1UHWA

Solution structure of the dep domain of mouse pleckstrin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GSSGSSGLGALYLSMKDPEKGIKELNLEKDKKVFNHCLTGSGVIDWLVSNKLVRNRQEGLMISASLLSEGYLQPAGDLSKNAADGIAENPFLDSPDAFYYFPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin
publication title Solution structure of the DEP domain of mouse pleckstrin
rcsb
source organism Mus musculus
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhwA00
1P2FA 3TO7A 4EJVA 2F5CA 5L3FA 4Z2YA 1P92A 3Q9SA 4HX7A 1ZYRF 3TOAA 1YLFA 2EWNA 3JAMZ 5LLQA 3Q5FA 1SD4A 2D1HA 5FD6A 2ELHA 5ERIA 2M8EA 4L0ZB 2J5PA 4ENNA 1R00A 4G7HF 5D4RA 4JK1X 1YS7A 2NNYA 3I0TA 3I53A 4IF4A 3MZHA 4RB2C 3H3ZA 3E97A 2R3SA 1MZBA 3ZP5A 3CDHA 2DTRA 1T39A 4M6YA 2DBBA 4N0BA 5D8KB 1IUYA 4ETSA 4L9TA 4M71A 4LG0B 3JTGA 5E1WA 1OYIA 1LEBA 3AAFA 3D5LA 2MLGA 3I58A 3RKWA 4OOIA 1IZ1A 2STWA 1BJAA 1R1UA 2L4MA 1TQMA 3ECHA 4CDGA 1XMAA 3QU3A 3R4KA 1FX7A 1CF7B 2A6HF 5IT9Z 2DQLA 3M8EA 3PQKA 1P4AA 2Z99A 4A6EA 2CGPA 1QBJA 2QWWA 1FBSA 5LEJA 4KUMA 3SFZA 2EA4A 3WGGA 4OIQF 1Z91A 3DFGA 3I71A 3T0YA 4Q4ZF 1J0RA 1R5HA 3ZMUA 2QZ8A 1GHCA 4Y17A 4IRGA 1K7AA 1FNNA 2H6BA 1TW3A 1C0WA 3GVAA 2RNJA 4A0YA 4GCVA 1FWZA 1STZA 1Q1HA 1FPQA 5DV5A 1YQAA 2YR2A 4ENJA 1LB2A 5ICGA 1U3EM 2OQRA 4B09A 4EM1A 1Z6RA 1ZHFA 4LB6B 5LEKA 1U8RA 2YU3A 2MC3A 3W6JB 2EK5A 3F23A 4A0XA 4BHCA 2LDUA 1Z9CA 1F9NA 5BOXA 1T98A 2VXZA 1XSDA 4UVCA 1YG2A 1ON2A 5FD5A 3L9FA 5D5UB 2BEOA 1LQ1A 2EV5A 1I1GA 1G4DA 4IHTA 2A5YB 3LA7A 4G6QA 3ABUA 2XUBA 2RV8A 3KEQA 3HRUA 3L09A 1YW9A 3COAC 4ZZLA 3T8RA 3VOEA 4HQEA 1R36A 2P6SA 2XRNA 4CO8A 4M9SA 5L3EA 1Z6TA 4L9JA 3RYPA 3TGNA 3HSEA 1G3TA 1ZARA 1H9GA 3KP5A 2BV6A 1YW7A 1BC8C 3E3VA 3BP8A 1YS6A 4M9ZA 3IWFA 4YFNF 2YPRA 2PBIA 2MH9A 5HS7A 1YFHA 5ILVA 2FBKA 3SZTA 4I7HA 1J5YA 3I59A 4XSXF 2C6YA 4EQQA 3CUOA 2YSRA 1R1TA 2LSOA 4BXUA 2TDXA 4P9FA 1V4RA 1QPMA 5FLXK 3PQJA 1I6XA 2F5EA 2IPQX 2HTJA 4HQMA 5CVJA 1RUOA 3LWFA 5ED4A 3R61A 1GVJA 4CICA 4IXAA 3KP4A 1IN6A 1B4AA 2P8TA 2FBIA 2CO5A 4BYYA 1WWXA 2VBXA 3ZQ7A 4I01A 4LLLA 1T38A 3BZ6A 2XAGA 1KGSA 1G6NA 4YIIA 4LMYA 2GIVA 2GA2A 5HLGA 1XN7A 3WGHA 1W4MA 2XKOA 3K0LA 3R0AA 2YX4A 4GO1A 1ON1A 2UXNA 3WTWC 1USSA 3E5UA 2UZKA 5E8IA 3U9GA 2EV0A 2CQKA 2M5WA 1T0FA 3BOQA 5TRDA 2FSWA 1R7JA 1FSHA 1KU7A 4CHUA 2D2WA 5F6FA 3DF8A 3F72A 1IAWA 2FE3A 4RB3C 1U5TC 3V8KA 4QLCU 1ZRFA 3HYIA 5JR3A 1S7AA 2ZMEB 4OU0A 4OMZA 2XIGA 3J7AO 4PZJA 5D4SA 3QOPA 4CYDA 3GF2A 4NHJA 5HLHA 3TOBA 3IRRA 1OKRA 2FMLA 4R79A 1ZG5A 3LFKA 1XSXA 2JPCA 4EVIA 1OMIA 3FZVA 1YYVA 2OZ6A 2V9VA 3F8NA 1QGPA 2EFNA 5K1YA 1LDJA 5FFZA 1FOKA 2PLYA 4XRFA 4O3MA 1KYWA 3GX4X 3C3WA 1LDDA 2MH2A 1O7LA 5EEHA 2BE5F 5HDGA 4GYIA 5H6QA 3VEPA 3TKYA 5DCMB 1T2KA 5DCFA 3CUQC 4AVPA 2VE8A 1PP8F 2E1CA 3GO5A 2M87A 2VOPA 1SD6A 4G6DA 4U88A 3WE2A 3ZMTA 4LG0A 3B73A 1J59A 2P7CB 1MDMB 2DLLA 1TNTA 4M73A 1BI1A 4A0ZA 5BPDA 3M9AA 3K1PA 3NRVA 4WXDA 4R8HA 1V3FA 1J75A 1LEAA 3FXQA 2D1VA 3T5XA 5D5WB 5HVQC 1GXPA 1CF7A 1XDSA 2K02A 2VBWA 4I0BA 1D8JA 1UB9A 3KLNA 3HIFA 3HTSB 3V8JA 2FNPA 3RPQA 4EMSA 1VTNC 2ZKZA 3TQNA 3VFZA 1KQ9A 1WSUA 2QBYB 2O0YA 1MD0A 3LSTA 3FMRA 2H6CA 1I1SA 3F6OA 5K5RA 4G9YA 1H0MA 1B1BA 4UNOA 3J81K 1Z7UA 2W57A 2V79A 1AWCA 1HSTA 4EJUA 1BC7C 3HRMA 2MD5A 1L3LA 2ZJ2A 2DQRA 3TO9A 2G9WA 1ONVA 1TBXA 4BAYA 3GXOA 3JTHA 4WXHA 2OA4A 4L9NA 3K1NA 2F5FA 4ESJA 3O2PE 2EFPA 1D3YA 1AOYA 1UFMA 1QZZA 2HGCA 2QUFA 1BOAA 1I27A 4AWXB 3KP3A 2LNBA 4ENKA 3GW2A 3HSFA 3KZZA 2E7XA 3SHFA 1S7OA 4RB1A 2OAZA 2ADUA 2FU4A 1FYKA 1R23A 1KQ0A 1O3TA 2CSOA 1D5VA 2QLZA 1U5TB 1W7PB 3BDDA 3ZN0A 4HF1A 3KEOA 1JHHA 1IN4A 5FLXZ 5E20A 4MTEA 4OIOF 1XGOA 4N9HA 1WKMA 2YX7A 4IRIA 3FXUA 2BGCA 2STTA 2XROA 2JPBA 5AONA 4L18B 2CWEA 2X4HA 2HYGD 2OQGA 1F4KA 1MJAA 2M45A 3I64A 2R7DA 2Y0MA 2ESNA 1F5TA 5BPIA 3HRTA 1MKMA 1X3UA 5AIQA 2A69F 2K27A 3FM5A 2PQ8A 2QQ9A 2O3FA 3WTUC 4HW0A 1S29A 3P9CA 4EJWA 4KT5C 2ACJA 4HV6A 3CUQB 4KIGA 2VBYA 1RZ4A 5ICCA 3LAJA 2EJRA 3GZ5A 2HS5A 2QVOA 2EFOA 1IRGA 2XHKA 4KDPA 4P55A 2UXXA 1O57A 4CZZA 3P9IA 3ZN1A 3U2RA 1DUXC 3GLXA 5J8FA 2W25A 4ESBA 3V8LA 2HZTA 1O3RA 3ZMZA 2JT1A 4IPAA 2PMUA 1MGTA 4MGRA 3GYHX 3WTYC 4KMFA 2P7VB 3KE2A 4ON0A 4EGYA 2JSCA 3SQNA 4FX0A 5FGMA 3WTSC 5KVRA 1HXDA 3J80K 2OBPA 1FBQA 4LK0F 2Y48A 2M1BA 3ZMDA 4LJZF 3LQRA 4HX4A 4ZYGA 3DKWA 3BJ6A 1HW2A 3LQQA 3EETA 3G3ZA 1RI7A 3WU1B 1IN7A 4AIKA 2ZMEA 3CTAA 4IHSA 3DXJF 4P9UA 3QP6A 2IJLA 3IWZA 3CJNA 3BWGA 3T8TA 1FP1D 2KKOA 4G7ZF 4FHTA 5ICFA 4AIHA 1J2XA 4G8XA 1YTYA 3GFJA 4Q47A 3T1BA 2GAUA 3VB2A 1QZYA 4ZYEA 2WTEA 2IW5A 1D8KA 4EM2A 4DQ2A 2RKHA 1W5TA 1DP7P 1ZN2A 3CLOA 5LHIA 4FX4A 4L5JA 1RUNA 2L01A 3GZ6A 3MWMA 5CVRA 2A07F 2GXGA 1FC3A 3KZYA 4H0EA 3E6MA 5AIPA 2LF8A 4ASNA 1GXQA 2OZUA 5DCMA 4HZFA 2Q8KA 5DUKA 3R6SA 3P7NA 3V7SA 1ZG1A 1Z1DA 1E2XA 1RIOH 3C7JA 4RGXA 1ULYA 3F8CA 3HHGA 2EFWA 1MDMA 4XBFA 6PAXA 3R60A 1Y0UA 1O3SA 4BHBA 1JHFA 4UXNA 4L9VA 3ZPLA 2HQNA 3ZMSA 5DDGA 2O6GE 3RPUA 4AIJA 1REPC 2K86A 2FMYA 3GFMA 2K7LA 3WE3A 2FOKA 4MQVA 4NB5A 3N97A 4BNCA 3RI4A 4Q5SF 4BQAA 5LGNA 2KIFA 5KK1A 4WCGA 1SD5A 3EYYA 3WG9A 3V4GA 4U0YA 1XGNA 4PCQA 2VE9A 3L00A 1DDNA 3HTUA 4XLPF 2XAQA 2PFBA 2ESHA 4EV0A 2CW0F 4LLNA 4U0WA 2QBYA 4GGGA 5J8CA 2XVCA 1O3QA 5DYMA 4AD9A 2QYOA 1OYYA 1TLHB 3I5UA 1YW8A 1HKQA 3ELKA 3ROUA 4LFUA 4MHGA 3FXRA 1OYWA 4IRHA 2E7WA 4P96A 3HOTA 1DPRA 2H27A 1T6SA 4IJAA 1SAXA 1USTA 1ZGAA 1K78B 5LRSA 1HBXG 2AXLA 3M1EA 5HS9A 5H6RA 2XV4S 2BYVE 4RGRA 2HYFA 5CLSA 5K5OA 4I0AA 2VONA 5LGTA 3WU0A 5EEGA 3HRSA 5E18F 1WQ2A 4HLXA 3FMQA 3VODA 3BROA 3I4PA 3Q9VA 2VC1A 1B9NA 1FZPB 5A2QK 2O8XA 2COMA 4TV7A 2V6CA 1W5SA 2OU2A 1ZGJA 3QPHA 2W85A 4XSZF 2A3SA 5DD8A 3C18A 4JBAA 1B59A 4U7BA 2NAZA 4KFCA 1IXRC 1MJ9A 2IRFG 4BH9A 2RQPA 2ZNZA 1U5TA 1W7PA 3K69A 1NHAA 4WXCA 5L3GA 2EV6A 2FXAA 2P4WA 4L5IA 1IN8A 3ULQB 3I54A 4UV9A 4CGZA 1ODDA 2FEZA 3DEUA 2WC2A 1B9MA 2ETHA 3M7GA 1IF1A 5JFRA 2KJCA 4CXFA 1LNWA 5CVVA 2PMHA 3LA3A 3JSOA 1FSEA 2KJBA 3W6KB 2QM3A 4A5MA 5D5VB 1Z05A 4MEYF 3DP7A 5HDKA 2OD5A 4D0PA 3F8FA 3GEZA 4PGHA 5D6EA 5L3BA 3CUQA 2DU9A 2HDCA 3ABTA 3WTZA 3J80Z 1U2WA 4I02A 1G3YA 1WRJA 4ZZDA 5H20A 1KYZA 2FRHA 3ML6A 1DPUA 1XSVA 3L7WA 1U78A 2EFQA 1LDKB 2PEXA 5HS8A 2PN6A 3KETA 1J7KA 3TDUC 2EB7A 3KP6A 2V1XA 3FM3A 2W24A 2ZBKA 4EJOA 3IRQA 5LHHA 3U1DA 2H09A 2QQBA 2XAJA 4KYWA 1G3WA 5LHGA 3NQOA 4ZYDA 1TQPA 1ZH5A 2VOOA 2RDPA 3QRFF 3QU6A 2NS0A 1XCBA 1HSJA 1PUEE 1KU3A 4HV5A 5K5QA 3D0SA 4HA8A 4Y15A 2GZWA 1BBYA 2DT5A 3K9TA 4O5VA 5JI6A 2Q0OA 3GUDA 1HW1A 4L0YB 2JTVA 1KQ8A 2FQ3A 1XGMA 3TDZC 1KA8A 4RAZA 4WK8F 3PFIA 2RGVA 5F64A 3ERED 4HBLA 3IC7A 4P5OA 2QQAA 2FNAA 4DNCA 2IT0A 4KA4A 4KNYA 1E17A 3N4MA 5CYVA 3RDIA 2Z5UA 2WV0A 3LAPA 2RVCA 4MQ9F 4OIPF 3MQ0A 2HWVA 1UHWA 2X0LA 1XB4A 4ESFA 2HR3A 1UCRA 1PP7U 2IVMA 3E6DA 1QO0D 5ILSA 5CJ9A 5D6FA 3HHHA 2LKPA 3DV8A 3OOPA 3F8BA 2PJPA 1SFEA 1P4XA 4G7OF 3RTRA 4B8XA 4UV8A 2R7FA 2L4AA 1IW7F 4A6DA 1IXCA 5F1RA 1O7FA 4Y13A 1U6GA 5ICEA 4HF0A 2DFIA 5L3CA 2ISZA 3S2WA 4OIRF 1CGPA 2ZCWA 2PG4A 2CYYA 2ISYA 1ZRCA 4HDVA 2D45A 2DAOA 2IA0A 3MAJA 3F6VA 3V7RA 2HKOA 2XAHA 5E1ZB 4WWCA 3ECOA 2FF4A 4OMYA 2P6TA 4NQWA 4RGUA 1FY7A 2MA3A 2WWYA 5BQTA 2O03A 2VN2A 2ZNYA 1OR7A 4MTDA 3WTVC 2DK5A 3TO6A 4I98B 1A04A 2MBFA 4LGWA 5E8GA 3HUGA 4WX9A 1S8NA 5CVUA 4QWQA 2ZFWA 1XCVA 5DEQA 2H94A 4I2OA 4M72A 1FYLA 1OPCA 2DK8A 1HKSA 2HKXA 3GWZA 1UHMA 3KFWX 5A2QZ 3QAHA 5J6XA 5FFXA 4HLYA 2LF7A 4HDUA 4A12A 3MFKA 3F3XA 2UWMA 3FWEA 4RGSA 4ZYHA 3DPLC 2RN7A 1K78A 3B02A 3E6CC 1JXSA 1LVAA 2A61A 3L2CA 3JW4A 1XD7A 2XASA 4RS8A 2RC4A 1BN5A 3HOSA 2P5VA 3IL2A 4MEXF 3O3KA 2GA1A 3SZPA 3CO6C 3RYRA 1QNTA 3FX3A 2GQQA 2P5KA 3K1MA 3KCCA 4OINF 4RAYA 2VT3A 4PGGA 3G73A 3IKTA 4S04A 2Y75A 4KIFA 3JAMK 2G7HA 2V1DA 1BIAA 4BHPA 4EJTA 2Q2EA 4HX8A 3NEUA 4LD5A 2L54A 1HW5A 2HEOA 4YG2F 3P9KA 2O61A 2GXBA 3ZMVA 4UVAA 3EUHA 5HLIA 2FBHA 5DUIA 5E17F 1BIBA 3MEXA 2HTSA 3SXYA 4M74A 3MZYA 1K6OA 3M8FA 1ZRDA 4FT8A 3FHZA 2AS5F 2XGXA 3EYIA 1YIOA 5LGUA 2W84A 5TJJA 5E1XA 2IP2A 1TTYA 4PDKA 2ZO4A 5D8LB 5LRRA 3LA2A 3J81Z 3QP5A 3BPXA 3V7CA 3H92A 4S05A 1TW2A 3HSRA 5BMZA 5FO5A 1MJBA 4EM0B 1KU9A 3OV8A 3IKVA 3DPTA 5IT9K 1K79A 2JZYA 1EV7A 3REOA 4GXOA 3CO7C 1H9TA 2KIMA 4M9XA 5HDNA 2B0LA 4M6XA 1XGSA 1S6LA 2L02A 2G7UA 2Z9OA 3BJAA 3R0JA 3WTTC 2P5LC 5JVTA 2V1UA 1QQIA 1SD7A 1KU2A 3WODF 2NNNA 2VT2A 1L0OC 1SFUA 2XKPA 4I09A 2PI0A 1IN5A 3EDPA 3RKXA 2Z3YA 1BI0A 3JSPA 1SMYF 1TNSA 2CFXA 4UHTA 1J9IA 4GYGA 3O6BB 2HFHA 3GFLA 2A68F 3RIRA 1LJ9A 2K4JA 2KIUA 2VBZA 1EH6A 1HKTA 2FA5A 2DPUA 4UUVA 3F22A 3KP2A 4KMUX 1R22A 1S3JA 1HQCA 3FF5A 2XAFA 4LLGF 2IA1A 1FT9A 5FB2A 2A6EF 3KP7A 3RJPA 5DD4A 4ENMA 2BBYA 1PDNC 4YFKF 4HAMA 5ILUA 5BS6A 2IA2A 4U0VA 2F5DA 1P4WA 1RNLA 2J5OA 1ZLJA 1IRFA 2DPDA 3I59B 2Z33A 2DO7A 4E70A 1BM9A 1JGSA 2DI3A 4IVNA 1EH8A 1ZG3A 4R1HA 2QENA 5IT3A 1FBUA 2HQRA 5HOOA 2MLKA 3ISPA 1R5GA 1W7PD 4Q48A 3F21A 1IXSB 3KLOA 2DW4A 3DQVC 2M30A 1P6RA 4UVBA 1I5ZA 5LBQA 4YIFA 5D5XB 2K4BA 5JHUA 3EQLF 4HOBA 5CVIA 4LB5A 5L3DA 1FLIA 2NRAC 1TQIA 1G3SA 4KICA 4JQFA 3QPTA 1ZAOA 3MCZA 3C1DA 3WTXC 4EGZA 1XMKA 4HF2A 4KIBA 2VC0A 1EH7A 1R1VA 1BI3A 3F8MA 3IHUA 3BY6A 4RB0A 1FYMA 1YO5C 3WGIA 1B6AA 4K2EA 1SFXA 3E5XA 4F7ZA 1R58A 1JE8A 2GWRA 4O6JA 2EA2A 3BPVA 4YFXF 1SMTA 3E5QA 1F1ZA 3E6BA 2KRFA 4KN7X 3GFIA 3RKYA 4MNUA 2ZXJA 3K2ZA 4G94A 2E1NA 1BI2A 4LK1F 4XLNF 4HYEA 4KN4X 4A5NA 4N9IA 4U7DA 2L3DA 4ZH4F 1XDUA 2HOEA 1WI9A 2VODA 1FP2A 3FMSA 2F2EA 2CG4A 4A2UA 3BJOA 3H3UA 1ZREA 4WF2A 2JRTA 1ZLKA 2NYXA
chains in the Genus database with same CATH superfamily
1P2FA 3K10A 1MBGA 2PMZA 4IOCF 3TO7A 2W4SA 4ZTFA 3K4BA 3CCEI 4EJVA 2BXYA 2F5CA 5L3FA 2A6TA 2NVQJ 4Z2YA 3DEWA 1P92A 3EPZA 3Q9SA 5FLVA 2XC7A 2E60A 4HX7A 4M3DA 2EZIA 2GIZA 1EJ9A 1ZYRF 5GTHC 3TOAA 1YLFA 2EWNA 1VQPI 3JAMZ 2F4IA 5LLQA 3BCBA 3Q5FA 2KZVA 1SD4A 2D1HA 2F4OB 2ELHA 3FBNB 5ERIA 5FD6A 3I4NJ 2M8EA 4L0ZB 2J5PA 1K4TA 1MMGA 1R00A 4ENNA 4UUSB 4RMNA 4HEA2 3OIOA 3S14J 5EEAA 2COBA 4G7HF 5D4RA 2MG4A 4JK1X 1YS7A 3CJRB 2NNYA 3TEDA 3HDDA 3I0TA 4A3BJ 3I53A 4IF4A 3VWBA 3MZHA 4BJTA 4RB2C 3H3ZA 4II3A 5LD2C 3ZCOA 3IV5A 4KISA 4XICA 4J00A 3E97A 1FTTA 4CCKA 2R3SA 1JKRC 2ZSHB 1MZBA 3ZP5A 3CDHA 2DTRA 1T39A 4M6YA 3CF5F 2DBBA 4N0BA 2CUZA 5D8KB 3HOVJ 1IUYA 4ETSA 4RDUA 1YITI 4L9TA 2K9QA 4XKVA 3H9JA 4M71A 4E7SA 4LG0B 3JTGA 2JA6J 3HG9A 5E1WA 2KIQA 3RZOJ 1OYIA 1LEBA 4XK4A 3AAFA 1LE8A 5FJ8J 2HVRA 3D5LA 2MLGA 4JYKA 3I58A 2IEKA 1LFPA 3RKWA 4ABZA 3CC4I 4OOIA 2QSFX 2I5UA 1IZ1A 1V5EA 1BJAA 2STWA 3KYCB 3HOZJ 1OR7C 2XSDC 2WAQN 2EIMH 1R1UA 2W82A 2L4MA 1TQMA 2JMWA 3ECHA 2BZTA 4CDGA 2CMPA 1XMAA 3QU3A 3R4KA 1FX7A 1CF7B 2A6HF 5IT9Z 2DQLA 3M8EA 3PQKA 1P4AA 2Z99A 4A6EA 4GRIA 2H1LA 2CGPA 1QBJA 2DMTA 2QWWA 5IYCJ 2VLAA 1FBSA 3SJMA 5LEJA 2LY1A 4KUMA 3BR6A 5J4VA 3SFZA 2EA4A 3WGGA 4CCMA 3ASOH 3UR3C 4OIQF 3FHNA 1Z91A 3DFGA 3I71A 3T0YA 4XRSA 1TT0A 4Q4ZF 4AYBN 2R92J 1J0RA 2V7FA 1R5HA 1P7IA 3ZMUA 2QZ8A 5FRNA 1GHCA 1QVTA 2BY3A 4NC6A 2N8GA 4DZJA 4Y17A 3OSFA 3BQZA 3G1LA 2E1MB 4IRGA 1K7AA 1FNNA 2H6BA 3GTJJ 1TW3A 1C0WA 3GVAA 2RNJA 1R49A 1OQYA 4A0YA 3NWTA 4GCVA 1P7JA 1UAAA 3MMYB 1BL0A 1SVOA 1FWZA 3LOCA 3FIWA 3HOYJ 3ESWB 1STZA 2LP0A 4B48A 1Q1HA 1FPQA 2TRTA 4C3HJ 2ZSIB 5B1BH 1GV5A 3CCYA 4CCNA 1NTCA 1MMSA 5GAEJ 5DV5A 1QA6A 5C3EJ 1YQAA 1OCOH 2YR2A 4ENJA 3GTGJ 5M5XJ 1LB2A 5ICGA 1U3EM 3C2BA 4XOPA 2OQRA 2KMUA 4B09A 3K4KA 1B8IA 2M9HA 4EM1A 1Z6RA 1ZHFA 4LB6B 5LEKA 1U8RA 2YU3A 1PYVA 2MC3A 3W6JB 4I76A 5EG0B 2EK5A 3AG2H 3F23A 3EUKL 3HXLA 1FTZA 1MBFA 4A0XA 4BHCA 2LDUA 4ZDOA 1Z9CA 1F9NA 4CA0A 3ZR8X 5BOXA 1T98A 2AXTC 2VXZA 3TL4X 1XSDA 3K70C 3ZGKA 2L9VA 4UVCA 1VFCA 1YG2A 1ON2A 5FD5A 1FOWA 3L9FA 5D5UB 2V6EA 2BEOA 4RA2A 1LQ1A 3H35A 2EV5A 1I1GA 1G4DA 1HCRA 4IHTA 4OAYA 2A5YB 3LA7A 2R5YB 2F48A 5EJCA 1EA3A 4G6QA 2R7VA 3FBIB 3ABUA 3KYDB 2XUBA 2RV8A 3KEQA 3HRUA 3L09A 1MNEA 3VYSB 2DYRH 2E71A 1SEUA 1YW9A 2ZB9A 3G1OA 3COAC 3FDYA 2DFEA 4ZZLA 4J19A 3SZGA 3T8RA 3VOEA 4HQEA 1UELB 3C2HA 1R36A 2P6SA 2XRNA 4CO8A 2M0MA 4M9SA 5HLTA 3BTCA 5L3EA 4IHVA 5GAHJ 1Z6TA 4L9JA 3HPGA 5CQEA 3RYPA 3WG7H 5J4YA 3A4CA 3TGNA 2R7OA 3HSEA 1VQ9I 1G3TA 1JT0A 1ZARA 4IQJA 1H9GA 1IC8A 3KP5A 3BR2A 2BV6A 4FASD 1YW7A 1BC8C 3PM1A 1W0UA 2LFBA 3E3VA 3BP8A 4GDFA 1YS6A 4M9ZA 3IWFA 4MIMA 2M2EA 4YFNF 2YPRA 2PBIA 2LMDA 2NVUB 1FIAA 2MH9A 5HS7A 1YFHA 3N05A 5ILVA 5DTDA 3QPLA 2BVMA 2FBKA 4I7HA 4IQ4A 4LIVA 3SZTA 1MBHA 1J5YA 3A0HC 3I59A 2XPVA 3QYBA 2DA1A 4XSXF 2LBFB 2C6YA 1OCRH 2DFHA 3PO2J 2M7AA 3OR1C 3OS2A 2DMQA 2IS2A 4EQQA 3CUOA 2YSRA 1R1TA 2LSOA 5FKOA 1RESA 3VDXA 3K7AJ 4BXUA 2TDXA 1UMQA 2CV0A 1VQ4I 4P9FA 1V4RA 1QPMA 2PMZN 4YEJA 3LMMA 3PQJA 5FLXK 1I6XA 2VPRA 2F5EA 3GBGA 2IPQX 2HTJA 4CCLA 4HQMA 5CVJA 1RUOA 3LWFA 3CD6I 5ED4A 3R61A 1N77A 1GVJA 3VYTB 4CICA 2VASA 4IXAA 2Z1DA 1KONA 3BR5A 3KP4A 1IN6A 1B4AA 2O5RA 1YHQI 2AQFA 2FUG2 2P8TA 4B47A 4F52A 2FBIA 4CUGA 3CCMI 2CO5A 1ENHA 1WWXA 2VBXA 4BYYA 1AKHA 1PJRA 3ZQ7A 1O4XA 4I01A 3S1MJ 4LLLA 3AFHA 5EGOB 1T38A 1UG0A 1BR2A 2NS7A 1Z21A 2DOFA 1I3QJ 3BZ6A 2XAGA 1KGSA 3OYCA 2B7EA 2CQQA 1G6NA 2XGEA 4YIIA 3CCQI 4A93J 4LMYA 3U1KA 3OYLA 1PUFB 2EIJH 2GIVA 1ZELA 1HF0A 3GTMJ 3JRCA 2VKDA 2CQXA 4BJ6C 2GA2A 1UHSA 4DZPA 5HLGA 1XN7A 3WGHA 1W4MA 2XKOA 5TISC 3CLQA 1N78A 3K0LA 3R0AA 2YX4A 2NVXJ 4GO1A 1D5YA 1FOYA 1ON1A 3HUGB 3MKZA 1OISA 2R7ZJ 2UXNA 4F91B 2MSYA 2IGMA 3ZQGA 3WTWC 1TC3C 4YIRX 2ZJRF 3S8PA 1USSA 3E5UA 2PJRA 2QF7A 2UZKA 2P81A 3L2RA 1Z0XA 3Q3SA 4C30A 5E8IA 2XDVA 2BY0A 2VKVA 1X4OA 1WH5A 4UB6C 3U9GA 2EV0A 2CQKA 2M5WA 3BG3A 3SFIA 1T8IA 1JKQC 1T0FA 1SC7A 2TCTA 3BR1A 3BOQA 5TRDA 2FSWA 2ZXWH 1R7JA 1FSHA 1KU7A 3I9V2 3MKWB 4CHUA 2D2WA 5F6FA 3UNGC 1E3OC 3DF8A 2DODA 3CDIA 3F72A 4QSHA 1IAWA 3B6AA 2FE3A 2XB0X 5E3OA 4RB3C 2WBMA 4D1QA 1U5TC 3V8KA 2KFDA 3W2VA 4QLCU 1HLVA 1ZRFA 1IUFA 5JLWA 3HYIA 5JR3A 1JKPC 1S7AA 2ZMEB 2XGCA 4OU0A 1SFKA 5KNLA 4OMZA 1VQ7I 2LD5A 2XIGA 5IOYA 3GTPJ 3J7AO 1IDZA 1QRYA 4PZJA 4JX4A 5D4SA 3QOPA 3PSFA 4CYDA 1G59A 2V1NA 4HG2A 3GF2A 5E79C 4NHJA 2KISA 3FK7A 5HLHA 2EH3A 3TOBA 1FJLA 3JRHA 3IRRA 1OFCX 2OTLI 1OKRA 2FMLA 2DJNA 4R79A 1ZG5A 2HOSA 3D5SC 2Y9YA 1XSXA 3LFKA 2JPCA 4EVIA 3NWSA 3VSLA 3ZQQA 4IEJA 3AG4H 1OMIA 1HOMA 2DMPA 2L7ZA 4PFOA 3FZVA 3OYIA 1YYVA 2OZ6A 2V9VA 3F8NA 2XAUA 1MSEC 2FD5A 1QGPA 2EFNA 5K1YA 1LDJA 1IG7A 5FFZA 1FOKA 2PLYA 3DTIA 4UUSA 4N4OB 3J7YJ 4XRFA 4O3MA 2W1OA 1KYWA 3GX4X 4RLQA 3C3WA 2DCEA 1LDDA 2MH2A 1O7LA 2BY2A 1ZQ3P 1MIJA 5EEHA 2YU9J 2BE5F 5HDGA 4W1UA 4GYIA 1I3AA 5H6QA 3VEPA 1RRJA 1BOBA 3ZRGA 3TKYA 3S32A 5DCMB 1T2KA 5DCFA 5HNHA 3CUQC 4AVPA 2VE8A 1U0JA 2Q2EB 1PP8F 2CH0A 3OYNA 1T33A 3IH3A 1NK2P 2E1CA 3GO5A 2M87A 4D5CA 2VOPA 2JA8J 3CF2A 1SD6A 1WGXA 3IH4A 4JOMA 2O8KA 4G6DA 1TWGJ 4U88A 2NOJB 3WE2A 3ZMTA 4LG0A 5GADJ 4ANJA 3B73A 1J59A 2P7CB 3DTEA 1MH4A 1MDMB 2DLLA 2H1KA 3SYTA 1TWFJ 1TNTA 3S93A 3A01B 4M73A 1BI1A 3EUAA 4A0ZA 5BPDA 3BQYA 3M9AA 2MYSA 3K1PA 2XF6A 3NRVA 4WXDA 2LR8A 2O9LA 4R8HA 1V3FA 1J75A 1LEAA 3FXQA 2D1VA 3T5XA 5D5WB 1IJWC 5HVQC 1GXPA 3MD2A 4PSWA 1CF7A 1XDSA 1MMNA 2L9SA 2IGOA 2LKSA 4A3IJ 2MD0A 2K02A 2VBWA 3DLLF 4M3EA 1B72B 1JJ6C 1X1CA 1WJAA 4I0BA 4CYCB 4BQOA 1D8JA 1UB9A 1HC8A 3ABKH 1NH3A 2X48A 4A3FJ 3KLNA 2JA2A 3HIFA 3PUBA 3HTSB 1ETXA 3V8JA 2FNPA 3S17J 3RPQA 4EMSA 1VTNC 2ZKZA 3TQNA 1IGNA 4Y52J 2R7UA 3VFZA 1XMXA 4I6ZA 1KQ9A 3CESA 1WSUA 4B1RA 5B66C 4BGDA 2QBYB 2O0YA 3S2DJ 4KITB 2GLOA 3S1NJ 1MMAA 1MD0A 3TW6A 2DJIA 3LSTA 3FMRA 2H6CA 1I1SA 1KZHA 3JRFA 3F6OA 3E0JB 4BJ5C 2HQAA 5K5RA 4ZC3A 2LYCA 4G9YA 5CPRB 2IGKA 4IO9F 2M34A 1H0MA 1B1BA 1NK3P 4UNOA 2KT0A 5IPAA 3J81K 1Z7UA 2W57A 2V79A 3M8JA 1AWCA 1HSTA 2LOOA 3LSJA 4EJUA 1TWHJ 1BC7C 3Q0WA 3HRMA 2MD5A 1L3LA 3BLYA 2ZJ2A 3FXOA 2DQRA 3TO9A 2G9WA 4XQFA 4A3CJ 3NAUA 1ONVA 1PVEA 1TBXA 4BAYA 3GXOA 1X1AA 3JTHA 4PSXA 2OC6A 4WXHA 5EG0A 3OYBA 2OA4A 3BT9A 4L9NA 1D1AA 3K1NA 2F5FA 5IP7J 2NOGA 3O2PE 2EFPA 1D3YA 3WHCA 4ESJA 1V5FA 1AOYA 1UFMA 2NVTJ 1LVKA 1QZZA 2HGCA 2QUFA 1VQNI 1BOAA 1I27A 4AWXB 2DA2A 3KP3A 2CS3A 4X1EA 2LNBA 2K3FA 4ENKA 3GW2A 1QPIA 3HSFA 5FKNA 2Y2ZA 5IP6A 1LKXA 2E7XA 3KZZA 5CQGA 3G1MA 2R5YA 3SHFA 1S7OA 5KCMA 3OS1A 4RB1A 4LG3A 5FLMJ 4HNUA 2OAZA 3A0BC 1A31A 4F93B 1QZEA 2D5VA 2ADUA 2FU4A 1FYKA 4E7HA 4XKCA 1R23A 2X1CA 3DBRB 2ID6A 2ZJPF 2DA7A 4FISA 3CCRI 1KQ0A 3H1CA 1O3TA 2CSOA 1D5VA 4HNTA 2QLZA 3S2HJ 1U5TB 4A3GJ 1W7PB 3BDDA 3DKYA 3ZN0A 5E3NA 4FQGA 4HF1A 3KEOA 1JHHA 1IN4A 5FLXZ 5E20A 4MTEA 4OIOF 1XGOA 4XL9A 2QSHX 1W36D 2DA3A 1E3PA 3HGGA 3QQAA 4N9HA 1WKMA 4BEHB 2YX7A 4IRIA 3FXUA 1RR7A 2BGCA 2DDBA 2STTA 2M8GX 1VQMI 1Z7LA 2XROA 3PL8A 1TZLA 1V55H 2JPBA 1XG1A 5AONA 1VNDA 4ZYAA 4L18B 1S72I 2CWEA 2JSPA 5J1UA 2X4HA 2HYGD 2OQGA 1FMWA 1F4KA 1MJAA 4L5EA 2M45A 4RLFA 3I64A 2L5QA 2LBFA 1RPWA 2WAEA 2R7DA 3K4JA 3ZQIA 4IZZA 2Y0MA 1Y6IA 2ESNA 1F5TA 2CW8A 1MBKA 5BPIA 1WCMJ 3HRTA 1MKMA 1X3UA 1S5LC 2JN6A 5AIQA 1QHGA 2A69F 2K27A 2QA4I 1Y56A 3FM5A 2PQ8A 1XC5A 1YE9A 2QQ9A 2B63J 2O3FA 4MFDA 2YUSA 3WTUC 3HC7A 4HW0A 4M3GA 2X6YA 4D7NA 3HKZA 4EEFG 2JRMA 1BR4A 1S29A 5GPCA 2ID3A 3P9CA 2JJ7A 4EJWA 1WVRA 4KT5C 1SAUA 2IGNA 2VQLA 2ACJA 4D5FA 4HV6A 3CUQB 4KIGA 4A3KJ 2JA7J 2VBYA 1RZ4A 1WJCA 5ICCA 1W1WE 3LAJA 2EJRA 1MW7A 3GZ5A 4XLCA 3OYFA 2HPMA 2HS5A 2QVOA 2EFOA 2L2OA 3A2KA 1VQ5I 1IRGA 2XHKA 4KDPA 4P55A 4DGWB 4RBOA 2P0WA 2UXXA 3FXLA 3OYDA 2KDZA 5B1AH 1O57A 4CZZA 4XMYA 1SVLA 2UUZA 3P9IA 3ZN1A 2QEXI 3U2RA 2RAEA 4H4KC 1DUXC 2VKHA 3BR3A 3BTIA 3GLXA 5J8FA 1PUFA 2W25A 4ESBA 2K3PA 3V8LA 2HZTA 3IH2A 5IYBJ 2KRCA 1O3RA 3ZMZA 2JT1A 4IPAA 4E6KG 4E7IA 2PMUA 2VL8A 2ME6A 1MGTA 4ZTJA 3MKYB 2R93J 3QYFA 1FMVA 4MGRA 1BJZA 3RQIA 3GYHX 3ZQLA 3WTYC 1R71A 4KMFA 2P7VB 3KE2A 4PJLA 4ON0A 4EGYA 2JSCA 3SQNA 3BZCA 4FX0A 5FGMA 2HDWA 3WTSC 5DS9A 1ZK8A 5KVRA 1JUPA 3BC8A 3S1RJ 1HXDA 3ABLH 3J80K 1RR8C 2OBPA 3BR0A 4A3JJ 1SANA 4B43A 1FBQA 4LK0F 2Y48A 2M1BA 4RAGA 3ZMDA 4BY1J 4LJZF 1RKTA 4XN3A 2LKXA 1ZR4A 2ELJA 5EF6A 3FXMA 3LQRA 5E3MA 5EZGA 4HX4A 4ZYGA 3DKWA 2VPLA 2NVYJ 4C2MJ 3BJ6A 1HW2A 3LQQA 3EETA 1IRZA 4XRSG 3G3ZA 2XGDA 1R9TJ 1RI7A 2WADA 3WU1B 1IN7A 4AIKA 1AU7A 2EBIA 4BXXJ 2ZMEA 2GBYA 1S7EA 3CTAA 5M3FJ 4IHSA 2HOTA 3DXJF 1WJEA 3CC7I 4II2A 2NXNB 3SEQA 3HZJA 4P9UA 3QP6A 3EUHC 2IJLA 3IWZA 1ETOA 1VQ8I 3CJNA 3BWGA 3T8TA 3ABMH 2Z2SB 1FP1D 3CCUI 3TW7A 4BL0B 2R7TA 2KKOA 1GDTA 4G7ZF 2MGQA 4QTRA 4FHTA 5ICFA 2M4GA 4AIHA 3FKIJ 1J2XA 3HOUJ 2E2JJ 4G8XA 3BG5A 1YTYA 3QYEA 1JJ8C 4IHXA 2GOMA 3GFJA 5C4JJ 1X2NA 3AG3H 4Q47A 3T1BA 2GAUA 5M5WJ 3VB2A 1QZYA 4ZYEA 2WTEA 3L2UA 3DTKA 2IW5A 1D8KA 4EM2A 4DQ2A 2XF7A 2RKHA 1W5TA 4CZCA 1DP7P 2L7FP 2AHQA 1ZN2A 3TBIA 4D9JA 2L0KA 3CLOA 3HB9A 5LHIA 4L5JA 4FX4A 2DDAA 2VQGA 1RUNA 1N75A 3JREA 2L01A 3GZ6A 3MWMA 5CVRA 2A07F 2E36A 1SFOJ 3F9KA 2GXGA 1FC3A 3RSNA 3KZYA 4H0EA 3E6MA 2HYJA 5AIPA 3H0DA 2LF8A 4ASNA 2AQEA 4BY7J 2HI3A 3CCJI 1D1BA 1GXQA 2OZUA 3I4MJ 5DCMA 4HZFA 2Q8KA 4DBQA 3S3OA 3PNYA 2UV1A 5DUKA 2BXZA 3R6SA 3OYKA 3P7NA 3K6GA 4PFPA 3FXJA 3V7SA 1ZG1A 1Z1DA 4F92B 1E2XA 1UJ8A 1RIOH 2WB1A 3C7JA 4RGXA 1ULYA 2IBDA 3F8CA 3L2WA 3HHGA 2EFWA 4IKFA 2FX0A 1MDMA 2O7OA 4XBFA 6PAXA 3R60A 1Y0UA 1O3SA 4BHBA 2E5NA 3M3YJ 4B3AA 1JHFA 4UXNA 1ETWA 3OYAA 5J1YA 2DA6A 2EZKA 1ZR2A 4L9VA 4FE4A 3ZPLA 2HQNA 3ZMSA 5DDGA 2O6GE 3KX2A 3RPUA 4AIJA 1REPC 2K86A 3HL2A 2DMUA 2ZFUA 2FMYA 3GFMA 4E7LA 5GPAA 4FETA 2K7LA 2QQ8A 3WE3A 2FOKA 4MQVA 1JI8A 4NB5A 3PO3J 4BE2A 2FJ1A 2MC4A 3N97A 4BNCA 4IX7A 3RI4A 3LL7A 4Q5SF 3H0GJ 4V2GA 1B72A 4BQAA 5LGNA 2KIFA 3GTOJ 1WPKA 5KK1A 3IAM2 4XLHA 4WCGA 1SD5A 3EYYA 4BBSJ 2CW7A 4NQWB 3WG9A 4CYCA 5E3LA 3V4GA 1TWAJ 4V19K 3OYHA 4U0YA 1F36A 1XGNA 3GZNB 4PCQA 2VE9A 1G2HA 3L00A 3S16J 1T56A 1A6QA 3HTUA 1DDNA 4IHWA 3ONQA 4XLPF 2XAQA 2RREA 2PFBA 2R7RA 1OLTA 4F55A 5IY5H 2ESHA 1IRXA 4EV0A 4DJAA 3H5RA 2CW0F 3I56I 4LLNA 2JVHA 4U0WA 2QBYA 4GGGA 5J8CA 2XVCA 1O3QA 5DYMA 3IAS2 4LITA 4AD9A 4BE1A 2KRHA 3OL3A 2XRLA 2QYOA 2IS6A 1OYYA 1TLHB 3I5UA 1X1PA 1YW8A 1HKQA 3ELKA 5EZHA 3ROUA 4LFUA 4MHGA 3FXRA 1OYWA 4NDLA 3BG7A 4IRHA 2E7WA 4P96A 1XTAA 1MSFC 2EQRA 3HOTA 1DPRA 2ME0A 4DBRA 2H27A 2DMNA 1T6SA 1E0EA 3IUOA 2HZDA 2KPMA 2ZXHA 3PIPF 2BW3B 4IJAA 1SAXA 4JX6A 1USTA 2R4GA 1FIPA 1MH3A 1ZGAA 1K78B 5LRSA 1QHHD 2DA4A 2R7XA 1HBXG 2AXLA 3DU6A 2OF7A 2R7QA 4X6AJ 2AO9A 4OWRB 3HKZN 1K6YA 3M1EA 5HS9A 5H6RA 2XV4S 1OCCH 2BYVE 1GLNA 4RGRA 5IOZA 4DYCA 2HYFA 3OIPA 5CLSA 3M4OJ 3PUFA 5K5OA 1VQKI 4I0AA 1VQOI 2VONA 5LGTA 3WU0A 5EEGA 3HRSA 2JQ7A 5E18F 1HDDC 1WQ2A 4HLXA 4Y33A 2MABA 3FMQA 3VODA 3BROA 3I4PA 3Q9VA 2VC1A 2Y0SA 3BTLA 4AVZA 1B9NA 1FZPB 2XPWA 5A2QK 1DP3A 1ETKA 2COMA 2O8XA 4MFEA 4TV7A 4ZDLA 4EATA 2QCOA 2V6CA 1W5SA 1MBJA 2K5CA 1RETA 2OU2A 2VI6A 4BU2A 1ZGJA 4JP0A 4BKXA 3KYLA 3CMMA 2F5VA 5F1JA 5EDNA 3QPHA 2RNGA 2W85A 4XSZF 4BDYA 2EZLA 2A3SA 3H9QA 5M3MJ 4M3BA 3V42A 3CDLA 4MLOA 5DD8A 3G71I 2OJED 4AYBA 2ZJQF 2E19A 3C18A 4JBAA 1B59A 1X3ZB 4U7BA 2NAZA 4KFCA 1IXRC 1MJ9A 4E7KA 2IRFG 1TP4A 3WHBA 4BH9A 2RQPA 1W5CC 3CQZJ 2ZNZA 4DW6A 1JTYA 1U5TA 4OAZA 1W7PA 2Z16A 3K69A 5B5EC 3OSGA 1NHAA 2K40A 2CUEA 1Y8QB 3BG9A 1GT0C 4WXCA 2Q1ZB 5L3GA 1I50J 2LREA 2EV6A 2FXAA 2P4WA 2QSGX 1WJDA 1X3WB 4C3JJ 1TL8A 4L5IA 4BEHA 3PJRA 1IN8A 3S3NA 3ULQB 3I54A 4Y3OA 2CV2A 4UV9A 4CGZA 3CP8A 1ODDA 1K83J 2FEZA 1A35A 5JVGF 3DEUA 2R7SA 2WC2A 2DTZA 1B9MA 2ETHA 3A1YA 3M7GA 4C3IJ 1GVDA 3DLAA 1IF1A 3BG6A 2XF5A 4V2FA 4E7JA 1YOVB 1V54H 4DYRA 5JFRA 2KJCA 4CXFA 1LNWA 5CVVA 2PMHA 3LA3A 4B4CA 3JSOA 2G0EA 3DWLE 1OCPA 2LTPA 3VYUB 2K9LA 1FSEA 3FKJA 2KJBA 1AHDP 3W6KB 1UG2A 2QM3A 2KQRA 4A5MA 5D5VB 1Z05A 2LLKA 4QPOA 2CRGA 2JUCA 4MEYF 4RM2A 3VSKA 1NG7A 5FKMA 4J01A 3L1PA 3DP7A 5HDKA 2OD5A 3GTQJ 2WA0A 1A5JA 4D0PA 2VKEA 3F8FA 3GEZA 1R5ID 1Y1VJ 4PGHA 5D6EA 5L3BA 2LY9A 3CUQA 2K9MA 2DU9A 3BTJA 5KHDA 4DYQA 2HDCA 2ZXIA 3ABTA 3WTZA 3J80Z 3G4SI 3RKQA 1U2WA 2XB5A 3L2QA 1X58A 2OCEA 3LSIA 4I02A 1WZ2A 5DM7F 3HOXJ 1G3YA 1WRJA 4ZZDA 1GUUA 5H20A 1KYZA 2FRHA 3ML6A 1DPUA 1XSVA 3L7WA 1U78A 1U9NA 2EFQA 4CSWA 1LDKB 2PEXA 4NC8A 5HS8A 2VJ5A 3CJQB 2KLOA 2PN6A 3KETA 1J7KA 2DT6A 2V9KA 2DOEA 3TDUC 3NARA 2EB7A 2V4JC 3KP6A 2V1XA 3FM3A 2W24A 3OYJA 1Z77A 4XLEA 2ZBKA 4EJOA 3JCUC 3IRQA 2E2IJ 4XKWA 5LHHA 3U1DA 2H09A 3JRAA 2QQBA 1W36C 2PJRB 4GFBA 2Y69H 2M3AA 2WV1A 4HNVA 2XAJA 1ITYA 3KZIC 4AIDA 1FOXA 1ZTRA 4KYWA 1G3WA 1G8XA 5LHGA 3NQOA 1TQPA 3O8HA 2MW8A 2HNHA 4ZYDA 1I6HJ 2OTJI 1A6IA 3I3LA 3CZ6A 2CU7A 1ZH5A 2M0CA 4QPQA 2QKLB 2VOOA 2RDPA 2VQHA 3QRFF 2HQ5A 3QU6A 2NS0A 1XCBA 1HSJA 1DGRM 3CCLI 1PUEE 2VB6A 1T08B 1KU3A 3BCAA 4HV5A 5K5QA 3G6EI 4RM3A 3D0SA 4HA8A 4LOCA 4Y15A 2GZWA 1BBYA 2DT5A 3ERMA 3K9TA 4O5VA 5LFAA 5JI6A 2XSJC 2Q0OA 3GUDA 2B9SA 3S1QJ 3C2GA 1HW1A 2CUFA 2ELKA 2OV7A 1HA8A 4L0YB 2X6OA 2JTVA 1KQ8A 2FQ3A 2W00A 1XGMA 3TDZC 4F3QA 1KA8A 2VQCA 4RAZA 4WK8F 3PFIA 3MN2A 2DXIA 2RGVA 5F64A 3ERED 4HBLA 2M7BA 3IC7A 2BOLA 2KZGA 4P5OA 1LFBA 2QQAA 2FNAA 3GTLJ 4P1WA 2GOXB 3JRIA 4DNCA 3D5RC 3SDGA 2IT0A 4Y7NJ 5M5YJ 1ETYA 4KA4A 5BNGA 2X1EA 4KNYA 1GV2A 3ZQHA 1E17A 3QOEA 3N4MA 4B44A 5CYVA 1WJ5A 4Z6YA 1A36A 3RDIA 3FXKA 4IHYA 2R5ZB 2Z5UA 2WV0A 3AKZA 3LAPA 2VJIA 3PSIA 4G12A 2RVCA 4MQ9F 4OIPF 3MQ0A 2HWVA 1UHWA 2X0LA 1XB4A 4ESFA 4XN0A 4PK4A 2HR3A 2GM4A 3JRGA 1UCRA 1Z3YA 1PP7U 2R0QC 2RQQA 4HSRA 3CCSI 2IVMA 1WFXA 1QO0D 3E6DA 5F0CA 1EF4A 5ILSA 1S9HA 5CJ9A 5D6FA 2CUJA 4XR6A 4HRIA 3SDBA 3HHHA 5J40A 2LKPA 1DGWY 4ZJZA 3DBLB 3OL4A 3DV8A 3OOPA 3F8BA 2PJPA 2E35A 2PX9A 1SFEA 4ITVA 1DQUA 1P4XA 5C44J 5F0HA 4C2UA 4G7OF 3RTRA 4YELA 5F04A 4B8XA 4UV8A 2R7FA 3OR2C 2L4AA 2HPIA 5IP9J 4XOTA 4U87A 5IYDJ 1D0ZA 3H5NA 3IP4B 1IW7F 1YRNB 4PJJA 4A6DA 3TMOA 1J09A 1IDYA 4A3MJ 3G2BA 3DU5A 1IXCA 5F1RA 3OY9A 1O7FA 2V26A 2BHYA 2W48A 2Y9ZA 4G6TB 1M1EB 2CFOA 5KAIC 4Y13A 2FOWA 2DOAA 1U6GA 5ICEA 3AL0C 4HF0A 4CCJA 2IAIA 2DFIA 5L3CA 3W6VA 2K85A 5CKTA 1ORKA 1X1BA 5F0FA 2ISZA 3S2WA 2Y0SN 2DN0A 4XM3A 4OIRF 3B6CA 5J47A 2W7NA 1CGPA 2ZCWA 9ANTA 2JWTA 2DA5A 2QKMB 3VYRB 5H2FC 3ASNH 2CQNA 2PG4A 2CYYA 2ISYA 1WH7A 4YRVA 1ZRCA 4HDVA 4LIUA 4D7MA 2D45A 2DAOA 1YIJI 4KJZA 1H88C 5EGOA 2IA0A 1IO2A 3DKXA 3MAJA 3F6VA 3CMEI 2HXOA 3V7RA 2HKOA 2XAHA 5E1ZB 3M07A 5HODA 4WWCA 3ECOA 3HOWJ 2L7KA 1K4SA 2FF4A 3ZQCA 4OMYA 2P6TA 4NQWA 4RGUA 3RCOA 1FY7A 3F0CA 2MA3A 2WWYA 1ACIA 4XRMA 1LUJB 5BQTA 1TT5B 2O03A 2VN2A 2ZMEC 1QU3A 2ZNYA 3LSGA 5HNFA 1FEXA 3H9GA 4XIDA 4PUSA 1OR7A 4MTDA 3WTVC 1Y0NA 2DK5A 3LSHA 3TO6A 1ZKGA 4I98B 1POGA 1A04A 2MBFA 3W3CA 4LGWA 1X1DA 5E8GA 3HUGA 4WX9A 1S8NA 2EIKH 5CVUA 4QWQA 2ZFWA 1ZGWA 1XCVA 5DEQA 2H94A 2EILH 4S0HB 4I2OA 2L9RA 4M72A 1DU0A 1FYLA 3DCFA 1OPCA 2DK8A 3K4LA 3CP2A 1HKSA 3K4MA 5KAFC 1OCZH 3FISA 2HKXA 5JHFA 3GWZA 1UHMA 3KFWX 5A2QZ 2L9NA 3QAHA 2E2HJ 5J6XA 5FFXA 4HLYA 3P5JA 2FQ4A 2LF7A 3A03A 4HDUA 4A12A 3MFKA 3F3XA 2BW3A 2UWMA 3FWEA 4RGSA 1TWCJ 2EZHA 3HGYA 3PNVA 4ZYHA 4M3FA 3WU2C 3DPLC 2RN7A 4XLFA 5B3SH 1K78A 3B02A 3E6CC 2WY7Q 1JXSA 2LVSA 3OMYA 1W0TA 1LVAA 2A61A 3L2CA 1I39A 4NC7A 3SEZA 3LNQA 3JW4A 4JX5A 1JGGA 1OCTC 1XD7A 2XASA 4ZDPA 4RS8A 4QIWN 2RC4A 1BN5A 2VUMJ 3HBLA 5K7HA 3HOSA 2P5VA 1BA5A 2LK2A 3KIOA 3S3MA 3K4CA 1R4MB 3IL2A 4MEXF 2HDDA 3O3KA 1HDPA 2GA1A 3SZPA 3CO6C 3PFYA 3RYRA 1ERDA 1QNTA 1RC9A 1MNDA 2GQQA 3FX3A 2P5KA 2QGUA 3K1MA 4DIQA 3KCCA 3A02A 4OINF 3OOUA 1K61A 2H8RA 3MVPA 2DYSH 4RAYA 2VT3A 4PGGA 1JUSA 3DEEA 1P9QC 1IV6A 3JR9A 3G73A 3OYGA 2LY2A 3LFUA 3CC2I 3IKTA 4S04A 2Y75A 4KIFA 4NBQA 1OJLA 3JAMK 2G7HA 1LE8B 1APLC 2VIXA 1XPXA 4C9YA 2V1DA 1BIAA 4BHPA 4A3DJ 5FRMA 2X51A 4EJTA 2Q2EA 3ZQFA 3HEFA 4HX8A 4X0GA 2HU9A 3NEUA 2X1DA 3S15J 4LD5A 2L54A 1HW5A 3PIOF 4A3EJ 1DU6A 2I10A 2HEOA 4YG2F 3P9KA 2O61A 3LSKA 2GXBA 3ZMVA 4UVAA 3EUHA 5HLIA 2FBHA 5DUIA 3K70D 5E17F 2BVLA 4XLAA 4BQQA 3A01A 1BIBA 3MEXA 2HTSA 3MZ8A 5TGTA 3SXYA 3MKLA 4M74A 3MZYA 3LSRA 1K6OA 3JRDA 3M8FA 2NS8A 4AM3A 1ZRDA 4BS9A 4FT8A 3FHZA 2AS5F 1BW5A 4PJMA 4CCOA 2XGXA 1T0FC 3EYIA 3RZDJ 1CQTA 2CV1A 5GP9A 1YIOA 5FROA 5LGUA 2W84A 5TJJA 2OUMA 5E1XA 2IP2A 1TTYA 1VI0A 1WI3A 4PDKA 2ZO4A 5D8LB 5LRRA 2EINH 3ZXSA 4BDZA 3LA2A 3M1CA 4BQNA 3J81Z 3CMAI 2I8DA 1YX3A 3QP5A 2WAFA 3BPXA 2LG4A 3V7CA 2IXSA 3H92A 4BUPA 1TW2A 4S05A 3HSRA 5BMZA 5FO5A 1MJBA 1LFUP 3BZKA 4EM0B 1KU9A 2X85A 3OV8A 3IKVA 3DPTA 3RPUD 4BACA 5EYRA 5IT9K 1K79A 4AC0A 2JZYA 3CMYA 2LH9A 1EV7A 2LRDA 2OCCH 1YJ9I 3REOA 4GXOA 3CO7C 1H8AC 5FKLA 1H9TA 2F6CA 3Q0UA 2KIMA 2EPFA 4M9XA 5HDNA 2B0LA 4M6XA 1XGSA 1S6LA 1Z3XA 3AL0B 2L02A 2G7UA 2Z9OA 1B8IB 3BJAA 4HPQA 3R0JA 3WTTC 1VQLI 2P5LC 5JVTA 2V1UA 1QQIA 1SD7A 5J3LA 1KU2A 3WODF 2KDOA 1SVMA 2NNNA 2VT2A 1L0OC 1SFUA 2BY1A 2XKPA 4KT6A 4I09A 4I99C 5F08A 2PI0A 1IN5A 2JUGA 4Y4RA 1VQ6I 3EDPA 5C4XJ 2K9NA 3L2VA 3RKXA 2Z3YA 2F4MB 1Y8RB 3KPHA 3X2QH 1Z67A 1WJFA 1BI0A 2K9SA 5J1RA 2A05A 1SMYF 2Y31A 3JSPA 1XS9A 1TNSA 2CFXA 3E7LA 4UHTA 4A3LJ 1J9IA 2VJ4A 4GYGA 3HJEA 1VF9A 2KP6A 3O6BB 2HFHA 3GFLA 3GCMA 1E3HA 2A68F 2ZC2A 4W97A 3RIRA 5GTIC 1JTXA 2WAQA 1LJ9A 5JLXA 2CJJA 5GAGJ 4XONA 4FE7A 4FCYA 2K4JA 4BXFA 2KIUA 4XKBA 1BR1A 2VBZA 4MO7A 1EH6A 1X19A 3VPRA 4AU7A 1HKTA 2FA5A 2DPUA 4UUVA 3F22A 3KP2A 1XX5A 5FKKA 2V9PA 4KMUX 3OYEA 1R22A 1S3JA 4DOZA 1HQCA 3FF5A 3OS0A 4C2TA 1MBEA 2XAFA 1R4NB 2IA1A 4LLGF 2GXAA 1FT9A 4BE0A 5FB2A 3TP0A 1V5GA 5DM6F 2A6EF 3KP7A 4E7ZA 3RJPA 1H89C 5DD4A 4ENMA 1JT6A 4BBRJ 2BBYA 4UB8C 1YJNI 1PDNC 4YFKF 2E34A 4HAMA 2L7MP 4CH7A 5ILUA 2XPUA 3DBHB 2IA2A 5BS6A 4U0VA 3TP3A 2F5DA 3GMEA 1P4WA 1RNLA 1X4PA 2IS4A 2HXIA 2R5ZA 2J5OA 1ZLJA 1IRFA 3LSPA 4RAFA 3QPSA 1Y1WJ 1AA7A 3K2AA 3QODA 2DPDA 4PJ0C 3I59B 1IV8A 2Z33A 2DO7A 4E70A 2WY8Q 2X6WA 3LSMA 1WJBA 1BM9A 1JUMA 3D1NI 2JVGA 1JGSA 3JRBA 2DI3A 2H8WA 4IVNA 4XORA 1EH8A 4UUTA 1ZG3A 3OYMA 4R1HA 2QENA 5IT3A 3J7AY 1FBUA 1YJWI 2HQRA 4XNFA 5HOOA 4UY8I 2E1MC 2OPTA 2MLKA 2X6XA 3ISPA 1R6RA 2ECBA 1R5GA 1W7PD 2JK3A 3QWLA 1YX5A 4Q48A 3F21A 2VJJA 3UKGA 4AUXA 3H5AA 1JKOC 1IXSB 4N4NB 3KLOA 2KL4A 2DW4A 3DQVC 1NG6A 2M30A 1P6RA 4UVBA 1I5ZA 5LBQA 4YIFA 5D5XB 3ZOBA 5F27A 4PJNA 1YRNA 3RQ4A 2K4BA 1RKWA 1Q1VA 5JHUA 5K7FA 3EQLF 4HOBA 5CVIA 4LB5A 3HPHA 5L3DA 1FLIA 3AG1H 2NRAC 1TQIA 2KHMA 1G3SA 3CJTB 1AKHB 4B3XA 3KEYA 4KICA 4JQFA 1QVUA 3QPTA 3Q0VA 2X9DA 1ZAOA 3MCZA 3C1DA 2VXDA 4IOAF 3WTXC 3CCVI 3PNTA 1YI2I 1LPQA 4EGZA 1XMKA 4HF2A 3E1SA 1U8BA 4KIBA 2VC0A 1EH7A 3K4NA 1WHUA 3O8GA 1R1VA 1BI3A 3F8MA 2E1OA 3IHUA 2HVSA 3BY6A 4RB0A 2HVQA 4E4HA 1FYMA 3OWTA 1YO5C 2CQ7A 3GLLA 4A69C 3J7ZI 3GTKJ 3WGIA 1B6AA 1EKEA 1SFXA 4K2EA 3E5XA 3I55I 4F7ZA 3H36A 1R58A 3W2AA 2E5ZA 4HSTA 2DFFA 1JE8A 1F43A 1MNMC 4FTHA 1D1CA 2BHZA 2GWRA 4IL6C 4O6JA 4M6VA 2LC2A 2EA2A 3BPVA 1Y39A 4YFXF 1SMTA 3E5QA 3HM5A 1F1ZA 3E6BA 1VZ0A 1BW6A 5K7ZA 2KRFA 4KN7X 3GFIA 2Y30A 2WB1N 3OIQA 3RKYA 1U9OA 1N25A 1ETQA 4MNUA 2ZXJA 3K2ZA 2R7WA 3W2WA 2HOAA 2MFZA 3FK6A 4G94A 2E1NA 1BI2A 1X2MA 4LK1F 4XLNF 4HYEA 2M4KA 4KN4X 4A5NA 4N9IA 4U7DA 1D0XA 2L3DA 2ICWG 4ZH4F 1XDUA 2JA5J 2HOEA 1WI9A 2VODA 1D0YA 4NUBA 1FP2A 2IS1A 1UZCA 3FMSA 2F2EA 3DPUA 2ECCA 2CG4A 1MMDA 4NNJA 4A2UA 3BJOA 1ETVA 3H3UA 2A5WA 2YS9A 3H3VK 1ZREA 4WF2A 1T95A 2JRTA 2DT7B 3U21A 1ZLKA 2NYXA
chains in the Genus database with same CATH topology
1P2FA 3TO7A 4EJVA 2F5CA 5L3FA 4Z2YA 1P92A 3Q9SA 4HX7A 1ZYRF 3TOAA 1YLFA 2EWNA 3JAMZ 5LLQA 3Q5FA 1SD4A 2D1HA 5FD6A 2ELHA 5ERIA 2M8EA 4L0ZB 2J5PA 4ENNA 1R00A 4G7HF 5D4RA 4JK1X 1YS7A 2NNYA 3I0TA 3I53A 4IF4A 3MZHA 4RB2C 3H3ZA 3E97A 2R3SA 1MZBA 3ZP5A 3CDHA 2DTRA 1T39A 4M6YA 2DBBA 4N0BA 5D8KB 1IUYA 4ETSA 4L9TA 4M71A 4LG0B 3JTGA 5E1WA 1OYIA 1LEBA 3AAFA 3D5LA 2MLGA 3I58A 3RKWA 4OOIA 1IZ1A 2STWA 1BJAA 1R1UA 2L4MA 1TQMA 3ECHA 4CDGA 1XMAA 3QU3A 3R4KA 1FX7A 1CF7B 2A6HF 5IT9Z 2DQLA 3M8EA 3PQKA 1P4AA 2Z99A 4A6EA 2CGPA 1QBJA 2QWWA 1FBSA 5LEJA 4KUMA 3SFZA 2EA4A 3WGGA 4OIQF 1Z91A 3DFGA 3I71A 3T0YA 4Q4ZF 1J0RA 1R5HA 3ZMUA 2QZ8A 1GHCA 4Y17A 4IRGA 1K7AA 1FNNA 2H6BA 1TW3A 1C0WA 3GVAA 2RNJA 4A0YA 4GCVA 1FWZA 1STZA 1Q1HA 1FPQA 5DV5A 1YQAA 2YR2A 4ENJA 1LB2A 5ICGA 1U3EM 2OQRA 4B09A 4EM1A 1Z6RA 1ZHFA 4LB6B 5LEKA 1U8RA 2YU3A 2MC3A 3W6JB 2EK5A 3F23A 4A0XA 4BHCA 2LDUA 1Z9CA 1F9NA 5BOXA 1T98A 2VXZA 1XSDA 4UVCA 1YG2A 1ON2A 5FD5A 3L9FA 5D5UB 2BEOA 1LQ1A 2EV5A 1I1GA 1G4DA 4IHTA 2A5YB 3LA7A 4G6QA 3ABUA 2XUBA 2RV8A 3KEQA 3HRUA 3L09A 1YW9A 3COAC 4ZZLA 3T8RA 3VOEA 4HQEA 1R36A 2P6SA 2XRNA 4CO8A 4M9SA 5L3EA 1Z6TA 4L9JA 3RYPA 3TGNA 3HSEA 1G3TA 1ZARA 1H9GA 3KP5A 2BV6A 1YW7A 1BC8C 3E3VA 3BP8A 1YS6A 4M9ZA 3IWFA 4YFNF 2YPRA 2PBIA 2MH9A 5HS7A 1YFHA 5ILVA 2FBKA 3SZTA 4I7HA 1J5YA 3I59A 4XSXF 2C6YA 4EQQA 3CUOA 2YSRA 1R1TA 2LSOA 4BXUA 2TDXA 4P9FA 1V4RA 1QPMA 5FLXK 3PQJA 1I6XA 2F5EA 2IPQX 2HTJA 4HQMA 5CVJA 1RUOA 3LWFA 5ED4A 3R61A 1GVJA 4CICA 4IXAA 3KP4A 1IN6A 1B4AA 2P8TA 2FBIA 2CO5A 4BYYA 1WWXA 2VBXA 3ZQ7A 4I01A 4LLLA 1T38A 3BZ6A 2XAGA 1KGSA 1G6NA 4YIIA 4LMYA 2GIVA 2GA2A 5HLGA 1XN7A 3WGHA 1W4MA 2XKOA 3K0LA 3R0AA 2YX4A 4GO1A 1ON1A 2UXNA 3WTWC 1USSA 3E5UA 2UZKA 5E8IA 3U9GA 2EV0A 2CQKA 2M5WA 1T0FA 3BOQA 5TRDA 2FSWA 1R7JA 1FSHA 1KU7A 4CHUA 2D2WA 5F6FA 3DF8A 3F72A 1IAWA 2FE3A 4RB3C 1U5TC 3V8KA 4QLCU 1ZRFA 3HYIA 5JR3A 1S7AA 2ZMEB 4OU0A 4OMZA 2XIGA 3J7AO 4PZJA 5D4SA 3QOPA 4CYDA 3GF2A 4NHJA 5HLHA 3TOBA 3IRRA 1OKRA 2FMLA 4R79A 1ZG5A 3LFKA 1XSXA 2JPCA 4EVIA 1OMIA 3FZVA 1YYVA 2OZ6A 2V9VA 3F8NA 1QGPA 2EFNA 5K1YA 1LDJA 5FFZA 1FOKA 2PLYA 4XRFA 4O3MA 1KYWA 3GX4X 3C3WA 1LDDA 2MH2A 1O7LA 5EEHA 2BE5F 5HDGA 4GYIA 5H6QA 3VEPA 3TKYA 5DCMB 1T2KA 5DCFA 3CUQC 4AVPA 2VE8A 1PP8F 2E1CA 3GO5A 2M87A 2VOPA 1SD6A 4G6DA 4U88A 3WE2A 3ZMTA 4LG0A 3B73A 1J59A 2P7CB 1MDMB 2DLLA 1TNTA 4M73A 1BI1A 4A0ZA 5BPDA 3M9AA 3K1PA 3NRVA 4WXDA 4R8HA 1V3FA 1J75A 1LEAA 3FXQA 2D1VA 3T5XA 5D5WB 5HVQC 1GXPA 1CF7A 1XDSA 2K02A 2VBWA 4I0BA 1D8JA 1UB9A 3KLNA 3HIFA 3HTSB 3V8JA 2FNPA 3RPQA 4EMSA 1VTNC 2ZKZA 3TQNA 3VFZA 1KQ9A 1WSUA 2QBYB 2O0YA 1MD0A 3LSTA 3FMRA 2H6CA 1I1SA 3F6OA 5K5RA 4G9YA 1H0MA 1B1BA 4UNOA 3J81K 1Z7UA 2W57A 2V79A 1AWCA 1HSTA 4EJUA 1BC7C 3HRMA 2MD5A 1L3LA 2ZJ2A 2DQRA 3TO9A 2G9WA 1ONVA 1TBXA 4BAYA 3GXOA 3JTHA 4WXHA 2OA4A 4L9NA 3K1NA 2F5FA 4ESJA 3O2PE 2EFPA 1D3YA 1AOYA 1UFMA 1QZZA 2HGCA 2QUFA 1BOAA 1I27A 4AWXB 3KP3A 2LNBA 4ENKA 3GW2A 3HSFA 3KZZA 2E7XA 3SHFA 1S7OA 4RB1A 2OAZA 2ADUA 2FU4A 1FYKA 1R23A 1KQ0A 1O3TA 2CSOA 1D5VA 2QLZA 1U5TB 1W7PB 3BDDA 3ZN0A 4HF1A 3KEOA 1JHHA 1IN4A 5FLXZ 5E20A 4MTEA 4OIOF 1XGOA 4N9HA 1WKMA 2YX7A 4IRIA 3FXUA 2BGCA 2STTA 2XROA 2JPBA 5AONA 4L18B 2CWEA 2X4HA 2HYGD 2OQGA 1F4KA 1MJAA 2M45A 3I64A 2R7DA 2Y0MA 2ESNA 1F5TA 5BPIA 3HRTA 1MKMA 1X3UA 5AIQA 2A69F 2K27A 3FM5A 2PQ8A 2QQ9A 2O3FA 3WTUC 4HW0A 1S29A 3P9CA 4EJWA 4KT5C 2ACJA 4HV6A 3CUQB 4KIGA 2VBYA 1RZ4A 5ICCA 3LAJA 2EJRA 3GZ5A 2HS5A 2QVOA 2EFOA 1IRGA 2XHKA 4KDPA 4P55A 2UXXA 1O57A 4CZZA 3P9IA 3ZN1A 3U2RA 1DUXC 3GLXA 5J8FA 2W25A 4ESBA 3V8LA 2HZTA 1O3RA 3ZMZA 2JT1A 4IPAA 2PMUA 1MGTA 4MGRA 3GYHX 3WTYC 4KMFA 2P7VB 3KE2A 4ON0A 4EGYA 2JSCA 3SQNA 4FX0A 5FGMA 3WTSC 5KVRA 1HXDA 3J80K 2OBPA 1FBQA 4LK0F 2Y48A 2M1BA 3ZMDA 4LJZF 3LQRA 4HX4A 4ZYGA 3DKWA 3BJ6A 1HW2A 3LQQA 3EETA 3G3ZA 1RI7A 3WU1B 1IN7A 4AIKA 2ZMEA 3CTAA 4IHSA 3DXJF 4P9UA 3QP6A 2IJLA 3IWZA 3CJNA 3BWGA 3T8TA 1FP1D 2KKOA 4G7ZF 4FHTA 5ICFA 4AIHA 1J2XA 4G8XA 1YTYA 3GFJA 4Q47A 3T1BA 2GAUA 3VB2A 1QZYA 4ZYEA 2WTEA 2IW5A 1D8KA 4EM2A 4DQ2A 2RKHA 1W5TA 1DP7P 1ZN2A 3CLOA 5LHIA 4FX4A 4L5JA 1RUNA 2L01A 3GZ6A 3MWMA 5CVRA 2A07F 2GXGA 1FC3A 3KZYA 4H0EA 3E6MA 5AIPA 2LF8A 4ASNA 1GXQA 2OZUA 5DCMA 4HZFA 2Q8KA 5DUKA 3R6SA 3P7NA 3V7SA 1ZG1A 1Z1DA 1E2XA 1RIOH 3C7JA 4RGXA 1ULYA 3F8CA 3HHGA 2EFWA 1MDMA 4XBFA 6PAXA 3R60A 1Y0UA 1O3SA 4BHBA 1JHFA 4UXNA 4L9VA 3ZPLA 2HQNA 3ZMSA 5DDGA 2O6GE 3RPUA 4AIJA 1REPC 2K86A 2FMYA 3GFMA 2K7LA 3WE3A 2FOKA 4MQVA 4NB5A 3N97A 4BNCA 3RI4A 4Q5SF 4BQAA 5LGNA 2KIFA 5KK1A 4WCGA 1SD5A 3EYYA 3WG9A 3V4GA 4U0YA 1XGNA 4PCQA 2VE9A 3L00A 1DDNA 3HTUA 4XLPF 2XAQA 2PFBA 2ESHA 4EV0A 2CW0F 4LLNA 4U0WA 2QBYA 4GGGA 5J8CA 2XVCA 1O3QA 5DYMA 4AD9A 2QYOA 1OYYA 1TLHB 3I5UA 1YW8A 1HKQA 3ELKA 3ROUA 4LFUA 4MHGA 3FXRA 1OYWA 4IRHA 2E7WA 4P96A 3HOTA 1DPRA 2H27A 1T6SA 4IJAA 1SAXA 1USTA 1ZGAA 1K78B 5LRSA 1HBXG 2AXLA 3M1EA 5HS9A 5H6RA 2XV4S 2BYVE 4RGRA 2HYFA 5CLSA 5K5OA 4I0AA 2VONA 5LGTA 3WU0A 5EEGA 3HRSA 5E18F 1WQ2A 4HLXA 3FMQA 3VODA 3BROA 3I4PA 3Q9VA 2VC1A 1B9NA 1FZPB 5A2QK 2O8XA 2COMA 4TV7A 2V6CA 1W5SA 2OU2A 1ZGJA 3QPHA 2W85A 4XSZF 2A3SA 5DD8A 3C18A 4JBAA 1B59A 4U7BA 2NAZA 4KFCA 1IXRC 1MJ9A 2IRFG 4BH9A 2RQPA 2ZNZA 1U5TA 1W7PA 3K69A 1NHAA 4WXCA 5L3GA 2EV6A 2FXAA 2P4WA 4L5IA 1IN8A 3ULQB 3I54A 4UV9A 4CGZA 1ODDA 2FEZA 3DEUA 2WC2A 1B9MA 2ETHA 3M7GA 1IF1A 5JFRA 2KJCA 4CXFA 1LNWA 5CVVA 2PMHA 3LA3A 3JSOA 1FSEA 2KJBA 3W6KB 2QM3A 4A5MA 5D5VB 1Z05A 4MEYF 3DP7A 5HDKA 2OD5A 4D0PA 3F8FA 3GEZA 4PGHA 5D6EA 5L3BA 3CUQA 2DU9A 2HDCA 3ABTA 3WTZA 3J80Z 1U2WA 4I02A 1G3YA 1WRJA 4ZZDA 5H20A 1KYZA 2FRHA 3ML6A 1DPUA 1XSVA 3L7WA 1U78A 2EFQA 1LDKB 2PEXA 5HS8A 2PN6A 3KETA 1J7KA 3TDUC 2EB7A 3KP6A 2V1XA 3FM3A 2W24A 2ZBKA 4EJOA 3IRQA 5LHHA 3U1DA 2H09A 2QQBA 2XAJA 4KYWA 1G3WA 5LHGA 3NQOA 4ZYDA 1TQPA 1ZH5A 2VOOA 2RDPA 3QRFF 3QU6A 2NS0A 1XCBA 1HSJA 1PUEE 1KU3A 4HV5A 5K5QA 3D0SA 4HA8A 4Y15A 2GZWA 1BBYA 2DT5A 3K9TA 4O5VA 5JI6A 2Q0OA 3GUDA 1HW1A 4L0YB 2JTVA 1KQ8A 2FQ3A 1XGMA 3TDZC 1KA8A 4RAZA 4WK8F 3PFIA 2RGVA 5F64A 3ERED 4HBLA 3IC7A 4P5OA 2QQAA 2FNAA 4DNCA 2IT0A 4KA4A 4KNYA 1E17A 3N4MA 5CYVA 3RDIA 2Z5UA 2WV0A 3LAPA 2RVCA 4MQ9F 4OIPF 3MQ0A 2HWVA 1UHWA 2X0LA 1XB4A 4ESFA 2HR3A 1UCRA 1PP7U 2IVMA 3E6DA 1QO0D 5ILSA 5CJ9A 5D6FA 3HHHA 2LKPA 3DV8A 3OOPA 3F8BA 2PJPA 1SFEA 1P4XA 4G7OF 3RTRA 4B8XA 4UV8A 2R7FA 2L4AA 1IW7F 4A6DA 1IXCA 5F1RA 1O7FA 4Y13A 1U6GA 5ICEA 4HF0A 2DFIA 5L3CA 2ISZA 3S2WA 4OIRF 1CGPA 2ZCWA 2PG4A 2CYYA 2ISYA 1ZRCA 4HDVA 2D45A 2DAOA 2IA0A 3MAJA 3F6VA 3V7RA 2HKOA 2XAHA 5E1ZB 4WWCA 3ECOA 2FF4A 4OMYA 2P6TA 4NQWA 4RGUA 1FY7A 2MA3A 2WWYA 5BQTA 2O03A 2VN2A 2ZNYA 1OR7A 4MTDA 3WTVC 2DK5A 3TO6A 4I98B 1A04A 2MBFA 4LGWA 5E8GA 3HUGA 4WX9A 1S8NA 5CVUA 4QWQA 2ZFWA 1XCVA 5DEQA 2H94A 4I2OA 4M72A 1FYLA 1OPCA 2DK8A 1HKSA 2HKXA 3GWZA 1UHMA 3KFWX 5A2QZ 3QAHA 5J6XA 5FFXA 4HLYA 2LF7A 4HDUA 4A12A 3MFKA 3F3XA 2UWMA 3FWEA 4RGSA 4ZYHA 3DPLC 2RN7A 1K78A 3B02A 3E6CC 1JXSA 1LVAA 2A61A 3L2CA 3JW4A 1XD7A 2XASA 4RS8A 2RC4A 1BN5A 3HOSA 2P5VA 3IL2A 4MEXF 3O3KA 2GA1A 3SZPA 3CO6C 3RYRA 1QNTA 3FX3A 2GQQA 2P5KA 3K1MA 3KCCA 4OINF 4RAYA 2VT3A 4PGGA 3G73A 3IKTA 4S04A 2Y75A 4KIFA 3JAMK 2G7HA 2V1DA 1BIAA 4BHPA 4EJTA 2Q2EA 4HX8A 3NEUA 4LD5A 2L54A 1HW5A 2HEOA 4YG2F 3P9KA 2O61A 2GXBA 3ZMVA 4UVAA 3EUHA 5HLIA 2FBHA 5DUIA 5E17F 1BIBA 3MEXA 2HTSA 3SXYA 4M74A 3MZYA 1K6OA 3M8FA 1ZRDA 4FT8A 3FHZA 2AS5F 2XGXA 3EYIA 1YIOA 5LGUA 2W84A 5TJJA 5E1XA 2IP2A 1TTYA 4PDKA 2ZO4A 5D8LB 5LRRA 3LA2A 3J81Z 3QP5A 3BPXA 3V7CA 3H92A 4S05A 1TW2A 3HSRA 5BMZA 5FO5A 1MJBA 4EM0B 1KU9A 3OV8A 3IKVA 3DPTA 5IT9K 1K79A 2JZYA 1EV7A 3REOA 4GXOA 3CO7C 1H9TA 2KIMA 4M9XA 5HDNA 2B0LA 4M6XA 1XGSA 1S6LA 2L02A 2G7UA 2Z9OA 3BJAA 3R0JA 3WTTC 2P5LC 5JVTA 2V1UA 1QQIA 1SD7A 1KU2A 3WODF 2NNNA 2VT2A 1L0OC 1SFUA 2XKPA 4I09A 2PI0A 1IN5A 3EDPA 3RKXA 2Z3YA 1BI0A 3JSPA 1SMYF 1TNSA 2CFXA 4UHTA 1J9IA 4GYGA 3O6BB 2HFHA 3GFLA 2A68F 3RIRA 1LJ9A 2K4JA 2KIUA 2VBZA 1EH6A 1HKTA 2FA5A 2DPUA 4UUVA 3F22A 3KP2A 4KMUX 1R22A 1S3JA 1HQCA 3FF5A 2XAFA 4LLGF 2IA1A 1FT9A 5FB2A 2A6EF 3KP7A 3RJPA 5DD4A 4ENMA 2BBYA 1PDNC 4YFKF 4HAMA 5ILUA 5BS6A 2IA2A 4U0VA 2F5DA 1P4WA 1RNLA 2J5OA 1ZLJA 1IRFA 2DPDA 3I59B 2Z33A 2DO7A 4E70A 1BM9A 1JGSA 2DI3A 4IVNA 1EH8A 1ZG3A 4R1HA 2QENA 5IT3A 1FBUA 2HQRA 5HOOA 2MLKA 3ISPA 1R5GA 1W7PD 4Q48A 3F21A 1IXSB 3KLOA 2DW4A 3DQVC 2M30A 1P6RA 4UVBA 1I5ZA 5LBQA 4YIFA 5D5XB 2K4BA 5JHUA 3EQLF 4HOBA 5CVIA 4LB5A 5L3DA 1FLIA 2NRAC 1TQIA 1G3SA 4KICA 4JQFA 3QPTA 1ZAOA 3MCZA 3C1DA 3WTXC 4EGZA 1XMKA 4HF2A 4KIBA 2VC0A 1EH7A 1R1VA 1BI3A 3F8MA 3IHUA 3BY6A 4RB0A 1FYMA 1YO5C 3WGIA 1B6AA 4K2EA 1SFXA 3E5XA 4F7ZA 1R58A 1JE8A 2GWRA 4O6JA 2EA2A 3BPVA 4YFXF 1SMTA 3E5QA 1F1ZA 3E6BA 2KRFA 4KN7X 3GFIA 3RKYA 4MNUA 2ZXJA 3K2ZA 4G94A 2E1NA 1BI2A 4LK1F 4XLNF 4HYEA 4KN4X 4A5NA 4N9IA 4U7DA 2L3DA 4ZH4F 1XDUA 2HOEA 1WI9A 2VODA 1FP2A 3FMSA 2F2EA 2CG4A 4A2UA 3BJOA 3H3UA 1ZREA 4WF2A 2JRTA 1ZLKA 2NYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2F A;  3TO7 A;  4EJV A;  2F5C A;  5L3F A;  4Z2Y A;  1P92 A;  3Q9S A;  4HX7 A;  1ZYR F;  3TOA A;  1YLF A;  2EWN A;  3JAM Z;  5LLQ A;  3Q5F A;  1SD4 A;  2D1H A;  5FD6 A;  2ELH A;  5ERI A;  2M8E A;  4L0Z B;  2J5P A;  4ENN A;  1R00 A;  4G7H F;  5D4R A;  4JK1 X;  1YS7 A;  2NNY A;  3I0T A;  3I53 A;  4IF4 A;  3MZH A;  4RB2 C;  3H3Z A;  3E97 A;  2R3S A;  1MZB A;  3ZP5 A;  3CDH A;  2DTR A;  1T39 A;  4M6Y A;  2DBB A;  4N0B A;  5D8K B;  1IUY A;  4ETS A;  4L9T A;  4M71 A;  4LG0 B;  3JTG A;  5E1W A;  1OYI A;  1LEB A;  3AAF A;  3D5L A;  2MLG A;  3I58 A;  3RKW A;  4OOI A;  1IZ1 A;  2STW A;  1BJA A;  1R1U A;  2L4M A;  1TQM A;  3ECH A;  4CDG A;  1XMA A;  3QU3 A;  3R4K A;  1FX7 A;  1CF7 B;  2A6H F;  5IT9 Z;  2DQL A;  3M8E A;  3PQK A;  1P4A A;  2Z99 A;  4A6E A;  2CGP A;  1QBJ A;  2QWW A;  1FBS A;  5LEJ A;  4KUM A;  3SFZ A;  2EA4 A;  3WGG A;  4OIQ F;  1Z91 A;  3DFG A;  3I71 A;  3T0Y A;  4Q4Z F;  1J0R A;  1R5H A;  3ZMU A;  2QZ8 A;  1GHC A;  4Y17 A;  4IRG A;  1K7A A;  1FNN A;  2H6B A;  1TW3 A;  1C0W A;  3GVA A;  2RNJ A;  4A0Y A;  4GCV A;  1FWZ A;  1STZ A;  1Q1H A;  1FPQ A;  5DV5 A;  1YQA A;  2YR2 A;  4ENJ A;  1LB2 A;  5ICG A;  1U3E M;  2OQR A;  4B09 A;  4EM1 A;  1Z6R A;  1ZHF A;  4LB6 B;  5LEK A;  1U8R A;  2YU3 A;  2MC3 A;  3W6J B;  2EK5 A;  3F23 A;  4A0X A;  4BHC A;  2LDU A;  1Z9C A;  1F9N A;  5BOX A;  1T98 A;  2VXZ A;  1XSD A;  4UVC A;  1YG2 A;  1ON2 A;  5FD5 A;  3L9F A;  5D5U B;  2BEO A;  1LQ1 A;  2EV5 A;  1I1G A;  1G4D A;  4IHT A;  2A5Y B;  3LA7 A;  4G6Q A;  3ABU A;  2XUB A;  2RV8 A;  3KEQ A;  3HRU A;  3L09 A;  1YW9 A;  3COA C;  4ZZL A;  3T8R A;  3VOE A;  4HQE A;  1R36 A;  2P6S A;  2XRN A;  4CO8 A;  4M9S A;  5L3E A;  1Z6T A;  4L9J A;  3RYP A;  3TGN A;  3HSE A;  1G3T A;  1ZAR A;  1H9G A;  3KP5 A;  2BV6 A;  1YW7 A;  1BC8 C;  3E3V A;  3BP8 A;  1YS6 A;  4M9Z A;  3IWF A;  4YFN F;  2YPR A;  2PBI A;  2MH9 A;  5HS7 A;  1YFH A;  5ILV A;  2FBK A;  3SZT A;  4I7H A;  1J5Y A;  3I59 A;  4XSX F;  2C6Y A;  4EQQ A;  3CUO A;  2YSR A;  1R1T A;  2LSO A;  4BXU A;  2TDX A;  4P9F A;  1V4R A;  1QPM A;  5FLX K;  3PQJ A;  1I6X A;  2F5E A;  2IPQ X;  2HTJ A;  4HQM A;  5CVJ A;  1RUO A;  3LWF A;  5ED4 A;  3R61 A;  1GVJ A;  4CIC A;  4IXA A;  3KP4 A;  1IN6 A;  1B4A A;  2P8T A;  2FBI A;  2CO5 A;  4BYY A;  1WWX A;  2VBX A;  3ZQ7 A;  4I01 A;  4LLL A;  1T38 A;  3BZ6 A;  2XAG A;  1KGS A;  1G6N A;  4YII A;  4LMY A;  2GIV A;  2GA2 A;  5HLG A;  1XN7 A;  3WGH A;  1W4M A;  2XKO A;  3K0L A;  3R0A A;  2YX4 A;  4GO1 A;  1ON1 A;  2UXN A;  3WTW C;  1USS A;  3E5U A;  2UZK A;  5E8I A;  3U9G A;  2EV0 A;  2CQK A;  2M5W A;  1T0F A;  3BOQ A;  5TRD A;  2FSW A;  1R7J A;  1FSH A;  1KU7 A;  4CHU A;  2D2W A;  5F6F A;  3DF8 A;  3F72 A;  1IAW A;  2FE3 A;  4RB3 C;  1U5T C;  3V8K A;  4QLC U;  1ZRF A;  3HYI A;  5JR3 A;  1S7A A;  2ZME B;  4OU0 A;  4OMZ A;  2XIG A;  3J7A O;  4PZJ A;  5D4S A;  3QOP A;  4CYD A;  3GF2 A;  4NHJ A;  5HLH A;  3TOB A;  3IRR A;  1OKR A;  2FML A;  4R79 A;  1ZG5 A;  3LFK A;  1XSX A;  2JPC A;  4EVI A;  1OMI A;  3FZV A;  1YYV A;  2OZ6 A;  2V9V A;  3F8N A;  1QGP A;  2EFN A;  5K1Y A;  1LDJ A;  5FFZ A;  1FOK A;  2PLY A;  4XRF A;  4O3M A;  1KYW A;  3GX4 X;  3C3W A;  1LDD A;  2MH2 A;  1O7L A;  5EEH A;  2BE5 F;  5HDG A;  4GYI A;  5H6Q A;  3VEP A;  3TKY A;  5DCM B;  1T2K A;  5DCF A;  3CUQ C;  4AVP A;  2VE8 A;  1PP8 F;  2E1C A;  3GO5 A;  2M87 A;  2VOP A;  1SD6 A;  4G6D A;  4U88 A;  3WE2 A;  3ZMT A;  4LG0 A;  3B73 A;  1J59 A;  2P7C B;  1MDM B;  2DLL A;  1TNT A;  4M73 A;  1BI1 A;  4A0Z A;  5BPD A;  3M9A A;  3K1P A;  3NRV A;  4WXD A;  4R8H A;  1V3F A;  1J75 A;  1LEA A;  3FXQ A;  2D1V A;  3T5X A;  5D5W B;  5HVQ C;  1GXP A;  1CF7 A;  1XDS A;  2K02 A;  2VBW A;  4I0B A;  1D8J A;  1UB9 A;  3KLN A;  3HIF A;  3HTS B;  3V8J A;  2FNP A;  3RPQ A;  4EMS A;  1VTN C;  2ZKZ A;  3TQN A;  3VFZ A;  1KQ9 A;  1WSU A;  2QBY B;  2O0Y A;  1MD0 A;  3LST A;  3FMR A;  2H6C A;  1I1S A;  3F6O A;  5K5R A;  4G9Y A;  1H0M A;  1B1B A;  4UNO A;  3J81 K;  1Z7U A;  2W57 A;  2V79 A;  1AWC A;  1HST A;  4EJU A;  1BC7 C;  3HRM A;  2MD5 A;  1L3L A;  2ZJ2 A;  2DQR A;  3TO9 A;  2G9W A;  1ONV A;  1TBX A;  4BAY A;  3GXO A;  3JTH A;  4WXH A;  2OA4 A;  4L9N A;  3K1N A;  2F5F A;  4ESJ A;  3O2P E;  2EFP A;  1D3Y A;  1AOY A;  1UFM A;  1QZZ A;  2HGC A;  2QUF A;  1BOA A;  1I27 A;  4AWX B;  3KP3 A;  2LNB A;  4ENK A;  3GW2 A;  3HSF A;  3KZZ A;  2E7X A;  3SHF A;  1S7O A;  4RB1 A;  2OAZ A;  2ADU A;  2FU4 A;  1FYK A;  1R23 A;  1KQ0 A;  1O3T A;  2CSO A;  1D5V A;  2QLZ A;  1U5T B;  1W7P B;  3BDD A;  3ZN0 A;  4HF1 A;  3KEO A;  1JHH A;  1IN4 A;  5FLX Z;  5E20 A;  4MTE A;  4OIO F;  1XGO A;  4N9H A;  1WKM A;  2YX7 A;  4IRI A;  3FXU A;  2BGC A;  2STT A;  2XRO A;  2JPB A;  5AON A;  4L18 B;  2CWE A;  2X4H A;  2HYG D;  2OQG A;  1F4K A;  1MJA A;  2M45 A;  3I64 A;  2R7D A;  2Y0M A;  2ESN A;  1F5T A;  5BPI A;  3HRT A;  1MKM A;  1X3U A;  5AIQ A;  2A69 F;  2K27 A;  3FM5 A;  2PQ8 A;  2QQ9 A;  2O3F A;  3WTU C;  4HW0 A;  1S29 A;  3P9C A;  4EJW A;  4KT5 C;  2ACJ A;  4HV6 A;  3CUQ B;  4KIG A;  2VBY A;  1RZ4 A;  5ICC A;  3LAJ A;  2EJR A;  3GZ5 A;  2HS5 A;  2QVO A;  2EFO A;  1IRG A;  2XHK A;  4KDP A;  4P55 A;  2UXX A;  1O57 A;  4CZZ A;  3P9I A;  3ZN1 A;  3U2R A;  1DUX C;  3GLX A;  5J8F A;  2W25 A;  4ESB A;  3V8L A;  2HZT A;  1O3R A;  3ZMZ A;  2JT1 A;  4IPA A;  2PMU A;  1MGT A;  4MGR A;  3GYH X;  3WTY C;  4KMF A;  2P7V B;  3KE2 A;  4ON0 A;  4EGY A;  2JSC A;  3SQN A;  4FX0 A;  5FGM A;  3WTS C;  5KVR A;  1HXD A;  3J80 K;  2OBP A;  1FBQ A;  4LK0 F;  2Y48 A;  2M1B A;  3ZMD A;  4LJZ F;  3LQR A;  4HX4 A;  4ZYG A;  3DKW A;  3BJ6 A;  1HW2 A;  3LQQ A;  3EET A;  3G3Z A;  1RI7 A;  3WU1 B;  1IN7 A;  4AIK A;  2ZME A;  3CTA A;  4IHS A;  3DXJ F;  4P9U A;  3QP6 A;  2IJL A;  3IWZ A;  3CJN A;  3BWG A;  3T8T A;  1FP1 D;  2KKO A;  4G7Z F;  4FHT A;  5ICF A;  4AIH A;  1J2X A;  4G8X A;  1YTY A;  3GFJ A;  4Q47 A;  3T1B A;  2GAU A;  3VB2 A;  1QZY A;  4ZYE A;  2WTE A;  2IW5 A;  1D8K A;  4EM2 A;  4DQ2 A;  2RKH A;  1W5T A;  1DP7 P;  1ZN2 A;  3CLO A;  5LHI A;  4FX4 A;  4L5J A;  1RUN A;  2L01 A;  3GZ6 A;  3MWM A;  5CVR A;  2A07 F;  2GXG A;  1FC3 A;  3KZY A;  4H0E A;  3E6M A;  5AIP A;  2LF8 A;  4ASN A;  1GXQ A;  2OZU A;  5DCM A;  4HZF A;  2Q8K A;  5DUK A;  3R6S A;  3P7N A;  3V7S A;  1ZG1 A;  1Z1D A;  1E2X A;  1RIO H;  3C7J A;  4RGX A;  1ULY A;  3F8C A;  3HHG A;  2EFW A;  1MDM A;  4XBF A;  6PAX A;  3R60 A;  1Y0U A;  1O3S A;  4BHB A;  1JHF A;  4UXN A;  4L9V A;  3ZPL A;  2HQN A;  3ZMS A;  5DDG A;  2O6G E;  3RPU A;  4AIJ A;  1REP C;  2K86 A;  2FMY A;  3GFM A;  2K7L A;  3WE3 A;  2FOK A;  4MQV A;  4NB5 A;  3N97 A;  4BNC A;  3RI4 A;  4Q5S F;  4BQA A;  5LGN A;  2KIF A;  5KK1 A;  4WCG A;  1SD5 A;  3EYY A;  3WG9 A;  3V4G A;  4U0Y A;  1XGN A;  4PCQ A;  2VE9 A;  3L00 A;  1DDN A;  3HTU A;  4XLP F;  2XAQ A;  2PFB A;  2ESH A;  4EV0 A;  2CW0 F;  4LLN A;  4U0W A;  2QBY A;  4GGG A;  5J8C A;  2XVC A;  1O3Q A;  5DYM A;  4AD9 A;  2QYO A;  1OYY A;  1TLH B;  3I5U A;  1YW8 A;  1HKQ A;  3ELK A;  3ROU A;  4LFU A;  4MHG A;  3FXR A;  1OYW A;  4IRH A;  2E7W A;  4P96 A;  3HOT A;  1DPR A;  2H27 A;  1T6S A;  4IJA A;  1SAX A;  1UST A;  1ZGA A;  1K78 B;  5LRS A;  1HBX G;  2AXL A;  3M1E A;  5HS9 A;  5H6R A;  2XV4 S;  2BYV E;  4RGR A;  2HYF A;  5CLS A;  5K5O A;  4I0A A;  2VON A;  5LGT A;  3WU0 A;  5EEG A;  3HRS A;  5E18 F;  1WQ2 A;  4HLX A;  3FMQ A;  3VOD A;  3BRO A;  3I4P A;  3Q9V A;  2VC1 A;  1B9N A;  1FZP B;  5A2Q K;  2O8X A;  2COM A;  4TV7 A;  2V6C A;  1W5S A;  2OU2 A;  1ZGJ A;  3QPH A;  2W85 A;  4XSZ F;  2A3S A;  5DD8 A;  3C18 A;  4JBA A;  1B59 A;  4U7B A;  2NAZ A;  4KFC A;  1IXR C;  1MJ9 A;  2IRF G;  4BH9 A;  2RQP A;  2ZNZ A;  1U5T A;  1W7P A;  3K69 A;  1NHA A;  4WXC A;  5L3G A;  2EV6 A;  2FXA A;  2P4W A;  4L5I A;  1IN8 A;  3ULQ B;  3I54 A;  4UV9 A;  4CGZ A;  1ODD A;  2FEZ A;  3DEU A;  2WC2 A;  1B9M A;  2ETH A;  3M7G A;  1IF1 A;  5JFR A;  2KJC A;  4CXF A;  1LNW A;  5CVV A;  2PMH A;  3LA3 A;  3JSO A;  1FSE A;  2KJB A;  3W6K B;  2QM3 A;  4A5M A;  5D5V B;  1Z05 A;  4MEY F;  3DP7 A;  5HDK A;  2OD5 A;  4D0P A;  3F8F A;  3GEZ A;  4PGH A;  5D6E A;  5L3B A;  3CUQ A;  2DU9 A;  2HDC A;  3ABT A;  3WTZ A;  3J80 Z;  1U2W A;  4I02 A;  1G3Y A;  1WRJ A;  4ZZD A;  5H20 A;  1KYZ A;  2FRH A;  3ML6 A;  1DPU A;  1XSV A;  3L7W A;  1U78 A;  2EFQ A;  1LDK B;  2PEX A;  5HS8 A;  2PN6 A;  3KET A;  1J7K A;  3TDU C;  2EB7 A;  3KP6 A;  2V1X A;  3FM3 A;  2W24 A;  2ZBK A;  4EJO A;  3IRQ A;  5LHH A;  3U1D A;  2H09 A;  2QQB A;  2XAJ A;  4KYW A;  1G3W A;  5LHG A;  3NQO A;  4ZYD A;  1TQP A;  1ZH5 A;  2VOO A;  2RDP A;  3QRF F;  3QU6 A;  2NS0 A;  1XCB A;  1HSJ A;  1PUE E;  1KU3 A;  4HV5 A;  5K5Q A;  3D0S A;  4HA8 A;  4Y15 A;  2GZW A;  1BBY A;  2DT5 A;  3K9T A;  4O5V A;  5JI6 A;  2Q0O A;  3GUD A;  1HW1 A;  4L0Y B;  2JTV A;  1KQ8 A;  2FQ3 A;  1XGM A;  3TDZ C;  1KA8 A;  4RAZ A;  4WK8 F;  3PFI A;  2RGV A;  5F64 A;  3ERE D;  4HBL A;  3IC7 A;  4P5O A;  2QQA A;  2FNA A;  4DNC A;  2IT0 A;  4KA4 A;  4KNY A;  1E17 A;  3N4M A;  5CYV A;  3RDI A;  2Z5U A;  2WV0 A;  3LAP A;  2RVC A;  4MQ9 F;  4OIP F;  3MQ0 A;  2HWV A;  1UHW A;  2X0L A;  1XB4 A;  4ESF A;  2HR3 A;  1UCR A;  1PP7 U;  2IVM A;  3E6D A;  1QO0 D;  5ILS A;  5CJ9 A;  5D6F A;  3HHH A;  2LKP A;  3DV8 A;  3OOP A;  3F8B A;  2PJP A;  1SFE A;  1P4X A;  4G7O F;  3RTR A;  4B8X A;  4UV8 A;  2R7F A;  2L4A A;  1IW7 F;  4A6D A;  1IXC A;  5F1R A;  1O7F A;  4Y13 A;  1U6G A;  5ICE A;  4HF0 A;  2DFI A;  5L3C A;  2ISZ A;  3S2W A;  4OIR F;  1CGP A;  2ZCW A;  2PG4 A;  2CYY A;  2ISY A;  1ZRC A;  4HDV A;  2D45 A;  2DAO A;  2IA0 A;  3MAJ A;  3F6V A;  3V7R A;  2HKO A;  2XAH A;  5E1Z B;  4WWC A;  3ECO A;  2FF4 A;  4OMY A;  2P6T A;  4NQW A;  4RGU A;  1FY7 A;  2MA3 A;  2WWY A;  5BQT A;  2O03 A;  2VN2 A;  2ZNY A;  1OR7 A;  4MTD A;  3WTV C;  2DK5 A;  3TO6 A;  4I98 B;  1A04 A;  2MBF A;  4LGW A;  5E8G A;  3HUG A;  4WX9 A;  1S8N A;  5CVU A;  4QWQ A;  2ZFW A;  1XCV A;  5DEQ A;  2H94 A;  4I2O A;  4M72 A;  1FYL A;  1OPC A;  2DK8 A;  1HKS A;  2HKX A;  3GWZ A;  1UHM A;  3KFW X;  5A2Q Z;  3QAH A;  5J6X A;  5FFX A;  4HLY A;  2LF7 A;  4HDU A;  4A12 A;  3MFK A;  3F3X A;  2UWM A;  3FWE A;  4RGS A;  4ZYH A;  3DPL C;  2RN7 A;  1K78 A;  3B02 A;  3E6C C;  1JXS A;  1LVA A;  2A61 A;  3L2C A;  3JW4 A;  1XD7 A;  2XAS A;  4RS8 A;  2RC4 A;  1BN5 A;  3HOS A;  2P5V A;  3IL2 A;  4MEX F;  3O3K A;  2GA1 A;  3SZP A;  3CO6 C;  3RYR A;  1QNT A;  3FX3 A;  2GQQ A;  2P5K A;  3K1M A;  3KCC A;  4OIN F;  4RAY A;  2VT3 A;  4PGG A;  3G73 A;  3IKT A;  4S04 A;  2Y75 A;  4KIF A;  3JAM K;  2G7H A;  2V1D A;  1BIA A;  4BHP A;  4EJT A;  2Q2E A;  4HX8 A;  3NEU A;  4LD5 A;  2L54 A;  1HW5 A;  2HEO A;  4YG2 F;  3P9K A;  2O61 A;  2GXB A;  3ZMV A;  4UVA A;  3EUH A;  5HLI A;  2FBH A;  5DUI A;  5E17 F;  1BIB A;  3MEX A;  2HTS A;  3SXY A;  4M74 A;  3MZY A;  1K6O A;  3M8F A;  1ZRD A;  4FT8 A;  3FHZ A;  2AS5 F;  2XGX A;  3EYI A;  1YIO A;  5LGU A;  2W84 A;  5TJJ A;  5E1X A;  2IP2 A;  1TTY A;  4PDK A;  2ZO4 A;  5D8L B;  5LRR A;  3LA2 A;  3J81 Z;  3QP5 A;  3BPX A;  3V7C A;  3H92 A;  4S05 A;  1TW2 A;  3HSR A;  5BMZ A;  5FO5 A;  1MJB A;  4EM0 B;  1KU9 A;  3OV8 A;  3IKV A;  3DPT A;  5IT9 K;  1K79 A;  2JZY A;  1EV7 A;  3REO A;  4GXO A;  3CO7 C;  1H9T A;  2KIM A;  4M9X A;  5HDN A;  2B0L A;  4M6X A;  1XGS A;  1S6L A;  2L02 A;  2G7U A;  2Z9O A;  3BJA A;  3R0J A;  3WTT C;  2P5L C;  5JVT A;  2V1U A;  1QQI A;  1SD7 A;  1KU2 A;  3WOD F;  2NNN A;  2VT2 A;  1L0O C;  1SFU A;  2XKP A;  4I09 A;  2PI0 A;  1IN5 A;  3EDP A;  3RKX A;  2Z3Y A;  1BI0 A;  3JSP A;  1SMY F;  1TNS A;  2CFX A;  4UHT A;  1J9I A;  4GYG A;  3O6B B;  2HFH A;  3GFL A;  2A68 F;  3RIR A;  1LJ9 A;  2K4J A;  2KIU A;  2VBZ A;  1EH6 A;  1HKT A;  2FA5 A;  2DPU A;  4UUV A;  3F22 A;  3KP2 A;  4KMU X;  1R22 A;  1S3J A;  1HQC A;  3FF5 A;  2XAF A;  4LLG F;  2IA1 A;  1FT9 A;  5FB2 A;  2A6E F;  3KP7 A;  3RJP A;  5DD4 A;  4ENM A;  2BBY A;  1PDN C;  4YFK F;  4HAM A;  5ILU A;  5BS6 A;  2IA2 A;  4U0V A;  2F5D A;  1P4W A;  1RNL A;  2J5O A;  1ZLJ A;  1IRF A;  2DPD A;  3I59 B;  2Z33 A;  2DO7 A;  4E70 A;  1BM9 A;  1JGS A;  2DI3 A;  4IVN A;  1EH8 A;  1ZG3 A;  4R1H A;  2QEN A;  5IT3 A;  1FBU A;  2HQR A;  5HOO A;  2MLK A;  3ISP A;  1R5G A;  1W7P D;  4Q48 A;  3F21 A;  1IXS B;  3KLO A;  2DW4 A;  3DQV C;  2M30 A;  1P6R A;  4UVB A;  1I5Z A;  5LBQ A;  4YIF A;  5D5X B;  2K4B A;  5JHU A;  3EQL F;  4HOB A;  5CVI A;  4LB5 A;  5L3D A;  1FLI A;  2NRA C;  1TQI A;  1G3S A;  4KIC A;  4JQF A;  3QPT A;  1ZAO A;  3MCZ A;  3C1D A;  3WTX C;  4EGZ A;  1XMK A;  4HF2 A;  4KIB A;  2VC0 A;  1EH7 A;  1R1V A;  1BI3 A;  3F8M A;  3IHU A;  3BY6 A;  4RB0 A;  1FYM A;  1YO5 C;  3WGI A;  1B6A A;  4K2E A;  1SFX A;  3E5X A;  4F7Z A;  1R58 A;  1JE8 A;  2GWR A;  4O6J A;  2EA2 A;  3BPV A;  4YFX F;  1SMT A;  3E5Q A;  1F1Z A;  3E6B A;  2KRF A;  4KN7 X;  3GFI A;  3RKY A;  4MNU A;  2ZXJ A;  3K2Z A;  4G94 A;  2E1N A;  1BI2 A;  4LK1 F;  4XLN F;  4HYE A;  4KN4 X;  4A5N A;  4N9I A;  4U7D A;  2L3D A;  4ZH4 F;  1XDU A;  2HOE A;  1WI9 A;  2VOD A;  1FP2 A;  3FMS A;  2F2E A;  2CG4 A;  4A2U A;  3BJO A;  3H3U A;  1ZRE A;  4WF2 A;  2JRT A;  1ZLK A;  2NYX A; 
#chains in the Genus database with same CATH topology
 1P2F A;  3K10 A;  1MBG A;  2PMZ A;  4IOC F;  3TO7 A;  2W4S A;  4ZTF A;  3K4B A;  3CCE I;  4EJV A;  2BXY A;  2F5C A;  5L3F A;  2A6T A;  2NVQ J;  4Z2Y A;  3DEW A;  1P92 A;  3EPZ A;  3Q9S A;  5FLV A;  2XC7 A;  2E60 A;  4HX7 A;  4M3D A;  2EZI A;  2GIZ A;  1EJ9 A;  1ZYR F;  5GTH C;  3TOA A;  1YLF A;  2EWN A;  1VQP I;  3JAM Z;  2F4I A;  5LLQ A;  3BCB A;  3Q5F A;  2KZV A;  1SD4 A;  2D1H A;  2F4O B;  2ELH A;  3FBN B;  5ERI A;  5FD6 A;  3I4N J;  2M8E A;  4L0Z B;  2J5P A;  1K4T A;  1MMG A;  1R00 A;  4ENN A;  4UUS B;  4RMN A;  4HEA 2;  3OIO A;  3S14 J;  5EEA A;  2COB A;  4G7H F;  5D4R A;  2MG4 A;  4JK1 X;  1YS7 A;  3CJR B;  2NNY A;  3TED A;  3HDD A;  3I0T A;  4A3B J;  3I53 A;  4IF4 A;  3VWB A;  3MZH A;  4BJT A;  4RB2 C;  3H3Z A;  4II3 A;  5LD2 C;  3ZCO A;  3IV5 A;  4KIS A;  4XIC A;  4J00 A;  3E97 A;  1FTT A;  4CCK A;  2R3S A;  1JKR C;  2ZSH B;  1MZB A;  3ZP5 A;  3CDH A;  2DTR A;  1T39 A;  4M6Y A;  3CF5 F;  2DBB A;  4N0B A;  2CUZ A;  5D8K B;  3HOV J;  1IUY A;  4ETS A;  4RDU A;  1YIT I;  4L9T A;  2K9Q A;  4XKV A;  3H9J A;  4M71 A;  4E7S A;  4LG0 B;  3JTG A;  2JA6 J;  3HG9 A;  5E1W A;  2KIQ A;  3RZO J;  1OYI A;  1LEB A;  4XK4 A;  3AAF A;  1LE8 A;  5FJ8 J;  2HVR A;  3D5L A;  2MLG A;  4JYK A;  3I58 A;  2IEK A;  1LFP A;  3RKW A;  4ABZ A;  3CC4 I;  4OOI A;  2QSF X;  2I5U A;  1IZ1 A;  1V5E A;  1BJA A;  2STW A;  3KYC B;  3HOZ J;  1OR7 C;  2XSD C;  2WAQ N;  2EIM H;  1R1U A;  2W82 A;  2L4M A;  1TQM A;  2JMW A;  3ECH A;  2BZT A;  4CDG A;  2CMP A;  1XMA A;  3QU3 A;  3R4K A;  1FX7 A;  1CF7 B;  2A6H F;  5IT9 Z;  2DQL A;  3M8E A;  3PQK A;  1P4A A;  2Z99 A;  4A6E A;  4GRI A;  2H1L A;  2CGP A;  1QBJ A;  2DMT A;  2QWW A;  5IYC J;  2VLA A;  1FBS A;  3SJM A;  5LEJ A;  2LY1 A;  4KUM A;  3BR6 A;  5J4V A;  3SFZ A;  2EA4 A;  3WGG A;  4CCM A;  3ASO H;  3UR3 C;  4OIQ F;  3FHN A;  1Z91 A;  3DFG A;  3I71 A;  3T0Y A;  4XRS A;  1TT0 A;  4Q4Z F;  4AYB N;  2R92 J;  1J0R A;  2V7F A;  1R5H A;  1P7I A;  3ZMU A;  2QZ8 A;  5FRN A;  1GHC A;  1QVT A;  2BY3 A;  4NC6 A;  2N8G A;  4DZJ A;  4Y17 A;  3OSF A;  3BQZ A;  3G1L A;  2E1M B;  4IRG A;  1K7A A;  1FNN A;  2H6B A;  3GTJ J;  1TW3 A;  1C0W A;  3GVA A;  2RNJ A;  1R49 A;  1OQY A;  4A0Y A;  3NWT A;  4GCV A;  1P7J A;  1UAA A;  3MMY B;  1BL0 A;  1SVO A;  1FWZ A;  3LOC A;  3FIW A;  3HOY J;  3ESW B;  1STZ A;  2LP0 A;  4B48 A;  1Q1H A;  1FPQ A;  2TRT A;  4C3H J;  2ZSI B;  5B1B H;  1GV5 A;  3CCY A;  4CCN A;  1NTC A;  1MMS A;  5GAE J;  5DV5 A;  1QA6 A;  5C3E J;  1YQA A;  1OCO H;  2YR2 A;  4ENJ A;  3GTG J;  5M5X J;  1LB2 A;  5ICG A;  1U3E M;  3C2B A;  4XOP A;  2OQR A;  2KMU A;  4B09 A;  3K4K A;  1B8I A;  2M9H A;  4EM1 A;  1Z6R A;  1ZHF A;  4LB6 B;  5LEK A;  1U8R A;  2YU3 A;  1PYV A;  2MC3 A;  3W6J B;  4I76 A;  5EG0 B;  2EK5 A;  3AG2 H;  3F23 A;  3EUK L;  3HXL A;  1FTZ A;  1MBF A;  4A0X A;  4BHC A;  2LDU A;  4ZDO A;  1Z9C A;  1F9N A;  4CA0 A;  3ZR8 X;  5BOX A;  1T98 A;  2AXT C;  2VXZ A;  3TL4 X;  1XSD A;  3K70 C;  3ZGK A;  2L9V A;  4UVC A;  1VFC A;  1YG2 A;  1ON2 A;  5FD5 A;  1FOW A;  3L9F A;  5D5U B;  2V6E A;  2BEO A;  4RA2 A;  1LQ1 A;  3H35 A;  2EV5 A;  1I1G A;  1G4D A;  1HCR A;  4IHT A;  4OAY A;  2A5Y B;  3LA7 A;  2R5Y B;  2F48 A;  5EJC A;  1EA3 A;  4G6Q A;  2R7V A;  3FBI B;  3ABU A;  3KYD B;  2XUB A;  2RV8 A;  3KEQ A;  3HRU A;  3L09 A;  1MNE A;  3VYS B;  2DYR H;  2E71 A;  1SEU A;  1YW9 A;  2ZB9 A;  3G1O A;  3COA C;  3FDY A;  2DFE A;  4ZZL A;  4J19 A;  3SZG A;  3T8R A;  3VOE A;  4HQE A;  1UEL B;  3C2H A;  1R36 A;  2P6S A;  2XRN A;  4CO8 A;  2M0M A;  4M9S A;  5HLT A;  3BTC A;  5L3E A;  4IHV A;  5GAH J;  1Z6T A;  4L9J A;  3HPG A;  5CQE A;  3RYP A;  3WG7 H;  5J4Y A;  3A4C A;  3TGN A;  2R7O A;  3HSE A;  1VQ9 I;  1G3T A;  1JT0 A;  1ZAR A;  4IQJ A;  1H9G A;  1IC8 A;  3KP5 A;  3BR2 A;  2BV6 A;  4FAS D;  1YW7 A;  1BC8 C;  3PM1 A;  1W0U A;  2LFB A;  3E3V A;  3BP8 A;  4GDF A;  1YS6 A;  4M9Z A;  3IWF A;  4MIM A;  2M2E A;  4YFN F;  2YPR A;  2PBI A;  2LMD A;  2NVU B;  1FIA A;  2MH9 A;  5HS7 A;  1YFH A;  3N05 A;  5ILV A;  5DTD A;  3QPL A;  2BVM A;  2FBK A;  4I7H A;  4IQ4 A;  4LIV A;  3SZT A;  1MBH A;  1J5Y A;  3A0H C;  3I59 A;  2XPV A;  3QYB A;  2DA1 A;  4XSX F;  2LBF B;  2C6Y A;  1OCR H;  2DFH A;  3PO2 J;  2M7A A;  3OR1 C;  3OS2 A;  2DMQ A;  2IS2 A;  4EQQ A;  3CUO A;  2YSR A;  1R1T A;  2LSO A;  5FKO A;  1RES A;  3VDX A;  3K7A J;  4BXU A;  2TDX A;  1UMQ A;  2CV0 A;  1VQ4 I;  4P9F A;  1V4R A;  1QPM A;  2PMZ N;  4YEJ A;  3LMM A;  3PQJ A;  5FLX K;  1I6X A;  2VPR A;  2F5E A;  3GBG A;  2IPQ X;  2HTJ A;  4CCL A;  4HQM A;  5CVJ A;  1RUO A;  3LWF A;  3CD6 I;  5ED4 A;  3R61 A;  1N77 A;  1GVJ A;  3VYT B;  4CIC A;  2VAS A;  4IXA A;  2Z1D A;  1KON A;  3BR5 A;  3KP4 A;  1IN6 A;  1B4A A;  2O5R A;  1YHQ I;  2AQF A;  2FUG 2;  2P8T A;  4B47 A;  4F52 A;  2FBI A;  4CUG A;  3CCM I;  2CO5 A;  1ENH A;  1WWX A;  2VBX A;  4BYY A;  1AKH A;  1PJR A;  3ZQ7 A;  1O4X A;  4I01 A;  3S1M J;  4LLL A;  3AFH A;  5EGO B;  1T38 A;  1UG0 A;  1BR2 A;  2NS7 A;  1Z21 A;  2DOF A;  1I3Q J;  3BZ6 A;  2XAG A;  1KGS A;  3OYC A;  2B7E A;  2CQQ A;  1G6N A;  2XGE A;  4YII A;  3CCQ I;  4A93 J;  4LMY A;  3U1K A;  3OYL A;  1PUF B;  2EIJ H;  2GIV A;  1ZEL A;  1HF0 A;  3GTM J;  3JRC A;  2VKD A;  2CQX A;  4BJ6 C;  2GA2 A;  1UHS A;  4DZP A;  5HLG A;  1XN7 A;  3WGH A;  1W4M A;  2XKO A;  5TIS C;  3CLQ A;  1N78 A;  3K0L A;  3R0A A;  2YX4 A;  2NVX J;  4GO1 A;  1D5Y A;  1FOY A;  1ON1 A;  3HUG B;  3MKZ A;  1OIS A;  2R7Z J;  2UXN A;  4F91 B;  2MSY A;  2IGM A;  3ZQG A;  3WTW C;  1TC3 C;  4YIR X;  2ZJR F;  3S8P A;  1USS A;  3E5U A;  2PJR A;  2QF7 A;  2UZK A;  2P81 A;  3L2R A;  1Z0X A;  3Q3S A;  4C30 A;  5E8I A;  2XDV A;  2BY0 A;  2VKV A;  1X4O A;  1WH5 A;  4UB6 C;  3U9G A;  2EV0 A;  2CQK A;  2M5W A;  3BG3 A;  3SFI A;  1T8I A;  1JKQ C;  1T0F A;  1SC7 A;  2TCT A;  3BR1 A;  3BOQ A;  5TRD A;  2FSW A;  2ZXW H;  1R7J A;  1FSH A;  1KU7 A;  3I9V 2;  3MKW B;  4CHU A;  2D2W A;  5F6F A;  3UNG C;  1E3O C;  3DF8 A;  2DOD A;  3CDI A;  3F72 A;  4QSH A;  1IAW A;  3B6A A;  2FE3 A;  2XB0 X;  5E3O A;  4RB3 C;  2WBM A;  4D1Q A;  1U5T C;  3V8K A;  2KFD A;  3W2V A;  4QLC U;  1HLV A;  1ZRF A;  1IUF A;  5JLW A;  3HYI A;  5JR3 A;  1JKP C;  1S7A A;  2ZME B;  2XGC A;  4OU0 A;  1SFK A;  5KNL A;  4OMZ A;  1VQ7 I;  2LD5 A;  2XIG A;  5IOY A;  3GTP J;  3J7A O;  1IDZ A;  1QRY A;  4PZJ A;  4JX4 A;  5D4S A;  3QOP A;  3PSF A;  4CYD A;  1G59 A;  2V1N A;  4HG2 A;  3GF2 A;  5E79 C;  4NHJ A;  2KIS A;  3FK7 A;  5HLH A;  2EH3 A;  3TOB A;  1FJL A;  3JRH A;  3IRR A;  1OFC X;  2OTL I;  1OKR A;  2FML A;  2DJN A;  4R79 A;  1ZG5 A;  2HOS A;  3D5S C;  2Y9Y A;  1XSX A;  3LFK A;  2JPC A;  4EVI A;  3NWS A;  3VSL A;  3ZQQ A;  4IEJ A;  3AG4 H;  1OMI A;  1HOM A;  2DMP A;  2L7Z A;  4PFO A;  3FZV A;  3OYI A;  1YYV A;  2OZ6 A;  2V9V A;  3F8N A;  2XAU A;  1MSE C;  2FD5 A;  1QGP A;  2EFN A;  5K1Y A;  1LDJ A;  1IG7 A;  5FFZ A;  1FOK A;  2PLY A;  3DTI A;  4UUS A;  4N4O B;  3J7Y J;  4XRF A;  4O3M A;  2W1O A;  1KYW A;  3GX4 X;  4RLQ A;  3C3W A;  2DCE A;  1LDD A;  2MH2 A;  1O7L A;  2BY2 A;  1ZQ3 P;  1MIJ A;  5EEH A;  2YU9 J;  2BE5 F;  5HDG A;  4W1U A;  4GYI A;  1I3A A;  5H6Q A;  3VEP A;  1RRJ A;  1BOB A;  3ZRG A;  3TKY A;  3S32 A;  5DCM B;  1T2K A;  5DCF A;  5HNH A;  3CUQ C;  4AVP A;  2VE8 A;  1U0J A;  2Q2E B;  1PP8 F;  2CH0 A;  3OYN A;  1T33 A;  3IH3 A;  1NK2 P;  2E1C A;  3GO5 A;  2M87 A;  4D5C A;  2VOP A;  2JA8 J;  3CF2 A;  1SD6 A;  1WGX A;  3IH4 A;  4JOM A;  2O8K A;  4G6D A;  1TWG J;  4U88 A;  2NOJ B;  3WE2 A;  3ZMT A;  4LG0 A;  5GAD J;  4ANJ A;  3B73 A;  1J59 A;  2P7C B;  3DTE A;  1MH4 A;  1MDM B;  2DLL A;  2H1K A;  3SYT A;  1TWF J;  1TNT A;  3S93 A;  3A01 B;  4M73 A;  1BI1 A;  3EUA A;  4A0Z A;  5BPD A;  3BQY A;  3M9A A;  2MYS A;  3K1P A;  2XF6 A;  3NRV A;  4WXD A;  2LR8 A;  2O9L A;  4R8H A;  1V3F A;  1J75 A;  1LEA A;  3FXQ A;  2D1V A;  3T5X A;  5D5W B;  1IJW C;  5HVQ C;  1GXP A;  3MD2 A;  4PSW A;  1CF7 A;  1XDS A;  1MMN A;  2L9S A;  2IGO A;  2LKS A;  4A3I J;  2MD0 A;  2K02 A;  2VBW A;  3DLL F;  4M3E A;  1B72 B;  1JJ6 C;  1X1C A;  1WJA A;  4I0B A;  4CYC B;  4BQO A;  1D8J A;  1UB9 A;  1HC8 A;  3ABK H;  1NH3 A;  2X48 A;  4A3F J;  3KLN A;  2JA2 A;  3HIF A;  3PUB A;  3HTS B;  1ETX A;  3V8J A;  2FNP A;  3S17 J;  3RPQ A;  4EMS A;  1VTN C;  2ZKZ A;  3TQN A;  1IGN A;  4Y52 J;  2R7U A;  3VFZ A;  1XMX A;  4I6Z A;  1KQ9 A;  3CES A;  1WSU A;  4B1R A;  5B66 C;  4BGD A;  2QBY B;  2O0Y A;  3S2D J;  4KIT B;  2GLO A;  3S1N J;  1MMA A;  1MD0 A;  3TW6 A;  2DJI A;  3LST A;  3FMR A;  2H6C A;  1I1S A;  1KZH A;  3JRF A;  3F6O A;  3E0J B;  4BJ5 C;  2HQA A;  5K5R A;  4ZC3 A;  2LYC A;  4G9Y A;  5CPR B;  2IGK A;  4IO9 F;  2M34 A;  1H0M A;  1B1B A;  1NK3 P;  4UNO A;  2KT0 A;  5IPA A;  3J81 K;  1Z7U A;  2W57 A;  2V79 A;  3M8J A;  1AWC A;  1HST A;  2LOO A;  3LSJ A;  4EJU A;  1TWH J;  1BC7 C;  3Q0W A;  3HRM A;  2MD5 A;  1L3L A;  3BLY A;  2ZJ2 A;  3FXO A;  2DQR A;  3TO9 A;  2G9W A;  4XQF A;  4A3C J;  3NAU A;  1ONV A;  1PVE A;  1TBX A;  4BAY A;  3GXO A;  1X1A A;  3JTH A;  4PSX A;  2OC6 A;  4WXH A;  5EG0 A;  3OYB A;  2OA4 A;  3BT9 A;  4L9N A;  1D1A A;  3K1N A;  2F5F A;  5IP7 J;  2NOG A;  3O2P E;  2EFP A;  1D3Y A;  3WHC A;  4ESJ A;  1V5F A;  1AOY A;  1UFM A;  2NVT J;  1LVK A;  1QZZ A;  2HGC A;  2QUF A;  1VQN I;  1BOA A;  1I27 A;  4AWX B;  2DA2 A;  3KP3 A;  2CS3 A;  4X1E A;  2LNB A;  2K3F A;  4ENK A;  3GW2 A;  1QPI A;  3HSF A;  5FKN A;  2Y2Z A;  5IP6 A;  1LKX A;  2E7X A;  3KZZ A;  5CQG A;  3G1M A;  2R5Y A;  3SHF A;  1S7O A;  5KCM A;  3OS1 A;  4RB1 A;  4LG3 A;  5FLM J;  4HNU A;  2OAZ A;  3A0B C;  1A31 A;  4F93 B;  1QZE A;  2D5V A;  2ADU A;  2FU4 A;  1FYK A;  4E7H A;  4XKC A;  1R23 A;  2X1C A;  3DBR B;  2ID6 A;  2ZJP F;  2DA7 A;  4FIS A;  3CCR I;  1KQ0 A;  3H1C A;  1O3T A;  2CSO A;  1D5V A;  4HNT A;  2QLZ A;  3S2H J;  1U5T B;  4A3G J;  1W7P B;  3BDD A;  3DKY A;  3ZN0 A;  5E3N A;  4FQG A;  4HF1 A;  3KEO A;  1JHH A;  1IN4 A;  5FLX Z;  5E20 A;  4MTE A;  4OIO F;  1XGO A;  4XL9 A;  2QSH X;  1W36 D;  2DA3 A;  1E3P A;  3HGG A;  3QQA A;  4N9H A;  1WKM A;  4BEH B;  2YX7 A;  4IRI A;  3FXU A;  1RR7 A;  2BGC A;  2DDB A;  2STT A;  2M8G X;  1VQM I;  1Z7L A;  2XRO A;  3PL8 A;  1TZL A;  1V55 H;  2JPB A;  1XG1 A;  5AON A;  1VND A;  4ZYA A;  4L18 B;  1S72 I;  2CWE A;  2JSP A;  5J1U A;  2X4H A;  2HYG D;  2OQG A;  1FMW A;  1F4K A;  1MJA A;  4L5E A;  2M45 A;  4RLF A;  3I64 A;  2L5Q A;  2LBF A;  1RPW A;  2WAE A;  2R7D A;  3K4J A;  3ZQI A;  4IZZ A;  2Y0M A;  1Y6I A;  2ESN A;  1F5T A;  2CW8 A;  1MBK A;  5BPI A;  1WCM J;  3HRT A;  1MKM A;  1X3U A;  1S5L C;  2JN6 A;  5AIQ A;  1QHG A;  2A69 F;  2K27 A;  2QA4 I;  1Y56 A;  3FM5 A;  2PQ8 A;  1XC5 A;  1YE9 A;  2QQ9 A;  2B63 J;  2O3F A;  4MFD A;  2YUS A;  3WTU C;  3HC7 A;  4HW0 A;  4M3G A;  2X6Y A;  4D7N A;  3HKZ A;  4EEF G;  2JRM A;  1BR4 A;  1S29 A;  5GPC A;  2ID3 A;  3P9C A;  2JJ7 A;  4EJW A;  1WVR A;  4KT5 C;  1SAU A;  2IGN A;  2VQL A;  2ACJ A;  4D5F A;  4HV6 A;  3CUQ B;  4KIG A;  4A3K J;  2JA7 J;  2VBY A;  1RZ4 A;  1WJC A;  5ICC A;  1W1W E;  3LAJ A;  2EJR A;  1MW7 A;  3GZ5 A;  4XLC A;  3OYF A;  2HPM A;  2HS5 A;  2QVO A;  2EFO A;  2L2O A;  3A2K A;  1VQ5 I;  1IRG A;  2XHK A;  4KDP A;  4P55 A;  4DGW B;  4RBO A;  2P0W A;  2UXX A;  3FXL A;  3OYD A;  2KDZ A;  5B1A H;  1O57 A;  4CZZ A;  4XMY A;  1SVL A;  2UUZ A;  3P9I A;  3ZN1 A;  2QEX I;  3U2R A;  2RAE A;  4H4K C;  1DUX C;  2VKH A;  3BR3 A;  3BTI A;  3GLX A;  5J8F A;  1PUF A;  2W25 A;  4ESB A;  2K3P A;  3V8L A;  2HZT A;  3IH2 A;  5IYB J;  2KRC A;  1O3R A;  3ZMZ A;  2JT1 A;  4IPA A;  4E6K G;  4E7I A;  2PMU A;  2VL8 A;  2ME6 A;  1MGT A;  4ZTJ A;  3MKY B;  2R93 J;  3QYF A;  1FMV A;  4MGR A;  1BJZ A;  3RQI A;  3GYH X;  3ZQL A;  3WTY C;  1R71 A;  4KMF A;  2P7V B;  3KE2 A;  4PJL A;  4ON0 A;  4EGY A;  2JSC A;  3SQN A;  3BZC A;  4FX0 A;  5FGM A;  2HDW A;  3WTS C;  5DS9 A;  1ZK8 A;  5KVR A;  1JUP A;  3BC8 A;  3S1R J;  1HXD A;  3ABL H;  3J80 K;  1RR8 C;  2OBP A;  3BR0 A;  4A3J J;  1SAN A;  4B43 A;  1FBQ A;  4LK0 F;  2Y48 A;  2M1B A;  4RAG A;  3ZMD A;  4BY1 J;  4LJZ F;  1RKT A;  4XN3 A;  2LKX A;  1ZR4 A;  2ELJ A;  5EF6 A;  3FXM A;  3LQR A;  5E3M A;  5EZG A;  4HX4 A;  4ZYG A;  3DKW A;  2VPL A;  2NVY J;  4C2M J;  3BJ6 A;  1HW2 A;  3LQQ A;  3EET A;  1IRZ A;  4XRS G;  3G3Z A;  2XGD A;  1R9T J;  1RI7 A;  2WAD A;  3WU1 B;  1IN7 A;  4AIK A;  1AU7 A;  2EBI A;  4BXX J;  2ZME A;  2GBY A;  1S7E A;  3CTA A;  5M3F J;  4IHS A;  2HOT A;  3DXJ F;  1WJE A;  3CC7 I;  4II2 A;  2NXN B;  3SEQ A;  3HZJ A;  4P9U A;  3QP6 A;  3EUH C;  2IJL A;  3IWZ A;  1ETO A;  1VQ8 I;  3CJN A;  3BWG A;  3T8T A;  3ABM H;  2Z2S B;  1FP1 D;  3CCU I;  3TW7 A;  4BL0 B;  2R7T A;  2KKO A;  1GDT A;  4G7Z F;  2MGQ A;  4QTR A;  4FHT A;  5ICF A;  2M4G A;  4AIH A;  3FKI J;  1J2X A;  3HOU J;  2E2J J;  4G8X A;  3BG5 A;  1YTY A;  3QYE A;  1JJ8 C;  4IHX A;  2GOM A;  3GFJ A;  5C4J J;  1X2N A;  3AG3 H;  4Q47 A;  3T1B A;  2GAU A;  5M5W J;  3VB2 A;  1QZY A;  4ZYE A;  2WTE A;  3L2U A;  3DTK A;  2IW5 A;  1D8K A;  4EM2 A;  4DQ2 A;  2XF7 A;  2RKH A;  1W5T A;  4CZC A;  1DP7 P;  2L7F P;  2AHQ A;  1ZN2 A;  3TBI A;  4D9J A;  2L0K A;  3CLO A;  3HB9 A;  5LHI A;  4L5J A;  4FX4 A;  2DDA A;  2VQG A;  1RUN A;  1N75 A;  3JRE A;  2L01 A;  3GZ6 A;  3MWM A;  5CVR A;  2A07 F;  2E36 A;  1SFO J;  3F9K A;  2GXG A;  1FC3 A;  3RSN A;  3KZY A;  4H0E A;  3E6M A;  2HYJ A;  5AIP A;  3H0D A;  2LF8 A;  4ASN A;  2AQE A;  4BY7 J;  2HI3 A;  3CCJ I;  1D1B A;  1GXQ A;  2OZU A;  3I4M J;  5DCM A;  4HZF A;  2Q8K A;  4DBQ A;  3S3O A;  3PNY A;  2UV1 A;  5DUK A;  2BXZ A;  3R6S A;  3OYK A;  3P7N A;  3K6G A;  4PFP A;  3FXJ A;  3V7S A;  1ZG1 A;  1Z1D A;  4F92 B;  1E2X A;  1UJ8 A;  1RIO H;  2WB1 A;  3C7J A;  4RGX A;  1ULY A;  2IBD A;  3F8C A;  3L2W A;  3HHG A;  2EFW A;  4IKF A;  2FX0 A;  1MDM A;  2O7O A;  4XBF A;  6PAX A;  3R60 A;  1Y0U A;  1O3S A;  4BHB A;  2E5N A;  3M3Y J;  4B3A A;  1JHF A;  4UXN A;  1ETW A;  3OYA A;  5J1Y A;  2DA6 A;  2EZK A;  1ZR2 A;  4L9V A;  4FE4 A;  3ZPL A;  2HQN A;  3ZMS A;  5DDG A;  2O6G E;  3KX2 A;  3RPU A;  4AIJ A;  1REP C;  2K86 A;  3HL2 A;  2DMU A;  2ZFU A;  2FMY A;  3GFM A;  4E7L A;  5GPA A;  4FET A;  2K7L A;  2QQ8 A;  3WE3 A;  2FOK A;  4MQV A;  1JI8 A;  4NB5 A;  3PO3 J;  4BE2 A;  2FJ1 A;  2MC4 A;  3N97 A;  4BNC A;  4IX7 A;  3RI4 A;  3LL7 A;  4Q5S F;  3H0G J;  4V2G A;  1B72 A;  4BQA A;  5LGN A;  2KIF A;  3GTO J;  1WPK A;  5KK1 A;  3IAM 2;  4XLH A;  4WCG A;  1SD5 A;  3EYY A;  4BBS J;  2CW7 A;  4NQW B;  3WG9 A;  4CYC A;  5E3L A;  3V4G A;  1TWA J;  4V19 K;  3OYH A;  4U0Y A;  1F36 A;  1XGN A;  3GZN B;  4PCQ A;  2VE9 A;  1G2H A;  3L00 A;  3S16 J;  1T56 A;  1A6Q A;  3HTU A;  1DDN A;  4IHW A;  3ONQ A;  4XLP F;  2XAQ A;  2RRE A;  2PFB A;  2R7R A;  1OLT A;  4F55 A;  5IY5 H;  2ESH A;  1IRX A;  4EV0 A;  4DJA A;  3H5R A;  2CW0 F;  3I56 I;  4LLN A;  2JVH A;  4U0W A;  2QBY A;  4GGG A;  5J8C A;  2XVC A;  1O3Q A;  5DYM A;  3IAS 2;  4LIT A;  4AD9 A;  4BE1 A;  2KRH A;  3OL3 A;  2XRL A;  2QYO A;  2IS6 A;  1OYY A;  1TLH B;  3I5U A;  1X1P A;  1YW8 A;  1HKQ A;  3ELK A;  5EZH A;  3ROU A;  4LFU A;  4MHG A;  3FXR A;  1OYW A;  4NDL A;  3BG7 A;  4IRH A;  2E7W A;  4P96 A;  1XTA A;  1MSF C;  2EQR A;  3HOT A;  1DPR A;  2ME0 A;  4DBR A;  2H27 A;  2DMN A;  1T6S A;  1E0E A;  3IUO A;  2HZD A;  2KPM A;  2ZXH A;  3PIP F;  2BW3 B;  4IJA A;  1SAX A;  4JX6 A;  1UST A;  2R4G A;  1FIP A;  1MH3 A;  1ZGA A;  1K78 B;  5LRS A;  1QHH D;  2DA4 A;  2R7X A;  1HBX G;  2AXL A;  3DU6 A;  2OF7 A;  2R7Q A;  4X6A J;  2AO9 A;  4OWR B;  3HKZ N;  1K6Y A;  3M1E A;  5HS9 A;  5H6R A;  2XV4 S;  1OCC H;  2BYV E;  1GLN A;  4RGR A;  5IOZ A;  4DYC A;  2HYF A;  3OIP A;  5CLS A;  3M4O J;  3PUF A;  5K5O A;  1VQK I;  4I0A A;  1VQO I;  2VON A;  5LGT A;  3WU0 A;  5EEG A;  3HRS A;  2JQ7 A;  5E18 F;  1HDD C;  1WQ2 A;  4HLX A;  4Y33 A;  2MAB A;  3FMQ A;  3VOD A;  3BRO A;  3I4P A;  3Q9V A;  2VC1 A;  2Y0S A;  3BTL A;  4AVZ A;  1B9N A;  1FZP B;  2XPW A;  5A2Q K;  1DP3 A;  1ETK A;  2COM A;  2O8X A;  4MFE A;  4TV7 A;  4ZDL A;  4EAT A;  2QCO A;  2V6C A;  1W5S A;  1MBJ A;  2K5C A;  1RET A;  2OU2 A;  2VI6 A;  4BU2 A;  1ZGJ A;  4JP0 A;  4BKX A;  3KYL A;  3CMM A;  2F5V A;  5F1J A;  5EDN A;  3QPH A;  2RNG A;  2W85 A;  4XSZ F;  4BDY A;  2EZL A;  2A3S A;  3H9Q A;  5M3M J;  4M3B A;  3V42 A;  3CDL A;  4MLO A;  5DD8 A;  3G71 I;  2OJE D;  4AYB A;  2ZJQ F;  2E19 A;  3C18 A;  4JBA A;  1B59 A;  1X3Z B;  4U7B A;  2NAZ A;  4KFC A;  1IXR C;  1MJ9 A;  4E7K A;  2IRF G;  1TP4 A;  3WHB A;  4BH9 A;  2RQP A;  1W5C C;  3CQZ J;  2ZNZ A;  4DW6 A;  1JTY A;  1U5T A;  4OAZ A;  1W7P A;  2Z16 A;  3K69 A;  5B5E C;  3OSG A;  1NHA A;  2K40 A;  2CUE A;  1Y8Q B;  3BG9 A;  1GT0 C;  4WXC A;  2Q1Z B;  5L3G A;  1I50 J;  2LRE A;  2EV6 A;  2FXA A;  2P4W A;  2QSG X;  1WJD A;  1X3W B;  4C3J J;  1TL8 A;  4L5I A;  4BEH A;  3PJR A;  1IN8 A;  3S3N A;  3ULQ B;  3I54 A;  4Y3O A;  2CV2 A;  4UV9 A;  4CGZ A;  3CP8 A;  1ODD A;  1K83 J;  2FEZ A;  1A35 A;  5JVG F;  3DEU A;  2R7S A;  2WC2 A;  2DTZ A;  1B9M A;  2ETH A;  3A1Y A;  3M7G A;  4C3I J;  1GVD A;  3DLA A;  1IF1 A;  3BG6 A;  2XF5 A;  4V2F A;  4E7J A;  1YOV B;  1V54 H;  4DYR A;  5JFR A;  2KJC A;  4CXF A;  1LNW A;  5CVV A;  2PMH A;  3LA3 A;  4B4C A;  3JSO A;  2G0E A;  3DWL E;  1OCP A;  2LTP A;  3VYU B;  2K9L A;  1FSE A;  3FKJ A;  2KJB A;  1AHD P;  3W6K B;  1UG2 A;  2QM3 A;  2KQR A;  4A5M A;  5D5V B;  1Z05 A;  2LLK A;  4QPO A;  2CRG A;  2JUC A;  4MEY F;  4RM2 A;  3VSK A;  1NG7 A;  5FKM A;  4J01 A;  3L1P A;  3DP7 A;  5HDK A;  2OD5 A;  3GTQ J;  2WA0 A;  1A5J A;  4D0P A;  2VKE A;  3F8F A;  3GEZ A;  1R5I D;  1Y1V J;  4PGH A;  5D6E A;  5L3B A;  2LY9 A;  3CUQ A;  2K9M A;  2DU9 A;  3BTJ A;  5KHD A;  4DYQ A;  2HDC A;  2ZXI A;  3ABT A;  3WTZ A;  3J80 Z;  3G4S I;  3RKQ A;  1U2W A;  2XB5 A;  3L2Q A;  1X58 A;  2OCE A;  3LSI A;  4I02 A;  1WZ2 A;  5DM7 F;  3HOX J;  1G3Y A;  1WRJ A;  4ZZD A;  1GUU A;  5H20 A;  1KYZ A;  2FRH A;  3ML6 A;  1DPU A;  1XSV A;  3L7W A;  1U78 A;  1U9N A;  2EFQ A;  4CSW A;  1LDK B;  2PEX A;  4NC8 A;  5HS8 A;  2VJ5 A;  3CJQ B;  2KLO A;  2PN6 A;  3KET A;  1J7K A;  2DT6 A;  2V9K A;  2DOE A;  3TDU C;  3NAR A;  2EB7 A;  2V4J C;  3KP6 A;  2V1X A;  3FM3 A;  2W24 A;  3OYJ A;  1Z77 A;  4XLE A;  2ZBK A;  4EJO A;  3JCU C;  3IRQ A;  2E2I J;  4XKW A;  5LHH A;  3U1D A;  2H09 A;  3JRA A;  2QQB A;  1W36 C;  2PJR B;  4GFB A;  2Y69 H;  2M3A A;  2WV1 A;  4HNV A;  2XAJ A;  1ITY A;  3KZI C;  4AID A;  1FOX A;  1ZTR A;  4KYW A;  1G3W A;  1G8X A;  5LHG A;  3NQO A;  1TQP A;  3O8H A;  2MW8 A;  2HNH A;  4ZYD A;  1I6H J;  2OTJ I;  1A6I A;  3I3L A;  3CZ6 A;  2CU7 A;  1ZH5 A;  2M0C A;  4QPQ A;  2QKL B;  2VOO A;  2RDP A;  2VQH A;  3QRF F;  2HQ5 A;  3QU6 A;  2NS0 A;  1XCB A;  1HSJ A;  1DGR M;  3CCL I;  1PUE E;  2VB6 A;  1T08 B;  1KU3 A;  3BCA A;  4HV5 A;  5K5Q A;  3G6E I;  4RM3 A;  3D0S A;  4HA8 A;  4LOC A;  4Y15 A;  2GZW A;  1BBY A;  2DT5 A;  3ERM A;  3K9T A;  4O5V A;  5LFA A;  5JI6 A;  2XSJ C;  2Q0O A;  3GUD A;  2B9S A;  3S1Q J;  3C2G A;  1HW1 A;  2CUF A;  2ELK A;  2OV7 A;  1HA8 A;  4L0Y B;  2X6O A;  2JTV A;  1KQ8 A;  2FQ3 A;  2W00 A;  1XGM A;  3TDZ C;  4F3Q A;  1KA8 A;  2VQC A;  4RAZ A;  4WK8 F;  3PFI A;  3MN2 A;  2DXI A;  2RGV A;  5F64 A;  3ERE D;  4HBL A;  2M7B A;  3IC7 A;  2BOL A;  2KZG A;  4P5O A;  1LFB A;  2QQA A;  2FNA A;  3GTL J;  4P1W A;  2GOX B;  3JRI A;  4DNC A;  3D5R C;  3SDG A;  2IT0 A;  4Y7N J;  5M5Y J;  1ETY A;  4KA4 A;  5BNG A;  2X1E A;  4KNY A;  1GV2 A;  3ZQH A;  1E17 A;  3QOE A;  3N4M A;  4B44 A;  5CYV A;  1WJ5 A;  4Z6Y A;  1A36 A;  3RDI A;  3FXK A;  4IHY A;  2R5Z B;  2Z5U A;  2WV0 A;  3AKZ A;  3LAP A;  2VJI A;  3PSI A;  4G12 A;  2RVC A;  4MQ9 F;  4OIP F;  3MQ0 A;  2HWV A;  1UHW A;  2X0L A;  1XB4 A;  4ESF A;  4XN0 A;  4PK4 A;  2HR3 A;  2GM4 A;  3JRG A;  1UCR A;  1Z3Y A;  1PP7 U;  2R0Q C;  2RQQ A;  4HSR A;  3CCS I;  2IVM A;  1WFX A;  1QO0 D;  3E6D A;  5F0C A;  1EF4 A;  5ILS A;  1S9H A;  5CJ9 A;  5D6F A;  2CUJ A;  4XR6 A;  4HRI A;  3SDB A;  3HHH A;  5J40 A;  2LKP A;  1DGW Y;  4ZJZ A;  3DBL B;  3OL4 A;  3DV8 A;  3OOP A;  3F8B A;  2PJP A;  2E35 A;  2PX9 A;  1SFE A;  4ITV A;  1DQU A;  1P4X A;  5C44 J;  5F0H A;  4C2U A;  4G7O F;  3RTR A;  4YEL A;  5F04 A;  4B8X A;  4UV8 A;  2R7F A;  3OR2 C;  2L4A A;  2HPI A;  5IP9 J;  4XOT A;  4U87 A;  5IYD J;  1D0Z A;  3H5N A;  3IP4 B;  1IW7 F;  1YRN B;  4PJJ A;  4A6D A;  3TMO A;  1J09 A;  1IDY A;  4A3M J;  3G2B A;  3DU5 A;  1IXC A;  5F1R A;  3OY9 A;  1O7F A;  2V26 A;  2BHY A;  2W48 A;  2Y9Z A;  4G6T B;  1M1E B;  2CFO A;  5KAI C;  4Y13 A;  2FOW A;  2DOA A;  1U6G A;  5ICE A;  3AL0 C;  4HF0 A;  4CCJ A;  2IAI A;  2DFI A;  5L3C A;  3W6V A;  2K85 A;  5CKT A;  1ORK A;  1X1B A;  5F0F A;  2ISZ A;  3S2W A;  2Y0S N;  2DN0 A;  4XM3 A;  4OIR F;  3B6C A;  5J47 A;  2W7N A;  1CGP A;  2ZCW A;  9ANT A;  2JWT A;  2DA5 A;  2QKM B;  3VYR B;  5H2F C;  3ASN H;  2CQN A;  2PG4 A;  2CYY A;  2ISY A;  1WH7 A;  4YRV A;  1ZRC A;  4HDV A;  4LIU A;  4D7M A;  2D45 A;  2DAO A;  1YIJ I;  4KJZ A;  1H88 C;  5EGO A;  2IA0 A;  1IO2 A;  3DKX A;  3MAJ A;  3F6V A;  3CME I;  2HXO A;  3V7R A;  2HKO A;  2XAH A;  5E1Z B;  3M07 A;  5HOD A;  4WWC A;  3ECO A;  3HOW J;  2L7K A;  1K4S A;  2FF4 A;  3ZQC A;  4OMY A;  2P6T A;  4NQW A;  4RGU A;  3RCO A;  1FY7 A;  3F0C A;  2MA3 A;  2WWY A;  1ACI A;  4XRM A;  1LUJ B;  5BQT A;  1TT5 B;  2O03 A;  2VN2 A;  2ZME C;  1QU3 A;  2ZNY A;  3LSG A;  5HNF A;  1FEX A;  3H9G A;  4XID A;  4PUS A;  1OR7 A;  4MTD A;  3WTV C;  1Y0N A;  2DK5 A;  3LSH A;  3TO6 A;  1ZKG A;  4I98 B;  1POG A;  1A04 A;  2MBF A;  3W3C A;  4LGW A;  1X1D A;  5E8G A;  3HUG A;  4WX9 A;  1S8N A;  2EIK H;  5CVU A;  4QWQ A;  2ZFW A;  1ZGW A;  1XCV A;  5DEQ A;  2H94 A;  2EIL H;  4S0H B;  4I2O A;  2L9R A;  4M72 A;  1DU0 A;  1FYL A;  3DCF A;  1OPC A;  2DK8 A;  3K4L A;  3CP2 A;  1HKS A;  3K4M A;  5KAF C;  1OCZ H;  3FIS A;  2HKX A;  5JHF A;  3GWZ A;  1UHM A;  3KFW X;  5A2Q Z;  2L9N A;  3QAH A;  2E2H J;  5J6X A;  5FFX A;  4HLY A;  3P5J A;  2FQ4 A;  2LF7 A;  3A03 A;  4HDU A;  4A12 A;  3MFK A;  3F3X A;  2BW3 A;  2UWM A;  3FWE A;  4RGS A;  1TWC J;  2EZH A;  3HGY A;  3PNV A;  4ZYH A;  4M3F A;  3WU2 C;  3DPL C;  2RN7 A;  4XLF A;  5B3S H;  1K78 A;  3B02 A;  3E6C C;  2WY7 Q;  1JXS A;  2LVS A;  3OMY A;  1W0T A;  1LVA A;  2A61 A;  3L2C A;  1I39 A;  4NC7 A;  3SEZ A;  3LNQ A;  3JW4 A;  4JX5 A;  1JGG A;  1OCT C;  1XD7 A;  2XAS A;  4ZDP A;  4RS8 A;  4QIW N;  2RC4 A;  1BN5 A;  2VUM J;  3HBL A;  5K7H A;  3HOS A;  2P5V A;  1BA5 A;  2LK2 A;  3KIO A;  3S3M A;  3K4C A;  1R4M B;  3IL2 A;  4MEX F;  2HDD A;  3O3K A;  1HDP A;  2GA1 A;  3SZP A;  3CO6 C;  3PFY A;  3RYR A;  1ERD A;  1QNT A;  1RC9 A;  1MND A;  2GQQ A;  3FX3 A;  2P5K A;  2QGU A;  3K1M A;  4DIQ A;  3KCC A;  3A02 A;  4OIN F;  3OOU A;  1K61 A;  2H8R A;  3MVP A;  2DYS H;  4RAY A;  2VT3 A;  4PGG A;  1JUS A;  3DEE A;  1P9Q C;  1IV6 A;  3JR9 A;  3G73 A;  3OYG A;  2LY2 A;  3LFU A;  3CC2 I;  3IKT A;  4S04 A;  2Y75 A;  4KIF A;  4NBQ A;  1OJL A;  3JAM K;  2G7H A;  1LE8 B;  1APL C;  2VIX A;  1XPX A;  4C9Y A;  2V1D A;  1BIA A;  4BHP A;  4A3D J;  5FRM A;  2X51 A;  4EJT A;  2Q2E A;  3ZQF A;  3HEF A;  4HX8 A;  4X0G A;  2HU9 A;  3NEU A;  2X1D A;  3S15 J;  4LD5 A;  2L54 A;  1HW5 A;  3PIO F;  4A3E J;  1DU6 A;  2I10 A;  2HEO A;  4YG2 F;  3P9K A;  2O61 A;  3LSK A;  2GXB A;  3ZMV A;  4UVA A;  3EUH A;  5HLI A;  2FBH A;  5DUI A;  3K70 D;  5E17 F;  2BVL A;  4XLA A;  4BQQ A;  3A01 A;  1BIB A;  3MEX A;  2HTS A;  3MZ8 A;  5TGT A;  3SXY A;  3MKL A;  4M74 A;  3MZY A;  3LSR A;  1K6O A;  3JRD A;  3M8F A;  2NS8 A;  4AM3 A;  1ZRD A;  4BS9 A;  4FT8 A;  3FHZ A;  2AS5 F;  1BW5 A;  4PJM A;  4CCO A;  2XGX A;  1T0F C;  3EYI A;  3RZD J;  1CQT A;  2CV1 A;  5GP9 A;  1YIO A;  5FRO A;  5LGU A;  2W84 A;  5TJJ A;  2OUM A;  5E1X A;  2IP2 A;  1TTY A;  1VI0 A;  1WI3 A;  4PDK A;  2ZO4 A;  5D8L B;  5LRR A;  2EIN H;  3ZXS A;  4BDZ A;  3LA2 A;  3M1C A;  4BQN A;  3J81 Z;  3CMA I;  2I8D A;  1YX3 A;  3QP5 A;  2WAF A;  3BPX A;  2LG4 A;  3V7C A;  2IXS A;  3H92 A;  4BUP A;  1TW2 A;  4S05 A;  3HSR A;  5BMZ A;  5FO5 A;  1MJB A;  1LFU P;  3BZK A;  4EM0 B;  1KU9 A;  2X85 A;  3OV8 A;  3IKV A;  3DPT A;  3RPU D;  4BAC A;  5EYR A;  5IT9 K;  1K79 A;  4AC0 A;  2JZY A;  3CMY A;  2LH9 A;  1EV7 A;  2LRD A;  2OCC H;  1YJ9 I;  3REO A;  4GXO A;  3CO7 C;  1H8A C;  5FKL A;  1H9T A;  2F6C A;  3Q0U A;  2KIM A;  2EPF A;  4M9X A;  5HDN A;  2B0L A;  4M6X A;  1XGS A;  1S6L A;  1Z3X A;  3AL0 B;  2L02 A;  2G7U A;  2Z9O A;  1B8I B;  3BJA A;  4HPQ A;  3R0J A;  3WTT C;  1VQL I;  2P5L C;  5JVT A;  2V1U A;  1QQI A;  1SD7 A;  5J3L A;  1KU2 A;  3WOD F;  2KDO A;  1SVM A;  2NNN A;  2VT2 A;  1L0O C;  1SFU A;  2BY1 A;  2XKP A;  4KT6 A;  4I09 A;  4I99 C;  5F08 A;  2PI0 A;  1IN5 A;  2JUG A;  4Y4R A;  1VQ6 I;  3EDP A;  5C4X J;  2K9N A;  3L2V A;  3RKX A;  2Z3Y A;  2F4M B;  1Y8R B;  3KPH A;  3X2Q H;  1Z67 A;  1WJF A;  1BI0 A;  2K9S A;  5J1R A;  2A05 A;  1SMY F;  2Y31 A;  3JSP A;  1XS9 A;  1TNS A;  2CFX A;  3E7L A;  4UHT A;  4A3L J;  1J9I A;  2VJ4 A;  4GYG A;  3HJE A;  1VF9 A;  2KP6 A;  3O6B B;  2HFH A;  3GFL A;  3GCM A;  1E3H A;  2A68 F;  2ZC2 A;  4W97 A;  3RIR A;  5GTI C;  1JTX A;  2WAQ A;  1LJ9 A;  5JLX A;  2CJJ A;  5GAG J;  4XON A;  4FE7 A;  4FCY A;  2K4J A;  4BXF A;  2KIU A;  4XKB A;  1BR1 A;  2VBZ A;  4MO7 A;  1EH6 A;  1X19 A;  3VPR A;  4AU7 A;  1HKT A;  2FA5 A;  2DPU A;  4UUV A;  3F22 A;  3KP2 A;  1XX5 A;  5FKK A;  2V9P A;  4KMU X;  3OYE A;  1R22 A;  1S3J A;  4DOZ A;  1HQC A;  3FF5 A;  3OS0 A;  4C2T A;  1MBE A;  2XAF A;  1R4N B;  2IA1 A;  4LLG F;  2GXA A;  1FT9 A;  4BE0 A;  5FB2 A;  3TP0 A;  1V5G A;  5DM6 F;  2A6E F;  3KP7 A;  4E7Z A;  3RJP A;  1H89 C;  5DD4 A;  4ENM A;  1JT6 A;  4BBR J;  2BBY A;  4UB8 C;  1YJN I;  1PDN C;  4YFK F;  2E34 A;  4HAM A;  2L7M P;  4CH7 A;  5ILU A;  2XPU A;  3DBH B;  2IA2 A;  5BS6 A;  4U0V A;  3TP3 A;  2F5D A;  3GME A;  1P4W A;  1RNL A;  1X4P A;  2IS4 A;  2HXI A;  2R5Z A;  2J5O A;  1ZLJ A;  1IRF A;  3LSP A;  4RAF A;  3QPS A;  1Y1W J;  1AA7 A;  3K2A A;  3QOD A;  2DPD A;  4PJ0 C;  3I59 B;  1IV8 A;  2Z33 A;  2DO7 A;  4E70 A;  2WY8 Q;  2X6W A;  3LSM A;  1WJB A;  1BM9 A;  1JUM A;  3D1N I;  2JVG A;  1JGS A;  3JRB A;  2DI3 A;  2H8W A;  4IVN A;  4XOR A;  1EH8 A;  4UUT A;  1ZG3 A;  3OYM A;  4R1H A;  2QEN A;  5IT3 A;  3J7A Y;  1FBU A;  1YJW I;  2HQR A;  4XNF A;  5HOO A;  4UY8 I;  2E1M C;  2OPT A;  2MLK A;  2X6X A;  3ISP A;  1R6R A;  2ECB A;  1R5G A;  1W7P D;  2JK3 A;  3QWL A;  1YX5 A;  4Q48 A;  3F21 A;  2VJJ A;  3UKG A;  4AUX A;  3H5A A;  1JKO C;  1IXS B;  4N4N B;  3KLO A;  2KL4 A;  2DW4 A;  3DQV C;  1NG6 A;  2M30 A;  1P6R A;  4UVB A;  1I5Z A;  5LBQ A;  4YIF A;  5D5X B;  3ZOB A;  5F27 A;  4PJN A;  1YRN A;  3RQ4 A;  2K4B A;  1RKW A;  1Q1V A;  5JHU A;  5K7F A;  3EQL F;  4HOB A;  5CVI A;  4LB5 A;  3HPH A;  5L3D A;  1FLI A;  3AG1 H;  2NRA C;  1TQI A;  2KHM A;  1G3S A;  3CJT B;  1AKH B;  4B3X A;  3KEY A;  4KIC A;  4JQF A;  1QVU A;  3QPT A;  3Q0V A;  2X9D A;  1ZAO A;  3MCZ A;  3C1D A;  2VXD A;  4IOA F;  3WTX C;  3CCV I;  3PNT A;  1YI2 I;  1LPQ A;  4EGZ A;  1XMK A;  4HF2 A;  3E1S A;  1U8B A;  4KIB A;  2VC0 A;  1EH7 A;  3K4N A;  1WHU A;  3O8G A;  1R1V A;  1BI3 A;  3F8M A;  2E1O A;  3IHU A;  2HVS A;  3BY6 A;  4RB0 A;  2HVQ A;  4E4H A;  1FYM A;  3OWT A;  1YO5 C;  2CQ7 A;  3GLL A;  4A69 C;  3J7Z I;  3GTK J;  3WGI A;  1B6A A;  1EKE A;  1SFX A;  4K2E A;  3E5X A;  3I55 I;  4F7Z A;  3H36 A;  1R58 A;  3W2A A;  2E5Z A;  4HST A;  2DFF A;  1JE8 A;  1F43 A;  1MNM C;  4FTH A;  1D1C A;  2BHZ A;  2GWR A;  4IL6 C;  4O6J A;  4M6V A;  2LC2 A;  2EA2 A;  3BPV A;  1Y39 A;  4YFX F;  1SMT A;  3E5Q A;  3HM5 A;  1F1Z A;  3E6B A;  1VZ0 A;  1BW6 A;  5K7Z A;  2KRF A;  4KN7 X;  3GFI A;  2Y30 A;  2WB1 N;  3OIQ A;  3RKY A;  1U9O A;  1N25 A;  1ETQ A;  4MNU A;  2ZXJ A;  3K2Z A;  2R7W A;  3W2W A;  2HOA A;  2MFZ A;  3FK6 A;  4G94 A;  2E1N A;  1BI2 A;  1X2M A;  4LK1 F;  4XLN F;  4HYE A;  2M4K A;  4KN4 X;  4A5N A;  4N9I A;  4U7D A;  1D0X A;  2L3D A;  2ICW G;  4ZH4 F;  1XDU A;  2JA5 J;  2HOE A;  1WI9 A;  2VOD A;  1D0Y A;  4NUB A;  1FP2 A;  2IS1 A;  1UZC A;  3FMS A;  2F2E A;  3DPU A;  2ECC A;  2CG4 A;  1MMD A;  4NNJ A;  4A2U A;  3BJO A;  1ETV A;  3H3U A;  2A5W A;  2YS9 A;  3H3V K;  1ZRE A;  4WF2 A;  1T95 A;  2JRT A;  2DT7 B;  3U21 A;  1ZLK A;  2NYX A; 
#chains in the Genus database with same CATH homology
 1P2F A;  3TO7 A;  4EJV A;  2F5C A;  5L3F A;  4Z2Y A;  1P92 A;  3Q9S A;  4HX7 A;  1ZYR F;  3TOA A;  1YLF A;  2EWN A;  3JAM Z;  5LLQ A;  3Q5F A;  1SD4 A;  2D1H A;  5FD6 A;  2ELH A;  5ERI A;  2M8E A;  4L0Z B;  2J5P A;  4ENN A;  1R00 A;  4G7H F;  5D4R A;  4JK1 X;  1YS7 A;  2NNY A;  3I0T A;  3I53 A;  4IF4 A;  3MZH A;  4RB2 C;  3H3Z A;  3E97 A;  2R3S A;  1MZB A;  3ZP5 A;  3CDH A;  2DTR A;  1T39 A;  4M6Y A;  2DBB A;  4N0B A;  5D8K B;  1IUY A;  4ETS A;  4L9T A;  4M71 A;  4LG0 B;  3JTG A;  5E1W A;  1OYI A;  1LEB A;  3AAF A;  3D5L A;  2MLG A;  3I58 A;  3RKW A;  4OOI A;  1IZ1 A;  2STW A;  1BJA A;  1R1U A;  2L4M A;  1TQM A;  3ECH A;  4CDG A;  1XMA A;  3QU3 A;  3R4K A;  1FX7 A;  1CF7 B;  2A6H F;  5IT9 Z;  2DQL A;  3M8E A;  3PQK A;  1P4A A;  2Z99 A;  4A6E A;  2CGP A;  1QBJ A;  2QWW A;  1FBS A;  5LEJ A;  4KUM A;  3SFZ A;  2EA4 A;  3WGG A;  4OIQ F;  1Z91 A;  3DFG A;  3I71 A;  3T0Y A;  4Q4Z F;  1J0R A;  1R5H A;  3ZMU A;  2QZ8 A;  1GHC A;  4Y17 A;  4IRG A;  1K7A A;  1FNN A;  2H6B A;  1TW3 A;  1C0W A;  3GVA A;  2RNJ A;  4A0Y A;  4GCV A;  1FWZ A;  1STZ A;  1Q1H A;  1FPQ A;  5DV5 A;  1YQA A;  2YR2 A;  4ENJ A;  1LB2 A;  5ICG A;  1U3E M;  2OQR A;  4B09 A;  4EM1 A;  1Z6R A;  1ZHF A;  4LB6 B;  5LEK A;  1U8R A;  2YU3 A;  2MC3 A;  3W6J B;  2EK5 A;  3F23 A;  4A0X A;  4BHC A;  2LDU A;  1Z9C A;  1F9N A;  5BOX A;  1T98 A;  2VXZ A;  1XSD A;  4UVC A;  1YG2 A;  1ON2 A;  5FD5 A;  3L9F A;  5D5U B;  2BEO A;  1LQ1 A;  2EV5 A;  1I1G A;  1G4D A;  4IHT A;  2A5Y B;  3LA7 A;  4G6Q A;  3ABU A;  2XUB A;  2RV8 A;  3KEQ A;  3HRU A;  3L09 A;  1YW9 A;  3COA C;  4ZZL A;  3T8R A;  3VOE A;  4HQE A;  1R36 A;  2P6S A;  2XRN A;  4CO8 A;  4M9S A;  5L3E A;  1Z6T A;  4L9J A;  3RYP A;  3TGN A;  3HSE A;  1G3T A;  1ZAR A;  1H9G A;  3KP5 A;  2BV6 A;  1YW7 A;  1BC8 C;  3E3V A;  3BP8 A;  1YS6 A;  4M9Z A;  3IWF A;  4YFN F;  2YPR A;  2PBI A;  2MH9 A;  5HS7 A;  1YFH A;  5ILV A;  2FBK A;  3SZT A;  4I7H A;  1J5Y A;  3I59 A;  4XSX F;  2C6Y A;  4EQQ A;  3CUO A;  2YSR A;  1R1T A;  2LSO A;  4BXU A;  2TDX A;  4P9F A;  1V4R A;  1QPM A;  5FLX K;  3PQJ A;  1I6X A;  2F5E A;  2IPQ X;  2HTJ A;  4HQM A;  5CVJ A;  1RUO A;  3LWF A;  5ED4 A;  3R61 A;  1GVJ A;  4CIC A;  4IXA A;  3KP4 A;  1IN6 A;  1B4A A;  2P8T A;  2FBI A;  2CO5 A;  4BYY A;  1WWX A;  2VBX A;  3ZQ7 A;  4I01 A;  4LLL A;  1T38 A;  3BZ6 A;  2XAG A;  1KGS A;  1G6N A;  4YII A;  4LMY A;  2GIV A;  2GA2 A;  5HLG A;  1XN7 A;  3WGH A;  1W4M A;  2XKO A;  3K0L A;  3R0A A;  2YX4 A;  4GO1 A;  1ON1 A;  2UXN A;  3WTW C;  1USS A;  3E5U A;  2UZK A;  5E8I A;  3U9G A;  2EV0 A;  2CQK A;  2M5W A;  1T0F A;  3BOQ A;  5TRD A;  2FSW A;  1R7J A;  1FSH A;  1KU7 A;  4CHU A;  2D2W A;  5F6F A;  3DF8 A;  3F72 A;  1IAW A;  2FE3 A;  4RB3 C;  1U5T C;  3V8K A;  4QLC U;  1ZRF A;  3HYI A;  5JR3 A;  1S7A A;  2ZME B;  4OU0 A;  4OMZ A;  2XIG A;  3J7A O;  4PZJ A;  5D4S A;  3QOP A;  4CYD A;  3GF2 A;  4NHJ A;  5HLH A;  3TOB A;  3IRR A;  1OKR A;  2FML A;  4R79 A;  1ZG5 A;  3LFK A;  1XSX A;  2JPC A;  4EVI A;  1OMI A;  3FZV A;  1YYV A;  2OZ6 A;  2V9V A;  3F8N A;  1QGP A;  2EFN A;  5K1Y A;  1LDJ A;  5FFZ A;  1FOK A;  2PLY A;  4XRF A;  4O3M A;  1KYW A;  3GX4 X;  3C3W A;  1LDD A;  2MH2 A;  1O7L A;  5EEH A;  2BE5 F;  5HDG A;  4GYI A;  5H6Q A;  3VEP A;  3TKY A;  5DCM B;  1T2K A;  5DCF A;  3CUQ C;  4AVP A;  2VE8 A;  1PP8 F;  2E1C A;  3GO5 A;  2M87 A;  2VOP A;  1SD6 A;  4G6D A;  4U88 A;  3WE2 A;  3ZMT A;  4LG0 A;  3B73 A;  1J59 A;  2P7C B;  1MDM B;  2DLL A;  1TNT A;  4M73 A;  1BI1 A;  4A0Z A;  5BPD A;  3M9A A;  3K1P A;  3NRV A;  4WXD A;  4R8H A;  1V3F A;  1J75 A;  1LEA A;  3FXQ A;  2D1V A;  3T5X A;  5D5W B;  5HVQ C;  1GXP A;  1CF7 A;  1XDS A;  2K02 A;  2VBW A;  4I0B A;  1D8J A;  1UB9 A;  3KLN A;  3HIF A;  3HTS B;  3V8J A;  2FNP A;  3RPQ A;  4EMS A;  1VTN C;  2ZKZ A;  3TQN A;  3VFZ A;  1KQ9 A;  1WSU A;  2QBY B;  2O0Y A;  1MD0 A;  3LST A;  3FMR A;  2H6C A;  1I1S A;  3F6O A;  5K5R A;  4G9Y A;  1H0M A;  1B1B A;  4UNO A;  3J81 K;  1Z7U A;  2W57 A;  2V79 A;  1AWC A;  1HST A;  4EJU A;  1BC7 C;  3HRM A;  2MD5 A;  1L3L A;  2ZJ2 A;  2DQR A;  3TO9 A;  2G9W A;  1ONV A;  1TBX A;  4BAY A;  3GXO A;  3JTH A;  4WXH A;  2OA4 A;  4L9N A;  3K1N A;  2F5F A;  4ESJ A;  3O2P E;  2EFP A;  1D3Y A;  1AOY A;  1UFM A;  1QZZ A;  2HGC A;  2QUF A;  1BOA A;  1I27 A;  4AWX B;  3KP3 A;  2LNB A;  4ENK A;  3GW2 A;  3HSF A;  3KZZ A;  2E7X A;  3SHF A;  1S7O A;  4RB1 A;  2OAZ A;  2ADU A;  2FU4 A;  1FYK A;  1R23 A;  1KQ0 A;  1O3T A;  2CSO A;  1D5V A;  2QLZ A;  1U5T B;  1W7P B;  3BDD A;  3ZN0 A;  4HF1 A;  3KEO A;  1JHH A;  1IN4 A;  5FLX Z;  5E20 A;  4MTE A;  4OIO F;  1XGO A;  4N9H A;  1WKM A;  2YX7 A;  4IRI A;  3FXU A;  2BGC A;  2STT A;  2XRO A;  2JPB A;  5AON A;  4L18 B;  2CWE A;  2X4H A;  2HYG D;  2OQG A;  1F4K A;  1MJA A;  2M45 A;  3I64 A;  2R7D A;  2Y0M A;  2ESN A;  1F5T A;  5BPI A;  3HRT A;  1MKM A;  1X3U A;  5AIQ A;  2A69 F;  2K27 A;  3FM5 A;  2PQ8 A;  2QQ9 A;  2O3F A;  3WTU C;  4HW0 A;  1S29 A;  3P9C A;  4EJW A;  4KT5 C;  2ACJ A;  4HV6 A;  3CUQ B;  4KIG A;  2VBY A;  1RZ4 A;  5ICC A;  3LAJ A;  2EJR A;  3GZ5 A;  2HS5 A;  2QVO A;  2EFO A;  1IRG A;  2XHK A;  4KDP A;  4P55 A;  2UXX A;  1O57 A;  4CZZ A;  3P9I A;  3ZN1 A;  3U2R A;  1DUX C;  3GLX A;  5J8F A;  2W25 A;  4ESB A;  3V8L A;  2HZT A;  1O3R A;  3ZMZ A;  2JT1 A;  4IPA A;  2PMU A;  1MGT A;  4MGR A;  3GYH X;  3WTY C;  4KMF A;  2P7V B;  3KE2 A;  4ON0 A;  4EGY A;  2JSC A;  3SQN A;  4FX0 A;  5FGM A;  3WTS C;  5KVR A;  1HXD A;  3J80 K;  2OBP A;  1FBQ A;  4LK0 F;  2Y48 A;  2M1B A;  3ZMD A;  4LJZ F;  3LQR A;  4HX4 A;  4ZYG A;  3DKW A;  3BJ6 A;  1HW2 A;  3LQQ A;  3EET A;  3G3Z A;  1RI7 A;  3WU1 B;  1IN7 A;  4AIK A;  2ZME A;  3CTA A;  4IHS A;  3DXJ F;  4P9U A;  3QP6 A;  2IJL A;  3IWZ A;  3CJN A;  3BWG A;  3T8T A;  1FP1 D;  2KKO A;  4G7Z F;  4FHT A;  5ICF A;  4AIH A;  1J2X A;  4G8X A;  1YTY A;  3GFJ A;  4Q47 A;  3T1B A;  2GAU A;  3VB2 A;  1QZY A;  4ZYE A;  2WTE A;  2IW5 A;  1D8K A;  4EM2 A;  4DQ2 A;  2RKH A;  1W5T A;  1DP7 P;  1ZN2 A;  3CLO A;  5LHI A;  4FX4 A;  4L5J A;  1RUN A;  2L01 A;  3GZ6 A;  3MWM A;  5CVR A;  2A07 F;  2GXG A;  1FC3 A;  3KZY A;  4H0E A;  3E6M A;  5AIP A;  2LF8 A;  4ASN A;  1GXQ A;  2OZU A;  5DCM A;  4HZF A;  2Q8K A;  5DUK A;  3R6S A;  3P7N A;  3V7S A;  1ZG1 A;  1Z1D A;  1E2X A;  1RIO H;  3C7J A;  4RGX A;  1ULY A;  3F8C A;  3HHG A;  2EFW A;  1MDM A;  4XBF A;  6PAX A;  3R60 A;  1Y0U A;  1O3S A;  4BHB A;  1JHF A;  4UXN A;  4L9V A;  3ZPL A;  2HQN A;  3ZMS A;  5DDG A;  2O6G E;  3RPU A;  4AIJ A;  1REP C;  2K86 A;  2FMY A;  3GFM A;  2K7L A;  3WE3 A;  2FOK A;  4MQV A;  4NB5 A;  3N97 A;  4BNC A;  3RI4 A;  4Q5S F;  4BQA A;  5LGN A;  2KIF A;  5KK1 A;  4WCG A;  1SD5 A;  3EYY A;  3WG9 A;  3V4G A;  4U0Y A;  1XGN A;  4PCQ A;  2VE9 A;  3L00 A;  1DDN A;  3HTU A;  4XLP F;  2XAQ A;  2PFB A;  2ESH A;  4EV0 A;  2CW0 F;  4LLN A;  4U0W A;  2QBY A;  4GGG A;  5J8C A;  2XVC A;  1O3Q A;  5DYM A;  4AD9 A;  2QYO A;  1OYY A;  1TLH B;  3I5U A;  1YW8 A;  1HKQ A;  3ELK A;  3ROU A;  4LFU A;  4MHG A;  3FXR A;  1OYW A;  4IRH A;  2E7W A;  4P96 A;  3HOT A;  1DPR A;  2H27 A;  1T6S A;  4IJA A;  1SAX A;  1UST A;  1ZGA A;  1K78 B;  5LRS A;  1HBX G;  2AXL A;  3M1E A;  5HS9 A;  5H6R A;  2XV4 S;  2BYV E;  4RGR A;  2HYF A;  5CLS A;  5K5O A;  4I0A A;  2VON A;  5LGT A;  3WU0 A;  5EEG A;  3HRS A;  5E18 F;  1WQ2 A;  4HLX A;  3FMQ A;  3VOD A;  3BRO A;  3I4P A;  3Q9V A;  2VC1 A;  1B9N A;  1FZP B;  5A2Q K;  2O8X A;  2COM A;  4TV7 A;  2V6C A;  1W5S A;  2OU2 A;  1ZGJ A;  3QPH A;  2W85 A;  4XSZ F;  2A3S A;  5DD8 A;  3C18 A;  4JBA A;  1B59 A;  4U7B A;  2NAZ A;  4KFC A;  1IXR C;  1MJ9 A;  2IRF G;  4BH9 A;  2RQP A;  2ZNZ A;  1U5T A;  1W7P A;  3K69 A;  1NHA A;  4WXC A;  5L3G A;  2EV6 A;  2FXA A;  2P4W A;  4L5I A;  1IN8 A;  3ULQ B;  3I54 A;  4UV9 A;  4CGZ A;  1ODD A;  2FEZ A;  3DEU A;  2WC2 A;  1B9M A;  2ETH A;  3M7G A;  1IF1 A;  5JFR A;  2KJC A;  4CXF A;  1LNW A;  5CVV A;  2PMH A;  3LA3 A;  3JSO A;  1FSE A;  2KJB A;  3W6K B;  2QM3 A;  4A5M A;  5D5V B;  1Z05 A;  4MEY F;  3DP7 A;  5HDK A;  2OD5 A;  4D0P A;  3F8F A;  3GEZ A;  4PGH A;  5D6E A;  5L3B A;  3CUQ A;  2DU9 A;  2HDC A;  3ABT A;  3WTZ A;  3J80 Z;  1U2W A;  4I02 A;  1G3Y A;  1WRJ A;  4ZZD A;  5H20 A;  1KYZ A;  2FRH A;  3ML6 A;  1DPU A;  1XSV A;  3L7W A;  1U78 A;  2EFQ A;  1LDK B;  2PEX A;  5HS8 A;  2PN6 A;  3KET A;  1J7K A;  3TDU C;  2EB7 A;  3KP6 A;  2V1X A;  3FM3 A;  2W24 A;  2ZBK A;  4EJO A;  3IRQ A;  5LHH A;  3U1D A;  2H09 A;  2QQB A;  2XAJ A;  4KYW A;  1G3W A;  5LHG A;  3NQO A;  4ZYD A;  1TQP A;  1ZH5 A;  2VOO A;  2RDP A;  3QRF F;  3QU6 A;  2NS0 A;  1XCB A;  1HSJ A;  1PUE E;  1KU3 A;  4HV5 A;  5K5Q A;  3D0S A;  4HA8 A;  4Y15 A;  2GZW A;  1BBY A;  2DT5 A;  3K9T A;  4O5V A;  5JI6 A;  2Q0O A;  3GUD A;  1HW1 A;  4L0Y B;  2JTV A;  1KQ8 A;  2FQ3 A;  1XGM A;  3TDZ C;  1KA8 A;  4RAZ A;  4WK8 F;  3PFI A;  2RGV A;  5F64 A;  3ERE D;  4HBL A;  3IC7 A;  4P5O A;  2QQA A;  2FNA A;  4DNC A;  2IT0 A;  4KA4 A;  4KNY A;  1E17 A;  3N4M A;  5CYV A;  3RDI A;  2Z5U A;  2WV0 A;  3LAP A;  2RVC A;  4MQ9 F;  4OIP F;  3MQ0 A;  2HWV A;  1UHW A;  2X0L A;  1XB4 A;  4ESF A;  2HR3 A;  1UCR A;  1PP7 U;  2IVM A;  3E6D A;  1QO0 D;  5ILS A;  5CJ9 A;  5D6F A;  3HHH A;  2LKP A;  3DV8 A;  3OOP A;  3F8B A;  2PJP A;  1SFE A;  1P4X A;  4G7O F;  3RTR A;  4B8X A;  4UV8 A;  2R7F A;  2L4A A;  1IW7 F;  4A6D A;  1IXC A;  5F1R A;  1O7F A;  4Y13 A;  1U6G A;  5ICE A;  4HF0 A;  2DFI A;  5L3C A;  2ISZ A;  3S2W A;  4OIR F;  1CGP A;  2ZCW A;  2PG4 A;  2CYY A;  2ISY A;  1ZRC A;  4HDV A;  2D45 A;  2DAO A;  2IA0 A;  3MAJ A;  3F6V A;  3V7R A;  2HKO A;  2XAH A;  5E1Z B;  4WWC A;  3ECO A;  2FF4 A;  4OMY A;  2P6T A;  4NQW A;  4RGU A;  1FY7 A;  2MA3 A;  2WWY A;  5BQT A;  2O03 A;  2VN2 A;  2ZNY A;  1OR7 A;  4MTD A;  3WTV C;  2DK5 A;  3TO6 A;  4I98 B;  1A04 A;  2MBF A;  4LGW A;  5E8G A;  3HUG A;  4WX9 A;  1S8N A;  5CVU A;  4QWQ A;  2ZFW A;  1XCV A;  5DEQ A;  2H94 A;  4I2O A;  4M72 A;  1FYL A;  1OPC A;  2DK8 A;  1HKS A;  2HKX A;  3GWZ A;  1UHM A;  3KFW X;  5A2Q Z;  3QAH A;  5J6X A;  5FFX A;  4HLY A;  2LF7 A;  4HDU A;  4A12 A;  3MFK A;  3F3X A;  2UWM A;  3FWE A;  4RGS A;  4ZYH A;  3DPL C;  2RN7 A;  1K78 A;  3B02 A;  3E6C C;  1JXS A;  1LVA A;  2A61 A;  3L2C A;  3JW4 A;  1XD7 A;  2XAS A;  4RS8 A;  2RC4 A;  1BN5 A;  3HOS A;  2P5V A;  3IL2 A;  4MEX F;  3O3K A;  2GA1 A;  3SZP A;  3CO6 C;  3RYR A;  1QNT A;  3FX3 A;  2GQQ A;  2P5K A;  3K1M A;  3KCC A;  4OIN F;  4RAY A;  2VT3 A;  4PGG A;  3G73 A;  3IKT A;  4S04 A;  2Y75 A;  4KIF A;  3JAM K;  2G7H A;  2V1D A;  1BIA A;  4BHP A;  4EJT A;  2Q2E A;  4HX8 A;  3NEU A;  4LD5 A;  2L54 A;  1HW5 A;  2HEO A;  4YG2 F;  3P9K A;  2O61 A;  2GXB A;  3ZMV A;  4UVA A;  3EUH A;  5HLI A;  2FBH A;  5DUI A;  5E17 F;  1BIB A;  3MEX A;  2HTS A;  3SXY A;  4M74 A;  3MZY A;  1K6O A;  3M8F A;  1ZRD A;  4FT8 A;  3FHZ A;  2AS5 F;  2XGX A;  3EYI A;  1YIO A;  5LGU A;  2W84 A;  5TJJ A;  5E1X A;  2IP2 A;  1TTY A;  4PDK A;  2ZO4 A;  5D8L B;  5LRR A;  3LA2 A;  3J81 Z;  3QP5 A;  3BPX A;  3V7C A;  3H92 A;  4S05 A;  1TW2 A;  3HSR A;  5BMZ A;  5FO5 A;  1MJB A;  4EM0 B;  1KU9 A;  3OV8 A;  3IKV A;  3DPT A;  5IT9 K;  1K79 A;  2JZY A;  1EV7 A;  3REO A;  4GXO A;  3CO7 C;  1H9T A;  2KIM A;  4M9X A;  5HDN A;  2B0L A;  4M6X A;  1XGS A;  1S6L A;  2L02 A;  2G7U A;  2Z9O A;  3BJA A;  3R0J A;  3WTT C;  2P5L C;  5JVT A;  2V1U A;  1QQI A;  1SD7 A;  1KU2 A;  3WOD F;  2NNN A;  2VT2 A;  1L0O C;  1SFU A;  2XKP A;  4I09 A;  2PI0 A;  1IN5 A;  3EDP A;  3RKX A;  2Z3Y A;  1BI0 A;  3JSP A;  1SMY F;  1TNS A;  2CFX A;  4UHT A;  1J9I A;  4GYG A;  3O6B B;  2HFH A;  3GFL A;  2A68 F;  3RIR A;  1LJ9 A;  2K4J A;  2KIU A;  2VBZ A;  1EH6 A;  1HKT A;  2FA5 A;  2DPU A;  4UUV A;  3F22 A;  3KP2 A;  4KMU X;  1R22 A;  1S3J A;  1HQC A;  3FF5 A;  2XAF A;  4LLG F;  2IA1 A;  1FT9 A;  5FB2 A;  2A6E F;  3KP7 A;  3RJP A;  5DD4 A;  4ENM A;  2BBY A;  1PDN C;  4YFK F;  4HAM A;  5ILU A;  5BS6 A;  2IA2 A;  4U0V A;  2F5D A;  1P4W A;  1RNL A;  2J5O A;  1ZLJ A;  1IRF A;  2DPD A;  3I59 B;  2Z33 A;  2DO7 A;  4E70 A;  1BM9 A;  1JGS A;  2DI3 A;  4IVN A;  1EH8 A;  1ZG3 A;  4R1H A;  2QEN A;  5IT3 A;  1FBU A;  2HQR A;  5HOO A;  2MLK A;  3ISP A;  1R5G A;  1W7P D;  4Q48 A;  3F21 A;  1IXS B;  3KLO A;  2DW4 A;  3DQV C;  2M30 A;  1P6R A;  4UVB A;  1I5Z A;  5LBQ A;  4YIF A;  5D5X B;  2K4B A;  5JHU A;  3EQL F;  4HOB A;  5CVI A;  4LB5 A;  5L3D A;  1FLI A;  2NRA C;  1TQI A;  1G3S A;  4KIC A;  4JQF A;  3QPT A;  1ZAO A;  3MCZ A;  3C1D A;  3WTX C;  4EGZ A;  1XMK A;  4HF2 A;  4KIB A;  2VC0 A;  1EH7 A;  1R1V A;  1BI3 A;  3F8M A;  3IHU A;  3BY6 A;  4RB0 A;  1FYM A;  1YO5 C;  3WGI A;  1B6A A;  4K2E A;  1SFX A;  3E5X A;  4F7Z A;  1R58 A;  1JE8 A;  2GWR A;  4O6J A;  2EA2 A;  3BPV A;  4YFX F;  1SMT A;  3E5Q A;  1F1Z A;  3E6B A;  2KRF A;  4KN7 X;  3GFI A;  3RKY A;  4MNU A;  2ZXJ A;  3K2Z A;  4G94 A;  2E1N A;  1BI2 A;  4LK1 F;  4XLN F;  4HYE A;  4KN4 X;  4A5N A;  4N9I A;  4U7D A;  2L3D A;  4ZH4 F;  1XDU A;  2HOE A;  1WI9 A;  2VOD A;  1FP2 A;  3FMS A;  2F2E A;  2CG4 A;  4A2U A;  3BJO A;  3H3U A;  1ZRE A;  4WF2 A;  2JRT A;  1ZLK A;  2NYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...