2FNPA

Crystal structure of sara
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYFKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnpA00
2P7VB 1DPRA 5DEQA 3QRFF 3WTUC 4ASNA 4MTEA 1LDKB 3WU0A 1BJAA 3R4KA 1Q1HA 2KIMA 2QM3A 4EGZA 1QQIA 1S8NA 1O3TA 1BC8C 5HDGA 3BOQA 2IT0A 1W7PD 5LHIA 1FBSA 3GZ6A 5HDNA 1SD6A 2F5DA 5LBQA 1PUEE 5DCMA 3M9AA 3HRUA 3KP5A 2H6BA 2YX7A 5D5WB 2QQAA 3TOBA 1K6OA 3T0YA 1D8KA 3TO9A 4AIKA 4RB0A 2EFPA 3ZMDA 1MJAA 4HQMA 2J5PA 3LA7A 4AD9A 4YFKF 4G7OF 3BJ6A 4M9SA 2K4JA 4N0BA 3WGHA 4MEYF 4O3MA 1O7LA 5HLHA 5E20A 1LDJA 1S29A 2DU9A 5HS9A 1NHAA 1HQCA 4HQEA 2E7WA 1RIOH 3HHHA 3L9FA 1L3LA 1SD5A 3CLOA 5F6FA 1XCBA 1SFUA 2ZJ2A 3T5XA 1O3SA 3KLNA 2W85A 1RI7A 4M9XA 2DK8A 3HRTA 3Q5FA 4M6YA 4M74A 3GFIA 3HUGA 1JXSA 3KP6A 4OINF 3IKTA 4R1HA 4PCQA 3T8RA 5IT3A 5DD8A 3JTGA 2L4AA 2D45A 1ZN2A 3V8KA 3WTZA 3V7CA 2AXLA 2VBZA 1F5TA 1FC3A 1DDNA 3R61A 5LGTA 1T39A 3ABTA 4WWCA 4IHSA 2HZTA 3KP3A 2TDXA 3IKVA 4MEXF 2DT5A 3QAHA 1DP7P 4JK1X 1FBUA 1K7AA 1HXDA 1DPUA 3GZ5A 1XGOA 1IAWA 1R1VA 4BH9A 4P9UA 3AAFA 3P9CA 1H9TA 3TGNA 3WTYC 2GZWA 2VXZA 1LEBA 5L3GA 6PAXA 1AWCA 2XIGA 1DUXC 2HQRA 1E17A 1YTYA 1SAXA 5D6EA 2EV0A 3HTSB 2K27A 1Z91A 3I59A 4A6EA 3SHFA 1QZYA 3BJAA 4MQ9F 2OZUA 1P4WA 2O61A 1Z7UA 4RB2C 3TQNA 3J7AO 3JSPA 2L02A 4KNYA 1GVJA 1MJ9A 3ERED 4GGGA 1P4XA 3M8FA 1BI3A 2HGCA 1QBJA 5CVRA 1SD7A 4ETSA 2WC2A 3V8LA 4D0PA 4RAYA 1FZPB 2RQPA 2VONA 2P8TA 4HX7A 4KA4A 4ESBA 2ESNA 2YPRA 1ZLJA 3OOPA 3EQLF 2FOKA 2XAGA 4L9TA 4EJUA 3M8EA 2P7CB 2XUBA 4CXFA 3RDIA 3BZ6A 4I0AA 2K02A 2L54A 5CLSA 3HHGA 4A12A 3MAJA 3BJOA 1PP7U 4ENMA 1J59A 2COMA 1G3TA 2VN2A 2UWMA 3MWMA 4OMYA 3E3VA 3HTUA 4I09A 1B59A 2V9VA 4CYDA 3WGIA 1YS6A 3WTSC 3GXOA 4ESFA 1U5TB 3I54A 2QQ9A 2GQQA 2QYOA 4GCVA 2PI0A 2JRTA 4Q4ZF 2P4WA 4P55A 1IRGA 3CUOA 4KIFA 4MNUA 1EV7A 1J0RA 2QVOA 3L7WA 2MD5A 2K86A 4LJZF 5JFRA 4EV0A 4AIJA 4L0ZB 1FBQA 4UV9A 3HIFA 1KYWA 3F8FA 2QBYA 3PQJA 4G9YA 1R7JA 2MH2A 2HR3A 1K79A 2EV5A 2NYXA 2DPUA 4CZZA 2QZ8A 2VT2A 1K78B 2XKPA 1XSXA 2EV6A 1H9GA 1PP8F 1YW7A 3KP7A 4BAYA 4AIHA 3CO6C 2DQRA 1YG2A 1U3EM 3GX4X 1O7FA 1FY7A 3EYIA 2MA3A 4WXCA 5D8LB 1BI0A 1P6RA 2E7XA 4KICA 4RB1A 3HRSA 3ISPA 2ZXJA 1IN6A 5JHUA 2ZO4A 2YX4A 1ZLKA 3FMSA 2DQLA 4XLNF 4CGZA 2Z3YA 2A3SA 1B4AA 4L9JA 2RDPA 1HKQA 3DP7A 1I5ZA 1OKRA 2HKOA 4FX0A 3COAC 1J5YA 3EYYA 5CVJA 4A6DA 4RGRA 5LHGA 2DFIA 1JE8A 1LB2A 3MZYA 1UB9A 3RKYA 3GFLA 4P96A 4OU0A 1FPQA 1QZZA 3F8BA 4B8XA 2D1HA 3RKWA 4KIBA 5HVQC 4U88A 2EFWA 2VC0A 3U2RA 2VE9A 2V1DA 2IPQX 4Q5SF 4M73A 4ZYHA 2RV8A 5HLIA 1WSUA 1OPCA 4PDKA 5FGMA 1MGTA 4OIRF 3BDDA 4LD5A 5K5QA 1FOKA 1R22A 5LGUA 1TNTA 1TQMA 2XHKA 2GA2A 3EUHA 5L3FA 1HKTA 3I5UA 1OYYA 3Q9VA 5FD5A 4FT8A 1Z1DA 3TOAA 3FX3A 2A6EF 3B73A 3RTRA 4N9HA 4OIQF 1KYZA 1TTYA 4G8XA 3JAMK 3MZHA 3ROUA 1UHMA 1YS7A 3E6CC 2A6HF 1SMYF 2F5EA 1BM9A 1FWZA 5KK1A 4N9IA 2NNNA 2UXXA 3F6VA 1W5TA 4HX8A 1H0MA 1LEAA 4E70A 5L3CA 2IA2A 2HS5A 3R6SA 3NEUA 5L3BA 1I27A 3JTHA 5D4RA 2RNJA 1ON1A 1O57A 3WGGA 1R5GA 2HWVA 5HS7A 2PG4A 1YYVA 1R5HA 3F72A 4KN7X 3NQOA 4MGRA 2A69F 4BXUA 1HSJA 1J7KA 1WKMA 2CQKA 4WF2A 3R0JA 3ECOA 5CVVA 3CUQB 4DQ2A 1XCVA 3G3ZA 3GFJA 1ZRFA 1F4KA 2IRFG 5JVTA 2EA2A 3F8MA 2ISYA 3C3WA 5K5RA 1XD7A 2HYFA 4KMUX 2ZMEB 5LGNA 4Y17A 4HF2A 2X4HA 3F3XA 1STZA 4L5IA 2W84A 2Z9OA 4JBAA 5L3DA 5CVUA 3K9TA 2M1BA 3IRQA 1OMIA 2LSOA 1X3UA 2R7FA 4BHCA 4L9NA 2HDCA 1P4AA 2Z5UA 3SZPA 4RS8A 1IN4A 3CDHA 1G3SA 4R8HA 4LMYA 5E1XA 1MJBA 2W24A 4RB3C 4UVAA 2XAFA 1IN5A 3GF2A 4LG0B 2J5OA 4KUMA 3E5QA 2X0LA 4Y15A 3ZMVA 2H09A 2FE3A 2P6TA 2V6CA 2A07F 2VOPA 1FSHA 3H92A 2ISZA 1S3JA 1TW2A 2CW0F 4BQAA 2PMHA 2LF8A 2VT3A 3L00A 1E2XA 3DKWA 1EH8A 3V7SA 3VFZA 2M5WA 4EJVA 2FF4A 1YFHA 5LHHA 4XRFA 3O3KA 1BC7C 5D5XB 2Y75A 2ZBKA 5LEKA 3CUQA 3GLXA 3KEQA 3KCCA 5H20A 4LLGF 3VOEA 3C1DA 1RUOA 1F9NA 4XSZF 2IW5A 2R7DA 4UXNA 4RGSA 5H6QA 2XAHA 2NAZA 5LRSA 1IXCA 3I4PA 2ZMEA 1LDDA 3C7JA 3F8NA 3SQNA 2C6YA 3M7GA 2RGVA 2O03A 2KIUA 4LGWA 5L3EA 3GO5A 2VBYA 1VTNC 2EA4A 2CFXA 4LLLA 4UHTA 4XLPF 1Y0UA 2FXAA 3BPXA 3IRRA 2BV6A 4OIPF 1XN7A 3GVAA 2DI3A 3WODF 4EGYA 2XKOA 2Z99A 2IP2A 4U0VA 5ERIA 1SD4A 2RKHA 3FWEA 4KDPA 2PQ8A 1IW7F 5E1ZB 4LFUA 3FMQA 1JHFA 3HSRA 1XMKA 4HLYA 3I53A 5DUKA 2PMUA 5DUIA 1XGSA 2M45A 5E8IA 1U5TC 2PBIA 4U7DA 3RKXA 4MTDA 1FLIA 2JSCA 2CO5A 3D0SA 3HSEA 4I98B 5TJJA 4KYWA 3F21A 1IUYA 4WX9A 3DV8A 2XROA 2RC4A 3KZYA 4YG2F 3GW2A 5BS6A 4MQVA 4KMFA 4LB6B 1WWXA 1V4RA 1BI1A 2BYVE 2CG4A 1GXQA 1FYMA 5ICFA 4HAMA 5DV5A 5JI6A 3GYHX 2V79A 1ZRCA 4JQFA 1XMAA 4IPAA 2PFBA 4ENKA 3HOSA 5LEJA 2VODA 2M87A 1RNLA 3F6OA 3M1EA 1ZRDA 1IXRC 3QPTA 1KA8A 5KVRA 3FXUA 2OA4A 2ETHA 1EH7A 4HF0A 5FD6A 3MCZA 5DYMA 2EFQA 1CF7B 4I2OA 4HYEA 3WTVC 1USTA 5ILSA 1UHWA 4A5MA 1S7AA 2W57A 1QNTA 1WI9A 3F8CA 3HOTA 2GXBA 5J8FA 1XSVA 3SZTA 4U7BA 4GO1A 5CJ9A 4HDUA 2HTJA 3SFZA 3P9IA 2CWEA 5AIPA 3JAMZ 1XGMA 2HQNA 2FBHA 3LAPA 3PQKA 2ZKZA 2H6CA 3I64A 5ILUA 4IJAA 4EJTA 4KN4X 4QWQA 4LLNA 4ZZLA 3DEUA 4RAZA 2HKXA 2XV4S 3QP5A 2MLKA 2O8XA 1Z6TA 5E8GA 3I58A 3O6BB 1T98A 1FSEA 1T6SA 1ZGAA 4IRIA 2GAUA 2BBYA 4G6QA 1C0WA 2OQGA 2PN6A 1YLFA 4UVBA 2EK5A 4DNCA 3P9KA 2VOOA 3IC7A 4K2EA 2HYGD 1W5SA 3L09A 2OD5A 3PFIA 1G3WA 4IRHA 3ECHA 3ZMTA 5ICGA 3QPHA 2Q0OA 3J81Z 1ULYA 2P6SA 3LWFA 5F64A 3T1BA 1J9IA 2IA1A 4G6DA 4Z2YA 1KU2A 3BP8A 1G3YA 4Y13A 2DW4A 3KLOA 3KETA 2P5LC 4UNOA 3QU6A 3QU3A 1YW8A 4PZJA 2OAZA 4XSXF 3QOPA 4BYYA 1TLHB 1RZ4A 2K7LA 1U5TA 2O6GE 1YQAA 2V1XA 4IRGA 1IF1A 5BOXA 1JGSA 1BIBA 1UFMA 2O3FA 1SFXA 1Z05A 3K2ZA 3K1NA 5ED4A 2MH9A 4HZFA 1B6AA 4ON0A 4ZH4F 2KJBA 4IXAA 2DBBA 2A61A 1PDNC 2XGXA 2RVCA 4IVNA 1ZGJA 2QUFA 4EMSA 4EM1A 2XRNA 2FRHA 2WV0A 3CO7C 5D5UB 4PGGA 4HX4A 1U6GA 4GXOA 3Q9SA 4LB5A 1K78A 2W25A 4NHJA 1T38A 5BPDA 5E18F 3U9GA 1I6XA 4Q47A 1MDMB 5FLXZ 1ZG5A 3CUQC 2EFOA 2QENA 2P5VA 2UXNA 2Y48A 1KU7A 4OOIA 2FNPA 1LJ9A 1CGPA 2ESHA 4EQQA 4EJWA 2BE5F 4G7ZF 4YFNF 3KEOA 2QQBA 5HDKA 4NQWA 1BIAA 4I02A 1ZH5A 1JHHA 2STTA 1P2FA 3LSTA 1ZARA 4KT5C 4CO8A 2NS0A 2XAJA 4ZYEA 1HW2A 1SFEA 2D1VA 1MD0A 1LVAA 5FFZA 5DCMB 2DAOA 3NRVA 4ZYGA 5IT9Z 2V1UA 4YIIA 2FA5A 3LQQA 1GXPA 1BI2A 2ELHA 2Y0MA 4RGXA 2YR2A 4HOBA 4YFXF 1XGNA 1O3RA 2ZNZA 1ZG3A 4U0WA 2UZKA 1V3FA 4ZYDA 4A0YA 3VB2A 1F1ZA 5A2QZ 2HFHA 1QGPA 1HW1A 3W6JB 3TDZC 3J81K 3RYRA 4I01A 3ZN0A 2VC1A 1FP1D 1Z9CA 4UVCA 1OYWA 2CGPA 1R23A 2BGCA 4ENNA 1GHCA 1W7PB 1MDMA 3BY6A 4R79A 4EM0B 2FBKA 3DPTA 2H94A 2PEXA 2JT1A 3R60A 2XAQA 1IRFA 3KZZA 5D5VB 3W6KB 1U8RA 3RJPA 2FMYA 4BHBA 5HLGA 5DCFA 2BEOA 1KQ0A 1HKSA 4YIFA 4A0ZA 3WU1B 2DTRA 2ZFWA 2XVCA 5K5OA 1KQ8A 5E17F 2KRFA 2EFNA 2VBXA 2HOEA 4KIGA 2G7UA 1ZAOA 2FEZA 3LQRA 2ZCWA 4I7HA 3WG9A 2ACJA 3ZP5A 1AOYA 3JW4A 5FLXK 5CYVA 4EM2A 5DD4A 5EEHA 3I59B 3E6DA 4Q48A 3DQVC 4P5OA 3DPLC 4HBLA 1WQ2A 3N97A 3REOA 1ODDA 4CHUA 1KU3A 1I1GA 1W7PA 2FSWA 5EEGA 2ADUA 3VODA 1BOAA 3CTAA 3ULQB 2JPCA 4B09A 3V7RA 4AWXB 2GIVA 5BQTA 3LA3A 3MFKA 4IHTA 1R1TA 2FMLA 4EVIA 5IT9K 1B9NA 3R0AA 3ZPLA 3VEPA 2VBWA 3K1MA 3IL2A 2O0YA 3U1DA 1R36A 2Q8KA 3FMRA 4I0BA 2JPBA 4TV7A 2B0LA 5AIQA 5BMZA 3FXQA 4WK8F 3ZQ7A 4LG0A 2MC3A 2XASA 5A2QK 2GXGA 4CICA 3E6BA 1ON2A 3RIRA 2AS5F 2E1NA 3K1PA 3T8TA 1BBYA 3N4MA 2F5CA 3KFWX 1S6LA 1B1BA 2QWWA 2YU3A 3BWGA 2CSOA 1USSA 3F23A 1LNWA 3J80Z 2LNBA 3DF8A 1TW3A 1R00A 1YIOA 3SXYA 2FNAA 4BNCA 4HF1A 1R1UA 1P92A 3V4GA 1OYIA 3MQ0A 4HV5A 4OMZA 1XDUA 4UUVA 3C18A 2G9WA 2IA0A 2QBYB 3G73A 4GYGA 1G6NA 1XSDA 1ZREA 1TQIA 1ZYRF 3EETA 1D3YA 4QLCU 1J2XA 3ABUA 3FHZA 3E97A 4A5NA 4L5JA 4H0EA 3ELKA 1G4DA 2JTVA 1YW9A 5JR3A 2VE8A 3ZMZA 2GWRA 2M30A 2EJRA 2Z33A 2KKOA 2K4BA 3K69A 5J8CA 1A04A 2M8EA 3H3UA 5J6XA 5BPIA 2KIFA 3HYIA 3WTXC 1EH6A 1TBXA 4BHPA 3TO6A 1XB4A 5LLQA 4S05A 4A0XA 1J75A 5D6FA 4LK1F 2JZYA 2WTEA 1IZ1A 4L18B 1L0OC 2STWA 5CVIA 3LFKA 1FP2A 3ZMSA 1U2WA 1OR7A 3IWZA 5FO5A 3RPUA 3FZVA 3ML6A 3LAJA 1QPMA 3KP2A 3BROA 1RUNA 1XDSA 2GA1A 4ENJA 2EWNA 3KP4A 1ZG1A 1B9MA 5TRDA 4FX4A 2G7HA 2HEOA 1IN8A 5D8KB 3D5LA 3RPQA 1KQ9A 2LKPA 1HBXG 1BN5A 2L4MA 5H6RA 4KFCA 2EB7A 3GWZA 3RYPA 3WTWC 3GFMA 1T2KA 2E1CA 1FX7A 1R58A 1W4MA 3WTTC 3O2PE 3TO7A 4NB5A 5E1WA 5DDGA 4RGUA 4U0YA 5F1RA 1CF7A 1D8JA 3J80K 3OV8A 3MEXA 2DK5A 3ZMUA 4WXDA 1ONVA 3S2WA 2MLGA 2WWYA 1Z6RA 2Q2EA 3B02A 2FQ3A 2OQRA 1IN7A 4A2UA 3FF5A 3JSOA 3E5UA 3TDUC 4HDVA 4L9VA 3TKYA 5K1YA 2FBIA 2L01A 1O3QA 1QO0D 3IWFA 3E5XA 2DLLA 4HW0A 1SMTA 1FNNA 2OZ6A 2OU2A 5ICEA 1ZHFA 5HS8A 1HSTA 3EDPA 2RN7A 3HSFA 4OIOF 4M6XA 5FB2A 2PLYA 3QP6A 1LQ1A 1HW5A 3DFGA 4PGHA 2LDUA 4G7HF 4M9ZA 2PJPA 3F22A 2F5FA 3WE3A 1T0FA 1MZBA 2P5KA 4O5VA 2LF7A 1KU9A 4AVPA 2A68F 4LK0F 4M72A 4GYIA 4M71A 2HTSA 2DO7A 4ESJA 1D5VA 1REPC 3RI4A 2QLZA 3LA2A 2NRAC 2D2WA 3ZN1A 5HOOA 2R3SA 2KJCA 2DPDA 1MKMA 1I1SA 3IHUA 2ZNYA 3K0LA 4WCGA 2YSRA 5D4SA 5FFXA 1WRJA 3GUDA 3V8JA 1FYKA 3GEZA 3CJNA 4FHTA 4EJOA 2A5YB 4L0YB 4S04A 3I0TA 4HV6A 5AONA 2NNYA 3HRMA 1S7OA 1IXSB 4HLXA 3KE2A 3FM5A 2IVMA 3FXRA 3L2CA 4CDGA 1KGSA 5ILVA 1YO5C 3BPVA 4MHGA 2FU4A 3E6MA 2L3DA 4ZZDA 5LRRA 1TQPA 2OBPA 2CYYA 4IF4A 5ICCA 2F2EA 2MBFA 4UV8A 4G94A 4HA8A 4WXHA 2H27A 3DXJF 3FM3A 3H3ZA 1FT9A 4F7ZA 1U78A 1FYLA 4XBFA 2IJLA 1TNSA 1UCRA 3P7NA 4P9FA 4O6JA 3WE2A 3I71A
chains in the Genus database with same CATH superfamily
2A6TA 2R7OA 4OAYA 4JYKA 1NK3P 5F08A 3CDLA 3CCRI 2P7VB 1DPRA 4CCNA 4CCKA 5DEQA 3QYFA 1B8IB 3QRFF 2VKEA 4CCJA 3WTUC 4ASNA 4MTEA 1LDKB 3WU0A 3BG3A 3I9V2 5M5YJ 1BJAA 3R4KA 5FKOA 1Q1HA 2KIMA 2QM3A 4EGZA 1A5JA 1QQIA 1LFUP 3S14J 1S8NA 1O3TA 1BC8C 5HDGA 3BOQA 2I8DA 1X1BA 2IT0A 3X2QH 1W7PD 5LHIA 1FBSA 3VPRA 3GZ6A 2YS9A 5HDNA 1SD6A 2F5DA 2HVSA 5LBQA 1PUEE 4ZYAA 5DCMA 3M9AA 3HRUA 5IYBJ 3KP5A 2H6BA 2YX7A 5D5WB 2QQAA 3BG6A 3TOBA 5EG0A 1K6OA 3T0YA 1D8KA 2CV2A 2MFZA 2K85A 3TO9A 3H5NA 4AIKA 4C2TA 1ETVA 3GTJJ 3GTMJ 4RB0A 2EFPA 4NUBA 3ZMDA 1OCCH 1PVEA 4FISA 1MJAA 1N77A 4HQMA 2M7BA 2E1MC 2J5PA 3LA7A 3A02A 2IBDA 2VJJA 4AD9A 5DM6F 5F0FA 4XMYA 2VJ4A 3SJMA 4YFKF 1ZQ3P 2GM4A 4G7OF 3AG1H 3BJ6A 4M9SA 2QGUA 5EGOB 1MMDA 2KLOA 4CYCB 1X1CA 2K4JA 4N0BA 3WGHA 5EDNA 4MEYF 4O3MA 1O7LA 1TWGJ 2LR8A 5E20A 1LDJA 5HLHA 1ETXA 1S29A 2DU9A 3Q0UA 1X3WB 5HS9A 2EIKH 1NHAA 4QPQA 4X6AJ 3KX2A 4RM3A 4CCMA 1OR7C 1SVOA 1LVKA 4KT6A 1HQCA 2I10A 4HQEA 1WJCA 2E7WA 1RIOH 3HHHA 3L9FA 1L3LA 5HNFA 1SD5A 3JRDA 1IC8A 1VQNI 1K83J 3CLOA 1VF9A 2OTJI 1XPXA 2XDVA 5F6FA 1XCBA 3LNQA 1SFUA 2DN0A 2ZJ2A 2EZHA 3OYCA 4BJTA 2JA5J 4DW6A 3T5XA 1O3SA 3KLNA 2W85A 3OYNA 1RI7A 4M9XA 3M3YJ 2DK8A 2KL4A 3PM1A 1Z67A 2GOMA 2KDZA 3HRTA 3WG7H 3Q5FA 3PNYA 4M6YA 3IH2A 1JJ8C 4M74A 4KISA 3H0DA 5LD2C 3GFIA 3HUGA 4CH7A 1JXSA 3KP6A 3TP3A 3ZCOA 4OINF 4Y33A 3IKTA 2P81A 3DWLE 4R1HA 5C44J 4PJLA 4PCQA 3T8RA 5IT3A 4ITVA 2UV1A 2IXSA 5DD8A 2VKDA 3JTGA 4E7LA 1XG1A 4YEJA 2L4AA 4BE1A 1ZN2A 2D45A 3JR9A 3V8KA 3WTZA 2M7AA 3V7CA 2GXAA 1BA5A 2AXLA 3OY9A 1A6IA 2VBZA 2X6OA 1F5TA 2FX0A 3OYHA 1FC3A 1DDNA 3R61A 5LGTA 3LSJA 3CMMA 1T39A 3BT9A 2LBFA 3ABTA 4WWCA 4IHSA 2HZTA 3KP3A 2TDXA 3H9JA 3IKVA 3K70D 1D0XA 4MEXF 2DT5A 3QAHA 2D5VA 4F93B 4XRSG 1DP7P 4JK1X 1E3HA 2CS3A 1ZK8A 2CQXA 1FBUA 1K7AA 1HXDA 2DA3A 1DPUA 3JRHA 3GZ5A 3L2VA 1O4XA 1WJBA 3LSGA 1XGOA 4HNVA 3WHBA 1IAWA 4FE7A 3HOXJ 2VXDA 1R1VA 5J1UA 4BH9A 4P9UA 3AAFA 3HKZN 3P9CA 1R4NB 1H9TA 3TGNA 3WTYC 2ELKA 2GZWA 2VXZA 1LEBA 5L3GA 3FIWA 1I3AA 6PAXA 1AWCA 2XIGA 1DUXC 2X85A 5EGOA 4CYCA 2ICWG 2F5VA 2HQRA 3PO3J 1E17A 1TWHJ 3C2HA 1YTYA 1SAXA 1R49A 5D6EA 2EV0A 2Y69H 1UG0A 3HTSB 4J01A 2HVRA 2K27A 1Z91A 2K9QA 3I59A 4A6EA 3J7YJ 3H5RA 3SHFA 3PJRA 5KHDA 1D1BA 1RETA 1QZYA 4IL6C 2JWTA 5CQEA 2DMNA 3BJAA 4MIMA 2K5CA 2OZUA 4MQ9F 1P4WA 2O61A 1Z7UA 1TWFJ 4RB2C 1X58A 3PUBA 3TQNA 3J7AO 3JSPA 3ABKH 3OYBA 3OYAA 2L02A 2CQ7A 4KNYA 3HOWJ 1GVJA 1MJ9A 2LG4A 4Y52J 4DZJA 5B1AH 3ERED 4GGGA 1P4XA 3M8FA 1BI3A 3K4JA 2HGCA 4XKBA 1QBJA 3ABMH 5CVRA 1SD7A 3BG7A 3E1SA 4ETSA 1IDZA 2WC2A 3DPUA 3V8LA 1IRXA 2JMWA 3DTEA 4D0PA 4HSRA 2EZIA 4PUSA 3FXMA 2RQPA 4RAYA 1FZPB 2VONA 2P8TA 3PUFA 4HX7A 4KA4A 4DJAA 4ESBA 2ESNA 2YPRA 4D1QA 1F43A 4XLCA 1LKXA 3WU2C 3FXKA 1ZLJA 4GDFA 5KAIC 3OOPA 4AC0A 2AHQA 4B43A 2WY7Q 3EQLF 2FOKA 2XAGA 2LD5A 1QU3A 4L9TA 2WAQA 4EJUA 3M8EA 2P7CB 3VYTB 2WB1N 2XUBA 1LPQA 2LKXA 4CXFA 1MMSA 2V4JC 3RDIA 3BZ6A 4I0AA 2K02A 1IO2A 2L54A 2VJIA 3HGYA 3MKWB 5CLSA 5FKKA 2A05A 3HHGA 4XLAA 3ZR8X 2V1NA 5K7ZA 4A12A 2E5NA 3MAJA 3FKIJ 3BJOA 1VQPI 4XQFA 1PP7U 3EUHC 4QSHA 4ENMA 4BKXA 1J59A 2E2HJ 2COMA 1G3TA 2VN2A 2UWMA 1OCRH 4XOTA 3MWMA 4OMYA 3E3VA 4C3JJ 3HTUA 4I09A 3OYIA 1B59A 2V9VA 4CYDA 1X1PA 3WGIA 1FIPA 2F4IA 4HEA2 1Y8RB 1YS6A 2XGEA 3CQZJ 3LL7A 5CKTA 3WTSC 3GXOA 1RR7A 4W97A 4ESFA 4RBOA 1U5TB 3I54A 2QQ9A 2GQQA 2QYOA 4GCVA 4BBRJ 4UUSB 2BW3B 2E60A 2PI0A 4BY1J 1WJAA 1EJ9A 2JRTA 4Q4ZF 2P4WA 4P55A 3OWTA 5J1RA 1IRGA 3CUOA 2ME6A 2CMPA 4KIFA 4MNUA 4JX4A 1EV7A 1J0RA 4A3JJ 2R7ZJ 3C2GA 2QVOA 2Y2ZA 2O5RA 3L7WA 2MD5A 2K86A 1W1WE 3A03A 3HM5A 4LJZF 2AQEA 5JFRA 1UZCA 4EV0A 1Y39A 3H9QA 1RPWA 1P7IA 4AIJA 1FBQA 4UV9A 4L0ZB 2FUG2 3HIFA 1KYWA 1MH3A 3F8FA 2QBYA 3PQJA 4G9YA 1R7JA 2E2IJ 2B63J 3A0BC 2MH2A 2HR3A 1K79A 2HNHA 3KYDB 2EV5A 2MG4A 2NYXA 3OIOA 2DPUA 5FJ8J 4CZZA 4B3AA 4EEFG 2QZ8A 1QHHD 3PL8A 2VT2A 1K78B 3SEQA 3L2WA 1WHUA 4LG3A 2XKPA 2ZJPF 4Y7NJ 2QQ8A 5J47A 3OSFA 1XSXA 1I3QJ 2EV6A 1H9GA 5GAEJ 1IJWC 3JRCA 1SEUA 1PP8F 2R5YB 1YW7A 2KZGA 2DOEA 3KP7A 4BAYA 2HPMA 5IYDJ 1ZTRA 4AIHA 2DT6A 3CO6C 1WFXA 2DQRA 1YG2A 1U3EM 3GX4X 3M8JA 1SFOJ 3HDDA 1O7FA 1FY7A 4ZTFA 3EYIA 2MA3A 2DT7B 4WXCA 4NDLA 5D8LB 1BI0A 4IX7A 2X1DA 1P6RA 3EUKL 1S9HA 5E3OA 3W3CA 5F04A 4RAGA 5FKLA 2LP0A 2V26A 2E7XA 4KICA 4RB1A 4NNJA 3ZXSA 4I76A 2XGDA 1Y56A 3HRSA 3ISPA 2ZXJA 1IN6A 1V5EA 4XN3A 5JHUA 2DA1A 2ZO4A 2YX4A 2GBYA 3FMSA 1ZLKA 3MKYB 4XNFA 2DQLA 4XLNF 4CGZA 3S2DJ 2VASA 3ZRGA 2Z3YA 2A3SA 3CMAI 2HU9A 1B4AA 1YJWI 4L9JA 1FOWA 2RDPA 1HKQA 3DP7A 1I5ZA 1OKRA 3QPSA 2HKOA 4FX0A 2QSHX 3COAC 1J5YA 3EYYA 5CVJA 2K40A 4A6DA 5GTIC 5JLXA 4IHXA 2DCEA 4RGRA 2DFIA 5GADJ 5LHGA 4C2UA 1JE8A 1LB2A 3MZYA 2E1OA 5GP9A 1UB9A 3RKYA 2FOWA 3GFLA 3PSIA 4P96A 2QEXI 1JKQC 2X9DA 3FK6A 4OU0A 1FPQA 1QZZA 2W82A 3F8BA 1ERDA 4B8XA 4MO7A 2D1HA 2XF7A 3RKWA 4KIBA 2EINH 2IS2A 2YUSA 2M9HA 4AM3A 3H36A 5HVQC 1WGXA 4U88A 3QWLA 2JA8J 2EFWA 4BL0B 2VC0A 3U2RA 2VE9A 4RDUA 1LFBA 2V1DA 2IPQX 4RM2A 4LIUA 2BVMA 4Q5SF 4M73A 4HSTA 4ZYHA 2RV8A 3S3MA 5HLIA 1RKTA 4D5CA 4UY8I 1FOXA 3G4SI 1WSUA 1OPCA 4PDKA 3CMYA 3BTLA 5FGMA 2R5YA 4DZPA 3G6EI 1MGTA 1WVRA 4N4OB 5FKNA 1APLC 4OIRF 3K4BA 3BDDA 4LD5A 5K5QA 3PIPF 1FOKA 1R22A 1MIJA 2XB5A 4A3DJ 1GV2A 3LMMA 5LGUA 1TNTA 4A3GJ 1TQMA 2XHKA 2GA2A 3EUHA 5L3FA 4G6TB 1HKTA 3I5UA 3OS1A 1OYYA 4F52A 2E35A 4QPOA 2R93J 1UG2A 5DS9A 4XKVA 3QOEA 3Q9VA 5FD5A 4FT8A 2IS1A 1Z1DA 2R7RA 3LSKA 3TOAA 2Y31A 3FX3A 2A6EF 1Z3XA 2ZMEC 3B73A 3RTRA 3DLAA 4N9HA 4OIQF 1KYZA 5E3NA 1TTYA 1XTAA 1MBKA 1PUFA 4G8XA 3JAMK 3MZHA 4DGWB 1NG6A 2ZXIA 3ROUA 1UHMA 1YS7A 2CW7A 3FK7A 3E6CC 2LLKA 3OSGA 1RKWA 2W4SA 3I56I 2BY1A 5EZHA 2A6HF 1SMYF 2F5EA 3BR1A 4Z6YA 1N75A 1BM9A 1FWZA 5KK1A 4RLFA 4N9IA 2NNNA 2UXXA 3F6VA 3HEFA 1W5TA 4HX8A 3S17J 4YELA 3OR1C 4E7HA 1TP4A 1H0MA 1N25A 2GIZA 2WV1A 4B4CA 2MYSA 1LEAA 1S7EA 1X1AA 4E70A 1VI0A 1JGGA 1QA6A 1U8BA 1HDPA 3HG9A 5L3CA 3BLYA 2IA2A 2HS5A 3R6SA 5F1JA 1MNDA 4M3DA 3H1CA 3NEUA 2KZVA 5L3BA 1I27A 2NOJB 3JTHA 5C3EJ 3FXOA 5D4RA 1IRZA 4DOZA 1W0TA 2RNJA 1ON1A 1O57A 3WGGA 1R5GA 2HWVA 2A5WA 5HS7A 3L1PA 2PG4A 1YYVA 1R5HA 1GLNA 4UB8C 1XS9A 3CDIA 3F72A 1UELB 4KN7X 2JSPA 1T8IA 3NQOA 2KDOA 4MGRA 2A69F 1GUUA 4BXUA 1HSJA 1J7KA 1WKMA 2CQKA 3AL0C 2K9LA 4WF2A 3R0JA 2WY8Q 2DODA 3ECOA 1WJ5A 4M3EA 5CVVA 3CUQB 4D7NA 4DQ2A 4AIDA 3QYEA 1XCVA 3G3ZA 5JHFA 3GFJA 2V9KA 1V55H 2HXIA 2RREA 2XC7A 3CC7I 3CLQA 2LFBA 2CUJA 3D5RC 3RSNA 1ZRFA 1F4KA 3W6VA 2IRFG 2DA7A 4DIQA 5JVTA 1UJ8A 2EA2A 3F8MA 3FISA 1A6QA 2ISYA 2OF7A 3KIOA 3TL4X 2F48A 5DM7F 3C3WA 5K5RA 1VQ8I 5C4XJ 1AKHA 3H35A 1XD7A 3NARA 2HYFA 4KMUX 2ZMEB 5LGNA 1RR8C 4Y17A 4JOMA 4HF2A 2X4HA 3F3XA 1STZA 4L5IA 3TW6A 3OYJA 4N4NB 2W84A 1F36A 2Z9OA 4JBAA 5L3DA 4P1WA 5CVUA 3LSRA 3BR3A 1HLVA 1VQ4I 3K9TA 2M1BA 3IRQA 1OMIA 2LSOA 1OLTA 1X3UA 3BR6A 2R7FA 4BHCA 4L9NA 4ZC3A 2CV0A 2HDCA 1P4AA 2Z5UA 1MH4A 2CUEA 3SZPA 4RS8A 4XIDA 1IN4A 3CDHA 5B1BH 3Q3SA 1G3SA 5FROA 2QCOA 4R8HA 4LMYA 5E1XA 1G8XA 1MJBA 3PNTA 4G12A 2NS8A 2W24A 2BXZA 4RB3C 1X1DA 4UVAA 2HXOA 2XAFA 2AQFA 1IN5A 1WJEA 3GF2A 2JQ7A 1YI2I 4LG0B 2J5OA 3E7LA 4KUMA 3E5QA 2X0LA 4BJ6C 4Y15A 2BY0A 3ZMVA 1RESA 2H09A 1IV8A 1VQ6I 2FE3A 2P6TA 1X2MA 1IDYA 2V6CA 2VPLA 2KQRA 2A07F 2VOPA 1FSHA 3H92A 2ISZA 1S3JA 1TW2A 2CW0F 2P0WA 4BQAA 2L7ZA 2PMHA 2WAQN 2LF8A 2VT3A 3UKGA 1VFCA 3CCUI 2M4GA 3AL0B 4I99C 2LC2A 3ZOBA 5M3MJ 5LFAA 2L2OA 3L00A 1E0EA 1E2XA 2LYCA 1MBFA 3DKWA 3K7AJ 1IUFA 1EH8A 3V7SA 3VFZA 2RAEA 2R92J 4U87A 2CQQA 2M5WA 4BQQA 4NC6A 2LREA 4EJVA 2FF4A 1YFHA 2EZLA 3H9GA 1TT5B 3BCAA 5LHHA 1H8AC 2DMQA 1ETQA 4YIRX 2LRDA 3S8PA 2DA6A 2NS7A 4XRFA 3O3KA 1NK2P 2GLOA 4BXFA 3MKLA 1BC7C 5D5XB 2Y75A 2ZBKA 5LEKA 3CUQA 1T08B 3GLXA 3ABLH 3KCCA 3KEQA 5H20A 4LLGF 1BR1A 3VOEA 3C1DA 1RUOA 1F9NA 4XSZF 2XF5A 4AVZA 3ZQFA 1I50J 1WI3A 2IW5A 2R7DA 2AXTC 4UXNA 2W1OA 4RGSA 5H6QA 2XAHA 3ASOH 4XM3A 2NAZA 1B8IA 2VPRA 5LRSA 2VJ5A 1IXCA 3I4PA 4XLEA 3CCLI 3CF5F 2ZMEA 4HNUA 3CCQI 4Y3OA 1LDDA 3C7JA 2CFOA 3F8NA 1V5FA 3KPHA 3SQNA 5JLWA 2C6YA 3M7GA 2RGVA 4RAFA 4ZTJA 2O03A 2KIUA 4A3CJ 4LGWA 5L3EA 2H8WA 3GO5A 2VBYA 1VTNC 5FRNA 2EA4A 4PK4A 1DP3A 2ECCA 2CFXA 2M0CA 4LLLA 4UHTA 3EUAA 4XLPF 3W2WA 1Y0UA 2FXAA 3BPXA 1XC5A 2BV6A 3IRRA 2WADA 4OIPF 2IAIA 1XN7A 1EF4A 3ASNH 4PFOA 2PJRB 3OIPA 4XN0A 3GVAA 5GAHJ 4C2MJ 1AA7A 2DI3A 3P5JA 3WODF 4EGYA 4ZJZA 2XKOA 2Z99A 3CESA 4E4HA 2KT0A 3DEEA 5IP6A 1VQKI 2IP2A 2CJJA 4U0VA 1M1EB 5ERIA 1SD4A 2B7EA 3BG9A 2RKHA 3FWEA 3I3LA 4KDPA 2PQ8A 2OCEA 1IW7F 1EA3A 5E1ZB 2H1KA 4LFUA 3FMQA 1D1AA 1JHFA 3HSRA 4XRMA 1X2NA 1XMKA 1D1CA 4HLYA 4XRSA 2DYRH 3I53A 5DUKA 3RQIA 2XPUA 2PMUA 3HB9A 4BY7J 3RCOA 2L9VA 1E3OC 5DUIA 5FLMJ 1XGSA 2M45A 2MW8A 5E8IA 1U5TC 3PSFA 2QSGX 2PBIA 2DA2A 2LKSA 4U7DA 3RKXA 4MTDA 1FLIA 1TZLA 4BQOA 1UAAA 3FXJA 2JSCA 5CPRB 2CO5A 3D0SA 3HSEA 1Z0XA 4I98B 5TJJA 4KYWA 2DDAA 4XORA 2M2EA 3F9KA 2W00A 3F21A 1IUYA 1Z21A 4WX9A 1MMAA 3CCYA 5J4YA 3S1RJ 2TCTA 3DV8A 4BE0A 1UHSA 2XROA 2ZFUA 2RC4A 3KZYA 3OYFA 4YG2F 3GW2A 3QODA 5BS6A 4MQVA 2JN6A 4A3FJ 1YHQI 4KMFA 4LB6B 1HDDC 3G1MA 1WWXA 1V4RA 1D5YA 1BI1A 3G71I 1FJLA 2BYVE 2CG4A 5IOYA 1GXQA 1FYMA 3GBGA 5ICFA 1X4PA 4HAMA 5DV5A 5JI6A 3GYHX 1W36C 2V79A 1JUSA 2WA0A 4B47A 1WJDA 1ZRCA 4JQFA 1XMAA 3M07A 4IPAA 2PFBA 4ENKA 1I6HJ 3HOSA 3BTJA 4W1UA 5DTDA 5LEJA 2VODA 2M87A 1RNLA 5HNHA 2L7FP 3CP8A 2K9SA 2O9LA 3BZCA 3F6OA 3A2KA 2DJIA 1R6RA 1IXRC 3M1EA 2M34A 3QPTA 1ZRDA 1KA8A 5KVRA 3D1NI 3FXUA 2ZSHB 2EPFA 2OA4A 2ETHA 1EH7A 4HF0A 2IS6A 4AYBA 5FD6A 3BZKA 3MCZA 2E34A 2DXIA 1POGA 2WAFA 5DYMA 2LY2A 2EFQA 1CF7B 1V5GA 4I2OA 2QKMB 1ETWA 4HYEA 3WTVC 3OYEA 3S15J 1MSEC 1USTA 1VQ9I 3LSIA 2JUCA 5ILSA 1VQOI 2PJRA 2LOOA 3IAM2 1UHWA 2K9MA 2XSJC 1SANA 4PSXA 4A5MA 1S7AA 3CCVI 2W57A 2NVYJ 2HVQA 1QNTA 1Y1WJ 1D0ZA 1WI9A 3IUOA 3NWTA 4MFDA 2O8KA 3O8HA 3F8CA 5J3LA 3HOTA 2Q2EB 3NAUA 2DMTA 2R7SA 4DYCA 2GXBA 1S5LC 3I55I 1R71A 3ZQIA 1JTYA 3A1YA 5J8FA 1XSVA 3RQ4A 3SZTA 2HOTA 2QA4I 1ETKA 1ZGWA 4U7BA 4B1RA 4GO1A 5CJ9A 2HYJA 4HDUA 2L7MP 2H8RA 2HTJA 3SFZA 2R7TA 3HJEA 3P9IA 5C4JJ 5B5EC 2CWEA 5AIPA 4BEHB 3JAMZ 1XGMA 3CCMI 4B3XA 5F0HA 2HQNA 1Q1VA 2FBHA 2KP6A 3PQKA 3LAPA 2IS4A 1JT6A 2OV7A 2H6CA 2ZKZA 2CW8A 1A36A 3I64A 5ILUA 4IJAA 5EEAA 4EJTA 4KN4X 3KEYA 4QWQA 4LLNA 4ZZLA 3DEUA 3PO2J 3RZDJ 5IY5H 4RAZA 2HKXA 2XGCA 2XV4S 3QP5A 2MLKA 2O8XA 3QPLA 4PJNA 2IGOA 4C9YA 1Z6TA 3S1QJ 2Y30A 5E8GA 3HOYJ 3OYDA 3I58A 3O6BB 1T98A 3G1LA 1FSEA 1T6SA 1ZGAA 4JP0A 4PFPA 4IRIA 9ANTA 3E0JB 2ELJA 3BR0A 2GAUA 1DQUA 2BBYA 4G6QA 1C0WA 2OQGA 2PN6A 1YLFA 4UVBA 3VWBA 2EK5A 4DNCA 5K7FA 3P9KA 1PJRA 3SZGA 4A3IJ 3ZGKA 2VOOA 3IC7A 3HC7A 4K2EA 2HYGD 4NC7A 1WZ2A 1W5SA 3L09A 2K3FA 2OD5A 1G3WA 3PFIA 4IRHA 1ETOA 3ECHA 3IH3A 3ZMTA 5ICGA 3A01B 3SYTA 2Z16A 4BDYA 3QPHA 2Q0OA 2JK3A 4B44A 3J81Z 1FOYA 1YX3A 3HOUJ 1ULYA 4XKCA 1OCZH 2P6SA 3LWFA 3FBNB 5F64A 1SVMA 3T1BA 1JT0A 1LFPA 1J9IA 2IA1A 3DTIA 4G6DA 5F0CA 4Z2YA 5E3LA 2VLAA 1G59A 1KU2A 3BP8A 2DDBA 1W36D 4OWRB 1G3YA 4IO9F 4Y13A 2DW4A 2R7VA 3KLOA 2UUZA 4NQWB 3KETA 4CA0A 2OPTA 5GAGJ 2P5LC 3K10A 4IOCF 4UNOA 3AG3H 2PMZN 4M3GA 3QU6A 2XPWA 3HXLA 2XSDC 3H0GJ 3QU3A 1YW8A 4PZJA 2OAZA 4XSXF 4RA2A 2COBA 3QQAA 2M0MA 3QOPA 4X0GA 4IZZA 4IKFA 4BYYA 1TLHB 4A3BJ 4PJ0C 2NVTJ 2E71A 1RZ4A 5IOZA 2K7LA 1U5TA 4E6KG 2O6GE 2V7FA 5KAFC 1YQAA 3OYMA 4FCYA 2DFEA 2V1XA 4IRGA 4E7IA 2ID6A 4UUSA 4IEJA 2BW3A 1IF1A 5BOXA 2V6EA 1BW5A 1JGSA 2NVXJ 1BIBA 1UFMA 2O3FA 5EZGA 1SFXA 4OAZA 1Z05A 2R4GA 3G1OA 3HOVJ 2L7KA 3K2ZA 3K4CA 2JVHA 3K1NA 5ED4A 2MH9A 4HZFA 4XLHA 1B6AA 2R7WA 3CP2A 4ON0A 4ABZA 4DYRA 2XRLA 2NXNB 4ZH4F 2TRTA 2KJBA 1BJZA 4IXAA 2DBBA 4V2GA 3S1MJ 2A61A 2NVQJ 1PDNC 2XGXA 2RVCA 1Y1VJ 4IVNA 3BR5A 3K4NA 1ZGJA 2QUFA 4EMSA 4EM1A 2VQHA 5E79C 2XRNA 2FRHA 2JA6J 2WV0A 1ZKGA 3A4CA 3CO7C 3HGGA 2DOFA 4PSWA 4C3HJ 2JUGA 5D5UB 4PGGA 4HX4A 1LUJB 3MMYB 1U6GA 2ZC2A 4GXOA 4D5FA 3BC8A 3JRBA 2JA7J 3Q9SA 3SDGA 4LB5A 1K78A 2W25A 1JKPC 4NHJA 4IQJA 1T38A 1DU0A 5BPDA 3LSPA 4NBQA 2L0KA 5E18F 3U9GA 1I6XA 4Q47A 4GFBA 1QVTA 1MDMB 5FLXZ 1ZG5A 5HODA 4CSWA 3DU6A 3A01A 3CUQC 2EFOA 2QENA 3OYLA 2CUZA 2F6CA 2P5VA 2UXNA 2Y48A 1KU7A 3BTCA 4OOIA 3BCBA 3VYUB 2FNPA 1LJ9A 1CGPA 2VUMJ 2L9SA 2ESHA 4EQQA 4S0HB 4EJWA 2DTZA 2BE5F 4G7ZF 2ECBA 4FE4A 4YFNF 1P7JA 2Y9ZA 3KEOA 2QQBA 3RKQA 2CRGA 5HDKA 4NQWA 1BIAA 3SFIA 2BHZA 4I02A 1ZH5A 1JHHA 2STTA 2KPMA 2JRMA 2ZXHA 1P2FA 3LSTA 1ZARA 4KT5C 4CO8A 4FQGA 2NS0A 2XAJA 4ZYEA 1HW2A 2KFDA 1SFEA 2D1VA 1G2HA 1MD0A 2DFHA 2IGNA 1LVAA 3C2BA 2KIQA 5GTHC 5FFZA 3EPZA 5GPAA 3OIQA 2DAOA 5DCMB 3NRVA 2L9NA 4ZYGA 2R0QC 5IT9Z 2V1UA 2HDWA 4YIIA 3VYSB 3OYKA 1IGNA 2FA5A 1K4TA 3LQQA 1GXPA 1BI2A 1GVDA 2ELHA 2WAEA 2Y0MA 3K4KA 4RGXA 2EQRA 2YR2A 4HOBA 4YFXF 1XGNA 2F4OB 1O3RA 2ZNZA 1ZG3A 4U0WA 2UZKA 1J09A 1BL0A 1V3FA 3SEZA 4ZYDA 4II3A 4A0YA 1VQMI 2X6WA 3VB2A 1IV6A 3CF2A 3CC2I 1OCTC 5CQGA 4H4KC 4HRIA 1F1ZA 2PMZA 5A2QZ 3CJQB 1DGWY 2HFHA 1QGPA 1HW1A 1A35A 2ZXWH 3W6JB 3TDZC 3PNVA 3J81K 4HPQA 1PYVA 3RYRA 2ZJRF 4I01A 3ZN0A 4AUXA 2HPIA 3I4NJ 2VC1A 2W48A 1QHGA 2VI6A 1FP1D 2X1EA 3A0HC 4MFEA 1SFKA 2CU7A 3CCEI 1Z9CA 3M1CA 4UVCA 3GTKJ 1OYWA 2CGPA 1MBEA 3DLLF 1ACIA 1R23A 2OCCH 2BGCA 3J7AY 4ENNA 1GHCA 1TL8A 1W7PB 2BXYA 1MDMA 4CUGA 3BY6A 2HI3A 4R79A 2ZB9A 4EM0B 2FBKA 3DPTA 4CCLA 1ETYA 3JRFA 1ITYA 2H94A 2PEXA 2JT1A 3K2AA 3R60A 4UB6C 3HL2A 1AHDP 4ANJA 1ZELA 5FRMA 1BW6A 2XAQA 1IRFA 3IAS2 3VDXA 3JRGA 2DMPA 4HG2A 3K70C 1JUMA 3GMEA 3KZZA 5D5VB 3W6KB 1U8RA 3RJPA 2FMYA 4BHBA 3MN2A 5HLGA 2LY9A 3D5SC 1K6YA 5DCFA 1Y6IA 4QIWN 2BEOA 1KQ0A 1HKSA 1QVUA 1WCMJ 3MKZA 4YIFA 4A0ZA 3WU1B 2DTRA 4X1EA 1YIJI 2ZFWA 2XVCA 5K5OA 1KQ8A 1OJLA 2WBMA 2LBFB 5E17F 3GTQJ 2DMUA 5J1YA 2KRFA 4XL9A 2EFNA 3FBIB 2VBXA 3GTGJ 2HOEA 4KIGA 3FHNA 3AG2H 2G7UA 5KCMA 2EZKA 1ZAOA 1BR4A 2E2JJ 2OTLI 1HC8A 1NG7A 2LTPA 2CV1A 4MLOA 3VYRB 2OUMA 2FEZA 3LQRA 2Z2SB 2LH9A 2ZCWA 1MMGA 2M4KA 4I7HA 4LOCA 4A3EJ 3WG9A 2ACJA 3ZP5A 1SVLA 4ZDOA 1AOYA 1EKEA 3ZQGA 4XLFA 2MD0A 3JW4A 3UR3C 5FLXK 1DGRM 5CYVA 4EM2A 1GT0C 2ME0A 5DD4A 4AYBN 5EEHA 2HOAA 5M3FJ 3O8GA 3I59B 1VNDA 1MW7A 3E6DA 1K61A 4Q48A 1P9QC 3DQVC 4C30A 4F92B 1S72I 4P5OA 1RC9A 1W0UA 5M5XJ 4BE2A 3CCSI 2RNGA 3DU5A 3DPLC 4BXXJ 4HBLA 1WQ2A 4IOAF 1W5CC 2FD5A 3N97A 2Y0SN 1H89C 4XK4A 3KYCB 1U0JA 3REOA 1ODDA 4CHUA 1KU3A 1I1GA 2ID3A 1W7PA 1KONA 2VQLA 2FSWA 5EEGA 4JX5A 2ADUA 3VODA 2KHMA 1BOAA 3CTAA 3ULQB 2JPCA 3DKXA 4B09A 3V7RA 4AWXB 3J7ZI 1TC3C 2GIVA 3AFHA 5BQTA 4E7KA 2N8GA 3LA3A 3U21A 3ZQQA 3MFKA 4IHTA 3CJRB 1R1TA 3MVPA 2FMLA 2EIJH 4EVIA 3FDYA 3CC4I 4J19A 1NTCA 5IT9K 3CMEI 2HQ5A 5F27A 4IHVA 2I5UA 2RQQA 1B9NA 3R0AA 5K7HA 3ZPLA 3VEPA 2VBWA 2BHYA 2L9RA 2BY3A 3K1MA 2JJ7A 3IL2A 1Y8QB 1JUPA 2O0YA 4FETA 3U1DA 4A3KJ 1R4MB 1FMVA 1R36A 3S93A 2W7NA 1YJNI 2CUFA 2BZTA 2Q8KA 1K4SA 3FMRA 1T95A 4I0BA 2DYSH 2JPBA 4M3BA 1X3ZB 3OL4A 4TV7A 2B0LA 5AIQA 5BMZA 3FXQA 5B66C 4WK8F 2M3AA 3ZQ7A 4LG0A 2MC3A 2XASA 3NWSA 5A2QK 2E1MB 2GXGA 3U1KA 4CICA 3E6BA 1ON2A 3RIRA 5IYCJ 4GRIA 1HCRA 2AS5F 2E1NA 4YRVA 3K1PA 1Z7LA 3T8TA 1BBYA 3N4MA 2Z1DA 2F5CA 3KFWX 4A3LJ 1S6LA 1B1BA 2QWWA 4ZDLA 2YU3A 4BDZA 1GDTA 5JVGF 2VQGA 2NOGA 4XONA 1MNEA 3BWGA 3DBLB 2CSOA 1USSA 5IP9J 3F23A 1LNWA 4M6VA 3J80Z 2R7UA 2LNBA 2MSYA 3OS2A 3HBLA 3DF8A 1MBGA 4XICA 4PJJA 1TW3A 1R00A 4AU7A 1YIOA 4BS9A 3SXYA 2FNAA 1QZEA 1OCOH 2DA4A 2E36A 3HPHA 5KNLA 4BNCA 4HF1A 1R1UA 1P92A 3W2VA 2X6YA 2HDDA 2VKHA 2OJED 3K4MA 1FMWA 3MD2A 1QPIA 3V4GA 5EJCA 1OYIA 3MQ0A 4HV5A 4OMZA 1XDUA 2BVLA 4UUVA 5BNGA 1YITI 1FEXA 3C18A 1AU7A 2E5ZA 3S3NA 2G9WA 3K6GA 2IA0A 2QBYB 3G73A 4RLQA 4GYGA 1G6NA 1XSDA 1ZREA 1TQIA 1ZYRF 3LOCA 3EETA 1D3YA 2R7XA 4QLCU 1J2XA 3N05A 3ABUA 1FTZA 2V9PA 4BGDA 3FHZA 3E97A 1MMNA 3PFYA 4A5NA 1T0FC 4L5JA 1JKRC 4H0EA 2BOLA 3BQZA 1T33A 3GCMA 4CZCA 5FKMA 3ELKA 2IEKA 3ZQHA 3RPUD 1G4DA 2JTVA 4XR6A 1YW9A 5JR3A 2VE8A 2LK2A 3ZMZA 2GWRA 1BR2A 2M30A 1V54H 2EJRA 3OS0A 4EATA 3TP0A 1R9TJ 2Z33A 1Z3YA 1XX5A 2KKOA 3ERMA 1WJFA 2K4BA 2EILH 3K69A 5J8CA 1A04A 2G0EA 2M8EA 3H3UA 5J6XA 2Y0SA 2HZDA 5BPIA 2KIFA 3HYIA 3KZIC 3WTXC 3GTOJ 4BQNA 1EH6A 1TBXA 2DA5A 4E7SA 3SDBA 4BHPA 2FQ4A 2XPVA 5H2FC 4QTRA 3TO6A 2KRHA 3TW7A 2VIXA 1OQYA 1XB4A 5LLQA 4S05A 1LE8B 3JREA 4A0XA 3S32A 1J75A 5D6FA 4LK1F 2JZYA 2WTEA 3LFUA 2HQAA 3Q0WA 1IZ1A 4L18B 3FKJA 5EF6A 1ORKA 1L0OC 5GPCA 4HNTA 2STWA 3B6AA 5CVIA 1OFCX 3LFKA 1FP2A 3ZMSA 1U2WA 1OR7A 3TMOA 5J4VA 3IWZA 5FO5A 3RPUA 3FZVA 4E7ZA 3ML6A 3LAJA 2YU9J 4V2FA 1QPMA 3KP2A 3BROA 1RUNA 1XDSA 3S16J 1XMXA 2EIMH 2GA1A 3ZQCA 4ENJA 4JX6A 3ONQA 2EWNA 2MGQA 3KP4A 1ZG1A 1H88C 1VZ0A 1B9MA 5TRDA 1BOBA 4IHYA 1YRNB 2MC4A 3HZJA 4FX4A 2G7HA 2HEOA 4BACA 2DOAA 1YOVB 1U9OA 1X4OA 1IN8A 5D8KB 1MBHA 2B9SA 3RZOJ 1D0YA 3D5LA 3RPQA 4BUPA 1A31A 3BR2A 1KQ9A 4V19K 1FTTA 3OR2C 4PJMA 2LKPA 1HBXG 3HKZA 1BN5A 2L4MA 5TGTA 3UNGC 5H6RA 4KFCA 2EB7A 1IG7A 3GWZA 1YJ9I 3RYPA 2JA2A 3WTWC 3GFMA 3TBIA 1T2KA 1SC7A 2E1CA 1WPKA 1FX7A 1R58A 3OOUA 1W4MA 2XF6A 3IH4A 3WTTC 1TWCJ 3O2PE 3TO7A 4NB5A 4II2A 5E1WA 3VSKA 4XOPA 1VQ5I 5DDGA 1X19A 4RGUA 4U0YA 2KISA 5F1RA 1CF7A 1JKOC 1D8JA 5J40A 4LIVA 1HOMA 3J80K 1T56A 2VQCA 4I6ZA 3OV8A 1RRJA 3MEXA 3BQYA 2DK5A 3ZMUA 3GLLA 4WXDA 1ONVA 3S2WA 2MLGA 2WWYA 3GTPJ 1Z6RA 2Q2EA 3B02A 2FQ3A 5EYRA 2OQRA 1IN7A 5TISC 4A2UA 3I4MJ 1JTXA 3DTKA 3MZ8A 1FIAA 3FF5A 3JSOA 1B72B 4M3FA 3E5UA 3TDUC 3DEWA 4HDVA 2JVGA 4D7MA 1PUFB 4L9VA 3HOZJ 2Q1ZB 3LSMA 2XAUA 2KRCA 3M4OJ 1QRYA 3TKYA 5IP7J 1NH3A 5K1YA 1LE8A 2FBIA 3OL3A 4NC8A 2L01A 2H1LA 2QKLB 3JRAA 2DJNA 2LMDA 1O3QA 1QO0D 3IWFA 4BEHA 3E5XA 2DLLA 4HW0A 1SMTA 1FNNA 1I39A 3TEDA 4BU2A 2X48A 4IQ4A 2OZ6A 2OU2A 2L5QA 3DKYA 3F0CA 5ICEA 1MSFC 1ZHFA 5HS8A 4XKWA 3G2BA 1HSTA 3EDPA 2R7QA 2DFFA 2X6XA 5HLTA 2RN7A 3HSFA 3ZQLA 4OIOF 1N78A 4DYQA 4L5EA 4E7JA 2WB1A 3HPGA 4M6XA 4F55A 5FB2A 2R5ZB 2VL8A 2PLYA 4UUTA 1ENHA 3QP6A 1LQ1A 1HW5A 3DFGA 4DBRA 4PGHA 2LDUA 4G7HF 3OYGA 4M9ZA 2PJPA 2K9NA 3DCFA 2MABA 3F22A 2F5FA 3K4LA 3WE3A 4BJ5C 1T0FA 4F3QA 2X1CA 4CCOA 3AKZA 3IP4B 1MZBA 4C3IJ 2P5KA 4O5VA 2LF7A 3V42A 1YRNA 1KU9A 2CH0A 5IPAA 4AVPA 2A68F 4LK0F 4M72A 2CQNA 2QF7A 4GYIA 4FTHA 4M71A 2HTSA 2DO7A 4ESJA 1D5VA 4IHWA 1REPC 3RI4A 2QLZA 3LA2A 2NRAC 1E3PA 2D2WA 3ZN1A 5HOOA 1VQ7I 2R3SA 2KJCA 1DU6A 1MBJA 2O7OA 2DPDA 1MKMA 1JJ6C 1I1SA 1JI8A 3KYLA 3FXLA 3JCUC 4B48A 3H3VK 3IHUA 3DBHB 2ZNYA 3K0LA 4WCGA 2YSRA 2KMUA 5D4SA 4F91B 1AKHB 3H5AA 5FFXA 3ESWB 1WRJA 1ZR4A 2VKVA 3IV5A 2FJ1A 3AG4H 4LITA 5M5WJ 3GUDA 4A93J 2K3PA 3S1NJ 4ZDPA 3V8JA 1FYKA 2QSFX 3VSLA 3GEZA 3CJNA 4FHTA 3CJTB 4EJOA 1CQTA 2A5YB 4L0YB 4S04A 3I0TA 4HV6A 5AONA 3B6CA 4RMNA 2IGKA 3W2AA 2F4MB 2NNYA 2E19A 3HRMA 1B72A 1S7OA 1IXSB 1HA8A 3Q0VA 3QYBA 4FASD 2M8GX 2AO9A 1OISA 2ZSIB 1YX5A 5EG0B 4HLXA 1HF0A 2Y9YA 3KE2A 3FM5A 2IVMA 2HOSA 3FXRA 3L2CA 3CD6I 3GTLJ 3WHCA 4CDGA 1KGSA 2LY1A 5ILVA 1YO5C 3BPVA 4MHGA 2FU4A 3E6MA 2L3DA 2PX9A 4ZZDA 4J00A 2OC6A 5LRRA 1TQPA 4Y4RA 2OBPA 3DBRB 4A69C 2CYYA 4D9JA 3L2RA 1UMQA 4IF4A 5ICCA 3GZNB 4A3MJ 2EBIA 1Z77A 2GOXB 2VB6A 2F2EA 2MBFA 1U9NA 2BY2A 4UV8A 3L2UA 4G94A 2R5ZA 3BG5A 1OCPA 3BTIA 4HA8A 5FLVA 4BBSJ 2EH3A 4WXHA 2H27A 3S2HJ 3DXJF 3FM3A 1KZHA 3H3ZA 1WH5A 1FT9A 1Y0NA 2X51A 4F7ZA 1U78A 1FYLA 4DBQA 4XBFA 2IGMA 1R5ID 3CZ6A 3PIOF 1TT0A 2IJLA 1TNSA 1YE9A 2NVUB 2ZJQF 5B3SH 3CCJI 1VQLI 4KITB 1UCRA 4KJZA 1WH7A 1SAUA 3OMYA 3L2QA 5E3MA 3LSHA 1TWAJ 3P7NA 4P9FA 1ZR2A 1GV5A 4O6JA 2LVSA 3S3OA 3WE2A 3JRIA 1MNMC 3I71A 2XB0X 3HUGB
chains in the Genus database with same CATH topology
2P7VB 1DPRA 5DEQA 3QRFF 3WTUC 4ASNA 4MTEA 1LDKB 3WU0A 1BJAA 3R4KA 1Q1HA 2KIMA 2QM3A 4EGZA 1QQIA 1S8NA 1O3TA 1BC8C 5HDGA 3BOQA 2IT0A 1W7PD 5LHIA 1FBSA 3GZ6A 5HDNA 1SD6A 2F5DA 5LBQA 1PUEE 5DCMA 3M9AA 3HRUA 3KP5A 2H6BA 2YX7A 5D5WB 2QQAA 3TOBA 1K6OA 3T0YA 1D8KA 3TO9A 4AIKA 4RB0A 2EFPA 3ZMDA 1MJAA 4HQMA 2J5PA 3LA7A 4AD9A 4YFKF 4G7OF 3BJ6A 4M9SA 2K4JA 4N0BA 3WGHA 4MEYF 4O3MA 1O7LA 5HLHA 5E20A 1LDJA 1S29A 2DU9A 5HS9A 1NHAA 1HQCA 4HQEA 2E7WA 1RIOH 3HHHA 3L9FA 1L3LA 1SD5A 3CLOA 5F6FA 1XCBA 1SFUA 2ZJ2A 3T5XA 1O3SA 3KLNA 2W85A 1RI7A 4M9XA 2DK8A 3HRTA 3Q5FA 4M6YA 4M74A 3GFIA 3HUGA 1JXSA 3KP6A 4OINF 3IKTA 4R1HA 4PCQA 3T8RA 5IT3A 5DD8A 3JTGA 2L4AA 2D45A 1ZN2A 3V8KA 3WTZA 3V7CA 2AXLA 2VBZA 1F5TA 1FC3A 1DDNA 3R61A 5LGTA 1T39A 3ABTA 4WWCA 4IHSA 2HZTA 3KP3A 2TDXA 3IKVA 4MEXF 2DT5A 3QAHA 1DP7P 4JK1X 1FBUA 1K7AA 1HXDA 1DPUA 3GZ5A 1XGOA 1IAWA 1R1VA 4BH9A 4P9UA 3AAFA 3P9CA 1H9TA 3TGNA 3WTYC 2GZWA 2VXZA 1LEBA 5L3GA 6PAXA 1AWCA 2XIGA 1DUXC 2HQRA 1E17A 1YTYA 1SAXA 5D6EA 2EV0A 3HTSB 2K27A 1Z91A 3I59A 4A6EA 3SHFA 1QZYA 3BJAA 4MQ9F 2OZUA 1P4WA 2O61A 1Z7UA 4RB2C 3TQNA 3J7AO 3JSPA 2L02A 4KNYA 1GVJA 1MJ9A 3ERED 4GGGA 1P4XA 3M8FA 1BI3A 2HGCA 1QBJA 5CVRA 1SD7A 4ETSA 2WC2A 3V8LA 4D0PA 4RAYA 1FZPB 2RQPA 2VONA 2P8TA 4HX7A 4KA4A 4ESBA 2ESNA 2YPRA 1ZLJA 3OOPA 3EQLF 2FOKA 2XAGA 4L9TA 4EJUA 3M8EA 2P7CB 2XUBA 4CXFA 3RDIA 3BZ6A 4I0AA 2K02A 2L54A 5CLSA 3HHGA 4A12A 3MAJA 3BJOA 1PP7U 4ENMA 1J59A 2COMA 1G3TA 2VN2A 2UWMA 3MWMA 4OMYA 3E3VA 3HTUA 4I09A 1B59A 2V9VA 4CYDA 3WGIA 1YS6A 3WTSC 3GXOA 4ESFA 1U5TB 3I54A 2QQ9A 2GQQA 2QYOA 4GCVA 2PI0A 2JRTA 4Q4ZF 2P4WA 4P55A 1IRGA 3CUOA 4KIFA 4MNUA 1EV7A 1J0RA 2QVOA 3L7WA 2MD5A 2K86A 4LJZF 5JFRA 4EV0A 4AIJA 4L0ZB 1FBQA 4UV9A 3HIFA 1KYWA 3F8FA 2QBYA 3PQJA 4G9YA 1R7JA 2MH2A 2HR3A 1K79A 2EV5A 2NYXA 2DPUA 4CZZA 2QZ8A 2VT2A 1K78B 2XKPA 1XSXA 2EV6A 1H9GA 1PP8F 1YW7A 3KP7A 4BAYA 4AIHA 3CO6C 2DQRA 1YG2A 1U3EM 3GX4X 1O7FA 1FY7A 3EYIA 2MA3A 4WXCA 5D8LB 1BI0A 1P6RA 2E7XA 4KICA 4RB1A 3HRSA 3ISPA 2ZXJA 1IN6A 5JHUA 2ZO4A 2YX4A 1ZLKA 3FMSA 2DQLA 4XLNF 4CGZA 2Z3YA 2A3SA 1B4AA 4L9JA 2RDPA 1HKQA 3DP7A 1I5ZA 1OKRA 2HKOA 4FX0A 3COAC 1J5YA 3EYYA 5CVJA 4A6DA 4RGRA 5LHGA 2DFIA 1JE8A 1LB2A 3MZYA 1UB9A 3RKYA 3GFLA 4P96A 4OU0A 1FPQA 1QZZA 3F8BA 4B8XA 2D1HA 3RKWA 4KIBA 5HVQC 4U88A 2EFWA 2VC0A 3U2RA 2VE9A 2V1DA 2IPQX 4Q5SF 4M73A 4ZYHA 2RV8A 5HLIA 1WSUA 1OPCA 4PDKA 5FGMA 1MGTA 4OIRF 3BDDA 4LD5A 5K5QA 1FOKA 1R22A 5LGUA 1TNTA 1TQMA 2XHKA 2GA2A 3EUHA 5L3FA 1HKTA 3I5UA 1OYYA 3Q9VA 5FD5A 4FT8A 1Z1DA 3TOAA 3FX3A 2A6EF 3B73A 3RTRA 4N9HA 4OIQF 1KYZA 1TTYA 4G8XA 3JAMK 3MZHA 3ROUA 1UHMA 1YS7A 3E6CC 2A6HF 1SMYF 2F5EA 1BM9A 1FWZA 5KK1A 4N9IA 2NNNA 2UXXA 3F6VA 1W5TA 4HX8A 1H0MA 1LEAA 4E70A 5L3CA 2IA2A 2HS5A 3R6SA 3NEUA 5L3BA 1I27A 3JTHA 5D4RA 2RNJA 1ON1A 1O57A 3WGGA 1R5GA 2HWVA 5HS7A 2PG4A 1YYVA 1R5HA 3F72A 4KN7X 3NQOA 4MGRA 2A69F 4BXUA 1HSJA 1J7KA 1WKMA 2CQKA 4WF2A 3R0JA 3ECOA 5CVVA 3CUQB 4DQ2A 1XCVA 3G3ZA 3GFJA 1ZRFA 1F4KA 2IRFG 5JVTA 2EA2A 3F8MA 2ISYA 3C3WA 5K5RA 1XD7A 2HYFA 4KMUX 2ZMEB 5LGNA 4Y17A 4HF2A 2X4HA 3F3XA 1STZA 4L5IA 2W84A 2Z9OA 4JBAA 5L3DA 5CVUA 3K9TA 2M1BA 3IRQA 1OMIA 2LSOA 1X3UA 2R7FA 4BHCA 4L9NA 2HDCA 1P4AA 2Z5UA 3SZPA 4RS8A 1IN4A 3CDHA 1G3SA 4R8HA 4LMYA 5E1XA 1MJBA 2W24A 4RB3C 4UVAA 2XAFA 1IN5A 3GF2A 4LG0B 2J5OA 4KUMA 3E5QA 2X0LA 4Y15A 3ZMVA 2H09A 2FE3A 2P6TA 2V6CA 2A07F 2VOPA 1FSHA 3H92A 2ISZA 1S3JA 1TW2A 2CW0F 4BQAA 2PMHA 2LF8A 2VT3A 3L00A 1E2XA 3DKWA 1EH8A 3V7SA 3VFZA 2M5WA 4EJVA 2FF4A 1YFHA 5LHHA 4XRFA 3O3KA 1BC7C 5D5XB 2Y75A 2ZBKA 5LEKA 3CUQA 3GLXA 3KEQA 3KCCA 5H20A 4LLGF 3VOEA 3C1DA 1RUOA 1F9NA 4XSZF 2IW5A 2R7DA 4UXNA 4RGSA 5H6QA 2XAHA 2NAZA 5LRSA 1IXCA 3I4PA 2ZMEA 1LDDA 3C7JA 3F8NA 3SQNA 2C6YA 3M7GA 2RGVA 2O03A 2KIUA 4LGWA 5L3EA 3GO5A 2VBYA 1VTNC 2EA4A 2CFXA 4LLLA 4UHTA 4XLPF 1Y0UA 2FXAA 3BPXA 3IRRA 2BV6A 4OIPF 1XN7A 3GVAA 2DI3A 3WODF 4EGYA 2XKOA 2Z99A 2IP2A 4U0VA 5ERIA 1SD4A 2RKHA 3FWEA 4KDPA 2PQ8A 1IW7F 5E1ZB 4LFUA 3FMQA 1JHFA 3HSRA 1XMKA 4HLYA 3I53A 5DUKA 2PMUA 5DUIA 1XGSA 2M45A 5E8IA 1U5TC 2PBIA 4U7DA 3RKXA 4MTDA 1FLIA 2JSCA 2CO5A 3D0SA 3HSEA 4I98B 5TJJA 4KYWA 3F21A 1IUYA 4WX9A 3DV8A 2XROA 2RC4A 3KZYA 4YG2F 3GW2A 5BS6A 4MQVA 4KMFA 4LB6B 1WWXA 1V4RA 1BI1A 2BYVE 2CG4A 1GXQA 1FYMA 5ICFA 4HAMA 5DV5A 5JI6A 3GYHX 2V79A 1ZRCA 4JQFA 1XMAA 4IPAA 2PFBA 4ENKA 3HOSA 5LEJA 2VODA 2M87A 1RNLA 3F6OA 3M1EA 1ZRDA 1IXRC 3QPTA 1KA8A 5KVRA 3FXUA 2OA4A 2ETHA 1EH7A 4HF0A 5FD6A 3MCZA 5DYMA 2EFQA 1CF7B 4I2OA 4HYEA 3WTVC 1USTA 5ILSA 1UHWA 4A5MA 1S7AA 2W57A 1QNTA 1WI9A 3F8CA 3HOTA 2GXBA 5J8FA 1XSVA 3SZTA 4U7BA 4GO1A 5CJ9A 4HDUA 2HTJA 3SFZA 3P9IA 2CWEA 5AIPA 3JAMZ 1XGMA 2HQNA 2FBHA 3LAPA 3PQKA 2ZKZA 2H6CA 3I64A 5ILUA 4IJAA 4EJTA 4KN4X 4QWQA 4LLNA 4ZZLA 3DEUA 4RAZA 2HKXA 2XV4S 3QP5A 2MLKA 2O8XA 1Z6TA 5E8GA 3I58A 3O6BB 1T98A 1FSEA 1T6SA 1ZGAA 4IRIA 2GAUA 2BBYA 4G6QA 1C0WA 2OQGA 2PN6A 1YLFA 4UVBA 2EK5A 4DNCA 3P9KA 2VOOA 3IC7A 4K2EA 2HYGD 1W5SA 3L09A 2OD5A 3PFIA 1G3WA 4IRHA 3ECHA 3ZMTA 5ICGA 3QPHA 2Q0OA 3J81Z 1ULYA 2P6SA 3LWFA 5F64A 3T1BA 1J9IA 2IA1A 4G6DA 4Z2YA 1KU2A 3BP8A 1G3YA 4Y13A 2DW4A 3KLOA 3KETA 2P5LC 4UNOA 3QU6A 3QU3A 1YW8A 4PZJA 2OAZA 4XSXF 3QOPA 4BYYA 1TLHB 1RZ4A 2K7LA 1U5TA 2O6GE 1YQAA 2V1XA 4IRGA 1IF1A 5BOXA 1JGSA 1BIBA 1UFMA 2O3FA 1SFXA 1Z05A 3K2ZA 3K1NA 5ED4A 2MH9A 4HZFA 1B6AA 4ON0A 4ZH4F 2KJBA 4IXAA 2DBBA 2A61A 1PDNC 2XGXA 2RVCA 4IVNA 1ZGJA 2QUFA 4EMSA 4EM1A 2XRNA 2FRHA 2WV0A 3CO7C 5D5UB 4PGGA 4HX4A 1U6GA 4GXOA 3Q9SA 4LB5A 1K78A 2W25A 4NHJA 1T38A 5BPDA 5E18F 3U9GA 1I6XA 4Q47A 1MDMB 5FLXZ 1ZG5A 3CUQC 2EFOA 2QENA 2P5VA 2UXNA 2Y48A 1KU7A 4OOIA 2FNPA 1LJ9A 1CGPA 2ESHA 4EQQA 4EJWA 2BE5F 4G7ZF 4YFNF 3KEOA 2QQBA 5HDKA 4NQWA 1BIAA 4I02A 1ZH5A 1JHHA 2STTA 1P2FA 3LSTA 1ZARA 4KT5C 4CO8A 2NS0A 2XAJA 4ZYEA 1HW2A 1SFEA 2D1VA 1MD0A 1LVAA 5FFZA 5DCMB 2DAOA 3NRVA 4ZYGA 5IT9Z 2V1UA 4YIIA 2FA5A 3LQQA 1GXPA 1BI2A 2ELHA 2Y0MA 4RGXA 2YR2A 4HOBA 4YFXF 1XGNA 1O3RA 2ZNZA 1ZG3A 4U0WA 2UZKA 1V3FA 4ZYDA 4A0YA 3VB2A 1F1ZA 5A2QZ 2HFHA 1QGPA 1HW1A 3W6JB 3TDZC 3J81K 3RYRA 4I01A 3ZN0A 2VC1A 1FP1D 1Z9CA 4UVCA 1OYWA 2CGPA 1R23A 2BGCA 4ENNA 1GHCA 1W7PB 1MDMA 3BY6A 4R79A 4EM0B 2FBKA 3DPTA 2H94A 2PEXA 2JT1A 3R60A 2XAQA 1IRFA 3KZZA 5D5VB 3W6KB 1U8RA 3RJPA 2FMYA 4BHBA 5HLGA 5DCFA 2BEOA 1KQ0A 1HKSA 4YIFA 4A0ZA 3WU1B 2DTRA 2ZFWA 2XVCA 5K5OA 1KQ8A 5E17F 2KRFA 2EFNA 2VBXA 2HOEA 4KIGA 2G7UA 1ZAOA 2FEZA 3LQRA 2ZCWA 4I7HA 3WG9A 2ACJA 3ZP5A 1AOYA 3JW4A 5FLXK 5CYVA 4EM2A 5DD4A 5EEHA 3I59B 3E6DA 4Q48A 3DQVC 4P5OA 3DPLC 4HBLA 1WQ2A 3N97A 3REOA 1ODDA 4CHUA 1KU3A 1I1GA 1W7PA 2FSWA 5EEGA 2ADUA 3VODA 1BOAA 3CTAA 3ULQB 2JPCA 4B09A 3V7RA 4AWXB 2GIVA 5BQTA 3LA3A 3MFKA 4IHTA 1R1TA 2FMLA 4EVIA 5IT9K 1B9NA 3R0AA 3ZPLA 3VEPA 2VBWA 3K1MA 3IL2A 2O0YA 3U1DA 1R36A 2Q8KA 3FMRA 4I0BA 2JPBA 4TV7A 2B0LA 5AIQA 5BMZA 3FXQA 4WK8F 3ZQ7A 4LG0A 2MC3A 2XASA 5A2QK 2GXGA 4CICA 3E6BA 1ON2A 3RIRA 2AS5F 2E1NA 3K1PA 3T8TA 1BBYA 3N4MA 2F5CA 3KFWX 1S6LA 1B1BA 2QWWA 2YU3A 3BWGA 2CSOA 1USSA 3F23A 1LNWA 3J80Z 2LNBA 3DF8A 1TW3A 1R00A 1YIOA 3SXYA 2FNAA 4BNCA 4HF1A 1R1UA 1P92A 3V4GA 1OYIA 3MQ0A 4HV5A 4OMZA 1XDUA 4UUVA 3C18A 2G9WA 2IA0A 2QBYB 3G73A 4GYGA 1G6NA 1XSDA 1ZREA 1TQIA 1ZYRF 3EETA 1D3YA 4QLCU 1J2XA 3ABUA 3FHZA 3E97A 4A5NA 4L5JA 4H0EA 3ELKA 1G4DA 2JTVA 1YW9A 5JR3A 2VE8A 3ZMZA 2GWRA 2M30A 2EJRA 2Z33A 2KKOA 2K4BA 3K69A 5J8CA 1A04A 2M8EA 3H3UA 5J6XA 5BPIA 2KIFA 3HYIA 3WTXC 1EH6A 1TBXA 4BHPA 3TO6A 1XB4A 5LLQA 4S05A 4A0XA 1J75A 5D6FA 4LK1F 2JZYA 2WTEA 1IZ1A 4L18B 1L0OC 2STWA 5CVIA 3LFKA 1FP2A 3ZMSA 1U2WA 1OR7A 3IWZA 5FO5A 3RPUA 3FZVA 3ML6A 3LAJA 1QPMA 3KP2A 3BROA 1RUNA 1XDSA 2GA1A 4ENJA 2EWNA 3KP4A 1ZG1A 1B9MA 5TRDA 4FX4A 2G7HA 2HEOA 1IN8A 5D8KB 3D5LA 3RPQA 1KQ9A 2LKPA 1HBXG 1BN5A 2L4MA 5H6RA 4KFCA 2EB7A 3GWZA 3RYPA 3WTWC 3GFMA 1T2KA 2E1CA 1FX7A 1R58A 1W4MA 3WTTC 3O2PE 3TO7A 4NB5A 5E1WA 5DDGA 4RGUA 4U0YA 5F1RA 1CF7A 1D8JA 3J80K 3OV8A 3MEXA 2DK5A 3ZMUA 4WXDA 1ONVA 3S2WA 2MLGA 2WWYA 1Z6RA 2Q2EA 3B02A 2FQ3A 2OQRA 1IN7A 4A2UA 3FF5A 3JSOA 3E5UA 3TDUC 4HDVA 4L9VA 3TKYA 5K1YA 2FBIA 2L01A 1O3QA 1QO0D 3IWFA 3E5XA 2DLLA 4HW0A 1SMTA 1FNNA 2OZ6A 2OU2A 5ICEA 1ZHFA 5HS8A 1HSTA 3EDPA 2RN7A 3HSFA 4OIOF 4M6XA 5FB2A 2PLYA 3QP6A 1LQ1A 1HW5A 3DFGA 4PGHA 2LDUA 4G7HF 4M9ZA 2PJPA 3F22A 2F5FA 3WE3A 1T0FA 1MZBA 2P5KA 4O5VA 2LF7A 1KU9A 4AVPA 2A68F 4LK0F 4M72A 4GYIA 4M71A 2HTSA 2DO7A 4ESJA 1D5VA 1REPC 3RI4A 2QLZA 3LA2A 2NRAC 2D2WA 3ZN1A 5HOOA 2R3SA 2KJCA 2DPDA 1MKMA 1I1SA 3IHUA 2ZNYA 3K0LA 4WCGA 2YSRA 5D4SA 5FFXA 1WRJA 3GUDA 3V8JA 1FYKA 3GEZA 3CJNA 4FHTA 4EJOA 2A5YB 4L0YB 4S04A 3I0TA 4HV6A 5AONA 2NNYA 3HRMA 1S7OA 1IXSB 4HLXA 3KE2A 3FM5A 2IVMA 3FXRA 3L2CA 4CDGA 1KGSA 5ILVA 1YO5C 3BPVA 4MHGA 2FU4A 3E6MA 2L3DA 4ZZDA 5LRRA 1TQPA 2OBPA 2CYYA 4IF4A 5ICCA 2F2EA 2MBFA 4UV8A 4G94A 4HA8A 4WXHA 2H27A 3DXJF 3FM3A 3H3ZA 1FT9A 4F7ZA 1U78A 1FYLA 4XBFA 2IJLA 1TNSA 1UCRA 3P7NA 4P9FA 4O6JA 3WE2A 3I71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7V B;  1DPR A;  5DEQ A;  3QRF F;  3WTU C;  4ASN A;  4MTE A;  1LDK B;  3WU0 A;  1BJA A;  3R4K A;  1Q1H A;  2KIM A;  2QM3 A;  4EGZ A;  1QQI A;  1S8N A;  1O3T A;  1BC8 C;  5HDG A;  3BOQ A;  2IT0 A;  1W7P D;  5LHI A;  1FBS A;  3GZ6 A;  5HDN A;  1SD6 A;  2F5D A;  5LBQ A;  1PUE E;  5DCM A;  3M9A A;  3HRU A;  3KP5 A;  2H6B A;  2YX7 A;  5D5W B;  2QQA A;  3TOB A;  1K6O A;  3T0Y A;  1D8K A;  3TO9 A;  4AIK A;  4RB0 A;  2EFP A;  3ZMD A;  1MJA A;  4HQM A;  2J5P A;  3LA7 A;  4AD9 A;  4YFK F;  4G7O F;  3BJ6 A;  4M9S A;  2K4J A;  4N0B A;  3WGH A;  4MEY F;  4O3M A;  1O7L A;  5HLH A;  5E20 A;  1LDJ A;  1S29 A;  2DU9 A;  5HS9 A;  1NHA A;  1HQC A;  4HQE A;  2E7W A;  1RIO H;  3HHH A;  3L9F A;  1L3L A;  1SD5 A;  3CLO A;  5F6F A;  1XCB A;  1SFU A;  2ZJ2 A;  3T5X A;  1O3S A;  3KLN A;  2W85 A;  1RI7 A;  4M9X A;  2DK8 A;  3HRT A;  3Q5F A;  4M6Y A;  4M74 A;  3GFI A;  3HUG A;  1JXS A;  3KP6 A;  4OIN F;  3IKT A;  4R1H A;  4PCQ A;  3T8R A;  5IT3 A;  5DD8 A;  3JTG A;  2L4A A;  2D45 A;  1ZN2 A;  3V8K A;  3WTZ A;  3V7C A;  2AXL A;  2VBZ A;  1F5T A;  1FC3 A;  1DDN A;  3R61 A;  5LGT A;  1T39 A;  3ABT A;  4WWC A;  4IHS A;  2HZT A;  3KP3 A;  2TDX A;  3IKV A;  4MEX F;  2DT5 A;  3QAH A;  1DP7 P;  4JK1 X;  1FBU A;  1K7A A;  1HXD A;  1DPU A;  3GZ5 A;  1XGO A;  1IAW A;  1R1V A;  4BH9 A;  4P9U A;  3AAF A;  3P9C A;  1H9T A;  3TGN A;  3WTY C;  2GZW A;  2VXZ A;  1LEB A;  5L3G A;  6PAX A;  1AWC A;  2XIG A;  1DUX C;  2HQR A;  1E17 A;  1YTY A;  1SAX A;  5D6E A;  2EV0 A;  3HTS B;  2K27 A;  1Z91 A;  3I59 A;  4A6E A;  3SHF A;  1QZY A;  3BJA A;  4MQ9 F;  2OZU A;  1P4W A;  2O61 A;  1Z7U A;  4RB2 C;  3TQN A;  3J7A O;  3JSP A;  2L02 A;  4KNY A;  1GVJ A;  1MJ9 A;  3ERE D;  4GGG A;  1P4X A;  3M8F A;  1BI3 A;  2HGC A;  1QBJ A;  5CVR A;  1SD7 A;  4ETS A;  2WC2 A;  3V8L A;  4D0P A;  4RAY A;  1FZP B;  2RQP A;  2VON A;  2P8T A;  4HX7 A;  4KA4 A;  4ESB A;  2ESN A;  2YPR A;  1ZLJ A;  3OOP A;  3EQL F;  2FOK A;  2XAG A;  4L9T A;  4EJU A;  3M8E A;  2P7C B;  2XUB A;  4CXF A;  3RDI A;  3BZ6 A;  4I0A A;  2K02 A;  2L54 A;  5CLS A;  3HHG A;  4A12 A;  3MAJ A;  3BJO A;  1PP7 U;  4ENM A;  1J59 A;  2COM A;  1G3T A;  2VN2 A;  2UWM A;  3MWM A;  4OMY A;  3E3V A;  3HTU A;  4I09 A;  1B59 A;  2V9V A;  4CYD A;  3WGI A;  1YS6 A;  3WTS C;  3GXO A;  4ESF A;  1U5T B;  3I54 A;  2QQ9 A;  2GQQ A;  2QYO A;  4GCV A;  2PI0 A;  2JRT A;  4Q4Z F;  2P4W A;  4P55 A;  1IRG A;  3CUO A;  4KIF A;  4MNU A;  1EV7 A;  1J0R A;  2QVO A;  3L7W A;  2MD5 A;  2K86 A;  4LJZ F;  5JFR A;  4EV0 A;  4AIJ A;  4L0Z B;  1FBQ A;  4UV9 A;  3HIF A;  1KYW A;  3F8F A;  2QBY A;  3PQJ A;  4G9Y A;  1R7J A;  2MH2 A;  2HR3 A;  1K79 A;  2EV5 A;  2NYX A;  2DPU A;  4CZZ A;  2QZ8 A;  2VT2 A;  1K78 B;  2XKP A;  1XSX A;  2EV6 A;  1H9G A;  1PP8 F;  1YW7 A;  3KP7 A;  4BAY A;  4AIH A;  3CO6 C;  2DQR A;  1YG2 A;  1U3E M;  3GX4 X;  1O7F A;  1FY7 A;  3EYI A;  2MA3 A;  4WXC A;  5D8L B;  1BI0 A;  1P6R A;  2E7X A;  4KIC A;  4RB1 A;  3HRS A;  3ISP A;  2ZXJ A;  1IN6 A;  5JHU A;  2ZO4 A;  2YX4 A;  1ZLK A;  3FMS A;  2DQL A;  4XLN F;  4CGZ A;  2Z3Y A;  2A3S A;  1B4A A;  4L9J A;  2RDP A;  1HKQ A;  3DP7 A;  1I5Z A;  1OKR A;  2HKO A;  4FX0 A;  3COA C;  1J5Y A;  3EYY A;  5CVJ A;  4A6D A;  4RGR A;  5LHG A;  2DFI A;  1JE8 A;  1LB2 A;  3MZY A;  1UB9 A;  3RKY A;  3GFL A;  4P96 A;  4OU0 A;  1FPQ A;  1QZZ A;  3F8B A;  4B8X A;  2D1H A;  3RKW A;  4KIB A;  5HVQ C;  4U88 A;  2EFW A;  2VC0 A;  3U2R A;  2VE9 A;  2V1D A;  2IPQ X;  4Q5S F;  4M73 A;  4ZYH A;  2RV8 A;  5HLI A;  1WSU A;  1OPC A;  4PDK A;  5FGM A;  1MGT A;  4OIR F;  3BDD A;  4LD5 A;  5K5Q A;  1FOK A;  1R22 A;  5LGU A;  1TNT A;  1TQM A;  2XHK A;  2GA2 A;  3EUH A;  5L3F A;  1HKT A;  3I5U A;  1OYY A;  3Q9V A;  5FD5 A;  4FT8 A;  1Z1D A;  3TOA A;  3FX3 A;  2A6E F;  3B73 A;  3RTR A;  4N9H A;  4OIQ F;  1KYZ A;  1TTY A;  4G8X A;  3JAM K;  3MZH A;  3ROU A;  1UHM A;  1YS7 A;  3E6C C;  2A6H F;  1SMY F;  2F5E A;  1BM9 A;  1FWZ A;  5KK1 A;  4N9I A;  2NNN A;  2UXX A;  3F6V A;  1W5T A;  4HX8 A;  1H0M A;  1LEA A;  4E70 A;  5L3C A;  2IA2 A;  2HS5 A;  3R6S A;  3NEU A;  5L3B A;  1I27 A;  3JTH A;  5D4R A;  2RNJ A;  1ON1 A;  1O57 A;  3WGG A;  1R5G A;  2HWV A;  5HS7 A;  2PG4 A;  1YYV A;  1R5H A;  3F72 A;  4KN7 X;  3NQO A;  4MGR A;  2A69 F;  4BXU A;  1HSJ A;  1J7K A;  1WKM A;  2CQK A;  4WF2 A;  3R0J A;  3ECO A;  5CVV A;  3CUQ B;  4DQ2 A;  1XCV A;  3G3Z A;  3GFJ A;  1ZRF A;  1F4K A;  2IRF G;  5JVT A;  2EA2 A;  3F8M A;  2ISY A;  3C3W A;  5K5R A;  1XD7 A;  2HYF A;  4KMU X;  2ZME B;  5LGN A;  4Y17 A;  4HF2 A;  2X4H A;  3F3X A;  1STZ A;  4L5I A;  2W84 A;  2Z9O A;  4JBA A;  5L3D A;  5CVU A;  3K9T A;  2M1B A;  3IRQ A;  1OMI A;  2LSO A;  1X3U A;  2R7F A;  4BHC A;  4L9N A;  2HDC A;  1P4A A;  2Z5U A;  3SZP A;  4RS8 A;  1IN4 A;  3CDH A;  1G3S A;  4R8H A;  4LMY A;  5E1X A;  1MJB A;  2W24 A;  4RB3 C;  4UVA A;  2XAF A;  1IN5 A;  3GF2 A;  4LG0 B;  2J5O A;  4KUM A;  3E5Q A;  2X0L A;  4Y15 A;  3ZMV A;  2H09 A;  2FE3 A;  2P6T A;  2V6C A;  2A07 F;  2VOP A;  1FSH A;  3H92 A;  2ISZ A;  1S3J A;  1TW2 A;  2CW0 F;  4BQA A;  2PMH A;  2LF8 A;  2VT3 A;  3L00 A;  1E2X A;  3DKW A;  1EH8 A;  3V7S A;  3VFZ A;  2M5W A;  4EJV A;  2FF4 A;  1YFH A;  5LHH A;  4XRF A;  3O3K A;  1BC7 C;  5D5X B;  2Y75 A;  2ZBK A;  5LEK A;  3CUQ A;  3GLX A;  3KEQ A;  3KCC A;  5H20 A;  4LLG F;  3VOE A;  3C1D A;  1RUO A;  1F9N A;  4XSZ F;  2IW5 A;  2R7D A;  4UXN A;  4RGS A;  5H6Q A;  2XAH A;  2NAZ A;  5LRS A;  1IXC A;  3I4P A;  2ZME A;  1LDD A;  3C7J A;  3F8N A;  3SQN A;  2C6Y A;  3M7G A;  2RGV A;  2O03 A;  2KIU A;  4LGW A;  5L3E A;  3GO5 A;  2VBY A;  1VTN C;  2EA4 A;  2CFX A;  4LLL A;  4UHT A;  4XLP F;  1Y0U A;  2FXA A;  3BPX A;  3IRR A;  2BV6 A;  4OIP F;  1XN7 A;  3GVA A;  2DI3 A;  3WOD F;  4EGY A;  2XKO A;  2Z99 A;  2IP2 A;  4U0V A;  5ERI A;  1SD4 A;  2RKH A;  3FWE A;  4KDP A;  2PQ8 A;  1IW7 F;  5E1Z B;  4LFU A;  3FMQ A;  1JHF A;  3HSR A;  1XMK A;  4HLY A;  3I53 A;  5DUK A;  2PMU A;  5DUI A;  1XGS A;  2M45 A;  5E8I A;  1U5T C;  2PBI A;  4U7D A;  3RKX A;  4MTD A;  1FLI A;  2JSC A;  2CO5 A;  3D0S A;  3HSE A;  4I98 B;  5TJJ A;  4KYW A;  3F21 A;  1IUY A;  4WX9 A;  3DV8 A;  2XRO A;  2RC4 A;  3KZY A;  4YG2 F;  3GW2 A;  5BS6 A;  4MQV A;  4KMF A;  4LB6 B;  1WWX A;  1V4R A;  1BI1 A;  2BYV E;  2CG4 A;  1GXQ A;  1FYM A;  5ICF A;  4HAM A;  5DV5 A;  5JI6 A;  3GYH X;  2V79 A;  1ZRC A;  4JQF A;  1XMA A;  4IPA A;  2PFB A;  4ENK A;  3HOS A;  5LEJ A;  2VOD A;  2M87 A;  1RNL A;  3F6O A;  3M1E A;  1ZRD A;  1IXR C;  3QPT A;  1KA8 A;  5KVR A;  3FXU A;  2OA4 A;  2ETH A;  1EH7 A;  4HF0 A;  5FD6 A;  3MCZ A;  5DYM A;  2EFQ A;  1CF7 B;  4I2O A;  4HYE A;  3WTV C;  1UST A;  5ILS A;  1UHW A;  4A5M A;  1S7A A;  2W57 A;  1QNT A;  1WI9 A;  3F8C A;  3HOT A;  2GXB A;  5J8F A;  1XSV A;  3SZT A;  4U7B A;  4GO1 A;  5CJ9 A;  4HDU A;  2HTJ A;  3SFZ A;  3P9I A;  2CWE A;  5AIP A;  3JAM Z;  1XGM A;  2HQN A;  2FBH A;  3LAP A;  3PQK A;  2ZKZ A;  2H6C A;  3I64 A;  5ILU A;  4IJA A;  4EJT A;  4KN4 X;  4QWQ A;  4LLN A;  4ZZL A;  3DEU A;  4RAZ A;  2HKX A;  2XV4 S;  3QP5 A;  2MLK A;  2O8X A;  1Z6T A;  5E8G A;  3I58 A;  3O6B B;  1T98 A;  1FSE A;  1T6S A;  1ZGA A;  4IRI A;  2GAU A;  2BBY A;  4G6Q A;  1C0W A;  2OQG A;  2PN6 A;  1YLF A;  4UVB A;  2EK5 A;  4DNC A;  3P9K A;  2VOO A;  3IC7 A;  4K2E A;  2HYG D;  1W5S A;  3L09 A;  2OD5 A;  3PFI A;  1G3W A;  4IRH A;  3ECH A;  3ZMT A;  5ICG A;  3QPH A;  2Q0O A;  3J81 Z;  1ULY A;  2P6S A;  3LWF A;  5F64 A;  3T1B A;  1J9I A;  2IA1 A;  4G6D A;  4Z2Y A;  1KU2 A;  3BP8 A;  1G3Y A;  4Y13 A;  2DW4 A;  3KLO A;  3KET A;  2P5L C;  4UNO A;  3QU6 A;  3QU3 A;  1YW8 A;  4PZJ A;  2OAZ A;  4XSX F;  3QOP A;  4BYY A;  1TLH B;  1RZ4 A;  2K7L A;  1U5T A;  2O6G E;  1YQA A;  2V1X A;  4IRG A;  1IF1 A;  5BOX A;  1JGS A;  1BIB A;  1UFM A;  2O3F A;  1SFX A;  1Z05 A;  3K2Z A;  3K1N A;  5ED4 A;  2MH9 A;  4HZF A;  1B6A A;  4ON0 A;  4ZH4 F;  2KJB A;  4IXA A;  2DBB A;  2A61 A;  1PDN C;  2XGX A;  2RVC A;  4IVN A;  1ZGJ A;  2QUF A;  4EMS A;  4EM1 A;  2XRN A;  2FRH A;  2WV0 A;  3CO7 C;  5D5U B;  4PGG A;  4HX4 A;  1U6G A;  4GXO A;  3Q9S A;  4LB5 A;  1K78 A;  2W25 A;  4NHJ A;  1T38 A;  5BPD A;  5E18 F;  3U9G A;  1I6X A;  4Q47 A;  1MDM B;  5FLX Z;  1ZG5 A;  3CUQ C;  2EFO A;  2QEN A;  2P5V A;  2UXN A;  2Y48 A;  1KU7 A;  4OOI A;  2FNP A;  1LJ9 A;  1CGP A;  2ESH A;  4EQQ A;  4EJW A;  2BE5 F;  4G7Z F;  4YFN F;  3KEO A;  2QQB A;  5HDK A;  4NQW A;  1BIA A;  4I02 A;  1ZH5 A;  1JHH A;  2STT A;  1P2F A;  3LST A;  1ZAR A;  4KT5 C;  4CO8 A;  2NS0 A;  2XAJ A;  4ZYE A;  1HW2 A;  1SFE A;  2D1V A;  1MD0 A;  1LVA A;  5FFZ A;  5DCM B;  2DAO A;  3NRV A;  4ZYG A;  5IT9 Z;  2V1U A;  4YII A;  2FA5 A;  3LQQ A;  1GXP A;  1BI2 A;  2ELH A;  2Y0M A;  4RGX A;  2YR2 A;  4HOB A;  4YFX F;  1XGN A;  1O3R A;  2ZNZ A;  1ZG3 A;  4U0W A;  2UZK A;  1V3F A;  4ZYD A;  4A0Y A;  3VB2 A;  1F1Z A;  5A2Q Z;  2HFH A;  1QGP A;  1HW1 A;  3W6J B;  3TDZ C;  3J81 K;  3RYR A;  4I01 A;  3ZN0 A;  2VC1 A;  1FP1 D;  1Z9C A;  4UVC A;  1OYW A;  2CGP A;  1R23 A;  2BGC A;  4ENN A;  1GHC A;  1W7P B;  1MDM A;  3BY6 A;  4R79 A;  4EM0 B;  2FBK A;  3DPT A;  2H94 A;  2PEX A;  2JT1 A;  3R60 A;  2XAQ A;  1IRF A;  3KZZ A;  5D5V B;  3W6K B;  1U8R A;  3RJP A;  2FMY A;  4BHB A;  5HLG A;  5DCF A;  2BEO A;  1KQ0 A;  1HKS A;  4YIF A;  4A0Z A;  3WU1 B;  2DTR A;  2ZFW A;  2XVC A;  5K5O A;  1KQ8 A;  5E17 F;  2KRF A;  2EFN A;  2VBX A;  2HOE A;  4KIG A;  2G7U A;  1ZAO A;  2FEZ A;  3LQR A;  2ZCW A;  4I7H A;  3WG9 A;  2ACJ A;  3ZP5 A;  1AOY A;  3JW4 A;  5FLX K;  5CYV A;  4EM2 A;  5DD4 A;  5EEH A;  3I59 B;  3E6D A;  4Q48 A;  3DQV C;  4P5O A;  3DPL C;  4HBL A;  1WQ2 A;  3N97 A;  3REO A;  1ODD A;  4CHU A;  1KU3 A;  1I1G A;  1W7P A;  2FSW A;  5EEG A;  2ADU A;  3VOD A;  1BOA A;  3CTA A;  3ULQ B;  2JPC A;  4B09 A;  3V7R A;  4AWX B;  2GIV A;  5BQT A;  3LA3 A;  3MFK A;  4IHT A;  1R1T A;  2FML A;  4EVI A;  5IT9 K;  1B9N A;  3R0A A;  3ZPL A;  3VEP A;  2VBW A;  3K1M A;  3IL2 A;  2O0Y A;  3U1D A;  1R36 A;  2Q8K A;  3FMR A;  4I0B A;  2JPB A;  4TV7 A;  2B0L A;  5AIQ A;  5BMZ A;  3FXQ A;  4WK8 F;  3ZQ7 A;  4LG0 A;  2MC3 A;  2XAS A;  5A2Q K;  2GXG A;  4CIC A;  3E6B A;  1ON2 A;  3RIR A;  2AS5 F;  2E1N A;  3K1P A;  3T8T A;  1BBY A;  3N4M A;  2F5C A;  3KFW X;  1S6L A;  1B1B A;  2QWW A;  2YU3 A;  3BWG A;  2CSO A;  1USS A;  3F23 A;  1LNW A;  3J80 Z;  2LNB A;  3DF8 A;  1TW3 A;  1R00 A;  1YIO A;  3SXY A;  2FNA A;  4BNC A;  4HF1 A;  1R1U A;  1P92 A;  3V4G A;  1OYI A;  3MQ0 A;  4HV5 A;  4OMZ A;  1XDU A;  4UUV A;  3C18 A;  2G9W A;  2IA0 A;  2QBY B;  3G73 A;  4GYG A;  1G6N A;  1XSD A;  1ZRE A;  1TQI A;  1ZYR F;  3EET A;  1D3Y A;  4QLC U;  1J2X A;  3ABU A;  3FHZ A;  3E97 A;  4A5N A;  4L5J A;  4H0E A;  3ELK A;  1G4D A;  2JTV A;  1YW9 A;  5JR3 A;  2VE8 A;  3ZMZ A;  2GWR A;  2M30 A;  2EJR A;  2Z33 A;  2KKO A;  2K4B A;  3K69 A;  5J8C A;  1A04 A;  2M8E A;  3H3U A;  5J6X A;  5BPI A;  2KIF A;  3HYI A;  3WTX C;  1EH6 A;  1TBX A;  4BHP A;  3TO6 A;  1XB4 A;  5LLQ A;  4S05 A;  4A0X A;  1J75 A;  5D6F A;  4LK1 F;  2JZY A;  2WTE A;  1IZ1 A;  4L18 B;  1L0O C;  2STW A;  5CVI A;  3LFK A;  1FP2 A;  3ZMS A;  1U2W A;  1OR7 A;  3IWZ A;  5FO5 A;  3RPU A;  3FZV A;  3ML6 A;  3LAJ A;  1QPM A;  3KP2 A;  3BRO A;  1RUN A;  1XDS A;  2GA1 A;  4ENJ A;  2EWN A;  3KP4 A;  1ZG1 A;  1B9M A;  5TRD A;  4FX4 A;  2G7H A;  2HEO A;  1IN8 A;  5D8K B;  3D5L A;  3RPQ A;  1KQ9 A;  2LKP A;  1HBX G;  1BN5 A;  2L4M A;  5H6R A;  4KFC A;  2EB7 A;  3GWZ A;  3RYP A;  3WTW C;  3GFM A;  1T2K A;  2E1C A;  1FX7 A;  1R58 A;  1W4M A;  3WTT C;  3O2P E;  3TO7 A;  4NB5 A;  5E1W A;  5DDG A;  4RGU A;  4U0Y A;  5F1R A;  1CF7 A;  1D8J A;  3J80 K;  3OV8 A;  3MEX A;  2DK5 A;  3ZMU A;  4WXD A;  1ONV A;  3S2W A;  2MLG A;  2WWY A;  1Z6R A;  2Q2E A;  3B02 A;  2FQ3 A;  2OQR A;  1IN7 A;  4A2U A;  3FF5 A;  3JSO A;  3E5U A;  3TDU C;  4HDV A;  4L9V A;  3TKY A;  5K1Y A;  2FBI A;  2L01 A;  1O3Q A;  1QO0 D;  3IWF A;  3E5X A;  2DLL A;  4HW0 A;  1SMT A;  1FNN A;  2OZ6 A;  2OU2 A;  5ICE A;  1ZHF A;  5HS8 A;  1HST A;  3EDP A;  2RN7 A;  3HSF A;  4OIO F;  4M6X A;  5FB2 A;  2PLY A;  3QP6 A;  1LQ1 A;  1HW5 A;  3DFG A;  4PGH A;  2LDU A;  4G7H F;  4M9Z A;  2PJP A;  3F22 A;  2F5F A;  3WE3 A;  1T0F A;  1MZB A;  2P5K A;  4O5V A;  2LF7 A;  1KU9 A;  4AVP A;  2A68 F;  4LK0 F;  4M72 A;  4GYI A;  4M71 A;  2HTS A;  2DO7 A;  4ESJ A;  1D5V A;  1REP C;  3RI4 A;  2QLZ A;  3LA2 A;  2NRA C;  2D2W A;  3ZN1 A;  5HOO A;  2R3S A;  2KJC A;  2DPD A;  1MKM A;  1I1S A;  3IHU A;  2ZNY A;  3K0L A;  4WCG A;  2YSR A;  5D4S A;  5FFX A;  1WRJ A;  3GUD A;  3V8J A;  1FYK A;  3GEZ A;  3CJN A;  4FHT A;  4EJO A;  2A5Y B;  4L0Y B;  4S04 A;  3I0T A;  4HV6 A;  5AON A;  2NNY A;  3HRM A;  1S7O A;  1IXS B;  4HLX A;  3KE2 A;  3FM5 A;  2IVM A;  3FXR A;  3L2C A;  4CDG A;  1KGS A;  5ILV A;  1YO5 C;  3BPV A;  4MHG A;  2FU4 A;  3E6M A;  2L3D A;  4ZZD A;  5LRR A;  1TQP A;  2OBP A;  2CYY A;  4IF4 A;  5ICC A;  2F2E A;  2MBF A;  4UV8 A;  4G94 A;  4HA8 A;  4WXH A;  2H27 A;  3DXJ F;  3FM3 A;  3H3Z A;  1FT9 A;  4F7Z A;  1U78 A;  1FYL A;  4XBF A;  2IJL A;  1TNS A;  1UCR A;  3P7N A;  4P9F A;  4O6J A;  3WE2 A;  3I71 A; 
#chains in the Genus database with same CATH topology
 2A6T A;  2R7O A;  4OAY A;  4JYK A;  1NK3 P;  5F08 A;  3CDL A;  3CCR I;  2P7V B;  1DPR A;  4CCN A;  4CCK A;  5DEQ A;  3QYF A;  1B8I B;  3QRF F;  2VKE A;  4CCJ A;  3WTU C;  4ASN A;  4MTE A;  1LDK B;  3WU0 A;  3BG3 A;  3I9V 2;  5M5Y J;  1BJA A;  3R4K A;  5FKO A;  1Q1H A;  2KIM A;  2QM3 A;  4EGZ A;  1A5J A;  1QQI A;  1LFU P;  3S14 J;  1S8N A;  1O3T A;  1BC8 C;  5HDG A;  3BOQ A;  2I8D A;  1X1B A;  2IT0 A;  3X2Q H;  1W7P D;  5LHI A;  1FBS A;  3VPR A;  3GZ6 A;  2YS9 A;  5HDN A;  1SD6 A;  2F5D A;  2HVS A;  5LBQ A;  1PUE E;  4ZYA A;  5DCM A;  3M9A A;  3HRU A;  5IYB J;  3KP5 A;  2H6B A;  2YX7 A;  5D5W B;  2QQA A;  3BG6 A;  3TOB A;  5EG0 A;  1K6O A;  3T0Y A;  1D8K A;  2CV2 A;  2MFZ A;  2K85 A;  3TO9 A;  3H5N A;  4AIK A;  4C2T A;  1ETV A;  3GTJ J;  3GTM J;  4RB0 A;  2EFP A;  4NUB A;  3ZMD A;  1OCC H;  1PVE A;  4FIS A;  1MJA A;  1N77 A;  4HQM A;  2M7B A;  2E1M C;  2J5P A;  3LA7 A;  3A02 A;  2IBD A;  2VJJ A;  4AD9 A;  5DM6 F;  5F0F A;  4XMY A;  2VJ4 A;  3SJM A;  4YFK F;  1ZQ3 P;  2GM4 A;  4G7O F;  3AG1 H;  3BJ6 A;  4M9S A;  2QGU A;  5EGO B;  1MMD A;  2KLO A;  4CYC B;  1X1C A;  2K4J A;  4N0B A;  3WGH A;  5EDN A;  4MEY F;  4O3M A;  1O7L A;  1TWG J;  2LR8 A;  5E20 A;  1LDJ A;  5HLH A;  1ETX A;  1S29 A;  2DU9 A;  3Q0U A;  1X3W B;  5HS9 A;  2EIK H;  1NHA A;  4QPQ A;  4X6A J;  3KX2 A;  4RM3 A;  4CCM A;  1OR7 C;  1SVO A;  1LVK A;  4KT6 A;  1HQC A;  2I10 A;  4HQE A;  1WJC A;  2E7W A;  1RIO H;  3HHH A;  3L9F A;  1L3L A;  5HNF A;  1SD5 A;  3JRD A;  1IC8 A;  1VQN I;  1K83 J;  3CLO A;  1VF9 A;  2OTJ I;  1XPX A;  2XDV A;  5F6F A;  1XCB A;  3LNQ A;  1SFU A;  2DN0 A;  2ZJ2 A;  2EZH A;  3OYC A;  4BJT A;  2JA5 J;  4DW6 A;  3T5X A;  1O3S A;  3KLN A;  2W85 A;  3OYN A;  1RI7 A;  4M9X A;  3M3Y J;  2DK8 A;  2KL4 A;  3PM1 A;  1Z67 A;  2GOM A;  2KDZ A;  3HRT A;  3WG7 H;  3Q5F A;  3PNY A;  4M6Y A;  3IH2 A;  1JJ8 C;  4M74 A;  4KIS A;  3H0D A;  5LD2 C;  3GFI A;  3HUG A;  4CH7 A;  1JXS A;  3KP6 A;  3TP3 A;  3ZCO A;  4OIN F;  4Y33 A;  3IKT A;  2P81 A;  3DWL E;  4R1H A;  5C44 J;  4PJL A;  4PCQ A;  3T8R A;  5IT3 A;  4ITV A;  2UV1 A;  2IXS A;  5DD8 A;  2VKD A;  3JTG A;  4E7L A;  1XG1 A;  4YEJ A;  2L4A A;  4BE1 A;  1ZN2 A;  2D45 A;  3JR9 A;  3V8K A;  3WTZ A;  2M7A A;  3V7C A;  2GXA A;  1BA5 A;  2AXL A;  3OY9 A;  1A6I A;  2VBZ A;  2X6O A;  1F5T A;  2FX0 A;  3OYH A;  1FC3 A;  1DDN A;  3R61 A;  5LGT A;  3LSJ A;  3CMM A;  1T39 A;  3BT9 A;  2LBF A;  3ABT A;  4WWC A;  4IHS A;  2HZT A;  3KP3 A;  2TDX A;  3H9J A;  3IKV A;  3K70 D;  1D0X A;  4MEX F;  2DT5 A;  3QAH A;  2D5V A;  4F93 B;  4XRS G;  1DP7 P;  4JK1 X;  1E3H A;  2CS3 A;  1ZK8 A;  2CQX A;  1FBU A;  1K7A A;  1HXD A;  2DA3 A;  1DPU A;  3JRH A;  3GZ5 A;  3L2V A;  1O4X A;  1WJB A;  3LSG A;  1XGO A;  4HNV A;  3WHB A;  1IAW A;  4FE7 A;  3HOX J;  2VXD A;  1R1V A;  5J1U A;  4BH9 A;  4P9U A;  3AAF A;  3HKZ N;  3P9C A;  1R4N B;  1H9T A;  3TGN A;  3WTY C;  2ELK A;  2GZW A;  2VXZ A;  1LEB A;  5L3G A;  3FIW A;  1I3A A;  6PAX A;  1AWC A;  2XIG A;  1DUX C;  2X85 A;  5EGO A;  4CYC A;  2ICW G;  2F5V A;  2HQR A;  3PO3 J;  1E17 A;  1TWH J;  3C2H A;  1YTY A;  1SAX A;  1R49 A;  5D6E A;  2EV0 A;  2Y69 H;  1UG0 A;  3HTS B;  4J01 A;  2HVR A;  2K27 A;  1Z91 A;  2K9Q A;  3I59 A;  4A6E A;  3J7Y J;  3H5R A;  3SHF A;  3PJR A;  5KHD A;  1D1B A;  1RET A;  1QZY A;  4IL6 C;  2JWT A;  5CQE A;  2DMN A;  3BJA A;  4MIM A;  2K5C A;  2OZU A;  4MQ9 F;  1P4W A;  2O61 A;  1Z7U A;  1TWF J;  4RB2 C;  1X58 A;  3PUB A;  3TQN A;  3J7A O;  3JSP A;  3ABK H;  3OYB A;  3OYA A;  2L02 A;  2CQ7 A;  4KNY A;  3HOW J;  1GVJ A;  1MJ9 A;  2LG4 A;  4Y52 J;  4DZJ A;  5B1A H;  3ERE D;  4GGG A;  1P4X A;  3M8F A;  1BI3 A;  3K4J A;  2HGC A;  4XKB A;  1QBJ A;  3ABM H;  5CVR A;  1SD7 A;  3BG7 A;  3E1S A;  4ETS A;  1IDZ A;  2WC2 A;  3DPU A;  3V8L A;  1IRX A;  2JMW A;  3DTE A;  4D0P A;  4HSR A;  2EZI A;  4PUS A;  3FXM A;  2RQP A;  4RAY A;  1FZP B;  2VON A;  2P8T A;  3PUF A;  4HX7 A;  4KA4 A;  4DJA A;  4ESB A;  2ESN A;  2YPR A;  4D1Q A;  1F43 A;  4XLC A;  1LKX A;  3WU2 C;  3FXK A;  1ZLJ A;  4GDF A;  5KAI C;  3OOP A;  4AC0 A;  2AHQ A;  4B43 A;  2WY7 Q;  3EQL F;  2FOK A;  2XAG A;  2LD5 A;  1QU3 A;  4L9T A;  2WAQ A;  4EJU A;  3M8E A;  2P7C B;  3VYT B;  2WB1 N;  2XUB A;  1LPQ A;  2LKX A;  4CXF A;  1MMS A;  2V4J C;  3RDI A;  3BZ6 A;  4I0A A;  2K02 A;  1IO2 A;  2L54 A;  2VJI A;  3HGY A;  3MKW B;  5CLS A;  5FKK A;  2A05 A;  3HHG A;  4XLA A;  3ZR8 X;  2V1N A;  5K7Z A;  4A12 A;  2E5N A;  3MAJ A;  3FKI J;  3BJO A;  1VQP I;  4XQF A;  1PP7 U;  3EUH C;  4QSH A;  4ENM A;  4BKX A;  1J59 A;  2E2H J;  2COM A;  1G3T A;  2VN2 A;  2UWM A;  1OCR H;  4XOT A;  3MWM A;  4OMY A;  3E3V A;  4C3J J;  3HTU A;  4I09 A;  3OYI A;  1B59 A;  2V9V A;  4CYD A;  1X1P A;  3WGI A;  1FIP A;  2F4I A;  4HEA 2;  1Y8R B;  1YS6 A;  2XGE A;  3CQZ J;  3LL7 A;  5CKT A;  3WTS C;  3GXO A;  1RR7 A;  4W97 A;  4ESF A;  4RBO A;  1U5T B;  3I54 A;  2QQ9 A;  2GQQ A;  2QYO A;  4GCV A;  4BBR J;  4UUS B;  2BW3 B;  2E60 A;  2PI0 A;  4BY1 J;  1WJA A;  1EJ9 A;  2JRT A;  4Q4Z F;  2P4W A;  4P55 A;  3OWT A;  5J1R A;  1IRG A;  3CUO A;  2ME6 A;  2CMP A;  4KIF A;  4MNU A;  4JX4 A;  1EV7 A;  1J0R A;  4A3J J;  2R7Z J;  3C2G A;  2QVO A;  2Y2Z A;  2O5R A;  3L7W A;  2MD5 A;  2K86 A;  1W1W E;  3A03 A;  3HM5 A;  4LJZ F;  2AQE A;  5JFR A;  1UZC A;  4EV0 A;  1Y39 A;  3H9Q A;  1RPW A;  1P7I A;  4AIJ A;  1FBQ A;  4UV9 A;  4L0Z B;  2FUG 2;  3HIF A;  1KYW A;  1MH3 A;  3F8F A;  2QBY A;  3PQJ A;  4G9Y A;  1R7J A;  2E2I J;  2B63 J;  3A0B C;  2MH2 A;  2HR3 A;  1K79 A;  2HNH A;  3KYD B;  2EV5 A;  2MG4 A;  2NYX A;  3OIO A;  2DPU A;  5FJ8 J;  4CZZ A;  4B3A A;  4EEF G;  2QZ8 A;  1QHH D;  3PL8 A;  2VT2 A;  1K78 B;  3SEQ A;  3L2W A;  1WHU A;  4LG3 A;  2XKP A;  2ZJP F;  4Y7N J;  2QQ8 A;  5J47 A;  3OSF A;  1XSX A;  1I3Q J;  2EV6 A;  1H9G A;  5GAE J;  1IJW C;  3JRC A;  1SEU A;  1PP8 F;  2R5Y B;  1YW7 A;  2KZG A;  2DOE A;  3KP7 A;  4BAY A;  2HPM A;  5IYD J;  1ZTR A;  4AIH A;  2DT6 A;  3CO6 C;  1WFX A;  2DQR A;  1YG2 A;  1U3E M;  3GX4 X;  3M8J A;  1SFO J;  3HDD A;  1O7F A;  1FY7 A;  4ZTF A;  3EYI A;  2MA3 A;  2DT7 B;  4WXC A;  4NDL A;  5D8L B;  1BI0 A;  4IX7 A;  2X1D A;  1P6R A;  3EUK L;  1S9H A;  5E3O A;  3W3C A;  5F04 A;  4RAG A;  5FKL A;  2LP0 A;  2V26 A;  2E7X A;  4KIC A;  4RB1 A;  4NNJ A;  3ZXS A;  4I76 A;  2XGD A;  1Y56 A;  3HRS A;  3ISP A;  2ZXJ A;  1IN6 A;  1V5E A;  4XN3 A;  5JHU A;  2DA1 A;  2ZO4 A;  2YX4 A;  2GBY A;  3FMS A;  1ZLK A;  3MKY B;  4XNF A;  2DQL A;  4XLN F;  4CGZ A;  3S2D J;  2VAS A;  3ZRG A;  2Z3Y A;  2A3S A;  3CMA I;  2HU9 A;  1B4A A;  1YJW I;  4L9J A;  1FOW A;  2RDP A;  1HKQ A;  3DP7 A;  1I5Z A;  1OKR A;  3QPS A;  2HKO A;  4FX0 A;  2QSH X;  3COA C;  1J5Y A;  3EYY A;  5CVJ A;  2K40 A;  4A6D A;  5GTI C;  5JLX A;  4IHX A;  2DCE A;  4RGR A;  2DFI A;  5GAD J;  5LHG A;  4C2U A;  1JE8 A;  1LB2 A;  3MZY A;  2E1O A;  5GP9 A;  1UB9 A;  3RKY A;  2FOW A;  3GFL A;  3PSI A;  4P96 A;  2QEX I;  1JKQ C;  2X9D A;  3FK6 A;  4OU0 A;  1FPQ A;  1QZZ A;  2W82 A;  3F8B A;  1ERD A;  4B8X A;  4MO7 A;  2D1H A;  2XF7 A;  3RKW A;  4KIB A;  2EIN H;  2IS2 A;  2YUS A;  2M9H A;  4AM3 A;  3H36 A;  5HVQ C;  1WGX A;  4U88 A;  3QWL A;  2JA8 J;  2EFW A;  4BL0 B;  2VC0 A;  3U2R A;  2VE9 A;  4RDU A;  1LFB A;  2V1D A;  2IPQ X;  4RM2 A;  4LIU A;  2BVM A;  4Q5S F;  4M73 A;  4HST A;  4ZYH A;  2RV8 A;  3S3M A;  5HLI A;  1RKT A;  4D5C A;  4UY8 I;  1FOX A;  3G4S I;  1WSU A;  1OPC A;  4PDK A;  3CMY A;  3BTL A;  5FGM A;  2R5Y A;  4DZP A;  3G6E I;  1MGT A;  1WVR A;  4N4O B;  5FKN A;  1APL C;  4OIR F;  3K4B A;  3BDD A;  4LD5 A;  5K5Q A;  3PIP F;  1FOK A;  1R22 A;  1MIJ A;  2XB5 A;  4A3D J;  1GV2 A;  3LMM A;  5LGU A;  1TNT A;  4A3G J;  1TQM A;  2XHK A;  2GA2 A;  3EUH A;  5L3F A;  4G6T B;  1HKT A;  3I5U A;  3OS1 A;  1OYY A;  4F52 A;  2E35 A;  4QPO A;  2R93 J;  1UG2 A;  5DS9 A;  4XKV A;  3QOE A;  3Q9V A;  5FD5 A;  4FT8 A;  2IS1 A;  1Z1D A;  2R7R A;  3LSK A;  3TOA A;  2Y31 A;  3FX3 A;  2A6E F;  1Z3X A;  2ZME C;  3B73 A;  3RTR A;  3DLA A;  4N9H A;  4OIQ F;  1KYZ A;  5E3N A;  1TTY A;  1XTA A;  1MBK A;  1PUF A;  4G8X A;  3JAM K;  3MZH A;  4DGW B;  1NG6 A;  2ZXI A;  3ROU A;  1UHM A;  1YS7 A;  2CW7 A;  3FK7 A;  3E6C C;  2LLK A;  3OSG A;  1RKW A;  2W4S A;  3I56 I;  2BY1 A;  5EZH A;  2A6H F;  1SMY F;  2F5E A;  3BR1 A;  4Z6Y A;  1N75 A;  1BM9 A;  1FWZ A;  5KK1 A;  4RLF A;  4N9I A;  2NNN A;  2UXX A;  3F6V A;  3HEF A;  1W5T A;  4HX8 A;  3S17 J;  4YEL A;  3OR1 C;  4E7H A;  1TP4 A;  1H0M A;  1N25 A;  2GIZ A;  2WV1 A;  4B4C A;  2MYS A;  1LEA A;  1S7E A;  1X1A A;  4E70 A;  1VI0 A;  1JGG A;  1QA6 A;  1U8B A;  1HDP A;  3HG9 A;  5L3C A;  3BLY A;  2IA2 A;  2HS5 A;  3R6S A;  5F1J A;  1MND A;  4M3D A;  3H1C A;  3NEU A;  2KZV A;  5L3B A;  1I27 A;  2NOJ B;  3JTH A;  5C3E J;  3FXO A;  5D4R A;  1IRZ A;  4DOZ A;  1W0T A;  2RNJ A;  1ON1 A;  1O57 A;  3WGG A;  1R5G A;  2HWV A;  2A5W A;  5HS7 A;  3L1P A;  2PG4 A;  1YYV A;  1R5H A;  1GLN A;  4UB8 C;  1XS9 A;  3CDI A;  3F72 A;  1UEL B;  4KN7 X;  2JSP A;  1T8I A;  3NQO A;  2KDO A;  4MGR A;  2A69 F;  1GUU A;  4BXU A;  1HSJ A;  1J7K A;  1WKM A;  2CQK A;  3AL0 C;  2K9L A;  4WF2 A;  3R0J A;  2WY8 Q;  2DOD A;  3ECO A;  1WJ5 A;  4M3E A;  5CVV A;  3CUQ B;  4D7N A;  4DQ2 A;  4AID A;  3QYE A;  1XCV A;  3G3Z A;  5JHF A;  3GFJ A;  2V9K A;  1V55 H;  2HXI A;  2RRE A;  2XC7 A;  3CC7 I;  3CLQ A;  2LFB A;  2CUJ A;  3D5R C;  3RSN A;  1ZRF A;  1F4K A;  3W6V A;  2IRF G;  2DA7 A;  4DIQ A;  5JVT A;  1UJ8 A;  2EA2 A;  3F8M A;  3FIS A;  1A6Q A;  2ISY A;  2OF7 A;  3KIO A;  3TL4 X;  2F48 A;  5DM7 F;  3C3W A;  5K5R A;  1VQ8 I;  5C4X J;  1AKH A;  3H35 A;  1XD7 A;  3NAR A;  2HYF A;  4KMU X;  2ZME B;  5LGN A;  1RR8 C;  4Y17 A;  4JOM A;  4HF2 A;  2X4H A;  3F3X A;  1STZ A;  4L5I A;  3TW6 A;  3OYJ A;  4N4N B;  2W84 A;  1F36 A;  2Z9O A;  4JBA A;  5L3D A;  4P1W A;  5CVU A;  3LSR A;  3BR3 A;  1HLV A;  1VQ4 I;  3K9T A;  2M1B A;  3IRQ A;  1OMI A;  2LSO A;  1OLT A;  1X3U A;  3BR6 A;  2R7F A;  4BHC A;  4L9N A;  4ZC3 A;  2CV0 A;  2HDC A;  1P4A A;  2Z5U A;  1MH4 A;  2CUE A;  3SZP A;  4RS8 A;  4XID A;  1IN4 A;  3CDH A;  5B1B H;  3Q3S A;  1G3S A;  5FRO A;  2QCO A;  4R8H A;  4LMY A;  5E1X A;  1G8X A;  1MJB A;  3PNT A;  4G12 A;  2NS8 A;  2W24 A;  2BXZ A;  4RB3 C;  1X1D A;  4UVA A;  2HXO A;  2XAF A;  2AQF A;  1IN5 A;  1WJE A;  3GF2 A;  2JQ7 A;  1YI2 I;  4LG0 B;  2J5O A;  3E7L A;  4KUM A;  3E5Q A;  2X0L A;  4BJ6 C;  4Y15 A;  2BY0 A;  3ZMV A;  1RES A;  2H09 A;  1IV8 A;  1VQ6 I;  2FE3 A;  2P6T A;  1X2M A;  1IDY A;  2V6C A;  2VPL A;  2KQR A;  2A07 F;  2VOP A;  1FSH A;  3H92 A;  2ISZ A;  1S3J A;  1TW2 A;  2CW0 F;  2P0W A;  4BQA A;  2L7Z A;  2PMH A;  2WAQ N;  2LF8 A;  2VT3 A;  3UKG A;  1VFC A;  3CCU I;  2M4G A;  3AL0 B;  4I99 C;  2LC2 A;  3ZOB A;  5M3M J;  5LFA A;  2L2O A;  3L00 A;  1E0E A;  1E2X A;  2LYC A;  1MBF A;  3DKW A;  3K7A J;  1IUF A;  1EH8 A;  3V7S A;  3VFZ A;  2RAE A;  2R92 J;  4U87 A;  2CQQ A;  2M5W A;  4BQQ A;  4NC6 A;  2LRE A;  4EJV A;  2FF4 A;  1YFH A;  2EZL A;  3H9G A;  1TT5 B;  3BCA A;  5LHH A;  1H8A C;  2DMQ A;  1ETQ A;  4YIR X;  2LRD A;  3S8P A;  2DA6 A;  2NS7 A;  4XRF A;  3O3K A;  1NK2 P;  2GLO A;  4BXF A;  3MKL A;  1BC7 C;  5D5X B;  2Y75 A;  2ZBK A;  5LEK A;  3CUQ A;  1T08 B;  3GLX A;  3ABL H;  3KCC A;  3KEQ A;  5H20 A;  4LLG F;  1BR1 A;  3VOE A;  3C1D A;  1RUO A;  1F9N A;  4XSZ F;  2XF5 A;  4AVZ A;  3ZQF A;  1I50 J;  1WI3 A;  2IW5 A;  2R7D A;  2AXT C;  4UXN A;  2W1O A;  4RGS A;  5H6Q A;  2XAH A;  3ASO H;  4XM3 A;  2NAZ A;  1B8I A;  2VPR A;  5LRS A;  2VJ5 A;  1IXC A;  3I4P A;  4XLE A;  3CCL I;  3CF5 F;  2ZME A;  4HNU A;  3CCQ I;  4Y3O A;  1LDD A;  3C7J A;  2CFO A;  3F8N A;  1V5F A;  3KPH A;  3SQN A;  5JLW A;  2C6Y A;  3M7G A;  2RGV A;  4RAF A;  4ZTJ A;  2O03 A;  2KIU A;  4A3C J;  4LGW A;  5L3E A;  2H8W A;  3GO5 A;  2VBY A;  1VTN C;  5FRN A;  2EA4 A;  4PK4 A;  1DP3 A;  2ECC A;  2CFX A;  2M0C A;  4LLL A;  4UHT A;  3EUA A;  4XLP F;  3W2W A;  1Y0U A;  2FXA A;  3BPX A;  1XC5 A;  2BV6 A;  3IRR A;  2WAD A;  4OIP F;  2IAI A;  1XN7 A;  1EF4 A;  3ASN H;  4PFO A;  2PJR B;  3OIP A;  4XN0 A;  3GVA A;  5GAH J;  4C2M J;  1AA7 A;  2DI3 A;  3P5J A;  3WOD F;  4EGY A;  4ZJZ A;  2XKO A;  2Z99 A;  3CES A;  4E4H A;  2KT0 A;  3DEE A;  5IP6 A;  1VQK I;  2IP2 A;  2CJJ A;  4U0V A;  1M1E B;  5ERI A;  1SD4 A;  2B7E A;  3BG9 A;  2RKH A;  3FWE A;  3I3L A;  4KDP A;  2PQ8 A;  2OCE A;  1IW7 F;  1EA3 A;  5E1Z B;  2H1K A;  4LFU A;  3FMQ A;  1D1A A;  1JHF A;  3HSR A;  4XRM A;  1X2N A;  1XMK A;  1D1C A;  4HLY A;  4XRS A;  2DYR H;  3I53 A;  5DUK A;  3RQI A;  2XPU A;  2PMU A;  3HB9 A;  4BY7 J;  3RCO A;  2L9V A;  1E3O C;  5DUI A;  5FLM J;  1XGS A;  2M45 A;  2MW8 A;  5E8I A;  1U5T C;  3PSF A;  2QSG X;  2PBI A;  2DA2 A;  2LKS A;  4U7D A;  3RKX A;  4MTD A;  1FLI A;  1TZL A;  4BQO A;  1UAA A;  3FXJ A;  2JSC A;  5CPR B;  2CO5 A;  3D0S A;  3HSE A;  1Z0X A;  4I98 B;  5TJJ A;  4KYW A;  2DDA A;  4XOR A;  2M2E A;  3F9K A;  2W00 A;  3F21 A;  1IUY A;  1Z21 A;  4WX9 A;  1MMA A;  3CCY A;  5J4Y A;  3S1R J;  2TCT A;  3DV8 A;  4BE0 A;  1UHS A;  2XRO A;  2ZFU A;  2RC4 A;  3KZY A;  3OYF A;  4YG2 F;  3GW2 A;  3QOD A;  5BS6 A;  4MQV A;  2JN6 A;  4A3F J;  1YHQ I;  4KMF A;  4LB6 B;  1HDD C;  3G1M A;  1WWX A;  1V4R A;  1D5Y A;  1BI1 A;  3G71 I;  1FJL A;  2BYV E;  2CG4 A;  5IOY A;  1GXQ A;  1FYM A;  3GBG A;  5ICF A;  1X4P A;  4HAM A;  5DV5 A;  5JI6 A;  3GYH X;  1W36 C;  2V79 A;  1JUS A;  2WA0 A;  4B47 A;  1WJD A;  1ZRC A;  4JQF A;  1XMA A;  3M07 A;  4IPA A;  2PFB A;  4ENK A;  1I6H J;  3HOS A;  3BTJ A;  4W1U A;  5DTD A;  5LEJ A;  2VOD A;  2M87 A;  1RNL A;  5HNH A;  2L7F P;  3CP8 A;  2K9S A;  2O9L A;  3BZC A;  3F6O A;  3A2K A;  2DJI A;  1R6R A;  1IXR C;  3M1E A;  2M34 A;  3QPT A;  1ZRD A;  1KA8 A;  5KVR A;  3D1N I;  3FXU A;  2ZSH B;  2EPF A;  2OA4 A;  2ETH A;  1EH7 A;  4HF0 A;  2IS6 A;  4AYB A;  5FD6 A;  3BZK A;  3MCZ A;  2E34 A;  2DXI A;  1POG A;  2WAF A;  5DYM A;  2LY2 A;  2EFQ A;  1CF7 B;  1V5G A;  4I2O A;  2QKM B;  1ETW A;  4HYE A;  3WTV C;  3OYE A;  3S15 J;  1MSE C;  1UST A;  1VQ9 I;  3LSI A;  2JUC A;  5ILS A;  1VQO I;  2PJR A;  2LOO A;  3IAM 2;  1UHW A;  2K9M A;  2XSJ C;  1SAN A;  4PSX A;  4A5M A;  1S7A A;  3CCV I;  2W57 A;  2NVY J;  2HVQ A;  1QNT A;  1Y1W J;  1D0Z A;  1WI9 A;  3IUO A;  3NWT A;  4MFD A;  2O8K A;  3O8H A;  3F8C A;  5J3L A;  3HOT A;  2Q2E B;  3NAU A;  2DMT A;  2R7S A;  4DYC A;  2GXB A;  1S5L C;  3I55 I;  1R71 A;  3ZQI A;  1JTY A;  3A1Y A;  5J8F A;  1XSV A;  3RQ4 A;  3SZT A;  2HOT A;  2QA4 I;  1ETK A;  1ZGW A;  4U7B A;  4B1R A;  4GO1 A;  5CJ9 A;  2HYJ A;  4HDU A;  2L7M P;  2H8R A;  2HTJ A;  3SFZ A;  2R7T A;  3HJE A;  3P9I A;  5C4J J;  5B5E C;  2CWE A;  5AIP A;  4BEH B;  3JAM Z;  1XGM A;  3CCM I;  4B3X A;  5F0H A;  2HQN A;  1Q1V A;  2FBH A;  2KP6 A;  3PQK A;  3LAP A;  2IS4 A;  1JT6 A;  2OV7 A;  2H6C A;  2ZKZ A;  2CW8 A;  1A36 A;  3I64 A;  5ILU A;  4IJA A;  5EEA A;  4EJT A;  4KN4 X;  3KEY A;  4QWQ A;  4LLN A;  4ZZL A;  3DEU A;  3PO2 J;  3RZD J;  5IY5 H;  4RAZ A;  2HKX A;  2XGC A;  2XV4 S;  3QP5 A;  2MLK A;  2O8X A;  3QPL A;  4PJN A;  2IGO A;  4C9Y A;  1Z6T A;  3S1Q J;  2Y30 A;  5E8G A;  3HOY J;  3OYD A;  3I58 A;  3O6B B;  1T98 A;  3G1L A;  1FSE A;  1T6S A;  1ZGA A;  4JP0 A;  4PFP A;  4IRI A;  9ANT A;  3E0J B;  2ELJ A;  3BR0 A;  2GAU A;  1DQU A;  2BBY A;  4G6Q A;  1C0W A;  2OQG A;  2PN6 A;  1YLF A;  4UVB A;  3VWB A;  2EK5 A;  4DNC A;  5K7F A;  3P9K A;  1PJR A;  3SZG A;  4A3I J;  3ZGK A;  2VOO A;  3IC7 A;  3HC7 A;  4K2E A;  2HYG D;  4NC7 A;  1WZ2 A;  1W5S A;  3L09 A;  2K3F A;  2OD5 A;  1G3W A;  3PFI A;  4IRH A;  1ETO A;  3ECH A;  3IH3 A;  3ZMT A;  5ICG A;  3A01 B;  3SYT A;  2Z16 A;  4BDY A;  3QPH A;  2Q0O A;  2JK3 A;  4B44 A;  3J81 Z;  1FOY A;  1YX3 A;  3HOU J;  1ULY A;  4XKC A;  1OCZ H;  2P6S A;  3LWF A;  3FBN B;  5F64 A;  1SVM A;  3T1B A;  1JT0 A;  1LFP A;  1J9I A;  2IA1 A;  3DTI A;  4G6D A;  5F0C A;  4Z2Y A;  5E3L A;  2VLA A;  1G59 A;  1KU2 A;  3BP8 A;  2DDB A;  1W36 D;  4OWR B;  1G3Y A;  4IO9 F;  4Y13 A;  2DW4 A;  2R7V A;  3KLO A;  2UUZ A;  4NQW B;  3KET A;  4CA0 A;  2OPT A;  5GAG J;  2P5L C;  3K10 A;  4IOC F;  4UNO A;  3AG3 H;  2PMZ N;  4M3G A;  3QU6 A;  2XPW A;  3HXL A;  2XSD C;  3H0G J;  3QU3 A;  1YW8 A;  4PZJ A;  2OAZ A;  4XSX F;  4RA2 A;  2COB A;  3QQA A;  2M0M A;  3QOP A;  4X0G A;  4IZZ A;  4IKF A;  4BYY A;  1TLH B;  4A3B J;  4PJ0 C;  2NVT J;  2E71 A;  1RZ4 A;  5IOZ A;  2K7L A;  1U5T A;  4E6K G;  2O6G E;  2V7F A;  5KAF C;  1YQA A;  3OYM A;  4FCY A;  2DFE A;  2V1X A;  4IRG A;  4E7I A;  2ID6 A;  4UUS A;  4IEJ A;  2BW3 A;  1IF1 A;  5BOX A;  2V6E A;  1BW5 A;  1JGS A;  2NVX J;  1BIB A;  1UFM A;  2O3F A;  5EZG A;  1SFX A;  4OAZ A;  1Z05 A;  2R4G A;  3G1O A;  3HOV J;  2L7K A;  3K2Z A;  3K4C A;  2JVH A;  3K1N A;  5ED4 A;  2MH9 A;  4HZF A;  4XLH A;  1B6A A;  2R7W A;  3CP2 A;  4ON0 A;  4ABZ A;  4DYR A;  2XRL A;  2NXN B;  4ZH4 F;  2TRT A;  2KJB A;  1BJZ A;  4IXA A;  2DBB A;  4V2G A;  3S1M J;  2A61 A;  2NVQ J;  1PDN C;  2XGX A;  2RVC A;  1Y1V J;  4IVN A;  3BR5 A;  3K4N A;  1ZGJ A;  2QUF A;  4EMS A;  4EM1 A;  2VQH A;  5E79 C;  2XRN A;  2FRH A;  2JA6 J;  2WV0 A;  1ZKG A;  3A4C A;  3CO7 C;  3HGG A;  2DOF A;  4PSW A;  4C3H J;  2JUG A;  5D5U B;  4PGG A;  4HX4 A;  1LUJ B;  3MMY B;  1U6G A;  2ZC2 A;  4GXO A;  4D5F A;  3BC8 A;  3JRB A;  2JA7 J;  3Q9S A;  3SDG A;  4LB5 A;  1K78 A;  2W25 A;  1JKP C;  4NHJ A;  4IQJ A;  1T38 A;  1DU0 A;  5BPD A;  3LSP A;  4NBQ A;  2L0K A;  5E18 F;  3U9G A;  1I6X A;  4Q47 A;  4GFB A;  1QVT A;  1MDM B;  5FLX Z;  1ZG5 A;  5HOD A;  4CSW A;  3DU6 A;  3A01 A;  3CUQ C;  2EFO A;  2QEN A;  3OYL A;  2CUZ A;  2F6C A;  2P5V A;  2UXN A;  2Y48 A;  1KU7 A;  3BTC A;  4OOI A;  3BCB A;  3VYU B;  2FNP A;  1LJ9 A;  1CGP A;  2VUM J;  2L9S A;  2ESH A;  4EQQ A;  4S0H B;  4EJW A;  2DTZ A;  2BE5 F;  4G7Z F;  2ECB A;  4FE4 A;  4YFN F;  1P7J A;  2Y9Z A;  3KEO A;  2QQB A;  3RKQ A;  2CRG A;  5HDK A;  4NQW A;  1BIA A;  3SFI A;  2BHZ A;  4I02 A;  1ZH5 A;  1JHH A;  2STT A;  2KPM A;  2JRM A;  2ZXH A;  1P2F A;  3LST A;  1ZAR A;  4KT5 C;  4CO8 A;  4FQG A;  2NS0 A;  2XAJ A;  4ZYE A;  1HW2 A;  2KFD A;  1SFE A;  2D1V A;  1G2H A;  1MD0 A;  2DFH A;  2IGN A;  1LVA A;  3C2B A;  2KIQ A;  5GTH C;  5FFZ A;  3EPZ A;  5GPA A;  3OIQ A;  2DAO A;  5DCM B;  3NRV A;  2L9N A;  4ZYG A;  2R0Q C;  5IT9 Z;  2V1U A;  2HDW A;  4YII A;  3VYS B;  3OYK A;  1IGN A;  2FA5 A;  1K4T A;  3LQQ A;  1GXP A;  1BI2 A;  1GVD A;  2ELH A;  2WAE A;  2Y0M A;  3K4K A;  4RGX A;  2EQR A;  2YR2 A;  4HOB A;  4YFX F;  1XGN A;  2F4O B;  1O3R A;  2ZNZ A;  1ZG3 A;  4U0W A;  2UZK A;  1J09 A;  1BL0 A;  1V3F A;  3SEZ A;  4ZYD A;  4II3 A;  4A0Y A;  1VQM I;  2X6W A;  3VB2 A;  1IV6 A;  3CF2 A;  3CC2 I;  1OCT C;  5CQG A;  4H4K C;  4HRI A;  1F1Z A;  2PMZ A;  5A2Q Z;  3CJQ B;  1DGW Y;  2HFH A;  1QGP A;  1HW1 A;  1A35 A;  2ZXW H;  3W6J B;  3TDZ C;  3PNV A;  3J81 K;  4HPQ A;  1PYV A;  3RYR A;  2ZJR F;  4I01 A;  3ZN0 A;  4AUX A;  2HPI A;  3I4N J;  2VC1 A;  2W48 A;  1QHG A;  2VI6 A;  1FP1 D;  2X1E A;  3A0H C;  4MFE A;  1SFK A;  2CU7 A;  3CCE I;  1Z9C A;  3M1C A;  4UVC A;  3GTK J;  1OYW A;  2CGP A;  1MBE A;  3DLL F;  1ACI A;  1R23 A;  2OCC H;  2BGC A;  3J7A Y;  4ENN A;  1GHC A;  1TL8 A;  1W7P B;  2BXY A;  1MDM A;  4CUG A;  3BY6 A;  2HI3 A;  4R79 A;  2ZB9 A;  4EM0 B;  2FBK A;  3DPT A;  4CCL A;  1ETY A;  3JRF A;  1ITY A;  2H94 A;  2PEX A;  2JT1 A;  3K2A A;  3R60 A;  4UB6 C;  3HL2 A;  1AHD P;  4ANJ A;  1ZEL A;  5FRM A;  1BW6 A;  2XAQ A;  1IRF A;  3IAS 2;  3VDX A;  3JRG A;  2DMP A;  4HG2 A;  3K70 C;  1JUM A;  3GME A;  3KZZ A;  5D5V B;  3W6K B;  1U8R A;  3RJP A;  2FMY A;  4BHB A;  3MN2 A;  5HLG A;  2LY9 A;  3D5S C;  1K6Y A;  5DCF A;  1Y6I A;  4QIW N;  2BEO A;  1KQ0 A;  1HKS A;  1QVU A;  1WCM J;  3MKZ A;  4YIF A;  4A0Z A;  3WU1 B;  2DTR A;  4X1E A;  1YIJ I;  2ZFW A;  2XVC A;  5K5O A;  1KQ8 A;  1OJL A;  2WBM A;  2LBF B;  5E17 F;  3GTQ J;  2DMU A;  5J1Y A;  2KRF A;  4XL9 A;  2EFN A;  3FBI B;  2VBX A;  3GTG J;  2HOE A;  4KIG A;  3FHN A;  3AG2 H;  2G7U A;  5KCM A;  2EZK A;  1ZAO A;  1BR4 A;  2E2J J;  2OTL I;  1HC8 A;  1NG7 A;  2LTP A;  2CV1 A;  4MLO A;  3VYR B;  2OUM A;  2FEZ A;  3LQR A;  2Z2S B;  2LH9 A;  2ZCW A;  1MMG A;  2M4K A;  4I7H A;  4LOC A;  4A3E J;  3WG9 A;  2ACJ A;  3ZP5 A;  1SVL A;  4ZDO A;  1AOY A;  1EKE A;  3ZQG A;  4XLF A;  2MD0 A;  3JW4 A;  3UR3 C;  5FLX K;  1DGR M;  5CYV A;  4EM2 A;  1GT0 C;  2ME0 A;  5DD4 A;  4AYB N;  5EEH A;  2HOA A;  5M3F J;  3O8G A;  3I59 B;  1VND A;  1MW7 A;  3E6D A;  1K61 A;  4Q48 A;  1P9Q C;  3DQV C;  4C30 A;  4F92 B;  1S72 I;  4P5O A;  1RC9 A;  1W0U A;  5M5X J;  4BE2 A;  3CCS I;  2RNG A;  3DU5 A;  3DPL C;  4BXX J;  4HBL A;  1WQ2 A;  4IOA F;  1W5C C;  2FD5 A;  3N97 A;  2Y0S N;  1H89 C;  4XK4 A;  3KYC B;  1U0J A;  3REO A;  1ODD A;  4CHU A;  1KU3 A;  1I1G A;  2ID3 A;  1W7P A;  1KON A;  2VQL A;  2FSW A;  5EEG A;  4JX5 A;  2ADU A;  3VOD A;  2KHM A;  1BOA A;  3CTA A;  3ULQ B;  2JPC A;  3DKX A;  4B09 A;  3V7R A;  4AWX B;  3J7Z I;  1TC3 C;  2GIV A;  3AFH A;  5BQT A;  4E7K A;  2N8G A;  3LA3 A;  3U21 A;  3ZQQ A;  3MFK A;  4IHT A;  3CJR B;  1R1T A;  3MVP A;  2FML A;  2EIJ H;  4EVI A;  3FDY A;  3CC4 I;  4J19 A;  1NTC A;  5IT9 K;  3CME I;  2HQ5 A;  5F27 A;  4IHV A;  2I5U A;  2RQQ A;  1B9N A;  3R0A A;  5K7H A;  3ZPL A;  3VEP A;  2VBW A;  2BHY A;  2L9R A;  2BY3 A;  3K1M A;  2JJ7 A;  3IL2 A;  1Y8Q B;  1JUP A;  2O0Y A;  4FET A;  3U1D A;  4A3K J;  1R4M B;  1FMV A;  1R36 A;  3S93 A;  2W7N A;  1YJN I;  2CUF A;  2BZT A;  2Q8K A;  1K4S A;  3FMR A;  1T95 A;  4I0B A;  2DYS H;  2JPB A;  4M3B A;  1X3Z B;  3OL4 A;  4TV7 A;  2B0L A;  5AIQ A;  5BMZ A;  3FXQ A;  5B66 C;  4WK8 F;  2M3A A;  3ZQ7 A;  4LG0 A;  2MC3 A;  2XAS A;  3NWS A;  5A2Q K;  2E1M B;  2GXG A;  3U1K A;  4CIC A;  3E6B A;  1ON2 A;  3RIR A;  5IYC J;  4GRI A;  1HCR A;  2AS5 F;  2E1N A;  4YRV A;  3K1P A;  1Z7L A;  3T8T A;  1BBY A;  3N4M A;  2Z1D A;  2F5C A;  3KFW X;  4A3L J;  1S6L A;  1B1B A;  2QWW A;  4ZDL A;  2YU3 A;  4BDZ A;  1GDT A;  5JVG F;  2VQG A;  2NOG A;  4XON A;  1MNE A;  3BWG A;  3DBL B;  2CSO A;  1USS A;  5IP9 J;  3F23 A;  1LNW A;  4M6V A;  3J80 Z;  2R7U A;  2LNB A;  2MSY A;  3OS2 A;  3HBL A;  3DF8 A;  1MBG A;  4XIC A;  4PJJ A;  1TW3 A;  1R00 A;  4AU7 A;  1YIO A;  4BS9 A;  3SXY A;  2FNA A;  1QZE A;  1OCO H;  2DA4 A;  2E36 A;  3HPH A;  5KNL A;  4BNC A;  4HF1 A;  1R1U A;  1P92 A;  3W2V A;  2X6Y A;  2HDD A;  2VKH A;  2OJE D;  3K4M A;  1FMW A;  3MD2 A;  1QPI A;  3V4G A;  5EJC A;  1OYI A;  3MQ0 A;  4HV5 A;  4OMZ A;  1XDU A;  2BVL A;  4UUV A;  5BNG A;  1YIT I;  1FEX A;  3C18 A;  1AU7 A;  2E5Z A;  3S3N A;  2G9W A;  3K6G A;  2IA0 A;  2QBY B;  3G73 A;  4RLQ A;  4GYG A;  1G6N A;  1XSD A;  1ZRE A;  1TQI A;  1ZYR F;  3LOC A;  3EET A;  1D3Y A;  2R7X A;  4QLC U;  1J2X A;  3N05 A;  3ABU A;  1FTZ A;  2V9P A;  4BGD A;  3FHZ A;  3E97 A;  1MMN A;  3PFY A;  4A5N A;  1T0F C;  4L5J A;  1JKR C;  4H0E A;  2BOL A;  3BQZ A;  1T33 A;  3GCM A;  4CZC A;  5FKM A;  3ELK A;  2IEK A;  3ZQH A;  3RPU D;  1G4D A;  2JTV A;  4XR6 A;  1YW9 A;  5JR3 A;  2VE8 A;  2LK2 A;  3ZMZ A;  2GWR A;  1BR2 A;  2M30 A;  1V54 H;  2EJR A;  3OS0 A;  4EAT A;  3TP0 A;  1R9T J;  2Z33 A;  1Z3Y A;  1XX5 A;  2KKO A;  3ERM A;  1WJF A;  2K4B A;  2EIL H;  3K69 A;  5J8C A;  1A04 A;  2G0E A;  2M8E A;  3H3U A;  5J6X A;  2Y0S A;  2HZD A;  5BPI A;  2KIF A;  3HYI A;  3KZI C;  3WTX C;  3GTO J;  4BQN A;  1EH6 A;  1TBX A;  2DA5 A;  4E7S A;  3SDB A;  4BHP A;  2FQ4 A;  2XPV A;  5H2F C;  4QTR A;  3TO6 A;  2KRH A;  3TW7 A;  2VIX A;  1OQY A;  1XB4 A;  5LLQ A;  4S05 A;  1LE8 B;  3JRE A;  4A0X A;  3S32 A;  1J75 A;  5D6F A;  4LK1 F;  2JZY A;  2WTE A;  3LFU A;  2HQA A;  3Q0W A;  1IZ1 A;  4L18 B;  3FKJ A;  5EF6 A;  1ORK A;  1L0O C;  5GPC A;  4HNT A;  2STW A;  3B6A A;  5CVI A;  1OFC X;  3LFK A;  1FP2 A;  3ZMS A;  1U2W A;  1OR7 A;  3TMO A;  5J4V A;  3IWZ A;  5FO5 A;  3RPU A;  3FZV A;  4E7Z A;  3ML6 A;  3LAJ A;  2YU9 J;  4V2F A;  1QPM A;  3KP2 A;  3BRO A;  1RUN A;  1XDS A;  3S16 J;  1XMX A;  2EIM H;  2GA1 A;  3ZQC A;  4ENJ A;  4JX6 A;  3ONQ A;  2EWN A;  2MGQ A;  3KP4 A;  1ZG1 A;  1H88 C;  1VZ0 A;  1B9M A;  5TRD A;  1BOB A;  4IHY A;  1YRN B;  2MC4 A;  3HZJ A;  4FX4 A;  2G7H A;  2HEO A;  4BAC A;  2DOA A;  1YOV B;  1U9O A;  1X4O A;  1IN8 A;  5D8K B;  1MBH A;  2B9S A;  3RZO J;  1D0Y A;  3D5L A;  3RPQ A;  4BUP A;  1A31 A;  3BR2 A;  1KQ9 A;  4V19 K;  1FTT A;  3OR2 C;  4PJM A;  2LKP A;  1HBX G;  3HKZ A;  1BN5 A;  2L4M A;  5TGT A;  3UNG C;  5H6R A;  4KFC A;  2EB7 A;  1IG7 A;  3GWZ A;  1YJ9 I;  3RYP A;  2JA2 A;  3WTW C;  3GFM A;  3TBI A;  1T2K A;  1SC7 A;  2E1C A;  1WPK A;  1FX7 A;  1R58 A;  3OOU A;  1W4M A;  2XF6 A;  3IH4 A;  3WTT C;  1TWC J;  3O2P E;  3TO7 A;  4NB5 A;  4II2 A;  5E1W A;  3VSK A;  4XOP A;  1VQ5 I;  5DDG A;  1X19 A;  4RGU A;  4U0Y A;  2KIS A;  5F1R A;  1CF7 A;  1JKO C;  1D8J A;  5J40 A;  4LIV A;  1HOM A;  3J80 K;  1T56 A;  2VQC A;  4I6Z A;  3OV8 A;  1RRJ A;  3MEX A;  3BQY A;  2DK5 A;  3ZMU A;  3GLL A;  4WXD A;  1ONV A;  3S2W A;  2MLG A;  2WWY A;  3GTP J;  1Z6R A;  2Q2E A;  3B02 A;  2FQ3 A;  5EYR A;  2OQR A;  1IN7 A;  5TIS C;  4A2U A;  3I4M J;  1JTX A;  3DTK A;  3MZ8 A;  1FIA A;  3FF5 A;  3JSO A;  1B72 B;  4M3F A;  3E5U A;  3TDU C;  3DEW A;  4HDV A;  2JVG A;  4D7M A;  1PUF B;  4L9V A;  3HOZ J;  2Q1Z B;  3LSM A;  2XAU A;  2KRC A;  3M4O J;  1QRY A;  3TKY A;  5IP7 J;  1NH3 A;  5K1Y A;  1LE8 A;  2FBI A;  3OL3 A;  4NC8 A;  2L01 A;  2H1L A;  2QKL B;  3JRA A;  2DJN A;  2LMD A;  1O3Q A;  1QO0 D;  3IWF A;  4BEH A;  3E5X A;  2DLL A;  4HW0 A;  1SMT A;  1FNN A;  1I39 A;  3TED A;  4BU2 A;  2X48 A;  4IQ4 A;  2OZ6 A;  2OU2 A;  2L5Q A;  3DKY A;  3F0C A;  5ICE A;  1MSF C;  1ZHF A;  5HS8 A;  4XKW A;  3G2B A;  1HST A;  3EDP A;  2R7Q A;  2DFF A;  2X6X A;  5HLT A;  2RN7 A;  3HSF A;  3ZQL A;  4OIO F;  1N78 A;  4DYQ A;  4L5E A;  4E7J A;  2WB1 A;  3HPG A;  4M6X A;  4F55 A;  5FB2 A;  2R5Z B;  2VL8 A;  2PLY A;  4UUT A;  1ENH A;  3QP6 A;  1LQ1 A;  1HW5 A;  3DFG A;  4DBR A;  4PGH A;  2LDU A;  4G7H F;  3OYG A;  4M9Z A;  2PJP A;  2K9N A;  3DCF A;  2MAB A;  3F22 A;  2F5F A;  3K4L A;  3WE3 A;  4BJ5 C;  1T0F A;  4F3Q A;  2X1C A;  4CCO A;  3AKZ A;  3IP4 B;  1MZB A;  4C3I J;  2P5K A;  4O5V A;  2LF7 A;  3V42 A;  1YRN A;  1KU9 A;  2CH0 A;  5IPA A;  4AVP A;  2A68 F;  4LK0 F;  4M72 A;  2CQN A;  2QF7 A;  4GYI A;  4FTH A;  4M71 A;  2HTS A;  2DO7 A;  4ESJ A;  1D5V A;  4IHW A;  1REP C;  3RI4 A;  2QLZ A;  3LA2 A;  2NRA C;  1E3P A;  2D2W A;  3ZN1 A;  5HOO A;  1VQ7 I;  2R3S A;  2KJC A;  1DU6 A;  1MBJ A;  2O7O A;  2DPD A;  1MKM A;  1JJ6 C;  1I1S A;  1JI8 A;  3KYL A;  3FXL A;  3JCU C;  4B48 A;  3H3V K;  3IHU A;  3DBH B;  2ZNY A;  3K0L A;  4WCG A;  2YSR A;  2KMU A;  5D4S A;  4F91 B;  1AKH B;  3H5A A;  5FFX A;  3ESW B;  1WRJ A;  1ZR4 A;  2VKV A;  3IV5 A;  2FJ1 A;  3AG4 H;  4LIT A;  5M5W J;  3GUD A;  4A93 J;  2K3P A;  3S1N J;  4ZDP A;  3V8J A;  1FYK A;  2QSF X;  3VSL A;  3GEZ A;  3CJN A;  4FHT A;  3CJT B;  4EJO A;  1CQT A;  2A5Y B;  4L0Y B;  4S04 A;  3I0T A;  4HV6 A;  5AON A;  3B6C A;  4RMN A;  2IGK A;  3W2A A;  2F4M B;  2NNY A;  2E19 A;  3HRM A;  1B72 A;  1S7O A;  1IXS B;  1HA8 A;  3Q0V A;  3QYB A;  4FAS D;  2M8G X;  2AO9 A;  1OIS A;  2ZSI B;  1YX5 A;  5EG0 B;  4HLX A;  1HF0 A;  2Y9Y A;  3KE2 A;  3FM5 A;  2IVM A;  2HOS A;  3FXR A;  3L2C A;  3CD6 I;  3GTL J;  3WHC A;  4CDG A;  1KGS A;  2LY1 A;  5ILV A;  1YO5 C;  3BPV A;  4MHG A;  2FU4 A;  3E6M A;  2L3D A;  2PX9 A;  4ZZD A;  4J00 A;  2OC6 A;  5LRR A;  1TQP A;  4Y4R A;  2OBP A;  3DBR B;  4A69 C;  2CYY A;  4D9J A;  3L2R A;  1UMQ A;  4IF4 A;  5ICC A;  3GZN B;  4A3M J;  2EBI A;  1Z77 A;  2GOX B;  2VB6 A;  2F2E A;  2MBF A;  1U9N A;  2BY2 A;  4UV8 A;  3L2U A;  4G94 A;  2R5Z A;  3BG5 A;  1OCP A;  3BTI A;  4HA8 A;  5FLV A;  4BBS J;  2EH3 A;  4WXH A;  2H27 A;  3S2H J;  3DXJ F;  3FM3 A;  1KZH A;  3H3Z A;  1WH5 A;  1FT9 A;  1Y0N A;  2X51 A;  4F7Z A;  1U78 A;  1FYL A;  4DBQ A;  4XBF A;  2IGM A;  1R5I D;  3CZ6 A;  3PIO F;  1TT0 A;  2IJL A;  1TNS A;  1YE9 A;  2NVU B;  2ZJQ F;  5B3S H;  3CCJ I;  1VQL I;  4KIT B;  1UCR A;  4KJZ A;  1WH7 A;  1SAU A;  3OMY A;  3L2Q A;  5E3M A;  3LSH A;  1TWA J;  3P7N A;  4P9F A;  1ZR2 A;  1GV5 A;  4O6J A;  2LVS A;  3S3O A;  3WE2 A;  3JRI A;  1MNM C;  3I71 A;  2XB0 X;  3HUG B; 
#chains in the Genus database with same CATH homology
 2P7V B;  1DPR A;  5DEQ A;  3QRF F;  3WTU C;  4ASN A;  4MTE A;  1LDK B;  3WU0 A;  1BJA A;  3R4K A;  1Q1H A;  2KIM A;  2QM3 A;  4EGZ A;  1QQI A;  1S8N A;  1O3T A;  1BC8 C;  5HDG A;  3BOQ A;  2IT0 A;  1W7P D;  5LHI A;  1FBS A;  3GZ6 A;  5HDN A;  1SD6 A;  2F5D A;  5LBQ A;  1PUE E;  5DCM A;  3M9A A;  3HRU A;  3KP5 A;  2H6B A;  2YX7 A;  5D5W B;  2QQA A;  3TOB A;  1K6O A;  3T0Y A;  1D8K A;  3TO9 A;  4AIK A;  4RB0 A;  2EFP A;  3ZMD A;  1MJA A;  4HQM A;  2J5P A;  3LA7 A;  4AD9 A;  4YFK F;  4G7O F;  3BJ6 A;  4M9S A;  2K4J A;  4N0B A;  3WGH A;  4MEY F;  4O3M A;  1O7L A;  5HLH A;  5E20 A;  1LDJ A;  1S29 A;  2DU9 A;  5HS9 A;  1NHA A;  1HQC A;  4HQE A;  2E7W A;  1RIO H;  3HHH A;  3L9F A;  1L3L A;  1SD5 A;  3CLO A;  5F6F A;  1XCB A;  1SFU A;  2ZJ2 A;  3T5X A;  1O3S A;  3KLN A;  2W85 A;  1RI7 A;  4M9X A;  2DK8 A;  3HRT A;  3Q5F A;  4M6Y A;  4M74 A;  3GFI A;  3HUG A;  1JXS A;  3KP6 A;  4OIN F;  3IKT A;  4R1H A;  4PCQ A;  3T8R A;  5IT3 A;  5DD8 A;  3JTG A;  2L4A A;  2D45 A;  1ZN2 A;  3V8K A;  3WTZ A;  3V7C A;  2AXL A;  2VBZ A;  1F5T A;  1FC3 A;  1DDN A;  3R61 A;  5LGT A;  1T39 A;  3ABT A;  4WWC A;  4IHS A;  2HZT A;  3KP3 A;  2TDX A;  3IKV A;  4MEX F;  2DT5 A;  3QAH A;  1DP7 P;  4JK1 X;  1FBU A;  1K7A A;  1HXD A;  1DPU A;  3GZ5 A;  1XGO A;  1IAW A;  1R1V A;  4BH9 A;  4P9U A;  3AAF A;  3P9C A;  1H9T A;  3TGN A;  3WTY C;  2GZW A;  2VXZ A;  1LEB A;  5L3G A;  6PAX A;  1AWC A;  2XIG A;  1DUX C;  2HQR A;  1E17 A;  1YTY A;  1SAX A;  5D6E A;  2EV0 A;  3HTS B;  2K27 A;  1Z91 A;  3I59 A;  4A6E A;  3SHF A;  1QZY A;  3BJA A;  4MQ9 F;  2OZU A;  1P4W A;  2O61 A;  1Z7U A;  4RB2 C;  3TQN A;  3J7A O;  3JSP A;  2L02 A;  4KNY A;  1GVJ A;  1MJ9 A;  3ERE D;  4GGG A;  1P4X A;  3M8F A;  1BI3 A;  2HGC A;  1QBJ A;  5CVR A;  1SD7 A;  4ETS A;  2WC2 A;  3V8L A;  4D0P A;  4RAY A;  1FZP B;  2RQP A;  2VON A;  2P8T A;  4HX7 A;  4KA4 A;  4ESB A;  2ESN A;  2YPR A;  1ZLJ A;  3OOP A;  3EQL F;  2FOK A;  2XAG A;  4L9T A;  4EJU A;  3M8E A;  2P7C B;  2XUB A;  4CXF A;  3RDI A;  3BZ6 A;  4I0A A;  2K02 A;  2L54 A;  5CLS A;  3HHG A;  4A12 A;  3MAJ A;  3BJO A;  1PP7 U;  4ENM A;  1J59 A;  2COM A;  1G3T A;  2VN2 A;  2UWM A;  3MWM A;  4OMY A;  3E3V A;  3HTU A;  4I09 A;  1B59 A;  2V9V A;  4CYD A;  3WGI A;  1YS6 A;  3WTS C;  3GXO A;  4ESF A;  1U5T B;  3I54 A;  2QQ9 A;  2GQQ A;  2QYO A;  4GCV A;  2PI0 A;  2JRT A;  4Q4Z F;  2P4W A;  4P55 A;  1IRG A;  3CUO A;  4KIF A;  4MNU A;  1EV7 A;  1J0R A;  2QVO A;  3L7W A;  2MD5 A;  2K86 A;  4LJZ F;  5JFR A;  4EV0 A;  4AIJ A;  4L0Z B;  1FBQ A;  4UV9 A;  3HIF A;  1KYW A;  3F8F A;  2QBY A;  3PQJ A;  4G9Y A;  1R7J A;  2MH2 A;  2HR3 A;  1K79 A;  2EV5 A;  2NYX A;  2DPU A;  4CZZ A;  2QZ8 A;  2VT2 A;  1K78 B;  2XKP A;  1XSX A;  2EV6 A;  1H9G A;  1PP8 F;  1YW7 A;  3KP7 A;  4BAY A;  4AIH A;  3CO6 C;  2DQR A;  1YG2 A;  1U3E M;  3GX4 X;  1O7F A;  1FY7 A;  3EYI A;  2MA3 A;  4WXC A;  5D8L B;  1BI0 A;  1P6R A;  2E7X A;  4KIC A;  4RB1 A;  3HRS A;  3ISP A;  2ZXJ A;  1IN6 A;  5JHU A;  2ZO4 A;  2YX4 A;  1ZLK A;  3FMS A;  2DQL A;  4XLN F;  4CGZ A;  2Z3Y A;  2A3S A;  1B4A A;  4L9J A;  2RDP A;  1HKQ A;  3DP7 A;  1I5Z A;  1OKR A;  2HKO A;  4FX0 A;  3COA C;  1J5Y A;  3EYY A;  5CVJ A;  4A6D A;  4RGR A;  5LHG A;  2DFI A;  1JE8 A;  1LB2 A;  3MZY A;  1UB9 A;  3RKY A;  3GFL A;  4P96 A;  4OU0 A;  1FPQ A;  1QZZ A;  3F8B A;  4B8X A;  2D1H A;  3RKW A;  4KIB A;  5HVQ C;  4U88 A;  2EFW A;  2VC0 A;  3U2R A;  2VE9 A;  2V1D A;  2IPQ X;  4Q5S F;  4M73 A;  4ZYH A;  2RV8 A;  5HLI A;  1WSU A;  1OPC A;  4PDK A;  5FGM A;  1MGT A;  4OIR F;  3BDD A;  4LD5 A;  5K5Q A;  1FOK A;  1R22 A;  5LGU A;  1TNT A;  1TQM A;  2XHK A;  2GA2 A;  3EUH A;  5L3F A;  1HKT A;  3I5U A;  1OYY A;  3Q9V A;  5FD5 A;  4FT8 A;  1Z1D A;  3TOA A;  3FX3 A;  2A6E F;  3B73 A;  3RTR A;  4N9H A;  4OIQ F;  1KYZ A;  1TTY A;  4G8X A;  3JAM K;  3MZH A;  3ROU A;  1UHM A;  1YS7 A;  3E6C C;  2A6H F;  1SMY F;  2F5E A;  1BM9 A;  1FWZ A;  5KK1 A;  4N9I A;  2NNN A;  2UXX A;  3F6V A;  1W5T A;  4HX8 A;  1H0M A;  1LEA A;  4E70 A;  5L3C A;  2IA2 A;  2HS5 A;  3R6S A;  3NEU A;  5L3B A;  1I27 A;  3JTH A;  5D4R A;  2RNJ A;  1ON1 A;  1O57 A;  3WGG A;  1R5G A;  2HWV A;  5HS7 A;  2PG4 A;  1YYV A;  1R5H A;  3F72 A;  4KN7 X;  3NQO A;  4MGR A;  2A69 F;  4BXU A;  1HSJ A;  1J7K A;  1WKM A;  2CQK A;  4WF2 A;  3R0J A;  3ECO A;  5CVV A;  3CUQ B;  4DQ2 A;  1XCV A;  3G3Z A;  3GFJ A;  1ZRF A;  1F4K A;  2IRF G;  5JVT A;  2EA2 A;  3F8M A;  2ISY A;  3C3W A;  5K5R A;  1XD7 A;  2HYF A;  4KMU X;  2ZME B;  5LGN A;  4Y17 A;  4HF2 A;  2X4H A;  3F3X A;  1STZ A;  4L5I A;  2W84 A;  2Z9O A;  4JBA A;  5L3D A;  5CVU A;  3K9T A;  2M1B A;  3IRQ A;  1OMI A;  2LSO A;  1X3U A;  2R7F A;  4BHC A;  4L9N A;  2HDC A;  1P4A A;  2Z5U A;  3SZP A;  4RS8 A;  1IN4 A;  3CDH A;  1G3S A;  4R8H A;  4LMY A;  5E1X A;  1MJB A;  2W24 A;  4RB3 C;  4UVA A;  2XAF A;  1IN5 A;  3GF2 A;  4LG0 B;  2J5O A;  4KUM A;  3E5Q A;  2X0L A;  4Y15 A;  3ZMV A;  2H09 A;  2FE3 A;  2P6T A;  2V6C A;  2A07 F;  2VOP A;  1FSH A;  3H92 A;  2ISZ A;  1S3J A;  1TW2 A;  2CW0 F;  4BQA A;  2PMH A;  2LF8 A;  2VT3 A;  3L00 A;  1E2X A;  3DKW A;  1EH8 A;  3V7S A;  3VFZ A;  2M5W A;  4EJV A;  2FF4 A;  1YFH A;  5LHH A;  4XRF A;  3O3K A;  1BC7 C;  5D5X B;  2Y75 A;  2ZBK A;  5LEK A;  3CUQ A;  3GLX A;  3KEQ A;  3KCC A;  5H20 A;  4LLG F;  3VOE A;  3C1D A;  1RUO A;  1F9N A;  4XSZ F;  2IW5 A;  2R7D A;  4UXN A;  4RGS A;  5H6Q A;  2XAH A;  2NAZ A;  5LRS A;  1IXC A;  3I4P A;  2ZME A;  1LDD A;  3C7J A;  3F8N A;  3SQN A;  2C6Y A;  3M7G A;  2RGV A;  2O03 A;  2KIU A;  4LGW A;  5L3E A;  3GO5 A;  2VBY A;  1VTN C;  2EA4 A;  2CFX A;  4LLL A;  4UHT A;  4XLP F;  1Y0U A;  2FXA A;  3BPX A;  3IRR A;  2BV6 A;  4OIP F;  1XN7 A;  3GVA A;  2DI3 A;  3WOD F;  4EGY A;  2XKO A;  2Z99 A;  2IP2 A;  4U0V A;  5ERI A;  1SD4 A;  2RKH A;  3FWE A;  4KDP A;  2PQ8 A;  1IW7 F;  5E1Z B;  4LFU A;  3FMQ A;  1JHF A;  3HSR A;  1XMK A;  4HLY A;  3I53 A;  5DUK A;  2PMU A;  5DUI A;  1XGS A;  2M45 A;  5E8I A;  1U5T C;  2PBI A;  4U7D A;  3RKX A;  4MTD A;  1FLI A;  2JSC A;  2CO5 A;  3D0S A;  3HSE A;  4I98 B;  5TJJ A;  4KYW A;  3F21 A;  1IUY A;  4WX9 A;  3DV8 A;  2XRO A;  2RC4 A;  3KZY A;  4YG2 F;  3GW2 A;  5BS6 A;  4MQV A;  4KMF A;  4LB6 B;  1WWX A;  1V4R A;  1BI1 A;  2BYV E;  2CG4 A;  1GXQ A;  1FYM A;  5ICF A;  4HAM A;  5DV5 A;  5JI6 A;  3GYH X;  2V79 A;  1ZRC A;  4JQF A;  1XMA A;  4IPA A;  2PFB A;  4ENK A;  3HOS A;  5LEJ A;  2VOD A;  2M87 A;  1RNL A;  3F6O A;  3M1E A;  1ZRD A;  1IXR C;  3QPT A;  1KA8 A;  5KVR A;  3FXU A;  2OA4 A;  2ETH A;  1EH7 A;  4HF0 A;  5FD6 A;  3MCZ A;  5DYM A;  2EFQ A;  1CF7 B;  4I2O A;  4HYE A;  3WTV C;  1UST A;  5ILS A;  1UHW A;  4A5M A;  1S7A A;  2W57 A;  1QNT A;  1WI9 A;  3F8C A;  3HOT A;  2GXB A;  5J8F A;  1XSV A;  3SZT A;  4U7B A;  4GO1 A;  5CJ9 A;  4HDU A;  2HTJ A;  3SFZ A;  3P9I A;  2CWE A;  5AIP A;  3JAM Z;  1XGM A;  2HQN A;  2FBH A;  3LAP A;  3PQK A;  2ZKZ A;  2H6C A;  3I64 A;  5ILU A;  4IJA A;  4EJT A;  4KN4 X;  4QWQ A;  4LLN A;  4ZZL A;  3DEU A;  4RAZ A;  2HKX A;  2XV4 S;  3QP5 A;  2MLK A;  2O8X A;  1Z6T A;  5E8G A;  3I58 A;  3O6B B;  1T98 A;  1FSE A;  1T6S A;  1ZGA A;  4IRI A;  2GAU A;  2BBY A;  4G6Q A;  1C0W A;  2OQG A;  2PN6 A;  1YLF A;  4UVB A;  2EK5 A;  4DNC A;  3P9K A;  2VOO A;  3IC7 A;  4K2E A;  2HYG D;  1W5S A;  3L09 A;  2OD5 A;  3PFI A;  1G3W A;  4IRH A;  3ECH A;  3ZMT A;  5ICG A;  3QPH A;  2Q0O A;  3J81 Z;  1ULY A;  2P6S A;  3LWF A;  5F64 A;  3T1B A;  1J9I A;  2IA1 A;  4G6D A;  4Z2Y A;  1KU2 A;  3BP8 A;  1G3Y A;  4Y13 A;  2DW4 A;  3KLO A;  3KET A;  2P5L C;  4UNO A;  3QU6 A;  3QU3 A;  1YW8 A;  4PZJ A;  2OAZ A;  4XSX F;  3QOP A;  4BYY A;  1TLH B;  1RZ4 A;  2K7L A;  1U5T A;  2O6G E;  1YQA A;  2V1X A;  4IRG A;  1IF1 A;  5BOX A;  1JGS A;  1BIB A;  1UFM A;  2O3F A;  1SFX A;  1Z05 A;  3K2Z A;  3K1N A;  5ED4 A;  2MH9 A;  4HZF A;  1B6A A;  4ON0 A;  4ZH4 F;  2KJB A;  4IXA A;  2DBB A;  2A61 A;  1PDN C;  2XGX A;  2RVC A;  4IVN A;  1ZGJ A;  2QUF A;  4EMS A;  4EM1 A;  2XRN A;  2FRH A;  2WV0 A;  3CO7 C;  5D5U B;  4PGG A;  4HX4 A;  1U6G A;  4GXO A;  3Q9S A;  4LB5 A;  1K78 A;  2W25 A;  4NHJ A;  1T38 A;  5BPD A;  5E18 F;  3U9G A;  1I6X A;  4Q47 A;  1MDM B;  5FLX Z;  1ZG5 A;  3CUQ C;  2EFO A;  2QEN A;  2P5V A;  2UXN A;  2Y48 A;  1KU7 A;  4OOI A;  2FNP A;  1LJ9 A;  1CGP A;  2ESH A;  4EQQ A;  4EJW A;  2BE5 F;  4G7Z F;  4YFN F;  3KEO A;  2QQB A;  5HDK A;  4NQW A;  1BIA A;  4I02 A;  1ZH5 A;  1JHH A;  2STT A;  1P2F A;  3LST A;  1ZAR A;  4KT5 C;  4CO8 A;  2NS0 A;  2XAJ A;  4ZYE A;  1HW2 A;  1SFE A;  2D1V A;  1MD0 A;  1LVA A;  5FFZ A;  5DCM B;  2DAO A;  3NRV A;  4ZYG A;  5IT9 Z;  2V1U A;  4YII A;  2FA5 A;  3LQQ A;  1GXP A;  1BI2 A;  2ELH A;  2Y0M A;  4RGX A;  2YR2 A;  4HOB A;  4YFX F;  1XGN A;  1O3R A;  2ZNZ A;  1ZG3 A;  4U0W A;  2UZK A;  1V3F A;  4ZYD A;  4A0Y A;  3VB2 A;  1F1Z A;  5A2Q Z;  2HFH A;  1QGP A;  1HW1 A;  3W6J B;  3TDZ C;  3J81 K;  3RYR A;  4I01 A;  3ZN0 A;  2VC1 A;  1FP1 D;  1Z9C A;  4UVC A;  1OYW A;  2CGP A;  1R23 A;  2BGC A;  4ENN A;  1GHC A;  1W7P B;  1MDM A;  3BY6 A;  4R79 A;  4EM0 B;  2FBK A;  3DPT A;  2H94 A;  2PEX A;  2JT1 A;  3R60 A;  2XAQ A;  1IRF A;  3KZZ A;  5D5V B;  3W6K B;  1U8R A;  3RJP A;  2FMY A;  4BHB A;  5HLG A;  5DCF A;  2BEO A;  1KQ0 A;  1HKS A;  4YIF A;  4A0Z A;  3WU1 B;  2DTR A;  2ZFW A;  2XVC A;  5K5O A;  1KQ8 A;  5E17 F;  2KRF A;  2EFN A;  2VBX A;  2HOE A;  4KIG A;  2G7U A;  1ZAO A;  2FEZ A;  3LQR A;  2ZCW A;  4I7H A;  3WG9 A;  2ACJ A;  3ZP5 A;  1AOY A;  3JW4 A;  5FLX K;  5CYV A;  4EM2 A;  5DD4 A;  5EEH A;  3I59 B;  3E6D A;  4Q48 A;  3DQV C;  4P5O A;  3DPL C;  4HBL A;  1WQ2 A;  3N97 A;  3REO A;  1ODD A;  4CHU A;  1KU3 A;  1I1G A;  1W7P A;  2FSW A;  5EEG A;  2ADU A;  3VOD A;  1BOA A;  3CTA A;  3ULQ B;  2JPC A;  4B09 A;  3V7R A;  4AWX B;  2GIV A;  5BQT A;  3LA3 A;  3MFK A;  4IHT A;  1R1T A;  2FML A;  4EVI A;  5IT9 K;  1B9N A;  3R0A A;  3ZPL A;  3VEP A;  2VBW A;  3K1M A;  3IL2 A;  2O0Y A;  3U1D A;  1R36 A;  2Q8K A;  3FMR A;  4I0B A;  2JPB A;  4TV7 A;  2B0L A;  5AIQ A;  5BMZ A;  3FXQ A;  4WK8 F;  3ZQ7 A;  4LG0 A;  2MC3 A;  2XAS A;  5A2Q K;  2GXG A;  4CIC A;  3E6B A;  1ON2 A;  3RIR A;  2AS5 F;  2E1N A;  3K1P A;  3T8T A;  1BBY A;  3N4M A;  2F5C A;  3KFW X;  1S6L A;  1B1B A;  2QWW A;  2YU3 A;  3BWG A;  2CSO A;  1USS A;  3F23 A;  1LNW A;  3J80 Z;  2LNB A;  3DF8 A;  1TW3 A;  1R00 A;  1YIO A;  3SXY A;  2FNA A;  4BNC A;  4HF1 A;  1R1U A;  1P92 A;  3V4G A;  1OYI A;  3MQ0 A;  4HV5 A;  4OMZ A;  1XDU A;  4UUV A;  3C18 A;  2G9W A;  2IA0 A;  2QBY B;  3G73 A;  4GYG A;  1G6N A;  1XSD A;  1ZRE A;  1TQI A;  1ZYR F;  3EET A;  1D3Y A;  4QLC U;  1J2X A;  3ABU A;  3FHZ A;  3E97 A;  4A5N A;  4L5J A;  4H0E A;  3ELK A;  1G4D A;  2JTV A;  1YW9 A;  5JR3 A;  2VE8 A;  3ZMZ A;  2GWR A;  2M30 A;  2EJR A;  2Z33 A;  2KKO A;  2K4B A;  3K69 A;  5J8C A;  1A04 A;  2M8E A;  3H3U A;  5J6X A;  5BPI A;  2KIF A;  3HYI A;  3WTX C;  1EH6 A;  1TBX A;  4BHP A;  3TO6 A;  1XB4 A;  5LLQ A;  4S05 A;  4A0X A;  1J75 A;  5D6F A;  4LK1 F;  2JZY A;  2WTE A;  1IZ1 A;  4L18 B;  1L0O C;  2STW A;  5CVI A;  3LFK A;  1FP2 A;  3ZMS A;  1U2W A;  1OR7 A;  3IWZ A;  5FO5 A;  3RPU A;  3FZV A;  3ML6 A;  3LAJ A;  1QPM A;  3KP2 A;  3BRO A;  1RUN A;  1XDS A;  2GA1 A;  4ENJ A;  2EWN A;  3KP4 A;  1ZG1 A;  1B9M A;  5TRD A;  4FX4 A;  2G7H A;  2HEO A;  1IN8 A;  5D8K B;  3D5L A;  3RPQ A;  1KQ9 A;  2LKP A;  1HBX G;  1BN5 A;  2L4M A;  5H6R A;  4KFC A;  2EB7 A;  3GWZ A;  3RYP A;  3WTW C;  3GFM A;  1T2K A;  2E1C A;  1FX7 A;  1R58 A;  1W4M A;  3WTT C;  3O2P E;  3TO7 A;  4NB5 A;  5E1W A;  5DDG A;  4RGU A;  4U0Y A;  5F1R A;  1CF7 A;  1D8J A;  3J80 K;  3OV8 A;  3MEX A;  2DK5 A;  3ZMU A;  4WXD A;  1ONV A;  3S2W A;  2MLG A;  2WWY A;  1Z6R A;  2Q2E A;  3B02 A;  2FQ3 A;  2OQR A;  1IN7 A;  4A2U A;  3FF5 A;  3JSO A;  3E5U A;  3TDU C;  4HDV A;  4L9V A;  3TKY A;  5K1Y A;  2FBI A;  2L01 A;  1O3Q A;  1QO0 D;  3IWF A;  3E5X A;  2DLL A;  4HW0 A;  1SMT A;  1FNN A;  2OZ6 A;  2OU2 A;  5ICE A;  1ZHF A;  5HS8 A;  1HST A;  3EDP A;  2RN7 A;  3HSF A;  4OIO F;  4M6X A;  5FB2 A;  2PLY A;  3QP6 A;  1LQ1 A;  1HW5 A;  3DFG A;  4PGH A;  2LDU A;  4G7H F;  4M9Z A;  2PJP A;  3F22 A;  2F5F A;  3WE3 A;  1T0F A;  1MZB A;  2P5K A;  4O5V A;  2LF7 A;  1KU9 A;  4AVP A;  2A68 F;  4LK0 F;  4M72 A;  4GYI A;  4M71 A;  2HTS A;  2DO7 A;  4ESJ A;  1D5V A;  1REP C;  3RI4 A;  2QLZ A;  3LA2 A;  2NRA C;  2D2W A;  3ZN1 A;  5HOO A;  2R3S A;  2KJC A;  2DPD A;  1MKM A;  1I1S A;  3IHU A;  2ZNY A;  3K0L A;  4WCG A;  2YSR A;  5D4S A;  5FFX A;  1WRJ A;  3GUD A;  3V8J A;  1FYK A;  3GEZ A;  3CJN A;  4FHT A;  4EJO A;  2A5Y B;  4L0Y B;  4S04 A;  3I0T A;  4HV6 A;  5AON A;  2NNY A;  3HRM A;  1S7O A;  1IXS B;  4HLX A;  3KE2 A;  3FM5 A;  2IVM A;  3FXR A;  3L2C A;  4CDG A;  1KGS A;  5ILV A;  1YO5 C;  3BPV A;  4MHG A;  2FU4 A;  3E6M A;  2L3D A;  4ZZD A;  5LRR A;  1TQP A;  2OBP A;  2CYY A;  4IF4 A;  5ICC A;  2F2E A;  2MBF A;  4UV8 A;  4G94 A;  4HA8 A;  4WXH A;  2H27 A;  3DXJ F;  3FM3 A;  3H3Z A;  1FT9 A;  4F7Z A;  1U78 A;  1FYL A;  4XBF A;  2IJL A;  1TNS A;  1UCR A;  3P7N A;  4P9F A;  4O6J A;  3WE2 A;  3I71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...