA 3LSTA 3CLOA 3K0LA 3TOAA 2OA4A 3DPLC 3ZQ7A 3M9AA 1ZG3A 3QPTA 4AWXB 2GZWA 1IN6A 1T0FA 3LA2A 5DD4A 3GF2A 2ZNZA 1RNLA 1F4KA 2E1CA 2EB7A 4EJWA 2OAZA 2KKOA 1EH7A 4BHCA 2QWWA 2KJCA 4OIRF 3G73A 1G3SA 3RIRA 3WTSC 3C7JA 1G3WA 1WKMA 4E70A 3TO6A 5DDGA 4EJVA 1FLIA 5ICFA 3WTYC 2HEOA 2DO7A 4LMYA 4I09A 2Z3YA 2P7VB 3ECHA 2DU9A 1F9NA 2VBXA 3DP7A 5D5VB 1G3TA 2M8EA 1Z1DA 2C6YA 1O3SA 4YG2F 2P6SA 3V7RA 5HLIA 3GW2A 1DPUA 2GXGA 4LB5A 4KIGA 1X3UA 2GXBA 2WWYA 1F5TA 4OIQF 1KQ0A 2DAOA 2ZBKA 3R4KA 2FBIA 4PGHA 2L3DA 5CLSA 2DFIA 3E6DA 3CO6C 2ESNA 4KMFA 3FF5A 3KFWX 3NQOA 3IWZA 4XSZF 2V79A 4ASNA 1ZG5A 1K78B 4UV9A 2RQPA 3C18A 4YIFA 4CICA 1R7JA 3SQNA 2QUFA 4OIPF 4P55A 3TDZC 1BM9A 1TLHB 2Z99A 1C0WA 2HKXA 1YS7A 4R8HA 3FXUA 3KZYA 4IF4A 3ZPLA 2VBYA 5H20A 1XSDA 4L9TA 2VOPA 2QZ8A 4HX7A 2DBBA 2DI3A 1ZG1A 2CWEA 1I6XA 4HA8A 5KVRA 1J9IA 3ZMZA 4A0ZA 1VTNC 1EH6A 5LLQA 4LLLA 1LDJA 4D0PA 4HX8A 4KDPA 4KYWA 2Y48A 5D4SA 1HW5A 3MWMA 2F5CA 1KU2A 2HZTA 4A6EA 4Q4ZF 1MDMB 1R22A 2CG4A 3GLXA 2FNAA 1XCVA 2Z5UA 3IRRA 4U7BA 4UHTA 3E5XA 3ABTA 2OU2A 5DV5A 1HXDA 4CZZA 3C3WA 4ZYHA 5D6FA 1MJ9A 2K02A 2A3SA 4Q47A 1YQAA 1QQIA 1TW2A 1P6RA 3KE2A 4RB2C 2GQQA 2VONA 3D5LA 4OOIA 1L0OC 2VE9A 2HYGD 1ZH5A 4WXDA 1ZREA 2LNBA 1MGTA 2M1BA 1R1VA 4FT8A 3SXYA 1HSJA 2IW5A 2J5PA 1ZLJA 2VBZA 3G3ZA 2O0YA 2XROA 3E6BA 1DPRA 3GFJA 1T98A 4HZFA 1ZYRF 1ON2A 1S6LA 3Q9SA 1IRGA 2EV5A 5BPIA 1BN5A 3LFKA 2NS0A 4LB6B 4KUMA 1USTA 5DCMA 2R7DA 1U78A 3T8TA 2V9VA 3I54A 3REOA 3ZMVA 2KIFA 2YR2A 4ZZDA 2MH2A 2B0LA 2M5WA 4LGWA 5CVJA 3K1MA 4N9IA 1XD7A 2E1NA 1YLFA 3Q9VA 3TO7A 3KETA 1YW8A 5L3FA 1TBXA 4LFUA 2VE8A 1YO5C 3H92A 4OIOF 2ZCWA 3QP6A 1D8KA 1XGOA 3BP8A 1IRFA 1FBUA 3P9KA 2XKPA 3L09A 1RIOH 2E7WA 4M6YA 2OBPA 3SHFA 3I0TA 1FY7A 1QZYA 5DYMA 4AVPA 3WODF 3K1NA 5J6XA 1I1SA 3MQ0A 1RUOA 4I0AA 1WSUA 1DDNA 3FXRA 4XBFA 2EFOA 1XSVA 2Z9OA 1BI2A 3ZMUA 2JSCA 4LK1F 2FBHA 5EEGA 1Q1HA 2ZKZA 3HHGA 2P6TA 3M7GA 3FMRA 4M74A 4L0YB 1ZARA 4ENKA 2NNNA 5LHGA 1YFHA 2H6BA 2AS5F 1W5SA 2ZXJA 4A12A 2PQ8A 5L3DA 2HWVA 4KN7X 2ACJA 3LA7A 3N97A 3O3KA 3ERED 3T8RA 4WX9A 4KN4X 2M87A 1BJAA 2W85A 5HDGA 4DNCA 1XN7A 5BQTA 1TQIA 3FZVA 4KICA 4RAZA 5DEQA 2IJLA 4HLYA 4A5NA 1BI3A 4LG0B 5DCFA 5L3EA 1NHAA 1USSA 2VBWA 1FT9A 5HDKA 3L7WA 3HYIA 5EEHA 2VC0A 3JTGA 1S8NA 4MQ9F 2XGXA 2XV4S 2ZNYA 3ABUA 3E3VA 4UV8A 4B09A 4JK1X 1RZ4A 2EV6A 1MJAA 2F2EA 1R1TA 3SZPA 2EA4A 2M45A 2NRAC 3RKWA 1PP8F 2RVCA 4EV0A 3QU6A 1CGPA 4S04A 4N0BA 1R00A 2PG4A 1BC7C 3FMSA 2DLLA 4WXCA 3P9CA 1XCBA 5AIQA 3L00A 4CO8A 1GVJA 1JHHA 4CHUA 4HV6A 4M6XA 3R61A 4LLNA 3MCZA 3IL2A 3V8LA 2YX7A 4PDKA 2HR3A 4QWQA 2KJBA 5JFRA 4WF2A 5K5OA 1ON1A 4ENMA 2IPQX 2VT3A 4OU0A 1ZRFA 1ODDA 4B8XA 2WC2A 1OR7A 5CVVA 1FOKA 3V7SA 2L02A 3HTUA 3FHZA 1SMTA 1CF7B 1SFXA 1WWXA 3JSOA 1W7PA 2X4HA 2ISYA 3J7AO 2A5YB 2K86A 1KYWA 5TJJA 2ADUA 2YX4A 4KA4A 3MEXA 5JR3A 2V1UA 4UUVA 1SD4A 1WRJA 1B6AA 4KIBA 4BXUA 3CUQA 2VN2A 3WGIA 2UXNA 3GEZA 3Q5FA 1O7FA 3W6KB 5KK1A 5A2QZ 4EMSA 2FQ3A 2LF7A 1HSTA 2K4JA 3HOTA 2ZJ2A 5FFZA 2OQGA 3QOPA 4IHSA 1QZZA 2EA2A 3RDIA 5K5QA 5LRRA 1JE8A 1S29A 1YYVA 3GFLA 5E8IA 3J81K 4EQQA 2PBIA 3E6CC 4LD5A 5HLGA 1BI0A 3F3XA 3QPHA 1IUYA 1K6OA 1QGPA 4NQWA 1R1UA 4HX4A 2YPRA 3U1DA 1UFMA 3BOQA 4R1HA 4XRFA 3IKTA 3DFGA 1ULYA 2BE5F 1JGSA 5DUIA 2XASA 2O61A 4GYGA 3V7CA 4BHBA 5HS9A 2ZO4A 4UXNA 2A6HF 3M8EA 4I02A 2J5OA 3FWEA 3VOEA 5BPDA 1IN8A 1U5TA 3K1PA 3RI4A 4CGZA 5E17F 3LA3A 4Z2YA 3WTVC 4BAYA 3ZN1A 4MEYF 1Z9CA 4RGRA 3O6BB 2G7HA 4BHPA 1Z05A 1Z6TA 2FXAA 5CVUA 1TTYA 2GAUA 2O8XA 4I01A 1SD7A 4QLCU 3BWGA 2P7CB 1AWCA 5FFXA 4PCQA 1U3EM 5F6FA 3GUDA 4O5VA 3I58A 4RGXA 3ZMSA 1QNTA 2L4MA 4YFNF 4MNUA 1MJBA 3GO5A 3FX3A 5HDNA 5D6EA 5L3BA 3T0YA 1PDNC 3HUGA 2W84A 3P9IA 2F5DA 5J8CA 4G94A 3GWZA 2MD5A 1G4DA 2MA3A 2UZKA 2EFQA 3I71A 1GXQA 2K7LA 3MFKA 3ROUA 5CVIA 5BS6A 3CDHA 3DEUA 3L2CA 4F7ZA 4KMUX 1MD0A 1GXPA 3KP2A 2FEZA 3WGGA 3HRMA 3WTZA 3ECOA 1IW7F 4I2OA 3S2WA 3BPXA 1DP7P 1FNNA 3JSPA 5D5WB 3FMQA 3HTSB 3BPVA 1W5TA 1B4AA 3H3ZA 3IWFA 3FM5A 1HW2A 3FM3A 3HHHA 1HKSA 3HRTA 1W7PD 4HDVA 3VEPA 2G9WA 3CUQC 3HSFA 3WGHA 2LF8A 2XIGA 3VODA 5E8GA 2COMA 3CO7C 2QQBA 3DXJF 4LLGF 1D3YA 1T2KA 3LAPA 5ILVA 2MBFA 4WWCA 3F8CA 1TW3A 4FX0A 2DQRA 1FP2A 4AIJA 3GXOA 4GYIA 6PAXA 1G6NA 1HW1A 2NAZA 4CYDA 3GFIA 4MTDA 1FX7A 3KP4A 2EK5A 1CF7A 2VT2A 3I59A 3DQVC 1IN7A 5E1ZB 3WTTC 1KU7A 1K79A 1IF1A 2TDXA 2LKPA 5A2QK 2RKHA 3R0AA 3HSEA 1FSHA 2ELHA 5ED4A 2JT1A 4Y13A 2D1VA 4MEXF 2ZMEB 1E2XA 1BBYA 2V1XA 1XSXA 4EM1A 2EFNA 2M30A 2RC4A 5FLXK 4KT5C 1Z7UA 1I1GA 1FWZA 1EV7A 3KEQA 4M9ZA 2IA2A 4JBAA 1LNWA 2OQRA 3ZMTA 3GVAA 1UHWA 2ETHA 4HLXA 1YIOA 1U5TC 1V4RA 3HSRA 3JW4A 1KU3A 4RGUA 5LEJA 3B73A 1R36A 2FNPA 1ONVA 3WTUC 2QLZA 1J0RA 2FBKA 2JTVA 5JVTA 4RGSA 4L18B 2MH9A 2JPBA 3I64A 4KNYA 4DQ2A 4BYYA 3M8FA 2Y0MA 3J81Z 3COAC 4U0YA 1STZA 2GA2A 4RB3C 2KRFA 2EFWA 1R5GA 3ZMDA 1I5ZA 1V3FA 2ESHA 4Y15A 2PI0A 3PFIA 2BBYA 3WTXC 4EGYA 3EYIA 4Y17A 2LDUA 4I7HA 4G7ZF 5K5RA 2PJPA 4TV7A 2JRTA 4HAMA 5LBQA 1SMYF 3F72A 1PP7U 4OINF 3KP5A 5H6QA 2XAQA 3F23A 5BOXA 5ICEA 1K78A 3WE2A 4OMYA 2CQKA 5HLHA 4AIKA 1RUNA 3GZ5A 2OZ6A 1DUXC 3JTHA 4HF2A 4ZZLA 1SFUA 2STWA 4HV5A 2AXLA 2G7UA 2H09A 3ML6A 5LRSA 2FSWA 2OZUA 1EH8A 1U6GA 4RB0A 4G9YA 1R58A 1FYKA 1HBXG 1BC8C 2K27A 3W6JB 5HVQC 1R5HA 5JI6A 1P4AA 4M9XA 2Q0OA 4EM0B 2UXXA 3R0JA 3ZP5A 1P4XA 2V1DA 4A5MA 4IHTA 5L3GA 2RGVA 3K9TA 1LEBA 4ZH4F 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDM A;  4GO1 A;  2FU4 A;  4YFK F;  1ZHF A;  3DKW A;  1GHC A;  2P4W A;  1ZRD A;  4FHT A;  4HF0 A;  3HOS A;  3J80 Z;  1REP C;  1B1B A;  2FRH A;  4XLN F;  4M71 A;  4G7O F;  3FXQ A;  2VOD A;  2MLG A;  3K2Z A;  2DK8 A;  4FX4 A;  1O3T A;  2IA1 A;  5ILU A;  4P9F A;  3LWF A;  1H9G A;  4A0Y A;  3E5U A;  3BZ6 A;  2H94 A;  3V8K A;  3E97 A;  2HFH A;  4ESB A;  4YII A;  2XUB A;  1OKR A;  1YW9 A;  4RAY A;  1H9T A;  5D8K B;  2QM3 A;  2D2W A;  2QQA A;  2HOE A;  1YTY A;  5CYV A;  2NNY A;  2A07 F;  1UCR A;  3I4P A;  4MTE A;  5E20 A;  4WXH A;  4A0X A;  1B9N A;  1I27 A;  1LB2 A;  4IXA A;  4L9N A;  2Q2E A;  1TQP A;  4MHG A;  4IRI A;  4L9V A;  4U0W A;  3GYH X;  4G8X A;  2BYV E;  3ULQ B;  3F8B A;  4EM2 A;  4I0B A;  2HQR A;  4L9J A;  4RB1 A;  4UVC A;  3F21 A;  2YSR A;  3ELK A;  2W57 A;  1W4M A;  2P5V A;  5E1X A;  2XRN A;  4AIH A;  1O7L A;  1B59 A;  4NB5 A;  2RN7 A;  3TO9 A;  3ZN0 A;  1TQM A;  3QAH A;  2CGP A;  2QQ9 A;  2FA5 A;  1QPM A;  5DUK A;  3KLO A;  5F1R A;  3GX4 X;  1RI7 A;  3NEU A;  5ICG A;  4N9H A;  3TGN A;  1FBS A;  3OV8 A;  2VC1 A;  4EGZ A;  1K7A A;  1SFE A;  5LHI A;  2DW4 A;  2DTR A;  5DCM B;  5K1Y A;  4OMZ A;  5FLX Z;  3KLN A;  1O3R A;  1IN5 A;  1OMI A;  3JAM K;  1LQ1 A;  3F6O A;  4P96 A;  4GCV A;  1FPQ A;  4GXO A;  2RNJ A;  2EFP A;  5D8L B;  3EET A;  4ZYG A;  2JPC A;  2FOK A;  3DPT A;  1LJ9 A;  3KEO A;  4G6D A;  3WU0 A;  4IRH A;  2EWN A;  2W25 A;  1XMK A;  3RYP A;  4HQM A;  2XAH A;  3TDU C;  1KU9 A;  1UHM A;  3TQN A;  5IT3 A;  3LQR A;  3SFZ A;  3TOB A;  3MAJ A;  5FB2 A;  1OYI A;  5IT9 K;  1KYZ A;  1WQ2 A;  1BIB A;  2A61 A;  4L0Z B;  2KIU A;  2OD5 A;  1T38 A;  3RYR A;  1Y0U A;  1OYY A;  5CVR A;  1QO0 D;  2HGC A;  3O2P E;  2IA0 A;  4M73 A;  2DPD A;  5ICC A;  3LAJ A;  3HIF A;  3VFZ A;  5LHH A;  1MZB A;  4ENJ A;  2HS5 A;  1OPC A;  3H3U A;  1QBJ A;  3T1B A;  3U9G A;  2ISZ A;  2R7F A;  2DQL A;  1P92 A;  3RJP A;  3WU1 B;  2XAG A;  5FD5 A;  4LG0 A;  1A04 A;  2A68 F;  2HQN A;  4PZJ A;  1BI1 A;  3J80 K;  4LK0 F;  3RKX A;  3WTW C;  1KQ9 A;  3RKY A;  3PQJ A;  3C1D A;  1B9M A;  5TRD A;  4XLP F;  1T6S A;  1U2W A;  3QRF F;  4ZYD A;  2CSO A;  4L5J A;  4O6J A;  2A6E F;  5LGT A;  2DPU A;  4ESJ A;  1XGM A;  3TKY A;  5L3C A;  2PMH A;  5DD8 A;  4K2E A;  2MLK A;  2VXZ A;  3BY6 A;  2CO5 A;  2QBY B;  1J5Y A;  4BH9 A;  2VOO A;  1SD5 A;  3EUH A;  1H0M A;  2RDP A;  2XAF A;  2RV8 A;  2F5E A;  4NHJ A;  2W24 A;  3KP3 A;  4S05 A;  3E6M A;  1KA8 A;  3DV8 A;  4R79 A;  3N4M A;  2XAJ A;  2JZY A;  3KP7 A;  4I98 B;  2STT A;  4UNO A;  1BOA A;  1T39 A;  1YS6 A;  2Q8K A;  3WG9 A;  1ZGJ A;  1J75 A;  3BRO A;  1XDS A;  2H27 A;  1JHF A;  3CJN A;  2HTS A;  2X0L A;  1YW7 A;  1FYL A;  2WV0 A;  1F1Z A;  1BIA A;  2IP2 A;  3RTR A;  4ETS A;  5FD6 A;  5E1W A;  3IRQ A;  1UB9 A;  4HBL A;  5HS7 A;  3KP6 A;  4P9U A;  2PFB A;  1IN4 A;  1YG2 A;  3RPQ A;  3BJA A;  2GIV A;  1W7P B;  4CXF A;  2EV0 A;  1SAX A;  4A6D A;  3PQK A;  3F8F A;  2BGC A;  2EJR A;  2LSO A;  1XGN A;  5JHU A;  1HKQ A;  1P2F A;  1R23 A;  1Z91 A;  2YU3 A;  3MZY A;  4MQV A;  4YFX F;  5H6R A;  3CUQ B;  4JQF A;  3F8N A;  3I53 A;  3EQL F;  4HF1 A;  2E7X A;  3U2R A;  3I5U A;  3EYY A;  1TNS A;  5HS8 A;  2O03 A;  4AD9 A;  2H6C A;  1KQ8 A;  2NYX A;  2FE3 A;  4G7H F;  4WCG A;  3RPU A;  3K69 A;  1FC3 A;  3E5Q A;  3ISP A;  3QP5 A;  3GZ6 A;  2CW0 F;  3JAM Z;  4BNC A;  1IXR C;  1L3L A;  1AOY A;  1KGS A;  1LDK B;  2PEX A;  3AAF A;  2IT0 A;  4KFC A;  3BJ6 A;  4HYE A;  1J59 A;  1XDU A;  2HTJ A;  3B02 A;  2IRF G;  3EDP A;  2DT5 A;  2P5L C;  2ZFW A;  1XMA A;  2GA1 A;  1S7O A;  2Y75 A;  1P4W A;  1TNT A;  4WK8 F;  4Q5S F;  2L54 A;  2IVM A;  4M72 A;  4RS8 A;  4IPA A;  3HRU A;  5ERI A;  5FO5 A;  2PN6 A;  1SD6 A;  1J2X A;  1U5T B;  3IKV A;  3VB2 A;  4IVN A;  2HDC A;  1O3Q A;  2L4A A;  1PUE E;  1ZRC A;  1XGS A;  1J7K A;  1S3J A;  4EVI A;  4IRG A;  5IT9 Z;  3OOP A;  5BMZ A;  1ZGA A;  3IHU A;  4ON0 A;  2D45 A;  1IXC A;  4KIF A;  1ZN2 A;  2O3F A;  4GGG A;  3WE3 A;  2Z33 A;  2CYY A;  2QEN A;  1FBQ A;  3HRS A;  4PGG A;  5CJ9 A;  2QVO A;  5ILS A;  5LGU A;  5AON A;  3SZT A;  2K4B A;  4HDU A;  4LJZ F;  4A2U A;  2A69 F;  4CDG A;  3BDD A;  2FMY A;  3T5X A;  5D4R A;  4IJA A;  1FSE A;  5J8F A;  4ESF A;  1IXS B;  1FZP B;  4U0V A;  1LDD A;  1D5V A;  1OYW A;  1ZAO A;  1HKT A;  5FGM A;  2XKO A;  5F64 A;  4G6Q A;  5HOO A;  4EJT A;  2F5F A;  3D0S A;  3F6V A;  5LEK A;  1Z6R A;  3P7N A;  5LGN A;  2L01 A;  4L5I A;  1LEA A;  4P5O A;  4HOB A;  1G3Y A;  2BV6 A;  2KIM A;  3MZH A;  2QBY A;  3GFM A;  2P8T A;  2O6G E;  2HYF A;  2D1H A;  2BEO A;  2WTE A;  2MC3 A;  2FF4 A;  2UWM A;  5AIP A;  3IC7 A;  2XHK A;  4U7D A;  1JXS A;  4EJO A;  4ZYE A;  2QYO A;  2DK5 A;  4ENN A;  4O3M A;  4EJU A;  1XB4 A;  5D5U B;  3M1E A;  3QU3 A;  3R60 A;  2GWR A;  3BJO A;  2R3S A;  3KZZ A;  1S7A A;  4U88 A;  1IZ1 A;  4M9S A;  3DF8 A;  1LVA A;  3L9F A;  1U8R A;  2V6C A;  2ZME A;  3NRV A;  3F22 A;  5D5X B;  4HW0 A;  1IAW A;  4HQE A;  3F8M A;  4XSX F;  2P5K A;  2FML A;  2CFX A;  1WI9 A;  1D8J A;  2XVC A;  4Q48 A;  4H0E A;  3CTA A;  3V8J A;  1O57 A;  2PMU A;  4UVA A;  1ZLK A;  5E18 F;  2HKO A;  3LQQ A;  3I59 B;  4UVB A;  3R6S A;  1FYM A;  1FP1 D;  3CUO A;  4BQA A;  3KCC A;  2PLY A;  3V4G A;  4MGR A;  1E17 A;  1HQC A;  3LST A;  3CLO A;  3K0L A;  3TOA A;  2OA4 A;  3DPL C;  3ZQ7 A;  3M9A A;  1ZG3 A;  3QPT A;  4AWX B;  2GZW A;  1IN6 A;  1T0F A;  3LA2 A;  5DD4 A;  3GF2 A;  2ZNZ A;  1RNL A;  1F4K A;  2E1C A;  2EB7 A;  4EJW A;  2OAZ A;  2KKO A;  1EH7 A;  4BHC A;  2QWW A;  2KJC A;  4OIR F;  3G73 A;  1G3S A;  3RIR A;  3WTS C;  3C7J A;  1G3W A;  1WKM A;  4E70 A;  3TO6 A;  5DDG A;  4EJV A;  1FLI A;  5ICF A;  3WTY C;  2HEO A;  2DO7 A;  4LMY A;  4I09 A;  2Z3Y A;  2P7V B;  3ECH A;  2DU9 A;  1F9N A;  2VBX A;  3DP7 A;  5D5V B;  1G3T A;  2M8E A;  1Z1D A;  2C6Y A;  1O3S A;  4YG2 F;  2P6S A;  3V7R A;  5HLI A;  3GW2 A;  1DPU A;  2GXG A;  4LB5 A;  4KIG A;  1X3U A;  2GXB A;  2WWY A;  1F5T A;  4OIQ F;  1KQ0 A;  2DAO A;  2ZBK A;  3R4K A;  2FBI A;  4PGH A;  2L3D A;  5CLS A;  2DFI A;  3E6D A;  3CO6 C;  2ESN A;  4KMF A;  3FF5 A;  3KFW X;  3NQO A;  3IWZ A;  4XSZ F;  2V79 A;  4ASN A;  1ZG5 A;  1K78 B;  4UV9 A;  2RQP A;  3C18 A;  4YIF A;  4CIC A;  1R7J A;  3SQN A;  2QUF A;  4OIP F;  4P55 A;  3TDZ C;  1BM9 A;  1TLH B;  2Z99 A;  1C0W A;  2HKX A;  1YS7 A;  4R8H A;  3FXU A;  3KZY A;  4IF4 A;  3ZPL A;  2VBY A;  5H20 A;  1XSD A;  4L9T A;  2VOP A;  2QZ8 A;  4HX7 A;  2DBB A;  2DI3 A;  1ZG1 A;  2CWE A;  1I6X A;  4HA8 A;  5KVR A;  1J9I A;  3ZMZ A;  4A0Z A;  1VTN C;  1EH6 A;  5LLQ A;  4LLL A;  1LDJ A;  4D0P A;  4HX8 A;  4KDP A;  4KYW A;  2Y48 A;  5D4S A;  1HW5 A;  3MWM A;  2F5C A;  1KU2 A;  2HZT A;  4A6E A;  4Q4Z F;  1MDM B;  1R22 A;  2CG4 A;  3GLX A;  2FNA A;  1XCV A;  2Z5U A;  3IRR A;  4U7B A;  4UHT A;  3E5X A;  3ABT A;  2OU2 A;  5DV5 A;  1HXD A;  4CZZ A;  3C3W A;  4ZYH A;  5D6F A;  1MJ9 A;  2K02 A;  2A3S A;  4Q47 A;  1YQA A;  1QQI A;  1TW2 A;  1P6R A;  3KE2 A;  4RB2 C;  2GQQ A;  2VON A;  3D5L A;  4OOI A;  1L0O C;  2VE9 A;  2HYG D;  1ZH5 A;  4WXD A;  1ZRE A;  2LNB A;  1MGT A;  2M1B A;  1R1V A;  4FT8 A;  3SXY A;  1HSJ A;  2IW5 A;  2J5P A;  1ZLJ A;  2VBZ A;  3G3Z A;  2O0Y A;  2XRO A;  3E6B A;  1DPR A;  3GFJ A;  1T98 A;  4HZF A;  1ZYR F;  1ON2 A;  1S6L A;  3Q9S A;  1IRG A;  2EV5 A;  5BPI A;  1BN5 A;  3LFK A;  2NS0 A;  4LB6 B;  4KUM A;  1UST A;  5DCM A;  2R7D A;  1U78 A;  3T8T A;  2V9V A;  3I54 A;  3REO A;  3ZMV A;  2KIF A;  2YR2 A;  4ZZD A;  2MH2 A;  2B0L A;  2M5W A;  4LGW A;  5CVJ A;  3K1M A;  4N9I A;  1XD7 A;  2E1N A;  1YLF A;  3Q9V A;  3TO7 A;  3KET A;  1YW8 A;  5L3F A;  1TBX A;  4LFU A;  2VE8 A;  1YO5 C;  3H92 A;  4OIO F;  2ZCW A;  3QP6 A;  1D8K A;  1XGO A;  3BP8 A;  1IRF A;  1FBU A;  3P9K A;  2XKP A;  3L09 A;  1RIO H;  2E7W A;  4M6Y A;  2OBP A;  3SHF A;  3I0T A;  1FY7 A;  1QZY A;  5DYM A;  4AVP A;  3WOD F;  3K1N A;  5J6X A;  1I1S A;  3MQ0 A;  1RUO A;  4I0A A;  1WSU A;  1DDN A;  3FXR A;  4XBF A;  2EFO A;  1XSV A;  2Z9O A;  1BI2 A;  3ZMU A;  2JSC A;  4LK1 F;  2FBH A;  5EEG A;  1Q1H A;  2ZKZ A;  3HHG A;  2P6T A;  3M7G A;  3FMR A;  4M74 A;  4L0Y B;  1ZAR A;  4ENK A;  2NNN A;  5LHG A;  1YFH A;  2H6B A;  2AS5 F;  1W5S A;  2ZXJ A;  4A12 A;  2PQ8 A;  5L3D A;  2HWV A;  4KN7 X;  2ACJ A;  3LA7 A;  3N97 A;  3O3K A;  3ERE D;  3T8R A;  4WX9 A;  4KN4 X;  2M87 A;  1BJA A;  2W85 A;  5HDG A;  4DNC A;  1XN7 A;  5BQT A;  1TQI A;  3FZV A;  4KIC A;  4RAZ A;  5DEQ A;  2IJL A;  4HLY A;  4A5N A;  1BI3 A;  4LG0 B;  5DCF A;  5L3E A;  1NHA A;  1USS A;  2VBW A;  1FT9 A;  5HDK A;  3L7W A;  3HYI A;  5EEH A;  2VC0 A;  3JTG A;  1S8N A;  4MQ9 F;  2XGX A;  2XV4 S;  2ZNY A;  3ABU A;  3E3V A;  4UV8 A;  4B09 A;  4JK1 X;  1RZ4 A;  2EV6 A;  1MJA A;  2F2E A;  1R1T A;  3SZP A;  2EA4 A;  2M45 A;  2NRA C;  3RKW A;  1PP8 F;  2RVC A;  4EV0 A;  3QU6 A;  1CGP A;  4S04 A;  4N0B A;  1R00 A;  2PG4 A;  1BC7 C;  3FMS A;  2DLL A;  4WXC A;  3P9C A;  1XCB A;  5AIQ A;  3L00 A;  4CO8 A;  1GVJ A;  1JHH A;  4CHU A;  4HV6 A;  4M6X A;  3R61 A;  4LLN A;  3MCZ A;  3IL2 A;  3V8L A;  2YX7 A;  4PDK A;  2HR3 A;  4QWQ A;  2KJB A;  5JFR A;  4WF2 A;  5K5O A;  1ON1 A;  4ENM A;  2IPQ X;  2VT3 A;  4OU0 A;  1ZRF A;  1ODD A;  4B8X A;  2WC2 A;  1OR7 A;  5CVV A;  1FOK A;  3V7S A;  2L02 A;  3HTU A;  3FHZ A;  1SMT A;  1CF7 B;  1SFX A;  1WWX A;  3JSO A;  1W7P A;  2X4H A;  2ISY A;  3J7A O;  2A5Y B;  2K86 A;  1KYW A;  5TJJ A;  2ADU A;  2YX4 A;  4KA4 A;  3MEX A;  5JR3 A;  2V1U A;  4UUV A;  1SD4 A;  1WRJ A;  1B6A A;  4KIB A;  4BXU A;  3CUQ A;  2VN2 A;  3WGI A;  2UXN A;  3GEZ A;  3Q5F A;  1O7F A;  3W6K B;  5KK1 A;  5A2Q Z;  4EMS A;  2FQ3 A;  2LF7 A;  1HST A;  2K4J A;  3HOT A;  2ZJ2 A;  5FFZ A;  2OQG A;  3QOP A;  4IHS A;  1QZZ A;  2EA2 A;  3RDI A;  5K5Q A;  5LRR A;  1JE8 A;  1S29 A;  1YYV A;  3GFL A;  5E8I A;  3J81 K;  4EQQ A;  2PBI A;  3E6C C;  4LD5 A;  5HLG A;  1BI0 A;  3F3X A;  3QPH A;  1IUY A;  1K6O A;  1QGP A;  4NQW A;  1R1U A;  4HX4 A;  2YPR A;  3U1D A;  1UFM A;  3BOQ A;  4R1H A;  4XRF A;  3IKT A;  3DFG A;  1ULY A;  2BE5 F;  1JGS A;  5DUI A;  2XAS A;  2O61 A;  4GYG A;  3V7C A;  4BHB A;  5HS9 A;  2ZO4 A;  4UXN A;  2A6H F;  3M8E A;  4I02 A;  2J5O A;  3FWE A;  3VOE A;  5BPD A;  1IN8 A;  1U5T A;  3K1P A;  3RI4 A;  4CGZ A;  5E17 F;  3LA3 A;  4Z2Y A;  3WTV C;  4BAY A;  3ZN1 A;  4MEY F;  1Z9C A;  4RGR A;  3O6B B;  2G7H A;  4BHP A;  1Z05 A;  1Z6T A;  2FXA A;  5CVU A;  1TTY A;  2GAU A;  2O8X A;  4I01 A;  1SD7 A;  4QLC U;  3BWG A;  2P7C B;  1AWC A;  5FFX A;  4PCQ A;  1U3E M;  5F6F A;  3GUD A;  4O5V A;  3I58 A;  4RGX A;  3ZMS A;  1QNT A;  2L4M A;  4YFN F;  4MNU A;  1MJB A;  3GO5 A;  3FX3 A;  5HDN A;  5D6E A;  5L3B A;  3T0Y A;  1PDN C;  3HUG A;  2W84 A;  3P9I A;  2F5D A;  5J8C A;  4G94 A;  3GWZ A;  2MD5 A;  1G4D A;  2MA3 A;  2UZK A;  2EFQ A;  3I71 A;  1GXQ A;  2K7L A;  3MFK A;  3ROU A;  5CVI A;  5BS6 A;  3CDH A;  3DEU A;  3L2C A;  4F7Z A;  4KMU X;  1MD0 A;  1GXP A;  3KP2 A;  2FEZ A;  3WGG A;  3HRM A;  3WTZ A;  3ECO A;  1IW7 F;  4I2O A;  3S2W A;  3BPX A;  1DP7 P;  1FNN A;  3JSP A;  5D5W B;  3FMQ A;  3HTS B;  3BPV A;  1W5T A;  1B4A A;  3H3Z A;  3IWF A;  3FM5 A;  1HW2 A;  3FM3 A;  3HHH A;  1HKS A;  3HRT A;  1W7P D;  4HDV A;  3VEP A;  2G9W A;  3CUQ C;  3HSF A;  3WGH A;  2LF8 A;  2XIG A;  3VOD A;  5E8G A;  2COM A;  3CO7 C;  2QQB A;  3DXJ F;  4LLG F;  1D3Y A;  1T2K A;  3LAP A;  5ILV A;  2MBF A;  4WWC A;  3F8C A;  1TW3 A;  4FX0 A;  2DQR A;  1FP2 A;  4AIJ A;  3GXO A;  4GYI A;  6PAX A;  1G6N A;  1HW1 A;  2NAZ A;  4CYD A;  3GFI A;  4MTD A;  1FX7 A;  3KP4 A;  2EK5 A;  1CF7 A;  2VT2 A;  3I59 A;  3DQV C;  1IN7 A;  5E1Z B;  3WTT C;  1KU7 A;  1K79 A;  1IF1 A;  2TDX A;  2LKP A;  5A2Q K;  2RKH A;  3R0A A;  3HSE A;  1FSH A;  2ELH A;  5ED4 A;  2JT1 A;  4Y13 A;  2D1V A;  4MEX F;  2ZME B;  1E2X A;  1BBY A;  2V1X A;  1XSX A;  4EM1 A;  2EFN A;  2M30 A;  2RC4 A;  5FLX K;  4KT5 C;  1Z7U A;  1I1G A;  1FWZ A;  1EV7 A;  3KEQ A;  4M9Z A;  2IA2 A;  4JBA A;  1LNW A;  2OQR A;  3ZMT A;  3GVA A;  1UHW A;  2ETH A;  4HLX A;  1YIO A;  1U5T C;  1V4R A;  3HSR A;  3JW4 A;  1KU3 A;  4RGU A;  5LEJ A;  3B73 A;  1R36 A;  2FNP A;  1ONV A;  3WTU C;  2QLZ A;  1J0R A;  2FBK A;  2JTV A;  5JVT A;  4RGS A;  4L18 B;  2MH9 A;  2JPB A;  3I64 A;  4KNY A;  4DQ2 A;  4BYY A;  3M8F A;  2Y0M A;  3J81 Z;  3COA C;  4U0Y A;  1STZ A;  2GA2 A;  4RB3 C;  2KRF A;  2EFW A;  1R5G A;  3ZMD A;  1I5Z A;  1V3F A;  2ESH A;  4Y15 A;  2PI0 A;  3PFI A;  2BBY A;  3WTX C;  4EGY A;  3EYI A;  4Y17 A;  2LDU A;  4I7H A;  4G7Z F;  5K5R A;  2PJP A;  4TV7 A;  2JRT A;  4HAM A;  5LBQ A;  1SMY F;  3F72 A;  1PP7 U;  4OIN F;  3KP5 A;  5H6Q A;  2XAQ A;  3F23 A;  5BOX A;  5ICE A;  1K78 A;  3WE2 A;  4OMY A;  2CQK A;  5HLH A;  4AIK A;  1RUN A;  3GZ5 A;  2OZ6 A;  1DUX C;  3JTH A;  4HF2 A;  4ZZL A;  1SFU A;  2STW A;  4HV5 A;  2AXL A;  2G7U A;  2H09 A;  3ML6 A;  5LRS A;  2FSW A;  2OZU A;  1EH8 A;  1U6G A;  4RB0 A;  4G9Y A;  1R58 A;  1FYK A;  1HBX G;  1BC8 C;  2K27 A;  3W6J B;  5HVQ C;  1R5H A;  5JI6 A;  1P4A A;  4M9X A;  2Q0O A;  4EM0 B;  2UXX A;  3R0J A;  3ZP5 A;  1P4X A;  2V1D A;  4A5M A;  4IHT A;  5L3G A;  2RGV A;  3K9T A;  1LEB A;  4ZH4 F;  1MKM A; 
#chains in the Genus database with same CATH topology
 1UG2 A;  4G12 A;  1MDM A;  2XRL A;  4GO1 A;  2FU4 A;  4YFK F;  1ZHF A;  3ABK H;  3DKW A;  1TWC J;  1GHC A;  2P4W A;  1ZRD A;  2F5V A;  3QQA A;  2VJJ A;  4FHT A;  5B1A H;  4HF0 A;  3HOS A;  2E35 A;  4BJT A;  1TL8 A;  3J80 Z;  2LR8 A;  2Y31 A;  1REP C;  2VI6 A;  1B1B A;  2FRH A;  2B9S A;  1VQO I;  4XLN F;  2DFH A;  2XSD C;  3HPH A;  4E7H A;  3B6A A;  4M71 A;  4HNV A;  4G7O F;  4A3I J;  1ZK8 A;  3S1R J;  3FXQ A;  3OYA A;  3LSI A;  2VOD A;  2MLG A;  2Y69 H;  2AQF A;  4QPO A;  3K2Z A;  2DK8 A;  1LKX A;  4FX4 A;  1O3T A;  3D5R C;  2IA1 A;  5ILU A;  4P9F A;  3LWF A;  3IV5 A;  1H9G A;  4A0Y A;  3ZQL A;  3E5U A;  3BZ6 A;  1POG A;  1V5E A;  2H94 A;  2MFZ A;  3V8K A;  3E97 A;  2HFH A;  2BVM A;  2AHQ A;  1F43 A;  2FQ4 A;  4ESB A;  4YII A;  2XUB A;  1OKR A;  1YW9 A;  4RAY A;  1A36 A;  1K83 J;  1H9T A;  3TBI A;  3CF5 F;  5D8K B;  2QM3 A;  4M3B A;  2X1C A;  2L9S A;  2D2W A;  2QQA A;  2HOE A;  1YTY A;  5CYV A;  2NNY A;  2NS7 A;  2MG4 A;  1JI8 A;  1OIS A;  2A07 F;  1UCR A;  4IO9 F;  3I4P A;  4MTE A;  4JOM A;  5E20 A;  2CV1 A;  4WXH A;  1K61 A;  5IY5 H;  1UG0 A;  1T08 B;  4A0X A;  1LFP A;  3G6E I;  1B9N A;  2QSH X;  1I27 A;  1OQY A;  3FDY A;  5FKO A;  1I3Q J;  1YX3 A;  4IXA A;  1J09 A;  1LB2 A;  2B7E A;  4L9N A;  1VQN I;  1TWG J;  1TQP A;  2Q2E A;  4H4K C;  1P9Q C;  4MHG A;  4IRI A;  2ICW G;  4L9V A;  4U0W A;  3GYH X;  4G8X A;  2BYV E;  3ULQ B;  3L2U A;  4AM3 A;  4M3F A;  3F8B A;  4EM2 A;  4LIU A;  2LVS A;  1Y1V J;  1P7I A;  4I0B A;  2HQR A;  4L9J A;  2H1K A;  3BG9 A;  3FXJ A;  4RB1 A;  4UVC A;  2L0K A;  3ABL H;  1B72 A;  2XGC A;  3F21 A;  2JK3 A;  2KIS A;  2YSR A;  3ELK A;  4ZDL A;  2F4I A;  2W57 A;  3I4N J;  2R7O A;  1W4M A;  2P5V A;  5E1X A;  3S32 A;  2XRN A;  4AIH A;  2EIN H;  3LSJ A;  4FQG A;  2DCE A;  3JRC A;  1VQL I;  1O7L A;  1B59 A;  4NB5 A;  2RN7 A;  2HVQ A;  3TO9 A;  1TQM A;  3ZN0 A;  4DIQ A;  3CC7 I;  1G59 A;  2A5W A;  2DT6 A;  3QAH A;  2CGP A;  2M3A A;  3K4N A;  2QQ9 A;  2FA5 A;  1QU3 A;  1QPM A;  4IHW A;  5DUK A;  5J4V A;  3KLO A;  5F1R A;  2ZJQ F;  3GX4 X;  1RI7 A;  3NEU A;  5ICG A;  3IH3 A;  1Z0X A;  4N9H A;  2LBF B;  3TGN A;  2R92 J;  4HRI A;  2R5Z A;  4XLE A;  1FBS A;  3OV8 A;  3OYL A;  2VC1 A;  4D5F A;  4EGZ A;  1K7A A;  1SFE A;  4B44 A;  5LHI A;  2DW4 A;  2PX9 A;  2OUM A;  2DTR A;  5DCM B;  5K1Y A;  4OMZ A;  2XF7 A;  3GBG A;  3KLN A;  3M07 A;  5FLX Z;  5EZG A;  1IN5 A;  1O3R A;  2JUG A;  1OMI A;  3JAM K;  2E2H J;  2CQQ A;  1IRX A;  3OWT A;  1LQ1 A;  3BZC A;  1DGR M;  3F6O A;  1MNE A;  1TWA J;  2VUM J;  2O9L A;  1YHQ I;  1NK2 P;  4P96 A;  1VQ6 I;  4GCV A;  1FPQ A;  4GXO A;  3OYI A;  4F93 B;  2RNJ A;  2EFP A;  3PJR A;  2K9S A;  2K5C A;  5D8L B;  5JVG F;  3EET A;  2ME0 A;  4ZYG A;  2XB5 A;  2JPC A;  2JA6 J;  2FOK A;  3E1S A;  3RCO A;  4CCN A;  2WAD A;  3DPT A;  1A5J A;  2AO9 A;  4FE7 A;  1LJ9 A;  1SFO J;  3KEO A;  1WJA A;  3GTP J;  4G6D A;  3SDB A;  3WU0 A;  4IRH A;  5GAH J;  5E3M A;  3OIO A;  1JT6 A;  3G2B A;  3AG2 H;  2EWN A;  1IUF A;  1PVE A;  2W25 A;  3F9K A;  1YJ9 I;  2M2E A;  1GVD A;  1MSF C;  1X1D A;  1XMK A;  3RYP A;  2ZSI B;  1VND A;  4HQM A;  2XAH A;  3TDU C;  2LFB A;  2LP0 A;  1KU9 A;  4XN3 A;  1UHM A;  3CDI A;  3TQN A;  4X6A J;  4M3D A;  4IKF A;  3FIS A;  5IT3 A;  3LQR A;  3SFZ A;  3TOB A;  3ZQI A;  2M34 A;  1JTY A;  4YEJ A;  3MAJ A;  5FB2 A;  1A31 A;  2MAB A;  1OYI A;  3ZXS A;  2VAS A;  4A3B J;  5IT9 K;  1KYZ A;  2K9L A;  5GAE J;  3CCE I;  1NK3 P;  1WQ2 A;  1BIB A;  4N4O B;  1LPQ A;  2A61 A;  4IL6 C;  1WZ2 A;  1MBE A;  1WH7 A;  2KIU A;  4L0Z B;  2EZK A;  2OD5 A;  2QKM B;  4XIC A;  1T38 A;  4UY8 I;  2JN6 A;  5J4Y A;  4PSX A;  3RYR A;  1UEL B;  1X3Z B;  1Y0U A;  2LOO A;  3J7Z I;  1OYY A;  1MMG A;  3DEE A;  3HZJ A;  5CVR A;  1QO0 D;  2HGC A;  3HEF A;  4CCJ A;  3WHC A;  3UKG A;  2M0C A;  3O2P E;  2IA0 A;  4HNT A;  4BGD A;  4M73 A;  1ZR2 A;  2DPD A;  5ICC A;  3DTI A;  2WV1 A;  3LAJ A;  2CH0 A;  3HIF A;  1U9N A;  2MC4 A;  3VFZ A;  5LHH A;  3RSN A;  1R9T J;  1MZB A;  2Y2Z A;  2DJN A;  4ENJ A;  2HS5 A;  1OPC A;  3H3U A;  2QA4 I;  4C9Y A;  1QBJ A;  4DYQ A;  4XOT A;  2L9V A;  4E6K G;  2BW3 B;  3T1B A;  3U9G A;  2ISZ A;  2DA2 A;  3WHB A;  2R7F A;  2DQL A;  1P92 A;  3RJP A;  5FLM J;  2XAG A;  2VKH A;  3WU1 B;  2VJ5 A;  5FD5 A;  4LG0 A;  4BE2 A;  2FOW A;  1GUU A;  1JGG A;  3CCQ I;  5FKK A;  4GRI A;  3HC7 A;  1A04 A;  2A68 F;  2HQN A;  1ZR4 A;  4PZJ A;  1IV8 A;  1BI1 A;  3MKZ A;  1JJ6 C;  4U87 A;  3OYD A;  3K4C A;  2ZXI A;  3H5R A;  3FXM A;  2R7U A;  3J80 K;  4NBQ A;  1WVR A;  3HOV J;  4LK0 F;  3RKX A;  3WTW C;  5B1B H;  3H3V K;  1KQ9 A;  2CUE A;  4XR6 A;  3RKY A;  1ZEL A;  3S14 J;  3PQJ A;  3C1D A;  1B9M A;  5TRD A;  1OR7 C;  1TP4 A;  5J3L A;  4XLP F;  1Z67 A;  1T6S A;  1N78 A;  2KFD A;  4ZTF A;  2VPR A;  2CQ7 A;  1U2W A;  3HJE A;  3IP4 B;  2K85 A;  3QRF F;  4ZYD A;  3FKI J;  2CSO A;  3DCF A;  4L5J A;  4O6J A;  3OSG A;  2A6E F;  5LGT A;  2DPU A;  2KL4 A;  4ESJ A;  1XGM A;  3TKY A;  5B3S H;  2PMH A;  5L3C A;  3TP3 A;  5DM6 F;  2CQN A;  3O8G A;  5DD8 A;  4K2E A;  2AXT C;  2MLK A;  4IHX A;  3QWL A;  1SAN A;  2VXZ A;  1E0E A;  4CYC B;  2V9K A;  3BY6 A;  2JVG A;  3PL8 A;  2CO5 A;  2QBY B;  1J5Y A;  2W4S A;  4BH9 A;  4X1E A;  2VOO A;  3CD6 I;  1SD5 A;  2OCE A;  3EUH A;  1H0M A;  3JCU C;  2RDP A;  2XAF A;  2RV8 A;  2F5E A;  2QSG X;  4NHJ A;  2E34 A;  3TL4 X;  4D1Q A;  2W24 A;  1WH5 A;  4ITV A;  2VQH A;  3KP3 A;  1ENH A;  2KDO A;  4QTR A;  4S05 A;  3E6M A;  1KA8 A;  3P5J A;  3DV8 A;  4BXF A;  2VIX A;  3UR3 C;  2M9H A;  4R79 A;  3N4M A;  2XAJ A;  1FIP A;  1EF4 A;  3DPU A;  2JZY A;  3KP7 A;  4I98 B;  3PM1 A;  2EIL H;  2STT A;  4UNO A;  5CPR B;  1BOA A;  4BQO A;  5C4X J;  3OYJ A;  1T39 A;  1YS6 A;  1WHU A;  3TW7 A;  4P1W A;  2Q8K A;  3WG9 A;  4XM3 A;  1ZGJ A;  1J75 A;  2DA4 A;  3BRO A;  1XDS A;  4MLO A;  1JHF A;  2JSP A;  2H27 A;  3CJN A;  2E71 A;  2HTS A;  2KMU A;  1XTA A;  2X0L A;  1YW7 A;  1R71 A;  4BEH A;  3A1Y A;  1FYL A;  2YS9 A;  3BC8 A;  2WV0 A;  1F1Z A;  1BIA A;  3CCU I;  2IP2 A;  4J00 A;  3RTR A;  4ETS A;  2CUZ A;  5FD6 A;  2DMQ A;  5E1W A;  3ZQC A;  3DWL E;  3Q0W A;  4PJL A;  1PUF B;  5E3O A;  2JMW A;  1UB9 A;  3IRQ A;  4HBL A;  5HS7 A;  3KP6 A;  4P9U A;  3A01 B;  1WJC A;  1IN4 A;  2PFB A;  3JRF A;  2KDZ A;  1YG2 A;  3RPQ A;  2R7Q A;  3BJA A;  5FKM A;  2GIV A;  1TT5 B;  1W7P B;  4CXF A;  2EV0 A;  2OTJ I;  1SAX A;  4A6D A;  1QVT A;  3F8F A;  3PQK A;  2BGC A;  4QSH A;  2EJR A;  2LBF A;  2LSO A;  1QVU A;  1XGN A;  3HOZ J;  1NG7 A;  4V2G A;  4RM2 A;  3ZRG A;  2W7N A;  3J7Y J;  5JHU A;  1HKQ A;  1P2F A;  3ZQH A;  1R23 A;  3HOX J;  3CMM A;  1Z91 A;  4S0H B;  2KT0 A;  2YU3 A;  3MZY A;  4MQV A;  1EKE A;  4YFX F;  5H6R A;  3CUQ B;  4JQF A;  1X58 A;  2JRM A;  3F8N A;  4RAG A;  3I53 A;  1WGX A;  3EQL F;  1MBH A;  3F0C A;  4LOC A;  4HF1 A;  2JQ7 A;  2ELJ A;  1TC3 C;  2E7X A;  2KIQ A;  2EZL A;  2VKV A;  3LSM A;  3U2R A;  3BG3 A;  2BZT A;  1VFC A;  3I5U A;  1MBK A;  3A0H C;  3EYY A;  2ELK A;  2OPT A;  1TNS A;  5HS8 A;  2O03 A;  2H8W A;  3MZ8 A;  2H6C A;  4AD9 A;  1KQ8 A;  2NYX A;  2CMP A;  3H35 A;  2FE3 A;  4G7H F;  4WCG A;  3RPU A;  4DOZ A;  3AG4 H;  3K69 A;  1FC3 A;  3E5Q A;  3ISP A;  3QP5 A;  3GZ6 A;  3BTC A;  4HPQ A;  4XRM A;  5J40 A;  2CW0 F;  3JAM Z;  4DYR A;  4BNC A;  1E3P A;  1IXR C;  2A6T A;  1L3L A;  1AOY A;  1KGS A;  1D1A A;  1LDK B;  5EDN A;  2YUS A;  2PEX A;  2LC2 A;  3AAF A;  2QQ8 A;  2IT0 A;  4FCY A;  4KFC A;  3BJ6 A;  4BE0 A;  4HYE A;  5K7Z A;  1J59 A;  1XDU A;  3MKY B;  3BQY A;  2HTJ A;  3B02 A;  2GOX B;  2IRF G;  4W97 A;  3EDP A;  2E2I J;  4NQW B;  1ETQ A;  2DT5 A;  4YEL A;  2P5L C;  3H5N A;  2BY3 A;  2ZFW A;  2ZXW H;  1XMA A;  2GA1 A;  1S7O A;  2JA2 A;  3D5S C;  5M5X J;  2Y75 A;  1P4W A;  3K4K A;  3QPS A;  1TNT A;  4WK8 F;  3FHN A;  2VLA A;  4AC0 A;  4Q5S F;  2EBI A;  2L54 A;  3K6G A;  2IVM A;  2N8G A;  3K4B A;  3TED A;  4M72 A;  1FJL A;  2MSY A;  4RS8 A;  5EG0 B;  4IPA A;  2XAU A;  3HRU A;  5ERI A;  5FO5 A;  3CDL A;  2LY1 A;  2PN6 A;  1SD6 A;  1Z21 A;  2EIJ H;  1J2X A;  2VB6 A;  1G2H A;  1U5T B;  2KRH A;  1H89 C;  2O8K A;  3AKZ A;  4F92 B;  3IKV A;  3VB2 A;  1W0T A;  5F27 A;  4IVN A;  1FOW A;  2HDC A;  1O3Q A;  2L4A A;  1PUE E;  1ZRC A;  2K9M A;  1XGS A;  1J7K A;  1ZQ3 P;  1S3J A;  4EVI A;  4IRG A;  5IT9 Z;  3OOP A;  4PJM A;  3SYT A;  1ZGA A;  3IHU A;  4ON0 A;  5BMZ A;  2D45 A;  1IXC A;  4KIF A;  2M4G A;  3LSK A;  3OS2 A;  1ZN2 A;  4RDU A;  3FK6 A;  4DZJ A;  1HOM A;  1LUJ B;  2BW3 A;  3WG7 H;  5J47 A;  2IGK A;  2O3F A;  1U0J A;  3FIW A;  5J1U A;  2LLK A;  3BTL A;  4GGG A;  3WE3 A;  2Z33 A;  2CYY A;  2XF5 A;  2QEN A;  5M3F J;  3ZGK A;  1FBQ A;  2IS2 A;  1GLN A;  4BE1 A;  3HRS A;  4PGG A;  4UB6 C;  5CJ9 A;  2QVO A;  3OYB A;  3EUH C;  5ILS A;  5LGU A;  2R7R A;  5AON A;  3SZT A;  1RKW A;  2K4B A;  4HDU A;  1HA8 A;  3FKJ A;  2HNH A;  2DDA A;  4LJZ F;  1AHD P;  4A2U A;  5J1Y A;  3HUG B;  2A69 F;  4CDG A;  3BDD A;  2LY2 A;  2FMY A;  3T5X A;  5D4R A;  4IJA A;  1M1E B;  1MBJ A;  5KNL A;  1FSE A;  5J8F A;  1RR8 C;  4ESF A;  4II3 A;  4AID A;  1IXS B;  1MMS A;  1FZP B;  3BCA A;  1MIJ A;  1MND A;  2DA7 A;  4U0V A;  1UAA A;  2CW7 A;  1LDD A;  1D5V A;  1OYW A;  1ZAO A;  1SEU A;  3MN2 A;  4I76 A;  1HKT A;  2VKD A;  4C2M J;  4GFB A;  5FGM A;  2AQE A;  2XKO A;  1T95 A;  5F64 A;  4G6Q A;  5HOO A;  2E1M C;  3DKY A;  2F5F A;  4EJT A;  2BHY A;  3UNG C;  2V9P A;  3MMY B;  3D0S A;  3F6V A;  5LEK A;  1Z6R A;  3P7N A;  5LGN A;  4DBQ A;  1XMX A;  2L01 A;  4L5I A;  1BW6 A;  3A03 A;  4EEF G;  1LEA A;  4P5O A;  1WFX A;  4HOB A;  4CYC A;  2Y9Y A;  1LFU P;  1SVM A;  1G3Y A;  2BV6 A;  2KIM A;  3MZH A;  4ZYA A;  1JKR C;  3S1M J;  3LSP A;  2QBY A;  3CCL I;  2X1E A;  2DTZ A;  3GFM A;  2R5Y A;  2P8T A;  1YIT I;  1GT0 C;  2VL8 A;  2O6G E;  2HYF A;  2D1H A;  2BEO A;  3HM5 A;  2WTE A;  2OC6 A;  3KYC B;  2O7O A;  1AU7 A;  2MC3 A;  2FF4 A;  3AG3 H;  2UWM A;  3N05 A;  2JA7 J;  5AIP A;  2JWT A;  4Y33 A;  1OCO H;  2XHK A;  3IC7 A;  4A93 J;  2LTP A;  3W6V A;  1FTZ A;  1ETW A;  3BTI A;  5DTD A;  4U7D A;  4MFE A;  3I4M J;  1Y8R B;  1JXS A;  2OJE D;  3CCJ I;  1NTC A;  4EJO A;  4ZYE A;  2QYO A;  3LL7 A;  2EPF A;  2DK5 A;  4ENN A;  3NAU A;  4O3M A;  4EJU A;  1XB4 A;  1BL0 A;  5D5U B;  4OAZ A;  3DBR B;  2NVT J;  3M1E A;  4HNU A;  3QU3 A;  3R60 A;  3RKQ A;  2GWR A;  3PSF A;  3BJO A;  5E79 C;  2L7F P;  2R3S A;  2M4K A;  4HSR A;  3CP8 A;  3KZZ A;  4EAT A;  4OWR B;  1B8I B;  1ITY A;  1S7A A;  4U88 A;  2KPM A;  3ZR8 X;  1IZ1 A;  3CCY A;  4XLC A;  1HLV A;  4M9S A;  3DF8 A;  1LVA A;  2XSJ C;  1SVL A;  3L9F A;  4CH7 A;  4JX6 A;  1U8R A;  2V6C A;  3S3N A;  1K4S A;  2ZME A;  4NDL A;  1JT0 A;  3NRV A;  3F22 A;  5D5X B;  4HW0 A;  2WBM A;  4A3M J;  1IAW A;  2DA3 A;  2EQR A;  4HQE A;  3F8M A;  2CQX A;  3KX2 A;  4CZC A;  2E36 A;  4D7M A;  4XSX F;  5IYB J;  2P5K A;  1IGN A;  4E7S A;  2MD0 A;  2FML A;  3A0B C;  3A01 A;  2M0M A;  2CFX A;  1WI9 A;  4GDF A;  3HL2 A;  1WCM J;  2XVC A;  1D8J A;  4Q48 A;  1ZKG A;  4H0E A;  3CTA A;  3V8J A;  1O57 A;  2PMU A;  3DTE A;  3CLQ A;  4UVA A;  1ZLK A;  3H9J A;  5E18 F;  2HKO A;  3LQQ A;  1X4P A;  1LE8 A;  3I59 B;  4UVB A;  1RES A;  2WA0 A;  3R6S A;  2V7F A;  3RPU D;  4A3F J;  1FYM A;  1FP1 D;  3GME A;  4D9J A;  3CUO A;  3JR9 A;  1OFC X;  4BQA A;  5GPA A;  4L5E A;  3KCC A;  3QOE A;  2PLY A;  3V4G A;  4Y52 J;  1BOB A;  4MGR A;  1E17 A;  4ABZ A;  5HNF A;  1ETO A;  1HQC A;  2HXI A;  3LST A;  3SZG A;  4ZDP A;  3CLO A;  3L1P A;  3K0L A;  3TOA A;  5C4J J;  2OA4 A;  2ZB9 A;  3OYK A;  3DPL C;  3CZ6 A;  2LG4 A;  3NAR A;  3ZQ7 A;  3M9A A;  1ZG3 A;  3QPT A;  4AWX B;  2M7A A;  2GZW A;  1IN6 A;  1T0F A;  4CSW A;  3W3C A;  1K6Y A;  3OL4 A;  3H36 A;  1T8I A;  3U1K A;  2Q1Z B;  3S8P A;  5TGT A;  3LA2 A;  3IUO A;  4J01 A;  5DD4 A;  1AKH A;  1SVO A;  3GF2 A;  3OR2 C;  1EA3 A;  4II2 A;  3OYM A;  2ZNZ A;  1RNL A;  1F4K A;  2E1C A;  2EB7 A;  2NVU B;  4XOR A;  4EJW A;  4E7K A;  3CMY A;  5HOD A;  2OAZ A;  2KKO A;  5GTH C;  1EH7 A;  3CF2 A;  4BHC A;  2ECB A;  2QWW A;  2KJC A;  2HXO A;  4OIR F;  3G73 A;  1G3S A;  3RIR A;  3WTS C;  3C7J A;  1G3W A;  1OCP A;  1OCC H;  1WKM A;  4E70 A;  1SFK A;  1IC8 A;  4IEJ A;  3TO6 A;  5DDG A;  4EJV A;  1FLI A;  2K9N A;  5ICF A;  3WTY C;  2HEO A;  2DO7 A;  4FE4 A;  3GTQ J;  4LMY A;  1VQ7 I;  1I50 J;  4I09 A;  2Z3Y A;  3RZO J;  1VQM I;  1DU0 A;  2P7V B;  3ECH A;  3MKW B;  2DU9 A;  1Y1W J;  1W36 D;  2XGE A;  2R0Q C;  3CJR B;  2DA6 A;  2DN0 A;  2EIK H;  1F9N A;  2VBX A;  3DP7 A;  1XX5 A;  2CUF A;  1D5Y A;  5D5V B;  2M8E A;  1G3T A;  1Z1D A;  1SAU A;  4UUS B;  2C6Y A;  3O8H A;  2NOJ B;  4YG2 F;  1O3S A;  2P6S A;  3V7R A;  5HLI A;  3GW2 A;  3GTM J;  1DPU A;  1MW7 A;  4QIW N;  2GXG A;  1RRJ A;  4LB5 A;  4F52 A;  1JKP C;  4KIG A;  3EUK L;  4BJ5 C;  2E2J J;  2H8R A;  1X3U A;  1MMD A;  2QF7 A;  2GXB A;  2WWY A;  3G1O A;  1F5T A;  2RAE A;  4OIQ F;  4ZJZ A;  1S9H A;  2BHZ A;  3OYC A;  1KQ0 A;  2DAO A;  2R7T A;  1JUM A;  4OAY A;  4PJN A;  1R4M B;  2O5R A;  2ZBK A;  3R4K A;  2FBI A;  1S5L C;  2DA1 A;  2L3D A;  4PGH A;  5CLS A;  1V54 H;  5F1J A;  2DFI A;  4V2F A;  3E6D A;  3HPG A;  3CO6 C;  2ESN A;  3OR1 C;  2IS1 A;  2I5U A;  3KYL A;  1Y6I A;  4KMF A;  1YRN A;  2NVY J;  3FF5 A;  3KFW X;  3NQO A;  2MGQ A;  1FMW A;  3IWZ A;  4XSZ F;  2V79 A;  4ASN A;  1ZG5 A;  1TWF J;  1K78 B;  4UV9 A;  1MMN A;  2RQP A;  3C18 A;  4YIF A;  4CIC A;  1R7J A;  3SQN A;  2QUF A;  3S1Q J;  4J19 A;  3EUA A;  4PK4 A;  3ABM H;  4P55 A;  4OIP F;  3TDZ C;  1S7E A;  3K70 C;  5H2F C;  2L2O A;  1BM9 A;  2NOG A;  1TLH B;  3LOC A;  1YJW I;  2K40 A;  2Z99 A;  4IQ4 A;  1C0W A;  5EGO B;  3QOD A;  2HKX A;  1YS7 A;  4XLA A;  4R8H A;  3JRH A;  3FXU A;  3KZY A;  2P0W A;  3U21 A;  4IF4 A;  2V6E A;  2VBY A;  3ZPL A;  5H20 A;  3GTG J;  4A3L J;  1XSD A;  2M8G X;  2F48 A;  1FOY A;  3K70 D;  4JYK A;  4L9T A;  5FKN A;  2VOP A;  2FD5 A;  2QZ8 A;  4NC8 A;  1DQU A;  4HX7 A;  5KAF C;  1X1C A;  2DBB A;  2DI3 A;  2XGD A;  1ZG1 A;  1FOX A;  2CWE A;  2TCT A;  1I6X A;  3HG9 A;  4HA8 A;  3KIO A;  5KVR A;  1J9I A;  4JP0 A;  3ZMZ A;  4A0Z A;  1VTN C;  1EH6 A;  2XPV A;  3FXO A;  5LLQ A;  4LLL A;  1RKT A;  1LDJ A;  5EZH A;  5GPC A;  4D0P A;  2ZME C;  4CA0 A;  4HX8 A;  4RM3 A;  4XKC A;  4KDP A;  4BJ6 C;  3LFU A;  4KYW A;  2QEX I;  2Y48 A;  3HBL A;  5D4S A;  1HW5 A;  2DFE A;  3MWM A;  2F5C A;  1KU2 A;  4RAF A;  2HZT A;  5GAD J;  4A6E A;  4Q4Z F;  5KHD A;  3M8J A;  3DTK A;  1MDM B;  1RET A;  4I6Z A;  3CME I;  3DBH B;  1E3H A;  1IDZ A;  1R22 A;  2CG4 A;  2TRT A;  1Z3X A;  4F3Q A;  1JKQ C;  1HCR A;  5EF6 A;  3ASN H;  2DXI A;  1NH3 A;  3GLX A;  3BTJ A;  1PYV A;  3H0D A;  2FNA A;  3PUB A;  1XCV A;  2Z5U A;  3IRR A;  4U7B A;  4UHT A;  3E5X A;  3ABT A;  2OU2 A;  3A02 A;  2FJ1 A;  5DV5 A;  1IDY A;  3CC2 I;  1HXD A;  4CZZ A;  2EZI A;  3OYG A;  3C3W A;  3ZOB A;  1VQK I;  3PSI A;  4ZYH A;  3OYF A;  5D6F A;  1MJ9 A;  3AL0 C;  4ZDO A;  2IS4 A;  3EPZ A;  2B63 J;  2K02 A;  2A3S A;  2WAQ N;  1VQ9 I;  4A3K J;  1D0X A;  4Q47 A;  1YQA A;  3LSH A;  1QQI A;  1T0F C;  1TW2 A;  1LVK A;  1P6R A;  3KE2 A;  4QPQ A;  2IBD A;  4W1U A;  4RB2 C;  2GQQ A;  1D1B A;  2VON A;  3D5L A;  4OOI A;  1L0O C;  2VE9 A;  2HYG D;  1ZH5 A;  4B43 A;  4I99 C;  3I9V 2;  4WXD A;  4Y7N J;  1OCT C;  1ZRE A;  4Y4R A;  2LNB A;  1MGT A;  1VQP I;  1X2M A;  3Q0V A;  2M1B A;  1RC9 A;  5K7F A;  1R1V A;  1D0Z A;  4FT8 A;  4IOA F;  5HLT A;  3SXY A;  1HSJ A;  3M4O J;  2IW5 A;  1UHS A;  4B47 A;  2J5P A;  1ZLJ A;  2VBZ A;  2ZJP F;  4KIS A;  3G3Z A;  2O0Y A;  2Q2E B;  2XRO A;  3E6B A;  2E5N A;  1DPR A;  2HDD A;  3GFJ A;  1T98 A;  4HZF A;  1YX5 A;  3BR2 A;  1ZYR F;  1ON2 A;  2X85 A;  1S6L A;  2XPU A;  3Q9S A;  5FJ8 J;  1CQT A;  1D1C A;  3G4S I;  1IRG A;  4HST A;  1B72 B;  2EV5 A;  3NWS A;  5BPI A;  1BN5 A;  3LFK A;  4PJJ A;  1W0U A;  2NS0 A;  4LB6 B;  4KUM A;  3IH4 A;  1UST A;  5DCM A;  2R7D A;  1U78 A;  2NVQ J;  4XON A;  2PJR B;  2F6C A;  2QGU A;  2DDB A;  3T8T A;  2V9V A;  3VYU B;  1BA5 A;  2CW8 A;  3I54 A;  3REO A;  3ZMV A;  4RLF A;  2KIF A;  2EZH A;  2YR2 A;  4ZZD A;  2ZSH B;  2MH2 A;  2B0L A;  2M5W A;  3BG7 A;  1GDT A;  4LGW A;  5CVJ A;  3K1M A;  1WJD A;  1X1A A;  1APL C;  4N9I A;  2CV0 A;  3OS1 A;  2W1O A;  2LD5 A;  1XD7 A;  4MO7 A;  1O4X A;  4XKV A;  2E1N A;  2VJ4 A;  2XPW A;  2Z2S B;  5FRM A;  1YLF A;  3Q9V A;  3NWT A;  1R5I D;  3TO7 A;  3KET A;  1YW8 A;  5L3F A;  2R5Z B;  3VYS B;  1TBX A;  4LFU A;  3HXL A;  2VE8 A;  3SDG A;  1YO5 C;  3LNQ A;  1QPI A;  1JKO C;  3H92 A;  3W2W A;  5F0C A;  4AYB N;  2W00 A;  3GTJ J;  4OIO F;  3JRD A;  2ZCW A;  3QP6 A;  1D8K A;  1A35 A;  1XGO A;  3BP8 A;  1IRF A;  3PIO F;  3E0J B;  1FBU A;  2L9N A;  3P9K A;  2XKP A;  3CCR I;  3L09 A;  1RIO H;  2CV2 A;  2F4M B;  2E7W A;  4M6Y A;  2OBP A;  3SHF A;  3I0T A;  1FY7 A;  4MFD A;  1QHG A;  3S17 J;  1QZY A;  2WAQ A;  5FRO A;  5DYM A;  3CCM I;  4BY7 J;  2DOE A;  1JJ8 C;  2DMU A;  5JLW A;  4AVP A;  2K3F A;  1N77 A;  3KPH A;  2CJJ A;  3BR0 A;  1QZE A;  2LMD A;  3OOU A;  1IRZ A;  5K7H A;  3S16 J;  5IYD J;  3WOD F;  3K1N A;  3L2W A;  3CMA I;  5J6X A;  3CQZ J;  1I1S A;  3MQ0 A;  1A6I A;  4BDZ A;  4UUT A;  4JX5 A;  2LRE A;  2X51 A;  1RUO A;  4I0A A;  1WSU A;  2KZG A;  1DDN A;  2E60 A;  3FXR A;  4XBF A;  2EFO A;  1XSV A;  4FIS A;  2Z9O A;  2ZC2 A;  1SC7 A;  3PO3 J;  4DBR A;  1BI2 A;  3IAS 2;  3MD2 A;  4CCL A;  3ZMU A;  2JSC A;  4LK1 F;  4XKB A;  2FBH A;  4X0G A;  5IOY A;  1D0Y A;  5EEG A;  1I6H J;  5CQG A;  2ZKZ A;  1Q1H A;  2CFO A;  3HHG A;  3K10 A;  2IXS A;  2P6T A;  2R7Z J;  3M7G A;  3TMO A;  3FMR A;  3OSF A;  4M74 A;  4L0Y B;  1ZAR A;  4ENK A;  2NNN A;  5IP9 J;  5LHG A;  1YFH A;  2Y0S N;  3CJQ B;  4B3X A;  2H6B A;  1YIJ I;  4A3J J;  1MNM C;  2AS5 F;  1W5S A;  2ZXJ A;  3RZD J;  4A12 A;  1BR4 A;  1Q1V A;  2PQ8 A;  5L3D A;  1X4O A;  2HWV A;  4KN7 X;  2ACJ A;  3JRB A;  3I55 I;  3LA7 A;  4B1R A;  2VPL A;  2X6O A;  1MH4 A;  3PO2 J;  3N97 A;  2I10 A;  4B48 A;  1TT0 A;  3MKL A;  3O3K A;  2DOF A;  3VYT B;  4RA2 A;  3ERE D;  3T8R A;  4WX9 A;  2QKL B;  2LRD A;  4KN4 X;  5KCM A;  3BR5 A;  3LSR A;  3S3M A;  4A69 C;  2M87 A;  4BDY A;  1OJL A;  1BJA A;  2IAI A;  2W85 A;  1I39 A;  4C3I J;  5HDG A;  4BXX J;  4DNC A;  1XN7 A;  1H88 C;  1V55 H;  4YRV A;  4BY1 J;  2Y9Z A;  5BQT A;  1TQI A;  3FZV A;  4KIC A;  4RAZ A;  4AYB A;  5DEQ A;  4FAS D;  1XPX A;  2IJL A;  4HLY A;  4A5N A;  1BI3 A;  2L7M P;  4LG0 B;  1WJ5 A;  5DCF A;  3OYN A;  3DLA A;  3S93 A;  5L3E A;  2ZXH A;  1NHA A;  1USS A;  3CC4 I;  4XK4 A;  2VBW A;  2HQA A;  1FT9 A;  3AFH A;  5HDK A;  1Y8Q B;  3L7W A;  3W2V A;  3HYI A;  5EEH A;  2VC0 A;  3JTG A;  1S8N A;  4MQ9 F;  2ME6 A;  2XGX A;  2XV4 S;  2ZNY A;  3ABU A;  3E3V A;  4UV8 A;  3FBI B;  4B09 A;  4JK1 X;  1RZ4 A;  2EV6 A;  1MJA A;  2F2E A;  1R1T A;  3SZP A;  3V42 A;  2EA4 A;  1ETX A;  2M45 A;  2NRA C;  2WAF A;  3RKW A;  1PP8 F;  2RVC A;  3BLY A;  1ETY A;  3RQ4 A;  3G1L A;  4EV0 A;  3JRE A;  3A4C A;  3H1C A;  3QU6 A;  4S04 A;  3G71 I;  1CGP A;  4ANJ A;  5IOZ A;  4N0B A;  4ZTJ A;  1R00 A;  2X48 A;  3PUF A;  5M5W J;  1FMV A;  2GM4 A;  2PG4 A;  1IJW C;  3SEQ A;  1BC7 C;  5DS9 A;  3FMS A;  1ORK A;  3BT9 A;  2DLL A;  2WY7 Q;  4WXC A;  4MIM A;  1BR1 A;  3P9C A;  1T33 A;  3OS0 A;  1OCZ H;  1XCB A;  5AIQ A;  2DT7 B;  1U9O A;  1UMQ A;  3L00 A;  1F36 A;  1HDP A;  1GVJ A;  4CO8 A;  5TIS C;  5F08 A;  2IGN A;  1JHH A;  3Q3S A;  4CHU A;  4HV6 A;  4M6X A;  3M3Y J;  3ZQG A;  3R61 A;  2X1D A;  5JLX A;  4LLN A;  3K2A A;  3MCZ A;  3IL2 A;  4LIV A;  3HOY J;  3V8L A;  4DYC A;  2YX7 A;  4PDK A;  5F0H A;  3J7A Y;  2HR3 A;  4QWQ A;  2KRC A;  3BG6 A;  2KJB A;  2Y0S A;  5JFR A;  4WF2 A;  4IHY A;  1ACI A;  5K5O A;  3OIQ A;  1VI0 A;  1ON1 A;  1W1W E;  1E3O C;  4ENM A;  2IPQ X;  4XLF A;  2JVH A;  2VT3 A;  3PFY A;  1QRY A;  4OU0 A;  2ID6 A;  2A05 A;  3RQI A;  1ZRF A;  4IQJ A;  3BR1 A;  1ODD A;  3VYR B;  4B8X A;  2WC2 A;  2X6W A;  1OR7 A;  5CVV A;  2KQR A;  3DEW A;  1FOK A;  1PUF A;  2VXD A;  3V7S A;  2L02 A;  1V5G A;  1WPK A;  2WB1 N;  2LK2 A;  3HTU A;  3K4M A;  3GTL J;  3FHZ A;  1OLT A;  1SMT A;  1CF7 B;  1SFX A;  1WWX A;  3JSO A;  2E1M B;  1W7P A;  2X4H A;  2ISY A;  3K4J A;  2A5Y B;  3J7A O;  2K86 A;  2R7X A;  3VWB A;  5J1R A;  1KYW A;  1MBG A;  5TJJ A;  2ADU A;  4BEH B;  2YX4 A;  3HOU J;  4PJ0 C;  3MEX A;  4AUX A;  4KA4 A;  5JR3 A;  2V1U A;  4UUV A;  4A3G J;  1SD4 A;  1WRJ A;  1B6A A;  4A3C J;  4KIB A;  1W5C C;  4BXU A;  3CUQ A;  2PJR A;  2VN2 A;  2BY1 A;  5B66 C;  4D5C A;  3WGI A;  2UXN A;  3GEZ A;  3Q5F A;  2VQL A;  1O7F A;  1ETK A;  3W6K B;  1JUS A;  2CRG A;  5KK1 A;  5A2Q Z;  3ZQQ A;  3S1N J;  2BY2 A;  5F04 A;  2L9R A;  4EMS A;  1GV5 A;  3ZCO A;  1VZ0 A;  1FTT A;  2R7V A;  2FQ3 A;  2LF7 A;  3MVP A;  5E3N A;  2UUZ A;  4XN0 A;  4B3A A;  4YIR X;  1HST A;  3DU6 A;  2K4J A;  4LG3 A;  4BKX A;  3TW6 A;  3HOT A;  2DYS H;  2X6X A;  3VDX A;  4IHV A;  3B6C A;  5LFA A;  4C2U A;  2ZJ2 A;  5FFZ A;  4E7J A;  3S3O A;  2OQG A;  3QOP A;  4IHS A;  4A3D J;  1DU6 A;  1HF0 A;  4DZP A;  1QZZ A;  3BCB A;  2EA2 A;  1YE9 A;  3RDI A;  5K5Q A;  4ZC3 A;  2NXN B;  5LRR A;  1JE8 A;  2V1N A;  2CS3 A;  2YU9 J;  1S29 A;  1YYV A;  3GFL A;  5E8I A;  2XF6 A;  3J81 K;  2HYJ A;  3D1N I;  1W36 C;  1WJB A;  4EQQ A;  2PBI A;  3E6C C;  4E7L A;  3ASO H;  3JRI A;  2RRE A;  4LD5 A;  5HLG A;  4NNJ A;  1BI0 A;  2WY8 Q;  2R7W A;  4XRS A;  3F3X A;  4F55 A;  3QPH A;  4XID A;  1IUY A;  1K6O A;  2BY0 A;  5CQE A;  2L7Z A;  2OCC H;  1QGP A;  4NQW A;  2GLO A;  3S2D J;  1R1U A;  4HX4 A;  2YPR A;  4M3E A;  4HEA 2;  2H1L A;  4LIT A;  4XOP A;  2HI3 A;  3U1D A;  1UFM A;  2QSF X;  3SEZ A;  3BOQ A;  4R1H A;  2HOT A;  4XRF A;  3IKT A;  2OV7 A;  5EEA A;  3PNY A;  3DFG A;  2L5Q A;  1WI3 A;  1ULY A;  4AVZ A;  1S72 I;  2BE5 F;  1JGS A;  3W2A A;  5DUI A;  2XAS A;  2O61 A;  4GYG A;  3V7C A;  4BHB A;  5HS9 A;  1AA7 A;  2ZO4 A;  1X3W B;  2A6H F;  4UXN A;  5EG0 A;  3M8E A;  1XS9 A;  5FLV A;  5IYC J;  3JRG A;  4I02 A;  2J5O A;  3C2B A;  2Z16 A;  3FWE A;  3IAM 2;  1IN8 A;  1U5T A;  3VOE A;  3X2Q H;  5BPD A;  2WB1 A;  3K1P A;  3RI4 A;  1FEX A;  4CGZ A;  2IGM A;  5E17 F;  3LA3 A;  2K3P A;  4Z2Y A;  3WTV C;  4BAY A;  4BAC A;  3ZN1 A;  4MEY F;  1Z9C A;  2FX0 A;  3BZK A;  4RGR A;  2HQ5 A;  3O6B B;  5E3L A;  2G7H A;  3H5A A;  4BHP A;  1Z05 A;  3PNT A;  1Z6T A;  2FXA A;  5CVU A;  3ESW B;  1TTY A;  2GAU A;  2O8X A;  4I01 A;  1SD7 A;  1I3A A;  4C3H J;  4QLC U;  1MH3 A;  3OYH A;  2D5V A;  5KAI C;  3BWG A;  2BXY A;  2P7C B;  1AWC A;  3L2Q A;  5FFX A;  4CCM A;  4PCQ A;  2IGO A;  1U3E M;  5F6F A;  3G1M A;  2HU9 A;  3GUD A;  3KZI C;  4O5V A;  2R93 J;  2CUJ A;  3I58 A;  2PMZ N;  4JX4 A;  2DYR H;  2LYC A;  1G8X A;  2COB A;  2HPM A;  4RGX A;  3ZMS A;  4RMN A;  3H9Q A;  1QNT A;  3A2K A;  2E5Z A;  1IV6 A;  1Z3Y A;  3CCS I;  2L4M A;  4BBR J;  1IO2 A;  4YFN F;  4MNU A;  1MJB A;  3BR3 A;  5EJC A;  3GO5 A;  3FX3 A;  5HDN A;  4UB8 C;  4M6V A;  1T56 A;  3IH2 A;  5D6E A;  5L3B A;  1K4T A;  3T0Y A;  4E4H A;  3VPR A;  3Q0U A;  1PDN C;  3HUG A;  2X6Y A;  2W84 A;  3P9I A;  2X9D A;  2F5D A;  2KZV A;  3C2G A;  3WU2 C;  5J8C A;  4G94 A;  3ONQ A;  3GWZ A;  2V4J C;  3PIP F;  2MD5 A;  5C3E J;  1G4D A;  3SJM A;  2MA3 A;  2UZK A;  5M3M J;  2NVX J;  2EFQ A;  2JUC A;  3I71 A;  3LMM A;  1GXQ A;  1V5F A;  1LFB A;  2K7L A;  3MFK A;  3ROU A;  1U8B A;  5CVI A;  1MBF A;  5BS6 A;  3KEY A;  3DKX A;  3CDH A;  3DEU A;  3GTO J;  3L2C A;  3H9G A;  2L7K A;  1R49 A;  4F7Z A;  4KMU X;  1MD0 A;  4KIT B;  1XG1 A;  1GXP A;  3OMY A;  3KP2 A;  3GTK J;  1VQ5 I;  2HVR A;  1N75 A;  4NC7 A;  1UJ8 A;  4XRS G;  1X19 A;  2FEZ A;  2G0E A;  3WGG A;  3HRM A;  1X1B A;  3WTZ A;  5JHF A;  1VQ4 I;  3ECO A;  1VF9 A;  5FKL A;  1IW7 F;  4I2O A;  1Y56 A;  3S2W A;  3BPX A;  1DP3 A;  1DP7 P;  1FNN A;  4NUB A;  3H0G J;  3FMQ A;  4F91 B;  5D5W B;  3JSP A;  3HTS B;  1TZL A;  3FXL A;  4DGW B;  3BPV A;  1W5T A;  1B4A A;  3H3Z A;  4Z6Y A;  3IWF A;  3FM5 A;  1HW2 A;  2ECC A;  1R6R A;  1UZC A;  3HKZ N;  4IX7 A;  3FM3 A;  3HHH A;  1KZH A;  3ZQF A;  5GAG J;  1ERD A;  5EYR A;  1TWH J;  4PSW A;  3QPL A;  1HKS A;  2LY9 A;  3HRT A;  3BG5 A;  1P7J A;  3SFI A;  2XC7 A;  1W7P D;  4HDV A;  3VEP A;  5DM7 F;  2G9W A;  2E19 A;  2KP6 A;  1FIA A;  3CUQ C;  3HSF A;  3WGH A;  4IOC F;  2KHM A;  2LF8 A;  2XIG A;  4KT6 A;  3VOD A;  5E8G A;  4DJA A;  2COM A;  3CO7 C;  2R5Y B;  2QQB A;  3DXJ F;  2OTL I;  2DMN A;  4LLG F;  2GIZ A;  2NS8 A;  3K7A J;  1D3Y A;  1T2K A;  1B8I A;  1Y39 A;  3S2H J;  3LAP A;  4RLQ A;  3FBN B;  1EJ9 A;  5ILV A;  2MBF A;  2W82 A;  1Y0N A;  4WWC A;  3F8C A;  1TW3 A;  2HVS A;  4FX0 A;  2DQR A;  2KLO A;  2PMZ A;  4IZZ A;  1FP2 A;  1ZTR A;  5F0F A;  4AIJ A;  3GXO A;  4GYI A;  6PAX A;  1G6N A;  1HW1 A;  4XLH A;  3GLL A;  2NAZ A;  4C3J J;  4CYD A;  3GFI A;  1N25 A;  4MTD A;  1FX7 A;  2IEK A;  3KP4 A;  2JA5 J;  4HG2 A;  2XDV A;  2EK5 A;  2HDW A;  1CF7 A;  4PFP A;  3M1C A;  1BW5 A;  1MSE C;  2VT2 A;  3I59 A;  3DQV C;  1IN7 A;  5E1Z B;  3WTT C;  1KU7 A;  2DOD A;  1K79 A;  1IF1 A;  4DW6 A;  4RBO A;  1HDD C;  2TDX A;  2DFF A;  2LKP A;  5A2Q K;  2RKH A;  3VSK A;  3R0A A;  3HSE A;  4BUP A;  1FSH A;  4BL0 B;  2ELH A;  4Y13 A;  2JT1 A;  2M7B A;  2D1V A;  5ED4 A;  2ZME B;  4MEX F;  5CKT A;  2HZD A;  2HOA A;  2EH3 A;  1E2X A;  4FET A;  3OIP A;  1BBY A;  2V1X A;  1XSX A;  1H8A C;  4EM1 A;  4FTH A;  2OF7 A;  2EFN A;  2M30 A;  2IS6 A;  2RC4 A;  3QYB A;  5FLX K;  4KT5 C;  3GZN B;  1LE8 B;  1Z7U A;  5GP9 A;  4BQQ A;  1I1G A;  2ZJR F;  1FWZ A;  1WJE A;  2MYS A;  1EV7 A;  1RPW A;  3KEQ A;  4M9Z A;  2IA2 A;  4JBA A;  3QYF A;  1LNW A;  4G6T B;  2OQR A;  1GV2 A;  3GVA A;  3ZMT A;  4AU7 A;  4BS9 A;  2BXZ A;  4A3E J;  3ERM A;  1UHW A;  2RNG A;  2ETH A;  4HLX A;  1YIO A;  3DLL F;  1U5T C;  2GBY A;  4BBS J;  1MMA A;  1QA6 A;  1V4R A;  2LH9 A;  3HSR A;  3AL0 B;  1HC8 A;  1XC5 A;  4XKW A;  4C2T A;  5GTI C;  3JW4 A;  1KU3 A;  4RGU A;  4B4C A;  3HKZ A;  2DA5 A;  5LEJ A;  2VQC A;  3B73 A;  4M3G A;  4PFO A;  1QHH D;  2DOA A;  3BQZ A;  3L2R A;  1R36 A;  3CCV I;  2FNP A;  1ONV A;  3WTU C;  2QLZ A;  1J0R A;  3FXK A;  1AKH B;  4NC6 A;  2DMT A;  2FBK A;  2F4O B;  4E7Z A;  3S15 J;  2JTV A;  3DBL B;  5JVT A;  4RGS A;  5BNG A;  4L18 B;  1DGW Y;  2MH9 A;  1ETV A;  2JPB A;  2BVL A;  3I64 A;  3HOW J;  4KNY A;  1Z7L A;  4UUS A;  4DQ2 A;  2BOL A;  2ID3 A;  4V19 K;  5HNH A;  2MW8 A;  4BYY A;  2V26 A;  5C44 J;  2GXA A;  3PNV A;  1X2N A;  3M8F A;  2UV1 A;  4CCO A;  5B5E C;  2Y0M A;  4C30 A;  3J81 Z;  3COA C;  1KON A;  4U0Y A;  1PJR A;  1STZ A;  2GA2 A;  4RB3 C;  2JA8 J;  2KRF A;  2ZFU A;  1R5G A;  2EFW A;  2CU7 A;  1OCR H;  1BJZ A;  3ZMD A;  4Y3O A;  1I5Z A;  1Z77 A;  1V3F A;  2ESH A;  3CES A;  4Y15 A;  1ZGW A;  2PI0 A;  3PFI A;  2BBY A;  9ANT A;  3WTX C;  1R4N B;  4CUG A;  2VKE A;  3K4L A;  2LKS A;  4EGY A;  3GCM A;  3EYI A;  5FRN A;  4Y17 A;  5LD2 C;  4BQN A;  2LDU A;  4CCK A;  2HOS A;  4I7H A;  3L2V A;  2QCO A;  4G7Z F;  1YI2 I;  4BU2 A;  5K5R A;  2PJP A;  4TV7 A;  2DJI A;  2JRT A;  3FK7 A;  4HAM A;  2W48 A;  2RQQ A;  3LSG A;  5LBQ A;  1SMY F;  3F72 A;  1PP7 U;  4OIN F;  2K9Q A;  1WJF A;  3KP5 A;  5H6Q A;  1JTX A;  2XAQ A;  3F23 A;  5BOX A;  5ICE A;  2E1O A;  3WE2 A;  1K78 A;  4OMY A;  3CP2 A;  4XNF A;  3I56 I;  2LKX A;  2CQK A;  5HLH A;  3OYE A;  1BR2 A;  4AIK A;  1RUN A;  4XL9 A;  3BR6 A;  4PUS A;  3GZ5 A;  2JJ7 A;  1NG6 A;  2OZ6 A;  3C2H A;  1DUX C;  3JTH A;  4HF2 A;  4D7N A;  4ZZL A;  3I3L A;  2FUG 2;  2VJI A;  2Z1D A;  1X1P A;  4E7I A;  4N4N B;  1SFU A;  2STW A;  4HV5 A;  5IPA A;  1RR7 A;  2AXL A;  2G7U A;  5EGO A;  1IG7 A;  3TP0 A;  1YRN B;  2I8D A;  4KJZ A;  3HB9 A;  2WAE A;  2H09 A;  3ML6 A;  5LRS A;  1JUP A;  3AG1 H;  2Y30 A;  2FSW A;  2OZU A;  3QYE A;  1EH8 A;  1U6G A;  2R4G A;  4RB0 A;  2P81 A;  4G9Y A;  1R58 A;  1FYK A;  1YJN I;  1HBX G;  1BC8 C;  3VSL A;  2K27 A;  2EIM H;  3HDD A;  2VQG A;  3W6J B;  5IP6 A;  1VQ8 I;  5HVQ C;  1R5H A;  5JI6 A;  1P4A A;  2HPI A;  2XB0 X;  3HGY A;  4XQF A;  3HGG A;  3KYD B;  2GOM A;  3OL3 A;  4M9X A;  4XMY A;  2Q0O A;  3DU5 A;  4EM0 B;  2R7S A;  5M5Y J;  2UXX A;  3R0J A;  1YOV B;  3CJT B;  1P4X A;  2V1D A;  3ZP5 A;  2DMP A;  4A5M A;  5IP7 J;  4IHT A;  5L3G A;  2RGV A;  3K9T A;  3OY9 A;  3JRA A;  1A6Q A;  1LEB A;  3E7L A;  4ZH4 F;  1MKM A; 
#chains in the Genus database with same CATH homology
 1MDM A;  4GO1 A;  2FU4 A;  4YFK F;  1ZHF A;  3DKW A;  1GHC A;  2P4W A;  1ZRD A;  4FHT A;  4HF0 A;  3HOS A;  3J80 Z;  1REP C;  1B1B A;  2FRH A;  4XLN F;  4M71 A;  4G7O F;  3FXQ A;  2VOD A;  2MLG A;  3K2Z A;  2DK8 A;  4FX4 A;  1O3T A;  2IA1 A;  5ILU A;  4P9F A;  3LWF A;  1H9G A;  4A0Y A;  3E5U A;  3BZ6 A;  2H94 A;  3V8K A;  3E97 A;  2HFH A;  4ESB A;  4YII A;  2XUB A;  1OKR A;  1YW9 A;  4RAY A;  1H9T A;  5D8K B;  2QM3 A;  2D2W A;  2QQA A;  2HOE A;  1YTY A;  5CYV A;  2NNY A;  2A07 F;  1UCR A;  3I4P A;  4MTE A;  5E20 A;  4WXH A;  4A0X A;  1B9N A;  1I27 A;  1LB2 A;  4IXA A;  4L9N A;  2Q2E A;  1TQP A;  4MHG A;  4IRI A;  4L9V A;  4U0W A;  3GYH X;  4G8X A;  2BYV E;  3ULQ B;  3F8B A;  4EM2 A;  4I0B A;  2HQR A;  4L9J A;  4RB1 A;  4UVC A;  3F21 A;  2YSR A;  3ELK A;  2W57 A;  1W4M A;  2P5V A;  5E1X A;  2XRN A;  4AIH A;  1O7L A;  1B59 A;  4NB5 A;  2RN7 A;  3TO9 A;  3ZN0 A;  1TQM A;  3QAH A;  2CGP A;  2QQ9 A;  2FA5 A;  1QPM A;  5DUK A;  3KLO A;  5F1R A;  3GX4 X;  1RI7 A;  3NEU A;  5ICG A;  4N9H A;  3TGN A;  1FBS A;  3OV8 A;  2VC1 A;  4EGZ A;  1K7A A;  1SFE A;  5LHI A;  2DW4 A;  2DTR A;  5DCM B;  5K1Y A;  4OMZ A;  5FLX Z;  3KLN A;  1O3R A;  1IN5 A;  1OMI A;  3JAM K;  1LQ1 A;  3F6O A;  4P96 A;  4GCV A;  1FPQ A;  4GXO A;  2RNJ A;  2EFP A;  5D8L B;  3EET A;  4ZYG A;  2JPC A;  2FOK A;  3DPT A;  1LJ9 A;  3KEO A;  4G6D A;  3WU0 A;  4IRH A;  2EWN A;  2W25 A;  1XMK A;  3RYP A;  4HQM A;  2XAH A;  3TDU C;  1KU9 A;  1UHM A;  3TQN A;  5IT3 A;  3LQR A;  3SFZ A;  3TOB A;  3MAJ A;  5FB2 A;  1OYI A;  5IT9 K;  1KYZ A;  1WQ2 A;  1BIB A;  2A61 A;  4L0Z B;  2KIU A;  2OD5 A;  1T38 A;  3RYR A;  1Y0U A;  1OYY A;  5CVR A;  1QO0 D;  2HGC A;  3O2P E;  2IA0 A;  4M73 A;  2DPD A;  5ICC A;  3LAJ A;  3HIF A;  3VFZ A;  5LHH A;  1MZB A;  4ENJ A;  2HS5 A;  1OPC A;  3H3U A;  1QBJ A;  3T1B A;  3U9G A;  2ISZ A;  2R7F A;  2DQL A;  1P92 A;  3RJP A;  3WU1 B;  2XAG A;  5FD5 A;  4LG0 A;  1A04 A;  2A68 F;  2HQN A;  4PZJ A;  1BI1 A;  3J80 K;  4LK0 F;  3RKX A;  3WTW C;  1KQ9 A;  3RKY A;  3PQJ A;  3C1D A;  1B9M A;  5TRD A;  4XLP F;  1T6S A;  1U2W A;  3QRF F;  4ZYD A;  2CSO A;  4L5J A;  4O6J A;  2A6E F;  5LGT A;  2DPU A;  4ESJ A;  1XGM A;  3TKY A;  5L3C A;  2PMH A;  5DD8 A;  4K2E A;  2MLK A;  2VXZ A;  3BY6 A;  2CO5 A;  2QBY B;  1J5Y A;  4BH9 A;  2VOO A;  1SD5 A;  3EUH A;  1H0M A;  2RDP A;  2XAF A;  2RV8 A;  2F5E A;  4NHJ A;  2W24 A;  3KP3 A;  4S05 A;  3E6M A;  1KA8 A;  3DV8 A;  4R79 A;  3N4M A;  2XAJ A;  2JZY A;  3KP7 A;  4I98 B;  2STT A;  4UNO A;  1BOA A;  1T39 A;  1YS6 A;  2Q8K A;  3WG9 A;  1ZGJ A;  1J75 A;  3BRO A;  1XDS A;  2H27 A;  1JHF A;  3CJN A;  2HTS A;  2X0L A;  1YW7 A;  1FYL A;  2WV0 A;  1F1Z A;  1BIA A;  2IP2 A;  3RTR A;  4ETS A;  5FD6 A;  5E1W A;  3IRQ A;  1UB9 A;  4HBL A;  5HS7 A;  3KP6 A;  4P9U A;  2PFB A;  1IN4 A;  1YG2 A;  3RPQ A;  3BJA A;  2GIV A;  1W7P B;  4CXF A;  2EV0 A;  1SAX A;  4A6D A;  3PQK A;  3F8F A;  2BGC A;  2EJR A;  2LSO A;  1XGN A;  5JHU A;  1HKQ A;  1P2F A;  1R23 A;  1Z91 A;  2YU3 A;  3MZY A;  4MQV A;  4YFX F;  5H6R A;  3CUQ B;  4JQF A;  3F8N A;  3I53 A;  3EQL F;  4HF1 A;  2E7X A;  3U2R A;  3I5U A;  3EYY A;  1TNS A;  5HS8 A;  2O03 A;  4AD9 A;  2H6C A;  1KQ8 A;  2NYX A;  2FE3 A;  4G7H F;  4WCG A;  3RPU A;  3K69 A;  1FC3 A;  3E5Q A;  3ISP A;  3QP5 A;  3GZ6 A;  2CW0 F;  3JAM Z;  4BNC A;  1IXR C;  1L3L A;  1AOY A;  1KGS A;  1LDK B;  2PEX A;  3AAF A;  2IT0 A;  4KFC A;  3BJ6 A;  4HYE A;  1J59 A;  1XDU A;  2HTJ A;  3B02 A;  2IRF G;  3EDP A;  2DT5 A;  2P5L C;  2ZFW A;  1XMA A;  2GA1 A;  1S7O A;  2Y75 A;  1P4W A;  1TNT A;  4WK8 F;  4Q5S F;  2L54 A;  2IVM A;  4M72 A;  4RS8 A;  4IPA A;  3HRU A;  5ERI A;  5FO5 A;  2PN6 A;  1SD6 A;  1J2X A;  1U5T B;  3IKV A;  3VB2 A;  4IVN A;  2HDC A;  1O3Q A;  2L4A A;  1PUE E;  1ZRC A;  1XGS A;  1J7K A;  1S3J A;  4EVI A;  4IRG A;  5IT9 Z;  3OOP A;  5BMZ A;  1ZGA A;  3IHU A;  4ON0 A;  2D45 A;  1IXC A;  4KIF A;  1ZN2 A;  2O3F A;  4GGG A;  3WE3 A;  2Z33 A;  2CYY A;  2QEN A;  1FBQ A;  3HRS A;  4PGG A;  5CJ9 A;  2QVO A;  5ILS A;  5LGU A;  5AON A;  3SZT A;  2K4B A;  4HDU A;  4LJZ F;  4A2U A;  2A69 F;  4CDG A;  3BDD A;  2FMY A;  3T5X A;  5D4R A;  4IJA A;  1FSE A;  5J8F A;  4ESF A;  1IXS B;  1FZP B;  4U0V A;  1LDD A;  1D5V A;  1OYW A;  1ZAO A;  1HKT A;  5FGM A;  2XKO A;  5F64 A;  4G6Q A;  5HOO A;  4EJT A;  2F5F A;  3D0S A;  3F6V A;  5LEK A;  1Z6R A;  3P7N A;  5LGN A;  2L01 A;  4L5I A;  1LEA A;  4P5O A;  4HOB A;  1G3Y A;  2BV6 A;  2KIM A;  3MZH A;  2QBY A;  3GFM A;  2P8T A;  2O6G E;  2HYF A;  2D1H A;  2BEO A;  2WTE A;  2MC3 A;  2FF4 A;  2UWM A;  5AIP A;  3IC7 A;  2XHK A;  4U7D A;  1JXS A;  4EJO A;  4ZYE A;  2QYO A;  2DK5 A;  4ENN A;  4O3M A;  4EJU A;  1XB4 A;  5D5U B;  3M1E A;  3QU3 A;  3R60 A;  2GWR A;  3BJO A;  2R3S A;  3KZZ A;  1S7A A;  4U88 A;  1IZ1 A;  4M9S A;  3DF8 A;  1LVA A;  3L9F A;  1U8R A;  2V6C A;  2ZME A;  3NRV A;  3F22 A;  5D5X B;  4HW0 A;  1IAW A;  4HQE A;  3F8M A;  4XSX F;  2P5K A;  2FML A;  2CFX A;  1WI9 A;  1D8J A;  2XVC A;  4Q48 A;  4H0E A;  3CTA A;  3V8J A;  1O57 A;  2PMU A;  4UVA A;  1ZLK A;  5E18 F;  2HKO A;  3LQQ A;  3I59 B;  4UVB A;  3R6S A;  1FYM A;  1FP1 D;  3CUO A;  4BQA A;  3KCC A;  2PLY A;  3V4G A;  4MGR A;  1E17 A;  1HQC A;  3LST A;  3CLO A;  3K0L A;  3TOA A;  2OA4 A;  3DPL C;  3ZQ7 A;  3M9A A;  1ZG3 A;  3QPT A;  4AWX B;  2GZW A;  1IN6 A;  1T0F A;  3LA2 A;  5DD4 A;  3GF2 A;  2ZNZ A;  1RNL A;  1F4K A;  2E1C A;  2EB7 A;  4EJW A;  2OAZ A;  2KKO A;  1EH7 A;  4BHC A;  2QWW A;  2KJC A;  4OIR F;  3G73 A;  1G3S A;  3RIR A;  3WTS C;  3C7J A;  1G3W A;  1WKM A;  4E70 A;  3TO6 A;  5DDG A;  4EJV A;  1FLI A;  5ICF A;  3WTY C;  2HEO A;  2DO7 A;  4LMY A;  4I09 A;  2Z3Y A;  2P7V B;  3ECH A;  2DU9 A;  1F9N A;  2VBX A;  3DP7 A;  5D5V B;  1G3T A;  2M8E A;  1Z1D A;  2C6Y A;  1O3S A;  4YG2 F;  2P6S A;  3V7R A;  5HLI A;  3GW2 A;  1DPU A;  2GXG A;  4LB5 A;  4KIG A;  1X3U A;  2GXB A;  2WWY A;  1F5T A;  4OIQ F;  1KQ0 A;  2DAO A;  2ZBK A;  3R4K A;  2FBI A;  4PGH A;  2L3D A;  5CLS A;  2DFI A;  3E6D A;  3CO6 C;  2ESN A;  4KMF A;  3FF5 A;  3KFW X;  3NQO A;  3IWZ A;  4XSZ F;  2V79 A;  4ASN A;  1ZG5 A;  1K78 B;  4UV9 A;  2RQP A;  3C18 A;  4YIF A;  4CIC A;  1R7J A;  3SQN A;  2QUF A;  4OIP F;  4P55 A;  3TDZ C;  1BM9 A;  1TLH B;  2Z99 A;  1C0W A;  2HKX A;  1YS7 A;  4R8H A;  3FXU A;  3KZY A;  4IF4 A;  3ZPL A;  2VBY A;  5H20 A;  1XSD A;  4L9T A;  2VOP A;  2QZ8 A;  4HX7 A;  2DBB A;  2DI3 A;  1ZG1 A;  2CWE A;  1I6X A;  4HA8 A;  5KVR A;  1J9I A;  3ZMZ A;  4A0Z A;  1VTN C;  1EH6 A;  5LLQ A;  4LLL A;  1LDJ A;  4D0P A;  4HX8 A;  4KDP A;  4KYW A;  2Y48 A;  5D4S A;  1HW5 A;  3MWM A;  2F5C A;  1KU2 A;  2HZT A;  4A6E A;  4Q4Z F;  1MDM B;  1R22 A;  2CG4 A;  3GLX A;  2FNA A;  1XCV A;  2Z5U A;  3IRR A;  4U7B A;  4UHT A;  3E5X A;  3ABT A;  2OU2 A;  5DV5 A;  1HXD A;  4CZZ A;  3C3W A;  4ZYH A;  5D6F A;  1MJ9 A;  2K02 A;  2A3S A;  4Q47 A;  1YQA A;  1QQI A;  1TW2 A;  1P6R A;  3KE2 A;  4RB2 C;  2GQQ A;  2VON A;  3D5L A;  4OOI A;  1L0O C;  2VE9 A;  2HYG D;  1ZH5 A;  4WXD A;  1ZRE A;  2LNB A;  1MGT A;  2M1B A;  1R1V A;  4FT8 A;  3SXY A;  1HSJ A;  2IW5 A;  2J5P A;  1ZLJ A;  2VBZ A;  3G3Z A;  2O0Y A;  2XRO A;  3E6B A;  1DPR A;  3GFJ A;  1T98 A;  4HZF A;  1ZYR F;  1ON2 A;  1S6L A;  3Q9S A;  1IRG A;  2EV5 A;  5BPI A;  1BN5 A;  3LFK A;  2NS0 A;  4LB6 B;  4KUM A;  1UST A;  5DCM A;  2R7D A;  1U78 A;  3T8T A;  2V9V A;  3I54 A;  3REO A;  3ZMV A;  2KIF A;  2YR2 A;  4ZZD A;  2MH2 A;  2B0L A;  2M5W A;  4LGW A;  5CVJ A;  3K1M A;  4N9I A;  1XD7 A;  2E1N A;  1YLF A;  3Q9V A;  3TO7 A;  3KET A;  1YW8 A;  5L3F A;  1TBX A;  4LFU A;  2VE8 A;  1YO5 C;  3H92 A;  4OIO F;  2ZCW A;  3QP6 A;  1D8K A;  1XGO A;  3BP8 A;  1IRF A;  1FBU A;  3P9K A;  2XKP A;  3L09 A;  1RIO H;  2E7W A;  4M6Y A;  2OBP A;  3SHF A;  3I0T A;  1FY7 A;  1QZY A;  5DYM A;  4AVP A;  3WOD F;  3K1N A;  5J6X A;  1I1S A;  3MQ0 A;  1RUO A;  4I0A A;  1WSU A;  1DDN A;  3FXR A;  4XBF A;  2EFO A;  1XSV A;  2Z9O A;  1BI2 A;  3ZMU A;  2JSC A;  4LK1 F;  2FBH A;  5EEG A;  1Q1H A;  2ZKZ A;  3HHG A;  2P6T A;  3M7G A;  3FMR A;  4M74 A;  4L0Y B;  1ZAR A;  4ENK A;  2NNN A;  5LHG A;  1YFH A;  2H6B A;  2AS5 F;  1W5S A;  2ZXJ A;  4A12 A;  2PQ8 A;  5L3D A;  2HWV A;  4KN7 X;  2ACJ A;  3LA7 A;  3N97 A;  3O3K A;  3ERE D;  3T8R A;  4WX9 A;  4KN4 X;  2M87 A;  1BJA A;  2W85 A;  5HDG A;  4DNC A;  1XN7 A;  5BQT A;  1TQI A;  3FZV A;  4KIC A;  4RAZ A;  5DEQ A;  2IJL A;  4HLY A;  4A5N A;  1BI3 A;  4LG0 B;  5DCF A;  5L3E A;  1NHA A;  1USS A;  2VBW A;  1FT9 A;  5HDK A;  3L7W A;  3HYI A;  5EEH A;  2VC0 A;  3JTG A;  1S8N A;  4MQ9 F;  2XGX A;  2XV4 S;  2ZNY A;  3ABU A;  3E3V A;  4UV8 A;  4B09 A;  4JK1 X;  1RZ4 A;  2EV6 A;  1MJA A;  2F2E A;  1R1T A;  3SZP A;  2EA4 A;  2M45 A;  2NRA C;  3RKW A;  1PP8 F;  2RVC A;  4EV0 A;  3QU6 A;  1CGP A;  4S04 A;  4N0B A;  1R00 A;  2PG4 A;  1BC7 C;  3FMS A;  2DLL A;  4WXC A;  3P9C A;  1XCB A;  5AIQ A;  3L00 A;  4CO8 A;  1GVJ A;  1JHH A;  4CHU A;  4HV6 A;  4M6X A;  3R61 A;  4LLN A;  3MCZ A;  3IL2 A;  3V8L A;  2YX7 A;  4PDK A;  2HR3 A;  4QWQ A;  2KJB A;  5JFR A;  4WF2 A;  5K5O A;  1ON1 A;  4ENM A;  2IPQ X;  2VT3 A;  4OU0 A;  1ZRF A;  1ODD A;  4B8X A;  2WC2 A;  1OR7 A;  5CVV A;  1FOK A;  3V7S A;  2L02 A;  3HTU A;  3FHZ A;  1SMT A;  1CF7 B;  1SFX A;  1WWX A;  3JSO A;  1W7P A;  2X4H A;  2ISY A;  3J7A O;  2A5Y B;  2K86 A;  1KYW A;  5TJJ A;  2ADU A;  2YX4 A;  4KA4 A;  3MEX A;  5JR3 A;  2V1U A;  4UUV A;  1SD4 A;  1WRJ A;  1B6A A;  4KIB A;  4BXU A;  3CUQ A;  2VN2 A;  3WGI A;  2UXN A;  3GEZ A;  3Q5F A;  1O7F A;  3W6K B;  5KK1 A;  5A2Q Z;  4EMS A;  2FQ3 A;  2LF7 A;  1HST A;  2K4J A;  3HOT A;  2ZJ2 A;  5FFZ A;  2OQG A;  3QOP A;  4IHS A;  1QZZ A;  2EA2 A;  3RDI A;  5K5Q A;  5LRR A;  1JE8 A;  1S29 A;  1YYV A;  3GFL A;  5E8I A;  3J81 K;  4EQQ A;  2PBI A;  3E6C C;  4LD5 A;  5HLG A;  1BI0 A;  3F3X A;  3QPH A;  1IUY A;  1K6O A;  1QGP A;  4NQW A;  1R1U A;  4HX4 A;  2YPR A;  3U1D A;  1UFM A;  3BOQ A;  4R1H A;  4XRF A;  3IKT A;  3DFG A;  1ULY A;  2BE5 F;  1JGS A;  5DUI A;  2XAS A;  2O61 A;  4GYG A;  3V7C A;  4BHB A;  5HS9 A;  2ZO4 A;  4UXN A;  2A6H F;  3M8E A;  4I02 A;  2J5O A;  3FWE A;  3VOE A;  5BPD A;  1IN8 A;  1U5T A;  3K1P A;  3RI4 A;  4CGZ A;  5E17 F;  3LA3 A;  4Z2Y A;  3WTV C;  4BAY A;  3ZN1 A;  4MEY F;  1Z9C A;  4RGR A;  3O6B B;  2G7H A;  4BHP A;  1Z05 A;  1Z6T A;  2FXA A;  5CVU A;  1TTY A;  2GAU A;  2O8X A;  4I01 A;  1SD7 A;  4QLC U;  3BWG A;  2P7C B;  1AWC A;  5FFX A;  4PCQ A;  1U3E M;  5F6F A;  3GUD A;  4O5V A;  3I58 A;  4RGX A;  3ZMS A;  1QNT A;  2L4M A;  4YFN F;  4MNU A;  1MJB A;  3GO5 A;  3FX3 A;  5HDN A;  5D6E A;  5L3B A;  3T0Y A;  1PDN C;  3HUG A;  2W84 A;  3P9I A;  2F5D A;  5J8C A;  4G94 A;  3GWZ A;  2MD5 A;  1G4D A;  2MA3 A;  2UZK A;  2EFQ A;  3I71 A;  1GXQ A;  2K7L A;  3MFK A;  3ROU A;  5CVI A;  5BS6 A;  3CDH A;  3DEU A;  3L2C A;  4F7Z A;  4KMU X;  1MD0 A;  1GXP A;  3KP2 A;  2FEZ A;  3WGG A;  3HRM A;  3WTZ A;  3ECO A;  1IW7 F;  4I2O A;  3S2W A;  3BPX A;  1DP7 P;  1FNN A;  3JSP A;  5D5W B;  3FMQ A;  3HTS B;  3BPV A;  1W5T A;  1B4A A;  3H3Z A;  3IWF A;  3FM5 A;  1HW2 A;  3FM3 A;  3HHH A;  1HKS A;  3HRT A;  1W7P D;  4HDV A;  3VEP A;  2G9W A;  3CUQ C;  3HSF A;  3WGH A;  2LF8 A;  2XIG A;  3VOD A;  5E8G A;  2COM A;  3CO7 C;  2QQB A;  3DXJ F;  4LLG F;  1D3Y A;  1T2K A;  3LAP A;  5ILV A;  2MBF A;  4WWC A;  3F8C A;  1TW3 A;  4FX0 A;  2DQR A;  1FP2 A;  4AIJ A;  3GXO A;  4GYI A;  6PAX A;  1G6N A;  1HW1 A;  2NAZ A;  4CYD A;  3GFI A;  4MTD A;  1FX7 A;  3KP4 A;  2EK5 A;  1CF7 A;  2VT2 A;  3I59 A;  3DQV C;  1IN7 A;  5E1Z B;  3WTT C;  1KU7 A;  1K79 A;  1IF1 A;  2TDX A;  2LKP A;  5A2Q K;  2RKH A;  3R0A A;  3HSE A;  1FSH A;  2ELH A;  5ED4 A;  2JT1 A;  4Y13 A;  2D1V A;  4MEX F;  2ZME B;  1E2X A;  1BBY A;  2V1X A;  1XSX A;  4EM1 A;  2EFN A;  2M30 A;  2RC4 A;  5FLX K;  4KT5 C;  1Z7U A;  1I1G A;  1FWZ A;  1EV7 A;  3KEQ A;  4M9Z A;  2IA2 A;  4JBA A;  1LNW A;  2OQR A;  3ZMT A;  3GVA A;  1UHW A;  2ETH A;  4HLX A;  1YIO A;  1U5T C;  1V4R A;  3HSR A;  3JW4 A;  1KU3 A;  4RGU A;  5LEJ A;  3B73 A;  1R36 A;  2FNP A;  1ONV A;  3WTU C;  2QLZ A;  1J0R A;  2FBK A;  2JTV A;  5JVT A;  4RGS A;  4L18 B;  2MH9 A;  2JPB A;  3I64 A;  4KNY A;  4DQ2 A;  4BYY A;  3M8F A;  2Y0M A;  3J81 Z;  3COA C;  4U0Y A;  1STZ A;  2GA2 A;  4RB3 C;  2KRF A;  2EFW A;  1R5G A;  3ZMD A;  1I5Z A;  1V3F A;  2ESH A;  4Y15 A;  2PI0 A;  3PFI A;  2BBY A;  3WTX C;  4EGY A;  3EYI A;  4Y17 A;  2LDU A;  4I7H A;  4G7Z F;  5K5R A;  2PJP A;  4TV7 A;  2JRT A;  4HAM A;  5LBQ A;  1SMY F;  3F72 A;  1PP7 U;  4OIN F;  3KP5 A;  5H6Q A;  2XAQ A;  3F23 A;  5BOX A;  5ICE A;  1K78 A;  3WE2 A;  4OMY A;  2CQK A;  5HLH A;  4AIK A;  1RUN A;  3GZ5 A;  2OZ6 A;  1DUX C;  3JTH A;  4HF2 A;  4ZZL A;  1SFU A;  2STW A;  4HV5 A;  2AXL A;  2G7U A;  2H09 A;  3ML6 A;  5LRS A;  2FSW A;  2OZU A;  1EH8 A;  1U6G A;  4RB0 A;  4G9Y A;  1R58 A;  1FYK A;  1HBX G;  1BC8 C;  2K27 A;  3W6J B;  5HVQ C;  1R5H A;  5JI6 A;  1P4A A;  4M9X A;  2Q0O A;  4EM0 B;  2UXX A;  3R0J A;  3ZP5 A;  1P4X A;  2V1D A;  4A5M A;  4IHT A;  5L3G A;  2RGV A;  3K9T A;  1LEB A;  4ZH4 F;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...