2FNPA

Crystal structure of sara
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYFKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Staphylococcal accessory regulator A
total genus 38
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fnpA00
5BPIA 1HKTA 2EV5A 2HZTA 3KP2A 4R8HA 3LAJA 2FMLA 2P5KA 3RYPA 1MGTA 2O8XA 5ILVA 1EV7A 3B02A 2DW4A 2IP2A 3K0LA 5FFZA 1J2XA 1IW7F 1OR7A 4M9ZA 4UNOA 1BI0A 3T8RA 3F8FA 4HOBA 1TTYA 4XBFA 1CF7B 5EEHA 1K6OA 3IHUA 5FD6A 2EFWA 2ZXJA 2UWMA 5TJJA 3T1BA 4L9JA 1Z6RA 4P55A 1J5YA 4NQWA 2XAGA 2G9WA 2DAOA 5JHUA 5ICFA 1D8JA 1TNTA 4WCGA 2Y75A 2EA4A 1K78A 1F4KA 2P6TA 1UHMA 1REPC 5BMZA 1ZLKA 1RI7A 3FWEA 1UB9A 2LNBA 2LDUA 4WK8F 3WG9A 3J7AO 4G94A 2GXGA 4CYDA 2VBYA 4L9NA 3CUOA 4WF2A 2GWRA 5IT9K 3Q9VA 3RPUA 3WTZA 2FQ3A 2O0YA 4UV8A 3AAFA 1R5GA 2DK8A 2XASA 1G3YA 2XAHA 3HRSA 2PJPA 4B8XA 3KLNA 3V7RA 3RKXA 5J8FA 4ZYGA 4KMFA 1MZBA 5HOOA 1K7AA 1R7JA 1VTNC 2V9VA 4TV7A 3FHZA 4Y17A 3GZ6A 4EGZA 5D8LB 3GFLA 3E5UA 1IXSB 1XCVA 1MJAA 3T5XA 4RGUA 1IZ1A 3I5UA 3KP6A 1QGPA 4QWQA 3SQNA 5DDGA 4Y13A 2D1HA 4YFNF 3P9KA 5JR3A 4LFUA 1A04A 5K5RA 1MKMA 4EM1A 2L4MA 3TGNA 4IRHA 4OOIA 4MTEA 1FX7A 4KMUX 2R7FA 2JSCA 4ENNA 3R4KA 4A5MA 2Q8KA 4U0YA 1JXSA 5D5UB 4CDGA 5ICCA 3ZMZA 1J59A 2MLKA 2Y0MA 4GO1A 1ZRCA 1TQMA 2QUFA 2YPRA 2OZUA 1FP2A 1QBJA 4EJUA 3S2WA 5E1ZB 2ZMEA 1HW5A 4HLXA 4MEYF 1YS7A 4RAYA 4OIOF 3F6OA 5LHIA 3GEZA 3FZVA 4R1HA 1OKRA 5HS8A 4F7ZA 1KQ8A 4G6DA 1H9TA 2H27A 3MAJA 5JVTA 2L01A 5F1RA 1FBSA 4I98B 3F3XA 1IXCA 2GXBA 4OIPF 3SZPA 5HLHA 4HQMA 3HTSB 2NNNA 5HS7A 1P4WA 4IVNA 4BHCA 1W5TA 4S04A 1WQ2A 3JAMZ 4KYWA 1LJ9A 2HFHA 1FBUA 1T38A 3JAMK 5LRSA 2OQGA 2A07F 2FXAA 3WGHA 2JPBA 3FXUA 1TQPA 4B09A 3GUDA 4JQFA 4G9YA 3V4GA 4WXDA 3F8NA 3E97A 1XDSA 1SD4A 4IXAA 3J81Z 2J5PA 3GFJA 3WTSC 4L5JA 5HLIA 3Q5FA 4O3MA 3W6KB 3FF5A 4FHTA 4ZYHA 3F23A 1XGSA 1BIBA 2PI0A 2ETHA 1R36A 1XN7A 2BGCA 4IRIA 4D0PA 3LSTA 1NHAA 3IKVA 3EQLF 2NS0A 1EH8A 1MDMB 4OU0A 2A6EF 3GW2A 1WI9A 1SFEA 4EMSA 3BZ6A 1XD7A 1HSTA 2YX4A 1GHCA 3P7NA 1RIOH 2MA3A 4EM2A 1K79A 1W7PD 2EV6A 2IW5A 3HRUA 4ENKA 3WU1B 5CVVA 3IWZA 3F8MA 4CICA 3P9IA 1I1GA 3DXJF 1DPRA 4FX4A 3RJPA 5DEQA 1FBQA 2YR2A 2XUBA 2QVOA 5E8IA 1GXPA 5LEKA 2NAZA 3BWGA 2H6CA 3WGGA 3IRQA 5FLXK 2HOEA 2A68F 3ECOA 2QQBA 2UXXA 5AIQA 2FE3A 1P2FA 1SAXA 4G6QA 2RQPA 2VT3A 1USTA 3N97A 2FEZA 1Q1HA 1LVAA 2X4HA 2M87A 4ESJA 4OIQF 3ZMDA 5HDGA 3K1NA 3NRVA 2PLYA 3ULQB 2A6HF 2AS5F 1OMIA 1R1UA 4ETSA 3KP7A 1WRJA 3R6SA 3RYRA 2Y48A 3MZHA 3QOPA 2XKOA 5LHHA 4LGWA 4XSZF 1YFHA 3C3WA 2QWWA 4OIRF 1KU9A 4PCQA 2FNAA 2RV8A 5AIPA 1U5TB 3EETA 1FLIA 2CW0F 3EYYA 4GCVA 2HTSA 1QO0D 1R58A 4AIHA 2ZNYA 2XAJA 4N0BA 2CG4A 4HDUA 1SMYF 4LG0A 4YG2F 2GA1A 4U7DA 1FNNA 2ZCWA 1U5TA 2LF7A 1XB4A 5FGMA 5DCMA 1RZ4A 3SXYA 2RGVA 4RAZA 2C6YA 1LDDA 4KIBA 4A0XA 3COAC 1WKMA 2QBYA 1QPMA 2EFQA 4EQQA 3F22A 1U78A 3GFMA 3L09A 1XSDA 2PN6A 1BM9A 3ZMSA 2F5CA 1ZGJA 5TRDA 3E6BA 4BHPA 2HDCA 3ECHA 2OQRA 4P9UA 2ESNA 2K4JA 1J7KA 1B9NA 3F8CA 4G7OF 1KYWA 3RIRA 3T8TA 5D8KB 1TW2A 5FB2A 5L3CA 1ON2A 3DQVC 3WTYC 2HQNA 1R1TA 4G7ZF 3TKYA 5LGUA 4HZFA 1T0FA 3BY6A 2L02A 1FPQA 1UHWA 2DI3A 4UHTA 2Q2EA 2PFBA 1JGSA 2YU3A 2DBBA 2YX7A 5ILSA 2DQRA 1B9MA 5BOXA 3GYHX 3MCZA 5EEGA 1BBYA 4I0BA 2GQQA 2D1VA 5DUIA 3O6BB 3T0YA 1BJAA 1D5VA 2HR3A 2ZBKA 3TQNA 1K78B 4BHBA 3ZQ7A 1ZARA 3M8EA 4AD9A 2QENA 2ZKZA 3KZYA 1H9GA 4MEXF 3KP3A 4ZH4F 4HX8A 1QZYA 1ON1A 5D5XB 4CO8A 4EJTA 1OYYA 2NYXA 1ZREA 3J81K 2CGPA 2EB7A 3WE3A 2WC2A 1XMKA 3K1PA 2LSOA 1R5HA 4LK1F 1X3UA 1JHHA 3HYIA 4PGHA 1DP7P 1O7LA 5A2QK 4HYEA 2P7CB 1LNWA 2E7XA 3GX4X 3EYIA 2IVMA 2JRTA 3QPHA 3QPTA 2EK5A 2VE9A 3JTGA 3LAPA 1FSEA 3HRTA 4HV6A 2TDXA 1USSA 5IT9Z 2VT2A 3GLXA 4M71A 3H92A 1G4DA 4I01A 4Y15A 2OD5A 4ZYEA 1T98A 2XROA 1TLHB 1ODDA 4LB6B 2DT5A 5L3EA 1ZG3A 4L5IA 3HTUA 1ZGAA 2DQLA 2FBIA 1LB2A 2VONA 5H6QA 4IRGA 2QQAA 3ZPLA 1IAWA 1ONVA 3C18A 2V1UA 1HSJA 1KU3A 4HAMA 3LA7A 2QM3A 2H94A 5K1YA 3GFIA 2KJCA 1IUYA 3KP4A 2UZKA 3KEOA 4H0EA 2M5WA 3CDHA 3HHHA 1HQCA 3RKWA 2XKPA 5F6FA 4I09A 1U2WA 2V6CA 1W5SA 4KN4X 1Z6TA 3DPTA 2K4BA 3FXRA 2O6GE 2HTJA 1KGSA 2XAQA 4U7BA 4QLCU 1YO5C 4Q4ZF 1BI1A 4YIIA 2VC1A 3RKYA 3K1MA 4FX0A 1PP8F 2IJLA 3V8LA 3HOTA 3VOEA 1Z05A 1XMAA 2QBYB 2M1BA 5CVIA 2IPQX 5J6XA 3G3ZA 3I0TA 3BJOA 3BPVA 6PAXA 5DCMB 3GO5A 2IA0A 2JZYA 2EFNA 4M73A 2Z9OA 3DP7A 3O2PE 4HA8A 3FM5A 4EV0A 2LF8A 5D5WB 2M45A 3RPQA 5CVRA 3HRMA 1DPUA 1R23A 4ON0A 1I6XA 5BS6A 1ZYRF 2HKXA 2Z5UA 4G8XA 2XGXA 2OAZA 2V1XA 4XSXF 3ISPA 1ZN2A 1P92A 2CO5A 2HS5A 5AONA 1AOYA 3GZ5A 2Z99A 4HDVA 4HBLA 3D5LA 3FMRA 2JPCA 5BPDA 2RNJA 5DD4A 3VFZA 4EM0B 1MDMA 1J0RA 2WV0A 3WODF 4DQ2A 1O3TA 1B6AA 3MWMA 2G7UA 2VE8A 2EA2A 4LLNA 3R0JA 5ICEA 3C7JA 3TOBA 5L3GA 5DV5A 1MJ9A 1FT9A 1BN5A 3VB2A 2WWYA 4CGZA 2HGCA 1P4AA 1HKQA 5K5OA 2BBYA 1HW2A 5FD5A 5JI6A 4N9HA 3RDIA 4A5NA 3HUGA 2RVCA 1R00A 3WU0A 4HX4A 1H0MA 3LFKA 5HS9A 4BQAA 1JHFA 2D2WA 2ZJ2A 2B0LA 1F5TA 4YIFA 4AIKA 2DU9A 1D8KA 1XSXA 3SFZA 4L0YB 4P96A 1UFMA 4M6YA 4NHJA 2FRHA 4AVPA 3ZN1A 5LHGA 2DPUA 3TO7A 2AXLA 4EGYA 3M7GA 1HW1A 4KNYA 3I59A 2M30A 1UCRA 2V79A 4IHTA 3BDDA 3LA2A 4OMYA 2XRNA 5H6RA 5D6EA 2A61A 3OV8A 5CJ9A 1BI2A 1TBXA 5L3FA 4RB1A 3HHGA 4M72A 4RGSA 2H6BA 1ULYA 1RNLA 3DFGA 2OU2A 3L2CA 5A2QZ 2HWVA 3BP8A 2H09A 3GWZA 1KA8A 4OMZA 3IC7A 3I54A 5ERIA 2HYGD 1QQIA 3DKWA 1IN4A 4P5OA 1EH6A 1YG2A 4UVBA 2X0LA 5D4RA 4PZJA 1ZLJA 3PFIA 3FMQA 3SZTA 3ABTA 4BNCA 4EJOA 2Q0OA 1FC3A 5DCFA 3FX3A 3V7SA 4NB5A 5E1XA 4XLPF 3IKTA 1G6NA 4PGGA 4KIFA 1GVJA 5IT3A 2RN7A 3LQRA 2PBIA 1YW9A 4AIJA 2ACJA 3ZMTA 5D5VB 2FU4A 2CFXA 1BIAA 4A0ZA 2PEXA 1U3EM 3W6JB 2BEOA 3GF2A 3R61A 2ZFWA 3ML6A 3QP5A 5FLXZ 1Y0UA 4K2EA 2W24A 5LEJA 3E6CC 2O03A 4A0YA 1KU2A 4MQ9F 2MH9A 1F1ZA 4PDKA 3U9GA 1OYIA 1IN5A 4A2UA 1V4RA 4RGRA 2Z3YA 2L4AA 4E70A 1GXQA 4IJAA 3F6VA 4UVAA 1PUEE 1LEBA 3BJAA 2CWEA 4WX9A 1O3SA 3RTRA 3CO6C 4M6XA 5CLSA 3K2ZA 1YW8A 2W84A 4MQVA 1B59A 3KFWX 4M9SA 2BV6A 3IL2A 4UXNA 2DPDA 4YFKF 3OOPA 4HW0A 3DF8A 3GVAA 3I53A 4ZZDA 3TDUC 2ZO4A 5JFRA 1G3TA 4XLNF 2WTEA 1ZHFA 1ZH5A 1R22A 1QNTA 2HQRA 4RB0A 2ZMEB 3WGIA 1STZA 4XRFA 4ENMA 3V7CA 3LWFA 1B4AA 2JT1A 2MH2A 2PQ8A 1BI3A 1IF1A 2K02A 3IWFA 3DPLC 3ZN0A 4WXHA 3WTWC 3TOAA 2EV0A 1J75A 1O57A 3CUQA 1LQ1A 5K5QA 1WSUA 2COMA 4CXFA 1S7OA 1KU7A 1KQ9A 1XDUA 1YQAA 4HQEA 3HIFA 5L3BA 2E1CA 1XCBA 3D0SA 3GXOA 4GGGA 1IN7A 3KCCA 3TO9A 3M8FA 5D4SA 2ISZA 4A12A 2MD5A 1SFXA 1L0OC 3WTTC 4JBAA 3CJNA 1HXDA 2KIFA 3KLOA 5DD8A 2XIGA 3LA3A 3H3ZA 3VEPA 1P4XA 1U5TC 1S29A 3VODA 2K7LA 4LK0F 3N4MA 5FO5A 2W57A 4L0ZB 5LLQA 4HF0A 5H20A 3BPXA 1FYMA 2VBWA 4LMYA 3RI4A 1BC7C 3O3KA 4LB5A 2KIUA 2A69F 1Z1DA 4G7HF 3ROUA 3ELKA 2KKOA 1E17A 4OINF 1T39A 3K69A 1TW3A 1T2KA 3WTXC 3R0AA 3I4PA 2EFPA 2IRFG 5E1WA 2RC4A 1T6SA 3FM3A 4I0AA 4ESFA 2F2EA 3J80Z 1EH7A 2K27A 2EWNA 2VODA 2EJRA 3JSPA 1RUOA 4N9IA 3BJ6A 3LQQA 1IRFA 4RGXA 3CUQC 2OZ6A 2G7HA 5HDNA 2QQ9A 2KJBA 4KA4A 2BE5F 3PQKA 4MNUA 2VN2A 3I59B 1FY7A 2RDPA 2ADUA 5HVQC 1W7PB 4ZZLA 2GZWA 2K86A 2E7WA 2QYOA 3REOA 4BH9A 4YFXF 1KQ0A 4S05A 5ED4A 1KYZA 2F5DA 2XVCA 2YSRA 4I2OA 1LEAA 1Z9CA 1YLFA 4ZYDA 4GYIA 1DDNA 5KK1A 2ELHA 1LDKB 3BROA 3G73A 1BC8C 2DK5A 1I5ZA 1ZG1A 1B1BA 3FMSA 1OPCA 4IHSA 4KICA 4Q47A 1ZRFA 2GAUA 3ZMUA 4KFCA 3KZZA 2DO7A 1D3YA 3E6DA 3E6MA 1J9IA 1U6GA 3E3VA 1XGNA 2FMYA 4I7HA 2E1NA 4U88A 1JE8A 2MBFA 4M9XA 4LLLA 3EUHA 2P5LC 5ICGA 1SD7A 1RUNA 1DUXC 4LJZF 5E20A 1I1SA 4FT8A 1V3FA 2F5FA 4L18B 5FFXA 4L9VA 4Q5SF 2VBZA 5E18F 2L54A 1O7FA 3F21A 3C1DA 2MC3A 2GIVA 4CHUA 2KIMA 1U8RA 2VC0A 4L9TA 3CO7C 2EFOA 3V8KA 5HLGA 5BQTA 5LGTA 1YIOA 2OBPA 2ESHA 2P6SA 5DYMA 1FWZA 1XGOA 1YS6A 4EJWA 3CLOA 5ILUA 3DEUA 2MLGA 2VOPA 3MFKA 5DUKA 1LDJA 2ISYA 4LLGF 3E5XA 4R79A 2VXZA 3JW4A 3HOSA 1MJBA 3B73A 1SD5A 4KUMA 4BAYA 5E8GA 3JSOA 3QU6A 2VOOA 2CSOA 1PP7U 3FXQA 3WTVC 1E2XA 1ZRDA 5E17F 2NRAC 4RB2C 3ZP5A 3HSFA 2UXNA 1CGPA 2PMHA 2XAFA 2Z33A 2STTA 5CVJA 2QZ8A 4RS8A 2HEOA 1S6LA 1BOAA 1C0WA 1ZAOA 2W85A 2STWA 3QP6A 5LBQA 2VBXA 1G3WA 1IN8A 4P9FA 1XSVA 2ZNZA 1S7AA 4ENJA 3MEXA 2IT0A 4WXCA 1S3JA 4A6DA 3I64A 2FOKA 2FBKA 4WWCA 5D6FA 4BYYA 3NEUA 2HYFA 5KVRA 1YW7A 2KRFA 3DV8A 1PDNC 1CF7A 5J8CA 2DTRA 3KEQA 2LKPA 3KE2A 2CYYA 3NQOA 2R7DA 3HSEA 4MGRA 1IN6A 2FBHA 4GXOA 4UV9A 4UUVA 3F8BA 2PMUA 2A5YB 4Q48A 2P5VA 4KT5C 2JTVA 2FNPA 3SHFA 2FF4A 4DNCA 1I27A 3QU3A 1FYKA 4ASNA 4EVIA 5CVUA 3MZYA 4RB3C 3I58A 4U0VA 2RKHA 2P7VB 3K9TA 1MD0A 1Z7UA 2V1DA 3KP5A 5L3DA 3CUQB 3R60A 4LD5A 1SD6A 2DLLA 4I02A 3J80K 4MHGA 4HF2A 2W25A 3IRRA 1S8NA 3P9CA 5CYVA 3WTUC 2J5OA 2OA4A 2HKOA 3Q9SA 3M9AA 1F9NA 1L3LA 1O3RA 1IXRC 3I71A 1OYWA 4MTDA 2IA1A 2O61A 2F5EA 4UVCA 2L3DA 2XHKA 3MQ0A 4IPAA 1W4MA 3L7WA 2O3FA 1P6RA 3TDZC 1Z91A 3U1DA 5F64A 1WWXA 2P4WA 1FSHA 1G3SA 4LG0B 3CTAA 4KIGA 4HX7A 4CZZA 3ERED 1SFUA 3V8JA 2NNYA 1AWCA 2A3SA 4EJVA 4M74A 1R1VA 2DFIA 1FP1D 2R3SA 3M1EA 3WE2A 1W7PA 2BYVE 2CQKA 1SMTA 4ESBA 4AWXB 3HSRA 4A6EA 4O5VA 5LRRA 4JK1X 2M8EA 1TQIA 2GA2A 3BOQA 1XGMA 1FOKA 3QAHA 1FYLA 3TO6A 2XV4S 2IA2A 2P8TA 4HF1A 4BXUA 3U2RA 1HBXG 3E5QA 1TNSA 4O6JA 2D45A 3L00A 3PQJA 5HDKA 3QRFF 1IRGA 2QLZA 3EDPA 3H3UA 1HKSA 4GYGA 3JTHA 4HLYA 2FSWA 1YYVA 4KDPA 1ZG5A 3ABUA 4U0WA 1QZZA 3F72A 4KN7X 2PG4A 3ZMVA 1O3QA 3L9FA 4HV5A 1FZPB 5LGNA 2FA5A 3KETA 4IF4A 1YTYA 4Z2YA
chains in the Genus database with same CATH superfamily
3RKQA 2F5VA 1VI0A 5BPIA 2R7VA 3IH3A 1HKTA 4BE0A 3BQYA 2EV5A 2HZTA 3K4JA 1OQYA 4BEHB 1NTCA 3H5NA 3KP2A 4R8HA 3LAJA 1D1CA 2FMLA 2P5KA 3RYPA 1MGTA 4BU2A 1HA8A 4ZJZA 4CA0A 2O8XA 5ILVA 3S2DJ 1EV7A 4RAFA 3B02A 2VKVA 2DW4A 1FTZA 3W3CA 1ITYA 2IP2A 3K0LA 5FFZA 1J2XA 1D0YA 3QWLA 3PIPF 2B7EA 1VZ0A 1IW7F 1OR7A 4M9ZA 2R7TA 4UNOA 3G2BA 1BI0A 3T8RA 3PL8A 1VQPI 1P9QC 3F8FA 3OYAA 4AUXA 2ZJQF 1SVLA 4HOBA 1TTYA 4XBFA 1CF7B 5EEHA 3CZ6A 3L2VA 2PX9A 2PMZA 2X9DA 1FJLA 1K6OA 2E1MB 3IHUA 5M5YJ 3WHBA 3S15J 1KONA 5FD6A 2EFWA 1YRNA 2ZXJA 2W4SA 2UWMA 1V5GA 1V55H 5TJJA 3IV5A 3T1BA 4L9JA 2DJNA 3OYBA 1IO2A 1P7IA 3PSFA 3DBRB 2KZGA 1Z6RA 4P55A 2H1KA 1PVEA 1J5YA 2QF7A 4NQWA 1VFCA 2XAGA 2G9WA 2DAOA 3S1NJ 3DEWA 2JN6A 3CCMI 5JHUA 3CP2A 5ICFA 1D8JA 1GDTA 1TNTA 3HZJA 4WCGA 3BQZA 4NC8A 2Y75A 1E3PA 1T33A 2EA4A 2BVLA 4D7MA 1W36C 3K4NA 1FMWA 1K78A 3ABMH 1F4KA 1WCMJ 2P6TA 2GLOA 2DMNA 1UHMA 3HPGA 1REPC 5BMZA 1ZLKA 1RI7A 3FWEA 1UB9A 2LNBA 3K4CA 2LDUA 3KEYA 4WK8F 3QOEA 3WG9A 3VPRA 2OF7A 3J7AO 4G94A 5B1AH 3OS2A 1TT0A 3SEQA 2GXGA 4CYDA 1J09A 2VBYA 5F08A 4L9NA 3CUOA 3GTKJ 4WF2A 2GWRA 5IT9K 1OISA 3OR2C 3Q9VA 3RPUA 1IUFA 3WTZA 2HXIA 2FQ3A 5FKKA 3VSLA 3UKGA 2O0YA 3PFYA 4UV8A 3AAFA 1WJCA 5GPAA 1IDYA 4A3CJ 1R5GA 2DK8A 2XASA 3CC2I 4KITB 1G3YA 2XAHA 4FE7A 3HRSA 2PJPA 4B8XA 2IS2A 3KLNA 2W48A 4BJTA 1QVTA 3V7RA 1MBGA 5E3LA 3OY9A 3RKXA 5J8FA 3FXJA 2O9LA 4ZYGA 2HVSA 3W2AA 4KMFA 2LY9A 2PJRA 1Y1WJ 1QZEA 3LL7A 1JUPA 1MZBA 2NVUB 1LPQA 1K4SA 3MD2A 2OCCH 1ACIA 2O7OA 3BC8A 5HOOA 1K7AA 3H3VK 1R7JA 1MNDA 5DS9A 2V9VA 1VTNC 4CYCB 4TV7A 3FHZA 4Y17A 4E7LA 2X6YA 1Y6IA 3GZ6A 1MMGA 1H8AC 4EGZA 5F0CA 5D8LB 3GFLA 2QSHX 3RPUD 3E5UA 1IXSB 1XCVA 3TL4X 1MJAA 2VQHA 3Q3SA 3T5XA 1MBFA 4RGUA 1IZ1A 3BLYA 2IGNA 4PUSA 3I5UA 3KP6A 1QGPA 2VXDA 4QWQA 3SQNA 5DDGA 4BDYA 4Y13A 5GAHJ 2D1HA 4YFNF 2TRTA 1A5JA 2Y9YA 4G12A 3AKZA 1JGGA 3P9KA 2LRDA 5E3NA 5JR3A 4LFUA 1A04A 2AQFA 2ZMEC 5K5RA 3TW7A 1MKMA 4EM1A 1TWHJ 1LUJB 4A3GJ 2L4MA 4IZZA 4IL6C 3TGNA 4IRHA 4OOIA 2K9MA 4QPQA 4MTEA 3JCUC 1FX7A 2ZXHA 4KMUX 2R7FA 1ETQA 4E7SA 2XGEA 2JSCA 1X3WB 4ENNA 4XL9A 2LFBA 3S1MJ 3R4KA 2B9SA 2OV7A 4A5MA 2Q8KA 4U0YA 1JXSA 5D5UB 4CDGA 3O8GA 3ZMZA 5ICCA 3FIWA 1J59A 2MLKA 2Y0MA 2FQ4A 4N4NB 1VNDA 1XTAA 2E2JJ 4GO1A 3CCYA 1ZRCA 1TQMA 2QUFA 2YPRA 3DLLF 5FKNA 3JRCA 2OZUA 1FP2A 1QBJA 4EJUA 1WFXA 3S2WA 1X1BA 5E1ZB 2LOOA 2CW8A 2ZMEA 1HW5A 4HLXA 4MEYF 3JRBA 1YS7A 4IHVA 3CMYA 4RAYA 1W0TA 2XGDA 4OIOF 3F6OA 3KX2A 5LHIA 3GEZA 3FZVA 2ZC2A 1OCTC 1MBEA 3K7AJ 2DJIA 4JP0A 1OKRA 1Y0NA 4R1HA 5HS8A 5C44J 4F7ZA 3S1QJ 1KQ8A 2WAQN 3HKZA 4G6DA 1H9TA 2H27A 1ETXA 3MAJA 5GPCA 2DMTA 5JVTA 2L01A 5F1RA 1B8IA 1FBSA 1WJDA 3E0JB 4I98B 3F3XA 3G1MA 2LKSA 1IXCA 2GXBA 4IHXA 4OIPF 2QQ8A 3SZPA 5HLHA 2ID3A 4HQMA 3HTSB 2NNNA 5HS7A 4AC0A 1PJRA 1P4WA 4IVNA 4BHCA 4NDLA 1W5TA 1OLTA 1WQ2A 3JAMZ 4S04A 4KYWA 1LJ9A 2HFHA 3OYKA 1GT0C 1AKHB 1FBUA 1T38A 3JAMK 5LRSA 2OQGA 2A07F 1WPKA 2FXAA 3WGHA 4E6KG 1WVRA 2JPBA 4MFDA 3A4CA 5J47A 2KRHA 3FXUA 4XICA 3JRGA 4XIDA 1H89C 1R4MB 3A03A 1T56A 3GBGA 2JQ7A 1TQPA 2DA4A 4B09A 3GUDA 1JUMA 4G9YA 4JQFA 1VQOI 1X4PA 3DBHB 3V4GA 4WXDA 3F8NA 2DXIA 3W2WA 3E97A 1XDSA 1SD4A 4IXAA 3J81Z 2R92J 3EUKL 2J5PA 3GFJA 4XLCA 1SANA 5CQEA 3WTSC 5IPAA 4L5JA 1SVOA 5HLIA 3AG1H 3Q5FA 2XB5A 1MMDA 4UY8I 1OFCX 4O3MA 4AVZA 4XK4A 3KZIC 2K9LA 3W6KB 3FF5A 4IKFA 2F4OB 1RESA 4C2MJ 2KMUA 4FHTA 3OR1C 2L9NA 2OTJI 4ZYHA 2XC7A 1MNMC 4IQJA 2R5ZA 3F23A 1MIJA 4BXXJ 1XGSA 1BIBA 2KLOA 3B6AA 2PI0A 2ETHA 3CD6I 4DYQA 1R36A 1XN7A 2BGCA 4IRIA 2K9QA 2XF7A 1A6QA 5EF6A 4E7JA 1IRXA 1UJ8A 4D0PA 3C2BA 3LSTA 1X1DA 3CMEI 4NQWB 2WB1N 1JTXA 1NHAA 3IKVA 3EQLF 2NS0A 3H35A 1EH8A 1MDMB 4OU0A 2EIMH 1BW5A 2VJ5A 2A6EF 3GW2A 1NH3A 1WI9A 2ELJA 3LSPA 1SFEA 3HKZN 4EMSA 2E35A 3BZ6A 1XD7A 1ZTRA 3MKWB 1OCCH 1HSTA 2LBFB 2HYJA 1FOXA 2YX4A 1GHCA 2XDVA 1A6IA 2R5ZB 2Y9ZA 1ERDA 3P7NA 2MA3A 1RIOH 2NS8A 4EM2A 1K79A 3W6VA 1W7PD 2EV6A 2IW5A 1W5CC 3BG3A 3HRUA 4ENKA 3WU1B 5CVVA 3IWZA 3F8MA 4CICA 3P9IA 1I1GA 3CESA 3DXJF 2WY8Q 5TGTA 1DPRA 4FX4A 3RJPA 1YJNI 5DEQA 1S72I 1FBQA 2YR2A 2EPFA 1IV6A 2XUBA 1B72A 2QVOA 5E8IA 1GXPA 5E3OA 1X1CA 4C30A 5LEKA 2NAZA 3BWGA 2H6CA 4N4OB 2X6XA 2CUZA 3WGGA 3IRQA 2B63J 5FLXK 3BZCA 1Z21A 5EDNA 2HOEA 5F0FA 2A68F 3HG9A 3HEFA 3ECOA 3LFUA 2QQBA 3BG9A 2DODA 2UXXA 3HUGB 5AIQA 2FE3A 3GLLA 1P2FA 2WAFA 1SAXA 3VYUB 1FOYA 4G6QA 1IDZA 2HDDA 2ZFUA 3G6EI 3JR9A 2RQPA 2DMPA 2VT3A 1USTA 3OWTA 2QGUA 3N97A 4XKVA 2FEZA 1Q1HA 1LVAA 2X4HA 2M87A 2N8GA 4ESJA 1H88C 4OIQF 3ZMDA 2BZTA 3Q0VA 4EATA 5HDGA 3K1NA 4CCMA 3NRVA 4Y4RA 3ULQB 2PLYA 2VPRA 5FKOA 2A6HF 5J4YA 3FXKA 2AS5F 5J1UA 1OMIA 1TT5B 2R7OA 2L9VA 1R1UA 2DFHA 5EZHA 4ETSA 3KP7A 4PJ0C 3EPZA 1WRJA 1EF4A 3R6SA 3RYRA 2Y48A 2JA8J 3MZHA 2HNHA 3QOPA 2XKOA 3GMEA 5LHHA 4LGWA 2HDWA 4XSZF 1YFHA 1HOMA 2EBIA 3CJRB 3C3WA 1DU0A 2QWWA 1KU9A 4OIRF 4LG3A 1NG7A 2NVTJ 2AQEA 1ENHA 4PCQA 3PJRA 3H9JA 2FNAA 2RV8A 4YRVA 4BY1J 1RR7A 5AIPA 2IXSA 4CCOA 3CLQA 4QTRA 1U5TB 5J1YA 1QPIA 3EETA 2CQXA 5JLXA 1HCRA 2CUEA 5GP9A 1FLIA 2CW0F 3EYYA 3CDLA 4GCVA 2HTSA 5B3SH 3PIOF 2R7RA 1I6HJ 4UUSB 1G2HA 3OYMA 5C4XJ 1QO0D 3ASNH 1R71A 1R58A 3OIOA 4XLEA 4BS9A 1T08B 4AIHA 2ZNYA 2XAJA 4N0BA 2COBA 3CJTB 2CG4A 2R0QC 1SC7A 2ZSIB 3KIOA 3TW6A 4HDUA 1SMYF 1UG2A 4LG0A 4YG2F 3OS1A 3UNGC 1GV5A 5M5XJ 2GA1A 4U7DA 1DQUA 1FNNA 2ZCWA 1U5TA 3DU5A 2LF7A 3HBLA 5IP6A 1XB4A 2IAIA 1ZK8A 3LSKA 5FGMA 5DCMA 1RZ4A 3SXYA 3HM5A 3MKYB 2RGVA 3LOCA 3ZQIA 1E3HA 4RAZA 1K6YA 2C6YA 2L9SA 2GBYA 3BR0A 1LDDA 2WA0A 3CQZJ 3DBLB 4KIBA 4A0XA 1VQMI 5FLVA 3COAC 2PJRB 3ABKH 9ANTA 1WKMA 1BL0A 2QBYA 1QPMA 4CCNA 4XNFA 2EFQA 4EQQA 1DGWY 2ME6A 3F22A 2M7AA 1U78A 3GFMA 1S9HA 4RDUA 4BJ5C 3L09A 4E7KA 3I4MJ 5JLWA 2FJ1A 1XSDA 4LIVA 2MYSA 3BT9A 4QPOA 1VQ6I 2PN6A 1BM9A 3DWLE 3ZMSA 2F5CA 3LSIA 2MW8A 4QIWN 4FTHA 2NOGA 1ZGJA 4B4CA 5TRDA 5C3EJ 3E6BA 1X1AA 4V2FA 4BHPA 2HDCA 3ECHA 4C2TA 2OQRA 3CCSI 4P9UA 2ESNA 1LFBA 2K4JA 2H8RA 3GTJJ 1J7KA 1B9NA 3F8CA 3CCUI 4G7OF 1RKTA 1KYWA 2JRMA 3RIRA 3T8TA 5D8KB 1TW2A 2LY1A 5FB2A 5L3CA 2LG4A 4XLHA 1ON2A 1XC5A 3DQVC 3WTYC 4DW6A 2HQNA 1R1TA 4G7ZF 3TKYA 3FXOA 5LGUA 4HZFA 1ZKGA 1T0FA 3BY6A 3HGYA 2L02A 4YIRX 2H8WA 3SEZA 5IOYA 1FPQA 1UHWA 2DI3A 4G6TB 3OYIA 3L2RA 1UG0A 2LREA 4UHTA 3FK7A 2Q2EA 1BA5A 5GADJ 4PSWA 2PFBA 1JGSA 2YU3A 3CMMA 2DBBA 1UZCA 2YX7A 5EJCA 5ILSA 4ZTJA 3E7LA 2DQRA 4X1EA 2YU9J 1B9MA 5FROA 5BOXA 3GYHX 3MCZA 5EEGA 1BBYA 2CUJA 1YI2I 2R4GA 5DM7F 4I0BA 2GQQA 2D1VA 2O8KA 5DUIA 1F36A 3O6BB 3L2WA 3T0YA 1BJAA 1D5VA 2HR3A 2ZBKA 3TQNA 3JRAA 1K78B 4XRSA 4BHBA 3S32A 3ZQ7A 2E2HJ 1ZARA 3NAUA 1WZ2A 3M8EA 4AD9A 5IOZA 1IG7A 2QENA 2DDBA 2ZKZA 3KZYA 1H9GA 3OSGA 2WAEA 4MEXF 5GAEJ 5KHDA 4Z6YA 3KP3A 4BY7J 3OYCA 4ZH4F 4HX8A 2L7MP 2NVQJ 4DJAA 3I56I 1QZYA 1ON1A 3BTCA 3JRIA 1AA7A 2VQCA 3IAS2 4BJ6C 5D5XB 1EJ9A 4CO8A 4GDFA 5K7FA 4EJTA 2BW3B 4V19K 3CCEI 1FTTA 1OYYA 3BTIA 1N77A 1W0UA 2NYXA 1ZREA 3VSKA 2HVQA 1SEUA 3J81K 4B48A 2CGPA 2K40A 2EB7A 1D1AA 4B47A 3J7YJ 3WE3A 2WC2A 1XMKA 3K1PA 2CRGA 2BVMA 2LSOA 4B1RA 1R5HA 2CQQA 4LK1F 4ZDOA 1X3UA 2OPTA 1JHHA 3HYIA 4PGHA 1O4XA 1DP7P 1WJEA 4W97A 2JA6J 4HPQA 4XKCA 1O7LA 4CSWA 5A2QK 4RBOA 2RQQA 4HYEA 2P7CB 1LNWA 3LMMA 2E36A 2E7XA 3ZQFA 1JTYA 4IOCF 1WJFA 2R7UA 4BBRJ 3GX4X 3EYIA 2IVMA 2JRTA 2Y30A 3LSHA 3QPHA 1RC9A 3H5AA 3QPTA 3CCQI 2EK5A 4B3AA 2VE9A 2R7WA 4DGWB 3JTGA 3PSIA 1TP4A 3LAPA 1FSEA 3HRTA 3FISA 4HV6A 3E1SA 2TDXA 3BZKA 1USSA 3N05A 5IT9Z 1OCRH 2VT2A 3G4SI 1R4NB 3GLXA 2EZIA 3H92A 4M71A 2IS6A 2KFDA 4HG2A 3TMOA 4I01A 1G4DA 2Q1ZB 4Y15A 2OD5A 3MKLA 4ZYEA 3OIQA 4M3FA 1T98A 4DZJA 2XROA 2LMDA 1TLHB 2X1EA 1ODDA 4LB6B 1LE8B 2XSJC 4FASD 3TEDA 2DT5A 5L3EA 3QYEA 1ZG3A 3DU6A 4L5IA 3ZXSA 3HTUA 1ZGAA 2DQLA 2FBIA 2DT6A 1R5ID 1LB2A 2VONA 4XRMA 1F43A 5H6QA 3PUFA 2K85A 1WH7A 2LC2A 2W00A 3A01A 2BY2A 3RCOA 4IRGA 2QQAA 4FQGA 2LKXA 1D5YA 3ZPLA 3C2HA 1IAWA 4DYCA 1ONVA 3C18A 1SFKA 2GM4A 5M3MJ 2V1UA 4LOCA 2HXOA 1A31A 1HSJA 4UUTA 2M4KA 2W82A 1KU3A 4HAMA 3ESWB 4RA2A 1D1BA 3LA7A 3CF5F 2QM3A 2H94A 2WADA 4A3EJ 5K1YA 3GFIA 2KJCA 1IUYA 1RPWA 2MABA 3CCJI 3KP4A 4A3IJ 2UZKA 1MH3A 3KEOA 4H0EA 2X6WA 2M5WA 3CDHA 3HHHA 1SFOJ 1HQCA 2RAEA 3RKWA 1PYVA 2XKPA 5F6FA 4I09A 4ANJA 3G71I 1U2WA 2V6CA 1W5SA 1Z6TA 3DPTA 4KN4X 2K4BA 3FXRA 4ABZA 2IS1A 2H1LA 2O6GE 2IEKA 2CV2A 1N25A 3UR3C 2HTJA 1KGSA 2XAQA 4U7BA 4QLCU 1YO5C 2LYCA 2FD5A 3J7AY 4Q4ZF 4E7IA 4I99C 1BI1A 2ZXWH 4Y52J 4YIIA 5FKLA 2DA3A 5J4VA 3SFIA 3ZQLA 2XF6A 1PUFB 1P7JA 5BNGA 3K4BA 3S3NA 2LH9A 2VC1A 4PJNA 3ZQGA 3RKYA 1YJWI 1GUUA 2VKDA 1QHHD 3K1MA 5F27A 4FX0A 1PP8F 2IJLA 3V8LA 2Y2ZA 3HOTA 3VOEA 1Z05A 3BG7A 3S8PA 1XMAA 2QBYB 2M1BA 5DM6F 5CVIA 2IPQX 2QSFX 4XLAA 4XLFA 2DA1A 4I76A 3G3ZA 3I0TA 4RLFA 4PFPA 5J6XA 3HL2A 2HPMA 2CQ7A 3W2VA 3BJOA 3BPVA 6PAXA 5DCMB 4DOZA 4ITVA 2OJED 3GO5A 1VQ4I 2IGKA 4KJZA 2IA0A 3D1NI 2JZYA 2EFNA 2VJJA 4M73A 2Z9OA 3DP7A 3O2PE 4HA8A 3FM5A 4EV0A 2UV1A 3NARA 2LF8A 4ZDPA 5D5WB 2M45A 4IHYA 2BOLA 3RPQA 5CVRA 3GZNB 2L7FP 3HRMA 1DPUA 1R23A 2M3AA 4ON0A 4AYBA 1B72B 1I6XA 5BS6A 1ZYRF 2HKXA 2LLKA 3PM1A 2CU7A 2Z5UA 4G8XA 1QVUA 3TP0A 3JRHA 2XGXA 1A36A 2OAZA 2V1XA 1YRNB 4XSXF 1ETKA 3D5SC 4MO7A 3ISPA 1WJ5A 1MH4A 1UELB 1ZN2A 1P92A 1Y8QB 1LKXA 2CO5A 2HS5A 1QA6A 2E19A 3A01B 5AONA 1SAUA 1AOYA 3GZ5A 2O5RA 2Z99A 4HDVA 4HBLA 3D5LA 3FMRA 4HEA2 2JPCA 5BPDA 3H9GA 2WV1A 5IY5H 1AU7A 2VUMJ 2RNJA 5DD4A 2V26A 3VFZA 1TWAJ 1N75A 1B8IB 4EM0B 1MDMA 1J0RA 2KP6A 2WV0A 3WODF 4DQ2A 1YITI 3OOUA 5J40A 2GOMA 1O3TA 1B6AA 3MWMA 2R5YB 2XPWA 4EEFG 2M8GX 2G7UA 2QKMB 5FLMJ 2IBDA 3ZQCA 2M2EA 5IP7J 1FMVA 4XMYA 1Y39A 2VE8A 2EA2A 4LLNA 3S2HJ 1Q1VA 3R0JA 5ICEA 3C7JA 3TOBA 5L3GA 5GTHC 3FBIB 2JMWA 1YJ9I 5F1JA 5DV5A 3MKZA 3LSMA 1MJ9A 1FT9A 1BN5A 5M3FJ 3VB2A 3KYDB 3VYTB 2WWYA 4CGZA 2HGCA 1P4AA 1HKQA 3HPHA 3I3LA 5K5OA 2BBYA 1HW2A 5FD5A 5JI6A 2FOWA 3HJEA 2BHZA 2XF5A 2K3FA 4N9HA 3RDIA 4A5NA 3D5RC 2XRLA 1Z7LA 3HUGA 3I9V2 1XPXA 3IH4A 5KAIC 1GLNA 2RVCA 1R00A 3WU0A 2I8DA 2BXZA 4HX4A 1H0MA 3LFKA 5HS9A 4BQAA 1Y8RB 3LSJA 1JHFA 2D2WA 1HDPA 2EZKA 2B0LA 2ZJ2A 3K6GA 1F5TA 4DBRA 4YIFA 4AIKA 2DCEA 1VF9A 2F48A 2DU9A 1D8KA 1XSXA 3SFZA 4BL0B 3OL4A 4AYBN 4L0YB 2MFZA 2MC4A 4P96A 5EG0B 1DU6A 2DOEA 1UFMA 4C2UA 4M6YA 1YOVB 2FRHA 4AVPA 4NHJA 3ZN1A 5LHGA 2DPUA 4A3LJ 1U9OA 1WGXA 3TO7A 3A0HC 3HOZJ 2BHYA 1JKPC 2AXLA 4EGYA 2YS9A 3M7GA 4RM3A 3AL0B 1WJBA 2KT0A 3OYJA 1HW1A 2NS7A 4KNYA 3I59A 2M30A 1UCRA 2V79A 2DOAA 4IHTA 3ZGKA 3PUBA 3V42A 4Z2YA 3BDDA 5F04A 3CC4I 3LA2A 3IH2A 3H1CA 4D5CA 2XPVA 4F91B 1POGA 4OMYA 2XRNA 4XOPA 5H6RA 3ZR8X 5D6EA 4DZPA 2E60A 3FHNA 5TISC 2A61A 3OV8A 5CJ9A 1K4TA 3VDXA 1BI2A 1TBXA 2KZVA 3DKYA 5L3FA 5HODA 1A35A 4RB1A 3K2AA 3HOYJ 2E34A 3HHGA 4B44A 4M72A 3IAM2 4RGSA 4BDZA 2KIQA 4NBQA 2Z1DA 2HPIA 2H6BA 1BW6A 3H9QA 1W1WE 2Z16A 3FK6A 3OSFA 1ULYA 1RNLA 3MMYB 3DFGA 4AU7A 4F93B 1CQTA 4V2GA 2OU2A 4MLOA 5A2QZ 2HWVA 3L2CA 1RRJA 2ECBA 1ZELA 2IGOA 2Y69H 3BR2A 1IGNA 4IHWA 1APLC 3BP8A 2XGCA 2H09A 3GWZA 2VJ4A 1KA8A 4MFEA 4OMZA 3IC7A 2KDZA 3I54A 3WG7H 5ERIA 2HYGD 1JI8A 3GCMA 3BCAA 1QQIA 3DKWA 4CCJA 2W1OA 1IN4A 2DN0A 3DLAA 4P5OA 1EH6A 2V1NA 3BR5A 4DBQA 1YG2A 4CH7A 4UVBA 2YUSA 2X0LA 3EUHC 3PNVA 4PZJA 5D4RA 5DTDA 2E71A 1ZLJA 3PFIA 2R93J 2LVSA 1WHUA 3FMQA 4RMNA 3U21A 4PK4A 3SZTA 4BEHA 3ZCOA 1FIAA 3ABTA 4BNCA 4EJOA 2Q0OA 1FC3A 5DCFA 3FX3A 1WJAA 3V7SA 1W36D 2I10A 4NB5A 4D7NA 5E1XA 4XLPF 3IKTA 1G6NA 2I5UA 4PGGA 4KIFA 1GVJA 2DYSH 5IT3A 4NC7A 2RN7A 3LQRA 4FISA 2PBIA 2QEXI 2BY0A 1FEXA 3G1LA 1YW9A 1GV2A 4AIJA 2GIZA 3ZMTA 2ACJA 4X6AJ 5M5WJ 2L7KA 3FXLA 5D5VB 2FU4A 3OYEA 2X51A 1Z3YA 4Y7NJ 2CFXA 1BIAA 4A0ZA 2PEXA 1U3EM 1X1PA 1TWGJ 3W6JB 3GTGJ 1S7EA 2BEOA 2BW3A 3GF2A 3R61A 2VASA 3GTMJ 3C2GA 2ZFWA 3ML6A 1X2MA 3QP5A 1MBKA 2CJJA 5JHFA 5EG0A 5FLXZ 3AFHA 1Y0UA 4K2EA 1YX5A 2W24A 4U87A 1LFPA 5LEJA 3E6CC 2O03A 2X48A 3ABLH 4A0YA 1KU2A 4MQ9F 3I55I 1IC8A 2MH9A 1UMQA 4GRIA 2DT7B 3S93A 1F1ZA 5E3MA 4JOMA 4PDKA 3U9GA 5EEAA 2XAUA 2M9HA 3SYTA 1OYIA 2V7FA 2KL4A 2A6TA 1IN5A 4A2UA 4XKWA 1V4RA 4RGRA 2Z3YA 2P81A 4F52A 3DPUA 3S14J 2L4AA 3RQ4A 4ZTFA 3RZDJ 4E70A 1GXQA 4IJAA 3F6VA 2HU9A 1IV8A 4UVAA 4BGDA 5E79C 3OS0A 1PUEE 1LEBA 3BJAA 2CWEA 2VI6A 3TP3A 2VPLA 2IS4A 1I3QJ 2DOFA 2ZSHB 4WX9A 1AKHA 4B43A 1O3SA 1BR1A 3BR1A 3RTRA 3CO6C 3SJMA 4XRSG 3Q0UA 3OYDA 2HVRA 4M6XA 5CLSA 1MW7A 3K2ZA 1YW8A 2W84A 3DTEA 3OYGA 4MQVA 5JVGF 1B59A 3KFWX 4M9SA 2BV6A 3IL2A 4UXNA 2DPDA 1ETWA 4YFKF 3OOPA 4C3JJ 4HW0A 3DF8A 1VQNI 2XPUA 3GVAA 3I53A 1OCOH 3TDUC 4ZZDA 2X85A 2CV0A 2ZO4A 5JFRA 1G3TA 1TWFJ 4RLQA 1OCZH 3M4OJ 5LFAA 4XLNF 2WTEA 1ZHFA 1K83J 1ZH5A 1QRYA 3GTQJ 3TBIA 1R22A 1QNTA 3CJQB 2JVGA 4BQQA 2HQRA 4RB0A 2ZMEB 4XRFA 1STZA 3WGIA 2ELKA 3NWSA 4ZC3A 3V7CA 3QODA 4ENMA 3LWFA 2E5NA 1B4AA 3MN2A 2JT1A 2ME0A 2MH2A 2PQ8A 1BI3A 1Z67A 3OYLA 1IF1A 2ZXIA 3RSNA 5B1BH 2K02A 3FXMA 3F9KA 2JVHA 2HOAA 3IWFA 3DPLC 4D9JA 3ZN0A 2EZHA 4J01A 1U9NA 2QA4I 4WXHA 3WTWC 3TOAA 2M0CA 2EV0A 4BE1A 1O57A 1J75A 5CQGA 2LK2A 2LP0A 1QHGA 3O8HA 2V9PA 3CUQA 3H5RA 1LQ1A 5K5QA 3A02A 1WSUA 2COMA 2E1OA 4CXFA 4E7ZA 1S7OA 1KU7A 1KQ9A 3K4KA 3BG5A 1X19A 1XDUA 1YQAA 2KRCA 4RM2A 4II3A 3CP8A 4HQEA 3HIFA 1I39A 4BUPA 2KHMA 5L3BA 3L2UA 2E1CA 1XCBA 2K9SA 3D0SA 3GXOA 3M07A 3PNYA 4GGGA 3K70C 4CUGA 1VQ7I 1E0EA 1FOWA 3HOXJ 1IN7A 3KCCA 3TO9A 3M8FA 5D4SA 2ISZA 4A12A 2GOXB 1V5EA 2QCOA 2MD5A 1SFXA 3ZRGA 1RKWA 4YELA 3ZQHA 4J00A 4P1WA 1L0OC 3BTLA 1KZHA 3WTTC 4JBAA 3FDYA 3DKXA 3CJNA 2A05A 2DTZA 2ID6A 1HXDA 2KIFA 3KLOA 1JUSA 2VJIA 5DD8A 2XIGA 5GAGJ 4KT6A 1I50J 3OIPA 2NOJB 3LA3A 1OCPA 3LNQA 1T95A 3K10A 1PUFA 3H3ZA 1X2NA 3VEPA 3VYRB 1P4XA 1U5TC 2JK3A 2A5WA 1S29A 3VODA 2DA2A 3LSGA 2BXYA 4JYKA 4I6ZA 1LE8A 1DP3A 2K7LA 1HC8A 2KISA 4B3XA 4LK0F 1LVKA 3N4MA 1EKEA 2BY1A 5FO5A 4PFOA 3S16J 3VYSB 2W57A 4L0ZB 5LLQA 4HF0A 2X6OA 5LD2C 5H20A 4A3KJ 2M7BA 1T8IA 3J7ZI 5B66C 3BPXA 1FYMA 2VBWA 2VKEA 4LMYA 3RI4A 2Q2EB 3O3KA 1BC7C 2HOTA 2ZJPF 2KIUA 4LB5A 2A69F 1Z1DA 4G7HF 1Z3XA 3ROUA 3ELKA 2KKOA 1E17A 1HLVA 4OINF 1T39A 3K69A 4A69C 1TW3A 1T2KA 3WTXC 3R0AA 1GVDA 5HNFA 4XN0A 3ZQQA 3I4PA 4OWRB 4H4KC 2EFPA 5EZGA 4CCLA 3JRFA 2IRFG 5E1WA 4C9YA 5KCMA 1X4OA 2Y31A 2DMUA 2RC4A 1T6SA 3FM3A 3GTOJ 4I0AA 4ESFA 2NVXJ 2F2EA 2OTLI 3J80Z 1EH7A 2K27A 3CF2A 2QSGX 1JKRC 2EWNA 3SZGA 2VODA 4Y3OA 2QKLB 2EINH 4XQFA 2EJRA 2CUFA 3CCVI 3JSPA 2OCEA 1RUOA 2G0EA 1YE9A 4N9IA 2DA7A 2CS3A 2IGMA 3BJ6A 3BCBA 3LQQA 3X2QH 4GFBA 1JJ6C 1IRFA 1MSFC 4RGXA 1Y56A 2L7ZA 2V6EA 3CUQC 1G59A 2OZ6A 4BBSJ 2V9KA 2G7HA 1RETA 2JA5J 2EZLA 5HDNA 1N78A 5F0HA 2OUMA 4E4HA 4QSHA 2QQ9A 5J1RA 3F0CA 2KJBA 2L2OA 4KA4A 1YX3A 2BE5F 3BG6A 3PQKA 1MMAA 4MNUA 4M6VA 2VN2A 4II2A 4NUBA 2KQRA 3I59B 2VB6A 1FY7A 2RDPA 1AHDP 1U0JA 1MSEC 1SVMA 2ADUA 5HVQC 1W7PB 4ZZLA 3CDIA 2GZWA 2K86A 2E7WA 1TC3C 2QYOA 3REOA 2ZJRF 3HOVJ 1Z77A 4Y33A 3JREA 4BXFA 4BH9A 4YFXF 1KQ0A 4S05A 4A3MJ 2HOSA 5EGOA 1R49A 5ED4A 2E5ZA 1KYZA 4PJMA 4IX7A 3H0GJ 3PNTA 4FE4A 5KNLA 3HGGA 1VQLI 4HNVA 3S17J 2F5DA 2XVCA 2YSRA 4I2OA 1LEAA 1WI3A 1Z9CA 1YLFA 4ZYDA 4GYIA 1DDNA 5KK1A 2ELHA 4XOTA 2JA2A 4PJLA 3H36A 1LDKB 2R7ZJ 3CC7I 3BROA 2D5VA 2EH3A 3G73A 1BC8C 2DK5A 1I5ZA 1ZG1A 1Y1VJ 4L5EA 1IRZA 1ETYA 1B1BA 1V54H 3HB9A 2R7SA 5K7ZA 4XN3A 2VKHA 3FMSA 1OPCA 4IQ4A 4ZYAA 3RQIA 4IHSA 4KICA 4Q47A 1ZRFA 1BR4A 2GAUA 3A2KA 3ZMUA 4KFCA 3BR6A 3KZZA 2DO7A 1D3YA 3E6DA 2KDOA 2VL8A 3H0DA 3S3OA 3E6MA 1J9IA 2LR8A 4FCYA 1U6GA 3E3VA 4HSRA 1XGNA 2FMYA 4I7HA 1D0ZA 2Y0SA 5K7HA 2E1NA 4U88A 1JE8A 4KISA 2GXAA 2MBFA 4M9XA 4LLLA 1UHSA 3EUHA 4C3IJ 1XG1A 2P5LC 4A3FJ 1HF0A 2R5YA 1VQ8I 1UAAA 5CPRB 4XM3A 5ICGA 1ZQ3P 3QPSA 4BQOA 1SD7A 1RUNA 1DUXC 1NG6A 4LJZF 1U8BA 4DYRA 5E20A 1I1SA 4FT8A 1V3FA 3S3MA 2F5FA 2RREA 3AG4H 4L18B 2DFFA 5FFXA 3U1KA 4L9VA 4OAYA 4Q5SF 2FX0A 4F3QA 2VBZA 5E18F 3CMAI 2L54A 1O7FA 3F21A 1E3OC 2HI3A 3C1DA 1OJLA 2MG4A 2MC3A 2GIVA 3FKIJ 4CHUA 2HZDA 2KIMA 3OMYA 2F4MB 2VC0A 1U8RA 4L9TA 2M4GA 3CO7C 3KYLA 2ECCA 3M1CA 2L5QA 2WY7Q 2EFOA 3V8KA 1FIPA 4JX6A 2HQAA 3HC7A 5EYRA 1S5LC 5HLGA 5BQTA 5LGTA 1YIOA 2OBPA 1HDDC 3JRDA 2ESHA 4DIQA 2P6SA 5DYMA 4ZDLA 3GTLJ 1FWZA 4JX5A 3HOWJ 1XGOA 1XMXA 3K70D 1YS6A 1BR2A 3WU2C 4EJWA 2EIKH 3CLOA 5ILUA 3DEUA 2MLGA 3L2QA 2VOPA 1BOBA 3MFKA 3G1OA 5DUKA 1LDJA 4HNUA 2ISYA 4LLGF 5FKMA 1IJWC 1XS9A 4CCKA 1G8XA 3E5XA 1ETVA 3BR3A 4R79A 2VXZA 2R7QA 4IO9F 3JW4A 3HOSA 1MJBA 3B73A 1SD5A 4KUMA 2L0KA 4BAYA 3NWTA 5E8GA 5IYBJ 3JSOA 3QU6A 2VOOA 2DA6A 3Q0WA 5HNHA 2R7XA 2CSOA 4XKBA 3QPLA 1PP7U 3FXQA 3WTVC 1TZLA 1E2XA 4D1QA 2HQ5A 4M3EA 4E7HA 1ZRDA 5E17F 2NVYJ 4BKXA 2NRAC 4RB2C 3ZP5A 2DDAA 1ETOA 5J3LA 3HSFA 2UXNA 2ZB9A 2JJ7A 3AG2H 1CGPA 2PMHA 3MVPA 2XAFA 1YIJI 2Z33A 2STTA 5CVJA 2QZ8A 3M8JA 4RS8A 2HEOA 5IP9J 3ONQA 1S6LA 1BOAA 1C0WA 1ZAOA 2W85A 2XSDC 3P5JA 2X1DA 2DA5A 2CQNA 3QP6A 4RAGA 2STWA 5FRNA 5LBQA 2VBXA 2CMPA 1G3WA 1RR8C 5IYCJ 4HRIA 1IN8A 4P9FA 1XSVA 2ZNZA 1S7AA 2MSYA 1XX5A 2CH0A 2K5CA 4ENJA 2KPMA 3PO2J 2BY3A 3MEXA 1WH5A 2IT0A 4WXCA 3ERMA 1OR7C 1S3JA 3HXLA 3FKJA 4A6DA 3I64A 2FOKA 2FBKA 1TWCJ 4LITA 1LFUP 4WWCA 3WHCA 1M1EB 2JSPA 5D6FA 4M3BA 4UUSA 4BYYA 3NEUA 1T0FC 4MIMA 2HYFA 5KVRA 2VLAA 1X3ZB 1YW7A 3DV8A 2KRFA 2X1CA 4FETA 1CF7A 3KPHA 1PDNC 3DTIA 4XORA 3A1YA 5J8CA 2DTRA 3KEQA 2LKPA 4BQNA 4AM3A 1ZGWA 4IOAF 2F4IA 3KE2A 1VQKI 2CYYA 3NQOA 2R7DA 3HSEA 4JX4A 2UUZA 4MGRA 3A0BC 5FJ8J 1IN6A 2FBHA 4GXOA 1D0XA 3GTPJ 4UV9A 4UUVA 1ZR4A 3F8BA 4W1UA 2WBMA 3ZOBA 2PMUA 2A5YB 5GTIC 4J19A 4Q48A 4YEJA 2P5VA 4KT5C 3KYCB 1DGRM 2JTVA 2FNPA 2K3PA 3SHFA 1Z0XA 2FF4A 4DNCA 2JUCA 3DTKA 1I27A 2L9RA 3QU3A 1JKQC 1FYKA 1JJ8C 5H2FC 4ASNA 4EVIA 3L1PA 3OYNA 2RNGA 5CVUA 3MZYA 3OL3A 2VQGA 4RB3C 3I58A 4U0VA 2RKHA 2P7VB 1K61A 3K9TA 1MD0A 2VIXA 1Z7UA 2M0MA 2V1DA 3KP5A 4XONA 3BTJA 5L3DA 3CUQB 3R60A 4LD5A 2F6CA 1SD6A 4IF4A 3B6CA 2FUG2 4HSTA 2DLLA 3DEEA 4I02A 3J80K 2E1MC 4X0GA 2LTPA 4MHGA 4HF2A 3HOUJ 4C3HJ 4NC6A 2W25A 3IRRA 3LSRA 1S8NA 3P9CA 5CYVA 3K4MA 3WTUC 2J5OA 2OA4A 2NXNB 2DFEA 2HKOA 1R6RA 3M9AA 3Q9SA 4UB8C 1F9NA 2MGQA 1L3LA 3AG3H 1O3RA 1IXRC 4LIUA 3CCLI 3I71A 1OYWA 4A3BJ 4MTDA 4A93J 5EGOB 3SDBA 2IA1A 3OYHA 2O61A 2JA7J 1MBJA 2F5EA 4UVCA 2L3DA 4AIDA 2XHKA 3MQ0A 1W4MA 2WAQA 4IPAA 2K9NA 3L7WA 2O3FA 1P6RA 2ICWG 3TDZC 2CFOA 1Z91A 2OC6A 3CCRI 3U1DA 5F64A 1NK3P 4F92B 1WWXA 2P4WA 3QYBA 1FSHA 2CV1A 4A3DJ 1JKOC 3MZ8A 1G3SA 2AO9A 1MBHA 5B5EC 4LG0B 4HNTA 4BACA 4PJJA 3RZOJ 1EA3A 1TL8A 2E2IJ 4NNJA 3CTAA 3IUOA 4KIGA 4BE2A 4HX7A 4CZZA 2EIJH 3ERED 1SFUA 3V8JA 2NNYA 4CZCA 5FRMA 4M3GA 1AWCA 2A3SA 4IEJA 4EJVA 4M74A 3OYFA 2Y0SN 1R1VA 2DFIA 1FP1D 1JT6A 2R3SA 3M1EA 3WE2A 1W7PA 2M34A 2BYVE 2LBFA 2CQKA 1SMTA 4ESBA 3VWBA 3HSRA 4M3DA 4A6EA 2XB0X 4O5VA 1I3AA 4AWXB 4PSXA 5CKTA 5LRRA 4JK1X 2M8EA 1TQIA 1X58A 3M3YJ 2GA2A 2Z2SB 3BOQA 1XGMA 3FBNB 1FOKA 2AXTC 3I4NJ 2LD5A 5KAFC 5C4JJ 2EQRA 3ASOH 1YHQI 3QAHA 1FYLA 3K4LA 3TO6A 2JWTA 2XV4S 2IA2A 2P8TA 2PMZN 4HF1A 4BXUA 3U2RA 2VQLA 1HBXG 2LY2A 3E5QA 4A3JJ 1MNEA 3IP4B 3PO3J 4O6JA 2D45A 1BJZA 4CYCA 4D5FA 4XR6A 3L00A 3PQJA 1ORKA 5HDKA 1MMSA 1MMNA 3QRFF 2JUGA 1IRGA 2DYRH 2QLZA 2CW7A 3EDPA 3H3UA 2EILH 2V4JC 4OAZA 2WB1A 1HKSA 4GYGA 3QQAA 3JTHA 1V5FA 5IYDJ 2W7NA 1VQ9I 4S0HB 1R9TJ 2MD0A 4HLYA 5HLTA 1JT0A 2FSWA 1YYVA 2AHQA 4KDPA 1ZG5A 1QU3A 3S1RJ 3ABUA 4U0WA 2DMQA 1QZZA 3F72A 4KN7X 2PG4A 2TCTA 3ZMVA 1O3QA 1NK2P 1ZR2A 2P0WA 3L9FA 4UB6C 4HV5A 1FZPB 3DCFA 1VQ5I 5LGNA 3EUAA 3SDGA 3HDDA 2FA5A 4F55A 3KETA 3QYFA 1YTYA 3AL0C 1TNSA
chains in the Genus database with same CATH topology
5BPIA 1HKTA 2EV5A 2HZTA 3KP2A 4R8HA 3LAJA 2FMLA 2P5KA 3RYPA 1MGTA 2O8XA 5ILVA 1EV7A 3B02A 2DW4A 2IP2A 3K0LA 5FFZA 1J2XA 1IW7F 1OR7A 4M9ZA 4UNOA 1BI0A 3T8RA 3F8FA 4HOBA 1TTYA 4XBFA 1CF7B 5EEHA 1K6OA 3IHUA 5FD6A 2EFWA 2ZXJA 2UWMA 5TJJA 3T1BA 4L9JA 1Z6RA 4P55A 1J5YA 4NQWA 2XAGA 2G9WA 2DAOA 5JHUA 5ICFA 1D8JA 1TNTA 4WCGA 2Y75A 2EA4A 1K78A 1F4KA 2P6TA 1UHMA 1REPC 5BMZA 1ZLKA 1RI7A 3FWEA 1UB9A 2LNBA 2LDUA 4WK8F 3WG9A 3J7AO 4G94A 2GXGA 4CYDA 2VBYA 4L9NA 3CUOA 4WF2A 2GWRA 5IT9K 3Q9VA 3RPUA 3WTZA 2FQ3A 2O0YA 4UV8A 3AAFA 1R5GA 2DK8A 2XASA 1G3YA 2XAHA 3HRSA 2PJPA 4B8XA 3KLNA 3V7RA 3RKXA 5J8FA 4ZYGA 4KMFA 1MZBA 5HOOA 1K7AA 1R7JA 1VTNC 2V9VA 4TV7A 3FHZA 4Y17A 3GZ6A 4EGZA 5D8LB 3GFLA 3E5UA 1IXSB 1XCVA 1MJAA 3T5XA 4RGUA 1IZ1A 3I5UA 3KP6A 1QGPA 4QWQA 3SQNA 5DDGA 4Y13A 2D1HA 4YFNF 3P9KA 5JR3A 4LFUA 1A04A 5K5RA 1MKMA 4EM1A 2L4MA 3TGNA 4IRHA 4OOIA 4MTEA 1FX7A 4KMUX 2R7FA 2JSCA 4ENNA 3R4KA 4A5MA 2Q8KA 4U0YA 1JXSA 5D5UB 4CDGA 5ICCA 3ZMZA 1J59A 2MLKA 2Y0MA 4GO1A 1ZRCA 1TQMA 2QUFA 2YPRA 2OZUA 1FP2A 1QBJA 4EJUA 3S2WA 5E1ZB 2ZMEA 1HW5A 4HLXA 4MEYF 1YS7A 4RAYA 4OIOF 3F6OA 5LHIA 3GEZA 3FZVA 4R1HA 1OKRA 5HS8A 4F7ZA 1KQ8A 4G6DA 1H9TA 2H27A 3MAJA 5JVTA 2L01A 5F1RA 1FBSA 4I98B 3F3XA 1IXCA 2GXBA 4OIPF 3SZPA 5HLHA 4HQMA 3HTSB 2NNNA 5HS7A 1P4WA 4IVNA 4BHCA 1W5TA 4S04A 1WQ2A 3JAMZ 4KYWA 1LJ9A 2HFHA 1FBUA 1T38A 3JAMK 5LRSA 2OQGA 2A07F 2FXAA 3WGHA 2JPBA 3FXUA 1TQPA 4B09A 3GUDA 4JQFA 4G9YA 3V4GA 4WXDA 3F8NA 3E97A 1XDSA 1SD4A 4IXAA 3J81Z 2J5PA 3GFJA 3WTSC 4L5JA 5HLIA 3Q5FA 4O3MA 3W6KB 3FF5A 4FHTA 4ZYHA 3F23A 1XGSA 1BIBA 2PI0A 2ETHA 1R36A 1XN7A 2BGCA 4IRIA 4D0PA 3LSTA 1NHAA 3IKVA 3EQLF 2NS0A 1EH8A 1MDMB 4OU0A 2A6EF 3GW2A 1WI9A 1SFEA 4EMSA 3BZ6A 1XD7A 1HSTA 2YX4A 1GHCA 3P7NA 1RIOH 2MA3A 4EM2A 1K79A 1W7PD 2EV6A 2IW5A 3HRUA 4ENKA 3WU1B 5CVVA 3IWZA 3F8MA 4CICA 3P9IA 1I1GA 3DXJF 1DPRA 4FX4A 3RJPA 5DEQA 1FBQA 2YR2A 2XUBA 2QVOA 5E8IA 1GXPA 5LEKA 2NAZA 3BWGA 2H6CA 3WGGA 3IRQA 5FLXK 2HOEA 2A68F 3ECOA 2QQBA 2UXXA 5AIQA 2FE3A 1P2FA 1SAXA 4G6QA 2RQPA 2VT3A 1USTA 3N97A 2FEZA 1Q1HA 1LVAA 2X4HA 2M87A 4ESJA 4OIQF 3ZMDA 5HDGA 3K1NA 3NRVA 2PLYA 3ULQB 2A6HF 2AS5F 1OMIA 1R1UA 4ETSA 3KP7A 1WRJA 3R6SA 3RYRA 2Y48A 3MZHA 3QOPA 2XKOA 5LHHA 4LGWA 4XSZF 1YFHA 3C3WA 2QWWA 4OIRF 1KU9A 4PCQA 2FNAA 2RV8A 5AIPA 1U5TB 3EETA 1FLIA 2CW0F 3EYYA 4GCVA 2HTSA 1QO0D 1R58A 4AIHA 2ZNYA 2XAJA 4N0BA 2CG4A 4HDUA 1SMYF 4LG0A 4YG2F 2GA1A 4U7DA 1FNNA 2ZCWA 1U5TA 2LF7A 1XB4A 5FGMA 5DCMA 1RZ4A 3SXYA 2RGVA 4RAZA 2C6YA 1LDDA 4KIBA 4A0XA 3COAC 1WKMA 2QBYA 1QPMA 2EFQA 4EQQA 3F22A 1U78A 3GFMA 3L09A 1XSDA 2PN6A 1BM9A 3ZMSA 2F5CA 1ZGJA 5TRDA 3E6BA 4BHPA 2HDCA 3ECHA 2OQRA 4P9UA 2ESNA 2K4JA 1J7KA 1B9NA 3F8CA 4G7OF 1KYWA 3RIRA 3T8TA 5D8KB 1TW2A 5FB2A 5L3CA 1ON2A 3DQVC 3WTYC 2HQNA 1R1TA 4G7ZF 3TKYA 5LGUA 4HZFA 1T0FA 3BY6A 2L02A 1FPQA 1UHWA 2DI3A 4UHTA 2Q2EA 2PFBA 1JGSA 2YU3A 2DBBA 2YX7A 5ILSA 2DQRA 1B9MA 5BOXA 3GYHX 3MCZA 5EEGA 1BBYA 4I0BA 2GQQA 2D1VA 5DUIA 3O6BB 3T0YA 1BJAA 1D5VA 2HR3A 2ZBKA 3TQNA 1K78B 4BHBA 3ZQ7A 1ZARA 3M8EA 4AD9A 2QENA 2ZKZA 3KZYA 1H9GA 4MEXF 3KP3A 4ZH4F 4HX8A 1QZYA 1ON1A 5D5XB 4CO8A 4EJTA 1OYYA 2NYXA 1ZREA 3J81K 2CGPA 2EB7A 3WE3A 2WC2A 1XMKA 3K1PA 2LSOA 1R5HA 4LK1F 1X3UA 1JHHA 3HYIA 4PGHA 1DP7P 1O7LA 5A2QK 4HYEA 2P7CB 1LNWA 2E7XA 3GX4X 3EYIA 2IVMA 2JRTA 3QPHA 3QPTA 2EK5A 2VE9A 3JTGA 3LAPA 1FSEA 3HRTA 4HV6A 2TDXA 1USSA 5IT9Z 2VT2A 3GLXA 4M71A 3H92A 1G4DA 4I01A 4Y15A 2OD5A 4ZYEA 1T98A 2XROA 1TLHB 1ODDA 4LB6B 2DT5A 5L3EA 1ZG3A 4L5IA 3HTUA 1ZGAA 2DQLA 2FBIA 1LB2A 2VONA 5H6QA 4IRGA 2QQAA 3ZPLA 1IAWA 1ONVA 3C18A 2V1UA 1HSJA 1KU3A 4HAMA 3LA7A 2QM3A 2H94A 5K1YA 3GFIA 2KJCA 1IUYA 3KP4A 2UZKA 3KEOA 4H0EA 2M5WA 3CDHA 3HHHA 1HQCA 3RKWA 2XKPA 5F6FA 4I09A 1U2WA 2V6CA 1W5SA 4KN4X 1Z6TA 3DPTA 2K4BA 3FXRA 2O6GE 2HTJA 1KGSA 2XAQA 4U7BA 4QLCU 1YO5C 4Q4ZF 1BI1A 4YIIA 2VC1A 3RKYA 3K1MA 4FX0A 1PP8F 2IJLA 3V8LA 3HOTA 3VOEA 1Z05A 1XMAA 2QBYB 2M1BA 5CVIA 2IPQX 5J6XA 3G3ZA 3I0TA 3BJOA 3BPVA 6PAXA 5DCMB 3GO5A 2IA0A 2JZYA 2EFNA 4M73A 2Z9OA 3DP7A 3O2PE 4HA8A 3FM5A 4EV0A 2LF8A 5D5WB 2M45A 3RPQA 5CVRA 3HRMA 1DPUA 1R23A 4ON0A 1I6XA 5BS6A 1ZYRF 2HKXA 2Z5UA 4G8XA 2XGXA 2OAZA 2V1XA 4XSXF 3ISPA 1ZN2A 1P92A 2CO5A 2HS5A 5AONA 1AOYA 3GZ5A 2Z99A 4HDVA 4HBLA 3D5LA 3FMRA 2JPCA 5BPDA 2RNJA 5DD4A 3VFZA 4EM0B 1MDMA 1J0RA 2WV0A 3WODF 4DQ2A 1O3TA 1B6AA 3MWMA 2G7UA 2VE8A 2EA2A 4LLNA 3R0JA 5ICEA 3C7JA 3TOBA 5L3GA 5DV5A 1MJ9A 1FT9A 1BN5A 3VB2A 2WWYA 4CGZA 2HGCA 1P4AA 1HKQA 5K5OA 2BBYA 1HW2A 5FD5A 5JI6A 4N9HA 3RDIA 4A5NA 3HUGA 2RVCA 1R00A 3WU0A 4HX4A 1H0MA 3LFKA 5HS9A 4BQAA 1JHFA 2D2WA 2ZJ2A 2B0LA 1F5TA 4YIFA 4AIKA 2DU9A 1D8KA 1XSXA 3SFZA 4L0YB 4P96A 1UFMA 4M6YA 4NHJA 2FRHA 4AVPA 3ZN1A 5LHGA 2DPUA 3TO7A 2AXLA 4EGYA 3M7GA 1HW1A 4KNYA 3I59A 2M30A 1UCRA 2V79A 4IHTA 3BDDA 3LA2A 4OMYA 2XRNA 5H6RA 5D6EA 2A61A 3OV8A 5CJ9A 1BI2A 1TBXA 5L3FA 4RB1A 3HHGA 4M72A 4RGSA 2H6BA 1ULYA 1RNLA 3DFGA 2OU2A 3L2CA 5A2QZ 2HWVA 3BP8A 2H09A 3GWZA 1KA8A 4OMZA 3IC7A 3I54A 5ERIA 2HYGD 1QQIA 3DKWA 1IN4A 4P5OA 1EH6A 1YG2A 4UVBA 2X0LA 5D4RA 4PZJA 1ZLJA 3PFIA 3FMQA 3SZTA 3ABTA 4BNCA 4EJOA 2Q0OA 1FC3A 5DCFA 3FX3A 3V7SA 4NB5A 5E1XA 4XLPF 3IKTA 1G6NA 4PGGA 4KIFA 1GVJA 5IT3A 2RN7A 3LQRA 2PBIA 1YW9A 4AIJA 2ACJA 3ZMTA 5D5VB 2FU4A 2CFXA 1BIAA 4A0ZA 2PEXA 1U3EM 3W6JB 2BEOA 3GF2A 3R61A 2ZFWA 3ML6A 3QP5A 5FLXZ 1Y0UA 4K2EA 2W24A 5LEJA 3E6CC 2O03A 4A0YA 1KU2A 4MQ9F 2MH9A 1F1ZA 4PDKA 3U9GA 1OYIA 1IN5A 4A2UA 1V4RA 4RGRA 2Z3YA 2L4AA 4E70A 1GXQA 4IJAA 3F6VA 4UVAA 1PUEE 1LEBA 3BJAA 2CWEA 4WX9A 1O3SA 3RTRA 3CO6C 4M6XA 5CLSA 3K2ZA 1YW8A 2W84A 4MQVA 1B59A 3KFWX 4M9SA 2BV6A 3IL2A 4UXNA 2DPDA 4YFKF 3OOPA 4HW0A 3DF8A 3GVAA 3I53A 4ZZDA 3TDUC 2ZO4A 5JFRA 1G3TA 4XLNF 2WTEA 1ZHFA 1ZH5A 1R22A 1QNTA 2HQRA 4RB0A 2ZMEB 3WGIA 1STZA 4XRFA 4ENMA 3V7CA 3LWFA 1B4AA 2JT1A 2MH2A 2PQ8A 1BI3A 1IF1A 2K02A 3IWFA 3DPLC 3ZN0A 4WXHA 3WTWC 3TOAA 2EV0A 1J75A 1O57A 3CUQA 1LQ1A 5K5QA 1WSUA 2COMA 4CXFA 1S7OA 1KU7A 1KQ9A 1XDUA 1YQAA 4HQEA 3HIFA 5L3BA 2E1CA 1XCBA 3D0SA 3GXOA 4GGGA 1IN7A 3KCCA 3TO9A 3M8FA 5D4SA 2ISZA 4A12A 2MD5A 1SFXA 1L0OC 3WTTC 4JBAA 3CJNA 1HXDA 2KIFA 3KLOA 5DD8A 2XIGA 3LA3A 3H3ZA 3VEPA 1P4XA 1U5TC 1S29A 3VODA 2K7LA 4LK0F 3N4MA 5FO5A 2W57A 4L0ZB 5LLQA 4HF0A 5H20A 3BPXA 1FYMA 2VBWA 4LMYA 3RI4A 1BC7C 3O3KA 4LB5A 2KIUA 2A69F 1Z1DA 4G7HF 3ROUA 3ELKA 2KKOA 1E17A 4OINF 1T39A 3K69A 1TW3A 1T2KA 3WTXC 3R0AA 3I4PA 2EFPA 2IRFG 5E1WA 2RC4A 1T6SA 3FM3A 4I0AA 4ESFA 2F2EA 3J80Z 1EH7A 2K27A 2EWNA 2VODA 2EJRA 3JSPA 1RUOA 4N9IA 3BJ6A 3LQQA 1IRFA 4RGXA 3CUQC 2OZ6A 2G7HA 5HDNA 2QQ9A 2KJBA 4KA4A 2BE5F 3PQKA 4MNUA 2VN2A 3I59B 1FY7A 2RDPA 2ADUA 5HVQC 1W7PB 4ZZLA 2GZWA 2K86A 2E7WA 2QYOA 3REOA 4BH9A 4YFXF 1KQ0A 4S05A 5ED4A 1KYZA 2F5DA 2XVCA 2YSRA 4I2OA 1LEAA 1Z9CA 1YLFA 4ZYDA 4GYIA 1DDNA 5KK1A 2ELHA 1LDKB 3BROA 3G73A 1BC8C 2DK5A 1I5ZA 1ZG1A 1B1BA 3FMSA 1OPCA 4IHSA 4KICA 4Q47A 1ZRFA 2GAUA 3ZMUA 4KFCA 3KZZA 2DO7A 1D3YA 3E6DA 3E6MA 1J9IA 1U6GA 3E3VA 1XGNA 2FMYA 4I7HA 2E1NA 4U88A 1JE8A 2MBFA 4M9XA 4LLLA 3EUHA 2P5LC 5ICGA 1SD7A 1RUNA 1DUXC 4LJZF 5E20A 1I1SA 4FT8A 1V3FA 2F5FA 4L18B 5FFXA 4L9VA 4Q5SF 2VBZA 5E18F 2L54A 1O7FA 3F21A 3C1DA 2MC3A 2GIVA 4CHUA 2KIMA 1U8RA 2VC0A 4L9TA 3CO7C 2EFOA 3V8KA 5HLGA 5BQTA 5LGTA 1YIOA 2OBPA 2ESHA 2P6SA 5DYMA 1FWZA 1XGOA 1YS6A 4EJWA 3CLOA 5ILUA 3DEUA 2MLGA 2VOPA 3MFKA 5DUKA 1LDJA 2ISYA 4LLGF 3E5XA 4R79A 2VXZA 3JW4A 3HOSA 1MJBA 3B73A 1SD5A 4KUMA 4BAYA 5E8GA 3JSOA 3QU6A 2VOOA 2CSOA 1PP7U 3FXQA 3WTVC 1E2XA 1ZRDA 5E17F 2NRAC 4RB2C 3ZP5A 3HSFA 2UXNA 1CGPA 2PMHA 2XAFA 2Z33A 2STTA 5CVJA 2QZ8A 4RS8A 2HEOA 1S6LA 1BOAA 1C0WA 1ZAOA 2W85A 2STWA 3QP6A 5LBQA 2VBXA 1G3WA 1IN8A 4P9FA 1XSVA 2ZNZA 1S7AA 4ENJA 3MEXA 2IT0A 4WXCA 1S3JA 4A6DA 3I64A 2FOKA 2FBKA 4WWCA 5D6FA 4BYYA 3NEUA 2HYFA 5KVRA 1YW7A 2KRFA 3DV8A 1PDNC 1CF7A 5J8CA 2DTRA 3KEQA 2LKPA 3KE2A 2CYYA 3NQOA 2R7DA 3HSEA 4MGRA 1IN6A 2FBHA 4GXOA 4UV9A 4UUVA 3F8BA 2PMUA 2A5YB 4Q48A 2P5VA 4KT5C 2JTVA 2FNPA 3SHFA 2FF4A 4DNCA 1I27A 3QU3A 1FYKA 4ASNA 4EVIA 5CVUA 3MZYA 4RB3C 3I58A 4U0VA 2RKHA 2P7VB 3K9TA 1MD0A 1Z7UA 2V1DA 3KP5A 5L3DA 3CUQB 3R60A 4LD5A 1SD6A 2DLLA 4I02A 3J80K 4MHGA 4HF2A 2W25A 3IRRA 1S8NA 3P9CA 5CYVA 3WTUC 2J5OA 2OA4A 2HKOA 3Q9SA 3M9AA 1F9NA 1L3LA 1O3RA 1IXRC 3I71A 1OYWA 4MTDA 2IA1A 2O61A 2F5EA 4UVCA 2L3DA 2XHKA 3MQ0A 4IPAA 1W4MA 3L7WA 2O3FA 1P6RA 3TDZC 1Z91A 3U1DA 5F64A 1WWXA 2P4WA 1FSHA 1G3SA 4LG0B 3CTAA 4KIGA 4HX7A 4CZZA 3ERED 1SFUA 3V8JA 2NNYA 1AWCA 2A3SA 4EJVA 4M74A 1R1VA 2DFIA 1FP1D 2R3SA 3M1EA 3WE2A 1W7PA 2BYVE 2CQKA 1SMTA 4ESBA 4AWXB 3HSRA 4A6EA 4O5VA 5LRRA 4JK1X 2M8EA 1TQIA 2GA2A 3BOQA 1XGMA 1FOKA 3QAHA 1FYLA 3TO6A 2XV4S 2IA2A 2P8TA 4HF1A 4BXUA 3U2RA 1HBXG 3E5QA 1TNSA 4O6JA 2D45A 3L00A 3PQJA 5HDKA 3QRFF 1IRGA 2QLZA 3EDPA 3H3UA 1HKSA 4GYGA 3JTHA 4HLYA 2FSWA 1YYVA 4KDPA 1ZG5A 3ABUA 4U0WA 1QZZA 3F72A 4KN7X 2PG4A 3ZMVA 1O3QA 3L9FA 4HV5A 1FZPB 5LGNA 2FA5A 3KETA 4IF4A 1YTYA 4Z2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPI A;  1HKT A;  2EV5 A;  2HZT A;  3KP2 A;  4R8H A;  3LAJ A;  2FML A;  2P5K A;  3RYP A;  1MGT A;  2O8X A;  5ILV A;  1EV7 A;  3B02 A;  2DW4 A;  2IP2 A;  3K0L A;  5FFZ A;  1J2X A;  1IW7 F;  1OR7 A;  4M9Z A;  4UNO A;  1BI0 A;  3T8R A;  3F8F A;  4HOB A;  1TTY A;  4XBF A;  1CF7 B;  5EEH A;  1K6O A;  3IHU A;  5FD6 A;  2EFW A;  2ZXJ A;  2UWM A;  5TJJ A;  3T1B A;  4L9J A;  1Z6R A;  4P55 A;  1J5Y A;  4NQW A;  2XAG A;  2G9W A;  2DAO A;  5JHU A;  5ICF A;  1D8J A;  1TNT A;  4WCG A;  2Y75 A;  2EA4 A;  1K78 A;  1F4K A;  2P6T A;  1UHM A;  1REP C;  5BMZ A;  1ZLK A;  1RI7 A;  3FWE A;  1UB9 A;  2LNB A;  2LDU A;  4WK8 F;  3WG9 A;  3J7A O;  4G94 A;  2GXG A;  4CYD A;  2VBY A;  4L9N A;  3CUO A;  4WF2 A;  2GWR A;  5IT9 K;  3Q9V A;  3RPU A;  3WTZ A;  2FQ3 A;  2O0Y A;  4UV8 A;  3AAF A;  1R5G A;  2DK8 A;  2XAS A;  1G3Y A;  2XAH A;  3HRS A;  2PJP A;  4B8X A;  3KLN A;  3V7R A;  3RKX A;  5J8F A;  4ZYG A;  4KMF A;  1MZB A;  5HOO A;  1K7A A;  1R7J A;  1VTN C;  2V9V A;  4TV7 A;  3FHZ A;  4Y17 A;  3GZ6 A;  4EGZ A;  5D8L B;  3GFL A;  3E5U A;  1IXS B;  1XCV A;  1MJA A;  3T5X A;  4RGU A;  1IZ1 A;  3I5U A;  3KP6 A;  1QGP A;  4QWQ A;  3SQN A;  5DDG A;  4Y13 A;  2D1H A;  4YFN F;  3P9K A;  5JR3 A;  4LFU A;  1A04 A;  5K5R A;  1MKM A;  4EM1 A;  2L4M A;  3TGN A;  4IRH A;  4OOI A;  4MTE A;  1FX7 A;  4KMU X;  2R7F A;  2JSC A;  4ENN A;  3R4K A;  4A5M A;  2Q8K A;  4U0Y A;  1JXS A;  5D5U B;  4CDG A;  5ICC A;  3ZMZ A;  1J59 A;  2MLK A;  2Y0M A;  4GO1 A;  1ZRC A;  1TQM A;  2QUF A;  2YPR A;  2OZU A;  1FP2 A;  1QBJ A;  4EJU A;  3S2W A;  5E1Z B;  2ZME A;  1HW5 A;  4HLX A;  4MEY F;  1YS7 A;  4RAY A;  4OIO F;  3F6O A;  5LHI A;  3GEZ A;  3FZV A;  4R1H A;  1OKR A;  5HS8 A;  4F7Z A;  1KQ8 A;  4G6D A;  1H9T A;  2H27 A;  3MAJ A;  5JVT A;  2L01 A;  5F1R A;  1FBS A;  4I98 B;  3F3X A;  1IXC A;  2GXB A;  4OIP F;  3SZP A;  5HLH A;  4HQM A;  3HTS B;  2NNN A;  5HS7 A;  1P4W A;  4IVN A;  4BHC A;  1W5T A;  4S04 A;  1WQ2 A;  3JAM Z;  4KYW A;  1LJ9 A;  2HFH A;  1FBU A;  1T38 A;  3JAM K;  5LRS A;  2OQG A;  2A07 F;  2FXA A;  3WGH A;  2JPB A;  3FXU A;  1TQP A;  4B09 A;  3GUD A;  4JQF A;  4G9Y A;  3V4G A;  4WXD A;  3F8N A;  3E97 A;  1XDS A;  1SD4 A;  4IXA A;  3J81 Z;  2J5P A;  3GFJ A;  3WTS C;  4L5J A;  5HLI A;  3Q5F A;  4O3M A;  3W6K B;  3FF5 A;  4FHT A;  4ZYH A;  3F23 A;  1XGS A;  1BIB A;  2PI0 A;  2ETH A;  1R36 A;  1XN7 A;  2BGC A;  4IRI A;  4D0P A;  3LST A;  1NHA A;  3IKV A;  3EQL F;  2NS0 A;  1EH8 A;  1MDM B;  4OU0 A;  2A6E F;  3GW2 A;  1WI9 A;  1SFE A;  4EMS A;  3BZ6 A;  1XD7 A;  1HST A;  2YX4 A;  1GHC A;  3P7N A;  1RIO H;  2MA3 A;  4EM2 A;  1K79 A;  1W7P D;  2EV6 A;  2IW5 A;  3HRU A;  4ENK A;  3WU1 B;  5CVV A;  3IWZ A;  3F8M A;  4CIC A;  3P9I A;  1I1G A;  3DXJ F;  1DPR A;  4FX4 A;  3RJP A;  5DEQ A;  1FBQ A;  2YR2 A;  2XUB A;  2QVO A;  5E8I A;  1GXP A;  5LEK A;  2NAZ A;  3BWG A;  2H6C A;  3WGG A;  3IRQ A;  5FLX K;  2HOE A;  2A68 F;  3ECO A;  2QQB A;  2UXX A;  5AIQ A;  2FE3 A;  1P2F A;  1SAX A;  4G6Q A;  2RQP A;  2VT3 A;  1UST A;  3N97 A;  2FEZ A;  1Q1H A;  1LVA A;  2X4H A;  2M87 A;  4ESJ A;  4OIQ F;  3ZMD A;  5HDG A;  3K1N A;  3NRV A;  2PLY A;  3ULQ B;  2A6H F;  2AS5 F;  1OMI A;  1R1U A;  4ETS A;  3KP7 A;  1WRJ A;  3R6S A;  3RYR A;  2Y48 A;  3MZH A;  3QOP A;  2XKO A;  5LHH A;  4LGW A;  4XSZ F;  1YFH A;  3C3W A;  2QWW A;  4OIR F;  1KU9 A;  4PCQ A;  2FNA A;  2RV8 A;  5AIP A;  1U5T B;  3EET A;  1FLI A;  2CW0 F;  3EYY A;  4GCV A;  2HTS A;  1QO0 D;  1R58 A;  4AIH A;  2ZNY A;  2XAJ A;  4N0B A;  2CG4 A;  4HDU A;  1SMY F;  4LG0 A;  4YG2 F;  2GA1 A;  4U7D A;  1FNN A;  2ZCW A;  1U5T A;  2LF7 A;  1XB4 A;  5FGM A;  5DCM A;  1RZ4 A;  3SXY A;  2RGV A;  4RAZ A;  2C6Y A;  1LDD A;  4KIB A;  4A0X A;  3COA C;  1WKM A;  2QBY A;  1QPM A;  2EFQ A;  4EQQ A;  3F22 A;  1U78 A;  3GFM A;  3L09 A;  1XSD A;  2PN6 A;  1BM9 A;  3ZMS A;  2F5C A;  1ZGJ A;  5TRD A;  3E6B A;  4BHP A;  2HDC A;  3ECH A;  2OQR A;  4P9U A;  2ESN A;  2K4J A;  1J7K A;  1B9N A;  3F8C A;  4G7O F;  1KYW A;  3RIR A;  3T8T A;  5D8K B;  1TW2 A;  5FB2 A;  5L3C A;  1ON2 A;  3DQV C;  3WTY C;  2HQN A;  1R1T A;  4G7Z F;  3TKY A;  5LGU A;  4HZF A;  1T0F A;  3BY6 A;  2L02 A;  1FPQ A;  1UHW A;  2DI3 A;  4UHT A;  2Q2E A;  2PFB A;  1JGS A;  2YU3 A;  2DBB A;  2YX7 A;  5ILS A;  2DQR A;  1B9M A;  5BOX A;  3GYH X;  3MCZ A;  5EEG A;  1BBY A;  4I0B A;  2GQQ A;  2D1V A;  5DUI A;  3O6B B;  3T0Y A;  1BJA A;  1D5V A;  2HR3 A;  2ZBK A;  3TQN A;  1K78 B;  4BHB A;  3ZQ7 A;  1ZAR A;  3M8E A;  4AD9 A;  2QEN A;  2ZKZ A;  3KZY A;  1H9G A;  4MEX F;  3KP3 A;  4ZH4 F;  4HX8 A;  1QZY A;  1ON1 A;  5D5X B;  4CO8 A;  4EJT A;  1OYY A;  2NYX A;  1ZRE A;  3J81 K;  2CGP A;  2EB7 A;  3WE3 A;  2WC2 A;  1XMK A;  3K1P A;  2LSO A;  1R5H A;  4LK1 F;  1X3U A;  1JHH A;  3HYI A;  4PGH A;  1DP7 P;  1O7L A;  5A2Q K;  4HYE A;  2P7C B;  1LNW A;  2E7X A;  3GX4 X;  3EYI A;  2IVM A;  2JRT A;  3QPH A;  3QPT A;  2EK5 A;  2VE9 A;  3JTG A;  3LAP A;  1FSE A;  3HRT A;  4HV6 A;  2TDX A;  1USS A;  5IT9 Z;  2VT2 A;  3GLX A;  4M71 A;  3H92 A;  1G4D A;  4I01 A;  4Y15 A;  2OD5 A;  4ZYE A;  1T98 A;  2XRO A;  1TLH B;  1ODD A;  4LB6 B;  2DT5 A;  5L3E A;  1ZG3 A;  4L5I A;  3HTU A;  1ZGA A;  2DQL A;  2FBI A;  1LB2 A;  2VON A;  5H6Q A;  4IRG A;  2QQA A;  3ZPL A;  1IAW A;  1ONV A;  3C18 A;  2V1U A;  1HSJ A;  1KU3 A;  4HAM A;  3LA7 A;  2QM3 A;  2H94 A;  5K1Y A;  3GFI A;  2KJC A;  1IUY A;  3KP4 A;  2UZK A;  3KEO A;  4H0E A;  2M5W A;  3CDH A;  3HHH A;  1HQC A;  3RKW A;  2XKP A;  5F6F A;  4I09 A;  1U2W A;  2V6C A;  1W5S A;  4KN4 X;  1Z6T A;  3DPT A;  2K4B A;  3FXR A;  2O6G E;  2HTJ A;  1KGS A;  2XAQ A;  4U7B A;  4QLC U;  1YO5 C;  4Q4Z F;  1BI1 A;  4YII A;  2VC1 A;  3RKY A;  3K1M A;  4FX0 A;  1PP8 F;  2IJL A;  3V8L A;  3HOT A;  3VOE A;  1Z05 A;  1XMA A;  2QBY B;  2M1B A;  5CVI A;  2IPQ X;  5J6X A;  3G3Z A;  3I0T A;  3BJO A;  3BPV A;  6PAX A;  5DCM B;  3GO5 A;  2IA0 A;  2JZY A;  2EFN A;  4M73 A;  2Z9O A;  3DP7 A;  3O2P E;  4HA8 A;  3FM5 A;  4EV0 A;  2LF8 A;  5D5W B;  2M45 A;  3RPQ A;  5CVR A;  3HRM A;  1DPU A;  1R23 A;  4ON0 A;  1I6X A;  5BS6 A;  1ZYR F;  2HKX A;  2Z5U A;  4G8X A;  2XGX A;  2OAZ A;  2V1X A;  4XSX F;  3ISP A;  1ZN2 A;  1P92 A;  2CO5 A;  2HS5 A;  5AON A;  1AOY A;  3GZ5 A;  2Z99 A;  4HDV A;  4HBL A;  3D5L A;  3FMR A;  2JPC A;  5BPD A;  2RNJ A;  5DD4 A;  3VFZ A;  4EM0 B;  1MDM A;  1J0R A;  2WV0 A;  3WOD F;  4DQ2 A;  1O3T A;  1B6A A;  3MWM A;  2G7U A;  2VE8 A;  2EA2 A;  4LLN A;  3R0J A;  5ICE A;  3C7J A;  3TOB A;  5L3G A;  5DV5 A;  1MJ9 A;  1FT9 A;  1BN5 A;  3VB2 A;  2WWY A;  4CGZ A;  2HGC A;  1P4A A;  1HKQ A;  5K5O A;  2BBY A;  1HW2 A;  5FD5 A;  5JI6 A;  4N9H A;  3RDI A;  4A5N A;  3HUG A;  2RVC A;  1R00 A;  3WU0 A;  4HX4 A;  1H0M A;  3LFK A;  5HS9 A;  4BQA A;  1JHF A;  2D2W A;  2ZJ2 A;  2B0L A;  1F5T A;  4YIF A;  4AIK A;  2DU9 A;  1D8K A;  1XSX A;  3SFZ A;  4L0Y B;  4P96 A;  1UFM A;  4M6Y A;  4NHJ A;  2FRH A;  4AVP A;  3ZN1 A;  5LHG A;  2DPU A;  3TO7 A;  2AXL A;  4EGY A;  3M7G A;  1HW1 A;  4KNY A;  3I59 A;  2M30 A;  1UCR A;  2V79 A;  4IHT A;  3BDD A;  3LA2 A;  4OMY A;  2XRN A;  5H6R A;  5D6E A;  2A61 A;  3OV8 A;  5CJ9 A;  1BI2 A;  1TBX A;  5L3F A;  4RB1 A;  3HHG A;  4M72 A;  4RGS A;  2H6B A;  1ULY A;  1RNL A;  3DFG A;  2OU2 A;  3L2C A;  5A2Q Z;  2HWV A;  3BP8 A;  2H09 A;  3GWZ A;  1KA8 A;  4OMZ A;  3IC7 A;  3I54 A;  5ERI A;  2HYG D;  1QQI A;  3DKW A;  1IN4 A;  4P5O A;  1EH6 A;  1YG2 A;  4UVB A;  2X0L A;  5D4R A;  4PZJ A;  1ZLJ A;  3PFI A;  3FMQ A;  3SZT A;  3ABT A;  4BNC A;  4EJO A;  2Q0O A;  1FC3 A;  5DCF A;  3FX3 A;  3V7S A;  4NB5 A;  5E1X A;  4XLP F;  3IKT A;  1G6N A;  4PGG A;  4KIF A;  1GVJ A;  5IT3 A;  2RN7 A;  3LQR A;  2PBI A;  1YW9 A;  4AIJ A;  2ACJ A;  3ZMT A;  5D5V B;  2FU4 A;  2CFX A;  1BIA A;  4A0Z A;  2PEX A;  1U3E M;  3W6J B;  2BEO A;  3GF2 A;  3R61 A;  2ZFW A;  3ML6 A;  3QP5 A;  5FLX Z;  1Y0U A;  4K2E A;  2W24 A;  5LEJ A;  3E6C C;  2O03 A;  4A0Y A;  1KU2 A;  4MQ9 F;  2MH9 A;  1F1Z A;  4PDK A;  3U9G A;  1OYI A;  1IN5 A;  4A2U A;  1V4R A;  4RGR A;  2Z3Y A;  2L4A A;  4E70 A;  1GXQ A;  4IJA A;  3F6V A;  4UVA A;  1PUE E;  1LEB A;  3BJA A;  2CWE A;  4WX9 A;  1O3S A;  3RTR A;  3CO6 C;  4M6X A;  5CLS A;  3K2Z A;  1YW8 A;  2W84 A;  4MQV A;  1B59 A;  3KFW X;  4M9S A;  2BV6 A;  3IL2 A;  4UXN A;  2DPD A;  4YFK F;  3OOP A;  4HW0 A;  3DF8 A;  3GVA A;  3I53 A;  4ZZD A;  3TDU C;  2ZO4 A;  5JFR A;  1G3T A;  4XLN F;  2WTE A;  1ZHF A;  1ZH5 A;  1R22 A;  1QNT A;  2HQR A;  4RB0 A;  2ZME B;  3WGI A;  1STZ A;  4XRF A;  4ENM A;  3V7C A;  3LWF A;  1B4A A;  2JT1 A;  2MH2 A;  2PQ8 A;  1BI3 A;  1IF1 A;  2K02 A;  3IWF A;  3DPL C;  3ZN0 A;  4WXH A;  3WTW C;  3TOA A;  2EV0 A;  1J75 A;  1O57 A;  3CUQ A;  1LQ1 A;  5K5Q A;  1WSU A;  2COM A;  4CXF A;  1S7O A;  1KU7 A;  1KQ9 A;  1XDU A;  1YQA A;  4HQE A;  3HIF A;  5L3B A;  2E1C A;  1XCB A;  3D0S A;  3GXO A;  4GGG A;  1IN7 A;  3KCC A;  3TO9 A;  3M8F A;  5D4S A;  2ISZ A;  4A12 A;  2MD5 A;  1SFX A;  1L0O C;  3WTT C;  4JBA A;  3CJN A;  1HXD A;  2KIF A;  3KLO A;  5DD8 A;  2XIG A;  3LA3 A;  3H3Z A;  3VEP A;  1P4X A;  1U5T C;  1S29 A;  3VOD A;  2K7L A;  4LK0 F;  3N4M A;  5FO5 A;  2W57 A;  4L0Z B;  5LLQ A;  4HF0 A;  5H20 A;  3BPX A;  1FYM A;  2VBW A;  4LMY A;  3RI4 A;  1BC7 C;  3O3K A;  4LB5 A;  2KIU A;  2A69 F;  1Z1D A;  4G7H F;  3ROU A;  3ELK A;  2KKO A;  1E17 A;  4OIN F;  1T39 A;  3K69 A;  1TW3 A;  1T2K A;  3WTX C;  3R0A A;  3I4P A;  2EFP A;  2IRF G;  5E1W A;  2RC4 A;  1T6S A;  3FM3 A;  4I0A A;  4ESF A;  2F2E A;  3J80 Z;  1EH7 A;  2K27 A;  2EWN A;  2VOD A;  2EJR A;  3JSP A;  1RUO A;  4N9I A;  3BJ6 A;  3LQQ A;  1IRF A;  4RGX A;  3CUQ C;  2OZ6 A;  2G7H A;  5HDN A;  2QQ9 A;  2KJB A;  4KA4 A;  2BE5 F;  3PQK A;  4MNU A;  2VN2 A;  3I59 B;  1FY7 A;  2RDP A;  2ADU A;  5HVQ C;  1W7P B;  4ZZL A;  2GZW A;  2K86 A;  2E7W A;  2QYO A;  3REO A;  4BH9 A;  4YFX F;  1KQ0 A;  4S05 A;  5ED4 A;  1KYZ A;  2F5D A;  2XVC A;  2YSR A;  4I2O A;  1LEA A;  1Z9C A;  1YLF A;  4ZYD A;  4GYI A;  1DDN A;  5KK1 A;  2ELH A;  1LDK B;  3BRO A;  3G73 A;  1BC8 C;  2DK5 A;  1I5Z A;  1ZG1 A;  1B1B A;  3FMS A;  1OPC A;  4IHS A;  4KIC A;  4Q47 A;  1ZRF A;  2GAU A;  3ZMU A;  4KFC A;  3KZZ A;  2DO7 A;  1D3Y A;  3E6D A;  3E6M A;  1J9I A;  1U6G A;  3E3V A;  1XGN A;  2FMY A;  4I7H A;  2E1N A;  4U88 A;  1JE8 A;  2MBF A;  4M9X A;  4LLL A;  3EUH A;  2P5L C;  5ICG A;  1SD7 A;  1RUN A;  1DUX C;  4LJZ F;  5E20 A;  1I1S A;  4FT8 A;  1V3F A;  2F5F A;  4L18 B;  5FFX A;  4L9V A;  4Q5S F;  2VBZ A;  5E18 F;  2L54 A;  1O7F A;  3F21 A;  3C1D A;  2MC3 A;  2GIV A;  4CHU A;  2KIM A;  1U8R A;  2VC0 A;  4L9T A;  3CO7 C;  2EFO A;  3V8K A;  5HLG A;  5BQT A;  5LGT A;  1YIO A;  2OBP A;  2ESH A;  2P6S A;  5DYM A;  1FWZ A;  1XGO A;  1YS6 A;  4EJW A;  3CLO A;  5ILU A;  3DEU A;  2MLG A;  2VOP A;  3MFK A;  5DUK A;  1LDJ A;  2ISY A;  4LLG F;  3E5X A;  4R79 A;  2VXZ A;  3JW4 A;  3HOS A;  1MJB A;  3B73 A;  1SD5 A;  4KUM A;  4BAY A;  5E8G A;  3JSO A;  3QU6 A;  2VOO A;  2CSO A;  1PP7 U;  3FXQ A;  3WTV C;  1E2X A;  1ZRD A;  5E17 F;  2NRA C;  4RB2 C;  3ZP5 A;  3HSF A;  2UXN A;  1CGP A;  2PMH A;  2XAF A;  2Z33 A;  2STT A;  5CVJ A;  2QZ8 A;  4RS8 A;  2HEO A;  1S6L A;  1BOA A;  1C0W A;  1ZAO A;  2W85 A;  2STW A;  3QP6 A;  5LBQ A;  2VBX A;  1G3W A;  1IN8 A;  4P9F A;  1XSV A;  2ZNZ A;  1S7A A;  4ENJ A;  3MEX A;  2IT0 A;  4WXC A;  1S3J A;  4A6D A;  3I64 A;  2FOK A;  2FBK A;  4WWC A;  5D6F A;  4BYY A;  3NEU A;  2HYF A;  5KVR A;  1YW7 A;  2KRF A;  3DV8 A;  1PDN C;  1CF7 A;  5J8C A;  2DTR A;  3KEQ A;  2LKP A;  3KE2 A;  2CYY A;  3NQO A;  2R7D A;  3HSE A;  4MGR A;  1IN6 A;  2FBH A;  4GXO A;  4UV9 A;  4UUV A;  3F8B A;  2PMU A;  2A5Y B;  4Q48 A;  2P5V A;  4KT5 C;  2JTV A;  2FNP A;  3SHF A;  2FF4 A;  4DNC A;  1I27 A;  3QU3 A;  1FYK A;  4ASN A;  4EVI A;  5CVU A;  3MZY A;  4RB3 C;  3I58 A;  4U0V A;  2RKH A;  2P7V B;  3K9T A;  1MD0 A;  1Z7U A;  2V1D A;  3KP5 A;  5L3D A;  3CUQ B;  3R60 A;  4LD5 A;  1SD6 A;  2DLL A;  4I02 A;  3J80 K;  4MHG A;  4HF2 A;  2W25 A;  3IRR A;  1S8N A;  3P9C A;  5CYV A;  3WTU C;  2J5O A;  2OA4 A;  2HKO A;  3Q9S A;  3M9A A;  1F9N A;  1L3L A;  1O3R A;  1IXR C;  3I71 A;  1OYW A;  4MTD A;  2IA1 A;  2O61 A;  2F5E A;  4UVC A;  2L3D A;  2XHK A;  3MQ0 A;  4IPA A;  1W4M A;  3L7W A;  2O3F A;  1P6R A;  3TDZ C;  1Z91 A;  3U1D A;  5F64 A;  1WWX A;  2P4W A;  1FSH A;  1G3S A;  4LG0 B;  3CTA A;  4KIG A;  4HX7 A;  4CZZ A;  3ERE D;  1SFU A;  3V8J A;  2NNY A;  1AWC A;  2A3S A;  4EJV A;  4M74 A;  1R1V A;  2DFI A;  1FP1 D;  2R3S A;  3M1E A;  3WE2 A;  1W7P A;  2BYV E;  2CQK A;  1SMT A;  4ESB A;  4AWX B;  3HSR A;  4A6E A;  4O5V A;  5LRR A;  4JK1 X;  2M8E A;  1TQI A;  2GA2 A;  3BOQ A;  1XGM A;  1FOK A;  3QAH A;  1FYL A;  3TO6 A;  2XV4 S;  2IA2 A;  2P8T A;  4HF1 A;  4BXU A;  3U2R A;  1HBX G;  3E5Q A;  1TNS A;  4O6J A;  2D45 A;  3L00 A;  3PQJ A;  5HDK A;  3QRF F;  1IRG A;  2QLZ A;  3EDP A;  3H3U A;  1HKS A;  4GYG A;  3JTH A;  4HLY A;  2FSW A;  1YYV A;  4KDP A;  1ZG5 A;  3ABU A;  4U0W A;  1QZZ A;  3F72 A;  4KN7 X;  2PG4 A;  3ZMV A;  1O3Q A;  3L9F A;  4HV5 A;  1FZP B;  5LGN A;  2FA5 A;  3KET A;  4IF4 A;  1YTY A;  4Z2Y A; 
#chains in the Genus database with same CATH topology
 3RKQ A;  2F5V A;  1VI0 A;  5BPI A;  2R7V A;  3IH3 A;  1HKT A;  4BE0 A;  3BQY A;  2EV5 A;  2HZT A;  3K4J A;  1OQY A;  4BEH B;  1NTC A;  3H5N A;  3KP2 A;  4R8H A;  3LAJ A;  1D1C A;  2FML A;  2P5K A;  3RYP A;  1MGT A;  4BU2 A;  1HA8 A;  4ZJZ A;  4CA0 A;  2O8X A;  5ILV A;  3S2D J;  1EV7 A;  4RAF A;  3B02 A;  2VKV A;  2DW4 A;  1FTZ A;  3W3C A;  1ITY A;  2IP2 A;  3K0L A;  5FFZ A;  1J2X A;  1D0Y A;  3QWL A;  3PIP F;  2B7E A;  1VZ0 A;  1IW7 F;  1OR7 A;  4M9Z A;  2R7T A;  4UNO A;  3G2B A;  1BI0 A;  3T8R A;  3PL8 A;  1VQP I;  1P9Q C;  3F8F A;  3OYA A;  4AUX A;  2ZJQ F;  1SVL A;  4HOB A;  1TTY A;  4XBF A;  1CF7 B;  5EEH A;  3CZ6 A;  3L2V A;  2PX9 A;  2PMZ A;  2X9D A;  1FJL A;  1K6O A;  2E1M B;  3IHU A;  5M5Y J;  3WHB A;  3S15 J;  1KON A;  5FD6 A;  2EFW A;  1YRN A;  2ZXJ A;  2W4S A;  2UWM A;  1V5G A;  1V55 H;  5TJJ A;  3IV5 A;  3T1B A;  4L9J A;  2DJN A;  3OYB A;  1IO2 A;  1P7I A;  3PSF A;  3DBR B;  2KZG A;  1Z6R A;  4P55 A;  2H1K A;  1PVE A;  1J5Y A;  2QF7 A;  4NQW A;  1VFC A;  2XAG A;  2G9W A;  2DAO A;  3S1N J;  3DEW A;  2JN6 A;  3CCM I;  5JHU A;  3CP2 A;  5ICF A;  1D8J A;  1GDT A;  1TNT A;  3HZJ A;  4WCG A;  3BQZ A;  4NC8 A;  2Y75 A;  1E3P A;  1T33 A;  2EA4 A;  2BVL A;  4D7M A;  1W36 C;  3K4N A;  1FMW A;  1K78 A;  3ABM H;  1F4K A;  1WCM J;  2P6T A;  2GLO A;  2DMN A;  1UHM A;  3HPG A;  1REP C;  5BMZ A;  1ZLK A;  1RI7 A;  3FWE A;  1UB9 A;  2LNB A;  3K4C A;  2LDU A;  3KEY A;  4WK8 F;  3QOE A;  3WG9 A;  3VPR A;  2OF7 A;  3J7A O;  4G94 A;  5B1A H;  3OS2 A;  1TT0 A;  3SEQ A;  2GXG A;  4CYD A;  1J09 A;  2VBY A;  5F08 A;  4L9N A;  3CUO A;  3GTK J;  4WF2 A;  2GWR A;  5IT9 K;  1OIS A;  3OR2 C;  3Q9V A;  3RPU A;  1IUF A;  3WTZ A;  2HXI A;  2FQ3 A;  5FKK A;  3VSL A;  3UKG A;  2O0Y A;  3PFY A;  4UV8 A;  3AAF A;  1WJC A;  5GPA A;  1IDY A;  4A3C J;  1R5G A;  2DK8 A;  2XAS A;  3CC2 I;  4KIT B;  1G3Y A;  2XAH A;  4FE7 A;  3HRS A;  2PJP A;  4B8X A;  2IS2 A;  3KLN A;  2W48 A;  4BJT A;  1QVT A;  3V7R A;  1MBG A;  5E3L A;  3OY9 A;  3RKX A;  5J8F A;  3FXJ A;  2O9L A;  4ZYG A;  2HVS A;  3W2A A;  4KMF A;  2LY9 A;  2PJR A;  1Y1W J;  1QZE A;  3LL7 A;  1JUP A;  1MZB A;  2NVU B;  1LPQ A;  1K4S A;  3MD2 A;  2OCC H;  1ACI A;  2O7O A;  3BC8 A;  5HOO A;  1K7A A;  3H3V K;  1R7J A;  1MND A;  5DS9 A;  2V9V A;  1VTN C;  4CYC B;  4TV7 A;  3FHZ A;  4Y17 A;  4E7L A;  2X6Y A;  1Y6I A;  3GZ6 A;  1MMG A;  1H8A C;  4EGZ A;  5F0C A;  5D8L B;  3GFL A;  2QSH X;  3RPU D;  3E5U A;  1IXS B;  1XCV A;  3TL4 X;  1MJA A;  2VQH A;  3Q3S A;  3T5X A;  1MBF A;  4RGU A;  1IZ1 A;  3BLY A;  2IGN A;  4PUS A;  3I5U A;  3KP6 A;  1QGP A;  2VXD A;  4QWQ A;  3SQN A;  5DDG A;  4BDY A;  4Y13 A;  5GAH J;  2D1H A;  4YFN F;  2TRT A;  1A5J A;  2Y9Y A;  4G12 A;  3AKZ A;  1JGG A;  3P9K A;  2LRD A;  5E3N A;  5JR3 A;  4LFU A;  1A04 A;  2AQF A;  2ZME C;  5K5R A;  3TW7 A;  1MKM A;  4EM1 A;  1TWH J;  1LUJ B;  4A3G J;  2L4M A;  4IZZ A;  4IL6 C;  3TGN A;  4IRH A;  4OOI A;  2K9M A;  4QPQ A;  4MTE A;  3JCU C;  1FX7 A;  2ZXH A;  4KMU X;  2R7F A;  1ETQ A;  4E7S A;  2XGE A;  2JSC A;  1X3W B;  4ENN A;  4XL9 A;  2LFB A;  3S1M J;  3R4K A;  2B9S A;  2OV7 A;  4A5M A;  2Q8K A;  4U0Y A;  1JXS A;  5D5U B;  4CDG A;  3O8G A;  3ZMZ A;  5ICC A;  3FIW A;  1J59 A;  2MLK A;  2Y0M A;  2FQ4 A;  4N4N B;  1VND A;  1XTA A;  2E2J J;  4GO1 A;  3CCY A;  1ZRC A;  1TQM A;  2QUF A;  2YPR A;  3DLL F;  5FKN A;  3JRC A;  2OZU A;  1FP2 A;  1QBJ A;  4EJU A;  1WFX A;  3S2W A;  1X1B A;  5E1Z B;  2LOO A;  2CW8 A;  2ZME A;  1HW5 A;  4HLX A;  4MEY F;  3JRB A;  1YS7 A;  4IHV A;  3CMY A;  4RAY A;  1W0T A;  2XGD A;  4OIO F;  3F6O A;  3KX2 A;  5LHI A;  3GEZ A;  3FZV A;  2ZC2 A;  1OCT C;  1MBE A;  3K7A J;  2DJI A;  4JP0 A;  1OKR A;  1Y0N A;  4R1H A;  5HS8 A;  5C44 J;  4F7Z A;  3S1Q J;  1KQ8 A;  2WAQ N;  3HKZ A;  4G6D A;  1H9T A;  2H27 A;  1ETX A;  3MAJ A;  5GPC A;  2DMT A;  5JVT A;  2L01 A;  5F1R A;  1B8I A;  1FBS A;  1WJD A;  3E0J B;  4I98 B;  3F3X A;  3G1M A;  2LKS A;  1IXC A;  2GXB A;  4IHX A;  4OIP F;  2QQ8 A;  3SZP A;  5HLH A;  2ID3 A;  4HQM A;  3HTS B;  2NNN A;  5HS7 A;  4AC0 A;  1PJR A;  1P4W A;  4IVN A;  4BHC A;  4NDL A;  1W5T A;  1OLT A;  1WQ2 A;  3JAM Z;  4S04 A;  4KYW A;  1LJ9 A;  2HFH A;  3OYK A;  1GT0 C;  1AKH B;  1FBU A;  1T38 A;  3JAM K;  5LRS A;  2OQG A;  2A07 F;  1WPK A;  2FXA A;  3WGH A;  4E6K G;  1WVR A;  2JPB A;  4MFD A;  3A4C A;  5J47 A;  2KRH A;  3FXU A;  4XIC A;  3JRG A;  4XID A;  1H89 C;  1R4M B;  3A03 A;  1T56 A;  3GBG A;  2JQ7 A;  1TQP A;  2DA4 A;  4B09 A;  3GUD A;  1JUM A;  4G9Y A;  4JQF A;  1VQO I;  1X4P A;  3DBH B;  3V4G A;  4WXD A;  3F8N A;  2DXI A;  3W2W A;  3E97 A;  1XDS A;  1SD4 A;  4IXA A;  3J81 Z;  2R92 J;  3EUK L;  2J5P A;  3GFJ A;  4XLC A;  1SAN A;  5CQE A;  3WTS C;  5IPA A;  4L5J A;  1SVO A;  5HLI A;  3AG1 H;  3Q5F A;  2XB5 A;  1MMD A;  4UY8 I;  1OFC X;  4O3M A;  4AVZ A;  4XK4 A;  3KZI C;  2K9L A;  3W6K B;  3FF5 A;  4IKF A;  2F4O B;  1RES A;  4C2M J;  2KMU A;  4FHT A;  3OR1 C;  2L9N A;  2OTJ I;  4ZYH A;  2XC7 A;  1MNM C;  4IQJ A;  2R5Z A;  3F23 A;  1MIJ A;  4BXX J;  1XGS A;  1BIB A;  2KLO A;  3B6A A;  2PI0 A;  2ETH A;  3CD6 I;  4DYQ A;  1R36 A;  1XN7 A;  2BGC A;  4IRI A;  2K9Q A;  2XF7 A;  1A6Q A;  5EF6 A;  4E7J A;  1IRX A;  1UJ8 A;  4D0P A;  3C2B A;  3LST A;  1X1D A;  3CME I;  4NQW B;  2WB1 N;  1JTX A;  1NHA A;  3IKV A;  3EQL F;  2NS0 A;  3H35 A;  1EH8 A;  1MDM B;  4OU0 A;  2EIM H;  1BW5 A;  2VJ5 A;  2A6E F;  3GW2 A;  1NH3 A;  1WI9 A;  2ELJ A;  3LSP A;  1SFE A;  3HKZ N;  4EMS A;  2E35 A;  3BZ6 A;  1XD7 A;  1ZTR A;  3MKW B;  1OCC H;  1HST A;  2LBF B;  2HYJ A;  1FOX A;  2YX4 A;  1GHC A;  2XDV A;  1A6I A;  2R5Z B;  2Y9Z A;  1ERD A;  3P7N A;  2MA3 A;  1RIO H;  2NS8 A;  4EM2 A;  1K79 A;  3W6V A;  1W7P D;  2EV6 A;  2IW5 A;  1W5C C;  3BG3 A;  3HRU A;  4ENK A;  3WU1 B;  5CVV A;  3IWZ A;  3F8M A;  4CIC A;  3P9I A;  1I1G A;  3CES A;  3DXJ F;  2WY8 Q;  5TGT A;  1DPR A;  4FX4 A;  3RJP A;  1YJN I;  5DEQ A;  1S72 I;  1FBQ A;  2YR2 A;  2EPF A;  1IV6 A;  2XUB A;  1B72 A;  2QVO A;  5E8I A;  1GXP A;  5E3O A;  1X1C A;  4C30 A;  5LEK A;  2NAZ A;  3BWG A;  2H6C A;  4N4O B;  2X6X A;  2CUZ A;  3WGG A;  3IRQ A;  2B63 J;  5FLX K;  3BZC A;  1Z21 A;  5EDN A;  2HOE A;  5F0F A;  2A68 F;  3HG9 A;  3HEF A;  3ECO A;  3LFU A;  2QQB A;  3BG9 A;  2DOD A;  2UXX A;  3HUG B;  5AIQ A;  2FE3 A;  3GLL A;  1P2F A;  2WAF A;  1SAX A;  3VYU B;  1FOY A;  4G6Q A;  1IDZ A;  2HDD A;  2ZFU A;  3G6E I;  3JR9 A;  2RQP A;  2DMP A;  2VT3 A;  1UST A;  3OWT A;  2QGU A;  3N97 A;  4XKV A;  2FEZ A;  1Q1H A;  1LVA A;  2X4H A;  2M87 A;  2N8G A;  4ESJ A;  1H88 C;  4OIQ F;  3ZMD A;  2BZT A;  3Q0V A;  4EAT A;  5HDG A;  3K1N A;  4CCM A;  3NRV A;  4Y4R A;  3ULQ B;  2PLY A;  2VPR A;  5FKO A;  2A6H F;  5J4Y A;  3FXK A;  2AS5 F;  5J1U A;  1OMI A;  1TT5 B;  2R7O A;  2L9V A;  1R1U A;  2DFH A;  5EZH A;  4ETS A;  3KP7 A;  4PJ0 C;  3EPZ A;  1WRJ A;  1EF4 A;  3R6S A;  3RYR A;  2Y48 A;  2JA8 J;  3MZH A;  2HNH A;  3QOP A;  2XKO A;  3GME A;  5LHH A;  4LGW A;  2HDW A;  4XSZ F;  1YFH A;  1HOM A;  2EBI A;  3CJR B;  3C3W A;  1DU0 A;  2QWW A;  1KU9 A;  4OIR F;  4LG3 A;  1NG7 A;  2NVT J;  2AQE A;  1ENH A;  4PCQ A;  3PJR A;  3H9J A;  2FNA A;  2RV8 A;  4YRV A;  4BY1 J;  1RR7 A;  5AIP A;  2IXS A;  4CCO A;  3CLQ A;  4QTR A;  1U5T B;  5J1Y A;  1QPI A;  3EET A;  2CQX A;  5JLX A;  1HCR A;  2CUE A;  5GP9 A;  1FLI A;  2CW0 F;  3EYY A;  3CDL A;  4GCV A;  2HTS A;  5B3S H;  3PIO F;  2R7R A;  1I6H J;  4UUS B;  1G2H A;  3OYM A;  5C4X J;  1QO0 D;  3ASN H;  1R71 A;  1R58 A;  3OIO A;  4XLE A;  4BS9 A;  1T08 B;  4AIH A;  2ZNY A;  2XAJ A;  4N0B A;  2COB A;  3CJT B;  2CG4 A;  2R0Q C;  1SC7 A;  2ZSI B;  3KIO A;  3TW6 A;  4HDU A;  1SMY F;  1UG2 A;  4LG0 A;  4YG2 F;  3OS1 A;  3UNG C;  1GV5 A;  5M5X J;  2GA1 A;  4U7D A;  1DQU A;  1FNN A;  2ZCW A;  1U5T A;  3DU5 A;  2LF7 A;  3HBL A;  5IP6 A;  1XB4 A;  2IAI A;  1ZK8 A;  3LSK A;  5FGM A;  5DCM A;  1RZ4 A;  3SXY A;  3HM5 A;  3MKY B;  2RGV A;  3LOC A;  3ZQI A;  1E3H A;  4RAZ A;  1K6Y A;  2C6Y A;  2L9S A;  2GBY A;  3BR0 A;  1LDD A;  2WA0 A;  3CQZ J;  3DBL B;  4KIB A;  4A0X A;  1VQM I;  5FLV A;  3COA C;  2PJR B;  3ABK H;  9ANT A;  1WKM A;  1BL0 A;  2QBY A;  1QPM A;  4CCN A;  4XNF A;  2EFQ A;  4EQQ A;  1DGW Y;  2ME6 A;  3F22 A;  2M7A A;  1U78 A;  3GFM A;  1S9H A;  4RDU A;  4BJ5 C;  3L09 A;  4E7K A;  3I4M J;  5JLW A;  2FJ1 A;  1XSD A;  4LIV A;  2MYS A;  3BT9 A;  4QPO A;  1VQ6 I;  2PN6 A;  1BM9 A;  3DWL E;  3ZMS A;  2F5C A;  3LSI A;  2MW8 A;  4QIW N;  4FTH A;  2NOG A;  1ZGJ A;  4B4C A;  5TRD A;  5C3E J;  3E6B A;  1X1A A;  4V2F A;  4BHP A;  2HDC A;  3ECH A;  4C2T A;  2OQR A;  3CCS I;  4P9U A;  2ESN A;  1LFB A;  2K4J A;  2H8R A;  3GTJ J;  1J7K A;  1B9N A;  3F8C A;  3CCU I;  4G7O F;  1RKT A;  1KYW A;  2JRM A;  3RIR A;  3T8T A;  5D8K B;  1TW2 A;  2LY1 A;  5FB2 A;  5L3C A;  2LG4 A;  4XLH A;  1ON2 A;  1XC5 A;  3DQV C;  3WTY C;  4DW6 A;  2HQN A;  1R1T A;  4G7Z F;  3TKY A;  3FXO A;  5LGU A;  4HZF A;  1ZKG A;  1T0F A;  3BY6 A;  3HGY A;  2L02 A;  4YIR X;  2H8W A;  3SEZ A;  5IOY A;  1FPQ A;  1UHW A;  2DI3 A;  4G6T B;  3OYI A;  3L2R A;  1UG0 A;  2LRE A;  4UHT A;  3FK7 A;  2Q2E A;  1BA5 A;  5GAD J;  4PSW A;  2PFB A;  1JGS A;  2YU3 A;  3CMM A;  2DBB A;  1UZC A;  2YX7 A;  5EJC A;  5ILS A;  4ZTJ A;  3E7L A;  2DQR A;  4X1E A;  2YU9 J;  1B9M A;  5FRO A;  5BOX A;  3GYH X;  3MCZ A;  5EEG A;  1BBY A;  2CUJ A;  1YI2 I;  2R4G A;  5DM7 F;  4I0B A;  2GQQ A;  2D1V A;  2O8K A;  5DUI A;  1F36 A;  3O6B B;  3L2W A;  3T0Y A;  1BJA A;  1D5V A;  2HR3 A;  2ZBK A;  3TQN A;  3JRA A;  1K78 B;  4XRS A;  4BHB A;  3S32 A;  3ZQ7 A;  2E2H J;  1ZAR A;  3NAU A;  1WZ2 A;  3M8E A;  4AD9 A;  5IOZ A;  1IG7 A;  2QEN A;  2DDB A;  2ZKZ A;  3KZY A;  1H9G A;  3OSG A;  2WAE A;  4MEX F;  5GAE J;  5KHD A;  4Z6Y A;  3KP3 A;  4BY7 J;  3OYC A;  4ZH4 F;  4HX8 A;  2L7M P;  2NVQ J;  4DJA A;  3I56 I;  1QZY A;  1ON1 A;  3BTC A;  3JRI A;  1AA7 A;  2VQC A;  3IAS 2;  4BJ6 C;  5D5X B;  1EJ9 A;  4CO8 A;  4GDF A;  5K7F A;  4EJT A;  2BW3 B;  4V19 K;  3CCE I;  1FTT A;  1OYY A;  3BTI A;  1N77 A;  1W0U A;  2NYX A;  1ZRE A;  3VSK A;  2HVQ A;  1SEU A;  3J81 K;  4B48 A;  2CGP A;  2K40 A;  2EB7 A;  1D1A A;  4B47 A;  3J7Y J;  3WE3 A;  2WC2 A;  1XMK A;  3K1P A;  2CRG A;  2BVM A;  2LSO A;  4B1R A;  1R5H A;  2CQQ A;  4LK1 F;  4ZDO A;  1X3U A;  2OPT A;  1JHH A;  3HYI A;  4PGH A;  1O4X A;  1DP7 P;  1WJE A;  4W97 A;  2JA6 J;  4HPQ A;  4XKC A;  1O7L A;  4CSW A;  5A2Q K;  4RBO A;  2RQQ A;  4HYE A;  2P7C B;  1LNW A;  3LMM A;  2E36 A;  2E7X A;  3ZQF A;  1JTY A;  4IOC F;  1WJF A;  2R7U A;  4BBR J;  3GX4 X;  3EYI A;  2IVM A;  2JRT A;  2Y30 A;  3LSH A;  3QPH A;  1RC9 A;  3H5A A;  3QPT A;  3CCQ I;  2EK5 A;  4B3A A;  2VE9 A;  2R7W A;  4DGW B;  3JTG A;  3PSI A;  1TP4 A;  3LAP A;  1FSE A;  3HRT A;  3FIS A;  4HV6 A;  3E1S A;  2TDX A;  3BZK A;  1USS A;  3N05 A;  5IT9 Z;  1OCR H;  2VT2 A;  3G4S I;  1R4N B;  3GLX A;  2EZI A;  3H92 A;  4M71 A;  2IS6 A;  2KFD A;  4HG2 A;  3TMO A;  4I01 A;  1G4D A;  2Q1Z B;  4Y15 A;  2OD5 A;  3MKL A;  4ZYE A;  3OIQ A;  4M3F A;  1T98 A;  4DZJ A;  2XRO A;  2LMD A;  1TLH B;  2X1E A;  1ODD A;  4LB6 B;  1LE8 B;  2XSJ C;  4FAS D;  3TED A;  2DT5 A;  5L3E A;  3QYE A;  1ZG3 A;  3DU6 A;  4L5I A;  3ZXS A;  3HTU A;  1ZGA A;  2DQL A;  2FBI A;  2DT6 A;  1R5I D;  1LB2 A;  2VON A;  4XRM A;  1F43 A;  5H6Q A;  3PUF A;  2K85 A;  1WH7 A;  2LC2 A;  2W00 A;  3A01 A;  2BY2 A;  3RCO A;  4IRG A;  2QQA A;  4FQG A;  2LKX A;  1D5Y A;  3ZPL A;  3C2H A;  1IAW A;  4DYC A;  1ONV A;  3C18 A;  1SFK A;  2GM4 A;  5M3M J;  2V1U A;  4LOC A;  2HXO A;  1A31 A;  1HSJ A;  4UUT A;  2M4K A;  2W82 A;  1KU3 A;  4HAM A;  3ESW B;  4RA2 A;  1D1B A;  3LA7 A;  3CF5 F;  2QM3 A;  2H94 A;  2WAD A;  4A3E J;  5K1Y A;  3GFI A;  2KJC A;  1IUY A;  1RPW A;  2MAB A;  3CCJ I;  3KP4 A;  4A3I J;  2UZK A;  1MH3 A;  3KEO A;  4H0E A;  2X6W A;  2M5W A;  3CDH A;  3HHH A;  1SFO J;  1HQC A;  2RAE A;  3RKW A;  1PYV A;  2XKP A;  5F6F A;  4I09 A;  4ANJ A;  3G71 I;  1U2W A;  2V6C A;  1W5S A;  1Z6T A;  3DPT A;  4KN4 X;  2K4B A;  3FXR A;  4ABZ A;  2IS1 A;  2H1L A;  2O6G E;  2IEK A;  2CV2 A;  1N25 A;  3UR3 C;  2HTJ A;  1KGS A;  2XAQ A;  4U7B A;  4QLC U;  1YO5 C;  2LYC A;  2FD5 A;  3J7A Y;  4Q4Z F;  4E7I A;  4I99 C;  1BI1 A;  2ZXW H;  4Y52 J;  4YII A;  5FKL A;  2DA3 A;  5J4V A;  3SFI A;  3ZQL A;  2XF6 A;  1PUF B;  1P7J A;  5BNG A;  3K4B A;  3S3N A;  2LH9 A;  2VC1 A;  4PJN A;  3ZQG A;  3RKY A;  1YJW I;  1GUU A;  2VKD A;  1QHH D;  3K1M A;  5F27 A;  4FX0 A;  1PP8 F;  2IJL A;  3V8L A;  2Y2Z A;  3HOT A;  3VOE A;  1Z05 A;  3BG7 A;  3S8P A;  1XMA A;  2QBY B;  2M1B A;  5DM6 F;  5CVI A;  2IPQ X;  2QSF X;  4XLA A;  4XLF A;  2DA1 A;  4I76 A;  3G3Z A;  3I0T A;  4RLF A;  4PFP A;  5J6X A;  3HL2 A;  2HPM A;  2CQ7 A;  3W2V A;  3BJO A;  3BPV A;  6PAX A;  5DCM B;  4DOZ A;  4ITV A;  2OJE D;  3GO5 A;  1VQ4 I;  2IGK A;  4KJZ A;  2IA0 A;  3D1N I;  2JZY A;  2EFN A;  2VJJ A;  4M73 A;  2Z9O A;  3DP7 A;  3O2P E;  4HA8 A;  3FM5 A;  4EV0 A;  2UV1 A;  3NAR A;  2LF8 A;  4ZDP A;  5D5W B;  2M45 A;  4IHY A;  2BOL A;  3RPQ A;  5CVR A;  3GZN B;  2L7F P;  3HRM A;  1DPU A;  1R23 A;  2M3A A;  4ON0 A;  4AYB A;  1B72 B;  1I6X A;  5BS6 A;  1ZYR F;  2HKX A;  2LLK A;  3PM1 A;  2CU7 A;  2Z5U A;  4G8X A;  1QVU A;  3TP0 A;  3JRH A;  2XGX A;  1A36 A;  2OAZ A;  2V1X A;  1YRN B;  4XSX F;  1ETK A;  3D5S C;  4MO7 A;  3ISP A;  1WJ5 A;  1MH4 A;  1UEL B;  1ZN2 A;  1P92 A;  1Y8Q B;  1LKX A;  2CO5 A;  2HS5 A;  1QA6 A;  2E19 A;  3A01 B;  5AON A;  1SAU A;  1AOY A;  3GZ5 A;  2O5R A;  2Z99 A;  4HDV A;  4HBL A;  3D5L A;  3FMR A;  4HEA 2;  2JPC A;  5BPD A;  3H9G A;  2WV1 A;  5IY5 H;  1AU7 A;  2VUM J;  2RNJ A;  5DD4 A;  2V26 A;  3VFZ A;  1TWA J;  1N75 A;  1B8I B;  4EM0 B;  1MDM A;  1J0R A;  2KP6 A;  2WV0 A;  3WOD F;  4DQ2 A;  1YIT I;  3OOU A;  5J40 A;  2GOM A;  1O3T A;  1B6A A;  3MWM A;  2R5Y B;  2XPW A;  4EEF G;  2M8G X;  2G7U A;  2QKM B;  5FLM J;  2IBD A;  3ZQC A;  2M2E A;  5IP7 J;  1FMV A;  4XMY A;  1Y39 A;  2VE8 A;  2EA2 A;  4LLN A;  3S2H J;  1Q1V A;  3R0J A;  5ICE A;  3C7J A;  3TOB A;  5L3G A;  5GTH C;  3FBI B;  2JMW A;  1YJ9 I;  5F1J A;  5DV5 A;  3MKZ A;  3LSM A;  1MJ9 A;  1FT9 A;  1BN5 A;  5M3F J;  3VB2 A;  3KYD B;  3VYT B;  2WWY A;  4CGZ A;  2HGC A;  1P4A A;  1HKQ A;  3HPH A;  3I3L A;  5K5O A;  2BBY A;  1HW2 A;  5FD5 A;  5JI6 A;  2FOW A;  3HJE A;  2BHZ A;  2XF5 A;  2K3F A;  4N9H A;  3RDI A;  4A5N A;  3D5R C;  2XRL A;  1Z7L A;  3HUG A;  3I9V 2;  1XPX A;  3IH4 A;  5KAI C;  1GLN A;  2RVC A;  1R00 A;  3WU0 A;  2I8D A;  2BXZ A;  4HX4 A;  1H0M A;  3LFK A;  5HS9 A;  4BQA A;  1Y8R B;  3LSJ A;  1JHF A;  2D2W A;  1HDP A;  2EZK A;  2B0L A;  2ZJ2 A;  3K6G A;  1F5T A;  4DBR A;  4YIF A;  4AIK A;  2DCE A;  1VF9 A;  2F48 A;  2DU9 A;  1D8K A;  1XSX A;  3SFZ A;  4BL0 B;  3OL4 A;  4AYB N;  4L0Y B;  2MFZ A;  2MC4 A;  4P96 A;  5EG0 B;  1DU6 A;  2DOE A;  1UFM A;  4C2U A;  4M6Y A;  1YOV B;  2FRH A;  4AVP A;  4NHJ A;  3ZN1 A;  5LHG A;  2DPU A;  4A3L J;  1U9O A;  1WGX A;  3TO7 A;  3A0H C;  3HOZ J;  2BHY A;  1JKP C;  2AXL A;  4EGY A;  2YS9 A;  3M7G A;  4RM3 A;  3AL0 B;  1WJB A;  2KT0 A;  3OYJ A;  1HW1 A;  2NS7 A;  4KNY A;  3I59 A;  2M30 A;  1UCR A;  2V79 A;  2DOA A;  4IHT A;  3ZGK A;  3PUB A;  3V42 A;  4Z2Y A;  3BDD A;  5F04 A;  3CC4 I;  3LA2 A;  3IH2 A;  3H1C A;  4D5C A;  2XPV A;  4F91 B;  1POG A;  4OMY A;  2XRN A;  4XOP A;  5H6R A;  3ZR8 X;  5D6E A;  4DZP A;  2E60 A;  3FHN A;  5TIS C;  2A61 A;  3OV8 A;  5CJ9 A;  1K4T A;  3VDX A;  1BI2 A;  1TBX A;  2KZV A;  3DKY A;  5L3F A;  5HOD A;  1A35 A;  4RB1 A;  3K2A A;  3HOY J;  2E34 A;  3HHG A;  4B44 A;  4M72 A;  3IAM 2;  4RGS A;  4BDZ A;  2KIQ A;  4NBQ A;  2Z1D A;  2HPI A;  2H6B A;  1BW6 A;  3H9Q A;  1W1W E;  2Z16 A;  3FK6 A;  3OSF A;  1ULY A;  1RNL A;  3MMY B;  3DFG A;  4AU7 A;  4F93 B;  1CQT A;  4V2G A;  2OU2 A;  4MLO A;  5A2Q Z;  2HWV A;  3L2C A;  1RRJ A;  2ECB A;  1ZEL A;  2IGO A;  2Y69 H;  3BR2 A;  1IGN A;  4IHW A;  1APL C;  3BP8 A;  2XGC A;  2H09 A;  3GWZ A;  2VJ4 A;  1KA8 A;  4MFE A;  4OMZ A;  3IC7 A;  2KDZ A;  3I54 A;  3WG7 H;  5ERI A;  2HYG D;  1JI8 A;  3GCM A;  3BCA A;  1QQI A;  3DKW A;  4CCJ A;  2W1O A;  1IN4 A;  2DN0 A;  3DLA A;  4P5O A;  1EH6 A;  2V1N A;  3BR5 A;  4DBQ A;  1YG2 A;  4CH7 A;  4UVB A;  2YUS A;  2X0L A;  3EUH C;  3PNV A;  4PZJ A;  5D4R A;  5DTD A;  2E71 A;  1ZLJ A;  3PFI A;  2R93 J;  2LVS A;  1WHU A;  3FMQ A;  4RMN A;  3U21 A;  4PK4 A;  3SZT A;  4BEH A;  3ZCO A;  1FIA A;  3ABT A;  4BNC A;  4EJO A;  2Q0O A;  1FC3 A;  5DCF A;  3FX3 A;  1WJA A;  3V7S A;  1W36 D;  2I10 A;  4NB5 A;  4D7N A;  5E1X A;  4XLP F;  3IKT A;  1G6N A;  2I5U A;  4PGG A;  4KIF A;  1GVJ A;  2DYS H;  5IT3 A;  4NC7 A;  2RN7 A;  3LQR A;  4FIS A;  2PBI A;  2QEX I;  2BY0 A;  1FEX A;  3G1L A;  1YW9 A;  1GV2 A;  4AIJ A;  2GIZ A;  3ZMT A;  2ACJ A;  4X6A J;  5M5W J;  2L7K A;  3FXL A;  5D5V B;  2FU4 A;  3OYE A;  2X51 A;  1Z3Y A;  4Y7N J;  2CFX A;  1BIA A;  4A0Z A;  2PEX A;  1U3E M;  1X1P A;  1TWG J;  3W6J B;  3GTG J;  1S7E A;  2BEO A;  2BW3 A;  3GF2 A;  3R61 A;  2VAS A;  3GTM J;  3C2G A;  2ZFW A;  3ML6 A;  1X2M A;  3QP5 A;  1MBK A;  2CJJ A;  5JHF A;  5EG0 A;  5FLX Z;  3AFH A;  1Y0U A;  4K2E A;  1YX5 A;  2W24 A;  4U87 A;  1LFP A;  5LEJ A;  3E6C C;  2O03 A;  2X48 A;  3ABL H;  4A0Y A;  1KU2 A;  4MQ9 F;  3I55 I;  1IC8 A;  2MH9 A;  1UMQ A;  4GRI A;  2DT7 B;  3S93 A;  1F1Z A;  5E3M A;  4JOM A;  4PDK A;  3U9G A;  5EEA A;  2XAU A;  2M9H A;  3SYT A;  1OYI A;  2V7F A;  2KL4 A;  2A6T A;  1IN5 A;  4A2U A;  4XKW A;  1V4R A;  4RGR A;  2Z3Y A;  2P81 A;  4F52 A;  3DPU A;  3S14 J;  2L4A A;  3RQ4 A;  4ZTF A;  3RZD J;  4E70 A;  1GXQ A;  4IJA A;  3F6V A;  2HU9 A;  1IV8 A;  4UVA A;  4BGD A;  5E79 C;  3OS0 A;  1PUE E;  1LEB A;  3BJA A;  2CWE A;  2VI6 A;  3TP3 A;  2VPL A;  2IS4 A;  1I3Q J;  2DOF A;  2ZSH B;  4WX9 A;  1AKH A;  4B43 A;  1O3S A;  1BR1 A;  3BR1 A;  3RTR A;  3CO6 C;  3SJM A;  4XRS G;  3Q0U A;  3OYD A;  2HVR A;  4M6X A;  5CLS A;  1MW7 A;  3K2Z A;  1YW8 A;  2W84 A;  3DTE A;  3OYG A;  4MQV A;  5JVG F;  1B59 A;  3KFW X;  4M9S A;  2BV6 A;  3IL2 A;  4UXN A;  2DPD A;  1ETW A;  4YFK F;  3OOP A;  4C3J J;  4HW0 A;  3DF8 A;  1VQN I;  2XPU A;  3GVA A;  3I53 A;  1OCO H;  3TDU C;  4ZZD A;  2X85 A;  2CV0 A;  2ZO4 A;  5JFR A;  1G3T A;  1TWF J;  4RLQ A;  1OCZ H;  3M4O J;  5LFA A;  4XLN F;  2WTE A;  1ZHF A;  1K83 J;  1ZH5 A;  1QRY A;  3GTQ J;  3TBI A;  1R22 A;  1QNT A;  3CJQ B;  2JVG A;  4BQQ A;  2HQR A;  4RB0 A;  2ZME B;  4XRF A;  1STZ A;  3WGI A;  2ELK A;  3NWS A;  4ZC3 A;  3V7C A;  3QOD A;  4ENM A;  3LWF A;  2E5N A;  1B4A A;  3MN2 A;  2JT1 A;  2ME0 A;  2MH2 A;  2PQ8 A;  1BI3 A;  1Z67 A;  3OYL A;  1IF1 A;  2ZXI A;  3RSN A;  5B1B H;  2K02 A;  3FXM A;  3F9K A;  2JVH A;  2HOA A;  3IWF A;  3DPL C;  4D9J A;  3ZN0 A;  2EZH A;  4J01 A;  1U9N A;  2QA4 I;  4WXH A;  3WTW C;  3TOA A;  2M0C A;  2EV0 A;  4BE1 A;  1O57 A;  1J75 A;  5CQG A;  2LK2 A;  2LP0 A;  1QHG A;  3O8H A;  2V9P A;  3CUQ A;  3H5R A;  1LQ1 A;  5K5Q A;  3A02 A;  1WSU A;  2COM A;  2E1O A;  4CXF A;  4E7Z A;  1S7O A;  1KU7 A;  1KQ9 A;  3K4K A;  3BG5 A;  1X19 A;  1XDU A;  1YQA A;  2KRC A;  4RM2 A;  4II3 A;  3CP8 A;  4HQE A;  3HIF A;  1I39 A;  4BUP A;  2KHM A;  5L3B A;  3L2U A;  2E1C A;  1XCB A;  2K9S A;  3D0S A;  3GXO A;  3M07 A;  3PNY A;  4GGG A;  3K70 C;  4CUG A;  1VQ7 I;  1E0E A;  1FOW A;  3HOX J;  1IN7 A;  3KCC A;  3TO9 A;  3M8F A;  5D4S A;  2ISZ A;  4A12 A;  2GOX B;  1V5E A;  2QCO A;  2MD5 A;  1SFX A;  3ZRG A;  1RKW A;  4YEL A;  3ZQH A;  4J00 A;  4P1W A;  1L0O C;  3BTL A;  1KZH A;  3WTT C;  4JBA A;  3FDY A;  3DKX A;  3CJN A;  2A05 A;  2DTZ A;  2ID6 A;  1HXD A;  2KIF A;  3KLO A;  1JUS A;  2VJI A;  5DD8 A;  2XIG A;  5GAG J;  4KT6 A;  1I50 J;  3OIP A;  2NOJ B;  3LA3 A;  1OCP A;  3LNQ A;  1T95 A;  3K10 A;  1PUF A;  3H3Z A;  1X2N A;  3VEP A;  3VYR B;  1P4X A;  1U5T C;  2JK3 A;  2A5W A;  1S29 A;  3VOD A;  2DA2 A;  3LSG A;  2BXY A;  4JYK A;  4I6Z A;  1LE8 A;  1DP3 A;  2K7L A;  1HC8 A;  2KIS A;  4B3X A;  4LK0 F;  1LVK A;  3N4M A;  1EKE A;  2BY1 A;  5FO5 A;  4PFO A;  3S16 J;  3VYS B;  2W57 A;  4L0Z B;  5LLQ A;  4HF0 A;  2X6O A;  5LD2 C;  5H20 A;  4A3K J;  2M7B A;  1T8I A;  3J7Z I;  5B66 C;  3BPX A;  1FYM A;  2VBW A;  2VKE A;  4LMY A;  3RI4 A;  2Q2E B;  3O3K A;  1BC7 C;  2HOT A;  2ZJP F;  2KIU A;  4LB5 A;  2A69 F;  1Z1D A;  4G7H F;  1Z3X A;  3ROU A;  3ELK A;  2KKO A;  1E17 A;  1HLV A;  4OIN F;  1T39 A;  3K69 A;  4A69 C;  1TW3 A;  1T2K A;  3WTX C;  3R0A A;  1GVD A;  5HNF A;  4XN0 A;  3ZQQ A;  3I4P A;  4OWR B;  4H4K C;  2EFP A;  5EZG A;  4CCL A;  3JRF A;  2IRF G;  5E1W A;  4C9Y A;  5KCM A;  1X4O A;  2Y31 A;  2DMU A;  2RC4 A;  1T6S A;  3FM3 A;  3GTO J;  4I0A A;  4ESF A;  2NVX J;  2F2E A;  2OTL I;  3J80 Z;  1EH7 A;  2K27 A;  3CF2 A;  2QSG X;  1JKR C;  2EWN A;  3SZG A;  2VOD A;  4Y3O A;  2QKL B;  2EIN H;  4XQF A;  2EJR A;  2CUF A;  3CCV I;  3JSP A;  2OCE A;  1RUO A;  2G0E A;  1YE9 A;  4N9I A;  2DA7 A;  2CS3 A;  2IGM A;  3BJ6 A;  3BCB A;  3LQQ A;  3X2Q H;  4GFB A;  1JJ6 C;  1IRF A;  1MSF C;  4RGX A;  1Y56 A;  2L7Z A;  2V6E A;  3CUQ C;  1G59 A;  2OZ6 A;  4BBS J;  2V9K A;  2G7H A;  1RET A;  2JA5 J;  2EZL A;  5HDN A;  1N78 A;  5F0H A;  2OUM A;  4E4H A;  4QSH A;  2QQ9 A;  5J1R A;  3F0C A;  2KJB A;  2L2O A;  4KA4 A;  1YX3 A;  2BE5 F;  3BG6 A;  3PQK A;  1MMA A;  4MNU A;  4M6V A;  2VN2 A;  4II2 A;  4NUB A;  2KQR A;  3I59 B;  2VB6 A;  1FY7 A;  2RDP A;  1AHD P;  1U0J A;  1MSE C;  1SVM A;  2ADU A;  5HVQ C;  1W7P B;  4ZZL A;  3CDI A;  2GZW A;  2K86 A;  2E7W A;  1TC3 C;  2QYO A;  3REO A;  2ZJR F;  3HOV J;  1Z77 A;  4Y33 A;  3JRE A;  4BXF A;  4BH9 A;  4YFX F;  1KQ0 A;  4S05 A;  4A3M J;  2HOS A;  5EGO A;  1R49 A;  5ED4 A;  2E5Z A;  1KYZ A;  4PJM A;  4IX7 A;  3H0G J;  3PNT A;  4FE4 A;  5KNL A;  3HGG A;  1VQL I;  4HNV A;  3S17 J;  2F5D A;  2XVC A;  2YSR A;  4I2O A;  1LEA A;  1WI3 A;  1Z9C A;  1YLF A;  4ZYD A;  4GYI A;  1DDN A;  5KK1 A;  2ELH A;  4XOT A;  2JA2 A;  4PJL A;  3H36 A;  1LDK B;  2R7Z J;  3CC7 I;  3BRO A;  2D5V A;  2EH3 A;  3G73 A;  1BC8 C;  2DK5 A;  1I5Z A;  1ZG1 A;  1Y1V J;  4L5E A;  1IRZ A;  1ETY A;  1B1B A;  1V54 H;  3HB9 A;  2R7S A;  5K7Z A;  4XN3 A;  2VKH A;  3FMS A;  1OPC A;  4IQ4 A;  4ZYA A;  3RQI A;  4IHS A;  4KIC A;  4Q47 A;  1ZRF A;  1BR4 A;  2GAU A;  3A2K A;  3ZMU A;  4KFC A;  3BR6 A;  3KZZ A;  2DO7 A;  1D3Y A;  3E6D A;  2KDO A;  2VL8 A;  3H0D A;  3S3O A;  3E6M A;  1J9I A;  2LR8 A;  4FCY A;  1U6G A;  3E3V A;  4HSR A;  1XGN A;  2FMY A;  4I7H A;  1D0Z A;  2Y0S A;  5K7H A;  2E1N A;  4U88 A;  1JE8 A;  4KIS A;  2GXA A;  2MBF A;  4M9X A;  4LLL A;  1UHS A;  3EUH A;  4C3I J;  1XG1 A;  2P5L C;  4A3F J;  1HF0 A;  2R5Y A;  1VQ8 I;  1UAA A;  5CPR B;  4XM3 A;  5ICG A;  1ZQ3 P;  3QPS A;  4BQO A;  1SD7 A;  1RUN A;  1DUX C;  1NG6 A;  4LJZ F;  1U8B A;  4DYR A;  5E20 A;  1I1S A;  4FT8 A;  1V3F A;  3S3M A;  2F5F A;  2RRE A;  3AG4 H;  4L18 B;  2DFF A;  5FFX A;  3U1K A;  4L9V A;  4OAY A;  4Q5S F;  2FX0 A;  4F3Q A;  2VBZ A;  5E18 F;  3CMA I;  2L54 A;  1O7F A;  3F21 A;  1E3O C;  2HI3 A;  3C1D A;  1OJL A;  2MG4 A;  2MC3 A;  2GIV A;  3FKI J;  4CHU A;  2HZD A;  2KIM A;  3OMY A;  2F4M B;  2VC0 A;  1U8R A;  4L9T A;  2M4G A;  3CO7 C;  3KYL A;  2ECC A;  3M1C A;  2L5Q A;  2WY7 Q;  2EFO A;  3V8K A;  1FIP A;  4JX6 A;  2HQA A;  3HC7 A;  5EYR A;  1S5L C;  5HLG A;  5BQT A;  5LGT A;  1YIO A;  2OBP A;  1HDD C;  3JRD A;  2ESH A;  4DIQ A;  2P6S A;  5DYM A;  4ZDL A;  3GTL J;  1FWZ A;  4JX5 A;  3HOW J;  1XGO A;  1XMX A;  3K70 D;  1YS6 A;  1BR2 A;  3WU2 C;  4EJW A;  2EIK H;  3CLO A;  5ILU A;  3DEU A;  2MLG A;  3L2Q A;  2VOP A;  1BOB A;  3MFK A;  3G1O A;  5DUK A;  1LDJ A;  4HNU A;  2ISY A;  4LLG F;  5FKM A;  1IJW C;  1XS9 A;  4CCK A;  1G8X A;  3E5X A;  1ETV A;  3BR3 A;  4R79 A;  2VXZ A;  2R7Q A;  4IO9 F;  3JW4 A;  3HOS A;  1MJB A;  3B73 A;  1SD5 A;  4KUM A;  2L0K A;  4BAY A;  3NWT A;  5E8G A;  5IYB J;  3JSO A;  3QU6 A;  2VOO A;  2DA6 A;  3Q0W A;  5HNH A;  2R7X A;  2CSO A;  4XKB A;  3QPL A;  1PP7 U;  3FXQ A;  3WTV C;  1TZL A;  1E2X A;  4D1Q A;  2HQ5 A;  4M3E A;  4E7H A;  1ZRD A;  5E17 F;  2NVY J;  4BKX A;  2NRA C;  4RB2 C;  3ZP5 A;  2DDA A;  1ETO A;  5J3L A;  3HSF A;  2UXN A;  2ZB9 A;  2JJ7 A;  3AG2 H;  1CGP A;  2PMH A;  3MVP A;  2XAF A;  1YIJ I;  2Z33 A;  2STT A;  5CVJ A;  2QZ8 A;  3M8J A;  4RS8 A;  2HEO A;  5IP9 J;  3ONQ A;  1S6L A;  1BOA A;  1C0W A;  1ZAO A;  2W85 A;  2XSD C;  3P5J A;  2X1D A;  2DA5 A;  2CQN A;  3QP6 A;  4RAG A;  2STW A;  5FRN A;  5LBQ A;  2VBX A;  2CMP A;  1G3W A;  1RR8 C;  5IYC J;  4HRI A;  1IN8 A;  4P9F A;  1XSV A;  2ZNZ A;  1S7A A;  2MSY A;  1XX5 A;  2CH0 A;  2K5C A;  4ENJ A;  2KPM A;  3PO2 J;  2BY3 A;  3MEX A;  1WH5 A;  2IT0 A;  4WXC A;  3ERM A;  1OR7 C;  1S3J A;  3HXL A;  3FKJ A;  4A6D A;  3I64 A;  2FOK A;  2FBK A;  1TWC J;  4LIT A;  1LFU P;  4WWC A;  3WHC A;  1M1E B;  2JSP A;  5D6F A;  4M3B A;  4UUS A;  4BYY A;  3NEU A;  1T0F C;  4MIM A;  2HYF A;  5KVR A;  2VLA A;  1X3Z B;  1YW7 A;  3DV8 A;  2KRF A;  2X1C A;  4FET A;  1CF7 A;  3KPH A;  1PDN C;  3DTI A;  4XOR A;  3A1Y A;  5J8C A;  2DTR A;  3KEQ A;  2LKP A;  4BQN A;  4AM3 A;  1ZGW A;  4IOA F;  2F4I A;  3KE2 A;  1VQK I;  2CYY A;  3NQO A;  2R7D A;  3HSE A;  4JX4 A;  2UUZ A;  4MGR A;  3A0B C;  5FJ8 J;  1IN6 A;  2FBH A;  4GXO A;  1D0X A;  3GTP J;  4UV9 A;  4UUV A;  1ZR4 A;  3F8B A;  4W1U A;  2WBM A;  3ZOB A;  2PMU A;  2A5Y B;  5GTI C;  4J19 A;  4Q48 A;  4YEJ A;  2P5V A;  4KT5 C;  3KYC B;  1DGR M;  2JTV A;  2FNP A;  2K3P A;  3SHF A;  1Z0X A;  2FF4 A;  4DNC A;  2JUC A;  3DTK A;  1I27 A;  2L9R A;  3QU3 A;  1JKQ C;  1FYK A;  1JJ8 C;  5H2F C;  4ASN A;  4EVI A;  3L1P A;  3OYN A;  2RNG A;  5CVU A;  3MZY A;  3OL3 A;  2VQG A;  4RB3 C;  3I58 A;  4U0V A;  2RKH A;  2P7V B;  1K61 A;  3K9T A;  1MD0 A;  2VIX A;  1Z7U A;  2M0M A;  2V1D A;  3KP5 A;  4XON A;  3BTJ A;  5L3D A;  3CUQ B;  3R60 A;  4LD5 A;  2F6C A;  1SD6 A;  4IF4 A;  3B6C A;  2FUG 2;  4HST A;  2DLL A;  3DEE A;  4I02 A;  3J80 K;  2E1M C;  4X0G A;  2LTP A;  4MHG A;  4HF2 A;  3HOU J;  4C3H J;  4NC6 A;  2W25 A;  3IRR A;  3LSR A;  1S8N A;  3P9C A;  5CYV A;  3K4M A;  3WTU C;  2J5O A;  2OA4 A;  2NXN B;  2DFE A;  2HKO A;  1R6R A;  3M9A A;  3Q9S A;  4UB8 C;  1F9N A;  2MGQ A;  1L3L A;  3AG3 H;  1O3R A;  1IXR C;  4LIU A;  3CCL I;  3I71 A;  1OYW A;  4A3B J;  4MTD A;  4A93 J;  5EGO B;  3SDB A;  2IA1 A;  3OYH A;  2O61 A;  2JA7 J;  1MBJ A;  2F5E A;  4UVC A;  2L3D A;  4AID A;  2XHK A;  3MQ0 A;  1W4M A;  2WAQ A;  4IPA A;  2K9N A;  3L7W A;  2O3F A;  1P6R A;  2ICW G;  3TDZ C;  2CFO A;  1Z91 A;  2OC6 A;  3CCR I;  3U1D A;  5F64 A;  1NK3 P;  4F92 B;  1WWX A;  2P4W A;  3QYB A;  1FSH A;  2CV1 A;  4A3D J;  1JKO C;  3MZ8 A;  1G3S A;  2AO9 A;  1MBH A;  5B5E C;  4LG0 B;  4HNT A;  4BAC A;  4PJJ A;  3RZO J;  1EA3 A;  1TL8 A;  2E2I J;  4NNJ A;  3CTA A;  3IUO A;  4KIG A;  4BE2 A;  4HX7 A;  4CZZ A;  2EIJ H;  3ERE D;  1SFU A;  3V8J A;  2NNY A;  4CZC A;  5FRM A;  4M3G A;  1AWC A;  2A3S A;  4IEJ A;  4EJV A;  4M74 A;  3OYF A;  2Y0S N;  1R1V A;  2DFI A;  1FP1 D;  1JT6 A;  2R3S A;  3M1E A;  3WE2 A;  1W7P A;  2M34 A;  2BYV E;  2LBF A;  2CQK A;  1SMT A;  4ESB A;  3VWB A;  3HSR A;  4M3D A;  4A6E A;  2XB0 X;  4O5V A;  1I3A A;  4AWX B;  4PSX A;  5CKT A;  5LRR A;  4JK1 X;  2M8E A;  1TQI A;  1X58 A;  3M3Y J;  2GA2 A;  2Z2S B;  3BOQ A;  1XGM A;  3FBN B;  1FOK A;  2AXT C;  3I4N J;  2LD5 A;  5KAF C;  5C4J J;  2EQR A;  3ASO H;  1YHQ I;  3QAH A;  1FYL A;  3K4L A;  3TO6 A;  2JWT A;  2XV4 S;  2IA2 A;  2P8T A;  2PMZ N;  4HF1 A;  4BXU A;  3U2R A;  2VQL A;  1HBX G;  2LY2 A;  3E5Q A;  4A3J J;  1MNE A;  3IP4 B;  3PO3 J;  4O6J A;  2D45 A;  1BJZ A;  4CYC A;  4D5F A;  4XR6 A;  3L00 A;  3PQJ A;  1ORK A;  5HDK A;  1MMS A;  1MMN A;  3QRF F;  2JUG A;  1IRG A;  2DYR H;  2QLZ A;  2CW7 A;  3EDP A;  3H3U A;  2EIL H;  2V4J C;  4OAZ A;  2WB1 A;  1HKS A;  4GYG A;  3QQA A;  3JTH A;  1V5F A;  5IYD J;  2W7N A;  1VQ9 I;  4S0H B;  1R9T J;  2MD0 A;  4HLY A;  5HLT A;  1JT0 A;  2FSW A;  1YYV A;  2AHQ A;  4KDP A;  1ZG5 A;  1QU3 A;  3S1R J;  3ABU A;  4U0W A;  2DMQ A;  1QZZ A;  3F72 A;  4KN7 X;  2PG4 A;  2TCT A;  3ZMV A;  1O3Q A;  1NK2 P;  1ZR2 A;  2P0W A;  3L9F A;  4UB6 C;  4HV5 A;  1FZP B;  3DCF A;  1VQ5 I;  5LGN A;  3EUA A;  3SDG A;  3HDD A;  2FA5 A;  4F55 A;  3KET A;  3QYF A;  1YTY A;  3AL0 C;  1TNS A; 
#chains in the Genus database with same CATH homology
 5BPI A;  1HKT A;  2EV5 A;  2HZT A;  3KP2 A;  4R8H A;  3LAJ A;  2FML A;  2P5K A;  3RYP A;  1MGT A;  2O8X A;  5ILV A;  1EV7 A;  3B02 A;  2DW4 A;  2IP2 A;  3K0L A;  5FFZ A;  1J2X A;  1IW7 F;  1OR7 A;  4M9Z A;  4UNO A;  1BI0 A;  3T8R A;  3F8F A;  4HOB A;  1TTY A;  4XBF A;  1CF7 B;  5EEH A;  1K6O A;  3IHU A;  5FD6 A;  2EFW A;  2ZXJ A;  2UWM A;  5TJJ A;  3T1B A;  4L9J A;  1Z6R A;  4P55 A;  1J5Y A;  4NQW A;  2XAG A;  2G9W A;  2DAO A;  5JHU A;  5ICF A;  1D8J A;  1TNT A;  4WCG A;  2Y75 A;  2EA4 A;  1K78 A;  1F4K A;  2P6T A;  1UHM A;  1REP C;  5BMZ A;  1ZLK A;  1RI7 A;  3FWE A;  1UB9 A;  2LNB A;  2LDU A;  4WK8 F;  3WG9 A;  3J7A O;  4G94 A;  2GXG A;  4CYD A;  2VBY A;  4L9N A;  3CUO A;  4WF2 A;  2GWR A;  5IT9 K;  3Q9V A;  3RPU A;  3WTZ A;  2FQ3 A;  2O0Y A;  4UV8 A;  3AAF A;  1R5G A;  2DK8 A;  2XAS A;  1G3Y A;  2XAH A;  3HRS A;  2PJP A;  4B8X A;  3KLN A;  3V7R A;  3RKX A;  5J8F A;  4ZYG A;  4KMF A;  1MZB A;  5HOO A;  1K7A A;  1R7J A;  1VTN C;  2V9V A;  4TV7 A;  3FHZ A;  4Y17 A;  3GZ6 A;  4EGZ A;  5D8L B;  3GFL A;  3E5U A;  1IXS B;  1XCV A;  1MJA A;  3T5X A;  4RGU A;  1IZ1 A;  3I5U A;  3KP6 A;  1QGP A;  4QWQ A;  3SQN A;  5DDG A;  4Y13 A;  2D1H A;  4YFN F;  3P9K A;  5JR3 A;  4LFU A;  1A04 A;  5K5R A;  1MKM A;  4EM1 A;  2L4M A;  3TGN A;  4IRH A;  4OOI A;  4MTE A;  1FX7 A;  4KMU X;  2R7F A;  2JSC A;  4ENN A;  3R4K A;  4A5M A;  2Q8K A;  4U0Y A;  1JXS A;  5D5U B;  4CDG A;  5ICC A;  3ZMZ A;  1J59 A;  2MLK A;  2Y0M A;  4GO1 A;  1ZRC A;  1TQM A;  2QUF A;  2YPR A;  2OZU A;  1FP2 A;  1QBJ A;  4EJU A;  3S2W A;  5E1Z B;  2ZME A;  1HW5 A;  4HLX A;  4MEY F;  1YS7 A;  4RAY A;  4OIO F;  3F6O A;  5LHI A;  3GEZ A;  3FZV A;  4R1H A;  1OKR A;  5HS8 A;  4F7Z A;  1KQ8 A;  4G6D A;  1H9T A;  2H27 A;  3MAJ A;  5JVT A;  2L01 A;  5F1R A;  1FBS A;  4I98 B;  3F3X A;  1IXC A;  2GXB A;  4OIP F;  3SZP A;  5HLH A;  4HQM A;  3HTS B;  2NNN A;  5HS7 A;  1P4W A;  4IVN A;  4BHC A;  1W5T A;  4S04 A;  1WQ2 A;  3JAM Z;  4KYW A;  1LJ9 A;  2HFH A;  1FBU A;  1T38 A;  3JAM K;  5LRS A;  2OQG A;  2A07 F;  2FXA A;  3WGH A;  2JPB A;  3FXU A;  1TQP A;  4B09 A;  3GUD A;  4JQF A;  4G9Y A;  3V4G A;  4WXD A;  3F8N A;  3E97 A;  1XDS A;  1SD4 A;  4IXA A;  3J81 Z;  2J5P A;  3GFJ A;  3WTS C;  4L5J A;  5HLI A;  3Q5F A;  4O3M A;  3W6K B;  3FF5 A;  4FHT A;  4ZYH A;  3F23 A;  1XGS A;  1BIB A;  2PI0 A;  2ETH A;  1R36 A;  1XN7 A;  2BGC A;  4IRI A;  4D0P A;  3LST A;  1NHA A;  3IKV A;  3EQL F;  2NS0 A;  1EH8 A;  1MDM B;  4OU0 A;  2A6E F;  3GW2 A;  1WI9 A;  1SFE A;  4EMS A;  3BZ6 A;  1XD7 A;  1HST A;  2YX4 A;  1GHC A;  3P7N A;  1RIO H;  2MA3 A;  4EM2 A;  1K79 A;  1W7P D;  2EV6 A;  2IW5 A;  3HRU A;  4ENK A;  3WU1 B;  5CVV A;  3IWZ A;  3F8M A;  4CIC A;  3P9I A;  1I1G A;  3DXJ F;  1DPR A;  4FX4 A;  3RJP A;  5DEQ A;  1FBQ A;  2YR2 A;  2XUB A;  2QVO A;  5E8I A;  1GXP A;  5LEK A;  2NAZ A;  3BWG A;  2H6C A;  3WGG A;  3IRQ A;  5FLX K;  2HOE A;  2A68 F;  3ECO A;  2QQB A;  2UXX A;  5AIQ A;  2FE3 A;  1P2F A;  1SAX A;  4G6Q A;  2RQP A;  2VT3 A;  1UST A;  3N97 A;  2FEZ A;  1Q1H A;  1LVA A;  2X4H A;  2M87 A;  4ESJ A;  4OIQ F;  3ZMD A;  5HDG A;  3K1N A;  3NRV A;  2PLY A;  3ULQ B;  2A6H F;  2AS5 F;  1OMI A;  1R1U A;  4ETS A;  3KP7 A;  1WRJ A;  3R6S A;  3RYR A;  2Y48 A;  3MZH A;  3QOP A;  2XKO A;  5LHH A;  4LGW A;  4XSZ F;  1YFH A;  3C3W A;  2QWW A;  4OIR F;  1KU9 A;  4PCQ A;  2FNA A;  2RV8 A;  5AIP A;  1U5T B;  3EET A;  1FLI A;  2CW0 F;  3EYY A;  4GCV A;  2HTS A;  1QO0 D;  1R58 A;  4AIH A;  2ZNY A;  2XAJ A;  4N0B A;  2CG4 A;  4HDU A;  1SMY F;  4LG0 A;  4YG2 F;  2GA1 A;  4U7D A;  1FNN A;  2ZCW A;  1U5T A;  2LF7 A;  1XB4 A;  5FGM A;  5DCM A;  1RZ4 A;  3SXY A;  2RGV A;  4RAZ A;  2C6Y A;  1LDD A;  4KIB A;  4A0X A;  3COA C;  1WKM A;  2QBY A;  1QPM A;  2EFQ A;  4EQQ A;  3F22 A;  1U78 A;  3GFM A;  3L09 A;  1XSD A;  2PN6 A;  1BM9 A;  3ZMS A;  2F5C A;  1ZGJ A;  5TRD A;  3E6B A;  4BHP A;  2HDC A;  3ECH A;  2OQR A;  4P9U A;  2ESN A;  2K4J A;  1J7K A;  1B9N A;  3F8C A;  4G7O F;  1KYW A;  3RIR A;  3T8T A;  5D8K B;  1TW2 A;  5FB2 A;  5L3C A;  1ON2 A;  3DQV C;  3WTY C;  2HQN A;  1R1T A;  4G7Z F;  3TKY A;  5LGU A;  4HZF A;  1T0F A;  3BY6 A;  2L02 A;  1FPQ A;  1UHW A;  2DI3 A;  4UHT A;  2Q2E A;  2PFB A;  1JGS A;  2YU3 A;  2DBB A;  2YX7 A;  5ILS A;  2DQR A;  1B9M A;  5BOX A;  3GYH X;  3MCZ A;  5EEG A;  1BBY A;  4I0B A;  2GQQ A;  2D1V A;  5DUI A;  3O6B B;  3T0Y A;  1BJA A;  1D5V A;  2HR3 A;  2ZBK A;  3TQN A;  1K78 B;  4BHB A;  3ZQ7 A;  1ZAR A;  3M8E A;  4AD9 A;  2QEN A;  2ZKZ A;  3KZY A;  1H9G A;  4MEX F;  3KP3 A;  4ZH4 F;  4HX8 A;  1QZY A;  1ON1 A;  5D5X B;  4CO8 A;  4EJT A;  1OYY A;  2NYX A;  1ZRE A;  3J81 K;  2CGP A;  2EB7 A;  3WE3 A;  2WC2 A;  1XMK A;  3K1P A;  2LSO A;  1R5H A;  4LK1 F;  1X3U A;  1JHH A;  3HYI A;  4PGH A;  1DP7 P;  1O7L A;  5A2Q K;  4HYE A;  2P7C B;  1LNW A;  2E7X A;  3GX4 X;  3EYI A;  2IVM A;  2JRT A;  3QPH A;  3QPT A;  2EK5 A;  2VE9 A;  3JTG A;  3LAP A;  1FSE A;  3HRT A;  4HV6 A;  2TDX A;  1USS A;  5IT9 Z;  2VT2 A;  3GLX A;  4M71 A;  3H92 A;  1G4D A;  4I01 A;  4Y15 A;  2OD5 A;  4ZYE A;  1T98 A;  2XRO A;  1TLH B;  1ODD A;  4LB6 B;  2DT5 A;  5L3E A;  1ZG3 A;  4L5I A;  3HTU A;  1ZGA A;  2DQL A;  2FBI A;  1LB2 A;  2VON A;  5H6Q A;  4IRG A;  2QQA A;  3ZPL A;  1IAW A;  1ONV A;  3C18 A;  2V1U A;  1HSJ A;  1KU3 A;  4HAM A;  3LA7 A;  2QM3 A;  2H94 A;  5K1Y A;  3GFI A;  2KJC A;  1IUY A;  3KP4 A;  2UZK A;  3KEO A;  4H0E A;  2M5W A;  3CDH A;  3HHH A;  1HQC A;  3RKW A;  2XKP A;  5F6F A;  4I09 A;  1U2W A;  2V6C A;  1W5S A;  4KN4 X;  1Z6T A;  3DPT A;  2K4B A;  3FXR A;  2O6G E;  2HTJ A;  1KGS A;  2XAQ A;  4U7B A;  4QLC U;  1YO5 C;  4Q4Z F;  1BI1 A;  4YII A;  2VC1 A;  3RKY A;  3K1M A;  4FX0 A;  1PP8 F;  2IJL A;  3V8L A;  3HOT A;  3VOE A;  1Z05 A;  1XMA A;  2QBY B;  2M1B A;  5CVI A;  2IPQ X;  5J6X A;  3G3Z A;  3I0T A;  3BJO A;  3BPV A;  6PAX A;  5DCM B;  3GO5 A;  2IA0 A;  2JZY A;  2EFN A;  4M73 A;  2Z9O A;  3DP7 A;  3O2P E;  4HA8 A;  3FM5 A;  4EV0 A;  2LF8 A;  5D5W B;  2M45 A;  3RPQ A;  5CVR A;  3HRM A;  1DPU A;  1R23 A;  4ON0 A;  1I6X A;  5BS6 A;  1ZYR F;  2HKX A;  2Z5U A;  4G8X A;  2XGX A;  2OAZ A;  2V1X A;  4XSX F;  3ISP A;  1ZN2 A;  1P92 A;  2CO5 A;  2HS5 A;  5AON A;  1AOY A;  3GZ5 A;  2Z99 A;  4HDV A;  4HBL A;  3D5L A;  3FMR A;  2JPC A;  5BPD A;  2RNJ A;  5DD4 A;  3VFZ A;  4EM0 B;  1MDM A;  1J0R A;  2WV0 A;  3WOD F;  4DQ2 A;  1O3T A;  1B6A A;  3MWM A;  2G7U A;  2VE8 A;  2EA2 A;  4LLN A;  3R0J A;  5ICE A;  3C7J A;  3TOB A;  5L3G A;  5DV5 A;  1MJ9 A;  1FT9 A;  1BN5 A;  3VB2 A;  2WWY A;  4CGZ A;  2HGC A;  1P4A A;  1HKQ A;  5K5O A;  2BBY A;  1HW2 A;  5FD5 A;  5JI6 A;  4N9H A;  3RDI A;  4A5N A;  3HUG A;  2RVC A;  1R00 A;  3WU0 A;  4HX4 A;  1H0M A;  3LFK A;  5HS9 A;  4BQA A;  1JHF A;  2D2W A;  2ZJ2 A;  2B0L A;  1F5T A;  4YIF A;  4AIK A;  2DU9 A;  1D8K A;  1XSX A;  3SFZ A;  4L0Y B;  4P96 A;  1UFM A;  4M6Y A;  4NHJ A;  2FRH A;  4AVP A;  3ZN1 A;  5LHG A;  2DPU A;  3TO7 A;  2AXL A;  4EGY A;  3M7G A;  1HW1 A;  4KNY A;  3I59 A;  2M30 A;  1UCR A;  2V79 A;  4IHT A;  3BDD A;  3LA2 A;  4OMY A;  2XRN A;  5H6R A;  5D6E A;  2A61 A;  3OV8 A;  5CJ9 A;  1BI2 A;  1TBX A;  5L3F A;  4RB1 A;  3HHG A;  4M72 A;  4RGS A;  2H6B A;  1ULY A;  1RNL A;  3DFG A;  2OU2 A;  3L2C A;  5A2Q Z;  2HWV A;  3BP8 A;  2H09 A;  3GWZ A;  1KA8 A;  4OMZ A;  3IC7 A;  3I54 A;  5ERI A;  2HYG D;  1QQI A;  3DKW A;  1IN4 A;  4P5O A;  1EH6 A;  1YG2 A;  4UVB A;  2X0L A;  5D4R A;  4PZJ A;  1ZLJ A;  3PFI A;  3FMQ A;  3SZT A;  3ABT A;  4BNC A;  4EJO A;  2Q0O A;  1FC3 A;  5DCF A;  3FX3 A;  3V7S A;  4NB5 A;  5E1X A;  4XLP F;  3IKT A;  1G6N A;  4PGG A;  4KIF A;  1GVJ A;  5IT3 A;  2RN7 A;  3LQR A;  2PBI A;  1YW9 A;  4AIJ A;  2ACJ A;  3ZMT A;  5D5V B;  2FU4 A;  2CFX A;  1BIA A;  4A0Z A;  2PEX A;  1U3E M;  3W6J B;  2BEO A;  3GF2 A;  3R61 A;  2ZFW A;  3ML6 A;  3QP5 A;  5FLX Z;  1Y0U A;  4K2E A;  2W24 A;  5LEJ A;  3E6C C;  2O03 A;  4A0Y A;  1KU2 A;  4MQ9 F;  2MH9 A;  1F1Z A;  4PDK A;  3U9G A;  1OYI A;  1IN5 A;  4A2U A;  1V4R A;  4RGR A;  2Z3Y A;  2L4A A;  4E70 A;  1GXQ A;  4IJA A;  3F6V A;  4UVA A;  1PUE E;  1LEB A;  3BJA A;  2CWE A;  4WX9 A;  1O3S A;  3RTR A;  3CO6 C;  4M6X A;  5CLS A;  3K2Z A;  1YW8 A;  2W84 A;  4MQV A;  1B59 A;  3KFW X;  4M9S A;  2BV6 A;  3IL2 A;  4UXN A;  2DPD A;  4YFK F;  3OOP A;  4HW0 A;  3DF8 A;  3GVA A;  3I53 A;  4ZZD A;  3TDU C;  2ZO4 A;  5JFR A;  1G3T A;  4XLN F;  2WTE A;  1ZHF A;  1ZH5 A;  1R22 A;  1QNT A;  2HQR A;  4RB0 A;  2ZME B;  3WGI A;  1STZ A;  4XRF A;  4ENM A;  3V7C A;  3LWF A;  1B4A A;  2JT1 A;  2MH2 A;  2PQ8 A;  1BI3 A;  1IF1 A;  2K02 A;  3IWF A;  3DPL C;  3ZN0 A;  4WXH A;  3WTW C;  3TOA A;  2EV0 A;  1J75 A;  1O57 A;  3CUQ A;  1LQ1 A;  5K5Q A;  1WSU A;  2COM A;  4CXF A;  1S7O A;  1KU7 A;  1KQ9 A;  1XDU A;  1YQA A;  4HQE A;  3HIF A;  5L3B A;  2E1C A;  1XCB A;  3D0S A;  3GXO A;  4GGG A;  1IN7 A;  3KCC A;  3TO9 A;  3M8F A;  5D4S A;  2ISZ A;  4A12 A;  2MD5 A;  1SFX A;  1L0O C;  3WTT C;  4JBA A;  3CJN A;  1HXD A;  2KIF A;  3KLO A;  5DD8 A;  2XIG A;  3LA3 A;  3H3Z A;  3VEP A;  1P4X A;  1U5T C;  1S29 A;  3VOD A;  2K7L A;  4LK0 F;  3N4M A;  5FO5 A;  2W57 A;  4L0Z B;  5LLQ A;  4HF0 A;  5H20 A;  3BPX A;  1FYM A;  2VBW A;  4LMY A;  3RI4 A;  1BC7 C;  3O3K A;  4LB5 A;  2KIU A;  2A69 F;  1Z1D A;  4G7H F;  3ROU A;  3ELK A;  2KKO A;  1E17 A;  4OIN F;  1T39 A;  3K69 A;  1TW3 A;  1T2K A;  3WTX C;  3R0A A;  3I4P A;  2EFP A;  2IRF G;  5E1W A;  2RC4 A;  1T6S A;  3FM3 A;  4I0A A;  4ESF A;  2F2E A;  3J80 Z;  1EH7 A;  2K27 A;  2EWN A;  2VOD A;  2EJR A;  3JSP A;  1RUO A;  4N9I A;  3BJ6 A;  3LQQ A;  1IRF A;  4RGX A;  3CUQ C;  2OZ6 A;  2G7H A;  5HDN A;  2QQ9 A;  2KJB A;  4KA4 A;  2BE5 F;  3PQK A;  4MNU A;  2VN2 A;  3I59 B;  1FY7 A;  2RDP A;  2ADU A;  5HVQ C;  1W7P B;  4ZZL A;  2GZW A;  2K86 A;  2E7W A;  2QYO A;  3REO A;  4BH9 A;  4YFX F;  1KQ0 A;  4S05 A;  5ED4 A;  1KYZ A;  2F5D A;  2XVC A;  2YSR A;  4I2O A;  1LEA A;  1Z9C A;  1YLF A;  4ZYD A;  4GYI A;  1DDN A;  5KK1 A;  2ELH A;  1LDK B;  3BRO A;  3G73 A;  1BC8 C;  2DK5 A;  1I5Z A;  1ZG1 A;  1B1B A;  3FMS A;  1OPC A;  4IHS A;  4KIC A;  4Q47 A;  1ZRF A;  2GAU A;  3ZMU A;  4KFC A;  3KZZ A;  2DO7 A;  1D3Y A;  3E6D A;  3E6M A;  1J9I A;  1U6G A;  3E3V A;  1XGN A;  2FMY A;  4I7H A;  2E1N A;  4U88 A;  1JE8 A;  2MBF A;  4M9X A;  4LLL A;  3EUH A;  2P5L C;  5ICG A;  1SD7 A;  1RUN A;  1DUX C;  4LJZ F;  5E20 A;  1I1S A;  4FT8 A;  1V3F A;  2F5F A;  4L18 B;  5FFX A;  4L9V A;  4Q5S F;  2VBZ A;  5E18 F;  2L54 A;  1O7F A;  3F21 A;  3C1D A;  2MC3 A;  2GIV A;  4CHU A;  2KIM A;  1U8R A;  2VC0 A;  4L9T A;  3CO7 C;  2EFO A;  3V8K A;  5HLG A;  5BQT A;  5LGT A;  1YIO A;  2OBP A;  2ESH A;  2P6S A;  5DYM A;  1FWZ A;  1XGO A;  1YS6 A;  4EJW A;  3CLO A;  5ILU A;  3DEU A;  2MLG A;  2VOP A;  3MFK A;  5DUK A;  1LDJ A;  2ISY A;  4LLG F;  3E5X A;  4R79 A;  2VXZ A;  3JW4 A;  3HOS A;  1MJB A;  3B73 A;  1SD5 A;  4KUM A;  4BAY A;  5E8G A;  3JSO A;  3QU6 A;  2VOO A;  2CSO A;  1PP7 U;  3FXQ A;  3WTV C;  1E2X A;  1ZRD A;  5E17 F;  2NRA C;  4RB2 C;  3ZP5 A;  3HSF A;  2UXN A;  1CGP A;  2PMH A;  2XAF A;  2Z33 A;  2STT A;  5CVJ A;  2QZ8 A;  4RS8 A;  2HEO A;  1S6L A;  1BOA A;  1C0W A;  1ZAO A;  2W85 A;  2STW A;  3QP6 A;  5LBQ A;  2VBX A;  1G3W A;  1IN8 A;  4P9F A;  1XSV A;  2ZNZ A;  1S7A A;  4ENJ A;  3MEX A;  2IT0 A;  4WXC A;  1S3J A;  4A6D A;  3I64 A;  2FOK A;  2FBK A;  4WWC A;  5D6F A;  4BYY A;  3NEU A;  2HYF A;  5KVR A;  1YW7 A;  2KRF A;  3DV8 A;  1PDN C;  1CF7 A;  5J8C A;  2DTR A;  3KEQ A;  2LKP A;  3KE2 A;  2CYY A;  3NQO A;  2R7D A;  3HSE A;  4MGR A;  1IN6 A;  2FBH A;  4GXO A;  4UV9 A;  4UUV A;  3F8B A;  2PMU A;  2A5Y B;  4Q48 A;  2P5V A;  4KT5 C;  2JTV A;  2FNP A;  3SHF A;  2FF4 A;  4DNC A;  1I27 A;  3QU3 A;  1FYK A;  4ASN A;  4EVI A;  5CVU A;  3MZY A;  4RB3 C;  3I58 A;  4U0V A;  2RKH A;  2P7V B;  3K9T A;  1MD0 A;  1Z7U A;  2V1D A;  3KP5 A;  5L3D A;  3CUQ B;  3R60 A;  4LD5 A;  1SD6 A;  2DLL A;  4I02 A;  3J80 K;  4MHG A;  4HF2 A;  2W25 A;  3IRR A;  1S8N A;  3P9C A;  5CYV A;  3WTU C;  2J5O A;  2OA4 A;  2HKO A;  3Q9S A;  3M9A A;  1F9N A;  1L3L A;  1O3R A;  1IXR C;  3I71 A;  1OYW A;  4MTD A;  2IA1 A;  2O61 A;  2F5E A;  4UVC A;  2L3D A;  2XHK A;  3MQ0 A;  4IPA A;  1W4M A;  3L7W A;  2O3F A;  1P6R A;  3TDZ C;  1Z91 A;  3U1D A;  5F64 A;  1WWX A;  2P4W A;  1FSH A;  1G3S A;  4LG0 B;  3CTA A;  4KIG A;  4HX7 A;  4CZZ A;  3ERE D;  1SFU A;  3V8J A;  2NNY A;  1AWC A;  2A3S A;  4EJV A;  4M74 A;  1R1V A;  2DFI A;  1FP1 D;  2R3S A;  3M1E A;  3WE2 A;  1W7P A;  2BYV E;  2CQK A;  1SMT A;  4ESB A;  4AWX B;  3HSR A;  4A6E A;  4O5V A;  5LRR A;  4JK1 X;  2M8E A;  1TQI A;  2GA2 A;  3BOQ A;  1XGM A;  1FOK A;  3QAH A;  1FYL A;  3TO6 A;  2XV4 S;  2IA2 A;  2P8T A;  4HF1 A;  4BXU A;  3U2R A;  1HBX G;  3E5Q A;  1TNS A;  4O6J A;  2D45 A;  3L00 A;  3PQJ A;  5HDK A;  3QRF F;  1IRG A;  2QLZ A;  3EDP A;  3H3U A;  1HKS A;  4GYG A;  3JTH A;  4HLY A;  2FSW A;  1YYV A;  4KDP A;  1ZG5 A;  3ABU A;  4U0W A;  1QZZ A;  3F72 A;  4KN7 X;  2PG4 A;  3ZMV A;  1O3Q A;  3L9F A;  4HV5 A;  1FZP B;  5LGN A;  2FA5 A;  3KET A;  4IF4 A;  1YTY A;  4Z2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...