2FNPA

Crystal structure of sara
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYFKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 38
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnpA00
1J75A 1AOYA 2PN6A 5CLSA 3N4MA 5DCFA 3GWZA 5AONA 2STWA 3JSPA 4DQ2A 4AWXB 1QZZA 1SAXA 3WTZA 2PMUA 3L00A 3I0TA 1O7LA 4EJOA 4LFUA 2VE9A 3KETA 2H94A 4KN4X 1XCBA 3E6DA 3WGGA 2BE5F 3LA2A 4N9HA 1FPQA 1W5SA 1YW9A 4A5MA 1YO5C 2PMHA 1I5ZA 2BYVE 3T0YA 4LGWA 2IP2A 3RKYA 3T1BA 1YTYA 1LQ1A 5F1RA 3FX3A 5J8CA 3F72A 5CVVA 1D8KA 4LLNA 5ILSA 4O5VA 1MKMA 5HLIA 1C0WA 2OAZA 1I27A 5CVUA 3TDZC 3I4PA 4R8HA 1JHHA 4Q48A 3BJAA 1EH7A 1QZYA 1SD5A 2DTRA 1T6SA 2Z9OA 1Z9CA 4I0AA 3C18A 1XMAA 5D6EA 2YR2A 4FX0A 4G6DA 5D4SA 2A5YB 2RN7A 4A12A 1K79A 4LG0A 3LSTA 4LG0B 4HF2A 3FM5A 1UB9A 1IN6A 1ZGAA 2O6GE 5BMZA 5ICGA 2XUBA 1W5TA 3HRMA 4RGXA 4RB3C 4M9SA 4NHJA 1MJAA 4HZFA 3ZMSA 2M45A 3HOSA 2VC1A 5ILVA 1ZG5A 1W4MA 3HRTA 2XIGA 2D1VA 2EJRA 5CVRA 4GO1A 1OMIA 3FM3A 3SFZA 4ZYGA 3I64A 3R61A 5D8KB 3ZMVA 2WC2A 5LRSA 2MLGA 2DAOA 4MQ9F 1HKTA 3DKWA 2IA1A 3CDHA 4A0XA 2ZNZA 2QVOA 3WTUC 1UHWA 1XGSA 4YFXF 3JAMZ 1XCVA 3GZ6A 4TV7A 2QQ9A 4I98B 1ZYRF 3T8RA 4M6YA 3KLNA 2ZMEA 3E97A 4P5OA 5DCMA 4HOBA 1KU7A 1WQ2A 2ZMEB 5DCMB 1IZ1A 3F6VA 3O3KA 4HX7A 5EEGA 4KT5C 4R79A 4OIPF 4ZZLA 2QZ8A 2VE8A 3LWFA 3COAC 3VOEA 3E5XA 2ZNYA 1FNNA 3CO7C 1ZRFA 1FX7A 1R00A 2L4MA 2Y48A 3GYHX 2LDUA 1GVJA 1REPC 4AVPA 5IT9K 3GFIA 1TTYA 3U2RA 1S6LA 3GFLA 3VB2A 4G7OF 3V8KA 3HRUA 3L7WA 1ZRDA 1XD7A 4Y17A 1ZHFA 4RAYA 3F8NA 5L3BA 2KKOA 4GXOA 2H6BA 2W85A 4ENNA 2COMA 3W6JB 4HLXA 4A5NA 1R23A 4UVCA 1NHAA 3R4KA 1UCRA 1PDNC 5LBQA 4CGZA 1LEBA 3HHHA 1SD6A 3F8FA 3BP8A 4MQVA 4EM2A 3FXQA 3IWFA 4IRIA 1U5TC 2IJLA 3JTHA 1OKRA 1FYLA 3J7AO 3KP3A 5DDGA 4EJTA 1RI7A 3TOAA 1E2XA 2PBIA 4BAYA 1FYMA 3F8BA 1MJBA 3DV8A 5TJJA 3TO6A 2P7VB 4I7HA 2A6EF 2YX4A 5TRDA 2QYOA 1P2FA 4EJUA 4MTDA 4LD5A 4XLNF 4EV0A 2OQRA 3PQJA 2JRTA 2C6YA 4WXCA 2EV6A 2ELHA 2HOEA 4GYIA 1ZRCA 5CYVA 1OYWA 2OU2A 5K5OA 2F5DA 2VOOA 2RDPA 4P96A 1XB4A 4XRFA 2V1UA 3ZP5A 1W7PA 1B9MA 2O8XA 3QP6A 2GXBA 1W7PB 1LDKB 1IXSB 3GXOA 2KIFA 4RAZA 3BJ6A 2L01A 2IW5A 2VONA 1PP8F 3GZ5A 2QENA 2XRNA 4PZJA 1JE8A 5D6FA 3NEUA 4KIBA 3WODF 1XDUA 2NAZA 2X0LA 2ZJ2A 3WGHA 1HXDA 4XSXF 3J80K 1TW3A 2QM3A 2OA4A 5K1YA 3RPUA 2DT5A 3C7JA 1O3QA 4WX9A 3GO5A 3E6BA 3BWGA 2PLYA 3FWEA 2XAJA 2Z99A 3IRQA 3SQNA 2ESHA 1PUEE 3QPHA 1R1TA 5DV5A 1F4KA 2JPCA 2CW0F 2NNNA 2MA3A 1P4AA 1VTNC 3FMRA 3LFKA 2EV0A 3H3ZA 2XASA 3AAFA 4WXDA 1SD7A 1P4XA 2OD5A 4B8XA 3HYIA 1LDJA 2DK8A 3C3WA 2UXNA 1WWXA 3DFGA 1FBQA 2HYFA 3MAJA 2JT1A 3ERED 5E8IA 4BXUA 1T98A 2FRHA 2ZXJA 3ELKA 5K5RA 3BY6A 4HLYA 4KIGA 4FT8A 1YW8A 3QAHA 2TDXA 1TQMA 3Q9SA 2EWNA 3BOQA 1XGNA 3HTSB 1XN7A 1RIOH 3EYIA 1S7AA 1FBSA 4PGHA 3ZMDA 3LQQA 1F5TA 3VFZA 3IKVA 1R1VA 4H0EA 2EFNA 2Q0OA 3WTWC 4ASNA 2A68F 4MTEA 3BDDA 2VXZA 3ABUA 4CXFA 3QRFF 4EMSA 3HTUA 2Y75A 5BS6A 5E18F 4YG2F 3OV8A 1FT9A 3I71A 2DW4A 2GAUA 3LA3A 3CUQA 3S2WA 5DEQA 3CUQB 3BPXA 2WTEA 4UV8A 3FMQA 3HIFA 5BOXA 1SMYF 1U2WA 3ECHA 1SFEA 5DD4A 2HEOA 2B0LA 4L0YB 1AWCA 1YW7A 2Z33A 1GXPA 2H6CA 1E17A 1OR7A 2MD5A 2DBBA 1R5HA 3LA7A 4IHSA 1Y0UA 2UWMA 4M9ZA 2CSOA 5CJ9A 1SD4A 4GYGA 1FC3A 2V1XA 1ZG1A 4L9JA 2GIVA 3GEZA 4WXHA 2G9WA 5F6FA 3K9TA 1O7FA 4OMZA 2DPDA 3HOTA 4BHBA 2HFHA 3E3VA 4GCVA 4UNOA 1QQIA 4HBLA 3CLOA 4HDVA 2JTVA 2H09A 1KU2A 1XSXA 1S3JA 4CDGA 3I54A 4UV9A 2ZO4A 3P9IA 1LNWA 3RI4A 4ZYHA 1D3YA 3F22A 3TKYA 1H0MA 1BI3A 1Z7UA 1HKQA 2CYYA 4BYYA 1T39A 3Q9VA 5F64A 2DPUA 4EM0B 4U7BA 1JGSA 2FXAA 2KJCA 3WTSC 3OOPA 3HSRA 2STTA 3H3UA 4HQEA 2G7UA 1IAWA 3NRVA 1USTA 3R0AA 3QU3A 2LF7A 5FGMA 4MGRA 1D5VA 2QWWA 1KQ0A 3V7RA 4G6QA 2ETHA 2KRFA 2R3SA 2IA0A 2W24A 2D45A 1B4AA 3FMSA 4N0BA 3HHGA 3TOBA 2YU3A 4O3MA 3JAMK 1RUNA 2CGPA 3HSEA 4LLGF 3IC7A 4D0PA 2JSCA 2ZFWA 1TLHB 1BOAA 4HF0A 2VBZA 4ZH4F 3IRRA 2ZCWA 2D2WA 3B73A 2LF8A 3QP5A 4ESJA 2YX7A 4HV5A 3V7SA 3KEOA 5FLXZ 2FOKA 3BROA 2BEOA 4A6EA 1LDDA 1FSHA 3ISPA 4HF1A 1BIAA 2ZBKA 2M30A 3WTYC 1IN5A 2CFXA 2XAQA 4HX4A 4AD9A 1BI2A 1S29A 5EEHA 4KA4A 5AIQA 4EGZA 1HW1A 3Q5FA 5KK1A 4FHTA 5LRRA 3I5UA 3N97A 1ONVA 1QNTA 5IT3A 1S8NA 3E5QA 2O61A 3WE2A 1QO0D 2VBXA 4WK8F 5LHIA 1T38A 3MZYA 2HYGD 2OZUA 3ZPLA 3ZMUA 2W57A 2JPBA 3JTGA 3I58A 3BPVA 3KCCA 4RGRA 4MNUA 1B59A 3JW4A 2HGCA 4KYWA 4ENJA 1ZH5A 2GXGA 1YLFA 1DDNA 3FZVA 4WWCA 4ESBA 1J7KA 1V3FA 2FBKA 4E70A 1MGTA 3M7GA 1BI0A 2FNPA 4OOIA 4P9FA 3T5XA 4FX4A 2VN2A 2KIMA 5E17F 1XGOA 1Z6RA 2HS5A 3RDIA 4P55A 1OPCA 1CF7A 2FQ3A 4L9NA 1CF7B 3KZZA 3WE3A 3HSFA 2P6SA 2M87A 5E8GA 3EETA 3REOA 3ZMTA 4UUVA 5D5XB 1KYZA 1DPRA 1ULYA 4K2EA 4MHGA 4NB5A 5AIPA 1Q1HA 3HUGA 1FSEA 3V8JA 3ML6A 2GQQA 4HAMA 1BJAA 2VT3A 1KYWA 4HV6A 4L5IA 3ZN1A 1R1UA 2DLLA 1ZLKA 4A2UA 3J81Z 2L4AA 3EYYA 4HDUA 2O0YA 4JQFA 1G3TA 1O57A 1MDMA 3I53A 5D5WB 1F1ZA 1MDMB 2GA2A 2YPRA 1KGSA 3KP6A 4RGUA 3MFKA 2EFOA 5K5QA 2A6HF 1LJ9A 3KP4A 3MQ0A 5ICFA 1Z1DA 4A0ZA 3F6OA 3TGNA 4ENMA 1A04A 1P6RA 3L9FA 3RPQA 5LHGA 2VBYA 3RIRA 2K4JA 1G3YA 2NS0A 5L3EA 2GWRA 1TNSA 3SXYA 3DXJF 2IA2A 3I59A 3RKWA 4XSZF 4LB5A 3I59B 1WRJA 1P92A 4KFCA 2MBFA 1JHFA 3V8LA 4P9UA 1O3SA 4L5JA 3F3XA 1TQPA 5HDKA 1TBXA 2IVMA 4HA8A 4ZYEA 4OU0A 1FLIA 2XVCA 3M8FA 4HX8A 4IPAA 2RGVA 2HQRA 4RB2C 3E6MA 5E1XA 3KLOA 1XDSA 2EV5A 3RJPA 3K1NA 1SMTA 1HW5A 2DQLA 3P7NA 2A07F 4LLLA 2RKHA 2MH2A 2NYXA 1GXQA 2CWEA 5KVRA 2VC0A 1R7JA 4YFKF 4IHTA 3F23A 1HKSA 3FHZA 5DD8A 1D8JA 3U1DA 4RB0A 5D4RA 4Y13A 2GZWA 2V6CA 1YIOA 2XROA 3R0JA 4Z2YA 4CZZA 4EJVA 1XSDA 3GW2A 1U78A 4G94A 2DFIA 4BQAA 4A6DA 2L54A 2JZYA 3BZ6A 3RKXA 2WWYA 5FD6A 4IXAA 1TNTA 1ZGJA 6PAXA 3G73A 4KUMA 4HYEA 5DUIA 2RNJA 1WI9A 2FSWA 2Y0MA 5D5UB 2XV4S 2Z5UA 2BGCA 5HLHA 4HQMA 2A69F 2EK5A 1RNLA 2QBYA 4M74A 2QBYB 3JSOA 5L3DA 3GFMA 4CO8A 5BQTA 2HZTA 3RYRA 2K7LA 1W7PD 2XKPA 2P5VA 2FNAA 1YQAA 1IW7F 1UFMA 5LHHA 4JBAA 2HTJA 2OZ6A 4KNYA 5HS9A 2EFWA 1RZ4A 3KZYA 1GHCA 3IL2A 1H9GA 4WCGA 3ROUA 4IJAA 1PP7U 2PFBA 1BI1A 3LQRA 2WV0A 5DYMA 3ZN0A 3GVAA 3D5LA 2DU9A 2QUFA 2XAFA 2FE3A 4CICA 2V79A 1U5TA 3IHUA 1U5TB 4DNCA 1ON2A 1K6OA 2RVCA 2W25A 5ICEA 2HTSA 4OIQF 1KU3A 1IN4A 4BHPA 1IXCA 2E7XA 2ISYA 4UXNA 5HDNA 5LLQA 2QLZA 3LAPA 4XBFA 1QPMA 1KU9A 4LJZF 1KQ8A 4EJWA 4BHCA 2FEZA 5E1ZB 2VODA 3GLXA 1R36A 1I1GA 1ZG3A 1QGPA 1J0RA 3FXRA 5FO5A 1FWZA 3O2PE 3K1PA 2HWVA 3WG9A 1T0FA 5J6XA 4YIIA 1XSVA 1FOKA 5CVIA 1R22A 4IF4A 2LNBA 3K1MA 3TO7A 4UHTA 2XGXA 3RTRA 1YS6A 3GFJA 5A2QZ 1EH8A 3ABTA 2R7DA 2P5LC 4I09A 5FLXK 4L9TA 2FBIA 2ADUA 5HS7A 3MEXA 2P7CB 5BPDA 4G8XA 1FP2A 3KEQA 1LB2A 4B09A 2PEXA 2HKXA 4EGYA 3B02A 4U7DA 3DPLC 1TW2A 4G7HF 2IT0A 3CO6C 1KQ9A 2RC4A 2XKOA 1I6XA 1JXSA 2EFQA 5H6QA 2EA2A 1MD0A 2FA5A 3L2CA 3MZHA 1LVAA 1QBJA 4I2OA 5BPIA 2P5KA 2FMLA 3SHFA 3ZMZA 1YFHA 4M71A 4KMFA 4Q5SF 2G7HA 2BBYA 5L3CA 5HOOA 3WTXC 4IRGA 2F5EA 5ILUA 1O3TA 3NQOA 3QU6A 1STZA 2M1BA 1OYYA 2HR3A 3M9AA 1U6GA 1J5YA 1IRGA 2X4HA 2EB7A 2RV8A 2OQGA 1ZARA 4YFNF 2UXXA 4OIOF 2XHKA 3D0SA 1FYKA 5H20A 4S05A 2P6TA 4LMYA 3FF5A 4BH9A 3K2ZA 5L3FA 4EM1A 1SFUA 2L02A 2EA4A 1K78A 5LGUA 4EQQA 1K78B 2IRFG 1BBYA 2BV6A 4CYDA 1ZLJA 2W84A 2FF4A 3KFWX 3V7CA 2VBWA 3WU0A 4ESFA 4M72A 3O6BB 4JK1X 3IKTA 1DP7P 4U0YA 2Z3YA 4MEYF 3WTTC 1T2KA 3P9CA 2PJPA 3PFIA 3IWZA 4ZYDA 4Q47A 1ZREA 3KP2A 1MJ9A 3EDPA 1IN7A 3T8TA 2KIUA 3J81K 3U9GA 2NNYA 1EV7A 2AS5F 3H92A 3K0LA 2MH9A 3C1DA 1G3WA 1S7OA 2FU4A 3RYPA 3M8EA 3K69A 2GA1A 1R5GA 1B6AA 3MWMA 4KMUX 3CUQC 3WU1B 1FP1D 4U88A 4R1HA 1EH6A 3MCZA 2H27A 2K02A 2YSRA 3F8MA 3DPTA 3BJOA 2M8EA 4LB6B 2VT2A 5HLGA 3GX4X 1U8RA 3CTAA 2XAGA 4OINF 4AIJA 4MEXF 3VEPA 2IPQX 3CJNA 1B1BA 5E1WA 2NRAC 5ED4A 2E1NA 3FXUA 1G6NA 4LK1F 1UHMA 4HW0A 2ACJA 3L09A 5IT9Z 2AXLA 2HKOA 1IRFA 4U0VA 4L0ZB 3SZTA 1IN8A 1BIBA 2LSOA 1FZPB 3W6KB 4A0YA 3GUDA 1Z91A 5ICCA 4UVAA 3SZPA 2RQPA 2J5OA 4PDKA 1BC7C 1HW2A 3KE2A 4CHUA 4PGGA 2QQBA 3E6CC 2DI3A 5JI6A 4KN7X 4I02A 4PCQA 1HBXG 2FBHA 2CQKA 5D5VB 4N9IA 4I0BA 1H9TA 2Q8KA 1OYIA 4BNCA 2F2EA 3QPTA 2K27A 1BC8C 1G3SA 2FMYA 4OMYA 1DUXC 4AIHA 4RS8A 1YS7A 1XMKA 3R6SA 1MZBA 1ZN2A 3WTVC 2O3FA 4G9YA 3DF8A 1TQIA 2F5FA 1Z6TA 1O3RA 2EFPA 1ON1A 4F7ZA 5ERIA 1FBUA 3KP7A 2DO7A 3GF2A 3EUHA 2P8TA 3ULQB 2Q2EA 3TQNA 5E20A 1IF1A 5H6RA 1V4RA 2E1CA 1J9IA 4LK0F 3P9KA 4IRHA 3M1EA 4S04A 3WGIA 3PQKA 5JVTA 4RGSA 3DQVC 2HDCA 1SFXA 4M9XA 4M73A 2CG4A 2DK5A 2PQ8A 4AIKA 1RUOA 3EQLF 5FD5A 2O03A 4M6XA 1R58A 4O6JA 1Z05A 2P4WA 1F9NA 2L3DA 5L3GA 2V1DA 5LGNA 5LEKA 4I01A 2DQRA 1YYVA 2OBPA 4GGGA 3QOPA 5FFZA 4Q4ZF 1ODDA 1WKMA 1I1SA 2K86A 3TO9A 1HSTA 1K7AA 2UZKA 3DEUA 4U0WA 1YG2A 2A61A 3KP5A 1IUYA 4QLCU 5HVQC 3J80Z 4L9VA 3E5UA 1WSUA 1XGMA 4KICA 4ZZDA 3R60A 2PI0A 1X3UA 5HS8A 5FFXA 4KDPA 3VODA 4IVNA 3LAJA 1LEAA 4EVIA 4QWQA 1DPUA 4Y15A 4OIRF 3TDUC 5FB2A 5HDGA 5JR3A 5D8LB 1BM9A 2V9VA 4XLPF 1CGPA 1ZAOA 2QQAA 4NQWA 3F21A 2E7WA 3HRSA 2LKPA 2ISZA 1B9NA 1G4DA 5CVJA 4G7ZF 1HQCA 1IXRC 5J8FA 2A3SA 2F5CA 3G3ZA 2J5PA 2MC3A 1BN5A 2HQNA 1L3LA 5LEJA 1U3EM 2R7FA 1USSA 2PG4A 3F8CA 2CO5A 4WF2A 4ETSA 2XAHA 2VOPA 3V4GA 4L18B 3ECOA 2M5WA 1J59A 5DUKA 4RB1A 4YIFA 5JHUA 2ZKZA 1KA8A 1HSJA 1P4WA 2MLKA 3ZQ7A 1FY7A 1J2XA 5JFRA 5LGTA 2KJBA 4ENKA 3CUOA 4ON0A 2D1HA 2ESNA 1L0OC 4UVBA 5A2QK 3DP7A 2K4BA 4KIFA
chains in the Genus database with same CATH superfamily
1J75A 2IS4A 1AOYA 4XQFA 2PN6A 3CCQI 5CLSA 3N4MA 5DCFA 4RM3A 4KJZA 1HOMA 2K5CA 3HM5A 2DA2A 2NS7A 3GWZA 2XSDC 5AONA 3FXJA 3JSPA 4DQ2A 2STWA 4AWXB 1SVLA 1QZZA 1SAXA 5EF6A 1SEUA 3MKLA 3OMYA 3I3LA 3WTZA 4F91B 5C3EJ 3JRHA 3S3MA 2PMUA 3SEQA 3L00A 3I0TA 1Z3XA 4D5CA 1O7LA 2DFEA 2DMUA 3OL3A 3GTQJ 4EJOA 2Z16A 5HNFA 3QODA 3DKXA 3S1RJ 1BL0A 4LFUA 4FETA 2VE9A 3KETA 1VQNI 1Y1VJ 2LBFA 2H94A 3LSJA 4KN4X 2LBFB 2DA5A 2E2JJ 1MMDA 1TP4A 1XCBA 1S7EA 2BE5F 3E6DA 3WGGA 4I6ZA 3LA2A 1FEXA 1YHQI 2EH3A 1FMWA 4N9HA 2X6YA 1FPQA 1W5SA 1YW9A 3MKWB 2IS1A 2KPMA 2XGDA 3PNYA 2PMHA 4A5MA 1YO5C 3AFHA 1I5ZA 2BYVE 2V26A 4PJNA 3Q0WA 2R7SA 4CCOA 3T0YA 3H9JA 4B3AA 2Y9ZA 4LGWA 2IP2A 3RKYA 1TWCJ 2W4SA 3T1BA 2HQAA 1YTYA 1LQ1A 5F1RA 3FX3A 5J8CA 3F72A 5CVVA 1D8KA 4LLNA 5ILSA 4O5VA 1MKMA 5HLIA 1C0WA 2OAZA 1I27A 5CVUA 3TDZC 2DA1A 3I4PA 4R8HA 1JHHA 3I4MJ 2NVTJ 4Q48A 2DOFA 3BJAA 1EH7A 1QZYA 2HVSA 2A6TA 1SD5A 4IQJA 2DTRA 1T6SA 3I9V2 2Z9OA 5JLWA 1Z9CA 4A3CJ 3BR2A 2RQQA 4I0AA 3C18A 2ELJA 2ZSHB 2NVXJ 4IKFA 4J00A 1XMAA 1EJ9A 5D6EA 3HOZJ 4YRVA 1WZ2A 1T8IA 2YR2A 4FX0A 5FJ8J 3ZGKA 4G6DA 5D4SA 2A5YB 2RN7A 4A12A 1K79A 1JUPA 4LG0A 5E3MA 4E7HA 4GFBA 1T95A 4DJAA 3LSTA 1OLTA 1RC9A 4LG0B 4HF2A 3FM5A 1UB9A 1IN6A 1ZGAA 1FTZA 2O6GE 5BMZA 5ICGA 3GTOJ 2XGEA 2XUBA 1XS9A 1W5TA 3QYBA 3HRMA 4M3FA 3JRFA 4RGXA 2ME6A 3ESWB 1TWAJ 3E7LA 4RB3C 3ZQLA 4M9SA 2RNGA 4NHJA 1MJAA 2CMPA 1VI0A 4HZFA 2R7RA 3ZMSA 2M45A 3B6AA 2VC1A 3HOSA 3O8HA 5ILVA 1X1BA 3J7ZI 3HG9A 1ZG5A 3DEWA 5F04A 1W4MA 4XRSG 3HRTA 4XKWA 3OYJA 2XIGA 1OCOH 2D1VA 2EJRA 1W0UA 5CVRA 2F6CA 3S3NA 4GO1A 3BCBA 2VLAA 2CV1A 1OMIA 3FM3A 3BTLA 2KZGA 3SFZA 4ZYGA 3I64A 1X2MA 3R61A 3CJQB 5D8KB 3ZMVA 5GP9A 2V6EA 2M9HA 2WC2A 3DLLF 2DMNA 3MKYB 3U1KA 2IBDA 4M3BA 4GDFA 2KL4A 2YS9A 4F3QA 5LRSA 2MLGA 3GLLA 3HKZA 3MVPA 2DAOA 4MQ9F 1HKTA 3DKWA 2CUEA 2QSFX 1MH4A 2IA1A 3BQZA 5CPRB 2LRDA 3CDHA 2E36A 4A0XA 2LK2A 3RQIA 2K9NA 2ZNZA 2QVOA 4XLHA 3WTUC 1UHWA 1XGSA 4KT6A 2R7VA 1AU7A 2I5UA 2MYSA 2NS8A 4YFXF 2IGOA 2XC7A 5F0FA 3JAMZ 1YJNI 1XCVA 3IAS2 3GZ6A 4TV7A 2QQ9A 4CZCA 5J47A 4I98B 4Y7NJ 1ZYRF 5IP6A 1YITI 1E0EA 3T8RA 4M6YA 1PVEA 3KLNA 2ZMEA 3E97A 4P5OA 5DCMA 4HOBA 1KU7A 1QU3A 1WQ2A 2ZMEB 5DCMB 4JOMA 3HL2A 1IZ1A 3F6VA 3O3KA 4HX7A 5EEGA 3JREA 4KT5C 2JA2A 4R79A 4OIPF 2AXTC 4ZZLA 5M3FJ 1X1CA 2QZ8A 1OJLA 2VE8A 2VPRA 3LWFA 3OYLA 2DMTA 4N4NB 2BOLA 2QSGX 2X9DA 3COAC 3VOEA 3H0GJ 2DT7B 3E5XA 2ZNYA 2XPUA 1FNNA 3CO7C 1ZRFA 1FX7A 4RM2A 5DS9A 1QRYA 1R00A 2L4MA 2Y48A 3GYHX 2LDUA 2W82A 1N78A 1HF0A 2LP0A 1GVJA 1REPC 4AVPA 2DXIA 5IT9K 3GFIA 1I3QJ 2H1KA 3DEEA 3FXOA 1TTYA 3U2RA 1S6LA 3GFLA 5KCMA 3VB2A 3GBGA 4G7OF 3V8KA 2A5WA 5BNGA 3KX2A 3HRUA 2WAEA 3QYEA 3L7WA 1ZRDA 1XD7A 2R0QC 2V9PA 4Y17A 5E79C 4UB6C 1ZHFA 4RAYA 3N05A 4C2MJ 4FASD 2LY9A 3F8NA 5L3BA 3DTEA 2KKOA 1QZEA 1UZCA 1V5FA 4GXOA 2H6BA 2XRLA 3IUOA 2W85A 2DA7A 4B1RA 3QQAA 4ENNA 2COMA 3W6JB 2VB6A 3W2VA 1JT0A 4BKXA 4CCNA 4B48A 3HOYJ 4A3EJ 4HLXA 4BBRJ 1ETXA 3ZRGA 2M8GX 4A5NA 4A3DJ 3PIPF 1R23A 4UVCA 2KRCA 1FIAA 1HA8A 3HB9A 1NHAA 2ZXWH 3E1SA 3R4KA 2R7QA 1UCRA 2V9KA 5LBQA 1PDNC 1IDYA 4D7NA 2DODA 1B72A 2F48A 1JKRC 4CGZA 1B72B 5J40A 1LEBA 1A36A 3HPGA 2L0KA 1SD6A 3HHHA 3OS1A 2WADA 3F8FA 3BP8A 4MQVA 4EM2A 1UAAA 1UJ8A 4XOTA 3FXQA 3IWFA 4IRIA 1U5TC 4X1EA 1IDZA 2IJLA 3K6GA 5JVGF 1SANA 1YJWI 5J1UA 3JTHA 5IOYA 1OKRA 2UUZA 3ZQFA 2Q1ZB 1FYLA 3J7AO 1TL8A 4A3FJ 3A0BC 2Y0SA 3KP3A 4BDZA 5DDGA 4LOCA 4EJTA 4B44A 4XL9A 1RI7A 3TOAA 4DGWB 4E7KA 1FMVA 1E2XA 4PJ0C 1NG7A 1MNEA 1A5JA 2PBIA 4BAYA 2F4MB 1FYMA 3F8BA 1F36A 1MJBA 4FTHA 2NVYJ 4XLCA 3DV8A 5TJJA 2HDWA 3VYUB 3TO6A 2P7VB 4ZDPA 4HG2A 2QQ8A 4I7HA 2A6EF 2YX4A 2BVMA 5TRDA 5FLMJ 2QYOA 1P2FA 3KIOA 1JKPC 4DZPA 4EJUA 1E3HA 4MTDA 2X1DA 4LD5A 1Y8QB 4XLNF 4AVZA 4EV0A 1UMQA 2OQRA 4FCYA 3PQJA 2JRTA 2C6YA 5KNLA 4LITA 4WXCA 1LUJB 2ELHA 2EV6A 2HOEA 4GYIA 5CYVA 5GAEJ 3OS2A 3OSFA 1ZRCA 3OYCA 4I76A 1R49A 1OYWA 2OU2A 5K5OA 1T0FC 1A6QA 2F5DA 3HPHA 4A69C 1IJWC 2VOOA 2PJRA 2CW8A 2RDPA 2TRTA 3BR0A 2PJRB 4IQ4A 3FIWA 1FJLA 4P96A 1XB4A 4XRFA 2V1UA 3UR3C 3HBLA 1Y0NA 3ZP5A 1W7PA 2HPMA 1B9MA 2O8XA 2Y9YA 2TCTA 1JUSA 1W7PB 1YE9A 3QP6A 2GXBA 1LDKB 1IXSB 2OF7A 2KIFA 2BY2A 3GXOA 4RAZA 3BJ6A 2L01A 1IC8A 2IW5A 4BE0A 2JQ7A 1X4OA 2VONA 1VZ0A 5TGTA 4QIWN 3CCJI 2M7AA 1PP8F 2DJNA 3GZ5A 4BUPA 2QENA 1W0TA 2XRNA 3BT9A 2GM4A 4PZJA 2Q2EB 1I3AA 2P81A 1JE8A 5D6FA 4B47A 2VKHA 3NEUA 4KIBA 3WODF 1K4TA 4S0HB 1XDUA 2ZJRF 4ZTJA 2KLOA 2NAZA 4XKVA 2X0LA 2ZJ2A 1ETOA 2ECBA 3WGHA 1HXDA 5FRNA 2MC4A 4XSXF 4F93B 3J80K 1TW3A 2G0EA 4V2GA 2QM3A 1JTYA 3HKZN 4XM3A 1TWFJ 1X2NA 2OA4A 1Z21A 3QYFA 2L9RA 5K1YA 3RPUA 2DT5A 3CC2I 2DN0A 1IGNA 3C7JA 3DBRB 2JWTA 2FD5A 2DOAA 4HNUA 1O3QA 3BQYA 3D5SC 4WX9A 2XF7A 3HJEA 3GO5A 3E6BA 3BWGA 2PLYA 3FWEA 4Y33A 2XAJA 3PSIA 2DMQA 4XR6A 2Z99A 3IRQA 1AKHA 3SQNA 2ESHA 3OYKA 1PUEE 3QPHA 1S9HA 1AKHB 2DT6A 4LG3A 1R1TA 5DV5A 1SVOA 1F4KA 2JPCA 3FXMA 2CW0F 2NNNA 3OIOA 4BJTA 3SJMA 4EATA 1JJ6C 2MA3A 2LG4A 2R7TA 1P4AA 1DP3A 1VQ8I 1VTNC 2LKXA 3CDIA 4G6TB 5B1BH 2KZVA 3FMRA 3LFKA 3TL4X 2EV0A 3S2DJ 3H3ZA 3OR2C 3SYTA 2XASA 3AAFA 1IG7A 2OC6A 2I8DA 4WXDA 1SD7A 1JTXA 1P4XA 3VYTB 4I99C 2OD5A 3ABKH 3F9KA 3HYIA 5IYBJ 4B8XA 1K6YA 1LDJA 2DK8A 3C3WA 5KAFC 2UXNA 1WWXA 3DFGA 4HSRA 1FBQA 1J09A 2HYFA 4RBOA 1K83J 2MGQA 3MAJA 2JT1A 1IRZA 2L7FP 4UB8C 3ERED 2VKVA 3JRBA 5E8IA 3DU6A 4BXUA 2R7UA 4B3XA 4D5FA 1T98A 2BXYA 2FRHA 2ZXJA 3ELKA 3JCUC 5K5RA 1MBJA 3IH4A 3BY6A 2R7XA 1JGGA 3CC4I 1TZLA 4C2UA 4L5EA 4HLYA 4KIGA 2L7MP 1YW8A 2ZXIA 4FT8A 1MMSA 1ETWA 1JT6A 5CQGA 3OOUA 3QAHA 5FKKA 3DCFA 3ZXSA 2TDXA 2V7FA 1TQMA 2AQFA 3Q9SA 3VYRB 2EWNA 3BOQA 1VQLI 1XGNA 1OFCX 3HTSB 4M3DA 1PYVA 4II3A 1XN7A 3Q0UA 1RIOH 1S7AA 4ZJZA 1FBSA 2CH0A 4PGHA 3LQQA 3ZMDA 1F5TA 3VFZA 1YRNB 3IKVA 1R1VA 1HC8A 4XLFA 4BQNA 4H0EA 5FRMA 2BY0A 2EFNA 2Q0OA 4PJMA 1U9OA 3WTWC 2KP6A 4ASNA 2A68F 4MTEA 3BDDA 5EZHA 2EQRA 2VXZA 1PUFB 4A3KJ 1RR7A 3ABUA 1VQ5I 4CXFA 1IV6A 3QRFF 5GPAA 4FE7A 4PJJA 3VWBA 4EMSA 3HTUA 2Y75A 5BS6A 1S72I 4E7JA 5E18F 2Y2ZA 3K4JA 4YG2F 3OV8A 4BJ6C 3OYGA 1FT9A 3DTKA 3I71A 2DW4A 2Y0SN 2GAUA 3ABLH 3LA3A 2OUMA 5EYRA 3BC8A 3CUQA 3S2WA 1Y1WJ 1DGWY 4IHVA 5DEQA 3CUQB 3H5RA 3BPXA 2WTEA 2M4KA 5GTIC 4UV8A 3FMQA 2WAFA 3L2VA 3HIFA 4MFEA 2GXAA 5BOXA 3KPHA 1SMYF 2N8GA 1U2WA 3ECHA 5J4VA 1H88C 1SFEA 5DD4A 1WGXA 4AIDA 2HEOA 2B0LA 4L0YB 3AL0C 3OWTA 4PJLA 2MFZA 1AWCA 5C44J 1WJ5A 1YW7A 1BR2A 2VJIA 4V2FA 3OYBA 2Z33A 1GXPA 1ZQ3P 2H6CA 2HOTA 3BG6A 1E17A 1OR7A 2MD5A 2Y69H 1ENHA 2VKEA 2DBBA 1R5HA 3LA7A 4IHSA 2CW7A 1Y0UA 1P7JA 4IHWA 1DGRM 2E35A 3OR1C 2UWMA 4M9ZA 2CSOA 3QPLA 1P7IA 4RLQA 5CJ9A 4BQOA 1RKWA 1SD4A 4GYGA 3S15J 2HYJA 5E3OA 1FC3A 2EBIA 1VQ9I 1LFUP 2V1XA 3EPZA 3G4SI 1ZG1A 1Y56A 4L9JA 2GIVA 2MW8A 3GEZA 4WXHA 1MW7A 2G9WA 2MSYA 2KQRA 4A3JJ 3K4KA 1SFOJ 5F6FA 3K9TA 3TMOA 1QVTA 4F92B 1O7FA 2RAEA 1R5ID 4OMZA 2DPDA 3HOTA 4BHBA 2HFHA 2OCEA 1BW5A 4DYQA 3FBNB 3E3VA 4E4HA 5M3MJ 2LY2A 2BY1A 4GCVA 4UNOA 1QQIA 2WV1A 4AU7A 4BY7J 2LKSA 1ETVA 3DPUA 4HBLA 3RSNA 3CLOA 2XB0X 3LSKA 4HDVA 2JTVA 5EEAA 3CCUI 2H09A 1KU2A 1XSXA 1S3JA 4CDGA 5FKLA 3I54A 3O8GA 2HDDA 4UV9A 2HXOA 2ZO4A 1ETQA 3P9IA 1LNWA 2X48A 1X1AA 2JVGA 3RI4A 4KISA 4ZYHA 4N4OB 4CCJA 1D3YA 2O7OA 3TKYA 3F22A 1H0MA 1BI3A 1Z7UA 1HKQA 2CYYA 4BYYA 1T39A 3Q9VA 2PX9A 5F64A 2DPUA 2X6XA 4EM0B 3ZQCA 2JA6J 3DLAA 4U7BA 1I50J 1JGSA 1VQ6I 2FXAA 4JX5A 2KJCA 2IS6A 3ASNH 3WTSC 3OOPA 2R5YA 3HSRA 1TC3C 2STTA 3S1NJ 3H3UA 3BTIA 2L5QA 2R5YB 3GTKJ 4HQEA 2G7UA 2WA0A 1IAWA 2WBMA 5FROA 3NRVA 1WJCA 3J7AY 2W7NA 3E0JB 1USTA 3R0AA 3QU3A 2M2EA 2LF7A 1V5EA 3K4NA 2DA6A 5FGMA 5F0HA 4MGRA 1D5VA 3BG9A 2QWWA 1KQ0A 3V7RA 4G6QA 3EUHC 2ETHA 2BY3A 1W36C 2KRFA 2R3SA 2IA0A 2W24A 4HNVA 2D45A 1B4AA 3FMSA 1XPXA 4N0BA 3VSLA 4W97A 3M4OJ 4NUBA 1BA5A 3HHGA 1SFKA 1ACIA 3TOBA 3I55I 4BDYA 2YU3A 4HEA2 4O3MA 3JAMK 1RUNA 3NWSA 1MNDA 5TISC 1YX5A 3ZR8X 2CGPA 3HSEA 4LLGF 4Y4RA 3IC7A 2E1MC 2CQQA 4D0PA 2JSCA 2ZFWA 1D1AA 1TLHB 3CCEI 5IPAA 4UY8I 2L7ZA 1BOAA 4HF0A 3VPRA 2VBZA 2VASA 4ZH4F 3IRRA 2E1OA 3CCSI 2ZCWA 2D2WA 3B73A 3DTIA 2LF8A 3QP5A 2K40A 4ESJA 2VQGA 2EZKA 2YX7A 4HV5A 3V7SA 1OISA 3KEOA 5FLXZ 1LFPA 2EINH 2FOKA 3LSGA 3I4NJ 3BROA 3KYLA 2DFFA 2BEOA 4C3HJ 2D5VA 4A6EA 1LDDA 1FSHA 1Z7LA 3ISPA 4HF1A 5J1YA 1BIAA 2ZBKA 2M30A 3WTYC 1IN5A 4UUSA 1DQUA 1XX5A 2CFXA 2HNHA 2XAQA 4HX4A 2LVSA 2WB1A 4AD9A 3FISA 1BI2A 4Y3OA 1S29A 5EEHA 4MIMA 4KA4A 5AIQA 2CQ7A 2QA4I 1JKOC 4EGZA 3IH2A 4QSHA 1HW1A 4BJ5C 1NH3A 1H8AC 2QSHX 4YIRX 3Q5FA 5KK1A 1V5GA 4FHTA 4XN3A 1IV8A 4E6KG 1KONA 5LRRA 2EIJH 3I5UA 3N97A 3H35A 1ONVA 4DYCA 1MNMC 1QNTA 5IT3A 1S8NA 1WJBA 3E5QA 3WE2A 2O61A 1QO0D 4NDLA 2EPFA 4B43A 2VBXA 4WK8F 3M8JA 4JP0A 3FK7A 1DU0A 5LHIA 1T38A 4IX7A 2QKMB 3Q0VA 4AM3A 2LD5A 3MZYA 1FOWA 2HYGD 3EYIA 1RESA 2OZUA 2BHYA 1JJ8C 1NTCA 3ZPLA 3S17J 3ZMUA 1X58A 1YI2I 1Z0XA 2JPBA 2W57A 1BJZA 3K4BA 3S1QJ 3JTGA 3P5JA 3I58A 3BPVA 3KCCA 1FTTA 2M4GA 1MMNA 2KMUA 4RGRA 4MNUA 2JK3A 3M07A 1B59A 3CLQA 1OCTC 4OWRB 3JW4A 1ITYA 2MD0A 2HGCA 4KYWA 4ENJA 1ZH5A 1Z77A 2L9VA 4HSTA 1JI8A 3MN2A 2GXGA 5IOZA 1YLFA 2XPWA 1DDNA 4XKCA 3FZVA 4WWCA 4ESBA 4CCKA 4PFOA 1J7KA 4X0GA 2CS3A 1V3FA 2FBKA 1NK3P 4E70A 1VFCA 3GZNB 1MGTA 3GCMA 2HQ5A 3M7GA 3MKZA 3Q3SA 2LOOA 1BI0A 4NNJA 3S14J 3A2KA 3C2BA 3BZKA 2FNPA 2W48A 2R93J 4OOIA 4P9FA 3T5XA 4FX4A 3CDLA 4CH7A 2VN2A 2KIMA 3J7YJ 1X1DA 2LLKA 3CCLI 2VQHA 1XGOA 1Z6RA 2HS5A 3RDIA 2KFDA 5E17F 4P55A 1OPCA 1CF7A 5LFAA 2FQ3A 4L9NA 1CF7B 3KZZA 3WE3A 1RRJA 1MSFC 3HSFA 2P6SA 2M87A 5E8GA 3ZQQA 3EETA 2KDZA 3CD6I 3REOA 5J1RA 3ZMTA 4UUVA 5D5XB 5B66C 1KYZA 2ZJPF 1DPRA 1ULYA 2JUCA 3ERMA 3K4CA 1VQMI 4K2EA 3IH3A 1U8BA 4MHGA 2FQ4A 3RCOA 4ABZA 4NB5A 5AIPA 1X1PA 1Q1HA 3L2WA 5K7HA 3HUGA 4BY1J 1FSEA 3V8JA 1YJ9I 3ML6A 1RETA 3K7AJ 2GQQA 2DA4A 4B4CA 4HAMA 1BJAA 2ZJQF 2VT3A 1KYWA 4HV6A 4L5IA 3ZN1A 4XN0A 4M3GA 2F4OB 5GTHC 1R1UA 1IUFA 1N75A 4DOZA 1OCZH 2DLLA 1ZLKA 3G2BA 4A2UA 1OR7C 1UG2A 3J81Z 2L4AA 3FKJA 2LH9A 4U87A 2HOSA 3EYYA 2FOWA 4HRIA 4HDUA 1TT0A 2O0YA 4JQFA 1G3TA 2VQCA 2IGMA 1O57A 3A01A 2ID3A 4F52A 5HODA 2K9MA 3S3OA 1MDMA 3A01B 3I53A 2K85A 1F1ZA 5D5WB 4ZC3A 1MDMB 2GA2A 2YPRA 1KGSA 5CKTA 1IRXA 4DZJA 1UELB 1BOBA 3SDBA 3KP6A 2VJ5A 3H5NA 3BG3A 2EFOA 4RGUA 3MFKA 3JRCA 5K5QA 2A6HF 1LJ9A 4A3BJ 2DTZA 3KP4A 3MQ0A 2E60A 3S2HJ 1RPWA 5ICFA 1Z1DA 2JSPA 4A0ZA 4IOAF 3F6OA 3TGNA 4ENMA 3BG7A 1A04A 1P6RA 3L9FA 3KYCB 1GT0C 3RPQA 5LHGA 2VBYA 2B9SA 1D0ZA 2A05A 3RIRA 3L2RA 1GVDA 5GAGJ 2K4JA 4C2TA 1G3YA 2NS0A 5L3EA 1W1WE 2GWRA 1EKEA 1A31A 4XONA 1TNSA 2X51A 3ONQA 3SXYA 2X6OA 5M5YJ 3DXJF 2IA2A 2XB5A 3I59A 3RKWA 4XSZF 2CUZA 4LB5A 3I59B 3CQZJ 3HOXJ 1WRJA 1P92A 4BE2A 4KFCA 5F0CA 2MBFA 2IXSA 2HVQA 2JUGA 1JHFA 2K3PA 3A02A 1D5YA 3H3VK 3V8LA 4P9UA 3H9GA 4BGDA 4L5JA 1O3SA 3F3XA 4JX6A 2WY8Q 1TQPA 5HDKA 3CESA 4QPOA 4PSXA 4W1UA 1TBXA 2H8WA 2IVMA 4HA8A 3CP2A 4ZYEA 4OU0A 1FLIA 2XVCA 3M8FA 1D0YA 4HX8A 1WH5A 4IPAA 3AKZA 2RGVA 1XC5A 2HQRA 3L1PA 4RB2C 2XF6A 2XAUA 3DWLE 3E6MA 5E1XA 2L9NA 3M1CA 2H8RA 3KLOA 4XICA 1XDSA 4V19K 2WB1N 4DBRA 1T56A 2EV5A 3RJPA 1WJFA 1QVUA 1Y8RB 1R4MB 2FJ1A 3K1NA 3HOWJ 1SMTA 3PNTA 1HW5A 4H4KC 2DQLA 1BW6A 3P7NA 4D7MA 3MZ8A 2A07F 1N25A 3GTGJ 4LLLA 4ZTFA 2RKHA 2MH2A 3RQ4A 2AO9A 2NYXA 1GXQA 3HGYA 3H9QA 2CWEA 5KVRA 1E3PA 2VC0A 1R7JA 4YFKF 4IHTA 1Y39A 3F23A 1HKSA 4XORA 3FHZA 4PFPA 3K4LA 5DD8A 1MIJA 1D8JA 5CQEA 2KHMA 3U1DA 2B7EA 4RB0A 4HNTA 3OYDA 5D4RA 4Y13A 2GZWA 2V6CA 1G59A 3JR9A 3RKQA 1YIOA 4HPQA 4II2A 4C3JJ 1ZK8A 5IP7J 2XROA 3R0JA 4Z2YA 4CZZA 3OYAA 4AUXA 4EJVA 1XSDA 3CJTB 2JRMA 3GW2A 3X2QH 1U78A 2I10A 1N77A 4OAYA 2L2OA 4G94A 2DFIA 2R7OA 3PNVA 4BQAA 4A6DA 2L54A 2E5ZA 4LIUA 2JZYA 4YEJA 3V42A 1MSEC 1X4PA 3NWTA 3CCVI 3BZ6A 2Z1DA 3RKXA 5M5XJ 2WWYA 5FD6A 4IXAA 1BR4A 4CCLA 9ANTA 1APLC 1EF4A 4ITVA 3DBLB 1GUUA 2JA5J 1TNTA 2KDOA 3VDXA 1ZGJA 5HNHA 6PAXA 3G73A 4KUMA 2HI3A 2X1EA 3PIOF 2L7KA 4HYEA 3DBHB 3QWLA 5DUIA 2RNJA 1WI9A 2FSWA 2Y0MA 5D5UB 2XV4S 1AHDP 2Z5UA 4XMYA 2LFBA 1ETYA 2CUFA 3BLYA 2LREA 4DW6A 2BGCA 2ME0A 3SZGA 4F55A 3D1NI 2WY7Q 5HLHA 4HQMA 2A69F 2EK5A 3ASOH 4ZYAA 5M5WJ 1RNLA 2ZMEC 4AC0A 2QBYA 4M74A 1NK2P 2QBYB 3JSOA 1W5CC 2DJIA 5L3DA 3GFMA 1YIJI 1V55H 2R7ZJ 1D1BA 4CO8A 3S32A 5BQTA 1FOYA 2HZTA 5FLVA 5EG0A 2DOEA 3RYRA 5EG0B 2K7LA 1Y6IA 2DYRH 2OTJI 1W7PD 4XLEA 1MMGA 2XKPA 2P5VA 1I6HJ 3VSKA 2KT0A 2FNAA 1YQAA 1IW7F 1UFMA 1ZR2A 5LHHA 4JBAA 2HTJA 2OZ6A 4KNYA 1W36D 4XIDA 2E19A 3GTLJ 2FX0A 2FUG2 5HS9A 2HVRA 1M1EB 2EFWA 1R4NB 4XNFA 1RZ4A 1VNDA 3KZYA 3L2QA 2IAIA 3LSIA 1GHCA 3IL2A 1H9GA 4WCGA 3ROUA 2CV0A 3BCAA 5FKNA 4XK4A 4IJAA 2VKDA 1PP7U 3FHNA 2PFBA 2E5NA 4E7SA 1BI1A 3AG2H 3W2WA 2GOXB 3LQRA 2WV0A 5DYMA 1R71A 2BXZA 3ZN0A 3DKYA 3F0CA 3GVAA 3OY9A 3D5LA 2DU9A 2QUFA 1TT5B 4RLFA 3CMYA 1HLVA 3TP0A 4QPQA 2XAFA 2FE3A 4CICA 2V79A 2OJED 1U5TA 1Z67A 3IHUA 1T33A 1U5TB 4DNCA 3JRDA 1ON2A 3ZCOA 2F5VA 1LVKA 1ZELA 1K6OA 2RVCA 2NVUB 4E7ZA 2W25A 5ICEA 2HTSA 2CJJA 4OIQF 1D0XA 3G6EI 1LKXA 1I39A 1KU3A 3AG3H 2OPTA 5F08A 1IN4A 4BHPA 1IXCA 3KZIC 2GIZA 4P1WA 2E7XA 2ISYA 4BL0B 4UXNA 5EDNA 5E3NA 3RZOJ 2HU9A 2VPLA 5HDNA 5LLQA 4RAFA 3RZDJ 2QLZA 3LAPA 4XBFA 1FIPA 1QPMA 3HXLA 1KU9A 4LJZF 1KQ8A 4EJWA 4BHCA 5GAHJ 2FEZA 4GRIA 3HOUJ 2HOAA 2COBA 5E1ZB 2VODA 3BR1A 2GLOA 3GLXA 4RAGA 1R36A 1I1GA 1ZG3A 3AG4H 1QGPA 1J0RA 3FXRA 5FO5A 5KHDA 3EUAA 2E71A 1FWZA 4RMNA 5IYDJ 3BTJA 2DCEA 1WJEA 3O2PE 3K1PA 2HWVA 3CMAI 1B8IA 3WG9A 4BE1A 2R7WA 1T0FA 1B8IB 3M3YJ 1G2HA 2VIXA 5J6XA 4YIIA 2ZXHA 3PM1A 1XSVA 3OS0A 5CVIA 1FOKA 1WI3A 1R22A 4LIVA 4IF4A 3OYEA 3MMYB 2LNBA 2R5ZA 4CCMA 3K1MA 3TO7A 2R5ZB 3PJRA 4UHTA 2XGXA 3RTRA 1YS6A 3CCMI 3GFJA 3S93A 5A2QZ 3HOVJ 1EH8A 3ABTA 3QPSA 2R7DA 3WHCA 2P5LC 4BXXJ 2ECCA 3SDGA 4I09A 5FLXK 4L9TA 2FBIA 2ADUA 3G1MA 5HS7A 3MEXA 2LMDA 1EA3A 2NOJB 2P7CB 5BPDA 4G8XA 1FP2A 4XLAA 3KEQA 3OIQA 2QEXI 4B09A 2PEXA 2W1OA 1LB2A 2HKXA 4IHXA 1R9TJ 4EGYA 3B02A 4U7DA 1SAUA 1OCPA 3DPLC 5B3SH 1TW2A 4G7HF 2IT0A 4M3EA 4J19A 3CO6C 1KQ9A 2EZLA 2RC4A 2XKOA 2K9SA 1I6XA 1JXSA 2XDVA 2EFQA 3CMMA 1ZKGA 3LNQA 1LPQA 3K2AA 4QTRA 5H6QA 2EA2A 1MD0A 5IP9J 1YX3A 2FA5A 1TWHJ 2JMWA 2M0CA 5F1JA 3PUBA 2X85A 4G12A 3L2CA 3GTPJ 5JHFA 2QGUA 3MZHA 1LVAA 1QBJA 1WCMJ 4I2OA 5BPIA 2P0WA 3B6CA 2P5KA 2FMLA 3SHFA 1JUMA 2KIQA 3K70C 4XRMA 3H1CA 2YU9J 2QF7A 3ZMZA 1YFHA 1GV5A 1OQYA 4M71A 1A35A 2R4GA 4KMFA 3ZQHA 4Q5SF 2G7HA 2BBYA 5L3CA 5HOOA 3FBIB 3WTXC 4IRGA 4EEFG 2F5EA 2F4IA 5ILUA 1O3TA 3NQOA 3QU6A 1STZA 1WH7A 2BW3A 2M1BA 1OYYA 4NBQA 3GTMJ 1MBHA 2BW3B 3ABMH 2EZIA 5HLTA 3EUKL 4MLOA 4UUSB 2HR3A 3M9AA 1U6GA 1J5YA 1GDTA 1ZGWA 1IRGA 2WAQA 2EIMH 2MABA 2X4HA 2EB7A 1Q1VA 3BTCA 5DM6F 2RV8A 2OQGA 1ZARA 1MH3A 4YFNF 2UXXA 2OV7A 3HDDA 4OIOF 2XHKA 3D0SA 4M6VA 1FYKA 1GLNA 4C3IJ 1V54H 4IHYA 2V4JC 5H20A 4S05A 2P6TA 4LMYA 3FF5A 5EZGA 3LMMA 4BH9A 2L9SA 3OL4A 3K2ZA 1QA6A 5L3FA 2W00A 3LSPA 1R6RA 4EM1A 4D9JA 1SFUA 2L02A 2EA4A 1K78A 5LGUA 4FE4A 4XRSA 1FOXA 4EQQA 5K7FA 3IV5A 1K78B 2IRFG 1BBYA 2IGKA 1H89C 2BV6A 3OIPA 4CYDA 1S5LC 1ZLJA 2W84A 2FF4A 1SC7A 3KFWX 3V7CA 2VBWA 1DU6A 4ZDLA 3WU0A 3ZQIA 4M72A 4ESFA 3O6BB 4JK1X 3IKTA 1DP7P 4U0YA 5C4XJ 2Z3YA 4MEYF 3WTTC 3S1MJ 1T2KA 3P9CA 2PJPA 3PFIA 4ZDOA 3IWZA 3FKIJ 1O4XA 4ZYDA 1F43A 2PMZA 3W2AA 4Q47A 2O8KA 1ZREA 5F27A 3KP2A 1MJ9A 3EDPA 1IN7A 4PK4A 5FKMA 3T8TA 2KIUA 2R92J 3U21A 3J81K 3U9GA 4ANJA 2NNYA 2UV1A 1EV7A 2AS5F 4IOCF 4BEHA 3JRAA 3H92A 1LFBA 3K4MA 3K0LA 3VYSB 4BEHB 2MH9A 3C1DA 2K9QA 5K7ZA 1VQPI 3UNGC 1G3WA 2H1LA 2XGCA 1S7OA 1QHGA 2FU4A 4AYBA 2HXIA 4BS9A 4DIQA 3RYPA 2ZC2A 2XSJC 4BQQA 3A03A 3CMEI 3M8EA 4NC7A 3AL0B 3K69A 2GA1A 4BXFA 1R5GA 1B6AA 2XPVA 3MWMA 4KMUX 1WVRA 3CUQC 2LTPA 2Y31A 1FP1D 3WU1B 2ID6A 4U88A 4R1HA 4E7LA 1EH6A 1XTAA 1WPKA 4NC8A 3MCZA 3PUFA 2H27A 3JRGA 2CQXA 3LL7A 2K02A 2YSRA 3F8MA 1G8XA 3DPTA 3BJOA 3GTJJ 2IS2A 2M8EA 1PJRA 4LB6B 3HUGB 2VT2A 5HLGA 3C2HA 3GX4X 1WJAA 3LSHA 3CTAA 2XAGA 1U8RA 3NARA 3PO2J 4OINF 2E2IJ 2EIKH 4AIJA 4MEXF 1U0JA 4JYKA 3KEYA 2ICWG 1MBEA 3VEPA 2IPQX 2M34A 3CF2A 3CJNA 3IP4B 5E3LA 1B1BA 5E1WA 3OSGA 2NRAC 4YELA 2XF5A 5ED4A 2OTLI 4XKBA 2E1NA 1X3WB 3A1YA 3FXUA 3GMEA 3KYDB 1G6NA 3AG1H 3TEDA 5KAIC 1WHUA 4LK1F 1UHMA 4HW0A 2ACJA 3L09A 5IT9Z 2AXLA 2HKOA 3LOCA 2CV2A 1IRFA 4U0VA 4L0ZB 3SZTA 1IN8A 1BIBA 2QCOA 2LSOA 1FZPB 3W6KB 1BR1A 2YUSA 2CRGA 4A0YA 3GUDA 1Z91A 5ICCA 5EGOA 2DA3A 4UVAA 5EGOB 3BR5A 3SZPA 2RQPA 3ZOBA 2J5OA 2LYCA 2LY1A 3SFIA 4PDKA 3OYNA 1BC7C 1HW2A 4Z6YA 2JA7J 2DFHA 3KE2A 2ELKA 3G71I 5GPCA 4CHUA 4A3GJ 1ETKA 4PGGA 1UG0A 1U9NA 2QQBA 3E6CC 2DI3A 5JI6A 2Z2SB 3FK6A 4KN7X 4I02A 4PCQA 4CUGA 1A6IA 1MBGA 1HBXG 2EILH 1VQKI 2FBHA 2CQKA 5D5VB 2AQEA 4N9IA 4I0BA 1H9TA 3PFYA 2B63J 2Q8KA 1OYIA 3TW6A 3JRIA 1AA7A 4BNCA 2F2EA 3QPTA 2K27A 1BC8C 3QOEA 1G3SA 2IEKA 3H5AA 4Y52J 2BHZA 2FMYA 2JVHA 4OMYA 1DUXC 1Z3YA 4RS8A 4AIHA 1YS7A 5LD2C 1QHHD 1XMKA 3R6SA 1MZBA 1ZN2A 3WTVC 2O3FA 4CA0A 4G9YA 3DF8A 1TQIA 2F5FA 1Z6TA 1RR8C 3G1OA 1O3RA 2BZTA 2EFPA 3BZCA 4FQGA 3W3CA 3NAUA 3L2UA 1ON1A 4F7ZA 5IY5H 5ERIA 3TP3A 1FBUA 3ZQGA 1E3OC 2LR8A 3CP8A 3KP7A 2DO7A 3GF2A 3EUHA 2P8TA 1GV2A 4D1QA 4BBSJ 3ULQB 2Q2EA 3TQNA 1X3ZB 5E20A 1IF1A 2CQNA 4A3LJ 4E7IA 3D5RC 2K9LA 2DYSH 2GOMA 5H6RA 5IYCJ 1V4RA 3MD2A 2WAQN 1MMAA 2GBYA 2VJJA 4DYRA 2E1CA 4PSWA 1J9IA 4LK0F 3OYFA 2NXNB 3P9KA 2M7BA 2E1MB 4IRHA 4XOPA 4X6AJ 3M1EA 4S04A 3WGIA 3PQKA 2VJ4A 5JVTA 4RGSA 1MBFA 1ZTRA 3PSFA 3BR3A 3DQVC 2HDCA 1SFXA 2X1CA 2AHQA 4M9XA 3BG5A 4M73A 4CYCA 2CG4A 2VQLA 3G1LA 4CYCB 3DU5A 4C9YA 3TBIA 2DK5A 2CFOA 3FXKA 2PQ8A 4IEJA 4AIKA 1SVMA 1RUOA 3EQLF 3LSRA 3FDYA 3HEFA 5FD5A 2O03A 4M6XA 1VQ7I 1R58A 4O6JA 1Z05A 2KRHA 2P4WA 2VXDA 3S16J 2O5RA 1F9NA 5DTDA 3HC7A 4CSWA 4IL6C 1HCRA 3H36A 2L3DA 5L3GA 2V1DA 5LGNA 5LEKA 4I01A 4MO7A 2VUMJ 2DQRA 4IO9F 2IGNA 1YYVA 2OBPA 1OCCH 4GGGA 3OYMA 3QOPA 4C30A 5FFZA 4Q4ZF 1UHSA 1ODDA 2LC2A 1WKMA 1VF9A 1I1SA 1MBKA 5B5EC 4KITB 1VQ4I 1XMXA 3W6VA 2K86A 3TO9A 1WJDA 5EJCA 2VL8A 1HSTA 1K7AA 2QKLB 2DMPA 2UZKA 3DEUA 4U0WA 1YG2A 5C4JJ 2PMZN 3K10A 2X6WA 2A61A 3KP5A 2HPIA 1IUYA 4QLCU 2RREA 5HVQC 1CQTA 3J80Z 4L9VA 4BACA 3E5UA 1YOVB 2MG4A 1XGMA 1WSUA 2KISA 2ZB9A 1KZHA 2JN6A 3WU2C 2E2HJ 4KICA 4ZZDA 3R60A 2PI0A 1OCRH 1X3UA 4AYBN 5HS8A 3OYIA 5FFXA 2E34A 1QPIA 1HDDC 3CZ6A 4KDPA 3VODA 1WFXA 4IVNA 3SEZA 3LAJA 1D1CA 5FKOA 1HDPA 1LEAA 4NC6A 2JA8J 4EVIA 4QWQA 1DPUA 4Y15A 1RKTA 4OIRF 3HZJA 3TDUC 3CF5F 4RA2A 5FB2A 5HDGA 3OYHA 1YRNA 1NG6A 5JR3A 5D8LB 2M0MA 1BM9A 5B1AH 1ERDA 2EZHA 2V9VA 4XLPF 1VQOI 2VI6A 5GADJ 1ZR4A 1CGPA 3FXLA 1ZAOA 2QQAA 1K61A 4DBQA 5DM7F 2K3FA 2DDBA 4NQWA 1PUFA 2NOGA 1ORKA 2ZSIB 3F21A 4NQWB 2E7WA 3HRSA 2LKPA 4RDUA 2ISZA 3BR6A 2JJ7A 1B9NA 4IZZA 3C2GA 3H0DA 1G4DA 5CVJA 2M3AA 4G7ZF 3I56I 1HQCA 5J4YA 3PL8A 3CJRB 1IXRC 5J8FA 2A3SA 2F5CA 4A93J 3G3ZA 2J5PA 3CCYA 1JKQC 2MC3A 1BN5A 4PUSA 2HQNA 2CU7A 5JLXA 2ZFUA 3LSMA 5H2FC 5LEJA 1L3LA 1POGA 1U3EM 2R7FA 3A0HC 1USSA 2PG4A 3F8CA 2NVQJ 3CC7I 2CO5A 4WF2A 4ETSA 3PO3J 2XAHA 3HGGA 1XG1A 2HZDA 2VOPA 3A4CA 3V4GA 4L18B 3ECOA 4A3MJ 3K70D 3RPUD 4BU2A 2M5WA 4J01A 4A3IJ 1TWGJ 1J59A 5DUKA 2Y30A 4RB1A 4FISA 2DDAA 3WHBA 4YIFA 5JHUA 2ZKZA 2V1NA 1IO2A 3TW7A 1KA8A 1HSJA 1P4WA 2O9LA 2CUJA 1K4SA 2MLKA 3UKGA 3ZQ7A 1FY7A 1J2XA 3IAM2 5JFRA 5LGTA 4MFDA 1LE8A 1X19A 2KJBA 1LE8B 4ENKA 1P9QC 3CUOA 1T08B 3CCRI 4ON0A 5J3LA 2D1HA 2BVLA 2ESNA 4JX4A 1L0OC 3LFUA 4UVBA 3WG7H 4UUTA 2OCCH 5A2QK 3DP7A 2K4BA 4KIFA 4OAZA 3S8PA
chains in the Genus database with same CATH topology
1J75A 1AOYA 2PN6A 5CLSA 3N4MA 5DCFA 3GWZA 5AONA 2STWA 3JSPA 4DQ2A 4AWXB 1QZZA 1SAXA 3WTZA 2PMUA 3L00A 3I0TA 1O7LA 4EJOA 4LFUA 2VE9A 3KETA 2H94A 4KN4X 1XCBA 3E6DA 3WGGA 2BE5F 3LA2A 4N9HA 1FPQA 1W5SA 1YW9A 4A5MA 1YO5C 2PMHA 1I5ZA 2BYVE 3T0YA 4LGWA 2IP2A 3RKYA 3T1BA 1YTYA 1LQ1A 5F1RA 3FX3A 5J8CA 3F72A 5CVVA 1D8KA 4LLNA 5ILSA 4O5VA 1MKMA 5HLIA 1C0WA 2OAZA 1I27A 5CVUA 3TDZC 3I4PA 4R8HA 1JHHA 4Q48A 3BJAA 1EH7A 1QZYA 1SD5A 2DTRA 1T6SA 2Z9OA 1Z9CA 4I0AA 3C18A 1XMAA 5D6EA 2YR2A 4FX0A 4G6DA 5D4SA 2A5YB 2RN7A 4A12A 1K79A 4LG0A 3LSTA 4LG0B 4HF2A 3FM5A 1UB9A 1IN6A 1ZGAA 2O6GE 5BMZA 5ICGA 2XUBA 1W5TA 3HRMA 4RGXA 4RB3C 4M9SA 4NHJA 1MJAA 4HZFA 3ZMSA 2M45A 3HOSA 2VC1A 5ILVA 1ZG5A 1W4MA 3HRTA 2XIGA 2D1VA 2EJRA 5CVRA 4GO1A 1OMIA 3FM3A 3SFZA 4ZYGA 3I64A 3R61A 5D8KB 3ZMVA 2WC2A 5LRSA 2MLGA 2DAOA 4MQ9F 1HKTA 3DKWA 2IA1A 3CDHA 4A0XA 2ZNZA 2QVOA 3WTUC 1UHWA 1XGSA 4YFXF 3JAMZ 1XCVA 3GZ6A 4TV7A 2QQ9A 4I98B 1ZYRF 3T8RA 4M6YA 3KLNA 2ZMEA 3E97A 4P5OA 5DCMA 4HOBA 1KU7A 1WQ2A 2ZMEB 5DCMB 1IZ1A 3F6VA 3O3KA 4HX7A 5EEGA 4KT5C 4R79A 4OIPF 4ZZLA 2QZ8A 2VE8A 3LWFA 3COAC 3VOEA 3E5XA 2ZNYA 1FNNA 3CO7C 1ZRFA 1FX7A 1R00A 2L4MA 2Y48A 3GYHX 2LDUA 1GVJA 1REPC 4AVPA 5IT9K 3GFIA 1TTYA 3U2RA 1S6LA 3GFLA 3VB2A 4G7OF 3V8KA 3HRUA 3L7WA 1ZRDA 1XD7A 4Y17A 1ZHFA 4RAYA 3F8NA 5L3BA 2KKOA 4GXOA 2H6BA 2W85A 4ENNA 2COMA 3W6JB 4HLXA 4A5NA 1R23A 4UVCA 1NHAA 3R4KA 1UCRA 1PDNC 5LBQA 4CGZA 1LEBA 3HHHA 1SD6A 3F8FA 3BP8A 4MQVA 4EM2A 3FXQA 3IWFA 4IRIA 1U5TC 2IJLA 3JTHA 1OKRA 1FYLA 3J7AO 3KP3A 5DDGA 4EJTA 1RI7A 3TOAA 1E2XA 2PBIA 4BAYA 1FYMA 3F8BA 1MJBA 3DV8A 5TJJA 3TO6A 2P7VB 4I7HA 2A6EF 2YX4A 5TRDA 2QYOA 1P2FA 4EJUA 4MTDA 4LD5A 4XLNF 4EV0A 2OQRA 3PQJA 2JRTA 2C6YA 4WXCA 2EV6A 2ELHA 2HOEA 4GYIA 1ZRCA 5CYVA 1OYWA 2OU2A 5K5OA 2F5DA 2VOOA 2RDPA 4P96A 1XB4A 4XRFA 2V1UA 3ZP5A 1W7PA 1B9MA 2O8XA 3QP6A 2GXBA 1W7PB 1LDKB 1IXSB 3GXOA 2KIFA 4RAZA 3BJ6A 2L01A 2IW5A 2VONA 1PP8F 3GZ5A 2QENA 2XRNA 4PZJA 1JE8A 5D6FA 3NEUA 4KIBA 3WODF 1XDUA 2NAZA 2X0LA 2ZJ2A 3WGHA 1HXDA 4XSXF 3J80K 1TW3A 2QM3A 2OA4A 5K1YA 3RPUA 2DT5A 3C7JA 1O3QA 4WX9A 3GO5A 3E6BA 3BWGA 2PLYA 3FWEA 2XAJA 2Z99A 3IRQA 3SQNA 2ESHA 1PUEE 3QPHA 1R1TA 5DV5A 1F4KA 2JPCA 2CW0F 2NNNA 2MA3A 1P4AA 1VTNC 3FMRA 3LFKA 2EV0A 3H3ZA 2XASA 3AAFA 4WXDA 1SD7A 1P4XA 2OD5A 4B8XA 3HYIA 1LDJA 2DK8A 3C3WA 2UXNA 1WWXA 3DFGA 1FBQA 2HYFA 3MAJA 2JT1A 3ERED 5E8IA 4BXUA 1T98A 2FRHA 2ZXJA 3ELKA 5K5RA 3BY6A 4HLYA 4KIGA 4FT8A 1YW8A 3QAHA 2TDXA 1TQMA 3Q9SA 2EWNA 3BOQA 1XGNA 3HTSB 1XN7A 1RIOH 3EYIA 1S7AA 1FBSA 4PGHA 3ZMDA 3LQQA 1F5TA 3VFZA 3IKVA 1R1VA 4H0EA 2EFNA 2Q0OA 3WTWC 4ASNA 2A68F 4MTEA 3BDDA 2VXZA 3ABUA 4CXFA 3QRFF 4EMSA 3HTUA 2Y75A 5BS6A 5E18F 4YG2F 3OV8A 1FT9A 3I71A 2DW4A 2GAUA 3LA3A 3CUQA 3S2WA 5DEQA 3CUQB 3BPXA 2WTEA 4UV8A 3FMQA 3HIFA 5BOXA 1SMYF 1U2WA 3ECHA 1SFEA 5DD4A 2HEOA 2B0LA 4L0YB 1AWCA 1YW7A 2Z33A 1GXPA 2H6CA 1E17A 1OR7A 2MD5A 2DBBA 1R5HA 3LA7A 4IHSA 1Y0UA 2UWMA 4M9ZA 2CSOA 5CJ9A 1SD4A 4GYGA 1FC3A 2V1XA 1ZG1A 4L9JA 2GIVA 3GEZA 4WXHA 2G9WA 5F6FA 3K9TA 1O7FA 4OMZA 2DPDA 3HOTA 4BHBA 2HFHA 3E3VA 4GCVA 4UNOA 1QQIA 4HBLA 3CLOA 4HDVA 2JTVA 2H09A 1KU2A 1XSXA 1S3JA 4CDGA 3I54A 4UV9A 2ZO4A 3P9IA 1LNWA 3RI4A 4ZYHA 1D3YA 3F22A 3TKYA 1H0MA 1BI3A 1Z7UA 1HKQA 2CYYA 4BYYA 1T39A 3Q9VA 5F64A 2DPUA 4EM0B 4U7BA 1JGSA 2FXAA 2KJCA 3WTSC 3OOPA 3HSRA 2STTA 3H3UA 4HQEA 2G7UA 1IAWA 3NRVA 1USTA 3R0AA 3QU3A 2LF7A 5FGMA 4MGRA 1D5VA 2QWWA 1KQ0A 3V7RA 4G6QA 2ETHA 2KRFA 2R3SA 2IA0A 2W24A 2D45A 1B4AA 3FMSA 4N0BA 3HHGA 3TOBA 2YU3A 4O3MA 3JAMK 1RUNA 2CGPA 3HSEA 4LLGF 3IC7A 4D0PA 2JSCA 2ZFWA 1TLHB 1BOAA 4HF0A 2VBZA 4ZH4F 3IRRA 2ZCWA 2D2WA 3B73A 2LF8A 3QP5A 4ESJA 2YX7A 4HV5A 3V7SA 3KEOA 5FLXZ 2FOKA 3BROA 2BEOA 4A6EA 1LDDA 1FSHA 3ISPA 4HF1A 1BIAA 2ZBKA 2M30A 3WTYC 1IN5A 2CFXA 2XAQA 4HX4A 4AD9A 1BI2A 1S29A 5EEHA 4KA4A 5AIQA 4EGZA 1HW1A 3Q5FA 5KK1A 4FHTA 5LRRA 3I5UA 3N97A 1ONVA 1QNTA 5IT3A 1S8NA 3E5QA 2O61A 3WE2A 1QO0D 2VBXA 4WK8F 5LHIA 1T38A 3MZYA 2HYGD 2OZUA 3ZPLA 3ZMUA 2W57A 2JPBA 3JTGA 3I58A 3BPVA 3KCCA 4RGRA 4MNUA 1B59A 3JW4A 2HGCA 4KYWA 4ENJA 1ZH5A 2GXGA 1YLFA 1DDNA 3FZVA 4WWCA 4ESBA 1J7KA 1V3FA 2FBKA 4E70A 1MGTA 3M7GA 1BI0A 2FNPA 4OOIA 4P9FA 3T5XA 4FX4A 2VN2A 2KIMA 5E17F 1XGOA 1Z6RA 2HS5A 3RDIA 4P55A 1OPCA 1CF7A 2FQ3A 4L9NA 1CF7B 3KZZA 3WE3A 3HSFA 2P6SA 2M87A 5E8GA 3EETA 3REOA 3ZMTA 4UUVA 5D5XB 1KYZA 1DPRA 1ULYA 4K2EA 4MHGA 4NB5A 5AIPA 1Q1HA 3HUGA 1FSEA 3V8JA 3ML6A 2GQQA 4HAMA 1BJAA 2VT3A 1KYWA 4HV6A 4L5IA 3ZN1A 1R1UA 2DLLA 1ZLKA 4A2UA 3J81Z 2L4AA 3EYYA 4HDUA 2O0YA 4JQFA 1G3TA 1O57A 1MDMA 3I53A 5D5WB 1F1ZA 1MDMB 2GA2A 2YPRA 1KGSA 3KP6A 4RGUA 3MFKA 2EFOA 5K5QA 2A6HF 1LJ9A 3KP4A 3MQ0A 5ICFA 1Z1DA 4A0ZA 3F6OA 3TGNA 4ENMA 1A04A 1P6RA 3L9FA 3RPQA 5LHGA 2VBYA 3RIRA 2K4JA 1G3YA 2NS0A 5L3EA 2GWRA 1TNSA 3SXYA 3DXJF 2IA2A 3I59A 3RKWA 4XSZF 4LB5A 3I59B 1WRJA 1P92A 4KFCA 2MBFA 1JHFA 3V8LA 4P9UA 1O3SA 4L5JA 3F3XA 1TQPA 5HDKA 1TBXA 2IVMA 4HA8A 4ZYEA 4OU0A 1FLIA 2XVCA 3M8FA 4HX8A 4IPAA 2RGVA 2HQRA 4RB2C 3E6MA 5E1XA 3KLOA 1XDSA 2EV5A 3RJPA 3K1NA 1SMTA 1HW5A 2DQLA 3P7NA 2A07F 4LLLA 2RKHA 2MH2A 2NYXA 1GXQA 2CWEA 5KVRA 2VC0A 1R7JA 4YFKF 4IHTA 3F23A 1HKSA 3FHZA 5DD8A 1D8JA 3U1DA 4RB0A 5D4RA 4Y13A 2GZWA 2V6CA 1YIOA 2XROA 3R0JA 4Z2YA 4CZZA 4EJVA 1XSDA 3GW2A 1U78A 4G94A 2DFIA 4BQAA 4A6DA 2L54A 2JZYA 3BZ6A 3RKXA 2WWYA 5FD6A 4IXAA 1TNTA 1ZGJA 6PAXA 3G73A 4KUMA 4HYEA 5DUIA 2RNJA 1WI9A 2FSWA 2Y0MA 5D5UB 2XV4S 2Z5UA 2BGCA 5HLHA 4HQMA 2A69F 2EK5A 1RNLA 2QBYA 4M74A 2QBYB 3JSOA 5L3DA 3GFMA 4CO8A 5BQTA 2HZTA 3RYRA 2K7LA 1W7PD 2XKPA 2P5VA 2FNAA 1YQAA 1IW7F 1UFMA 5LHHA 4JBAA 2HTJA 2OZ6A 4KNYA 5HS9A 2EFWA 1RZ4A 3KZYA 1GHCA 3IL2A 1H9GA 4WCGA 3ROUA 4IJAA 1PP7U 2PFBA 1BI1A 3LQRA 2WV0A 5DYMA 3ZN0A 3GVAA 3D5LA 2DU9A 2QUFA 2XAFA 2FE3A 4CICA 2V79A 1U5TA 3IHUA 1U5TB 4DNCA 1ON2A 1K6OA 2RVCA 2W25A 5ICEA 2HTSA 4OIQF 1KU3A 1IN4A 4BHPA 1IXCA 2E7XA 2ISYA 4UXNA 5HDNA 5LLQA 2QLZA 3LAPA 4XBFA 1QPMA 1KU9A 4LJZF 1KQ8A 4EJWA 4BHCA 2FEZA 5E1ZB 2VODA 3GLXA 1R36A 1I1GA 1ZG3A 1QGPA 1J0RA 3FXRA 5FO5A 1FWZA 3O2PE 3K1PA 2HWVA 3WG9A 1T0FA 5J6XA 4YIIA 1XSVA 1FOKA 5CVIA 1R22A 4IF4A 2LNBA 3K1MA 3TO7A 4UHTA 2XGXA 3RTRA 1YS6A 3GFJA 5A2QZ 1EH8A 3ABTA 2R7DA 2P5LC 4I09A 5FLXK 4L9TA 2FBIA 2ADUA 5HS7A 3MEXA 2P7CB 5BPDA 4G8XA 1FP2A 3KEQA 1LB2A 4B09A 2PEXA 2HKXA 4EGYA 3B02A 4U7DA 3DPLC 1TW2A 4G7HF 2IT0A 3CO6C 1KQ9A 2RC4A 2XKOA 1I6XA 1JXSA 2EFQA 5H6QA 2EA2A 1MD0A 2FA5A 3L2CA 3MZHA 1LVAA 1QBJA 4I2OA 5BPIA 2P5KA 2FMLA 3SHFA 3ZMZA 1YFHA 4M71A 4KMFA 4Q5SF 2G7HA 2BBYA 5L3CA 5HOOA 3WTXC 4IRGA 2F5EA 5ILUA 1O3TA 3NQOA 3QU6A 1STZA 2M1BA 1OYYA 2HR3A 3M9AA 1U6GA 1J5YA 1IRGA 2X4HA 2EB7A 2RV8A 2OQGA 1ZARA 4YFNF 2UXXA 4OIOF 2XHKA 3D0SA 1FYKA 5H20A 4S05A 2P6TA 4LMYA 3FF5A 4BH9A 3K2ZA 5L3FA 4EM1A 1SFUA 2L02A 2EA4A 1K78A 5LGUA 4EQQA 1K78B 2IRFG 1BBYA 2BV6A 4CYDA 1ZLJA 2W84A 2FF4A 3KFWX 3V7CA 2VBWA 3WU0A 4ESFA 4M72A 3O6BB 4JK1X 3IKTA 1DP7P 4U0YA 2Z3YA 4MEYF 3WTTC 1T2KA 3P9CA 2PJPA 3PFIA 3IWZA 4ZYDA 4Q47A 1ZREA 3KP2A 1MJ9A 3EDPA 1IN7A 3T8TA 2KIUA 3J81K 3U9GA 2NNYA 1EV7A 2AS5F 3H92A 3K0LA 2MH9A 3C1DA 1G3WA 1S7OA 2FU4A 3RYPA 3M8EA 3K69A 2GA1A 1R5GA 1B6AA 3MWMA 4KMUX 3CUQC 3WU1B 1FP1D 4U88A 4R1HA 1EH6A 3MCZA 2H27A 2K02A 2YSRA 3F8MA 3DPTA 3BJOA 2M8EA 4LB6B 2VT2A 5HLGA 3GX4X 1U8RA 3CTAA 2XAGA 4OINF 4AIJA 4MEXF 3VEPA 2IPQX 3CJNA 1B1BA 5E1WA 2NRAC 5ED4A 2E1NA 3FXUA 1G6NA 4LK1F 1UHMA 4HW0A 2ACJA 3L09A 5IT9Z 2AXLA 2HKOA 1IRFA 4U0VA 4L0ZB 3SZTA 1IN8A 1BIBA 2LSOA 1FZPB 3W6KB 4A0YA 3GUDA 1Z91A 5ICCA 4UVAA 3SZPA 2RQPA 2J5OA 4PDKA 1BC7C 1HW2A 3KE2A 4CHUA 4PGGA 2QQBA 3E6CC 2DI3A 5JI6A 4KN7X 4I02A 4PCQA 1HBXG 2FBHA 2CQKA 5D5VB 4N9IA 4I0BA 1H9TA 2Q8KA 1OYIA 4BNCA 2F2EA 3QPTA 2K27A 1BC8C 1G3SA 2FMYA 4OMYA 1DUXC 4AIHA 4RS8A 1YS7A 1XMKA 3R6SA 1MZBA 1ZN2A 3WTVC 2O3FA 4G9YA 3DF8A 1TQIA 2F5FA 1Z6TA 1O3RA 2EFPA 1ON1A 4F7ZA 5ERIA 1FBUA 3KP7A 2DO7A 3GF2A 3EUHA 2P8TA 3ULQB 2Q2EA 3TQNA 5E20A 1IF1A 5H6RA 1V4RA 2E1CA 1J9IA 4LK0F 3P9KA 4IRHA 3M1EA 4S04A 3WGIA 3PQKA 5JVTA 4RGSA 3DQVC 2HDCA 1SFXA 4M9XA 4M73A 2CG4A 2DK5A 2PQ8A 4AIKA 1RUOA 3EQLF 5FD5A 2O03A 4M6XA 1R58A 4O6JA 1Z05A 2P4WA 1F9NA 2L3DA 5L3GA 2V1DA 5LGNA 5LEKA 4I01A 2DQRA 1YYVA 2OBPA 4GGGA 3QOPA 5FFZA 4Q4ZF 1ODDA 1WKMA 1I1SA 2K86A 3TO9A 1HSTA 1K7AA 2UZKA 3DEUA 4U0WA 1YG2A 2A61A 3KP5A 1IUYA 4QLCU 5HVQC 3J80Z 4L9VA 3E5UA 1WSUA 1XGMA 4KICA 4ZZDA 3R60A 2PI0A 1X3UA 5HS8A 5FFXA 4KDPA 3VODA 4IVNA 3LAJA 1LEAA 4EVIA 4QWQA 1DPUA 4Y15A 4OIRF 3TDUC 5FB2A 5HDGA 5JR3A 5D8LB 1BM9A 2V9VA 4XLPF 1CGPA 1ZAOA 2QQAA 4NQWA 3F21A 2E7WA 3HRSA 2LKPA 2ISZA 1B9NA 1G4DA 5CVJA 4G7ZF 1HQCA 1IXRC 5J8FA 2A3SA 2F5CA 3G3ZA 2J5PA 2MC3A 1BN5A 2HQNA 1L3LA 5LEJA 1U3EM 2R7FA 1USSA 2PG4A 3F8CA 2CO5A 4WF2A 4ETSA 2XAHA 2VOPA 3V4GA 4L18B 3ECOA 2M5WA 1J59A 5DUKA 4RB1A 4YIFA 5JHUA 2ZKZA 1KA8A 1HSJA 1P4WA 2MLKA 3ZQ7A 1FY7A 1J2XA 5JFRA 5LGTA 2KJBA 4ENKA 3CUOA 4ON0A 2D1HA 2ESNA 1L0OC 4UVBA 5A2QK 3DP7A 2K4BA 4KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J75 A;  1AOY A;  2PN6 A;  5CLS A;  3N4M A;  5DCF A;  3GWZ A;  5AON A;  2STW A;  3JSP A;  4DQ2 A;  4AWX B;  1QZZ A;  1SAX A;  3WTZ A;  2PMU A;  3L00 A;  3I0T A;  1O7L A;  4EJO A;  4LFU A;  2VE9 A;  3KET A;  2H94 A;  4KN4 X;  1XCB A;  3E6D A;  3WGG A;  2BE5 F;  3LA2 A;  4N9H A;  1FPQ A;  1W5S A;  1YW9 A;  4A5M A;  1YO5 C;  2PMH A;  1I5Z A;  2BYV E;  3T0Y A;  4LGW A;  2IP2 A;  3RKY A;  3T1B A;  1YTY A;  1LQ1 A;  5F1R A;  3FX3 A;  5J8C A;  3F72 A;  5CVV A;  1D8K A;  4LLN A;  5ILS A;  4O5V A;  1MKM A;  5HLI A;  1C0W A;  2OAZ A;  1I27 A;  5CVU A;  3TDZ C;  3I4P A;  4R8H A;  1JHH A;  4Q48 A;  3BJA A;  1EH7 A;  1QZY A;  1SD5 A;  2DTR A;  1T6S A;  2Z9O A;  1Z9C A;  4I0A A;  3C18 A;  1XMA A;  5D6E A;  2YR2 A;  4FX0 A;  4G6D A;  5D4S A;  2A5Y B;  2RN7 A;  4A12 A;  1K79 A;  4LG0 A;  3LST A;  4LG0 B;  4HF2 A;  3FM5 A;  1UB9 A;  1IN6 A;  1ZGA A;  2O6G E;  5BMZ A;  5ICG A;  2XUB A;  1W5T A;  3HRM A;  4RGX A;  4RB3 C;  4M9S A;  4NHJ A;  1MJA A;  4HZF A;  3ZMS A;  2M45 A;  3HOS A;  2VC1 A;  5ILV A;  1ZG5 A;  1W4M A;  3HRT A;  2XIG A;  2D1V A;  2EJR A;  5CVR A;  4GO1 A;  1OMI A;  3FM3 A;  3SFZ A;  4ZYG A;  3I64 A;  3R61 A;  5D8K B;  3ZMV A;  2WC2 A;  5LRS A;  2MLG A;  2DAO A;  4MQ9 F;  1HKT A;  3DKW A;  2IA1 A;  3CDH A;  4A0X A;  2ZNZ A;  2QVO A;  3WTU C;  1UHW A;  1XGS A;  4YFX F;  3JAM Z;  1XCV A;  3GZ6 A;  4TV7 A;  2QQ9 A;  4I98 B;  1ZYR F;  3T8R A;  4M6Y A;  3KLN A;  2ZME A;  3E97 A;  4P5O A;  5DCM A;  4HOB A;  1KU7 A;  1WQ2 A;  2ZME B;  5DCM B;  1IZ1 A;  3F6V A;  3O3K A;  4HX7 A;  5EEG A;  4KT5 C;  4R79 A;  4OIP F;  4ZZL A;  2QZ8 A;  2VE8 A;  3LWF A;  3COA C;  3VOE A;  3E5X A;  2ZNY A;  1FNN A;  3CO7 C;  1ZRF A;  1FX7 A;  1R00 A;  2L4M A;  2Y48 A;  3GYH X;  2LDU A;  1GVJ A;  1REP C;  4AVP A;  5IT9 K;  3GFI A;  1TTY A;  3U2R A;  1S6L A;  3GFL A;  3VB2 A;  4G7O F;  3V8K A;  3HRU A;  3L7W A;  1ZRD A;  1XD7 A;  4Y17 A;  1ZHF A;  4RAY A;  3F8N A;  5L3B A;  2KKO A;  4GXO A;  2H6B A;  2W85 A;  4ENN A;  2COM A;  3W6J B;  4HLX A;  4A5N A;  1R23 A;  4UVC A;  1NHA A;  3R4K A;  1UCR A;  1PDN C;  5LBQ A;  4CGZ A;  1LEB A;  3HHH A;  1SD6 A;  3F8F A;  3BP8 A;  4MQV A;  4EM2 A;  3FXQ A;  3IWF A;  4IRI A;  1U5T C;  2IJL A;  3JTH A;  1OKR A;  1FYL A;  3J7A O;  3KP3 A;  5DDG A;  4EJT A;  1RI7 A;  3TOA A;  1E2X A;  2PBI A;  4BAY A;  1FYM A;  3F8B A;  1MJB A;  3DV8 A;  5TJJ A;  3TO6 A;  2P7V B;  4I7H A;  2A6E F;  2YX4 A;  5TRD A;  2QYO A;  1P2F A;  4EJU A;  4MTD A;  4LD5 A;  4XLN F;  4EV0 A;  2OQR A;  3PQJ A;  2JRT A;  2C6Y A;  4WXC A;  2EV6 A;  2ELH A;  2HOE A;  4GYI A;  1ZRC A;  5CYV A;  1OYW A;  2OU2 A;  5K5O A;  2F5D A;  2VOO A;  2RDP A;  4P96 A;  1XB4 A;  4XRF A;  2V1U A;  3ZP5 A;  1W7P A;  1B9M A;  2O8X A;  3QP6 A;  2GXB A;  1W7P B;  1LDK B;  1IXS B;  3GXO A;  2KIF A;  4RAZ A;  3BJ6 A;  2L01 A;  2IW5 A;  2VON A;  1PP8 F;  3GZ5 A;  2QEN A;  2XRN A;  4PZJ A;  1JE8 A;  5D6F A;  3NEU A;  4KIB A;  3WOD F;  1XDU A;  2NAZ A;  2X0L A;  2ZJ2 A;  3WGH A;  1HXD A;  4XSX F;  3J80 K;  1TW3 A;  2QM3 A;  2OA4 A;  5K1Y A;  3RPU A;  2DT5 A;  3C7J A;  1O3Q A;  4WX9 A;  3GO5 A;  3E6B A;  3BWG A;  2PLY A;  3FWE A;  2XAJ A;  2Z99 A;  3IRQ A;  3SQN A;  2ESH A;  1PUE E;  3QPH A;  1R1T A;  5DV5 A;  1F4K A;  2JPC A;  2CW0 F;  2NNN A;  2MA3 A;  1P4A A;  1VTN C;  3FMR A;  3LFK A;  2EV0 A;  3H3Z A;  2XAS A;  3AAF A;  4WXD A;  1SD7 A;  1P4X A;  2OD5 A;  4B8X A;  3HYI A;  1LDJ A;  2DK8 A;  3C3W A;  2UXN A;  1WWX A;  3DFG A;  1FBQ A;  2HYF A;  3MAJ A;  2JT1 A;  3ERE D;  5E8I A;  4BXU A;  1T98 A;  2FRH A;  2ZXJ A;  3ELK A;  5K5R A;  3BY6 A;  4HLY A;  4KIG A;  4FT8 A;  1YW8 A;  3QAH A;  2TDX A;  1TQM A;  3Q9S A;  2EWN A;  3BOQ A;  1XGN A;  3HTS B;  1XN7 A;  1RIO H;  3EYI A;  1S7A A;  1FBS A;  4PGH A;  3ZMD A;  3LQQ A;  1F5T A;  3VFZ A;  3IKV A;  1R1V A;  4H0E A;  2EFN A;  2Q0O A;  3WTW C;  4ASN A;  2A68 F;  4MTE A;  3BDD A;  2VXZ A;  3ABU A;  4CXF A;  3QRF F;  4EMS A;  3HTU A;  2Y75 A;  5BS6 A;  5E18 F;  4YG2 F;  3OV8 A;  1FT9 A;  3I71 A;  2DW4 A;  2GAU A;  3LA3 A;  3CUQ A;  3S2W A;  5DEQ A;  3CUQ B;  3BPX A;  2WTE A;  4UV8 A;  3FMQ A;  3HIF A;  5BOX A;  1SMY F;  1U2W A;  3ECH A;  1SFE A;  5DD4 A;  2HEO A;  2B0L A;  4L0Y B;  1AWC A;  1YW7 A;  2Z33 A;  1GXP A;  2H6C A;  1E17 A;  1OR7 A;  2MD5 A;  2DBB A;  1R5H A;  3LA7 A;  4IHS A;  1Y0U A;  2UWM A;  4M9Z A;  2CSO A;  5CJ9 A;  1SD4 A;  4GYG A;  1FC3 A;  2V1X A;  1ZG1 A;  4L9J A;  2GIV A;  3GEZ A;  4WXH A;  2G9W A;  5F6F A;  3K9T A;  1O7F A;  4OMZ A;  2DPD A;  3HOT A;  4BHB A;  2HFH A;  3E3V A;  4GCV A;  4UNO A;  1QQI A;  4HBL A;  3CLO A;  4HDV A;  2JTV A;  2H09 A;  1KU2 A;  1XSX A;  1S3J A;  4CDG A;  3I54 A;  4UV9 A;  2ZO4 A;  3P9I A;  1LNW A;  3RI4 A;  4ZYH A;  1D3Y A;  3F22 A;  3TKY A;  1H0M A;  1BI3 A;  1Z7U A;  1HKQ A;  2CYY A;  4BYY A;  1T39 A;  3Q9V A;  5F64 A;  2DPU A;  4EM0 B;  4U7B A;  1JGS A;  2FXA A;  2KJC A;  3WTS C;  3OOP A;  3HSR A;  2STT A;  3H3U A;  4HQE A;  2G7U A;  1IAW A;  3NRV A;  1UST A;  3R0A A;  3QU3 A;  2LF7 A;  5FGM A;  4MGR A;  1D5V A;  2QWW A;  1KQ0 A;  3V7R A;  4G6Q A;  2ETH A;  2KRF A;  2R3S A;  2IA0 A;  2W24 A;  2D45 A;  1B4A A;  3FMS A;  4N0B A;  3HHG A;  3TOB A;  2YU3 A;  4O3M A;  3JAM K;  1RUN A;  2CGP A;  3HSE A;  4LLG F;  3IC7 A;  4D0P A;  2JSC A;  2ZFW A;  1TLH B;  1BOA A;  4HF0 A;  2VBZ A;  4ZH4 F;  3IRR A;  2ZCW A;  2D2W A;  3B73 A;  2LF8 A;  3QP5 A;  4ESJ A;  2YX7 A;  4HV5 A;  3V7S A;  3KEO A;  5FLX Z;  2FOK A;  3BRO A;  2BEO A;  4A6E A;  1LDD A;  1FSH A;  3ISP A;  4HF1 A;  1BIA A;  2ZBK A;  2M30 A;  3WTY C;  1IN5 A;  2CFX A;  2XAQ A;  4HX4 A;  4AD9 A;  1BI2 A;  1S29 A;  5EEH A;  4KA4 A;  5AIQ A;  4EGZ A;  1HW1 A;  3Q5F A;  5KK1 A;  4FHT A;  5LRR A;  3I5U A;  3N97 A;  1ONV A;  1QNT A;  5IT3 A;  1S8N A;  3E5Q A;  2O61 A;  3WE2 A;  1QO0 D;  2VBX A;  4WK8 F;  5LHI A;  1T38 A;  3MZY A;  2HYG D;  2OZU A;  3ZPL A;  3ZMU A;  2W57 A;  2JPB A;  3JTG A;  3I58 A;  3BPV A;  3KCC A;  4RGR A;  4MNU A;  1B59 A;  3JW4 A;  2HGC A;  4KYW A;  4ENJ A;  1ZH5 A;  2GXG A;  1YLF A;  1DDN A;  3FZV A;  4WWC A;  4ESB A;  1J7K A;  1V3F A;  2FBK A;  4E70 A;  1MGT A;  3M7G A;  1BI0 A;  2FNP A;  4OOI A;  4P9F A;  3T5X A;  4FX4 A;  2VN2 A;  2KIM A;  5E17 F;  1XGO A;  1Z6R A;  2HS5 A;  3RDI A;  4P55 A;  1OPC A;  1CF7 A;  2FQ3 A;  4L9N A;  1CF7 B;  3KZZ A;  3WE3 A;  3HSF A;  2P6S A;  2M87 A;  5E8G A;  3EET A;  3REO A;  3ZMT A;  4UUV A;  5D5X B;  1KYZ A;  1DPR A;  1ULY A;  4K2E A;  4MHG A;  4NB5 A;  5AIP A;  1Q1H A;  3HUG A;  1FSE A;  3V8J A;  3ML6 A;  2GQQ A;  4HAM A;  1BJA A;  2VT3 A;  1KYW A;  4HV6 A;  4L5I A;  3ZN1 A;  1R1U A;  2DLL A;  1ZLK A;  4A2U A;  3J81 Z;  2L4A A;  3EYY A;  4HDU A;  2O0Y A;  4JQF A;  1G3T A;  1O57 A;  1MDM A;  3I53 A;  5D5W B;  1F1Z A;  1MDM B;  2GA2 A;  2YPR A;  1KGS A;  3KP6 A;  4RGU A;  3MFK A;  2EFO A;  5K5Q A;  2A6H F;  1LJ9 A;  3KP4 A;  3MQ0 A;  5ICF A;  1Z1D A;  4A0Z A;  3F6O A;  3TGN A;  4ENM A;  1A04 A;  1P6R A;  3L9F A;  3RPQ A;  5LHG A;  2VBY A;  3RIR A;  2K4J A;  1G3Y A;  2NS0 A;  5L3E A;  2GWR A;  1TNS A;  3SXY A;  3DXJ F;  2IA2 A;  3I59 A;  3RKW A;  4XSZ F;  4LB5 A;  3I59 B;  1WRJ A;  1P92 A;  4KFC A;  2MBF A;  1JHF A;  3V8L A;  4P9U A;  1O3S A;  4L5J A;  3F3X A;  1TQP A;  5HDK A;  1TBX A;  2IVM A;  4HA8 A;  4ZYE A;  4OU0 A;  1FLI A;  2XVC A;  3M8F A;  4HX8 A;  4IPA A;  2RGV A;  2HQR A;  4RB2 C;  3E6M A;  5E1X A;  3KLO A;  1XDS A;  2EV5 A;  3RJP A;  3K1N A;  1SMT A;  1HW5 A;  2DQL A;  3P7N A;  2A07 F;  4LLL A;  2RKH A;  2MH2 A;  2NYX A;  1GXQ A;  2CWE A;  5KVR A;  2VC0 A;  1R7J A;  4YFK F;  4IHT A;  3F23 A;  1HKS A;  3FHZ A;  5DD8 A;  1D8J A;  3U1D A;  4RB0 A;  5D4R A;  4Y13 A;  2GZW A;  2V6C A;  1YIO A;  2XRO A;  3R0J A;  4Z2Y A;  4CZZ A;  4EJV A;  1XSD A;  3GW2 A;  1U78 A;  4G94 A;  2DFI A;  4BQA A;  4A6D A;  2L54 A;  2JZY A;  3BZ6 A;  3RKX A;  2WWY A;  5FD6 A;  4IXA A;  1TNT A;  1ZGJ A;  6PAX A;  3G73 A;  4KUM A;  4HYE A;  5DUI A;  2RNJ A;  1WI9 A;  2FSW A;  2Y0M A;  5D5U B;  2XV4 S;  2Z5U A;  2BGC A;  5HLH A;  4HQM A;  2A69 F;  2EK5 A;  1RNL A;  2QBY A;  4M74 A;  2QBY B;  3JSO A;  5L3D A;  3GFM A;  4CO8 A;  5BQT A;  2HZT A;  3RYR A;  2K7L A;  1W7P D;  2XKP A;  2P5V A;  2FNA A;  1YQA A;  1IW7 F;  1UFM A;  5LHH A;  4JBA A;  2HTJ A;  2OZ6 A;  4KNY A;  5HS9 A;  2EFW A;  1RZ4 A;  3KZY A;  1GHC A;  3IL2 A;  1H9G A;  4WCG A;  3ROU A;  4IJA A;  1PP7 U;  2PFB A;  1BI1 A;  3LQR A;  2WV0 A;  5DYM A;  3ZN0 A;  3GVA A;  3D5L A;  2DU9 A;  2QUF A;  2XAF A;  2FE3 A;  4CIC A;  2V79 A;  1U5T A;  3IHU A;  1U5T B;  4DNC A;  1ON2 A;  1K6O A;  2RVC A;  2W25 A;  5ICE A;  2HTS A;  4OIQ F;  1KU3 A;  1IN4 A;  4BHP A;  1IXC A;  2E7X A;  2ISY A;  4UXN A;  5HDN A;  5LLQ A;  2QLZ A;  3LAP A;  4XBF A;  1QPM A;  1KU9 A;  4LJZ F;  1KQ8 A;  4EJW A;  4BHC A;  2FEZ A;  5E1Z B;  2VOD A;  3GLX A;  1R36 A;  1I1G A;  1ZG3 A;  1QGP A;  1J0R A;  3FXR A;  5FO5 A;  1FWZ A;  3O2P E;  3K1P A;  2HWV A;  3WG9 A;  1T0F A;  5J6X A;  4YII A;  1XSV A;  1FOK A;  5CVI A;  1R22 A;  4IF4 A;  2LNB A;  3K1M A;  3TO7 A;  4UHT A;  2XGX A;  3RTR A;  1YS6 A;  3GFJ A;  5A2Q Z;  1EH8 A;  3ABT A;  2R7D A;  2P5L C;  4I09 A;  5FLX K;  4L9T A;  2FBI A;  2ADU A;  5HS7 A;  3MEX A;  2P7C B;  5BPD A;  4G8X A;  1FP2 A;  3KEQ A;  1LB2 A;  4B09 A;  2PEX A;  2HKX A;  4EGY A;  3B02 A;  4U7D A;  3DPL C;  1TW2 A;  4G7H F;  2IT0 A;  3CO6 C;  1KQ9 A;  2RC4 A;  2XKO A;  1I6X A;  1JXS A;  2EFQ A;  5H6Q A;  2EA2 A;  1MD0 A;  2FA5 A;  3L2C A;  3MZH A;  1LVA A;  1QBJ A;  4I2O A;  5BPI A;  2P5K A;  2FML A;  3SHF A;  3ZMZ A;  1YFH A;  4M71 A;  4KMF A;  4Q5S F;  2G7H A;  2BBY A;  5L3C A;  5HOO A;  3WTX C;  4IRG A;  2F5E A;  5ILU A;  1O3T A;  3NQO A;  3QU6 A;  1STZ A;  2M1B A;  1OYY A;  2HR3 A;  3M9A A;  1U6G A;  1J5Y A;  1IRG A;  2X4H A;  2EB7 A;  2RV8 A;  2OQG A;  1ZAR A;  4YFN F;  2UXX A;  4OIO F;  2XHK A;  3D0S A;  1FYK A;  5H20 A;  4S05 A;  2P6T A;  4LMY A;  3FF5 A;  4BH9 A;  3K2Z A;  5L3F A;  4EM1 A;  1SFU A;  2L02 A;  2EA4 A;  1K78 A;  5LGU A;  4EQQ A;  1K78 B;  2IRF G;  1BBY A;  2BV6 A;  4CYD A;  1ZLJ A;  2W84 A;  2FF4 A;  3KFW X;  3V7C A;  2VBW A;  3WU0 A;  4ESF A;  4M72 A;  3O6B B;  4JK1 X;  3IKT A;  1DP7 P;  4U0Y A;  2Z3Y A;  4MEY F;  3WTT C;  1T2K A;  3P9C A;  2PJP A;  3PFI A;  3IWZ A;  4ZYD A;  4Q47 A;  1ZRE A;  3KP2 A;  1MJ9 A;  3EDP A;  1IN7 A;  3T8T A;  2KIU A;  3J81 K;  3U9G A;  2NNY A;  1EV7 A;  2AS5 F;  3H92 A;  3K0L A;  2MH9 A;  3C1D A;  1G3W A;  1S7O A;  2FU4 A;  3RYP A;  3M8E A;  3K69 A;  2GA1 A;  1R5G A;  1B6A A;  3MWM A;  4KMU X;  3CUQ C;  3WU1 B;  1FP1 D;  4U88 A;  4R1H A;  1EH6 A;  3MCZ A;  2H27 A;  2K02 A;  2YSR A;  3F8M A;  3DPT A;  3BJO A;  2M8E A;  4LB6 B;  2VT2 A;  5HLG A;  3GX4 X;  1U8R A;  3CTA A;  2XAG A;  4OIN F;  4AIJ A;  4MEX F;  3VEP A;  2IPQ X;  3CJN A;  1B1B A;  5E1W A;  2NRA C;  5ED4 A;  2E1N A;  3FXU A;  1G6N A;  4LK1 F;  1UHM A;  4HW0 A;  2ACJ A;  3L09 A;  5IT9 Z;  2AXL A;  2HKO A;  1IRF A;  4U0V A;  4L0Z B;  3SZT A;  1IN8 A;  1BIB A;  2LSO A;  1FZP B;  3W6K B;  4A0Y A;  3GUD A;  1Z91 A;  5ICC A;  4UVA A;  3SZP A;  2RQP A;  2J5O A;  4PDK A;  1BC7 C;  1HW2 A;  3KE2 A;  4CHU A;  4PGG A;  2QQB A;  3E6C C;  2DI3 A;  5JI6 A;  4KN7 X;  4I02 A;  4PCQ A;  1HBX G;  2FBH A;  2CQK A;  5D5V B;  4N9I A;  4I0B A;  1H9T A;  2Q8K A;  1OYI A;  4BNC A;  2F2E A;  3QPT A;  2K27 A;  1BC8 C;  1G3S A;  2FMY A;  4OMY A;  1DUX C;  4AIH A;  4RS8 A;  1YS7 A;  1XMK A;  3R6S A;  1MZB A;  1ZN2 A;  3WTV C;  2O3F A;  4G9Y A;  3DF8 A;  1TQI A;  2F5F A;  1Z6T A;  1O3R A;  2EFP A;  1ON1 A;  4F7Z A;  5ERI A;  1FBU A;  3KP7 A;  2DO7 A;  3GF2 A;  3EUH A;  2P8T A;  3ULQ B;  2Q2E A;  3TQN A;  5E20 A;  1IF1 A;  5H6R A;  1V4R A;  2E1C A;  1J9I A;  4LK0 F;  3P9K A;  4IRH A;  3M1E A;  4S04 A;  3WGI A;  3PQK A;  5JVT A;  4RGS A;  3DQV C;  2HDC A;  1SFX A;  4M9X A;  4M73 A;  2CG4 A;  2DK5 A;  2PQ8 A;  4AIK A;  1RUO A;  3EQL F;  5FD5 A;  2O03 A;  4M6X A;  1R58 A;  4O6J A;  1Z05 A;  2P4W A;  1F9N A;  2L3D A;  5L3G A;  2V1D A;  5LGN A;  5LEK A;  4I01 A;  2DQR A;  1YYV A;  2OBP A;  4GGG A;  3QOP A;  5FFZ A;  4Q4Z F;  1ODD A;  1WKM A;  1I1S A;  2K86 A;  3TO9 A;  1HST A;  1K7A A;  2UZK A;  3DEU A;  4U0W A;  1YG2 A;  2A61 A;  3KP5 A;  1IUY A;  4QLC U;  5HVQ C;  3J80 Z;  4L9V A;  3E5U A;  1WSU A;  1XGM A;  4KIC A;  4ZZD A;  3R60 A;  2PI0 A;  1X3U A;  5HS8 A;  5FFX A;  4KDP A;  3VOD A;  4IVN A;  3LAJ A;  1LEA A;  4EVI A;  4QWQ A;  1DPU A;  4Y15 A;  4OIR F;  3TDU C;  5FB2 A;  5HDG A;  5JR3 A;  5D8L B;  1BM9 A;  2V9V A;  4XLP F;  1CGP A;  1ZAO A;  2QQA A;  4NQW A;  3F21 A;  2E7W A;  3HRS A;  2LKP A;  2ISZ A;  1B9N A;  1G4D A;  5CVJ A;  4G7Z F;  1HQC A;  1IXR C;  5J8F A;  2A3S A;  2F5C A;  3G3Z A;  2J5P A;  2MC3 A;  1BN5 A;  2HQN A;  1L3L A;  5LEJ A;  1U3E M;  2R7F A;  1USS A;  2PG4 A;  3F8C A;  2CO5 A;  4WF2 A;  4ETS A;  2XAH A;  2VOP A;  3V4G A;  4L18 B;  3ECO A;  2M5W A;  1J59 A;  5DUK A;  4RB1 A;  4YIF A;  5JHU A;  2ZKZ A;  1KA8 A;  1HSJ A;  1P4W A;  2MLK A;  3ZQ7 A;  1FY7 A;  1J2X A;  5JFR A;  5LGT A;  2KJB A;  4ENK A;  3CUO A;  4ON0 A;  2D1H A;  2ESN A;  1L0O C;  4UVB A;  5A2Q K;  3DP7 A;  2K4B A;  4KIF A; 
#chains in the Genus database with same CATH topology
 1J75 A;  2IS4 A;  1AOY A;  4XQF A;  2PN6 A;  3CCQ I;  5CLS A;  3N4M A;  5DCF A;  4RM3 A;  4KJZ A;  1HOM A;  2K5C A;  3HM5 A;  2DA2 A;  2NS7 A;  3GWZ A;  2XSD C;  5AON A;  3FXJ A;  3JSP A;  4DQ2 A;  2STW A;  4AWX B;  1SVL A;  1QZZ A;  1SAX A;  5EF6 A;  1SEU A;  3MKL A;  3OMY A;  3I3L A;  3WTZ A;  4F91 B;  5C3E J;  3JRH A;  3S3M A;  2PMU A;  3SEQ A;  3L00 A;  3I0T A;  1Z3X A;  4D5C A;  1O7L A;  2DFE A;  2DMU A;  3OL3 A;  3GTQ J;  4EJO A;  2Z16 A;  5HNF A;  3QOD A;  3DKX A;  3S1R J;  1BL0 A;  4LFU A;  4FET A;  2VE9 A;  3KET A;  1VQN I;  1Y1V J;  2LBF A;  2H94 A;  3LSJ A;  4KN4 X;  2LBF B;  2DA5 A;  2E2J J;  1MMD A;  1TP4 A;  1XCB A;  1S7E A;  2BE5 F;  3E6D A;  3WGG A;  4I6Z A;  3LA2 A;  1FEX A;  1YHQ I;  2EH3 A;  1FMW A;  4N9H A;  2X6Y A;  1FPQ A;  1W5S A;  1YW9 A;  3MKW B;  2IS1 A;  2KPM A;  2XGD A;  3PNY A;  2PMH A;  4A5M A;  1YO5 C;  3AFH A;  1I5Z A;  2BYV E;  2V26 A;  4PJN A;  3Q0W A;  2R7S A;  4CCO A;  3T0Y A;  3H9J A;  4B3A A;  2Y9Z A;  4LGW A;  2IP2 A;  3RKY A;  1TWC J;  2W4S A;  3T1B A;  2HQA A;  1YTY A;  1LQ1 A;  5F1R A;  3FX3 A;  5J8C A;  3F72 A;  5CVV A;  1D8K A;  4LLN A;  5ILS A;  4O5V A;  1MKM A;  5HLI A;  1C0W A;  2OAZ A;  1I27 A;  5CVU A;  3TDZ C;  2DA1 A;  3I4P A;  4R8H A;  1JHH A;  3I4M J;  2NVT J;  4Q48 A;  2DOF A;  3BJA A;  1EH7 A;  1QZY A;  2HVS A;  2A6T A;  1SD5 A;  4IQJ A;  2DTR A;  1T6S A;  3I9V 2;  2Z9O A;  5JLW A;  1Z9C A;  4A3C J;  3BR2 A;  2RQQ A;  4I0A A;  3C18 A;  2ELJ A;  2ZSH B;  2NVX J;  4IKF A;  4J00 A;  1XMA A;  1EJ9 A;  5D6E A;  3HOZ J;  4YRV A;  1WZ2 A;  1T8I A;  2YR2 A;  4FX0 A;  5FJ8 J;  3ZGK A;  4G6D A;  5D4S A;  2A5Y B;  2RN7 A;  4A12 A;  1K79 A;  1JUP A;  4LG0 A;  5E3M A;  4E7H A;  4GFB A;  1T95 A;  4DJA A;  3LST A;  1OLT A;  1RC9 A;  4LG0 B;  4HF2 A;  3FM5 A;  1UB9 A;  1IN6 A;  1ZGA A;  1FTZ A;  2O6G E;  5BMZ A;  5ICG A;  3GTO J;  2XGE A;  2XUB A;  1XS9 A;  1W5T A;  3QYB A;  3HRM A;  4M3F A;  3JRF A;  4RGX A;  2ME6 A;  3ESW B;  1TWA J;  3E7L A;  4RB3 C;  3ZQL A;  4M9S A;  2RNG A;  4NHJ A;  1MJA A;  2CMP A;  1VI0 A;  4HZF A;  2R7R A;  3ZMS A;  2M45 A;  3B6A A;  2VC1 A;  3HOS A;  3O8H A;  5ILV A;  1X1B A;  3J7Z I;  3HG9 A;  1ZG5 A;  3DEW A;  5F04 A;  1W4M A;  4XRS G;  3HRT A;  4XKW A;  3OYJ A;  2XIG A;  1OCO H;  2D1V A;  2EJR A;  1W0U A;  5CVR A;  2F6C A;  3S3N A;  4GO1 A;  3BCB A;  2VLA A;  2CV1 A;  1OMI A;  3FM3 A;  3BTL A;  2KZG A;  3SFZ A;  4ZYG A;  3I64 A;  1X2M A;  3R61 A;  3CJQ B;  5D8K B;  3ZMV A;  5GP9 A;  2V6E A;  2M9H A;  2WC2 A;  3DLL F;  2DMN A;  3MKY B;  3U1K A;  2IBD A;  4M3B A;  4GDF A;  2KL4 A;  2YS9 A;  4F3Q A;  5LRS A;  2MLG A;  3GLL A;  3HKZ A;  3MVP A;  2DAO A;  4MQ9 F;  1HKT A;  3DKW A;  2CUE A;  2QSF X;  1MH4 A;  2IA1 A;  3BQZ A;  5CPR B;  2LRD A;  3CDH A;  2E36 A;  4A0X A;  2LK2 A;  3RQI A;  2K9N A;  2ZNZ A;  2QVO A;  4XLH A;  3WTU C;  1UHW A;  1XGS A;  4KT6 A;  2R7V A;  1AU7 A;  2I5U A;  2MYS A;  2NS8 A;  4YFX F;  2IGO A;  2XC7 A;  5F0F A;  3JAM Z;  1YJN I;  1XCV A;  3IAS 2;  3GZ6 A;  4TV7 A;  2QQ9 A;  4CZC A;  5J47 A;  4I98 B;  4Y7N J;  1ZYR F;  5IP6 A;  1YIT I;  1E0E A;  3T8R A;  4M6Y A;  1PVE A;  3KLN A;  2ZME A;  3E97 A;  4P5O A;  5DCM A;  4HOB A;  1KU7 A;  1QU3 A;  1WQ2 A;  2ZME B;  5DCM B;  4JOM A;  3HL2 A;  1IZ1 A;  3F6V A;  3O3K A;  4HX7 A;  5EEG A;  3JRE A;  4KT5 C;  2JA2 A;  4R79 A;  4OIP F;  2AXT C;  4ZZL A;  5M3F J;  1X1C A;  2QZ8 A;  1OJL A;  2VE8 A;  2VPR A;  3LWF A;  3OYL A;  2DMT A;  4N4N B;  2BOL A;  2QSG X;  2X9D A;  3COA C;  3VOE A;  3H0G J;  2DT7 B;  3E5X A;  2ZNY A;  2XPU A;  1FNN A;  3CO7 C;  1ZRF A;  1FX7 A;  4RM2 A;  5DS9 A;  1QRY A;  1R00 A;  2L4M A;  2Y48 A;  3GYH X;  2LDU A;  2W82 A;  1N78 A;  1HF0 A;  2LP0 A;  1GVJ A;  1REP C;  4AVP A;  2DXI A;  5IT9 K;  3GFI A;  1I3Q J;  2H1K A;  3DEE A;  3FXO A;  1TTY A;  3U2R A;  1S6L A;  3GFL A;  5KCM A;  3VB2 A;  3GBG A;  4G7O F;  3V8K A;  2A5W A;  5BNG A;  3KX2 A;  3HRU A;  2WAE A;  3QYE A;  3L7W A;  1ZRD A;  1XD7 A;  2R0Q C;  2V9P A;  4Y17 A;  5E79 C;  4UB6 C;  1ZHF A;  4RAY A;  3N05 A;  4C2M J;  4FAS D;  2LY9 A;  3F8N A;  5L3B A;  3DTE A;  2KKO A;  1QZE A;  1UZC A;  1V5F A;  4GXO A;  2H6B A;  2XRL A;  3IUO A;  2W85 A;  2DA7 A;  4B1R A;  3QQA A;  4ENN A;  2COM A;  3W6J B;  2VB6 A;  3W2V A;  1JT0 A;  4BKX A;  4CCN A;  4B48 A;  3HOY J;  4A3E J;  4HLX A;  4BBR J;  1ETX A;  3ZRG A;  2M8G X;  4A5N A;  4A3D J;  3PIP F;  1R23 A;  4UVC A;  2KRC A;  1FIA A;  1HA8 A;  3HB9 A;  1NHA A;  2ZXW H;  3E1S A;  3R4K A;  2R7Q A;  1UCR A;  2V9K A;  5LBQ A;  1PDN C;  1IDY A;  4D7N A;  2DOD A;  1B72 A;  2F48 A;  1JKR C;  4CGZ A;  1B72 B;  5J40 A;  1LEB A;  1A36 A;  3HPG A;  2L0K A;  1SD6 A;  3HHH A;  3OS1 A;  2WAD A;  3F8F A;  3BP8 A;  4MQV A;  4EM2 A;  1UAA A;  1UJ8 A;  4XOT A;  3FXQ A;  3IWF A;  4IRI A;  1U5T C;  4X1E A;  1IDZ A;  2IJL A;  3K6G A;  5JVG F;  1SAN A;  1YJW I;  5J1U A;  3JTH A;  5IOY A;  1OKR A;  2UUZ A;  3ZQF A;  2Q1Z B;  1FYL A;  3J7A O;  1TL8 A;  4A3F J;  3A0B C;  2Y0S A;  3KP3 A;  4BDZ A;  5DDG A;  4LOC A;  4EJT A;  4B44 A;  4XL9 A;  1RI7 A;  3TOA A;  4DGW B;  4E7K A;  1FMV A;  1E2X A;  4PJ0 C;  1NG7 A;  1MNE A;  1A5J A;  2PBI A;  4BAY A;  2F4M B;  1FYM A;  3F8B A;  1F36 A;  1MJB A;  4FTH A;  2NVY J;  4XLC A;  3DV8 A;  5TJJ A;  2HDW A;  3VYU B;  3TO6 A;  2P7V B;  4ZDP A;  4HG2 A;  2QQ8 A;  4I7H A;  2A6E F;  2YX4 A;  2BVM A;  5TRD A;  5FLM J;  2QYO A;  1P2F A;  3KIO A;  1JKP C;  4DZP A;  4EJU A;  1E3H A;  4MTD A;  2X1D A;  4LD5 A;  1Y8Q B;  4XLN F;  4AVZ A;  4EV0 A;  1UMQ A;  2OQR A;  4FCY A;  3PQJ A;  2JRT A;  2C6Y A;  5KNL A;  4LIT A;  4WXC A;  1LUJ B;  2ELH A;  2EV6 A;  2HOE A;  4GYI A;  5CYV A;  5GAE J;  3OS2 A;  3OSF A;  1ZRC A;  3OYC A;  4I76 A;  1R49 A;  1OYW A;  2OU2 A;  5K5O A;  1T0F C;  1A6Q A;  2F5D A;  3HPH A;  4A69 C;  1IJW C;  2VOO A;  2PJR A;  2CW8 A;  2RDP A;  2TRT A;  3BR0 A;  2PJR B;  4IQ4 A;  3FIW A;  1FJL A;  4P96 A;  1XB4 A;  4XRF A;  2V1U A;  3UR3 C;  3HBL A;  1Y0N A;  3ZP5 A;  1W7P A;  2HPM A;  1B9M A;  2O8X A;  2Y9Y A;  2TCT A;  1JUS A;  1W7P B;  1YE9 A;  3QP6 A;  2GXB A;  1LDK B;  1IXS B;  2OF7 A;  2KIF A;  2BY2 A;  3GXO A;  4RAZ A;  3BJ6 A;  2L01 A;  1IC8 A;  2IW5 A;  4BE0 A;  2JQ7 A;  1X4O A;  2VON A;  1VZ0 A;  5TGT A;  4QIW N;  3CCJ I;  2M7A A;  1PP8 F;  2DJN A;  3GZ5 A;  4BUP A;  2QEN A;  1W0T A;  2XRN A;  3BT9 A;  2GM4 A;  4PZJ A;  2Q2E B;  1I3A A;  2P81 A;  1JE8 A;  5D6F A;  4B47 A;  2VKH A;  3NEU A;  4KIB A;  3WOD F;  1K4T A;  4S0H B;  1XDU A;  2ZJR F;  4ZTJ A;  2KLO A;  2NAZ A;  4XKV A;  2X0L A;  2ZJ2 A;  1ETO A;  2ECB A;  3WGH A;  1HXD A;  5FRN A;  2MC4 A;  4XSX F;  4F93 B;  3J80 K;  1TW3 A;  2G0E A;  4V2G A;  2QM3 A;  1JTY A;  3HKZ N;  4XM3 A;  1TWF J;  1X2N A;  2OA4 A;  1Z21 A;  3QYF A;  2L9R A;  5K1Y A;  3RPU A;  2DT5 A;  3CC2 I;  2DN0 A;  1IGN A;  3C7J A;  3DBR B;  2JWT A;  2FD5 A;  2DOA A;  4HNU A;  1O3Q A;  3BQY A;  3D5S C;  4WX9 A;  2XF7 A;  3HJE A;  3GO5 A;  3E6B A;  3BWG A;  2PLY A;  3FWE A;  4Y33 A;  2XAJ A;  3PSI A;  2DMQ A;  4XR6 A;  2Z99 A;  3IRQ A;  1AKH A;  3SQN A;  2ESH A;  3OYK A;  1PUE E;  3QPH A;  1S9H A;  1AKH B;  2DT6 A;  4LG3 A;  1R1T A;  5DV5 A;  1SVO A;  1F4K A;  2JPC A;  3FXM A;  2CW0 F;  2NNN A;  3OIO A;  4BJT A;  3SJM A;  4EAT A;  1JJ6 C;  2MA3 A;  2LG4 A;  2R7T A;  1P4A A;  1DP3 A;  1VQ8 I;  1VTN C;  2LKX A;  3CDI A;  4G6T B;  5B1B H;  2KZV A;  3FMR A;  3LFK A;  3TL4 X;  2EV0 A;  3S2D J;  3H3Z A;  3OR2 C;  3SYT A;  2XAS A;  3AAF A;  1IG7 A;  2OC6 A;  2I8D A;  4WXD A;  1SD7 A;  1JTX A;  1P4X A;  3VYT B;  4I99 C;  2OD5 A;  3ABK H;  3F9K A;  3HYI A;  5IYB J;  4B8X A;  1K6Y A;  1LDJ A;  2DK8 A;  3C3W A;  5KAF C;  2UXN A;  1WWX A;  3DFG A;  4HSR A;  1FBQ A;  1J09 A;  2HYF A;  4RBO A;  1K83 J;  2MGQ A;  3MAJ A;  2JT1 A;  1IRZ A;  2L7F P;  4UB8 C;  3ERE D;  2VKV A;  3JRB A;  5E8I A;  3DU6 A;  4BXU A;  2R7U A;  4B3X A;  4D5F A;  1T98 A;  2BXY A;  2FRH A;  2ZXJ A;  3ELK A;  3JCU C;  5K5R A;  1MBJ A;  3IH4 A;  3BY6 A;  2R7X A;  1JGG A;  3CC4 I;  1TZL A;  4C2U A;  4L5E A;  4HLY A;  4KIG A;  2L7M P;  1YW8 A;  2ZXI A;  4FT8 A;  1MMS A;  1ETW A;  1JT6 A;  5CQG A;  3OOU A;  3QAH A;  5FKK A;  3DCF A;  3ZXS A;  2TDX A;  2V7F A;  1TQM A;  2AQF A;  3Q9S A;  3VYR B;  2EWN A;  3BOQ A;  1VQL I;  1XGN A;  1OFC X;  3HTS B;  4M3D A;  1PYV A;  4II3 A;  1XN7 A;  3Q0U A;  1RIO H;  1S7A A;  4ZJZ A;  1FBS A;  2CH0 A;  4PGH A;  3LQQ A;  3ZMD A;  1F5T A;  3VFZ A;  1YRN B;  3IKV A;  1R1V A;  1HC8 A;  4XLF A;  4BQN A;  4H0E A;  5FRM A;  2BY0 A;  2EFN A;  2Q0O A;  4PJM A;  1U9O A;  3WTW C;  2KP6 A;  4ASN A;  2A68 F;  4MTE A;  3BDD A;  5EZH A;  2EQR A;  2VXZ A;  1PUF B;  4A3K J;  1RR7 A;  3ABU A;  1VQ5 I;  4CXF A;  1IV6 A;  3QRF F;  5GPA A;  4FE7 A;  4PJJ A;  3VWB A;  4EMS A;  3HTU A;  2Y75 A;  5BS6 A;  1S72 I;  4E7J A;  5E18 F;  2Y2Z A;  3K4J A;  4YG2 F;  3OV8 A;  4BJ6 C;  3OYG A;  1FT9 A;  3DTK A;  3I71 A;  2DW4 A;  2Y0S N;  2GAU A;  3ABL H;  3LA3 A;  2OUM A;  5EYR A;  3BC8 A;  3CUQ A;  3S2W A;  1Y1W J;  1DGW Y;  4IHV A;  5DEQ A;  3CUQ B;  3H5R A;  3BPX A;  2WTE A;  2M4K A;  5GTI C;  4UV8 A;  3FMQ A;  2WAF A;  3L2V A;  3HIF A;  4MFE A;  2GXA A;  5BOX A;  3KPH A;  1SMY F;  2N8G A;  1U2W A;  3ECH A;  5J4V A;  1H88 C;  1SFE A;  5DD4 A;  1WGX A;  4AID A;  2HEO A;  2B0L A;  4L0Y B;  3AL0 C;  3OWT A;  4PJL A;  2MFZ A;  1AWC A;  5C44 J;  1WJ5 A;  1YW7 A;  1BR2 A;  2VJI A;  4V2F A;  3OYB A;  2Z33 A;  1GXP A;  1ZQ3 P;  2H6C A;  2HOT A;  3BG6 A;  1E17 A;  1OR7 A;  2MD5 A;  2Y69 H;  1ENH A;  2VKE A;  2DBB A;  1R5H A;  3LA7 A;  4IHS A;  2CW7 A;  1Y0U A;  1P7J A;  4IHW A;  1DGR M;  2E35 A;  3OR1 C;  2UWM A;  4M9Z A;  2CSO A;  3QPL A;  1P7I A;  4RLQ A;  5CJ9 A;  4BQO A;  1RKW A;  1SD4 A;  4GYG A;  3S15 J;  2HYJ A;  5E3O A;  1FC3 A;  2EBI A;  1VQ9 I;  1LFU P;  2V1X A;  3EPZ A;  3G4S I;  1ZG1 A;  1Y56 A;  4L9J A;  2GIV A;  2MW8 A;  3GEZ A;  4WXH A;  1MW7 A;  2G9W A;  2MSY A;  2KQR A;  4A3J J;  3K4K A;  1SFO J;  5F6F A;  3K9T A;  3TMO A;  1QVT A;  4F92 B;  1O7F A;  2RAE A;  1R5I D;  4OMZ A;  2DPD A;  3HOT A;  4BHB A;  2HFH A;  2OCE A;  1BW5 A;  4DYQ A;  3FBN B;  3E3V A;  4E4H A;  5M3M J;  2LY2 A;  2BY1 A;  4GCV A;  4UNO A;  1QQI A;  2WV1 A;  4AU7 A;  4BY7 J;  2LKS A;  1ETV A;  3DPU A;  4HBL A;  3RSN A;  3CLO A;  2XB0 X;  3LSK A;  4HDV A;  2JTV A;  5EEA A;  3CCU I;  2H09 A;  1KU2 A;  1XSX A;  1S3J A;  4CDG A;  5FKL A;  3I54 A;  3O8G A;  2HDD A;  4UV9 A;  2HXO A;  2ZO4 A;  1ETQ A;  3P9I A;  1LNW A;  2X48 A;  1X1A A;  2JVG A;  3RI4 A;  4KIS A;  4ZYH A;  4N4O B;  4CCJ A;  1D3Y A;  2O7O A;  3TKY A;  3F22 A;  1H0M A;  1BI3 A;  1Z7U A;  1HKQ A;  2CYY A;  4BYY A;  1T39 A;  3Q9V A;  2PX9 A;  5F64 A;  2DPU A;  2X6X A;  4EM0 B;  3ZQC A;  2JA6 J;  3DLA A;  4U7B A;  1I50 J;  1JGS A;  1VQ6 I;  2FXA A;  4JX5 A;  2KJC A;  2IS6 A;  3ASN H;  3WTS C;  3OOP A;  2R5Y A;  3HSR A;  1TC3 C;  2STT A;  3S1N J;  3H3U A;  3BTI A;  2L5Q A;  2R5Y B;  3GTK J;  4HQE A;  2G7U A;  2WA0 A;  1IAW A;  2WBM A;  5FRO A;  3NRV A;  1WJC A;  3J7A Y;  2W7N A;  3E0J B;  1UST A;  3R0A A;  3QU3 A;  2M2E A;  2LF7 A;  1V5E A;  3K4N A;  2DA6 A;  5FGM A;  5F0H A;  4MGR A;  1D5V A;  3BG9 A;  2QWW A;  1KQ0 A;  3V7R A;  4G6Q A;  3EUH C;  2ETH A;  2BY3 A;  1W36 C;  2KRF A;  2R3S A;  2IA0 A;  2W24 A;  4HNV A;  2D45 A;  1B4A A;  3FMS A;  1XPX A;  4N0B A;  3VSL A;  4W97 A;  3M4O J;  4NUB A;  1BA5 A;  3HHG A;  1SFK A;  1ACI A;  3TOB A;  3I55 I;  4BDY A;  2YU3 A;  4HEA 2;  4O3M A;  3JAM K;  1RUN A;  3NWS A;  1MND A;  5TIS C;  1YX5 A;  3ZR8 X;  2CGP A;  3HSE A;  4LLG F;  4Y4R A;  3IC7 A;  2E1M C;  2CQQ A;  4D0P A;  2JSC A;  2ZFW A;  1D1A A;  1TLH B;  3CCE I;  5IPA A;  4UY8 I;  2L7Z A;  1BOA A;  4HF0 A;  3VPR A;  2VBZ A;  2VAS A;  4ZH4 F;  3IRR A;  2E1O A;  3CCS I;  2ZCW A;  2D2W A;  3B73 A;  3DTI A;  2LF8 A;  3QP5 A;  2K40 A;  4ESJ A;  2VQG A;  2EZK A;  2YX7 A;  4HV5 A;  3V7S A;  1OIS A;  3KEO A;  5FLX Z;  1LFP A;  2EIN H;  2FOK A;  3LSG A;  3I4N J;  3BRO A;  3KYL A;  2DFF A;  2BEO A;  4C3H J;  2D5V A;  4A6E A;  1LDD A;  1FSH A;  1Z7L A;  3ISP A;  4HF1 A;  5J1Y A;  1BIA A;  2ZBK A;  2M30 A;  3WTY C;  1IN5 A;  4UUS A;  1DQU A;  1XX5 A;  2CFX A;  2HNH A;  2XAQ A;  4HX4 A;  2LVS A;  2WB1 A;  4AD9 A;  3FIS A;  1BI2 A;  4Y3O A;  1S29 A;  5EEH A;  4MIM A;  4KA4 A;  5AIQ A;  2CQ7 A;  2QA4 I;  1JKO C;  4EGZ A;  3IH2 A;  4QSH A;  1HW1 A;  4BJ5 C;  1NH3 A;  1H8A C;  2QSH X;  4YIR X;  3Q5F A;  5KK1 A;  1V5G A;  4FHT A;  4XN3 A;  1IV8 A;  4E6K G;  1KON A;  5LRR A;  2EIJ H;  3I5U A;  3N97 A;  3H35 A;  1ONV A;  4DYC A;  1MNM C;  1QNT A;  5IT3 A;  1S8N A;  1WJB A;  3E5Q A;  3WE2 A;  2O61 A;  1QO0 D;  4NDL A;  2EPF A;  4B43 A;  2VBX A;  4WK8 F;  3M8J A;  4JP0 A;  3FK7 A;  1DU0 A;  5LHI A;  1T38 A;  4IX7 A;  2QKM B;  3Q0V A;  4AM3 A;  2LD5 A;  3MZY A;  1FOW A;  2HYG D;  3EYI A;  1RES A;  2OZU A;  2BHY A;  1JJ8 C;  1NTC A;  3ZPL A;  3S17 J;  3ZMU A;  1X58 A;  1YI2 I;  1Z0X A;  2JPB A;  2W57 A;  1BJZ A;  3K4B A;  3S1Q J;  3JTG A;  3P5J A;  3I58 A;  3BPV A;  3KCC A;  1FTT A;  2M4G A;  1MMN A;  2KMU A;  4RGR A;  4MNU A;  2JK3 A;  3M07 A;  1B59 A;  3CLQ A;  1OCT C;  4OWR B;  3JW4 A;  1ITY A;  2MD0 A;  2HGC A;  4KYW A;  4ENJ A;  1ZH5 A;  1Z77 A;  2L9V A;  4HST A;  1JI8 A;  3MN2 A;  2GXG A;  5IOZ A;  1YLF A;  2XPW A;  1DDN A;  4XKC A;  3FZV A;  4WWC A;  4ESB A;  4CCK A;  4PFO A;  1J7K A;  4X0G A;  2CS3 A;  1V3F A;  2FBK A;  1NK3 P;  4E70 A;  1VFC A;  3GZN B;  1MGT A;  3GCM A;  2HQ5 A;  3M7G A;  3MKZ A;  3Q3S A;  2LOO A;  1BI0 A;  4NNJ A;  3S14 J;  3A2K A;  3C2B A;  3BZK A;  2FNP A;  2W48 A;  2R93 J;  4OOI A;  4P9F A;  3T5X A;  4FX4 A;  3CDL A;  4CH7 A;  2VN2 A;  2KIM A;  3J7Y J;  1X1D A;  2LLK A;  3CCL I;  2VQH A;  1XGO A;  1Z6R A;  2HS5 A;  3RDI A;  2KFD A;  5E17 F;  4P55 A;  1OPC A;  1CF7 A;  5LFA A;  2FQ3 A;  4L9N A;  1CF7 B;  3KZZ A;  3WE3 A;  1RRJ A;  1MSF C;  3HSF A;  2P6S A;  2M87 A;  5E8G A;  3ZQQ A;  3EET A;  2KDZ A;  3CD6 I;  3REO A;  5J1R A;  3ZMT A;  4UUV A;  5D5X B;  5B66 C;  1KYZ A;  2ZJP F;  1DPR A;  1ULY A;  2JUC A;  3ERM A;  3K4C A;  1VQM I;  4K2E A;  3IH3 A;  1U8B A;  4MHG A;  2FQ4 A;  3RCO A;  4ABZ A;  4NB5 A;  5AIP A;  1X1P A;  1Q1H A;  3L2W A;  5K7H A;  3HUG A;  4BY1 J;  1FSE A;  3V8J A;  1YJ9 I;  3ML6 A;  1RET A;  3K7A J;  2GQQ A;  2DA4 A;  4B4C A;  4HAM A;  1BJA A;  2ZJQ F;  2VT3 A;  1KYW A;  4HV6 A;  4L5I A;  3ZN1 A;  4XN0 A;  4M3G A;  2F4O B;  5GTH C;  1R1U A;  1IUF A;  1N75 A;  4DOZ A;  1OCZ H;  2DLL A;  1ZLK A;  3G2B A;  4A2U A;  1OR7 C;  1UG2 A;  3J81 Z;  2L4A A;  3FKJ A;  2LH9 A;  4U87 A;  2HOS A;  3EYY A;  2FOW A;  4HRI A;  4HDU A;  1TT0 A;  2O0Y A;  4JQF A;  1G3T A;  2VQC A;  2IGM A;  1O57 A;  3A01 A;  2ID3 A;  4F52 A;  5HOD A;  2K9M A;  3S3O A;  1MDM A;  3A01 B;  3I53 A;  2K85 A;  1F1Z A;  5D5W B;  4ZC3 A;  1MDM B;  2GA2 A;  2YPR A;  1KGS A;  5CKT A;  1IRX A;  4DZJ A;  1UEL B;  1BOB A;  3SDB A;  3KP6 A;  2VJ5 A;  3H5N A;  3BG3 A;  2EFO A;  4RGU A;  3MFK A;  3JRC A;  5K5Q A;  2A6H F;  1LJ9 A;  4A3B J;  2DTZ A;  3KP4 A;  3MQ0 A;  2E60 A;  3S2H J;  1RPW A;  5ICF A;  1Z1D A;  2JSP A;  4A0Z A;  4IOA F;  3F6O A;  3TGN A;  4ENM A;  3BG7 A;  1A04 A;  1P6R A;  3L9F A;  3KYC B;  1GT0 C;  3RPQ A;  5LHG A;  2VBY A;  2B9S A;  1D0Z A;  2A05 A;  3RIR A;  3L2R A;  1GVD A;  5GAG J;  2K4J A;  4C2T A;  1G3Y A;  2NS0 A;  5L3E A;  1W1W E;  2GWR A;  1EKE A;  1A31 A;  4XON A;  1TNS A;  2X51 A;  3ONQ A;  3SXY A;  2X6O A;  5M5Y J;  3DXJ F;  2IA2 A;  2XB5 A;  3I59 A;  3RKW A;  4XSZ F;  2CUZ A;  4LB5 A;  3I59 B;  3CQZ J;  3HOX J;  1WRJ A;  1P92 A;  4BE2 A;  4KFC A;  5F0C A;  2MBF A;  2IXS A;  2HVQ A;  2JUG A;  1JHF A;  2K3P A;  3A02 A;  1D5Y A;  3H3V K;  3V8L A;  4P9U A;  3H9G A;  4BGD A;  4L5J A;  1O3S A;  3F3X A;  4JX6 A;  2WY8 Q;  1TQP A;  5HDK A;  3CES A;  4QPO A;  4PSX A;  4W1U A;  1TBX A;  2H8W A;  2IVM A;  4HA8 A;  3CP2 A;  4ZYE A;  4OU0 A;  1FLI A;  2XVC A;  3M8F A;  1D0Y A;  4HX8 A;  1WH5 A;  4IPA A;  3AKZ A;  2RGV A;  1XC5 A;  2HQR A;  3L1P A;  4RB2 C;  2XF6 A;  2XAU A;  3DWL E;  3E6M A;  5E1X A;  2L9N A;  3M1C A;  2H8R A;  3KLO A;  4XIC A;  1XDS A;  4V19 K;  2WB1 N;  4DBR A;  1T56 A;  2EV5 A;  3RJP A;  1WJF A;  1QVU A;  1Y8R B;  1R4M B;  2FJ1 A;  3K1N A;  3HOW J;  1SMT A;  3PNT A;  1HW5 A;  4H4K C;  2DQL A;  1BW6 A;  3P7N A;  4D7M A;  3MZ8 A;  2A07 F;  1N25 A;  3GTG J;  4LLL A;  4ZTF A;  2RKH A;  2MH2 A;  3RQ4 A;  2AO9 A;  2NYX A;  1GXQ A;  3HGY A;  3H9Q A;  2CWE A;  5KVR A;  1E3P A;  2VC0 A;  1R7J A;  4YFK F;  4IHT A;  1Y39 A;  3F23 A;  1HKS A;  4XOR A;  3FHZ A;  4PFP A;  3K4L A;  5DD8 A;  1MIJ A;  1D8J A;  5CQE A;  2KHM A;  3U1D A;  2B7E A;  4RB0 A;  4HNT A;  3OYD A;  5D4R A;  4Y13 A;  2GZW A;  2V6C A;  1G59 A;  3JR9 A;  3RKQ A;  1YIO A;  4HPQ A;  4II2 A;  4C3J J;  1ZK8 A;  5IP7 J;  2XRO A;  3R0J A;  4Z2Y A;  4CZZ A;  3OYA A;  4AUX A;  4EJV A;  1XSD A;  3CJT B;  2JRM A;  3GW2 A;  3X2Q H;  1U78 A;  2I10 A;  1N77 A;  4OAY A;  2L2O A;  4G94 A;  2DFI A;  2R7O A;  3PNV A;  4BQA A;  4A6D A;  2L54 A;  2E5Z A;  4LIU A;  2JZY A;  4YEJ A;  3V42 A;  1MSE C;  1X4P A;  3NWT A;  3CCV I;  3BZ6 A;  2Z1D A;  3RKX A;  5M5X J;  2WWY A;  5FD6 A;  4IXA A;  1BR4 A;  4CCL A;  9ANT A;  1APL C;  1EF4 A;  4ITV A;  3DBL B;  1GUU A;  2JA5 J;  1TNT A;  2KDO A;  3VDX A;  1ZGJ A;  5HNH A;  6PAX A;  3G73 A;  4KUM A;  2HI3 A;  2X1E A;  3PIO F;  2L7K A;  4HYE A;  3DBH B;  3QWL A;  5DUI A;  2RNJ A;  1WI9 A;  2FSW A;  2Y0M A;  5D5U B;  2XV4 S;  1AHD P;  2Z5U A;  4XMY A;  2LFB A;  1ETY A;  2CUF A;  3BLY A;  2LRE A;  4DW6 A;  2BGC A;  2ME0 A;  3SZG A;  4F55 A;  3D1N I;  2WY7 Q;  5HLH A;  4HQM A;  2A69 F;  2EK5 A;  3ASO H;  4ZYA A;  5M5W J;  1RNL A;  2ZME C;  4AC0 A;  2QBY A;  4M74 A;  1NK2 P;  2QBY B;  3JSO A;  1W5C C;  2DJI A;  5L3D A;  3GFM A;  1YIJ I;  1V55 H;  2R7Z J;  1D1B A;  4CO8 A;  3S32 A;  5BQT A;  1FOY A;  2HZT A;  5FLV A;  5EG0 A;  2DOE A;  3RYR A;  5EG0 B;  2K7L A;  1Y6I A;  2DYR H;  2OTJ I;  1W7P D;  4XLE A;  1MMG A;  2XKP A;  2P5V A;  1I6H J;  3VSK A;  2KT0 A;  2FNA A;  1YQA A;  1IW7 F;  1UFM A;  1ZR2 A;  5LHH A;  4JBA A;  2HTJ A;  2OZ6 A;  4KNY A;  1W36 D;  4XID A;  2E19 A;  3GTL J;  2FX0 A;  2FUG 2;  5HS9 A;  2HVR A;  1M1E B;  2EFW A;  1R4N B;  4XNF A;  1RZ4 A;  1VND A;  3KZY A;  3L2Q A;  2IAI A;  3LSI A;  1GHC A;  3IL2 A;  1H9G A;  4WCG A;  3ROU A;  2CV0 A;  3BCA A;  5FKN A;  4XK4 A;  4IJA A;  2VKD A;  1PP7 U;  3FHN A;  2PFB A;  2E5N A;  4E7S A;  1BI1 A;  3AG2 H;  3W2W A;  2GOX B;  3LQR A;  2WV0 A;  5DYM A;  1R71 A;  2BXZ A;  3ZN0 A;  3DKY A;  3F0C A;  3GVA A;  3OY9 A;  3D5L A;  2DU9 A;  2QUF A;  1TT5 B;  4RLF A;  3CMY A;  1HLV A;  3TP0 A;  4QPQ A;  2XAF A;  2FE3 A;  4CIC A;  2V79 A;  2OJE D;  1U5T A;  1Z67 A;  3IHU A;  1T33 A;  1U5T B;  4DNC A;  3JRD A;  1ON2 A;  3ZCO A;  2F5V A;  1LVK A;  1ZEL A;  1K6O A;  2RVC A;  2NVU B;  4E7Z A;  2W25 A;  5ICE A;  2HTS A;  2CJJ A;  4OIQ F;  1D0X A;  3G6E I;  1LKX A;  1I39 A;  1KU3 A;  3AG3 H;  2OPT A;  5F08 A;  1IN4 A;  4BHP A;  1IXC A;  3KZI C;  2GIZ A;  4P1W A;  2E7X A;  2ISY A;  4BL0 B;  4UXN A;  5EDN A;  5E3N A;  3RZO J;  2HU9 A;  2VPL A;  5HDN A;  5LLQ A;  4RAF A;  3RZD J;  2QLZ A;  3LAP A;  4XBF A;  1FIP A;  1QPM A;  3HXL A;  1KU9 A;  4LJZ F;  1KQ8 A;  4EJW A;  4BHC A;  5GAH J;  2FEZ A;  4GRI A;  3HOU J;  2HOA A;  2COB A;  5E1Z B;  2VOD A;  3BR1 A;  2GLO A;  3GLX A;  4RAG A;  1R36 A;  1I1G A;  1ZG3 A;  3AG4 H;  1QGP A;  1J0R A;  3FXR A;  5FO5 A;  5KHD A;  3EUA A;  2E71 A;  1FWZ A;  4RMN A;  5IYD J;  3BTJ A;  2DCE A;  1WJE A;  3O2P E;  3K1P A;  2HWV A;  3CMA I;  1B8I A;  3WG9 A;  4BE1 A;  2R7W A;  1T0F A;  1B8I B;  3M3Y J;  1G2H A;  2VIX A;  5J6X A;  4YII A;  2ZXH A;  3PM1 A;  1XSV A;  3OS0 A;  5CVI A;  1FOK A;  1WI3 A;  1R22 A;  4LIV A;  4IF4 A;  3OYE A;  3MMY B;  2LNB A;  2R5Z A;  4CCM A;  3K1M A;  3TO7 A;  2R5Z B;  3PJR A;  4UHT A;  2XGX A;  3RTR A;  1YS6 A;  3CCM I;  3GFJ A;  3S93 A;  5A2Q Z;  3HOV J;  1EH8 A;  3ABT A;  3QPS A;  2R7D A;  3WHC A;  2P5L C;  4BXX J;  2ECC A;  3SDG A;  4I09 A;  5FLX K;  4L9T A;  2FBI A;  2ADU A;  3G1M A;  5HS7 A;  3MEX A;  2LMD A;  1EA3 A;  2NOJ B;  2P7C B;  5BPD A;  4G8X A;  1FP2 A;  4XLA A;  3KEQ A;  3OIQ A;  2QEX I;  4B09 A;  2PEX A;  2W1O A;  1LB2 A;  2HKX A;  4IHX A;  1R9T J;  4EGY A;  3B02 A;  4U7D A;  1SAU A;  1OCP A;  3DPL C;  5B3S H;  1TW2 A;  4G7H F;  2IT0 A;  4M3E A;  4J19 A;  3CO6 C;  1KQ9 A;  2EZL A;  2RC4 A;  2XKO A;  2K9S A;  1I6X A;  1JXS A;  2XDV A;  2EFQ A;  3CMM A;  1ZKG A;  3LNQ A;  1LPQ A;  3K2A A;  4QTR A;  5H6Q A;  2EA2 A;  1MD0 A;  5IP9 J;  1YX3 A;  2FA5 A;  1TWH J;  2JMW A;  2M0C A;  5F1J A;  3PUB A;  2X85 A;  4G12 A;  3L2C A;  3GTP J;  5JHF A;  2QGU A;  3MZH A;  1LVA A;  1QBJ A;  1WCM J;  4I2O A;  5BPI A;  2P0W A;  3B6C A;  2P5K A;  2FML A;  3SHF A;  1JUM A;  2KIQ A;  3K70 C;  4XRM A;  3H1C A;  2YU9 J;  2QF7 A;  3ZMZ A;  1YFH A;  1GV5 A;  1OQY A;  4M71 A;  1A35 A;  2R4G A;  4KMF A;  3ZQH A;  4Q5S F;  2G7H A;  2BBY A;  5L3C A;  5HOO A;  3FBI B;  3WTX C;  4IRG A;  4EEF G;  2F5E A;  2F4I A;  5ILU A;  1O3T A;  3NQO A;  3QU6 A;  1STZ A;  1WH7 A;  2BW3 A;  2M1B A;  1OYY A;  4NBQ A;  3GTM J;  1MBH A;  2BW3 B;  3ABM H;  2EZI A;  5HLT A;  3EUK L;  4MLO A;  4UUS B;  2HR3 A;  3M9A A;  1U6G A;  1J5Y A;  1GDT A;  1ZGW A;  1IRG A;  2WAQ A;  2EIM H;  2MAB A;  2X4H A;  2EB7 A;  1Q1V A;  3BTC A;  5DM6 F;  2RV8 A;  2OQG A;  1ZAR A;  1MH3 A;  4YFN F;  2UXX A;  2OV7 A;  3HDD A;  4OIO F;  2XHK A;  3D0S A;  4M6V A;  1FYK A;  1GLN A;  4C3I J;  1V54 H;  4IHY A;  2V4J C;  5H20 A;  4S05 A;  2P6T A;  4LMY A;  3FF5 A;  5EZG A;  3LMM A;  4BH9 A;  2L9S A;  3OL4 A;  3K2Z A;  1QA6 A;  5L3F A;  2W00 A;  3LSP A;  1R6R A;  4EM1 A;  4D9J A;  1SFU A;  2L02 A;  2EA4 A;  1K78 A;  5LGU A;  4FE4 A;  4XRS A;  1FOX A;  4EQQ A;  5K7F A;  3IV5 A;  1K78 B;  2IRF G;  1BBY A;  2IGK A;  1H89 C;  2BV6 A;  3OIP A;  4CYD A;  1S5L C;  1ZLJ A;  2W84 A;  2FF4 A;  1SC7 A;  3KFW X;  3V7C A;  2VBW A;  1DU6 A;  4ZDL A;  3WU0 A;  3ZQI A;  4M72 A;  4ESF A;  3O6B B;  4JK1 X;  3IKT A;  1DP7 P;  4U0Y A;  5C4X J;  2Z3Y A;  4MEY F;  3WTT C;  3S1M J;  1T2K A;  3P9C A;  2PJP A;  3PFI A;  4ZDO A;  3IWZ A;  3FKI J;  1O4X A;  4ZYD A;  1F43 A;  2PMZ A;  3W2A A;  4Q47 A;  2O8K A;  1ZRE A;  5F27 A;  3KP2 A;  1MJ9 A;  3EDP A;  1IN7 A;  4PK4 A;  5FKM A;  3T8T A;  2KIU A;  2R92 J;  3U21 A;  3J81 K;  3U9G A;  4ANJ A;  2NNY A;  2UV1 A;  1EV7 A;  2AS5 F;  4IOC F;  4BEH A;  3JRA A;  3H92 A;  1LFB A;  3K4M A;  3K0L A;  3VYS B;  4BEH B;  2MH9 A;  3C1D A;  2K9Q A;  5K7Z A;  1VQP I;  3UNG C;  1G3W A;  2H1L A;  2XGC A;  1S7O A;  1QHG A;  2FU4 A;  4AYB A;  2HXI A;  4BS9 A;  4DIQ A;  3RYP A;  2ZC2 A;  2XSJ C;  4BQQ A;  3A03 A;  3CME I;  3M8E A;  4NC7 A;  3AL0 B;  3K69 A;  2GA1 A;  4BXF A;  1R5G A;  1B6A A;  2XPV A;  3MWM A;  4KMU X;  1WVR A;  3CUQ C;  2LTP A;  2Y31 A;  1FP1 D;  3WU1 B;  2ID6 A;  4U88 A;  4R1H A;  4E7L A;  1EH6 A;  1XTA A;  1WPK A;  4NC8 A;  3MCZ A;  3PUF A;  2H27 A;  3JRG A;  2CQX A;  3LL7 A;  2K02 A;  2YSR A;  3F8M A;  1G8X A;  3DPT A;  3BJO A;  3GTJ J;  2IS2 A;  2M8E A;  1PJR A;  4LB6 B;  3HUG B;  2VT2 A;  5HLG A;  3C2H A;  3GX4 X;  1WJA A;  3LSH A;  3CTA A;  2XAG A;  1U8R A;  3NAR A;  3PO2 J;  4OIN F;  2E2I J;  2EIK H;  4AIJ A;  4MEX F;  1U0J A;  4JYK A;  3KEY A;  2ICW G;  1MBE A;  3VEP A;  2IPQ X;  2M34 A;  3CF2 A;  3CJN A;  3IP4 B;  5E3L A;  1B1B A;  5E1W A;  3OSG A;  2NRA C;  4YEL A;  2XF5 A;  5ED4 A;  2OTL I;  4XKB A;  2E1N A;  1X3W B;  3A1Y A;  3FXU A;  3GME A;  3KYD B;  1G6N A;  3AG1 H;  3TED A;  5KAI C;  1WHU A;  4LK1 F;  1UHM A;  4HW0 A;  2ACJ A;  3L09 A;  5IT9 Z;  2AXL A;  2HKO A;  3LOC A;  2CV2 A;  1IRF A;  4U0V A;  4L0Z B;  3SZT A;  1IN8 A;  1BIB A;  2QCO A;  2LSO A;  1FZP B;  3W6K B;  1BR1 A;  2YUS A;  2CRG A;  4A0Y A;  3GUD A;  1Z91 A;  5ICC A;  5EGO A;  2DA3 A;  4UVA A;  5EGO B;  3BR5 A;  3SZP A;  2RQP A;  3ZOB A;  2J5O A;  2LYC A;  2LY1 A;  3SFI A;  4PDK A;  3OYN A;  1BC7 C;  1HW2 A;  4Z6Y A;  2JA7 J;  2DFH A;  3KE2 A;  2ELK A;  3G71 I;  5GPC A;  4CHU A;  4A3G J;  1ETK A;  4PGG A;  1UG0 A;  1U9N A;  2QQB A;  3E6C C;  2DI3 A;  5JI6 A;  2Z2S B;  3FK6 A;  4KN7 X;  4I02 A;  4PCQ A;  4CUG A;  1A6I A;  1MBG A;  1HBX G;  2EIL H;  1VQK I;  2FBH A;  2CQK A;  5D5V B;  2AQE A;  4N9I A;  4I0B A;  1H9T A;  3PFY A;  2B63 J;  2Q8K A;  1OYI A;  3TW6 A;  3JRI A;  1AA7 A;  4BNC A;  2F2E A;  3QPT A;  2K27 A;  1BC8 C;  3QOE A;  1G3S A;  2IEK A;  3H5A A;  4Y52 J;  2BHZ A;  2FMY A;  2JVH A;  4OMY A;  1DUX C;  1Z3Y A;  4RS8 A;  4AIH A;  1YS7 A;  5LD2 C;  1QHH D;  1XMK A;  3R6S A;  1MZB A;  1ZN2 A;  3WTV C;  2O3F A;  4CA0 A;  4G9Y A;  3DF8 A;  1TQI A;  2F5F A;  1Z6T A;  1RR8 C;  3G1O A;  1O3R A;  2BZT A;  2EFP A;  3BZC A;  4FQG A;  3W3C A;  3NAU A;  3L2U A;  1ON1 A;  4F7Z A;  5IY5 H;  5ERI A;  3TP3 A;  1FBU A;  3ZQG A;  1E3O C;  2LR8 A;  3CP8 A;  3KP7 A;  2DO7 A;  3GF2 A;  3EUH A;  2P8T A;  1GV2 A;  4D1Q A;  4BBS J;  3ULQ B;  2Q2E A;  3TQN A;  1X3Z B;  5E20 A;  1IF1 A;  2CQN A;  4A3L J;  4E7I A;  3D5R C;  2K9L A;  2DYS H;  2GOM A;  5H6R A;  5IYC J;  1V4R A;  3MD2 A;  2WAQ N;  1MMA A;  2GBY A;  2VJJ A;  4DYR A;  2E1C A;  4PSW A;  1J9I A;  4LK0 F;  3OYF A;  2NXN B;  3P9K A;  2M7B A;  2E1M B;  4IRH A;  4XOP A;  4X6A J;  3M1E A;  4S04 A;  3WGI A;  3PQK A;  2VJ4 A;  5JVT A;  4RGS A;  1MBF A;  1ZTR A;  3PSF A;  3BR3 A;  3DQV C;  2HDC A;  1SFX A;  2X1C A;  2AHQ A;  4M9X A;  3BG5 A;  4M73 A;  4CYC A;  2CG4 A;  2VQL A;  3G1L A;  4CYC B;  3DU5 A;  4C9Y A;  3TBI A;  2DK5 A;  2CFO A;  3FXK A;  2PQ8 A;  4IEJ A;  4AIK A;  1SVM A;  1RUO A;  3EQL F;  3LSR A;  3FDY A;  3HEF A;  5FD5 A;  2O03 A;  4M6X A;  1VQ7 I;  1R58 A;  4O6J A;  1Z05 A;  2KRH A;  2P4W A;  2VXD A;  3S16 J;  2O5R A;  1F9N A;  5DTD A;  3HC7 A;  4CSW A;  4IL6 C;  1HCR A;  3H36 A;  2L3D A;  5L3G A;  2V1D A;  5LGN A;  5LEK A;  4I01 A;  4MO7 A;  2VUM J;  2DQR A;  4IO9 F;  2IGN A;  1YYV A;  2OBP A;  1OCC H;  4GGG A;  3OYM A;  3QOP A;  4C30 A;  5FFZ A;  4Q4Z F;  1UHS A;  1ODD A;  2LC2 A;  1WKM A;  1VF9 A;  1I1S A;  1MBK A;  5B5E C;  4KIT B;  1VQ4 I;  1XMX A;  3W6V A;  2K86 A;  3TO9 A;  1WJD A;  5EJC A;  2VL8 A;  1HST A;  1K7A A;  2QKL B;  2DMP A;  2UZK A;  3DEU A;  4U0W A;  1YG2 A;  5C4J J;  2PMZ N;  3K10 A;  2X6W A;  2A61 A;  3KP5 A;  2HPI A;  1IUY A;  4QLC U;  2RRE A;  5HVQ C;  1CQT A;  3J80 Z;  4L9V A;  4BAC A;  3E5U A;  1YOV B;  2MG4 A;  1XGM A;  1WSU A;  2KIS A;  2ZB9 A;  1KZH A;  2JN6 A;  3WU2 C;  2E2H J;  4KIC A;  4ZZD A;  3R60 A;  2PI0 A;  1OCR H;  1X3U A;  4AYB N;  5HS8 A;  3OYI A;  5FFX A;  2E34 A;  1QPI A;  1HDD C;  3CZ6 A;  4KDP A;  3VOD A;  1WFX A;  4IVN A;  3SEZ A;  3LAJ A;  1D1C A;  5FKO A;  1HDP A;  1LEA A;  4NC6 A;  2JA8 J;  4EVI A;  4QWQ A;  1DPU A;  4Y15 A;  1RKT A;  4OIR F;  3HZJ A;  3TDU C;  3CF5 F;  4RA2 A;  5FB2 A;  5HDG A;  3OYH A;  1YRN A;  1NG6 A;  5JR3 A;  5D8L B;  2M0M A;  1BM9 A;  5B1A H;  1ERD A;  2EZH A;  2V9V A;  4XLP F;  1VQO I;  2VI6 A;  5GAD J;  1ZR4 A;  1CGP A;  3FXL A;  1ZAO A;  2QQA A;  1K61 A;  4DBQ A;  5DM7 F;  2K3F A;  2DDB A;  4NQW A;  1PUF A;  2NOG A;  1ORK A;  2ZSI B;  3F21 A;  4NQW B;  2E7W A;  3HRS A;  2LKP A;  4RDU A;  2ISZ A;  3BR6 A;  2JJ7 A;  1B9N A;  4IZZ A;  3C2G A;  3H0D A;  1G4D A;  5CVJ A;  2M3A A;  4G7Z F;  3I56 I;  1HQC A;  5J4Y A;  3PL8 A;  3CJR B;  1IXR C;  5J8F A;  2A3S A;  2F5C A;  4A93 J;  3G3Z A;  2J5P A;  3CCY A;  1JKQ C;  2MC3 A;  1BN5 A;  4PUS A;  2HQN A;  2CU7 A;  5JLX A;  2ZFU A;  3LSM A;  5H2F C;  5LEJ A;  1L3L A;  1POG A;  1U3E M;  2R7F A;  3A0H C;  1USS A;  2PG4 A;  3F8C A;  2NVQ J;  3CC7 I;  2CO5 A;  4WF2 A;  4ETS A;  3PO3 J;  2XAH A;  3HGG A;  1XG1 A;  2HZD A;  2VOP A;  3A4C A;  3V4G A;  4L18 B;  3ECO A;  4A3M J;  3K70 D;  3RPU D;  4BU2 A;  2M5W A;  4J01 A;  4A3I J;  1TWG J;  1J59 A;  5DUK A;  2Y30 A;  4RB1 A;  4FIS A;  2DDA A;  3WHB A;  4YIF A;  5JHU A;  2ZKZ A;  2V1N A;  1IO2 A;  3TW7 A;  1KA8 A;  1HSJ A;  1P4W A;  2O9L A;  2CUJ A;  1K4S A;  2MLK A;  3UKG A;  3ZQ7 A;  1FY7 A;  1J2X A;  3IAM 2;  5JFR A;  5LGT A;  4MFD A;  1LE8 A;  1X19 A;  2KJB A;  1LE8 B;  4ENK A;  1P9Q C;  3CUO A;  1T08 B;  3CCR I;  4ON0 A;  5J3L A;  2D1H A;  2BVL A;  2ESN A;  4JX4 A;  1L0O C;  3LFU A;  4UVB A;  3WG7 H;  4UUT A;  2OCC H;  5A2Q K;  3DP7 A;  2K4B A;  4KIF A;  4OAZ A;  3S8P A; 
#chains in the Genus database with same CATH homology
 1J75 A;  1AOY A;  2PN6 A;  5CLS A;  3N4M A;  5DCF A;  3GWZ A;  5AON A;  2STW A;  3JSP A;  4DQ2 A;  4AWX B;  1QZZ A;  1SAX A;  3WTZ A;  2PMU A;  3L00 A;  3I0T A;  1O7L A;  4EJO A;  4LFU A;  2VE9 A;  3KET A;  2H94 A;  4KN4 X;  1XCB A;  3E6D A;  3WGG A;  2BE5 F;  3LA2 A;  4N9H A;  1FPQ A;  1W5S A;  1YW9 A;  4A5M A;  1YO5 C;  2PMH A;  1I5Z A;  2BYV E;  3T0Y A;  4LGW A;  2IP2 A;  3RKY A;  3T1B A;  1YTY A;  1LQ1 A;  5F1R A;  3FX3 A;  5J8C A;  3F72 A;  5CVV A;  1D8K A;  4LLN A;  5ILS A;  4O5V A;  1MKM A;  5HLI A;  1C0W A;  2OAZ A;  1I27 A;  5CVU A;  3TDZ C;  3I4P A;  4R8H A;  1JHH A;  4Q48 A;  3BJA A;  1EH7 A;  1QZY A;  1SD5 A;  2DTR A;  1T6S A;  2Z9O A;  1Z9C A;  4I0A A;  3C18 A;  1XMA A;  5D6E A;  2YR2 A;  4FX0 A;  4G6D A;  5D4S A;  2A5Y B;  2RN7 A;  4A12 A;  1K79 A;  4LG0 A;  3LST A;  4LG0 B;  4HF2 A;  3FM5 A;  1UB9 A;  1IN6 A;  1ZGA A;  2O6G E;  5BMZ A;  5ICG A;  2XUB A;  1W5T A;  3HRM A;  4RGX A;  4RB3 C;  4M9S A;  4NHJ A;  1MJA A;  4HZF A;  3ZMS A;  2M45 A;  3HOS A;  2VC1 A;  5ILV A;  1ZG5 A;  1W4M A;  3HRT A;  2XIG A;  2D1V A;  2EJR A;  5CVR A;  4GO1 A;  1OMI A;  3FM3 A;  3SFZ A;  4ZYG A;  3I64 A;  3R61 A;  5D8K B;  3ZMV A;  2WC2 A;  5LRS A;  2MLG A;  2DAO A;  4MQ9 F;  1HKT A;  3DKW A;  2IA1 A;  3CDH A;  4A0X A;  2ZNZ A;  2QVO A;  3WTU C;  1UHW A;  1XGS A;  4YFX F;  3JAM Z;  1XCV A;  3GZ6 A;  4TV7 A;  2QQ9 A;  4I98 B;  1ZYR F;  3T8R A;  4M6Y A;  3KLN A;  2ZME A;  3E97 A;  4P5O A;  5DCM A;  4HOB A;  1KU7 A;  1WQ2 A;  2ZME B;  5DCM B;  1IZ1 A;  3F6V A;  3O3K A;  4HX7 A;  5EEG A;  4KT5 C;  4R79 A;  4OIP F;  4ZZL A;  2QZ8 A;  2VE8 A;  3LWF A;  3COA C;  3VOE A;  3E5X A;  2ZNY A;  1FNN A;  3CO7 C;  1ZRF A;  1FX7 A;  1R00 A;  2L4M A;  2Y48 A;  3GYH X;  2LDU A;  1GVJ A;  1REP C;  4AVP A;  5IT9 K;  3GFI A;  1TTY A;  3U2R A;  1S6L A;  3GFL A;  3VB2 A;  4G7O F;  3V8K A;  3HRU A;  3L7W A;  1ZRD A;  1XD7 A;  4Y17 A;  1ZHF A;  4RAY A;  3F8N A;  5L3B A;  2KKO A;  4GXO A;  2H6B A;  2W85 A;  4ENN A;  2COM A;  3W6J B;  4HLX A;  4A5N A;  1R23 A;  4UVC A;  1NHA A;  3R4K A;  1UCR A;  1PDN C;  5LBQ A;  4CGZ A;  1LEB A;  3HHH A;  1SD6 A;  3F8F A;  3BP8 A;  4MQV A;  4EM2 A;  3FXQ A;  3IWF A;  4IRI A;  1U5T C;  2IJL A;  3JTH A;  1OKR A;  1FYL A;  3J7A O;  3KP3 A;  5DDG A;  4EJT A;  1RI7 A;  3TOA A;  1E2X A;  2PBI A;  4BAY A;  1FYM A;  3F8B A;  1MJB A;  3DV8 A;  5TJJ A;  3TO6 A;  2P7V B;  4I7H A;  2A6E F;  2YX4 A;  5TRD A;  2QYO A;  1P2F A;  4EJU A;  4MTD A;  4LD5 A;  4XLN F;  4EV0 A;  2OQR A;  3PQJ A;  2JRT A;  2C6Y A;  4WXC A;  2EV6 A;  2ELH A;  2HOE A;  4GYI A;  1ZRC A;  5CYV A;  1OYW A;  2OU2 A;  5K5O A;  2F5D A;  2VOO A;  2RDP A;  4P96 A;  1XB4 A;  4XRF A;  2V1U A;  3ZP5 A;  1W7P A;  1B9M A;  2O8X A;  3QP6 A;  2GXB A;  1W7P B;  1LDK B;  1IXS B;  3GXO A;  2KIF A;  4RAZ A;  3BJ6 A;  2L01 A;  2IW5 A;  2VON A;  1PP8 F;  3GZ5 A;  2QEN A;  2XRN A;  4PZJ A;  1JE8 A;  5D6F A;  3NEU A;  4KIB A;  3WOD F;  1XDU A;  2NAZ A;  2X0L A;  2ZJ2 A;  3WGH A;  1HXD A;  4XSX F;  3J80 K;  1TW3 A;  2QM3 A;  2OA4 A;  5K1Y A;  3RPU A;  2DT5 A;  3C7J A;  1O3Q A;  4WX9 A;  3GO5 A;  3E6B A;  3BWG A;  2PLY A;  3FWE A;  2XAJ A;  2Z99 A;  3IRQ A;  3SQN A;  2ESH A;  1PUE E;  3QPH A;  1R1T A;  5DV5 A;  1F4K A;  2JPC A;  2CW0 F;  2NNN A;  2MA3 A;  1P4A A;  1VTN C;  3FMR A;  3LFK A;  2EV0 A;  3H3Z A;  2XAS A;  3AAF A;  4WXD A;  1SD7 A;  1P4X A;  2OD5 A;  4B8X A;  3HYI A;  1LDJ A;  2DK8 A;  3C3W A;  2UXN A;  1WWX A;  3DFG A;  1FBQ A;  2HYF A;  3MAJ A;  2JT1 A;  3ERE D;  5E8I A;  4BXU A;  1T98 A;  2FRH A;  2ZXJ A;  3ELK A;  5K5R A;  3BY6 A;  4HLY A;  4KIG A;  4FT8 A;  1YW8 A;  3QAH A;  2TDX A;  1TQM A;  3Q9S A;  2EWN A;  3BOQ A;  1XGN A;  3HTS B;  1XN7 A;  1RIO H;  3EYI A;  1S7A A;  1FBS A;  4PGH A;  3ZMD A;  3LQQ A;  1F5T A;  3VFZ A;  3IKV A;  1R1V A;  4H0E A;  2EFN A;  2Q0O A;  3WTW C;  4ASN A;  2A68 F;  4MTE A;  3BDD A;  2VXZ A;  3ABU A;  4CXF A;  3QRF F;  4EMS A;  3HTU A;  2Y75 A;  5BS6 A;  5E18 F;  4YG2 F;  3OV8 A;  1FT9 A;  3I71 A;  2DW4 A;  2GAU A;  3LA3 A;  3CUQ A;  3S2W A;  5DEQ A;  3CUQ B;  3BPX A;  2WTE A;  4UV8 A;  3FMQ A;  3HIF A;  5BOX A;  1SMY F;  1U2W A;  3ECH A;  1SFE A;  5DD4 A;  2HEO A;  2B0L A;  4L0Y B;  1AWC A;  1YW7 A;  2Z33 A;  1GXP A;  2H6C A;  1E17 A;  1OR7 A;  2MD5 A;  2DBB A;  1R5H A;  3LA7 A;  4IHS A;  1Y0U A;  2UWM A;  4M9Z A;  2CSO A;  5CJ9 A;  1SD4 A;  4GYG A;  1FC3 A;  2V1X A;  1ZG1 A;  4L9J A;  2GIV A;  3GEZ A;  4WXH A;  2G9W A;  5F6F A;  3K9T A;  1O7F A;  4OMZ A;  2DPD A;  3HOT A;  4BHB A;  2HFH A;  3E3V A;  4GCV A;  4UNO A;  1QQI A;  4HBL A;  3CLO A;  4HDV A;  2JTV A;  2H09 A;  1KU2 A;  1XSX A;  1S3J A;  4CDG A;  3I54 A;  4UV9 A;  2ZO4 A;  3P9I A;  1LNW A;  3RI4 A;  4ZYH A;  1D3Y A;  3F22 A;  3TKY A;  1H0M A;  1BI3 A;  1Z7U A;  1HKQ A;  2CYY A;  4BYY A;  1T39 A;  3Q9V A;  5F64 A;  2DPU A;  4EM0 B;  4U7B A;  1JGS A;  2FXA A;  2KJC A;  3WTS C;  3OOP A;  3HSR A;  2STT A;  3H3U A;  4HQE A;  2G7U A;  1IAW A;  3NRV A;  1UST A;  3R0A A;  3QU3 A;  2LF7 A;  5FGM A;  4MGR A;  1D5V A;  2QWW A;  1KQ0 A;  3V7R A;  4G6Q A;  2ETH A;  2KRF A;  2R3S A;  2IA0 A;  2W24 A;  2D45 A;  1B4A A;  3FMS A;  4N0B A;  3HHG A;  3TOB A;  2YU3 A;  4O3M A;  3JAM K;  1RUN A;  2CGP A;  3HSE A;  4LLG F;  3IC7 A;  4D0P A;  2JSC A;  2ZFW A;  1TLH B;  1BOA A;  4HF0 A;  2VBZ A;  4ZH4 F;  3IRR A;  2ZCW A;  2D2W A;  3B73 A;  2LF8 A;  3QP5 A;  4ESJ A;  2YX7 A;  4HV5 A;  3V7S A;  3KEO A;  5FLX Z;  2FOK A;  3BRO A;  2BEO A;  4A6E A;  1LDD A;  1FSH A;  3ISP A;  4HF1 A;  1BIA A;  2ZBK A;  2M30 A;  3WTY C;  1IN5 A;  2CFX A;  2XAQ A;  4HX4 A;  4AD9 A;  1BI2 A;  1S29 A;  5EEH A;  4KA4 A;  5AIQ A;  4EGZ A;  1HW1 A;  3Q5F A;  5KK1 A;  4FHT A;  5LRR A;  3I5U A;  3N97 A;  1ONV A;  1QNT A;  5IT3 A;  1S8N A;  3E5Q A;  2O61 A;  3WE2 A;  1QO0 D;  2VBX A;  4WK8 F;  5LHI A;  1T38 A;  3MZY A;  2HYG D;  2OZU A;  3ZPL A;  3ZMU A;  2W57 A;  2JPB A;  3JTG A;  3I58 A;  3BPV A;  3KCC A;  4RGR A;  4MNU A;  1B59 A;  3JW4 A;  2HGC A;  4KYW A;  4ENJ A;  1ZH5 A;  2GXG A;  1YLF A;  1DDN A;  3FZV A;  4WWC A;  4ESB A;  1J7K A;  1V3F A;  2FBK A;  4E70 A;  1MGT A;  3M7G A;  1BI0 A;  2FNP A;  4OOI A;  4P9F A;  3T5X A;  4FX4 A;  2VN2 A;  2KIM A;  5E17 F;  1XGO A;  1Z6R A;  2HS5 A;  3RDI A;  4P55 A;  1OPC A;  1CF7 A;  2FQ3 A;  4L9N A;  1CF7 B;  3KZZ A;  3WE3 A;  3HSF A;  2P6S A;  2M87 A;  5E8G A;  3EET A;  3REO A;  3ZMT A;  4UUV A;  5D5X B;  1KYZ A;  1DPR A;  1ULY A;  4K2E A;  4MHG A;  4NB5 A;  5AIP A;  1Q1H A;  3HUG A;  1FSE A;  3V8J A;  3ML6 A;  2GQQ A;  4HAM A;  1BJA A;  2VT3 A;  1KYW A;  4HV6 A;  4L5I A;  3ZN1 A;  1R1U A;  2DLL A;  1ZLK A;  4A2U A;  3J81 Z;  2L4A A;  3EYY A;  4HDU A;  2O0Y A;  4JQF A;  1G3T A;  1O57 A;  1MDM A;  3I53 A;  5D5W B;  1F1Z A;  1MDM B;  2GA2 A;  2YPR A;  1KGS A;  3KP6 A;  4RGU A;  3MFK A;  2EFO A;  5K5Q A;  2A6H F;  1LJ9 A;  3KP4 A;  3MQ0 A;  5ICF A;  1Z1D A;  4A0Z A;  3F6O A;  3TGN A;  4ENM A;  1A04 A;  1P6R A;  3L9F A;  3RPQ A;  5LHG A;  2VBY A;  3RIR A;  2K4J A;  1G3Y A;  2NS0 A;  5L3E A;  2GWR A;  1TNS A;  3SXY A;  3DXJ F;  2IA2 A;  3I59 A;  3RKW A;  4XSZ F;  4LB5 A;  3I59 B;  1WRJ A;  1P92 A;  4KFC A;  2MBF A;  1JHF A;  3V8L A;  4P9U A;  1O3S A;  4L5J A;  3F3X A;  1TQP A;  5HDK A;  1TBX A;  2IVM A;  4HA8 A;  4ZYE A;  4OU0 A;  1FLI A;  2XVC A;  3M8F A;  4HX8 A;  4IPA A;  2RGV A;  2HQR A;  4RB2 C;  3E6M A;  5E1X A;  3KLO A;  1XDS A;  2EV5 A;  3RJP A;  3K1N A;  1SMT A;  1HW5 A;  2DQL A;  3P7N A;  2A07 F;  4LLL A;  2RKH A;  2MH2 A;  2NYX A;  1GXQ A;  2CWE A;  5KVR A;  2VC0 A;  1R7J A;  4YFK F;  4IHT A;  3F23 A;  1HKS A;  3FHZ A;  5DD8 A;  1D8J A;  3U1D A;  4RB0 A;  5D4R A;  4Y13 A;  2GZW A;  2V6C A;  1YIO A;  2XRO A;  3R0J A;  4Z2Y A;  4CZZ A;  4EJV A;  1XSD A;  3GW2 A;  1U78 A;  4G94 A;  2DFI A;  4BQA A;  4A6D A;  2L54 A;  2JZY A;  3BZ6 A;  3RKX A;  2WWY A;  5FD6 A;  4IXA A;  1TNT A;  1ZGJ A;  6PAX A;  3G73 A;  4KUM A;  4HYE A;  5DUI A;  2RNJ A;  1WI9 A;  2FSW A;  2Y0M A;  5D5U B;  2XV4 S;  2Z5U A;  2BGC A;  5HLH A;  4HQM A;  2A69 F;  2EK5 A;  1RNL A;  2QBY A;  4M74 A;  2QBY B;  3JSO A;  5L3D A;  3GFM A;  4CO8 A;  5BQT A;  2HZT A;  3RYR A;  2K7L A;  1W7P D;  2XKP A;  2P5V A;  2FNA A;  1YQA A;  1IW7 F;  1UFM A;  5LHH A;  4JBA A;  2HTJ A;  2OZ6 A;  4KNY A;  5HS9 A;  2EFW A;  1RZ4 A;  3KZY A;  1GHC A;  3IL2 A;  1H9G A;  4WCG A;  3ROU A;  4IJA A;  1PP7 U;  2PFB A;  1BI1 A;  3LQR A;  2WV0 A;  5DYM A;  3ZN0 A;  3GVA A;  3D5L A;  2DU9 A;  2QUF A;  2XAF A;  2FE3 A;  4CIC A;  2V79 A;  1U5T A;  3IHU A;  1U5T B;  4DNC A;  1ON2 A;  1K6O A;  2RVC A;  2W25 A;  5ICE A;  2HTS A;  4OIQ F;  1KU3 A;  1IN4 A;  4BHP A;  1IXC A;  2E7X A;  2ISY A;  4UXN A;  5HDN A;  5LLQ A;  2QLZ A;  3LAP A;  4XBF A;  1QPM A;  1KU9 A;  4LJZ F;  1KQ8 A;  4EJW A;  4BHC A;  2FEZ A;  5E1Z B;  2VOD A;  3GLX A;  1R36 A;  1I1G A;  1ZG3 A;  1QGP A;  1J0R A;  3FXR A;  5FO5 A;  1FWZ A;  3O2P E;  3K1P A;  2HWV A;  3WG9 A;  1T0F A;  5J6X A;  4YII A;  1XSV A;  1FOK A;  5CVI A;  1R22 A;  4IF4 A;  2LNB A;  3K1M A;  3TO7 A;  4UHT A;  2XGX A;  3RTR A;  1YS6 A;  3GFJ A;  5A2Q Z;  1EH8 A;  3ABT A;  2R7D A;  2P5L C;  4I09 A;  5FLX K;  4L9T A;  2FBI A;  2ADU A;  5HS7 A;  3MEX A;  2P7C B;  5BPD A;  4G8X A;  1FP2 A;  3KEQ A;  1LB2 A;  4B09 A;  2PEX A;  2HKX A;  4EGY A;  3B02 A;  4U7D A;  3DPL C;  1TW2 A;  4G7H F;  2IT0 A;  3CO6 C;  1KQ9 A;  2RC4 A;  2XKO A;  1I6X A;  1JXS A;  2EFQ A;  5H6Q A;  2EA2 A;  1MD0 A;  2FA5 A;  3L2C A;  3MZH A;  1LVA A;  1QBJ A;  4I2O A;  5BPI A;  2P5K A;  2FML A;  3SHF A;  3ZMZ A;  1YFH A;  4M71 A;  4KMF A;  4Q5S F;  2G7H A;  2BBY A;  5L3C A;  5HOO A;  3WTX C;  4IRG A;  2F5E A;  5ILU A;  1O3T A;  3NQO A;  3QU6 A;  1STZ A;  2M1B A;  1OYY A;  2HR3 A;  3M9A A;  1U6G A;  1J5Y A;  1IRG A;  2X4H A;  2EB7 A;  2RV8 A;  2OQG A;  1ZAR A;  4YFN F;  2UXX A;  4OIO F;  2XHK A;  3D0S A;  1FYK A;  5H20 A;  4S05 A;  2P6T A;  4LMY A;  3FF5 A;  4BH9 A;  3K2Z A;  5L3F A;  4EM1 A;  1SFU A;  2L02 A;  2EA4 A;  1K78 A;  5LGU A;  4EQQ A;  1K78 B;  2IRF G;  1BBY A;  2BV6 A;  4CYD A;  1ZLJ A;  2W84 A;  2FF4 A;  3KFW X;  3V7C A;  2VBW A;  3WU0 A;  4ESF A;  4M72 A;  3O6B B;  4JK1 X;  3IKT A;  1DP7 P;  4U0Y A;  2Z3Y A;  4MEY F;  3WTT C;  1T2K A;  3P9C A;  2PJP A;  3PFI A;  3IWZ A;  4ZYD A;  4Q47 A;  1ZRE A;  3KP2 A;  1MJ9 A;  3EDP A;  1IN7 A;  3T8T A;  2KIU A;  3J81 K;  3U9G A;  2NNY A;  1EV7 A;  2AS5 F;  3H92 A;  3K0L A;  2MH9 A;  3C1D A;  1G3W A;  1S7O A;  2FU4 A;  3RYP A;  3M8E A;  3K69 A;  2GA1 A;  1R5G A;  1B6A A;  3MWM A;  4KMU X;  3CUQ C;  3WU1 B;  1FP1 D;  4U88 A;  4R1H A;  1EH6 A;  3MCZ A;  2H27 A;  2K02 A;  2YSR A;  3F8M A;  3DPT A;  3BJO A;  2M8E A;  4LB6 B;  2VT2 A;  5HLG A;  3GX4 X;  1U8R A;  3CTA A;  2XAG A;  4OIN F;  4AIJ A;  4MEX F;  3VEP A;  2IPQ X;  3CJN A;  1B1B A;  5E1W A;  2NRA C;  5ED4 A;  2E1N A;  3FXU A;  1G6N A;  4LK1 F;  1UHM A;  4HW0 A;  2ACJ A;  3L09 A;  5IT9 Z;  2AXL A;  2HKO A;  1IRF A;  4U0V A;  4L0Z B;  3SZT A;  1IN8 A;  1BIB A;  2LSO A;  1FZP B;  3W6K B;  4A0Y A;  3GUD A;  1Z91 A;  5ICC A;  4UVA A;  3SZP A;  2RQP A;  2J5O A;  4PDK A;  1BC7 C;  1HW2 A;  3KE2 A;  4CHU A;  4PGG A;  2QQB A;  3E6C C;  2DI3 A;  5JI6 A;  4KN7 X;  4I02 A;  4PCQ A;  1HBX G;  2FBH A;  2CQK A;  5D5V B;  4N9I A;  4I0B A;  1H9T A;  2Q8K A;  1OYI A;  4BNC A;  2F2E A;  3QPT A;  2K27 A;  1BC8 C;  1G3S A;  2FMY A;  4OMY A;  1DUX C;  4AIH A;  4RS8 A;  1YS7 A;  1XMK A;  3R6S A;  1MZB A;  1ZN2 A;  3WTV C;  2O3F A;  4G9Y A;  3DF8 A;  1TQI A;  2F5F A;  1Z6T A;  1O3R A;  2EFP A;  1ON1 A;  4F7Z A;  5ERI A;  1FBU A;  3KP7 A;  2DO7 A;  3GF2 A;  3EUH A;  2P8T A;  3ULQ B;  2Q2E A;  3TQN A;  5E20 A;  1IF1 A;  5H6R A;  1V4R A;  2E1C A;  1J9I A;  4LK0 F;  3P9K A;  4IRH A;  3M1E A;  4S04 A;  3WGI A;  3PQK A;  5JVT A;  4RGS A;  3DQV C;  2HDC A;  1SFX A;  4M9X A;  4M73 A;  2CG4 A;  2DK5 A;  2PQ8 A;  4AIK A;  1RUO A;  3EQL F;  5FD5 A;  2O03 A;  4M6X A;  1R58 A;  4O6J A;  1Z05 A;  2P4W A;  1F9N A;  2L3D A;  5L3G A;  2V1D A;  5LGN A;  5LEK A;  4I01 A;  2DQR A;  1YYV A;  2OBP A;  4GGG A;  3QOP A;  5FFZ A;  4Q4Z F;  1ODD A;  1WKM A;  1I1S A;  2K86 A;  3TO9 A;  1HST A;  1K7A A;  2UZK A;  3DEU A;  4U0W A;  1YG2 A;  2A61 A;  3KP5 A;  1IUY A;  4QLC U;  5HVQ C;  3J80 Z;  4L9V A;  3E5U A;  1WSU A;  1XGM A;  4KIC A;  4ZZD A;  3R60 A;  2PI0 A;  1X3U A;  5HS8 A;  5FFX A;  4KDP A;  3VOD A;  4IVN A;  3LAJ A;  1LEA A;  4EVI A;  4QWQ A;  1DPU A;  4Y15 A;  4OIR F;  3TDU C;  5FB2 A;  5HDG A;  5JR3 A;  5D8L B;  1BM9 A;  2V9V A;  4XLP F;  1CGP A;  1ZAO A;  2QQA A;  4NQW A;  3F21 A;  2E7W A;  3HRS A;  2LKP A;  2ISZ A;  1B9N A;  1G4D A;  5CVJ A;  4G7Z F;  1HQC A;  1IXR C;  5J8F A;  2A3S A;  2F5C A;  3G3Z A;  2J5P A;  2MC3 A;  1BN5 A;  2HQN A;  1L3L A;  5LEJ A;  1U3E M;  2R7F A;  1USS A;  2PG4 A;  3F8C A;  2CO5 A;  4WF2 A;  4ETS A;  2XAH A;  2VOP A;  3V4G A;  4L18 B;  3ECO A;  2M5W A;  1J59 A;  5DUK A;  4RB1 A;  4YIF A;  5JHU A;  2ZKZ A;  1KA8 A;  1HSJ A;  1P4W A;  2MLK A;  3ZQ7 A;  1FY7 A;  1J2X A;  5JFR A;  5LGT A;  2KJB A;  4ENK A;  3CUO A;  4ON0 A;  2D1H A;  2ESN A;  1L0O C;  4UVB A;  5A2Q K;  3DP7 A;  2K4B A;  4KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...