1UHWA

Solution structure of the dep domain of mouse pleckstrin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GSSGSSGLGALYLSMKDPEKGIKELNLEKDKKVFNHCLTGSGVIDWLVSNKLVRNRQEGLMISASLLSEGYLQPAGDLSKNAADGIAENPFLDSPDAFYYFPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin
publication title Solution structure of the DEP domain of mouse pleckstrin
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhwA00
1UHWA 1GHCA 4OIQF 2CQKA 2G7UA 3DQVC 3I5UA 3CO6C 2K4JA 3I0TA 1S7AA 1G3YA 2ZXJA 2FBKA 2K7LA 1R5GA 3J7AO 4L9TA 3EYYA 4LLNA 3KP6A 3ZQ7A 1W7PD 1XMKA 1TW2A 3U2RA 4RB1A 5ILUA 1SD4A 2JRTA 2QYOA 3ERED 3GEZA 2JPBA 2BYVE 5FLXK 1X3UA 3I58A 2KJBA 2PFBA 2Z99A 4PDKA 1DUXC 4EM2A 1S29A 3F8MA 5LGTA 5TRDA 2DU9A 3OV8A 3QPTA 1FYMA 2HTJA 2PJPA 1D8JA 3QOPA 2CYYA 2VBYA 3K0LA 2HQRA 3DPLC 5FFZA 3I59A 3ELKA 4A6DA 2HOEA 2GA1A 2FNPA 2P7VB 2HYGD 2O03A 1FP2A 1XGSA 1J2XA 4IHSA 4M9ZA 4LGWA 2E7WA 5A2QK 3EDPA 4EJTA 2YR2A 3O2PE 3N97A 1KQ9A 5H20A 1BM9A 2HTSA 3GXOA 3ZN0A 2K27A 1F9NA 3DKWA 4HW0A 1KYZA 4HDVA 5L3EA 4ZZDA 2JT1A 5D5VB 1OPCA 3GWZA 2LF7A 1IN5A 1RUOA 2K4BA 2DW4A 5FO5A 2IT0A 1HKQA 4IVNA 1ZG3A 3MFKA 5FD6A 1LDJA 2GXBA 2KJCA 4CO8A 1YW9A 1D8KA 2ZCWA 1HSTA 1LDDA 3M1EA 3FMSA 4KN7X 1KU7A 3VOEA 2PN6A 5E17F 1G6NA 1EV7A 1YW8A 3I59B 1K78B 3JAMZ 1Z05A 2ESHA 3EYIA 4O3MA 3ML6A 3H92A 2E1NA 4YFNF 3K9TA 2A3SA 2AS5F 1SFUA 4R1HA 3G73A 4UUVA 3K2ZA 1R22A 1YW7A 1IAWA 3FM3A 2DQRA 3Q9VA 3QRFF 4G7HF 1LVAA 5LGUA 3K1NA 3RYPA 1XSDA 3C3WA 4GYGA 2HKXA 2X4HA 2D2WA 2M8EA 5ILVA 1SFXA 4OOIA 3ABUA 3KCCA 4HV5A 3KFWX 4U0WA 4PCQA 3GLXA 2DT5A 4M6XA 1SD6A 3I71A 3BROA 4M9SA 4YFXF 4ZYHA 3TO9A 2JSCA 4ZYGA 3EQLF 3LQQA 5HLHA 3RI4A 2EV0A 2V1DA 4BHPA 4Z2YA 2OAZA 3HRSA 1R00A 1PUEE 1QZZA 2VXZA 5L3FA 2DAOA 2H94A 2VT2A 4N9IA 1Z6TA 2STWA 4M72A 2EK5A 3F23A 2R7FA 3LFKA 1S8NA 5ICEA 2RQPA 3E97A 3SHFA 4A0YA 3V8JA 2Z9OA 2P8TA 1MD0A 2P7CB 1XB4A 3P9CA 2MLGA 1Z7UA 4EJOA 3O6BB 1T39A 2P4WA 2O3FA 2VC0A 4EQQA 3WGHA 2VE9A 3BY6A 4HLXA 2UXXA 5F64A 3F21A 1TBXA 2FEZA 1WWXA 4HF1A 3LSTA 3WU1B 3I54A 4HX8A 3DPTA 3IKVA 5DV5A 4N9HA 3VODA 5D4SA 2WV0A 2W85A 1EH7A 4MEYF 4ESJA 1UCRA 2W24A 4P55A 3KLOA 2QWWA 5DEQA 5K5RA 1E17A 2GWRA 2H6BA 2ZNZA 4O6JA 1R36A 4HF2A 1Z1DA 3J81K 4A6EA 1FYLA 1USSA 3JSPA 4RS8A 1S7OA 4B09A 4FHTA 1SD5A 3O3KA 5K5OA 2RC4A 1FSHA 2EWNA 1IXSB 2YPRA 2HYFA 2EJRA 3HHHA 5DD4A 1ZG5A 1GXQA 1P4XA 2Q0OA 5IT3A 3R60A 3NQOA 1W7PB 2F5DA 3MCZA 2QQAA 2XAHA 4ESFA 5BPDA 1R5HA 3BDDA 4LG0A 3TKYA 4GYIA 5JR3A 5BOXA 1QBJA 5JVTA 3F6VA 5IT9K 4KT5C 2MH9A 1GVJA 2FOKA 2P5VA 3KP7A 3N4MA 1IN8A 4U7DA 3FF5A 5D5XB 4ESBA 2XVCA 4RGRA 5D8KB 1GXPA 4UHTA 1WI9A 2W25A 2PLYA 3GFJA 1CGPA 3H3UA 5E1WA 4LB6B 4OU0A 2H09A 3OOPA 1XCBA 2H6CA 4KICA 2L01A 3BJ6A 3R61A 1KA8A 2YX4A 3QP6A 3TGNA 4MHGA 4RGSA 3GVAA 1FOKA 1XD7A 1U5TC 1FSEA 4CICA 3WTZA 3D0SA 2DPUA 1YIOA 3CUQC 5BQTA 3VB2A 3GF2A 1HW2A 1O3RA 4A5MA 1U3EM 1BC7C 1LJ9A 3F3XA 4WK8F 1ONVA 5K5QA 3GFIA 2HGCA 2ELHA 1BOAA 3IKTA 3GFMA 2AXLA 2JTVA 1ON1A 4A12A 1TQIA 4BAYA 3ZMSA 4JK1X 1K6OA 3BP8A 1O7LA 4I98B 1J0RA 1P2FA 2Y75A 1XDUA 2O0YA 1MJ9A 2Z5UA 4I02A 2EFNA 3T1BA 3BPVA 2XHKA 4OIPF 3SFZA 4G7ZF 2QENA 1ZH5A 4LMYA 3V8LA 3KZZA 2LF8A 4KUMA 1B4AA 1UB9A 2KKOA 2VOOA 2STTA 1D5VA 1HSJA 1XDSA 1V4RA 3R4KA 2UZKA 2ACJA 3TO6A 5JI6A 2DFIA 2R7DA 5DDGA 2DI3A 5JFRA 3V7CA 2OQGA 2VBZA 2LKPA 3JW4A 5CVUA 2OZUA 3JTGA 1U6GA 4EV0A 5F1RA 1ZG1A 2XIGA 1BN5A 3LA2A 4ON0A 1YG2A 2RNJA 1LEBA 4MQ9F 3V8KA 3BJAA 1G4DA 4XSZF 3WTTC 4G6QA 1PP8F 3RPUA 4LLGF 2NYXA 4EGZA 3FXUA 3ZMVA 1JXSA 3FMRA 1RZ4A 4Q4ZF 4LJZF 1BI0A 2GZWA 1H9GA 4PZJA 1R1VA 4WX9A 1FBUA 4RB3C 1RUNA 1IRFA 3F6OA 1JHHA 4KYWA 1ON2A 4RGXA 3Q9SA 1S3JA 2XROA 1W5SA 1JE8A 3GYHX 2DQLA 1BC8C 1USTA 2ETHA 1ZAOA 1K78A 4I09A 5D4RA 1MDMB 4L0YB 5HS7A 5LGNA 5CVIA 4WWCA 1G3SA 4HQMA 1LDKB 1XSXA 1EH6A 4LK0F 1O57A 2ZKZA 3WE3A 1IZ1A 1XMAA 1SMTA 2JPCA 4OMZA 5CVJA 3CUQB 2CG4A 1REPC 5FLXZ 1IN7A 4BH9A 3U9GA 1WRJA 2V9VA 3J80K 2V79A 5E8IA 2MC3A 3HRTA 1D3YA 2KRFA 3WTWC 1QZYA 4IPAA 2F5FA 1IRGA 4LFUA 3I64A 3ZN1A 1L0OC 1FNNA 3K1PA 2HR3A 3E5XA 1TQPA 1J9IA 1ZRCA 1J5YA 2PQ8A 2Q2EA 1T0FA 5D8LB 2CSOA 2FF4A 3PQJA 5A2QZ 2CFXA 2DK5A 2IJLA 2EFPA 1IXCA 1KU2A 3HSEA 2MA3A 3HRUA 5E1ZB 1IXRC 2H27A 4IRHA 1K79A 2QQBA 4P96A 1ZN2A 3PFIA 3E5QA 3HIFA 3ZMDA 4R79A 2D1VA 2XKOA 3COAC 1YQAA 3FM5A 2GQQA 2GIVA 4PGGA 4FX0A 3DXJF 4IF4A 4OIRF 1QO0D 2ZJ2A 1HKSA 1KGSA 5AONA 3KE2A 1MZBA 2F5EA 4MEXF 4AIKA 3M8EA 3EETA 4GXOA 1NHAA 2OU2A 4UNOA 2EFWA 3P7NA 2XV4S 4I2OA 3V4GA 3MWMA 4P5OA 1P4AA 3KP4A 1RIOH 2P5KA 3HOSA 2HKOA 2MD5A 3MZYA 1FPQA 4JBAA 2FBHA 4HOBA 1T38A 3T8TA 2FXAA 3WTSC 1O3SA 2RN7A 1IUYA 1W7PA 2NNYA 2EV5A 1JGSA 1FBQA 1OR7A 4XSXF 2PMHA 1K7AA 2NRAC 2IA0A 1E2XA 2IW5A 1HW1A 1TW3A 4I0BA 1XSVA 2J5OA 3WTUC 1I5ZA 2QZ8A 3CO7C 1G3WA 5BS6A 1LNWA 5CJ9A 3ECOA 2A6EF 4ENJA 3E6DA 4WF2A 2BE5F 1DP7P 3DEUA 2LDUA 4CGZA 2IA2A 2HWVA 2Q8KA 3RKXA 1B59A 1U78A 3F8BA 4M9XA 1IW7F 4P9UA 2G7HA 1ZARA 1KQ0A 1BIBA 1Q1HA 5EEGA 2HDCA 3KETA 2WWYA 2V6CA 3IL2A 3LAJA 3IWFA 1RNLA 3WE2A 2A68F 2D1HA 2KIFA 3HOTA 1SD7A 2MH2A 3DF8A 3KLNA 1T98A 3MAJA 5ILSA 4MNUA 2GA2A 3REOA 3HTSB 1ZGAA 5LLQA 4AIJA 3TOAA 1HXDA 5E1XA 1P6RA 4ENKA 5KVRA 1YS6A 4L5IA 1H0MA 3ZPLA 1CF7B 4WCGA 3DP7A 5ICFA 5LHIA 3IRRA 5L3BA 2XAGA 4GCVA 4ASNA 1ZRDA 2RGVA 4L18B 3GW2A 4PGHA 2J5PA 1TNSA 5TJJA 2QLZA 2ZMEB 4I7HA 2ZFWA 4R8HA 5LEJA 3FMQA 3L7WA 3GO5A 2OQRA 3J81Z 2W84A 5LHGA 3GFLA 1WSUA 3B02A 4KNYA 5HS9A 3WTXC 4GGGA 3GZ6A 1MJBA 2IA1A 2X0LA 2DO7A 4L9VA 4Y17A 3MZHA 5D5UB 1UFMA 3RDIA 1MGTA 1SMYF 1O7FA 5KK1A 1Z6RA 1EH8A 4S05A 4Y15A 2PG4A 4Q5SF 2GAUA 2XAJA 4BQAA 3M8FA 4RB2C 2L02A 3WTVC 3QPHA 3GX4X 4BNCA 4UXNA 2M45A 2L3DA 2XGXA 1W4MA 1KU9A 5IT9Z 3B73A 1I1GA 5AIQA 2V1XA 3T5XA 3TO7A 4BHBA 4RAYA 2EA2A 1OYIA 5H6QA 3SZTA 4OMYA 4WXDA 4HF0A 3R6SA 3H3ZA 3I4PA 1OMIA 1QNTA 5F6FA 1JHFA 3T8RA 1BBYA 3FXQA 1C0WA 4OIOF 1LQ1A 4TV7A 1J7KA 4G8XA 2EFQA 5L3DA 2CW0F 4CHUA 2BV6A 4WXCA 1FX7A 1R23A 4EVIA 2Y48A 1FLIA 4AD9A 2ZO4A 2XASA 1MJAA 2XUBA 4O5VA 5H6RA 2FA5A 4ZYDA 2OA4A 1FC3A 2ADUA 5DCMB 3QP5A 2A61A 1R1TA 5J8CA 1QPMA 4U7BA 3WU0A 3D5LA 4MGRA 1XGOA 3L9FA 1H9TA 2IVMA 4KA4A 4Q48A 2K86A 2M87A 1QQIA 4IRGA 1ZHFA 2M5WA 1MDMA 2ISYA 5HS8A 1Z91A 3P9KA 4EM0B 3RTRA 4CYDA 2FMLA 5FD5A 3GUDA 5E8GA 1Y0UA 3W6JB 2BEOA 1S6LA 4CZZA 5HVQC 3E6BA 2IRFG 4A5NA 3CUQA 5L3GA 1QGPA 3NEUA 3S2WA 3JSOA 4HV6A 1FWZA 1YLFA 4LK1F 3KZYA 2HQNA 3TDUC 1IN6A 4L5JA 5BPIA 3L2CA 1HBXG 1TTYA 2QVOA 3SXYA 2HFHA 1PDNC 3KP2A 2CO5A 2COMA 3WGGA 1R7JA 1AWCA 2XAFA 3E5UA 2QBYB 3WG9A 3M9AA 3TQNA 5HLGA 5JHUA 4I0AA 2UXNA 4HZFA 2YX7A 2HZTA 3HHGA 2VOPA 2BGCA 5L3CA 1J59A 1BI2A 3GZ5A 2RV8A 4KIFA 5ICGA 2A5YB 4YG2F 3LA7A 4HQEA 1IF1A 2DPDA 2GXGA 1U5TB 3ULQB 3HTUA 3LA3A 4A0ZA 4Q47A 1YO5C 1OYYA 4RB0A 2EA4A 4XLPF 2K02A 3E6MA 4BHCA 1DDNA 2OZ6A 1ODDA 2F2EA 4AVPA 4HLYA 4ETSA 4KMUX 2VT3A 2EV6A 4BXUA 1ZLJA 3CTAA 4U0YA 3KP5A 4M73A 3JAMK 2DBBA 2WTEA 4WXHA 1FT9A 3FHZA 3MEXA 4ZYEA 4HA8A 2HEOA 4EJUA 5HDNA 3PQKA 4IJAA 4HAMA 3NRVA 2FU4A 5CVRA 3HSRA 4EMSA 4ZZLA 3E6CC 4U0VA 1F1ZA 1KQ8A 2FBIA 2KIMA 3FX3A 1R58A 4L9JA 5HDGA 3V7RA 4HYEA 1WKMA 5ERIA 1ZLKA 4G9YA 2FRHA 3QAHA 4HBLA 3F8NA 5E20A 2VC1A 4MTDA 1HQCA 3F72A 3ZP5A 4A2UA 1YYVA 3ECHA 1T6SA 1ULYA 3K1MA 3J80Z 1FY7A 3QU6A 5DD8A 5CVVA 2OBPA 4YIFA 1MKMA 3VFZA 1F5TA 2O6GE 1BJAA 2ZNYA 2VE8A 3R0JA 2NAZA 2RDPA 2TDXA 5BMZA 5CLSA 5LEKA 4BYYA 1VTNC 4UV9A 1B9MA 1BIAA 3CUOA 1P4WA 4GO1A 1TNTA 1V3FA 1W5TA 2G9WA 2A07F 4IRIA 4ENMA 3KP3A 1AOYA 4G7OF 3ROUA 2VN2A 1OKRA 2PBIA 4S04A 1DPUA 4U88A 1TQMA 4L9NA 3FWEA 2L54A 1G3TA 1FYKA 4LD5A 2IPQX 3TOBA 5FGMA 2ISZA 2MLKA 2XAQA 1BI3A 3BJOA 1OYWA 3L09A 2EFOA 4KN4X 1ZRFA 2UWMA 5DUIA 2QQ9A 4HX7A 2VBXA 2OD5A 2DK8A 3HRMA 2O8XA 1YTYA 1XN7A 4JQFA 3BWGA 1Z9CA 1XGNA 3FXRA 3VEPA 2FMYA 1CF7A 4B8XA 3CJNA 4LB5A 3SZPA 5DUKA 5LRRA 4EJWA 2P5LC 2MBFA 3FZVA 2FQ3A 3T0YA 1B1BA 3ZMTA 3IWZA 1B9NA 2ZMEA 4KDPA 1XCVA 1R1UA 3RKWA 2Y0MA 4D0PA 1KU3A 1SAXA 2YU3A 3F8FA 5D5WB 1ZGJA 4YIIA 3SQNA 4M74A 1P92A 2DTRA 1L3LA 2M30A 2FNAA 5LBQA 4NHJA 3E3VA 3W6KB 2VBWA 4Y13A 1I27A 1YS7A 3U1DA 4HX4A 4EJVA 5CYVA 2V1UA 5D6FA 3C1DA 4P9FA 1IN4A 3CDHA 4M6YA 1WQ2A 3I53A 1O3TA 2A69F 4KFCA 4G6DA 4MQVA 2W57A 4FT8A 2VONA 2QM3A 2JZYA 3HSFA 1HW5A 4DNCA 5EEHA 2XKPA 2Z33A 1F4KA 4K2EA 4RGUA 2A6HF 3ABTA 2Z3YA 3KEOA 3RIRA 2ZBKA 2FE3A 2P6SA 2CWEA 3BPXA 3IHUA 1O3QA 3G3ZA 4DQ2A 3C7JA 5FFXA 5J6XA 2IP2A 2F5CA 4KMFA 5D6EA 3JTHA 3BOQA 1A04A 3P9IA 2PMUA 5HDKA 3ISPA 1DPRA 4I01A 5DYMA 4HDUA 4AWXB 1UHMA 2YSRA 3IC7A 4FX4A 5DCMA 5LRSA 3DV8A 3RKYA 2PEXA 4NQWA 2O61A 2RKHA 4QLCU 4ENNA 3KEQA 4UVCA 2L4AA 1FBSA 3DFGA 4UVBA 2FSWA 2P6TA 2NS0A 3WGIA 3AAFA 5DCFA 3L00A 4ZH4F 2HS5A 6PAXA 4MTEA 3HUGA 2KIUA 3WTYC 2L4MA 3EUHA 3F22A 4QWQA 2BBYA 5FB2A 4XBFA 3BZ6A 2C6YA 3RYRA 1HKTA 5E18F 2VODA 4IXAA 1ZREA 1KYWA 2E1CA 4AIHA 4XLNF 4XRFA 5HOOA 2DLLA 1J75A 2WC2A 5HLIA 3MQ0A 3RJPA 2CGPA 4EGYA 4UVAA 3QU3A 1BI1A 3V7SA 5AIPA 4IHTA 4LG0B 5ICCA 3F8CA 4CDGA 1LB2A 1ZYRF 2XRNA 4KIBA 4UV8A 5LHHA 3LQRA 1LEAA 2D45A 1PP7U 4YFKF 1I6XA 4A0XA 1TLHB 2QUFA 3IRQA 1RI7A 3LWFA 4M71A 3ZMZA 3ZMUA 5K1YA 2EB7A 2LSOA 4CXFA 3R0AA 2QBYA 1U2WA 1I1SA 2RVCA 4L0ZB 2B0LA 3Q5FA 3WODF 2E7XA 4RAZA 1STZA 5ED4A 3TDZC 1FZPB 3C18A 1SFEA 3RPQA 3LAPA 1U8RA 2LNBA 2ESNA 3HYIA 3M7GA 4KIGA 3K69A 4OINF 1YFHA 5J8FA 4H0EA 1U5TA 3CLOA 4E70A 1T2KA 4LLLA 1B6AA 4N0BA 2PI0A 4G94A 1FP1D 2M1BA 4F7ZA 2NNNA 1XGMA 4EM1A 2R3SA 4NB5A
chains in the Genus database with same CATH superfamily
1UHWA 3BR2A 3SFIA 1GHCA 5J40A 4OIQF 2CQKA 2G7UA 1IGNA 1A31A 3DQVC 2M8GX 3I5UA 3S8PA 3CO6C 1ETQA 2K4JA 4YEJA 3I0TA 4BBRJ 1S7AA 1G3YA 2HPMA 2ZXJA 3PUBA 4KT6A 2FBKA 2K7LA 1R5GA 3J7AO 3BZCA 3FKJA 2LMDA 4L9TA 2LG4A 4E7HA 2WV1A 1I50J 4JX6A 3EYYA 3OWTA 1GV5A 4LLNA 3KP6A 3ZQ7A 3I9V2 3O8GA 4I6ZA 2Q1ZB 1OISA 1GUUA 1W7PD 4A93J 1XMKA 1TW2A 3U2RA 4RB1A 5ILUA 1SD4A 2JRTA 2QYOA 2V4JC 3ERED 1T0FC 3GEZA 2JPBA 3CCQI 4OWRB 4E6KG 4NDLA 2BYVE 5EZHA 4IOCF 4F93B 5FLXK 3CZ6A 1X3UA 3I58A 2KJBA 2PFBA 4F52A 2Z99A 4PDKA 1DUXC 4EM2A 2LVSA 1S29A 2O9LA 2IGKA 4XOPA 2VQCA 3F8MA 4KITB 5LGTA 5E3OA 3H9GA 5TRDA 2DU9A 3JRAA 3OV8A 1IUFA 2GOXB 1QHGA 3OR1C 3QPTA 1FYMA 2HTJA 1W5CC 4B3AA 2PJPA 3QOPA 3JR9A 2CYYA 2VPLA 1D8JA 2VBYA 3K0LA 1A35A 2HQRA 3DPLC 5FFZA 1RR8C 3HM5A 3ELKA 3FK6A 3I59A 2XAUA 4A6DA 2HOEA 2GA1A 4ZC3A 2FNPA 3BR5A 4IL6C 1YRNA 2P7VB 2HYGD 1JKQC 3UR3C 2O03A 3DCFA 2XGCA 1FP2A 3OL4A 2JA5J 1XGSA 1J2XA 2ECBA 4IHSA 3TEDA 3M4OJ 4M9ZA 2OCCH 3HZJA 5F0FA 3VWBA 1T56A 4LGWA 1QU3A 2E7WA 5A2QK 3EDPA 3HC7A 2KT0A 4EJTA 2YR2A 3O2PE 4YELA 3N97A 1KQ9A 5H20A 2WAQN 3S3MA 1BM9A 5J4YA 2HTSA 3OYDA 3N05A 3CMYA 2NVTJ 3GXOA 3ZN0A 3ESWB 4MO7A 2K27A 2KZVA 2DODA 1F9NA 3CCUI 3DKWA 2JVHA 4HW0A 2DXIA 1KYZA 4HDVA 4BQOA 5L3EA 3OOUA 2R4GA 1D1CA 2A05A 2JT1A 4ZZDA 5D5VB 2XSJC 1OPCA 3GWZA 2LF7A 1Q1VA 1IN5A 2X6YA 5IP6A 1RUOA 1ETVA 2R7ZJ 2NVUB 2K4BA 1MIJA 1WJDA 4A69C 5IYCJ 2DW4A 1I39A 1TT5B 1Y0NA 5FO5A 3OS2A 1Z3YA 2WB1A 2IT0A 1HKQA 2KDOA 4IVNA 1ZG3A 3GTJJ 3K4KA 3MFKA 1ZELA 1FTZA 5FD6A 2F48A 4UUSA 1LDJA 1WJCA 2GXBA 2KJCA 1IRZA 3M07A 1VQ6I 1O4XA 1ZQ3P 4CO8A 1YW9A 1D8KA 2ZCWA 1HSTA 1OR7C 3RZDJ 2JN6A 1LDDA 1XMXA 2VJ4A 3M1EA 3TBIA 2DTZA 3FMSA 4KN7X 2K9QA 2LRDA 1KU7A 2H8RA 2R7TA 3BCAA 1WVRA 3A02A 3VOEA 2PN6A 4BXXJ 5E17F 1EV7A 1G6NA 2VQHA 1V5GA 1YW8A 1QRYA 2KPMA 3I59B 1K78B 3JAMZ 1Z05A 2ESHA 3EYIA 4O3MA 3ML6A 3W2WA 3G1OA 3H92A 2E1NA 3Q0WA 3K9TA 4YFNF 2A3SA 2AS5F 1SFUA 4D5CA 4R1HA 3L2RA 3G73A 4UUVA 4IQJA 2FQ4A 3K2ZA 2HVSA 4C2TA 5EDNA 1R22A 1HOMA 2MGQA 4ZJZA 1G8XA 3TW6A 1YW7A 1IAWA 3FM3A 5KAIC 2DQRA 4FE7A 2NVXJ 3Q9VA 2ICWG 4DYCA 3QRFF 4IHWA 4G7HF 3S15J 1LVAA 4NC8A 5LGUA 4NNJA 3K1NA 1Y39A 3RYPA 1XSDA 3BC8A 3C3WA 4GYGA 2HKXA 2EIMH 2X4HA 5B5EC 3DBLB 2D2WA 2JVGA 2M8EA 1HA8A 5ILVA 1XS9A 1SFXA 3HBLA 4OOIA 3ABUA 4XN0A 3ZQFA 3KCCA 3LFUA 4HV5A 3VYUB 4AVZA 3S14J 2DMNA 3KFWX 4U0WA 4PCQA 1POGA 1ZR4A 4BS9A 3GLXA 2LY2A 2DT5A 3PUFA 4M6XA 1SD6A 3MN2A 3I71A 3BROA 2LREA 3MVPA 1SEUA 4ZDOA 4M9SA 2X1CA 2DOFA 4YFXF 4ZYHA 3TO9A 3PO2J 1JKRC 2JSCA 4ZYGA 3EQLF 3LQQA 5HLHA 4RBOA 2M3AA 1SFOJ 2JUCA 3RI4A 3NAUA 4XONA 1FIAA 2EV0A 2V1DA 2XF7A 3K4JA 4BHPA 1PUFB 3U1KA 4Z2YA 2KRCA 2OAZA 2O5RA 1Y1WJ 3HRSA 5GAGJ 1R00A 4JX4A 2Q2EB 3BR0A 3NWSA 1PUEE 1QZZA 2VXZA 3HB9A 3CESA 2E5NA 3CCVI 1WFXA 5L3FA 3K70C 2DAOA 4E7SA 2H94A 2VT2A 4N9IA 1Z6TA 3BR1A 4M72A 3ZOBA 2STWA 2EK5A 2ZJQF 3F23A 2R5YB 4DIQA 2R7FA 3LFKA 1TL8A 1UHSA 4BXFA 1S8NA 5ICEA 2RQPA 3OYAA 3S16J 4HG2A 3E97A 2MFZA 2LOOA 1SAUA 3SHFA 4A0YA 2M4GA 3HJEA 1WI3A 3V8JA 5GPCA 2Z9OA 2P8TA 2FJ1A 1MD0A 3DEWA 4Y3OA 1ETOA 2P7CB 1XB4A 3P9CA 1TWGJ 2MLGA 1K61A 1AU7A 3RZOJ 2XB0X 2ME6A 1Z7UA 4EJOA 3O6BB 2ID6A 1T39A 2P4WA 1BJZA 2O3FA 2VC0A 2KHMA 4EQQA 4HNUA 2RREA 2LR8A 3WGHA 3OYCA 2VE9A 3BY6A 4HLXA 2UXXA 5F64A 4CSWA 3F21A 2NS8A 3L1PA 1P7IA 2BY0A 1TBXA 5F0HA 2FEZA 1WWXA 4HF1A 4XM3A 5J47A 3CQZJ 3LSTA 3BR6A 3WU1B 3I54A 4HX8A 4D7NA 2F6CA 2BOLA 3KYDB 1X3WB 3DPTA 3IKVA 4N9HA 5DV5A 3VODA 3QYFA 2K9MA 2X6WA 5D4SA 1DU6A 2WV0A 2BXZA 2W85A 1EH7A 4RA2A 4MEYF 4V2GA 3MZ8A 4ESJA 1VNDA 4XK4A 2R7OA 5EF6A 3G1MA 1UCRA 2W24A 4P55A 3OYBA 3KLOA 2V1NA 2QWWA 3W6VA 2HXIA 3CJRB 3IH2A 2K9NA 2JUGA 5DEQA 1K4SA 5JHFA 2R7VA 5K5RA 1S9HA 2LP0A 1E17A 2WAQA 3H9QA 2GWRA 2H6BA 2VI6A 5FKMA 1V5FA 2ZNZA 4RM2A 4O6JA 4AIDA 3EUHC 3SZGA 1R36A 4HF2A 1Z1DA 3CP2A 3J81K 4A6EA 1FYLA 4F55A 1USSA 1X2NA 3JSPA 2R7XA 2CQXA 4J19A 4RS8A 1S7OA 2LBFA 4B09A 2F4MB 1XPXA 4FHTA 1SD5A 2VB6A 3BTJA 3O3KA 5K5OA 2AQFA 5M3MJ 2RC4A 3DLAA 1FSHA 3OYEA 3J7YJ 5EG0A 2EWNA 4N4OB 1IXSB 1E3PA 2YPRA 2WA0A 4AUXA 2ZXIA 2HYFA 2EJRA 3HHHA 3W3CA 4NC6A 1VQ7I 5DD4A 1ZG5A 1GXQA 1A6QA 1P4XA 2Q0OA 4B48A 3V42A 5IT3A 3R60A 3NQOA 1W7PB 2F5DA 2OF7A 3MCZA 4A3IJ 1Y8RB 2QQAA 2XAHA 4ESFA 3ZXSA 5BPDA 3GTLJ 4DJAA 2Z16A 4A3GJ 1RPWA 2I8DA 1R5HA 3BDDA 3CDIA 4LG0A 3TKYA 3LMMA 4GYIA 5JR3A 1WJAA 2CUJA 2CS3A 1KZHA 5JVTA 3CDLA 5BOXA 1QBJA 3F6VA 5IT9K 2HNHA 4KT5C 2MG4A 2MH9A 1OQYA 2W00A 5M5WJ 1GVJA 2FOKA 2P5VA 1VQ4I 4B4CA 5HLTA 3KP7A 3N4MA 1IN8A 4U7DA 5GAEJ 3FF5A 2JSPA 3KEYA 4D5FA 5F27A 5D5XB 3S1RJ 2JK3A 2NS7A 3HEFA 2IS6A 4ESBA 4IQ4A 3QWLA 4XORA 1RR7A 1BOBA 4XOTA 2MD0A 2VUMJ 2XVCA 4RGRA 5D8KB 4XLAA 1GXPA 4UHTA 2Y30A 2KIQA 1WI9A 2W25A 2FX0A 2PLYA 3GFJA 1CGPA 3H3UA 5E1WA 1VF9A 4LG3A 2DN0A 2IGNA 4Y52J 3JRIA 3DTEA 4LB6B 3IAM2 4OU0A 2BVLA 2H09A 3OOPA 4LOCA 5B3SH 2OUMA 1XCBA 2H6CA 4KICA 2L01A 5HNHA 3BJ6A 2FUG2 2VJIA 3R61A 1KA8A 1ORKA 2GIZA 2E1MC 2QA4I 2YX4A 1ZTRA 3QP6A 3TGNA 5EJCA 4ZTJA 2WAEA 1UZCA 4MHGA 4RGSA 4BE0A 3GVAA 3UNGC 1FOKA 1XD7A 1U5TC 1FSEA 2CQQA 1I3QJ 4CICA 1MMGA 2MABA 3HOWJ 2QSHX 2QF7A 3M8JA 3D0SA 3W2VA 3WTZA 3S3NA 2DPUA 1JUPA 1YIOA 2LY9A 1N75A 3CUQC 3BG3A 5BQTA 3G2BA 2RAEA 1Z67A 1KONA 2ZSIB 3VB2A 3GF2A 1HW2A 5FLMJ 4BDYA 1O3RA 1HC8A 4BDZA 4A5MA 1U3EM 2LTPA 1BC7C 2IGOA 1LJ9A 3F3XA 2BVMA 4WK8F 1ONVA 4CCNA 2HOTA 3IH4A 2WY8Q 2QCOA 2ZSHB 5K5QA 4HNTA 2L7KA 3GFIA 2HGCA 2ELHA 1BOAA 3IKTA 3GFMA 3OIOA 2AXLA 3W2AA 2JTVA 1ON1A 4A12A 1TQIA 4BAYA 3O8HA 1PVEA 1WGXA 2I10A 3ZMSA 4JK1X 3OYLA 3HG9A 2XRLA 1K6OA 1S5LC 3E1SA 3BP8A 4B1RA 1JUMA 1O7LA 2M0CA 4Y7NJ 4EATA 4I98B 5B1BH 1J0RA 1P2FA 4E7IA 2QEXI 2Y75A 1XDUA 4DYRA 2O0YA 1JTYA 3X2QH 2R7UA 2EILH 1MJ9A 2Z5UA 4I02A 2EFNA 2BY2A 3T1BA 3VSLA 1P7JA 2KMUA 3BPVA 3F9KA 2XHKA 4OIPF 3SFZA 4G7ZF 2QENA 1ZH5A 4LMYA 3HOUJ 3V8LA 2WY7Q 3KZZA 2LF8A 4KUMA 3CC4I 1B4AA 1UB9A 4RAGA 2KKOA 2VOOA 2STTA 1D5VA 1GLNA 4LITA 1HSJA 1XDSA 1V4RA 3R4KA 2UZKA 1R49A 5KCMA 2ACJA 4BE2A 3DKXA 3TO6A 5JI6A 4E7LA 2DFIA 1E0EA 2ELKA 1HDDC 2CJJA 1YJWI 2R7DA 3JCUC 3PM1A 1ZK8A 3DLLF 3M1CA 3OIPA 5DDGA 2R7SA 4RLFA 1QHHD 2DI3A 1W0TA 1X3ZB 5JFRA 1YE9A 5M3FJ 2R92J 1LFPA 4HRIA 1YJNI 3RCOA 1NTCA 2O8KA 1FOYA 4C2MJ 3V7CA 2OQGA 2VBZA 2LKPA 3JW4A 2COBA 5CVUA 1V55H 2OZUA 4A3FJ 3JTGA 5E3LA 4XKVA 5B66C 4NBQA 1U6GA 4EV0A 2LD5A 3I3LA 5F1RA 1ZG1A 1MBEA 5DTDA 2QGUA 2UUZA 2XIGA 1BN5A 3LA2A 5HNFA 2DA2A 1FJLA 4ON0A 1YG2A 2RNJA 1LEBA 4E7ZA 2L9RA 4PSWA 4MQ9F 1VI0A 2BW3A 2XPWA 3V8KA 3BJAA 3AG3H 1G4DA 4XSZF 4C3JJ 2M34A 4DW6A 3WTTC 4G6QA 1PP8F 1JKPC 3RPUA 4V2FA 4LLGF 2NYXA 2EZHA 4L5EA 4EGZA 3FXUA 3ZMVA 1JXSA 3OSFA 3FMRA 1RZ4A 1G59A 4CH7A 5JLWA 3OYNA 2DYRH 4BJ6C 4Z6YA 2A5WA 4Q4ZF 4LJZF 1BI0A 4BY1J 2GZWA 1VQ9I 2K5CA 1UJ8A 1H9GA 4PZJA 3AL0B 1TC3C 1R1VA 2E2HJ 3HGYA 2EZIA 4WX9A 1FBUA 4IHVA 3ZGKA 4RB3C 1RUNA 1FIPA 2CUFA 1IRFA 3ZQHA 1FTTA 1BL0A 3F6OA 1JHHA 2R7QA 3CCJI 4KYWA 1ON2A 4RGXA 4N4NB 3SJMA 1SC7A 5IP9J 1X1CA 2VXDA 2KRHA 3TW7A 3KPHA 2X51A 4D9JA 3Q9SA 3GTMJ 1S3JA 3QPSA 2XROA 1W5SA 1JE8A 4BJ5C 3EUAA 2ZC2A 3GYHX 1IJWC 2DQLA 3OYMA 3GZNB 1USTA 5K7FA 1BC8C 2ETHA 1GV2A 1ZAOA 4RM3A 1K78A 1ERDA 1JTXA 2BXYA 2OC6A 1DU0A 4I09A 3S17J 4DGWB 3AFHA 5IP7J 4D1QA 3D5RC 5D4RA 1MDMB 4L0YB 5HS7A 5LGNA 5CVIA 3H0DA 5C4XJ 1Z3XA 4WWCA 2ME0A 3B6AA 5C3EJ 1G3SA 4HQMA 1LDKB 2AHQA 1XSXA 2VL8A 5IYBJ 4BGDA 1EH6A 2LY1A 4LK0F 4RLQA 2V9PA 2CV2A 1O57A 2ZKZA 3WE3A 1IZ1A 1XMAA 1SMTA 2Y69H 3B6CA 2JPCA 4OMZA 5CVJA 2BHYA 2BW3B 3D1NI 3FXKA 3CUQB 3LSRA 2CG4A 1OFCX 1REPC 1QPIA 5FLXZ 1LUJB 3HPGA 1LFBA 1IN7A 3JRHA 4BH9A 2XPUA 3U9GA 3MKLA 3LNQA 1WRJA 2V9VA 3J80K 2V79A 4XKBA 2LC2A 2VQLA 2MC3A 5E8IA 2E5ZA 1AHDP 3G4SI 1BW6A 1MNEA 3FXOA 3VYRB 4A3EJ 3CJQB 1RESA 3HRTA 2CUEA 1D3YA 2LK2A 2KRFA 3K70D 3WTWC 3PSIA 1QZYA 4IPAA 1YJ9I 4CCKA 2F5FA 1IRGA 4LFUA 3BG9A 2CU7A 2F5VA 3CCEI 4CYCB 4IKFA 4FCYA 3A1YA 3BT9A 2PMZN 3I64A 1L0OC 1FNNA 1MMDA 2K9LA 3LSMA 3K1PA 3K4CA 2JA2A 3ZN1A 1PUFA 1WZ2A 1MBHA 2HR3A 3S32A 3E5XA 3FIWA 1TQPA 2EPFA 4ZDPA 1J9IA 1ZRCA 3ONQA 1JJ6C 2Y0SN 1J5YA 2PQ8A 2Q2EA 1QZEA 1T0FA 2NVYJ 5D8LB 1UELB 1S7EA 2CSOA 2FF4A 3OR2C 5E3MA 3PQJA 5A2QZ 2CFXA 4XLEA 1M1EB 1U9OA 2DK5A 2IJLA 2OPTA 4MFEA 2EFPA 1IXCA 4B44A 2VIXA 2R5YA 3S2HJ 1KU2A 3HSEA 1QVTA 2MA3A 1CQTA 3HRUA 2P0WA 5E1ZB 1IXRC 2H27A 4IRHA 1K79A 2QQBA 4P96A 2VQGA 3E7LA 1ZN2A 1WH7A 3PFIA 2ZMEC 3E5QA 3HIFA 3ZMDA 4R79A 2D1VA 3HGGA 3QQAA 2XKOA 1Y6IA 3COAC 1YQAA 4FTHA 3DKYA 1SVMA 3FM5A 2GQQA 2GIVA 1APLC 3QODA 3RQIA 3WHCA 1OCCH 2Y2ZA 4CUGA 3KYCB 1NK2P 4PGGA 4FX0A 3GCMA 3DXJF 3EUKL 2JMWA 4IF4A 3H9JA 4F3QA 2CV0A 4OIRF 1QO0D 2ZJ2A 1HKSA 1KGSA 1Z21A 5AONA 1K6YA 3KE2A 2NVQJ 3AG2H 1MZBA 2CQNA 2IS2A 2F5EA 3MMYB 3VDXA 2DA6A 4DZJA 4MEXF 4JX5A 2E36A 4AIKA 2Y9YA 4P1WA 3M8EA 4RMNA 3DU6A 3EETA 1OCOH 4GXOA 1NHAA 2OU2A 3BR3A 1VFCA 4UNOA 1D0YA 2X6OA 2EFWA 5IY5H 5K7ZA 3P7NA 4XLCA 4AYBN 2XV4S 1ETXA 3NWTA 1MBJA 2R93J 1DQUA 3PJRA 4I2OA 4YIRX 3V4GA 3HOXJ 3MWMA 4P5OA 2CUZA 3PIPF 1P4AA 3KP4A 1RIOH 2P5KA 3GMEA 3HOSA 2HKOA 2Z2SB 2B7EA 1JI8A 3BG5A 2MD5A 3MZYA 2D5VA 5F04A 3BQZA 3ZQQA 1IV6A 2X6XA 1FPQA 4JBAA 1X19A 2FBHA 1X2MA 4HOBA 1T38A 2CQ7A 5EYRA 3T8TA 2FXAA 2XDVA 1ENHA 5J1RA 1VQPI 3WTSC 4A3JJ 1ZR2A 1O3SA 4BACA 1ETYA 4QTRA 3RKQA 4M3FA 2RN7A 3GBGA 2AO9A 1OCZH 3H5NA 4OAYA 2HI3A 3JRDA 1IUYA 1W7PA 2NNYA 2EV5A 5J4VA 1JGSA 1FBQA 1OR7A 2W1OA 3PFYA 4XSXF 3MKWB 2PMHA 1K7AA 1YI2I 1MNMC 2NRAC 2IA0A 1E2XA 2IW5A 1HW1A 3SYTA 1TW3A 1TP4A 4I0BA 1BR2A 1XSVA 2J5OA 1D0ZA 1LFUP 2FOWA 1X4PA 4V19K 1NG7A 3Q0VA 3WTUC 1YX5A 2GOMA 3BG6A 1WJEA 1I5ZA 2QZ8A 3CO7C 1G3WA 5BS6A 1LNWA 5CJ9A 3ECOA 2A6EF 5LFAA 4G12A 3GTPJ 1X1PA 4ENJA 3E6DA 5FJ8J 1H8AC 4W1UA 2L5QA 4WF2A 2BE5F 4A3DJ 1DP7P 3DEUA 2LDUA 4CGZA 2IA2A 3FK7A 2HWVA 2Q8KA 3RKXA 1B59A 1U78A 1R71A 4A3BJ 2ZXWH 3F8BA 3BLYA 3DWLE 4M9XA 1JKOC 1IW7F 3LSKA 4IZZA 3HOYJ 4P9UA 3ZR8X 3CD6I 2G7HA 1ZARA 2CV1A 1KQ0A 1BIBA 1Q1HA 1VQ8I 1D0XA 5EEGA 2HDCA 4IOAF 4E7JA 2HDDA 3KETA 2HXOA 3H35A 2GLOA 2V7FA 3H5AA 2WWYA 5M5XJ 3OYJA 2V6CA 3IL2A 3LAJA 3IWFA 4S0HB 1RNLA 2X1DA 3WE2A 2K9SA 1QVUA 2A68F 2D1HA 2KIFA 3HOTA 5BNGA 1SD7A 2MH2A 1YIJI 3CC7I 2PJRA 3DF8A 4ABZA 3BCBA 3QOEA 3KLNA 1T98A 1SFKA 2RNGA 3MAJA 1DGWY 1P9QC 3VPRA 5ILSA 4MNUA 2GA2A 4AC0A 3REOA 4C3HJ 3HTSB 1ZGAA 2VKVA 5LLQA 3LSIA 4AIJA 2E19A 4J01A 2EBIA 2KDZA 3TOAA 1HXDA 5E1XA 1P6RA 4ENKA 3SDGA 4C9YA 3HL2A 5TGTA 4A3KJ 2LH9A 4OAZA 1IO2A 1WJ5A 5KVRA 1YS6A 4L5IA 2PMZA 3F0CA 3S3OA 1H0MA 1X1AA 3ZPLA 1CF7B 4WCGA 3DP7A 5ICFA 5LHIA 3IRRA 1RRJA 5L3BA 1U8BA 2XAGA 1MSEC 2Y0SA 4GCVA 3M3YJ 2ELJA 4ASNA 1ZRDA 1H89C 2RGVA 2DDBA 3CMMA 4RDUA 4L18B 3PNVA 2HQ5A 3GW2A 4BE1A 4PGHA 4DZPA 2DJNA 2J5PA 3BTLA 1TNSA 5TJJA 1GT0C 2QLZA 2CMPA 2ZMEB 4XRMA 4I7HA 2TRTA 4F91B 1ETKA 2ZFWA 4R8HA 2MSYA 3BG7A 3FMQA 4ZDLA 5LEJA 3L7WA 4HEA2 3GO5A 5EEAA 2OQRA 2UV1A 3J81Z 2W84A 1X58A 4MFDA 5LHGA 3GFLA 1WSUA 4M3BA 3B02A 2JJ7A 4KNYA 5HS9A 3WTXC 4IHXA 4DYQA 4GGGA 3GZ6A 2X0LA 1MJBA 2IA1A 2DO7A 4L9VA 4Y17A 3MZHA 2DT6A 4PJJA 5GP9A 5D5UB 1UFMA 3RDIA 1MGTA 5B1AH 1SMYF 2VKDA 1O7FA 4PK4A 5KK1A 3IV5A 1Z6RA 2BHZA 4UB8C 4II2A 2Y9ZA 1FOWA 2IGMA 1EH8A 4S05A 4Y15A 2PG4A 4Q5SF 2GAUA 2XAJA 4BQAA 3FXMA 3G71I 3QYEA 3M8FA 2YS9A 2L7MP 2EZLA 3C2HA 2WBMA 4RB2C 2L02A 3WTVC 1OJLA 1D1AA 3QPHA 3GX4X 2PJRB 5KHDA 4I99C 3S93A 3S1MJ 4BNCA 4UXNA 2M45A 2LKSA 1OCPA 1XC5A 1E3OC 2L3DA 2XGXA 1W4MA 3ASNH 1VQMI 4C2UA 1KU9A 4XKCA 3B73A 3FDYA 5IT9Z 3K6GA 1I1GA 5AIQA 1SVOA 2B9SA 3K7AJ 2V1XA 3T5XA 2L9SA 3TO7A 4BHBA 4AYBA 3DBHB 4RAYA 3WU2C 2EA2A 2V6EA 1W36C 1OYIA 5H6QA 3SZTA 2OV7A 4OMYA 4WXDA 4HF0A 3R6SA 3H3ZA 3I4PA 4F92B 1OMIA 1F36A 4LIUA 4HSRA 1QNTA 5F6FA 1JHFA 3T8RA 4BEHA 2H1KA 1BBYA 3FXQA 2QSFX 1C0WA 5F0CA 1FEXA 4OIOF 1W1WE 1LQ1A 3C2BA 3E0JB 4TV7A 1J7KA 4G8XA 2EFQA 5L3DA 3VYSB 2CW0F 3VSKA 2IAIA 2R7WA 3MKYB 4CHUA 2BV6A 4WXCA 5GAHJ 1FX7A 5EGOA 1R23A 2DMUA 1MMAA 3CCMI 4EVIA 3PIOF 1GVDA 2Y48A 1FLIA 4MLOA 2K85A 4AD9A 2ZO4A 3FISA 3K4BA 2XASA 1EKEA 2V9KA 3C2GA 1MJAA 2XUBA 4O5VA 5H6RA 3KIOA 5E3NA 2FA5A 4C30A 4ZYDA 2OA4A 1FC3A 4FETA 1WJFA 2ADUA 5DCMB 3NARA 3FXJA 2DOAA 3QP5A 4NQWB 1YITI 2L9NA 2A61A 1R1TA 1XX5A 2HYJA 5J8CA 1AKHB 1QPMA 4BU2A 4U7BA 5FKLA 3K4MA 3WU0A 3D5LA 3A0HC 1RKTA 2YU9J 4MGRA 1EJ9A 2DFFA 1XGOA 2GXAA 3OYHA 3CMAI 4PFOA 4FASD 1DGRM 3L9FA 3HUGB 1H9TA 2IVMA 4KA4A 4Q48A 3I4NJ 2K86A 2M87A 3WHBA 1QQIA 2O7OA 4IRGA 1ZHFA 1S72I 2M5WA 1MDMA 2ISYA 5HS8A 2Y31A 1Z91A 3P9KA 4M6VA 4EM0B 3RTRA 3FKIJ 1NH3A 1D5YA 4CYDA 2FMLA 2DCEA 5FD5A 3GUDA 5E8GA 4X6AJ 4PJLA 5F08A 4M3GA 1Y0UA 3W6JB 2BEOA 1S6LA 4CZZA 5HVQC 4JP0A 4BEHB 3JRGA 3E6BA 4IHYA 1WPKA 3OS1A 2IRFG 4A5NA 1ETWA 5IPAA 1IC8A 4E7KA 1MH3A 3CUQA 1JT6A 2LLKA 4D7MA 5L3GA 1SVLA 1UAAA 1QGPA 3NEUA 3S2WA 3JSOA 2EIJH 3LSPA 3DPUA 4HV6A 1B72B 2VASA 3FBNB 5FKOA 2ZFUA 3KZIC 4BQQA 1FWZA 2EQRA 2M7BA 4KJZA 1YLFA 5EGOB 3DU5A 5IOYA 3VYTB 5H2FC 4LK1F 3KZYA 2HQNA 3TDUC 1IN6A 4B3XA 4L5JA 5BPIA 3RQ4A 3LSHA 1AA7A 3L2CA 1HBXG 3OYFA 2MC4A 2IS4A 1TTYA 2QVOA 3A03A 3SXYA 5F1JA 2HFHA 3IAS2 1WJBA 3AKZA 1PDNC 2TCTA 2MYSA 1OCRH 3KP2A 2CO5A 4CYCA 2COMA 3WGGA 2QSGX 2HQAA 2JA6J 1R7JA 1AWCA 2XAFA 4XKWA 3H5RA 3CF2A 3GTKJ 2HVQA 3E5UA 2QBYB 3WG9A 3BQYA 3M9AA 3TQNA 1BR1A 1DP3A 2FD5A 2ZXHA 5HLGA 2WAFA 3FHNA 3A0BC 1MBFA 2KISA 5GTIC 4J00A 5GADJ 5JHUA 4I0AA 2UXNA 4HZFA 1UG2A 2HZTA 2YX7A 3HHGA 2BGCA 3IUOA 2VOPA 5L3CA 1J59A 3GTQJ 3CCRI 4B43A 1BI2A 1NK3P 2XB5A 3GZ5A 1ZGWA 2RV8A 4KIFA 5ICGA 2E1MB 2A5YB 4YG2F 1WCMJ 2JA7J 3LA7A 4XR6A 4HQEA 1JGGA 5FROA 1IF1A 2NOJB 2VJJA 1WH5A 2DPDA 2GXGA 2OCEA 1U5TB 3G1LA 3ULQB 3HTUA 3LA3A 4A0ZA 4Q47A 2BY3A 3I56I 1YO5C 1OYYA 1N25A 4RB0A 4A3CJ 2EA4A 1MW7A 4XLPF 4BQNA 5IOZA 2K02A 3E6MA 3SDBA 4BHCA 1DDNA 2E71A 2OZ6A 1ODDA 4H4KC 1WHUA 4ANJA 2F2EA 1NG6A 4AVPA 4NC7A 4IX7A 1A5JA 4HLYA 4ETSA 4KMUX 2KQRA 2VT3A 3CC2I 2EV6A 4BXUA 1ZLJA 4CA0A 3CTAA 4U0YA 2E2IJ 3KP5A 5E79C 4M73A 3OYIA 3ZQCA 3JAMK 2DBBA 2WTEA 4PJ0C 4PSXA 4WXHA 5LD2C 1TWAJ 1UMQA 2JWTA 2DMPA 3JREA 3LL7A 5IYDJ 1FT9A 3FHZA 1Z0XA 2VJ5A 4Y4RA 3MEXA 1TT0A 4ZYEA 5J3LA 2KP6A 4HA8A 1TWCJ 1Y56A 5CKTA 2CW7A 1F43A 3L2WA 1Z7LA 2HEOA 4EJUA 1IRXA 2VKEA 5HDNA 3JRFA 3DBRB 3PQKA 4IJAA 2M0MA 4HAMA 3NRVA 2FU4A 2DMQA 3HKZN 3HSRA 5CVRA 1GDTA 4EMSA 4ZZLA 3E6CC 4PJMA 4U0VA 1F1ZA 1KQ8A 2FBIA 2KIMA 3FX3A 1R58A 4L9JA 5HDGA 3V7RA 4HYEA 2ID3A 1WKMA 5ERIA 3GTGJ 1U9NA 2NXNB 1ZLKA 4G9YA 2FRHA 1I3AA 3QAHA 2KZGA 4HBLA 3F8NA 5E20A 2VC1A 2HU9A 4MTDA 2W7NA 1HQCA 4XNFA 3F72A 3ZP5A 4A2UA 1YYVA 1HF0A 5KNLA 1V54H 3ECHA 2BZTA 1T6SA 1HLVA 2XGEA 4XN3A 3OY9A 3SEZA 1N77A 4CCMA 1ULYA 5FKNA 1MBGA 3K1MA 2F4OB 3J80Z 3CCLI 1FY7A 3QU6A 5DD8A 5CVVA 2OBPA 4YIFA 3K4LA 1YRNB 1MKMA 3VFZA 1F5TA 2R0QC 1FMWA 2O6GE 1BJAA 3ZCOA 5GPAA 2ZNYA 1R4MB 2VE8A 3R0JA 2CH0A 2NAZA 2RDPA 5FLVA 2KL4A 2TDXA 5BMZA 3ABMH 5CLSA 5LEKA 2KLOA 3H3VK 1R5ID 4BYYA 1VTNC 4UV9A 1B9MA 1BIAA 3CUOA 1P4WA 3FXLA 4UB6C 2H8WA 3A2KA 4GO1A 1TNTA 1UG0A 1OCTC 1V3FA 1W5TA 4G6TB 1X4OA 2G9WA 1K4TA 2A07F 1T33A 2LYCA 4IRIA 2W82A 4PUSA 4ENMA 5C4JJ 2BY1A 3KP3A 2JA8J 1AOYA 1IG7A 4G7OF 3ROUA 2QQ8A 3J7AY 2X48A 2L7ZA 2QKLB 1X1BA 3CJTB 2E1OA 4ZTFA 2VN2A 5DM7F 2QKMB 2L7FP 1OKRA 2PBIA 2L2OA 3QPLA 2ZB9A 4X0GA 4S04A 1DPUA 2X1EA 2ZJRF 4U88A 2GM4A 4E4HA 2I5UA 1TQMA 4L9NA 3Q3SA 4ITVA 3FWEA 2L54A 4HNVA 1G3TA 1FYKA 4LD5A 4XLHA 2IPQX 3TOBA 2W48A 5FGMA 4QSHA 4DBQA 1ITYA 3CP8A 2ISZA 2MLKA 2XF5A 2XAQA 1VZ0A 4UUSB 3PO3J 1R9TJ 1BI3A 3BJOA 1OYWA 3L09A 2EFOA 1LE8A 1VQNI 4I76A 4KN4X 1ZRFA 2UWMA 1FOXA 1T8IA 5DUIA 3LSGA 2QQ9A 4HX7A 2VBXA 4U87A 2OD5A 2DK8A 3HRMA 2O8XA 4DOZA 1YTYA 2NOGA 4JYKA 1XN7A 2EH3A 1VQOI 4JQFA 4II3A 2K3FA 3BWGA 1Z9CA 1XGNA 3FXRA 3VEPA 2FMYA 4C3IJ 1HCRA 1BR4A 1CF7A 4B8XA 3CJNA 4LB5A 3MD2A 3SZPA 5DUKA 2E2JJ 5LRRA 3CCYA 3P5JA 4EJWA 2P5LC 1TZLA 2LFBA 3IP4B 2MBFA 2VLAA 3FZVA 2FQ3A 3OSGA 4UY8I 3T0YA 1K83J 1B1BA 2L0KA 3LOCA 3S2DJ 3ZMTA 4A3LJ 3IWZA 1B9NA 2ZMEA 3S1QJ 4KDPA 1XCVA 1R1UA 3TP0A 2EINH 1HDPA 2M4KA 3RKWA 3HOZJ 2Y0MA 4D0PA 5FRMA 1KU3A 1SAXA 2YU3A 1Y8QB 3F8FA 1SANA 1ZKGA 5D5WB 3I4MJ 1ZGJA 2YUSA 1X1DA 3DTIA 4YIIA 4JOMA 4BJTA 3SQNA 1TWHJ 5CQEA 3L2UA 4M74A 1P92A 9ANTA 2DTRA 2AXTC 4A3MJ 2IXSA 1L3LA 2M30A 2FNAA 3IH3A 4CCJA 1XTAA 5J1UA 3OYGA 1XG1A 2E34A 5LBQA 4QPQA 2OTLI 2OTJI 3ASOH 4DBRA 4NHJA 2A6TA 3E3VA 4RAFA 3W6KB 2VBWA 1TWFJ 5FRNA 4Y13A 1I27A 1YS7A 3U1DA 3HPHA 2ECCA 3H36A 3DEEA 4HX4A 1B8IA 1W36D 3DTKA 4EJVA 5CYVA 2V1UA 5D6FA 3C1DA 1U0JA 1RC9A 3ABLH 2G0EA 3KX2A 4P9FA 1A36A 1IN4A 3CDHA 4W97A 4M6YA 1WQ2A 3I53A 1O3TA 3AG1H 4FQGA 2A69F 3CLQA 1IDZA 1QA6A 2K40A 1LE8B 4KFCA 4G6DA 4AM3A 2R7RA 3BTCA 3PSFA 4MQVA 4IO9F 2W57A 4QIWN 2JRMA 3RPUD 4FT8A 3ZQGA 2VONA 2F4IA 2QM3A 4EEFG 2JZYA 3HSFA 1HW5A 3GTOJ 4DNCA 5EEHA 2XKPA 2Z33A 1H88C 2CRGA 3HKZA 1G2HA 1F4KA 4K2EA 3JRCA 4RGUA 3AG4H 2A6HF 3ABTA 2Z3YA 2DYSH 2E35A 3KEOA 3RIRA 4CCLA 5CPRB 3OS0A 2X85A 2DDAA 2ZBKA 3HXLA 2MW8A 2FE3A 4XQFA 5J1YA 1MMSA 1OLTA 2P6SA 2CWEA 2CFOA 3JRBA 3BPXA 3IHUA 2B63J 5DS9A 3KYLA 1R4NB 3A4CA 4HPQA 1O3QA 3G3ZA 4DQ2A 3C7JA 1MH4A 2M9HA 2VKHA 3OIQA 3K2AA 5FFXA 5J6XA 3BZKA 2IP2A 1W0UA 2F5CA 2ZJPF 2P81A 4KMFA 5D6EA 3JTHA 5GTHC 3BOQA 3CCSI 3AL0C 1YX3A 1A04A 4PFPA 1T95A 5JVGF 3MKZA 3HDDA 3P9IA 4XRSA 3L2QA 2AQEA 2PMUA 3D5SC 5HDKA 3ISPA 1DPRA 4I01A 5DYMA 4BBSJ 4HDUA 3PL8A 4AWXB 2R5ZA 1UHMA 2YSRA 3IC7A 4GDFA 4FX4A 3ABKH 3RSNA 5DCMA 5KAFC 5LRSA 1YHQI 1EF4A 3DV8A 4X1EA 3RKYA 2PEXA 4NQWA 3A01A 2HPIA 2O61A 2RKHA 4QLCU 4ENNA 1VQ5I 3KEQA 4UVCA 2L4AA 4YRVA 1E3HA 1FBSA 5FKKA 1Y1VJ 2OJED 3DFGA 4UVBA 2FSWA 2P6TA 2NS0A 1AKHA 2M2EA 3WGIA 3AAFA 1RETA 1B8IB 1EA3A 1IDYA 5DCFA 3L00A 4XL9A 4ZH4F 2HS5A 3K10A 3PNYA 6PAXA 2DOEA 4MTEA 3FBIB 1BA5A 1VQLI 3HUGA 2KIUA 3WTYC 2L4MA 2DJIA 2XPVA 3EUHA 3ZRGA 3F22A 4QWQA 3Q0UA 2BBYA 5FB2A 4BL0B 2LBFB 4BUPA 2KFDA 5JLXA 4XBFA 3S1NJ 4IEJA 3BZ6A 2C6YA 3RYRA 1HKTA 5E18F 3U21A 4B47A 1ACIA 5DM6F 2VODA 1Z77A 5EG0B 4IXAA 1ZREA 1KYWA 4XLFA 2E1CA 4AIHA 3OYKA 4XLNF 4XRFA 4AU7A 2DLLA 5HOOA 1JJ8C 1J75A 3K4NA 3ERMA 2XC7A 2WC2A 4HSTA 5HLIA 2XSDC 3MQ0A 2IS1A 2EIKH 2DFHA 1MSFC 3RJPA 2CGPA 2HVRA 2N8GA 4UVAA 4EGYA 2DA7A 3QU3A 1BI1A 1LPQA 3V7SA 3TMOA 1MMNA 5M5YJ 3QYBA 2DMTA 1LKXA 5AIPA 4IHTA 4FISA 4QPOA 4M3DA 4LG0B 4XIDA 2E60A 3J7ZI 1RKWA 5ICCA 3ZQLA 3F8CA 4NUBA 1JUSA 1B72A 2W4SA 4CDGA 1LB2A 3TP3A 1ZYRF 2H1LA 2XRNA 5K7HA 2WB1N 3BTIA 4KIBA 1PJRA 2GBYA 3HOVJ 4UV8A 3LSJA 3LQRA 4M3EA 1A6IA 1MBKA 5TISC 5LHHA 1LEAA 2D45A 3L2VA 1PP7U 4YFKF 3CMEI 3I55I 4FE4A 1I6XA 4A0XA 1BW5A 1TLHB 3OMYA 5HODA 2QUFA 3IRQA 3G6EI 3CF5F 1JT0A 2R5ZB 3UKGA 1RI7A 1VQKI 3SEQA 3LWFA 4XMYA 5EZGA 4M71A 2IBDA 2M7AA 3A01B 3ZMZA 3ZMUA 2DFEA 2IEKA 2HOSA 1YOVB 3H0GJ 1MNDA 1V5EA 5K1YA 2EB7A 2LSOA 2XGDA 1PYVA 2HZDA 3H1CA 4CXFA 3R0AA 2QBYA 3EPZA 1U2WA 1I1SA 2RVCA 4L0ZB 2B0LA 2DA5A 2K3PA 4ZYAA 3Q5FA 3WODF 4CZCA 2PX9A 2E7XA 4RAZA 2HOAA 2RQQA 1STZA 3PNTA 1LVKA 5ED4A 3TDZC 1FZPB 4KISA 4GRIA 1R6RA 5CQGA 2LKXA 1N78A 3GLLA 3C18A 1SFEA 3RPQA 3LAPA 1U8RA 2LNBA 1D1BA 1IV8A 2ESNA 3HYIA 4BY7J 3M7GA 1FMVA 2EZKA 4KIGA 4XICA 3K69A 2L9VA 3ZQIA 1J09A 2Z1DA 4OINF 1YFHA 5J8FA 4H0EA 2JQ7A 4Y33A 2DT7B 2XF6A 4LIVA 1U5TA 3CLOA 4BKXA 4E70A 4UUTA 2DA3A 1T2KA 3WG7H 2CW8A 2DA4A 1T08B 4CCOA 4GFBA 4LLLA 1B6AA 4N0BA 2PI0A 2X9DA 4G94A 1I6HJ 1FP1D 5C44J 2M1BA 2V26A 4XRSG 4F7ZA 2NNNA 2VPRA 1XGMA 2DA1A 3OL3A 4MIMA 4EM1A 2R3SA 4NB5A 4PJNA 2HDWA 2WADA 3TL4X
chains in the Genus database with same CATH topology
1UHWA 1GHCA 4OIQF 2CQKA 2G7UA 3DQVC 3I5UA 3CO6C 2K4JA 3I0TA 1S7AA 1G3YA 2ZXJA 2FBKA 2K7LA 1R5GA 3J7AO 4L9TA 3EYYA 4LLNA 3KP6A 3ZQ7A 1W7PD 1XMKA 1TW2A 3U2RA 4RB1A 5ILUA 1SD4A 2JRTA 2QYOA 3ERED 3GEZA 2JPBA 2BYVE 5FLXK 1X3UA 3I58A 2KJBA 2PFBA 2Z99A 4PDKA 1DUXC 4EM2A 1S29A 3F8MA 5LGTA 5TRDA 2DU9A 3OV8A 3QPTA 1FYMA 2HTJA 2PJPA 1D8JA 3QOPA 2CYYA 2VBYA 3K0LA 2HQRA 3DPLC 5FFZA 3I59A 3ELKA 4A6DA 2HOEA 2GA1A 2FNPA 2P7VB 2HYGD 2O03A 1FP2A 1XGSA 1J2XA 4IHSA 4M9ZA 4LGWA 2E7WA 5A2QK 3EDPA 4EJTA 2YR2A 3O2PE 3N97A 1KQ9A 5H20A 1BM9A 2HTSA 3GXOA 3ZN0A 2K27A 1F9NA 3DKWA 4HW0A 1KYZA 4HDVA 5L3EA 4ZZDA 2JT1A 5D5VB 1OPCA 3GWZA 2LF7A 1IN5A 1RUOA 2K4BA 2DW4A 5FO5A 2IT0A 1HKQA 4IVNA 1ZG3A 3MFKA 5FD6A 1LDJA 2GXBA 2KJCA 4CO8A 1YW9A 1D8KA 2ZCWA 1HSTA 1LDDA 3M1EA 3FMSA 4KN7X 1KU7A 3VOEA 2PN6A 5E17F 1G6NA 1EV7A 1YW8A 3I59B 1K78B 3JAMZ 1Z05A 2ESHA 3EYIA 4O3MA 3ML6A 3H92A 2E1NA 4YFNF 3K9TA 2A3SA 2AS5F 1SFUA 4R1HA 3G73A 4UUVA 3K2ZA 1R22A 1YW7A 1IAWA 3FM3A 2DQRA 3Q9VA 3QRFF 4G7HF 1LVAA 5LGUA 3K1NA 3RYPA 1XSDA 3C3WA 4GYGA 2HKXA 2X4HA 2D2WA 2M8EA 5ILVA 1SFXA 4OOIA 3ABUA 3KCCA 4HV5A 3KFWX 4U0WA 4PCQA 3GLXA 2DT5A 4M6XA 1SD6A 3I71A 3BROA 4M9SA 4YFXF 4ZYHA 3TO9A 2JSCA 4ZYGA 3EQLF 3LQQA 5HLHA 3RI4A 2EV0A 2V1DA 4BHPA 4Z2YA 2OAZA 3HRSA 1R00A 1PUEE 1QZZA 2VXZA 5L3FA 2DAOA 2H94A 2VT2A 4N9IA 1Z6TA 2STWA 4M72A 2EK5A 3F23A 2R7FA 3LFKA 1S8NA 5ICEA 2RQPA 3E97A 3SHFA 4A0YA 3V8JA 2Z9OA 2P8TA 1MD0A 2P7CB 1XB4A 3P9CA 2MLGA 1Z7UA 4EJOA 3O6BB 1T39A 2P4WA 2O3FA 2VC0A 4EQQA 3WGHA 2VE9A 3BY6A 4HLXA 2UXXA 5F64A 3F21A 1TBXA 2FEZA 1WWXA 4HF1A 3LSTA 3WU1B 3I54A 4HX8A 3DPTA 3IKVA 5DV5A 4N9HA 3VODA 5D4SA 2WV0A 2W85A 1EH7A 4MEYF 4ESJA 1UCRA 2W24A 4P55A 3KLOA 2QWWA 5DEQA 5K5RA 1E17A 2GWRA 2H6BA 2ZNZA 4O6JA 1R36A 4HF2A 1Z1DA 3J81K 4A6EA 1FYLA 1USSA 3JSPA 4RS8A 1S7OA 4B09A 4FHTA 1SD5A 3O3KA 5K5OA 2RC4A 1FSHA 2EWNA 1IXSB 2YPRA 2HYFA 2EJRA 3HHHA 5DD4A 1ZG5A 1GXQA 1P4XA 2Q0OA 5IT3A 3R60A 3NQOA 1W7PB 2F5DA 3MCZA 2QQAA 2XAHA 4ESFA 5BPDA 1R5HA 3BDDA 4LG0A 3TKYA 4GYIA 5JR3A 5BOXA 1QBJA 5JVTA 3F6VA 5IT9K 4KT5C 2MH9A 1GVJA 2FOKA 2P5VA 3KP7A 3N4MA 1IN8A 4U7DA 3FF5A 5D5XB 4ESBA 2XVCA 4RGRA 5D8KB 1GXPA 4UHTA 1WI9A 2W25A 2PLYA 3GFJA 1CGPA 3H3UA 5E1WA 4LB6B 4OU0A 2H09A 3OOPA 1XCBA 2H6CA 4KICA 2L01A 3BJ6A 3R61A 1KA8A 2YX4A 3QP6A 3TGNA 4MHGA 4RGSA 3GVAA 1FOKA 1XD7A 1U5TC 1FSEA 4CICA 3WTZA 3D0SA 2DPUA 1YIOA 3CUQC 5BQTA 3VB2A 3GF2A 1HW2A 1O3RA 4A5MA 1U3EM 1BC7C 1LJ9A 3F3XA 4WK8F 1ONVA 5K5QA 3GFIA 2HGCA 2ELHA 1BOAA 3IKTA 3GFMA 2AXLA 2JTVA 1ON1A 4A12A 1TQIA 4BAYA 3ZMSA 4JK1X 1K6OA 3BP8A 1O7LA 4I98B 1J0RA 1P2FA 2Y75A 1XDUA 2O0YA 1MJ9A 2Z5UA 4I02A 2EFNA 3T1BA 3BPVA 2XHKA 4OIPF 3SFZA 4G7ZF 2QENA 1ZH5A 4LMYA 3V8LA 3KZZA 2LF8A 4KUMA 1B4AA 1UB9A 2KKOA 2VOOA 2STTA 1D5VA 1HSJA 1XDSA 1V4RA 3R4KA 2UZKA 2ACJA 3TO6A 5JI6A 2DFIA 2R7DA 5DDGA 2DI3A 5JFRA 3V7CA 2OQGA 2VBZA 2LKPA 3JW4A 5CVUA 2OZUA 3JTGA 1U6GA 4EV0A 5F1RA 1ZG1A 2XIGA 1BN5A 3LA2A 4ON0A 1YG2A 2RNJA 1LEBA 4MQ9F 3V8KA 3BJAA 1G4DA 4XSZF 3WTTC 4G6QA 1PP8F 3RPUA 4LLGF 2NYXA 4EGZA 3FXUA 3ZMVA 1JXSA 3FMRA 1RZ4A 4Q4ZF 4LJZF 1BI0A 2GZWA 1H9GA 4PZJA 1R1VA 4WX9A 1FBUA 4RB3C 1RUNA 1IRFA 3F6OA 1JHHA 4KYWA 1ON2A 4RGXA 3Q9SA 1S3JA 2XROA 1W5SA 1JE8A 3GYHX 2DQLA 1BC8C 1USTA 2ETHA 1ZAOA 1K78A 4I09A 5D4RA 1MDMB 4L0YB 5HS7A 5LGNA 5CVIA 4WWCA 1G3SA 4HQMA 1LDKB 1XSXA 1EH6A 4LK0F 1O57A 2ZKZA 3WE3A 1IZ1A 1XMAA 1SMTA 2JPCA 4OMZA 5CVJA 3CUQB 2CG4A 1REPC 5FLXZ 1IN7A 4BH9A 3U9GA 1WRJA 2V9VA 3J80K 2V79A 5E8IA 2MC3A 3HRTA 1D3YA 2KRFA 3WTWC 1QZYA 4IPAA 2F5FA 1IRGA 4LFUA 3I64A 3ZN1A 1L0OC 1FNNA 3K1PA 2HR3A 3E5XA 1TQPA 1J9IA 1ZRCA 1J5YA 2PQ8A 2Q2EA 1T0FA 5D8LB 2CSOA 2FF4A 3PQJA 5A2QZ 2CFXA 2DK5A 2IJLA 2EFPA 1IXCA 1KU2A 3HSEA 2MA3A 3HRUA 5E1ZB 1IXRC 2H27A 4IRHA 1K79A 2QQBA 4P96A 1ZN2A 3PFIA 3E5QA 3HIFA 3ZMDA 4R79A 2D1VA 2XKOA 3COAC 1YQAA 3FM5A 2GQQA 2GIVA 4PGGA 4FX0A 3DXJF 4IF4A 4OIRF 1QO0D 2ZJ2A 1HKSA 1KGSA 5AONA 3KE2A 1MZBA 2F5EA 4MEXF 4AIKA 3M8EA 3EETA 4GXOA 1NHAA 2OU2A 4UNOA 2EFWA 3P7NA 2XV4S 4I2OA 3V4GA 3MWMA 4P5OA 1P4AA 3KP4A 1RIOH 2P5KA 3HOSA 2HKOA 2MD5A 3MZYA 1FPQA 4JBAA 2FBHA 4HOBA 1T38A 3T8TA 2FXAA 3WTSC 1O3SA 2RN7A 1IUYA 1W7PA 2NNYA 2EV5A 1JGSA 1FBQA 1OR7A 4XSXF 2PMHA 1K7AA 2NRAC 2IA0A 1E2XA 2IW5A 1HW1A 1TW3A 4I0BA 1XSVA 2J5OA 3WTUC 1I5ZA 2QZ8A 3CO7C 1G3WA 5BS6A 1LNWA 5CJ9A 3ECOA 2A6EF 4ENJA 3E6DA 4WF2A 2BE5F 1DP7P 3DEUA 2LDUA 4CGZA 2IA2A 2HWVA 2Q8KA 3RKXA 1B59A 1U78A 3F8BA 4M9XA 1IW7F 4P9UA 2G7HA 1ZARA 1KQ0A 1BIBA 1Q1HA 5EEGA 2HDCA 3KETA 2WWYA 2V6CA 3IL2A 3LAJA 3IWFA 1RNLA 3WE2A 2A68F 2D1HA 2KIFA 3HOTA 1SD7A 2MH2A 3DF8A 3KLNA 1T98A 3MAJA 5ILSA 4MNUA 2GA2A 3REOA 3HTSB 1ZGAA 5LLQA 4AIJA 3TOAA 1HXDA 5E1XA 1P6RA 4ENKA 5KVRA 1YS6A 4L5IA 1H0MA 3ZPLA 1CF7B 4WCGA 3DP7A 5ICFA 5LHIA 3IRRA 5L3BA 2XAGA 4GCVA 4ASNA 1ZRDA 2RGVA 4L18B 3GW2A 4PGHA 2J5PA 1TNSA 5TJJA 2QLZA 2ZMEB 4I7HA 2ZFWA 4R8HA 5LEJA 3FMQA 3L7WA 3GO5A 2OQRA 3J81Z 2W84A 5LHGA 3GFLA 1WSUA 3B02A 4KNYA 5HS9A 3WTXC 4GGGA 3GZ6A 1MJBA 2IA1A 2X0LA 2DO7A 4L9VA 4Y17A 3MZHA 5D5UB 1UFMA 3RDIA 1MGTA 1SMYF 1O7FA 5KK1A 1Z6RA 1EH8A 4S05A 4Y15A 2PG4A 4Q5SF 2GAUA 2XAJA 4BQAA 3M8FA 4RB2C 2L02A 3WTVC 3QPHA 3GX4X 4BNCA 4UXNA 2M45A 2L3DA 2XGXA 1W4MA 1KU9A 5IT9Z 3B73A 1I1GA 5AIQA 2V1XA 3T5XA 3TO7A 4BHBA 4RAYA 2EA2A 1OYIA 5H6QA 3SZTA 4OMYA 4WXDA 4HF0A 3R6SA 3H3ZA 3I4PA 1OMIA 1QNTA 5F6FA 1JHFA 3T8RA 1BBYA 3FXQA 1C0WA 4OIOF 1LQ1A 4TV7A 1J7KA 4G8XA 2EFQA 5L3DA 2CW0F 4CHUA 2BV6A 4WXCA 1FX7A 1R23A 4EVIA 2Y48A 1FLIA 4AD9A 2ZO4A 2XASA 1MJAA 2XUBA 4O5VA 5H6RA 2FA5A 4ZYDA 2OA4A 1FC3A 2ADUA 5DCMB 3QP5A 2A61A 1R1TA 5J8CA 1QPMA 4U7BA 3WU0A 3D5LA 4MGRA 1XGOA 3L9FA 1H9TA 2IVMA 4KA4A 4Q48A 2K86A 2M87A 1QQIA 4IRGA 1ZHFA 2M5WA 1MDMA 2ISYA 5HS8A 1Z91A 3P9KA 4EM0B 3RTRA 4CYDA 2FMLA 5FD5A 3GUDA 5E8GA 1Y0UA 3W6JB 2BEOA 1S6LA 4CZZA 5HVQC 3E6BA 2IRFG 4A5NA 3CUQA 5L3GA 1QGPA 3NEUA 3S2WA 3JSOA 4HV6A 1FWZA 1YLFA 4LK1F 3KZYA 2HQNA 3TDUC 1IN6A 4L5JA 5BPIA 3L2CA 1HBXG 1TTYA 2QVOA 3SXYA 2HFHA 1PDNC 3KP2A 2CO5A 2COMA 3WGGA 1R7JA 1AWCA 2XAFA 3E5UA 2QBYB 3WG9A 3M9AA 3TQNA 5HLGA 5JHUA 4I0AA 2UXNA 4HZFA 2YX7A 2HZTA 3HHGA 2VOPA 2BGCA 5L3CA 1J59A 1BI2A 3GZ5A 2RV8A 4KIFA 5ICGA 2A5YB 4YG2F 3LA7A 4HQEA 1IF1A 2DPDA 2GXGA 1U5TB 3ULQB 3HTUA 3LA3A 4A0ZA 4Q47A 1YO5C 1OYYA 4RB0A 2EA4A 4XLPF 2K02A 3E6MA 4BHCA 1DDNA 2OZ6A 1ODDA 2F2EA 4AVPA 4HLYA 4ETSA 4KMUX 2VT3A 2EV6A 4BXUA 1ZLJA 3CTAA 4U0YA 3KP5A 4M73A 3JAMK 2DBBA 2WTEA 4WXHA 1FT9A 3FHZA 3MEXA 4ZYEA 4HA8A 2HEOA 4EJUA 5HDNA 3PQKA 4IJAA 4HAMA 3NRVA 2FU4A 5CVRA 3HSRA 4EMSA 4ZZLA 3E6CC 4U0VA 1F1ZA 1KQ8A 2FBIA 2KIMA 3FX3A 1R58A 4L9JA 5HDGA 3V7RA 4HYEA 1WKMA 5ERIA 1ZLKA 4G9YA 2FRHA 3QAHA 4HBLA 3F8NA 5E20A 2VC1A 4MTDA 1HQCA 3F72A 3ZP5A 4A2UA 1YYVA 3ECHA 1T6SA 1ULYA 3K1MA 3J80Z 1FY7A 3QU6A 5DD8A 5CVVA 2OBPA 4YIFA 1MKMA 3VFZA 1F5TA 2O6GE 1BJAA 2ZNYA 2VE8A 3R0JA 2NAZA 2RDPA 2TDXA 5BMZA 5CLSA 5LEKA 4BYYA 1VTNC 4UV9A 1B9MA 1BIAA 3CUOA 1P4WA 4GO1A 1TNTA 1V3FA 1W5TA 2G9WA 2A07F 4IRIA 4ENMA 3KP3A 1AOYA 4G7OF 3ROUA 2VN2A 1OKRA 2PBIA 4S04A 1DPUA 4U88A 1TQMA 4L9NA 3FWEA 2L54A 1G3TA 1FYKA 4LD5A 2IPQX 3TOBA 5FGMA 2ISZA 2MLKA 2XAQA 1BI3A 3BJOA 1OYWA 3L09A 2EFOA 4KN4X 1ZRFA 2UWMA 5DUIA 2QQ9A 4HX7A 2VBXA 2OD5A 2DK8A 3HRMA 2O8XA 1YTYA 1XN7A 4JQFA 3BWGA 1Z9CA 1XGNA 3FXRA 3VEPA 2FMYA 1CF7A 4B8XA 3CJNA 4LB5A 3SZPA 5DUKA 5LRRA 4EJWA 2P5LC 2MBFA 3FZVA 2FQ3A 3T0YA 1B1BA 3ZMTA 3IWZA 1B9NA 2ZMEA 4KDPA 1XCVA 1R1UA 3RKWA 2Y0MA 4D0PA 1KU3A 1SAXA 2YU3A 3F8FA 5D5WB 1ZGJA 4YIIA 3SQNA 4M74A 1P92A 2DTRA 1L3LA 2M30A 2FNAA 5LBQA 4NHJA 3E3VA 3W6KB 2VBWA 4Y13A 1I27A 1YS7A 3U1DA 4HX4A 4EJVA 5CYVA 2V1UA 5D6FA 3C1DA 4P9FA 1IN4A 3CDHA 4M6YA 1WQ2A 3I53A 1O3TA 2A69F 4KFCA 4G6DA 4MQVA 2W57A 4FT8A 2VONA 2QM3A 2JZYA 3HSFA 1HW5A 4DNCA 5EEHA 2XKPA 2Z33A 1F4KA 4K2EA 4RGUA 2A6HF 3ABTA 2Z3YA 3KEOA 3RIRA 2ZBKA 2FE3A 2P6SA 2CWEA 3BPXA 3IHUA 1O3QA 3G3ZA 4DQ2A 3C7JA 5FFXA 5J6XA 2IP2A 2F5CA 4KMFA 5D6EA 3JTHA 3BOQA 1A04A 3P9IA 2PMUA 5HDKA 3ISPA 1DPRA 4I01A 5DYMA 4HDUA 4AWXB 1UHMA 2YSRA 3IC7A 4FX4A 5DCMA 5LRSA 3DV8A 3RKYA 2PEXA 4NQWA 2O61A 2RKHA 4QLCU 4ENNA 3KEQA 4UVCA 2L4AA 1FBSA 3DFGA 4UVBA 2FSWA 2P6TA 2NS0A 3WGIA 3AAFA 5DCFA 3L00A 4ZH4F 2HS5A 6PAXA 4MTEA 3HUGA 2KIUA 3WTYC 2L4MA 3EUHA 3F22A 4QWQA 2BBYA 5FB2A 4XBFA 3BZ6A 2C6YA 3RYRA 1HKTA 5E18F 2VODA 4IXAA 1ZREA 1KYWA 2E1CA 4AIHA 4XLNF 4XRFA 5HOOA 2DLLA 1J75A 2WC2A 5HLIA 3MQ0A 3RJPA 2CGPA 4EGYA 4UVAA 3QU3A 1BI1A 3V7SA 5AIPA 4IHTA 4LG0B 5ICCA 3F8CA 4CDGA 1LB2A 1ZYRF 2XRNA 4KIBA 4UV8A 5LHHA 3LQRA 1LEAA 2D45A 1PP7U 4YFKF 1I6XA 4A0XA 1TLHB 2QUFA 3IRQA 1RI7A 3LWFA 4M71A 3ZMZA 3ZMUA 5K1YA 2EB7A 2LSOA 4CXFA 3R0AA 2QBYA 1U2WA 1I1SA 2RVCA 4L0ZB 2B0LA 3Q5FA 3WODF 2E7XA 4RAZA 1STZA 5ED4A 3TDZC 1FZPB 3C18A 1SFEA 3RPQA 3LAPA 1U8RA 2LNBA 2ESNA 3HYIA 3M7GA 4KIGA 3K69A 4OINF 1YFHA 5J8FA 4H0EA 1U5TA 3CLOA 4E70A 1T2KA 4LLLA 1B6AA 4N0BA 2PI0A 4G94A 1FP1D 2M1BA 4F7ZA 2NNNA 1XGMA 4EM1A 2R3SA 4NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHW A;  1GHC A;  4OIQ F;  2CQK A;  2G7U A;  3DQV C;  3I5U A;  3CO6 C;  2K4J A;  3I0T A;  1S7A A;  1G3Y A;  2ZXJ A;  2FBK A;  2K7L A;  1R5G A;  3J7A O;  4L9T A;  3EYY A;  4LLN A;  3KP6 A;  3ZQ7 A;  1W7P D;  1XMK A;  1TW2 A;  3U2R A;  4RB1 A;  5ILU A;  1SD4 A;  2JRT A;  2QYO A;  3ERE D;  3GEZ A;  2JPB A;  2BYV E;  5FLX K;  1X3U A;  3I58 A;  2KJB A;  2PFB A;  2Z99 A;  4PDK A;  1DUX C;  4EM2 A;  1S29 A;  3F8M A;  5LGT A;  5TRD A;  2DU9 A;  3OV8 A;  3QPT A;  1FYM A;  2HTJ A;  2PJP A;  1D8J A;  3QOP A;  2CYY A;  2VBY A;  3K0L A;  2HQR A;  3DPL C;  5FFZ A;  3I59 A;  3ELK A;  4A6D A;  2HOE A;  2GA1 A;  2FNP A;  2P7V B;  2HYG D;  2O03 A;  1FP2 A;  1XGS A;  1J2X A;  4IHS A;  4M9Z A;  4LGW A;  2E7W A;  5A2Q K;  3EDP A;  4EJT A;  2YR2 A;  3O2P E;  3N97 A;  1KQ9 A;  5H20 A;  1BM9 A;  2HTS A;  3GXO A;  3ZN0 A;  2K27 A;  1F9N A;  3DKW A;  4HW0 A;  1KYZ A;  4HDV A;  5L3E A;  4ZZD A;  2JT1 A;  5D5V B;  1OPC A;  3GWZ A;  2LF7 A;  1IN5 A;  1RUO A;  2K4B A;  2DW4 A;  5FO5 A;  2IT0 A;  1HKQ A;  4IVN A;  1ZG3 A;  3MFK A;  5FD6 A;  1LDJ A;  2GXB A;  2KJC A;  4CO8 A;  1YW9 A;  1D8K A;  2ZCW A;  1HST A;  1LDD A;  3M1E A;  3FMS A;  4KN7 X;  1KU7 A;  3VOE A;  2PN6 A;  5E17 F;  1G6N A;  1EV7 A;  1YW8 A;  3I59 B;  1K78 B;  3JAM Z;  1Z05 A;  2ESH A;  3EYI A;  4O3M A;  3ML6 A;  3H92 A;  2E1N A;  4YFN F;  3K9T A;  2A3S A;  2AS5 F;  1SFU A;  4R1H A;  3G73 A;  4UUV A;  3K2Z A;  1R22 A;  1YW7 A;  1IAW A;  3FM3 A;  2DQR A;  3Q9V A;  3QRF F;  4G7H F;  1LVA A;  5LGU A;  3K1N A;  3RYP A;  1XSD A;  3C3W A;  4GYG A;  2HKX A;  2X4H A;  2D2W A;  2M8E A;  5ILV A;  1SFX A;  4OOI A;  3ABU A;  3KCC A;  4HV5 A;  3KFW X;  4U0W A;  4PCQ A;  3GLX A;  2DT5 A;  4M6X A;  1SD6 A;  3I71 A;  3BRO A;  4M9S A;  4YFX F;  4ZYH A;  3TO9 A;  2JSC A;  4ZYG A;  3EQL F;  3LQQ A;  5HLH A;  3RI4 A;  2EV0 A;  2V1D A;  4BHP A;  4Z2Y A;  2OAZ A;  3HRS A;  1R00 A;  1PUE E;  1QZZ A;  2VXZ A;  5L3F A;  2DAO A;  2H94 A;  2VT2 A;  4N9I A;  1Z6T A;  2STW A;  4M72 A;  2EK5 A;  3F23 A;  2R7F A;  3LFK A;  1S8N A;  5ICE A;  2RQP A;  3E97 A;  3SHF A;  4A0Y A;  3V8J A;  2Z9O A;  2P8T A;  1MD0 A;  2P7C B;  1XB4 A;  3P9C A;  2MLG A;  1Z7U A;  4EJO A;  3O6B B;  1T39 A;  2P4W A;  2O3F A;  2VC0 A;  4EQQ A;  3WGH A;  2VE9 A;  3BY6 A;  4HLX A;  2UXX A;  5F64 A;  3F21 A;  1TBX A;  2FEZ A;  1WWX A;  4HF1 A;  3LST A;  3WU1 B;  3I54 A;  4HX8 A;  3DPT A;  3IKV A;  5DV5 A;  4N9H A;  3VOD A;  5D4S A;  2WV0 A;  2W85 A;  1EH7 A;  4MEY F;  4ESJ A;  1UCR A;  2W24 A;  4P55 A;  3KLO A;  2QWW A;  5DEQ A;  5K5R A;  1E17 A;  2GWR A;  2H6B A;  2ZNZ A;  4O6J A;  1R36 A;  4HF2 A;  1Z1D A;  3J81 K;  4A6E A;  1FYL A;  1USS A;  3JSP A;  4RS8 A;  1S7O A;  4B09 A;  4FHT A;  1SD5 A;  3O3K A;  5K5O A;  2RC4 A;  1FSH A;  2EWN A;  1IXS B;  2YPR A;  2HYF A;  2EJR A;  3HHH A;  5DD4 A;  1ZG5 A;  1GXQ A;  1P4X A;  2Q0O A;  5IT3 A;  3R60 A;  3NQO A;  1W7P B;  2F5D A;  3MCZ A;  2QQA A;  2XAH A;  4ESF A;  5BPD A;  1R5H A;  3BDD A;  4LG0 A;  3TKY A;  4GYI A;  5JR3 A;  5BOX A;  1QBJ A;  5JVT A;  3F6V A;  5IT9 K;  4KT5 C;  2MH9 A;  1GVJ A;  2FOK A;  2P5V A;  3KP7 A;  3N4M A;  1IN8 A;  4U7D A;  3FF5 A;  5D5X B;  4ESB A;  2XVC A;  4RGR A;  5D8K B;  1GXP A;  4UHT A;  1WI9 A;  2W25 A;  2PLY A;  3GFJ A;  1CGP A;  3H3U A;  5E1W A;  4LB6 B;  4OU0 A;  2H09 A;  3OOP A;  1XCB A;  2H6C A;  4KIC A;  2L01 A;  3BJ6 A;  3R61 A;  1KA8 A;  2YX4 A;  3QP6 A;  3TGN A;  4MHG A;  4RGS A;  3GVA A;  1FOK A;  1XD7 A;  1U5T C;  1FSE A;  4CIC A;  3WTZ A;  3D0S A;  2DPU A;  1YIO A;  3CUQ C;  5BQT A;  3VB2 A;  3GF2 A;  1HW2 A;  1O3R A;  4A5M A;  1U3E M;  1BC7 C;  1LJ9 A;  3F3X A;  4WK8 F;  1ONV A;  5K5Q A;  3GFI A;  2HGC A;  2ELH A;  1BOA A;  3IKT A;  3GFM A;  2AXL A;  2JTV A;  1ON1 A;  4A12 A;  1TQI A;  4BAY A;  3ZMS A;  4JK1 X;  1K6O A;  3BP8 A;  1O7L A;  4I98 B;  1J0R A;  1P2F A;  2Y75 A;  1XDU A;  2O0Y A;  1MJ9 A;  2Z5U A;  4I02 A;  2EFN A;  3T1B A;  3BPV A;  2XHK A;  4OIP F;  3SFZ A;  4G7Z F;  2QEN A;  1ZH5 A;  4LMY A;  3V8L A;  3KZZ A;  2LF8 A;  4KUM A;  1B4A A;  1UB9 A;  2KKO A;  2VOO A;  2STT A;  1D5V A;  1HSJ A;  1XDS A;  1V4R A;  3R4K A;  2UZK A;  2ACJ A;  3TO6 A;  5JI6 A;  2DFI A;  2R7D A;  5DDG A;  2DI3 A;  5JFR A;  3V7C A;  2OQG A;  2VBZ A;  2LKP A;  3JW4 A;  5CVU A;  2OZU A;  3JTG A;  1U6G A;  4EV0 A;  5F1R A;  1ZG1 A;  2XIG A;  1BN5 A;  3LA2 A;  4ON0 A;  1YG2 A;  2RNJ A;  1LEB A;  4MQ9 F;  3V8K A;  3BJA A;  1G4D A;  4XSZ F;  3WTT C;  4G6Q A;  1PP8 F;  3RPU A;  4LLG F;  2NYX A;  4EGZ A;  3FXU A;  3ZMV A;  1JXS A;  3FMR A;  1RZ4 A;  4Q4Z F;  4LJZ F;  1BI0 A;  2GZW A;  1H9G A;  4PZJ A;  1R1V A;  4WX9 A;  1FBU A;  4RB3 C;  1RUN A;  1IRF A;  3F6O A;  1JHH A;  4KYW A;  1ON2 A;  4RGX A;  3Q9S A;  1S3J A;  2XRO A;  1W5S A;  1JE8 A;  3GYH X;  2DQL A;  1BC8 C;  1UST A;  2ETH A;  1ZAO A;  1K78 A;  4I09 A;  5D4R A;  1MDM B;  4L0Y B;  5HS7 A;  5LGN A;  5CVI A;  4WWC A;  1G3S A;  4HQM A;  1LDK B;  1XSX A;  1EH6 A;  4LK0 F;  1O57 A;  2ZKZ A;  3WE3 A;  1IZ1 A;  1XMA A;  1SMT A;  2JPC A;  4OMZ A;  5CVJ A;  3CUQ B;  2CG4 A;  1REP C;  5FLX Z;  1IN7 A;  4BH9 A;  3U9G A;  1WRJ A;  2V9V A;  3J80 K;  2V79 A;  5E8I A;  2MC3 A;  3HRT A;  1D3Y A;  2KRF A;  3WTW C;  1QZY A;  4IPA A;  2F5F A;  1IRG A;  4LFU A;  3I64 A;  3ZN1 A;  1L0O C;  1FNN A;  3K1P A;  2HR3 A;  3E5X A;  1TQP A;  1J9I A;  1ZRC A;  1J5Y A;  2PQ8 A;  2Q2E A;  1T0F A;  5D8L B;  2CSO A;  2FF4 A;  3PQJ A;  5A2Q Z;  2CFX A;  2DK5 A;  2IJL A;  2EFP A;  1IXC A;  1KU2 A;  3HSE A;  2MA3 A;  3HRU A;  5E1Z B;  1IXR C;  2H27 A;  4IRH A;  1K79 A;  2QQB A;  4P96 A;  1ZN2 A;  3PFI A;  3E5Q A;  3HIF A;  3ZMD A;  4R79 A;  2D1V A;  2XKO A;  3COA C;  1YQA A;  3FM5 A;  2GQQ A;  2GIV A;  4PGG A;  4FX0 A;  3DXJ F;  4IF4 A;  4OIR F;  1QO0 D;  2ZJ2 A;  1HKS A;  1KGS A;  5AON A;  3KE2 A;  1MZB A;  2F5E A;  4MEX F;  4AIK A;  3M8E A;  3EET A;  4GXO A;  1NHA A;  2OU2 A;  4UNO A;  2EFW A;  3P7N A;  2XV4 S;  4I2O A;  3V4G A;  3MWM A;  4P5O A;  1P4A A;  3KP4 A;  1RIO H;  2P5K A;  3HOS A;  2HKO A;  2MD5 A;  3MZY A;  1FPQ A;  4JBA A;  2FBH A;  4HOB A;  1T38 A;  3T8T A;  2FXA A;  3WTS C;  1O3S A;  2RN7 A;  1IUY A;  1W7P A;  2NNY A;  2EV5 A;  1JGS A;  1FBQ A;  1OR7 A;  4XSX F;  2PMH A;  1K7A A;  2NRA C;  2IA0 A;  1E2X A;  2IW5 A;  1HW1 A;  1TW3 A;  4I0B A;  1XSV A;  2J5O A;  3WTU C;  1I5Z A;  2QZ8 A;  3CO7 C;  1G3W A;  5BS6 A;  1LNW A;  5CJ9 A;  3ECO A;  2A6E F;  4ENJ A;  3E6D A;  4WF2 A;  2BE5 F;  1DP7 P;  3DEU A;  2LDU A;  4CGZ A;  2IA2 A;  2HWV A;  2Q8K A;  3RKX A;  1B59 A;  1U78 A;  3F8B A;  4M9X A;  1IW7 F;  4P9U A;  2G7H A;  1ZAR A;  1KQ0 A;  1BIB A;  1Q1H A;  5EEG A;  2HDC A;  3KET A;  2WWY A;  2V6C A;  3IL2 A;  3LAJ A;  3IWF A;  1RNL A;  3WE2 A;  2A68 F;  2D1H A;  2KIF A;  3HOT A;  1SD7 A;  2MH2 A;  3DF8 A;  3KLN A;  1T98 A;  3MAJ A;  5ILS A;  4MNU A;  2GA2 A;  3REO A;  3HTS B;  1ZGA A;  5LLQ A;  4AIJ A;  3TOA A;  1HXD A;  5E1X A;  1P6R A;  4ENK A;  5KVR A;  1YS6 A;  4L5I A;  1H0M A;  3ZPL A;  1CF7 B;  4WCG A;  3DP7 A;  5ICF A;  5LHI A;  3IRR A;  5L3B A;  2XAG A;  4GCV A;  4ASN A;  1ZRD A;  2RGV A;  4L18 B;  3GW2 A;  4PGH A;  2J5P A;  1TNS A;  5TJJ A;  2QLZ A;  2ZME B;  4I7H A;  2ZFW A;  4R8H A;  5LEJ A;  3FMQ A;  3L7W A;  3GO5 A;  2OQR A;  3J81 Z;  2W84 A;  5LHG A;  3GFL A;  1WSU A;  3B02 A;  4KNY A;  5HS9 A;  3WTX C;  4GGG A;  3GZ6 A;  1MJB A;  2IA1 A;  2X0L A;  2DO7 A;  4L9V A;  4Y17 A;  3MZH A;  5D5U B;  1UFM A;  3RDI A;  1MGT A;  1SMY F;  1O7F A;  5KK1 A;  1Z6R A;  1EH8 A;  4S05 A;  4Y15 A;  2PG4 A;  4Q5S F;  2GAU A;  2XAJ A;  4BQA A;  3M8F A;  4RB2 C;  2L02 A;  3WTV C;  3QPH A;  3GX4 X;  4BNC A;  4UXN A;  2M45 A;  2L3D A;  2XGX A;  1W4M A;  1KU9 A;  5IT9 Z;  3B73 A;  1I1G A;  5AIQ A;  2V1X A;  3T5X A;  3TO7 A;  4BHB A;  4RAY A;  2EA2 A;  1OYI A;  5H6Q A;  3SZT A;  4OMY A;  4WXD A;  4HF0 A;  3R6S A;  3H3Z A;  3I4P A;  1OMI A;  1QNT A;  5F6F A;  1JHF A;  3T8R A;  1BBY A;  3FXQ A;  1C0W A;  4OIO F;  1LQ1 A;  4TV7 A;  1J7K A;  4G8X A;  2EFQ A;  5L3D A;  2CW0 F;  4CHU A;  2BV6 A;  4WXC A;  1FX7 A;  1R23 A;  4EVI A;  2Y48 A;  1FLI A;  4AD9 A;  2ZO4 A;  2XAS A;  1MJA A;  2XUB A;  4O5V A;  5H6R A;  2FA5 A;  4ZYD A;  2OA4 A;  1FC3 A;  2ADU A;  5DCM B;  3QP5 A;  2A61 A;  1R1T A;  5J8C A;  1QPM A;  4U7B A;  3WU0 A;  3D5L A;  4MGR A;  1XGO A;  3L9F A;  1H9T A;  2IVM A;  4KA4 A;  4Q48 A;  2K86 A;  2M87 A;  1QQI A;  4IRG A;  1ZHF A;  2M5W A;  1MDM A;  2ISY A;  5HS8 A;  1Z91 A;  3P9K A;  4EM0 B;  3RTR A;  4CYD A;  2FML A;  5FD5 A;  3GUD A;  5E8G A;  1Y0U A;  3W6J B;  2BEO A;  1S6L A;  4CZZ A;  5HVQ C;  3E6B A;  2IRF G;  4A5N A;  3CUQ A;  5L3G A;  1QGP A;  3NEU A;  3S2W A;  3JSO A;  4HV6 A;  1FWZ A;  1YLF A;  4LK1 F;  3KZY A;  2HQN A;  3TDU C;  1IN6 A;  4L5J A;  5BPI A;  3L2C A;  1HBX G;  1TTY A;  2QVO A;  3SXY A;  2HFH A;  1PDN C;  3KP2 A;  2CO5 A;  2COM A;  3WGG A;  1R7J A;  1AWC A;  2XAF A;  3E5U A;  2QBY B;  3WG9 A;  3M9A A;  3TQN A;  5HLG A;  5JHU A;  4I0A A;  2UXN A;  4HZF A;  2YX7 A;  2HZT A;  3HHG A;  2VOP A;  2BGC A;  5L3C A;  1J59 A;  1BI2 A;  3GZ5 A;  2RV8 A;  4KIF A;  5ICG A;  2A5Y B;  4YG2 F;  3LA7 A;  4HQE A;  1IF1 A;  2DPD A;  2GXG A;  1U5T B;  3ULQ B;  3HTU A;  3LA3 A;  4A0Z A;  4Q47 A;  1YO5 C;  1OYY A;  4RB0 A;  2EA4 A;  4XLP F;  2K02 A;  3E6M A;  4BHC A;  1DDN A;  2OZ6 A;  1ODD A;  2F2E A;  4AVP A;  4HLY A;  4ETS A;  4KMU X;  2VT3 A;  2EV6 A;  4BXU A;  1ZLJ A;  3CTA A;  4U0Y A;  3KP5 A;  4M73 A;  3JAM K;  2DBB A;  2WTE A;  4WXH A;  1FT9 A;  3FHZ A;  3MEX A;  4ZYE A;  4HA8 A;  2HEO A;  4EJU A;  5HDN A;  3PQK A;  4IJA A;  4HAM A;  3NRV A;  2FU4 A;  5CVR A;  3HSR A;  4EMS A;  4ZZL A;  3E6C C;  4U0V A;  1F1Z A;  1KQ8 A;  2FBI A;  2KIM A;  3FX3 A;  1R58 A;  4L9J A;  5HDG A;  3V7R A;  4HYE A;  1WKM A;  5ERI A;  1ZLK A;  4G9Y A;  2FRH A;  3QAH A;  4HBL A;  3F8N A;  5E20 A;  2VC1 A;  4MTD A;  1HQC A;  3F72 A;  3ZP5 A;  4A2U A;  1YYV A;  3ECH A;  1T6S A;  1ULY A;  3K1M A;  3J80 Z;  1FY7 A;  3QU6 A;  5DD8 A;  5CVV A;  2OBP A;  4YIF A;  1MKM A;  3VFZ A;  1F5T A;  2O6G E;  1BJA A;  2ZNY A;  2VE8 A;  3R0J A;  2NAZ A;  2RDP A;  2TDX A;  5BMZ A;  5CLS A;  5LEK A;  4BYY A;  1VTN C;  4UV9 A;  1B9M A;  1BIA A;  3CUO A;  1P4W A;  4GO1 A;  1TNT A;  1V3F A;  1W5T A;  2G9W A;  2A07 F;  4IRI A;  4ENM A;  3KP3 A;  1AOY A;  4G7O F;  3ROU A;  2VN2 A;  1OKR A;  2PBI A;  4S04 A;  1DPU A;  4U88 A;  1TQM A;  4L9N A;  3FWE A;  2L54 A;  1G3T A;  1FYK A;  4LD5 A;  2IPQ X;  3TOB A;  5FGM A;  2ISZ A;  2MLK A;  2XAQ A;  1BI3 A;  3BJO A;  1OYW A;  3L09 A;  2EFO A;  4KN4 X;  1ZRF A;  2UWM A;  5DUI A;  2QQ9 A;  4HX7 A;  2VBX A;  2OD5 A;  2DK8 A;  3HRM A;  2O8X A;  1YTY A;  1XN7 A;  4JQF A;  3BWG A;  1Z9C A;  1XGN A;  3FXR A;  3VEP A;  2FMY A;  1CF7 A;  4B8X A;  3CJN A;  4LB5 A;  3SZP A;  5DUK A;  5LRR A;  4EJW A;  2P5L C;  2MBF A;  3FZV A;  2FQ3 A;  3T0Y A;  1B1B A;  3ZMT A;  3IWZ A;  1B9N A;  2ZME A;  4KDP A;  1XCV A;  1R1U A;  3RKW A;  2Y0M A;  4D0P A;  1KU3 A;  1SAX A;  2YU3 A;  3F8F A;  5D5W B;  1ZGJ A;  4YII A;  3SQN A;  4M74 A;  1P92 A;  2DTR A;  1L3L A;  2M30 A;  2FNA A;  5LBQ A;  4NHJ A;  3E3V A;  3W6K B;  2VBW A;  4Y13 A;  1I27 A;  1YS7 A;  3U1D A;  4HX4 A;  4EJV A;  5CYV A;  2V1U A;  5D6F A;  3C1D A;  4P9F A;  1IN4 A;  3CDH A;  4M6Y A;  1WQ2 A;  3I53 A;  1O3T A;  2A69 F;  4KFC A;  4G6D A;  4MQV A;  2W57 A;  4FT8 A;  2VON A;  2QM3 A;  2JZY A;  3HSF A;  1HW5 A;  4DNC A;  5EEH A;  2XKP A;  2Z33 A;  1F4K A;  4K2E A;  4RGU A;  2A6H F;  3ABT A;  2Z3Y A;  3KEO A;  3RIR A;  2ZBK A;  2FE3 A;  2P6S A;  2CWE A;  3BPX A;  3IHU A;  1O3Q A;  3G3Z A;  4DQ2 A;  3C7J A;  5FFX A;  5J6X A;  2IP2 A;  2F5C A;  4KMF A;  5D6E A;  3JTH A;  3BOQ A;  1A04 A;  3P9I A;  2PMU A;  5HDK A;  3ISP A;  1DPR A;  4I01 A;  5DYM A;  4HDU A;  4AWX B;  1UHM A;  2YSR A;  3IC7 A;  4FX4 A;  5DCM A;  5LRS A;  3DV8 A;  3RKY A;  2PEX A;  4NQW A;  2O61 A;  2RKH A;  4QLC U;  4ENN A;  3KEQ A;  4UVC A;  2L4A A;  1FBS A;  3DFG A;  4UVB A;  2FSW A;  2P6T A;  2NS0 A;  3WGI A;  3AAF A;  5DCF A;  3L00 A;  4ZH4 F;  2HS5 A;  6PAX A;  4MTE A;  3HUG A;  2KIU A;  3WTY C;  2L4M A;  3EUH A;  3F22 A;  4QWQ A;  2BBY A;  5FB2 A;  4XBF A;  3BZ6 A;  2C6Y A;  3RYR A;  1HKT A;  5E18 F;  2VOD A;  4IXA A;  1ZRE A;  1KYW A;  2E1C A;  4AIH A;  4XLN F;  4XRF A;  5HOO A;  2DLL A;  1J75 A;  2WC2 A;  5HLI A;  3MQ0 A;  3RJP A;  2CGP A;  4EGY A;  4UVA A;  3QU3 A;  1BI1 A;  3V7S A;  5AIP A;  4IHT A;  4LG0 B;  5ICC A;  3F8C A;  4CDG A;  1LB2 A;  1ZYR F;  2XRN A;  4KIB A;  4UV8 A;  5LHH A;  3LQR A;  1LEA A;  2D45 A;  1PP7 U;  4YFK F;  1I6X A;  4A0X A;  1TLH B;  2QUF A;  3IRQ A;  1RI7 A;  3LWF A;  4M71 A;  3ZMZ A;  3ZMU A;  5K1Y A;  2EB7 A;  2LSO A;  4CXF A;  3R0A A;  2QBY A;  1U2W A;  1I1S A;  2RVC A;  4L0Z B;  2B0L A;  3Q5F A;  3WOD F;  2E7X A;  4RAZ A;  1STZ A;  5ED4 A;  3TDZ C;  1FZP B;  3C18 A;  1SFE A;  3RPQ A;  3LAP A;  1U8R A;  2LNB A;  2ESN A;  3HYI A;  3M7G A;  4KIG A;  3K69 A;  4OIN F;  1YFH A;  5J8F A;  4H0E A;  1U5T A;  3CLO A;  4E70 A;  1T2K A;  4LLL A;  1B6A A;  4N0B A;  2PI0 A;  4G94 A;  1FP1 D;  2M1B A;  4F7Z A;  2NNN A;  1XGM A;  4EM1 A;  2R3S A;  4NB5 A; 
#chains in the Genus database with same CATH topology
 1UHW A;  3BR2 A;  3SFI A;  1GHC A;  5J40 A;  4OIQ F;  2CQK A;  2G7U A;  1IGN A;  1A31 A;  3DQV C;  2M8G X;  3I5U A;  3S8P A;  3CO6 C;  1ETQ A;  2K4J A;  4YEJ A;  3I0T A;  4BBR J;  1S7A A;  1G3Y A;  2HPM A;  2ZXJ A;  3PUB A;  4KT6 A;  2FBK A;  2K7L A;  1R5G A;  3J7A O;  3BZC A;  3FKJ A;  2LMD A;  4L9T A;  2LG4 A;  4E7H A;  2WV1 A;  1I50 J;  4JX6 A;  3EYY A;  3OWT A;  1GV5 A;  4LLN A;  3KP6 A;  3ZQ7 A;  3I9V 2;  3O8G A;  4I6Z A;  2Q1Z B;  1OIS A;  1GUU A;  1W7P D;  4A93 J;  1XMK A;  1TW2 A;  3U2R A;  4RB1 A;  5ILU A;  1SD4 A;  2JRT A;  2QYO A;  2V4J C;  3ERE D;  1T0F C;  3GEZ A;  2JPB A;  3CCQ I;  4OWR B;  4E6K G;  4NDL A;  2BYV E;  5EZH A;  4IOC F;  4F93 B;  5FLX K;  3CZ6 A;  1X3U A;  3I58 A;  2KJB A;  2PFB A;  4F52 A;  2Z99 A;  4PDK A;  1DUX C;  4EM2 A;  2LVS A;  1S29 A;  2O9L A;  2IGK A;  4XOP A;  2VQC A;  3F8M A;  4KIT B;  5LGT A;  5E3O A;  3H9G A;  5TRD A;  2DU9 A;  3JRA A;  3OV8 A;  1IUF A;  2GOX B;  1QHG A;  3OR1 C;  3QPT A;  1FYM A;  2HTJ A;  1W5C C;  4B3A A;  2PJP A;  3QOP A;  3JR9 A;  2CYY A;  2VPL A;  1D8J A;  2VBY A;  3K0L A;  1A35 A;  2HQR A;  3DPL C;  5FFZ A;  1RR8 C;  3HM5 A;  3ELK A;  3FK6 A;  3I59 A;  2XAU A;  4A6D A;  2HOE A;  2GA1 A;  4ZC3 A;  2FNP A;  3BR5 A;  4IL6 C;  1YRN A;  2P7V B;  2HYG D;  1JKQ C;  3UR3 C;  2O03 A;  3DCF A;  2XGC A;  1FP2 A;  3OL4 A;  2JA5 J;  1XGS A;  1J2X A;  2ECB A;  4IHS A;  3TED A;  3M4O J;  4M9Z A;  2OCC H;  3HZJ A;  5F0F A;  3VWB A;  1T56 A;  4LGW A;  1QU3 A;  2E7W A;  5A2Q K;  3EDP A;  3HC7 A;  2KT0 A;  4EJT A;  2YR2 A;  3O2P E;  4YEL A;  3N97 A;  1KQ9 A;  5H20 A;  2WAQ N;  3S3M A;  1BM9 A;  5J4Y A;  2HTS A;  3OYD A;  3N05 A;  3CMY A;  2NVT J;  3GXO A;  3ZN0 A;  3ESW B;  4MO7 A;  2K27 A;  2KZV A;  2DOD A;  1F9N A;  3CCU I;  3DKW A;  2JVH A;  4HW0 A;  2DXI A;  1KYZ A;  4HDV A;  4BQO A;  5L3E A;  3OOU A;  2R4G A;  1D1C A;  2A05 A;  2JT1 A;  4ZZD A;  5D5V B;  2XSJ C;  1OPC A;  3GWZ A;  2LF7 A;  1Q1V A;  1IN5 A;  2X6Y A;  5IP6 A;  1RUO A;  1ETV A;  2R7Z J;  2NVU B;  2K4B A;  1MIJ A;  1WJD A;  4A69 C;  5IYC J;  2DW4 A;  1I39 A;  1TT5 B;  1Y0N A;  5FO5 A;  3OS2 A;  1Z3Y A;  2WB1 A;  2IT0 A;  1HKQ A;  2KDO A;  4IVN A;  1ZG3 A;  3GTJ J;  3K4K A;  3MFK A;  1ZEL A;  1FTZ A;  5FD6 A;  2F48 A;  4UUS A;  1LDJ A;  1WJC A;  2GXB A;  2KJC A;  1IRZ A;  3M07 A;  1VQ6 I;  1O4X A;  1ZQ3 P;  4CO8 A;  1YW9 A;  1D8K A;  2ZCW A;  1HST A;  1OR7 C;  3RZD J;  2JN6 A;  1LDD A;  1XMX A;  2VJ4 A;  3M1E A;  3TBI A;  2DTZ A;  3FMS A;  4KN7 X;  2K9Q A;  2LRD A;  1KU7 A;  2H8R A;  2R7T A;  3BCA A;  1WVR A;  3A02 A;  3VOE A;  2PN6 A;  4BXX J;  5E17 F;  1EV7 A;  1G6N A;  2VQH A;  1V5G A;  1YW8 A;  1QRY A;  2KPM A;  3I59 B;  1K78 B;  3JAM Z;  1Z05 A;  2ESH A;  3EYI A;  4O3M A;  3ML6 A;  3W2W A;  3G1O A;  3H92 A;  2E1N A;  3Q0W A;  3K9T A;  4YFN F;  2A3S A;  2AS5 F;  1SFU A;  4D5C A;  4R1H A;  3L2R A;  3G73 A;  4UUV A;  4IQJ A;  2FQ4 A;  3K2Z A;  2HVS A;  4C2T A;  5EDN A;  1R22 A;  1HOM A;  2MGQ A;  4ZJZ A;  1G8X A;  3TW6 A;  1YW7 A;  1IAW A;  3FM3 A;  5KAI C;  2DQR A;  4FE7 A;  2NVX J;  3Q9V A;  2ICW G;  4DYC A;  3QRF F;  4IHW A;  4G7H F;  3S15 J;  1LVA A;  4NC8 A;  5LGU A;  4NNJ A;  3K1N A;  1Y39 A;  3RYP A;  1XSD A;  3BC8 A;  3C3W A;  4GYG A;  2HKX A;  2EIM H;  2X4H A;  5B5E C;  3DBL B;  2D2W A;  2JVG A;  2M8E A;  1HA8 A;  5ILV A;  1XS9 A;  1SFX A;  3HBL A;  4OOI A;  3ABU A;  4XN0 A;  3ZQF A;  3KCC A;  3LFU A;  4HV5 A;  3VYU B;  4AVZ A;  3S14 J;  2DMN A;  3KFW X;  4U0W A;  4PCQ A;  1POG A;  1ZR4 A;  4BS9 A;  3GLX A;  2LY2 A;  2DT5 A;  3PUF A;  4M6X A;  1SD6 A;  3MN2 A;  3I71 A;  3BRO A;  2LRE A;  3MVP A;  1SEU A;  4ZDO A;  4M9S A;  2X1C A;  2DOF A;  4YFX F;  4ZYH A;  3TO9 A;  3PO2 J;  1JKR C;  2JSC A;  4ZYG A;  3EQL F;  3LQQ A;  5HLH A;  4RBO A;  2M3A A;  1SFO J;  2JUC A;  3RI4 A;  3NAU A;  4XON A;  1FIA A;  2EV0 A;  2V1D A;  2XF7 A;  3K4J A;  4BHP A;  1PUF B;  3U1K A;  4Z2Y A;  2KRC A;  2OAZ A;  2O5R A;  1Y1W J;  3HRS A;  5GAG J;  1R00 A;  4JX4 A;  2Q2E B;  3BR0 A;  3NWS A;  1PUE E;  1QZZ A;  2VXZ A;  3HB9 A;  3CES A;  2E5N A;  3CCV I;  1WFX A;  5L3F A;  3K70 C;  2DAO A;  4E7S A;  2H94 A;  2VT2 A;  4N9I A;  1Z6T A;  3BR1 A;  4M72 A;  3ZOB A;  2STW A;  2EK5 A;  2ZJQ F;  3F23 A;  2R5Y B;  4DIQ A;  2R7F A;  3LFK A;  1TL8 A;  1UHS A;  4BXF A;  1S8N A;  5ICE A;  2RQP A;  3OYA A;  3S16 J;  4HG2 A;  3E97 A;  2MFZ A;  2LOO A;  1SAU A;  3SHF A;  4A0Y A;  2M4G A;  3HJE A;  1WI3 A;  3V8J A;  5GPC A;  2Z9O A;  2P8T A;  2FJ1 A;  1MD0 A;  3DEW A;  4Y3O A;  1ETO A;  2P7C B;  1XB4 A;  3P9C A;  1TWG J;  2MLG A;  1K61 A;  1AU7 A;  3RZO J;  2XB0 X;  2ME6 A;  1Z7U A;  4EJO A;  3O6B B;  2ID6 A;  1T39 A;  2P4W A;  1BJZ A;  2O3F A;  2VC0 A;  2KHM A;  4EQQ A;  4HNU A;  2RRE A;  2LR8 A;  3WGH A;  3OYC A;  2VE9 A;  3BY6 A;  4HLX A;  2UXX A;  5F64 A;  4CSW A;  3F21 A;  2NS8 A;  3L1P A;  1P7I A;  2BY0 A;  1TBX A;  5F0H A;  2FEZ A;  1WWX A;  4HF1 A;  4XM3 A;  5J47 A;  3CQZ J;  3LST A;  3BR6 A;  3WU1 B;  3I54 A;  4HX8 A;  4D7N A;  2F6C A;  2BOL A;  3KYD B;  1X3W B;  3DPT A;  3IKV A;  4N9H A;  5DV5 A;  3VOD A;  3QYF A;  2K9M A;  2X6W A;  5D4S A;  1DU6 A;  2WV0 A;  2BXZ A;  2W85 A;  1EH7 A;  4RA2 A;  4MEY F;  4V2G A;  3MZ8 A;  4ESJ A;  1VND A;  4XK4 A;  2R7O A;  5EF6 A;  3G1M A;  1UCR A;  2W24 A;  4P55 A;  3OYB A;  3KLO A;  2V1N A;  2QWW A;  3W6V A;  2HXI A;  3CJR B;  3IH2 A;  2K9N A;  2JUG A;  5DEQ A;  1K4S A;  5JHF A;  2R7V A;  5K5R A;  1S9H A;  2LP0 A;  1E17 A;  2WAQ A;  3H9Q A;  2GWR A;  2H6B A;  2VI6 A;  5FKM A;  1V5F A;  2ZNZ A;  4RM2 A;  4O6J A;  4AID A;  3EUH C;  3SZG A;  1R36 A;  4HF2 A;  1Z1D A;  3CP2 A;  3J81 K;  4A6E A;  1FYL A;  4F55 A;  1USS A;  1X2N A;  3JSP A;  2R7X A;  2CQX A;  4J19 A;  4RS8 A;  1S7O A;  2LBF A;  4B09 A;  2F4M B;  1XPX A;  4FHT A;  1SD5 A;  2VB6 A;  3BTJ A;  3O3K A;  5K5O A;  2AQF A;  5M3M J;  2RC4 A;  3DLA A;  1FSH A;  3OYE A;  3J7Y J;  5EG0 A;  2EWN A;  4N4O B;  1IXS B;  1E3P A;  2YPR A;  2WA0 A;  4AUX A;  2ZXI A;  2HYF A;  2EJR A;  3HHH A;  3W3C A;  4NC6 A;  1VQ7 I;  5DD4 A;  1ZG5 A;  1GXQ A;  1A6Q A;  1P4X A;  2Q0O A;  4B48 A;  3V42 A;  5IT3 A;  3R60 A;  3NQO A;  1W7P B;  2F5D A;  2OF7 A;  3MCZ A;  4A3I J;  1Y8R B;  2QQA A;  2XAH A;  4ESF A;  3ZXS A;  5BPD A;  3GTL J;  4DJA A;  2Z16 A;  4A3G J;  1RPW A;  2I8D A;  1R5H A;  3BDD A;  3CDI A;  4LG0 A;  3TKY A;  3LMM A;  4GYI A;  5JR3 A;  1WJA A;  2CUJ A;  2CS3 A;  1KZH A;  5JVT A;  3CDL A;  5BOX A;  1QBJ A;  3F6V A;  5IT9 K;  2HNH A;  4KT5 C;  2MG4 A;  2MH9 A;  1OQY A;  2W00 A;  5M5W J;  1GVJ A;  2FOK A;  2P5V A;  1VQ4 I;  4B4C A;  5HLT A;  3KP7 A;  3N4M A;  1IN8 A;  4U7D A;  5GAE J;  3FF5 A;  2JSP A;  3KEY A;  4D5F A;  5F27 A;  5D5X B;  3S1R J;  2JK3 A;  2NS7 A;  3HEF A;  2IS6 A;  4ESB A;  4IQ4 A;  3QWL A;  4XOR A;  1RR7 A;  1BOB A;  4XOT A;  2MD0 A;  2VUM J;  2XVC A;  4RGR A;  5D8K B;  4XLA A;  1GXP A;  4UHT A;  2Y30 A;  2KIQ A;  1WI9 A;  2W25 A;  2FX0 A;  2PLY A;  3GFJ A;  1CGP A;  3H3U A;  5E1W A;  1VF9 A;  4LG3 A;  2DN0 A;  2IGN A;  4Y52 J;  3JRI A;  3DTE A;  4LB6 B;  3IAM 2;  4OU0 A;  2BVL A;  2H09 A;  3OOP A;  4LOC A;  5B3S H;  2OUM A;  1XCB A;  2H6C A;  4KIC A;  2L01 A;  5HNH A;  3BJ6 A;  2FUG 2;  2VJI A;  3R61 A;  1KA8 A;  1ORK A;  2GIZ A;  2E1M C;  2QA4 I;  2YX4 A;  1ZTR A;  3QP6 A;  3TGN A;  5EJC A;  4ZTJ A;  2WAE A;  1UZC A;  4MHG A;  4RGS A;  4BE0 A;  3GVA A;  3UNG C;  1FOK A;  1XD7 A;  1U5T C;  1FSE A;  2CQQ A;  1I3Q J;  4CIC A;  1MMG A;  2MAB A;  3HOW J;  2QSH X;  2QF7 A;  3M8J A;  3D0S A;  3W2V A;  3WTZ A;  3S3N A;  2DPU A;  1JUP A;  1YIO A;  2LY9 A;  1N75 A;  3CUQ C;  3BG3 A;  5BQT A;  3G2B A;  2RAE A;  1Z67 A;  1KON A;  2ZSI B;  3VB2 A;  3GF2 A;  1HW2 A;  5FLM J;  4BDY A;  1O3R A;  1HC8 A;  4BDZ A;  4A5M A;  1U3E M;  2LTP A;  1BC7 C;  2IGO A;  1LJ9 A;  3F3X A;  2BVM A;  4WK8 F;  1ONV A;  4CCN A;  2HOT A;  3IH4 A;  2WY8 Q;  2QCO A;  2ZSH B;  5K5Q A;  4HNT A;  2L7K A;  3GFI A;  2HGC A;  2ELH A;  1BOA A;  3IKT A;  3GFM A;  3OIO A;  2AXL A;  3W2A A;  2JTV A;  1ON1 A;  4A12 A;  1TQI A;  4BAY A;  3O8H A;  1PVE A;  1WGX A;  2I10 A;  3ZMS A;  4JK1 X;  3OYL A;  3HG9 A;  2XRL A;  1K6O A;  1S5L C;  3E1S A;  3BP8 A;  4B1R A;  1JUM A;  1O7L A;  2M0C A;  4Y7N J;  4EAT A;  4I98 B;  5B1B H;  1J0R A;  1P2F A;  4E7I A;  2QEX I;  2Y75 A;  1XDU A;  4DYR A;  2O0Y A;  1JTY A;  3X2Q H;  2R7U A;  2EIL H;  1MJ9 A;  2Z5U A;  4I02 A;  2EFN A;  2BY2 A;  3T1B A;  3VSL A;  1P7J A;  2KMU A;  3BPV A;  3F9K A;  2XHK A;  4OIP F;  3SFZ A;  4G7Z F;  2QEN A;  1ZH5 A;  4LMY A;  3HOU J;  3V8L A;  2WY7 Q;  3KZZ A;  2LF8 A;  4KUM A;  3CC4 I;  1B4A A;  1UB9 A;  4RAG A;  2KKO A;  2VOO A;  2STT A;  1D5V A;  1GLN A;  4LIT A;  1HSJ A;  1XDS A;  1V4R A;  3R4K A;  2UZK A;  1R49 A;  5KCM A;  2ACJ A;  4BE2 A;  3DKX A;  3TO6 A;  5JI6 A;  4E7L A;  2DFI A;  1E0E A;  2ELK A;  1HDD C;  2CJJ A;  1YJW I;  2R7D A;  3JCU C;  3PM1 A;  1ZK8 A;  3DLL F;  3M1C A;  3OIP A;  5DDG A;  2R7S A;  4RLF A;  1QHH D;  2DI3 A;  1W0T A;  1X3Z B;  5JFR A;  1YE9 A;  5M3F J;  2R92 J;  1LFP A;  4HRI A;  1YJN I;  3RCO A;  1NTC A;  2O8K A;  1FOY A;  4C2M J;  3V7C A;  2OQG A;  2VBZ A;  2LKP A;  3JW4 A;  2COB A;  5CVU A;  1V55 H;  2OZU A;  4A3F J;  3JTG A;  5E3L A;  4XKV A;  5B66 C;  4NBQ A;  1U6G A;  4EV0 A;  2LD5 A;  3I3L A;  5F1R A;  1ZG1 A;  1MBE A;  5DTD A;  2QGU A;  2UUZ A;  2XIG A;  1BN5 A;  3LA2 A;  5HNF A;  2DA2 A;  1FJL A;  4ON0 A;  1YG2 A;  2RNJ A;  1LEB A;  4E7Z A;  2L9R A;  4PSW A;  4MQ9 F;  1VI0 A;  2BW3 A;  2XPW A;  3V8K A;  3BJA A;  3AG3 H;  1G4D A;  4XSZ F;  4C3J J;  2M34 A;  4DW6 A;  3WTT C;  4G6Q A;  1PP8 F;  1JKP C;  3RPU A;  4V2F A;  4LLG F;  2NYX A;  2EZH A;  4L5E A;  4EGZ A;  3FXU A;  3ZMV A;  1JXS A;  3OSF A;  3FMR A;  1RZ4 A;  1G59 A;  4CH7 A;  5JLW A;  3OYN A;  2DYR H;  4BJ6 C;  4Z6Y A;  2A5W A;  4Q4Z F;  4LJZ F;  1BI0 A;  4BY1 J;  2GZW A;  1VQ9 I;  2K5C A;  1UJ8 A;  1H9G A;  4PZJ A;  3AL0 B;  1TC3 C;  1R1V A;  2E2H J;  3HGY A;  2EZI A;  4WX9 A;  1FBU A;  4IHV A;  3ZGK A;  4RB3 C;  1RUN A;  1FIP A;  2CUF A;  1IRF A;  3ZQH A;  1FTT A;  1BL0 A;  3F6O A;  1JHH A;  2R7Q A;  3CCJ I;  4KYW A;  1ON2 A;  4RGX A;  4N4N B;  3SJM A;  1SC7 A;  5IP9 J;  1X1C A;  2VXD A;  2KRH A;  3TW7 A;  3KPH A;  2X51 A;  4D9J A;  3Q9S A;  3GTM J;  1S3J A;  3QPS A;  2XRO A;  1W5S A;  1JE8 A;  4BJ5 C;  3EUA A;  2ZC2 A;  3GYH X;  1IJW C;  2DQL A;  3OYM A;  3GZN B;  1UST A;  5K7F A;  1BC8 C;  2ETH A;  1GV2 A;  1ZAO A;  4RM3 A;  1K78 A;  1ERD A;  1JTX A;  2BXY A;  2OC6 A;  1DU0 A;  4I09 A;  3S17 J;  4DGW B;  3AFH A;  5IP7 J;  4D1Q A;  3D5R C;  5D4R A;  1MDM B;  4L0Y B;  5HS7 A;  5LGN A;  5CVI A;  3H0D A;  5C4X J;  1Z3X A;  4WWC A;  2ME0 A;  3B6A A;  5C3E J;  1G3S A;  4HQM A;  1LDK B;  2AHQ A;  1XSX A;  2VL8 A;  5IYB J;  4BGD A;  1EH6 A;  2LY1 A;  4LK0 F;  4RLQ A;  2V9P A;  2CV2 A;  1O57 A;  2ZKZ A;  3WE3 A;  1IZ1 A;  1XMA A;  1SMT A;  2Y69 H;  3B6C A;  2JPC A;  4OMZ A;  5CVJ A;  2BHY A;  2BW3 B;  3D1N I;  3FXK A;  3CUQ B;  3LSR A;  2CG4 A;  1OFC X;  1REP C;  1QPI A;  5FLX Z;  1LUJ B;  3HPG A;  1LFB A;  1IN7 A;  3JRH A;  4BH9 A;  2XPU A;  3U9G A;  3MKL A;  3LNQ A;  1WRJ A;  2V9V A;  3J80 K;  2V79 A;  4XKB A;  2LC2 A;  2VQL A;  2MC3 A;  5E8I A;  2E5Z A;  1AHD P;  3G4S I;  1BW6 A;  1MNE A;  3FXO A;  3VYR B;  4A3E J;  3CJQ B;  1RES A;  3HRT A;  2CUE A;  1D3Y A;  2LK2 A;  2KRF A;  3K70 D;  3WTW C;  3PSI A;  1QZY A;  4IPA A;  1YJ9 I;  4CCK A;  2F5F A;  1IRG A;  4LFU A;  3BG9 A;  2CU7 A;  2F5V A;  3CCE I;  4CYC B;  4IKF A;  4FCY A;  3A1Y A;  3BT9 A;  2PMZ N;  3I64 A;  1L0O C;  1FNN A;  1MMD A;  2K9L A;  3LSM A;  3K1P A;  3K4C A;  2JA2 A;  3ZN1 A;  1PUF A;  1WZ2 A;  1MBH A;  2HR3 A;  3S32 A;  3E5X A;  3FIW A;  1TQP A;  2EPF A;  4ZDP A;  1J9I A;  1ZRC A;  3ONQ A;  1JJ6 C;  2Y0S N;  1J5Y A;  2PQ8 A;  2Q2E A;  1QZE A;  1T0F A;  2NVY J;  5D8L B;  1UEL B;  1S7E A;  2CSO A;  2FF4 A;  3OR2 C;  5E3M A;  3PQJ A;  5A2Q Z;  2CFX A;  4XLE A;  1M1E B;  1U9O A;  2DK5 A;  2IJL A;  2OPT A;  4MFE A;  2EFP A;  1IXC A;  4B44 A;  2VIX A;  2R5Y A;  3S2H J;  1KU2 A;  3HSE A;  1QVT A;  2MA3 A;  1CQT A;  3HRU A;  2P0W A;  5E1Z B;  1IXR C;  2H27 A;  4IRH A;  1K79 A;  2QQB A;  4P96 A;  2VQG A;  3E7L A;  1ZN2 A;  1WH7 A;  3PFI A;  2ZME C;  3E5Q A;  3HIF A;  3ZMD A;  4R79 A;  2D1V A;  3HGG A;  3QQA A;  2XKO A;  1Y6I A;  3COA C;  1YQA A;  4FTH A;  3DKY A;  1SVM A;  3FM5 A;  2GQQ A;  2GIV A;  1APL C;  3QOD A;  3RQI A;  3WHC A;  1OCC H;  2Y2Z A;  4CUG A;  3KYC B;  1NK2 P;  4PGG A;  4FX0 A;  3GCM A;  3DXJ F;  3EUK L;  2JMW A;  4IF4 A;  3H9J A;  4F3Q A;  2CV0 A;  4OIR F;  1QO0 D;  2ZJ2 A;  1HKS A;  1KGS A;  1Z21 A;  5AON A;  1K6Y A;  3KE2 A;  2NVQ J;  3AG2 H;  1MZB A;  2CQN A;  2IS2 A;  2F5E A;  3MMY B;  3VDX A;  2DA6 A;  4DZJ A;  4MEX F;  4JX5 A;  2E36 A;  4AIK A;  2Y9Y A;  4P1W A;  3M8E A;  4RMN A;  3DU6 A;  3EET A;  1OCO H;  4GXO A;  1NHA A;  2OU2 A;  3BR3 A;  1VFC A;  4UNO A;  1D0Y A;  2X6O A;  2EFW A;  5IY5 H;  5K7Z A;  3P7N A;  4XLC A;  4AYB N;  2XV4 S;  1ETX A;  3NWT A;  1MBJ A;  2R93 J;  1DQU A;  3PJR A;  4I2O A;  4YIR X;  3V4G A;  3HOX J;  3MWM A;  4P5O A;  2CUZ A;  3PIP F;  1P4A A;  3KP4 A;  1RIO H;  2P5K A;  3GME A;  3HOS A;  2HKO A;  2Z2S B;  2B7E A;  1JI8 A;  3BG5 A;  2MD5 A;  3MZY A;  2D5V A;  5F04 A;  3BQZ A;  3ZQQ A;  1IV6 A;  2X6X A;  1FPQ A;  4JBA A;  1X19 A;  2FBH A;  1X2M A;  4HOB A;  1T38 A;  2CQ7 A;  5EYR A;  3T8T A;  2FXA A;  2XDV A;  1ENH A;  5J1R A;  1VQP I;  3WTS C;  4A3J J;  1ZR2 A;  1O3S A;  4BAC A;  1ETY A;  4QTR A;  3RKQ A;  4M3F A;  2RN7 A;  3GBG A;  2AO9 A;  1OCZ H;  3H5N A;  4OAY A;  2HI3 A;  3JRD A;  1IUY A;  1W7P A;  2NNY A;  2EV5 A;  5J4V A;  1JGS A;  1FBQ A;  1OR7 A;  2W1O A;  3PFY A;  4XSX F;  3MKW B;  2PMH A;  1K7A A;  1YI2 I;  1MNM C;  2NRA C;  2IA0 A;  1E2X A;  2IW5 A;  1HW1 A;  3SYT A;  1TW3 A;  1TP4 A;  4I0B A;  1BR2 A;  1XSV A;  2J5O A;  1D0Z A;  1LFU P;  2FOW A;  1X4P A;  4V19 K;  1NG7 A;  3Q0V A;  3WTU C;  1YX5 A;  2GOM A;  3BG6 A;  1WJE A;  1I5Z A;  2QZ8 A;  3CO7 C;  1G3W A;  5BS6 A;  1LNW A;  5CJ9 A;  3ECO A;  2A6E F;  5LFA A;  4G12 A;  3GTP J;  1X1P A;  4ENJ A;  3E6D A;  5FJ8 J;  1H8A C;  4W1U A;  2L5Q A;  4WF2 A;  2BE5 F;  4A3D J;  1DP7 P;  3DEU A;  2LDU A;  4CGZ A;  2IA2 A;  3FK7 A;  2HWV A;  2Q8K A;  3RKX A;  1B59 A;  1U78 A;  1R71 A;  4A3B J;  2ZXW H;  3F8B A;  3BLY A;  3DWL E;  4M9X A;  1JKO C;  1IW7 F;  3LSK A;  4IZZ A;  3HOY J;  4P9U A;  3ZR8 X;  3CD6 I;  2G7H A;  1ZAR A;  2CV1 A;  1KQ0 A;  1BIB A;  1Q1H A;  1VQ8 I;  1D0X A;  5EEG A;  2HDC A;  4IOA F;  4E7J A;  2HDD A;  3KET A;  2HXO A;  3H35 A;  2GLO A;  2V7F A;  3H5A A;  2WWY A;  5M5X J;  3OYJ A;  2V6C A;  3IL2 A;  3LAJ A;  3IWF A;  4S0H B;  1RNL A;  2X1D A;  3WE2 A;  2K9S A;  1QVU A;  2A68 F;  2D1H A;  2KIF A;  3HOT A;  5BNG A;  1SD7 A;  2MH2 A;  1YIJ I;  3CC7 I;  2PJR A;  3DF8 A;  4ABZ A;  3BCB A;  3QOE A;  3KLN A;  1T98 A;  1SFK A;  2RNG A;  3MAJ A;  1DGW Y;  1P9Q C;  3VPR A;  5ILS A;  4MNU A;  2GA2 A;  4AC0 A;  3REO A;  4C3H J;  3HTS B;  1ZGA A;  2VKV A;  5LLQ A;  3LSI A;  4AIJ A;  2E19 A;  4J01 A;  2EBI A;  2KDZ A;  3TOA A;  1HXD A;  5E1X A;  1P6R A;  4ENK A;  3SDG A;  4C9Y A;  3HL2 A;  5TGT A;  4A3K J;  2LH9 A;  4OAZ A;  1IO2 A;  1WJ5 A;  5KVR A;  1YS6 A;  4L5I A;  2PMZ A;  3F0C A;  3S3O A;  1H0M A;  1X1A A;  3ZPL A;  1CF7 B;  4WCG A;  3DP7 A;  5ICF A;  5LHI A;  3IRR A;  1RRJ A;  5L3B A;  1U8B A;  2XAG A;  1MSE C;  2Y0S A;  4GCV A;  3M3Y J;  2ELJ A;  4ASN A;  1ZRD A;  1H89 C;  2RGV A;  2DDB A;  3CMM A;  4RDU A;  4L18 B;  3PNV A;  2HQ5 A;  3GW2 A;  4BE1 A;  4PGH A;  4DZP A;  2DJN A;  2J5P A;  3BTL A;  1TNS A;  5TJJ A;  1GT0 C;  2QLZ A;  2CMP A;  2ZME B;  4XRM A;  4I7H A;  2TRT A;  4F91 B;  1ETK A;  2ZFW A;  4R8H A;  2MSY A;  3BG7 A;  3FMQ A;  4ZDL A;  5LEJ A;  3L7W A;  4HEA 2;  3GO5 A;  5EEA A;  2OQR A;  2UV1 A;  3J81 Z;  2W84 A;  1X58 A;  4MFD A;  5LHG A;  3GFL A;  1WSU A;  4M3B A;  3B02 A;  2JJ7 A;  4KNY A;  5HS9 A;  3WTX C;  4IHX A;  4DYQ A;  4GGG A;  3GZ6 A;  2X0L A;  1MJB A;  2IA1 A;  2DO7 A;  4L9V A;  4Y17 A;  3MZH A;  2DT6 A;  4PJJ A;  5GP9 A;  5D5U B;  1UFM A;  3RDI A;  1MGT A;  5B1A H;  1SMY F;  2VKD A;  1O7F A;  4PK4 A;  5KK1 A;  3IV5 A;  1Z6R A;  2BHZ A;  4UB8 C;  4II2 A;  2Y9Z A;  1FOW A;  2IGM A;  1EH8 A;  4S05 A;  4Y15 A;  2PG4 A;  4Q5S F;  2GAU A;  2XAJ A;  4BQA A;  3FXM A;  3G71 I;  3QYE A;  3M8F A;  2YS9 A;  2L7M P;  2EZL A;  3C2H A;  2WBM A;  4RB2 C;  2L02 A;  3WTV C;  1OJL A;  1D1A A;  3QPH A;  3GX4 X;  2PJR B;  5KHD A;  4I99 C;  3S93 A;  3S1M J;  4BNC A;  4UXN A;  2M45 A;  2LKS A;  1OCP A;  1XC5 A;  1E3O C;  2L3D A;  2XGX A;  1W4M A;  3ASN H;  1VQM I;  4C2U A;  1KU9 A;  4XKC A;  3B73 A;  3FDY A;  5IT9 Z;  3K6G A;  1I1G A;  5AIQ A;  1SVO A;  2B9S A;  3K7A J;  2V1X A;  3T5X A;  2L9S A;  3TO7 A;  4BHB A;  4AYB A;  3DBH B;  4RAY A;  3WU2 C;  2EA2 A;  2V6E A;  1W36 C;  1OYI A;  5H6Q A;  3SZT A;  2OV7 A;  4OMY A;  4WXD A;  4HF0 A;  3R6S A;  3H3Z A;  3I4P A;  4F92 B;  1OMI A;  1F36 A;  4LIU A;  4HSR A;  1QNT A;  5F6F A;  1JHF A;  3T8R A;  4BEH A;  2H1K A;  1BBY A;  3FXQ A;  2QSF X;  1C0W A;  5F0C A;  1FEX A;  4OIO F;  1W1W E;  1LQ1 A;  3C2B A;  3E0J B;  4TV7 A;  1J7K A;  4G8X A;  2EFQ A;  5L3D A;  3VYS B;  2CW0 F;  3VSK A;  2IAI A;  2R7W A;  3MKY B;  4CHU A;  2BV6 A;  4WXC A;  5GAH J;  1FX7 A;  5EGO A;  1R23 A;  2DMU A;  1MMA A;  3CCM I;  4EVI A;  3PIO F;  1GVD A;  2Y48 A;  1FLI A;  4MLO A;  2K85 A;  4AD9 A;  2ZO4 A;  3FIS A;  3K4B A;  2XAS A;  1EKE A;  2V9K A;  3C2G A;  1MJA A;  2XUB A;  4O5V A;  5H6R A;  3KIO A;  5E3N A;  2FA5 A;  4C30 A;  4ZYD A;  2OA4 A;  1FC3 A;  4FET A;  1WJF A;  2ADU A;  5DCM B;  3NAR A;  3FXJ A;  2DOA A;  3QP5 A;  4NQW B;  1YIT I;  2L9N A;  2A61 A;  1R1T A;  1XX5 A;  2HYJ A;  5J8C A;  1AKH B;  1QPM A;  4BU2 A;  4U7B A;  5FKL A;  3K4M A;  3WU0 A;  3D5L A;  3A0H C;  1RKT A;  2YU9 J;  4MGR A;  1EJ9 A;  2DFF A;  1XGO A;  2GXA A;  3OYH A;  3CMA I;  4PFO A;  4FAS D;  1DGR M;  3L9F A;  3HUG B;  1H9T A;  2IVM A;  4KA4 A;  4Q48 A;  3I4N J;  2K86 A;  2M87 A;  3WHB A;  1QQI A;  2O7O A;  4IRG A;  1ZHF A;  1S72 I;  2M5W A;  1MDM A;  2ISY A;  5HS8 A;  2Y31 A;  1Z91 A;  3P9K A;  4M6V A;  4EM0 B;  3RTR A;  3FKI J;  1NH3 A;  1D5Y A;  4CYD A;  2FML A;  2DCE A;  5FD5 A;  3GUD A;  5E8G A;  4X6A J;  4PJL A;  5F08 A;  4M3G A;  1Y0U A;  3W6J B;  2BEO A;  1S6L A;  4CZZ A;  5HVQ C;  4JP0 A;  4BEH B;  3JRG A;  3E6B A;  4IHY A;  1WPK A;  3OS1 A;  2IRF G;  4A5N A;  1ETW A;  5IPA A;  1IC8 A;  4E7K A;  1MH3 A;  3CUQ A;  1JT6 A;  2LLK A;  4D7M A;  5L3G A;  1SVL A;  1UAA A;  1QGP A;  3NEU A;  3S2W A;  3JSO A;  2EIJ H;  3LSP A;  3DPU A;  4HV6 A;  1B72 B;  2VAS A;  3FBN B;  5FKO A;  2ZFU A;  3KZI C;  4BQQ A;  1FWZ A;  2EQR A;  2M7B A;  4KJZ A;  1YLF A;  5EGO B;  3DU5 A;  5IOY A;  3VYT B;  5H2F C;  4LK1 F;  3KZY A;  2HQN A;  3TDU C;  1IN6 A;  4B3X A;  4L5J A;  5BPI A;  3RQ4 A;  3LSH A;  1AA7 A;  3L2C A;  1HBX G;  3OYF A;  2MC4 A;  2IS4 A;  1TTY A;  2QVO A;  3A03 A;  3SXY A;  5F1J A;  2HFH A;  3IAS 2;  1WJB A;  3AKZ A;  1PDN C;  2TCT A;  2MYS A;  1OCR H;  3KP2 A;  2CO5 A;  4CYC A;  2COM A;  3WGG A;  2QSG X;  2HQA A;  2JA6 J;  1R7J A;  1AWC A;  2XAF A;  4XKW A;  3H5R A;  3CF2 A;  3GTK J;  2HVQ A;  3E5U A;  2QBY B;  3WG9 A;  3BQY A;  3M9A A;  3TQN A;  1BR1 A;  1DP3 A;  2FD5 A;  2ZXH A;  5HLG A;  2WAF A;  3FHN A;  3A0B C;  1MBF A;  2KIS A;  5GTI C;  4J00 A;  5GAD J;  5JHU A;  4I0A A;  2UXN A;  4HZF A;  1UG2 A;  2HZT A;  2YX7 A;  3HHG A;  2BGC A;  3IUO A;  2VOP A;  5L3C A;  1J59 A;  3GTQ J;  3CCR I;  4B43 A;  1BI2 A;  1NK3 P;  2XB5 A;  3GZ5 A;  1ZGW A;  2RV8 A;  4KIF A;  5ICG A;  2E1M B;  2A5Y B;  4YG2 F;  1WCM J;  2JA7 J;  3LA7 A;  4XR6 A;  4HQE A;  1JGG A;  5FRO A;  1IF1 A;  2NOJ B;  2VJJ A;  1WH5 A;  2DPD A;  2GXG A;  2OCE A;  1U5T B;  3G1L A;  3ULQ B;  3HTU A;  3LA3 A;  4A0Z A;  4Q47 A;  2BY3 A;  3I56 I;  1YO5 C;  1OYY A;  1N25 A;  4RB0 A;  4A3C J;  2EA4 A;  1MW7 A;  4XLP F;  4BQN A;  5IOZ A;  2K02 A;  3E6M A;  3SDB A;  4BHC A;  1DDN A;  2E71 A;  2OZ6 A;  1ODD A;  4H4K C;  1WHU A;  4ANJ A;  2F2E A;  1NG6 A;  4AVP A;  4NC7 A;  4IX7 A;  1A5J A;  4HLY A;  4ETS A;  4KMU X;  2KQR A;  2VT3 A;  3CC2 I;  2EV6 A;  4BXU A;  1ZLJ A;  4CA0 A;  3CTA A;  4U0Y A;  2E2I J;  3KP5 A;  5E79 C;  4M73 A;  3OYI A;  3ZQC A;  3JAM K;  2DBB A;  2WTE A;  4PJ0 C;  4PSX A;  4WXH A;  5LD2 C;  1TWA J;  1UMQ A;  2JWT A;  2DMP A;  3JRE A;  3LL7 A;  5IYD J;  1FT9 A;  3FHZ A;  1Z0X A;  2VJ5 A;  4Y4R A;  3MEX A;  1TT0 A;  4ZYE A;  5J3L A;  2KP6 A;  4HA8 A;  1TWC J;  1Y56 A;  5CKT A;  2CW7 A;  1F43 A;  3L2W A;  1Z7L A;  2HEO A;  4EJU A;  1IRX A;  2VKE A;  5HDN A;  3JRF A;  3DBR B;  3PQK A;  4IJA A;  2M0M A;  4HAM A;  3NRV A;  2FU4 A;  2DMQ A;  3HKZ N;  3HSR A;  5CVR A;  1GDT A;  4EMS A;  4ZZL A;  3E6C C;  4PJM A;  4U0V A;  1F1Z A;  1KQ8 A;  2FBI A;  2KIM A;  3FX3 A;  1R58 A;  4L9J A;  5HDG A;  3V7R A;  4HYE A;  2ID3 A;  1WKM A;  5ERI A;  3GTG J;  1U9N A;  2NXN B;  1ZLK A;  4G9Y A;  2FRH A;  1I3A A;  3QAH A;  2KZG A;  4HBL A;  3F8N A;  5E20 A;  2VC1 A;  2HU9 A;  4MTD A;  2W7N A;  1HQC A;  4XNF A;  3F72 A;  3ZP5 A;  4A2U A;  1YYV A;  1HF0 A;  5KNL A;  1V54 H;  3ECH A;  2BZT A;  1T6S A;  1HLV A;  2XGE A;  4XN3 A;  3OY9 A;  3SEZ A;  1N77 A;  4CCM A;  1ULY A;  5FKN A;  1MBG A;  3K1M A;  2F4O B;  3J80 Z;  3CCL I;  1FY7 A;  3QU6 A;  5DD8 A;  5CVV A;  2OBP A;  4YIF A;  3K4L A;  1YRN B;  1MKM A;  3VFZ A;  1F5T A;  2R0Q C;  1FMW A;  2O6G E;  1BJA A;  3ZCO A;  5GPA A;  2ZNY A;  1R4M B;  2VE8 A;  3R0J A;  2CH0 A;  2NAZ A;  2RDP A;  5FLV A;  2KL4 A;  2TDX A;  5BMZ A;  3ABM H;  5CLS A;  5LEK A;  2KLO A;  3H3V K;  1R5I D;  4BYY A;  1VTN C;  4UV9 A;  1B9M A;  1BIA A;  3CUO A;  1P4W A;  3FXL A;  4UB6 C;  2H8W A;  3A2K A;  4GO1 A;  1TNT A;  1UG0 A;  1OCT C;  1V3F A;  1W5T A;  4G6T B;  1X4O A;  2G9W A;  1K4T A;  2A07 F;  1T33 A;  2LYC A;  4IRI A;  2W82 A;  4PUS A;  4ENM A;  5C4J J;  2BY1 A;  3KP3 A;  2JA8 J;  1AOY A;  1IG7 A;  4G7O F;  3ROU A;  2QQ8 A;  3J7A Y;  2X48 A;  2L7Z A;  2QKL B;  1X1B A;  3CJT B;  2E1O A;  4ZTF A;  2VN2 A;  5DM7 F;  2QKM B;  2L7F P;  1OKR A;  2PBI A;  2L2O A;  3QPL A;  2ZB9 A;  4X0G A;  4S04 A;  1DPU A;  2X1E A;  2ZJR F;  4U88 A;  2GM4 A;  4E4H A;  2I5U A;  1TQM A;  4L9N A;  3Q3S A;  4ITV A;  3FWE A;  2L54 A;  4HNV A;  1G3T A;  1FYK A;  4LD5 A;  4XLH A;  2IPQ X;  3TOB A;  2W48 A;  5FGM A;  4QSH A;  4DBQ A;  1ITY A;  3CP8 A;  2ISZ A;  2MLK A;  2XF5 A;  2XAQ A;  1VZ0 A;  4UUS B;  3PO3 J;  1R9T J;  1BI3 A;  3BJO A;  1OYW A;  3L09 A;  2EFO A;  1LE8 A;  1VQN I;  4I76 A;  4KN4 X;  1ZRF A;  2UWM A;  1FOX A;  1T8I A;  5DUI A;  3LSG A;  2QQ9 A;  4HX7 A;  2VBX A;  4U87 A;  2OD5 A;  2DK8 A;  3HRM A;  2O8X A;  4DOZ A;  1YTY A;  2NOG A;  4JYK A;  1XN7 A;  2EH3 A;  1VQO I;  4JQF A;  4II3 A;  2K3F A;  3BWG A;  1Z9C A;  1XGN A;  3FXR A;  3VEP A;  2FMY A;  4C3I J;  1HCR A;  1BR4 A;  1CF7 A;  4B8X A;  3CJN A;  4LB5 A;  3MD2 A;  3SZP A;  5DUK A;  2E2J J;  5LRR A;  3CCY A;  3P5J A;  4EJW A;  2P5L C;  1TZL A;  2LFB A;  3IP4 B;  2MBF A;  2VLA A;  3FZV A;  2FQ3 A;  3OSG A;  4UY8 I;  3T0Y A;  1K83 J;  1B1B A;  2L0K A;  3LOC A;  3S2D J;  3ZMT A;  4A3L J;  3IWZ A;  1B9N A;  2ZME A;  3S1Q J;  4KDP A;  1XCV A;  1R1U A;  3TP0 A;  2EIN H;  1HDP A;  2M4K A;  3RKW A;  3HOZ J;  2Y0M A;  4D0P A;  5FRM A;  1KU3 A;  1SAX A;  2YU3 A;  1Y8Q B;  3F8F A;  1SAN A;  1ZKG A;  5D5W B;  3I4M J;  1ZGJ A;  2YUS A;  1X1D A;  3DTI A;  4YII A;  4JOM A;  4BJT A;  3SQN A;  1TWH J;  5CQE A;  3L2U A;  4M74 A;  1P92 A;  9ANT A;  2DTR A;  2AXT C;  4A3M J;  2IXS A;  1L3L A;  2M30 A;  2FNA A;  3IH3 A;  4CCJ A;  1XTA A;  5J1U A;  3OYG A;  1XG1 A;  2E34 A;  5LBQ A;  4QPQ A;  2OTL I;  2OTJ I;  3ASO H;  4DBR A;  4NHJ A;  2A6T A;  3E3V A;  4RAF A;  3W6K B;  2VBW A;  1TWF J;  5FRN A;  4Y13 A;  1I27 A;  1YS7 A;  3U1D A;  3HPH A;  2ECC A;  3H36 A;  3DEE A;  4HX4 A;  1B8I A;  1W36 D;  3DTK A;  4EJV A;  5CYV A;  2V1U A;  5D6F A;  3C1D A;  1U0J A;  1RC9 A;  3ABL H;  2G0E A;  3KX2 A;  4P9F A;  1A36 A;  1IN4 A;  3CDH A;  4W97 A;  4M6Y A;  1WQ2 A;  3I53 A;  1O3T A;  3AG1 H;  4FQG A;  2A69 F;  3CLQ A;  1IDZ A;  1QA6 A;  2K40 A;  1LE8 B;  4KFC A;  4G6D A;  4AM3 A;  2R7R A;  3BTC A;  3PSF A;  4MQV A;  4IO9 F;  2W57 A;  4QIW N;  2JRM A;  3RPU D;  4FT8 A;  3ZQG A;  2VON A;  2F4I A;  2QM3 A;  4EEF G;  2JZY A;  3HSF A;  1HW5 A;  3GTO J;  4DNC A;  5EEH A;  2XKP A;  2Z33 A;  1H88 C;  2CRG A;  3HKZ A;  1G2H A;  1F4K A;  4K2E A;  3JRC A;  4RGU A;  3AG4 H;  2A6H F;  3ABT A;  2Z3Y A;  2DYS H;  2E35 A;  3KEO A;  3RIR A;  4CCL A;  5CPR B;  3OS0 A;  2X85 A;  2DDA A;  2ZBK A;  3HXL A;  2MW8 A;  2FE3 A;  4XQF A;  5J1Y A;  1MMS A;  1OLT A;  2P6S A;  2CWE A;  2CFO A;  3JRB A;  3BPX A;  3IHU A;  2B63 J;  5DS9 A;  3KYL A;  1R4N B;  3A4C A;  4HPQ A;  1O3Q A;  3G3Z A;  4DQ2 A;  3C7J A;  1MH4 A;  2M9H A;  2VKH A;  3OIQ A;  3K2A A;  5FFX A;  5J6X A;  3BZK A;  2IP2 A;  1W0U A;  2F5C A;  2ZJP F;  2P81 A;  4KMF A;  5D6E A;  3JTH A;  5GTH C;  3BOQ A;  3CCS I;  3AL0 C;  1YX3 A;  1A04 A;  4PFP A;  1T95 A;  5JVG F;  3MKZ A;  3HDD A;  3P9I A;  4XRS A;  3L2Q A;  2AQE A;  2PMU A;  3D5S C;  5HDK A;  3ISP A;  1DPR A;  4I01 A;  5DYM A;  4BBS J;  4HDU A;  3PL8 A;  4AWX B;  2R5Z A;  1UHM A;  2YSR A;  3IC7 A;  4GDF A;  4FX4 A;  3ABK H;  3RSN A;  5DCM A;  5KAF C;  5LRS A;  1YHQ I;  1EF4 A;  3DV8 A;  4X1E A;  3RKY A;  2PEX A;  4NQW A;  3A01 A;  2HPI A;  2O61 A;  2RKH A;  4QLC U;  4ENN A;  1VQ5 I;  3KEQ A;  4UVC A;  2L4A A;  4YRV A;  1E3H A;  1FBS A;  5FKK A;  1Y1V J;  2OJE D;  3DFG A;  4UVB A;  2FSW A;  2P6T A;  2NS0 A;  1AKH A;  2M2E A;  3WGI A;  3AAF A;  1RET A;  1B8I B;  1EA3 A;  1IDY A;  5DCF A;  3L00 A;  4XL9 A;  4ZH4 F;  2HS5 A;  3K10 A;  3PNY A;  6PAX A;  2DOE A;  4MTE A;  3FBI B;  1BA5 A;  1VQL I;  3HUG A;  2KIU A;  3WTY C;  2L4M A;  2DJI A;  2XPV A;  3EUH A;  3ZRG A;  3F22 A;  4QWQ A;  3Q0U A;  2BBY A;  5FB2 A;  4BL0 B;  2LBF B;  4BUP A;  2KFD A;  5JLX A;  4XBF A;  3S1N J;  4IEJ A;  3BZ6 A;  2C6Y A;  3RYR A;  1HKT A;  5E18 F;  3U21 A;  4B47 A;  1ACI A;  5DM6 F;  2VOD A;  1Z77 A;  5EG0 B;  4IXA A;  1ZRE A;  1KYW A;  4XLF A;  2E1C A;  4AIH A;  3OYK A;  4XLN F;  4XRF A;  4AU7 A;  2DLL A;  5HOO A;  1JJ8 C;  1J75 A;  3K4N A;  3ERM A;  2XC7 A;  2WC2 A;  4HST A;  5HLI A;  2XSD C;  3MQ0 A;  2IS1 A;  2EIK H;  2DFH A;  1MSF C;  3RJP A;  2CGP A;  2HVR A;  2N8G A;  4UVA A;  4EGY A;  2DA7 A;  3QU3 A;  1BI1 A;  1LPQ A;  3V7S A;  3TMO A;  1MMN A;  5M5Y J;  3QYB A;  2DMT A;  1LKX A;  5AIP A;  4IHT A;  4FIS A;  4QPO A;  4M3D A;  4LG0 B;  4XID A;  2E60 A;  3J7Z I;  1RKW A;  5ICC A;  3ZQL A;  3F8C A;  4NUB A;  1JUS A;  1B72 A;  2W4S A;  4CDG A;  1LB2 A;  3TP3 A;  1ZYR F;  2H1L A;  2XRN A;  5K7H A;  2WB1 N;  3BTI A;  4KIB A;  1PJR A;  2GBY A;  3HOV J;  4UV8 A;  3LSJ A;  3LQR A;  4M3E A;  1A6I A;  1MBK A;  5TIS C;  5LHH A;  1LEA A;  2D45 A;  3L2V A;  1PP7 U;  4YFK F;  3CME I;  3I55 I;  4FE4 A;  1I6X A;  4A0X A;  1BW5 A;  1TLH B;  3OMY A;  5HOD A;  2QUF A;  3IRQ A;  3G6E I;  3CF5 F;  1JT0 A;  2R5Z B;  3UKG A;  1RI7 A;  1VQK I;  3SEQ A;  3LWF A;  4XMY A;  5EZG A;  4M71 A;  2IBD A;  2M7A A;  3A01 B;  3ZMZ A;  3ZMU A;  2DFE A;  2IEK A;  2HOS A;  1YOV B;  3H0G J;  1MND A;  1V5E A;  5K1Y A;  2EB7 A;  2LSO A;  2XGD A;  1PYV A;  2HZD A;  3H1C A;  4CXF A;  3R0A A;  2QBY A;  3EPZ A;  1U2W A;  1I1S A;  2RVC A;  4L0Z B;  2B0L A;  2DA5 A;  2K3P A;  4ZYA A;  3Q5F A;  3WOD F;  4CZC A;  2PX9 A;  2E7X A;  4RAZ A;  2HOA A;  2RQQ A;  1STZ A;  3PNT A;  1LVK A;  5ED4 A;  3TDZ C;  1FZP B;  4KIS A;  4GRI A;  1R6R A;  5CQG A;  2LKX A;  1N78 A;  3GLL A;  3C18 A;  1SFE A;  3RPQ A;  3LAP A;  1U8R A;  2LNB A;  1D1B A;  1IV8 A;  2ESN A;  3HYI A;  4BY7 J;  3M7G A;  1FMV A;  2EZK A;  4KIG A;  4XIC A;  3K69 A;  2L9V A;  3ZQI A;  1J09 A;  2Z1D A;  4OIN F;  1YFH A;  5J8F A;  4H0E A;  2JQ7 A;  4Y33 A;  2DT7 B;  2XF6 A;  4LIV A;  1U5T A;  3CLO A;  4BKX A;  4E70 A;  4UUT A;  2DA3 A;  1T2K A;  3WG7 H;  2CW8 A;  2DA4 A;  1T08 B;  4CCO A;  4GFB A;  4LLL A;  1B6A A;  4N0B A;  2PI0 A;  2X9D A;  4G94 A;  1I6H J;  1FP1 D;  5C44 J;  2M1B A;  2V26 A;  4XRS G;  4F7Z A;  2NNN A;  2VPR A;  1XGM A;  2DA1 A;  3OL3 A;  4MIM A;  4EM1 A;  2R3S A;  4NB5 A;  4PJN A;  2HDW A;  2WAD A;  3TL4 X; 
#chains in the Genus database with same CATH homology
 1UHW A;  1GHC A;  4OIQ F;  2CQK A;  2G7U A;  3DQV C;  3I5U A;  3CO6 C;  2K4J A;  3I0T A;  1S7A A;  1G3Y A;  2ZXJ A;  2FBK A;  2K7L A;  1R5G A;  3J7A O;  4L9T A;  3EYY A;  4LLN A;  3KP6 A;  3ZQ7 A;  1W7P D;  1XMK A;  1TW2 A;  3U2R A;  4RB1 A;  5ILU A;  1SD4 A;  2JRT A;  2QYO A;  3ERE D;  3GEZ A;  2JPB A;  2BYV E;  5FLX K;  1X3U A;  3I58 A;  2KJB A;  2PFB A;  2Z99 A;  4PDK A;  1DUX C;  4EM2 A;  1S29 A;  3F8M A;  5LGT A;  5TRD A;  2DU9 A;  3OV8 A;  3QPT A;  1FYM A;  2HTJ A;  2PJP A;  1D8J A;  3QOP A;  2CYY A;  2VBY A;  3K0L A;  2HQR A;  3DPL C;  5FFZ A;  3I59 A;  3ELK A;  4A6D A;  2HOE A;  2GA1 A;  2FNP A;  2P7V B;  2HYG D;  2O03 A;  1FP2 A;  1XGS A;  1J2X A;  4IHS A;  4M9Z A;  4LGW A;  2E7W A;  5A2Q K;  3EDP A;  4EJT A;  2YR2 A;  3O2P E;  3N97 A;  1KQ9 A;  5H20 A;  1BM9 A;  2HTS A;  3GXO A;  3ZN0 A;  2K27 A;  1F9N A;  3DKW A;  4HW0 A;  1KYZ A;  4HDV A;  5L3E A;  4ZZD A;  2JT1 A;  5D5V B;  1OPC A;  3GWZ A;  2LF7 A;  1IN5 A;  1RUO A;  2K4B A;  2DW4 A;  5FO5 A;  2IT0 A;  1HKQ A;  4IVN A;  1ZG3 A;  3MFK A;  5FD6 A;  1LDJ A;  2GXB A;  2KJC A;  4CO8 A;  1YW9 A;  1D8K A;  2ZCW A;  1HST A;  1LDD A;  3M1E A;  3FMS A;  4KN7 X;  1KU7 A;  3VOE A;  2PN6 A;  5E17 F;  1G6N A;  1EV7 A;  1YW8 A;  3I59 B;  1K78 B;  3JAM Z;  1Z05 A;  2ESH A;  3EYI A;  4O3M A;  3ML6 A;  3H92 A;  2E1N A;  4YFN F;  3K9T A;  2A3S A;  2AS5 F;  1SFU A;  4R1H A;  3G73 A;  4UUV A;  3K2Z A;  1R22 A;  1YW7 A;  1IAW A;  3FM3 A;  2DQR A;  3Q9V A;  3QRF F;  4G7H F;  1LVA A;  5LGU A;  3K1N A;  3RYP A;  1XSD A;  3C3W A;  4GYG A;  2HKX A;  2X4H A;  2D2W A;  2M8E A;  5ILV A;  1SFX A;  4OOI A;  3ABU A;  3KCC A;  4HV5 A;  3KFW X;  4U0W A;  4PCQ A;  3GLX A;  2DT5 A;  4M6X A;  1SD6 A;  3I71 A;  3BRO A;  4M9S A;  4YFX F;  4ZYH A;  3TO9 A;  2JSC A;  4ZYG A;  3EQL F;  3LQQ A;  5HLH A;  3RI4 A;  2EV0 A;  2V1D A;  4BHP A;  4Z2Y A;  2OAZ A;  3HRS A;  1R00 A;  1PUE E;  1QZZ A;  2VXZ A;  5L3F A;  2DAO A;  2H94 A;  2VT2 A;  4N9I A;  1Z6T A;  2STW A;  4M72 A;  2EK5 A;  3F23 A;  2R7F A;  3LFK A;  1S8N A;  5ICE A;  2RQP A;  3E97 A;  3SHF A;  4A0Y A;  3V8J A;  2Z9O A;  2P8T A;  1MD0 A;  2P7C B;  1XB4 A;  3P9C A;  2MLG A;  1Z7U A;  4EJO A;  3O6B B;  1T39 A;  2P4W A;  2O3F A;  2VC0 A;  4EQQ A;  3WGH A;  2VE9 A;  3BY6 A;  4HLX A;  2UXX A;  5F64 A;  3F21 A;  1TBX A;  2FEZ A;  1WWX A;  4HF1 A;  3LST A;  3WU1 B;  3I54 A;  4HX8 A;  3DPT A;  3IKV A;  5DV5 A;  4N9H A;  3VOD A;  5D4S A;  2WV0 A;  2W85 A;  1EH7 A;  4MEY F;  4ESJ A;  1UCR A;  2W24 A;  4P55 A;  3KLO A;  2QWW A;  5DEQ A;  5K5R A;  1E17 A;  2GWR A;  2H6B A;  2ZNZ A;  4O6J A;  1R36 A;  4HF2 A;  1Z1D A;  3J81 K;  4A6E A;  1FYL A;  1USS A;  3JSP A;  4RS8 A;  1S7O A;  4B09 A;  4FHT A;  1SD5 A;  3O3K A;  5K5O A;  2RC4 A;  1FSH A;  2EWN A;  1IXS B;  2YPR A;  2HYF A;  2EJR A;  3HHH A;  5DD4 A;  1ZG5 A;  1GXQ A;  1P4X A;  2Q0O A;  5IT3 A;  3R60 A;  3NQO A;  1W7P B;  2F5D A;  3MCZ A;  2QQA A;  2XAH A;  4ESF A;  5BPD A;  1R5H A;  3BDD A;  4LG0 A;  3TKY A;  4GYI A;  5JR3 A;  5BOX A;  1QBJ A;  5JVT A;  3F6V A;  5IT9 K;  4KT5 C;  2MH9 A;  1GVJ A;  2FOK A;  2P5V A;  3KP7 A;  3N4M A;  1IN8 A;  4U7D A;  3FF5 A;  5D5X B;  4ESB A;  2XVC A;  4RGR A;  5D8K B;  1GXP A;  4UHT A;  1WI9 A;  2W25 A;  2PLY A;  3GFJ A;  1CGP A;  3H3U A;  5E1W A;  4LB6 B;  4OU0 A;  2H09 A;  3OOP A;  1XCB A;  2H6C A;  4KIC A;  2L01 A;  3BJ6 A;  3R61 A;  1KA8 A;  2YX4 A;  3QP6 A;  3TGN A;  4MHG A;  4RGS A;  3GVA A;  1FOK A;  1XD7 A;  1U5T C;  1FSE A;  4CIC A;  3WTZ A;  3D0S A;  2DPU A;  1YIO A;  3CUQ C;  5BQT A;  3VB2 A;  3GF2 A;  1HW2 A;  1O3R A;  4A5M A;  1U3E M;  1BC7 C;  1LJ9 A;  3F3X A;  4WK8 F;  1ONV A;  5K5Q A;  3GFI A;  2HGC A;  2ELH A;  1BOA A;  3IKT A;  3GFM A;  2AXL A;  2JTV A;  1ON1 A;  4A12 A;  1TQI A;  4BAY A;  3ZMS A;  4JK1 X;  1K6O A;  3BP8 A;  1O7L A;  4I98 B;  1J0R A;  1P2F A;  2Y75 A;  1XDU A;  2O0Y A;  1MJ9 A;  2Z5U A;  4I02 A;  2EFN A;  3T1B A;  3BPV A;  2XHK A;  4OIP F;  3SFZ A;  4G7Z F;  2QEN A;  1ZH5 A;  4LMY A;  3V8L A;  3KZZ A;  2LF8 A;  4KUM A;  1B4A A;  1UB9 A;  2KKO A;  2VOO A;  2STT A;  1D5V A;  1HSJ A;  1XDS A;  1V4R A;  3R4K A;  2UZK A;  2ACJ A;  3TO6 A;  5JI6 A;  2DFI A;  2R7D A;  5DDG A;  2DI3 A;  5JFR A;  3V7C A;  2OQG A;  2VBZ A;  2LKP A;  3JW4 A;  5CVU A;  2OZU A;  3JTG A;  1U6G A;  4EV0 A;  5F1R A;  1ZG1 A;  2XIG A;  1BN5 A;  3LA2 A;  4ON0 A;  1YG2 A;  2RNJ A;  1LEB A;  4MQ9 F;  3V8K A;  3BJA A;  1G4D A;  4XSZ F;  3WTT C;  4G6Q A;  1PP8 F;  3RPU A;  4LLG F;  2NYX A;  4EGZ A;  3FXU A;  3ZMV A;  1JXS A;  3FMR A;  1RZ4 A;  4Q4Z F;  4LJZ F;  1BI0 A;  2GZW A;  1H9G A;  4PZJ A;  1R1V A;  4WX9 A;  1FBU A;  4RB3 C;  1RUN A;  1IRF A;  3F6O A;  1JHH A;  4KYW A;  1ON2 A;  4RGX A;  3Q9S A;  1S3J A;  2XRO A;  1W5S A;  1JE8 A;  3GYH X;  2DQL A;  1BC8 C;  1UST A;  2ETH A;  1ZAO A;  1K78 A;  4I09 A;  5D4R A;  1MDM B;  4L0Y B;  5HS7 A;  5LGN A;  5CVI A;  4WWC A;  1G3S A;  4HQM A;  1LDK B;  1XSX A;  1EH6 A;  4LK0 F;  1O57 A;  2ZKZ A;  3WE3 A;  1IZ1 A;  1XMA A;  1SMT A;  2JPC A;  4OMZ A;  5CVJ A;  3CUQ B;  2CG4 A;  1REP C;  5FLX Z;  1IN7 A;  4BH9 A;  3U9G A;  1WRJ A;  2V9V A;  3J80 K;  2V79 A;  5E8I A;  2MC3 A;  3HRT A;  1D3Y A;  2KRF A;  3WTW C;  1QZY A;  4IPA A;  2F5F A;  1IRG A;  4LFU A;  3I64 A;  3ZN1 A;  1L0O C;  1FNN A;  3K1P A;  2HR3 A;  3E5X A;  1TQP A;  1J9I A;  1ZRC A;  1J5Y A;  2PQ8 A;  2Q2E A;  1T0F A;  5D8L B;  2CSO A;  2FF4 A;  3PQJ A;  5A2Q Z;  2CFX A;  2DK5 A;  2IJL A;  2EFP A;  1IXC A;  1KU2 A;  3HSE A;  2MA3 A;  3HRU A;  5E1Z B;  1IXR C;  2H27 A;  4IRH A;  1K79 A;  2QQB A;  4P96 A;  1ZN2 A;  3PFI A;  3E5Q A;  3HIF A;  3ZMD A;  4R79 A;  2D1V A;  2XKO A;  3COA C;  1YQA A;  3FM5 A;  2GQQ A;  2GIV A;  4PGG A;  4FX0 A;  3DXJ F;  4IF4 A;  4OIR F;  1QO0 D;  2ZJ2 A;  1HKS A;  1KGS A;  5AON A;  3KE2 A;  1MZB A;  2F5E A;  4MEX F;  4AIK A;  3M8E A;  3EET A;  4GXO A;  1NHA A;  2OU2 A;  4UNO A;  2EFW A;  3P7N A;  2XV4 S;  4I2O A;  3V4G A;  3MWM A;  4P5O A;  1P4A A;  3KP4 A;  1RIO H;  2P5K A;  3HOS A;  2HKO A;  2MD5 A;  3MZY A;  1FPQ A;  4JBA A;  2FBH A;  4HOB A;  1T38 A;  3T8T A;  2FXA A;  3WTS C;  1O3S A;  2RN7 A;  1IUY A;  1W7P A;  2NNY A;  2EV5 A;  1JGS A;  1FBQ A;  1OR7 A;  4XSX F;  2PMH A;  1K7A A;  2NRA C;  2IA0 A;  1E2X A;  2IW5 A;  1HW1 A;  1TW3 A;  4I0B A;  1XSV A;  2J5O A;  3WTU C;  1I5Z A;  2QZ8 A;  3CO7 C;  1G3W A;  5BS6 A;  1LNW A;  5CJ9 A;  3ECO A;  2A6E F;  4ENJ A;  3E6D A;  4WF2 A;  2BE5 F;  1DP7 P;  3DEU A;  2LDU A;  4CGZ A;  2IA2 A;  2HWV A;  2Q8K A;  3RKX A;  1B59 A;  1U78 A;  3F8B A;  4M9X A;  1IW7 F;  4P9U A;  2G7H A;  1ZAR A;  1KQ0 A;  1BIB A;  1Q1H A;  5EEG A;  2HDC A;  3KET A;  2WWY A;  2V6C A;  3IL2 A;  3LAJ A;  3IWF A;  1RNL A;  3WE2 A;  2A68 F;  2D1H A;  2KIF A;  3HOT A;  1SD7 A;  2MH2 A;  3DF8 A;  3KLN A;  1T98 A;  3MAJ A;  5ILS A;  4MNU A;  2GA2 A;  3REO A;  3HTS B;  1ZGA A;  5LLQ A;  4AIJ A;  3TOA A;  1HXD A;  5E1X A;  1P6R A;  4ENK A;  5KVR A;  1YS6 A;  4L5I A;  1H0M A;  3ZPL A;  1CF7 B;  4WCG A;  3DP7 A;  5ICF A;  5LHI A;  3IRR A;  5L3B A;  2XAG A;  4GCV A;  4ASN A;  1ZRD A;  2RGV A;  4L18 B;  3GW2 A;  4PGH A;  2J5P A;  1TNS A;  5TJJ A;  2QLZ A;  2ZME B;  4I7H A;  2ZFW A;  4R8H A;  5LEJ A;  3FMQ A;  3L7W A;  3GO5 A;  2OQR A;  3J81 Z;  2W84 A;  5LHG A;  3GFL A;  1WSU A;  3B02 A;  4KNY A;  5HS9 A;  3WTX C;  4GGG A;  3GZ6 A;  1MJB A;  2IA1 A;  2X0L A;  2DO7 A;  4L9V A;  4Y17 A;  3MZH A;  5D5U B;  1UFM A;  3RDI A;  1MGT A;  1SMY F;  1O7F A;  5KK1 A;  1Z6R A;  1EH8 A;  4S05 A;  4Y15 A;  2PG4 A;  4Q5S F;  2GAU A;  2XAJ A;  4BQA A;  3M8F A;  4RB2 C;  2L02 A;  3WTV C;  3QPH A;  3GX4 X;  4BNC A;  4UXN A;  2M45 A;  2L3D A;  2XGX A;  1W4M A;  1KU9 A;  5IT9 Z;  3B73 A;  1I1G A;  5AIQ A;  2V1X A;  3T5X A;  3TO7 A;  4BHB A;  4RAY A;  2EA2 A;  1OYI A;  5H6Q A;  3SZT A;  4OMY A;  4WXD A;  4HF0 A;  3R6S A;  3H3Z A;  3I4P A;  1OMI A;  1QNT A;  5F6F A;  1JHF A;  3T8R A;  1BBY A;  3FXQ A;  1C0W A;  4OIO F;  1LQ1 A;  4TV7 A;  1J7K A;  4G8X A;  2EFQ A;  5L3D A;  2CW0 F;  4CHU A;  2BV6 A;  4WXC A;  1FX7 A;  1R23 A;  4EVI A;  2Y48 A;  1FLI A;  4AD9 A;  2ZO4 A;  2XAS A;  1MJA A;  2XUB A;  4O5V A;  5H6R A;  2FA5 A;  4ZYD A;  2OA4 A;  1FC3 A;  2ADU A;  5DCM B;  3QP5 A;  2A61 A;  1R1T A;  5J8C A;  1QPM A;  4U7B A;  3WU0 A;  3D5L A;  4MGR A;  1XGO A;  3L9F A;  1H9T A;  2IVM A;  4KA4 A;  4Q48 A;  2K86 A;  2M87 A;  1QQI A;  4IRG A;  1ZHF A;  2M5W A;  1MDM A;  2ISY A;  5HS8 A;  1Z91 A;  3P9K A;  4EM0 B;  3RTR A;  4CYD A;  2FML A;  5FD5 A;  3GUD A;  5E8G A;  1Y0U A;  3W6J B;  2BEO A;  1S6L A;  4CZZ A;  5HVQ C;  3E6B A;  2IRF G;  4A5N A;  3CUQ A;  5L3G A;  1QGP A;  3NEU A;  3S2W A;  3JSO A;  4HV6 A;  1FWZ A;  1YLF A;  4LK1 F;  3KZY A;  2HQN A;  3TDU C;  1IN6 A;  4L5J A;  5BPI A;  3L2C A;  1HBX G;  1TTY A;  2QVO A;  3SXY A;  2HFH A;  1PDN C;  3KP2 A;  2CO5 A;  2COM A;  3WGG A;  1R7J A;  1AWC A;  2XAF A;  3E5U A;  2QBY B;  3WG9 A;  3M9A A;  3TQN A;  5HLG A;  5JHU A;  4I0A A;  2UXN A;  4HZF A;  2YX7 A;  2HZT A;  3HHG A;  2VOP A;  2BGC A;  5L3C A;  1J59 A;  1BI2 A;  3GZ5 A;  2RV8 A;  4KIF A;  5ICG A;  2A5Y B;  4YG2 F;  3LA7 A;  4HQE A;  1IF1 A;  2DPD A;  2GXG A;  1U5T B;  3ULQ B;  3HTU A;  3LA3 A;  4A0Z A;  4Q47 A;  1YO5 C;  1OYY A;  4RB0 A;  2EA4 A;  4XLP F;  2K02 A;  3E6M A;  4BHC A;  1DDN A;  2OZ6 A;  1ODD A;  2F2E A;  4AVP A;  4HLY A;  4ETS A;  4KMU X;  2VT3 A;  2EV6 A;  4BXU A;  1ZLJ A;  3CTA A;  4U0Y A;  3KP5 A;  4M73 A;  3JAM K;  2DBB A;  2WTE A;  4WXH A;  1FT9 A;  3FHZ A;  3MEX A;  4ZYE A;  4HA8 A;  2HEO A;  4EJU A;  5HDN A;  3PQK A;  4IJA A;  4HAM A;  3NRV A;  2FU4 A;  5CVR A;  3HSR A;  4EMS A;  4ZZL A;  3E6C C;  4U0V A;  1F1Z A;  1KQ8 A;  2FBI A;  2KIM A;  3FX3 A;  1R58 A;  4L9J A;  5HDG A;  3V7R A;  4HYE A;  1WKM A;  5ERI A;  1ZLK A;  4G9Y A;  2FRH A;  3QAH A;  4HBL A;  3F8N A;  5E20 A;  2VC1 A;  4MTD A;  1HQC A;  3F72 A;  3ZP5 A;  4A2U A;  1YYV A;  3ECH A;  1T6S A;  1ULY A;  3K1M A;  3J80 Z;  1FY7 A;  3QU6 A;  5DD8 A;  5CVV A;  2OBP A;  4YIF A;  1MKM A;  3VFZ A;  1F5T A;  2O6G E;  1BJA A;  2ZNY A;  2VE8 A;  3R0J A;  2NAZ A;  2RDP A;  2TDX A;  5BMZ A;  5CLS A;  5LEK A;  4BYY A;  1VTN C;  4UV9 A;  1B9M A;  1BIA A;  3CUO A;  1P4W A;  4GO1 A;  1TNT A;  1V3F A;  1W5T A;  2G9W A;  2A07 F;  4IRI A;  4ENM A;  3KP3 A;  1AOY A;  4G7O F;  3ROU A;  2VN2 A;  1OKR A;  2PBI A;  4S04 A;  1DPU A;  4U88 A;  1TQM A;  4L9N A;  3FWE A;  2L54 A;  1G3T A;  1FYK A;  4LD5 A;  2IPQ X;  3TOB A;  5FGM A;  2ISZ A;  2MLK A;  2XAQ A;  1BI3 A;  3BJO A;  1OYW A;  3L09 A;  2EFO A;  4KN4 X;  1ZRF A;  2UWM A;  5DUI A;  2QQ9 A;  4HX7 A;  2VBX A;  2OD5 A;  2DK8 A;  3HRM A;  2O8X A;  1YTY A;  1XN7 A;  4JQF A;  3BWG A;  1Z9C A;  1XGN A;  3FXR A;  3VEP A;  2FMY A;  1CF7 A;  4B8X A;  3CJN A;  4LB5 A;  3SZP A;  5DUK A;  5LRR A;  4EJW A;  2P5L C;  2MBF A;  3FZV A;  2FQ3 A;  3T0Y A;  1B1B A;  3ZMT A;  3IWZ A;  1B9N A;  2ZME A;  4KDP A;  1XCV A;  1R1U A;  3RKW A;  2Y0M A;  4D0P A;  1KU3 A;  1SAX A;  2YU3 A;  3F8F A;  5D5W B;  1ZGJ A;  4YII A;  3SQN A;  4M74 A;  1P92 A;  2DTR A;  1L3L A;  2M30 A;  2FNA A;  5LBQ A;  4NHJ A;  3E3V A;  3W6K B;  2VBW A;  4Y13 A;  1I27 A;  1YS7 A;  3U1D A;  4HX4 A;  4EJV A;  5CYV A;  2V1U A;  5D6F A;  3C1D A;  4P9F A;  1IN4 A;  3CDH A;  4M6Y A;  1WQ2 A;  3I53 A;  1O3T A;  2A69 F;  4KFC A;  4G6D A;  4MQV A;  2W57 A;  4FT8 A;  2VON A;  2QM3 A;  2JZY A;  3HSF A;  1HW5 A;  4DNC A;  5EEH A;  2XKP A;  2Z33 A;  1F4K A;  4K2E A;  4RGU A;  2A6H F;  3ABT A;  2Z3Y A;  3KEO A;  3RIR A;  2ZBK A;  2FE3 A;  2P6S A;  2CWE A;  3BPX A;  3IHU A;  1O3Q A;  3G3Z A;  4DQ2 A;  3C7J A;  5FFX A;  5J6X A;  2IP2 A;  2F5C A;  4KMF A;  5D6E A;  3JTH A;  3BOQ A;  1A04 A;  3P9I A;  2PMU A;  5HDK A;  3ISP A;  1DPR A;  4I01 A;  5DYM A;  4HDU A;  4AWX B;  1UHM A;  2YSR A;  3IC7 A;  4FX4 A;  5DCM A;  5LRS A;  3DV8 A;  3RKY A;  2PEX A;  4NQW A;  2O61 A;  2RKH A;  4QLC U;  4ENN A;  3KEQ A;  4UVC A;  2L4A A;  1FBS A;  3DFG A;  4UVB A;  2FSW A;  2P6T A;  2NS0 A;  3WGI A;  3AAF A;  5DCF A;  3L00 A;  4ZH4 F;  2HS5 A;  6PAX A;  4MTE A;  3HUG A;  2KIU A;  3WTY C;  2L4M A;  3EUH A;  3F22 A;  4QWQ A;  2BBY A;  5FB2 A;  4XBF A;  3BZ6 A;  2C6Y A;  3RYR A;  1HKT A;  5E18 F;  2VOD A;  4IXA A;  1ZRE A;  1KYW A;  2E1C A;  4AIH A;  4XLN F;  4XRF A;  5HOO A;  2DLL A;  1J75 A;  2WC2 A;  5HLI A;  3MQ0 A;  3RJP A;  2CGP A;  4EGY A;  4UVA A;  3QU3 A;  1BI1 A;  3V7S A;  5AIP A;  4IHT A;  4LG0 B;  5ICC A;  3F8C A;  4CDG A;  1LB2 A;  1ZYR F;  2XRN A;  4KIB A;  4UV8 A;  5LHH A;  3LQR A;  1LEA A;  2D45 A;  1PP7 U;  4YFK F;  1I6X A;  4A0X A;  1TLH B;  2QUF A;  3IRQ A;  1RI7 A;  3LWF A;  4M71 A;  3ZMZ A;  3ZMU A;  5K1Y A;  2EB7 A;  2LSO A;  4CXF A;  3R0A A;  2QBY A;  1U2W A;  1I1S A;  2RVC A;  4L0Z B;  2B0L A;  3Q5F A;  3WOD F;  2E7X A;  4RAZ A;  1STZ A;  5ED4 A;  3TDZ C;  1FZP B;  3C18 A;  1SFE A;  3RPQ A;  3LAP A;  1U8R A;  2LNB A;  2ESN A;  3HYI A;  3M7G A;  4KIG A;  3K69 A;  4OIN F;  1YFH A;  5J8F A;  4H0E A;  1U5T A;  3CLO A;  4E70 A;  1T2K A;  4LLL A;  1B6A A;  4N0B A;  2PI0 A;  4G94 A;  1FP1 D;  2M1B A;  4F7Z A;  2NNN A;  1XGM A;  4EM1 A;  2R3S A;  4NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...