1UHWA

Solution structure of the dep domain of mouse pleckstrin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GSSGSSGLGALYLSMKDPEKGIKELNLEKDKKVFNHCLTGSGVIDWLVSNKLVRNRQEGLMISASLLSEGYLQPAGDLSKNAADGIAENPFLDSPDAFYYFPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin
publication title Solution structure of the DEP domain of mouse pleckstrin
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhwA00
4AVPA 3EDPA 2CSOA 1W7PD 4UVCA 1LDDA 1W5TA 4WXHA 3U1DA 2XAFA 4XSXF 3CO6C 3WU0A 3KP3A 3PQJA 3ERED 4Y13A 1FBUA 4KN7X 4B8XA 1BM9A 1P6RA 5JI6A 3E5QA 2MC3A 4R1HA 3N4MA 5F6FA 2DO7A 2QLZA 2JTVA 3M8EA 1GXPA 1LDJA 4RB2C 2Q0OA 5LRRA 2XASA 5E8GA 1EH7A 2MLKA 3AAFA 2DK8A 2Y48A 1ONVA 4LLLA 2ZO4A 4CYDA 5K5QA 4G7OF 1ZHFA 2O3FA 3BPVA 5D5VB 2K4JA 3ABTA 4KYWA 2STTA 3CJNA 4RB3C 4QWQA 2C6YA 2A68F 2AXLA 5D5UB 1C0WA 3WTUC 4BYYA 2M1BA 5AIPA 3FXRA 3FHZA 1Z91A 3K1MA 1L0OC 2H6BA 5FB2A 1SFXA 2XVCA 3L09A 4OIRF 3K0LA 2HKOA 5JFRA 1PDNC 2K02A 2FOKA 4G7HF 3V8JA 4HDVA 3I59A 4HV5A 3B02A 3HTUA 1QBJA 3MQ0A 2X4HA 1A04A 4BHPA 1P92A 1WI9A 3N97A 2QBYA 1STZA 4ZZDA 2PN6A 3FM3A 2A3SA 1ZAOA 4ON0A 1MJAA 1P4WA 3KP2A 4MQ9F 1S29A 1G3TA 4HF2A 5FD6A 3D5LA 3V7RA 1IW7F 3R0AA 1ON2A 2W85A 2VE9A 1PP7U 2EA2A 3QAHA 2FMLA 2D1HA 2G9WA 4RAZA 3RKXA 5H20A 2EFQA 2W57A 3FMRA 2QQ9A 5ICEA 4L5JA 3L9FA 1IN8A 1YQAA 3FX3A 1XD7A 5K5OA 1SMYF 5BS6A 3ZN0A 4CO8A 2M45A 3TO6A 4EM1A 3DKWA 1J7KA 2HQRA 1YW7A 5BPDA 1HKQA 4EV0A 1KU7A 2KJBA 1FSHA 1JE8A 4EJVA 3SHFA 2H94A 4BQAA 2K7LA 4IRIA 3ZMZA 3ECHA 3MEXA 4I0BA 3GX4X 2CW0F 2DPDA 3F6OA 2HEOA 3NQOA 2IA0A 1KQ0A 4AWXB 4KDPA 4IHSA 1Z6RA 4U7BA 1B9MA 2JZYA 3MZYA 1TW3A 3TDZC 2NNYA 4XSZF 1MD0A 3GZ5A 1FYKA 4FHTA 3GUDA 1G3SA 3FF5A 2FE3A 2BYVE 3GZ6A 1E17A 1DPUA 3W6JB 4KMFA 3ZPLA 1KA8A 5HDNA 4HF1A 3Q9VA 2OQRA 5DD8A 2VODA 2YX4A 3J80K 4L9VA 5BOXA 2DFIA 1S8NA 2BBYA 4I2OA 2VXZA 1IXRC 3K1PA 2Z33A 2IPQX 3J7AO 4ENKA 1BI2A 1R7JA 3WTWC 4I09A 1IXCA 2JPBA 4LD5A 1FBQA 2PMHA 4FT8A 2W24A 1Z05A 5FGMA 4M9XA 4K2EA 5HDKA 1P2FA 3KP6A 3DXJF 4A0ZA 3I0TA 4YFNF 5ILSA 2FEZA 1UB9A 3KEOA 4KT5C 3BP8A 4ZYGA 2BV6A 2ZMEB 1QO0D 4Q48A 1KYWA 4UV8A 5DYMA 5FLXK 1FZPB 5DCFA 5ERIA 4YIIA 2HFHA 5HDGA 3SFZA 3BZ6A 1K78A 1XSXA 3HOSA 2P4WA 4RGXA 4UV9A 1L3LA 2QQBA 2FU4A 2P5KA 2RVCA 1MKMA 3CUQA 1TBXA 3SQNA 2A61A 4AIJA 4EM0B 4WF2A 1OPCA 3F6VA 4G6DA 2LDUA 4EMSA 4ESJA 2FQ3A 5E17F 3MWMA 4MGRA 1ZG3A 1IXSB 5FD5A 2O6GE 3LA2A 5J8FA 1O57A 1ZG1A 1ZH5A 3TGNA 2R3SA 4M73A 1RUNA 1IZ1A 1REPC 1OR7A 2Y75A 1J2XA 1IUYA 2VC0A 3EUHA 3F8CA 2DQRA 3RPUA 3U2RA 2HR3A 1IF1A 1SD4A 2VT2A 2OU2A 5BMZA 2QQAA 3M1EA 5E1ZB 3KCCA 4BXUA 1HW2A 1E2XA 4OU0A 4BH9A 1XDSA 2FRHA 2DPUA 4ASNA 1G6NA 2M8EA 1I1SA 3HOTA 3F8NA 4GCVA 4IRGA 2EJRA 2ZBKA 1J9IA 3HSEA 3LWFA 2HTSA 2P8TA 2ZKZA 3BJOA 2EV6A 3IRRA 3E6CC 2VONA 1QZYA 3RIRA 2EV5A 3ZMDA 4M71A 3FMQA 2A6EF 1R1UA 3HRSA 5LLQA 1Z1DA 3I54A 4PZJA 1S7OA 2HS5A 1CF7A 4O3MA 3ZMVA 2XAHA 1K6OA 1FBSA 3JSOA 3OV8A 3L7WA 4OMYA 3L2CA 3GLXA 5L3CA 1U3EM 4M6XA 3HIFA 2FBHA 4MNUA 5K5RA 1XN7A 4O6JA 1P4AA 1QQIA 2YSRA 4BAYA 1OKRA 4IRHA 6PAXA 2WV0A 1R1VA 4MTEA 1T2KA 1YW9A 3I58A 4LB5A 3QPHA 1R00A 1B1BA 3MFKA 5HS8A 3RYRA 2TDXA 1W4MA 2HWVA 2VBWA 1VTNC 1UCRA 2EA4A 2M30A 3HUGA 1BJAA 1IAWA 3V7SA 5ED4A 2F5FA 3QOPA 3QU3A 4D0PA 5ILUA 3LSTA 4EGZA 1OYYA 2P5VA 2EFWA 1ZRDA 2OD5A 3WG9A 3DF8A 3ZMUA 2A5YB 2IRFG 4ENMA 2D2WA 1F5TA 5E1XA 4IVNA 2CGPA 1BIAA 1LQ1A 3RKWA 1WSUA 2M87A 1CGPA 2VBZA 1J59A 4HF0A 4LK1F 2EFOA 5J8CA 2K27A 4XLPF 1IRGA 1SFEA 1USSA 3RTRA 3ZMTA 5LEKA 3VOEA 2XAJA 1R5GA 2P7CB 1FY7A 3TKYA 3G3ZA 1ZLJA 2XAQA 3R0JA 2ELHA 5ILVA 3VEPA 2ADUA 1LVAA 3D0SA 1O7LA 2J5PA 5CVVA 1H0MA 3GW2A 3FM5A 2F5EA 1O3TA 1BOAA 2XAGA 4L0ZB 3I5UA 3U9GA 4ZYHA 4DNCA 1LNWA 4MEYF 1U5TA 2LF8A 4XLNF 1FNNA 3HSRA 1ZGAA 5L3DA 3R61A 2CO5A 3WGHA 4Q5SF 1FLIA 2QWWA 2WTEA 4S05A 4LG0B 2NS0A 3SZPA 4I7HA 3IRQA 2L01A 4I98B 3HTSB 3HSFA 4EVIA 5JVTA 4H0EA 5HS9A 4L9NA 3V8KA 3KP7A 5CVIA 2V1DA 1UFMA 2QVOA 1FWZA 1O3SA 5IT9Z 4P96A 4WXCA 2OAZA 1T6SA 4AIHA 3B73A 1DP7P 4KIBA 1TW2A 1B59A 2Z3YA 1HSTA 4RB1A 4L18B 2GXBA 3IC7A 4L9TA 1Z7UA 3GFIA 3BJ6A 4U0VA 3O6BB 2PI0A 5E18F 2Q8KA 2RV8A 3P7NA 4KN4X 2DI3A 2F5CA 2OBPA 3ZMSA 3RJPA 1WKMA 5BQTA 1W5SA 2PLYA 1MDMB 2PJPA 2O03A 1KGSA 3WTSC 4RB0A 4ENNA 3K2ZA 5FO5A 3V8LA 3LQRA 2DT5A 4HYEA 4RS8A 2ISZA 5DCMB 5D4RA 1G3WA 2FMYA 1SMTA 3F23A 2L02A 4CZZA 1F9NA 1OYIA 3C1DA 4ZYEA 4KMUX 3H3UA 2MLGA 3DPTA 4KUMA 1W7PB 4HA8A 2YPRA 5CLSA 3NRVA 2BGCA 2D45A 4LLNA 2PEXA 2QM3A 4P9UA 4HQEA 4U88A 2GWRA 2ZNYA 3T8RA 4KIGA 2Z9OA 4YG2F 4TV7A 1QNTA 3F22A 1YG2A 4R8HA 2WC2A 3E5XA 4PGGA 3T1BA 1T98A 5LBQA 4BNCA 1V3FA 3R6SA 4FX4A 1HW1A 2XIGA 3F8MA 4ZYDA 3I64A 5F64A 5LRSA 3JTHA 1AOYA 2R7FA 2UXNA 2NAZA 1KQ9A 5F1RA 2DAOA 3ELKA 1XGMA 4EJWA 5JHUA 3E5UA 1R36A 2XHKA 3TOBA 1RNLA 2B0LA 5CVRA 2VBXA 5E20A 3FXQA 3M8FA 5TJJA 3MCZA 1X3UA 1D3YA 2RGVA 2ZXJA 3V7CA 4PGHA 4UUVA 1D8JA 3HRMA 2V79A 2XKOA 4PCQA 1ZARA 4XRFA 2IA1A 5L3FA 2GA1A 2HYFA 3IWFA 4AIKA 4CGZA 2M5WA 3T5XA 2ZJ2A 3BWGA 2H27A 1UHWA 3R60A 4LLGF 1F1ZA 1XSDA 4HX4A 4A5MA 2O8XA 2COMA 3O3KA 4U0WA 3LA7A 2F2EA 1TQMA 2K86A 3EYIA 3DFGA 2E1CA 2PG4A 3W6KB 3GO5A 2ACJA 4IHTA 1H9GA 2D1VA 4AD9A 2ETHA 1BC8C 2EWNA 1XCVA 4HBLA 2Z99A 1I27A 3G73A 2RNJA 4UHTA 3RDIA 3BROA 1O7FA 5DD4A 1IN5A 2GXGA 1Q1HA 1G4DA 2Y0MA 2GAUA 4HV6A 3I59B 5CJ9A 4JBAA 5ICFA 2G7HA 5HOOA 1U8RA 2HKXA 2MH9A 4WCGA 4HQMA 1R1TA 1K79A 4HDUA 4EQQA 2CWEA 2HYGD 2DQLA 3TO9A 4A0YA 5FFZA 2WWYA 1PP8F 2Z5UA 4I02A 3KP4A 4WWCA 4Q4ZF 2XV4S 4GYIA 5KK1A 3K69A 1SFUA 4M9ZA 5FFXA 1O3QA 1KU9A 4XBFA 2EV0A 3H3ZA 4NQWA 4I0AA 1J5YA 3KZZA 4BHCA 4ZH4F 5K1YA 2V6CA 1D5VA 1MJ9A 2J5OA 1YTYA 1ZRFA 2IW5A 5CVUA 4CHUA 2V1UA 5HLGA 1U6GA 1XGNA 1SD7A 1FT9A 1XGSA 3CLOA 1XSVA 1JXSA 5LEJA 1FSEA 4KICA 5JR3A 4KNYA 1JGSA 2IVMA 2IA2A 2LNBA 1Z9CA 5D5WB 3PQKA 2VT3A 5DUKA 1WRJA 1KYZA 4EM2A 2HQNA 4DQ2A 3P9CA 2UXXA 2L54A 1J0RA 2W25A 1BC7C 2LKPA 2LSOA 1AWCA 1ZREA 1DUXC 2ESHA 1BIBA 3OOPA 1XCBA 1HW5A 5H6QA 4OMZA 3RYPA 5IT9K 2IT0A 3RKYA 1YFHA 3C18A 4CXFA 4MQVA 2RQPA 2JRTA 2BEOA 2BE5F 5A2QZ 4B09A 3O2PE 4LB6B 3I53A 5D8LB 3MAJA 4G9YA 1QZZA 2ZFWA 3TOAA 2MBFA 1LDKB 3HYIA 1QGPA 2PFBA 5ICGA 4U7DA 3T0YA 5D4SA 5LGUA 4N0BA 1YYVA 2V9VA 3WTXC 3JW4A 1YS6A 2DU9A 5L3BA 4EJUA 3ABUA 5DDGA 2UWMA 3DV8A 2MH2A 4GO1A 2O0YA 5J6XA 1FOKA 1ULYA 3WGIA 4E70A 3GYHX 4GGGA 1R23A 2NRAC 2FBIA 4LFUA 2ESNA 3C3WA 1U2WA 4ETSA 3ML6A 4CICA 2XRNA 1RUOA 2E7WA 2GQQA 2FA5A 1T0FA 4M6YA 4U0YA 4EGYA 1R58A 2K4BA 2V1XA 2VC1A 1TNTA 4UNOA 2FNAA 4A2UA 2Q2EA 2GA2A 3J81Z 1J75A 2E1NA 2DBBA 1TNSA 4OINF 3ZN1A 3BOQA 3LFKA 2CYYA 3QP6A 4HX8A 1QPMA 3HRTA 1FP1D 3JSPA 1BN5A 1YLFA 3DP7A 2H6CA 5EEGA 4QLCU 2OZUA 1R5HA 1ZYRF 2FNPA 4M72A 1U78A 2VOOA 2P5LC 5L3GA 4GYGA 2VE8A 2UZKA 3KLNA 3KZYA 5EEHA 3SXYA 1IN7A 1BBYA 5DEQA 1K78B 2PBIA 4HZFA 3MZHA 2VOPA 4JQFA 1I6XA 5LHIA 5E8IA 3CUQB 4N9IA 2EK5A 2ZMEA 4WXDA 2YX7A 3F72A 2AS5F 4L0YB 1EV7A 4RAYA 3ROUA 4WK8F 1KU2A 2OA4A 3WODF 1MJBA 5D6EA 3QU6A 1IRFA 3KLOA 4F7ZA 4Z2YA 2KIFA 4S04A 3WTYC 1BI1A 3ULQB 1JHFA 3M9AA 3EQLF 2FF4A 3P9KA 3QP5A 3WGGA 3DQVC 2OZ6A 1S7AA 3H92A 2JSCA 2ZCWA 4I01A 1I5ZA 2VBYA 3IHUA 2OQGA 3TDUC 1YO5C 3WTZA 3E97A 3F8BA 2YU3A 4BHBA 4ESBA 2E7XA 1SD5A 1KU3A 1YS7A 5DV5A 3BY6A 1PUEE 3GFJA 3TQNA 5BPIA 2P6SA 3REOA 1HKTA 3GVAA 3F21A 4A0XA 4KFCA 5TRDA 4P55A 4LK0F 1P4XA 2CFXA 4RGRA 3GFMA 2A69F 3GWZA 2IJLA 3E6BA 4IXAA 5CYVA 1B6AA 3EETA 3FZVA 3CUOA 2HTJA 5AONA 2L3DA 2YR2A 4ESFA 3IWZA 1XDUA 1CF7B 3CTAA 2LF7A 3WE3A 3VODA 1ON1A 4G7ZF 3WTVC 5D8KB 2XGXA 1ZN2A 4UVBA 2XROA 2A07F 1B4AA 3ISPA 2X0LA 3JAMK 5DUIA 4HX7A 2RKHA 1LB2A 1HSJA 4MHGA 4EJTA 5LHHA 2W84A 3WE2A 2QZ8A 1RI7A 1F4KA 1GVJA 2KRFA 4UXNA 4PDKA 1T39A 5L3EA 2PMUA 4CDGA 3SZTA 3RI4A 2CG4A 2FSWA 3ZP5A 4P5OA 2JT1A 4UVAA 3R4KA 1IN4A 2HGCA 3L00A 3GFLA 5HS7A 2ISYA 2RN7A 4HOBA 1FYLA 4YFXF 3CUQC 3CDHA 1I1GA 1O3RA 3HHGA 3LQQA 4O5VA 2QYOA 3LAPA 4NHJA 3GF2A 4L9JA 1XB4A 4ENJA 3E6DA 4L5IA 1H9TA 1MGTA 4HLXA 4LJZF 3V4GA 2XUBA 2EB7A 3IL2A 1FPQA 1KQ8A 3E3VA 2GIVA 2KKOA 1K7AA 4YFKF 1GHCA 5LGTA 5KVRA 3KE2A 2L4AA 4RGUA 3DEUA 2MD5A 3M7GA 2DK5A 3F8FA 3BJAA 4LGWA 1IN6A 3VB2A 3CO7C 3K1NA 3KEQA 1ZG5A 1BI3A 1MZBA 3T8TA 4M74A 2P6TA 1TQPA 1XMKA 4HLYA 4LMYA 1LEBA 2QUFA 1XGOA 5AIQA 3EYYA 1XMAA 5E1WA 5A2QK 1ZGJA 5LHGA 4NB5A 3K9TA 4MEXF 4Y17A 3I71A 1U5TB 3JTGA 4P9FA 4IF4A 2KIMA 2F5DA 4EJOA 2FXAA 2JPCA 4JK1X 4HAMA 2ZNZA 3LAJA 4M9SA 3COAC 4ZZLA 2DLLA 2KIUA 2KJCA 3IKVA 4OOIA 3JAMZ 3WTTC 4RGSA 2L4MA 2PQ8A 1G3YA 4FX0A 2DW4A 3GXOA 4LG0A 4R79A 4Y15A 4N9HA 1ZLKA 2QBYB 1JHHA 5IT3A 1UHMA 3F3XA 1FX7A 3GEZA 4WX9A 4GXOA 1YW8A 1LEAA 1D8KA 2HZTA 1HBXG 3WU1B 3FMSA 3J81K 3VFZA 4IJAA 3S2WA 4KIFA 5HVQC 4IPAA 2RDPA 2O61A 1OYWA 2H09A 1TQIA 1S6LA 2MA3A 1HQCA 1YIOA 5ICCA 2GZWA 3IKTA 1S3JA 4A6DA 2G7UA 2QENA 1GXQA 3PFIA 1Y0UA 4A6EA 2EFNA 3BPXA 5CVJA 3J80Z 3HRUA 2XKPA 4Q47A 2A6HF 1DPRA 2NNNA 1LJ9A 3P9IA 1USTA 5LGNA 1MDMA 3KFWX 3E6MA 1SD6A 3KP5A 2RC4A 3FXUA 5HLIA 2VN2A 2CQKA 4YIFA 1EH6A 4OIPF 3BDDA 2HDCA 5DCMA 1HKSA 3TO7A 3FWEA 1FYMA 1OMIA 4HW0A 1DDNA 1V4RA 2DTRA 3LA3A 2FBKA 4MTDA 3C7JA 3NEUA 3Q5FA 5H6RA 2HOEA 3DPLC 1Z6TA 1W7PA 3ECOA 1HXDA 1ZRCA 1TTYA 2STWA 3QPTA 1FP2A 5FLXZ 3KETA 4OIQF 5D6FA 3Q9SA 1TLHB 4OIOF 1ODDA 4G94A 3HHHA 1WWXA 3RPQA 3QRFF 1R22A 4KA4A 1B9NA 1SAXA 3ZQ7A 1EH8A 1FC3A 2EFPA 4A5NA 2P7VB 1U5TC 1RIOH 1RZ4A 3I4PA 1NHAA 4G8XA 2NYXA 4G6QA 2IP2A 5D5XB 5HLHA 1T38A 1BI0A 2R7DA 4A12A 1WQ2A
chains in the Genus database with same CATH superfamily
4AVZA 1T08B 4XKWA 4AVPA 4G6TB 3EDPA 3JREA 3U1KA 2EILH 2CSOA 1W7PD 4UVCA 1LDDA 1W5TA 4WXHA 3U1DA 2CW8A 2XAFA 2CMPA 1MBJA 4XSXF 1FMWA 3CO6C 2DOEA 3BG3A 3WU0A 3GTQJ 3KP3A 3PQJA 2HDDA 3ERED 1Y6IA 4Y13A 1FBUA 1HCRA 3KPHA 4KN7X 4B8XA 3PJRA 2PJRA 4A3DJ 1BM9A 1P6RA 5JI6A 2JA8J 3E5QA 3HDDA 2MC3A 4R1HA 3ABMH 4BU2A 3N4MA 5F6FA 2DO7A 4PSXA 2HOSA 2QLZA 2JTVA 2HVQA 3S2HJ 3M8EA 3AL0B 4HNUA 1LDJA 4RB2C 3BG6A 3PSFA 2Q0OA 5FKOA 1GXPA 4PSWA 4XNFA 3I4MJ 3FXKA 2CU7A 5LRRA 4IZZA 1LE8B 2XASA 2DMQA 4B47A 5E8GA 2QSGX 3KX2A 4AM3A 2MLKA 2NOGA 3AAFA 2DK8A 4BE1A 2Y48A 5IP9J 1ONVA 1N77A 4LLLA 2OCCH 2ZO4A 4CYDA 4PJLA 5K5QA 4G7OF 2EPFA 3MD2A 2HPIA 1ZHFA 2O3FA 4RM3A 2L7ZA 3BPVA 3IV5A 1PUFB 4RAFA 5D5VB 2K4JA 5KAFC 3ABTA 2LREA 2MABA 2CJJA 4KYWA 3FK7A 2STTA 2O7OA 4XM3A 3CJNA 4RB3C 4A3MJ 3G71I 4QWQA 2C6YA 1Y56A 2VKVA 1VQPI 2A68F 2AXLA 1RC9A 3O8GA 5D5UB 3WTUC 1W36C 1C0WA 4BYYA 3F9KA 3ESWB 3OSFA 3H3VK 2M1BA 5AIPA 4BEHB 5F27A 2LY9A 3CJQB 2CQNA 3FXRA 5GTIC 3FHZA 1Z91A 3K1MA 1L0OC 2H6BA 5FB2A 4E7KA 4JX5A 3NAUA 3H9JA 1SFXA 4B44A 2XF7A 2XVCA 3L09A 4OIRF 4DYCA 3K0LA 3J7ZI 2XGDA 2HKOA 3HXLA 5JFRA 1PDNC 2K02A 2JMWA 3GCMA 2FOKA 4PUSA 4G7HF 3V8JA 1BJZA 1A36A 4XRMA 4HDVA 3I59A 2LFBA 2Y69H 4H4KC 4HV5A 3S2DJ 3B02A 3HTUA 1GDTA 1QBJA 2VQHA 2P81A 3DU6A 4NQWB 3MQ0A 2X4HA 3PUFA 1A04A 4BHPA 1P92A 1WI9A 1VNDA 2DOFA 3N97A 2QBYA 1STZA 4ZZDA 3GTLJ 2PN6A 2LH9A 3FM3A 2A3SA 1ETQA 4RMNA 1ZAOA 3HB9A 2XSJC 4ON0A 1MJAA 1P4WA 2GOXB 3DEWA 3KP2A 5C3EJ 1UZCA 4MQ9F 3I55I 3SFIA 3WHBA 1S29A 4BJTA 1APLC 1G3TA 3AKZA 3A0HC 4HF2A 3PL8A 5FD6A 3D5LA 3V7RA 4DOZA 1IW7F 2JUGA 2LG4A 3IH3A 3R0AA 1ON2A 2W85A 2VE9A 1PP7U 2E5ZA 2R7TA 2EA2A 3QAHA 1OQYA 3K2AA 2FMLA 2D1HA 1MBFA 2GM4A 2G9WA 2WAFA 4RAZA 3RKXA 1CQTA 1W5CC 5E3MA 5H20A 1QRYA 2EFQA 2W57A 2ZB9A 2E5NA 3FMRA 2QQ9A 5ICEA 4L5JA 2DT6A 3L9FA 4CCNA 3G2BA 3I4NJ 2QEXI 1IN8A 1YQAA 1JTYA 1BOBA 3MKLA 2WADA 2E71A 3FX3A 1DGWY 1XD7A 5K5OA 3JRGA 1SMYF 5BS6A 2FX0A 3ZN0A 3ASNH 2YU9J 4CO8A 4S0HB 3G4SI 1S72I 2M45A 1S5LC 3TO6A 3BQYA 1IUFA 3VDXA 3OYAA 1B8IA 4EM1A 3DKWA 1J7KA 2F6CA 3OYMA 3ZQQA 4J19A 2V1NA 2HQRA 3QYEA 1BW6A 3FKIJ 1YW7A 5BPDA 1X2NA 1WPKA 1TZLA 1HKQA 4EV0A 2DA1A 1MBGA 2KJBA 2MC4A 1KU7A 3K4KA 2UUZA 2IS4A 1FSHA 1JE8A 4EJVA 3SHFA 5J1UA 2H94A 4CCMA 1HF0A 3BT9A 4BQAA 4CSWA 2IGNA 2K7LA 4IRIA 1I3AA 2L0KA 5EF6A 4IHYA 4F93B 3ZMZA 3L1PA 3AL0C 4C9YA 1ETYA 3ECHA 3MEXA 4I0BA 3GX4X 2CW0F 3CCSI 2DPDA 2R7VA 4RA2A 3F6OA 1HLVA 1T95A 2HEOA 3NQOA 2IA0A 1TP4A 1KQ0A 1LVKA 1JKQC 2DA5A 3HUGB 4AWXB 4KDPA 4IHWA 4IHSA 1Z6RA 4U7BA 2WAQA 2KFDA 4DYQA 1LUJB 1GVDA 2LP0A 1B9MA 2OUMA 2JZYA 3MZYA 1TW3A 3TDZC 2P0WA 1NTCA 4XSZF 2NNYA 1MD0A 3GZ5A 1FYKA 1UAAA 4QPQA 4D1QA 2E1MB 3GUDA 4FHTA 2DODA 1MNMC 1VQKI 1G3SA 3FF5A 2FE3A 3D5RC 2BYVE 3GZ6A 1E17A 1OLTA 1DPUA 1GV5A 4FISA 3W6JB 5M5WJ 2EBIA 3CQZJ 4XONA 4KMFA 3ZPLA 1KA8A 5HDNA 4HF1A 3Q9VA 2AO9A 2ZC2A 2R7UA 2OQRA 5DD8A 1QU3A 2VODA 1YJ9I 3AG3H 4IX7A 2YX4A 1RKTA 3J80K 4L9VA 1X58A 5BOXA 3ABLH 2DFIA 4A3CJ 1S8NA 4ZDOA 2Q2EB 1MNDA 2KL4A 2BBYA 1OCRH 4I2OA 3M3YJ 2VXZA 1R4NB 2K9QA 3H5RA 3OS0A 3WHCA 1IXRC 3K1PA 3D1NI 1SANA 2Z33A 2IPQX 1E0EA 3CJRB 1OR7C 3J7AO 2DFHA 4ENKA 1BI2A 1R7JA 2RNGA 3WTWC 4I09A 3HJEA 1IXCA 1RETA 3LNQA 2JPBA 4LD5A 2JA6J 1FBQA 4BJ5C 5LD2C 2PMHA 4A3BJ 4FT8A 2H8WA 2ECCA 2W24A 1Z05A 5FGMA 4M9XA 4K2EA 5HDKA 2KZGA 2V26A 1P2FA 4XKCA 3KP6A 3DXJF 2F5VA 3I0TA 4A0ZA 4YFNF 5ILSA 1P7IA 2FEZA 4PJNA 1UB9A 3KEOA 4KT5C 2JA5J 3BP8A 4ZYGA 2BV6A 4D5FA 1LFPA 3HC7A 2ZMEB 1FIAA 4QPOA 3LSGA 3RSNA 1QO0D 2BVLA 4Q48A 3OYKA 1KYWA 4UV8A 2B63J 5DYMA 2WAQN 1R71A 5FLMJ 5FLXK 2RREA 3BTJA 2QA4I 1WFXA 1LE8A 1FZPB 5DCFA 2L9RA 5ERIA 4YIIA 2LBFB 4BL0B 2HFHA 5HDGA 2L5QA 3SFZA 3UKGA 4GFBA 4YELA 3BZ6A 2KIQA 1K78A 1XSXA 3ERMA 3HOSA 2BW3A 2P4WA 4RGXA 2ZJQF 2DA2A 1BR2A 3OR1C 3PO3J 4UV9A 1L3LA 3ASOH 2QQBA 2FU4A 2P5KA 2RVCA 1MKMA 4IOAF 2NOJB 3CUQA 1TBXA 3MMYB 3SQNA 2A61A 4DW6A 5J47A 4AIJA 1PUFA 2QGUA 4EM0B 4UB6C 4WF2A 1OPCA 2DFEA 4OWRB 2ZXHA 1VF9A 3F6VA 4PK4A 3RZDJ 2DCEA 1OFCX 4G6DA 2W1OA 4ZYAA 2LDUA 1ZR4A 4EMSA 4ESJA 5F0HA 2FQ3A 2Z16A 3Q0WA 5E17F 3MWMA 1JUSA 1YX5A 3P5JA 4MGRA 4XR6A 1ZG3A 2R5ZB 3S15J 2VPRA 1IXSB 5J1YA 1GLNA 3DTKA 5FD5A 4XK4A 1T33A 2O6GE 1BR1A 3LA2A 5J8FA 1O57A 3H5NA 1ZG1A 3VWBA 1IRZA 1ZH5A 1Z77A 1P9QC 3OL4A 5KAIC 3DKYA 1P7JA 3VSLA 2GBYA 3HPGA 2XPWA 3TGNA 2R3SA 4M73A 1X19A 2VIXA 1RUNA 1IZ1A 1REPC 4E7IA 3S1QJ 3EUAA 1OR7A 2Y75A 1J2XA 1IUYA 2IXSA 4BQNA 2TRTA 3L2UA 1T8IA 2ECBA 2VC0A 3EUHA 3FHNA 3F8CA 2DQRA 2HI3A 1D0YA 5J40A 3RPUA 5GAHJ 3U2RA 3W6VA 1VQOI 2HR3A 2NS7A 3CCUI 1IF1A 2B7EA 1SD4A 2VT2A 3BG7A 2OU2A 5BMZA 2QQAA 3M1EA 5E1ZB 3KCCA 4BXUA 1HW2A 1E2XA 4OU0A 1TWGJ 4BH9A 2CRGA 4N4NB 1AKHB 1XDSA 2FRHA 2DPUA 3I3LA 4ASNA 5FKKA 1G6NA 2VXDA 1W0UA 3PO2J 1E3OC 2M8EA 1I1SA 2XAUA 3H35A 5F1JA 3HOTA 2E1MC 3F8NA 4GCVA 3K70C 1LFUP 3KIOA 4IRGA 2DJIA 2VJ5A 3L2VA 4XMYA 4XRSG 2EJRA 2ZBKA 3DBLB 1K6YA 5DTDA 3W2WA 4CCJA 1J9IA 1QHHD 1R9TJ 3HSEA 3H5AA 1T0FC 2WAEA 2EIKH 2BXYA 3LWFA 3K4BA 2HTSA 4HEA2 1FOWA 2P8TA 2ZKZA 2I10A 3BJOA 1LPQA 1HOMA 3CP8A 2EV6A 3IRRA 1WJDA 3VYTB 4ZDLA 3E6CC 3CCMI 2VONA 1QZYA 3RIRA 2EV5A 4A3EJ 1SFKA 4NNJA 4IQ4A 2ID3A 3ZMDA 4M71A 3FMQA 2A6EF 2VJIA 1R1UA 2EZKA 3HRSA 4XOTA 1Z1DA 3I54A 2IGKA 5LLQA 4BDZA 4Y52J 4PZJA 3RPUD 5CPRB 1S7OA 2HS5A 4FCYA 1CF7A 3VPRA 4O3MA 2OV7A 3ZMVA 2XAHA 4MFEA 3OSGA 2IS2A 4D7MA 4BY7J 1K6OA 1FBSA 3JSOA 3OV8A 3L7WA 2K40A 3DCFA 3FDYA 4OMYA 3L2CA 3GLXA 5B66C 5L3CA 3LSRA 1YE9A 5KCMA 1U3EM 2QQ8A 4M6XA 3ABKH 3HIFA 4W97A 3OY9A 5IOZA 5LFAA 2FBHA 4MNUA 5K5RA 1XN7A 2HPMA 3SDGA 1ORKA 3JRCA 1MNEA 4O6JA 1P4AA 3CCQI 1QQIA 2YSRA 4BAYA 1OKRA 4IRHA 6PAXA 2WV0A 1R1VA 3BCAA 3VYUB 4HSTA 4MTEA 3LMMA 2M0MA 1T2KA 1S7EA 5H2FC 4RBOA 2NVQJ 1YW9A 4BS9A 1OCCH 3CCYA 3I58A 1R00A 3QPHA 4LB5A 2BOLA 2ZMEC 1B1BA 3MFKA 1MMNA 5HS8A 3RYRA 2TDXA 4ZJZA 2O9LA 1W4MA 1MSEC 3QWLA 3OYHA 3M4OJ 3ZQCA 2HWVA 3CCJI 4HNTA 2HQAA 5J4VA 2VBWA 1VTNC 2DMPA 3AG4H 3BR0A 5EGOA 5JLWA 2Y9ZA 1UCRA 2EA4A 2M30A 3HUGA 1BJAA 4A3FJ 4PJ0C 1IAWA 3V7SA 5ED4A 3W2VA 2LY2A 2KDOA 1N75A 5IP7J 2HVSA 2F5FA 2F4MB 3K4JA 3QOPA 1WJCA 3QU3A 4D0PA 5ILUA 3LSTA 4EGZA 1FEXA 2BXZA 1OYYA 2P5VA 3IAS2 2EFWA 1ZRDA 4BXXJ 1Z3XA 2OD5A 3WG9A 3DF8A 3EUKL 2A5YB 3TL4X 1UJ8A 3ZMUA 4ENMA 1YRNB 2IRFG 3GTOJ 2D2WA 4UUSA 1F5TA 2JN6A 4E6KG 5E1XA 4IVNA 2CGPA 2Y30A 1LFBA 3QQAA 1BIAA 3OR2C 1LQ1A 4JYKA 3RKWA 1WSUA 2M87A 2GIZA 3HOWJ 1V5GA 1CGPA 4C3IJ 2VBZA 3KYDB 3L2RA 1J59A 1Z21A 3PIPF 4HF0A 3ZXSA 4LK1F 3WG7H 3Q3SA 2EFOA 5J8CA 2K27A 4XLPF 4QTRA 1IRGA 1SFEA 5KHDA 4A3GJ 1USSA 3RTRA 3ZMTA 3GTKJ 3UNGC 3VSKA 4BQQA 5LEKA 3VOEA 2XAJA 1R5GA 2P7CB 1FY7A 4ITVA 2R7RA 3TKYA 4IKFA 1K4SA 3G3ZA 1ZLJA 5EG0B 5C44J 2AQFA 2XAQA 4M3FA 3R0JA 2ELHA 1ETOA 4FTHA 2VKDA 2OC6A 5ILVA 3VEPA 2LTPA 2W7NA 2ADUA 2DYSH 1LVAA 3LOCA 3D0SA 2VQCA 4II2A 1O7LA 2J5PA 4UB8C 2Y0SA 5CVVA 1H0MA 2R4GA 3PNVA 3GW2A 4XLEA 1ACIA 1ITYA 3FM5A 1D5YA 3H1CA 4BE2A 2F5EA 2KRCA 1O3TA 5GAGJ 4FE4A 3FXMA 1BOAA 2XAGA 1I6HJ 3BC8A 4L0ZB 3I5UA 1D1BA 2YS9A 3U9GA 3AFHA 4ZYHA 2A05A 5B1AH 4DNCA 3KYCB 1LNWA 1QZEA 1V5FA 4MEYF 1U5TA 2LF8A 4XLNF 1FNNA 2HYJA 3HSRA 1ZGAA 5L3DA 3R61A 2CO5A 2BHZA 1WJFA 1FJLA 3GTGJ 3WGHA 4Q5SF 1FLIA 2QWWA 1TC3C 2WTEA 2LBFA 4S05A 2H8RA 4LG0B 2NS0A 3BTCA 3SZPA 1AHDP 3JR9A 2E2IJ 4I7HA 2AHQA 1U9OA 4L5EA 9ANTA 3IRQA 2L01A 4I98B 3LSHA 3ZOBA 3HTSB 3HSFA 4EVIA 2DN0A 5JVTA 4H0EA 1IRXA 1A6IA 5HS9A 4L9NA 3V8KA 3KP7A 5CVIA 2V1DA 3KYLA 1UFMA 2QVOA 1Y8RB 1FWZA 1IJWC 4JX4A 1O3SA 5IT9Z 4P96A 2BY3A 3GBGA 2DFFA 4WXCA 2OAZA 4FE7A 1T6SA 2L7MP 3HOXJ 4AIHA 4B3XA 3HBLA 4HSRA 3B73A 4A3IJ 1DP7P 3ZRGA 4KIBA 1TW2A 2EIMH 3HM5A 3DLAA 1B59A 3IH2A 2CUJA 2Z3YA 2K3PA 2OJED 1DU0A 3CMEI 1HSTA 1UG2A 4RB1A 4L18B 3SZGA 2GXBA 1EF4A 3OYLA 3IC7A 4L9TA 2X6XA 1Z7UA 4FQGA 2V4JC 1JJ6C 3GFIA 3BJ6A 3JRIA 4U0VA 3O6BB 5F04A 2DYRH 3G1OA 2PI0A 2M2EA 4LG3A 4W1UA 4NBQA 5IYDJ 4CYCA 2X6YA 5E18F 2Q8KA 2RV8A 1ZGWA 3P7NA 4KN4X 2DI3A 2Y0SN 3K4CA 4CCOA 3MN2A 3RQIA 2F5CA 2OBPA 1ETXA 3ZMSA 1DU6A 3RJPA 3E0JB 1WKMA 5BQTA 3MZ8A 2DA6A 1BA5A 1W5SA 2PLYA 1MDMB 4DBRA 2PJPA 2O03A 4C2TA 1KGSA 3WTSC 4RB0A 4PFPA 4X0GA 4ENNA 3LSIA 5JHFA 3BR5A 2X6WA 3K2ZA 1YITI 5FO5A 3E1SA 3V8LA 2GLOA 3LQRA 2DT5A 3PSIA 4DIQA 1JJ8C 1AKHA 4HYEA 1VZ0A 4RS8A 4XQFA 2ISZA 5DCMB 5D4RA 4PJMA 1VI0A 4MLOA 2FUG2 3OYBA 1G3WA 2FMYA 1SMTA 3F23A 1JGGA 2L02A 2QKLB 4F55A 1MMGA 2VKEA 1N25A 2NXNB 4CZZA 1F9NA 1OYIA 3C1DA 3A01A 2L7FP 3K7AJ 5GP9A 4ZYEA 2KDZA 4KMUX 2CS3A 3H3UA 1K4TA 1MMDA 2MLGA 1IV6A 3DPTA 4KUMA 1Y1WJ 1QA6A 3SEZA 3I56I 1MMAA 3CMYA 2HDWA 1W7PB 4HA8A 2YPRA 5CLSA 2ELJA 4NC6A 3NRVA 2BGCA 3QPLA 2D45A 4LLNA 2PEXA 2QM3A 4P9UA 3PM1A 4BKXA 1D0XA 4HQEA 1TWCJ 4U88A 2GWRA 2ZNYA 4DJAA 3T8RA 4KIGA 2Z9OA 1MBHA 4YG2F 1XTAA 1GV2A 2ICWG 2E35A 4TV7A 3CMMA 2BHYA 1QNTA 2M7BA 2V9KA 4J01A 5DS9A 2CQ7A 4F3QA 3F22A 1XPXA 1YG2A 2BY0A 3BZCA 4R8HA 2WC2A 1R4MB 3QYFA 3E5XA 4PGGA 1WGXA 1QVUA 3T1BA 1T98A 3FXLA 1W36D 1RR8C 4E4HA 3LSJA 3JRFA 2R5YA 3LSKA 5LBQA 2DTZA 2HNHA 2QKMB 2PX9A 4BNCA 1V3FA 5GADJ 3HZJA 5J4YA 3R6SA 4FX4A 1HW1A 2DJNA 2XIGA 3F8MA 4ZYDA 2BVMA 2R92J 3I64A 5F64A 5LRSA 2R7WA 3JTHA 1FIPA 4ZC3A 1AOYA 1MH3A 5K7ZA 3H9GA 2K5CA 2R7FA 2UXNA 4QIWN 4XN0A 2K85A 4YIRX 4X1EA 2NAZA 3OYEA 1KQ9A 5F1RA 2DAOA 3ELKA 1XGMA 4EJWA 5JHUA 3E5UA 3QPSA 1R36A 2XHKA 3A2KA 3TOBA 1RNLA 3CCLI 2B0LA 3C2HA 1WCMJ 2X1CA 1OCPA 3S3MA 3OIQA 4BBSJ 5CVRA 2K9LA 4IOCF 1U0JA 4J00A 2VBXA 5E20A 3FXQA 3M8FA 5TJJA 3MCZA 4GRIA 5TISC 1X3UA 1D3YA 3CC2I 2RGVA 2ZXJA 2PJRB 3MKWB 3V7CA 5M5XJ 4OAZA 5M3MJ 3LSMA 4PGHA 4HNVA 1EJ9A 4UUVA 1D8JA 3HRMA 2V79A 2XKOA 3MVPA 3BG9A 4PCQA 1ZARA 3FKJA 4XRFA 3HOYJ 1E3HA 1Z7LA 2IA1A 3CD6I 5L3FA 4NUBA 2K3FA 1I3QJ 2FOWA 2GA1A 4XKBA 2HYFA 3DTIA 3IWFA 4AIKA 4CGZA 1NG7A 2M5WA 1GUUA 5HNFA 2MD0A 1IDZA 3T5XA 1X1PA 2ZJ2A 3BWGA 3FXJA 2ZFUA 2H27A 3IAM2 1UHWA 4XRSA 3R60A 1VQ6I 1Y39A 3W3CA 4A93J 3CCVI 4LLGF 1F1ZA 1XSDA 3OMYA 4HX4A 2M0CA 4ZTJA 4RLQA 1XX5A 4A5MA 2VQLA 2KLOA 2COMA 2O8XA 3O3KA 4CA0A 3B6CA 4U0WA 3LA7A 2F2EA 1TQMA 2K86A 1Z0XA 3BR6A 5IP6A 3EYIA 3DFGA 2E1CA 3G1MA 2PG4A 3W6KB 3GO5A 2ACJA 5GPAA 4IHTA 1G8XA 1H9GA 4IO9F 5JLXA 5M5YJ 3SJMA 3CMAI 2D1VA 4AD9A 2ETHA 1BC8C 2EWNA 1XCVA 3DTEA 4HBLA 2Z99A 1D1CA 1I27A 2KZVA 2KPMA 3G73A 4XL9A 2MW8A 2RNJA 2M7AA 3GLLA 4UHTA 3HKZA 2X51A 3RDIA 3BROA 2F48A 1O7FA 4CCLA 2M4KA 3FISA 5DD4A 4KISA 1IN5A 2GXGA 1YX3A 2M4GA 3OYCA 1Q1HA 1A31A 1RR7A 4IHVA 4A69C 1G4DA 2Y0MA 3OS2A 2GAUA 1I50J 2F4OB 3S8PA 4HV6A 3I59B 4A12A 4ZDPA 5CJ9A 4JBAA 5ICFA 4BEHA 2E1OA 2G7HA 5HOOA 1U8RA 2HKXA 2MH9A 2YUSA 5J1RA 4WCGA 4HQMA 1R1TA 3RCOA 1K79A 4HDUA 1ZKGA 4EQQA 2CWEA 2XGCA 2HYGD 2DQLA 3TO9A 3ZQHA 5FFZA 4A0YA 2WWYA 1PP8F 2M34A 2Z5UA 4I02A 3X2QH 3KP4A 1V5EA 1X1AA 4WWCA 4Q4ZF 3OS1A 2XV4S 4GYIA 5KK1A 2R7SA 3K69A 3CDIA 1SFUA 4M9ZA 2CFOA 5FFXA 1O3QA 1OCTC 3GTMJ 1KU9A 1A5JA 3HPHA 4XBFA 3BR2A 4RDUA 2E2JJ 2JVHA 1X1CA 2EV0A 2ME0A 3CCRI 3H3ZA 4NQWA 4I0AA 1J5YA 1IDYA 5E3NA 3KZZA 2ZJRF 4BHCA 5BNGA 4ZH4F 5K1YA 1ZR2A 2V6CA 4XOPA 3S3NA 3CC4I 2VJ4A 1MSFC 5TGTA 1D5VA 2JJ7A 3HOVJ 1MJ9A 2J5OA 5EDNA 1YTYA 3M1CA 3HGYA 1AA7A 3LSPA 1ZRFA 2IW5A 5CVUA 1R5ID 4CHUA 2IGOA 2V1UA 5HLGA 1U6GA 1XGNA 1SD7A 1FT9A 1XGSA 3CLOA 3G1LA 1XSVA 1JXSA 2OTJI 3PFYA 5LEJA 2R7XA 1G2HA 1IV8A 2K9SA 2MFZA 1FSEA 4KICA 5JR3A 2I8DA 3OYIA 4KNYA 4PFOA 3ZR8X 3S93A 1JGSA 2IVMA 1VQ4I 3A0BC 1JKOC 2IA2A 2LNBA 1R6RA 1Z9CA 5B1BH 4PJJA 5D5WB 1I39A 3HKZN 3PQKA 2QCOA 2VT3A 5DUKA 1WRJA 1KYZA 5F08A 5F0CA 4EM2A 3GZNB 1F43A 3NARA 2HQNA 4DQ2A 1XMXA 3P9CA 1B8IB 2VB6A 2UXXA 1NG6A 4C2UA 3I9V2 3OYFA 3OL3A 2L54A 1J0RA 2W25A 2VLAA 1LKXA 1BC7C 5IY5H 2LKPA 2LSOA 1AWCA 2NVXJ 1ZREA 3TBIA 4EEFG 1DUXC 2XC7A 1YI2I 2ESHA 1BIBA 4E7LA 2ZXIA 3OOPA 1XCBA 3CESA 1HW5A 3CLQA 4G12A 3CCEI 5CQGA 2JA2A 4X6AJ 1IG7A 1JTXA 5H6QA 1JUMA 4OMZA 1UG0A 3RYPA 1K83J 2DA7A 5IT9K 2IT0A 2BZTA 2X1DA 3RKYA 1YFHA 1FMVA 4I6ZA 1VQ8I 3C18A 4CXFA 4MQVA 2XF6A 1F36A 1ENHA 2RQPA 2V9PA 2JRTA 2BEOA 2BE5F 5A2QZ 4ANJA 5FROA 1PJRA 1ZTRA 4NDLA 4NC7A 2W4SA 4B09A 3O2PE 4LB6B 3I53A 1D0ZA 5D8LB 1VQLI 3MAJA 4G9YA 1QZZA 4F52A 2ZFWA 3TOAA 2MBFA 1VQ9I 1LDKB 5E3OA 3HYIA 4C30A 3BR1A 1QGPA 2PFBA 1W0TA 5ICGA 4U7DA 3T0YA 1FTZA 5C4XJ 5D4SA 4I99C 2FJ1A 5LGUA 2EZIA 4N0BA 5EZGA 1YYVA 1OCZH 2V9VA 3WTXC 1A6QA 3JW4A 2L9NA 2WB1A 1YS6A 2QF7A 2VPLA 2KRHA 2XB5A 2DU9A 5L3BA 5GPCA 4EJUA 4DGWB 3ABUA 5DDGA 4IL6C 2UWMA 3H36A 3DV8A 2MH2A 4GO1A 2O0YA 5J6XA 1FOKA 3FXOA 1ULYA 3WGIA 3ZQLA 2X85A 4E70A 3GYHX 4GGGA 3M8JA 5E79C 1R23A 4E7HA 2NRAC 1KONA 1A35A 2EINH 2FBIA 4LFUA 3K4MA 1B72B 1Z67A 2ESNA 2VQGA 3C3WA 3IH4A 2KP6A 1U2WA 4ETSA 1TWHJ 3ML6A 3U21A 4CICA 2XRNA 2JSPA 1RUOA 2CQXA 1EKEA 1POGA 2E2HJ 2N8GA 2E7WA 2GQQA 2FA5A 3NWTA 1T0FA 1QPIA 1FTTA 4XN3A 4M6YA 4BUPA 3NWSA 4U0YA 2LR8A 2ME6A 2DDAA 4EGYA 3KZIC 1R58A 2K4BA 2Y31A 2HOAA 2V1XA 2LLKA 2VC1A 1TNTA 1H8AC 4UNOA 1WJ5A 2FNAA 4A2UA 4V2FA 2HOTA 2Q2EA 2GA2A 3J7YJ 1IC8A 3J81Z 1J75A 4I76A 2H1LA 2ID6A 2E1NA 2DBBA 1TNSA 2F4IA 4OINF 5K7HA 2IBDA 3A4CA 3ZN1A 2L9VA 3BOQA 3LFKA 1E3PA 2CYYA 3QP6A 2XSDC 4HX8A 4BDYA 3O8HA 5FKLA 1QPMA 3BTIA 3HRTA 1FP1D 3JSPA 1BN5A 1Y1VJ 5FLVA 2MSYA 1YLFA 3DP7A 2H6CA 5EEGA 4U87A 4QLCU 2OTLI 2OZUA 1R5HA 1ZYRF 4B3AA 2FNPA 4DYRA 2JA7J 1JKPC 2VL8A 2MYSA 2VJJA 4CZCA 2HU9A 1Z3YA 4M72A 2EQRA 1U78A 1SVOA 2VOOA 2P5LC 5L3GA 3VYSB 3JRBA 4GYGA 2VE8A 2UZKA 1RKWA 2GXAA 3KLNA 1YIJI 3KZYA 2KMUA 5EEHA 3SXYA 5FRNA 4BXFA 2KISA 2X9DA 1IN7A 3K70D 4DBQA 1BBYA 2VUMJ 3PNYA 3CF5F 3H0DA 5DEQA 1K78B 2PBIA 2BY2A 2MGQA 4HZFA 2CUZA 3DPUA 3MZHA 2BW3B 2RQQA 2VOPA 1TT5B 4JQFA 3ZQGA 5HODA 4A3KJ 3K4NA 1I6XA 2WB1N 5LHIA 5E8IA 3CUQB 4N9IA 2EK5A 2ZMEA 3BQZA 5EJCA 2K9MA 1K61A 4WXDA 2YX7A 3F72A 2CV1A 1H89C 3DKXA 2AS5F 4C3JJ 4L0YB 1EV7A 4RAYA 3ROUA 4Z6YA 4UY8I 4WK8F 1QVTA 5B5EC 1KU2A 3S3OA 2OA4A 3WODF 3CZ6A 1MJBA 5D6EA 3QU6A 1JKRC 1Y0NA 5IOYA 1IRFA 1KZHA 3K6GA 3KLOA 3S1MJ 4F7ZA 4Z2YA 1TL8A 2KIFA 1H88C 4E7JA 4S04A 3CC7I 2LOOA 1X1BA 3WTYC 1BI1A 3ULQB 2JUCA 2LY1A 1JHFA 2AXTC 3M9AA 1NH3A 3EQLF 3OOUA 5DM7F 2HXIA 2EZHA 3OYGA 2FF4A 2IS6A 4XLFA 3P9KA 3QP5A 3Q0VA 3WGGA 3DQVC 1V55H 2OZ6A 4HG2A 4M6VA 1EA3A 1S7AA 2V6EA 1UHSA 3H92A 2R7ZJ 2JSCA 4HPQA 1VFCA 2HVRA 2R5ZA 3CJTB 2ZCWA 2PMZA 4I01A 5IPAA 1I5ZA 2KT0A 2VBYA 3IHUA 2OQGA 4ABZA 3TDUC 2E34A 2IEKA 2JK3A 1YO5C 1GT0C 1RPWA 5IYBJ 3WTZA 3E97A 3DBHB 3F8BA 2YU3A 4BHBA 4ESBA 3OYDA 2E19A 1VQMI 1XS9A 2E7XA 4EATA 5GAEJ 1SD5A 1KU3A 5EZHA 1YS7A 3DWLE 3GMEA 2OPTA 3BY6A 5DV5A 1PUEE 3GFJA 4RAGA 3TQNA 5BPIA 2P6SA 3FK6A 3REOA 5M3FJ 1QHGA 2CV0A 2A5WA 1HKTA 3GVAA 1XC5A 3F21A 4A3JJ 3A02A 4A0XA 4KFCA 5TRDA 4P55A 4LK0F 1P4XA 2E60A 2UV1A 3ONQA 2LKSA 5E3LA 2CFXA 2DA3A 3HGGA 3BTLA 4RGRA 2CH0A 4CH7A 3GFMA 2A69F 3GWZA 1YJNI 2IJLA 3E6BA 1ETWA 2XGEA 4IXAA 5CYVA 1B6AA 4BJ6C 3J7AY 1T56A 2WY8Q 3EETA 1XG1A 3FZVA 1X3WB 3PNTA 1VQ7I 3CUOA 2GOMA 2HTJA 1MIJA 5AONA 4XLHA 1R49A 2L3DA 3DBRB 4LIUA 4FASD 2L2OA 2OF7A 4KJZA 2YR2A 1X2MA 4ESFA 3AG2H 3IWZA 1XDUA 1DP3A 1CF7B 3CTAA 2LF7A 3TP0A 3WE3A 3BZKA 2Y9YA 3VODA 1ON1A 1OJLA 4G7ZF 2LVSA 3WTVC 4XKVA 5D8KB 3PUBA 5K7FA 2XGXA 1ZN2A 2ZXWH 4UVBA 2XROA 3HG9A 2A07F 1B4AA 3ISPA 4D5CA 4XICA 2X0LA 3TP3A 1UELB 3MKYB 3FIWA 3JAMK 5DUIA 4HX7A 2RKHA 1LB2A 4B1RA 2H1KA 1PYVA 2PMZN 1HSJA 3JRHA 3RKQA 4MHGA 5HLTA 4M3DA 1WH5A 4EJTA 5LHHA 2LD5A 1U8BA 2R7OA 2W84A 3WE2A 3A03A 2QZ8A 1RI7A 1RRJA 2OCEA 1F4KA 2FQ4A 4NC8A 1GVJA 2KRFA 3H0GJ 4PDKA 2LMDA 4UXNA 3S17J 1T39A 3TW7A 5L3EA 1O4XA 2PMUA 2Z2SB 4CDGA 3SZTA 3RI4A 1SC7A 2CG4A 2W82A 1TWAJ 4BE0A 3AG1H 3BG5A 3HOZJ 2FSWA 4CUGA 3BCBA 3ZQIA 1RESA 2WY7Q 1V54H 3ZP5A 1UMQA 5HNHA 1J09A 4P5OA 2JT1A 2WV1A 4UVAA 5EGOB 3R4KA 2KHMA 1IN4A 2HGCA 3SDBA 4MO7A 4E7SA 3L00A 4F92B 3GFLA 5HS7A 2ISYA 4AUXA 2KQRA 2K9NA 4UUTA 2RN7A 3LFUA 4HOBA 1FYLA 3SYTA 3RZOJ 4P1WA 4YFXF 3CUQC 3CDHA 1I1GA 1O3RA 3DU5A 3HHGA 3HEFA 3LQQA 4O5VA 3OIPA 3CF2A 3S1NJ 1U9NA 2QYOA 3LAPA 1ZQ3P 4NHJA 3GF2A 4L9JA 2LK2A 1XB4A 4UUSB 1WJBA 4M3EA 4ENJA 3E6DA 4L5IA 4XIDA 2NS8A 3C2BA 3MKZA 3OWTA 1FOXA 2XB0X 1H9TA 1X4PA 1MGTA 1S9HA 4HLXA 4LJZF 3V4GA 2XUBA 5DM6F 2EB7A 1WHUA 3JRDA 4BACA 1ZK8A 3GTJJ 2D5VA 1ETVA 2A6TA 2XPUA 3BLYA 3IL2A 4JX6A 1FPQA 1KQ8A 4IQJA 2CW7A 2JRMA 5CKTA 5FKNA 3E3VA 1JT6A 2R0QC 2GIVA 1B72A 2KKOA 1K7AA 3EPZA 4YFKF 1HA8A 2ELKA 1YRNA 5LGTA 1GHCA 5KVRA 2EIJH 3KE2A 2L4AA 4RGUA 3V42A 3DEUA 2V7FA 3S16J 4BGDA 3LL7A 3M07A 2MD5A 3M7GA 1BR4A 3EUHC 4FETA 2DK5A 3F8FA 3BJAA 4LGWA 2IS1A 1IN6A 2O5RA 4V2GA 3VB2A 4B43A 2XRLA 3CO7C 3K1NA 3KEQA 1ZG5A 2XPVA 1BI3A 1MZBA 4XLAA 3T8TA 4M74A 1AU7A 4D9JA 1FOYA 2P6TA 1TQPA 4MIMA 1XMKA 4HLYA 4LMYA 1LEBA 2QUFA 3HL2A 1YHQI 1HDPA 1IGNA 1XGOA 5AIQA 4F91B 5EG0A 2WA0A 2XDVA 3EYYA 3RQ4A 3WU2C 2JVGA 2DMTA 1HC8A 1XMAA 4II3A 4Y33A 5E1WA 5A2QK 1ZGJA 5LHGA 4NB5A 3K9TA 4MEXF 4Y17A 3I71A 2I5UA 5FKMA 1U5TB 3JTGA 4C2MJ 2R7QA 4P9FA 4IF4A 2KIMA 3S1RJ 2F5DA 1WH7A 4EJOA 2FXAA 2JPCA 2X48A 4JK1X 4LITA 5CQEA 3FBNB 3ZCOA 1WZ2A 2AQEA 4CCKA 4HAMA 4M3GA 2DA4A 2ZNZA 4B48A 3LAJA 4M9SA 3COAC 3FBIB 2DLLA 4ZZLA 2EZLA 3QYBA 2KIUA 4AC0A 1SFOJ 2CV2A 2KJCA 5J3LA 3IKVA 4OOIA 3JAMZ 2EH3A 2ZSIB 3KEYA 3WTTC 3OYJA 2HXOA 4DZPA 4RGSA 2L4MA 2PQ8A 1G3YA 2CQQA 2DOAA 4FX0A 2DW4A 3GXOA 4LG0A 4R79A 4Y15A 4N9HA 1MW7A 1TT0A 2G0EA 1ZLKA 2W48A 2QBYB 1JHHA 1VQNI 5IT3A 4YRVA 5C4JJ 1X4OA 3N05A 1UHMA 2NVYJ 2MG4A 4Y3OA 3F3XA 1FX7A 3TW6A 2TCTA 3W2AA 2NVUB 4LIVA 3GEZA 4WX9A 4KT6A 5FJ8J 4GXOA 1SAUA 3D5SC 2XF5A 3PIOF 1BL0A 3BR3A 2ZSHB 2DMUA 1YW8A 1SVLA 4RLFA 4JOMA 3S32A 1LEAA 1D8KA 2HZTA 2Z1DA 4HRIA 1DGRM 3QODA 2M8GX 1HBXG 3VYRB 3WU1B 4CYCB 3E7LA 3FMSA 3J81K 3VFZA 4IJAA 2Y2ZA 4AYBA 3S2WA 1YJWI 1JT0A 2L9SA 1NK2P 4KIFA 3A1YA 1OISA 5HVQC 4V19K 3UR3C 1SVMA 2HQ5A 4IHXA 4A3LJ 4IPAA 2RDPA 2O61A 1MMSA 1OYWA 2NVTJ 2H09A 1TQIA 2O8KA 1S6LA 1X1DA 2LKXA 2MA3A 4JP0A 4N4OB 1HQCA 2DDBA 1YIOA 3ZGKA 5ICCA 1WVRA 1ZELA 2X1EA 3L2WA 4LOCA 3TEDA 2GZWA 1MBKA 1S3JA 4XLCA 1OCOH 3OYNA 4A6DA 3IKTA 4YEJA 1JUPA 2G7UA 2HZDA 2QENA 2X6OA 5IYCJ 3DLLF 2DMNA 3OIOA 4MFDA 1GXQA 4ZTFA 4GDFA 1WJAA 3PFIA 1Y0UA 2LYCA 4A6EA 2DT7B 4Y7NJ 2EFNA 3G6EI 4BBRJ 3BPXA 3JRAA 2IGMA 4XORA 5CVJA 3J80Z 1ERDA 3HRUA 3CDLA 1Y8QB 2XKPA 4Q47A 2A6HF 2M3AA 1DPRA 2IAIA 2L7KA 1LJ9A 2NNNA 1USTA 3P9IA 2B9SA 4D7NA 5LGNA 4IEJA 5F0FA 3A01B 1MDMA 3KFWX 3E6MA 4B4CA 2R93J 1SD6A 3KP5A 3K10A 2BY1A 4DZJA 2RC4A 2RAEA 3FXUA 1M1EB 5HLIA 1W1WE 1X3ZB 1BW5A 2VN2A 4Y4RA 2CQKA 3JCUC 4YIFA 1VQ5I 1EH6A 4OIPF 3ZQFA 3BDDA 2HDCA 2Q1ZB 5DCMA 3L2QA 1HKSA 3TO7A 3FWEA 2JWTA 4E7ZA 3K4LA 3Q0UA 2LRDA 2M9HA 2WBMA 1FYMA 1D1AA 1OMIA 1WJEA 4HW0A 1DDNA 1V4RA 2DTRA 3LA3A 5EEAA 5KNLA 2ZJPF 2FBKA 1JI8A 2CUEA 2W00A 4MTDA 3GTPJ 3DEEA 3IP4B 5EYRA 1ETKA 2COBA 2LC2A 1HDDC 3C7JA 3NEUA 2VKHA 4AIDA 3Q5FA 3CP2A 5H6RA 2HOEA 1TWFJ 4AU7A 3F0CA 1WI3A 3DPLC 5GTHC 1Z6TA 1W7PA 3ECOA 1HXDA 1ZRCA 1TTYA 2STWA 4AYBN 2CUFA 3QPTA 3TMOA 1FP2A 5FLXZ 3KETA 2R5YB 2DXIA 1YOVB 5JVGF 1N78A 3HOUJ 4OIQF 1IO2A 1PVEA 4OAYA 5D6FA 4C3HJ 1MBEA 3Q9SA 3H9QA 4M3BA 1TLHB 4OIOF 1ODDA 5B3SH 1DQUA 4G94A 3HHHA 3QOEA 1WWXA 3RPQA 3QRFF 4BQOA 2QSFX 1R22A 4KA4A 1B9NA 1SAXA 4RM2A 2E36A 3ZQ7A 1SEUA 1EH8A 1FC3A 2EFPA 4QSHA 2P7VB 4A5NA 3S14J 3SEQA 1U5TC 1RIOH 1RZ4A 3I4PA 1NHAA 2VASA 2FD5A 1NK3P 3B6AA 4G8XA 4BY1J 2NYXA 2QSHX 3IUOA 2VI6A 4G6QA 2IP2A 3C2GA 5D5XB 1MH4A 2JQ7A 5HLHA 1T38A 1BI0A 1G59A 5FRMA 1Q1VA 2R7DA 4KITB 1EH7A 1WQ2A
chains in the Genus database with same CATH topology
4AVPA 3EDPA 2CSOA 1W7PD 4UVCA 1LDDA 1W5TA 4WXHA 3U1DA 2XAFA 4XSXF 3CO6C 3WU0A 3KP3A 3PQJA 3ERED 4Y13A 1FBUA 4KN7X 4B8XA 1BM9A 1P6RA 5JI6A 3E5QA 2MC3A 4R1HA 3N4MA 5F6FA 2DO7A 2QLZA 2JTVA 3M8EA 1GXPA 1LDJA 4RB2C 2Q0OA 5LRRA 2XASA 5E8GA 1EH7A 2MLKA 3AAFA 2DK8A 2Y48A 1ONVA 4LLLA 2ZO4A 4CYDA 5K5QA 4G7OF 1ZHFA 2O3FA 3BPVA 5D5VB 2K4JA 3ABTA 4KYWA 2STTA 3CJNA 4RB3C 4QWQA 2C6YA 2A68F 2AXLA 5D5UB 1C0WA 3WTUC 4BYYA 2M1BA 5AIPA 3FXRA 3FHZA 1Z91A 3K1MA 1L0OC 2H6BA 5FB2A 1SFXA 2XVCA 3L09A 4OIRF 3K0LA 2HKOA 5JFRA 1PDNC 2K02A 2FOKA 4G7HF 3V8JA 4HDVA 3I59A 4HV5A 3B02A 3HTUA 1QBJA 3MQ0A 2X4HA 1A04A 4BHPA 1P92A 1WI9A 3N97A 2QBYA 1STZA 4ZZDA 2PN6A 3FM3A 2A3SA 1ZAOA 4ON0A 1MJAA 1P4WA 3KP2A 4MQ9F 1S29A 1G3TA 4HF2A 5FD6A 3D5LA 3V7RA 1IW7F 3R0AA 1ON2A 2W85A 2VE9A 1PP7U 2EA2A 3QAHA 2FMLA 2D1HA 2G9WA 4RAZA 3RKXA 5H20A 2EFQA 2W57A 3FMRA 2QQ9A 5ICEA 4L5JA 3L9FA 1IN8A 1YQAA 3FX3A 1XD7A 5K5OA 1SMYF 5BS6A 3ZN0A 4CO8A 2M45A 3TO6A 4EM1A 3DKWA 1J7KA 2HQRA 1YW7A 5BPDA 1HKQA 4EV0A 1KU7A 2KJBA 1FSHA 1JE8A 4EJVA 3SHFA 2H94A 4BQAA 2K7LA 4IRIA 3ZMZA 3ECHA 3MEXA 4I0BA 3GX4X 2CW0F 2DPDA 3F6OA 2HEOA 3NQOA 2IA0A 1KQ0A 4AWXB 4KDPA 4IHSA 1Z6RA 4U7BA 1B9MA 2JZYA 3MZYA 1TW3A 3TDZC 2NNYA 4XSZF 1MD0A 3GZ5A 1FYKA 4FHTA 3GUDA 1G3SA 3FF5A 2FE3A 2BYVE 3GZ6A 1E17A 1DPUA 3W6JB 4KMFA 3ZPLA 1KA8A 5HDNA 4HF1A 3Q9VA 2OQRA 5DD8A 2VODA 2YX4A 3J80K 4L9VA 5BOXA 2DFIA 1S8NA 2BBYA 4I2OA 2VXZA 1IXRC 3K1PA 2Z33A 2IPQX 3J7AO 4ENKA 1BI2A 1R7JA 3WTWC 4I09A 1IXCA 2JPBA 4LD5A 1FBQA 2PMHA 4FT8A 2W24A 1Z05A 5FGMA 4M9XA 4K2EA 5HDKA 1P2FA 3KP6A 3DXJF 4A0ZA 3I0TA 4YFNF 5ILSA 2FEZA 1UB9A 3KEOA 4KT5C 3BP8A 4ZYGA 2BV6A 2ZMEB 1QO0D 4Q48A 1KYWA 4UV8A 5DYMA 5FLXK 1FZPB 5DCFA 5ERIA 4YIIA 2HFHA 5HDGA 3SFZA 3BZ6A 1K78A 1XSXA 3HOSA 2P4WA 4RGXA 4UV9A 1L3LA 2QQBA 2FU4A 2P5KA 2RVCA 1MKMA 3CUQA 1TBXA 3SQNA 2A61A 4AIJA 4EM0B 4WF2A 1OPCA 3F6VA 4G6DA 2LDUA 4EMSA 4ESJA 2FQ3A 5E17F 3MWMA 4MGRA 1ZG3A 1IXSB 5FD5A 2O6GE 3LA2A 5J8FA 1O57A 1ZG1A 1ZH5A 3TGNA 2R3SA 4M73A 1RUNA 1IZ1A 1REPC 1OR7A 2Y75A 1J2XA 1IUYA 2VC0A 3EUHA 3F8CA 2DQRA 3RPUA 3U2RA 2HR3A 1IF1A 1SD4A 2VT2A 2OU2A 5BMZA 2QQAA 3M1EA 5E1ZB 3KCCA 4BXUA 1HW2A 1E2XA 4OU0A 4BH9A 1XDSA 2FRHA 2DPUA 4ASNA 1G6NA 2M8EA 1I1SA 3HOTA 3F8NA 4GCVA 4IRGA 2EJRA 2ZBKA 1J9IA 3HSEA 3LWFA 2HTSA 2P8TA 2ZKZA 3BJOA 2EV6A 3IRRA 3E6CC 2VONA 1QZYA 3RIRA 2EV5A 3ZMDA 4M71A 3FMQA 2A6EF 1R1UA 3HRSA 5LLQA 1Z1DA 3I54A 4PZJA 1S7OA 2HS5A 1CF7A 4O3MA 3ZMVA 2XAHA 1K6OA 1FBSA 3JSOA 3OV8A 3L7WA 4OMYA 3L2CA 3GLXA 5L3CA 1U3EM 4M6XA 3HIFA 2FBHA 4MNUA 5K5RA 1XN7A 4O6JA 1P4AA 1QQIA 2YSRA 4BAYA 1OKRA 4IRHA 6PAXA 2WV0A 1R1VA 4MTEA 1T2KA 1YW9A 3I58A 4LB5A 3QPHA 1R00A 1B1BA 3MFKA 5HS8A 3RYRA 2TDXA 1W4MA 2HWVA 2VBWA 1VTNC 1UCRA 2EA4A 2M30A 3HUGA 1BJAA 1IAWA 3V7SA 5ED4A 2F5FA 3QOPA 3QU3A 4D0PA 5ILUA 3LSTA 4EGZA 1OYYA 2P5VA 2EFWA 1ZRDA 2OD5A 3WG9A 3DF8A 3ZMUA 2A5YB 2IRFG 4ENMA 2D2WA 1F5TA 5E1XA 4IVNA 2CGPA 1BIAA 1LQ1A 3RKWA 1WSUA 2M87A 1CGPA 2VBZA 1J59A 4HF0A 4LK1F 2EFOA 5J8CA 2K27A 4XLPF 1IRGA 1SFEA 1USSA 3RTRA 3ZMTA 5LEKA 3VOEA 2XAJA 1R5GA 2P7CB 1FY7A 3TKYA 3G3ZA 1ZLJA 2XAQA 3R0JA 2ELHA 5ILVA 3VEPA 2ADUA 1LVAA 3D0SA 1O7LA 2J5PA 5CVVA 1H0MA 3GW2A 3FM5A 2F5EA 1O3TA 1BOAA 2XAGA 4L0ZB 3I5UA 3U9GA 4ZYHA 4DNCA 1LNWA 4MEYF 1U5TA 2LF8A 4XLNF 1FNNA 3HSRA 1ZGAA 5L3DA 3R61A 2CO5A 3WGHA 4Q5SF 1FLIA 2QWWA 2WTEA 4S05A 4LG0B 2NS0A 3SZPA 4I7HA 3IRQA 2L01A 4I98B 3HTSB 3HSFA 4EVIA 5JVTA 4H0EA 5HS9A 4L9NA 3V8KA 3KP7A 5CVIA 2V1DA 1UFMA 2QVOA 1FWZA 1O3SA 5IT9Z 4P96A 4WXCA 2OAZA 1T6SA 4AIHA 3B73A 1DP7P 4KIBA 1TW2A 1B59A 2Z3YA 1HSTA 4RB1A 4L18B 2GXBA 3IC7A 4L9TA 1Z7UA 3GFIA 3BJ6A 4U0VA 3O6BB 2PI0A 5E18F 2Q8KA 2RV8A 3P7NA 4KN4X 2DI3A 2F5CA 2OBPA 3ZMSA 3RJPA 1WKMA 5BQTA 1W5SA 2PLYA 1MDMB 2PJPA 2O03A 1KGSA 3WTSC 4RB0A 4ENNA 3K2ZA 5FO5A 3V8LA 3LQRA 2DT5A 4HYEA 4RS8A 2ISZA 5DCMB 5D4RA 1G3WA 2FMYA 1SMTA 3F23A 2L02A 4CZZA 1F9NA 1OYIA 3C1DA 4ZYEA 4KMUX 3H3UA 2MLGA 3DPTA 4KUMA 1W7PB 4HA8A 2YPRA 5CLSA 3NRVA 2BGCA 2D45A 4LLNA 2PEXA 2QM3A 4P9UA 4HQEA 4U88A 2GWRA 2ZNYA 3T8RA 4KIGA 2Z9OA 4YG2F 4TV7A 1QNTA 3F22A 1YG2A 4R8HA 2WC2A 3E5XA 4PGGA 3T1BA 1T98A 5LBQA 4BNCA 1V3FA 3R6SA 4FX4A 1HW1A 2XIGA 3F8MA 4ZYDA 3I64A 5F64A 5LRSA 3JTHA 1AOYA 2R7FA 2UXNA 2NAZA 1KQ9A 5F1RA 2DAOA 3ELKA 1XGMA 4EJWA 5JHUA 3E5UA 1R36A 2XHKA 3TOBA 1RNLA 2B0LA 5CVRA 2VBXA 5E20A 3FXQA 3M8FA 5TJJA 3MCZA 1X3UA 1D3YA 2RGVA 2ZXJA 3V7CA 4PGHA 4UUVA 1D8JA 3HRMA 2V79A 2XKOA 4PCQA 1ZARA 4XRFA 2IA1A 5L3FA 2GA1A 2HYFA 3IWFA 4AIKA 4CGZA 2M5WA 3T5XA 2ZJ2A 3BWGA 2H27A 1UHWA 3R60A 4LLGF 1F1ZA 1XSDA 4HX4A 4A5MA 2O8XA 2COMA 3O3KA 4U0WA 3LA7A 2F2EA 1TQMA 2K86A 3EYIA 3DFGA 2E1CA 2PG4A 3W6KB 3GO5A 2ACJA 4IHTA 1H9GA 2D1VA 4AD9A 2ETHA 1BC8C 2EWNA 1XCVA 4HBLA 2Z99A 1I27A 3G73A 2RNJA 4UHTA 3RDIA 3BROA 1O7FA 5DD4A 1IN5A 2GXGA 1Q1HA 1G4DA 2Y0MA 2GAUA 4HV6A 3I59B 5CJ9A 4JBAA 5ICFA 2G7HA 5HOOA 1U8RA 2HKXA 2MH9A 4WCGA 4HQMA 1R1TA 1K79A 4HDUA 4EQQA 2CWEA 2HYGD 2DQLA 3TO9A 4A0YA 5FFZA 2WWYA 1PP8F 2Z5UA 4I02A 3KP4A 4WWCA 4Q4ZF 2XV4S 4GYIA 5KK1A 3K69A 1SFUA 4M9ZA 5FFXA 1O3QA 1KU9A 4XBFA 2EV0A 3H3ZA 4NQWA 4I0AA 1J5YA 3KZZA 4BHCA 4ZH4F 5K1YA 2V6CA 1D5VA 1MJ9A 2J5OA 1YTYA 1ZRFA 2IW5A 5CVUA 4CHUA 2V1UA 5HLGA 1U6GA 1XGNA 1SD7A 1FT9A 1XGSA 3CLOA 1XSVA 1JXSA 5LEJA 1FSEA 4KICA 5JR3A 4KNYA 1JGSA 2IVMA 2IA2A 2LNBA 1Z9CA 5D5WB 3PQKA 2VT3A 5DUKA 1WRJA 1KYZA 4EM2A 2HQNA 4DQ2A 3P9CA 2UXXA 2L54A 1J0RA 2W25A 1BC7C 2LKPA 2LSOA 1AWCA 1ZREA 1DUXC 2ESHA 1BIBA 3OOPA 1XCBA 1HW5A 5H6QA 4OMZA 3RYPA 5IT9K 2IT0A 3RKYA 1YFHA 3C18A 4CXFA 4MQVA 2RQPA 2JRTA 2BEOA 2BE5F 5A2QZ 4B09A 3O2PE 4LB6B 3I53A 5D8LB 3MAJA 4G9YA 1QZZA 2ZFWA 3TOAA 2MBFA 1LDKB 3HYIA 1QGPA 2PFBA 5ICGA 4U7DA 3T0YA 5D4SA 5LGUA 4N0BA 1YYVA 2V9VA 3WTXC 3JW4A 1YS6A 2DU9A 5L3BA 4EJUA 3ABUA 5DDGA 2UWMA 3DV8A 2MH2A 4GO1A 2O0YA 5J6XA 1FOKA 1ULYA 3WGIA 4E70A 3GYHX 4GGGA 1R23A 2NRAC 2FBIA 4LFUA 2ESNA 3C3WA 1U2WA 4ETSA 3ML6A 4CICA 2XRNA 1RUOA 2E7WA 2GQQA 2FA5A 1T0FA 4M6YA 4U0YA 4EGYA 1R58A 2K4BA 2V1XA 2VC1A 1TNTA 4UNOA 2FNAA 4A2UA 2Q2EA 2GA2A 3J81Z 1J75A 2E1NA 2DBBA 1TNSA 4OINF 3ZN1A 3BOQA 3LFKA 2CYYA 3QP6A 4HX8A 1QPMA 3HRTA 1FP1D 3JSPA 1BN5A 1YLFA 3DP7A 2H6CA 5EEGA 4QLCU 2OZUA 1R5HA 1ZYRF 2FNPA 4M72A 1U78A 2VOOA 2P5LC 5L3GA 4GYGA 2VE8A 2UZKA 3KLNA 3KZYA 5EEHA 3SXYA 1IN7A 1BBYA 5DEQA 1K78B 2PBIA 4HZFA 3MZHA 2VOPA 4JQFA 1I6XA 5LHIA 5E8IA 3CUQB 4N9IA 2EK5A 2ZMEA 4WXDA 2YX7A 3F72A 2AS5F 4L0YB 1EV7A 4RAYA 3ROUA 4WK8F 1KU2A 2OA4A 3WODF 1MJBA 5D6EA 3QU6A 1IRFA 3KLOA 4F7ZA 4Z2YA 2KIFA 4S04A 3WTYC 1BI1A 3ULQB 1JHFA 3M9AA 3EQLF 2FF4A 3P9KA 3QP5A 3WGGA 3DQVC 2OZ6A 1S7AA 3H92A 2JSCA 2ZCWA 4I01A 1I5ZA 2VBYA 3IHUA 2OQGA 3TDUC 1YO5C 3WTZA 3E97A 3F8BA 2YU3A 4BHBA 4ESBA 2E7XA 1SD5A 1KU3A 1YS7A 5DV5A 3BY6A 1PUEE 3GFJA 3TQNA 5BPIA 2P6SA 3REOA 1HKTA 3GVAA 3F21A 4A0XA 4KFCA 5TRDA 4P55A 4LK0F 1P4XA 2CFXA 4RGRA 3GFMA 2A69F 3GWZA 2IJLA 3E6BA 4IXAA 5CYVA 1B6AA 3EETA 3FZVA 3CUOA 2HTJA 5AONA 2L3DA 2YR2A 4ESFA 3IWZA 1XDUA 1CF7B 3CTAA 2LF7A 3WE3A 3VODA 1ON1A 4G7ZF 3WTVC 5D8KB 2XGXA 1ZN2A 4UVBA 2XROA 2A07F 1B4AA 3ISPA 2X0LA 3JAMK 5DUIA 4HX7A 2RKHA 1LB2A 1HSJA 4MHGA 4EJTA 5LHHA 2W84A 3WE2A 2QZ8A 1RI7A 1F4KA 1GVJA 2KRFA 4UXNA 4PDKA 1T39A 5L3EA 2PMUA 4CDGA 3SZTA 3RI4A 2CG4A 2FSWA 3ZP5A 4P5OA 2JT1A 4UVAA 3R4KA 1IN4A 2HGCA 3L00A 3GFLA 5HS7A 2ISYA 2RN7A 4HOBA 1FYLA 4YFXF 3CUQC 3CDHA 1I1GA 1O3RA 3HHGA 3LQQA 4O5VA 2QYOA 3LAPA 4NHJA 3GF2A 4L9JA 1XB4A 4ENJA 3E6DA 4L5IA 1H9TA 1MGTA 4HLXA 4LJZF 3V4GA 2XUBA 2EB7A 3IL2A 1FPQA 1KQ8A 3E3VA 2GIVA 2KKOA 1K7AA 4YFKF 1GHCA 5LGTA 5KVRA 3KE2A 2L4AA 4RGUA 3DEUA 2MD5A 3M7GA 2DK5A 3F8FA 3BJAA 4LGWA 1IN6A 3VB2A 3CO7C 3K1NA 3KEQA 1ZG5A 1BI3A 1MZBA 3T8TA 4M74A 2P6TA 1TQPA 1XMKA 4HLYA 4LMYA 1LEBA 2QUFA 1XGOA 5AIQA 3EYYA 1XMAA 5E1WA 5A2QK 1ZGJA 5LHGA 4NB5A 3K9TA 4MEXF 4Y17A 3I71A 1U5TB 3JTGA 4P9FA 4IF4A 2KIMA 2F5DA 4EJOA 2FXAA 2JPCA 4JK1X 4HAMA 2ZNZA 3LAJA 4M9SA 3COAC 4ZZLA 2DLLA 2KIUA 2KJCA 3IKVA 4OOIA 3JAMZ 3WTTC 4RGSA 2L4MA 2PQ8A 1G3YA 4FX0A 2DW4A 3GXOA 4LG0A 4R79A 4Y15A 4N9HA 1ZLKA 2QBYB 1JHHA 5IT3A 1UHMA 3F3XA 1FX7A 3GEZA 4WX9A 4GXOA 1YW8A 1LEAA 1D8KA 2HZTA 1HBXG 3WU1B 3FMSA 3J81K 3VFZA 4IJAA 3S2WA 4KIFA 5HVQC 4IPAA 2RDPA 2O61A 1OYWA 2H09A 1TQIA 1S6LA 2MA3A 1HQCA 1YIOA 5ICCA 2GZWA 3IKTA 1S3JA 4A6DA 2G7UA 2QENA 1GXQA 3PFIA 1Y0UA 4A6EA 2EFNA 3BPXA 5CVJA 3J80Z 3HRUA 2XKPA 4Q47A 2A6HF 1DPRA 2NNNA 1LJ9A 3P9IA 1USTA 5LGNA 1MDMA 3KFWX 3E6MA 1SD6A 3KP5A 2RC4A 3FXUA 5HLIA 2VN2A 2CQKA 4YIFA 1EH6A 4OIPF 3BDDA 2HDCA 5DCMA 1HKSA 3TO7A 3FWEA 1FYMA 1OMIA 4HW0A 1DDNA 1V4RA 2DTRA 3LA3A 2FBKA 4MTDA 3C7JA 3NEUA 3Q5FA 5H6RA 2HOEA 3DPLC 1Z6TA 1W7PA 3ECOA 1HXDA 1ZRCA 1TTYA 2STWA 3QPTA 1FP2A 5FLXZ 3KETA 4OIQF 5D6FA 3Q9SA 1TLHB 4OIOF 1ODDA 4G94A 3HHHA 1WWXA 3RPQA 3QRFF 1R22A 4KA4A 1B9NA 1SAXA 3ZQ7A 1EH8A 1FC3A 2EFPA 4A5NA 2P7VB 1U5TC 1RIOH 1RZ4A 3I4PA 1NHAA 4G8XA 2NYXA 4G6QA 2IP2A 5D5XB 5HLHA 1T38A 1BI0A 2R7DA 4A12A 1WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVP A;  3EDP A;  2CSO A;  1W7P D;  4UVC A;  1LDD A;  1W5T A;  4WXH A;  3U1D A;  2XAF A;  4XSX F;  3CO6 C;  3WU0 A;  3KP3 A;  3PQJ A;  3ERE D;  4Y13 A;  1FBU A;  4KN7 X;  4B8X A;  1BM9 A;  1P6R A;  5JI6 A;  3E5Q A;  2MC3 A;  4R1H A;  3N4M A;  5F6F A;  2DO7 A;  2QLZ A;  2JTV A;  3M8E A;  1GXP A;  1LDJ A;  4RB2 C;  2Q0O A;  5LRR A;  2XAS A;  5E8G A;  1EH7 A;  2MLK A;  3AAF A;  2DK8 A;  2Y48 A;  1ONV A;  4LLL A;  2ZO4 A;  4CYD A;  5K5Q A;  4G7O F;  1ZHF A;  2O3F A;  3BPV A;  5D5V B;  2K4J A;  3ABT A;  4KYW A;  2STT A;  3CJN A;  4RB3 C;  4QWQ A;  2C6Y A;  2A68 F;  2AXL A;  5D5U B;  1C0W A;  3WTU C;  4BYY A;  2M1B A;  5AIP A;  3FXR A;  3FHZ A;  1Z91 A;  3K1M A;  1L0O C;  2H6B A;  5FB2 A;  1SFX A;  2XVC A;  3L09 A;  4OIR F;  3K0L A;  2HKO A;  5JFR A;  1PDN C;  2K02 A;  2FOK A;  4G7H F;  3V8J A;  4HDV A;  3I59 A;  4HV5 A;  3B02 A;  3HTU A;  1QBJ A;  3MQ0 A;  2X4H A;  1A04 A;  4BHP A;  1P92 A;  1WI9 A;  3N97 A;  2QBY A;  1STZ A;  4ZZD A;  2PN6 A;  3FM3 A;  2A3S A;  1ZAO A;  4ON0 A;  1MJA A;  1P4W A;  3KP2 A;  4MQ9 F;  1S29 A;  1G3T A;  4HF2 A;  5FD6 A;  3D5L A;  3V7R A;  1IW7 F;  3R0A A;  1ON2 A;  2W85 A;  2VE9 A;  1PP7 U;  2EA2 A;  3QAH A;  2FML A;  2D1H A;  2G9W A;  4RAZ A;  3RKX A;  5H20 A;  2EFQ A;  2W57 A;  3FMR A;  2QQ9 A;  5ICE A;  4L5J A;  3L9F A;  1IN8 A;  1YQA A;  3FX3 A;  1XD7 A;  5K5O A;  1SMY F;  5BS6 A;  3ZN0 A;  4CO8 A;  2M45 A;  3TO6 A;  4EM1 A;  3DKW A;  1J7K A;  2HQR A;  1YW7 A;  5BPD A;  1HKQ A;  4EV0 A;  1KU7 A;  2KJB A;  1FSH A;  1JE8 A;  4EJV A;  3SHF A;  2H94 A;  4BQA A;  2K7L A;  4IRI A;  3ZMZ A;  3ECH A;  3MEX A;  4I0B A;  3GX4 X;  2CW0 F;  2DPD A;  3F6O A;  2HEO A;  3NQO A;  2IA0 A;  1KQ0 A;  4AWX B;  4KDP A;  4IHS A;  1Z6R A;  4U7B A;  1B9M A;  2JZY A;  3MZY A;  1TW3 A;  3TDZ C;  2NNY A;  4XSZ F;  1MD0 A;  3GZ5 A;  1FYK A;  4FHT A;  3GUD A;  1G3S A;  3FF5 A;  2FE3 A;  2BYV E;  3GZ6 A;  1E17 A;  1DPU A;  3W6J B;  4KMF A;  3ZPL A;  1KA8 A;  5HDN A;  4HF1 A;  3Q9V A;  2OQR A;  5DD8 A;  2VOD A;  2YX4 A;  3J80 K;  4L9V A;  5BOX A;  2DFI A;  1S8N A;  2BBY A;  4I2O A;  2VXZ A;  1IXR C;  3K1P A;  2Z33 A;  2IPQ X;  3J7A O;  4ENK A;  1BI2 A;  1R7J A;  3WTW C;  4I09 A;  1IXC A;  2JPB A;  4LD5 A;  1FBQ A;  2PMH A;  4FT8 A;  2W24 A;  1Z05 A;  5FGM A;  4M9X A;  4K2E A;  5HDK A;  1P2F A;  3KP6 A;  3DXJ F;  4A0Z A;  3I0T A;  4YFN F;  5ILS A;  2FEZ A;  1UB9 A;  3KEO A;  4KT5 C;  3BP8 A;  4ZYG A;  2BV6 A;  2ZME B;  1QO0 D;  4Q48 A;  1KYW A;  4UV8 A;  5DYM A;  5FLX K;  1FZP B;  5DCF A;  5ERI A;  4YII A;  2HFH A;  5HDG A;  3SFZ A;  3BZ6 A;  1K78 A;  1XSX A;  3HOS A;  2P4W A;  4RGX A;  4UV9 A;  1L3L A;  2QQB A;  2FU4 A;  2P5K A;  2RVC A;  1MKM A;  3CUQ A;  1TBX A;  3SQN A;  2A61 A;  4AIJ A;  4EM0 B;  4WF2 A;  1OPC A;  3F6V A;  4G6D A;  2LDU A;  4EMS A;  4ESJ A;  2FQ3 A;  5E17 F;  3MWM A;  4MGR A;  1ZG3 A;  1IXS B;  5FD5 A;  2O6G E;  3LA2 A;  5J8F A;  1O57 A;  1ZG1 A;  1ZH5 A;  3TGN A;  2R3S A;  4M73 A;  1RUN A;  1IZ1 A;  1REP C;  1OR7 A;  2Y75 A;  1J2X A;  1IUY A;  2VC0 A;  3EUH A;  3F8C A;  2DQR A;  3RPU A;  3U2R A;  2HR3 A;  1IF1 A;  1SD4 A;  2VT2 A;  2OU2 A;  5BMZ A;  2QQA A;  3M1E A;  5E1Z B;  3KCC A;  4BXU A;  1HW2 A;  1E2X A;  4OU0 A;  4BH9 A;  1XDS A;  2FRH A;  2DPU A;  4ASN A;  1G6N A;  2M8E A;  1I1S A;  3HOT A;  3F8N A;  4GCV A;  4IRG A;  2EJR A;  2ZBK A;  1J9I A;  3HSE A;  3LWF A;  2HTS A;  2P8T A;  2ZKZ A;  3BJO A;  2EV6 A;  3IRR A;  3E6C C;  2VON A;  1QZY A;  3RIR A;  2EV5 A;  3ZMD A;  4M71 A;  3FMQ A;  2A6E F;  1R1U A;  3HRS A;  5LLQ A;  1Z1D A;  3I54 A;  4PZJ A;  1S7O A;  2HS5 A;  1CF7 A;  4O3M A;  3ZMV A;  2XAH A;  1K6O A;  1FBS A;  3JSO A;  3OV8 A;  3L7W A;  4OMY A;  3L2C A;  3GLX A;  5L3C A;  1U3E M;  4M6X A;  3HIF A;  2FBH A;  4MNU A;  5K5R A;  1XN7 A;  4O6J A;  1P4A A;  1QQI A;  2YSR A;  4BAY A;  1OKR A;  4IRH A;  6PAX A;  2WV0 A;  1R1V A;  4MTE A;  1T2K A;  1YW9 A;  3I58 A;  4LB5 A;  3QPH A;  1R00 A;  1B1B A;  3MFK A;  5HS8 A;  3RYR A;  2TDX A;  1W4M A;  2HWV A;  2VBW A;  1VTN C;  1UCR A;  2EA4 A;  2M30 A;  3HUG A;  1BJA A;  1IAW A;  3V7S A;  5ED4 A;  2F5F A;  3QOP A;  3QU3 A;  4D0P A;  5ILU A;  3LST A;  4EGZ A;  1OYY A;  2P5V A;  2EFW A;  1ZRD A;  2OD5 A;  3WG9 A;  3DF8 A;  3ZMU A;  2A5Y B;  2IRF G;  4ENM A;  2D2W A;  1F5T A;  5E1X A;  4IVN A;  2CGP A;  1BIA A;  1LQ1 A;  3RKW A;  1WSU A;  2M87 A;  1CGP A;  2VBZ A;  1J59 A;  4HF0 A;  4LK1 F;  2EFO A;  5J8C A;  2K27 A;  4XLP F;  1IRG A;  1SFE A;  1USS A;  3RTR A;  3ZMT A;  5LEK A;  3VOE A;  2XAJ A;  1R5G A;  2P7C B;  1FY7 A;  3TKY A;  3G3Z A;  1ZLJ A;  2XAQ A;  3R0J A;  2ELH A;  5ILV A;  3VEP A;  2ADU A;  1LVA A;  3D0S A;  1O7L A;  2J5P A;  5CVV A;  1H0M A;  3GW2 A;  3FM5 A;  2F5E A;  1O3T A;  1BOA A;  2XAG A;  4L0Z B;  3I5U A;  3U9G A;  4ZYH A;  4DNC A;  1LNW A;  4MEY F;  1U5T A;  2LF8 A;  4XLN F;  1FNN A;  3HSR A;  1ZGA A;  5L3D A;  3R61 A;  2CO5 A;  3WGH A;  4Q5S F;  1FLI A;  2QWW A;  2WTE A;  4S05 A;  4LG0 B;  2NS0 A;  3SZP A;  4I7H A;  3IRQ A;  2L01 A;  4I98 B;  3HTS B;  3HSF A;  4EVI A;  5JVT A;  4H0E A;  5HS9 A;  4L9N A;  3V8K A;  3KP7 A;  5CVI A;  2V1D A;  1UFM A;  2QVO A;  1FWZ A;  1O3S A;  5IT9 Z;  4P96 A;  4WXC A;  2OAZ A;  1T6S A;  4AIH A;  3B73 A;  1DP7 P;  4KIB A;  1TW2 A;  1B59 A;  2Z3Y A;  1HST A;  4RB1 A;  4L18 B;  2GXB A;  3IC7 A;  4L9T A;  1Z7U A;  3GFI A;  3BJ6 A;  4U0V A;  3O6B B;  2PI0 A;  5E18 F;  2Q8K A;  2RV8 A;  3P7N A;  4KN4 X;  2DI3 A;  2F5C A;  2OBP A;  3ZMS A;  3RJP A;  1WKM A;  5BQT A;  1W5S A;  2PLY A;  1MDM B;  2PJP A;  2O03 A;  1KGS A;  3WTS C;  4RB0 A;  4ENN A;  3K2Z A;  5FO5 A;  3V8L A;  3LQR A;  2DT5 A;  4HYE A;  4RS8 A;  2ISZ A;  5DCM B;  5D4R A;  1G3W A;  2FMY A;  1SMT A;  3F23 A;  2L02 A;  4CZZ A;  1F9N A;  1OYI A;  3C1D A;  4ZYE A;  4KMU X;  3H3U A;  2MLG A;  3DPT A;  4KUM A;  1W7P B;  4HA8 A;  2YPR A;  5CLS A;  3NRV A;  2BGC A;  2D45 A;  4LLN A;  2PEX A;  2QM3 A;  4P9U A;  4HQE A;  4U88 A;  2GWR A;  2ZNY A;  3T8R A;  4KIG A;  2Z9O A;  4YG2 F;  4TV7 A;  1QNT A;  3F22 A;  1YG2 A;  4R8H A;  2WC2 A;  3E5X A;  4PGG A;  3T1B A;  1T98 A;  5LBQ A;  4BNC A;  1V3F A;  3R6S A;  4FX4 A;  1HW1 A;  2XIG A;  3F8M A;  4ZYD A;  3I64 A;  5F64 A;  5LRS A;  3JTH A;  1AOY A;  2R7F A;  2UXN A;  2NAZ A;  1KQ9 A;  5F1R A;  2DAO A;  3ELK A;  1XGM A;  4EJW A;  5JHU A;  3E5U A;  1R36 A;  2XHK A;  3TOB A;  1RNL A;  2B0L A;  5CVR A;  2VBX A;  5E20 A;  3FXQ A;  3M8F A;  5TJJ A;  3MCZ A;  1X3U A;  1D3Y A;  2RGV A;  2ZXJ A;  3V7C A;  4PGH A;  4UUV A;  1D8J A;  3HRM A;  2V79 A;  2XKO A;  4PCQ A;  1ZAR A;  4XRF A;  2IA1 A;  5L3F A;  2GA1 A;  2HYF A;  3IWF A;  4AIK A;  4CGZ A;  2M5W A;  3T5X A;  2ZJ2 A;  3BWG A;  2H27 A;  1UHW A;  3R60 A;  4LLG F;  1F1Z A;  1XSD A;  4HX4 A;  4A5M A;  2O8X A;  2COM A;  3O3K A;  4U0W A;  3LA7 A;  2F2E A;  1TQM A;  2K86 A;  3EYI A;  3DFG A;  2E1C A;  2PG4 A;  3W6K B;  3GO5 A;  2ACJ A;  4IHT A;  1H9G A;  2D1V A;  4AD9 A;  2ETH A;  1BC8 C;  2EWN A;  1XCV A;  4HBL A;  2Z99 A;  1I27 A;  3G73 A;  2RNJ A;  4UHT A;  3RDI A;  3BRO A;  1O7F A;  5DD4 A;  1IN5 A;  2GXG A;  1Q1H A;  1G4D A;  2Y0M A;  2GAU A;  4HV6 A;  3I59 B;  5CJ9 A;  4JBA A;  5ICF A;  2G7H A;  5HOO A;  1U8R A;  2HKX A;  2MH9 A;  4WCG A;  4HQM A;  1R1T A;  1K79 A;  4HDU A;  4EQQ A;  2CWE A;  2HYG D;  2DQL A;  3TO9 A;  4A0Y A;  5FFZ A;  2WWY A;  1PP8 F;  2Z5U A;  4I02 A;  3KP4 A;  4WWC A;  4Q4Z F;  2XV4 S;  4GYI A;  5KK1 A;  3K69 A;  1SFU A;  4M9Z A;  5FFX A;  1O3Q A;  1KU9 A;  4XBF A;  2EV0 A;  3H3Z A;  4NQW A;  4I0A A;  1J5Y A;  3KZZ A;  4BHC A;  4ZH4 F;  5K1Y A;  2V6C A;  1D5V A;  1MJ9 A;  2J5O A;  1YTY A;  1ZRF A;  2IW5 A;  5CVU A;  4CHU A;  2V1U A;  5HLG A;  1U6G A;  1XGN A;  1SD7 A;  1FT9 A;  1XGS A;  3CLO A;  1XSV A;  1JXS A;  5LEJ A;  1FSE A;  4KIC A;  5JR3 A;  4KNY A;  1JGS A;  2IVM A;  2IA2 A;  2LNB A;  1Z9C A;  5D5W B;  3PQK A;  2VT3 A;  5DUK A;  1WRJ A;  1KYZ A;  4EM2 A;  2HQN A;  4DQ2 A;  3P9C A;  2UXX A;  2L54 A;  1J0R A;  2W25 A;  1BC7 C;  2LKP A;  2LSO A;  1AWC A;  1ZRE A;  1DUX C;  2ESH A;  1BIB A;  3OOP A;  1XCB A;  1HW5 A;  5H6Q A;  4OMZ A;  3RYP A;  5IT9 K;  2IT0 A;  3RKY A;  1YFH A;  3C18 A;  4CXF A;  4MQV A;  2RQP A;  2JRT A;  2BEO A;  2BE5 F;  5A2Q Z;  4B09 A;  3O2P E;  4LB6 B;  3I53 A;  5D8L B;  3MAJ A;  4G9Y A;  1QZZ A;  2ZFW A;  3TOA A;  2MBF A;  1LDK B;  3HYI A;  1QGP A;  2PFB A;  5ICG A;  4U7D A;  3T0Y A;  5D4S A;  5LGU A;  4N0B A;  1YYV A;  2V9V A;  3WTX C;  3JW4 A;  1YS6 A;  2DU9 A;  5L3B A;  4EJU A;  3ABU A;  5DDG A;  2UWM A;  3DV8 A;  2MH2 A;  4GO1 A;  2O0Y A;  5J6X A;  1FOK A;  1ULY A;  3WGI A;  4E70 A;  3GYH X;  4GGG A;  1R23 A;  2NRA C;  2FBI A;  4LFU A;  2ESN A;  3C3W A;  1U2W A;  4ETS A;  3ML6 A;  4CIC A;  2XRN A;  1RUO A;  2E7W A;  2GQQ A;  2FA5 A;  1T0F A;  4M6Y A;  4U0Y A;  4EGY A;  1R58 A;  2K4B A;  2V1X A;  2VC1 A;  1TNT A;  4UNO A;  2FNA A;  4A2U A;  2Q2E A;  2GA2 A;  3J81 Z;  1J75 A;  2E1N A;  2DBB A;  1TNS A;  4OIN F;  3ZN1 A;  3BOQ A;  3LFK A;  2CYY A;  3QP6 A;  4HX8 A;  1QPM A;  3HRT A;  1FP1 D;  3JSP A;  1BN5 A;  1YLF A;  3DP7 A;  2H6C A;  5EEG A;  4QLC U;  2OZU A;  1R5H A;  1ZYR F;  2FNP A;  4M72 A;  1U78 A;  2VOO A;  2P5L C;  5L3G A;  4GYG A;  2VE8 A;  2UZK A;  3KLN A;  3KZY A;  5EEH A;  3SXY A;  1IN7 A;  1BBY A;  5DEQ A;  1K78 B;  2PBI A;  4HZF A;  3MZH A;  2VOP A;  4JQF A;  1I6X A;  5LHI A;  5E8I A;  3CUQ B;  4N9I A;  2EK5 A;  2ZME A;  4WXD A;  2YX7 A;  3F72 A;  2AS5 F;  4L0Y B;  1EV7 A;  4RAY A;  3ROU A;  4WK8 F;  1KU2 A;  2OA4 A;  3WOD F;  1MJB A;  5D6E A;  3QU6 A;  1IRF A;  3KLO A;  4F7Z A;  4Z2Y A;  2KIF A;  4S04 A;  3WTY C;  1BI1 A;  3ULQ B;  1JHF A;  3M9A A;  3EQL F;  2FF4 A;  3P9K A;  3QP5 A;  3WGG A;  3DQV C;  2OZ6 A;  1S7A A;  3H92 A;  2JSC A;  2ZCW A;  4I01 A;  1I5Z A;  2VBY A;  3IHU A;  2OQG A;  3TDU C;  1YO5 C;  3WTZ A;  3E97 A;  3F8B A;  2YU3 A;  4BHB A;  4ESB A;  2E7X A;  1SD5 A;  1KU3 A;  1YS7 A;  5DV5 A;  3BY6 A;  1PUE E;  3GFJ A;  3TQN A;  5BPI A;  2P6S A;  3REO A;  1HKT A;  3GVA A;  3F21 A;  4A0X A;  4KFC A;  5TRD A;  4P55 A;  4LK0 F;  1P4X A;  2CFX A;  4RGR A;  3GFM A;  2A69 F;  3GWZ A;  2IJL A;  3E6B A;  4IXA A;  5CYV A;  1B6A A;  3EET A;  3FZV A;  3CUO A;  2HTJ A;  5AON A;  2L3D A;  2YR2 A;  4ESF A;  3IWZ A;  1XDU A;  1CF7 B;  3CTA A;  2LF7 A;  3WE3 A;  3VOD A;  1ON1 A;  4G7Z F;  3WTV C;  5D8K B;  2XGX A;  1ZN2 A;  4UVB A;  2XRO A;  2A07 F;  1B4A A;  3ISP A;  2X0L A;  3JAM K;  5DUI A;  4HX7 A;  2RKH A;  1LB2 A;  1HSJ A;  4MHG A;  4EJT A;  5LHH A;  2W84 A;  3WE2 A;  2QZ8 A;  1RI7 A;  1F4K A;  1GVJ A;  2KRF A;  4UXN A;  4PDK A;  1T39 A;  5L3E A;  2PMU A;  4CDG A;  3SZT A;  3RI4 A;  2CG4 A;  2FSW A;  3ZP5 A;  4P5O A;  2JT1 A;  4UVA A;  3R4K A;  1IN4 A;  2HGC A;  3L00 A;  3GFL A;  5HS7 A;  2ISY A;  2RN7 A;  4HOB A;  1FYL A;  4YFX F;  3CUQ C;  3CDH A;  1I1G A;  1O3R A;  3HHG A;  3LQQ A;  4O5V A;  2QYO A;  3LAP A;  4NHJ A;  3GF2 A;  4L9J A;  1XB4 A;  4ENJ A;  3E6D A;  4L5I A;  1H9T A;  1MGT A;  4HLX A;  4LJZ F;  3V4G A;  2XUB A;  2EB7 A;  3IL2 A;  1FPQ A;  1KQ8 A;  3E3V A;  2GIV A;  2KKO A;  1K7A A;  4YFK F;  1GHC A;  5LGT A;  5KVR A;  3KE2 A;  2L4A A;  4RGU A;  3DEU A;  2MD5 A;  3M7G A;  2DK5 A;  3F8F A;  3BJA A;  4LGW A;  1IN6 A;  3VB2 A;  3CO7 C;  3K1N A;  3KEQ A;  1ZG5 A;  1BI3 A;  1MZB A;  3T8T A;  4M74 A;  2P6T A;  1TQP A;  1XMK A;  4HLY A;  4LMY A;  1LEB A;  2QUF A;  1XGO A;  5AIQ A;  3EYY A;  1XMA A;  5E1W A;  5A2Q K;  1ZGJ A;  5LHG A;  4NB5 A;  3K9T A;  4MEX F;  4Y17 A;  3I71 A;  1U5T B;  3JTG A;  4P9F A;  4IF4 A;  2KIM A;  2F5D A;  4EJO A;  2FXA A;  2JPC A;  4JK1 X;  4HAM A;  2ZNZ A;  3LAJ A;  4M9S A;  3COA C;  4ZZL A;  2DLL A;  2KIU A;  2KJC A;  3IKV A;  4OOI A;  3JAM Z;  3WTT C;  4RGS A;  2L4M A;  2PQ8 A;  1G3Y A;  4FX0 A;  2DW4 A;  3GXO A;  4LG0 A;  4R79 A;  4Y15 A;  4N9H A;  1ZLK A;  2QBY B;  1JHH A;  5IT3 A;  1UHM A;  3F3X A;  1FX7 A;  3GEZ A;  4WX9 A;  4GXO A;  1YW8 A;  1LEA A;  1D8K A;  2HZT A;  1HBX G;  3WU1 B;  3FMS A;  3J81 K;  3VFZ A;  4IJA A;  3S2W A;  4KIF A;  5HVQ C;  4IPA A;  2RDP A;  2O61 A;  1OYW A;  2H09 A;  1TQI A;  1S6L A;  2MA3 A;  1HQC A;  1YIO A;  5ICC A;  2GZW A;  3IKT A;  1S3J A;  4A6D A;  2G7U A;  2QEN A;  1GXQ A;  3PFI A;  1Y0U A;  4A6E A;  2EFN A;  3BPX A;  5CVJ A;  3J80 Z;  3HRU A;  2XKP A;  4Q47 A;  2A6H F;  1DPR A;  2NNN A;  1LJ9 A;  3P9I A;  1UST A;  5LGN A;  1MDM A;  3KFW X;  3E6M A;  1SD6 A;  3KP5 A;  2RC4 A;  3FXU A;  5HLI A;  2VN2 A;  2CQK A;  4YIF A;  1EH6 A;  4OIP F;  3BDD A;  2HDC A;  5DCM A;  1HKS A;  3TO7 A;  3FWE A;  1FYM A;  1OMI A;  4HW0 A;  1DDN A;  1V4R A;  2DTR A;  3LA3 A;  2FBK A;  4MTD A;  3C7J A;  3NEU A;  3Q5F A;  5H6R A;  2HOE A;  3DPL C;  1Z6T A;  1W7P A;  3ECO A;  1HXD A;  1ZRC A;  1TTY A;  2STW A;  3QPT A;  1FP2 A;  5FLX Z;  3KET A;  4OIQ F;  5D6F A;  3Q9S A;  1TLH B;  4OIO F;  1ODD A;  4G94 A;  3HHH A;  1WWX A;  3RPQ A;  3QRF F;  1R22 A;  4KA4 A;  1B9N A;  1SAX A;  3ZQ7 A;  1EH8 A;  1FC3 A;  2EFP A;  4A5N A;  2P7V B;  1U5T C;  1RIO H;  1RZ4 A;  3I4P A;  1NHA A;  4G8X A;  2NYX A;  4G6Q A;  2IP2 A;  5D5X B;  5HLH A;  1T38 A;  1BI0 A;  2R7D A;  4A12 A;  1WQ2 A; 
#chains in the Genus database with same CATH topology
 4AVZ A;  1T08 B;  4XKW A;  4AVP A;  4G6T B;  3EDP A;  3JRE A;  3U1K A;  2EIL H;  2CSO A;  1W7P D;  4UVC A;  1LDD A;  1W5T A;  4WXH A;  3U1D A;  2CW8 A;  2XAF A;  2CMP A;  1MBJ A;  4XSX F;  1FMW A;  3CO6 C;  2DOE A;  3BG3 A;  3WU0 A;  3GTQ J;  3KP3 A;  3PQJ A;  2HDD A;  3ERE D;  1Y6I A;  4Y13 A;  1FBU A;  1HCR A;  3KPH A;  4KN7 X;  4B8X A;  3PJR A;  2PJR A;  4A3D J;  1BM9 A;  1P6R A;  5JI6 A;  2JA8 J;  3E5Q A;  3HDD A;  2MC3 A;  4R1H A;  3ABM H;  4BU2 A;  3N4M A;  5F6F A;  2DO7 A;  4PSX A;  2HOS A;  2QLZ A;  2JTV A;  2HVQ A;  3S2H J;  3M8E A;  3AL0 B;  4HNU A;  1LDJ A;  4RB2 C;  3BG6 A;  3PSF A;  2Q0O A;  5FKO A;  1GXP A;  4PSW A;  4XNF A;  3I4M J;  3FXK A;  2CU7 A;  5LRR A;  4IZZ A;  1LE8 B;  2XAS A;  2DMQ A;  4B47 A;  5E8G A;  2QSG X;  3KX2 A;  4AM3 A;  2MLK A;  2NOG A;  3AAF A;  2DK8 A;  4BE1 A;  2Y48 A;  5IP9 J;  1ONV A;  1N77 A;  4LLL A;  2OCC H;  2ZO4 A;  4CYD A;  4PJL A;  5K5Q A;  4G7O F;  2EPF A;  3MD2 A;  2HPI A;  1ZHF A;  2O3F A;  4RM3 A;  2L7Z A;  3BPV A;  3IV5 A;  1PUF B;  4RAF A;  5D5V B;  2K4J A;  5KAF C;  3ABT A;  2LRE A;  2MAB A;  2CJJ A;  4KYW A;  3FK7 A;  2STT A;  2O7O A;  4XM3 A;  3CJN A;  4RB3 C;  4A3M J;  3G71 I;  4QWQ A;  2C6Y A;  1Y56 A;  2VKV A;  1VQP I;  2A68 F;  2AXL A;  1RC9 A;  3O8G A;  5D5U B;  3WTU C;  1W36 C;  1C0W A;  4BYY A;  3F9K A;  3ESW B;  3OSF A;  3H3V K;  2M1B A;  5AIP A;  4BEH B;  5F27 A;  2LY9 A;  3CJQ B;  2CQN A;  3FXR A;  5GTI C;  3FHZ A;  1Z91 A;  3K1M A;  1L0O C;  2H6B A;  5FB2 A;  4E7K A;  4JX5 A;  3NAU A;  3H9J A;  1SFX A;  4B44 A;  2XF7 A;  2XVC A;  3L09 A;  4OIR F;  4DYC A;  3K0L A;  3J7Z I;  2XGD A;  2HKO A;  3HXL A;  5JFR A;  1PDN C;  2K02 A;  2JMW A;  3GCM A;  2FOK A;  4PUS A;  4G7H F;  3V8J A;  1BJZ A;  1A36 A;  4XRM A;  4HDV A;  3I59 A;  2LFB A;  2Y69 H;  4H4K C;  4HV5 A;  3S2D J;  3B02 A;  3HTU A;  1GDT A;  1QBJ A;  2VQH A;  2P81 A;  3DU6 A;  4NQW B;  3MQ0 A;  2X4H A;  3PUF A;  1A04 A;  4BHP A;  1P92 A;  1WI9 A;  1VND A;  2DOF A;  3N97 A;  2QBY A;  1STZ A;  4ZZD A;  3GTL J;  2PN6 A;  2LH9 A;  3FM3 A;  2A3S A;  1ETQ A;  4RMN A;  1ZAO A;  3HB9 A;  2XSJ C;  4ON0 A;  1MJA A;  1P4W A;  2GOX B;  3DEW A;  3KP2 A;  5C3E J;  1UZC A;  4MQ9 F;  3I55 I;  3SFI A;  3WHB A;  1S29 A;  4BJT A;  1APL C;  1G3T A;  3AKZ A;  3A0H C;  4HF2 A;  3PL8 A;  5FD6 A;  3D5L A;  3V7R A;  4DOZ A;  1IW7 F;  2JUG A;  2LG4 A;  3IH3 A;  3R0A A;  1ON2 A;  2W85 A;  2VE9 A;  1PP7 U;  2E5Z A;  2R7T A;  2EA2 A;  3QAH A;  1OQY A;  3K2A A;  2FML A;  2D1H A;  1MBF A;  2GM4 A;  2G9W A;  2WAF A;  4RAZ A;  3RKX A;  1CQT A;  1W5C C;  5E3M A;  5H20 A;  1QRY A;  2EFQ A;  2W57 A;  2ZB9 A;  2E5N A;  3FMR A;  2QQ9 A;  5ICE A;  4L5J A;  2DT6 A;  3L9F A;  4CCN A;  3G2B A;  3I4N J;  2QEX I;  1IN8 A;  1YQA A;  1JTY A;  1BOB A;  3MKL A;  2WAD A;  2E71 A;  3FX3 A;  1DGW Y;  1XD7 A;  5K5O A;  3JRG A;  1SMY F;  5BS6 A;  2FX0 A;  3ZN0 A;  3ASN H;  2YU9 J;  4CO8 A;  4S0H B;  3G4S I;  1S72 I;  2M45 A;  1S5L C;  3TO6 A;  3BQY A;  1IUF A;  3VDX A;  3OYA A;  1B8I A;  4EM1 A;  3DKW A;  1J7K A;  2F6C A;  3OYM A;  3ZQQ A;  4J19 A;  2V1N A;  2HQR A;  3QYE A;  1BW6 A;  3FKI J;  1YW7 A;  5BPD A;  1X2N A;  1WPK A;  1TZL A;  1HKQ A;  4EV0 A;  2DA1 A;  1MBG A;  2KJB A;  2MC4 A;  1KU7 A;  3K4K A;  2UUZ A;  2IS4 A;  1FSH A;  1JE8 A;  4EJV A;  3SHF A;  5J1U A;  2H94 A;  4CCM A;  1HF0 A;  3BT9 A;  4BQA A;  4CSW A;  2IGN A;  2K7L A;  4IRI A;  1I3A A;  2L0K A;  5EF6 A;  4IHY A;  4F93 B;  3ZMZ A;  3L1P A;  3AL0 C;  4C9Y A;  1ETY A;  3ECH A;  3MEX A;  4I0B A;  3GX4 X;  2CW0 F;  3CCS I;  2DPD A;  2R7V A;  4RA2 A;  3F6O A;  1HLV A;  1T95 A;  2HEO A;  3NQO A;  2IA0 A;  1TP4 A;  1KQ0 A;  1LVK A;  1JKQ C;  2DA5 A;  3HUG B;  4AWX B;  4KDP A;  4IHW A;  4IHS A;  1Z6R A;  4U7B A;  2WAQ A;  2KFD A;  4DYQ A;  1LUJ B;  1GVD A;  2LP0 A;  1B9M A;  2OUM A;  2JZY A;  3MZY A;  1TW3 A;  3TDZ C;  2P0W A;  1NTC A;  4XSZ F;  2NNY A;  1MD0 A;  3GZ5 A;  1FYK A;  1UAA A;  4QPQ A;  4D1Q A;  2E1M B;  3GUD A;  4FHT A;  2DOD A;  1MNM C;  1VQK I;  1G3S A;  3FF5 A;  2FE3 A;  3D5R C;  2BYV E;  3GZ6 A;  1E17 A;  1OLT A;  1DPU A;  1GV5 A;  4FIS A;  3W6J B;  5M5W J;  2EBI A;  3CQZ J;  4XON A;  4KMF A;  3ZPL A;  1KA8 A;  5HDN A;  4HF1 A;  3Q9V A;  2AO9 A;  2ZC2 A;  2R7U A;  2OQR A;  5DD8 A;  1QU3 A;  2VOD A;  1YJ9 I;  3AG3 H;  4IX7 A;  2YX4 A;  1RKT A;  3J80 K;  4L9V A;  1X58 A;  5BOX A;  3ABL H;  2DFI A;  4A3C J;  1S8N A;  4ZDO A;  2Q2E B;  1MND A;  2KL4 A;  2BBY A;  1OCR H;  4I2O A;  3M3Y J;  2VXZ A;  1R4N B;  2K9Q A;  3H5R A;  3OS0 A;  3WHC A;  1IXR C;  3K1P A;  3D1N I;  1SAN A;  2Z33 A;  2IPQ X;  1E0E A;  3CJR B;  1OR7 C;  3J7A O;  2DFH A;  4ENK A;  1BI2 A;  1R7J A;  2RNG A;  3WTW C;  4I09 A;  3HJE A;  1IXC A;  1RET A;  3LNQ A;  2JPB A;  4LD5 A;  2JA6 J;  1FBQ A;  4BJ5 C;  5LD2 C;  2PMH A;  4A3B J;  4FT8 A;  2H8W A;  2ECC A;  2W24 A;  1Z05 A;  5FGM A;  4M9X A;  4K2E A;  5HDK A;  2KZG A;  2V26 A;  1P2F A;  4XKC A;  3KP6 A;  3DXJ F;  2F5V A;  3I0T A;  4A0Z A;  4YFN F;  5ILS A;  1P7I A;  2FEZ A;  4PJN A;  1UB9 A;  3KEO A;  4KT5 C;  2JA5 J;  3BP8 A;  4ZYG A;  2BV6 A;  4D5F A;  1LFP A;  3HC7 A;  2ZME B;  1FIA A;  4QPO A;  3LSG A;  3RSN A;  1QO0 D;  2BVL A;  4Q48 A;  3OYK A;  1KYW A;  4UV8 A;  2B63 J;  5DYM A;  2WAQ N;  1R71 A;  5FLM J;  5FLX K;  2RRE A;  3BTJ A;  2QA4 I;  1WFX A;  1LE8 A;  1FZP B;  5DCF A;  2L9R A;  5ERI A;  4YII A;  2LBF B;  4BL0 B;  2HFH A;  5HDG A;  2L5Q A;  3SFZ A;  3UKG A;  4GFB A;  4YEL A;  3BZ6 A;  2KIQ A;  1K78 A;  1XSX A;  3ERM A;  3HOS A;  2BW3 A;  2P4W A;  4RGX A;  2ZJQ F;  2DA2 A;  1BR2 A;  3OR1 C;  3PO3 J;  4UV9 A;  1L3L A;  3ASO H;  2QQB A;  2FU4 A;  2P5K A;  2RVC A;  1MKM A;  4IOA F;  2NOJ B;  3CUQ A;  1TBX A;  3MMY B;  3SQN A;  2A61 A;  4DW6 A;  5J47 A;  4AIJ A;  1PUF A;  2QGU A;  4EM0 B;  4UB6 C;  4WF2 A;  1OPC A;  2DFE A;  4OWR B;  2ZXH A;  1VF9 A;  3F6V A;  4PK4 A;  3RZD J;  2DCE A;  1OFC X;  4G6D A;  2W1O A;  4ZYA A;  2LDU A;  1ZR4 A;  4EMS A;  4ESJ A;  5F0H A;  2FQ3 A;  2Z16 A;  3Q0W A;  5E17 F;  3MWM A;  1JUS A;  1YX5 A;  3P5J A;  4MGR A;  4XR6 A;  1ZG3 A;  2R5Z B;  3S15 J;  2VPR A;  1IXS B;  5J1Y A;  1GLN A;  3DTK A;  5FD5 A;  4XK4 A;  1T33 A;  2O6G E;  1BR1 A;  3LA2 A;  5J8F A;  1O57 A;  3H5N A;  1ZG1 A;  3VWB A;  1IRZ A;  1ZH5 A;  1Z77 A;  1P9Q C;  3OL4 A;  5KAI C;  3DKY A;  1P7J A;  3VSL A;  2GBY A;  3HPG A;  2XPW A;  3TGN A;  2R3S A;  4M73 A;  1X19 A;  2VIX A;  1RUN A;  1IZ1 A;  1REP C;  4E7I A;  3S1Q J;  3EUA A;  1OR7 A;  2Y75 A;  1J2X A;  1IUY A;  2IXS A;  4BQN A;  2TRT A;  3L2U A;  1T8I A;  2ECB A;  2VC0 A;  3EUH A;  3FHN A;  3F8C A;  2DQR A;  2HI3 A;  1D0Y A;  5J40 A;  3RPU A;  5GAH J;  3U2R A;  3W6V A;  1VQO I;  2HR3 A;  2NS7 A;  3CCU I;  1IF1 A;  2B7E A;  1SD4 A;  2VT2 A;  3BG7 A;  2OU2 A;  5BMZ A;  2QQA A;  3M1E A;  5E1Z B;  3KCC A;  4BXU A;  1HW2 A;  1E2X A;  4OU0 A;  1TWG J;  4BH9 A;  2CRG A;  4N4N B;  1AKH B;  1XDS A;  2FRH A;  2DPU A;  3I3L A;  4ASN A;  5FKK A;  1G6N A;  2VXD A;  1W0U A;  3PO2 J;  1E3O C;  2M8E A;  1I1S A;  2XAU A;  3H35 A;  5F1J A;  3HOT A;  2E1M C;  3F8N A;  4GCV A;  3K70 C;  1LFU P;  3KIO A;  4IRG A;  2DJI A;  2VJ5 A;  3L2V A;  4XMY A;  4XRS G;  2EJR A;  2ZBK A;  3DBL B;  1K6Y A;  5DTD A;  3W2W A;  4CCJ A;  1J9I A;  1QHH D;  1R9T J;  3HSE A;  3H5A A;  1T0F C;  2WAE A;  2EIK H;  2BXY A;  3LWF A;  3K4B A;  2HTS A;  4HEA 2;  1FOW A;  2P8T A;  2ZKZ A;  2I10 A;  3BJO A;  1LPQ A;  1HOM A;  3CP8 A;  2EV6 A;  3IRR A;  1WJD A;  3VYT B;  4ZDL A;  3E6C C;  3CCM I;  2VON A;  1QZY A;  3RIR A;  2EV5 A;  4A3E J;  1SFK A;  4NNJ A;  4IQ4 A;  2ID3 A;  3ZMD A;  4M71 A;  3FMQ A;  2A6E F;  2VJI A;  1R1U A;  2EZK A;  3HRS A;  4XOT A;  1Z1D A;  3I54 A;  2IGK A;  5LLQ A;  4BDZ A;  4Y52 J;  4PZJ A;  3RPU D;  5CPR B;  1S7O A;  2HS5 A;  4FCY A;  1CF7 A;  3VPR A;  4O3M A;  2OV7 A;  3ZMV A;  2XAH A;  4MFE A;  3OSG A;  2IS2 A;  4D7M A;  4BY7 J;  1K6O A;  1FBS A;  3JSO A;  3OV8 A;  3L7W A;  2K40 A;  3DCF A;  3FDY A;  4OMY A;  3L2C A;  3GLX A;  5B66 C;  5L3C A;  3LSR A;  1YE9 A;  5KCM A;  1U3E M;  2QQ8 A;  4M6X A;  3ABK H;  3HIF A;  4W97 A;  3OY9 A;  5IOZ A;  5LFA A;  2FBH A;  4MNU A;  5K5R A;  1XN7 A;  2HPM A;  3SDG A;  1ORK A;  3JRC A;  1MNE A;  4O6J A;  1P4A A;  3CCQ I;  1QQI A;  2YSR A;  4BAY A;  1OKR A;  4IRH A;  6PAX A;  2WV0 A;  1R1V A;  3BCA A;  3VYU B;  4HST A;  4MTE A;  3LMM A;  2M0M A;  1T2K A;  1S7E A;  5H2F C;  4RBO A;  2NVQ J;  1YW9 A;  4BS9 A;  1OCC H;  3CCY A;  3I58 A;  1R00 A;  3QPH A;  4LB5 A;  2BOL A;  2ZME C;  1B1B A;  3MFK A;  1MMN A;  5HS8 A;  3RYR A;  2TDX A;  4ZJZ A;  2O9L A;  1W4M A;  1MSE C;  3QWL A;  3OYH A;  3M4O J;  3ZQC A;  2HWV A;  3CCJ I;  4HNT A;  2HQA A;  5J4V A;  2VBW A;  1VTN C;  2DMP A;  3AG4 H;  3BR0 A;  5EGO A;  5JLW A;  2Y9Z A;  1UCR A;  2EA4 A;  2M30 A;  3HUG A;  1BJA A;  4A3F J;  4PJ0 C;  1IAW A;  3V7S A;  5ED4 A;  3W2V A;  2LY2 A;  2KDO A;  1N75 A;  5IP7 J;  2HVS A;  2F5F A;  2F4M B;  3K4J A;  3QOP A;  1WJC A;  3QU3 A;  4D0P A;  5ILU A;  3LST A;  4EGZ A;  1FEX A;  2BXZ A;  1OYY A;  2P5V A;  3IAS 2;  2EFW A;  1ZRD A;  4BXX J;  1Z3X A;  2OD5 A;  3WG9 A;  3DF8 A;  3EUK L;  2A5Y B;  3TL4 X;  1UJ8 A;  3ZMU A;  4ENM A;  1YRN B;  2IRF G;  3GTO J;  2D2W A;  4UUS A;  1F5T A;  2JN6 A;  4E6K G;  5E1X A;  4IVN A;  2CGP A;  2Y30 A;  1LFB A;  3QQA A;  1BIA A;  3OR2 C;  1LQ1 A;  4JYK A;  3RKW A;  1WSU A;  2M87 A;  2GIZ A;  3HOW J;  1V5G A;  1CGP A;  4C3I J;  2VBZ A;  3KYD B;  3L2R A;  1J59 A;  1Z21 A;  3PIP F;  4HF0 A;  3ZXS A;  4LK1 F;  3WG7 H;  3Q3S A;  2EFO A;  5J8C A;  2K27 A;  4XLP F;  4QTR A;  1IRG A;  1SFE A;  5KHD A;  4A3G J;  1USS A;  3RTR A;  3ZMT A;  3GTK J;  3UNG C;  3VSK A;  4BQQ A;  5LEK A;  3VOE A;  2XAJ A;  1R5G A;  2P7C B;  1FY7 A;  4ITV A;  2R7R A;  3TKY A;  4IKF A;  1K4S A;  3G3Z A;  1ZLJ A;  5EG0 B;  5C44 J;  2AQF A;  2XAQ A;  4M3F A;  3R0J A;  2ELH A;  1ETO A;  4FTH A;  2VKD A;  2OC6 A;  5ILV A;  3VEP A;  2LTP A;  2W7N A;  2ADU A;  2DYS H;  1LVA A;  3LOC A;  3D0S A;  2VQC A;  4II2 A;  1O7L A;  2J5P A;  4UB8 C;  2Y0S A;  5CVV A;  1H0M A;  2R4G A;  3PNV A;  3GW2 A;  4XLE A;  1ACI A;  1ITY A;  3FM5 A;  1D5Y A;  3H1C A;  4BE2 A;  2F5E A;  2KRC A;  1O3T A;  5GAG J;  4FE4 A;  3FXM A;  1BOA A;  2XAG A;  1I6H J;  3BC8 A;  4L0Z B;  3I5U A;  1D1B A;  2YS9 A;  3U9G A;  3AFH A;  4ZYH A;  2A05 A;  5B1A H;  4DNC A;  3KYC B;  1LNW A;  1QZE A;  1V5F A;  4MEY F;  1U5T A;  2LF8 A;  4XLN F;  1FNN A;  2HYJ A;  3HSR A;  1ZGA A;  5L3D A;  3R61 A;  2CO5 A;  2BHZ A;  1WJF A;  1FJL A;  3GTG J;  3WGH A;  4Q5S F;  1FLI A;  2QWW A;  1TC3 C;  2WTE A;  2LBF A;  4S05 A;  2H8R A;  4LG0 B;  2NS0 A;  3BTC A;  3SZP A;  1AHD P;  3JR9 A;  2E2I J;  4I7H A;  2AHQ A;  1U9O A;  4L5E A;  9ANT A;  3IRQ A;  2L01 A;  4I98 B;  3LSH A;  3ZOB A;  3HTS B;  3HSF A;  4EVI A;  2DN0 A;  5JVT A;  4H0E A;  1IRX A;  1A6I A;  5HS9 A;  4L9N A;  3V8K A;  3KP7 A;  5CVI A;  2V1D A;  3KYL A;  1UFM A;  2QVO A;  1Y8R B;  1FWZ A;  1IJW C;  4JX4 A;  1O3S A;  5IT9 Z;  4P96 A;  2BY3 A;  3GBG A;  2DFF A;  4WXC A;  2OAZ A;  4FE7 A;  1T6S A;  2L7M P;  3HOX J;  4AIH A;  4B3X A;  3HBL A;  4HSR A;  3B73 A;  4A3I J;  1DP7 P;  3ZRG A;  4KIB A;  1TW2 A;  2EIM H;  3HM5 A;  3DLA A;  1B59 A;  3IH2 A;  2CUJ A;  2Z3Y A;  2K3P A;  2OJE D;  1DU0 A;  3CME I;  1HST A;  1UG2 A;  4RB1 A;  4L18 B;  3SZG A;  2GXB A;  1EF4 A;  3OYL A;  3IC7 A;  4L9T A;  2X6X A;  1Z7U A;  4FQG A;  2V4J C;  1JJ6 C;  3GFI A;  3BJ6 A;  3JRI A;  4U0V A;  3O6B B;  5F04 A;  2DYR H;  3G1O A;  2PI0 A;  2M2E A;  4LG3 A;  4W1U A;  4NBQ A;  5IYD J;  4CYC A;  2X6Y A;  5E18 F;  2Q8K A;  2RV8 A;  1ZGW A;  3P7N A;  4KN4 X;  2DI3 A;  2Y0S N;  3K4C A;  4CCO A;  3MN2 A;  3RQI A;  2F5C A;  2OBP A;  1ETX A;  3ZMS A;  1DU6 A;  3RJP A;  3E0J B;  1WKM A;  5BQT A;  3MZ8 A;  2DA6 A;  1BA5 A;  1W5S A;  2PLY A;  1MDM B;  4DBR A;  2PJP A;  2O03 A;  4C2T A;  1KGS A;  3WTS C;  4RB0 A;  4PFP A;  4X0G A;  4ENN A;  3LSI A;  5JHF A;  3BR5 A;  2X6W A;  3K2Z A;  1YIT I;  5FO5 A;  3E1S A;  3V8L A;  2GLO A;  3LQR A;  2DT5 A;  3PSI A;  4DIQ A;  1JJ8 C;  1AKH A;  4HYE A;  1VZ0 A;  4RS8 A;  4XQF A;  2ISZ A;  5DCM B;  5D4R A;  4PJM A;  1VI0 A;  4MLO A;  2FUG 2;  3OYB A;  1G3W A;  2FMY A;  1SMT A;  3F23 A;  1JGG A;  2L02 A;  2QKL B;  4F55 A;  1MMG A;  2VKE A;  1N25 A;  2NXN B;  4CZZ A;  1F9N A;  1OYI A;  3C1D A;  3A01 A;  2L7F P;  3K7A J;  5GP9 A;  4ZYE A;  2KDZ A;  4KMU X;  2CS3 A;  3H3U A;  1K4T A;  1MMD A;  2MLG A;  1IV6 A;  3DPT A;  4KUM A;  1Y1W J;  1QA6 A;  3SEZ A;  3I56 I;  1MMA A;  3CMY A;  2HDW A;  1W7P B;  4HA8 A;  2YPR A;  5CLS A;  2ELJ A;  4NC6 A;  3NRV A;  2BGC A;  3QPL A;  2D45 A;  4LLN A;  2PEX A;  2QM3 A;  4P9U A;  3PM1 A;  4BKX A;  1D0X A;  4HQE A;  1TWC J;  4U88 A;  2GWR A;  2ZNY A;  4DJA A;  3T8R A;  4KIG A;  2Z9O A;  1MBH A;  4YG2 F;  1XTA A;  1GV2 A;  2ICW G;  2E35 A;  4TV7 A;  3CMM A;  2BHY A;  1QNT A;  2M7B A;  2V9K A;  4J01 A;  5DS9 A;  2CQ7 A;  4F3Q A;  3F22 A;  1XPX A;  1YG2 A;  2BY0 A;  3BZC A;  4R8H A;  2WC2 A;  1R4M B;  3QYF A;  3E5X A;  4PGG A;  1WGX A;  1QVU A;  3T1B A;  1T98 A;  3FXL A;  1W36 D;  1RR8 C;  4E4H A;  3LSJ A;  3JRF A;  2R5Y A;  3LSK A;  5LBQ A;  2DTZ A;  2HNH A;  2QKM B;  2PX9 A;  4BNC A;  1V3F A;  5GAD J;  3HZJ A;  5J4Y A;  3R6S A;  4FX4 A;  1HW1 A;  2DJN A;  2XIG A;  3F8M A;  4ZYD A;  2BVM A;  2R92 J;  3I64 A;  5F64 A;  5LRS A;  2R7W A;  3JTH A;  1FIP A;  4ZC3 A;  1AOY A;  1MH3 A;  5K7Z A;  3H9G A;  2K5C A;  2R7F A;  2UXN A;  4QIW N;  4XN0 A;  2K85 A;  4YIR X;  4X1E A;  2NAZ A;  3OYE A;  1KQ9 A;  5F1R A;  2DAO A;  3ELK A;  1XGM A;  4EJW A;  5JHU A;  3E5U A;  3QPS A;  1R36 A;  2XHK A;  3A2K A;  3TOB A;  1RNL A;  3CCL I;  2B0L A;  3C2H A;  1WCM J;  2X1C A;  1OCP A;  3S3M A;  3OIQ A;  4BBS J;  5CVR A;  2K9L A;  4IOC F;  1U0J A;  4J00 A;  2VBX A;  5E20 A;  3FXQ A;  3M8F A;  5TJJ A;  3MCZ A;  4GRI A;  5TIS C;  1X3U A;  1D3Y A;  3CC2 I;  2RGV A;  2ZXJ A;  2PJR B;  3MKW B;  3V7C A;  5M5X J;  4OAZ A;  5M3M J;  3LSM A;  4PGH A;  4HNV A;  1EJ9 A;  4UUV A;  1D8J A;  3HRM A;  2V79 A;  2XKO A;  3MVP A;  3BG9 A;  4PCQ A;  1ZAR A;  3FKJ A;  4XRF A;  3HOY J;  1E3H A;  1Z7L A;  2IA1 A;  3CD6 I;  5L3F A;  4NUB A;  2K3F A;  1I3Q J;  2FOW A;  2GA1 A;  4XKB A;  2HYF A;  3DTI A;  3IWF A;  4AIK A;  4CGZ A;  1NG7 A;  2M5W A;  1GUU A;  5HNF A;  2MD0 A;  1IDZ A;  3T5X A;  1X1P A;  2ZJ2 A;  3BWG A;  3FXJ A;  2ZFU A;  2H27 A;  3IAM 2;  1UHW A;  4XRS A;  3R60 A;  1VQ6 I;  1Y39 A;  3W3C A;  4A93 J;  3CCV I;  4LLG F;  1F1Z A;  1XSD A;  3OMY A;  4HX4 A;  2M0C A;  4ZTJ A;  4RLQ A;  1XX5 A;  4A5M A;  2VQL A;  2KLO A;  2COM A;  2O8X A;  3O3K A;  4CA0 A;  3B6C A;  4U0W A;  3LA7 A;  2F2E A;  1TQM A;  2K86 A;  1Z0X A;  3BR6 A;  5IP6 A;  3EYI A;  3DFG A;  2E1C A;  3G1M A;  2PG4 A;  3W6K B;  3GO5 A;  2ACJ A;  5GPA A;  4IHT A;  1G8X A;  1H9G A;  4IO9 F;  5JLX A;  5M5Y J;  3SJM A;  3CMA I;  2D1V A;  4AD9 A;  2ETH A;  1BC8 C;  2EWN A;  1XCV A;  3DTE A;  4HBL A;  2Z99 A;  1D1C A;  1I27 A;  2KZV A;  2KPM A;  3G73 A;  4XL9 A;  2MW8 A;  2RNJ A;  2M7A A;  3GLL A;  4UHT A;  3HKZ A;  2X51 A;  3RDI A;  3BRO A;  2F48 A;  1O7F A;  4CCL A;  2M4K A;  3FIS A;  5DD4 A;  4KIS A;  1IN5 A;  2GXG A;  1YX3 A;  2M4G A;  3OYC A;  1Q1H A;  1A31 A;  1RR7 A;  4IHV A;  4A69 C;  1G4D A;  2Y0M A;  3OS2 A;  2GAU A;  1I50 J;  2F4O B;  3S8P A;  4HV6 A;  3I59 B;  4A12 A;  4ZDP A;  5CJ9 A;  4JBA A;  5ICF A;  4BEH A;  2E1O A;  2G7H A;  5HOO A;  1U8R A;  2HKX A;  2MH9 A;  2YUS A;  5J1R A;  4WCG A;  4HQM A;  1R1T A;  3RCO A;  1K79 A;  4HDU A;  1ZKG A;  4EQQ A;  2CWE A;  2XGC A;  2HYG D;  2DQL A;  3TO9 A;  3ZQH A;  5FFZ A;  4A0Y A;  2WWY A;  1PP8 F;  2M34 A;  2Z5U A;  4I02 A;  3X2Q H;  3KP4 A;  1V5E A;  1X1A A;  4WWC A;  4Q4Z F;  3OS1 A;  2XV4 S;  4GYI A;  5KK1 A;  2R7S A;  3K69 A;  3CDI A;  1SFU A;  4M9Z A;  2CFO A;  5FFX A;  1O3Q A;  1OCT C;  3GTM J;  1KU9 A;  1A5J A;  3HPH A;  4XBF A;  3BR2 A;  4RDU A;  2E2J J;  2JVH A;  1X1C A;  2EV0 A;  2ME0 A;  3CCR I;  3H3Z A;  4NQW A;  4I0A A;  1J5Y A;  1IDY A;  5E3N A;  3KZZ A;  2ZJR F;  4BHC A;  5BNG A;  4ZH4 F;  5K1Y A;  1ZR2 A;  2V6C A;  4XOP A;  3S3N A;  3CC4 I;  2VJ4 A;  1MSF C;  5TGT A;  1D5V A;  2JJ7 A;  3HOV J;  1MJ9 A;  2J5O A;  5EDN A;  1YTY A;  3M1C A;  3HGY A;  1AA7 A;  3LSP A;  1ZRF A;  2IW5 A;  5CVU A;  1R5I D;  4CHU A;  2IGO A;  2V1U A;  5HLG A;  1U6G A;  1XGN A;  1SD7 A;  1FT9 A;  1XGS A;  3CLO A;  3G1L A;  1XSV A;  1JXS A;  2OTJ I;  3PFY A;  5LEJ A;  2R7X A;  1G2H A;  1IV8 A;  2K9S A;  2MFZ A;  1FSE A;  4KIC A;  5JR3 A;  2I8D A;  3OYI A;  4KNY A;  4PFO A;  3ZR8 X;  3S93 A;  1JGS A;  2IVM A;  1VQ4 I;  3A0B C;  1JKO C;  2IA2 A;  2LNB A;  1R6R A;  1Z9C A;  5B1B H;  4PJJ A;  5D5W B;  1I39 A;  3HKZ N;  3PQK A;  2QCO A;  2VT3 A;  5DUK A;  1WRJ A;  1KYZ A;  5F08 A;  5F0C A;  4EM2 A;  3GZN B;  1F43 A;  3NAR A;  2HQN A;  4DQ2 A;  1XMX A;  3P9C A;  1B8I B;  2VB6 A;  2UXX A;  1NG6 A;  4C2U A;  3I9V 2;  3OYF A;  3OL3 A;  2L54 A;  1J0R A;  2W25 A;  2VLA A;  1LKX A;  1BC7 C;  5IY5 H;  2LKP A;  2LSO A;  1AWC A;  2NVX J;  1ZRE A;  3TBI A;  4EEF G;  1DUX C;  2XC7 A;  1YI2 I;  2ESH A;  1BIB A;  4E7L A;  2ZXI A;  3OOP A;  1XCB A;  3CES A;  1HW5 A;  3CLQ A;  4G12 A;  3CCE I;  5CQG A;  2JA2 A;  4X6A J;  1IG7 A;  1JTX A;  5H6Q A;  1JUM A;  4OMZ A;  1UG0 A;  3RYP A;  1K83 J;  2DA7 A;  5IT9 K;  2IT0 A;  2BZT A;  2X1D A;  3RKY A;  1YFH A;  1FMV A;  4I6Z A;  1VQ8 I;  3C18 A;  4CXF A;  4MQV A;  2XF6 A;  1F36 A;  1ENH A;  2RQP A;  2V9P A;  2JRT A;  2BEO A;  2BE5 F;  5A2Q Z;  4ANJ A;  5FRO A;  1PJR A;  1ZTR A;  4NDL A;  4NC7 A;  2W4S A;  4B09 A;  3O2P E;  4LB6 B;  3I53 A;  1D0Z A;  5D8L B;  1VQL I;  3MAJ A;  4G9Y A;  1QZZ A;  4F52 A;  2ZFW A;  3TOA A;  2MBF A;  1VQ9 I;  1LDK B;  5E3O A;  3HYI A;  4C30 A;  3BR1 A;  1QGP A;  2PFB A;  1W0T A;  5ICG A;  4U7D A;  3T0Y A;  1FTZ A;  5C4X J;  5D4S A;  4I99 C;  2FJ1 A;  5LGU A;  2EZI A;  4N0B A;  5EZG A;  1YYV A;  1OCZ H;  2V9V A;  3WTX C;  1A6Q A;  3JW4 A;  2L9N A;  2WB1 A;  1YS6 A;  2QF7 A;  2VPL A;  2KRH A;  2XB5 A;  2DU9 A;  5L3B A;  5GPC A;  4EJU A;  4DGW B;  3ABU A;  5DDG A;  4IL6 C;  2UWM A;  3H36 A;  3DV8 A;  2MH2 A;  4GO1 A;  2O0Y A;  5J6X A;  1FOK A;  3FXO A;  1ULY A;  3WGI A;  3ZQL A;  2X85 A;  4E70 A;  3GYH X;  4GGG A;  3M8J A;  5E79 C;  1R23 A;  4E7H A;  2NRA C;  1KON A;  1A35 A;  2EIN H;  2FBI A;  4LFU A;  3K4M A;  1B72 B;  1Z67 A;  2ESN A;  2VQG A;  3C3W A;  3IH4 A;  2KP6 A;  1U2W A;  4ETS A;  1TWH J;  3ML6 A;  3U21 A;  4CIC A;  2XRN A;  2JSP A;  1RUO A;  2CQX A;  1EKE A;  1POG A;  2E2H J;  2N8G A;  2E7W A;  2GQQ A;  2FA5 A;  3NWT A;  1T0F A;  1QPI A;  1FTT A;  4XN3 A;  4M6Y A;  4BUP A;  3NWS A;  4U0Y A;  2LR8 A;  2ME6 A;  2DDA A;  4EGY A;  3KZI C;  1R58 A;  2K4B A;  2Y31 A;  2HOA A;  2V1X A;  2LLK A;  2VC1 A;  1TNT A;  1H8A C;  4UNO A;  1WJ5 A;  2FNA A;  4A2U A;  4V2F A;  2HOT A;  2Q2E A;  2GA2 A;  3J7Y J;  1IC8 A;  3J81 Z;  1J75 A;  4I76 A;  2H1L A;  2ID6 A;  2E1N A;  2DBB A;  1TNS A;  2F4I A;  4OIN F;  5K7H A;  2IBD A;  3A4C A;  3ZN1 A;  2L9V A;  3BOQ A;  3LFK A;  1E3P A;  2CYY A;  3QP6 A;  2XSD C;  4HX8 A;  4BDY A;  3O8H A;  5FKL A;  1QPM A;  3BTI A;  3HRT A;  1FP1 D;  3JSP A;  1BN5 A;  1Y1V J;  5FLV A;  2MSY A;  1YLF A;  3DP7 A;  2H6C A;  5EEG A;  4U87 A;  4QLC U;  2OTL I;  2OZU A;  1R5H A;  1ZYR F;  4B3A A;  2FNP A;  4DYR A;  2JA7 J;  1JKP C;  2VL8 A;  2MYS A;  2VJJ A;  4CZC A;  2HU9 A;  1Z3Y A;  4M72 A;  2EQR A;  1U78 A;  1SVO A;  2VOO A;  2P5L C;  5L3G A;  3VYS B;  3JRB A;  4GYG A;  2VE8 A;  2UZK A;  1RKW A;  2GXA A;  3KLN A;  1YIJ I;  3KZY A;  2KMU A;  5EEH A;  3SXY A;  5FRN A;  4BXF A;  2KIS A;  2X9D A;  1IN7 A;  3K70 D;  4DBQ A;  1BBY A;  2VUM J;  3PNY A;  3CF5 F;  3H0D A;  5DEQ A;  1K78 B;  2PBI A;  2BY2 A;  2MGQ A;  4HZF A;  2CUZ A;  3DPU A;  3MZH A;  2BW3 B;  2RQQ A;  2VOP A;  1TT5 B;  4JQF A;  3ZQG A;  5HOD A;  4A3K J;  3K4N A;  1I6X A;  2WB1 N;  5LHI A;  5E8I A;  3CUQ B;  4N9I A;  2EK5 A;  2ZME A;  3BQZ A;  5EJC A;  2K9M A;  1K61 A;  4WXD A;  2YX7 A;  3F72 A;  2CV1 A;  1H89 C;  3DKX A;  2AS5 F;  4C3J J;  4L0Y B;  1EV7 A;  4RAY A;  3ROU A;  4Z6Y A;  4UY8 I;  4WK8 F;  1QVT A;  5B5E C;  1KU2 A;  3S3O A;  2OA4 A;  3WOD F;  3CZ6 A;  1MJB A;  5D6E A;  3QU6 A;  1JKR C;  1Y0N A;  5IOY A;  1IRF A;  1KZH A;  3K6G A;  3KLO A;  3S1M J;  4F7Z A;  4Z2Y A;  1TL8 A;  2KIF A;  1H88 C;  4E7J A;  4S04 A;  3CC7 I;  2LOO A;  1X1B A;  3WTY C;  1BI1 A;  3ULQ B;  2JUC A;  2LY1 A;  1JHF A;  2AXT C;  3M9A A;  1NH3 A;  3EQL F;  3OOU A;  5DM7 F;  2HXI A;  2EZH A;  3OYG A;  2FF4 A;  2IS6 A;  4XLF A;  3P9K A;  3QP5 A;  3Q0V A;  3WGG A;  3DQV C;  1V55 H;  2OZ6 A;  4HG2 A;  4M6V A;  1EA3 A;  1S7A A;  2V6E A;  1UHS A;  3H92 A;  2R7Z J;  2JSC A;  4HPQ A;  1VFC A;  2HVR A;  2R5Z A;  3CJT B;  2ZCW A;  2PMZ A;  4I01 A;  5IPA A;  1I5Z A;  2KT0 A;  2VBY A;  3IHU A;  2OQG A;  4ABZ A;  3TDU C;  2E34 A;  2IEK A;  2JK3 A;  1YO5 C;  1GT0 C;  1RPW A;  5IYB J;  3WTZ A;  3E97 A;  3DBH B;  3F8B A;  2YU3 A;  4BHB A;  4ESB A;  3OYD A;  2E19 A;  1VQM I;  1XS9 A;  2E7X A;  4EAT A;  5GAE J;  1SD5 A;  1KU3 A;  5EZH A;  1YS7 A;  3DWL E;  3GME A;  2OPT A;  3BY6 A;  5DV5 A;  1PUE E;  3GFJ A;  4RAG A;  3TQN A;  5BPI A;  2P6S A;  3FK6 A;  3REO A;  5M3F J;  1QHG A;  2CV0 A;  2A5W A;  1HKT A;  3GVA A;  1XC5 A;  3F21 A;  4A3J J;  3A02 A;  4A0X A;  4KFC A;  5TRD A;  4P55 A;  4LK0 F;  1P4X A;  2E60 A;  2UV1 A;  3ONQ A;  2LKS A;  5E3L A;  2CFX A;  2DA3 A;  3HGG A;  3BTL A;  4RGR A;  2CH0 A;  4CH7 A;  3GFM A;  2A69 F;  3GWZ A;  1YJN I;  2IJL A;  3E6B A;  1ETW A;  2XGE A;  4IXA A;  5CYV A;  1B6A A;  4BJ6 C;  3J7A Y;  1T56 A;  2WY8 Q;  3EET A;  1XG1 A;  3FZV A;  1X3W B;  3PNT A;  1VQ7 I;  3CUO A;  2GOM A;  2HTJ A;  1MIJ A;  5AON A;  4XLH A;  1R49 A;  2L3D A;  3DBR B;  4LIU A;  4FAS D;  2L2O A;  2OF7 A;  4KJZ A;  2YR2 A;  1X2M A;  4ESF A;  3AG2 H;  3IWZ A;  1XDU A;  1DP3 A;  1CF7 B;  3CTA A;  2LF7 A;  3TP0 A;  3WE3 A;  3BZK A;  2Y9Y A;  3VOD A;  1ON1 A;  1OJL A;  4G7Z F;  2LVS A;  3WTV C;  4XKV A;  5D8K B;  3PUB A;  5K7F A;  2XGX A;  1ZN2 A;  2ZXW H;  4UVB A;  2XRO A;  3HG9 A;  2A07 F;  1B4A A;  3ISP A;  4D5C A;  4XIC A;  2X0L A;  3TP3 A;  1UEL B;  3MKY B;  3FIW A;  3JAM K;  5DUI A;  4HX7 A;  2RKH A;  1LB2 A;  4B1R A;  2H1K A;  1PYV A;  2PMZ N;  1HSJ A;  3JRH A;  3RKQ A;  4MHG A;  5HLT A;  4M3D A;  1WH5 A;  4EJT A;  5LHH A;  2LD5 A;  1U8B A;  2R7O A;  2W84 A;  3WE2 A;  3A03 A;  2QZ8 A;  1RI7 A;  1RRJ A;  2OCE A;  1F4K A;  2FQ4 A;  4NC8 A;  1GVJ A;  2KRF A;  3H0G J;  4PDK A;  2LMD A;  4UXN A;  3S17 J;  1T39 A;  3TW7 A;  5L3E A;  1O4X A;  2PMU A;  2Z2S B;  4CDG A;  3SZT A;  3RI4 A;  1SC7 A;  2CG4 A;  2W82 A;  1TWA J;  4BE0 A;  3AG1 H;  3BG5 A;  3HOZ J;  2FSW A;  4CUG A;  3BCB A;  3ZQI A;  1RES A;  2WY7 Q;  1V54 H;  3ZP5 A;  1UMQ A;  5HNH A;  1J09 A;  4P5O A;  2JT1 A;  2WV1 A;  4UVA A;  5EGO B;  3R4K A;  2KHM A;  1IN4 A;  2HGC A;  3SDB A;  4MO7 A;  4E7S A;  3L00 A;  4F92 B;  3GFL A;  5HS7 A;  2ISY A;  4AUX A;  2KQR A;  2K9N A;  4UUT A;  2RN7 A;  3LFU A;  4HOB A;  1FYL A;  3SYT A;  3RZO J;  4P1W A;  4YFX F;  3CUQ C;  3CDH A;  1I1G A;  1O3R A;  3DU5 A;  3HHG A;  3HEF A;  3LQQ A;  4O5V A;  3OIP A;  3CF2 A;  3S1N J;  1U9N A;  2QYO A;  3LAP A;  1ZQ3 P;  4NHJ A;  3GF2 A;  4L9J A;  2LK2 A;  1XB4 A;  4UUS B;  1WJB A;  4M3E A;  4ENJ A;  3E6D A;  4L5I A;  4XID A;  2NS8 A;  3C2B A;  3MKZ A;  3OWT A;  1FOX A;  2XB0 X;  1H9T A;  1X4P A;  1MGT A;  1S9H A;  4HLX A;  4LJZ F;  3V4G A;  2XUB A;  5DM6 F;  2EB7 A;  1WHU A;  3JRD A;  4BAC A;  1ZK8 A;  3GTJ J;  2D5V A;  1ETV A;  2A6T A;  2XPU A;  3BLY A;  3IL2 A;  4JX6 A;  1FPQ A;  1KQ8 A;  4IQJ A;  2CW7 A;  2JRM A;  5CKT A;  5FKN A;  3E3V A;  1JT6 A;  2R0Q C;  2GIV A;  1B72 A;  2KKO A;  1K7A A;  3EPZ A;  4YFK F;  1HA8 A;  2ELK A;  1YRN A;  5LGT A;  1GHC A;  5KVR A;  2EIJ H;  3KE2 A;  2L4A A;  4RGU A;  3V42 A;  3DEU A;  2V7F A;  3S16 J;  4BGD A;  3LL7 A;  3M07 A;  2MD5 A;  3M7G A;  1BR4 A;  3EUH C;  4FET A;  2DK5 A;  3F8F A;  3BJA A;  4LGW A;  2IS1 A;  1IN6 A;  2O5R A;  4V2G A;  3VB2 A;  4B43 A;  2XRL A;  3CO7 C;  3K1N A;  3KEQ A;  1ZG5 A;  2XPV A;  1BI3 A;  1MZB A;  4XLA A;  3T8T A;  4M74 A;  1AU7 A;  4D9J A;  1FOY A;  2P6T A;  1TQP A;  4MIM A;  1XMK A;  4HLY A;  4LMY A;  1LEB A;  2QUF A;  3HL2 A;  1YHQ I;  1HDP A;  1IGN A;  1XGO A;  5AIQ A;  4F91 B;  5EG0 A;  2WA0 A;  2XDV A;  3EYY A;  3RQ4 A;  3WU2 C;  2JVG A;  2DMT A;  1HC8 A;  1XMA A;  4II3 A;  4Y33 A;  5E1W A;  5A2Q K;  1ZGJ A;  5LHG A;  4NB5 A;  3K9T A;  4MEX F;  4Y17 A;  3I71 A;  2I5U A;  5FKM A;  1U5T B;  3JTG A;  4C2M J;  2R7Q A;  4P9F A;  4IF4 A;  2KIM A;  3S1R J;  2F5D A;  1WH7 A;  4EJO A;  2FXA A;  2JPC A;  2X48 A;  4JK1 X;  4LIT A;  5CQE A;  3FBN B;  3ZCO A;  1WZ2 A;  2AQE A;  4CCK A;  4HAM A;  4M3G A;  2DA4 A;  2ZNZ A;  4B48 A;  3LAJ A;  4M9S A;  3COA C;  3FBI B;  2DLL A;  4ZZL A;  2EZL A;  3QYB A;  2KIU A;  4AC0 A;  1SFO J;  2CV2 A;  2KJC A;  5J3L A;  3IKV A;  4OOI A;  3JAM Z;  2EH3 A;  2ZSI B;  3KEY A;  3WTT C;  3OYJ A;  2HXO A;  4DZP A;  4RGS A;  2L4M A;  2PQ8 A;  1G3Y A;  2CQQ A;  2DOA A;  4FX0 A;  2DW4 A;  3GXO A;  4LG0 A;  4R79 A;  4Y15 A;  4N9H A;  1MW7 A;  1TT0 A;  2G0E A;  1ZLK A;  2W48 A;  2QBY B;  1JHH A;  1VQN I;  5IT3 A;  4YRV A;  5C4J J;  1X4O A;  3N05 A;  1UHM A;  2NVY J;  2MG4 A;  4Y3O A;  3F3X A;  1FX7 A;  3TW6 A;  2TCT A;  3W2A A;  2NVU B;  4LIV A;  3GEZ A;  4WX9 A;  4KT6 A;  5FJ8 J;  4GXO A;  1SAU A;  3D5S C;  2XF5 A;  3PIO F;  1BL0 A;  3BR3 A;  2ZSH B;  2DMU A;  1YW8 A;  1SVL A;  4RLF A;  4JOM A;  3S32 A;  1LEA A;  1D8K A;  2HZT A;  2Z1D A;  4HRI A;  1DGR M;  3QOD A;  2M8G X;  1HBX G;  3VYR B;  3WU1 B;  4CYC B;  3E7L A;  3FMS A;  3J81 K;  3VFZ A;  4IJA A;  2Y2Z A;  4AYB A;  3S2W A;  1YJW I;  1JT0 A;  2L9S A;  1NK2 P;  4KIF A;  3A1Y A;  1OIS A;  5HVQ C;  4V19 K;  3UR3 C;  1SVM A;  2HQ5 A;  4IHX A;  4A3L J;  4IPA A;  2RDP A;  2O61 A;  1MMS A;  1OYW A;  2NVT J;  2H09 A;  1TQI A;  2O8K A;  1S6L A;  1X1D A;  2LKX A;  2MA3 A;  4JP0 A;  4N4O B;  1HQC A;  2DDB A;  1YIO A;  3ZGK A;  5ICC A;  1WVR A;  1ZEL A;  2X1E A;  3L2W A;  4LOC A;  3TED A;  2GZW A;  1MBK A;  1S3J A;  4XLC A;  1OCO H;  3OYN A;  4A6D A;  3IKT A;  4YEJ A;  1JUP A;  2G7U A;  2HZD A;  2QEN A;  2X6O A;  5IYC J;  3DLL F;  2DMN A;  3OIO A;  4MFD A;  1GXQ A;  4ZTF A;  4GDF A;  1WJA A;  3PFI A;  1Y0U A;  2LYC A;  4A6E A;  2DT7 B;  4Y7N J;  2EFN A;  3G6E I;  4BBR J;  3BPX A;  3JRA A;  2IGM A;  4XOR A;  5CVJ A;  3J80 Z;  1ERD A;  3HRU A;  3CDL A;  1Y8Q B;  2XKP A;  4Q47 A;  2A6H F;  2M3A A;  1DPR A;  2IAI A;  2L7K A;  1LJ9 A;  2NNN A;  1UST A;  3P9I A;  2B9S A;  4D7N A;  5LGN A;  4IEJ A;  5F0F A;  3A01 B;  1MDM A;  3KFW X;  3E6M A;  4B4C A;  2R93 J;  1SD6 A;  3KP5 A;  3K10 A;  2BY1 A;  4DZJ A;  2RC4 A;  2RAE A;  3FXU A;  1M1E B;  5HLI A;  1W1W E;  1X3Z B;  1BW5 A;  2VN2 A;  4Y4R A;  2CQK A;  3JCU C;  4YIF A;  1VQ5 I;  1EH6 A;  4OIP F;  3ZQF A;  3BDD A;  2HDC A;  2Q1Z B;  5DCM A;  3L2Q A;  1HKS A;  3TO7 A;  3FWE A;  2JWT A;  4E7Z A;  3K4L A;  3Q0U A;  2LRD A;  2M9H A;  2WBM A;  1FYM A;  1D1A A;  1OMI A;  1WJE A;  4HW0 A;  1DDN A;  1V4R A;  2DTR A;  3LA3 A;  5EEA A;  5KNL A;  2ZJP F;  2FBK A;  1JI8 A;  2CUE A;  2W00 A;  4MTD A;  3GTP J;  3DEE A;  3IP4 B;  5EYR A;  1ETK A;  2COB A;  2LC2 A;  1HDD C;  3C7J A;  3NEU A;  2VKH A;  4AID A;  3Q5F A;  3CP2 A;  5H6R A;  2HOE A;  1TWF J;  4AU7 A;  3F0C A;  1WI3 A;  3DPL C;  5GTH C;  1Z6T A;  1W7P A;  3ECO A;  1HXD A;  1ZRC A;  1TTY A;  2STW A;  4AYB N;  2CUF A;  3QPT A;  3TMO A;  1FP2 A;  5FLX Z;  3KET A;  2R5Y B;  2DXI A;  1YOV B;  5JVG F;  1N78 A;  3HOU J;  4OIQ F;  1IO2 A;  1PVE A;  4OAY A;  5D6F A;  4C3H J;  1MBE A;  3Q9S A;  3H9Q A;  4M3B A;  1TLH B;  4OIO F;  1ODD A;  5B3S H;  1DQU A;  4G94 A;  3HHH A;  3QOE A;  1WWX A;  3RPQ A;  3QRF F;  4BQO A;  2QSF X;  1R22 A;  4KA4 A;  1B9N A;  1SAX A;  4RM2 A;  2E36 A;  3ZQ7 A;  1SEU A;  1EH8 A;  1FC3 A;  2EFP A;  4QSH A;  2P7V B;  4A5N A;  3S14 J;  3SEQ A;  1U5T C;  1RIO H;  1RZ4 A;  3I4P A;  1NHA A;  2VAS A;  2FD5 A;  1NK3 P;  3B6A A;  4G8X A;  4BY1 J;  2NYX A;  2QSH X;  3IUO A;  2VI6 A;  4G6Q A;  2IP2 A;  3C2G A;  5D5X B;  1MH4 A;  2JQ7 A;  5HLH A;  1T38 A;  1BI0 A;  1G59 A;  5FRM A;  1Q1V A;  2R7D A;  4KIT B;  1EH7 A;  1WQ2 A; 
#chains in the Genus database with same CATH homology
 4AVP A;  3EDP A;  2CSO A;  1W7P D;  4UVC A;  1LDD A;  1W5T A;  4WXH A;  3U1D A;  2XAF A;  4XSX F;  3CO6 C;  3WU0 A;  3KP3 A;  3PQJ A;  3ERE D;  4Y13 A;  1FBU A;  4KN7 X;  4B8X A;  1BM9 A;  1P6R A;  5JI6 A;  3E5Q A;  2MC3 A;  4R1H A;  3N4M A;  5F6F A;  2DO7 A;  2QLZ A;  2JTV A;  3M8E A;  1GXP A;  1LDJ A;  4RB2 C;  2Q0O A;  5LRR A;  2XAS A;  5E8G A;  1EH7 A;  2MLK A;  3AAF A;  2DK8 A;  2Y48 A;  1ONV A;  4LLL A;  2ZO4 A;  4CYD A;  5K5Q A;  4G7O F;  1ZHF A;  2O3F A;  3BPV A;  5D5V B;  2K4J A;  3ABT A;  4KYW A;  2STT A;  3CJN A;  4RB3 C;  4QWQ A;  2C6Y A;  2A68 F;  2AXL A;  5D5U B;  1C0W A;  3WTU C;  4BYY A;  2M1B A;  5AIP A;  3FXR A;  3FHZ A;  1Z91 A;  3K1M A;  1L0O C;  2H6B A;  5FB2 A;  1SFX A;  2XVC A;  3L09 A;  4OIR F;  3K0L A;  2HKO A;  5JFR A;  1PDN C;  2K02 A;  2FOK A;  4G7H F;  3V8J A;  4HDV A;  3I59 A;  4HV5 A;  3B02 A;  3HTU A;  1QBJ A;  3MQ0 A;  2X4H A;  1A04 A;  4BHP A;  1P92 A;  1WI9 A;  3N97 A;  2QBY A;  1STZ A;  4ZZD A;  2PN6 A;  3FM3 A;  2A3S A;  1ZAO A;  4ON0 A;  1MJA A;  1P4W A;  3KP2 A;  4MQ9 F;  1S29 A;  1G3T A;  4HF2 A;  5FD6 A;  3D5L A;  3V7R A;  1IW7 F;  3R0A A;  1ON2 A;  2W85 A;  2VE9 A;  1PP7 U;  2EA2 A;  3QAH A;  2FML A;  2D1H A;  2G9W A;  4RAZ A;  3RKX A;  5H20 A;  2EFQ A;  2W57 A;  3FMR A;  2QQ9 A;  5ICE A;  4L5J A;  3L9F A;  1IN8 A;  1YQA A;  3FX3 A;  1XD7 A;  5K5O A;  1SMY F;  5BS6 A;  3ZN0 A;  4CO8 A;  2M45 A;  3TO6 A;  4EM1 A;  3DKW A;  1J7K A;  2HQR A;  1YW7 A;  5BPD A;  1HKQ A;  4EV0 A;  1KU7 A;  2KJB A;  1FSH A;  1JE8 A;  4EJV A;  3SHF A;  2H94 A;  4BQA A;  2K7L A;  4IRI A;  3ZMZ A;  3ECH A;  3MEX A;  4I0B A;  3GX4 X;  2CW0 F;  2DPD A;  3F6O A;  2HEO A;  3NQO A;  2IA0 A;  1KQ0 A;  4AWX B;  4KDP A;  4IHS A;  1Z6R A;  4U7B A;  1B9M A;  2JZY A;  3MZY A;  1TW3 A;  3TDZ C;  2NNY A;  4XSZ F;  1MD0 A;  3GZ5 A;  1FYK A;  4FHT A;  3GUD A;  1G3S A;  3FF5 A;  2FE3 A;  2BYV E;  3GZ6 A;  1E17 A;  1DPU A;  3W6J B;  4KMF A;  3ZPL A;  1KA8 A;  5HDN A;  4HF1 A;  3Q9V A;  2OQR A;  5DD8 A;  2VOD A;  2YX4 A;  3J80 K;  4L9V A;  5BOX A;  2DFI A;  1S8N A;  2BBY A;  4I2O A;  2VXZ A;  1IXR C;  3K1P A;  2Z33 A;  2IPQ X;  3J7A O;  4ENK A;  1BI2 A;  1R7J A;  3WTW C;  4I09 A;  1IXC A;  2JPB A;  4LD5 A;  1FBQ A;  2PMH A;  4FT8 A;  2W24 A;  1Z05 A;  5FGM A;  4M9X A;  4K2E A;  5HDK A;  1P2F A;  3KP6 A;  3DXJ F;  4A0Z A;  3I0T A;  4YFN F;  5ILS A;  2FEZ A;  1UB9 A;  3KEO A;  4KT5 C;  3BP8 A;  4ZYG A;  2BV6 A;  2ZME B;  1QO0 D;  4Q48 A;  1KYW A;  4UV8 A;  5DYM A;  5FLX K;  1FZP B;  5DCF A;  5ERI A;  4YII A;  2HFH A;  5HDG A;  3SFZ A;  3BZ6 A;  1K78 A;  1XSX A;  3HOS A;  2P4W A;  4RGX A;  4UV9 A;  1L3L A;  2QQB A;  2FU4 A;  2P5K A;  2RVC A;  1MKM A;  3CUQ A;  1TBX A;  3SQN A;  2A61 A;  4AIJ A;  4EM0 B;  4WF2 A;  1OPC A;  3F6V A;  4G6D A;  2LDU A;  4EMS A;  4ESJ A;  2FQ3 A;  5E17 F;  3MWM A;  4MGR A;  1ZG3 A;  1IXS B;  5FD5 A;  2O6G E;  3LA2 A;  5J8F A;  1O57 A;  1ZG1 A;  1ZH5 A;  3TGN A;  2R3S A;  4M73 A;  1RUN A;  1IZ1 A;  1REP C;  1OR7 A;  2Y75 A;  1J2X A;  1IUY A;  2VC0 A;  3EUH A;  3F8C A;  2DQR A;  3RPU A;  3U2R A;  2HR3 A;  1IF1 A;  1SD4 A;  2VT2 A;  2OU2 A;  5BMZ A;  2QQA A;  3M1E A;  5E1Z B;  3KCC A;  4BXU A;  1HW2 A;  1E2X A;  4OU0 A;  4BH9 A;  1XDS A;  2FRH A;  2DPU A;  4ASN A;  1G6N A;  2M8E A;  1I1S A;  3HOT A;  3F8N A;  4GCV A;  4IRG A;  2EJR A;  2ZBK A;  1J9I A;  3HSE A;  3LWF A;  2HTS A;  2P8T A;  2ZKZ A;  3BJO A;  2EV6 A;  3IRR A;  3E6C C;  2VON A;  1QZY A;  3RIR A;  2EV5 A;  3ZMD A;  4M71 A;  3FMQ A;  2A6E F;  1R1U A;  3HRS A;  5LLQ A;  1Z1D A;  3I54 A;  4PZJ A;  1S7O A;  2HS5 A;  1CF7 A;  4O3M A;  3ZMV A;  2XAH A;  1K6O A;  1FBS A;  3JSO A;  3OV8 A;  3L7W A;  4OMY A;  3L2C A;  3GLX A;  5L3C A;  1U3E M;  4M6X A;  3HIF A;  2FBH A;  4MNU A;  5K5R A;  1XN7 A;  4O6J A;  1P4A A;  1QQI A;  2YSR A;  4BAY A;  1OKR A;  4IRH A;  6PAX A;  2WV0 A;  1R1V A;  4MTE A;  1T2K A;  1YW9 A;  3I58 A;  4LB5 A;  3QPH A;  1R00 A;  1B1B A;  3MFK A;  5HS8 A;  3RYR A;  2TDX A;  1W4M A;  2HWV A;  2VBW A;  1VTN C;  1UCR A;  2EA4 A;  2M30 A;  3HUG A;  1BJA A;  1IAW A;  3V7S A;  5ED4 A;  2F5F A;  3QOP A;  3QU3 A;  4D0P A;  5ILU A;  3LST A;  4EGZ A;  1OYY A;  2P5V A;  2EFW A;  1ZRD A;  2OD5 A;  3WG9 A;  3DF8 A;  3ZMU A;  2A5Y B;  2IRF G;  4ENM A;  2D2W A;  1F5T A;  5E1X A;  4IVN A;  2CGP A;  1BIA A;  1LQ1 A;  3RKW A;  1WSU A;  2M87 A;  1CGP A;  2VBZ A;  1J59 A;  4HF0 A;  4LK1 F;  2EFO A;  5J8C A;  2K27 A;  4XLP F;  1IRG A;  1SFE A;  1USS A;  3RTR A;  3ZMT A;  5LEK A;  3VOE A;  2XAJ A;  1R5G A;  2P7C B;  1FY7 A;  3TKY A;  3G3Z A;  1ZLJ A;  2XAQ A;  3R0J A;  2ELH A;  5ILV A;  3VEP A;  2ADU A;  1LVA A;  3D0S A;  1O7L A;  2J5P A;  5CVV A;  1H0M A;  3GW2 A;  3FM5 A;  2F5E A;  1O3T A;  1BOA A;  2XAG A;  4L0Z B;  3I5U A;  3U9G A;  4ZYH A;  4DNC A;  1LNW A;  4MEY F;  1U5T A;  2LF8 A;  4XLN F;  1FNN A;  3HSR A;  1ZGA A;  5L3D A;  3R61 A;  2CO5 A;  3WGH A;  4Q5S F;  1FLI A;  2QWW A;  2WTE A;  4S05 A;  4LG0 B;  2NS0 A;  3SZP A;  4I7H A;  3IRQ A;  2L01 A;  4I98 B;  3HTS B;  3HSF A;  4EVI A;  5JVT A;  4H0E A;  5HS9 A;  4L9N A;  3V8K A;  3KP7 A;  5CVI A;  2V1D A;  1UFM A;  2QVO A;  1FWZ A;  1O3S A;  5IT9 Z;  4P96 A;  4WXC A;  2OAZ A;  1T6S A;  4AIH A;  3B73 A;  1DP7 P;  4KIB A;  1TW2 A;  1B59 A;  2Z3Y A;  1HST A;  4RB1 A;  4L18 B;  2GXB A;  3IC7 A;  4L9T A;  1Z7U A;  3GFI A;  3BJ6 A;  4U0V A;  3O6B B;  2PI0 A;  5E18 F;  2Q8K A;  2RV8 A;  3P7N A;  4KN4 X;  2DI3 A;  2F5C A;  2OBP A;  3ZMS A;  3RJP A;  1WKM A;  5BQT A;  1W5S A;  2PLY A;  1MDM B;  2PJP A;  2O03 A;  1KGS A;  3WTS C;  4RB0 A;  4ENN A;  3K2Z A;  5FO5 A;  3V8L A;  3LQR A;  2DT5 A;  4HYE A;  4RS8 A;  2ISZ A;  5DCM B;  5D4R A;  1G3W A;  2FMY A;  1SMT A;  3F23 A;  2L02 A;  4CZZ A;  1F9N A;  1OYI A;  3C1D A;  4ZYE A;  4KMU X;  3H3U A;  2MLG A;  3DPT A;  4KUM A;  1W7P B;  4HA8 A;  2YPR A;  5CLS A;  3NRV A;  2BGC A;  2D45 A;  4LLN A;  2PEX A;  2QM3 A;  4P9U A;  4HQE A;  4U88 A;  2GWR A;  2ZNY A;  3T8R A;  4KIG A;  2Z9O A;  4YG2 F;  4TV7 A;  1QNT A;  3F22 A;  1YG2 A;  4R8H A;  2WC2 A;  3E5X A;  4PGG A;  3T1B A;  1T98 A;  5LBQ A;  4BNC A;  1V3F A;  3R6S A;  4FX4 A;  1HW1 A;  2XIG A;  3F8M A;  4ZYD A;  3I64 A;  5F64 A;  5LRS A;  3JTH A;  1AOY A;  2R7F A;  2UXN A;  2NAZ A;  1KQ9 A;  5F1R A;  2DAO A;  3ELK A;  1XGM A;  4EJW A;  5JHU A;  3E5U A;  1R36 A;  2XHK A;  3TOB A;  1RNL A;  2B0L A;  5CVR A;  2VBX A;  5E20 A;  3FXQ A;  3M8F A;  5TJJ A;  3MCZ A;  1X3U A;  1D3Y A;  2RGV A;  2ZXJ A;  3V7C A;  4PGH A;  4UUV A;  1D8J A;  3HRM A;  2V79 A;  2XKO A;  4PCQ A;  1ZAR A;  4XRF A;  2IA1 A;  5L3F A;  2GA1 A;  2HYF A;  3IWF A;  4AIK A;  4CGZ A;  2M5W A;  3T5X A;  2ZJ2 A;  3BWG A;  2H27 A;  1UHW A;  3R60 A;  4LLG F;  1F1Z A;  1XSD A;  4HX4 A;  4A5M A;  2O8X A;  2COM A;  3O3K A;  4U0W A;  3LA7 A;  2F2E A;  1TQM A;  2K86 A;  3EYI A;  3DFG A;  2E1C A;  2PG4 A;  3W6K B;  3GO5 A;  2ACJ A;  4IHT A;  1H9G A;  2D1V A;  4AD9 A;  2ETH A;  1BC8 C;  2EWN A;  1XCV A;  4HBL A;  2Z99 A;  1I27 A;  3G73 A;  2RNJ A;  4UHT A;  3RDI A;  3BRO A;  1O7F A;  5DD4 A;  1IN5 A;  2GXG A;  1Q1H A;  1G4D A;  2Y0M A;  2GAU A;  4HV6 A;  3I59 B;  5CJ9 A;  4JBA A;  5ICF A;  2G7H A;  5HOO A;  1U8R A;  2HKX A;  2MH9 A;  4WCG A;  4HQM A;  1R1T A;  1K79 A;  4HDU A;  4EQQ A;  2CWE A;  2HYG D;  2DQL A;  3TO9 A;  4A0Y A;  5FFZ A;  2WWY A;  1PP8 F;  2Z5U A;  4I02 A;  3KP4 A;  4WWC A;  4Q4Z F;  2XV4 S;  4GYI A;  5KK1 A;  3K69 A;  1SFU A;  4M9Z A;  5FFX A;  1O3Q A;  1KU9 A;  4XBF A;  2EV0 A;  3H3Z A;  4NQW A;  4I0A A;  1J5Y A;  3KZZ A;  4BHC A;  4ZH4 F;  5K1Y A;  2V6C A;  1D5V A;  1MJ9 A;  2J5O A;  1YTY A;  1ZRF A;  2IW5 A;  5CVU A;  4CHU A;  2V1U A;  5HLG A;  1U6G A;  1XGN A;  1SD7 A;  1FT9 A;  1XGS A;  3CLO A;  1XSV A;  1JXS A;  5LEJ A;  1FSE A;  4KIC A;  5JR3 A;  4KNY A;  1JGS A;  2IVM A;  2IA2 A;  2LNB A;  1Z9C A;  5D5W B;  3PQK A;  2VT3 A;  5DUK A;  1WRJ A;  1KYZ A;  4EM2 A;  2HQN A;  4DQ2 A;  3P9C A;  2UXX A;  2L54 A;  1J0R A;  2W25 A;  1BC7 C;  2LKP A;  2LSO A;  1AWC A;  1ZRE A;  1DUX C;  2ESH A;  1BIB A;  3OOP A;  1XCB A;  1HW5 A;  5H6Q A;  4OMZ A;  3RYP A;  5IT9 K;  2IT0 A;  3RKY A;  1YFH A;  3C18 A;  4CXF A;  4MQV A;  2RQP A;  2JRT A;  2BEO A;  2BE5 F;  5A2Q Z;  4B09 A;  3O2P E;  4LB6 B;  3I53 A;  5D8L B;  3MAJ A;  4G9Y A;  1QZZ A;  2ZFW A;  3TOA A;  2MBF A;  1LDK B;  3HYI A;  1QGP A;  2PFB A;  5ICG A;  4U7D A;  3T0Y A;  5D4S A;  5LGU A;  4N0B A;  1YYV A;  2V9V A;  3WTX C;  3JW4 A;  1YS6 A;  2DU9 A;  5L3B A;  4EJU A;  3ABU A;  5DDG A;  2UWM A;  3DV8 A;  2MH2 A;  4GO1 A;  2O0Y A;  5J6X A;  1FOK A;  1ULY A;  3WGI A;  4E70 A;  3GYH X;  4GGG A;  1R23 A;  2NRA C;  2FBI A;  4LFU A;  2ESN A;  3C3W A;  1U2W A;  4ETS A;  3ML6 A;  4CIC A;  2XRN A;  1RUO A;  2E7W A;  2GQQ A;  2FA5 A;  1T0F A;  4M6Y A;  4U0Y A;  4EGY A;  1R58 A;  2K4B A;  2V1X A;  2VC1 A;  1TNT A;  4UNO A;  2FNA A;  4A2U A;  2Q2E A;  2GA2 A;  3J81 Z;  1J75 A;  2E1N A;  2DBB A;  1TNS A;  4OIN F;  3ZN1 A;  3BOQ A;  3LFK A;  2CYY A;  3QP6 A;  4HX8 A;  1QPM A;  3HRT A;  1FP1 D;  3JSP A;  1BN5 A;  1YLF A;  3DP7 A;  2H6C A;  5EEG A;  4QLC U;  2OZU A;  1R5H A;  1ZYR F;  2FNP A;  4M72 A;  1U78 A;  2VOO A;  2P5L C;  5L3G A;  4GYG A;  2VE8 A;  2UZK A;  3KLN A;  3KZY A;  5EEH A;  3SXY A;  1IN7 A;  1BBY A;  5DEQ A;  1K78 B;  2PBI A;  4HZF A;  3MZH A;  2VOP A;  4JQF A;  1I6X A;  5LHI A;  5E8I A;  3CUQ B;  4N9I A;  2EK5 A;  2ZME A;  4WXD A;  2YX7 A;  3F72 A;  2AS5 F;  4L0Y B;  1EV7 A;  4RAY A;  3ROU A;  4WK8 F;  1KU2 A;  2OA4 A;  3WOD F;  1MJB A;  5D6E A;  3QU6 A;  1IRF A;  3KLO A;  4F7Z A;  4Z2Y A;  2KIF A;  4S04 A;  3WTY C;  1BI1 A;  3ULQ B;  1JHF A;  3M9A A;  3EQL F;  2FF4 A;  3P9K A;  3QP5 A;  3WGG A;  3DQV C;  2OZ6 A;  1S7A A;  3H92 A;  2JSC A;  2ZCW A;  4I01 A;  1I5Z A;  2VBY A;  3IHU A;  2OQG A;  3TDU C;  1YO5 C;  3WTZ A;  3E97 A;  3F8B A;  2YU3 A;  4BHB A;  4ESB A;  2E7X A;  1SD5 A;  1KU3 A;  1YS7 A;  5DV5 A;  3BY6 A;  1PUE E;  3GFJ A;  3TQN A;  5BPI A;  2P6S A;  3REO A;  1HKT A;  3GVA A;  3F21 A;  4A0X A;  4KFC A;  5TRD A;  4P55 A;  4LK0 F;  1P4X A;  2CFX A;  4RGR A;  3GFM A;  2A69 F;  3GWZ A;  2IJL A;  3E6B A;  4IXA A;  5CYV A;  1B6A A;  3EET A;  3FZV A;  3CUO A;  2HTJ A;  5AON A;  2L3D A;  2YR2 A;  4ESF A;  3IWZ A;  1XDU A;  1CF7 B;  3CTA A;  2LF7 A;  3WE3 A;  3VOD A;  1ON1 A;  4G7Z F;  3WTV C;  5D8K B;  2XGX A;  1ZN2 A;  4UVB A;  2XRO A;  2A07 F;  1B4A A;  3ISP A;  2X0L A;  3JAM K;  5DUI A;  4HX7 A;  2RKH A;  1LB2 A;  1HSJ A;  4MHG A;  4EJT A;  5LHH A;  2W84 A;  3WE2 A;  2QZ8 A;  1RI7 A;  1F4K A;  1GVJ A;  2KRF A;  4UXN A;  4PDK A;  1T39 A;  5L3E A;  2PMU A;  4CDG A;  3SZT A;  3RI4 A;  2CG4 A;  2FSW A;  3ZP5 A;  4P5O A;  2JT1 A;  4UVA A;  3R4K A;  1IN4 A;  2HGC A;  3L00 A;  3GFL A;  5HS7 A;  2ISY A;  2RN7 A;  4HOB A;  1FYL A;  4YFX F;  3CUQ C;  3CDH A;  1I1G A;  1O3R A;  3HHG A;  3LQQ A;  4O5V A;  2QYO A;  3LAP A;  4NHJ A;  3GF2 A;  4L9J A;  1XB4 A;  4ENJ A;  3E6D A;  4L5I A;  1H9T A;  1MGT A;  4HLX A;  4LJZ F;  3V4G A;  2XUB A;  2EB7 A;  3IL2 A;  1FPQ A;  1KQ8 A;  3E3V A;  2GIV A;  2KKO A;  1K7A A;  4YFK F;  1GHC A;  5LGT A;  5KVR A;  3KE2 A;  2L4A A;  4RGU A;  3DEU A;  2MD5 A;  3M7G A;  2DK5 A;  3F8F A;  3BJA A;  4LGW A;  1IN6 A;  3VB2 A;  3CO7 C;  3K1N A;  3KEQ A;  1ZG5 A;  1BI3 A;  1MZB A;  3T8T A;  4M74 A;  2P6T A;  1TQP A;  1XMK A;  4HLY A;  4LMY A;  1LEB A;  2QUF A;  1XGO A;  5AIQ A;  3EYY A;  1XMA A;  5E1W A;  5A2Q K;  1ZGJ A;  5LHG A;  4NB5 A;  3K9T A;  4MEX F;  4Y17 A;  3I71 A;  1U5T B;  3JTG A;  4P9F A;  4IF4 A;  2KIM A;  2F5D A;  4EJO A;  2FXA A;  2JPC A;  4JK1 X;  4HAM A;  2ZNZ A;  3LAJ A;  4M9S A;  3COA C;  4ZZL A;  2DLL A;  2KIU A;  2KJC A;  3IKV A;  4OOI A;  3JAM Z;  3WTT C;  4RGS A;  2L4M A;  2PQ8 A;  1G3Y A;  4FX0 A;  2DW4 A;  3GXO A;  4LG0 A;  4R79 A;  4Y15 A;  4N9H A;  1ZLK A;  2QBY B;  1JHH A;  5IT3 A;  1UHM A;  3F3X A;  1FX7 A;  3GEZ A;  4WX9 A;  4GXO A;  1YW8 A;  1LEA A;  1D8K A;  2HZT A;  1HBX G;  3WU1 B;  3FMS A;  3J81 K;  3VFZ A;  4IJA A;  3S2W A;  4KIF A;  5HVQ C;  4IPA A;  2RDP A;  2O61 A;  1OYW A;  2H09 A;  1TQI A;  1S6L A;  2MA3 A;  1HQC A;  1YIO A;  5ICC A;  2GZW A;  3IKT A;  1S3J A;  4A6D A;  2G7U A;  2QEN A;  1GXQ A;  3PFI A;  1Y0U A;  4A6E A;  2EFN A;  3BPX A;  5CVJ A;  3J80 Z;  3HRU A;  2XKP A;  4Q47 A;  2A6H F;  1DPR A;  2NNN A;  1LJ9 A;  3P9I A;  1UST A;  5LGN A;  1MDM A;  3KFW X;  3E6M A;  1SD6 A;  3KP5 A;  2RC4 A;  3FXU A;  5HLI A;  2VN2 A;  2CQK A;  4YIF A;  1EH6 A;  4OIP F;  3BDD A;  2HDC A;  5DCM A;  1HKS A;  3TO7 A;  3FWE A;  1FYM A;  1OMI A;  4HW0 A;  1DDN A;  1V4R A;  2DTR A;  3LA3 A;  2FBK A;  4MTD A;  3C7J A;  3NEU A;  3Q5F A;  5H6R A;  2HOE A;  3DPL C;  1Z6T A;  1W7P A;  3ECO A;  1HXD A;  1ZRC A;  1TTY A;  2STW A;  3QPT A;  1FP2 A;  5FLX Z;  3KET A;  4OIQ F;  5D6F A;  3Q9S A;  1TLH B;  4OIO F;  1ODD A;  4G94 A;  3HHH A;  1WWX A;  3RPQ A;  3QRF F;  1R22 A;  4KA4 A;  1B9N A;  1SAX A;  3ZQ7 A;  1EH8 A;  1FC3 A;  2EFP A;  4A5N A;  2P7V B;  1U5T C;  1RIO H;  1RZ4 A;  3I4P A;  1NHA A;  4G8X A;  2NYX A;  4G6Q A;  2IP2 A;  5D5X B;  5HLH A;  1T38 A;  1BI0 A;  2R7D A;  4A12 A;  1WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...