1D8KA

Solution structure of the central core domain of tfiie beta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
molecule tags Gene regulation
source organism Homo sapiens
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8kA00
3FF5A 5E1XA 1YTYA 4A5NA 2XAJA 4HAMA 2IJLA 1T6SA 2TDXA 2M8EA 5F6FA 1XN7A 2F5FA 1S7AA 4HF1A 2MC3A 1U5TC 1S7OA 2C6YA 1HKQA 1ZN2A 5J8FA 1IN6A 3CTAA 4IPAA 5DUIA 2DU9A 5CJ9A 4AIJA 1XSXA 3DFGA 4A0ZA 4PZJA 1E17A 1CF7A 2RN7A 3RI4A 1R7JA 2DAOA 3E5QA 1TTYA 2DI3A 1KU7A 4KA4A 3HSFA 3F8MA 4L5JA 4RS8A 2YPRA 1G3YA 4RGSA 2XAFA 1LDKB 2H09A 1W7PA 2RC4A 2VC0A 2LKPA 5LGUA 4HDUA 2VN2A 1S6LA 3O3KA 1OMIA 4HLXA 3M1EA 2PQ8A 1R1VA 5FD5A 1IRGA 1YS7A 1FYLA 5FFXA 3ISPA 3HSEA 3DP7A 1P4XA 4OU0A 1FYMA 5L3FA 2NNYA 5D6EA 5CVVA 1HW2A 5D5UB 1AWCA 2WWYA 3O6BB 4MNUA 1ZYRF 3IRQA 4OIPF 5D5XB 1W7PB 4U0VA 3CJNA 1J9IA 2ZKZA 3KLOA 1O7FA 5BOXA 5J6XA 4KMFA 2YX7A 3NRVA 1U8RA 3GZ5A 3I4PA 3EYYA 4HYEA 1XCVA 3HOTA 5HS9A 2P5VA 2R7DA 3DXJF 2V79A 5FGMA 2CGPA 1MDMA 2B0LA 4A0XA 4MEXF 4GGGA 3GLXA 3Q9SA 4IHSA 2VXZA 2FQ3A 4A0YA 2MLKA 3S2WA 3P9CA 2EB7A 3BP8A 2DFIA 3ZMUA 2HYGD 4DQ2A 4CZZA 2EV0A 4BNCA 1R1TA 3QU3A 2W85A 2XRNA 3MCZA 3JTHA 1G4DA 3IHUA 4A6DA 4BH9A 4I0AA 4MEYF 2FNPA 1DPRA 3F8BA 1UB9A 3JTGA 4KMUX 4UNOA 3KEOA 2E7XA 2Z99A 3QP5A 3WGIA 2QYOA 1MGTA 1LVAA 3BPVA 2JSCA 4AD9A 1SD7A 1IN5A 2D1HA 3M9AA 2MH9A 1FNNA 4EJVA 2RV8A 4KN7X 1MDMB 4JK1X 3DF8A 2ISZA 1SAXA 2ELHA 1B1BA 4R1HA 1Z7UA 2P6SA 3WTXC 2Z33A 1H9GA 4Z2YA 1SD5A 3EUHA 1WI9A 3K1MA 1R5GA 5ICFA 4KDPA 1ZGJA 2NS0A 2LF7A 1BIBA 3WODF 3RYRA 2IW5A 2LF8A 3RJPA 3LA7A 2PG4A 1IXCA 1USTA 2QLZA 5DUKA 2IVMA 1ZRFA 5H20A 2QM3A 3E97A 5L3DA 4U0WA 3JSOA 1BI0A 3RDIA 2UXNA 2Z3YA 2YX4A 3KP2A 2FRHA 2E1NA 1P2FA 4G7HF 5HDGA 1I1SA 4BYYA 4EJOA 5ILUA 4HQEA 4ETSA 1LDJA 4EJWA 2ACJA 2FBIA 4KIBA 1TW3A 1P92A 3MAJA 3LQRA 4ESFA 4HZFA 4L9VA 2STTA 1J59A 3I53A 4XSZF 4LB6B 4B09A 3Q9VA 1S8NA 1SD4A 1XDSA 1R36A 4LLGF 4FX0A 4M72A 1H9TA 4IJAA 1ONVA 5ICEA 2NNNA 1BN5A 2EFPA 4RAZA 3DPTA 3E6MA 4O5VA 1ZAOA 4U7BA 1FBQA 3VEPA 1X3UA 2BYVE 3EQLF 4KIFA 4NB5A 3TDZC 5AONA 4RB1A 1FPQA 2OQRA 2JPBA 5D5WB 1IN7A 2DQRA 1K6OA 2GQQA 4IRGA 4ON0A 3COAC 2X4HA 3F3XA 1STZA 4G6QA 4U0YA 1HW5A 2PN6A 4IHTA 4UXNA 3GYHX 4XBFA 3R4KA 3IL2A 3FM3A 2F5EA 2HQNA 4RGUA 1KU2A 1ZG1A 1K79A 5JI6A 2DK8A 1I27A 4P55A 3TDUC 3KP5A 1YFHA 3LA3A 2W24A 5E17F 2O61A 2DPUA 1R5HA 2YU3A 5LLQA 3CO7C 3M7GA 1E2XA 2XKPA 1TNTA 1IUYA 2EA4A 1FY7A 3SFZA 1FP1D 3U2RA 4IF4A 3G3ZA 5DD4A 3I71A 1J0RA 2ETHA 3JAMK 5DCMA 4QLCU 3IRRA 3V7SA 3FXUA 2MH2A 4Q5SF 1ZLKA 2A3SA 2XASA 1OPCA 3ECOA 2PFBA 2ZJ2A 3K0LA 3GZ6A 3V7RA 4RGRA 3HRUA 1ZGAA 4A5MA 1ZG5A 1HXDA 1USSA 1B59A 3KP6A 1NHAA 2HDCA 3E5XA 3WTYC 4PCQA 1TW2A 5E8GA 1SD6A 4ENMA 2VOOA 4OIQF 4MGRA 3QPTA 1QPMA 2OU2A 4EM0B 1EH8A 1Z6RA 1D8JA 1QGPA 1W4MA 4I7HA 1G3WA 1FYKA 1TNSA 1C0WA 1XGNA 2L4MA 1U78A 4AIKA 2FNAA 3LAPA 3HIFA 4G7ZF 4L18B 1O3TA 5E18F 2HKOA 5DCMB 2EFWA 3HTSB 1BI1A 4WXCA 5JR3A 3E6BA 2F5CA 3F8CA 2KKOA 2O0YA 1DPUA 2A61A 1AOYA 2HR3A 5CVJA 2WTEA 3T8TA 5DEQA 2ZMEB 4GCVA 3ZMDA 3I58A 1I1GA 3GX4X 4Q4ZF 5BS6A 2VE8A 4LJZF 2EFQA 4Q48A 4UVBA 4ZYGA 1XB4A 5IT9K 1IXRC 3PQKA 3PQJA 5D4SA 2ISYA 3V7CA 2Q0OA 2A6EF 1MJAA 5HLHA 5ILSA 2L02A 4M6XA 3U1DA 4YG2F 3V8JA 1RNLA 2P7CB 5FD6A 3R0JA 3VB2A 4QWQA 1YO5C 3VFZA 4CHUA 2HWVA 4OMYA 1TBXA 2M1BA 1V4RA 4KYWA 2Z9OA 3F72A 2CWEA 3FXQA 3QAHA 1DP7P 1LQ1A 3ML6A 4G6DA 4LMYA 4Y17A 4RB2C 2FE3A 1QZYA 3JAMZ 3F8FA 4HX8A 2ZCWA 4L9NA 2XV4S 1XD7A 5K5QA 1BM9A 1MJ9A 1YQAA 1KA8A 4ZZLA 4GYIA 4JQFA 3SQNA 2K4BA 3CUQB 2IRFG 3CUOA 4FT8A 4EGYA 4ESJA 2HEOA 2XGXA 1SMTA 1TQIA 3ECHA 1VTNC 5F64A 1BIAA 2CO5A 2GXGA 4RGXA 4G9YA 5LHGA 4YIIA 1RUOA 5H6RA 3V8LA 2CFXA 4HLYA 1O3SA 4DNCA 1J7KA 1BBYA 4S05A 3R0AA 4B8XA 2PMUA 5H6QA 1T0FA 4HV6A 2IP2A 2NRAC 3KFWX 5E1ZB 3SZTA 3PFIA 2RVCA 5LHIA 5E8IA 4HOBA 2HTSA 5L3BA 1YLFA 1IN4A 2NAZA 3RYPA 3K1PA 3TO9A 3ULQB 4N9HA 2DLLA 4D0PA 3K1NA 2V9VA 2RGVA 1OYYA 3V8KA 4AWXB 2OQGA 2EFNA 1D3YA 1OR7A 3HUGA 2HOEA 1R23A 1FP2A 1R1UA 1XCBA 3K69A 3LWFA 4KFCA 3SZPA 5LEKA 2HZTA 1HQCA 2KIUA 3F22A 3IWFA 2M30A 4E70A 4OIRF 5IT9Z 1FBUA 5L3CA 1YW9A 1R58A 3CDHA 1I6XA 4I0BA 1DUXC 2K4JA 1ODDA 2JT1A 1P4AA 2P7VB 5HOOA 1O3QA 4PGHA 4ZZDA 4I02A 4BQAA 1GXPA 2W25A 2O8XA 3RIRA 2QUFA 3HHGA 1P4WA 2UXXA 4HQMA 3F21A 5FO5A 5L3EA 1UCRA 2GA1A 3C7JA 1WQ2A 1HKSA 2QWWA 2FU4A 2V6CA 4HF2A 4WX9A 3FX3A 3MZYA 5ERIA 3BZ6A 2FSWA 5ILVA 4HX7A 4JBAA 4I2OA 1LEBA 2HFHA 3GFMA 2XHKA 4KNYA 3ELKA 1O57A 4GYGA 4PDKA 4Y13A 5DCFA 3F6OA 1WSUA 2OBPA 1B6AA 1LJ9A 3IWZA 5HS7A 4ENNA 1YW7A 5J8CA 4L5IA 2R7FA 2K7LA 1J2XA 3J7AO 3KEQA 4NQWA 2PLYA 3R60A 3KETA 2E7WA 2F5DA 3WTZA 5FB2A 4TV7A 2HYFA 3C1DA 2VOPA 1PUEE 2Y0MA 1JHFA 3ZMZA 2XVCA 5K1YA 2IT0A 4AIHA 4S04A 2PBIA 3GFJA 2O6GE 3FM5A 1T2KA 2M87A 3P9IA 4WF2A 1REPC 5A2QK 4IXAA 2QQAA 2DBBA 3L9FA 3O2PE 2IA0A 4ENKA 3G73A 4LLNA 1SFUA 2LSOA 1EH7A 4CO8A 1L0OC 3P7NA 2G9WA 4OOIA 2LDUA 4F7ZA 3LQQA 2QBYA 3GXOA 1Z9CA 1IAWA 2BGCA 4IVNA 2FEZA 1W7PD 2A07F 1P6RA 4UHTA 3ZN1A 1MZBA 4HDVA 4M6YA 4HBLA 2VBXA 3VOEA 1XGMA 2IA1A 2STWA 1ZLJA 5DD8A 1JGSA 3GWZA 4KT5C 4LGWA 5K5OA 1PDNC 3GO5A 2HKXA 4EMSA 4Y15A 2ZO4A 1U5TA 3BOQA 2EFOA 4IRHA 3ZQ7A 4R79A 3J80K 4WK8F 2GIVA 6PAXA 1T38A 3WTSC 2VBYA 1G3TA 2QBYB 3ZN0A 4BHBA 2JRTA 4CGZA 1F5TA 3T0YA 2G7HA 1HSTA 3QU6A 2DT5A 2EV6A 1XGSA 3BJAA 3I64A 3GUDA 2BE5F 2A69F 1XSDA 4LB5A 3EETA 1Z6TA 2V1UA 3RPQA 5EEHA 4M73A 5JHUA 4BXUA 5FFZA 5LGTA 4ZYHA 3TO6A 3WU0A 2FMYA 1I5ZA 4FHTA 2PI0A 3LSTA 5E1WA 2EJRA 1FBSA 2M5WA 1U5TB 2PMHA 2XROA 2V1XA 5JVTA 4H0EA 3H3ZA 4LG0A 3ROUA 5DDGA 2VT3A 4G7OF 2A6HF 3GFLA 3RKXA 1YS6A 2EK5A 2FXAA 2ZMEA 4LFUA 2AXLA 3BJOA 3F8NA 1HKTA 3BJ6A 1ZRDA 2ZNZA 2P6TA 2O3FA 4U7DA 1A04A 3BROA 1TQMA 2EWNA 2Y75A 3N97A 3HRTA 3LFKA 4P9UA 4M71A 2HS5A 2O03A 1JXSA 4RAYA 2E1CA 2XIGA 1DDNA 2R3SA 4YFKF 5LRRA 3WG9A 2D45A 1ZHFA 5AIPA 1RZ4A 3HRMA 1T39A 3E3VA 2MA3A 1K7AA 4UUVA 3MFKA 4O6JA 4L0ZB 1MJBA 4LG0B 4N0BA 2PJPA 1ZARA 3GW2A 3RPUA 5LRSA 3GF2A 5LBQA 2K27A 1KQ0A 4GXOA 3HTUA 4L9TA 1ZRCA 3GFIA 2JPCA 1U3EM 5D8LB 1ZREA 1FOKA 2IPQX 1BI3A 3MWMA 4HX4A 3J80Z 1O7LA 4LLLA 2QVOA 3B73A 3CUQA 4ASNA 2P5LC 1IRFA 4U88A 2AS5F 1D8KA 2L54A 1FC3A 5LEJA 3QRFF 1QZZA 5D4RA 1Z91A 3TKYA 4M9XA 2J5PA 1QBJA 5HLIA 5KVRA 1PP8F 3Q5FA 2OZUA 4G8XA 2K86A 1IXSB 1HW1A 3KCCA 1JE8A 1ON1A 3DKWA 3H3UA 2WV0A 2CSOA 4EJUA 5JFRA 2P5KA 2A68F 2V1DA 4M74A 1Y0UA 2F2EA 2X0LA 3L2CA 1B9NA 4XLPF 3RKYA 1T98A 1KYZA 2GAUA 3AAFA 1FT9A 3WU1B 1ON2A 2DK5A 1J75A 1H0MA 4ZH4F 2OAZA 2FBKA 1G6NA 4P9FA 1ZH5A 5HS8A 2MD5A 1XSVA 3MEXA 3ZMTA 5D8KB 1UFMA 5HLGA 1IW7F 5TRDA 3ABUA 3KP3A 1J5YA 2FF4A 4A6EA 3KLNA 3BPXA 2L3DA 3DPLC 4KN4X 1CGPA 2W84A 1G3SA 1XMAA 1V3FA 4BAYA 4CICA 4I09A 1U6GA 2ZNYA 3T5XA 3RTRA 1WWXA 1KQ8A 1RUNA 3ZMVA 3GEZA 3KP7A 3H92A 2D2WA 3TOBA 4M9SA 2VE9A 1CF7B 3MQ0A 2RNJA 2H94A 3D0SA 4EM2A 2ZFWA 2FOKA 1SFEA 3F23A 5BPDA 3JSPA 5FLXK 3TO7A 2G7UA 4P96A 1YW8A 3QOPA 2JTVA 3E5UA 5F1RA 2J5OA 1KU9A 1HSJA 2K02A 2QQBA 3ABTA 3BWGA 4LD5A 1ZG3A 5E20A 3FXRA 2UZKA 2RDPA 2ADUA 2BBYA 5ICCA 4L0YB 2YSRA 3KZYA 3OV8A 3P9KA 4HA8A 3M8EA 3T8RA 3GVAA 2IA2A 3J81K 4OMZA 1IF1A 1BOAA 1YG2A 4XLNF 1WKMA 3K9TA 2ESHA 4XSXF 4LK1F 3QPHA 3K2ZA 4OINF 3I59A 2GWRA 3MZHA 2Q2EA 1KGSA 1UHMA 5LHHA 1LB2A 1F9NA 3VODA 2H27A 3NEUA 3CUQC 3EDPA 2M45A 4UVAA 2HGCA 2L4AA 1F4KA 4YFNF 3BY6A 2CYYA 2XKOA 3I0TA 3REOA 2Q8KA 2LNBA 1FSEA 3EYIA 3QP6A 3FHZA 2H6BA 1EV7A 2EV5A 4UVCA 1QQIA 1LNWA 3SXYA 2FMLA 2CW0F 2VODA 1YIOA 2MLGA 1KYWA 1KQ9A 4CYDA 1JHHA 3FMRA 3M8FA 2VC1A 1BC8C 2KIFA 5BPIA 2OA4A 4L9JA 2JZYA 1F1ZA 2WC2A 1BI2A 5CYVA 3R61A 3I5UA 3I59B 3ZPLA 1R22A 3JW4A 1XDUA 2P8TA 4G94A 2DTRA 4Q47A 4BHCA 3FMQA 1FLIA 1BJAA 1D5VA 1L3LA 2NYXA 5K5RA 1RIOH 4EVIA 1FX7A 2MBFA 4LK0F 4O3MA 3WGHA 4MTEA 1TLHB 4CXFA 2VBZA 1O3RA 3TGNA 2GXBA 5CVRA 5DV5A 2HTJA 2XUBA 3LAJA 1GVJA 2W57A 2KRFA 5D5VB 5FLXZ 4YIFA 1FZPB 4KUMA 2FA5A 2DPDA 2XAHA 2D1VA 5EEGA 5IT3A 1XMKA 2FBHA 4EQQA 4I98B 2CQKA 2QQ9A 1LDDA 4CDGA 4N9IA 5DYMA 4PGGA 1B4AA 3CLOA 1OYIA 3TOAA 4AVPA 3KP4A 2XAGA 4MQ9F 1UHWA 3DEUA 4WCGA 2COMA 2ZXJA 3I54A 3KZZA 3DV8A 1RI7A 4WXHA 4GO1A 3J81Z 2HQRA 4EM1A 4YFXF 3IKVA 1IN8A 5BMZA 1GXQA 3BDDA 2VT2A 3W6KB 2Y48A 3CO6C 3T1BA 2QZ8A 2DO7A 4ZYDA 1S29A 4MQVA 4RB3C 3ZMSA 1QO0D 4OIOF 4ESBA 3HOSA 4UV8A 2VBWA 2QENA 3WGGA 4P5OA 2BEOA 1QNTA 2OZ6A 4WXDA 3FWEA 3KE2A 1XGOA 3ZP5A 2OD5A 2A5YB 2GZWA 5KK1A 4M9ZA 5HDKA 2YR2A 3HRSA 2BV6A 1K78A 2KJCA 3SHFA 3WTWC 2P4WA 3ERED 1ULYA 3WE2A 2EA2A 1IZ1A 1WRJA 4R8HA 3C18A 5D6FA 4ENJA 1R00A 3IC7A 1BC7C 3RKWA 4MHGA 1FWZA 1SFXA 2UWMA 5HVQC 5A2QZ 3D5LA 3WTTC 5CLSA 1GHCA 3WE3A 3L7WA 2VONA 4HV5A 5AIQA 1PP7U 1LEAA 4K2EA 4IRIA 2KJBA 4BHPA 4UV9A 2Z5UA 2ZBKA 5TJJA 3NQOA 4HW0A 1S3JA 4WWCA 3L00A 3WTUC 1U2WA 3F6VA 4HF0A 3FZVA 5BQTA 3C3WA 3B02A 2CG4A 1HBXG 4A12A 1FSHA 1MKMA 3N4MA 4I01A 2H6CA 3HYIA 3E6CC 2DW4A 1K78B 3L09A 2DQLA 4A2UA 3E6DA 3HSRA 4NHJA 2ESNA 1Z1DA 1Z05A 3V4GA 3FMSA 5LGNA 2PEXA 4XRFA 3HHHA 3DQVC 5L3GA 1W5SA 4ZYEA 2GA2A 5HDNA 4EJTA 2XAQA 1B9MA 2KIMA 4KICA 1YYVA 1EH6A 1OYWA 2L01A 1KU3A 5CVIA 4EV0A 2RQPA 5CVUA 5ED4A 1SMYF 3TQNA 2RKHA 4MTDA 3IKTA 4RB0A 5ICGA 3OOPA 3R6SA 4KIGA 1MD0A 1W5TA 3U9GA 1OKRA 3LA2A 3W6JB 3WTVC 1TQPA 4FX4A 4EGZA 1Q1HA
chains in the Genus database with same CATH superfamily
3FF5A 5E1XA 2KT0A 4A5NA 1YTYA 2XAJA 4HAMA 2JVHA 3KYDB 5E3OA 2IJLA 4M3GA 3LSKA 1K83J 9ANTA 2MFZA 1T6SA 3W2AA 2TDXA 2M8EA 4AC0A 5F6FA 1XN7A 3SEZA 5M5WJ 2VKVA 1WCMJ 2F5FA 1S7AA 4HF1A 2MC3A 4QPQA 3BZCA 1U5TC 1S7OA 4BE1A 3BR0A 4AVZA 1JI8A 2C6YA 1HKQA 2V9PA 4F93B 1APLC 3ZQQA 1ZN2A 3FXLA 5J8FA 1IN6A 2DJNA 3CTAA 4IPAA 5DUIA 1WJCA 2DU9A 3H5NA 5CJ9A 3HOZJ 4AIJA 2LYCA 3I4MJ 3ZOBA 1XSXA 5C4JJ 2VQGA 4E6KG 3DFGA 1TWHJ 4A0ZA 3PO2J 4PZJA 2CUEA 1CF7A 2KISA 4IHYA 1E17A 2R7VA 2RN7A 3W2WA 3RI4A 1P7IA 2E19A 2ZSIB 3W3CA 3L2WA 1R7JA 1FIPA 2DAOA 1LE8A 2DDAA 2L0KA 3G2BA 2I8DA 2E71A 3E5QA 1TTYA 2DI3A 3C2HA 1KU7A 2K9MA 4KA4A 3HSFA 3F8MA 4L5JA 4RS8A 1Z67A 3Q3SA 2YPRA 1YJNI 1G3YA 1YRNA 1WJAA 2FD5A 4RGSA 4DOZA 1BL0A 2EIKH 2XAFA 1LDKB 2H09A 1W7PA 3HPGA 2M8GX 2RC4A 2VC0A 4CZCA 3FXJA 2BHYA 2LKPA 5LGUA 4HDUA 4HG2A 1MMAA 3W6VA 2VN2A 3ABKH 2AQFA 2AHQA 1S6LA 2KRCA 3O3KA 1OMIA 2EZHA 4HLXA 3M1EA 4BKXA 2R5ZA 2Y9ZA 4IQJA 2DJIA 2PQ8A 2HVRA 1R1VA 5FD5A 3ABMH 1JT6A 3RQIA 2DYSH 1IRGA 2M4KA 1YS7A 4ZC3A 1I3QJ 1FYLA 5FFXA 1Y0NA 3DEWA 3ISPA 3CF2A 4M3FA 5J40A 3HSEA 3DP7A 2JA6J 4DBQA 1P4XA 4OU0A 2WAEA 1VI0A 1A6QA 1FYMA 4BBRJ 3S17J 5L3FA 1V5EA 1IUFA 2NNYA 5D6EA 1UJ8A 2B63J 4XIDA 5CVVA 1HW2A 5D5UB 1LE8B 1AWCA 3S14J 4JYKA 2LY2A 2WWYA 2VPRA 3O6BB 4MNUA 1ZR2A 1ZYRF 2FOWA 3IRQA 4OIPF 3BLYA 1YRNB 2NOGA 5D5XB 3CC4I 1S5LC 1W7PB 1ETYA 4U0VA 4ZTFA 3OR1C 1TT5B 2X1CA 3CJNA 1IV6A 1J9IA 2YU9J 2F4MB 2ZKZA 3KLOA 5CQGA 4EGZA 2IS4A 1O7FA 2PMZN 5BOXA 2L5QA 2CUJA 2MW8A 5J6XA 3GTOJ 4KMFA 3AL0B 2YX7A 3NRVA 1U8RA 3OIPA 3GZ5A 2R5ZB 3I4PA 3EYYA 4HYEA 3B6AA 1XCVA 4YIRX 5HS9A 2JSPA 3HOTA 2P5VA 2R7DA 4NC7A 3DXJF 3NWTA 2V79A 5FGMA 2CGPA 2HOAA 1MDMA 2CUFA 4AYBA 2B0LA 1X1CA 4A0XA 4MEXF 4GGGA 3BG6A 3GLXA 3Q9SA 3I9V2 2VXZA 4IHSA 2KDZA 3G71I 2FQ3A 2W00A 4A0YA 2MLKA 2NVQJ 3S2WA 3P9CA 1ZR4A 2EB7A 1E0EA 2NVUB 3BP8A 2DFIA 3ZMUA 1PYVA 2HYGD 4DQ2A 2NS8A 4CZZA 2EILH 2MG4A 4ZDLA 4IEJA 1FJLA 3NWSA 2EV0A 2V7FA 4BNCA 5IP6A 1R1TA 3QU3A 3K4KA 3RPUD 2W85A 4F55A 3PNTA 2XRNA 3MCZA 4BU2A 1DU6A 3JTHA 2DOAA 1G4DA 3IHUA 4FISA 1VF9A 4A6DA 4BH9A 2HOSA 4I0AA 1WJ5A 4MEYF 5GP9A 1XS9A 2FNPA 2VPLA 3S3MA 3RZOJ 1DPRA 3F8BA 1UB9A 2KDOA 3JTGA 3CP2A 1WJFA 4KMUX 2WA0A 2R5YA 4LIUA 4UNOA 3KEOA 3TW6A 2E7XA 2Z99A 2CS3A 3QP5A 3WGIA 2QYOA 1MGTA 1LVAA 2R7OA 3ABLH 3BPVA 4J19A 1E3PA 4F92B 4A3KJ 3HOVJ 2JSCA 2FQ4A 3LSGA 3QYBA 3QOEA 1FOWA 4AD9A 1SD7A 3S8PA 3DU5A 3DBHB 4CCMA 1IN5A 3OYDA 4DYRA 2D1HA 4CCJA 3M9AA 1Z3XA 1R49A 5B1BH 2BXYA 2MH9A 1FNNA 5FKLA 4EJVA 2RV8A 2IGKA 4KN7X 1MDMB 4JK1X 3DF8A 1H8AC 2O9LA 2ISZA 5IOZA 1DGRM 4IHWA 3PNVA 2ELHA 1SAXA 2Y31A 2IEKA 5DM6F 1B1BA 2GOMA 2R7XA 4R1HA 1Z7UA 2P6SA 1NG7A 4HNTA 1VFCA 4A3CJ 3WTXC 2Z33A 4NC6A 1H9GA 4MLOA 4Z2YA 1SD5A 2XF5A 3EUHA 1WI9A 3K1MA 3KEYA 1A36A 2JVGA 1GT0C 2QEXI 2Z1DA 1R5GA 4XM3A 5ICFA 4C30A 4KDPA 1Y56A 1ZGJA 2GIZA 1EKEA 2NS0A 2LF7A 2VKHA 5IOYA 1BIBA 3IH2A 4I99C 2CW8A 2W7NA 3WODF 1QU3A 3CF5F 3RYRA 1UMQA 1NG6A 1D1CA 3H9GA 2IW5A 2LF8A 3TEDA 3RJPA 3LA7A 3QYFA 3G1OA 2PG4A 1IXCA 1USTA 2QLZA 5DUKA 2IVMA 1VQLI 2HPMA 2NVYJ 1ZRFA 1ZTRA 4BXXJ 2DCEA 5H20A 4A3FJ 2XGCA 2QM3A 3E97A 2DFEA 5L3DA 4U0WA 3JSOA 1BI0A 3RDIA 1UHSA 2UXNA 2Z3YA 1FOYA 2DMTA 2HXOA 2YX4A 3KP2A 2FRHA 3PUFA 2E1NA 1P2FA 4G7HF 5HDGA 3S15J 1I1SA 1BR1A 3ZGKA 2UUZA 3BG7A 4BYYA 4EJOA 5ILUA 4HQEA 4ETSA 3A03A 1LDJA 4EJWA 1MH4A 3DKYA 4RBOA 2ACJA 2FBIA 4KIBA 1V5GA 1TW3A 3BG5A 4Y52J 1OISA 1P92A 2K5CA 3MAJA 4IX7A 3LQRA 2CU7A 1NK2P 4ESFA 2X9DA 4HZFA 2CV1A 4L9VA 2STTA 3VDXA 3CCJI 1J59A 3I53A 4Y4RA 4XSZF 4LB6B 4B09A 3Q9VA 1S8NA 1SD4A 1XDSA 1R36A 2L7FP 1P9QC 4LLGF 4PK4A 4C2MJ 2ELJA 4FX0A 4M72A 5IY5H 1H9TA 4IJAA 1UAAA 1ONVA 5ICEA 2NNNA 1BN5A 2EFPA 4RAZA 3DPTA 3E6MA 3AKZA 4O5VA 1ZAOA 4U7BA 1FBQA 4PJMA 3VEPA 1X3UA 2OV7A 2X6OA 5J1YA 2BYVE 3EQLF 4KIFA 4NB5A 5J3LA 3TDZC 1SVOA 2JA5J 5AONA 2AXTC 1T56A 4XLHA 2IGOA 4RB1A 1BOBA 1X4OA 1FPQA 2OQRA 4BACA 1BR4A 2JPBA 3HOXJ 2QCOA 5D5WB 3S1RJ 2BW3B 2VJ4A 5LD2C 1IN7A 3HJEA 2LK2A 1GV2A 2DQRA 2HNHA 1JTXA 3BQYA 1QZEA 1K6OA 5FRNA 1VZ0A 2JA8J 2GQQA 4IRGA 4ON0A 4IHXA 1MBGA 2QA4I 2XC7A 3COAC 2X4HA 1D0YA 3F3XA 3OWTA 3H5RA 3RSNA 1STZA 2BOLA 4G6QA 1YITI 3HGYA 2L7MP 3Q0UA 4U0YA 1HW5A 2PN6A 3CMEI 4IHTA 5DTDA 3JRAA 3PFYA 1PJRA 4UXNA 3GYHX 4XBFA 3R4KA 3IL2A 3FM3A 2JA7J 2F5EA 2HQNA 4RGUA 1KU2A 2P81A 5IP7J 1ZG1A 5K7FA 5JI6A 1K79A 3H0GJ 5F0HA 2DK8A 2QSHX 1I27A 1FTTA 4P55A 3TDUC 4FE4A 2LY1A 2HDWA 3KP5A 1YFHA 3LA3A 2W24A 4F52A 2QGUA 5E17F 2O61A 3OYHA 2DPUA 3QYEA 1R5HA 1M1EB 2YU3A 5LLQA 1MMSA 3CO7C 3CCQI 3M7GA 1E2XA 2DTZA 3GCMA 3LSPA 3RKQA 2Y2ZA 2XKPA 4DW6A 1TNTA 5H2FC 3PJRA 1IUYA 2EA4A 3GTLJ 3CZ6A 2K3FA 1FY7A 3SFZA 1FP1D 4XORA 1YE9A 3JRCA 3U2RA 4UB6C 4IF4A 3G3ZA 5DD4A 3I71A 1QVTA 1J0RA 2ETHA 3JAMK 3K4LA 5DCMA 4QLCU 3IRRA 3L2QA 2WY8Q 3V7SA 3GTGJ 3PM1A 4ABZA 3FXUA 1QHHD 1TWCJ 4UY8I 1MBFA 2MH2A 4BXFA 5K7ZA 4Q5SF 1ZLKA 4D9JA 2A3SA 2XASA 1OPCA 3ECOA 3GTJJ 2PFBA 1HOMA 3OYMA 2DA6A 2ZJ2A 1DU0A 1WJEA 3HKZN 3CLQA 4FASD 3K0LA 2DMNA 3OYJA 1HDDC 4QTRA 3GZ6A 2A5WA 3V7RA 4AUXA 4Y7NJ 4RGRA 5E3LA 3HRUA 1GUUA 1ZGAA 4A5MA 4ZDPA 1MBKA 1Y6IA 2M7AA 1ZG5A 1XG1A 1HXDA 1USSA 1B59A 2BXZA 3QODA 3KP6A 1NHAA 4V2GA 1JT0A 2HDCA 1SAUA 1WH7A 3E5XA 3WTYC 4W97A 3E7LA 4PCQA 1TW2A 5E8GA 1SD6A 4ENMA 2TCTA 4CUGA 4V19K 2VOOA 1YI2I 1RRJA 4OIQF 4MGRA 4XLFA 3QPTA 1QPMA 2OU2A 2CW7A 4EM0B 1EH8A 3DPUA 1Z6RA 1D8JA 1Q1VA 1QGPA 1W4MA 4C3JJ 3EUHC 4I7HA 4M3DA 3H0DA 1G3WA 1Z21A 1JUPA 3G4SI 2GM4A 3BT9A 1FYKA 4E4HA 4QPOA 1TNSA 4PSXA 1C0WA 1XGNA 2L4MA 3E1SA 1X58A 1U78A 4AIKA 1X19A 2FNAA 4NBQA 3LAPA 3HIFA 4G7ZF 4L18B 1O3TA 5E18F 4GDFA 2HKOA 5DCMB 2EFWA 3PUBA 2PMZA 3HTSB 4D7NA 1BI1A 4WXCA 5FKNA 2IS6A 1Z3YA 5JR3A 2K9LA 2ME0A 3ASNH 3E6BA 1FMVA 2F5CA 3F8CA 1MNEA 1MBEA 2KKOA 2O0YA 3ZQCA 1DPUA 2A61A 4HEA2 1AOYA 3LL7A 5F04A 3CC2I 1RKTA 4YEJA 2HR3A 5CVJA 2KZVA 4E7JA 2WTEA 3T8TA 2NXNB 5DEQA 2ZMEB 4GCVA 2ZJPF 3ZMDA 1OCCH 3I58A 1I1GA 3GX4X 4Q4ZF 4XKVA 5BS6A 2VE8A 2L7KA 4LJZF 2EFQA 4A3IJ 1BW6A 2EBIA 4Q48A 4UVBA 4ZYGA 1VQ4I 1XB4A 1GDTA 5IT9K 3MMYB 1MBHA 5F0CA 3GTKJ 1IXRC 5TISC 2H1KA 3PQKA 4XKBA 1AA7A 3PQJA 5D4SA 1I39A 2ISYA 1T8IA 3F9KA 1XMXA 2X51A 3V7CA 2Q0OA 2KFDA 2A6EF 3UNGC 2VQLA 1Y39A 1MJAA 3FISA 5HLHA 5ILSA 3EUAA 5EZGA 2L02A 4M6XA 3U1DA 4YG2F 3V8JA 1TP4A 3B6CA 3BZKA 2F4OB 4RA2A 1RNLA 4B1RA 2P7CB 5FD6A 1LPQA 1SFKA 3R0JA 4XKCA 4QWQA 3VB2A 1YO5C 5B3SH 3VFZA 3OSGA 1LFPA 4CHUA 4PJ0C 2HWVA 4X0GA 4OMYA 1TBXA 2M1BA 2E36A 3G1MA 1V4RA 2WAQN 4KYWA 3OYKA 2Z9OA 3F72A 2CWEA 5KCMA 3FXQA 2E1MB 1I3AA 1HC8A 1ITYA 2ZC2A 3MN2A 3QAHA 1U0JA 1DP7P 1KZHA 1LQ1A 2NS7A 5J4VA 1LKXA 1X1AA 3ML6A 4G6DA 4RLQA 2ME6A 2HPIA 4LMYA 1SVLA 4Y17A 4E7ZA 4RB2C 2GLOA 5F1JA 2FE3A 4AU7A 5GAHJ 1QZYA 5LFAA 4CA0A 2LH9A 3CD6I 3JAMZ 3F8FA 3HEFA 2ZCWA 4HX8A 4PFPA 1O4XA 4L9NA 2IS2A 2VKEA 2XV4S 1XD7A 1Z7LA 1K61A 4B3AA 2G0EA 2DA3A 1D1BA 2R4GA 5K5QA 1BM9A 1MJ9A 4G12A 1YQAA 1KA8A 2KMUA 4ZZLA 4GYIA 1X3WB 4JQFA 2R7ZJ 2L7ZA 2CQXA 2R7RA 3NAUA 3SQNA 4J00A 2K4BA 4AM3A 2ELKA 3CUQB 2IRFG 2VUMJ 3CUOA 4FT8A 4Z6YA 4EGYA 1S7EA 5F27A 1K6YA 1HA8A 4ESJA 2HEOA 2XGXA 1SMTA 1TQIA 2MYSA 3WHCA 1FOXA 3J7YJ 1G8XA 3ECHA 2DODA 1VTNC 3HDDA 5F64A 3J7ZI 1BIAA 2CO5A 2GXGA 4XONA 4RGXA 4G9YA 5LHGA 3S3OA 4DJAA 4YIIA 1RUOA 1WPKA 5H6RA 3OYBA 3KPHA 2VJ5A 2ID3A 5C3EJ 1P7JA 3V8LA 2CFXA 4HLYA 1O3SA 4DNCA 5GAEJ 1J7KA 1BBYA 4S05A 3R0AA 4BY7J 1ZK8A 4BL0B 4MO7A 2MABA 4B8XA 3CMAI 2PMUA 5H6QA 1T0FA 4HV6A 2IP2A 2NRAC 1DGWY 1ETKA 4M3BA 3KFWX 4NUBA 5E1ZB 3VYUB 4X1EA 3SZTA 3PFIA 1IC8A 2I10A 2RVCA 4QIWN 4II2A 4BE0A 4ANJA 5LHIA 2RAEA 5E8IA 3CJRB 4HOBA 2KQRA 2DA7A 3LMMA 2HTSA 5L3BA 1YLFA 2PJRA 1VQNI 3LNQA 1IN4A 4S0HB 2NAZA 1ZQ3P 3RYPA 3K1PA 3TO9A 3ULQB 4N9HA 2DLLA 4D0PA 3K1NA 2V9VA 1VQ9I 2RGVA 1MMNA 1OYYA 3V8KA 4BS9A 2ZJRF 4AWXB 3O8GA 2FX0A 2OQGA 2EFNA 4ZJZA 2K9QA 1D3YA 3ZCOA 2Y30A 1OR7A 2EQRA 3HUGA 1J09A 2HOEA 1R23A 1YIJI 3X2QH 1VQ6I 3A4CA 1FP2A 3OIQA 1R1UA 1XCBA 5FKKA 3HGGA 3K69A 3LWFA 2V9KA 1VQPI 1PUFA 3SZPA 4KFCA 1OLTA 5LEKA 2HZTA 1HQCA 2KIUA 2OCEA 3F22A 4A3MJ 3S32A 2DFHA 3IWFA 4V2FA 2M30A 4E70A 3JREA 4OIRF 5IT9Z 1FBUA 5L3CA 2XAUA 5K7HA 1YW9A 3VWBA 1R58A 3CDHA 1I6XA 2ID6A 4I0BA 1DUXC 2K4JA 2VQHA 3CESA 1ODDA 1WHUA 3I56I 3VYRB 2JT1A 4XLEA 2M3AA 1P4AA 3FHNA 5EZHA 2P7VB 5F0FA 5HOOA 1O3QA 4PGHA 5CQEA 2HVSA 4ZZDA 4I02A 3A02A 4UUSB 4BQAA 3SDGA 2W25A 1GXPA 2YUSA 2O8XA 3RIRA 4XR6A 2VXDA 2QUFA 2XGDA 3I55I 3HHGA 1VQ7I 3BG3A 1P4WA 2E1MC 2UXXA 2OPTA 3ESWB 2DMQA 3BR3A 3FXOA 4DZPA 1Y8QB 3PIOF 4HQMA 3A0HC 2ZJQF 1IDYA 5FO5A 3F21A 5L3EA 1UCRA 2GA1A 3C7JA 1HCRA 1BR2A 3AG4H 2PJRB 1SANA 3K4JA 5B66C 2CH0A 1WQ2A 1HKSA 2QWWA 4RLFA 2FU4A 3CDLA 2V6CA 4HSRA 4E7SA 4WX9A 1ETVA 4HF2A 3FX3A 2K40A 3MZYA 4UUTA 2XSJC 4XNFA 5ERIA 3HUGB 3BZ6A 3HOWJ 2FSWA 4IQ4A 4IL6C 5ILVA 4HX7A 4JBAA 2LR8A 4I2OA 3VYSB 1LEBA 2HFHA 3QWLA 5J1RA 3QPSA 3GFMA 1PUFB 3JRDA 2XHKA 4KNYA 2XPUA 3ELKA 1O57A 4XKWA 3SFIA 4BUPA 4NC8A 2WB1A 4GYGA 4BJTA 4PDKA 5BNGA 3KX2A 4Y13A 5DCFA 1ZELA 2KIQA 3F6OA 3I3LA 1WSUA 2V4JC 3EUKL 3D5SC 1RR8C 3IP4B 4BDZA 2OBPA 1Y1WJ 1B6AA 2V26A 3K4MA 3QQAA 3OYIA 1LJ9A 3IWZA 2LY9A 5FKOA 4H4KC 5HS7A 4IHVA 3HC7A 4JX5A 3TW7A 1YW7A 4ENNA 3VPRA 3UR3C 1X2MA 3BC8A 4L5IA 5J8CA 2R7FA 1S72I 2K7LA 1J2XA 1FIAA 2L9VA 3J7AO 3HKZA 3KEQA 2BHZA 4NQWA 3R60A 2PLYA 1E3OC 3KETA 2E7WA 2F5DA 1T08B 3WTZA 3TP0A 5FB2A 1R9TJ 4TV7A 2HYFA 3C1DA 2VOPA 1PUEE 3D1NI 2Y0MA 1JKQC 1I6HJ 1JHFA 2IAIA 2VJIA 3ZMZA 2LC2A 4OAYA 2XVCA 3H35A 4B3XA 5K1YA 2IT0A 4AIHA 3DTKA 3P5JA 4S04A 2PBIA 3GFJA 1JJ8C 2O6GE 1QHGA 2RQQA 1V54H 3FM5A 1MIJA 1MNMC 2LTPA 1VQOI 2HOTA 1T2KA 2M87A 3P9IA 4WF2A 3AFHA 5FROA 2UV1A 5A2QK 1IJWC 1REPC 4IXAA 3DKXA 2QQAA 2V1NA 2DBBA 3L9FA 3O2PE 2IA0A 4ENKA 3G73A 4D7MA 4LLNA 1R4NB 1YJ9I 3SZGA 2JRMA 2BW3A 5KNLA 1SFUA 2LSOA 2GXAA 1EH7A 1MSEC 1XTAA 1MH3A 4CO8A 3PIPF 1L0OC 3P7NA 2G9WA 3CCUI 4OOIA 3L1PA 2LDUA 4F7ZA 4ZYAA 2VJJA 3LQQA 2QBYA 4KITB 3GXOA 3S2HJ 3OYLA 1Z9CA 1IAWA 2BGCA 4IVNA 2CQNA 3HM5A 2FEZA 3AL0C 1ACIA 1W7PD 1RR7A 3K6GA 1YX5A 3S93A 5M5XJ 2A07F 1P6RA 4UHTA 2EIJH 3Q0WA 5EYRA 3M1CA 2QSGX 3ZN1A 4J01A 1MZBA 5CKTA 4NQWB 2E5NA 3EPZA 1QVUA 2XGEA 4HDVA 4M6YA 1MMDA 4KJZA 4HBLA 5B1AH 1HDPA 4MFDA 2VBXA 2L9RA 4JP0A 1XGMA 2DT6A 3VOEA 1Z77A 2HXIA 2IA1A 1GVDA 2Y0SN 1ZLJA 2STWA 1T0FC 3BQZA 1ERDA 5DD8A 2CQQA 1JGSA 2B7EA 3GWZA 4KT5C 3OS0A 3CCLI 3SJMA 4LGWA 5K5OA 3BR2A 1PDNC 3GO5A 2HKXA 2M7BA 2P0WA 2LKXA 4C2UA 4IZZA 4EMSA 3N05A 4Y15A 2VASA 2EZLA 2ZO4A 2O7OA 1U5TA 3BOQA 1JGGA 1TT0A 4M3EA 1ZGWA 2WY7Q 2HI3A 4CH7A 2EFOA 1RETA 4IRHA 2ECBA 2DOFA 3ZQ7A 4R79A 3WHBA 3J80K 4WK8F 1OR7C 2GIVA 6PAXA 3PL8A 4XRSG 2DDBA 1T38A 3JR9A 3WTSC 2VBYA 1G3TA 4DYCA 2WAQA 1H88C 1T95A 1JKOC 3ZR8X 2QBYB 1BJZA 3ZN0A 1AU7A 4BHBA 2E2HJ 2F6CA 2JRTA 3LSHA 4CGZA 1F5TA 3FKIJ 3T0YA 2G7HA 1HSTA 3QU6A 4HNVA 2DT5A 5FLVA 2EV6A 2DMPA 4D5CA 4FCYA 1OCTC 1XGSA 3G1LA 3BJAA 1TWFJ 3FXKA 3CMYA 3I64A 3GUDA 4HRIA 1N78A 2LBFA 2BE5F 1LUJB 3AG2H 2A69F 1TL8A 1XSDA 3CCVI 2EH3A 1LFUP 4LB5A 3EETA 3HOYJ 2JK3A 1Z6TA 1FMWA 2W48A 2JJ7A 2HQ5A 3RPQA 2V1UA 3O8HA 5EEHA 3IAM2 4DZJA 4M73A 4C3IJ 5JHUA 2E2IJ 4BXUA 4CCKA 5FFZA 4U87A 5LGTA 1X3ZB 4ZYHA 3TO6A 2M34A 1S9HA 3WU0A 2FMYA 1I5ZA 4FHTA 2R7UA 2PI0A 2JN6A 3LSTA 1R6RA 1X2NA 2OJED 4UB8C 2CUZA 5E1WA 2ECCA 2EJRA 1FBSA 1LFBA 2M5WA 1U5TB 4E7HA 4C2TA 1WZ2A 2PMHA 2XROA 4CCOA 2V1XA 1U9NA 5JVTA 4H0EA 2DA1A 3H3ZA 4LG0A 3OS1A 2XSDC 3ROUA 5DDGA 2JMWA 2VT3A 3KYLA 5M3FJ 1SC7A 4PFOA 4G7OF 2V6EA 2A6HF 3GFLA 3W2VA 4A69C 4DIQA 2BZTA 2I5UA 3E0JB 4BQQA 3RKXA 2IXSA 1YS6A 3FKJA 5JHFA 3I4NJ 4MIMA 2EK5A 1YJWI 2FXAA 2ZMEA 3OIOA 4LFUA 2AXLA 3BJOA 1IRXA 3F8NA 4G6TB 1HKTA 3BJ6A 2BVMA 2CFOA 4BJ6C 1ZRDA 2ZNZA 5DM7F 5IPAA 2P6TA 1IDZA 2O3FA 2R7TA 1B72A 3L2UA 5JLXA 2F48A 2WBMA 1A04A 4U7DA 3BROA 2LBFB 1CQTA 1TQMA 2EWNA 2Y75A 5KAIC 3S2DJ 3C2BA 3N97A 2ZSHB 2KLOA 3HRTA 3LFKA 4P9UA 4M71A 2HS5A 2DFFA 2AO9A 5EJCA 5JLWA 2O03A 2DOEA 5FJ8J 1EF4A 1JXSA 4RAYA 2E1CA 3Q0VA 2XIGA 1YHQI 1DDNA 2R3SA 4YFKF 5DS9A 1N77A 5LRRA 4BQNA 3WG9A 2NOJB 1ZHFA 5AIPA 1RZ4A 3CCYA 2ICWG 3HRMA 1XC5A 2D45A 1T39A 1OQYA 3E3VA 2MA3A 1K7AA 3TL4X 4E7IA 3DEEA 3BTLA 1X1DA 1IO2A 3GTMJ 4UUVA 1UELB 1VQ5I 3F0CA 2CJJA 3MFKA 4O6JA 2PX9A 4L0ZB 1Y8RB 1MJBA 1QPIA 3DBRB 1D5YA 2R0QC 2K85A 2AQEA 1UG0A 4LG0B 4N0BA 2PJPA 4BE2A 1ZARA 1AKHA 1TWAJ 3LOCA 3GW2A 3RPUA 2X48A 5LRSA 2FJ1A 1VNDA 2K9SA 2M0MA 3GF2A 1B8IA 5LBQA 2K27A 1KQ0A 3CJQB 2KHMA 4GXOA 4ITVA 3HTUA 4L9TA 2E35A 3BCAA 1ZRCA 3GFIA 2JPCA 1KONA 1U3EM 5D8LB 3BTJA 5EGOA 1TZLA 1ZREA 2HQAA 5EF6A 1FOKA 4LITA 2DN0A 2OTLI 2LMDA 2IPQX 1BI3A 3MWMA 3H3VK 4HX4A 1B72B 2DT7B 1RPWA 3H9JA 1O7LA 3J80Z 4LLLA 4ZTJA 2QVOA 5HODA 3VSKA 2ZXWH 3ZQFA 3B73A 2WADA 3CUQA 4ASNA 2P5LC 4E7LA 3BR5A 3HG9A 4LIVA 3H36A 3FBNB 3WG7H 2HVQA 1IRFA 4U88A 2AS5F 1D8KA 2VIXA 2ZXHA 1U8BA 2L54A 1FC3A 5LEJA 3QRFF 3D5RC 4HNUA 5E3NA 3HOUJ 4A3GJ 2F5VA 2MSYA 2X6WA 3CC7I 3BCBA 3VYTB 3MVPA 1QZZA 2VL8A 2QF7A 5D4RA 1Z91A 4OWRB 3TKYA 3CDIA 3V42A 1VQ8I 2ZB9A 2COBA 2Y9YA 4M9XA 2J5PA 5E3MA 1QBJA 1NK3P 5HLIA 5KVRA 1PP8F 3Q5FA 5GAGJ 3BTCA 4BY1J 2OZUA 4JX4A 2QSFX 3U21A 4G8XA 1W0UA 2K9NA 2K86A 3TMOA 4A93J 1IXSB 1HW1A 3KCCA 2E34A 3CCRI 1AKHB 3IUOA 3DCFA 3OYAA 2M0CA 4RAGA 1ON1A 1JE8A 1OJLA 3DKWA 3H3UA 4JX6A 4EEFG 1B8IB 2WV0A 2L9SA 4A3EJ 2CSOA 4EJUA 3JRBA 5JFRA 2P5KA 2A68F 1N75A 4XLAA 1IRZA 5EGOB 2V1DA 4M74A 5GADJ 1Y0UA 2K3PA 2F2EA 4OAZA 3M3YJ 2X0LA 4XN0A 3K2AA 3L2CA 1F43A 3DLAA 4B4CA 1B9NA 3SDBA 4XLPF 3RKYA 1WFXA 1T98A 1KYZA 2LVSA 2GAUA 3CJTB 4A3BJ 3M4OJ 3AAFA 3OOUA 1FT9A 3DWLE 3GBGA 2LOOA 3WU1B 1A5JA 1MSFC 1ON2A 2DK5A 2M9HA 3OL3A 2LKSA 4XK4A 1J75A 1H0MA 5KHDA 2BY1A 2OAZA 2FBKA 4ZH4F 1G6NA 4P9FA 1ZH5A 2KPMA 3IAS2 2X1EA 3ERMA 2QKMB 1D0XA 2E60A 2XF7A 5HS8A 2MD5A 2CV0A 1XSVA 3MEXA 2W1OA 1POGA 4HSTA 3ZMTA 5D8KB 2XF6A 1UFMA 5HLGA 4CCNA 1IW7F 2D5VA 5TRDA 3ABUA 4B48A 2VKDA 3KP3A 2EZKA 1J5YA 2FF4A 3PSFA 2HYJA 1JUSA 4UUSA 4A6EA 3KLNA 3BG9A 4FQGA 3AG1H 2RNGA 3BPXA 2L3DA 4F3QA 3DPLC 4KN4X 3CCMI 1N25A 2W84A 1G3SA 1CGPA 1XMAA 1V3FA 4BAYA 4CICA 4I09A 1U6GA 5GTHC 2JWTA 1MNDA 2ZNYA 2WV1A 3OY9A 4CCLA 1XPXA 3T5XA 2Q1ZB 3RTRA 1WWXA 1KQ8A 1RUNA 3ZMVA 3GEZA 3KP7A 1W36C 1BA5A 3H92A 2TRTA 3JCUC 2D2WA 4Y33A 3TOBA 2ZMEC 2CV2A 1X1BA 4M9SA 2VE9A 1CF7B 3OS2A 3MQ0A 4L5EA 4C9YA 2R7WA 2M4GA 2RNJA 2Y0SA 5GPAA 2H94A 1Y1VJ 1V5FA 4HPQA 3HPHA 5FKMA 3CP8A 2DMUA 5EDNA 5GTIC 2R7SA 1ETOA 3D0SA 1W36D 2HZDA 2E2JJ 2Z16A 1IV8A 4EM2A 2ZFWA 1JKPC 1OFCX 4D5FA 3CQZJ 2FOKA 1SFEA 4EATA 3F23A 5BPDA 3JSPA 2B9SA 3TO7A 2Y69H 4KISA 5FLXK 2G7UA 4P96A 1YW8A 3QOPA 3RZDJ 2JTVA 3E5UA 5EG0A 2W82A 3WU2C 2XB5A 3CCEI 3H9QA 1A31A 5F1RA 2J5OA 1KU9A 1HSJA 2K02A 2QQBA 3ABTA 3BWGA 2EPFA 5F08A 1RKWA 3H5AA 4B43A 1MMGA 4FETA 4NNJA 4XRMA 4LD5A 1ZG3A 2KL4A 3IH4A 2A6TA 4BGDA 5C44J 4RM2A 5E20A 3FXRA 2ZFUA 1G2HA 5HLTA 4JOMA 1I50J 2VB6A 2UZKA 2RDPA 2ADUA 2BBYA 5ICCA 5B5EC 5M3MJ 2YSRA 3KZYA 4L0YB 4FTHA 3OV8A 1U9OA 3P9KA 4HA8A 3M8EA 3T8RA 3GVAA 2IA2A 4BEHA 3J81K 3LSJA 1WJBA 1WH5A 3HXLA 4OMZA 1BOAA 4PUSA 1IF1A 3A0BC 1YG2A 3H1CA 3K10A 4CYCA 1YX3A 4XLNF 3OYCA 1JJ6C 3UKGA 1WKMA 3MZ8A 4X6AJ 3K9TA 4GRIA 3L2VA 2ESHA 4LG3A 4XSXF 4BQOA 4LK1F 3QPHA 3OYEA 1K4TA 3IH3A 1A6IA 4PJJA 3K2ZA 4XOPA 4DBRA 3L2RA 4OINF 3I59A 3S3NA 2GWRA 3MZHA 1T33A 1ETQA 2Q2EA 2RREA 3HL2A 2LLKA 1KGSA 1UHMA 5LHHA 1GLNA 1LB2A 1F9NA 1DP3A 2EIMH 3VODA 2H27A 3NEUA 3CUQC 3EDPA 1SFOJ 2M45A 4UVAA 4A3LJ 2HGCA 3TBIA 2L4AA 1F4KA 4YFNF 2NVTJ 2DXIA 3BY6A 3GZNB 1G59A 5EG0B 4I6ZA 4N4NB 3DBLB 4II3A 4RAFA 2CYYA 1HLVA 4D1QA 2XKOA 2YS9A 3I0TA 3S1NJ 3K4CA 3S1MJ 3REOA 3FK7A 2X1DA 4LOCA 1EA3A 3FK6A 2Q8KA 2LRDA 2LNBA 1FSEA 4F91B 3EYIA 3QP6A 3FHZA 1A35A 4PJLA 2FUG2 2R7QA 2VI6A 2H6BA 1EV7A 1W1WE 2EV5A 2H1LA 4UVCA 3GLLA 1QQIA 1JUMA 1LNWA 1ZKGA 2FMLA 2CW0F 3SXYA 4C3HJ 2VODA 1YIOA 2MLGA 3C2GA 1KYWA 2L2OA 4RDUA 1KQ9A 4BEHB 4CYDA 1JHHA 1D0ZA 3FMRA 3M8FA 2VC1A 5J4YA 4CYCB 3M07A 1BC8C 2KIFA 4GFBA 5BPIA 1SEUA 5IYCJ 2OA4A 4L9JA 4XMYA 2JZYA 2N8GA 4DYQA 3MKZA 2XDVA 3ONQA 4XQFA 1F1ZA 2WC2A 1BI2A 5CYVA 2CRGA 3R61A 1RESA 3I5UA 4A3JJ 3I59B 3JRHA 3ZPLA 1R22A 3HBLA 3JW4A 5FRMA 1XDUA 3JRFA 2P8TA 2Q2EB 4G94A 2W4SA 3MKYB 2Z2SB 4PSWA 5EEAA 2L9NA 2DTRA 3PSIA 4Q47A 4BHCA 3FMQA 1FLIA 1BJAA 1D5VA 1L3LA 1TWGJ 2NYXA 3AG3H 4XL9A 3RQ4A 5K5RA 1RIOH 4EVIA 1FX7A 1SVMA 2MBFA 2VQCA 4LK0F 3WGHA 2R5YB 4O3MA 2E5ZA 4MTEA 4B47A 1TLHB 1Z0XA 4CXFA 2VBZA 1R4MB 3TGNA 1O3RA 3KIOA 3PNYA 5TGTA 3SEQA 2GXBA 5CVRA 5DV5A 4RM3A 2HTJA 3BR6A 3OMYA 1HF0A 2XUBA 3LAJA 1GVJA 4KT6A 5E79C 3SYTA 3OR2C 3K4BA 2QQ8A 3ZQIA 1K4SA 2W57A 1GV5A 2KRFA 3LSRA 2HDDA 5D5VB 5FLXZ 4YIFA 2KRHA 1FZPB 3DLLF 1LVKA 4KUMA 2IGMA 2FA5A 2DPDA 1QRYA 2XAHA 2D1VA 5EEGA 5IT3A 1XMKA 2FBHA 2O8KA 4EQQA 2ZXIA 2CQKA 4I98B 3DTIA 2QQ9A 4BJ5C 1TC3C 2BY3A 3M8JA 3KYCB 1LDDA 1OCPA 1OCOH 1PVEA 3OL4A 4CDGA 4N9IA 4IO9F 5DYMA 4PGGA 5GPCA 2VLAA 2X6YA 1B4AA 2WAFA 3CLOA 4FE7A 1OYIA 2DA4A 2M2EA 1E3HA 2XAGA 3KP4A 4MQ9F 3TOAA 2BY2A 4AVPA 4IOCF 1FEXA 3J7AY 3OYGA 3LSIA 1UHWA 1X1PA 3DEUA 4WCGA 2COMA 2ZXJA 1UZCA 2JUCA 4Y3OA 3I54A 3KZZA 3DV8A 1RI7A 4WXHA 5IYBJ 4GO1A 3J81Z 2HQRA 2H8WA 4QSHA 4EM1A 2A05A 2DA5A 4YFXF 3ZQHA 3FXMA 3IKVA 3MKWB 1IN8A 3GTQJ 2O5RA 4CSWA 5IP9J 5BMZA 1ORKA 1GXQA 3ZXSA 3K7AJ 4XOTA 2GBYA 3FBIB 3BDDA 1XX5A 2VT2A 3W6KB 2Y48A 3CO6C 3T1BA 2QZ8A 2DO7A 4AYBN 2X85A 1D1AA 4ZYDA 1S29A 1W0TA 4MQVA 4RB3C 3TP3A 4BDYA 3ZMSA 2LD5A 1QO0D 4OIOF 4ESBA 3DTEA 5FLMJ 3HOSA 3K4NA 4UV8A 4MFEA 3CCSI 2VBWA 2QENA 3WGGA 4P5OA 2BEOA 4P1WA 1VQMI 1QNTA 2OZ6A 4WXDA 2IGNA 1FTZA 3A01A 3FWEA 4YELA 2DA2A 3LFUA 3OYNA 3BTIA 3KE2A 5HNFA 1XGOA 3ZP5A 2OD5A 1IG7A 5HNHA 3HB9A 2A5YB 2GZWA 2OUMA 5KK1A 4M9ZA 3S16J 5HDKA 2YR2A 3OSFA 3HRSA 2JQ7A 2BV6A 1K78A 2X6XA 1H89C 2KJCA 3SHFA 3WTWC 2BY0A 2P4WA 2EZIA 5IYDJ 3ERED 4IKFA 3DU6A 1ULYA 3WE2A 2EA2A 1IZ1A 1WRJA 3G6EI 4R8HA 1EJ9A 3C18A 1JKRC 3HZJA 3NARA 5D6FA 2LP0A 3RCOA 4ENJA 1R00A 4PJNA 3IC7A 1W5CC 2WB1N 1BC7C 2LG4A 5JVGF 3RKWA 5C4XJ 4MHGA 1WJDA 2JA2A 1MW7A 2XRLA 1IGNA 1FWZA 1SFXA 4DGWB 2UWMA 5HVQC 1ETXA 3D5LA 5A2QZ 5CLSA 4XICA 3WTTC 3K70C 4IOAF 1GHCA 3WE3A 3L7WA 4XN3A 2VONA 1UG2A 2CQ7A 2IBDA 3ZQLA 4HV5A 2HU9A 3MD2A 5AIQA 1PP7U 4N4OB 1LEAA 4K2EA 3BR1A 4IRIA 2KJBA 2R93J 4BHPA 4UV9A 2XPVA 2Z5UA 2F4IA 2ZBKA 5TJJA 3A2KA 3NQOA 4HW0A 1WGXA 1NTCA 1S3JA 4WWCA 2IS1A 1DQUA 4W1UA 3L00A 4NDLA 4YRVA 3WTUC 1U2WA 3F6VA 1OCZH 4HF0A 5M5YJ 3K70D 1QA6A 3FZVA 2OTJI 2KZGA 5BQTA 1JTYA 1WVRA 3C3WA 3B02A 1V55H 2CG4A 1BW5A 1HBXG 3A01B 4A12A 1FSHA 1AHDP 5KAFC 5J47A 1MKMA 1MBJA 2EINH 3N4MA 3S1QJ 5CPRB 4I01A 2OC6A 2MD0A 2XPWA 2CMPA 3ZQGA 2H6CA 3HYIA 3PO3J 2KP6A 2DW4A 3OYFA 3E6CC 1K78B 1VQKI 3L09A 2DQLA 4A2UA 1X4PA 2XB0X 3E6DA 3HSRA 1OCRH 2LFBA 4XLCA 4M6VA 5J1UA 4NHJA 4ZDOA 2ESNA 3GMEA 1Z1DA 1Z05A 3V4GA 3FMSA 4A3DJ 3ASOH 5LGNA 2PEXA 4XRFA 3HHHA 3DQVC 5L3GA 1W5SA 4ZYEA 2GA2A 1RC9A 3KZIC 5HDNA 4EJTA 2XAQA 1R71A 1R5ID 4RMNA 1B9MA 1YOVB 2KIMA 4KICA 3VSLA 1ENHA 1YYVA 3MKLA 4AIDA 2MGQA 1EH6A 2E1OA 3GTPJ 1OYWA 2L01A 1KU3A 3QPLA 3IV5A 5CVIA 2QKLB 2GOXB 4EV0A 2RQPA 5CVUA 1NH3A 3CMMA 1ETWA 2BVLA 4E7KA 5ED4A 1SMYF 3TQNA 2DYRH 2RKHA 3JRGA 2R92J 1F36A 3FIWA 2OCCH 4MTDA 3IKTA 4RB0A 2H8RA 2MC4A 3ZRGA 5ICGA 4XRSA 3OOPA 2JUGA 4KIGA 3R6SA 3JRIA 3U1KA 3A1YA 1MD0A 1WI3A 2LREA 4BBSJ 1W5TA 3U9GA 2NVXJ 4B44A 1OKRA 3LA2A 3FDYA 4I76A 3LSMA 3W6JB 3WTVC 1TQPA 4FX4A 2OF7A 1Q1HA
chains in the Genus database with same CATH topology
3FF5A 5E1XA 1YTYA 4A5NA 2XAJA 4HAMA 2IJLA 1T6SA 2TDXA 2M8EA 5F6FA 1XN7A 2F5FA 1S7AA 4HF1A 2MC3A 1U5TC 1S7OA 2C6YA 1HKQA 1ZN2A 5J8FA 1IN6A 3CTAA 4IPAA 5DUIA 2DU9A 5CJ9A 4AIJA 1XSXA 3DFGA 4A0ZA 4PZJA 1E17A 1CF7A 2RN7A 3RI4A 1R7JA 2DAOA 3E5QA 1TTYA 2DI3A 1KU7A 4KA4A 3HSFA 3F8MA 4L5JA 4RS8A 2YPRA 1G3YA 4RGSA 2XAFA 1LDKB 2H09A 1W7PA 2RC4A 2VC0A 2LKPA 5LGUA 4HDUA 2VN2A 1S6LA 3O3KA 1OMIA 4HLXA 3M1EA 2PQ8A 1R1VA 5FD5A 1IRGA 1YS7A 1FYLA 5FFXA 3ISPA 3HSEA 3DP7A 1P4XA 4OU0A 1FYMA 5L3FA 2NNYA 5D6EA 5CVVA 1HW2A 5D5UB 1AWCA 2WWYA 3O6BB 4MNUA 1ZYRF 3IRQA 4OIPF 5D5XB 1W7PB 4U0VA 3CJNA 1J9IA 2ZKZA 3KLOA 1O7FA 5BOXA 5J6XA 4KMFA 2YX7A 3NRVA 1U8RA 3GZ5A 3I4PA 3EYYA 4HYEA 1XCVA 3HOTA 5HS9A 2P5VA 2R7DA 3DXJF 2V79A 5FGMA 2CGPA 1MDMA 2B0LA 4A0XA 4MEXF 4GGGA 3GLXA 3Q9SA 4IHSA 2VXZA 2FQ3A 4A0YA 2MLKA 3S2WA 3P9CA 2EB7A 3BP8A 2DFIA 3ZMUA 2HYGD 4DQ2A 4CZZA 2EV0A 4BNCA 1R1TA 3QU3A 2W85A 2XRNA 3MCZA 3JTHA 1G4DA 3IHUA 4A6DA 4BH9A 4I0AA 4MEYF 2FNPA 1DPRA 3F8BA 1UB9A 3JTGA 4KMUX 4UNOA 3KEOA 2E7XA 2Z99A 3QP5A 3WGIA 2QYOA 1MGTA 1LVAA 3BPVA 2JSCA 4AD9A 1SD7A 1IN5A 2D1HA 3M9AA 2MH9A 1FNNA 4EJVA 2RV8A 4KN7X 1MDMB 4JK1X 3DF8A 2ISZA 1SAXA 2ELHA 1B1BA 4R1HA 1Z7UA 2P6SA 3WTXC 2Z33A 1H9GA 4Z2YA 1SD5A 3EUHA 1WI9A 3K1MA 1R5GA 5ICFA 4KDPA 1ZGJA 2NS0A 2LF7A 1BIBA 3WODF 3RYRA 2IW5A 2LF8A 3RJPA 3LA7A 2PG4A 1IXCA 1USTA 2QLZA 5DUKA 2IVMA 1ZRFA 5H20A 2QM3A 3E97A 5L3DA 4U0WA 3JSOA 1BI0A 3RDIA 2UXNA 2Z3YA 2YX4A 3KP2A 2FRHA 2E1NA 1P2FA 4G7HF 5HDGA 1I1SA 4BYYA 4EJOA 5ILUA 4HQEA 4ETSA 1LDJA 4EJWA 2ACJA 2FBIA 4KIBA 1TW3A 1P92A 3MAJA 3LQRA 4ESFA 4HZFA 4L9VA 2STTA 1J59A 3I53A 4XSZF 4LB6B 4B09A 3Q9VA 1S8NA 1SD4A 1XDSA 1R36A 4LLGF 4FX0A 4M72A 1H9TA 4IJAA 1ONVA 5ICEA 2NNNA 1BN5A 2EFPA 4RAZA 3DPTA 3E6MA 4O5VA 1ZAOA 4U7BA 1FBQA 3VEPA 1X3UA 2BYVE 3EQLF 4KIFA 4NB5A 3TDZC 5AONA 4RB1A 1FPQA 2OQRA 2JPBA 5D5WB 1IN7A 2DQRA 1K6OA 2GQQA 4IRGA 4ON0A 3COAC 2X4HA 3F3XA 1STZA 4G6QA 4U0YA 1HW5A 2PN6A 4IHTA 4UXNA 3GYHX 4XBFA 3R4KA 3IL2A 3FM3A 2F5EA 2HQNA 4RGUA 1KU2A 1ZG1A 1K79A 5JI6A 2DK8A 1I27A 4P55A 3TDUC 3KP5A 1YFHA 3LA3A 2W24A 5E17F 2O61A 2DPUA 1R5HA 2YU3A 5LLQA 3CO7C 3M7GA 1E2XA 2XKPA 1TNTA 1IUYA 2EA4A 1FY7A 3SFZA 1FP1D 3U2RA 4IF4A 3G3ZA 5DD4A 3I71A 1J0RA 2ETHA 3JAMK 5DCMA 4QLCU 3IRRA 3V7SA 3FXUA 2MH2A 4Q5SF 1ZLKA 2A3SA 2XASA 1OPCA 3ECOA 2PFBA 2ZJ2A 3K0LA 3GZ6A 3V7RA 4RGRA 3HRUA 1ZGAA 4A5MA 1ZG5A 1HXDA 1USSA 1B59A 3KP6A 1NHAA 2HDCA 3E5XA 3WTYC 4PCQA 1TW2A 5E8GA 1SD6A 4ENMA 2VOOA 4OIQF 4MGRA 3QPTA 1QPMA 2OU2A 4EM0B 1EH8A 1Z6RA 1D8JA 1QGPA 1W4MA 4I7HA 1G3WA 1FYKA 1TNSA 1C0WA 1XGNA 2L4MA 1U78A 4AIKA 2FNAA 3LAPA 3HIFA 4G7ZF 4L18B 1O3TA 5E18F 2HKOA 5DCMB 2EFWA 3HTSB 1BI1A 4WXCA 5JR3A 3E6BA 2F5CA 3F8CA 2KKOA 2O0YA 1DPUA 2A61A 1AOYA 2HR3A 5CVJA 2WTEA 3T8TA 5DEQA 2ZMEB 4GCVA 3ZMDA 3I58A 1I1GA 3GX4X 4Q4ZF 5BS6A 2VE8A 4LJZF 2EFQA 4Q48A 4UVBA 4ZYGA 1XB4A 5IT9K 1IXRC 3PQKA 3PQJA 5D4SA 2ISYA 3V7CA 2Q0OA 2A6EF 1MJAA 5HLHA 5ILSA 2L02A 4M6XA 3U1DA 4YG2F 3V8JA 1RNLA 2P7CB 5FD6A 3R0JA 3VB2A 4QWQA 1YO5C 3VFZA 4CHUA 2HWVA 4OMYA 1TBXA 2M1BA 1V4RA 4KYWA 2Z9OA 3F72A 2CWEA 3FXQA 3QAHA 1DP7P 1LQ1A 3ML6A 4G6DA 4LMYA 4Y17A 4RB2C 2FE3A 1QZYA 3JAMZ 3F8FA 4HX8A 2ZCWA 4L9NA 2XV4S 1XD7A 5K5QA 1BM9A 1MJ9A 1YQAA 1KA8A 4ZZLA 4GYIA 4JQFA 3SQNA 2K4BA 3CUQB 2IRFG 3CUOA 4FT8A 4EGYA 4ESJA 2HEOA 2XGXA 1SMTA 1TQIA 3ECHA 1VTNC 5F64A 1BIAA 2CO5A 2GXGA 4RGXA 4G9YA 5LHGA 4YIIA 1RUOA 5H6RA 3V8LA 2CFXA 4HLYA 1O3SA 4DNCA 1J7KA 1BBYA 4S05A 3R0AA 4B8XA 2PMUA 5H6QA 1T0FA 4HV6A 2IP2A 2NRAC 3KFWX 5E1ZB 3SZTA 3PFIA 2RVCA 5LHIA 5E8IA 4HOBA 2HTSA 5L3BA 1YLFA 1IN4A 2NAZA 3RYPA 3K1PA 3TO9A 3ULQB 4N9HA 2DLLA 4D0PA 3K1NA 2V9VA 2RGVA 1OYYA 3V8KA 4AWXB 2OQGA 2EFNA 1D3YA 1OR7A 3HUGA 2HOEA 1R23A 1FP2A 1R1UA 1XCBA 3K69A 3LWFA 4KFCA 3SZPA 5LEKA 2HZTA 1HQCA 2KIUA 3F22A 3IWFA 2M30A 4E70A 4OIRF 5IT9Z 1FBUA 5L3CA 1YW9A 1R58A 3CDHA 1I6XA 4I0BA 1DUXC 2K4JA 1ODDA 2JT1A 1P4AA 2P7VB 5HOOA 1O3QA 4PGHA 4ZZDA 4I02A 4BQAA 1GXPA 2W25A 2O8XA 3RIRA 2QUFA 3HHGA 1P4WA 2UXXA 4HQMA 3F21A 5FO5A 5L3EA 1UCRA 2GA1A 3C7JA 1WQ2A 1HKSA 2QWWA 2FU4A 2V6CA 4HF2A 4WX9A 3FX3A 3MZYA 5ERIA 3BZ6A 2FSWA 5ILVA 4HX7A 4JBAA 4I2OA 1LEBA 2HFHA 3GFMA 2XHKA 4KNYA 3ELKA 1O57A 4GYGA 4PDKA 4Y13A 5DCFA 3F6OA 1WSUA 2OBPA 1B6AA 1LJ9A 3IWZA 5HS7A 4ENNA 1YW7A 5J8CA 4L5IA 2R7FA 2K7LA 1J2XA 3J7AO 3KEQA 4NQWA 2PLYA 3R60A 3KETA 2E7WA 2F5DA 3WTZA 5FB2A 4TV7A 2HYFA 3C1DA 2VOPA 1PUEE 2Y0MA 1JHFA 3ZMZA 2XVCA 5K1YA 2IT0A 4AIHA 4S04A 2PBIA 3GFJA 2O6GE 3FM5A 1T2KA 2M87A 3P9IA 4WF2A 1REPC 5A2QK 4IXAA 2QQAA 2DBBA 3L9FA 3O2PE 2IA0A 4ENKA 3G73A 4LLNA 1SFUA 2LSOA 1EH7A 4CO8A 1L0OC 3P7NA 2G9WA 4OOIA 2LDUA 4F7ZA 3LQQA 2QBYA 3GXOA 1Z9CA 1IAWA 2BGCA 4IVNA 2FEZA 1W7PD 2A07F 1P6RA 4UHTA 3ZN1A 1MZBA 4HDVA 4M6YA 4HBLA 2VBXA 3VOEA 1XGMA 2IA1A 2STWA 1ZLJA 5DD8A 1JGSA 3GWZA 4KT5C 4LGWA 5K5OA 1PDNC 3GO5A 2HKXA 4EMSA 4Y15A 2ZO4A 1U5TA 3BOQA 2EFOA 4IRHA 3ZQ7A 4R79A 3J80K 4WK8F 2GIVA 6PAXA 1T38A 3WTSC 2VBYA 1G3TA 2QBYB 3ZN0A 4BHBA 2JRTA 4CGZA 1F5TA 3T0YA 2G7HA 1HSTA 3QU6A 2DT5A 2EV6A 1XGSA 3BJAA 3I64A 3GUDA 2BE5F 2A69F 1XSDA 4LB5A 3EETA 1Z6TA 2V1UA 3RPQA 5EEHA 4M73A 5JHUA 4BXUA 5FFZA 5LGTA 4ZYHA 3TO6A 3WU0A 2FMYA 1I5ZA 4FHTA 2PI0A 3LSTA 5E1WA 2EJRA 1FBSA 2M5WA 1U5TB 2PMHA 2XROA 2V1XA 5JVTA 4H0EA 3H3ZA 4LG0A 3ROUA 5DDGA 2VT3A 4G7OF 2A6HF 3GFLA 3RKXA 1YS6A 2EK5A 2FXAA 2ZMEA 4LFUA 2AXLA 3BJOA 3F8NA 1HKTA 3BJ6A 1ZRDA 2ZNZA 2P6TA 2O3FA 4U7DA 1A04A 3BROA 1TQMA 2EWNA 2Y75A 3N97A 3HRTA 3LFKA 4P9UA 4M71A 2HS5A 2O03A 1JXSA 4RAYA 2E1CA 2XIGA 1DDNA 2R3SA 4YFKF 5LRRA 3WG9A 2D45A 1ZHFA 5AIPA 1RZ4A 3HRMA 1T39A 3E3VA 2MA3A 1K7AA 4UUVA 3MFKA 4O6JA 4L0ZB 1MJBA 4LG0B 4N0BA 2PJPA 1ZARA 3GW2A 3RPUA 5LRSA 3GF2A 5LBQA 2K27A 1KQ0A 4GXOA 3HTUA 4L9TA 1ZRCA 3GFIA 2JPCA 1U3EM 5D8LB 1ZREA 1FOKA 2IPQX 1BI3A 3MWMA 4HX4A 3J80Z 1O7LA 4LLLA 2QVOA 3B73A 3CUQA 4ASNA 2P5LC 1IRFA 4U88A 2AS5F 1D8KA 2L54A 1FC3A 5LEJA 3QRFF 1QZZA 5D4RA 1Z91A 3TKYA 4M9XA 2J5PA 1QBJA 5HLIA 5KVRA 1PP8F 3Q5FA 2OZUA 4G8XA 2K86A 1IXSB 1HW1A 3KCCA 1JE8A 1ON1A 3DKWA 3H3UA 2WV0A 2CSOA 4EJUA 5JFRA 2P5KA 2A68F 2V1DA 4M74A 1Y0UA 2F2EA 2X0LA 3L2CA 1B9NA 4XLPF 3RKYA 1T98A 1KYZA 2GAUA 3AAFA 1FT9A 3WU1B 1ON2A 2DK5A 1J75A 1H0MA 4ZH4F 2OAZA 2FBKA 1G6NA 4P9FA 1ZH5A 5HS8A 2MD5A 1XSVA 3MEXA 3ZMTA 5D8KB 1UFMA 5HLGA 1IW7F 5TRDA 3ABUA 3KP3A 1J5YA 2FF4A 4A6EA 3KLNA 3BPXA 2L3DA 3DPLC 4KN4X 1CGPA 2W84A 1G3SA 1XMAA 1V3FA 4BAYA 4CICA 4I09A 1U6GA 2ZNYA 3T5XA 3RTRA 1WWXA 1KQ8A 1RUNA 3ZMVA 3GEZA 3KP7A 3H92A 2D2WA 3TOBA 4M9SA 2VE9A 1CF7B 3MQ0A 2RNJA 2H94A 3D0SA 4EM2A 2ZFWA 2FOKA 1SFEA 3F23A 5BPDA 3JSPA 5FLXK 3TO7A 2G7UA 4P96A 1YW8A 3QOPA 2JTVA 3E5UA 5F1RA 2J5OA 1KU9A 1HSJA 2K02A 2QQBA 3ABTA 3BWGA 4LD5A 1ZG3A 5E20A 3FXRA 2UZKA 2RDPA 2ADUA 2BBYA 5ICCA 4L0YB 2YSRA 3KZYA 3OV8A 3P9KA 4HA8A 3M8EA 3T8RA 3GVAA 2IA2A 3J81K 4OMZA 1IF1A 1BOAA 1YG2A 4XLNF 1WKMA 3K9TA 2ESHA 4XSXF 4LK1F 3QPHA 3K2ZA 4OINF 3I59A 2GWRA 3MZHA 2Q2EA 1KGSA 1UHMA 5LHHA 1LB2A 1F9NA 3VODA 2H27A 3NEUA 3CUQC 3EDPA 2M45A 4UVAA 2HGCA 2L4AA 1F4KA 4YFNF 3BY6A 2CYYA 2XKOA 3I0TA 3REOA 2Q8KA 2LNBA 1FSEA 3EYIA 3QP6A 3FHZA 2H6BA 1EV7A 2EV5A 4UVCA 1QQIA 1LNWA 3SXYA 2FMLA 2CW0F 2VODA 1YIOA 2MLGA 1KYWA 1KQ9A 4CYDA 1JHHA 3FMRA 3M8FA 2VC1A 1BC8C 2KIFA 5BPIA 2OA4A 4L9JA 2JZYA 1F1ZA 2WC2A 1BI2A 5CYVA 3R61A 3I5UA 3I59B 3ZPLA 1R22A 3JW4A 1XDUA 2P8TA 4G94A 2DTRA 4Q47A 4BHCA 3FMQA 1FLIA 1BJAA 1D5VA 1L3LA 2NYXA 5K5RA 1RIOH 4EVIA 1FX7A 2MBFA 4LK0F 4O3MA 3WGHA 4MTEA 1TLHB 4CXFA 2VBZA 1O3RA 3TGNA 2GXBA 5CVRA 5DV5A 2HTJA 2XUBA 3LAJA 1GVJA 2W57A 2KRFA 5D5VB 5FLXZ 4YIFA 1FZPB 4KUMA 2FA5A 2DPDA 2XAHA 2D1VA 5EEGA 5IT3A 1XMKA 2FBHA 4EQQA 4I98B 2CQKA 2QQ9A 1LDDA 4CDGA 4N9IA 5DYMA 4PGGA 1B4AA 3CLOA 1OYIA 3TOAA 4AVPA 3KP4A 2XAGA 4MQ9F 1UHWA 3DEUA 4WCGA 2COMA 2ZXJA 3I54A 3KZZA 3DV8A 1RI7A 4WXHA 4GO1A 3J81Z 2HQRA 4EM1A 4YFXF 3IKVA 1IN8A 5BMZA 1GXQA 3BDDA 2VT2A 3W6KB 2Y48A 3CO6C 3T1BA 2QZ8A 2DO7A 4ZYDA 1S29A 4MQVA 4RB3C 3ZMSA 1QO0D 4OIOF 4ESBA 3HOSA 4UV8A 2VBWA 2QENA 3WGGA 4P5OA 2BEOA 1QNTA 2OZ6A 4WXDA 3FWEA 3KE2A 1XGOA 3ZP5A 2OD5A 2A5YB 2GZWA 5KK1A 4M9ZA 5HDKA 2YR2A 3HRSA 2BV6A 1K78A 2KJCA 3SHFA 3WTWC 2P4WA 3ERED 1ULYA 3WE2A 2EA2A 1IZ1A 1WRJA 4R8HA 3C18A 5D6FA 4ENJA 1R00A 3IC7A 1BC7C 3RKWA 4MHGA 1FWZA 1SFXA 2UWMA 5HVQC 5A2QZ 3D5LA 3WTTC 5CLSA 1GHCA 3WE3A 3L7WA 2VONA 4HV5A 5AIQA 1PP7U 1LEAA 4K2EA 4IRIA 2KJBA 4BHPA 4UV9A 2Z5UA 2ZBKA 5TJJA 3NQOA 4HW0A 1S3JA 4WWCA 3L00A 3WTUC 1U2WA 3F6VA 4HF0A 3FZVA 5BQTA 3C3WA 3B02A 2CG4A 1HBXG 4A12A 1FSHA 1MKMA 3N4MA 4I01A 2H6CA 3HYIA 3E6CC 2DW4A 1K78B 3L09A 2DQLA 4A2UA 3E6DA 3HSRA 4NHJA 2ESNA 1Z1DA 1Z05A 3V4GA 3FMSA 5LGNA 2PEXA 4XRFA 3HHHA 3DQVC 5L3GA 1W5SA 4ZYEA 2GA2A 5HDNA 4EJTA 2XAQA 1B9MA 2KIMA 4KICA 1YYVA 1EH6A 1OYWA 2L01A 1KU3A 5CVIA 4EV0A 2RQPA 5CVUA 5ED4A 1SMYF 3TQNA 2RKHA 4MTDA 3IKTA 4RB0A 5ICGA 3OOPA 3R6SA 4KIGA 1MD0A 1W5TA 3U9GA 1OKRA 3LA2A 3W6JB 3WTVC 1TQPA 4FX4A 4EGZA 1Q1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF5 A;  5E1X A;  1YTY A;  4A5N A;  2XAJ A;  4HAM A;  2IJL A;  1T6S A;  2TDX A;  2M8E A;  5F6F A;  1XN7 A;  2F5F A;  1S7A A;  4HF1 A;  2MC3 A;  1U5T C;  1S7O A;  2C6Y A;  1HKQ A;  1ZN2 A;  5J8F A;  1IN6 A;  3CTA A;  4IPA A;  5DUI A;  2DU9 A;  5CJ9 A;  4AIJ A;  1XSX A;  3DFG A;  4A0Z A;  4PZJ A;  1E17 A;  1CF7 A;  2RN7 A;  3RI4 A;  1R7J A;  2DAO A;  3E5Q A;  1TTY A;  2DI3 A;  1KU7 A;  4KA4 A;  3HSF A;  3F8M A;  4L5J A;  4RS8 A;  2YPR A;  1G3Y A;  4RGS A;  2XAF A;  1LDK B;  2H09 A;  1W7P A;  2RC4 A;  2VC0 A;  2LKP A;  5LGU A;  4HDU A;  2VN2 A;  1S6L A;  3O3K A;  1OMI A;  4HLX A;  3M1E A;  2PQ8 A;  1R1V A;  5FD5 A;  1IRG A;  1YS7 A;  1FYL A;  5FFX A;  3ISP A;  3HSE A;  3DP7 A;  1P4X A;  4OU0 A;  1FYM A;  5L3F A;  2NNY A;  5D6E A;  5CVV A;  1HW2 A;  5D5U B;  1AWC A;  2WWY A;  3O6B B;  4MNU A;  1ZYR F;  3IRQ A;  4OIP F;  5D5X B;  1W7P B;  4U0V A;  3CJN A;  1J9I A;  2ZKZ A;  3KLO A;  1O7F A;  5BOX A;  5J6X A;  4KMF A;  2YX7 A;  3NRV A;  1U8R A;  3GZ5 A;  3I4P A;  3EYY A;  4HYE A;  1XCV A;  3HOT A;  5HS9 A;  2P5V A;  2R7D A;  3DXJ F;  2V79 A;  5FGM A;  2CGP A;  1MDM A;  2B0L A;  4A0X A;  4MEX F;  4GGG A;  3GLX A;  3Q9S A;  4IHS A;  2VXZ A;  2FQ3 A;  4A0Y A;  2MLK A;  3S2W A;  3P9C A;  2EB7 A;  3BP8 A;  2DFI A;  3ZMU A;  2HYG D;  4DQ2 A;  4CZZ A;  2EV0 A;  4BNC A;  1R1T A;  3QU3 A;  2W85 A;  2XRN A;  3MCZ A;  3JTH A;  1G4D A;  3IHU A;  4A6D A;  4BH9 A;  4I0A A;  4MEY F;  2FNP A;  1DPR A;  3F8B A;  1UB9 A;  3JTG A;  4KMU X;  4UNO A;  3KEO A;  2E7X A;  2Z99 A;  3QP5 A;  3WGI A;  2QYO A;  1MGT A;  1LVA A;  3BPV A;  2JSC A;  4AD9 A;  1SD7 A;  1IN5 A;  2D1H A;  3M9A A;  2MH9 A;  1FNN A;  4EJV A;  2RV8 A;  4KN7 X;  1MDM B;  4JK1 X;  3DF8 A;  2ISZ A;  1SAX A;  2ELH A;  1B1B A;  4R1H A;  1Z7U A;  2P6S A;  3WTX C;  2Z33 A;  1H9G A;  4Z2Y A;  1SD5 A;  3EUH A;  1WI9 A;  3K1M A;  1R5G A;  5ICF A;  4KDP A;  1ZGJ A;  2NS0 A;  2LF7 A;  1BIB A;  3WOD F;  3RYR A;  2IW5 A;  2LF8 A;  3RJP A;  3LA7 A;  2PG4 A;  1IXC A;  1UST A;  2QLZ A;  5DUK A;  2IVM A;  1ZRF A;  5H20 A;  2QM3 A;  3E97 A;  5L3D A;  4U0W A;  3JSO A;  1BI0 A;  3RDI A;  2UXN A;  2Z3Y A;  2YX4 A;  3KP2 A;  2FRH A;  2E1N A;  1P2F A;  4G7H F;  5HDG A;  1I1S A;  4BYY A;  4EJO A;  5ILU A;  4HQE A;  4ETS A;  1LDJ A;  4EJW A;  2ACJ A;  2FBI A;  4KIB A;  1TW3 A;  1P92 A;  3MAJ A;  3LQR A;  4ESF A;  4HZF A;  4L9V A;  2STT A;  1J59 A;  3I53 A;  4XSZ F;  4LB6 B;  4B09 A;  3Q9V A;  1S8N A;  1SD4 A;  1XDS A;  1R36 A;  4LLG F;  4FX0 A;  4M72 A;  1H9T A;  4IJA A;  1ONV A;  5ICE A;  2NNN A;  1BN5 A;  2EFP A;  4RAZ A;  3DPT A;  3E6M A;  4O5V A;  1ZAO A;  4U7B A;  1FBQ A;  3VEP A;  1X3U A;  2BYV E;  3EQL F;  4KIF A;  4NB5 A;  3TDZ C;  5AON A;  4RB1 A;  1FPQ A;  2OQR A;  2JPB A;  5D5W B;  1IN7 A;  2DQR A;  1K6O A;  2GQQ A;  4IRG A;  4ON0 A;  3COA C;  2X4H A;  3F3X A;  1STZ A;  4G6Q A;  4U0Y A;  1HW5 A;  2PN6 A;  4IHT A;  4UXN A;  3GYH X;  4XBF A;  3R4K A;  3IL2 A;  3FM3 A;  2F5E A;  2HQN A;  4RGU A;  1KU2 A;  1ZG1 A;  1K79 A;  5JI6 A;  2DK8 A;  1I27 A;  4P55 A;  3TDU C;  3KP5 A;  1YFH A;  3LA3 A;  2W24 A;  5E17 F;  2O61 A;  2DPU A;  1R5H A;  2YU3 A;  5LLQ A;  3CO7 C;  3M7G A;  1E2X A;  2XKP A;  1TNT A;  1IUY A;  2EA4 A;  1FY7 A;  3SFZ A;  1FP1 D;  3U2R A;  4IF4 A;  3G3Z A;  5DD4 A;  3I71 A;  1J0R A;  2ETH A;  3JAM K;  5DCM A;  4QLC U;  3IRR A;  3V7S A;  3FXU A;  2MH2 A;  4Q5S F;  1ZLK A;  2A3S A;  2XAS A;  1OPC A;  3ECO A;  2PFB A;  2ZJ2 A;  3K0L A;  3GZ6 A;  3V7R A;  4RGR A;  3HRU A;  1ZGA A;  4A5M A;  1ZG5 A;  1HXD A;  1USS A;  1B59 A;  3KP6 A;  1NHA A;  2HDC A;  3E5X A;  3WTY C;  4PCQ A;  1TW2 A;  5E8G A;  1SD6 A;  4ENM A;  2VOO A;  4OIQ F;  4MGR A;  3QPT A;  1QPM A;  2OU2 A;  4EM0 B;  1EH8 A;  1Z6R A;  1D8J A;  1QGP A;  1W4M A;  4I7H A;  1G3W A;  1FYK A;  1TNS A;  1C0W A;  1XGN A;  2L4M A;  1U78 A;  4AIK A;  2FNA A;  3LAP A;  3HIF A;  4G7Z F;  4L18 B;  1O3T A;  5E18 F;  2HKO A;  5DCM B;  2EFW A;  3HTS B;  1BI1 A;  4WXC A;  5JR3 A;  3E6B A;  2F5C A;  3F8C A;  2KKO A;  2O0Y A;  1DPU A;  2A61 A;  1AOY A;  2HR3 A;  5CVJ A;  2WTE A;  3T8T A;  5DEQ A;  2ZME B;  4GCV A;  3ZMD A;  3I58 A;  1I1G A;  3GX4 X;  4Q4Z F;  5BS6 A;  2VE8 A;  4LJZ F;  2EFQ A;  4Q48 A;  4UVB A;  4ZYG A;  1XB4 A;  5IT9 K;  1IXR C;  3PQK A;  3PQJ A;  5D4S A;  2ISY A;  3V7C A;  2Q0O A;  2A6E F;  1MJA A;  5HLH A;  5ILS A;  2L02 A;  4M6X A;  3U1D A;  4YG2 F;  3V8J A;  1RNL A;  2P7C B;  5FD6 A;  3R0J A;  3VB2 A;  4QWQ A;  1YO5 C;  3VFZ A;  4CHU A;  2HWV A;  4OMY A;  1TBX A;  2M1B A;  1V4R A;  4KYW A;  2Z9O A;  3F72 A;  2CWE A;  3FXQ A;  3QAH A;  1DP7 P;  1LQ1 A;  3ML6 A;  4G6D A;  4LMY A;  4Y17 A;  4RB2 C;  2FE3 A;  1QZY A;  3JAM Z;  3F8F A;  4HX8 A;  2ZCW A;  4L9N A;  2XV4 S;  1XD7 A;  5K5Q A;  1BM9 A;  1MJ9 A;  1YQA A;  1KA8 A;  4ZZL A;  4GYI A;  4JQF A;  3SQN A;  2K4B A;  3CUQ B;  2IRF G;  3CUO A;  4FT8 A;  4EGY A;  4ESJ A;  2HEO A;  2XGX A;  1SMT A;  1TQI A;  3ECH A;  1VTN C;  5F64 A;  1BIA A;  2CO5 A;  2GXG A;  4RGX A;  4G9Y A;  5LHG A;  4YII A;  1RUO A;  5H6R A;  3V8L A;  2CFX A;  4HLY A;  1O3S A;  4DNC A;  1J7K A;  1BBY A;  4S05 A;  3R0A A;  4B8X A;  2PMU A;  5H6Q A;  1T0F A;  4HV6 A;  2IP2 A;  2NRA C;  3KFW X;  5E1Z B;  3SZT A;  3PFI A;  2RVC A;  5LHI A;  5E8I A;  4HOB A;  2HTS A;  5L3B A;  1YLF A;  1IN4 A;  2NAZ A;  3RYP A;  3K1P A;  3TO9 A;  3ULQ B;  4N9H A;  2DLL A;  4D0P A;  3K1N A;  2V9V A;  2RGV A;  1OYY A;  3V8K A;  4AWX B;  2OQG A;  2EFN A;  1D3Y A;  1OR7 A;  3HUG A;  2HOE A;  1R23 A;  1FP2 A;  1R1U A;  1XCB A;  3K69 A;  3LWF A;  4KFC A;  3SZP A;  5LEK A;  2HZT A;  1HQC A;  2KIU A;  3F22 A;  3IWF A;  2M30 A;  4E70 A;  4OIR F;  5IT9 Z;  1FBU A;  5L3C A;  1YW9 A;  1R58 A;  3CDH A;  1I6X A;  4I0B A;  1DUX C;  2K4J A;  1ODD A;  2JT1 A;  1P4A A;  2P7V B;  5HOO A;  1O3Q A;  4PGH A;  4ZZD A;  4I02 A;  4BQA A;  1GXP A;  2W25 A;  2O8X A;  3RIR A;  2QUF A;  3HHG A;  1P4W A;  2UXX A;  4HQM A;  3F21 A;  5FO5 A;  5L3E A;  1UCR A;  2GA1 A;  3C7J A;  1WQ2 A;  1HKS A;  2QWW A;  2FU4 A;  2V6C A;  4HF2 A;  4WX9 A;  3FX3 A;  3MZY A;  5ERI A;  3BZ6 A;  2FSW A;  5ILV A;  4HX7 A;  4JBA A;  4I2O A;  1LEB A;  2HFH A;  3GFM A;  2XHK A;  4KNY A;  3ELK A;  1O57 A;  4GYG A;  4PDK A;  4Y13 A;  5DCF A;  3F6O A;  1WSU A;  2OBP A;  1B6A A;  1LJ9 A;  3IWZ A;  5HS7 A;  4ENN A;  1YW7 A;  5J8C A;  4L5I A;  2R7F A;  2K7L A;  1J2X A;  3J7A O;  3KEQ A;  4NQW A;  2PLY A;  3R60 A;  3KET A;  2E7W A;  2F5D A;  3WTZ A;  5FB2 A;  4TV7 A;  2HYF A;  3C1D A;  2VOP A;  1PUE E;  2Y0M A;  1JHF A;  3ZMZ A;  2XVC A;  5K1Y A;  2IT0 A;  4AIH A;  4S04 A;  2PBI A;  3GFJ A;  2O6G E;  3FM5 A;  1T2K A;  2M87 A;  3P9I A;  4WF2 A;  1REP C;  5A2Q K;  4IXA A;  2QQA A;  2DBB A;  3L9F A;  3O2P E;  2IA0 A;  4ENK A;  3G73 A;  4LLN A;  1SFU A;  2LSO A;  1EH7 A;  4CO8 A;  1L0O C;  3P7N A;  2G9W A;  4OOI A;  2LDU A;  4F7Z A;  3LQQ A;  2QBY A;  3GXO A;  1Z9C A;  1IAW A;  2BGC A;  4IVN A;  2FEZ A;  1W7P D;  2A07 F;  1P6R A;  4UHT A;  3ZN1 A;  1MZB A;  4HDV A;  4M6Y A;  4HBL A;  2VBX A;  3VOE A;  1XGM A;  2IA1 A;  2STW A;  1ZLJ A;  5DD8 A;  1JGS A;  3GWZ A;  4KT5 C;  4LGW A;  5K5O A;  1PDN C;  3GO5 A;  2HKX A;  4EMS A;  4Y15 A;  2ZO4 A;  1U5T A;  3BOQ A;  2EFO A;  4IRH A;  3ZQ7 A;  4R79 A;  3J80 K;  4WK8 F;  2GIV A;  6PAX A;  1T38 A;  3WTS C;  2VBY A;  1G3T A;  2QBY B;  3ZN0 A;  4BHB A;  2JRT A;  4CGZ A;  1F5T A;  3T0Y A;  2G7H A;  1HST A;  3QU6 A;  2DT5 A;  2EV6 A;  1XGS A;  3BJA A;  3I64 A;  3GUD A;  2BE5 F;  2A69 F;  1XSD A;  4LB5 A;  3EET A;  1Z6T A;  2V1U A;  3RPQ A;  5EEH A;  4M73 A;  5JHU A;  4BXU A;  5FFZ A;  5LGT A;  4ZYH A;  3TO6 A;  3WU0 A;  2FMY A;  1I5Z A;  4FHT A;  2PI0 A;  3LST A;  5E1W A;  2EJR A;  1FBS A;  2M5W A;  1U5T B;  2PMH A;  2XRO A;  2V1X A;  5JVT A;  4H0E A;  3H3Z A;  4LG0 A;  3ROU A;  5DDG A;  2VT3 A;  4G7O F;  2A6H F;  3GFL A;  3RKX A;  1YS6 A;  2EK5 A;  2FXA A;  2ZME A;  4LFU A;  2AXL A;  3BJO A;  3F8N A;  1HKT A;  3BJ6 A;  1ZRD A;  2ZNZ A;  2P6T A;  2O3F A;  4U7D A;  1A04 A;  3BRO A;  1TQM A;  2EWN A;  2Y75 A;  3N97 A;  3HRT A;  3LFK A;  4P9U A;  4M71 A;  2HS5 A;  2O03 A;  1JXS A;  4RAY A;  2E1C A;  2XIG A;  1DDN A;  2R3S A;  4YFK F;  5LRR A;  3WG9 A;  2D45 A;  1ZHF A;  5AIP A;  1RZ4 A;  3HRM A;  1T39 A;  3E3V A;  2MA3 A;  1K7A A;  4UUV A;  3MFK A;  4O6J A;  4L0Z B;  1MJB A;  4LG0 B;  4N0B A;  2PJP A;  1ZAR A;  3GW2 A;  3RPU A;  5LRS A;  3GF2 A;  5LBQ A;  2K27 A;  1KQ0 A;  4GXO A;  3HTU A;  4L9T A;  1ZRC A;  3GFI A;  2JPC A;  1U3E M;  5D8L B;  1ZRE A;  1FOK A;  2IPQ X;  1BI3 A;  3MWM A;  4HX4 A;  3J80 Z;  1O7L A;  4LLL A;  2QVO A;  3B73 A;  3CUQ A;  4ASN A;  2P5L C;  1IRF A;  4U88 A;  2AS5 F;  1D8K A;  2L54 A;  1FC3 A;  5LEJ A;  3QRF F;  1QZZ A;  5D4R A;  1Z91 A;  3TKY A;  4M9X A;  2J5P A;  1QBJ A;  5HLI A;  5KVR A;  1PP8 F;  3Q5F A;  2OZU A;  4G8X A;  2K86 A;  1IXS B;  1HW1 A;  3KCC A;  1JE8 A;  1ON1 A;  3DKW A;  3H3U A;  2WV0 A;  2CSO A;  4EJU A;  5JFR A;  2P5K A;  2A68 F;  2V1D A;  4M74 A;  1Y0U A;  2F2E A;  2X0L A;  3L2C A;  1B9N A;  4XLP F;  3RKY A;  1T98 A;  1KYZ A;  2GAU A;  3AAF A;  1FT9 A;  3WU1 B;  1ON2 A;  2DK5 A;  1J75 A;  1H0M A;  4ZH4 F;  2OAZ A;  2FBK A;  1G6N A;  4P9F A;  1ZH5 A;  5HS8 A;  2MD5 A;  1XSV A;  3MEX A;  3ZMT A;  5D8K B;  1UFM A;  5HLG A;  1IW7 F;  5TRD A;  3ABU A;  3KP3 A;  1J5Y A;  2FF4 A;  4A6E A;  3KLN A;  3BPX A;  2L3D A;  3DPL C;  4KN4 X;  1CGP A;  2W84 A;  1G3S A;  1XMA A;  1V3F A;  4BAY A;  4CIC A;  4I09 A;  1U6G A;  2ZNY A;  3T5X A;  3RTR A;  1WWX A;  1KQ8 A;  1RUN A;  3ZMV A;  3GEZ A;  3KP7 A;  3H92 A;  2D2W A;  3TOB A;  4M9S A;  2VE9 A;  1CF7 B;  3MQ0 A;  2RNJ A;  2H94 A;  3D0S A;  4EM2 A;  2ZFW A;  2FOK A;  1SFE A;  3F23 A;  5BPD A;  3JSP A;  5FLX K;  3TO7 A;  2G7U A;  4P96 A;  1YW8 A;  3QOP A;  2JTV A;  3E5U A;  5F1R A;  2J5O A;  1KU9 A;  1HSJ A;  2K02 A;  2QQB A;  3ABT A;  3BWG A;  4LD5 A;  1ZG3 A;  5E20 A;  3FXR A;  2UZK A;  2RDP A;  2ADU A;  2BBY A;  5ICC A;  4L0Y B;  2YSR A;  3KZY A;  3OV8 A;  3P9K A;  4HA8 A;  3M8E A;  3T8R A;  3GVA A;  2IA2 A;  3J81 K;  4OMZ A;  1IF1 A;  1BOA A;  1YG2 A;  4XLN F;  1WKM A;  3K9T A;  2ESH A;  4XSX F;  4LK1 F;  3QPH A;  3K2Z A;  4OIN F;  3I59 A;  2GWR A;  3MZH A;  2Q2E A;  1KGS A;  1UHM A;  5LHH A;  1LB2 A;  1F9N A;  3VOD A;  2H27 A;  3NEU A;  3CUQ C;  3EDP A;  2M45 A;  4UVA A;  2HGC A;  2L4A A;  1F4K A;  4YFN F;  3BY6 A;  2CYY A;  2XKO A;  3I0T A;  3REO A;  2Q8K A;  2LNB A;  1FSE A;  3EYI A;  3QP6 A;  3FHZ A;  2H6B A;  1EV7 A;  2EV5 A;  4UVC A;  1QQI A;  1LNW A;  3SXY A;  2FML A;  2CW0 F;  2VOD A;  1YIO A;  2MLG A;  1KYW A;  1KQ9 A;  4CYD A;  1JHH A;  3FMR A;  3M8F A;  2VC1 A;  1BC8 C;  2KIF A;  5BPI A;  2OA4 A;  4L9J A;  2JZY A;  1F1Z A;  2WC2 A;  1BI2 A;  5CYV A;  3R61 A;  3I5U A;  3I59 B;  3ZPL A;  1R22 A;  3JW4 A;  1XDU A;  2P8T A;  4G94 A;  2DTR A;  4Q47 A;  4BHC A;  3FMQ A;  1FLI A;  1BJA A;  1D5V A;  1L3L A;  2NYX A;  5K5R A;  1RIO H;  4EVI A;  1FX7 A;  2MBF A;  4LK0 F;  4O3M A;  3WGH A;  4MTE A;  1TLH B;  4CXF A;  2VBZ A;  1O3R A;  3TGN A;  2GXB A;  5CVR A;  5DV5 A;  2HTJ A;  2XUB A;  3LAJ A;  1GVJ A;  2W57 A;  2KRF A;  5D5V B;  5FLX Z;  4YIF A;  1FZP B;  4KUM A;  2FA5 A;  2DPD A;  2XAH A;  2D1V A;  5EEG A;  5IT3 A;  1XMK A;  2FBH A;  4EQQ A;  4I98 B;  2CQK A;  2QQ9 A;  1LDD A;  4CDG A;  4N9I A;  5DYM A;  4PGG A;  1B4A A;  3CLO A;  1OYI A;  3TOA A;  4AVP A;  3KP4 A;  2XAG A;  4MQ9 F;  1UHW A;  3DEU A;  4WCG A;  2COM A;  2ZXJ A;  3I54 A;  3KZZ A;  3DV8 A;  1RI7 A;  4WXH A;  4GO1 A;  3J81 Z;  2HQR A;  4EM1 A;  4YFX F;  3IKV A;  1IN8 A;  5BMZ A;  1GXQ A;  3BDD A;  2VT2 A;  3W6K B;  2Y48 A;  3CO6 C;  3T1B A;  2QZ8 A;  2DO7 A;  4ZYD A;  1S29 A;  4MQV A;  4RB3 C;  3ZMS A;  1QO0 D;  4OIO F;  4ESB A;  3HOS A;  4UV8 A;  2VBW A;  2QEN A;  3WGG A;  4P5O A;  2BEO A;  1QNT A;  2OZ6 A;  4WXD A;  3FWE A;  3KE2 A;  1XGO A;  3ZP5 A;  2OD5 A;  2A5Y B;  2GZW A;  5KK1 A;  4M9Z A;  5HDK A;  2YR2 A;  3HRS A;  2BV6 A;  1K78 A;  2KJC A;  3SHF A;  3WTW C;  2P4W A;  3ERE D;  1ULY A;  3WE2 A;  2EA2 A;  1IZ1 A;  1WRJ A;  4R8H A;  3C18 A;  5D6F A;  4ENJ A;  1R00 A;  3IC7 A;  1BC7 C;  3RKW A;  4MHG A;  1FWZ A;  1SFX A;  2UWM A;  5HVQ C;  5A2Q Z;  3D5L A;  3WTT C;  5CLS A;  1GHC A;  3WE3 A;  3L7W A;  2VON A;  4HV5 A;  5AIQ A;  1PP7 U;  1LEA A;  4K2E A;  4IRI A;  2KJB A;  4BHP A;  4UV9 A;  2Z5U A;  2ZBK A;  5TJJ A;  3NQO A;  4HW0 A;  1S3J A;  4WWC A;  3L00 A;  3WTU C;  1U2W A;  3F6V A;  4HF0 A;  3FZV A;  5BQT A;  3C3W A;  3B02 A;  2CG4 A;  1HBX G;  4A12 A;  1FSH A;  1MKM A;  3N4M A;  4I01 A;  2H6C A;  3HYI A;  3E6C C;  2DW4 A;  1K78 B;  3L09 A;  2DQL A;  4A2U A;  3E6D A;  3HSR A;  4NHJ A;  2ESN A;  1Z1D A;  1Z05 A;  3V4G A;  3FMS A;  5LGN A;  2PEX A;  4XRF A;  3HHH A;  3DQV C;  5L3G A;  1W5S A;  4ZYE A;  2GA2 A;  5HDN A;  4EJT A;  2XAQ A;  1B9M A;  2KIM A;  4KIC A;  1YYV A;  1EH6 A;  1OYW A;  2L01 A;  1KU3 A;  5CVI A;  4EV0 A;  2RQP A;  5CVU A;  5ED4 A;  1SMY F;  3TQN A;  2RKH A;  4MTD A;  3IKT A;  4RB0 A;  5ICG A;  3OOP A;  3R6S A;  4KIG A;  1MD0 A;  1W5T A;  3U9G A;  1OKR A;  3LA2 A;  3W6J B;  3WTV C;  1TQP A;  4FX4 A;  4EGZ A;  1Q1H A; 
#chains in the Genus database with same CATH topology
 3FF5 A;  5E1X A;  2KT0 A;  4A5N A;  1YTY A;  2XAJ A;  4HAM A;  2JVH A;  3KYD B;  5E3O A;  2IJL A;  4M3G A;  3LSK A;  1K83 J;  9ANT A;  2MFZ A;  1T6S A;  3W2A A;  2TDX A;  2M8E A;  4AC0 A;  5F6F A;  1XN7 A;  3SEZ A;  5M5W J;  2VKV A;  1WCM J;  2F5F A;  1S7A A;  4HF1 A;  2MC3 A;  4QPQ A;  3BZC A;  1U5T C;  1S7O A;  4BE1 A;  3BR0 A;  4AVZ A;  1JI8 A;  2C6Y A;  1HKQ A;  2V9P A;  4F93 B;  1APL C;  3ZQQ A;  1ZN2 A;  3FXL A;  5J8F A;  1IN6 A;  2DJN A;  3CTA A;  4IPA A;  5DUI A;  1WJC A;  2DU9 A;  3H5N A;  5CJ9 A;  3HOZ J;  4AIJ A;  2LYC A;  3I4M J;  3ZOB A;  1XSX A;  5C4J J;  2VQG A;  4E6K G;  3DFG A;  1TWH J;  4A0Z A;  3PO2 J;  4PZJ A;  2CUE A;  1CF7 A;  2KIS A;  4IHY A;  1E17 A;  2R7V A;  2RN7 A;  3W2W A;  3RI4 A;  1P7I A;  2E19 A;  2ZSI B;  3W3C A;  3L2W A;  1R7J A;  1FIP A;  2DAO A;  1LE8 A;  2DDA A;  2L0K A;  3G2B A;  2I8D A;  2E71 A;  3E5Q A;  1TTY A;  2DI3 A;  3C2H A;  1KU7 A;  2K9M A;  4KA4 A;  3HSF A;  3F8M A;  4L5J A;  4RS8 A;  1Z67 A;  3Q3S A;  2YPR A;  1YJN I;  1G3Y A;  1YRN A;  1WJA A;  2FD5 A;  4RGS A;  4DOZ A;  1BL0 A;  2EIK H;  2XAF A;  1LDK B;  2H09 A;  1W7P A;  3HPG A;  2M8G X;  2RC4 A;  2VC0 A;  4CZC A;  3FXJ A;  2BHY A;  2LKP A;  5LGU A;  4HDU A;  4HG2 A;  1MMA A;  3W6V A;  2VN2 A;  3ABK H;  2AQF A;  2AHQ A;  1S6L A;  2KRC A;  3O3K A;  1OMI A;  2EZH A;  4HLX A;  3M1E A;  4BKX A;  2R5Z A;  2Y9Z A;  4IQJ A;  2DJI A;  2PQ8 A;  2HVR A;  1R1V A;  5FD5 A;  3ABM H;  1JT6 A;  3RQI A;  2DYS H;  1IRG A;  2M4K A;  1YS7 A;  4ZC3 A;  1I3Q J;  1FYL A;  5FFX A;  1Y0N A;  3DEW A;  3ISP A;  3CF2 A;  4M3F A;  5J40 A;  3HSE A;  3DP7 A;  2JA6 J;  4DBQ A;  1P4X A;  4OU0 A;  2WAE A;  1VI0 A;  1A6Q A;  1FYM A;  4BBR J;  3S17 J;  5L3F A;  1V5E A;  1IUF A;  2NNY A;  5D6E A;  1UJ8 A;  2B63 J;  4XID A;  5CVV A;  1HW2 A;  5D5U B;  1LE8 B;  1AWC A;  3S14 J;  4JYK A;  2LY2 A;  2WWY A;  2VPR A;  3O6B B;  4MNU A;  1ZR2 A;  1ZYR F;  2FOW A;  3IRQ A;  4OIP F;  3BLY A;  1YRN B;  2NOG A;  5D5X B;  3CC4 I;  1S5L C;  1W7P B;  1ETY A;  4U0V A;  4ZTF A;  3OR1 C;  1TT5 B;  2X1C A;  3CJN A;  1IV6 A;  1J9I A;  2YU9 J;  2F4M B;  2ZKZ A;  3KLO A;  5CQG A;  4EGZ A;  2IS4 A;  1O7F A;  2PMZ N;  5BOX A;  2L5Q A;  2CUJ A;  2MW8 A;  5J6X A;  3GTO J;  4KMF A;  3AL0 B;  2YX7 A;  3NRV A;  1U8R A;  3OIP A;  3GZ5 A;  2R5Z B;  3I4P A;  3EYY A;  4HYE A;  3B6A A;  1XCV A;  4YIR X;  5HS9 A;  2JSP A;  3HOT A;  2P5V A;  2R7D A;  4NC7 A;  3DXJ F;  3NWT A;  2V79 A;  5FGM A;  2CGP A;  2HOA A;  1MDM A;  2CUF A;  4AYB A;  2B0L A;  1X1C A;  4A0X A;  4MEX F;  4GGG A;  3BG6 A;  3GLX A;  3Q9S A;  3I9V 2;  2VXZ A;  4IHS A;  2KDZ A;  3G71 I;  2FQ3 A;  2W00 A;  4A0Y A;  2MLK A;  2NVQ J;  3S2W A;  3P9C A;  1ZR4 A;  2EB7 A;  1E0E A;  2NVU B;  3BP8 A;  2DFI A;  3ZMU A;  1PYV A;  2HYG D;  4DQ2 A;  2NS8 A;  4CZZ A;  2EIL H;  2MG4 A;  4ZDL A;  4IEJ A;  1FJL A;  3NWS A;  2EV0 A;  2V7F A;  4BNC A;  5IP6 A;  1R1T A;  3QU3 A;  3K4K A;  3RPU D;  2W85 A;  4F55 A;  3PNT A;  2XRN A;  3MCZ A;  4BU2 A;  1DU6 A;  3JTH A;  2DOA A;  1G4D A;  3IHU A;  4FIS A;  1VF9 A;  4A6D A;  4BH9 A;  2HOS A;  4I0A A;  1WJ5 A;  4MEY F;  5GP9 A;  1XS9 A;  2FNP A;  2VPL A;  3S3M A;  3RZO J;  1DPR A;  3F8B A;  1UB9 A;  2KDO A;  3JTG A;  3CP2 A;  1WJF A;  4KMU X;  2WA0 A;  2R5Y A;  4LIU A;  4UNO A;  3KEO A;  3TW6 A;  2E7X A;  2Z99 A;  2CS3 A;  3QP5 A;  3WGI A;  2QYO A;  1MGT A;  1LVA A;  2R7O A;  3ABL H;  3BPV A;  4J19 A;  1E3P A;  4F92 B;  4A3K J;  3HOV J;  2JSC A;  2FQ4 A;  3LSG A;  3QYB A;  3QOE A;  1FOW A;  4AD9 A;  1SD7 A;  3S8P A;  3DU5 A;  3DBH B;  4CCM A;  1IN5 A;  3OYD A;  4DYR A;  2D1H A;  4CCJ A;  3M9A A;  1Z3X A;  1R49 A;  5B1B H;  2BXY A;  2MH9 A;  1FNN A;  5FKL A;  4EJV A;  2RV8 A;  2IGK A;  4KN7 X;  1MDM B;  4JK1 X;  3DF8 A;  1H8A C;  2O9L A;  2ISZ A;  5IOZ A;  1DGR M;  4IHW A;  3PNV A;  2ELH A;  1SAX A;  2Y31 A;  2IEK A;  5DM6 F;  1B1B A;  2GOM A;  2R7X A;  4R1H A;  1Z7U A;  2P6S A;  1NG7 A;  4HNT A;  1VFC A;  4A3C J;  3WTX C;  2Z33 A;  4NC6 A;  1H9G A;  4MLO A;  4Z2Y A;  1SD5 A;  2XF5 A;  3EUH A;  1WI9 A;  3K1M A;  3KEY A;  1A36 A;  2JVG A;  1GT0 C;  2QEX I;  2Z1D A;  1R5G A;  4XM3 A;  5ICF A;  4C30 A;  4KDP A;  1Y56 A;  1ZGJ A;  2GIZ A;  1EKE A;  2NS0 A;  2LF7 A;  2VKH A;  5IOY A;  1BIB A;  3IH2 A;  4I99 C;  2CW8 A;  2W7N A;  3WOD F;  1QU3 A;  3CF5 F;  3RYR A;  1UMQ A;  1NG6 A;  1D1C A;  3H9G A;  2IW5 A;  2LF8 A;  3TED A;  3RJP A;  3LA7 A;  3QYF A;  3G1O A;  2PG4 A;  1IXC A;  1UST A;  2QLZ A;  5DUK A;  2IVM A;  1VQL I;  2HPM A;  2NVY J;  1ZRF A;  1ZTR A;  4BXX J;  2DCE A;  5H20 A;  4A3F J;  2XGC A;  2QM3 A;  3E97 A;  2DFE A;  5L3D A;  4U0W A;  3JSO A;  1BI0 A;  3RDI A;  1UHS A;  2UXN A;  2Z3Y A;  1FOY A;  2DMT A;  2HXO A;  2YX4 A;  3KP2 A;  2FRH A;  3PUF A;  2E1N A;  1P2F A;  4G7H F;  5HDG A;  3S15 J;  1I1S A;  1BR1 A;  3ZGK A;  2UUZ A;  3BG7 A;  4BYY A;  4EJO A;  5ILU A;  4HQE A;  4ETS A;  3A03 A;  1LDJ A;  4EJW A;  1MH4 A;  3DKY A;  4RBO A;  2ACJ A;  2FBI A;  4KIB A;  1V5G A;  1TW3 A;  3BG5 A;  4Y52 J;  1OIS A;  1P92 A;  2K5C A;  3MAJ A;  4IX7 A;  3LQR A;  2CU7 A;  1NK2 P;  4ESF A;  2X9D A;  4HZF A;  2CV1 A;  4L9V A;  2STT A;  3VDX A;  3CCJ I;  1J59 A;  3I53 A;  4Y4R A;  4XSZ F;  4LB6 B;  4B09 A;  3Q9V A;  1S8N A;  1SD4 A;  1XDS A;  1R36 A;  2L7F P;  1P9Q C;  4LLG F;  4PK4 A;  4C2M J;  2ELJ A;  4FX0 A;  4M72 A;  5IY5 H;  1H9T A;  4IJA A;  1UAA A;  1ONV A;  5ICE A;  2NNN A;  1BN5 A;  2EFP A;  4RAZ A;  3DPT A;  3E6M A;  3AKZ A;  4O5V A;  1ZAO A;  4U7B A;  1FBQ A;  4PJM A;  3VEP A;  1X3U A;  2OV7 A;  2X6O A;  5J1Y A;  2BYV E;  3EQL F;  4KIF A;  4NB5 A;  5J3L A;  3TDZ C;  1SVO A;  2JA5 J;  5AON A;  2AXT C;  1T56 A;  4XLH A;  2IGO A;  4RB1 A;  1BOB A;  1X4O A;  1FPQ A;  2OQR A;  4BAC A;  1BR4 A;  2JPB A;  3HOX J;  2QCO A;  5D5W B;  3S1R J;  2BW3 B;  2VJ4 A;  5LD2 C;  1IN7 A;  3HJE A;  2LK2 A;  1GV2 A;  2DQR A;  2HNH A;  1JTX A;  3BQY A;  1QZE A;  1K6O A;  5FRN A;  1VZ0 A;  2JA8 J;  2GQQ A;  4IRG A;  4ON0 A;  4IHX A;  1MBG A;  2QA4 I;  2XC7 A;  3COA C;  2X4H A;  1D0Y A;  3F3X A;  3OWT A;  3H5R A;  3RSN A;  1STZ A;  2BOL A;  4G6Q A;  1YIT I;  3HGY A;  2L7M P;  3Q0U A;  4U0Y A;  1HW5 A;  2PN6 A;  3CME I;  4IHT A;  5DTD A;  3JRA A;  3PFY A;  1PJR A;  4UXN A;  3GYH X;  4XBF A;  3R4K A;  3IL2 A;  3FM3 A;  2JA7 J;  2F5E A;  2HQN A;  4RGU A;  1KU2 A;  2P81 A;  5IP7 J;  1ZG1 A;  5K7F A;  5JI6 A;  1K79 A;  3H0G J;  5F0H A;  2DK8 A;  2QSH X;  1I27 A;  1FTT A;  4P55 A;  3TDU C;  4FE4 A;  2LY1 A;  2HDW A;  3KP5 A;  1YFH A;  3LA3 A;  2W24 A;  4F52 A;  2QGU A;  5E17 F;  2O61 A;  3OYH A;  2DPU A;  3QYE A;  1R5H A;  1M1E B;  2YU3 A;  5LLQ A;  1MMS A;  3CO7 C;  3CCQ I;  3M7G A;  1E2X A;  2DTZ A;  3GCM A;  3LSP A;  3RKQ A;  2Y2Z A;  2XKP A;  4DW6 A;  1TNT A;  5H2F C;  3PJR A;  1IUY A;  2EA4 A;  3GTL J;  3CZ6 A;  2K3F A;  1FY7 A;  3SFZ A;  1FP1 D;  4XOR A;  1YE9 A;  3JRC A;  3U2R A;  4UB6 C;  4IF4 A;  3G3Z A;  5DD4 A;  3I71 A;  1QVT A;  1J0R A;  2ETH A;  3JAM K;  3K4L A;  5DCM A;  4QLC U;  3IRR A;  3L2Q A;  2WY8 Q;  3V7S A;  3GTG J;  3PM1 A;  4ABZ A;  3FXU A;  1QHH D;  1TWC J;  4UY8 I;  1MBF A;  2MH2 A;  4BXF A;  5K7Z A;  4Q5S F;  1ZLK A;  4D9J A;  2A3S A;  2XAS A;  1OPC A;  3ECO A;  3GTJ J;  2PFB A;  1HOM A;  3OYM A;  2DA6 A;  2ZJ2 A;  1DU0 A;  1WJE A;  3HKZ N;  3CLQ A;  4FAS D;  3K0L A;  2DMN A;  3OYJ A;  1HDD C;  4QTR A;  3GZ6 A;  2A5W A;  3V7R A;  4AUX A;  4Y7N J;  4RGR A;  5E3L A;  3HRU A;  1GUU A;  1ZGA A;  4A5M A;  4ZDP A;  1MBK A;  1Y6I A;  2M7A A;  1ZG5 A;  1XG1 A;  1HXD A;  1USS A;  1B59 A;  2BXZ A;  3QOD A;  3KP6 A;  1NHA A;  4V2G A;  1JT0 A;  2HDC A;  1SAU A;  1WH7 A;  3E5X A;  3WTY C;  4W97 A;  3E7L A;  4PCQ A;  1TW2 A;  5E8G A;  1SD6 A;  4ENM A;  2TCT A;  4CUG A;  4V19 K;  2VOO A;  1YI2 I;  1RRJ A;  4OIQ F;  4MGR A;  4XLF A;  3QPT A;  1QPM A;  2OU2 A;  2CW7 A;  4EM0 B;  1EH8 A;  3DPU A;  1Z6R A;  1D8J A;  1Q1V A;  1QGP A;  1W4M A;  4C3J J;  3EUH C;  4I7H A;  4M3D A;  3H0D A;  1G3W A;  1Z21 A;  1JUP A;  3G4S I;  2GM4 A;  3BT9 A;  1FYK A;  4E4H A;  4QPO A;  1TNS A;  4PSX A;  1C0W A;  1XGN A;  2L4M A;  3E1S A;  1X58 A;  1U78 A;  4AIK A;  1X19 A;  2FNA A;  4NBQ A;  3LAP A;  3HIF A;  4G7Z F;  4L18 B;  1O3T A;  5E18 F;  4GDF A;  2HKO A;  5DCM B;  2EFW A;  3PUB A;  2PMZ A;  3HTS B;  4D7N A;  1BI1 A;  4WXC A;  5FKN A;  2IS6 A;  1Z3Y A;  5JR3 A;  2K9L A;  2ME0 A;  3ASN H;  3E6B A;  1FMV A;  2F5C A;  3F8C A;  1MNE A;  1MBE A;  2KKO A;  2O0Y A;  3ZQC A;  1DPU A;  2A61 A;  4HEA 2;  1AOY A;  3LL7 A;  5F04 A;  3CC2 I;  1RKT A;  4YEJ A;  2HR3 A;  5CVJ A;  2KZV A;  4E7J A;  2WTE A;  3T8T A;  2NXN B;  5DEQ A;  2ZME B;  4GCV A;  2ZJP F;  3ZMD A;  1OCC H;  3I58 A;  1I1G A;  3GX4 X;  4Q4Z F;  4XKV A;  5BS6 A;  2VE8 A;  2L7K A;  4LJZ F;  2EFQ A;  4A3I J;  1BW6 A;  2EBI A;  4Q48 A;  4UVB A;  4ZYG A;  1VQ4 I;  1XB4 A;  1GDT A;  5IT9 K;  3MMY B;  1MBH A;  5F0C A;  3GTK J;  1IXR C;  5TIS C;  2H1K A;  3PQK A;  4XKB A;  1AA7 A;  3PQJ A;  5D4S A;  1I39 A;  2ISY A;  1T8I A;  3F9K A;  1XMX A;  2X51 A;  3V7C A;  2Q0O A;  2KFD A;  2A6E F;  3UNG C;  2VQL A;  1Y39 A;  1MJA A;  3FIS A;  5HLH A;  5ILS A;  3EUA A;  5EZG A;  2L02 A;  4M6X A;  3U1D A;  4YG2 F;  3V8J A;  1TP4 A;  3B6C A;  3BZK A;  2F4O B;  4RA2 A;  1RNL A;  4B1R A;  2P7C B;  5FD6 A;  1LPQ A;  1SFK A;  3R0J A;  4XKC A;  4QWQ A;  3VB2 A;  1YO5 C;  5B3S H;  3VFZ A;  3OSG A;  1LFP A;  4CHU A;  4PJ0 C;  2HWV A;  4X0G A;  4OMY A;  1TBX A;  2M1B A;  2E36 A;  3G1M A;  1V4R A;  2WAQ N;  4KYW A;  3OYK A;  2Z9O A;  3F72 A;  2CWE A;  5KCM A;  3FXQ A;  2E1M B;  1I3A A;  1HC8 A;  1ITY A;  2ZC2 A;  3MN2 A;  3QAH A;  1U0J A;  1DP7 P;  1KZH A;  1LQ1 A;  2NS7 A;  5J4V A;  1LKX A;  1X1A A;  3ML6 A;  4G6D A;  4RLQ A;  2ME6 A;  2HPI A;  4LMY A;  1SVL A;  4Y17 A;  4E7Z A;  4RB2 C;  2GLO A;  5F1J A;  2FE3 A;  4AU7 A;  5GAH J;  1QZY A;  5LFA A;  4CA0 A;  2LH9 A;  3CD6 I;  3JAM Z;  3F8F A;  3HEF A;  2ZCW A;  4HX8 A;  4PFP A;  1O4X A;  4L9N A;  2IS2 A;  2VKE A;  2XV4 S;  1XD7 A;  1Z7L A;  1K61 A;  4B3A A;  2G0E A;  2DA3 A;  1D1B A;  2R4G A;  5K5Q A;  1BM9 A;  1MJ9 A;  4G12 A;  1YQA A;  1KA8 A;  2KMU A;  4ZZL A;  4GYI A;  1X3W B;  4JQF A;  2R7Z J;  2L7Z A;  2CQX A;  2R7R A;  3NAU A;  3SQN A;  4J00 A;  2K4B A;  4AM3 A;  2ELK A;  3CUQ B;  2IRF G;  2VUM J;  3CUO A;  4FT8 A;  4Z6Y A;  4EGY A;  1S7E A;  5F27 A;  1K6Y A;  1HA8 A;  4ESJ A;  2HEO A;  2XGX A;  1SMT A;  1TQI A;  2MYS A;  3WHC A;  1FOX A;  3J7Y J;  1G8X A;  3ECH A;  2DOD A;  1VTN C;  3HDD A;  5F64 A;  3J7Z I;  1BIA A;  2CO5 A;  2GXG A;  4XON A;  4RGX A;  4G9Y A;  5LHG A;  3S3O A;  4DJA A;  4YII A;  1RUO A;  1WPK A;  5H6R A;  3OYB A;  3KPH A;  2VJ5 A;  2ID3 A;  5C3E J;  1P7J A;  3V8L A;  2CFX A;  4HLY A;  1O3S A;  4DNC A;  5GAE J;  1J7K A;  1BBY A;  4S05 A;  3R0A A;  4BY7 J;  1ZK8 A;  4BL0 B;  4MO7 A;  2MAB A;  4B8X A;  3CMA I;  2PMU A;  5H6Q A;  1T0F A;  4HV6 A;  2IP2 A;  2NRA C;  1DGW Y;  1ETK A;  4M3B A;  3KFW X;  4NUB A;  5E1Z B;  3VYU B;  4X1E A;  3SZT A;  3PFI A;  1IC8 A;  2I10 A;  2RVC A;  4QIW N;  4II2 A;  4BE0 A;  4ANJ A;  5LHI A;  2RAE A;  5E8I A;  3CJR B;  4HOB A;  2KQR A;  2DA7 A;  3LMM A;  2HTS A;  5L3B A;  1YLF A;  2PJR A;  1VQN I;  3LNQ A;  1IN4 A;  4S0H B;  2NAZ A;  1ZQ3 P;  3RYP A;  3K1P A;  3TO9 A;  3ULQ B;  4N9H A;  2DLL A;  4D0P A;  3K1N A;  2V9V A;  1VQ9 I;  2RGV A;  1MMN A;  1OYY A;  3V8K A;  4BS9 A;  2ZJR F;  4AWX B;  3O8G A;  2FX0 A;  2OQG A;  2EFN A;  4ZJZ A;  2K9Q A;  1D3Y A;  3ZCO A;  2Y30 A;  1OR7 A;  2EQR A;  3HUG A;  1J09 A;  2HOE A;  1R23 A;  1YIJ I;  3X2Q H;  1VQ6 I;  3A4C A;  1FP2 A;  3OIQ A;  1R1U A;  1XCB A;  5FKK A;  3HGG A;  3K69 A;  3LWF A;  2V9K A;  1VQP I;  1PUF A;  3SZP A;  4KFC A;  1OLT A;  5LEK A;  2HZT A;  1HQC A;  2KIU A;  2OCE A;  3F22 A;  4A3M J;  3S32 A;  2DFH A;  3IWF A;  4V2F A;  2M30 A;  4E70 A;  3JRE A;  4OIR F;  5IT9 Z;  1FBU A;  5L3C A;  2XAU A;  5K7H A;  1YW9 A;  3VWB A;  1R58 A;  3CDH A;  1I6X A;  2ID6 A;  4I0B A;  1DUX C;  2K4J A;  2VQH A;  3CES A;  1ODD A;  1WHU A;  3I56 I;  3VYR B;  2JT1 A;  4XLE A;  2M3A A;  1P4A A;  3FHN A;  5EZH A;  2P7V B;  5F0F A;  5HOO A;  1O3Q A;  4PGH A;  5CQE A;  2HVS A;  4ZZD A;  4I02 A;  3A02 A;  4UUS B;  4BQA A;  3SDG A;  2W25 A;  1GXP A;  2YUS A;  2O8X A;  3RIR A;  4XR6 A;  2VXD A;  2QUF A;  2XGD A;  3I55 I;  3HHG A;  1VQ7 I;  3BG3 A;  1P4W A;  2E1M C;  2UXX A;  2OPT A;  3ESW B;  2DMQ A;  3BR3 A;  3FXO A;  4DZP A;  1Y8Q B;  3PIO F;  4HQM A;  3A0H C;  2ZJQ F;  1IDY A;  5FO5 A;  3F21 A;  5L3E A;  1UCR A;  2GA1 A;  3C7J A;  1HCR A;  1BR2 A;  3AG4 H;  2PJR B;  1SAN A;  3K4J A;  5B66 C;  2CH0 A;  1WQ2 A;  1HKS A;  2QWW A;  4RLF A;  2FU4 A;  3CDL A;  2V6C A;  4HSR A;  4E7S A;  4WX9 A;  1ETV A;  4HF2 A;  3FX3 A;  2K40 A;  3MZY A;  4UUT A;  2XSJ C;  4XNF A;  5ERI A;  3HUG B;  3BZ6 A;  3HOW J;  2FSW A;  4IQ4 A;  4IL6 C;  5ILV A;  4HX7 A;  4JBA A;  2LR8 A;  4I2O A;  3VYS B;  1LEB A;  2HFH A;  3QWL A;  5J1R A;  3QPS A;  3GFM A;  1PUF B;  3JRD A;  2XHK A;  4KNY A;  2XPU A;  3ELK A;  1O57 A;  4XKW A;  3SFI A;  4BUP A;  4NC8 A;  2WB1 A;  4GYG A;  4BJT A;  4PDK A;  5BNG A;  3KX2 A;  4Y13 A;  5DCF A;  1ZEL A;  2KIQ A;  3F6O A;  3I3L A;  1WSU A;  2V4J C;  3EUK L;  3D5S C;  1RR8 C;  3IP4 B;  4BDZ A;  2OBP A;  1Y1W J;  1B6A A;  2V26 A;  3K4M A;  3QQA A;  3OYI A;  1LJ9 A;  3IWZ A;  2LY9 A;  5FKO A;  4H4K C;  5HS7 A;  4IHV A;  3HC7 A;  4JX5 A;  3TW7 A;  1YW7 A;  4ENN A;  3VPR A;  3UR3 C;  1X2M A;  3BC8 A;  4L5I A;  5J8C A;  2R7F A;  1S72 I;  2K7L A;  1J2X A;  1FIA A;  2L9V A;  3J7A O;  3HKZ A;  3KEQ A;  2BHZ A;  4NQW A;  3R60 A;  2PLY A;  1E3O C;  3KET A;  2E7W A;  2F5D A;  1T08 B;  3WTZ A;  3TP0 A;  5FB2 A;  1R9T J;  4TV7 A;  2HYF A;  3C1D A;  2VOP A;  1PUE E;  3D1N I;  2Y0M A;  1JKQ C;  1I6H J;  1JHF A;  2IAI A;  2VJI A;  3ZMZ A;  2LC2 A;  4OAY A;  2XVC A;  3H35 A;  4B3X A;  5K1Y A;  2IT0 A;  4AIH A;  3DTK A;  3P5J A;  4S04 A;  2PBI A;  3GFJ A;  1JJ8 C;  2O6G E;  1QHG A;  2RQQ A;  1V54 H;  3FM5 A;  1MIJ A;  1MNM C;  2LTP A;  1VQO I;  2HOT A;  1T2K A;  2M87 A;  3P9I A;  4WF2 A;  3AFH A;  5FRO A;  2UV1 A;  5A2Q K;  1IJW C;  1REP C;  4IXA A;  3DKX A;  2QQA A;  2V1N A;  2DBB A;  3L9F A;  3O2P E;  2IA0 A;  4ENK A;  3G73 A;  4D7M A;  4LLN A;  1R4N B;  1YJ9 I;  3SZG A;  2JRM A;  2BW3 A;  5KNL A;  1SFU A;  2LSO A;  2GXA A;  1EH7 A;  1MSE C;  1XTA A;  1MH3 A;  4CO8 A;  3PIP F;  1L0O C;  3P7N A;  2G9W A;  3CCU I;  4OOI A;  3L1P A;  2LDU A;  4F7Z A;  4ZYA A;  2VJJ A;  3LQQ A;  2QBY A;  4KIT B;  3GXO A;  3S2H J;  3OYL A;  1Z9C A;  1IAW A;  2BGC A;  4IVN A;  2CQN A;  3HM5 A;  2FEZ A;  3AL0 C;  1ACI A;  1W7P D;  1RR7 A;  3K6G A;  1YX5 A;  3S93 A;  5M5X J;  2A07 F;  1P6R A;  4UHT A;  2EIJ H;  3Q0W A;  5EYR A;  3M1C A;  2QSG X;  3ZN1 A;  4J01 A;  1MZB A;  5CKT A;  4NQW B;  2E5N A;  3EPZ A;  1QVU A;  2XGE A;  4HDV A;  4M6Y A;  1MMD A;  4KJZ A;  4HBL A;  5B1A H;  1HDP A;  4MFD A;  2VBX A;  2L9R A;  4JP0 A;  1XGM A;  2DT6 A;  3VOE A;  1Z77 A;  2HXI A;  2IA1 A;  1GVD A;  2Y0S N;  1ZLJ A;  2STW A;  1T0F C;  3BQZ A;  1ERD A;  5DD8 A;  2CQQ A;  1JGS A;  2B7E A;  3GWZ A;  4KT5 C;  3OS0 A;  3CCL I;  3SJM A;  4LGW A;  5K5O A;  3BR2 A;  1PDN C;  3GO5 A;  2HKX A;  2M7B A;  2P0W A;  2LKX A;  4C2U A;  4IZZ A;  4EMS A;  3N05 A;  4Y15 A;  2VAS A;  2EZL A;  2ZO4 A;  2O7O A;  1U5T A;  3BOQ A;  1JGG A;  1TT0 A;  4M3E A;  1ZGW A;  2WY7 Q;  2HI3 A;  4CH7 A;  2EFO A;  1RET A;  4IRH A;  2ECB A;  2DOF A;  3ZQ7 A;  4R79 A;  3WHB A;  3J80 K;  4WK8 F;  1OR7 C;  2GIV A;  6PAX A;  3PL8 A;  4XRS G;  2DDB A;  1T38 A;  3JR9 A;  3WTS C;  2VBY A;  1G3T A;  4DYC A;  2WAQ A;  1H88 C;  1T95 A;  1JKO C;  3ZR8 X;  2QBY B;  1BJZ A;  3ZN0 A;  1AU7 A;  4BHB A;  2E2H J;  2F6C A;  2JRT A;  3LSH A;  4CGZ A;  1F5T A;  3FKI J;  3T0Y A;  2G7H A;  1HST A;  3QU6 A;  4HNV A;  2DT5 A;  5FLV A;  2EV6 A;  2DMP A;  4D5C A;  4FCY A;  1OCT C;  1XGS A;  3G1L A;  3BJA A;  1TWF J;  3FXK A;  3CMY A;  3I64 A;  3GUD A;  4HRI A;  1N78 A;  2LBF A;  2BE5 F;  1LUJ B;  3AG2 H;  2A69 F;  1TL8 A;  1XSD A;  3CCV I;  2EH3 A;  1LFU P;  4LB5 A;  3EET A;  3HOY J;  2JK3 A;  1Z6T A;  1FMW A;  2W48 A;  2JJ7 A;  2HQ5 A;  3RPQ A;  2V1U A;  3O8H A;  5EEH A;  3IAM 2;  4DZJ A;  4M73 A;  4C3I J;  5JHU A;  2E2I J;  4BXU A;  4CCK A;  5FFZ A;  4U87 A;  5LGT A;  1X3Z B;  4ZYH A;  3TO6 A;  2M34 A;  1S9H A;  3WU0 A;  2FMY A;  1I5Z A;  4FHT A;  2R7U A;  2PI0 A;  2JN6 A;  3LST A;  1R6R A;  1X2N A;  2OJE D;  4UB8 C;  2CUZ A;  5E1W A;  2ECC A;  2EJR A;  1FBS A;  1LFB A;  2M5W A;  1U5T B;  4E7H A;  4C2T A;  1WZ2 A;  2PMH A;  2XRO A;  4CCO A;  2V1X A;  1U9N A;  5JVT A;  4H0E A;  2DA1 A;  3H3Z A;  4LG0 A;  3OS1 A;  2XSD C;  3ROU A;  5DDG A;  2JMW A;  2VT3 A;  3KYL A;  5M3F J;  1SC7 A;  4PFO A;  4G7O F;  2V6E A;  2A6H F;  3GFL A;  3W2V A;  4A69 C;  4DIQ A;  2BZT A;  2I5U A;  3E0J B;  4BQQ A;  3RKX A;  2IXS A;  1YS6 A;  3FKJ A;  5JHF A;  3I4N J;  4MIM A;  2EK5 A;  1YJW I;  2FXA A;  2ZME A;  3OIO A;  4LFU A;  2AXL A;  3BJO A;  1IRX A;  3F8N A;  4G6T B;  1HKT A;  3BJ6 A;  2BVM A;  2CFO A;  4BJ6 C;  1ZRD A;  2ZNZ A;  5DM7 F;  5IPA A;  2P6T A;  1IDZ A;  2O3F A;  2R7T A;  1B72 A;  3L2U A;  5JLX A;  2F48 A;  2WBM A;  1A04 A;  4U7D A;  3BRO A;  2LBF B;  1CQT A;  1TQM A;  2EWN A;  2Y75 A;  5KAI C;  3S2D J;  3C2B A;  3N97 A;  2ZSH B;  2KLO A;  3HRT A;  3LFK A;  4P9U A;  4M71 A;  2HS5 A;  2DFF A;  2AO9 A;  5EJC A;  5JLW A;  2O03 A;  2DOE A;  5FJ8 J;  1EF4 A;  1JXS A;  4RAY A;  2E1C A;  3Q0V A;  2XIG A;  1YHQ I;  1DDN A;  2R3S A;  4YFK F;  5DS9 A;  1N77 A;  5LRR A;  4BQN A;  3WG9 A;  2NOJ B;  1ZHF A;  5AIP A;  1RZ4 A;  3CCY A;  2ICW G;  3HRM A;  1XC5 A;  2D45 A;  1T39 A;  1OQY A;  3E3V A;  2MA3 A;  1K7A A;  3TL4 X;  4E7I A;  3DEE A;  3BTL A;  1X1D A;  1IO2 A;  3GTM J;  4UUV A;  1UEL B;  1VQ5 I;  3F0C A;  2CJJ A;  3MFK A;  4O6J A;  2PX9 A;  4L0Z B;  1Y8R B;  1MJB A;  1QPI A;  3DBR B;  1D5Y A;  2R0Q C;  2K85 A;  2AQE A;  1UG0 A;  4LG0 B;  4N0B A;  2PJP A;  4BE2 A;  1ZAR A;  1AKH A;  1TWA J;  3LOC A;  3GW2 A;  3RPU A;  2X48 A;  5LRS A;  2FJ1 A;  1VND A;  2K9S A;  2M0M A;  3GF2 A;  1B8I A;  5LBQ A;  2K27 A;  1KQ0 A;  3CJQ B;  2KHM A;  4GXO A;  4ITV A;  3HTU A;  4L9T A;  2E35 A;  3BCA A;  1ZRC A;  3GFI A;  2JPC A;  1KON A;  1U3E M;  5D8L B;  3BTJ A;  5EGO A;  1TZL A;  1ZRE A;  2HQA A;  5EF6 A;  1FOK A;  4LIT A;  2DN0 A;  2OTL I;  2LMD A;  2IPQ X;  1BI3 A;  3MWM A;  3H3V K;  4HX4 A;  1B72 B;  2DT7 B;  1RPW A;  3H9J A;  1O7L A;  3J80 Z;  4LLL A;  4ZTJ A;  2QVO A;  5HOD A;  3VSK A;  2ZXW H;  3ZQF A;  3B73 A;  2WAD A;  3CUQ A;  4ASN A;  2P5L C;  4E7L A;  3BR5 A;  3HG9 A;  4LIV A;  3H36 A;  3FBN B;  3WG7 H;  2HVQ A;  1IRF A;  4U88 A;  2AS5 F;  1D8K A;  2VIX A;  2ZXH A;  1U8B A;  2L54 A;  1FC3 A;  5LEJ A;  3QRF F;  3D5R C;  4HNU A;  5E3N A;  3HOU J;  4A3G J;  2F5V A;  2MSY A;  2X6W A;  3CC7 I;  3BCB A;  3VYT B;  3MVP A;  1QZZ A;  2VL8 A;  2QF7 A;  5D4R A;  1Z91 A;  4OWR B;  3TKY A;  3CDI A;  3V42 A;  1VQ8 I;  2ZB9 A;  2COB A;  2Y9Y A;  4M9X A;  2J5P A;  5E3M A;  1QBJ A;  1NK3 P;  5HLI A;  5KVR A;  1PP8 F;  3Q5F A;  5GAG J;  3BTC A;  4BY1 J;  2OZU A;  4JX4 A;  2QSF X;  3U21 A;  4G8X A;  1W0U A;  2K9N A;  2K86 A;  3TMO A;  4A93 J;  1IXS B;  1HW1 A;  3KCC A;  2E34 A;  3CCR I;  1AKH B;  3IUO A;  3DCF A;  3OYA A;  2M0C A;  4RAG A;  1ON1 A;  1JE8 A;  1OJL A;  3DKW A;  3H3U A;  4JX6 A;  4EEF G;  1B8I B;  2WV0 A;  2L9S A;  4A3E J;  2CSO A;  4EJU A;  3JRB A;  5JFR A;  2P5K A;  2A68 F;  1N75 A;  4XLA A;  1IRZ A;  5EGO B;  2V1D A;  4M74 A;  5GAD J;  1Y0U A;  2K3P A;  2F2E A;  4OAZ A;  3M3Y J;  2X0L A;  4XN0 A;  3K2A A;  3L2C A;  1F43 A;  3DLA A;  4B4C A;  1B9N A;  3SDB A;  4XLP F;  3RKY A;  1WFX A;  1T98 A;  1KYZ A;  2LVS A;  2GAU A;  3CJT B;  4A3B J;  3M4O J;  3AAF A;  3OOU A;  1FT9 A;  3DWL E;  3GBG A;  2LOO A;  3WU1 B;  1A5J A;  1MSF C;  1ON2 A;  2DK5 A;  2M9H A;  3OL3 A;  2LKS A;  4XK4 A;  1J75 A;  1H0M A;  5KHD A;  2BY1 A;  2OAZ A;  2FBK A;  4ZH4 F;  1G6N A;  4P9F A;  1ZH5 A;  2KPM A;  3IAS 2;  2X1E A;  3ERM A;  2QKM B;  1D0X A;  2E60 A;  2XF7 A;  5HS8 A;  2MD5 A;  2CV0 A;  1XSV A;  3MEX A;  2W1O A;  1POG A;  4HST A;  3ZMT A;  5D8K B;  2XF6 A;  1UFM A;  5HLG A;  4CCN A;  1IW7 F;  2D5V A;  5TRD A;  3ABU A;  4B48 A;  2VKD A;  3KP3 A;  2EZK A;  1J5Y A;  2FF4 A;  3PSF A;  2HYJ A;  1JUS A;  4UUS A;  4A6E A;  3KLN A;  3BG9 A;  4FQG A;  3AG1 H;  2RNG A;  3BPX A;  2L3D A;  4F3Q A;  3DPL C;  4KN4 X;  3CCM I;  1N25 A;  2W84 A;  1G3S A;  1CGP A;  1XMA A;  1V3F A;  4BAY A;  4CIC A;  4I09 A;  1U6G A;  5GTH C;  2JWT A;  1MND A;  2ZNY A;  2WV1 A;  3OY9 A;  4CCL A;  1XPX A;  3T5X A;  2Q1Z B;  3RTR A;  1WWX A;  1KQ8 A;  1RUN A;  3ZMV A;  3GEZ A;  3KP7 A;  1W36 C;  1BA5 A;  3H92 A;  2TRT A;  3JCU C;  2D2W A;  4Y33 A;  3TOB A;  2ZME C;  2CV2 A;  1X1B A;  4M9S A;  2VE9 A;  1CF7 B;  3OS2 A;  3MQ0 A;  4L5E A;  4C9Y A;  2R7W A;  2M4G A;  2RNJ A;  2Y0S A;  5GPA A;  2H94 A;  1Y1V J;  1V5F A;  4HPQ A;  3HPH A;  5FKM A;  3CP8 A;  2DMU A;  5EDN A;  5GTI C;  2R7S A;  1ETO A;  3D0S A;  1W36 D;  2HZD A;  2E2J J;  2Z16 A;  1IV8 A;  4EM2 A;  2ZFW A;  1JKP C;  1OFC X;  4D5F A;  3CQZ J;  2FOK A;  1SFE A;  4EAT A;  3F23 A;  5BPD A;  3JSP A;  2B9S A;  3TO7 A;  2Y69 H;  4KIS A;  5FLX K;  2G7U A;  4P96 A;  1YW8 A;  3QOP A;  3RZD J;  2JTV A;  3E5U A;  5EG0 A;  2W82 A;  3WU2 C;  2XB5 A;  3CCE I;  3H9Q A;  1A31 A;  5F1R A;  2J5O A;  1KU9 A;  1HSJ A;  2K02 A;  2QQB A;  3ABT A;  3BWG A;  2EPF A;  5F08 A;  1RKW A;  3H5A A;  4B43 A;  1MMG A;  4FET A;  4NNJ A;  4XRM A;  4LD5 A;  1ZG3 A;  2KL4 A;  3IH4 A;  2A6T A;  4BGD A;  5C44 J;  4RM2 A;  5E20 A;  3FXR A;  2ZFU A;  1G2H A;  5HLT A;  4JOM A;  1I50 J;  2VB6 A;  2UZK A;  2RDP A;  2ADU A;  2BBY A;  5ICC A;  5B5E C;  5M3M J;  2YSR A;  3KZY A;  4L0Y B;  4FTH A;  3OV8 A;  1U9O A;  3P9K A;  4HA8 A;  3M8E A;  3T8R A;  3GVA A;  2IA2 A;  4BEH A;  3J81 K;  3LSJ A;  1WJB A;  1WH5 A;  3HXL A;  4OMZ A;  1BOA A;  4PUS A;  1IF1 A;  3A0B C;  1YG2 A;  3H1C A;  3K10 A;  4CYC A;  1YX3 A;  4XLN F;  3OYC A;  1JJ6 C;  3UKG A;  1WKM A;  3MZ8 A;  4X6A J;  3K9T A;  4GRI A;  3L2V A;  2ESH A;  4LG3 A;  4XSX F;  4BQO A;  4LK1 F;  3QPH A;  3OYE A;  1K4T A;  3IH3 A;  1A6I A;  4PJJ A;  3K2Z A;  4XOP A;  4DBR A;  3L2R A;  4OIN F;  3I59 A;  3S3N A;  2GWR A;  3MZH A;  1T33 A;  1ETQ A;  2Q2E A;  2RRE A;  3HL2 A;  2LLK A;  1KGS A;  1UHM A;  5LHH A;  1GLN A;  1LB2 A;  1F9N A;  1DP3 A;  2EIM H;  3VOD A;  2H27 A;  3NEU A;  3CUQ C;  3EDP A;  1SFO J;  2M45 A;  4UVA A;  4A3L J;  2HGC A;  3TBI A;  2L4A A;  1F4K A;  4YFN F;  2NVT J;  2DXI A;  3BY6 A;  3GZN B;  1G59 A;  5EG0 B;  4I6Z A;  4N4N B;  3DBL B;  4II3 A;  4RAF A;  2CYY A;  1HLV A;  4D1Q A;  2XKO A;  2YS9 A;  3I0T A;  3S1N J;  3K4C A;  3S1M J;  3REO A;  3FK7 A;  2X1D A;  4LOC A;  1EA3 A;  3FK6 A;  2Q8K A;  2LRD A;  2LNB A;  1FSE A;  4F91 B;  3EYI A;  3QP6 A;  3FHZ A;  1A35 A;  4PJL A;  2FUG 2;  2R7Q A;  2VI6 A;  2H6B A;  1EV7 A;  1W1W E;  2EV5 A;  2H1L A;  4UVC A;  3GLL A;  1QQI A;  1JUM A;  1LNW A;  1ZKG A;  2FML A;  2CW0 F;  3SXY A;  4C3H J;  2VOD A;  1YIO A;  2MLG A;  3C2G A;  1KYW A;  2L2O A;  4RDU A;  1KQ9 A;  4BEH B;  4CYD A;  1JHH A;  1D0Z A;  3FMR A;  3M8F A;  2VC1 A;  5J4Y A;  4CYC B;  3M07 A;  1BC8 C;  2KIF A;  4GFB A;  5BPI A;  1SEU A;  5IYC J;  2OA4 A;  4L9J A;  4XMY A;  2JZY A;  2N8G A;  4DYQ A;  3MKZ A;  2XDV A;  3ONQ A;  4XQF A;  1F1Z A;  2WC2 A;  1BI2 A;  5CYV A;  2CRG A;  3R61 A;  1RES A;  3I5U A;  4A3J J;  3I59 B;  3JRH A;  3ZPL A;  1R22 A;  3HBL A;  3JW4 A;  5FRM A;  1XDU A;  3JRF A;  2P8T A;  2Q2E B;  4G94 A;  2W4S A;  3MKY B;  2Z2S B;  4PSW A;  5EEA A;  2L9N A;  2DTR A;  3PSI A;  4Q47 A;  4BHC A;  3FMQ A;  1FLI A;  1BJA A;  1D5V A;  1L3L A;  1TWG J;  2NYX A;  3AG3 H;  4XL9 A;  3RQ4 A;  5K5R A;  1RIO H;  4EVI A;  1FX7 A;  1SVM A;  2MBF A;  2VQC A;  4LK0 F;  3WGH A;  2R5Y B;  4O3M A;  2E5Z A;  4MTE A;  4B47 A;  1TLH B;  1Z0X A;  4CXF A;  2VBZ A;  1R4M B;  3TGN A;  1O3R A;  3KIO A;  3PNY A;  5TGT A;  3SEQ A;  2GXB A;  5CVR A;  5DV5 A;  4RM3 A;  2HTJ A;  3BR6 A;  3OMY A;  1HF0 A;  2XUB A;  3LAJ A;  1GVJ A;  4KT6 A;  5E79 C;  3SYT A;  3OR2 C;  3K4B A;  2QQ8 A;  3ZQI A;  1K4S A;  2W57 A;  1GV5 A;  2KRF A;  3LSR A;  2HDD A;  5D5V B;  5FLX Z;  4YIF A;  2KRH A;  1FZP B;  3DLL F;  1LVK A;  4KUM A;  2IGM A;  2FA5 A;  2DPD A;  1QRY A;  2XAH A;  2D1V A;  5EEG A;  5IT3 A;  1XMK A;  2FBH A;  2O8K A;  4EQQ A;  2ZXI A;  2CQK A;  4I98 B;  3DTI A;  2QQ9 A;  4BJ5 C;  1TC3 C;  2BY3 A;  3M8J A;  3KYC B;  1LDD A;  1OCP A;  1OCO H;  1PVE A;  3OL4 A;  4CDG A;  4N9I A;  4IO9 F;  5DYM A;  4PGG A;  5GPC A;  2VLA A;  2X6Y A;  1B4A A;  2WAF A;  3CLO A;  4FE7 A;  1OYI A;  2DA4 A;  2M2E A;  1E3H A;  2XAG A;  3KP4 A;  4MQ9 F;  3TOA A;  2BY2 A;  4AVP A;  4IOC F;  1FEX A;  3J7A Y;  3OYG A;  3LSI A;  1UHW A;  1X1P A;  3DEU A;  4WCG A;  2COM A;  2ZXJ A;  1UZC A;  2JUC A;  4Y3O A;  3I54 A;  3KZZ A;  3DV8 A;  1RI7 A;  4WXH A;  5IYB J;  4GO1 A;  3J81 Z;  2HQR A;  2H8W A;  4QSH A;  4EM1 A;  2A05 A;  2DA5 A;  4YFX F;  3ZQH A;  3FXM A;  3IKV A;  3MKW B;  1IN8 A;  3GTQ J;  2O5R A;  4CSW A;  5IP9 J;  5BMZ A;  1ORK A;  1GXQ A;  3ZXS A;  3K7A J;  4XOT A;  2GBY A;  3FBI B;  3BDD A;  1XX5 A;  2VT2 A;  3W6K B;  2Y48 A;  3CO6 C;  3T1B A;  2QZ8 A;  2DO7 A;  4AYB N;  2X85 A;  1D1A A;  4ZYD A;  1S29 A;  1W0T A;  4MQV A;  4RB3 C;  3TP3 A;  4BDY A;  3ZMS A;  2LD5 A;  1QO0 D;  4OIO F;  4ESB A;  3DTE A;  5FLM J;  3HOS A;  3K4N A;  4UV8 A;  4MFE A;  3CCS I;  2VBW A;  2QEN A;  3WGG A;  4P5O A;  2BEO A;  4P1W A;  1VQM I;  1QNT A;  2OZ6 A;  4WXD A;  2IGN A;  1FTZ A;  3A01 A;  3FWE A;  4YEL A;  2DA2 A;  3LFU A;  3OYN A;  3BTI A;  3KE2 A;  5HNF A;  1XGO A;  3ZP5 A;  2OD5 A;  1IG7 A;  5HNH A;  3HB9 A;  2A5Y B;  2GZW A;  2OUM A;  5KK1 A;  4M9Z A;  3S16 J;  5HDK A;  2YR2 A;  3OSF A;  3HRS A;  2JQ7 A;  2BV6 A;  1K78 A;  2X6X A;  1H89 C;  2KJC A;  3SHF A;  3WTW C;  2BY0 A;  2P4W A;  2EZI A;  5IYD J;  3ERE D;  4IKF A;  3DU6 A;  1ULY A;  3WE2 A;  2EA2 A;  1IZ1 A;  1WRJ A;  3G6E I;  4R8H A;  1EJ9 A;  3C18 A;  1JKR C;  3HZJ A;  3NAR A;  5D6F A;  2LP0 A;  3RCO A;  4ENJ A;  1R00 A;  4PJN A;  3IC7 A;  1W5C C;  2WB1 N;  1BC7 C;  2LG4 A;  5JVG F;  3RKW A;  5C4X J;  4MHG A;  1WJD A;  2JA2 A;  1MW7 A;  2XRL A;  1IGN A;  1FWZ A;  1SFX A;  4DGW B;  2UWM A;  5HVQ C;  1ETX A;  3D5L A;  5A2Q Z;  5CLS A;  4XIC A;  3WTT C;  3K70 C;  4IOA F;  1GHC A;  3WE3 A;  3L7W A;  4XN3 A;  2VON A;  1UG2 A;  2CQ7 A;  2IBD A;  3ZQL A;  4HV5 A;  2HU9 A;  3MD2 A;  5AIQ A;  1PP7 U;  4N4O B;  1LEA A;  4K2E A;  3BR1 A;  4IRI A;  2KJB A;  2R93 J;  4BHP A;  4UV9 A;  2XPV A;  2Z5U A;  2F4I A;  2ZBK A;  5TJJ A;  3A2K A;  3NQO A;  4HW0 A;  1WGX A;  1NTC A;  1S3J A;  4WWC A;  2IS1 A;  1DQU A;  4W1U A;  3L00 A;  4NDL A;  4YRV A;  3WTU C;  1U2W A;  3F6V A;  1OCZ H;  4HF0 A;  5M5Y J;  3K70 D;  1QA6 A;  3FZV A;  2OTJ I;  2KZG A;  5BQT A;  1JTY A;  1WVR A;  3C3W A;  3B02 A;  1V55 H;  2CG4 A;  1BW5 A;  1HBX G;  3A01 B;  4A12 A;  1FSH A;  1AHD P;  5KAF C;  5J47 A;  1MKM A;  1MBJ A;  2EIN H;  3N4M A;  3S1Q J;  5CPR B;  4I01 A;  2OC6 A;  2MD0 A;  2XPW A;  2CMP A;  3ZQG A;  2H6C A;  3HYI A;  3PO3 J;  2KP6 A;  2DW4 A;  3OYF A;  3E6C C;  1K78 B;  1VQK I;  3L09 A;  2DQL A;  4A2U A;  1X4P A;  2XB0 X;  3E6D A;  3HSR A;  1OCR H;  2LFB A;  4XLC A;  4M6V A;  5J1U A;  4NHJ A;  4ZDO A;  2ESN A;  3GME A;  1Z1D A;  1Z05 A;  3V4G A;  3FMS A;  4A3D J;  3ASO H;  5LGN A;  2PEX A;  4XRF A;  3HHH A;  3DQV C;  5L3G A;  1W5S A;  4ZYE A;  2GA2 A;  1RC9 A;  3KZI C;  5HDN A;  4EJT A;  2XAQ A;  1R71 A;  1R5I D;  4RMN A;  1B9M A;  1YOV B;  2KIM A;  4KIC A;  3VSL A;  1ENH A;  1YYV A;  3MKL A;  4AID A;  2MGQ A;  1EH6 A;  2E1O A;  3GTP J;  1OYW A;  2L01 A;  1KU3 A;  3QPL A;  3IV5 A;  5CVI A;  2QKL B;  2GOX B;  4EV0 A;  2RQP A;  5CVU A;  1NH3 A;  3CMM A;  1ETW A;  2BVL A;  4E7K A;  5ED4 A;  1SMY F;  3TQN A;  2DYR H;  2RKH A;  3JRG A;  2R92 J;  1F36 A;  3FIW A;  2OCC H;  4MTD A;  3IKT A;  4RB0 A;  2H8R A;  2MC4 A;  3ZRG A;  5ICG A;  4XRS A;  3OOP A;  2JUG A;  4KIG A;  3R6S A;  3JRI A;  3U1K A;  3A1Y A;  1MD0 A;  1WI3 A;  2LRE A;  4BBS J;  1W5T A;  3U9G A;  2NVX J;  4B44 A;  1OKR A;  3LA2 A;  3FDY A;  4I76 A;  3LSM A;  3W6J B;  3WTV C;  1TQP A;  4FX4 A;  2OF7 A;  1Q1H A; 
#chains in the Genus database with same CATH homology
 3FF5 A;  5E1X A;  1YTY A;  4A5N A;  2XAJ A;  4HAM A;  2IJL A;  1T6S A;  2TDX A;  2M8E A;  5F6F A;  1XN7 A;  2F5F A;  1S7A A;  4HF1 A;  2MC3 A;  1U5T C;  1S7O A;  2C6Y A;  1HKQ A;  1ZN2 A;  5J8F A;  1IN6 A;  3CTA A;  4IPA A;  5DUI A;  2DU9 A;  5CJ9 A;  4AIJ A;  1XSX A;  3DFG A;  4A0Z A;  4PZJ A;  1E17 A;  1CF7 A;  2RN7 A;  3RI4 A;  1R7J A;  2DAO A;  3E5Q A;  1TTY A;  2DI3 A;  1KU7 A;  4KA4 A;  3HSF A;  3F8M A;  4L5J A;  4RS8 A;  2YPR A;  1G3Y A;  4RGS A;  2XAF A;  1LDK B;  2H09 A;  1W7P A;  2RC4 A;  2VC0 A;  2LKP A;  5LGU A;  4HDU A;  2VN2 A;  1S6L A;  3O3K A;  1OMI A;  4HLX A;  3M1E A;  2PQ8 A;  1R1V A;  5FD5 A;  1IRG A;  1YS7 A;  1FYL A;  5FFX A;  3ISP A;  3HSE A;  3DP7 A;  1P4X A;  4OU0 A;  1FYM A;  5L3F A;  2NNY A;  5D6E A;  5CVV A;  1HW2 A;  5D5U B;  1AWC A;  2WWY A;  3O6B B;  4MNU A;  1ZYR F;  3IRQ A;  4OIP F;  5D5X B;  1W7P B;  4U0V A;  3CJN A;  1J9I A;  2ZKZ A;  3KLO A;  1O7F A;  5BOX A;  5J6X A;  4KMF A;  2YX7 A;  3NRV A;  1U8R A;  3GZ5 A;  3I4P A;  3EYY A;  4HYE A;  1XCV A;  3HOT A;  5HS9 A;  2P5V A;  2R7D A;  3DXJ F;  2V79 A;  5FGM A;  2CGP A;  1MDM A;  2B0L A;  4A0X A;  4MEX F;  4GGG A;  3GLX A;  3Q9S A;  4IHS A;  2VXZ A;  2FQ3 A;  4A0Y A;  2MLK A;  3S2W A;  3P9C A;  2EB7 A;  3BP8 A;  2DFI A;  3ZMU A;  2HYG D;  4DQ2 A;  4CZZ A;  2EV0 A;  4BNC A;  1R1T A;  3QU3 A;  2W85 A;  2XRN A;  3MCZ A;  3JTH A;  1G4D A;  3IHU A;  4A6D A;  4BH9 A;  4I0A A;  4MEY F;  2FNP A;  1DPR A;  3F8B A;  1UB9 A;  3JTG A;  4KMU X;  4UNO A;  3KEO A;  2E7X A;  2Z99 A;  3QP5 A;  3WGI A;  2QYO A;  1MGT A;  1LVA A;  3BPV A;  2JSC A;  4AD9 A;  1SD7 A;  1IN5 A;  2D1H A;  3M9A A;  2MH9 A;  1FNN A;  4EJV A;  2RV8 A;  4KN7 X;  1MDM B;  4JK1 X;  3DF8 A;  2ISZ A;  1SAX A;  2ELH A;  1B1B A;  4R1H A;  1Z7U A;  2P6S A;  3WTX C;  2Z33 A;  1H9G A;  4Z2Y A;  1SD5 A;  3EUH A;  1WI9 A;  3K1M A;  1R5G A;  5ICF A;  4KDP A;  1ZGJ A;  2NS0 A;  2LF7 A;  1BIB A;  3WOD F;  3RYR A;  2IW5 A;  2LF8 A;  3RJP A;  3LA7 A;  2PG4 A;  1IXC A;  1UST A;  2QLZ A;  5DUK A;  2IVM A;  1ZRF A;  5H20 A;  2QM3 A;  3E97 A;  5L3D A;  4U0W A;  3JSO A;  1BI0 A;  3RDI A;  2UXN A;  2Z3Y A;  2YX4 A;  3KP2 A;  2FRH A;  2E1N A;  1P2F A;  4G7H F;  5HDG A;  1I1S A;  4BYY A;  4EJO A;  5ILU A;  4HQE A;  4ETS A;  1LDJ A;  4EJW A;  2ACJ A;  2FBI A;  4KIB A;  1TW3 A;  1P92 A;  3MAJ A;  3LQR A;  4ESF A;  4HZF A;  4L9V A;  2STT A;  1J59 A;  3I53 A;  4XSZ F;  4LB6 B;  4B09 A;  3Q9V A;  1S8N A;  1SD4 A;  1XDS A;  1R36 A;  4LLG F;  4FX0 A;  4M72 A;  1H9T A;  4IJA A;  1ONV A;  5ICE A;  2NNN A;  1BN5 A;  2EFP A;  4RAZ A;  3DPT A;  3E6M A;  4O5V A;  1ZAO A;  4U7B A;  1FBQ A;  3VEP A;  1X3U A;  2BYV E;  3EQL F;  4KIF A;  4NB5 A;  3TDZ C;  5AON A;  4RB1 A;  1FPQ A;  2OQR A;  2JPB A;  5D5W B;  1IN7 A;  2DQR A;  1K6O A;  2GQQ A;  4IRG A;  4ON0 A;  3COA C;  2X4H A;  3F3X A;  1STZ A;  4G6Q A;  4U0Y A;  1HW5 A;  2PN6 A;  4IHT A;  4UXN A;  3GYH X;  4XBF A;  3R4K A;  3IL2 A;  3FM3 A;  2F5E A;  2HQN A;  4RGU A;  1KU2 A;  1ZG1 A;  1K79 A;  5JI6 A;  2DK8 A;  1I27 A;  4P55 A;  3TDU C;  3KP5 A;  1YFH A;  3LA3 A;  2W24 A;  5E17 F;  2O61 A;  2DPU A;  1R5H A;  2YU3 A;  5LLQ A;  3CO7 C;  3M7G A;  1E2X A;  2XKP A;  1TNT A;  1IUY A;  2EA4 A;  1FY7 A;  3SFZ A;  1FP1 D;  3U2R A;  4IF4 A;  3G3Z A;  5DD4 A;  3I71 A;  1J0R A;  2ETH A;  3JAM K;  5DCM A;  4QLC U;  3IRR A;  3V7S A;  3FXU A;  2MH2 A;  4Q5S F;  1ZLK A;  2A3S A;  2XAS A;  1OPC A;  3ECO A;  2PFB A;  2ZJ2 A;  3K0L A;  3GZ6 A;  3V7R A;  4RGR A;  3HRU A;  1ZGA A;  4A5M A;  1ZG5 A;  1HXD A;  1USS A;  1B59 A;  3KP6 A;  1NHA A;  2HDC A;  3E5X A;  3WTY C;  4PCQ A;  1TW2 A;  5E8G A;  1SD6 A;  4ENM A;  2VOO A;  4OIQ F;  4MGR A;  3QPT A;  1QPM A;  2OU2 A;  4EM0 B;  1EH8 A;  1Z6R A;  1D8J A;  1QGP A;  1W4M A;  4I7H A;  1G3W A;  1FYK A;  1TNS A;  1C0W A;  1XGN A;  2L4M A;  1U78 A;  4AIK A;  2FNA A;  3LAP A;  3HIF A;  4G7Z F;  4L18 B;  1O3T A;  5E18 F;  2HKO A;  5DCM B;  2EFW A;  3HTS B;  1BI1 A;  4WXC A;  5JR3 A;  3E6B A;  2F5C A;  3F8C A;  2KKO A;  2O0Y A;  1DPU A;  2A61 A;  1AOY A;  2HR3 A;  5CVJ A;  2WTE A;  3T8T A;  5DEQ A;  2ZME B;  4GCV A;  3ZMD A;  3I58 A;  1I1G A;  3GX4 X;  4Q4Z F;  5BS6 A;  2VE8 A;  4LJZ F;  2EFQ A;  4Q48 A;  4UVB A;  4ZYG A;  1XB4 A;  5IT9 K;  1IXR C;  3PQK A;  3PQJ A;  5D4S A;  2ISY A;  3V7C A;  2Q0O A;  2A6E F;  1MJA A;  5HLH A;  5ILS A;  2L02 A;  4M6X A;  3U1D A;  4YG2 F;  3V8J A;  1RNL A;  2P7C B;  5FD6 A;  3R0J A;  3VB2 A;  4QWQ A;  1YO5 C;  3VFZ A;  4CHU A;  2HWV A;  4OMY A;  1TBX A;  2M1B A;  1V4R A;  4KYW A;  2Z9O A;  3F72 A;  2CWE A;  3FXQ A;  3QAH A;  1DP7 P;  1LQ1 A;  3ML6 A;  4G6D A;  4LMY A;  4Y17 A;  4RB2 C;  2FE3 A;  1QZY A;  3JAM Z;  3F8F A;  4HX8 A;  2ZCW A;  4L9N A;  2XV4 S;  1XD7 A;  5K5Q A;  1BM9 A;  1MJ9 A;  1YQA A;  1KA8 A;  4ZZL A;  4GYI A;  4JQF A;  3SQN A;  2K4B A;  3CUQ B;  2IRF G;  3CUO A;  4FT8 A;  4EGY A;  4ESJ A;  2HEO A;  2XGX A;  1SMT A;  1TQI A;  3ECH A;  1VTN C;  5F64 A;  1BIA A;  2CO5 A;  2GXG A;  4RGX A;  4G9Y A;  5LHG A;  4YII A;  1RUO A;  5H6R A;  3V8L A;  2CFX A;  4HLY A;  1O3S A;  4DNC A;  1J7K A;  1BBY A;  4S05 A;  3R0A A;  4B8X A;  2PMU A;  5H6Q A;  1T0F A;  4HV6 A;  2IP2 A;  2NRA C;  3KFW X;  5E1Z B;  3SZT A;  3PFI A;  2RVC A;  5LHI A;  5E8I A;  4HOB A;  2HTS A;  5L3B A;  1YLF A;  1IN4 A;  2NAZ A;  3RYP A;  3K1P A;  3TO9 A;  3ULQ B;  4N9H A;  2DLL A;  4D0P A;  3K1N A;  2V9V A;  2RGV A;  1OYY A;  3V8K A;  4AWX B;  2OQG A;  2EFN A;  1D3Y A;  1OR7 A;  3HUG A;  2HOE A;  1R23 A;  1FP2 A;  1R1U A;  1XCB A;  3K69 A;  3LWF A;  4KFC A;  3SZP A;  5LEK A;  2HZT A;  1HQC A;  2KIU A;  3F22 A;  3IWF A;  2M30 A;  4E70 A;  4OIR F;  5IT9 Z;  1FBU A;  5L3C A;  1YW9 A;  1R58 A;  3CDH A;  1I6X A;  4I0B A;  1DUX C;  2K4J A;  1ODD A;  2JT1 A;  1P4A A;  2P7V B;  5HOO A;  1O3Q A;  4PGH A;  4ZZD A;  4I02 A;  4BQA A;  1GXP A;  2W25 A;  2O8X A;  3RIR A;  2QUF A;  3HHG A;  1P4W A;  2UXX A;  4HQM A;  3F21 A;  5FO5 A;  5L3E A;  1UCR A;  2GA1 A;  3C7J A;  1WQ2 A;  1HKS A;  2QWW A;  2FU4 A;  2V6C A;  4HF2 A;  4WX9 A;  3FX3 A;  3MZY A;  5ERI A;  3BZ6 A;  2FSW A;  5ILV A;  4HX7 A;  4JBA A;  4I2O A;  1LEB A;  2HFH A;  3GFM A;  2XHK A;  4KNY A;  3ELK A;  1O57 A;  4GYG A;  4PDK A;  4Y13 A;  5DCF A;  3F6O A;  1WSU A;  2OBP A;  1B6A A;  1LJ9 A;  3IWZ A;  5HS7 A;  4ENN A;  1YW7 A;  5J8C A;  4L5I A;  2R7F A;  2K7L A;  1J2X A;  3J7A O;  3KEQ A;  4NQW A;  2PLY A;  3R60 A;  3KET A;  2E7W A;  2F5D A;  3WTZ A;  5FB2 A;  4TV7 A;  2HYF A;  3C1D A;  2VOP A;  1PUE E;  2Y0M A;  1JHF A;  3ZMZ A;  2XVC A;  5K1Y A;  2IT0 A;  4AIH A;  4S04 A;  2PBI A;  3GFJ A;  2O6G E;  3FM5 A;  1T2K A;  2M87 A;  3P9I A;  4WF2 A;  1REP C;  5A2Q K;  4IXA A;  2QQA A;  2DBB A;  3L9F A;  3O2P E;  2IA0 A;  4ENK A;  3G73 A;  4LLN A;  1SFU A;  2LSO A;  1EH7 A;  4CO8 A;  1L0O C;  3P7N A;  2G9W A;  4OOI A;  2LDU A;  4F7Z A;  3LQQ A;  2QBY A;  3GXO A;  1Z9C A;  1IAW A;  2BGC A;  4IVN A;  2FEZ A;  1W7P D;  2A07 F;  1P6R A;  4UHT A;  3ZN1 A;  1MZB A;  4HDV A;  4M6Y A;  4HBL A;  2VBX A;  3VOE A;  1XGM A;  2IA1 A;  2STW A;  1ZLJ A;  5DD8 A;  1JGS A;  3GWZ A;  4KT5 C;  4LGW A;  5K5O A;  1PDN C;  3GO5 A;  2HKX A;  4EMS A;  4Y15 A;  2ZO4 A;  1U5T A;  3BOQ A;  2EFO A;  4IRH A;  3ZQ7 A;  4R79 A;  3J80 K;  4WK8 F;  2GIV A;  6PAX A;  1T38 A;  3WTS C;  2VBY A;  1G3T A;  2QBY B;  3ZN0 A;  4BHB A;  2JRT A;  4CGZ A;  1F5T A;  3T0Y A;  2G7H A;  1HST A;  3QU6 A;  2DT5 A;  2EV6 A;  1XGS A;  3BJA A;  3I64 A;  3GUD A;  2BE5 F;  2A69 F;  1XSD A;  4LB5 A;  3EET A;  1Z6T A;  2V1U A;  3RPQ A;  5EEH A;  4M73 A;  5JHU A;  4BXU A;  5FFZ A;  5LGT A;  4ZYH A;  3TO6 A;  3WU0 A;  2FMY A;  1I5Z A;  4FHT A;  2PI0 A;  3LST A;  5E1W A;  2EJR A;  1FBS A;  2M5W A;  1U5T B;  2PMH A;  2XRO A;  2V1X A;  5JVT A;  4H0E A;  3H3Z A;  4LG0 A;  3ROU A;  5DDG A;  2VT3 A;  4G7O F;  2A6H F;  3GFL A;  3RKX A;  1YS6 A;  2EK5 A;  2FXA A;  2ZME A;  4LFU A;  2AXL A;  3BJO A;  3F8N A;  1HKT A;  3BJ6 A;  1ZRD A;  2ZNZ A;  2P6T A;  2O3F A;  4U7D A;  1A04 A;  3BRO A;  1TQM A;  2EWN A;  2Y75 A;  3N97 A;  3HRT A;  3LFK A;  4P9U A;  4M71 A;  2HS5 A;  2O03 A;  1JXS A;  4RAY A;  2E1C A;  2XIG A;  1DDN A;  2R3S A;  4YFK F;  5LRR A;  3WG9 A;  2D45 A;  1ZHF A;  5AIP A;  1RZ4 A;  3HRM A;  1T39 A;  3E3V A;  2MA3 A;  1K7A A;  4UUV A;  3MFK A;  4O6J A;  4L0Z B;  1MJB A;  4LG0 B;  4N0B A;  2PJP A;  1ZAR A;  3GW2 A;  3RPU A;  5LRS A;  3GF2 A;  5LBQ A;  2K27 A;  1KQ0 A;  4GXO A;  3HTU A;  4L9T A;  1ZRC A;  3GFI A;  2JPC A;  1U3E M;  5D8L B;  1ZRE A;  1FOK A;  2IPQ X;  1BI3 A;  3MWM A;  4HX4 A;  3J80 Z;  1O7L A;  4LLL A;  2QVO A;  3B73 A;  3CUQ A;  4ASN A;  2P5L C;  1IRF A;  4U88 A;  2AS5 F;  1D8K A;  2L54 A;  1FC3 A;  5LEJ A;  3QRF F;  1QZZ A;  5D4R A;  1Z91 A;  3TKY A;  4M9X A;  2J5P A;  1QBJ A;  5HLI A;  5KVR A;  1PP8 F;  3Q5F A;  2OZU A;  4G8X A;  2K86 A;  1IXS B;  1HW1 A;  3KCC A;  1JE8 A;  1ON1 A;  3DKW A;  3H3U A;  2WV0 A;  2CSO A;  4EJU A;  5JFR A;  2P5K A;  2A68 F;  2V1D A;  4M74 A;  1Y0U A;  2F2E A;  2X0L A;  3L2C A;  1B9N A;  4XLP F;  3RKY A;  1T98 A;  1KYZ A;  2GAU A;  3AAF A;  1FT9 A;  3WU1 B;  1ON2 A;  2DK5 A;  1J75 A;  1H0M A;  4ZH4 F;  2OAZ A;  2FBK A;  1G6N A;  4P9F A;  1ZH5 A;  5HS8 A;  2MD5 A;  1XSV A;  3MEX A;  3ZMT A;  5D8K B;  1UFM A;  5HLG A;  1IW7 F;  5TRD A;  3ABU A;  3KP3 A;  1J5Y A;  2FF4 A;  4A6E A;  3KLN A;  3BPX A;  2L3D A;  3DPL C;  4KN4 X;  1CGP A;  2W84 A;  1G3S A;  1XMA A;  1V3F A;  4BAY A;  4CIC A;  4I09 A;  1U6G A;  2ZNY A;  3T5X A;  3RTR A;  1WWX A;  1KQ8 A;  1RUN A;  3ZMV A;  3GEZ A;  3KP7 A;  3H92 A;  2D2W A;  3TOB A;  4M9S A;  2VE9 A;  1CF7 B;  3MQ0 A;  2RNJ A;  2H94 A;  3D0S A;  4EM2 A;  2ZFW A;  2FOK A;  1SFE A;  3F23 A;  5BPD A;  3JSP A;  5FLX K;  3TO7 A;  2G7U A;  4P96 A;  1YW8 A;  3QOP A;  2JTV A;  3E5U A;  5F1R A;  2J5O A;  1KU9 A;  1HSJ A;  2K02 A;  2QQB A;  3ABT A;  3BWG A;  4LD5 A;  1ZG3 A;  5E20 A;  3FXR A;  2UZK A;  2RDP A;  2ADU A;  2BBY A;  5ICC A;  4L0Y B;  2YSR A;  3KZY A;  3OV8 A;  3P9K A;  4HA8 A;  3M8E A;  3T8R A;  3GVA A;  2IA2 A;  3J81 K;  4OMZ A;  1IF1 A;  1BOA A;  1YG2 A;  4XLN F;  1WKM A;  3K9T A;  2ESH A;  4XSX F;  4LK1 F;  3QPH A;  3K2Z A;  4OIN F;  3I59 A;  2GWR A;  3MZH A;  2Q2E A;  1KGS A;  1UHM A;  5LHH A;  1LB2 A;  1F9N A;  3VOD A;  2H27 A;  3NEU A;  3CUQ C;  3EDP A;  2M45 A;  4UVA A;  2HGC A;  2L4A A;  1F4K A;  4YFN F;  3BY6 A;  2CYY A;  2XKO A;  3I0T A;  3REO A;  2Q8K A;  2LNB A;  1FSE A;  3EYI A;  3QP6 A;  3FHZ A;  2H6B A;  1EV7 A;  2EV5 A;  4UVC A;  1QQI A;  1LNW A;  3SXY A;  2FML A;  2CW0 F;  2VOD A;  1YIO A;  2MLG A;  1KYW A;  1KQ9 A;  4CYD A;  1JHH A;  3FMR A;  3M8F A;  2VC1 A;  1BC8 C;  2KIF A;  5BPI A;  2OA4 A;  4L9J A;  2JZY A;  1F1Z A;  2WC2 A;  1BI2 A;  5CYV A;  3R61 A;  3I5U A;  3I59 B;  3ZPL A;  1R22 A;  3JW4 A;  1XDU A;  2P8T A;  4G94 A;  2DTR A;  4Q47 A;  4BHC A;  3FMQ A;  1FLI A;  1BJA A;  1D5V A;  1L3L A;  2NYX A;  5K5R A;  1RIO H;  4EVI A;  1FX7 A;  2MBF A;  4LK0 F;  4O3M A;  3WGH A;  4MTE A;  1TLH B;  4CXF A;  2VBZ A;  1O3R A;  3TGN A;  2GXB A;  5CVR A;  5DV5 A;  2HTJ A;  2XUB A;  3LAJ A;  1GVJ A;  2W57 A;  2KRF A;  5D5V B;  5FLX Z;  4YIF A;  1FZP B;  4KUM A;  2FA5 A;  2DPD A;  2XAH A;  2D1V A;  5EEG A;  5IT3 A;  1XMK A;  2FBH A;  4EQQ A;  4I98 B;  2CQK A;  2QQ9 A;  1LDD A;  4CDG A;  4N9I A;  5DYM A;  4PGG A;  1B4A A;  3CLO A;  1OYI A;  3TOA A;  4AVP A;  3KP4 A;  2XAG A;  4MQ9 F;  1UHW A;  3DEU A;  4WCG A;  2COM A;  2ZXJ A;  3I54 A;  3KZZ A;  3DV8 A;  1RI7 A;  4WXH A;  4GO1 A;  3J81 Z;  2HQR A;  4EM1 A;  4YFX F;  3IKV A;  1IN8 A;  5BMZ A;  1GXQ A;  3BDD A;  2VT2 A;  3W6K B;  2Y48 A;  3CO6 C;  3T1B A;  2QZ8 A;  2DO7 A;  4ZYD A;  1S29 A;  4MQV A;  4RB3 C;  3ZMS A;  1QO0 D;  4OIO F;  4ESB A;  3HOS A;  4UV8 A;  2VBW A;  2QEN A;  3WGG A;  4P5O A;  2BEO A;  1QNT A;  2OZ6 A;  4WXD A;  3FWE A;  3KE2 A;  1XGO A;  3ZP5 A;  2OD5 A;  2A5Y B;  2GZW A;  5KK1 A;  4M9Z A;  5HDK A;  2YR2 A;  3HRS A;  2BV6 A;  1K78 A;  2KJC A;  3SHF A;  3WTW C;  2P4W A;  3ERE D;  1ULY A;  3WE2 A;  2EA2 A;  1IZ1 A;  1WRJ A;  4R8H A;  3C18 A;  5D6F A;  4ENJ A;  1R00 A;  3IC7 A;  1BC7 C;  3RKW A;  4MHG A;  1FWZ A;  1SFX A;  2UWM A;  5HVQ C;  5A2Q Z;  3D5L A;  3WTT C;  5CLS A;  1GHC A;  3WE3 A;  3L7W A;  2VON A;  4HV5 A;  5AIQ A;  1PP7 U;  1LEA A;  4K2E A;  4IRI A;  2KJB A;  4BHP A;  4UV9 A;  2Z5U A;  2ZBK A;  5TJJ A;  3NQO A;  4HW0 A;  1S3J A;  4WWC A;  3L00 A;  3WTU C;  1U2W A;  3F6V A;  4HF0 A;  3FZV A;  5BQT A;  3C3W A;  3B02 A;  2CG4 A;  1HBX G;  4A12 A;  1FSH A;  1MKM A;  3N4M A;  4I01 A;  2H6C A;  3HYI A;  3E6C C;  2DW4 A;  1K78 B;  3L09 A;  2DQL A;  4A2U A;  3E6D A;  3HSR A;  4NHJ A;  2ESN A;  1Z1D A;  1Z05 A;  3V4G A;  3FMS A;  5LGN A;  2PEX A;  4XRF A;  3HHH A;  3DQV C;  5L3G A;  1W5S A;  4ZYE A;  2GA2 A;  5HDN A;  4EJT A;  2XAQ A;  1B9M A;  2KIM A;  4KIC A;  1YYV A;  1EH6 A;  1OYW A;  2L01 A;  1KU3 A;  5CVI A;  4EV0 A;  2RQP A;  5CVU A;  5ED4 A;  1SMY F;  3TQN A;  2RKH A;  4MTD A;  3IKT A;  4RB0 A;  5ICG A;  3OOP A;  3R6S A;  4KIG A;  1MD0 A;  1W5T A;  3U9G A;  1OKR A;  3LA2 A;  3W6J B;  3WTV C;  1TQP A;  4FX4 A;  4EGZ A;  1Q1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...